1QRYA

Homeobox protein vnd (ventral nervous system defective protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
b'GSHMSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLTSLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HOMEOBOX VENTRAL NERVOUS SYSTEM DEFECTIVE PROTEIN)
molecule tags Dna binding protein
source organism Drosophila melanogaster
publication title Distortion of the three-dimensional structure of the vnd/NK-2 homeodomain bound to DNA induced by an embryonically lethal A35T point mutation.
pubmed doi rcsb
total genus 11
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qryA00
4LOCA 4IHXA 5IPAA 3CDLA 1WH7A 1XG1A 1QPIA 1JTXA 2MG4A 2IBDA 2PMZN 5FKLA 3HGYA 3NAUA 3RZDJ 3HOXJ 1F43A 2DA5A 1GVDA 2VUMJ 3A02A 4M3FA 2B63J 2Y0SN 2CJJA 3JRAA 3O8GA 1GUUA 1VI0A 3BQYA 1U9OA 1B72A 1BW6A 1WPKA 4A3GJ 3ZQHA 3BT9A 3S17J 4V2GA 1W0UA 2DN0A 4MFDA 1TWAJ 4XRMA 4JYKA 5EGOB 1MBJA 1MSEC 3MN2A 4A3KJ 3M3YJ 1ZKGA 3A03A 3Q0WA 4D7NA 2AO9A 3PM1A 3GTMJ 3OSFA 4RBOA 2HOAA 3HOZJ 1GV2A 2R5ZA 5EG0A 1RKWA 2O8KA 3HOUJ 3S1MJ 3S2DJ 2HI3A 3VPRA 2DMNA 3WHBA 1HF0A 3LSPA 2EBIA 3JRCA 5M3MJ 2HQ5A 5C44J 2NOGA 1JT6A 1LE8B 1WI3A 1JKRC 1ETWA 1WH5A 2E1OA 2HXIA 1S7EA 5F08A 4A3LJ 4A3DJ 2Y31A 3Q3SA 2O7OA 1TC3C 1IUFA 3MVPA 2ECBA 2DA3A 2EZKA 5J1RA 2IEKA 3TW7A 2NVYJ 1ZGWA 4CYCA 2EQRA 1IG7A 1BW5A 1R9TJ 2E2HJ 1YRNA 1RR7A 5IYDJ 3GTLJ 1Z77A 4DYRA 3H0GJ 2M2EA 2CQQA 3DCFA 3FISA 5FLVA 3LSRA 4JX6A 5F27A 3RQIA 1HCRA 2DA1A 1OJLA 1HLVA 1IJWC 4XIDA 1YRNB 4FCYA 1POGA 2MSYA 3TP0A 1H89C 2OPTA 3OIOA 2NVQJ 3LSGA 2MW8A 4B1RA 3QPSA 3G1MA 1SFOJ 1XC5A 4D7MA 1RESA 2HDDA 4AYBN 2XGEA 2CU7A 4DZJA 1GT0C 1JKOC 2YUSA 1MH4A 2QCOA 1ETVA 2NVXJ 9ANTA 3TP3A 1VF9A 4CYCB 1AKHB 1X58A 1Y1WJ 1BL0A 3A01A 2XRLA 1FEXA 1UG2A 2K40A 3G1LA 1PUFB 1Z0XA 2CUEA 2JA8J 5JLXA 1ZQ3P 4C2MJ 5C3EJ 4MIMA 4L5EA 2R0QC 1I6HJ 5F04A 1GDTA 1U78A 2DMUA 3SJMA 3OSGA 2R5YB 1B8IB 4BXXJ 3IH2A 5E3LA 4A3FJ 1JJ6C 4IHVA 3LNQA 3G1OA 5EDNA 1TWFJ 2DTZA 3ZQFA 3BTIA 3Q0UA 2X48A 5C4JJ 2XPWA 2H1KA 4GFBA 2LKXA 5FKKA 2DA6A 4EEFG 1ETQA 1G2HA 3FKIJ 1H8AC 2WB1N 4M3BA 4UUSA 3QPLA 2ID6A 2NS7A 3LSJA 1JUMA 2R92J 5F0HA 4M3EA 1EF4A 1K61A 1AKHA 3K2AA 2FD5A 4I76A 3ZQIA 1JT0A 5M5XJ 4G12A 4NDLA 2P81A 4UUSB 3W6VA 2K9SA 4W97A 3B6CA 4M3DA 5JLWA 3M4OJ 3S1RJ 1F36A 2DA4A 2XB5A 1ETYA 1JJ8C 2H8RA 5EGOA 1MH3A 3BR0A 4DZPA 2HOSA 3FIWA 3RKQA 2LP0A 4C3HJ 3S14J 3CQZJ 2WV1A 5J3LA 4IHYA 3GTJJ 4XICA 3GTPJ 2FX0A 2LTPA 4J19A 2GM4A 5E3NA 2DMTA 3B6AA 5IP7J 5EF6A 2ELKA 1P7JA 1APLC 2JWTA 3TEDA 3K7AJ 4MFEA 1MBGA 4DW6A 2EZLA 4S0HB 1U9NA 3LOCA 4QIWN 3ZQCA 2R7ZJ 4X6AJ 5F0CA 4B4CA 2Y9ZA 3HEFA 1Q1VA 5K7FA 2LY9A 4MO7A 2ID3A 1A5JA 3JREA 2VKEA 5FJ8J 3JRFA 1JTYA 3E7LA 2L7FP 2Y2ZA 3GTKJ 2N8GA 1LE8A 5GPAA 2ME6A 4DYCA 1JKPC 3GTOJ 4AC0A 1FTTA 3HGGA 1TWGJ 2NS8A 2CUFA 5K7ZA 5EG0B 1WCMJ 1GV5A 3IH3A 2LLKA 1MSFC 3GTGJ 5FKOA 2CQXA 3MKLA 2JA5J 2K9QA 2DJNA 1WGXA 1JKQC 3BQZA 4BY7J 3HOVJ 4B3AA 3BG3A 2QF7A 2L0KA 4BY1J 2ME0A 3BR6A 3ZQGA 1B72B 2JJ7A 2TCTA 1ZK8A 4A69C 5HODA 3DEWA 1AU7A 3FK6A 4A3JJ 3WHCA 5GPCA 3BR2A 1FIAA 1ZR2A 1IDYA 3S15J 3D1NI 2OF7A 4FE4A 1IV6A 1IC8A 3PO2J 2L7MP 2LK2A 2R5ZB 2G0EA 5M5WJ 1JGGA 2LFBA 4D5FA 1ORKA 1CQTA 2HOTA 3JRGA 1RKTA 5IOYA 5IP9J 3I4MJ 2VKVA 1W0TA 3JRDA 1DU6A 2YS9A 2W48A 3JRHA 5IOZA 1HDDC 1JUPA 3QQAA 2RAEA 1VFCA 1MBFA 1X2NA 2KT0A 3SFIA 4A3CJ 5DS9A 5DTDA 1OFCX 3CCYA 3BTCA 1VNDA 2D5VA 3H3VK 3PO3J 4FE7A 1A6IA 4QSHA 1BA5A 2JA6J 3F0CA 4JP0A 1K83J 1IRZA 3S1QJ 3HOYJ 3BR1A 3SDGA 2XPVA 2YU9J 3BG9A 1ETXA 2XGDA 2JN6A 4ABZA 3BTLA 3S16J 5C4XJ 2NVTJ 2WAQN 3IH4A 5FKMA 5F1JA 2K9NA 4M3GA 5K7HA 3BTJA 1I3QJ 1LFBA 1OCPA 3L1PA 1ETKA 4FTHA 1TWHJ 2Y9YA 3GBGA 3HM5A 3BR3A 2LVSA 3HDDA 2MGQA 3I4NJ 5E3MA 5M3FJ 4BBSJ 1BJZA 4QTRA 4A3IJ 4XRSA 2DA2A 1T33A 4IHWA 1Y1VJ 1LFUP 4M6VA 1HOMA 5J1YA 3JRIA 3CMYA 1NTCA 3IV5A 1ZR4A 1IGNA 2E2JJ 2DA7A 5IP6A 3C2BA 4Y7NJ 5E3OA 3HKZN 3BG5A 4D5CA 2O9LA 3RZOJ 4MLOA 2X6OA 2ECCA 1X2MA 2XPUA 1HDPA 2EZIA 4FISA 1RETA 4I6ZA 5EZGA 1OCTC 1O4XA 2M34A 2LR8A 2L7ZA 4XK4A 1FTZA 5F0FA 4DYQA 2VPRA 4BBRJ 5EZHA 1D5YA 3FK7A 1PUFA 1FJLA 2L9RA 2JA7J 2CRGA 4C3IJ 1H88C 4AUXA 2EZHA 3GTQJ 3ZQLA 2VI6A 2ZB9A 5FKNA 2COBA 4A3MJ 2HXOA 1I50J 1TWCJ 4A93J 1ETOA 1QVTA 2TRTA 1T56A 2E19A 2I10A 2KDZA 2M8GX 2DMQA 4Y52J 2HYJA 1MBKA 1QRYA 3JRBA 5EEAA 4HNVA 1E3OC 1UHSA 1AHDP 2R93J 3HB9A 3TW6A 1UMQA 4UUTA 2JK3A 1DU0A 1NK3P 2FQ4A 2DMPA 2E2IJ 4W1UA 1SANA 5IYCJ 2JMWA 5FLMJ 1ZTRA 2XSDC 1JUSA 2M9HA 2M0CA 4A3EJ 2Y30A 3ZOBA 1QVUA 2XB0X 3A01B 5J1UA 2EH3A 3O8HA 4IEJA 1XS9A 1IDZA 4V2FA 4RDUA 4X1EA 3BR5A 2GBYA 5BNGA 4XRSG 5GP9A 3S2HJ 1RPWA 4C3JJ 1FIPA 3UKGA 4A3BJ 1MNMC 3OOUA 5IYBJ 1MBEA 3NARA 2IAIA 2R5YA 1B8IA 2AHQA 4JX4A 4BKXA 2X9DA 4JX5A 3HBLA 3Q0VA 2GLOA 1ITYA 3JR9A 1P7IA 3S1NJ 2FJ1A 5M5YJ 1MBHA 1NK2P 5EYRA 3HOWJ 2LD5A 1ENHA 2XGCA 1U8BA
chains in the Genus database with same CATH superfamily
3ERMA 4IHXA 2E5NA 3VSLA 1MDMA 1XG1A 1JTXA 2M5WA 2MG4A 1SMTA 3O6BB 4ENMA 3HTUA 1K79A 3FMSA 3HGYA 5KVRA 1F43A 3KX2A 5LBQA 2MD0A 2D1HA 3M07A 5CVRA 2B63J 2ADUA 2YPRA 4HX8A 4KN4X 2QBYB 4G6DA 2OCCH 1DP7P 1GUUA 2JVHA 3N4MA 2L01A 4HSRA 3J7ZI 5L3DA 2HPMA 1S8NA 1B72A 4KICA 3WU2C 1FSHA 3GF2A 2EV6A 3ZQHA 2VBXA 3BT9A 4R1HA 4LB6B 4PZJA 3NRVA 4XRMA 3JTGA 2F4OB 3ZP5A 1DDNA 3MN2A 3BG7A 1NG6A 3A03A 4RGSA 3Q0WA 4D7NA 4MGRA 4HV6A 5J4YA 1W7PA 2IS4A 1D0YA 2V6CA 3HJEA 3SZGA 2VC1A 5BPIA 1O3QA 2OZ6A 5HNFA 3CJRB 3FKJA 2EFQA 2ZJPF 1XB4A 3NWSA 5EG0A 1FP2A 4N9IA 4I98B 3TO6A 1J5YA 2KJBA 2GXBA 3HG9A 4A6EA 2HQ5A 2DTRA 2E1MB 3DP7A 1LE8B 1WI3A 3JSOA 4Y4RA 5IY5H 1S7EA 4IF4A 5F08A 4D0PA 2Z9OA 1D0ZA 1Y39A 2Y31A 1TC3C 4CA0A 3NQOA 3S3MA 1IUFA 5IT9K 1R22A 2ECBA 2DA3A 1J2XA 2EZKA 2XHKA 3GFJA 3VEPA 5J1RA 1ZGWA 5DEQA 2ZNZA 4H4KC 1IRFA 1YRNA 4EJOA 4M72A 2LYCA 2EWNA 5BQTA 3DWLE 5TGTA 1FOXA 2DOEA 2GXGA 1Z9CA 1AWCA 3E6DA 3H0GJ 1YI2I 5K1YA 3DCFA 1W5CC 1BOBA 1Z05A 1T98A 4Y3OA 3LSRA 5FLVA 4G7OF 5F27A 3RQIA 3L2VA 4XLHA 1HLVA 4XIDA 4FCYA 2EIJH 1H89C 3RPUA 4YFKF 1JHFA 3G2BA 2IPQX 2MW8A 5KAIC 4D1QA 1G59A 1GHCA 3QPSA 3F8FA 2EA2A 2VC0A 3S32A 4D7MA 1XCBA 3E5QA 3F8BA 2XGEA 4AYBN 2CU7A 5FB2A 4BHPA 5D6FA 1XMKA 4ENKA 1GT0C 1ODDA 1A36A 3TDUC 2ELHA 4RAYA 2NVXJ 1TNTA 2R7WA 1V5GA 4AD9A 3ZMTA 4CDGA 4N0BA 2L5QA 2KL4A 4RB3C 1BL0A 1VQPI 1HW2A 4NB5A 1YTYA 4UUVA 1FEXA 2XSJC 3SHFA 2K40A 4Y17A 2R7XA 1Z0XA 3EPZA 2CUEA 3IP4B 3V42A 4BXUA 3BOQA 3V7CA 1ULYA 2LBFB 2JA8J 4R8HA 3V8KA 4PJLA 1OCOH 1EH6A 3GEZA 4L5EA 1GDTA 2PJPA 3KCCA 2DMUA 3OSGA 2BYVE 2LREA 1RUOA 5E3LA 3I55I 2HEOA 4IHVA 2E1MC 4XKVA 1J0RA 5EDNA 1TWFJ 2EIKH 4GFBA 2LKXA 1S3JA 1TP4A 2QM3A 4G7ZF 1IW7F 2F5EA 4M3BA 3QPLA 4Q47A 2ID6A 2NS7A 3LSJA 3MZYA 5E8GA 3TO7A 3WGIA 3KYCB 4QPOA 4PFPA 5ERIA 2R7FA 2OCEA 4M3EA 3OMYA 1R1TA 1T0FC 3AG3H 1K61A 3BCAA 3K2AA 4ETSA 3HTSB 3A0BC 3KEQA 5FFZA 1S6LA 5M5XJ 2DYSH 1TW2A 3CUQA 1IRXA 3T1BA 4W97A 5JVTA 3B6CA 5JLWA 3JW4A 1CF7A 3S1RJ 4ZZLA 1BN5A 2H8RA 5EGOA 2O61A 3CZ6A 1ZRFA 4GDFA 2LSOA 2PQ8A 1W1WE 3K4LA 3BR0A 5HLGA 4G7HF 2HOSA 2EJRA 2BVMA 3RKQA 1BR2A 3S14J 1FOWA 3J80Z 5J3LA 4GCVA 1U0JA 3KE2A 4XICA 1XN7A 3GTPJ 2MFZA 2DFEA 3AFHA 1G4DA 3HPHA 2LRDA 2RVCA 3B6AA 4IHSA 3K2ZA 1G8XA 5EF6A 5A2QK 5EJCA 4CH7A 4BJ6C 1APLC 3BZKA 3K7AJ 2RDPA 5DCMA 3MEXA 1SD6A 2EZLA 2ISZA 2AQEA 3JAMK 2R7ZJ 5L3EA 4X6AJ 4B4CA 3WTZA 3C1DA 4MO7A 2XAQA 3JREA 4E7LA 4AU7A 1N77A 2KFDA 5BPDA 3JRFA 2E5ZA 3FM5A 2B0LA 4ENNA 3RYRA 5ICGA 5GPAA 5LGNA 5HLHA 1JKPC 4NNJA 5KK1A 4BYYA 5B1BH 1EV7A 3JAMZ 1FBSA 3M7GA 5DD4A 5EG0B 4ZYEA 1WJDA 2FSWA 3LQQA 1GV5A 2HVSA 2NRAC 3LA2A 2JSCA 2OQGA 4I0BA 5DUIA 2CQXA 3ZMSA 3AL0B 4X0GA 1TNSA 2DJNA 2PG4A 2WAQA 2K4JA 1KQ9A 5F6FA 4ZC3A 5FD6A 4BY7J 3FBNB 3CF5F 3RPQA 3T5XA 2QF7A 1ON2A 2Y75A 2X1EA 3BR6A 1M1EB 2BW3A 2JZYA 2PX9A 1S29A 2XAUA 4HF0A 5HODA 1UB9A 3FK6A 3ESWB 4WX9A 2H6CA 2QBYA 3HRSA 1B1BA 3DLLF 1P6RA 5GAGJ 3H9QA 2QSHX 2OF7A 4FE4A 1IC8A 5CVIA 4G9YA 4CCOA 3ULQB 2LFBA 2QYOA 4L0ZB 3CLQA 1WRJA 1CQTA 2HOTA 3KPHA 3REOA 4I09A 1WKMA 1F4KA 4IHTA 1RKTA 2ZJ2A 3I4MJ 3JRDA 3G3ZA 4GYGA 1DU6A 1ZLJA 2KJCA 3OIPA 3TBIA 1J7KA 5J8FA 2NVUB 2ICWG 2DT5A 3QQAA 5TISC 3BJOA 1FPQA 2KT0A 1IN4A 2L54A 3CCYA 2D2WA 3LSHA 3IAS2 3S2WA 1K78B 1VZ0A 1ZLKA 2D5VA 1VNDA 2BE5F 3BPXA 2PJRB 2PMHA 2STWA 1N78A 1IN7A 4A0YA 1IRZA 3V7RA 3BR1A 4KYWA 2R7QA 3SDGA 2YU9J 1UHMA 1ZHFA 3P9IA 1DPRA 2H6BA 4ESBA 4IL6C 3PIOF 1XMXA 2NVTJ 2WAQN 1B59A 5FKMA 4AVPA 4BU2A 1E17A 5E1WA 3TOBA 3LA3A 4G94A 1SVMA 1Z6TA 3CCQI 1JHHA 1LFBA 2DK5A 1ETKA 1SAUA 1E2XA 3I5UA 4BDYA 1TWHJ 3K70D 3GBGA 5AONA 4XORA 3BR3A 2K02A 2LVSA 2M1BA 3TL4X 4Q5SF 2WA0A 4K2EA 1TQIA 4LLLA 4ASNA 2ZXJA 1BJZA 4BDZA 2V1DA 3FWEA 2DA2A 1T33A 4IHWA 1VQ7I 3S3NA 1LFUP 4M6VA 5J47A 1HOMA 2KISA 3CC4I 5J1YA 4EATA 4O6JA 1NTCA 3JRIA 1ZR4A 3F9KA 2K5CA 5IP6A 1N25A 4Y7NJ 1USTA 