1QRYA

Homeobox protein vnd (ventral nervous system defective protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
GSHMSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLTSLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distortion of the three-dimensional structure of the vnd/NK-2 homeodomain bound to DNA induced by an embryonically lethal A35T point mutation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords PROTEIN (HOMEOBOX VENTRAL NERVOUS SYSTEM DEFECTIVE PROTEIN)
total genus 11
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qryA00
4S0HB 3CMYA 4LOCA 3O8GA 4A3EJ 2XSDC 1GDTA 2DMPA 3LSPA 2M8GX 2ZB9A 5F1JA 5FJ8J 3JRAA 1B8IB 2JA8J 2M0CA 2Y0SN 2NVTJ 1HCRA 5FKLA 5C3EJ 2JMWA 3G1MA 5DS9A 1FEXA 3UKGA 5IOZA 3GTMJ 2L9RA 3HBLA 3ZOBA 1MBKA 5JLWA 3BTIA 1Y1WJ 1MNMC 1ENHA 2RAEA 4I6ZA 2R5YA 5FKMA 4M3EA 2NVXJ 4FE4A 4DW6A 1K61A 5IPAA 4JP0A 1QVUA 5F27A 4C3HJ 2KDZA 3GTJJ 2W48A 1ORKA 3GTOJ 2EQRA 1MH4A 1X58A 4XRSA 5EF6A 2L7MP 3S2DJ 1H8AC 3JRFA 3JRCA 1B72B 3GTGJ 1EF4A 2CRGA 3IV5A 2K40A 3CDLA 1RR7A 2LKXA 2DA6A 2X9DA 3JRHA 4IHVA 4JYKA 3B6CA 3BTJA 2VPRA 2E2JJ 2QCOA 4D7NA 5EGOB 2ECCA 3QPSA 3PM1A 3S1MJ 2H1KA 2DA7A 3OIOA 2R92J 2XGCA 1APLC 2X48A 2R5ZA 1MBHA 1VF9A 4NDLA 5EDNA 3JRIA 1ZKGA 1X2NA 2I10A 3FKIJ 3K2AA 2O8KA 2AHQA 2LTPA 3H3VK 4M3GA 4B3AA 5C44J 1W0TA 1JT0A 2K9NA 2MSYA 1HF0A 3ZQGA 2HOTA 1JJ8C 1Q1VA 1VFCA 1ETKA 4MFDA 4AC0A 2LK2A 3W6VA 2XRLA 4QIWN 2LFBA 2Y9ZA 1WI3A 1AKHA 1GVDA 2EBIA 2OPTA 3Q3SA 2COBA 1W0UA 1A5JA 3BTCA 2CU7A 2VUMJ 5IOYA 2CQXA 4BBSJ 2E2IJ 5EG0B 5EZHA 3BR2A 1ZTRA 2KT0A 5BNGA 3S1RJ 1ZGWA 1DU6A 4IHWA 1GUUA 1RETA 4CYCA 2XPVA 1JTYA 3ZQHA 2ID3A 3HOZJ 4BBRJ 4QSHA 4V2GA 1LE8A 4A3BJ 3FK7A 3TP0A 5C4XJ 3LSJA 3BR6A 2JA7J 4D7MA 5J1UA 3BR1A 4ABZA 3M3YJ 4DZPA 4G12A 3RZDJ 3BT9A 5FLVA 5F0HA 2DA1A 3PO3J 2DN0A 5M5YJ 3QQAA 4DYCA 1BW5A 2HI3A 4W97A 3NAUA 3D1NI 3JREA 2D5VA 3A02A 1HLVA 3DCFA 4DZJA 4FCYA 1E3OC 4CYCB 5FLMJ 1SANA 3IH2A 4IEJA 4JX5A 2K9SA 2HXOA 2L0KA 2EH3A 3BR5A 1FIAA 1QRYA 1VNDA 2O7OA 4D5FA 3GTLJ 4A3JJ 2HQ5A 1F43A 2HOAA 1D5YA 3IH4A 5M5XJ 2G0EA 5DTDA 5IYCJ 1OCTC 1AKHB 2LY9A 3A03A 1JKOC 2R93J 4W1UA 1P7IA 2JK3A 1R9TJ 2WB1N 2EZKA 1A6IA 1TWGJ 3JRGA 5K7HA 1B8IA 2JN6A 1AHDP 4GFBA 3MKLA 3CCYA 2MG4A 1B72A 4UUTA 1GV2A 2DA2A 1U9OA 3OOUA 5GPCA 3BG9A 1TWAJ 2DJNA 4C2MJ 5K7FA 5J1RA 1JUSA 2R7ZJ 2DMUA 2NOGA 3BTLA 3ZQLA 1GT0C 2HXIA 3GTKJ 3S14J 2IAIA 1P7JA 4FTHA 2M2EA 2AO9A 1Z0XA 1IJWC 5EGOA 1RPWA 1OCPA 5J3LA 2M34A 3HB9A 3K7AJ 1MSFC 4BKXA 2XGDA 3HOUJ 4XICA 3HOYJ 1FTTA 1TWFJ 4FE7A 2N8GA 4A69C 2LP0A 1G2HA 3ZQIA 1MBFA 1U9NA 2NS8A 2HDDA 2IEKA 3S17J 1T56A 2JWTA 3MN2A 4Y7NJ 2DA3A 2EZIA 4RBOA 1K83J 5GPAA 4DYRA 3HM5A 3HOWJ 3JRBA 1LFUP 3ZQCA 3Q0VA 2LLKA 5IP7J 5GP9A 3JRDA 3ZQFA 2MGQA 4A3KJ 5E3MA 2Y9YA 1XS9A 4A3MJ 3F0CA 3S1QJ 1CQTA 2GBYA 5EG0A 1HDDC 3JR9A 2QF7A 3LOCA 1JT6A 1DU0A 3HGYA 4QTRA 5HODA 2YS9A 5FKNA 1UHSA 2EZLA 2XGEA 1GV5A 1IUFA 4IHYA 4I76A 1LE8B 1IC8A 1Y1VJ 2FD5A 1MH3A 3GBGA 1U78A 2XPWA 3HOVJ 3E7LA 1JUMA 5E3LA 1X2MA 4B1RA 2LR8A 3TP3A 1NK3P 5IYBJ 1MBGA 2R5YB 1ETXA 5FKOA 3BG3A 2ID6A 2TCTA 2FQ4A 2XPUA 2PMZN 5FKKA 1XG1A 1NK2P 5E3OA 1WH7A 1JJ6C 1AU7A 5M3FJ 2DMNA 3S15J 2HOSA 2L7FP 5C4JJ 3LSGA 4XRSG 3OSGA 2B63J 2Y30A 2GLOA 2JA5J 1QPIA 1H89C 4MFEA 3S2HJ 4A3DJ 1HDPA 3VPRA 5K7ZA 1IDYA 2GM4A 2JA6J 3TW7A 1PUFA 3TW6A 4Y52J 1I6HJ 1RKWA 1VI0A 4A3LJ 4M3DA 4MIMA 4HNVA 4A3FJ 3C2BA 4JX4A 2E2HJ 3G1LA 2E19A 4DYQA 1RESA 1ETQA 4AYBN 4X1EA 2DA5A 3HKZN 1JKPC 1WGXA 1RKTA 2DTZA 3S1NJ 1WH5A 2OF7A 4L5EA 3RKQA 1YRNA 1LFBA 3HOXJ 1IV6A 3OSFA 3WHBA 4A3CJ 1BL0A 5JLXA 5F08A 2Y31A 4M3BA 3A01A 3MVPA 2R0QC 3BR0A 1BW6A 2R5ZB 1I50J 1BA5A 1WPKA 2NVQJ 3GTQJ 1H88C 3DEWA 4V2FA 2MW8A 1TWCJ 2NS7A 2FX0A 2WAQN 2CUEA 4XRMA 3BQYA 1OJLA 4D5CA 1JKRC 5M5WJ 3B6AA 5E3NA 2E1OA 5F0FA 4J19A 3NARA 3FISA 4EEFG 4BY1J 1JKQC 3RQIA 1MSEC 4JX6A 4BY7J 4XK4A 4MLOA 3SJMA 3I4MJ 2K9QA 2VKVA 2LD5A 1IRZA 1IDZA 5EYRA 4XIDA 3HGGA 1ZQ3P 1JUPA 1JTXA 1JGGA 1ETWA 2YU9J 3BG5A 2XB5A 1UMQA 3HDDA 4UUSB 4C3JJ 2ME0A 1FTZA 2X6OA 2Y2ZA 3IH3A 2IBDA 2JJ7A 1FIPA 1Z77A 3BR3A 3HEFA 1MBJA 2DMTA 5J1YA 1BJZA 1ZK8A 4BXXJ 2HYJA 1UG2A 2CUFA 5IYDJ 5IP6A 1ETOA 4UUSA 3FK6A 1ETVA 3CQZJ 3H0GJ 4C3IJ 1T33A 2VKEA 3S16J 4FISA 3LNQA 4MO7A 1I3QJ 1WCMJ 4B4CA 5EEAA 3A01B 1ZR2A 2H8RA 2YUSA 3Q0WA 2XB0X 4A93J 1TC3C 3L1PA 4X6AJ 4RDUA 1ZR4A 1XC5A 1IGNA 1YRNB 1MBEA 3SFIA 2ECBA 4M6VA 1O4XA 2O9LA 1ITYA 2TRTA 1OFCX 3M4OJ 3G1OA 2DA4A 1F36A 2LVSA 3SDGA 1U8BA 2P81A 1IG7A 3RZOJ 2EZHA 3FIWA 4A3GJ 3WHCA 3PO2J 1S7EA 3Q0UA 1FJLA 3TEDA 4AUXA 2DMQA 3BQZA 4A3IJ 2M9HA 1POGA 5M3MJ 3I4NJ 5EZGA 1QVTA 1NTCA 9ANTA 2WV1A 1HOMA 4IHXA 5F04A 2L7ZA 3QPLA 4M3FA 2VI6A 2ME6A 1ETYA 2NVYJ 3O8HA 3GTPJ 1PUFB 2FJ1A 2ELKA 1SFOJ 5IP9J 2CJJA 2CQQA 5F0CA 3LSRA 1TWHJ
chains in the Genus database with same CATH superfamily
4YEJA 4ZYGA 4CCOA 4RAYA 4RAFA 3WGGA 2OQRA 3L2UA 3QYBA 4DIQA 2M8GX 2WY8Q 2M5WA 4OIOF 2P5VA 1JGSA 2BEOA 2ZB9A 3KEOA 1XSXA 3KZYA 2HU9A 3C2GA 2BZTA 3DPLC 1S7AA 4IVNA 1DPUA 3G1MA 3E6BA 3QRFF 2X0LA 5H6RA 2VBWA 3VOEA 2PFBA 2JA2A 3DQVC 2CMPA 4O6JA 1Z7LA 1Y1WJ 1MNMC 1WQ2A 2X4HA 1UZCA 2RAEA 2ACJA 5J8FA 5IPAA 2MC4A 3PQKA 4LD5A 3GTOJ 2EQRA 2HS5A 3SDBA 2DO7A 5LGNA 4HV5A 3NWTA 1MH4A 1P92A 3H9QA 1G3YA 2L7MP 2BE5F 4OAZA 1B72B 3GTGJ 1EF4A 3IV5A 2K40A 3CDLA 3N4MA 3FBIB 1RR7A 4B8XA 3ERED 2LKXA 3M7GA 2KMUA 2STWA 3C7JA 2D2WA 5E18F 3K1MA 1BI1A 2VPRA 4BEHB 2E2JJ 1Z7UA 2H6BA 3K2ZA 1FOWA 3CP2A 3VSKA 5LRSA 2WB1A 2JZYA 2GIVA 2ECCA 2L9NA 2VBZA 1GXPA 4HZFA 2PMUA 1G59A 3RYPA 1APLC 1EJ9A 1PP7U 2X48A 2R5ZA 1SVLA 1MBHA 4PJMA 3ZMTA 1R5HA 4GYIA 4LK0F 1X2NA 4EV0A 2LTPA 2VONA 5F6FA 4M3GA 4B3AA 3C2HA 3TKYA 1HF0A 1ZRCA 3PQJA 2VLAA 1P9QC 1XB4A 3F8MA 2HOTA 4PGHA 1J7KA 3EDPA 4LLNA 2XRLA 4N4OB 2ZJPF 2MYSA 2EV0A 5K1YA 2XUBA 2W00A 2EBIA 5HLTA 4XN3A 4AIHA 2OPTA 4RGSA 4E7LA 4LB5A 1A5JA 3BTCA 5FD6A 5IOYA 2CQXA 1WJCA 2XKPA 4C2TA 4L9VA 4L9TA 5EG0B 5J40A 2Y48A 5BNGA 1DU6A 4BDYA 2UXNA 4IHWA 3BG6A 1HSJA 4K2EA 1R1TA 1IAWA 4P9FA 2ID3A 3ZQHA 2DFIA 3M8FA 1F9NA 3A4CA 5GTIC 2LH9A 3CMMA 1R1UA 3FK7A 3CC2I 3PJRA 3DEUA 3TP0A 5C4XJ 3RPUA 4JBAA 3BR6A 2JUCA 3IKVA 5GADJ 3S93A 4F92B 2Z1DA 4NHJA 2ZJ2A 2VPLA 4FHTA 3RZDJ 1MJ9A 3BT9A 1QU3A 5FLVA 1LEBA 1ERDA 2LNBA 4AD9A 3PO3J 1NG7A 2HYFA 4DYCA 2W1OA 3H9GA 3H36A 2HNHA 1BW5A 2HI3A 1TP4A 1SAXA 2KKOA 3NAUA 4GGGA 3ROUA 5F64A 2DW4A 3MCZA 2FU4A 3CP8A 2BV6A 3E6CC 3A02A 2DLLA 1HLVA 1F1ZA 3BCBA 4DZJA 1E3OC 3ABUA 2VB6A 5BQTA 1VQOI 2RNGA 2XF6A 4ESFA 4I2OA 3GFJA 3A2KA 2K9SA 2HXOA 4FETA 1FIAA 2ZCWA 5IT9K 1VNDA 3QWLA 3I59B 4CH7A 3A0HC 4LIVA 4F55A 3GTLJ 2LY2A 3TOAA 3I0TA 1BJAA 1H9GA 3K4JA 3IH4A 5M5XJ 2G0EA 2NYXA 5DTDA 5HDNA 1TQMA 2YR2A 1OCTC 3ABMH 2L54A 2L9SA 3A03A 4LG0A 1V4RA 1SD5A 3I4PA 5FFZA 3CUQC 3WTUC 2QSGX 1HC8A 2XAFA 2CFXA 1XX5A 4W1UA 4AU7A 5K5RA 3CD6I 1P7IA 2Y75A 4XKWA 1YQAA 4PJ0C 1A6IA 4BHBA 1J09A 4RB2C 3VYTB 2JN6A 5HOOA 1WJ5A 5E17F 1B72A 1U9OA 2MD5A 3L09A 1XCVA 3VDXA 5CQGA 4F52A 4RLQA 1VQ9I 3DLLF 2DMUA 2M3AA 3QOPA 1Y39A 3ZQLA 2IAIA 4PCQA 4QPOA 4XLAA 1G8XA 1IJWC 3A0BC 1RPWA 2LBFA 4BL0B 2NS0A 3LQQA 3JSOA 4BKXA 1ODDA 2XGDA 1TWFJ 2Q2EA 1MDMA 3I58A 2KP6A 2N8GA 3MKYB 2RN7A 2F5VA 2R7SA 3HOTA 2GOXB 5KAFC 3FHZA 4PDKA 4ZDLA 2JWTA 1ZREA 2EZIA 3QP5A 2VIXA 3IUOA 1B9NA 2VBYA 3KEQA 2BGCA 2FQ3A 1YI2I 1O3TA 2M4GA 3JRBA 1IN4A 2HQRA 2PBIA 4B47A 1I3AA 2LSOA 5DCMA 2LLKA 1RI7A 1D5VA 2IGNA 3KP2A 1N78A 1MJBA 3RQ4A 3Q5FA 3BG7A 3S1QJ 1XCBA 2WTEA 4BYYA 3ZP5A 4A6DA 5EG0A 2FMYA 3MKZA 2VQCA 3K6GA 1MD0A 2QUFA 4E7ZA 4BXFA 1B9MA 1N77A 1JT6A 3PL8A 5KVRA 3W2WA 4Y4RA 2VC1A 2P6TA 1QHGA 1GV5A 4HYEA 4QLCU 5LFAA 1VQNI 4DBQA 1IUFA 2X1EA 1LE8B 3KP3A 1BI0A 2M87A 3GBGA 5HS8A 4KT5C 1K4TA 1SFKA 2F6CA 2IP2A 4L5JA 2ESHA 3O3KA 1I1SA 3OYEA 5EEHA 4B1RA 2DT6A 4II3A 3CCVI 1IZ1A 2QQ9A 1I6XA 4OMZA 2R5YB 1FSHA 4ENMA 4LG3A 3H5RA 1O7LA 1QO0D 3DEEA 2DODA 2Y0SA 1KGSA 4X0GA 4EGYA 2WWYA 1V3FA 3EUHA 5AIPA 3MZHA 1X19A 1XG1A 1NK2P 3LQRA 3IAM2 1ZG1A 1E2XA 1AU7A 1VQ6I 2FOWA 2LG4A 4A0XA 2X85A 2MA3A 3CDIA 3BPVA 2X6WA 4XLCA 3MKWB 4HF2A 1RC9A 3OSGA 1SEUA 2NOJB 2Y30A 2GLOA 2JA5J 2DQLA 4DGWB 4MFEA 1ULYA 4G6DA 1HDPA 2X6XA 4II2A 4GYGA 1MNDA 3ZPLA 4U0YA 1BR1A 3BJAA 2JA6J 1JHHA 2RQPA 3P7NA 3NRVA 2H09A 3TW7A 3TW6A 4Y52J 2GZWA 1S72I 2BYVE 1LDKB 5CVJA 3EETA 4XMYA 4MTEA 1SMTA 2PJRA 2E2HJ 3AL0C 2LF8A 3K4LA 2KJBA 3AG1H 1RESA 4N0BA 1DUXC 3OIPA 5GAGJ 4AYBN 1LPQA 2CGPA 4ZYDA 1YG2A 4F3QA 4XSZF 4BQOA 3CCMI 1NG6A 2HPMA 1JKPC 1WGXA 2CO5A 2CS3A 4D0PA 2DTZA 3FM5A 1N25A 2EFNA 3W6JB 3RKQA 1DGWY 1V55H 2X1CA 3GLXA 5L3FA 5LGUA 3HOXJ 2FBIA 4EMSA 4YELA 4ENKA 3CCSI 2Y31A 5J4VA 2R0QC 3BR0A 4I01A 1I50J 4XLEA 3DBHB 1WPKA 5L3BA 4UNOA 3PFYA 3CC4I 2FX0A 2RKHA 3BZ6A 4BAYA 3IRRA 4H0EA 1F5TA 3T8RA 1JKRC 1FYMA 4PSWA 2PLYA 3B6AA 