2KIUA

Solution structure and backbone dynamics of the dna-binding domain of foxp1: insight into its domain swapping
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
AEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFPYFRRNAATWKNAVRHNLSLHKYFVRVENVKGAVWTVDEVEFQKRRPQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Forkhead box protein P1
publication title Solution structure and backbone dynamics of the DNA-binding domain of FOXP1: Insight into its domain swapping and DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2009-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kiuA00
4P96A 4EJUA 2O3FA 3T0YA 5BPDA 4HA8A 4I09A 2HYGD 2KJBA 2VBWA 3P9CA 2QZ8A 1F4KA 3HOTA 3PQKA 3DPTA 5CVUA 1KGSA 3LQQA 5DD8A 1EV7A 4G7HF 2JZYA 1NHAA 5FLXK 4KIGA 3V8LA 4MTEA 1W7PB 3RKWA 3OV8A 4LLGF 1FNNA 4YFKF 5DV5A 2BEOA 4R8HA 1XGSA 3R60A 1R1TA 3MAJA 2QQBA 3K69A 4AIJA 1T0FA 5CVIA 4OIRF 1BI3A 4UVCA 1O7FA 1SMYF 1BBYA 3HOSA 1B4AA 4G7ZF 4ZYDA 1FZPB 1IN7A 1L3LA 5LRSA 2KRFA 2Y75A 1Z91A 4QLCU 4HYEA 2PEXA 1XB4A 2Z5UA 3K2ZA 1OMIA 3P9IA 2W85A 2EB7A 4MEYF 1MZBA 4CYDA 3GZ6A 3CJNA 5DEQA 2CYYA 4FX0A 1U8RA 2P5VA 5IT9Z 5ED4A 2L4MA 4UV8A 4LG0B 3WTTC 3LSTA 4G9YA 4OIQF 5K5OA 3PQJA 3B73A 2VT3A 4ENNA 1HW2A 2YU3A 4M73A 2PJPA 2DU9A 4E70A 2HDCA 3W6JB 3RIRA 1S29A 1Y0UA 4KMUX 4QWQA 5L3CA 3V8JA 3GFLA 3M1EA 5ILUA 3ML6A 4LK1F 3BP8A 2XIGA 2XAFA 1IZ1A 2O61A 1E17A 4JK1X 1T39A 2IA2A 1UHWA 2JSCA 2FSWA 1KU2A 5L3DA 2EV0A 4PCQA 5HVQC 2XVCA 2Z9OA 4L5JA 1ZAOA 2LKPA 1YW9A 3FHZA 1F5TA 1R1VA 1TLHB 4RB2C 1XCVA 4MNUA 5A2QK 5HDGA 2A5YB 1P92A 1J75A 2COMA 1OPCA 3BROA 2PI0A 4IJAA 4P55A 2L4AA 2R3SA 2VC0A 3VODA 2LNBA 3KP7A 4YG2F 5J8CA 4M72A 1PUEE 1R22A 5LHGA 3L00A 4I0AA 