1W7PA

The crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
213
Chain Sequence
b'VNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VPS22, YPL002C
publication title Escrt-II, an Endosome-Associated Complex Required for Protein Sorting: Crystal Structure and Interactions with Escrt-III and Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 60
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04157 EAP30 EAP30/Vps36 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pA03
1XMAA 2COMA 3ZQ7A 1S6LA 2IP2A 4P9UA 5LRRA 3MCZA 2JT1A 2KRFA 1QZYA 5JI6A 2KJBA 3KP3A 2PG4A 2E7XA 4RGRA 2Y75A 5KVRA 2P4WA 3IRRA 2GXBA 4HLXA 3CUQB 2VOPA 3GYHX 2DTRA 2HYGD 1K6OA 2ESHA 2CWEA 2A07F 1O7LA 3RDIA 1S3JA 2EFOA 2QQBA 4HYEA 4ENMA 2KIFA 5BMZA 1U3EM 1TW3A 2AS5F 3KEOA 5HDGA 2P5LC 3F8FA 4ENKA 1GXPA 1FBQA 1OYYA 2A68F 1ODDA 4A5NA 2VC0A 4U0WA 5E1WA 4XLNF 3KP6A 3VB2A 3HIFA 1FBUA 5ERIA 3KP2A 3EDPA 2NAZA 3DFGA 1I1GA 4OOIA 3F22A 3QU3A 2XV4S 5L3EA 1WKMA 1SD4A 3KCCA 5IT9Z 2XVCA 3F8NA 2H6BA 2DPDA 3HRTA 2ZMEA 5DV5A 4EJWA 4G7ZF 1MJ9A 4I7HA 4M9ZA 1KYWA 1IN7A 4HOBA 4PDKA 3L09A 4XLPF 4P9FA 3EYIA 2FNAA 4A2UA 3N97A 3WU0A 3H3UA 2DI3A 2PMUA 3N4MA 5D8KB 4HF0A 2HOEA 2OD5A 1KGSA 3NRVA 2ZBKA 3ABTA 4WWCA 2H09A 3EYYA 1CF7B 4AVPA 1IXCA 2M30A 1YS6A 2R3SA 2ELHA 2GWRA 5DUKA 3GFJA 4R8HA 3G3ZA 5E1XA 3RPUA 1B59A 1ZG5A 1HW2A 4CGZA 1H9GA 1O3SA 1TQMA 1TW2A 1R5HA 3K1MA 5L3DA 1ZGJA 1FZPB 2Z99A 4LLLA 1U8RA 1LEBA 1KU9A 4U7BA 4OIQF 4KN4X 2EJRA 3MWMA 1D8JA 3HRSA 1ZAOA 2HYFA 3MFKA 2IJLA 4KMFA 1HBXG 3E6DA 1YQAA 2BE5F 1XGMA 2HR3A 3FZVA 4AIHA 5DD4A 4ESJA 4OMYA 2FBHA 2ESNA 3CO7C 3LA2A 4HLYA 2JRTA 2E1NA 2P7VB 4UV8A 5BPIA 4UVBA 4WX9A 5FLXZ 5AONA 4RB0A 1LDDA 3HHHA 4IVNA 3ISPA 2W57A 1OYIA 4BXUA 1SD5A 2IA2A 4IXAA 2HKOA 4LMYA 1U78A 4IHSA 4RGSA 2HQNA 1IN6A 4Q4ZF 1BOAA 5LEKA 2ZXJA 4R1HA 4GCVA 4MNUA 1SAXA 2HZTA 1PDNC 2A6HF 1IUYA 2JPBA 2STWA 3QPTA 5LHIA 4MEYF 2KKOA 3KE2A 1DDNA 4KUMA 1QGPA 2M8EA 2GXGA 2CYYA 2KIMA 3LA7A 4P55A 3GW2A 5LGNA 1H9TA 2ZO4A 2RNJA 1L3LA 1ZREA 4NQWA 1ZHFA 2WC2A 4LFUA 5ICCA 2L54A 1IXRC 3WTYC 3WTUC 3EUHA 2V9VA 3KP5A 4M6YA 4NHJA 2K7LA 4HX4A 1P4XA 5TJJA 3BJ6A 1TNTA 2KJCA 1IF1A 4YG2F 1G4DA 2PMHA 3CO6C 3M7GA 5BS6A 2UZKA 4I98B 2PQ8A 3VEPA 5A2QZ 1ZLJA 2CGPA 2ZMEB 1Z05A 4KIFA 1KQ8A 3REOA 4MGRA 4FT8A 4AWXB 3K1PA 3E6BA 3QP5A 2A3SA 3ML6A 1SFXA 3HRMA 1E17A 4BAYA 3Q5FA 3WE2A 3IHUA 3GEZA 2RV8A 5FD5A 2CW0F 5HDNA 3AAFA 4OIOF 3DF8A 5FB2A 4BH9A 3FMSA 4MHGA 1GVJA 3F6OA 3GVAA 2BGCA 1J7KA 3F72A 3FXQA 5K5QA 4F7ZA 4L9JA 3C7JA 2XUBA 4WK8F 2XHKA 3HTSB 2M1BA 3BP8A 4ZZDA 2P7CB 1MD0A 1BM9A 4CXFA 5K1YA 3QAHA 1I6XA 4IPAA 3RYPA 2QWWA 5CVVA 4BQAA 1R5GA 2F5CA 4KN7X 3WGHA 2ZNYA 3RKWA 3R0AA 3CLOA 3WE3A 4ZYGA 5H6QA 2O0YA 5K5OA 3IWZA 3L9FA 1T98A 2MD5A 2ACJA 2HQRA 2PFBA 1BBYA 2OQGA 1HSTA 3ZP5A 5HLHA 1BN5A 2VE8A 2K86A 1S7AA 1V4RA 3L00A 3JAMK 4WXCA 3CDHA 4FX4A 4HQMA 2P6SA 1QNTA 2OA4A 4LJZF 1FP1D 2W85A 3GFLA 2YX7A 4CO8A 4G6QA 1I27A 2EA4A 3GFIA 4GYIA 2Z33A 4M9XA 4JQFA 2ETHA 1T2KA 1ZRDA 4EJUA 1ZG3A 5BOXA 1FSHA 4KDPA 2P6TA 4EM0B 3ZMDA 2O6GE 3DP7A 2EK5A 2Q2EA 3U1DA 1I5ZA 1OPCA 2ISZA 5CVJA 1SMYF 4TV7A 3V8LA 4FX0A 3QU6A 5L3GA 4RAYA 1NHAA 4Y13A 3DQVC 3K2ZA 2GA2A 4MTEA 1FLIA 3DPLC 1P4WA 3QRFF 4L5JA 4HQEA 3FM3A 1BC8C 1UFMA 1KU7A 2L02A 5CVIA 1R1TA 2IPQX 2DFIA 2O3FA 1U5TA 1J5YA 4MQVA 3GWZA 3LSTA 4O3MA 4HF1A 2DU9A 3COAC 1T6SA 1XGNA 3ZPLA 2Y0MA 2IVMA 4HV5A 1KQ9A 2O61A 3V8JA 4M72A 5D5UB 1XSVA 3LQQA 2UXNA 3ROUA 1U6GA 5D6EA 4KMUX 4UHTA 3ECHA 2DQLA 3CJNA 3BPXA 3GZ6A 4P5OA 3WGGA 2D1VA 2RKHA 3WODF 2DLLA 2MC3A 4YIIA 1VTNC 2FF4A 5IT3A 1IRFA 2FQ3A 3R60A 1WQ2A 2ZJ2A 2HDCA 4RGXA 5HLGA 2LSOA 3E97A 3BDDA 4IHTA 3BZ6A 3J7AO 4RGUA 2FXAA 4EGYA 1YO5C 4HX7A 1LQ1A 2DK8A 2EB7A 1A04A 2JTVA 2Z5UA 1ZGAA 1MJBA 1B9NA 2PI0A 3I59A 5LBQA 2WV0A 1FSEA 3I58A 4QLCU 3WGIA 1R7JA 2DPUA 2X4HA 4LD5A 4HA8A 3I64A 1IRGA 3TO9A 3E6CC 1MKMA 2FSWA 3Q9SA 1FYMA 3QOPA 2FOKA 2V1DA 4PGGA 2F5DA 5L3BA 5HS9A 4WCGA 2XIGA 1W5TA 3FF5A 1RUOA 3S2WA 1FNNA 2Z9OA 1D5VA 1S29A 3EETA 1JXSA 3TDUC 1T39A 3OOPA 3MZHA 3RI4A 1PP7U 3VFZA 3O2PE 5DD8A 1S8NA 2BV6A 4LLNA 1LNWA 3W6JB 3FXRA 1KA8A 4BHPA 1J59A 3GX4X 5D4SA 3ZN0A 2DW4A 1BIBA 3LQRA 1IN8A 4M73A 2XAFA 4EVIA 3R61A 1B9MA 3SHFA 4M74A 1Z91A 1G3TA 5E1ZB 2GQQA 4IRIA 2PJPA 2ZKZA 2NNNA 1P4AA 1U2WA 1QQIA 4PGHA 5DCFA 3HHGA 3KLNA 4I0BA 4XSXF 2QBYA 2PN6A 1DUXC 1FYKA 1U5TB 2J5PA 3U9GA 4ON0A 1SMTA 3RYRA 3LWFA 2V1XA 1ZN2A 2LKPA 4ETSA 3HSFA 3SFZA 5ILSA 1LB2A 5J6XA 1UHWA 4AIJA 3KEQA 4XBFA 4BYYA 2OAZA 3P9IA 4LB6B 3E6MA 3HYIA 1D3YA 2QM3A 3MZYA 4L9NA 5E8GA 4EQQA 2G7UA 1TQIA 4B8XA 2WTEA 2TDXA 2O03A 5J8CA 1MDMA 1Q1HA 4OU0A 3SZPA 2W24A 5DUIA 1UCRA 4ESBA 2D2WA 1EV7A 3CTAA 2RDPA 1K78A 4A6EA 2DK5A 3VODA 1P92A 4KYWA 2VBYA 3EQLF 2MH9A 3JTHA 4N9IA 4A5MA 3IL2A 4E70A 1R1VA 1F4KA 3I59B 1H0MA 2L4MA 1XB4A 3K69A 4EV0A 3KZZA 4OIPF 1J9IA 1KQ0A 2HTSA 2IW5A 1F9NA 1ON2A 2AXLA 2GAUA 4U0VA 4Q5SF 1OMIA 1ULYA 3KZYA 2DT5A 1R22A 2IA1A 3FMQA 2M45A 3WTSC 2G7HA 1ON1A 2MH2A 4L9VA 2B0LA 1XSDA 4UXNA 2J5OA 4WF2A 4HV6A 5FO5A 2HS5A 5D6FA 4A0YA 3NQOA 3F21A 1R00A 1SD7A 1C0WA 1WWXA 2Z3YA 4EMSA 3H3ZA 3HOSA 5JVTA 1PP8F 2OZ6A 2ZCWA 3P7NA 4PZJA 5FFZA 3T5XA 2XAJA 4BNCA 4L0ZB 3KP7A 4PCQA 2QENA 4I02A 2DO7A 3J80K 4UNOA 4WXHA 4ZYEA 4YFNF 1X3UA 2EV5A 2OBPA 4RB1A 2QYOA 1SFUA 1QO0D 1YFHA 2DQRA 5H6RA 2H94A 3SQNA 1B1BA 4G9YA 5BPDA 1TLHB 4A0ZA 1J2XA 5D4RA 3PFIA 4O5VA 4HF2A 5JR3A 4XSZF 3ZMTA 2QBYB 2K4BA 1HSJA 2NYXA 4ZZLA 2K4JA 2VONA 1O7FA 2ISYA 4RAZA 3PQJA 1W7PD 1TQPA 2V1UA 1HKQA 1W5SA 3F8MA 5D5WB 2HFHA 2XASA 4KFCA 3QPHA 3K9TA 2Q8KA 4ZH4F 2GIVA 1AOYA 5E18F 3F23A 1LDJA 1W7PA 4M6XA 1KU2A 2FU4A 3SZTA 5LLQA 1UB9A 2RVCA 3D5LA 4HX8A 1MDMB 1IN5A 2YSRA 2STTA 5AIPA 3SXYA 2KIUA 3QP6A 3WTZA 3M9AA 3E5UA 2FRHA 3HOTA 1Z6TA 3DPTA 1FY7A 1K78B 3P9KA 1WRJA 5HVQC 4ZYHA 1MZBA 2O8XA 4XRFA 1XCVA 3RJPA 3WTXC 4S04A 5L3CA 1FYLA 2FBIA 3KFWX 1J75A 1GHCA 4GXOA 1IAWA 4NB5A 5CVUA 1UHMA 2A69F 5L3FA 1W4MA 2VE9A 4MEXF 3I54A 5K5RA 2YU3A 1T0FA 2L01A 1FC3A 3ZMSA 5E20A 3Q9VA 1K7AA 3C18A 1HW5A 1YTYA 2OQRA 5LHHA 2PLYA 3ULQB 3J81K 1XGOA 2VBWA 4HW0A 2IT0A 1YW7A 4D0PA 4G7HF 3WU1B 4U88A 4A12A 4N9HA 2L3DA 2H27A 3R6SA 5CVRA 1RIOH 3BY6A 2P8TA 5CJ9A 3V4GA 3VOEA 4EJTA 1O3RA 5CYVA 3ECOA 1LVAA 3LAJA 3L2CA 3PQKA 3OV8A 3T0YA 4R79A 2K27A 4CZZA 1KYZA 1HW1A 5AIQA 5FLXK 4MTDA 4HZFA 2OU2A 2XRNA 5ICFA 3IKTA 5BQTA 4I0AA 2ADUA 2RGVA 1SFEA 4GYGA 1Z9CA 1XGSA 5JHUA 1Z7UA 5HS8A 1BI1A 4LK0F 3TOAA 4A0XA 3I53A 1R36A 4U0YA 1XSXA 2QZ8A 1ZG1A 3I4PA 3F8CA 1YW8A 1BJAA 3O3KA 2OZUA 3B02A 4ENJA 2DBBA 2QQ9A 3T1BA 3WG9A 5FGMA 3KLOA 3DXJF 3D0SA 4IF4A 3ERED 3E3VA 4CYDA 3J80Z 5E17F 1ZRCA 5H20A 3HUGA 4RB3C 1W7PB 3BROA 2Q0OA 4AD9A 1G3YA 3I0TA 3TKYA 3FXUA 3F8BA 3DEUA 1O3TA 4U7DA 5A2QK 1B4AA 3LFKA 3FM5A 4L18B 3GXOA 3I5UA 2PBIA 2LF8A 2MLKA 2EFNA 3ZMZA 1WI9A 4RS8A 1O3QA 5LGUA 3FWEA 3P9CA 1YS7A 1USTA 1BI2A 5DYMA 4Q47A 5F64A 1R58A 3LAPA 1TTYA 2XGXA 1IZ1A 3DKWA 2W84A 4GGGA 5LRSA 3JW4A 4YFKF 1RUNA 1REPC 3H92A 1JE8A 6PAXA 3ZN1A 3JSPA 1KU3A 2F5FA 1FP2A 3FHZA 2EFWA 4LG0B 1P6RA 1G6NA 2NRAC 3HSEA 3GLXA 1DP7P 2RQPA 5DDGA 1QZZA 3E5XA 1YLFA 1ZRFA 3I71A 3HSRA 4KT5C 1I1SA 4BHCA 4MQ9F 1MJAA 4L5IA 3JAMZ 1OKRA 1Z6RA 4EJVA 2E1CA 4IRGA 1AWCA 2E7WA 4CHUA 1FWZA 2VT2A 3O6BB 2M87A 5HDKA 2A5YB 1G3SA 1CGPA 3C1DA 3B73A 3BOQA 5LEJA 1ZH5A 4LB5A 2VBZA 3K1NA 1XCBA 5ED4A 2HTJA 5ICEA 4QWQA 4ZYDA 3ABUA 1EH8A 3ZMVA 2VN2A 5HOOA 1QPMA 2XAGA 5DCMA 1LEAA 5ILUA 3J81Z 5EEHA 3RTRA 3JTGA 4EGZA 3IKVA 1DPRA 2JSCA 2NNYA 1ONVA 2WWYA 1J0RA 1F1ZA 2HGCA 5F1RA 3V7SA 2F5EA 1LJ9A 4L0YB 1G3WA 4UUVA 4AIKA 2MLGA 4UV9A 1ZARA 3K0LA 3F3XA 5TRDA 3WTVC 5DEQA 2Y48A 3NEUA 5J8FA 1ZYRF 4LK1F 1Y0UA 4KICA 4I01A 4B09A 3LA3A 1R1UA 2HKXA 1T38A 3RKXA 3TGNA 4EJOA 3R0JA 1L0OC 1BC7C 3GF2A 2UWMA 4OINF 3CUQC 5ILVA 2QVOA 2FEZA 2FE3A 3BPVA 1FX7A 2EV0A 2GZWA 3HTUA 2A61A 1EH6A 4Y15A 3BJOA 3V8KA 1IW7F 4CICA 3IWFA 4I09A 3U2RA 4KIBA 2EA2A 2C6YA 5EEGA 4KA4A 4IRHA 1B6AA 3TDZC 1K79A 5D5VB 2V79A 2HWVA 4Z2YA 1QBJA 2PEXA 2YPRA 1BI3A 2BEOA 4H0EA 2ZFWA 4KIGA 1TNSA 4OIRF 4LLGF 2QQAA 5LGTA 2P5KA 3HRUA 1RZ4A 4G6DA 4LGWA 2BBYA 4N0BA 1JHHA 4G7OF 2H6CA 2UXXA 4M71A 2LF7A 1HKTA 2FA5A 1BI0A 2F2EA 4G8XA 2CFXA 2QUFA 3GO5A 2LDUA 4O6JA 2IA0A 2V6CA 3FX3A 3R4KA 1EH7A 1DPUA 3WTWC 1RNLA 2ZNZA 1TBXA 2CSOA 2D45A 4I2OA 3M1EA 4CDGA 5D5XB 4WXDA 1XD7A 4YFXF 1WSUA 3KP4A 2A6EF 3V7CA 4EM1A 2CO5A 2JZYA 2EWNA 3E5QA 3ELKA 3MQ0A 1U5TC 3V7RA 3MAJA 2XROA 1YG2A 2CQKA 2YR2A 1FBSA 4P96A 4FHTA 4OMZA 4M9SA 5E8IA 4HDUA 5DCMB 3M8FA 1FOKA 5IT9K 3KETA 2VC1A 3CUOA 3M8EA 4BHBA 2D1HA 5LHGA 3CUQA 3G73A 2HEOA 1OR7A 1P2FA 1RI7A 2XKOA 4JBAA 1V3FA 1XDSA 2XAQA 2XAHA 5FFXA 1PUEE 3T8RA 1F5TA 1YW9A 4Q48A 1Z1DA 1HXDA 3RPQA 1OYWA 5D8LB 3GUDA 1ZLKA 2FNPA 4DQ2A 2DAOA 2VODA 4ASNA 3MEXA 2FMYA 2IRFG 4KNYA 3RKYA 1IN4A 2RC4A 3F6VA 1XMKA 3TQNA 3JSOA 3T8TA 4IJAA 2RN7A 2EFQA 1JGSA 2QLZA 2EFPA 5CLSA 1O57A 1LDKB 4L9TA 2XKPA 3IRQA 1SD6A 3GZ5A 4HAMA 1FT9A 3IC7A 4ESFA 4LG0A 2W25A 1JHFA 3GFMA 3W6KB 2YX4A 2X0LA 1YIOA 1BIAA 2VXZA 4ENNA 2M5WA 1XDUA 1E2XA 4UVAA 2MBFA 4S05A 4K2EA 2BYVE 2VOOA 4HDVA 2L4AA 2R7DA 5JFRA 4JK1X 3BJAA 2G9WA 5HLIA 5KK1A 2VBXA 3C3WA 2R7FA 1CF7A 2EV6A 3RIRA 2P5VA 4RB2C 1HQCA 3FMRA 2MA3A 2GA1A 1GXQA 1STZA 1IXSB 2FMLA 5FD6A 2JPCA 4UVCA 1FPQA 4GO1A 4HBLA 1MGTA 1S7OA 1XN7A 4DNCA 2VT3A 5ICGA 3TO6A 4EM2A 4A6DA 3BWGA 3TO7A 4Y17A 5F6FA 1HKSA 3L7WA 1YYVA 2LNBA 4G94A 3ZMUA 1R23A 4YIFA 2NS0A 3DV8A 3WTTC 1D8KA 1USSA 2FBKA 5HS7A 2K02A 2CG4A 3TOBA
chains in the Genus database with same CATH superfamily
2LFBA 1XMAA 1TL8A 2COMA 2OCEA 2FX0A 1FOYA 3ZQ7A 1S6LA 2IP2A 3GTGJ 4P9UA 1HCRA 3OYKA 5LRRA 1MNDA 1OCZH 3MCZA 5IP9J 2JT1A 2KRFA 1X2MA 3LL7A 1QZYA 2WA0A 5JI6A 2KJBA 3KP3A 2PG4A 2E7XA 2EZLA 5GPAA 4RGRA 2Y75A 3ABKH 5KVRA 2P4WA 4FE4A 2NOGA 3IRRA 2GXBA 3LSKA 4HLXA 5IOZA 2CV2A 2PJRA 3CUQB 4A3JJ 4IQJA 2M7AA 4LIVA 2KL4A 2VOPA 1JJ8C 2MC4A 5KAIC 3GYHX 2DTRA 3BCBA 3L2RA 2HYGD 1K6OA 2ESHA 3ONQA 2CWEA 3GTOJ 3A01B 1Z21A 1ZELA 2A07F 3OL3A 1O7LA 2EIMH 3RDIA 1S3JA 3CLQA 3V42A 2LKXA 1MBGA 2EFOA 5IYDJ 2V9PA 2QQBA 2TCTA 4HYEA 4ENMA 2KIFA 1IF1A 1HDPA 3GTLJ 1VQ9I 5BMZA 1U3EM 1TW3A 2AS5F 3KEOA 5HDGA 2P5LC 3A0BC 3F8FA 4ENKA 1GXPA 1FBQA 1OYYA 3K4CA 2A68F 1ODDA 1MBFA 1X1AA 4A5NA 2VC0A 3SZGA 4A3EJ 1SC7A 4U0WA 3FK6A 5E1WA 5F27A 4XLNF 3KP6A 4I6ZA 2H8WA 3VB2A 3HIFA 1FBUA 5ERIA 3KP2A 1QHHD 5FLMJ 4ABZA 3EDPA 2XPUA 2NAZA 3DFGA 1I1GA 4OOIA 3F22A 3QU3A 4RM3A 1ETXA 2XV4S 5L3EA 5FRNA 1WKMA 2CV0A 1SD4A 3KCCA 4BU2A 1N25A 2BY3A 3LMMA 1X4PA 1MH4A 5IT9Z 3GBGA 3H1CA 2XVCA 4PFOA 2QSFX 3F8NA 2H6BA 2DPDA 3HRTA 3S16J 2W4SA 2ZMEA 5DV5A 4EJWA 2AO9A 2Q2EB 4G7ZF 1MJ9A 2DOAA 1MMAA 4I7HA 4M9ZA 1KYWA 1IN7A 3BZKA 4HOBA 4PDKA 3L09A 2IS6A 4XLPF 4CCLA 1ITYA 4EATA 3OOUA 4V2GA 3K4BA 4N4NB 3W2AA 2DT6A 4NC8A 4P9FA 3EYIA 2FNAA 4A2UA 3IH4A 3N97A 3WU0A 4ZTFA 3H3UA 2DI3A 3PNYA 2PMUA 5HLTA 2D5VA 3N4MA 5J1UA 5D8KB 2Y69H 4HF0A 4OAYA 1D0XA 3RPUD 1VQ4I 2HOEA 2OD5A 1KGSA 1WJDA 3DPUA 3NRVA 2AQEA 2ZBKA 1KZHA 3ABTA 3H9GA 2DODA 4WWCA 5C4JJ 2H09A 1MSFC 3EYYA 1CF7B 4AVPA 1IXCA 2M30A 1OCPA 1YS6A 2R3SA 2W48A 1WGXA 2ELHA 2GWRA 1Z0XA 3B6AA 5DUKA 3PO2J 3GFJA 1Y8RB 3KYLA 4R8HA 4DYQA 3G3ZA 5E1XA 3RPUA 1ENHA 1B59A 1FMVA 1ZG5A 1HW2A 4CGZA 1EF4A 4PSWA 1K6YA 1H9GA 3EUAA 1O3SA 1TQMA 4M6VA 5KNLA 1TW2A 2XGDA 1HA8A 2WAQN 4BE0A 3CMMA 5HODA 1R5HA 1HLVA 4A69C 3K1MA 3PIPF 5JLXA 5L3DA 2V4JC 5GTHC 1ZGJA 2X1CA 4A93J 1S72I 3K4KA 2HOAA 2Z99A 3C2BA 1FZPB 4LLLA 5HNHA 1U8RA 4Z6YA 1LEBA 1KU9A 4G12A 4U7BA 5J4YA 3DKYA 2OJED 3DTKA 1YITI 2HZDA 4HG2A 4BY1J 1EKEA 5J3LA 5IOYA 4OIQF 4KN4X 2O8KA 2EZKA 2E60A 2EJRA 1V5GA 3MWMA 3NWSA 4XKBA 3K4MA 3CF5F 1D8JA 3HRSA 1ZAOA 2HYFA 3MFKA 2IJLA 4KMFA 3ZXSA 1HBXG 3MKLA 3E6DA 2NVUB 1YQAA 