1QRYA

Homeobox protein vnd (ventral nervous system defective protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
b'GSHMSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLTSLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HOMEOBOX VENTRAL NERVOUS SYSTEM DEFECTIVE PROTEIN)
publication title Distortion of the three-dimensional structure of the vnd/NK-2 homeodomain bound to DNA induced by an embryonically lethal A35T point mutation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 11
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qryA00
4A3EJ 1TWGJ 2CQXA 1AKHB 1ZTRA 1FTZA 2EZHA 4IHXA 2MGQA 1BA5A 5J1YA 3BR0A 4C2MJ 1JGGA 1GT0C 2K9NA 5JLWA 2EZKA 1IV6A 4M3GA 2KT0A 1H8AC 1IRZA 2DA5A 1OCPA 1FIPA 3ZQLA 1P7IA 2YS9A 4EEFG 1AU7A 5M5YJ 1IDZA 4A3FJ 2CUEA 2M9HA 3S1QJ 2LY9A 2Y30A 2DA3A 4B1RA 1XG1A 1MBKA 4V2GA 5IOZA 1APLC 2O8KA 5EDNA 5EG0A 2HOSA 1ZR4A 3MKLA 3PO2J 2Y31A 1X2MA 5E3NA 3ZQCA 1HDDC 3JRHA 3Q0WA 2FQ4A 3BR3A 1LE8A 3BT9A 1K61A 4A3IJ 4NDLA 3NAUA 4IHWA 2PMZN 2NVXJ 3TP0A 2YU9J 3GTQJ 3TW7A 1MBGA 2GLOA 2HQ5A 1SANA 2WV1A 2DA6A 3OIOA 5EG0B 3GTLJ 1GVDA 3LSPA 3D1NI 1MBHA 5J1RA 2VPRA 4A3DJ 3QPLA 5F0HA 5F0CA 4W1UA 5M5WJ 1T33A 2NVQJ 2QCOA 4XRSA 1LE8B 1NK2P 1FEXA 3IV5A 5J1UA 1WPKA 2ID6A 4A3JJ 4JX4A 1W0UA 2XSDC 1IG7A 4D7MA 5GPCA 2HOTA 1RETA 1FIAA 2EQRA 1VI0A 2R5YB 1ZKGA 1MSFC 4DYCA 5FKNA 4S0HB 1WGXA 3GBGA 1IJWC 2E19A 1JKRC 2NVTJ 1MH3A 2ELKA 3RZOJ 3K7AJ 2L0KA 3GTJJ 4BBRJ 1MSEC 1POGA 4MO7A 5DTDA 2M2EA 5FJ8J 1ZQ3P 3I4MJ 4BBSJ 5FKLA 2R5ZB 2COBA 3BTJA 2R0QC 2NS8A 2TCTA 3G1LA 5K7HA 2H1KA 5IYDJ 5EZHA 3Q0VA 3SFIA 3BQZA 3HOYJ 1MBJA 2EBIA 1TWAJ 4UUSB 1AKHA 5BNGA 2LVSA 2JA7J 3TP3A 1CQTA 1RESA 5GPAA 1QVUA 2CQQA 1X2NA 4B3AA 3QQAA 1ORKA 3S2DJ 2HOAA 3BQYA 1RKWA 5K7FA 2FJ1A 4M3FA 3CMYA 3A03A 3VPRA 2GM4A 4IHVA 4BXXJ 1K83J 3BR2A 2LP0A 5E3MA 1U9OA 2NOGA 2XPUA 3FKIJ 4AYBN 5HODA 5C44J 3OSGA 3PO3J 1RPWA 4FTHA 2RAEA 1NK3P 3CCYA 3HBLA 2LLKA 3PM1A 3S2HJ 3WHBA 3RQIA 1U8BA 3TW6A 2NVYJ 2EH3A 1ZR2A 2YUSA 2JA6J 3M3YJ 1E3OC 1EF4A 5IP6A 3OSFA 1A6IA 3JR9A 3HB9A 2AO9A 4DZJA 1I50J 1WI3A 3S16J 3BTIA 1B8IB 1MH4A 1IDYA 3Q3SA 1UHSA 3H3VK 2Y9YA 2GBYA 1S7EA 3BG9A 4IEJA 2VKEA 2DMTA 1AHDP 2XRLA 4D7NA 3BR5A 2LD5A 4C3HJ 5K7ZA 1TWCJ 1Z77A 4M3BA 1ENHA 2Y2ZA 4A3LJ 3JREA 4A93J 4L5EA 1ETYA 2NS7A 2X48A 5EEAA 3JRBA 1QPIA 2N8GA 2MSYA 1H88C 3W6VA 1YRNA 1BW5A 2L7FP 5J3LA 3B6AA 5F1JA 2R5YA 4M3EA 3FK7A 3LSRA 4QSHA 1WCMJ 4ABZA 1PUFB 1T56A 2LR8A 3RKQA 1I3QJ 3JRAA 2WAQN 4CYCB 1GV2A 5F04A 4XRMA 4QTRA 5FLMJ 3HKZN 2E2HJ 1UMQA 2EZLA 2QF7A 3LSGA 5JLXA 2VI6A 4M6VA 3SDGA 2DA1A 2M8GX 4XICA 4BKXA 2R5ZA 1WH5A 3OOUA 1OJLA 1SFOJ 1YRNB 4C3IJ 2W48A 1OCTC 5FKMA 2JMWA 1VF9A 2EZIA 1TWFJ 1ETXA 4M3DA 4UUSA 2JJ7A 1HLVA 1U78A 1BL0A 4LOCA 1X58A 2TRTA 1TWHJ 3GTKJ 2L7MP 2XPWA 2DMPA 5FKKA 3WHCA 2HDDA 3JRGA 2HXOA 2LFBA 1JT0A 2LK2A 1TC3C 2P81A 2DMUA 2HXIA 1DU0A 1D5YA 3H0GJ 4FE4A 1JJ6C 5F0FA 2AHQA 2H8RA 2R92J 2X6OA 4A3GJ 3ZQHA 2HYJA 2L9RA 5EYRA 2ZB9A 5C4JJ 1WH7A 5DS9A 1B72A 3ZQGA 3JRFA 2D5VA 1W0TA 1GDTA 1Y1VJ 1LFUP 1XC5A 3DCFA 1IGNA 3GTPJ 3O8GA 2ECBA 1RKTA 4JX6A 2ME6A 3ZQFA 3O8HA 5EGOA 4B4CA 1A5JA 1B8IA 2VKVA 2DJNA 2MW8A 3HGGA 2B63J 1QRYA 3IH4A 4UUTA 4MFEA 2G0EA 2DTZA 1JJ8C 3UKGA 4FISA 3HOUJ 4A3BJ 3G1OA 1B72B 3G1MA 1JKQC 3HOXJ 2JN6A 4RBOA 2R7ZJ 2FX0A 4JP0A 2E2IJ 5EF6A 2CUFA 3FIWA 2IBDA 2M0CA 4W97A 4A3KJ 2CJJA 5EGOB 2ME0A 3BG3A 3JRDA 5IYBJ 3IH3A 1PUFA 1U9NA 2DA4A 1FJLA 4GFBA 2JA8J 4CYCA 3C2BA 2MG4A 4MFDA 3L1PA 3QPSA 3S1RJ 4DYRA 2WB1N 1Q1VA 2FD5A 2JA5J 4AUXA 2OPTA 3SJMA 2XPVA 1JUPA 5FKOA 3E7LA 1ETVA 3ZQIA 5C3EJ 2XB5A 2X9DA 1DU6A 1FTTA 5IPAA 2L7ZA 4FCYA 1HCRA 3HDDA 4MLOA 2LKXA 1UG2A 3K2AA 3BR6A 3GTOJ 2JK3A 5EZGA 1GV5A 1JT6A 3FISA 1HOMA 2XGCA 4XIDA 3MVPA 2OF7A 1NTCA 9ANTA 3BTLA 3GTGJ 1QVTA 2E2JJ 1BJZA 4X6AJ 3HGYA 5GP9A 4A69C 1F36A 1G2HA 1JTYA 4G12A 4D5CA 5F08A 4J19A 3S1MJ 4XK4A 5FLVA 1ETWA 1RR7A 1ZK8A 4DYQA 3LNQA 3BG5A 1MNMC 3IH2A 2XB0X 4Y7NJ 3Q0UA 1BW6A 3DEWA 4D5FA 2E1OA 2DA7A 3TEDA 1ETKA 3ZOBA 1HDPA 1VNDA 2ID3A 2JWTA 5M5XJ 4DW6A 1IUFA 4DZPA 2R93J 3JRIA 2DN0A 1JKOC 4HNVA 4AC0A 1ZGWA 3S1NJ 2K9QA 3S14J 1OFCX 2KDZA 4JX5A 2O7OA 2K9SA 2M34A 3B6CA 3GTMJ 2DA2A 1VFCA 4BY7J 1Y1WJ 3BR1A 2XGDA 2CU7A 2I10A 2K40A 3HEFA 4I76A 2IAIA 1LFBA 4Y52J 1F43A 4JYKA 3F0CA 3HOZJ 2Y9ZA 1JUSA 5E3LA 3S15J 1JTXA 3HOVJ 2HI3A 2IEKA 3MN2A 3M4OJ 1JKPC 3CQZJ 5C4XJ 1ETQA 3A01A 1O4XA 2Y0SN 1ITYA 5IOYA 5IP9J 4MIMA 5M3FJ 4I6ZA 3RZDJ 3HOWJ 4C3JJ 1IC8A 2CRGA 1H89C 1GUUA 4X1EA 1R9TJ 2O9LA 4XRSG 5M3MJ 4A3MJ 3S17J 3LSJA 2XGEA 3I4NJ 2DMNA 3CDLA 3HM5A 3NARA 4V2FA 5IP7J 3BTCA 4BY1J 1XS9A 2ECCA 1JUMA 2LTPA 2VUMJ 1MBFA 3LOCA 1ETOA 4IHYA 5IYCJ 1I6HJ 1Z0XA 4A3CJ 1P7JA 1MBEA 5E3OA 5F27A 3A01B 3A02A 4RDUA 4QIWN 3JRCA 4FE7A 3FK6A 1HF0A 2DMQA
chains in the Genus database with same CATH superfamily
2Z16A 3GEZA 3PFIA 3ZRGA 2GZWA 3V4GA 3A2KA 1R58A 2CQXA 2QBYA 4I02A 3REOA 1BR1A 3U2RA 3ZMZA 4GO1A 3BR0A 3W2AA 2QLZA 4LMYA 1DQUA 4M72A 2VE8A 1QZEA 1P2FA 2E35A 4M3GA 2AQEA 2KT0A 1QGPA 5LRSA 1IRZA 2KFDA 3ZQLA 1P7IA 2KRFA 2DU9A 2FNPA 4AD9A 4ETSA 4A3FJ 3CLQA 2BV6A 3BJAA 2Y30A 3KIOA 1FBUA 2DA3A 2HOSA 5CVVA 1IN6A 2KMUA 1DUXC 1K79A 3ZQCA 2L01A 1OQYA 4BACA 6PAXA 1R23A 3L2UA 3BR3A 4IO9F 1BN5A 2IGNA 1K61A 2W00A 2QSFX 1MIJA 1U5TA 3GFLA 3PQKA 4YFKF 4IHWA 2OJED 3C18A 3KPHA 2NVXJ 2STTA 4Q4ZF 2YU9J 1FP2A 1FWZA 3TW7A 1J09A 3HUGA 3F8NA 3OIPA 1U0JA 4F3QA 1H9GA 5BPDA 2JRTA 2DA6A 4ZYDA 2IXSA 5CVJA 1SMYF 3W3CA 5EG0B 3C7JA 1B1BA 3CZ6A 3LSPA 3D1NI 3CCRI 4CCOA 1T08B 1KQ9A 1HSTA 2QSHX 2NVQJ 3FMRA 4E4HA 2V1UA 2X6XA 5E79C 2IVMA 2CO5A 3L2CA 2EIMH 2VJIA 3KP4A 4A3JJ 4NQWA 4D7MA 1Z05A 1FMVA 1RETA 4AIHA 1FIAA 3BZ6A 1VI0A 3OIQA 5IT3A 2R5YB 2NS0A 2LOOA 1MSFC 2CV0A 5FKNA 4S0HB 4A6DA 3AG1H 1T0FC 1LVAA 2R7FA 3CCVI 3QRFF 4CCKA 2VQHA 1OYYA 1J59A 3A0BC 1FBSA 1I5ZA 2ELKA 2ELJA 3KLOA 2NNYA 5E1ZB 5KAIC 2KIFA 5FJ8J 4HSTA 2GQQA 3QOEA 1VQPI 3BCBA 4IHTA 4L5JA 5DEQA 1X4OA 3FF5A 2VQGA 2R5ZB 2GOMA 1W5SA 3I5UA 4HA8A 4UV9A 2K4BA 5EZHA 3Q0VA 3H3UA 1OYIA 3SFIA 4ZTJA 3OL4A 3SZTA 2RGVA 3DQVC 3HOYJ 2L9SA 5KK1A 1ZGAA 1TWAJ 4M9SA 4UUSB 1YITI 5FROA 3LA7A 1Y8RB 2KQRA 3K1NA 4PFOA 1CQTA 4UUVA 5GPAA 2BY1A 3P7NA 4B3AA 2DK8A 1RKWA 2FJ1A 1OCRH 1G3YA 4QLCU 4LLNA 1HW1A 3L7WA 2IS6A 5JVTA 2VBXA 3QYBA 1K78A 4AYBN 3RPUA 5LHHA 5HODA 1OCCH 2BBYA 3OSGA 1YIOA 2MC4A 3F6VA 5E1WA 1RPWA 3CC7I 2EFOA 2PX9A 1G3WA 2R3SA 1UG0A 3PL8A 3LQRA 2BY0A 3ZN0A 3DPUA 4ENMA 1VQ6I 2V9VA 2NVYJ 1QQIA 4XLFA 2B0LA 3KEYA 4MGRA 2KIUA 2JA6J 5FD5A 3M3YJ 1S7OA 4BDZA 3CUQA 5IP6A 1B6AA 5KAFC 2NOJB 1D8JA 2D1VA 1I50J 3BTIA 3Q3SA 1UHSA 3H3VK 2Y9YA 1S7EA 3FXUA 1R6RA 1W5TA 4GGGA 4RM3A 1V5FA 4D7NA 3BR5A 4ASNA 4BJ5C 3K2ZA 2HVQA 3G71I 3NEUA 3B02A 4C3HJ 3KEQA 1Z77A 4PJ0C 2Y2ZA 2K85A 3F23A 2O0YA 3JREA 2NS7A 5E18F 5LGNA 4EJWA 3JRBA 2VQCA 1H88C 2LKSA 3DWLE 3W6VA 1JI8A 4HX7A 3WTXC 2L7FP 3FK7A 3LSRA 1WCMJ 4ESBA 2KPMA 2HKOA 4XOTA 1XSDA 3R0JA 3S8PA 5D5UB 2K9MA 2WAQN 4CYCB 3SQNA 3A4CA 3PIPF 2EZLA 5K5OA 2P7VB 4WXHA 2NYXA 3SDGA 1NH3A 1BI3A 2M8GX 4N9HA 2ZXJA 4XICA 1GXQA 3I0TA 1KYWA 4I0AA 3OOUA 4PZJA 2QQAA 1V5GA 1WJBA 5AIPA 1YRNB 3DKYA 5CKTA 2BGCA 3D0SA 1EV7A 1YLFA 3RI4A 4M3DA 1FT9A 2JJ7A 2OCCH 1U78A 1IUYA 2BOLA 1TT0A 3ASNH 3GUDA 2VN2A 3MZ8A 3WHCA 2L02A 5FKKA 5HNHA 3TO6A 1LVKA 4BQQA 4KMFA 3EPZA 3ROUA 3K4NA 3RQ4A 1DU0A 5KVRA 3R60A 1IO2A 2JPCA 1ODDA 5H6QA 1L0OC 2HTJA 3N4MA 2AS5F 1JJ6C 5F0FA 5TISC 3CMAI 3Q5FA 2X6OA 3KETA 3OYHA 4O6JA 3BG7A 3ZQHA 2HYJA 2PFBA 3FHZA 4R79A 3DU6A 2MD0A 1BR4A 3LFUA 3I64A 4J01A 4BQNA 3CF5F 3BPVA 1Z9CA 2PG4A 2ACJA 3OWTA 3JRFA 4BE1A 2VOOA 1SVLA 2P8TA 3I58A 4IX7A 2OQRA 1GVJA 1RI7A 2A61A 3HOSA 1QA6A 1ULYA 5A2QZ 2ME6A 3ZQFA 2QKLB 4QWQA 1A5JA 3Q9SA 1B8IA 4RAZA 3HGGA 3K4CA 4RGUA 4MFEA 1AWCA 3FMQA 2G0EA 3ECHA 1X3WB 4LK1F 4RB3C 1B4AA 3IUOA 4OOIA 3G73A 3VB2A 3BWGA 3G1OA 1B72B 3G1MA 4DQ2A 4F92B 2DYSH 3N05A 5GTHC 1MDMA 3HHGA 2A07F 1B9NA 4EMSA 3K70C 5B66C 1MKMA 2FX0A 1YFHA 2E2IJ 3GFIA 2JVHA 2CUFA 1F4KA 4IRIA 2M0CA 4L9VA 4W97A 2EINH 4A3KJ 2DJIA 1F5TA 3BG3A 1P9QC 3CMEI 1W36C 2NXNB 5IYBJ 3IH3A 4IRGA 4J00A 4XRFA 5FGMA 1FJLA 4UVAA 2BVLA 4AYBA 4MFDA 1WQ2A 2R7DA 3MKZA 3MFKA 3VYTB 1H0MA 2MH2A 2JA5J 1BIBA 4AUXA 2DQRA 2MH9A 3LA2A 3SJMA 2STWA 4CXFA 1EJ9A 1V3FA 2PJRB 1ETVA 3JW4A 3HSFA 2R7XA 1D0XA 3FX3A 2WC2A 2RV8A 2X9DA 1FTTA 4KYWA 3K4KA 3ZMSA 5IPAA 2EJRA 4E7LA 2HS5A 3AAFA 2KLOA 4AIJA 1HCRA 2M4KA 3GZNB 1FSHA 4LG3A 3ABLH 3BR6A 3QU6A 5J40A 3FISA 1HOMA 2HPIA 4XIDA 2OF7A 9ANTA 3BTLA 5L3FA 1ZG3A 2M5WA 2VJ5A 1IN8A 1R1UA 1TQIA 1SAUA 5GP9A 4KN4X 2DYRH 1TBXA 2QQ9A 1Y0UA 3E0JB 1JXSA 4XK4A 3C3WA 1ETWA 2K3PA 3K10A 1SVOA 1W1WE 3VYUB 5KNLA 2VLAA 3S2WA 5FLXK 1MJAA 4PK4A 3P9CA 4IOCF 2LBFA 3FWEA 3FM5A 2K3FA 3BY6A 1HDPA 1VNDA 4UV8A 2JWTA 4A0ZA 