2VODA 5L3BA 4XBFA 1ZG3A 2LSOA 3GW2A 1HKTA 5F1RA 1G6NA 1HQCA 1U5TB 3L9FA 3VB2A 2D1HA 1X3UA 5ICFA 4HLYA 1QBJA 4TV7A 3DEUA 4M9ZA 2GA1A 5IT3A 3WU1B 3K1PA 2P6TA 5CYVA 1IN6A 1Z9CA 3ELKA 4OMYA 2DQRA 1U2WA 3F6VA 4RB0A 3TDUC 1DPUA 2VBZA 1KA8A 1ZGJA 3K0LA 3HHGA 1W5TA 1HW1A 4RB1A 2C6YA 4A6DA 2ELHA 1XN7A 4ESJA 3IWFA 3G73A 1IRGA 2RV8A 3Q9VA 2O03A 2XUBA 1B6AA 4M6XA 5BOXA 3FMRA 1W7PA 4L18B 3JTHA 1MD0A 4R1HA 2DT5A 3T8TA 1ZN2A 2PBIA 4ENMA 3JAMK 1C0WA 3JTGA 4I98B 3GXOA 1LQ1A 3E97A 1H0MA 2MH9A 4CGZA 2RGVA 4UNOA 2PLYA 5AIQA 4Y17A 4ZYGA 4OINF 5LRRA 2IP2A 5FD5A 2QBYB 2YPRA 5CVRA 3O6BB 4A6EA 5D8KB 3IRRA 4KN4X 2KKOA 2K86A 2D2WA 3RYRA 1SFXA 4ZZDA 3SZTA 4ZYHA 2CFXA 4MGRA 2GWRA 4OU0A 1P4WA 3V4GA 2NNYA 3ISPA 4M9SA 1A04A 3R61A 3VEPA 1EH7A 1G3SA 4MQ9F 3TDZC 4O6JA 3BPVA 1L0OC 1J5YA 2HKOA 4XRFA 2QQAA 5DYMA 5E8GA 2Y48A 3SFZA 5FB2A 3IC7A 4Y13A 4PGGA 3HRMA 3LQRA 3ZMTA 1KU7A 1Z6RA 1UB9A 3T1BA 5HLHA 2FF4A 2NNNA 4BHPA 2L54A 1B9NA 3F22A 1R7JA 4EM1A 2FNAA 4PZJA 5TRDA 1T6SA 1D5VA 1OR7A 3FMQA 4ENJA 1FC3A 1DDNA 2BV6A 3IWZA 2XAGA 1QGPA 3BWGA 2R7DA 3HTSB 1S6LA 3ULQB 4N9HA 1P4XA 4IRHA 2DI3A 2TDXA 4AWXB 4L0ZB 1RUOA 2J5OA 5AONA 2OD5A 3ECHA 3SXYA 4G6QA 3I53A 4KN7X 2YX7A 4Y15A 3E6DA 1IXRC 3BDDA 3HSEA 4U0WA 4AVPA 2FBHA 2LF7A 4HOBA 3BOQA 2MLGA 1TQPA 2QENA 4A5NA 4WF2A 5CVVA 4ENKA 1JHFA 2MBFA 4GGGA 2E7XA 5ICGA 4RGRA 2VBXA 5KVRA 1BI0A 2V79A 3KZYA 2A6HF 3QPTA 1S7AA 5J6XA 1K78B 3D0SA 5H6QA 4EGZA 3HTUA 3DKWA 1KYZA 3TGNA 5D4SA 2QQ9A 1OYYA 3BZ6A 2EFWA 3K9TA 1LB2A 4L9NA 1V4RA 5HDKA 1KQ9A 1FYLA 4N9IA 5L3EA 3E6MA 2W24A 1SAXA 3VOEA 2OBPA 1UHMA 2UWMA 2ADUA 2NAZA 3FXUA 1J59A 1O3QA 4DNCA 4CO8A 3IKVA 2ZKZA 1W5SA 2DK8A 3KE2A 2Q2EA 2ESNA 3GFIA 2KIMA 4U7DA 1VTNC 1O57A 2GQQA 3WTVC 