2BE5F 1XGMA 2HR3A 3FZVA 2VJ4A 3QYBA 5DD4A 4AIHA 4ESJA 4V19K 4F92B 4OMYA 5GP9A 2FBHA 2Y30A 4AM3A 2ESNA 2R7ZJ 3CO7C 3LA2A 2JSPA 4HLYA 4B47A 2JRTA 2M34A 1H89C 4PK4A 5FRMA 4XLCA 2E1NA 2Q1ZB 3DU6A 2P7VB 4UV8A 5BPIA 3ASNH 2ZB9A 4UVBA 4WX9A 1H88C 5FLXZ 1ETVA 3DKXA 3UR3C 1DU0A 5AONA 4RB0A 1LDDA 4V2FA 1CQTA 3HHHA 3MVPA 4IVNA 1K61A 1VQPI 2E2HJ 3ISPA 2W57A 3H0DA 1OYIA 4BXUA 1SD5A 1XS9A 3BR5A 4YELA 2IA2A 4IXAA 2HKOA 4LMYA 1U78A 3CC4I 2PJRB 4IHSA 1WHUA 1OCCH 2JA2A 4QPQA 2A5WA 4RGSA 9ANTA 2HQNA 2GOMA 1IN6A 2K5CA 4Q4ZF 4Y3OA 1EA3A 1BOAA 5LEKA 2ZXJA 4R1HA 2PX9A 4GCVA 5C4XJ 4MNUA 1BJZA 1SAXA 4QPOA 2HZTA 1PDNC 2A6HF 3MZ8A 3CCSI 1TZLA 1IUYA 1PJRA 1WJBA 2JPBA 3CCEI 3QPTA 2STWA 1RC9A 5LHIA 2LY2A 2NVYJ 3OYCA 4MEYF 2KKOA 4ZDPA 3KE2A 5M5XJ 1DDNA 4KUMA 1QGPA 5CKTA 1VQ5I 1B72A 1XMXA 2HXIA 2GXGA 2M8EA 2CYYA 2KIMA 3C2HA 3U21A 3LA7A 2DN0A 4P55A 3GW2A 5LGNA 1W5CC 3PUBA 1H9TA 3QWLA 2VPRA 2ZO4A 2PMZN 2ZFUA 2RNJA 1MMGA 1L3LA 3S2HJ 3HZJA 1ZREA 2X85A 4NQWA 1ZHFA 2JUGA 2WC2A 4LFUA 1IO2A 5ICCA 2L54A 1IXRC 3D5SC 3WTYC 4XICA 3WTUC 3EUHA 2V9VA 2KISA 3KP5A 4M6YA 4NHJA 1FJLA 2K7LA 4S0HB 3ZGKA 4HX4A 2AHQA 1P4XA 5TJJA 3BJ6A 1WH5A 1TNTA 2KJCA 4BJ6C 3MN2A 3BG7A 3PUFA 4IOCF 4YG2F 1G4DA 2PMHA 3M7GA 5BS6A 3WG7H 3CO6C 2UZKA 1IJWC 1VQKI 4I98B 2PQ8A 2LK2A 2XGEA 3KYCB 3VEPA 4CA0A 5A2QZ 1ZLJA 2CGPA 2RREA 3VYRB 1A5JA 2ZMEB 5F0CA 3CCMI 3AL0B 4XM3A 2IGNA 1Z05A 4KIFA 1KQ8A 4NC6A 4RLFA 1NK2P 1T0FC 3REOA 4MGRA 4FT8A 2NXNB 1QU3A 1SANA 3RQIA 2LKSA 3S1NJ 2XB0X 4AWXB 1PVEA 1GV5A 1NH3A 3K1PA 1DQUA 3E6BA 3QP5A 2A3SA 1D5YA 3ML6A 1SFXA 3D5RC 2HU9A 3HRMA 3DLAA 1E17A 1PUFA 2Z1DA 3A03A 4BAYA 3S1QJ 2X51A 2JMWA 2R7OA 2MYSA 3O8GA 3Q5FA 3WE2A 3IHUA 2H1KA 3GEZA 3A02A 2RV8A 3K6GA 5FD5A 2CW0F 4KITB 5HDNA 2Y2ZA 1RR7A 4RAFA 3MKWB 3AAFA 4OIOF 2JK3A 3DF8A 4XK4A 1Y56A 2OV7A 5FB2A 2RAEA 2CQNA 4BH9A 3FMSA 2OUMA 4CCKA 4MHGA 3IUOA 1GVJA 3D1NI 3F6OA 3VWBA 3GVAA 4XONA 1Q1VA 2BGCA 1J7KA 3F72A 1UMQA 1U8BA 1VQNI 3FXQA 5K5QA 4BDYA 1FTZA 4F7ZA 2ID6A 4L9JA 3C7JA 4GFBA 3OSFA 2DA2A 3ZOBA 1MBJA 3MD2A 2XUBA 4WK8F 2XHKA 2KQRA 3HTSB 2M1BA 3BP8A 4ZZDA 1Y39A 3G4SI 2ECCA 2IGKA 1HDDC 1W36D 2WB1A 1SAUA 3HOVJ 3BTJA 2P7CB 1MD0A 1BM9A 4CXFA 4IO9F 5K1YA 3QAHA 2M9HA 1X2NA 5LFAA 2IS4A 2IBDA 3LSPA 1I6XA 4IPAA 3RYPA 2QWWA 5CVVA 4BQAA 1R5GA 2F5CA 2ZXIA 4FCYA 1WPKA 4KN7X 3WGHA 2JVGA 2ZNYA 1JT6A 2DMNA 3RKWA 3R0AA 3CLOA 3H35A 3WE3A 4ZYGA 3TL4X 5H6QA 2O0YA 1MSEC 1WCMJ 1X19A 5K5OA 4ZDOA 3IAS2 2CW7A 3IWZA 4ITVA 2KRHA 2VQCA 3L9FA 3OYBA 4D9JA 1T98A 1TWFJ 3JRFA 2MD5A 2ACJA 2HQRA 2LTPA 1BBYA 2PFBA 2OQGA 1HSTA 3ZP5A 5HLHA 1WJFA 1BN5A 2VE8A 3W6VA 2K86A 3LSHA 4YRVA 1S7AA 1V4RA 3L00A 3JAMK 4WXCA 3CDHA 4FX4A 5FLVA 4XLFA 4HQMA 2P6SA 1QNTA 4MLOA 4BJTA 2OA4A 2MABA 5EYRA 4IX7A 4LJZF 3BQZA 2DDBA 1FP1D 2W85A 3GFLA 3ZQCA 2YX7A 1QA6A 5EG0B 3CCYA 4CO8A 3CCRI 2DJIA 4G6QA 1MMNA 1I27A 1JKPC 2E71A 2EA4A 2RQQA 1H8AC 3GFIA 3G1LA 4GYIA 3OYNA 2Z33A 2XAUA 4M9XA 1OQYA 4JQFA 2ETHA 1T2KA 1NK3P 1ZRDA 4EJUA 5JHFA 1ZG3A 3OYAA 3HL2A 2JA6J 1MW7A 3K4JA 5BOXA 4KDPA 2P6TA 4EM0B 5HNFA 1FSHA 2P81A 3DLLF 1S9HA 2QKMB 1RKTA 1VZ0A 2NVXJ 3ZMDA 2W00A 3C2GA 3LSJA 4IL6C 2O6GE 1ETYA 3DP7A 2EK5A 2Q2EA 3U1DA 5DS9A 1JGGA 1B72B 1I5ZA 1OPCA 2BHYA 2ISZA 3M1CA 5CVJA 2KZGA 1SMYF 4TV7A 3V8LA 4FX0A 3QU6A 4P1WA 3K4NA 3QODA 1NHAA 3FK7A 1BR1A 4RAYA 5L3GA 3FIWA 3HPGA 4Y13A 2W1OA 3DQVC 3KZIC 3Q3SA 3K2ZA 4NQWB 2GA2A 1QZEA 4HPQA 4MTEA 1FLIA 2LYCA 1P4WA 3DPLC 3QRFF 4L5JA 4HQEA 4XQFA 3HEFA 1S5LC 3FM3A 3DWLE 2ZSIB 4BQQA 1BC8C 1UFMA 2CUFA 2L02A 5CVIA 1KU7A 4CYCA 1R1TA 2IPQX 2DMTA 4QIWN 2DFIA 2O3FA 3DTEA 1JKOC 1U5TA 1Z7LA 1J5YA 3PIOF 1I50J 4MQVA 1ACIA 1VQ6I 3KX2A 2L0KA 2F48A 2DJNA 3GWZA 4DZJA 3LSTA 4O3MA 1TT5B 4HF1A 2DU9A 3COAC 1T6SA 1XGNA 1N77A 3EUKL 3ZPLA 3BR3A 1GUUA 4JP0A 2Y0MA 2IVMA 4HV5A 4C30A 3S3OA 1KQ9A 2OF7A 4BXFA 1YIJI 2O61A 2WV1A 3V8JA 4F93B 4BGDA 4M72A 3PJRA 2HNHA 1LKXA 5D5UB 2LLKA 2VPLA 1XSVA 3LQQA 5KHDA 2UXNA 3RCOA 3ROUA 1U6GA 2EIKH 2CUZA 4YIRX 2M4KA 3J7AY 5D6EA 4KMUX 1FMWA 4C3HJ 1XPXA 2GIZA 4UHTA 3L2QA 3ECHA 1IDYA 2DQLA 5EGOA 3CJNA 1WI3A 3BPXA 3GZ6A 4P5OA 1UG0A 3WGGA 2D1VA 3DU5A 3HM5A 2XF5A 1YHQI 2R93J 2BHZA 2RKHA 1BW5A 3WODF 2DLLA 2MC3A 4XN0A 3KPHA 3TW6A 5F08A 4YIIA 1VTNC 2VL8A 3S17J 2FF4A 1R9TJ 3HGYA 1IDZA 5IT3A 2QSGX 1IRFA 2A05A 1E0EA 5K7FA 2FQ3A 3R60A 1WQ2A 2DFHA 2ZJ2A 2DMPA 3ZR8X 2HDCA 4D5FA 4RAGA 3ZQGA 3WHCA 4XMYA 4RGXA 5HLGA 3AFHA 2LSOA 3E97A 3G6EI 1J09A 3BDDA 4L5EA 4IHTA 2A6TA 1APLC 3BZ6A 3J7AO 3PNVA 4RGUA 1OCRH 2FXAA 2K3PA 1IGNA 4EGYA 2K9LA 1YO5C 4HX7A 2R7XA 1OCOH 3CDIA 1FEXA 2OCCH 3H0GJ 1LQ1A 2DK8A 2EB7A 1A04A 2JTVA 2CJJA 4DYRA 2Z5UA 5GAHJ 2HI3A 3J7ZI 1ZGAA 1MJBA 1B9NA 1RPWA 2LY9A 3L2WA 2PI0A 3I59A 5LBQA 3S1MJ 2M0MA 2WV0A 1JJ6C 4FETA 4GDFA 2OTLI 2VQHA 3OWTA 1FSEA 4X0GA 3I58A 4QLCU 3WGIA 1R7JA 4XIDA 2B9SA 1IRZA 5IYBJ 2DPUA 2X4HA 4LD5A 4HA8A 3L1PA 3I64A 1SEUA 1IRGA 3TO9A 1RR8C 3E6CC 1MKMA 2FSWA 2KDOA 3Q9SA 1SFKA 2CS3A 5M5YJ 1FYMA 2R7UA 4XLAA 3QOPA 2FOKA 4PJLA 2GBYA 2X6YA 2V1DA 4PGGA 2F5DA 5L3BA 2AXTC 5HS9A 4WCGA 2XIGA 4ANJA 4MFDA 4F3QA 1W5TA 3FF5A 3OYJA 1RUOA 3S2WA 3K4LA 1FNNA 4FQGA 3IH2A 2Z9OA 2LG4A 1VQMI 1D5VA 1S29A 4ZTJA 5B1AH 3EETA 2O5RA 1JXSA 2R4GA 3OIPA 3TDUC 3MMYB 1T39A 2KLOA 3CMEI 3NARA 3OOPA 3MZHA 1AA7A 3RI4A 2G0EA 2FD5A 1W0UA 1PP7U 2E1MC 3VFZA 1Z77A 4ZDLA 3O2PE 1ETQA 1WVRA 5DD8A 5E79C 3K70D 3GTPJ 1S8NA 2BV6A 1ZGWA 3CMYA 4LLNA 3EPZA 1LNWA 3W6JB 3M07A 3FXRA 1KA8A 4A3LJ 2JN6A 4E7LA 2DMQA 2B7EA 4BHPA 1J59A 3RZOJ 3LSGA 3GX4X 5D4SA 1T33A 3ZN0A 4JX6A 2DTZA 2DW4A 2F5VA 4ZC3A 1BIBA 3LQRA 4B3XA 3BCAA 1WJEA 1IN8A 2NS8A 1NG7A 2N8GA 4M73A 3VYTB 2XAFA 2YUSA 4BKXA 1JUSA 3R61A 4EVIA 1B9MA 3SHFA 4M74A 1Z91A 1G3TA 5E1ZB 2GQQA 1Y8QB 2VJ5A 4PJNA 1ZR4A 4IRIA 1OCTC 2PJPA 2ZKZA 2JUCA 2NNNA 1YI2I 1P4AA 2L5QA 4DGWB 1U2WA 2HXOA 4F52A 5F0HA 1QQIA 4PGHA 1MH3A 5DCFA 4A3FJ 3HHGA 3KLNA 2BVMA 4I0BA 4XSXF 4CYCB 1MBHA 1F36A 2QBYA 1G8XA 2PN6A 2X48A 5FKKA 1DUXC 1JI8A 1FYKA 4FTHA 1U5TB 2COBA 2J5PA 3U9GA 4ON0A 1YX5A 2V9KA 3BTIA 3HOUJ 2BXYA 2L2OA 4MFEA 1SMTA 4B44A 2L7KA 2R5ZA 2L9VA 3RYRA 3LWFA 3HPHA 4I99C 2V1XA 1ZN2A 2LKPA 3BLYA 3FBIB 3HSFA 3SFZA 4ETSA 3SEZA 5ILSA 4DW6A 2HDDA 4BE1A 1LB2A 5J6XA 3H9QA 2Y0SA 1UHWA 4AIJA 2WADA 2QGUA 3KEQA 4XBFA 1ETOA 4D7MA 4BYYA 1RRJA 2HVQA 2CH0A 2EINH 3RZDJ 2OAZA 3P9IA 2DA5A 4B48A 3G2BA 5EGOB 4LB6B 3E6MA 3HYIA 1D3YA 4PJJA 2QM3A 2GOXB 3MZYA 1R49A 4L9NA 4BQOA 5E8GA 4HRIA 1SVOA 4EQQA 4XKCA 1K83J 1TQIA 1TT0A 2G7UA 4B8XA 3W2VA 2WTEA 2EILH 2W7NA 2TDXA 2O03A 1POGA 5J8CA 5H2FC 2KIQA 5J4VA 1MDMA 1Q1HA 1WJ5A 4OU0A 3SZPA 2W24A 2I8DA 2WBMA 5DUIA 3OYEA 2DYSH 1UCRA 4KT6A 3HG9A 4ESBA 2D2WA 3IV5A 1EV7A 1UELB 4UB8C 4C3IJ 2JVHA 2L7ZA 3ZQQA 2NOJB 5FJ8J 3LFUA 4J19A 3CTAA 2M2EA 1JKQC 2MGQA 2RDPA 2XDVA 1K78A 3AKZA 4A6EA 2DK5A 5B66C 1DGWY 3VODA 1P92A 2VKHA 4KYWA 1FIPA 2VBYA 5CQEA 2FJ1A 3DBRB 3EQLF 5EG0A 2MH9A 3JTHA 4N9IA 1JKRC 4A5MA 3IL2A 4M3FA 4E70A 1R1VA 4RMNA 1F4KA 3I59B 3U1KA 1H0MA 2L4MA 2Z16A 1XB4A 3FXLA 1LFPA 2OTJI 3K69A 4EV0A 3KZZA 1AKHB 3OIQA 5F1JA 3RSNA 1I3QJ 4AIDA 4OIPF 2M3AA 3N05A 1SFOJ 1J9IA 3KYDB 1R4NB 4UUTA 1KQ0A 3ZQFA 2HTSA 2IW5A 1F9NA 1ON2A 2AXLA 2GAUA 4U0VA 4E7KA 4Q5SF 3OYGA 1OMIA 3CP2A 4IOAF 1ULYA 3KZYA 2DT5A 1R22A 5B3SH 2IA1A 3FMQA 3GZNB 2M45A 3WTSC 1VNDA 1OR7C 4A3IJ 2G7HA 2ZJPF 2HOTA 1ON1A 2MH2A 4L9VA 2I10A 2B0LA 1XSDA 4PFPA 4UXNA 3A2KA 2LOOA 2J5OA 4WF2A 5IY5H 3HOZJ 3M3YJ 4HV6A 3BR2A 3CZ6A 1B8IA 5FO5A 2HS5A 5D6FA 2UUZA 2X9DA 3NQOA 4A0YA 3F21A 1R00A 1SD7A 2O9LA 1C0WA 1WWXA 2QCOA 1BA5A 2Z3YA 4EMSA 3H3ZA 3HOSA 3TMOA 5JVTA 1VQ7I 1PP8F 3AG4H 2OC6A 2ELJA 2OZ6A 2ZCWA 3P7NA 4G6TB 4PZJA 2XAJA 3H5AA 5FFZA 3T5XA 4BNCA 2X1EA 3ABLH 3H5RA 2LY1A 3KP7A 2QENA 4PCQA 4L0ZB 4I02A 2VKEA 1XG1A 3PL8A 2DO7A 3J80K 4UNOA 4IHYA 4RA2A 4WXHA 4ZYEA 4YFNF 1VI0A 1X3UA 2EV5A 3H9JA 2OBPA 4RB1A 2QYOA 2VIXA 1SFUA 1QO0D 1YFHA 1G2HA 2ME0A 4II2A 2DQRA 3GCMA 5H6RA 4Y4RA 3BG9A 1XX5A 1TWAJ 2H94A 2V1NA 2EZHA 1B1BA 3SQNA 4G9YA 1UG2A 4CCMA 5BPDA 1TLHB 1Y0NA 4A0ZA 1J2XA 5D4RA 1IV8A 3PFIA 1TWCJ 4O5VA 3CP8A 4HF2A 3PO3J 1YE9A 4PJ0C 2JWTA 5JR3A 4MO7A 1ZTRA 3HKZN 1MIJA 4IKFA 4NUBA 4XSZF 3ZMTA 2QBYB 2K4BA 4DOZA 3FKIJ 1DGRM 1HSJA 3BTLA 2NYXA 1JTXA 5GTIC 3J7YJ 3JRDA 4ZZLA 2K4JA 1TWHJ 5FKLA 2R5ZB 1V54H 4F91B 2VONA 1O7FA 2ISYA 3DTIA 2E1OA 5IP6A 4PSXA 4RAZA 3KIOA 3PQJA 3TP0A 4JOMA 2XC7A 3E0JB 4HSTA 1KONA 3NAUA 4BACA 1QHGA 1ZK8A 3HXLA 1W7PD 3B6CA 1TQPA 5EJCA 1HKQA 4W97A 2V1UA 1W5SA 3F8MA 5D5WB 2HFHA 2RNGA 4CCNA 5K7ZA 2CUJA 2XASA 4RBOA 3OYHA 4KFCA 2VASA 3FXOA 3QPHA 3K9TA 1EJ9A 2Q8KA 4A3BJ 3MKYB 4ZH4F 2Y31A 2GIVA 1AOYA 5E18F 2ZSHB 1Y1VJ 3NWTA 3F23A 2QA4I 1LDJA 5J40A 4UUSB 1W7PA 4M6XA 1KU2A 2KT0A 2OPTA 2V26A 4XLHA 2WAQA 2FU4A 4BL0B 2HOSA 2R92J 4LITA 3SZTA 5GAGJ 3GLLA 2DA3A 5LLQA 1UB9A 2RVCA 5CPRB 3D5LA 4HX8A 2XGCA 1SVLA 3LOCA 1MDMB 1IN5A 2I5UA 4LG3A 4CCJA 2YSRA 3HC7A 3LSMA 2STTA 5AIPA 3SXYA 2HYJA 4FASD 2KIUA 3QP6A 3BG5A 3ZQLA 3WTZA 3M9AA 4HSRA 2W82A 3E5UA 2FRHA 4DBRA 3HOTA 3TW7A 1Z6TA 3CJRB 3QYEA 3DPTA 1FY7A 3CCQI 1K78B 3P9KA 3M8JA 3G71I 2CW8A 4B4CA 1WRJA 2DYRH 2L9RA 1LFBA 2DA1A 5HVQC 3GTKJ 4ZYHA 1MZBA 2O8XA 3HB9A 1DU6A 1YJWI 4XRFA 3HJEA 1XCVA 3FISA 3RJPA 5FKNA 3GMEA 3WTXC 4HNUA 2X6WA 2H8RA 4BY7J 5L3CA 4S04A 1FYLA 2M4GA 2FBIA 3KFWX 4F55A 1J75A 4GXOA 2YU9J 1GHCA 1IAWA 4NB5A 5CVUA 1UHMA 2Y9ZA 3E1SA 4Y52J 2A69F 4BUPA 5L3FA 1W4MA 2X1DA 2VE9A 3PFYA 2XSDC 4MEXF 1X1CA 2DOFA 3CJTB 3I9V2 3I54A 2LH9A 5K5RA 2YU3A 3F0CA 2KDZA 1T0FA 2EIJH 3ZCOA 3G1MA 2L01A 2ID3A 2JRMA 1FC3A 1VF9A 3K2AA 5E3MA 4E7SA 3ZMSA 1T8IA 2L7MP 5E20A 4I76A 3BG6A 3Q9VA 1JT0A 1K7AA 3C18A 1HW5A 1YTYA 2OQRA 1YJ9I 5LHHA 1YRNA 2PLYA 3TP3A 3ULQB 3J81K 1JTYA 1XGOA 2VBWA 4HW0A 1A35A 2IT0A 1YW7A 4NBQA 4D0PA 1O4XA 4X6AJ 3KEYA 1RETA 3DEEA 1B8IB 4G7HF 3WU1B 4U88A 1OISA 2KZVA 4A12A 4N9HA 2LD5A 2XRLA 1YX3A 1U0JA 3OR1C 2L3DA 2IEKA 2XPVA 4B1RA 2H27A 3A0HC 2LREA 5CVRA 3R6SA 2R7QA 2DDAA 3FXMA 4A3DJ 1RIOH 2DCEA 3BY6A 2F4MB 2P8TA 1BR2A 3W2WA 5CJ9A 3V4GA 3VOEA 4JX4A 2VI6A 4EJTA 1O3RA 5CYVA 3ECOA 1LVAA 3IP4B 3LAJA 4XNFA 1VQLI 2PMZA 3L2CA 3S8PA 1IC8A 5B5EC 3PQKA 3PSFA 3ESWB 3OV8A 3T0YA 4R79A 3S1RJ 2K27A 3TBIA 4CZZA 2CQQA 1KYZA 1HW1A 2L9NA 5AIQA 5FLXK 5FKOA 1LE8A 4MTDA 4E7HA 2DT7B 3TEDA 4HZFA 2OU2A 2XRNA 5DM7F 5ICFA 3IKTA 2K9SA 5BQTA 4I0AA 1XC5A 2ADUA 4FE7A 2RGVA 1Y1WJ 2FOWA 3FHNA 1SFEA 4GYGA 1Z9CA 3L2VA 1UHSA 3G1OA 2VKVA 2ZMEC 4BJ5C 4BXXJ 3S3MA 5F04A 2IS1A 1XGSA 5JHUA 1Z7UA 5HS8A 2VLAA 4J00A 4XORA 4QTRA 1BI1A 2BY2A 4LK0F 4JX5A 3TOAA 3ERMA 1A36A 4A0XA 3I53A 5J1YA 1A6QA 1R36A 1X1DA 4U0YA 1XSXA 2QZ8A 1ZG1A 3OSGA 4NC7A 3I4PA 3VSLA 3F8CA 1YW8A 1BJAA 2F4OB 3O3KA 1MNMC 2OZUA 2LC2A 3B02A 4ENJA 2MW8A 4IQ4A 1IUFA 3OS0A 3BTCA 3ZRGA 2DBBA 2QQ9A 3DBHB 2AQFA 2IS2A 3T1BA 1D1BA 3GTMJ 3HKZA 4M3GA 3WG9A 5FGMA 2CMPA 2P0WA 4ZJZA 3KLOA 4AYBN 3DXJF 3D0SA 4IF4A 3ERED 1FOWA 3DBLB 1AHDP 1X1BA 2Y9YA 3E3VA 4CYDA 3J80Z 5E17F 1MNEA 1ZRCA 3FKJA 3HUGA 2LRDA 5H20A 5FROA 4RB3C 1W7PB 1FIAA 2HQ5A 2KHMA 3BROA 4RDUA 2H1LA 2CV1A 1F43A 1GV2A 2Q0OA 4AD9A 2NS7A 1G3YA 2WAEA 3I0TA 3TKYA 2NVTJ 3A4CA 3SYTA 3H3VK 1AKHA 3FXUA 1BW6A 2BY1A 3F8BA 3DEUA 1O3TA 4U7DA 5A2QK 1B4AA 1ZKGA 2ZJQF 1ERDA 2K9QA 4DZPA 3LFKA 2TRTA 3FM5A 5M3MJ 2LVSA 4L18B 3GXOA 3I5UA 1BL0A 2JQ7A 1E3PA 2UV1A 2PBIA 2LF8A 4AU7A 2MLKA 3VYSB 2HPMA 2R7TA 1UJ8A 2EFNA 3ZMZA 1A6IA 4D5CA 2BZTA 1WI9A 3ABMH 3M4OJ 4RS8A 3K10A 1DP3A 4KJZA 1O3QA 1WH7A 5LGUA 4XN3A 3JR9A 3FWEA 4HNTA 3P9CA 1YS7A 2XSJC 1USTA 3SFIA 1BI2A 3QQAA 5DYMA 4QSHA 1Z3YA 4Q47A 3OIOA 5F64A 4M3EA 3QPSA 1R58A 3LAPA 3DCFA 1TTYA 2XGXA 2R7SA 1IZ1A 2XF7A 1Y6IA 2KMUA 2W84A 3DKWA 4GGGA 3S93A 3ZQHA 4XLEA 3DEWA 1P7JA 5LRSA 3JW4A 3H5NA 4YFKF 1RUNA 1REPC 3OMYA 3H92A 1U9NA 1JE8A 6PAXA 3ZN1A 3JSPA 1KU3A 5IPAA 2F5FA 