1N78A 4BGDA 3M8JA 4YFXF 2KKOA 2R4GA 3E97A 3AG3H 5AIQA 2R93J 1RUNA 4AC0A 1ZGWA 3M1EA 1QZYA 3SHFA 3S14J 2X1DA 2XF7A 3VODA 2P4WA 3O6BB 4KMUX 2K86A 3VEPA 1XGSA 3RJPA 4LLLA 3U9GA 5JHUA 3BR1A 2MC3A 1LFBA 1ACIA 2K5CA 2RQPA 2R7OA 3GLLA 3HOZJ 2Y9ZA 2LSOA 2V9KA 4ZJZA 3H1CA 2Z2SB 2LH9A 2IEKA 3SEZA 3M4OJ 4XLPF 3OOPA 4ANJA 1JKPC 3D5SC 3J7ZI 1BM9A 3E6BA 5IOYA 3RSNA 4BQOA 4C3JJ 3V42A 4EVIA 2FBHA 4X1EA 3EUHA 2Z33A 4Q5SF 1FP1D 3QYFA 2XKPA 5IP7J 2BE5F 2K9LA 3BTCA 4CA0A 2ECCA 1MW7A 3OYKA 1ZG5A 3PJRA 3IWZA 2VUMJ 3K0LA 3BG6A 3HYIA 4BYYA 4IHYA 5DM7F 3LSTA 3LAJA 4LIUA 1Z0XA 4ZDPA 2VB6A 4HSRA 3IRRA 1FOKA 2LRDA 3A01B 5HOOA 1KQ8A 1ZHFA 2EK5A 4Y15A 3OYCA 1VTNC 2DI3A 4G94A 5F1RA 1EKEA 3KEOA 1AKHB 1XMKA 1ZTRA 2EZHA 2JQ7A 3M7GA 1BA5A 3EETA 1X1DA 2KJCA 2ZMEB 2NNNA 1MGTA 2EZKA 2JSCA 2FBKA 1OCZH 3F9KA 3JSOA 2ZSIB 3MKWB 3LFKA 1XSXA 1DDNA 5DCMA 4M74A 1AU7A 1IDZA 1XB4A 2M9HA 3CCQI 3QODA 3E3VA 3HRMA 4MNUA 5B3SH 2P0WA 4BXUA 2E1MB 1XG1A 2O8KA 1R22A 5EG0A 1W7PD 5E20A 4BHBA 1ZR4A 3TDUC 4YEJA 2QA4I 4UB6C 2XF6A 3K6GA 4II3A 5GTIC 4U7BA 3G4SI 2KZGA 3V8KA 4BEHB 4PDKA 2HGCA 3Q0WA 5CPRB 2GXAA 1TP4A 2EILH 2MA3A 4ZZDA 5J8CA 1R7JA 1AA7A 3J7AY 3NAUA 3OYEA 2PMZN 4F7ZA 2CGPA 5HLGA 3RYPA 1S9HA 2L2OA 1MBGA 3DFGA 3I59B 5ED4A 2XRNA 4XBFA 3I9V2 4OINF 3H3ZA 2IW5A 4MQ9F 3GTLJ 4P96A 2VPRA 4A3DJ 1WJ5A 2IS1A 5F0HA 3E5QA 3HRTA 4W1UA 2OBPA 4XRSA 2LDUA 4MTDA 2Q8KA 4V19K 3IL2A 1FEXA 5J1UA 3JSPA 1WPKA 1SD4A 2V79A 2W1OA 1BI2A 4JQFA 2G7UA 1BOAA 4JX4A 4WWCA 1W0UA 2XSDC 3JAMK 4PFPA 5F6FA 1ZKGA 2X1CA 3QYEA 1MD0A 2UZKA 3K4LA 2IA2A 3FKJA 4HLYA 3GBGA 3GMEA 3BROA 1WJAA 2XHKA 3SZGA 1XX5A 2CW0F 2VC1A 4A5NA 2EFNA 1KZHA 3DF8A 1JKRC 2NVTJ 2MFZA 2GOXB 1MH3A 3MQ0A 4ZYEA 2WWYA 3K7AJ 3OR1C 1V55H 1TW2A 2XDVA 2XASA 3P5JA 3TDZC 2QQ8A 3ABTA 2GA2A 1ZQ3P 2HWVA 4KITB 3CCLI 5FKLA 4RB0A 1S5LC 2V9PA 1R1VA 4UXNA 3TO7A 4GCVA 2ELHA 5D8LB 2L9VA 2NS8A 5K7HA 1N77A 1MNEA 3OYNA 2KP6A 3RCOA 1CF7A 3C2GA 1QHGA 5JI6A 5TGTA 4P5OA 2DDAA 1Y6IA 4HAMA 1BC8C 3KP7A 1X1PA 4HX8A 1Z7UA 3H0DA 2CQQA 1I1SA 2RC4A 1X2NA 3KP5A 5HDGA 5E17F 3HC7A 3BQYA 5K7FA 4BAYA 3CLOA 3CMYA 4HEA2 3HG9A 5B5EC 4BXXJ 3HTUA 3VSKA 2X0LA 3BR2A 1T98A 1IV8A 3QP5A 1Z3YA 2XSJC 2FOWA 2B9SA 4XM3A 3ELKA 1WJDA 4FTHA 4L9NA 1I3AA 4B09A 2OC6A 2IGMA 1NK3P 1VZ0A 3CCYA 3OMYA 4HV5A 3T8TA 4LIVA 2ZXIA 4OAZA 3FXLA 3TW6A 1ZR2A 3E5XA 3CDIA 2YUSA 1DGRM 4B3XA 2HYGD 1VQ9I 5BS6A 5FO5A 4E70A 1E3OC 2AXTC 3JR9A 2Q2EA 3HB9A 2A5WA 1M1EB 3OYGA 1HXDA 5HLIA 5HS8A 4CICA 4KFCA 1RZ4A 4HNUA 2GBYA 4XR6A 1YTYA 1LQ1A 4WXDA 3ERMA 2PLYA 1LDDA 2VKHA 4XSXF 1LB2A 5FFZA 4A3LJ 2XGXA 2CV1A 1R36A 4L5EA 3NQOA 1ETYA 3EUAA 3U1KA 2X48A 4NC8A 4MQVA 3IP4B 2MSYA 3LSMA 1IN4A 1TQMA 4WK8F 4B48A 4XKVA 2CW8A 3DXJF 4IF4A 4E7KA 1YRNA 3FXQA 1ON1A 4HW0A 2DQLA 5F1JA 3B6AA 4M3EA 2DT5A 3BC8A 4L0YB 4WCGA 3G2BA 1IRGA 3AFHA 4BE2A 1PUFB 4CHUA 1STZA 1T56A 1U6GA 2LR8A 3MKYB 2DFEA 2WAEA 4JBAA 5HNFA 2OZUA 4HQEA 2JRMA 4S05A 2QF7A 2IT0A 2GIZA 4RLQA 2W84A 2M8EA 2ZC2A 3IAM2 4ON0A 1A31A 2FA5A 4PGGA 4KUMA 2JUCA 2XAHA 4A5MA 2EFQA 2H6CA 1SFOJ 2E5ZA 2WAFA 2JMWA 1VF9A 2LG4A 4BJTA 5A2QK 5CVIA 4P9FA 3WTWC 4GRIA 1TWFJ 3BLYA 1ETXA 4EJUA 2PMZA 3ZMTA 2QSGX 1SD7A 3CJRB 3LSKA 2JPBA 2W82A 3A1YA 2DCEA 2M45A 2HR3A 1RC9A 1T2KA 4BDYA 5LEKA 1TWHJ 2F5EA 3OYBA 3GTKJ 4NBQA 2O8XA 2XROA 4NUBA 5LD2C 1MMSA 4IRHA 2LK2A 1TC3C 1P4WA 2HXIA 4QPOA 1D1CA 2DK5A 2B7EA 3NRVA 4LG0A 3QAHA 1IXSB 2V7FA 1J5YA 4KDPA 1B9MA 2OA4A 4FE4A 2AHQA 2H8RA 4G7HF 2R92J 2M87A 5LGUA 1YI2I 3FZVA 3DBLB 2CFXA 1UAAA 1I27A 2HU9A 2E7XA 2JUGA 2ZB9A 3V7SA 2WY7Q 5K5RA 4XKWA 4BE0A 2H94A 1VQ7I 5EJCA 3JTHA 5DS9A 1VQOI 1B72A 4Y13A 2Z99A 5GAGJ 2PMUA 1ZRFA 4BH9A 1SMTA 4Q47A 2D5VA 4PJNA 1W0TA 1GDTA 1XSVA 1Y1VJ 4DBRA 1LFUP 2VPLA 1IGNA 1Y0NA 4HLXA 2LNBA 3JAMZ 3PUFA 3GZ6A 2DPUA 2ECBA 3LA3A 3TOAA 1MMNA 1XCVA 2FBIA 1FLIA 1YJWI 2HPMA 2F4MB 2X6WA 3DBHB 4O3MA 4RB2C 1FNNA 1QRYA 2CH0A 2IJLA 3ABUA 3TQNA 1BC7C 4N9IA 2BW3A 1R5GA 2QZ8A 2W85A 1IRXA 1D8KA 3UKGA 2E71A 2QKMB 4LK0F 1UCRA 1DP3A 4A3BJ 4AIKA 3OYFA 3CC4I 1JKQC 1YS7A 3E5UA 3L2QA 4DGWB 2F5VA 1K4SA 3MAJA 1EA3A 3DP7A 3HIFA 1HBXG 2WADA 1TT5B 5D6FA 3DTIA 5J4YA 2CJJA 5EGOB 1D5VA 5DCFA 2M0MA 3CCJI 3HZJA 4HZFA 1TL8A 3CTAA 1Z21A 3H92A 3L1PA 1DP7P 4DYRA 2O61A 2HKXA 4RB1A 2KRCA 1Q1VA 1C0WA 2O6GE 2FD5A 3S3NA 3HJEA 4XORA 3FXMA 5B1AH 2E5NA 5E8GA 3W2VA 2ADUA 5C3EJ 2XB5A 3ZQQA 4S04A 1V4RA 3HXLA 1IZ1A 2L7ZA 5HS7A 4KJZA 3VYSB 4IVNA 2QBYB 1BI0A 1N75A 3HDDA 2LKXA 3OYDA 1MMAA 2HVRA 1SFKA 3HSRA 4RM2A 1ZREA 3TGNA 2XGCA 3S3OA 1J75A 1NTCA 1BI1A 4XKBA 3HPHA 3HRUA 2I5UA 2Y48A 1E0EA 2V6CA 3ABMH 3CD6I 4E7SA 1JTYA 3FM3A 4IKFA 1G2HA 4G12A 5F08A 1ZGJA 1V54H 1WFXA 4HG2A 2PI0A 3T8RA 1ZK8A 1J7KA 2RREA 4M6XA 2VL8A 2FMLA 4Y33A 5CLSA 1USTA 1REPC 3T1BA 3LMMA 2E1OA 3ZGKA 3H5AA 1KQ0A 3ZOBA 3F6OA 4O5VA 5LRRA 2R7VA 2EA2A 5M5XJ 1YQAA 1G3TA 1IUFA 4RAYA 2DOAA 3NWTA 3GZ5A 1U5TB 1LDKB 3H9JA 4DZPA 1DGWY 1ZYRF 3SZPA 3JRIA 5ICCA 4HNVA 2F2EA 3R0AA 3CF2A 2VBYA 4XLHA 4E6KG 2K9QA 2X4HA 4OMZA 4XMYA 1HKSA 2KDZA 3CO7C 1VQMI 2KHMA 1NG7A 1WSUA 1CGPA 4XN3A 5TJJA 4OIQF 4ENJA 3H5NA 2M34A 4UVBA 2XAJA 1Y1WJ 4UB8C 1BBYA 3HEFA 2I10A 3ONQA 4NB5A 4Y52J 3TO9A 4EGZA 5FRMA 3DKXA 3K1MA 3S15J 3OYMA 3F8FA 1ZELA 1R4MB 4EJOA 2EFWA 4L9TA 4E7JA 1YE9A 3CQZJ 5C4XJ 4MTEA 4A6EA 4NQWB 3A01A 1O4XA 1K4TA 2Y0SN 2LY1A 5IP9J 5JHFA 4MIMA 4A0YA 3HOWJ 2H09A 1W7PA 1GUUA 1R9TJ 3BJ6A 2QEXI 2FEZA 3LAPA 2XGEA 3K70D 2DMNA 3CDLA 4BY1J 3W2WA 2R7RA 1U5TC 3H5RA 5LLQA 1VQKI 1JUMA 2G9WA 3A0HC 5DV5A 2ZNZA 2L7KA 2LTPA 1G6NA 3S3MA 3LOCA 1W36D 1ETOA 1D0ZA 4OIPF 5IYCJ 3L2WA 3F22A 3PQJA 2ETHA 1I6HJ 3WTYC 2HDCA 2FUG2 2CFOA 2R7WA 4N0BA 2CQKA 1Z3XA 3KZIC 4RDUA 3FK6A 4KA4A 2ZXHA 3J81Z 3L00A 1OR7A 1OYWA 1E3PA 1FTZA 1YX3A 4Y17A 4LITA 2MGQA 3HOTA 2TDXA 4C2MJ 3KP6A 1GT0C 1JGGA 5JLWA 4CCNA 1H8AC 3ZN1A 3FMSA 1A35A 1OCPA 1FIPA 2CQNA 4FHTA 2YS9A 5B1BH 1G3SA 3V7RA 3CCEI 1K78B 3CCMI 3I59A 2F5DA 5K1YA 2MBFA 5ILUA 1MBKA 1SFEA 5IOZA 4BUPA 4ENNA 3PNYA 4YRVA 1X2MA 1SFUA 1FZPB 5E3NA 2FU4A 3GLXA 3JRHA 1HDDC 1ZLJA 4UNOA 1HSJA 5JVGF 4DIQA 4HX4A 3HRSA 3LWFA 3BT9A 3TKYA 4IL6C 2IA0A 4AVPA 4A3IJ 2EWNA 3CCSI 2QM3A 3GCMA 4GDFA 1YW9A 3TP0A 2CMPA 4XLAA 2XUBA 1N25A 4XONA 3GTQJ 3RPUD 2PBIA 1SANA 1KONA 5DUIA 2CSOA 1J0RA 2OU2A 1MBHA 5J1RA 4HDUA 4Y4RA 4RA2A 4YELA 5F0CA 3EUKL 4B43A 3G6EI 1T33A 3GF2A 4M6YA 3WU0A 3C1DA 2X6YA 4L9JA 2DO7A 5F64A 1LE8B 2NRAC 1O57A 4JK1X 1NK2P 1YW8A 2WTEA 1U2WA 3WE3A 2WAQA 4PJJA 3DEEA 4M71A 1IG7A 2XV4S 2HOTA 4U0YA 4FT8A 1UFMA 1T8IA 1R1TA 4G6QA 2EQRA 2ESNA 3OV8A 3H9QA 3BJOA 1UHMA 4DYCA 3H36A 4YIIA 1WGXA 2NVUB 4UVCA 4HRIA 1IJWC 1H9TA 4KIGA 4FASD 3ZMUA 3OYIA 1FYKA 2RVCA 2E7WA 2L0KA 2XVCA 3GTJJ 1ZH5A 3CUQC 4BBRJ 1YJ9I 5DTDA 2M2EA 5ERIA 3G3ZA 3V8JA 2EPFA 2DOFA 2DXIA 3MCZA 3FXJA 4GYIA 2R0QC 1AOYA 2TCTA 3G1LA 3ZR8X 1ON2A 5K5QA 5BOXA 3ZCOA 4KIFA 3EDPA 1K7AA 4X0GA 4YFNF 2RDPA 2R7SA 2LVSA 1PVEA 1GLNA 2EIKH 1KGSA 2JA7J 1RESA 2BXYA 2O03A 3L2VA 4IHSA 1YYVA 3K4BA 5HDKA 2VBWA 2RNJA 3MD2A 4G7OF 1ORKA 3IC7A 4RAGA 3S2DJ 1Z7LA 3BDDA 4XLNF 4FX0A 5ILSA 3VPRA 1JGSA 2ZCWA 4YG2F 4EM2A 2XPUA 3FKIJ 5J8FA 4ZH4F 5C44J 1D3YA 4IXAA 2F6CA 1Y56A 4XL9A 5LGTA 3PO3J 2QQBA 2RAEA 2Y0SA 1UJ8A 3M1CA 4OWRB 1OCOH 1A6QA 2P5LC 3HBLA 3OS2A 3PM1A 4TV7A 3RQIA 3O2PE 1WJFA 1FPQA 3WHBA 1O3TA 2EH3A 3ISPA 2MABA 3D5RC 1J2XA 3EYYA 4U7DA 2VODA 1EF4A 2HQAA 3OSFA 1U8RA 3RKWA 2AXLA 1YX5A 2DT7B 3Q9VA 1Z6RA 4DZJA 4NC7A 1WI3A 2IA1A 4YIRX 3RYRA 4EM0B 1B8IB 2D1HA 3ESWB 3HPGA 2VQLA 3BG9A 4CCJA 1AHDP 4Y3OA 2EIJH 3U21A 5TRDA 2LD5A 3GYHX 1T6SA 4M3BA 5HDNA 2Y69H 4C2TA 3AG2H 4OAYA 2BYVE 3KP3A 3LSHA 3QPTA 1X3ZB 1VQ4I 2CG4A 1MMDA 5FD6A 4RGRA 5LBQA 1QPIA 1I6XA 1FOWA 5HS9A 5GAEJ 3F8MA 4IJAA 4P9UA 3I71A 2XAGA 2V1NA 5DD8A 3BZCA 5J3LA 2R5YA 1G8XA 4FQGA 1L3LA 4RGSA 1TNTA 5EEHA 2QENA 4KICA 3OR2C 1Y8QB 3I55I 4A12A 1LUJB 2F4IA 1XCBA 3HKZN 2E2HJ 1UMQA 1HKQA 3LSGA 2VI6A 1KYZA 3VOEA 4BNCA 3CESA 4XOPA 2W24A 4M9ZA 2CV2A 4DOZA 2OQGA 1YOVB 4I0BA 5L3EA 2YSRA 3CMMA 1P4AA 2LY2A 4BKXA 3GO5A 5LEJA 2R5ZA 1PJRA 2I8DA 2K27A 1D0YA 1JE8A 4F91B 2D45A 1QBJA 1OJLA 3K69A 5D8KB 4RS8A 1XDUA 3QU3A 5ICGA 4I98B 2KRHA 3WU2C 4YIFA 4UUSA 4ITVA 3DLAA 1HLVA 2X85A 1FOXA 3BOQA 1UB9A 1X58A 4LOCA 1TZLA 2TRTA 1R00A 3CCUI 1TTYA 2OUMA 2L7MP 4ENKA 2DMPA 1HA8A 2DT6A 3JRGA 2DW4A 2FSWA 3DKWA 2HXOA 4I09A 3ZMVA 1K6YA 1E17A 1JT0A 5EEGA 1OR7C 2DMUA 2P81A 2DFIA 2P5KA 1YHQI 4HBLA 2MD5A 1IW7F 1R5ID 4F52A 1XDSA 1HQCA 4A3GJ 4CGZA 1O7LA 4UHTA 2VBZA 2FNAA 2A6TA 2LBFB 3SFZA 4KN7X 1W4MA 5C4JJ 3S93A 1F1ZA 2FF4A 2K4JA 1WH7A 2IRFG 3CP2A 2M4GA 1A36A 1BOBA 3MMYB 3ZQGA 1X3UA 5J4VA 1ZRDA 3TBIA 4LB5A 1XC5A 5LFAA 1GHCA 3WG9A 3ABKH 4JX6A 1RKTA 1P6RA 4HF0A 2CYYA 1BJAA 3O8HA 5EGOA 4B4CA 2HQRA 2VKVA 2MW8A 1TQPA 2B63J 2FOKA 2VE9A 3J80K 1LEBA 3ASOH 2CUZA 4XLCA 