1QRYA

Homeobox protein vnd (ventral nervous system defective protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
GSHMSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLTSLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HOMEOBOX VENTRAL NERVOUS SYSTEM DEFECTIVE PROTEIN)
publication title Distortion of the three-dimensional structure of the vnd/NK-2 homeodomain bound to DNA induced by an embryonically lethal A35T point mutation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 11
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qryA00
4JX5A 2R92J 3RKQA 2NVTJ 1MSEC 1JKRC 4V2GA 2X48A 5IP7J 5EG0A 2LD5A 1TWHJ 5E3OA 2W48A 2ECBA 2NVQJ 3HOZJ 1F43A 1JKOC 4HNVA 2ID6A 3CDLA 2LKXA 1B72B 4A3DJ 3BTLA 1ZGWA 1XG1A 1ETWA 5HODA 1GVDA 4QIWN 2JA8J 1X2MA 1MH4A 2M34A 5IPAA 5E3NA 3S1MJ 3IV5A 3BG9A 1K61A 3S1QJ 3RZDJ 4XRSA 4XK4A 3G1OA 3HOXJ 4I6ZA 1XC5A 4LOCA 3HOYJ 2DMPA 1IJWC 1HDPA 3LSGA 4RDUA 3D1NI 1JKPC 5F0CA 5JLWA 5J1UA 2HOSA 3S2HJ 3BTCA 1JUSA 1DU0A 2R0QC 5FKKA 4BKXA 1BL0A 3BR5A 1A6IA 3S1RJ 2KDZA 2CQXA 2R93J 1GV5A 3BTIA 3PM1A 3HOVJ 3HKZN 1TWGJ 3WHBA 1S7EA 1WI3A 3NAUA 4BXXJ 3O8HA 1UHSA 1VI0A 4C2MJ 1LFBA 3TW7A 2LFBA 2HDDA 5FLMJ 5FLVA 5EYRA 3GTOJ 1GV2A 2DA1A 2Y9ZA 2JMWA 2HYJA 4M3BA 4XIDA 3OSGA 2HOTA 2MGQA 1IDYA 1ETVA 5JLXA 4MLOA 1GT0C 3DEWA 5IOZA 2O7OA 3TW6A 2LVSA 2VUMJ 1Y1WJ 1FTTA 2R5YA 1I3QJ 1SANA 4M3EA 1APLC 1RPWA 1U9NA 5IP9J 1JT0A 3Q0UA 4S0HB 2QF7A 5GPAA 4FTHA 3JRAA 1JJ6C 2R7ZJ 1IDZA 3WHCA 3Q0VA 3Q3SA 4JX6A 4M3DA 1AU7A 2M0CA 5EGOB 5F04A 4BY1J 1RETA 1K83J 2XSDC 3LSRA 3BQYA 4G12A 1MBFA 1U9OA 3FKIJ 4IHYA 4IEJA 2Y9YA 9ANTA 3JR9A 5K7ZA 2EZKA 2KT0A 2TRTA 5IYBJ 1DU6A 3A01A 1P7JA 2OF7A 5M5WJ 1U78A 4D5FA 2VKEA 2CJJA 2IEKA 2WB1N 4FISA 4FE4A 4A69C 3M3YJ 5E3LA 3BG3A 4AYBN 1JUMA 3MVPA 1BA5A 2GLOA 4FCYA 3JRHA 4DYQA 4IHWA 3MN2A 1RKWA 4B4CA 2LR8A 3GTGJ 3GTMJ 4JX4A 5K7FA 3UKGA 1T56A 2PMZN 2VI6A 3LSJA 3TP0A 2LK2A 1MBKA 5DTDA 1YRNA 4AC0A 1B72A 1P7IA 5M5XJ 4FE7A 1T33A 2CUEA 2CQQA 1PUFB 3O8GA 1VFCA 4CYCA 3HOUJ 2JWTA 2I10A 3FK7A 2ID3A 4QSHA 2HXIA 3ZQGA 2DMUA 2Y2ZA 2P81A 1G2HA 1ETKA 3S16J 5EG0B 3LSPA 1BJZA 4D7MA 1RR7A 4X1EA 2LP0A 3OOUA 3Q0WA 4I76A 4D5CA 4A3BJ 3I4MJ 4EEFG 2E2JJ 1FIPA 2CU7A 5E3MA 2NVXJ 1JUPA 3QPSA 1B8IA 5J3LA 2DA6A 1CQTA 2NOGA 3HDDA 3JRGA 3JRIA 3OIOA 3B6CA 3ZQCA 1FIAA 1LE8A 4A3CJ 1MH3A 1UG2A 1TWCJ 3FISA 4DZPA 4XRMA 5C44J 2DMNA 4M3FA 3S17J 4W1UA 4C3JJ 2JA6J 2X9DA 4B3AA 5FKMA 2EZIA 1OJLA 4A93J 5C4JJ 3K2AA 2NVYJ 2EH3A 1IUFA 3HB9A 2DTZA 2N8GA 2VPRA 3TP3A 2G0EA 2MG4A 2DA4A 4MIMA 3BR6A 3BG5A 1IV6A 2E2HJ 2M9HA 1X2NA 3JRDA 1BW6A 4D7NA 2XGEA 4IHVA 2Y31A 5IYCJ 1JTYA 2QCOA 1OFCX 1IRZA 3BQZA 1A5JA 2EBIA 5FKLA 3PO3J 3S15J 1WH5A 1AKHA 2FJ1A 1D5YA 4X6AJ 2H8RA 2OPTA 2R5ZA 2O8KA 1FTZA 2ME6A 1TWFJ 4DW6A 3F0CA 2D5VA 1W0UA 2R5YB 1BW5A 2ME0A 3BT9A 4JP0A 4C3HJ 5IYDJ 5M5YJ 4RBOA 1NK3P 2EZLA 3QQAA 2E1OA 2K9NA 2YS9A 3M4OJ 2AO9A 2L9RA 4A3JJ 3HGYA 5GP9A 5M3MJ 4M3GA 1OCTC 2XB0X 1ETQA 2XGCA 1LFUP 2K9SA 1F36A 1I6HJ 3BTJA 4MFDA 4A3KJ 3BR0A 5J1YA 4UUSA 2DA7A 3S14J 3OSFA 5GPCA 2HQ5A 2DMTA 2LTPA 3G1LA 1IG7A 1GDTA 4AUXA 1JJ8C 4J19A 1QVTA 2WV1A 5C3EJ 1ETOA 1AHDP 1EF4A 1Z0XA 3A01B 1HDDC 3CQZJ 1QPIA 1MBEA 3ZQHA 3W6VA 1ITYA 2IAIA 5F27A 3H0GJ 5C4XJ 1FJLA 1H89C 1ORKA 2K40A 4DYRA 1ZKGA 2NS7A 1UMQA 1I50J 3B6AA 5J1RA 3QPLA 2JJ7A 1ZR4A 2XB5A 1VF9A 3S1NJ 5DS9A 4A3GJ 4GFBA 4M6VA 5EF6A 1QVUA 3ZOBA 2M8GX 1JKQC 4A3FJ 3JREA 3A02A 4ABZA 5EDNA 1MNMC 1MBHA 2DA5A 1YRNB 3VPRA 3RQIA 1IGNA 4UUTA 4XRSG 2EZHA 3GTPJ 2MSYA 1RKTA 3DCFA 1MSFC 4BY7J 4CYCB 5F0FA 2NS8A 3S2DJ 5IOYA 1W0TA 1H88C 1TWAJ 1VNDA 2HOAA 1HCRA 3FIWA 5K7HA 3IH4A 5F1JA 1Z77A 3GTKJ 3JRFA 2YU9J 2L7ZA 3SFIA 2L0KA 2XRLA 4BBRJ 3SDGA 2JK3A 3RZOJ 2Y30A 1O4XA 2M2EA 5BNGA 1WPKA 2JA7J 2DA3A 3TEDA 5FKNA 4NDLA 3JRCA 3HGGA 1TC3C 2L7MP 3HEFA 1NK2P 3IH3A 3G1MA 2Y0SN 3HBLA 2GM4A 3BR2A 1B8IB 1OCPA 4A3LJ 3LNQA 4A3EJ 1GUUA 4B1RA 1ENHA 1MBGA 3K7AJ 2DMQA 3L1PA 3GTQJ 5IP6A 1FEXA 4IHXA 3SJMA 1LE8B 3HOWJ 1XS9A 3LOCA 3ZQIA 2WAQN 3HM5A 2LY9A 1ZK8A 2K9QA 1JT6A 4JYKA 1H8AC 4BBSJ 3BR3A 2EQRA 3ZQLA 3GBGA 3MKLA 1RESA 2H1KA 1ETXA 5M3FJ 3PO2J 3I4NJ 1NTCA 1POGA 3JRBA 5EGOA 2B63J 1WH7A 4A3IJ 1ETYA 2DA2A 2FD5A 1JTXA 3CCYA 3ZQFA 2GBYA 2FX0A 3E7LA 4C3IJ 3IH2A 4A3MJ 2XPUA 2COBA 2X6OA 2DN0A 5FJ8J 1WGXA 1ZR2A 4MFEA 1WCMJ 1AKHB 2ZB9A 2L7FP 2TCTA 5EEAA 3C2BA 2LLKA 4V2FA 3FK6A 4DYCA 3NARA 2JA5J 1HF0A 2XPWA 2R5ZB 5EZGA 2FQ4A 2YUSA 2IBDA 1HOMA 2VKVA 4MO7A 1R9TJ 2HI3A 5F0HA 2E2IJ 2HXOA 3BR1A 2MW8A 3A03A 1IC8A 1U8BA 5F08A 2ELKA 3GTJJ 4W97A 4XICA 4DZJA 2AHQA 2RAEA 2XGDA 2XPVA 3GTLJ 1Y1VJ 5FKOA 3CMYA 2JN6A 4L5EA 1ZQ3P 4Y52J 1SFOJ 1E3OC 2ECCA 5EZHA 1Q1VA 1X58A 2E19A 2CRGA 1PUFA 2DJNA 2CUFA 4UUSB 1HLVA 3H3VK 4Y7NJ 2O9LA 1ZTRA 1JGGA 1MBJA 1QRYA 4QTRA
chains in the Genus database with same CATH superfamily
2OZ6A 1I27A 3RKQA 2L4AA 1TQMA 5IP7J 1TWHJ 4EJTA 3KYDB 2W4SA 3GLLA 2NVQJ 3KEYA 3CCQI 1JKOC 1F9NA 2ID6A 3QYFA 3CTAA 1I3AA 2A68F 3BTLA 5F1RA 2VOOA 1YIJI 1ETWA 1UELB 2JVGA 1R4MB 4RM2A 4CZZA 3J80Z 2M34A 2CUZA 1FY7A 3S1MJ 3IV5A 5GAHJ 2COMA 5CQEA 1OLTA 2WTEA 4XK4A 3TDUC 2PMHA 3E0JB 2DMPA 3FXUA 1HDPA 1WWXA 4X0GA 3D1NI 1JKPC 1W5SA 2VE9A 5J1UA 3S2HJ 2L2OA 4I0AA 3TMOA 2IVMA 2BVMA 5E1XA 1TNSA 1ZHFA 2K3PA 1DU0A 5FKKA 1Y6IA 4RS8A 1QPMA 4BKXA 3BR5A 3PFYA 1DGWY 2Q2EA 3S1RJ 1S7OA 4RGXA 3PM1A 5DEQA 4F7ZA 2LREA 3I64A 3VEPA 2IJLA 4BXXJ 2FQ3A 4EGYA 1T0FC 1B6AA 3WG7H 1OQYA 1P4WA 1IRFA 5EYRA 4HLXA 2GZWA 3S32A 4ETSA 2L3DA 3A0BC 3RYPA 3ELKA 2DDAA 2HYJA 1AA7A 3K4MA 4C2TA 2MGQA 2VBWA 4HRIA 1IDYA 2DOEA 4R1HA 3FDYA 1FSHA 4YEJA 1MW7A 4YFNF 4CCNA 5IOZA 2F48A 1H0MA 2IS1A 4UVAA 3F8FA 4DNCA 1FT9A 2KIFA 1GXPA 4YRVA 2K27A 4M3EA 3RI4A 1APLC 2XAQA 4KIFA 4ZYEA 4RLQA 3F8BA 2DODA 3RKXA 3D0SA 4HV6A 1R1VA 2JPBA 2I8DA 2K4JA 3EDPA 1JJ6C 2DFIA 5D5UB 2UZKA 3GLXA 3Q0VA 3K70C 3Q3SA 5FFZA 4B3XA 5JI6A 3FXQA 2M0CA 5HLIA 5EGOB 1RETA 4J00A 4M74A 3OS1A 3K6GA 3FHZA 3BQYA 1WHUA 4A5MA 3G4SI 3OL3A 1Z6TA 1XSVA 3FKIJ 3L00A 1LVKA 4IEJA 4FT8A 5JFRA 3PIOF 2JSPA 4A12A 2KLOA 3LA7A 1W36C 2E60A 2PMUA 1N78A 3KFWX 4HDVA 3PQKA 2EZKA 2JRMA 2TRTA 5DYMA 3P9CA 4XBFA 2KRCA 3BC8A 1ODDA 3DQVC 5M5WJ 4I2OA 3KZZA 1VQPI 2CJJA 2FXAA 3NEUA 5D4SA 2CUJA 5DUIA 2H27A 2BY0A 1NG6A 2NAZA 4BE1A 3QPTA 2KZGA 5HNHA 4G6QA 3MVPA 1OCOH 2XC7A 2MA3A 1D8KA 3CJQB 3Q5FA 3EUHA 1BA5A 4M6XA 2XAFA 3MN2A 1F1ZA 3BJ6A 1RKWA 1MJAA 1LUJB 3KX2A 3K4NA 1WKMA 1ZGJA 4IQJA 4IOAF 5J47A 4JX4A 2A6EF 3E5QA 5LHGA 3LSJA 1DPRA 4E7LA 1F5TA 2DLLA 2QKMB 2FE3A 4NC6A 2RDPA 5B3SH 3K4BA 4FE7A 2L01A 1GLNA 2A61A 1VFCA 4BQNA 5B1AH 1IN6A 4JOMA 2VKDA 3RKYA 4CYCA 3IWZA 2JZYA 3MZHA 5A2QK 3FK7A 3CO6C 2ID3A 1EH8A 3O2PE 3KIOA 3W2WA 2IS6A 4LB5A 2WC2A 4BE2A 3OOPA 2DMUA 3DLLF 3GFMA 4WX9A 1X1BA 4ENNA 5HLGA 1BJZA 4CICA 2OC6A 2LP0A 3I4MJ 1LDDA 5LBQA 1FP2A 3GFJA 1FIPA 3EPZA 4AYBA 1SFUA 4HOBA 3HXLA 1N25A 2VC1A 3AFHA 2AS5F 1M1EB 4XONA 1ZG3A 3JRGA 3I71A 2STWA 4IZZA 4OIRF 4WXDA 5FD6A 2HQRA 3B6CA 4I7HA 2IGKA 2PMZA 4A3CJ 1UG2A 1TWCJ 3PQJA 4DZPA 2LY1A 2HVRA 2VJJA 4OIPF 2DMNA 4IPAA 2ESNA 2X9DA 2GIVA 4XKBA 3EUKL 5FROA 4BHPA 3NRVA 2FF4A 3K2AA 3U9GA 1SC7A 2EH3A 4KICA 1IUFA 2N8GA 2G0EA 2MG4A 2Q2EB 4MIMA 2XF6A 2GXGA 2R7TA 3WTUC 2X6YA 2WWYA 4DBRA 4CCKA 4G6DA 5TJJA 3BG6A 2QCOA 2IT0A 4XKCA 3D5RC 1Q1HA 3OYEA 3BQZA 1B9MA 4ZDPA 2QLZA 2EBIA 1HSTA 3LAJA 4L0ZB 1W1WE 1D5YA 2FJ1A 5IT3A 1D1AA 4DOZA 3SEQA 1L0OC 2ZXJA 2R5ZA 3PSFA 2O8KA 3T1BA 4E4HA 5FB2A 1K78A 3TO7A 2OCEA 2DW4A 1FTZA 2WBMA 1USSA 1R5HA 3G73A 2P5KA 1EH6A 1WJCA 2D5VA 1W0UA 2XUBA 4FASD 3J80K 4OIQF 1BW5A 2GWRA 2ME0A 3BT9A 1MJ9A 4NBQA 2CG4A 3QOEA 5M5YJ 1L3LA 1KA8A 2FBHA 3ZMVA 1J9IA 3L2QA 5CVIA 2OV7A 3ECHA 2XASA 4EQQA 1YX5A 5JVGF 1Y39A 4IJAA 3M4OJ 4G7OF 3AL0B 2HYGD 2XGCA 4BEHA 3K4CA 2IP2A 4E7KA 1F36A 3F3XA 3FF5A 1E2XA 1G8XA 5J1YA 1Z3YA 1STZA 2MH9A 4HF1A 4ZZDA 1YQAA 2KHMA 1IG7A 4YIIA 2A05A 1GDTA 4AUXA 4ZJZA 2D1VA 1D3YA 3QU6A 3W3CA 5ILVA 5D5WB 1A36A 1TT5B 5DCMA 3WU1B 2I5UA 1SD6A 2WADA 4MGRA 4HDUA 1DPUA 1EF4A 1HXDA 4LG3A 1XDUA 2G7UA 4PJJA 3REOA 1ZRDA 5DM7F 4PFPA 1DDNA 2UV1A 3W6VA 1W7PB 2IAIA 3H0GJ 2MD0A 2OZUA 5C4XJ 3WE2A 4OOIA 3WTTC 1ORKA 2K40A 2VASA 1ZKGA 2P6TA 2NS7A 1UMQA 3J7AY 1VQNI 2MD5A 3LQQA 1FX7A 2BYVE 2JJ7A 5H20A 2XB5A 1FOKA 3S1NJ 1W5TA 3A1YA 5EF6A 2M8GX 5FLXZ 4HNUA 3LSIA 1MNMC 3RSNA 1Y8QB 2LY2A 3DU6A 1YLFA 3CZ6A 4WF2A 2LBFA 4ZYGA 2EWNA 4L9JA 4AVZA 1MSFC 4BACA 3L09A 5LHIA 1HA8A 2JTVA 4I09A 2M5WA 1TNTA 4CYCB 5F0FA 2NNNA 1IN7A 3S2DJ 4K2EA 3C18A 1VNDA 1UFMA 4LMYA 4DBQA 3E6CC 3DPLC 3FXRA 4IHSA 1BM9A 4IOCF 3GTKJ 4AWXB 2YU9J 2M7BA 2OA4A 1FBQA 4BBRJ 3SDGA 3F23A 2JK3A 1O4XA 3AL0C 5JHFA 3BPVA 5BNGA 1WPKA 3ASOH 4FX0A 1YOVB 2GOMA 1TC3C 3EUAA 1G3WA 4CO8A 4CXFA 3HEFA 4O5VA 4JBAA 1SD7A 2CWEA 1U5TA 4A3EJ 2KIMA 2LH9A 2XHKA 