1W7PA

The crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
213
Chain Sequence
VNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escrt-II, an Endosome-Associated Complex Required for Protein Sorting: Crystal Structure and Interactions with Escrt-III and Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords VPS22, YPL002C
total genus 60
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04157 EAP30 EAP30/Vps36 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pA03
2D1VA 3VB2A 4G6DA 5D5UB 1DPUA 2LF7A 4UVCA 1UHWA 2MH9A 2EWNA 2OD5A 5D6EA 3S2WA 1B4AA 2FBIA 1V4RA 3SHFA 3I53A 4YFKF 3MWMA 1G4DA 5HS8A 2L4AA 3C3WA 3JTGA 3V7RA 1S7OA 1QQIA 3HIFA 1C0WA 2EFOA 1U5TA 2KKOA 4EVIA 1KA8A 4L9TA 1GXQA 1HW1A 4I0BA 3KP4A 1XN7A 4OIOF 1FBUA 3K1PA 1O7LA 5K5QA 2EFPA 1HSJA 4CICA 3AAFA 2GA1A 2KIUA 1WI9A 3HRSA 5DV5A 2Y75A 1K79A 3JTHA 3NRVA 3J81Z 2RGVA 4IHSA 3EDPA 4KUMA 1I5ZA 5L3GA 3L9FA 2IA0A 3FF5A 3F22A 1BBYA 4M6YA 3K0LA 2K7LA 2V6CA 1MGTA 4KDPA 1LDDA 4L9NA 2V1UA 4BH9A 4G7ZF 2DQLA 1XGSA 2QWWA 1DP7P 1TQMA 4EGYA 4GXOA 1WWXA 2F5EA 1OKRA 1R1VA 3BJOA 4ZYEA 1FWZA 5FD5A 3EYYA 3F8FA 2VBWA 4PZJA 5L3EA 1Z05A 3B73A 5E1XA 3WTVC 5HLHA 4ZZLA 4WXCA 4OOIA 1QGPA 2PBIA 2EJRA 1FSHA 5CVRA 1EV7A 3QPHA 4MTDA 1FC3A 2F2EA 1KQ8A 1FOKA 1XGOA 4ASNA 4HLYA 2RVCA 3WTSC 2MA3A 1ZG1A 2BYVE 2G7UA 1H9GA 4I02A 1QZZA 1HW2A 5D5VB 3DV8A 3WE3A 3WTUC 1XGMA 3ZMSA 1YLFA 2BV6A 4KA4A 1S3JA 4KT5C 4UVBA 3TO6A 2H27A 2CG4A 4G8XA 5FLXK 3DP7A 1XCVA 1XD7A 4Q47A 1P4WA 1FP2A 3KEOA 2E7XA 4EV0A 4YIIA 3ML6A 1I27A 1HBXG 4A0ZA 4M72A 4L9VA 2DBBA 2VBXA 1DUXC 1WQ2A 4AIHA 1T39A 1G3TA 1USSA 2P5KA 1HQCA 1ZARA 2V1DA 2J5PA 2IT0A 3OOPA 4WK8F 3ZMTA 5ICCA 2QZ8A 2DPUA 2L02A 3LFKA 1YW7A 1U2WA 4EQQA 5F64A 5CYVA 1D5VA 4GYIA 2DAOA 3KP7A 3QU6A 1Y0UA 4HX7A 3I58A 3M9AA 3RYPA 2DTRA 1I1GA 4KFCA 2OU2A 3HSRA 4N9HA 2D1HA 5E1WA 2RKHA 2XKOA 2YX7A 1KU7A 2WTEA 2KJCA 3BJ6A 3BOQA 3VEPA 1B6AA 4KIFA 2OA4A 1PP7U 5KVRA 3K69A 2VC1A 3WU0A 1ZLJA 1HKSA 4Y13A 1IXRC 3T0YA 2XASA 4ZH4F 4BQAA 2PFBA 3FM5A 3E5XA 2LNBA 5LHGA 2HYFA 2HQRA 2VN2A 4LB6B 2XVCA 5DDGA 3J7AO 4LLLA 3KETA 4KYWA 2YU3A 4P55A 1QPMA 1SFXA 5D5XB 4A6EA 5E1ZB 1ZRDA 3WGGA 4AVPA 5AONA 4TV7A 1O3RA 2BEOA 1MJAA 3JSOA 4EMSA 4EJOA 1IXCA 3ERED 3TQNA 3QPTA 3HRTA 3JW4A 3KZZA 2JSCA 3IWFA 3EETA 1GXPA 1SD4A 1Z1DA 3ISPA 3KP3A 3ZN0A 3LA3A 4I2OA 3MCZA 1BI1A 4UHTA 3IRQA 3HTSB 2VE9A 2QENA 5ED4A 4MQVA 2P5VA 2P7VB 2R3SA 3L09A 4U7DA 1RUOA 4FX4A 3HTUA 1HKQA 4A5MA 3HHHA 1RZ4A 1B9MA 1I1SA 3FXQA 3F8BA 1QZYA 3PQJA 2GZWA 4E70A 5HS9A 4IF4A 2MBFA 4XBFA 2O61A 5TJJA 3R0AA 4P96A 1J0RA 3K9TA 1CF7B 5J6XA 3GYHX 1Z6RA 1LJ9A 1O57A 2H6CA 3CDHA 2Z9OA 2HKXA 3DQVC 4O6JA 2DK8A 3I0TA 1O3TA 3FHZA 3N4MA 2XHKA 2EA4A 1YFHA 3SZTA 2Y0MA 4U0VA 4NQWA 4ETSA 3B02A 4EM0B 4Y15A 1FLIA 1F5TA 4L0ZB 1HXDA 2IRFG 2OQGA 2PQ8A 5F1RA 3E97A 2XAQA 2GXBA 2F5FA 3R0JA 2NRAC 2K4BA 2UWMA 1G3SA 1ZN2A 3PQKA 1BIAA 4CO8A 2STWA 3U2RA 3KEQA 2CGPA 4IVNA 2ISYA 1XMKA 1R1TA 1MDMB 5LHIA 1UFMA 3ECOA 4MGRA 4A0XA 1TBXA 5LLQA 1NHAA 2KIFA 3GX4X 1U5TC 2GXGA 1YS6A 3SXYA 2ZKZA 2P6SA 2ZJ2A 5L3CA 4HDVA 3F8CA 5D5WB 1S7AA 2DLLA 4S05A 2OBPA 4U88A 1Z91A 1R22A 1K78A 2ELHA 1O3SA 4O3MA 4LLGF 5DUKA 3DF8A 2MC3A 4RB1A 2ZMEB 2HR3A 1T2KA 4KN4X 2LSOA 2P5LC 1RI7A 4P9FA 3F72A 2CO5A 2K02A 3HRUA 5ICFA 4I0AA 3RTRA 5ILUA 1HW5A 1UHMA 2V9VA 5LRRA 3WGHA 2HTJA 4LB5A 4L18B 2CYYA 3VOEA 2GWRA 5IT9K 3U9GA 3COAC 4RGSA 2A07F 1P6RA 3E6MA 1HSTA 1J59A 4PCQA 1BN5A 4ESJA 4MQ9F 4P9UA 1UCRA 1R00A 1MDMA 2L4MA 3TO9A 2QM3A 2PJPA 3F3XA 1IRFA 2O6GE 1LQ1A 1CF7A 5L3BA 3F6OA 3T5XA 4WCGA 1B9NA 1XDSA 1BI2A 2GQQA 2V1XA 3CUQB 4JK1X 2PLYA 1OMIA 3F6VA 1ZREA 5JHUA 1UB9A 1KQ9A 1FY7A 3BPXA 4L9JA 1P4AA 4OIPF 3IKVA 2Z99A 2P8TA 2G9WA 4P5OA 4PDKA 4IRHA 5DUIA 4UUVA 3F21A 4HAMA 2E7WA 1IUYA 1JHFA 1W7PB 2ADUA 4HLXA 5ILVA 2EFQA 3C18A 4RB2C 1T0FA 1IAWA 3FMQA 5DEQA 4KIGA 5JR3A 2EA2A 2R7DA 3DXJF 1DDNA 3QU3A 2RQPA 4CXFA 5BOXA 1MKMA 5CLSA 5E8IA 1IN5A 4L5IA 1Q1HA 4IPAA 1G6NA 1U3EM 2LDUA 4BHBA 2M87A 4GGGA 1FYKA 1BC8C 5E20A 5LRSA 1TW3A 1F4KA 3TKYA 3M7GA 2J5OA 2EB7A 3I5UA 1SD5A 1XDUA 2AS5F 4HQMA 1BC7C 3TOAA 3T8RA 1W7PA 4G6QA 4BAYA 1BJAA 2O3FA 2FSWA 4R1HA 4U0YA 3O3KA 2MD5A 3J80K 2ZFWA 3GXOA 1B1BA 5FFZA 2ACJA 1Z6TA 2D45A 2UXXA 1OPCA 1QNTA 3ZN1A 2RC4A 2NAZA 3RIRA 4WF2A 3KFWX 3WTXC 3DPLC 5FLXZ 3V7CA 4RAZA 1D8KA 2L3DA 4I7HA 3HYIA 5DYMA 4RGRA 2VBYA 3GWZA 5J8FA 1LDJA 2IPQX 3BWGA 3E6DA 3V4GA 2KJBA 4ZZDA 3P9KA 4HW0A 2KRFA 1IXSB 2QVOA 4OU0A 1KU2A 2PG4A 4M74A 3VODA 2C6YA 3SQNA 3T1BA 2K86A 4RGUA 3ZMVA 2VT3A 3WE2A 3ABUA 1JE8A 1EH7A 1U78A 2A5YB 2FBHA 5BPIA 5L3DA 3F8MA 2WWYA 4I98B 1T38A 4BNCA 1T6SA 4S04A 1E17A 5LGNA 1ZLKA 1ZGAA 2GA2A 5JVTA 2XAFA 1LB2A 4HQEA 2OQRA 4HX8A 1PUEE 3JAMZ 3KCCA 2QUFA 2A68F 2HEOA 4OINF 4KIBA 4I09A 5LEKA 1IF1A 4M73A 3HOTA 4IJAA 3BDDA 2IVMA 1LDKB 3GF2A 2FQ3A 1HKTA 3I59A 4HF2A 1ZG3A 2HGCA 1SFEA 2YX4A 2QBYB 4RS8A 1FP1D 1ZGJA 1MJ9A 5EEHA 2ESHA 4H0EA 4UV9A 4RB3C 5FB2A 3F8NA 5CVIA 2A6EF 3RDIA 3LA7A 4GCVA 2O03A 2FEZA 4HV6A 3WTZA 2PN6A 2W84A 1WKMA 4LLNA 1YO5C 1R7JA 2D2WA 2Y48A 4EGZA 1L0OC 1K78B 5A2QK 3TDUC 4EM1A 2W85A 3FXRA 2HS5A 2W24A 3I54A 1KU3A 3I64A 4NB5A 1REPC 1GHCA 1XSDA 2OAZA 4JQFA 2CWEA 2XIGA 1S29A 4FX0A 2M30A 1XGNA 1ZRFA 1YW8A 3D5LA 2Z5UA 3NQOA 4ESFA 4ESBA 2RV8A 2FOKA 3M1EA 1O7FA 2A3SA 4UV8A 1ONVA 1R58A 4AD9A 3Q5FA 1J9IA 1S6LA 4Q48A 3IHUA 4Y17A 2YR2A 3IKTA 3K1NA 5BMZA 1R5HA 3T8TA 2Z3YA 2AXLA 3R4KA 3R60A 1FSEA 3IRRA 5DD8A 3RKYA 1WRJA 2IP2A 4O5VA 3GEZA 3GFMA 3BP8A 1IRGA 2RN7A 2X0LA 2ISZA 3HHGA 3CO7C 2EFWA 2JTVA 3V8LA 5H6QA 2NNYA 3ABTA 4A2UA 5D6FA 2KIMA 2QQAA 3J80Z 2FRHA 4GYGA 1A04A 3M8EA 1F9NA 2HDCA 3SFZA 3WTYC 3GVAA 2E1NA 1YG2A 3RPQA 2RDPA 5K5OA 4L0YB 4U0WA 1D8JA 2XGXA 1I6XA 3GZ6A 4YFXF 2M1BA 3CUQA 3C7JA 3ECHA 2IW5A 3V7SA 3RKWA 3TDZC 4UNOA 3KZYA 2A6HF 1R1UA 1H0MA 3GLXA 2GIVA 2FMYA 2XAGA 5DCMA 4G7OF 2HKOA 1OYWA 4CYDA 3JAMK 2BGCA 1FNNA 4YFNF 1H9TA 3MQ0A 2ZXJA 4LGWA 2NS0A 3HSEA 4CZZA 2FU4A 4U7BA 2F5DA 2FNPA 4WXHA 4D0PA 2VOPA 4ENMA 2CQKA 2A61A 2DQRA 2EV5A 2R7FA 3ELKA 2XKPA 4LMYA 2L54A 5CVVA 3RJPA 3L7WA 2PEXA 3E5UA 1U6GA 5D4SA 2O0YA 5LGTA 3M8FA 4WXDA 4AWXB 3KP6A 4RGXA 2JRTA 2L01A 1STZA 4XRFA 1BIBA 5IT3A 1TLHB 1MZBA 4M9XA 2HZTA 2HTSA 4KMFA 2H6BA 1FT9A 3QAHA 6PAXA 2STTA 4DQ2A 3IL2A 2NYXA 4AIKA 4M9SA 2LKPA 4Q4ZF 3HUGA 1XMAA 5ERIA 2H94A 3U1DA 4MNUA 5CVJA 3QOPA 2EFNA 4ON0A 3J81K 4ENNA 4OIQF 3OV8A 4CDGA 1MJBA 5J8CA 3LQRA 4B8XA 2MH2A 1KGSA 1IN7A 3D0SA 2FNAA 1TNSA 1USTA 1IW7F 4HV5A 2HWVA 1DPRA 1X3UA 5D8LB 1FX7A 3R61A 4PGGA 1K7AA 5HDNA 2M5WA 1QO0D 1XSXA 2CW0F 4RB0A 1VTNC 4XLNF 3WODF 4ZYGA 1IN8A 2FBKA 4AIJA 5KK1A 2CSOA 4EJUA 3V8JA 2JPBA 3I59B 1SAXA 3REOA 1RUNA 3FX3A 1P92A 2HOEA 1FPQA 5DD4A 2BBYA 4UXNA 2K27A 3HOSA 4F7ZA 2UXNA 5HVQC 3BROA 3E3VA 5K1YA 4G9YA 4LD5A 5E17F 4BXUA 3ZP5A 1PDNC 4KN7X 2IJLA 1JXSA 2DU9A 1KYWA 1LEAA 5IT9Z 3E5QA 1IN4A 1AOYA 1ODDA 1JHHA 4LJZF 2RNJA 1XCBA 2P6TA 1KYZA 3RKXA 4IHTA 5JI6A 3LAPA 1ZAOA 5AIPA 2XAJA 3BJAA 2DO7A 5HOOA 4MTEA 3P9CA 2V79A 1XSVA 3P9IA 4WWCA 1FBQA 1YS7A 3CO6C 3E6BA 3JSPA 2DT5A 4HA8A 3DFGA 4HYEA 2FMLA 3FXUA 3IWZA 4UVAA 5HS7A 1ULYA 4IRGA 1WSUA 3KP2A 5D8KB 4IXAA 2VONA 1TQPA 2MLKA 2P4WA 4OMZA 3WU1B 4N0BA 2WC2A 1ZH5A 2P7CB 4RAYA 3GFIA 3ZMDA 2K4JA 3GO5A 3ZMUA 1J7KA 2COMA 1TNTA 2ZBKA 2YSRA 2EV6A 4EJTA 1OYYA 4G94A 1S8NA 3PFIA 4EJWA 3RYRA 3GW2A 4EM2A 4KMUX 4XSZF 4OMYA 4GO1A 3BZ6A 1Z7UA 1QBJA 3K1MA 3EUHA 1J75A 4ENKA 3E6CC 5H20A 1RNLA 5BPDA 5LBQA 5TRDA 5E8GA 1W5TA 5HLIA 2M45A 3GFJA 2WV0A 3DPTA 3H3UA 3LAJA 2QQBA 5HDGA 3GZ5A 1KQ0A 1ZHFA 1Z9CA 4M9ZA 3TOBA 4HZFA 3KP5A 3F23A 1W7PD 3FMSA 1FBSA 3NEUA 2HQNA 3FM3A 2XROA 4K2EA 2GAUA 2YPRA 2E1CA 2W57A 1KU9A 4A0YA 4XSXF 4WX9A 2XUBA 3R6SA 3Q9VA 4YG2F 1SMYF 3LSTA 2DFIA 3KLNA 2ETHA 1FZPB 1V3FA 1MD0A 1TTYA 2XAHA 5L3FA 3BPVA 1AWCA 2DK5A 4MHGA 3RPUA 4R79A 3MZHA 3WTWC 2A69F 2FXAA 3FMRA 2FA5A 1IN6A 4NHJA 2Q0OA 1BI3A 4HX4A 3KLOA 2OZUA 3QRFF 1OYIA 3CTAA 2LF8A 3WG9A 4ENJA 4CHUA 1JGSA 4ZYHA 1SD6A 2VXZA 2QQ9A 5BQTA 2ZNYA 4N9IA 2FE3A 3FZVA 5DCFA 4MEYF 4BHPA 2JPCA 2DI3A 3KE2A 3LA2A 2F5CA 1YQAA 3EYIA 1B59A 1R5GA 2NNNA 1U8RA 4CGZA 5JFRA 2UZKA 4Z2YA 5ICGA 2MLGA 2OZ6A 3GUDA 3O6BB 1SMTA 4XLPF 3L00A 1G3WA 2VOOA 5DCMB 4LK1F 3O2PE 4ZYDA 3MZYA 2XRNA 3L2CA 1K6OA 3V8KA 3W6JB 2XV4S 5HLGA 3EQLF 4LK0F 5H6RA 3N97A 2ZMEA 2QLZA 1J5YA 3CUQC 4YIFA 1BM9A 4OIRF 3MAJA 2W25A 3MFKA 3ROUA 5AIQA 5CVUA 5FO5A 3W6KB 2FF4A 3ULQB 3GFLA 3ZQ7A 1R23A 3LQQA 1E2XA 1J2XA 2Q8KA 5HDKA 4JBAA 2IA2A 4FT8A 2QBYA 3TO7A 3CJNA 3FWEA 3IC7A 2Q2EA 1U5TB 4HOBA 1EH8A 1ON1A 5ILSA 5LGUA 3SZPA 1SD7A 1GVJA 4PGHA 4I01A 3WGIA 2CFXA 4R8HA 3H92A 2JZYA 1ON2A 1T98A 1LNWA 1P4XA 2PI0A 3I71A 2TDXA 5CJ9A 3LWFA 3HRMA 5FD6A 1YW9A 1R36A 2HYGD 3DEUA 5F6FA 1W5SA 4MEXF 1FYMA 3WTTC 4HF1A 5BS6A 5LEJA 3VFZA 2JT1A 2M8EA 3HSFA 2VODA 5FFXA 1EH6A 4Q5SF 4QWQA 3G3ZA 4A12A 5EEGA 4DNCA 2ESNA 1F1ZA 2BE5F 2G7HA 2ZCWA 4FHTA 1ZG5A 3CLOA 2O8XA 2PMUA 4BHCA 3MEXA 5ICEA 4M71A 2ZNZA 4LFUA 2QYOA 3K2ZA 1YYVA 2B0LA 2EV0A 3I4PA 1TQIA 4LG0B 3H3ZA 1OR7A 1LEBA 5E18F 5D4RA 4HDUA 4M6XA 1D3YA 1XB4A 3G73A 1L3LA 4BYYA 1IZ1A 2ZO4A 5K5RA 2X4HA 4A6DA 3C1DA 4B09A 5LHHA 1CGPA 4KNYA 1TW2A 1ZRCA 1O3QA 2VE8A 1RIOH 2IA1A 2H09A 3ZMZA 4HBLA 1P2FA 3BY6A 4HF0A 2EK5A 1BOAA 2DW4A 1W4MA 3QP6A 4LG0A 3DKWA 1YIOA 3RI4A 2PMHA 4A5NA 5FGMA 2VC0A 3Q9SA 1PP8F 4KICA 1YTYA 4QLCU 2VBZA 2VT2A 1ZYRF 2DPDA 3P7NA 1BI0A 3QP5A 3TGNA 1FYLA 4G7HF 4L5JA 4EJVA 3ZPLA 2Z33A 1G3YA 1SFUA 4IRIA 1LVAA 3CUOA 2HFHA 5A2QZ
chains in the Genus database with same CATH superfamily
4JOMA 2D1VA 5IPAA 3VB2A 1OFCX 3RPUD 3K70D 2F48A 4G6DA 5D5UB 3J7YJ 2OTJI 1DPUA 2LF7A 3DKYA 3DU5A 4UB6C 4UVCA 1UHWA 2MH9A 2EWNA 2OD5A 5D6EA 4XL9A 5KCMA 3S2WA 1B4AA 2FBIA 1V4RA 2D5VA 3SHFA 3I53A 4YFKF 3MWMA 1G4DA 3CDIA 2L4AA 3C3WA 2ID6A 1GLNA 3HJEA 5HS8A 3JTGA 2IS6A 2XGEA 3V7RA 1S7OA 1QQIA 3PNYA 3HIFA 4PK4A 3BR0A 1JT6A 1C0WA 2EFOA 1U5TA 2KKOA 3K4BA 1UG0A 3PO2J 4EVIA 5BNGA 1KA8A 3I9V2 4L9TA 2BW3B 1XPXA 3TP0A 1GXQA 3HOUJ 1HW1A 3GTKJ 5EZGA 4I0BA 3KP4A 4MIMA 4BQOA 1XN7A 4OIOF 1FBUA 4IHVA 2DMPA 1O7LA 3K1PA 5K5QA 3H9GA 2O8KA 2EFPA 1HSJA 4CICA 3RCOA 3AAFA 2KRCA 2JA2A 5B5EC 2GA1A 2HQAA 2KIUA 4MLOA 1V54H 4GFBA 5K7FA 1WI9A 3FDYA 3HRSA 5DV5A 2QKMB 1X1DA 2IBDA 2Y75A 1ZR2A 2HVRA 1K79A 3JTHA 2VIXA 3NRVA 3Q0UA 1VQMI 5B3SH 3J81Z 3CCJI 2RGVA 4HNUA 5F04A 3OYJA 4IHSA 3EDPA 4KUMA 2LKXA 1I5ZA 5L3GA 5CQEA 3L9FA 1QHGA 2IA0A 2KIQA 2ZXHA 4N4OB 2X85A 3FF5A 3F22A 3WG7H 3PIOF 1BBYA 4M6YA 3K0LA 1PUFA 2K7LA 1IC8A 2V6CA 1MGTA 4XOTA 4KDPA 1LDDA 4L9NA 3BR2A 2V1UA 2AO9A 4BH9A 4G7ZF 4I76A 1VFCA 4CA0A 2DQLA 4XORA 1XGSA 5J4VA 5EG0B 2QWWA 1DP7P 1TQMA 3PUBA 4HSTA 2ZJRF 1V55H 2QKLB 4EGYA 4GXOA 1WWXA 2F5EA 1BR1A 1OKRA 3O8HA 3H35A 2K9NA 1R1VA 3BJOA 4ZYEA 5KAFC 1NK3P 1A35A 1FWZA 2JQ7A 5FD5A 4IQ4A 3EYYA 4FCYA 3F8FA 4M3GA 2VBWA 4PZJA 3JRHA 1QA6A 2R7TA 3KYCB 5L3EA 5EF6A 2LLKA 4S0HB 1Z05A 5E3OA 3IV5A 4AU7A 3B73A 2CW7A 5E1XA 3WTVC 2L7MP 4UB8C 3CMMA 1ITYA 3DU6A 5HLHA 4ZZLA 4WXCA 2YUSA 4OOIA 1QGPA 2XSDC 2HOSA 1JTXA 2PBIA 3H3VK 5IYCJ 4IKFA 2TCTA 2EJRA 1FSHA 2KDZA 1UMQA 5CVRA 2VPLA 1EV7A 5GP9A 4HRIA 3QPHA 4MTDA 1FC3A 3ZOBA 4D7MA 1YX5A 2F2EA 1KQ8A 1FOKA 1XGOA 4ASNA 2M4GA 4AYBA 2RVCA 4HLYA 1MSEC 3M4OJ 4I6ZA 1GT0C 3WTSC 1N25A 1ACIA 2MA3A 1ZG1A 2BYVE 5F27A 3L1PA 2G7UA 1Z77A 2R7RA 3H9QA 1H9GA 4I02A 1QZZA 1RPWA 2CMPA 4PFOA 4XKBA 3ONQA 4Y7NJ 1HW2A 4BBRJ 5D5VB 3DV8A 3WE3A 4IEJA 2F4MB 3ZQHA 3WTUC 1XGMA 3TBIA 3ZMSA 1H88C 1YLFA 2BV6A 3VYSB 2DJNA 4KA4A 1S3JA 4E7IA 4KT5C 1G59A 4UVBA 3TO6A 4X1EA 2VJIA 2H27A 3ZR8X 2CG4A 4G8XA 5FLXK 3DP7A 1XCVA 1XD7A 4Q47A 3HPGA 1P4WA 1FP2A 3KEOA 2L9RA 2E7XA 4EV0A 1TC3C 4YIIA 1ETQA 3ML6A 3L2UA 1I27A 1QVUA 3QWLA 1HBXG 4A0ZA 4M72A 5F08A 4L9VA 2DBBA 4PJLA 