4W1UA 1FP2A 3FHZA 2E35A 3E7LA 3SDBA 1QPIA 3JCUC 3LSIA 2EFWA 3BR6A 4LG0B 1P6RA 2VKDA 1YRNB 1G6NA 2NRAC 3HSEA 3GLXA 1DP7P 1I3AA 3JRCA 2CQ7A 2RQPA 2QEXI 5DDGA 4E6KG 5JLWA 3OS1A 4II3A 1P7IA 4M3BA 1QZZA 5EZGA 3E5XA 2R7RA 3UNGC 1YLFA 1ZRFA 3S15J 3I71A 3HSRA 4KT5C 1FOXA 3FBNB 4BHCA 1I1SA 4B3AA 4MQ9F 4PJMA 1MJAA 4L5IA 4OAZA 3JAMZ 1OKRA 1Z6RA 4ZYAA 1D0YA 4EJVA 2E1CA 4IRGA 4XOTA 2BOLA 1AWCA 2E7WA 4CHUA 2ZXHA 3Q0VA 5C3EJ 1ORKA 3CCJI 1FWZA 4AUXA 2VT2A 4FISA 3O6BB 2M87A 1JUPA 1WFXA 1YJNI 3FXJA 5HDKA 2FQ4A 1UZCA 2A5YB 2WB1N 2KFDA 1G3SA 2LMDA 2M8GX 3RQ4A 3EUHC 3CCUI 3CD6I 1LE8B 2VJJA 1NG6A 1CGPA 3C1DA 5BNGA 3A1YA 3B73A 3BOQA 5LEJA 1ZH5A 3LSRA 5K7HA 4X1EA 3WU2C 2R5YA 4LB5A 2VBZA 3K1NA 2HQAA 1XCBA 2HPIA 1TC3C 5ED4A 1BR4A 2HTJA 5CQGA 4A3CJ 5E3LA 4YEJA 2VB6A 5ICEA 3JREA 4QWQA 4ZYDA 3PSIA 4UUSA 3SDGA 2JJ7A 1EH8A 3ABUA 3ZMVA 3OYIA 4BDZA 4DYCA 2VN2A 3VDXA 4CCOA 2E5NA 3BQYA 1X58A 5HOOA 1BOBA 4HEA2 1QPMA 2XAGA 5DCMA 4C2UA 1LEAA 3S2DJ 4U87A 5ILUA 2QQ8A 3ZQIA 3J81Z 3FXKA 5EEHA 1VFCA 1K4TA 3QYFA 3RTRA 3JTGA 4PUSA 1IG7A 4EGZA 5KAFC 2FUG2 3IKVA 4LOCA 4RLQA 1DPRA 2WY7Q 2JSCA 3JRIA 2NNYA 2B63J 1ONVA 3JRGA 2F6CA 2WWYA 1J0RA 1F1ZA 2DA6A 2HGCA 1QRYA 5F1RA 3V7SA 2F5EA 1LJ9A 1ZR2A 3OY9A 2IXSA 4L0YB 1G3WA 2O7OA 4UUVA 3AG3H 4AIKA 1V5FA 2MLGA 4M3DA 3W3CA 3OL4A 1R6RA 4XKWA 1D0ZA 4UV9A 1ZARA 3K0LA 2BY0A 3F3XA 4D7NA 3HUGB 3WTVC 5TRDA 5DEQA 2MFZA 2WAFA 5TGTA 2X6XA 4XRSA 1E3HA 2Y48A 3SEQA 4BEHA 2LBFA 2E5ZA 3NEUA 5J8FA 1ZYRF 2E34A 4LK1F 3SJMA 1Y0UA 1TWGJ 2L9SA 1VQOI 4KICA 1R4MB 5EDNA 3JRHA 1YOVB 4I01A 4B09A 3LA3A 1W1WE 1R1UA 2HKXA 1U9OA 1T38A 3RKXA 3TGNA 4EJOA 5GADJ 4AYBA 4E7IA 3R0JA 4IEJA 1L0OC 1OFCX 1BC7C 3GF2A 2UWMA 4OINF 4BBSJ 3CUQC 2K40A 1G59A 2GXAA 3AG1H 5ILVA 2M7BA 3K7AJ 1W36C 5TISC 2QVOA 2FEZA 2FE3A 3BPVA 1FX7A 4DJAA 2HVSA 1LVKA 2EQRA 2EV0A 4CUGA 4XL9A 2GZWA 3HTUA 1D1CA 2R7VA 2A61A 1EH6A 4Y15A 4DIQA 3BJOA 3V8KA 1IW7F 4CICA 3I4MJ 4UY8I 3IWFA 4I09A 3U2RA 4KIBA 1JUMA 2EA2A 2HDWA 4C2TA 2C6YA 5J47A 5EEGA 3VSKA 4IHVA 4KA4A 3Q0UA 1B6AA 4IRHA 2ME6A 5E3NA 3TDZC 1K79A 1LPQA 4HNVA 5D5VB 2KP6A 2GM4A 1Z3XA 2V79A 2HWVA 2XF6A 3HDDA 5M5WJ 4Z2YA 1NTCA 2MSYA 1P9QC 5DM6F 1QBJA 2PEXA 2YPRA 1BI3A 1A31A 2BEOA 4H0EA 2ZFWA 4KIGA 4Y33A 3VYUB 2VQGA 1GDTA 1TNSA 4CH7A 3CJQB 3CC2I 4OIRF 2QKLB 4LLGF 2E2JJ 2QQAA 3CMAI 5LGTA 2P5KA 4XR6A 2F4IA 3HRUA 1RZ4A 4G6DA 1ETWA 4LGWA 2BBYA 4N0BA 1JHHA 2CFOA 2DA7A 1IV6A 3LNQA 4G7OF 2VQLA 2DFFA 2H6CA 1D1AA 1VQ8I 3O8HA 2UXXA 4M71A 2LF7A 1HKTA 2FA5A 4BBRJ 2EZIA 1BI0A 2F2EA 4IHWA 2KRCA 3OYMA 4G8XA 4D1QA 2WY8Q 2CFXA 2QUFA 5DTDA 1X3ZB 3HGGA 5F0FA 4UB6C 1I39A 2LDUA 2BXZA 3FDYA 3GO5A 4O6JA 4KISA 2IA0A 2V6CA 2BW3A 1R5ID 5J1RA 4E4HA 2CU7A 3L2UA 1T08B 5M3FJ 3FX3A 3QOEA 1GVDA 5IYCJ 3R4KA 1EH7A 1DPUA 3WTWC 1RNLA 2ZNZA 4J01A 1TBXA 2CSOA 2JA5J 1M1EB 2D45A 4I2OA 3M1EA 4CDGA 5D5XB 4WXDA 3CF2A 1XD7A 4YFXF 4BQNA 1WSUA 3KP4A 4NNJA 1GT0C 2A6EF 2MD0A 3V7CA 4EM1A 2CO5A 2JZYA 4IZZA 4N4OB 2EWNA 3E5QA 3ELKA 3MQ0A 2R5YB 1U5TC 3V7RA 3MAJA 2XROA 1XTAA 1YG2A 2CQKA 2YR2A 1FBSA 4XRMA 3F9KA 4FHTA 4P96A 4DBQA 1E3OC 4OMZA 4M9SA 3JRBA 2VXDA 2L7FP 3AG2H 2XB5A 5E8IA 2MG4A 4Y7NJ 4HDUA 1N75A 3P5JA 1QVUA 5DCMB 3M8FA 1FOKA 5IT9K 3KETA 2VC1A 3CUOA 3M8EA 3I55I 2VUMJ 3QPLA 3MKZA 4BHBA 3BR0A 4A3KJ 3IAM2 1HF0A 2D1HA 4EEFG 5LHGA 3CUQA 1MMSA 4C3JJ 1MBKA 3G73A 2HEOA 2V6EA 1OR7A 1P2FA 1X1PA 1RI7A 3VPRA 3BZCA 3OS2A 2XKOA 4JBAA 2K85A 1V3FA 1XDSA 3PM1A 2XAHA 2XAQA 1K4SA 5FFXA 3A01A 1T56A 3T8RA 1PUEE 1F5TA 1YW9A 1MMDA 4Q48A 1Z1DA 2HVRA 2XPWA 1HXDA 5EF6A 3BT9A 1V55H 2GLOA 1FTTA 3RPQA 1OYWA 5D8LB 5GAEJ 1Z67A 3GUDA 1WZ2A 1IRXA 3CQZJ 2E1MB 4BEHB 1ZLKA 3X2QH 2FNPA 4DQ2A 2DAOA 2LBFB 2X6OA 2VODA 3OYLA 4ASNA 3CDLA 3MEXA 2FMYA 2IRFG 2K3FA 4KNYA 3RKYA 1IN4A 2RC4A 4H4KC 3F6VA 1XMKA 3TQNA 3JSOA 3I3LA 1T95A 3T8TA 4CSWA 1AU7A 4IJAA 2RN7A 2EFQA 4NDLA 3UKGA 1JGSA 2QLZA 4IHXA 3HBLA 2JA7J 2JA8J 2EFPA 5EEAA 1MBEA 5CLSA 2YS9A 1O57A 2ICWG 3HOYJ 1LDKB 1LFUP 4L9TA 3PNTA 2XKPA 5E3OA 3BG3A 3IRQA 1RESA 1SD6A 2IGMA 3S32A 3GZ5A 4HAMA 4CZCA 2R0QC 4GRIA 2IAIA 1FT9A 3IC7A 3BR1A 4ESFA 2Z2SB 4A3GJ 4LG0A 3ASOH 2W25A 3WHBA 5FKMA 4BE2A 1JHFA 2ZC2A 4MIMA 3GFMA 3W6KB 2YX4A 2ZJRF 1OLTA 2X0LA 4RM2A 3CC7I 1HC8A 4C2MJ 1V5EA 2QF7A 3OYFA 3BC8A 2ELKA 2BVLA 1YIOA 1R71A 1BIAA 1X3WB 2VXZA 4ENNA 5JVGF 2M5WA 1XDUA 1GLNA 4OWRB 3CCLI 3I56I 3JRAA 2LP0A 2LR8A 5B1BH 1E2XA 4UVAA 2MBFA 4S05A 4K2EA 1PYVA 2DA4A 2BYVE 1SVMA 2VOOA 4HDVA 1S7EA 2L4AA 4XOPA 2R7DA 3S14J 1ZQ3P 5JFRA 4JK1X 3OYDA 2DOEA 2DMUA 2M0CA 3BJAA 3HOXJ 2Y0SN 4AVZA 2G9WA 1RKWA 2EBIA 3IH3A 1N78A 5HLIA 5KK1A 3I4NJ 1HOMA 2VBXA 3C3WA 2DFEA 2R7FA 1CF7A 1QVTA 2E2IJ 2EV6A 5EZHA 3RIRA 2EPFA 2P5VA 5KCMA 5LD2C 3OR2C 3GTJJ 4RB2C 1HQCA 4LIUA 1I6HJ 1WJCA 4A3MJ 2DXIA 3HOWJ 2CRGA 2MA3A 3FMRA 2NVQJ 2GA1A 1GXQA 3CESA 1STZA 1TP4A 2CUEA 2EH3A 4JYKA 4E7JA 2CQXA 1IXSB 2FMLA 5FD6A 2JPCA 3AL0C 4UVCA 1FPQA 1OJLA 4XRSG 4GO1A 4E7ZA 2E36A 4HBLA 2E19A 1ETKA 1MGTA 2ECBA 1S7OA 2BW3B 1XN7A 4DNCA 3Q0WA 2VT3A 2VJIA 5ICGA 5GPCA 3TO6A 4C9YA 4EM2A 2R7WA 5IP7J 2V7FA 3K70C 4A6DA 3BWGA 3TO7A 4Y17A 1PUFB 5F6FA 2K9NA 1HKSA 2QSHX 3S3NA 3L7WA 4B43A 4AC0A 1YYVA 2LNBA 4G94A 4XKVA 2K9MA 3ZMUA 3CCVI 1R23A 4YIFA 2NS0A 3H36A 4BS9A 2KPMA 3DV8A 2IGOA 3WTTC 1D8KA 1LUJB 1W0TA 1UAAA 1USSA 2FBKA 5HS7A 2K02A 2CG4A 5C44J 3TOBA 3RKQA 3GTQJ 1X4OA 2ZXWH 1WJAA
chains in the Genus database with same CATH topology
1XMAA 2COMA 3ZQ7A 1S6LA 2IP2A 4P9UA 5LRRA 3MCZA 2JT1A 2KRFA 1QZYA 5JI6A 2KJBA 3KP3A 2PG4A 2E7XA 4RGRA 2Y75A 5KVRA 2P4WA 3IRRA 2GXBA 4HLXA 3CUQB 2VOPA 3GYHX 2DTRA 2HYGD 1K6OA 2ESHA 2CWEA 2A07F 1O7LA 3RDIA 1S3JA 2EFOA 2QQBA 4HYEA 4ENMA 2KIFA 5BMZA 1U3EM 1TW3A 2AS5F 3KEOA 5HDGA 2P5LC 3F8FA 4ENKA 1GXPA 1FBQA 1OYYA 2A68F 1ODDA 4A5NA 2VC0A 4U0WA 5E1WA 4XLNF 3KP6A 3VB2A 3HIFA 1FBUA 5ERIA 3KP2A 3EDPA 2NAZA 3DFGA 1I1GA 4OOIA 3F22A 3QU3A 2XV4S 5L3EA 1WKMA 1SD4A 3KCCA 5IT9Z 2XVCA 3F8NA 2H6BA 2DPDA 3HRTA 2ZMEA 5DV5A 4EJWA 4G7ZF 1MJ9A 4I7HA 4M9ZA 1KYWA 1IN7A 4HOBA 4PDKA 3L09A 4XLPF 4P9FA 3EYIA 2FNAA 4A2UA 3N97A 3WU0A 3H3UA 2DI3A 2PMUA 3N4MA 5D8KB 4HF0A 2HOEA 2OD5A 1KGSA 3NRVA 2ZBKA 3ABTA 4WWCA 2H09A 3EYYA 1CF7B 4AVPA 1IXCA 2M30A 1YS6A 2R3SA 2ELHA 2GWRA 5DUKA 3GFJA 4R8HA 3G3ZA 5E1XA 3RPUA 1B59A 1ZG5A 1HW2A 4CGZA 1H9GA 1O3SA 1TQMA 1TW2A 1R5HA 3K1MA 5L3DA 1ZGJA 1FZPB 2Z99A 4LLLA 1U8RA 1LEBA 1KU9A 4U7BA 4OIQF 4KN4X 2EJRA 3MWMA 1D8JA 3HRSA 1ZAOA 2HYFA 3MFKA 2IJLA 4KMFA 1HBXG 3E6DA 1YQAA 2BE5F 1XGMA 2HR3A 3FZVA 4AIHA 5DD4A 4ESJA 4OMYA 2FBHA 2ESNA 3CO7C 3LA2A 4HLYA 2JRTA 2E1NA 2P7VB 4UV8A 5BPIA 4UVBA 4WX9A 5FLXZ 5AONA 4RB0A 1LDDA 3HHHA 4IVNA 3ISPA 2W57A 1OYIA 4BXUA 1SD5A 2IA2A 4IXAA 2HKOA 4LMYA 1U78A 4IHSA 4RGSA 2HQNA 1IN6A 4Q4ZF 1BOAA 5LEKA 2ZXJA 4R1HA 4GCVA 4MNUA 1SAXA 2HZTA 1PDNC 2A6HF 1IUYA 2JPBA 2STWA 3QPTA 5LHIA 4MEYF 2KKOA 3KE2A 1DDNA 4KUMA 1QGPA 2M8EA 2GXGA 2CYYA 2KIMA 3LA7A 4P55A 3GW2A 5LGNA 1H9TA 2ZO4A 2RNJA 1L3LA 1ZREA 4NQWA 1ZHFA 2WC2A 4LFUA 5ICCA 2L54A 1IXRC 3WTYC 3WTUC 3EUHA 2V9VA 3KP5A 4M6YA 4NHJA 2K7LA 4HX4A 1P4XA 5TJJA 3BJ6A 1TNTA 2KJCA 1IF1A 4YG2F 1G4DA 2PMHA 3CO6C 3M7GA 5BS6A 2UZKA 4I98B 2PQ8A 3VEPA 5A2QZ 1ZLJA 2CGPA 2ZMEB 1Z05A 4KIFA 1KQ8A 3REOA 4MGRA 4FT8A 4AWXB 3K1PA 3E6BA 3QP5A 2A3SA 3ML6A 1SFXA 3HRMA 1E17A 4BAYA 3Q5FA 3WE2A 3IHUA 3GEZA 2RV8A 5FD5A 2CW0F 5HDNA 3AAFA 4OIOF 3DF8A 5FB2A 4BH9A 3FMSA 4MHGA 1GVJA 3F6OA 3GVAA 2BGCA 1J7KA 3F72A 3FXQA 5K5QA 4F7ZA 4L9JA 3C7JA 2XUBA 4WK8F 2XHKA 3HTSB 2M1BA 3BP8A 4ZZDA 2P7CB 1MD0A 1BM9A 4CXFA 5K1YA 3QAHA 1I6XA 4IPAA 3RYPA 2QWWA 5CVVA 4BQAA 1R5GA 2F5CA 4KN7X 3WGHA 2ZNYA 3RKWA 3R0AA 3CLOA 3WE3A 4ZYGA 5H6QA 2O0YA 5K5OA 3IWZA 3L9FA 1T98A 2MD5A 2ACJA 2HQRA 2PFBA 1BBYA 2OQGA 1HSTA 3ZP5A 5HLHA 1BN5A 2VE8A 2K86A 1S7AA 1V4RA 3L00A 3JAMK 4WXCA 3CDHA 4FX4A 4HQMA 2P6SA 1QNTA 2OA4A 4LJZF 1FP1D 2W85A 3GFLA 2YX7A 4CO8A 4G6QA 1I27A 2EA4A 3GFIA 4GYIA 2Z33A 4M9XA 4JQFA 2ETHA 1T2KA 1ZRDA 4EJUA 1ZG3A 5BOXA 1FSHA 4KDPA 2P6TA 4EM0B 3ZMDA 2O6GE 3DP7A 2EK5A 2Q2EA 3U1DA 1I5ZA 1OPCA 2ISZA 5CVJA 1SMYF 4TV7A 3V8LA 4FX0A 3QU6A 5L3GA 4RAYA 1NHAA 4Y13A 3DQVC 3K2ZA 2GA2A 4MTEA 1FLIA 3DPLC 1P4WA 3QRFF 4L5JA 4HQEA 3FM3A 1BC8C 1UFMA 1KU7A 2L02A 5CVIA 1R1TA 2IPQX 2DFIA 2O3FA 1U5TA 1J5YA 4MQVA 3GWZA 3LSTA 4O3MA 4HF1A 2DU9A 3COAC 1T6SA 1XGNA 3ZPLA 2Y0MA 2IVMA 4HV5A 1KQ9A 2O61A 3V8JA 4M72A 5D5UB 1XSVA 3LQQA 2UXNA 3ROUA 1U6GA 5D6EA 4KMUX 4UHTA 3ECHA 2DQLA 3CJNA 3BPXA 3GZ6A 4P5OA 3WGGA 2D1VA 2RKHA 3WODF 2DLLA 2MC3A 4YIIA 1VTNC 2FF4A 5IT3A 1IRFA 2FQ3A 3R60A 1WQ2A 2ZJ2A 2HDCA 4RGXA 5HLGA 2LSOA 3E97A 3BDDA 4IHTA 3BZ6A 3J7AO 4RGUA 2FXAA 4EGYA 1YO5C 4HX7A 1LQ1A 2DK8A 2EB7A 1A04A 2JTVA 2Z5UA 1ZGAA 1MJBA 1B9NA 2PI0A 3I59A 5LBQA 2WV0A 1FSEA 3I58A 4QLCU 3WGIA 1R7JA 2DPUA 2X4HA 4LD5A 4HA8A 3I64A 1IRGA 3TO9A 3E6CC 1MKMA 2FSWA 3Q9SA 1FYMA 3QOPA 2FOKA 2V1DA 4PGGA 2F5DA 5L3BA 5HS9A 4WCGA 2XIGA 1W5TA 3FF5A 1RUOA 3S2WA 1FNNA 2Z9OA 1D5VA 1S29A 3EETA 1JXSA 3TDUC 1T39A 3OOPA 3MZHA 3RI4A 1PP7U 3VFZA 3O2PE 5DD8A 1S8NA 2BV6A 4LLNA 1LNWA 3W6JB 3FXRA 1KA8A 4BHPA 1J59A 3GX4X 5D4SA 3ZN0A 2DW4A 1BIBA 3LQRA 1IN8A 4M73A 2XAFA 4EVIA 3R61A 1B9MA 3SHFA 4M74A 1Z91A 1G3TA 5E1ZB 2GQQA 4IRIA 2PJPA 2ZKZA 2NNNA 1P4AA 1U2WA 1QQIA 4PGHA 5DCFA 3HHGA 3KLNA 4I0BA 4XSXF 2QBYA 2PN6A 1DUXC 1FYKA 1U5TB 2J5PA 3U9GA 4ON0A 1SMTA 3RYRA 3LWFA 2V1XA 1ZN2A 2LKPA 4ETSA 3HSFA 3SFZA 5ILSA 1LB2A 5J6XA 1UHWA 4AIJA 3KEQA 4XBFA 4BYYA 2OAZA 3P9IA 4LB6B 3E6MA 3HYIA 1D3YA 2QM3A 3MZYA 4L9NA 5E8GA 4EQQA 2G7UA 1TQIA 4B8XA 2WTEA 2TDXA 2O03A 5J8CA 1MDMA 1Q1HA 4OU0A 3SZPA 2W24A 5DUIA 1UCRA 4ESBA 2D2WA 1EV7A 3CTAA 2RDPA 1K78A 4A6EA 2DK5A 3VODA 1P92A 4KYWA 2VBYA 3EQLF 2MH9A 3JTHA 4N9IA 4A5MA 3IL2A 4E70A 1R1VA 1F4KA 3I59B 1H0MA 2L4MA 1XB4A 3K69A 4EV0A 3KZZA 4OIPF 1J9IA 1KQ0A 2HTSA 2IW5A 1F9NA 1ON2A 2AXLA 2GAUA 4U0VA 4Q5SF 1OMIA 1ULYA 3KZYA 2DT5A 1R22A 2IA1A 3FMQA 2M45A 3WTSC 2G7HA 1ON1A 2MH2A 4L9VA 2B0LA 1XSDA 4UXNA 2J5OA 4WF2A 4HV6A 5FO5A 2HS5A 5D6FA 4A0YA 3NQOA 3F21A 1R00A 1SD7A 1C0WA 1WWXA 2Z3YA 4EMSA 3H3ZA 3HOSA 5JVTA 1PP8F 2OZ6A 2ZCWA 3P7NA 4PZJA 5FFZA 3T5XA 2XAJA 4BNCA 4L0ZB 3KP7A 4PCQA 2QENA 4I02A 2DO7A 3J80K 4UNOA 4WXHA 4ZYEA 4YFNF 1X3UA 2EV5A 2OBPA 4RB1A 2QYOA 1SFUA 1QO0D 1YFHA 2DQRA 5H6RA 2H94A 3SQNA 1B1BA 4G9YA 5BPDA 1TLHB 4A0ZA 1J2XA 5D4RA 3PFIA 4O5VA 4HF2A 5JR3A 4XSZF 3ZMTA 2QBYB 2K4BA 1HSJA 2NYXA 4ZZLA 2K4JA 2VONA 1O7FA 2ISYA 4RAZA 3PQJA 1W7PD 1TQPA 2V1UA 1HKQA 1W5SA 3F8MA 5D5WB 2HFHA 2XASA 4KFCA 3QPHA 3K9TA 2Q8KA 4ZH4F 2GIVA 1AOYA 5E18F 3F23A 1LDJA 1W7PA 4M6XA 1KU2A 2FU4A 3SZTA 5LLQA 1UB9A 2RVCA 3D5LA 4HX8A 1MDMB 1IN5A 2YSRA 2STTA 5AIPA 3SXYA 2KIUA 3QP6A 3WTZA 3M9AA 3E5UA 2FRHA 3HOTA 1Z6TA 3DPTA 1FY7A 1K78B 3P9KA 1WRJA 5HVQC 4ZYHA 1MZBA 2O8XA 4XRFA 1XCVA 3RJPA 3WTXC 4S04A 5L3CA 1FYLA 2FBIA 3KFWX 1J75A 1GHCA 4GXOA 1IAWA 4NB5A 5CVUA 1UHMA 2A69F 5L3FA 1W4MA 2VE9A 4MEXF 3I54A 5K5RA 2YU3A 1T0FA 2L01A 1FC3A 3ZMSA 5E20A 3Q9VA 1K7AA 3C18A 1HW5A 1YTYA 2OQRA 5LHHA 2PLYA 3ULQB 3J81K 1XGOA 2VBWA 4HW0A 2IT0A 1YW7A 4D0PA 4G7HF 3WU1B 4U88A 4A12A 4N9HA 2L3DA 2H27A 3R6SA 5CVRA 1RIOH 3BY6A 2P8TA 5CJ9A 3V4GA 3VOEA 4EJTA 1O3RA 5CYVA 3ECOA 1LVAA 3LAJA 3L2CA 3PQKA 3OV8A 3T0YA 4R79A 2K27A 4CZZA 1KYZA 1HW1A 5AIQA 5FLXK 4MTDA 4HZFA 2OU2A 2XRNA 5ICFA 3IKTA 5BQTA 4I0AA 2ADUA 2RGVA 1SFEA 4GYGA 1Z9CA 1XGSA 5JHUA 1Z7UA 5HS8A 1BI1A 4LK0F 3TOAA 4A0XA 3I53A 1R36A 4U0YA 1XSXA 2QZ8A 1ZG1A 3I4PA 3F8CA 1YW8A 1BJAA 3O3KA 2OZUA 3B02A 4ENJA 2DBBA 2QQ9A 3T1BA 3WG9A 5FGMA 3KLOA 3DXJF 3D0SA 4IF4A 3ERED 3E3VA 4CYDA 3J80Z 5E17F 1ZRCA 5H20A 3HUGA 4RB3C 1W7PB 3BROA 2Q0OA 4AD9A 1G3YA 3I0TA 3TKYA 3FXUA 3F8BA 3DEUA 1O3TA 4U7DA 5A2QK 1B4AA 3LFKA 3FM5A 4L18B 3GXOA 3I5UA 2PBIA 2LF8A 2MLKA 2EFNA 3ZMZA 1WI9A 4RS8A 