1SD5A 4G6DA 2L4MA 3M8EA 3FXKA 4IPAA 1JJ8C 4PCQA 4L18B 2Y0MA 1PDNC 3LL7A 2LC2A 2W4SA 3HOXJ 3QOPA 4RBOA 1WKMA 1J9IA 4JP0A 5EF6A 2GXGA 3FIWA 2IBDA 2OV7A 5FFXA 4BHPA 4EJTA 3WODF 4ZZLA 1MZBA 3JRDA 1U9NA 2DA4A 3I54A 2JA8J 4CYCA 1O3SA 2DLLA 3WG7H 2DFFA 1O7FA 3WGGA 3S1RJ 4AWXB 2PJPA 2WB1N 3FBIB 3WTSC 2E1CA 4FETA 4OMYA 3GWZA 5D5WB 1JUPA 3E7LA 4DJAA 1NG6A 4NNJA 5J6XA 3W6JB 5D5XB 1DU6A 3CP8A 5IT9K 2Z9OA 1FYMA 4PSWA 3CUOA 5ICFA 3FXRA 1ZAOA 1LNWA 1UG2A 3K2AA 4ZYGA 3ZP5A 1T39A 3GTOJ 3N97A 1JT6A 4P1WA 4CDGA 3MVPA 4A2UA 1EH7A 2E2JJ 4CCMA 5DDGA 4X6AJ 4IQ4A 2BHYA 5DCMB 3EUHC 1F36A 1G59A 5DUKA 3DTEA 4D5CA 4PGHA 4J19A 2A68F 3MZYA 3S1MJ 4BJ6C 2OAZA 1RR7A 4P55A 4U0WA 2KZVA 3IH2A 1MNMC 4Y7NJ 4FX4A 2DAOA 3Q0UA 1BW6A 3DEWA 2AQFA 3E1SA 4LLGF 4D5FA 2A6EF 4OIOF 2DA7A 4RGXA 4AVZA 3KP2A 4RLFA 2DDBA 4DW6A 3DPTA 4U88A 1VQNI 1OPCA 3VWBA 1XD7A 4L0ZB 3GVAA 3W6KB 1XGOA 3E6CC 1JKOC 2FQ3A 3HKZA 1JHHA 2OCEA 4XQFA 2M7BA 3X2QH 3S1NJ 3KX2A 3M07A 1OFCX 4U87A 3I53A 4JX5A 3QWLA 1NHAA 2O7OA 2RNGA 4R8HA 3J81K 2XC7A 4EM1A 1USSA 2WV0A 2XAFA 4M73A 5J47A 2XGDA 2K40A 4E7IA 4I76A 2IAIA 3M9AA 3P9IA 4IQJA 3QP6A 4OIRF 3F0CA 2XF5A 1OKRA 1JUSA 1X1AA 2FE3A 2HNHA 4I7HA 2LF8A 2W57A 5E3LA 2HI3A 3HSEA 1GXPA 3HOVJ 2M1BA 2UUZA 1TNSA 5IY5H 5CYVA 4HOBA 5BMZA 2JSPA 3PSIA 4UY8I 1E3HA 3DBRB 5M3FJ 4KT5C 4N4OB 1ZLKA 4LJZF 2R7UA 1S72I 2O9LA 5BQTA 4A3MJ 2F5CA 3M8FA 3I4NJ 1QPMA 1VQ8I 1MNDA 3HM5A 3CO6C 4V2FA 2DODA 1PYVA 5FB2A 1RRJA 2A3SA 2WBMA 4F55A 4EATA 5HLTA 1ONVA 1QNTA 2G7HA 2GWRA 2BXZA 3WGIA 4II2A 2YPRA 4BHCA 4A3CJ 2UXNA 2HQNA 1LJ9A 2PJRA 5F27A 3AKZA 5CVUA 4QIWN 4NC6A 4FE7A 1IF1A 4ZDLA 3ZQ7A 3EYIA 2DMQA 3KLNA 4XNFA 4PJLA 1CF7B 3OS0A 1IAWA 5FRNA 4A3EJ 1TWGJ 2X51A 1RNLA 2JA2A 2OTLI 3DLLF 2OD5A 3L09A 3GW2A 1WJCA 1Z67A 4IHXA 5J1YA 4BXFA 1SAXA 3IWFA 2QGUA 2K9NA 4PUSA 1IV6A 2EV6A 2L4AA 2DA5A 5AONA 2BY3A 4DNCA 3DTKA 1KU7A 4EEFG 1MJ9A 2O5RA 5M5YJ 2BVMA 2GA1A 2MYSA 2KIQA 2CUEA 3S1QJ 2EV5A 2LY9A 4K2EA 3FDYA 3R61A 4B1RA 3SXYA 4V2GA 1APLC 1HW2A 4GYGA 1R5HA 2PN6A 5EDNA 1R49A 3RDIA 3J80Z 3MKLA 3PO2J 4N4NB 1A04A 2Y31A 2VT2A 3IKTA 1RIOH 2GXBA 2L54A 2RQQA 1ERDA 2A69F 3J7AO 2EV0A 2FQ4A 1IRFA 1XMXA 3T5XA 1LE8A 2P7CB 3IKVA 2LKPA 2VJ4A 4NDLA 2EB7A 4ZTFA 2Q2EB 2VKDA 5KHDA 2MLGA 1WJEA 1FSEA 2WB1A 4D9JA 4L5IA 1P4XA 3F21A 2GLOA 2MLKA 2HQ5A 2YU3A 2WV1A 1K6OA 3OIOA 2ICWG 1GVDA 1S29A 1UZCA 4F93B 3QPLA 2DTRA 5M5WJ 1QO0D 2QCOA 5LHGA 3RTRA 2J5PA 4ESJA 5CQGA 2FMYA 5H20A 4G6TB 3GFJA 4M9XA 3IV5A 2K02A 1S3JA 2LMDA 4IZZA 2ID6A 2VASA 4CZCA 4HF2A 4KISA 3HHHA 2V1DA 4I2OA 5JR3A 5IT9Z 5GPCA 1YJNI 2R7TA 2D2WA 3HL2A 2L5QA 3HUGB 4BS9A 1BR2A 2KIMA 3KZYA 1SVMA 1YS6A 3KYDB 3WTUC 2Z1DA 2A05A 3UR3C 1EH8A 1XPXA 4HV6A 3DEUA 3U1DA 2E19A 1R71A 1YIJI 2EFPA 3ULQB 3RZOJ 4B47A 1SEUA 3O3KA 1MSEC 1POGA 4MO7A 5D6EA 3I4MJ 4BBSJ 1HKTA 4XSZF 3ZXSA 3OL3A 4ESFA 1WVRA 1ZN2A 3IHUA 4CZZA 1S8NA 1JHFA 2COBA 3BTJA 2GAUA 5IYDJ 2C6YA 2H1KA 4H0EA 2ZO4A 1OLTA 4G8XA 3BQZA 4HYEA 3DU5A 1MBJA 2EBIA 2P6TA 2XIGA 1AKHA 5BNGA 3F72A 4EJVA 3TP3A 2OTJI 1QVUA 3H9GA 3F8CA 2ZMEA 1LKXA 3GXOA 3QQAA 1FC3A 2HOAA 4NHJA 4M3FA 3ZPLA 3SDBA 4Z2YA 3A03A 2HZTA 2GM4A 1E2XA 3DV8A 4HF1A 4IHVA 2W25A 3BPXA 1K83J 2LP0A 5E3MA 4G9YA 1UHWA 1U9OA 4LG0B 2ZKZA 2NOGA 2HDWA 1MJBA 4EQQA 1HW5A 2F4OB 2LF7A 3E6DA 3RPQA 1LFPA 1OISA 2KJBA 3OYAA 2V1XA 1IXRC 1YG2A 4BEHA 2Z5UA 1FBQA 1VQ5I 3RIRA 4B8XA 5GAHJ 1RR8C 2LLKA 3S2HJ 5E8IA 2XAQA 1U8BA 2NAZA 4I99C 2COMA 5H6RA 2QWWA 2H27A 2VC0A 1XMAA 1A6IA 4ZYAA 3FXOA 4IOAF 2AO9A 2XKOA 3S16J 3DPLC 5CQEA 1MH4A 3MZHA 1IDYA 2F5FA 4EV0A 4R1HA 4IEJA 3PNTA 2VKEA 2LREA 2DMTA 2XRLA 4ZYHA 1SD6A 1W5CC 2BW3B 1TLHB 5K7ZA 1TWCJ 2LYCA 3NWSA 3RKXA 1ENHA 2Q1ZB 4QPQA 1PP8F 4A93J 3S32A 4EGYA 4CH7A 3LSIA 2IS4A 1BIAA 5DYMA 3K9TA 5EEAA 2N8GA 1OMIA 4I01A 1P92A 2YX7A 3CUQB 3R6SA 3ZMDA 1KU2A 2ZSHB 1BW5A 4RAFA 3EQLF 3P9KA 4QSHA 5L3DA 4XKCA 4ABZA 3D5LA 1QHHD 4ZC3A 3RKQA 1I3QJ 3WU1B 1YO5C 3JRAA 2EA4A 1GV2A 1Y39A 4XN0A 5F04A 4XRMA 4C2UA 4QTRA 5FLMJ 2E36A 1Q1HA 2UV1A 2ZXWH 5JLXA 1FOYA 1Z6TA 4M6VA 4BU2A 4H4KC 4C30A 2DA1A 5D5VB 2ZBKA 2FXAA 3IAS2 4HNTA 2ZNYA 3MEXA 1R4NB 3K4MA 1WH5A 1LPQA 5D4RA 2ZJQF 2ISZA 4C3IJ 2W48A 2DFHA 2O3FA 3R4KA 5FKMA 1OCTC 4BL0B 2EZIA 2CUJA 2J5OA 1PP7U 2CS3A 2FRHA 4MHGA 2E34A 3E6MA 1BL0A 4LD5A 4LB6B 4G7ZF 1FMWA 2A5YB 2E60A 3F8BA 3OS1A 2XPWA 2HDDA 1FX7A 4DBQA 2DBBA 2HTSA 3ECOA 2LFBA 5HLHA 5KCMA 1QZZA 1HC8A 3H35A 4PSXA 4KIBA 3MWMA 1Z1DA 2Z3YA 3COAC 1X1CA 1D5YA 2CQ7A 3H0GJ 1X4PA 1U3EM 2H1LA 2KDOA 4KT6A 3V7CA 2E1NA 3C2HA 5BPIA 2X1EA 2PEXA 4MEYF 2W7NA 2KISA 4CUGA 3OY9A 2L9RA 5EYRA 1I39A 1EH6A 3KZZA 4CSWA 2V4JC 2VIXA 3T0YA 1RUOA 1LDJA 3ERED 2VOPA 4HQMA 3AL0B 3I3LA 4AIDA 5CVRA 3FHNA 2VJJA 1KU3A 3DCFA 3GTPJ 2M3AA 3O8GA 3KE2A 1X19A 2QUFA 3SEQA 2DJNA 4OU0A 2CW7A 2VXDA 4PJMA 3IH4A 5JFRA 2BY2A 4HPQA 4UUTA 3CC2I 2PMHA 2DTZA 3PNVA 4HDVA 1KU9A 4FISA 1T0FA 3HTSB 3HOUJ 4LFUA 2BHZA 3K1PA 2JTVA 2DOEA 2YX4A 2JN6A 3WTTC 2R7ZJ 1XGNA 2P5VA 2K7LA 1SFXA 1S7AA 2L9NA 1W7PB 2L3DA 5E1XA 3L2RA 2HZDA 2IGOA 2H8WA 2ME0A 3PSFA 5ILVA 5HVQC 1S6LA 1XN7A 5H2FC 1PUFA 4GFBA 3VFZA 3LQQA 1WHUA 1WI9A 3TOBA 3AL0C 3C2BA 2MG4A 2HYFA 2R7QA 3QPSA 5GADJ 1B59A 1FYLA 4XLEA 1X1BA 5ICEA 2HFHA 2Y75A 1VQLI 2OPTA 2XPVA 1MDMB 5FKOA 1SC7A 3ZQIA 2UWMA 2CWEA 1Z91A 2ZFWA 1WRJA 3FBNB 4BQAA 4Z6YA 2BZTA 1I1GA 1TW3A 5CJ9A 2GIVA 4FCYA 3OYLA 4MLOA 2H6BA 3BCAA 2QVOA 2JK3A 5EZGA 1O3QA 2M30A 1GV5A 4E7HA 1O3RA 2RN7A 5D4SA 3CJNA 1V5EA 1WZ2A 3L9FA 3KYLA 2XAUA 2M7AA 1QVTA 3BZKA 3KCCA 3GTGJ 4E7ZA 1BJZA 1IN5A 2ZJRF 4LGWA 2QYOA 3HGYA 4A69C 4U0VA 4CCLA 1MMGA 1UELB 3AG4H 5FLVA 4KNYA 4DYQA 4WF2A 4Q48A 3WTVC 3BG5A 1XGMA 3LNQA 1IXCA 2ZMEC 3WGHA 2DPDA 2IS2A 2XB0X 2A6HF 2IPQX 2JZYA 3CJQB 4AM3A 3TEDA 2KL4A 1ETKA 1PUEE 3WTZA 3SYTA 2ID3A 3CDHA 2BEOA 2ZJ2A 4MEXF 2ESHA 1KA8A 3TMOA 2E1MC 4JOMA 3J7YJ 2DN0A 1G4DA 3VSLA 3PIOF 2JT1A 2RKHA 4AU7A 4D0PA 2JVGA 1DPRA 4RMNA 2VONA 3RKYA 3VDXA 4A0XA 2K9SA 3B6CA 3QPHA 4CYDA 3GTMJ 2DA2A 1D1BA 3ML6A 3IRQA 5DD4A 4BY7J 1ZG1A 4B44A 1VFCA 2HVSA 2ZJPF 3B73A 2CU7A 3UNGC 3JTGA 3KYCB 2UXXA 2WA0A 3BP8A 4JYKA 1F43A 1D1AA 3GX4X 1JTXA 2IGKA 3F3XA 2IP2A 1QU3A 5LHIA 3KFWX 2V26A 2HEOA 3MN2A 2YR2A 4WX9A 1ETQA 3OYJA 3PUBA 5L3GA 3I4PA 3I56I 1ITYA 4I6ZA 3RZDJ 1LEAA 1IC8A 1FY7A 2CRGA 2PQ8A 2Q0OA 2VXZA 5FLXZ 1H89C 3V8LA 4XRSG 2OZ6A 3GFMA 1WWXA 5M3MJ 3LSJA 5L3CA 3S17J 3NARA 1ZRCA 5L3BA 1DPUA 1XS9A 1XTAA 4C9YA 1IN7A 3K4JA 1T95A 2V6EA 2P6SA 2ISYA 4D1QA 3VYRB 1YW7A 1MBFA 1ZARA 3WE2A 4WXCA 1F9NA 3TL4X 1T38A 5DM6F 4ZDOA 2WY8Q 1P7JA 4GXOA 1MBEA 5E3OA 4CO8A 3CJTB 2VT3A 2ZFUA 3A02A 3PFYA 3JRCA 1HF0A 2HOEA 3JCUC 2F48A
chains in the Genus database with same CATH topology
4A3EJ 1TWGJ 2CQXA 1AKHB 1ZTRA 1FTZA 2EZHA 4IHXA 2MGQA 1BA5A 5J1YA 3BR0A 4C2MJ 1JGGA 1GT0C 2K9NA 5JLWA 2EZKA 1IV6A 4M3GA 2KT0A 1H8AC 1IRZA 2DA5A 1OCPA 1FIPA 3ZQLA 1P7IA 2YS9A 4EEFG 1AU7A 5M5YJ 1IDZA 4A3FJ 2CUEA 2M9HA 3S1QJ 2LY9A 2Y30A 2DA3A 4B1RA 1XG1A 1MBKA 4V2GA 5IOZA 1APLC 2O8KA 5EDNA 5EG0A 2HOSA 1ZR4A 3MKLA 3PO2J 2Y31A 1X2MA 5E3NA 3ZQCA 1HDDC 3JRHA 3Q0WA 2FQ4A 3BR3A 1LE8A 3BT9A 1K61A 4A3IJ 4NDLA 3NAUA 4IHWA 2PMZN 2NVXJ 3TP0A 2YU9J 3GTQJ 3TW7A 1MBGA 2GLOA 2HQ5A 1SANA 2WV1A 2DA6A 3OIOA 5EG0B 3GTLJ 1GVDA 3LSPA 3D1NI 1MBHA 5J1RA 2VPRA 4A3DJ 3QPLA 5F0HA 5F0CA 4W1UA 5M5WJ 1T33A 2NVQJ 2QCOA 4XRSA 1LE8B 1NK2P 1FEXA 3IV5A 5J1UA 1WPKA 2ID6A 4A3JJ 4JX4A 1W0UA 2XSDC 1IG7A 4D7MA 5GPCA 2HOTA 1RETA 1FIAA 2EQRA 1VI0A 2R5YB 1ZKGA 1MSFC 4DYCA 5FKNA 4S0HB 1WGXA 3GBGA 1IJWC 2E19A 1JKRC 2NVTJ 1MH3A 2ELKA 3RZOJ 3K7AJ 2L0KA 3GTJJ 4BBRJ 1MSEC 1POGA 4MO7A 5DTDA 2M2EA 5FJ8J 1ZQ3P 3I4MJ 4BBSJ 5FKLA 2R5ZB 2COBA 3BTJA 2R0QC 2NS8A 2TCTA 3G1LA 5K7HA 2H1KA 5IYDJ 5EZHA 3Q0VA 3SFIA 3BQZA 3HOYJ 1MBJA 2EBIA 1TWAJ 4UUSB 1AKHA 5BNGA 2LVSA 2JA7J 3TP3A 1CQTA 1RESA 5GPAA 1QVUA 2CQQA 1X2NA 4B3AA 3QQAA 1ORKA 3S2DJ 2HOAA 3BQYA 1RKWA 5K7FA 2FJ1A 4M3FA 3CMYA 3A03A 3VPRA 2GM4A 4IHVA 4BXXJ 1K83J 3BR2A 2LP0A 5E3MA 1U9OA 2NOGA 2XPUA 3FKIJ 4AYBN 5HODA 5C44J 3OSGA 3PO3J 1RPWA 4FTHA 2RAEA 1NK3P 3CCYA 3HBLA 2LLKA 3PM1A 3S2HJ 3WHBA 3RQIA 1U8BA 3TW6A 2NVYJ 2EH3A 1ZR2A 2YUSA 2JA6J 3M3YJ 1E3OC 1EF4A 5IP6A 3OSFA 1A6IA 3JR9A 3HB9A 2AO9A 4DZJA 1I50J 1WI3A 3S16J 3BTIA 1B8IB 1MH4A 1IDYA 3Q3SA 1UHSA 3H3VK 2Y9YA 2GBYA 1S7EA 3BG9A 4IEJA 2VKEA 2DMTA 1AHDP 2XRLA 4D7NA 3BR5A 2LD5A 4C3HJ 5K7ZA 1TWCJ 1Z77A 4M3BA 1ENHA 2Y2ZA 4A3LJ 3JREA 4A93J 4L5EA 1ETYA 2NS7A 2X48A 5EEAA 3JRBA 1QPIA 2N8GA 2MSYA 1H88C 3W6VA 1YRNA 1BW5A 2L7FP 5J3LA 3B6AA 5F1JA 2R5YA 4M3EA 3FK7A 3LSRA 4QSHA 1WCMJ 4ABZA 1PUFB 1T56A 2LR8A 3RKQA 1I3QJ 3JRAA 2WAQN 4CYCB 1GV2A 5F04A 4XRMA 4QTRA 5FLMJ 3HKZN 2E2HJ 1UMQA 2EZLA 2QF7A 3LSGA 5JLXA 2VI6A 4M6VA 3SDGA 2DA1A 2M8GX 4XICA 4BKXA 2R5ZA 1WH5A 3OOUA 1OJLA 1SFOJ 1YRNB 4C3IJ 2W48A 