3J7AO 4MTDA 1B9MA 1XSXA 2EV6A 2HYFA 1O7LA 2H09A 3EUHA 3MQ0A 2P5KA 1ON2A 1ZG5A 1IW7F 4H0EA 4GYGA 3REOA 2GAUA 1S3JA 2HR3A 3IHUA 2FOKA 3V7RA 1W4MA 2FMYA 4HF1A 3C3WA 3L2CA 2CWEA 5D6EA 4OOIA 1LEBA 3RPUA 5J8FA 5ILSA 2QBYA 5E1WA 3F72A 5DUKA 2DK5A 2MC3A 5K5RA 1H9TA 4JBAA 1G3TA 1K79A 3TOAA 1EH6A 1KU3A 3F8NA 4IHSA 4HW0A 4IPAA 3QOPA 2DPUA 4BQAA 2HKXA 4LLNA 2OA4A 2G7HA 1D8JA 3F8MA 1ZLKA 1XCBA 2XROA 5CVJA 1FWZA 2RNJA 2CQKA 1CF7A 3BJAA 2EWNA 2FQ3A 1OYIA 4XSZF 3TO9A 5E17F 5E18F 5DDGA 2YX4A 1PP7U 1FPQA 3BJOA 3LAJA 4I7HA 2HS5A 5DD4A 3I59B 1GHCA 5DCFA 1BIBA 3T8RA 1SD4A 1IAWA 5D5XB 4WXHA 2DLLA 2FA5A 1Q1HA 1MJBA 1FY7A 1SD6A 1KU9A 2HQNA 1LVAA 3LWFA 3CUQC 1MJAA 5HOOA 4LMYA 2STWA 2W25A 2DFIA 4RB3C 2RKHA 1YYVA 1TQMA 3JSPA 4U0VA 2XAJA 3KETA 4A12A 3KP5A 3ZP5A 4P9UA 5E20A 2OQRA 2FU4A 1LJ9A 1P6RA 1FLIA 4GYIA 4KA4A 2IA0A 2A69F 2NYXA 2D45A 4XLPF 4I2OA 3H92A 3H3ZA 3O3KA 1YTYA 3VFZA 4KIBA 3WGHA 2HWVA 1K78A 1V3FA 4GO1A 5FO5A 1F9NA 2ZMEA 3GX4X 5HDNA 5FD6A 1IXSB 2PFBA 4UVAA 4UUVA 2IVMA 1CGPA 4PGHA 3WTUC 3E5UA 5EEGA 4HDUA 2CW0F 5K1YA 2K4BA 2PG4A 1T98A 2LDUA 1FBSA 1GXPA 2ZNZA 4L5IA 3IKTA 4KYWA 2E1NA 2ZCWA 4BXUA 3SQNA 4WWCA 4Q5SF 1BI1A 3HYIA 1DPRA 3E5XA 1QNTA 4CHUA 1S8NA 2O6GE 3MCZA 3TOBA 1B59A 2QUFA 2Q8KA 3ABTA 3LFKA 3DQVC 2NRAC 4YIFA 4I02A 1TQIA 3WTWC 3GFMA 2VOPA 1BI2A 2EFOA 3WTZA 5FLXZ 3B02A 2EA4A 3KFWX 5JHUA 2WTEA 4HDVA 2M5WA 1GVJA 1TNTA 5ICEA 2HZTA 4L9JA 2D1VA 1ZRFA 1KQ8A 1UFMA 4P9FA 4XLNF 4I01A 1U78A 1MGTA 5D6FA 2K4JA 3FM3A 4OMZA 2VC1A 1HKQA 2RC4A 4A0XA 2K02A 2A07F 4HZFA 2FEZA 3RJPA 1WQ2A 2M45A 3EDPA 1HW5A 4A2UA 3KCCA 4L9VA 1WWXA 3DXJF 3PFIA 4KDPA 5L3GA 2KIFA 4ASNA 1R1UA 1REPC 3GZ5A 4MHGA 1ZYRF 1I27A 1JGSA 5D8LB 3AAFA 2ISYA 2STTA 3I59A 2RDPA 