2LRDA 4J19A 5DD8A 2QENA 1UHMA 1UFMA 1LNWA 5HLGA 1OCZH 1X1CA 2KISA 3OIQA 1D1BA 3J7YJ 3WTZA 2CW7A 3MD2A 3DFGA 1WJFA 1HW1A 2X1DA 4XONA 5EYRA 3HGGA 3LSKA 3BWGA 3QP6A 5EEGA 2MH9A 3S2WA 2E1MB 3ZMVA 1EH7A 5K5QA 1YHQI 3L2CA 4RGUA 2XB5A 2DDAA 4UUSB 4M73A 1FTZA 2IBDA 2PQ8A 2HTJA 5IY5H 5CVIA 3HEFA 2DMTA 4CA0A 5J1YA 2IS6A 1BJZA 4ZC3A 2ZMEA 3DU5A 3DV8A 5IYDJ 1PVEA 3CCQI 3FBNB 1ETVA 4C3IJ 3S16J 1U5TC 4WF2A 2LOOA 2PMZA 3R0JA 4MO7A 3A01B 3TBIA 2XF7A 2CYYA 1KONA 2XB0X 3LAJA 4A93J 3RJPA 4CCLA 1XC5A 2QBYA 1MBEA 4BGDA 4M6VA 2LC2A 2O9LA 4B48A 3VFZA 2TRTA 1OFCX 3T1BA 4NBQA 3G1OA 1XMKA 2Q1ZB 3J7AY 2P81A 5E8IA 4RB0A 3WHCA 3AG3H 3V7SA 3LWFA 1XPXA 3WTTC 2WAFA 2Q2EB 3KEYA 1POGA 9ANTA 3GO5A 1QVTA 2A05A 4PSXA 2L7ZA 4A2UA 2ESNA 1Z67A 2OBPA 1WI9A 2RNJA 2XGXA 5CPRB 3VB2A 1Y6IA 3FM3A 3BPXA 3O8HA 4BACA 1PUFB 1LUJB 2BXYA 2DYRH 2ELKA 1SFOJ 1KU7A 3KP5A 4A5NA 3NWSA 5IP9J 3LSRA 3G4SI 3C18A 3CMYA 3ML6A 4G7ZF 4Z6YA 2Q0OA 1XGOA 2E71A 4RM2A 4A3EJ 3AG2H 3CLOA 3GVAA 2KIUA 2DMPA 5DCMB 4BQNA 2AXLA 2W4SA 1IRFA 3L7WA 1OPCA 1I1GA 2LREA 1FNNA 5F1JA 3JRAA 1B8IB 2M0CA 1HCRA 3ABLH 1EA3A 1LVAA 4UB6C 2H1LA 4ZTJA 1VQ5I 5C3EJ 3E0JB 2JMWA 4C30A 5DS9A 2FBKA 2K3PA 3OMYA 4XN0A 5IOZA 3ZGKA 2LF7A 3FWEA 1KYZA 3F8NA 4I98B 1XSDA 1P4WA 2EB7A 2D1VA 2R7FA 1T98A 1DGRM 3HBLA 3ZOBA 1MBKA 5JLWA 4EATA 1ENHA 1TTYA 3IHUA 3JTGA 2A5YB 4M3EA 2VQGA 1R49A 1K61A 5E20A 4KITB 4C3HJ 3GLLA 5F27A 4HW0A 3EYYA 2W48A 1SVMA 2MH2A 3FKJA 1X58A 2IA0A 2V26A 4AIKA 3LA3A 3KP7A 5DYMA 3JRFA 1WFXA 3S3OA 2CG4A 3GEZA 3S3MA 4IHVA 1YIJI 5D8KB 1ZAOA 5E8GA 3B6CA 5JVTA 2WAQA 1QPMA 2QCOA 2LBFB 1ON2A 5EGOB 2KL4A 2OUMA 3BLYA 3OIOA 2R92J 2ZMEC 5LHHA 3PIPF 2D45A 2O8XA 4NQWA 2I8DA 3CCJI 1Z6TA 2IA2A 5LGTA 3HKZA 5EDNA 5DDGA 4IHSA 3FXRA 3FXLA 2KZGA 2I10A 4NB5A 5TGTA 2QWWA 3UNGC 1T39A 1D8JA 1JT0A 1W0TA 1X4PA 1GXQA 2GA2A 4ZTFA 5BS6A 2VN2A 1S6LA 2YSRA 3CLQA 5KAIC 3TO7A 1Q1VA 3BP8A 1VFCA 2JRMA 4UVAA 4PJLA 4AC0A 4HEA2 5JFRA 3F8FA 4YFKF 3CMEI 2LFBA 2H8WA 3ZCOA 3O6BB 4E7IA 1Y8RB 4OMYA 4Q5SF 4XLNF 2PEXA 4YRVA 1LVKA 1NHAA 3ECOA 4KT6A 3F6VA 3CDHA 2E2IJ 2NXNB 5EZHA 2KT0A 2V1UA 2IS2A 2B0LA 1SFXA 2HDWA 2OJED 3JCUC 2BVMA 4IOCF 4GXOA 4DQ2A 4CYCA 2VOPA 3RSNA 2M7BA 2JT1A 1XDSA 2C6YA 2STTA 4BBRJ 1RUOA 4QSHA 1PUEE 2DPUA 3HC7A 1X1BA 2CV0A 2HFHA 1L0OC 3LSJA 2JA7J 4PJNA 3DLAA 5J1UA 3RKYA 3BR1A 4RLFA 2QSHX 2CFOA 5CKTA 2MLKA 1M1EB 3FMRA 2WAEA 5F0HA 2R7UA 2DN0A 2J5PA 1E0EA 5M5YJ 1D1AA 5J8CA 2KFDA 1HBXG 1HKSA 3AKZA 2HWVA 3N05A 1B59A 1OMIA 3N97A 5IT9Z 4W97A 4J00A 3QPHA 2YU3A 1FT9A 5LEKA 3SXYA 3I59A 1BM9A 4EJTA 2XKOA 3OY9A 3GCMA 3KLNA 4IEJA 3KP6A 2L0KA 2W85A 5DUIA 2VC0A 4A12A 3H5AA 2EK5A 3E6MA 1D0XA 4PFPA 2NNYA 2DQRA 2LY1A 2L9VA 3E6DA 1JKOC 4BQAA 2EIMH 3OR1C 2JK3A 5B1AH 2WB1N 2K3FA 2ADUA 5E1WA 2QGUA 4BJ6C 1J5YA 3FMQA 5K7HA 1TL8A 2A3SA 1AHDP 2L2OA 1S7OA 3CCYA 3MKLA 2MG4A 1UAAA 4OAYA 1IW7F 4G9YA 1GV2A 2DA2A 5FFXA 5FGMA 1KA8A 5LHGA 5K7FA 5J1RA 2EWNA 1JUSA 2VJ4A 2DJIA 2R7ZJ 4WXCA 3CO7C 3RYRA 1JXSA 2M2EA 1U6GA 3HRTA 3RKWA 2BY3A 2FOKA 2CV1A 2V79A 1N75A 1RZ4A 3DTIA 3I71A 2M34A 5J3LA 4UB8C 3UR3C 1MSFC 3F9KA 2K9LA 4A6EA 4HQMA 4YIIA 3OYHA 2EFQA 2ZSIB 1MDMB 3HIFA 2GXAA 4IQJA 2HDDA 3PUBA 2BW3A 4YFXF 3FXJA 1TNTA 1LDDA 1HXDA 1BR4A 2F5DA 4Y7NJ 3GFLA 5KHDA 3HM5A 2ZNZA 1WSUA 4EJWA 1A6QA 3ZQCA 4YFNF 3W6KB 5FB2A 4TV7A 5IP7J 3OYIA 5GP9A 1QHHD 3JRDA 1KQ8A 2MGQA 4HRIA 4CZCA 5E3MA 1OYIA 2R7TA 1Z21A 4UY8I 4A3MJ 4LLGF 3F0CA 1K79A 1CQTA 3OYCA 3FDYA 4LK1F 2GBYA 1W5SA 3ESWB 5KCMA 2K7LA 1SD7A 1T38A 3U21A 5FRNA 3MZYA 4WWCA 2QF7A 1DU0A 2GWRA 3HGYA 2K9MA 2YS9A 3TOBA 5HODA 5FKNA 2UXXA 4ZZLA 2ZNYA 1TZLA 1UHSA 4E7SA 2UWMA 2EZLA 2FEZA 3DTEA 4I02A 2XRNA 3SHFA 5D5WB 3JSPA 2ZXIA 1LJ9A 4RAGA 1U78A 2E1NA 2XPWA 3HOVJ 2QA4I 3IAS2 4I0AA 2V7FA 2LR8A 1T95A 2MD0A 2OQGA 4S04A 3OV8A 4XNFA 3H5NA 3VODA 3IRQA 1MBGA 3GX4X 1BI2A 3RI4A 4BHPA 1ETXA 4XKBA 4XKCA 3GZ6A 3J80K 3BG3A 2HQAA 1CGPA 5B66C 4OIRF 1YOVB 2DFFA 5FKKA 3V4GA 3S32A 4L0ZB 5E3OA 1WH7A 1JJ6C 3ZN1A 1GLNA 3CCUI 3E5XA 2ZJRF 3ECHA 2AQFA 1TW3A 2RC4A 5J47A 3HPHA 3KP4A 2B63J 3LMMA 5JI6A 1YITI 1QPIA 1H89C 1A36A 5E1XA 1FP2A 3VPRA 2KIMA 2Z2SB 2OCCH 2CSOA 4R1HA 2VL8A 1R23A 4Q47A 1PUFA 2W82A 1SD6A 1I6HJ 2EA4A 1O3QA 1PYVA 4Y15A 4E4HA 3I53A 4A3FJ 1YLFA 2V1XA 2DFEA 2O6GE 3C2BA 3G1LA 3HRUA 5BOXA 4XM3A 1X3ZB 1MIJA 1SD4A 3S8PA 3I54A 3WG7H 4CDGA 3OS0A 4CHUA 3DBRB 3K69A 2M1BA 2FBHA 5A2QZ 5LRRA 3F72A 1RKTA 2XAHA 5CVVA 4OIQF 3CTAA 3R0AA 1YO5C 5L3GA 4U7BA 4IHTA 2BVLA 1WHUA 3DPTA 5KNLA 2KRFA 3DP7A 3HXLA 3IC7A 1SVOA 3MVPA 4GCVA 5E1ZB 4O3MA 4UVCA 1P2FA 3GFMA 3CJNA 1BOAA 2K4BA 3RKXA 1B1BA 3HTUA 1H88C 3GTQJ 1Y56A 4I0BA 4V2FA 2MW8A 2NS7A 1R4MB 2QM3A 3WODF 4HX4A 3BQYA 1FP1D 4D5CA 5BPIA 4KYWA 5HLIA 1RNLA 3W3CA 3K1NA 3QU3A 4G6TB 5E3NA 3MFKA 3QODA 3FISA 5JVGF 1YJWI 4LJZF 4IRHA 1ON1A 3D5SC 4JX6A 5FLXZ 4FQGA 2PJRB 2HVSA 1VQ4I 4ENJA 1LDJA 4XK4A 4C9YA 3SJMA 2XAJA 2LD5A 5ICCA 2E35A 1AA7A 3BDDA 3QYEA 5FO5A 3RPQA 4HLYA 1WJAA 2JPCA 2QQ8A 4HOBA 1JGGA 1JTXA 1ZQ3P 3ASNH 4G6QA 2V9PA 2YU9J 1QZYA 4HSTA 3KX2A 5D5UB 1UMQA 3HDDA 3IP4B 3WTSC 3LSTA 3BROA 3P5JA 1OCOH 1A35A 3IH3A 3LSHA 1Z3YA 3AFHA 1XTAA 1FIPA 3BR3A 5ILSA 2VJ5A 1XN7A 3G3ZA 1MBJA 2ZXWH 5LD2C 2KJCA 3DKYA 3T5XA 2HYJA 3BZKA 2IS4A 1UG2A 2OD5A 5J6XA 2KIFA 3AG4H 4BNCA 2HEOA 2OU2A 5JR3A 1P4XA 3QOEA 3TGNA 3HHGA 2XAQA 2CW8A 4FISA 4FASD 3L2RA 4B4CA 5EEAA 1ZR2A 4ZJZA 4CGZA 4L18B 2YUSA 3Q0WA 4LITA 3PIOF 3QYFA 1Y0NA 5FROA 3CMAI 2MC3A 4RDUA 1MW7A 1ZR4A 1YRNB 3L2QA 1UG0A 3P9KA 1R1VA 2MFZA 3V7CA 2ISYA 1ACIA 3M4OJ 1IG7A 5AONA 1U8BA 1WZ2A 2CV2A 1S8NA 3FX3A 3FIWA 4A3GJ 2VXDA 1TQIA 3X2QH 3WU1B 1D0YA 3J7AO 2ISZA 3TEDA 2DMQA 4A3IJ 2M9HA 5K5OA 2OTJI 1OQYA 3SZPA 4OWRB 1HW5A 1X3WB 3QPLA 4XOTA 4M3FA 3G2BA 2VT2A 1BBYA 2FJ1A 5BMZA 2CJJA 5F0CA 1S5LC 2Z16A 4E6KG 4S0HB 4LOCA 3O8GA 3OL4A 2OCEA 4KUMA 4WCGA 3J81K 2XSJC 2JVGA 3TL4X 4R79A 4BQQA 5FJ8J 2A07F 1QZEA 2Y0SN 2PN6A 2AXTC 4CCNA 3IKTA 2YPRA 3ZXSA 2F5EA 5TJJA 1H9TA 1FEXA 3R4KA 2K5CA 4KN7X 2L9RA 2CH0A 1QBJA 1LB2A 4IO9F 3GZ5A 2R7VA 2X6YA 5FKMA 4B43A 3WU0A 2VXZA 1PDNC 3MZ8A 4Q48A 2E34A 1QVUA 3LAPA 2KDZA 4N4NB 3CF5F 1IO2A 4BE0A 1J59A 4CCMA 2V4JC 2GOMA 2E1MC 1BC8C 2H6CA 4XRSA 2A6EF 1MNEA 5EF6A 1KZHA 2L4AA 1H8AC 1JI8A 4HNUA 2EIKH 5LEJA 1BC7C 1YW9A 5CQEA 3H3UA 4XOPA 3WGHA 1Z91A 2VKHA 4BS9A 1FBUA 2DA6A 2M8EA 2X9DA 3JRHA 5HS9A 4JOMA 4FX0A 2ELHA 3OYAA 1WKMA 4D7NA 2NRAC 1E17A 1R7JA 1GHCA 5HVQC 1YS6A 2E60A 1SMYF 3QPSA 3VYSB 3SEQA 5FD5A 2H1KA 2DA7A 4N9IA 1U5TA 3DF8A 1RIOH 3CJQB 3DTKA 3RCOA 1VF9A 3JRIA 2EILH 2F48A 1QA6A 1U2WA 2EINH 2ZBKA 5H6QA 2O8KA 2HKXA 3H3VK 2W7NA 4IRGA 2R3SA 3DWLE 2Y0MA 1STZA 1D0ZA 2MSYA 4HPQA 4WXHA 4JK1X 4Y3OA 3M9AA 1JJ8C 3MAJA 5KK1A 1R6RA 1IN5A 5TRDA 3TDUC 1LQ1A 2WY7Q 1XGMA 4MFDA 3ISPA 4DOZA 2O61A 3D0SA 2Y9ZA 1USTA 3HTSB 1Y8QB 2A61A 3G71I 3OR2C 1MGTA 3HHHA 1WJEA 4XQFA 5ILVA 5D8LB 4M9SA 4C2UA 4KFCA 4BBSJ 1T0FC 4UXNA 4EVIA 4NUBA 5AIQA 3BR2A 3DU6A 2IS1A 3V8KA 4BXUA 1KU9A 2L4MA 2W84A 1JTYA 4M9XA 2CW0F 5D4SA 2IVMA 2UV1A 2QKLB 1FOXA 1XMAA 2DYSH 4A3BJ 3HSFA 3LFUA 3VWBA 1D3YA 1UB9A 3FXMA 2QZ8A 3OYLA 4NQWB 5ED4A 1MMSA 4JQFA 4NNJA 4D7MA 4KNYA 4I7HA 4ABZA 3K10A 3M3YJ 2QLZA 1Q1HA 3V8JA 4ZH4F 4DZPA 4ZYHA 2F5FA 3Q9VA 4B44A 2Z33A 4D9JA 2JSCA 3SFZA 1T0FA 2KRCA 3ZMSA 4UHTA 1NH3A 2AQEA 4HX8A 3HG9A 3D1NI 3K4BA 2QSFX 4CUGA 3JREA 2D5VA 3M8EA 1OYYA 5HNHA 2HKOA 3DCFA 4FCYA 4CXFA 1WRJA 5FLMJ 2WC2A 1SANA 3QAHA 3IH2A 4G94A 4JX5A 5CYVA 4ZYAA 2DPDA 4CICA 3BR5A 2O7OA 2XDVA 2P5KA 1ZARA 3LSIA 1PP8F 2BW3B 3RPUD 2R7RA 3KZZA 2HOAA 4EM2A 1D5YA 3DKWA 2HYGD 4IXAA 1AKHB 2LY9A 3HOSA 3H35A 3ZN0A 5A2QK 1IRXA 2R93J 1R9TJ 3OWTA 3OYNA 1IXSB 4WK8F 2A6TA 2EZKA 3D5LA 2EA2A 3JRGA 2H94A 1O3RA 3CF2A 1B8IA 2HDCA 2IRFG 3GW2A 4GFBA 5JHFA 3TO6A 3OOPA 3G6EI 2LKPA 3OOUA 5GPCA 1E3PA 3K4NA 4C2MJ 2QYOA 2GIZA 2NOGA 1GT0C 1W36C 3GTKJ 3S14J 3CZ6A 3TO9A 2AO9A 1LEAA 4PK4A 5CVUA 5EGOA 3U9GA 3HYIA 1X3UA 1OCRH 4N9HA 3K7AJ 3ZMDA 4KIFA 2FUG2 1WWXA 2FE3A 3FXOA 4XICA 1ZG5A 3HOYJ 1FTTA 5DD4A 4U87A 1G2HA 1GVJA 1J75A 6PAXA 1U9NA 2IEKA 1Z1DA 2HQNA 4Z2YA 3F6OA 3M1EA 2ETHA 3S17J 5FRMA 1T56A 2PJPA 3MN2A 1U0JA 2NVUB 1X4OA 1HSTA 5GPAA 4DYRA 2XAGA 2IA1A 3Q0VA 4DNCA 3L9FA 2E5ZA 2R7XA 2G7HA 3I3LA 4I99C 3ZQFA 4ITVA 4PFOA 2QQAA 4KIBA 4A3KJ 4L9NA 2K86A 2G9WA 2FXAA 2RGVA 5H20A 1MJAA 2XF5A 3KE2A 4KJZA 2M4KA 1HDDC 3ZMUA 2RVCA 1FBQA 3ZMZA 3OYDA 3GMEA 4BEHA 2B9SA 3LOCA 4XSXF 1FWZA 2W25A 4QTRA 3HSEA 2LMDA 4MEYF 5CJ9A 4ON0A 1FYLA 2XGEA 2HTSA 4RB1A 3WTXC 4IHYA 3PFIA 2L3DA 4I76A 5ILUA 2FNAA 4IRIA 1IC8A 1OCCH 1Y1VJ 2FD5A 1FPQA 4FX4A 1W5CC 4IKFA 2BBYA 3LL7A 4IZZA 2QBYB 1W4MA 1X2MA 2M30A 3J81Z 3GF2A 3H1CA 2V6EA 2LDUA 3TP3A 2OAZA 2WA0A 5IYBJ 1QZZA 1L3LA 2XC7A 3CJTB 4LGWA 4HF1A 2GQQA 4HDVA 5FKOA 1VQPI 2ID6A 1BIAA 5CLSA 2F4MB 2TDXA 3M1CA 