1PVEA 2DPUA 1ENHA 1G4DA 3CJTB 4EJUA 3OWTA 2KJBA 4OMYA 1O57A 4HX7A 1J7KA 2GA1A 3KEOA 3O6BB 3FXOA 2XAHA 5DDGA 4Q47A 2LY9A 1IRGA 2XAGA 3QRFF 4MQVA 3MEXA 1RESA 3PSIA 1ETXA 3PO2J 1HW2A 4IRHA 2RKHA 2O03A 3S3OA 4M73A 1KU7A 1WFXA 4XQFA 1JTXA 3ZQFA 3CCRI 2GBYA 4OMZA 3HSRA 4RMNA 3E6DA 4C3IJ 4OWRB 1B1BA 2ADUA 2Q1ZB 1V5GA 1XSXA 2EV0A 2X6OA 2NS0A 1QNTA 3BLYA 4HYEA 2JRTA 4UUVA 3WGIA 1P4AA 1SVOA 1V5FA 1WCMJ 3OR2C 4CZCA 1J75A 2L7FP 4P96A 1FLIA 3DKWA 4Y4RA 3FK6A 3CO7C 3NARA 4JK1X 1HF0A 2XPWA 2R5ZB 2PI0A 4RAZA 1K78B 5EJCA 2ACJA 3ABKH 1K4TA 4WWCA 4MO7A 1VQ9I 3PL8A 2E2IJ 2CQ7A 3HPGA 2ISZA 2MW8A 3WG9A 2QSHX 2AQEA 1U8BA 1VQ4I 5F08A 1S5LC 1FSEA 2ELKA 4W97A 5L3DA 2HVSA 2XPVA 2X1DA 1IXSB 2ZNZA 5FKOA 2JN6A 1ULYA 1BIAA 2C6YA 4Y52J 4D0PA 2LNBA 4B8XA 1DQUA 4MQ9F 4BEHB 5HDKA 2XV4S 5ICGA 3E6MA 4O6JA 5B1BH 2CRGA 2H8WA 1PUFA 3D5SC 2CQNA 3HSEA 2DJNA 1Z21A 3I4PA 1SVLA 3EETA 3L7WA 3JTGA 2E7WA 2QUFA 3FM3A 5DD8A 1DGRM 1IO2A 2F4OB 4M9XA 1ZTRA 2MC3A 2QA4I 1MBJA 1QRYA 5DCMB 3JAMK 4JX5A 2R92J 2BY1A 2F5CA 2OBPA 3VOEA 2BHZA 1MSEC 3M1CA 5E8GA 2DYSH 5EG0A 2UXXA 4AVPA 2LD5A 2GOXB 2L54A 3V8LA 3HOZJ 1F43A 3SZGA 3KZYA 1O3QA 3UNGC 4HNVA 4ZH4F 3CDLA 3G71I 1B72B 1R6RA 3HRMA 1FYKA 2A69F 1ZGWA 5HODA 1KONA 4ENMA 4LIVA 1P9QC 2WAEA 3H9GA 3FX3A 4B09A 2VBXA 3ZMZA 4P1WA 5IPAA 2CYYA 5HOOA 1TZLA 3DBHB 4WK8F 1J0RA 1VQOI 1EH7A 1W5CC 4XLAA 2KL4A 3RZDJ 1Z05A 3K9TA 3Q9VA 4XN0A 4XRSA 3OYJA 5HS7A 4OINF 3HOYJ 1IJWC 2LBFB 3FBNB 4RDUA 1UHMA 3OYMA 3MCZA 4EM2A 1USTA 3AG3H 3ABLH 1JHHA 1X4OA 1KZHA 2VIXA 1S29A 4B47A 3ZQ7A 1A6IA 1K4SA 2RNGA 1GV5A 3BTIA 3HOVJ 3GUDA 1RUOA 1TWGJ 1BIBA 1S7EA 3JCUC 1SFEA 1LFBA 1UAAA 2LFBA 2QKLB 4BE0A 2HDDA 4AIDA 4XKWA 5FLMJ 5FLVA 4CCMA 1RR8C 3R6SA 1XB4A 1TT0A 5LRRA 2PJRA 2JMWA 2FEZA 1RI7A 4M3BA 3RYRA 3KETA 1BJAA 5JLXA 3LL7A 2O61A 3CUQB 2QM3A 1T8IA 3DPUA 2EV5A 2QYOA 2O7OA 3HPHA 1YYVA 1MDMB 1BI0A 3K4KA 2HZTA 4PJMA 2VUMJ 2A5WA 2VLAA 2QSGX 1FTTA 5KNLA 5D5XB 3LFKA 4BNCA 3IWFA 2R7FA 1K6YA 4HQMA 3H36A 3GFIA 6PAXA 3TDZC 2ZMEA 2K02A 4BHBA 1JT0A 4M6YA 1MMGA 3ZP5A 2QF7A 1O7LA 3CESA 3ZR8X 4FTHA 2W82A 4GRIA 1I39A 2HVQA 2Y0SA 5FLXK 4KJZA 4RLFA 3WHCA 3VB2A 2V26A 2BXYA 1YW7A 3LSMA 2VQHA 3OIPA 2JSCA 3N4MA 3HKZA 3V8JA 4MEXF 3LSRA 2V6CA 2CV0A 3D5LA 2MLGA 2R7RA 3V42A 1UB9A 3CP2A 1XTAA 5J8CA 2VQGA 3VODA 2Y9YA 2GXAA 9ANTA 4AIHA 2KQRA 3ZPLA 2ETHA 3CCMI 2KT0A 4UB8C 1LNWA 2W1OA 1DU6A 1P7JA 2V79A 4KN4X 4D5FA 2L9NA 2VKEA 3EYIA 4A69C 2IEKA 4FISA 4UV9A 1G3SA 5LEJA 1VQKI 4LLNA 3OYIA 4BQQA 4KMFA 1MMAA 1VTNC 1X3ZB 3OY9A 1PP8F 2BXZA 4ZC3A 3M8JA 3W6KB 3JRHA 4J01A 4BJ6C 1R00A 2V1NA 3JTHA 4XLEA 1U8RA 4N4NB 5LHHA 5TISC 1T56A 3K1PA 1VQ8I 3SYTA 2L9VA 5DTDA 4WCGA 4AC0A 1YRNA 5E17F 1QHGA 3U2RA 1U6GA 1NH3A 3ZXSA 3J7AO 5M5XJ 1T33A 1PUFB 3K2ZA 1Z91A 3CUQC 4NNJA 1N77A 4E7ZA 1XCBA 4M71A 3HOUJ 2R7QA 3HJEA 3K4JA 3HYIA 4NUBA 4PSXA 3RTRA 3P9KA 3MZ8A 2HXIA 4BL0B 1D5VA 4I99C 4XSZF 5BPIA 2X51A 2Y2ZA 2F5VA 2P81A 4GO1A 3CCJI 5EG0B 3LSPA 4RGUA 2QGUA 1H9GA 1RR7A 1D0ZA 5LGUA 1SAUA 3Q0WA 4A3BJ 1B59A 2AXLA 3BZCA 3ZMUA 4EEFG 1S7AA 3DEEA 4BGDA 1SD5A 4U0VA 2P0WA 2BW3B 4NQWA 3M07A 1WJDA 2M8EA 3QPSA 1CGPA 4LJZF 1C0WA 1CQTA 3HDDA 3CCVI 2EA4A 4GCVA 2R7XA 2ZKZA 5KVRA 3FWEA 4EATA 1FIAA 3L2RA 3LSTA 1LE8A 2LG4A 5D6EA 1MH3A 1IRXA 5C44J 4XRMA 3BWGA 5GAGJ 4MEYF 4M3FA 2EK5A 4XLFA 1OR7A 3DFGA 1Y0NA 1Y0UA 2BVLA 4B3AA 2QWWA 4A93J 5C4JJ 1Z1DA 3BY6A 4GXOA 3R4KA 4PGGA 2DTZA 2RNJA 2WV0A 2E2HJ 3BR6A 2A6HF 1YIOA 2X0LA 2OTJI 1BN5A 3JRDA 1R7JA 4BYYA 4IHVA 4QWQA 3CUOA 3SHFA 2A5YB 1PDNC 1OFCX 2E71A 4Y33A 4U88A 2BEOA 2VXDA 3MWMA 2X1EA 2BGCA 2BE5F 4E70A 2PJRB 1WH5A 2OD5A 4N0BA 2KPMA 4ZYHA 5LEKA 3QPHA 2MLKA 4IXAA 2PQ8A 3K10A 2H6CA 1B4AA 4RAYA 4B43A 1ZLJA 3OYHA 1QA6A 2Z3YA 2ZMEB 4C3HJ 3GFLA 4LG0B 1Y8RB 2ZCWA 4MTDA 3H0DA 4A2UA 1YG2A 2E1OA 3BZKA 2K9NA 2YS9A 4RB1A 2ZO4A 1E3HA 2AO9A 4CA0A 1X19A 2B7EA 5GP9A 2M4KA 4E7JA 3OMYA 2QSFX 2DDBA 2ZFUA 1FYMA 1BI3A 1WJFA 2K9SA 1IN8A 2ESHA 1I6HJ 3JSOA 1W36D 3VFZA 3BTJA 1UZCA 2CS3A 3HSFA 4A3KJ 3X2QH 2DA7A 2IW5A 3CCSI 3OSFA 5GPCA 3WTSC 3R0AA 2EFWA 3G1LA 3KP7A 4Q48A 1KYWA 2HGCA 3V7SA 2OAZA 3W6JB 5C3EJ 4NHJA 2RC4A 2P5LC 1KU9A 3ZN1A 5J8FA 1MBEA 5H6QA 3TOAA 2ICWG 2ZXIA 1KQ9A 1ITYA 2M7AA 5F27A 4QPOA 4KN7X 2HWVA 3S3NA 2KMUA 2IGOA 1H89C 1FJLA 2BY2A 1IAWA 4HEA2 5BS6A 1I50J 3B6AA 5J1RA 2IS4A 2XROA 3S2WA 4ZDLA 1XDSA 1ZR4A 2ZJ2A 2QQ8A 4F55A 4IHTA 3ZOBA 1MMDA 2OJED 3WGHA 1JKQC 1Y56A 4A3FJ 2Z2SB 4ABZA 1D0YA 1YRNB 2DT7B 3C2HA 4XRSG 1BR2A 2WB1A 2XAJA 2EZHA 2ZSHB 2MSYA 1RKTA 3DCFA 1R49A 2JT1A 3ABUA 4IRIA 3DTIA 3KP6A 2NS8A 3TOBA 2DCEA 5IOYA 1W0TA 1H88C 2XKOA 2XF7A 4BAYA 3IRQA 3FIWA 3OYBA 2YX4A 1J09A 3IAM2 2YPRA 3J7ZI 4AM3A 1I1SA 2L7ZA 1VQ7I 4XLCA 2NOJB 1VQMI 3I54A 3DKYA 5FKNA 3FMQA 2W00A 3HGGA 2VC0A 4XOPA 5K5QA 3HOTA 2Y0SN 3DBLB 2GM4A 4ZYDA 4NQWB 2EFPA 1KGSA 1OCPA 2WY7Q 3LNQA 2CW8A 2RQPA 1RC9A 2P6SA 1QBJA 5CYVA 1HKTA 3K7AJ 3JAMZ 3Q9SA 4IHXA 1LE8B 2EA2A 4N4OB 4HV5A 3EQLF 3HM5A 1WJAA 3FHNA 5J6XA 2V9KA 4JYKA 4BBSJ 3BR3A 4PJLA 3ZQLA 4NC7A 2W7NA 3MKLA 4UNOA 1P4XA 2H1KA 5F64A 4EV0A 2LKSA 2KISA 5M3FJ 2H6BA 5ICFA 5HNFA 3JRBA 5K5RA 5HS8A 2HDCA 2BY3A 2KIQA 2FD5A 1MNDA 4OAYA 4RB3C 3ROUA 2HEOA 3K1NA 3WTXC 1R71A 2DOFA 2XPUA 2UWMA 2IGMA 4R79A 5LFAA 1TLHB 4MNUA 2DN0A 1WGXA 4YFXF 4L0YB 2VJ4A 1YFHA 2F2EA 4MFEA 2HOEA 3OS0A 5KK1A 1LB2A 4FX4A 2LLKA 4V2FA 2ZJPF 5D5VB 5EZGA 2V9PA 3I3LA 2B0LA 2QZ8A 1MZBA 2YUSA 3GXOA 1R9TJ 1ERDA 3C7JA 3BR1A 3CCUI 2BBYA 1IN4A 3M9AA 2K5CA 3GW2A 2AHQA 3GO5A 3RJPA 2HYFA 1IV8A 3CMYA 5L3GA 1XSDA 1V3FA 1JI8A 3TO6A 3KYLA 3QP6A 2ECCA 2X6XA 5EZHA 1Q1VA 4G7HF 2IA0A 3CMEI 4EGZA 1WSUA 1REPC 2DO7A 2J5PA 4CCJA 2QEXI 3QP5A 4CSWA 2VB6A 2IPQX 2E1MB 1HLVA 2XRNA 2NVUB 1U3EM 5TGTA 3LA2A 2O9LA 3PNVA 2F5FA 1JGGA 3CC2I 1YS7A 2E7XA 1LJ9A 2FMYA 2NVTJ 3MKYB 3C3WA 4V2GA 1JKRC 1E17A 1G59A 3IKTA 3VSKA 3L9FA 2ECBA 2M0MA 3ECOA 3E6BA 1HQCA 3RPUA 4WXCA 4PGHA 1XG1A 1T6SA 1GVDA 3IKVA 2CSOA 2JA8J 1QZZA 1Z7LA 1RNLA 2K9MA 1FMVA 2JUCA 2QENA 3CF5F 1ZG5A 2MH2A 4UVCA 1T2KA 5IT9K 4EJVA 3I56I 3HOXJ 4I6ZA 1XC5A 3OYFA 2OU2A 3ABTA 2VQCA 4PJ0C 3FMRA 1HKQA 5JR3A 1XPXA 2BOLA 5CKTA 2EILH 1FNNA 1P6RA 5F0CA 5JLWA 2KIUA 3OS2A 2HKOA 3TBIA 3BTCA 1JUSA 1X1AA 2HZDA 1B9NA 5LLQA 4HSTA 5HVQC 2KDZA 2CQXA 2R93J 1IUYA 1BI1A 2MC4A 1BR4A 3WHBA 1WI3A 3CF2A 3O8HA 1VI0A 3HRUA 1XX5A 3TW7A 1LVAA 2EV6A 2ZJRF 4GDFA 3CMMA 2M87A 2M45A 2HPIA 4V19K 1AOYA 4XLNF 3OYDA 2RVCA 3COAC 4DGWB 2DA1A 2Y9ZA 1O3TA 4XIDA 3OSGA 2HOTA 4UXNA 1VQ5I 4LIUA 1ETVA 4OAZA 3H3ZA 4P5OA 2A07F 3VYUB 4PK4A 3VDXA 3B02A 1LPQA 1FMWA 3GZ5A 3TW6A 3FXMA 2LVSA 2FNPA 2A3SA 3EUHC 4NC8A 2ZXHA 4Y15A 1I3QJ 1SANA 3OYAA 3QAHA 3K69A 4ZYAA 1U9NA 3I55I 1EKEA 2KRHA 1BI2A 5IP9J 3ZMTA 5B66C 3Q0UA 2DU9A 4AIKA 1OISA 5AONA 1S9HA 2FU4A 2VQLA 1WRJA 1SFXA 1BC7C 2ZXWH 2EINH 3S8PA 3JRAA 2KJCA 4A0ZA 2EIJH 3DP7A 2ZC2A 4JX6A 4LLLA 2L02A 3RKWA 4XN3A 5F04A 1Z7UA 3I9V2 1K83J 2XSDC 1NHAA 1RUNA 2DT5A 1S3JA 1U2WA 1DP3A 1MBFA 1U9OA 4IHYA 4KIGA 1T0FA 1I5ZA 3F8CA 1BBYA 1K79A 3V7RA 4RGSA 2RGVA 1WJ5A 5K7ZA 1GXQA 4N9IA 1MNEA 1ZN2A 3GWZA 3A01A 3QOPA 4RGRA 3L2WA 1X1PA 3M1EA 4HG2A 2WB1N 3KP4A 1CF7A 4WXHA 3M3YJ 3H5NA 5E3LA 4HW0A 1D0XA 3ONQA 2VOPA 3BG3A 4RB0A 4AYBN 2PG4A 1JUMA 4G6TB 2BZTA 2GLOA 4ESFA 1XGSA 2LF7A 3UR3C 4Q5SF 1G6NA 2O0YA 1VZ0A 3CD6I 2LR8A 2XSJC 3ASNH 3GTMJ 2H09A 1OPCA 3QODA 3HUGA 3UKGA 3CC4I 4KNYA 2PMZN 2VI6A 1MBKA 3FZVA 3BCAA 4PCQA 3T0YA 2F5DA 1P7IA 3PUBA 4Y3OA 2CUEA 4KDPA 3O8GA 2CW7A 4HZFA 1YX3A 5JHUA 4BJTA 4ASNA 3ERMA 2ISYA 2JWTA 2I10A 3IC7A 2DFFA 5CQGA 4C30A 1EV7A 4ANJA 1R36A 3ZQGA 3HHGA 2VPLA 5LGNA 3A2KA 2AQFA 1TW2A 3GZNB 3MZYA 3SQNA 3HRTA 4D7MA 2R7SA 4X1EA 5E1WA 3OOUA 2G9WA 4I76A 3F9KA 3DEUA 4L9TA 2P7CB 3PNYA 3K1MA 2NVXJ 1JUPA 3KYCB 1T95A 1B8IA 4PDKA 1SD4A 1R1UA 1QO0D 2K85A 3GZ6A 4CGZA 5E20A 2O5RA 1E0EA 3KZIC 3NWSA 5ILUA 1WVRA 5ED4A 1OMIA 3OIOA 4RM3A 3TKYA 3ZQCA 1LEAA 5J40A 2D45A 1KQ8A 1R23A 2STTA 3FISA 1HKSA 2GAUA 3J81Z 1J59A 4HQEA 4LITA 3WTWC 3AG2H 4W1UA 3FMSA 1MD0A 4IVNA 1YHQI 5FKMA 2EZIA 1OJLA 4KT5C 2RV8A 3HRSA 4U0WA 2NVYJ 1U5TB 2AXTC 3HB9A 2VPRA 4F93B 2DA4A 4C2UA 4KFCA 1SMTA 3H1CA 2Z33A 4E7HA 4LB6B 1X2NA 1ZH5A 1T98A 1BW6A 4D7NA 1MMNA 2XGEA 2Y31A 3PUFA 2MYSA 1VQLI 4CHUA 2E1CA 1V4RA 5KAIC 2E1NA 4EJWA 2OCCH 3S93A 5LGTA 4E7SA 1A5JA 1A35A 3GCMA 3JSPA 1HC8A 3CDHA 3PNTA 4XMYA 1LKXA 2OPTA 4S05A 2H8RA 2DFHA 3RPQA 2LF8A 4RB2C 4XM3A 3CJRB 2KFDA 1TWFJ 4KA4A 3F0CA 4BQAA 3RPUD 2DQRA 5FRNA 4KT6A 4XKVA 4Q4ZF 4RBOA 1NK3P 3QQAA 1DUXC 4ESBA 2W84A 2L9RA 3HGYA 3WODF 5M3MJ 5GTIC 2XB0X 1LDKB 3IRRA 1ETQA 1LFUP 2VXZA 4A0YA 3ZGKA 5E18F 1YITI 1J5YA 4EJOA 3BR0A 2R4GA 5B5EC 4UHTA 3MMYB 3T8TA 2DMTA 2HS5A 1S72I 4EM1A 4CCOA 3GVAA 4PZJA 1QU3A 3S3MA 1JJ8C 3BPXA 3WTYC 1QVTA 4EVIA 2X1CA 4J19A 2FRHA 2KRFA 2WV1A 4D1QA 