3COAC 3NRVA 3FM5A 2IRFG 3RTRA 3M9AA 1G3WA 2V1XA 5FFXA 3DP7A 1Z7UA 5E1ZB 1FSEA 2EA2A 2HTSA 4LB6B 5LEKA 4IRGA 1CF7B 1WRJA 5L3FA 1XSDA 3KLNA 2M30A 4HF0A 3ZMUA 2XRNA 3KP3A 3V7SA 2IT0A 2V9VA 2QWWA 3O2PE 3TO7A 3RI4A 1QQIA 2V1UA 2XV4S 3P7NA 3GLXA 2BYVE 3HRUA 2CGPA 1YQAA 2XKOA 5DUIA 3J80Z 4GXOA 2XHKA 4BHCA 3RKYA 2P6SA 2GZWA 1G4DA 3Q5FA 3K1NA 1BC8C 3M8FA 3GEZA 1YS7A 4N0BA 4CDGA 4BHBA 4LK0F 3ROUA 1TBXA 4JQFA 2VBYA 4NHJA 3ZMZA 4AIHA 4O5VA 2K27A 2PMHA 2XASA 4LJZF 3TQNA 4NB5A 3RDIA 4HAMA 4ETSA 1IN5A 5JVTA 1IN8A 3HHHA 2UZKA 1ON1A 3GYHX 3CUQB 4K2EA 2HEOA 2R7FA 4ESBA 1ULYA 3F3XA 4HQMA 4U0YA 5IT9K 2IJLA 5LGUA 1J9IA 3F23A 2EK5A 2OZ6A 3GO5A 2WWYA 1ZLJA 3E6CC 4GCVA 2EFQA 2ZBKA 5BS6A 1U5TC 1IUYA 1HSJA 2FRHA 2AS5F 1J0RA 2ZMEB 4HV6A 1BC7C 1B1BA 5TJJA 1BIAA 5LGNA 1JE8A 1FP1D 4L0YB 4PDKA 3QAHA 4CZZA 2P4WA 1LNWA 2FE3A 1YW8A 5AIPA 2XGXA 4EQQA 4S04A 3E3VA 1OKRA 4WXCA 2QVOA 2VT2A 3L7WA 2DW4A 1YLFA 3V8KA 2VXZA 5LHHA 2ACJA 3QRFF 2QYOA 2HGCA 3JAMZ 1U3EM 1TW2A 2FBKA 1T2KA 3KEQA 4CXFA 4IHTA 1I1GA 1YIOA 1R5HA 4DQ2A 2K7LA 3R6SA 4AIKA 1ODDA 3U1DA 3BY6A 3TO6A 4EVIA 4LB5A 2ETHA 5HS8A 1SD5A 5BMZA 3BJ6A 4MQVA 4IRIA 3ZMDA 2ZJ2A 3F8FA 1JXSA 1MJ9A 3JSOA 3CO6C 2HFHA 4OIPF 3SZPA 1USSA 3WE2A 3EQLF 3HSRA 3R4KA 4WX9A 2VN2A 1ZARA 1O3RA 1R36A 2L01A 4M74A 4BAYA 5E8IA 3ZN1A 4HX8A 1FP2A 1XSVA 4NQWA 5JR3A 1ZRDA 1MDMB 2A6EF 2ZO4A 4G7OF 1HKSA 4WCGA 1FOKA 1QPMA 4KFCA 4EM2A 1YW7A 2BBYA 2FNPA 4B09A 4FX4A 4U7BA 5BQTA 2O0YA 3MFKA 1K7AA 1SMTA 3JW4A 2VOOA 2F5FA 2PMUA 4ZZLA 5HS7A 4G6DA 1LDDA 1U6GA 3LA2A 2EJRA 1HSTA 1R00A 3WTYC 4U88A 5DCMA 1IXCA 2ZNYA 3E6BA 4A0YA 3MZYA 2ZXJA 3QU6A 1KQ0A 1ZREA 3R0JA 2L3DA 2CG4A 3BPXA 2EFPA 1IN4A 4BYYA 2F2EA 3I0TA 3ABUA 2YSRA 3MEXA 2G7UA 2A68F 