2VQLA 1MJAA 3BG5A 3HKZN 3RZOJ 2ECCA 2TDXA 3HSEA 4XNFA 4OOIA 1R71A 1D1BA 4EJWA 4I6ZA 2CH0A 2DBBA 2FOKA 1ZAOA 1FT9A 1F5TA 1LDKB 4LIVA 2HU9A 5F0FA 2VIXA 3FK7A 4M73A 1SVOA 3OR2C 3W6KB 4BHBA 2FE3A 3G4SI 1QHGA 2W85A 4I2OA 2BY3A 3QYEA 1EH8A 1P4XA 5FKNA 4RM2A 5LEJA 3LQRA 2XRNA 1D8KA 1QVTA 2TRTA 1T56A 3KP5A 3Q9SA 4YELA 4IX7A 2COMA 2I10A 2Y0MA 3FM3A 1PYVA 2M8GX 2KDZA 2GXAA 2HVQA 2O0YA 1Y6IA 4B43A 3K4KA 4L9NA 3JRBA 3A4CA 1V55H 3OIQA 3P7NA 4DGWB 1X3UA 3CO7C 1UMQA 5IYBJ 3WODF 4HLXA 2JK3A 4BS9A 3F22A 4E7IA 3FMQA 4LFUA 2JMWA 2ESNA 3I3LA 3RPUD 1XPXA 2FMLA 2FOWA 2DK8A 2XSDC 1JUSA 1RRJA 2M0CA 1ZH5A 3ONQA 3H36A 1G3SA 3ZMUA 2ESHA 1IO2A 1FWZA 1XTAA 2VBWA 5J1UA 1XS9A 2CMPA 4DIQA 2PMUA 1X1PA 3SEZA 4F92B 4FQGA 5BNGA 4MEXF 2LKPA 4PGHA 4JOMA 5GP9A 3FZVA 3S2HJ 4RAZA 4C3JJ 1K4SA 1GLNA 4P9UA 1UHWA 2UZKA 4J01A 3OOUA 5HDGA 3CD6I 1PVEA 1X19A 1MBEA 4RGXA 3NARA 2VJIA 3M8EA 3KFWX 2R4GA 4AVZA 3KYDB 3MAJA 2A69F 4NQWB 4JX4A 4IKFA 5E8IA 1R23A 3KZYA 4P1WA 3GLLA 1I1GA 2GLOA 1ITYA 1LDJA 2DAOA 3IRRA 2QKMB 2VT3A 1MBHA 1KU7A 5EYRA 1ENHA 2F48A 4MHGA 4LOCA 4QPQA 1I27A 1SFKA 2EB7A 4U0YA 1QA6A 3GZNB 3D5LA 3C7JA 3CDLA 1WH7A 2R3SA 2KIMA 2WAEA 4B09A 3H1CA 2PMZN 1ZRCA 2KZVA 3GFLA 4XLAA 5FKLA 1FMWA 3HOXJ 1FYLA 2VUMJ 2ELJA 1LKXA 2HYGD 2FNPA 2CFOA 2BV6A 3JRAA 1WFXA 1RIOH 5IT9Z 2W00A 1XSVA 5B3SH 1DQUA 1WPKA 4FETA 2NAZA 3J7YJ 4Q48A 3S17J 1KYWA 4F3QA 2DN0A 4JYKA 2VXDA 2CUJA 1QNTA 2UUZA 1LUJB 2KIQA 5EGOB 1MBJA 1Z7LA 1XX5A 4BUPA 4XLPF 4XLFA 3L2QA 4OIRF 1SMYF 5AIPA 3PM1A 5FGMA 4L0YB 2HDWA 2HOAA 2V1XA 4N9HA 3WGHA 4RAFA 1HQCA 1BIAA 3K1MA 2IW5A 4XLNF 3VPRA 2DMNA 3FBIB 1HF0A 2O3FA 1BR1A 2NOJB 4XONA 3WG9A 2B9SA 5M3MJ 1T38A 3CLOA 4U7DA 1GXPA 2DOAA 1WH5A 2HXIA 5LLQA 5JVGF 1A6QA 2O7OA 2HYFA 3CJNA 1UELB 3MVPA 4YIIA 2W57A 4Q4ZF 4HOBA 5GADJ 4WXHA 1B6AA 2OTJI 1VQKI 1IN8A 3C2HA 3RQ4A 2E2HJ 1R00A 1XDSA 4BQOA 3J80K 3GTLJ 3A1YA 1SFXA 2Z5UA 2VKDA 2YX4A 2DQLA 2M2EA 3FXLA 1HCRA 3QP6A 3FX3A 4IVNA 1STZA 3GW2A 4E7ZA 5DD8A 1POGA 2MSYA 3TP0A 3OIOA 3WGGA 3I53A 4LG0B 1P2FA 3R6SA 2MBFA 3G1MA 2EK5A 4V19K 1RESA 1Z1DA 1VQ6I 2IGOA 2V7FA 5H20A 4NC8A 3E0JB 4CGZA 1MH4A 4A2UA 2CQNA 3IC7A 4XKWA 5D8KB 3BLYA 1X3WB 3Q9VA 9ANTA 1NG7A 5GAEJ 1LVAA 3MKWB 4B44A 1MDMB 5LGTA 3OL3A 3WU0A 2VT2A 2X6YA 1REPC 4JBAA 5DYMA 1WJFA 1UG2A 4O5VA 1QU3A 4EVIA 4XQFA 2P5KA 3IHUA 4IPAA 2RV8A 2IGMA 2MYSA 3QRFF 2XROA 1ZG5A 3QYFA 2GOXB 4C2MJ 2BXZA 4MIMA 2V9KA 2ISYA 1V3FA 2DW4A 1FSEA 4TV7A 4IRHA 3Q5FA 2MD5A 2O03A 1U78A 3SJMA 1KU3A 3FMRA 2QEXI 4BXXJ 4A3FJ 3K1PA 1ZGAA 3LNQA 4U7BA 3G1OA 4YEJA 1V5FA 4EM1A 2DTZA 2CV0A 3I59B 3BTIA 1S7AA 3ZQFA 1BBYA 4S05A 2H1KA 3CTAA 1D1AA 3L00A 1RZ4A 3W2VA 1HC8A 3LSIA 4DOZA 4EEFG 3OYCA 2L9NA 1IN6A 3QOPA 1R5ID 3BY6A 2WB1N 5DM7F 5LHGA 4B8XA 1OYWA 2V6EA 3FF5A 1YJ9I 5F1RA 4NQWA 1IF1A 2R92J 1U6GA 3H5NA 2PJRA 1EF4A 3DPUA 1BR4A 2DFFA 4I76A 2F5VA 4G12A 2P81A 3D5SC 3AG4H 4UUSB 5DM6F 3IRQA 1JJ8C 1OMIA 3SDBA 3OYHA 4UHTA 2QA4I 5H6QA 4DZPA 3FIWA 1HBXG 5J40A 1R58A 2LP0A 2ZO4A 3OWTA 3CQZJ 2LMDA 2WV1A 4QWQA 2LTPA 1B9NA 2A68F 2D1VA 4UVBA 5E3NA 4PCQA 2DMTA 3MD2A 5FD5A 1YHQI 4IJAA 2QSFX 4PSWA 1OR7C 3QODA 1MBGA 4Y33A 2NXNB 2X1CA 1U9NA 1G3TA 4N4NB 1ZARA 3W6JB 3HC7A 4AM3A 2HGCA 2QQ8A 5F0CA 1FYMA 2OQRA 3FXUA 2MLGA 3L2WA 2EFOA 2PBIA 3BDDA 2F5DA 2PMZA 1Y0UA 3K4CA 3VSKA 1LE8A 4A5NA 2JSPA 1G6NA 3S3OA 1FTTA 2LH9A 4AYBA 3HGGA 1TWGJ 2L4MA 2CUFA 4HNUA 1ZRDA 4GYIA 3IH3A 4B48A 2GIZA 2LLKA 3TKYA 3DV8A 3DFGA 1XGOA 3HSRA 2F2EA 2JA5J 1J75A 5CQGA 3KEYA 1YITI 3BQZA 2UWMA 4HX4A 4DQ2A 4LIUA 2I8DA 3OYNA 2L0KA 1TL8A 2ME0A 3KLOA 4NUBA 4KNYA 4BQNA 2K85A 1B72B 3BROA 3HSFA 2JJ7A 1OPCA 1ZK8A 4EM2A 4YFNF 3I71A 4IQJA 1RI7A 3MKYB 3LSKA 5KAFC 4XMYA 2OJED 3S15J 3PNYA 2P6TA 4MNUA 2AXTC 2UXXA 2XV4S 5K5OA 1OCCH 1WWXA 2LK2A 4PDKA 2R5ZB 3SZPA 2H1LA 1ORKA 1EH7A 3J7AO 5CVJA 3JRGA 1MJ9A 2A61A 3DEUA 3F6VA 3H5AA 4M74A 2PLYA 1YS6A 3JSPA 3JRHA 5IOZA 1HDDC 1YJNI 1Q1HA 3ASOH 1FC3A 4M9SA 1VFCA 3QYBA 4A3CJ 2NYXA 4LD5A 2M7AA 4WXDA 3ROUA 2H09A 2CGPA 2W7NA 3DBRB 5B5EC 3PO3J 1LNWA 3VODA 1BA5A 5HS7A 2JA6J 3F0CA 3VYSB 4WCGA 1K83J 1X4PA 2IRFG 4P55A 1R4MB 4RB2C 5LEKA 4M71A 3BWGA 4CYDA 4S04A 4JK1X 1BC7C 1R5GA 1ETXA 2XGDA 2QLZA 2ZBKA 4ZYHA 2JN6A 3S16J 5C4XJ 4RGUA 5A2QZ 2HFHA 1IXCA 4BQQA 2LY1A 2ZXWH 1KU9A 2HS5A 5F1JA 3ASNH 4KIFA 4J00A 1I3QJ 2P7VB 2KLOA 1OCPA 2RREA 2BXYA 1U5TB 1KZHA 3VB2A 1VQOI 2CV2A 5CQEA 1IN5A 1Z7UA 3VYUB 2KRFA 5D5VB 2IS2A 4PUSA 3P9KA 3AKZA 3GZ6A 4KMFA 1UG0A 4BGDA 1Z91A 4QTRA 1O57A 4A3IJ 4CZZA 4WWCA 2A3SA 1IGNA 3CMYA 2E2JJ 2BBYA 5E3OA 3HOTA 4M9ZA 3FDYA 4XN3A 4D5CA 4MLOA 1USSA 1YW8A 2HPIA 2FBIA 1HDPA 3SYTA 2EZIA 1TBXA 2F6CA 2CFXA 4FISA 3CCMI 2W1OA 3M1CA 2DO7A 2M87A 2LR8A 4XOTA 2HVRA 1FTZA 3LA7A 4BBRJ 2DOFA 5EZHA 1FJLA 1BI2A 2L9RA 3D0SA 1QQIA 2CRGA 1H88C 2VONA 4CXFA 4E7SA 3ZQLA 1L0OC 4UB6C 3OS0A 3I56I 3ABLH 3GUDA 2HQAA 1G3YA 3BZCA 1I6XA 1OR7A 3EUKL 4QLCU 1X1BA 1I50J 5ICCA 2VQCA 3V8JA 3SFZA 3H5RA 4MQVA 1I39A 2HWVA 3R0AA 1YO5C 2JRMA 3DXJF 2W25A 1QZYA 4LITA 3I59A 1O3RA 2LNBA 2CSOA 4XKCA 5JHFA 4E70A 1AHDP 5BMZA 2R93J 1XGMA 2JTVA 1DU0A 1D5VA 2FQ4A 1R4NB 1WJCA 1V4RA 5BS6A 4W1UA 3ABKH 3E1SA 3FXOA 3O3KA 4IZZA 3AAFA 2OTLI 2JVGA 4RB1A 1IAWA 3X2QH 4EJTA 3KZZA 4L9JA 5FO5A 5J4VA 5L3CA 2FEZA 1TQPA 3ZOBA 2E60A 4EJVA 2KKOA 2XB0X 3ECOA 1KONA 3O8HA 3C2GA 4IEJA 5HNHA 4BE0A 3ZPLA 4I02A 2QKLB 3CO6C 1PDNC 3OYJA 1ZREA 4X1EA 4H0EA 1MMNA 2Z3YA 4ZYDA 4XRSG 4XRFA 5D6EA 3OYAA 3DPTA 3RKYA 2IS6A 3EQLF 1FIPA 2QZ8A 4A3BJ 4ZDPA 3IL2A 2GWRA 2DI3A 5HOOA 2JPBA 2IAIA 3HL2A 1W7PD 1WQ2A 5H2FC 4HX7A 4JX5A 4II2A 3Q0VA 2GOMA 3IAM2 2OAZA 4UNOA 5M5YJ 4FX0A 2ZSIB 3RCOA 1NK2P 2HZTA 3HOWJ 4Z6YA 4OMYA 2O8XA 3ZMVA 3IWFA 3KP4A 2RQPA 1DGRM 1LEAA 4IRGA 1X3ZB 4FHTA 1K4TA 3CUQC 2HZDA 5LRSA 4XR6A 1QPIA 3K0LA 1SAXA 5D8LB 5AIQA 1DUXC 1WJEA 3EDPA 3FXKA 1QGPA 2BGCA 3RZDJ 2Y0SA 2K86A 3HKZA 4M3FA 1H9TA 3ZQ7A 2Y0SN 2CJJA 2CO5A 4HEA2 2XKPA 3O8GA 4XLEA 3ZR8X 3PQKA 1S9HA 1VI0A 3H92A 2MA3A 4XOPA 4BACA 4NHJA 3PUFA 1BW6A 1W7PB 1MIJA 2X51A 2STTA 3EUHC 4EGYA 4AIKA 3RDIA 1GVJA 4MFDA 1TWAJ 2Q2EA 4BE2A 4BEHA 4O3MA 4AIDA 4A0XA 1R1UA 4A3KJ 5DV5A 2G9WA 2VASA 2AO9A 3ZGKA 1QO0D 4CUGA 2V1UA 3GTMJ 3BP8A 4LG0A 2XDVA 4F93B 3L2RA 3LAJA 3HOZJ 2LC2A 2AXLA 4GO1A 2L7KA 2QVOA 1GV2A 1MW7A 2M7BA 1R7JA 1YS7A 2R5ZA 3OOPA 3OYKA 1V5EA 4HPQA 1WSUA 1RKWA 2O8KA 1W36C 3S2DJ 4C2UA 2FF4A 3LSPA 1HA8A 2LBFA 3JRCA 5FRNA 1FMVA 1K6OA 3LFUA 3OYGA 2NOGA 2CV1A 1JT6A 5FRMA 1ETWA 1BI0A 3L7WA 4P5OA 2WWYA 4A3LJ 1XGNA 2MC3A 3DQVC 3E6BA 2HKOA 3MMYB 4KFCA 2IEKA 2H27A 1IG7A 3J81Z 4HA8A 1TZLA 4GRIA 2XF6A 2FMYA 4EGZA 1RR7A 2DXIA 1Z77A 1BOAA 2Q8KA 2CQQA 2FUG2 2OU2A 4JX6A 1RNLA 2DA1A 4CSWA 1OJLA 5LHHA 2EFPA 1IJWC 3K4BA 5J8CA 1YRNB 2VJ4A 2Y48A 1LFPA 3I54A 3DLAA 3ZMDA 2NVQJ 3LSGA 4L9VA 5FFXA 3DKXA 3FXJA 3JTHA 2ZXHA 2HDCA 1LB2A 4CCNA 2KDOA 3MKZA 1XC5A 5DUKA 3G73A 2LG4A 3NWTA 2PN6A 5KNLA 3DTKA 3F8MA 4PSXA 1X1AA 3RTRA 4DZJA 4CZCA 3J7AY 5D5WB 3ABUA 2X4HA 2QCOA 5F64A 1QBJA 3PSIA 3H35A 4N4OB 4DJAA 2GZWA 3ZQQA 3TP3A 1VF9A 4XM3A 3CP8A 5LRRA 3GX4X 2VE8A 2EIMH 2XRLA 3W2AA 4OIOF 5ICEA 3QAHA 4G8XA 2IS1A 3HYIA 4HNTA 3A2KA 4MQ9F 5CKTA 4YFXF 3OYBA 4A0ZA 3GFMA 4UB8C 1PJRA 2MH2A 5C3EJ 2E7WA 4PJNA 4DBRA 1I6HJ 1D3YA 4C2TA 1RC9A 1F1ZA 1UZCA 2JA2A 1LEBA 5D5UB 5D4RA 4E6KG 2R5YB 3GMEA 3F3XA 5GTIC 1W4MA 5HLIA 1JJ6C 2VOOA 2XUBA 2RNJA 1RUNA 4RA2A 3BC8A 4CICA 1T2KA 5C4JJ 3Q0UA 2XPWA 2OZUA 4F7ZA 2NS0A 3ZMZA 2VQHA 4G6QA 1IXSB 2DA6A 4LLGF 1ETQA 1VTNC 1G2HA 2R7RA 1FYKA 3F8NA 4UUSA 4EM0B 1VQ5I 2BY0A 3ZXSA 1HW5A 2FQ3A 2XASA 2VOPA 2VXZA 4XN0A 4I01A 1AKHA 2B7EA 2EA4A 1A04A 2VBYA 3ZQIA 3K70C 3I58A 2Q1ZB 3CMMA 3W6VA 1ON1A 5CPRB 2XF5A 3CCJI 2IJLA 5DDGA 3M4OJ 5EEGA 1F36A 2DA4A 1ETYA 3MWMA 2K27A 1MH3A 4U0WA 1O3TA 3PNVA 1H0MA 4HG2A 3LL7A 5TRDA 4HYEA 1U2WA 3GZ5A 2ZFWA 4IHYA 2BY1A 2HR3A 3JCUC 4D9JA 2FX0A 4KN7X 1TT5B 4HAMA 4KT5C 5L3BA 3WU1B 2XGXA 4LG3A 1R36A 3PFIA 5IP7J 3TEDA 5EEHA 1YX5A 4IOCF 3DKWA 5B66C 4MFEA 4HF2A 2Y69H 4E7KA 4S0HB 4QIWN 3ZQCA 3V8LA 2WB1A 2AS5F 5HS8A 1MMDA 2Y9ZA 1R1VA 3F23A 2ID3A 4LMYA 2YSRA 3G71I 1A5JA 1FBQA 4UVCA 1G3WA 5FJ8J 3NEUA 1P9QC 3DPLC 3E7LA 2L7FP 2Y2ZA 2FRHA 3ISPA 3GTKJ 5E20A 2X6XA 1LJ9A 3QP5A 5CYVA 1ZG3A 1B9MA 6PAXA 2IP2A 1OLTA 3BCBA 5HVQC 3B73A 4P96A 4AC0A 2Q0OA 2H94A 4OMZA 5K7ZA 1C0WA 4OAYA 4YIRX 1WCMJ 3GXOA 3K69A 1K6YA 4OAZA 3U2RA 1MSFC 2R7VA 3CMEI 4Z2YA 4RMNA 1X4OA 4PGGA 1TLHB 2HQRA 2UXNA 1FX7A 4R79A 4PK4A 2V4JC 2Q2EB 3C18A 3A0HC 3HOVJ 3G6EI 3R60A 2DPDA 5FLXK 1U5TC 3BG3A 3LAPA 3RJPA 1T39A 2GA1A 2EILH 5JR3A 2JPCA 3R4KA 4A69C 1X1DA 3DEWA 4A3JJ 3WHCA 2XF7A 5GPCA 1FIAA 4KA4A 3AG1H 2E1CA 3ZN1A 3LSTA 2E34A 2M45A 2XKOA 1O7FA 1IV6A 1BI3A 1T0FA 2KRCA 2L7MP 2LY2A 1JGGA 2K4BA 4D5FA 5ILVA 2HQNA 3O2PE 1WJAA 2VBZA 1XD7A 5FROA 2ZKZA 4OU0A 4BHCA 4EV0A 4ZH4F 