1O3QA 5LGUA 3FWEA 3P9CA 1YS7A 1USTA 1BI2A 5DYMA 4Q47A 5F64A 1R58A 3LAPA 1TTYA 2XGXA 1IZ1A 3DKWA 2W84A 4GGGA 5LRSA 3JW4A 4YFKF 1RUNA 1REPC 3H92A 1JE8A 6PAXA 3ZN1A 3JSPA 1KU3A 2F5FA 1FP2A 3FHZA 2EFWA 4LG0B 1P6RA 1G6NA 2NRAC 3HSEA 3GLXA 1DP7P 2RQPA 5DDGA 1QZZA 3E5XA 1YLFA 1ZRFA 3I71A 3HSRA 4KT5C 1I1SA 4BHCA 4MQ9F 1MJAA 4L5IA 3JAMZ 1OKRA 1Z6RA 4EJVA 2E1CA 4IRGA 1AWCA 2E7WA 4CHUA 1FWZA 2VT2A 3O6BB 2M87A 5HDKA 2A5YB 1G3SA 1CGPA 3C1DA 3B73A 3BOQA 5LEJA 1ZH5A 4LB5A 2VBZA 3K1NA 1XCBA 5ED4A 2HTJA 5ICEA 4QWQA 4ZYDA 3ABUA 1EH8A 3ZMVA 2VN2A 5HOOA 1QPMA 2XAGA 5DCMA 1LEAA 5ILUA 3J81Z 5EEHA 3RTRA 3JTGA 4EGZA 3IKVA 1DPRA 2JSCA 2NNYA 1ONVA 2WWYA 1J0RA 1F1ZA 2HGCA 5F1RA 3V7SA 2F5EA 1LJ9A 4L0YB 1G3WA 4UUVA 4AIKA 2MLGA 4UV9A 1ZARA 3K0LA 3F3XA 5TRDA 3WTVC 5DEQA 2Y48A 3NEUA 5J8FA 1ZYRF 4LK1F 1Y0UA 4KICA 4I01A 4B09A 3LA3A 1R1UA 2HKXA 1T38A 3RKXA 3TGNA 4EJOA 3R0JA 1L0OC 1BC7C 3GF2A 2UWMA 4OINF 3CUQC 5ILVA 2QVOA 2FEZA 2FE3A 3BPVA 1FX7A 2EV0A 2GZWA 3HTUA 2A61A 1EH6A 4Y15A 3BJOA 3V8KA 1IW7F 4CICA 3IWFA 4I09A 3U2RA 4KIBA 2EA2A 2C6YA 5EEGA 4KA4A 4IRHA 1B6AA 3TDZC 1K79A 5D5VB 2V79A 2HWVA 4Z2YA 1QBJA 2PEXA 2YPRA 1BI3A 2BEOA 4H0EA 2ZFWA 4KIGA 1TNSA 4OIRF 4LLGF 2QQAA 5LGTA 2P5KA 3HRUA 1RZ4A 4G6DA 4LGWA 2BBYA 4N0BA 1JHHA 4G7OF 2H6CA 2UXXA 4M71A 2LF7A 1HKTA 2FA5A 1BI0A 2F2EA 4G8XA 2CFXA 2QUFA 3GO5A 2LDUA 4O6JA 2IA0A 2V6CA 3FX3A 3R4KA 1EH7A 1DPUA 3WTWC 1RNLA 2ZNZA 1TBXA 2CSOA 2D45A 4I2OA 3M1EA 4CDGA 5D5XB 4WXDA 1XD7A 4YFXF 1WSUA 3KP4A 2A6EF 3V7CA 4EM1A 2CO5A 2JZYA 2EWNA 3E5QA 3ELKA 3MQ0A 1U5TC 3V7RA 3MAJA 2XROA 1YG2A 2CQKA 2YR2A 1FBSA 4P96A 4FHTA 4OMZA 4M9SA 5E8IA 4HDUA 5DCMB 3M8FA 1FOKA 5IT9K 3KETA 2VC1A 3CUOA 3M8EA 4BHBA 2D1HA 5LHGA 3CUQA 3G73A 2HEOA 1OR7A 1P2FA 1RI7A 2XKOA 4JBAA 1V3FA 1XDSA 2XAQA 2XAHA 5FFXA 1PUEE 3T8RA 1F5TA 1YW9A 4Q48A 1Z1DA 1HXDA 3RPQA 1OYWA 5D8LB 3GUDA 1ZLKA 2FNPA 4DQ2A 2DAOA 2VODA 4ASNA 3MEXA 2FMYA 2IRFG 4KNYA 3RKYA 1IN4A 2RC4A 3F6VA 1XMKA 3TQNA 3JSOA 3T8TA 4IJAA 2RN7A 2EFQA 1JGSA 2QLZA 2EFPA 5CLSA 1O57A 1LDKB 4L9TA 2XKPA 3IRQA 1SD6A 3GZ5A 4HAMA 1FT9A 3IC7A 4ESFA 4LG0A 2W25A 1JHFA 3GFMA 3W6KB 2YX4A 2X0LA 1YIOA 1BIAA 2VXZA 4ENNA 2M5WA 1XDUA 1E2XA 4UVAA 2MBFA 4S05A 4K2EA 2BYVE 2VOOA 4HDVA 2L4AA 2R7DA 5JFRA 4JK1X 3BJAA 2G9WA 5HLIA 5KK1A 2VBXA 3C3WA 2R7FA 1CF7A 2EV6A 3RIRA 2P5VA 4RB2C 1HQCA 3FMRA 2MA3A 2GA1A 1GXQA 1STZA 1IXSB 2FMLA 5FD6A 2JPCA 4UVCA 1FPQA 4GO1A 4HBLA 1MGTA 1S7OA 1XN7A 4DNCA 2VT3A 5ICGA 3TO6A 4EM2A 4A6DA 3BWGA 3TO7A 4Y17A 5F6FA 1HKSA 3L7WA 1YYVA 2LNBA 4G94A 3ZMUA 1R23A 4YIFA 2NS0A 3DV8A 3WTTC 1D8KA 1USSA 2FBKA 5HS7A 2K02A 2CG4A 3TOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMA A;  2COM A;  3ZQ7 A;  1S6L A;  2IP2 A;  4P9U A;  5LRR A;  3MCZ A;  2JT1 A;  2KRF A;  1QZY A;  5JI6 A;  2KJB A;  3KP3 A;  2PG4 A;  2E7X A;  4RGR A;  2Y75 A;  5KVR A;  2P4W A;  3IRR A;  2GXB A;  4HLX A;  3CUQ B;  2VOP A;  3GYH X;  2DTR A;  2HYG D;  1K6O A;  2ESH A;  2CWE A;  2A07 F;  1O7L A;  3RDI A;  1S3J A;  2EFO A;  2QQB A;  4HYE A;  4ENM A;  2KIF A;  5BMZ A;  1U3E M;  1TW3 A;  2AS5 F;  3KEO A;  5HDG A;  2P5L C;  3F8F A;  4ENK A;  1GXP A;  1FBQ A;  1OYY A;  2A68 F;  1ODD A;  4A5N A;  2VC0 A;  4U0W A;  5E1W A;  4XLN F;  3KP6 A;  3VB2 A;  3HIF A;  1FBU A;  5ERI A;  3KP2 A;  3EDP A;  2NAZ A;  3DFG A;  1I1G A;  4OOI A;  3F22 A;  3QU3 A;  2XV4 S;  5L3E A;  1WKM A;  1SD4 A;  3KCC A;  5IT9 Z;  2XVC A;  3F8N A;  2H6B A;  2DPD A;  3HRT A;  2ZME A;  5DV5 A;  4EJW A;  4G7Z F;  1MJ9 A;  4I7H A;  4M9Z A;  1KYW A;  1IN7 A;  4HOB A;  4PDK A;  3L09 A;  4XLP F;  4P9F A;  3EYI A;  2FNA A;  4A2U A;  3N97 A;  3WU0 A;  3H3U A;  2DI3 A;  2PMU A;  3N4M A;  5D8K B;  4HF0 A;  2HOE A;  2OD5 A;  1KGS A;  3NRV A;  2ZBK A;  3ABT A;  4WWC A;  2H09 A;  3EYY A;  1CF7 B;  4AVP A;  1IXC A;  2M30 A;  1YS6 A;  2R3S A;  2ELH A;  2GWR A;  5DUK A;  3GFJ A;  4R8H A;  3G3Z A;  5E1X A;  3RPU A;  1B59 A;  1ZG5 A;  1HW2 A;  4CGZ A;  1H9G A;  1O3S A;  1TQM A;  1TW2 A;  1R5H A;  3K1M A;  5L3D A;  1ZGJ A;  1FZP B;  2Z99 A;  4LLL A;  1U8R A;  1LEB A;  1KU9 A;  4U7B A;  4OIQ F;  4KN4 X;  2EJR A;  3MWM A;  1D8J A;  3HRS A;  1ZAO A;  2HYF A;  3MFK A;  2IJL A;  4KMF A;  1HBX G;  3E6D A;  1YQA A;  2BE5 F;  1XGM A;  2HR3 A;  3FZV A;  4AIH A;  5DD4 A;  4ESJ A;  4OMY A;  2FBH A;  2ESN A;  3CO7 C;  3LA2 A;  4HLY A;  2JRT A;  2E1N A;  2P7V B;  4UV8 A;  5BPI A;  4UVB A;  4WX9 A;  5FLX Z;  5AON A;  4RB0 A;  1LDD A;  3HHH A;  4IVN A;  3ISP A;  2W57 A;  1OYI A;  4BXU A;  1SD5 A;  2IA2 A;  4IXA A;  2HKO A;  4LMY A;  1U78 A;  4IHS A;  4RGS A;  2HQN A;  1IN6 A;  4Q4Z F;  1BOA A;  5LEK A;  2ZXJ A;  4R1H A;  4GCV A;  4MNU A;  1SAX A;  2HZT A;  1PDN C;  2A6H F;  1IUY A;  2JPB A;  2STW A;  3QPT A;  5LHI A;  4MEY F;  2KKO A;  3KE2 A;  1DDN A;  4KUM A;  1QGP A;  2M8E A;  2GXG A;  2CYY A;  2KIM A;  3LA7 A;  4P55 A;  3GW2 A;  5LGN A;  1H9T A;  2ZO4 A;  2RNJ A;  1L3L A;  1ZRE A;  4NQW A;  1ZHF A;  2WC2 A;  4LFU A;  5ICC A;  2L54 A;  1IXR C;  3WTY C;  3WTU C;  3EUH A;  2V9V A;  3KP5 A;  4M6Y A;  4NHJ A;  2K7L A;  4HX4 A;  1P4X A;  5TJJ A;  3BJ6 A;  1TNT A;  2KJC A;  1IF1 A;  4YG2 F;  1G4D A;  2PMH A;  3CO6 C;  3M7G A;  5BS6 A;  2UZK A;  4I98 B;  2PQ8 A;  3VEP A;  5A2Q Z;  1ZLJ A;  2CGP A;  2ZME B;  1Z05 A;  4KIF A;  1KQ8 A;  3REO A;  4MGR A;  4FT8 A;  4AWX B;  3K1P A;  3E6B A;  3QP5 A;  2A3S A;  3ML6 A;  1SFX A;  3HRM A;  1E17 A;  4BAY A;  3Q5F A;  3WE2 A;  3IHU A;  3GEZ A;  2RV8 A;  5FD5 A;  2CW0 F;  5HDN A;  3AAF A;  4OIO F;  3DF8 A;  5FB2 A;  4BH9 A;  3FMS A;  4MHG A;  1GVJ A;  3F6O A;  3GVA A;  2BGC A;  1J7K A;  3F72 A;  3FXQ A;  5K5Q A;  4F7Z A;  4L9J A;  3C7J A;  2XUB A;  4WK8 F;  2XHK A;  3HTS B;  2M1B A;  3BP8 A;  4ZZD A;  2P7C B;  1MD0 A;  1BM9 A;  4CXF A;  5K1Y A;  3QAH A;  1I6X A;  4IPA A;  3RYP A;  2QWW A;  5CVV A;  4BQA A;  1R5G A;  2F5C A;  4KN7 X;  3WGH A;  2ZNY A;  3RKW A;  3R0A A;  3CLO A;  3WE3 A;  4ZYG A;  5H6Q A;  2O0Y A;  5K5O A;  3IWZ A;  3L9F A;  1T98 A;  2MD5 A;  2ACJ A;  2HQR A;  2PFB A;  1BBY A;  2OQG A;  1HST A;  3ZP5 A;  5HLH A;  1BN5 A;  2VE8 A;  2K86 A;  1S7A A;  1V4R A;  3L00 A;  3JAM K;  4WXC A;  3CDH A;  4FX4 A;  4HQM A;  2P6S A;  1QNT A;  2OA4 A;  4LJZ F;  1FP1 D;  2W85 A;  3GFL A;  2YX7 A;  4CO8 A;  4G6Q A;  1I27 A;  2EA4 A;  3GFI A;  4GYI A;  2Z33 A;  4M9X A;  4JQF A;  2ETH A;  1T2K A;  1ZRD A;  4EJU A;  1ZG3 A;  5BOX A;  1FSH A;  4KDP A;  2P6T A;  4EM0 B;  3ZMD A;  2O6G E;  3DP7 A;  2EK5 A;  2Q2E A;  3U1D A;  1I5Z A;  1OPC A;  2ISZ A;  5CVJ A;  1SMY F;  4TV7 A;  3V8L A;  4FX0 A;  3QU6 A;  5L3G A;  4RAY A;  1NHA A;  4Y13 A;  3DQV C;  3K2Z A;  2GA2 A;  4MTE A;  1FLI A;  3DPL C;  1P4W A;  3QRF F;  4L5J A;  4HQE A;  3FM3 A;  1BC8 C;  1UFM A;  1KU7 A;  2L02 A;  5CVI A;  1R1T A;  2IPQ X;  2DFI A;  2O3F A;  1U5T A;  1J5Y A;  4MQV A;  3GWZ A;  3LST A;  4O3M A;  4HF1 A;  2DU9 A;  3COA C;  1T6S A;  1XGN A;  3ZPL A;  2Y0M A;  2IVM A;  4HV5 A;  1KQ9 A;  2O61 A;  3V8J A;  4M72 A;  5D5U B;  1XSV A;  3LQQ A;  2UXN A;  3ROU A;  1U6G A;  5D6E A;  4KMU X;  4UHT A;  3ECH A;  2DQL A;  3CJN A;  3BPX A;  3GZ6 A;  4P5O A;  3WGG A;  2D1V A;  2RKH A;  3WOD F;  2DLL A;  2MC3 A;  4YII A;  1VTN C;  2FF4 A;  5IT3 A;  1IRF A;  2FQ3 A;  3R60 A;  1WQ2 A;  2ZJ2 A;  2HDC A;  4RGX A;  5HLG A;  2LSO A;  3E97 A;  3BDD A;  4IHT A;  3BZ6 A;  3J7A O;  4RGU A;  2FXA A;  4EGY A;  1YO5 C;  4HX7 A;  1LQ1 A;  2DK8 A;  2EB7 A;  1A04 A;  2JTV A;  2Z5U A;  1ZGA A;  1MJB A;  1B9N A;  2PI0 A;  3I59 A;  5LBQ A;  2WV0 A;  1FSE A;  3I58 A;  4QLC U;  3WGI A;  1R7J A;  2DPU A;  2X4H A;  4LD5 A;  4HA8 A;  3I64 A;  1IRG A;  3TO9 A;  3E6C C;  1MKM A;  2FSW A;  3Q9S A;  1FYM A;  3QOP A;  2FOK A;  2V1D A;  4PGG A;  2F5D A;  5L3B A;  5HS9 A;  4WCG A;  2XIG A;  1W5T A;  3FF5 A;  1RUO A;  3S2W A;  1FNN A;  2Z9O A;  1D5V A;  1S29 A;  3EET A;  1JXS A;  3TDU C;  1T39 A;  3OOP A;  3MZH A;  3RI4 A;  1PP7 U;  3VFZ A;  3O2P E;  5DD8 A;  1S8N A;  2BV6 A;  4LLN A;  1LNW A;  3W6J B;  3FXR A;  1KA8 A;  4BHP A;  1J59 A;  3GX4 X;  5D4S A;  3ZN0 A;  2DW4 A;  1BIB A;  3LQR A;  1IN8 A;  4M73 A;  2XAF A;  4EVI A;  3R61 A;  1B9M A;  3SHF A;  4M74 A;  1Z91 A;  1G3T A;  5E1Z B;  2GQQ A;  4IRI A;  2PJP A;  2ZKZ A;  2NNN A;  1P4A A;  1U2W A;  1QQI A;  4PGH A;  5DCF A;  3HHG A;  3KLN A;  4I0B A;  4XSX F;  2QBY A;  2PN6 A;  1DUX C;  1FYK A;  1U5T B;  2J5P A;  3U9G A;  4ON0 A;  1SMT A;  3RYR A;  3LWF A;  2V1X A;  1ZN2 A;  2LKP A;  4ETS A;  3HSF A;  3SFZ A;  5ILS A;  1LB2 A;  5J6X A;  1UHW A;  4AIJ A;  3KEQ A;  4XBF A;  4BYY A;  2OAZ A;  3P9I A;  4LB6 B;  3E6M A;  3HYI A;  1D3Y A;  2QM3 A;  3MZY A;  4L9N A;  5E8G A;  4EQQ A;  2G7U A;  1TQI A;  4B8X A;  2WTE A;  2TDX A;  2O03 A;  5J8C A;  1MDM A;  1Q1H A;  4OU0 A;  3SZP A;  2W24 A;  5DUI A;  1UCR A;  4ESB A;  2D2W A;  1EV7 A;  3CTA A;  2RDP A;  1K78 A;  4A6E A;  2DK5 A;  3VOD A;  1P92 A;  4KYW A;  2VBY A;  3EQL F;  2MH9 A;  3JTH A;  4N9I A;  4A5M A;  3IL2 A;  4E70 A;  1R1V A;  1F4K A;  3I59 B;  1H0M A;  2L4M A;  1XB4 A;  3K69 A;  4EV0 A;  3KZZ A;  4OIP F;  1J9I A;  1KQ0 A;  2HTS A;  2IW5 A;  1F9N A;  1ON2 A;  2AXL A;  2GAU A;  4U0V A;  4Q5S F;  1OMI A;  1ULY A;  3KZY A;  2DT5 A;  1R22 A;  2IA1 A;  3FMQ A;  2M45 A;  3WTS C;  2G7H A;  1ON1 A;  2MH2 A;  4L9V A;  2B0L A;  1XSD A;  4UXN A;  2J5O A;  4WF2 A;  4HV6 A;  5FO5 A;  2HS5 A;  5D6F A;  4A0Y A;  3NQO A;  3F21 A;  1R00 A;  1SD7 A;  1C0W A;  1WWX A;  2Z3Y A;  4EMS A;  3H3Z A;  3HOS A;  5JVT A;  1PP8 F;  2OZ6 A;  2ZCW A;  3P7N A;  4PZJ A;  5FFZ A;  3T5X A;  2XAJ A;  4BNC A;  4L0Z B;  3KP7 A;  4PCQ A;  2QEN A;  4I02 A;  2DO7 A;  3J80 K;  4UNO A;  4WXH A;  4ZYE A;  4YFN F;  1X3U A;  2EV5 A;  2OBP A;  4RB1 A;  2QYO A;  1SFU A;  1QO0 D;  1YFH A;  2DQR A;  5H6R A;  2H94 A;  3SQN A;  1B1B A;  4G9Y A;  5BPD A;  1TLH B;  4A0Z A;  1J2X A;  5D4R A;  3PFI A;  4O5V A;  4HF2 A;  5JR3 A;  4XSZ F;  3ZMT A;  2QBY B;  2K4B A;  1HSJ A;  2NYX A;  4ZZL A;  2K4J A;  2VON A;  1O7F A;  2ISY A;  4RAZ A;  3PQJ A;  1W7P D;  1TQP A;  2V1U A;  1HKQ A;  1W5S A;  3F8M A;  5D5W B;  2HFH A;  2XAS A;  4KFC A;  3QPH A;  3K9T A;  2Q8K A;  4ZH4 F;  2GIV A;  1AOY A;  5E18 F;  3F23 A;  1LDJ A;  1W7P A;  4M6X A;  1KU2 A;  2FU4 A;  3SZT A;  5LLQ A;  1UB9 A;  2RVC A;  3D5L A;  4HX8 A;  1MDM B;  1IN5 A;  2YSR A;  2STT A;  5AIP A;  3SXY A;  2KIU A;  3QP6 A;  3WTZ A;  3M9A A;  3E5U A;  2FRH A;  3HOT A;  1Z6T A;  3DPT A;  1FY7 A;  1K78 B;  3P9K A;  1WRJ A;  5HVQ C;  4ZYH A;  1MZB A;  2O8X A;  4XRF A;  1XCV A;  3RJP A;  3WTX C;  4S04 A;  5L3C A;  1FYL A;  2FBI A;  3KFW X;  1J75 A;  1GHC A;  4GXO A;  1IAW A;  4NB5 A;  5CVU A;  1UHM A;  2A69 F;  5L3F A;  1W4M A;  2VE9 A;  4MEX F;  3I54 A;  5K5R A;  2YU3 A;  1T0F A;  2L01 A;  1FC3 A;  3ZMS A;  5E20 A;  3Q9V A;  1K7A A;  3C18 A;  1HW5 A;  1YTY A;  2OQR A;  5LHH A;  2PLY A;  3ULQ B;  3J81 K;  1XGO A;  2VBW A;  4HW0 A;  2IT0 A;  1YW7 A;  4D0P A;  4G7H F;  3WU1 B;  4U88 A;  4A12 A;  4N9H A;  2L3D A;  2H27 A;  3R6S A;  5CVR A;  1RIO H;  3BY6 A;  2P8T A;  5CJ9 A;  3V4G A;  3VOE A;  4EJT A;  1O3R A;  5CYV A;  3ECO A;  1LVA A;  3LAJ A;  3L2C A;  3PQK A;  3OV8 A;  3T0Y A;  4R79 A;  2K27 A;  4CZZ A;  1KYZ A;  1HW1 A;  5AIQ A;  5FLX K;  4MTD A;  4HZF A;  2OU2 A;  2XRN A;  5ICF A;  3IKT A;  5BQT A;  4I0A A;  2ADU A;  2RGV A;  1SFE A;  4GYG A;  1Z9C A;  1XGS A;  5JHU A;  1Z7U A;  5HS8 A;  1BI1 A;  4LK0 F;  3TOA A;  4A0X A;  3I53 A;  1R36 A;  4U0Y A;  1XSX A;  2QZ8 A;  1ZG1 A;  3I4P A;  3F8C A;  1YW8 A;  1BJA A;  3O3K A;  2OZU A;  3B02 