5ICEA 3CC7I 1JE8A 2DTRA 1ETOA 2DK8A 2WA0A 3A01B 2Z16A 1HDDC 2R7OA 1QPIA 1TP4A 5GAEJ 4O3MA 2IXSA 2A6TA 5FGMA 3ZQHA 2B9SA 2XGXA 2V1XA 5K1YA 1CF7B 1U5TC 2DAOA 2HR3A 1R5ID 4DYRA 1BC8C 5KHDA 3HZJA 3AAFA 1FPQA 3CP8A 3MD2A 4U7BA 2Z1DA 3FBIB 3QPLA 2JVHA 1U0JA 5TRDA 2LRDA 4ON0A 3W2AA 4M6VA 4GFBA 3HUGB 4A3GJ 3JREA 2PJPA 3A02A 5EDNA 1J2XA 2DA5A 2PFBA 3VPRA 4QPQA 1IGNA 2QVOA 5CVUA 2QQAA 3BZ6A 3L2VA 2VBYA 4HA8A 5E79C 4BY7J 2R7WA 2Y75A 3M7GA 2KDOA 2DOAA 4HSRA 4II3A 1FOXA 1HCRA 2PEXA 5K7HA 3IH4A 5F6FA 2E36A 3W2VA 1Z77A 2MABA 2VKHA 3SFIA 2L0KA 2XRLA 5J4VA 5CPRB 1WQ2A 3RZOJ 3MKZA 2Y30A 2EPFA 2NXNB 2JPCA 2M2EA 2DA3A 1WI9A 5EEGA 3IH3A 3G6EI 3G1MA 2V4JC 4RAGA 2EIKH 2NNYA 3BR2A 3DPTA 4HPQA 3DTKA 1B8IB 2E5NA 4A3LJ 1GUUA 2WY8Q 1R4NB 3F6OA 4B1RA 1RIOH 1ZRFA 1OCZH 1ZRCA 2K9LA 2DMQA 2O6GE 3GTQJ 2RN7A 1TBXA 2XIGA 3TGNA 3SJMA 3OV8A 5L3BA 1ZELA 3SFZA 3P9IA 2D2WA 1ZK8A 2K9QA 1T38A 4CCLA 1Z6RA 1X4PA 2W85A 5CJ9A 4OIOF 2VJ5A 2YR2A 2CQKA 2LMDA 3DXJF 1NTCA 4XORA 4HLYA 2B63J 1WH7A 2ELHA 4A3IJ 3TO9A 2DA2A 3CCYA 2RQQA 2Z5UA 2HDWA 1FOWA 4MHGA 2XF5A 3E7LA 4A6DA 5IT9Z 3K70D 2HFHA 3IH2A 4A3MJ 1FOYA 4IL6C 2W57A 3BCBA 2QQBA 3E5UA 4LLGF 3F8NA 3GX4X 2YX7A 3I59A 2P7VB 5CLSA 1ZR2A 4FETA 3KLNA 1X3WB 2ZB9A 3ZMSA 3DLAA 1UG0A 4BDYA 2TCTA 3C2BA 1GVJA 1S6LA 4KMUX 4DYCA 1A04A 2JA5J 2FBKA 2HTJA 2XAUA 3F72A 4DQ2A 4H4KC 4OU0A 3LSHA 3F21A 4KYWA 1JGSA 2WAFA 1D1CA 2HI3A 3T5XA 1HW5A 3MAJA 4FQGA 4L5JA 4ENKA 2K4BA 3RDIA 5H6RA 3LA3A 2OUMA 3HTSB 5LD2C 4ZDOA 3GTJJ 3IAS2 2K7LA 2V7FA 1ZREA 3GTLJ 2VBZA 3IHUA 4U87A 3KCCA 3BG7A 5AIQA 1ZQ3P 2KP6A 3J81K 3DV8A 1XGOA 1YS6A 2E19A 2M1BA 1IZ1A 1W7PA 4E7IA 3F22A 4BS9A 3CDIA 2QBYA 2CUFA 2O3FA 1XGNA 4Y7NJ 1KU2A 3QWLA 2FA5A 1OYYA 5DCFA 2DYRH 2PBIA 3I58A 5LRSA 4XRFA 2DQLA 2F5EA 4QTRA 1TL8A 4A0XA 3OL4A 2CV2A 2R7UA 3H5RA 2Z99A 5HLTA 2GA2A 1LQ1A 3ISPA 3E5XA 3KLOA 2X48A 3GYHX 4HX8A 3T8RA 3WGGA 5E3OA 2W48A 1UJ8A 3ESWB 2CH0A 4P9FA 1XMAA 4PUSA 5KCMA 1ZAOA 3U1KA 3OIQA 4ESJA 2LKXA 3LFUA 4A3DJ 1R58A 1V55H 4I0BA 2L5QA 1UCRA 4MTEA 2QQ9A 2TDXA 1XN7A 4B48A 4QIWN 4A5NA 1X2MA 1MH4A 1SVMA 3R0JA 5E3NA 2GQQA 2IRFG 5D6FA 4IRGA 3BG9A 1E3PA 2E35A 2ZMEC 3QYBA 2MFZA 3IUOA 1K61A 3S1QJ 5D8KB 3G1OA 3WTVC 1XGMA 4LOCA 4XR6A 1VQ6I 3I53A 2X4HA 3B73A 3LSGA 3GEZA 4BH9A 2V1DA 2HOSA 5HDNA 2FBIA 3NWTA 5ILSA 3N97A 3PJRA 2R0QC 4CUGA 2Y48A 4BJ5C 4RA2A 1BL0A 4CH7A 3ZRGA 4XLPF 2Z9OA 3HKZN 2K3FA 1EA3A 1IXCA 1XCVA 1LDJA 3NAUA 3FXKA 4CYDA 1MGTA 1UHSA 2VE8A 5HDGA 4C2MJ 2DJIA 1XD7A 2FOKA 1Z3XA 1QZEA 4AD9A 3E97A 3GTOJ 2RREA 1ON1A 5ERIA 1GV2A 4M9SA 4DIQA 2DFEA 2CV1A 5E8IA 2P4WA 3VYSB 4N9HA 4U7DA 2VT2A 1PJRA 2VONA 2LYCA 3LWFA 4IF4A 3K0LA 4MLOA 1FBSA 2LDUA 1GT0C 3N05A 3HTUA 5FRMA 3DEWA 2P8TA 4KISA 3ULQB 4BDZA 1QZYA 2CW0F 3RQ4A 3ZMDA 2CO5A 1Y1WJ 2UUZA 2R5YA 3V7CA 1ACIA 1HW1A 1RPWA 3ABMH 2V6EA 1O7FA 4UV8A 5IY5H 5DM6F 2X6WA 2EJRA 4S0HB 2VL8A 3U1DA 3CCEI 5GPAA 1FC3A 4GYIA 2DT6A 4BU2A 2R7ZJ 1IDZA 1Z9CA 2YSRA 4D9JA 4TV7A 3H5AA 2ZSIB 4M3DA 5BMZA 1AU7A 2K86A 4F92B 4BY1J 3L2UA 5L3EA 4ZZLA 4Y13A 1Z67A 3LQRA 2V9VA 4G12A 4HX4A 3DF8A 3KP5A 1PP7U 2LOOA 2FOWA 3NQOA 5FFXA 2WAQA 1EJ9A 3WU0A 5GADJ 2ZBKA 3JR9A 3A0HC 3I59B 2R3SA 3FXLA 2HTSA 1N75A 5D8LB 3HHHA 3R61A 5IYBJ 3CMAI 1IW7F 2OF7A 3K4LA 1XMKA 1U78A 1QGPA 1YW8A 2W24A 3SZPA 4FE4A 1X1CA 1KU3A 5KAFC 1RZ4A 3A4CA 2BHYA 2XVCA 4FCYA 1O3SA 2LC2A 2LKPA 3ZCOA 4E6KG 2HKXA 4DYQA 4IHWA 2PLYA 4G94A 4ZTJA 3OYKA 3H9JA 2DXIA 4KIBA 4B4CA 3AG4H 4HF2A 3GTGJ 5K7FA 1LFPA 1LEBA 3TP0A 2LK2A 3AG1H 1OR7C 2L9SA 3HIFA 3I0TA 4XL9A 1G3TA 5DUKA 4QLCU 1B72A 3V8KA 3BJOA 3ZN0A 2CQQA 4YELA 2YU3A 3HC7A 2QBYB 5L3FA 1FZPB 3P7NA 5L3CA 3LAPA 4IQ4A 2HPMA 4II2A 1FP1D 1YI2I 1MKMA 4QSHA 3OYGA 5D4RA 4KITB 3V4GA 4P55A 1ZYRF 4BXFA 3RIRA 1G2HA 1ETKA 2VN2A 2FMLA 3S16J 2EIMH 1PYVA 1P2FA 1YJNI 3E1SA 4D5CA 1RRJA 2E2JJ 1WJBA 2CU7A 3FKJA 5E3MA 3DBRB 1DP7P 3H92A 5J3LA 1BOBA 4I02A 2DA6A 4GGGA 1ZARA 2LSOA 2NOGA 3JRIA 1BOAA 1FBUA 1OYWA 2ZJQF 4EMSA 3U21A 3KPHA 3VYRB 5DV5A 3J7YJ 2W25A 4NB5A 4BQOA 3S17J 2Y0MA 4C3JJ 2JA6J 3L2CA 5FO5A 1T08B 3CUQA 1XMXA 3MKWB 3KEQA 2KZVA 3EYYA 2R7VA 3TP3A 2ZNYA 2E1MC 1MDMA 3OYCA 1IV6A 2VJIA 2Y69H 2EB7A 3BG5A 4F52A 4F91B 4IO9F 1D8JA 2M9HA 4ENJA 3BJAA 4GYGA 3OYLA 1W7PD 5IYCJ 3I5UA 1JTYA 1V54H 3QU3A 4YIFA 4UB6C 2F4MB 2PX9A 1IRZA 3AKZA 3F8MA 1F4KA 5BOXA 2HQNA 5FKLA 4A6EA 3PO3J 3S15J 2DBBA 1AKHA 1OCCH 3DTEA 2R7DA 3CLQA 3WE3A 4X6AJ 4L9NA 3G2BA 4YFKF 2XDVA 2HQAA 1IXRC 4HBLA 2ME6A 2D1HA 3H3UA 2VODA 1JXSA 4DW6A 1MMSA 4C9YA 2R5YB 4S04A 1YJ9I 3C2GA 3FM5A 2ZFWA 1X3UA 4JP0A 2G7HA 5IYDJ 4Y17A 1KQ0A 2EZLA 2CGPA 2MBFA 1X1DA 3CJNA 4H0EA 2PN6A 3F6VA 4A3JJ 4M3GA 2Q0OA 1H9TA 1OCTC 1SMYF 3LMMA 4LD5A 5ICCA 1ON2A 1P92A 2UXNA 2GXBA 1KYZA 3CLOA 5H2FC 4MFDA 1GHCA 4UUSA 4F3QA 1D1BA 2M3AA 3S14J 3G3ZA 2HQ5A 2LTPA 2L7KA 1A6QA 3IP4B 5BPDA 4P9UA 5JVTA 4YG2F 1O3RA 2ELJA 3BDDA 4R8HA 2NRAC 1IF1A 1HSJA 2XKPA 1AHDP 2JQ7A 4UY8I 1Z0XA 5CVVA 3FXJA 2JA2A 2M4GA 3HG9A 3CQZJ 3PFIA 3SDBA 1OYIA 3O3KA 4G8XA 2H94A 1K6OA 2E5ZA 1NG7A 5AIPA 4L5IA 4L9VA 2X85A 1K7AA 4I98B 2JUGA 4I01A 3OYNA 3H35A 3WTZA 3VYTB 1BR1A 2FSWA 3DKXA 4PFOA 3KE2A 2EFOA 4BXUA 2L4MA 1VF9A 2F6CA 5DS9A 3HL2A 1QVUA 4Z2YA 4RAFA 3BOQA 1MBHA 4PSWA 4AU7A 4G7ZF 3RQIA 4UUTA 3KP2A 3WU2C 1R22A 3GTPJ 4IKFA 2IA1A 1FYLA 1ONVA 2Q8KA 4U0YA 2BW3A 2OQRA 2HNHA 4ZTFA 1TWAJ 1T39A 1TW3A 2HOAA 3IL2A 2EFNA 3QYEA 4HF0A 1WZ2A 5F1JA 3MQ0A 4BUPA 3JRFA 2FUG2 2E34A 4FHTA 4HNTA 1R5GA 3TQNA 1G3YA 2JA7J 3VWBA 4XNFA 1YTYA 3TEDA 4NDLA 3JRCA 1W4MA 1QHHD 2L7MP 2OTLI 1TQPA 1NK2P 2CFXA 4LK0F 3HBLA 4EM0B 2CFOA 2OQGA 4JQFA 3C1DA 5K5OA 1MBGA 3H9QA 5CVJA 3ZQQA 3L1PA 4UVBA 5FD5A 4M9ZA 2VT3A 2IGNA 5IP6A 1FEXA 3VSLA 4ITVA 3HOWJ 2P5VA 1XS9A 1OCRH 2CMPA 3LOCA 5EEHA 3ZQIA 2WAQN 3BP8A 3P5JA 1SEUA 2BV6A 3ERED 1HBXG 4BHCA 3PIPF 1JT6A 3SZTA 1H8AC 2DK5A 2DPDA 2EQRA 1ZG1A 1IN5A 1YE9A 1I6XA 3GBGA 2O8XA 2J5OA 5CVRA 2KKOA 1R1TA 4CDGA 3I4NJ 1TQIA 3SEZA 2H1LA 2IA2A 1POGA 2DI3A 5EGOA 5A2QZ 4PJNA 3OR1C 4XSXF 1ETYA 1YW9A 2F4IA 3GMEA 2FX0A 3ML6A 4LG0A 3JW4A 1UHWA 2COBA 5HLHA 5HS9A 4M72A 5FJ8J 4LGWA 3SXYA 1AWCA 4XOTA 1AKHB 3BROA 2GIZA 1YJWI 5EEAA 5BQTA 2FNAA 4Z6YA 1V5EA 2FQ4A 5E1ZB 2IS2A 1OKRA 2IBDA 1HOMA 1S8NA 2VKVA 3DU5A 5GTHC 3E3VA 5F0HA 1JHFA 2HXOA 1ZGAA 3A03A 1IC8A 3M8EA 3M8FA 1QQIA 4IX7A 4XLHA 4G9YA 4XICA 2NYXA 4HAMA 1WJEA 1I1GA 2RAEA 4DZJA 1PUEE 2XGDA 1Y1VJ 5J4YA 3DWLE 4L5EA 1ZLKA 3MFKA 1SFOJ 1E3OC 1TTYA 2V1UA 3LSKA 4LK1F 3R60A 4LFUA 1MIJA 1SFKA 1X58A 3TL4X 4L18B 3GF2A 4DJAA 2M30A 3HOSA 1SAXA 4UUSB 1A31A 4KUMA 3H3VK 2HU9A 3RCOA 3CCLI 1YO5C 2EFQA 5DD4A 1MJBA 1FWZA 4B44A 3KP3A 4AIJA 4YIRX
chains in the Genus database with same CATH topology
4JX5A 2R92J 3RKQA 2NVTJ 1MSEC 1JKRC 4V2GA 2X48A 5IP7J 5EG0A 2LD5A 1TWHJ 5E3OA 2W48A 2ECBA 2NVQJ 3HOZJ 1F43A 1JKOC 4HNVA 2ID6A 3CDLA 2LKXA 1B72B 4A3DJ 3BTLA 1ZGWA 1XG1A 1ETWA 5HODA 1GVDA 4QIWN 2JA8J 1X2MA 1MH4A 2M34A 5IPAA 5E3NA 3S1MJ 3IV5A 3BG9A 1K61A 3S1QJ 3RZDJ 4XRSA 4XK4A 3G1OA 3HOXJ 4I6ZA 1XC5A 4LOCA 3HOYJ 2DMPA 1IJWC 1HDPA 3LSGA 4RDUA 3D1NI 1JKPC 5F0CA 5JLWA 5J1UA 2HOSA 3S2HJ 3BTCA 1JUSA 1DU0A 2R0QC 5FKKA 4BKXA 1BL0A 3BR5A 1A6IA 3S1RJ 2KDZA 2CQXA 2R93J 1GV5A 3BTIA 3PM1A 3HOVJ 3HKZN 1TWGJ 3WHBA 1S7EA 1WI3A 3NAUA 4BXXJ 3O8HA 1UHSA 1VI0A 4C2MJ 1LFBA 3TW7A 2LFBA 2HDDA 5FLMJ 5FLVA 5EYRA 3GTOJ 1GV2A 2DA1A 2Y9ZA 2JMWA 2HYJA 4M3BA 4XIDA 3OSGA 2HOTA 2MGQA 1IDYA 1ETVA 5JLXA 4MLOA 1GT0C 3DEWA 5IOZA 2O7OA 3TW6A 2LVSA 2VUMJ 1Y1WJ 1FTTA 2R5YA 1I3QJ 1SANA 4M3EA 1APLC 1RPWA 1U9NA 5IP9J 1JT0A 3Q0UA 4S0HB 2QF7A 5GPAA 4FTHA 3JRAA 1JJ6C 2R7ZJ 1IDZA 3WHCA 3Q0VA 3Q3SA 4JX6A 4M3DA 1AU7A 2M0CA 5EGOB 5F04A 4BY1J 1RETA 1K83J 2XSDC 3LSRA 3BQYA 4G12A 1MBFA 1U9OA 3FKIJ 4IHYA 4IEJA 2Y9YA 9ANTA 3JR9A 5K7ZA 2EZKA 2KT0A 2TRTA 5IYBJ 1DU6A 3A01A 1P7JA 2OF7A 5M5WJ 1U78A 4D5FA 2VKEA 2CJJA 2IEKA 2WB1N 4FISA 4FE4A 4A69C 3M3YJ 5E3LA 3BG3A 4AYBN 1JUMA 3MVPA 1BA5A 2GLOA 4FCYA 3JRHA 4DYQA 4IHWA 3MN2A 1RKWA 4B4CA 2LR8A 3GTGJ 3GTMJ 4JX4A 5K7FA 3UKGA 1T56A 2PMZN 2VI6A 3LSJA 3TP0A 2LK2A 1MBKA 5DTDA 1YRNA 4AC0A 1B72A 1P7IA 5M5XJ 4FE7A 1T33A 2CUEA 2CQQA 1PUFB 3O8GA 1VFCA 4CYCA 3HOUJ 2JWTA 2I10A 3FK7A 2ID3A 4QSHA 2HXIA 3ZQGA 2DMUA 2Y2ZA 2P81A 1G2HA 1ETKA 3S16J 5EG0B 3LSPA 1BJZA 4D7MA 1RR7A 4X1EA 2LP0A 3OOUA 3Q0WA 4I76A 4D5CA 4A3BJ 3I4MJ 4EEFG 2E2JJ 1FIPA 2CU7A 5E3MA 2NVXJ 1JUPA 3QPSA 1B8IA 5J3LA 2DA6A 1CQTA 2NOGA 3HDDA 3JRGA 3JRIA 3OIOA 3B6CA 3ZQCA 1FIAA 1LE8A 4A3CJ 1MH3A 1UG2A 1TWCJ 3FISA 4DZPA 4XRMA 5C44J 2DMNA 4M3FA 3S17J 4W1UA 4C3JJ 2JA6J 2X9DA 4B3AA 5FKMA 2EZIA 1OJLA 4A93J 5C4JJ 3K2AA 2NVYJ 2EH3A 1IUFA 3HB9A 2DTZA 2N8GA 2VPRA 3TP3A 2G0EA 2MG4A 2DA4A 4MIMA 3BR6A 3BG5A 1IV6A 2E2HJ 2M9HA 1X2NA 3JRDA 1BW6A 4D7NA 2XGEA 4IHVA 2Y31A 5IYCJ 1JTYA 2QCOA 1OFCX 1IRZA 3BQZA 