3HOSA 3DU6A 5IOYA 4IO9F 3IWZA 5IP9J 2LDUA 3PL8A 1W0TA 3OL4A 3TDZC 3RI4A 2W48A 4CCMA 5HLTA 2PI0A 1JUPA 1RR8C 2MLKA 1Z3YA 3SFIA 1EA3A 3QPHA 5LGUA 3MZ8A 5HS9A 2ACJA 4FE7A 1A6IA 2CS3A 4OIPF 3ABTA 1U8RA 2XIGA 1YFHA 5CVVA 3S1QJ 2R7DA 2YX7A 4KIBA 2QQAA 5B1AH 4LB5A 3HHGA 1FOYA 2MH9A 3GCMA 3BTLA 4ABZA 4CO8A 1SD7A 1J09A 5K7HA 1D8JA 4FTHA 2E7XA 3GYHX 2V1NA 2E35A 1FY7A 1TQMA 3BZ6A 3UR3C 5LHIA 3L9FA 1AOYA 2ZJRF 3HDDA 2MGQA 3OYDA 2M8EA 3QU3A 5KCMA 4E4HA 5E3MA 5M3FJ 5E79C 4BBSJ 2UV1A 3F21A 1HKQA 2O6GE 4XRSA 3M8FA 3DKYA 4F52A 3KP2A 3GLXA 1VQLI 2RKHA 3C2BA 2A07F 3VYRB 2X6OA 1S5LC 2FNAA 4RLFA 2XPUA 2ZFUA 1YW9A 1RETA 5EZGA 1ZG1A 3K6GA 1YX3A 2X85A 1O4XA 1CGPA 2L9SA 2V26A 3HRTA 5E1ZB 4XK4A 4BJ5C 4DYQA 1CF7B 2VODA 2GAUA 2IGKA 4A5MA 1D5YA 1NHAA 1HSJA 2XVCA 1ERDA 3L2UA 2PFBA 2QGUA 1YIJI 2JA7J 1KQ0A 3E5XA 5BOXA 1Z21A 1YYVA 2CQ7A 4AUXA 4C3IJ 1FBUA 2COBA 3TMOA 1LPQA 2HXOA 2JQ7A 4IXAA 3WTUC 4A93J 3E5UA 4LJZF 3KYLA 2I5UA 1ETOA 2P7CB 4L5IA 2E19A 3V4GA 1ACIA 3KP6A 1N75A 4HW0A 4WXCA 4BH9A 4UV8A 4Y52J 2HYJA 1MBKA 5EEAA 2L2OA 1Y56A 3LSMA 4HNVA 1E3OC 5CVUA 3TW6A 1T6SA 4I7HA 2K9LA 2JT1A 4XSXF 4HRIA 2DMPA 5GTHC 2E2IJ 2J5PA 5JI6A 5FLMJ 4XL9A 1ZTRA 5K5RA 2NNNA 2EPFA 1X1CA 4NBQA 4XBFA 3DTEA 4A3EJ 1U5TA 3EETA 1QVUA 2EV0A 1LVKA 4CCLA 2IA2A 2EH3A 4Y15A 2LF8A 4C30A 1IDZA 1YQAA 5TJJA 1K7AA 2NNYA 2CQKA 3IKTA 4BJTA 2F5FA 3BR5A 3FXQA 4HBLA 2ZSHB 3OYIA 4Y13A 4IRIA 1JXSA 1RPWA 2A6EF 2GIVA 2EINH 3WTTC 3S93A 1I3AA 3H9JA 2VLAA 4IQ4A 4U88A 2KMUA 1QZEA 1YOVB 3GVAA 3AG2H 3ABMH 3DBHB 2OC6A 1AA7A 1XSXA 3OR1C 4HLYA 1WI9A 2HTJA 1B8IA 3E97A 5L3GA 2AHQA 4HZFA 4ESFA 2VPLA 3QOEA 3ERED 4GXOA 3HBLA 3HRUA 1U3EM 5ED4A 1P7IA 3S1NJ 2OV7A 1V54H 3RSNA 4RB0A 2XGCA 3VDXA 3OV8A 3R0JA 5GAHJ 2BY2A 3KETA 1U8BA 2DU9A 4RGRA 3M1EA 1DGWY 2W82A 1D0XA 2RN7A 3F8CA 5IPAA 3ECHA 5KHDA 1EKEA 2P6SA 3CC7I 3H0DA 1HXDA 3CCEI 1W5TA 2IBDA 1SC7A 3WE2A 4OWRB 2A5WA 3NAUA 1VQNI 2DA5A 1GVDA 3H9GA 2P5VA 3A02A 2RGVA 4IOAF 2M4GA 2DT6A 3VYTB 3ZN0A 1JI8A 2J5OA 3BQYA 1SD5A 1U9OA 5CLSA 2C6YA 1OISA 4EQQA 1Z3XA 4A6DA 1XDUA 4A3GJ 2W24A 3PFYA 3DTIA 4V2GA 1W0UA 1WJ5A 3OY9A 2QQ9A 2V9VA 3AL0C 4M6XA 2QQBA 4U0VA 1MSEC 3M3YJ 1ZKGA 3KEOA 2VN2A 4F91B 3M8JA 4KUMA 2V79A 2BHZA 3DF8A 2HKXA 3VOEA 2IA1A 5HDNA 4RBOA 3OSFA 1HSTA 4AWXB 2F5CA 5L3FA 3OYEA 4KISA 2R7SA 4RM3A 2DT7B 3SZTA 4FT8A 2A6HF 3LFKA 1KQ8A 4M9XA 3HOUJ 3S1MJ 2HI3A 2MABA 3WHBA 2EBIA 1DPUA 2IGNA 5C44J 5E17F 2Z33A 2G7HA 1JKRC 4MEYF 2E1OA 2DLLA 1KA8A 4A3DJ 4ZZDA 3Q3SA 2XAGA 3OYMA 1WVRA 1A31A 4GGGA 3SQNA 3TW7A 2NVYJ 2BEOA 4CYCA 2E1NA 2EQRA 2LKSA 1BW5A 4ZYAA 3COAC 1R9TJ 1BJAA 2WBMA 2DDBA 2CW7A 2KIFA 3ELKA 3MQ0A 4HF1A 1T08B 5IYDJ 5LD2C 1PUEE 4PJMA 4DYRA 2OBPA 4HDUA 3FISA 3HZJA 2Z2SB 3FXRA 3EUAA 2WY8Q 3U1KA 1FOKA 3D5RC 2OD5A 2CWEA 4ENJA 1I5ZA 2KZGA 1SD4A 2IVMA 2OPTA 2BZTA 1HW1A 3J81K 2H8WA 1J59A 2RNGA 4B1RA 2KQRA 1E3PA 3HIFA 1SFOJ 2JUCA 4WF2A 2HDDA 3CDHA 3CMAI 5JFRA 2DODA 3IKVA 1JKOC 2YUSA 1WZ2A 1OCRH 4RLQA 1ETVA 4ZDLA 3CP2A 4CYCB 4M6YA 1AKHB 1X58A 3VFZA 1Y1WJ 1W5SA 2X6WA 3DEEA 3DU5A 2DFIA 2MC4A 2VKHA 3A01A 3OS2A 2F4MB 4CHUA 3G1LA 1PUFB 1K78A 4UVAA 1PP8F 5JLXA 1ZQ3P 1XMAA 1ZYRF 3B02A 1BC8C 4ZDOA 3RYPA 2JRTA 2R0QC 1FLIA 5F04A 5K5QA 4YG2F 1O3SA 1IUYA 1B8IB 3IH2A 1VQ8I 4L9TA 2ZJQF 2CYYA 2ETHA 2KHMA 2WADA 4A12A 4XSZF 2W84A 2DCEA 3H3UA 2K7LA 3OYLA 2DDAA 2X48A 1I1SA 1Z67A 1WHUA 2EFWA 4XKBA 5FKKA 3CF2A 1FNNA 3T8RA 3FKIJ 2M3AA 4B3XA 1MJBA 1H8AC 2V9PA 3W2WA 2ZMEA 3CUQB 5J6XA 1YJWI 4WK8F 1JUMA 4HV5A 1MZBA 3CUOA 1H9GA 1FP1D 2A5YB 2FU4A 2LOOA 3M9AA 5F0HA 1OQYA 4PJ0C 3RIRA 1UJ8A 2FD5A 2BW3B 1JT0A 1F9NA 4NDLA 3KP7A 1VQ9I 2K9SA 1UFMA 4G6TB 4M3DA 3FHNA 3U21A 4ZTJA 2XB5A 3MCZA 1QHHD 2VJJA 4BEHB 2L02A 2FA5A 3U9GA 3QU6A 2X1DA 4RAGA 4C3HJ 3WTXC 4KMUX 4OINF 4ZTFA 1J9IA 3KIOA 4HSTA 1XCVA 3WTWC 3GTJJ 4YIFA 4FASD 5HDKA 1PP7U 3FHZA 5FLXZ 4J19A 1T95A 1IZ1A 3LMMA 5DCMB 2GM4A 2FBKA 2K3PA 2L4AA 4I0AA 3HXLA 3I0TA 3MZHA 3CCLI 2ZC2A 2ELKA 1T8IA 1P7JA 2JWTA 1MMSA 2HNHA 2JUGA 4EJUA 2CUZA 2VL8A 4LGWA 3BPVA 2HTSA 4DW6A 3LOCA 2IT0A 2VE9A 3HEFA 1Q1VA 5K7FA 1Y8RB 2LY9A 3BJ6A 1DP3A 2VKEA 3L09A 4AIJA 2XAJA 4NC6A 1JTYA 1Y0NA 2N8GA 3S8PA 2ME6A 4DYCA 1YG2A 1P92A 1BIBA 3GTOJ 2EV5A 3T0YA 1O7LA 4HQMA 1S7OA 2NS8A 1GXQA 2KP6A 3GTGJ 2E36A 5CJ9A 4KT6A 5FKOA 3MKLA 3K4JA 1LDDA 2K9QA 3QPTA 1YLFA 5E1XA 3HHHA 1WGXA 3H3ZA 1LQ1A 4UV9A 1JKQC 4B3AA 4ON0A 4BY1J 1HKTA 4ZYGA 4AIHA 3ZQGA 2P8TA 1L3LA 2IXSA 2TCTA 2M0MA 2XAFA 1AU7A 1OKRA 1MKMA 4ANJA 4DNCA 2CW8A 2P4WA 1JE8A 1FZPB 2L9VA 3TGNA 3BR2A 4BE1A 1ZR2A 1IDYA 1HKSA 1MD0A 3CJTB 2Z99A 3CESA 3D1NI 1MMAA 2D45A 3PO2J 5D5XB 3MFKA 4KDPA 2G0EA 5M5WJ 2QSGX 3FXMA 1UCRA 2R7OA 3PIPF 1B4AA 3N05A 1NH3A 2WY7Q 1ZN2A 1WJBA 1R49A 2VKVA 2ZMEB 4P9FA 3R61A 2YS9A 4ITVA 4E7JA 2XC7A 4LK0F 1BM9A 2CG4A 1TTYA 3N97A 4FX4A 1E0EA 2RAEA 1MBFA 1X2NA 3GO5A 3IUOA 5DS9A 5DTDA 1OFCX 4YRVA 2DYRH 1XGSA 3I4PA 3PQJA 2PEXA 1YW7A 1SVLA 3BTCA 3SXYA 3H3VK 3EYIA 2M4KA 5D4SA 5ILUA 4KIGA 4QSHA 3VWBA 1Y8QB 3F6OA 4JP0A 4BL0B 5ICFA 3SEQA 1VQ4I 2ZNYA 1Z6RA 2CW0F 3K4MA 3HOYJ 2DJIA 2P5LC 3V7SA 2XPVA 5DCFA 3BG9A 2BOLA 2F4IA 5H6RA 3CCVI 2IA0A 3IH4A 4OIQF 1UAAA 2KRHA 4HQEA 3I64A 4UY8I 2BVLA 1ZGJA 2A05A 2KIUA 2Z1DA 3GFIA 2K9NA 3BJAA 4M3GA 4DBQA 2HOEA 3BTJA 4B47A 2AQFA 1EJ9A 2A6TA 3L1PA 2OUMA 3DBLB 2VB6A 2EFNA 2Y9YA 2K9MA 3HM5A 2E71A 1OYIA 1YIOA 3K4NA 2M30A 2OA4A 2QENA 2LF7A 2XAHA 4LK1F 3TOAA 1VQMI 3I4NJ 1SEUA 4BQAA 2YU3A 1P4AA 2GQQA 2ZXIA 4BAYA 3OS1A 1Y1VJ 3HUGB 3QWLA 3CDIA 3U1DA 3F72A 2FBHA 3TO9A 3IV5A 1S72I 2DA7A 3CJQB 3E3VA 2L3DA 3OYFA 2O9LA 1X2MA 2YR2A 3W3CA 1TT0A 2O5RA 1YE9A 1MNEA 1OCTC 2M34A 3BG6A 2L7ZA 4CCKA 2VPRA 4I99C 3CCSI 4E7HA 1PUFA 2RQQA 4KJZA 2QUFA 4PFOA 1R5HA 3RKXA 1W36D 3C3WA 2DPUA 4BNCA 2WTEA 3E6CC 3CC2I 1OCZH 1JGSA 2EZHA 3GTQJ 3CCRI 1MGTA 1IV8A 3KZIC 4LLNA 2VI6A 2ZCWA 2ZB9A 3K1NA 3CCUI 4A3MJ 2WC2A 1TWCJ 3PSFA 4EMSA 1OYYA 1KGSA 4HDVA 1SFUA 2RC4A 1MNDA 3WTYC 2DMQA 3HRMA 1QRYA 2P0WA 4UXNA 1QZZA 4PJJA 2R7TA 3LWFA 3HPGA 4II3A 1UHSA 4BXFA 4ESJA 2WAFA 3HB9A 2DQRA 4NC7A 1TW3A 4UUTA 3WTVC 1NK3P 1IRGA 3E6MA 1ZELA 1SANA 2VJ5A 1R6RA 3KP3A 5IYCJ 3L2CA 4JQFA 2M9HA 3WE3A 3T8TA 2X0LA 3UNGC 4KITB 3EYYA 2G7UA 2Y30A 4CCJA 3A01B 4C9YA 1IXRC 2W4SA 4V2FA 3WG7H 3P5JA 1KU2A 2GA2A 3KLNA 3ZCOA 4RDUA 4L18B 2R7UA 2ZMEC 2DFHA 1XSDA 1KYZA 2GBYA 4XLCA 4MTEA 4U87A 3K10A 5IT3A 3RKWA 1SFEA 3UKGA 2Z16A 3K9TA 1MNMC 3P9CA 3WTSC 3HUGA 1E3HA 1QPMA 2FXAA 4ZJZA 2QWWA 1ONVA 2KPMA 4RS8A 2R5YA 2WV0A 1A35A 3I9V2 5LFAA 3TQNA 4BKXA 3PJRA 2X9DA 5JHUA 4F55A 2BHYA 3EUHA 3PNTA 2K3FA 1P4WA 2VQGA 3JR9A 3ML6A 5E18F 4L5JA 1MMGA 2FJ1A 3PUBA 1D1CA 5ILSA 4MTDA 3GWZA 2LD5A 1BI1A 3ZRGA
chains in the Genus database with same CATH topology
4LOCA 4IHXA 5IPAA 3CDLA 1WH7A 1XG1A 1QPIA 1JTXA 2MG4A 2IBDA 2PMZN 5FKLA 3HGYA 3NAUA 3RZDJ 3HOXJ 1F43A 2DA5A 1GVDA 2VUMJ 3A02A 4M3FA 2B63J 2Y0SN 2CJJA 3JRAA 3O8GA 1GUUA 1VI0A 3BQYA 1U9OA 1B72A 1BW6A 1WPKA 4A3GJ 3ZQHA 3BT9A 3S17J 4V2GA 1W0UA 2DN0A 4MFDA 1TWAJ 4XRMA 4JYKA 5EGOB 1MBJA 1MSEC 3MN2A 4A3KJ 3M3YJ 1ZKGA 3A03A 3Q0WA 4D7NA 2AO9A 3PM1A 3GTMJ 3OSFA 4RBOA 2HOAA 3HOZJ 1GV2A 2R5ZA 5EG0A 1RKWA 2O8KA 3HOUJ 3S1MJ 3S2DJ 2HI3A 3VPRA 2DMNA 3WHBA 1HF0A 3LSPA 2EBIA 3JRCA 5M3MJ 2HQ5A 5C44J 2NOGA 1JT6A 1LE8B 1WI3A 1JKRC 1ETWA 1WH5A 2E1OA 2HXIA 1S7EA 5F08A 4A3LJ 4A3DJ 2Y31A 3Q3SA 2O7OA 1TC3C 1IUFA 3MVPA 2ECBA 2DA3A 2EZKA 5J1RA 2IEKA 3TW7A 2NVYJ 1ZGWA 4CYCA 2EQRA 1IG7A 1BW5A 1R9TJ 2E2HJ 1YRNA 1RR7A 5IYDJ 3GTLJ 1Z77A 4DYRA 3H0GJ 2M2EA 2CQQA 3DCFA 3FISA 5FLVA 3LSRA 4JX6A 5F27A 3RQIA 1HCRA 2DA1A 1OJLA 1HLVA 1IJWC 4XIDA 1YRNB 4FCYA 1POGA 2MSYA 3TP0A 1H89C 2OPTA 3OIOA 2NVQJ 3LSGA 2MW8A 4B1RA 3QPSA 3G1MA 1SFOJ 1XC5A 4D7MA 1RESA 2HDDA 4AYBN 2XGEA 2CU7A 4DZJA 1GT0C 1JKOC 2YUSA 1MH4A 2QCOA 1ETVA 2NVXJ 9ANTA 3TP3A 1VF9A 4CYCB 1AKHB 1X58A 1Y1WJ 1BL0A 3A01A 2XRLA 1FEXA 1UG2A 2K40A 3G1LA 1PUFB 1Z0XA 2CUEA 2JA8J 5JLXA 1ZQ3P 4C2MJ 5C3EJ 4MIMA 4L5EA 2R0QC 1I6HJ 5F04A 1GDTA 1U78A 2DMUA 3SJMA 3OSGA 2R5YB 1B8IB 4BXXJ 3IH2A 5E3LA 4A3FJ 1JJ6C 4IHVA 3LNQA 3G1OA 5EDNA 1TWFJ 2DTZA 3ZQFA 3BTIA 3Q0UA 2X48A 5C4JJ 2XPWA 2H1KA 4GFBA 2LKXA 5FKKA 2DA6A 4EEFG 1ETQA 1G2HA 3FKIJ 1H8AC 2WB1N 4M3BA 4UUSA 3QPLA 2ID6A 2NS7A 3LSJA 1JUMA 2R92J 5F0HA 4M3EA 1EF4A 1K61A 1AKHA 3K2AA 2FD5A 4I76A 3ZQIA 1JT0A 5M5XJ 4G12A 4NDLA 2P81A 4UUSB 3W6VA 2K9SA 4W97A 3B6CA 4M3DA 5JLWA 3M4OJ 3S1RJ 1F36A 2DA4A 2XB5A 1ETYA 1JJ8C 2H8RA 5EGOA 1MH3A 3BR0A 4DZPA 2HOSA 3FIWA 3RKQA 2LP0A 4C3HJ 3S14J 3CQZJ 2WV1A 5J3LA 4IHYA 3GTJJ 4XICA 3GTPJ 2FX0A 2LTPA 4J19A 2GM4A 5E3NA 2DMTA 3B6AA 5IP7J 5EF6A 2ELKA 1P7JA 1APLC 2JWTA 3TEDA 3K7AJ 4MFEA 1MBGA 4DW6A 2EZLA 4S0HB 1U9NA 3LOCA 4QIWN 3ZQCA 2R7ZJ 4X6AJ 5F0CA 4B4CA 2Y9ZA 3HEFA 1Q1VA 5K7FA 2LY9A 4MO7A 2ID3A 1A5JA 3JREA 2VKEA 5FJ8J 