1TBXA 2FMLA 2PMZN 3ZR8X 2RDPA 3WU2C 2DXIA 1Z05A 4Y13A 1WJDA 1EKEA 4MQ9F 3CCLI 3K4KA 4ASNA 2BY0A 4RM3A 4MTDA 2HOSA 4HG2A 2FA5A 2VBXA 2Z9OA 1T2KA 4HSRA 5C4JJ 3LSGA 3WTYC 4KIGA 4XRSG 4P1WA 3OL3A 2IXSA 1G4DA 2I5UA 1IDYA 3IL2A 3M07A 3CUQA 4LLLA 4L0YB 2ZMEB 1TT5B 1KU3A 4MIMA 4G8XA 1JHFA 4G7HF 3R6SA 3WE3A 3OYJA 4DYQA 3HSRA 1ETQA 4B3XA 4U0WA 2VQLA 1KU2A 2DA5A 2P0WA 1DP3A 3HKZN 3CCRI 4O5VA 2P5LC 1CF7B 2HZTA 4B09A 1WH5A 2OF7A 3KLOA 4L5EA 2DCEA 4A0ZA 4CZZA 3R60A 3F23A 1IN7A 1YRNA 1UELB 3ULQB 3FXKA 5B1BH 1LFBA 1IV6A 4QWQA 3VYRB 2P4WA 1W7PB 3WHBA 3OSFA 2V9VA 1F4KA 2KPMA 1X1PA 2K27A 4KMFA 1XGSA 2ZJQF 2CWEA 5F08A 2CUZA 2L02A 1SFEA 3LA2A 4RB3C 3E97A 2CQ7A 1BW6A 2R5ZB 2F2EA 3K0LA 1FX7A 4GRIA 4U0VA 2NVQJ 3HUGB 4F91B 4P5OA 3DEWA 2MABA 5FLXK 4KMUX 2RQQA 2WAQN 1IXRC 1I5ZA 1T8IA 2R7DA 1WVRA 1YX5A 5M5WJ 5F0FA 1ZH5A 3NARA 2O5RA 1B4AA 4IF4A 4EEFG 3OS1A 5GAEJ 4HX7A 4BY1J 3RQIA 2MLGA 4LIUA 3S3NA 1XGNA 3EUHC 2WV0A 3BJOA 4KDPA 2L7KA 4RS8A 2VODA 2EPFA 1YW7A 3I4MJ 4NC6A 3BC8A 1IDZA 4A5MA 3ABTA 2OTLI 1IN6A 4HLXA 3E1SA 1HW2A 2LYCA 4XORA 1ETWA 5HNFA 4DBRA 3SZTA 1VQ7I 2DU9A 3ELKA 4C3JJ 3FF5A 1FZPB 2KIQA 1KQ0A 2VKDA 2X6OA 5CVRA 1U3EM 5D5VB 4EJOA 2HVRA 3E3VA 2DOEA 1ZK8A 2BHZA 4BXXJ 3L00A 3U1KA 3P9CA 4HA8A 3M8JA 4UUSA 1Y0UA 1A31A 3CQZJ 3H0GJ 1T33A 4R8HA 1V54H 1W5TA 2EFOA 3W2VA 1YJ9I 1TC3C 3L1PA 4LMYA 2J5OA 4X6AJ 3GWZA 1TLHB 1IGNA 3CUOA 4XLHA 3SFIA 2ECBA 1O4XA 1ITYA 3MQ0A 3SDGA 2DA4A 1F36A 2LVSA 2DTRA 4M71A 1RR8C 3RZOJ 2V1DA 3KFWX 2IGKA 4HQEA 2JRTA 2CQNA 3PO2J 2O3FA 3FXQA 3KYCB 1R00A 3BQZA 4AIDA 3CO6C 3I4NJ 1YYVA 5EZGA 1NTCA 2WV1A 3C3WA 1HOMA 3OYBA 2X51A 2IT0A 4MGRA 3RDIA 1YTYA 4M6XA 2A68F 4BE2A 1ETYA 2NVYJ 3GZNB 3GTPJ 1ONVA 4AIJA 4J01A 2DOAA 1MMGA 2JQ7A 1D1CA 2IGOA 1KQ9A 5DM7F 2XASA 2XSDC 2XROA 1GDTA 1QNTA 4L9JA 2VQHA 2VE9A 1UHWA 3OYFA 3LSPA 1K6YA 3A1YA 4BJTA 3WTVC 2JA8J 5L3CA 2NVTJ 1K78B 1OLTA 5FKLA 3JAMK 1YFHA 4XRFA 4E7JA 3HJEA 1VTNC 1S29A 1W7PD 3KIOA 3UKGA 1CF7A 1HKTA 1YW8A 3GTMJ 3K70C 2GAUA 1I39A 4LB6B 2MBFA 2BY2A 2F5CA 4OINF 3OS2A 1TNSA 1ZG3A 3TQNA 3BTIA 5DM6F 4IOAF 2G7UA 4I6ZA 2E7XA 2R5YA 2NVXJ 4FE4A 4XBFA 4DW6A 3TMOA 2VE8A 4JP0A 3HPGA 3GTJJ 4L5IA 3EYIA 3B02A 1ORKA 4BH9A 1R58A 4UV8A 4P55A 4D1QA 1DDNA 3S2DJ 1W1WE 2BHYA 3JRCA 1ZGJA 4MQVA 4RMNA 2CRGA 4EGZA 1J9IA 4Y17A 5BPDA 4JYKA 3EQLF 3BTJA 4UUVA 1T08B 3B73A 3FXUA 5ERIA 5HDGA 1BOBA 1R4NB 4S05A 2JUGA 4BDZA 1FSEA 4ZYEA 4LG0B 3PM1A 1G3WA 3CUQB 3S1MJ 2OZUA 4BHCA 2P8TA 4LFUA 2XGCA 1ZGAA 2EFPA 3HRMA 1YX3A 2A6HF 4PJJA 4NDLA 2OV7A 4CSWA 1O7FA 1ZKGA 1VQ8I 1FOYA 2Z3YA 3FKIJ 3K2AA 2QQBA 2AHQA 2KHMA 4MNUA 4WX9A 3L2WA 2RV8A 5C44J 4HBLA 4U88A 2K9NA 2V6CA 2QKMB 1IF1A 1DPRA 1MZBA 4MHGA 3ZQGA 5HS7A 4AVPA 5EJCA 1YS7A 4AM3A 1ETKA 5E79C 4CYDA 4WXDA 2LK2A 2OA4A 3BZCA 3W6VA 4QIWN 5LHIA 1JE8A 4GDFA 1WI3A 3BOQA 4E70A 1AKHA 1GVDA 3IWFA 2P6SA 4AYBA 3U2RA 4XLPF 3Q3SA 3KYLA 4QPQA 2PG4A 3FMSA 1HQCA 2COBA 2Y69H 3V8LA 1W0UA 2CU7A 4IQ4A 2VUMJ 1OR7C 1Z9CA 2W57A 4OU0A 2HVQA 1ZGWA 1ZTRA 3GUDA 3S1RJ 2UZKA 2ZKZA 1GUUA 1RETA 3ZRGA 2XPVA 2Q8KA 3HOZJ 3K9TA 3PNTA 3F21A 3K1PA 1SFUA 4V2GA 1LE8A 2JPBA 3DPUA 1R71A 2KLOA 4XLFA 3PNVA 3T8TA 2K4JA 4G12A 4EM0B 1YE9A 3LA7A 1TW2A 1ZRDA 3DBLB 2DA1A 2EFWA 2HOEA 1IXCA 3QQAA 2HZDA 1BN5A 5DV5A 3BJ6A 2DK5A 4KICA 4OIPF 1R5ID 4YIRX 3WTWC 2VT3A 1K6OA 2DBBA 4CYCB 2P7CB 3NEUA 1EV7A 2EH3A 2R7WA 1VQMI 3KPHA 4AWXB 1QRYA 3EUKL 4D5FA 3WG9A 4A3JJ 4EM1A 2HQ5A 1F43A 1ZLJA 3F8CA 3HZJA 1AOYA 3F3XA 1Z6RA 2BY1A 5IYCJ 2CUJA 1S3JA 1VZ0A 2DOFA 2GA1A 2UUZA 3KYDB 1ZELA 1FMVA 4UVBA 5ICEA 1TWGJ 3DKXA 1TQPA 3BCAA 3Q9SA 2M0MA 2PX9A 3J7ZI 2D1HA 1AWCA 4CCKA 4UUTA 3K70D 4E7KA 3C1DA 2DAOA 3BG9A 2ZSHB 1TWAJ 3SQNA 2DJNA 3L2VA 1OR7A 4EJVA 3MEXA 2PMHA 1E3HA 1OISA 3BTLA 1BIBA 2HXIA 3R61A 4HNTA 5L3EA 1YJNI 1G3SA 2DK8A 2E1CA 1P7JA 4H4KC 4FTHA 3NQOA 2OZ6A 1Z0XA 2M45A 2AS5F 1OCPA 1FMWA 3QU6A 3HB9A 3H92A 1XSVA 2WADA 3H9JA 3JTHA 3HOUJ 3WE2A 4FE7A 3ERMA 4A69C 2LP0A 5J4YA 2QEXI 3ZQIA 1MBFA 2NS8A 4PZJA 2QVOA 1LKXA 2W24A 2DDBA 1H0MA 1USSA 1ZRFA 2DA3A 4E7HA 4KA4A 4RBOA 3GYHX 1K78A 1FC3A 1K83J 4GO1A 4BU2A 2GXBA 3HOWJ 2IJLA 1LFUP 2XHKA 1DP7P 3I56I 2R4GA 1G3TA 3SZGA 1FYKA 1G6NA 2CQKA 1DQUA 4MEXF 4CO8A 2K85A 2Y9YA 3VSLA 1XS9A 4XKVA 1UJ8A 3V42A 2E36A 3JR9A 5DUKA 2EV5A 2BOLA 2O0YA 4ESBA 2YX4A 2ZFWA 2F4IA 4HF0A 2LKSA 1O57A 3IWZA 5HDKA 4M6YA 5D6EA 2E5NA 1MMDA 3DXJF 1J2XA 2HGCA 4V19K 2VOOA 2XIGA 2ELJA 4M72A 4EJUA 1MH3A 1SAUA 4AVZA 3J80Z 1ZYRF 1JUMA 3E7LA 5E3LA 3AAFA 3V7RA 4RGXA 1BI3A 1K7AA 3EPZA 1I27A 3I9V2 2XAUA 2JSPA 3PSIA 4ENNA 1NK3P 4ZZDA 4M9ZA 2DT7B 2ZO4A 3K4MA 2HR3A 3PUFA 2HPIA 3RIRA 2V1NA 3D5RC 1QQIA 4PGGA 3CCEI 2EJRA 3SYTA 4RA2A 1OKRA 3KZIC 2TCTA 2WBMA 1V5EA 2FQ4A 2ICWG 2XPUA 3HRSA 5DEQA 1A04A 2EIJH 3ABKH 5M3FJ 2DMNA 3F22A 3S15J 2F4OB 2L7FP 3G73A 5F1RA 3ASOH 4XR6A 2GXGA 3S2HJ 4A3DJ 1B6AA 2NAZA 1FY7A 5K7ZA 2V9KA 5ICFA 2PI0A 2GM4A 1U5TB 1W7PA 4YG2F 5GTHC 3CC7I 4KISA 4P9UA 4Q4ZF 3QPTA 1RKWA 1VI0A 3T0YA 4A3LJ 4M3DA 4RAZA 1BR2A 5B3SH 3ZQ7A 4HNVA 4YIFA 4ZDOA 4IJAA 2JTVA 4JX4A 5DCFA 2E19A 5ICGA 1IUYA 3U1DA 4ANJA 4NC7A 2VJIA 2KZVA 4X1EA 2DFHA 5TISC 4BJ5C 3I5UA 3PSFA 5D6FA 4KN4X 4U7DA 3S1NJ 1MMNA 1IRGA 2IGMA 4ETSA 4F7ZA 2XVCA 4BE1A 3REOA 4ZDPA 4FT8A 4A3CJ 1BL0A 1P4AA 1XDUA 2YX7A 4M3BA 5JLXA 3OYMA 3A01A 1QGPA 3ZQQA 3GFIA 3KETA 3LSMA 1BA5A 2E7WA 3TDZC 2RREA 2OC6A 1ZHFA 2EV6A 4Y33A 2KDOA 3W2AA 2FSWA 3LFKA 2BXZA 2M7AA 4G7OF 1TWCJ 4XL9A 2CUEA 2IW5A 1V5GA 4XRMA 1MKMA 1OJLA 1R22A 2L01A 4NC8A 4CCJA 1ZN2A 1FLIA 4F93B 1RUNA 4HDUA 3OYKA 2E1OA 2NNNA 3EUAA 3H3ZA 1K4SA 3HUGA 2B7EA 5H2FC 2K02A 2VJJA 1JKQC 1MSEC 4M74A 2P7VB 2XV4S 4BY7J 5GAHJ 3F8BA 4EQQA 3GXOA 2R7OA 3H0DA 1ZLKA 4MLOA 3WGIA 1Z3XA 1U8RA 2K9QA 2VKVA 1IRZA 1W36D 3E5QA 4IX7A 2DT5A 4XIDA 3VYUB 1EH8A 1JUPA 2A69F 2R7QA 4OOIA 3BG5A 4HV6A 5JHUA 3O2PE 1D8KA 3ONQA 1V5FA 1X1AA 3MWMA 4P96A 2ME0A 2Y2ZA 1S9HA 1X1DA 1IV8A 1T6SA 2JJ7A 4I09A 1Z77A 4IPAA 1IN8A 2ZFUA 1KYWA 1VQLI 1R36A 1LFPA 2FNPA 1RRJA 2ZXHA 5L3DA 3HL2A 3COAC 1MMAA 2Z99A 2KQRA 3E5UA 2FF4A 2CUFA 1HKQA 5IP6A 3RTRA 1ETOA 3FK6A 3OYGA 3FHNA 2VKEA 1P6RA 5IT3A 3JAMZ 3I55I 3LNQA 1O3SA 2H27A 1I3QJ 1WCMJ 2H8RA 2VASA 3K4CA 1XMXA 2IPQX 1HA8A 1XD7A 4A0YA 4UV9A 1VQKI 3SEZA 2JVHA 3MMYB 2COMA 4RGRA 2DI3A 1TT0A 2ZC2A 2L5QA 3AL0B 5D5XB 3P9IA 2A5WA 5HLHA 1R5GA 1OYWA 3PNYA 4PUSA 1FOKA 2ZXJA 3I64A 1UCRA 4DJAA 1FBSA 2EZHA 3KCCA 1PJRA 1S7EA 5B5EC 2O03A 3Q0UA 4HAMA 5D4RA 4AUXA 1C0WA 5LBQA 1FJLA 1J0RA 3BY6A 5M3MJ 1YIOA 4IHXA 5F04A 4BUPA 1EH6A 3JW4A 3VEPA 1REPC 1WJBA 2VI6A 2ME6A 1SC7A 4IL6C 3CJRB 2Z5UA 4ESJA 2FRHA 2KRHA 3CESA 2CQQA 5LLQA 1TWHJ 3FZVA
chains in the Genus database with same CATH topology
4S0HB 3CMYA 4LOCA 3O8GA 4A3EJ 2XSDC 1GDTA 2DMPA 3LSPA 2M8GX 2ZB9A 5F1JA 5FJ8J 3JRAA 1B8IB 2JA8J 2M0CA 2Y0SN 2NVTJ 1HCRA 5FKLA 5C3EJ 2JMWA 3G1MA 5DS9A 1FEXA 3UKGA 5IOZA 3GTMJ 2L9RA 3HBLA 3ZOBA 1MBKA 5JLWA 3BTIA 1Y1WJ 1MNMC 1ENHA 2RAEA 4I6ZA 2R5YA 5FKMA 4M3EA 2NVXJ 4FE4A 4DW6A 1K61A 5IPAA 4JP0A 1QVUA 5F27A 4C3HJ 2KDZA 3GTJJ 2W48A 1ORKA 3GTOJ 2EQRA 1MH4A 1X58A 4XRSA 5EF6A 2L7MP 3S2DJ 1H8AC 3JRFA 3JRCA 1B72B 3GTGJ 1EF4A 2CRGA 3IV5A 2K40A 3CDLA 1RR7A 2LKXA 2DA6A 2X9DA 3JRHA 4IHVA 4JYKA 3B6CA 3BTJA 2VPRA 2E2JJ 2QCOA 4D7NA 5EGOB 2ECCA 3QPSA 3PM1A 3S1MJ 2H1KA 2DA7A 3OIOA 2R92J 2XGCA 1APLC 2X48A 2R5ZA 1MBHA 1VF9A 4NDLA 5EDNA 3JRIA 1ZKGA 1X2NA 2I10A 3FKIJ 3K2AA 2O8KA 2AHQA 2LTPA 3H3VK 4M3GA 4B3AA 5C44J 1W0TA 1JT0A 2K9NA 2MSYA 1HF0A 3ZQGA 2HOTA 1JJ8C 1Q1VA 1VFCA 1ETKA 4MFDA 4AC0A 2LK2A 3W6VA 2XRLA 4QIWN 2LFBA 2Y9ZA 1WI3A 1AKHA 1GVDA 2EBIA 2OPTA 3Q3SA 2COBA 1W0UA 1A5JA 3BTCA 2CU7A 2VUMJ 5IOYA 2CQXA 4BBSJ 2E2IJ 5EG0B 5EZHA 3BR2A 1ZTRA 2KT0A 5BNGA 3S1RJ 1ZGWA 1DU6A 4IHWA 1GUUA 1RETA 4CYCA 2XPVA 1JTYA 3ZQHA 2ID3A 3HOZJ 4BBRJ 4QSHA 4V2GA 1LE8A 4A3BJ 3FK7A 3TP0A 5C4XJ 3LSJA 3BR6A 2JA7J 4D7MA 5J1UA 3BR1A 4ABZA 3M3YJ 4DZPA 4G12A 3RZDJ 3BT9A 5FLVA 5F0HA 2DA1A 3PO3J 2DN0A 5M5YJ 3QQAA 4DYCA 1BW5A 2HI3A 4W97A 3NAUA 3D1NI 3JREA 2D5VA 3A02A 1HLVA 3DCFA 4DZJA 4FCYA 1E3OC 4CYCB 5FLMJ 1SANA 3IH2A 4IEJA 4JX5A 2K9SA 2HXOA 2L0KA 2EH3A 3BR5A 1FIAA 1QRYA 1VNDA 2O7OA 4D5FA 3GTLJ 4A3JJ 2HQ5A 1F43A 2HOAA 1D5YA 3IH4A 5M5XJ 2G0EA 5DTDA 5IYCJ 1OCTC 1AKHB 2LY9A 3A03A 1JKOC 2R93J 4W1UA 1P7IA 2JK3A 1R9TJ 2WB1N 2EZKA 1A6IA 1TWGJ 3JRGA 5K7HA 1B8IA 2JN6A 1AHDP 4GFBA 3MKLA 3CCYA 2MG4A 1B72A 4UUTA 1GV2A 2DA2A 1U9OA 3OOUA 5GPCA 3BG9A 1TWAJ 2DJNA 4C2MJ 5K7FA 5J1RA 1JUSA 2R7ZJ 2DMUA 2NOGA 3BTLA 3ZQLA 1GT0C 2HXIA 3GTKJ 3S14J 2IAIA 1P7JA 4FTHA 2M2EA 2AO9A 1Z0XA 1IJWC 5EGOA 1RPWA 1OCPA 5J3LA 2M34A 3HB9A 3K7AJ 1MSFC 4BKXA 2XGDA 3HOUJ 4XICA 3HOYJ 1FTTA 1TWFJ 4FE7A 2N8GA 4A69C 2LP0A 1G2HA 3ZQIA 1MBFA 1U9NA 2NS8A 2HDDA 2IEKA 3S17J 1T56A 2JWTA 3MN2A 4Y7NJ 2DA3A 2EZIA 4RBOA 1K83J 