1W7PA

The crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
213
Chain Sequence
VNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords VPS22, YPL002C
publication title Escrt-II, an Endosome-Associated Complex Required for Protein Sorting: Crystal Structure and Interactions with Escrt-III and Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 60
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04157 EAP30 EAP30/Vps36 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pA03
1GXQA 4YIIA 3JTHA 3CTAA 2DO7A 4B09A 2XAQA 1QBJA 4FX4A 1KYZA 1TQPA 3E6BA 2L4AA 1BBYA 4EVIA 4OMYA 1ZG1A 1V3FA 3KZZA 1SD4A 2IPQX 2QYOA 4BXUA 4L0YB 2OZ6A 1T0FA 1FP1D 3CLOA 2NAZA 3DEUA 5HDKA 1PP7U 1R5HA 1MDMA 3HSFA 1KGSA 1GVJA 2M1BA 1PDNC 5A2QK 3WTZA 3ZN0A 2IVMA 1U5TA 4AIKA 3H92A 2DW4A 3EUHA 2EV6A 1P4WA 3V8JA 1I1GA 3K9TA 3J80K 3VFZA 2HQNA 3I64A 3BZ6A 2PBIA 2CW0F 4A0ZA 3M8FA 4FX0A 3E6CC 3ZQ7A 4U88A 2RKHA 5E20A 3BROA 2A68F 2OZUA 5TJJA 2F5FA 3I53A 4ZYEA 1UHWA 1H0MA 5DV5A 1MGTA 3WE3A 4RB3C 1DDNA 1STZA 3F8FA 3BP8A 3EETA 4BHPA 2A5YB 5F64A 3CUQC 3NQOA 1YO5C 4EGZA 3BJOA 1R5GA 4N9IA 3QPHA 2W57A 4ESJA 4GGGA 4LK1F 2PFBA 2V79A 3W6KB 4O6JA 4M71A 1TW2A 1J5YA 2PQ8A 5D4RA 1IN6A 1JGSA 4GYGA 3KP4A 1EH7A 3LAJA 1ODDA 1SMTA 2RNJA 3U1DA 5HOOA 2VODA 3DPTA 1W5SA 4Q47A 4YFNF 4BH9A 3KETA 4KICA 2JPBA 1XGSA 4WF2A 4AD9A 1RIOH 3MQ0A 5LEKA 2M87A 1YFHA 4QLCU 3REOA 3E97A 5K1YA 1HKTA 4HX4A 2DI3A 5L3GA 2P6TA 3B02A 1LB2A 2EK5A 5L3BA 2IRFG 4Y17A 1BC8C 1R36A 2DPDA 1FSHA 3FXRA 4LB6B 3BJAA 4OMZA 2DQRA 3HUGA 5LGUA 3F22A 1IAWA 2EFWA 3E6DA 2ZJ2A 2MC3A 4FHTA 4L0ZB 2HQRA 5BMZA 2H09A 3IC7A 4UXNA 3W6JB 4PDKA 1SAXA 2A07F 4G7HF 4R8HA 2VE8A 2FBKA 3P9CA 5ICFA 4KIBA 4Q5SF 2P4WA 4BNCA 2DK5A 3O2PE 2F2EA 5CVRA 4U7BA 1B1BA 2ZKZA 4P9UA 3KEQA 2STWA 2GZWA 2FA5A 1G3TA 3G3ZA 3RKXA 2V1UA 2QBYA 2M5WA 3SQNA 1R00A 3RPUA 1BN5A 5CYVA 3ZMSA 1UHMA 3WTVC 1TBXA 4Z2YA 1B9NA 2Q0OA 3MWMA 2ESNA 4RAYA 2L02A 1IRGA 1XD7A 1WI9A 5BPIA 2E1CA 2NRAC 2FEZA 2VBZA 2GIVA 4EM1A 5ILUA 1HXDA 1K78A 5LRSA 2ELHA 4G7OF 2XGXA 4OIOF 5HS7A 4ZZLA 2PG4A 4CO8A 5A2QZ 5K5OA 1R23A 1LNWA 3M1EA 3LFKA 1AWCA 1ZG5A 2BEOA 3J80Z 4KUMA 3C3WA 3Q5FA 4A5MA 4KA4A 1W5TA 1S3JA 4I2OA 2L54A 4UUVA 4L9NA 4MQ9F 3HTUA 3KP3A 1F9NA 4KMUX 4K2EA 4BQAA 3WTSC 5HDNA 1FWZA 2EA2A 2K7LA 1BJAA 3T5XA 2A6HF 1BC7C 5E1WA 2WV0A 4R79A 3IKTA 1IXSB 5D5VB 2XROA 5JVTA 4KYWA 2VBYA 2PJPA 1KQ8A 1IN4A 1D8JA 4RS8A 4Q48A 3EYIA 1L0OC 1T2KA 2QQBA 1C0WA 1YTYA 4IHTA 3NEUA 1HW2A 2PMUA 4HDVA 1DP7P 4A0YA 1ULYA 2PN6A 3V8LA 2FOKA 3V7SA 2FMYA 1P4XA 1KU3A 1HBXG 2QM3A 1U5TC 3RKWA 5DUIA 1MD0A 3I71A 1U78A 1Z1DA 2JPCA 4KNYA 2STTA 4WXDA 4E70A 2XAHA 2MLKA 4YFXF 2EA4A 3C18A 2WC2A 2YSRA 2R3SA 5H20A 2EFQA 3F6VA 1RI7A 3GFLA 5H6QA 4Y13A 1FSEA 2D45A 3QP6A 3HOSA 5JFRA 2H6CA 2L01A 4S05A 1R22A 1YQAA 4BAYA 2CQKA 2VONA 1BI3A 4RB0A 1Y0UA 1R1UA 2IP2A 2A3SA 1ZYRF 5TRDA 3MFKA 2MA3A 2ZNZA 2Z9OA 1X3UA 2RVCA 4MEXF 3SXYA 3I54A 1YIOA 3I0TA 3WTUC 4HV5A 1KU9A 3L7WA 3I59B 4KMFA 3DPLC 4WXCA 4I02A 1BI0A 1DPRA 4BHCA 4BYYA 3FXUA 2RDPA 3P9KA 3T8TA 1CF7B 4G6QA 3KP2A 3BPVA 1E17A 1W7PB 3F23A 2O03A 3RPQA 1IN8A 3JW4A 4F7ZA 1J7KA 3ZMDA 4ZYDA 3TO6A 2ACJA 5CVIA 2XIGA 3JAMK 3SZTA 5EEGA 2BBYA 1UCRA 3WODF 2PMHA 1LEBA 3O6BB 1XN7A 4ESBA 4OIRF 4FT8A 1JXSA 1IZ1A 3F8BA 3D5LA 4L9TA 2JZYA 6PAXA 1Z6TA 1FY7A 1SFEA 2TDXA 3L9FA 2H6BA 2HR3A 4NB5A 3VEPA 4PGHA 1A04A 4U0YA 2P7CB 1FNNA 1VTNC 5LBQA 3IHUA 3KZYA 2MH9A 4CDGA 4JQFA 1H9TA 1W7PD 1KYWA 4XRFA 4HDUA 1K7AA 2DAOA 4EJVA 2EV5A 1WWXA 2CFXA 2QUFA 2GXGA 2OQRA 3JTGA 5D5XB 4A6DA 3V7RA 1YW9A 3LA3A 5ILVA 3GFMA 3H3ZA 1ZRCA 3CDHA 2VT3A 3AAFA 4OOIA 3ECHA 4PZJA 1YLFA 3EDPA 3FXQA 1IF1A 3JSOA 4MHGA 4G6DA 4EM0B 5ICCA 1XDUA 2FQ3A 4EV0A 2X0LA 4ENMA 4GXOA 2LF8A 3QRFF 4I09A 1Z05A 3R4KA 1S8NA 1FBQA 3K69A 1O3RA 5D4SA 3IKVA 2JRTA 3KLNA 1BM9A 4EQQA 4MEYF 4RB1A 4HF2A 1B4AA 4PCQA 5L3DA 3V7CA 5IT3A 2LNBA 1HSTA 5KK1A 2ZMEB 3GZ6A 2G7HA 3RKYA 4XBFA 3GW2A 4BHBA 3M7GA 4IF4A 1TLHB 3WTTC 1FPQA 3DV8A 1KA8A 2NNNA 1XSXA 3NRVA 4S04A 3LSTA 3HRTA 3TOBA 5HLIA 5HLGA 5E1XA 2OBPA 3Q9SA 3MAJA 1U6GA 4CGZA 2P7VB 2FMLA 4IRHA 2DPUA 5BS6A 4I0AA 1TW3A 4O3MA 5DYMA 3K1NA 2V9VA 2CG4A 5AONA 1RZ4A 3J81K 1B9MA 2GQQA 4OINF 1BIAA 4ASNA 2RV8A 4M73A 2XASA 3BPXA 5CVJA 5AIQA 2JT1A 2AXLA 2O6GE 2LDUA 5E8GA 4IXAA 3T8RA 1XGOA 3T1BA 3HSEA 4RGSA 4HBLA 3VB2A 1KQ0A 5K5QA 1LDKB 5JI6A 5D8KB 2O61A 1B59A 1W7PA 3JAMZ 1Z91A 2L4MA 2QQ9A 3T0YA 3PQJA 4L5IA 3TDUC 5J8FA 3HHGA 3TGNA 1FZPB 1RUNA 4I01A 1J9IA 4MGRA 4ZH4F 3GO5A 1LQ1A 4A0XA 4HW0A 4M72A 2W25A 2RC4A 4RGUA 2X4HA 1T38A 3WU1B 4LLNA 4HOBA 3JSPA 1IN7A 3GLXA 4LK0F 4MQVA 2BYVE 5J8CA 2EWNA 3BJ6A 1H9GA 4CICA 3DQVC 4I98B 1D8KA 5ICEA 2K27A 2EFOA 3CO7C 1BI1A 2XUBA 4EJTA 2XAGA 2ZNYA 1T98A 3QU3A 3GFIA 4L9JA 2M8EA 5DEQA 4HLYA 1O3TA 3DF8A 3WGGA 1QGPA 3MZHA 4HQEA 3FM3A 1I5ZA 3V4GA 5BQTA 4KIGA 5HS8A 4ESFA 2F5EA 1I27A 1P4AA 1F5TA 2OA4A 2ESHA 2VT2A 2OU2A 3GZ5A 4RAZA 4N0BA 1OYYA 1REPC 3S2WA 4A6EA 1ZGAA 4OIQF 4IVNA 2CWEA 2HDCA 4A2UA 5LGTA 3F8NA 5DD4A 1YS7A 4LGWA 1T39A 1QPMA 4LG0B 3WG9A 3N4MA 1TNTA 2HYGD 2DLLA 3HRMA 3F8CA 5KVRA 1XCVA 2M30A 1HW1A 3FMQA 5CVUA 1D5VA 1KU7A 3EYYA 5IT9K 1USSA 2MD5A 4I0BA 1K79A 3HTSB 5FGMA 4M9XA 5FB2A 1UB9A 2YX4A 5FLXK 3KEOA 5F6FA 3WGHA 4RB2C 3OOPA 1MDMB 2J5OA 2ZMEA 4LLLA 2C6YA 4YG2F 5ILSA 4DQ2A 4XSZF 2HTSA 4Q4ZF 1U5TB 2OQGA 3GEZA 1MJAA 4MTEA 1BI2A 4UNOA 4IHSA 1S6LA 5D6FA 2VC1A 3HRUA 3QOPA 2G9WA 3CJNA 4P5OA 2HKOA 1I1SA 2D2WA 2KIUA 2O0YA 4NHJA 4KDPA 5HS9A 1NHAA 4M74A 2NS0A 1FYLA 4RGRA 3LAPA 1GXPA 3J81Z 3BWGA 4QWQA 4IJAA 1WQ2A 2YU3A 4EMSA 4MNUA 1HKSA 2FE3A 3GVAA 2W24A 1QO0D 3BY6A 2HWVA 4CZZA 1YW7A 3M9AA 1S29A 2V1XA 2KKOA 3WTWC 3F6OA 2P5LC 3MZYA 1FX7A 3QPTA 3FF5A 5BPDA 3G73A 4IPAA 4LJZF 1SD6A 2EFPA 4HX8A 2KJBA 1DUXC 2R7DA 1G6NA 2A69F 5CVVA 2XAJA 3H3UA 5E18F 2ADUA 3M8EA 2K4JA 3RDIA 2WWYA 1ZLJA 1WSUA 1GHCA 3Q9VA 4LD5A 1QNTA 3LA7A 2HS5A 5JHUA 1OR7A 4UVCA 1G3SA 1MZBA 4P96A 1MJ9A 4CHUA 1P6RA 2GXBA 5L3EA 1O3SA 3F3XA 1Z6RA 3ZN1A 2GAUA 3RJPA 3ZMVA 3F8MA 4GO1A 3VOEA 4NQWA 1KU2A 3KP7A 1RUOA 2RQPA 5LRRA 1OPCA 3SZPA 4G8XA 1ZG3A 1YYVA 4R1HA 3KE2A 1IXCA 5FD6A 4GCVA 4DNCA 2V6CA 2GA1A 4L18B 2PEXA 3SFZA 2UZKA 3WU0A 1LVAA 4ENKA 3ZMTA 5FO5A 2K86A 2IA0A 4OU0A 1HQCA 4XLPF 3ZMZA 4ENNA 1USTA 2MH2A 4AIJA 2A6EF 3SHFA 1R7JA 4L5JA 2HTJA 1P92A 4XSXF 2P5KA 3E5UA 2RN7A 1CGPA 3K2ZA 4AIHA 4UVBA 4N9HA 3RYPA 3IRRA 2QBYB 3I58A 5D5WB 1IW7F 2DTRA 2HGCA 4KN7X 2Y0MA 1MKMA 1SMYF 2QENA 1U2WA 2PI0A 3BDDA 1SD5A 4UV8A 2BV6A 4LG0A 4EJOA 5IT9Z 2FBIA 3ABUA 1QZYA 3KLOA 3PFIA 3F21A 2KJCA 3HIFA 4G94A 1ON2A 1K78B 2O8XA 4I7HA 5FLXZ 2E7XA 2Z5UA 3BOQA 4B8XA 4WX9A 2YX7A 3DXJF 3ROUA 2HYFA 2G7UA 2FNAA 2V1DA 3I5UA 1FP2A 5ED4A 5EEHA 1LDDA 1S7OA 3V8KA 2HZTA 1SFXA 4WCGA 2Q8KA 5LEJA 2XV4S 1T6SA 2NNYA 1TQMA 4ON0A 1LJ9A 3RI4A 4A12A 2XAFA 3CUQB 3KCCA 1LDJA 1HSJA 4XLNF 4ZZDA 2Q2EA 3O3KA 3L2CA 2DK8A 4Y15A 1OYIA 1G3WA 2JSCA 4HAMA 3R60A 4LMYA 3TQNA 1BOAA 4PGGA 2YR2A 2VC0A 2Y48A 4D0PA 2BGCA 3HOTA 1OMIA 1RNLA 3GYHX 2ZXJA 1HW5A 5HDGA 2XRNA 1FYKA 4UVAA 4AWXB 1BIBA 2P6SA 2CGPA 4ZYHA 4U0WA 3QU6A 2K4BA 2UWMA 1IRFA 4EM2A 3U9GA 2Y75A 5HVQC 2VE9A 5K5RA 1P2FA 2E1NA 3FWEA 2VXZA 1FC3A 2VBWA 2D1VA 1ON1A 2LSOA 4HX7A 5H6RA 3ERED 1Z9CA 4WWCA 2XKPA 2CSOA 1B6AA 1KQ9A 3GX4X 3TO9A 3FX3A 2PLYA 5L3CA 1G4DA 4EJUA 1IN5A 1O3QA 1S7AA 3C7JA 5FD5A 3TO7A 2XKOA 3DFGA 5L3FA 3E5XA 4WXHA 1EV7A 1WRJA 3I59A 1XCBA 1FYMA 3RYRA 3LQQA 3ABTA 4KFCA 1SD7A 3IRQA 2GA2A 3HRSA 2VN2A 3IL2A 4G7ZF 2FNPA 2ISYA 2HEOA 1CF7A 5E17F 1PP8F 3WTYC 3IWFA 4HA8A 3K1PA 4LLGF 3WGIA 3CUOA 1ZREA 1ZARA 5DCFA 3B73A 5DUKA 1XSDA 4ETSA 5LHHA 2ZCWA 2DBBA 1ZGJA 2R7FA 2E7WA 2HFHA 2FRHA 1WKMA 4OIPF 2LKPA 2XHKA 2FU4A 4P55A 2EFNA 2ISZA 2UXNA 1XSVA 3J7AO 2IJLA 2ZBKA 4KN4X 4HYEA 3GUDA 2AS5F 2XVCA 3F72A 1J2XA 1K6OA 5HLHA 1YS6A 2Z99A 5E8IA 5LLQA 4H0EA 2MBFA 2UXXA 2DQLA 3ECOA 3E3VA 1E2XA 1FOKA 2ZO4A 5DCMB 3R0JA 3K0LA 4M9ZA 2W85A 3ZMUA 4ZYGA 1QZZA 3E5QA 4IRIA 4U7DA 4GYIA 2FSWA 1FLIA 2H94A 5ERIA 1ZHFA 3P7NA 4HZFA 3P9IA 1JHHA 3TKYA 1LEAA 4YIFA 1HKQA 1QQIA 2QWWA 4AVPA 1F1ZA 2FBHA 3RTRA 3WTXC 2EJRA 3ISPA 2NYXA 2ETHA 4HLXA 2H27A 2IA1A 1O7LA 2GWRA 2F5CA 5LHIA 3QAHA 4TV7A 4L9VA 3C1DA 3HHHA 1ZRFA 5D5UB 3GF2A 2OAZA 4G9YA 4KIFA 1TNSA 1XDSA 3L00A 4UHTA 2DT5A 3FMSA 1ZRDA 3GFJA 3CUQA 3HSRA 3VODA 1EH6A 1I6XA 2QZ8A 2J5PA 2D1HA 4M6YA 2WTEA 3GWZA 1OYWA 2QQAA 1XB4A 5DD8A 3ML6A 2KIMA 1IXRC 1ZH5A 5D6EA 2P8TA 2VOOA 2BE5F 2ZFWA 1FBUA 1OKRA 3FMRA 1YW8A 1FBSA 2IT0A 3TOAA 5FFXA 3KP6A 2QVOA 3ZPLA 4KT5C 2VOPA 3N97A 3ZP5A 3ELKA 1JE8A 1ZN2A 4HF0A 3PQKA 2CO5A 2KIFA 1TTYA 3COAC 5J6XA 3ULQB 2HOEA 4RGXA 5CJ9A 3CO6C 1U8RA 1V4RA 4JBAA 2OD5A 3IWZA 3GXOA 1UFMA 3KFWX 3R61A 2DFIA 4A5NA 3DKWA 2P5VA 3K1MA 2EB7A 1R58A 1J59A 2FF4A 2HKXA 5LHGA 1J75A 4WK8F 2DU9A 1D3YA 3I4PA 5E1ZB 1L3LA 3FM5A 2Z3YA 5F1RA 4O5VA 4HQMA 4LFUA 5BOXA 3DP7A 2YPRA 4P9FA 4ENJA 2MLGA 5JR3A 5FFZA 1Z7UA 4JK1X 1F4KA 3LQRA 1SFUA 1ONVA 4YFKF 4EGYA 1J0RA 3R6SA 2W84A 2FXAA 1O57A 3U2RA 2QLZA 1XGMA 3QP5A 4EJWA 1Q1HA 1W4MA 5CLSA 2RGVA 3KP5A 4IRGA 2F5DA 2COMA 2IA2A 3LWFA 2K02A 1G3YA 1R1VA 1R1TA 1ZAOA 2M45A 1EH8A 1JHFA 2LF7A 2KRFA 1XMKA 2VBXA 1YG2A 3MEXA 1ZLKA 4U0VA 1AOYA 3EQLF 3OV8A 4M6XA 3WE2A 3R0AA 1U3EM 3RIRA 3HYIA 5DCMA 2A61A 4LB5A 1DPUA 5D8LB 2O3FA 5LGNA 1MJBA 4CYDA 2Z33A 3E6MA 5ICGA 1FT9A 3MCZA 1PUEE 2IW5A 2L3DA 3FHZA 3LA2A 3FZVA 2EV0A 3L09A 4HV6A 5AIPA 1TQIA 4CXFA 1IUYA 2JTVA 3TDZC 2CYYA 1O7FA 1XMAA 3D0SA 4UV9A 4MTDA 5DDGA 4M9SA 2B0LA 1XGNA 4HF1A
chains in the Genus database with same CATH superfamily
4FTHA 1S7EA 2DMNA 2KRHA 1GXQA 4YIIA 3JTHA 3CTAA 3RSNA 2DO7A 4B09A 2DMQA 2MYSA 2HXOA 2QQ8A 2V26A 1FOWA 2XAQA 4PJMA 4Y33A 1QBJA 4FX4A 1KYZA 4I6ZA 2E34A 1TQPA 3E6BA 3Q0WA 3SDGA 2L4AA 1BBYA 3C2HA 4EVIA 2DOFA 4OMYA 2LLKA 1ZG1A 1V3FA 2TCTA 2VKEA 1F36A 3KZZA 1SD4A 2F4MB 2IPQX 2QYOA 3CJRB 3O8HA 4BXUA 1R6RA 1J09A 2OZ6A 4L0YB 1T0FA 1FP1D 3OL3A 1NTCA 3CLOA 1LPQA 2NAZA 3DEUA 3NWSA 5HDKA 3OYAA 3UNGC 1PP7U 1R5HA 3CCMI 1MDMA 3HSFA 4EEFG 1KGSA 4ZC3A 1GVJA 1V54H 2WA0A 2M1BA 1PDNC 2NOGA 5A2QK 3H36A 1TP4A 3WTZA 1UG0A 3L2RA 3CCVI 1VQ9I 4IHWA 5JLXA 4XOPA 1TWGJ 5GTIC 3ZN0A 3I9V2 2IVMA 1U5TA 3L2WA 4AIKA 2IBDA 3H92A 3HPHA 2K3PA 2DW4A 2IGNA 5GADJ 3PJRA 3EUHA 2EV6A 5J3LA 1P4WA 3V8JA 1I1GA 3K9TA 3J80K 3PO3J 3VFZA 4NDLA 5FLVA 2W00A 4N4NB 2HQNA 3I64A 3BZ6A 3DBRB 3RPUD 2EZHA 1RR8C 2KLOA 3I56I 2PBIA 5M5YJ 2CW0F 4A0ZA 3M8FA 2IGKA 4FX0A 3E6CC 3ZQ7A 4U88A 1PYVA 2RKHA 5CPRB 2FX0A 3JRHA 2MSYA 5E20A 3BROA 3DPUA 2A68F 4QPOA 2OZUA 2DMTA 3LSRA 2KL4A 2AQEA 2XF6A 5TJJA 2E5ZA 4BBRJ 2F5FA 2LRDA 3I53A 4ZYEA 1UHWA 3OYBA 1H0MA 5DV5A 3IH2A 1MGTA 3WE3A 4RB3C 5TISC 5J1YA 1DDNA 1STZA 2DA5A 3F8FA 1RC9A 3BP8A 3K4MA 2CV2A 1VQPI 2LKSA 4XLCA 3EETA 5C4JJ 4MO7A 2X9DA 1WGXA 2F5VA 2A5YB 3C2BA 5F64A 4BHPA 2X51A 1JKPC 4HRIA 4X6AJ 3CUQC 3NQOA 1YO5C 3VSKA 4A3KJ 4EGZA 3BJOA 5GPAA 4RA2A 1R5GA 4LOCA 2R7ZJ 2M2EA 1ZKGA 4N9IA 3QPHA 2W57A 4ESJA 4GGGA 4LK1F 3JR9A 2PFBA 2V79A 3BQZA 3GTOJ 2EPFA 3MZ8A 2TRTA 3W6KB 4YRVA 4O6JA 4M71A 1TW2A 5TGTA 1J5YA 2PQ8A 5D4RA 1IN6A 1JGSA 4GYGA 3KP4A 1EH7A 2E36A 3HZJA 3LAJA 1ODDA 1SMTA 2RNJA 3U1DA 1TL8A 3U21A 2IS6A 5HOOA 2VODA 3DPTA 1W5SA 4Q47A 4YFNF 1YJNI 2Y2ZA 1FTZA 4BH9A 3KETA 1IRZA 3OYNA 3S2DJ 1MMDA 4KICA 2JPBA 4DYQA 1XGSA 3BLYA 4WF2A 2ELJA 4AD9A 1KZHA 1RIOH 3MQ0A 2M87A 5LEKA 1YFHA 1YOVB 1IC8A 4QLCU 1E3PA 3GTMJ 2ME6A 2WB1A 3FXLA 4E6KG 3REOA 2VUMJ 2W1OA 1FEXA 4XRSA 3GTLJ 3E97A 5K1YA 2AHQA 1HKTA 4D9JA 4HX4A 1POGA 3FXOA 2DI3A 5L3GA 1Z0XA 2P6TA 4DZPA 3B02A 1LB2A 1ZGWA 2EK5A 4DZJA 2Z2SB 3ZR8X 5L3BA 2IRFG 4Y17A 1BC8C 3IAS2 2CRGA 4BXXJ 1R36A 2EIJH 4XKVA 3SJMA 3FXRA 2DPDA 4LB6B 2BW3A 4E7SA 3BJAA 3I4NJ 1FSHA 4M6VA 4OMZA 1WH7A 2DQRA 3KYDB 2MC4A 3HUGA 3GTJJ 