4ENKA

Crystal structure of s. pombe atl1 in complex with damaged dna containing o6-propylguanine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Alkyltransferase-like protein 1
publication title Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 29
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4enkA00
2A68F 2H6BA 2W57A 3HRTA 3T1BA 3V7RA 5D6EA 3RKWA 1XGNA 2Z99A 1SFEA 1ZN2A 1KYZA 2EV5A 1H0MA 2EJRA 1MJBA 2A6EF 2LSOA 2PI0A 4I7HA 1FLIA 1XSDA 2ZKZA 2VT3A 4A0XA 3ZMVA 5D8KB 3HSRA 1YW8A 3MWMA 3GF2A 1S3JA 3U9GA 4MTDA 1XGSA 2WWYA 1MDMB 1ZLKA 2YSRA 1LQ1A 1R1VA 3F6VA 3RJPA 1B9NA 1G3YA 3GVAA 3BY6A 4A0ZA 3QOPA 2A61A 2P8TA 2IPQX 3ECOA 1QNTA 5JVTA 5E17F 4KMUX 2DLLA 1YYVA 2OZUA 5FD5A 3G73A 4RGSA 1S7AA 2Y0MA 3WU0A 2FF4A 4FX4A 2HS5A 4UV8A 1XSVA 2Z3YA 4KA4A 1F4KA 2EFPA 2IP2A 4IRHA 4Q5SF 4I0AA 1CF7B 2PFBA 2O6GE 4M9ZA 1LVAA 3KP4A 1J7KA 2H94A 1DPUA 2P7CB 2GXBA 4L9TA 5HLGA 5FB2A 2UXXA 4DQ2A 1JHHA 4HOBA 1D8JA 2XUBA 4HQEA 2STTA 1WI9A 2KJBA 3F8BA 4HAMA 4EGYA 4CHUA 2A3SA 5LRSA 3QAHA 1GXQA 1SMYF 2VT2A 5ILSA 1CGPA 4CGZA 1ZARA 4CYDA 2DPUA 4NHJA 1MJAA 3I53A 5K5RA 1XN7A 1I5ZA 3E97A 4PDKA 1W7PD 3WTUC 2MH2A 1TTYA 1SD5A 2OBPA 2DK5A 2KRFA 3EETA 3O3KA 5FGMA 3ECHA 4PGGA 1PDNC 3NRVA 2P5LC 1IN6A 4K2EA 4BNCA 4EMSA 2RN7A 4KUMA 1XGMA 4D0PA 3ULQB 2XAGA 2R7DA 1U8RA 4HF0A 5CVIA 5H6QA 1TQPA 1XB4A 2P5VA 4XLPF 3ERED 3SHFA 3K1MA 2MA3A 4HLYA 4LMYA 4ENMA 2VBXA 2XHKA 1WSUA 5ICGA 4EJVA 3FMRA 1S29A 2K4JA 5D5WB 1SD4A 5KK1A 4KDPA 3CO6C 1G4DA 3WODF 2W84A 2ZNYA 1K79A 2W24A 2E1CA 2LF8A 5D4RA 2VONA 4EJOA 1BBYA 3LWFA 4U7BA 3GO5A 5ERIA 1I6XA 5IT3A 4G94A 4EJTA 3F21A 5HDNA 2XVCA 4G9YA 1BIBA 1T38A 1OKRA 3C3WA 4MHGA 3GZ5A 4HQMA 5AIQA 1AWCA 4UHTA 1YO5C 5DEQA 2FSWA 3WTXC 1IN8A 2XIGA 2KIFA 3WTZA 3H92A 2BGCA 5L3DA 3VFZA 5J6XA 1P6RA 1F9NA 4ESBA 4AD9A 3CO7C 2VXZA 3CDHA 3F8MA 3HHHA 3BOQA 3DPTA 3RI4A 1ULYA 3KZZA 4ESJA 1DDNA 5FO5A 1R5HA 5F6FA 4LGWA 4HA8A 4N9IA 1YIOA 1P2FA 2MLGA 3J80K 3F23A 4HF2A 3WTVC 3GYHX 2EWNA 1O57A 4I2OA 4QWQA 3F6OA 2L02A 2ZMEB 2EA2A 1FBQA 3REOA 4R1HA 4P55A 5FLXK 3E5UA 5D5VB 3M8EA 1IW7F 2MC3A 2GXGA 3F8CA 2Q8KA 3QRFF 3Q5FA 3K69A 1V3FA 1FOKA 1L3LA 2FU4A 4XLNF 4LLNA 1J5YA 1TQMA 2L01A 4AWXB 2FXAA 1IAWA 4LFUA 1IRGA 2GQQA 3BPXA 4YFXF 3GW2A 3MFKA 2RGVA 3WGHA 5F64A 5CVVA 1ZH5A 1AOYA 1K78B 4RS8A 5LEJA 2PN6A 2GA2A 3JTHA 3P9KA 4BH9A 3F8NA 4OIOF 5D8LB 3EDPA 1U6GA 2LF7A 3KETA 4EVIA 3GFJA 2CYYA 2PMHA 3QU6A 3EQLF 2M5WA 4S05A 4ZYGA 2QVOA 4A0YA 4L0ZB 1SD7A 1PP7U 2M30A 2ESHA 5J8FA 4YFKF 3QP6A 4M6XA 1VTNC 1A04A 2VOPA 3K2ZA 3U2RA 4E70A 3IHUA 2LDUA 4OMZA 5FD6A 2EFWA 3R0JA 4ASNA 3GEZA 2RNJA 1YS7A 4A6DA 4O3MA 1ZYRF 2FE3A 2L4MA 5E20A 1D8KA 1YW7A 4RB2C 5DYMA 4HLXA 2VC0A 3DFGA 2FA5A 2QBYB 1I1SA 1E2XA 3B73A 4KMFA 1FSHA 1QO0D 1WRJA 1HW5A 2B0LA 1V4RA 2F5CA 3OV8A 3ZQ7A 3CUQB 1RNLA 1O3SA 2H09A 1W5TA 3KZYA 2FRHA 2XAJA 3BP8A 2Y75A 1IF1A 2NYXA 3ISPA 3I71A 2DT5A 4IHTA 2QQAA 4RGXA 3HOSA 1MKMA 2QQ9A 2VC1A 3O6BB 3BPVA 2Z33A 2HGCA 3HSFA 4EM1A 4MTEA 3DF8A 3I5UA 1T39A 2HTSA 1GXPA 2QUFA 3LA2A 5E1XA 2O03A 3IC7A 1FX7A 4RB0A 5ED4A 2IA2A 3SXYA 2QENA 4ZYHA 3JAMZ 3J81Z 2NNNA 3KP5A 4IVNA 5TJJA 3TGNA 1K7AA 1HW2A 1WKMA 2XRNA 1HSTA 4ZYDA 4RAZA 3V8LA 3ZP5A 2FBHA 2PJPA 1UCRA 1J2XA 2FBKA 1GHCA 4OIRF 2Y48A 2AS5F 4BYYA 2ZNZA 1MJ9A 5BQTA 3QPHA 2TDXA 3WTTC 4IHSA 3IWFA 3F3XA 3H3ZA 4Q47A 3S2WA 1I1GA 5HLIA 2K02A 3HYIA 3HUGA 2E1NA 1RZ4A 2P6SA 4O5VA 3I4PA 3RPQA 1FC3A 4BHPA 2KIMA 4I02A 1KU3A 4CZZA 4LJZF 2F5FA 4R8HA 2DBBA 2L3DA 1ZHFA 4UXNA 5HS7A 2BV6A 4HV5A 4NQWA 4G6DA 1BN5A 5CYVA 2KIUA 1W5SA 1H9GA 1UB9A 2VN2A 3ZMTA 1UHWA 4B09A 3L2CA 4WX9A 5BOXA 4MGRA 1R1TA 1XMAA 1Z6RA 1NHAA 3CJNA 4BHBA 2YX4A 1HQCA 1JHFA 4Q4ZF 2XKOA 3VOEA 5JHUA 3NQOA 3TOBA 4G6QA 5K5QA 2RVCA 4L18B 4ENKA 3FWEA 4L5IA 4MEXF 2KKOA 3C7JA 4N0BA 1YTYA 2G7HA 1XD7A 4UVCA 1STZA 5L3BA 1ZRCA 5D5UB 1FBUA 1FP2A 2STWA 3MAJA 1Y0UA 5A2QZ 3F72A 3GWZA 1IXSB 1ODDA 1BI3A 4I98B 5BMZA 5D5XB 2MD5A 4BQAA 2A07F 1G3WA 4MQ9F 5LHGA 2O0YA 2PBIA 3K1PA 4KFCA 1T2KA 3R61A 5DDGA 2WC2A 3E3VA 3KLNA 4U7DA 1ZG3A 3I64A 2PEXA 3KFWX 4LG0B 2DFIA 4G7OF 2K4BA 2K27A 2M45A 2P4WA 4WXCA 4GYIA 1USTA 4HDUA 2CW0F 5FFZA 1BI0A 1LDKB 2X0LA 1R23A 1ZG5A 3MQ0A 1LNWA 1R00A 2Q0OA 2EB7A 4BAYA 5E8GA 2JT1A 4WXDA 3R0AA 4BHCA 1HXDA 1IN4A 3BJ6A 1SFXA 3KLOA 1DPRA 5LLQA 1SFUA 3F8FA 2O3FA 2ISZA 2JZYA 5DUKA 1UFMA 2FMYA 4M71A 4L9JA 1WWXA 2G9WA 3GFLA 1F5TA 2BBYA 5BS6A 1XMKA 3GUDA 2NAZA 3WU1B 4IJAA 3MEXA 4H0EA 1W7PA 3ZMDA 4MEYF 3LA7A 4EJUA 1HKSA 3WTWC 3I59A 2CWEA 1CF7A 2YX7A 3AAFA 1EH8A 2Z9OA 2YPRA 5BPDA 2XV4S 3FZVA 2FEZA 4L9NA 3GX4X 1FYKA 4ZH4F 4OU0A 4LLLA 1U5TB 1TW2A 5LGUA 2GWRA 1R58A 3H3UA 3V8JA 1EH6A 4U0YA 4GYGA 2QM3A 4Z2YA 2ZBKA 4RGUA 4GXOA 2GZWA 3SZTA 1T0FA 4HF1A 1W4MA 2MBFA 2FQ3A 4IF4A 5EEGA 1XCVA 4JK1X 4RAYA 2XGXA 2R3SA 1QZZA 2GAUA 4RGRA 3TDUC 4XSXF 1IRFA 4HZFA 1XDUA 1BJAA 1Z05A 1U5TC 4G7HF 4NB5A 1FY7A 3HRUA 1ZRFA 3WGGA 4OMYA 4LLGF 2PG4A 3OOPA 5LRRA 2H27A 5HS8A 3SFZA 1O3RA 3I54A 5J8CA 3IKTA 5DV5A 1DP7P 2IRFG 1KU9A 1YG2A 3N4MA 2EFOA 1LEBA 2A5YB 5HLHA 4KICA 3KCCA 2IT0A 5JR3A 3C18A 2OD5A 1B9MA 2PQ8A 1KU2A 3P9CA 3R6SA 4AVPA 1FNNA 2XAFA 2V1XA 5ICCA 3E6MA 2JPCA 5IT9K 3CLOA 1K6OA 1YS6A 4RB3C 2ISYA 4ENJA 1TNTA 1YW9A 1C0WA 1JXSA 2FMLA 2M8EA 4Y13A 1UHMA 5AONA 2DO7A 1HBXG 4ETSA 2JTVA 2OQGA 3ML6A 3LAPA 2OAZA 5DD8A 5DUIA 2VBZA 3B02A 3MZYA 5K5OA 3GFIA 2XROA 3L9FA 5HS9A 4WWCA 4ENNA 1IXCA 2EFQA 2HDCA 1XDSA 2ZO4A 2QWWA 1RI7A 3ZN0A 2HQNA 2D1VA 1KA8A 2W25A 4I01A 3FHZA 2ZCWA 4S04A 4U0WA 3VB2A 1R1UA 1O3TA 5ILVA 4AIKA 2ADUA 2V9VA 2HZTA 3FMSA 3L7WA 1U2WA 3LFKA 2O8XA 2IA0A 4HX8A 2UXNA 2XASA 4I0BA 1B6AA 3C1DA 4GGGA 1QGPA 2G7UA 1FYLA 1T98A 1Q1HA 2HQRA 1KU7A 1ZREA 4OIQF 1Z7UA 5EEHA 2ETHA 4LK1F 3DEUA 3DXJF 3CUOA 1LDJA 3IKVA 1MGTA 3IL2A 3RYPA 3F22A 1FP1D 4U0VA 1TNSA 1QZYA 3RDIA 4OIPF 3JAMK 2AXLA 3GFMA 2HOEA 2QYOA 3W6JB 3WGIA 1SMTA 3QP5A 3SZPA 3JTGA 1IUYA 4KN7X 4WXHA 1HSJA 3DV8A 5LHHA 1P4AA 1ON1A 4A12A 3W6KB 2D45A 1ZRDA 2D1HA 3KP7A 2P5KA 1I27A 1LDDA 3CUQC 5F1RA 1P4WA 4PZJA 1B59A 1G3TA 3E6DA 3WE3A 3BWGA 1TLHB 1IN7A 1ON2A 3FF5A 1XSXA 1B1BA 2V1UA 3BJAA 1J9IA 4UVBA 3TQNA 4M9SA 4M6YA 3PFIA 1FYMA 3FX3A 4ESFA 3CTAA 3TO7A 1S7OA 2XAQA 2ELHA 3M8FA 3WE2A 2V79A 1MZBA 2OU2A 2HKOA 4B8XA 3WTYC 4UV9A 1EV7A 1FSEA 4AIHA 4GCVA 2CFXA 1HKQA 3E6CC 1FZPB 2BE5F 2W85A 3FXUA 2UWMA 3G3ZA 5HDGA 1OPCA 5TRDA 2R7FA 2EFNA 3P7NA 2Q2EA 3Q9SA 3QU3A 3ROUA 2OZ6A 2QQBA 3K9TA 3BDDA 3NEUA 1YLFA 4ZZDA 3D0SA 4UNOA 5FFXA 1TQIA 1TW3A 2HTJA 2O61A 3T0YA 2A6HF 2LKPA 1S6LA 4M74A 1JGSA 1WQ2A 5E1WA 1T6SA 4CO8A 3K1NA 3KEOA 5E8IA 5ILUA 2GIVA 2WV0A 1BI2A 2JRTA 5A2QK 1FT9A 3E5QA 4EM0B 2CSOA 1U78A 5DCMA 5CJ9A 4IRIA 2E7WA 2VE9A 4ZZLA 3LAJA 1KYWA 5HVQC 4XSZF 1RUNA 5ICFA 4YG2F 2E7XA 5LHIA 5H6RA 1HKTA 1QPMA 2F2EA 4M72A 3IRQA 2QLZA 1QBJA 2XAHA 1QQIA 4LK0F 5CVJA 2NNYA 1OYIA 3FMQA 2HYFA 2HR3A 1R36A 4FHTA 3FM5A 4CDGA 1W7PB 1JE8A 3T8RA 4L5JA 3T8TA 3BZ6A 3KP3A 1H9TA 4MQVA 1OMIA 3I59B 2DW4A 1R5GA 4KT5C 4YIIA 3VODA 2YR2A 3SQNA 4MNUA 1Z1DA 3GXOA 2COMA 3E6BA 4IRGA 2CGPA 3K0LA 4EM2A 4EV0A 5E18F 2OA4A 4EJWA 2JPBA 4Q48A 4TV7A 3O2PE 2BEOA 3U1DA 1OYWA 3ABTA 5HOOA 1F1ZA 2RV8A 1MDMA 4I09A 3MZHA 3V4GA 3HIFA 1R7JA 5L3CA 5LEKA 2DQRA 1Z9CA 1Z6TA 3HHGA 2HFHA 3J7AO 1R22A 3ZMZA 2EV0A 3KP2A 4ON0A 1BIAA 1L0OC 3DPLC 4WCGA 4IPAA 5BPIA 2V6CA 1IXRC 1FBSA 1FWZA 2Z5UA 3HTSB 2XKPA 3M9AA 2LNBA 3V7CA 2K7LA 1LEAA 4WF2A 1Z91A 1BOAA 2J5OA 2DQLA 3ABUA 3T5XA 4AIJA 1P4XA 2VBYA 3ZMUA 2QZ8A 4M9XA 4HX7A 3PQJA 3BROA 2IJLA 2WTEA 1EH7A 4BXUA 3M7GA 3TOAA 2FOKA 1REPC 4P5OA 2DTRA 2DPDA 2EK5A 4WK8F 1ONVA 2DAOA 4KIFA 1ZGAA 4OINF 3RKYA 1IZ1A 3KE2A 3FXQA 4L0YB 2ZJ2A 4LG0A 5CVUA 2FNAA 2DK8A 3HRSA 4XBFA 4M73A 1YQAA 3D5LA 4P9UA 1BC7C 3EUHA 4ZYEA 2HYGD 2L4AA 2L54A 4P9FA 3ELKA 3RTRA 3DQVC 4Y17A 2IA1A 3V7SA 3P9IA 3VEPA 5L3GA 4G7ZF 5AIPA 4KNYA 5DCFA 4KN4X 4GO1A 2EV6A 3HOTA 1XGOA 4DNCA 4YIFA 1KQ0A 3Q9VA 4PGHA 4LB5A 5L3FA 5E1ZB 1U3EM 4F7ZA 2M1BA 2PMUA 4LD5A 4HV6A 3PQKA 1SD6A 2RKHA 1MD0A 2JSCA 2C6YA 4R79A 1USSA 2MH9A 2FBIA 3JSOA 1IN5A 1S8NA 2J5PA 3FXRA 2DU9A 2OQRA 4EQQA 1B4AA 5D6FA 4A6EA 6PAXA 1OYYA 2UZKA 3E5XA 3TKYA 2CO5A 2YU3A 1J75A 1HW1A 2HEOA 2NS0A 4U88A 1KQ8A 5L3EA 1X3UA 3RPUA 4HDVA 3FM3A 4LB6B 4EGZA 3R4KA 4IXAA 1U5TA 3MCZA 1TBXA 5H20A 1GVJA 3HTUA 2P7VB 3J80Z 3RIRA 4FX0A 3M1EA 2X4HA 4KIGA 3WG9A 4G8XA 5FLXZ 2HWVA 2M87A 3RKXA 5IT9Z 1D3YA 4CICA 3LSTA 1KGSA 3EYYA 5D4SA 1YFHA 1O3QA 3HSEA 1PUEE 1SAXA 2ACJA 2K86A 5LGTA 4YFNF 4RB1A 1G6NA 1XCBA 3L00A 3KEQA 2CG4A 5DD4A 2A69F 1D5VA 1OR7A 3LQRA 2GA1A 3LQQA 2H6CA 3N97A 2IW5A 2PLYA 3DKWA 5JI6A 1ZGJA 5LGNA 2ZMEA 5KVRA 4OOIA 4HW0A 3ZN1A 2F5DA 2MLKA 1E17A 2DI3A 3COAC 4A5NA 5CVRA 2NRAC 1DUXC 2VOOA 3V8KA 1RIOH 2ZXJA 4QLCU 5ICEA 3ZMSA 5LBQA 1ZLJA 3ZPLA 4PCQA 1LJ9A 3TO6A 3J81K 4JQFA 1LB2A 3JSPA 3IRRA 1BI1A 2KJCA 2RC4A 3BJOA 3I58A 2ZFWA 4CXFA 4HBLA 3RYRA 3TO9A 3KP6A 1K78A 3LA3A 4P96A 2EA4A 2RQPA 4HYEA 1PP8F 1P92A 3JW4A 1ZAOA 4N9HA 4A2UA 2VE8A 1BC8C 2BYVE 3WTSC 2VODA 2RDPA 5JFRA 1O7LA 4HX4A 5CLSA 2VBWA 5K1YA 3TDZC 3R60A 2CQKA 4KIBA 5DCMB 3DP7A 3I0TA 1O7FA 3GLXA 2ESNA 2HKXA 4FT8A 4JBAA 1G3SA 3QPTA 3EYIA 1ZG1A 2P6TA 1FPQA 2F5EA 4Y15A 2V1DA 3GZ6A 1BM9A 1J0RA 1RUOA 2QBYA 2IVMA 4XRFA 3HRMA 1J59A 2FNPA 3L09A 4UUVA 4L9VA 5HDKA 3IWZA 1KQ9A 4KYWA 4O6JA 4A5MA 2D2WA 4UVAA 3CUQA
chains in the Genus database with same CATH superfamily
2A68F 4PUSA 3G71I 2H6BA 3AFHA 3HG9A 3PFYA 3VYRB 2W57A 1FOXA 3LSMA 3HRTA 3T1BA 5GADJ 1LFUP 3P5JA 3V7RA 5D6EA 3RKWA 1XGNA 2Z99A 2XF6A 1VQOI 2R7QA 4BBRJ 1SFEA 2E1MB 4XN3A 5F27A 1WJFA 2KRHA 2L5QA 5B1BH 2FJ1A 2M9HA 3CLQA 4UUTA 1ZN2A 4XNFA 3KYLA 3K4NA 1KYZA 3OYHA 2EV5A 3S93A 1I3QJ 1VZ0A 3PNYA 1H0MA 2EJRA 1MJBA 3BG3A 3DPUA 4G12A 2A6EF 2LSOA 3H9QA 2PI0A 4I7HA 2OUMA 1FLIA 4XORA 4Y33A 4CCKA 2HZDA 1XSDA 5J47A 2VPLA 2ZKZA 3BG6A 2VT3A 4A0XA 4BY1J 1A6IA 3ZMVA 5D8KB 2WAQA 3HSRA 1FTZA 1YW8A 2CUJA 2DN0A 2VJJA 3MWMA 3FKJA 1YI2I 2E19A 3GF2A 3GTKJ 1S3JA 3U9GA 4MTDA 1XGSA 2WWYA 1MDMB 4PJ0C 5C44J 1ZLKA 3BQZA 2YSRA 1LQ1A 4MFEA 1R1VA 3F6VA 3WG7H 4YEJA 3RJPA 1B9NA 1G3YA 2QF7A 3DTKA 3GVAA 2QEXI 3BY6A 4A0ZA 3QOPA 1RKTA 2JVGA 4JX6A 1Z7LA 2A61A 2P8TA 2IPQX 3ZQFA 2E1MC 3ECOA 1D0YA 2X6WA 1QNTA 1IDYA 4GFBA 1T95A 5JVTA 5E17F 4KMUX 2DLLA 5JLXA 1YYVA 2OZUA 2VKVA 3H0GJ 4BQQA 3L2UA 5FD5A 3FIWA 3G73A 4UUSB 3I3LA 4V2GA 1QHHD 5EDNA 4RGSA 4D7MA 2HDDA 1S7AA 2Y0MA 3WU0A 2FF4A 4FX4A 2HS5A 4UV8A 1XSVA 1LUJB 2Z3YA 2Z2SB 3HBLA 1OCZH 4B3AA 4KA4A 2EFPA 1F4KA 1RC9A 2IP2A 4IRHA 4I0AA 4Q5SF 2EZIA 1OCRH 3A1YA 3HGYA 4IHXA 1LVKA 1R9TJ 3CDLA 4A69C 5GAEJ 1CF7B 3ASNH 2PFBA 5FKNA 2VL8A 2O6GE 4M9ZA 5DS9A 1LVAA 4NC7A 3KP4A 1J7KA 2H94A 3TP0A 5J4VA 1DPUA 2P7CB 3JRBA 2JUGA 1SVOA 4L9TA 5HLGA 5JHFA 5FB2A 2GXBA 5F1JA 2UXXA 1K6YA 4DQ2A 3GTMJ 1JHHA 3S16J 4HOBA 3J7YJ 2XUBA 4HQEA 2STTA 2I5UA 2LBFA 1WI9A 3HOWJ 1D8JA 1Z21A 2KJBA 3F8BA 4HAMA 4EGYA 1MBHA 4CHUA 3A01B 2A3SA 5LRSA 3QAHA 2GLOA 3F9KA 4B1RA 1GXQA 1SMYF 2VT2A 5ILSA 3JCUC 1I39A 4FTHA 1NK2P 2PMZA 3IP4B 1CGPA 3U21A 4CGZA 1ZARA 2O5RA 4H4KC 3L1PA 4CYDA 2XPWA 2DPUA 1ITYA 2XB5A 1BR1A 3AG1H 4NHJA 2DDBA 4II2A 2RQQA 1MJAA 3ESWB 5J4YA 3I53A 5K5RA 1IO2A 1XN7A 1I5ZA 4IQJA 1X1BA 3S17J 3E97A 2GOMA 2XB0X 3ONQA 5E3LA 3CC4I 5IPAA 2IGNA 4PDKA 1W7PD 1G2HA 2MH2A 3WTUC 1TTYA 1SD5A 2OBPA 2NVQJ 2DK5A 3OOUA 2KISA 5H2FC 1LE8A 2KRFA 3IH3A 3RQ4A 3EETA 3O3KA 5FGMA 3ZXSA 2DODA 1ZKGA 1E3OC 2X6OA 3ECHA 4C2UA 2ME0A 3G1MA 4PGGA 1PDNC 3NRVA 2R5YB 3D5RC 3MKYB 5FKOA 2P5LC 2X6XA 4XKWA 1IN6A 4K2EA 5F04A 4BNCA 4XRSA 2DTZA 4EMSA 2HQAA 4A3MJ 2RN7A 1T0FC 4KUMA 1XGMA 4D0PA 4XOTA 2DT7B 3ULQB 4J01A 2B7EA 2XAGA 1MNDA 2R7DA 3JRDA 1DGWY 1U8RA 2Y9ZA 4HF0A 5CVIA 3PSIA 1TQPA 5H6QA 4E7KA 1XB4A 2P5VA 1SAUA 4XLPF 1TWFJ 2R7WA 2HU9A 