5GPAA 4DYRA 3HM5A 3HOWJ 3JRBA 1LFUP 3ZQCA 3Q0VA 2LLKA 5IP7J 5GP9A 3JRDA 3ZQFA 2MGQA 4A3KJ 5E3MA 2Y9YA 1XS9A 4A3MJ 3F0CA 3S1QJ 1CQTA 2GBYA 5EG0A 1HDDC 3JR9A 2QF7A 3LOCA 1JT6A 1DU0A 3HGYA 4QTRA 5HODA 2YS9A 5FKNA 1UHSA 2EZLA 2XGEA 1GV5A 1IUFA 4IHYA 4I76A 1LE8B 1IC8A 1Y1VJ 2FD5A 1MH3A 3GBGA 1U78A 2XPWA 3HOVJ 3E7LA 1JUMA 5E3LA 1X2MA 4B1RA 2LR8A 3TP3A 1NK3P 5IYBJ 1MBGA 2R5YB 1ETXA 5FKOA 3BG3A 2ID6A 2TCTA 2FQ4A 2XPUA 2PMZN 5FKKA 1XG1A 1NK2P 5E3OA 1WH7A 1JJ6C 1AU7A 5M3FJ 2DMNA 3S15J 2HOSA 2L7FP 5C4JJ 3LSGA 4XRSG 3OSGA 2B63J 2Y30A 2GLOA 2JA5J 1QPIA 1H89C 4MFEA 3S2HJ 4A3DJ 1HDPA 3VPRA 5K7ZA 1IDYA 2GM4A 2JA6J 3TW7A 1PUFA 3TW6A 4Y52J 1I6HJ 1RKWA 1VI0A 4A3LJ 4M3DA 4MIMA 4HNVA 4A3FJ 3C2BA 4JX4A 2E2HJ 3G1LA 2E19A 4DYQA 1RESA 1ETQA 4AYBN 4X1EA 2DA5A 3HKZN 1JKPC 1WGXA 1RKTA 2DTZA 3S1NJ 1WH5A 2OF7A 4L5EA 3RKQA 1YRNA 1LFBA 3HOXJ 1IV6A 3OSFA 3WHBA 4A3CJ 1BL0A 5JLXA 5F08A 2Y31A 4M3BA 3A01A 3MVPA 2R0QC 3BR0A 1BW6A 2R5ZB 1I50J 1BA5A 1WPKA 2NVQJ 3GTQJ 1H88C 3DEWA 4V2FA 2MW8A 1TWCJ 2NS7A 2FX0A 2WAQN 2CUEA 4XRMA 3BQYA 1OJLA 4D5CA 1JKRC 5M5WJ 3B6AA 5E3NA 2E1OA 5F0FA 4J19A 3NARA 3FISA 4EEFG 4BY1J 1JKQC 3RQIA 1MSEC 4JX6A 4BY7J 4XK4A 4MLOA 3SJMA 3I4MJ 2K9QA 2VKVA 2LD5A 1IRZA 1IDZA 5EYRA 4XIDA 3HGGA 1ZQ3P 1JUPA 1JTXA 1JGGA 1ETWA 2YU9J 3BG5A 2XB5A 1UMQA 3HDDA 4UUSB 4C3JJ 2ME0A 1FTZA 2X6OA 2Y2ZA 3IH3A 2IBDA 2JJ7A 1FIPA 1Z77A 3BR3A 3HEFA 1MBJA 2DMTA 5J1YA 1BJZA 1ZK8A 4BXXJ 2HYJA 1UG2A 2CUFA 5IYDJ 5IP6A 1ETOA 4UUSA 3FK6A 1ETVA 3CQZJ 3H0GJ 4C3IJ 1T33A 2VKEA 3S16J 4FISA 3LNQA 4MO7A 1I3QJ 1WCMJ 4B4CA 5EEAA 3A01B 1ZR2A 2H8RA 2YUSA 3Q0WA 2XB0X 4A93J 1TC3C 3L1PA 4X6AJ 4RDUA 1ZR4A 1XC5A 1IGNA 1YRNB 1MBEA 3SFIA 2ECBA 4M6VA 1O4XA 2O9LA 1ITYA 2TRTA 1OFCX 3M4OJ 3G1OA 2DA4A 1F36A 2LVSA 3SDGA 1U8BA 2P81A 1IG7A 3RZOJ 2EZHA 3FIWA 4A3GJ 3WHCA 3PO2J 1S7EA 3Q0UA 1FJLA 3TEDA 4AUXA 2DMQA 3BQZA 4A3IJ 2M9HA 1POGA 5M3MJ 3I4NJ 5EZGA 1QVTA 1NTCA 9ANTA 2WV1A 1HOMA 4IHXA 5F04A 2L7ZA 3QPLA 4M3FA 2VI6A 2ME6A 1ETYA 2NVYJ 3O8HA 3GTPJ 1PUFB 2FJ1A 2ELKA 1SFOJ 5IP9J 2CJJA 2CQQA 5F0CA 3LSRA 1TWHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S0H B;  3CMY A;  4LOC A;  3O8G A;  4A3E J;  2XSD C;  1GDT A;  2DMP A;  3LSP A;  2M8G X;  2ZB9 A;  5F1J A;  5FJ8 J;  3JRA A;  1B8I B;  2JA8 J;  2M0C A;  2Y0S N;  2NVT J;  1HCR A;  5FKL A;  5C3E J;  2JMW A;  3G1M A;  5DS9 A;  1FEX A;  3UKG A;  5IOZ A;  3GTM J;  2L9R A;  3HBL A;  3ZOB A;  1MBK A;  5JLW A;  3BTI A;  1Y1W J;  1MNM C;  1ENH A;  2RAE A;  4I6Z A;  2R5Y A;  5FKM A;  4M3E A;  2NVX J;  4FE4 A;  4DW6 A;  1K61 A;  5IPA A;  4JP0 A;  1QVU A;  5F27 A;  4C3H J;  2KDZ A;  3GTJ J;  2W48 A;  1ORK A;  3GTO J;  2EQR A;  1MH4 A;  1X58 A;  4XRS A;  5EF6 A;  2L7M P;  3S2D J;  1H8A C;  3JRF A;  3JRC A;  1B72 B;  3GTG J;  1EF4 A;  2CRG A;  3IV5 A;  2K40 A;  3CDL A;  1RR7 A;  2LKX A;  2DA6 A;  2X9D A;  3JRH A;  4IHV A;  4JYK A;  3B6C A;  3BTJ A;  2VPR A;  2E2J J;  2QCO A;  4D7N A;  5EGO B;  2ECC A;  3QPS A;  3PM1 A;  3S1M J;  2H1K A;  2DA7 A;  3OIO A;  2R92 J;  2XGC A;  1APL C;  2X48 A;  2R5Z A;  1MBH A;  1VF9 A;  4NDL A;  5EDN A;  3JRI A;  1ZKG A;  1X2N A;  2I10 A;  3FKI J;  3K2A A;  2O8K A;  2AHQ A;  2LTP A;  3H3V K;  4M3G A;  4B3A A;  5C44 J;  1W0T A;  1JT0 A;  2K9N A;  2MSY A;  1HF0 A;  3ZQG A;  2HOT A;  1JJ8 C;  1Q1V A;  1VFC A;  1ETK A;  4MFD A;  4AC0 A;  2LK2 A;  3W6V A;  2XRL A;  4QIW N;  2LFB A;  2Y9Z A;  1WI3 A;  1AKH A;  1GVD A;  2EBI A;  2OPT A;  3Q3S A;  2COB A;  1W0U A;  1A5J A;  3BTC A;  2CU7 A;  2VUM J;  5IOY A;  2CQX A;  4BBS J;  2E2I J;  5EG0 B;  5EZH A;  3BR2 A;  1ZTR A;  2KT0 A;  5BNG A;  3S1R J;  1ZGW A;  1DU6 A;  4IHW A;  1GUU A;  1RET A;  4CYC A;  2XPV A;  1JTY A;  3ZQH A;  2ID3 A;  3HOZ J;  4BBR J;  4QSH A;  4V2G A;  1LE8 A;  4A3B J;  3FK7 A;  3TP0 A;  5C4X J;  3LSJ A;  3BR6 A;  2JA7 J;  4D7M A;  5J1U A;  3BR1 A;  4ABZ A;  3M3Y J;  4DZP A;  4G12 A;  3RZD J;  3BT9 A;  5FLV A;  5F0H A;  2DA1 A;  3PO3 J;  2DN0 A;  5M5Y J;  3QQA A;  4DYC A;  1BW5 A;  2HI3 A;  4W97 A;  3NAU A;  3D1N I;  3JRE A;  2D5V A;  3A02 A;  1HLV A;  3DCF A;  4DZJ A;  4FCY A;  1E3O C;  4CYC B;  5FLM J;  1SAN A;  3IH2 A;  4IEJ A;  4JX5 A;  2K9S A;  2HXO A;  2L0K A;  2EH3 A;  3BR5 A;  1FIA A;  1QRY A;  1VND A;  2O7O A;  4D5F A;  3GTL J;  4A3J J;  2HQ5 A;  1F43 A;  2HOA A;  1D5Y A;  3IH4 A;  5M5X J;  2G0E A;  5DTD A;  5IYC J;  1OCT C;  1AKH B;  2LY9 A;  3A03 A;  1JKO C;  2R93 J;  4W1U A;  1P7I A;  2JK3 A;  1R9T J;  2WB1 N;  2EZK A;  1A6I A;  1TWG J;  3JRG A;  5K7H A;  1B8I A;  2JN6 A;  1AHD P;  4GFB A;  3MKL A;  3CCY A;  2MG4 A;  1B72 A;  4UUT A;  1GV2 A;  2DA2 A;  1U9O A;  3OOU A;  5GPC A;  3BG9 A;  1TWA J;  2DJN A;  4C2M J;  5K7F A;  5J1R A;  1JUS A;  2R7Z J;  2DMU A;  2NOG A;  3BTL A;  3ZQL A;  1GT0 C;  2HXI A;  3GTK J;  3S14 J;  2IAI A;  1P7J A;  4FTH A;  2M2E A;  2AO9 A;  1Z0X A;  1IJW C;  5EGO A;  1RPW A;  1OCP A;  5J3L A;  2M34 A;  3HB9 A;  3K7A J;  1MSF C;  4BKX A;  2XGD A;  3HOU J;  4XIC A;  3HOY J;  1FTT A;  1TWF J;  4FE7 A;  2N8G A;  4A69 C;  2LP0 A;  1G2H A;  3ZQI A;  1MBF A;  1U9N A;  2NS8 A;  2HDD A;  2IEK A;  3S17 J;  1T56 A;  2JWT A;  3MN2 A;  4Y7N J;  2DA3 A;  2EZI A;  4RBO A;  1K83 J;  5GPA A;  4DYR A;  3HM5 A;  3HOW J;  3JRB A;  1LFU P;  3ZQC A;  3Q0V A;  2LLK A;  5IP7 J;  5GP9 A;  3JRD A;  3ZQF A;  2MGQ A;  4A3K J;  5E3M A;  2Y9Y A;  1XS9 A;  4A3M J;  3F0C A;  3S1Q J;  1CQT A;  2GBY A;  5EG0 A;  1HDD C;  3JR9 A;  2QF7 A;  3LOC A;  1JT6 A;  1DU0 A;  3HGY A;  4QTR A;  5HOD A;  2YS9 A;  5FKN A;  1UHS A;  2EZL A;  2XGE A;  1GV5 A;  1IUF A;  4IHY A;  4I76 A;  1LE8 B;  1IC8 A;  1Y1V J;  2FD5 A;  1MH3 A;  3GBG A;  1U78 A;  2XPW A;  3HOV J;  3E7L A;  1JUM A;  5E3L A;  1X2M A;  4B1R A;  2LR8 A;  3TP3 A;  1NK3 P;  5IYB J;  1MBG A;  2R5Y B;  1ETX A;  5FKO A;  3BG3 A;  2ID6 A;  2TCT A;  2FQ4 A;  2XPU A;  2PMZ N;  5FKK A;  1XG1 A;  1NK2 P;  5E3O A;  1WH7 A;  1JJ6 C;  1AU7 A;  5M3F J;  2DMN A;  3S15 J;  2HOS A;  2L7F P;  5C4J J;  3LSG A;  4XRS G;  3OSG A;  2B63 J;  2Y30 A;  2GLO A;  2JA5 J;  1QPI A;  1H89 C;  4MFE A;  3S2H J;  4A3D J;  1HDP A;  3VPR A;  5K7Z A;  1IDY A;  2GM4 A;  2JA6 J;  3TW7 A;  1PUF A;  3TW6 A;  4Y52 J;  1I6H J;  1RKW A;  1VI0 A;  4A3L J;  4M3D A;  4MIM A;  4HNV A;  4A3F J;  3C2B A;  4JX4 A;  2E2H J;  3G1L A;  2E19 A;  4DYQ A;  1RES A;  1ETQ A;  4AYB N;  4X1E A;  2DA5 A;  3HKZ N;  1JKP C;  1WGX A;  1RKT A;  2DTZ A;  3S1N J;  1WH5 A;  2OF7 A;  4L5E A;  3RKQ A;  1YRN A;  1LFB A;  3HOX J;  1IV6 A;  3OSF A;  3WHB A;  4A3C J;  1BL0 A;  5JLX A;  5F08 A;  2Y31 A;  4M3B A;  3A01 A;  3MVP A;  2R0Q C;  3BR0 A;  1BW6 A;  2R5Z B;  1I50 J;  1BA5 A;  1WPK A;  2NVQ J;  3GTQ J;  1H88 C;  3DEW A;  4V2F A;  2MW8 A;  1TWC J;  2NS7 A;  2FX0 A;  2WAQ N;  2CUE A;  4XRM A;  3BQY A;  1OJL A;  4D5C A;  1JKR C;  5M5W J;  3B6A A;  5E3N A;  2E1O A;  5F0F A;  4J19 A;  3NAR A;  3FIS A;  4EEF G;  4BY1 J;  1JKQ C;  3RQI A;  1MSE C;  4JX6 A;  4BY7 J;  4XK4 A;  4MLO A;  3SJM A;  3I4M J;  2K9Q A;  2VKV A;  2LD5 A;  1IRZ A;  1IDZ A;  5EYR A;  4XID A;  3HGG A;  1ZQ3 P;  1JUP A;  1JTX A;  1JGG A;  1ETW A;  2YU9 J;  3BG5 A;  2XB5 A;  1UMQ A;  3HDD A;  4UUS B;  4C3J J;  2ME0 A;  1FTZ A;  2X6O A;  2Y2Z A;  3IH3 A;  2IBD A;  2JJ7 A;  1FIP A;  1Z77 A;  3BR3 A;  3HEF A;  1MBJ A;  2DMT A;  5J1Y A;  1BJZ A;  1ZK8 A;  4BXX J;  2HYJ A;  1UG2 A;  2CUF A;  5IYD J;  5IP6 A;  1ETO A;  4UUS A;  3FK6 A;  1ETV A;  3CQZ J;  3H0G J;  4C3I J;  1T33 A;  2VKE A;  3S16 J;  4FIS A;  3LNQ A;  4MO7 A;  1I3Q J;  1WCM J;  4B4C A;  5EEA A;  3A01 B;  1ZR2 A;  2H8R A;  2YUS A;  3Q0W A;  2XB0 X;  4A93 J;  1TC3 C;  3L1P A;  4X6A J;  4RDU A;  1ZR4 A;  1XC5 A;  1IGN A;  1YRN B;  1MBE A;  3SFI A;  2ECB A;  4M6V A;  1O4X A;  2O9L A;  1ITY A;  2TRT A;  1OFC X;  3M4O J;  3G1O A;  2DA4 A;  1F36 A;  2LVS A;  3SDG A;  1U8B A;  2P81 A;  1IG7 A;  3RZO J;  2EZH A;  3FIW A;  4A3G J;  3WHC A;  3PO2 J;  1S7E A;  3Q0U A;  1FJL A;  3TED A;  4AUX A;  2DMQ A;  3BQZ A;  4A3I J;  2M9H A;  1POG A;  5M3M J;  3I4N J;  5EZG A;  1QVT A;  1NTC A;  9ANT A;  2WV1 A;  1HOM A;  4IHX A;  5F04 A;  2L7Z A;  3QPL A;  4M3F A;  2VI6 A;  2ME6 A;  1ETY A;  2NVY J;  3O8H A;  3GTP J;  1PUF B;  2FJ1 A;  2ELK A;  1SFO J;  5IP9 J;  2CJJ A;  2CQQ A;  5F0C A;  3LSR A;  1TWH J; 
#chains in the Genus database with same CATH topology