A;  4ENJ A;  2DBB A;  2QQ9 A;  3T1B A;  3WG9 A;  5FGM A;  3KLO A;  3DXJ F;  3D0S A;  4IF4 A;  3ERE D;  3E3V A;  4CYD A;  3J80 Z;  5E17 F;  1ZRC A;  5H20 A;  3HUG A;  4RB3 C;  1W7P B;  3BRO A;  2Q0O A;  4AD9 A;  1G3Y A;  3I0T A;  3TKY A;  3FXU A;  3F8B A;  3DEU A;  1O3T A;  4U7D A;  5A2Q K;  1B4A A;  3LFK A;  3FM5 A;  4L18 B;  3GXO A;  3I5U A;  2PBI A;  2LF8 A;  2MLK A;  2EFN A;  3ZMZ A;  1WI9 A;  4RS8 A;  1O3Q A;  5LGU A;  3FWE A;  3P9C A;  1YS7 A;  1UST A;  1BI2 A;  5DYM A;  4Q47 A;  5F64 A;  1R58 A;  3LAP A;  1TTY A;  2XGX A;  1IZ1 A;  3DKW A;  2W84 A;  4GGG A;  5LRS A;  3JW4 A;  4YFK F;  1RUN A;  1REP C;  3H92 A;  1JE8 A;  6PAX A;  3ZN1 A;  3JSP A;  1KU3 A;  2F5F A;  1FP2 A;  3FHZ A;  2EFW A;  4LG0 B;  1P6R A;  1G6N A;  2NRA C;  3HSE A;  3GLX A;  1DP7 P;  2RQP A;  5DDG A;  1QZZ A;  3E5X A;  1YLF A;  1ZRF A;  3I71 A;  3HSR A;  4KT5 C;  1I1S A;  4BHC A;  4MQ9 F;  1MJA A;  4L5I A;  3JAM Z;  1OKR A;  1Z6R A;  4EJV A;  2E1C A;  4IRG A;  1AWC A;  2E7W A;  4CHU A;  1FWZ A;  2VT2 A;  3O6B B;  2M87 A;  5HDK A;  2A5Y B;  1G3S A;  1CGP A;  3C1D A;  3B73 A;  3BOQ A;  5LEJ A;  1ZH5 A;  4LB5 A;  2VBZ A;  3K1N A;  1XCB A;  5ED4 A;  2HTJ A;  5ICE A;  4QWQ A;  4ZYD A;  3ABU A;  1EH8 A;  3ZMV A;  2VN2 A;  5HOO A;  1QPM A;  2XAG A;  5DCM A;  1LEA A;  5ILU A;  3J81 Z;  5EEH A;  3RTR A;  3JTG A;  4EGZ A;  3IKV A;  1DPR A;  2JSC A;  2NNY A;  1ONV A;  2WWY A;  1J0R A;  1F1Z A;  2HGC A;  5F1R A;  3V7S A;  2F5E A;  1LJ9 A;  4L0Y B;  1G3W A;  4UUV A;  4AIK A;  2MLG A;  4UV9 A;  1ZAR A;  3K0L A;  3F3X A;  5TRD A;  3WTV C;  5DEQ A;  2Y48 A;  3NEU A;  5J8F A;  1ZYR F;  4LK1 F;  1Y0U A;  4KIC A;  4I01 A;  4B09 A;  3LA3 A;  1R1U A;  2HKX A;  1T38 A;  3RKX A;  3TGN A;  4EJO A;  3R0J A;  1L0O C;  1BC7 C;  3GF2 A;  2UWM A;  4OIN F;  3CUQ C;  5ILV A;  2QVO A;  2FEZ A;  2FE3 A;  3BPV A;  1FX7 A;  2EV0 A;  2GZW A;  3HTU A;  2A61 A;  1EH6 A;  4Y15 A;  3BJO A;  3V8K A;  1IW7 F;  4CIC A;  3IWF A;  4I09 A;  3U2R A;  4KIB A;  2EA2 A;  2C6Y A;  5EEG A;  4KA4 A;  4IRH A;  1B6A A;  3TDZ C;  1K79 A;  5D5V B;  2V79 A;  2HWV A;  4Z2Y A;  1QBJ A;  2PEX A;  2YPR A;  1BI3 A;  2BEO A;  4H0E A;  2ZFW A;  4KIG A;  1TNS A;  4OIR F;  4LLG F;  2QQA A;  5LGT A;  2P5K A;  3HRU A;  1RZ4 A;  4G6D A;  4LGW A;  2BBY A;  4N0B A;  1JHH A;  4G7O F;  2H6C A;  2UXX A;  4M71 A;  2LF7 A;  1HKT A;  2FA5 A;  1BI0 A;  2F2E A;  4G8X A;  2CFX A;  2QUF A;  3GO5 A;  2LDU A;  4O6J A;  2IA0 A;  2V6C A;  3FX3 A;  3R4K A;  1EH7 A;  1DPU A;  3WTW C;  1RNL A;  2ZNZ A;  1TBX A;  2CSO A;  2D45 A;  4I2O A;  3M1E A;  4CDG A;  5D5X B;  4WXD A;  1XD7 A;  4YFX F;  1WSU A;  3KP4 A;  2A6E F;  3V7C A;  4EM1 A;  2CO5 A;  2JZY A;  2EWN A;  3E5Q A;  3ELK A;  3MQ0 A;  1U5T C;  3V7R A;  3MAJ A;  2XRO A;  1YG2 A;  2CQK A;  2YR2 A;  1FBS A;  4P96 A;  4FHT A;  4OMZ A;  4M9S A;  5E8I A;  4HDU A;  5DCM B;  3M8F A;  1FOK A;  5IT9 K;  3KET A;  2VC1 A;  3CUO A;  3M8E A;  4BHB A;  2D1H A;  5LHG A;  3CUQ A;  3G73 A;  2HEO A;  1OR7 A;  1P2F A;  1RI7 A;  2XKO A;  4JBA A;  1V3F A;  1XDS A;  2XAQ A;  2XAH A;  5FFX A;  1PUE E;  3T8R A;  1F5T A;  1YW9 A;  4Q48 A;  1Z1D A;  1HXD A;  3RPQ A;  1OYW A;  5D8L B;  3GUD A;  1ZLK A;  2FNP A;  4DQ2 A;  2DAO A;  2VOD A;  4ASN A;  3MEX A;  2FMY A;  2IRF G;  4KNY A;  3RKY A;  1IN4 A;  2RC4 A;  3F6V A;  1XMK A;  3TQN A;  3JSO A;  3T8T A;  4IJA A;  2RN7 A;  2EFQ A;  1JGS A;  2QLZ A;  2EFP A;  5CLS A;  1O57 A;  1LDK B;  4L9T A;  2XKP A;  3IRQ A;  1SD6 A;  3GZ5 A;  4HAM A;  1FT9 A;  3IC7 A;  4ESF A;  4LG0 A;  2W25 A;  1JHF A;  3GFM A;  3W6K B;  2YX4 A;  2X0L A;  1YIO A;  1BIA A;  2VXZ A;  4ENN A;  2M5W A;  1XDU A;  1E2X A;  4UVA A;  2MBF A;  4S05 A;  4K2E A;  2BYV E;  2VOO A;  4HDV A;  2L4A A;  2R7D A;  5JFR A;  4JK1 X;  3BJA A;  2G9W A;  5HLI A;  5KK1 A;  2VBX A;  3C3W A;  2R7F A;  1CF7 A;  2EV6 A;  3RIR A;  2P5V A;  4RB2 C;  1HQC A;  3FMR A;  2MA3 A;  2GA1 A;  1GXQ A;  1STZ A;  1IXS B;  2FML A;  5FD6 A;  2JPC A;  4UVC A;  1FPQ A;  4GO1 A;  4HBL A;  1MGT A;  1S7O A;  1XN7 A;  4DNC A;  2VT3 A;  5ICG A;  3TO6 A;  4EM2 A;  4A6D A;  3BWG A;  3TO7 A;  4Y17 A;  5F6F A;  1HKS A;  3L7W A;  1YYV A;  2LNB A;  4G94 A;  3ZMU A;  1R23 A;  4YIF A;  2NS0 A;  3DV8 A;  3WTT C;  1D8K A;  1USS A;  2FBK A;  5HS7 A;  2K02 A;  2CG4 A;  3TOB A; 
#chains in the Genus database with same CATH topology
 2LFB A;  1XMA A;  1TL8 A;  2COM A;  2OCE A;  2FX0 A;  1FOY A;  3ZQ7 A;  1S6L A;  2IP2 A;  3GTG J;  4P9U A;  1HCR A;  3OYK A;  5LRR A;  1MND A;  1OCZ H;  3MCZ A;  5IP9 J;  2JT1 A;  2KRF A;  1X2M A;  3LL7 A;  1QZY A;  2WA0 A;  5JI6 A;  2KJB A;  3KP3 A;  2PG4 A;  2E7X A;  2EZL A;  5GPA A;  4RGR A;  2Y75 A;  3ABK H;  5KVR A;  2P4W A;  4FE4 A;  2NOG A;  3IRR A;  2GXB A;  3LSK A;  4HLX A;  5IOZ A;  2CV2 A;  2PJR A;  3CUQ B;  4A3J J;  4IQJ A;  2M7A A;  4LIV A;  2KL4 A;  2VOP A;  1JJ8 C;  2MC4 A;  5KAI C;  3GYH X;  2DTR A;  3BCB A;  3L2R A;  2HYG D;  1K6O A;  2ESH A;  3ONQ A;  2CWE A;  3GTO J;  3A01 B;  1Z21 A;  1ZEL A;  2A07 F;  3OL3 A;  1O7L A;  2EIM H;  3RDI A;  1S3J A;  3CLQ A;  3V42 A;  2LKX A;  1MBG A;  2EFO A;  5IYD J;  2V9P A;  2QQB A;  2TCT A;  4HYE A;  4ENM A;  2KIF A;  1IF1 A;  1HDP A;  3GTL J;  1VQ9 I;  5BMZ A;  1U3E M;  1TW3 A;  2AS5 F;  3KEO A;  5HDG A;  2P5L C;  3A0B C;  3F8F A;  4ENK A;  1GXP A;  1FBQ A;  1OYY A;  3K4C A;  2A68 F;  1ODD A;  1MBF A;  1X1A A;  4A5N A;  2VC0 A;  3SZG A;  4A3E J;  1SC7 A;  4U0W A;  3FK6 A;  5E1W A;  5F27 A;  4XLN F;  3KP6 A;  4I6Z A;  2H8W A;  3VB2 A;  3HIF A;  1FBU A;  5ERI A;  3KP2 A;  1QHH D;  5FLM J;  4ABZ A;  3EDP A;  2XPU A;  2NAZ A;  3DFG A;  1I1G A;  4OOI A;  3F22 A;  3QU3 A;  4RM3 A;  1ETX A;  2XV4 S;  5L3E A;  5FRN A;  1WKM A;  2CV0 A;  1SD4 A;  3KCC A;  4BU2 A;  1N25 A;  2BY3 A;  3LMM A;  1X4P A;  1MH4 A;  5IT9 Z;  3GBG A;  3H1C A;  2XVC A;  4PFO A;  2QSF X;  3F8N A;  2H6B A;  2DPD A;  3HRT A;  3S16 J;  2W4S A;  2ZME A;  5DV5 A;  4EJW A;  2AO9 A;  2Q2E B;  4G7Z F;  1MJ9 A;  2DOA A;  1MMA A;  4I7H A;  4M9Z A;  1KYW A;  1IN7 A;  3BZK A;  4HOB A;  4PDK A;  3L09 A;  2IS6 A;  4XLP F;  4CCL A;  1ITY A;  4EAT A;  3OOU A;  4V2G A;  3K4B A;  4N4N B;  3W2A A;  2DT6 A;  4NC8 A;  4P9F A;  3EYI A;  2FNA A;  4A2U A;  3IH4 A;  3N97 A;  3WU0 A;  4ZTF A;  3H3U A;  2DI3 A;  3PNY A;  2PMU A;  5HLT A;  2D5V A;  3N4M A;  5J1U A;  5D8K B;  2Y69 H;  4HF0 A;  4OAY A;  1D0X A;  3RPU D;  1VQ4 I;  2HOE A;  2OD5 A;  1KGS A;  1WJD A;  3DPU A;  3NRV A;  2AQE A;  2ZBK A;  1KZH A;  3ABT A;  3H9G A;  2DOD A;  4WWC A;  5C4J J;  2H09 A;  1MSF C;  3EYY A;  1CF7 B;  4AVP A;  1IXC A;  2M30 A;  1OCP A;  1YS6 A;  2R3S A;  2W48 A;  1WGX A;  2ELH A;  2GWR A;  1Z0X A;  3B6A A;  5DUK A;  3PO2 J;  3GFJ A;  1Y8R B;  3KYL A;  4R8H A;  4DYQ A;  3G3Z A;  5E1X A;  3RPU A;  1ENH A;  1B59 A;  1FMV A;  1ZG5 A;  1HW2 A;  4CGZ A;  1EF4 A;  4PSW A;  1K6Y A;  1H9G A;  3EUA A;  1O3S A;  1TQM A;  4M6V A;  5KNL A;  1TW2 A;  2XGD A;  1HA8 A;  2WAQ N;  4BE0 A;  3CMM A;  5HOD A;  1R5H A;  1HLV A;  4A69 C;  3K1M A;  3PIP F;  5JLX A;  5L3D A;  2V4J C;  5GTH C;  1ZGJ A;  2X1C A;  4A93 J;  1S72 I;  3K4K A;  2HOA A;  2Z99 A;  3C2B A;  1FZP B;  4LLL A;  5HNH A;  1U8R A;  4Z6Y A;  1LEB A;  1KU9 A;  4G12 A;  4U7B A;  5J4Y A;  3DKY A;  2OJE D;  3DTK A;  1YIT I;  2HZD A;  4HG2 A;  4BY1 J;  1EKE A;  5J3L A;  5IOY A;  4OIQ F;  4KN4 X;  2O8K A;  2EZK A;  2E60 A;  2EJR A;  1V5G A;  3MWM A;  3NWS A;  4XKB A;  3K4M A;  3CF5 F;  1D8J A;  3HRS A;  1ZAO A;  2HYF A;  3MFK A;  2IJL A;  4KMF A;  3ZXS A;  1HBX G;  3MKL A;  3E6D A;  2NVU B;  1YQA A;  2BE5 F;  1XGM A;  2HR3 A;  3FZV A;  2VJ4 A;  3QYB A;  5DD4 A;  4AIH A;  4ESJ A;  4V19 K;  4F92 B;  4OMY A;  5GP9 A;  2FBH A;  2Y30 A;  4AM3 A;  2ESN A;  2R7Z J;  3CO7 C;  3LA2 A;  2JSP A;  4HLY A;  4B47 A;  2JRT A;  2M34 A;  1H89 C;  4PK4 A;  5FRM A;  4XLC A;  2E1N A;  2Q1Z B;  3DU6 A;  2P7V B;  4UV8 A;  5BPI A;  3ASN H;  2ZB9 A;  4UVB A;  4WX9 A;  1H88 C;  5FLX Z;  1ETV A;  3DKX A;  3UR3 C;  1DU0 A;  5AON A;  4RB0 A;  1LDD A;  4V2F A;  1CQT A;  3HHH A;  3MVP A;  4IVN A;  1K61 A;  1VQP I;  2E2H J;  3ISP A;  2W57 A;  3H0D A;  1OYI A;  4BXU A;  1SD5 A;  1XS9 A;  3BR5 A;  4YEL A;  2IA2 A;  4IXA A;  2HKO A;  4LMY A;  1U78 A;  3CC4 I;  2PJR B;  4IHS A;  1WHU A;  1OCC H;  2JA2 A;  4QPQ A;  2A5W A;  4RGS A;  9ANT A;  2HQN A;  2GOM A;  1IN6 A;  2K5C A;  4Q4Z F;  4Y3O A;  1EA3 A;  1BOA A;  5LEK A;  2ZXJ A;  4R1H A;  2PX9 A;  4GCV A;  5C4X J;  4MNU A;  1BJZ A;  1SAX A;  4QPO A;  2HZT A;  1PDN C;  2A6H F;  3MZ8 A;  3CCS I;  1TZL A;  1IUY A;  1PJR A;  1WJB A;  2JPB A;  3CCE I;  3QPT A;  2STW A;  1RC9 A;  5LHI A;  2LY2 A;  2NVY J;  3OYC A;  4MEY F;  2KKO A;  4ZDP A;  3KE2 A;  5M5X J;  1DDN A;  4KUM A;  1QGP A;  5CKT A;  1VQ5 I;  1B72 A;  1XMX A;  2HXI A;  2GXG A;  2M8E A;  2CYY A;  2KIM A;  3C2H A;  3U21 A;  3LA7 A;  2DN0 A;  4P55 A;  3GW2 A;  5LGN A;  1W5C C;  3PUB A;  1H9T A;  3QWL A;  2VPR A;  2ZO4 A;  2PMZ N;  2ZFU A;  2RNJ A;  1MMG A;  1L3L A;  3S2H J;  3HZJ A;  1ZRE A;  2X85 A;  4NQW A;  1ZHF A;  2JUG A;  2WC2 A;  4LFU A;  1IO2 A;  5ICC A;  2L54 A;  1IXR C;  3D5S C;  3WTY C;  4XIC A;  3WTU C;  3EUH A;  2V9V A;  2KIS A;  3KP5 A;  4M6Y A;  4NHJ A;  1FJL A;  2K7L A;  4S0H B;  3ZGK A;  4HX4 A;  2AHQ A;  1P4X A;  5TJJ A;  3BJ6 A;  1WH5 A;  1TNT A;  2KJC A;  4BJ6 C;  3MN2 A;  3BG7 A;  3PUF A;  4IOC F;  4YG2 F;  1G4D A;  2PMH A;  3M7G A;  5BS6 A;  3WG7 H;  3CO6 C;  2UZK A;  1IJW C;  1VQK I;  4I98 B;  2PQ8 A;  2LK2 A;  2XGE A;  3KYC B;  3VEP A;  4CA0 A;  5A2Q Z;  1ZLJ A;  2CGP A;  2RRE A;  3VYR B;  1A5J A;  2ZME B;  5F0C A;  3CCM I;  3AL0 B;  4XM3 A;  2IGN A;  1Z05 A;  4KIF A;  1KQ8 A;  4NC6 A;  4RLF A;  1NK2 P;  1T0F C;  3REO A;  4MGR A;  4FT8 A;  2NXN B;  1QU3 A;  1SAN A;  3RQI A;  2LKS A;  3S1N J;  2XB0 X;  4AWX B;  1PVE A;  1GV5 A;  1NH3 A;  3K1P A;  1DQU A;  3E6B A;  3QP5 A;  2A3S A;  1D5Y A;  3ML6 A;  1SFX A;  3D5R C;  2HU9 A;  3HRM A;  3DLA A;  1E17 A;  1PUF A;  2Z1D A;  3A03 A;  4BAY A;  3S1Q J;  2X51 A;  2JMW A;  2R7O A;  2MYS A;  3O8G A;  3Q5F A;  3WE2 A;  3IHU A;  2H1K A;  3GEZ A;  3A02 A;  2RV8 A;  3K6G A;  5FD5 A;  2CW0 F;  4KIT B;  5HDN A;  2Y2Z A;  1RR7 A;  4RAF A;  3MKW B;  3AAF A;  4OIO F;  2JK3 A;  3DF8 A;  4XK4 A;  1Y56 A;  2OV7 A;  5FB2 A;  2RAE A;  2CQN A;  4BH9 A;  3FMS A;  2OUM A;  4CCK A;  4MHG A;  3IUO A;  1GVJ A;  3D1N I;  3F6O A;  3VWB A;  3GVA A;  4XON A;  1Q1V A;  2BGC A;  1J7K A;  3F72 A;  1UMQ A;  1U8B A;  1VQN I;  3FXQ A;  5K5Q A;  4BDY A;  1FTZ A;  4F7Z A;  2ID6 A;  4L9J A;  3C7J A;  4GFB A;  3OSF A;  2DA2 A;  3ZOB A;  1MBJ A;  3MD2 A;  2XUB A;  4WK8 F;  2XHK A;  2KQR A;  3HTS B;  2M1B A;  3BP8 A;  4ZZD A;  1Y39 A;  3G4S I;  2ECC A;  2IGK A;  1HDD C;  1W36 D;  2WB1 A;  1SAU A;  3HOV J;  3BTJ A;  2P7C B;  1MD0 A;  1BM9 A;  4CXF A;  4IO9 F;  5K1Y A;  3QAH A;  2M9H A;  1X2N A;  5LFA A;  2IS4 A;  2IBD A;  3LSP A;  1I6X A;  4IPA A;  3RYP A;  2QWW A;  5CVV A;  4BQA A;  1R5G A;  2F5C A;  2ZXI A;  4FCY A;  1WPK A;  4KN7 X;  3WGH A;  2JVG A;  2ZNY A;  1JT6 A;  2DMN A;  3RKW A;  3R0A A;  3CLO A;  3H35 A;  3WE3 A;  4ZYG A;  3TL4 X;  5H6Q A;  2O0Y A;  1MSE C;  1WCM J;  1X19 A;  5K5O A;  4ZDO A;  3IAS 2;  2CW7 A;  3IWZ A;  4ITV A;  2KRH A;  2VQC A;  3L9F A;  3OYB A;  4D9J A;  1T98 A;  1TWF J;  3JRF A;  2MD5 A;  2ACJ A;  2HQR A;  2LTP A;  1BBY A;  2PFB A;  2OQG A;  1HST A;  3ZP5 A;  5HLH A;  1WJF A;  1BN5 A;  2VE8 A;  3W6V A;  2K86 A;  3LSH A;  4YRV A;  1S7A A;  1V4R