3J81Z 3CTAA 2Q0OA 2Z33A 1OYWA 1TW3A 3ZPLA 4HLXA 1XDUA 1RUNA 5CLSA 1I1SA 2CO5A 3ZQ7A 2E7WA 2A3SA 2MD5A 1TNSA 2P7CB 2P7VB 1HXDA 3N4MA 2OZUA 4LGWA 4YFNF 4ZYEA 1HBXG 4R79A 3I58A 4EJVA 1J2XA 1BOAA 3LA3A 3I64A 3CUQA 4HBLA 1RZ4A 3FXQA 4D0PA 2V1DA 3GWZA 3R0AA 2M1BA 2PQ8A 2AXLA 1DUXC 3GVAA 3I71A 3W6KB 2OQGA 3EYYA 5D5VB 2L02A 3KP4A 3KP2A 3SHFA 1GXQA 2ZFWA 4LD5A 4Q48A 3WTSC 1BN5A 2NS0A 3HRTA 4EJWA 1QO0D 3EETA 4UVBA 1YO5C 2IA1A 3J80K 3FX3A 4S05A 3C7JA 2JTVA 2X0LA 1WKMA 4UXNA 1AOYA 5D4RA 2DAOA 3C18A 1UCRA 2HQRA 2H6BA 3WGIA 3U2RA 4YIIA 2EV5A 2GIVA 3HIFA 3I54A 3KP6A 3FMSA 1JHHA 1ZG1A 4G94A 2PN6A 3NEUA 5LEJA 3KLOA 1MKMA 3CDHA 1USTA 2M8EA 2B0LA 5HLIA 2VE9A 1H9GA 4Q4ZF 1Z1DA 3RPQA 3HSFA 4IF4A 2DBBA 6PAXA 3G3ZA 4RGUA 4BH9A 2EFNA 4A5MA 4WXDA 2JT1A 2FMLA 4O3MA 3M8EA 2BE5F 3S2WA 3KZZA 2RVCA 5E1XA 2G9WA 3WTXC 4RAZA 2XAHA 2F5CA 2P8TA 1E2XA 3F6OA 3RYPA 3N97A 5K5QA 1YS6A 4EM0B 4KIFA 3TKYA 1R58A 3DFGA 3LAPA 2H6CA 4UHTA 4LFUA 4XSXF 2XKPA 4KMFA 2YR2A 3LA7A 2VONA 3GFJA 4Z2YA 1DP7P 5D5UB 3DF8A 2A61A 3CO7C 4RGXA 3WODF 2UXNA 3V7CA 1MDMA 3ZN0A 3KEOA 1J7KA 3CLOA 1FT9A 3F8CA 1T38A 3H3UA 2DTRA 4ON0A 2WC2A 2IPQX 1FYKA 3DPLC 3MWMA 4ESFA 2F5DA 2QM3A 1ZH5A 4EV0A 2QLZA 5EEHA 1SFUA 2FBIA 3I4PA 1YG2A 1FX7A 2P5LC 3FZVA 1AWCA 1XMKA 3F8BA 2XAQA 4FT8A 1F1ZA 1O3SA 3GF2A 1LDKB 2WV0A 5ICCA 4UV9A 5LGTA 1XGMA 1BM9A 3QU3A 5F64A 1PDNC 1W7PD 3ZMSA 4WK8F 4KICA 2F5EA 2J5PA 1KYWA 5ERIA 4HF2A 2DO7A 2CSOA 2JPCA 3FF5A 1D3YA 5H20A 3QPHA 5HLGA 2RN7A 2ISZA 3ERED 1WSUA 1XGOA 2Z99A 3D5LA 5JI6A 4LG0A 2O8XA 4KUMA 5DCMB 1XMAA 4EMSA 4RGSA 2ESHA 2Y0MA 5FGMA 4F7ZA 2W84A 3ZMVA 3IL2A 4M6YA 1Z6TA 2HTJA 1BJAA 5A2QZ 5CJ9A 4OIOF 3DV8A 3HRSA 3NQOA 1Z05A 1ZGAA 2RQPA 4HV5A 2HOEA 1FYMA 4RS8A 