 4YEJ A;  4ZYG A;  4CCO A;  4RAY A;  4RAF A;  3WGG A;  2OQR A;  3L2U A;  3QYB A;  4DIQ A;  2M8G X;  2WY8 Q;  2M5W A;  4OIO F;  2P5V A;  1JGS A;  2BEO A;  2ZB9 A;  3KEO A;  1XSX A;  3KZY A;  2HU9 A;  3C2G A;  2BZT A;  3DPL C;  1S7A A;  4IVN A;  1DPU A;  3G1M A;  3E6B A;  3QRF F;  2X0L A;  5H6R A;  2VBW A;  3VOE A;  2PFB A;  2JA2 A;  3DQV C;  2CMP A;  4O6J A;  1Z7L A;  1Y1W J;  1MNM C;  1WQ2 A;  2X4H A;  1UZC A;  2RAE A;  2ACJ A;  5J8F A;  5IPA A;  2MC4 A;  3PQK A;  4LD5 A;  3GTO J;  2EQR A;  2HS5 A;  3SDB A;  2DO7 A;  5LGN A;  4HV5 A;  3NWT A;  1MH4 A;  1P92 A;  3H9Q A;  1G3Y A;  2L7M P;  2BE5 F;  4OAZ A;  1B72 B;  3GTG J;  1EF4 A;  3IV5 A;  2K40 A;  3CDL A;  3N4M A;  3FBI B;  1RR7 A;  4B8X A;  3ERE D;  2LKX A;  3M7G A;  2KMU A;  2STW A;  3C7J A;  2D2W A;  5E18 F;  3K1M A;  1BI1 A;  2VPR A;  4BEH B;  2E2J J;  1Z7U A;  2H6B A;  3K2Z A;  1FOW A;  3CP2 A;  3VSK A;  5LRS A;  2WB1 A;  2JZY A;  2GIV A;  2ECC A;  2L9N A;  2VBZ A;  1GXP A;  4HZF A;  2PMU A;  1G59 A;  3RYP A;  1APL C;  1EJ9 A;  1PP7 U;  2X48 A;  2R5Z A;  1SVL A;  1MBH A;  4PJM A;  3ZMT A;  1R5H A;  4GYI A;  4LK0 F;  1X2N A;  4EV0 A;  2LTP A;  2VON A;  5F6F A;  4M3G A;  4B3A A;  3C2H A;  3TKY A;  1HF0 A;  1ZRC A;  3PQJ A;  2VLA A;  1P9Q C;  1XB4 A;  3F8M A;  2HOT A;  4PGH A;  1J7K A;  3EDP A;  4LLN A;  2XRL A;  4N4O B;  2ZJP F;  2MYS A;  2EV0 A;  5K1Y A;  2XUB A;  2W00 A;  2EBI A;  5HLT A;  4XN3 A;  4AIH A;  2OPT A;  4RGS A;  4E7L A;  4LB5 A;  1A5J A;  3BTC A;  5FD6 A;  5IOY A;  2CQX A;  1WJC A;  2XKP A;  4C2T A;  4L9V A;  4L9T A;  5EG0 B;  5J40 A;  2Y48 A;  5BNG A;  1DU6 A;  4BDY A;  2UXN A;  4IHW A;  3BG6 A;  1HSJ A;  4K2E A;  1R1T A;  1IAW A;  4P9F A;  2ID3 A;  3ZQH A;  2DFI A;  3M8F A;  1F9N A;  3A4C A;  5GTI C;  2LH9 A;  3CMM A;  1R1U A;  3FK7 A;  3CC2 I;  3PJR A;  3DEU A;  3TP0 A;  5C4X J;  3RPU A;  4JBA A;  3BR6 A;  2JUC A;  3IKV A;  5GAD J;  3S93 A;  4F92 B;  2Z1D A;  4NHJ A;  2ZJ2 A;  2VPL A;  4FHT A;  3RZD J;  1MJ9 A;  3BT9 A;  1QU3 A;  5FLV A;  1LEB A;  1ERD A;  2LNB A;  4AD9 A;  3PO3 J;  1NG7 A;  2HYF A;  4DYC A;  2W1O A;  3H9G A;  3H36 A;  2HNH A;  1BW5 A;  2HI3 A;  1TP4 A;  1SAX A;  2KKO A;  3NAU A;  4GGG A;  3ROU A;  5F64 A;  2DW4 A;  3MCZ A;  2FU4 A;  3CP8 A;  2BV6 A;  3E6C C;  3A02 A;  2DLL A;  1HLV A;  1F1Z A;  3BCB A;  4DZJ A;  1E3O C;  3ABU A;  2VB6 A;  5BQT A;  1VQO I;  2RNG A;  2XF6 A;  4ESF A;  4I2O A;  3GFJ A;  3A2K A;  2K9S A;  2HXO A;  4FET A;  1FIA A;  2ZCW A;  5IT9 K;  1VND A;  3QWL A;  3I59 B;  4CH7 A;  3A0H C;  4LIV A;  4F55 A;  3GTL J;  2LY2 A;  3TOA A;  3I0T A;  1BJA A;  1H9G A;  3K4J A;  3IH4 A;  5M5X J;  2G0E A;  2NYX A;  5DTD A;  5HDN A;  1TQM A;  2YR2 A;  1OCT C;  3ABM H;  2L54 A;  2L9S A;  3A03 A;  4LG0 A;  1V4R A;  1SD5 A;  3I4P A;  5FFZ A;  3CUQ C;  3WTU C;  2QSG X;  1HC8 A;  2XAF A;  2CFX A;  1XX5 A;  4W1U A;  4AU7 A;  5K5R A;  3CD6 I;  1P7I A;  2Y75 A;  4XKW A;  1YQA A;  4PJ0 C;  1A6I A;  4BHB A;  1J09 A;  4RB2 C;  3VYT B;  2JN6 A;  5HOO A;  1WJ5 A;  5E17 F;  1B72 A;  1U9O A;  2MD5 A;  3L09 A;  1XCV A;  3VDX A;  5CQG A;  4F52 A;  4RLQ A;  1VQ9 I;  3DLL F;  2DMU A;  2M3A A;  3QOP A;  1Y39 A;  3ZQL A;  2IAI A;  4PCQ A;  4QPO A;  4XLA A;  1G8X A;  1IJW C;  3A0B C;  1RPW A;  2LBF A;  4BL0 B;  2NS0 A;  3LQQ A;  3JSO A;  4BKX A;  1ODD A;  2XGD A;  1TWF J;  2Q2E A;  1MDM A;  3I58 A;  2KP6 A;  2N8G A;  3MKY B;  2RN7 A;  2F5V A;  2R7S A;  3HOT A;  2GOX B;  5KAF C;  3FHZ A;  4PDK A;  4ZDL A;  2JWT A;  1ZRE A;  2EZI A;  3QP5 A;  2VIX A;  3IUO A;  1B9N A;  2VBY A;  3KEQ A;  2BGC A;  2FQ3 A;  1YI2 I;  1O3T A;  2M4G A;  3JRB A;  1IN4 A;  2HQR A;  2PBI A;  4B47 A;  1I3A A;  2LSO A;  5DCM A;  2LLK A;  1RI7 A;  1D5V A;  2IGN A;  3KP2 A;  1N78 A;  1MJB A;  3RQ4 A;  3Q5F A;  3BG7 A;  3S1Q J;  1XCB A;  2WTE A;  4BYY A;  3ZP5 A;  4A6D A;  5EG0 A;  2FMY A;  3MKZ A;  2VQC A;  3K6G A;  1MD0 A;  2QUF A;  4E7Z A;  4BXF A;  1B9M A;  1N77 A;  1JT6 A;  3PL8 A;  5KVR A;  3W2W A;  4Y4R A;  2VC1 A;  2P6T A;  1QHG A;  1GV5 A;  4HYE A;  4QLC U;  5LFA A;  1VQN I;  4DBQ A;  1IUF A;  2X1E A;  1LE8 B;  3KP3 A;  1BI0 A;  2M87 A;  3GBG A;  5HS8 A;  4KT5 C;  1K4T A;  1SFK A;  2F6C A;  2IP2 A;  4L5J A;  2ESH A;  3O3K A;  1I1S A;  3OYE A;  5EEH A;  4B1R A;  2DT6 A;  4II3 A;  3CCV I;  1IZ1 A;  2QQ9 A;  1I6X A;  4OMZ A;  2R5Y B;  1FSH A;  4ENM A;  4LG3 A;  3H5R A;  1O7L A;  1QO0 D;  3DEE A;  2DOD A;  2Y0S A;  1KGS A;  4X0G A;  4EGY A;  2WWY A;  1V3F A;  3EUH A;  5AIP A;  3MZH A;  1X19 A;  1XG1 A;  1NK2 P;  3LQR A;  3IAM 2;  1ZG1 A;  1E2X A;  1AU7 A;  1VQ6 I;  2FOW A;  2LG4 A;  4A0X A;  2X85 A;  2MA3 A;  3CDI A;  3BPV A;  2X6W A;  4XLC A;  3MKW B;  4HF2 A;  1RC9 A;  3OSG A;  1SEU A;  2NOJ B;  2Y30 A;  2GLO A;  2JA5 J;  2DQL A;  4DGW B;  4MFE A;  1ULY A;  4G6D A;  1HDP A;  2X6X A;  4II2 A;  4GYG A;  1MND A;  3ZPL A;  4U0Y A;  1BR1 A;  3BJA A;  2JA6 J;  1JHH A;  2RQP A;  3P7N A;  3NRV A;  2H09 A;  3TW7 A;  3TW6 A;  4Y52 J;  2GZW A;  1S72 I;  2BYV E;  1LDK B;  5CVJ A;  3EET A;  4XMY A;  4MTE A;  1SMT A;  2PJR A;  2E2H J;  3AL0 C;  2LF8 A;  3K4L A;  2KJB A;  3AG1 H;  1RES A;  4N0B A;  1DUX C;  3OIP A;  5GAG J;  4AYB N;  1LPQ A;  2CGP A;  4ZYD A;  1YG2 A;  4F3Q A;  4XSZ F;  4BQO A;  3CCM I;  1NG6 A;  2HPM A;  1JKP C;  1WGX A;  2CO5 A;  2CS3 A;  4D0P A;  2DTZ A;  3FM5 A;  1N25 A;  2EFN A;  3W6J B;  3RKQ A;  1DGW Y;  1V55 H;  2X1C A;  3GLX A;  5L3F A;  5LGU A;  3HOX J;  2FBI A;  4EMS A;  4YEL A;  4ENK A;  3CCS I;  2Y31 A;  5J4V A;  2R0Q C;  3BR0 A;  4I01 A;  1I50 J;  4XLE A;  3DBH B;  1WPK A;  5L3B A;  4UNO A;  3PFY A;  3CC4 I;  2FX0 A;  2RKH A;  3BZ6 A;  4BAY A;  3IRR A;  4H0E A;  1F5T A;  3T8R A;  1JKR C;  1FYM A;  4PSW A;  2PLY A;  3B6A A;  2LRD A;  4J19 A;  5DD8 A;  2QEN A;  1UHM A;  1UFM A;  1LNW A;  5HLG A;  1OCZ H;  1X1C A;  2KIS A;  3OIQ A;  1D1B A;  3J7Y J;  3WTZ A;  2CW7 A;  3MD2 A;  3DFG A;  1WJF A;  1HW1 A;  2X1D A;  4XON A;  5EYR A;  3HGG A;  3LSK A;  3BWG A;  3QP6 A;  5EEG A;  2MH9 A;  3S2W A;  2E1M B;  3ZMV A;  1EH7 A;  5K5Q A;  1YHQ I;  3L2C A;  4RGU A;  2XB5 A;  2DDA A;  4UUS B;  4M73 A;  1FTZ A;  2IBD A;  2PQ8 A;  2HTJ A;  5IY5 H;  5CVI A;  3HEF A;  2DMT A;  4CA0 A;  5J1Y A;  2IS6 A;  1BJZ A;  4ZC3 A;  2ZME A;  3DU5 A;  3DV8 A;  5IYD J;  1PVE A;  3CCQ I;  3FBN B;  1ETV A;  4C3I J;  3S16 J;  1U5T C;  4WF2 A;  2LOO A;  2PMZ A;  3R0J A;  4MO7 A;  3A01 B;  3TBI A;  2XF7 A;  2CYY A;  1KON A;  2XB0 X;  3LAJ A;  4A93 J;  3RJP A;  4CCL A;  1XC5 A;  2QBY A;  1MBE A;  4BGD A;  4M6V A;  2LC2 A;  2O9L A;  4B48 A;  3VFZ A;  2TRT A;  1OFC X;  3T1B A;  4NBQ A;  3G1O A;  1XMK A;  2Q1Z B;  3J7A Y;  2P81 A;  5E8I A;  4RB0 A;  3WHC A;  3AG3 H;  3V7S A;  3LWF A;  1XPX A;  3WTT C;  2WAF A;  2Q2E B;  3KEY A;  1POG A;  9ANT A;  3GO5 A;  1QVT A;  2A05 A;  4PSX A;  2L7Z A;  4A2U A;  2ESN A;  1Z67 A;  2OBP A;  1WI9 A;  2RNJ A;  2XGX A;  5CPR B;  3VB2 A;  1Y6I A;  3FM3 A;  3BPX A;  3O8H A;  4BAC A;  1PUF B;  1LUJ B;  2BXY A;  2DYR H;  2ELK A;  1SFO J;  1KU7 A;  3KP5 A;  4A5N A;  3NWS A;  5IP9 J;  3LSR A;  3G4S I;  3C18 A;  3CMY A;  3ML6 A;  4G7Z F;  4Z6Y A;  2Q0O A;  1XGO A;  2E71 A;  4RM2 A;  4A3E J;  3AG2 H;  3CLO A;  3GVA A;  2KIU A;  2DMP A;  5DCM B;  4BQN A;  2AXL A;  2W4S A;  1IRF A;  3L7W A;  1OPC A;  1I1G A;  2LRE A;  1FNN A;  5F1J A;  3JRA A;  1B8I B;  2M0C A;  1HCR A;  3ABL H;  1EA3 A;  1LVA A;  4UB6 C;  2H1L A;  4ZTJ A;  1VQ5 I;  5C3E J;  3E0J B;  2JMW A;  4C30 A;  5DS9 A;  2FBK A;  2K3P A;  3OMY A;  4XN0 A;  5IOZ A;  3ZGK A;  2LF7 A;  3FWE A;  1KYZ A;  3F8N A;  4I98 B;  1XSD A;  1P4W A;  2EB7 A;  2D1V A;  2R7F A;  1T98 A;  1DGR M;  3HBL A;  3ZOB A;  1MBK A;  5JLW A;  4EAT A;  1ENH A;  1TTY A;  3IHU A;  3JTG A;  2A5Y B;  4M3E A;  2VQG A;  1R49 A;  1K61 A;  5E20 A;  4KIT B;  4C3H J;  3GLL A;  5F27 A;  4HW0 A;  3EYY A;  2W48 A;  1SVM A;  2MH2 A;  3FKJ A;  1X58 A;  2IA0 A;  2V26 A;  4AIK A;  3LA3 A;  3KP7 A;  5DYM A;  3JRF A;  1WFX A;  3S3O A;  2CG4 A;  3GEZ A;  3S3M A;  4IHV A;  1YIJ I;  5D8K B;  1ZAO A;  5E8G A;  3B6C A;  5JVT A;  2WAQ A;  1QPM A;  2QCO A;  2LBF B;  1ON2 A;  5EGO B;  2KL4 A;  2OUM A;  3BLY A;  3OIO A;  2R92 J;  2ZME C;  5LHH A;  3PIP F;  2D45 A;  2O8X A;  4NQW A;  2I8D A;  3CCJ I;  1Z6T A;  2IA2 A;  5LGT A;  3HKZ A;  5EDN A;  5DDG A;  4IHS A;  3FXR A;  3FXL A;  2KZG A;  2I10 A;  4NB5 A;  5TGT A;  2QWW A;  3UNG C;  1T39 A;  1D8J A;  1JT0 A;  1W0T A;  1X4P A;  1GXQ A;  2GA2 A;  4ZTF A;  5BS6 A;  2VN2 A;  1S6L A;  2YSR A;  3CLQ A;  5KAI C;  3TO7 A;  1Q1V A;  3BP8 A;  1VFC A;  2JRM A;  4UVA A;  4PJL A;  4AC0 A;  4HEA 2;  5JFR A;  3F8F A;  4YFK F;  3CME I;  2LFB A;  2H8W A;  3ZCO A;  3O6B B;  4E7I A;  1Y8R B;  4OMY A;  4Q5S F;  4XLN F;  2PEX A;  4YRV A;  1LVK A;  1NHA A;  3ECO A;  4KT6 A;  3F6V A;  3CDH A;  2E2I J;  2NXN B;  5EZH A;  2KT0 A;  