1A5JA 2EBIA 5FKLA 3PO3J 3S15J 1WH5A 1AKHA 2FJ1A 1D5YA 4X6AJ 2H8RA 2OPTA 2R5ZA 2O8KA 1FTZA 2ME6A 1TWFJ 4DW6A 3F0CA 2D5VA 1W0UA 2R5YB 1BW5A 2ME0A 3BT9A 4JP0A 4C3HJ 5IYDJ 5M5YJ 4RBOA 1NK3P 2EZLA 3QQAA 2E1OA 2K9NA 2YS9A 3M4OJ 2AO9A 2L9RA 4A3JJ 3HGYA 5GP9A 5M3MJ 4M3GA 1OCTC 2XB0X 1ETQA 2XGCA 1LFUP 2K9SA 1F36A 1I6HJ 3BTJA 4MFDA 4A3KJ 3BR0A 5J1YA 4UUSA 2DA7A 3S14J 3OSFA 5GPCA 2HQ5A 2DMTA 2LTPA 3G1LA 1IG7A 1GDTA 4AUXA 1JJ8C 4J19A 1QVTA 2WV1A 5C3EJ 1ETOA 1AHDP 1EF4A 1Z0XA 3A01B 1HDDC 3CQZJ 1QPIA 1MBEA 3ZQHA 3W6VA 1ITYA 2IAIA 5F27A 3H0GJ 5C4XJ 1FJLA 1H89C 1ORKA 2K40A 4DYRA 1ZKGA 2NS7A 1UMQA 1I50J 3B6AA 5J1RA 3QPLA 2JJ7A 1ZR4A 2XB5A 1VF9A 3S1NJ 5DS9A 4A3GJ 4GFBA 4M6VA 5EF6A 1QVUA 3ZOBA 2M8GX 1JKQC 4A3FJ 3JREA 3A02A 4ABZA 5EDNA 1MNMC 1MBHA 2DA5A 1YRNB 3VPRA 3RQIA 1IGNA 4UUTA 4XRSG 2EZHA 3GTPJ 2MSYA 1RKTA 3DCFA 1MSFC 4BY7J 4CYCB 5F0FA 2NS8A 3S2DJ 5IOYA 1W0TA 1H88C 1TWAJ 1VNDA 2HOAA 1HCRA 3FIWA 5K7HA 3IH4A 5F1JA 1Z77A 3GTKJ 3JRFA 2YU9J 2L7ZA 3SFIA 2L0KA 2XRLA 4BBRJ 3SDGA 2JK3A 3RZOJ 2Y30A 1O4XA 2M2EA 5BNGA 1WPKA 2JA7J 2DA3A 3TEDA 5FKNA 4NDLA 3JRCA 3HGGA 1TC3C 2L7MP 3HEFA 1NK2P 3IH3A 3G1MA 2Y0SN 3HBLA 2GM4A 3BR2A 1B8IB 1OCPA 4A3LJ 3LNQA 4A3EJ 1GUUA 4B1RA 1ENHA 1MBGA 3K7AJ 2DMQA 3L1PA 3GTQJ 5IP6A 1FEXA 4IHXA 3SJMA 1LE8B 3HOWJ 1XS9A 3LOCA 3ZQIA 2WAQN 3HM5A 2LY9A 1ZK8A 2K9QA 1JT6A 4JYKA 1H8AC 4BBSJ 3BR3A 2EQRA 3ZQLA 3GBGA 3MKLA 1RESA 2H1KA 1ETXA 5M3FJ 3PO2J 3I4NJ 1NTCA 1POGA 3JRBA 5EGOA 2B63J 1WH7A 4A3IJ 1ETYA 2DA2A 2FD5A 1JTXA 3CCYA 3ZQFA 2GBYA 2FX0A 3E7LA 4C3IJ 3IH2A 4A3MJ 2XPUA 2COBA 2X6OA 2DN0A 5FJ8J 1WGXA 1ZR2A 4MFEA 1WCMJ 1AKHB 2ZB9A 2L7FP 2TCTA 5EEAA 3C2BA 2LLKA 4V2FA 3FK6A 4DYCA 3NARA 2JA5J 1HF0A 2XPWA 2R5ZB 5EZGA 2FQ4A 2YUSA 2IBDA 1HOMA 2VKVA 4MO7A 1R9TJ 2HI3A 5F0HA 2E2IJ 2HXOA 3BR1A 2MW8A 3A03A 1IC8A 1U8BA 5F08A 2ELKA 3GTJJ 4W97A 4XICA 4DZJA 2AHQA 2RAEA 2XGDA 2XPVA 3GTLJ 1Y1VJ 5FKOA 3CMYA 2JN6A 4L5EA 1ZQ3P 4Y52J 1SFOJ 1E3OC 2ECCA 5EZHA 1Q1VA 1X58A 2E19A 2CRGA 1PUFA 2DJNA 2CUFA 4UUSB 1HLVA 3H3VK 4Y7NJ 2O9LA 1ZTRA 1JGGA 1MBJA 1QRYA 4QTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX5 A;  2R92 J;  3RKQ A;  2NVT J;  1MSE C;  1JKR C;  4V2G A;  2X48 A;  5IP7 J;  5EG0 A;  2LD5 A;  1TWH J;  5E3O A;  2W48 A;  2ECB A;  2NVQ J;  3HOZ J;  1F43 A;  1JKO C;  4HNV A;  2ID6 A;  3CDL A;  2LKX A;  1B72 B;  4A3D J;  3BTL A;  1ZGW A;  1XG1 A;  1ETW A;  5HOD A;  1GVD A;  4QIW N;  2JA8 J;  1X2M A;  1MH4 A;  2M34 A;  5IPA A;  5E3N A;  3S1M J;  3IV5 A;  3BG9 A;  1K61 A;  3S1Q J;  3RZD J;  4XRS A;  4XK4 A;  3G1O A;  3HOX J;  4I6Z A;  1XC5 A;  4LOC A;  3HOY J;  2DMP A;  1IJW C;  1HDP A;  3LSG A;  4RDU A;  3D1N I;  1JKP C;  5F0C A;  5JLW A;  5J1U A;  2HOS A;  3S2H J;  3BTC A;  1JUS A;  1DU0 A;  2R0Q C;  5FKK A;  4BKX A;  1BL0 A;  3BR5 A;  1A6I A;  3S1R J;  2KDZ A;  2CQX A;  2R93 J;  1GV5 A;  3BTI A;  3PM1 A;  3HOV J;  3HKZ N;  1TWG J;  3WHB A;  1S7E A;  1WI3 A;  3NAU A;  4BXX J;  3O8H A;  1UHS A;  1VI0 A;  4C2M J;  1LFB A;  3TW7 A;  2LFB A;  2HDD A;  5FLM J;  5FLV A;  5EYR A;  3GTO J;  1GV2 A;  2DA1 A;  2Y9Z A;  2JMW A;  2HYJ A;  4M3B A;  4XID A;  3OSG A;  2HOT A;  2MGQ A;  1IDY A;  1ETV A;  5JLX A;  4MLO A;  1GT0 C;  3DEW A;  5IOZ A;  2O7O A;  3TW6 A;  2LVS A;  2VUM J;  1Y1W J;  1FTT A;  2R5Y A;  1I3Q J;  1SAN A;  4M3E A;  1APL C;  1RPW A;  1U9N A;  5IP9 J;  1JT0 A;  3Q0U A;  4S0H B;  2QF7 A;  5GPA A;  4FTH A;  3JRA A;  1JJ6 C;  2R7Z J;  1IDZ A;  3WHC A;  3Q0V A;  3Q3S A;  4JX6 A;  4M3D A;  1AU7 A;  2M0C A;  5EGO B;  5F04 A;  4BY1 J;  1RET A;  1K83 J;  2XSD C;  3LSR A;  3BQY A;  4G12 A;  1MBF A;  1U9O A;  3FKI J;  4IHY A;  4IEJ A;  2Y9Y A;  9ANT A;  3JR9 A;  5K7Z A;  2EZK A;  2KT0 A;  2TRT A;  5IYB J;  1DU6 A;  3A01 A;  1P7J A;  2OF7 A;  5M5W J;  1U78 A;  4D5F A;  2VKE A;  2CJJ A;  2IEK A;  2WB1 N;  4FIS A;  4FE4 A;  4A69 C;  3M3Y J;  5E3L A;  3BG3 A;  4AYB N;  1JUM A;  3MVP A;  1BA5 A;  2GLO A;  4FCY A;  3JRH A;  4DYQ A;  4IHW A;  3MN2 A;  1RKW A;  4B4C A;  2LR8 A;  3GTG J;  3GTM J;  4JX4 A;  5K7F A;  3UKG A;  1T56 A;  2PMZ N;  2VI6 A;  3LSJ A;  3TP0 A;  2LK2 A;  1MBK A;  5DTD A;  1YRN A;  4AC0 A;  1B72 A;  1P7I A;  5M5X J;  4FE7 A;  1T33 A;  2CUE A;  2CQQ A;  1PUF B;  3O8G A;  1VFC A;  4CYC A;  3HOU J;  2JWT A;  2I10 A;  3FK7 A;  2ID3 A;  4QSH A;  2HXI A;  3ZQG A;  2DMU A;  2Y2Z A;  2P81 A;  1G2H A;  1ETK A;  3S16 J;  5EG0 B;  3LSP A;  1BJZ A;  4D7M A;  1RR7 A;  4X1E A;  2LP0 A;  3OOU A;  3Q0W A;  4I76 A;  4D5C A;  4A3B J;  3I4M J;  4EEF G;  2E2J J;  1FIP A;  2CU7 A;  5E3M A;  2NVX J;  1JUP A;  3QPS A;  1B8I A;  5J3L A;  2DA6 A;  1CQT A;  2NOG A;  3HDD A;  3JRG A;  3JRI A;  3OIO A;  3B6C A;  3ZQC A;  1FIA A;  1LE8 A;  4A3C J;  1MH3 A;  1UG2 A;  1TWC J;  3FIS A;  4DZP A;  4XRM A;  5C44 J;  2DMN A;  4M3F A;  3S17 J;  4W1U A;  4C3J J;  2JA6 J;  2X9D A;  4B3A A;  5FKM A;  2EZI A;  1OJL A;  4A93 J;  5C4J J;  3K2A A;  2NVY J;  2EH3 A;  1IUF A;  3HB9 A;  2DTZ A;  2N8G A;  2VPR A;  3TP3 A;  2G0E A;  2MG4 A;  2DA4 A;  4MIM A;  3BR6 A;  3BG5 A;  1IV6 A;  2E2H J;  2M9H A;  1X2N A;  3JRD A;  1BW6 A;  4D7N A;  2XGE A;  4IHV A;  2Y31 A;  5IYC J;  1JTY A;  2QCO A;  1OFC X;  1IRZ A;  3BQZ A;  1A5J A;  2EBI A;  5FKL A;  3PO3 J;  3S15 J;  1WH5 A;  1AKH A;  2FJ1 A;  1D5Y A;  4X6A J;  2H8R A;  2OPT A;  2R5Z A;  2O8K A;  1FTZ A;  2ME6 A;  1TWF J;  4DW6 A;  3F0C A;  2D5V A;  1W0U A;  2R5Y B;  1BW5 A;  2ME0 A;  3BT9 A;  4JP0 A;  4C3H J;  5IYD J;  5M5Y J;  4RBO A;  1NK3 P;  2EZL A;  3QQA A;  2E1O A;  2K9N A;  2YS9 A;  3M4O J;  2AO9 A;  2L9R A;  4A3J J;  3HGY A;  5GP9 A;  5M3M J;  4M3G A;  1OCT C;  2XB0 X;  1ETQ A;  2XGC A;  1LFU P;  2K9S A;  1F36 A;  1I6H J;  3BTJ A;  4MFD A;  4A3K J;  3BR0 A;  5J1Y A;  4UUS A;  2DA7 A;  3S14 J;  3OSF A;  5GPC A;  2HQ5 A;  2DMT A;  2LTP A;  3G1L A;  1IG7 A;  1GDT A;  4AUX A;  1JJ8 C;  4J19 A;  1QVT A;  2WV1 A;  5C3E J;  1ETO A;  1AHD P;  1EF4 A;  1Z0X A;  3A01 B;  1HDD C;  3CQZ J;  1QPI A;  1MBE A;  3ZQH A;  3W6V A;  1ITY A;  2IAI A;  5F27 A;  3H0G J;  5C4X J;  1FJL A;  1H89 C;  1ORK A;  2K40 A;  4DYR A;  1ZKG A;  2NS7 A;  1UMQ A;  1I50 J;  3B6A A;  5J1R A;  3QPL A;  2JJ7 A;  1ZR4 A;  2XB5 A;  1VF9 A;  3S1N J;  5DS9 A;  4A3G J;  4GFB A;  4M6V A;  5EF6 A;  1QVU A;  3ZOB A;  2M8G X;  1JKQ C;  4A3F J;  3JRE A;  3A02 A;  4ABZ A;  5EDN A;  1MNM C;  1MBH A;  2DA5 A;  1YRN B;  3VPR A;  3RQI A;  1IGN A;  4UUT A;  4XRS G;  2EZH A;  3GTP J;  2MSY A;  1RKT A;  3DCF A;  1MSF C;  4BY7 J;  4CYC B;  5F0F A;  2NS8 A;  3S2D J;  5IOY A;  1W0T A;  1H88 C;  1TWA J;  1VND A;  2HOA A;  1HCR A;  3FIW A;  5K7H A;  3IH4 A;  5F1J A;  1Z77 A;  3GTK J;  3JRF A;  2YU9 J;  2L7Z A;  3SFI A;  2L0K A;  2XRL A;  4BBR J;  3SDG A;  2JK3 A;  3RZO J;  2Y30 A;  1O4X A;  2M2E A;  5BNG A;  1WPK A;  2JA7 J;  2DA3 A;  3TED A;  5FKN A;  4NDL A;  3JRC A;  3HGG A;  1TC3 C;  2L7M P;  3HEF A;  1NK2 P;  3IH3 A;  3G1M A;  2Y0S N;  3HBL A;  2GM4 A;  3BR2 A;  1B8I B;  1OCP A;  4A3L J;  3LNQ A;  4A3E J;  1GUU A;  4B1R A;  1ENH A;  1MBG A;  3K7A J;  2DMQ A;  3L1P A;  3GTQ J;  5IP6 A;  1FEX A;  4IHX A;  3SJM A;  1LE8 B;  3HOW J;  1XS9 A;  3LOC A;  3ZQI A;  2WAQ N;  3HM5 A;  2LY9 A;  1ZK8 A;  2K9Q A;  1JT6 A;  4JYK A;  1H8A C;  4BBS J;  3BR3 A;  2EQR A;  3ZQL A;  3GBG A;  3MKL A;  1RES A;  2H1K A;  1ETX A;  5M3F J;  3PO2 J;  3I4N J;  1NTC A;  1POG A;  3JRB A;  5EGO A;  2B63 J;  1WH7 A;  4A3I J;  1ETY A;  2DA2 A;  2FD5 A;  1JTX A;  3CCY A;  3ZQF A;  2GBY A;  2FX0 A;  3E7L A;  4C3I J;  3IH2 A;  4A3M J;  2XPU A;  2COB A;  2X6O A;  2DN0 A;  5FJ8 J;  1WGX A;  1ZR2 A;  4MFE A;  1WCM J;  1AKH B;  2ZB9 A;  2L7F P;  2TCT A;  5EEA A;  3C2B A;  2LLK A;  4V2F A;  3FK6 A;  4DYC A;  3NAR A;  2JA5 J;  1HF0 A;  2XPW A;  2R5Z B;  5EZG A;  2FQ4 A;  2YUS A;  2IBD A;  1HOM A;  2VKV A;  4MO7 A;  1R9T J;  2HI3 A;  5F0H A;  2E2I J;  2HXO A;  3BR1 A;  2MW8 A;  3A03 A;  1IC8 A;  1U8B A;  5F08 A;  2ELK A;  3GTJ J;  4W97 A;  4XIC A;  4DZJ A;  2AHQ A;  2RAE A;  2XGD A;  2XPV A;  3GTL J;  1Y1V J;  5FKO A;  3CMY A;  2JN6 A;  4L5E A;  1ZQ3 P;  4Y52 J;  1SFO J;  1E3O C;  2ECC A;  5EZH A;  1Q1V A;  1X58 A;  2E19 A;  2CRG A;  1PUF A;  2DJN A;  2CUF A;  4UUS B;  1HLV A;  3H3V K;  4Y7N J;  2O9L A;  1ZTR A;  1JGG A;  1MBJ A;  1QRY A;  4QTR A; 
#chains in the Genus database with same CATH topology