5B66C 2VBXA 2M0CA 1WI3A 1DUXC 2XF5A 1WQ2A 4AIHA 1IRXA 1T39A 4ABZA 2WADA 1G3TA 1USSA 2P5KA 1HQCA 5FKOA 1ZARA 2V1DA 2J5PA 1UG2A 2IT0A 1B8IA 1R71A 2L9VA 3LSPA 3OOPA 4WK8F 3ZMTA 5ICCA 5IY5H 2QZ8A 2IGOA 3JRFA 2R7OA 1MMNA 2DPUA 2VPRA 2VLAA 2L02A 3F9KA 3LFKA 1YW7A 1U2WA 4EQQA 3ASOH 3S17J 4XRMA 5F64A 5IYDJ 4BE2A 3BR3A 2K40A 5CYVA 3BTCA 4U87A 1D5VA 4XONA 3MMYB 2IS2A 4GYIA 2DAOA 3KP7A 3QU6A 2EIKH 4CZCA 2P81A 2CH0A 1Y0UA 1Y0NA 4HX7A 3I58A 3M9AA 3KZIC 3RYPA 2DTRA 5CPRB 1I1GA 1DQUA 3QPLA 3OR1C 2ZMEC 4KFCA 2OU2A 2O5RA 5HNHA 3HSRA 3I3LA 4N9HA 2D1HA 5E1WA 1WJAA 1E3OC 2V1NA 2RKHA 2XKOA 2YX7A 5DTDA 1KU7A 3QOEA 2WTEA 2I5UA 2KJCA 3BJ6A 3BOQA 5FKMA 3VEPA 5EGOB 5FLVA 4DJAA 2NS7A 3D5SC 1B6AA 5HODA 3HG9A 4BQQA 4KIFA 2OA4A 1PP7U 5KVRA 3K69A 3D5RC 2VC1A 3WU0A 1ZLJA 3BG9A 1HKSA 4Y13A 1IXRC 3T0YA 2XASA 4BEHA 4ZH4F 4BQAA 2PFBA 2LK2A 4RM3A 2CFOA 3FM5A 3E5XA 2LNBA 5JHFA 2JRMA 4J01A 4XRSG 1DGRM 2Y69H 1DU6A 5LHGA 1VQOI 2X1EA 2HYFA 2HQRA 2VN2A 4LB6B 2XVCA 5DDGA 4NNJA 3J7AO 3K4NA 1B72B 4LLLA 3KETA 2CV0A 4KYWA 2YU3A 4P55A 2DDBA 2RAEA 1RRJA 2LG4A 1QPMA 1FOYA 1FTTA 1SFXA 5D5XB 4A6EA 3CMAI 5E1ZB 1ZRDA 4AC0A 3WGGA 4AVPA 5AONA 1X3WB 2Y30A 5FJ8J 4CCMA 3JRCA 1OJLA 4TV7A 1O3RA 1ORKA 2BEOA 1MJAA 4F93B 4C3HJ 4IO9F 3JSOA 4EMSA 1EA3A 3K70C 1WJBA 3HKZN 4EJOA 1IXCA 3ERED 1MNEA 1W36C 3TQNA 2V9PA 3QPTA 2DODA 2WB1N 3CDLA 3HRTA 2PX9A 3JW4A 3KZZA 2JSCA 3IWFA 1HOMA 3EETA 1GXPA 1SD4A 1TP4A 4IOAF 2QEXI 1Z1DA 3ISPA 3KP3A 3ZN0A 1F43A 5M5WJ 2WAQN 1OCRH 3LA3A 1MSFC 2CJJA 3CF2A 1WPKA 4I2OA 2QA4I 3MCZA 1BI1A 4A3DJ 4UHTA 1U0JA 3IRQA 3P5JA 3HTSB 4Y4RA 4DIQA 3ESWB 1OCCH 2B7EA 2QENA 5ED4A 3RQIA 4MQVA 2VE9A 1VQ4I 2P5VA 3CMYA 4FQGA 2P7VB 4D5FA 4P1WA 2R3SA 3L09A 4U7DA 1RUOA 3OS1A 3F0CA 4FX4A 3HTUA 1HKQA 4UUTA 4A5MA 4NDLA 3HHHA 1RZ4A 5GPAA 1B9MA 1I1SA 3FXQA 3F8BA 1QZYA 2W48A 3ZQLA 2L5QA 2E35A 3PQJA 2GZWA 2XB0X 2VKHA 1HLVA 4E70A 1RKTA 4IF4A 5HS9A 1SVMA 2MBFA 4XBFA 2O61A 5TJJA 4GDFA 3BQYA 3OSFA 2ME0A 1CQTA 3PL8A 1OCPA 1D5YA 2M4KA 4B47A 3R0AA 4P96A 1J0RA 1IGNA 2WV1A 4A3BJ 3K9TA 1Y1WJ 1CF7B 5J6XA 1TT5B 3GYHX 1IRZA 4A3CJ 1Z6RA 4OWRB 5J1RA 1LJ9A 4PJJA 1O57A 2H6CA 2EZHA 3CDHA 2DA5A 4IHWA 4XOPA 2LC2A 3A0BC 2HKXA 2Z9OA 3FKIJ 2ME6A 4W97A 3EPZA 3DQVC 1RESA 2ID3A 4O6JA 2DK8A 3S32A 3I0TA 3W2WA 1XTAA 3FHZA 3N4MA 1O3TA 2LRDA 2XHKA 3CCSI 1NH3A 1ZGWA 2JN6A 2UUZA 1T33A 5GAGJ 2EA4A 1YFHA 4UUSA 1OR7C 3SZTA 2W00A 3QYFA 2Y0MA 2EZIA 4U0VA 4B43A 4NQWA 4ETSA 5J3LA 4Y33A 3B02A 4EM0B 3CC2I 4Y15A 4Y52J 1FLIA 1F5TA 3AL0B 2BXZA 2ZSHB 3OYNA 2NVXJ 4L0ZB 5M5YJ 1HXDA 2IRFG 2OQGA 1MBHA 2EQRA 5EDNA 2PMZN 1MBKA 1SVOA 3K4JA 2VUMJ 2PQ8A 2L2OA 5F1RA 3E97A 2XAQA 2GXBA 2F5FA 1A6IA 2R7XA 2XDVA 3HXLA 2OV7A 2OC6A 3L2WA 2K9QA 3R0JA 2NRAC 2K4BA 2UWMA 1G3SA 1ZN2A 2LFBA 3PQKA 1WZ2A 1BIAA 4CO8A 1JKPC 2Z2SB 2STWA 3U2RA 2V6EA 2V9KA 2DTZA 3CCVI 2JA6J 2MSYA 4N4NB 1FJLA 3KEQA 2CGPA 2BXYA 3E1SA 2ECBA 4IVNA 2ISYA 1XMKA 1R1TA 1MDMB 2H1LA 2NOJB 5LHIA 1UFMA 1I6HJ 3ECOA 4MGRA 4A0XA 4M3DA 3CJQB 2VJ4A 1TBXA 2CS3A 5H2FC 1VF9A 1HDDC 2OUMA 5LLQA 1NHAA 2KIFA 3GX4X 1U5TC 2GXGA 5FKLA 1YS6A 3SXYA 3J7ZI 2ZKZA 1YI2I 2P6SA 1ETXA 3A4CA 2ZJ2A 1JUSA 2OTLI 5L3CA 2CQXA 1LPQA 5J40A 4DZJA 3A2KA 4HDVA 4DYRA 3F8CA 3QYEA 5D5WB 1S7AA 2Y9ZA 2DLLA 3FXMA 2OBPA 4S05A 4U88A 2GOXB 3G71I 1Z91A 1R22A 2VQHA 2ELHA 1O3SA 1K78A 4A3JJ 3OWTA 3H5RA 2XGDA 1FMVA 4FASD 2BY2A 3ERMA 4HNVA 4O3MA 1MMAA 3HOWJ 4LLGF 4XN3A 2ECCA 5DUKA 3DF8A 1SVLA 2MC3A 4PJ0C 2WY7Q 2R7VA 2QF7A 3NARA 4OAYA 4RB1A 2ZMEB 2HR3A 2HZDA 1T2KA 1TWAJ 1JI8A 4KN4X 2LSOA 2OCCH 4XKCA 3BG7A 3QYBA 1GV2A 2P5LC 1RI7A 4P9FA 3F72A 2CO5A 2K02A 3HRUA 3LSKA 3Q3SA 5ICFA 4I0AA 3RTRA 3BZKA 5ILUA 1HW5A 2FUG2 3MKWB 1UHMA 2V9VA 5LRRA 3WGHA 2HTJA 4LB5A 1MMGA 4L18B 2CYYA 2E1MB 4E7ZA 3VOEA 2GWRA 3CZ6A 5IT9K 2W7NA 1A31A 3OYCA 3U9GA 3COAC 1WGXA 3FXJA 3HGGA 2I8DA 4RGSA 2A07F 1P6RA 3E6MA 1DGWY 1HSTA 4JP0A 1J59A 1P7JA 4PCQA 1BN5A 1TWCJ 4ESJA 3KIOA 1PJRA 4MQ9F 5M5XJ 4P9UA 1UCRA 1R00A 4PSXA 4F52A 1MDMA 2L4MA 1BL0A 3TO9A 1WVRA 3L2RA 2QM3A 2W82A 2E2IJ 2PJPA 4AUXA 2Y2ZA 3F3XA 3GTJJ 4ZTFA 3JRGA 2EILH 1IRFA 3OYAA 2O6GE 3LSJA 2KL4A 2LD5A 1UZCA 4NBQA 1S72I 2IGMA 4EATA 3IAS2 1LQ1A 1HC8A 1CF7A 3QODA 4KT6A 3Q0VA 5L3BA 3F6OA 3T5XA 3AG4H 4WCGA 1B9NA 2GM4A 1XDSA 1R5ID 5DM6F 1BI2A 2GQQA 2MG4A 2P0WA 2V1XA 4A3LJ 2M7BA 2R93J 3A01B 3CUQB 3DPUA 2IEKA 4JK1X 2PLYA 1OMIA 2HI3A 3F6VA 1ZREA 5JHUA 2QSHX 1UB9A 2AQFA 1KQ9A 5K7HA 1BR4A 1FY7A 3JRDA 3OSGA 3BPXA 1W0UA 3GTLJ 1IUFA 4L9JA 3WHBA 1P4AA 1W0TA 1X1BA 2XB5A 4OIPF 4BBSJ 3IKVA 2E60A 4HSRA 2Z99A 2P8TA 5CKTA 2L7ZA 2G9WA 2OCEA 4P5OA 3OYHA 2R0QC 3AFHA 2VASA 1TL8A 4PDKA 5EG0A 1K83J 4IRHA 2LOOA 5DUIA 4UUVA 3F21A 4HAMA 2DA3A 2DYRH 4CYCB 3PIPF 3S2DJ 4AIDA 2E7WA 1IUYA 1ZELA 1JHFA 1W7PB 2ADUA 4PFPA 2KDOA 2K9LA 4HLXA 1ENHA 3H5AA 2EFQA 3C18A 5ILVA 3HGYA 1MBGA 3H0DA 3DLAA 4RB2C 2CQNA 1T0FA 4LIUA 1IAWA 3FMQA 5DEQA 4KIGA 3MZ8A 4QIWN 5JR3A 2UV1A 2EA2A 2R7DA 1QRYA 2VQLA 3CLQA 4RAGA 1QVTA 1S9HA 5GAHJ 3DXJF 1DDNA 1YITI 3HM5A 3S16J 3QU3A 2RQPA 1DP3A 4CXFA 5BOXA 1VQLI 1I50J 1MKMA 1X58A 5CLSA 5E8IA 1QU3A 1IN5A 4L5IA 1Q1HA 4IPAA 1G6NA 3DTKA 1U3EM 2LDUA 2M0MA 3VDXA 4DYCA 4BHBA 4JYKA 2M87A 4GGGA 1FYKA 1HDPA 1BC8C 5E20A 5LRSA 2M2EA 1TW3A 1X1PA 1F4KA 2QCOA 2LY9A 3FBIB 3TKYA 4D9JA 4F92B 1T08B 4YELA 3M7GA 3HOXJ 3RQ4A 1K4SA 4BGDA 2J5OA 2EB7A 2JWTA 2MYSA 1SD5A 1XDUA 3I5UA 4KJZA 4RLFA 2VQGA 2AS5F 1YJWI 4HQMA 4IL6C 2HOTA 1BC7C 2IGKA 4XLHA 3FK7A 2L9NA 3TOAA 4V2FA 4QPOA 3T8RA 2XC7A 1W7PA 3H5NA 1WJDA 1K6YA 4G6QA 4BAYA 2DMNA 1BJAA 2HXOA 2Q1ZB 4XNFA 2O3FA 2FSWA 4JX6A 2GXAA 4R1HA 4NQWB 2M3AA 4U0YA 3O3KA 2MD5A 3J80K 1YE9A 2ZFWA 2LP0A 1B1BA 3GXOA 5FFZA 2ACJA 1Z6TA 2M8GX 3FXOA 4A3MJ 2D45A 2XGCA 4II2A 1GVDA 2UXXA 2YU9J 5FRMA 2HPMA 1OPCA 2ICWG 1QNTA 3ZN1A 2RC4A 2DXIA 3S3MA 2NAZA 3RIRA 1JT0A 4GRIA 4WF2A 3LNQA 3KFWX 4A69C 3WTXC 1W1WE 5KAIC 3DPLC 5FLXZ 3V7CA 2VJJA 4RAZA 1D8KA 1TT0A 2FJ1A 1IJWC 1IDYA 4F3QA 2L3DA 4I7HA 4BJ5C 3IH2A 1JUPA 3S1QJ 3HYIA 5DYMA 4RGRA 4JX4A 2WB1A 3W2VA 4CCNA 2VBYA 3GWZA 3BR5A 5J8FA 3SEZA 2R5YA 1LDJA 2IPQX 3CCUI 3TMOA 1I39A 3BWGA 3E6DA 3V4GA 1Y56A 1ETYA 2KJBA 3E7LA 4ZZDA 3P9KA 4Z6YA 1Y6IA 4HW0A 2KRFA 1IXSB 2R7QA 2Y0SA 1XX5A 4DW6A 2QVOA 4OU0A 1EKEA 3BG3A 1JKQC 1KU2A 2PG4A 1Z67A 3HZJA 4M74A 3VODA 1VQ7I 2C6YA 3SQNA 2MW8A 4B3AA 1X19A 2K86A 3T1BA 4RGUA 3ZMVA 2VT3A 3SZGA 3WE2A 1BW6A 3ABUA 4XMYA 3ZXSA 1JE8A 1EH7A 4A3GJ 1U78A 2A5YB 1RR8C 3HC7A 3CP2A 2FBHA 2LR8A 4IQJA 4M3FA 3ASNH 3EUKL 1BR2A 3N05A 5L3DA 5BPIA 3F8MA 5C4XJ 3ZQFA 2WWYA 1YIJI 4B48A 1OQYA 4I98B 1T38A 1VQ5I 2CV1A 4E6KG 4BNCA 3ZCOA 1T6SA 4ZC3A 4S04A 4HNTA 4IX7A 4C9YA 1E17A 1WJEA 3MKLA 5LGNA 1ZLKA 2HDDA 1ZGAA 2CRGA 2GA2A 3RZOJ 5JVTA 2XAFA 1LB2A 4HQEA 2VKEA 5DS9A 1IV6A 2OQRA 4HPQA 4HX8A 1PUEE 3JAMZ 5LD2C 2R7WA 3KCCA 2QUFA 2A68F 5GAEJ 2HEOA 1Z3XA 3IH3A 3U1KA 2LVSA 4B1RA 4OINF 2IGNA 2X6YA 3BTLA 3HB9A 2XRLA 4KIBA 3TW6A 4I09A 1MH3A 3SYTA 3M1CA 3CP8A 5LEKA 4C3JJ 1IF1A 1KONA 4M73A 3HOTA 4IJAA 4AYBN 3BDDA 3CJTB 4W1UA 2IVMA 3GF2A 1LDKB 2FQ3A 2W4SA 4CUGA 1X4PA 5F0FA 3UNGC 3S14J 1HKTA 4QTRA 3I59A 3TW7A 4HF2A 5C4JJ 1ZG3A 2HGCA 1YRNA 2AQEA 1B72A 1SFEA 2YX4A 3OIPA 4UUSB 3AL0C 2QBYB 4RS8A 1FP1D 1ZGJA 1MJ9A 4AVZA 2KPMA 2H8WA 5EEHA 1B8IB 1RR7A 3OYKA 1SC7A 2ESHA 4H0EA 4UV9A 4XIDA 4RB3C 5FB2A 3F8NA 3DEEA 1U9NA 1VQPI 2NVYJ 2K5CA 5CVIA 2A6EF 5EGOA 3RDIA 4QSHA 2VL8A 3G1LA 3LA7A 3MVPA 4GCVA 3VYTB 2O03A 1D1CA 2FEZA 1J09A 4HV6A 3WTZA 2PN6A 2JUGA 2W84A 1WKMA 2JA7J 4LLNA 1YO5C 1R7JA 2D2WA 2Y48A 2JSPA 4EGZA 4XLEA 1NTCA 1POGA 1ZR4A 1R6RA 2ZSIB 2HXIA 3BLYA 4HG2A 2QGUA 1MNMC 4A93J 3DLLF 1L0OC 1K78B 5A2QK 3FXLA 3TDUC 1VNDA 4EM1A 2W85A 2BHZA 3BCBA 3FXRA 1ETWA 2N8GA 2DOAA 2JUCA 2HS5A 1MNDA 2W24A 5E3LA 2CUFA 2BY1A 2KRHA 1KU3A 3I54A 3I64A 4NB5A 1REPC 3OYBA 3K4CA 1FOXA 3W2AA 1LUJB 1GHCA 5E3NA 1XSDA 1WJ5A 2OAZA 4MO7A 3M07A 4JQFA 1ZKGA 2CWEA 5GTHC 2H8RA 2XIGA 3PNTA 2X9DA 1S29A 4FX0A 2M30A 3PFYA 1XGNA 1ZRFA 2L7FP 4V19K 4XN0A 1YW8A 3D5LA 5TISC 2Z5UA 3NQOA 4ESFA 4ESBA 2RV8A 4CCJA 2FOKA 3M1EA 1D0XA 5IOZA 1O7FA 2A3SA 3RZDJ 3K4MA 2R7SA 4UV8A 1ONVA 1R58A 2DA4A 4AD9A 3BQZA 3Q5FA 1J9IA 4MFDA 1S6LA 4Q48A 3IUOA 3IHUA 4Y17A 2YR2A 3IKTA 3K1NA 5BMZA 3GTOJ 1ETOA 1R5HA 2Z16A 3T8TA 5J1YA 3PNVA 3S1MJ 2CUEA 2Z3YA 2AXLA 3R4KA 1MIJA 1V5FA 4KISA 2JMWA 3R60A 4BU2A 1FSEA 3IRRA 2E1OA 2OF7A 5DD8A 3GLLA 3RKYA 4DZPA 4PSWA 3L2QA 1WRJA 2IP2A 4O5VA 3GEZA 3M3YJ 2DCEA 3GFMA 3BP8A 1IRGA 2RN7A 2DMQA 2X0LA 5FROA 2ISZA 1LFPA 3HHGA 2XAUA 2ELJA 3CO7C 2JTVA 2EFWA 3A0HC 3K2AA 2NS8A 3JRIA 1TWHJ 3G6EI 3UR3C 1T0FC 5FKNA 3V8LA 3FBNB 2DT7B 1PVEA 2NOGA 3ABTA 4XR6A 5H6QA 2NNYA 3I4MJ 5FLMJ 4A2UA 5D6FA 3JRBA 2KIMA 3ABMH 2A6TA 4RBOA 1X1AA 2L0KA 2JA5J 2QQAA 4C2UA 3J80Z 2FRHA 2X6WA 4GYGA 1A04A 3GBGA 2YS9A 1QHHD 2E1MC 1F9NA 3M8EA 3J7AY 3OYIA 3I56I 2HDCA 1X3ZB 3SFZA 3WTYC 3GVAA 1FEXA 3OR2C 2E1NA 4XLFA 5FKKA 1YG2A 3RPQA 2RDPA 3NWSA 5K5OA 2OPTA 4L0YB 4U0WA 1D8JA 5EZHA 1X4OA 2FOWA 1GUUA 2XGXA 1I6XA 3GMEA 3GZ6A 2GLOA 1JKRC 4D5CA 4YFXF 2M1BA 3CJRB 3CUQA 1T56A 3C7JA 3CCEI 4IOCF 2BVMA 3ECHA 2DDAA 2IW5A 3V7SA 4BDZA 3B6AA 3RKWA 3TDZC 1ZK8A 3DBHB 3G1OA 3HL2A 4UNOA 3KZYA 5JLWA 1ETKA 3OYGA 2A6HF 3BTJA 1R1UA 1H0MA 3GLXA 2GIVA 4J19A 1R4MB 2R7ZJ 2FMYA 2X48A 2XAGA 3H0GJ 5DCMA 1R9TJ 4G7OF 2HKOA 2EINH 2QSFX 1OYWA 4CYDA 2XPUA 3AG3H 4CSWA 5C44J 5HNFA 3JAMK 2BGCA 5JLXA 2LYCA 3LOCA 1FNNA 4YFNF 1H9TA 1XMXA 3MQ0A 5IP9J 2ZJQF 4KITB 2VB6A 2ZXJA 2BZTA 1Y39A 2Y31A 2NS0A 4LGWA 3HSEA 4CZZA 2FU4A 4U7BA 2F5DA 3BG6A 1W36D 2FNPA 2WY8Q 4WXHA 4D0PA 4DGWB 2VOPA 2F5VA 3KPHA 1P7IA 1XC5A 4ENMA 2CQKA 2VKDA 2A61A 3HEFA 4E7KA 2DQRA 2EV5A 2R7FA 3ELKA 2LY2A 2NVQJ 3BZCA 2XKPA 3I4NJ 2R92J 2K3FA 1SEUA 3CQZJ 1LE8B 4CCKA 4LMYA 2L54A 3LSGA 1HCRA 5CVVA 3RJPA 2O9LA 3L7WA 3OL4A 2PEXA 2RNGA 3E5UA 1MMDA 1SAUA 3M8JA 1U6GA 3DWLE 5D4SA 1XS9A 2DN0A 4HEA2 2MFZA 4BQNA 2O0YA 2LBFB 5LGTA 2HOAA 3M8FA 4WXDA 4AWXB 3KP6A 2Y0SN 3OYFA 1U9OA 4RGXA 2JRTA 2L01A 2EIMH 1STZA 4XRFA 2GOMA 1HF0A 1BIBA 1T95A 1TLHB 5IT3A 4PJNA 3CMEI 1MZBA 1V5GA 2QSGX 4M9XA 2HZTA 4CYCA 2HTSA 3OOUA 4BKXA 4DBRA 4KMFA 1SFKA 2H6BA 1FT9A 3QAHA 2BVLA 1JTYA 2MC4A 6PAXA 4BE0A 4G12A 1R49A 2X6XA 2STTA 3HUGB 4DQ2A 2ELKA 1UELB 3IL2A 2NYXA 2CV2A 2RREA 4RA2A 5J4YA 4AIKA 4M9SA 4NC6A 2FX0A 2LKPA 4Q4ZF 3HUGA 3S3OA 2M34A 1YOVB 1XMAA 2KFDA 2EH3A 5ERIA 2H94A 3U1DA 4MNUA 5CVJA 3QOPA 2R7UA 3HKZA 2EFNA 2WA0A 1Q1VA 4ON0A 3J81K 2DJIA 5B1BH 3U21A 4ENNA 4OIQF 1FIAA 3OV8A 4CDGA 3MKZA 2E2HJ 1MJBA 3HPHA 2FD5A 3DBRB 5J8CA 3LQRA 4B8XA 2MH2A 1KGSA 2ZXWH 2LBFA 1IN7A 3D0SA 1AHDP 2EPFA 2FNAA 3AG2H 1GDTA 1TNSA 4ZJZA 3CD6I 1USTA 1IW7F 3GZNB 3UKGA 1YJ9I 4HV5A 2HWVA 4XKWA 2V26A 1DPRA 1X3UA 5D8LB 1FX7A 1JJ6C 2KZVA 1OCTC 3R61A 2XPVA 4PGGA 1K7AA 4FISA 2BY0A 5HDNA 3C2BA 5E3MA 2M5WA 1QO0D 1XSXA 2CW0F 2L9SA 2VI6A 4RB0A 1VTNC 4XLNF 4BXXJ 3VYUB 4OAZA 3WODF 4V2GA 2KISA 4ZYGA 1IN8A 1BA5A 1ZQ3P 2FBKA 1LKXA 4AIJA 5KK1A 2CSOA 4EJUA 3V8JA 3MD2A 2DFFA 2JPBA 4RM2A 2XPWA 3OIOA 3I55I 3I59B 2KZGA 1SAXA 1TZLA 3REOA 1RUNA 2LY1A 3FX3A 1RKWA 1P92A 2HOEA 2NVUB 2K85A 1ETVA 3L2VA 1LFUP 1FPQA 5DD4A 2BBYA 4UXNA 2K27A 3HOSA 3CCYA 4F7ZA 2X1DA 3OS0A 2UXNA 4G6TB 1IG7A 5HVQC 3BROA 3E3VA 5K1YA 5IYBJ 4G9YA 4LD5A 5E17F 4BXUA 3FK6A 3ZP5A 1RC9A 1PDNC 3S2HJ 1X2NA 4KN7X 3PM1A 5KHDA 2IJLA 1JXSA 2DU9A 2EZKA 2E2JJ 5IP7J 1KYWA 1LEAA 5IT9Z 3E5QA 1IN4A 3TP3A 4CH7A 1AOYA 4NUBA 1K4TA 2DOEA 2GBYA 1ODDA 1RETA 4E7JA 1DU0A 1JHHA 4LJZF 3G4SI 2RNJA 1XCBA 3S8PA 2P6TA 1KYZA 3RKXA 4IHTA 5F0HA 5JI6A 3LAPA 1ZAOA 2F4OB 5AIPA 1MBEA 2XAJA 3BJAA 1NG7A 3RSNA 2DO7A 2KQRA 4X0GA 2E5ZA 5HOOA 4II3A 3BC8A 4MTEA 3P9CA 2V79A 5C3EJ 1XSVA 3P9IA 4WWCA 1FBQA 1MMSA 1YS7A 3CO6C 3E6BA 4LG3A 5EJCA 3JSPA 2XSJC 2DT5A 4HA8A 1SFOJ 3DFGA 2COBA 4HYEA 2OJED 5LFAA 2FMLA 