2V1U A;  2IS2 A;  2B0L A;  1SFX A;  2HDW A;  2OJE D;  3JCU C;  2BVM A;  4IOC F;  4GXO A;  4DQ2 A;  4CYC A;  2VOP A;  3RSN A;  2M7B A;  2JT1 A;  1XDS A;  2C6Y A;  2STT A;  4BBR J;  1RUO A;  4QSH A;  1PUE E;  2DPU A;  3HC7 A;  1X1B A;  2CV0 A;  2HFH A;  1L0O C;  3LSJ A;  2JA7 J;  4PJN A;  3DLA A;  5J1U A;  3RKY A;  3BR1 A;  4RLF A;  2QSH X;  2CFO A;  5CKT A;  2MLK A;  1M1E B;  3FMR A;  2WAE A;  5F0H A;  2R7U A;  2DN0 A;  2J5P A;  1E0E A;  5M5Y J;  1D1A A;  5J8C A;  2KFD A;  1HBX G;  1HKS A;  3AKZ A;  2HWV A;  3N05 A;  1B59 A;  1OMI A;  3N97 A;  5IT9 Z;  4W97 A;  4J00 A;  3QPH A;  2YU3 A;  1FT9 A;  5LEK A;  3SXY A;  3I59 A;  1BM9 A;  4EJT A;  2XKO A;  3OY9 A;  3GCM A;  3KLN A;  4IEJ A;  3KP6 A;  2L0K A;  2W85 A;  5DUI A;  2VC0 A;  4A12 A;  3H5A A;  2EK5 A;  3E6M A;  1D0X A;  4PFP A;  2NNY A;  2DQR A;  2LY1 A;  2L9V A;  3E6D A;  1JKO C;  4BQA A;  2EIM H;  3OR1 C;  2JK3 A;  5B1A H;  2WB1 N;  2K3F A;  2ADU A;  5E1W A;  2QGU A;  4BJ6 C;  1J5Y A;  3FMQ A;  5K7H A;  1TL8 A;  2A3S A;  1AHD P;  2L2O A;  1S7O A;  3CCY A;  3MKL A;  2MG4 A;  1UAA A;  4OAY A;  1IW7 F;  4G9Y A;  1GV2 A;  2DA2 A;  5FFX A;  5FGM A;  1KA8 A;  5LHG A;  5K7F A;  5J1R A;  2EWN A;  1JUS A;  2VJ4 A;  2DJI A;  2R7Z J;  4WXC A;  3CO7 C;  3RYR A;  1JXS A;  2M2E A;  1U6G A;  3HRT A;  3RKW A;  2BY3 A;  2FOK A;  2CV1 A;  2V79 A;  1N75 A;  1RZ4 A;  3DTI A;  3I71 A;  2M34 A;  5J3L A;  4UB8 C;  3UR3 C;  1MSF C;  3F9K A;  2K9L A;  4A6E A;  4HQM A;  4YII A;  3OYH A;  2EFQ A;  2ZSI B;  1MDM B;  3HIF A;  2GXA A;  4IQJ A;  2HDD A;  3PUB A;  2BW3 A;  4YFX F;  3FXJ A;  1TNT A;  1LDD A;  1HXD A;  1BR4 A;  2F5D A;  4Y7N J;  3GFL A;  5KHD A;  3HM5 A;  2ZNZ A;  1WSU A;  4EJW A;  1A6Q A;  3ZQC A;  4YFN F;  3W6K B;  5FB2 A;  4TV7 A;  5IP7 J;  3OYI A;  5GP9 A;  1QHH D;  3JRD A;  1KQ8 A;  2MGQ A;  4HRI A;  4CZC A;  5E3M A;  1OYI A;  2R7T A;  1Z21 A;  4UY8 I;  4A3M J;  4LLG F;  3F0C A;  1K79 A;  1CQT A;  3OYC A;  3FDY A;  4LK1 F;  2GBY A;  1W5S A;  3ESW B;  5KCM A;  2K7L A;  1SD7 A;  1T38 A;  3U21 A;  5FRN A;  3MZY A;  4WWC A;  2QF7 A;  1DU0 A;  2GWR A;  3HGY A;  2K9M A;  2YS9 A;  3TOB A;  5HOD A;  5FKN A;  2UXX A;  4ZZL A;  2ZNY A;  1TZL A;  1UHS A;  4E7S A;  2UWM A;  2EZL A;  2FEZ A;  3DTE A;  4I02 A;  2XRN A;  3SHF A;  5D5W B;  3JSP A;  2ZXI A;  1LJ9 A;  4RAG A;  1U78 A;  2E1N A;  2XPW A;  3HOV J;  2QA4 I;  3IAS 2;  4I0A A;  2V7F A;  2LR8 A;  1T95 A;  2MD0 A;  2OQG A;  4S04 A;  3OV8 A;  4XNF A;  3H5N A;  3VOD A;  3IRQ A;  1MBG A;  3GX4 X;  1BI2 A;  3RI4 A;  4BHP A;  1ETX A;  4XKB A;  4XKC A;  3GZ6 A;  3J80 K;  3BG3 A;  2HQA A;  1CGP A;  5B66 C;  4OIR F;  1YOV B;  2DFF A;  5FKK A;  3V4G A;  3S32 A;  4L0Z B;  5E3O A;  1WH7 A;  1JJ6 C;  3ZN1 A;  1GLN A;  3CCU I;  3E5X A;  2ZJR F;  3ECH A;  2AQF A;  1TW3 A;  2RC4 A;  5J47 A;  3HPH A;  3KP4 A;  2B63 J;  3LMM A;  5JI6 A;  1YIT I;  1QPI A;  1H89 C;  1A36 A;  5E1X A;  1FP2 A;  3VPR A;  2KIM A;  2Z2S B;  2OCC H;  2CSO A;  4R1H A;  2VL8 A;  1R23 A;  4Q47 A;  1PUF A;  2W82 A;  1SD6 A;  1I6H J;  2EA4 A;  1O3Q A;  1PYV A;  4Y15 A;  4E4H A;  3I53 A;  4A3F J;  1YLF A;  2V1X A;  2DFE A;  2O6G E;  3C2B A;  3G1L A;  3HRU A;  5BOX A;  4XM3 A;  1X3Z B;  1MIJ A;  1SD4 A;  3S8P A;  3I54 A;  3WG7 H;  4CDG A;  3OS0 A;  4CHU A;  3DBR B;  3K69 A;  2M1B A;  2FBH A;  5A2Q Z;  5LRR A;  3F72 A;  1RKT A;  2XAH A;  5CVV A;  4OIQ F;  3CTA A;  3R0A A;  1YO5 C;  5L3G A;  4U7B A;  4IHT A;  2BVL A;  1WHU A;  3DPT A;  5KNL A;  2KRF A;  3DP7 A;  3HXL A;  3IC7 A;  1SVO A;  3MVP A;  4GCV A;  5E1Z B;  4O3M A;  4UVC A;  1P2F A;  3GFM A;  3CJN A;  1BOA A;  2K4B A;  3RKX A;  1B1B A;  3HTU A;  1H88 C;  3GTQ J;  1Y56 A;  4I0B A;  4V2F A;  2MW8 A;  2NS7 A;  1R4M B;  2QM3 A;  3WOD F;  4HX4 A;  3BQY A;  1FP1 D;  4D5C A;  5BPI A;  4KYW A;  5HLI A;  1RNL A;  3W3C A;  3K1N A;  3QU3 A;  4G6T B;  5E3N A;  3MFK A;  3QOD A;  3FIS A;  5JVG F;  1YJW I;  4LJZ F;  4IRH A;  1ON1 A;  3D5S C;  4JX6 A;  5FLX Z;  4FQG A;  2PJR B;  2HVS A;  1VQ4 I;  4ENJ A;  1LDJ A;  4XK4 A;  4C9Y A;  3SJM A;  2XAJ A;  2LD5 A;  5ICC A;  2E35 A;  1AA7 A;  3BDD A;  3QYE A;  5FO5 A;  3RPQ A;  4HLY A;  1WJA A;  2JPC A;  2QQ8 A;  4HOB A;  1JGG A;  1JTX A;  1ZQ3 P;  3ASN H;  4G6Q A;  2V9P A;  2YU9 J;  1QZY A;  4HST A;  3KX2 A;  5D5U B;  1UMQ A;  3HDD A;  3IP4 B;  3WTS C;  3LST A;  3BRO A;  3P5J A;  1OCO H;  1A35 A;  3IH3 A;  3LSH A;  1Z3Y A;  3AFH A;  1XTA A;  1FIP A;  3BR3 A;  5ILS A;  2VJ5 A;  1XN7 A;  3G3Z A;  1MBJ A;  2ZXW H;  5LD2 C;  2KJC A;  3DKY A;  3T5X A;  2HYJ A;  3BZK A;  2IS4 A;  1UG2 A;  2OD5 A;  5J6X A;  2KIF A;  3AG4 H;  4BNC A;  2HEO A;  2OU2 A;  5JR3 A;  1P4X A;  3QOE A;  3TGN A;  3HHG A;  2XAQ A;  2CW8 A;  4FIS A;  4FAS D;  3L2R A;  4B4C A;  5EEA A;  1ZR2 A;  4ZJZ A;  4CGZ A;  4L18 B;  2YUS A;  3Q0W A;  4LIT A;  3PIO F;  3QYF A;  1Y0N A;  5FRO A;  3CMA I;  2MC3 A;  4RDU A;  1MW7 A;  1ZR4 A;  1YRN B;  3L2Q A;  1UG0 A;  3P9K A;  1R1V A;  2MFZ A;  3V7C A;  2ISY A;  1ACI A;  3M4O J;  1IG7 A;  5AON A;  1U8B A;  1WZ2 A;  2CV2 A;  1S8N A;  3FX3 A;  3FIW A;  4A3G J;  2VXD A;  1TQI A;  3X2Q H;  3WU1 B;  1D0Y A;  3J7A O;  2ISZ A;  3TED A;  2DMQ A;  4A3I J;  2M9H A;  5K5O A;  2OTJ I;  1OQY A;  3SZP A;  4OWR B;  1HW5 A;  1X3W B;  3QPL A;  4XOT A;  4M3F A;  3G2B A;  2VT2 A;  1BBY A;  2FJ1 A;  5BMZ A;  2CJJ A;  5F0C A;  1S5L C;  2Z16 A;  4E6K G;  4S0H B;  4LOC A;  3O8G A;  3OL4 A;  2OCE A;  4KUM A;  4WCG A;  3J81 K;  2XSJ C;  2JVG A;  3TL4 X;  4R79 A;  4BQQ A;  5FJ8 J;  2A07 F;  1QZE A;  2Y0S N;  2PN6 A;  2AXT C;  4CCN A;  3IKT A;  2YPR A;  3ZXS A;  2F5E A;  5TJJ A;  1H9T A;  1FEX A;  3R4K A;  2K5C A;  4KN7 X;  2L9R A;  2CH0 A;  1QBJ A;  1LB2 A;  4IO9 F;  3GZ5 A;  2R7V A;  2X6Y A;  5FKM A;  4B43 A;  3WU0 A;  2VXZ A;  1PDN C;  3MZ8 A;  4Q48 A;  2E34 A;  1QVU A;  3LAP A;  2KDZ A;  4N4N B;  3CF5 F;  1IO2 A;  4BE0 A;  1J59 A;  4CCM A;  2V4J C;  2GOM A;  2E1M C;  1BC8 C;  2H6C A;  4XRS A;  2A6E F;  1MNE A;  5EF6 A;  1KZH A;  2L4A A;  1H8A C;  1JI8 A;  4HNU A;  2EIK H;  5LEJ A;  1BC7 C;  1YW9 A;  5CQE A;  3H3U A;  4XOP A;  3WGH A;  1Z91 A;  2VKH A;  4BS9 A;  1FBU A;  2DA6 A;  2M8E A;  2X9D A;  3JRH A;  5HS9 A;  4JOM A;  4FX0 A;  2ELH A;  3OYA A;  1WKM A;  4D7N A;  2NRA C;  1E17 A;  1R7J A;  1GHC A;  5HVQ C;  1YS6 A;  2E60 A;  1SMY F;  3QPS A;  3VYS B;  3SEQ A;  5FD5 A;  2H1K A;  2DA7 A;  4N9I A;  1U5T A;  3DF8 A;  1RIO H;  3CJQ B;  3DTK A;  3RCO A;  1VF9 A;  3JRI A;  2EIL H;  2F48 A;  1QA6 A;  1U2W A;  2EIN H;  2ZBK A;  5H6Q A;  2O8K A;  2HKX A;  3H3V K;  2W7N A;  4IRG A;  2R3S A;  3DWL E;  2Y0M A;  1STZ A;  1D0Z A;  2MSY A;  4HPQ A;  4WXH A;  4JK1 X;  4Y3O A;  3M9A A;  1JJ8 C;  3MAJ A;  5KK1 A;  1R6R A;  1IN5 A;  5TRD A;  3TDU C;  1LQ1 A;  2WY7 Q;  1XGM A;  4MFD A;  3ISP A;  4DOZ A;  2O61 A;  3D0S A;  2Y9Z A;  1UST A;  3HTS B;  1Y8Q B;  2A61 A;  3G71 I;  3OR2 C;  1MGT A;  3HHH A;  1WJE A;  4XQF A;  5ILV A;  5D8L B;  4M9S A;  4C2U A;  4KFC A;  4BBS J;  1T0F C;  4UXN A;  4EVI A;  4NUB A;  5AIQ A;  3BR2 A;  3DU6 A;  2IS1 A;  3V8K A;  4BXU A;  1KU9 A;  2L4M A;  2W84 A;  1JTY A;  4M9X A;  2CW0 F;  5D4S A;  2IVM A;  2UV1 A;  2QKL B;  1FOX A;  1XMA A;  2DYS H;  4A3B J;  3HSF A;  3LFU A;  3VWB A;  1D3Y A;  1UB9 A;  3FXM A;  2QZ8 A;  3OYL A;  4NQW B;  5ED4 A;  1MMS A;  4JQF A;  4NNJ A;  4D7M A;  4KNY A;  4I7H A;  4ABZ A;  3K10 A;  3M3Y J;  2QLZ A;  1Q1H A;  3V8J A;  4ZH4 F;  4DZP A;  4ZYH A;  2F5F A;  3Q9V A;  4B44 A;  2Z33 A;  4D9J A;  2JSC A;  3SFZ A;  1T0F A;  2KRC A;  3ZMS A;  4UHT A;  1NH3 A;  2AQE A;  4HX8 A;  3HG9 A;  3D1N I;  3K4B A;  2QSF X;  4CUG A;  3JRE A;  2D5V A;  3M8E A;  1OYY A;  5HNH A;  2HKO A;  3DCF A;  4FCY A;  4CXF A;  1WRJ A;  5FLM J;  2WC2 A;  1SAN A;  3QAH A;  3IH2 A;  4G94 A;  4JX5 A;  5CYV A;  4ZYA A;  2DPD A;  4CIC A;  3BR5 A;  2O7O A;  2XDV A;  2P5K A;  1ZAR A;  3LSI A;  1PP8 F;  2BW3 B;  3RPU D;  2R7R A;  3KZZ A;  2HOA A;  4EM2 A;  1D5Y A;  3DKW A;  2HYG D;  4IXA A;  1AKH B;  2LY9 A;  3HOS A;  3H35 A;  3ZN0 A;  5A2Q K;  1IRX A;  2R93 J;  1R9T J;  3OWT A;  3OYN A;  1IXS B;  4WK8 F;  2A6T A;  2EZK A;  3D5L A;  2EA2 A;  3JRG A;  2H94 A;  1O3R A;  3CF2 A;  1B8I A;  2HDC A;  2IRF G;  3GW2 A;  4GFB A;  5JHF A;  3TO6 A;  3OOP A;  3G6E I;  2LKP A;  3OOU A;  5GPC A;  1E3P A;  3K4N A;  4C2M J;  2QYO A;  2GIZ A;  2NOG A;  1GT0 C;  1W36 C;  3GTK J;  3S14 J;  3CZ6 A;  3TO9 A;  2AO9 A;  1LEA A;  4PK4 A;  5CVU A;  5EGO A;  3U9G A;  3HYI A;  1X3U A;  1OCR H;  4N9H A;  3K7A J;  3ZMD A;  4KIF A;  2FUG 2;  1WWX A;  2FE3 A;  3FXO A;  4XIC A;  