 2OZ6 A;  1I27 A;  3RKQ A;  2L4A A;  1TQM A;  5IP7 J;  1TWH J;  4EJT A;  3KYD B;  2W4S A;  3GLL A;  2NVQ J;  3KEY A;  3CCQ I;  1JKO C;  1F9N A;  2ID6 A;  3QYF A;  3CTA A;  1I3A A;  2A68 F;  3BTL A;  5F1R A;  2VOO A;  1YIJ I;  1ETW A;  1UEL B;  2JVG A;  1R4M B;  4RM2 A;  4CZZ A;  3J80 Z;  2M34 A;  2CUZ A;  1FY7 A;  3S1M J;  3IV5 A;  5GAH J;  2COM A;  5CQE A;  1OLT A;  2WTE A;  4XK4 A;  3TDU C;  2PMH A;  3E0J B;  2DMP A;  3FXU A;  1HDP A;  1WWX A;  4X0G A;  3D1N I;  1JKP C;  1W5S A;  2VE9 A;  5J1U A;  3S2H J;  2L2O A;  4I0A A;  3TMO A;  2IVM A;  2BVM A;  5E1X A;  1TNS A;  1ZHF A;  2K3P A;  1DU0 A;  5FKK A;  1Y6I A;  4RS8 A;  1QPM A;  4BKX A;  3BR5 A;  3PFY A;  1DGW Y;  2Q2E A;  3S1R J;  1S7O A;  4RGX A;  3PM1 A;  5DEQ A;  4F7Z A;  2LRE A;  3I64 A;  3VEP A;  2IJL A;  4BXX J;  2FQ3 A;  4EGY A;  1T0F C;  1B6A A;  3WG7 H;  1OQY A;  1P4W A;  1IRF A;  5EYR A;  4HLX A;  2GZW A;  3S32 A;  4ETS A;  2L3D A;  3A0B C;  3RYP A;  3ELK A;  2DDA A;  2HYJ A;  1AA7 A;  3K4M A;  4C2T A;  2MGQ A;  2VBW A;  4HRI A;  1IDY A;  2DOE A;  4R1H A;  3FDY A;  1FSH A;  4YEJ A;  1MW7 A;  4YFN F;  4CCN A;  5IOZ A;  2F48 A;  1H0M A;  2IS1 A;  4UVA A;  3F8F A;  4DNC A;  1FT9 A;  2KIF A;  1GXP A;  4YRV A;  2K27 A;  4M3E A;  3RI4 A;  1APL C;  2XAQ A;  4KIF A;  4ZYE A;  4RLQ A;  3F8B A;  2DOD A;  3RKX A;  3D0S A;  4HV6 A;  1R1V A;  2JPB A;  2I8D A;  2K4J A;  3EDP A;  1JJ6 C;  2DFI A;  5D5U B;  2UZK A;  3GLX A;  3Q0V A;  3K70 C;  3Q3S A;  5FFZ A;  4B3X A;  5JI6 A;  3FXQ A;  2M0C A;  5HLI A;  5EGO B;  1RET A;  4J00 A;  4M74 A;  3OS1 A;  3K6G A;  3FHZ A;  3BQY A;  1WHU A;  4A5M A;  3G4S I;  3OL3 A;  1Z6T A;  1XSV A;  3FKI J;  3L00 A;  1LVK A;  4IEJ A;  4FT8 A;  5JFR A;  3PIO F;  2JSP A;  4A12 A;  2KLO A;  3LA7 A;  1W36 C;  2E60 A;  2PMU A;  1N78 A;  3KFW X;  4HDV A;  3PQK A;  2EZK A;  2JRM A;  2TRT A;  5DYM A;  3P9C A;  4XBF A;  2KRC A;  3BC8 A;  1ODD A;  3DQV C;  5M5W J;  4I2O A;  3KZZ A;  1VQP I;  2CJJ A;  2FXA A;  3NEU A;  5D4S A;  2CUJ A;  5DUI A;  2H27 A;  2BY0 A;  1NG6 A;  2NAZ A;  4BE1 A;  3QPT A;  2KZG A;  5HNH A;  4G6Q A;  3MVP A;  1OCO H;  2XC7 A;  2MA3 A;  1D8K A;  3CJQ B;  3Q5F A;  3EUH A;  1BA5 A;  4M6X A;  2XAF A;  3MN2 A;  1F1Z A;  3BJ6 A;  1RKW A;  1MJA A;  1LUJ B;  3KX2 A;  3K4N A;  1WKM A;  1ZGJ A;  4IQJ A;  4IOA F;  5J47 A;  4JX4 A;  2A6E F;  3E5Q A;  5LHG A;  3LSJ A;  1DPR A;  4E7L A;  1F5T A;  2DLL A;  2QKM B;  2FE3 A;  4NC6 A;  2RDP A;  5B3S H;  3K4B A;  4FE7 A;  2L01 A;  1GLN A;  2A61 A;  1VFC A;  4BQN A;  5B1A H;  1IN6 A;  4JOM A;  2VKD A;  3RKY A;  4CYC A;  3IWZ A;  2JZY A;  3MZH A;  5A2Q K;  3FK7 A;  3CO6 C;  2ID3 A;  1EH8 A;  3O2P E;  3KIO A;  3W2W A;  2IS6 A;  4LB5 A;  2WC2 A;  4BE2 A;  3OOP A;  2DMU A;  3DLL F;  3GFM A;  4WX9 A;  1X1B A;  4ENN A;  5HLG A;  1BJZ A;  4CIC A;  2OC6 A;  2LP0 A;  3I4M J;  1LDD A;  5LBQ A;  1FP2 A;  3GFJ A;  1FIP A;  3EPZ A;  4AYB A;  1SFU A;  4HOB A;  3HXL A;  1N25 A;  2VC1 A;  3AFH A;  2AS5 F;  1M1E B;  4XON A;  1ZG3 A;  3JRG A;  3I71 A;  2STW A;  4IZZ A;  4OIR F;  4WXD A;  5FD6 A;  2HQR A;  3B6C A;  4I7H A;  2IGK A;  2PMZ A;  4A3C J;  1UG2 A;  1TWC J;  3PQJ A;  4DZP A;  2LY1 A;  2HVR A;  2VJJ A;  4OIP F;  2DMN A;  4IPA A;  2ESN A;  2X9D A;  2GIV A;  4XKB A;  3EUK L;  5FRO A;  4BHP A;  3NRV A;  2FF4 A;  3K2A A;  3U9G A;  1SC7 A;  2EH3 A;  4KIC A;  1IUF A;  2N8G A;  2G0E A;  2MG4 A;  2Q2E B;  4MIM A;  2XF6 A;  2GXG A;  2R7T A;  3WTU C;  2X6Y A;  2WWY A;  4DBR A;  4CCK A;  4G6D A;  5TJJ A;  3BG6 A;  2QCO A;  2IT0 A;  4XKC A;  3D5R C;  1Q1H A;  3OYE A;  3BQZ A;  1B9M A;  4ZDP A;  2QLZ A;  2EBI A;  1HST A;  3LAJ A;  4L0Z B;  1W1W E;  1D5Y A;  2FJ1 A;  5IT3 A;  1D1A A;  4DOZ A;  3SEQ A;  1L0O C;  2ZXJ A;  2R5Z A;  3PSF A;  2O8K A;  3T1B A;  4E4H A;  5FB2 A;  1K78 A;  3TO7 A;  2OCE A;  2DW4 A;  1FTZ A;  2WBM A;  1USS A;  1R5H A;  3G73 A;  2P5K A;  1EH6 A;  1WJC A;  2D5V A;  1W0U A;  2XUB A;  4FAS D;  3J80 K;  4OIQ F;  1BW5 A;  2GWR A;  2ME0 A;  3BT9 A;  1MJ9 A;  4NBQ A;  2CG4 A;  3QOE A;  5M5Y J;  1L3L A;  1KA8 A;  2FBH A;  3ZMV A;  1J9I A;  3L2Q A;  5CVI A;  2OV7 A;  3ECH A;  2XAS A;  4EQQ A;  1YX5 A;  5JVG F;  1Y39 A;  4IJA A;  3M4O J;  4G7O F;  3AL0 B;  2HYG D;  2XGC A;  4BEH A;  3K4C A;  2IP2 A;  4E7K A;  1F36 A;  3F3X A;  3FF5 A;  1E2X A;  1G8X A;  5J1Y A;  1Z3Y A;  1STZ A;  2MH9 A;  4HF1 A;  4ZZD A;  1YQA A;  2KHM A;  1IG7 A;  4YII A;  2A05 A;  1GDT A;  4AUX A;  4ZJZ A;  2D1V A;  1D3Y A;  3QU6 A;  3W3C A;  5ILV A;  5D5W B;  1A36 A;  1TT5 B;  5DCM A;  3WU1 B;  2I5U A;  1SD6 A;  2WAD A;  4MGR A;  4HDU A;  1DPU A;  1EF4 A;  1HXD A;  4LG3 A;  1XDU A;  2G7U A;  4PJJ A;  3REO A;  1ZRD A;  5DM7 F;  4PFP A;  1DDN A;  2UV1 A;  3W6V A;  1W7P B;  2IAI A;  3H0G J;  2MD0 A;  2OZU A;  5C4X J;  3WE2 A;  4OOI A;  3WTT C;  1ORK A;  2K40 A;  2VAS A;  1ZKG A;  2P6T A;  2NS7 A;  1UMQ A;  3J7A Y;  1VQN I;  2MD5 A;  3LQQ A;  1FX7 A;  2BYV E;  2JJ7 A;  5H20 A;  2XB5 A;  1FOK A;  3S1N J;  1W5T A;  3A1Y A;  5EF6 A;  2M8G X;  5FLX Z;  4HNU A;  3LSI A;  1MNM C;  3RSN A;  1Y8Q B;  2LY2 A;  3DU6 A;  1YLF A;  3CZ6 A;  4WF2 A;  2LBF A;  4ZYG A;  2EWN A;  4L9J A;  4AVZ A;  1MSF C;  4BAC A;  3L09 A;  5LHI A;  1HA8 A;  2JTV A;  4I09 A;  2M5W A;  1TNT A;  4CYC B;  5F0F A;  2NNN A;  1IN7 A;  3S2D J;  4K2E A;  3C18 A;  1VND A;  1UFM A;  4LMY A;  4DBQ A;  3E6C C;  3DPL C;  3FXR A;  4IHS A;  1BM9 A;  4IOC F;  3GTK J;  4AWX B;  2YU9 J;  2M7B A;  2OA4 A;  1FBQ A;  4BBR J;  3SDG A;  3F23 A;  2JK3 A;  1O4X A;  3AL0 C;  5JHF A;  3BPV A;  5BNG A;  1WPK A;  3ASO H;  4FX0 A;  1YOV B;  2GOM A;  1TC3 C;  3EUA A;  1G3W A;  4CO8 A;  4CXF A;  3HEF A;  4O5V A;  4JBA A;  1SD7 A;  2CWE A;  1U5T A;  4A3E J;  2KIM A;  2LH9 A;  2XHK A;  1PVE A;  2DPU A;  1ENH A;  1G4D A;  3CJT B;  4EJU A;  3OWT A;  2KJB A;  4OMY A;  1O57 A;  4HX7 A;  1J7K A;  2GA1 A;  3KEO A;  3O6B B;  3FXO A;  2XAH A;  5DDG A;  4Q47 A;  2LY9 A;  1IRG A;  2XAG A;  3QRF F;  4MQV A;  3MEX A;  1RES A;  3PSI A;  1ETX A;  3PO2 J;  1HW2 A;  4IRH A;  2RKH A;  2O03 A;  3S3O A;  4M73 A;  1KU7 A;  1WFX A;  4XQF A;  1JTX A;  3ZQF A;  3CCR I;  2GBY A;  4OMZ A;  3HSR A;  4RMN A;  3E6D A;  4C3I J;  4OWR B;  1B1B A;  2ADU A;  2Q1Z B;  1V5G A;  1XSX A;  2EV0 A;  2X6O A;  2NS0 A;  1QNT A;  3BLY A;  4HYE A;  2JRT A;  4UUV A;  3WGI A;  1P4A A;  1SVO A;  1V5F A;  1WCM J;  3OR2 C;  4CZC A;  1J75 A;  2L7F P;  4P96 A;  1FLI A;  3DKW A;  4Y4R A;  3FK6 A;  3CO7 C;  3NAR A;  4JK1 X;  1HF0 A;  2XPW A;  2R5Z B;  2PI0 A;  4RAZ A;  1K78 B;  5EJC A;  2ACJ A;  3ABK H;  1K4T A;  4WWC A;  4MO7 A;  1VQ9 I;  3PL8 A;  2E2I J;  2CQ7 A;  3HPG A;  2ISZ A;  2MW8 A;  3WG9 A;  2QSH X;  2AQE A;  1U8B A;  1VQ4 I;  5F08 A;  1S5L C;  1FSE A;  2ELK A;  4W97 A;  5L3D A;  2HVS A;  2XPV A;  2X1D A;  1IXS B;  2ZNZ A;  5FKO A;  2JN6 A;  1ULY A;  1BIA A;  2C6Y A;  4Y52 J;  4D0P A;  2LNB A;  4B8X A;  1DQU A;  4MQ9 F;  4BEH B;  5HDK A;  2XV4 S;  5ICG A;  3E6M A;  4O6J A;  5B1B H;  2CRG A;  2H8W A;  1PUF A;  3D5S C;  2CQN A;  3HSE A;  2DJN A;  1Z21 A;  3I4P A;  1SVL A;  3EET A;  3L7W A;  3JTG A;  2E7W A;  2QUF A;  3FM3 A;  5DD8 A;  1DGR M;  1IO2 A;  2F4O B;  4M9X A;  1ZTR A;  2MC3 A;  2QA4 I;  1MBJ A;  1QRY A;  5DCM B;  3JAM K;  4JX5 A;  2R92 J;  2BY1 A;  2F5C A;  2OBP A;  3VOE A;  2BHZ A;  1MSE C;  3M1C A;  5E8G A;  2DYS H;  5EG0 A;  2UXX A;  4AVP A;  2LD5 A;  2GOX B;  2L54 A;  3V8L A;  3HOZ J;  1F43 A;  3SZG A;  3KZY A;  1O3Q A;  3UNG C;  4HNV A;  4ZH4 F;  3CDL A;  3G71 I;  1B72 B;  1R6R A;  3HRM A;  1FYK A;  2A69 F;  1ZGW A;  5HOD A;  1KON A;  4ENM A;  4LIV A;  1P9Q C;  2WAE A;  3H9G A;  3FX3 A;  4B09 A;  2VBX A;  3ZMZ A;  4P1W A;  5IPA A;  2CYY A;  5HOO A;  1TZL A;  3DBH B;  4WK8 F;  1J0R A;  1VQO I;  1EH7 A;  1W5C C;  4XLA A;  2KL4 A;  3RZD J;  1Z05 A;  3K9T A;  3Q9V A;  4XN0 A;  4XRS A;  3OYJ A;  5HS7 A;  4OIN F;  3HOY J;  1IJW C;  2LBF B;  3FBN B;  4RDU A;  1UHM A;  3OYM A;  3MCZ A;  4EM2 A;  1UST A;  3AG3 H;  3ABL H;  1JHH A;  1X4O A;  1KZH A;  2VIX A;  1S29 A;  4B47 A;  3ZQ7 A;  1A6I A;  1K4S A;  2RNG A;  1GV5 A;  3BTI A;  3HOV J;  3GUD A;  1RUO A;  1TWG J;  1BIB A;  1S7E A;  3JCU C;  1SFE A;  1LFB A;  1UAA A;  2LFB A;  2QKL B;  4BE0 A;  2HDD A;  4AID A;  4XKW A;  5FLM J;  5FLV A;  4CCM A;  1RR8 C;  3R6S A;  1XB4 A;  1TT0 A;  5LRR A;  2PJR A;  2JMW A;  2FEZ A;  1RI7 A;  4M3B A;  3RYR A;  3KET A;  1BJA A;  5JLX A;  3LL7 A;  2O61 A;  3CUQ B;  2QM3 A;  1T8I A;  3DPU A;  2EV5 A;  2QYO A;  2O7O A;  3HPH A;  1YYV A;  1MDM B;  1BI0 A;  3K4K A;  2HZT A;  4PJM A;  2VUM J;  2A5W A;  2VLA A;  2QSG X;  1FTT A;  5KNL A;  5D5X B;  3LFK A;  4BNC A;  3IWF A;  2R7F A;  1K6Y A;  4HQM A;  3H36 A;  3GFI A;  6PAX A;  3TDZ C;  2ZME A;  2K02 A;  4BHB A;  1JT0 A;  4M6Y A;  1MMG A;  3ZP5 A;  2QF7 A;  1O7L A;  3CES A;  3ZR8 X;  4FTH A;  2W82 A;  