1OCTC 5FKMA 2JMWA 1VF9A 2EZIA 1TWFJ 1ETXA 4M3DA 4UUSA 2JJ7A 1HLVA 1U78A 1BL0A 4LOCA 1X58A 2TRTA 1TWHJ 3GTKJ 2L7MP 2XPWA 2DMPA 5FKKA 3WHCA 2HDDA 3JRGA 2HXOA 2LFBA 1JT0A 2LK2A 1TC3C 2P81A 2DMUA 2HXIA 1DU0A 1D5YA 3H0GJ 4FE4A 1JJ6C 5F0FA 2AHQA 2H8RA 2R92J 2X6OA 4A3GJ 3ZQHA 2HYJA 2L9RA 5EYRA 2ZB9A 5C4JJ 1WH7A 5DS9A 1B72A 3ZQGA 3JRFA 2D5VA 1W0TA 1GDTA 1Y1VJ 1LFUP 1XC5A 3DCFA 1IGNA 3GTPJ 3O8GA 2ECBA 1RKTA 4JX6A 2ME6A 3ZQFA 3O8HA 5EGOA 4B4CA 1A5JA 1B8IA 2VKVA 2DJNA 2MW8A 3HGGA 2B63J 1QRYA 3IH4A 4UUTA 4MFEA 2G0EA 2DTZA 1JJ8C 3UKGA 4FISA 3HOUJ 4A3BJ 3G1OA 1B72B 3G1MA 1JKQC 3HOXJ 2JN6A 4RBOA 2R7ZJ 2FX0A 4JP0A 2E2IJ 5EF6A 2CUFA 3FIWA 2IBDA 2M0CA 4W97A 4A3KJ 2CJJA 5EGOB 2ME0A 3BG3A 3JRDA 5IYBJ 3IH3A 1PUFA 1U9NA 2DA4A 1FJLA 4GFBA 2JA8J 4CYCA 3C2BA 2MG4A 4MFDA 3L1PA 3QPSA 3S1RJ 4DYRA 2WB1N 1Q1VA 2FD5A 2JA5J 4AUXA 2OPTA 3SJMA 2XPVA 1JUPA 5FKOA 3E7LA 1ETVA 3ZQIA 5C3EJ 2XB5A 2X9DA 1DU6A 1FTTA 5IPAA 2L7ZA 4FCYA 1HCRA 3HDDA 4MLOA 2LKXA 1UG2A 3K2AA 3BR6A 3GTOJ 2JK3A 5EZGA 1GV5A 1JT6A 3FISA 1HOMA 2XGCA 4XIDA 3MVPA 2OF7A 1NTCA 9ANTA 3BTLA 3GTGJ 1QVTA 2E2JJ 1BJZA 4X6AJ 3HGYA 5GP9A 4A69C 1F36A 1G2HA 1JTYA 4G12A 4D5CA 5F08A 4J19A 3S1MJ 4XK4A 5FLVA 1ETWA 1RR7A 1ZK8A 4DYQA 3LNQA 3BG5A 1MNMC 3IH2A 2XB0X 4Y7NJ 3Q0UA 1BW6A 3DEWA 4D5FA 2E1OA 2DA7A 3TEDA 1ETKA 3ZOBA 1HDPA 1VNDA 2ID3A 2JWTA 5M5XJ 4DW6A 1IUFA 4DZPA 2R93J 3JRIA 2DN0A 1JKOC 4HNVA 4AC0A 1ZGWA 3S1NJ 2K9QA 3S14J 1OFCX 2KDZA 4JX5A 2O7OA 2K9SA 2M34A 3B6CA 3GTMJ 2DA2A 1VFCA 4BY7J 1Y1WJ 3BR1A 2XGDA 2CU7A 2I10A 2K40A 3HEFA 4I76A 2IAIA 1LFBA 4Y52J 1F43A 4JYKA 3F0CA 3HOZJ 2Y9ZA 1JUSA 5E3LA 3S15J 1JTXA 3HOVJ 2HI3A 2IEKA 3MN2A 3M4OJ 1JKPC 3CQZJ 5C4XJ 1ETQA 3A01A 1O4XA 2Y0SN 1ITYA 5IOYA 5IP9J 4MIMA 5M3FJ 4I6ZA 3RZDJ 3HOWJ 4C3JJ 1IC8A 2CRGA 1H89C 1GUUA 4X1EA 1R9TJ 2O9LA 4XRSG 5M3MJ 4A3MJ 3S17J 3LSJA 2XGEA 3I4NJ 2DMNA 3CDLA 3HM5A 3NARA 4V2FA 5IP7J 3BTCA 4BY1J 1XS9A 2ECCA 1JUMA 2LTPA 2VUMJ 1MBFA 3LOCA 1ETOA 4IHYA 5IYCJ 1I6HJ 1Z0XA 4A3CJ 1P7JA 1MBEA 5E3OA 5F27A 3A01B 3A02A 4RDUA 4QIWN 3JRCA 4FE7A 3FK6A 1HF0A 2DMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E J;  1TWG J;  2CQX A;  1AKH B;  1ZTR A;  1FTZ A;  2EZH A;  4IHX A;  2MGQ A;  1BA5 A;  5J1Y A;  3BR0 A;  4C2M J;  1JGG A;  1GT0 C;  2K9N A;  5JLW A;  2EZK A;  1IV6 A;  4M3G A;  2KT0 A;  1H8A C;  1IRZ A;  2DA5 A;  1OCP A;  1FIP A;  3ZQL A;  1P7I A;  2YS9 A;  4EEF G;  1AU7 A;  5M5Y J;  1IDZ A;  4A3F J;  2CUE A;  2M9H A;  3S1Q J;  2LY9 A;  2Y30 A;  2DA3 A;  4B1R A;  1XG1 A;  1MBK A;  4V2G A;  5IOZ A;  1APL C;  2O8K A;  5EDN A;  5EG0 A;  2HOS A;  1ZR4 A;  3MKL A;  3PO2 J;  2Y31 A;  1X2M A;  5E3N A;  3ZQC A;  1HDD C;  3JRH A;  3Q0W A;  2FQ4 A;  3BR3 A;  1LE8 A;  3BT9 A;  1K61 A;  4A3I J;  4NDL A;  3NAU A;  4IHW A;  2PMZ N;  2NVX J;  3TP0 A;  2YU9 J;  3GTQ J;  3TW7 A;  1MBG A;  2GLO A;  2HQ5 A;  1SAN A;  2WV1 A;  2DA6 A;  3OIO A;  5EG0 B;  3GTL J;  1GVD A;  3LSP A;  3D1N I;  1MBH A;  5J1R A;  2VPR A;  4A3D J;  3QPL A;  5F0H A;  5F0C A;  4W1U A;  5M5W J;  1T33 A;  2NVQ J;  2QCO A;  4XRS A;  1LE8 B;  1NK2 P;  1FEX A;  3IV5 A;  5J1U A;  1WPK A;  2ID6 A;  4A3J J;  4JX4 A;  1W0U A;  2XSD C;  1IG7 A;  4D7M A;  5GPC A;  2HOT A;  1RET A;  1FIA A;  2EQR A;  1VI0 A;  2R5Y B;  1ZKG A;  1MSF C;  4DYC A;  5FKN A;  4S0H B;  1WGX A;  3GBG A;  1IJW C;  2E19 A;  1JKR C;  2NVT J;  1MH3 A;  2ELK A;  3RZO J;  3K7A J;  2L0K A;  3GTJ J;  4BBR J;  1MSE C;  1POG A;  4MO7 A;  5DTD A;  2M2E A;  5FJ8 J;  1ZQ3 P;  3I4M J;  4BBS J;  5FKL A;  2R5Z B;  2COB A;  3BTJ A;  2R0Q C;  2NS8 A;  2TCT A;  3G1L A;  5K7H A;  2H1K A;  5IYD J;  5EZH A;  3Q0V A;  3SFI A;  3BQZ A;  3HOY J;  1MBJ A;  2EBI A;  1TWA J;  4UUS B;  1AKH A;  5BNG A;  2LVS A;  2JA7 J;  3TP3 A;  1CQT A;  1RES A;  5GPA A;  1QVU A;  2CQQ A;  1X2N A;  4B3A A;  3QQA A;  1ORK A;  3S2D J;  2HOA A;  3BQY A;  1RKW A;  5K7F A;  2FJ1 A;  4M3F A;  3CMY A;  3A03 A;  3VPR A;  2GM4 A;  4IHV A;  4BXX J;  1K83 J;  3BR2 A;  2LP0 A;  5E3M A;  1U9O A;  2NOG A;  2XPU A;  3FKI J;  4AYB N;  5HOD A;  5C44 J;  3OSG A;  3PO3 J;  1RPW A;  4FTH A;  2RAE A;  1NK3 P;  3CCY A;  3HBL A;  2LLK A;  3PM1 A;  3S2H J;  3WHB A;  3RQI A;  1U8B A;  3TW6 A;  2NVY J;  2EH3 A;  1ZR2 A;  2YUS A;  2JA6 J;  3M3Y J;  1E3O C;  1EF4 A;  5IP6 A;  3OSF A;  1A6I A;  3JR9 A;  3HB9 A;  2AO9 A;  4DZJ A;  1I50 J;  1WI3 A;  3S16 J;  3BTI A;  1B8I B;  1MH4 A;  1IDY A;  3Q3S A;  1UHS A;  3H3V K;  2Y9Y A;  2GBY A;  1S7E A;  3BG9 A;  4IEJ A;  2VKE A;  2DMT A;  1AHD P;  2XRL A;  4D7N A;  3BR5 A;  2LD5 A;  4C3H J;  5K7Z A;  1TWC J;  1Z77 A;  4M3B A;  1ENH A;  2Y2Z A;  4A3L J;  3JRE A;  4A93 J;  4L5E A;  1ETY A;  2NS7 A;  2X48 A;  5EEA A;  3JRB A;  1QPI A;  2N8G A;  2MSY A;  1H88 C;  3W6V A;  1YRN A;  1BW5 A;  2L7F P;  5J3L A;  3B6A A;  5F1J A;  2R5Y A;  4M3E A;  3FK7 A;  3LSR A;  4QSH A;  1WCM J;  4ABZ A;  1PUF B;  1T56 A;  2LR8 A;  3RKQ A;  1I3Q J;  3JRA A;  2WAQ N;  4CYC B;  1GV2 A;  5F04 A;  4XRM A;  4QTR A;  5FLM J;  3HKZ N;  2E2H J;  1UMQ A;  2EZL A;  2QF7 A;  3LSG A;  5JLX A;  2VI6 A;  4M6V A;  3SDG A;  2DA1 A;  2M8G X;  4XIC A;  4BKX A;  2R5Z A;  1WH5 A;  3OOU A;  1OJL A;  1SFO J;  1YRN B;  4C3I J;  2W48 A;  1OCT C;  5FKM A;  2JMW A;  1VF9 A;  2EZI A;  1TWF J;  1ETX A;  4M3D A;  4UUS A;  2JJ7 A;  1HLV A;  1U78 A;  1BL0 A;  4LOC A;  1X58 A;  2TRT A;  1TWH J;  3GTK J;  2L7M P;  2XPW A;  2DMP A;  5FKK A;  3WHC A;  2HDD A;  3JRG A;  2HXO A;  2LFB A;  1JT0 A;  2LK2 A;  1TC3 C;  2P81 A;  2DMU A;  2HXI A;  1DU0 A;  1D5Y A;  3H0G J;  4FE4 A;  1JJ6 C;  5F0F A;  2AHQ A;  2H8R A;  2R92 J;  2X6O A;  4A3G J;  3ZQH A;  2HYJ A;  2L9R A;  5EYR A;  2ZB9 A;  5C4J J;  1WH7 A;  5DS9 A;  1B72 A;  3ZQG A;  3JRF A;  2D5V A;  1W0T A;  1GDT A;  1Y1V J;  1LFU P;  1XC5 A;  3DCF A;  1IGN A;  3GTP J;  3O8G A;  2ECB A;  1RKT A;  4JX6 A;  2ME6 A;  3ZQF A;  3O8H A;  5EGO A;  4B4C A;  1A5J A;  1B8I A;  2VKV A;  2DJN A;  2MW8 A;  3HGG A;  2B63 J;  1QRY A;  3IH4 A;  4UUT A;  4MFE A;  2G0E A;  2DTZ A;  1JJ8 C;  3UKG A;  4FIS A;  3HOU J;  4A3B J;  3G1O A;  1B72 B;  3G1M A;  1JKQ C;  3HOX J;  2JN6 A;  4RBO A;  2R7Z J;  2FX0 A;  4JP0 A;  2E2I J;  5EF6 A;  2CUF A;  3FIW A;  2IBD A;  2M0C A;  4W97 A;  4A3K J;  2CJJ A;  5EGO B;  2ME0 A;  3BG3 A;  3JRD A;  5IYB J;  3IH3 A;  1PUF A;  1U9N A;  2DA4 A;  1FJL A;  4GFB A;  2JA8 J;  4CYC A;  3C2B A;  2MG4 A;  4MFD A;  3L1P A;  3QPS A;  3S1R J;  4DYR A;  2WB1 N;  1Q1V A;  2FD5 A;  2JA5 J;  4AUX A;  2OPT A;  3SJM A;  2XPV A;  1JUP A;  5FKO A;  3E7L A;  1ETV A;  3ZQI A;  5C3E J;  2XB5 A;  2X9D A;  1DU6 A;  1FTT A;  5IPA A;  2L7Z A;  4FCY A;  1HCR A;  3HDD A;  4MLO A;  2LKX A;  1UG2 A;  3K2A A;  3BR6 A;  3GTO J;  2JK3 A;  5EZG A;  1GV5 A;  1JT6 A;  3FIS A;  1HOM A;  2XGC A;  4XID A;  3MVP A;  2OF7 A;  1NTC A;  9ANT A;  3BTL A;  3GTG J;  1QVT A;  2E2J J;  1BJZ A;  4X6A J;  3HGY A;  5GP9 A;  4A69 C;  1F36 A;  1G2H A;  1JTY A;  4G12 A;  4D5C A;  5F08 A;  4J19 A;  3S1M J;  4XK4 A;  5FLV A;  1ETW A;  1RR7 A;  1ZK8 A;  4DYQ A;  3LNQ A;  3BG5 A;  1MNM C;  3IH2 A;  2XB0 X;  4Y7N J;  3Q0U A;  1BW6 A;  3DEW A;  4D5F A;  2E1O A;  2DA7 A;  3TED A;  1ETK A;  3ZOB A;  1HDP A;  1VND A;  2ID3 A;  2JWT A;  5M5X J;  4DW6 A;  1IUF A;  4DZP A;  2R93 J;  3JRI A;  2DN0 A;  1JKO C;  4HNV A;  4AC0 A;  1ZGW A;  3S1N J;  2K9Q A;  3S14 J;  1OFC X;  2KDZ A;  4JX5 A;  2O7O A;  2K9S A;  2M34 A;  3B6C A;  3GTM J;  2DA2 A;  1VFC A;  4BY7 J;  1Y1W J;  3BR1 A;  2XGD A;  2CU7 A;  2I10 A;  2K40 A;  3HEF A;  4I76 A;  2IAI A;  1LFB A;  4Y52 J;  1F43 A;  4JYK A;  3F0C A;  3HOZ J;  2Y9Z A;  1JUS A;  5E3L A;  3S15 J;  1JTX A;  3HOV J;  2HI3 A;  2IEK A;  3MN2 A;  3M4O J;  1JKP C;  3CQZ J;  5C4X J;  1ETQ A;  3A01 A;  1O4X A;  2Y0S N;  1ITY A;  5IOY A;  5IP9 J;  4MIM A;  5M3F J;  4I6Z A;  3RZD J;  3HOW J;  4C3J J;  1IC8 A;  2CRG A;  1H89 C;  1GUU A;  4X1E A;  1R9T J;  2O9L A;  4XRS G;  5M3M J;  4A3M J;  3S17 J;  3LSJ A;  2XGE A;  3I4N J;  2DMN A;  3CDL A;  3HM5 A;  3NAR A;  4V2F A;  5IP7 J;  3BTC A;  4BY1 J;  1XS9 A;  2ECC A;  1JUM A;  2LTP A;  2VUM J;  1MBF A;  3LOC A;  1ETO A;  4IHY A;  5IYC J;  1I6H J;  1Z0X A;  4A3C J;  1P7J A;  1MBE A;  5E3O A;  5F27 A;  3A01 B;  3A02 A;  4RDU A;  4QIW N;  3JRC A;  4FE7 A;  3FK6 A;  1HF0 A;  2DMQ A; 
#chains in the Genus database with same CATH topology