5LGUA 2JA2A 1XS9A 3F22A 1IAWA 2EFWA 3PNVA 3E6DA 2ZJ2A 4CCKA 4QSHA 2MC3A 4B3AA 2HDWA 4FHTA 4L0ZB 2HQRA 5BMZA 4E4HA 2H09A 3X2QH 1FIPA 3J7ZI 5E3LA 4IHVA 3IC7A 4UXNA 2WY8Q 2GIZA 1HA8A 4II2A 3K4BA 3SZGA 4PDKA 3W6JB 2XGCA 5EG0B 1SAXA 2A07F 1WJ5A 3SEQA 4G7HF 2ELKA 4R8HA 2VE8A 2DYSH 2FBKA 4C9YA 1VZ0A 3P9CA 1V5EA 4ZTFA 2R7QA 2MG4A 5ICFA 4KIBA 5BNGA 4Q5SF 2P4WA 4XICA 2BXYA 2PX9A 2E60A 3DEEA 2E1OA 2VJ4A 4BNCA 2DK5A 2F48A 4BS9A 3O2PE 2F2EA 5CVRA 4BJ5C 4CCMA 1B1BA 4NQWB 4U7BA 2R5YB 1MNEA 2ZKZA 4P9UA 3KEQA 2STWA 5F04A 3GTPJ 2OTJI 2GZWA 3S3MA 4F91B 2FA5A 3BR6A 1G3TA 2R7VA 3G3ZA 2LKXA 1WCMJ 1Q1VA 2JA5J 2H8RA 1R9TJ 3I3LA 3AG1H 3WHCA 3OYIA 5EYRA 2LH9A 3RKXA 1ETOA 1GT0C 2QBYA 3LSHA 2V1UA 3FBNB 2M5WA 2FQ4A 1OCCH 4D7NA 3SQNA 3CCRI 2QSHX 4EATA 4ANJA 2LG4A 4JOMA 5GAHJ 4W1UA 1R00A 4LIVA 3HM5A 3RPUA 1BN5A 5CYVA 3ZMSA 1UHMA 1P7IA 2M7BA 3WTVC 1TBXA 4Z2YA 1B9NA 2Q0OA 3MWMA 2ESNA 4RAYA 2L02A 1IRGA 3CMYA 1X2NA 1XD7A 1WI9A 3F0CA 2VPRA 2WADA 5BPIA 2E1CA 2NRAC 2O7OA 3BTJA 2FEZA 2VBZA 2GIVA 2GM4A 4EM1A 5ILUA 4XIDA 2XPVA 4BBSJ 3CP2A 1HXDA 1K78A 2Y69H 2ELHA 5LRSA 4G7OF 3A0BC 3CC4I 2XGXA 4OIOF 2M9HA 3H0GJ 1TWAJ 5HS7A 3FBIB 3ESWB 4DBRA 2GOXB 4UUSB 4ZZLA 2KP6A 2PG4A 1YI2I 1DGWY 3PM1A 2XF5A 1YJ9I 4CO8A 2F4OB 5A2QZ 3K70C 1JJ8C 1FOXA 5K5OA 1R23A 4A69C 3CMEI 1LNWA 3M1EA 3LFKA 3OYKA 1AWCA 3OYEA 1ZG5A 1WJCA 2BEOA 4Y7NJ 2R7WA 3J80Z 4KUMA 4JX5A 2LYCA 3C3WA 4XLAA 5CQGA 3Q5FA 1X4OA 4CUGA 4A5MA 4KA4A 2LY1A 5EF6A 1W5TA 5J4VA 1S3JA 2W4SA 3KEYA 5CQEA 1MW7A 3TW6A 5JVGF 4I2OA 2JK3A 2M0MA 2L54A 2CW7A 2RAEA 3KIOA 2XGDA 4UUVA 4L9NA 4MQ9F 3HTUA 3TEDA 3KP3A 1F9NA 1N78A 4KMUX 4K2EA 4BQAA 3WTSC 3K6GA 4H4KC 5HDNA 1FWZA 4IOCF 2EA2A 2K7LA 1MBJA 1BJAA 3T5XA 2A6HF 1BC7C 5E1WA 2JWTA 4J01A 2WV0A 4R79A 2B7EA 3FIWA 2DJNA 2CQ7A 5J40A 2R7SA 3W2VA 4CZCA 3IKTA 2YU9J 1IXSB 1LKXA 3L1PA 4ZJZA 5D5VB 2XROA 5JVTA 2HDDA 4KYWA 2VBYA 4XLEA 2PJPA 4B47A 1KQ8A 3SYTA 4XMYA 1GDTA 1IN4A 1D8JA 1N25A 2IGOA 4RS8A 4Q48A 3EYIA 3OR1C 1MNDA 1L0OC 2KPMA 2W82A 2VKHA 2HYJA 1T2KA 3CC2I 2BZTA 2ECBA 3ZQIA 4AC0A 2LD5A 1WJDA 2QQBA 1C0WA 2KHMA 1QHHD 5B66C 1T0FC 1YTYA 1Y1VJ 4IHTA 3GLLA 1WJFA 3NEUA 1HW2A 2PMUA 4HDVA 1U9NA 1DP7P 2CS3A 2M4KA 5C4XJ 4A0YA 1ULYA 2PN6A 3V8LA 1IDYA 2FOKA 3V7SA 2FMYA 1P4XA 1KU3A 1HBXG 1TWFJ 2QM3A 1U5TC 3RKWA 1RESA 1BL0A 2LMDA 5DUIA 1MD0A 1LE8B 3I71A 3EUHC 1U78A 4BE2A 1Z1DA 2JPCA 4KNYA 1X4PA 2STTA 4WXDA 5HNFA 1K61A 2XAHA 4E70A 2MLKA 5EZGA 4YFXF 2EA4A 3C18A 2WC2A 2YSRA 1NK2P 2R3SA 5H20A 2EFQA 5KNLA 2ZXWH 1I6HJ 3F6VA 1RI7A 4JX6A 3GFLA 5H6QA 4Z6YA 1X1CA 4Y13A 3GCMA 2KRCA 1N77A 1FSEA 2D45A 2BXZA 1QZEA 2NS8A 2L7ZA 3QP6A 3PO2J 3HOSA 2COBA 5JFRA 2H6CA 3CLQA 4V2GA 5M5XJ 3UKGA 2L01A 4S05A 1R22A 3CCYA 1VQ5I 2F6CA 2VLAA 1YQAA 2ICWG 2CQKA 4BAYA 2XB5A 2IAIA 2VONA 1BI3A 4RB0A 2Y31A 2HPMA 2L9VA 3V42A 2PJRA 1TT5B 3EPZA 1Y0UA 4C2MJ 4IL6C 2LVSA 2CFOA 1R1UA 4CCJA 2IP2A 2XRLA 3S3NA 2A3SA 1ZYRF 4DOZA 2XSJC 1XPXA 1T8IA 5B1BH 5TRDA 3MFKA 3NARA 2MA3A 1I50J 2K9QA 3OS2A 1MMSA 5F0HA 2ZNZA 3DLLF 3MVPA 4PFPA 2Z9OA 1X3UA 2RVCA 3FXMA 3CC7I 4MEXF 3SXYA 4S0HB 3FISA 2DTZA 5DM6F 1W5CC 3I54A 2EZKA 4M3DA 1YIOA 4XLHA 2OC6A 3I0TA 3WTUC 4HV5A 4ZYAA 1KU9A 3L7WA 3HG9A 3I59B 3FKJA 4KMFA 3DPLC 4WXCA 4I02A 1BI0A 1DPRA 5DM7F 1PUFB 4ITVA 4BHCA 2L9NA 4BYYA 3PSFA 3FXUA 2RDPA 2WAFA 2X85A 5FKLA 3P9KA 2KDZA 2R5YA 3GBGA 1I3QJ 2NVQJ 3T8TA 1CF7B 4G6QA 1OCZH 3H0DA 3KP2A 3H3VK 3BPVA 4XORA 1E17A 2IEKA 1W7PB 3HBLA 2E71A 5KCMA 3F23A 1ETXA 2O03A 3RPQA 1IN8A 3HGGA 3JW4A 1B72B 4F7ZA 2P81A 1J7KA 1A6QA 3ZMDA 3Q3SA 4ZYDA 3TO6A 3PL8A 2ACJA 5CVIA 2XIGA 2BOLA 4G6TB 3K4CA 3JAMK 3SZTA 3LOCA 2ECCA 5EEGA 2R5ZB 2BBYA 2XSDC 4OWRB 3IUOA 1UCRA 3M8JA 3WODF 2PMHA 4QTRA 1JKOC 4IO9F 2M3AA 2M8GX 3CCSI 1JI8A 2DCEA 1LEBA 2MW8A 3O6BB 3QOEA 1XN7A 4ESBA 4OIRF 4A3IJ 3OSFA 3B6CA 4FT8A 2A6TA 2E19A 2L0KA 1JXSA 1IZ1A 3BR0A 3F8BA 4XR6A 3D5LA 4L9TA 4UUSA 4KITB 2ZB9A 2L7FP 2GLOA 2JZYA 6PAXA 1Z6TA 1FY7A 4C2TA 1SFEA 4C2UA 2TDXA 3L9FA 1VI0A 2H6BA 2HR3A 4NB5A 3ZQGA 2X1EA 2B63J 2QSFX 3VEPA 2DFHA 2JMWA 3SFIA 1S5LC 4PGHA 1A04A 3BZKA 4NC6A 4U0YA 2R7OA 1GUUA 3ZQFA 2DYRH 4FISA 3KX2A 2P7CB 1FNNA 1X19A 1VTNC 5LBQA 3IHUA 3KZYA 2MH9A 4CDGA 2B9SA 1MSEC 4JQFA 2LOOA 1H9TA 1W7PD 1KYWA 2HQAA 4XRFA 4HDUA 3VPRA 1K7AA 2DAOA 4EJVA 2EV5A 1WWXA 2CFXA 2QUFA 2GXGA 2OQRA 1T56A 4AYBN 3JTGA 4JYKA 5D5XB 3M4OJ 1FTTA 2LTPA 3ABMH 4BDZA 5FKKA 4A6DA 9ANTA 3QPLA 3V7RA 1YW9A 3LA3A 5ILVA 3CCJI 4A3CJ 1GVDA 3C2GA 2LFBA 3GFMA 3H3ZA 2K9NA 1YJWI 1ZRCA 3CDHA 3FKIJ 4XM3A 2VT3A 4RMNA 3AAFA 4OOIA 3ECHA 4PZJA 3K4JA 1YLFA 3EDPA 3FXQA 2VJIA 1IF1A 3JSOA 1GV2A 4MHGA 4G6DA 4EM0B 5ICCA 1XDUA 1R4NB 3ZRGA 2FQ3A 5GP9A 4EV0A 2X0LA 5IP6A 4GXOA 4ENMA 3OIOA 2LF8A 1A35A 1K6YA 3QRFF 1YX3A 2JJ7A 4I09A 1Z05A 3JCUC 3R4KA 1D0XA 3TL4X 1S8NA 1FBQA 3K69A 4P1WA 1O3RA 5D4SA 1K83J 1JGGA 3IKVA 2JRTA 3Q0VA 1R71A 3KLNA 2K9SA 1BM9A 4EQQA 4MEYF 2ZFUA 2JVHA 2UV1A 4RB1A 4HF2A 1B4AA 4PCQA 4PSXA 5L3DA 3PUFA 3V7CA 4HSTA 5IT3A 3OYMA 1MMGA 3M07A 3EUKL 2LNBA 1HSTA 4HG2A 2GOMA 5KK1A 2CUJA 3ERMA 2ZMEB 3DBHB 3QYFA 3GZ6A 3IH4A 4CSWA 2HOTA 3OS1A 2G7HA 3RKYA 2XC7A 1TT0A 3LSKA 4XBFA 3GW2A 1ETQA 3M1CA 4BHBA 3M7GA 4IF4A 1TLHB 2V4JC 3DU6A 3WTTC 1FPQA 2DA4A 3DV8A 4CYCB 1KA8A 2NNNA 1SC7A 3H9JA 4IQJA 1XSXA 2A05A 3S1RJ 3NRVA 1WZ2A 1EJ9A 1FIAA 4S04A 3LSTA 1XX5A 2CUEA 2PMZN 2KQRA 3HRTA 3A02A 2E2IJ 5F08A 3TOBA 1BR4A 2JUCA 5HLIA 4YIRX 4BQQA 5HLGA 4XKCA 1W36D 5E1XA 2OBPA 2CUZA 3G1LA 3Q9SA 2Y0SN 5FROA 3CF5F 3MAJA 1U6GA 3IH3A 4CGZA 2P7VB 5FLMJ 2FMLA 3K7AJ 3BC8A 4IRHA 2DPUA 3MD2A 5DTDA 1Z3XA 5BS6A 4I0AA 3AL0C 3CCQI 1TW3A 4A3MJ 4O3MA 5J47A 5DYMA 1RKTA 2QGUA 1SANA 4F92B 2LY9A 4BE1A 3DTKA 3K1NA 2V9VA 4DGWB 2CG4A 5AONA 2DOEA 1AU7A 3EUAA 1RZ4A 3J81K 3QPSA 1B9MA 1APLC 1NH3A 2GQQA 4KJZA 1G2HA 4OINF 1BIAA 4ASNA 2RV8A 4M73A 2XASA 2HU9A 2CQQA 3BPXA 2E35A 1V55H 1E0EA 5CVJA 1DU6A 5AIQA 4HNUA 2E2JJ 5J4YA 2JT1A 5HODA 2AXLA 2O6GE 2LDUA 5E8GA 2VL8A 4IXAA 3T8RA 1OFCX 2I10A 5C44J 3A0HC 3AG2H 2VPLA 1XGOA 3RQ4A 1H89C 3GZNB 3T1BA 2JA8J 3HSEA 5J1UA 5KAIC 4RGSA 4HBLA 1X58A 1WJBA 3VB2A 1KQ0A 3HOVJ 5K7FA 3S1NJ 3HOWJ 1MSFC 5K5QA 1ETVA 2L9SA 1X2MA 1JTXA 4UY8I 1LDKB 1QHGA 2XPUA 3JRGA 5JI6A 1XMXA 5D8KB 2O61A 1HDDC 1B59A 1W7PA 3JAMZ 1Z91A 2BVMA 2L4MA 2CUFA 2QQ9A 1BR1A 1U0JA 3T0YA 3PQJA 3PNTA 4L5IA 3W3CA 3QQAA 3TDUC 2L9RA 5J8FA 2L7MP 3HHGA 3TGNA 1FZPB 1RUNA 4I01A 1J9IA 3BT9A 1ORKA 4MGRA 1FJLA 1VNDA 1BR2A 4ZH4F 5M3MJ 2X6WA 1P7JA 3GO5A 4A0XA 2X6YA 1LQ1A 4HW0A 1MH3A 3G1OA 4M72A 3VSLA 2W25A 4Y52J 1UZCA 2RC4A 1EKEA 4RGUA 2X4HA 1T38A 4AYBA 1RPWA 1EA3A 1QRYA 1XC5A 2DT7B 3WU1B 1D1BA 4LLNA 4FQGA 2LBFB 4HOBA 3JSPA 3H35A 1DGRM 1IN7A 1D5YA 1GLNA 4I76A 3GLXA 4LK0F 4MQVA 2BYVE 2NVYJ 4DJAA 5J8CA 5M5WJ 2EWNA 3BJ6A 1H9GA 4CICA 3DQVC 4I98B 2ZJPF 1D8KA 5ICEA 2K27A 2EFOA 3CO7C 1BI1A 2XUBA 5JLWA 4EJTA 2XAGA 2VIXA 3HB9A 2ZNYA 1JUSA 1T98A 3QU3A 5EGOB 4AVZA 1OCOH 3GFIA 4L9JA 4RDUA 3LSGA 2M8EA 3W6VA 3S1QJ 1YX5A 2Y9YA 1K4TA 3K4NA 5DEQA 2GBYA 4HLYA 4C30A 3DF8A 3WGGA 1O3TA 1JJ6C 3I4MJ 1NG6A 3KZIC 4IX7A 1QGPA 4DYCA 1SFOJ 3OMYA 3O8GA 4II3A 4HQEA 1MBHA 3BTLA 4AIDA 3MZHA 3FM3A 1NK3P 3JRBA 1I5ZA 3BR2A 3LSPA 3TP3A 1Z67A 3V4GA 5BQTA 1JT6A 4KIGA 3WHBA 4NBQA 1FMVA 1Z7LA 5HS8A 4ESFA 2O9LA 1LFPA 3OOUA 2F5EA 2RNGA 1I27A 1P4AA 5F0CA 1F5TA 2OA4A 5F0FA 2ESHA 2VT2A 2OU2A 3GZ5A 2P0WA 4RAZA 4N0BA 1OYYA 1REPC 3S2WA 3BQYA 4A6EA 3N05A 2K40A 1ZGAA 2R7RA 4OIQF 4XOTA 4IVNA 2V6EA 1AKHB 2CWEA 1WPKA 2HDCA 5B1AH 4A2UA 5LGTA 3F8NA 2L7KA 4A3FJ 3G2BA 5DD4A 1YS7A 3OYCA 2FOWA 4LGWA 1ETYA 1T39A 1QPMA 1VQNI 2DXIA 5C3EJ 4LG0B 1HCRA 1B8IB 3DKXA 3WG9A 2WBMA 3N4MA 1TNTA 3W2WA 4F93B 2HYGD 2H1LA 2DLLA 3HRMA 4Y3OA 1H8AC 3F8CA 5KVRA 3VYSB 2QCOA 1XCVA 1Y39A 4M3GA 3AG4H 2PMZA 2M30A 3MKZA 1HW1A 3FMQA 4MIMA 5CVUA 4A3GJ 3CDIA 1D5VA 1KU7A 3EYYA 5IT9K 1USSA 2I5UA 5K7ZA 2MD5A 4GRIA 2Y0SA 1VFCA 4I0BA 2ZXHA 1K79A 3HTSB 5E3NA 5M3FJ 3ZGKA 1JTYA 1RR7A 3PIOF 4B43A 5FGMA 4F55A 5IP7J 3JRDA 4M9XA 5FB2A 1T33A 1RKWA 1UB9A 3K4LA 3LFUA 1BOBA 2YX4A 5FLXK 3KEOA 4E7HA 5F6FA 3WGHA 4AM3A 4RB2C 3AG3H 3OOPA 1MDMB 2J5OA 1BA5A 3MKLA 2ZMEA 4LLLA 2C6YA 4M3FA 3W2AA 4YG2F 4XN3A 5ILSA 4DQ2A 4XSZF 2HTSA 4Q4ZF 1U5TB 2OQGA 3GEZA 1MJAA 4MTEA 1BI2A 2ZSIB 2BVLA 5LFAA 4UNOA 4IHSA 1S6LA 3J7YJ 2DA1A 5D6FA 3K2AA 5K7HA 1ZTRA 2VC1A 3RZDJ 3OSGA 3IV5A 2X6XA 3HRUA 5KAFC 2Q2EB 3QOPA 2G9WA 3CJNA 2E1MC 3Q0UA 4A93J 1ZR2A 4P5OA 2HKOA 1I1SA 2D2WA 1JUMA 4YEJA 2KIUA 3VYUB 3S15J 2O0YA 4NHJA 4AU7A 4KDPA 5HS9A 1WVRA 1NHAA 4M74A 4F3QA 2NS0A 2HOAA 1FYLA 4RGRA 1CQTA 1EF4A 3LAPA 1IG7A 1GXPA 3BR5A 1YE9A 2BY2A 3J81Z 2VJ5A 3VWBA 1V5GA 3BWGA 4QWQA 2DA3A 2QKLB 2VJJA 4IJAA 4YELA 1WQ2A 2YU3A 4MFDA 2WV1A 4EMSA 1OJLA 4MNUA 1T95A 1HKSA 1X1BA 2FE3A 2WAQN 4ZDOA 3H5AA 4Y4RA 3GVAA 2W24A 1YIJI 4C3IJ 1QO0D 3BY6A 2HWVA 4CZZA 1VQ7I 2VXDA 1YW7A 2X48A 4BDYA 3M9AA 2QEXI 1S29A 2V1XA 2KKOA 3TP0A 3F6OA 2XB0X 3WTWC 2P5LC 3MZYA 1FX7A 3QPTA 3FF5A 1MNMC 4BEHB 2VQCA 2R7UA 5BPDA 3D5SC 3L2VA 3G73A 3AKZA 4IPAA 4LJZF 1SD6A 2EFPA 4HX8A 5FKNA 2KJBA 2KZGA 1DUXC 1TC3C 3HOUJ 2R7DA 1G6NA 2EILH 4PFOA 3CQZJ 3ABLH 4FE7A 2A69F 2G0EA 4PJJA 5CVVA 2CU7A 2XAJA 3H3UA 5IYCJ 5E18F 2ADUA 3M8EA 3TBIA 4BY1J 3OIQA 2K4JA 3RDIA 4BJTA 1ZLJA 1BJZA 3HEFA 2WWYA 1WSUA 1E3OC 2OF7A 1GHCA 3Q9VA 4LD5A 3S3OA 1QNTA 1X3ZB 3LA7A 4HNTA 4A3DJ 2HXIA 2HS5A 4DYRA 1SVLA 1D0YA 5EG0A 5JHUA 1IV8A 1OR7A 3KYCB 2K85A 3H9GA 4UVCA 2HVRA 1G3SA 1MZBA 1Z21A 1MJ9A 4P96A 4CHUA 3JRIA 1P6RA 2BY3A 2GXBA 5L3EA 3M3YJ 3S8PA 2E5NA 1O3SA 3F3XA 1Z6RA 3G4SI 1RRJA 3ZN1A 1TWCJ 2QF7A 2GAUA 2VQGA 3RJPA 2ID6A 4AUXA 3HOXJ 3ZMVA 1HC8A 3F8MA 1PJRA 4GO1A 4V2FA 3KYLA 3IAM2 2NXNB 3GTQJ 3CJQB 3VOEA 3D1NI 5IYDJ 3ZQQA 1WFXA 4NQWA 5B3SH 1KU2A 3KP7A 4NNJA 3E7LA 1ZR4A 1FMWA 3AFHA 4IKFA 2CMPA 1UG2A 1RUOA 2RQPA 3FDYA 5LRRA 1OPCA 3QYBA 3OYJA 3SZPA 4GDFA 3DBLB 4G8XA 1ZG3A 3HUGB 3RKQA 1YYVA 4R1HA 3JRCA 3KE2A 3UR3C 1IXCA 2IGMA 1RETA 4PJLA 5FD6A 4GCVA 5E79C 5GPCA 4DNCA 2V6CA 2DA7A 4D5CA 2GA1A 4L18B 2PEXA 2QSGX 2V7FA 3SFZA 2HI3A 2UZKA 3WU0A 4KT6A 4ZTJA 3GTGJ 2Y9ZA 2ME0A 1LVAA 3CJTB 1X1PA 2DMUA 4ENKA 3ZMTA 5FO5A 2K86A 2IA0A 3FK7A 4OU0A 3JRAA 1X1DA 1HQCA 4XLPF 2ZJRF 3ZMZA 3OYHA 3BG9A 4ENNA 1USTA 2MH2A 1JT0A 5HNHA 2A6EF 3CZ6A 4AIJA 1AHDP 2IS1A 3SHFA 1R7JA 4L5JA 4NC7A 2HTJA 1P92A 4UB8C 4XSXF 4B4CA 2P5KA 3E5UA 2X6OA 1Y6IA 3VYRB 2RN7A 2V9KA 1CGPA 1DP3A 2FD5A 4E7JA 3K2ZA 4X1EA 1Y56A 1QPIA 1R49A 4BE0A 3P5JA 4AIHA 4UVBA 4D5FA 4N9HA 3RYPA 2CQNA 3K4KA 2KIQA 3ZXSA 3IRRA 3H9QA 2QBYB 1ETWA 1QU3A 3RQIA 3I58A 5E3MA 1IW7F 2DTRA 2HGCA 4RM3A 5F1JA 5D5WB 4XKWA 4KN7X 5IY5H 5GAGJ 2DN0A 2Y0MA 2EIMH 1MKMA 2H8WA 1SMYF 2OCCH 2QENA 2X1DA 5FKMA 1U2WA 2M4GA 3GTKJ 3DU5A 2OJED 2PI0A 3CP8A 2CW8A 3BDDA 4LITA 1OQYA 2MD0A 4J00A 1SD5A 2F4IA 3MN2A 4UV8A 2BV6A 4LG0A 3HXLA 2LC2A 4RBOA 4RLFA 1UAAA 2ZSHB 4EJOA 4CH7A 5IT9Z 2FBIA 3ABUA 1QZYA 3KLOA 4X0GA 3PFIA 3F21A 4PK4A 3HOZJ 3S14J 4ABZA 2KJCA 3HIFA 3RCOA 4G94A 1OCTC 2EQRA 1YITI 1ACIA 3OYFA 1ON2A 1K78B 4JX4A 2O8XA 4I7HA 3HJEA 1R5ID 5FLXZ 4BQOA 2E7XA 2XPWA 2Z5UA 3BOQA 4B48A 1W0UA 3A01B 4B8XA 4IHYA 3PNYA 3MKWB 4WX9A 2YX7A 2VASA 3BR1A 3DXJF 3ROUA 2HYFA 2G7UA 2VKDA 5CKTA 2FNAA 3B6AA 2V1DA 3I5UA 1FP2A 2NS7A 5ED4A 5EEHA 1LDDA 1F43A 1S7OA 4PSWA 4B44A 1VQMI 1IDZA 3V8KA 2HZTA 2WAQA 1PVEA 2IS2A 1SFXA 4WCGA 3JRFA 2Q8KA 5LEJA 1I3AA 4E7KA 1OCRH 4CCNA 1MMAA 2JRMA 3BZCA 3OR2C 2XV4S 1T6SA 3J7AY 5FRNA 3S16J 2NNYA 1TQMA 3LSMA 4ON0A 1Y8RB 1LJ9A 3RI4A 3CMMA 4A12A 1XG1A 2XAFA 3CUQB 3KCCA 4BACA 1LDJA 1HSJA 4XLNF 4A3LJ 4ZZDA 3BTIA 4BXFA 2Q2EA 5FKOA 3O3KA 1ZK8A 5GAEJ 3L2CA 1G8XA 1H88C 1JUPA 4OAZA 3CMAI 3NWTA 2EBIA 2DK8A 4Y15A 1BW6A 1OYIA 1G3WA 4QPQA 2JSCA 2HVQA 4HAMA 4J19A 2OUMA 1LE8A 2MFZA 1W36C 3DLAA 3R60A 2DT6A 4LMYA 1OCPA 3TQNA 1BOAA 2M34A 2VQLA 4PGGA 