3SHFA 3ERED 2W82A 3K1MA 2MA3A 4XKVA 1S9HA 4HLYA 4LMYA 4ENMA 2DA1A 2VBXA 2XHKA 3MD2A 1RKWA 2WAQN 1WSUA 5ICGA 1TT0A 2G0EA 4EJVA 3FMRA 1S29A 4KISA 2DOFA 2K4JA 1YJ9I 4PJNA 3X2QH 2B9SA 3FXJA 5D5WB 3JRIA 1SD4A 5KK1A 4KDPA 5EF6A 3CO6C 1G4DA 3WODF 3E0JB 1V54H 3WHBA 2W84A 2ZNYA 3OYJA 1K79A 1I6HJ 3ABLH 2TCTA 3PJRA 3OMYA 3BZCA 2W24A 3BG5A 4IHYA 2D5VA 2DYSH 2E1CA 2LF8A 5D4RA 2VONA 3UKGA 4EJOA 4MFDA 1BBYA 1X1DA 3KPHA 3LWFA 2R7VA 4U7BA 2BW3B 2FX0A 3GO5A 2ID3A 5ERIA 1I6XA 5IT3A 4G94A 5M5WJ 4V19K 4BL0B 1FMVA 2IXSA 4EJTA 2Y0SA 5HDNA 1N25A 2XVCA 3L2QA 3F21A 3GTGJ 4G9YA 1BIBA 3MMYB 3ASOH 1OKRA 1T38A 3HKZA 1ETOA 1VQLI 3C3WA 4MHGA 3GZ5A 2W7NA 3CJRB 3FK7A 4HQMA 5AIQA 1AWCA 4UHTA 1KZHA 1VQMI 1YO5C 4JOMA 5DEQA 3M1CA 3OYEA 2FSWA 3WTXC 1VFCA 2LH9A 3HOZJ 1IN8A 2F4MB 2XIGA 3RZDJ 2KIFA 1X2MA 3WTZA 3H92A 2BGCA 1BJZA 5L3DA 1Y1VJ 4EATA 4F55A 3VFZA 5J6XA 3G4SI 1TWHJ 2EQRA 1FOYA 2VKDA 1PVEA 1P6RA 1F9NA 4ESBA 4AD9A 3ZOBA 3CO7C 1MMNA 1X1PA 2X85A 2VXZA 4PK4A 4AU7A 3CDHA 3F8MA 3HHHA 3GTLJ 4CYCA 3BOQA 3DPTA 2V6EA 3RI4A 1ULYA 3KZZA 2MSYA 5KAFC 4ESJA 3BTLA 1DDNA 5FO5A 1SFOJ 1R5HA 5F6FA 4LGWA 2LYCA 4HA8A 2BY1A 3RPUD 4N9IA 1YIOA 1P2FA 4IO9F 3TP3A 5M5XJ 5EZGA 3CMYA 4D7NA 2MLGA 4BXXJ 1X1CA 3J80K 3F23A 2PMZN 3WTVC 4HF2A 2HOSA 5EGOB 3CCRI 3GYHX 2EWNA 1GLNA 1K4SA 1O57A 4I2OA 4QWQA 1SVLA 1XX5A 1JJ6C 1G8XA 2W4SA 3F6OA 4XKBA 2L02A 2MFZA 2XGEA 4IQ4A 2ZMEB 5F0HA 2EBIA 5F0FA 2EA2A 1UZCA 4AYBA 1FBQA 2P81A 3REOA 4RDUA 4R1HA 2M7AA 4P55A 1VQNI 5FLXK 5BNGA 3E5UA 3S2DJ 4XLFA 2CUEA 5D5VB 3M8EA 1VQ9I 2XF7A 1JI8A 1IW7F 2MC3A 2GXGA 3F8CA 2Q8KA 3QRFF 3Q5FA 3BG7A 2ECBA 4PFOA 5FKMA 3K69A 3OYLA 1V3FA 3MZ8A 1FOKA 2OCCH 1L3LA 2FU4A 4XLNF 4W97A 4LLNA 3H5AA 1J5YA 1TQMA 2L01A 2E36A 2FXAA 4AWXB 1PYVA 4D5FA 5JLWA 1IAWA 2IAIA 4LFUA 1IRGA 2DYRH 4DYCA 2GQQA 4C30A 3H3VK 3BPXA 4M6VA 4YFXF 3GW2A 3MFKA 2Y30A 2RGVA 3WGHA 2VKEA 1D0ZA 2NS7A 2L0KA 5F64A 5CVVA 1D0XA 1ZH5A 1AOYA 4AUXA 2ZMEC 4BGDA 1LPQA 1K78B 4RS8A 5LEJA 3CJTB 2KL4A 1HDPA 2PN6A 3QQAA 2GA2A 3JTHA 3P9KA 3Q0WA 3PO3J 4BH9A 2L2OA 1X1AA 1X3ZB 3F8NA 4OIOF 5D8LB 3EDPA 2LLKA 1HOMA 1U6GA 2LF7A 3KETA 4EVIA 4XRMA 3GFJA 2CYYA 2PMHA 3QOEA 3QU6A 1MSEC 5FKKA 3EQLF 1Z67A 2M5WA 2M4GA 1DU0A 4S05A 4ZYGA 1NTCA 2QVOA 3I9V2 2L9NA 3GLLA 4A0YA 3CP2A 4L0ZB 2F4IA 1SD7A 3W2VA 3AG4H 2M30A 4BUPA 2ESHA 1PP7U 5J8FA 2HVRA 4YFKF 2VASA 2WBMA 1YRNB 4DGWB 3QP6A 4XLCA 4M6XA 4AVZA 1VTNC 1A04A 2DJNA 1XTAA 3J7ZI 2VOPA 3RCOA 1WFXA 4HG2A 3K2ZA 1QU3A 3U2RA 4UB8C 3GZNB 4E70A 1YIJI 3IHUA 2LDUA 4F52A 3BT9A 4OMZA 3VPRA 5FD6A 2EFWA 3R0JA 1ETVA 4ASNA 3M4OJ 3GEZA 2RNJA 3H35A 2CW8A 1YS7A 2OF7A 4A6DA 4C3HJ 4O3MA 2HYJA 3RQIA 1ZYRF 2FE3A 1SEUA 3S32A 2L4MA 2IS6A 1S7EA 2QQ8A 2Y0SN 5E20A 3CMEI 1D8KA 1UG0A 1YW7A 4PJMA 4RB2C 5DYMA 3VSLA 3HKZN 1P9QC 4HLXA 2VC0A 3DFGA 3OIPA 3TW6A 2FA5A 2QBYB 1I1SA 1E2XA 3B73A 1WJ5A 4KMFA 2VIXA 2BY0A 1QO0D 1WRJA 1FSHA 1HW5A 2B0LA 4NUBA 1EF4A 5C3EJ 1V4RA 3BR0A 1V5EA 1ETWA 1D1AA 2F5CA 5B5EC 3OV8A 3OIQA 3ZQ7A 2DXIA 2DMQA 4ABZA 5M5YJ 3CUQB 2COBA 1K61A 4XONA 2QSFX 1RNLA 2WAEA 1O3SA 2KP6A 2KPMA 2DFFA 2H09A 1WJBA 4CA0A 1W5TA 3S3OA 3KZYA 2JMWA 2LMDA 2FRHA 4Z6YA 2XAJA 3BP8A 2JA8J 4X1EA 1OCTC 1B8IB 4XICA 2Y75A 3K4JA 1IF1A 2NYXA 4P1WA 3ISPA 3I71A 2DT5A 4IHTA 2QQAA 1T56A 5EG0A 2BXZA 4RGXA 2M0MA 3HOSA 2QQ9A 1MKMA 2VC1A 3EPZA 3O6BB 3CCQI 3S8PA 1OCOH 1IV6A 2HPIA 1ETQA 3HJEA 1Y8QB 3BPVA 4PJJA 2Z33A 2HGCA 3HSFA 4EM1A 4MTEA 3DF8A 3I5UA 1T08B 1T39A 2HTSA 1GXPA 2QUFA 3LA2A 3FXOA 5E1XA 4AYBN 3H0DA 3FHNA 2O03A 3E1SA 3IC7A 3L2RA 1FX7A 1YJNI 2XPVA 2K85A 5GTIC 4RB0A 1GDTA 1F36A 2WY7Q 5ED4A 2IA2A 3UR3C 3SXYA 2IS1A 2QENA 4ZYHA 3JAMZ 1K4TA 3J81Z 2NNNA 2E35A 1Y8RB 3KP5A 4RMNA 4IVNA 5TJJA 3TGNA 1O4XA 1K7AA 1OCCH 1HW2A 1WKMA 2XRNA 1HSTA 3Q0VA 3OS0A 4ZYDA 1VNDA 3Q0UA 4RAZA 3V8LA 3ZP5A 2AHQA 2VQGA 3JR9A 2FBHA 4DBRA 2PJPA 1UCRA 1J2XA 2FBKA 1GHCA 3VDXA 4OIRF 2ELJA 2Y48A 3FXMA 2UV1A 2AS5F 3OIOA 1IRXA 4U87A 4BYYA 2ZNZA 1MJ9A 1WVRA 5BQTA 2A05A 3QPHA 4BBSJ 4ZYAA 2X1DA 4BACA 2TDXA 5FLMJ 3DTIA 3WTTC 3G2BA 1MH3A 4IHSA 1IJWC 3IWFA 2AQFA 3GTOJ 2PJRA 3F3XA 3H3ZA 1YX3A 2KQRA 4Q47A 4HNTA 3S2WA 1I1GA 5HLIA 2K02A 3S15J 3HYIA 1IUFA 2HNHA 3HUGA 1UAAA 1MBEA 1J09A 2E1NA 1RZ4A 2P6SA 5KCMA 4O5VA 1KONA 1AKHA 1YOVB 4PSWA 2KDZA 2DT6A 3OYCA 3I4PA 2A5WA 3RPQA 1FC3A 4BHPA 1DP3A 4D9JA 2KIMA 4KITB 2NOGA 4I02A 1KU3A 4CZZA 5CKTA 2LBFB 4LJZF 3IH4A 2F5FA 4R8HA 2DBBA 2L3DA 3OS2A 1IGNA 1ZHFA 4UXNA 1QVTA 2OPTA 5HS7A 2BV6A 2BHZA 4HV5A 2YU9J 4NQWA 2WADA 3QWLA 4G6DA 1BN5A 5CYVA 3JRGA 9ANTA 2KIUA 5IOZA 2OC6A 3KX2A 1W5SA 1H9GA 1M1EB 4JP0A 2VQCA 5C4XJ 1UB9A 2LR8A 3TEDA 2VN2A 2OJED 3N05A 5IYDJ 3ZMTA 1H89C 1UHWA 2MD0A 3EUAA 2DA5A 4B09A 3L2CA 5E3NA 5J40A 2HOTA 4WX9A 4HNVA 5BOXA 2R7UA 1UHSA 4MGRA 3I55I 2LD5A 1R1TA 1XMAA 1WCMJ 4HEA2 1D5YA 1Z6RA 4C3IJ 1NHAA 3CJNA 3J7AY 4BHBA 4W1UA 2V26A 3S3NA 2YX4A 2ZC2A 1HQCA 4NC8A 1JHFA 4Q4ZF 4XL9A 2XKOA 3VOEA 5JHUA 3NQOA 3TOBA 4G6QA 5K5QA 4FE4A 2RVCA 3D5SC 3OY9A 4L18B 4ENKA 3FWEA 4L5IA 1RETA 2NS8A 4MEXF 2KKOA 3C7JA 4N0BA 1YTYA 2G7HA 1U9NA 3K6GA 1LKXA 2DMPA 1XD7A 2KZGA 1STZA 4UVCA 3SFIA 5L3BA 1ZRCA 1BW5A 5D5UB 4IZZA 1FBUA 3AG2H 1FP2A 1FOWA 2STWA 1LFBA 2EIMH 1MBKA 3A03A 3MAJA 1Y0UA 5A2QZ 3F72A 3GWZA 5E79C 1IXSB 1NG7A 1ODDA 2N8GA 1BI3A 4LIVA 4I98B 5BMZA 1NG6A 4MO7A 2EZKA 5D5XB 2MD5A 4BQAA 2A07F 1G3WA 4MQ9F 3ZR8X 5LHGA 3JREA 2O0YA 5KNLA 2PBIA 2V4JC 3K1PA 3DU5A 1YE9A 4KFCA 1T2KA 3BTIA 3R61A 2DJIA 5DDGA 4M3DA 1V5GA 2WC2A 3ZQGA 4EEFG 4II3A 3E3VA 1MBGA 3KLNA 1MMAA 4U7DA 1ZG3A 3HOUJ 1PJRA 2M4KA 3W2WA 3I64A 2PEXA 3KFWX 4LG0B 2FQ4A 2FUG2 2LRDA 2ZSIB 2DFIA 1WJEA 4G7OF 3KIOA 2K4BA 1MSFC 2K27A 1GVDA 2M45A 2P4WA 1WJDA 3PNVA 4C3JJ 4DYRA 2W00A 4WXCA 3BZKA 2CV0A 4GYIA 1USTA 4HDUA 5IP7J 2CW0F 5FFZA 1UMQA 1BI0A 1LDKB 2BHYA 5FKLA 1QHGA 2X0LA 1R23A 1ZG5A 2DCEA 2HXIA 3MQ0A 1QRYA 4N4NB 1LNWA 5CPRB 2F48A 3K2AA 1R00A 4DIQA 2Q0OA 2EB7A 4BAYA 3CMMA 2JVHA 5E8GA 2L9SA 2JT1A 1QA6A 4UY8I 1R5ID 2K9MA 5DM7F 2ZXHA 4DYQA 4WXDA 1X2NA 3CESA 2EIKH 3R0AA 4BHCA 2YUSA 1HXDA 1IN4A 3FDYA 1RR8C 3BJ6A 1SFXA 2XRLA 1DQUA 3KLOA 2JRMA 1DPRA 1ETYA 5LLQA 1SFUA 3F8FA 2O3FA 2E2IJ 2ISZA 2JZYA 3BCBA 3GTQJ 3OL3A 5J3LA 5DUKA 1VQKI 4XK4A 4DZJA 1UFMA 2F4OB 4C9YA 2FMYA 4M71A 2EZHA 3LNQA 2CRGA 3G6EI 4A3LJ 4L9JA 1WWXA 2G9WA 3G1OA 3EUHC 1QZEA 3GFLA 1F5TA 1JTXA 2BBYA 5BS6A 4B3XA 1XMKA 3GUDA 3CCMI 4ZDPA 2GIZA 2NAZA 3WU1B 2JQ7A 4IJAA 3MEXA 3MKZA 3DEEA 4H0EA 2O9LA 1W7PA 2LTPA 3BR5A 2R4GA 1K83J 3ZMDA 2V9KA 4MEYF 3L2VA 2X9DA 1X58A 2M7BA 4F92B 3LA7A 1WHUA 3MKWB 2HPMA 4EJUA 1HKSA 2BVMA 3WTWC 2M0CA 3I59A 2CWEA 4CCOA 3EUKL 1CF7A 1VQ5I 2YX7A 3AAFA 1EH8A 4HSTA 2Z9OA 2YPRA 3K4MA 5BPDA 3BTJA 2W48A 2CUFA 2XV4S 1WH7A 3FZVA 2FEZA 1GT0C 4L9NA 3GX4X 4NC6A 1FYKA 4ZH4F 1S5LC 4BJ6C 4OU0A 1TWAJ 4LLLA 1I3AA 1OFCX 1U5TB 1TW2A 2CQ7A 2CS3A 2UUZA 2X51A 5LGUA 1TC3C 3DBHB 2GWRA 1R58A 2CW7A 3H3UA 4E7ZA 3V8JA 1FJLA 3OYDA 1EH6A 1HF0A 3PUFA 4GYGA 2QM3A 4Z2YA 4U0YA 2ZBKA 2BZTA 2CQNA 4RGUA 1B72A 1ERDA 4GXOA 3H9JA 2GZWA 4YRVA 3OR2C 2WAFA 3SZTA 1GV5A 4GDFA 1T0FA 1IDZA 3SDGA 4HF1A 1W4MA 2MBFA 3TMOA 2FQ3A 4IF4A 5EEGA 2RNGA 1XCVA 4JK1X 3BTCA 3WHCA 4RAYA 3CCUI 1HC8A 1YITI 2XGXA 2R3SA 3FISA 1QZZA 2GAUA 4RGRA 3HPHA 2E5NA 4XSXF 3TDUC 1IRFA 4HZFA 1XDUA 1ENHA 1BJAA 1Z05A 1EJ9A 3C2GA 1U5TC 1E3PA 4G7HF 3LL7A 4NB5A 3HPGA 1FY7A 3HRUA 1ZRFA 4I6ZA 3WGGA 2FOWA 4JX4A 1Z3XA 4I76A 4OMYA 4LLGF 2M8GX 4CCLA 4QTRA 2PG4A 3OOPA 5LRRA 2R7XA 5C4JJ 2H27A 5HS8A 3SFZA 1A6QA 1TZLA 2GBYA 1O3RA 4XLAA 2K3FA 4DOZA 2E5ZA 3I54A 5J8CA 2JK3A 4BJTA 4A93J 2X1CA 3IKTA 5DV5A 1DP7P 2IRFG 1KU9A 1YG2A 3N4MA 4ZTJA 1IRZA 1APLC 2EFOA 5DM6F 1LEBA 2A5YB 2K3PA 2CJJA 5HLHA 2Y31A 4KICA 3HB9A 2ZFUA 3UNGC 3BR3A 2KMUA 3KCCA 3DLLF 2IT0A 1JKPC 5JR3A 5DTDA 3C18A 4A3IJ 2OD5A 1B9MA 2PQ8A 2R7TA 3I56I 1DU6A 1KU2A 5E3MA 2RREA 3P9CA 3R6SA 4AVPA 2IS2A 2E60A 1FNNA 2DMUA 2XAFA 2V1XA 3LMMA 2O8KA 3A0HC 5ICCA 5IYBJ 3HDDA 2F5VA 3E6MA 2JPCA 4NBQA 5IT9K 1XPXA 4BEHA 3CLOA 1K6OA 1YS6A 4RB3C 2ISYA 4ENJA 1TNTA 4E7HA 1H8AC 1YW9A 1C0WA 1JXSA 2FMLA 3ZRGA 2BY3A 2M8EA 3ZQHA 4Y13A 1UHMA 5AONA 2WB1A 1Z3YA 3TW7A 2DO7A 4JX5A 1HBXG 4ETSA 2JTVA 3GMEA 2OQGA 2R93J 3M3YJ 3IAM2 3ML6A 2DMTA 3LAPA 3PIOF 2DA6A 1OR7C 2F6CA 2OAZA 5DD8A 3SYTA 5DUIA 2VBZA 3B02A 5GAHJ 1JTYA 3MZYA 4ZC3A 1UJ8A 3LOCA 2VPRA 5K5OA 1A35A 3GFIA 1F43A 2XROA 4B4CA 4M3FA 4CSWA 3BR1A 3L9FA 1MBFA 1T33A 5HS9A 3OYGA 2KHMA 4WWCA 2ZJQF 4ENNA 4B43A 1IXCA 2EFQA 3SEZA 1XDSA 2HDCA 2KZVA 2VLAA 5HLTA 2ZO4A 2H1LA 2X48A 2R5ZA 1ZR4A 2QWWA 1EKEA 4RM2A 1RI7A 3ZN0A 4AIDA 2HQNA 5EG0B 3ZCOA 2D1VA 1KA8A 2W25A 4I01A 2LK2A 3FHZA 2ZCWA 4S04A 4U0WA 3BR6A 1ZTRA 3VB2A 1R1UA 1GV2A 1O3TA 5ILVA 4AIKA 1BOBA 3FBNB 2CUZA 3NARA 4CCJA 3AL0B 2ADUA 3CF5F 2DA4A 3MN2A 2V9VA 1G59A 2HZTA 2MG4A 3CQZJ 3FMSA 3IAS2 3L7WA 1U2WA 1UELB 3LFKA 5TISC 4LIUA 4E7IA 2JA7J 4X0GA 3LFUA 3OYNA 2O8XA 1R6RA 1HDDC 1CQTA 2IA0A 4HX8A 3CC7I 5F08A 3FBIB 2OTJI 2UXNA 2XASA 1JUMA 2Y2ZA 5M3FJ 4I0BA 4E7SA 3BCAA 3NWSA 5CQGA 1B6AA 3C1DA 4GGGA 1QGPA 1D1CA 2R7OA 2CH0A 2G7UA 3BR2A 1FYLA 2B63J 1T98A 1Q1HA 2HQRA 1KU7A 4MIMA 1YX5A 1FIPA 1ZREA 4OIQF 1Z7UA 2IGMA 2XDVA 5EEHA 1DGRM 1SVMA 2L9VA 2ETHA 4LK1F 3DEUA 3DXJF 2AO9A 3AL0C 3CUOA 1LDJA 3DKXA 3IKVA 1MGTA 3IL2A 2XSDC 3PO2J 1MBJA 3OL4A 2E71A 4V2FA 3RYPA 4ZDLA 2PJRB 3F22A 1FP1D 1WZ2A 1TT5B 4U0VA 1TNSA 2L7KA 1QZYA 3RDIA 4OIPF 3JAMK 2AXLA 3GFMA 4FE7A 2HOEA 3A0BC 3DLAA 2M2EA 2DFHA 2QYOA 4BQOA 3W6JB 3WGIA 1SMTA 3QP5A 4ZDOA 3SZPA 3JTGA 1PUFA 2VKHA 1IUYA 4KN7X 4WXHA 3ABKH 3L2WA 1HSJA 4XLEA 3DV8A 4BY7J 1R71A 2MABA 5LHHA 3KYCB 1P4AA 3I4NJ 1ON1A 4A12A 1ZELA 3W6KB 2D45A 1EA3A 2VJIA 2MYSA 1BW6A 1ZRDA 2D1HA 1VQ7I 4NQWB 3ZQQA 2DFEA 5GTHC 1SC7A 3KP7A 1MNEA 2P5KA 3GTPJ 1I27A 1WJAA 2WA0A 4J00A 2Y69H 3LSGA 3B6CA 1LDDA 3CUQC 5F1RA 1P4WA 1W1WE 2VXDA 4PZJA 2V1NA 1B59A 2Z16A 4OWRB 4YELA 1G3TA 3E6DA 3WE3A 3FXLA 1H88C 4BDYA 3BWGA 2QGUA 2W1OA 2QA4I 1TLHB 2BY2A 1IN7A 2OCEA 1MNMC 1ON2A 2ICWG 4BJ5C 3FF5A 2HDWA 1XSXA 1B1BA 2HOAA 2V1UA 3BJAA 1J9IA 2ZJRF 4UVBA 3TQNA 3S1QJ 1Y1WJ 4M9SA 4M6YA 2XGDA 3VYTB 3OYMA 3VYUB 2CMPA 4RA2A 3PFIA 3CCJI 1FYMA 3FX3A 4ESFA 4BE1A 1ZR2A 3CTAA 2HI3A 3TO7A 1S7OA 3HGGA 2XAQA 2ELHA 3M8FA 1MMGA 3WE2A 3S1RJ 4A3BJ 2V79A 1MZBA 3C2HA 5IOYA 1BR4A 2OU2A 2HKOA 4B8XA 4OAYA 3WTYC 4A3EJ 4UV9A 1EV7A 2L7FP 3HOVJ 1FSEA 4AIHA 2XAUA 4GCVA 4IX7A 2CFXA 1WH5A 2XC7A 1HKQA 4RBOA 3FK6A 1V5FA 1N78A 3G1LA 3E6CC 1FZPB 2BE5F 2W85A 3FXUA 2UWMA 1W0TA 4IEJA 3G3ZA 2OTLI 2NOJB 2KDOA 4JYKA 2HVQA 2GOXB 5HDGA 3K10A 1OPCA 5TRDA 2R7FA 2E1OA 2EFNA 2OV7A 3P7NA 2Q2EA 3Q9SA 3QU3A 3BQYA 2K5CA 3ROUA 2OZ6A 2QQBA 3K9TA 5JVGF 4A3FJ 3NWTA 2A6TA 3BDDA 1IC8A 3NEUA 1YLFA 1AHDP 2CU7A 3LSKA 3CDIA 4ZZDA 3D0SA 3CP8A 2LY2A 3BG9A 4UNOA 5FFXA 1TQIA 1TW3A 3ZQIA 1ZGWA 2HTJA 2JA2A 2O61A 3T0YA 3HEFA 2LG4A 4GRIA 2A6HF 1FIAA 2VQLA 4XQFA 2LKPA 5GAGJ 3PUBA 1B8IA 1S6LA 4M3EA 4A3JJ 3OSGA 4M74A 1JGSA 1WQ2A 5E1WA 2FD5A 1T6SA 1W5CC 4CO8A 3K1NA 3RKQA 2CV2A 3KEOA 5E8IA 5ILUA 2DOEA 2GIVA 2WV0A 1BI2A 3QYEA 3A4CA 2JRTA 3S1MJ 2DA7A 3VSKA 3HM5A 3O8GA 4OAZA 4F91B 5A2QK 4LOCA 3FXKA 1FT9A 3E5QA 3K4BA 3LSIA 4EM0B 2VI6A 3LSPA 2CSOA 3LSRA 1U78A 1NH3A 1QPIA 1IV8A 3QYFA 5DCMA 5CJ9A 1NK3P 2E7WA 4IRIA 4B44A 1LE8B 5B66C 2VE9A 1X19A 4ZZLA 3ZGKA 3LAJA 2ZB9A 4FCYA 3OR1C 2K9QA 1KYWA 1Q1VA 3K4LA 5HVQC 4XSZF 1RUNA 5ICFA 4YG2F 2E7XA 2JSPA 2AXTC 1OCPA 2O7OA 5EZHA 5LHIA 5H6RA 1HKTA 3IUOA 2WV1A 3S14J 1JT0A 4J19A 5CQEA 1XC5A 1QPMA 1N77A 2F2EA 4M72A 2MGQA 4KJZA 1JKQC 3H5NA 1VI0A 5FJ8J 1JUPA 3IRQA 2QLZA 1QBJA 2XAHA 1QQIA 4LK0F 2BVLA 5CVJA 1OYIA 2NNYA 3FMQA 4CCMA 2HYFA 2HR3A 1R36A 4FHTA 3FM5A 4CDGA 1W7PB 1JE8A 1BA5A 3OYBA 3OSFA 3T8RA 4HPQA 1RESA 4L5JA 1N75A 3T8TA 3BZ6A 3FKIJ 1BR2A 3KP3A 2MC4A 4LG3A 4AC0A 1H9TA 