3T5XA 1WI9A 1FBUA 4G8XA 1I6XA 1D8KA 2JPBA 5F6FA 4Q47A 4KT5C 1ZRCA 3MZHA 1R23A 3WU0A 4EJTA 5H6RA 3P9KA 1RNLA 3K1MA 4A0ZA 1TTYA 4FHTA 2LF8A 2DPDA 3FXRA 5LHIA 1K6OA 1R5GA 2H27A 4LLLA 2MH2A 4ZH4F 3J81K 4B8XA 1SFEA 1QZYA 3U9GA 2Z3YA 5D5WB 2BGCA 3ECOA 4IVNA 4M9XA 3QP6A 4CICA 1IRFA 2MLKA 2GXGA 4IXAA 2X4HA 1LDJA 3WG9A 3QP5A 3IRQA 2MA3A 2VE8A 1IF1A 4P5OA 2GXBA 5KK1A 5JFRA 4KNYA 4EGYA 1SD7A 4MEXF 2JRTA 5LLQA 5BPIA 4BNCA 1FBQA 1U5TA 2FXAA 4RAYA 2M87A 2H94A 3HUGA 3WE3A 3CUOA 3FWEA 3M7GA 1O3TA 1STZA 1RIOH 2V6CA 3E5QA 1I5ZA 1P4AA 1YFHA 1G3YA 2UXXA 1LEAA 3Q9SA 3WGGA 4I0BA 3EYIA 2W57A 4HX4A 1FSHA 4EJOA 4AD9A 1RI7A 2KJCA 2KIUA 1XD7A 3L09A 4HX7A 1P2FA 3F21A 1XGNA 3GUDA 2OAZA 4M71A 4YFXF 2OU2A 1XDSA 1PP8F 5ILVA 1EH8A 1S7OA 3RKXA 4HQEA 1ONVA 5HS9A 5LBQA 1ZHFA 3I5UA 1QZZA 2IW5A 2GA2A 2DQLA 3C1DA 3OOPA 2E1CA 5FFZA 4L9TA
chains in the Genus database with same CATH superfamily
3ERMA 1D5YA 4M3FA 3OMYA 4P96A 1U9NA 3E7LA 3C2BA 4EJUA 2O3FA 2HOTA 1FJLA 3T0YA 1A6QA 4XN3A 5BPDA 4HA8A 4I09A 4Y33A 2HYGD 2KJBA 2VBWA 3D5SC 3P9CA 2QZ8A 5IOZA 1F4KA 3HOTA 1X1AA 2JWTA 3PQKA 3DPTA 2IGOA 5CVUA 3BR5A 1KGSA 5GP9A 4RLQA 3LQQA 5DD8A 2R4GA 1EV7A 4G7HF 1X3WB 2JZYA 3MKZA 4EEFG 1NHAA 4GDFA 2QKMB 3GTPJ 2Y69H 1Z7LA 5FLXK 1AKHB 1VQPI 1YRNA 4KIGA 1WJDA 3V8LA 4IOCF 4MTEA 1W7PB 1W0UA 3RKWA 3OV8A 4LLGF 1FNNA 2NS8A 4YFKF 3S1NJ 4E6KG 1ZQ3P 3A02A 5DV5A 3RPUD 2BEOA 2R7OA 2A05A 2DA3A 4M3BA 4R8HA 1XGSA 4M3DA 3R60A 1IV8A 3BG5A 5FKOA 1R1TA 4NUBA 3PL8A 3MAJA 1MBKA 2BXZA 1Y1WJ 1JT0A 1UAAA 3AG2H 1ZR4A 4HEA2 2QQBA 3K69A 4AIJA 2LC2A 1T0FA 5CVIA 4OIRF 4C9YA 1BI3A 4ZYAA 1EJ9A 4EATA 1F36A 1ORKA 4UVCA 2IEKA 1XPXA 1O7FA 3S1RJ 4MFDA 2VUMJ 1SMYF 2DA1A 5E79C 1BBYA 5IOYA 1B4AA 1IUFA 4Z6YA 