4FE4A 2YR2A 2Q1ZB 2VKVA 2VC0A 2XF7A 1Y1WJ 3BCAA 2CJJA 2Y48A 1WJAA 2DA2A 2BGCA 4D0PA 3HOTA 1MBKA 5H2FC 2R0QC 3DTEA 1OMIA 5KHDA 1RNLA 3K10A 3GYHX 2O8KA 2ZXJA 3AL0B 1JKRC 1HW5A 5HDGA 3ZCOA 3A4CA 2XRNA 2EZIA 4UVAA 1FYKA 4AWXB 1BIBA 2KZVA 2P6SA 2CQXA 4HEA2 3ABKH 4NUBA 2CGPA 4ZYHA 3HL2A 4U0WA 3QU6A 3LNQA 4BEHA 2JUGA 4DBQA 2K4BA 2UWMA 1IRFA 4EM2A 3BTCA 4HSRA 1SAUA 4B1RA 3HC7A 3U9GA 2Y75A 5HVQC 2ZMEC 3DCFA 2ID3A 1P2FA 2E1NA 4I99C 4W97A 5K5RA 2VE9A 2CV0A 3HGYA 3U1KA 3FWEA 2VXZA 1FC3A 2VBWA 2D1VA 1ON1A 2LSOA 3NAUA 4HX7A 5H6RA 3ERED 2CH0A 1Z9CA 2BY1A 2UUZA 4BY7J 4WWCA 2XKPA 2AQFA 2CSOA 3CD6I 2HPIA 1B6AA 4RAGA 1KQ9A 3GX4X 3TO9A 3FX3A 2PLYA 5L3CA 2YS9A 1G4DA 1WH5A 4EJUA 2R92J 1IN5A 1O3QA 1S7AA 3C7JA 4IZZA 5FD5A 3TO7A 2XKOA 3DFGA 5L3FA 3E5XA 4WXHA 4HNVA 1EV7A 1K4SA 2KISA 2HNHA 3S32A 5HLTA 1P9QC 1ETKA 1UJ8A 2NOJB 2DJIA 1WRJA 3I59A 3G1MA 2NVUB 1XCBA 3CESA 3CCEI 3OIPA 3RYRA 3LQQA 3ABTA 4C3JJ 5EJCA 1FYMA 1PUFA 4KFCA 4FCYA 3TMOA 5EEAA 1SD7A 3IRQA 2N8GA 3PUBA 1QVTA 2GA2A 3HRSA 2R7TA 2VN2A 3LMMA 4UUTA 4E7ZA 3IL2A 4G7ZF 4DIQA 2FNPA 2ISYA 2HEOA 1O4XA 1CF7A 5E17F 3SEZA 2D5VA 2K3FA 1PP8F 4XQFA 2NVTJ 3WTYC 4LG3A 3IWFA 4HA8A 1VQ8I 2PJRB 3K1PA 4LLGF 2DDBA 3WGIA 4XN0A 2NVXJ 1YRNB 5JHFA 3HDDA 2VB6A 3CUOA 1ZREA 4XRSG 1ZARA 4XONA 1IUFA 1B72A 1X1AA 4IOAF 1VQ4I 5DCFA 4BGDA 2JSPA 3BG6A 3B73A 5DUKA 1XSDA 4ETSA 5LHHA 1D0ZA 1MMNA 1QVUA 2ZCWA 2R5ZA 2JQ7A 2DBBA 2Y30A 4D1QA 1ZGJA 2L5QA 2R7FA 2E7WA 2HFHA 1SVMA 2FRHA 2OPTA 2Z16A 1M1EB 1WKMA 4OIPF 3VYTB 2LKPA 1AA7A 2FU4A 2XHKA 5EZHA 3CDLA 4P55A 2EFNA 2AO9A 2ISZA 3CCUI 3SDBA 4DW6A 2UXNA 1XSVA 3PIPF 4XKBA 2FUG2 2HVSA 2IJLA 4IEJA 3J7AO 2ZBKA 4QIWN 2KFDA 4KN4X 3FK6A 1U9OA 4HYEA 3GUDA 1MBEA 1OR7C 4RLQA 2IS4A 2XGEA 2AS5F 2OV7A 4U87A 2XVCA 2ZJQF 3F72A 1J2XA 3F9KA 1K6OA 3KPHA 1JKQC 4CA0A 5HLHA 1HLVA 1YS6A 1UELB 2Z99A 5E8IA 5LLQA 3BG3A 4H0EA 2M7AA 2KDOA 2MBFA 3ZQHA 3ZQCA 3H5RA 1S9HA 2UXXA 2DQLA 2BY0A 3ECOA 3E3VA 1E2XA 1MBFA 1MBGA 3H5NA 4A3JJ 4FETA 3VDXA 1FOKA 3BR3A 2ZO4A 3E1SA 5DCMB 3R0JA 3K0LA 4L5EA 4M9ZA 3S17J 2W85A 4JP0A 3ZMUA 4ZYGA 2QA4I 4XK4A 1QZZA 3GMEA 2O5RA 3E5QA 4IRIA 4U7DA 4GYIA 2W7NA 2FSWA 1MH4A 1FLIA 3FXKA 3S2HJ 2H94A 5ERIA 1ZHFA 3P7NA 4HZFA 3P9IA 1JHHA 3TKYA 1LEAA 4YIFA 3BCBA 1HKQA 1QQIA 2L2OA 3S93A 2QWWA 3A1YA 4AVPA 1F1ZA 2FBHA 3RTRA 1WI3A 3WTXC 2EJRA 3ISPA 2NYXA 2ETHA 3A01A 4PJNA 1QA6A 2DFFA 4HLXA 1HOMA 1G59A 2H27A 2IA1A 5DS9A 1O7LA 2HOSA 2GWRA 2WAEA 2X1CA 2F5CA 2ZC2A 4ZDPA 2DODA 5LHIA 4XNFA 3QAHA 4TV7A 3BG5A 4L9VA 2I8DA 3FXJA 2MGQA 3C1DA 4ZDLA 3LSJA 3RZOJ 3OYDA 1XTAA 3QWLA 3HHHA 1ZRFA 3HOYJ 1W1WE 5D5UB 2JA7J 3ASOH 3GF2A 3HKZN 1VQKI 2OAZA 4G9YA 4KIFA 1TNSA 1SEUA 2XDVA 1XDSA 1OLTA 3L00A 4C3HJ 4UHTA 2DT5A 3FMSA 1WJEA 1ZRDA 3GFJA 3K70D 3CUQA 5FRMA 2VQHA 3HSRA 3VODA 2CV1A 1EH6A 2JN6A 1U8BA 1I6XA 2QZ8A 1VQOI 2EINH 2GXAA 3OS0A 4E7IA 2J5PA 2D1HA 4M6YA 5IYBJ 1TWHJ 2WTEA 3GWZA 2E1MB 5FJ8J 3WU2C 2VI6A 2W48A 1WHUA 1OYWA 2QQAA 2DMPA 1SVOA 1XB4A 5DD8A 2DFEA 3ML6A 3JREA 4KISA 3A2KA 3H1CA 3OYGA 2KIMA 1VQLI 1IXRC 1Z3YA 1ZELA 3OWTA 4F52A 1ZH5A 1SFKA 5D6EA 3CF2A 2EZLA 2P8TA 1S72I 2VOOA 2BE5F 2ZFWA 4CYCA 1FBUA 1OKRA 1VF9A 3FMRA 4HPQA 4XL9A 4BL0B 3BG7A 1YW8A 1TZLA 1ZQ3P 4M3EA 1ITYA 3G6EI 2BHZA 2K5CA 1FBSA 2K9MA 2IT0A 3TOAA 5FFXA 3LSIA 3KP6A 2QVOA 3G71I 2YUSA 3ZPLA 3WG7H 4KT5C 2IXSA 4PJ0C 2VOPA 3N97A 3ZP5A 1Z77A 3ELKA 3L2UA 1JE8A 4MFEA 3CCLI 1ZN2A 4HF0A 3ZQLA 3PQKA 4XLFA 4V19K 2CO5A 4LIUA 2KIFA 3DWLE 3S1MJ 3DTIA 3TW7A 1TTYA 3COAC 5J6XA 3ULQB 2HOEA 1T08B 4BUPA 4RGXA 5CJ9A 1LFUP 2OCEA 3CO6C 1X3WB 1IRXA 4UB6C 1U8RA 2K9LA 1V4RA 4JBAA 4MLOA 2OD5A 1HDPA 3IWZA 3GXOA 1UFMA 3KFWX 3R61A 5F27A 2DFIA 4A5NA 3DKWA 2P5VA 3K1MA 2EB7A 1R58A 4CCOA 1J59A 2FF4A 2HKXA 4XRMA 5LHGA 1VQ6I 1J75A 2EIKH 1A6IA 3FHNA 4WK8F 2DU9A 2KT0A 4BQNA 3D5RC 4M3BA 1D3YA 3I4PA 4B3XA 5IP9J 4NC8A 1FOYA 3HPGA 4G12A 1A36A 2A5WA 5E3OA 4OAYA 1MIJA 5E1ZB 1V5FA 1L3LA 3FM5A 2JA6J 2Z3YA 5F1RA 3L2QA 1UMQA 2LK2A 3OY9A 4O5VA 4HQMA 2WY7Q 4LFUA 5BOXA 3DP7A 2YPRA 4P9FA 4RM2A 2MLGA 4ENJA 5JR3A 1BW5A 3LL7A 2RREA 5FFZA 5B5EC 1Z7UA 2V1NA 3ONQA 4JK1X 1HF0A 1F4KA 3LQRA 1NG7A 1ERDA 3DEWA 2KMUA 4BU2A 1A31A 2FJ1A 4GFBA 4A3EJ 1YRNA 1SFUA 2M0CA 1ONVA 3OYLA 4YFKF 4EGYA 1J0RA 2JVGA 1A5JA 3R6SA 1D1CA 2W84A 5LD2C 2FXAA 4IHXA 1O57A 2LREA 3U2RA 1OISA 2QLZA 1XGMA 3A03A 3QP5A 4EJWA 3MMYB 3E0JB 1ENHA 1LVKA 1Q1HA 1W4MA 5CLSA 2RGVA 3KP5A 2XAUA 4IRGA 2F5DA 2QKMB 3DKYA 2COMA 1IGNA 3PSIA 2IA2A 2BW3B 3LWFA 4N4OB 2R7XA 1D1AA 2K02A 1G3YA 1R1VA 1DU0A 4IQ4A 2LBFA 2HZDA 2R4GA 1R1TA 1IO2A 1IV6A 1ZAOA 3PFYA 1Y0NA 3OL4A 1I39A 5J1RA 5IOYA 2M45A 1EH8A 2DDAA 3QODA 4BJ6C 5GTHC 1JHFA 5EDNA 2LF7A 2RQQA 3IP4B 3QYEA 2KRFA 1XMKA 2VBXA 3ASNH 5EGOA 1IJWC 4CCLA 1YHQI 1YG2A 4A3BJ 3MEXA 1R4MB 1ZLKA 2HQ5A 4E7LA 4U0VA 2WB1N 1W0TA 1AOYA 3EQLF 1KONA 3OV8A 2AXTC 2R93J 4M6XA 3HKZA 2LR8A 2E2HJ 3WE2A 3R0AA 2V9PA 1U3EM 3RIRA 3HYIA 5DCMA 2DA6A 2DOAA 2A61A 2ZXIA 1GV5A 4LB5A 1DPUA 4PUSA 5D8LB 2O3FA 5LGNA 1MJBA 3I55I 4CYDA 4FASD 2LP0A 2Z33A 3E6MA 5ICGA 1FT9A 3MCZA 1N75A 1PUEE 2BHYA 2IW5A 1E3HA 2MABA 2L3DA 3FHZA 2EH3A 3LA2A 1Y8QB 3FZVA 1LFBA 1LUJB 2EV0A 3L09A 4HV6A 5AIPA 1AKHA 3MKYB 5IPAA 4BKXA 1TQIA 4CXFA 1IUYA 2JTVA 3ZOBA 3TDZC 2CYYA 1O7FA 1XMAA 4RAFA 2H1KA 3D0SA 4UV9A 4MTDA 5DDGA 2Z1DA 2OTLI 1B8IA 2LY2A 4M9SA 2B0LA 1UHSA 1XGNA 4HF1A 4D7MA 5IOZA 1DQUA
chains in the Genus database with same CATH topology
1GXQA 4YIIA 3JTHA 3CTAA 2DO7A 4B09A 2XAQA 1QBJA 4FX4A 1KYZA 1TQPA 3E6BA 2L4AA 1BBYA 4EVIA 4OMYA 1ZG1A 1V3FA 3KZZA 1SD4A 2IPQX 2QYOA 4BXUA 4L0YB 2OZ6A 1T0FA 1FP1D 3CLOA 2NAZA 3DEUA 5HDKA 1PP7U 1R5HA 1MDMA 3HSFA 1KGSA 1GVJA 2M1BA 1PDNC 5A2QK 3WTZA 3ZN0A 2IVMA 1U5TA 4AIKA 3H92A 2DW4A 3EUHA 2EV6A 1P4WA 3V8JA 1I1GA 3K9TA 3J80K 3VFZA 2HQNA 3I64A 3BZ6A 2PBIA 2CW0F 4A0ZA 3M8FA 4FX0A 3E6CC 3ZQ7A 4U88A 2RKHA 5E20A 3BROA 2A68F 2OZUA 5TJJA 2F5FA 3I53A 4ZYEA 1UHWA 1H0MA 5DV5A 1MGTA 3WE3A 4RB3C 1DDNA 1STZA 3F8FA 3BP8A 3EETA 4BHPA 2A5YB 5F64A 3CUQC 3NQOA 1YO5C 4EGZA 3BJOA 1R5GA 4N9IA 3QPHA 2W57A 4ESJA 4GGGA 4LK1F 2PFBA 2V79A 3W6KB 4O6JA 4M71A 1TW2A 1J5YA 2PQ8A 5D4RA 1IN6A 1JGSA 4GYGA 3KP4A 1EH7A 3LAJA 1ODDA 1SMTA 2RNJA 3U1DA 5HOOA 2VODA 3DPTA 1W5SA 4Q47A 4YFNF 4BH9A 3KETA 4KICA 2JPBA 1XGSA 4WF2A 4AD9A 1RIOH 3MQ0A 5LEKA 2M87A 1YFHA 4QLCU 3REOA 3E97A 5K1YA 1HKTA 4HX4A 2DI3A 5L3GA 2P6TA 3B02A 1LB2A 2EK5A 5L3BA 2IRFG 4Y17A 1BC8C 1R36A 2DPDA 1FSHA 3FXRA 4LB6B 3BJAA 4OMZA 2DQRA 3HUGA 5LGUA 3F22A 1IAWA 2EFWA 3E6DA 2ZJ2A 2MC3A 4FHTA 4L0ZB 2HQRA 5BMZA 2H09A 3IC7A 4UXNA 3W6JB 4PDKA 1SAXA 2A07F 4G7HF 4R8HA 2VE8A 2FBKA 3P9CA 5ICFA 4KIBA 4Q5SF 2P4WA 4BNCA 2DK5A 3O2PE 2F2EA 5CVRA 4U7BA 1B1BA 2ZKZA 4P9UA 3KEQA 2STWA 2GZWA 2FA5A 1G3TA 3G3ZA 3RKXA 2V1UA 2QBYA 2M5WA 3SQNA 1R00A 3RPUA 1BN5A 5CYVA 3ZMSA 1UHMA 3WTVC 1TBXA 4Z2YA 1B9NA 2Q0OA 3MWMA 2ESNA 4RAYA 2L02A 1IRGA 1XD7A 1WI9A 5BPIA 2E1CA 2NRAC 2FEZA 2VBZA 2GIVA 4EM1A 5ILUA 1HXDA 1K78A 5LRSA 2ELHA 4G7OF 2XGXA 4OIOF 5HS7A 4ZZLA 2PG4A 4CO8A 5A2QZ 5K5OA 1R23A 1LNWA 3M1EA 3LFKA 1AWCA 1ZG5A 2BEOA 3J80Z 4KUMA 3C3WA 3Q5FA 4A5MA 4KA4A 1W5TA 1S3JA 4I2OA 2L54A 4UUVA 4L9NA 4MQ9F 3HTUA 3KP3A 1F9NA 4KMUX 4K2EA 4BQAA 3WTSC 5HDNA 1FWZA 2EA2A 2K7LA 1BJAA 3T5XA 2A6HF 1BC7C 5E1WA 2WV0A 4R79A 3IKTA 1IXSB 5D5VB 2XROA 5JVTA 4KYWA 2VBYA 2PJPA 1KQ8A 1IN4A 1D8JA 4RS8A 4Q48A 3EYIA 1L0OC 1T2KA 2QQBA 1C0WA 1YTYA 4IHTA 3NEUA 1HW2A 2PMUA 4HDVA 1DP7P 4A0YA 1ULYA 2PN6A 3V8LA 2FOKA 3V7SA 2FMYA 1P4XA 1KU3A 1HBXG 2QM3A 1U5TC 3RKWA 5DUIA 1MD0A 3I71A 1U78A 1Z1DA 2JPCA 4KNYA 2STTA 4WXDA 4E70A 2XAHA 2MLKA 4YFXF 2EA4A 3C18A 2WC2A 2YSRA 2R3SA 5H20A 2EFQA 3F6VA 1RI7A 3GFLA 5H6QA 4Y13A 1FSEA 2D45A 3QP6A 3HOSA 5JFRA 2H6CA 2L01A 4S05A 1R22A 1YQAA 4BAYA 2CQKA 2VONA 1BI3A 4RB0A 1Y0UA 1R1UA 2IP2A 2A3SA 1ZYRF 5TRDA 3MFKA 2MA3A 2ZNZA 2Z9OA 1X3UA 2RVCA 4MEXF 3SXYA 3I54A 1YIOA 3I0TA 3WTUC 4HV5A 1KU9A 3L7WA 3I59B 4KMFA 3DPLC 4WXCA 4I02A 1BI0A 1DPRA 4BHCA 4BYYA 3FXUA 2RDPA 3P9KA 3T8TA 1CF7B 4G6QA 3KP2A 3BPVA 1E17A 1W7PB 3F23A 2O03A 3RPQA 1IN8A 3JW4A 4F7ZA 1J7KA 3ZMDA 4ZYDA 3TO6A 2ACJA 5CVIA 2XIGA 3JAMK 3SZTA 5EEGA 2BBYA 1UCRA 3WODF 2PMHA 1LEBA 3O6BB 1XN7A 4ESBA 4OIRF 4FT8A 1JXSA 1IZ1A 3F8BA 3D5LA 4L9TA 2JZYA 6PAXA 1Z6TA 1FY7A 1SFEA 2TDXA 3L9FA 2H6BA 2HR3A 4NB5A 3VEPA 4PGHA 1A04A 4U0YA 2P7CB 1FNNA 1VTNC 5LBQA 3IHUA 3KZYA 2MH9A 4CDGA 4JQFA 1H9TA 1W7PD 1KYWA 4XRFA 4HDUA 1K7AA 2DAOA 4EJVA 2EV5A 1WWXA 2CFXA 2QUFA 2GXGA 2OQRA 3JTGA 5D5XB 4A6DA 3V7RA 1YW9A 3LA3A 5ILVA 3GFMA 3H3ZA 1ZRCA 3CDHA 2VT3A 3AAFA 4OOIA 3ECHA 4PZJA 1YLFA 3EDPA 3FXQA 1IF1A 3JSOA 4MHGA 4G6DA 4EM0B 5ICCA 1XDUA 2FQ3A 4EV0A 2X0LA 4ENMA 4GXOA 2LF8A 3QRFF 4I09A 1Z05A 3R4KA 1S8NA 1FBQA 3K69A 1O3RA 5D4SA 3IKVA 2JRTA 3KLNA 1BM9A 4EQQA 4MEYF 4RB1A 4HF2A 1B4AA 4PCQA 5L3DA 3V7CA 5IT3A 2LNBA 1HSTA 5KK1A 2ZMEB 3GZ6A 2G7HA 3RKYA 4XBFA 3GW2A 4BHBA 3M7GA 4IF4A 1TLHB 3WTTC 1FPQA 3DV8A 1KA8A 2NNNA 1XSXA 3NRVA 4S04A 3LSTA 3HRTA 3TOBA 5HLIA 5HLGA 5E1XA 2OBPA 3Q9SA 3MAJA 1U6GA 4CGZA 2P7VB 2FMLA 4IRHA 2DPUA 5BS6A 4I0AA 1TW3A 4O3MA 5DYMA 3K1NA 2V9VA 2CG4A 5AONA 1RZ4A 3J81K 1B9MA 2GQQA 4OINF 1BIAA 4ASNA 2RV8A 4M73A 2XASA 3BPXA 5CVJA 5AIQA 2JT1A 2AXLA 2O6GE 2LDUA 5E8GA 4IXAA 3T8RA 1XGOA 3T1BA 3HSEA 4RGSA 4HBLA 3VB2A 1KQ0A 5K5QA 1LDKB 5JI6A 5D8KB 2O61A 1B59A 1W7PA 3JAMZ 1Z91A 2L4MA 2QQ9A 3T0YA 3PQJA 4L5IA 3TDUC 5J8FA 3HHGA 3TGNA 1FZPB 1RUNA 4I01A 1J9IA 4MGRA 4ZH4F 3GO5A 1LQ1A 4A0XA 4HW0A 4M72A 2W25A 2RC4A 4RGUA 2X4HA 1T38A 3WU1B 4LLNA 4HOBA 3JSPA 1IN7A 3GLXA 4LK0F 4MQVA 2BYVE 5J8CA 2EWNA 3BJ6A 1H9GA 4CICA 3DQVC 4I98B 1D8KA 5ICEA 2K27A 2EFOA 3CO7C 1BI1A 2XUBA 4EJTA 2XAGA 2ZNYA 1T98A 3QU3A 3GFIA 4L9JA 2M8EA 5DEQA 4HLYA 1O3TA 3DF8A 3WGGA 1QGPA 3MZHA 4HQEA 3FM3A 1I5ZA 3V4GA 5BQTA 4KIGA 5HS8A 4ESFA 2F5EA 1I27A 1P4AA 1F5TA 2OA4A 2ESHA 2VT2A 2OU2A 3GZ5A 4RAZA 4N0BA 1OYYA 1REPC 3S2WA 4A6EA 1ZGAA 4OIQF 4IVNA 2CWEA 2HDCA 4A2UA 5LGTA 3F8NA 5DD4A 1YS7A 4LGWA 1T39A 1QPMA 4LG0B 3WG9A 3N4MA 1TNTA 2HYGD 2DLLA 3HRMA 3F8CA 5KVRA 1XCVA 2M30A 1HW1A 3FMQA 5CVUA 1D5VA 1KU7A 3EYYA 5IT9K 1USSA 2MD5A 4I0BA 1K79A 3HTSB 5FGMA 4M9XA 5FB2A 1UB9A 2YX4A 5FLXK 3KEOA 5F6FA 3WGHA 4RB2C 3OOPA 1MDMB 2J5OA 2ZMEA 4LLLA 2C6YA 4YG2F 5ILSA 4DQ2A 4XSZF 2HTSA 4Q4ZF 1U5TB 2OQGA 3GEZA 1MJAA 4MTEA 1BI2A 4UNOA 4IHSA 1S6LA 5D6FA 2VC1A 3HRUA 3QOPA 2G9WA 3CJNA 4P5OA 2HKOA 1I1SA 2D2WA 2KIUA 2O0YA 4NHJA 4KDPA 5HS9A 1NHAA 4M74A 2NS0A 1FYLA 4RGRA 3LAPA 1GXPA 3J81Z 3BWGA 4QWQA 4IJAA 1WQ2A 2YU3A 4EMSA 4MNUA 1HKSA 2FE3A 3GVAA 2W24A 1QO0D 3BY6A 2HWVA 4CZZA 1YW7A 3M9AA 1S29A 2V1XA 2KKOA 3WTWC 3F6OA 2P5LC 3MZYA 1FX7A 3QPTA 3FF5A 5BPDA 3G73A 4IPAA 4LJZF 1SD6A 2EFPA 4HX8A 2KJBA 1DUXC 2R7DA 1G6NA 2A69F 5CVVA 2XAJA 3H3UA 5E18F 2ADUA 3M8EA 2K4JA 3RDIA 2WWYA 1ZLJA 1WSUA 1GHCA 3Q9VA 4LD5A 1QNTA 3LA7A 2HS5A 5JHUA 1OR7A 4UVCA 1G3SA 1MZBA 4P96A 1MJ9A 4CHUA 1P6RA 2GXBA 5L3EA 1O3SA 3F3XA 1Z6RA 3ZN1A 2GAUA 3RJPA 3ZMVA 3F8MA 4GO1A 3VOEA 4NQWA 1KU2A 3KP7A 1RUOA 2RQPA 5LRRA 1OPCA 3SZPA 4G8XA 1ZG3A 1YYVA 4R1HA 3KE2A 1IXCA 5FD6A 4GCVA 4DNCA 2V6CA 2GA1A 4L18B 2PEXA 3SFZA 2UZKA 3WU0A 1LVAA 4ENKA 3ZMTA 5FO5A 2K86A 2IA0A 4OU0A 1HQCA 4XLPF 3ZMZA 4ENNA 1USTA 2MH2A 4AIJA 2A6EF 3SHFA 1R7JA 4L5JA 2HTJA 1P92A 4XSXF 2P5KA 3E5UA 2RN7A 1CGPA 3K2ZA 4AIHA 4UVBA 4N9HA 3RYPA 3IRRA 2QBYB 3I58A 5D5WB 1IW7F 2DTRA 2HGCA 4KN7X 2Y0MA 1MKMA 1SMYF 2QENA 1U2WA 2PI0A 3BDDA 1SD5A 4UV8A 2BV6A 4LG0A 4EJOA 5IT9Z 2FBIA 3ABUA 1QZYA 3KLOA 3PFIA 3F21A 2KJCA 3HIFA 4G94A 1ON2A 1K78B 2O8XA 4I7HA 5FLXZ 2E7XA 2Z5UA 3BOQA 4B8XA 4WX9A 2YX7A 3DXJF 3ROUA 2HYFA 2G7UA 2FNAA 2V1DA 3I5UA 1FP2A 5ED4A 5EEHA 1LDDA 1S7OA 3V8KA 2HZTA 1SFXA 4WCGA 2Q8KA 5LEJA 2XV4S 1T6SA 2NNYA 1TQMA 4ON0A 1LJ9A 3RI4A 4A12A 2XAFA 3CUQB 3KCCA 1LDJA 