1VQ4I 4MQVA 1OMIA 3I59B 2DW4A 2QCOA 4BE2A 1R5GA 4XLHA 1OLTA 4XM3A 4KT5C 2K40A 4DJAA 4YIIA 3VODA 2YR2A 3SQNA 4MNUA 5K7FA 3K70C 1Z1DA 5HODA 1R49A 3CZ6A 3GXOA 2COMA 3E6BA 4IRGA 3DBRB 2CGPA 1TWCJ 3JRFA 3K0LA 5FRMA 4NDLA 4EM2A 4Y7NJ 3OYAA 4EV0A 5E18F 1U0JA 2OA4A 4EJWA 2JPBA 4XMYA 4RAFA 4Q48A 4TV7A 1MIJA 4ZJZA 3O2PE 2BEOA 3U1DA 1WI3A 5GPCA 4E6KG 1B72B 4RM3A 1OYWA 3ABTA 5HOOA 3K70D 1RR7A 1F1ZA 1RPWA 2RV8A 4XN0A 4Y52J 2Q1ZB 2GXAA 3HOXJ 1MDMA 3WU2C 4I09A 5M3MJ 1Y56A 2E34A 1R4NB 1VQ8I 3PSFA 5GP9A 3MZHA 2VB6A 2EILH 3V4GA 4BE0A 1T8IA 3HIFA 1R7JA 5L3CA 5LEKA 2DQRA 1Z9CA 1Z6TA 3HHGA 1P7IA 4CCNA 1YHQI 4DW6A 3ZQLA 2HFHA 4XR6A 1V55H 3J7AO 2R7SA 4QSHA 4ITVA 3IV5A 1R22A 3ZMZA 4F93B 2EV0A 4XOPA 4Y4RA 2JUCA 3KP2A 4ON0A 3A2KA 3M8JA 1BIAA 1L0OC 2LREA 3DPLC 4WCGA 4M3BA 4IPAA 3DCFA 5BPIA 2QSHX 1WPKA 4CYCB 2V6CA 1IXRC 1FBSA 4UUSA 5B1AH 1FWZA 2Z5UA 2QKMB 3HTSB 1HA8A 3H9GA 2KIQA 2XKPA 3DBLB 3M9AA 3CCVI 2LNBA 1X4OA 5FROA 4IOCF 2QSGX 3V7CA 2K7LA 1MW7A 4A3CJ 2H1KA 1LEAA 4WF2A 1Z91A 2JN6A 2KFDA 3V42A 2L7MP 1BOAA 2J5OA 2DQLA 4BQNA 1AU7A 5GPAA 3ABUA 1JJ8C 5TGTA 3T5XA 4AIJA 2XPUA 3CCEI 4FISA 1P4XA 1LFPA 1ORKA 2VBYA 3ZMUA 1E0EA 3S3MA 2QZ8A 2K9SA 4BS9A 4M9XA 3HXLA 4HX7A 1E3HA 3PQJA 2K9NA 2LVSA 2LY1A 3BROA 2IJLA 5K7ZA 2WTEA 1EH7A 4BXUA 3M7GA 3HL2A 3TOAA 2FOKA 1REPC 4XKCA 1WGXA 4BEHB 2ID6A 5KAIC 4P5OA 2CQQA 3DEWA 2DTRA 3OS1A 2DPDA 2EK5A 4D5CA 4WK8F 1ONVA 2DAOA 4KIFA 3KEYA 3Q3SA 3NAUA 1ZGAA 2R7RA 4OINF 3RKYA 1IZ1A 3A01A 2KLOA 3A02A 2I8DA 2DDAA 3KE2A 3MKLA 3JRAA 3FXQA 4L0YB 2ZJ2A 3W3CA 4LG0A 2LKXA 5CVUA 2FNAA 1FEXA 4I99C 1XMXA 1JKOC 2DK8A 2K9LA 3DKYA 4X6AJ 3HRSA 4XBFA 3CF2A 4M73A 1YQAA 3D5LA 4P9UA 1BC7C 3EUHA 2CV1A 1W36C 3SDBA 1VQPI 4ZYEA 1Z0XA 2HYGD 2L4AA 2L54A 2LOOA 3U1KA 3ZQCA 4P9FA 3ELKA 3RTRA 3DQVC 4Y17A 2IA1A 1U8BA 4KT6A 2R5ZB 2LFBA 3V7SA 3P9IA 3VEPA 5L3GA 4G7ZF 1ACIA 3RSNA 2JJ7A 2VUMJ 5AIPA 4KNYA 2RAEA 1MH4A 3M07A 4LITA 5DCFA 3IH2A 1A36A 4FASD 4KN4X 4GO1A 1TL8A 3LSJA 2EV6A 3HOTA 1OQYA 2VQHA 2R5YA 1XGOA 3CJQB 5LFAA 4DNCA 4YIFA 1KQ0A 1W36D 2R7ZJ 4E7LA 3Q9VA 3C2BA 1FMWA 1Y0NA 1VF9A 4PGHA 1A5JA 2YS9A 4LB5A 5L3FA 2EZLA 5E1ZB 1U3EM 4F7ZA 2M1BA 2PMUA 4LD5A 1BL0A 4HV6A 3PQKA 3BC8A 5LD2C 4Y3OA 1ETXA 1SD6A 4CZCA 2RKHA 2GM4A 1MD0A 2JSCA 2NVYJ 2C6YA 3CCYA 1JKRC 3CCSI 1JGGA 2DA3A 4R79A 2ZSHB 2TRTA 1USSA 2BOLA 2MH9A 2FBIA 3K7AJ 3JSOA 1IN5A 1S72I 1S8NA 2IS4A 2J5PA 3PNTA 3FXRA 3S2HJ 2DU9A 2OQRA 4EQQA 1B4AA 5D6FA 4A6EA 2CQXA 2XSJC 1ZK8A 6PAXA 1OYYA 2WY8Q 3RZOJ 4G6TB 2ELKA 4DBQA 4QPOA 1YJWI 2UZKA 3E5XA 3TKYA 4A3GJ 4C2TA 3OYFA 2CO5A 2YU3A 1J75A 1HW1A 2HEOA 2NS0A 3K4CA 5EYRA 2ZXWH 4ZTFA 4PSXA 4U88A 4HNUA 3E7LA 5HNHA 1KQ8A 5L3EA 1X3UA 3RPUA 4HDVA 3FM3A 4LB6B 4EGZA 5E3OA 3H1CA 3QPLA 3R4KA 4IXAA 2EPFA 1JT6A 1U5TA 5IP9J 3K4KA 4BDZA 5J1YA 1TWGJ 3F0CA 3MCZA 4HSRA 3PL8A 2MW8A 5IYCJ 2BW3A 3W2AA 3AG3H 3DU6A 1TBXA 3CD6I 5H20A 3GCMA 4PJLA 3JRHA 1GVJA 3PM1A 2PX9A 4RAGA 3HTUA 2P7VB 3J80Z 3JRCA 3RIRA 4FX0A 1PUFB 3M1EA 4D1QA 2X4HA 4KIGA 4RLQA 3WG9A 2LC2A 4G8XA 3BLYA 3AKZA 4HRIA 2P0WA 3B6AA 1WJCA 3HOYJ 1D1BA 1TP4A 2IGOA 3TBIA 2LKSA 5FLXZ 1POGA 2HWVA 3OYKA 2M87A 3ABMH 2EINH 3RKXA 3O8HA 5IT9Z 1D3YA 1Y6IA 4CICA 2BXYA 3LSTA 4RLFA 1KGSA 2NVTJ 3EYYA 3QYBA 5D4SA 2M34A 1YFHA 2L9RA 3GTJJ 2L7ZA 1O3QA 3HSEA 1PUEE 1SAXA 2ACJA 3LSHA 2K86A 5LGTA 5FLVA 4YFNF 4BXFA 4RB1A 3VYSB 1G6NA 2CFOA 2E2HJ 1XCBA 3L00A 3KEQA 2CG4A 5DD4A 2A69F 1Y39A 3HC7A 1D5VA 3PIPF 1OR7A 2I10A 5EJCA 2ZJPF 3LQRA 2GA1A 3LQQA 4FETA 5EGOA 2H6CA 4DZPA 3N97A 1SANA 2IW5A 2PLYA 3DKWA 4QPQA 1ZGJA 5JI6A 5F0CA 4E4HA 5LGNA 1W0UA 2ZMEA 2M3AA 5KVRA 4OOIA 2DOAA 1U9OA 1ZQ3P 3MVPA 4HW0A 3ZN1A 2F5DA 5J1RA 4E7JA 5B3SH 2MLKA 1E17A 2DI3A 3COAC 4A5NA 5CVRA 4M3GA 2NRAC 1DUXC 2QKLB 2VOOA 3V8KA 4QIWN 1RIOH 2H8RA 3I4MJ 2ZXJA 4QLCU 1SFKA 5ICEA 3ZMSA 3QODA 2IGKA 1HLVA 1P7JA 3SEQA 2NXNB 5LBQA 5FRNA 3SJMA 1ZLJA 1X3WB 2XGCA 1LJ9A 3DWLE 4PCQA 1IG7A 3ZPLA 4AM3A 3OWTA 2EIJH 3ERMA 3HUGB 4N4OB 3TO6A 3CC2I 1UG2A 3J81K 2R0QC 4JQFA 1LB2A 3JSPA 1AKHB 1A31A 2LP0A 2Q2EB 3IRRA 2JA6J 1BI1A 1Z77A 2IEKA 2HVSA 2NVUB 2KJCA 4F3QA 2RC4A 4XIDA 1OISA 3BJOA 3I58A 4C2MJ 5K7HA 3H5RA 2ME6A 1MMDA 2ZFWA 4CXFA 4HBLA 3RYRA 3TO9A 3KP6A 2E2JJ 1K78A 3LA3A 1FTTA 2VJ4A 2JWTA 4P96A 2AQEA 3HZJA 2EA4A 2RQPA 2KT0A 4HYEA 2X6YA 1PP8F 5J1UA 4A3KJ 1P92A 1XG1A 1MMSA 2V7FA 3JW4A 1X4PA 1ZAOA 4N9HA 3TL4X 2VJ5A 4A2UA 4PFPA 2HXOA 1ETKA 2VE8A 3CCLI 3QPSA 1VQ6I 1BC8C 2BYVE 3WTSC 4B47A 4CUGA 1JUSA 2ECCA 4B48A 2VODA 2RDPA 4NNJA 5JFRA 4L5EA 1O7LA 3OYIA 1YRNA 4HX4A 4IHWA 5CLSA 2VBWA 5KHDA 3TDZC 5K1YA 1GUUA 3R60A 2X1EA 2CQKA 4ANJA 4KIBA 1R4MB 2WB1N 2XF5A 5DCMB 5EEAA 1XS9A 4XRSG 3DP7A 3I0TA 4FQGA 1O7FA 4BKXA 3CMAI 3GLXA 1QVUA 2ESNA 3SZGA 2HKXA 4CH7A 5IY5H 2JA5J 4FT8A 5HNFA 2Z1DA 1RRJA 4JBAA 1G3SA 2NVXJ 2R92J 3QPTA 4IOAF 1HCRA 3EYIA 2LY9A 2P6TA 1ZG1A 1FPQA 2F5EA 4Y15A 2V1DA 1OJLA 3GZ6A 4IKFA 2DA2A 3GBGA 3S1NJ 1BM9A 1J0RA 1RUOA 2QBYA 4A3DJ 2HQ5A 2IVMA 4XRFA 3KZIC 4IL6C 3HRMA 1J59A 3VWBA 4MLOA 2FNPA 3DTEA 3L09A 3W6VA 1AA7A 4UUVA 4L9VA 5HDKA 4YIRX 3IWZA 1KQ9A 2IBDA 4KYWA 2H8WA 2V9PA 2EH3A 2Y9YA 4O6JA 1I50J 4A5MA 4BU2A 2D2WA 2KRCA 4S0HB 4UB6C 3D1NI 3KYDB 4UVAA 3CUQA 2ZXIA 4IHVA 3H36A 2DMNA 5IP6A
chains in the Genus database with same CATH topology
2A68F 2H6BA 2W57A 3HRTA 3T1BA 3V7RA 5D6EA 3RKWA 1XGNA 2Z99A 1SFEA 1ZN2A 1KYZA 2EV5A 1H0MA 2EJRA 1MJBA 2A6EF 2LSOA 2PI0A 4I7HA 1FLIA 1XSDA 2ZKZA 2VT3A 4A0XA 3ZMVA 5D8KB 3HSRA 1YW8A 3MWMA 3GF2A 1S3JA 3U9GA 4MTDA 1XGSA 2WWYA 1MDMB 1ZLKA 2YSRA 1LQ1A 1R1VA 3F6VA 3RJPA 1B9NA 1G3YA 3GVAA 3BY6A 4A0ZA 3QOPA 2A61A 2P8TA 2IPQX 3ECOA 1QNTA 5JVTA 5E17F 4KMUX 2DLLA 1YYVA 2OZUA 5FD5A 3G73A 4RGSA 1S7AA 2Y0MA 3WU0A 2FF4A 4FX4A 2HS5A 4UV8A 1XSVA 2Z3YA 4KA4A 1F4KA 2EFPA 2IP2A 4IRHA 4Q5SF 4I0AA 1CF7B 2PFBA 2O6GE 4M9ZA 1LVAA 3KP4A 1J7KA 2H94A 1DPUA 2P7CB 2GXBA 4L9TA 5HLGA 5FB2A 2UXXA 4DQ2A 1JHHA 4HOBA 1D8JA 2XUBA 4HQEA 2STTA 1WI9A 2KJBA 3F8BA 4HAMA 4EGYA 4CHUA 2A3SA 5LRSA 3QAHA 1GXQA 1SMYF 2VT2A 5ILSA 1CGPA 4CGZA 1ZARA 4CYDA 2DPUA 4NHJA 1MJAA 3I53A 5K5RA 1XN7A 1I5ZA 3E97A 4PDKA 1W7PD 3WTUC 2MH2A 1TTYA 1SD5A 2OBPA 2DK5A 2KRFA 3EETA 3O3KA 5FGMA 3ECHA 4PGGA 1PDNC 3NRVA 2P5LC 1IN6A 4K2EA 4BNCA 4EMSA 2RN7A 4KUMA 1XGMA 4D0PA 3ULQB 2XAGA 2R7DA 1U8RA 4HF0A 5CVIA 5H6QA 1TQPA 1XB4A 2P5VA 4XLPF 3ERED 3SHFA 3K1MA 2MA3A 4HLYA 4LMYA 4ENMA 2VBXA 2XHKA 1WSUA 5ICGA 4EJVA 3FMRA 1S29A 2K4JA 5D5WB 1SD4A 5KK1A 4KDPA 3CO6C 1G4DA 3WODF 2W84A 2ZNYA 1K79A 2W24A 2E1CA 2LF8A 5D4RA 2VONA 4EJOA 1BBYA 3LWFA 4U7BA 3GO5A 5ERIA 1I6XA 5IT3A 4G94A 4EJTA 3F21A 5HDNA 2XVCA 4G9YA 1BIBA 1T38A 1OKRA 3C3WA 4MHGA 3GZ5A 4HQMA 5AIQA 1AWCA 4UHTA 1YO5C 5DEQA 2FSWA 3WTXC 1IN8A 2XIGA 2KIFA 3WTZA 3H92A 2BGCA 5L3DA 3VFZA 5J6XA 1P6RA 1F9NA 4ESBA 4AD9A 3CO7C 2VXZA 3CDHA 3F8MA 3HHHA 3BOQA 3DPTA 3RI4A 1ULYA 3KZZA 4ESJA 1DDNA 5FO5A 1R5HA 5F6FA 4LGWA 4HA8A 4N9IA 1YIOA 1P2FA 2MLGA 3J80K 3F23A 4HF2A 3WTVC 3GYHX 2EWNA 1O57A 4I2OA 4QWQA 3F6OA 2L02A 2ZMEB 2EA2A 1FBQA 3REOA 4R1HA 4P55A 5FLXK 3E5UA 5D5VB 3M8EA 1IW7F 2MC3A 2GXGA 3F8CA 2Q8KA 3QRFF 3Q5FA 3K69A 1V3FA 1FOKA 1L3LA 2FU4A 4XLNF 4LLNA 1J5YA 1TQMA 2L01A 4AWXB 2FXAA 1IAWA 4LFUA 1IRGA 2GQQA 3BPXA 4YFXF 3GW2A 3MFKA 2RGVA 3WGHA 5F64A 5CVVA 1ZH5A 1AOYA 1K78B 4RS8A 5LEJA 2PN6A 2GA2A 3JTHA 3P9KA 4BH9A 3F8NA 4OIOF 5D8LB 3EDPA 1U6GA 2LF7A 3KETA 4EVIA 3GFJA 2CYYA 2PMHA 3QU6A 3EQLF 2M5WA 4S05A 4ZYGA 2QVOA 4A0YA 4L0ZB 1SD7A 1PP7U 2M30A 2ESHA 5J8FA 4YFKF 3QP6A 4M6XA 1VTNC 1A04A 2VOPA 3K2ZA 3U2RA 4E70A 3IHUA 2LDUA 4OMZA 5FD6A 2EFWA 3R0JA 4ASNA 3GEZA 2RNJA 1YS7A 4A6DA 4O3MA 1ZYRF 2FE3A 2L4MA 5E20A 1D8KA 1YW7A 4RB2C 5DYMA 4HLXA 2VC0A 3DFGA 2FA5A 2QBYB 1I1SA 1E2XA 3B73A 4KMFA 1FSHA 1QO0D 1WRJA 1HW5A 2B0LA 1V4RA 2F5CA 3OV8A 3ZQ7A 3CUQB 1RNLA 1O3SA 2H09A 1W5TA 3KZYA 2FRHA 2XAJA 3BP8A 2Y75A 1IF1A 2NYXA 3ISPA 3I71A 2DT5A 4IHTA 2QQAA 4RGXA 3HOSA 1MKMA 2QQ9A 2VC1A 3O6BB 3BPVA 2Z33A 2HGCA 3HSFA 4EM1A 4MTEA 3DF8A 3I5UA 1T39A 2HTSA 1GXPA 2QUFA 3LA2A 5E1XA 2O03A 3IC7A 1FX7A 4RB0A 5ED4A 2IA2A 3SXYA 2QENA 4ZYHA 3JAMZ 3J81Z 2NNNA 3KP5A 4IVNA 5TJJA 3TGNA 1K7AA 1HW2A 1WKMA 2XRNA 1HSTA 4ZYDA 4RAZA 3V8LA 3ZP5A 2FBHA 2PJPA 1UCRA 1J2XA 2FBKA 1GHCA 4OIRF 2Y48A 2AS5F 4BYYA 2ZNZA 1MJ9A 5BQTA 3QPHA 2TDXA 3WTTC 4IHSA 3IWFA 3F3XA 3H3ZA 4Q47A 3S2WA 1I1GA 5HLIA 2K02A 3HYIA 3HUGA 2E1NA 1RZ4A 2P6SA 4O5VA 3I4PA 3RPQA 1FC3A 4BHPA 2KIMA 4I02A 1KU3A 4CZZA 4LJZF 2F5FA 4R8HA 2DBBA 2L3DA 1ZHFA 4UXNA 5HS7A 2BV6A 4HV5A 4NQWA 4G6DA 1BN5A 5CYVA 2KIUA 1W5SA 1H9GA 1UB9A 2VN2A 3ZMTA 1UHWA 4B09A 3L2CA 4WX9A 5BOXA 4MGRA 1R1TA 1XMAA 1Z6RA 1NHAA 3CJNA 4BHBA 2YX4A 1HQCA 1JHFA 4Q4ZF 2XKOA 3VOEA 5JHUA 3NQOA 3TOBA 4G6QA 5K5QA 2RVCA 4L18B 4ENKA 3FWEA 4L5IA 4MEXF 2KKOA 3C7JA 4N0BA 1YTYA 2G7HA 1XD7A 4UVCA 1STZA 5L3BA 1ZRCA 5D5UB 1FBUA 1FP2A 2STWA 3MAJA 1Y0UA 5A2QZ 3F72A 3GWZA 1IXSB 1ODDA 1BI3A 4I98B 5BMZA 5D5XB 2MD5A 4BQAA 2A07F 1G3WA 4MQ9F 5LHGA 2O0YA 2PBIA 3K1PA 4KFCA 1T2KA 3R61A 5DDGA 2WC2A 3E3VA 3KLNA 4U7DA 1ZG3A 3I64A 2PEXA 3KFWX 4LG0B 2DFIA 4G7OF 2K4BA 2K27A 2M45A 2P4WA 4WXCA 4GYIA 1USTA 4HDUA 2CW0F 5FFZA 1BI0A 1LDKB 2X0LA 1R23A 1ZG5A 3MQ0A 1LNWA 1R00A 2Q0OA 2EB7A 4BAYA 5E8GA 2JT1A 4WXDA 3R0AA 4BHCA 1HXDA 1IN4A 3BJ6A 1SFXA 3KLOA 1DPRA 5LLQA 1SFUA 3F8FA 2O3FA 2ISZA 2JZYA 5DUKA 1UFMA 2FMYA 4M71A 4L9JA 1WWXA 2G9WA 3GFLA 1F5TA 2BBYA 5BS6A 1XMKA 3GUDA 2NAZA 3WU1B 4IJAA 3MEXA 4H0EA 1W7PA 3ZMDA 4MEYF 3LA7A 4EJUA 1HKSA 3WTWC 3I59A 2CWEA 1CF7A 2YX7A 3AAFA 1EH8A 2Z9OA 2YPRA 5BPDA 2XV4S 3FZVA 2FEZA 4L9NA 3GX4X 1FYKA 4ZH4F 4OU0A 4LLLA 1U5TB 1TW2A 5LGUA 2GWRA 1R58A 3H3UA 3V8JA 1EH6A 4U0YA 4GYGA 2QM3A 4Z2YA 2ZBKA 4RGUA 4GXOA 2GZWA 3SZTA 1T0FA 4HF1A 1W4MA 2MBFA 2FQ3A 4IF4A 5EEGA 1XCVA 4JK1X 4RAYA 2XGXA 2R3SA 1QZZA 2GAUA 4RGRA 3TDUC 4XSXF 1IRFA 4HZFA 1XDUA 1BJAA 1Z05A 1U5TC 4G7HF 4NB5A 1FY7A 3HRUA 1ZRFA 3WGGA 4OMYA 4LLGF 2PG4A 3OOPA 5LRRA 2H27A 5HS8A 3SFZA 1O3RA 3I54A 5J8CA 3IKTA 5DV5A 1DP7P 2IRFG 1KU9A 1YG2A 3N4MA 2EFOA 1LEBA 2A5YB 5HLHA 4KICA 3KCCA 2IT0A 5JR3A 3C18A 2OD5A 1B9MA 2PQ8A 1KU2A 3P9CA 3R6SA 4AVPA 1FNNA 2XAFA 2V1XA 5ICCA 3E6MA 2JPCA 5IT9K 3CLOA 1K6OA 1YS6A 4RB3C 2ISYA 4ENJA 1TNTA 1YW9A 1C0WA 1JXSA 2FMLA 2M8EA 4Y13A 1UHMA 5AONA 2DO7A 1HBXG 4ETSA 2JTVA 2OQGA 3ML6A 3LAPA 2OAZA 5DD8A 5DUIA 2VBZA 3B02A 3MZYA 5K5OA 3GFIA 2XROA 3L9FA 5HS9A 4WWCA 4ENNA 1IXCA 2EFQA 2HDCA 1XDSA 2ZO4A 2QWWA 1RI7A 3ZN0A 2HQNA 2D1VA 1KA8A 2W25A 4I01A 3FHZA 2ZCWA 4S04A 4U0WA 3VB2A 1R1UA 1O3TA 5ILVA 4AIKA 2ADUA 2V9VA 2HZTA 3FMSA 3L7WA 1U2WA 3LFKA 2O8XA 2IA0A 4HX8A 2UXNA 2XASA 4I0BA 1B6AA 3C1DA 4GGGA 1QGPA 2G7UA 1FYLA 1T98A 1Q1HA 2HQRA 1KU7A 1ZREA 4OIQF 1Z7UA 5EEHA 2ETHA 4LK1F 3DEUA 3DXJF 3CUOA 1LDJA 3IKVA 1MGTA 3IL2A 3RYPA 3F22A 1FP1D 4U0VA 1TNSA 1QZYA 3RDIA 4OIPF 3JAMK 2AXLA 3GFMA 2HOEA 2QYOA 3W6JB 3WGIA 1SMTA 3QP5A 3SZPA 3JTGA 1IUYA 4KN7X 4WXHA 1HSJA 3DV8A 5LHHA 1P4AA 1ON1A 4A12A 3W6KB 2D45A 1ZRDA 2D1HA 3KP7A 2P5KA 1I27A 1LDDA 3CUQC 5F1RA 1P4WA 4PZJA 1B59A 1G3TA 3E6DA 3WE3A 3BWGA 1TLHB 1IN7A 1ON2A 3FF5A 1XSXA 1B1BA 2V1UA 3BJAA 1J9IA 4UVBA 3TQNA 4M9SA 4M6YA 3PFIA 1FYMA 3FX3A 4ESFA 3CTAA 3TO7A 1S7OA 2XAQA 2ELHA 3M8FA 3WE2A 2V79A 1MZBA 2OU2A 2HKOA 4B8XA 3WTYC 4UV9A 1EV7A 1FSEA 4AIHA 4GCVA 2CFXA 1HKQA 3E6CC 1FZPB 2BE5F 2W85A 3FXUA 2UWMA 3G3ZA 5HDGA 1OPCA 5TRDA 2R7FA 2EFNA 3P7NA 2Q2EA 3Q9SA 3QU3A 3ROUA 2OZ6A 2QQBA 3K9TA 3BDDA 3NEUA 1YLFA 4ZZDA 3D0SA 4UNOA 5FFXA 1TQIA 1TW3A 2HTJA 2O61A 3T0YA 2A6HF 2LKPA 1S6LA 4M74A 1JGSA 1WQ2A 5E1WA 1T6SA 4CO8A 3K1NA 3KEOA 5E8IA 5ILUA 2GIVA 2WV0A 1BI2A 2JRTA 5A2QK 1FT9A 3E5QA 4EM0B 2CSOA 1U78A 5DCMA 5CJ9A 4IRIA 2E7WA 2VE9A 4ZZLA 3LAJA 1KYWA 5HVQC 4XSZF 1RUNA 5ICFA 4YG2F 2E7XA 5LHIA 5H6RA 1HKTA 1QPMA 2F2EA 4M72A 