3JRFA 1JTYA 3E7LA 2L7FP 2Y2ZA 3GTKJ 2N8GA 1LE8A 5GPAA 2ME6A 4DYCA 1JKPC 3GTOJ 4AC0A 1FTTA 3HGGA 1TWGJ 2NS8A 2CUFA 5K7ZA 5EG0B 1WCMJ 1GV5A 3IH3A 2LLKA 1MSFC 3GTGJ 5FKOA 2CQXA 3MKLA 2JA5J 2K9QA 2DJNA 1WGXA 1JKQC 3BQZA 4BY7J 3HOVJ 4B3AA 3BG3A 2QF7A 2L0KA 4BY1J 2ME0A 3BR6A 3ZQGA 1B72B 2JJ7A 2TCTA 1ZK8A 4A69C 5HODA 3DEWA 1AU7A 3FK6A 4A3JJ 3WHCA 5GPCA 3BR2A 1FIAA 1ZR2A 1IDYA 3S15J 3D1NI 2OF7A 4FE4A 1IV6A 1IC8A 3PO2J 2L7MP 2LK2A 2R5ZB 2G0EA 5M5WJ 1JGGA 2LFBA 4D5FA 1ORKA 1CQTA 2HOTA 3JRGA 1RKTA 5IOYA 5IP9J 3I4MJ 2VKVA 1W0TA 3JRDA 1DU6A 2YS9A 2W48A 3JRHA 5IOZA 1HDDC 1JUPA 3QQAA 2RAEA 1VFCA 1MBFA 1X2NA 2KT0A 3SFIA 4A3CJ 5DS9A 5DTDA 1OFCX 3CCYA 3BTCA 1VNDA 2D5VA 3H3VK 3PO3J 4FE7A 1A6IA 4QSHA 1BA5A 2JA6J 3F0CA 4JP0A 1K83J 1IRZA 3S1QJ 3HOYJ 3BR1A 3SDGA 2XPVA 2YU9J 3BG9A 1ETXA 2XGDA 2JN6A 4ABZA 3BTLA 3S16J 5C4XJ 2NVTJ 2WAQN 3IH4A 5FKMA 5F1JA 2K9NA 4M3GA 5K7HA 3BTJA 1I3QJ 1LFBA 1OCPA 3L1PA 1ETKA 4FTHA 1TWHJ 2Y9YA 3GBGA 3HM5A 3BR3A 2LVSA 3HDDA 2MGQA 3I4NJ 5E3MA 5M3FJ 4BBSJ 1BJZA 4QTRA 4A3IJ 4XRSA 2DA2A 1T33A 4IHWA 1Y1VJ 1LFUP 4M6VA 1HOMA 5J1YA 3JRIA 3CMYA 1NTCA 3IV5A 1ZR4A 1IGNA 2E2JJ 2DA7A 5IP6A 3C2BA 4Y7NJ 5E3OA 3HKZN 3BG5A 4D5CA 2O9LA 3RZOJ 4MLOA 2X6OA 2ECCA 1X2MA 2XPUA 1HDPA 2EZIA 4FISA 1RETA 4I6ZA 5EZGA 1OCTC 1O4XA 2M34A 2LR8A 2L7ZA 4XK4A 1FTZA 5F0FA 4DYQA 2VPRA 4BBRJ 5EZHA 1D5YA 3FK7A 1PUFA 1FJLA 2L9RA 2JA7J 2CRGA 4C3IJ 1H88C 4AUXA 2EZHA 3GTQJ 3ZQLA 2VI6A 2ZB9A 5FKNA 2COBA 4A3MJ 2HXOA 1I50J 1TWCJ 4A93J 1ETOA 1QVTA 2TRTA 1T56A 2E19A 2I10A 2KDZA 2M8GX 2DMQA 4Y52J 2HYJA 1MBKA 1QRYA 3JRBA 5EEAA 4HNVA 1E3OC 1UHSA 1AHDP 2R93J 3HB9A 3TW6A 1UMQA 4UUTA 2JK3A 1DU0A 1NK3P 2FQ4A 2DMPA 2E2IJ 4W1UA 1SANA 5IYCJ 2JMWA 5FLMJ 1ZTRA 2XSDC 1JUSA 2M9HA 2M0CA 4A3EJ 2Y30A 3ZOBA 1QVUA 2XB0X 3A01B 5J1UA 2EH3A 3O8HA 4IEJA 1XS9A 1IDZA 4V2FA 4RDUA 4X1EA 3BR5A 2GBYA 5BNGA 4XRSG 5GP9A 3S2HJ 1RPWA 4C3JJ 1FIPA 3UKGA 4A3BJ 1MNMC 3OOUA 5IYBJ 1MBEA 3NARA 2IAIA 2R5YA 1B8IA 2AHQA 4JX4A 4BKXA 2X9DA 4JX5A 3HBLA 3Q0VA 2GLOA 1ITYA 3JR9A 1P7IA 3S1NJ 2FJ1A 5M5YJ 1MBHA 1NK2P 5EYRA 3HOWJ 2LD5A 1ENHA 2XGCA 1U8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LOC A;  4IHX A;  5IPA A;  3CDL A;  1WH7 A;  1XG1 A;  1QPI A;  1JTX A;  2MG4 A;  2IBD A;  2PMZ N;  5FKL A;  3HGY A;  3NAU A;  3RZD J;  3HOX J;  1F43 A;  2DA5 A;  1GVD A;  2VUM J;  3A02 A;  4M3F A;  2B63 J;  2Y0S N;  2CJJ A;  3JRA A;  3O8G A;  1GUU A;  1VI0 A;  3BQY A;  1U9O A;  1B72 A;  1BW6 A;  1WPK A;  4A3G J;  3ZQH A;  3BT9 A;  3S17 J;  4V2G A;  1W0U A;  2DN0 A;  4MFD A;  1TWA J;  4XRM A;  4JYK A;  5EGO B;  1MBJ A;  1MSE C;  3MN2 A;  4A3K J;  3M3Y J;  1ZKG A;  3A03 A;  3Q0W A;  4D7N A;  2AO9 A;  3PM1 A;  3GTM J;  3OSF A;  4RBO A;  2HOA A;  3HOZ J;  1GV2 A;  2R5Z A;  5EG0 A;  1RKW A;  2O8K A;  3HOU J;  3S1M J;  3S2D J;  2HI3 A;  3VPR A;  2DMN A;  3WHB A;  1HF0 A;  3LSP A;  2EBI A;  3JRC A;  5M3M J;  2HQ5 A;  5C44 J;  2NOG A;  1JT6 A;  1LE8 B;  1WI3 A;  1JKR C;  1ETW A;  1WH5 A;  2E1O A;  2HXI A;  1S7E A;  5F08 A;  4A3L J;  4A3D J;  2Y31 A;  3Q3S A;  2O7O A;  1TC3 C;  1IUF A;  3MVP A;  2ECB A;  2DA3 A;  2EZK A;  5J1R A;  2IEK A;  3TW7 A;  2NVY J;  1ZGW A;  4CYC A;  2EQR A;  1IG7 A;  1BW5 A;  1R9T J;  2E2H J;  1YRN A;  1RR7 A;  5IYD J;  3GTL J;  1Z77 A;  4DYR A;  3H0G J;  2M2E A;  2CQQ A;  3DCF A;  3FIS A;  5FLV A;  3LSR A;  4JX6 A;  5F27 A;  3RQI A;  1HCR A;  2DA1 A;  1OJL A;  1HLV A;  1IJW C;  4XID A;  1YRN B;  4FCY A;  1POG A;  2MSY A;  3TP0 A;  1H89 C;  2OPT A;  3OIO A;  2NVQ J;  3LSG A;  2MW8 A;  4B1R A;  3QPS A;  3G1M A;  1SFO J;  1XC5 A;  4D7M A;  1RES A;  2HDD A;  4AYB N;  2XGE A;  2CU7 A;  4DZJ A;  1GT0 C;  1JKO C;  2YUS A;  1MH4 A;  2QCO A;  1ETV A;  2NVX J;  9ANT A;  3TP3 A;  1VF9 A;  4CYC B;  1AKH B;  1X58 A;  1Y1W J;  1BL0 A;  3A01 A;  2XRL A;  1FEX A;  1UG2 A;  2K40 A;  3G1L A;  1PUF B;  1Z0X A;  2CUE A;  2JA8 J;  5JLX A;  1ZQ3 P;  4C2M J;  5C3E J;  4MIM A;  4L5E A;  2R0Q C;  1I6H J;  5F04 A;  1GDT A;  1U78 A;  2DMU A;  3SJM A;  3OSG A;  2R5Y B;  1B8I B;  4BXX J;  3IH2 A;  5E3L A;  4A3F J;  1JJ6 C;  4IHV A;  3LNQ A;  3G1O A;  5EDN A;  1TWF J;  2DTZ A;  3ZQF A;  3BTI A;  3Q0U A;  2X48 A;  5C4J J;  2XPW A;  2H1K A;  4GFB A;  2LKX A;  5FKK A;  2DA6 A;  4EEF G;  1ETQ A;  1G2H A;  3FKI J;  1H8A C;  2WB1 N;  4M3B A;  4UUS A;  3QPL A;  2ID6 A;  2NS7 A;  3LSJ A;  1JUM A;  2R92 J;  5F0H A;  4M3E A;  1EF4 A;  1K61 A;  1AKH A;  3K2A A;  2FD5 A;  4I76 A;  3ZQI A;  1JT0 A;  5M5X J;  4G12 A;  4NDL A;  2P81 A;  4UUS B;  3W6V A;  2K9S A;  4W97 A;  3B6C A;  4M3D A;  5JLW A;  3M4O J;  3S1R J;  1F36 A;  2DA4 A;  2XB5 A;  1ETY A;  1JJ8 C;  2H8R A;  5EGO A;  1MH3 A;  3BR0 A;  4DZP A;  2HOS A;  3FIW A;  3RKQ A;  2LP0 A;  4C3H J;  3S14 J;  3CQZ J;  2WV1 A;  5J3L A;  4IHY A;  3GTJ J;  4XIC A;  3GTP J;  2FX0 A;  2LTP A;  4J19 A;  2GM4 A;  5E3N A;  2DMT A;  3B6A A;  5IP7 J;  5EF6 A;  2ELK A;  1P7J A;  1APL C;  2JWT A;  3TED A;  3K7A J;  4MFE A;  1MBG A;  4DW6 A;  2EZL A;  4S0H B;  1U9N A;  3LOC A;  4QIW N;  3ZQC A;  2R7Z J;  4X6A J;  5F0C A;  4B4C A;  2Y9Z A;  3HEF A;  1Q1V A;  5K7F A;  2LY9 A;  4MO7 A;  2ID3 A;  1A5J A;  3JRE A;  2VKE A;  5FJ8 J;  3JRF A;  1JTY A;  3E7L A;  2L7F P;  2Y2Z A;  3GTK J;  2N8G A;  1LE8 A;  5GPA A;  2ME6 A;  4DYC A;  1JKP C;  3GTO J;  4AC0 A;  1FTT A;  3HGG A;  1TWG J;  2NS8 A;  2CUF A;  5K7Z A;  5EG0 B;  1WCM J;  1GV5 A;  3IH3 A;  2LLK A;  1MSF C;  3GTG J;  5FKO A;  2CQX A;  3MKL A;  2JA5 J;  2K9Q A;  2DJN A;  1WGX A;  1JKQ C;  3BQZ A;  4BY7 J;  3HOV J;  4B3A A;  3BG3 A;  2QF7 A;  2L0K A;  4BY1 J;  2ME0 A;  3BR6 A;  3ZQG A;  1B72 B;  2JJ7 A;  2TCT A;  1ZK8 A;  4A69 C;  5HOD A;  3DEW A;  1AU7 A;  3FK6 A;  4A3J J;  3WHC A;  5GPC A;  3BR2 A;  1FIA A;  1ZR2 A;  1IDY A;  3S15 J;  3D1N I;  2OF7 A;  4FE4 A;  1IV6 A;  1IC8 A;  3PO2 J;  2L7M P;  2LK2 A;  2R5Z B;  2G0E A;  5M5W J;  1JGG A;  2LFB A;  4D5F A;  1ORK A;  1CQT A;  2HOT A;  3JRG A;  1RKT A;  5IOY A;  5IP9 J;  3I4M J;  2VKV A;  1W0T A;  3JRD A;  1DU6 A;  2YS9 A;  2W48 A;  3JRH A;  5IOZ A;  1HDD C;  1JUP A;  3QQA A;  2RAE A;  1VFC A;  1MBF A;  1X2N A;  2KT0 A;  3SFI A;  4A3C J;  5DS9 A;  5DTD A;  1OFC X;  3CCY A;  3BTC A;  1VND A;  2D5V A;  3H3V K;  3PO3 J;  4FE7 A;  1A6I A;  4QSH A;  1BA5 A;  2JA6 J;  3F0C A;  4JP0 A;  1K83 J;  1IRZ A;  3S1Q J;  3HOY J;  3BR1 A;  3SDG A;  2XPV A;  2YU9 J;  3BG9 A;  1ETX A;  2XGD A;  2JN6 A;  4ABZ A;  3BTL A;  3S16 J;  5C4X J;  2NVT J;  2WAQ N;  3IH4 A;  5FKM A;  5F1J A;  2K9N A;  4M3G A;  5K7H A;  3BTJ A;  1I3Q J;  1LFB A;  1OCP A;  3L1P A;  1ETK A;  4FTH A;  1TWH J;  2Y9Y A;  3GBG A;  3HM5 A;  3BR3 A;  2LVS A;  3HDD A;  2MGQ A;  3I4N J;  5E3M A;  5M3F J;  4BBS J;  1BJZ A;  4QTR A;  4A3I J;  4XRS A;  2DA2 A;  1T33 A;  4IHW A;  1Y1V J;  1LFU P;  4M6V A;  1HOM A;  5J1Y A;  3JRI A;  3CMY A;  1NTC A;  3IV5 A;  1ZR4 A;  1IGN A;  2E2J J;  2DA7 A;  5IP6 A;  3C2B A;  4Y7N J;  5E3O A;  3HKZ N;  3BG5 A;  4D5C A;  2O9L A;  3RZO J;  4MLO A;  2X6O A;  2ECC A;  1X2M A;  2XPU A;  1HDP A;  2EZI A;  4FIS A;  1RET A;  4I6Z A;  5EZG A;  1OCT C;  1O4X A;  2M34 A;  2LR8 A;  2L7Z A;  4XK4 A;  1FTZ A;  5F0F A;  4DYQ A;  2VPR A;  4BBR J;  5EZH A;  1D5Y A;  3FK7 A;  1PUF A;  1FJL A;  2L9R A;  2JA7 J;  2CRG A;  4C3I J;  1H88 C;  4AUX A;  2EZH A;  3GTQ J;  3ZQL A;  2VI6 A;  2ZB9 A;  5FKN A;  2COB A;  4A3M J;  2HXO A;  1I50 J;  1TWC J;  4A93 J;  1ETO A;  1QVT A;  2TRT A;  1T56 A;  2E19 A;  2I10 A;  2KDZ A;  2M8G X;  2DMQ A;  4Y52 J;  2HYJ A;  1MBK A;  1QRY A;  3JRB A;  5EEA A;  4HNV A;  1E3O C;  1UHS A;  1AHD P;  2R93 J;  3HB9 A;  3TW6 A;  1UMQ A;  4UUT A;  2JK3 A;  1DU0 A;  1NK3 P;  2FQ4 A;  2DMP A;  2E2I J;  4W1U A;  1SAN A;  5IYC J;  2JMW A;  5FLM J;  1ZTR A;  2XSD C;  1JUS A;  2M9H A;  2M0C A;  4A3E J;  2Y30 A;  3ZOB A;  1QVU A;  2XB0 X;  3A01 B;  5J1U A;  2EH3 A;  3O8H A;  4IEJ A;  1XS9 A;  1IDZ A;  4V2F A;  4RDU A;  4X1E A;  3BR5 A;  2GBY A;  5BNG A;  4XRS G;  5GP9 A;  3S2H J;  1RPW A;  4C3J J;  1FIP A;  3UKG A;  4A3B J;  1MNM C;  3OOU A;  5IYB J;  1MBE A;  3NAR A;  2IAI A;  2R5Y A;  1B8I A;  2AHQ A;  4JX4 A;  4BKX A;  2X9D A;  4JX5 A;  3HBL A;  3Q0V A;  2GLO A;  1ITY A;  3JR9 A;  1P7I A;  3S1N J;  2FJ1 A;  5M5Y J;  1MBH A;  1NK2 P;  5EYR A;  3HOW J;  2LD5 A;  1ENH A;  2XGC A;  1U8B A; 
#chains in the Genus database with same CATH topology