1ZG5 A;  3HOY J;  1FTT A;  5DD4 A;  4U87 A;  1G2H A;  1GVJ A;  1J75 A;  6PAX A;  1U9N A;  2IEK A;  1Z1D A;  2HQN A;  4Z2Y A;  3F6O A;  3M1E A;  2ETH A;  3S17 J;  5FRM A;  1T56 A;  2PJP A;  3MN2 A;  1U0J A;  2NVU B;  1X4O A;  1HST A;  5GPA A;  4DYR A;  2XAG A;  2IA1 A;  3Q0V A;  4DNC A;  3L9F A;  2E5Z A;  2R7X A;  2G7H A;  3I3L A;  4I99 C;  3ZQF A;  4ITV A;  4PFO A;  2QQA A;  4KIB A;  4A3K J;  4L9N A;  2K86 A;  2G9W A;  2FXA A;  2RGV A;  5H20 A;  1MJA A;  2XF5 A;  3KE2 A;  4KJZ A;  2M4K A;  1HDD C;  3ZMU A;  2RVC A;  1FBQ A;  3ZMZ A;  3OYD A;  3GME A;  4BEH A;  2B9S A;  3LOC A;  4XSX F;  1FWZ A;  2W25 A;  4QTR A;  3HSE A;  2LMD A;  4MEY F;  5CJ9 A;  4ON0 A;  1FYL A;  2XGE A;  2HTS A;  4RB1 A;  3WTX C;  4IHY A;  3PFI A;  2L3D A;  4I76 A;  5ILU A;  2FNA A;  4IRI A;  1IC8 A;  1OCC H;  1Y1V J;  2FD5 A;  1FPQ A;  4FX4 A;  1W5C C;  4IKF A;  2BBY A;  3LL7 A;  4IZZ A;  2QBY B;  1W4M A;  1X2M A;  2M30 A;  3J81 Z;  3GF2 A;  3H1C A;  2V6E A;  2LDU A;  3TP3 A;  2OAZ A;  2WA0 A;  5IYB J;  1QZZ A;  1L3L A;  2XC7 A;  3CJT B;  4LGW A;  4HF1 A;  2GQQ A;  4HDV A;  5FKO A;  1VQP I;  2ID6 A;  1BIA A;  5CLS A;  2F4M B;  2TDX A;  3M1C A;  1TBX A;  2FML A;  2PMZ N;  3ZR8 X;  2RDP A;  3WU2 C;  2DXI A;  1Z05 A;  4Y13 A;  1WJD A;  1EKE A;  4MQ9 F;  3CCL I;  3K4K A;  4ASN A;  2BY0 A;  4RM3 A;  4MTD A;  2HOS A;  4HG2 A;  2FA5 A;  2VBX A;  2Z9O A;  1T2K A;  4HSR A;  5C4J J;  3LSG A;  3WTY C;  4KIG A;  4XRS G;  4P1W A;  3OL3 A;  2IXS A;  1G4D A;  2I5U A;  1IDY A;  3IL2 A;  3M07 A;  3CUQ A;  4LLL A;  4L0Y B;  2ZME B;  1TT5 B;  1KU3 A;  4MIM A;  4G8X A;  1JHF A;  4G7H F;  3R6S A;  3WE3 A;  3OYJ A;  4DYQ A;  3HSR A;  1ETQ A;  4B3X A;  4U0W A;  2VQL A;  1KU2 A;  2DA5 A;  2P0W A;  1DP3 A;  3HKZ N;  3CCR I;  4O5V A;  2P5L C;  1CF7 B;  2HZT A;  4B09 A;  1WH5 A;  2OF7 A;  3KLO A;  4L5E A;  2DCE A;  4A0Z A;  4CZZ A;  3R60 A;  3F23 A;  1IN7 A;  1YRN A;  1UEL B;  3ULQ B;  3FXK A;  5B1B H;  1LFB A;  1IV6 A;  4QWQ A;  3VYR B;  2P4W A;  1W7P B;  3WHB A;  3OSF A;  2V9V A;  1F4K A;  2KPM A;  1X1P A;  2K27 A;  4KMF A;  1XGS A;  2ZJQ F;  2CWE A;  5F08 A;  2CUZ A;  2L02 A;  1SFE A;  3LA2 A;  4RB3 C;  3E97 A;  2CQ7 A;  1BW6 A;  2R5Z B;  2F2E A;  3K0L A;  1FX7 A;  4GRI A;  4U0V A;  2NVQ J;  3HUG B;  4F91 B;  4P5O A;  3DEW A;  2MAB A;  5FLX K;  4KMU X;  2RQQ A;  2WAQ N;  1IXR C;  1I5Z A;  1T8I A;  2R7D A;  1WVR A;  1YX5 A;  5M5W J;  5F0F A;  1ZH5 A;  3NAR A;  2O5R A;  1B4A A;  4IF4 A;  4EEF G;  3OS1 A;  5GAE J;  4HX7 A;  4BY1 J;  3RQI A;  2MLG A;  4LIU A;  3S3N A;  1XGN A;  3EUH C;  2WV0 A;  3BJO A;  4KDP A;  2L7K A;  4RS8 A;  2VOD A;  2EPF A;  1YW7 A;  3I4M J;  4NC6 A;  3BC8 A;  1IDZ A;  4A5M A;  3ABT A;  2OTL I;  1IN6 A;  4HLX A;  3E1S A;  1HW2 A;  2LYC A;  4XOR A;  1ETW A;  5HNF A;  4DBR A;  3SZT A;  1VQ7 I;  2DU9 A;  3ELK A;  4C3J J;  3FF5 A;  1FZP B;  2KIQ A;  1KQ0 A;  2VKD A;  2X6O A;  5CVR A;  1U3E M;  5D5V B;  4EJO A;  2HVR A;  3E3V A;  2DOE A;  1ZK8 A;  2BHZ A;  4BXX J;  3L00 A;  3U1K A;  3P9C A;  4HA8 A;  3M8J A;  4UUS A;  1Y0U A;  1A31 A;  3CQZ J;  3H0G J;  1T33 A;  4R8H A;  1V54 H;  1W5T A;  2EFO A;  3W2V A;  1YJ9 I;  1TC3 C;  3L1P A;  4LMY A;  2J5O A;  4X6A J;  3GWZ A;  1TLH B;  1IGN A;  3CUO A;  4XLH A;  3SFI A;  2ECB A;  1O4X A;  1ITY A;  3MQ0 A;  3SDG A;  2DA4 A;  1F36 A;  2LVS A;  2DTR A;  4M71 A;  1RR8 C;  3RZO J;  2V1D A;  3KFW X;  2IGK A;  4HQE A;  2JRT A;  2CQN A;  3PO2 J;  2O3F A;  3FXQ A;  3KYC B;  1R00 A;  3BQZ A;  4AID A;  3CO6 C;  3I4N J;  1YYV A;  5EZG A;  1NTC A;  2WV1 A;  3C3W A;  1HOM A;  3OYB A;  2X51 A;  2IT0 A;  4MGR A;  3RDI A;  1YTY A;  4M6X A;  2A68 F;  4BE2 A;  1ETY A;  2NVY J;  3GZN B;  3GTP J;  1ONV A;  4AIJ A;  4J01 A;  2DOA A;  1MMG A;  2JQ7 A;  1D1C A;  2IGO A;  1KQ9 A;  5DM7 F;  2XAS A;  2XSD C;  2XRO A;  1GDT A;  1QNT A;  4L9J A;  2VQH A;  2VE9 A;  1UHW A;  3OYF A;  3LSP A;  1K6Y A;  3A1Y A;  4BJT A;  3WTV C;  2JA8 J;  5L3C A;  2NVT J;  1K78 B;  1OLT A;  5FKL A;  3JAM K;  1YFH A;  4XRF A;  4E7J A;  3HJE A;  1VTN C;  1S29 A;  1W7P D;  3KIO A;  3UKG A;  1CF7 A;  1HKT A;  1YW8 A;  3GTM J;  3K70 C;  2GAU A;  1I39 A;  4LB6 B;  2MBF A;  2BY2 A;  2F5C A;  4OIN F;  3OS2 A;  1TNS A;  1ZG3 A;  3TQN A;  3BTI A;  5DM6 F;  4IOA F;  2G7U A;  4I6Z A;  2E7X A;  2R5Y A;  2NVX J;  4FE4 A;  4XBF A;  4DW6 A;  3TMO A;  2VE8 A;  4JP0 A;  3HPG A;  3GTJ J;  4L5I A;  3EYI A;  3B02 A;  1ORK A;  4BH9 A;  1R58 A;  4UV8 A;  4P55 A;  4D1Q A;  1DDN A;  3S2D J;  1W1W E;  2BHY A;  3JRC A;  1ZGJ A;  4MQV A;  4RMN A;  2CRG A;  4EGZ A;  1J9I A;  4Y17 A;  5BPD A;  4JYK A;  3EQL F;  3BTJ A;  4UUV A;  1T08 B;  3B73 A;  3FXU A;  5ERI A;  5HDG A;  1BOB A;  1R4N B;  4S05 A;  2JUG A;  4BDZ A;  1FSE A;  4ZYE A;  4LG0 B;  3PM1 A;  1G3W A;  3CUQ B;  3S1M J;  2OZU A;  4BHC A;  2P8T A;  4LFU A;  2XGC A;  1ZGA A;  2EFP A;  3HRM A;  1YX3 A;  2A6H F;  4PJJ A;  4NDL A;  2OV7 A;  4CSW A;  1O7F A;  1ZKG A;  1VQ8 I;  1FOY A;  2Z3Y A;  3FKI J;  3K2A A;  2QQB A;  2AHQ A;  2KHM A;  4MNU A;  4WX9 A;  3L2W A;  2RV8 A;  5C44 J;  4HBL A;  4U88 A;  2K9N A;  2V6C A;  2QKM B;  1IF1 A;  1DPR A;  1MZB A;  4MHG A;  3ZQG A;  5HS7 A;  4AVP A;  5EJC A;  1YS7 A;  4AM3 A;  1ETK A;  5E79 C;  4CYD A;  4WXD A;  2LK2 A;  2OA4 A;  3BZC A;  3W6V A;  4QIW N;  5LHI A;  1JE8 A;  4GDF A;  1WI3 A;  3BOQ A;  4E70 A;  1AKH A;  1GVD A;  3IWF A;  2P6S A;  4AYB A;  3U2R A;  4XLP F;  3Q3S A;  3KYL A;  4QPQ A;  2PG4 A;  3FMS A;  1HQC A;  2COB A;  2Y69 H;  3V8L A;  1W0U A;  2CU7 A;  4IQ4 A;  2VUM J;  1OR7 C;  1Z9C A;  2W57 A;  4OU0 A;  2HVQ A;  1ZGW A;  1ZTR A;  3GUD A;  3S1R J;  2UZK A;  2ZKZ A;  1GUU A;  1RET A;  3ZRG A;  2XPV A;  2Q8K A;  3HOZ J;  3K9T A;  3PNT A;  3F21 A;  3K1P A;  1SFU A;  4V2G A;  1LE8 A;  2JPB A;  3DPU A;  1R71 A;  2KLO A;  4XLF A;  3PNV A;  3T8T A;  2K4J A;  4G12 A;  4EM0 B;  1YE9 A;  3LA7 A;  1TW2 A;  1ZRD A;  3DBL B;  2DA1 A;  2EFW A;  2HOE A;  1IXC A;  3QQA A;  2HZD A;  1BN5 A;  5DV5 A;  3BJ6 A;  2DK5 A;  4KIC A;  4OIP F;  1R5I D;  4YIR X;  3WTW C;  2VT3 A;  1K6O A;  2DBB A;  4CYC B;  2P7C B;  3NEU A;  1EV7 A;  2EH3 A;  2R7W A;  1VQM I;  3KPH A;  4AWX B;  1QRY A;  3EUK L;  4D5F A;  3WG9 A;  4A3J J;  4EM1 A;  2HQ5 A;  1F43 A;  1ZLJ A;  3F8C A;  3HZJ A;  1AOY A;  3F3X A;  1Z6R A;  2BY1 A;  5IYC J;  2CUJ A;  1S3J A;  1VZ0 A;  2DOF A;  2GA1 A;  2UUZ A;  3KYD B;  1ZEL A;  1FMV A;  4UVB A;  5ICE A;  1TWG J;  3DKX A;  1TQP A;  3BCA A;  3Q9S A;  2M0M A;  2PX9 A;  3J7Z I;  2D1H A;  1AWC A;  4CCK A;  4UUT A;  3K70 D;  4E7K A;  3C1D A;  2DAO A;  3BG9 A;  2ZSH B;  1TWA J;  3SQN A;  2DJN A;  3L2V A;  1OR7 A;  4EJV A;  3MEX A;  2PMH A;  1E3H A;  1OIS A;  3BTL A;  1BIB A;  2HXI A;  3R61 A;  4HNT A;  5L3E A;  1YJN I;  1G3S A;  2DK8 A;  2E1C A;  1P7J A;  4H4K C;  4FTH A;  3NQO A;  2OZ6 A;  1Z0X A;  2M45 A;  2AS5 F;  1OCP A;  1FMW A;  3QU6 A;  3HB9 A;  3H92 A;  1XSV A;  2WAD A;  3H9J A;  3JTH A;  3HOU J;  3WE2 A;  4FE7 A;  3ERM A;  4A69 C;  2LP0 A;  5J4Y A;  2QEX I;  3ZQI A;  1MBF A;  2NS8 A;  4PZJ A;  2QVO A;  1LKX A;  2W24 A;  2DDB A;  1H0M A;  1USS A;  1ZRF A;  2DA3 A;  4E7H A;  4KA4 A;  4RBO A;  3GYH X;  1K78 A;  1FC3 A;  1K83 J;  4GO1 A;  4BU2 A;  2GXB A;  3HOW J;  2IJL A;  1LFU P;  2XHK A;  1DP7 P;  3I56 I;  2R4G A;  1G3T A;  3SZG A;  1FYK A;  1G6N A;  2CQK A;  1DQU A;  4MEX F;  4CO8 A;  2K85 A;  2Y9Y A;  3VSL A;  1XS9 A;  4XKV A;  1UJ8 A;  3V42 A;  2E36 A;  3JR9 A;  5DUK A;  2EV5 A;  2BOL A;  2O0Y A;  4ESB A;  2YX4 A;  2ZFW A;  2F4I A;  4HF0 A;  2LKS A;  1O57 A;  3IWZ A;  5HDK A;  4M6Y A;  5D6E A;  2E5N A;  1MMD A;  3DXJ F;  1J2X A;  2HGC A;  4V19 K;  2VOO A;  2XIG A;  2ELJ A;  4M72 A;  4EJU A;  1MH3 A;  1SAU A;  4AVZ A;  3J80 Z;  1ZYR F;  1JUM A;  3E7L A;  5E3L A;  3AAF A;  3V7R A;  4RGX A;  1BI3 A;  1K7A A;  3EPZ A;  1I27 A;  3I9V 2;  2XAU A;  2JSP A;  3PSI A;  4ENN A;  1NK3 P;  4ZZD A;  4M9Z A;  2DT7 B;  2ZO4 A;  3K4M A;  2HR3 A;  3PUF A;  2HPI A;  3RIR A;  2V1N A;  3D5R C;  1QQI A;  4PGG A;  3CCE I;  2EJR A;  3SYT A;  4RA2 A;  1OKR A;  3KZI C;  2TCT A;  2WBM A;  1V5E A;  2FQ4 A;  2ICW G;  2XPU A;  3HRS A;  5DEQ A;  1A04 A;  2EIJ H;  3ABK H;  5M3F J;  2DMN A;  3F22 A;  3S15 J;  2F4O B;  2L7F P;  3G73 A;  5F1R A;  3ASO H;  4XR6 A;  2GXG A;  3S2H J;  4A3D J;  1B6A A;  2NAZ A;  1FY7 A;  5K7Z A;  2V9K A;  5ICF A;  2PI0 A;  2GM4 A;  1U5T B;  1W7P A;  4YG2 F;  5GTH C;  3CC7 I;  4KIS A;  4P9U A;  4Q4Z F;  3QPT A;  1RKW A;  1VI0 A;  3T0Y A;  4A3L J;  4M3D A;  4RAZ A;  1BR2 A;  5B3S H;  3ZQ7 A;  4HNV A;  4YIF A;  4ZDO A;  4IJA A;  2JTV