1QRYA

Homeobox protein vnd (ventral nervous system defective protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
GSHMSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLTSLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PROTEIN (HOMEOBOX VENTRAL NERVOUS SYSTEM DEFECTIVE PROTEIN)
publication title Distortion of the three-dimensional structure of the vnd/NK-2 homeodomain bound to DNA induced by an embryonically lethal A35T point mutation.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 11
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qryA00
4FCYA 5IP6A 1FEXA 2PMZN 1K83J 2W48A 3TW6A 2FQ4A 5F0HA 1BA5A 4JP0A 2DA2A 2NOGA 1ETWA 3JRGA 5FKOA 1IUFA 1MBKA 5GP9A 3BR6A 3BG5A 2DMQA 5FKKA 5C44J 3JRDA 2LKXA 1WH7A 2R5YB 5E3LA 5EG0A 1G2HA 2R7ZJ 4RDUA 4CYCA 2WB1N 1S7EA 3HGGA 1JUMA 4D7MA 1DU6A 1IC8A 2YUSA 4FTHA 1RETA 3H0GJ 2CUEA 3JREA 2DMNA 1LE8B 2N8GA 2LP0A 2XGCA 2EZKA 1WGXA 3PM1A 1X2MA 4XRSA 1IDZA 1ETYA 5C3EJ 4QIWN 5IYCJ 2JA8J 3JRHA 1JT6A 1PUFB 4BBRJ 2G0EA 1B72B 4DZPA 1ORKA 1WCMJ 3CMYA 1HDPA 1TWCJ 4HNVA 1BW5A 3FIWA 2E2IJ 3MVPA 3I4NJ 1H89C 3BQZA 2LY9A 2L7ZA 5IYBJ 3ZOBA 3LSRA 2JMWA 2Y2ZA 4DW6A 5C4JJ 1TWHJ 4D7NA 2VKVA 5J1YA 4IHVA 4XIDA 1QRYA 5C4XJ 1MBHA 2M2EA 4A3DJ 1Y1WJ 4BY1J 1HLVA 4M3BA 2OPTA 5GPCA 3JRFA 2JA5J 4W1UA 2WV1A 2JN6A 3ZQCA 2KT0A 3ZQGA 3HKZN 3LSPA 5JLWA 1GV2A 1A5JA 3RQIA 2X48A 4V2GA 4I76A 3CQZJ 2HDDA 2VKEA 2Y31A 4BKXA 2XPWA 2XPVA 2E2JJ 3HOZJ 3PO2J 2LK2A 2NVQJ 5EZGA 2LFBA 2CRGA 2VPRA 2NVXJ 2YU9J 3HOWJ 1U78A 2FJ1A 3QPLA 2GM4A 1TWGJ 4FE4A 3JRIA 2DTZA 1ZR2A 1GDTA 2COBA 3BR1A 1BL0A 1IV6A 1JTXA 5F27A 2OF7A 1Z0XA 3FKIJ 1VFCA 3RKQA 1NK3P 5M3MJ 4IHXA 3K2AA 3D1NI 5F08A 2AO9A 3UKGA 1NK2P 2ZB9A 3Q3SA 5J1RA 2Y9ZA 1MSFC 1GT0C 2MG4A 3S17J 3DEWA 4BY7J 2TCTA 3M3YJ 5EZHA 2IBDA 3OIOA 3IH3A 5F0FA 5EGOB 1MNMC 3CCYA 4S0HB 1LFUP 2HOTA 1ZKGA 1Z77A 5F1JA 4EEFG 1MH3A 4Y7NJ 3HM5A 3GTJJ 3FK7A 2CUFA 2FX0A 1ZK8A 2DMPA 4XICA 3BG3A 1TC3C 3FK6A 2ECBA 2CQXA 3B6AA 2DA1A 2HI3A 1K61A 1P7JA 3BR2A 3SFIA 4MFEA 2CQQA 4IHYA 1HF0A 2DA7A 2QCOA 4AC0A 2YS9A 5EF6A 4A3EJ 3S1MJ 3W6VA 5EEAA 1U8BA 1XG1A 2WAQN 2M8GX 1WI3A 3BR3A 1BJZA 1MBEA 3BQYA 1ZR4A 3ZQIA 1JUSA 4M3FA 5FKNA 4C3JJ 2X6OA 3GTKJ 2KDZA 3BR0A 3S16J 4DYCA 2H8RA 1GVDA 2CJJA 4B1RA 1MH4A 5K7FA 2ME0A 2DA5A 4JX4A 4C3IJ 1JJ8C 5F0CA 1T56A 2L0KA 1DU0A 1ETOA 1RKWA 1YRNA 1FTTA 3LSGA 5EG0B 1X2NA 1ENHA 4CYCB 3GTQJ 2JA7J 4XRSG 1IGNA 1H88C 5JLXA 4UUSA 3S2HJ 3SDGA 1JTYA 1YRNB 1XC5A 3A03A 5IOYA 3I4MJ 1JKOC 3BG9A 5K7ZA 1ETVA 4DYQA 3ZQHA 1ETXA 3IH4A 3HOUJ 1IRZA 1UHSA 2DA3A 5K7HA 4A3KJ 1MBFA 2E19A 4Y52J 1U9NA 4I6ZA 1B8IA 1AKHA 2E2HJ 3PO3J 3M4OJ 2R0QC 5M5WJ 2XGDA 1F36A 3LSJA 2DJNA 3HGYA 3B6CA 1RR7A 1B8IB 2HXIA 3GTOJ 3L1PA 3GTLJ 2LR8A 3LOCA 2DN0A 3FISA 2HYJA 1WPKA 5GPAA 2X9DA 2K9QA 1VF9A 1JGGA 4AUXA 4MO7A 3IV5A 1D5YA 2HOSA 1VNDA 5E3NA 1RPWA 5J3LA 2H1KA 3RZDJ 3QQAA 2R93J 2Y30A 1QVTA 1H8AC 2VUMJ 3BTCA 5DTDA 1OCTC 4MIMA 2ME6A 1W0TA 2D5VA 4M3GA 2O8KA 3G1LA 2MGQA 1UG2A 2JK3A 2LVSA 2E1OA 2ID6A 3BTIA 2L7MP 4A69C 2QF7A 2XRLA 2LTPA 3HOVJ 3S1QJ 1I50J 3TW7A 2O7OA 5E3MA 1FJLA 2DMUA 2Y9YA 5FLVA 1HOMA 2XSDC 1BW6A 1GV5A 1GUUA 3HOXJ 4D5FA 3G1OA 3JRCA 3S1RJ 5IP9J 2R5ZA 2B63J 2ID3A 4MFDA 4A3LJ 2M9HA 3NARA 2CU7A 2P81A 4QSHA 2I10A 5IP7J 3OSFA 2L9RA 2XB5A 2DA6A 2M0CA 4J19A 1O4XA 3ZQFA 3GTMJ 1FTZA 4M3DA 4BBSJ 3LNQA 1I3QJ 3G1MA 3K7AJ 4C2MJ 4IEJA 4L5EA 4W97A 1HDDC 4A3FJ 2DA4A 1HCRA 1SANA 4C3HJ 1JKQC 2EH3A 2EZLA 2NS8A 1R9TJ 2HQ5A 3SJMA 3BT9A 3IH2A 4D5CA 4FISA 4X1EA 1RESA 1U9OA 2NVYJ 4ABZA 1ZGWA 2EZHA 2R92J 2R5YA 2L7FP 4QTRA 3O8HA 3QPSA 1AHDP 3BTJA 3F0CA 3TP0A 1JKPC 4FE7A 3O8GA 3Q0UA 1MBGA 1LE8A 1FIPA 1OCPA 1I6HJ 1UMQA 3BTLA 2M34A 5DS9A 3S14J 2EQRA 3OOUA 1JJ6C 1PUFA 5FJ8J 1B72A 3S15J 1ITYA 3JR9A 5M3FJ 2IEKA 4UUSB 2K9NA 1Q1VA 2K40A 5EYRA 2LD5A 3DCFA 3HEFA 1CQTA 5FKLA 1TWAJ 2NVTJ 1F43A 4MLOA 1FIAA 2HOAA 5IPAA 4A93J 2NS7A 5EDNA 4A3JJ 2ECCA 3HBLA 5IYDJ 2TRTA 4AYBN 3S1NJ 2EBIA 2FD5A 1E3OC 1QPIA 1OFCX 1ETKA 5J1UA 3BR5A 3WHBA 3Q0VA 4A3BJ 3E7LA 4XK4A 4IHWA 1OJLA 2EZIA 3GTGJ 1A6IA 2GBYA 4A3GJ 3HB9A 1APLC 1AKHB 2IAIA 4A3IJ 4B4CA 3VPRA 4BXXJ 1IDYA 1EF4A 4JX6A 1IJWC 3H3VK 4A3MJ 4RBOA 4JYKA 3JRAA 3CDLA 1IG7A 3HDDA 4GFBA 4B3AA 3C2BA 2LLKA 3JRBA 2O9LA 3MN2A 1TWFJ 3NAUA 2XGEA 5FKMA 3Q0WA 1ZQ3P 1SFOJ 4G12A 4M6VA 2XPUA 5M5YJ 3S2DJ 1JKRC 4A3CJ 1T33A 1Y1VJ 4M3EA 2ELKA 4XRMA 1X58A 3A02A 2JA6J 1JUPA 3OSGA 5E3OA 1MBJA 4X6AJ 4DZJA 3HOYJ 9ANTA 2VI6A 2DMTA 3TP3A 5F04A 1LFBA 5EGOA 5FLMJ 3GTPJ 4LOCA 2GLOA 2XB0X 1ETQA 3ZQLA 2Y0SN 4NDLA 3A01A 3WHCA 2K9SA 2MW8A 5HODA 2R5ZB 4V2FA 3RZOJ 1P7IA 2HXOA 1XS9A 3MKLA 2JJ7A 4JX5A 1WH5A 1RKTA 3A01B 1AU7A 3TEDA 2MSYA 1NTCA 2RAEA 5IOZA 1W0UA 5BNGA 2JWTA 1QVUA 5M5XJ 1MSEC 1VI0A 1POGA 3GBGA 2AHQA 4DYRA 4UUTA 1JT0A 1ZTRA
chains in the Genus database with same CATH superfamily
2EFQA 1ZRDA 1USSA 3GXOA 3TW6A 5B66C 2Q2EA 4CUGA 2F48A 4OAYA 2JSPA 3OIPA 4FHTA 2P7VB 3H3UA 3TDUC 1DDNA 1ETWA 4EGZA 3ZN1A 3LSHA 2A05A 2KPMA 2DMQA 4YFNF 2ZMEC 5FKKA 3E6DA 5C44J 5D5UB 3FMRA 5EG0A 1S5LC 4RDUA 2E60A 1E2XA 4OAZA 4E7IA 2FE3A 4WWCA 1DU6A 4FTHA 1YW7A 3H0GJ 3WTSC 2DMNA 1HC8A 3HHHA 2LP0A 3MWMA 4F3QA 1X2MA 4A0YA 5FLXZ 1D3YA 1Z3XA 1IDZA 3TDZC 3D5SC 1ETYA 4ASNA 2VBYA 2X6WA 1YG2A 3K70C 1SAXA 1WCMJ 1QZEA 3CMYA 4HNVA 4DJAA 2RVCA 3QAHA 2E2IJ 1U5TC 1H89C 2RV8A 1WKMA 2L7ZA 3ZOBA 1D0YA 4HZFA 2BV6A 4PJJA 1YFHA 4K2EA 2ZSIB 4IHVA 4IRGA 2E1MC 1Y0UA 1NG7A 2OPTA 2EFPA 1D1CA 2E34A 5GPCA 5DUIA 4W1UA 4U87A 2JN6A 4ITVA 4L5JA 4P96A 3OYLA 3ZQCA 2KT0A 2L2OA 3FMSA 1CF7A 2VPLA 3HTSB 2WAQA 5CQGA 2FU4A 3TMOA 1MD0A 4NC6A 2X48A 5H20A 2OQGA 1YX3A 2HU9A 3E6MA 2HDDA 5HDNA 1IV8A 4RM2A 1V5EA 2Y31A 4ZDLA 4CZZA 2UWMA 2E2JJ 4HRIA 2LK2A 1XMAA 4CCLA 3WU2C 3OYJA 3PFIA 5GADJ 1V5FA 3WE2A 2NVXJ 4RB2C 2BXZA 2FJ1A 3KP6A 2GM4A 1TWGJ 3FDYA 3JRIA 2DTZA 4GRIA 5E20A 1BL0A 1W5CC 3N4MA 3FKIJ 3JCUC 1O57A 1P9QC 3RSNA 3HL2A 1NK3P 3DKXA 4NQWA 4EJOA 2VJIA 2ZBKA 3QP6A 3BROA 1YW8A 2DT7B 3MKYB 2QGUA 3UKGA 1JE8A 1SMYF 2VT3A 2F5CA 4NBQA 5J1RA 2ZXHA 1X4PA 1WHUA 3EETA 1X3ZB 4UV8A 5FO5A 2ZXJA 5B1BH 1TNTA 3CO7C 1Y6IA 3IH3A 3HOTA 3DTKA 5F0FA 5E8GA 5EGOB 2JPCA 2QEXI 4FETA 5KNLA 2VLAA 2A5WA 3IRQA 5DD4A 2DTRA 3PQJA 1ZGAA 3CCMI 2CW7A 3FXMA 4EEFG 1K78B 3GFIA 3CMEI 1XSDA 4P9UA 3FK7A 3CUQB 2IJLA 2CUFA 3PFYA 1VZ0A 2BVMA 2BBYA 4EVIA 3L9FA 3BG3A 2O6GE 4CYDA 3FK6A 4FQGA 3OYGA 2CQXA 2M4KA 3WG7H 1XMKA 3ZQQA 2JT1A 1MIJA 1O3RA 2QYOA 2DDBA 1P7JA 3BR2A 4BHBA 4B48A 3ZRGA 4E7LA 1HF0A 2L5QA 1K6OA 5D5VB 2A6EF 2DCEA 1U8BA 1XG1A 4XKVA 4XR6A 3KETA 1FOXA 1TW3A 4BEHA 3DBHB 2JUCA 5LRRA 1BJZA 1MBEA 3CDHA 1F4KA 2Q2EB 1Z7LA 4PSXA 1FY7A 3ZQIA 5ED4A 4PK4A 2ELJA 1Y8QB 5FKNA 3GTKJ 3LAJA 3CMMA 4F91B 1KQ9A 3FMQA 4DYCA 2Q1ZB 1ZGJA 1GVDA 1UAAA 3H36A 1LB2A 4L9JA 1O3QA 1PDNC 1DU0A 1JJ8C 2JQ7A 1T56A 3GEZA 4B44A 2JUGA 1RKWA 3FXRA 4E7HA 1YRNA 5EG0B 2HQNA 2JA7J 2F2EA 4XRSG 1GHCA 1YQAA 2VL8A 2ADUA 5ILSA 3OYDA 3CDIA 3QU6A 2MH2A 1W7PD 4UVCA 3CUOA 3CP8A 2BGCA 1V55H 5KHDA 1TQIA 3Q9VA 3OYMA 2GOXB 5F64A 2A6HF 3W6JB 2HEOA 2CQNA 4JOMA 3E1SA 4AVZA 2VXDA 5GTIC 3HRMA 1UB9A 2F5FA 2OBPA 3ISPA 3F6VA 3ZQ7A 4DYQA 3S3OA 4HSTA 2OTJI 2CW0F 1ETXA 3IH4A 1G3SA 5K7HA 2DQLA 1OCOH 2K86A 4BDYA 2RQQA 2XV4S 1ZRCA 2EB7A 2BOLA 1TP4A 3DPTA 2DT6A 2GXAA 2XDVA 4EJWA 2KZVA 2VE8A 1WWXA 3AG4H 4JBAA 1IXCA 2FSWA 1S8NA 1XGNA 3MD2A 5D8LB 1RRJA 2QQBA 3DBRB 3HGYA 3M8FA 1W1WE 2MABA 3QOEA 5EEGA 1CF7B 5HNHA 3L2UA 2LG4A 3L1PA 3FISA 1WPKA 2HYJA 1IN6A 1I6XA 2R7XA 1XB4A 1D5YA 5IT9K 5H6QA 4LIVA 2EV5A 4MTEA 3VOEA 3E5QA 1AOYA 1R49A 3MZ8A 5FD6A 1YOVB 2VASA 3K6GA 2JVHA 2FA5A 2Y30A 1GXPA 2V9PA 3KP7A 5H2FC 1W4MA 1RIOH 5DTDA 2JA2A 4OOIA 1LFPA 2ME6A 2JVGA 4RLQA 4PGGA 3HJEA 4M3GA 4MGRA 1I39A 3W3CA 2X85A 3IAS2 5GAHJ 1J59A 1R58A 3MFKA 1ZG3A 3G71I 1I3AA 3TO6A 2E1OA 3ZN0A 3PQKA 1ACIA 1BOAA 2QF7A 4NQWB 1TZLA 1EH6A 2K7LA 1IW7F 5LGTA 3TQNA 1UHWA 3ZP5A 4M9ZA 4KICA 2LMDA 1R23A 3R61A 3JRCA 4XLPF 1VQ5I 2HPIA 4MFDA 4E7JA 3E3VA 1PYVA 2ZC2A 2CU7A 1X4OA 4RAZA 4D9JA 1LDJA 2AXTC 1Z91A 3JTHA 5LD2C 2L9RA 4LB5A 3J80Z 1T95A 2F5DA 3HPGA 2M0CA 2XSJC 1JI8A 3GLLA 1RNLA 2QVOA 5FFZA 4BBSJ 3LNQA 5KAIC 3QU3A 4PJLA 4PCQA 4C2MJ 1HDDC 1J5YA 2M1BA 1WVRA 2K9MA 5HS7A 3P9CA 1VQLI 3WGIA 3A1YA 4PJ0C 2QUFA 1OYYA 2HQ5A 4IHSA 3IH2A 2R7WA 4D5CA 2E1NA 2V79A 4BE1A 2M30A 3VYTB 2NVYJ 3FX3A 4BEHB 2EZHA 1I1GA 2KIUA 2L7FP 4IX7A 3BJ6A 2DOEA 3D5RC 1BBYA 1JKPC 2XAGA 3VYSB 3F8NA 4WX9A 1I27A 3HSFA 2IA0A 5E18F 1HW2A 2DK5A 1BR4A 4MEYF 1UMQA 3DBLB 4RGRA 4AWXB 3BTLA 4YG2F 1HXDA 1OMIA 4Y15A 5DS9A 1T39A 1D8KA 3O6BB 3M9AA 2OD5A 2I5UA 3S15J 1GLNA 2PI0A 4XLEA 3GCMA 1FSHA 2M4GA 3FXJA 1IRXA 4L18B 3EUHA 2P5LC 2R7QA 1CQTA 1W7PA 3K1NA 4MHGA 4S05A 2NVTJ 3KPHA 4LIUA 4RA2A 1FIAA 1QBJA 2HOAA 4P55A 1FOKA 1LUJB 3VYUB 3MKWB 