A;  3L00 A;  3JAM K;  4WXC A;  3CDH A;  4FX4 A;  5FLV A;  4XLF A;  4HQM A;  2P6S A;  1QNT A;  4MLO A;  4BJT A;  2OA4 A;  2MAB A;  5EYR A;  4IX7 A;  4LJZ F;  3BQZ A;  2DDB A;  1FP1 D;  2W85 A;  3GFL A;  3ZQC A;  2YX7 A;  1QA6 A;  5EG0 B;  3CCY A;  4CO8 A;  3CCR I;  2DJI A;  4G6Q A;  1MMN A;  1I27 A;  1JKP C;  2E71 A;  2EA4 A;  2RQQ A;  1H8A C;  3GFI A;  3G1L A;  4GYI A;  3OYN A;  2Z33 A;  2XAU A;  4M9X A;  1OQY A;  4JQF A;  2ETH A;  1T2K A;  1NK3 P;  1ZRD A;  4EJU A;  5JHF A;  1ZG3 A;  3OYA A;  3HL2 A;  2JA6 J;  1MW7 A;  3K4J A;  5BOX A;  4KDP A;  2P6T A;  4EM0 B;  5HNF A;  1FSH A;  2P81 A;  3DLL F;  1S9H A;  2QKM B;  1RKT A;  1VZ0 A;  2NVX J;  3ZMD A;  2W00 A;  3C2G A;  3LSJ A;  4IL6 C;  2O6G E;  1ETY A;  3DP7 A;  2EK5 A;  2Q2E A;  3U1D A;  5DS9 A;  1JGG A;  1B72 B;  1I5Z A;  1OPC A;  2BHY A;  2ISZ A;  3M1C A;  5CVJ A;  2KZG A;  1SMY F;  4TV7 A;  3V8L A;  4FX0 A;  3QU6 A;  4P1W A;  3K4N A;  3QOD A;  1NHA A;  3FK7 A;  1BR1 A;  4RAY A;  5L3G A;  3FIW A;  3HPG A;  4Y13 A;  2W1O A;  3DQV C;  3KZI C;  3Q3S A;  3K2Z A;  4NQW B;  2GA2 A;  1QZE A;  4HPQ A;  4MTE A;  1FLI A;  2LYC A;  1P4W A;  3DPL C;  3QRF F;  4L5J A;  4HQE A;  4XQF A;  3HEF A;  1S5L C;  3FM3 A;  3DWL E;  2ZSI B;  4BQQ A;  1BC8 C;  1UFM A;  2CUF A;  2L02 A;  5CVI A;  1KU7 A;  4CYC A;  1R1T A;  2IPQ X;  2DMT A;  4QIW N;  2DFI A;  2O3F A;  3DTE A;  1JKO C;  1U5T A;  1Z7L A;  1J5Y A;  3PIO F;  1I50 J;  4MQV A;  1ACI A;  1VQ6 I;  3KX2 A;  2L0K A;  2F48 A;  2DJN A;  3GWZ A;  4DZJ A;  3LST A;  4O3M A;  1TT5 B;  4HF1 A;  2DU9 A;  3COA C;  1T6S A;  1XGN A;  1N77 A;  3EUK L;  3ZPL A;  3BR3 A;  1GUU A;  4JP0 A;  2Y0M A;  2IVM A;  4HV5 A;  4C30 A;  3S3O A;  1KQ9 A;  2OF7 A;  4BXF A;  1YIJ I;  2O61 A;  2WV1 A;  3V8J A;  4F93 B;  4BGD A;  4M72 A;  3PJR A;  2HNH A;  1LKX A;  5D5U B;  2LLK A;  2VPL A;  1XSV A;  3LQQ A;  5KHD A;  2UXN A;  3RCO A;  3ROU A;  1U6G A;  2EIK H;  2CUZ A;  4YIR X;  2M4K A;  3J7A Y;  5D6E A;  4KMU X;  1FMW A;  4C3H J;  1XPX A;  2GIZ A;  4UHT A;  3L2Q A;  3ECH A;  1IDY A;  2DQL A;  5EGO A;  3CJN A;  1WI3 A;  3BPX A;  3GZ6 A;  4P5O A;  1UG0 A;  3WGG A;  2D1V A;  3DU5 A;  3HM5 A;  2XF5 A;  1YHQ I;  2R93 J;  2BHZ A;  2RKH A;  1BW5 A;  3WOD F;  2DLL A;  2MC3 A;  4XN0 A;  3KPH A;  3TW6 A;  5F08 A;  4YII A;  1VTN C;  2VL8 A;  3S17 J;  2FF4 A;  1R9T J;  3HGY A;  1IDZ A;  5IT3 A;  2QSG X;  1IRF A;  2A05 A;  1E0E A;  5K7F A;  2FQ3 A;  3R60 A;  1WQ2 A;  2DFH A;  2ZJ2 A;  2DMP A;  3ZR8 X;  2HDC A;  4D5F A;  4RAG A;  3ZQG A;  3WHC A;  4XMY A;  4RGX A;  5HLG A;  3AFH A;  2LSO A;  3E97 A;  3G6E I;  1J09 A;  3BDD A;  4L5E A;  4IHT A;  2A6T A;  1APL C;  3BZ6 A;  3J7A O;  3PNV A;  4RGU A;  1OCR H;  2FXA A;  2K3P A;  1IGN A;  4EGY A;  2K9L A;  1YO5 C;  4HX7 A;  2R7X A;  1OCO H;  3CDI A;  1FEX A;  2OCC H;  3H0G J;  1LQ1 A;  2DK8 A;  2EB7 A;  1A04 A;  2JTV A;  2CJJ A;  4DYR A;  2Z5U A;  5GAH J;  2HI3 A;  3J7Z I;  1ZGA A;  1MJB A;  1B9N A;  1RPW A;  2LY9 A;  3L2W A;  2PI0 A;  3I59 A;  5LBQ A;  3S1M J;  2M0M A;  2WV0 A;  1JJ6 C;  4FET A;  4GDF A;  2OTL I;  2VQH A;  3OWT A;  1FSE A;  4X0G A;  3I58 A;  4QLC U;  3WGI A;  1R7J A;  4XID A;  2B9S A;  1IRZ A;  5IYB J;  2DPU A;  2X4H A;  4LD5 A;  4HA8 A;  3L1P A;  3I64 A;  1SEU A;  1IRG A;  3TO9 A;  1RR8 C;  3E6C C;  1MKM A;  2FSW A;  2KDO A;  3Q9S A;  1SFK A;  2CS3 A;  5M5Y J;  1FYM A;  2R7U A;  4XLA A;  3QOP A;  2FOK A;  4PJL A;  2GBY A;  2X6Y A;  2V1D A;  4PGG A;  2F5D A;  5L3B A;  2AXT C;  5HS9 A;  4WCG A;  2XIG A;  4ANJ A;  4MFD A;  4F3Q A;  1W5T A;  3FF5 A;  3OYJ A;  1RUO A;  3S2W A;  3K4L A;  1FNN A;  4FQG A;  3IH2 A;  2Z9O A;  2LG4 A;  1VQM I;  1D5V A;  1S29 A;  4ZTJ A;  5B1A H;  3EET A;  2O5R A;  1JXS A;  2R4G A;  3OIP A;  3TDU C;  3MMY B;  1T39 A;  2KLO A;  3CME I;  3NAR A;  3OOP A;  3MZH A;  1AA7 A;  3RI4 A;  2G0E A;  2FD5 A;  1W0U A;  1PP7 U;  2E1M C;  3VFZ A;  1Z77 A;  4ZDL A;  3O2P E;  1ETQ A;  1WVR A;  5DD8 A;  5E79 C;  3K70 D;  3GTP J;  1S8N A;  2BV6 A;  1ZGW A;  3CMY A;  4LLN A;  3EPZ A;  1LNW A;  3W6J B;  3M07 A;  3FXR A;  1KA8 A;  4A3L J;  2JN6 A;  4E7L A;  2DMQ A;  2B7E A;  4BHP A;  1J59 A;  3RZO J;  3LSG A;  3GX4 X;  5D4S A;  1T33 A;  3ZN0 A;  4JX6 A;  2DTZ A;  2DW4 A;  2F5V A;  4ZC3 A;  1BIB A;  3LQR A;  4B3X A;  3BCA A;  1WJE A;  1IN8 A;  2NS8 A;  1NG7 A;  2N8G A;  4M73 A;  3VYT B;  2XAF A;  2YUS A;  4BKX A;  1JUS A;  3R61 A;  4EVI A;  1B9M A;  3SHF A;  4M74 A;  1Z91 A;  1G3T A;  5E1Z B;  2GQQ A;  1Y8Q B;  2VJ5 A;  4PJN A;  1ZR4 A;  4IRI A;  1OCT C;  2PJP A;  2ZKZ A;  2JUC A;  2NNN A;  1YI2 I;  1P4A A;  2L5Q A;  4DGW B;  1U2W A;  2HXO A;  4F52 A;  5F0H A;  1QQI A;  4PGH A;  1MH3 A;  5DCF A;  4A3F J;  3HHG A;  3KLN A;  2BVM A;  4I0B A;  4XSX F;  4CYC B;  1MBH A;  1F36 A;  2QBY A;  1G8X A;  2PN6 A;  2X48 A;  5FKK A;  1DUX C;  1JI8 A;  1FYK A;  4FTH A;  1U5T B;  2COB A;  2J5P A;  3U9G A;  4ON0 A;  1YX5 A;  2V9K A;  3BTI A;  3HOU J;  2BXY A;  2L2O A;  4MFE A;  1SMT A;  4B44 A;  2L7K A;  2R5Z A;  2L9V A;  3RYR A;  3LWF A;  3HPH A;  4I99 C;  2V1X A;  1ZN2 A;  2LKP A;  3BLY A;  3FBI B;  3HSF A;  3SFZ A;  4ETS A;  3SEZ A;  5ILS A;  4DW6 A;  2HDD A;  4BE1 A;  1LB2 A;  5J6X A;  3H9Q A;  2Y0S A;  1UHW A;  4AIJ A;  2WAD A;  2QGU A;  3KEQ A;  4XBF A;  1ETO A;  4D7M A;  4BYY A;  1RRJ A;  2HVQ A;  2CH0 A;  2EIN H;  3RZD J;  2OAZ A;  3P9I A;  2DA5 A;  4B48 A;  3G2B A;  5EGO B;  4LB6 B;  3E6M A;  3HYI A;  1D3Y A;  4PJJ A;  2QM3 A;  2GOX B;  3MZY A;  1R49 A;  4L9N A;  4BQO A;  5E8G A;  4HRI A;  1SVO A;  4EQQ A;  4XKC A;  1K83 J;  1TQI A;  1TT0 A;  2G7U A;  4B8X A;  3W2V A;  2WTE A;  2EIL H;  2W7N A;  2TDX A;  2O03 A;  1POG A;  5J8C A;  5H2F C;  2KIQ A;  5J4V A;  1MDM A;  1Q1H A;  1WJ5 A;  4OU0 A;  3SZP A;  2W24 A;  2I8D A;  2WBM A;  5DUI A;  3OYE A;  2DYS H;  1UCR A;  4KT6 A;  3HG9 A;  4ESB A;  2D2W A;  3IV5 A;  1EV7 A;  1UEL B;  4UB8 C;  4C3I J;  2JVH A;  2L7Z A;  3ZQQ A;  2NOJ B;  5FJ8 J;  3LFU A;  4J19 A;  3CTA A;  2M2E A;  1JKQ C;  2MGQ A;  2RDP A;  2XDV A;  1K78 A;  3AKZ A;  4A6E A;  2DK5 A;  5B66 C;  1DGW Y;  3VOD A;  1P92 A;  2VKH A;  4KYW A;  1FIP A;  2VBY A;  5CQE A;  2FJ1 A;  3DBR B;  3EQL F;  5EG0 A;  2MH9 A;  3JTH A;  4N9I A;  1JKR C;  4A5M A;  3IL2 A;  4M3F A;  4E70 A;  1R1V A;  4RMN A;  1F4K A;  3I59 B;  3U1K A;  1H0M A;  2L4M A;  2Z16 A;  1XB4 A;  3FXL A;  1LFP A;  2OTJ I;  3K69 A;  4EV0 A;  3KZZ A;  1AKH B;  3OIQ A;  5F1J A;  3RSN A;  1I3Q J;  4AID A;  4OIP F;  2M3A A;  3N05 A;  1SFO J;  1J9I A;  3KYD B;  1R4N B;  4UUT A;  1KQ0 A;  3ZQF A;  2HTS A;  2IW5 A;  1F9N A;  1ON2 A;  2AXL A;  2GAU A;  4U0V A;  4E7K A;  4Q5S F;  3OYG A;  1OMI A;  3CP2 A;  4IOA F;  1ULY A;  3KZY A;  2DT5 A;  1R22 A;  5B3S H;  2IA1 A;  3FMQ A;  3GZN B;  2M45 A;  3WTS C;  1VND A;  1OR7 C;  4A3I J;  2G7H A;  2ZJP F;  2HOT A;  1ON1 A;  2MH2 A;  4L9V A;  2I10 A;  2B0L A;  1XSD A;  4PFP A;  4UXN A;  3A2K A;  2LOO A;  2J5O A;  4WF2 A;  5IY5 H;  3HOZ J;  3M3Y J;  4HV6 A;  3BR2 A;  3CZ6 A;  1B8I A;  5FO5 A;  2HS5 A;  5D6F A;  2UUZ A;  2X9D A;  3NQO A;  4A0Y A;  3F21 A;  1R00 A;  1SD7 A;  2O9L A;  1C0W A;  1WWX A;  2QCO A;  1BA5 A;  2Z3Y A;  4EMS A;  3H3Z A;  3HOS A;  3TMO A;  5JVT A;  1VQ7 I;  1PP8 F;  3AG4 H;  2OC6 A;  2ELJ A;  2OZ6 A;  2ZCW A;  3P7N A;  4G6T B;  4PZJ A;  2XAJ A;  3H5A A;  5FFZ A;  3T5X A;  4BNC A;  2X1E A;  3ABL H;  3H5R A;  2LY1 A;  3KP7 A;  2QEN A;  4PCQ A;  4L0Z B;  4I02 A;  2VKE A;  1XG1 A;  3PL8 A;  2DO7 A;  3J80 K;  4UNO A;  4IHY A;  4RA2 A;  4WXH A;  4ZYE A;  4YFN F;  1VI0 A;  1X3U A;  2EV5 A;  3H9J A;  2OBP A;  4RB1 A;  2QYO A;  2VIX A;  1SFU A;  1QO0 D;  1YFH A;  1G2H A;  2ME0 A;  4II2 A;  2DQR A;  3GCM A;  5H6R A;  4Y4R A;  3BG9 A;  1XX5 A;  1TWA J;  2H94 A;  2V1N A;  2EZH A;  1B1B A;  3SQN A;  4G9Y A;  1UG2 A;  4CCM A;  5BPD A;  1TLH B;  1Y0N A;  4A0Z A;  1J2X A;  5D4R A;  1IV8 A;  3PFI A;  1TWC J;  4O5V A;  3CP8 A;  4HF2 A;  3PO3 J;  1YE9 A;  4PJ0 C;  2JWT A;  5JR3 A;  4MO7 A;  1ZTR A;  3HKZ N;  1MIJ A;  4IKF A;  4NUB A;  4XSZ F;  3ZMT A;  2QBY B;  2K4B A;  4DOZ A;  3FKI J;  1DGR M;  1HSJ A;  3BTL A;  2NYX A;  1JTX A;  5GTI C;  3J7Y J;  3JRD A;  4ZZL A;  2K4J A;  1TWH J;  5FKL A;  2R5Z B;  1V54 H;  4F91 B;  2VON A;  1O7F A;  2ISY A;  3DTI A;  2E1O A;  5IP6 A;  4PSX A;  4RAZ A;  3KIO A;  3PQJ A;  3TP0 A;  4JOM A;  2XC7 A;  3E0J B;  4HST A;  1KON A;  3NAU A;  4BAC A;  1QHG A;  1ZK8 A;  3HXL A;  1W7P D;  3B6C A;  1TQP A;  5EJC A;  1HKQ A;  4W97 A;  2V1U A;  1W5S A;  3F8M A;  5D5W B;  2HFH A;  2RNG A;  4CCN A;  5K7Z A;  2CUJ A;  2XAS A;  4RBO A;  3OYH A;  4KFC A;  2VAS A;  3FXO A;  3QPH A;  3K9T A;  1EJ9 A;  2Q8K A;  4A3B J;  3MKY B;  4ZH4 F;  2Y31 A;  2GIV A;  1AOY A;  5E18 F;  2ZSH B;  1Y1V J;  3NWT A;  3F23 A;  2QA4 I;  1LDJ A;  5J40 A;  4UUS B;  1W7P A;  4M6X A;  1KU2 A;  2KT0 A;  2OPT A;  2V26 A;  4XLH A;  2WAQ A;  2FU4 A;  4BL0 B;  2HOS A;  2R92 J;  4LIT A;  3SZT A;  5GAG J;  3GLL A;  2DA3 A;  5LLQ A;  1UB9 A;  2RVC A;  5CPR B;  3D5L A;  4HX8 A;  2XGC A;  1SVL A;  3LOC A;  1MDM B;  1IN5 A;  2I5U A;  4LG3 A;  4CCJ A;  2YSR A;  3HC7 A;  3LSM A;  2STT A;  5AIP A;  3SXY A;  2HYJ A;  4FAS D;  2KIU A;  3QP6 A;  3BG5 A;  3ZQL A;  3WTZ A;  3M9A A;  4HSR A;  2W82 A;  3E5U A;  2FRH A;  4DBR A;  3HOT A;  3TW7 A;  1Z6T A;  3CJR B;  3QYE A;  3DPT A;  1FY7 A;  3CCQ I;  1K78 B;  3P9K A;  3M8J A;  3G71 I;  2CW8 A;  4B4C A;  1WRJ A;  2DYR H;  2L9R A;  1LFB A;  2DA1 A;  5HVQ C;  3GTK J;  4ZYH A;  1MZB A;  2O8X A;  3HB9 A;  1DU6 A;  1YJW I;  4XRF A;  3HJE A;  1XCV A;  3FIS A;  3RJP A;  5FKN A;  3GME A;  3WTX C;  4HNU A;  2X6W A;  2H8R A;  4BY7 J;  5L3C A;  4S04 A;  1FYL A;  2M4G A;  2FBI A;  3KFW X;  4F55 A;  1J75 A;  4GXO A;  2YU9 J;  1GHC A;  1IAW A;  4NB5 A;  5CVU A;  1UHM A;  2Y9Z A;  3E1S A;  4Y52 J;  2A69 F;  4BUP A;  5L3F A;  1W4M A;  2X1D A;  2VE9 A;  3PFY A;  2XSD C;  4MEX F;  1X1C A;  2DOF A;  3CJT B;  3I9V 2;  3I54 A;  2LH9 A;  5K5R A;  2YU3 A;  3F0C A;  2KDZ A;  1T0F A;  2EIJ H;  3ZCO A;  3G1M A;  2L01 A;  2ID3 A;  2JRM A;  1FC3 A;  1VF9 A;  3K2A A;  5E3M A;  4E7S A;  3ZMS A;  1T8I A;  2L7M P;  5E20 A;  4I76 A;  3BG6 A;  3Q9V A;  1JT0 A;  1K7A A;  3C18 A;  1HW5 A;  1YTY A;  2OQR A;  1YJ9 I;  5LHH A;  1YRN A;  2PLY A;  3TP3 A;  3ULQ B;  3J81 K;  1JTY A;  1XGO A;  2VBW A;  4HW0 A;  1A35 A;  2IT0 A;  1YW7 A;  4NBQ A;  4D0P A;  1O4X A;  4X6A J;  3KEY A;  1RET A;  3DEE A;  1B8I B;  4G7H F;  3WU1 B;  4U88 A;  1OIS A;  2KZV A;  4A12 A;  4N9H A;  2LD5 A;  2XRL A;  1YX3 A;  1U0J A;  3OR1 C;  2L3D A;  2IEK A;  2XPV A;  4B1R A;  2H27 A;  3A0H C;  2LRE A;  5CVR A;  3R6S A;  2R7Q A;  2DDA A;  3FXM A;  4A3D J;  1RIO H;  2DCE A;  3BY6 A;  2F4M B;  2P8T A;  1BR2 A;  3W2W A;  5CJ9 A;  3V4G A;  3VOE A;  4JX4 A;  2VI6 A;  4EJT A;  1O3R A;  5CYV A;  3ECO A;  1LVA A;  3IP4 B;  3LAJ A;  4XNF A;  1VQL I;  2PMZ A;  3L2C A;  3S8P A;  1IC8 A;  5B5E C;  3PQK A;  3PSF A;  3ESW B;  3OV8 A;  3T0Y A;  4R79 A;  3S1R J;  2K27 A;  3TBI A;  4CZZ A;  2CQQ A;  1KYZ A;  1HW1 A;  2L9N A;  5AIQ A;  5FLX K;  5FKO A;  1LE8 A;  4MTD A;  4E7H A;  2DT7 B;  3TED A;  4HZF A;  2OU2 A;  2XRN A;  5DM7 F;  5ICF A;  3IKT A;  2K9S A;  5BQT A;  4I0A A;  1XC5 A;  2ADU A;  4FE7 A;  2RGV A;  1Y1W J;  2FOW A;  3FHN A;  1SFE A;  4GYG A;  1Z9C A;  3L2V A;  1UHS A;  3G1O A;  2VKV A;  2ZME C;  4BJ5 C;  4BXX J;  3S3M A;  5F04 A;  2IS1 A;  1XGS A;  5JHU A;  1Z7U A;  5HS8 A;  2VLA A;  4J00 A;  4XOR A;  4QTR A;  1BI1 A;  2BY2 A;  4LK0 F;  4JX5 