4GRI A;  1I39 A;  2HVQ A;  2Y0S A;  5FLX K;  4KJZ A;  4RLF A;  3WHC A;  3VB2 A;  2V26 A;  2BXY A;  1YW7 A;  3LSM A;  2VQH A;  3OIP A;  2JSC A;  3N4M A;  3HKZ A;  3V8J A;  4MEX F;  3LSR A;  2V6C A;  2CV0 A;  3D5L A;  2MLG A;  2R7R A;  3V42 A;  1UB9 A;  3CP2 A;  1XTA A;  5J8C A;  2VQG A;  3VOD A;  2Y9Y A;  2GXA A;  9ANT A;  4AIH A;  2KQR A;  3ZPL A;  2ETH A;  3CCM I;  2KT0 A;  4UB8 C;  1LNW A;  2W1O A;  1DU6 A;  1P7J A;  2V79 A;  4KN4 X;  4D5F A;  2L9N A;  2VKE A;  3EYI A;  4A69 C;  2IEK A;  4FIS A;  4UV9 A;  1G3S A;  5LEJ A;  1VQK I;  4LLN A;  3OYI A;  4BQQ A;  4KMF A;  1MMA A;  1VTN C;  1X3Z B;  3OY9 A;  1PP8 F;  2BXZ A;  4ZC3 A;  3M8J A;  3W6K B;  3JRH A;  4J01 A;  4BJ6 C;  1R00 A;  2V1N A;  3JTH A;  4XLE A;  1U8R A;  4N4N B;  5LHH A;  5TIS C;  1T56 A;  3K1P A;  1VQ8 I;  3SYT A;  2L9V A;  5DTD A;  4WCG A;  4AC0 A;  1YRN A;  5E17 F;  1QHG A;  3U2R A;  1U6G A;  1NH3 A;  3ZXS A;  3J7A O;  5M5X J;  1T33 A;  1PUF B;  3K2Z A;  1Z91 A;  3CUQ C;  4NNJ A;  1N77 A;  4E7Z A;  1XCB A;  4M71 A;  3HOU J;  2R7Q A;  3HJE A;  3K4J A;  3HYI A;  4NUB A;  4PSX A;  3RTR A;  3P9K A;  3MZ8 A;  2HXI A;  4BL0 B;  1D5V A;  4I99 C;  4XSZ F;  5BPI A;  2X51 A;  2Y2Z A;  2F5V A;  2P81 A;  4GO1 A;  3CCJ I;  5EG0 B;  3LSP A;  4RGU A;  2QGU A;  1H9G A;  1RR7 A;  1D0Z A;  5LGU A;  1SAU A;  3Q0W A;  4A3B J;  1B59 A;  2AXL A;  3BZC A;  3ZMU A;  4EEF G;  1S7A A;  3DEE A;  4BGD A;  1SD5 A;  4U0V A;  2P0W A;  2BW3 B;  4NQW A;  3M07 A;  1WJD A;  2M8E A;  3QPS A;  1CGP A;  4LJZ F;  1C0W A;  1CQT A;  3HDD A;  3CCV I;  2EA4 A;  4GCV A;  2R7X A;  2ZKZ A;  5KVR A;  3FWE A;  4EAT A;  1FIA A;  3L2R A;  3LST A;  1LE8 A;  2LG4 A;  5D6E A;  1MH3 A;  1IRX A;  5C44 J;  4XRM A;  3BWG A;  5GAG J;  4MEY F;  4M3F A;  2EK5 A;  4XLF A;  1OR7 A;  3DFG A;  1Y0N A;  1Y0U A;  2BVL A;  4B3A A;  2QWW A;  4A93 J;  5C4J J;  1Z1D A;  3BY6 A;  4GXO A;  3R4K A;  4PGG A;  2DTZ A;  2RNJ A;  2WV0 A;  2E2H J;  3BR6 A;  2A6H F;  1YIO A;  2X0L A;  2OTJ I;  1BN5 A;  3JRD A;  1R7J A;  4BYY A;  4IHV A;  4QWQ A;  3CUO A;  3SHF A;  2A5Y B;  1PDN C;  1OFC X;  2E71 A;  4Y33 A;  4U88 A;  2BEO A;  2VXD A;  3MWM A;  2X1E A;  2BGC A;  2BE5 F;  4E70 A;  2PJR B;  1WH5 A;  2OD5 A;  4N0B A;  2KPM A;  4ZYH A;  5LEK A;  3QPH A;  2MLK A;  4IXA A;  2PQ8 A;  3K10 A;  2H6C A;  1B4A A;  4RAY A;  4B43 A;  1ZLJ A;  3OYH A;  1QA6 A;  2Z3Y A;  2ZME B;  4C3H J;  3GFL A;  4LG0 B;  1Y8R B;  2ZCW A;  4MTD A;  3H0D A;  4A2U A;  1YG2 A;  2E1O A;  3BZK A;  2K9N A;  2YS9 A;  4RB1 A;  2ZO4 A;  1E3H A;  2AO9 A;  4CA0 A;  1X19 A;  2B7E A;  5GP9 A;  2M4K A;  4E7J A;  3OMY A;  2QSF X;  2DDB A;  2ZFU A;  1FYM A;  1BI3 A;  1WJF A;  2K9S A;  1IN8 A;  2ESH A;  1I6H J;  3JSO A;  1W36 D;  3VFZ A;  3BTJ A;  1UZC A;  2CS3 A;  3HSF A;  4A3K J;  3X2Q H;  2DA7 A;  2IW5 A;  3CCS I;  3OSF A;  5GPC A;  3WTS C;  3R0A A;  2EFW A;  3G1L A;  3KP7 A;  4Q48 A;  1KYW A;  2HGC A;  3V7S A;  2OAZ A;  3W6J B;  5C3E J;  4NHJ A;  2RC4 A;  2P5L C;  1KU9 A;  3ZN1 A;  5J8F A;  1MBE A;  5H6Q A;  3TOA A;  2ICW G;  2ZXI A;  1KQ9 A;  1ITY A;  2M7A A;  5F27 A;  4QPO A;  4KN7 X;  2HWV A;  3S3N A;  2KMU A;  2IGO A;  1H89 C;  1FJL A;  2BY2 A;  1IAW A;  4HEA 2;  5BS6 A;  1I50 J;  3B6A A;  5J1R A;  2IS4 A;  2XRO A;  3S2W A;  4ZDL A;  1XDS A;  1ZR4 A;  2ZJ2 A;  2QQ8 A;  4F55 A;  4IHT A;  3ZOB A;  1MMD A;  2OJE D;  3WGH A;  1JKQ C;  1Y56 A;  4A3F J;  2Z2S B;  4ABZ A;  1D0Y A;  1YRN B;  2DT7 B;  3C2H A;  4XRS G;  1BR2 A;  2WB1 A;  2XAJ A;  2EZH A;  2ZSH B;  2MSY A;  1RKT A;  3DCF A;  1R49 A;  2JT1 A;  3ABU A;  4IRI A;  3DTI A;  3KP6 A;  2NS8 A;  3TOB A;  2DCE A;  5IOY A;  1W0T A;  1H88 C;  2XKO A;  2XF7 A;  4BAY A;  3IRQ A;  3FIW A;  3OYB A;  2YX4 A;  1J09 A;  3IAM 2;  2YPR A;  3J7Z I;  4AM3 A;  1I1S A;  2L7Z A;  1VQ7 I;  4XLC A;  2NOJ B;  1VQM I;  3I54 A;  3DKY A;  5FKN A;  3FMQ A;  2W00 A;  3HGG A;  2VC0 A;  4XOP A;  5K5Q A;  3HOT A;  2Y0S N;  3DBL B;  2GM4 A;  4ZYD A;  4NQW B;  2EFP A;  1KGS A;  1OCP A;  2WY7 Q;  3LNQ A;  2CW8 A;  2RQP A;  1RC9 A;  2P6S A;  1QBJ A;  5CYV A;  1HKT A;  3K7A J;  3JAM Z;  3Q9S A;  4IHX A;  1LE8 B;  2EA2 A;  4N4O B;  4HV5 A;  3EQL F;  3HM5 A;  1WJA A;  3FHN A;  5J6X A;  2V9K A;  4JYK A;  4BBS J;  3BR3 A;  4PJL A;  3ZQL A;  4NC7 A;  2W7N A;  3MKL A;  4UNO A;  1P4X A;  2H1K A;  5F64 A;  4EV0 A;  2LKS A;  2KIS A;  5M3F J;  2H6B A;  5ICF A;  5HNF A;  3JRB A;  5K5R A;  5HS8 A;  2HDC A;  2BY3 A;  2KIQ A;  2FD5 A;  1MND A;  4OAY A;  4RB3 C;  3ROU A;  2HEO A;  3K1N A;  3WTX C;  1R71 A;  2DOF A;  2XPU A;  2UWM A;  2IGM A;  4R79 A;  5LFA A;  1TLH B;  4MNU A;  2DN0 A;  1WGX A;  4YFX F;  4L0Y B;  2VJ4 A;  1YFH A;  2F2E A;  4MFE A;  2HOE A;  3OS0 A;  5KK1 A;  1LB2 A;  4FX4 A;  2LLK A;  4V2F A;  2ZJP F;  5D5V B;  5EZG A;  2V9P A;  3I3L A;  2B0L A;  2QZ8 A;  1MZB A;  2YUS A;  3GXO A;  1R9T J;  1ERD A;  3C7J A;  3BR1 A;  3CCU I;  2BBY A;  1IN4 A;  3M9A A;  2K5C A;  3GW2 A;  2AHQ A;  3GO5 A;  3RJP A;  2HYF A;  1IV8 A;  3CMY A;  5L3G A;  1XSD A;  1V3F A;  1JI8 A;  3TO6 A;  3KYL A;  3QP6 A;  2ECC A;  2X6X A;  5EZH A;  1Q1V A;  4G7H F;  2IA0 A;  3CME I;  4EGZ A;  1WSU A;  1REP C;  2DO7 A;  2J5P A;  4CCJ A;  2QEX I;  3QP5 A;  4CSW A;  2VB6 A;  2IPQ X;  2E1M B;  1HLV A;  2XRN A;  2NVU B;  1U3E M;  5TGT A;  3LA2 A;  2O9L A;  3PNV A;  2F5F A;  1JGG A;  3CC2 I;  1YS7 A;  2E7X A;  1LJ9 A;  2FMY A;  2NVT J;  3MKY B;  3C3W A;  4V2G A;  1JKR C;  1E17 A;  1G59 A;  3IKT A;  3VSK A;  3L9F A;  2ECB A;  2M0M A;  3ECO A;  3E6B A;  1HQC A;  3RPU A;  4WXC A;  4PGH A;  1XG1 A;  1T6S A;  1GVD A;  3IKV A;  2CSO A;  2JA8 J;  1QZZ A;  1Z7L A;  1RNL A;  2K9M A;  1FMV A;  2JUC A;  2QEN A;  3CF5 F;  1ZG5 A;  2MH2 A;  4UVC A;  1T2K A;  5IT9 K;  4EJV A;  3I56 I;  3HOX J;  4I6Z A;  1XC5 A;  3OYF A;  2OU2 A;  3ABT A;  2VQC A;  4PJ0 C;  3FMR A;  1HKQ A;  5JR3 A;  1XPX A;  2BOL A;  5CKT A;  2EIL H;  1FNN A;  1P6R A;  5F0C A;  5JLW A;  2KIU A;  3OS2 A;  2HKO A;  3TBI A;  3BTC A;  1JUS A;  1X1A A;  2HZD A;  1B9N A;  5LLQ A;  4HST A;  5HVQ C;  2KDZ A;  2CQX A;  2R93 J;  1IUY A;  1BI1 A;  2MC4 A;  1BR4 A;  3WHB A;  1WI3 A;  3CF2 A;  3O8H A;  1VI0 A;  3HRU A;  1XX5 A;  3TW7 A;  1LVA A;  2EV6 A;  2ZJR F;  4GDF A;  3CMM A;  2M87 A;  2M45 A;  2HPI A;  4V19 K;  1AOY A;  4XLN F;  3OYD A;  2RVC A;  3COA C;  4DGW B;  2DA1 A;  2Y9Z A;  1O3T A;  4XID A;  3OSG A;  2HOT A;  4UXN A;  1VQ5 I;  4LIU A;  1ETV A;  4OAZ A;  3H3Z A;  4P5O A;  2A07 F;  3VYU B;  4PK4 A;  3VDX A;  3B02 A;  1LPQ A;  1FMW A;  3GZ5 A;  3TW6 A;  3FXM A;  2LVS A;  2FNP A;  2A3S A;  3EUH C;  4NC8 A;  2ZXH A;  4Y15 A;  1I3Q J;  1SAN A;  3OYA A;  3QAH A;  3K69 A;  4ZYA A;  1U9N A;  3I55 I;  1EKE A;  2KRH A;  1BI2 A;  5IP9 J;  3ZMT A;  5B66 C;  3Q0U A;  2DU9 A;  4AIK A;  1OIS A;  5AON A;  1S9H A;  2FU4 A;  2VQL A;  1WRJ A;  1SFX A;  1BC7 C;  2ZXW H;  2EIN H;  3S8P A;  3JRA A;  2KJC A;  4A0Z A;  2EIJ H;  3DP7 A;  2ZC2 A;  4JX6 A;  4LLL A;  2L02 A;  3RKW A;  4XN3 A;  5F04 A;  1Z7U A;  3I9V 2;  1K83 J;  2XSD C;  1NHA A;  1RUN A;  2DT5 A;  1S3J A;  1U2W A;  1DP3 A;  1MBF A;  1U9O A;  4IHY A;  4KIG A;  1T0F A;  1I5Z A;  3F8C A;  1BBY A;  1K79 A;  3V7R A;  4RGS A;  2RGV A;  1WJ5 A;  5K7Z A;  1GXQ A;  4N9I A;  1MNE A;  1ZN2 A;  3GWZ A;  3A01 A;  3QOP A;  4RGR A;  3L2W A;  1X1P A;  3M1E A;  4HG2 A;  2WB1 N;  3KP4 A;  1CF7 A;  4WXH A;  3M3Y J;  3H5N A;  5E3L A;  4HW0 A;  1D0X A;  3ONQ A;  2VOP A;  3BG3 A;  4RB0 A;  4AYB N;  2PG4 A;  1JUM A;  4G6T B;  2BZT A;  2GLO A;  4ESF A;  1XGS A;  2LF7 A;  3UR3 C;  4Q5S F;  1G6N A;  2O0Y A;  1VZ0 A;  3CD6 I;  2LR8 A;  2XSJ C;  3ASN H;  3GTM J;  2H09 A;  1OPC A;  3QOD A;  3HUG A;  3UKG A;  3CC4 I;  4KNY A;  2PMZ N;  2VI6 A;  1MBK A;  3FZV A;  3BCA A;  4PCQ A;  3T0Y A;  2F5D A;  1P7I A;  3PUB A;  4Y3O A;  2CUE A;  4KDP A;  3O8G A;  2CW7 A;  4HZF A;  1YX3 A;  5JHU A;  4BJT A;  4ASN A;  3ERM A;  2ISY A;  2JWT A;  2I10 A;  3IC7 A;  2DFF A;  5CQG A;  4C30 A;  1EV7 A;  4ANJ A;  1R36 A;  3ZQG A;  3HHG A;  2VPL A;  5LGN A;  3A2K A;  2AQF A;  1TW2 A;  3GZN B;  3MZY A;  3SQN A;  3HRT A;  4D7M A;  2R7S A;  4X1E A;  5E1W A;  3OOU A;  2G9W A;  4I76 A;  3F9K A;  3DEU A;  4L9T A;  2P7C B;  3PNY A;  3K1M A;  2NVX J;  1JUP A;  3KYC B;  1T95 A;  1B8I A;  4PDK A;  1SD4 A;  1R1U A;  1QO0 D;  2K85 A;  3GZ6 A;  4CGZ A;  5E20 A;  2O5R A;  1E0E A;  3KZI C;  3NWS A;  5ILU A;  1WVR A;  5ED4 A;  1OMI A;  3OIO A;  4RM3 A;  3TKY A;  3ZQC A;  1LEA A;  5J40 A;  2D45 A;  1KQ8 A;  1R23 A;  2STT A;  3FIS A;  1HKS A;  2GAU A;  3J81 Z;  1J59 A;  4HQE A;  4LIT A;  3WTW C;  3AG2 