A;  4JX4 A;  5DCF A;  2E19 A;  5ICG A;  1IUY A;  3U1D A;  4ANJ A;  4NC7 A;  2VJI A;  2KZV A;  4X1E A;  2DFH A;  5TIS C;  4BJ5 C;  3I5U A;  3PSF A;  5D6F A;  4KN4 X;  4U7D A;  3S1N J;  1MMN A;  1IRG A;  2IGM A;  4ETS A;  4F7Z A;  2XVC A;  4BE1 A;  3REO A;  4ZDP A;  4FT8 A;  4A3C J;  1BL0 A;  1P4A A;  1XDU A;  2YX7 A;  4M3B A;  5JLX A;  3OYM A;  3A01 A;  1QGP A;  3ZQQ A;  3GFI A;  3KET A;  3LSM A;  1BA5 A;  2E7W A;  3TDZ C;  2RRE A;  2OC6 A;  1ZHF A;  2EV6 A;  4Y33 A;  2KDO A;  3W2A A;  2FSW A;  3LFK A;  2BXZ A;  2M7A A;  4G7O F;  1TWC J;  4XL9 A;  2CUE A;  2IW5 A;  1V5G A;  4XRM A;  1MKM A;  1OJL A;  1R22 A;  2L01 A;  4NC8 A;  4CCJ A;  1ZN2 A;  1FLI A;  4F93 B;  1RUN A;  4HDU A;  3OYK A;  2E1O A;  2NNN A;  3EUA A;  3H3Z A;  1K4S A;  3HUG A;  2B7E A;  5H2F C;  2K02 A;  2VJJ A;  1JKQ C;  1MSE C;  4M74 A;  2P7V B;  2XV4 S;  4BY7 J;  5GAH J;  3F8B A;  4EQQ A;  3GXO A;  2R7O A;  3H0D A;  1ZLK A;  4MLO A;  3WGI A;  1Z3X A;  1U8R A;  2K9Q A;  2VKV A;  1IRZ A;  1W36 D;  3E5Q A;  4IX7 A;  2DT5 A;  4XID A;  3VYU B;  1EH8 A;  1JUP A;  2A69 F;  2R7Q A;  4OOI A;  3BG5 A;  4HV6 A;  5JHU A;  3O2P E;  1D8K A;  3ONQ A;  1V5F A;  1X1A A;  3MWM A;  4P96 A;  2ME0 A;  2Y2Z A;  1S9H A;  1X1D A;  1IV8 A;  1T6S A;  2JJ7 A;  4I09 A;  1Z77 A;  4IPA A;  1IN8 A;  2ZFU A;  1KYW A;  1VQL I;  1R36 A;  1LFP A;  2FNP A;  1RRJ A;  2ZXH A;  5L3D A;  3HL2 A;  3COA C;  1MMA A;  2Z99 A;  2KQR A;  3E5U A;  2FF4 A;  2CUF A;  1HKQ A;  5IP6 A;  3RTR A;  1ETO A;  3FK6 A;  3OYG A;  3FHN A;  2VKE A;  1P6R A;  5IT3 A;  3JAM Z;  3I55 I;  3LNQ A;  1O3S A;  2H27 A;  1I3Q J;  1WCM J;  2H8R A;  2VAS A;  3K4C A;  1XMX A;  2IPQ X;  1HA8 A;  1XD7 A;  4A0Y A;  4UV9 A;  1VQK I;  3SEZ A;  2JVH A;  3MMY B;  2COM A;  4RGR A;  2DI3 A;  1TT0 A;  2ZC2 A;  2L5Q A;  3AL0 B;  5D5X B;  3P9I A;  2A5W A;  5HLH A;  1R5G A;  1OYW A;  3PNY A;  4PUS A;  1FOK A;  2ZXJ A;  3I64 A;  1UCR A;  4DJA A;  1FBS A;  2EZH A;  3KCC A;  1PJR A;  1S7E A;  5B5E C;  2O03 A;  3Q0U A;  4HAM A;  5D4R A;  4AUX A;  1C0W A;  5LBQ A;  1FJL A;  1J0R A;  3BY6 A;  5M3M J;  1YIO A;  4IHX A;  5F04 A;  4BUP A;  1EH6 A;  3JW4 A;  3VEP A;  1REP C;  1WJB A;  2VI6 A;  2ME6 A;  1SC7 A;  4IL6 C;  3CJR B;  2Z5U A;  4ESJ A;  2FRH A;  2KRH A;  3CES A;  2CQQ A;  5LLQ A;  1TWH J;  3FZV A; 
#chains in the Genus database with same CATH homology
 4S0H B;  3CMY A;  4LOC A;  3O8G A;  4A3E J;  2XSD C;  1GDT A;  2DMP A;  3LSP A;  2M8G X;  2ZB9 A;  5F1J A;  5FJ8 J;  3JRA A;  1B8I B;  2JA8 J;  2M0C A;  2Y0S N;  2NVT J;  1HCR A;  5FKL A;  5C3E J;  2JMW A;  3G1M A;  5DS9 A;  1FEX A;  3UKG A;  5IOZ A;  3GTM J;  2L9R A;  3HBL A;  3ZOB A;  1MBK A;  5JLW A;  3BTI A;  1Y1W J;  1MNM C;  1ENH A;  2RAE A;  4I6Z A;  2R5Y A;  5FKM A;  4M3E A;  2NVX J;  4FE4 A;  4DW6 A;  1K61 A;  5IPA A;  4JP0 A;  1QVU A;  5F27 A;  4C3H J;  2KDZ A;  3GTJ J;  2W48 A;  1ORK A;  3GTO J;  2EQR A;  1MH4 A;  1X58 A;  4XRS A;  5EF6 A;  2L7M P;  3S2D J;  1H8A C;  3JRF A;  3JRC A;  1B72 B;  3GTG J;  1EF4 A;  2CRG A;  3IV5 A;  2K40 A;  3CDL A;  1RR7 A;  2LKX A;  2DA6 A;  2X9D A;  3JRH A;  4IHV A;  4JYK A;  3B6C A;  3BTJ A;  2VPR A;  2E2J J;  2QCO A;  4D7N A;  5EGO B;  2ECC A;  3QPS A;  3PM1 A;  3S1M J;  2H1K A;  2DA7 A;  3OIO A;  2R92 J;  2XGC A;  1APL C;  2X48 A;  2R5Z A;  1MBH A;  1VF9 A;  4NDL A;  5EDN A;  3JRI A;  1ZKG A;  1X2N A;  2I10 A;  3FKI J;  3K2A A;  2O8K A;  2AHQ A;  2LTP A;  3H3V K;  4M3G A;  4B3A A;  5C44 J;  1W0T A;  1JT0 A;  2K9N A;  2MSY A;  1HF0 A;  3ZQG A;  2HOT A;  1JJ8 C;  1Q1V A;  1VFC A;  1ETK A;  4MFD A;  4AC0 A;  2LK2 A;  3W6V A;  2XRL A;  4QIW N;  2LFB A;  2Y9Z A;  1WI3 A;  1AKH A;  1GVD A;  2EBI A;  2OPT A;  3Q3S A;  2COB A;  1W0U A;  1A5J A;  3BTC A;  2CU7 A;  2VUM J;  5IOY A;  2CQX A;  4BBS J;  2E2I J;  5EG0 B;  5EZH A;  3BR2 A;  1ZTR A;  2KT0 A;  5BNG A;  3S1R J;  1ZGW A;  1DU6 A;  4IHW A;  1GUU A;  1RET A;  4CYC A;  2XPV A;  1JTY A;  3ZQH A;  2ID3 A;  3HOZ J;  4BBR J;  4QSH A;  4V2G A;  1LE8 A;  4A3B J;  3FK7 A;  3TP0 A;  5C4X J;  3LSJ A;  3BR6 A;  2JA7 J;  4D7M A;  5J1U A;  3BR1 A;  4ABZ A;  3M3Y J;  4DZP A;  4G12 A;  3RZD J;  3BT9 A;  5FLV A;  5F0H A;  2DA1 A;  3PO3 J;  2DN0 A;  5M5Y J;  3QQA A;  4DYC A;  1BW5 A;  2HI3 A;  4W97 A;  3NAU A;  3D1N I;  3JRE A;  2D5V A;  3A02 A;  1HLV A;  3DCF A;  4DZJ A;  4FCY A;  1E3O C;  4CYC B;  5FLM J;  1SAN A;  3IH2 A;  4IEJ A;  4JX5 A;  2K9S A;  2HXO A;  2L0K A;  2EH3 A;  3BR5 A;  1FIA A;  1QRY A;  1VND A;  2O7O A;  4D5F A;  3GTL J;  4A3J J;  2HQ5 A;  1F43 A;  2HOA A;  1D5Y A;  3IH4 A;  5M5X J;  2G0E A;  5DTD A;  5IYC J;  1OCT C;  1AKH B;  2LY9 A;  3A03 A;  1JKO C;  2R93 J;  4W1U A;  1P7I A;  2JK3 A;  1R9T J;  2WB1 N;  2EZK A;  1A6I A;  1TWG J;  3JRG A;  5K7H A;  1B8I A;  2JN6 A;  1AHD P;  4GFB A;  3MKL A;  3CCY A;  2MG4 A;  1B72 A;  4UUT A;  1GV2 A;  2DA2 A;  1U9O A;  3OOU A;  5GPC A;  3BG9 A;  1TWA J;  2DJN A;  4C2M J;  5K7F A;  5J1R A;  1JUS A;  2R7Z J;  2DMU A;  2NOG A;  3BTL A;  3ZQL A;  1GT0 C;  2HXI A;  3GTK J;  3S14 J;  2IAI A;  1P7J A;  4FTH A;  2M2E A;  2AO9 A;  1Z0X A;  1IJW C;  5EGO A;  1RPW A;  1OCP A;  5J3L A;  2M34 A;  3HB9 A;  3K7A J;  1MSF C;  4BKX A;  2XGD A;  3HOU J;  4XIC A;  3HOY J;  1FTT A;  1TWF J;  4FE7 A;  2N8G A;  4A69 C;  2LP0 A;  1G2H A;  3ZQI A;  1MBF A;  1U9N A;  2NS8 A;  2HDD A;  2IEK A;  3S17 J;  1T56 A;  2JWT A;  3MN2 A;  4Y7N J;  2DA3 A;  2EZI A;  4RBO A;  1K83 J;  5GPA A;  4DYR A;  3HM5 A;  3HOW J;  3JRB A;  1LFU P;  3ZQC A;  3Q0V A;  2LLK A;  5IP7 J;  5GP9 A;  3JRD A;  3ZQF A;  2MGQ A;  4A3K J;  5E3M A;  2Y9Y A;  1XS9 A;  4A3M J;  3F0C A;  3S1Q J;  1CQT A;  2GBY A;  5EG0 A;  1HDD C;  3JR9 A;  2QF7 A;  3LOC A;  1JT6 A;  1DU0 A;  3HGY A;  4QTR A;  5HOD A;  2YS9 A;  5FKN A;  1UHS A;  2EZL A;  2XGE A;  1GV5 A;  1IUF A;  4IHY A;  4I76 A;  1LE8 B;  1IC8 A;  1Y1V J;  2FD5 A;  1MH3 A;  3GBG A;  1U78 A;  2XPW A;  3HOV J;  3E7L A;  1JUM A;  5E3L A;  1X2M A;  4B1R A;  2LR8 A;  3TP3 A;  1NK3 P;  5IYB J;  1MBG A;  2R5Y B;  1ETX A;  5FKO A;  3BG3 A;  2ID6 A;  2TCT A;  2FQ4 A;  2XPU A;  2PMZ N;  5FKK A;  1XG1 A;  1NK2 P;  5E3O A;  1WH7 A;  1JJ6 C;  1AU7 A;  5M3F J;  2DMN A;  3S15 J;  2HOS A;  2L7F P;  5C4J J;  3LSG A;  4XRS G;  3OSG A;  2B63 J;  2Y30 A;  2GLO A;  2JA5 J;  1QPI A;  1H89 C;  4MFE A;  3S2H J;  4A3D J;  1HDP A;  3VPR A;  5K7Z A;  1IDY A;  2GM4 A;  2JA6 J;  3TW7 A;  1PUF A;  3TW6 A;  4Y52 J;  1I6H J;  1RKW A;  1VI0 A;  4A3L J;  4M3D A;  4MIM A;  4HNV A;  4A3F J;  3C2B A;  4JX4 A;  2E2H J;  3G1L A;  2E19 A;  4DYQ A;  1RES A;  1ETQ A;  4AYB N;  4X1E A;  2DA5 A;  3HKZ N;  1JKP C;  1WGX A;  1RKT A;  2DTZ A;  3S1N J;  1WH5 A;  2OF7 A;  4L5E A;  3RKQ A;  1YRN A;  1LFB A;  3HOX J;  1IV6 A;  3OSF A;  3WHB A;  4A3C J;  1BL0 A;  5JLX A;  5F08 A;  2Y31 A;  4M3B A;  3A01 A;  3MVP A;  2R0Q C;  3BR0 A;  1BW6 A;  2R5Z B;  1I50 J;  1BA5 A;  1WPK A;  2NVQ J;  3GTQ J;  1H88 C;  3DEW A;  4V2F A;  2MW8 A;  1TWC J;  2NS7 A;  2FX0 A;  2WAQ N;  2CUE A;  4XRM A;  3BQY A;  1OJL A;  4D5C A;  1JKR C;  5M5W J;  3B6A A;  5E3N A;  2E1O A;  5F0F A;  4J19 A;  3NAR A;  3FIS A;  4EEF G;  4BY1 J;  1JKQ C;  3RQI A;  1MSE C;  4JX6 A;  4BY7 J;  4XK4 A;  4MLO A;  3SJM A;  3I4M J;  2K9Q A;  2VKV A;  2LD5 A;  1IRZ A;  1IDZ A;  5EYR A;  4XID A;  3HGG A;  1ZQ3 P;  1JUP A;  1JTX A;  1JGG A;  1ETW A;  2YU9 J;  3BG5 A;  2XB5 A;  1UMQ A;  3HDD A;  4UUS B;  4C3J J;  2ME0 A;  1FTZ A;  2X6O A;  2Y2Z A;  3IH3 A;  2IBD A;  2JJ7 A;  1FIP A;  1Z77 A;  3BR3 A;  3HEF A;  1MBJ A;  2DMT A;  5J1Y A;  1BJZ A;  1ZK8 A;  4BXX J;  2HYJ A;  1UG2 A;  2CUF A;  5IYD J;  5IP6 A;  1ETO A;  4UUS A;  3FK6 A;  1ETV A;  3CQZ J;  3H0G J;  4C3I J;  1T33 A;  2VKE A;  3S16 J;  4FIS A;  3LNQ A;  4MO7 A;  1I3Q J;  1WCM J;  4B4C A;  5EEA A;  3A01 B;  1ZR2 A;  2H8R A;  2YUS A;  3Q0W A;  2XB0 X;  4A93 J;  1TC3 C;  3L1P A;  4X6A J;  4RDU A;  1ZR4 A;  1XC5 A;  1IGN A;  1YRN B;  1MBE A;  3SFI A;  2ECB A;  4M6V A;  1O4X A;  2O9L A;  1ITY A;  2TRT A;  1OFC X;  3M4O J;  3G1O A;  2DA4 A;  1F36 A;  2LVS A;  3SDG A;  1U8B A;  2P81 A;  1IG7 A;  3RZO J;  2EZH A;  3FIW A;  4A3G J;  3WHC A;  3PO2 J;  1S7E A;  3Q0U A;  1FJL A;  3TED A;  4AUX A;  2DMQ A;  3BQZ A;  4A3I J;  2M9H A;  1POG A;  5M3M J;  3I4N J;  5EZG A;  1QVT A;  1NTC A;  9ANT A;  2WV1 A;  1HOM A;  4IHX A;  5F04 A;  2L7Z A;  3QPL A;  4M3F A;  2VI6 A;  2ME6 A;  1ETY A;  2NVY J;  3O8H A;  3GTP J;  1PUF B;  2FJ1 A;  2ELK A;  1SFO J;  5IP9 J;  2CJJ A;  2CQQ A;  5F0C A;  3LSR A;  1TWH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...