3IRQA 2QLZA 1QBJA 2XAHA 1QQIA 4LK0F 5CVJA 2NNYA 1OYIA 3FMQA 2HYFA 2HR3A 1R36A 4FHTA 3FM5A 4CDGA 1W7PB 1JE8A 3T8RA 4L5JA 3T8TA 3BZ6A 3KP3A 1H9TA 4MQVA 1OMIA 3I59B 2DW4A 1R5GA 4KT5C 4YIIA 3VODA 2YR2A 3SQNA 4MNUA 1Z1DA 3GXOA 2COMA 3E6BA 4IRGA 2CGPA 3K0LA 4EM2A 4EV0A 5E18F 2OA4A 4EJWA 2JPBA 4Q48A 4TV7A 3O2PE 2BEOA 3U1DA 1OYWA 3ABTA 5HOOA 1F1ZA 2RV8A 1MDMA 4I09A 3MZHA 3V4GA 3HIFA 1R7JA 5L3CA 5LEKA 2DQRA 1Z9CA 1Z6TA 3HHGA 2HFHA 3J7AO 1R22A 3ZMZA 2EV0A 3KP2A 4ON0A 1BIAA 1L0OC 3DPLC 4WCGA 4IPAA 5BPIA 2V6CA 1IXRC 1FBSA 1FWZA 2Z5UA 3HTSB 2XKPA 3M9AA 2LNBA 3V7CA 2K7LA 1LEAA 4WF2A 1Z91A 1BOAA 2J5OA 2DQLA 3ABUA 3T5XA 4AIJA 1P4XA 2VBYA 3ZMUA 2QZ8A 4M9XA 4HX7A 3PQJA 3BROA 2IJLA 2WTEA 1EH7A 4BXUA 3M7GA 3TOAA 2FOKA 1REPC 4P5OA 2DTRA 2DPDA 2EK5A 4WK8F 1ONVA 2DAOA 4KIFA 1ZGAA 4OINF 3RKYA 1IZ1A 3KE2A 3FXQA 4L0YB 2ZJ2A 4LG0A 5CVUA 2FNAA 2DK8A 3HRSA 4XBFA 4M73A 1YQAA 3D5LA 4P9UA 1BC7C 3EUHA 4ZYEA 2HYGD 2L4AA 2L54A 4P9FA 3ELKA 3RTRA 3DQVC 4Y17A 2IA1A 3V7SA 3P9IA 3VEPA 5L3GA 4G7ZF 5AIPA 4KNYA 5DCFA 4KN4X 4GO1A 2EV6A 3HOTA 1XGOA 4DNCA 4YIFA 1KQ0A 3Q9VA 4PGHA 4LB5A 5L3FA 5E1ZB 1U3EM 4F7ZA 2M1BA 2PMUA 4LD5A 4HV6A 3PQKA 1SD6A 2RKHA 1MD0A 2JSCA 2C6YA 4R79A 1USSA 2MH9A 2FBIA 3JSOA 1IN5A 1S8NA 2J5PA 3FXRA 2DU9A 2OQRA 4EQQA 1B4AA 5D6FA 4A6EA 6PAXA 1OYYA 2UZKA 3E5XA 3TKYA 2CO5A 2YU3A 1J75A 1HW1A 2HEOA 2NS0A 4U88A 1KQ8A 5L3EA 1X3UA 3RPUA 4HDVA 3FM3A 4LB6B 4EGZA 3R4KA 4IXAA 1U5TA 3MCZA 1TBXA 5H20A 1GVJA 3HTUA 2P7VB 3J80Z 3RIRA 4FX0A 3M1EA 2X4HA 4KIGA 3WG9A 4G8XA 5FLXZ 2HWVA 2M87A 3RKXA 5IT9Z 1D3YA 4CICA 3LSTA 1KGSA 3EYYA 5D4SA 1YFHA 1O3QA 3HSEA 1PUEE 1SAXA 2ACJA 2K86A 5LGTA 4YFNF 4RB1A 1G6NA 1XCBA 3L00A 3KEQA 2CG4A 5DD4A 2A69F 1D5VA 1OR7A 3LQRA 2GA1A 3LQQA 2H6CA 3N97A 2IW5A 2PLYA 3DKWA 5JI6A 1ZGJA 5LGNA 2ZMEA 5KVRA 4OOIA 4HW0A 3ZN1A 2F5DA 2MLKA 1E17A 2DI3A 3COAC 4A5NA 5CVRA 2NRAC 1DUXC 2VOOA 3V8KA 1RIOH 2ZXJA 4QLCU 5ICEA 3ZMSA 5LBQA 1ZLJA 3ZPLA 4PCQA 1LJ9A 3TO6A 3J81K 4JQFA 1LB2A 3JSPA 3IRRA 1BI1A 2KJCA 2RC4A 3BJOA 3I58A 2ZFWA 4CXFA 4HBLA 3RYRA 3TO9A 3KP6A 1K78A 3LA3A 4P96A 2EA4A 2RQPA 4HYEA 1PP8F 1P92A 3JW4A 1ZAOA 4N9HA 4A2UA 2VE8A 1BC8C 2BYVE 3WTSC 2VODA 2RDPA 5JFRA 1O7LA 4HX4A 5CLSA 2VBWA 5K1YA 3TDZC 3R60A 2CQKA 4KIBA 5DCMB 3DP7A 3I0TA 1O7FA 3GLXA 2ESNA 2HKXA 4FT8A 4JBAA 1G3SA 3QPTA 3EYIA 1ZG1A 2P6TA 1FPQA 2F5EA 4Y15A 2V1DA 3GZ6A 1BM9A 1J0RA 1RUOA 2QBYA 2IVMA 4XRFA 3HRMA 1J59A 2FNPA 3L09A 4UUVA 4L9VA 5HDKA 3IWZA 1KQ9A 4KYWA 4O6JA 4A5MA 2D2WA 4UVAA 3CUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 F;  2H6B A;  2W57 A;  3HRT A;  3T1B A;  3V7R A;  5D6E A;  3RKW A;  1XGN A;  2Z99 A;  1SFE A;  1ZN2 A;  1KYZ A;  2EV5 A;  1H0M A;  2EJR A;  1MJB A;  2A6E F;  2LSO A;  2PI0 A;  4I7H A;  1FLI A;  1XSD A;  2ZKZ A;  2VT3 A;  4A0X A;  3ZMV A;  5D8K B;  3HSR A;  1YW8 A;  3MWM A;  3GF2 A;  1S3J A;  3U9G A;  4MTD A;  1XGS A;  2WWY A;  1MDM B;  1ZLK A;  2YSR A;  1LQ1 A;  1R1V A;  3F6V A;  3RJP A;  1B9N A;  1G3Y A;  3GVA A;  3BY6 A;  4A0Z A;  3QOP A;  2A61 A;  2P8T A;  2IPQ X;  3ECO A;  1QNT A;  5JVT A;  5E17 F;  4KMU X;  2DLL A;  1YYV A;  2OZU A;  5FD5 A;  3G73 A;  4RGS A;  1S7A A;  2Y0M A;  3WU0 A;  2FF4 A;  4FX4 A;  2HS5 A;  4UV8 A;  1XSV A;  2Z3Y A;  4KA4 A;  1F4K A;  2EFP A;  2IP2 A;  4IRH A;  4Q5S F;  4I0A A;  1CF7 B;  2PFB A;  2O6G E;  4M9Z A;  1LVA A;  3KP4 A;  1J7K A;  2H94 A;  1DPU A;  2P7C B;  2GXB A;  4L9T A;  5HLG A;  5FB2 A;  2UXX A;  4DQ2 A;  1JHH A;  4HOB A;  1D8J A;  2XUB A;  4HQE A;  2STT A;  1WI9 A;  2KJB A;  3F8B A;  4HAM A;  4EGY A;  4CHU A;  2A3S A;  5LRS A;  3QAH A;  1GXQ A;  1SMY F;  2VT2 A;  5ILS A;  1CGP A;  4CGZ A;  1ZAR A;  4CYD A;  2DPU A;  4NHJ A;  1MJA A;  3I53 A;  5K5R A;  1XN7 A;  1I5Z A;  3E97 A;  4PDK A;  1W7P D;  3WTU C;  2MH2 A;  1TTY A;  1SD5 A;  2OBP A;  2DK5 A;  2KRF A;  3EET A;  3O3K A;  5FGM A;  3ECH A;  4PGG A;  1PDN C;  3NRV A;  2P5L C;  1IN6 A;  4K2E A;  4BNC A;  4EMS A;  2RN7 A;  4KUM A;  1XGM A;  4D0P A;  3ULQ B;  2XAG A;  2R7D A;  1U8R A;  4HF0 A;  5CVI A;  5H6Q A;  1TQP A;  1XB4 A;  2P5V A;  4XLP F;  3ERE D;  3SHF A;  3K1M A;  2MA3 A;  4HLY A;  4LMY A;  4ENM A;  2VBX A;  2XHK A;  1WSU A;  5ICG A;  4EJV A;  3FMR A;  1S29 A;  2K4J A;  5D5W B;  1SD4 A;  5KK1 A;  4KDP A;  3CO6 C;  1G4D A;  3WOD F;  2W84 A;  2ZNY A;  1K79 A;  2W24 A;  2E1C A;  2LF8 A;  5D4R A;  2VON A;  4EJO A;  1BBY A;  3LWF A;  4U7B A;  3GO5 A;  5ERI A;  1I6X A;  5IT3 A;  4G94 A;  4EJT A;  3F21 A;  5HDN A;  2XVC A;  4G9Y A;  1BIB A;  1T38 A;  1OKR A;  3C3W A;  4MHG A;  3GZ5 A;  4HQM A;  5AIQ A;  1AWC A;  4UHT A;  1YO5 C;  5DEQ A;  2FSW A;  3WTX C;  1IN8 A;  2XIG A;  2KIF A;  3WTZ A;  3H92 A;  2BGC A;  5L3D A;  3VFZ A;  5J6X A;  1P6R A;  1F9N A;  4ESB A;  4AD9 A;  3CO7 C;  2VXZ A;  3CDH A;  3F8M A;  3HHH A;  3BOQ A;  3DPT A;  3RI4 A;  1ULY A;  3KZZ A;  4ESJ A;  1DDN A;  5FO5 A;  1R5H A;  5F6F A;  4LGW A;  4HA8 A;  4N9I A;  1YIO A;  1P2F A;  2MLG A;  3J80 K;  3F23 A;  4HF2 A;  3WTV C;  3GYH X;  2EWN A;  1O57 A;  4I2O A;  4QWQ A;  3F6O A;  2L02 A;  2ZME B;  2EA2 A;  1FBQ A;  3REO A;  4R1H A;  4P55 A;  5FLX K;  3E5U A;  5D5V B;  3M8E A;  1IW7 F;  2MC3 A;  2GXG A;  3F8C A;  2Q8K A;  3QRF F;  3Q5F A;  3K69 A;  1V3F A;  1FOK A;  1L3L A;  2FU4 A;  4XLN F;  4LLN A;  1J5Y A;  1TQM A;  2L01 A;  4AWX B;  2FXA A;  1IAW A;  4LFU A;  1IRG A;  2GQQ A;  3BPX A;  4YFX F;  3GW2 A;  3MFK A;  2RGV A;  3WGH A;  5F64 A;  5CVV A;  1ZH5 A;  1AOY A;  1K78 B;  4RS8 A;  5LEJ A;  2PN6 A;  2GA2 A;  3JTH A;  3P9K A;  4BH9 A;  3F8N A;  4OIO F;  5D8L B;  3EDP A;  1U6G A;  2LF7 A;  3KET A;  4EVI A;  3GFJ A;  2CYY A;  2PMH A;  3QU6 A;  3EQL F;  2M5W A;  4S05 A;  4ZYG A;  2QVO A;  4A0Y A;  4L0Z B;  1SD7 A;  1PP7 U;  2M30 A;  2ESH A;  5J8F A;  4YFK F;  3QP6 A;  4M6X A;  1VTN C;  1A04 A;  2VOP A;  3K2Z A;  3U2R A;  4E70 A;  3IHU A;  2LDU A;  4OMZ A;  5FD6 A;  2EFW A;  3R0J A;  4ASN A;  3GEZ A;  2RNJ A;  1YS7 A;  4A6D A;  4O3M A;  1ZYR F;  2FE3 A;  2L4M A;  5E20 A;  1D8K A;  1YW7 A;  4RB2 C;  5DYM A;  4HLX A;  2VC0 A;  3DFG A;  2FA5 A;  2QBY B;  1I1S A;  1E2X A;  3B73 A;  4KMF A;  1FSH A;  1QO0 D;  1WRJ A;  1HW5 A;  2B0L A;  1V4R A;  2F5C A;  3OV8 A;  3ZQ7 A;  3CUQ B;  1RNL A;  1O3S A;  2H09 A;  1W5T A;  3KZY A;  2FRH A;  2XAJ A;  3BP8 A;  2Y75 A;  1IF1 A;  2NYX A;  3ISP A;  3I71 A;  2DT5 A;  4IHT A;  2QQA A;  4RGX A;  3HOS A;  1MKM A;  2QQ9 A;  2VC1 A;  3O6B B;  3BPV A;  2Z33 A;  2HGC A;  3HSF A;  4EM1 A;  4MTE A;  3DF8 A;  3I5U A;  1T39 A;  2HTS A;  1GXP A;  2QUF A;  3LA2 A;  5E1X A;  2O03 A;  3IC7 A;  1FX7 A;  4RB0 A;  5ED4 A;  2IA2 A;  3SXY A;  2QEN A;  4ZYH A;  3JAM Z;  3J81 Z;  2NNN A;  3KP5 A;  4IVN A;  5TJJ A;  3TGN A;  1K7A A;  1HW2 A;  1WKM A;  2XRN A;  1HST A;  4ZYD A;  4RAZ A;  3V8L A;  3ZP5 A;  2FBH A;  2PJP A;  1UCR A;  1J2X A;  2FBK A;  1GHC A;  4OIR F;  2Y48 A;  2AS5 F;  4BYY A;  2ZNZ A;  1MJ9 A;  5BQT A;  3QPH A;  2TDX A;  3WTT C;  4IHS A;  3IWF A;  3F3X A;  3H3Z A;  4Q47 A;  3S2W A;  1I1G A;  5HLI A;  2K02 A;  3HYI A;  3HUG A;  2E1N A;  1RZ4 A;  2P6S A;  4O5V A;  3I4P A;  3RPQ A;  1FC3 A;  4BHP A;  2KIM A;  4I02 A;  1KU3 A;  4CZZ A;  4LJZ F;  2F5F A;  4R8H A;  2DBB A;  2L3D A;  1ZHF A;  4UXN A;  5HS7 A;  2BV6 A;  4HV5 A;  4NQW A;  4G6D A;  1BN5 A;  5CYV A;  2KIU A;  1W5S A;  1H9G A;  1UB9 A;  2VN2 A;  3ZMT A;  1UHW A;  4B09 A;  3L2C A;  4WX9 A;  5BOX A;  4MGR A;  1R1T A;  1XMA A;  1Z6R A;  1NHA A;  3CJN A;  4BHB A;  2YX4 A;  1HQC A;  1JHF A;  4Q4Z F;  2XKO A;  3VOE A;  5JHU A;  3NQO A;  3TOB A;  4G6Q A;  5K5Q A;  2RVC A;  4L18 B;  4ENK A;  3FWE A;  4L5I A;  4MEX F;  2KKO A;  3C7J A;  4N0B A;  1YTY A;  2G7H A;  1XD7 A;  4UVC A;  1STZ A;  5L3B A;  1ZRC A;  5D5U B;  1FBU A;  1FP2 A;  2STW A;  3MAJ A;  1Y0U A;  5A2Q Z;  3F72 A;  3GWZ A;  1IXS B;  1ODD A;  1BI3 A;  4I98 B;  5BMZ A;  5D5X B;  2MD5 A;  4BQA A;  2A07 F;  1G3W A;  4MQ9 F;  5LHG A;  2O0Y A;  2PBI A;  3K1P A;  4KFC A;  1T2K A;  3R61 A;  5DDG A;  2WC2 A;  3E3V A;  3KLN A;  4U7D A;  1ZG3 A;  3I64 A;  2PEX A;  3KFW X;  4LG0 B;  2DFI A;  4G7O F;  2K4B A;  2K27 A;  2M45 A;  2P4W A;  4WXC A;  4GYI A;  1UST A;  4HDU A;  2CW0 F;  5FFZ A;  1BI0 A;  1LDK B;  2X0L A;  1R23 A;  1ZG5 A;  3MQ0 A;  1LNW A;  1R00 A;  2Q0O A;  2EB7 A;  4BAY A;  5E8G A;  2JT1 A;  4WXD A;  3R0A A;  4BHC A;  1HXD A;  1IN4 A;  3BJ6 A;  1SFX A;  3KLO A;  1DPR A;  5LLQ A;  1SFU A;  3F8F A;  2O3F A;  2ISZ A;  2JZY A;  5DUK A;  1UFM A;  2FMY A;  4M71 A;  4L9J A;  1WWX A;  2G9W A;  3GFL A;  1F5T A;  2BBY A;  5BS6 A;  1XMK A;  3GUD A;  2NAZ A;  3WU1 B;  4IJA A;  3MEX A;  4H0E A;  1W7P A;  3ZMD A;  4MEY F;  3LA7 A;  4EJU A;  1HKS A;  3WTW C;  3I59 A;  2CWE A;  1CF7 A;  2YX7 A;  3AAF A;  1EH8 A;  2Z9O A;  2YPR A;  5BPD A;  2XV4 S;  3FZV A;  2FEZ A;  4L9N A;  3GX4 X;  1FYK A;  4ZH4 F;  4OU0 A;  4LLL A;  1U5T B;  1TW2 A;  5LGU A;  2GWR A;  1R58 A;  3H3U A;  3V8J A;  1EH6 A;  4U0Y A;  4GYG A;  2QM3 A;  4Z2Y A;  2ZBK A;  4RGU A;  4GXO A;  2GZW A;  3SZT A;  1T0F A;  4HF1 A;  1W4M A;  2MBF A;  2FQ3 A;  4IF4 A;  5EEG A;  1XCV A;  4JK1 X;  4RAY A;  2XGX A;  2R3S A;  1QZZ A;  2GAU A;  4RGR A;  3TDU C;  4XSX F;  1IRF A;  4HZF A;  1XDU A;  1BJA A;  1Z05 A;  1U5T C;  4G7H F;  4NB5 A;  1FY7 A;  3HRU A;  1ZRF A;  3WGG A;  4OMY A;  4LLG F;  2PG4 A;  3OOP A;  5LRR A;  2H27 A;  5HS8 A;  3SFZ A;  1O3R A;  3I54 A;  5J8C A;  3IKT A;  5DV5 A;  1DP7 P;  2IRF G;  1KU9 A;  1YG2 A;  3N4M A;  2EFO A;  1LEB A;  2A5Y B;  5HLH A;  4KIC A;  3KCC A;  2IT0 A;  5JR3 A;  3C18 A;  2OD5 A;  1B9M A;  2PQ8 A;  1KU2 A;  3P9C A;  3R6S A;  4AVP A;  1FNN A;  2XAF A;  2V1X A;  5ICC A;  3E6M A;  2JPC A;  5IT9 K;  3CLO A;  1K6O A;  1YS6 A;  4RB3 C;  2ISY A;  4ENJ A;  1TNT A;  1YW9 A;  1C0W A;  1JXS A;  2FML A;  2M8E A;  4Y13 A;  1UHM A;  5AON A;  2DO7 A;  1HBX G;  4ETS A;  2JTV A;  2OQG A;  3ML6 A;  3LAP A;  2OAZ A;  5DD8 A;  5DUI A;  2VBZ A;  3B02 A;  3MZY A;  5K5O A;  3GFI A;  2XRO A;  3L9F A;  5HS9 A;  4WWC A;  4ENN A;  1IXC A;  2EFQ A;  2HDC A;  1XDS A;  2ZO4 A;  2QWW A;  1RI7 A;  3ZN0 A;  2HQN A;  2D1V A;  1KA8 A;  2W25 A;  4I01 A;  3FHZ A;  2ZCW A;  4S04 A;  4U0W A;  3VB2 A;  1R1U A;  1O3T A;  5ILV A;  4AIK A;  2ADU A;  2V9V A;  2HZT A;  3FMS A;  3L7W A;  1U2W A;  3LFK A;  2O8X A;  2IA0 A;  4HX8 A;  2UXN A;  2XAS A;  4I0B A;  1B6A A;  3C1D A;  4GGG A;  1QGP A;  2G7U A;  1FYL A;  1T98 A;  1Q1H A;  2HQR A;  1KU7 A;  1ZRE A;  4OIQ F;  1Z7U A;  5EEH A;  2ETH A;  4LK1 F;  3DEU A;  3DXJ F;  3CUO A;  1LDJ A;  3IKV A;  1MGT A;  3IL2 A;  3RYP A;  3F22 A;  1FP1 D;  4U0V A;  1TNS A;  1QZY A;  3RDI A;  4OIP F;  3JAM K;  2AXL A;  3GFM A;  2HOE A;  2QYO A;  3W6J B;  3WGI A;  1SMT A;  3QP5 A;  3SZP A;  3JTG A;  1IUY A;  4KN7 X;  4WXH A;  1HSJ A;  3DV8 A;  5LHH A;  1P4A A;  1ON1 A;  4A12 A;  3W6K B;  2D45 A;  1ZRD A;  2D1H A;  3KP7 A;  2P5K A;  1I27 A;  1LDD A;  3CUQ C;  5F1R A;  1P4W A;  4PZJ A;  1B59 A;  1G3T A;  3E6D A;  3WE3 A;  3BWG A;  1TLH B;  1IN7 A;  1ON2 A;  3FF5 A;  1XSX A;  1B1B A;  2V1U A;  3BJA A;  1J9I A;  4UVB A;  3TQN A;  4M9S A;  4M6Y A;  3PFI A;  1FYM A;  3FX3 A;  4ESF A;  3CTA A;  3TO7 A;  1S7O A;  2XAQ A;  2ELH A;  3M8F A;  3WE2 A;  2V79 A;  1MZB A;  2OU2 A;  2HKO A;  4B8X A;  3WTY C;  4UV9 A;  1EV7 A;  1FSE A;  4AIH A;  4GCV A;  2CFX A;  1HKQ A;  3E6C C;  1FZP B;  2BE5 F;  2W85 A;  3FXU A;  2UWM A;  3G3Z A;  5HDG A;  1OPC A;  5TRD A;  2R7F A;  2EFN A;  3P7N A;  2Q2E A;  3Q9S A;  3QU3 A;  3ROU A;  2OZ6 A;  2QQB A;  3K9T A;  3BDD