3FXUA 3IWZA 4UVAA 5HS7A 1ULYA 4E7SA 4YIRX 3VPRA 5F1JA 3SJMA 4IRGA 4D1QA 3KP2A 1WSUA 5D8KB 2Z1DA 5K7ZA 1TWFJ 1UJ8A 4IXAA 2VONA 1TQPA 2MLKA 1MBFA 1W5CC 2L7KA 2LREA 3FHNA 2M9HA 3HOYJ 2P4WA 3DKXA 2R5ZB 4OMZA 3WU1B 4N0BA 4EEFG 2WC2A 1K61A 1MH4A 1ZH5A 2P7CB 4RAYA 4XM3A 3BR6A 1D1BA 4IHXA 3GFIA 3E0JB 3ZMDA 3GO5A 2K4JA 3ZMUA 2MABA 1J7KA 2CUJA 2COMA 1AKHA 1TNTA 3DTEA 2ZBKA 4D7NA 2YSRA 3O8GA 3LSIA 2EV6A 2ZXIA 2PJRB 4EJTA 2R4GA 1OYYA 3CF5F 2ZJPF 4BL0B 2PMZA 4G94A 1S8NA 3PFIA 4M3EA 3GTGJ 2WAQA 4EJWA 3RYRA 3A02A 3KX2A 2K3PA 3GW2A 1VQ8I 3W3CA 2Q2EB 2XF7A 2JJ7A 5E79C 3OYMA 3ZQCA 2A05A 4EM2A 4KMUX 4XSZF 4OMYA 1P9QC 4GO1A 3BZ6A 1Z7UA 3OY9A 1QBJA 3QPSA 3K1MA 1YJNI 3EUHA 4C2TA 1J75A 4ENKA 2DMTA 4BY7J 3E6CC 5H20A 1RNLA 3GTMJ 4X6AJ 5BPDA 1F36A 5LBQA 1D0ZA 1YHQI 2AHQA 5TRDA 3CC7I 5E8GA 2LH9A 1W5TA 1WCMJ 3LFUA 5HLIA 2M45A 3GFJA 2WV0A 1XG1A 2CW8A 3DPTA 3H3UA 3LAJA 2QQBA 5HDGA 3GZ5A 1KQ0A 1ZHFA 4LOCA 1X1CA 2GIZA 4M9ZA 1Z9CA 3TOBA 4HZFA 3KP5A 3F23A 4B4CA 1BJZA 4XICA 1W7PD 3FMSA 1FBSA 1E3HA 4ZDPA 3LMMA 1PYVA 4ZTJA 5FRNA 3NEUA 2K9SA 2HQNA 3FM3A 2IXSA 2XROA 1VQNI 1EJ9A 4K2EA 2GAUA 2YPRA 2E1CA 2W57A 1KU9A 4A0YA 3G1MA 4XSXF 4WX9A 2XUBA 3R6SA 1I3QJ 3Q9VA 4YG2F 3VSKA 1SMYF 3JREA 3H1CA 2DFIA 3LSTA 2BW3A 1FIPA 3EUHC 2B63J 2JVHA 4BACA 4ZDOA 2QQ8A 4YRVA 4BE1A 3KLNA 2ETHA 1KZHA 1FZPB 1V3FA 1MD0A 1TTYA 2XAHA 2F6CA 3WU2C 5L3FA 2FQ4A 3BPVA 4YEJA 1AWCA 1WFXA 2DK5A 3PSFA 4MFEA 4MHGA 1TWGJ 2CU7A 3RPUA 4R79A 3MZHA 3WTWC 2A69F 2FXAA 2E34A 3FMRA 2ZB9A 4IZZA 2FA5A 1IN6A 4NHJA 1A6QA 2Q0OA 4J00A 1BI3A 4HX4A 1ERDA 3KLOA 2OZUA 3QRFF 1OYIA 3CTAA 2PJRA 1MW7A 4PUSA 2LF8A 3VYRB 3WG9A 2DMUA 3KEYA 4ENJA 4A3KJ 4CHUA 3OIQA 1JGSA 3NAUA 4ZYHA 4L5EA 1SD6A 3S15J 4FE4A 2VXZA 2QQ9A 5BQTA 4XKVA 3KYLA 2ZNYA 4N9IA 2DT6A 2WAFA 2FE3A 3FZVA 5DCFA 1FMWA 4MEYF 4BHPA 2JPCA 2DI3A 3KE2A 3LA2A 1NK2P 2F5CA 1YQAA 2O7OA 3TEDA 3EYIA 1B59A 5TGTA 4IHYA 1R5GA 2NNNA 3JRAA 1U8RA 4CGZA 3BT9A 1MBJA 5JFRA 5J47A 4NC8A 2EBIA 4LITA 4RAFA 2UZKA 1UAAA 2WBMA 3ZQIA 4Z2YA 5ICGA 2MLGA 2BY3A 3HBLA 2OZ6A 3GUDA 3O6BB 5DM7F 3LSRA 3BG5A 1FOWA 1SMTA 2W1OA 2VXDA 2X6OA 4XLPF 2EZLA 3L00A 1G3WA 1LVKA 5GPCA 2HVSA 3G2BA 2VOOA 2DA7A 3LSHA 5DCMB 4BJ6C 2VQCA 4LK1F 2LMDA 3O2PE 4ZYDA 3MZYA 2XRNA 4C3IJ 3L2CA 1K6OA 3V8KA 3W6JB 3BR1A 3OYEA 2XV4S 1R4NB 2HPIA 5HLGA 3EQLF 1WH5A 4LK0F 5H6RA 3N97A 2ZMEA 2QLZA 4B3XA 2KLOA 3W6VA 1J5YA 3CUQC 4YIFA 1BM9A 5B1AH 3OS2A 4A3FJ 1FTZA 4OIRF 3LL7A 3DTIA 2I10A 1A36A 3MAJA 3C2HA 4DYQA 1JUMA 1VQ9I 2W25A 1E3PA 3MFKA 3ABLH 3ROUA 2JA8J 4XLCA 5AIQA 1I3AA 4JX5A 5CVUA 3K4LA 5FO5A 3W6KB 1G8XA 2FF4A 3ULQB 3GFLA 3ZQ7A 1Y8RB 1R23A 3LQQA 1E2XA 1J2XA 1SANA 3OL3A 1AA7A 1H8AC 2Q8KA 5HDKA 1BW5A 2BOLA 4JBAA 2IA2A 1LE8A 3ZQGA 4FT8A 4BS9A 2QBYA 3TO7A 3CJNA 3FWEA 2HVQA 3IC7A 1YX3A 2TRTA 2K9MA 1OISA 2NXNB 1YRNB 2EIJH 4QPQA 1VZ0A 2Q2EA 3FISA 3RKQA 1N75A 1U5TB 3GCMA 1N77A 4HOBA 4BY1J 1EH8A 3MN2A 1ON1A 1ZTRA 5ILSA 5LGUA 2CUZA 2IAIA 3ZRGA 3IAM2 2KT0A 3SZPA 3PO3J 1SD7A 1WHUA 1GVJA 1VQ6I 5EYRA 4PGHA 1Z3YA 3B6CA 4I01A 2WAEA 2CFXA 1D1AA 4F55A 3WGIA 1IO2A 4R8HA 3ABKH 3H92A 3QQAA 4C2MJ 2JZYA 1ON2A 1T98A 3CCMI 1G2HA 4XK4A 5EEAA 3K6GA 1LNWA 1P4XA 4BEHB 2PI0A 3OYDA 3DBLB 4CCLA 3I71A 4RMNA 3VSLA 1E0EA 2TDXA 5CJ9A 2NVTJ 2JK3A 3LWFA 1A5JA 2B9SA 3HRMA 5JVGF 2RQQA 5FD6A 1YW9A 1R36A 2HYGD 2LKSA 3DEUA 5F6FA 1W5SA 3FXKA 2F4IA 4NC7A 4MEXF 1JKOC 3PUFA 3ZGKA 2H1KA 1FYMA 3X2QH 3WTTC 3IP4B 1S5LC 2DA2A 4HF1A 4CCOA 5BS6A 3CCLI 4H4KC 1EF4A 3V42A 5LEJA 2IS1A 4ITVA 4ANJA 3VFZA 4RDUA 5IOYA 2JT1A 2CQQA 3S1RJ 2M8EA 3S1NJ 2HU9A 1D0YA 2A5WA 1OCOH 3HSFA 4RLQA 3SDBA 2VODA 5FFXA 1EH6A 1H89C 3KYDB 2DA1A 3C2GA 5KNLA 2HYJA 4Q5SF 3WHCA 4QWQA 3G3ZA 2G0EA 3OYLA 4A12A 3GTQJ 5EEGA 4ZYAA 4Y3OA 4F91B 4DNCA 4FETA 2ESNA 1U8BA 1F1ZA 2X51A 3CESA 2BE5F 2G7HA 2ZCWA 1JGGA 3NWTA 3OMYA 1AU7A 4FHTA 5F0CA 1ZG5A 3CLOA 2O8XA 3SEQA 5M3FJ 3A03A 2PMUA 4BHCA 3MEXA 4AM3A 5ICEA 1V5EA 2JVGA 3GTPJ 4M71A 2M7AA 4BJTA 2ZNZA 4E7HA 1LFBA 4LFUA 2QYOA 3K2ZA 1QPIA 1YYVA 2DA6A 3SDGA 1Z21A 2VJ5A 4FTHA 1GV5A 2B0LA 2EV0A 3I4PA 1TQIA 3K7AJ 4LG0B 2ZFUA 3H3ZA 1O4XA 2E36A 1WJFA 2LTPA 4BXFA 1HA8A 1OR7A 3S93A 1OCZH 3CCRI 3H9JA 3JR9A 1S7EA 3HOVJ 3FKJA 1LEBA 2DFHA 1N78A 5E18F 5D4RA 1JJ8C 1VQKI 4HDUA 4M6XA 1D3YA 3TL4X 3CC4I 4ZDLA 1XB4A 2Y9YA 3Q0WA 2E19A 3G73A 1L3LA 4BYYA 1IZ1A 2ZO4A 5K5RA 2X4HA 4A6DA 3C1DA 4C30A 3A01A 4B09A 3PSIA 5LHHA 1CGPA 4PJMA 4KNYA 1TW2A 1UHSA 4XLAA 3AKZA 1ZRCA 1O3QA 2VE8A 4I99C 5CQGA 1RIOH 2IA1A 1BOBA 1Z7LA 2H09A 4XQFA 1PUFB 3ZMZA 4HBLA 1P2FA 3BY6A 4HF0A 2AXTC 2CQ7A 2EK5A 2V4JC 3HDDA 1BOAA 2R5YB 2DW4A 2KMUA 1W4MA 3QP6A 4LG0A 3DKWA 1IDZA 2BHYA 1WJCA 2VKVA 1YIOA 2KHMA 3H36A 3RI4A 3JCUC 2E5NA 3MKYB 4FE7A 2PMHA 1QZEA 4M6VA 2HQ5A 3EUAA 4A5NA 3SFIA 3PJRA 3BCAA 1VI0A 4BUPA 2R5ZA 1M1EB 5FGMA 4E4HA 4A3EJ 1Z0XA 2VC0A 3DEWA 3Q9SA 2DOFA 1PP8F 3LSMA 4KICA 2ZC2A 3CCQI 4A3IJ 2MD0A 4UY8I 1OLTA 1NG6A 3IH4A 3K4KA 1Y8QB 5M3MJ 1WH7A 1YTYA 4QLCU 4XRSA 2DYSH 3AG1H 2VBZA 2MGQA 5HLTA 2VT2A 3S3NA 2HDWA 4LIVA 3ZQQA 1ZYRF 5GADJ 2DPDA 3FIWA 3P7NA 4B44A 1BI0A 4BDYA 2IS4A 3QP5A 5GTIC 3TGNA 2V7FA 5IP6A 1T8IA 2X1CA 1FYLA 9ANTA 3HOZJ 2XF6A 1AKHB 4G7HF 4E7LA 4L5JA 4EJVA 1IV8A 3A1YA 3BTIA 3ZPLA 2E71A 4M3BA 2Z33A 2DFEA 3D1NI 4DOZA 1APLC 5J1UA 1G3YA 3DCFA 3K10A 1SFUA 2HNHA 1Y1VJ 3VWBA 1X2MA 1LVAA 3CUOA 4DBQA 4IRIA 2HFHA 2KP6A 5A2QZ
chains in the Genus database with same CATH topology
2D1VA 3VB2A 4G6DA 5D5UB 1DPUA 2LF7A 4UVCA 1UHWA 2MH9A 2EWNA 2OD5A 5D6EA 3S2WA 1B4AA 2FBIA 1V4RA 3SHFA 3I53A 4YFKF 3MWMA 1G4DA 5HS8A 2L4AA 3C3WA 3JTGA 3V7RA 1S7OA 1QQIA 3HIFA 1C0WA 2EFOA 1U5TA 2KKOA 4EVIA 1KA8A 4L9TA 1GXQA 1HW1A 4I0BA 3KP4A 1XN7A 4OIOF 1FBUA 3K1PA 1O7LA 5K5QA 2EFPA 1HSJA 4CICA 3AAFA 2GA1A 2KIUA 1WI9A 3HRSA 5DV5A 2Y75A 1K79A 3JTHA 3NRVA 3J81Z 2RGVA 4IHSA 3EDPA 4KUMA 1I5ZA 5L3GA 3L9FA 2IA0A 3FF5A 3F22A 1BBYA 4M6YA 3K0LA 2K7LA 2V6CA 1MGTA 4KDPA 1LDDA 4L9NA 2V1UA 4BH9A 4G7ZF 2DQLA 1XGSA 2QWWA 1DP7P 1TQMA 4EGYA 4GXOA 1WWXA 2F5EA 1OKRA 1R1VA 3BJOA 4ZYEA 1FWZA 5FD5A 3EYYA 3F8FA 2VBWA 4PZJA 5L3EA 1Z05A 3B73A 5E1XA 3WTVC 5HLHA 4ZZLA 4WXCA 4OOIA 1QGPA 2PBIA 2EJRA 1FSHA 5CVRA 1EV7A 3QPHA 4MTDA 1FC3A 2F2EA 1KQ8A 1FOKA 1XGOA 4ASNA 4HLYA 2RVCA 3WTSC 2MA3A 1ZG1A 2BYVE 2G7UA 1H9GA 4I02A 1QZZA 1HW2A 5D5VB 3DV8A 3WE3A 3WTUC 1XGMA 3ZMSA 1YLFA 2BV6A 4KA4A 1S3JA 4KT5C 4UVBA 3TO6A 2H27A 2CG4A 4G8XA 5FLXK 3DP7A 1XCVA 1XD7A 4Q47A 1P4WA 1FP2A 3KEOA 2E7XA 4EV0A 4YIIA 3ML6A 1I27A 1HBXG 4A0ZA 4M72A 4L9VA 2DBBA 2VBXA 1DUXC 1WQ2A 4AIHA 1T39A 1G3TA 1USSA 2P5KA 1HQCA 1ZARA 2V1DA 2J5PA 2IT0A 3OOPA 4WK8F 3ZMTA 5ICCA 2QZ8A 2DPUA 2L02A 3LFKA 1YW7A 1U2WA 4EQQA 5F64A 5CYVA 1D5VA 4GYIA 2DAOA 3KP7A 3QU6A 1Y0UA 4HX7A 3I58A 3M9AA 3RYPA 2DTRA 1I1GA 4KFCA 2OU2A 3HSRA 4N9HA 2D1HA 5E1WA 2RKHA 2XKOA 2YX7A 1KU7A 2WTEA 2KJCA 3BJ6A 3BOQA 3VEPA 1B6AA 4KIFA 2OA4A 1PP7U 5KVRA 3K69A 2VC1A 3WU0A 1ZLJA 1HKSA 4Y13A 1IXRC 3T0YA 2XASA 4ZH4F 4BQAA 2PFBA 3FM5A 3E5XA 2LNBA 5LHGA 2HYFA 2HQRA 2VN2A 4LB6B 2XVCA 5DDGA 3J7AO 4LLLA 3KETA 4KYWA 2YU3A 4P55A 1QPMA 1SFXA 5D5XB 4A6EA 5E1ZB 1ZRDA 3WGGA 4AVPA 5AONA 4TV7A 1O3RA 2BEOA 1MJAA 3JSOA 4EMSA 4EJOA 1IXCA 3ERED 3TQNA 3QPTA 3HRTA 3JW4A 3KZZA 2JSCA 3IWFA 3EETA 1GXPA 1SD4A 1Z1DA 3ISPA 3KP3A 3ZN0A 3LA3A 4I2OA 3MCZA 1BI1A 4UHTA 3IRQA 3HTSB 2VE9A 2QENA 5ED4A 4MQVA 2P5VA 2P7VB 2R3SA 3L09A 4U7DA 1RUOA 4FX4A 3HTUA 1HKQA 4A5MA 3HHHA 1RZ4A 1B9MA 1I1SA 3FXQA 3F8BA 1QZYA 3PQJA 2GZWA 4E70A 5HS9A 4IF4A 2MBFA 4XBFA 2O61A 5TJJA 3R0AA 4P96A 1J0RA 3K9TA 1CF7B 5J6XA 3GYHX 1Z6RA 1LJ9A 1O57A 2H6CA 3CDHA 2Z9OA 2HKXA 3DQVC 4O6JA 2DK8A 3I0TA 1O3TA 3FHZA 3N4MA 2XHKA 2EA4A 1YFHA 3SZTA 2Y0MA 4U0VA 4NQWA 4ETSA 3B02A 4EM0B 4Y15A 1FLIA 1F5TA 4L0ZB 1HXDA 2IRFG 2OQGA 2PQ8A 5F1RA 3E97A 2XAQA 2GXBA 2F5FA 3R0JA 2NRAC 2K4BA 2UWMA 1G3SA 1ZN2A 3PQKA 1BIAA 4CO8A 2STWA 3U2RA 3KEQA 2CGPA 4IVNA 2ISYA 1XMKA 1R1TA 1MDMB 5LHIA 1UFMA 3ECOA 4MGRA 4A0XA 1TBXA 5LLQA 1NHAA 2KIFA 3GX4X 1U5TC 2GXGA 1YS6A 3SXYA 2ZKZA 2P6SA 2ZJ2A 5L3CA 4HDVA 3F8CA 5D5WB 1S7AA 2DLLA 4S05A 2OBPA 4U88A 1Z91A 1R22A 1K78A 2ELHA 1O3SA 4O3MA 4LLGF 5DUKA 3DF8A 2MC3A 4RB1A 2ZMEB 2HR3A 1T2KA 4KN4X 2LSOA 2P5LC 1RI7A 4P9FA 3F72A 2CO5A 2K02A 3HRUA 5ICFA 4I0AA 3RTRA 5ILUA 1HW5A 1UHMA 2V9VA 5LRRA 3WGHA 2HTJA 4LB5A 4L18B 2CYYA 3VOEA 2GWRA 5IT9K 3U9GA 3COAC 4RGSA 2A07F 1P6RA 3E6MA 1HSTA 1J59A 4PCQA 1BN5A 4ESJA 4MQ9F 4P9UA 1UCRA 1R00A 1MDMA 2L4MA 3TO9A 2QM3A 2PJPA 3F3XA 1IRFA 2O6GE 1LQ1A 1CF7A 5L3BA 3F6OA 3T5XA 4WCGA 1B9NA 1XDSA 1BI2A 2GQQA 2V1XA 3CUQB 4JK1X 2PLYA 1OMIA 3F6VA 1ZREA 5JHUA 1UB9A 1KQ9A 1FY7A 3BPXA 4L9JA 1P4AA 4OIPF 3IKVA 2Z99A 2P8TA 2G9WA 4P5OA 4PDKA 4IRHA 5DUIA 4UUVA 3F21A 4HAMA 2E7WA 1IUYA 1JHFA 1W7PB 2ADUA 4HLXA 5ILVA 2EFQA 3C18A 4RB2C 1T0FA 1IAWA 3FMQA 5DEQA 4KIGA 5JR3A 2EA2A 2R7DA 3DXJF 1DDNA 3QU3A 2RQPA 4CXFA 5BOXA 1MKMA 5CLSA 5E8IA 1IN5A 4L5IA 1Q1HA 4IPAA 1G6NA 1U3EM 2LDUA 4BHBA 2M87A 4GGGA 1FYKA 1BC8C 5E20A 5LRSA 1TW3A 1F4KA 3TKYA 3M7GA 2J5OA 2EB7A 3I5UA 1SD5A 1XDUA 2AS5F 4HQMA 1BC7C 3TOAA 3T8RA 1W7PA 4G6QA 4BAYA 1BJAA 2O3FA 2FSWA 4R1HA 4U0YA 3O3KA 2MD5A 3J80K 2ZFWA 3GXOA 1B1BA 5FFZA 2ACJA 1Z6TA 2D45A 2UXXA 1OPCA 1QNTA 3ZN1A 2RC4A 2NAZA 3RIRA 4WF2A 3KFWX 3WTXC 3DPLC 5FLXZ 3V7CA 4RAZA 1D8KA 2L3DA 4I7HA 3HYIA 5DYMA 4RGRA 2VBYA 3GWZA 5J8FA 1LDJA 2IPQX 3BWGA 3E6DA 3V4GA 2KJBA 4ZZDA 3P9KA 4HW0A 2KRFA 1IXSB 2QVOA 4OU0A 1KU2A 2PG4A 4M74A 3VODA 2C6YA 3SQNA 3T1BA 2K86A 4RGUA 3ZMVA 2VT3A 3WE2A 3ABUA 1JE8A 1EH7A 1U78A 2A5YB 2FBHA 5BPIA 5L3DA 3F8MA 2WWYA 4I98B 1T38A 4BNCA 1T6SA 4S04A 1E17A 5LGNA 1ZLKA 1ZGAA 2GA2A 5JVTA 2XAFA 1LB2A 4HQEA 2OQRA 4HX8A 1PUEE 3JAMZ 3KCCA 2QUFA 2A68F 2HEOA 4OINF 4KIBA 4I09A 5LEKA 1IF1A 4M73A 3HOTA 4IJAA 3BDDA 2IVMA 1LDKB 3GF2A 2FQ3A 1HKTA 3I59A 4HF2A 1ZG3A 2HGCA 1SFEA 2YX4A 2QBYB 4RS8A 1FP1D 1ZGJA 1MJ9A 5EEHA 2ESHA 4H0EA 4UV9A 4RB3C 5FB2A 3F8NA 5CVIA 2A6EF 3RDIA 3LA7A 4GCVA 2O03A 2FEZA 4HV6A 3WTZA 2PN6A 2W84A 1WKMA 4LLNA 1YO5C 1R7JA 2D2WA 2Y48A 4EGZA 1L0OC 1K78B 5A2QK 3TDUC 4EM1A 2W85A 3FXRA 2HS5A 2W24A 3I54A 1KU3A 3I64A 4NB5A 1REPC 1GHCA 1XSDA 2OAZA 4JQFA 2CWEA 2XIGA 1S29A 4FX0A 2M30A 1XGNA 1ZRFA 1YW8A 3D5LA 2Z5UA 3NQOA 4ESFA 4ESBA 2RV8A 2FOKA 3M1EA 1O7FA 2A3SA 4UV8A 1ONVA 1R58A 4AD9A 3Q5FA 1J9IA 1S6LA 4Q48A 3IHUA 4Y17A 2YR2A 3IKTA 3K1NA 5BMZA 1R5HA 3T8TA 2Z3YA 2AXLA 3R4KA 3R60A 1FSEA 3IRRA 5DD8A 3RKYA 1WRJA 2IP2A 4O5VA 3GEZA 3GFMA 3BP8A 1IRGA 2RN7A 2X0LA 2ISZA 3HHGA 3CO7C 2EFWA 2JTVA 3V8LA 5H6QA 2NNYA 3ABTA 4A2UA 5D6FA 2KIMA 2QQAA 3J80Z 2FRHA 4GYGA 1A04A 3M8EA 1F9NA 2HDCA 3SFZA 3WTYC 3GVAA 2E1NA 1YG2A 3RPQA 2RDPA 5K5OA 4L0YB 4U0WA 1D8JA 2XGXA 1I6XA 3GZ6A 4YFXF 2M1BA 3CUQA 3C7JA 3ECHA 2IW5A 3V7SA 3RKWA 3TDZC 4UNOA 3KZYA 2A6HF 1R1UA 1H0MA 3GLXA 2GIVA 2FMYA 2XAGA 5DCMA 4G7OF 2HKOA 1OYWA 4CYDA 3JAMK 2BGCA 1FNNA 4YFNF 1H9TA 3MQ0A 2ZXJA 4LGWA 2NS0A 3HSEA 4CZZA 2FU4A 4U7BA 2F5DA 2FNPA 4WXHA 4D0PA 2VOPA 4ENMA 2CQKA 2A61A 2DQRA 2EV5A 2R7FA 3ELKA 2XKPA 4LMYA 2L54A 5CVVA 3RJPA 3L7WA 2PEXA 3E5UA 1U6GA 5D4SA 2O0YA 5LGTA 3M8FA 4WXDA 4AWXB 3KP6A 4RGXA 2JRTA 2L01A 1STZA 4XRFA 1BIBA 5IT3A 1TLHB 1MZBA 4M9XA 2HZTA 2HTSA 4KMFA 2H6BA 1FT9A 3QAHA 6PAXA 2STTA 4DQ2A 3IL2A 2NYXA 4AIKA 4M9SA 2LKPA 4Q4ZF 3HUGA 1XMAA 5ERIA 2H94A 3U1DA 4MNUA 5CVJA 3QOPA 2EFNA 4ON0A 3J81K 4ENNA 4OIQF 3OV8A 4CDGA 1MJBA 5J8CA 3LQRA 4B8XA 2MH2A 1KGSA 1IN7A 3D0SA 2FNAA 1TNSA 1USTA 1IW7F 4HV5A 2HWVA 1DPRA 1X3UA 5D8LB 1FX7A 3R61A 4PGGA 1K7AA 5HDNA 2M5WA 1QO0D 1XSXA 2CW0F 4RB0A 1VTNC 4XLNF 3WODF 4ZYGA 1IN8A 2FBKA 4AIJA 5KK1A 2CSOA 4EJUA 3V8JA 2JPBA 3I59B 1SAXA 3REOA 1RUNA 3FX3A 1P92A 2HOEA 1FPQA 5DD4A 2BBYA 4UXNA 2K27A 3HOSA 4F7ZA 2UXNA 5HVQC 3BROA 3E3VA 5K1YA 4G9YA 4LD5A 5E17F 4BXUA 3ZP5A 1PDNC 4KN7X 2IJLA 1JXSA 