 2Z16 A;  3GEZ A;  3PFI A;  3ZRG A;  2GZW A;  3V4G A;  3A2K A;  1R58 A;  2CQX A;  2QBY A;  4I02 A;  3REO A;  1BR1 A;  3U2R A;  3ZMZ A;  4GO1 A;  3BR0 A;  3W2A A;  2QLZ A;  4LMY A;  1DQU A;  4M72 A;  2VE8 A;  1QZE A;  1P2F A;  2E35 A;  4M3G A;  2AQE A;  2KT0 A;  1QGP A;  5LRS A;  1IRZ A;  2KFD A;  3ZQL A;  1P7I A;  2KRF A;  2DU9 A;  2FNP A;  4AD9 A;  4ETS A;  4A3F J;  3CLQ A;  2BV6 A;  3BJA A;  2Y30 A;  3KIO A;  1FBU A;  2DA3 A;  2HOS A;  5CVV A;  1IN6 A;  2KMU A;  1DUX C;  1K79 A;  3ZQC A;  2L01 A;  1OQY A;  4BAC A;  6PAX A;  1R23 A;  3L2U A;  3BR3 A;  4IO9 F;  1BN5 A;  2IGN A;  1K61 A;  2W00 A;  2QSF X;  1MIJ A;  1U5T A;  3GFL A;  3PQK A;  4YFK F;  4IHW A;  2OJE D;  3C18 A;  3KPH A;  2NVX J;  2STT A;  4Q4Z F;  2YU9 J;  1FP2 A;  1FWZ A;  3TW7 A;  1J09 A;  3HUG A;  3F8N A;  3OIP A;  1U0J A;  4F3Q A;  1H9G A;  5BPD A;  2JRT A;  2DA6 A;  4ZYD A;  2IXS A;  5CVJ A;  1SMY F;  3W3C A;  5EG0 B;  3C7J A;  1B1B A;  3CZ6 A;  3LSP A;  3D1N I;  3CCR I;  4CCO A;  1T08 B;  1KQ9 A;  1HST A;  2QSH X;  2NVQ J;  3FMR A;  4E4H A;  2V1U A;  2X6X A;  5E79 C;  2IVM A;  2CO5 A;  3L2C A;  2EIM H;  2VJI A;  3KP4 A;  4A3J J;  4NQW A;  4D7M A;  1Z05 A;  1FMV A;  1RET A;  4AIH A;  1FIA A;  3BZ6 A;  1VI0 A;  3OIQ A;  5IT3 A;  2R5Y B;  2NS0 A;  2LOO A;  1MSF C;  2CV0 A;  5FKN A;  4S0H B;  4A6D A;  3AG1 H;  1T0F C;  1LVA A;  2R7F A;  3CCV I;  3QRF F;  4CCK A;  2VQH A;  1OYY A;  1J59 A;  3A0B C;  1FBS A;  1I5Z A;  2ELK A;  2ELJ A;  3KLO A;  2NNY A;  5E1Z B;  5KAI C;  2KIF A;  5FJ8 J;  4HST A;  2GQQ A;  3QOE A;  1VQP I;  3BCB A;  4IHT A;  4L5J A;  5DEQ A;  1X4O A;  3FF5 A;  2VQG A;  2R5Z B;  2GOM A;  1W5S A;  3I5U A;  4HA8 A;  4UV9 A;  2K4B A;  5EZH A;  3Q0V A;  3H3U A;  1OYI A;  3SFI A;  4ZTJ A;  3OL4 A;  3SZT A;  2RGV A;  3DQV C;  3HOY J;  2L9S A;  5KK1 A;  1ZGA A;  1TWA J;  4M9S A;  4UUS B;  1YIT I;  5FRO A;  3LA7 A;  1Y8R B;  2KQR A;  3K1N A;  4PFO A;  1CQT A;  4UUV A;  5GPA A;  2BY1 A;  3P7N A;  4B3A A;  2DK8 A;  1RKW A;  2FJ1 A;  1OCR H;  1G3Y A;  4QLC U;  4LLN A;  1HW1 A;  3L7W A;  2IS6 A;  5JVT A;  2VBX A;  3QYB A;  1K78 A;  4AYB N;  3RPU A;  5LHH A;  5HOD A;  1OCC H;  2BBY A;  3OSG A;  1YIO A;  2MC4 A;  3F6V A;  5E1W A;  1RPW A;  3CC7 I;  2EFO A;  2PX9 A;  1G3W A;  2R3S A;  1UG0 A;  3PL8 A;  3LQR A;  2BY0 A;  3ZN0 A;  3DPU A;  4ENM A;  1VQ6 I;  2V9V A;  2NVY J;  1QQI A;  4XLF A;  2B0L A;  3KEY A;  4MGR A;  2KIU A;  2JA6 J;  5FD5 A;  3M3Y J;  1S7O A;  4BDZ A;  3CUQ A;  5IP6 A;  1B6A A;  5KAF C;  2NOJ B;  1D8J A;  2D1V A;  1I50 J;  3BTI A;  3Q3S A;  1UHS A;  3H3V K;  2Y9Y A;  1S7E A;  3FXU A;  1R6R A;  1W5T A;  4GGG A;  4RM3 A;  1V5F A;  4D7N A;  3BR5 A;  4ASN A;  4BJ5 C;  3K2Z A;  2HVQ A;  3G71 I;  3NEU A;  3B02 A;  4C3H J;  3KEQ A;  1Z77 A;  4PJ0 C;  2Y2Z A;  2K85 A;  3F23 A;  2O0Y A;  3JRE A;  2NS7 A;  5E18 F;  5LGN A;  4EJW A;  3JRB A;  2VQC A;  1H88 C;  2LKS A;  3DWL E;  3W6V A;  1JI8 A;  4HX7 A;  3WTX C;  2L7F P;  3FK7 A;  3LSR A;  1WCM J;  4ESB A;  2KPM A;  2HKO A;  4XOT A;  1XSD A;  3R0J A;  3S8P A;  5D5U B;  2K9M A;  2WAQ N;  4CYC B;  3SQN A;  3A4C A;  3PIP F;  2EZL A;  5K5O A;  2P7V B;  4WXH A;  2NYX A;  3SDG A;  1NH3 A;  1BI3 A;  2M8G X;  4N9H A;  2ZXJ A;  4XIC A;  1GXQ A;  3I0T A;  1KYW A;  4I0A A;  3OOU A;  4PZJ A;  2QQA A;  1V5G A;  1WJB A;  5AIP A;  1YRN B;  3DKY A;  5CKT A;  2BGC A;  3D0S A;  1EV7 A;  1YLF A;  3RI4 A;  4M3D A;  1FT9 A;  2JJ7 A;  2OCC H;  1U78 A;  1IUY A;  2BOL A;  1TT0 A;  3ASN H;  3GUD A;  2VN2 A;  3MZ8 A;  3WHC A;  2L02 A;  5FKK A;  5HNH A;  3TO6 A;  1LVK A;  4BQQ A;  4KMF A;  3EPZ A;  3ROU A;  3K4N A;  3RQ4 A;  1DU0 A;  5KVR A;  3R60 A;  1IO2 A;  2JPC A;  1ODD A;  5H6Q A;  1L0O C;  2HTJ A;  3N4M A;  2AS5 F;  1JJ6 C;  5F0F A;  5TIS C;  3CMA I;  3Q5F A;  2X6O A;  3KET A;  3OYH A;  4O6J A;  3BG7 A;  3ZQH A;  2HYJ A;  2PFB A;  3FHZ A;  4R79 A;  3DU6 A;  2MD0 A;  1BR4 A;  3LFU A;  3I64 A;  4J01 A;  4BQN A;  3CF5 F;  3BPV A;  1Z9C A;  2PG4 A;  2ACJ A;  3OWT A;  3JRF A;  4BE1 A;  2VOO A;  1SVL A;  2P8T A;  3I58 A;  4IX7 A;  2OQR A;  1GVJ A;  1RI7 A;  2A61 A;  3HOS A;  1QA6 A;  1ULY A;  5A2Q Z;  2ME6 A;  3ZQF A;  2QKL B;  4QWQ A;  1A5J A;  3Q9S A;  1B8I A;  4RAZ A;  3HGG A;  3K4C A;  4RGU A;  4MFE A;  1AWC A;  3FMQ A;  2G0E A;  3ECH A;  1X3W B;  4LK1 F;  4RB3 C;  1B4A A;  3IUO A;  4OOI A;  3G73 A;  3VB2 A;  3BWG A;  3G1O A;  1B72 B;  3G1M A;  4DQ2 A;  4F92 B;  2DYS H;  3N05 A;  5GTH C;  1MDM A;  3HHG A;  2A07 F;  1B9N A;  4EMS A;  3K70 C;  5B66 C;  1MKM A;  2FX0 A;  1YFH A;  2E2I J;  3GFI A;  2JVH A;  2CUF A;  1F4K A;  4IRI A;  2M0C A;  4L9V A;  4W97 A;  2EIN H;  4A3K J;  2DJI A;  1F5T A;  3BG3 A;  1P9Q C;  3CME I;  1W36 C;  2NXN B;  5IYB J;  3IH3 A;  4IRG A;  4J00 A;  4XRF A;  5FGM A;  1FJL A;  4UVA A;  2BVL A;  4AYB A;  4MFD A;  1WQ2 A;  2R7D A;  3MKZ A;  3MFK A;  3VYT B;  1H0M A;  2MH2 A;  2JA5 J;  1BIB A;  4AUX A;  2DQR A;  2MH9 A;  3LA2 A;  3SJM A;  2STW A;  4CXF A;  1EJ9 A;  1V3F A;  2PJR B;  1ETV A;  3JW4 A;  3HSF A;  2R7X A;  1D0X A;  3FX3 A;  2WC2 A;  2RV8 A;  2X9D A;  1FTT A;  4KYW A;  3K4K A;  3ZMS A;  5IPA A;  2EJR A;  4E7L A;  2HS5 A;  3AAF A;  2KLO A;  4AIJ A;  1HCR A;  2M4K A;  3GZN B;  1FSH A;  4LG3 A;  3ABL H;  3BR6 A;  3QU6 A;  5J40 A;  3FIS A;  1HOM A;  2HPI A;  4XID A;  2OF7 A;  9ANT A;  3BTL A;  5L3F A;  1ZG3 A;  2M5W A;  2VJ5 A;  1IN8 A;  1R1U A;  1TQI A;  1SAU A;  5GP9 A;  4KN4 X;  2DYR H;  1TBX A;  2QQ9 A;  1Y0U A;  3E0J B;  1JXS A;  4XK4 A;  3C3W A;  1ETW A;  2K3P A;  3K10 A;  1SVO A;  1W1W E;  3VYU B;  5KNL A;  2VLA A;  3S2W A;  5FLX K;  1MJA A;  4PK4 A;  3P9C A;  4IOC F;  2LBF A;  3FWE A;  3FM5 A;  2K3F A;  3BY6 A;  1HDP A;  1VND A;  4UV8 A;  2JWT A;  4A0Z A;  1N78 A;  4BGD A;  3M8J A;  4YFX F;  2KKO A;  2R4G A;  3E97 A;  3AG3 H;  5AIQ A;  2R93 J;  1RUN A;  4AC0 A;  1ZGW A;  3M1E A;  1QZY A;  3SHF A;  3S14 J;  2X1D A;  2XF7 A;  3VOD A;  2P4W A;  3O6B B;  4KMU X;  2K86 A;  3VEP A;  1XGS A;  3RJP A;  4LLL A;  3U9G A;  5JHU A;  3BR1 A;  2MC3 A;  1LFB A;  1ACI A;  2K5C A;  2RQP A;  2R7O A;  3GLL A;  3HOZ J;  2Y9Z A;  2LSO A;  2V9K A;  4ZJZ A;  3H1C A;  2Z2S B;  2LH9 A;  2IEK A;  3SEZ A;  3M4O J;  4XLP F;  3OOP A;  4ANJ A;  1JKP C;  3D5S C;  3J7Z I;  1BM9 A;  3E6B A;  5IOY A;  3RSN A;  4BQO A;  4C3J J;  3V42 A;  4EVI A;  2FBH A;  4X1E A;  3EUH A;  2Z33 A;  4Q5S F;  1FP1 D;  3QYF A;  2XKP A;  5IP7 J;  2BE5 F;  2K9L A;  3BTC A;  4CA0 A;  2ECC A;  1MW7 A;  3OYK A;  1ZG5 A;  3PJR A;  3IWZ A;  2VUM J;  3K0L A;  3BG6 A;  3HYI A;  4BYY A;  4IHY A;  5DM7 F;  3LST A;  3LAJ A;  4LIU A;  1Z0X A;  4ZDP A;  2VB6 A;  4HSR A;  3IRR A;  1FOK A;  2LRD A;  3A01 B;  5HOO A;  1KQ8 A;  1ZHF A;  2EK5 A;  4Y15 A;  3OYC A;  1VTN C;  2DI3 A;  4G94 A;  5F1R A;  1EKE A;  3KEO A;  1AKH B;  1XMK A;  1ZTR A;  2EZH A;  2JQ7 A;  3M7G A;  1BA5 A;  3EET A;  1X1D A;  2KJC A;  2ZME B;  2NNN A;  1MGT A;  2EZK A;  2JSC A;  2FBK A;  1OCZ H;  3F9K A;  3JSO A;  2ZSI B;  3MKW B;  3LFK A;  1XSX A;  1DDN A;  5DCM A;  4M74 A;  1AU7 A;  1IDZ A;  1XB4 A;  2M9H A;  3CCQ I;  3QOD A;  3E3V A;  3HRM A;  4MNU A;  5B3S H;  2P0W A;  4BXU A;  2E1M B;  1XG1 A;  2O8K A;  1R22 A;  5EG0 A;  1W7P D;  5E20 A;  4BHB A;  1ZR4 A;  3TDU C;  4YEJ A;  2QA4 I;  4UB6 C;  2XF6 A;  3K6G A;  4II3 A;  5GTI C;  4U7B A;  3G4S I;  2KZG A;  3V8K A;  4BEH B;  4PDK A;  2HGC A;  3Q0W A;  5CPR B;  2GXA A;  1TP4 A;  2EIL H;  2MA3 A;  4ZZD A;  5J8C A;  1R7J A;  1AA7 A;  3J7A Y;  3NAU A;  3OYE A;  2PMZ N;  4F7Z A;  2CGP A;  5HLG A;  3RYP A;  1S9H A;  2L2O A;  1MBG A;  3DFG A;  3I59 B;  5ED4 A;  2XRN A;  4XBF A;  3I9V 2;  4OIN F;  3H3Z A;  2IW5 A;  4MQ9 F;  3GTL J;  4P96 A;  2VPR A;  4A3D J;  1WJ5 A;  2IS1 A;  5F0H A;  3E5Q A;  3HRT A;  4W1U A;  2OBP A;  4XRS A;  2LDU A;  4MTD A;  2Q8K A;  4V19 K;  3IL2 A;  1FEX A;  5J1U A;  3JSP A;  1WPK A;  1SD4 A;  2V79 A;  2W1O A;  1BI2 A;  4JQF A;  2G7U A;  1BOA A;  4JX4 A;  4WWC A;  1W0U A;  2XSD C;  3JAM K;  4PFP A;  5F6F A;  1ZKG A;  2X1C A;  3QYE A;  1MD0 A;  2UZK A;  3K4L A;  2IA2 A;  3FKJ A;  4HLY A;  3GBG A;  3GME A;  3BRO A;  1WJA A;  2XHK A;  3SZG A;  1XX5 A;  2CW0 F;  2VC1 A;  4A5N A;  2EFN A;  1KZH A;  3DF8 A;  1JKR C;  2NVT J;  2MFZ A;  2GOX B;  1MH3 A;  3MQ0 A;  4ZYE A;  2WWY A;  3K7A J;  3OR1 C;  1V55 H;  1TW2 A;  2XDV A;  2XAS A;  3P5J A;  3TDZ C;  2QQ8 A;  3ABT A;  2GA2 A;  1ZQ3 P;  2HWV A;  4KIT B;  3CCL I;  5FKL A;  4RB0 A;  1S5L C;  2V9P A;  1R1V A;  4UXN A;  3TO7 A;  4GCV A;  2ELH A;  5D8L B;  2L9V A;  2NS8 A;  5K7H A;  1N77 A;  1MNE A;  3OYN A;  2KP6 A;  3RCO A;  1CF7 A;  3C2G A;  1QHG A;  5JI6 A;  5TGT A;  4P5O A;  2DDA A;  1Y6I A;  4HAM A;  1BC8 C;  3KP7 A;  1X1P A;  4HX8 A;  1Z7U A;  3H0D A;  2CQQ A;  1I1S A;  2RC4 A;  1X2N A;  3KP5 A;  5HDG A;  5E17 F;  3HC7 A;  3BQY A;  5K7F A;  4BAY A;  3CLO A;  