3HOSA 3MN2A 4G7ZF 1O4XA 1I39A 4ZYDA 4DBRA 1FZPB 1IN7A 4II2A 5LRSA 2KRFA 1L3LA 2Y75A 1Z91A 4QLCU 4HYEA 4A3IJ 2PEXA 1XB4A 4DGWB 2Z5UA 2W82A 3K2ZA 1OMIA 3MKLA 3P9IA 4C2MJ 4IQ4A 2W85A 2EB7A 4MEYF 1MZBA 4CYDA 3GZ6A 2L9VA 1E3OC 3ABLH 1JTYA 1WHUA 2OCCH 3CCJI 3CJNA 3KYLA 5DEQA 2LY9A 2CYYA 4FX0A 1U8RA 2P5VA 5IT9Z 4CA0A 5ED4A 2L4MA 2ME6A 4UV8A 4LG0B 4X1EA 1EKEA 3IH2A 3WTTC 1KONA 2X6YA 3LSTA 4G9YA 4HG2A 4OIQF 3S14J 4IHWA 2IGKA 4FE7A 5K5OA 3PQJA 3B73A 2VT3A 4ENNA 2FUG2 1HW2A 4BKXA 2EBIA 2V4JC 2VQHA 1D0XA 1VQ6I 2YU3A 4BY7J 4M73A 2PJPA 2DU9A 2HZDA 2HYJA 2WB1A 3CCSI 3BTCA 1LE8B 5DM7F 4KISA 2A6TA 4E70A 4D1QA 2HDCA 3W6JB 3QOEA 3RIRA 1S29A 1Y0UA 4KMUX 4QWQA 5L3CA 3V8JA 5DTDA 2WY7Q 3GFLA 3M1EA 1POGA 1A36A 5ILUA 3ML6A 4LK1F 3JRHA 2Y2ZA 3BP8A 3RZOJ 2HXOA 2XIGA 2XAFA 1IZ1A 4OAYA 2O61A 1X4PA 3OS2A 2CUFA 1E17A 4JK1X 4MFEA 1U0JA 1T39A 4FTHA 2IA2A 2E2JJ 1T08B 3FKIJ 3IH3A 4JP0A 1UHWA 2JSCA 4QPQA 4Y3OA 2IBDA 2FSWA 2JQ7A 1KU2A 4RMNA 3JR9A 3UKGA 5L3DA 2EV0A 2QSFX 4PCQA 3S93A 3AFHA 5HVQC 1LVKA 2K9LA 2DMQA 2XVCA 1QU3A 2Z9OA 4L5JA 3S17J 1ZAOA 4RBOA 2LKPA 3VDXA 3Q0WA 1YW9A 3FHZA 1F5TA 1R1VA 1UG0A 1SAUA 4BE0A 1TLHB 4RB2C 1YE9A 1XCVA 5IYCJ 4MNUA 1GT0C 3G4SI 5A2QK 3HM5A 1MMSA 5HDGA 2A5YB 1P92A 2BVMA 1QZEA 2K9SA 2DOAA 1J75A 2COMA 5IP6A 3DBRB 4UY8I 1OPCA 4XNFA 4AIDA 3BROA 2PI0A 4U87A 2AO9A 1HLVA 4IJAA 3SEQA 4B48A 4P55A 1D1CA 2L4AA 2LREA 2R3SA 4YRVA 2VC0A 2L9NA 4RA2A 3VODA 3FK7A 4GFBA 3GTKJ 1P9QC 2LNBA 2V9PA 3KP7A 1R5ID 1WI3A 4YG2F 3Q3SA 5J47A 2JUGA 2XF7A 5F0HA 5J8CA 4M72A 4XKBA 3DTEA 1PUEE 3HOVJ 1R22A 5LHGA 3L00A 2HQAA 4I0AA 2BXYA 2X48A 2VODA 5L3BA 3UR3C 3S3NA 2N8GA 2DYRH 4XBFA 1RRJA 2BHYA 2B7EA 1ZG3A 3FXJA 2LSOA 3GW2A 4P1WA 4BE2A 2LLKA 1HKTA 5F1RA 