2DU9A 1KYWA 1LEAA 5IT9Z 3E5QA 1IN4A 1AOYA 1ODDA 1JHHA 4LJZF 2RNJA 1XCBA 2P6TA 1KYZA 3RKXA 4IHTA 5JI6A 3LAPA 1ZAOA 5AIPA 2XAJA 3BJAA 2DO7A 5HOOA 4MTEA 3P9CA 2V79A 1XSVA 3P9IA 4WWCA 1FBQA 1YS7A 3CO6C 3E6BA 3JSPA 2DT5A 4HA8A 3DFGA 4HYEA 2FMLA 3FXUA 3IWZA 4UVAA 5HS7A 1ULYA 4IRGA 1WSUA 3KP2A 5D8KB 4IXAA 2VONA 1TQPA 2MLKA 2P4WA 4OMZA 3WU1B 4N0BA 2WC2A 1ZH5A 2P7CB 4RAYA 3GFIA 3ZMDA 2K4JA 3GO5A 3ZMUA 1J7KA 2COMA 1TNTA 2ZBKA 2YSRA 2EV6A 4EJTA 1OYYA 4G94A 1S8NA 3PFIA 4EJWA 3RYRA 3GW2A 4EM2A 4KMUX 4XSZF 4OMYA 4GO1A 3BZ6A 1Z7UA 1QBJA 3K1MA 3EUHA 1J75A 4ENKA 3E6CC 5H20A 1RNLA 5BPDA 5LBQA 5TRDA 5E8GA 1W5TA 5HLIA 2M45A 3GFJA 2WV0A 3DPTA 3H3UA 3LAJA 2QQBA 5HDGA 3GZ5A 1KQ0A 1ZHFA 1Z9CA 4M9ZA 3TOBA 4HZFA 3KP5A 3F23A 1W7PD 3FMSA 1FBSA 3NEUA 2HQNA 3FM3A 2XROA 4K2EA 2GAUA 2YPRA 2E1CA 2W57A 1KU9A 4A0YA 4XSXF 4WX9A 2XUBA 3R6SA 3Q9VA 4YG2F 1SMYF 3LSTA 2DFIA 3KLNA 2ETHA 1FZPB 1V3FA 1MD0A 1TTYA 2XAHA 5L3FA 3BPVA 1AWCA 2DK5A 4MHGA 3RPUA 4R79A 3MZHA 3WTWC 2A69F 2FXAA 3FMRA 2FA5A 1IN6A 4NHJA 2Q0OA 1BI3A 4HX4A 3KLOA 2OZUA 3QRFF 1OYIA 3CTAA 2LF8A 3WG9A 4ENJA 4CHUA 1JGSA 4ZYHA 1SD6A 2VXZA 2QQ9A 5BQTA 2ZNYA 4N9IA 2FE3A 3FZVA 5DCFA 4MEYF 4BHPA 2JPCA 2DI3A 3KE2A 3LA2A 2F5CA 1YQAA 3EYIA 1B59A 1R5GA 2NNNA 1U8RA 4CGZA 5JFRA 2UZKA 4Z2YA 5ICGA 2MLGA 2OZ6A 3GUDA 3O6BB 1SMTA 4XLPF 3L00A 1G3WA 2VOOA 5DCMB 4LK1F 3O2PE 4ZYDA 3MZYA 2XRNA 3L2CA 1K6OA 3V8KA 3W6JB 2XV4S 5HLGA 3EQLF 4LK0F 5H6RA 3N97A 2ZMEA 2QLZA 1J5YA 3CUQC 4YIFA 1BM9A 4OIRF 3MAJA 2W25A 3MFKA 3ROUA 5AIQA 5CVUA 5FO5A 3W6KB 2FF4A 3ULQB 3GFLA 3ZQ7A 1R23A 3LQQA 1E2XA 1J2XA 2Q8KA 5HDKA 4JBAA 2IA2A 4FT8A 2QBYA 3TO7A 3CJNA 3FWEA 3IC7A 2Q2EA 1U5TB 4HOBA 1EH8A 1ON1A 5ILSA 5LGUA 3SZPA 1SD7A 1GVJA 4PGHA 4I01A 3WGIA 2CFXA 4R8HA 3H92A 2JZYA 1ON2A 1T98A 1LNWA 1P4XA 2PI0A 3I71A 2TDXA 5CJ9A 3LWFA 3HRMA 5FD6A 1YW9A 1R36A 2HYGD 3DEUA 5F6FA 1W5SA 4MEXF 1FYMA 3WTTC 4HF1A 5BS6A 5LEJA 3VFZA 2JT1A 2M8EA 3HSFA 2VODA 5FFXA 1EH6A 4Q5SF 4QWQA 3G3ZA 4A12A 5EEGA 4DNCA 2ESNA 1F1ZA 2BE5F 2G7HA 2ZCWA 4FHTA 1ZG5A 3CLOA 2O8XA 2PMUA 4BHCA 3MEXA 5ICEA 4M71A 2ZNZA 4LFUA 2QYOA 3K2ZA 1YYVA 2B0LA 2EV0A 3I4PA 1TQIA 4LG0B 3H3ZA 1OR7A 1LEBA 5E18F 5D4RA 4HDUA 4M6XA 1D3YA 1XB4A 3G73A 1L3LA 4BYYA 1IZ1A 2ZO4A 5K5RA 2X4HA 4A6DA 3C1DA 4B09A 5LHHA 1CGPA 4KNYA 1TW2A 1ZRCA 1O3QA 2VE8A 1RIOH 2IA1A 2H09A 3ZMZA 4HBLA 1P2FA 3BY6A 4HF0A 2EK5A 1BOAA 2DW4A 1W4MA 3QP6A 4LG0A 3DKWA 1YIOA 3RI4A 2PMHA 4A5NA 5FGMA 2VC0A 3Q9SA 1PP8F 4KICA 1YTYA 4QLCU 2VBZA 2VT2A 1ZYRF 2DPDA 3P7NA 1BI0A 3QP5A 3TGNA 1FYLA 4G7HF 4L5JA 4EJVA 3ZPLA 2Z33A 1G3YA 1SFUA 4IRIA 1LVAA 3CUOA 2HFHA 5A2QZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1V A;  3VB2 A;  4G6D A;  5D5U B;  1DPU A;  2LF7 A;  4UVC A;  1UHW A;  2MH9 A;  2EWN A;  2OD5 A;  5D6E A;  3S2W A;  1B4A A;  2FBI A;  1V4R A;  3SHF A;  3I53 A;  4YFK F;  3MWM A;  1G4D A;  5HS8 A;  2L4A A;  3C3W A;  3JTG A;  3V7R A;  1S7O A;  1QQI A;  3HIF A;  1C0W A;  2EFO A;  1U5T A;  2KKO A;  4EVI A;  1KA8 A;  4L9T A;  1GXQ A;  1HW1 A;  4I0B A;  3KP4 A;  1XN7 A;  4OIO F;  1FBU A;  3K1P A;  1O7L A;  5K5Q A;  2EFP A;  1HSJ A;  4CIC A;  3AAF A;  2GA1 A;  2KIU A;  1WI9 A;  3HRS A;  5DV5 A;  2Y75 A;  1K79 A;  3JTH A;  3NRV A;  3J81 Z;  2RGV A;  4IHS A;  3EDP A;  4KUM A;  1I5Z A;  5L3G A;  3L9F A;  2IA0 A;  3FF5 A;  3F22 A;  1BBY A;  4M6Y A;  3K0L A;  2K7L A;  2V6C A;  1MGT A;  4KDP A;  1LDD A;  4L9N A;  2V1U A;  4BH9 A;  4G7Z F;  2DQL A;  1XGS A;  2QWW A;  1DP7 P;  1TQM A;  4EGY A;  4GXO A;  1WWX A;  2F5E A;  1OKR A;  1R1V A;  3BJO A;  4ZYE A;  1FWZ A;  5FD5 A;  3EYY A;  3F8F A;  2VBW A;  4PZJ A;  5L3E A;  1Z05 A;  3B73 A;  5E1X A;  3WTV C;  5HLH A;  4ZZL A;  4WXC A;  4OOI A;  1QGP A;  2PBI A;  2EJR A;  1FSH A;  5CVR A;  1EV7 A;  3QPH A;  4MTD A;  1FC3 A;  2F2E A;  1KQ8 A;  1FOK A;  1XGO A;  4ASN A;  4HLY A;  2RVC A;  3WTS C;  2MA3 A;  1ZG1 A;  2BYV E;  2G7U A;  1H9G A;  4I02 A;  1QZZ A;  1HW2 A;  5D5V B;  3DV8 A;  3WE3 A;  3WTU C;  1XGM A;  3ZMS A;  1YLF A;  2BV6 A;  4KA4 A;  1S3J A;  4KT5 C;  4UVB A;  3TO6 A;  2H27 A;  2CG4 A;  4G8X A;  5FLX K;  3DP7 A;  1XCV A;  1XD7 A;  4Q47 A;  1P4W A;  1FP2 A;  3KEO A;  2E7X A;  4EV0 A;  4YII A;  3ML6 A;  1I27 A;  1HBX G;  4A0Z A;  4M72 A;  4L9V A;  2DBB A;  2VBX A;  1DUX C;  1WQ2 A;  4AIH A;  1T39 A;  1G3T A;  1USS A;  2P5K A;  1HQC A;  1ZAR A;  2V1D A;  2J5P A;  2IT0 A;  3OOP A;  4WK8 F;  3ZMT A;  5ICC A;  2QZ8 A;  2DPU A;  2L02 A;  3LFK A;  1YW7 A;  1U2W A;  4EQQ A;  5F64 A;  5CYV A;  1D5V A;  4GYI A;  2DAO A;  3KP7 A;  3QU6 A;  1Y0U A;  4HX7 A;  3I58 A;  3M9A A;  3RYP A;  2DTR A;  1I1G A;  4KFC A;  2OU2 A;  3HSR A;  4N9H A;  2D1H A;  5E1W A;  2RKH A;  2XKO A;  2YX7 A;  1KU7 A;  2WTE A;  2KJC A;  3BJ6 A;  3BOQ A;  3VEP A;  1B6A A;  4KIF A;  2OA4 A;  1PP7 U;  5KVR A;  3K69 A;  2VC1 A;  3WU0 A;  1ZLJ A;  1HKS A;  4Y13 A;  1IXR C;  3T0Y A;  2XAS A;  4ZH4 F;  4BQA A;  2PFB A;  3FM5 A;  3E5X A;  2LNB A;  5LHG A;  2HYF A;  2HQR A;  2VN2 A;  4LB6 B;  2XVC A;  5DDG A;  3J7A O;  4LLL A;  3KET A;  4KYW A;  2YU3 A;  4P55 A;  1QPM A;  1SFX A;  5D5X B;  4A6E A;  5E1Z B;  1ZRD A;  3WGG A;  4AVP A;  5AON A;  4TV7 A;  1O3R A;  2BEO A;  1MJA A;  3JSO A;  4EMS A;  4EJO A;  1IXC A;  3ERE D;  3TQN A;  3QPT A;  3HRT A;  3JW4 A;  3KZZ A;  2JSC A;  3IWF A;  3EET A;  1GXP A;  1SD4 A;  1Z1D A;  3ISP A;  3KP3 A;  3ZN0 A;  3LA3 A;  4I2O A;  3MCZ A;  1BI1 A;  4UHT A;  3IRQ A;  3HTS B;  2VE9 A;  2QEN A;  5ED4 A;  4MQV A;  2P5V A;  2P7V B;  2R3S A;  3L09 A;  4U7D A;  1RUO A;  4FX4 A;  3HTU A;  1HKQ A;  4A5M A;  3HHH A;  1RZ4 A;  1B9M A;  1I1S A;  3FXQ A;  3F8B A;  1QZY A;  3PQJ A;  2GZW A;  4E70 A;  5HS9 A;  4IF4 A;  2MBF A;  4XBF A;  2O61 A;  5TJJ A;  3R0A A;  4P96 A;  1J0R A;  3K9T A;  1CF7 B;  5J6X A;  3GYH X;  1Z6R A;  1LJ9 A;  1O57 A;  2H6C A;  3CDH A;  2Z9O A;  2HKX A;  3DQV C;  4O6J A;  2DK8 A;  3I0T A;  1O3T A;  3FHZ A;  3N4M A;  2XHK A;  2EA4 A;  1YFH A;  3SZT A;  2Y0M A;  4U0V A;  4NQW A;  4ETS A;  3B02 A;  4EM0 B;  4Y15 A;  1FLI A;  1F5T A;  4L0Z B;  1HXD A;  2IRF G;  2OQG A;  2PQ8 A;  5F1R A;  3E97 A;  2XAQ A;  2GXB A;  2F5F A;  3R0J A;  2NRA C;  2K4B A;  2UWM A;  1G3S A;  1ZN2 A;  3PQK A;  1BIA A;  4CO8 A;  2STW A;  3U2R A;  3KEQ A;  2CGP A;  4IVN A;  2ISY A;  1XMK A;  1R1T A;  1MDM B;  5LHI A;  1UFM A;  3ECO A;  4MGR A;  4A0X A;  1TBX A;  5LLQ A;  1NHA A;  2KIF A;  3GX4 X;  1U5T C;  2GXG A;  1YS6 A;  3SXY A;  2ZKZ A;  2P6S A;  2ZJ2 A;  5L3C A;  4HDV A;  3F8C A;  5D5W B;  1S7A A;  2DLL A;  4S05 A;  2OBP A;  4U88 A;  1Z91 A;  1R22 A;  1K78 A;  2ELH A;  1O3S A;  4O3M A;  4LLG F;  5DUK A;  3DF8 A;  2MC3 A;  4RB1 A;  2ZME B;  2HR3 A;  1T2K A;  4KN4 X;  2LSO A;  2P5L C;  1RI7 A;  4P9F A;  3F72 A;  2CO5 A;  2K02 A;  3HRU A;  5ICF A;  4I0A A;  3RTR A;  5ILU A;  1HW5 A;  1UHM A;  2V9V A;  5LRR A;  3WGH A;  2HTJ A;  4LB5 A;  4L18 B;  2CYY A;  3VOE A;  2GWR A;  5IT9 K;  3U9G A;  3COA C;  4RGS A;  2A07 F;  1P6R A;  3E6M A;  1HST A;  1J59 A;  4PCQ A;  1BN5 A;  4ESJ A;  4MQ9 F;  4P9U A;  1UCR A;  1R00 A;  1MDM A;  2L4M A;  3TO9 A;  2QM3 A;  2PJP A;  3F3X A;  1IRF A;  2O6G E;  1LQ1 A;  1CF7 A;  5L3B A;  3F6O A;  3T5X A;  4WCG A;  1B9N A;  1XDS A;  1BI2 A;  2GQQ A;  2V1X A;  3CUQ B;  4JK1 X;  2PLY A;  1OMI A;  3F6V A;  1ZRE A;  5JHU A;  1UB9 A;  1KQ9 A;  1FY7 A;  3BPX A;  4L9J A;  1P4A A;  4OIP F;  3IKV A;  2Z99 A;  2P8T A;  2G9W A;  4P5O A;  4PDK A;  4IRH A;  5DUI A;  4UUV A;  3F21 A;  4HAM A;  2E7W A;  1IUY A;  1JHF A;  1W7P B;  2ADU A;  4HLX A;  5ILV A;  2EFQ A;  3C18 A;  4RB2 C;  1T0F A;  1IAW A;  3FMQ A;  5DEQ A;  4KIG A;  5JR3 A;  2EA2 A;  2R7D A;  3DXJ F;  1DDN A;  3QU3 A;  2RQP A;  4CXF A;  5BOX A;  1MKM A;  5CLS A;  5E8I A;  1IN5 A;  4L5I A;  1Q1H A;  4IPA A;  1G6N A;  1U3E M;  2LDU A;  4BHB A;  2M87 A;  4GGG A;  1FYK A;  1BC8 C;  5E20 A;  5LRS A;  1TW3 A;  1F4K A;  3TKY A;  3M7G A;  2J5O A;  2EB7 A;  3I5U A;  1SD5 A;  1XDU A;  2AS5 F;  4HQM A;  1BC7 C;  3TOA A;  3T8R A;  1W7P A;  4G6Q A;  4BAY A;  1BJA A;  2O3F A;  2FSW A;  4R1H A;  4U0Y A;  3O3K A;  2MD5 A;  3J80 K;  2ZFW A;  3GXO A;  1B1B A;  5FFZ A;  2ACJ A;  1Z6T A;  2D45 A;  2UXX A;  1OPC A;  1QNT A;  3ZN1 A;  2RC4 A;  2NAZ A;  3RIR A;  4WF2 A;  3KFW X;  3WTX C;  3DPL C;  5FLX Z;  3V7C A;  4RAZ A;  1D8K A;  2L3D A;  4I7H A;  3HYI A;  5DYM A;  4RGR A;  2VBY A;  3GWZ A;  5J8F A;  1LDJ A;  2IPQ X;  3BWG A;  3E6D A;  3V4G A;  2KJB A;  4ZZD A;  3P9K A;  4HW0 A;  2KRF A;  1IXS B;  2QVO A;  4OU0 A;  1KU2 A;  2PG4 A;  4M74 A;  3VOD A;  2C6Y A;  3SQN A;  3T1B A;  2K86 A;  4RGU A;  3ZMV A;  2VT3 A;  3WE2 A;  3ABU A;  1JE8 A;  1EH7 A;  1U78 A;  2A5Y B;  2FBH A;  5BPI A;  5L3D A;  3F8M A;  2WWY A;  4I98 B;  1T38 A;  4BNC A;  1T6S A;  4S04 A;  1E17 A;  5LGN A;  1ZLK A;  1ZGA A;  2GA2 A;  5JVT A;  2XAF A;  1LB2 A;  4HQE A;  2OQR A;  4HX8 A;  1PUE E;  3JAM Z;  3KCC A;  2QUF A;  2A68 F;  2HEO A;  4OIN F;  4KIB A;  4I09 A;  5LEK A;  1IF1 A;  4M73 A;  3HOT A;  4IJA A;  3BDD A;  2IVM A;  1LDK B;  3GF2 A;  2FQ3 A;  1HKT A;  3I59 A;  4HF2 A;  1ZG3 A;  2HGC A;  1SFE A;  2YX4 A;  2QBY B;  4RS8 A;  1FP1 D;  1ZGJ A;  1MJ9 A;  5EEH A;  2ESH A;  4H0E A;  4UV9 A;  4RB3 C;  5FB2 A;  3F8N A;  5CVI A;  2A6E F;  3RDI A;  3LA7 A;  4GCV A;  2O03 A;  2FEZ A;  4HV6 A;  3WTZ A;  2PN6 A;  2W84 A;  1WKM A;  4LLN A;  1YO5 C;  1R7J A;  2D2W A;  2Y48 A;  4EGZ A;  1L0O C;  1K78 B;  5A2Q K;  3TDU C;  4EM1 A;  2W85 A;  3FXR A;  2HS5 A;  2W24 A;  3I54 A;  1KU3 A;  3I64 A;  4NB5 A;  1REP C;  1GHC A;  1XSD A;  2OAZ A;  4JQF A;  2CWE A;  2XIG A;  1S29 A;  4FX0 A;  2M30 A;  1XGN A;  1ZRF A;  1YW8 A;  3D5L A;  2Z5U A;  3NQO A;  4ESF A;  4ESB A;  2RV8 A;  2FOK A;  3M1E A;  1O7F A;  2A3S A;  4UV8 A;  1ONV A;  1R58 A;  4AD9 A;  3Q5F A;  1J9I A;  1S6L A;  4Q48 A;  3IHU A;  4Y17 A;  2YR2 A;  3IKT A;  3K1N A;  5BMZ A;  1R5H A;  3T8T A;  2Z3Y A;  2AXL A;  3R4K A;  3R60 A;  1FSE A;  3IRR A;  5DD8 A;  3RKY A;  1WRJ A;  2IP2 A;  4O5V A;  3GEZ A;  3GFM A;  3BP8 A;  1IRG A;  2RN7 A;  2X0L A;  2ISZ A;  3HHG A;  3CO7 C;  2EFW A;  2JTV A;  3V8L A;  5H6Q A;  2NNY A;  3ABT A;  4A2U A;  5D6F A;  2KIM A;  2QQA A;  3J80 Z;  2FRH A;  4GYG A;  1A04 A;  3M8E A;  1F9N A;  2HDC A;  3SFZ A;  3WTY C;  3GVA A;  2E1N A;  1YG2 A;  3RPQ A;  2RDP A;  5K5O A;  4L0Y B;  4U0W A;  1D8J A;  2XGX A;  1I6X A;  3GZ6 A;  4YFX F;  2M1B A;  3CUQ A;  3C7J A;  3ECH A;  2IW5 A;  3V7S A;  3RKW A;  3TDZ C;  4UNO A;  3KZY A;  2A6H F;  1R1U A;  1H0M A;  3GLX A;  2GIV A;  2FMY A;  2XAG A;  5DCM A;  4G7O F;  2HKO A;  1OYW A;  4CYD A;  3JAM K;  2BGC A;  1FNN A;  4YFN F;  1H9T A;  3MQ0 A;  2ZXJ A;  4LGW A;  2NS0 A;  3HSE A;  4CZZ A;  2FU4 A;  4U7B A;  2F5D A;  2FNP A;  4WXH A;  4D0P A;  2VOP A;  4ENM A;  2CQK A;  2A61 A;  2DQR A;  2EV5 A;  2R7F A;  3ELK A;  2XKP A;  4LMY A;  2L54 A;  5CVV A;  3RJP A;  3L7W A;  2PEX A;  3E5U A;  1U6G A;  5D4S A;  2O0Y A;  5LGT A;  3M8F A;  4WXD A;  4AWX B;  3KP6 A;  4RGX A;  2JRT A;  2L01 A;  1STZ A;  4XRF A;  1BIB A;  5IT3 A;  1TLH B;  1MZB A;  4M9X A;  2HZT A;  2HTS A;  4KMF A;  2H6B A;  1FT9 A;  3QAH A;  6PAX A;  2STT A;  4DQ2 A;  3IL2 A;  2NYX A;  4AIK A;  4M9S A;  2LKP A;  4Q4Z F;  3HUG A;  1XMA A;  5ERI A;  2H94 A;  3U1D A;  4MNU A;  5CVJ A;  3QOP A;  2EFN A;  4ON0 A;  3J81 K;  4ENN A;  4OIQ F;  3OV8 A;  4CDG A;  1MJB A;  5J8C A;  3LQR A;  4B8X A;  2MH2 A;  1KGS A;  1IN7 A;  3D0S A;  2FNA A;  1TNS A;  1UST A;  1IW7 F;  4HV5 A;  2HWV A;  1DPR A;  1X3U A;  5D8L B;  1FX7 A;  3R61 A;  4PGG A;  1K7A A;  