 3ERM A;  4IHX A;  2E5N A;  3VSL A;  1MDM A;  1XG1 A;  1JTX A;  2M5W A;  2MG4 A;  1SMT A;  3O6B B;  4ENM A;  3HTU A;  1K79 A;  3FMS A;  3HGY A;  5KVR A;  1F43 A;  3KX2 A;  5LBQ A;  2MD0 A;  2D1H A;  3M07 A;  5CVR A;  2B63 J;  2ADU A;  2YPR A;  4HX8 A;  4KN4 X;  2QBY B;  4G6D A;  2OCC H;  1DP7 P;  1GUU A;  2JVH A;  3N4M A;  2L01 A;  4HSR A;  3J7Z I;  5L3D A;  2HPM A;  1S8N A;  1B72 A;  4KIC A;  3WU2 C;  1FSH A;  3GF2 A;  2EV6 A;  3ZQH A;  2VBX A;  3BT9 A;  4R1H A;  4LB6 B;  4PZJ A;  3NRV A;  4XRM A;  3JTG A;  2F4O B;  3ZP5 A;  1DDN A;  3MN2 A;  3BG7 A;  1NG6 A;  3A03 A;  4RGS A;  3Q0W A;  4D7N A;  4MGR A;  4HV6 A;  5J4Y A;  1W7P A;  2IS4 A;  1D0Y A;  2V6C A;  3HJE A;  3SZG A;  2VC1 A;  5BPI A;  1O3Q A;  2OZ6 A;  5HNF A;  3CJR B;  3FKJ A;  2EFQ A;  2ZJP F;  1XB4 A;  3NWS A;  5EG0 A;  1FP2 A;  4N9I A;  4I98 B;  3TO6 A;  1J5Y A;  2KJB A;  2GXB A;  3HG9 A;  4A6E A;  2HQ5 A;  2DTR A;  2E1M B;  3DP7 A;  1LE8 B;  1WI3 A;  3JSO A;  4Y4R A;  5IY5 H;  1S7E A;  4IF4 A;  5F08 A;  4D0P A;  2Z9O A;  1D0Z A;  1Y39 A;  2Y31 A;  1TC3 C;  4CA0 A;  3NQO A;  3S3M A;  1IUF A;  5IT9 K;  1R22 A;  2ECB A;  2DA3 A;  1J2X A;  2EZK A;  2XHK A;  3GFJ A;  3VEP A;  5J1R A;  1ZGW A;  5DEQ A;  2ZNZ A;  4H4K C;  1IRF A;  1YRN A;  4EJO A;  4M72 A;  2LYC A;  2EWN A;  5BQT A;  3DWL E;  5TGT A;  1FOX A;  2DOE A;  2GXG A;  1Z9C A;  1AWC A;  3E6D A;  3H0G J;  1YI2 I;  5K1Y A;  3DCF A;  1W5C C;  1BOB A;  1Z05 A;  1T98 A;  4Y3O A;  3LSR A;  5FLV A;  4G7O F;  5F27 A;  3RQI A;  3L2V A;  4XLH A;  1HLV A;  4XID A;  4FCY A;  2EIJ H;  1H89 C;  3RPU A;  4YFK F;  1JHF A;  3G2B A;  2IPQ X;  2MW8 A;  5KAI C;  4D1Q A;  1G59 A;  1GHC A;  3QPS A;  3F8F A;  2EA2 A;  2VC0 A;  3S32 A;  4D7M A;  1XCB A;  3E5Q A;  3F8B A;  2XGE A;  4AYB N;  2CU7 A;  5FB2 A;  4BHP A;  5D6F A;  1XMK A;  4ENK A;  1GT0 C;  1ODD A;  1A36 A;  3TDU C;  2ELH A;  4RAY A;  2NVX J;  1TNT A;  2R7W A;  1V5G A;  4AD9 A;  3ZMT A;  4CDG A;  4N0B A;  2L5Q A;  2KL4 A;  4RB3 C;  1BL0 A;  1VQP I;  1HW2 A;  4NB5 A;  1YTY A;  4UUV A;  1FEX A;  2XSJ C;  3SHF A;  2K40 A;  4Y17 A;  2R7X A;  1Z0X A;  3EPZ A;  2CUE A;  3IP4 B;  3V42 A;  4BXU A;  3BOQ A;  3V7C A;  1ULY A;  2LBF B;  2JA8 J;  4R8H A;  3V8K A;  4PJL A;  1OCO H;  1EH6 A;  3GEZ A;  4L5E A;  1GDT A;  2PJP A;  3KCC A;  2DMU A;  3OSG A;  2BYV E;  2LRE A;  1RUO A;  5E3L A;  3I55 I;  2HEO A;  4IHV A;  2E1M C;  4XKV A;  1J0R A;  5EDN A;  1TWF J;  2EIK H;  4GFB A;  2LKX A;  1S3J A;  1TP4 A;  2QM3 A;  4G7Z F;  1IW7 F;  2F5E A;  4M3B A;  3QPL A;  4Q47 A;  2ID6 A;  2NS7 A;  3LSJ A;  3MZY A;  5E8G A;  3TO7 A;  3WGI A;  3KYC B;  4QPO A;  4PFP A;  5ERI A;  2R7F A;  2OCE A;  4M3E A;  3OMY A;  1R1T A;  1T0F C;  3AG3 H;  1K61 A;  3BCA A;  3K2A A;  4ETS A;  3HTS B;  3A0B C;  3KEQ A;  5FFZ A;  1S6L A;  5M5X J;  2DYS H;  1TW2 A;  3CUQ A;  1IRX A;  3T1B A;  4W97 A;  5JVT A;  3B6C A;  5JLW A;  3JW4 A;  1CF7 A;  3S1R J;  4ZZL A;  1BN5 A;  2H8R A;  5EGO A;  2O61 A;  3CZ6 A;  1ZRF A;  4GDF A;  2LSO A;  2PQ8 A;  1W1W E;  3K4L A;  3BR0 A;  5HLG A;  4G7H F;  2HOS A;  2EJR A;  2BVM A;  3RKQ A;  1BR2 A;  3S14 J;  1FOW A;  3J80 Z;  5J3L A;  4GCV A;  1U0J A;  3KE2 A;  4XIC A;  1XN7 A;  3GTP J;  2MFZ A;  2DFE A;  3AFH A;  1G4D A;  3HPH A;  2LRD A;  2RVC A;  3B6A A;  4IHS A;  3K2Z A;  1G8X A;  5EF6 A;  5A2Q K;  5EJC A;  4CH7 A;  4BJ6 C;  1APL C;  3BZK A;  3K7A J;  2RDP A;  5DCM A;  3MEX A;  1SD6 A;  2EZL A;  2ISZ A;  2AQE A;  3JAM K;  2R7Z J;  5L3E A;  4X6A J;  4B4C A;  3WTZ A;  3C1D A;  4MO7 A;  2XAQ A;  3JRE A;  4E7L A;  4AU7 A;  1N77 A;  2KFD A;  5BPD A;  3JRF A;  2E5Z A;  3FM5 A;  2B0L A;  4ENN A;  3RYR A;  5ICG A;  5GPA A;  5LGN A;  5HLH A;  1JKP C;  4NNJ A;  5KK1 A;  4BYY A;  5B1B H;  1EV7 A;  3JAM Z;  1FBS A;  3M7G A;  5DD4 A;  5EG0 B;  4ZYE A;  1WJD A;  2FSW A;  3LQQ A;  1GV5 A;  2HVS A;  2NRA C;  3LA2 A;  2JSC A;  2OQG A;  4I0B A;  5DUI A;  2CQX A;  3ZMS A;  3AL0 B;  4X0G A;  1TNS A;  2DJN A;  2PG4 A;  2WAQ A;  2K4J A;  1KQ9 A;  5F6F A;  4ZC3 A;  5FD6 A;  4BY7 J;  3FBN B;  3CF5 F;  3RPQ A;  3T5X A;  2QF7 A;  1ON2 A;  2Y75 A;  2X1E A;  3BR6 A;  1M1E B;  2BW3 A;  2JZY A;  2PX9 A;  1S29 A;  2XAU A;  4HF0 A;  5HOD A;  1UB9 A;  3FK6 A;  3ESW B;  4WX9 A;  2H6C A;  2QBY A;  3HRS A;  1B1B A;  3DLL F;  1P6R A;  5GAG J;  3H9Q A;  2QSH X;  2OF7 A;  4FE4 A;  1IC8 A;  5CVI A;  4G9Y A;  4CCO A;  3ULQ B;  2LFB A;  2QYO A;  4L0Z B;  3CLQ A;  1WRJ A;  1CQT A;  2HOT A;  3KPH A;  3REO A;  4I09 A;  1WKM A;  1F4K A;  4IHT A;  1RKT A;  2ZJ2 A;  3I4M J;  3JRD A;  3G3Z A;  4GYG A;  1DU6 A;  1ZLJ A;  2KJC A;  3OIP A;  3TBI A;  1J7K A;  5J8F A;  2NVU B;  2ICW G;  2DT5 A;  3QQA A;  5TIS C;  3BJO A;  1FPQ A;  2KT0 A;  1IN4 A;  2L54 A;  3CCY A;  2D2W A;  3LSH A;  3IAS 2;  3S2W A;  1K78 B;  1VZ0 A;  1ZLK A;  2D5V A;  1VND A;  2BE5 F;  3BPX A;  2PJR B;  2PMH A;  2STW A;  1N78 A;  1IN7 A;  4A0Y A;  1IRZ A;  3V7R A;  3BR1 A;  4KYW A;  2R7Q A;  3SDG A;  2YU9 J;  1UHM A;  1ZHF A;  3P9I A;  1DPR A;  2H6B A;  4ESB A;  4IL6 C;  3PIO F;  1XMX A;  2NVT J;  2WAQ N;  1B59 A;  5FKM A;  4AVP A;  4BU2 A;  1E17 A;  5E1W A;  3TOB A;  3LA3 A;  4G94 A;  1SVM A;  1Z6T A;  3CCQ I;  1JHH A;  1LFB A;  2DK5 A;  1ETK A;  1SAU A;  1E2X A;  3I5U A;  4BDY A;  1TWH J;  3K70 D;  3GBG A;  5AON A;  4XOR A;  3BR3 A;  2K02 A;  2LVS A;  2M1B A;  3TL4 X;  4Q5S F;  2WA0 A;  4K2E A;  1TQI A;  4LLL A;  4ASN A;  2ZXJ A;  1BJZ A;  4BDZ A;  2V1D A;  3FWE A;  2DA2 A;  1T33 A;  4IHW A;  1VQ7 I;  3S3N A;  1LFU P;  4M6V A;  5J47 A;  1HOM A;  2KIS A;  3CC4 I;  5J1Y A;  4EAT A;  4O6J A;  1NTC A;  3JRI A;  1ZR4 A;  3F9K A;  2K5C A;  5IP6 A;  1N25 A;  4Y7N J;  1UST A;  2VQL A;  1MJA A;  3BG5 A;  3HKZ N;  3RZO J;  2ECC A;  2TDX A;  3HSE A;  4XNF A;  4OOI A;  1R71 A;  1D1B A;  4EJW A;  4I6Z A;  2CH0 A;  2DBB A;  2FOK A;  1ZAO A;  1FT9 A;  1F5T A;  1LDK B;  4LIV A;  2HU9 A;  5F0F A;  2VIX A;  3FK7 A;  4M73 A;  1SVO A;  3OR2 C;  3W6K B;  4BHB A;  2FE3 A;  3G4S I;  1QHG A;  2W85 A;  4I2O A;  2BY3 A;  3QYE A;  1EH8 A;  1P4X A;  5FKN A;  4RM2 A;  5LEJ A;  3LQR A;  2XRN A;  1D8K A;  1QVT A;  2TRT A;  1T56 A;  3KP5 A;  3Q9S A;  4YEL A;  4IX7 A;  2COM A;  2I10 A;  2Y0M A;  3FM3 A;  1PYV A;  2M8G X;  2KDZ A;  2GXA A;  2HVQ A;  2O0Y A;  1Y6I A;  4B43 A;  3K4K A;  4L9N A;  3JRB A;  3A4C A;  1V55 H;  3OIQ A;  3P7N A;  4DGW B;  1X3U A;  3CO7 C;  1UMQ A;  5IYB J;  3WOD F;  4HLX A;  2JK3 A;  4BS9 A;  3F22 A;  4E7I A;  3FMQ A;  4LFU A;  2JMW A;  2ESN A;  3I3L A;  3RPU D;  1XPX A;  2FML A;  2FOW A;  2DK8 A;  2XSD C;  1JUS A;  1RRJ A;  2M0C A;  1ZH5 A;  3ONQ A;  3H36 A;  1G3S A;  3ZMU A;  2ESH A;  1IO2 A;  1FWZ A;  1XTA A;  2VBW A;  5J1U A;  1XS9 A;  2CMP A;  4DIQ A;  2PMU A;  1X1P A;  3SEZ A;  4F92 B;  4FQG A;  5BNG A;  4MEX F;  2LKP A;  4PGH A;  4JOM A;  5GP9 A;  3FZV A;  3S2H J;  4RAZ A;  4C3J J;  1K4S A;  1GLN A;  4P9U A;  1UHW A;  2UZK A;  4J01 A;  3OOU A;  5HDG A;  3CD6 I;  1PVE A;  1X19 A;  1MBE A;  4RGX A;  3NAR A;  2VJI A;  3M8E A;  3KFW X;  2R4G A;  4AVZ A;  3KYD B;  3MAJ A;  2A69 F;  4NQW B;  4JX4 A;  4IKF A;  5E8I A;  1R23 A;  3KZY A;  4P1W A;  3GLL A;  1I1G A;  2GLO A;  1ITY A;  1LDJ A;  2DAO A;  3IRR A;  2QKM B;  2VT3 A;  1MBH A;  1KU7 A;  5EYR A;  1ENH A;  2F48 A;  4MHG A;  4LOC A;  4QPQ A;  1I27 A;  1SFK A;  2EB7 A;  4U0Y A;  1QA6 A;  3GZN B;  3D5L A;  3C7J A;  3CDL A;  1WH7 A;  2R3S A;  2KIM A;  2WAE A;  4B09 A;  3H1C A;  2PMZ N;  1ZRC A;  2KZV A;  3GFL A;  4XLA A;  5FKL A;  1FMW A;  3HOX J;  1FYL A;  2VUM J;  2ELJ A;  1LKX A;  2HYG D;  2FNP A;  2CFO A;  2BV6 A;  3JRA A;  1WFX A;  1RIO H;  5IT9 Z;  2W00 A;  1XSV A;  5B3S H;  1DQU A;  1WPK A;  4FET A;  2NAZ A;  3J7Y J;  4Q48 A;  3S17 J;  1KYW A;  4F3Q A;  2DN0 A;  4JYK A;  2VXD A;  2CUJ A;  1QNT A;  2UUZ A;  1LUJ B;  2KIQ A;  5EGO B;  1MBJ A;  1Z7L A;  1XX5 A;  4BUP A;  4XLP F;  4XLF A;  3L2Q A;  4OIR F;  1SMY F;  5AIP A;  3PM1 A;  5FGM A;  4L0Y B;  2HDW A;  2HOA A;  2V1X A;  4N9H A;  3WGH A;  4RAF A;  1HQC A;  1BIA A;  3K1M A;  2IW5 A;  4XLN F;  3VPR A;  2DMN A;  3FBI B;  1HF0 A;  2O3F A;  1BR1 A;  2NOJ B;  4XON A;  3WG9 A;  2B9S A;  5M3M J;  1T38 A;  3CLO A;  4U7D A;  1GXP A;  2DOA A;  1WH5 A;  2HXI A;  5LLQ A;  5JVG F;  1A6Q A;  2O7O A;  2HYF A;  3CJN A;  1UEL B;  3MVP A;  4YII A;  2W57 A;  4Q4Z F;  4HOB A;  5GAD J;  4WXH A;  1B6A A;  2OTJ I;  1VQK I;  1IN8 A;  3C2H A;  3RQ4 A;  2E2H J;  1R00 A;  1XDS A;  4BQO A;  3J80 K;  3GTL J;  3A1Y A;  1SFX A;  2Z5U A;  2VKD A;  2YX4 A;  2DQL A;  2M2E A;  3FXL A;  1HCR A;  3QP6 A;  3FX3 A;  4IVN A;  1STZ A;  3GW2 A;  4E7Z A;  5DD8 A;  1POG A;  2MSY A;  3TP0 A;  3OIO A;  3WGG A;  3I53 A;  4LG0 B;  1P2F A;  3R6S A;  2MBF A;  3G1M A;  2EK5 A;  4V19 K;  1RES A;  1Z1D A;  1VQ6 I;  2IGO A;  2V7F A;  5H20 A;  4NC8 A;  3E0J B;  4CGZ A;  1MH4 A;  