A;  3NEU A;  1YLF A;  4ZZD A;  3D0S A;  4UNO A;  5FFX A;  1TQI A;  1TW3 A;  2HTJ A;  2O61 A;  3T0Y A;  2A6H F;  2LKP A;  1S6L A;  4M74 A;  1JGS A;  1WQ2 A;  5E1W A;  1T6S A;  4CO8 A;  3K1N A;  3KEO A;  5E8I A;  5ILU A;  2GIV A;  2WV0 A;  1BI2 A;  2JRT A;  5A2Q K;  1FT9 A;  3E5Q A;  4EM0 B;  2CSO A;  1U78 A;  5DCM A;  5CJ9 A;  4IRI A;  2E7W A;  2VE9 A;  4ZZL A;  3LAJ A;  1KYW A;  5HVQ C;  4XSZ F;  1RUN A;  5ICF A;  4YG2 F;  2E7X A;  5LHI A;  5H6R A;  1HKT A;  1QPM A;  2F2E A;  4M72 A;  3IRQ A;  2QLZ A;  1QBJ A;  2XAH A;  1QQI A;  4LK0 F;  5CVJ A;  2NNY A;  1OYI A;  3FMQ A;  2HYF A;  2HR3 A;  1R36 A;  4FHT A;  3FM5 A;  4CDG A;  1W7P B;  1JE8 A;  3T8R A;  4L5J A;  3T8T A;  3BZ6 A;  3KP3 A;  1H9T A;  4MQV A;  1OMI A;  3I59 B;  2DW4 A;  1R5G A;  4KT5 C;  4YII A;  3VOD A;  2YR2 A;  3SQN A;  4MNU A;  1Z1D A;  3GXO A;  2COM A;  3E6B A;  4IRG A;  2CGP A;  3K0L A;  4EM2 A;  4EV0 A;  5E18 F;  2OA4 A;  4EJW A;  2JPB A;  4Q48 A;  4TV7 A;  3O2P E;  2BEO A;  3U1D A;  1OYW A;  3ABT A;  5HOO A;  1F1Z A;  2RV8 A;  1MDM A;  4I09 A;  3MZH A;  3V4G A;  3HIF A;  1R7J A;  5L3C A;  5LEK A;  2DQR A;  1Z9C A;  1Z6T A;  3HHG A;  2HFH A;  3J7A O;  1R22 A;  3ZMZ A;  2EV0 A;  3KP2 A;  4ON0 A;  1BIA A;  1L0O C;  3DPL C;  4WCG A;  4IPA A;  5BPI A;  2V6C A;  1IXR C;  1FBS A;  1FWZ A;  2Z5U A;  3HTS B;  2XKP A;  3M9A A;  2LNB A;  3V7C A;  2K7L A;  1LEA A;  4WF2 A;  1Z91 A;  1BOA A;  2J5O A;  2DQL A;  3ABU A;  3T5X A;  4AIJ A;  1P4X A;  2VBY A;  3ZMU A;  2QZ8 A;  4M9X A;  4HX7 A;  3PQJ A;  3BRO A;  2IJL A;  2WTE A;  1EH7 A;  4BXU A;  3M7G A;  3TOA A;  2FOK A;  1REP C;  4P5O A;  2DTR A;  2DPD A;  2EK5 A;  4WK8 F;  1ONV A;  2DAO A;  4KIF A;  1ZGA A;  4OIN F;  3RKY A;  1IZ1 A;  3KE2 A;  3FXQ A;  4L0Y B;  2ZJ2 A;  4LG0 A;  5CVU A;  2FNA A;  2DK8 A;  3HRS A;  4XBF A;  4M73 A;  1YQA A;  3D5L A;  4P9U A;  1BC7 C;  3EUH A;  4ZYE A;  2HYG D;  2L4A A;  2L54 A;  4P9F A;  3ELK A;  3RTR A;  3DQV C;  4Y17 A;  2IA1 A;  3V7S A;  3P9I A;  3VEP A;  5L3G A;  4G7Z F;  5AIP A;  4KNY A;  5DCF A;  4KN4 X;  4GO1 A;  2EV6 A;  3HOT A;  1XGO A;  4DNC A;  4YIF A;  1KQ0 A;  3Q9V A;  4PGH A;  4LB5 A;  5L3F A;  5E1Z B;  1U3E M;  4F7Z A;  2M1B A;  2PMU A;  4LD5 A;  4HV6 A;  3PQK A;  1SD6 A;  2RKH A;  1MD0 A;  2JSC A;  2C6Y A;  4R79 A;  1USS A;  2MH9 A;  2FBI A;  3JSO A;  1IN5 A;  1S8N A;  2J5P A;  3FXR A;  2DU9 A;  2OQR A;  4EQQ A;  1B4A A;  5D6F A;  4A6E A;  6PAX A;  1OYY A;  2UZK A;  3E5X A;  3TKY A;  2CO5 A;  2YU3 A;  1J75 A;  1HW1 A;  2HEO A;  2NS0 A;  4U88 A;  1KQ8 A;  5L3E A;  1X3U A;  3RPU A;  4HDV A;  3FM3 A;  4LB6 B;  4EGZ A;  3R4K A;  4IXA A;  1U5T A;  3MCZ A;  1TBX A;  5H20 A;  1GVJ A;  3HTU A;  2P7V B;  3J80 Z;  3RIR A;  4FX0 A;  3M1E A;  2X4H A;  4KIG A;  3WG9 A;  4G8X A;  5FLX Z;  2HWV A;  2M87 A;  3RKX A;  5IT9 Z;  1D3Y A;  4CIC A;  3LST A;  1KGS A;  3EYY A;  5D4S A;  1YFH A;  1O3Q A;  3HSE A;  1PUE E;  1SAX A;  2ACJ A;  2K86 A;  5LGT A;  4YFN F;  4RB1 A;  1G6N A;  1XCB A;  3L00 A;  3KEQ A;  2CG4 A;  5DD4 A;  2A69 F;  1D5V A;  1OR7 A;  3LQR A;  2GA1 A;  3LQQ A;  2H6C A;  3N97 A;  2IW5 A;  2PLY A;  3DKW A;  5JI6 A;  1ZGJ A;  5LGN A;  2ZME A;  5KVR A;  4OOI A;  4HW0 A;  3ZN1 A;  2F5D A;  2MLK A;  1E17 A;  2DI3 A;  3COA C;  4A5N A;  5CVR A;  2NRA C;  1DUX C;  2VOO A;  3V8K A;  1RIO H;  2ZXJ A;  4QLC U;  5ICE A;  3ZMS A;  5LBQ A;  1ZLJ A;  3ZPL A;  4PCQ A;  1LJ9 A;  3TO6 A;  3J81 K;  4JQF A;  1LB2 A;  3JSP A;  3IRR A;  1BI1 A;  2KJC A;  2RC4 A;  3BJO A;  3I58 A;  2ZFW A;  4CXF A;  4HBL A;  3RYR A;  3TO9 A;  3KP6 A;  1K78 A;  3LA3 A;  4P96 A;  2EA4 A;  2RQP A;  4HYE A;  1PP8 F;  1P92 A;  3JW4 A;  1ZAO A;  4N9H A;  4A2U A;  2VE8 A;  1BC8 C;  2BYV E;  3WTS C;  2VOD A;  2RDP A;  5JFR A;  1O7L A;  4HX4 A;  5CLS A;  2VBW A;  5K1Y A;  3TDZ C;  3R60 A;  2CQK A;  4KIB A;  5DCM B;  3DP7 A;  3I0T A;  1O7F A;  3GLX A;  2ESN A;  2HKX A;  4FT8 A;  4JBA A;  1G3S A;  3QPT A;  3EYI A;  1ZG1 A;  2P6T A;  1FPQ A;  2F5E A;  4Y15 A;  2V1D A;  3GZ6 A;  1BM9 A;  1J0R A;  1RUO A;  2QBY A;  2IVM A;  4XRF A;  3HRM A;  1J59 A;  2FNP A;  3L09 A;  4UUV A;  4L9V A;  5HDK A;  3IWZ A;  1KQ9 A;  4KYW A;  4O6J A;  4A5M A;  2D2W A;  4UVA A;  3CUQ A; 
#chains in the Genus database with same CATH topology
 2A68 F;  4PUS A;  3G71 I;  2H6B A;  3AFH A;  3HG9 A;  3PFY A;  3VYR B;  2W57 A;  1FOX A;  3LSM A;  3HRT A;  3T1B A;  5GAD J;  1LFU P;  3P5J A;  3V7R A;  5D6E A;  3RKW A;  1XGN A;  2Z99 A;  2XF6 A;  1VQO I;  2R7Q A;  4BBR J;  1SFE A;  2E1M B;  4XN3 A;  5F27 A;  1WJF A;  2KRH A;  2L5Q A;  5B1B H;  2FJ1 A;  2M9H A;  3CLQ A;  4UUT A;  1ZN2 A;  4XNF A;  3KYL A;  3K4N A;  1KYZ A;  3OYH A;  2EV5 A;  3S93 A;  1I3Q J;  1VZ0 A;  3PNY A;  1H0M A;  2EJR A;  1MJB A;  3BG3 A;  3DPU A;  4G12 A;  2A6E F;  2LSO A;  3H9Q A;  2PI0 A;  4I7H A;  2OUM A;  1FLI A;  4XOR A;  4Y33 A;  4CCK A;  2HZD A;  1XSD A;  5J47 A;  2VPL A;  2ZKZ A;  3BG6 A;  2VT3 A;  4A0X A;  4BY1 J;  1A6I A;  3ZMV A;  5D8K B;  2WAQ A;  3HSR A;  1FTZ A;  1YW8 A;  2CUJ A;  2DN0 A;  2VJJ A;  3MWM A;  3FKJ A;  1YI2 I;  2E19 A;  3GF2 A;  3GTK J;  1S3J A;  3U9G A;  4MTD A;  1XGS A;  2WWY A;  1MDM B;  4PJ0 C;  5C44 J;  1ZLK A;  3BQZ A;  2YSR A;  1LQ1 A;  4MFE A;  1R1V A;  3F6V A;  3WG7 H;  4YEJ A;  3RJP A;  1B9N A;  1G3Y A;  2QF7 A;  3DTK A;  3GVA A;  2QEX I;  3BY6 A;  4A0Z A;  3QOP A;  1RKT A;  2JVG A;  4JX6 A;  1Z7L A;  2A61 A;  2P8T A;  2IPQ X;  3ZQF A;  2E1M C;  3ECO A;  1D0Y A;  2X6W A;  1QNT A;  1IDY A;  4GFB A;  1T95 A;  5JVT A;  5E17 F;  4KMU X;  2DLL A;  5JLX A;  1YYV A;  2OZU A;  2VKV A;  3H0G J;  4BQQ A;  3L2U A;  5FD5 A;  3FIW A;  3G73 A;  4UUS B;  3I3L A;  4V2G A;  1QHH D;  5EDN A;  4RGS A;  4D7M A;  2HDD A;  1S7A A;  2Y0M A;  3WU0 A;  2FF4 A;  4FX4 A;  2HS5 A;  4UV8 A;  1XSV A;  1LUJ B;  2Z3Y A;  2Z2S B;  3HBL A;  1OCZ H;  4B3A A;  4KA4 A;  2EFP A;  1F4K A;  1RC9 A;  2IP2 A;  4IRH A;  4I0A A;  4Q5S F;  2EZI A;  1OCR H;  3A1Y A;  3HGY A;  4IHX A;  1LVK A;  1R9T J;  3CDL A;  4A69 C;  5GAE J;  1CF7 B;  3ASN H;  2PFB A;  5FKN A;  2VL8 A;  2O6G E;  4M9Z A;  5DS9 A;  1LVA A;  4NC7 A;  3KP4 A;  1J7K A;  2H94 A;  3TP0 A;  5J4V A;  1DPU A;  2P7C B;  3JRB A;  2JUG A;  1SVO A;  4L9T A;  5HLG A;  5JHF A;  5FB2 A;  2GXB A;  5F1J A;  2UXX A;  1K6Y A;  4DQ2 A;  3GTM J;  1JHH A;  3S16 J;  4HOB A;  3J7Y J;  2XUB A;  4HQE A;  2STT A;  2I5U A;  2LBF A;  1WI9 A;  3HOW J;  1D8J A;  1Z21 A;  2KJB A;  3F8B A;  4HAM A;  4EGY A;  1MBH A;  4CHU A;  3A01 B;  2A3S A;  5LRS A;  3QAH A;  2GLO A;  3F9K A;  4B1R A;  1GXQ A;  1SMY F;  2VT2 A;  5ILS A;  3JCU C;  1I39 A;  4FTH A;  1NK2 P;  2PMZ A;  3IP4 B;  1CGP A;  3U21 A;  4CGZ A;  1ZAR A;  2O5R A;  4H4K C;  3L1P A;  4CYD A;  2XPW A;  2DPU A;  1ITY A;  2XB5 A;  1BR1 A;  3AG1 H;  4NHJ A;  2DDB A;  4II2 A;  2RQQ A;  1MJA A;  3ESW B;  5J4Y A;  3I53 A;  5K5R A;  1IO2 A;  1XN7 A;  1I5Z A;  4IQJ A;  1X1B A;  3S17 J;  3E97 A;  2GOM A;  2XB0 X;  3ONQ A;  5E3L A;  3CC4 I;  5IPA A;  2IGN A;  4PDK A;  1W7P D;  1G2H A;  2MH2 A;  3WTU C;  1TTY A;  1SD5 A;  2OBP A;  2NVQ J;  2DK5 A;  3OOU A;  2KIS A;  5H2F C;  1LE8 A;  2KRF A;  3IH3 A;  3RQ4 A;  3EET A;  3O3K A;  5FGM A;  3ZXS A;  2DOD A;  1ZKG A;  1E3O C;  2X6O A;  3ECH A;  4C2U A;  2ME0 A;  3G1M A;  4PGG A;  1PDN C;  3NRV A;  2R5Y B;  3D5R C;  3MKY B;  5FKO A;  2P5L C;  2X6X A;  4XKW A;  1IN6 A;  4K2E A;  5F04 A;  4BNC A;  4XRS A;  2DTZ A;  4EMS A;  2HQA A;  4A3M J;  2RN7 A;  1T0F C;  4KUM A;  1XGM A;  4D0P A;  4XOT A;  2DT7 B;  3ULQ B;  4J01 A;  2B7E A;  2XAG A;  1MND A;  2R7D A;  3JRD A;  1DGW Y;  1U8R A;  2Y9Z A;  4HF0 A;  5CVI A;  3PSI A;  1TQP A;  5H6Q A;  4E7K A;  1XB4 A;  2P5V A;  1SAU A;  4XLP F;  1TWF J;  2R7W A;  2HU9 A;  3SHF A;  3ERE D;  2W82 A;  3K1M A;  2MA3 A;  4XKV A;  1S9H A;  4HLY A;  4LMY A;  4ENM A;  2DA1 A;  2VBX A;  2XHK A;  3MD2 A;  1RKW A;  2WAQ N;  1WSU A;  5ICG A;  1TT0 A;  2G0E A;  4EJV A;  3FMR A;  1S29 A;  4KIS A;  2DOF A;  2K4J A;  1YJ9 I;  4PJN A;  3X2Q H;  2B9S A;  3FXJ A;  5D5W B;  3JRI A;  1SD4 A;  5KK1 A;  4KDP A;  5EF6 A;  3CO6 C;  1G4D A;  3WOD F;  3E0J B;  1V54 H;  3WHB A;  2W84 A;  2ZNY A;  3OYJ A;  1K79 A;  1I6H J;  3ABL H;  2TCT A;  3PJR A;  3OMY A;  3BZC A;  2W24 A;  3BG5 A;  4IHY A;  2D5V A;  2DYS H;  2E1C A;  2LF8 A;  5D4R A;  2VON A;  3UKG A;  4EJO A;  4MFD A;  1BBY A;  1X1D A;  3KPH A;  3LWF A;  2R7V A;  4U7B A;  2BW3 B;  2FX0 A;  3GO5 A;  2ID3 A;  5ERI A;  1I6X A;  5IT3 A;  4G94 A;  5M5W J;  4V19 K;  4BL0 B;  1FMV A;  2IXS A;  4EJT A;  2Y0S A;  5HDN A;  1N25 A;  2XVC A;  3L2Q A;  3F21 A;  3GTG J;  4G9Y A;  1BIB A;  3MMY B;  3ASO H;  1OKR A;  1T38 A;  3HKZ A;  1ETO A;  1VQL I;  3C3W A;  4MHG A;  3GZ5 A;  2W7N A;  3CJR B;  3FK7 A;  4HQM A;  5AIQ A;  1AWC A;  4UHT A;  1KZH A;  1VQM I;  1YO5 C;  4JOM A;  5DEQ A;  3M1C A;  3OYE A;  2FSW A;  3WTX C;  1VFC A;  2LH9 A;  3HOZ J;  1IN8 A;  2F4M B;  2XIG A;  3RZD J;  2KIF A;  1X2M A;  3WTZ A;  3H92 A;  2BGC A;  1BJZ A;  5L3D A;  1Y1V J;  4EAT A;  4F55 A;  3VFZ A;  5J6X A;  3G4S I;  1TWH J;  2EQR A;  1FOY A;  2VKD A;  1PVE A;  1P6R A;  1F9N A;  4ESB A;  4AD9 A;  3ZOB A;  3CO7 C;  1MMN A;  1X1P A;  2X85 A;  2VXZ A;  4PK4 A;  4AU7 A;  3CDH A;  3F8M A;  3HHH A;  3GTL J;  4CYC A;  3BOQ A;  3DPT A;  2V6E A;  3RI4 A;  1ULY A;  3KZZ A;  2MSY A;  5KAF C;  4ESJ A;  3BTL A;  1DDN A;  5FO5 A;  1SFO J;  1R5H A;  5F6F A;  4LGW A;  2LYC A;  4HA8 A;  2BY1 A;  3RPU D;  4N9I A;  1YIO A;  1P2F A;  4IO9 F;  3TP3 A;  5M5X J;  5EZG A;  3CMY A;  4D7N A;  2MLG A;  4BXX J;  1X1C A;  3J80 K;  3F23 A;  2PMZ N;  3WTV C;  4HF2 A;  2HOS A;  5EGO B;  3CCR I;  3GYH X;  2EWN A;  1GLN A;  1K4S A;  1O57 A;  4I2O A;  4QWQ A;  1SVL A;  1XX5 A;  1JJ6 C;  1G8X A;  2W4S A;  3F6O A;  4XKB A;  2L02 A;  2MFZ A;  2XGE A;  4IQ4 A;  2ZME B;  5F0H A;  2EBI A;  5F0F A;  2EA2 A;  1UZC A;  4AYB A;  1FBQ A;  2P81 A;  3REO A;  4RDU A;  4R1H A;  2M7A A;  4P55 A;  1VQN I;  5FLX K;  5BNG A;  3E5U A;  3S2D J;  4XLF A;  2CUE A;  5D5V B;  3M8E A;  1VQ9 I;  2XF7 A;  1JI8 A;  1IW7 F;  2MC3 A;  2GXG A;  3F8C A;  2Q8K A;  3QRF F;  3Q5F A;  3BG7 A;  2ECB A;  4PFO A;  5FKM A;  3K69 A;  3OYL A;  1V3F A;  3MZ8 A;  1FOK A;  2OCC H;  1L3L A;  2FU4 A;  4XLN F;  4W97 A;  4LLN A;  3H5A A;  1J5Y A;  1TQM A;  2L01 A;  2E36 A;  2FXA A;  4AWX B;  1PYV A;  4D5F A;  5JLW A;  1IAW A;  2IAI A;  4LFU A;  1IRG A;  2DYR H;  4DYC A;  2GQQ A;  4C30 A;  3H3V K;  3BPX A;  4M6V A;  4YFX F;  3GW2 A;  3MFK A;  2Y30 A;  2RGV A;  3WGH A;  2VKE A;  1D0Z A;  2NS7 A;  2L0K A;  5F64 A;  5CVV A;  1D0X A;  1ZH5 A;  1AOY A;  4AUX A;  2ZME C;  4BGD A;  1LPQ A;  1K78 B;  4RS8 A;  5LEJ A;  3CJT B;  2KL4 A;  1HDP A;  2PN6 A;  3QQA A;  2GA2 A;  3JTH A;  3P9K A;  3Q0W A;  3PO3 J;  4BH9 A;  2L2O A;  1X1A A;  1X3Z B;  3F8N A;  4OIO F;  5D8L B;  3EDP A;  2LLK A;  1HOM A;  1U6G A;  2LF7 A;  3KET A;  4EVI A;  4XRM A;  3GFJ A;  2CYY A;  2PMH A;  3QOE A;  3QU6 A;  1MSE C;  5FKK A;  3EQL F;  1Z67 A;  2M5W A;  2M4G A;  1DU0 A;  4S05 A;  4ZYG A;  1NTC A;  2QVO A;  3I9V 2;  2L9N A;  3GLL A;  4A0Y A;  3CP2 A;  4L0Z B;  2F4I A;  1SD7 A;  3W2V A;  3AG4 H;  2M30 A;  4BUP A;  2ESH A;  1PP7 U;  5J8F A;  2HVR A;  4YFK F;  2VAS A;  2WBM A;  1YRN B;  4DGW B;  3QP6 A;  4XLC A;  4M6X A;  4AVZ A;  1VTN C;  1A04 A;  2DJN A;  1XTA A;  3J7Z I;  2VOP A;  3RCO A;  1WFX A;  4HG2 A;  3K2Z A;  1QU3 A;  3U2R A;  4UB8 C;  3GZN B;  4E70 A;  1YIJ I;  3IHU A;  2LDU A;  4F52 A;  3BT9 A;  