5HDN A;  2M5W A;  1QO0 D;  1XSX A;  2CW0 F;  4RB0 A;  1VTN C;  4XLN F;  3WOD F;  4ZYG A;  1IN8 A;  2FBK A;  4AIJ A;  5KK1 A;  2CSO A;  4EJU A;  3V8J A;  2JPB A;  3I59 B;  1SAX A;  3REO A;  1RUN A;  3FX3 A;  1P92 A;  2HOE A;  1FPQ A;  5DD4 A;  2BBY A;  4UXN A;  2K27 A;  3HOS A;  4F7Z A;  2UXN A;  5HVQ C;  3BRO A;  3E3V A;  5K1Y A;  4G9Y A;  4LD5 A;  5E17 F;  4BXU A;  3ZP5 A;  1PDN C;  4KN7 X;  2IJL A;  1JXS A;  2DU9 A;  1KYW A;  1LEA A;  5IT9 Z;  3E5Q A;  1IN4 A;  1AOY A;  1ODD A;  1JHH A;  4LJZ F;  2RNJ A;  1XCB A;  2P6T A;  1KYZ A;  3RKX A;  4IHT A;  5JI6 A;  3LAP A;  1ZAO A;  5AIP A;  2XAJ A;  3BJA A;  2DO7 A;  5HOO A;  4MTE A;  3P9C A;  2V79 A;  1XSV A;  3P9I A;  4WWC A;  1FBQ A;  1YS7 A;  3CO6 C;  3E6B A;  3JSP A;  2DT5 A;  4HA8 A;  3DFG A;  4HYE A;  2FML A;  3FXU A;  3IWZ A;  4UVA A;  5HS7 A;  1ULY A;  4IRG A;  1WSU A;  3KP2 A;  5D8K B;  4IXA A;  2VON A;  1TQP A;  2MLK A;  2P4W A;  4OMZ A;  3WU1 B;  4N0B A;  2WC2 A;  1ZH5 A;  2P7C B;  4RAY A;  3GFI A;  3ZMD A;  2K4J A;  3GO5 A;  3ZMU A;  1J7K A;  2COM A;  1TNT A;  2ZBK A;  2YSR A;  2EV6 A;  4EJT A;  1OYY A;  4G94 A;  1S8N A;  3PFI A;  4EJW A;  3RYR A;  3GW2 A;  4EM2 A;  4KMU X;  4XSZ F;  4OMY A;  4GO1 A;  3BZ6 A;  1Z7U A;  1QBJ A;  3K1M A;  3EUH A;  1J75 A;  4ENK A;  3E6C C;  5H20 A;  1RNL A;  5BPD A;  5LBQ A;  5TRD A;  5E8G A;  1W5T A;  5HLI A;  2M45 A;  3GFJ A;  2WV0 A;  3DPT A;  3H3U A;  3LAJ A;  2QQB A;  5HDG A;  3GZ5 A;  1KQ0 A;  1ZHF A;  1Z9C A;  4M9Z A;  3TOB A;  4HZF A;  3KP5 A;  3F23 A;  1W7P D;  3FMS A;  1FBS A;  3NEU A;  2HQN A;  3FM3 A;  2XRO A;  4K2E A;  2GAU A;  2YPR A;  2E1C A;  2W57 A;  1KU9 A;  4A0Y A;  4XSX F;  4WX9 A;  2XUB A;  3R6S A;  3Q9V A;  4YG2 F;  1SMY F;  3LST A;  2DFI A;  3KLN A;  2ETH A;  1FZP B;  1V3F A;  1MD0 A;  1TTY A;  2XAH A;  5L3F A;  3BPV A;  1AWC A;  2DK5 A;  4MHG A;  3RPU A;  4R79 A;  3MZH A;  3WTW C;  2A69 F;  2FXA A;  3FMR A;  2FA5 A;  1IN6 A;  4NHJ A;  2Q0O A;  1BI3 A;  4HX4 A;  3KLO A;  2OZU A;  3QRF F;  1OYI A;  3CTA A;  2LF8 A;  3WG9 A;  4ENJ A;  4CHU A;  1JGS A;  4ZYH A;  1SD6 A;  2VXZ A;  2QQ9 A;  5BQT A;  2ZNY A;  4N9I A;  2FE3 A;  3FZV A;  5DCF A;  4MEY F;  4BHP A;  2JPC A;  2DI3 A;  3KE2 A;  3LA2 A;  2F5C A;  1YQA A;  3EYI A;  1B59 A;  1R5G A;  2NNN A;  1U8R A;  4CGZ A;  5JFR A;  2UZK A;  4Z2Y A;  5ICG A;  2MLG A;  2OZ6 A;  3GUD A;  3O6B B;  1SMT A;  4XLP F;  3L00 A;  1G3W A;  2VOO A;  5DCM B;  4LK1 F;  3O2P E;  4ZYD A;  3MZY A;  2XRN A;  3L2C A;  1K6O A;  3V8K A;  3W6J B;  2XV4 S;  5HLG A;  3EQL F;  4LK0 F;  5H6R A;  3N97 A;  2ZME A;  2QLZ A;  1J5Y A;  3CUQ C;  4YIF A;  1BM9 A;  4OIR F;  3MAJ A;  2W25 A;  3MFK A;  3ROU A;  5AIQ A;  5CVU A;  5FO5 A;  3W6K B;  2FF4 A;  3ULQ B;  3GFL A;  3ZQ7 A;  1R23 A;  3LQQ A;  1E2X A;  1J2X A;  2Q8K A;  5HDK A;  4JBA A;  2IA2 A;  4FT8 A;  2QBY A;  3TO7 A;  3CJN A;  3FWE A;  3IC7 A;  2Q2E A;  1U5T B;  4HOB A;  1EH8 A;  1ON1 A;  5ILS A;  5LGU A;  3SZP A;  1SD7 A;  1GVJ A;  4PGH A;  4I01 A;  3WGI A;  2CFX A;  4R8H A;  3H92 A;  2JZY A;  1ON2 A;  1T98 A;  1LNW A;  1P4X A;  2PI0 A;  3I71 A;  2TDX A;  5CJ9 A;  3LWF A;  3HRM A;  5FD6 A;  1YW9 A;  1R36 A;  2HYG D;  3DEU A;  5F6F A;  1W5S A;  4MEX F;  1FYM A;  3WTT C;  4HF1 A;  5BS6 A;  5LEJ A;  3VFZ A;  2JT1 A;  2M8E A;  3HSF A;  2VOD A;  5FFX A;  1EH6 A;  4Q5S F;  4QWQ A;  3G3Z A;  4A12 A;  5EEG A;  4DNC A;  2ESN A;  1F1Z A;  2BE5 F;  2G7H A;  2ZCW A;  4FHT A;  1ZG5 A;  3CLO A;  2O8X A;  2PMU A;  4BHC A;  3MEX A;  5ICE A;  4M71 A;  2ZNZ A;  4LFU A;  2QYO A;  3K2Z A;  1YYV A;  2B0L A;  2EV0 A;  3I4P A;  1TQI A;  4LG0 B;  3H3Z A;  1OR7 A;  1LEB A;  5E18 F;  5D4R A;  4HDU A;  4M6X A;  1D3Y A;  1XB4 A;  3G73 A;  1L3L A;  4BYY A;  1IZ1 A;  2ZO4 A;  5K5R A;  2X4H A;  4A6D A;  3C1D A;  4B09 A;  5LHH A;  1CGP A;  4KNY A;  1TW2 A;  1ZRC A;  1O3Q A;  2VE8 A;  1RIO H;  2IA1 A;  2H09 A;  3ZMZ A;  4HBL A;  1P2F A;  3BY6 A;  4HF0 A;  2EK5 A;  1BOA A;  2DW4 A;  1W4M A;  3QP6 A;  4LG0 A;  3DKW A;  1YIO A;  3RI4 A;  2PMH A;  4A5N A;  5FGM A;  2VC0 A;  3Q9S A;  1PP8 F;  4KIC A;  1YTY A;  4QLC U;  2VBZ A;  2VT2 A;  1ZYR F;  2DPD A;  3P7N A;  1BI0 A;  3QP5 A;  3TGN A;  1FYL A;  4G7H F;  4L5J A;  4EJV A;  3ZPL A;  2Z33 A;  1G3Y A;  1SFU A;  4IRI A;  1LVA A;  3CUO A;  2HFH A;  5A2Q Z; 
#chains in the Genus database with same CATH topology
 4JOM A;  2D1V A;  5IPA A;  3VB2 A;  1OFC X;  3RPU D;  3K70 D;  2F48 A;  4G6D A;  5D5U B;  3J7Y J;  2OTJ I;  1DPU A;  2LF7 A;  3DKY A;  3DU5 A;  4UB6 C;  4UVC A;  1UHW A;  2MH9 A;  2EWN A;  2OD5 A;  5D6E A;  4XL9 A;  5KCM A;  3S2W A;  1B4A A;  2FBI A;  1V4R A;  2D5V A;  3SHF A;  3I53 A;  4YFK F;  3MWM A;  1G4D A;  3CDI A;  2L4A A;  3C3W A;  2ID6 A;  1GLN A;  3HJE A;  5HS8 A;  3JTG A;  2IS6 A;  2XGE A;  3V7R A;  1S7O A;  1QQI A;  3PNY A;  3HIF A;  4PK4 A;  3BR0 A;  1JT6 A;  1C0W A;  2EFO A;  1U5T A;  2KKO A;  3K4B A;  1UG0 A;  3PO2 J;  4EVI A;  5BNG A;  1KA8 A;  3I9V 2;  4L9T A;  2BW3 B;  1XPX A;  3TP0 A;  1GXQ A;  3HOU J;  1HW1 A;  3GTK J;  5EZG A;  4I0B A;  3KP4 A;  4MIM A;  4BQO A;  1XN7 A;  4OIO F;  1FBU A;  4IHV A;  2DMP A;  1O7L A;  3K1P A;  5K5Q A;  3H9G A;  2O8K A;  2EFP A;  1HSJ A;  4CIC A;  3RCO A;  3AAF A;  2KRC A;  2JA2 A;  5B5E C;  2GA1 A;  2HQA A;  2KIU A;  4MLO A;  1V54 H;  4GFB A;  5K7F A;  1WI9 A;  3FDY A;  3HRS A;  5DV5 A;  2QKM B;  1X1D A;  2IBD A;  2Y75 A;  1ZR2 A;  2HVR A;  1K79 A;  3JTH A;  2VIX A;  3NRV A;  3Q0U A;  1VQM I;  5B3S H;  3J81 Z;  3CCJ I;  2RGV A;  4HNU A;  5F04 A;  3OYJ A;  4IHS A;  3EDP A;  4KUM A;  2LKX A;  1I5Z A;  5L3G A;  5CQE A;  3L9F A;  1QHG A;  2IA0 A;  2KIQ A;  2ZXH A;  4N4O B;  2X85 A;  3FF5 A;  3F22 A;  3WG7 H;  3PIO F;  1BBY A;  4M6Y A;  3K0L A;  1PUF A;  2K7L A;  1IC8 A;  2V6C A;  1MGT A;  4XOT A;  4KDP A;  1LDD A;  4L9N A;  3BR2 A;  2V1U A;  2AO9 A;  4BH9 A;  4G7Z F;  4I76 A;  1VFC A;  4CA0 A;  2DQL A;  4XOR A;  1XGS A;  5J4V A;  5EG0 B;  2QWW A;  1DP7 P;  1TQM A;  3PUB A;  4HST A;  2ZJR F;  1V55 H;  2QKL B;  4EGY A;  4GXO A;  1WWX A;  2F5E A;  1BR1 A;  1OKR A;  3O8H A;  3H35 A;  2K9N A;  1R1V A;  3BJO A;  4ZYE A;  5KAF C;  1NK3 P;  1A35 A;  1FWZ A;  2JQ7 A;  5FD5 A;  4IQ4 A;  3EYY A;  4FCY A;  3F8F A;  4M3G A;  2VBW A;  4PZJ A;  3JRH A;  1QA6 A;  2R7T A;  3KYC B;  5L3E A;  5EF6 A;  2LLK A;  4S0H B;  1Z05 A;  5E3O A;  3IV5 A;  4AU7 A;  3B73 A;  2CW7 A;  5E1X A;  3WTV C;  2L7M P;  4UB8 C;  3CMM A;  1ITY A;  3DU6 A;  5HLH A;  4ZZL A;  4WXC A;  2YUS A;  4OOI A;  1QGP A;  2XSD C;  2HOS A;  1JTX A;  2PBI A;  3H3V K;  5IYC J;  4IKF A;  2TCT A;  2EJR A;  1FSH A;  2KDZ A;  1UMQ A;  5CVR A;  2VPL A;  1EV7 A;  5GP9 A;  4HRI A;  3QPH A;  4MTD A;  1FC3 A;  3ZOB A;  4D7M A;  1YX5 A;  2F2E A;  1KQ8 A;  1FOK A;  1XGO A;  4ASN A;  2M4G A;  4AYB A;  2RVC A;  4HLY A;  1MSE C;  3M4O J;  4I6Z A;  1GT0 C;  3WTS C;  1N25 A;  1ACI A;  2MA3 A;  1ZG1 A;  2BYV E;  5F27 A;  3L1P A;  2G7U A;  1Z77 A;  2R7R A;  3H9Q A;  1H9G A;  4I02 A;  1QZZ A;  1RPW A;  2CMP A;  4PFO A;  4XKB A;  3ONQ A;  4Y7N J;  1HW2 A;  4BBR J;  5D5V B;  3DV8 A;  3WE3 A;  4IEJ A;  2F4M B;  3ZQH A;  3WTU C;  1XGM A;  3TBI A;  3ZMS A;  1H88 C;  1YLF A;  2BV6 A;  3VYS B;  2DJN A;  4KA4 A;  1S3J A;  4E7I A;  4KT5 C;  1G59 A;  4UVB A;  3TO6 A;  4X1E A;  2VJI A;  2H27 A;  3ZR8 X;  2CG4 A;  4G8X A;  5FLX K;  3DP7 A;  1XCV A;  1XD7 A;  4Q47 A;  3HPG A;  1P4W A;  1FP2 A;  3KEO A;  2L9R A;  2E7X A;  4EV0 A;  1TC3 C;  4YII A;  1ETQ A;  3ML6 A;  3L2U A;  1I27 A;  1QVU A;  3QWL A;  1HBX G;  4A0Z A;  4M72 A;  5F08 A;  4L9V A;  2DBB A;  4PJL A;  5B66 C;  2VBX A;  2M0C A;  1WI3 A;  1DUX C;  2XF5 A;  1WQ2 A;  4AIH A;  1IRX A;  1T39 A;  4ABZ A;  2WAD A;  1G3T A;  1USS A;  2P5K A;  1HQC A;  5FKO A;  1ZAR A;  2V1D A;  2J5P A;  1UG2 A;  2IT0 A;  1B8I A;  1R71 A;  2L9V A;  3LSP A;  3OOP A;  4WK8 F;  3ZMT A;  5ICC A;  5IY5 H;  2QZ8 A;  2IGO A;  3JRF A;  2R7O A;  1MMN A;  2DPU A;  2VPR A;  2VLA A;  2L02 A;  3F9K A;  3LFK A;  1YW7 A;  1U2W A;  4EQQ A;  3ASO H;  3S17 J;  4XRM A;  5F64 A;  5IYD J;  4BE2 A;  3BR3 A;  2K40 A;  5CYV A;  3BTC A;  4U87 A;  1D5V A;  4XON A;  3MMY B;  2IS2 A;  4GYI A;  2DAO A;  3KP7 A;  3QU6 A;  2EIK H;  4CZC A;  2P81 A;  2CH0 A;  1Y0U A;  1Y0N A;  4HX7 A;  3I58 A;  3M9A A;  3KZI C;  3RYP A;  2DTR A;  5CPR B;  1I1G A;  1DQU A;  3QPL A;  3OR1 C;  2ZME C;  4KFC A;  2OU2 A;  2O5R A;  5HNH A;  3HSR A;  3I3L A;  4N9H A;  2D1H A;  5E1W A;  1WJA A;  1E3O C;  2V1N A;  2RKH A;  2XKO A;  2YX7 A;  5DTD A;  1KU7 A;  3QOE A;  2WTE A;  2I5U A;  2KJC A;  3BJ6 A;  3BOQ A;  5FKM A;  3VEP A;  5EGO B;  5FLV A;  4DJA A;  2NS7 A;  3D5S C;  1B6A A;  5HOD A;  3HG9 A;  4BQQ A;  4KIF A;  2OA4 A;  1PP7 U;  5KVR A;  3K69 A;  3D5R C;  2VC1 A;  3WU0 A;  1ZLJ A;  3BG9 A;  1HKS A;  4Y13 A;  1IXR C;  3T0Y A;  2XAS A;  4BEH A;  4ZH4 F;  4BQA A;  2PFB A;  2LK2 A;  4RM3 A;  2CFO A;  3FM5 A;  3E5X A;  2LNB A;  5JHF A;  2JRM A;  4J01 A;  4XRS G;  1DGR M;  2Y69 H;  1DU6 A;  5LHG A;  1VQO I;  2X1E A;  2HYF A;  2HQR A;  2VN2 A;  4LB6 B;  2XVC A;  5DDG A;  4NNJ A;  3J7A O;  3K4N A;  1B72 B;  4LLL A;  3KET A;  2CV0 A;  4KYW A;  2YU3 A;  4P55 A;  2DDB A;  2RAE A;  1RRJ A;  2LG4 A;  1QPM A;  1FOY A;  1FTT A;  1SFX A;  5D5X B;  4A6E A;  3CMA I;  5E1Z B;  1ZRD A;  4AC0 A;  3WGG A;  4AVP A;  5AON A;  1X3W B;  2Y30 A;  5FJ8 J;  4CCM A;  3JRC A;  1OJL A;  4TV7 A;  1O3R A;  1ORK A;  2BEO A;  1MJA A;  4F93 B;  4C3H J;  4IO9 F;  3JSO A;  4EMS A;  1EA3 A;  3K70 C;  1WJB A;  3HKZ N;  4EJO A;  1IXC A;  3ERE D;  1MNE A;  1W36 C;  3TQN A;  2V9P A;  3QPT A;  2DOD A;  2WB1 N;  3CDL A;  3HRT A;  2PX9 A;  3JW4 A;  3KZZ A;  2JSC A;  3IWF A;  1HOM A;  3EET A;  1GXP A;  1SD4 A;  1TP4 A;  4IOA F;  2QEX I;  1Z1D A;  3ISP A;  3KP3 A;  3ZN0 A;  1F43 A;  5M5W J;  2WAQ N;  1OCR H;  3LA3 A;  1MSF C;  2CJJ A;  3CF2 A;  1WPK A;  4I2O A;  2QA4 I;  3MCZ A;  1BI1 A;  4A3D J;  4UHT A;  1U0J A;  3IRQ A;  3P5J A;  3HTS B;  4Y4R A;  4DIQ A;  3ESW B;  1OCC H;  2B7E A;  2QEN A;  5ED4 A;  3RQI A;  4MQV A;  2VE9 A;  1VQ4 I;  2P5V A;  3CMY A;  4FQG A;  2P7V B;  4D5F A;  4P1W A;  2R3S A;  3L09 A;  4U7D A;  1RUO A;  3OS1 A;  3F0C A;  4FX4 A;  3HTU A;  1HKQ A;  4UUT A;  4A5M A;  4NDL A;  3HHH A;  1RZ4 A;  5GPA A;  1B9M A;  1I1S A;  3FXQ A;  3F8B A;  1QZY A;  2W48 A;  3ZQL A;  2L5Q A;  2E35 A;  3PQJ A;  2GZW A;  2XB0 X;  2VKH A;  1HLV A;  4E70 A;  1RKT A;  4IF4 A;  5HS9 A;  1SVM A;  2MBF A;  4XBF A;  2O61 A;  5TJJ A;  4GDF A;  3BQY A;  3OSF A;  2ME0 A;  1CQT A;  3PL8 A;  1OCP A;  1D5Y A;  2M4K A;  4B47 A;  3R0A A;  4P96 A;  1J0R A;  1IGN A;  2WV1 A;  4A3B J;  3K9T A;  1Y1W J;  1CF7 B;  5J6X A;  1TT5 B;  3GYH X;  1IRZ A;  4A3C J;  1Z6R A;  4OWR B;  5J1R A;  1LJ9 A;  4PJJ A;  1O57 A;  2H6C A;  2EZH A;  3CDH A;  2DA5 A;  4IHW A;  4XOP A;  2LC2 A;  3A0B C;  2HKX A;  2Z9O A;  3FKI J;  2ME6 A;  4W97 A;  3EPZ A;  3DQV C;  1RES A;  2ID3 A;  4O6J A;  2DK8 A;  3S32 A;  3I0T A;  3W2W A;  1XTA A;  3FHZ A;  3N4M A;  1O3T A;  2LRD A;  2XHK A;  3CCS I;  1NH3 A;  1ZGW A;  2JN6 A;  2UUZ A;  1T33 A;  5GAG J;  2EA4 A;  1YFH A;  4UUS A;  1OR7 C;  3SZT A;  2W00 A;  3QYF A;  2Y0M A;  2EZI A;  4U0V A;  4B43 A;  4NQW A;  4ETS A;  5J3L A;  4Y33 A;  3B02 A;  4EM0 B;  3CC2 I;  4Y15 A;  4Y52 J;  1FLI A;  1F5T A;  3AL0 B;  2BXZ A;  2ZSH B;  3OYN A;  2NVX J;  4L0Z B;  5M5Y J;  1HXD A;  2IRF G;  2OQG A;  1MBH A;  2EQR A;  5EDN A;  2PMZ N;  1MBK A;  1SVO A;  3K4J A;  2VUM J;  2PQ8 A;  2L2O A;  5F1R A;  3E97 