2NS7A 4HF2A 1B9NA 2ZJRF 3CUQC 3BJOA 4ZDOA 1BIBA 1O3TA 3CCJI 2TRTA 2DK8A 4YFXF 5CYVA 5IYDJ 2WC2A 2EBIA 3OL4A 3E6CC 1QPIA 4KUMA 5E1ZB 3BR5A 2M8EA 3Q0VA 3N97A 1ZG1A 1OJLA 1MNEA 2EZIA 2IS4A 3HB9A 3S2WA 4X0GA 3FM5A 3AG3H 4CICA 2IAIA 4B4CA 5TJJA 4EM0B 4RAYA 1IDYA 1EF4A 1MZBA 4JX6A 1IJWC 1R22A 4AIJA 3UR3C 2BVLA 4B8XA 3JRAA 2B7EA 3CDLA 3OR2C 3C7JA 3CC7I 2RREA 2F4MB 4B3AA 4Z2YA 3S3MA 3MN2A 3CMAI 3SZPA 2XGEA 1ZAOA 2ISYA 3KP2A 1SFOJ 1X1AA 4G12A 3W2VA 1K4SA 2H94A 5FRMA 1S3JA 2ELHA 2KRCA 4QWQA 2WADA 3CD6I 1XCVA 2H6CA 4XSZF 2V6EA 5HS8A 2XIGA 4XBFA 1T33A 1Y1VJ 2ELKA 4XRMA 3WTYC 3M8JA 3RPQA 5TRDA 2ZNZA 2QKLB 3H3ZA 5E3OA 2CS3A 3V8LA 1MBJA 4HX4A 2KHMA 4BAYA 2FNPA 4X6AJ 2HGCA 1YJ9I 1ODDA 2CWEA 2A61A 1YS7A 3DKYA 3RCOA 3G73A 3TOAA 9ANTA 2IA2A 5ICEA 2OU2A 4KIGA 2W85A 3TP3A 5F04A 2H1LA 2CH0A 1LFBA 3F21A 2Y48A 2HNHA 3SZTA 2GLOA 1SD5A 3REOA 2LSOA 2M45A 4LK1F 2K3PA 1MJBA 1LDKB 2VQGA 3WHCA 3LQQA 1P7IA 4UUVA 2HXOA 1QGPA 1TNSA 4KISA 4OIPF 4JX5A 5HLIA 2IGNA 2PLYA 3GFMA 2VQCA 2BY3A 1T98A 3F8CA 2QQ9A 4HYEA 2RAEA 1PJRA 3OS1A 1MDMB 1STZA 5IOZA 1AWCA 2J5OA 2DXIA 4XOTA 3ECOA 3C2HA 4G6DA 2K9LA 1FWZA 5LGNA 3KEYA 3GBGA 1X3WB 4UUTA 3I64A 1ZTRA 1RC9A 2FBIA 4M6XA 1V3FA 5IP6A 1FEXA 2PMZN 2HR3A 5F0HA 5FLXK 1BA5A 3AG2H 1IO2A 3K4NA 3KYDB 2DA2A 2NOGA 2IXSA 5FKOA 1CGPA 2VC1A 1KGSA 3BR6A 2KLOA 4XMYA 2VE9A 1VQ8I 2ZNYA 2WTEA 3JRDA 2LKXA 4KA4A 2GXGA 2M5WA 1G2HA 2E5ZA 2HWVA 2WB1N 4ZYEA 1D0XA 4PDKA 4DBQA 3LA7A 3RKYA 2QSGX 2YUSA 3K1MA 2CUEA 2N8GA 1N78A 3WODF 5FD5A 4J00A 2LKSA 1WGXA 1W36D 3HXLA 1R5ID 3LSMA 3FF5A 2G0EA 3T8RA 2JSCA 3RKXA 1TWCJ 1VQOI 1VQKI 2D2WA 3ZMVA 2EV0A 2LY9A 4LLGF 3HHGA 4B09A 4DOZA 1X1BA 4FASD 4YIFA 3LSRA 2L01A 5HOOA 2LYCA 2V7FA 3K4MA 2FOWA 5C4JJ 1W7PB 4NNJA 5FB2A 2VKVA 1OQYA 5J1YA 4S04A 3LFUA 5HS9A 3JAMK 4XL9A 4BY1J 3OYBA 3EUAA 1T2KA 3LA3A 1REPC 4QLCU 1RI7A 2UV1A 1NHAA 3CCSI 1XMXA 5JLWA 1WJ5A 1LEBA 3FBNB 4M6YA 2KJBA 1FSEA 2VBZA 1ZH5A 2OAZA 3BWGA 3CQZJ 2VKEA 3FXLA 4LLLA 4FX4A 5HLGA 4JQFA 2ESHA 1FYKA 2STTA 5D4RA 2XAQA 2NVQJ 3J81Z 3BPXA 1D8JA 3HOWJ 5F1RA 5CVUA 1GDTA 5BPIA 3OYFA 1E0EA 3N05A 4GYIA 1IV6A 3CESA 5F27A 3IKTA 2E35A 4U7DA 1Z0XA 3EQLF 1QNTA 3LFKA 3RKQA 1W5SA 5FFXA 2XC7A 5D5WB 5JHUA 1QPMA 3D1NI 4XLNF 4RB1A 2R7OA 2O03A 2CYYA 3BJAA 3ZMZA 4I0BA 2AQFA 2HKXA 2ZB9A 2WY8Q 4ENMA 3OS2A 1X3UA 4U0WA 4XRFA 3S17J 4MQVA 4BUPA 4XKBA 3L2QA 2QBYA 3VEPA 3DEUA 3R4KA 3IRRA 2IBDA 1Z1DA 3OIOA 3FWEA 1E3PA 1MNDA 1SD6A 1UELB 5E1XA 5D4SA 4R79A 3CCYA 2OZUA 1LFUP 3TL4X 3I3LA 4Z6YA 1HKQA 1ZKGA 5ICFA 3CJTB 1F5TA 1Z05A 4LD5A 4C30A 1MH3A 2HS5A 4EM2A 1FMVA 1ZRFA 1B1BA 1XDUA 4EM1A 4XICA 1AA7A 3BZKA 4U88A 3F22A 4XM3A 4AD9A 2EIMH 1B4AA 2IGMA 4OWRB 1K61A 1V4RA 4G7ZF 3SFIA 4MFEA 1Y56A 3LSIA 1R00A 3F3XA 1S29A 3ASNH 2YS9A 2MD0A 1BN5A 3W6VA 2YU3A 2KRFA 1QZZA 3T0YA 3PIOF 3OY9A 2MLKA 2A3SA 3GWZA 2KL4A 3KYCB 1NH3A 2Y75A 1JUSA 1JHHA 3F72A 4CCKA 1IXRC 3BOQA 2X6OA 4C3JJ 1YJNI 2XKOA 4KNYA 2XF7A 2CJJA 1FLIA 1MH4A 3V42A 2H6BA 2YX4A 2KRHA 5F0CA 5JVTA 1T8IA 1ETOA 2BY1A 2ZFUA 2IS1A 2PN6A 1VQ7I 1IRFA 3JSOA 3CC2I 4XN3A 4HNTA 4CZCA 1H88C 2OCEA 1IGNA 1UJ8A 3RI4A 2KIQA 3SDGA 3GVAA 1JTYA 4HF0A 4CHUA 4PUSA 4F93B 5IOYA 2FXAA 3IUOA 2QWWA 1WI9A 1PP7U 3LL7A 1YLFA 2XAFA 4PFOA 2ZXWH 3HOUJ 2VKHA 2R7SA 1IRZA 1DGWY 4A3KJ 3IL2A 5A2QZ 1ZHFA 1VQ6I 1OISA 2ICWG 3TBIA 4Y52J 1U9NA 1HW5A 1TBXA 2QKMB 4BQAA 3OR1C 3I59B 1A35A 2ZKZA 2LRDA 2GXBA 3M4OJ 3JW4A 2R0QC 2V1DA 5B1AH 5L3FA 2R7RA 1F36A 4LGWA 5BOXA 2DO7A 5CLSA 4DIQA 2L9VA 4EATA 1DPRA 1RR7A 2OV7A 1B8IB 1G6NA 1Z7UA 2HXIA 2L54A 3CTAA 3EYYA 4WXCA 4C2TA 2LR8A 2HVRA 3LAPA 5DD8A 5GPAA 4E7KA 1T6SA 1X19A 2FEZA 3T1BA 1VF9A 1QQIA 4AUXA 3PUBA 3MCZA 2EA2A 1VNDA 4RS8A 5E3NA 1MGTA 3WU1B 2NNNA 2QLZA 2QENA 3QQAA 4XN0A 4GYGA 1OCTC 4MIMA 2VKDA 1HSJA 3U1KA 2OTLI 3BZCA 3ERMA 2LF7A 2V26A 2IT0A 1KU9A 1T0FC 3F8MA 1FPQA 4KMFA 3BCAA 1FYMA 4CO8A 2M3AA 2LVSA 3BDDA 2X6XA 3BTIA 2DODA 4A69C 2XRLA 4HX7A 2ZJPF 2IRFG 3DLAA 4WXDA 5TGTA 3GX4X 4RAFA 5CVRA 2XSDC 5DM7F 1QHHD 4Y13A 5EEHA 3HOXJ 5LHGA 5FGMA 4F7ZA 5IP9J 4BXUA 2QBYB 1IN8A 3T5XA 1MMGA 3NARA 2K3FA 3LA2A 3IWFA 4QSHA 5IP7J 1E17A 4LLNA 3OSFA 4M73A 6PAXA 1Q1HA 3OYNA 2FBKA 1UFMA 4DNCA 2HVQA 1O4XA 4LJZF 3ZQFA 2A07F 4M3DA 1K79A 3ASOH 2XHKA 3I0TA 2E36A 1I3QJ 3K7AJ 4HLYA 4IEJA 1P2FA 4W97A 2VOPA 2V1XA 1FBQA 4MNUA 2DA4A 4A0ZA 1L0OC 4C3HJ 3KP5A 2F4IA 2NS8A 4G7OF 4EJTA 4FISA 5KVRA 1EV7A 4ZZDA 4ABZA 3PL8A 2R5YA 1WQ2A 1KQ0A 4B43A 3J7ZI 3OYIA 4FE7A 1XCBA 3I4PA 1RR8C 1MBGA 3I54A 4XLCA 1LE8A 1OCPA 1I6HJ 2EIJH 2CV2A 3P7NA 2A6TA 4I0AA 4BDZA 2NRAC 4PZJA 3DP7A 2EQRA 3OOUA 1PUFA 1PP8F 3QYBA 1JXSA 1B72A 4A5NA 1BI1A 2FQ3A 5M3FJ 2X1DA 2K40A 3DU6A 5LBQA 2ZSHB 5DEQA 1WFXA 5EYRA 3FZVA 5KCMA 1A04A 4IOCF 3DCFA 3E5XA 2FBHA 1ZREA 3H35A 1VTNC 3QWLA 4AM3A 2HKOA 1NG6A 2DJIA 4ESFA 4EGYA 4ZDPA 2NNYA 1WJDA 4QPOA 5EDNA 3KP4A 4E6KG 2A69F 2KP6A 1P4WA 3WGHA 2JRTA 3WHBA 1JGSA 4XK4A 3ZCOA 4IHWA 2ZJQF 4EMSA 4HQMA 4E7ZA 4BXXJ 2PMZA 3C18A 2AXLA 2MH9A 3VFZA 1SAUA 2VBWA 4GXOA 4A3MJ 3M1CA 2Q0OA 1YHQI 2BY0A 2LC2A 3FXUA 3EPZA 1IG7A 1RUNA 3C2BA 2LLKA 3JRBA 3NAUA 1TWFJ 2BE5F 3RTRA 1HKSA 2XRNA 3CJRB 1ZQ3P 2P5KA 1TW2A 1Y0NA 2H09A 5JHFA 3HYIA 2VXZA 2F6CA 2WB1A 2Y0MA 4BQOA 2VJ4A 4HPQA 4DGWB 5ILUA 3WTUC 4NC7A 1YW9A 3ZMUA 3LSTA 4L9VA 2P6SA 1SEUA 2E5NA 3A02A 2ZMEA 3BG7A 4FX0A 5HDGA 3FHZA 3H5RA 1U0JA 2GIZA 3S8PA 2GQQA 2BHZA 2XAJA 1MMNA 4DZJA 2X6YA 3HOYJ 4IQJA 3K2ZA 3V8JA 4HV6A 1TL8A 2KMUA 1K7AA 1O7FA 3ZR8X 2W7NA 3AL0B 3C2GA 3G4SI 5FLMJ 2D1HA 4II2A 4O5VA 3KZZA 1YX5A 3ZQLA 3P9KA 4UV9A 2COMA 1H9GA 2K9SA 3RYPA 1MDMA 2KKOA 3I9V2 4ZTFA 3L2WA 2FNAA 1R4MB 1WH5A 2VQHA 1RKTA 3WGGA 5L3BA 3SEZA 3WTWC 3A01B 5FROA 1YITI 3G3ZA 2TDXA 3QODA 2CUJA 4HV5A 4BYYA 2JWTA 3KLNA 1XSXA 3X2QH 1MSEC 1ZYRF 1LEAA 2H27A 3L7WA 2AHQA 2DDAA 3K4LA 3KE2A 4FCYA 3CCQI 3TO7A 3PUFA 3BC8A 4JP0A 2DU9A 2DPUA 3K10A 2M0MA 4P9FA 3SEQA 4L5IA 2R7UA 5DCMB 1QA6A 5LRSA 3VWBA 1OYWA 3L2VA 2R5YB 2CV0A 4GCVA 3H0DA 3I71A 3DPUA 2VOOA 1V54H 4LFUA 4KFCA 5K5QA 4Q4ZF 1LE8B 4ON0A 1TLHB 2EZKA 3T8TA 1R6RA 2XF5A 3PM1A 4BH9A 4XRSA 5C3EJ 1YO5C 4QIWN 1LQ1A 3JRHA 1PUFB 4BBRJ 3L00A 1B72B 4DZPA 1ORKA 4ZTJA 1FT9A 1HDPA 1KA8A 1BW5A 2K27A 2RNGA 3CP2A 2XKPA 3FIWA 3MVPA 3BQZA 2HQRA 2DI3A 2Y2ZA 2DYSH 4DW6A 1TWHJ 1KYWA 1ZN2A 3CLQA 3WTZA 2CSOA 1QRYA 4XIDA 3CCRI 2EV6A 2OUMA 4Q48A 1MJ9A 4GO1A 4I7HA 1HLVA 4ZH4F 2JA5J 2WV1A 5AIPA 5E17F 2X1EA 3HKZN 2HDWA 1OLTA 2VN2A 1A5JA 4RAGA 1HQCA 3F6OA 1FBSA 2L02A 2GWRA 4V2GA 1DQUA 1O7LA 4BKXA 5CVIA 2WBMA 1S7OA 4D1QA 2XPWA 2XPVA 5E1WA 5CPRB 3PO2J 3HOZJ 1YS6A 3K1PA 3ULQB 2BW3B 2IPQX 3FXKA 3SZGA 4IOAF 4PJMA 4BS9A 1ERDA 2CRGA 3C3WA 3LWFA 2YU9J 1ONVA 2KDOA 4L0YB 2BY2A 4HAMA 2G9WA 4Q5SF 1OYIA 2KIMA 3I56I 4RGSA 3TKYA 1USTA 2XROA 3L2CA 1B9MA 1G3YA 3FHNA 4IL6C 1P6RA 1Y39A 2P7CB 3CCVI 3WTXC 3R0JA 4IHXA 2KZGA 3K2AA 1SMTA 2ZMEB 1IUYA 1OCZH 3IC7A 2EFNA 4YRVA 3FXQA 4XQFA 4EQQA 1NK2P 2EPFA 1LVKA 1GT0C 3D5LA 1ZARA 1S6LA 2DFIA 2LOOA 2BXYA 4BY7J 4PSWA 2IGOA 4ZYAA 5IT9Z 5EZHA 2UXXA 1IF1A 2J5PA 1MNMC 4JK1X 4S0HB 5JI6A 3C1DA 3MZHA 2K4BA 4RB0A 2HOTA 2IVMA 2KIFA 1L3LA 1Z77A 2AQEA 4AYBA 1Y8RB 5F1JA 2GOMA 4AIDA 2EILH 3IAM2 2NYXA 1ZK8A 2DMPA 2EFOA 4AIHA 4WF2A 5LFAA 5K1YA 2DA1A 3DXJF 2HI3A 3ROUA 3OYCA 4J01A 3EUKL 3U1DA 4CCOA 1ZELA 2MLGA 4IHYA 4I02A 4XKCA 5LLQA 2DA7A 2QCOA 3I5UA 4AC0A 2PFBA 3HOSA 3S1MJ 2HZDA 2M8GX 1ON1A 3FM3A 2GA1A 2OCCH 1XGSA 2QA4I 1T08B 1WSUA 1ZR4A 1LJ9A 2DFFA 1W5TA 4PFPA 5CVJA 3BR0A 4F55A 4RLFA 1X1DA 5K7FA 3IWZA 2ME0A 2DA5A 3MZYA 2L0KA 3OYHA 2VJ5A 1QO0D 1UZCA 3H1CA 4YELA 1ENHA 1J7KA 2CQ7A 3GTQJ 3PSFA 2WAFA 3HRUA 2HOEA 5JLXA 2W82A 4HLXA 4UUSA 1K4TA 2PMHA 4HF1A 3KZIC 3AL0C 3TGNA 4A12A 2HPMA 5K7ZA 5DYMA 2QSFX 4HG2A 2HYFA 4RGXA 1G3TA 1YTYA 3I59A 3CCLI 2K02A 5CKTA 1D1BA 1Z3YA 4P1WA 1UHSA 4IZZA 1HA8A 2XAHA 4HOBA 2I8DA 4E4HA 4OMYA 3KZYA 4XORA 1DUXC 2LBFA 3DV8A 3GYHX 4LMYA 4I6ZA 1B8IA 1AKHA 2E2HJ 1FP2A 3DKWA 3DPLC 2IP2A 3R6SA 2W00A 5M5WJ 5E79C 1ZLKA 3LSJA 2DJNA 4A2UA 1VQPI 4I98B 4MEXF 3B6CA 2O5RA 1FYLA 1WJCA 2WV0A 2DN0A 2NAZA 4CXFA 2X9DA 3A0HC 3R60A 1JGGA 3TO9A 1WZ2A 1J9IA 3V7CA 1EKEA 3I53A 4KDPA 4ETSA 5J6XA 4ANJA 2HOSA 3OWTA 2R4GA 5J3LA 3RZDJ 1G3WA 1H8AC 2VUMJ 4QPQA 2RGVA 5CQEA 4I99C 1QZYA 1J75A 2ZO4A 3HSEA 4I09A 2D5VA 5E8IA 1MW7A 1G59A 1ZG5A 1H9TA 2CG4A 3SYTA 4B47A 3G1LA 3SHFA 1OCCH 2MGQA 5EJCA 1UG2A 4CSWA 4NB5A 5DV5A 2B9SA 4UXNA 2L7MP 2V1NA 4BHCA 3HOVJ 5JVGF 3S1QJ 1I50J 3TW7A 1KYZA 3OIQA 2O7OA 5E3MA 4N9HA 1FOWA 1N25A 1HOMA 1XD7A 3G6EI 1S9HA 1GUUA 3AKZA 2HYGD 2B63J 1D1AA 3RJPA 4A3LJ 2P8TA 4P5OA 2M9HA 2P0WA 5HVQC 2OA4A 2P81A 3K4JA 3HRTA 1LDDA 3DWLE 2O3FA 3O3KA 3KYLA 3ERED 2W1OA 2FUG2 3NEUA 4IHTA 1R71A 1VQMI 2DA6A 2IW5A 4J19A 3KCCA 2PBIA 1X1CA 3GTMJ 2KFDA 1SVMA 1FTZA 2E1CA 2OJED 1I1SA 2QM3A 2XUBA 1SFEA 