1HSJA 4XLNF 4ZZDA 2Q2EA 3O3KA 3L2CA 2DK8A 4Y15A 1OYIA 1G3WA 2JSCA 4HAMA 3R60A 4LMYA 3TQNA 1BOAA 4PGGA 2YR2A 2VC0A 2Y48A 4D0PA 2BGCA 3HOTA 1OMIA 1RNLA 3GYHX 2ZXJA 1HW5A 5HDGA 2XRNA 1FYKA 4UVAA 4AWXB 1BIBA 2P6SA 2CGPA 4ZYHA 4U0WA 3QU6A 2K4BA 2UWMA 1IRFA 4EM2A 3U9GA 2Y75A 5HVQC 2VE9A 5K5RA 1P2FA 2E1NA 3FWEA 2VXZA 1FC3A 2VBWA 2D1VA 1ON1A 2LSOA 4HX7A 5H6RA 3ERED 1Z9CA 4WWCA 2XKPA 2CSOA 1B6AA 1KQ9A 3GX4X 3TO9A 3FX3A 2PLYA 5L3CA 1G4DA 4EJUA 1IN5A 1O3QA 1S7AA 3C7JA 5FD5A 3TO7A 2XKOA 3DFGA 5L3FA 3E5XA 4WXHA 1EV7A 1WRJA 3I59A 1XCBA 1FYMA 3RYRA 3LQQA 3ABTA 4KFCA 1SD7A 3IRQA 2GA2A 3HRSA 2VN2A 3IL2A 4G7ZF 2FNPA 2ISYA 2HEOA 1CF7A 5E17F 1PP8F 3WTYC 3IWFA 4HA8A 3K1PA 4LLGF 3WGIA 3CUOA 1ZREA 1ZARA 5DCFA 3B73A 5DUKA 1XSDA 4ETSA 5LHHA 2ZCWA 2DBBA 1ZGJA 2R7FA 2E7WA 2HFHA 2FRHA 1WKMA 4OIPF 2LKPA 2XHKA 2FU4A 4P55A 2EFNA 2ISZA 2UXNA 1XSVA 3J7AO 2IJLA 2ZBKA 4KN4X 4HYEA 3GUDA 2AS5F 2XVCA 3F72A 1J2XA 1K6OA 5HLHA 1YS6A 2Z99A 5E8IA 5LLQA 4H0EA 2MBFA 2UXXA 2DQLA 3ECOA 3E3VA 1E2XA 1FOKA 2ZO4A 5DCMB 3R0JA 3K0LA 4M9ZA 2W85A 3ZMUA 4ZYGA 1QZZA 3E5QA 4IRIA 4U7DA 4GYIA 2FSWA 1FLIA 2H94A 5ERIA 1ZHFA 3P7NA 4HZFA 3P9IA 1JHHA 3TKYA 1LEAA 4YIFA 1HKQA 1QQIA 2QWWA 4AVPA 1F1ZA 2FBHA 3RTRA 3WTXC 2EJRA 3ISPA 2NYXA 2ETHA 4HLXA 2H27A 2IA1A 1O7LA 2GWRA 2F5CA 5LHIA 3QAHA 4TV7A 4L9VA 3C1DA 3HHHA 1ZRFA 5D5UB 3GF2A 2OAZA 4G9YA 4KIFA 1TNSA 1XDSA 3L00A 4UHTA 2DT5A 3FMSA 1ZRDA 3GFJA 3CUQA 3HSRA 3VODA 1EH6A 1I6XA 2QZ8A 2J5PA 2D1HA 4M6YA 2WTEA 3GWZA 1OYWA 2QQAA 1XB4A 5DD8A 3ML6A 2KIMA 1IXRC 1ZH5A 5D6EA 2P8TA 2VOOA 2BE5F 2ZFWA 1FBUA 1OKRA 3FMRA 1YW8A 1FBSA 2IT0A 3TOAA 5FFXA 3KP6A 2QVOA 3ZPLA 4KT5C 2VOPA 3N97A 3ZP5A 3ELKA 1JE8A 1ZN2A 4HF0A 3PQKA 2CO5A 2KIFA 1TTYA 3COAC 5J6XA 3ULQB 2HOEA 4RGXA 5CJ9A 3CO6C 1U8RA 1V4RA 4JBAA 2OD5A 3IWZA 3GXOA 1UFMA 3KFWX 3R61A 2DFIA 4A5NA 3DKWA 2P5VA 3K1MA 2EB7A 1R58A 1J59A 2FF4A 2HKXA 5LHGA 1J75A 4WK8F 2DU9A 1D3YA 3I4PA 5E1ZB 1L3LA 3FM5A 2Z3YA 5F1RA 4O5VA 4HQMA 4LFUA 5BOXA 3DP7A 2YPRA 4P9FA 4ENJA 2MLGA 5JR3A 5FFZA 1Z7UA 4JK1X 1F4KA 3LQRA 1SFUA 1ONVA 4YFKF 4EGYA 1J0RA 3R6SA 2W84A 2FXAA 1O57A 3U2RA 2QLZA 1XGMA 3QP5A 4EJWA 1Q1HA 1W4MA 5CLSA 2RGVA 3KP5A 4IRGA 2F5DA 2COMA 2IA2A 3LWFA 2K02A 1G3YA 1R1VA 1R1TA 1ZAOA 2M45A 1EH8A 1JHFA 2LF7A 2KRFA 1XMKA 2VBXA 1YG2A 3MEXA 1ZLKA 4U0VA 1AOYA 3EQLF 3OV8A 4M6XA 3WE2A 3R0AA 1U3EM 3RIRA 3HYIA 5DCMA 2A61A 4LB5A 1DPUA 5D8LB 2O3FA 5LGNA 1MJBA 4CYDA 2Z33A 3E6MA 5ICGA 1FT9A 3MCZA 1PUEE 2IW5A 2L3DA 3FHZA 3LA2A 3FZVA 2EV0A 3L09A 4HV6A 5AIPA 1TQIA 4CXFA 1IUYA 2JTVA 3TDZC 2CYYA 1O7FA 1XMAA 3D0SA 4UV9A 4MTDA 5DDGA 4M9SA 2B0LA 1XGNA 4HF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXQ A;  4YII A;  3JTH A;  3CTA A;  2DO7 A;  4B09 A;  2XAQ A;  1QBJ A;  4FX4 A;  1KYZ A;  1TQP A;  3E6B A;  2L4A A;  1BBY A;  4EVI A;  4OMY A;  1ZG1 A;  1V3F A;  3KZZ A;  1SD4 A;  2IPQ X;  2QYO A;  4BXU A;  4L0Y B;  2OZ6 A;  1T0F A;  1FP1 D;  3CLO A;  2NAZ A;  3DEU A;  5HDK A;  1PP7 U;  1R5H A;  1MDM A;  3HSF A;  1KGS A;  1GVJ A;  2M1B A;  1PDN C;  5A2Q K;  3WTZ A;  3ZN0 A;  2IVM A;  1U5T A;  4AIK A;  3H92 A;  2DW4 A;  3EUH A;  2EV6 A;  1P4W A;  3V8J A;  1I1G A;  3K9T A;  3J80 K;  3VFZ A;  2HQN A;  3I64 A;  3BZ6 A;  2PBI A;  2CW0 F;  4A0Z A;  3M8F A;  4FX0 A;  3E6C C;  3ZQ7 A;  4U88 A;  2RKH A;  5E20 A;  3BRO A;  2A68 F;  2OZU A;  5TJJ A;  2F5F A;  3I53 A;  4ZYE A;  1UHW A;  1H0M A;  5DV5 A;  1MGT A;  3WE3 A;  4RB3 C;  1DDN A;  1STZ A;  3F8F A;  3BP8 A;  3EET A;  4BHP A;  2A5Y B;  5F64 A;  3CUQ C;  3NQO A;  1YO5 C;  4EGZ A;  3BJO A;  1R5G A;  4N9I A;  3QPH A;  2W57 A;  4ESJ A;  4GGG A;  4LK1 F;  2PFB A;  2V79 A;  3W6K B;  4O6J A;  4M71 A;  1TW2 A;  1J5Y A;  2PQ8 A;  5D4R A;  1IN6 A;  1JGS A;  4GYG A;  3KP4 A;  1EH7 A;  3LAJ A;  1ODD A;  1SMT A;  2RNJ A;  3U1D A;  5HOO A;  2VOD A;  3DPT A;  1W5S A;  4Q47 A;  4YFN F;  4BH9 A;  3KET A;  4KIC A;  2JPB A;  1XGS A;  4WF2 A;  4AD9 A;  1RIO H;  3MQ0 A;  5LEK A;  2M87 A;  1YFH A;  4QLC U;  3REO A;  3E97 A;  5K1Y A;  1HKT A;  4HX4 A;  2DI3 A;  5L3G A;  2P6T A;  3B02 A;  1LB2 A;  2EK5 A;  5L3B A;  2IRF G;  4Y17 A;  1BC8 C;  1R36 A;  2DPD A;  1FSH A;  3FXR A;  4LB6 B;  3BJA A;  4OMZ A;  2DQR A;  3HUG A;  5LGU A;  3F22 A;  1IAW A;  2EFW A;  3E6D A;  2ZJ2 A;  2MC3 A;  4FHT A;  4L0Z B;  2HQR A;  5BMZ A;  2H09 A;  3IC7 A;  4UXN A;  3W6J B;  4PDK A;  1SAX A;  2A07 F;  4G7H F;  4R8H A;  2VE8 A;  2FBK A;  3P9C A;  5ICF A;  4KIB A;  4Q5S F;  2P4W A;  4BNC A;  2DK5 A;  3O2P E;  2F2E A;  5CVR A;  4U7B A;  1B1B A;  2ZKZ A;  4P9U A;  3KEQ A;  2STW A;  2GZW A;  2FA5 A;  1G3T A;  3G3Z A;  3RKX A;  2V1U A;  2QBY A;  2M5W A;  3SQN A;  1R00 A;  3RPU A;  1BN5 A;  5CYV A;  3ZMS A;  1UHM A;  3WTV C;  1TBX A;  4Z2Y A;  1B9N A;  2Q0O A;  3MWM A;  2ESN A;  4RAY A;  2L02 A;  1IRG A;  1XD7 A;  1WI9 A;  5BPI A;  2E1C A;  2NRA C;  2FEZ A;  2VBZ A;  2GIV A;  4EM1 A;  5ILU A;  1HXD A;  1K78 A;  5LRS A;  2ELH A;  4G7O F;  2XGX A;  4OIO F;  5HS7 A;  4ZZL A;  2PG4 A;  4CO8 A;  5A2Q Z;  5K5O A;  1R23 A;  1LNW A;  3M1E A;  3LFK A;  1AWC A;  1ZG5 A;  2BEO A;  3J80 Z;  4KUM A;  3C3W A;  3Q5F A;  4A5M A;  4KA4 A;  1W5T A;  1S3J A;  4I2O A;  2L54 A;  4UUV A;  4L9N A;  4MQ9 F;  3HTU A;  3KP3 A;  1F9N A;  4KMU X;  4K2E A;  4BQA A;  3WTS C;  5HDN A;  1FWZ A;  2EA2 A;  2K7L A;  1BJA A;  3T5X A;  2A6H F;  1BC7 C;  5E1W A;  2WV0 A;  4R79 A;  3IKT A;  1IXS B;  5D5V B;  2XRO A;  5JVT A;  4KYW A;  2VBY A;  2PJP A;  1KQ8 A;  1IN4 A;  1D8J A;  4RS8 A;  4Q48 A;  3EYI A;  1L0O C;  1T2K A;  2QQB A;  1C0W A;  1YTY A;  4IHT A;  3NEU A;  1HW2 A;  2PMU A;  4HDV A;  1DP7 P;  4A0Y A;  1ULY A;  2PN6 A;  3V8L A;  2FOK A;  3V7S A;  2FMY A;  1P4X A;  1KU3 A;  1HBX G;  2QM3 A;  1U5T C;  3RKW A;  5DUI A;  1MD0 A;  3I71 A;  1U78 A;  1Z1D A;  2JPC A;  4KNY A;  2STT A;  4WXD A;  4E70 A;  2XAH A;  2MLK A;  4YFX F;  2EA4 A;  3C18 A;  2WC2 A;  2YSR A;  2R3S A;  5H20 A;  2EFQ A;  3F6V A;  1RI7 A;  3GFL A;  5H6Q A;  4Y13 A;  1FSE A;  2D45 A;  3QP6 A;  3HOS A;  5JFR A;  2H6C A;  2L01 A;  4S05 A;  1R22 A;  1YQA A;  4BAY A;  2CQK A;  2VON A;  1BI3 A;  4RB0 A;  1Y0U A;  1R1U A;  2IP2 A;  2A3S A;  1ZYR F;  5TRD A;  3MFK A;  2MA3 A;  2ZNZ A;  2Z9O A;  1X3U A;  2RVC A;  4MEX F;  3SXY A;  3I54 A;  1YIO A;  3I0T A;  3WTU C;  4HV5 A;  1KU9 A;  3L7W A;  3I59 B;  4KMF A;  3DPL C;  4WXC A;  4I02 A;  1BI0 A;  1DPR A;  4BHC A;  4BYY A;  3FXU A;  2RDP A;  3P9K A;  3T8T A;  1CF7 B;  4G6Q A;  3KP2 A;  3BPV A;  1E17 A;  1W7P B;  3F23 A;  2O03 A;  3RPQ A;  1IN8 A;  3JW4 A;  4F7Z A;  1J7K A;  3ZMD A;  4ZYD A;  3TO6 A;  2ACJ A;  5CVI A;  2XIG A;  3JAM K;  3SZT A;  5EEG A;  2BBY A;  1UCR A;  3WOD F;  2PMH A;  1LEB A;  3O6B B;  1XN7 A;  4ESB A;  4OIR F;  4FT8 A;  1JXS A;  1IZ1 A;  3F8B A;  3D5L A;  4L9T A;  2JZY A;  6PAX A;  1Z6T A;  1FY7 A;  1SFE A;  2TDX A;  3L9F A;  2H6B A;  2HR3 A;  4NB5 A;  3VEP A;  4PGH A;  1A04 A;  4U0Y A;  2P7C B;  1FNN A;  1VTN C;  5LBQ A;  3IHU A;  3KZY A;  2MH9 A;  4CDG A;  4JQF A;  1H9T A;  1W7P D;  1KYW A;  4XRF A;  4HDU A;  1K7A A;  2DAO A;  4EJV A;  2EV5 A;  1WWX A;  2CFX A;  2QUF A;  2GXG A;  2OQR A;  3JTG A;  5D5X B;  4A6D A;  3V7R A;  1YW9 A;  3LA3 A;  5ILV A;  3GFM A;  3H3Z A;  1ZRC A;  3CDH A;  2VT3 A;  3AAF A;  4OOI A;  3ECH A;  4PZJ A;  1YLF A;  3EDP A;  3FXQ A;  1IF1 A;  3JSO A;  4MHG A;  4G6D A;  4EM0 B;  5ICC A;  1XDU A;  2FQ3 A;  4EV0 A;  2X0L A;  4ENM A;  4GXO A;  2LF8 A;  3QRF F;  4I09 A;  1Z05 A;  3R4K A;  1S8N A;  1FBQ A;  3K69 A;  1O3R A;  5D4S A;  3IKV A;  2JRT A;  3KLN A;  1BM9 A;  4EQQ A;  4MEY F;  4RB1 A;  4HF2 A;  1B4A A;  4PCQ A;  5L3D A;  3V7C A;  5IT3 A;  2LNB A;  1HST A;  5KK1 A;  2ZME B;  3GZ6 A;  2G7H A;  3RKY A;  4XBF A;  3GW2 A;  4BHB A;  3M7G A;  4IF4 A;  1TLH B;  3WTT C;  1FPQ A;  3DV8 A;  1KA8 A;  2NNN A;  1XSX A;  3NRV A;  4S04 A;  3LST A;  3HRT A;  3TOB A;  5HLI A;  5HLG A;  5E1X A;  2OBP A;  3Q9S A;  3MAJ A;  1U6G A;  4CGZ A;  2P7V B;  2FML A;  4IRH A;  2DPU A;  5BS6 A;  4I0A A;  1TW3 A;  4O3M A;  5DYM A;  3K1N A;  2V9V A;  2CG4 A;  5AON A;  1RZ4 A;  3J81 K;  1B9M A;  2GQQ A;  4OIN F;  1BIA A;  4ASN A;  2RV8 A;  4M73 A;  2XAS A;  3BPX A;  5CVJ A;  5AIQ A;  2JT1 A;  2AXL A;  2O6G E;  2LDU A;  5E8G A;  4IXA A;  3T8R A;  1XGO A;  3T1B A;  3HSE A;  4RGS A;  4HBL A;  3VB2 A;  1KQ0 A;  5K5Q A;  1LDK B;  5JI6 A;  5D8K B;  2O61 A;  1B59 A;  1W7P A;  3JAM Z;  1Z91 A;  2L4M A;  2QQ9 A;  3T0Y A;  3PQJ A;  4L5I A;  3TDU C;  5J8F A;  3HHG A;  3TGN A;  1FZP B;  1RUN A;  4I01 A;  1J9I A;  4MGR A;  4ZH4 F;  3GO5 A;  1LQ1 A;  4A0X A;  4HW0 A;  4M72 A;  2W25 A;  2RC4 A;  4RGU A;  2X4H A;  1T38 A;  3WU1 B;  4LLN A;  4HOB A;  3JSP A;  1IN7 A;  3GLX A;  4LK0 F;  4MQV A;  2BYV E;  5J8C A;  2EWN A;  3BJ6 A;  1H9G A;  4CIC A;  3DQV C;  4I98 B;  1D8K A;  5ICE A;  2K27 A;  2EFO A;  3CO7 C;  1BI1 A;  2XUB A;  4EJT A;  2XAG A;  2ZNY A;  1T98 A;  3QU3 A;  3GFI A;  4L9J A;  2M8E A;  5DEQ A;  4HLY A;  1O3T A;  3DF8 A;  3WGG A;  1QGP A;  3MZH A;  4HQE A;  3FM3 A;  1I5Z A;  3V4G A;  5BQT A;  4KIG A;  5HS8 A;  4ESF A;  2F5E A;  1I27 A;  1P4A A;  1F5T A;  2OA4 A;  2ESH A;  2VT2 A;  2OU2 A;  3GZ5 A;  4RAZ A;  4N0B A;  1OYY A;  1REP C;  3S2W A;  4A6E A;  1ZGA A;  4OIQ F;  4IVN A;  2CWE A;  2HDC A;  4A2U A;  5LGT A;  3F8N A;  5DD4 A;  1YS7 A;  4LGW A;  1T39 A;  1QPM A;  4LG0 B;  3WG9 A;  3N4M A;  1TNT A;  2HYG D;  2DLL A;  3HRM A;  3F8C A;  5KVR A;  1XCV A;  2M30 A;  1HW1 A;  3FMQ A;  5CVU A;  1D5V A;  1KU7 A;  3EYY A;  5IT9 K;  1USS A;  2MD5 A;  4I0B A;  1K79 A;  3HTS B;  5FGM A;  4M9X A;  5FB2 A;  1UB9 A;  2YX4 A;  5FLX K;  3KEO A;  5F6F A;  3WGH A;  4RB2 C;  3OOP A;  1MDM B;  2J5O A;  2ZME A;  4LLL A;  2C6Y A;  4YG2 F;  5ILS A;  4DQ2 A;  4XSZ F;  2HTS A;  4Q4Z F;  1U5T B;  2OQG A;  3GEZ A;  1MJA A;  4MTE A;  1BI2 A;  4UNO A;  4IHS A;  1S6L A;  5D6F A;  2VC1 A;  3HRU A;  3QOP A;  2G9W A;  3CJN A;  4P5O A;  2HKO A;  1I1S A;  2D2W A;  2KIU A;  2O0Y A;  4NHJ A;  4KDP A;  5HS9 A;  1NHA A;  4M74 A;  2NS0 A;  1FYL A;  4RGR A;  3LAP A;  1GXP A;  3J81 Z;  3BWG A;  4QWQ A;  4IJA A;  1WQ2 A;  2YU3 A;  4EMS A;  4MNU A;  1HKS A;  2FE3 A;  3GVA A;  2W24 A;  1QO0 D;  3BY6 A;  2HWV A;  4CZZ A;  1YW7 A;  3M9A A;  1S29 A;  2V1X A;  2KKO A;  3WTW C;  3F6O A;  2P5L C;  3MZY A;  1FX7 A;  3QPT A;  3FF5 A;  5BPD A;  3G73 A;  4IPA A;  4LJZ F;  1SD6 A;  2EFP A;  4HX8 A;  2KJB A;  1DUX C;  2R7D A;  1G6N A;  2A69 F;  5CVV A;  2XAJ A;  3H3U A;  5E18 F;  2ADU A;  3M8E A;  2K4J A;  3RDI A;  2WWY A;  1ZLJ A;  1WSU A;  1GHC A;  3Q9V A;  4LD5 A;  1QNT A;  3LA7 A;  2HS5 A;  5JHU A;  1OR7 A;  4UVC A;  1G3S A;  1MZB A;  4P96 A;  1MJ9 A;  4CHU A;  1P6R A;  2GXB A;  5L3E A;  1O3S A;  3F3X A;  1Z6R A;  3ZN1 A;  2GAU A;  3RJP A;  3ZMV A;  3F8M A;  4GO1 A;  3VOE A;  4NQW A;  1KU2 A;  3KP7 A;  1RUO A;  2RQP A;  5LRR A;  1OPC A;  3SZP A;  4G8X A;  1ZG3 A;  1YYV A;  4R1H A;  3KE2 A;  1IXC A;  5FD6 A;  4GCV A;  4DNC A;  2V6C A;  2GA1 A;  4L18 B;  2PEX A;  3SFZ A;  2UZK A;  3WU0 A;  1LVA A;  4ENK A;  3ZMT A;  5FO5 A;  2K86 A;  2IA0 A;  4OU0 A;  1HQC A;  4XLP F;  3ZMZ A;  4ENN A;  1UST A;  2MH2 A;  4AIJ A;  2A6E F;  3SHF A;  1R7J A;  4L5J A;  2HTJ A;  1P92 A;  4XSX F;  2P5K A;  3E5U A;  2RN7 A;  1CGP A;  3K2Z A;  4AIH A;  4UVB A;  4N9H A;  3RYP A;  3IRR A;  2QBY B;  3I58 A;  5D5W B;  1IW7 F;  2DTR A;  2HGC A;  4KN7 X;  2Y0M A;  1MKM A;  1SMY F;  2QEN A;  1U2W A;  2PI0 A;  3BDD A;  1SD5 A;  4UV8 A;  2BV6 A;  4LG0 A;  4EJO A;  5IT9 Z;  2FBI A;  3ABU A;  1QZY A;  3KLO A;  3PFI