A;  2XAQ A;  2GXB A;  2F5F A;  1A6I A;  2R7X A;  2XDV A;  3HXL A;  2OV7 A;  2OC6 A;  3L2W A;  2K9Q A;  3R0J A;  2NRA C;  2K4B A;  2UWM A;  1G3S A;  1ZN2 A;  2LFB A;  3PQK A;  1WZ2 A;  1BIA A;  4CO8 A;  1JKP C;  2Z2S B;  2STW A;  3U2R A;  2V6E A;  2V9K A;  2DTZ A;  3CCV I;  2JA6 J;  2MSY A;  4N4N B;  1FJL A;  3KEQ A;  2CGP A;  2BXY A;  3E1S A;  2ECB A;  4IVN A;  2ISY A;  1XMK A;  1R1T A;  1MDM B;  2H1L A;  2NOJ B;  5LHI A;  1UFM A;  1I6H J;  3ECO A;  4MGR A;  4A0X A;  4M3D A;  3CJQ B;  2VJ4 A;  1TBX A;  2CS3 A;  5H2F C;  1VF9 A;  1HDD C;  2OUM A;  5LLQ A;  1NHA A;  2KIF A;  3GX4 X;  1U5T C;  2GXG A;  5FKL A;  1YS6 A;  3SXY A;  3J7Z I;  2ZKZ A;  1YI2 I;  2P6S A;  1ETX A;  3A4C A;  2ZJ2 A;  1JUS A;  2OTL I;  5L3C A;  2CQX A;  1LPQ A;  5J40 A;  4DZJ A;  3A2K A;  4HDV A;  4DYR A;  3F8C A;  3QYE A;  5D5W B;  1S7A A;  2Y9Z A;  2DLL A;  3FXM A;  2OBP A;  4S05 A;  4U88 A;  2GOX B;  3G71 I;  1Z91 A;  1R22 A;  2VQH A;  2ELH A;  1O3S A;  1K78 A;  4A3J J;  3OWT A;  3H5R A;  2XGD A;  1FMV A;  4FAS D;  2BY2 A;  3ERM A;  4HNV A;  4O3M A;  1MMA A;  3HOW J;  4LLG F;  4XN3 A;  2ECC A;  5DUK A;  3DF8 A;  1SVL A;  2MC3 A;  4PJ0 C;  2WY7 Q;  2R7V A;  2QF7 A;  3NAR A;  4OAY A;  4RB1 A;  2ZME B;  2HR3 A;  2HZD A;  1T2K A;  1TWA J;  1JI8 A;  4KN4 X;  2LSO A;  2OCC H;  4XKC A;  3BG7 A;  3QYB A;  1GV2 A;  2P5L C;  1RI7 A;  4P9F A;  3F72 A;  2CO5 A;  2K02 A;  3HRU A;  3LSK A;  3Q3S A;  5ICF A;  4I0A A;  3RTR A;  3BZK A;  5ILU A;  1HW5 A;  2FUG 2;  3MKW B;  1UHM A;  2V9V A;  5LRR A;  3WGH A;  2HTJ A;  4LB5 A;  1MMG A;  4L18 B;  2CYY A;  2E1M B;  4E7Z A;  3VOE A;  2GWR A;  3CZ6 A;  5IT9 K;  2W7N A;  1A31 A;  3OYC A;  3U9G A;  3COA C;  1WGX A;  3FXJ A;  3HGG A;  2I8D A;  4RGS A;  2A07 F;  1P6R A;  3E6M A;  1DGW Y;  1HST A;  4JP0 A;  1J59 A;  1P7J A;  4PCQ A;  1BN5 A;  1TWC J;  4ESJ A;  3KIO A;  1PJR A;  4MQ9 F;  5M5X J;  4P9U A;  1UCR A;  1R00 A;  4PSX A;  4F52 A;  1MDM A;  2L4M A;  1BL0 A;  3TO9 A;  1WVR A;  3L2R A;  2QM3 A;  2W82 A;  2E2I J;  2PJP A;  4AUX A;  2Y2Z A;  3F3X A;  3GTJ J;  4ZTF A;  3JRG A;  2EIL H;  1IRF A;  3OYA A;  2O6G E;  3LSJ A;  2KL4 A;  2LD5 A;  1UZC A;  4NBQ A;  1S72 I;  2IGM A;  4EAT A;  3IAS 2;  1LQ1 A;  1HC8 A;  1CF7 A;  3QOD A;  4KT6 A;  3Q0V A;  5L3B A;  3F6O A;  3T5X A;  3AG4 H;  4WCG A;  1B9N A;  2GM4 A;  1XDS A;  1R5I D;  5DM6 F;  1BI2 A;  2GQQ A;  2MG4 A;  2P0W A;  2V1X A;  4A3L J;  2M7B A;  2R93 J;  3A01 B;  3CUQ B;  3DPU A;  2IEK A;  4JK1 X;  2PLY A;  1OMI A;  2HI3 A;  3F6V A;  1ZRE A;  5JHU A;  2QSH X;  1UB9 A;  2AQF A;  1KQ9 A;  5K7H A;  1BR4 A;  1FY7 A;  3JRD A;  3OSG A;  3BPX A;  1W0U A;  3GTL J;  1IUF A;  4L9J A;  3WHB A;  1P4A A;  1W0T A;  1X1B A;  2XB5 A;  4OIP F;  4BBS J;  3IKV A;  2E60 A;  4HSR A;  2Z99 A;  2P8T A;  5CKT A;  2L7Z A;  2G9W A;  2OCE A;  4P5O A;  3OYH A;  2R0Q C;  3AFH A;  2VAS A;  1TL8 A;  4PDK A;  5EG0 A;  1K83 J;  4IRH A;  2LOO A;  5DUI A;  4UUV A;  3F21 A;  4HAM A;  2DA3 A;  2DYR H;  4CYC B;  3PIP F;  3S2D J;  4AID A;  2E7W A;  1IUY A;  1ZEL A;  1JHF A;  1W7P B;  2ADU A;  4PFP A;  2KDO A;  2K9L A;  4HLX A;  1ENH A;  3H5A A;  2EFQ A;  3C18 A;  5ILV A;  3HGY A;  1MBG A;  3H0D A;  3DLA A;  4RB2 C;  2CQN A;  1T0F A;  4LIU A;  1IAW A;  3FMQ A;  5DEQ A;  4KIG A;  3MZ8 A;  4QIW N;  5JR3 A;  2UV1 A;  2EA2 A;  2R7D A;  1QRY A;  2VQL A;  3CLQ A;  4RAG A;  1QVT A;  1S9H A;  5GAH J;  3DXJ F;  1DDN A;  1YIT I;  3HM5 A;  3S16 J;  3QU3 A;  2RQP A;  1DP3 A;  4CXF A;  5BOX A;  1VQL I;  1I50 J;  1MKM A;  1X58 A;  5CLS A;  5E8I A;  1QU3 A;  1IN5 A;  4L5I A;  1Q1H A;  4IPA A;  1G6N A;  3DTK A;  1U3E M;  2LDU A;  2M0M A;  3VDX A;  4DYC A;  4BHB A;  4JYK A;  2M87 A;  4GGG A;  1FYK A;  1HDP A;  1BC8 C;  5E20 A;  5LRS A;  2M2E A;  1TW3 A;  1X1P A;  1F4K A;  2QCO A;  2LY9 A;  3FBI B;  3TKY A;  4D9J A;  4F92 B;  1T08 B;  4YEL A;  3M7G A;  3HOX J;  3RQ4 A;  1K4S A;  4BGD A;  2J5O A;  2EB7 A;  2JWT A;  2MYS A;  1SD5 A;  1XDU A;  3I5U A;  4KJZ A;  4RLF A;  2VQG A;  2AS5 F;  1YJW I;  4HQM A;  4IL6 C;  2HOT A;  1BC7 C;  2IGK A;  4XLH A;  3FK7 A;  2L9N A;  3TOA A;  4V2F A;  4QPO A;  3T8R A;  2XC7 A;  1W7P A;  3H5N A;  1WJD A;  1K6Y A;  4G6Q A;  4BAY A;  2DMN A;  1BJA A;  2HXO A;  2Q1Z B;  4XNF A;  2O3F A;  2FSW A;  4JX6 A;  2GXA A;  4R1H A;  4NQW B;  2M3A A;  4U0Y A;  3O3K A;  2MD5 A;  3J80 K;  1YE9 A;  2ZFW A;  2LP0 A;  1B1B A;  3GXO A;  5FFZ A;  2ACJ A;  1Z6T A;  2M8G X;  3FXO A;  4A3M J;  2D45 A;  2XGC A;  4II2 A;  1GVD A;  2UXX A;  2YU9 J;  5FRM A;  2HPM A;  1OPC A;  2ICW G;  1QNT A;  3ZN1 A;  2RC4 A;  2DXI A;  3S3M A;  2NAZ A;  3RIR A;  1JT0 A;  4GRI A;  4WF2 A;  3LNQ A;  3KFW X;  4A69 C;  3WTX C;  1W1W E;  5KAI C;  3DPL C;  5FLX Z;  3V7C A;  2VJJ A;  4RAZ A;  1D8K A;  1TT0 A;  2FJ1 A;  1IJW C;  1IDY A;  4F3Q A;  2L3D A;  4I7H A;  4BJ5 C;  3IH2 A;  1JUP A;  3S1Q J;  3HYI A;  5DYM A;  4RGR A;  4JX4 A;  2WB1 A;  3W2V A;  4CCN A;  2VBY A;  3GWZ A;  3BR5 A;  5J8F A;  3SEZ A;  2R5Y A;  1LDJ A;  2IPQ X;  3CCU I;  3TMO A;  1I39 A;  3BWG A;  3E6D A;  3V4G A;  1Y56 A;  1ETY A;  2KJB A;  3E7L A;  4ZZD A;  3P9K A;  4Z6Y A;  1Y6I A;  4HW0 A;  2KRF A;  1IXS B;  2R7Q A;  2Y0S A;  1XX5 A;  4DW6 A;  2QVO A;  4OU0 A;  1EKE A;  3BG3 A;  1JKQ C;  1KU2 A;  2PG4 A;  1Z67 A;  3HZJ A;  4M74 A;  3VOD A;  1VQ7 I;  2C6Y A;  3SQN A;  2MW8 A;  4B3A A;  1X19 A;  2K86 A;  3T1B A;  4RGU A;  3ZMV A;  2VT3 A;  3SZG A;  3WE2 A;  1BW6 A;  3ABU A;  4XMY A;  3ZXS A;  1JE8 A;  1EH7 A;  4A3G J;  1U78 A;  2A5Y B;  1RR8 C;  3HC7 A;  3CP2 A;  2FBH A;  2LR8 A;  4IQJ A;  4M3F A;  3ASN H;  3EUK L;  1BR2 A;  3N05 A;  5L3D A;  5BPI A;  3F8M A;  5C4X J;  3ZQF A;  2WWY A;  1YIJ I;  4B48 A;  1OQY A;  4I98 B;  1T38 A;  1VQ5 I;  2CV1 A;  4E6K G;  4BNC A;  3ZCO A;  1T6S A;  4ZC3 A;  4S04 A;  4HNT A;  4IX7 A;  4C9Y A;  1E17 A;  1WJE A;  3MKL A;  5LGN A;  1ZLK A;  2HDD A;  1ZGA A;  2CRG A;  2GA2 A;  3RZO J;  5JVT A;  2XAF A;  1LB2 A;  4HQE A;  2VKE A;  5DS9 A;  1IV6 A;  2OQR A;  4HPQ A;  4HX8 A;  1PUE E;  3JAM Z;  5LD2 C;  2R7W A;  3KCC A;  2QUF A;  2A68 F;  5GAE J;  2HEO A;  1Z3X A;  3IH3 A;  3U1K A;  2LVS A;  4B1R A;  4OIN F;  2IGN A;  2X6Y A;  3BTL A;  3HB9 A;  2XRL A;  4KIB A;  3TW6 A;  4I09 A;  1MH3 A;  3SYT A;  3M1C A;  3CP8 A;  5LEK A;  4C3J J;  1IF1 A;  1KON A;  4M73 A;  3HOT A;  4IJA A;  4AYB N;  3BDD A;  3CJT B;  4W1U A;  2IVM A;  3GF2 A;  1LDK B;  2FQ3 A;  2W4S A;  4CUG A;  1X4P A;  5F0F A;  3UNG C;  3S14 J;  1HKT A;  4QTR A;  3I59 A;  3TW7 A;  4HF2 A;  5C4J J;  1ZG3 A;  2HGC A;  1YRN A;  2AQE A;  1B72 A;  1SFE A;  2YX4 A;  3OIP A;  4UUS B;  3AL0 C;  2QBY B;  4RS8 A;  1FP1 D;  1ZGJ A;  1MJ9 A;  4AVZ A;  2KPM A;  2H8W A;  5EEH A;  1B8I B;  1RR7 A;  3OYK A;  1SC7 A;  2ESH A;  4H0E A;  4UV9 A;  4XID A;  4RB3 C;  5FB2 A;  3F8N A;  3DEE A;  1U9N A;  1VQP I;  2NVY J;  2K5C A;  5CVI A;  2A6E F;  5EGO A;  3RDI A;  4QSH A;  2VL8 A;  3G1L A;  3LA7 A;  3MVP A;  4GCV A;  3VYT B;  2O03 A;  1D1C A;  2FEZ A;  1J09 A;  4HV6 A;  3WTZ A;  2PN6 A;  2JUG A;  2W84 A;  1WKM A;  2JA7 J;  4LLN A;  1YO5 C;  1R7J A;  2D2W A;  2Y48 A;  2JSP A;  4EGZ A;  4XLE A;  1NTC A;  1POG A;  1ZR4 A;  1R6R A;  2ZSI B;  2HXI A;  3BLY A;  4HG2 A;  2QGU A;  1MNM C;  4A93 J;  3DLL F;  1L0O C;  1K78 B;  5A2Q K;  3FXL A;  3TDU C;  1VND A;  4EM1 A;  2W85 A;  2BHZ A;  3BCB A;  3FXR A;  1ETW A;  2N8G A;  2DOA A;  2JUC A;  2HS5 A;  1MND A;  2W24 A;  5E3L A;  2CUF A;  2BY1 A;  2KRH A;  1KU3 A;  3I54 A;  3I64 A;  4NB5 A;  1REP C;  3OYB A;  3K4C A;  1FOX A;  3W2A A;  1LUJ B;  1GHC A;  5E3N A;  1XSD A;  1WJ5 A;  2OAZ A;  4MO7 A;  3M07 A;  4JQF A;  1ZKG A;  2CWE A;  5GTH C;  2H8R A;  2XIG A;  3PNT A;  2X9D A;  1S29 A;  4FX0 A;  2M30 A;  3PFY A;  1XGN A;  1ZRF A;  2L7F P;  4V19 K;  4XN0 A;  1YW8 A;  3D5L A;  5TIS C;  2Z5U A;  3NQO A;  4ESF A;  4ESB A;  2RV8 A;  4CCJ A;  2FOK A;  3M1E A;  1D0X A;  5IOZ A;  1O7F A;  2A3S A;  3RZD J;  3K4M A;  2R7S A;  4UV8 A;  1ONV A;  1R58 A;  2DA4 A;  4AD9 A;  3BQZ A;  3Q5F A;  1J9I A;  4MFD A;  1S6L A;  4Q48 A;  3IUO A;  3IHU A;  4Y17 A;  2YR2 A;  3IKT A;  3K1N A;  5BMZ A;  3GTO J;  1ETO A;  1R5H A;  2Z16 A;  3T8T A;  5J1Y A;  3PNV A;  3S1M J;  2CUE A;  2Z3Y A;  2AXL A;  3R4K A;  1MIJ A;  1V5F A;  4KIS A;  2JMW A;  3R60 A;  4BU2 A;  1FSE A;  3IRR A;  2E1O A;  2OF7 A;  5DD8 A;  3GLL A;  3RKY A;  4DZP A;  4PSW A;  3L2Q A;  1WRJ A;  2IP2 A;  4O5V A;  3GEZ A;  3M3Y J;  2DCE A;  3GFM A;  3BP8 A;  1IRG A;  2RN7 A;  2DMQ A;  2X0L A;  5FRO A;  2ISZ A;  1LFP A;  3HHG A;  2XAU A;  2ELJ A;  3CO7 C;  2JTV A;  2EFW A;  3A0H C;  3K2A A;  2NS8 A;  3JRI A;  1TWH J;  3G6E I;  3UR3 C;  1T0F C;  5FKN A;  3V8L A;  3FBN B;  2DT7 B;  1PVE A;  2NOG A;  3ABT A;  4XR6 A;  5H6Q A;  2NNY A;  3I4M J;  5FLM J;  4A2U A;  5D6F A;  3JRB A;  2KIM A;  3ABM H;  2A6T A;  4RBO A;  1X1A A;  2L0K A;  2JA5 J;  2QQA A;  4C2U A;  3J80 Z;  2FRH A;  2X6W A;  4GYG A;  1A04 A;  3GBG A;  2YS9 A;  1QHH D;  2E1M C;  1F9N A;  3M8E A;  3J7A Y;  3OYI A;  3I56 I;  2HDC A;  1X3Z B;  3SFZ A;  3WTY C;  3GVA A;  1FEX A;  3OR2 C;  2E1N A;  4XLF A;  5FKK A;  1YG2 A;  3RPQ A;  2RDP A;  3NWS A;  5K5O A;  2OPT A;  4L0Y B;  4U0W A;  1D8J A;  5EZH A;  1X4O A;  2FOW A;  1GUU A;  2XGX A;  1I6X A;  3GME A;  3GZ6 A;  2GLO A;  1JKR C;  4D5C A;  4YFX F;  2M1B A;  3CJR B;  3CUQ A;  1T56 A;  3C7J A;  3CCE I;  4IOC F;  2BVM A;  3ECH A;  2DDA A;  2IW5 A;  3V7S A;  4BDZ A;  3B6A A;  3RKW A;  3TDZ C;  1ZK8 A;  3DBH B;  3G1O A;  3HL2 A;  4UNO A;  3KZY A;  5JLW A;  1ETK A;  3OYG A;  2A6H F;  3BTJ A;  1R1U A;  1H0M A;  3GLX A;  2GIV A;  4J19 A;  1R4M B;  2R7Z J;  2FMY A;  2X48 A;  2XAG A;  3H0G J;  5DCM A;  1R9T J;  4G7O F;  2HKO A;  2EIN H;  2QSF X;  1OYW A;  4CYD A;  2XPU A;  3AG3 H;  4CSW A;  5C44 J;  5HNF A;  3JAM K;  2BGC A;  5JLX A;  2LYC A;  3LOC A;  1FNN A;  4YFN F;  1H9T A;  1XMX A;  3MQ0 A;  5IP9 J;  2ZJQ F;  4KIT B;  2VB6 A;  2ZXJ A;  2BZT A;  1Y39 A;  2Y31 A;  2NS0 A;  4LGW A;  3HSE A;  4CZZ A;  2FU4 A;  4U7B A;  2F5D A;  3BG6 A;  1W36 D;  2FNP A;  2WY8 Q;  4WXH A;  4D0P A;  4DGW B;  2VOP A;  2F5V A;  3KPH A;  1P7I A;  1XC5 A;  4ENM A;  2CQK A;  2VKD A;  2A61 A;  3HEF A;  4E7K A;  2DQR A;  2EV5 A;  2R7F A;  3ELK A;  2LY2 A;  2NVQ J;  3BZC A;  2XKP A;  3I4N J;  2R92 J;  2K3F A;  1SEU A;  3CQZ J;  1LE8 B;  4CCK A;  4LMY A;  2L54 A;  3LSG A;  1HCR A;  5CVV A;  3RJP A;  2O9L A;  3L7W A;  3OL4 A;  2PEX A;  2RNG A;  3E5U A;  1MMD A;  1SAU A;  3M8J A;  1U6G A;  3DWL E;  5D4S A;  1XS9 A;  2DN0 A;  4HEA 2;  2MFZ A;  4BQN A;  2O0Y A;  2LBF B;  5LGT A;  2HOA A;  3M8F A;  4WXD A;  4AWX B;  3KP6 A;  2Y0S N;  3OYF A;  1U9O A;  4RGX A;  2JRT A;  2L01 A;  2EIM H;  1STZ A;  4XRF A;  2GOM A;  1HF0 A;  1BIB A;  1T95 A;  1TLH B;  5IT3 A;  4PJN A;  3CME I;  1MZB A;  1V5G A;  2QSG X;  4M9X A;  2HZT A;  4CYC A;  2HTS A;  3OOU A;  4BKX A;  4DBR A;  4KMF A;  1SFK A;  2H6B A;  1FT9 A;  3QAH A;  2BVL A;  1JTY A;  2MC4 A;  6PAX A;  4BE0 A;  4G12 A;  1R49 A;  2X6X A;  2STT A;  3HUG B;  4DQ2 A;  2ELK A;  1UEL B;  3IL2 A;  2NYX A;  2CV2 A;  2RRE A;  4RA2 A;  5J4Y A;  4AIK A;  4M9S A;  4NC6 A;  2FX0 A;  2LKP A;  4Q4Z F;  3HUG A;  3S3O A;  2M34 A;  1YOV B;  1XMA A;  2KFD A;  2EH3 A;  5ERI A;  2H94 A;  3U1D A;  4MNU A;  5CVJ A;  3QOP A;  2R7U A;  3HKZ A;  2EFN A;  2WA0 A;  1Q1V A;  4ON0 A;  3J81 K;  2DJI A;  5B1B H;  3U21 A;  4ENN A;  4OIQ F;  1FIA A;  3OV8 A;  4CDG A;  3MKZ A;  2E2H J;  1MJB A;  3HPH A;  2FD5 A;  3DBR B;  5J8C A;  3LQR