3CMY A;  4HEA 2;  3HG9 A;  5B5E C;  4BXX J;  3HTU A;  3VSK A;  2X0L A;  3BR2 A;  1T98 A;  1IV8 A;  3QP5 A;  1Z3Y A;  2XSJ C;  2FOW A;  2B9S A;  4XM3 A;  3ELK A;  1WJD A;  4FTH A;  4L9N A;  1I3A A;  4B09 A;  2OC6 A;  2IGM A;  1NK3 P;  1VZ0 A;  3CCY A;  3OMY A;  4HV5 A;  3T8T A;  4LIV A;  2ZXI A;  4OAZ A;  3FXL A;  3TW6 A;  1ZR2 A;  3E5X A;  3CDI A;  2YUS A;  1DGR M;  4B3X A;  2HYG D;  1VQ9 I;  5BS6 A;  5FO5 A;  4E70 A;  1E3O C;  2AXT C;  3JR9 A;  2Q2E A;  3HB9 A;  2A5W A;  1M1E B;  3OYG A;  1HXD A;  5HLI A;  5HS8 A;  4CIC A;  4KFC A;  1RZ4 A;  4HNU A;  2GBY A;  4XR6 A;  1YTY A;  1LQ1 A;  4WXD A;  3ERM A;  2PLY A;  1LDD A;  2VKH A;  4XSX F;  1LB2 A;  5FFZ A;  4A3L J;  2XGX A;  2CV1 A;  1R36 A;  4L5E A;  3NQO A;  1ETY A;  3EUA A;  3U1K A;  2X48 A;  4NC8 A;  4MQV A;  3IP4 B;  2MSY A;  3LSM A;  1IN4 A;  1TQM A;  4WK8 F;  4B48 A;  4XKV A;  2CW8 A;  3DXJ F;  4IF4 A;  4E7K A;  1YRN A;  3FXQ A;  1ON1 A;  4HW0 A;  2DQL A;  5F1J A;  3B6A A;  4M3E A;  2DT5 A;  3BC8 A;  4L0Y B;  4WCG A;  3G2B A;  1IRG A;  3AFH A;  4BE2 A;  1PUF B;  4CHU A;  1STZ A;  1T56 A;  1U6G A;  2LR8 A;  3MKY B;  2DFE A;  2WAE A;  4JBA A;  5HNF A;  2OZU A;  4HQE A;  2JRM A;  4S05 A;  2QF7 A;  2IT0 A;  2GIZ A;  4RLQ A;  2W84 A;  2M8E A;  2ZC2 A;  3IAM 2;  4ON0 A;  1A31 A;  2FA5 A;  4PGG A;  4KUM A;  2JUC A;  2XAH A;  4A5M A;  2EFQ A;  2H6C A;  1SFO J;  2E5Z A;  2WAF A;  2JMW A;  1VF9 A;  2LG4 A;  4BJT A;  5A2Q K;  5CVI A;  4P9F A;  3WTW C;  4GRI A;  1TWF J;  3BLY A;  1ETX A;  4EJU A;  2PMZ A;  3ZMT A;  2QSG X;  1SD7 A;  3CJR B;  3LSK A;  2JPB A;  2W82 A;  3A1Y A;  2DCE A;  2M45 A;  2HR3 A;  1RC9 A;  1T2K A;  4BDY A;  5LEK A;  1TWH J;  2F5E A;  3OYB A;  3GTK J;  4NBQ A;  2O8X A;  2XRO A;  4NUB A;  5LD2 C;  1MMS A;  4IRH A;  2LK2 A;  1TC3 C;  1P4W A;  2HXI A;  4QPO A;  1D1C A;  2DK5 A;  2B7E A;  3NRV A;  4LG0 A;  3QAH A;  1IXS B;  2V7F A;  1J5Y A;  4KDP A;  1B9M A;  2OA4 A;  4FE4 A;  2AHQ A;  2H8R A;  4G7H F;  2R92 J;  2M87 A;  5LGU A;  1YI2 I;  3FZV A;  3DBL B;  2CFX A;  1UAA A;  1I27 A;  2HU9 A;  2E7X A;  2JUG A;  2ZB9 A;  3V7S A;  2WY7 Q;  5K5R A;  4XKW A;  4BE0 A;  2H94 A;  1VQ7 I;  5EJC A;  3JTH A;  5DS9 A;  1VQO I;  1B72 A;  4Y13 A;  2Z99 A;  5GAG J;  2PMU A;  1ZRF A;  4BH9 A;  1SMT A;  4Q47 A;  2D5V A;  4PJN A;  1W0T A;  1GDT A;  1XSV A;  1Y1V J;  4DBR A;  1LFU P;  2VPL A;  1IGN A;  1Y0N A;  4HLX A;  2LNB A;  3JAM Z;  3PUF A;  3GZ6 A;  2DPU A;  2ECB A;  3LA3 A;  3TOA A;  1MMN A;  1XCV A;  2FBI A;  1FLI A;  1YJW I;  2HPM A;  2F4M B;  2X6W A;  3DBH B;  4O3M A;  4RB2 C;  1FNN A;  1QRY A;  2CH0 A;  2IJL A;  3ABU A;  3TQN A;  1BC7 C;  4N9I A;  2BW3 A;  1R5G A;  2QZ8 A;  2W85 A;  1IRX A;  1D8K A;  3UKG A;  2E71 A;  2QKM B;  4LK0 F;  1UCR A;  1DP3 A;  4A3B J;  4AIK A;  3OYF A;  3CC4 I;  1JKQ C;  1YS7 A;  3E5U A;  3L2Q A;  4DGW B;  2F5V A;  1K4S A;  3MAJ A;  1EA3 A;  3DP7 A;  3HIF A;  1HBX G;  2WAD A;  1TT5 B;  5D6F A;  3DTI A;  5J4Y A;  2CJJ A;  5EGO B;  1D5V A;  5DCF A;  2M0M A;  3CCJ I;  3HZJ A;  4HZF A;  1TL8 A;  3CTA A;  1Z21 A;  3H92 A;  3L1P A;  1DP7 P;  4DYR A;  2O61 A;  2HKX A;  4RB1 A;  2KRC A;  1Q1V A;  1C0W A;  2O6G E;  2FD5 A;  3S3N A;  3HJE A;  4XOR A;  3FXM A;  5B1A H;  2E5N A;  5E8G A;  3W2V A;  2ADU A;  5C3E J;  2XB5 A;  3ZQQ A;  4S04 A;  1V4R A;  3HXL A;  1IZ1 A;  2L7Z A;  5HS7 A;  4KJZ A;  3VYS B;  4IVN A;  2QBY B;  1BI0 A;  1N75 A;  3HDD A;  2LKX A;  3OYD A;  1MMA A;  2HVR A;  1SFK A;  3HSR A;  4RM2 A;  1ZRE A;  3TGN A;  2XGC A;  3S3O A;  1J75 A;  1NTC A;  1BI1 A;  4XKB A;  3HPH A;  3HRU A;  2I5U A;  2Y48 A;  1E0E A;  2V6C A;  3ABM H;  3CD6 I;  4E7S A;  1JTY A;  3FM3 A;  4IKF A;  1G2H A;  4G12 A;  5F08 A;  1ZGJ A;  1V54 H;  1WFX A;  4HG2 A;  2PI0 A;  3T8R A;  1ZK8 A;  1J7K A;  2RRE A;  4M6X A;  2VL8 A;  2FML A;  4Y33 A;  5CLS A;  1UST A;  1REP C;  3T1B A;  3LMM A;  2E1O A;  3ZGK A;  3H5A A;  1KQ0 A;  3ZOB A;  3F6O A;  4O5V A;  5LRR A;  2R7V A;  2EA2 A;  5M5X J;  1YQA A;  1G3T A;  1IUF A;  4RAY A;  2DOA A;  3NWT A;  3GZ5 A;  1U5T B;  1LDK B;  3H9J A;  4DZP A;  1DGW Y;  1ZYR F;  3SZP A;  3JRI A;  5ICC A;  4HNV A;  2F2E A;  3R0A A;  3CF2 A;  2VBY A;  4XLH A;  4E6K G;  2K9Q A;  2X4H A;  4OMZ A;  4XMY A;  1HKS A;  2KDZ A;  3CO7 C;  1VQM I;  2KHM A;  1NG7 A;  1WSU A;  1CGP A;  4XN3 A;  5TJJ A;  4OIQ F;  4ENJ A;  3H5N A;  2M34 A;  4UVB A;  2XAJ A;  1Y1W J;  4UB8 C;  1BBY A;  3HEF A;  2I10 A;  3ONQ A;  4NB5 A;  4Y52 J;  3TO9 A;  4EGZ A;  5FRM A;  3DKX A;  3K1M A;  3S15 J;  3OYM A;  3F8F A;  1ZEL A;  1R4M B;  4EJO A;  2EFW A;  4L9T A;  4E7J A;  1YE9 A;  3CQZ J;  5C4X J;  4MTE A;  4A6E A;  4NQW B;  3A01 A;  1O4X A;  1K4T A;  2Y0S N;  2LY1 A;  5IP9 J;  5JHF A;  4MIM A;  4A0Y A;  3HOW J;  2H09 A;  1W7P A;  1GUU A;  1R9T J;  3BJ6 A;  2QEX I;  2FEZ A;  3LAP A;  2XGE A;  3K70 D;  2DMN A;  3CDL A;  4BY1 J;  3W2W A;  2R7R A;  1U5T C;  3H5R A;  5LLQ A;  1VQK I;  1JUM A;  2G9W A;  3A0H C;  5DV5 A;  2ZNZ A;  2L7K A;  2LTP A;  1G6N A;  3S3M A;  3LOC A;  1W36 D;  1ETO A;  1D0Z A;  4OIP F;  5IYC J;  3L2W A;  3F22 A;  3PQJ A;  2ETH A;  1I6H J;  3WTY C;  2HDC A;  2FUG 2;  2CFO A;  2R7W A;  4N0B A;  2CQK A;  1Z3X A;  3KZI C;  4RDU A;  3FK6 A;  4KA4 A;  2ZXH A;  3J81 Z;  3L00 A;  1OR7 A;  1OYW A;  1E3P A;  1FTZ A;  1YX3 A;  4Y17 A;  4LIT A;  2MGQ A;  3HOT A;  2TDX A;  4C2M J;  3KP6 A;  1GT0 C;  1JGG A;  5JLW A;  4CCN A;  1H8A C;  3ZN1 A;  3FMS A;  1A35 A;  1OCP A;  1FIP A;  2CQN A;  4FHT A;  2YS9 A;  5B1B H;  1G3S A;  3V7R A;  3CCE I;  1K78 B;  3CCM I;  3I59 A;  2F5D A;  5K1Y A;  2MBF A;  5ILU A;  1MBK A;  1SFE A;  5IOZ A;  4BUP A;  4ENN A;  3PNY A;  4YRV A;  1X2M A;  1SFU A;  1FZP B;  5E3N A;  2FU4 A;  3GLX A;  3JRH A;  1HDD C;  1ZLJ A;  4UNO A;  1HSJ A;  5JVG F;  4DIQ A;  4HX4 A;  3HRS A;  3LWF A;  3BT9 A;  3TKY A;  4IL6 C;  2IA0 A;  4AVP A;  4A3I J;  2EWN A;  3CCS I;  2QM3 A;  3GCM A;  4GDF A;  1YW9 A;  3TP0 A;  2CMP A;  4XLA A;  2XUB A;  1N25 A;  4XON A;  3GTQ J;  3RPU D;  2PBI A;  1SAN A;  1KON A;  5DUI A;  2CSO A;  1J0R A;  2OU2 A;  1MBH A;  5J1R A;  4HDU A;  4Y4R A;  4RA2 A;  4YEL A;  5F0C A;  3EUK L;  4B43 A;  3G6E I;  1T33 A;  3GF2 A;  4M6Y A;  3WU0 A;  3C1D A;  2X6Y A;  4L9J A;  2DO7 A;  5F64 A;  1LE8 B;  2NRA C;  1O57 A;  4JK1 X;  1NK2 P;  1YW8 A;  2WTE A;  1U2W A;  3WE3 A;  2WAQ A;  4PJJ A;  3DEE A;  4M71 A;  1IG7 A;  2XV4 S;  2HOT A;  4U0Y A;  4FT8 A;  1UFM A;  1T8I A;  1R1T A;  4G6Q A;  2EQR A;  2ESN A;  3OV8 A;  3H9Q A;  3BJO A;  1UHM A;  4DYC A;  3H36 A;  4YII A;  1WGX A;  2NVU B;  4UVC A;  4HRI A;  1IJW C;  1H9T A;  4KIG A;  4FAS D;  3ZMU A;  3OYI A;  1FYK A;  2RVC A;  2E7W A;  2L0K A;  2XVC A;  3GTJ J;  1ZH5 A;  3CUQ C;  4BBR J;  1YJ9 I;  5DTD A;  2M2E A;  5ERI A;  3G3Z A;  3V8J A;  2EPF A;  2DOF A;  2DXI A;  3MCZ A;  3FXJ A;  4GYI A;  2R0Q C;  1AOY A;  2TCT A;  3G1L A;  3ZR8 X;  1ON2 A;  5K5Q A;  5BOX A;  3ZCO A;  4KIF A;  3EDP A;  1K7A A;  4X0G A;  4YFN F;  2RDP A;  2R7S A;  2LVS A;  1PVE A;  1GLN A;  2EIK H;  1KGS A;  2JA7 J;  1RES A;  2BXY A;  2O03 A;  3L2V A;  4IHS A;  1YYV A;  3K4B A;  5HDK A;  2VBW A;  2RNJ A;  3MD2 A;  4G7O F;  1ORK A;  3IC7 A;  4RAG A;  3S2D J;  1Z7L A;  3BDD A;  4XLN F;  4FX0 A;  5ILS A;  3VPR A;  1JGS A;  2ZCW A;  4YG2 F;  4EM2 A;  2XPU A;  3FKI J;  5J8F A;  4ZH4 F;  5C44 J;  1D3Y A;  4IXA A;  2F6C A;  1Y56 A;  4XL9 A;  5LGT A;  3PO3 J;  2QQB A;  2RAE A;  2Y0S A;  1UJ8 A;  3M1C A;  4OWR B;  1OCO H;  1A6Q A;  2P5L C;  3HBL A;  3OS2 A;  3PM1 A;  4TV7 A;  3RQI A;  3O2P E;  1WJF A;  1FPQ A;  3WHB A;  1O3T A;  2EH3 A;  3ISP A;  2MAB A;  3D5R C;  1J2X A;  3EYY A;  4U7D A;  2VOD A;  1EF4 A;  2HQA A;  3OSF A;  1U8R A;  3RKW A;  2AXL A;  1YX5 A;  2DT7 B;  3Q9V A;  1Z6R A;  4DZJ A;  4NC7 A;  1WI3 A;  2IA1 A;  4YIR X;  3RYR A;  4EM0 B;  1B8I B;  2D1H A;  3ESW B;  3HPG A;  2VQL A;  3BG9 A;  4CCJ A;  1AHD P;  4Y3O A;  2EIJ H;  3U21 A;  5TRD A;  2LD5 A;  3GYH X;  1T6S A;  4M3B A;  5HDN A;  2Y69 H;  4C2T A;  3AG2 H;  4OAY A;  2BYV E;  3KP3 A;  3LSH A;  3QPT A;  1X3Z B;  1VQ4 I;  2CG4 A;  1MMD A;  5FD6 A;  4RGR A;  5LBQ A;  1QPI A;  1I6X A;  1FOW A;  5HS9 A;  5GAE J;  3F8M A;  4IJA A;  4P9U A;  3I71 A;  2XAG A;  2V1N A;  5DD8 A;  3BZC A;  5J3L A;  2R5Y A;  1G8X A;  4FQG A;  1L3L A;  4RGS A;  1TNT A;  5EEH A;  2QEN A;  4KIC A;  3OR2 C;  1Y8Q B;  3I55 I;  4A12 A;  1LUJ B;  2F4I A;  1XCB A;  3HKZ N;  2E2H J;  1UMQ A;  1HKQ A;  3LSG A;  2VI6 A;  1KYZ A;  3VOE A;  4BNC A;  3CES A;  4XOP A;  2W24 A;  4M9Z A;  2CV2 A;  4DOZ A;  2OQG A;  1YOV B;  4I0B A;  5L3E A;  2YSR A;  3CMM