4OMZ A;  3VPR A;  5FD6 A;  2EFW A;  3R0J A;  1ETV A;  4ASN A;  3M4O J;  3GEZ A;  2RNJ A;  3H35 A;  2CW8 A;  1YS7 A;  2OF7 A;  4A6D A;  4C3H J;  4O3M A;  2HYJ A;  3RQI A;  1ZYR F;  2FE3 A;  1SEU A;  3S32 A;  2L4M A;  2IS6 A;  1S7E A;  2QQ8 A;  2Y0S N;  5E20 A;  3CME I;  1D8K A;  1UG0 A;  1YW7 A;  4PJM A;  4RB2 C;  5DYM A;  3VSL A;  3HKZ N;  1P9Q C;  4HLX A;  2VC0 A;  3DFG A;  3OIP A;  3TW6 A;  2FA5 A;  2QBY B;  1I1S A;  1E2X A;  3B73 A;  1WJ5 A;  4KMF A;  2VIX A;  2BY0 A;  1QO0 D;  1WRJ A;  1FSH A;  1HW5 A;  2B0L A;  4NUB A;  1EF4 A;  5C3E J;  1V4R A;  3BR0 A;  1V5E A;  1ETW A;  1D1A A;  2F5C A;  5B5E C;  3OV8 A;  3OIQ A;  3ZQ7 A;  2DXI A;  2DMQ A;  4ABZ A;  5M5Y J;  3CUQ B;  2COB A;  1K61 A;  4XON A;  2QSF X;  1RNL A;  2WAE A;  1O3S A;  2KP6 A;  2KPM A;  2DFF A;  2H09 A;  1WJB A;  4CA0 A;  1W5T A;  3S3O A;  3KZY A;  2JMW A;  2LMD A;  2FRH A;  4Z6Y A;  2XAJ A;  3BP8 A;  2JA8 J;  4X1E A;  1OCT C;  1B8I B;  4XIC A;  2Y75 A;  3K4J A;  1IF1 A;  2NYX A;  4P1W A;  3ISP A;  3I71 A;  2DT5 A;  4IHT A;  2QQA A;  1T56 A;  5EG0 A;  2BXZ A;  4RGX A;  2M0M A;  3HOS A;  2QQ9 A;  1MKM A;  2VC1 A;  3EPZ A;  3O6B B;  3CCQ I;  3S8P A;  1OCO H;  1IV6 A;  2HPI A;  1ETQ A;  3HJE A;  1Y8Q B;  3BPV A;  4PJJ A;  2Z33 A;  2HGC A;  3HSF A;  4EM1 A;  4MTE A;  3DF8 A;  3I5U A;  1T08 B;  1T39 A;  2HTS A;  1GXP A;  2QUF A;  3LA2 A;  3FXO A;  5E1X A;  4AYB N;  3H0D A;  3FHN A;  2O03 A;  3E1S A;  3IC7 A;  3L2R A;  1FX7 A;  1YJN I;  2XPV A;  2K85 A;  5GTI C;  4RB0 A;  1GDT A;  1F36 A;  2WY7 Q;  5ED4 A;  2IA2 A;  3UR3 C;  3SXY A;  2IS1 A;  2QEN A;  4ZYH A;  3JAM Z;  1K4T A;  3J81 Z;  2NNN A;  2E35 A;  1Y8R B;  3KP5 A;  4RMN A;  4IVN A;  5TJJ A;  3TGN A;  1O4X A;  1K7A A;  1OCC H;  1HW2 A;  1WKM A;  2XRN A;  1HST A;  3Q0V A;  3OS0 A;  4ZYD A;  1VND A;  3Q0U A;  4RAZ A;  3V8L A;  3ZP5 A;  2AHQ A;  2VQG A;  3JR9 A;  2FBH A;  4DBR A;  2PJP A;  1UCR A;  1J2X A;  2FBK A;  1GHC A;  3VDX A;  4OIR F;  2ELJ A;  2Y48 A;  3FXM A;  2UV1 A;  2AS5 F;  3OIO A;  1IRX A;  4U87 A;  4BYY A;  2ZNZ A;  1MJ9 A;  1WVR A;  5BQT A;  2A05 A;  3QPH A;  4BBS J;  4ZYA A;  2X1D A;  4BAC A;  2TDX A;  5FLM J;  3DTI A;  3WTT C;  3G2B A;  1MH3 A;  4IHS A;  1IJW C;  3IWF A;  2AQF A;  3GTO J;  2PJR A;  3F3X A;  3H3Z A;  1YX3 A;  2KQR A;  4Q47 A;  4HNT A;  3S2W A;  1I1G A;  5HLI A;  2K02 A;  3S15 J;  3HYI A;  1IUF A;  2HNH A;  3HUG A;  1UAA A;  1MBE A;  1J09 A;  2E1N A;  1RZ4 A;  2P6S A;  5KCM A;  4O5V A;  1KON A;  1AKH A;  1YOV B;  4PSW A;  2KDZ A;  2DT6 A;  3OYC A;  3I4P A;  2A5W A;  3RPQ A;  1FC3 A;  4BHP A;  1DP3 A;  4D9J A;  2KIM A;  4KIT B;  2NOG A;  4I02 A;  1KU3 A;  4CZZ A;  5CKT A;  2LBF B;  4LJZ F;  3IH4 A;  2F5F A;  4R8H A;  2DBB A;  2L3D A;  3OS2 A;  1IGN A;  1ZHF A;  4UXN A;  1QVT A;  2OPT A;  5HS7 A;  2BV6 A;  2BHZ A;  4HV5 A;  2YU9 J;  4NQW A;  2WAD A;  3QWL A;  4G6D A;  1BN5 A;  5CYV A;  3JRG A;  9ANT A;  2KIU A;  5IOZ A;  2OC6 A;  3KX2 A;  1W5S A;  1H9G A;  1M1E B;  4JP0 A;  2VQC A;  5C4X J;  1UB9 A;  2LR8 A;  3TED A;  2VN2 A;  2OJE D;  3N05 A;  5IYD J;  3ZMT A;  1H89 C;  1UHW A;  2MD0 A;  3EUA A;  2DA5 A;  4B09 A;  3L2C A;  5E3N A;  5J40 A;  2HOT A;  4WX9 A;  4HNV A;  5BOX A;  2R7U A;  1UHS A;  4MGR A;  3I55 I;  2LD5 A;  1R1T A;  1XMA A;  1WCM J;  4HEA 2;  1D5Y A;  1Z6R A;  4C3I J;  1NHA A;  3CJN A;  3J7A Y;  4BHB A;  4W1U A;  2V26 A;  3S3N A;  2YX4 A;  2ZC2 A;  1HQC A;  4NC8 A;  1JHF A;  4Q4Z F;  4XL9 A;  2XKO A;  3VOE A;  5JHU A;  3NQO A;  3TOB A;  4G6Q A;  5K5Q A;  4FE4 A;  2RVC A;  3D5S C;  3OY9 A;  4L18 B;  4ENK A;  3FWE A;  4L5I A;  1RET A;  2NS8 A;  4MEX F;  2KKO A;  3C7J A;  4N0B A;  1YTY A;  2G7H A;  1U9N A;  3K6G A;  1LKX A;  2DMP A;  1XD7 A;  2KZG A;  1STZ A;  4UVC A;  3SFI A;  5L3B A;  1ZRC A;  1BW5 A;  5D5U B;  4IZZ A;  1FBU A;  3AG2 H;  1FP2 A;  1FOW A;  2STW A;  1LFB A;  2EIM H;  1MBK A;  3A03 A;  3MAJ A;  1Y0U A;  5A2Q Z;  3F72 A;  3GWZ A;  5E79 C;  1IXS B;  1NG7 A;  1ODD A;  2N8G A;  1BI3 A;  4LIV A;  4I98 B;  5BMZ A;  1NG6 A;  4MO7 A;  2EZK A;  5D5X B;  2MD5 A;  4BQA A;  2A07 F;  1G3W A;  4MQ9 F;  3ZR8 X;  5LHG A;  3JRE A;  2O0Y A;  5KNL A;  2PBI A;  2V4J C;  3K1P A;  3DU5 A;  1YE9 A;  4KFC A;  1T2K A;  3BTI A;  3R61 A;  2DJI A;  5DDG A;  4M3D A;  1V5G A;  2WC2 A;  3ZQG A;  4EEF G;  4II3 A;  3E3V A;  1MBG A;  3KLN A;  1MMA A;  4U7D A;  1ZG3 A;  3HOU J;  1PJR A;  2M4K A;  3W2W A;  3I64 A;  2PEX A;  3KFW X;  4LG0 B;  2FQ4 A;  2FUG 2;  2LRD A;  2ZSI B;  2DFI A;  1WJE A;  4G7O F;  3KIO A;  2K4B A;  1MSF C;  2K27 A;  1GVD A;  2M45 A;  2P4W A;  1WJD A;  3PNV A;  4C3J J;  4DYR A;  2W00 A;  4WXC A;  3BZK A;  2CV0 A;  4GYI A;  1UST A;  4HDU A;  5IP7 J;  2CW0 F;  5FFZ A;  1UMQ A;  1BI0 A;  1LDK B;  2BHY A;  5FKL A;  1QHG A;  2X0L A;  1R23 A;  1ZG5 A;  2DCE A;  2HXI A;  3MQ0 A;  1QRY A;  4N4N B;  1LNW A;  5CPR B;  2F48 A;  3K2A A;  1R00 A;  4DIQ A;  2Q0O A;  2EB7 A;  4BAY A;  3CMM A;  2JVH A;  5E8G A;  2L9S A;  2JT1 A;  1QA6 A;  4UY8 I;  1R5I D;  2K9M A;  5DM7 F;  2ZXH A;  4DYQ A;  4WXD A;  1X2N A;  3CES A;  2EIK H;  3R0A A;  4BHC A;  2YUS A;  1HXD A;  1IN4 A;  3FDY A;  1RR8 C;  3BJ6 A;  1SFX A;  2XRL A;  1DQU A;  3KLO A;  2JRM A;  1DPR A;  1ETY A;  5LLQ A;  1SFU A;  3F8F A;  2O3F A;  2E2I J;  2ISZ A;  2JZY A;  3BCB A;  3GTQ J;  3OL3 A;  5J3L A;  5DUK A;  1VQK I;  4XK4 A;  4DZJ A;  1UFM A;  2F4O B;  4C9Y A;  2FMY A;  4M71 A;  2EZH A;  3LNQ A;  2CRG A;  3G6E I;  4A3L J;  4L9J A;  1WWX A;  2G9W A;  3G1O A;  3EUH C;  1QZE A;  3GFL A;  1F5T A;  1JTX A;  2BBY A;  5BS6 A;  4B3X A;  1XMK A;  3GUD A;  3CCM I;  4ZDP A;  2GIZ A;  2NAZ A;  3WU1 B;  2JQ7 A;  4IJA A;  3MEX A;  3MKZ A;  3DEE A;  4H0E A;  2O9L A;  1W7P A;  2LTP A;  3BR5 A;  2R4G A;  1K83 J;  3ZMD A;  2V9K A;  4MEY F;  3L2V A;  2X9D A;  1X58 A;  2M7B A;  4F92 B;  3LA7 A;  1WHU A;  3MKW B;  2HPM A;  4EJU A;  1HKS A;  2BVM A;  3WTW C;  2M0C A;  3I59 A;  2CWE A;  4CCO A;  3EUK L;  1CF7 A;  1VQ5 I;  2YX7 A;  3AAF A;  1EH8 A;  4HST A;  2Z9O A;  2YPR A;  3K4M A;  5BPD A;  3BTJ A;  2W48 A;  2CUF A;  2XV4 S;  1WH7 A;  3FZV A;  2FEZ A;  1GT0 C;  4L9N A;  3GX4 X;  4NC6 A;  1FYK A;  4ZH4 F;  1S5L C;  4BJ6 C;  4OU0 A;  1TWA J;  4LLL A;  1I3A A;  1OFC X;  1U5T B;  1TW2 A;  2CQ7 A;  2CS3 A;  2UUZ A;  2X51 A;  5LGU A;  1TC3 C;  3DBH B;  2GWR A;  1R58 A;  2CW7 A;  3H3U A;  4E7Z A;  3V8J A;  1FJL A;  3OYD A;  1EH6 A;  1HF0 A;  3PUF A;  4GYG A;  2QM3 A;  4Z2Y A;  4U0Y A;  2ZBK A;  2BZT A;  2CQN A;  4RGU A;  1B72 A;  1ERD A;  4GXO A;  3H9J A;  2GZW A;  4YRV A;  3OR2 C;  2WAF A;  3SZT A;  1GV5 A;  4GDF A;  1T0F A;  1IDZ A;  3SDG A;  4HF1 A;  1W4M A;  2MBF A;  3TMO A;  2FQ3 A;  4IF4 A;  5EEG A;  2RNG A;  1XCV A;  4JK1 X;  3BTC A;  3WHC A;  4RAY A;  3CCU I;  1HC8 A;  1YIT I;  2XGX A;  2R3S A;  3FIS A;  1QZZ A;  2GAU A;  4RGR A;  3HPH A;  2E5N A;  4XSX F;  3TDU C;  1IRF A;  4HZF A;  1XDU A;  1ENH A;  1BJA A;  1Z05 A;  1EJ9 A;  3C2G A;  1U5T C;  1E3P A;  4G7H F;  3LL7 A;  4NB5 A;  3HPG A;  1FY7 A;  3HRU A;  1ZRF A;  4I6Z A;  3WGG A;  2FOW A;  4JX4 A;  1Z3X A;  4I76 A;  4OMY A;  4LLG F;  2M8G X;  4CCL A;  4QTR A;  2PG4 A;  3OOP A;  5LRR A;  2R7X A;  5C4J J;  2H27 A;  5HS8 A;  3SFZ A;  1A6Q A;  1TZL A;  2GBY A;  1O3R A;  4XLA A;  2K3F A;  4DOZ A;  2E5Z A;  3I54 A;  5J8C A;  2JK3 A;  4BJT A;  4A93 J;  2X1C A;  3IKT A;  5DV5 A;  1DP7 P;  2IRF G;  1KU9 A;  1YG2 A;  3N4M A;  4ZTJ A;  1IRZ A;  1APL C;  2EFO A;  5DM6 F;  1LEB A;  2A5Y B;  2K3P A;  2CJJ A;  5HLH A;  2Y31 A;  4KIC A;  3HB9 A;  2ZFU A;  3UNG C;  3BR3 A;  2KMU A;  3KCC A;  3DLL F;  2IT0 A;  1JKP C;  5JR3 A;  5DTD A;  3C18 A;  4A3I J;  2OD5 A;  1B9M A;  2PQ8 A;  2R7T A;  3I56 I;  1DU6 A;  1KU2 A;  5E3M A;  2RRE A;  3P9C A;  3R6S A;  4AVP A;  2IS2 A;  2E60 A;  1FNN A;  2DMU A;  2XAF A;  2V1X A;  3LMM A;  2O8K A;  3A0H C;  5ICC A;  5IYB J;  3HDD A;  2F5V A;  3E6M A;  2JPC A;  4NBQ A;  5IT9 K;  1XPX A;  4BEH A;  3CLO A;  1K6O A;  1YS6 A;  4RB3 C;  2ISY A;  4ENJ A;  1TNT A;  4E7H A;  1H8A C;  1YW9 A;  1C0W A;  1JXS A;  2FML A;  3ZRG A;  2BY3 A;  2M8E A;  3ZQH A;  4Y13 A;  1UHM A;  5AON A;  2WB1 A;  1Z3Y A;  3TW7 A;  2DO7 A;  4JX5 A;  1HBX G;  4ETS A;  2JTV A;  3GME A;  2OQG A;  2R93 J;  3M3Y J;  3IAM 2;  3ML6 A;  2DMT A;  3LAP A;  3PIO F;  2DA6 A;  1OR7 C;  2F6C A;  2OAZ A;  5DD8 A;  3SYT A;  5DUI A;  2VBZ A;  3B02 A;  5GAH J;  1JTY A;  3MZY A;  4ZC3 A;  1UJ8 A;  3LOC A;  2VPR A;  5K5O A;  1A35 A;  3GFI A;  1F43 A;  2XRO A;  4B4C A;  4M3F A;  4CSW A;  3BR1 A;  3L9F A;  1MBF A;  1T33 A;  5HS9 A;  3OYG A;  2KHM A;  4WWC A;  2ZJQ F;  4ENN A;  4B43 A;  1IXC A;  2EFQ A;  3SEZ A;  1XDS A;  2HDC A;  2KZV A;  2VLA A;  5HLT A;  2ZO4 A;  2H1L A;  2X48 A;  2R5Z A;  1ZR4 A;  2QWW A;  1EKE A;  4RM2 A;  1RI7 A;  3ZN0 A;  4AID A;  2HQN A;  5EG0 B;  3ZCO A;  2D1V A;  1KA8 A;  2W25 A;  4I01 A;  2LK2 A;  3FHZ A;  2ZCW A;  4S04 A;  4U0W A;  3BR6 A;  1ZTR A;  3VB2 A;  1R1U A;  1GV2 A;  1O3T A;  5ILV A;  4AIK A;  1BOB A;  3FBN B;  2CUZ A;  3NAR A;  4CCJ A;  3AL0 B;  2ADU A;  3CF5 F;  2DA4 A;  3MN2 A;  2V9V A;  1G59 A;  2HZT A;  2MG4 A;  3CQZ J;  3FMS A;  3IAS 2;  3L7W A;  1U2W A;  1UEL B;  3LFK A;  5TIS C;  4LIU A;  4E7I A;  2JA7 J;  4X0G A;  3LFU A;  3OYN A;  2O8X A;  1R6R A;  1HDD C;  1CQT A;  2IA0 A;  4HX8 A;  3CC7 I;  5F08 A;  3FBI B;  2OTJ I;  2UXN A;  2XAS A;  1JUM A;  2Y2Z A;  5M3F J;  4I0B A;  4E7S A;  3BCA A;  3NWS A;  5CQG A;  1B6A A;  3C1D A;  4GGG A;  1QGP A;  1D1C A;  2R7O A;  2CH0 A;  2G7U A;  3BR2 A;  1FYL A;  2B63 J;  1T98 A;  1Q1H A;  2HQR A;  1KU7 A;  4MIM A;  1YX5 A;  1FIP A;  1ZRE A;  4OIQ F;  1Z7U A;  2IGM A;  2XDV A;  5EEH A;  1DGR M;  1SVM A;  2L9V A;  2ETH A;  4LK1 F;  3DEU A;  3DXJ F;  2AO9 A;  3AL0 C;  3CUO A;  1LDJ A;  3DKX A;  3IKV A;  1MGT A;  3IL2 A;  2XSD C;  3PO2 J;  1MBJ A;  3OL4 A;  2E71 A;  4V2F A;  3RYP A;  4ZDL A;  2PJR B;  3F22 A;  1FP1 D;  1WZ2 A;  1TT5 B;  4U0V A;  1TNS A;  2L7K A;  1QZY A;  3RDI A;  4OIP F;  3JAM K;  2AXL A;  3GFM A;  4FE7 A;  2HOE A;  3A0B C;  3DLA A;  2M2E A;  2DFH A;  2QYO A;  4BQO A;  3W6J B;  3WGI A;  1SMT A;  3QP5 A;  4ZDO A;  3SZP A;  3JTG A;  1PUF A;  2VKH A;  1IUY A;  4KN7 X;  4WXH A;  3ABK H;  3L2W A;  1HSJ A;  4XLE A;  3DV8 A;  4BY7 J;  1R71 A;  2MAB A;  5LHH A;  3KYC B;  1P4A A;  3I4N J;  1ON1 A;  4A12 A;  1ZEL A;  3W6K B;  2D45 A;  1EA3 A;  2VJI A;  2MYS A;  1BW6 A;  1ZRD A;  2D1H A;  1VQ7 I;  4NQW B;  3ZQQ A;  2DFE A;  5GTH C;  1SC7 A;  3KP7 A;  1MNE A;  2P5K A;  3GTP J;  1I27 A;  1WJA A;  2WA0 A;  4J00 A;  2Y69 H;  3LSG A;  3B6C A;  1LDD A;  3CUQ C;  5F1R A;  1P4W A;  1W1W E;  2VXD A;  4PZJ A;  2V1N A;  1B59 A;  2Z16 A;  4OWR B;  4YEL A;  1G3T A;  3E6D A;  3WE3 A;  3FXL A;  1H88 C;  4BDY A;  3BWG A;  2QGU A;  2W1O A;  2QA4 I;  1TLH B;  2BY2 A;  1IN7 A;  2OCE A;  1MNM C;  1ON2 A;  2ICW G;  4BJ5 C;  3FF5 A;  2HDW A;  1XSX A;  1B1B A;  2HOA A;  2V1U A;  3BJA A;  1J9I A;  2ZJR F;  4UVB A;  3TQN A;  3S1Q J;  1Y1W J;  4M9S A;  4M6Y A;  2XGD A;  3VYT B;  3OYM A;  3VYU B;  2CMP A;  4RA2 A;  3PFI A;  3CCJ I;  1FYM A;  3FX3 A;  4ESF A;  4BE1 A;  1ZR2 A;  3CTA A;  2HI3 A;  3TO7 A;  1S7O A;  3HGG A;  2XAQ A;  2ELH A;  3M8F A;  1MMG A;  3WE2 A;  3S1R J;  4A3B J;  2V79 A;  1MZB A;  3C2H A;  5IOY A;  1BR4 A;  2OU2 A;  2HKO A;  4B8X A;  4OAY A;  3WTY C;  4A3E J;  4UV9 A;  1EV7 A;  2L7F P;  3HOV J;  1FSE A;  4AIH A;  2XAU A;  4GCV A;  4IX7 A;  2CFX A;  1WH5 A;  2XC7 A;  1HKQ A;  4RBO A;  3FK6 