4A2U A;  2CQN A;  3IC7 A;  4XKW A;  5D8K B;  3BLY A;  1X3W B;  3Q9V A;  9ANT A;  1NG7 A;  5GAE J;  1LVA A;  3MKW B;  4B44 A;  1MDM B;  5LGT A;  3OL3 A;  3WU0 A;  2VT2 A;  2X6Y A;  1REP C;  4JBA A;  5DYM A;  1WJF A;  1UG2 A;  4O5V A;  1QU3 A;  4EVI A;  4XQF A;  2P5K A;  3IHU A;  4IPA A;  2RV8 A;  2IGM A;  2MYS A;  3QRF F;  2XRO A;  1ZG5 A;  3QYF A;  2GOX B;  4C2M J;  2BXZ A;  4MIM A;  2V9K A;  2ISY A;  1V3F A;  2DW4 A;  1FSE A;  4TV7 A;  4IRH A;  3Q5F A;  2MD5 A;  2O03 A;  1U78 A;  3SJM A;  1KU3 A;  3FMR A;  2QEX I;  4BXX J;  4A3F J;  3K1P A;  1ZGA A;  3LNQ A;  4U7B A;  3G1O A;  4YEJ A;  1V5F A;  4EM1 A;  2DTZ A;  2CV0 A;  3I59 B;  3BTI A;  1S7A A;  3ZQF A;  1BBY A;  4S05 A;  2H1K A;  3CTA A;  1D1A A;  3L00 A;  1RZ4 A;  3W2V A;  1HC8 A;  3LSI A;  4DOZ A;  4EEF G;  3OYC A;  2L9N A;  1IN6 A;  3QOP A;  1R5I D;  3BY6 A;  2WB1 N;  5DM7 F;  5LHG A;  4B8X A;  1OYW A;  2V6E A;  3FF5 A;  1YJ9 I;  5F1R A;  4NQW A;  1IF1 A;  2R92 J;  1U6G A;  3H5N A;  2PJR A;  1EF4 A;  3DPU A;  1BR4 A;  2DFF A;  4I76 A;  2F5V A;  4G12 A;  2P81 A;  3D5S C;  3AG4 H;  4UUS B;  5DM6 F;  3IRQ A;  1JJ8 C;  1OMI A;  3SDB A;  3OYH A;  4UHT A;  2QA4 I;  5H6Q A;  4DZP A;  3FIW A;  1HBX G;  5J40 A;  1R58 A;  2LP0 A;  2ZO4 A;  3OWT A;  3CQZ J;  2LMD A;  2WV1 A;  4QWQ A;  2LTP A;  1B9N A;  2A68 F;  2D1V A;  4UVB A;  5E3N A;  4PCQ A;  2DMT A;  3MD2 A;  5FD5 A;  1YHQ I;  4IJA A;  2QSF X;  4PSW A;  1OR7 C;  3QOD A;  1MBG A;  4Y33 A;  2NXN B;  2X1C A;  1U9N A;  1G3T A;  4N4N B;  1ZAR A;  3W6J B;  3HC7 A;  4AM3 A;  2HGC A;  2QQ8 A;  5F0C A;  1FYM A;  2OQR A;  3FXU A;  2MLG A;  3L2W A;  2EFO A;  2PBI A;  3BDD A;  2F5D A;  2PMZ A;  1Y0U A;  3K4C A;  3VSK A;  1LE8 A;  4A5N A;  2JSP A;  1G6N A;  3S3O A;  1FTT A;  2LH9 A;  4AYB A;  3HGG A;  1TWG J;  2L4M A;  2CUF A;  4HNU A;  1ZRD A;  4GYI A;  3IH3 A;  4B48 A;  2GIZ A;  2LLK A;  3TKY A;  3DV8 A;  3DFG A;  1XGO A;  3HSR A;  2F2E A;  2JA5 J;  1J75 A;  5CQG A;  3KEY A;  1YIT I;  3BQZ A;  2UWM A;  4HX4 A;  4DQ2 A;  4LIU A;  2I8D A;  3OYN A;  2L0K A;  1TL8 A;  2ME0 A;  3KLO A;  4NUB A;  4KNY A;  4BQN A;  2K85 A;  1B72 B;  3BRO A;  3HSF A;  2JJ7 A;  1OPC A;  1ZK8 A;  4EM2 A;  4YFN F;  3I71 A;  4IQJ A;  1RI7 A;  3MKY B;  3LSK A;  5KAF C;  4XMY A;  2OJE D;  3S15 J;  3PNY A;  2P6T A;  4MNU A;  2AXT C;  2UXX A;  2XV4 S;  5K5O A;  1OCC H;  1WWX A;  2LK2 A;  4PDK A;  2R5Z B;  3SZP A;  2H1L A;  1ORK A;  1EH7 A;  3J7A O;  5CVJ A;  3JRG A;  1MJ9 A;  2A61 A;  3DEU A;  3F6V A;  3H5A A;  4M74 A;  2PLY A;  1YS6 A;  3JSP A;  3JRH A;  5IOZ A;  1HDD C;  1YJN I;  1Q1H A;  3ASO H;  1FC3 A;  4M9S A;  1VFC A;  3QYB A;  4A3C J;  2NYX A;  4LD5 A;  2M7A A;  4WXD A;  3ROU A;  2H09 A;  2CGP A;  2W7N A;  3DBR B;  5B5E C;  3PO3 J;  1LNW A;  3VOD A;  1BA5 A;  5HS7 A;  2JA6 J;  3F0C A;  3VYS B;  4WCG A;  1K83 J;  1X4P A;  2IRF G;  4P55 A;  1R4M B;  4RB2 C;  5LEK A;  4M71 A;  3BWG A;  4CYD A;  4S04 A;  4JK1 X;  1BC7 C;  1R5G A;  1ETX A;  2XGD A;  2QLZ A;  2ZBK A;  4ZYH A;  2JN6 A;  3S16 J;  5C4X J;  4RGU A;  5A2Q Z;  2HFH A;  1IXC A;  4BQQ A;  2LY1 A;  2ZXW H;  1KU9 A;  2HS5 A;  5F1J A;  3ASN H;  4KIF A;  4J00 A;  1I3Q J;  2P7V B;  2KLO A;  1OCP A;  2RRE A;  2BXY A;  1U5T B;  1KZH A;  3VB2 A;  1VQO I;  2CV2 A;  5CQE A;  1IN5 A;  1Z7U A;  3VYU B;  2KRF A;  5D5V B;  2IS2 A;  4PUS A;  3P9K A;  3AKZ A;  3GZ6 A;  4KMF A;  1UG0 A;  4BGD A;  1Z91 A;  4QTR A;  1O57 A;  4A3I J;  4CZZ A;  4WWC A;  2A3S A;  1IGN A;  3CMY A;  2E2J J;  2BBY A;  5E3O A;  3HOT A;  4M9Z A;  3FDY A;  4XN3 A;  4D5C A;  4MLO A;  1USS A;  1YW8 A;  2HPI A;  2FBI A;  1HDP A;  3SYT A;  2EZI A;  1TBX A;  2F6C A;  2CFX A;  4FIS A;  3CCM I;  2W1O A;  3M1C A;  2DO7 A;  2M87 A;  2LR8 A;  4XOT A;  2HVR A;  1FTZ A;  3LA7 A;  4BBR J;  2DOF A;  5EZH A;  1FJL A;  1BI2 A;  2L9R A;  3D0S A;  1QQI A;  2CRG A;  1H88 C;  2VON A;  4CXF A;  4E7S A;  3ZQL A;  1L0O C;  4UB6 C;  3OS0 A;  3I56 I;  3ABL H;  3GUD A;  2HQA A;  1G3Y A;  3BZC A;  1I6X A;  1OR7 A;  3EUK L;  4QLC U;  1X1B A;  1I50 J;  5ICC A;  2VQC A;  3V8J A;  3SFZ A;  3H5R A;  4MQV A;  1I39 A;  2HWV A;  3R0A A;  1YO5 C;  2JRM A;  3DXJ F;  2W25 A;  1QZY A;  4LIT A;  3I59 A;  1O3R A;  2LNB A;  2CSO A;  4XKC A;  5JHF A;  4E70 A;  1AHD P;  5BMZ A;  2R93 J;  1XGM A;  2JTV A;  1DU0 A;  1D5V A;  2FQ4 A;  1R4N B;  1WJC A;  1V4R A;  5BS6 A;  4W1U A;  3ABK H;  3E1S A;  3FXO A;  3O3K A;  4IZZ A;  3AAF A;  2OTL I;  2JVG A;  4RB1 A;  1IAW A;  3X2Q H;  4EJT A;  3KZZ A;  4L9J A;  5FO5 A;  5J4V A;  5L3C A;  2FEZ A;  1TQP A;  3ZOB A;  2E60 A;  4EJV A;  2KKO A;  2XB0 X;  3ECO A;  1KON A;  3O8H A;  3C2G A;  4IEJ A;  5HNH A;  4BE0 A;  3ZPL A;  4I02 A;  2QKL B;  3CO6 C;  1PDN C;  3OYJ A;  1ZRE A;  4X1E A;  4H0E A;  1MMN A;  2Z3Y A;  4ZYD A;  4XRS G;  4XRF A;  5D6E A;  3OYA A;  3DPT A;  3RKY A;  2IS6 A;  3EQL F;  1FIP A;  2QZ8 A;  4A3B J;  4ZDP A;  3IL2 A;  2GWR A;  2DI3 A;  5HOO A;  2JPB A;  2IAI A;  3HL2 A;  1W7P D;  1WQ2 A;  5H2F C;  4HX7 A;  4JX5 A;  4II2 A;  3Q0V A;  2GOM A;  3IAM 2;  2OAZ A;  4UNO A;  5M5Y J;  4FX0 A;  2ZSI B;  3RCO A;  1NK2 P;  2HZT A;  3HOW J;  4Z6Y A;  4OMY A;  2O8X A;  3ZMV A;  3IWF A;  3KP4 A;  2RQP A;  1DGR M;  1LEA A;  4IRG A;  1X3Z B;  4FHT A;  1K4T A;  3CUQ C;  2HZD A;  5LRS A;  4XR6 A;  1QPI A;  3K0L A;  1SAX A;  5D8L B;  5AIQ A;  1DUX C;  1WJE A;  3EDP A;  3FXK A;  1QGP A;  2BGC A;  3RZD J;  2Y0S A;  2K86 A;  3HKZ A;  4M3F A;  1H9T A;  3ZQ7 A;  2Y0S N;  2CJJ A;  2CO5 A;  4HEA 2;  2XKP A;  3O8G A;  4XLE A;  3ZR8 X;  3PQK A;  1S9H A;  1VI0 A;  3H92 A;  2MA3 A;  4XOP A;  4BAC A;  4NHJ A;  3PUF A;  1BW6 A;  1W7P B;  1MIJ A;  2X51 A;  2STT A;  3EUH C;  4EGY A;  4AIK A;  3RDI A;  1GVJ A;  4MFD A;  1TWA J;  2Q2E A;  4BE2 A;  4BEH A;  4O3M A;  4AID A;  4A0X A;  1R1U A;  4A3K J;  5DV5 A;  2G9W A;  2VAS A;  2AO9 A;  3ZGK A;  1QO0 D;  4CUG A;  2V1U A;  3GTM J;  3BP8 A;  4LG0 A;  2XDV A;  4F93 B;  3L2R A;  3LAJ A;  3HOZ J;  2LC2 A;  2AXL A;  4GO1 A;  2L7K A;  2QVO A;  1GV2 A;  1MW7 A;  2M7B A;  1R7J A;  1YS7 A;  2R5Z A;  3OOP A;  3OYK A;  1V5E A;  4HPQ A;  1WSU A;  1RKW A;  2O8K A;  1W36 C;  3S2D J;  4C2U A;  2FF4 A;  3LSP A;  1HA8 A;  2LBF A;  3JRC A;  5FRN A;  1FMV A;  1K6O A;  3LFU A;  3OYG A;  2NOG A;  2CV1 A;  1JT6 A;  5FRM A;  1ETW A;  1BI0 A;  3L7W A;  4P5O A;  2WWY A;  4A3L J;  1XGN A;  2MC3 A;  3DQV C;  3E6B A;  2HKO A;  3MMY B;  4KFC A;  2IEK A;  2H27 A;  1IG7 A;  3J81 Z;  4HA8 A;  1TZL A;  4GRI A;  2XF6 A;  2FMY A;  4EGZ A;  1RR7 A;  2DXI A;  1Z77 A;  1BOA A;  2Q8K A;  2CQQ A;  2FUG 2;  2OU2 A;  4JX6 A;  1RNL A;  2DA1 A;  4CSW A;  1OJL A;  5LHH A;  2EFP A;  1IJW C;  3K4B A;  5J8C A;  1YRN B;  2VJ4 A;  2Y48 A;  1LFP A;  3I54 A;  3DLA A;  3ZMD A;  2NVQ J;  3LSG A;  4L9V A;  5FFX A;  3DKX A;  3FXJ A;  3JTH A;  2ZXH A;  2HDC A;  1LB2 A;  4CCN A;  2KDO A;  3MKZ A;  1XC5 A;  5DUK A;  3G73 A;  2LG4 A;  3NWT A;  2PN6 A;  5KNL A;  3DTK A;  3F8M A;  4PSX A;  1X1A A;  3RTR A;  4DZJ A;  4CZC A;  3J7A Y;  5D5W B;  3ABU A;  2X4H A;  2QCO A;  5F64 A;  1QBJ A;  3PSI A;  3H35 A;  4N4O B;  4DJA A;  2GZW A;  3ZQQ A;  3TP3 A;  1VF9 A;  4XM3 A;  3CP8 A;  5LRR A;  3GX4 X;  2VE8 A;  2EIM H;  2XRL A;  3W2A A;  4OIO F;  5ICE A;  3QAH A;  4G8X A;  2IS1 A;  3HYI A;  4HNT A;  3A2K A;  4MQ9 F;  5CKT A;  4YFX F;  3OYB A;  4A0Z A;  3GFM A;  4UB8 C;  1PJR A;  2MH2 A;  5C3E J;  2E7W A;  4PJN A;  4DBR A;  1I6H J;  1D3Y A;  4C2T A;  1RC9 A;  1F1Z A;  1UZC A;  2JA2 A;  1LEB A;  5D5U B;  5D4R A;  4E6K G;  2R5Y B;  3GME A;  3F3X A;  5GTI C;  1W4M A;  5HLI A;  1JJ6 C;  2VOO A;  2XUB A;  2RNJ A;  1RUN A;  4RA2 A;  3BC8 A;  4CIC A;  1T2K A;  5C4J J;  3Q0U A;  2XPW A;  2OZU A;  4F7Z A;  2NS0 A;  3ZMZ A;  2VQH A;  4G6Q A;  1IXS B;  2DA6 A;  4LLG F;  1ETQ A;  1VTN C;  1G2H A;  2R7R A;  1FYK A;  3F8N A;  4UUS A;  4EM0 B;  1VQ5 I;  2BY0 A;  3ZXS A;  1HW5 A;  2FQ3 A;  2XAS A;  2VOP A;  2VXZ A;  4XN0 A;  4I01 A;  1AKH A;  2B7E A;  2EA4 A;  1A04 A;  2VBY A;  3ZQI A;  3K70 C;  3I58 A;  2Q1Z B;  3CMM A;  3W6V A;  1ON1 A;  5CPR B;  2XF5 A;  3CCJ I;  2IJL A;  5DDG A;  3M4O J;  5EEG A;  1F36 A;  2DA4 A;  1ETY A;  3MWM A;  2K27 A;  1MH3 A;  4U0W A;  1O3T A;  3PNV A;  1H0M A;  4HG2 A;  3LL7 A;  5TRD A;  4HYE A;  1U2W A;  3GZ5 A;  2ZFW A;  4IHY A;  2BY1 A;  2HR3 A;  3JCU C;  4D9J A;  2FX0 A;  4KN7 X;  1TT5 B;  4HAM A;  4KT5 C;  5L3B A;  3WU1 B;  2XGX A;  4LG3 A;  1R36 A;  3PFI A;  5IP7 J;  3TED A;  5EEH A;  1YX5 A;  4IOC F;  3DKW A;  5B66 C;  4MFE A;  4HF2 A;  2Y69 H;  4E7K A;  4S0H B;  4QIW N;  3ZQC A;  3V8L A;  2WB1 A;  2AS5 F;  