4CH7A 4A3FJ 4KT6A 1HCRA 4XLFA 1U2WA 4KITB 1JKQC 1G8XA 2EH3A 2EZLA 1R9TJ 1PVEA 1VQNI 2YSRA 3FKJA 2NVUB 2HDCA 3SJMA 1KONA 3P9IA 2XAUA 4X1EA 3W2AA 2PJPA 1EH7A 1RESA 2D45A 3F9KA 1N77A 1C0WA 4QTRA 3O8HA 1AHDP 4HSRA 3O8GA 3VSKA 4O3MA 2V6CA 2DT5A 1R5HA 1WJAA 4BE0A 1FIPA 4BJ5C 3J7AY 2G7HA 2HVSA 3Q5FA 1YJWI 2IGKA 1Z6TA 3S14J 5IT3A 2Z2SB 1JJ6C 3E0JB 4BQNA 4YIIA 2CV1A 4HX8A 2L9NA 4UUSB 1WRJA 3QRFF 4XLAA 2K4JA 1R4NB 3PSIA 2JZYA 3OL3A 3SFZA 3HEFA 1TT5B 2QZ8A 4PJNA 1ZLJA 2FMYA 5FKLA 1TWAJ 2ZFWA 5L3EA 4MLOA 1XN7A 5IPAA 1BOBA 4A93J 1FMWA 3BCBA 2CO5A 1DGRM 2ECCA 3CC4I 1R5GA 5HDKA 4AYBN 3CF5F 3S1NJ 1E3OC 2FD5A 1E3HA 2W25A 1OFCX 3ZGKA 5J1UA 2M87A 3E7LA 1OPCA 2HTJA 2LBFB 3GTGJ 3M8EA 3WG9A 2ETHA 1P4AA 1AKHB 5K5RA 3J7YJ 4RM3A 3VPRA 2R7DA 2ZCWA 3GFJA 5BMZA 3DF8A 5D6FA 3CCUI 4RBOA 3R0AA 4JYKA 2EK5A 2CW8A 3DQVC 1WJFA 2O9LA 4G94A 3MMYB 4Y17A 1J2XA 1BR2A 2L4AA 3ML6A 2LREA 4NC8A 4M6VA 1IRGA 2XPUA 5BPDA 3CJQB 4KIBA 3ZMDA 2NOJB 1JKRC 2VONA 5H6RA 2P4WA 4A3CJ 3ABLH 4M3EA 3JAMZ 3U2RA 3E97A 4BU2A 5J4YA 1BI3A 3K9TA 4UB6C 2OQRA 3J80K 2JA6J 1JUPA 3OSGA 2L3DA 2Z3YA 1EH8A 1XSVA 4HA8A 3W2WA 2XGXA 3K70D 5L3DA 1SD4A 4R1HA 2DFHA 4UB8C 3V8KA 1TT0A 5BS6A 1FNNA 3EUHC 2B0LA 2VBXA 1R1UA 3VYRB 1OCRH 2E71A 2LKPA 3GTPJ 4LOCA 3CCEI 3LSKA 2FMLA 2Y0SN 4UHTA 3RDIA 4NDLA 2O8XA 1FP1D 4G9YA 1BIAA 4KMUX 3A01A 5DCFA 5HODA 3HIFA 4V2FA 3CJNA 5IY5H 3HKZA 5D6EA 3ZMTA 1YIJI 5LHHA 1LVAA 3RZOJ 1VQ9I 2EJRA 1XS9A 1I5ZA 2ESNA 4Y4RA 5JFRA 5CJ9A 1NTCA 4F92B 3CZ6A 2WA0A 1W0UA 2L4MA 5DDGA 3MQ0A 4G6TB 5M5XJ 2JPBA 1H0MA 2DBBA 1POGA 4BNCA 3K4CA 5DCMA 4DYRA 2DFEA 5GAEJ 1KU7A 3HDDA 3BZ6A 4AU7A 1GVJA 1RZ4A 1J0RA 2W48A 1K83J 2FOKA 2FQ4A 3PJRA 4ZYDA 3JRGA 1IUFA 1MBKA 5GP9A 4LG0A 2RDPA 2BHYA 3BG5A 4IRHA 4YIRX 4XONA 4BE2A 4ZYHA 2RQPA 1XPXA 2X4HA 5GTHC 1WH7A 3BPVA 5E3LA 1G4DA 4II3A 2R7ZJ 2MA3A 4CYCA 2RNJA 1FZPB 4KYWA 1S7EA 3HGGA 3H92A 1JUMA 2VJJA 1IN7A 4D7MA 3ABMH 1IC8A 1SC7A 3VSLA 1RETA 2WWYA 4ENNA 2YX7A 3JREA 3M7GA 4L0ZB 2XGCA 3I58A 3S3NA 1HSTA 3WTTC 4L9NA 1YYVA 1TQPA 3B02A 5F6FA 4A6DA 4DQ2A 3G2BA 5IYCJ 2JA8J 1JT6A 2MC4A 2R3SA 4IKFA 3ABTA 2ZJ2A 1D0ZA 4M71A 3GO5A 3I4NJ 4WXHA 2F5VA 2X1CA 4GGGA 1U3EM 1RUOA 5IYBJ 1MMDA 3GF2A 4YFKF 2JMWA 2EINH 3UNGC 4AIKA 4D7NA 1R36A 2LF8A 3KP3A 3K69A 1KQ8A 4O6JA 5ICGA 3DFGA 1XGMA 1O3SA 4XSXF 5C4XJ 1MBHA 1N75A 2M2EA 2C6YA 2GA2A 4A3DJ 1F9NA 1MJAA 1DPUA 1IXSB 1UCRA 4EJVA 1Y1WJ 2Z16A 4M3BA 4TV7A 2VB6A 3QP5A 4HEA2 3JRFA 2LNBA 4YEJA 1Z9CA 3ZQGA 3LSPA 3HSRA 2CFOA 3H9QA 1GV2A 1SD7A 2BW3A 2LY2A 1OR7A 3RQIA 4OIQF 2DYRH 2JRMA 3ESWB 4I76A 4B3XA 4BGDA 5J47A 3E6BA 4OIOF 1V5GA 3V7SA 5EZGA 2LFBA 2W4SA 2VPRA 1UG0A 3VDXA 1U78A 3QPLA 4E70A 5KAFC 4FE4A 1ZR2A 4EV0A 3HZJA 2COBA 3BR1A 2WAEA 3U9GA 4KT5C 4ZJZA 3BLYA 3GLXA 3RKWA 1JTXA 2R7VA 2OF7A 3VB2A 4L9TA 3A0BC 1VFCA 1HBXG 1VQ4I 5M3MJ 2EA4A 3KFWX 2MD5A 4HNUA 1IAWA 5F08A 2GIVA 2AO9A 3NWSA 5ERIA 4U0YA 4ESBA 4ENJA 4M9SA 1F1ZA 3Q3SA 2P5VA 2Y9ZA 1MSFC 3RIRA 5J8FA 2MG4A 5HNFA 4N4OB 3DEWA 5AONA 4ESJA 2TCTA 2LY1A 5TISC 1U5TA 3M3YJ 5LEJA 4IPAA 4U0VA 4FT8A 2ISZA 3DTIA 3H5AA 2MC3A 3QYFA 4N9IA 2A68F 4Y7NJ 3HM5A 4HQEA 3GTJJ 2OZ6A 2FF4A 2FX0A 4U7BA 3WE3A 4BJ6C 4KN7X 3QPHA 1BC8C 1TC3C 2ECBA 3SXYA 2HZTA 2K5CA 3B6AA 3PIPF 3WTVC 4IQ4A 1LPQA 2HFHA 2W24A 2CQQA 4CCJA 5J4VA 3I55I 3PNVA 5EF6A 4GDFA 1X1PA 4A3EJ 1D5VA 2Y69H 5EEAA 4D0PA 2V1UA 1LKXA 1B59A 2WAQN 4EJUA 3GZ6A 2RN7A 4ZC3A 1WI3A 3FXOA 1WJEA 5LGUA 2YPRA 3BR3A 3BQYA 2KISA 3ABKH 5B3SH 3P5JA 4M3FA 4OMZA 3CLOA 4LG0B 2KDZA 4CCNA 3S16J 2R7FA 2H8RA 4B1RA 3WU0A 2L9SA 4JX4A 4C3IJ 3ZXSA 4BXFA 1T38A 2NS0A 1FTTA 2P6TA 3LSGA 1X2NA 4CYCB 4BACA 4XKWA 1TQMA 1MKMA 2F5EA 1FOYA 1T0FA 4HW0A 3U21A 3HPHA 5HLHA 3S2HJ 1XDSA 1Z6RA 5LEKA 4OINF 1XC5A 3A03A 1YRNB 4Y33A 3I4MJ 1S7AA 2MBFA 1JKOC 3BG9A 2IA1A 4A6EA 3HG9A 2QQAA 5L3GA 1MMAA 1ETVA 3M07A 2VIXA 2DW4A 2O61A 3F8FA 2CQKA 3J81K 2X51A 3ZQHA 4LK0F 3RQ4A 3MEXA 2EIKH 2DA3A 3O2PE 3GZ5A 1MBFA 2E19A 2Z99A 3RPUD 4M74A 3PNTA 4G8XA 3H9GA 2PJRA 2VODA 1YE9A 2EFWA 3PO3J 3F23A 3H5NA 3CO6C 2WY7Q 3GUDA 2XGDA 5D8KB 2XASA 4A5MA 1BI2A 2ZXIA 3OYKA 1S72I 4OIRF 3E5UA 3V4GA 4RGUA 1BJAA 3JSPA 3KEQA 2E7WA 4NHJA 3GTOJ 5DM6F 3GTLJ 3COAC 3LOCA 1SFUA 2K9QA 3OMYA 4IRIA 4CGZA 1U8RA 2UZKA 1UHMA 2KQRA 4MO7A 3IV5A 3CF2A 1RPWA 3QOPA 2H1KA 4IJAA 1XX5A 3QYEA 3F8BA 2R93J 3BP8A 4CDGA 1QVTA 3BTCA 2Z1DA 4H0EA 5L3CA 2E7XA 2EWNA 1P92A 1W0TA 1BC7C 3B73A 3AFHA 4OU0A 3S32A 3IKVA 2O8KA 1IN5A 3KIOA 1SFKA 2JK3A 2ID6A 4KN4X 2H8WA 2XVCA 1GXQA 2LTPA 5B5EC 1J09A 3W6KB 3PNYA 1KU3A 2DLLA 2X0LA 1FJLA 2DMUA 2Y9YA 5FLVA 1IN4A 1W36C 4XLHA 1FC3A 2CMPA 1M1EB 3SQNA 4BHPA 1LNWA 5D5XB 4IO9F 2W57A 4ENKA 1BW6A 3EDPA 1GV5A 4G6QA 4V19K 1K6YA 1WJBA 3OS0A 4D5FA 4ZZLA 3G1OA 3S1RJ 3NRVA 2R5ZA 2KJCA 3KX2A 1U5TB 3NQOA 2ID3A 4UVBA 5KK1A 2NXNB 2IS6A 2I10A 5ICCA 1MMSA 3DU5A 4KJZA 3OOPA 4R8HA 3HUGA 1U6GA 4BL0B 5FRNA 4DBRA 2E1MB 2XB5A 3MKZA 2HTSA 4I01A 4CCMA 3A4CA 2CGPA 3G1MA 4L5EA 1Z67A 3S93A 2STWA 4UY8I 4RMNA 1SANA 3MAJA 1SFXA 2DQRA 3LQRA 1XTAA 2F4OB 1ULYA 3BT9A 4IXAA 1A31A 2L7KA 4LG3A 5AIQA 1U9OA 4LITA 1EA3A 1ZGWA 2D1VA 4XOPA 2Z9OA 2R92J 2PEXA 3QPSA 5A2QK 3BTJA 3F0CA 1ON2A 3TP0A 1B6AA 2M7AA 3Q0UA 2PX9A 1A6QA 1HW1A 4NUBA 2LH9A 1YI2I 4UNOA 3BG6A 2M7BA 3M1EA 2Z33A 4HDUA 1A36A 5J8CA 3ELKA 1R7JA 2M34A 1Z21A 3Q9SA 4A0XA 4Y3OA 1KZHA 3V7RA 2K85A 5FJ8J 4HDVA 1ITYA 4M9XA 3HTUA 2Y0SA 3JR9A 2IEKA 2CUZA 1OKRA 3OYAA 2K9NA 5BQTA 1Q1VA 3BY6A 5JR3A 3IHUA 1BI0A 2LD5A 4H4KC 3GFLA 3OV8A 2DPDA 3HRSA 4N4NB 3K4BA 4LB6B 3ZPLA 5GAGJ 4PGHA 2XF6A 5J40A 2QSHX 1F43A 3K0LA 2W84A 2OC6A 4A3JJ 4RB3C 3HBLA 2RC4A 2VT2A 4A3BJ 1ETKA 3RYRA 4IF4A 5CVVA 5K5OA 4MTDA 4F52A 1A6IA 2GBYA 2VQLA 4A3GJ 1APLC 4M72A 4BQQA 4A3IJ 2PJRB 1HKTA 1FX7A 3SDBA 3TOBA 3RPUA 3GW2A 4AVPA 2DOFA 3H3VK 2R7TA 4I2OA 4IVNA 2FRHA 2IS2A 2QQ8A 2PQ8A 1BM9A 1R1TA 3AAFA 4GFBA 2YR2A 3HC7A 3ABUA 2AS5F 5FKMA 3Q0WA 1XGOA 4KIFA 3ZMSA 2MYSA 2CFXA 1FBUA 1IZ1A 2GAUA 1P4XA 2LDUA 1SVLA 5M5YJ 3J7AO 1YIOA 3S2DJ 1PUEE 4CA0A 2Z5UA 2BEOA 2O0YA 3ECHA 1X58A 2V9VA 2UUZA 2V9KA 3GMEA 1TTYA 3KLOA 4N0BA 3DEEA 4UVAA 2Q8KA 4BJTA 5ILVA 3QPTA 5LHIA 3OYEA 4MQ9F 5HLTA 4C2UA 3JTGA 2BZTA 4WK8F 2RKHA 2VC0A 1EJ9A 1DP7P 3GZNB 2VI6A 3DTEA 2DMTA 3VODA 2JTVA 3ONQA 1DP3A 1R1VA 3AG1H 5EGOA 2BYVE 2ACJA 3EYIA 4Q47A 2XB0X 1ETQA 1QU3A 1K78A 2A5YB 3K4KA 5DUKA 2HQAA 3KEOA 2PMUA 3DLLF 2V4JC 2MW8A 1BR1A 3D0SA 3NWTA 3CUQA 2R5ZB 4HBLA 2G7UA 3L2RA 1KU2A 2MFZA 3H9JA 3L09A 2DAOA 3MKLA 3IP4B 2JJ7A 3LMMA 1AU7A 4XNFA 3TEDA 1SVOA 3HUGB 2MSYA 2UXNA 2GZWA 4E7SA 2PG4A 5BNGA 2DOAA 4ZYGA 4WCGA 1QVUA 3A2KA 1OR7C 1QHGA 1VI0A 3FBIB 4G7HF 1JHFA 4C9YA 1JT0A
chains in the Genus database with same CATH topology
4FCYA 5IP6A 1FEXA 2PMZN 1K83J 2W48A 3TW6A 2FQ4A 5F0HA 1BA5A 4JP0A 2DA2A 2NOGA 1ETWA 3JRGA 5FKOA 1IUFA 1MBKA 5GP9A 3BR6A 3BG5A 2DMQA 5FKKA 5C44J 3JRDA 2LKXA 1WH7A 2R5YB 5E3LA 5EG0A 1G2HA 2R7ZJ 4RDUA 4CYCA 2WB1N 1S7EA 3HGGA 1JUMA 4D7MA 1DU6A 1IC8A 2YUSA 4FTHA 1RETA 3H0GJ 2CUEA 3JREA 2DMNA 1LE8B 2N8GA 2LP0A 2XGCA 2EZKA 1WGXA 3PM1A 1X2MA 4XRSA 1IDZA 1ETYA 5C3EJ 4QIWN 5IYCJ 2JA8J 3JRHA 1JT6A 1PUFB 4BBRJ 2G0EA 1B72B 4DZPA 1ORKA 1WCMJ 3CMYA 1HDPA 1TWCJ 4HNVA 1BW5A 3FIWA 2E2IJ 3MVPA 3I4NJ 1H89C 3BQZA 2LY9A 2L7ZA 5IYBJ 3ZOBA 3LSRA 2JMWA 2Y2ZA 4DW6A 5C4JJ 1TWHJ 4D7NA 2VKVA 5J1YA 4IHVA 4XIDA 1QRYA 5C4XJ 1MBHA 2M2EA 4A3DJ 1Y1WJ 4BY1J 1HLVA 4M3BA 2OPTA 5GPCA 3JRFA 2JA5J 4W1UA 2WV1A 2JN6A 3ZQCA 2KT0A 3ZQGA 3HKZN 3LSPA 5JLWA 1GV2A 1A5JA 3RQIA 2X48A 4V2GA 4I76A 3CQZJ 2HDDA 2VKEA 2Y31A 4BKXA 2XPWA 2XPVA 2E2JJ 3HOZJ 3PO2J 2LK2A 2NVQJ 5EZGA 2LFBA 2CRGA 2VPRA 2NVXJ 2YU9J 3HOWJ 1U78A 2FJ1A 3QPLA 2GM4A 1TWGJ 4FE4A 3JRIA 2DTZA 1ZR2A 1GDTA 2COBA 3BR1A 1BL0A 1IV6A 1JTXA 5F27A 2OF7A 1Z0XA 3FKIJ 1VFCA 3RKQA 1NK3P 5M3MJ 4IHXA 3K2AA 3D1NI 5F08A 2AO9A 3UKGA 1NK2P 2ZB9A 3Q3SA 5J1RA 2Y9ZA 1MSFC 1GT0C 2MG4A 3S17J 3DEWA 4BY7J 2TCTA 3M3YJ 5EZHA 2IBDA 3OIOA 3IH3A 5F0FA 5EGOB 1MNMC 3CCYA 4S0HB 1LFUP 2HOTA 1ZKGA 1Z77A 5F1JA 4EEFG 1MH3A 4Y7NJ 3HM5A 3GTJJ 3FK7A 2CUFA 2FX0A 1ZK8A 2DMPA 4XICA 3BG3A 1TC3C 3FK6A 2ECBA 2CQXA 3B6AA 2DA1A 2HI3A 1K61A 1P7JA 3BR2A 3SFIA 4MFEA 2CQQA 4IHYA 1HF0A 2DA7A 2QCOA 4AC0A 2YS9A 5EF6A 4A3EJ 3S1MJ 3W6VA 5EEAA 1U8BA 1XG1A 2WAQN 2M8GX 1WI3A 3BR3A 1BJZA 1MBEA 3BQYA 1ZR4A 3ZQIA 1JUSA 4M3FA 5FKNA 4C3JJ 2X6OA 3GTKJ 2KDZA 3BR0A 3S16J 4DYCA 2H8RA 1GVDA 2CJJA 4B1RA 1MH4A 5K7FA 2ME0A 2DA5A 4JX4A 4C3IJ 1JJ8C 5F0CA 1T56A 2L0KA 1DU0A 1ETOA 1RKWA 1YRNA 1FTTA 3LSGA 5EG0B 1X2NA 1ENHA 4CYCB 3GTQJ 2JA7J 4XRSG 1IGNA 1H88C 5JLXA 4UUSA 3S2HJ 3SDGA 1JTYA 1YRNB 1XC5A 3A03A 5IOYA 3I4MJ 1JKOC 3BG9A 5K7ZA 1ETVA 4DYQA 3ZQHA 1ETXA 3IH4A 3HOUJ 1IRZA 1UHSA 2DA3A 5K7HA 4A3KJ 1MBFA 2E19A 4Y52J 1U9NA 4I6ZA 1B8IA 1AKHA 2E2HJ 3PO3J 3M4OJ 2R0QC 5M5WJ 2XGDA 1F36A 