A;  1V5F A;  1N78 A;  3G1L A;  3E6C C;  1FZP B;  2BE5 F;  2W85 A;  3FXU A;  2UWM A;  1W0T A;  4IEJ A;  3G3Z A;  2OTL I;  2NOJ B;  2KDO A;  4JYK A;  2HVQ A;  2GOX B;  5HDG A;  3K10 A;  1OPC A;  5TRD A;  2R7F A;  2E1O A;  2EFN A;  2OV7 A;  3P7N A;  2Q2E A;  3Q9S A;  3QU3 A;  3BQY A;  2K5C A;  3ROU A;  2OZ6 A;  2QQB A;  3K9T A;  5JVG F;  4A3F J;  3NWT A;  2A6T A;  3BDD A;  1IC8 A;  3NEU A;  1YLF A;  1AHD P;  2CU7 A;  3LSK A;  3CDI A;  4ZZD A;  3D0S A;  3CP8 A;  2LY2 A;  3BG9 A;  4UNO A;  5FFX A;  1TQI A;  1TW3 A;  3ZQI A;  1ZGW A;  2HTJ A;  2JA2 A;  2O61 A;  3T0Y A;  3HEF A;  2LG4 A;  4GRI A;  2A6H F;  1FIA A;  2VQL A;  4XQF A;  2LKP A;  5GAG J;  3PUB A;  1B8I A;  1S6L A;  4M3E A;  4A3J J;  3OSG A;  4M74 A;  1JGS A;  1WQ2 A;  5E1W A;  2FD5 A;  1T6S A;  1W5C C;  4CO8 A;  3K1N A;  3RKQ A;  2CV2 A;  3KEO A;  5E8I A;  5ILU A;  2DOE A;  2GIV A;  2WV0 A;  1BI2 A;  3QYE A;  3A4C A;  2JRT A;  3S1M J;  2DA7 A;  3VSK A;  3HM5 A;  3O8G A;  4OAZ A;  4F91 B;  5A2Q K;  4LOC A;  3FXK A;  1FT9 A;  3E5Q A;  3K4B A;  3LSI A;  4EM0 B;  2VI6 A;  3LSP A;  2CSO A;  3LSR A;  1U78 A;  1NH3 A;  1QPI A;  1IV8 A;  3QYF A;  5DCM A;  5CJ9 A;  1NK3 P;  2E7W A;  4IRI A;  4B44 A;  1LE8 B;  5B66 C;  2VE9 A;  1X19 A;  4ZZL A;  3ZGK A;  3LAJ A;  2ZB9 A;  4FCY A;  3OR1 C;  2K9Q A;  1KYW A;  1Q1V A;  3K4L A;  5HVQ C;  4XSZ F;  1RUN A;  5ICF A;  4YG2 F;  2E7X A;  2JSP A;  2AXT C;  1OCP A;  2O7O A;  5EZH A;  5LHI A;  5H6R A;  1HKT A;  3IUO A;  2WV1 A;  3S14 J;  1JT0 A;  4J19 A;  5CQE A;  1XC5 A;  1QPM A;  1N77 A;  2F2E A;  4M72 A;  2MGQ A;  4KJZ A;  1JKQ C;  3H5N A;  1VI0 A;  5FJ8 J;  1JUP A;  3IRQ A;  2QLZ A;  1QBJ A;  2XAH A;  1QQI A;  4LK0 F;  2BVL A;  5CVJ A;  1OYI A;  2NNY A;  3FMQ A;  4CCM A;  2HYF A;  2HR3 A;  1R36 A;  4FHT A;  3FM5 A;  4CDG A;  1W7P B;  1JE8 A;  1BA5 A;  3OYB A;  3OSF A;  3T8R A;  4HPQ A;  1RES A;  4L5J A;  1N75 A;  3T8T A;  3BZ6 A;  3FKI J;  1BR2 A;  3KP3 A;  2MC4 A;  4LG3 A;  4AC0 A;  1H9T A;  1VQ4 I;  4MQV A;  1OMI A;  3I59 B;  2DW4 A;  2QCO A;  4BE2 A;  1R5G A;  4XLH A;  1OLT A;  4XM3 A;  4KT5 C;  2K40 A;  4DJA A;  4YII A;  3VOD A;  2YR2 A;  3SQN A;  4MNU A;  5K7F A;  3K70 C;  1Z1D A;  5HOD A;  1R49 A;  3CZ6 A;  3GXO A;  2COM A;  3E6B A;  4IRG A;  3DBR B;  2CGP A;  1TWC J;  3JRF A;  3K0L A;  5FRM A;  4NDL A;  4EM2 A;  4Y7N J;  3OYA A;  4EV0 A;  5E18 F;  1U0J A;  2OA4 A;  4EJW A;  2JPB A;  4XMY A;  4RAF A;  4Q48 A;  4TV7 A;  1MIJ A;  4ZJZ A;  3O2P E;  2BEO A;  3U1D A;  1WI3 A;  5GPC A;  4E6K G;  1B72 B;  4RM3 A;  1OYW A;  3ABT A;  5HOO A;  3K70 D;  1RR7 A;  1F1Z A;  1RPW A;  2RV8 A;  4XN0 A;  4Y52 J;  2Q1Z B;  2GXA A;  3HOX J;  1MDM A;  3WU2 C;  4I09 A;  5M3M J;  1Y56 A;  2E34 A;  1R4N B;  1VQ8 I;  3PSF A;  5GP9 A;  3MZH A;  2VB6 A;  2EIL H;  3V4G A;  4BE0 A;  1T8I A;  3HIF A;  1R7J A;  5L3C A;  5LEK A;  2DQR A;  1Z9C A;  1Z6T A;  3HHG A;  1P7I A;  4CCN A;  1YHQ I;  4DW6 A;  3ZQL A;  2HFH A;  4XR6 A;  1V55 H;  3J7A O;  2R7S A;  4QSH A;  4ITV A;  3IV5 A;  1R22 A;  3ZMZ A;  4F93 B;  2EV0 A;  4XOP A;  4Y4R A;  2JUC A;  3KP2 A;  4ON0 A;  3A2K A;  3M8J A;  1BIA A;  1L0O C;  2LRE A;  3DPL C;  4WCG A;  4M3B A;  4IPA A;  3DCF A;  5BPI A;  2QSH X;  1WPK A;  4CYC B;  2V6C A;  1IXR C;  1FBS A;  4UUS A;  5B1A H;  1FWZ A;  2Z5U A;  2QKM B;  3HTS B;  1HA8 A;  3H9G A;  2KIQ A;  2XKP A;  3DBL B;  3M9A A;  3CCV I;  2LNB A;  1X4O A;  5FRO A;  4IOC F;  2QSG X;  3V7C A;  2K7L A;  1MW7 A;  4A3C J;  2H1K A;  1LEA A;  4WF2 A;  1Z91 A;  2JN6 A;  2KFD A;  3V42 A;  2L7M P;  1BOA A;  2J5O A;  2DQL A;  4BQN A;  1AU7 A;  5GPA A;  3ABU A;  1JJ8 C;  5TGT A;  3T5X A;  4AIJ A;  2XPU A;  3CCE I;  4FIS A;  1P4X A;  1LFP A;  1ORK A;  2VBY A;  3ZMU A;  1E0E A;  3S3M A;  2QZ8 A;  2K9S A;  4BS9 A;  4M9X A;  3HXL A;  4HX7 A;  1E3H A;  3PQJ A;  2K9N A;  2LVS A;  2LY1 A;  3BRO A;  2IJL A;  5K7Z A;  2WTE A;  1EH7 A;  4BXU A;  3M7G A;  3HL2 A;  3TOA A;  2FOK A;  1REP C;  4XKC A;  1WGX A;  4BEH B;  2ID6 A;  5KAI C;  4P5O A;  2CQQ A;  3DEW A;  2DTR A;  3OS1 A;  2DPD A;  2EK5 A;  4D5C A;  4WK8 F;  1ONV A;  2DAO A;  4KIF A;  3KEY A;  3Q3S A;  3NAU A;  1ZGA A;  2R7R A;  4OIN F;  3RKY A;  1IZ1 A;  3A01 A;  2KLO A;  3A02 A;  2I8D A;  2DDA A;  3KE2 A;  3MKL A;  3JRA A;  3FXQ A;  4L0Y B;  2ZJ2 A;  3W3C A;  4LG0 A;  2LKX A;  5CVU A;  2FNA A;  1FEX A;  4I99 C;  1XMX A;  1JKO C;  2DK8 A;  2K9L A;  3DKY A;  4X6A J;  3HRS A;  4XBF A;  3CF2 A;  4M73 A;  1YQA A;  3D5L A;  4P9U A;  1BC7 C;  3EUH A;  2CV1 A;  1W36 C;  3SDB A;  1VQP I;  4ZYE A;  1Z0X A;  2HYG D;  2L4A A;  2L54 A;  2LOO A;  3U1K A;  3ZQC A;  4P9F A;  3ELK A;  3RTR A;  3DQV C;  4Y17 A;  2IA1 A;  1U8B A;  4KT6 A;  2R5Z B;  2LFB A;  3V7S A;  3P9I A;  3VEP A;  5L3G A;  4G7Z F;  1ACI A;  3RSN A;  2JJ7 A;  2VUM J;  5AIP A;  4KNY A;  2RAE A;  1MH4 A;  3M07 A;  4LIT A;  5DCF A;  3IH2 A;  1A36 A;  4FAS D;  4KN4 X;  4GO1 A;  1TL8 A;  3LSJ A;  2EV6 A;  3HOT A;  1OQY A;  2VQH A;  2R5Y A;  1XGO A;  3CJQ B;  5LFA A;  4DNC A;  4YIF A;  1KQ0 A;  1W36 D;  2R7Z J;  4E7L A;  3Q9V A;  3C2B A;  1FMW A;  1Y0N A;  1VF9 A;  4PGH A;  1A5J A;  2YS9 A;  4LB5 A;  5L3F A;  2EZL A;  5E1Z B;  1U3E M;  4F7Z A;  2M1B A;  2PMU A;  4LD5 A;  1BL0 A;  4HV6 A;  3PQK A;  3BC8 A;  5LD2 C;  4Y3O A;  1ETX A;  1SD6 A;  4CZC A;  2RKH A;  2GM4 A;  1MD0 A;  2JSC A;  2NVY J;  2C6Y A;  3CCY A;  1JKR C;  3CCS I;  1JGG A;  2DA3 A;  4R79 A;  2ZSH B;  2TRT A;  1USS A;  2BOL A;  2MH9 A;  2FBI A;  3K7A J;  3JSO A;  1IN5 A;  1S72 I;  1S8N A;  2IS4 A;  2J5P A;  3PNT A;  3FXR A;  3S2H J;  2DU9 A;  2OQR A;  4EQQ A;  1B4A A;  5D6F A;  4A6E A;  2CQX A;  2XSJ C;  1ZK8 A;  6PAX A;  1OYY A;  2WY8 Q;  3RZO J;  4G6T B;  2ELK A;  4DBQ A;  4QPO A;  1YJW I;  2UZK A;  3E5X A;  3TKY A;  4A3G J;  4C2T A;  3OYF A;  2CO5 A;  2YU3 A;  1J75 A;  1HW1 A;  2HEO A;  2NS0 A;  3K4C A;  5EYR A;  2ZXW H;  4ZTF A;  4PSX A;  4U88 A;  4HNU A;  3E7L A;  5HNH A;  1KQ8 A;  5L3E A;  1X3U A;  3RPU A;  4HDV A;  3FM3 A;  4LB6 B;  4EGZ A;  5E3O A;  3H1C A;  3QPL A;  3R4K A;  4IXA A;  2EPF A;  1JT6 A;  1U5T A;  5IP9 J;  3K4K A;  4BDZ A;  5J1Y A;  1TWG J;  3F0C A;  3MCZ A;  4HSR A;  3PL8 A;  2MW8 A;  5IYC J;  2BW3 A;  3W2A A;  3AG3 H;  3DU6 A;  1TBX A;  3CD6 I;  5H20 A;  3GCM A;  4PJL A;  3JRH A;  1GVJ A;  3PM1 A;  2PX9 A;  4RAG A;  3HTU A;  2P7V B;  3J80 Z;  3JRC A;  3RIR A;  4FX0 A;  1PUF B;  3M1E A;  4D1Q A;  2X4H A;  4KIG A;  4RLQ A;  3WG9 A;  2LC2 A;  4G8X A;  3BLY A;  3AKZ A;  4HRI A;  2P0W A;  3B6A A;  1WJC A;  3HOY J;  1D1B A;  1TP4 A;  2IGO A;  3TBI A;  2LKS A;  5FLX Z;  1POG A;  2HWV A;  3OYK A;  2M87 A;  3ABM H;  2EIN H;  3RKX A;  3O8H A;  5IT9 Z;  1D3Y A;  1Y6I A;  4CIC A;  2BXY A;  3LST A;  4RLF A;  1KGS A;  2NVT J;  3EYY A;  3QYB A;  5D4S A;  2M34 A;  1YFH A;  2L9R A;  3GTJ J;  2L7Z A;  1O3Q A;  3HSE A;  1PUE E;  1SAX A;  2ACJ A;  3LSH A;  2K86 A;  5LGT A;  5FLV A;  4YFN F;  4BXF A;  4RB1 A;  3VYS B;  1G6N A;  2CFO A;  2E2H J;  1XCB A;  3L00 A;  3KEQ A;  2CG4 A;  5DD4 A;  2A69 F;  1Y39 A;  3HC7 A;  1D5V A;  3PIP F;  1OR7 A;  2I10 A;  5EJC A;  2ZJP F;  3LQR A;  2GA1 A;  3LQQ A;  4FET A;  5EGO A;  2H6C A;  4DZP A;  3N97 A;  1SAN A;  2IW5 A;  2PLY A;  3DKW A;  4QPQ A;  1ZGJ A;  5JI6 A;  5F0C A;  4E4H A;  5LGN A;  1W0U A;  2ZME A;  2M3A A;  5KVR A;  4OOI A;  2DOA A;  1U9O A;  1ZQ3 P;  3MVP A;  4HW0 A;  3ZN1 A;  2F5D A;  5J1R A;  4E7J A;  5B3S H;  2MLK A;  1E17 A;  2DI3 A;  3COA C;  4A5N A;  5CVR A;  4M3G A;  2NRA C;  1DUX C;  2QKL B;  2VOO A;  3V8K A;  4QIW N;  1RIO H;  2H8R A;  3I4M J;  2ZXJ A;  4QLC U;  1SFK A;  5ICE A;  3ZMS A;  3QOD A;  2IGK A;  1HLV A;  1P7J A;  3SEQ A;  2NXN B;  5LBQ A;  5FRN A;  3SJM A;  1ZLJ A;  1X3W B;  2XGC A;  1LJ9 A;  3DWL E;  4PCQ A;  1IG7 A;  3ZPL A;  4AM3 A;  3OWT A;  2EIJ H;  3ERM A;  3HUG B;  4N4O B;  3TO6 A;  3CC2 I;  1UG2 A;  3J81 K;  2R0Q C;  4JQF A;  1LB2 A;  3JSP A;  1AKH B;  1A31 A;  2LP0 A;  2Q2E B;  3IRR A;  2JA6 J;  1BI1 A;  1Z77 A;  2IEK A;  2HVS A;  2NVU B;  2KJC A;  4F3Q A;  2RC4 A;  4XID A;  1OIS A;  3BJO A;  3I58 A;  4C2M J;  5K7H A;  3H5R A;  2ME6 A;  1MMD A;  2ZFW A;  4CXF A;  4HBL A;  3RYR A;  3TO9 A;  3KP6 A;  2E2J J;  1K78 A;  3LA3 A;  1FTT A;  2VJ4 A;  2JWT A;  4P96 A;  2AQE A;  3HZJ A;  2EA4 A;  2RQP A;  2KT0 A;  4HYE A;  2X6Y A;  1PP8 F;  5J1U A;  4A3K J;  1P92 A;  1XG1 A;  1MMS A;  2V7F A;  3JW4 A;  1X4P A;  1ZAO A;  4N9H A;  3TL4 X;  2VJ5 A;  4A2U A;  4PFP A;  2HXO A;  1ETK A;  2VE8 A;  3CCL I;  3QPS A;  1VQ6 I;  1BC8 C;  2BYV E;  3WTS C;  4B47 A;  4CUG A;  1JUS A;  2ECC A;  4B48 A;  2VOD A;  2RDP A;  4NNJ A;  5JFR A;  4L5E A;  1O7L A;  3OYI A;  1YRN A;  4HX4 A;  4IHW A;  5CLS A;  2VBW A;  5KHD A;  3TDZ C;  5K1Y A;  1GUU A;  3R60 A;  2X1E A;  2CQK A;  4ANJ A;  4KIB A;  1R4M B;  2WB1 N;  2XF5 A;  5DCM B;  5EEA A;  1XS9 A;  4XRS G;  3DP7 A;  3I0T A;  4FQG A;  1O7F A;  4BKX A;  3CMA I;  3GLX A;  1QVU A;  2ESN A;  3SZG A;  2HKX A;  4CH7 A;  5IY5 H;  2JA5 J;  4FT8 A;  5HNF A;  2Z1D A;  1RRJ A;  4JBA A;  1G3S A;  2NVX J;  2R92 J;  3QPT A;  4IOA F;  1HCR A;  3EYI A;  2LY9 A;  2P6T A;  1ZG1 A;  1FPQ A;  2F5E A;  4Y15 A;  2V1D A;  1OJL A;  3GZ6 A;  4IKF A;  2DA2 A;  3GBG A;  3S1N J;  1BM9 A;  1J0R A;  1RUO A;  2QBY A;  4A3D J;  2HQ5 A;  2IVM A;  4XRF A;  3KZI C;  4IL6 C;  3HRM A;  1J59 A;  3VWB A;  4MLO A;  2FNP A;  3DTE A;  3L09 A;  3W6V A;  1AA7 A;  4UUV A;  4L9V A;  5HDK A;  4YIR X;  3IWZ A;  1KQ9 A;  2IBD A;  4KYW A;  2H8W A;  2V9P A;  2EH3 A;  2Y9Y A;  4O6J A;  1I50 J;  4A5M A;  4BU2 A;  2D2W A;  2KRC A;  4S0H B;  4UB6 C;  3D1N I;  3KYD B;  4UVA A;  3CUQ A;  2ZXI A;  4IHV A;  3H36 A;  2DMN A;  5IP6 A; 
#chains in the Genus database with same CATH homology
 2A68 F;  2H6B A;  2W57 A;  3HRT A;  3T1B A;  3V7R A;  5D6E A;  3RKW A;  1XGN A;  2Z99 A;  1SFE A;  1ZN2 A;  1KYZ A;  2EV5 A;  1H0M A;  2EJR A;  1MJB A;  2A6E F;  2LSO A;  2PI0 A;  4I7H A;  1FLI A;  1XSD A;  2ZKZ A;  2VT3 A;  4A0X A;  3ZMV A;  5D8K B;  3HSR A;  1YW8 A;  3MWM A;  3GF2 A;  1S3J A;  3U9G A;  4MTD A;  1XGS A;  2WWY A;  1MDM B;  1ZLK A;  2YSR A;  1LQ1 A;  1R1V A;  3F6V A;  3RJP A;  1B9N A;  1G3Y A;  3GVA A;  3BY6 A;  4A0Z A;  3QOP A;  2A61 A;  2P8T A;  2IPQ X;  3ECO A;  1QNT A;  5JVT A;  5E17 F;  4KMU X;  2DLL A;  1YYV A;  2OZU A;  5FD5 A;  3G73 A;  4RGS A;  1S7A A;  2Y0M A;  3WU0 A;  2FF4 A;  4FX4 A;  2HS5 A;  4UV8 A;  1XSV A;  2Z3Y A;  4KA4 A;  1F4K A;  2EFP A;  2IP2 A;  4IRH A;  4Q5S F;  4I0A A;  1CF7 B;  2PFB A;  2O6G E;  4M9Z A;  1LVA A;  3KP4 A;  1J7K A;  2H94 A;  1DPU A;  2P7C B;  2GXB A;  4L9T A;  5HLG A;  5FB2 A;  2UXX A;  4DQ2 A;  1JHH A;  4HOB A;  1D8J A;  2XUB A;  4HQE A;  2STT A;  1WI9 A;  2KJB A;  3F8B A;  4HAM A;  4EGY A;  4CHU A;  2A3S A;  5LRS A;  3QAH A;  1GXQ A;  1SMY F;  2VT2 A;  5ILS A;  1CGP A;  4CGZ A;  1ZAR A;  4CYD A;  2DPU A;  4NHJ A;  1MJA A;  3I53 A;  5K5R A;  1XN7 A;  1I5Z A;  3E97 A;  4PDK A;  1W7P D;  3WTU C;  2MH2 A;  1TTY A;  1SD5 A;  2OBP A;  2DK5 A;  2KRF A;  3EET A;  3O3K A;  5FGM A;  3ECH A;  4PGG A;  1PDN C;  3NRV A;  2P5L C;  1IN6 A;  4K2E A;  4BNC A;  4EMS A;  2RN7 A;  4KUM A;  1XGM A;  4D0P A;  3ULQ B;  2XAG A;  2R7D A;  1U8R A;  4HF0 A;  5CVI A;  5H6Q A;  1TQP A;  1XB4 A;  2P5V A;  4XLP F;  3ERE D;  3SHF A;  3K1M A;  2MA3 A;  4HLY A;  4LMY A;  4ENM A;  2VBX A;  2XHK A;  1WSU A;  5ICG A;  4EJV A;  3FMR A;  1S29 A;  2K4J A;  5D5W B;  1SD4 A;  5KK1 A;  4KDP A;  3CO6 C;  1G4D A;  3WOD F;  2W84 A;  