5HS8 A;  1MMD A;  2Y9Z A;  1R1V A;  3F23 A;  2ID3 A;  4LMY A;  2YSR A;  3G71 I;  1A5J A;  1FBQ A;  4UVC A;  1G3W A;  5FJ8 J;  3NEU A;  1P9Q C;  3DPL C;  3E7L A;  2L7F P;  2Y2Z A;  2FRH A;  3ISP A;  3GTK J;  5E20 A;  2X6X A;  1LJ9 A;  3QP5 A;  5CYV A;  1ZG3 A;  1B9M A;  6PAX A;  2IP2 A;  1OLT A;  3BCB A;  5HVQ C;  3B73 A;  4P96 A;  4AC0 A;  2Q0O A;  2H94 A;  4OMZ A;  5K7Z A;  1C0W A;  4OAY A;  4YIR X;  1WCM J;  3GXO A;  3K69 A;  1K6Y A;  4OAZ A;  3U2R A;  1MSF C;  2R7V A;  3CME I;  4Z2Y A;  4RMN A;  1X4O A;  4PGG A;  1TLH B;  2HQR A;  2UXN A;  1FX7 A;  4R79 A;  4PK4 A;  2V4J C;  2Q2E B;  3C18 A;  3A0H C;  3HOV J;  3G6E I;  3R60 A;  2DPD A;  5FLX K;  1U5T C;  3BG3 A;  3LAP A;  3RJP A;  1T39 A;  2GA1 A;  2EIL H;  5JR3 A;  2JPC A;  3R4K A;  4A69 C;  1X1D A;  3DEW A;  4A3J J;  3WHC A;  2XF7 A;  5GPC A;  1FIA A;  4KA4 A;  3AG1 H;  2E1C A;  3ZN1 A;  3LST A;  2E34 A;  2M45 A;  2XKO A;  1O7F A;  1IV6 A;  1BI3 A;  1T0F A;  2KRC A;  2L7M P;  2LY2 A;  1JGG A;  2K4B A;  4D5F A;  5ILV A;  2HQN A;  3O2P E;  1WJA A;  2VBZ A;  1XD7 A;  5FRO A;  2ZKZ A;  4OU0 A;  4BHC A;  4EV0 A;  4ZH4 F;  3HOS A;  3DU6 A;  5IOY A;  4IO9 F;  3IWZ A;  5IP9 J;  2LDU A;  3PL8 A;  1W0T A;  3OL4 A;  3TDZ C;  3RI4 A;  2W48 A;  4CCM A;  5HLT A;  2PI0 A;  1JUP A;  1RR8 C;  2MLK A;  1Z3Y A;  3SFI A;  1EA3 A;  3QPH A;  5LGU A;  3MZ8 A;  5HS9 A;  2ACJ A;  4FE7 A;  1A6I A;  2CS3 A;  4OIP F;  3ABT A;  1U8R A;  2XIG A;  1YFH A;  5CVV A;  3S1Q J;  2R7D A;  2YX7 A;  4KIB A;  2QQA A;  5B1A H;  4LB5 A;  3HHG A;  1FOY A;  2MH9 A;  3GCM A;  3BTL A;  4ABZ A;  4CO8 A;  1SD7 A;  1J09 A;  5K7H A;  1D8J A;  4FTH A;  2E7X A;  3GYH X;  2V1N A;  2E35 A;  1FY7 A;  1TQM A;  3BZ6 A;  3UR3 C;  5LHI A;  3L9F A;  1AOY A;  2ZJR F;  3HDD A;  2MGQ A;  3OYD A;  2M8E A;  3QU3 A;  5KCM A;  4E4H A;  5E3M A;  5M3F J;  5E79 C;  4BBS J;  2UV1 A;  3F21 A;  1HKQ A;  2O6G E;  4XRS A;  3M8F A;  3DKY A;  4F52 A;  3KP2 A;  3GLX A;  1VQL I;  2RKH A;  3C2B A;  2A07 F;  3VYR B;  2X6O A;  1S5L C;  2FNA A;  4RLF A;  2XPU A;  2ZFU A;  1YW9 A;  1RET A;  5EZG A;  1ZG1 A;  3K6G A;  1YX3 A;  2X85 A;  1O4X A;  1CGP A;  2L9S A;  2V26 A;  3HRT A;  5E1Z B;  4XK4 A;  4BJ5 C;  4DYQ A;  1CF7 B;  2VOD A;  2GAU A;  2IGK A;  4A5M A;  1D5Y A;  1NHA A;  1HSJ A;  2XVC A;  1ERD A;  3L2U A;  2PFB A;  2QGU A;  1YIJ I;  2JA7 J;  1KQ0 A;  3E5X A;  5BOX A;  1Z21 A;  1YYV A;  2CQ7 A;  4AUX A;  4C3I J;  1FBU A;  2COB A;  3TMO A;  1LPQ A;  2HXO A;  2JQ7 A;  4IXA A;  3WTU C;  4A93 J;  3E5U A;  4LJZ F;  3KYL A;  2I5U A;  1ETO A;  2P7C B;  4L5I A;  2E19 A;  3V4G A;  1ACI A;  3KP6 A;  1N75 A;  4HW0 A;  4WXC A;  4BH9 A;  4UV8 A;  4Y52 J;  2HYJ A;  1MBK A;  5EEA A;  2L2O A;  1Y56 A;  3LSM A;  4HNV A;  1E3O C;  5CVU A;  3TW6 A;  1T6S A;  4I7H A;  2K9L A;  2JT1 A;  4XSX F;  4HRI A;  2DMP A;  5GTH C;  2E2I J;  2J5P A;  5JI6 A;  5FLM J;  4XL9 A;  1ZTR A;  5K5R A;  2NNN A;  2EPF A;  1X1C A;  4NBQ A;  4XBF A;  3DTE A;  4A3E J;  1U5T A;  3EET A;  1QVU A;  2EV0 A;  1LVK A;  4CCL A;  2IA2 A;  2EH3 A;  4Y15 A;  2LF8 A;  4C30 A;  1IDZ A;  1YQA A;  5TJJ A;  1K7A A;  2NNY A;  2CQK A;  3IKT A;  4BJT A;  2F5F A;  3BR5 A;  3FXQ A;  4HBL A;  2ZSH B;  3OYI A;  4Y13 A;  4IRI A;  1JXS A;  1RPW A;  2A6E F;  2GIV A;  2EIN H;  3WTT C;  3S93 A;  1I3A A;  3H9J A;  2VLA A;  4IQ4 A;  4U88 A;  2KMU A;  1QZE A;  1YOV B;  3GVA A;  3AG2 H;  3ABM H;  3DBH B;  2OC6 A;  1AA7 A;  1XSX A;  3OR1 C;  4HLY A;  1WI9 A;  2HTJ A;  1B8I A;  3E97 A;  5L3G A;  2AHQ A;  4HZF A;  4ESF A;  2VPL A;  3QOE A;  3ERE D;  4GXO A;  3HBL A;  3HRU A;  1U3E M;  5ED4 A;  1P7I A;  3S1N J;  2OV7 A;  1V54 H;  3RSN A;  4RB0 A;  2XGC A;  3VDX A;  3OV8 A;  3R0J A;  5GAH J;  2BY2 A;  3KET A;  1U8B A;  2DU9 A;  4RGR A;  3M1E A;  1DGW Y;  2W82 A;  1D0X A;  2RN7 A;  3F8C A;  5IPA A;  3ECH A;  5KHD A;  1EKE A;  2P6S A;  3CC7 I;  3H0D A;  1HXD A;  3CCE I;  1W5T A;  2IBD A;  1SC7 A;  3WE2 A;  4OWR B;  2A5W A;  3NAU A;  1VQN I;  2DA5 A;  1GVD A;  3H9G A;  2P5V A;  3A02 A;  2RGV A;  4IOA F;  2M4G A;  2DT6 A;  3VYT B;  3ZN0 A;  1JI8 A;  2J5O A;  3BQY A;  1SD5 A;  1U9O A;  5CLS A;  2C6Y A;  1OIS A;  4EQQ A;  1Z3X A;  4A6D A;  1XDU A;  4A3G J;  2W24 A;  3PFY A;  3DTI A;  4V2G A;  1W0U A;  1WJ5 A;  3OY9 A;  2QQ9 A;  2V9V A;  3AL0 C;  4M6X A;  2QQB A;  4U0V A;  1MSE C;  3M3Y J;  1ZKG A;  3KEO A;  2VN2 A;  4F91 B;  3M8J A;  4KUM A;  2V79 A;  2BHZ A;  3DF8 A;  2HKX A;  3VOE A;  2IA1 A;  5HDN A;  4RBO A;  3OSF A;  1HST A;  4AWX B;  2F5C A;  5L3F A;  3OYE A;  4KIS A;  2R7S A;  4RM3 A;  2DT7 B;  3SZT A;  4FT8 A;  2A6H F;  3LFK A;  1KQ8 A;  4M9X A;  3HOU J;  3S1M J;  2HI3 A;  2MAB A;  3WHB A;  2EBI A;  1DPU A;  2IGN A;  5C44 J;  5E17 F;  2Z33 A;  2G7H A;  1JKR C;  4MEY F;  2E1O A;  2DLL A;  1KA8 A;  4A3D J;  4ZZD A;  3Q3S A;  2XAG A;  3OYM A;  1WVR A;  1A31 A;  4GGG A;  3SQN A;  3TW7 A;  2NVY J;  2BEO A;  4CYC A;  2E1N A;  2EQR A;  2LKS A;  1BW5 A;  4ZYA A;  3COA C;  1R9T J;  1BJA A;  2WBM A;  2DDB A;  2CW7 A;  2KIF A;  3ELK A;  3MQ0 A;  4HF1 A;  1T08 B;  5IYD J;  5LD2 C;  1PUE E;  4PJM A;  4DYR A;  2OBP A;  4HDU A;  3FIS A;  3HZJ A;  2Z2S B;  3FXR A;  3EUA A;  2WY8 Q;  3U1K A;  1FOK A;  3D5R C;  2OD5 A;  2CWE A;  4ENJ A;  1I5Z A;  2KZG A;  1SD4 A;  2IVM A;  2OPT A;  2BZT A;  1HW1 A;  3J81 K;  2H8W A;  1J59 A;  2RNG A;  4B1R A;  2KQR A;  1E3P A;  3HIF A;  1SFO J;  2JUC A;  4WF2 A;  2HDD A;  3CDH A;  3CMA I;  5JFR A;  2DOD A;  3IKV A;  1JKO C;  2YUS A;  1WZ2 A;  1OCR H;  4RLQ A;  1ETV A;  4ZDL A;  3CP2 A;  4CYC B;  4M6Y A;  1AKH B;  1X58 A;  3VFZ A;  1Y1W J;  1W5S A;  2X6W A;  3DEE A;  3DU5 A;  2DFI A;  2MC4 A;  2VKH A;  3A01 A;  3OS2 A;  2F4M B;  4CHU A;  3G1L A;  1PUF B;  1K78 A;  4UVA A;  1PP8 F;  5JLX A;  1ZQ3 P;  1XMA A;  1ZYR F;  3B02 A;  1BC8 C;  4ZDO A;  3RYP A;  2JRT A;  2R0Q C;  1FLI A;  5F04 A;  5K5Q A;  4YG2 F;  1O3S A;  1IUY A;  1B8I B;  3IH2 A;  1VQ8 I;  4L9T A;  2ZJQ F;  2CYY A;  2ETH A;  2KHM A;  2WAD A;  4A12 A;  4XSZ F;  2W84 A;  2DCE A;  3H3U A;  2K7L A;  3OYL A;  2DDA A;  2X48 A;  1I1S A;  1Z67 A;  1WHU A;  2EFW A;  4XKB A;  5FKK A;  3CF2 A;  1FNN A;  3T8R A;  3FKI J;  2M3A A;  4B3X A;  1MJB A;  1H8A C;  2V9P A;  3W2W A;  2ZME A;  3CUQ B;  5J6X A;  1YJW I;  4WK8 F;  1JUM A;  4HV5 A;  1MZB A;  3CUO A;  1H9G A;  1FP1 D;  2A5Y B;  2FU4 A;  2LOO A;  3M9A A;  5F0H A;  1OQY A;  4PJ0 C;  3RIR A;  1UJ8 A;  2FD5 A;  2BW3 B;  1JT0 A;  1F9N A;  4NDL A;  3KP7 A;  1VQ9 I;  2K9S A;  1UFM A;  4G6T B;  4M3D A;  3FHN A;  3U21 A;  4ZTJ A;  2XB5 A;  3MCZ A;  1QHH D;  2VJJ A;  4BEH B;  2L02 A;  2FA5 A;  3U9G A;  3QU6 A;  2X1D A;  4RAG A;  4C3H J;  3WTX C;  4KMU X;  4OIN F;  4ZTF A;  1J9I A;  3KIO A;  4HST A;  1XCV A;  3WTW C;  3GTJ J;  4YIF A;  4FAS D;  5HDK A;  1PP7 U;  3FHZ A;  5FLX Z;  4J19 A;  1T95 A;  1IZ1 A;  3LMM A;  5DCM B;  2GM4 A;  2FBK A;  2K3P A;  2L4A A;  4I0A A;  3HXL A;  3I0T A;  3MZH A;  3CCL I;  2ZC2 A;  2ELK A;  1T8I A;  1P7J A;  2JWT A;  1MMS A;  2HNH A;  2JUG A;  4EJU A;  2CUZ A;  2VL8 A;  4LGW A;  3BPV A;  2HTS A;  4DW6 A;  3LOC A;  2IT0 A;  2VE9 A;  3HEF A;  1Q1V A;  5K7F A;  1Y8R B;  2LY9 A;  3BJ6 A;  1DP3 A;  2VKE A;  3L09 A;  4AIJ A;  2XAJ A;  4NC6 A;  1JTY A;  1Y0N A;  2N8G A;  3S8P A;  2ME6 A;  4DYC A;  1YG2 A;  1P92 A;  1BIB A;  3GTO J;  2EV5 A;  3T0Y A;  1O7L A;  4HQM A;  1S7O A;  2NS8 A;  1GXQ A;  2KP6 A;  3GTG J;  2E36 A;  5CJ9 A;  4KT6 A;  5FKO A;  3MKL A;  3K4J A;  1LDD A;  2K9Q A;  3QPT A;  1YLF A;  5E1X A;  3HHH A;  1WGX A;  3H3Z A;  1LQ1 A;  4UV9 A;  1JKQ C;  4B3A A;  4ON0 A;  4BY1 J;  1HKT A;  4ZYG A;  4AIH A;  3ZQG A;  2P8T A;  1L3L A;  2IXS A;  2TCT A;  2M0M A;  2XAF A;  1AU7 A;  1OKR A;  1MKM A;  4ANJ A;  4DNC A;  2CW8 A;  2P4W A;  1JE8 A;  1FZP B;  2L9V A;  3TGN A;  3BR2 A;  4BE1 A;  1ZR2 A;  1IDY A;  1HKS A;  1MD0 A;  3CJT B;  2Z99 A;  3CES A;  3D1N I;  1MMA A;  2D45 A;  3PO2 J;  5D5X B;  3MFK A;  4KDP A;  2G0E A;  5M5W J;  2QSG X;  3FXM A;  1UCR A;  2R7O A;  3PIP F;  1B4A A;  3N05 A;  1NH3 A;  2WY7 Q;  1ZN2 A;  1WJB A;  1R49 A;  2VKV A;  2ZME B;  4P9F A;  3R61 A;  2YS9 A;  4ITV A;  4E7J A;  2XC7 A;  4LK0 F;  1BM9 A;  2CG4 A;  1TTY A;  3N97 A;  4FX4 A;  1E0E A;  2RAE A;  1MBF A;  1X2N A;  3GO5 A;  3IUO A;  5DS9 A;  5DTD A;  1OFC X;  4YRV A;  2DYR H;  1XGS A;  3I4P A;  3PQJ A;  2PEX A;  1YW7 A;  1SVL A;  3BTC A;  3SXY A;  3H3V K;  3EYI A;  2M4K A;  5D4S A;  5ILU A;  4KIG A;  4QSH A;  3VWB A;  1Y8Q B;  3F6O A;  4JP0 A;  4BL0 B;  5ICF A;  3SEQ A;  1VQ4 I;  2ZNY A;  1Z6R A;  2CW0 F;  3K4M A;  3HOY J;  2DJI A;  2P5L