A;  4B8X A;  2MH2 A;  1KGS A;  2ZXW H;  2LBF A;  1IN7 A;  3D0S A;  1AHD P;  2EPF A;  2FNA A;  3AG2 H;  1GDT A;  1TNS A;  4ZJZ A;  3CD6 I;  1UST A;  1IW7 F;  3GZN B;  3UKG A;  1YJ9 I;  4HV5 A;  2HWV A;  4XKW A;  2V26 A;  1DPR A;  1X3U A;  5D8L B;  1FX7 A;  1JJ6 C;  2KZV A;  1OCT C;  3R61 A;  2XPV A;  4PGG A;  1K7A A;  4FIS A;  2BY0 A;  5HDN A;  3C2B A;  5E3M A;  2M5W A;  1QO0 D;  1XSX A;  2CW0 F;  2L9S A;  2VI6 A;  4RB0 A;  1VTN C;  4XLN F;  4BXX J;  3VYU B;  4OAZ A;  3WOD F;  4V2G A;  2KIS A;  4ZYG A;  1IN8 A;  1BA5 A;  1ZQ3 P;  2FBK A;  1LKX A;  4AIJ A;  5KK1 A;  2CSO A;  4EJU A;  3V8J A;  3MD2 A;  2DFF A;  2JPB A;  4RM2 A;  2XPW A;  3OIO A;  3I55 I;  3I59 B;  2KZG A;  1SAX A;  1TZL A;  3REO A;  1RUN A;  2LY1 A;  3FX3 A;  1RKW A;  1P92 A;  2HOE A;  2NVU B;  2K85 A;  1ETV A;  3L2V A;  1LFU P;  1FPQ A;  5DD4 A;  2BBY A;  4UXN A;  2K27 A;  3HOS A;  3CCY A;  4F7Z A;  2X1D A;  3OS0 A;  2UXN A;  4G6T B;  1IG7 A;  5HVQ C;  3BRO A;  3E3V A;  5K1Y A;  5IYB J;  4G9Y A;  4LD5 A;  5E17 F;  4BXU A;  3FK6 A;  3ZP5 A;  1RC9 A;  1PDN C;  3S2H J;  1X2N A;  4KN7 X;  3PM1 A;  5KHD A;  2IJL A;  1JXS A;  2DU9 A;  2EZK A;  2E2J J;  5IP7 J;  1KYW A;  1LEA A;  5IT9 Z;  3E5Q A;  1IN4 A;  3TP3 A;  4CH7 A;  1AOY A;  4NUB A;  1K4T A;  2DOE A;  2GBY A;  1ODD A;  1RET A;  4E7J A;  1DU0 A;  1JHH A;  4LJZ F;  3G4S I;  2RNJ A;  1XCB A;  3S8P A;  2P6T A;  1KYZ A;  3RKX A;  4IHT A;  5F0H A;  5JI6 A;  3LAP A;  1ZAO A;  2F4O B;  5AIP A;  1MBE A;  2XAJ A;  3BJA A;  1NG7 A;  3RSN A;  2DO7 A;  2KQR A;  4X0G A;  2E5Z A;  5HOO A;  4II3 A;  3BC8 A;  4MTE A;  3P9C A;  2V79 A;  5C3E J;  1XSV A;  3P9I A;  4WWC A;  1FBQ A;  1MMS A;  1YS7 A;  3CO6 C;  3E6B A;  4LG3 A;  5EJC A;  3JSP A;  2XSJ C;  2DT5 A;  4HA8 A;  1SFO J;  3DFG A;  2COB A;  4HYE A;  2OJE D;  5LFA A;  2FML A;  3FXU A;  3IWZ A;  4UVA A;  5HS7 A;  1ULY A;  4E7S A;  4YIR X;  3VPR A;  5F1J A;  3SJM A;  4IRG A;  4D1Q A;  3KP2 A;  1WSU A;  5D8K B;  2Z1D A;  5K7Z A;  1TWF J;  1UJ8 A;  4IXA A;  2VON A;  1TQP A;  2MLK A;  1MBF A;  1W5C C;  2L7K A;  2LRE A;  3FHN A;  2M9H A;  3HOY J;  2P4W A;  3DKX A;  2R5Z B;  4OMZ A;  3WU1 B;  4N0B A;  4EEF G;  2WC2 A;  1K61 A;  1MH4 A;  1ZH5 A;  2P7C B;  4RAY A;  4XM3 A;  3BR6 A;  1D1B A;  4IHX A;  3GFI A;  3E0J B;  3ZMD A;  3GO5 A;  2K4J A;  3ZMU A;  2MAB A;  1J7K A;  2CUJ A;  2COM A;  1AKH A;  1TNT A;  3DTE A;  2ZBK A;  4D7N A;  2YSR A;  3O8G A;  3LSI A;  2EV6 A;  2ZXI A;  2PJR B;  4EJT A;  2R4G A;  1OYY A;  3CF5 F;  2ZJP F;  4BL0 B;  2PMZ A;  4G94 A;  1S8N A;  3PFI A;  4M3E A;  3GTG J;  2WAQ A;  4EJW A;  3RYR A;  3A02 A;  3KX2 A;  2K3P A;  3GW2 A;  1VQ8 I;  3W3C A;  2Q2E B;  2XF7 A;  2JJ7 A;  5E79 C;  3OYM A;  3ZQC A;  2A05 A;  4EM2 A;  4KMU X;  4XSZ F;  4OMY A;  1P9Q C;  4GO1 A;  3BZ6 A;  1Z7U A;  3OY9 A;  1QBJ A;  3QPS A;  3K1M A;  1YJN I;  3EUH A;  4C2T A;  1J75 A;  4ENK A;  2DMT A;  4BY7 J;  3E6C C;  5H20 A;  1RNL A;  3GTM J;  4X6A J;  5BPD A;  1F36 A;  5LBQ A;  1D0Z A;  1YHQ I;  2AHQ A;  5TRD A;  3CC7 I;  5E8G A;  2LH9 A;  1W5T A;  1WCM J;  3LFU A;  5HLI A;  2M45 A;  3GFJ A;  2WV0 A;  1XG1 A;  2CW8 A;  3DPT A;  3H3U A;  3LAJ A;  2QQB A;  5HDG A;  3GZ5 A;  1KQ0 A;  1ZHF A;  4LOC A;  1X1C A;  2GIZ A;  4M9Z A;  1Z9C A;  3TOB A;  4HZF A;  3KP5 A;  3F23 A;  4B4C A;  1BJZ A;  4XIC A;  1W7P D;  3FMS A;  1FBS A;  1E3H A;  4ZDP A;  3LMM A;  1PYV A;  4ZTJ A;  5FRN A;  3NEU A;  2K9S A;  2HQN A;  3FM3 A;  2IXS A;  2XRO A;  1VQN I;  1EJ9 A;  4K2E A;  2GAU A;  2YPR A;  2E1C A;  2W57 A;  1KU9 A;  4A0Y A;  3G1M A;  4XSX F;  4WX9 A;  2XUB A;  3R6S A;  1I3Q J;  3Q9V A;  4YG2 F;  3VSK A;  1SMY F;  3JRE A;  3H1C A;  2DFI A;  3LST A;  2BW3 A;  1FIP A;  3EUH C;  2B63 J;  2JVH A;  4BAC A;  4ZDO A;  2QQ8 A;  4YRV A;  4BE1 A;  3KLN A;  2ETH A;  1KZH A;  1FZP B;  1V3F A;  1MD0 A;  1TTY A;  2XAH A;  2F6C A;  3WU2 C;  5L3F A;  2FQ4 A;  3BPV A;  4YEJ A;  1AWC A;  1WFX A;  2DK5 A;  3PSF A;  4MFE A;  4MHG A;  1TWG J;  2CU7 A;  3RPU A;  4R79 A;  3MZH A;  3WTW C;  2A69 F;  2FXA A;  2E34 A;  3FMR A;  2ZB9 A;  4IZZ A;  2FA5 A;  1IN6 A;  4NHJ A;  1A6Q A;  2Q0O A;  4J00 A;  1BI3 A;  4HX4 A;  1ERD A;  3KLO A;  2OZU A;  3QRF F;  1OYI A;  3CTA A;  2PJR A;  1MW7 A;  4PUS A;  2LF8 A;  3VYR B;  3WG9 A;  2DMU A;  3KEY A;  4ENJ A;  4A3K J;  4CHU A;  3OIQ A;  1JGS A;  3NAU A;  4ZYH A;  4L5E A;  1SD6 A;  3S15 J;  4FE4 A;  2VXZ A;  2QQ9 A;  5BQT A;  4XKV A;  3KYL A;  2ZNY A;  4N9I A;  2DT6 A;  2WAF A;  2FE3 A;  3FZV A;  5DCF A;  1FMW A;  4MEY F;  4BHP A;  2JPC A;  2DI3 A;  3KE2 A;  3LA2 A;  1NK2 P;  2F5C A;  1YQA A;  2O7O A;  3TED A;  3EYI A;  1B59 A;  5TGT A;  4IHY A;  1R5G A;  2NNN A;  3JRA A;  1U8R A;  4CGZ A;  3BT9 A;  1MBJ A;  5JFR A;  5J47 A;  4NC8 A;  2EBI A;  4LIT A;  4RAF A;  2UZK A;  1UAA A;  2WBM A;  3ZQI A;  4Z2Y A;  5ICG A;  2MLG A;  2BY3 A;  3HBL A;  2OZ6 A;  3GUD A;  3O6B B;  5DM7 F;  3LSR A;  3BG5 A;  1FOW A;  1SMT A;  2W1O A;  2VXD A;  2X6O A;  4XLP F;  2EZL A;  3L00 A;  1G3W A;  1LVK A;  5GPC A;  2HVS A;  3G2B A;  2VOO A;  2DA7 A;  3LSH A;  5DCM B;  4BJ6 C;  2VQC A;  4LK1 F;  2LMD A;  3O2P E;  4ZYD A;  3MZY A;  2XRN A;  4C3I J;  3L2C A;  1K6O A;  3V8K A;  3W6J B;  3BR1 A;  3OYE A;  2XV4 S;  1R4N B;  2HPI A;  5HLG A;  3EQL F;  1WH5 A;  4LK0 F;  5H6R A;  3N97 A;  2ZME A;  2QLZ A;  4B3X A;  2KLO A;  3W6V A;  1J5Y A;  3CUQ C;  4YIF A;  1BM9 A;  5B1A H;  3OS2 A;  4A3F J;  1FTZ A;  4OIR F;  3LL7 A;  3DTI A;  2I10 A;  1A36 A;  3MAJ A;  3C2H A;  4DYQ A;  1JUM A;  1VQ9 I;  2W25 A;  1E3P A;  3MFK A;  3ABL H;  3ROU A;  2JA8 J;  4XLC A;  5AIQ A;  1I3A A;  4JX5 A;  5CVU A;  3K4L A;  5FO5 A;  3W6K B;  1G8X A;  2FF4 A;  3ULQ B;  3GFL A;  3ZQ7 A;  1Y8R B;  1R23 A;  3LQQ A;  1E2X A;  1J2X A;  1SAN A;  3OL3 A;  1AA7 A;  1H8A C;  2Q8K A;  5HDK A;  1BW5 A;  2BOL A;  4JBA A;  2IA2 A;  1LE8 A;  3ZQG A;  4FT8 A;  4BS9 A;  2QBY A;  3TO7 A;  3CJN A;  3FWE A;  2HVQ A;  3IC7 A;  1YX3 A;  2TRT A;  2K9M A;  1OIS A;  2NXN B;  1YRN B;  2EIJ H;  4QPQ A;  1VZ0 A;  2Q2E A;  3FIS A;  3RKQ A;  1N75 A;  1U5T B;  3GCM A;  1N77 A;  4HOB A;  4BY1 J;  1EH8 A;  3MN2 A;  1ON1 A;  1ZTR A;  5ILS A;  5LGU A;  2CUZ A;  2IAI A;  3ZRG A;  3IAM 2;  2KT0 A;  3SZP A;  3PO3 J;  1SD7 A;  1WHU A;  1GVJ A;  1VQ6 I;  5EYR A;  4PGH A;  1Z3Y A;  3B6C A;  4I01 A;  2WAE A;  2CFX A;  1D1A A;  4F55 A;  3WGI A;  1IO2 A;  4R8H A;  3ABK H;  3H92 A;  3QQA A;  4C2M J;  2JZY A;  1ON2 A;  1T98 A;  3CCM I;  1G2H A;  4XK4 A;  5EEA A;  3K6G A;  1LNW A;  1P4X A;  4BEH B;  2PI0 A;  3OYD A;  3DBL B;  4CCL A;  3I71 A;  4RMN A;  3VSL A;  1E0E A;  2TDX A;  5CJ9 A;  2NVT J;  2JK3 A;  3LWF A;  1A5J A;  2B9S A;  3HRM A;  5JVG F;  2RQQ A;  5FD6 A;  1YW9 A;  1R36 A;  2HYG D;  2LKS A;  3DEU A;  5F6F A;  1W5S A;  3FXK A;  2F4I A;  4NC7 A;  4MEX F;  1JKO C;  3PUF A;  3ZGK A;  2H1K A;  1FYM A;  3X2Q H;  3WTT C;  3IP4 B;  1S5L C;  2DA2 A;  4HF1 A;  4CCO A;  5BS6 A;  3CCL I;  4H4K C;  1EF4 A;  3V42 A;  5LEJ A;  2IS1 A;  4ITV A;  4ANJ A;  3VFZ A;  4RDU A;  5IOY A;  2JT1 A;  2CQQ A;  3S1R J;  2M8E A;  3S1N J;  2HU9 A;  1D0Y A;  2A5W A;  1OCO H;  3HSF A;  4RLQ A;  3SDB A;  2VOD A;  5FFX A;  1EH6 A;  1H89 C;  3KYD B;  2DA1 A;  3C2G A;  5KNL A;  2HYJ A;  4Q5S F;  3WHC A;  4QWQ A;  3G3Z A;  2G0E A;  3OYL A;  4A12 A;  3GTQ J;  5EEG A;  4ZYA A;  4Y3O A;  4F91 B;  4DNC A;  4FET A;  2ESN A;  1U8B A;  1F1Z A;  2X51 A;  3CES A;  2BE5 F;  2G7H A;  2ZCW A;  1JGG A;  3NWT A;  3OMY A;  1AU7 A;  4FHT A;  5F0C A;  1ZG5 A;  3CLO A;  2O8X A;  3SEQ A;  5M3F J;  3A03 A;  2PMU A;  4BHC A;  3MEX A;  4AM3 A;  5ICE A;  1V5E A;  2JVG A;  3GTP J;  4M71 A;  2M7A A;  4BJT A;  2ZNZ A;  4E7H A;  1LFB A;  4LFU A;  2QYO A;  3K2Z A;  1QPI A;  1YYV A;  2DA6 A;  3SDG A;  1Z21 A;  2VJ5 A;  4FTH A;  1GV5 A;  2B0L A;  2EV0 A;  3I4P A;  1TQI A;  3K7A J;  4LG0 B;  2ZFU A;  3H3Z A;  1O4X A;  2E36 A;  1WJF A;  2LTP A;  4BXF A;  1HA8 A;  1OR7 A;  3S93 A;  1OCZ H;  3CCR I;  3H9J A;  3JR9 A;  1S7E A;  3HOV J;  3FKJ A;  1LEB A;  2DFH A;  1N78 A;  5E18 F;  5D4R A;  1JJ8 C;  1VQK I;  4HDU A;  4M6X A;  1D3Y A;  3TL4 X;  3CC4 I;  4ZDL A;  1XB4 A;  2Y9Y A;  3Q0W A;  2E19 A;  3G73 A;  1L3L A;  4BYY A;  1IZ1 A;  2ZO4 A;  5K5R A;  2X4H A;  4A6D A;  3C1D A;  4C30 A;  3A01 A;  4B09 A;  3PSI A;  5LHH A;  1CGP A;  4PJM A;  4KNY A;  1TW2 A;  1UHS A;  4XLA A;  3AKZ A;  1ZRC A;  1O3Q A;  2VE8 A;  4I99 C;  5CQG A;  1RIO H;  2IA1 A;  1BOB A;  1Z7L A;  2H09 A;  4XQF A;  1PUF B;  3ZMZ A;  4HBL A;  1P2F A;  3BY6 A;  4HF0 A;  2AXT C;  2CQ7 A;  2EK5 A;  2V4J C;  3HDD A;  1BOA A;  2R5Y B;  2DW4 A;  2KMU A;  1W4M A;  3QP6 A;  4LG0 A;  3DKW A;  1IDZ A;  2BHY A;  1WJC A;  2VKV A;  1YIO A;  2KHM A;  3H36 A;  3RI4 A;  3JCU C;  2E5N A;  3MKY B;  4FE7 A;  2PMH A;  1QZE A;  4M6V A;  2HQ5 A;  3EUA A;  4A5N A;  3SFI A;  3PJR A;  3BCA A;  1VI0 A;  4BUP A;  2R5Z A;  1M1E B;  5FGM A;  4E4H A;  4A3E J;  1Z0X A;  2VC0 A;  3DEW A;  3Q9S A;  2DOF A;  1PP8 F;  3LSM A;  4KIC A;  2ZC2 A;  3CCQ I;  4A3I J;  2MD0 A;  4UY8 I;  1OLT A;  1NG6 A;  3IH4 A;  3K4K A;  1Y8Q B;  5M3M J;  1WH7 A;  1YTY A;  4QLC U;  4XRS A;  2DYS H;  3AG1 H;  2VBZ A;  2MGQ A;  5HLT A;  2VT2 A;  3S3N A;  2HDW A;  4LIV A;  3ZQQ A;  1ZYR F;  5GAD J;  2DPD A;  3FIW A;  3P7N A;  4B44 A;  1BI0 A;  4BDY A;  2IS4 A;  3QP5 A;  5GTI C;  3TGN A;  2V7F A;  5IP6 A;  1T8I A;  2X1C A;  1FYL A;  9ANT A;  3HOZ J;  2XF6 A;  1AKH B;  4G7H F;  4E7L A;  4L5J A;  4EJV A;  1IV8 A;  3A1Y A;  3BTI A;  3ZPL A;  2E71 A;  4M3B A;  2Z33 A;  2DFE A;  3D1N I;  4DOZ A;  1APL C;  5J1U A;  1G3Y A;  3DCF A;  3K10 A;  1SFU A;  2HNH A;  1Y1V J;  3VWB A;  1X2M A;  1LVA A;  3CUO A;  4DBQ A;  4IRI A;  2HFH A;  2KP6 A;  5A2Q Z; 
#chains in the Genus database with same CATH homology
 2D1V A;  3VB2 A;  4G6D A;  5D5U B;  1DPU A;  2LF7 A;  4UVC A;  1UHW A;  2MH9 A;  2EWN A;  2OD5 A;  5D6E A;  3S2W A;  1B4A A;  2FBI A;  1V4R A;  3SHF A;  3I53 A;  4YFK F;  3MWM A;  1G4D A;  5HS8 A;  2L4A A;  3C3W A;  3JTG A;  3V7R A;  1S7O A;  1QQI A;  3HIF A;  1C0W A;  2EFO A;  1U5T A;  2KKO A;  4EVI A;  1KA8 A;  4L9T A;  1GXQ A;  1HW1 A;  4I0B A;  3KP4 A;  1XN7 A;  4OIO F;  1FBU A;  3K1P A;  1O7L A;  5K5Q A;  2EFP A;  1HSJ A;  4CIC A;  3AAF A;  2GA1 A;  2KIU A;  1WI9 A;  3HRS A;  5DV5 A;  2Y75 A;  1K79 A;  3JTH A;  3NRV A;  3J81 Z;  2RGV A;  4IHS A;  3EDP A;  4KUM A;  1I5Z A;  5L3G A;  3L9F A;  2IA0 A;  3FF5 A;  3F22 A;  1BBY A;  4M6Y A;  3K0L A;  2K7L A;  2V6C A;  1MGT A;  4KDP A;  1LDD A;  4L9N A;  2V1U A;  4BH9 A;  4G7Z F;  2DQL A;  1XGS A;  2QWW A;  1DP7 P;  1TQM A;  4EGY A;  4GXO A;  1WWX A;  2F5E A;  1OKR A;  1R1V A;  3BJO A;  4ZYE A;  1FWZ A;  5FD5 A;  3EYY A;  3F8F A;  2VBW A;  4PZJ A;  5L3E A;  1Z05 A;  3B73 A;  5E1X A;  3WTV C;  5HLH A;  4ZZL A;  4WXC A;  4OOI A;  1QGP A;  2PBI A;  2EJR A;  1FSH A;  5CVR A;  1EV7 A;  3QPH A;  4MTD A;  1FC3 A;  2F2E A;  1KQ8 A;  1FOK A;  1XGO A;  4ASN A;  4HLY A;  2RVC A;  3WTS C;  2MA3 A;  1ZG1 A;  2BYV E;  2G7U A;  1H9G A;  4I02 A;  1QZZ A;  1HW2 A;  5D5V B;  3DV8 A;  3WE3 A;  3WTU C;  1XGM A;  3ZMS A;  1YLF A;  2BV6 A;  4KA4 A;  1S3J A;  4KT5 C;  4UVB A;  3TO6 A;  2H27 A;  2CG4 A;  4G8X A;  5FLX K;  3DP7 A;  1XCV A;  1XD7 A;  4Q47 A;  1P4W A;  1FP2 A;  3KEO A;  2E7X A;  4EV0 A;  4YII A;  3ML6 A;  1I27 A;  1HBX G;  4A0Z A;  4M72 A;  4L9V A;  2DBB A;  2VBX A;  1DUX C;  1WQ2 A;  4AIH A;  1T39 A;  1G3T A;  1USS A;  2P5K A;  1HQC A;  1ZAR A;  2V1D A;  2J5P A;  2IT0 A;  3OOP A;  4WK8 