A;  3F21 A;  2KJC A;  3HIF A;  4G94 A;  1ON2 A;  1K78 B;  2O8X A;  4I7H A;  5FLX Z;  2E7X A;  2Z5U A;  3BOQ A;  4B8X A;  4WX9 A;  2YX7 A;  3DXJ F;  3ROU A;  2HYF A;  2G7U A;  2FNA A;  2V1D A;  3I5U A;  1FP2 A;  5ED4 A;  5EEH A;  1LDD A;  1S7O A;  3V8K A;  2HZT A;  1SFX A;  4WCG A;  2Q8K A;  5LEJ A;  2XV4 S;  1T6S A;  2NNY A;  1TQM A;  4ON0 A;  1LJ9 A;  3RI4 A;  4A12 A;  2XAF A;  3CUQ B;  3KCC A;  1LDJ A;  1HSJ A;  4XLN F;  4ZZD A;  2Q2E A;  3O3K A;  3L2C A;  2DK8 A;  4Y15 A;  1OYI A;  1G3W A;  2JSC A;  4HAM A;  3R60 A;  4LMY A;  3TQN A;  1BOA A;  4PGG A;  2YR2 A;  2VC0 A;  2Y48 A;  4D0P A;  2BGC A;  3HOT A;  1OMI A;  1RNL A;  3GYH X;  2ZXJ A;  1HW5 A;  5HDG A;  2XRN A;  1FYK A;  4UVA A;  4AWX B;  1BIB A;  2P6S A;  2CGP A;  4ZYH A;  4U0W A;  3QU6 A;  2K4B A;  2UWM A;  1IRF A;  4EM2 A;  3U9G A;  2Y75 A;  5HVQ C;  2VE9 A;  5K5R A;  1P2F A;  2E1N A;  3FWE A;  2VXZ A;  1FC3 A;  2VBW A;  2D1V A;  1ON1 A;  2LSO A;  4HX7 A;  5H6R A;  3ERE D;  1Z9C A;  4WWC A;  2XKP A;  2CSO A;  1B6A A;  1KQ9 A;  3GX4 X;  3TO9 A;  3FX3 A;  2PLY A;  5L3C A;  1G4D A;  4EJU A;  1IN5 A;  1O3Q A;  1S7A A;  3C7J A;  5FD5 A;  3TO7 A;  2XKO A;  3DFG A;  5L3F A;  3E5X A;  4WXH A;  1EV7 A;  1WRJ A;  3I59 A;  1XCB A;  1FYM A;  3RYR A;  3LQQ A;  3ABT A;  4KFC A;  1SD7 A;  3IRQ A;  2GA2 A;  3HRS A;  2VN2 A;  3IL2 A;  4G7Z F;  2FNP A;  2ISY A;  2HEO A;  1CF7 A;  5E17 F;  1PP8 F;  3WTY C;  3IWF A;  4HA8 A;  3K1P A;  4LLG F;  3WGI A;  3CUO A;  1ZRE A;  1ZAR A;  5DCF A;  3B73 A;  5DUK A;  1XSD A;  4ETS A;  5LHH A;  2ZCW A;  2DBB A;  1ZGJ A;  2R7F A;  2E7W A;  2HFH A;  2FRH A;  1WKM A;  4OIP F;  2LKP A;  2XHK A;  2FU4 A;  4P55 A;  2EFN A;  2ISZ A;  2UXN A;  1XSV A;  3J7A O;  2IJL A;  2ZBK A;  4KN4 X;  4HYE A;  3GUD A;  2AS5 F;  2XVC A;  3F72 A;  1J2X A;  1K6O A;  5HLH A;  1YS6 A;  2Z99 A;  5E8I A;  5LLQ A;  4H0E A;  2MBF A;  2UXX A;  2DQL A;  3ECO A;  3E3V A;  1E2X A;  1FOK A;  2ZO4 A;  5DCM B;  3R0J A;  3K0L A;  4M9Z A;  2W85 A;  3ZMU A;  4ZYG A;  1QZZ A;  3E5Q A;  4IRI A;  4U7D A;  4GYI A;  2FSW A;  1FLI A;  2H94 A;  5ERI A;  1ZHF A;  3P7N A;  4HZF A;  3P9I A;  1JHH A;  3TKY A;  1LEA A;  4YIF A;  1HKQ A;  1QQI A;  2QWW A;  4AVP A;  1F1Z A;  2FBH A;  3RTR A;  3WTX C;  2EJR A;  3ISP A;  2NYX A;  2ETH A;  4HLX A;  2H27 A;  2IA1 A;  1O7L A;  2GWR A;  2F5C A;  5LHI A;  3QAH A;  4TV7 A;  4L9V A;  3C1D A;  3HHH A;  1ZRF A;  5D5U B;  3GF2 A;  2OAZ A;  4G9Y A;  4KIF A;  1TNS A;  1XDS A;  3L00 A;  4UHT A;  2DT5 A;  3FMS A;  1ZRD A;  3GFJ A;  3CUQ A;  3HSR A;  3VOD A;  1EH6 A;  1I6X A;  2QZ8 A;  2J5P A;  2D1H A;  4M6Y A;  2WTE A;  3GWZ A;  1OYW A;  2QQA A;  1XB4 A;  5DD8 A;  3ML6 A;  2KIM A;  1IXR C;  1ZH5 A;  5D6E A;  2P8T A;  2VOO A;  2BE5 F;  2ZFW A;  1FBU A;  1OKR A;  3FMR A;  1YW8 A;  1FBS A;  2IT0 A;  3TOA A;  5FFX A;  3KP6 A;  2QVO A;  3ZPL A;  4KT5 C;  2VOP A;  3N97 A;  3ZP5 A;  3ELK A;  1JE8 A;  1ZN2 A;  4HF0 A;  3PQK A;  2CO5 A;  2KIF A;  1TTY A;  3COA C;  5J6X A;  3ULQ B;  2HOE A;  4RGX A;  5CJ9 A;  3CO6 C;  1U8R A;  1V4R A;  4JBA A;  2OD5 A;  3IWZ A;  3GXO A;  1UFM A;  3KFW X;  3R61 A;  2DFI A;  4A5N A;  3DKW A;  2P5V A;  3K1M A;  2EB7 A;  1R58 A;  1J59 A;  2FF4 A;  2HKX A;  5LHG A;  1J75 A;  4WK8 F;  2DU9 A;  1D3Y A;  3I4P A;  5E1Z B;  1L3L A;  3FM5 A;  2Z3Y A;  5F1R A;  4O5V A;  4HQM A;  4LFU A;  5BOX A;  3DP7 A;  2YPR A;  4P9F A;  4ENJ A;  2MLG A;  5JR3 A;  5FFZ A;  1Z7U A;  4JK1 X;  1F4K A;  3LQR A;  1SFU A;  1ONV A;  4YFK F;  4EGY A;  1J0R A;  3R6S A;  2W84 A;  2FXA A;  1O57 A;  3U2R A;  2QLZ A;  1XGM A;  3QP5 A;  4EJW A;  1Q1H A;  1W4M A;  5CLS A;  2RGV A;  3KP5 A;  4IRG A;  2F5D A;  2COM A;  2IA2 A;  3LWF A;  2K02 A;  1G3Y A;  1R1V A;  1R1T A;  1ZAO A;  2M45 A;  1EH8 A;  1JHF A;  2LF7 A;  2KRF A;  1XMK A;  2VBX A;  1YG2 A;  3MEX A;  1ZLK A;  4U0V A;  1AOY A;  3EQL F;  3OV8 A;  4M6X A;  3WE2 A;  3R0A A;  1U3E M;  3RIR A;  3HYI A;  5DCM A;  2A61 A;  4LB5 A;  1DPU A;  5D8L B;  2O3F A;  5LGN A;  1MJB A;  4CYD A;  2Z33 A;  3E6M A;  5ICG A;  1FT9 A;  3MCZ A;  1PUE E;  2IW5 A;  2L3D A;  3FHZ A;  3LA2 A;  3FZV A;  2EV0 A;  3L09 A;  4HV6 A;  5AIP A;  1TQI A;  4CXF A;  1IUY A;  2JTV A;  3TDZ C;  2CYY A;  1O7F A;  1XMA A;  3D0S A;  4UV9 A;  4MTD A;  5DDG A;  4M9S A;  2B0L A;  1XGN A;  4HF1 A; 
#chains in the Genus database with same CATH topology
 4FTH A;  1S7E A;  2DMN A;  2KRH A;  1GXQ A;  4YII A;  3JTH A;  3CTA A;  3RSN A;  2DO7 A;  4B09 A;  2DMQ A;  2MYS A;  2HXO A;  2QQ8 A;  2V26 A;  1FOW A;  2XAQ A;  4PJM A;  4Y33 A;  1QBJ A;  4FX4 A;  1KYZ A;  4I6Z A;  2E34 A;  1TQP A;  3E6B A;  3Q0W A;  3SDG A;  2L4A A;  1BBY A;  3C2H A;  4EVI A;  2DOF A;  4OMY A;  2LLK A;  1ZG1 A;  1V3F A;  2TCT A;  2VKE A;  1F36 A;  3KZZ A;  1SD4 A;  2F4M B;  2IPQ X;  2QYO A;  3CJR B;  3O8H A;  4BXU A;  1R6R A;  1J09 A;  2OZ6 A;  4L0Y B;  1T0F A;  1FP1 D;  3OL3 A;  1NTC A;  3CLO A;  1LPQ A;  2NAZ A;  3DEU A;  3NWS A;  5HDK A;  3OYA A;  3UNG C;  1PP7 U;  1R5H A;  3CCM I;  1MDM A;  3HSF A;  4EEF G;  1KGS A;  4ZC3 A;  1GVJ A;  1V54 H;  2WA0 A;  2M1B A;  1PDN C;  2NOG A;  5A2Q K;  3H36 A;  1TP4 A;  3WTZ A;  1UG0 A;  3L2R A;  3CCV I;  1VQ9 I;  4IHW A;  5JLX A;  4XOP A;  1TWG J;  5GTI C;  3ZN0 A;  3I9V 2;  2IVM A;  1U5T A;  3L2W A;  4AIK A;  2IBD A;  3H92 A;  3HPH A;  2K3P A;  2DW4 A;  2IGN A;  5GAD J;  3PJR A;  3EUH A;  2EV6 A;  5J3L A;  1P4W A;  3V8J A;  1I1G A;  3K9T A;  3J80 K;  3PO3 J;  3VFZ A;  4NDL A;  5FLV A;  2W00 A;  4N4N B;  2HQN A;  3I64 A;  3BZ6 A;  3DBR B;  3RPU D;  2EZH A;  1RR8 C;  2KLO A;  3I56 I;  2PBI A;  5M5Y J;  2CW0 F;  4A0Z A;  3M8F A;  2IGK A;  4FX0 A;  3E6C C;  3ZQ7 A;  4U88 A;  1PYV A;  2RKH A;  5CPR B;  2FX0 A;  3JRH A;  2MSY A;  5E20 A;  3BRO A;  3DPU A;  2A68 F;  4QPO A;  2OZU A;  2DMT A;  3LSR A;  2KL4 A;  2AQE A;  2XF6 A;  5TJJ A;  2E5Z A;  4BBR J;  2F5F A;  2LRD A;  3I53 A;  4ZYE A;  1UHW A;  3OYB A;  1H0M A;  5DV5 A;  3IH2 A;  1MGT A;  3WE3 A;  4RB3 C;  5TIS C;  5J1Y A;  1DDN A;  1STZ A;  2DA5 A;  3F8F A;  1RC9 A;  3BP8 A;  3K4M A;  2CV2 A;  1VQP I;  2LKS A;  4XLC A;  3EET A;  5C4J J;  4MO7 A;  2X9D A;  1WGX A;  2F5V A;  2A5Y B;  3C2B A;  5F64 A;  4BHP A;  2X51 A;  1JKP C;  4HRI A;  4X6A J;  3CUQ C;  3NQO A;  1YO5 C;  3VSK A;  4A3K J;  4EGZ A;  3BJO A;  5GPA A;  4RA2 A;  1R5G A;  4LOC A;  2R7Z J;  2M2E A;  1ZKG A;  4N9I A;  3QPH A;  2W57 A;  4ESJ A;  4GGG A;  4LK1 F;  3JR9 A;  2PFB A;  2V79 A;  3BQZ A;  3GTO J;  2EPF A;  3MZ8 A;  2TRT A;  3W6K B;  4YRV A;  4O6J A;  4M71 A;  1TW2 A;  5TGT A;  1J5Y A;  2PQ8 A;  5D4R A;  1IN6 A;  1JGS A;  4GYG A;  3KP4 A;  1EH7 A;  2E36 A;  3HZJ A;  3LAJ A;  1ODD A;  1SMT A;  2RNJ A;  3U1D A;  1TL8 A;  3U21 A;  2IS6 A;  5HOO A;  2VOD A;  3DPT A;  1W5S A;  4Q47 A;  4YFN F;  1YJN I;  2Y2Z A;  1FTZ A;  4BH9 A;  3KET A;  1IRZ A;  3OYN A;  3S2D J;  1MMD A;  4KIC A;  2JPB A;  4DYQ A;  1XGS A;  3BLY A;  4WF2 A;  2ELJ A;  4AD9 A;  1KZH A;  1RIO H;  3MQ0 A;  2M87 A;  5LEK A;  1YFH A;  1YOV B;  1IC8 A;  4QLC U;  1E3P A;  3GTM J;  2ME6 A;  2WB1 A;  3FXL A;  4E6K G;  3REO A;  2VUM J;  2W1O A;  1FEX A;  4XRS A;  3GTL J;  3E97 A;  5K1Y A;  2AHQ A;  1HKT A;  4D9J A;  4HX4 A;  1POG A;  3FXO A;  2DI3 A;  5L3G A;  1Z0X A;  2P6T A;  4DZP A;  3B02 A;  1LB2 A;  1ZGW A;  2EK5 A;  4DZJ A;  2Z2S B;  3ZR8 X;  5L3B A;  2IRF G;  4Y17 A;  1BC8 C;  3IAS 2;  2CRG A;  4BXX J;  1R36 A;  2EIJ H;  4XKV A;  3SJM A;  3FXR A;  2DPD A;  4LB6 B;  2BW3 A;  4E7S A;  3BJA A;  3I4N J;  1FSH A;  4M6V A;  4OMZ A;  1WH7 A;  2DQR A;  3KYD B;  2MC4 A;  3HUG A;  3GTJ J;  5LGU A;  2JA2 A;  1XS9 A;  3F22 A;  1IAW A;  2EFW A;  3PNV A;  3E6D A;  2ZJ2 A;  4CCK A;  4QSH A;  2MC3 A;  4B3A A;  2HDW A;  4FHT A;  4L0Z B;  2HQR A;  5BMZ A;  4E4H A;  2H09 A;  3X2Q H;  1FIP A;  3J7Z I;  5E3L A;  4IHV A;  3IC7 A;  4UXN A;  2WY8 Q;  2GIZ A;  1HA8 A;  4II2 A;  3K4B A;  3SZG A;  4PDK A;  3W6J B;  2XGC A;  5EG0 B;  1SAX A;  2A07 F;  1WJ5 A;  3SEQ A;  4G7H F;  2ELK A;  4R8H A;  2VE8 A;  2DYS H;  2FBK A;  4C9Y A;  1VZ0 A;  3P9C A;  1V5E A;  4ZTF A;  2R7Q A;  2MG4 A;  5ICF A;  4KIB A;  5BNG A;  4Q5S F;  2P4W A;  4XIC A;  2BXY A;  2PX9 A;  2E60 A;  3DEE A;  2E1O A;  2VJ4 A;  4BNC A;  2DK5 A;  2F48 A;  4BS9 A;  3O2P E;  2F2E A;  5CVR A;  4BJ5 C;  4CCM A;  1B1B A;  4NQW B;  4U7B A;  2R5Y B;  1MNE A;  2ZKZ A;  4P9U A;  3KEQ A;  2STW A;  5F04 A;  3GTP J;  2OTJ I;  2GZW A;  3S3M A;  4F91 B;  2FA5 A;  3BR6 A;  1G3T A;  2R7V A;  3G3Z A;  2LKX A;  1WCM J;  1Q1V A;  2JA5 J;  2H8R A;  1R9T J;  3I3L A;  3AG1 H;  3WHC A;  3OYI A;  5EYR A;  2LH9 A;  3RKX A;  1ETO A;  1GT0 C;  2QBY A;  3LSH A;  2V1U A;  3FBN B;  2M5W A;  2FQ4 A;  1OCC H;  4D7N A;  3SQN A;  3CCR I;  2QSH X;  4EAT A;  4ANJ A;  2LG4 A;  4JOM A;  5GAH J;  4W1U A;  1R00 A;  4LIV A;  3HM5 A;  3RPU A;  1BN5 A;  5CYV A;  3ZMS A;  1UHM A;  1P7I A;  2M7B A;  3WTV C;  1TBX A;  4Z2Y A;  1B9N A;  2Q0O A;  3MWM A;  2ESN A;  4RAY A;  2L02 A;  1IRG A;  3CMY A;  1X2N A;  1XD7 A;  1WI9 A;  3F0C A;  2VPR A;  2WAD A;  5BPI A;  2E1C A;  2NRA C;  2O7O A;  3BTJ A;  2FEZ A;  2VBZ A;  2GIV A;  2GM4 A;  4EM1 A;  5ILU A;  4XID A;  2XPV A;  4BBS J;  3CP2 A;  1HXD A;  1K78 A;  2Y69 H;  2ELH A;  5LRS A;  4G7O F;  3A0B C;  3CC4 I;  2XGX A;  4OIO F;  2M9H A;  3H0G J;  1TWA J;  5HS7 A;  3FBI B;  3ESW B;  4DBR A;  2GOX B;  4UUS B;  4ZZL A;  2KP6 A;  2PG4 A;  1YI2 I;  1DGW Y;  3PM1 A;  2XF5 A;  1YJ9 I;  4CO8 A;  2F4O B;  5A2Q Z;  3K70 C;  1JJ8 C;  1FOX A;  5K5O A;  1R23 A;  4A69 C;  3CME I;  1LNW A;  3M1E A;  3LFK A;  3OYK A;  1AWC A;  3OYE A;  1ZG5 A;  1WJC A;  2BEO A;  4Y7N J;  2R7W A;  3J80 Z;  4KUM A;  4JX5 A;  2LYC A;  3C3W A;  4XLA A;  5CQG A;  3Q5F A;  1X4O A;  4CUG A;  4A5M A;  4KA4 A;  2LY1 A;  5EF6 A;  1W5T A;  5J4V A;  1S3J A;  2W4S A;  3KEY A;  5CQE A;  1MW7 A;  3TW6 A;  5JVG F;  4I2O A;  2JK3 A;  2M0M A;  2L54 A;  2CW7 A;  2RAE A;  3KIO A;  2XGD A;  4UUV A;  4L9N A;  4MQ9 F;  3HTU A;  3TED A;  3KP3 A;  1F9N A;  1N78 A;  4KMU X;  4K2E A;  4BQA A;  3WTS C;  3K6G A;  4H4K C;  5HDN A;  1FWZ A;  4IOC F;  2EA2 A;  2K7L A;  1MBJ A;  1BJA A;  3T5X A;  2A6H F;  1BC7 C;  5E1W A;  2JWT A;  4J01 A;  2WV0 A;  4R79 A;  2B7E A;  3FIW A;  2DJN A;  2CQ7 A;  5J40 A;  2R7S A;  3W2V A;  4CZC A;  3IKT A;  2YU9 J;  1IXS B;  1LKX A;  3L1P A;  4ZJZ A;  5D5V B;  2XRO A;  5JVT A;  2HDD A;  4KYW A;  2VBY A;  4XLE A;  2PJP A;  4B47 A;  1KQ8 A;  3SYT A;  4XMY A;  1GDT A;  1IN4 A;  1D8J A;  1N25 A;  2IGO A;  4RS8 A;  4Q48 A;  3EYI A;  3OR1 C;  1MND A;  1L0O C;  2KPM A;  2W82 A;  2VKH A;  2HYJ A;  1T2K A;  3CC2 I;  2BZT A;  2ECB A;  3ZQI A;  4AC0 A;  2LD5 A;  1WJD A;  2QQB A;  1C0W A;  2KHM A;  1QHH D;  5B66 C;  1T0F C;  1YTY A;  1Y1V J;  4IHT A;  3GLL A;  1WJF A;  3NEU A;  1HW2 A;  2PMU A;  4HDV A;  1U9N A;  1DP7 P;  2CS3 A;  2M4K A;  5C4X J;  4A0Y A;  1ULY A;  2PN6 A;  3V8L A;  1IDY A;  2FOK A;  3V7S A;  2FMY A;  1P4X A;  1KU3 A;  1HBX G;  1TWF J;  2QM3 A;  1U5T C;  3RKW A;  1RES A;  1BL0 A;  2LMD A;  5DUI A;  1MD0 A;  1LE8 B;  3I71 A;  3EUH C;  1U78 A;  4BE2 A;  1Z1D A;  2JPC A;  4KNY A;  1X4P A;  2STT A;  4WXD A;  5HNF A;  1K61 A;  2XAH A;  4E70 A;  2MLK A;  5EZG A;  4YFX F;  2EA4 A;  3C18 A;  2WC2 A;  2YSR A;  1NK2 P;  2R3S A;  5H20 A;  2EFQ A;  5KNL A;  2ZXW H;  1I6H J;  3F6V A;  1RI7 A;  4JX6 A;  3GFL A;  5H6Q A;  4Z6Y A;  1X1C A;  4Y13 A;  3GCM A;  2KRC A;  1N77 A;  1FSE A;  2D45 A;  2BXZ A;  1QZE A;  2NS8 A;  2L7Z A;  3QP6 A;  3PO2 J;  3HOS A;  2COB