3LSJA 2DJNA 3HGYA 3B6CA 1RR7A 1B8IB 2HXIA 3GTOJ 3L1PA 3GTLJ 2LR8A 3LOCA 2DN0A 3FISA 2HYJA 1WPKA 5GPAA 2X9DA 2K9QA 1VF9A 1JGGA 4AUXA 4MO7A 3IV5A 1D5YA 2HOSA 1VNDA 5E3NA 1RPWA 5J3LA 2H1KA 3RZDJ 3QQAA 2R93J 2Y30A 1QVTA 1H8AC 2VUMJ 3BTCA 5DTDA 1OCTC 4MIMA 2ME6A 1W0TA 2D5VA 4M3GA 2O8KA 3G1LA 2MGQA 1UG2A 2JK3A 2LVSA 2E1OA 2ID6A 3BTIA 2L7MP 4A69C 2QF7A 2XRLA 2LTPA 3HOVJ 3S1QJ 1I50J 3TW7A 2O7OA 5E3MA 1FJLA 2DMUA 2Y9YA 5FLVA 1HOMA 2XSDC 1BW6A 1GV5A 1GUUA 3HOXJ 4D5FA 3G1OA 3JRCA 3S1RJ 5IP9J 2R5ZA 2B63J 2ID3A 4MFDA 4A3LJ 2M9HA 3NARA 2CU7A 2P81A 4QSHA 2I10A 5IP7J 3OSFA 2L9RA 2XB5A 2DA6A 2M0CA 4J19A 1O4XA 3ZQFA 3GTMJ 1FTZA 4M3DA 4BBSJ 3LNQA 1I3QJ 3G1MA 3K7AJ 4C2MJ 4IEJA 4L5EA 4W97A 1HDDC 4A3FJ 2DA4A 1HCRA 1SANA 4C3HJ 1JKQC 2EH3A 2EZLA 2NS8A 1R9TJ 2HQ5A 3SJMA 3BT9A 3IH2A 4D5CA 4FISA 4X1EA 1RESA 1U9OA 2NVYJ 4ABZA 1ZGWA 2EZHA 2R92J 2R5YA 2L7FP 4QTRA 3O8HA 3QPSA 1AHDP 3BTJA 3F0CA 3TP0A 1JKPC 4FE7A 3O8GA 3Q0UA 1MBGA 1LE8A 1FIPA 1OCPA 1I6HJ 1UMQA 3BTLA 2M34A 5DS9A 3S14J 2EQRA 3OOUA 1JJ6C 1PUFA 5FJ8J 1B72A 3S15J 1ITYA 3JR9A 5M3FJ 2IEKA 4UUSB 2K9NA 1Q1VA 2K40A 5EYRA 2LD5A 3DCFA 3HEFA 1CQTA 5FKLA 1TWAJ 2NVTJ 1F43A 4MLOA 1FIAA 2HOAA 5IPAA 4A93J 2NS7A 5EDNA 4A3JJ 2ECCA 3HBLA 5IYDJ 2TRTA 4AYBN 3S1NJ 2EBIA 2FD5A 1E3OC 1QPIA 1OFCX 1ETKA 5J1UA 3BR5A 3WHBA 3Q0VA 4A3BJ 3E7LA 4XK4A 4IHWA 1OJLA 2EZIA 3GTGJ 1A6IA 2GBYA 4A3GJ 3HB9A 1APLC 1AKHB 2IAIA 4A3IJ 4B4CA 3VPRA 4BXXJ 1IDYA 1EF4A 4JX6A 1IJWC 3H3VK 4A3MJ 4RBOA 4JYKA 3JRAA 3CDLA 1IG7A 3HDDA 4GFBA 4B3AA 3C2BA 2LLKA 3JRBA 2O9LA 3MN2A 1TWFJ 3NAUA 2XGEA 5FKMA 3Q0WA 1ZQ3P 1SFOJ 4G12A 4M6VA 2XPUA 5M5YJ 3S2DJ 1JKRC 4A3CJ 1T33A 1Y1VJ 4M3EA 2ELKA 4XRMA 1X58A 3A02A 2JA6J 1JUPA 3OSGA 5E3OA 1MBJA 4X6AJ 4DZJA 3HOYJ 9ANTA 2VI6A 2DMTA 3TP3A 5F04A 1LFBA 5EGOA 5FLMJ 3GTPJ 4LOCA 2GLOA 2XB0X 1ETQA 3ZQLA 2Y0SN 4NDLA 3A01A 3WHCA 2K9SA 2MW8A 5HODA 2R5ZB 4V2FA 3RZOJ 1P7IA 2HXOA 1XS9A 3MKLA 2JJ7A 4JX5A 1WH5A 1RKTA 3A01B 1AU7A 3TEDA 2MSYA 1NTCA 2RAEA 5IOZA 1W0UA 5BNGA 2JWTA 1QVUA 5M5XJ 1MSEC 1VI0A 1POGA 3GBGA 2AHQA 4DYRA 4UUTA 1JT0A 1ZTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCY A;  5IP6 A;  1FEX A;  2PMZ N;  1K83 J;  2W48 A;  3TW6 A;  2FQ4 A;  5F0H A;  1BA5 A;  4JP0 A;  2DA2 A;  2NOG A;  1ETW A;  3JRG A;  5FKO A;  1IUF A;  1MBK A;  5GP9 A;  3BR6 A;  3BG5 A;  2DMQ A;  5FKK A;  5C44 J;  3JRD A;  2LKX A;  1WH7 A;  2R5Y B;  5E3L A;  5EG0 A;  1G2H A;  2R7Z J;  4RDU A;  4CYC A;  2WB1 N;  1S7E A;  3HGG A;  1JUM A;  4D7M A;  1DU6 A;  1IC8 A;  2YUS A;  4FTH A;  1RET A;  3H0G J;  2CUE A;  3JRE A;  2DMN A;  1LE8 B;  2N8G A;  2LP0 A;  2XGC A;  2EZK A;  1WGX A;  3PM1 A;  1X2M A;  4XRS A;  1IDZ A;  1ETY A;  5C3E J;  4QIW N;  5IYC J;  2JA8 J;  3JRH A;  1JT6 A;  1PUF B;  4BBR J;  2G0E A;  1B72 B;  4DZP A;  1ORK A;  1WCM J;  3CMY A;  1HDP A;  1TWC J;  4HNV A;  1BW5 A;  3FIW A;  2E2I J;  3MVP A;  3I4N J;  1H89 C;  3BQZ A;  2LY9 A;  2L7Z A;  5IYB J;  3ZOB A;  3LSR A;  2JMW A;  2Y2Z A;  4DW6 A;  5C4J J;  1TWH J;  4D7N A;  2VKV A;  5J1Y A;  4IHV A;  4XID A;  1QRY A;  5C4X J;  1MBH A;  2M2E A;  4A3D J;  1Y1W J;  4BY1 J;  1HLV A;  4M3B A;  2OPT A;  5GPC A;  3JRF A;  2JA5 J;  4W1U A;  2WV1 A;  2JN6 A;  3ZQC A;  2KT0 A;  3ZQG A;  3HKZ N;  3LSP A;  5JLW A;  1GV2 A;  1A5J A;  3RQI A;  2X48 A;  4V2G A;  4I76 A;  3CQZ J;  2HDD A;  2VKE A;  2Y31 A;  4BKX A;  2XPW A;  2XPV A;  2E2J J;  3HOZ J;  3PO2 J;  2LK2 A;  2NVQ J;  5EZG A;  2LFB A;  2CRG A;  2VPR A;  2NVX J;  2YU9 J;  3HOW J;  1U78 A;  2FJ1 A;  3QPL A;  2GM4 A;  1TWG J;  4FE4 A;  3JRI A;  2DTZ A;  1ZR2 A;  1GDT A;  2COB A;  3BR1 A;  1BL0 A;  1IV6 A;  1JTX A;  5F27 A;  2OF7 A;  1Z0X A;  3FKI J;  1VFC A;  3RKQ A;  1NK3 P;  5M3M J;  4IHX A;  3K2A A;  3D1N I;  5F08 A;  2AO9 A;  3UKG A;  1NK2 P;  2ZB9 A;  3Q3S A;  5J1R A;  2Y9Z A;  1MSF C;  1GT0 C;  2MG4 A;  3S17 J;  3DEW A;  4BY7 J;  2TCT A;  3M3Y J;  5EZH A;  2IBD A;  3OIO A;  3IH3 A;  5F0F A;  5EGO B;  1MNM C;  3CCY A;  4S0H B;  1LFU P;  2HOT A;  1ZKG A;  1Z77 A;  5F1J A;  4EEF G;  1MH3 A;  4Y7N J;  3HM5 A;  3GTJ J;  3FK7 A;  2CUF A;  2FX0 A;  1ZK8 A;  2DMP A;  4XIC A;  3BG3 A;  1TC3 C;  3FK6 A;  2ECB A;  2CQX A;  3B6A A;  2DA1 A;  2HI3 A;  1K61 A;  1P7J A;  3BR2 A;  3SFI A;  4MFE A;  2CQQ A;  4IHY A;  1HF0 A;  2DA7 A;  2QCO A;  4AC0 A;  2YS9 A;  5EF6 A;  4A3E J;  3S1M J;  3W6V A;  5EEA A;  1U8B A;  1XG1 A;  2WAQ N;  2M8G X;  1WI3 A;  3BR3 A;  1BJZ A;  1MBE A;  3BQY A;  1ZR4 A;  3ZQI A;  1JUS A;  4M3F A;  5FKN A;  4C3J J;  2X6O A;  3GTK J;  2KDZ A;  3BR0 A;  3S16 J;  4DYC A;  2H8R A;  1GVD A;  2CJJ A;  4B1R A;  1MH4 A;  5K7F A;  2ME0 A;  2DA5 A;  4JX4 A;  4C3I J;  1JJ8 C;  5F0C A;  1T56 A;  2L0K A;  1DU0 A;  1ETO A;  1RKW A;  1YRN A;  1FTT A;  3LSG A;  5EG0 B;  1X2N A;  1ENH A;  4CYC B;  3GTQ J;  2JA7 J;  4XRS G;  1IGN A;  1H88 C;  5JLX A;  4UUS A;  3S2H J;  3SDG A;  1JTY A;  1YRN B;  1XC5 A;  3A03 A;  5IOY A;  3I4M J;  1JKO C;  3BG9 A;  5K7Z A;  1ETV A;  4DYQ A;  3ZQH A;  1ETX A;  3IH4 A;  3HOU J;  1IRZ A;  1UHS A;  2DA3 A;  5K7H A;  4A3K J;  1MBF A;  2E19 A;  4Y52 J;  1U9N A;  4I6Z A;  1B8I A;  1AKH A;  2E2H J;  3PO3 J;  3M4O J;  2R0Q C;  5M5W J;  2XGD A;  1F36 A;  3LSJ A;  2DJN A;  3HGY A;  3B6C A;  1RR7 A;  1B8I B;  2HXI A;  3GTO J;  3L1P A;  3GTL J;  2LR8 A;  3LOC A;  2DN0 A;  3FIS A;  2HYJ A;  1WPK A;  5GPA A;  2X9D A;  2K9Q A;  1VF9 A;  1JGG A;  4AUX A;  4MO7 A;  3IV5 A;  1D5Y A;  2HOS A;  1VND A;  5E3N A;  1RPW A;  5J3L A;  2H1K A;  3RZD J;  3QQA A;  2R93 J;  2Y30 A;  1QVT A;  1H8A C;  2VUM J;  3BTC A;  5DTD A;  1OCT C;  4MIM A;  2ME6 A;  1W0T A;  2D5V A;  4M3G A;  2O8K A;  3G1L A;  2MGQ A;  1UG2 A;  2JK3 A;  2LVS A;  2E1O A;  2ID6 A;  3BTI A;  2L7M P;  4A69 C;  2QF7 A;  2XRL A;  2LTP A;  3HOV J;  3S1Q J;  1I50 J;  3TW7 A;  2O7O A;  5E3M A;  1FJL A;  2DMU A;  2Y9Y A;  5FLV A;  1HOM A;  2XSD C;  1BW6 A;  1GV5 A;  1GUU A;  3HOX J;  4D5F A;  3G1O A;  3JRC A;  3S1R J;  5IP9 J;  2R5Z A;  2B63 J;  2ID3 A;  4MFD A;  4A3L J;  2M9H A;  3NAR A;  2CU7 A;  2P81 A;  4QSH A;  2I10 A;  5IP7 J;  3OSF A;  2L9R A;  2XB5 A;  2DA6 A;  2M0C A;  4J19 A;  1O4X A;  3ZQF A;  3GTM J;  1FTZ A;  4M3D A;  4BBS J;  3LNQ A;  1I3Q J;  3G1M A;  3K7A J;  4C2M J;  4IEJ A;  4L5E A;  4W97 A;  1HDD C;  4A3F J;  2DA4 A;  1HCR A;  1SAN A;  4C3H J;  1JKQ C;  2EH3 A;  2EZL A;  2NS8 A;  1R9T J;  2HQ5 A;  3SJM A;  3BT9 A;  3IH2 A;  4D5C A;  4FIS A;  4X1E A;  1RES A;  1U9O A;  2NVY J;  4ABZ A;  1ZGW A;  2EZH A;  2R92 J;  2R5Y A;  2L7F P;  4QTR A;  3O8H A;  3QPS A;  1AHD P;  3BTJ A;  3F0C A;  3TP0 A;  1JKP C;  4FE7 A;  3O8G A;  3Q0U A;  1MBG A;  1LE8 A;  1FIP A;  1OCP A;  1I6H J;  1UMQ A;  3BTL A;  2M34 A;  5DS9 A;  3S14 J;  2EQR A;  3OOU A;  1JJ6 C;  1PUF A;  5FJ8 J;  1B72 A;  3S15 J;  1ITY A;  3JR9 A;  5M3F J;  2IEK A;  4UUS B;  2K9N A;  1Q1V A;  2K40 A;  5EYR A;  2LD5 A;  3DCF A;  3HEF A;  1CQT A;  5FKL A;  1TWA J;  2NVT J;  1F43 A;  4MLO A;  1FIA A;  2HOA A;  5IPA A;  4A93 J;  2NS7 A;  5EDN A;  4A3J J;  2ECC A;  3HBL A;  5IYD J;  2TRT A;  4AYB N;  3S1N J;  2EBI A;  2FD5 A;  1E3O C;  1QPI A;  1OFC X;  1ETK A;  5J1U A;  3BR5 A;  3WHB A;  3Q0V A;  4A3B J;  3E7L A;  4XK4 A;  4IHW A;  1OJL A;  2EZI A;  3GTG J;  1A6I A;  2GBY A;  4A3G J;  3HB9 A;  1APL C;  1AKH B;  2IAI A;  4A3I J;  4B4C A;  3VPR A;  4BXX J;  1IDY A;  1EF4 A;  4JX6 A;  1IJW C;  3H3V K;  4A3M J;  4RBO A;  4JYK A;  3JRA A;  3CDL A;  1IG7 A;  3HDD A;  4GFB A;  4B3A A;  3C2B A;  2LLK A;  3JRB A;  2O9L A;  3MN2 A;  1TWF J;  3NAU A;  2XGE A;  5FKM A;  3Q0W A;  1ZQ3 P;  1SFO J;  4G12 A;  4M6V A;  2XPU A;  5M5Y J;  3S2D J;  1JKR C;  4A3C J;  1T33 A;  1Y1V J;  4M3E A;  2ELK A;  4XRM A;  1X58 A;  3A02 A;  2JA6 J;  1JUP A;  3OSG A;  5E3O A;  1MBJ A;  4X6A J;  4DZJ A;  3HOY J;  9ANT A;  2VI6 A;  2DMT A;  3TP3 A;  5F04 A;  1LFB A;  5EGO A;  5FLM J;  3GTP J;  4LOC A;  2GLO A;  2XB0 X;  1ETQ A;  3ZQL A;  2Y0S N;  4NDL A;  3A01 A;  3WHC A;  2K9S A;  2MW8 A;  5HOD A;  2R5Z B;  4V2F A;  3RZO J;  1P7I A;  2HXO A;  1XS9 A;  3MKL A;  2JJ7 A;  4JX5 A;  1WH5 A;  1RKT A;  3A01 B;  1AU7 A;  3TED A;  2MSY A;  1NTC A;  2RAE A;  5IOZ A;  1W0U A;  5BNG A;  2JWT A;  1QVU A;  5M5X J;  1MSE C;  1VI0 A;  1POG A;  3GBG A;  2AHQ A;  4DYR A;  4UUT A;  1JT0 A;  1ZTR A; 
#chains in the Genus database with same CATH topology