A;  1P4A A;  2LY2 A;  4BKX A;  3GO5 A;  5LEJ A;  2R5Z A;  1PJR A;  2I8D A;  2K27 A;  1D0Y A;  1JE8 A;  4F91 B;  2D45 A;  1QBJ A;  1OJL A;  3K69 A;  5D8K B;  4RS8 A;  1XDU A;  3QU3 A;  5ICG A;  4I98 B;  2KRH A;  3WU2 C;  4YIF A;  4UUS A;  4ITV A;  3DLA A;  1HLV A;  2X85 A;  1FOX A;  3BOQ A;  1UB9 A;  1X58 A;  4LOC A;  1TZL A;  2TRT A;  1R00 A;  3CCU I;  1TTY A;  2OUM A;  2L7M P;  4ENK A;  2DMP A;  1HA8 A;  2DT6 A;  3JRG A;  2DW4 A;  2FSW A;  3DKW A;  2HXO A;  4I09 A;  3ZMV A;  1K6Y A;  1E17 A;  1JT0 A;  5EEG A;  1OR7 C;  2DMU A;  2P81 A;  2DFI A;  2P5K A;  1YHQ I;  4HBL A;  2MD5 A;  1IW7 F;  1R5I D;  4F52 A;  1XDS A;  1HQC A;  4A3G J;  4CGZ A;  1O7L A;  4UHT A;  2VBZ A;  2FNA A;  2A6T A;  2LBF B;  3SFZ A;  4KN7 X;  1W4M A;  5C4J J;  3S93 A;  1F1Z A;  2FF4 A;  2K4J A;  1WH7 A;  2IRF G;  3CP2 A;  2M4G A;  1A36 A;  1BOB A;  3MMY B;  3ZQG A;  1X3U A;  5J4V A;  1ZRD A;  3TBI A;  4LB5 A;  1XC5 A;  5LFA A;  1GHC A;  3WG9 A;  3ABK H;  4JX6 A;  1RKT A;  1P6R A;  4HF0 A;  2CYY A;  1BJA A;  3O8H A;  5EGO A;  4B4C A;  2HQR A;  2VKV A;  2MW8 A;  1TQP A;  2B63 J;  2FOK A;  2VE9 A;  3J80 K;  1LEB A;  3ASO H;  2CUZ A;  4XLC A;  1SD5 A;  4G6D A;  2L4M A;  3M8E A;  3FXK A;  4IPA A;  1JJ8 C;  4PCQ A;  4L18 B;  2Y0M A;  1PDN C;  3LL7 A;  2LC2 A;  2W4S A;  3HOX J;  3QOP A;  4RBO A;  1WKM A;  1J9I A;  4JP0 A;  5EF6 A;  2GXG A;  3FIW A;  2IBD A;  2OV7 A;  5FFX A;  4BHP A;  4EJT A;  3WOD F;  4ZZL A;  1MZB A;  3JRD A;  1U9N A;  2DA4 A;  3I54 A;  2JA8 J;  4CYC A;  1O3S A;  2DLL A;  3WG7 H;  2DFF A;  1O7F A;  3WGG A;  3S1R J;  4AWX B;  2PJP A;  2WB1 N;  3FBI B;  3WTS C;  2E1C A;  4FET A;  4OMY A;  3GWZ A;  5D5W B;  1JUP A;  3E7L A;  4DJA A;  1NG6 A;  4NNJ A;  5J6X A;  3W6J B;  5D5X B;  1DU6 A;  3CP8 A;  5IT9 K;  2Z9O A;  1FYM A;  4PSW A;  3CUO A;  5ICF A;  3FXR A;  1ZAO A;  1LNW A;  1UG2 A;  3K2A A;  4ZYG A;  3ZP5 A;  1T39 A;  3GTO J;  3N97 A;  1JT6 A;  4P1W A;  4CDG A;  3MVP A;  4A2U A;  1EH7 A;  2E2J J;  4CCM A;  5DDG A;  4X6A J;  4IQ4 A;  2BHY A;  5DCM B;  3EUH C;  1F36 A;  1G59 A;  5DUK A;  3DTE A;  4D5C A;  4PGH A;  4J19 A;  2A68 F;  3MZY A;  3S1M J;  4BJ6 C;  2OAZ A;  1RR7 A;  4P55 A;  4U0W A;  2KZV A;  3IH2 A;  1MNM C;  4Y7N J;  4FX4 A;  2DAO A;  3Q0U A;  1BW6 A;  3DEW A;  2AQF A;  3E1S A;  4LLG F;  4D5F A;  2A6E F;  4OIO F;  2DA7 A;  4RGX A;  4AVZ A;  3KP2 A;  4RLF A;  2DDB A;  4DW6 A;  3DPT A;  4U88 A;  1VQN I;  1OPC A;  3VWB A;  1XD7 A;  4L0Z B;  3GVA A;  3W6K B;  1XGO A;  3E6C C;  1JKO C;  2FQ3 A;  3HKZ A;  1JHH A;  2OCE A;  4XQF A;  2M7B A;  3X2Q H;  3S1N J;  3KX2 A;  3M07 A;  1OFC X;  4U87 A;  3I53 A;  4JX5 A;  3QWL A;  1NHA A;  2O7O A;  2RNG A;  4R8H A;  3J81 K;  2XC7 A;  4EM1 A;  1USS A;  2WV0 A;  2XAF A;  4M73 A;  5J47 A;  2XGD A;  2K40 A;  4E7I A;  4I76 A;  2IAI A;  3M9A A;  3P9I A;  4IQJ A;  3QP6 A;  4OIR F;  3F0C A;  2XF5 A;  1OKR A;  1JUS A;  1X1A A;  2FE3 A;  2HNH A;  4I7H A;  2LF8 A;  2W57 A;  5E3L A;  2HI3 A;  3HSE A;  1GXP A;  3HOV J;  2M1B A;  2UUZ A;  1TNS A;  5IY5 H;  5CYV A;  4HOB A;  5BMZ A;  2JSP A;  3PSI A;  4UY8 I;  1E3H A;  3DBR B;  5M3F J;  4KT5 C;  4N4O B;  1ZLK A;  4LJZ F;  2R7U A;  1S72 I;  2O9L A;  5BQT A;  4A3M J;  2F5C A;  3M8F A;  3I4N J;  1QPM A;  1VQ8 I;  1MND A;  3HM5 A;  3CO6 C;  4V2F A;  2DOD A;  1PYV A;  5FB2 A;  1RRJ A;  2A3S A;  2WBM A;  4F55 A;  4EAT A;  5HLT A;  1ONV A;  1QNT A;  2G7H A;  2GWR A;  2BXZ A;  3WGI A;  4II2 A;  2YPR A;  4BHC A;  4A3C J;  2UXN A;  2HQN A;  1LJ9 A;  2PJR A;  5F27 A;  3AKZ A;  5CVU A;  4QIW N;  4NC6 A;  4FE7 A;  1IF1 A;  4ZDL A;  3ZQ7 A;  3EYI A;  2DMQ A;  3KLN A;  4XNF A;  4PJL A;  1CF7 B;  3OS0 A;  1IAW A;  5FRN A;  4A3E J;  1TWG J;  2X51 A;  1RNL A;  2JA2 A;  2OTL I;  3DLL F;  2OD5 A;  3L09 A;  3GW2 A;  1WJC A;  1Z67 A;  4IHX A;  5J1Y A;  4BXF A;  1SAX A;  3IWF A;  2QGU A;  2K9N A;  4PUS A;  1IV6 A;  2EV6 A;  2L4A A;  2DA5 A;  5AON A;  2BY3 A;  4DNC A;  3DTK A;  1KU7 A;  4EEF G;  1MJ9 A;  2O5R A;  5M5Y J;  2BVM A;  2GA1 A;  2MYS A;  2KIQ A;  2CUE A;  3S1Q J;  2EV5 A;  2LY9 A;  4K2E A;  3FDY A;  3R61 A;  4B1R A;  3SXY A;  4V2G A;  1APL C;  1HW2 A;  4GYG A;  1R5H A;  2PN6 A;  5EDN A;  1R49 A;  3RDI A;  3J80 Z;  3MKL A;  3PO2 J;  4N4N B;  1A04 A;  2Y31 A;  2VT2 A;  3IKT A;  1RIO H;  2GXB A;  2L54 A;  2RQQ A;  1ERD A;  2A69 F;  3J7A O;  2EV0 A;  2FQ4 A;  1IRF A;  1XMX A;  3T5X A;  1LE8 A;  2P7C B;  3IKV A;  2LKP A;  2VJ4 A;  4NDL A;  2EB7 A;  4ZTF A;  2Q2E B;  2VKD A;  5KHD A;  2MLG A;  1WJE A;  1FSE A;  2WB1 A;  4D9J A;  4L5I A;  1P4X A;  3F21 A;  2GLO A;  2MLK A;  2HQ5 A;  2YU3 A;  2WV1 A;  1K6O A;  3OIO A;  2ICW G;  1GVD A;  1S29 A;  1UZC A;  4F93 B;  3QPL A;  2DTR A;  5M5W J;  1QO0 D;  2QCO A;  5LHG A;  3RTR A;  2J5P A;  4ESJ A;  5CQG A;  2FMY A;  5H20 A;  4G6T B;  3GFJ A;  4M9X A;  3IV5 A;  2K02 A;  1S3J A;  2LMD A;  4IZZ A;  2ID6 A;  2VAS A;  4CZC A;  4HF2 A;  4KIS A;  3HHH A;  2V1D A;  4I2O A;  5JR3 A;  5IT9 Z;  5GPC A;  1YJN I;  2R7T A;  2D2W A;  3HL2 A;  2L5Q A;  3HUG B;  4BS9 A;  1BR2 A;  2KIM A;  3KZY A;  1SVM A;  1YS6 A;  3KYD B;  3WTU C;  2Z1D A;  2A05 A;  3UR3 C;  1EH8 A;  1XPX A;  4HV6 A;  3DEU A;  3U1D A;  2E19 A;  1R71 A;  1YIJ I;  2EFP A;  3ULQ B;  3RZO J;  4B47 A;  1SEU A;  3O3K A;  1MSE C;  1POG A;  4MO7 A;  5D6E A;  3I4M J;  4BBS J;  1HKT A;  4XSZ F;  3ZXS A;  3OL3 A;  4ESF A;  1WVR A;  1ZN2 A;  3IHU A;  4CZZ A;  1S8N A;  1JHF A;  2COB A;  3BTJ A;  2GAU A;  5IYD J;  2C6Y A;  2H1K A;  4H0E A;  2ZO4 A;  1OLT A;  4G8X A;  3BQZ A;  4HYE A;  3DU5 A;  1MBJ A;  2EBI A;  2P6T A;  2XIG A;  1AKH A;  5BNG A;  3F72 A;  4EJV A;  3TP3 A;  2OTJ I;  1QVU A;  3H9G A;  3F8C A;  2ZME A;  1LKX A;  3GXO A;  3QQA A;  1FC3 A;  2HOA A;  4NHJ A;  4M3F A;  3ZPL A;  3SDB A;  4Z2Y A;  3A03 A;  2HZT A;  2GM4 A;  1E2X A;  3DV8 A;  4HF1 A;  4IHV A;  2W25 A;  3BPX A;  1K83 J;  2LP0 A;  5E3M A;  4G9Y A;  1UHW A;  1U9O A;  4LG0 B;  2ZKZ A;  2NOG A;  2HDW A;  1MJB A;  4EQQ A;  1HW5 A;  2F4O B;  2LF7 A;  3E6D A;  3RPQ A;  1LFP A;  1OIS A;  2KJB A;  3OYA A;  2V1X A;  1IXR C;  1YG2 A;  4BEH A;  2Z5U A;  1FBQ A;  1VQ5 I;  3RIR A;  4B8X A;  5GAH J;  1RR8 C;  2LLK A;  3S2H J;  5E8I A;  2XAQ A;  1U8B A;  2NAZ A;  4I99 C;  2COM A;  5H6R A;  2QWW A;  2H27 A;  2VC0 A;  1XMA A;  1A6I A;  4ZYA A;  3FXO A;  4IOA F;  2AO9 A;  2XKO A;  3S16 J;  3DPL C;  5CQE A;  1MH4 A;  3MZH A;  1IDY A;  2F5F A;  4EV0 A;  4R1H A;  4IEJ A;  3PNT A;  2VKE A;  2LRE A;  2DMT A;  2XRL A;  4ZYH A;  1SD6 A;  1W5C C;  2BW3 B;  1TLH B;  5K7Z A;  1TWC J;  2LYC A;  3NWS A;  3RKX A;  1ENH A;  2Q1Z B;  4QPQ A;  1PP8 F;  4A93 J;  3S32 A;  4EGY A;  4CH7 A;  3LSI A;  2IS4 A;  1BIA A;  5DYM A;  3K9T A;  5EEA A;  2N8G A;  1OMI A;  4I01 A;  1P92 A;  2YX7 A;  3CUQ B;  3R6S A;  3ZMD A;  1KU2 A;  2ZSH B;  1BW5 A;  4RAF A;  3EQL F;  3P9K A;  4QSH A;  5L3D A;  4XKC A;  4ABZ A;  3D5L A;  1QHH D;  4ZC3 A;  3RKQ A;  1I3Q J;  3WU1 B;  1YO5 C;  3JRA A;  2EA4 A;  1GV2 A;  1Y39 A;  4XN0 A;  5F04 A;  4XRM A;  4C2U A;  4QTR A;  5FLM J;  2E36 A;  1Q1H A;  2UV1 A;  2ZXW H;  5JLX A;  1FOY A;  1Z6T A;  4M6V A;  4BU2 A;  4H4K C;  4C30 A;  2DA1 A;  5D5V B;  2ZBK A;  2FXA A;  3IAS 2;  4HNT A;  2ZNY A;  3MEX A;  1R4N B;  3K4M A;  1WH5 A;  1LPQ A;  5D4R A;  2ZJQ F;  2ISZ A;  4C3I J;  2W48 A;  2DFH A;  2O3F A;  3R4K A;  5FKM A;  1OCT C;  4BL0 B;  2EZI A;  2CUJ A;  2J5O A;  1PP7 U;  2CS3 A;  2FRH A;  4MHG A;  2E34 A;  3E6M A;  1BL0 A;  4LD5 A;  4LB6 B;  4G7Z F;  1FMW A;  2A5Y B;  2E60 A;  3F8B A;  3OS1 A;  2XPW A;  2HDD A;  1FX7 A;  4DBQ A;  2DBB A;  2HTS A;  3ECO A;  2LFB A;  5HLH A;  5KCM A;  1QZZ A;  1HC8 A;  3H35 A;  4PSX A;  4KIB A;  3MWM A;  1Z1D A;  2Z3Y A;  3COA C;  1X1C A;  1D5Y A;  2CQ7 A;  3H0G J;  1X4P A;  1U3E M;  2H1L A;  2KDO A;  4KT6 A;  3V7C A;  2E1N A;  3C2H A;  5BPI A;  2X1E A;  2PEX A;  4MEY F;  2W7N A;  2KIS A;  4CUG A;  3OY9 A;  2L9R A;  5EYR A;  1I39 A;  1EH6 A;  3KZZ A;  4CSW A;  2V4J C;  2VIX A;  3T0Y A;  1RUO A;  1LDJ A;  3ERE D;  2VOP A;  4HQM A;  3AL0 B;  3I3L A;  4AID A;  5CVR A;  3FHN A;  2VJJ A;  1KU3 A;  3DCF A;  3GTP J;  2M3A A;  3O8G A;  3KE2 A;  1X19 A;  2QUF A;  3SEQ A;  2DJN A;  4OU0 A;  2CW7 A;  2VXD A;  4PJM A;  3IH4 A;  5JFR A;  2BY2 A;  4HPQ A;  4UUT A;  3CC2 I;  2PMH A;  2DTZ A;  3PNV A;  4HDV A;  1KU9 A;  4FIS A;  1T0F A;  3HTS B;  3HOU J;  4LFU A;  2BHZ A;  3K1P A;  2JTV A;  2DOE A;  2YX4 A;  2JN6 A;  3WTT C;  2R7Z J;  1XGN A;  2P5V A;  2K7L A;  1SFX A;  1S7A A;  2L9N A;  1W7P B;  2L3D A;  5E1X A;  3L2R A;  2HZD A;  2IGO A;  2H8W A;  2ME0 