A;  5JFR A;  2H6C A;  3CLQ A;  4V2G A;  5M5X J;  3UKG A;  2L01 A;  4S05 A;  1R22 A;  3CCY A;  1VQ5 I;  2F6C A;  2VLA A;  1YQA A;  2ICW G;  2CQK A;  4BAY A;  2XB5 A;  2IAI A;  2VON A;  1BI3 A;  4RB0 A;  2Y31 A;  2HPM A;  2L9V A;  3V42 A;  2PJR A;  1TT5 B;  3EPZ A;  1Y0U A;  4C2M J;  4IL6 C;  2LVS A;  2CFO A;  1R1U A;  4CCJ A;  2IP2 A;  2XRL A;  3S3N A;  2A3S A;  1ZYR F;  4DOZ A;  2XSJ C;  1XPX A;  1T8I A;  5B1B H;  5TRD A;  3MFK A;  3NAR A;  2MA3 A;  1I50 J;  2K9Q A;  3OS2 A;  1MMS A;  5F0H A;  2ZNZ A;  3DLL F;  3MVP A;  4PFP A;  2Z9O A;  1X3U A;  2RVC A;  3FXM A;  3CC7 I;  4MEX F;  3SXY A;  4S0H B;  3FIS A;  2DTZ A;  5DM6 F;  1W5C C;  3I54 A;  2EZK A;  4M3D A;  1YIO A;  4XLH A;  2OC6 A;  3I0T A;  3WTU C;  4HV5 A;  4ZYA A;  1KU9 A;  3L7W A;  3HG9 A;  3I59 B;  3FKJ A;  4KMF A;  3DPL C;  4WXC A;  4I02 A;  1BI0 A;  1DPR A;  5DM7 F;  1PUF B;  4ITV A;  4BHC A;  2L9N A;  4BYY A;  3PSF A;  3FXU A;  2RDP A;  2WAF A;  2X85 A;  5FKL A;  3P9K A;  2KDZ A;  2R5Y A;  3GBG A;  1I3Q J;  2NVQ J;  3T8T A;  1CF7 B;  4G6Q A;  1OCZ H;  3H0D A;  3KP2 A;  3H3V K;  3BPV A;  4XOR A;  1E17 A;  2IEK A;  1W7P B;  3HBL A;  2E71 A;  5KCM A;  3F23 A;  1ETX A;  2O03 A;  3RPQ A;  1IN8 A;  3HGG A;  3JW4 A;  1B72 B;  4F7Z A;  2P81 A;  1J7K A;  1A6Q A;  3ZMD A;  3Q3S A;  4ZYD A;  3TO6 A;  3PL8 A;  2ACJ A;  5CVI A;  2XIG A;  2BOL A;  4G6T B;  3K4C A;  3JAM K;  3SZT A;  3LOC A;  2ECC A;  5EEG A;  2R5Z B;  2BBY A;  2XSD C;  4OWR B;  3IUO A;  1UCR A;  3M8J A;  3WOD F;  2PMH A;  4QTR A;  1JKO C;  4IO9 F;  2M3A A;  2M8G X;  3CCS I;  1JI8 A;  2DCE A;  1LEB A;  2MW8 A;  3O6B B;  3QOE A;  1XN7 A;  4ESB A;  4OIR F;  4A3I J;  3OSF A;  3B6C A;  4FT8 A;  2A6T A;  2E19 A;  2L0K A;  1JXS A;  1IZ1 A;  3BR0 A;  3F8B A;  4XR6 A;  3D5L A;  4L9T A;  4UUS A;  4KIT B;  2ZB9 A;  2L7F P;  2GLO A;  2JZY A;  6PAX A;  1Z6T A;  1FY7 A;  4C2T A;  1SFE A;  4C2U A;  2TDX A;  3L9F A;  1VI0 A;  2H6B A;  2HR3 A;  4NB5 A;  3ZQG A;  2X1E A;  2B63 J;  2QSF X;  3VEP A;  2DFH A;  2JMW A;  3SFI A;  1S5L C;  4PGH A;  1A04 A;  3BZK A;  4NC6 A;  4U0Y A;  2R7O A;  1GUU A;  3ZQF A;  2DYR H;  4FIS A;  3KX2 A;  2P7C B;  1FNN A;  1X19 A;  1VTN C;  5LBQ A;  3IHU A;  3KZY A;  2MH9 A;  4CDG A;  2B9S A;  1MSE C;  4JQF A;  2LOO A;  1H9T A;  1W7P D;  1KYW A;  2HQA A;  4XRF A;  4HDU A;  3VPR A;  1K7A A;  2DAO A;  4EJV A;  2EV5 A;  1WWX A;  2CFX A;  2QUF A;  2GXG A;  2OQR A;  1T56 A;  4AYB N;  3JTG A;  4JYK A;  5D5X B;  3M4O J;  1FTT A;  2LTP A;  3ABM H;  4BDZ A;  5FKK A;  4A6D A;  9ANT A;  3QPL A;  3V7R A;  1YW9 A;  3LA3 A;  5ILV A;  3CCJ I;  4A3C J;  1GVD A;  3C2G A;  2LFB A;  3GFM A;  3H3Z A;  2K9N A;  1YJW I;  1ZRC A;  3CDH A;  3FKI J;  4XM3 A;  2VT3 A;  4RMN A;  3AAF A;  4OOI A;  3ECH A;  4PZJ A;  3K4J A;  1YLF A;  3EDP A;  3FXQ A;  2VJI A;  1IF1 A;  3JSO A;  1GV2 A;  4MHG A;  4G6D A;  4EM0 B;  5ICC A;  1XDU A;  1R4N B;  3ZRG A;  2FQ3 A;  5GP9 A;  4EV0 A;  2X0L A;  5IP6 A;  4GXO A;  4ENM A;  3OIO A;  2LF8 A;  1A35 A;  1K6Y A;  3QRF F;  1YX3 A;  2JJ7 A;  4I09 A;  1Z05 A;  3JCU C;  3R4K A;  1D0X A;  3TL4 X;  1S8N A;  1FBQ A;  3K69 A;  4P1W A;  1O3R A;  5D4S A;  1K83 J;  1JGG A;  3IKV A;  2JRT A;  3Q0V A;  1R71 A;  3KLN A;  2K9S A;  1BM9 A;  4EQQ A;  4MEY F;  2ZFU A;  2JVH A;  2UV1 A;  4RB1 A;  4HF2 A;  1B4A A;  4PCQ A;  4PSX A;  5L3D A;  3PUF A;  3V7C A;  4HST A;  5IT3 A;  3OYM A;  1MMG A;  3M07 A;  3EUK L;  2LNB A;  1HST A;  4HG2 A;  2GOM A;  5KK1 A;  2CUJ A;  3ERM A;  2ZME B;  3DBH B;  3QYF A;  3GZ6 A;  3IH4 A;  4CSW A;  2HOT A;  3OS1 A;  2G7H A;  3RKY A;  2XC7 A;  1TT0 A;  3LSK A;  4XBF A;  3GW2 A;  1ETQ A;  3M1C A;  4BHB A;  3M7G A;  4IF4 A;  1TLH B;  2V4J C;  3DU6 A;  3WTT C;  1FPQ A;  2DA4 A;  3DV8 A;  4CYC B;  1KA8 A;  2NNN A;  1SC7 A;  3H9J A;  4IQJ A;  1XSX A;  2A05 A;  3S1R J;  3NRV A;  1WZ2 A;  1EJ9 A;  1FIA A;  4S04 A;  3LST A;  1XX5 A;  2CUE A;  2PMZ N;  2KQR A;  3HRT A;  3A02 A;  2E2I J;  5F08 A;  3TOB A;  1BR4 A;  2JUC A;  5HLI A;  4YIR X;  4BQQ A;  5HLG A;  4XKC A;  1W36 D;  5E1X A;  2OBP A;  2CUZ A;  3G1L A;  3Q9S A;  2Y0S N;  5FRO A;  3CF5 F;  3MAJ A;  1U6G A;  3IH3 A;  4CGZ A;  2P7V B;  5FLM J;  2FML A;  3K7A J;  3BC8 A;  4IRH A;  2DPU A;  3MD2 A;  5DTD A;  1Z3X A;  5BS6 A;  4I0A A;  3AL0 C;  3CCQ I;  1TW3 A;  4A3M J;  4O3M A;  5J47 A;  5DYM A;  1RKT A;  2QGU A;  1SAN A;  4F92 B;  2LY9 A;  4BE1 A;  3DTK A;  3K1N A;  2V9V A;  4DGW B;  2CG4 A;  5AON A;  2DOE A;  1AU7 A;  3EUA A;  1RZ4 A;  3J81 K;  3QPS A;  1B9M A;  1APL C;  1NH3 A;  2GQQ A;  4KJZ A;  1G2H A;  4OIN F;  1BIA A;  4ASN A;  2RV8 A;  4M73 A;  2XAS A;  2HU9 A;  2CQQ A;  3BPX A;  2E35 A;  1V55 H;  1E0E A;  5CVJ A;  1DU6 A;  5AIQ A;  4HNU A;  2E2J J;  5J4Y A;  2JT1 A;  5HOD A;  2AXL A;  2O6G E;  2LDU A;  5E8G A;  2VL8 A;  4IXA A;  3T8R A;  1OFC X;  2I10 A;  5C44 J;  3A0H C;  3AG2 H;  2VPL A;  1XGO A;  3RQ4 A;  1H89 C;  3GZN B;  3T1B A;  2JA8 J;  3HSE A;  5J1U A;  5KAI C;  4RGS A;  4HBL A;  1X58 A;  1WJB A;  3VB2 A;  1KQ0 A;  3HOV J;  5K7F A;  3S1N J;  3HOW J;  1MSF C;  5K5Q A;  1ETV A;  2L9S A;  1X2M A;  1JTX A;  4UY8 I;  1LDK B;  1QHG A;  2XPU A;  3JRG A;  5JI6 A;  1XMX A;  5D8K B;  2O61 A;  1HDD C;  1B59 A;  1W7P A;  3JAM Z;  1Z91 A;  2BVM A;  2L4M A;  2CUF A;  2QQ9 A;  1BR1 A;  1U0J A;  3T0Y A;  3PQJ A;  3PNT A;  4L5I A;  3W3C A;  3QQA A;  3TDU C;  2L9R A;  5J8F A;  2L7M P;  3HHG A;  3TGN A;  1FZP B;  1RUN A;  4I01 A;  1J9I A;  3BT9 A;  1ORK A;  4MGR A;  1FJL A;  1VND A;  1BR2 A;  4ZH4 F;  5M3M J;  2X6W A;  1P7J A;  3GO5 A;  4A0X A;  2X6Y A;  1LQ1 A;  4HW0 A;  1MH3 A;  3G1O A;  4M72 A;  3VSL A;  2W25 A;  4Y52 J;  1UZC A;  2RC4 A;  1EKE A;  4RGU A;  2X4H A;  1T38 A;  4AYB A;  1RPW A;  1EA3 A;  1QRY A;  1XC5 A;  2DT7 B;  3WU1 B;  1D1B A;  4LLN A;  4FQG A;  2LBF B;  4HOB A;  3JSP A;  3H35 A;  1DGR M;  1IN7 A;  1D5Y A;  1GLN A;  4I76 A;  3GLX A;  4LK0 F;  4MQV A;  2BYV E;  2NVY J;  4DJA A;  5J8C A;  5M5W J;  2EWN A;  3BJ6 A;  1H9G A;  4CIC A;  3DQV C;  4I98 B;  2ZJP F;  1D8K A;  5ICE A;  2K27 A;  2EFO A;  3CO7 C;  1BI1 A;  2XUB A;  5JLW A;  4EJT A;  2XAG A;  2VIX A;  3HB9 A;  2ZNY A;  1JUS A;  1T98 A;  3QU3 A;  5EGO B;  4AVZ A;  1OCO H;  3GFI A;  4L9J A;  4RDU A;  3LSG A;  2M8E A;  3W6V A;  3S1Q J;  1YX5 A;  2Y9Y A;  1K4T A;  3K4N A;  5DEQ A;  2GBY A;  4HLY A;  4C30 A;  3DF8 A;  3WGG A;  1O3T A;  1JJ6 C;  3I4M J;  1NG6 A;  3KZI C;  4IX7 A;  1QGP A;  4DYC A;  1SFO J;  3OMY A;  3O8G A;  4II3 A;  4HQE A;  1MBH A;  3BTL A;  4AID A;  3MZH A;  3FM3 A;  1NK3 P;  3JRB A;  1I5Z A;  3BR2 A;  3LSP A;  3TP3 A;  1Z67 A;  3V4G A;  5BQT A;  1JT6 A;  4KIG A;  3WHB A;  4NBQ A;  1FMV A;  1Z7L A;  5HS8 A;  4ESF A;  2O9L A;  1LFP A;  3OOU A;  2F5E A;  2RNG A;  1I27 A;  1P4A A;  5F0C A;  1F5T A;  2OA4 A;  5F0F A;  2ESH A;  2VT2 A;  2OU2 A;  3GZ5 A;  2P0W A;  4RAZ A;  4N0B A;  1OYY A;  1REP C;  3S2W A;  3BQY A;  4A6E A;  3N05 A;  2K40 A;  1ZGA A;  2R7R A;  4OIQ F;  4XOT A;  4IVN A;  2V6E A;  1AKH B;  2CWE A;  1WPK A;  2HDC A;  5B1A H;  4A2U A;  5LGT A;  3F8N A;  2L7K A;  4A3F J;  3G2B A;  5DD4 A;  1YS7 A;  3OYC A;  2FOW A;  4LGW A;  1ETY A;  1T39 A;  1QPM A;  1VQN I;  2DXI A;  5C3E J;  4LG0 B;  1HCR A;  1B8I B;  3DKX A;  3WG9 A;  2WBM A;  3N4M A;  1TNT A;  3W2W A;  4F93 B;  2HYG D;  2H1L A;  2DLL A;  3HRM A;  4Y3O A;  1H8A C;  3F8C A;  5KVR A;  3VYS B;  2QCO A;  1XCV A;  1Y39 A;  4M3G A;  3AG4 H;  2PMZ A;  2M30 A;  3MKZ A;  1HW1 A;  3FMQ A;  4MIM A;  5CVU A;  4A3G J;  3CDI A;  1D5V A;  1KU7 A;  3EYY A;  5IT9 K;  1USS A;  2I5U A;  5K7Z A;  2MD5 A;  4GRI A;  2Y0S A;  1VFC A;  4I0B A;  2ZXH A;  1K79 A;  3HTS B;  5E3N A;  5M3F J;  3ZGK A;  1JTY A;  1RR7 A;  3PIO F;  4B43 A;  5FGM A;  4F55 A;  5IP7 J;  3JRD A;  4M9X A;  5FB2 A;  1T33 A;  1RKW A;  1UB9 A;  3K4L A;  3LFU A;  1BOB A;  2YX4 A;  5FLX K;  3KEO A;  4E7H A;  5F6F A;  3WGH A;  4AM3 A;  4RB2 C;  3AG3 H;  3OOP A;  1MDM B;  2J5O A;  1BA5 A;  3MKL A;  2ZME A;  4LLL A;  2C6Y A;  4M3F A;  3W2A A;  4YG2 F;  4XN3 A;  5ILS A;  4DQ2 A;  4XSZ F;  2HTS A;  4Q4Z F;  1U5T B;  2OQG A;  3GEZ A;  1MJA A;  4MTE A;  1BI2 A;  2ZSI B;  2BVL A;  5LFA A;  4UNO A;  4IHS A;  1S6L A;  3J7Y J;  2DA1 A;  5D6F A;  3K2A A;  5K7H A;  1ZTR A;  2VC1 A;  3RZD J;  3OSG A;  3IV5 A;  2X6X A;  3HRU A;  5KAF C;  2Q2E B;  3QOP A;  2G9W A;  3CJN A;  2E1M C;  3Q0U A;  4A93 J;  1ZR2 A;  4P5O A;  2HKO A;  1I1S A;  2D2W A;  1JUM A;  4YEJ A;  2KIU A;  3VYU B;  3S15 J;  2O0Y A;  4NHJ A;  4AU7 A;  4KDP A;  5HS9 A;  1WVR A;  1NHA A;  4M74 A;  4F3Q A;  2NS0 A;  2HOA A;  1FYL A;  4RGR A;  1CQT A;  1EF4 A;  3LAP A;  1IG7 A;  1GXP A;  3BR5 A;  1YE9 A;  2BY2 A;  3J81 Z;  2VJ5 A;  3VWB A;  1V5G A;  3BWG A;  4QWQ A;  2DA3 A;  2QKL B;  2VJJ A;  4IJA A;  4YEL A;  1WQ2 A;  2YU3 A;  4MFD A;  2WV1 A;  4EMS A;  1OJL A;  4MNU A;  1T95 A;  1HKS A;  1X1B A;  2FE3 A;  2WAQ N;  4ZDO A;  3H5A A;  4Y4R A;  3GVA A;  2W24 A;  1YIJ I;  4C3I J;  1QO0 D;  3BY6 A;  2HWV A;  4CZZ A;  1VQ7 I;  2VXD A;  1YW7 A;  2X48 A;  4BDY A;  3M9A A;  2QEX I;  1S29 A;  2V1X A;  2KKO A;  3TP0 A;  3F6O A;  2XB0 X;  3WTW C;  2P5L C;  3MZY A;  1FX7 A;  3QPT A;  3FF5 A;  1MNM C;  4BEH B;  2VQC A;  2R7U A;  5BPD A;  3D5S C;  3L2V A;  3G73 A;  3AKZ A;  4IPA A;  4LJZ F;  1SD6 A;  2EFP A;  4HX8 A;  5FKN A;  2KJB A;  2KZG A;  1DUX C;  1TC3 C;  3HOU J;  2R7D A;  1G6N A;  2EIL H;  4PFO A;  3CQZ J;  3ABL H;  4FE7 A;  2A69 F;  2G0E A;  4PJJ A;  5CVV A;  2CU7 A;  2XAJ A;  3H3U A;  5IYC J;  5E18 F;  2ADU A;  3M8E A;  3TBI A;  4BY1 J;  3OIQ A;  2K4J A;  3RDI A;  4BJT A;  1ZLJ A;  1BJZ A;  3HEF A;  2WWY A;  1WSU A;  1E3O C;  2OF7 A;  1GHC A;  3Q9V A;  4LD5 A;  3S3O A;  1QNT A;  1X3Z B;  3LA7 A;  4HNT A;  4A3D J;  2HXI A;  2HS5 A;  4DYR A;  1SVL A;  1D0Y A;  5EG0 A;  5JHU A;  1IV8 A;  1OR7 A;  3KYC B;  2K85 A;  3H9G A;  4UVC A;  2HVR A;  1G3S A;  1MZB A;  1Z21 A;  1MJ9 A;  4P96 A;  4CHU A;  3JRI A;  1P6R A;  2BY3 A;  2GXB A;  5L3E A;  3M3Y J;  3S8P A;  2E5N A;  1O3S A;  3F3X A;  1Z6R A;  3G4S I;  1RRJ A;  3ZN1 A;  1TWC J;  2QF7 A;  2GAU A;  2VQG A;  3RJP A;  2ID6 A;  4AUX A;  3HOX J;  3ZMV A;  1HC8 A;  3F8M A;  1PJR A;  4GO1 A;  4V2F A;  3KYL A;  3IAM 2;  2NXN B;  3GTQ J;  3CJQ B;  3VOE A;  3D1N I;  5IYD J;  3ZQQ A;  1WFX A;  4NQW A;  5B3S H;  1KU2 A;  3KP7 A;  4NNJ A;  3E7L A;  1ZR4 A;  1FMW A;  3AFH A;  4IKF A;  2CMP A;  1UG2 A;  1RUO A;  2RQP A;  3FDY A;  5LRR A;  1OPC A;  3QYB A;  3OYJ A;  3SZP A;  4GDF A;  3DBL B;  4G8X A;  1ZG3 A;  3HUG B;  3RKQ A;  1YYV A;  4R1H A;  3JRC A;  3KE2 A;  3UR3 C;  1IXC A;  2IGM A;  1RET A;  4PJL A;  5FD6 A;  4GCV A;  5E79 C;  5GPC A;  4DNC A;  2V6C A;  2DA7 A;  4D5C A;  2GA1 A;  4L18 B;  2PEX A;  2QSG X;  2V7F A;  3SFZ A;  2HI3 A;  2UZK A;  3WU0 A;  4KT6 A;  4ZTJ A;  3GTG J;  2Y9Z A;  2ME0 A;  1LVA A;  3CJT B;  1X1P A;  2DMU A;  4ENK A;  3ZMT A;  5FO5 A;  2K86 A;  2IA0 A;  3FK7 A;  4OU0 A;  3JRA A;  1X1D A;  1HQC A;  4XLP F;  2ZJR F;  3ZMZ A;  3OYH A;  3BG9 A;  4ENN A;  1UST A;  2MH2 A;  1JT0 A;  5HNH A;  2A6E F;  3CZ6 A;  4AIJ A;  1AHD P;  2IS1 A;  3SHF A;  1R7J A;  4L5J A;  4NC7 A;  2HTJ A;  1P92 A;  4UB8 C;  4XSX F;  4B4C A;  2P5K A;  3E5U A;  2X6O A;  1Y6I A;  3VYR B;  2RN7 A;  2V9K A;  1CGP A;  1DP3 A;  2FD5 A;  4E7J A;  3K2Z A;  4X1E A;  1Y56 A;  1QPI A;  1R49 A;  4BE0 A;  3P5J A;  4AIH A;  4UVB A;  4D5F A;  4N9H A;  3RYP A;  2CQN A;  3K4K A;  2KIQ A;  3ZXS A;  3IRR A;  3H9Q A;  2QBY B;  1ETW A;  1QU3 A;  3RQI A;  3I58 A;  5E3M