 2EFQ A;  1ZRD A;  1USS A;  3GXO A;  3TW6 A;  5B66 C;  2Q2E A;  4CUG A;  2F48 A;  4OAY A;  2JSP A;  3OIP A;  4FHT A;  2P7V B;  3H3U A;  3TDU C;  1DDN A;  1ETW A;  4EGZ A;  3ZN1 A;  3LSH A;  2A05 A;  2KPM A;  2DMQ A;  4YFN F;  2ZME C;  5FKK A;  3E6D A;  5C44 J;  5D5U B;  3FMR A;  5EG0 A;  1S5L C;  4RDU A;  2E60 A;  1E2X A;  4OAZ A;  4E7I A;  2FE3 A;  4WWC A;  1DU6 A;  4FTH A;  1YW7 A;  3H0G J;  3WTS C;  2DMN A;  1HC8 A;  3HHH A;  2LP0 A;  3MWM A;  4F3Q A;  1X2M A;  4A0Y A;  5FLX Z;  1D3Y A;  1Z3X A;  1IDZ A;  3TDZ C;  3D5S C;  1ETY A;  4ASN A;  2VBY A;  2X6W A;  1YG2 A;  3K70 C;  1SAX A;  1WCM J;  1QZE A;  3CMY A;  4HNV A;  4DJA A;  2RVC A;  3QAH A;  2E2I J;  1U5T C;  1H89 C;  2RV8 A;  1WKM A;  2L7Z A;  3ZOB A;  1D0Y A;  4HZF A;  2BV6 A;  4PJJ A;  1YFH A;  4K2E A;  2ZSI B;  4IHV A;  4IRG A;  2E1M C;  1Y0U A;  1NG7 A;  2OPT A;  2EFP A;  1D1C A;  2E34 A;  5GPC A;  5DUI A;  4W1U A;  4U87 A;  2JN6 A;  4ITV A;  4L5J A;  4P96 A;  3OYL A;  3ZQC A;  2KT0 A;  2L2O A;  3FMS A;  1CF7 A;  2VPL A;  3HTS B;  2WAQ A;  5CQG A;  2FU4 A;  3TMO A;  1MD0 A;  4NC6 A;  2X48 A;  5H20 A;  2OQG A;  1YX3 A;  2HU9 A;  3E6M A;  2HDD A;  5HDN A;  1IV8 A;  4RM2 A;  1V5E A;  2Y31 A;  4ZDL A;  4CZZ A;  2UWM A;  2E2J J;  4HRI A;  2LK2 A;  1XMA A;  4CCL A;  3WU2 C;  3OYJ A;  3PFI A;  5GAD J;  1V5F A;  3WE2 A;  2NVX J;  4RB2 C;  2BXZ A;  2FJ1 A;  3KP6 A;  2GM4 A;  1TWG J;  3FDY A;  3JRI A;  2DTZ A;  4GRI A;  5E20 A;  1BL0 A;  1W5C C;  3N4M A;  3FKI J;  3JCU C;  1O57 A;  1P9Q C;  3RSN A;  3HL2 A;  1NK3 P;  3DKX A;  4NQW A;  4EJO A;  2VJI A;  2ZBK A;  3QP6 A;  3BRO A;  1YW8 A;  2DT7 B;  3MKY B;  2QGU A;  3UKG A;  1JE8 A;  1SMY F;  2VT3 A;  2F5C A;  4NBQ A;  5J1R A;  2ZXH A;  1X4P A;  1WHU A;  3EET A;  1X3Z B;  4UV8 A;  5FO5 A;  2ZXJ A;  5B1B H;  1TNT A;  3CO7 C;  1Y6I A;  3IH3 A;  3HOT A;  3DTK A;  5F0F A;  5E8G A;  5EGO B;  2JPC A;  2QEX I;  4FET A;  5KNL A;  2VLA A;  2A5W A;  3IRQ A;  5DD4 A;  2DTR A;  3PQJ A;  1ZGA A;  3CCM I;  2CW7 A;  3FXM A;  4EEF G;  1K78 B;  3GFI A;  3CME I;  1XSD A;  4P9U A;  3FK7 A;  3CUQ B;  2IJL A;  2CUF A;  3PFY A;  1VZ0 A;  2BVM A;  2BBY A;  4EVI A;  3L9F A;  3BG3 A;  2O6G E;  4CYD A;  3FK6 A;  4FQG A;  3OYG A;  2CQX A;  2M4K A;  3WG7 H;  1XMK A;  3ZQQ A;  2JT1 A;  1MIJ A;  1O3R A;  2QYO A;  2DDB A;  1P7J A;  3BR2 A;  4BHB A;  4B48 A;  3ZRG A;  4E7L A;  1HF0 A;  2L5Q A;  1K6O A;  5D5V B;  2A6E F;  2DCE A;  1U8B A;  1XG1 A;  4XKV A;  4XR6 A;  3KET A;  1FOX A;  1TW3 A;  4BEH A;  3DBH B;  2JUC A;  5LRR A;  1BJZ A;  1MBE A;  3CDH A;  1F4K A;  2Q2E B;  1Z7L A;  4PSX A;  1FY7 A;  3ZQI A;  5ED4 A;  4PK4 A;  2ELJ A;  1Y8Q B;  5FKN A;  3GTK J;  3LAJ A;  3CMM A;  4F91 B;  1KQ9 A;  3FMQ A;  4DYC A;  2Q1Z B;  1ZGJ A;  1GVD A;  1UAA A;  3H36 A;  1LB2 A;  4L9J A;  1O3Q A;  1PDN C;  1DU0 A;  1JJ8 C;  2JQ7 A;  1T56 A;  3GEZ A;  4B44 A;  2JUG A;  1RKW A;  3FXR A;  4E7H A;  1YRN A;  5EG0 B;  2HQN A;  2JA7 J;  2F2E A;  4XRS G;  1GHC A;  1YQA A;  2VL8 A;  2ADU A;  5ILS A;  3OYD A;  3CDI A;  3QU6 A;  2MH2 A;  1W7P D;  4UVC A;  3CUO A;  3CP8 A;  2BGC A;  1V55 H;  5KHD A;  1TQI A;  3Q9V A;  3OYM A;  2GOX B;  5F64 A;  2A6H F;  3W6J B;  2HEO A;  2CQN A;  4JOM A;  3E1S A;  4AVZ A;  2VXD A;  5GTI C;  3HRM A;  1UB9 A;  2F5F A;  2OBP A;  3ISP A;  3F6V A;  3ZQ7 A;  4DYQ A;  3S3O A;  4HST A;  2OTJ I;  2CW0 F;  1ETX A;  3IH4 A;  1G3S A;  5K7H A;  2DQL A;  1OCO H;  2K86 A;  4BDY A;  2RQQ A;  2XV4 S;  1ZRC A;  2EB7 A;  2BOL A;  1TP4 A;  3DPT A;  2DT6 A;  2GXA A;  2XDV A;  4EJW A;  2KZV A;  2VE8 A;  1WWX A;  3AG4 H;  4JBA A;  1IXC A;  2FSW A;  1S8N A;  1XGN A;  3MD2 A;  5D8L B;  1RRJ A;  2QQB A;  3DBR B;  3HGY A;  3M8F A;  1W1W E;  2MAB A;  3QOE A;  5EEG A;  1CF7 B;  5HNH A;  3L2U A;  2LG4 A;  3L1P A;  3FIS A;  1WPK A;  2HYJ A;  1IN6 A;  1I6X A;  2R7X A;  1XB4 A;  1D5Y A;  5IT9 K;  5H6Q A;  4LIV A;  2EV5 A;  4MTE A;  3VOE A;  3E5Q A;  1AOY A;  1R49 A;  3MZ8 A;  5FD6 A;  1YOV B;  2VAS A;  3K6G A;  2JVH A;  2FA5 A;  2Y30 A;  1GXP A;  2V9P A;  3KP7 A;  5H2F C;  1W4M A;  1RIO H;  5DTD A;  2JA2 A;  4OOI A;  1LFP A;  2ME6 A;  2JVG A;  4RLQ A;  4PGG A;  3HJE A;  4M3G A;  4MGR A;  1I39 A;  3W3C A;  2X85 A;  3IAS 2;  5GAH J;  1J59 A;  1R58 A;  3MFK A;  1ZG3 A;  3G71 I;  1I3A A;  3TO6 A;  2E1O A;  3ZN0 A;  3PQK A;  1ACI A;  1BOA A;  2QF7 A;  4NQW B;  1TZL A;  1EH6 A;  2K7L A;  1IW7 F;  5LGT A;  3TQN A;  1UHW A;  3ZP5 A;  4M9Z A;  4KIC A;  2LMD A;  1R23 A;  3R61 A;  3JRC A;  4XLP F;  1VQ5 I;  2HPI A;  4MFD A;  4E7J A;  3E3V A;  1PYV A;  2ZC2 A;  2CU7 A;  1X4O A;  4RAZ A;  4D9J A;  1LDJ A;  2AXT C;  1Z91 A;  3JTH A;  5LD2 C;  2L9R A;  4LB5 A;  3J80 Z;  1T95 A;  2F5D A;  3HPG A;  2M0C A;  2XSJ C;  1JI8 A;  3GLL A;  1RNL A;  2QVO A;  5FFZ A;  4BBS J;  3LNQ A;  5KAI C;  3QU3 A;  4PJL A;  4PCQ A;  4C2M J;  1HDD C;  1J5Y A;  2M1B A;  1WVR A;  2K9M A;  5HS7 A;  3P9C A;  1VQL I;  3WGI A;  3A1Y A;  4PJ0 C;  2QUF A;  1OYY A;  2HQ5 A;  4IHS A;  3IH2 A;  2R7W A;  4D5C A;  2E1N A;  2V79 A;  4BE1 A;  2M30 A;  3VYT B;  2NVY J;  3FX3 A;  4BEH B;  2EZH A;  1I1G A;  2KIU A;  2L7F P;  4IX7 A;  3BJ6 A;  2DOE A;  3D5R C;  1BBY A;  1JKP C;  2XAG A;  3VYS B;  3F8N A;  4WX9 A;  1I27 A;  3HSF A;  2IA0 A;  5E18 F;  1HW2 A;  2DK5 A;  1BR4 A;  4MEY F;  1UMQ A;  3DBL B;  4RGR A;  4AWX B;  3BTL A;  4YG2 F;  1HXD A;  1OMI A;  4Y15 A;  5DS9 A;  1T39 A;  1D8K A;  3O6B B;  3M9A A;  2OD5 A;  2I5U A;  3S15 J;  1GLN A;  2PI0 A;  4XLE A;  3GCM A;  1FSH A;  2M4G A;  3FXJ A;  1IRX A;  4L18 B;  3EUH A;  2P5L C;  2R7Q A;  1CQT A;  1W7P A;  3K1N A;  4MHG A;  4S05 A;  2NVT J;  3KPH A;  4LIU A;  4RA2 A;  1FIA A;  1QBJ A;  2HOA A;  4P55 A;  1FOK A;  1LUJ B;  3VYU B;  3MKW B;  2NS7 A;  4HF2 A;  1B9N A;  2ZJR F;  3CUQ C;  3BJO A;  4ZDO A;  1BIB A;  1O3T A;  3CCJ I;  2TRT A;  2DK8 A;  4YFX F;  5CYV A;  5IYD J;  2WC2 A;  2EBI A;  3OL4 A;  3E6C C;  1QPI A;  4KUM A;  5E1Z B;  3BR5 A;  2M8E A;  3Q0V A;  3N97 A;  1ZG1 A;  1OJL A;  1MNE A;  2EZI A;  2IS4 A;  3HB9 A;  3S2W A;  4X0G A;  3FM5 A;  3AG3 H;  4CIC A;  2IAI A;  4B4C A;  5TJJ A;  4EM0 B;  4RAY A;  1IDY A;  1EF4 A;  1MZB A;  4JX6 A;  1IJW C;  1R22 A;  4AIJ A;  3UR3 C;  2BVL A;  4B8X A;  3JRA A;  2B7E A;  3CDL A;  3OR2 C;  3C7J A;  3CC7 I;  2RRE A;  2F4M B;  4B3A A;  4Z2Y A;  3S3M A;  3MN2 A;  3CMA I;  3SZP A;  2XGE A;  1ZAO A;  2ISY A;  3KP2 A;  1SFO J;  1X1A A;  4G12 A;  3W2V A;  1K4S A;  2H94 A;  5FRM A;  1S3J A;  2ELH A;  2KRC A;  4QWQ A;  2WAD A;  3CD6 I;  1XCV A;  2H6C A;  4XSZ F;  2V6E A;  5HS8 A;  2XIG A;  4XBF A;  1T33 A;  1Y1V J;  2ELK A;  4XRM A;  3WTY C;  3M8J A;  3RPQ A;  5TRD A;  2ZNZ A;  2QKL B;  3H3Z A;  5E3O A;  2CS3 A;  3V8L A;  1MBJ A;  4HX4 A;  2KHM A;  4BAY A;  2FNP A;  4X6A J;  2HGC A;  1YJ9 I;  1ODD A;  2CWE A;  2A61 A;  1YS7 A;  3DKY A;  3RCO A;  3G73 A;  3TOA A;  9ANT A;  2IA2 A;  5ICE A;  2OU2 A;  4KIG A;  2W85 A;  3TP3 A;  5F04 A;  2H1L A;  2CH0 A;  1LFB A;  3F21 A;  2Y48 A;  2HNH A;  3SZT A;  2GLO A;  1SD5 A;  3REO A;  2LSO A;  2M45 A;  4LK1 F;  2K3P A;  1MJB A;  1LDK B;  2VQG A;  3WHC A;  3LQQ A;  1P7I A;  4UUV A;  2HXO A;  1QGP A;  1TNS A;  4KIS A;  4OIP F;  4JX5 A;  5HLI A;  2IGN A;  2PLY A;  3GFM A;  2VQC A;  2BY3 A;  1T98 A;  3F8C A;  2QQ9 A;  4HYE A;  2RAE A;  1PJR A;  3OS1 A;  1MDM B;  1STZ A;  5IOZ A;  1AWC A;  2J5O A;  2DXI A;  4XOT A;  3ECO A;  3C2H A;  4G6D A;  2K9L A;  1FWZ A;  5LGN A;  3KEY A;  3GBG A;  1X3W B;  4UUT A;  3I64 A;  1ZTR A;  1RC9 A;  2FBI A;  4M6X A;  1V3F A;  5IP6 A;  1FEX A;  2PMZ N;  2HR3 A;  5F0H A;  5FLX K;  1BA5 A;  3AG2 H;  1IO2 A;  3K4N A;  3KYD B;  2DA2 A;  2NOG A;  2IXS A;  5FKO A;  1CGP A;  2VC1 A;  1KGS A;  3BR6 A;  2KLO A;  4XMY A;  2VE9 A;  1VQ8 I;  2ZNY A;  2WTE A;  3JRD A;  2LKX A;  4KA4 A;  2GXG A;  2M5W A;  1G2H A;  2E5Z A;  2HWV A;  2WB1 N;  4ZYE A;  1D0X A;  4PDK A;  4DBQ A;  3LA7 A;  3RKY A;  2QSG X;  2YUS A;  3K1M A;  2CUE A;  2N8G A;  1N78 A;  3WOD F;  5FD5 A;  4J00 A;  2LKS A;  1WGX A;  1W36 D;  3HXL A;  1R5I D;  3LSM A;  3FF5 A;  2G0E A;  3T8R A;  2JSC A;  3RKX A;  1TWC J;  1VQO I;  1VQK I;  2D2W A;  3ZMV A;  2EV0 A;  2LY9 A;  4LLG F;  3HHG A;  4B09 A;  4DOZ A;  1X1B A;  4FAS D;  4YIF A;  3LSR A;  2L01 A;  5HOO A;  2LYC A;  2V7F A;  3K4M A;  2FOW A;  5C4J J;  1W7P B;  4NNJ A;  5FB2 A;  2VKV A;  1OQY A;  5J1Y A;  4S04 A;  3LFU A;  5HS9 A;  3JAM K;  4XL9 A;  4BY1 J;  3OYB A;  3EUA A;  1T2K A;  3LA3 A;  1REP C;  4QLC U;  1RI7 A;  2UV1 A;  1NHA A;  3CCS I;  1XMX A;  5JLW A;  1WJ5 A;  1LEB A;  3FBN B;  4M6Y A;  2KJB A;  1FSE A;  2VBZ A;  1ZH5 A;  2OAZ A;  3BWG A;  3CQZ J;  2VKE A;  3FXL A;  4LLL A;  4FX4 A;  5HLG A;  4JQF A;  2ESH A;  1FYK A;  2STT A;  5D4R A;  2XAQ A;  2NVQ J;  3J81 Z;  3BPX A;  1D8J A;  3HOW J;  5F1R A;  5CVU A;  1GDT A;  5BPI A;  3OYF A;  1E0E A;  3N05 