H;  4W1U A;  3FMS A;  1MD0 A;  4IVN A;  1YHQ I;  5FKM A;  2EZI A;  1OJL A;  4KT5 C;  2RV8 A;  3HRS A;  4U0W A;  2NVY J;  1U5T B;  2AXT C;  3HB9 A;  2VPR A;  4F93 B;  2DA4 A;  4C2U A;  4KFC A;  1SMT A;  3H1C A;  2Z33 A;  4E7H A;  4LB6 B;  1X2N A;  1ZH5 A;  1T98 A;  1BW6 A;  4D7N A;  1MMN A;  2XGE A;  2Y31 A;  3PUF A;  2MYS A;  1VQL I;  4CHU A;  2E1C A;  1V4R A;  5KAI C;  2E1N A;  4EJW A;  2OCC H;  3S93 A;  5LGT A;  4E7S A;  1A5J A;  1A35 A;  3GCM A;  3JSP A;  1HC8 A;  3CDH A;  3PNT A;  4XMY A;  1LKX A;  2OPT A;  4S05 A;  2H8R A;  2DFH A;  3RPQ A;  2LF8 A;  4RB2 C;  4XM3 A;  3CJR B;  2KFD A;  1TWF J;  4KA4 A;  3F0C A;  4BQA A;  3RPU D;  2DQR A;  5FRN A;  4KT6 A;  4XKV A;  4Q4Z F;  4RBO A;  1NK3 P;  3QQA A;  1DUX C;  4ESB A;  2W84 A;  2L9R A;  3HGY A;  3WOD F;  5M3M J;  5GTI C;  2XB0 X;  1LDK B;  3IRR A;  1ETQ A;  1LFU P;  2VXZ A;  4A0Y A;  3ZGK A;  5E18 F;  1YIT I;  1J5Y A;  4EJO A;  3BR0 A;  2R4G A;  5B5E C;  4UHT A;  3MMY B;  3T8T A;  2DMT A;  2HS5 A;  1S72 I;  4EM1 A;  4CCO A;  3GVA A;  4PZJ A;  1QU3 A;  3S3M A;  1JJ8 C;  3BPX A;  3WTY C;  1QVT A;  4EVI A;  2X1C A;  4J19 A;  2FRH A;  2KRF A;  2WV1 A;  4D1Q A;  5ICE A;  3CC7 I;  1JE8 A;  2DTR A;  1ETO A;  2DK8 A;  2WA0 A;  3A01 B;  2Z16 A;  1HDD C;  2R7O A;  1QPI A;  1TP4 A;  5GAE J;  4O3M A;  2IXS A;  2A6T A;  5FGM A;  3ZQH A;  2B9S A;  2XGX A;  2V1X A;  5K1Y A;  1CF7 B;  1U5T C;  2DAO A;  2HR3 A;  1R5I D;  4DYR A;  1BC8 C;  5KHD A;  3HZJ A;  3AAF A;  1FPQ A;  3CP8 A;  3MD2 A;  4U7B A;  2Z1D A;  3FBI B;  3QPL A;  2JVH A;  1U0J A;  5TRD A;  2LRD A;  4ON0 A;  3W2A A;  4M6V A;  4GFB A;  3HUG B;  4A3G J;  3JRE A;  2PJP A;  3A02 A;  5EDN A;  1J2X A;  2DA5 A;  2PFB A;  3VPR A;  4QPQ A;  1IGN A;  2QVO A;  5CVU A;  2QQA A;  3BZ6 A;  3L2V A;  2VBY A;  4HA8 A;  5E79 C;  4BY7 J;  2R7W A;  2Y75 A;  3M7G A;  2KDO A;  2DOA A;  4HSR A;  4II3 A;  1FOX A;  1HCR A;  2PEX A;  5K7H A;  3IH4 A;  5F6F A;  2E36 A;  3W2V A;  1Z77 A;  2MAB A;  2VKH A;  3SFI A;  2L0K A;  2XRL A;  5J4V A;  5CPR B;  1WQ2 A;  3RZO J;  3MKZ A;  2Y30 A;  2EPF A;  2NXN B;  2JPC A;  2M2E A;  2DA3 A;  1WI9 A;  5EEG A;  3IH3 A;  3G6E I;  3G1M A;  2V4J C;  4RAG A;  2EIK H;  2NNY A;  3BR2 A;  3DPT A;  4HPQ A;  3DTK A;  1B8I B;  2E5N A;  4A3L J;  1GUU A;  2WY8 Q;  1R4N B;  3F6O A;  4B1R A;  1RIO H;  1ZRF A;  1OCZ H;  1ZRC A;  2K9L A;  2DMQ A;  2O6G E;  3GTQ J;  2RN7 A;  1TBX A;  2XIG A;  3TGN A;  3SJM A;  3OV8 A;  5L3B A;  1ZEL A;  3SFZ A;  3P9I A;  2D2W A;  1ZK8 A;  2K9Q A;  1T38 A;  4CCL A;  1Z6R A;  1X4P A;  2W85 A;  5CJ9 A;  4OIO F;  2VJ5 A;  2YR2 A;  2CQK A;  2LMD A;  3DXJ F;  1NTC A;  4XOR A;  4HLY A;  2B63 J;  1WH7 A;  2ELH A;  4A3I J;  3TO9 A;  2DA2 A;  3CCY A;  2RQQ A;  2Z5U A;  2HDW A;  1FOW A;  4MHG A;  2XF5 A;  3E7L A;  4A6D A;  5IT9 Z;  3K70 D;  2HFH A;  3IH2 A;  4A3M J;  1FOY A;  4IL6 C;  2W57 A;  3BCB A;  2QQB A;  3E5U A;  4LLG F;  3F8N A;  3GX4 X;  2YX7 A;  3I59 A;  2P7V B;  5CLS A;  1ZR2 A;  4FET A;  3KLN A;  1X3W B;  2ZB9 A;  3ZMS A;  3DLA A;  1UG0 A;  4BDY A;  2TCT A;  3C2B A;  1GVJ A;  1S6L A;  4KMU X;  4DYC A;  1A04 A;  2JA5 J;  2FBK A;  2HTJ A;  2XAU A;  3F72 A;  4DQ2 A;  4H4K C;  4OU0 A;  3LSH A;  3F21 A;  4KYW A;  1JGS A;  2WAF A;  1D1C A;  2HI3 A;  3T5X A;  1HW5 A;  3MAJ A;  4FQG A;  4L5J A;  4ENK A;  2K4B A;  3RDI A;  5H6R A;  3LA3 A;  2OUM A;  3HTS B;  5LD2 C;  4ZDO A;  3GTJ J;  3IAS 2;  2K7L A;  2V7F A;  1ZRE A;  3GTL J;  2VBZ A;  3IHU A;  4U87 A;  3KCC A;  3BG7 A;  5AIQ A;  1ZQ3 P;  2KP6 A;  3J81 K;  3DV8 A;  1XGO A;  1YS6 A;  2E19 A;  2M1B A;  1IZ1 A;  1W7P A;  4E7I A;  3F22 A;  4BS9 A;  3CDI A;  2QBY A;  2CUF A;  2O3F A;  1XGN A;  4Y7N J;  1KU2 A;  3QWL A;  2FA5 A;  1OYY A;  5DCF A;  2DYR H;  2PBI A;  3I58 A;  5LRS A;  4XRF A;  2DQL A;  2F5E A;  4QTR A;  1TL8 A;  4A0X A;  3OL4 A;  2CV2 A;  2R7U A;  3H5R A;  2Z99 A;  5HLT A;  2GA2 A;  1LQ1 A;  3ISP A;  3E5X A;  3KLO A;  2X48 A;  3GYH X;  4HX8 A;  3T8R A;  3WGG A;  5E3O A;  2W48 A;  1UJ8 A;  3ESW B;  2CH0 A;  4P9F A;  1XMA A;  4PUS A;  5KCM A;  1ZAO A;  3U1K A;  3OIQ A;  4ESJ A;  2LKX A;  3LFU A;  4A3D J;  1R58 A;  1V55 H;  4I0B A;  2L5Q A;  1UCR A;  4MTE A;  2QQ9 A;  2TDX A;  1XN7 A;  4B48 A;  4QIW N;  4A5N A;  1X2M A;  1MH4 A;  1SVM A;  3R0J A;  5E3N A;  2GQQ A;  2IRF G;  5D6F A;  4IRG A;  3BG9 A;  1E3P A;  2E35 A;  2ZME C;  3QYB A;  2MFZ A;  3IUO A;  1K61 A;  3S1Q J;  5D8K B;  3G1O A;  3WTV C;  1XGM A;  4LOC A;  4XR6 A;  1VQ6 I;  3I53 A;  2X4H A;  3B73 A;  3LSG A;  3GEZ A;  4BH9 A;  2V1D A;  2HOS A;  5HDN A;  2FBI A;  3NWT A;  5ILS A;  3N97 A;  3PJR A;  2R0Q C;  4CUG A;  2Y48 A;  4BJ5 C;  4RA2 A;  1BL0 A;  4CH7 A;  3ZRG A;  4XLP F;  2Z9O A;  3HKZ N;  2K3F A;  1EA3 A;  1IXC A;  1XCV A;  1LDJ A;  3NAU A;  3FXK A;  4CYD A;  1MGT A;  1UHS A;  2VE8 A;  5HDG A;  4C2M J;  2DJI A;  1XD7 A;  2FOK A;  1Z3X A;  1QZE A;  4AD9 A;  3E97 A;  3GTO J;  2RRE A;  1ON1 A;  5ERI A;  1GV2 A;  4M9S A;  4DIQ A;  2DFE A;  2CV1 A;  5E8I A;  2P4W A;  3VYS B;  4N9H A;  4U7D A;  2VT2 A;  1PJR A;  2VON A;  2LYC A;  3LWF A;  4IF4 A;  3K0L A;  4MLO A;  1FBS A;  2LDU A;  1GT0 C;  3N05 A;  3HTU A;  5FRM A;  3DEW A;  2P8T A;  4KIS A;  3ULQ B;  4BDZ A;  1QZY A;  2CW0 F;  3RQ4 A;  3ZMD A;  2CO5 A;  1Y1W J;  2UUZ A;  2R5Y A;  3V7C A;  1ACI A;  1HW1 A;  1RPW A;  3ABM H;  2V6E A;  1O7F A;  4UV8 A;  5IY5 H;  5DM6 F;  2X6W A;  2EJR A;  4S0H B;  2VL8 A;  3U1D A;  3CCE I;  5GPA A;  1FC3 A;  4GYI A;  2DT6 A;  4BU2 A;  2R7Z J;  1IDZ A;  1Z9C A;  2YSR A;  4D9J A;  4TV7 A;  3H5A A;  2ZSI B;  4M3D A;  5BMZ A;  1AU7 A;  2K86 A;  4F92 B;  4BY1 J;  3L2U A;  5L3E A;  4ZZL A;  4Y13 A;  1Z67 A;  3LQR A;  2V9V A;  4G12 A;  4HX4 A;  3DF8 A;  3KP5 A;  1PP7 U;  2LOO A;  2FOW A;  3NQO A;  5FFX A;  2WAQ A;  1EJ9 A;  3WU0 A;  5GAD J;  2ZBK A;  3JR9 A;  3A0H C;  3I59 B;  2R3S A;  3FXL A;  2HTS A;  1N75 A;  5D8L B;  3HHH A;  3R61 A;  5IYB J;  3CMA I;  1IW7 F;  2OF7 A;  3K4L A;  1XMK A;  1U78 A;  1QGP A;  1YW8 A;  2W24 A;  3SZP A;  4FE4 A;  1X1C A;  1KU3 A;  5KAF C;  1RZ4 A;  3A4C A;  2BHY A;  2XVC A;  4FCY A;  1O3S A;  2LC2 A;  2LKP A;  3ZCO A;  4E6K G;  2HKX A;  4DYQ A;  4IHW A;  2PLY A;  4G94 A;  4ZTJ A;  3OYK A;  3H9J A;  2DXI A;  4KIB A;  4B4C A;  3AG4 H;  4HF2 A;  3GTG J;  5K7F A;  1LFP A;  1LEB A;  3TP0 A;  2LK2 A;  3AG1 H;  1OR7 C;  2L9S A;  3HIF A;  3I0T A;  4XL9 A;  1G3T A;  5DUK A;  4QLC U;  1B72 A;  3V8K A;  3BJO A;  3ZN0 A;  2CQQ A;  4YEL A;  2YU3 A;  3HC7 A;  2QBY B;  5L3F A;  1FZP B;  3P7N A;  5L3C A;  3LAP A;  4IQ4 A;  2HPM A;  4II2 A;  1FP1 D;  1YI2 I;  1MKM A;  4QSH A;  3OYG A;  5D4R A;  4KIT B;  3V4G A;  4P55 A;  1ZYR F;  4BXF A;  3RIR A;  1G2H A;  1ETK A;  2VN2 A;  2FML A;  3S16 J;  2EIM H;  1PYV A;  1P2F A;  1YJN I;  3E1S A;  4D5C A;  1RRJ A;  2E2J J;  1WJB A;  2CU7 A;  3FKJ A;  5E3M A;  3DBR B;  1DP7 P;  3H92 A;  5J3L A;  1BOB A;  4I02 A;  2DA6 A;  4GGG A;  1ZAR A;  2LSO A;  2NOG A;  3JRI A;  1BOA A;  1FBU A;  1OYW A;  2ZJQ F;  4EMS A;  3U21 A;  3KPH A;  3VYR B;  5DV5 A;  3J7Y J;  2W25 A;  4NB5 A;  4BQO A;  3S17 J;  2Y0M A;  4C3J J;  2JA6 J;  3L2C A;  5FO5 A;  1T08 B;  3CUQ A;  1XMX A;  3MKW B;  3KEQ A;  2KZV A;  3EYY A;  2R7V A;  3TP3 A;  2ZNY A;  2E1M C;  1MDM A;  3OYC A;  1IV6 A;  2VJI A;  2Y69 H;  2EB7 A;  3BG5 A;  4F52 A;  4F91 B;  4IO9 F;  1D8J A;  2M9H A;  4ENJ A;  3BJA A;  4GYG A;  3OYL A;  1W7P D;  5IYC J;  3I5U A;  1JTY A;  1V54 H;  3QU3 A;  4YIF A;  4UB6 C;  2F4M B;  2PX9 A;  1IRZ A;  3AKZ A;  3F8M A;  1F4K A;  5BOX A;  2HQN A;  5FKL A;  4A6E A;  3PO3 J;  3S15 J;  2DBB A;  1AKH A;  1OCC H;  3DTE A;  2R7D A;  3CLQ A;  3WE3 A;  4X6A J;  4L9N A;  3G2B A;  4YFK F;  2XDV A;  2HQA A;  1IXR C;  4HBL A;  2ME6 A;  2D1H A;  3H3U A;  2VOD A;  1JXS A;  4DW6 A;  1MMS A;  4C9Y A;  2R5Y B;  4S04 A;  1YJ9 I;  3C2G A;  3FM5 A;  2ZFW A;  1X3U A;  4JP0 A;  2G7H A;  5IYD J;  4Y17 A;  1KQ0 A;  2EZL A;  2CGP A;  2MBF A;  1X1D A;  3CJN A;  4H0E A;  2PN6 A;  3F6V A;  4A3J J;  4M3G A;  2Q0O A;  1H9T A;  1OCT C;  1SMY F;  3LMM A;  4LD5 A;  5ICC A;  1ON2 A;  1P92 A;  2UXN A;  2GXB A;  1KYZ A;  3CLO A;  5H2F C;  4MFD A;  1GHC A;  4UUS A;  4F3Q A;  1D1B A;  2M3A A;  3S14 J;  3G3Z A;  2HQ5 A;  2LTP A;  2L7K A;  1A6Q A;  3IP4 B;  5BPD A;  4P9U A;  5JVT A;  4YG2 F;  1O3R A;  2ELJ A;  3BDD A;  4R8H A;  2NRA C;  1IF1 A;  1HSJ A;  2XKP A;  1AHD P;  2JQ7 A;  4UY8 I;  1Z0X A;  5CVV A;  3FXJ A;  2JA2 A;  2M4G A;  3HG9 A;  3CQZ J;  3PFI A;  3SDB A;  1OYI A;  3O3K A;  4G8X A;  2H94 A;  1K6O A;  2E5Z A;  1NG7 A;  5AIP A;  4L5I A;  4L9V