2ZNY A;  1K79 A;  2W24 A;  2E1C A;  2LF8 A;  5D4R A;  2VON A;  4EJO A;  1BBY A;  3LWF A;  4U7B A;  3GO5 A;  5ERI A;  1I6X A;  5IT3 A;  4G94 A;  4EJT A;  3F21 A;  5HDN A;  2XVC A;  4G9Y A;  1BIB A;  1T38 A;  1OKR A;  3C3W A;  4MHG A;  3GZ5 A;  4HQM A;  5AIQ A;  1AWC A;  4UHT A;  1YO5 C;  5DEQ A;  2FSW A;  3WTX C;  1IN8 A;  2XIG A;  2KIF A;  3WTZ A;  3H92 A;  2BGC A;  5L3D A;  3VFZ A;  5J6X A;  1P6R A;  1F9N A;  4ESB A;  4AD9 A;  3CO7 C;  2VXZ A;  3CDH A;  3F8M A;  3HHH A;  3BOQ A;  3DPT A;  3RI4 A;  1ULY A;  3KZZ A;  4ESJ A;  1DDN A;  5FO5 A;  1R5H A;  5F6F A;  4LGW A;  4HA8 A;  4N9I A;  1YIO A;  1P2F A;  2MLG A;  3J80 K;  3F23 A;  4HF2 A;  3WTV C;  3GYH X;  2EWN A;  1O57 A;  4I2O A;  4QWQ A;  3F6O A;  2L02 A;  2ZME B;  2EA2 A;  1FBQ A;  3REO A;  4R1H A;  4P55 A;  5FLX K;  3E5U A;  5D5V B;  3M8E A;  1IW7 F;  2MC3 A;  2GXG A;  3F8C A;  2Q8K A;  3QRF F;  3Q5F A;  3K69 A;  1V3F A;  1FOK A;  1L3L A;  2FU4 A;  4XLN F;  4LLN A;  1J5Y A;  1TQM A;  2L01 A;  4AWX B;  2FXA A;  1IAW A;  4LFU A;  1IRG A;  2GQQ A;  3BPX A;  4YFX F;  3GW2 A;  3MFK A;  2RGV A;  3WGH A;  5F64 A;  5CVV A;  1ZH5 A;  1AOY A;  1K78 B;  4RS8 A;  5LEJ A;  2PN6 A;  2GA2 A;  3JTH A;  3P9K A;  4BH9 A;  3F8N A;  4OIO F;  5D8L B;  3EDP A;  1U6G A;  2LF7 A;  3KET A;  4EVI A;  3GFJ A;  2CYY A;  2PMH A;  3QU6 A;  3EQL F;  2M5W A;  4S05 A;  4ZYG A;  2QVO A;  4A0Y A;  4L0Z B;  1SD7 A;  1PP7 U;  2M30 A;  2ESH A;  5J8F A;  4YFK F;  3QP6 A;  4M6X A;  1VTN C;  1A04 A;  2VOP A;  3K2Z A;  3U2R A;  4E70 A;  3IHU A;  2LDU A;  4OMZ A;  5FD6 A;  2EFW A;  3R0J A;  4ASN A;  3GEZ A;  2RNJ A;  1YS7 A;  4A6D A;  4O3M A;  1ZYR F;  2FE3 A;  2L4M A;  5E20 A;  1D8K A;  1YW7 A;  4RB2 C;  5DYM A;  4HLX A;  2VC0 A;  3DFG A;  2FA5 A;  2QBY B;  1I1S A;  1E2X A;  3B73 A;  4KMF A;  1FSH A;  1QO0 D;  1WRJ A;  1HW5 A;  2B0L A;  1V4R A;  2F5C A;  3OV8 A;  3ZQ7 A;  3CUQ B;  1RNL A;  1O3S A;  2H09 A;  1W5T A;  3KZY A;  2FRH A;  2XAJ A;  3BP8 A;  2Y75 A;  1IF1 A;  2NYX A;  3ISP A;  3I71 A;  2DT5 A;  4IHT A;  2QQA A;  4RGX A;  3HOS A;  1MKM A;  2QQ9 A;  2VC1 A;  3O6B B;  3BPV A;  2Z33 A;  2HGC A;  3HSF A;  4EM1 A;  4MTE A;  3DF8 A;  3I5U A;  1T39 A;  2HTS A;  1GXP A;  2QUF A;  3LA2 A;  5E1X A;  2O03 A;  3IC7 A;  1FX7 A;  4RB0 A;  5ED4 A;  2IA2 A;  3SXY A;  2QEN A;  4ZYH A;  3JAM Z;  3J81 Z;  2NNN A;  3KP5 A;  4IVN A;  5TJJ A;  3TGN A;  1K7A A;  1HW2 A;  1WKM A;  2XRN A;  1HST A;  4ZYD A;  4RAZ A;  3V8L A;  3ZP5 A;  2FBH A;  2PJP A;  1UCR A;  1J2X A;  2FBK A;  1GHC A;  4OIR F;  2Y48 A;  2AS5 F;  4BYY A;  2ZNZ A;  1MJ9 A;  5BQT A;  3QPH A;  2TDX A;  3WTT C;  4IHS A;  3IWF A;  3F3X A;  3H3Z A;  4Q47 A;  3S2W A;  1I1G A;  5HLI A;  2K02 A;  3HYI A;  3HUG A;  2E1N A;  1RZ4 A;  2P6S A;  4O5V A;  3I4P A;  3RPQ A;  1FC3 A;  4BHP A;  2KIM A;  4I02 A;  1KU3 A;  4CZZ A;  4LJZ F;  2F5F A;  4R8H A;  2DBB A;  2L3D A;  1ZHF A;  4UXN A;  5HS7 A;  2BV6 A;  4HV5 A;  4NQW A;  4G6D A;  1BN5 A;  5CYV A;  2KIU A;  1W5S A;  1H9G A;  1UB9 A;  2VN2 A;  3ZMT A;  1UHW A;  4B09 A;  3L2C A;  4WX9 A;  5BOX A;  4MGR A;  1R1T A;  1XMA A;  1Z6R A;  1NHA A;  3CJN A;  4BHB A;  2YX4 A;  1HQC A;  1JHF A;  4Q4Z F;  2XKO A;  3VOE A;  5JHU A;  3NQO A;  3TOB A;  4G6Q A;  5K5Q A;  2RVC A;  4L18 B;  4ENK A;  3FWE A;  4L5I A;  4MEX F;  2KKO A;  3C7J A;  4N0B A;  1YTY A;  2G7H A;  1XD7 A;  4UVC A;  1STZ A;  5L3B A;  1ZRC A;  5D5U B;  1FBU A;  1FP2 A;  2STW A;  3MAJ A;  1Y0U A;  5A2Q Z;  3F72 A;  3GWZ A;  1IXS B;  1ODD A;  1BI3 A;  4I98 B;  5BMZ A;  5D5X B;  2MD5 A;  4BQA A;  2A07 F;  1G3W A;  4MQ9 F;  5LHG A;  2O0Y A;  2PBI A;  3K1P A;  4KFC A;  1T2K A;  3R61 A;  5DDG A;  2WC2 A;  3E3V A;  3KLN A;  4U7D A;  1ZG3 A;  3I64 A;  2PEX A;  3KFW X;  4LG0 B;  2DFI A;  4G7O F;  2K4B A;  2K27 A;  2M45 A;  2P4W A;  4WXC A;  4GYI A;  1UST A;  4HDU A;  2CW0 F;  5FFZ A;  1BI0 A;  1LDK B;  2X0L A;  1R23 A;  1ZG5 A;  3MQ0 A;  1LNW A;  1R00 A;  2Q0O A;  2EB7 A;  4BAY A;  5E8G A;  2JT1 A;  4WXD A;  3R0A A;  4BHC A;  1HXD A;  1IN4 A;  3BJ6 A;  1SFX A;  3KLO A;  1DPR A;  5LLQ A;  1SFU A;  3F8F A;  2O3F A;  2ISZ A;  2JZY A;  5DUK A;  1UFM A;  2FMY A;  4M71 A;  4L9J A;  1WWX A;  2G9W A;  3GFL A;  1F5T A;  2BBY A;  5BS6 A;  1XMK A;  3GUD A;  2NAZ A;  3WU1 B;  4IJA A;  3MEX A;  4H0E A;  1W7P A;  3ZMD A;  4MEY F;  3LA7 A;  4EJU A;  1HKS A;  3WTW C;  3I59 A;  2CWE A;  1CF7 A;  2YX7 A;  3AAF A;  1EH8 A;  2Z9O A;  2YPR A;  5BPD A;  2XV4 S;  3FZV A;  2FEZ A;  4L9N A;  3GX4 X;  1FYK A;  4ZH4 F;  4OU0 A;  4LLL A;  1U5T B;  1TW2 A;  5LGU A;  2GWR A;  1R58 A;  3H3U A;  3V8J A;  1EH6 A;  4U0Y A;  4GYG A;  2QM3 A;  4Z2Y A;  2ZBK A;  4RGU A;  4GXO A;  2GZW A;  3SZT A;  1T0F A;  4HF1 A;  1W4M A;  2MBF A;  2FQ3 A;  4IF4 A;  5EEG A;  1XCV A;  4JK1 X;  4RAY A;  2XGX A;  2R3S A;  1QZZ A;  2GAU A;  4RGR A;  3TDU C;  4XSX F;  1IRF A;  4HZF A;  1XDU A;  1BJA A;  1Z05 A;  1U5T C;  4G7H F;  4NB5 A;  1FY7 A;  3HRU A;  1ZRF A;  3WGG A;  4OMY A;  4LLG F;  2PG4 A;  3OOP A;  5LRR A;  2H27 A;  5HS8 A;  3SFZ A;  1O3R A;  3I54 A;  5J8C A;  3IKT A;  5DV5 A;  1DP7 P;  2IRF G;  1KU9 A;  1YG2 A;  3N4M A;  2EFO A;  1LEB A;  2A5Y B;  5HLH A;  4KIC A;  3KCC A;  2IT0 A;  5JR3 A;  3C18 A;  2OD5 A;  1B9M A;  2PQ8 A;  1KU2 A;  3P9C A;  3R6S A;  4AVP A;  1FNN A;  2XAF A;  2V1X A;  5ICC A;  3E6M A;  2JPC A;  5IT9 K;  3CLO A;  1K6O A;  1YS6 A;  4RB3 C;  2ISY A;  4ENJ A;  1TNT A;  1YW9 A;  1C0W A;  1JXS A;  2FML A;  2M8E A;  4Y13 A;  1UHM A;  5AON A;  2DO7 A;  1HBX G;  4ETS A;  2JTV A;  2OQG A;  3ML6 A;  3LAP A;  2OAZ A;  5DD8 A;  5DUI A;  2VBZ A;  3B02 A;  3MZY A;  5K5O A;  3GFI A;  2XRO A;  3L9F A;  5HS9 A;  4WWC A;  4ENN A;  1IXC A;  2EFQ A;  2HDC A;  1XDS A;  2ZO4 A;  2QWW A;  1RI7 A;  3ZN0 A;  2HQN A;  2D1V A;  1KA8 A;  2W25 A;  4I01 A;  3FHZ A;  2ZCW A;  4S04 A;  4U0W A;  3VB2 A;  1R1U A;  1O3T A;  5ILV A;  4AIK A;  2ADU A;  2V9V A;  2HZT A;  3FMS A;  3L7W A;  1U2W A;  3LFK A;  2O8X A;  2IA0 A;  4HX8 A;  2UXN A;  2XAS A;  4I0B A;  1B6A A;  3C1D A;  4GGG A;  1QGP A;  2G7U A;  1FYL A;  1T98 A;  1Q1H A;  2HQR A;  1KU7 A;  1ZRE A;  4OIQ F;  1Z7U A;  5EEH A;  2ETH A;  4LK1 F;  3DEU A;  3DXJ F;  3CUO A;  1LDJ A;  3IKV A;  1MGT A;  3IL2 A;  3RYP A;  3F22 A;  1FP1 D;  4U0V A;  1TNS A;  1QZY A;  3RDI A;  4OIP F;  3JAM K;  2AXL A;  3GFM A;  2HOE A;  2QYO A;  3W6J B;  3WGI A;  1SMT A;  3QP5 A;  3SZP A;  3JTG A;  1IUY A;  4KN7 X;  4WXH A;  1HSJ A;  3DV8 A;  5LHH A;  1P4A A;  1ON1 A;  4A12 A;  3W6K B;  2D45 A;  1ZRD A;  2D1H A;  3KP7 A;  2P5K A;  1I27 A;  1LDD A;  3CUQ C;  5F1R A;  1P4W A;  4PZJ A;  1B59 A;  1G3T A;  3E6D A;  3WE3 A;  3BWG A;  1TLH B;  1IN7 A;  1ON2 A;  3FF5 A;  1XSX A;  1B1B A;  2V1U A;  3BJA A;  1J9I A;  4UVB A;  3TQN A;  4M9S A;  4M6Y A;  3PFI A;  1FYM A;  3FX3 A;  4ESF A;  3CTA A;  3TO7 A;  1S7O A;  2XAQ A;  2ELH A;  3M8F A;  3WE2 A;  2V79 A;  1MZB A;  2OU2 A;  2HKO A;  4B8X A;  3WTY C;  4UV9 A;  1EV7 A;  1FSE A;  4AIH A;  4GCV A;  2CFX A;  1HKQ A;  3E6C C;  1FZP B;  2BE5 F;  2W85 A;  3FXU A;  2UWM A;  3G3Z A;  5HDG A;  1OPC A;  5TRD A;  2R7F A;  2EFN A;  3P7N A;  2Q2E A;  3Q9S A;  3QU3 A;  3ROU A;  2OZ6 A;  2QQB A;  3K9T A;  3BDD A;  3NEU A;  1YLF A;  4ZZD A;  3D0S A;  4UNO A;  5FFX A;  1TQI A;  1TW3 A;  2HTJ A;  2O61 A;  3T0Y A;  2A6H F;  2LKP A;  1S6L A;  4M74 A;  1JGS A;  1WQ2 A;  5E1W A;  1T6S A;  4CO8 A;  3K1N A;  3KEO A;  5E8I A;  5ILU A;  2GIV A;  2WV0 A;  1BI2 A;  2JRT A;  5A2Q K;  1FT9 A;  3E5Q A;  4EM0 B;  2CSO A;  1U78 A;  5DCM A;  5CJ9 A;  4IRI A;  2E7W A;  2VE9 A;  4ZZL A;  3LAJ A;  1KYW A;  5HVQ C;  4XSZ F;  1RUN A;  5ICF A;  4YG2 F;  2E7X A;  5LHI A;  5H6R A;  1HKT A;  1QPM A;  2F2E A;  4M72 A;  3IRQ A;  2QLZ A;  1QBJ A;  2XAH A;  1QQI A;  4LK0 F;  5CVJ A;  2NNY A;  1OYI A;  3FMQ A;  2HYF A;  2HR3 A;  1R36 A;  4FHT A;  3FM5 A;  4CDG A;  1W7P B;  1JE8 A;  3T8R A;  4L5J A;  3T8T A;  3BZ6 A;  3KP3 A;  1H9T A;  4MQV A;  1OMI A;  3I59 B;  2DW4 A;  1R5G A;  4KT5 C;  4YII A;  3VOD A;  2YR2 A;  3SQN A;  4MNU A;  1Z1D A;  3GXO A;  2COM A;  3E6B A;  4IRG A;  2CGP A;  3K0L A;  4EM2 A;  4EV0 A;  5E18 F;  2OA4 A;  4EJW A;  2JPB A;  4Q48 A;  4TV7 A;  3O2P E;  2BEO A;  3U1D A;  1OYW A;  3ABT A;  5HOO A;  1F1Z A;  2RV8 A;  1MDM A;  4I09 A;  3MZH A;  3V4G A;  3HIF A;  1R7J A;  5L3C A;  5LEK A;  2DQR A;  1Z9C A;  1Z6T A;  3HHG A;  2HFH A;  3J7A O;  1R22 A;  3ZMZ A;  2EV0 A;  3KP2 A;  4ON0 A;  1BIA A;  1L0O C;  3DPL C;  4WCG A;  4IPA A;  5BPI A;  2V6C A;  1IXR C;  1FBS A;  1FWZ A;  2Z5U A;  3HTS B;  2XKP A;  3M9A A;  2LNB A;  3V7C A;  2K7L A;  1LEA A;  4WF2 A;  1Z91 A;  1BOA A;  2J5O A;  2DQL A;  3ABU A;  3T5X A;  4AIJ A;  1P4X A;  2VBY A;  3ZMU A;  2QZ8 A;  4M9X A;  4HX7 A;  3PQJ A;  3BRO A;  2IJL A;  2WTE A;  1EH7 A;  4BXU A;  3M7G A;  3TOA A;  2FOK A;  1REP C;  4P5O A;  2DTR A;  2DPD A;  2EK5 A;  4WK8 F;  1ONV A;  2DAO A;  4KIF A;  1ZGA A;  4OIN F;  3RKY A;  1IZ1 A;  3KE2 A;  3FXQ A;  4L0Y B;  2ZJ2 A;  4LG0 A;  5CVU A;  2FNA A;  2DK8 A;  3HRS A;  4XBF A;  4M73 A;  1YQA A;  3D5L A;  4P9U A;  1BC7 C;  3EUH A;  4ZYE A;  2HYG D;  2L4A A;  2L54 A;  4P9F A;  3ELK A;  3RTR A;  3DQV C;  4Y17 A;  2IA1 A;  3V7S A;  3P9I A;  3VEP A;  5L3G A;  4G7Z F;  5AIP A;  4KNY A;  5DCF A;  4KN4 X;  4GO1 A;  2EV6 A;  3HOT A;  1XGO A;  4DNC A;  4YIF A;  1KQ0 A;  3Q9V A;  4PGH A;  4LB5 A;  5L3F A;  5E1Z B;  1U3E M;  4F7Z A;  2M1B A;  2PMU A;  4LD5 A;  4HV6 A;  3PQK A;  1SD6 A;  2RKH A;  1MD0 A;  2JSC A;  2C6Y A;  4R79 A;  1USS A;  2MH9 A;  2FBI A;  3JSO A;  1IN5 A;  1S8N A;  2J5P A;  3FXR A;  2DU9 A;  2OQR A;  4EQQ A;  1B4A A;  5D6F A;  4A6E A;  6PAX A;  1OYY A;  2UZK A;  3E5X A;  3TKY A;  2CO5 A;  2YU3 A;  1J75 A;  1HW1 A;  2HEO A;  2NS0 A;  4U88 A;  1KQ8 A;  5L3E A;  1X3U A;  3RPU A;  4HDV A;  3FM3 A;  4LB6 B;  4EGZ A;  3R4K A;  4IXA A;  1U5T A;  3MCZ A;  1TBX A;  5H20 A;  1GVJ A;  3HTU A;  2P7V B;  3J80 Z;  3RIR A;  4FX0 A;  3M1E A;  2X4H A;  4KIG A;  3WG9 A;  4G8X A;  5FLX Z;  2HWV A;  2M87 A;  3RKX A;  5IT9 Z;  1D3Y A;  4CIC A;  3LST A;  1KGS A;  3EYY A;  5D4S A;  1YFH A;  1O3Q A;  3HSE A;  1PUE E;  1SAX A;  2ACJ A;  2K86 A;  5LGT A;  4YFN F;  4RB1 A;  1G6N A;  1XCB A;  3L00 A;  3KEQ A;  2CG4 A;  5DD4 A;  2A69 F;  1D5V A;  1OR7 A;  3LQR A;  2GA1 A;  3LQQ A;  2H6C A;  3N97 A;  2IW5 A;  2PLY A;  3DKW A;  5JI6 A;  1ZGJ A;  5LGN A;  2ZME A;  5KVR A;  4OOI A;  4HW0 A;  3ZN1 A;  2F5D A;  2MLK A;  1E17 A;  2DI3 A;  3COA C;  4A5N A;  5CVR A;  2NRA C;  1DUX C;  2VOO A;  3V8K A;  1RIO H;  2ZXJ A;  4QLC U;  5ICE A;  3ZMS A;  5LBQ A;  1ZLJ A;  3ZPL A;  4PCQ A;  1LJ9 A;  3TO6 A;  3J81 K;  4JQF A;  1LB2 A;  3JSP A;  3IRR A;  1BI1 A;  2KJC A;  2RC4 A;  3BJO A;  3I58 A;  2ZFW A;  4CXF A;  4HBL A;  3RYR A;  3TO9 A;  3KP6 A;  1K78 A;  3LA3 A;  4P96 A;  2EA4 A;  2RQP A;  4HYE A;  1PP8 F;  1P92 A;  3JW4 A;  1ZAO A;  4N9H A;  4A2U A;  2VE8 A;  1BC8 C;  2BYV E;  3WTS C;  2VOD A;  2RDP A;  5JFR A;  1O7L A;  4HX4 A;  5CLS A;  2VBW A;  5K1Y A;  3TDZ C;  3R60 A;  2CQK A;  4KIB A;  5DCM B;  3DP7 A;  3I0T A;  1O7F A;  3GLX A;  2ESN A;  2HKX A;  4FT8 A;  4JBA A;  1G3S A;  3QPT A;  3EYI A;  1ZG1 A;  2P6T A;  1FPQ A;  2F5E A;  4Y15 A;  2V1D A;  3GZ6 A;  1BM9 A;  1J0R A;  1RUO A;  2QBY A;  2IVM A;  4XRF A;  3HRM A;  1J59 A;  2FNP A;  3L09 A;  4UUV A;  4L9V A;  5HDK A;  3IWZ A;  1KQ9 A;  4KYW A;  4O6J A;  4A5M A;  2D2W A;  4UVA A;  3CUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...