A;  4GYI A;  1IV6 A;  3CES A;  5F27 A;  3IKT A;  2E35 A;  4U7D A;  1Z0X A;  3EQL F;  1QNT A;  3LFK A;  3RKQ A;  1W5S A;  5FFX A;  2XC7 A;  5D5W B;  5JHU A;  1QPM A;  3D1N I;  4XLN F;  4RB1 A;  2R7O A;  2O03 A;  2CYY A;  3BJA A;  3ZMZ A;  4I0B A;  2AQF A;  2HKX A;  2ZB9 A;  2WY8 Q;  4ENM A;  3OS2 A;  1X3U A;  4U0W A;  4XRF A;  3S17 J;  4MQV A;  4BUP A;  4XKB A;  3L2Q A;  2QBY A;  3VEP A;  3DEU A;  3R4K A;  3IRR A;  2IBD A;  1Z1D A;  3OIO A;  3FWE A;  1E3P A;  1MND A;  1SD6 A;  1UEL B;  5E1X A;  5D4S A;  4R79 A;  3CCY A;  2OZU A;  1LFU P;  3TL4 X;  3I3L A;  4Z6Y A;  1HKQ A;  1ZKG A;  5ICF A;  3CJT B;  1F5T A;  1Z05 A;  4LD5 A;  4C30 A;  1MH3 A;  2HS5 A;  4EM2 A;  1FMV A;  1ZRF A;  1B1B A;  1XDU A;  4EM1 A;  4XIC A;  1AA7 A;  3BZK A;  4U88 A;  3F22 A;  4XM3 A;  4AD9 A;  2EIM H;  1B4A A;  2IGM A;  4OWR B;  1K61 A;  1V4R A;  4G7Z F;  3SFI A;  4MFE A;  1Y56 A;  3LSI A;  1R00 A;  3F3X A;  1S29 A;  3ASN H;  2YS9 A;  2MD0 A;  1BN5 A;  3W6V A;  2YU3 A;  2KRF A;  1QZZ A;  3T0Y A;  3PIO F;  3OY9 A;  2MLK A;  2A3S A;  3GWZ A;  2KL4 A;  3KYC B;  1NH3 A;  2Y75 A;  1JUS A;  1JHH A;  3F72 A;  4CCK A;  1IXR C;  3BOQ A;  2X6O A;  4C3J J;  1YJN I;  2XKO A;  4KNY A;  2XF7 A;  2CJJ A;  1FLI A;  1MH4 A;  3V42 A;  2H6B A;  2YX4 A;  2KRH A;  5F0C A;  5JVT A;  1T8I A;  1ETO A;  2BY1 A;  2ZFU A;  2IS1 A;  2PN6 A;  1VQ7 I;  1IRF A;  3JSO A;  3CC2 I;  4XN3 A;  4HNT A;  4CZC A;  1H88 C;  2OCE A;  1IGN A;  1UJ8 A;  3RI4 A;  2KIQ A;  3SDG A;  3GVA A;  1JTY A;  4HF0 A;  4CHU A;  4PUS A;  4F93 B;  5IOY A;  2FXA A;  3IUO A;  2QWW A;  1WI9 A;  1PP7 U;  3LL7 A;  1YLF A;  2XAF A;  4PFO A;  2ZXW H;  3HOU J;  2VKH A;  2R7S A;  1IRZ A;  1DGW Y;  4A3K J;  3IL2 A;  5A2Q Z;  1ZHF A;  1VQ6 I;  1OIS A;  2ICW G;  3TBI A;  4Y52 J;  1U9N A;  1HW5 A;  1TBX A;  2QKM B;  4BQA A;  3OR1 C;  3I59 B;  1A35 A;  2ZKZ A;  2LRD A;  2GXB A;  3M4O J;  3JW4 A;  2R0Q C;  2V1D A;  5B1A H;  5L3F A;  2R7R A;  1F36 A;  4LGW A;  5BOX A;  2DO7 A;  5CLS A;  4DIQ A;  2L9V A;  4EAT A;  1DPR A;  1RR7 A;  2OV7 A;  1B8I B;  1G6N A;  1Z7U A;  2HXI A;  2L54 A;  3CTA A;  3EYY A;  4WXC A;  4C2T A;  2LR8 A;  2HVR A;  3LAP A;  5DD8 A;  5GPA A;  4E7K A;  1T6S A;  1X19 A;  2FEZ A;  3T1B A;  1VF9 A;  1QQI A;  4AUX A;  3PUB A;  3MCZ A;  2EA2 A;  1VND A;  4RS8 A;  5E3N A;  1MGT A;  3WU1 B;  2NNN A;  2QLZ A;  2QEN A;  3QQA A;  4XN0 A;  4GYG A;  1OCT C;  4MIM A;  2VKD A;  1HSJ A;  3U1K A;  2OTL I;  3BZC A;  3ERM A;  2LF7 A;  2V26 A;  2IT0 A;  1KU9 A;  1T0F C;  3F8M A;  1FPQ A;  4KMF A;  3BCA A;  1FYM A;  4CO8 A;  2M3A A;  2LVS A;  3BDD A;  2X6X A;  3BTI A;  2DOD A;  4A69 C;  2XRL A;  4HX7 A;  2ZJP F;  2IRF G;  3DLA A;  4WXD A;  5TGT A;  3GX4 X;  4RAF A;  5CVR A;  2XSD C;  5DM7 F;  1QHH D;  4Y13 A;  5EEH A;  3HOX J;  5LHG A;  5FGM A;  4F7Z A;  5IP9 J;  4BXU A;  2QBY B;  1IN8 A;  3T5X A;  1MMG A;  3NAR A;  2K3F A;  3LA2 A;  3IWF A;  4QSH A;  5IP7 J;  1E17 A;  4LLN A;  3OSF A;  4M73 A;  6PAX A;  1Q1H A;  3OYN A;  2FBK A;  1UFM A;  4DNC A;  2HVQ A;  1O4X A;  4LJZ F;  3ZQF A;  2A07 F;  4M3D A;  1K79 A;  3ASO H;  2XHK A;  3I0T A;  2E36 A;  1I3Q J;  3K7A J;  4HLY A;  4IEJ A;  1P2F A;  4W97 A;  2VOP A;  2V1X A;  1FBQ A;  4MNU A;  2DA4 A;  4A0Z A;  1L0O C;  4C3H J;  3KP5 A;  2F4I A;  2NS8 A;  4G7O F;  4EJT A;  4FIS A;  5KVR A;  1EV7 A;  4ZZD A;  4ABZ A;  3PL8 A;  2R5Y A;  1WQ2 A;  1KQ0 A;  4B43 A;  3J7Z I;  3OYI A;  4FE7 A;  1XCB A;  3I4P A;  1RR8 C;  1MBG A;  3I54 A;  4XLC A;  1LE8 A;  1OCP A;  1I6H J;  2EIJ H;  2CV2 A;  3P7N A;  2A6T A;  4I0A A;  4BDZ A;  2NRA C;  4PZJ A;  3DP7 A;  2EQR A;  3OOU A;  1PUF A;  1PP8 F;  3QYB A;  1JXS A;  1B72 A;  4A5N A;  1BI1 A;  2FQ3 A;  5M3F J;  2X1D A;  2K40 A;  3DU6 A;  5LBQ A;  2ZSH B;  5DEQ A;  1WFX A;  5EYR A;  3FZV A;  5KCM A;  1A04 A;  4IOC F;  3DCF A;  3E5X A;  2FBH A;  1ZRE A;  3H35 A;  1VTN C;  3QWL A;  4AM3 A;  2HKO A;  1NG6 A;  2DJI A;  4ESF A;  4EGY A;  4ZDP A;  2NNY A;  1WJD A;  4QPO A;  5EDN A;  3KP4 A;  4E6K G;  2A69 F;  2KP6 A;  1P4W A;  3WGH A;  2JRT A;  3WHB A;  1JGS A;  4XK4 A;  3ZCO A;  4IHW A;  2ZJQ F;  4EMS A;  4HQM A;  4E7Z A;  4BXX J;  2PMZ A;  3C18 A;  2AXL A;  2MH9 A;  3VFZ A;  1SAU A;  2VBW A;  4GXO A;  4A3M J;  3M1C A;  2Q0O A;  1YHQ I;  2BY0 A;  2LC2 A;  3FXU A;  3EPZ A;  1IG7 A;  1RUN A;  3C2B A;  2LLK A;  3JRB A;  3NAU A;  1TWF J;  2BE5 F;  3RTR A;  1HKS A;  2XRN A;  3CJR B;  1ZQ3 P;  2P5K A;  1TW2 A;  1Y0N A;  2H09 A;  5JHF A;  3HYI A;  2VXZ A;  2F6C A;  2WB1 A;  2Y0M A;  4BQO A;  2VJ4 A;  4HPQ A;  4DGW B;  5ILU A;  3WTU C;  4NC7 A;  1YW9 A;  3ZMU A;  3LST A;  4L9V A;  2P6S A;  1SEU A;  2E5N A;  3A02 A;  2ZME A;  3BG7 A;  4FX0 A;  5HDG A;  3FHZ A;  3H5R A;  1U0J A;  2GIZ A;  3S8P A;  2GQQ A;  2BHZ A;  2XAJ A;  1MMN A;  4DZJ A;  2X6Y A;  3HOY J;  4IQJ A;  3K2Z A;  3V8J A;  4HV6 A;  1TL8 A;  2KMU A;  1K7A A;  1O7F A;  3ZR8 X;  2W7N A;  3AL0 B;  3C2G A;  3G4S I;  5FLM J;  2D1H A;  4II2 A;  4O5V A;  3KZZ A;  1YX5 A;  3ZQL A;  3P9K A;  4UV9 A;  2COM A;  1H9G A;  2K9S A;  3RYP A;  1MDM A;  2KKO A;  3I9V 2;  4ZTF A;  3L2W A;  2FNA A;  1R4M B;  1WH5 A;  2VQH A;  1RKT A;  3WGG A;  5L3B A;  3SEZ A;  3WTW C;  3A01 B;  5FRO A;  1YIT I;  3G3Z A;  2TDX A;  3QOD A;  2CUJ A;  4HV5 A;  4BYY A;  2JWT A;  3KLN A;  1XSX A;  3X2Q H;  1MSE C;  1ZYR F;  1LEA A;  2H27 A;  3L7W A;  2AHQ A;  2DDA A;  3K4L A;  3KE2 A;  4FCY A;  3CCQ I;  3TO7 A;  3PUF A;  3BC8 A;  4JP0 A;  2DU9 A;  2DPU A;  3K10 A;  2M0M A;  4P9F A;  3SEQ A;  4L5I A;  2R7U A;  5DCM B;  1QA6 A;  5LRS A;  3VWB A;  1OYW A;  3L2V A;  2R5Y B;  2CV0 A;  4GCV A;  3H0D A;  3I71 A;  3DPU A;  2VOO A;  1V54 H;  4LFU A;  4KFC A;  5K5Q A;  4Q4Z F;  1LE8 B;  4ON0 A;  1TLH B;  2EZK A;  3T8T A;  1R6R A;  2XF5 A;  3PM1 A;  4BH9 A;  4XRS A;  5C3E J;  1YO5 C;  4QIW N;  1LQ1 A;  3JRH A;  1PUF B;  4BBR J;  3L00 A;  1B72 B;  4DZP A;  1ORK A;  4ZTJ A;  1FT9 A;  1HDP A;  1KA8 A;  1BW5 A;  2K27 A;  2RNG A;  3CP2 A;  2XKP A;  3FIW A;  3MVP A;  3BQZ A;  2HQR A;  2DI3 A;  2Y2Z A;  2DYS H;  4DW6 A;  1TWH J;  1KYW A;  1ZN2 A;  3CLQ A;  3WTZ A;  2CSO A;  1QRY A;  4XID A;  3CCR I;  2EV6 A;  2OUM A;  4Q48 A;  1MJ9 A;  4GO1 A;  4I7H A;  1HLV A;  4ZH4 F;  2JA5 J;  2WV1 A;  5AIP A;  5E17 F;  2X1E A;  3HKZ N;  2HDW A;  1OLT A;  2VN2 A;  1A5J A;  4RAG A;  1HQC A;  3F6O A;  1FBS A;  2L02 A;  2GWR A;  4V2G A;  1DQU A;  1O7L A;  4BKX A;  5CVI A;  2WBM A;  1S7O A;  4D1Q A;  2XPW A;  2XPV A;  5E1W A;  5CPR B;  3PO2 J;  3HOZ J;  1YS6 A;  3K1P A;  3ULQ B;  2BW3 B;  2IPQ X;  3FXK A;  3SZG A;  4IOA F;  4PJM A;  4BS9 A;  1ERD A;  2CRG A;  3C3W A;  3LWF A;  2YU9 J;  1ONV A;  2KDO A;  4L0Y B;  2BY2 A;  4HAM A;  2G9W A;  4Q5S F;  1OYI A;  2KIM A;  3I56 I;  4RGS A;  3TKY A;  1UST A;  2XRO A;  3L2C A;  1B9M A;  1G3Y A;  3FHN A;  4IL6 C;  1P6R A;  1Y39 A;  2P7C B;  3CCV I;  3WTX C;  3R0J A;  4IHX A;  2KZG A;  3K2A A;  1SMT A;  2ZME B;  1IUY A;  1OCZ H;  3IC7 A;  2EFN A;  4YRV A;  3FXQ A;  4XQF A;  4EQQ A;  1NK2 P;  2EPF A;  1LVK A;  1GT0 C;  3D5L A;  1ZAR A;  1S6L A;  2DFI A;  2LOO A;  2BXY A;  4BY7 J;  4PSW A;  2IGO A;  4ZYA A;  5IT9 Z;  5EZH A;  2UXX A;  1IF1 A;  2J5P A;  1MNM C;  4JK1 X;  4S0H B;  5JI6 A;  3C1D A;  3MZH A;  2K4B A;  4RB0 A;  2HOT A;  2IVM A;  2KIF A;  1L3L A;  1Z77 A;  2AQE A;  4AYB A;  1Y8R B;  5F1J A;  2GOM A;  4AID A;  2EIL H;  3IAM 2;  2NYX A;  1ZK8 A;  2DMP A;  2EFO A;  4AIH A;  4WF2 A;  5LFA A;  5K1Y A;  2DA1 A;  3DXJ F;  2HI3 A;  3ROU A;  3OYC A;  4J01 A;  3EUK L;  3U1D A;  4CCO A;  1ZEL A;  2MLG A;  4IHY A;  4I02 A;  4XKC A;  5LLQ A;  2DA7 A;  2QCO A;  3I5U A;  4AC0 A;  2PFB A;  3HOS A;  3S1M J;  2HZD A;  2M8G X;  1ON1 A;  3FM3 A;  2GA1 A;  2OCC H;  1XGS A;  2QA4 I;  1T08 B;  1WSU A;  1ZR4 A;  1LJ9 A;  2DFF A;  1W5T A;  4PFP A;  5CVJ A;  3BR0 A;  4F55 A;  4RLF A;  1X1D A;  5K7F A;  3IWZ A;  2ME0 A;  2DA5 A;  3MZY A;  2L0K A;  3OYH A;  2VJ5 A;  1QO0 D;  1UZC A;  3H1C A;  4YEL A;  1ENH A;  1J7K A;  2CQ7 A;  3GTQ J;  3PSF A;  2WAF A;  3HRU A;  2HOE A;  5JLX A;  2W82 A;  4HLX A;  4UUS A;  1K4T A;  2PMH A;  4HF1 A;  3KZI C;  3AL0 C;  3TGN A;  4A12 A;  2HPM A;  5K7Z A;  5DYM A;  2QSF X;  4HG2 A;  2HYF A;  4RGX A;  1G3T A;  1YTY A;  3I59 A;  3CCL I;  2K02 A;  5CKT A;  1D1B A;  1Z3Y A;  4P1W A;  1UHS A;  4IZZ A;  1HA8 A;  2XAH A;  4HOB A;  2I8D A;  4E4H A;  4OMY A;  3KZY A;  4XOR A;  1DUX C;  2LBF A;  3DV8 A;  3GYH X;  4LMY A;  4I6Z A;  1B8I A;  1AKH A;  2E2H J;  1FP2 A;  3DKW A;  3DPL C;  2IP2 A;  3R6S A;  2W00 A;  5M5W J;  5E79 C;  1ZLK A;  3LSJ A;  2DJN A;  4A2U A;  