A;  1IW7 F;  2DTR A;  2HGC A;  4RM3 A;  5F1J A;  5D5W B;  4XKW A;  4KN7 X;  5IY5 H;  5GAG J;  2DN0 A;  2Y0M A;  2EIM H;  1MKM A;  2H8W A;  1SMY F;  2OCC H;  2QEN A;  2X1D A;  5FKM A;  1U2W A;  2M4G A;  3GTK J;  3DU5 A;  2OJE D;  2PI0 A;  3CP8 A;  2CW8 A;  3BDD A;  4LIT A;  1OQY A;  2MD0 A;  4J00 A;  1SD5 A;  2F4I A;  3MN2 A;  4UV8 A;  2BV6 A;  4LG0 A;  3HXL A;  2LC2 A;  4RBO A;  4RLF A;  1UAA A;  2ZSH B;  4EJO A;  4CH7 A;  5IT9 Z;  2FBI A;  3ABU A;  1QZY A;  3KLO A;  4X0G A;  3PFI A;  3F21 A;  4PK4 A;  3HOZ J;  3S14 J;  4ABZ A;  2KJC A;  3HIF A;  3RCO A;  4G94 A;  1OCT C;  2EQR A;  1YIT I;  1ACI A;  3OYF A;  1ON2 A;  1K78 B;  4JX4 A;  2O8X A;  4I7H A;  3HJE A;  1R5I D;  5FLX Z;  4BQO A;  2E7X A;  2XPW A;  2Z5U A;  3BOQ A;  4B48 A;  1W0U A;  3A01 B;  4B8X A;  4IHY A;  3PNY A;  3MKW B;  4WX9 A;  2YX7 A;  2VAS A;  3BR1 A;  3DXJ F;  3ROU A;  2HYF A;  2G7U A;  2VKD A;  5CKT A;  2FNA A;  3B6A A;  2V1D A;  3I5U A;  1FP2 A;  2NS7 A;  5ED4 A;  5EEH A;  1LDD A;  1F43 A;  1S7O A;  4PSW A;  4B44 A;  1VQM I;  1IDZ A;  3V8K A;  2HZT A;  2WAQ A;  1PVE A;  2IS2 A;  1SFX A;  4WCG A;  3JRF A;  2Q8K A;  5LEJ A;  1I3A A;  4E7K A;  1OCR H;  4CCN A;  1MMA A;  2JRM A;  3BZC A;  3OR2 C;  2XV4 S;  1T6S A;  3J7A Y;  5FRN A;  3S16 J;  2NNY A;  1TQM A;  3LSM A;  4ON0 A;  1Y8R B;  1LJ9 A;  3RI4 A;  3CMM A;  4A12 A;  1XG1 A;  2XAF A;  3CUQ B;  3KCC A;  4BAC A;  1LDJ A;  1HSJ A;  4XLN F;  4A3L J;  4ZZD A;  3BTI A;  4BXF A;  2Q2E A;  5FKO A;  3O3K A;  1ZK8 A;  5GAE J;  3L2C A;  1G8X A;  1H88 C;  1JUP A;  4OAZ A;  3CMA I;  3NWT A;  2EBI A;  2DK8 A;  4Y15 A;  1BW6 A;  1OYI A;  1G3W A;  4QPQ A;  2JSC A;  2HVQ A;  4HAM A;  4J19 A;  2OUM A;  1LE8 A;  2MFZ A;  1W36 C;  3DLA A;  3R60 A;  2DT6 A;  4LMY A;  1OCP A;  3TQN A;  1BOA A;  2M34 A;  2VQL A;  4PGG A;  4FE4 A;  2YR2 A;  2Q1Z B;  2VKV A;  2VC0 A;  2XF7 A;  1Y1W J;  3BCA A;  2CJJ A;  2Y48 A;  1WJA A;  2DA2 A;  2BGC A;  4D0P A;  3HOT A;  1MBK A;  5H2F C;  2R0Q C;  3DTE A;  1OMI A;  5KHD A;  1RNL A;  3K10 A;  3GYH X;  2O8K A;  2ZXJ A;  3AL0 B;  1JKR C;  1HW5 A;  5HDG A;  3ZCO A;  3A4C A;  2XRN A;  2EZI A;  4UVA A;  1FYK A;  4AWX B;  1BIB A;  2KZV A;  2P6S A;  2CQX A;  4HEA 2;  3ABK H;  4NUB A;  2CGP A;  4ZYH A;  3HL2 A;  4U0W A;  3QU6 A;  3LNQ A;  4BEH A;  2JUG A;  4DBQ A;  2K4B A;  2UWM A;  1IRF A;  4EM2 A;  3BTC A;  4HSR A;  1SAU A;  4B1R A;  3HC7 A;  3U9G A;  2Y75 A;  5HVQ C;  2ZME C;  3DCF A;  2ID3 A;  1P2F A;  2E1N A;  4I99 C;  4W97 A;  5K5R A;  2VE9 A;  2CV0 A;  3HGY A;  3U1K A;  3FWE A;  2VXZ A;  1FC3 A;  2VBW A;  2D1V A;  1ON1 A;  2LSO A;  3NAU A;  4HX7 A;  5H6R A;  3ERE D;  2CH0 A;  1Z9C A;  2BY1 A;  2UUZ A;  4BY7 J;  4WWC A;  2XKP A;  2AQF A;  2CSO A;  3CD6 I;  2HPI A;  1B6A A;  4RAG A;  1KQ9 A;  3GX4 X;  3TO9 A;  3FX3 A;  2PLY A;  5L3C A;  2YS9 A;  1G4D A;  1WH5 A;  4EJU A;  2R92 J;  1IN5 A;  1O3Q A;  1S7A A;  3C7J A;  4IZZ A;  5FD5 A;  3TO7 A;  2XKO A;  3DFG A;  5L3F A;  3E5X A;  4WXH A;  4HNV A;  1EV7 A;  1K4S A;  2KIS A;  2HNH A;  3S32 A;  5HLT A;  1P9Q C;  1ETK A;  1UJ8 A;  2NOJ B;  2DJI A;  1WRJ A;  3I59 A;  3G1M A;  2NVU B;  1XCB A;  3CES A;  3CCE I;  3OIP A;  3RYR A;  3LQQ A;  3ABT A;  4C3J J;  5EJC A;  1FYM A;  1PUF A;  4KFC A;  4FCY A;  3TMO A;  5EEA A;  1SD7 A;  3IRQ A;  2N8G A;  3PUB A;  1QVT A;  2GA2 A;  3HRS A;  2R7T A;  2VN2 A;  3LMM A;  4UUT A;  4E7Z A;  3IL2 A;  4G7Z F;  4DIQ A;  2FNP A;  2ISY A;  2HEO A;  1O4X A;  1CF7 A;  5E17 F;  3SEZ A;  2D5V A;  2K3F A;  1PP8 F;  4XQF A;  2NVT J;  3WTY C;  4LG3 A;  3IWF A;  4HA8 A;  1VQ8 I;  2PJR B;  3K1P A;  4LLG F;  2DDB A;  3WGI A;  4XN0 A;  2NVX J;  1YRN B;  5JHF A;  3HDD A;  2VB6 A;  3CUO A;  1ZRE A;  4XRS G;  1ZAR A;  4XON A;  1IUF A;  1B72 A;  1X1A A;  4IOA F;  1VQ4 I;  5DCF A;  4BGD A;  2JSP A;  3BG6 A;  3B73 A;  5DUK A;  1XSD A;  4ETS A;  5LHH A;  1D0Z A;  1MMN A;  1QVU A;  2ZCW A;  2R5Z A;  2JQ7 A;  2DBB A;  2Y30 A;  4D1Q A;  1ZGJ A;  2L5Q A;  2R7F A;  2E7W A;  2HFH A;  1SVM A;  2FRH A;  2OPT A;  2Z16 A;  1M1E B;  1WKM A;  4OIP F;  3VYT B;  2LKP A;  1AA7 A;  2FU4 A;  2XHK A;  5EZH A;  3CDL A;  4P55 A;  2EFN A;  2AO9 A;  2ISZ A;  3CCU I;  3SDB A;  4DW6 A;  2UXN A;  1XSV A;  3PIP F;  4XKB A;  2FUG 2;  2HVS A;  2IJL A;  4IEJ A;  3J7A O;  2ZBK A;  4QIW N;  2KFD A;  4KN4 X;  3FK6 A;  1U9O A;  4HYE A;  3GUD A;  1MBE A;  1OR7 C;  4RLQ A;  2IS4 A;  2XGE A;  2AS5 F;  2OV7 A;  4U87 A;  2XVC A;  2ZJQ F;  3F72 A;  1J2X A;  3F9K A;  1K6O A;  3KPH A;  1JKQ C;  4CA0 A;  5HLH A;  1HLV A;  1YS6 A;  1UEL B;  2Z99 A;  5E8I A;  5LLQ A;  3BG3 A;  4H0E A;  2M7A A;  2KDO A;  2MBF A;  3ZQH A;  3ZQC A;  3H5R A;  1S9H A;  2UXX A;  2DQL A;  2BY0 A;  3ECO A;  3E3V A;  1E2X A;  1MBF A;  1MBG A;  3H5N A;  4A3J J;  4FET A;  3VDX A;  1FOK A;  3BR3 A;  2ZO4 A;  3E1S A;  5DCM B;  3R0J A;  3K0L A;  4L5E A;  4M9Z A;  3S17 J;  2W85 A;  4JP0 A;  3ZMU A;  4ZYG A;  2QA4 I;  4XK4 A;  1QZZ A;  3GME A;  2O5R A;  3E5Q A;  4IRI A;  4U7D A;  4GYI A;  2W7N A;  2FSW A;  1MH4 A;  1FLI A;  3FXK A;  3S2H J;  2H94 A;  5ERI A;  1ZHF A;  3P7N A;  4HZF A;  3P9I A;  1JHH A;  3TKY A;  1LEA A;  4YIF A;  3BCB A;  1HKQ A;  1QQI A;  2L2O A;  3S93 A;  2QWW A;  3A1Y A;  4AVP A;  1F1Z A;  2FBH A;  3RTR A;  1WI3 A;  3WTX C;  2EJR A;  3ISP A;  2NYX A;  2ETH A;  3A01 A;  4PJN A;  1QA6 A;  2DFF A;  4HLX A;  1HOM A;  1G59 A;  2H27 A;  2IA1 A;  5DS9 A;  1O7L A;  2HOS A;  2GWR A;  2WAE A;  2X1C A;  2F5C A;  2ZC2 A;  4ZDP A;  2DOD A;  5LHI A;  4XNF A;  3QAH A;  4TV7 A;  3BG5 A;  4L9V A;  2I8D A;  3FXJ A;  2MGQ A;  3C1D A;  4ZDL A;  3LSJ A;  3RZO J;  3OYD A;  1XTA A;  3QWL A;  3HHH A;  1ZRF A;  3HOY J;  1W1W E;  5D5U B;  2JA7 J;  3ASO H;  3GF2 A;  3HKZ N;  1VQK I;  2OAZ A;  4G9Y A;  4KIF A;  1TNS A;  1SEU A;  2XDV A;  1XDS A;  1OLT A;  3L00 A;  4C3H J;  4UHT A;  2DT5 A;  3FMS A;  1WJE A;  1ZRD A;  3GFJ A;  3K70 D;  3CUQ A;  5FRM A;  2VQH A;  3HSR A;  3VOD A;  2CV1 A;  1EH6 A;  2JN6 A;  1U8B A;  1I6X A;  2QZ8 A;  1VQO I;  2EIN H;  2GXA A;  3OS0 A;  4E7I A;  2J5P A;  2D1H A;  4M6Y A;  5IYB J;  1TWH J;  2WTE A;  3GWZ A;  2E1M B;  5FJ8 J;  3WU2 C;  2VI6 A;  2W48 A;  1WHU A;  1OYW A;  2QQA A;  2DMP A;  1SVO A;  1XB4 A;  5DD8 A;  2DFE A;  3ML6 A;  3JRE A;  4KIS A;  3A2K A;  3H1C A;  3OYG A;  2KIM A;  1VQL I;  1IXR C;  1Z3Y A;  1ZEL A;  3OWT A;  4F52 A;  1ZH5 A;  1SFK A;  5D6E A;  3CF2 A;  2EZL A;  2P8T A;  1S72 I;  2VOO A;  2BE5 F;  2ZFW A;  4CYC A;  1FBU A;  1OKR A;  1VF9 A;  3FMR A;  4HPQ A;  4XL9 A;  4BL0 B;  3BG7 A;  1YW8 A;  1TZL A;  1ZQ3 P;  4M3E A;  1ITY A;  3G6E I;  2BHZ A;  2K5C A;  1FBS A;  2K9M A;  2IT0 A;  3TOA A;  5FFX A;  3LSI A;  3KP6 A;  2QVO A;  3G71 I;  2YUS A;  3ZPL A;  3WG7 H;  4KT5 C;  2IXS A;  4PJ0 C;  2VOP A;  3N97 A;  3ZP5 A;  1Z77 A;  3ELK A;  3L2U A;  1JE8 A;  4MFE A;  3CCL I;  1ZN2 A;  4HF0 A;  3ZQL A;  3PQK A;  4XLF A;  4V19 K;  2CO5 A;  4LIU A;  2KIF A;  3DWL E;  3S1M J;  3DTI A;  3TW7 A;  1TTY A;  3COA C;  5J6X A;  3ULQ B;  2HOE A;  1T08 B;  4BUP A;  4RGX A;  5CJ9 A;  1LFU P;  2OCE A;  3CO6 C;  1X3W B;  1IRX A;  4UB6 C;  1U8R A;  2K9L A;  1V4R A;  4JBA A;  4MLO A;  2OD5 A;  1HDP A;  3IWZ A;  3GXO A;  1UFM A;  3KFW X;  3R61 A;  5F27 A;  2DFI A;  4A5N A;  3DKW A;  2P5V A;  3K1M A;  2EB7 A;  1R58 A;  4CCO A;  1J59 A;  2FF4 A;  2HKX A;  4XRM A;  5LHG A;  1VQ6 I;  1J75 A;  2EIK H;  1A6I A;  3FHN A;  4WK8 F;  2DU9 A;  2KT0 A;  4BQN A;  3D5R C;  4M3B A;  1D3Y A;  3I4P A;  4B3X A;  5IP9 J;  4NC8 A;  1FOY A;  3HPG A;  4G12 A;  1A36 A;  2A5W A;  5E3O A;  4OAY A;  1MIJ A;  5E1Z B;  1V5F A;  1L3L A;  3FM5 A;  2JA6 J;  2Z3Y A;  5F1R A;  3L2Q A;  1UMQ A;  2LK2 A;  3OY9 A;  4O5V A;  4HQM A;  2WY7 Q;  4LFU A;  5BOX A;  3DP7 A;  2YPR A;  4P9F A;  4RM2 A;  2MLG A;  4ENJ A;  5JR3 A;  1BW5 A;  3LL7 A;  2RRE A;  5FFZ A;  5B5E C;  1Z7U A;  2V1N A;  3ONQ A;  4JK1 X;  1HF0 A;  1F4K A;  3LQR A;  1NG7 A;  1ERD A;  3DEW A;  2KMU A;  4BU2 A;  1A31 A;  2FJ1 A;  4GFB A;  4A3E J;  1YRN A;  1SFU A;  2M0C A;  1ONV A;  3OYL A;  4YFK F;  4EGY A;  1J0R A;  2JVG A;  1A5J A;  3R6S A;  1D1C A;  2W84 A;  5LD2 C;  2FXA A;  4IHX A;  1O57 A;  2LRE A;  3U2R A;  1OIS A;  2QLZ A;  1XGM A;  3A03 A;  3QP5 A;  4EJW A;  3MMY B;  3E0J B;  1ENH A;  1LVK A;  1Q1H A;  1W4M A;  5CLS A;  2RGV A;  3KP5 A;  2XAU A;  4IRG A;  2F5D A;  2QKM B;  3DKY A;  2COM A;  1IGN A;  3PSI A;  2IA2 A;  2BW3 B;  3LWF A;  4N4O B;  2R7X A;  1D1A A;  2K02 A;  1G3Y A;  1R1V A;  1DU0 A;  4IQ4 A;  2LBF A;  2HZD A;  2R4G A;  1R1T A;  1IO2 A;  1IV6 A;  1ZAO A;  3PFY A;  1Y0N A;  3OL4 A;  1I39 A;  5J1R A;  5IOY A;  2M45 A;  1EH8 A;  2DDA A;  3QOD A;  4BJ6 C;  5GTH C;  1JHF A;  5EDN A;  2LF7 A;  2RQQ A;  3IP4 B;  3QYE A;  2KRF A;  1XMK A;  2VBX A;  3ASN H;  5EGO A;  1IJW C;  4CCL A;  1YHQ I;  1YG2 A;  4A3B J;  3MEX A;  1R4M B;  1ZLK A;  2HQ5 A;  4E7L A;  4U0V A;  2WB1 N;  1W0T A;  1AOY A;  3EQL F;  1KON A;  3OV8 A;  2AXT C;  2R93 J;  4M6X A;  3HKZ A;  2LR8 A;  2E2H J;  3WE2 A;  3R0A A;  2V9P A;  1U3E M;  3RIR A;  3HYI A;  5DCM A;  2DA6 A;  2DOA A;  2A61 A;  2ZXI A;  1GV5 A;  4LB5 A;  1DPU A;  4PUS A;  5D8L B;  2O3F A;  5LGN A;  1MJB A;  3I55 I;  4CYD A;  4FAS D;  2LP0 A;  2Z33 A;  3E6M A;  5ICG A;  1FT9 A;  3MCZ A;  1N75 A;  1PUE E;  2BHY A;  2IW5 A;  1E3H A;  2MAB A;  2L3D A;  3FHZ A;  2EH3 A;  3LA2 A;  1Y8Q B;  3FZV A;  1LFB A;  1LUJ B;  2EV0 A;  3L09 A;  4HV6 A;  5AIP A;  1AKH A;  3MKY B;  5IPA A;  4BKX A;  1TQI A;  4CXF A;  1IUY A;  2JTV A;  3ZOB A;  3TDZ C;  2CYY A;  1O7F A;  1XMA A;  4RAF A;  2H1K A;  3D0S A;  4UV9 A;  4MTD A;  5DDG A;  2Z1D A;  2OTL I;  1B8I A;  2LY2 A;  4M9S A;  2B0L A;  1UHS A;  1XGN A;  4HF1 A;  4D7M A;  5IOZ A;  1DQU A; 
#chains in the Genus database with same CATH homology
 1GXQ A;  4YII A;  3JTH A;  3CTA A;  2DO7 A;  4B09 A;  2XAQ A;  1QBJ A;  4FX4 A;  1KYZ A;  1TQP A;  3E6B A;  2L4A A;  1BBY A;  4EVI A;  4OMY A;  1ZG1 A;  1V3F A;  3KZZ A;  1SD4 A;  2IPQ X;  2QYO A;  4BXU A;  4L0Y B;  2OZ6 A;  1T0F A;  1FP1 D;  3CLO A;  2NAZ A;  3DEU A;  5HDK A;  1PP7 U;  1R5H A;  1MDM A;  3HSF A;  1KGS A;  1GVJ A;  2M1B A;  1PDN C;  5A2Q K;  3WTZ A;  3ZN0 A;  2IVM A;  1U5T A;  4AIK A;  3H92 A;  2DW4 A;  3EUH A;  2EV6 A;  1P4W A;  3V8J A;  1I1G A;  3K9T A;  3J80 K;  3VFZ A;  2HQN A;  3I64 A;  3BZ6 A;  2PBI A;  2CW0 F;  4A0Z A;  3M8F A;  4FX0 A;  3E6C C;  3ZQ7 A;  4U88 A;  2RKH A;  5E20 A;  3BRO A;  2A68 F;  2OZU A;  5TJJ A;  2F5F A;  3I53 A;  4ZYE A;  1UHW A;  1H0M A;  5DV5 A;  1MGT A;  3WE3 A;  4RB3 C;  1DDN A;  1STZ A;  3F8F A;  3BP8 A;  3EET A;  4BHP A;  2A5Y B;  5F64 A;  3CUQ C;  3NQO A;  1YO5 C;  4EGZ A;  3BJO A;  1R5G A;  4N9I A;  3QPH A;  2W57 A;  4ESJ A;  4GGG A;  4LK1 F;  2PFB A;  2V79 A;  3W6K B;  4O6J A;  4M71 A;  1TW2 A;  1J5Y A;  2PQ8 A;  5D4R A;  1IN6 A;  1JGS A;  4GYG A;  3KP4 A;  1EH7 A;  3LAJ A;  1ODD A;  1SMT A;  2RNJ A;  3U1D A;  5HOO A;  2VOD A;  3DPT A;  1W5S A;  4Q47 A;  4YFN F;  4BH9 A;  3KET A;  4KIC A;  2JPB A;  1XGS A;  4WF2 A;  4AD9 A;  1RIO H;  3MQ0 A;  5LEK A;  2M87 A;  1YFH A;  4QLC U;  3REO A;  3E97 A;  5K1Y A;  1HKT A;  4HX4 A;  2DI3 A;  5L3G A;  2P6T A;  3B02 A;  1LB2 A;  2EK5 A;  5L3B A;  2IRF G;  4Y17 A;  1BC8 C;  1R36 A;  2DPD A;  1FSH A;  3FXR A;  4LB6 B;  3BJA A;  4OMZ A;  2DQR A;  3HUG A;  5LGU A;  3F22 A;  1IAW A;  2EFW A;  3E6D A;  2ZJ2 A;  2MC3 A;  4FHT A;  4L0Z B;  2HQR A;  5BMZ A;  2H09 A;  3IC7 A;  4UXN A;  3W6J B;  4PDK A;  1SAX A;  2A07 F;  4G7H F;  4R8H A;  2VE8 