A;  2X85 A;  1K7A A;  4I98 B;  2JUG A;  4I01 A;  3OYN A;  3H35 A;  3WTZ A;  3VYT B;  1BR1 A;  2FSW A;  3DKX A;  4PFO A;  3KE2 A;  2EFO A;  4BXU A;  2L4M A;  1VF9 A;  2F6C A;  5DS9 A;  3HL2 A;  1QVU A;  4Z2Y A;  4RAF A;  3BOQ A;  1MBH A;  4PSW A;  4AU7 A;  4G7Z F;  3RQI A;  4UUT A;  3KP2 A;  3WU2 C;  1R22 A;  3GTP J;  4IKF A;  2IA1 A;  1FYL A;  1ONV A;  2Q8K A;  4U0Y A;  2BW3 A;  2OQR A;  2HNH A;  4ZTF A;  1TWA J;  1T39 A;  1TW3 A;  2HOA A;  3IL2 A;  2EFN A;  3QYE A;  4HF0 A;  1WZ2 A;  5F1J A;  3MQ0 A;  4BUP A;  3JRF A;  2FUG 2;  2E34 A;  4FHT A;  4HNT A;  1R5G A;  3TQN A;  1G3Y A;  2JA7 J;  3VWB A;  4XNF A;  1YTY A;  3TED A;  4NDL A;  3JRC A;  1W4M A;  1QHH D;  2L7M P;  2OTL I;  1TQP A;  1NK2 P;  2CFX A;  4LK0 F;  3HBL A;  4EM0 B;  2CFO A;  2OQG A;  4JQF A;  3C1D A;  5K5O A;  1MBG A;  3H9Q A;  5CVJ A;  3ZQQ A;  3L1P A;  4UVB A;  5FD5 A;  4M9Z A;  2VT3 A;  2IGN A;  5IP6 A;  1FEX A;  3VSL A;  4ITV A;  3HOW J;  2P5V A;  1XS9 A;  1OCR H;  2CMP A;  3LOC A;  5EEH A;  3ZQI A;  2WAQ N;  3BP8 A;  3P5J A;  1SEU A;  2BV6 A;  3ERE D;  1HBX G;  4BHC A;  3PIP F;  1JT6 A;  3SZT A;  1H8A C;  2DK5 A;  2DPD A;  2EQR A;  1ZG1 A;  1IN5 A;  1YE9 A;  1I6X A;  3GBG A;  2O8X A;  2J5O A;  5CVR A;  2KKO A;  1R1T A;  4CDG A;  3I4N J;  1TQI A;  3SEZ A;  2H1L A;  2IA2 A;  1POG A;  2DI3 A;  5EGO A;  5A2Q Z;  4PJN A;  3OR1 C;  4XSX F;  1ETY A;  1YW9 A;  2F4I A;  3GME A;  2FX0 A;  3ML6 A;  4LG0 A;  3JW4 A;  1UHW A;  2COB A;  5HLH A;  5HS9 A;  4M72 A;  5FJ8 J;  4LGW A;  3SXY A;  1AWC A;  4XOT A;  1AKH B;  3BRO A;  2GIZ A;  1YJW I;  5EEA A;  5BQT A;  2FNA A;  4Z6Y A;  1V5E A;  2FQ4 A;  5E1Z B;  2IS2 A;  1OKR A;  2IBD A;  1HOM A;  1S8N A;  2VKV A;  3DU5 A;  5GTH C;  3E3V A;  5F0H A;  1JHF A;  2HXO A;  1ZGA A;  3A03 A;  1IC8 A;  3M8E A;  3M8F A;  1QQI A;  4IX7 A;  4XLH A;  4G9Y A;  4XIC A;  2NYX A;  4HAM A;  1WJE A;  1I1G A;  2RAE A;  4DZJ A;  1PUE E;  2XGD A;  1Y1V J;  5J4Y A;  3DWL E;  4L5E A;  1ZLK A;  3MFK A;  1SFO J;  1E3O C;  1TTY A;  2V1U A;  3LSK A;  4LK1 F;  3R60 A;  4LFU A;  1MIJ A;  1SFK A;  1X58 A;  3TL4 X;  4L18 B;  3GF2 A;  4DJA A;  2M30 A;  3HOS A;  1SAX A;  4UUS B;  1A31 A;  4KUM A;  3H3V K;  2HU9 A;  3RCO A;  3CCL I;  1YO5 C;  2EFQ A;  5DD4 A;  1MJB A;  1FWZ A;  4B44 A;  3KP3 A;  4AIJ A;  4YIR X; 
#chains in the Genus database with same CATH homology
 4JX5 A;  2R92 J;  3RKQ A;  2NVT J;  1MSE C;  1JKR C;  4V2G A;  2X48 A;  5IP7 J;  5EG0 A;  2LD5 A;  1TWH J;  5E3O A;  2W48 A;  2ECB A;  2NVQ J;  3HOZ J;  1F43 A;  1JKO C;  4HNV A;  2ID6 A;  3CDL A;  2LKX A;  1B72 B;  4A3D J;  3BTL A;  1ZGW A;  1XG1 A;  1ETW A;  5HOD A;  1GVD A;  4QIW N;  2JA8 J;  1X2M A;  1MH4 A;  2M34 A;  5IPA A;  5E3N A;  3S1M J;  3IV5 A;  3BG9 A;  1K61 A;  3S1Q J;  3RZD J;  4XRS A;  4XK4 A;  3G1O A;  3HOX J;  4I6Z A;  1XC5 A;  4LOC A;  3HOY J;  2DMP A;  1IJW C;  1HDP A;  3LSG A;  4RDU A;  3D1N I;  1JKP C;  5F0C A;  5JLW A;  5J1U A;  2HOS A;  3S2H J;  3BTC A;  1JUS A;  1DU0 A;  2R0Q C;  5FKK A;  4BKX A;  1BL0 A;  3BR5 A;  1A6I A;  3S1R J;  2KDZ A;  2CQX A;  2R93 J;  1GV5 A;  3BTI A;  3PM1 A;  3HOV J;  3HKZ N;  1TWG J;  3WHB A;  1S7E A;  1WI3 A;  3NAU A;  4BXX J;  3O8H A;  1UHS A;  1VI0 A;  4C2M J;  1LFB A;  3TW7 A;  2LFB A;  2HDD A;  5FLM J;  5FLV A;  5EYR A;  3GTO J;  1GV2 A;  2DA1 A;  2Y9Z A;  2JMW A;  2HYJ A;  4M3B A;  4XID A;  3OSG A;  2HOT A;  2MGQ A;  1IDY A;  1ETV A;  5JLX A;  4MLO A;  1GT0 C;  3DEW A;  5IOZ A;  2O7O A;  3TW6 A;  2LVS A;  2VUM J;  1Y1W J;  1FTT A;  2R5Y A;  1I3Q J;  1SAN A;  4M3E A;  1APL C;  1RPW A;  1U9N A;  5IP9 J;  1JT0 A;  3Q0U A;  4S0H B;  2QF7 A;  5GPA A;  4FTH A;  3JRA A;  1JJ6 C;  2R7Z J;  1IDZ A;  3WHC A;  3Q0V A;  3Q3S A;  4JX6 A;  4M3D A;  1AU7 A;  2M0C A;  5EGO B;  5F04 A;  4BY1 J;  1RET A;  1K83 J;  2XSD C;  3LSR A;  3BQY A;  4G12 A;  1MBF A;  1U9O A;  3FKI J;  4IHY A;  4IEJ A;  2Y9Y A;  9ANT A;  3JR9 A;  5K7Z A;  2EZK A;  2KT0 A;  2TRT A;  5IYB J;  1DU6 A;  3A01 A;  1P7J A;  2OF7 A;  5M5W J;  1U78 A;  4D5F A;  2VKE A;  2CJJ A;  2IEK A;  2WB1 N;  4FIS A;  4FE4 A;  4A69 C;  3M3Y J;  5E3L A;  3BG3 A;  4AYB N;  1JUM A;  3MVP A;  1BA5 A;  2GLO A;  4FCY A;  3JRH A;  4DYQ A;  4IHW A;  3MN2 A;  1RKW A;  4B4C A;  2LR8 A;  3GTG J;  3GTM J;  4JX4 A;  5K7F A;  3UKG A;  1T56 A;  2PMZ N;  2VI6 A;  3LSJ A;  3TP0 A;  2LK2 A;  1MBK A;  5DTD A;  1YRN A;  4AC0 A;  1B72 A;  1P7I A;  5M5X J;  4FE7 A;  1T33 A;  2CUE A;  2CQQ A;  1PUF B;  3O8G A;  1VFC A;  4CYC A;  3HOU J;  2JWT A;  2I10 A;  3FK7 A;  2ID3 A;  4QSH A;  2HXI A;  3ZQG A;  2DMU A;  2Y2Z A;  2P81 A;  1G2H A;  1ETK A;  3S16 J;  5EG0 B;  3LSP A;  1BJZ A;  4D7M A;  1RR7 A;  4X1E A;  2LP0 A;  3OOU A;  3Q0W A;  4I76 A;  4D5C A;  4A3B J;  3I4M J;  4EEF G;  2E2J J;  1FIP A;  2CU7 A;  5E3M A;  2NVX J;  1JUP A;  3QPS A;  1B8I A;  5J3L A;  2DA6 A;  1CQT A;  2NOG A;  3HDD A;  3JRG A;  3JRI A;  3OIO A;  3B6C A;  3ZQC A;  1FIA A;  1LE8 A;  4A3C J;  1MH3 A;  1UG2 A;  1TWC J;  3FIS A;  4DZP A;  4XRM A;  5C44 J;  2DMN A;  4M3F A;  3S17 J;  4W1U A;  4C3J J;  2JA6 J;  2X9D A;  4B3A A;  5FKM A;  2EZI A;  1OJL A;  4A93 J;  5C4J J;  3K2A A;  2NVY J;  2EH3 A;  1IUF A;  3HB9 A;  2DTZ A;  2N8G A;  2VPR A;  3TP3 A;  2G0E A;  2MG4 A;  2DA4 A;  4MIM A;  3BR6 A;  3BG5 A;  1IV6 A;  2E2H J;  2M9H A;  1X2N A;  3JRD A;  1BW6 A;  4D7N A;  2XGE A;  4IHV A;  2Y31 A;  5IYC J;  1JTY A;  2QCO A;  1OFC X;  1IRZ A;  3BQZ A;  1A5J A;  2EBI A;  5FKL A;  3PO3 J;  3S15 J;  1WH5 A;  1AKH A;  2FJ1 A;  1D5Y A;  4X6A J;  2H8R A;  2OPT A;  2R5Z A;  2O8K A;  1FTZ A;  2ME6 A;  1TWF J;  4DW6 A;  3F0C A;  2D5V A;  1W0U A;  2R5Y B;  1BW5 A;  2ME0 A;  3BT9 A;  4JP0 A;  4C3H J;  5IYD J;  5M5Y J;  4RBO A;  1NK3 P;  2EZL A;  3QQA A;  2E1O A;  2K9N A;  2YS9 A;  3M4O J;  2AO9 A;  2L9R A;  4A3J J;  3HGY A;  5GP9 A;  5M3M J;  4M3G A;  1OCT C;  2XB0 X;  1ETQ A;  2XGC A;  1LFU P;  2K9S A;  1F36 A;  1I6H J;  3BTJ A;  4MFD A;  4A3K J;  3BR0 A;  5J1Y A;  4UUS A;  2DA7 A;  3S14 J;  3OSF A;  5GPC A;  2HQ5 A;  2DMT A;  2LTP A;  3G1L A;  1IG7 A;  1GDT A;  4AUX A;  1JJ8 C;  4J19 A;  1QVT A;  2WV1 A;  5C3E J;  1ETO A;  1AHD P;  1EF4 A;  1Z0X A;  3A01 B;  1HDD C;  3CQZ J;  1QPI A;  1MBE A;  3ZQH A;  3W6V A;  1ITY A;  2IAI A;  5F27 A;  3H0G J;  5C4X J;  1FJL A;  1H89 C;  1ORK A;  2K40 A;  4DYR A;  1ZKG A;  2NS7 A;  1UMQ A;  1I50 J;  3B6A A;  5J1R A;  3QPL A;  2JJ7 A;  1ZR4 A;  2XB5 A;  1VF9 A;  3S1N J;  5DS9 A;  4A3G J;  4GFB A;  4M6V A;  5EF6 A;  1QVU A;  3ZOB A;  2M8G X;  1JKQ C;  4A3F J;  3JRE A;  3A02 A;  4ABZ A;  5EDN A;  1MNM C;  1MBH A;  2DA5 A;  1YRN B;  3VPR A;  3RQI A;  1IGN A;  4UUT A;  4XRS G;  2EZH A;  3GTP J;  2MSY A;  1RKT A;  3DCF A;  1MSF C;  4BY7 J;  4CYC B;  5F0F A;  2NS8 A;  3S2D J;  5IOY A;  1W0T A;  1H88 C;  1TWA J;  1VND A;  2HOA A;  1HCR A;  3FIW A;  5K7H A;  3IH4 A;  5F1J A;  1Z77 A;  3GTK J;  3JRF A;  2YU9 J;  2L7Z A;  3SFI A;  2L0K A;  2XRL A;  4BBR J;  3SDG A;  2JK3 A;  3RZO J;  2Y30 A;  1O4X A;  2M2E A;  5BNG A;  1WPK A;  2JA7 J;  2DA3 A;  3TED A;  5FKN A;  4NDL A;  3JRC A;  3HGG A;  1TC3 C;  2L7M P;  3HEF A;  1NK2 P;  3IH3 A;  3G1M A;  2Y0S N;  3HBL A;  2GM4 A;  3BR2 A;  1B8I B;  1OCP A;  4A3L J;  3LNQ A;  4A3E J;  1GUU A;  4B1R A;  1ENH A;  1MBG A;  3K7A J;  2DMQ A;  3L1P A;  3GTQ J;  5IP6 A;  1FEX A;  4IHX A;  3SJM A;  1LE8 B;  3HOW J;  1XS9 A;  3LOC A;  3ZQI A;  2WAQ N;  3HM5 A;  2LY9 A;  1ZK8 A;  2K9Q A;  1JT6 A;  4JYK A;  1H8A C;  4BBS J;  3BR3 A;  2EQR A;  3ZQL A;  3GBG A;  3MKL A;  1RES A;  2H1K A;  1ETX A;  5M3F J;  3PO2 J;  3I4N J;  1NTC A;  1POG A;  3JRB A;  5EGO A;  2B63 J;  1WH7 A;  4A3I J;  1ETY A;  2DA2 A;  2FD5 A;  1JTX A;  3CCY A;  3ZQF A;  2GBY A;  2FX0 A;  3E7L A;  4C3I J;  3IH2 A;  4A3M J;  2XPU A;  2COB A;  2X6O A;  2DN0 A;  5FJ8 J;  1WGX A;  1ZR2 A;  4MFE A;  1WCM J;  1AKH B;  2ZB9 A;  2L7F P;  2TCT A;  5EEA A;  3C2B A;  2LLK A;  4V2F A;  3FK6 A;  4DYC A;  3NAR A;  2JA5 J;  1HF0 A;  2XPW A;  2R5Z B;  5EZG A;  2FQ4 A;  2YUS A;  2IBD A;  1HOM A;  2VKV A;  4MO7 A;  1R9T J;  2HI3 A;  5F0H A;  2E2I J;  2HXO A;  3BR1 A;  2MW8 A;  3A03 A;  1IC8 A;  1U8B A;  5F08 A;  2ELK A;  3GTJ J;  4W97 A;  4XIC A;  4DZJ A;  2AHQ A;  2RAE A;  2XGD A;  2XPV A;  3GTL J;  1Y1V J;  5FKO A;  3CMY A;  2JN6 A;  4L5E A;  1ZQ3 P;  4Y52 J;  1SFO J;  1E3O C;  2ECC A;  5EZH A;  1Q1V A;  1X58 A;  2E19 A;  2CRG A;  1PUF A;  2DJN A;  2CUF A;  4UUS B;  1HLV A;  3H3V K;  4Y7N J;  2O9L A;  1ZTR A;  1JGG A;  1MBJ A;  1QRY A;  4QTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...