1VQP I;  4I98 B;  4MEX F;  3B6C A;  2O5R A;  1FYL A;  1WJC A;  2WV0 A;  2DN0 A;  2NAZ A;  4CXF A;  2X9D A;  3A0H C;  3R60 A;  1JGG A;  3TO9 A;  1WZ2 A;  1J9I A;  3V7C A;  1EKE A;  3I53 A;  4KDP A;  4ETS A;  5J6X A;  4ANJ A;  2HOS A;  3OWT A;  2R4G A;  5J3L A;  3RZD J;  1G3W A;  1H8A C;  2VUM J;  4QPQ A;  2RGV A;  5CQE A;  4I99 C;  1QZY A;  1J75 A;  2ZO4 A;  3HSE A;  4I09 A;  2D5V A;  5E8I A;  1MW7 A;  1G59 A;  1ZG5 A;  1H9T A;  2CG4 A;  3SYT A;  4B47 A;  3G1L A;  3SHF A;  1OCC H;  2MGQ A;  5EJC A;  1UG2 A;  4CSW A;  4NB5 A;  5DV5 A;  2B9S A;  4UXN A;  2L7M P;  2V1N A;  4BHC A;  3HOV J;  5JVG F;  3S1Q J;  1I50 J;  3TW7 A;  1KYZ A;  3OIQ A;  2O7O A;  5E3M A;  4N9H A;  1FOW A;  1N25 A;  1HOM A;  1XD7 A;  3G6E I;  1S9H A;  1GUU A;  3AKZ A;  2HYG D;  2B63 J;  1D1A A;  3RJP A;  4A3L J;  2P8T A;  4P5O A;  2M9H A;  2P0W A;  5HVQ C;  2OA4 A;  2P81 A;  3K4J A;  3HRT A;  1LDD A;  3DWL E;  2O3F A;  3O3K A;  3KYL A;  3ERE D;  2W1O A;  2FUG 2;  3NEU A;  4IHT A;  1R71 A;  1VQM I;  2DA6 A;  2IW5 A;  4J19 A;  3KCC A;  2PBI A;  1X1C A;  3GTM J;  2KFD A;  1SVM A;  1FTZ A;  2E1C A;  2OJE D;  1I1S A;  2QM3 A;  2XUB A;  1SFE A;  4CH7 A;  4A3F J;  4KT6 A;  1HCR A;  4XLF A;  1U2W A;  4KIT B;  1JKQ C;  1G8X A;  2EH3 A;  2EZL A;  1R9T J;  1PVE A;  1VQN I;  2YSR A;  3FKJ A;  2NVU B;  2HDC A;  3SJM A;  1KON A;  3P9I A;  2XAU A;  4X1E A;  3W2A A;  2PJP A;  1EH7 A;  1RES A;  2D45 A;  3F9K A;  1N77 A;  1C0W A;  4QTR A;  3O8H A;  1AHD P;  4HSR A;  3O8G A;  3VSK A;  4O3M A;  2V6C A;  2DT5 A;  1R5H A;  1WJA A;  4BE0 A;  1FIP A;  4BJ5 C;  3J7A Y;  2G7H A;  2HVS A;  3Q5F A;  1YJW I;  2IGK A;  1Z6T A;  3S14 J;  5IT3 A;  2Z2S B;  1JJ6 C;  3E0J B;  4BQN A;  4YII A;  2CV1 A;  4HX8 A;  2L9N A;  4UUS B;  1WRJ A;  3QRF F;  4XLA A;  2K4J A;  1R4N B;  3PSI A;  2JZY A;  3OL3 A;  3SFZ A;  3HEF A;  1TT5 B;  2QZ8 A;  4PJN A;  1ZLJ A;  2FMY A;  5FKL A;  1TWA J;  2ZFW A;  5L3E A;  4MLO A;  1XN7 A;  5IPA A;  1BOB A;  4A93 J;  1FMW A;  3BCB A;  2CO5 A;  1DGR M;  2ECC A;  3CC4 I;  1R5G A;  5HDK A;  4AYB N;  3CF5 F;  3S1N J;  1E3O C;  2FD5 A;  1E3H A;  2W25 A;  1OFC X;  3ZGK A;  5J1U A;  2M87 A;  3E7L A;  1OPC A;  2HTJ A;  2LBF B;  3GTG J;  3M8E A;  3WG9 A;  2ETH A;  1P4A A;  1AKH B;  5K5R A;  3J7Y J;  4RM3 A;  3VPR A;  2R7D A;  2ZCW A;  3GFJ A;  5BMZ A;  3DF8 A;  5D6F A;  3CCU I;  4RBO A;  3R0A A;  4JYK A;  2EK5 A;  2CW8 A;  3DQV C;  1WJF A;  2O9L A;  4G94 A;  3MMY B;  4Y17 A;  1J2X A;  1BR2 A;  2L4A A;  3ML6 A;  2LRE A;  4NC8 A;  4M6V A;  1IRG A;  2XPU A;  5BPD A;  3CJQ B;  4KIB A;  3ZMD A;  2NOJ B;  1JKR C;  2VON A;  5H6R A;  2P4W A;  4A3C J;  3ABL H;  4M3E A;  3JAM Z;  3U2R A;  3E97 A;  4BU2 A;  5J4Y A;  1BI3 A;  3K9T A;  4UB6 C;  2OQR A;  3J80 K;  2JA6 J;  1JUP A;  3OSG A;  2L3D A;  2Z3Y A;  1EH8 A;  1XSV A;  4HA8 A;  3W2W A;  2XGX A;  3K70 D;  5L3D A;  1SD4 A;  4R1H A;  2DFH A;  4UB8 C;  3V8K A;  1TT0 A;  5BS6 A;  1FNN A;  3EUH C;  2B0L A;  2VBX A;  1R1U A;  3VYR B;  1OCR H;  2E71 A;  2LKP A;  3GTP J;  4LOC A;  3CCE I;  3LSK A;  2FML A;  2Y0S N;  4UHT A;  3RDI A;  4NDL A;  2O8X A;  1FP1 D;  4G9Y A;  1BIA A;  4KMU X;  3A01 A;  5DCF A;  5HOD A;  3HIF A;  4V2F A;  3CJN A;  5IY5 H;  3HKZ A;  5D6E A;  3ZMT A;  1YIJ I;  5LHH A;  1LVA A;  3RZO J;  1VQ9 I;  2EJR A;  1XS9 A;  1I5Z A;  2ESN A;  4Y4R A;  5JFR A;  5CJ9 A;  1NTC A;  4F92 B;  3CZ6 A;  2WA0 A;  1W0U A;  2L4M A;  5DDG A;  3MQ0 A;  4G6T B;  5M5X J;  2JPB A;  1H0M A;  2DBB A;  1POG A;  4BNC A;  3K4C A;  5DCM A;  4DYR A;  2DFE A;  5GAE J;  1KU7 A;  3HDD A;  3BZ6 A;  4AU7 A;  1GVJ A;  1RZ4 A;  1J0R A;  2W48 A;  1K83 J;  2FOK A;  2FQ4 A;  3PJR A;  4ZYD A;  3JRG A;  1IUF A;  1MBK A;  5GP9 A;  4LG0 A;  2RDP A;  2BHY A;  3BG5 A;  4IRH A;  4YIR X;  4XON A;  4BE2 A;  4ZYH A;  2RQP A;  1XPX A;  2X4H A;  5GTH C;  1WH7 A;  3BPV A;  5E3L A;  1G4D A;  4II3 A;  2R7Z J;  2MA3 A;  4CYC A;  2RNJ A;  1FZP B;  4KYW A;  1S7E A;  3HGG A;  3H92 A;  1JUM A;  2VJJ A;  1IN7 A;  4D7M A;  3ABM H;  1IC8 A;  1SC7 A;  3VSL A;  1RET A;  2WWY A;  4ENN A;  2YX7 A;  3JRE A;  3M7G A;  4L0Z B;  2XGC A;  3I58 A;  3S3N A;  1HST A;  3WTT C;  4L9N A;  1YYV A;  1TQP A;  3B02 A;  5F6F A;  4A6D A;  4DQ2 A;  3G2B A;  5IYC J;  2JA8 J;  1JT6 A;  2MC4 A;  2R3S A;  4IKF A;  3ABT A;  2ZJ2 A;  1D0Z A;  4M71 A;  3GO5 A;  3I4N J;  4WXH A;  2F5V A;  2X1C A;  4GGG A;  1U3E M;  1RUO A;  5IYB J;  1MMD A;  3GF2 A;  4YFK F;  2JMW A;  2EIN H;  3UNG C;  4AIK A;  4D7N A;  1R36 A;  2LF8 A;  3KP3 A;  3K69 A;  1KQ8 A;  4O6J A;  5ICG A;  3DFG A;  1XGM A;  1O3S A;  4XSX F;  5C4X J;  1MBH A;  1N75 A;  2M2E A;  2C6Y A;  2GA2 A;  4A3D J;  1F9N A;  1MJA A;  1DPU A;  1IXS B;  1UCR A;  4EJV A;  1Y1W J;  2Z16 A;  4M3B A;  4TV7 A;  2VB6 A;  3QP5 A;  4HEA 2;  3JRF A;  2LNB A;  4YEJ A;  1Z9C A;  3ZQG A;  3LSP A;  3HSR A;  2CFO A;  3H9Q A;  1GV2 A;  1SD7 A;  2BW3 A;  2LY2 A;  1OR7 A;  3RQI A;  4OIQ F;  2DYR H;  2JRM A;  3ESW B;  4I76 A;  4B3X A;  4BGD A;  5J47 A;  3E6B A;  4OIO F;  1V5G A;  3V7S A;  5EZG A;  2LFB A;  2W4S A;  2VPR A;  1UG0 A;  3VDX A;  1U78 A;  3QPL A;  4E70 A;  5KAF C;  4FE4 A;  1ZR2 A;  4EV0 A;  3HZJ A;  2COB A;  3BR1 A;  2WAE A;  3U9G A;  4KT5 C;  4ZJZ A;  3BLY A;  3GLX A;  3RKW A;  1JTX A;  2R7V A;  2OF7 A;  3VB2 A;  4L9T A;  3A0B C;  1VFC A;  1HBX G;  1VQ4 I;  5M3M J;  2EA4 A;  3KFW X;  2MD5 A;  4HNU A;  1IAW A;  5F08 A;  2GIV A;  2AO9 A;  3NWS A;  5ERI A;  4U0Y A;  4ESB A;  4ENJ A;  4M9S A;  1F1Z A;  3Q3S A;  2P5V A;  2Y9Z A;  1MSF C;  3RIR A;  5J8F A;  2MG4 A;  5HNF A;  4N4O B;  3DEW A;  5AON A;  4ESJ A;  2TCT A;  2LY1 A;  5TIS C;  1U5T A;  3M3Y J;  5LEJ A;  4IPA A;  4U0V A;  4FT8 A;  2ISZ A;  3DTI A;  3H5A A;  2MC3 A;  3QYF A;  4N9I A;  2A68 F;  4Y7N J;  3HM5 A;  4HQE A;  3GTJ J;  2OZ6 A;  2FF4 A;  2FX0 A;  4U7B A;  3WE3 A;  4BJ6 C;  4KN7 X;  3QPH A;  1BC8 C;  1TC3 C;  2ECB A;  3SXY A;  2HZT A;  2K5C A;  3B6A A;  3PIP F;  3WTV C;  4IQ4 A;  1LPQ A;  2HFH A;  2W24 A;  2CQQ A;  4CCJ A;  5J4V A;  3I55 I;  3PNV A;  5EF6 A;  4GDF A;  1X1P A;  4A3E J;  1D5V A;  2Y69 H;  5EEA A;  4D0P A;  2V1U A;  1LKX A;  1B59 A;  2WAQ N;  4EJU A;  3GZ6 A;  2RN7 A;  4ZC3 A;  1WI3 A;  3FXO A;  1WJE A;  5LGU A;  2YPR A;  3BR3 A;  3BQY A;  2KIS A;  3ABK H;  5B3S H;  3P5J A;  4M3F A;  4OMZ A;  3CLO A;  4LG0 B;  2KDZ A;  4CCN A;  3S16 J;  2R7F A;  2H8R A;  4B1R A;  3WU0 A;  2L9S A;  4JX4 A;  4C3I J;  3ZXS A;  4BXF A;  1T38 A;  2NS0 A;  1FTT A;  2P6T A;  3LSG A;  1X2N A;  4CYC B;  4BAC A;  4XKW A;  1TQM A;  1MKM A;  2F5E A;  1FOY A;  1T0F A;  4HW0 A;  3U21 A;  3HPH A;  5HLH A;  3S2H J;  1XDS A;  1Z6R A;  5LEK A;  4OIN F;  1XC5 A;  3A03 A;  1YRN B;  4Y33 A;  3I4M J;  1S7A A;  2MBF A;  1JKO C;  3BG9 A;  2IA1 A;  4A6E A;  3HG9 A;  2QQA A;  5L3G A;  1MMA A;  1ETV A;  3M07 A;  2VIX A;  2DW4 A;  2O61 A;  3F8F A;  2CQK A;  3J81 K;  2X51 A;  3ZQH A;  4LK0 F;  3RQ4 A;  3MEX A;  2EIK H;  2DA3 A;  3O2P E;  3GZ5 A;  1MBF A;  2E19 A;  2Z99 A;  3RPU D;  4M74 A;  3PNT A;  4G8X A;  3H9G A;  2PJR A;  2VOD A;  1YE9 A;  2EFW A;  3PO3 J;  3F23 A;  3H5N A;  3CO6 C;  2WY7 Q;  3GUD A;  2XGD A;  5D8K B;  2XAS A;  4A5M A;  1BI2 A;  2ZXI A;  3OYK A;  1S72 I;  4OIR F;  3E5U A;  3V4G A;  4RGU A;  1BJA A;  3JSP A;  3KEQ A;  2E7W A;  4NHJ A;  3GTO J;  5DM6 F;  3GTL J;  3COA C;  3LOC A;  1SFU A;  2K9Q A;  3OMY A;  4IRI A;  4CGZ A;  1U8R A;  2UZK A;  1UHM A;  2KQR A;  4MO7 A;  3IV5 A;  3CF2 A;  1RPW A;  3QOP A;  2H1K A;  4IJA A;  1XX5 A;  3QYE A;  3F8B A;  2R93 J;  3BP8 A;  4CDG A;  1QVT A;  3BTC A;  2Z1D A;  4H0E A;  5L3C A;  2E7X A;  2EWN A;  1P92 A;  1W0T A;  1BC7 C;  3B73 A;  3AFH A;  4OU0 A;  3S32 A;  3IKV A;  2O8K A;  1IN5 A;  3KIO A;  1SFK A;  2JK3 A;  2ID6 A;  4KN4 X;  2H8W A;  2XVC A;  1GXQ A;  2LTP A;  5B5E C;  1J09 A;  3W6K B;  3PNY A;  1KU3 A;  2DLL A;  2X0L A;  1FJL A;  2DMU A;  2Y9Y A;  5FLV A;  1IN4 A;  1W36 C;  4XLH A;  1FC3 A;  2CMP A;  1M1E B;  3SQN A;  4BHP A;  1LNW A;  5D5X B;  4IO9 F;  2W57 A;  4ENK A;  1BW6 A;  3EDP A;  1GV5 A;  4G6Q A;  4V19 K;  1K6Y A;  1WJB A;  3OS0 A;  4D5F A;  4ZZL A;  3G1O A;  3S1R J;  3NRV A;  2R5Z A;  2KJC A;  3KX2 A;  1U5T B;  3NQO A;  2ID3 A;  4UVB A;  5KK1 A;  2NXN B;  2IS6 A;  2I10 A;  5ICC A;  1MMS A;  3DU5 A;  4KJZ A;  3OOP A;  4R8H A;  3HUG A;  1U6G A;  4BL0 B;  5FRN A;  4DBR A;  2E1M B;  2XB5 A;  3MKZ A;  2HTS A;  4I01 A;  4CCM A;  3A4C A;  2CGP A;  3G1M A;  4L5E A;  1Z67 A;  3S93 A;  2STW A;  4UY8 I;  4RMN A;  1SAN A;  3MAJ A;  1SFX A;  2DQR A;  3LQR A;  1XTA A;  2F4O B;  1ULY A;  3BT9 A;  4IXA A;  1A31 