A;  3PSF A;  5ILV A;  5HVQ C;  1S6L A;  1XN7 A;  5H2F C;  1PUF A;  4GFB A;  3VFZ A;  3LQQ A;  1WHU A;  1WI9 A;  3TOB A;  3AL0 C;  3C2B A;  2MG4 A;  2HYF A;  2R7Q A;  3QPS A;  5GAD J;  1B59 A;  1FYL A;  4XLE A;  1X1B A;  5ICE A;  2HFH A;  2Y75 A;  1VQL I;  2OPT A;  2XPV A;  1MDM B;  5FKO A;  1SC7 A;  3ZQI A;  2UWM A;  2CWE A;  1Z91 A;  2ZFW A;  1WRJ A;  3FBN B;  4BQA A;  4Z6Y A;  2BZT A;  1I1G A;  1TW3 A;  5CJ9 A;  2GIV A;  4FCY A;  3OYL A;  4MLO A;  2H6B A;  3BCA A;  2QVO A;  2JK3 A;  5EZG A;  1O3Q A;  2M30 A;  1GV5 A;  4E7H A;  1O3R A;  2RN7 A;  5D4S A;  3CJN A;  1V5E A;  1WZ2 A;  3L9F A;  3KYL A;  2XAU A;  2M7A A;  1QVT A;  3BZK A;  3KCC A;  3GTG J;  4E7Z A;  1BJZ A;  1IN5 A;  2ZJR F;  4LGW A;  2QYO A;  3HGY A;  4A69 C;  4U0V A;  4CCL A;  1MMG A;  1UEL B;  3AG4 H;  5FLV A;  4KNY A;  4DYQ A;  4WF2 A;  4Q48 A;  3WTV C;  3BG5 A;  1XGM A;  3LNQ A;  1IXC A;  2ZME C;  3WGH A;  2DPD A;  2IS2 A;  2XB0 X;  2A6H F;  2IPQ X;  2JZY A;  3CJQ B;  4AM3 A;  3TED A;  2KL4 A;  1ETK A;  1PUE E;  3WTZ A;  3SYT A;  2ID3 A;  3CDH A;  2BEO A;  2ZJ2 A;  4MEX F;  2ESH A;  1KA8 A;  3TMO A;  2E1M C;  4JOM A;  3J7Y J;  2DN0 A;  1G4D A;  3VSL A;  3PIO F;  2JT1 A;  2RKH A;  4AU7 A;  4D0P A;  2JVG A;  1DPR A;  4RMN A;  2VON A;  3RKY A;  3VDX A;  4A0X A;  2K9S A;  3B6C A;  3QPH A;  4CYD A;  3GTM J;  2DA2 A;  1D1B A;  3ML6 A;  3IRQ A;  5DD4 A;  4BY7 J;  1ZG1 A;  4B44 A;  1VFC A;  2HVS A;  2ZJP F;  3B73 A;  2CU7 A;  3UNG C;  3JTG A;  3KYC B;  2UXX A;  2WA0 A;  3BP8 A;  4JYK A;  1F43 A;  1D1A A;  3GX4 X;  1JTX A;  2IGK A;  3F3X A;  2IP2 A;  1QU3 A;  5LHI A;  3KFW X;  2V26 A;  2HEO A;  3MN2 A;  2YR2 A;  4WX9 A;  1ETQ A;  3OYJ A;  3PUB A;  5L3G A;  3I4P A;  3I56 I;  1ITY A;  4I6Z A;  3RZD J;  1LEA A;  1IC8 A;  1FY7 A;  2CRG A;  2PQ8 A;  2Q0O A;  2VXZ A;  5FLX Z;  1H89 C;  3V8L A;  4XRS G;  2OZ6 A;  3GFM A;  1WWX A;  5M3M J;  3LSJ A;  5L3C A;  3S17 J;  3NAR A;  1ZRC A;  5L3B A;  1DPU A;  1XS9 A;  1XTA A;  4C9Y A;  1IN7 A;  3K4J A;  1T95 A;  2V6E A;  2P6S A;  2ISY A;  4D1Q A;  3VYR B;  1YW7 A;  1MBF A;  1ZAR A;  3WE2 A;  4WXC A;  1F9N A;  3TL4 X;  1T38 A;  5DM6 F;  4ZDO A;  2WY8 Q;  1P7J A;  4GXO A;  1MBE A;  5E3O A;  4CO8 A;  3CJT B;  2VT3 A;  2ZFU A;  3A02 A;  3PFY A;  3JRC A;  1HF0 A;  2HOE A;  3JCU C;  2F48 A; 
#chains in the Genus database with same CATH homology
 4A3E J;  1TWG J;  2CQX A;  1AKH B;  1ZTR A;  1FTZ A;  2EZH A;  4IHX A;  2MGQ A;  1BA5 A;  5J1Y A;  3BR0 A;  4C2M J;  1JGG A;  1GT0 C;  2K9N A;  5JLW A;  2EZK A;  1IV6 A;  4M3G A;  2KT0 A;  1H8A C;  1IRZ A;  2DA5 A;  1OCP A;  1FIP A;  3ZQL A;  1P7I A;  2YS9 A;  4EEF G;  1AU7 A;  5M5Y J;  1IDZ A;  4A3F J;  2CUE A;  2M9H A;  3S1Q J;  2LY9 A;  2Y30 A;  2DA3 A;  4B1R A;  1XG1 A;  1MBK A;  4V2G A;  5IOZ A;  1APL C;  2O8K A;  5EDN A;  5EG0 A;  2HOS A;  1ZR4 A;  3MKL A;  3PO2 J;  2Y31 A;  1X2M A;  5E3N A;  3ZQC A;  1HDD C;  3JRH A;  3Q0W A;  2FQ4 A;  3BR3 A;  1LE8 A;  3BT9 A;  1K61 A;  4A3I J;  4NDL A;  3NAU A;  4IHW A;  2PMZ N;  2NVX J;  3TP0 A;  2YU9 J;  3GTQ J;  3TW7 A;  1MBG A;  2GLO A;  2HQ5 A;  1SAN A;  2WV1 A;  2DA6 A;  3OIO A;  5EG0 B;  3GTL J;  1GVD A;  3LSP A;  3D1N I;  1MBH A;  5J1R A;  2VPR A;  4A3D J;  3QPL A;  5F0H A;  5F0C A;  4W1U A;  5M5W J;  1T33 A;  2NVQ J;  2QCO A;  4XRS A;  1LE8 B;  1NK2 P;  1FEX A;  3IV5 A;  5J1U A;  1WPK A;  2ID6 A;  4A3J J;  4JX4 A;  1W0U A;  2XSD C;  1IG7 A;  4D7M A;  5GPC A;  2HOT A;  1RET A;  1FIA A;  2EQR A;  1VI0 A;  2R5Y B;  1ZKG A;  1MSF C;  4DYC A;  5FKN A;  4S0H B;  1WGX A;  3GBG A;  1IJW C;  2E19 A;  1JKR C;  2NVT J;  1MH3 A;  2ELK A;  3RZO J;  3K7A J;  2L0K A;  3GTJ J;  4BBR J;  1MSE C;  1POG A;  4MO7 A;  5DTD A;  2M2E A;  5FJ8 J;  1ZQ3 P;  3I4M J;  4BBS J;  5FKL A;  2R5Z B;  2COB A;  3BTJ A;  2R0Q C;  2NS8 A;  2TCT A;  3G1L A;  5K7H A;  2H1K A;  5IYD J;  5EZH A;  3Q0V A;  3SFI A;  3BQZ A;  3HOY J;  1MBJ A;  2EBI A;  1TWA J;  4UUS B;  1AKH A;  5BNG A;  2LVS A;  2JA7 J;  3TP3 A;  1CQT A;  1RES A;  5GPA A;  1QVU A;  2CQQ A;  1X2N A;  4B3A A;  3QQA A;  1ORK A;  3S2D J;  2HOA A;  3BQY A;  1RKW A;  5K7F A;  2FJ1 A;  4M3F A;  3CMY A;  3A03 A;  3VPR A;  2GM4 A;  4IHV A;  4BXX J;  1K83 J;  3BR2 A;  2LP0 A;  5E3M A;  1U9O A;  2NOG A;  2XPU A;  3FKI J;  4AYB N;  5HOD A;  5C44 J;  3OSG A;  3PO3 J;  1RPW A;  4FTH A;  2RAE A;  1NK3 P;  3CCY A;  3HBL A;  2LLK A;  3PM1 A;  3S2H J;  3WHB A;  3RQI A;  1U8B A;  3TW6 A;  2NVY J;  2EH3 A;  1ZR2 A;  2YUS A;  2JA6 J;  3M3Y J;  1E3O C;  1EF4 A;  5IP6 A;  3OSF A;  1A6I A;  3JR9 A;  3HB9 A;  2AO9 A;  4DZJ A;  1I50 J;  1WI3 A;  3S16 J;  3BTI A;  1B8I B;  1MH4 A;  1IDY A;  3Q3S A;  1UHS A;  3H3V K;  2Y9Y A;  2GBY A;  1S7E A;  3BG9 A;  4IEJ A;  2VKE A;  2DMT A;  1AHD P;  2XRL A;  4D7N A;  3BR5 A;  2LD5 A;  4C3H J;  5K7Z A;  1TWC J;  1Z77 A;  4M3B A;  1ENH A;  2Y2Z A;  4A3L J;  3JRE A;  4A93 J;  4L5E A;  1ETY A;  2NS7 A;  2X48 A;  5EEA A;  3JRB A;  1QPI A;  2N8G A;  2MSY A;  1H88 C;  3W6V A;  1YRN A;  1BW5 A;  2L7F P;  5J3L A;  3B6A A;  5F1J A;  2R5Y A;  4M3E A;  3FK7 A;  3LSR A;  4QSH A;  1WCM J;  4ABZ A;  1PUF B;  1T56 A;  2LR8 A;  3RKQ A;  1I3Q J;  3JRA A;  2WAQ N;  4CYC B;  1GV2 A;  5F04 A;  4XRM A;  4QTR A;  5FLM J;  3HKZ N;  2E2H J;  1UMQ A;  2EZL A;  2QF7 A;  3LSG A;  5JLX A;  2VI6 A;  4M6V A;  3SDG A;  2DA1 A;  2M8G X;  4XIC A;  4BKX A;  2R5Z A;  1WH5 A;  3OOU A;  1OJL A;  1SFO J;  1YRN B;  4C3I J;  2W48 A;  1OCT C;  5FKM A;  2JMW A;  1VF9 A;  2EZI A;  1TWF J;  1ETX A;  4M3D A;  4UUS A;  2JJ7 A;  1HLV A;  1U78 A;  1BL0 A;  4LOC A;  1X58 A;  2TRT A;  1TWH J;  3GTK J;  2L7M P;  2XPW A;  2DMP A;  5FKK A;  3WHC A;  2HDD A;  3JRG A;  2HXO A;  2LFB A;  1JT0 A;  2LK2 A;  1TC3 C;  2P81 A;  2DMU A;  2HXI A;  1DU0 A;  1D5Y A;  3H0G J;  4FE4 A;  1JJ6 C;  5F0F A;  2AHQ A;  2H8R A;  2R92 J;  2X6O A;  4A3G J;  3ZQH A;  2HYJ A;  2L9R A;  5EYR A;  2ZB9 A;  5C4J J;  1WH7 A;  5DS9 A;  1B72 A;  3ZQG A;  3JRF A;  2D5V A;  1W0T A;  1GDT A;  1Y1V J;  1LFU P;  1XC5 A;  3DCF A;  1IGN A;  3GTP J;  3O8G A;  2ECB A;  1RKT A;  4JX6 A;  2ME6 A;  3ZQF A;  3O8H A;  5EGO A;  4B4C A;  1A5J A;  1B8I A;  2VKV A;  2DJN A;  2MW8 A;  3HGG A;  2B63 J;  1QRY A;  3IH4 A;  4UUT A;  4MFE A;  2G0E A;  2DTZ A;  1JJ8 C;  3UKG A;  4FIS A;  3HOU J;  4A3B J;  3G1O A;  1B72 B;  3G1M A;  1JKQ C;  3HOX J;  2JN6 A;  4RBO A;  2R7Z J;  2FX0 A;  4JP0 A;  2E2I J;  5EF6 A;  2CUF A;  3FIW A;  2IBD A;  2M0C A;  4W97 A;  4A3K J;  2CJJ A;  5EGO B;  2ME0 A;  3BG3 A;  3JRD A;  5IYB J;  3IH3 A;  1PUF A;  1U9N A;  2DA4 A;  1FJL A;  4GFB A;  2JA8 J;  4CYC A;  3C2B A;  2MG4 A;  4MFD A;  3L1P A;  3QPS A;  3S1R J;  4DYR A;  2WB1 N;  1Q1V A;  2FD5 A;  2JA5 J;  4AUX A;  2OPT A;  3SJM A;  2XPV A;  1JUP A;  5FKO A;  3E7L A;  1ETV A;  3ZQI A;  5C3E J;  2XB5 A;  2X9D A;  1DU6 A;  1FTT A;  5IPA A;  2L7Z A;  4FCY A;  1HCR A;  3HDD A;  4MLO A;  2LKX A;  1UG2 A;  3K2A A;  3BR6 A;  3GTO J;  2JK3 A;  5EZG A;  1GV5 A;  1JT6 A;  3FIS A;  1HOM A;  2XGC A;  4XID A;  3MVP A;  2OF7 A;  1NTC A;  9ANT A;  3BTL A;  3GTG J;  1QVT A;  2E2J J;  1BJZ A;  4X6A J;  3HGY A;  5GP9 A;  4A69 C;  1F36 A;  1G2H A;  1JTY A;  4G12 A;  4D5C A;  5F08 A;  4J19 A;  3S1M J;  4XK4 A;  5FLV A;  1ETW A;  1RR7 A;  1ZK8 A;  4DYQ A;  3LNQ A;  3BG5 A;  1MNM C;  3IH2 A;  2XB0 X;  4Y7N J;  3Q0U A;  1BW6 A;  3DEW A;  4D5F A;  2E1O A;  2DA7 A;  3TED A;  1ETK A;  3ZOB A;  1HDP A;  1VND A;  2ID3 A;  2JWT A;  5M5X J;  4DW6 A;  1IUF A;  4DZP A;  2R93 J;  3JRI A;  2DN0 A;  1JKO C;  4HNV A;  4AC0 A;  1ZGW A;  3S1N J;  2K9Q A;  3S14 J;  1OFC X;  2KDZ A;  4JX5 A;  2O7O A;  2K9S A;  2M34 A;  3B6C A;  3GTM J;  2DA2 A;  1VFC A;  4BY7 J;  1Y1W J;  3BR1 A;  2XGD A;  2CU7 A;  2I10 A;  2K40 A;  3HEF A;  4I76 A;  2IAI A;  1LFB A;  4Y52 J;  1F43 A;  4JYK A;  3F0C A;  3HOZ J;  2Y9Z A;  1JUS A;  5E3L A;  3S15 J;  1JTX A;  3HOV J;  2HI3 A;  2IEK A;  3MN2 A;  3M4O J;  1JKP C;  3CQZ J;  5C4X J;  1ETQ A;  3A01 A;  1O4X A;  2Y0S N;  1ITY A;  5IOY A;  5IP9 J;  4MIM A;  5M3F J;  4I6Z A;  3RZD J;  3HOW J;  4C3J J;  1IC8 A;  2CRG A;  1H89 C;  1GUU A;  4X1E A;  1R9T J;  2O9L A;  4XRS G;  5M3M J;  4A3M J;  3S17 J;  3LSJ A;  2XGE A;  3I4N J;  2DMN A;  3CDL A;  3HM5 A;  3NAR A;  4V2F A;  5IP7 J;  3BTC A;  4BY1 J;  1XS9 A;  2ECC A;  1JUM A;  2LTP A;  2VUM J;  1MBF A;  3LOC A;  1ETO A;  4IHY A;  5IYC J;  1I6H J;  1Z0X A;  4A3C J;  1P7J A;  1MBE A;  5E3O A;  5F27 A;  3A01 B;  3A02 A;  4RDU A;  4QIW N;  3JRC A;  4FE7 A;  3FK6 A;  1HF0 A;  2DMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...