A;  3TOA A;  3ERM A;  1A36 A;  4A0X A;  3I53 A;  5J1Y A;  1A6Q A;  1R36 A;  1X1D A;  4U0Y A;  1XSX A;  2QZ8 A;  1ZG1 A;  3OSG A;  4NC7 A;  3I4P A;  3VSL A;  3F8C A;  1YW8 A;  1BJA A;  2F4O B;  3O3K A;  1MNM C;  2OZU A;  2LC2 A;  3B02 A;  4ENJ A;  2MW8 A;  4IQ4 A;  1IUF A;  3OS0 A;  3BTC A;  3ZRG A;  2DBB A;  2QQ9 A;  3DBH B;  2AQF A;  2IS2 A;  3T1B A;  1D1B A;  3GTM J;  3HKZ A;  4M3G A;  3WG9 A;  5FGM A;  2CMP A;  2P0W A;  4ZJZ A;  3KLO A;  4AYB N;  3DXJ F;  3D0S A;  4IF4 A;  3ERE D;  1FOW A;  3DBL B;  1AHD P;  1X1B A;  2Y9Y A;  3E3V A;  4CYD A;  3J80 Z;  5E17 F;  1MNE A;  1ZRC A;  3FKJ A;  3HUG A;  2LRD A;  5H20 A;  5FRO A;  4RB3 C;  1W7P B;  1FIA A;  2HQ5 A;  2KHM A;  3BRO A;  4RDU A;  2H1L A;  2CV1 A;  1F43 A;  1GV2 A;  2Q0O A;  4AD9 A;  2NS7 A;  1G3Y A;  2WAE A;  3I0T A;  3TKY A;  2NVT J;  3A4C A;  3SYT A;  3H3V K;  1AKH A;  3FXU A;  1BW6 A;  2BY1 A;  3F8B A;  3DEU A;  1O3T A;  4U7D A;  5A2Q K;  1B4A A;  1ZKG A;  2ZJQ F;  1ERD A;  2K9Q A;  4DZP A;  3LFK A;  2TRT A;  3FM5 A;  5M3M J;  2LVS A;  4L18 B;  3GXO A;  3I5U A;  1BL0 A;  2JQ7 A;  1E3P A;  2UV1 A;  2PBI A;  2LF8 A;  4AU7 A;  2MLK A;  3VYS B;  2HPM A;  2R7T A;  1UJ8 A;  2EFN A;  3ZMZ A;  1A6I A;  4D5C A;  2BZT A;  1WI9 A;  3ABM H;  3M4O J;  4RS8 A;  3K10 A;  1DP3 A;  4KJZ A;  1O3Q A;  1WH7 A;  5LGU A;  4XN3 A;  3JR9 A;  3FWE A;  4HNT A;  3P9C A;  1YS7 A;  2XSJ C;  1UST A;  3SFI A;  1BI2 A;  3QQA A;  5DYM A;  4QSH A;  1Z3Y A;  4Q47 A;  3OIO A;  5F64 A;  4M3E A;  3QPS A;  1R58 A;  3LAP A;  3DCF A;  1TTY A;  2XGX A;  2R7S A;  1IZ1 A;  2XF7 A;  1Y6I A;  2KMU A;  2W84 A;  3DKW A;  4GGG A;  3S93 A;  3ZQH A;  4XLE A;  3DEW A;  1P7J A;  5LRS A;  3JW4 A;  3H5N A;  4YFK F;  1RUN A;  1REP C;  3OMY A;  3H92 A;  1U9N A;  1JE8 A;  6PAX A;  3ZN1 A;  3JSP A;  1KU3 A;  5IPA A;  2F5F A;  4W1U A;  1FP2 A;  3FHZ A;  2E35 A;  3E7L A;  3SDB A;  1QPI A;  3JCU C;  3LSI A;  2EFW A;  3BR6 A;  4LG0 B;  1P6R A;  2VKD A;  1YRN B;  1G6N A;  2NRA C;  3HSE A;  3GLX A;  1DP7 P;  1I3A A;  3JRC A;  2CQ7 A;  2RQP A;  2QEX I;  5DDG A;  4E6K G;  5JLW A;  3OS1 A;  4II3 A;  1P7I A;  4M3B A;  1QZZ A;  5EZG A;  3E5X A;  2R7R A;  3UNG C;  1YLF A;  1ZRF A;  3S15 J;  3I71 A;  3HSR A;  4KT5 C;  1FOX A;  3FBN B;  4BHC A;  1I1S A;  4B3A A;  4MQ9 F;  4PJM A;  1MJA A;  4L5I A;  4OAZ A;  3JAM Z;  1OKR A;  1Z6R A;  4ZYA A;  1D0Y A;  4EJV A;  2E1C A;  4IRG A;  4XOT A;  2BOL A;  1AWC A;  2E7W A;  4CHU A;  2ZXH A;  3Q0V A;  5C3E J;  1ORK A;  3CCJ I;  1FWZ A;  4AUX A;  2VT2 A;  4FIS A;  3O6B B;  2M87 A;  1JUP A;  1WFX A;  1YJN I;  3FXJ A;  5HDK A;  2FQ4 A;  1UZC A;  2A5Y B;  2WB1 N;  2KFD A;  1G3S A;  2LMD A;  2M8G X;  3RQ4 A;  3EUH C;  3CCU I;  3CD6 I;  1LE8 B;  2VJJ A;  1NG6 A;  1CGP A;  3C1D A;  5BNG A;  3A1Y A;  3B73 A;  3BOQ A;  5LEJ A;  1ZH5 A;  3LSR A;  5K7H A;  4X1E A;  3WU2 C;  2R5Y A;  4LB5 A;  2VBZ A;  3K1N A;  2HQA A;  1XCB A;  2HPI A;  1TC3 C;  5ED4 A;  1BR4 A;  2HTJ A;  5CQG A;  4A3C J;  5E3L A;  4YEJ A;  2VB6 A;  5ICE A;  3JRE A;  4QWQ A;  4ZYD A;  3PSI A;  4UUS A;  3SDG A;  2JJ7 A;  1EH8 A;  3ABU A;  3ZMV A;  3OYI A;  4BDZ A;  4DYC A;  2VN2 A;  3VDX A;  4CCO A;  2E5N A;  3BQY A;  1X58 A;  5HOO A;  1BOB A;  4HEA 2;  1QPM A;  2XAG A;  5DCM A;  4C2U A;  1LEA A;  3S2D J;  4U87 A;  5ILU A;  2QQ8 A;  3ZQI A;  3J81 Z;  3FXK A;  5EEH A;  1VFC A;  1K4T A;  3QYF A;  3RTR A;  3JTG A;  4PUS A;  1IG7 A;  4EGZ A;  5KAF C;  2FUG 2;  3IKV A;  4LOC A;  4RLQ A;  1DPR A;  2WY7 Q;  2JSC A;  3JRI A;  2NNY A;  2B63 J;  1ONV A;  3JRG A;  2F6C A;  2WWY A;  1J0R A;  1F1Z A;  2DA6 A;  2HGC A;  1QRY A;  5F1R A;  3V7S A;  2F5E A;  1LJ9 A;  1ZR2 A;  3OY9 A;  2IXS A;  4L0Y B;  1G3W A;  2O7O A;  4UUV A;  3AG3 H;  4AIK A;  1V5F A;  2MLG A;  4M3D A;  3W3C A;  3OL4 A;  1R6R A;  4XKW A;  1D0Z A;  4UV9 A;  1ZAR A;  3K0L A;  2BY0 A;  3F3X A;  4D7N A;  3HUG B;  3WTV C;  5TRD A;  5DEQ A;  2MFZ A;  2WAF A;  5TGT A;  2X6X A;  4XRS A;  1E3H A;  2Y48 A;  3SEQ A;  4BEH A;  2LBF A;  2E5Z A;  3NEU A;  5J8F A;  1ZYR F;  2E34 A;  4LK1 F;  3SJM A;  1Y0U A;  1TWG J;  2L9S A;  1VQO I;  4KIC A;  1R4M B;  5EDN A;  3JRH A;  1YOV B;  4I01 A;  4B09 A;  3LA3 A;  1W1W E;  1R1U A;  2HKX A;  1U9O A;  1T38 A;  3RKX A;  3TGN A;  4EJO A;  5GAD J;  4AYB A;  4E7I A;  3R0J A;  4IEJ A;  1L0O C;  1OFC X;  1BC7 C;  3GF2 A;  2UWM A;  4OIN F;  4BBS J;  3CUQ C;  2K40 A;  1G59 A;  2GXA A;  3AG1 H;  5ILV A;  2M7B A;  3K7A J;  1W36 C;  5TIS C;  2QVO A;  2FEZ A;  2FE3 A;  3BPV A;  1FX7 A;  4DJA A;  2HVS A;  1LVK A;  2EQR A;  2EV0 A;  4CUG A;  4XL9 A;  2GZW A;  3HTU A;  1D1C A;  2R7V A;  2A61 A;  1EH6 A;  4Y15 A;  4DIQ A;  3BJO A;  3V8K A;  1IW7 F;  4CIC A;  3I4M J;  4UY8 I;  3IWF A;  4I09 A;  3U2R A;  4KIB A;  1JUM A;  2EA2 A;  2HDW A;  4C2T A;  2C6Y A;  5J47 A;  5EEG A;  3VSK A;  4IHV A;  4KA4 A;  3Q0U A;  1B6A A;  4IRH A;  2ME6 A;  5E3N A;  3TDZ C;  1K79 A;  1LPQ A;  4HNV A;  5D5V B;  2KP6 A;  2GM4 A;  1Z3X A;  2V79 A;  2HWV A;  2XF6 A;  3HDD A;  5M5W J;  4Z2Y A;  1NTC A;  2MSY A;  1P9Q C;  5DM6 F;  1QBJ A;  2PEX A;  2YPR A;  1BI3 A;  1A31 A;  2BEO A;  4H0E A;  2ZFW A;  4KIG A;  4Y33 A;  3VYU B;  2VQG A;  1GDT A;  1TNS A;  4CH7 A;  3CJQ B;  3CC2 I;  4OIR F;  2QKL B;  4LLG F;  2E2J J;  2QQA A;  3CMA I;  5LGT A;  2P5K A;  4XR6 A;  2F4I A;  3HRU A;  1RZ4 A;  4G6D A;  1ETW A;  4LGW A;  2BBY A;  4N0B A;  1JHH A;  2CFO A;  2DA7 A;  1IV6 A;  3LNQ A;  4G7O F;  2VQL A;  2DFF A;  2H6C A;  1D1A A;  1VQ8 I;  3O8H A;  2UXX A;  4M71 A;  2LF7 A;  1HKT A;  2FA5 A;  4BBR J;  2EZI A;  1BI0 A;  2F2E A;  4IHW A;  2KRC A;  3OYM A;  4G8X A;  4D1Q A;  2WY8 Q;  2CFX A;  2QUF A;  5DTD A;  1X3Z B;  3HGG A;  5F0F A;  4UB6 C;  1I39 A;  2LDU A;  2BXZ A;  3FDY A;  3GO5 A;  4O6J A;  4KIS A;  2IA0 A;  2V6C A;  2BW3 A;  1R5I D;  5J1R A;  4E4H A;  2CU7 A;  3L2U A;  1T08 B;  5M3F J;  3FX3 A;  3QOE A;  1GVD A;  5IYC J;  3R4K A;  1EH7 A;  1DPU A;  3WTW C;  1RNL A;  2ZNZ A;  4J01 A;  1TBX A;  2CSO A;  2JA5 J;  1M1E B;  2D45 A;  4I2O A;  3M1E A;  4CDG A;  5D5X B;  4WXD A;  3CF2 A;  1XD7 A;  4YFX F;  4BQN A;  1WSU A;  3KP4 A;  4NNJ A;  1GT0 C;  2A6E F;  2MD0 A;  3V7C A;  4EM1 A;  2CO5 A;  2JZY A;  4IZZ A;  4N4O B;  2EWN A;  3E5Q A;  3ELK A;  3MQ0 A;  2R5Y B;  1U5T C;  3V7R A;  3MAJ A;  2XRO A;  1XTA A;  1YG2 A;  2CQK A;  2YR2 A;  1FBS A;  4XRM A;  3F9K A;  4FHT A;  4P96 A;  4DBQ A;  1E3O C;  4OMZ A;  4M9S A;  3JRB A;  2VXD A;  2L7F P;  3AG2 H;  2XB5 A;  5E8I A;  2MG4 A;  4Y7N J;  4HDU A;  1N75 A;  3P5J A;  1QVU A;  5DCM B;  3M8F A;  1FOK A;  5IT9 K;  3KET A;  2VC1 A;  3CUO A;  3M8E A;  3I55 I;  2VUM J;  3QPL A;  3MKZ A;  4BHB A;  3BR0 A;  4A3K J;  3IAM 2;  1HF0 A;  2D1H A;  4EEF G;  5LHG A;  3CUQ A;  1MMS A;  4C3J J;  1MBK A;  3G73 A;  2HEO A;  2V6E A;  1OR7 A;  1P2F A;  1X1P A;  1RI7 A;  3VPR A;  3BZC A;  3OS2 A;  2XKO A;  4JBA A;  2K85 A;  1V3F A;  1XDS A;  3PM1 A;  2XAH A;  2XAQ A;  1K4S A;  5FFX A;  3A01 A;  1T56 A;  3T8R A;  1PUE E;  1F5T A;  1YW9 A;  1MMD A;  4Q48 A;  1Z1D A;  2HVR A;  2XPW A;  1HXD A;  5EF6 A;  3BT9 A;  1V55 H;  2GLO A;  1FTT A;  3RPQ A;  1OYW A;  5D8L B;  5GAE J;  1Z67 A;  3GUD A;  1WZ2 A;  1IRX A;  3CQZ J;  2E1M B;  4BEH B;  1ZLK A;  3X2Q H;  2FNP A;  4DQ2 A;  2DAO A;  2LBF B;  2X6O A;  2VOD A;  3OYL A;  4ASN A;  3CDL A;  3MEX A;  2FMY A;  2IRF G;  2K3F A;  4KNY A;  3RKY A;  1IN4 A;  2RC4 A;  4H4K C;  3F6V A;  1XMK A;  3TQN A;  3JSO A;  3I3L A;  1T95 A;  3T8T A;  4CSW A;  1AU7 A;  4IJA A;  2RN7 A;  2EFQ A;  4NDL A;  3UKG A;  1JGS A;  2QLZ A;  4IHX A;  3HBL A;  2JA7 J;  2JA8 J;  2EFP A;  5EEA A;  1MBE A;  5CLS A;  2YS9 A;  1O57 A;  2ICW G;  3HOY J;  1LDK B;  1LFU P;  4L9T A;  3PNT A;  2XKP A;  5E3O A;  3BG3 A;  3IRQ A;  1RES A;  1SD6 A;  2IGM A;  3S32 A;  3GZ5 A;  4HAM A;  4CZC A;  2R0Q C;  4GRI A;  2IAI A;  1FT9 A;  3IC7 A;  3BR1 A;  4ESF A;  2Z2S B;  4A3G J;  4LG0 A;  3ASO H;  2W25 A;  3WHB A;  5FKM A;  4BE2 A;  1JHF A;  2ZC2 A;  4MIM A;  3GFM A;  3W6K B;  2YX4 A;  2ZJR F;  1OLT A;  2X0L A;  4RM2 A;  3CC7 I;  1HC8 A;  4C2M J;  1V5E A;  2QF7 A;  3OYF A;  3BC8 A;  2ELK A;  2BVL A;  1YIO A;  1R71 A;  1BIA A;  1X3W B;  2VXZ A;  4ENN A;  5JVG F;  2M5W A;  1XDU A;  1GLN A;  4OWR B;  3CCL I;  3I56 I;  3JRA A;  2LP0 A;  2LR8 A;  5B1B H;  1E2X A;  4UVA A;  2MBF A;  4S05 A;  4K2E A;  1PYV A;  2DA4 A;  2BYV E;  1SVM A;  2VOO A;  4HDV A;  1S7E A;  2L4A A;  4XOP A;  2R7D A;  3S14 J;  1ZQ3 P;  5JFR A;  4JK1 X;  3OYD A;  2DOE A;  2DMU A;  2M0C A;  3BJA A;  3HOX J;  2Y0S N;  4AVZ A;  2G9W A;  1RKW A;  2EBI A;  3IH3 A;  1N78 A;  5HLI A;  5KK1 A;  3I4N J;  1HOM A;  2VBX A;  3C3W A;  2DFE A;  2R7F A;  1CF7 A;  1QVT A;  2E2I J;  2EV6 A;  5EZH A;  3RIR A;  2EPF A;  2P5V A;  5KCM A;  5LD2 C;  3OR2 C;  3GTJ J;  4RB2 C;  1HQC A;  4LIU A;  1I6H J;  1WJC A;  4A3M J;  2DXI A;  3HOW J;  2CRG A;  2MA3 A;  3FMR A;  2NVQ J;  2GA1 A;  1GXQ A;  3CES A;  1STZ A;  1TP4 A;  2CUE A;  2EH3 A;  4JYK A;  4E7J A;  2CQX A;  1IXS B;  2FML A;  5FD6 A;  2JPC A;  3AL0 C;  4UVC A;  1FPQ A;  1OJL A;  4XRS G;  4GO1 A;  4E7Z A;  2E36 A;  4HBL A;  2E19 A;  1ETK A;  1MGT A;  2ECB A;  1S7O A;  2BW3 B;  1XN7 A;  4DNC A;  3Q0W A;  2VT3 A;  2VJI A;  5ICG A;  5GPC A;  3TO6 A;  4C9Y A;  4EM2 A;  2R7W A;  5IP7 J;  2V7F A;  3K70 C;  4A6D A;  3BWG A;  3TO7 A;  4Y17 A;  1PUF B;  5F6F A;  2K9N A;  1HKS A;  2QSH X;  3S3N A;  3L7W A;  4B43 A;  4AC0 A;  1YYV A;  2LNB A;  4G94 A;  4XKV A;  2K9M A;  3ZMU A;  3CCV I;  1R23 A;  4YIF A;  2NS0 A;  3H36 A;  4BS9 A;  2KPM A;  3DV8 A;  2IGO A;  3WTT C;  1D8K A;  1LUJ B;  1W0T A;  1UAA A;  1USS A;  2FBK A;  5HS7 A;  2K02 A;  2CG4 A;  5C44 J;  3TOB A;  3RKQ A;  3GTQ J;  1X4O A;  2ZXW H;  1WJA A; 
#chains in the Genus database with same CATH homology
 1XMA A;  2COM A;  3ZQ7 A;  1S6L A;  2IP2 A;  4P9U A;  5LRR A;  3MCZ A;  2JT1 A;  2KRF A;  1QZY A;  5JI6 A;  2KJB A;  3KP3 A;  2PG4 A;  2E7X A;  4RGR A;  2Y75 A;  5KVR A;  2P4W A;  3IRR A;  2GXB A;  4HLX A;  3CUQ B;  2VOP A;  3GYH X;  2DTR A;  2HYG D;  1K6O A;  2ESH A;  2CWE A;  2A07 F;  1O7L A;  3RDI A;  1S3J A;  2EFO A;  2QQB A;  4HYE A;  4ENM A;  2KIF A;  5BMZ A;  1U3E M;  1TW3 A;  2AS5 F;  3KEO A;  5HDG A;  2P5L C;  3F8F A;  4ENK A;  1GXP A;  1FBQ A;  1OYY A;  2A68 F;  1ODD A;  4A5N A;  2VC0 A;  4U0W A;  5E1W A;  4XLN F;  3KP6 A;  3VB2 A;  3HIF A;  1FBU A;  5ERI A;  3KP2 A;  3EDP A;  2NAZ A;  3DFG A;  1I1G A;  4OOI A;  3F22 A;  3QU3 A;  2XV4 S;  5L3E A;  1WKM A;  1SD4 A;  3KCC A;  5IT9 Z;  2XVC A;  3F8N A;  2H6B A;  2DPD A;  3HRT A;  2ZME A;  5DV5 A;  4EJW A;  4G7Z F;  1MJ9 A;  4I7H A;  4M9Z A;  1KYW A;  1IN7 A;  4HOB A;  4PDK A;  3L09 A;  4XLP F;  4P9F A;  3EYI A;  2FNA A;  4A2U A;  3N97 A;  3WU0 A;  3H3U A;  2DI3 A;  2PMU A;  3N4M A;  5D8K B;  4HF0 A;  2HOE A;  2OD5 A;  1KGS A;  3NRV A;  2ZBK A;  3ABT A;  4WWC A;  2H09 A;  3EYY A;  1CF7 B;  4AVP A;  1IXC A;  2M30 A;  1YS6 A;  2R3S A;  2ELH A;  2GWR A;  5DUK A;  3GFJ A;  4R8H A;  3G3Z A;  5E1X A;  3RPU A;  1B59 A;  1ZG5 A;  1HW2 A;  4CGZ A;  1H9G A;  1O3S A;  1TQM A;  1TW2 A;  1R5H A;  3K1M A;  5L3D A;  1ZGJ A;  1FZP B;  2Z99 A;  4LLL A;  1U8R A;  1LEB A;  1KU9 A;  4U7B A;  4OIQ F;  4KN4 X;  2EJR A;  3MWM A;  1D8J A;  3HRS A;  1ZAO A;  2HYF A;  3MFK A;  2IJL A;  4KMF A;  1HBX G;  3E6D A;  1YQA A;  2BE5 F;  1XGM A;  2HR3 A;  3FZV A;  4AIH A;  5DD4 A;  4ESJ A;  4OMY A;  2FBH A;  2ESN A;  3CO7 C;  3LA2 A;  4HLY A;  2JRT A;  2E1N A;  2P7V B;  4UV8 A;  5BPI A;  4UVB A;  4WX9 