A;  2L7K A;  4LG3 A;  5AIQ A;  1U9O A;  4LIT A;  1EA3 A;  1ZGW A;  2D1V A;  4XOP A;  2Z9O A;  2R92 J;  2PEX A;  3QPS A;  5A2Q K;  3BTJ A;  3F0C A;  1ON2 A;  3TP0 A;  1B6A A;  2M7A A;  3Q0U A;  2PX9 A;  1A6Q A;  1HW1 A;  4NUB A;  2LH9 A;  1YI2 I;  4UNO A;  3BG6 A;  2M7B A;  3M1E A;  2Z33 A;  4HDU A;  1A36 A;  5J8C A;  3ELK A;  1R7J A;  2M34 A;  1Z21 A;  3Q9S A;  4A0X A;  4Y3O A;  1KZH A;  3V7R A;  2K85 A;  5FJ8 J;  4HDV A;  1ITY A;  4M9X A;  3HTU A;  2Y0S A;  3JR9 A;  2IEK A;  2CUZ A;  1OKR A;  3OYA A;  2K9N A;  5BQT A;  1Q1V A;  3BY6 A;  5JR3 A;  3IHU A;  1BI0 A;  2LD5 A;  4H4K C;  3GFL A;  3OV8 A;  2DPD A;  3HRS A;  4N4N B;  3K4B A;  4LB6 B;  3ZPL A;  5GAG J;  4PGH A;  2XF6 A;  5J40 A;  2QSH X;  1F43 A;  3K0L A;  2W84 A;  2OC6 A;  4A3J J;  4RB3 C;  3HBL A;  2RC4 A;  2VT2 A;  4A3B J;  1ETK A;  3RYR A;  4IF4 A;  5CVV A;  5K5O A;  4MTD A;  4F52 A;  1A6I A;  2GBY A;  2VQL A;  4A3G J;  1APL C;  4M72 A;  4BQQ A;  4A3I J;  2PJR B;  1HKT A;  1FX7 A;  3SDB A;  3TOB A;  3RPU A;  3GW2 A;  4AVP A;  2DOF A;  3H3V K;  2R7T A;  4I2O A;  4IVN A;  2FRH A;  2IS2 A;  2QQ8 A;  2PQ8 A;  1BM9 A;  1R1T A;  3AAF A;  4GFB A;  2YR2 A;  3HC7 A;  3ABU A;  2AS5 F;  5FKM A;  3Q0W A;  1XGO A;  4KIF A;  3ZMS A;  2MYS A;  2CFX A;  1FBU A;  1IZ1 A;  2GAU A;  1P4X A;  2LDU A;  1SVL A;  5M5Y J;  3J7A O;  1YIO A;  3S2D J;  1PUE E;  4CA0 A;  2Z5U A;  2BEO A;  2O0Y A;  3ECH A;  1X58 A;  2V9V A;  2UUZ A;  2V9K A;  3GME A;  1TTY A;  3KLO A;  4N0B A;  3DEE A;  4UVA A;  2Q8K A;  4BJT A;  5ILV A;  3QPT A;  5LHI A;  3OYE A;  4MQ9 F;  5HLT A;  4C2U A;  3JTG A;  2BZT A;  4WK8 F;  2RKH A;  2VC0 A;  1EJ9 A;  1DP7 P;  3GZN B;  2VI6 A;  3DTE A;  2DMT A;  3VOD A;  2JTV A;  3ONQ A;  1DP3 A;  1R1V A;  3AG1 H;  5EGO A;  2BYV E;  2ACJ A;  3EYI A;  4Q47 A;  2XB0 X;  1ETQ A;  1QU3 A;  1K78 A;  2A5Y B;  3K4K A;  5DUK A;  2HQA A;  3KEO A;  2PMU A;  3DLL F;  2V4J C;  2MW8 A;  1BR1 A;  3D0S A;  3NWT A;  3CUQ A;  2R5Z B;  4HBL A;  2G7U A;  3L2R A;  1KU2 A;  2MFZ A;  3H9J A;  3L09 A;  2DAO A;  3MKL A;  3IP4 B;  2JJ7 A;  3LMM A;  1AU7 A;  4XNF A;  3TED A;  1SVO A;  3HUG B;  2MSY A;  2UXN A;  2GZW A;  4E7S A;  2PG4 A;  5BNG A;  2DOA A;  4ZYG A;  4WCG A;  1QVU A;  3A2K A;  1OR7 C;  1QHG A;  1VI0 A;  3FBI B;  4G7H F;  1JHF A;  4C9Y A;  1JT0 A; 
#chains in the Genus database with same CATH homology
 4FCY A;  5IP6 A;  1FEX A;  2PMZ N;  1K83 J;  2W48 A;  3TW6 A;  2FQ4 A;  5F0H A;  1BA5 A;  4JP0 A;  2DA2 A;  2NOG A;  1ETW A;  3JRG A;  5FKO A;  1IUF A;  1MBK A;  5GP9 A;  3BR6 A;  3BG5 A;  2DMQ A;  5FKK A;  5C44 J;  3JRD A;  2LKX A;  1WH7 A;  2R5Y B;  5E3L A;  5EG0 A;  1G2H A;  2R7Z J;  4RDU A;  4CYC A;  2WB1 N;  1S7E A;  3HGG A;  1JUM A;  4D7M A;  1DU6 A;  1IC8 A;  2YUS A;  4FTH A;  1RET A;  3H0G J;  2CUE A;  3JRE A;  2DMN A;  1LE8 B;  2N8G A;  2LP0 A;  2XGC A;  2EZK A;  1WGX A;  3PM1 A;  1X2M A;  4XRS A;  1IDZ A;  1ETY A;  5C3E J;  4QIW N;  5IYC J;  2JA8 J;  3JRH A;  1JT6 A;  1PUF B;  4BBR J;  2G0E A;  1B72 B;  4DZP A;  1ORK A;  1WCM J;  3CMY A;  1HDP A;  1TWC J;  4HNV A;  1BW5 A;  3FIW A;  2E2I J;  3MVP A;  3I4N J;  1H89 C;  3BQZ A;  2LY9 A;  2L7Z A;  5IYB J;  3ZOB A;  3LSR A;  2JMW A;  2Y2Z A;  4DW6 A;  5C4J J;  1TWH J;  4D7N A;  2VKV A;  5J1Y A;  4IHV A;  4XID A;  1QRY A;  5C4X J;  1MBH A;  2M2E A;  4A3D J;  1Y1W J;  4BY1 J;  1HLV A;  4M3B A;  2OPT A;  5GPC A;  3JRF A;  2JA5 J;  4W1U A;  2WV1 A;  2JN6 A;  3ZQC A;  2KT0 A;  3ZQG A;  3HKZ N;  3LSP A;  5JLW A;  1GV2 A;  1A5J A;  3RQI A;  2X48 A;  4V2G A;  4I76 A;  3CQZ J;  2HDD A;  2VKE A;  2Y31 A;  4BKX A;  2XPW A;  2XPV A;  2E2J J;  3HOZ J;  3PO2 J;  2LK2 A;  2NVQ J;  5EZG A;  2LFB A;  2CRG A;  2VPR A;  2NVX J;  2YU9 J;  3HOW J;  1U78 A;  2FJ1 A;  3QPL A;  2GM4 A;  1TWG J;  4FE4 A;  3JRI A;  2DTZ A;  1ZR2 A;  1GDT A;  2COB A;  3BR1 A;  1BL0 A;  1IV6 A;  1JTX A;  5F27 A;  2OF7 A;  1Z0X A;  3FKI J;  1VFC A;  3RKQ A;  1NK3 P;  5M3M J;  4IHX A;  3K2A A;  3D1N I;  5F08 A;  2AO9 A;  3UKG A;  1NK2 P;  2ZB9 A;  3Q3S A;  5J1R A;  2Y9Z A;  1MSF C;  1GT0 C;  2MG4 A;  3S17 J;  3DEW A;  4BY7 J;  2TCT A;  3M3Y J;  5EZH A;  2IBD A;  3OIO A;  3IH3 A;  5F0F A;  5EGO B;  1MNM C;  3CCY A;  4S0H B;  1LFU P;  2HOT A;  1ZKG A;  1Z77 A;  5F1J A;  4EEF G;  1MH3 A;  4Y7N J;  3HM5 A;  3GTJ J;  3FK7 A;  2CUF A;  2FX0 A;  1ZK8 A;  2DMP A;  4XIC A;  3BG3 A;  1TC3 C;  3FK6 A;  2ECB A;  2CQX A;  3B6A A;  2DA1 A;  2HI3 A;  1K61 A;  1P7J A;  3BR2 A;  3SFI A;  4MFE A;  2CQQ A;  4IHY A;  1HF0 A;  2DA7 A;  2QCO A;  4AC0 A;  2YS9 A;  5EF6 A;  4A3E J;  3S1M J;  3W6V A;  5EEA A;  1U8B A;  1XG1 A;  2WAQ N;  2M8G X;  1WI3 A;  3BR3 A;  1BJZ A;  1MBE A;  3BQY A;  1ZR4 A;  3ZQI A;  1JUS A;  4M3F A;  5FKN A;  4C3J J;  2X6O A;  3GTK J;  2KDZ A;  3BR0 A;  3S16 J;  4DYC A;  2H8R A;  1GVD A;  2CJJ A;  4B1R A;  1MH4 A;  5K7F A;  2ME0 A;  2DA5 A;  4JX4 A;  4C3I J;  1JJ8 C;  5F0C A;  1T56 A;  2L0K A;  1DU0 A;  1ETO A;  1RKW A;  1YRN A;  1FTT A;  3LSG A;  5EG0 B;  1X2N A;  1ENH A;  4CYC B;  3GTQ J;  2JA7 J;  4XRS G;  1IGN A;  1H88 C;  5JLX A;  4UUS A;  3S2H J;  3SDG A;  1JTY A;  1YRN B;  1XC5 A;  3A03 A;  5IOY A;  3I4M J;  1JKO C;  3BG9 A;  5K7Z A;  1ETV A;  4DYQ A;  3ZQH A;  1ETX A;  3IH4 A;  3HOU J;  1IRZ A;  1UHS A;  2DA3 A;  5K7H A;  4A3K J;  1MBF A;  2E19 A;  4Y52 J;  1U9N A;  4I6Z A;  1B8I A;  1AKH A;  2E2H J;  3PO3 J;  3M4O J;  2R0Q C;  5M5W J;  2XGD A;  1F36 A;  3LSJ A;  2DJN A;  3HGY A;  3B6C A;  1RR7 A;  1B8I B;  2HXI A;  3GTO J;  3L1P A;  3GTL J;  2LR8 A;  3LOC A;  2DN0 A;  3FIS A;  2HYJ A;  1WPK A;  5GPA A;  2X9D A;  2K9Q A;  1VF9 A;  1JGG A;  4AUX A;  4MO7 A;  3IV5 A;  1D5Y A;  2HOS A;  1VND A;  5E3N A;  1RPW A;  5J3L A;  2H1K A;  3RZD J;  3QQA A;  2R93 J;  2Y30 A;  1QVT A;  1H8A C;  2VUM J;  3BTC A;  5DTD A;  1OCT C;  4MIM A;  2ME6 A;  1W0T A;  2D5V A;  4M3G A;  2O8K A;  3G1L A;  2MGQ A;  1UG2 A;  2JK3 A;  2LVS A;  2E1O A;  2ID6 A;  3BTI A;  2L7M P;  4A69 C;  2QF7 A;  2XRL A;  2LTP A;  3HOV J;  3S1Q J;  1I50 J;  3TW7 A;  2O7O A;  5E3M A;  1FJL A;  2DMU A;  2Y9Y A;  5FLV A;  1HOM A;  2XSD C;  1BW6 A;  1GV5 A;  1GUU A;  3HOX J;  4D5F A;  3G1O A;  3JRC A;  3S1R J;  5IP9 J;  2R5Z A;  2B63 J;  2ID3 A;  4MFD A;  4A3L J;  2M9H A;  3NAR A;  2CU7 A;  2P81 A;  4QSH A;  2I10 A;  5IP7 J;  3OSF A;  2L9R A;  2XB5 A;  2DA6 A;  2M0C A;  4J19 A;  1O4X A;  3ZQF A;  3GTM J;  1FTZ A;  4M3D A;  4BBS J;  3LNQ A;  1I3Q J;  3G1M A;  3K7A J;  4C2M J;  4IEJ A;  4L5E A;  4W97 A;  1HDD C;  4A3F J;  2DA4 A;  1HCR A;  1SAN A;  4C3H J;  1JKQ C;  2EH3 A;  2EZL A;  2NS8 A;  1R9T J;  2HQ5 A;  3SJM A;  3BT9 A;  3IH2 A;  4D5C A;  4FIS A;  4X1E A;  1RES A;  1U9O A;  2NVY J;  4ABZ A;  1ZGW A;  2EZH A;  2R92 J;  2R5Y A;  2L7F P;  4QTR A;  3O8H A;  3QPS A;  1AHD P;  3BTJ A;  3F0C A;  3TP0 A;  1JKP C;  4FE7 A;  3O8G A;  3Q0U A;  1MBG A;  1LE8 A;  1FIP A;  1OCP A;  1I6H J;  1UMQ A;  3BTL A;  2M34 A;  5DS9 A;  3S14 J;  2EQR A;  3OOU A;  1JJ6 C;  1PUF A;  5FJ8 J;  1B72 A;  3S15 J;  1ITY A;  3JR9 A;  5M3F J;  2IEK A;  4UUS B;  2K9N A;  1Q1V A;  2K40 A;  5EYR A;  2LD5 A;  3DCF A;  3HEF A;  1CQT A;  5FKL A;  1TWA J;  2NVT J;  1F43 A;  4MLO A;  1FIA A;  2HOA A;  5IPA A;  4A93 J;  2NS7 A;  5EDN A;  4A3J J;  2ECC A;  3HBL A;  5IYD J;  2TRT A;  4AYB N;  3S1N J;  2EBI A;  2FD5 A;  1E3O C;  1QPI A;  1OFC X;  1ETK A;  5J1U A;  3BR5 A;  3WHB A;  3Q0V A;  4A3B J;  3E7L A;  4XK4 A;  4IHW A;  1OJL A;  2EZI A;  3GTG J;  1A6I A;  2GBY A;  4A3G J;  3HB9 A;  1APL C;  1AKH B;  2IAI A;  4A3I J;  4B4C A;  3VPR A;  4BXX J;  1IDY A;  1EF4 A;  4JX6 A;  1IJW C;  3H3V K;  4A3M J;  4RBO A;  4JYK A;  3JRA A;  3CDL A;  1IG7 A;  3HDD A;  4GFB A;  4B3A A;  3C2B A;  2LLK A;  3JRB A;  2O9L A;  3MN2 A;  1TWF J;  3NAU A;  2XGE A;  5FKM A;  3Q0W A;  1ZQ3 P;  1SFO J;  4G12 A;  4M6V A;  2XPU A;  5M5Y J;  3S2D J;  1JKR C;  4A3C J;  1T33 A;  1Y1V J;  4M3E A;  2ELK A;  4XRM A;  1X58 A;  3A02 A;  2JA6 J;  1JUP A;  3OSG A;  5E3O A;  1MBJ A;  4X6A J;  4DZJ A;  3HOY J;  9ANT A;  2VI6 A;  2DMT A;  3TP3 A;  5F04 A;  1LFB A;  5EGO A;  5FLM J;  3GTP J;  4LOC A;  2GLO A;  2XB0 X;  1ETQ A;  3ZQL A;  2Y0S N;  4NDL A;  3A01 A;  3WHC A;  2K9S A;  2MW8 A;  5HOD A;  2R5Z B;  4V2F A;  3RZO J;  1P7I A;  2HXO A;  1XS9 A;  3MKL A;  2JJ7 A;  4JX5 A;  1WH5 A;  1RKT A;  3A01 B;  1AU7 A;  3TED A;  2MSY A;  1NTC A;  2RAE A;  5IOZ A;  1W0U A;  5BNG A;  2JWT A;  1QVU A;  5M5X J;  1MSE C;  1VI0 A;  1POG A;  3GBG A;  2AHQ A;  4DYR A;  4UUT A;  1JT0 A;  1ZTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...