A;  2FBK A;  3P9C A;  5ICF A;  4KIB A;  4Q5S F;  2P4W A;  4BNC A;  2DK5 A;  3O2P E;  2F2E A;  5CVR A;  4U7B A;  1B1B A;  2ZKZ A;  4P9U A;  3KEQ A;  2STW A;  2GZW A;  2FA5 A;  1G3T A;  3G3Z A;  3RKX A;  2V1U A;  2QBY A;  2M5W A;  3SQN A;  1R00 A;  3RPU A;  1BN5 A;  5CYV A;  3ZMS A;  1UHM A;  3WTV C;  1TBX A;  4Z2Y A;  1B9N A;  2Q0O A;  3MWM A;  2ESN A;  4RAY A;  2L02 A;  1IRG A;  1XD7 A;  1WI9 A;  5BPI A;  2E1C A;  2NRA C;  2FEZ A;  2VBZ A;  2GIV A;  4EM1 A;  5ILU A;  1HXD A;  1K78 A;  5LRS A;  2ELH A;  4G7O F;  2XGX A;  4OIO F;  5HS7 A;  4ZZL A;  2PG4 A;  4CO8 A;  5A2Q Z;  5K5O A;  1R23 A;  1LNW A;  3M1E A;  3LFK A;  1AWC A;  1ZG5 A;  2BEO A;  3J80 Z;  4KUM A;  3C3W A;  3Q5F A;  4A5M A;  4KA4 A;  1W5T A;  1S3J A;  4I2O A;  2L54 A;  4UUV A;  4L9N A;  4MQ9 F;  3HTU A;  3KP3 A;  1F9N A;  4KMU X;  4K2E A;  4BQA A;  3WTS C;  5HDN A;  1FWZ A;  2EA2 A;  2K7L A;  1BJA A;  3T5X A;  2A6H F;  1BC7 C;  5E1W A;  2WV0 A;  4R79 A;  3IKT A;  1IXS B;  5D5V B;  2XRO A;  5JVT A;  4KYW A;  2VBY A;  2PJP A;  1KQ8 A;  1IN4 A;  1D8J A;  4RS8 A;  4Q48 A;  3EYI A;  1L0O C;  1T2K A;  2QQB A;  1C0W A;  1YTY A;  4IHT A;  3NEU A;  1HW2 A;  2PMU A;  4HDV A;  1DP7 P;  4A0Y A;  1ULY A;  2PN6 A;  3V8L A;  2FOK A;  3V7S A;  2FMY A;  1P4X A;  1KU3 A;  1HBX G;  2QM3 A;  1U5T C;  3RKW A;  5DUI A;  1MD0 A;  3I71 A;  1U78 A;  1Z1D A;  2JPC A;  4KNY A;  2STT A;  4WXD A;  4E70 A;  2XAH A;  2MLK A;  4YFX F;  2EA4 A;  3C18 A;  2WC2 A;  2YSR A;  2R3S A;  5H20 A;  2EFQ A;  3F6V A;  1RI7 A;  3GFL A;  5H6Q A;  4Y13 A;  1FSE A;  2D45 A;  3QP6 A;  3HOS A;  5JFR A;  2H6C A;  2L01 A;  4S05 A;  1R22 A;  1YQA A;  4BAY A;  2CQK A;  2VON A;  1BI3 A;  4RB0 A;  1Y0U A;  1R1U A;  2IP2 A;  2A3S A;  1ZYR F;  5TRD A;  3MFK A;  2MA3 A;  2ZNZ A;  2Z9O A;  1X3U A;  2RVC A;  4MEX F;  3SXY A;  3I54 A;  1YIO A;  3I0T A;  3WTU C;  4HV5 A;  1KU9 A;  3L7W A;  3I59 B;  4KMF A;  3DPL C;  4WXC A;  4I02 A;  1BI0 A;  1DPR A;  4BHC A;  4BYY A;  3FXU A;  2RDP A;  3P9K A;  3T8T A;  1CF7 B;  4G6Q A;  3KP2 A;  3BPV A;  1E17 A;  1W7P B;  3F23 A;  2O03 A;  3RPQ A;  1IN8 A;  3JW4 A;  4F7Z A;  1J7K A;  3ZMD A;  4ZYD A;  3TO6 A;  2ACJ A;  5CVI A;  2XIG A;  3JAM K;  3SZT A;  5EEG A;  2BBY A;  1UCR A;  3WOD F;  2PMH A;  1LEB A;  3O6B B;  1XN7 A;  4ESB A;  4OIR F;  4FT8 A;  1JXS A;  1IZ1 A;  3F8B A;  3D5L A;  4L9T A;  2JZY A;  6PAX A;  1Z6T A;  1FY7 A;  1SFE A;  2TDX A;  3L9F A;  2H6B A;  2HR3 A;  4NB5 A;  3VEP A;  4PGH A;  1A04 A;  4U0Y A;  2P7C B;  1FNN A;  1VTN C;  5LBQ A;  3IHU A;  3KZY A;  2MH9 A;  4CDG A;  4JQF A;  1H9T A;  1W7P D;  1KYW A;  4XRF A;  4HDU A;  1K7A A;  2DAO A;  4EJV A;  2EV5 A;  1WWX A;  2CFX A;  2QUF A;  2GXG A;  2OQR A;  3JTG A;  5D5X B;  4A6D A;  3V7R A;  1YW9 A;  3LA3 A;  5ILV A;  3GFM A;  3H3Z A;  1ZRC A;  3CDH A;  2VT3 A;  3AAF A;  4OOI A;  3ECH A;  4PZJ A;  1YLF A;  3EDP A;  3FXQ A;  1IF1 A;  3JSO A;  4MHG A;  4G6D A;  4EM0 B;  5ICC A;  1XDU A;  2FQ3 A;  4EV0 A;  2X0L A;  4ENM A;  4GXO A;  2LF8 A;  3QRF F;  4I09 A;  1Z05 A;  3R4K A;  1S8N A;  1FBQ A;  3K69 A;  1O3R A;  5D4S A;  3IKV A;  2JRT A;  3KLN A;  1BM9 A;  4EQQ A;  4MEY F;  4RB1 A;  4HF2 A;  1B4A A;  4PCQ A;  5L3D A;  3V7C A;  5IT3 A;  2LNB A;  1HST A;  5KK1 A;  2ZME B;  3GZ6 A;  2G7H A;  3RKY A;  4XBF A;  3GW2 A;  4BHB A;  3M7G A;  4IF4 A;  1TLH B;  3WTT C;  1FPQ A;  3DV8 A;  1KA8 A;  2NNN A;  1XSX A;  3NRV A;  4S04 A;  3LST A;  3HRT A;  3TOB A;  5HLI A;  5HLG A;  5E1X A;  2OBP A;  3Q9S A;  3MAJ A;  1U6G A;  4CGZ A;  2P7V B;  2FML A;  4IRH A;  2DPU A;  5BS6 A;  4I0A A;  1TW3 A;  4O3M A;  5DYM A;  3K1N A;  2V9V A;  2CG4 A;  5AON A;  1RZ4 A;  3J81 K;  1B9M A;  2GQQ A;  4OIN F;  1BIA A;  4ASN A;  2RV8 A;  4M73 A;  2XAS A;  3BPX A;  5CVJ A;  5AIQ A;  2JT1 A;  2AXL A;  2O6G E;  2LDU A;  5E8G A;  4IXA A;  3T8R A;  1XGO A;  3T1B A;  3HSE A;  4RGS A;  4HBL A;  3VB2 A;  1KQ0 A;  5K5Q A;  1LDK B;  5JI6 A;  5D8K B;  2O61 A;  1B59 A;  1W7P A;  3JAM Z;  1Z91 A;  2L4M A;  2QQ9 A;  3T0Y A;  3PQJ A;  4L5I A;  3TDU C;  5J8F A;  3HHG A;  3TGN A;  1FZP B;  1RUN A;  4I01 A;  1J9I A;  4MGR A;  4ZH4 F;  3GO5 A;  1LQ1 A;  4A0X A;  4HW0 A;  4M72 A;  2W25 A;  2RC4 A;  4RGU A;  2X4H A;  1T38 A;  3WU1 B;  4LLN A;  4HOB A;  3JSP A;  1IN7 A;  3GLX A;  4LK0 F;  4MQV A;  2BYV E;  5J8C A;  2EWN A;  3BJ6 A;  1H9G A;  4CIC A;  3DQV C;  4I98 B;  1D8K A;  5ICE A;  2K27 A;  2EFO A;  3CO7 C;  1BI1 A;  2XUB A;  4EJT A;  2XAG A;  2ZNY A;  1T98 A;  3QU3 A;  3GFI A;  4L9J A;  2M8E A;  5DEQ A;  4HLY A;  1O3T A;  3DF8 A;  3WGG A;  1QGP A;  3MZH A;  4HQE A;  3FM3 A;  1I5Z A;  3V4G A;  5BQT A;  4KIG A;  5HS8 A;  4ESF A;  2F5E A;  1I27 A;  1P4A A;  1F5T A;  2OA4 A;  2ESH A;  2VT2 A;  2OU2 A;  3GZ5 A;  4RAZ A;  4N0B A;  1OYY A;  1REP C;  3S2W A;  4A6E A;  1ZGA A;  4OIQ F;  4IVN A;  2CWE A;  2HDC A;  4A2U A;  5LGT A;  3F8N A;  5DD4 A;  1YS7 A;  4LGW A;  1T39 A;  1QPM A;  4LG0 B;  3WG9 A;  3N4M A;  1TNT A;  2HYG D;  2DLL A;  3HRM A;  3F8C A;  5KVR A;  1XCV A;  2M30 A;  1HW1 A;  3FMQ A;  5CVU A;  1D5V A;  1KU7 A;  3EYY A;  5IT9 K;  1USS A;  2MD5 A;  4I0B A;  1K79 A;  3HTS B;  5FGM A;  4M9X A;  5FB2 A;  1UB9 A;  2YX4 A;  5FLX K;  3KEO A;  5F6F A;  3WGH A;  4RB2 C;  3OOP A;  1MDM B;  2J5O A;  2ZME A;  4LLL A;  2C6Y A;  4YG2 F;  5ILS A;  4DQ2 A;  4XSZ F;  2HTS A;  4Q4Z F;  1U5T B;  2OQG A;  3GEZ A;  1MJA A;  4MTE A;  1BI2 A;  4UNO A;  4IHS A;  1S6L A;  5D6F A;  2VC1 A;  3HRU A;  3QOP A;  2G9W A;  3CJN A;  4P5O A;  2HKO A;  1I1S A;  2D2W A;  2KIU A;  2O0Y A;  4NHJ A;  4KDP A;  5HS9 A;  1NHA A;  4M74 A;  2NS0 A;  1FYL A;  4RGR A;  3LAP A;  1GXP A;  3J81 Z;  3BWG A;  4QWQ A;  4IJA A;  1WQ2 A;  2YU3 A;  4EMS A;  4MNU A;  1HKS A;  2FE3 A;  3GVA A;  2W24 A;  1QO0 D;  3BY6 A;  2HWV A;  4CZZ A;  1YW7 A;  3M9A A;  1S29 A;  2V1X A;  2KKO A;  3WTW C;  3F6O A;  2P5L C;  3MZY A;  1FX7 A;  3QPT A;  3FF5 A;  5BPD A;  3G73 A;  4IPA A;  4LJZ F;  1SD6 A;  2EFP A;  4HX8 A;  2KJB A;  1DUX C;  2R7D A;  1G6N A;  2A69 F;  5CVV A;  2XAJ A;  3H3U A;  5E18 F;  2ADU A;  3M8E A;  2K4J A;  3RDI A;  2WWY A;  1ZLJ A;  1WSU A;  1GHC A;  3Q9V A;  4LD5 A;  1QNT A;  3LA7 A;  2HS5 A;  5JHU A;  1OR7 A;  4UVC A;  1G3S A;  1MZB A;  4P96 A;  1MJ9 A;  4CHU A;  1P6R A;  2GXB A;  5L3E A;  1O3S A;  3F3X A;  1Z6R A;  3ZN1 A;  2GAU A;  3RJP A;  3ZMV A;  3F8M A;  4GO1 A;  3VOE A;  4NQW A;  1KU2 A;  3KP7 A;  1RUO A;  2RQP A;  5LRR A;  1OPC A;  3SZP A;  4G8X A;  1ZG3 A;  1YYV A;  4R1H A;  3KE2 A;  1IXC A;  5FD6 A;  4GCV A;  4DNC A;  2V6C A;  2GA1 A;  4L18 B;  2PEX A;  3SFZ A;  2UZK A;  3WU0 A;  1LVA A;  4ENK A;  3ZMT A;  5FO5 A;  2K86 A;  2IA0 A;  4OU0 A;  1HQC A;  4XLP F;  3ZMZ A;  4ENN A;  1UST A;  2MH2 A;  4AIJ A;  2A6E F;  3SHF A;  1R7J A;  4L5J A;  2HTJ A;  1P92 A;  4XSX F;  2P5K A;  3E5U A;  2RN7 A;  1CGP A;  3K2Z A;  4AIH A;  4UVB A;  4N9H A;  3RYP A;  3IRR A;  2QBY B;  3I58 A;  5D5W B;  1IW7 F;  2DTR A;  2HGC A;  4KN7 X;  2Y0M A;  1MKM A;  1SMY F;  2QEN A;  1U2W A;  2PI0 A;  3BDD A;  1SD5 A;  4UV8 A;  2BV6 A;  4LG0 A;  4EJO A;  5IT9 Z;  2FBI A;  3ABU A;  1QZY A;  3KLO A;  3PFI A;  3F21 A;  2KJC A;  3HIF A;  4G94 A;  1ON2 A;  1K78 B;  2O8X A;  4I7H A;  5FLX Z;  2E7X A;  2Z5U A;  3BOQ A;  4B8X A;  4WX9 A;  2YX7 A;  3DXJ F;  3ROU A;  2HYF A;  2G7U A;  2FNA A;  2V1D A;  3I5U A;  1FP2 A;  5ED4 A;  5EEH A;  1LDD A;  1S7O A;  3V8K A;  2HZT A;  1SFX A;  4WCG A;  2Q8K A;  5LEJ A;  2XV4 S;  1T6S A;  2NNY A;  1TQM A;  4ON0 A;  1LJ9 A;  3RI4 A;  4A12 A;  2XAF A;  3CUQ B;  3KCC A;  1LDJ A;  1HSJ A;  4XLN F;  4ZZD A;  2Q2E A;  3O3K A;  3L2C A;  2DK8 A;  4Y15 A;  1OYI A;  1G3W A;  2JSC A;  4HAM A;  3R60 A;  4LMY A;  3TQN A;  1BOA A;  4PGG A;  2YR2 A;  2VC0 A;  2Y48 A;  4D0P A;  2BGC A;  3HOT A;  1OMI A;  1RNL A;  3GYH X;  2ZXJ A;  1HW5 A;  5HDG A;  2XRN A;  1FYK A;  4UVA A;  4AWX B;  1BIB A;  2P6S A;  2CGP A;  4ZYH A;  4U0W A;  3QU6 A;  2K4B A;  2UWM A;  1IRF A;  4EM2 A;  3U9G A;  2Y75 A;  5HVQ C;  2VE9 A;  5K5R A;  1P2F A;  2E1N A;  3FWE A;  2VXZ A;  1FC3 A;  2VBW A;  2D1V A;  1ON1 A;  2LSO A;  4HX7 A;  5H6R A;  3ERE D;  1Z9C A;  4WWC A;  2XKP A;  2CSO A;  1B6A A;  1KQ9 A;  3GX4 X;  3TO9 A;  3FX3 A;  2PLY A;  5L3C A;  1G4D A;  4EJU A;  1IN5 A;  1O3Q A;  1S7A A;  3C7J A;  5FD5 A;  3TO7 A;  2XKO A;  3DFG A;  5L3F A;  3E5X A;  4WXH A;  1EV7 A;  1WRJ A;  3I59 A;  1XCB A;  1FYM A;  3RYR A;  3LQQ A;  3ABT A;  4KFC A;  1SD7 A;  3IRQ A;  2GA2 A;  3HRS A;  2VN2 A;  3IL2 A;  4G7Z F;  2FNP A;  2ISY A;  2HEO A;  1CF7 A;  5E17 F;  1PP8 F;  3WTY C;  3IWF A;  4HA8 A;  3K1P A;  4LLG F;  3WGI A;  3CUO A;  1ZRE A;  1ZAR A;  5DCF A;  3B73 A;  5DUK A;  1XSD A;  4ETS A;  5LHH A;  2ZCW A;  2DBB A;  1ZGJ A;  2R7F A;  2E7W A;  2HFH A;  2FRH A;  1WKM A;  4OIP F;  2LKP A;  2XHK A;  2FU4 A;  4P55 A;  2EFN A;  2ISZ A;  2UXN A;  1XSV A;  3J7A O;  2IJL A;  2ZBK A;  4KN4 X;  4HYE A;  3GUD A;  2AS5 F;  2XVC A;  3F72 A;  1J2X A;  1K6O A;  5HLH A;  1YS6 A;  2Z99 A;  5E8I A;  5LLQ A;  4H0E A;  2MBF A;  2UXX A;  2DQL A;  3ECO A;  3E3V A;  1E2X A;  1FOK A;  2ZO4 A;  5DCM B;  3R0J A;  3K0L A;  4M9Z A;  2W85 A;  3ZMU A;  4ZYG A;  1QZZ A;  3E5Q A;  4IRI A;  4U7D A;  4GYI A;  2FSW A;  1FLI A;  2H94 A;  5ERI A;  1ZHF A;  3P7N A;  4HZF A;  3P9I A;  1JHH A;  3TKY A;  1LEA A;  4YIF A;  1HKQ A;  1QQI A;  2QWW A;  4AVP A;  1F1Z A;  2FBH A;  3RTR A;  3WTX C;  2EJR A;  3ISP A;  2NYX A;  2ETH A;  4HLX A;  2H27 A;  2IA1 A;  1O7L A;  2GWR A;  2F5C A;  5LHI A;  3QAH A;  4TV7 A;  4L9V A;  3C1D A;  3HHH A;  1ZRF A;  5D5U B;  3GF2 A;  2OAZ A;  4G9Y A;  4KIF A;  1TNS A;  1XDS A;  3L00 A;  4UHT A;  2DT5 A;  3FMS A;  1ZRD A;  3GFJ A;  3CUQ A;  3HSR A;  3VOD A;  1EH6 A;  1I6X A;  2QZ8 A;  2J5P A;  2D1H A;  4M6Y A;  2WTE A;  3GWZ A;  1OYW A;  2QQA A;  1XB4 A;  5DD8 A;  3ML6 A;  2KIM A;  1IXR C;  1ZH5 A;  5D6E A;  2P8T A;  2VOO A;  2BE5 F;  2ZFW A;  1FBU A;  1OKR A;  3FMR A;  1YW8 A;  1FBS A;  2IT0 A;  3TOA A;  5FFX A;  3KP6 A;  2QVO A;  3ZPL A;  4KT5 C;  2VOP A;  3N97 A;  3ZP5 A;  3ELK A;  1JE8 A;  1ZN2 A;  4HF0 A;  3PQK A;  2CO5 A;  2KIF A;  1TTY A;  3COA C;  5J6X A;  3ULQ B;  2HOE A;  4RGX A;  5CJ9 A;  3CO6 C;  1U8R A;  1V4R A;  4JBA A;  2OD5 A;  3IWZ A;  3GXO A;  1UFM A;  3KFW X;  3R61 A;  2DFI A;  4A5N A;  3DKW A;  2P5V A;  3K1M A;  2EB7 A;  1R58 A;  1J59 A;  2FF4 A;  2HKX A;  5LHG A;  1J75 A;  4WK8 F;  2DU9 A;  1D3Y A;  3I4P A;  5E1Z B;  1L3L A;  3FM5 A;  2Z3Y A;  5F1R A;  4O5V A;  4HQM A;  4LFU A;  5BOX A;  3DP7 A;  2YPR A;  4P9F A;  4ENJ A;  2MLG A;  5JR3 A;  5FFZ A;  1Z7U A;  4JK1 X;  1F4K A;  3LQR A;  1SFU A;  1ONV A;  4YFK F;  4EGY A;  1J0R A;  3R6S A;  2W84 A;  2FXA A;  1O57 A;  3U2R A;  2QLZ A;  1XGM A;  3QP5 A;  4EJW A;  1Q1H A;  1W4M A;  5CLS A;  2RGV A;  3KP5 A;  4IRG A;  2F5D A;  2COM A;  2IA2 A;  3LWF A;  2K02 A;  1G3Y A;  1R1V A;  1R1T A;  1ZAO A;  2M45 A;  1EH8 A;  1JHF A;  2LF7 A;  2KRF A;  1XMK A;  2VBX A;  1YG2 A;  3MEX A;  1ZLK A;  4U0V A;  1AOY A;  3EQL F;  3OV8 A;  4M6X A;  3WE2 A;  3R0A A;  1U3E M;  3RIR A;  3HYI A;  5DCM A;  2A61 A;  4LB5 A;  1DPU A;  5D8L B;  2O3F A;  5LGN A;  1MJB A;  4CYD A;  2Z33 A;  3E6M A;  5ICG A;  1FT9 A;  3MCZ A;  1PUE E;  2IW5 A;  2L3D A;  3FHZ A;  3LA2 A;  3FZV A;  2EV0 A;  3L09 A;  4HV6 A;  5AIP A;  1TQI A;  4CXF A;  1IUY A;  2JTV A;  3TDZ C;  2CYY A;  1O7F A;  1XMA A;  3D0S A;  4UV9 A;  4MTD A;  5DDG A;  4M9S A;  2B0L A;  1XGN A;  4HF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...