A;  5FLX Z;  5AON A;  4RB0 A;  1LDD A;  3HHH A;  4IVN A;  3ISP A;  2W57 A;  1OYI A;  4BXU A;  1SD5 A;  2IA2 A;  4IXA A;  2HKO A;  4LMY A;  1U78 A;  4IHS A;  4RGS A;  2HQN A;  1IN6 A;  4Q4Z F;  1BOA A;  5LEK A;  2ZXJ A;  4R1H A;  4GCV A;  4MNU A;  1SAX A;  2HZT A;  1PDN C;  2A6H F;  1IUY A;  2JPB A;  2STW A;  3QPT A;  5LHI A;  4MEY F;  2KKO A;  3KE2 A;  1DDN A;  4KUM A;  1QGP A;  2M8E A;  2GXG A;  2CYY A;  2KIM A;  3LA7 A;  4P55 A;  3GW2 A;  5LGN A;  1H9T A;  2ZO4 A;  2RNJ A;  1L3L A;  1ZRE A;  4NQW A;  1ZHF A;  2WC2 A;  4LFU A;  5ICC A;  2L54 A;  1IXR C;  3WTY C;  3WTU C;  3EUH A;  2V9V A;  3KP5 A;  4M6Y A;  4NHJ A;  2K7L A;  4HX4 A;  1P4X A;  5TJJ A;  3BJ6 A;  1TNT A;  2KJC A;  1IF1 A;  4YG2 F;  1G4D A;  2PMH A;  3CO6 C;  3M7G A;  5BS6 A;  2UZK A;  4I98 B;  2PQ8 A;  3VEP A;  5A2Q Z;  1ZLJ A;  2CGP A;  2ZME B;  1Z05 A;  4KIF A;  1KQ8 A;  3REO A;  4MGR A;  4FT8 A;  4AWX B;  3K1P A;  3E6B A;  3QP5 A;  2A3S A;  3ML6 A;  1SFX A;  3HRM A;  1E17 A;  4BAY A;  3Q5F A;  3WE2 A;  3IHU A;  3GEZ A;  2RV8 A;  5FD5 A;  2CW0 F;  5HDN A;  3AAF A;  4OIO F;  3DF8 A;  5FB2 A;  4BH9 A;  3FMS A;  4MHG A;  1GVJ A;  3F6O A;  3GVA A;  2BGC A;  1J7K A;  3F72 A;  3FXQ A;  5K5Q A;  4F7Z A;  4L9J A;  3C7J A;  2XUB A;  4WK8 F;  2XHK A;  3HTS B;  2M1B A;  3BP8 A;  4ZZD A;  2P7C B;  1MD0 A;  1BM9 A;  4CXF A;  5K1Y A;  3QAH A;  1I6X A;  4IPA A;  3RYP A;  2QWW A;  5CVV A;  4BQA A;  1R5G A;  2F5C A;  4KN7 X;  3WGH A;  2ZNY A;  3RKW A;  3R0A A;  3CLO A;  3WE3 A;  4ZYG A;  5H6Q A;  2O0Y A;  5K5O A;  3IWZ A;  3L9F A;  1T98 A;  2MD5 A;  2ACJ A;  2HQR A;  2PFB A;  1BBY A;  2OQG A;  1HST A;  3ZP5 A;  5HLH A;  1BN5 A;  2VE8 A;  2K86 A;  1S7A A;  1V4R A;  3L00 A;  3JAM K;  4WXC A;  3CDH A;  4FX4 A;  4HQM A;  2P6S A;  1QNT A;  2OA4 A;  4LJZ F;  1FP1 D;  2W85 A;  3GFL A;  2YX7 A;  4CO8 A;  4G6Q A;  1I27 A;  2EA4 A;  3GFI A;  4GYI A;  2Z33 A;  4M9X A;  4JQF A;  2ETH A;  1T2K A;  1ZRD A;  4EJU A;  1ZG3 A;  5BOX A;  1FSH A;  4KDP A;  2P6T A;  4EM0 B;  3ZMD A;  2O6G E;  3DP7 A;  2EK5 A;  2Q2E A;  3U1D A;  1I5Z A;  1OPC A;  2ISZ A;  5CVJ A;  1SMY F;  4TV7 A;  3V8L A;  4FX0 A;  3QU6 A;  5L3G A;  4RAY A;  1NHA A;  4Y13 A;  3DQV C;  3K2Z A;  2GA2 A;  4MTE A;  1FLI A;  3DPL C;  1P4W A;  3QRF F;  4L5J A;  4HQE A;  3FM3 A;  1BC8 C;  1UFM A;  1KU7 A;  2L02 A;  5CVI A;  1R1T A;  2IPQ X;  2DFI A;  2O3F A;  1U5T A;  1J5Y A;  4MQV A;  3GWZ A;  3LST A;  4O3M A;  4HF1 A;  2DU9 A;  3COA C;  1T6S A;  1XGN A;  3ZPL A;  2Y0M A;  2IVM A;  4HV5 A;  1KQ9 A;  2O61 A;  3V8J A;  4M72 A;  5D5U B;  1XSV A;  3LQQ A;  2UXN A;  3ROU A;  1U6G A;  5D6E A;  4KMU X;  4UHT A;  3ECH A;  2DQL A;  3CJN A;  3BPX A;  3GZ6 A;  4P5O A;  3WGG A;  2D1V A;  2RKH A;  3WOD F;  2DLL A;  2MC3 A;  4YII A;  1VTN C;  2FF4 A;  5IT3 A;  1IRF A;  2FQ3 A;  3R60 A;  1WQ2 A;  2ZJ2 A;  2HDC A;  4RGX A;  5HLG A;  2LSO A;  3E97 A;  3BDD A;  4IHT A;  3BZ6 A;  3J7A O;  4RGU A;  2FXA A;  4EGY A;  1YO5 C;  4HX7 A;  1LQ1 A;  2DK8 A;  2EB7 A;  1A04 A;  2JTV A;  2Z5U A;  1ZGA A;  1MJB A;  1B9N A;  2PI0 A;  3I59 A;  5LBQ A;  2WV0 A;  1FSE A;  3I58 A;  4QLC U;  3WGI A;  1R7J A;  2DPU A;  2X4H A;  4LD5 A;  4HA8 A;  3I64 A;  1IRG A;  3TO9 A;  3E6C C;  1MKM A;  2FSW A;  3Q9S A;  1FYM A;  3QOP A;  2FOK A;  2V1D A;  4PGG A;  2F5D A;  5L3B A;  5HS9 A;  4WCG A;  2XIG A;  1W5T A;  3FF5 A;  1RUO A;  3S2W A;  1FNN A;  2Z9O A;  1D5V A;  1S29 A;  3EET A;  1JXS A;  3TDU C;  1T39 A;  3OOP A;  3MZH A;  3RI4 A;  1PP7 U;  3VFZ A;  3O2P E;  5DD8 A;  1S8N A;  2BV6 A;  4LLN A;  1LNW A;  3W6J B;  3FXR A;  1KA8 A;  4BHP A;  1J59 A;  3GX4 X;  5D4S A;  3ZN0 A;  2DW4 A;  1BIB A;  3LQR A;  1IN8 A;  4M73 A;  2XAF A;  4EVI A;  3R61 A;  1B9M A;  3SHF A;  4M74 A;  1Z91 A;  1G3T A;  5E1Z B;  2GQQ A;  4IRI A;  2PJP A;  2ZKZ A;  2NNN A;  1P4A A;  1U2W A;  1QQI A;  4PGH A;  5DCF A;  3HHG A;  3KLN A;  4I0B A;  4XSX F;  2QBY A;  2PN6 A;  1DUX C;  1FYK A;  1U5T B;  2J5P A;  3U9G A;  4ON0 A;  1SMT A;  3RYR A;  3LWF A;  2V1X A;  1ZN2 A;  2LKP A;  4ETS A;  3HSF A;  3SFZ A;  5ILS A;  1LB2 A;  5J6X A;  1UHW A;  4AIJ A;  3KEQ A;  4XBF A;  4BYY A;  2OAZ A;  3P9I A;  4LB6 B;  3E6M A;  3HYI A;  1D3Y A;  2QM3 A;  3MZY A;  4L9N A;  5E8G A;  4EQQ A;  2G7U A;  1TQI A;  4B8X A;  2WTE A;  2TDX A;  2O03 A;  5J8C A;  1MDM A;  1Q1H A;  4OU0 A;  3SZP A;  2W24 A;  5DUI A;  1UCR A;  4ESB A;  2D2W A;  1EV7 A;  3CTA A;  2RDP A;  1K78 A;  4A6E A;  2DK5 A;  3VOD A;  1P92 A;  4KYW A;  2VBY A;  3EQL F;  2MH9 A;  3JTH A;  4N9I A;  4A5M A;  3IL2 A;  4E70 A;  1R1V A;  1F4K A;  3I59 B;  1H0M A;  2L4M A;  1XB4 A;  3K69 A;  4EV0 A;  3KZZ A;  4OIP F;  1J9I A;  1KQ0 A;  2HTS A;  2IW5 A;  1F9N A;  1ON2 A;  2AXL A;  2GAU A;  4U0V A;  4Q5S F;  1OMI A;  1ULY A;  3KZY A;  2DT5 A;  1R22 A;  2IA1 A;  3FMQ A;  2M45 A;  3WTS C;  2G7H A;  1ON1 A;  2MH2 A;  4L9V A;  2B0L A;  1XSD A;  4UXN A;  2J5O A;  4WF2 A;  4HV6 A;  5FO5 A;  2HS5 A;  5D6F A;  4A0Y A;  3NQO A;  3F21 A;  1R00 A;  1SD7 A;  1C0W A;  1WWX A;  2Z3Y A;  4EMS A;  3H3Z A;  3HOS A;  5JVT A;  1PP8 F;  2OZ6 A;  2ZCW A;  3P7N A;  4PZJ A;  5FFZ A;  3T5X A;  2XAJ A;  4BNC A;  4L0Z B;  3KP7 A;  4PCQ A;  2QEN A;  4I02 A;  2DO7 A;  3J80 K;  4UNO A;  4WXH A;  4ZYE A;  4YFN F;  1X3U A;  2EV5 A;  2OBP A;  4RB1 A;  2QYO A;  1SFU A;  1QO0 D;  1YFH A;  2DQR A;  5H6R A;  2H94 A;  3SQN A;  1B1B A;  4G9Y A;  5BPD A;  1TLH B;  4A0Z A;  1J2X A;  5D4R A;  3PFI A;  4O5V A;  4HF2 A;  5JR3 A;  4XSZ F;  3ZMT A;  2QBY B;  2K4B A;  1HSJ A;  2NYX A;  4ZZL A;  2K4J A;  2VON A;  1O7F A;  2ISY A;  4RAZ A;  3PQJ A;  1W7P D;  1TQP A;  2V1U A;  1HKQ A;  1W5S A;  3F8M A;  5D5W B;  2HFH A;  2XAS A;  4KFC A;  3QPH A;  3K9T A;  2Q8K A;  4ZH4 F;  2GIV A;  1AOY A;  5E18 F;  3F23 A;  1LDJ A;  1W7P A;  4M6X A;  1KU2 A;  2FU4 A;  3SZT A;  5LLQ A;  1UB9 A;  2RVC A;  3D5L A;  4HX8 A;  1MDM B;  1IN5 A;  2YSR A;  2STT A;  5AIP A;  3SXY A;  2KIU A;  3QP6 A;  3WTZ A;  3M9A A;  3E5U A;  2FRH A;  3HOT A;  1Z6T A;  3DPT A;  1FY7 A;  1K78 B;  3P9K A;  1WRJ A;  5HVQ C;  4ZYH A;  1MZB A;  2O8X A;  4XRF A;  1XCV A;  3RJP A;  3WTX C;  4S04 A;  5L3C A;  1FYL A;  2FBI A;  3KFW X;  1J75 A;  1GHC A;  4GXO A;  1IAW A;  4NB5 A;  5CVU A;  1UHM A;  2A69 F;  5L3F A;  1W4M A;  2VE9 A;  4MEX F;  3I54 A;  5K5R A;  2YU3 A;  1T0F A;  2L01 A;  1FC3 A;  3ZMS A;  5E20 A;  3Q9V A;  1K7A A;  3C18 A;  1HW5 A;  1YTY A;  2OQR A;  5LHH A;  2PLY A;  3ULQ B;  3J81 K;  1XGO A;  2VBW A;  4HW0 A;  2IT0 A;  1YW7 A;  4D0P A;  4G7H F;  3WU1 B;  4U88 A;  4A12 A;  4N9H A;  2L3D A;  2H27 A;  3R6S A;  5CVR A;  1RIO H;  3BY6 A;  2P8T A;  5CJ9 A;  3V4G A;  3VOE A;  4EJT A;  1O3R A;  5CYV A;  3ECO A;  1LVA A;  3LAJ A;  3L2C A;  3PQK A;  3OV8 A;  3T0Y A;  4R79 A;  2K27 A;  4CZZ A;  1KYZ A;  1HW1 A;  5AIQ A;  5FLX K;  4MTD A;  4HZF A;  2OU2 A;  2XRN A;  5ICF A;  3IKT A;  5BQT A;  4I0A A;  2ADU A;  2RGV A;  1SFE A;  4GYG A;  1Z9C A;  1XGS A;  5JHU A;  1Z7U A;  5HS8 A;  1BI1 A;  4LK0 F;  3TOA A;  4A0X A;  3I53 A;  1R36 A;  4U0Y A;  1XSX A;  2QZ8 A;  1ZG1 A;  3I4P A;  3F8C A;  1YW8 A;  1BJA A;  3O3K A;  2OZU A;  3B02 A;  4ENJ A;  2DBB A;  2QQ9 A;  3T1B A;  3WG9 A;  5FGM A;  3KLO A;  3DXJ F;  3D0S A;  4IF4 A;  3ERE D;  3E3V A;  4CYD A;  3J80 Z;  5E17 F;  1ZRC A;  5H20 A;  3HUG A;  4RB3 C;  1W7P B;  3BRO A;  2Q0O A;  4AD9 A;  1G3Y A;  3I0T A;  3TKY A;  3FXU A;  3F8B A;  3DEU A;  1O3T A;  4U7D A;  5A2Q K;  1B4A A;  3LFK A;  3FM5 A;  4L18 B;  3GXO A;  3I5U A;  2PBI A;  2LF8 A;  2MLK A;  2EFN A;  3ZMZ A;  1WI9 A;  4RS8 A;  1O3Q A;  5LGU A;  3FWE A;  3P9C A;  1YS7 A;  1UST A;  1BI2 A;  5DYM A;  4Q47 A;  5F64 A;  1R58 A;  3LAP A;  1TTY A;  2XGX A;  1IZ1 A;  3DKW A;  2W84 A;  4GGG A;  5LRS A;  3JW4 A;  4YFK F;  1RUN A;  1REP C;  3H92 A;  1JE8 A;  6PAX A;  3ZN1 A;  3JSP A;  1KU3 A;  2F5F A;  1FP2 A;  3FHZ A;  2EFW A;  4LG0 B;  1P6R A;  1G6N A;  2NRA C;  3HSE A;  3GLX A;  1DP7 P;  2RQP A;  5DDG A;  1QZZ A;  3E5X A;  1YLF A;  1ZRF A;  3I71 A;  3HSR A;  4KT5 C;  1I1S A;  4BHC A;  4MQ9 F;  1MJA A;  4L5I A;  3JAM Z;  1OKR A;  1Z6R A;  4EJV A;  2E1C A;  4IRG A;  1AWC A;  2E7W A;  4CHU A;  1FWZ A;  2VT2 A;  3O6B B;  2M87 A;  5HDK A;  2A5Y B;  1G3S A;  1CGP A;  3C1D A;  3B73 A;  3BOQ A;  5LEJ A;  1ZH5 A;  4LB5 A;  2VBZ A;  3K1N A;  1XCB A;  5ED4 A;  2HTJ A;  5ICE A;  4QWQ A;  4ZYD A;  3ABU A;  1EH8 A;  3ZMV A;  2VN2 A;  5HOO A;  1QPM A;  2XAG A;  5DCM A;  1LEA A;  5ILU A;  3J81 Z;  5EEH A;  3RTR A;  3JTG A;  4EGZ A;  3IKV A;  1DPR A;  2JSC A;  2NNY A;  1ONV A;  2WWY A;  1J0R A;  1F1Z A;  2HGC A;  5F1R A;  3V7S A;  2F5E A;  1LJ9 A;  4L0Y B;  1G3W A;  4UUV A;  4AIK A;  2MLG A;  4UV9 A;  1ZAR A;  3K0L A;  3F3X A;  5TRD A;  3WTV C;  5DEQ A;  2Y48 A;  3NEU A;  5J8F A;  1ZYR F;  4LK1 F;  1Y0U A;  4KIC A;  4I01 A;  4B09 A;  3LA3 A;  1R1U A;  2HKX A;  1T38 A;  3RKX A;  3TGN A;  4EJO A;  3R0J A;  1L0O C;  1BC7 C;  3GF2 A;  2UWM A;  4OIN F;  3CUQ C;  5ILV A;  2QVO A;  2FEZ A;  2FE3 A;  3BPV A;  1FX7 A;  2EV0 A;  2GZW A;  3HTU A;  2A61 A;  1EH6 A;  4Y15 A;  3BJO A;  3V8K A;  1IW7 F;  4CIC A;  3IWF A;  4I09 A;  3U2R A;  4KIB A;  2EA2 A;  2C6Y A;  5EEG A;  4KA4 A;  4IRH A;  1B6A A;  3TDZ C;  1K79 A;  5D5V B;  2V79 A;  2HWV A;  4Z2Y A;  1QBJ A;  2PEX A;  2YPR A;  1BI3 A;  2BEO A;  4H0E A;  2ZFW A;  4KIG A;  1TNS A;  4OIR F;  4LLG F;  2QQA A;  5LGT A;  2P5K A;  3HRU A;  1RZ4 A;  4G6D A;  4LGW A;  2BBY A;  4N0B A;  1JHH A;  4G7O F;  2H6C A;  2UXX A;  4M71 A;  2LF7 A;  1HKT A;  2FA5 A;  1BI0 A;  2F2E A;  4G8X A;  2CFX A;  2QUF A;  3GO5 A;  2LDU A;  4O6J A;  2IA0 A;  2V6C A;  3FX3 A;  3R4K A;  1EH7 A;  1DPU A;  3WTW C;  1RNL A;  2ZNZ A;  1TBX A;  2CSO A;  2D45 A;  4I2O A;  3M1E A;  4CDG A;  5D5X B;  4WXD A;  1XD7 A;  4YFX F;  1WSU A;  3KP4 A;  2A6E F;  3V7C A;  4EM1 A;  2CO5 A;  2JZY A;  2EWN A;  3E5Q A;  3ELK A;  3MQ0 A;  1U5T C;  3V7R A;  3MAJ A;  2XRO A;  1YG2 A;  2CQK A;  2YR2 A;  1FBS A;  4P96 A;  4FHT A;  4OMZ A;  4M9S A;  5E8I A;  4HDU A;  5DCM B;  3M8F A;  1FOK A;  5IT9 K;  3KET A;  2VC1 A;  3CUO A;  3M8E A;  4BHB A;  2D1H A;  5LHG A;  3CUQ A;  3G73 A;  2HEO A;  1OR7 A;  1P2F A;  1RI7 A;  2XKO A;  4JBA A;  1V3F A;  1XDS A;  2XAQ A;  2XAH A;  5FFX A;  1PUE E;  3T8R A;  1F5T A;  1YW9 A;  4Q48 A;  1Z1D A;  1HXD A;  3RPQ A;  1OYW A;  5D8L B;  3GUD A;  1ZLK A;  2FNP A;  4DQ2 A;  2DAO A;  2VOD A;  4ASN A;  3MEX A;  2FMY A;  2IRF G;  4KNY A;  3RKY A;  1IN4 A;  2RC4 A;  3F6V A;  1XMK A;  3TQN A;  3JSO A;  3T8T A;  4IJA A;  2RN7 A;  2EFQ A;  1JGS A;  2QLZ A;  2EFP A;  5CLS A;  1O57 A;  1LDK B;  4L9T A;  2XKP A;  3IRQ A;  1SD6 A;  3GZ5 A;  4HAM A;  1FT9 A;  3IC7 A;  4ESF A;  4LG0 A;  2W25 A;  1JHF A;  3GFM A;  3W6K B;  2YX4 A;  2X0L A;  1YIO A;  1BIA A;  2VXZ A;  4ENN A;  2M5W A;  1XDU A;  1E2X A;  4UVA A;  2MBF A;  4S05 A;  4K2E A;  2BYV E;  2VOO A;  4HDV A;  2L4A A;  2R7D A;  5JFR A;  4JK1 X;  3BJA A;  2G9W A;  5HLI A;  5KK1 A;  2VBX A;  3C3W A;  2R7F A;  1CF7 A;  2EV6 A;  3RIR A;  2P5V A;  4RB2 C;  1HQC A;  3FMR A;  2MA3 A;  2GA1 A;  1GXQ A;  1STZ A;  1IXS B;  2FML A;  5FD6 A;  2JPC A;  4UVC A;  1FPQ A;  4GO1 A;  4HBL A;  1MGT A;  1S7O A;  1XN7 A;  4DNC A;  2VT3 A;  5ICG A;  3TO6 A;  4EM2 A;  4A6D A;  3BWG A;  3TO7 A;  4Y17 A;  5F6F A;  1HKS A;  3L7W A;  1YYV A;  2LNB A;  4G94 A;  3ZMU A;  1R23 A;  4YIF A;  2NS0 A;  3DV8 A;  3WTT C;  1D8K A;  1USS A;  2FBK A;  5HS7 A;  2K02 A;  2CG4 A;  3TOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...