C;  3V7S A;  2XPV A;  5DCF A;  3BG9 A;  2BOL A;  2F4I A;  5H6R A;  3CCV I;  2IA0 A;  3IH4 A;  4OIQ F;  1UAA A;  2KRH A;  4HQE A;  3I64 A;  4UY8 I;  2BVL A;  1ZGJ A;  2A05 A;  2KIU A;  2Z1D A;  3GFI A;  2K9N A;  3BJA A;  4M3G A;  4DBQ A;  2HOE A;  3BTJ A;  4B47 A;  2AQF A;  1EJ9 A;  2A6T A;  3L1P A;  2OUM A;  3DBL B;  2VB6 A;  2EFN A;  2Y9Y A;  2K9M A;  3HM5 A;  2E71 A;  1OYI A;  1YIO A;  3K4N A;  2M30 A;  2OA4 A;  2QEN A;  2LF7 A;  2XAH A;  4LK1 F;  3TOA A;  1VQM I;  3I4N J;  1SEU A;  4BQA A;  2YU3 A;  1P4A A;  2GQQ A;  2ZXI A;  4BAY A;  3OS1 A;  1Y1V J;  3HUG B;  3QWL A;  3CDI A;  3U1D A;  3F72 A;  2FBH A;  3TO9 A;  3IV5 A;  1S72 I;  2DA7 A;  3CJQ B;  3E3V A;  2L3D A;  3OYF A;  2O9L A;  1X2M A;  2YR2 A;  3W3C A;  1TT0 A;  2O5R A;  1YE9 A;  1MNE A;  1OCT C;  2M34 A;  3BG6 A;  2L7Z A;  4CCK A;  2VPR A;  4I99 C;  3CCS I;  4E7H A;  1PUF A;  2RQQ A;  4KJZ A;  2QUF A;  4PFO A;  1R5H A;  3RKX A;  1W36 D;  3C3W A;  2DPU A;  4BNC A;  2WTE A;  3E6C C;  3CC2 I;  1OCZ H;  1JGS A;  2EZH A;  3GTQ J;  3CCR I;  1MGT A;  1IV8 A;  3KZI C;  4LLN A;  2VI6 A;  2ZCW A;  2ZB9 A;  3K1N A;  3CCU I;  4A3M J;  2WC2 A;  1TWC J;  3PSF A;  4EMS A;  1OYY A;  1KGS A;  4HDV A;  1SFU A;  2RC4 A;  1MND A;  3WTY C;  2DMQ A;  3HRM A;  1QRY A;  2P0W A;  4UXN A;  1QZZ A;  4PJJ A;  2R7T A;  3LWF A;  3HPG A;  4II3 A;  1UHS A;  4BXF A;  4ESJ A;  2WAF A;  3HB9 A;  2DQR A;  4NC7 A;  1TW3 A;  4UUT A;  3WTV C;  1NK3 P;  1IRG A;  3E6M A;  1ZEL A;  1SAN A;  2VJ5 A;  1R6R A;  3KP3 A;  5IYC J;  3L2C A;  4JQF A;  2M9H A;  3WE3 A;  3T8T A;  2X0L A;  3UNG C;  4KIT B;  3EYY A;  2G7U A;  2Y30 A;  4CCJ A;  3A01 B;  4C9Y A;  1IXR C;  2W4S A;  4V2F A;  3WG7 H;  3P5J A;  1KU2 A;  2GA2 A;  3KLN A;  3ZCO A;  4RDU A;  4L18 B;  2R7U A;  2ZME C;  2DFH A;  1XSD A;  1KYZ A;  2GBY A;  4XLC A;  4MTE A;  4U87 A;  3K10 A;  5IT3 A;  3RKW A;  1SFE A;  3UKG A;  2Z16 A;  3K9T A;  1MNM C;  3P9C A;  3WTS C;  3HUG A;  1E3H A;  1QPM A;  2FXA A;  4ZJZ A;  2QWW A;  1ONV A;  2KPM A;  4RS8 A;  2R5Y A;  2WV0 A;  1A35 A;  3I9V 2;  5LFA A;  3TQN A;  4BKX A;  3PJR A;  2X9D A;  5JHU A;  4F55 A;  2BHY A;  3EUH A;  3PNT A;  2K3F A;  1P4W A;  2VQG A;  3JR9 A;  3ML6 A;  5E18 F;  4L5J A;  1MMG A;  2FJ1 A;  3PUB A;  1D1C A;  5ILS A;  4MTD A;  3GWZ A;  2LD5 A;  1BI1 A;  3ZRG A; 
#chains in the Genus database with same CATH homology
 4LOC A;  4IHX A;  5IPA A;  3CDL A;  1WH7 A;  1XG1 A;  1QPI A;  1JTX A;  2MG4 A;  2IBD A;  2PMZ N;  5FKL A;  3HGY A;  3NAU A;  3RZD J;  3HOX J;  1F43 A;  2DA5 A;  1GVD A;  2VUM J;  3A02 A;  4M3F A;  2B63 J;  2Y0S N;  2CJJ A;  3JRA A;  3O8G A;  1GUU A;  1VI0 A;  3BQY A;  1U9O A;  1B72 A;  1BW6 A;  1WPK A;  4A3G J;  3ZQH A;  3BT9 A;  3S17 J;  4V2G A;  1W0U A;  2DN0 A;  4MFD A;  1TWA J;  4XRM A;  4JYK A;  5EGO B;  1MBJ A;  1MSE C;  3MN2 A;  4A3K J;  3M3Y J;  1ZKG A;  3A03 A;  3Q0W A;  4D7N A;  2AO9 A;  3PM1 A;  3GTM J;  3OSF A;  4RBO A;  2HOA A;  3HOZ J;  1GV2 A;  2R5Z A;  5EG0 A;  1RKW A;  2O8K A;  3HOU J;  3S1M J;  3S2D J;  2HI3 A;  3VPR A;  2DMN A;  3WHB A;  1HF0 A;  3LSP A;  2EBI A;  3JRC A;  5M3M J;  2HQ5 A;  5C44 J;  2NOG A;  1JT6 A;  1LE8 B;  1WI3 A;  1JKR C;  1ETW A;  1WH5 A;  2E1O A;  2HXI A;  1S7E A;  5F08 A;  4A3L J;  4A3D J;  2Y31 A;  3Q3S A;  2O7O A;  1TC3 C;  1IUF A;  3MVP A;  2ECB A;  2DA3 A;  2EZK A;  5J1R A;  2IEK A;  3TW7 A;  2NVY J;  1ZGW A;  4CYC A;  2EQR A;  1IG7 A;  1BW5 A;  1R9T J;  2E2H J;  1YRN A;  1RR7 A;  5IYD J;  3GTL J;  1Z77 A;  4DYR A;  3H0G J;  2M2E A;  2CQQ A;  3DCF A;  3FIS A;  5FLV A;  3LSR A;  4JX6 A;  5F27 A;  3RQI A;  1HCR A;  2DA1 A;  1OJL A;  1HLV A;  1IJW C;  4XID A;  1YRN B;  4FCY A;  1POG A;  2MSY A;  3TP0 A;  1H89 C;  2OPT A;  3OIO A;  2NVQ J;  3LSG A;  2MW8 A;  4B1R A;  3QPS A;  3G1M A;  1SFO J;  1XC5 A;  4D7M A;  1RES A;  2HDD A;  4AYB N;  2XGE A;  2CU7 A;  4DZJ A;  1GT0 C;  1JKO C;  2YUS A;  1MH4 A;  2QCO A;  1ETV A;  2NVX J;  9ANT A;  3TP3 A;  1VF9 A;  4CYC B;  1AKH B;  1X58 A;  1Y1W J;  1BL0 A;  3A01 A;  2XRL A;  1FEX A;  1UG2 A;  2K40 A;  3G1L A;  1PUF B;  1Z0X A;  2CUE A;  2JA8 J;  5JLX A;  1ZQ3 P;  4C2M J;  5C3E J;  4MIM A;  4L5E A;  2R0Q C;  1I6H J;  5F04 A;  1GDT A;  1U78 A;  2DMU A;  3SJM A;  3OSG A;  2R5Y B;  1B8I B;  4BXX J;  3IH2 A;  5E3L A;  4A3F J;  1JJ6 C;  4IHV A;  3LNQ A;  3G1O A;  5EDN A;  1TWF J;  2DTZ A;  3ZQF A;  3BTI A;  3Q0U A;  2X48 A;  5C4J J;  2XPW A;  2H1K A;  4GFB A;  2LKX A;  5FKK A;  2DA6 A;  4EEF G;  1ETQ A;  1G2H A;  3FKI J;  1H8A C;  2WB1 N;  4M3B A;  4UUS A;  3QPL A;  2ID6 A;  2NS7 A;  3LSJ A;  1JUM A;  2R92 J;  5F0H A;  4M3E A;  1EF4 A;  1K61 A;  1AKH A;  3K2A A;  2FD5 A;  4I76 A;  3ZQI A;  1JT0 A;  5M5X J;  4G12 A;  4NDL A;  2P81 A;  4UUS B;  3W6V A;  2K9S A;  4W97 A;  3B6C A;  4M3D A;  5JLW A;  3M4O J;  3S1R J;  1F36 A;  2DA4 A;  2XB5 A;  1ETY A;  1JJ8 C;  2H8R A;  5EGO A;  1MH3 A;  3BR0 A;  4DZP A;  2HOS A;  3FIW A;  3RKQ A;  2LP0 A;  4C3H J;  3S14 J;  3CQZ J;  2WV1 A;  5J3L A;  4IHY A;  3GTJ J;  4XIC A;  3GTP J;  2FX0 A;  2LTP A;  4J19 A;  2GM4 A;  5E3N A;  2DMT A;  3B6A A;  5IP7 J;  5EF6 A;  2ELK A;  1P7J A;  1APL C;  2JWT A;  3TED A;  3K7A J;  4MFE A;  1MBG A;  4DW6 A;  2EZL A;  4S0H B;  1U9N A;  3LOC A;  4QIW N;  3ZQC A;  2R7Z J;  4X6A J;  5F0C A;  4B4C A;  2Y9Z A;  3HEF A;  1Q1V A;  5K7F A;  2LY9 A;  4MO7 A;  2ID3 A;  1A5J A;  3JRE A;  2VKE A;  5FJ8 J;  3JRF A;  1JTY A;  3E7L A;  2L7F P;  2Y2Z A;  3GTK J;  2N8G A;  1LE8 A;  5GPA A;  2ME6 A;  4DYC A;  1JKP C;  3GTO J;  4AC0 A;  1FTT A;  3HGG A;  1TWG J;  2NS8 A;  2CUF A;  5K7Z A;  5EG0 B;  1WCM J;  1GV5 A;  3IH3 A;  2LLK A;  1MSF C;  3GTG J;  5FKO A;  2CQX A;  3MKL A;  2JA5 J;  2K9Q A;  2DJN A;  1WGX A;  1JKQ C;  3BQZ A;  4BY7 J;  3HOV J;  4B3A A;  3BG3 A;  2QF7 A;  2L0K A;  4BY1 J;  2ME0 A;  3BR6 A;  3ZQG A;  1B72 B;  2JJ7 A;  2TCT A;  1ZK8 A;  4A69 C;  5HOD A;  3DEW A;  1AU7 A;  3FK6 A;  4A3J J;  3WHC A;  5GPC A;  3BR2 A;  1FIA A;  1ZR2 A;  1IDY A;  3S15 J;  3D1N I;  2OF7 A;  4FE4 A;  1IV6 A;  1IC8 A;  3PO2 J;  2L7M P;  2LK2 A;  2R5Z B;  2G0E A;  5M5W J;  1JGG A;  2LFB A;  4D5F A;  1ORK A;  1CQT A;  2HOT A;  3JRG A;  1RKT A;  5IOY A;  5IP9 J;  3I4M J;  2VKV A;  1W0T A;  3JRD A;  1DU6 A;  2YS9 A;  2W48 A;  3JRH A;  5IOZ A;  1HDD C;  1JUP A;  3QQA A;  2RAE A;  1VFC A;  1MBF A;  1X2N A;  2KT0 A;  3SFI A;  4A3C J;  5DS9 A;  5DTD A;  1OFC X;  3CCY A;  3BTC A;  1VND A;  2D5V A;  3H3V K;  3PO3 J;  4FE7 A;  1A6I A;  4QSH A;  1BA5 A;  2JA6 J;  3F0C A;  4JP0 A;  1K83 J;  1IRZ A;  3S1Q J;  3HOY J;  3BR1 A;  3SDG A;  2XPV A;  2YU9 J;  3BG9 A;  1ETX A;  2XGD A;  2JN6 A;  4ABZ A;  3BTL A;  3S16 J;  5C4X J;  2NVT J;  2WAQ N;  3IH4 A;  5FKM A;  5F1J A;  2K9N A;  4M3G A;  5K7H A;  3BTJ A;  1I3Q J;  1LFB A;  1OCP A;  3L1P A;  1ETK A;  4FTH A;  1TWH J;  2Y9Y A;  3GBG A;  3HM5 A;  3BR3 A;  2LVS A;  3HDD A;  2MGQ A;  3I4N J;  5E3M A;  5M3F J;  4BBS J;  1BJZ A;  4QTR A;  4A3I J;  4XRS A;  2DA2 A;  1T33 A;  4IHW A;  1Y1V J;  1LFU P;  4M6V A;  1HOM A;  5J1Y A;  3JRI A;  3CMY A;  1NTC A;  3IV5 A;  1ZR4 A;  1IGN A;  2E2J J;  2DA7 A;  5IP6 A;  3C2B A;  4Y7N J;  5E3O A;  3HKZ N;  3BG5 A;  4D5C A;  2O9L A;  3RZO J;  4MLO A;  2X6O A;  2ECC A;  1X2M A;  2XPU A;  1HDP A;  2EZI A;  4FIS A;  1RET A;  4I6Z A;  5EZG A;  1OCT C;  1O4X A;  2M34 A;  2LR8 A;  2L7Z A;  4XK4 A;  1FTZ A;  5F0F A;  4DYQ A;  2VPR A;  4BBR J;  5EZH A;  1D5Y A;  3FK7 A;  1PUF A;  1FJL A;  2L9R A;  2JA7 J;  2CRG A;  4C3I J;  1H88 C;  4AUX A;  2EZH A;  3GTQ J;  3ZQL A;  2VI6 A;  2ZB9 A;  5FKN A;  2COB A;  4A3M J;  2HXO A;  1I50 J;  1TWC J;  4A93 J;  1ETO A;  1QVT A;  2TRT A;  1T56 A;  2E19 A;  2I10 A;  2KDZ A;  2M8G X;  2DMQ A;  4Y52 J;  2HYJ A;  1MBK A;  1QRY A;  3JRB A;  5EEA A;  4HNV A;  1E3O C;  1UHS A;  1AHD P;  2R93 J;  3HB9 A;  3TW6 A;  1UMQ A;  4UUT A;  2JK3 A;  1DU0 A;  1NK3 P;  2FQ4 A;  2DMP A;  2E2I J;  4W1U A;  1SAN A;  5IYC J;  2JMW A;  5FLM J;  1ZTR A;  2XSD C;  1JUS A;  2M9H A;  2M0C A;  4A3E J;  2Y30 A;  3ZOB A;  1QVU A;  2XB0 X;  3A01 B;  5J1U A;  2EH3 A;  3O8H A;  4IEJ A;  1XS9 A;  1IDZ A;  4V2F A;  4RDU A;  4X1E A;  3BR5 A;  2GBY A;  5BNG A;  4XRS G;  5GP9 A;  3S2H J;  1RPW A;  4C3J J;  1FIP A;  3UKG A;  4A3B J;  1MNM C;  3OOU A;  5IYB J;  1MBE A;  3NAR A;  2IAI A;  2R5Y A;  1B8I A;  2AHQ A;  4JX4 A;  4BKX A;  2X9D A;  4JX5 A;  3HBL A;  3Q0V A;  2GLO A;  1ITY A;  3JR9 A;  1P7I A;  3S1N J;  2FJ1 A;  5M5Y J;  1MBH A;  1NK2 P;  5EYR A;  3HOW J;  2LD5 A;  1ENH A;  2XGC A;  1U8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...