F;  3ZMT A;  5ICC A;  2QZ8 A;  2DPU A;  2L02 A;  3LFK A;  1YW7 A;  1U2W A;  4EQQ A;  5F64 A;  5CYV A;  1D5V A;  4GYI A;  2DAO A;  3KP7 A;  3QU6 A;  1Y0U A;  4HX7 A;  3I58 A;  3M9A A;  3RYP A;  2DTR A;  1I1G A;  4KFC A;  2OU2 A;  3HSR A;  4N9H A;  2D1H A;  5E1W A;  2RKH A;  2XKO A;  2YX7 A;  1KU7 A;  2WTE A;  2KJC A;  3BJ6 A;  3BOQ A;  3VEP A;  1B6A A;  4KIF A;  2OA4 A;  1PP7 U;  5KVR A;  3K69 A;  2VC1 A;  3WU0 A;  1ZLJ A;  1HKS A;  4Y13 A;  1IXR C;  3T0Y A;  2XAS A;  4ZH4 F;  4BQA A;  2PFB A;  3FM5 A;  3E5X A;  2LNB A;  5LHG A;  2HYF A;  2HQR A;  2VN2 A;  4LB6 B;  2XVC A;  5DDG A;  3J7A O;  4LLL A;  3KET A;  4KYW A;  2YU3 A;  4P55 A;  1QPM A;  1SFX A;  5D5X B;  4A6E A;  5E1Z B;  1ZRD A;  3WGG A;  4AVP A;  5AON A;  4TV7 A;  1O3R A;  2BEO A;  1MJA A;  3JSO A;  4EMS A;  4EJO A;  1IXC A;  3ERE D;  3TQN A;  3QPT A;  3HRT A;  3JW4 A;  3KZZ A;  2JSC A;  3IWF A;  3EET A;  1GXP A;  1SD4 A;  1Z1D A;  3ISP A;  3KP3 A;  3ZN0 A;  3LA3 A;  4I2O A;  3MCZ A;  1BI1 A;  4UHT A;  3IRQ A;  3HTS B;  2VE9 A;  2QEN A;  5ED4 A;  4MQV A;  2P5V A;  2P7V B;  2R3S A;  3L09 A;  4U7D A;  1RUO A;  4FX4 A;  3HTU A;  1HKQ A;  4A5M A;  3HHH A;  1RZ4 A;  1B9M A;  1I1S A;  3FXQ A;  3F8B A;  1QZY A;  3PQJ A;  2GZW A;  4E70 A;  5HS9 A;  4IF4 A;  2MBF A;  4XBF A;  2O61 A;  5TJJ A;  3R0A A;  4P96 A;  1J0R A;  3K9T A;  1CF7 B;  5J6X A;  3GYH X;  1Z6R A;  1LJ9 A;  1O57 A;  2H6C A;  3CDH A;  2Z9O A;  2HKX A;  3DQV C;  4O6J A;  2DK8 A;  3I0T A;  1O3T A;  3FHZ A;  3N4M A;  2XHK A;  2EA4 A;  1YFH A;  3SZT A;  2Y0M A;  4U0V A;  4NQW A;  4ETS A;  3B02 A;  4EM0 B;  4Y15 A;  1FLI A;  1F5T A;  4L0Z B;  1HXD A;  2IRF G;  2OQG A;  2PQ8 A;  5F1R A;  3E97 A;  2XAQ A;  2GXB A;  2F5F A;  3R0J A;  2NRA C;  2K4B A;  2UWM A;  1G3S A;  1ZN2 A;  3PQK A;  1BIA A;  4CO8 A;  2STW A;  3U2R A;  3KEQ A;  2CGP A;  4IVN A;  2ISY A;  1XMK A;  1R1T A;  1MDM B;  5LHI A;  1UFM A;  3ECO A;  4MGR A;  4A0X A;  1TBX A;  5LLQ A;  1NHA A;  2KIF A;  3GX4 X;  1U5T C;  2GXG A;  1YS6 A;  3SXY A;  2ZKZ A;  2P6S A;  2ZJ2 A;  5L3C A;  4HDV A;  3F8C A;  5D5W B;  1S7A A;  2DLL A;  4S05 A;  2OBP A;  4U88 A;  1Z91 A;  1R22 A;  1K78 A;  2ELH A;  1O3S A;  4O3M A;  4LLG F;  5DUK A;  3DF8 A;  2MC3 A;  4RB1 A;  2ZME B;  2HR3 A;  1T2K A;  4KN4 X;  2LSO A;  2P5L C;  1RI7 A;  4P9F A;  3F72 A;  2CO5 A;  2K02 A;  3HRU A;  5ICF A;  4I0A A;  3RTR A;  5ILU A;  1HW5 A;  1UHM A;  2V9V A;  5LRR A;  3WGH A;  2HTJ A;  4LB5 A;  4L18 B;  2CYY A;  3VOE A;  2GWR A;  5IT9 K;  3U9G A;  3COA C;  4RGS A;  2A07 F;  1P6R A;  3E6M A;  1HST A;  1J59 A;  4PCQ A;  1BN5 A;  4ESJ A;  4MQ9 F;  4P9U A;  1UCR A;  1R00 A;  1MDM A;  2L4M A;  3TO9 A;  2QM3 A;  2PJP A;  3F3X A;  1IRF A;  2O6G E;  1LQ1 A;  1CF7 A;  5L3B A;  3F6O A;  3T5X A;  4WCG A;  1B9N A;  1XDS A;  1BI2 A;  2GQQ A;  2V1X A;  3CUQ B;  4JK1 X;  2PLY A;  1OMI A;  3F6V A;  1ZRE A;  5JHU A;  1UB9 A;  1KQ9 A;  1FY7 A;  3BPX A;  4L9J A;  1P4A A;  4OIP F;  3IKV A;  2Z99 A;  2P8T A;  2G9W A;  4P5O A;  4PDK A;  4IRH A;  5DUI A;  4UUV A;  3F21 A;  4HAM A;  2E7W A;  1IUY A;  1JHF A;  1W7P B;  2ADU A;  4HLX A;  5ILV A;  2EFQ A;  3C18 A;  4RB2 C;  1T0F A;  1IAW A;  3FMQ A;  5DEQ A;  4KIG A;  5JR3 A;  2EA2 A;  2R7D A;  3DXJ F;  1DDN A;  3QU3 A;  2RQP A;  4CXF A;  5BOX A;  1MKM A;  5CLS A;  5E8I A;  1IN5 A;  4L5I A;  1Q1H A;  4IPA A;  1G6N A;  1U3E M;  2LDU A;  4BHB A;  2M87 A;  4GGG A;  1FYK A;  1BC8 C;  5E20 A;  5LRS A;  1TW3 A;  1F4K A;  3TKY A;  3M7G A;  2J5O A;  2EB7 A;  3I5U A;  1SD5 A;  1XDU A;  2AS5 F;  4HQM A;  1BC7 C;  3TOA A;  3T8R A;  1W7P A;  4G6Q A;  4BAY A;  1BJA A;  2O3F A;  2FSW A;  4R1H A;  4U0Y A;  3O3K A;  2MD5 A;  3J80 K;  2ZFW A;  3GXO A;  1B1B A;  5FFZ A;  2ACJ A;  1Z6T A;  2D45 A;  2UXX A;  1OPC A;  1QNT A;  3ZN1 A;  2RC4 A;  2NAZ A;  3RIR A;  4WF2 A;  3KFW X;  3WTX C;  3DPL C;  5FLX Z;  3V7C A;  4RAZ A;  1D8K A;  2L3D A;  4I7H A;  3HYI A;  5DYM A;  4RGR A;  2VBY A;  3GWZ A;  5J8F A;  1LDJ A;  2IPQ X;  3BWG A;  3E6D A;  3V4G A;  2KJB A;  4ZZD A;  3P9K A;  4HW0 A;  2KRF A;  1IXS B;  2QVO A;  4OU0 A;  1KU2 A;  2PG4 A;  4M74 A;  3VOD A;  2C6Y A;  3SQN A;  3T1B A;  2K86 A;  4RGU A;  3ZMV A;  2VT3 A;  3WE2 A;  3ABU A;  1JE8 A;  1EH7 A;  1U78 A;  2A5Y B;  2FBH A;  5BPI A;  5L3D A;  3F8M A;  2WWY A;  4I98 B;  1T38 A;  4BNC A;  1T6S A;  4S04 A;  1E17 A;  5LGN A;  1ZLK A;  1ZGA A;  2GA2 A;  5JVT A;  2XAF A;  1LB2 A;  4HQE A;  2OQR A;  4HX8 A;  1PUE E;  3JAM Z;  3KCC A;  2QUF A;  2A68 F;  2HEO A;  4OIN F;  4KIB A;  4I09 A;  5LEK A;  1IF1 A;  4M73 A;  3HOT A;  4IJA A;  3BDD A;  2IVM A;  1LDK B;  3GF2 A;  2FQ3 A;  1HKT A;  3I59 A;  4HF2 A;  1ZG3 A;  2HGC A;  1SFE A;  2YX4 A;  2QBY B;  4RS8 A;  1FP1 D;  1ZGJ A;  1MJ9 A;  5EEH A;  2ESH A;  4H0E A;  4UV9 A;  4RB3 C;  5FB2 A;  3F8N A;  5CVI A;  2A6E F;  3RDI A;  3LA7 A;  4GCV A;  2O03 A;  2FEZ A;  4HV6 A;  3WTZ A;  2PN6 A;  2W84 A;  1WKM A;  4LLN A;  1YO5 C;  1R7J A;  2D2W A;  2Y48 A;  4EGZ A;  1L0O C;  1K78 B;  5A2Q K;  3TDU C;  4EM1 A;  2W85 A;  3FXR A;  2HS5 A;  2W24 A;  3I54 A;  1KU3 A;  3I64 A;  4NB5 A;  1REP C;  1GHC A;  1XSD A;  2OAZ A;  4JQF A;  2CWE A;  2XIG A;  1S29 A;  4FX0 A;  2M30 A;  1XGN A;  1ZRF A;  1YW8 A;  3D5L A;  2Z5U A;  3NQO A;  4ESF A;  4ESB A;  2RV8 A;  2FOK A;  3M1E A;  1O7F A;  2A3S A;  4UV8 A;  1ONV A;  1R58 A;  4AD9 A;  3Q5F A;  1J9I A;  1S6L A;  4Q48 A;  3IHU A;  4Y17 A;  2YR2 A;  3IKT A;  3K1N A;  5BMZ A;  1R5H A;  3T8T A;  2Z3Y A;  2AXL A;  3R4K A;  3R60 A;  1FSE A;  3IRR A;  5DD8 A;  3RKY A;  1WRJ A;  2IP2 A;  4O5V A;  3GEZ A;  3GFM A;  3BP8 A;  1IRG A;  2RN7 A;  2X0L A;  2ISZ A;  3HHG A;  3CO7 C;  2EFW A;  2JTV A;  3V8L A;  5H6Q A;  2NNY A;  3ABT A;  4A2U A;  5D6F A;  2KIM A;  2QQA A;  3J80 Z;  2FRH A;  4GYG A;  1A04 A;  3M8E A;  1F9N A;  2HDC A;  3SFZ A;  3WTY C;  3GVA A;  2E1N A;  1YG2 A;  3RPQ A;  2RDP A;  5K5O A;  4L0Y B;  4U0W A;  1D8J A;  2XGX A;  1I6X A;  3GZ6 A;  4YFX F;  2M1B A;  3CUQ A;  3C7J A;  3ECH A;  2IW5 A;  3V7S A;  3RKW A;  3TDZ C;  4UNO A;  3KZY A;  2A6H F;  1R1U A;  1H0M A;  3GLX A;  2GIV A;  2FMY A;  2XAG A;  5DCM A;  4G7O F;  2HKO A;  1OYW A;  4CYD A;  3JAM K;  2BGC A;  1FNN A;  4YFN F;  1H9T A;  3MQ0 A;  2ZXJ A;  4LGW A;  2NS0 A;  3HSE A;  4CZZ A;  2FU4 A;  4U7B A;  2F5D A;  2FNP A;  4WXH A;  4D0P A;  2VOP A;  4ENM A;  2CQK A;  2A61 A;  2DQR A;  2EV5 A;  2R7F A;  3ELK A;  2XKP A;  4LMY A;  2L54 A;  5CVV A;  3RJP A;  3L7W A;  2PEX A;  3E5U A;  1U6G A;  5D4S A;  2O0Y A;  5LGT A;  3M8F A;  4WXD A;  4AWX B;  3KP6 A;  4RGX A;  2JRT A;  2L01 A;  1STZ A;  4XRF A;  1BIB A;  5IT3 A;  1TLH B;  1MZB A;  4M9X A;  2HZT A;  2HTS A;  4KMF A;  2H6B A;  1FT9 A;  3QAH A;  6PAX A;  2STT A;  4DQ2 A;  3IL2 A;  2NYX A;  4AIK A;  4M9S A;  2LKP A;  4Q4Z F;  3HUG A;  1XMA A;  5ERI A;  2H94 A;  3U1D A;  4MNU A;  5CVJ A;  3QOP A;  2EFN A;  4ON0 A;  3J81 K;  4ENN A;  4OIQ F;  3OV8 A;  4CDG A;  1MJB A;  5J8C A;  3LQR A;  4B8X A;  2MH2 A;  1KGS A;  1IN7 A;  3D0S A;  2FNA A;  1TNS A;  1UST A;  1IW7 F;  4HV5 A;  2HWV A;  1DPR A;  1X3U A;  5D8L B;  1FX7 A;  3R61 A;  4PGG A;  1K7A A;  5HDN A;  2M5W A;  1QO0 D;  1XSX A;  2CW0 F;  4RB0 A;  1VTN C;  4XLN F;  3WOD F;  4ZYG A;  1IN8 A;  2FBK A;  4AIJ A;  5KK1 A;  2CSO A;  4EJU A;  3V8J A;  2JPB A;  3I59 B;  1SAX A;  3REO A;  1RUN A;  3FX3 A;  1P92 A;  2HOE A;  1FPQ A;  5DD4 A;  2BBY A;  4UXN A;  2K27 A;  3HOS A;  4F7Z A;  2UXN A;  5HVQ C;  3BRO A;  3E3V A;  5K1Y A;  4G9Y A;  4LD5 A;  5E17 F;  4BXU A;  3ZP5 A;  1PDN C;  4KN7 X;  2IJL A;  1JXS A;  2DU9 A;  1KYW A;  1LEA A;  5IT9 Z;  3E5Q A;  1IN4 A;  1AOY A;  1ODD A;  1JHH A;  4LJZ F;  2RNJ A;  1XCB A;  2P6T A;  1KYZ A;  3RKX A;  4IHT A;  5JI6 A;  3LAP A;  1ZAO A;  5AIP A;  2XAJ A;  3BJA A;  2DO7 A;  5HOO A;  4MTE A;  3P9C A;  2V79 A;  1XSV A;  3P9I A;  4WWC A;  1FBQ A;  1YS7 A;  3CO6 C;  3E6B A;  3JSP A;  2DT5 A;  4HA8 A;  3DFG A;  4HYE A;  2FML A;  3FXU A;  3IWZ A;  4UVA A;  5HS7 A;  1ULY A;  4IRG A;  1WSU A;  3KP2 A;  5D8K B;  4IXA A;  2VON A;  1TQP A;  2MLK A;  2P4W A;  4OMZ A;  3WU1 B;  4N0B A;  2WC2 A;  1ZH5 A;  2P7C B;  4RAY A;  3GFI A;  3ZMD A;  2K4J A;  3GO5 A;  3ZMU A;  1J7K A;  2COM A;  1TNT A;  2ZBK A;  2YSR A;  2EV6 A;  4EJT A;  1OYY A;  4G94 A;  1S8N A;  3PFI A;  4EJW A;  3RYR A;  3GW2 A;  4EM2 A;  4KMU X;  4XSZ F;  4OMY A;  4GO1 A;  3BZ6 A;  1Z7U A;  1QBJ A;  3K1M A;  3EUH A;  1J75 A;  4ENK A;  3E6C C;  5H20 A;  1RNL A;  5BPD A;  5LBQ A;  5TRD A;  5E8G A;  1W5T A;  5HLI A;  2M45 A;  3GFJ A;  2WV0 A;  3DPT A;  3H3U A;  3LAJ A;  2QQB A;  5HDG A;  3GZ5 A;  1KQ0 A;  1ZHF A;  1Z9C A;  4M9Z A;  3TOB A;  4HZF A;  3KP5 A;  3F23 A;  1W7P D;  3FMS A;  1FBS A;  3NEU A;  2HQN A;  3FM3 A;  2XRO A;  4K2E A;  2GAU A;  2YPR A;  2E1C A;  2W57 A;  1KU9 A;  4A0Y A;  4XSX F;  4WX9 A;  2XUB A;  3R6S A;  3Q9V A;  4YG2 F;  1SMY F;  3LST A;  2DFI A;  3KLN A;  2ETH A;  1FZP B;  1V3F A;  1MD0 A;  1TTY A;  2XAH A;  5L3F A;  3BPV A;  1AWC A;  2DK5 A;  4MHG A;  3RPU A;  4R79 A;  3MZH A;  3WTW C;  2A69 F;  2FXA A;  3FMR A;  2FA5 A;  1IN6 A;  4NHJ A;  2Q0O A;  1BI3 A;  4HX4 A;  3KLO A;  2OZU A;  3QRF F;  1OYI A;  3CTA A;  2LF8 A;  3WG9 A;  4ENJ A;  4CHU A;  1JGS A;  4ZYH A;  1SD6 A;  2VXZ A;  2QQ9 A;  5BQT A;  2ZNY A;  4N9I A;  2FE3 A;  3FZV A;  5DCF A;  4MEY F;  4BHP A;  2JPC A;  2DI3 A;  3KE2 A;  3LA2 A;  2F5C A;  1YQA A;  3EYI A;  1B59 A;  1R5G A;  2NNN A;  1U8R A;  4CGZ A;  5JFR A;  2UZK A;  4Z2Y A;  5ICG A;  2MLG A;  2OZ6 A;  3GUD A;  3O6B B;  1SMT A;  4XLP F;  3L00 A;  1G3W A;  2VOO A;  5DCM B;  4LK1 F;  3O2P E;  4ZYD A;  3MZY A;  2XRN A;  3L2C A;  1K6O A;  3V8K A;  3W6J B;  2XV4 S;  5HLG A;  3EQL F;  4LK0 F;  5H6R A;  3N97 A;  2ZME A;  2QLZ A;  1J5Y A;  3CUQ C;  4YIF A;  1BM9 A;  4OIR F;  3MAJ A;  2W25 A;  3MFK A;  3ROU A;  5AIQ A;  5CVU A;  5FO5 A;  3W6K B;  2FF4 A;  3ULQ B;  3GFL A;  3ZQ7 A;  1R23 A;  3LQQ A;  1E2X A;  1J2X A;  2Q8K A;  5HDK A;  4JBA A;  2IA2 A;  4FT8 A;  2QBY A;  3TO7 A;  3CJN A;  3FWE A;  3IC7 A;  2Q2E A;  1U5T B;  4HOB A;  1EH8 A;  1ON1 A;  5ILS A;  5LGU A;  3SZP A;  1SD7 A;  1GVJ A;  4PGH A;  4I01 A;  3WGI A;  2CFX A;  4R8H A;  3H92 A;  2JZY A;  1ON2 A;  1T98 A;  1LNW A;  1P4X A;  2PI0 A;  3I71 A;  2TDX A;  5CJ9 A;  3LWF A;  3HRM A;  5FD6 A;  1YW9 A;  1R36 A;  2HYG D;  3DEU A;  5F6F A;  1W5S A;  4MEX F;  1FYM A;  3WTT C;  4HF1 A;  5BS6 A;  5LEJ A;  3VFZ A;  2JT1 A;  2M8E A;  3HSF A;  2VOD A;  5FFX A;  1EH6 A;  4Q5S F;  4QWQ A;  3G3Z A;  4A12 A;  5EEG A;  4DNC A;  2ESN A;  1F1Z A;  2BE5 F;  2G7H A;  2ZCW A;  4FHT A;  1ZG5 A;  3CLO A;  2O8X A;  2PMU A;  4BHC A;  3MEX A;  5ICE A;  4M71 A;  2ZNZ A;  4LFU A;  2QYO A;  3K2Z A;  1YYV A;  2B0L A;  2EV0 A;  3I4P A;  1TQI A;  4LG0 B;  3H3Z A;  1OR7 A;  1LEB A;  5E18 F;  5D4R A;  4HDU A;  4M6X A;  1D3Y A;  1XB4 A;  3G73 A;  1L3L A;  4BYY A;  1IZ1 A;  2ZO4 A;  5K5R A;  2X4H A;  4A6D A;  3C1D A;  4B09 A;  5LHH A;  1CGP A;  4KNY A;  1TW2 A;  1ZRC A;  1O3Q A;  2VE8 A;  1RIO H;  2IA1 A;  2H09 A;  3ZMZ A;  4HBL A;  1P2F A;  3BY6 A;  4HF0 A;  2EK5 A;  1BOA A;  2DW4 A;  1W4M A;  3QP6 A;  4LG0 A;  3DKW A;  1YIO A;  3RI4 A;  2PMH A;  4A5N A;  5FGM A;  2VC0 A;  3Q9S A;  1PP8 F;  4KIC A;  1YTY A;  4QLC U;  2VBZ A;  2VT2 A;  1ZYR F;  2DPD A;  3P7N A;  1BI0 A;  3QP5 A;  3TGN A;  1FYL A;  4G7H F;  4L5J A;  4EJV A;  3ZPL A;  2Z33 A;  1G3Y A;  1SFU A;  4IRI A;  1LVA A;  3CUO A;  2HFH A;  5A2Q Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...