1G6NA 4D9JA 2X6WA 1HQCA 1U5TB 2KZVA 1MIJA 3L9FA 1AU7A 2H1LA 3VB2A 3K4MA 2D1HA 4DJAA 2LBFA 2PX9A 3OS1A 1X3UA 5EGOA 2M9HA 5ICFA 3PO2J 3X2QH 4HLYA 3ONQA 2P0WA 1QBJA 3K4BA 4TV7A 1ETYA 2XGCA 3DEUA 4M9ZA 2Y31A 2GA1A 5IT3A 3WU1B 3K1PA 2HPIA 2P6TA 1A35A 1GV5A 3CDIA 5CYVA 1IN6A 4W97A 1Z9CA 3ELKA 5E3NA 3DTIA 1WJBA 2CW7A 3CC4I 2DQRA 4OMYA 1U2WA 3F6VA 4RB0A 3TDUC 1DPUA 2VBZA 1KA8A 1ZGJA 3FBIB 3K0LA 3HHGA 1YHQI 1FEXA 1MNMC 5GPCA 3OY9A 1JKOC 5B1AH 2WA0A 3BCBA 1W5TA 3OYHA 1HW1A 1N25A 1V54H 4RB1A 4RDUA 2XGDA 2C6YA 1W1WE 4A6DA 1ETXA 2ELHA 3VSLA 1XN7A 4ESJA 3IWFA 3G73A 2M3AA 4W1UA 1IRGA 2RV8A 3Q9VA 1AKHA 1S72I 5M5WJ 2O03A 2XUBA 1B6AA 4M6XA 5BOXA 1JUMA 4ZDOA 3FMRA 1W7PA 5K7HA 4L18B 1VFCA 3JTHA 2HXIA 1MD0A 4R1HA 2DT5A 4V2FA 2VJ4A 3T8TA 1ZN2A 3HB9A 2PBIA 4ENMA 3JAMK 3OWTA 1J09A 5TGTA 1C0WA 3OL4A 3JTGA 4I98B 3CJTB 3GXOA 4XRMA 4XQFA 1LQ1A 3ABKH 3E97A 1K4SA 1H0MA 2MH9A 4BJTA 1RKWA 1A31A 4CGZA 3AL0B 4PJJA 3VYTB 3W6VA 2RGVA 4UNOA 2PLYA 5AIQA 1RR7A 2R7WA 4Y17A 4ZYGA 5C3EJ 1SFKA 4OINF 5LRRA 4NC8A 2IP2A 5FD5A 5M3FJ 2QBYB 2YPRA 3CD6I 5CVRA 3O6BB 3SYTA 4A6EA 5D8KB 4KN4X 3IRRA 1VQ9I 2KKOA 3NWSA 2K86A 2D2WA 2XF6A 4XORA 4NC7A 3FHNA 2E2IJ 2ID3A 3RYRA 5GAEJ 3G6EI 3LSJA 1SFXA 4ZZDA 3S2HJ 4YEJA 4CCJA 3SZTA 4ZYHA 2R5ZB 2CFXA 4MGRA 2GWRA 2CU7A 3IAM2 4OU0A 5JHFA 1TWAJ 1P4WA 2JVHA 2DT7B 1WJCA 3V4GA 3RCOA 2KZGA 1JJ8C 2NNYA 1JGGA 4C2UA 3ISPA 2NVQJ 4M9SA 1A04A 4FETA 3WG7H 3MD2A 3R61A 1B72B 1MSEC 2EPFA 2X1CA 1EH7A 3VEPA 1G3SA 1U9OA 4MQ9F 3TDZC 3OS0A 4O6JA 2BY1A 3BPVA 1L0OC 4BDZA 1J5YA 2R7RA 2HKOA 3JREA 1SEUA 4XRFA 2QQAA 3O8GA 5DYMA 4A69C 5E8GA 2Y48A 1I50J 1MBJA 3SFZA 5FB2A 3AKZA 3OYJA 4A3LJ 1FTZA 3IC7A 4Y13A 1LE8A 2K5CA 4ZTFA 1PJRA 3QYEA 4PGGA 5F08A 3HRMA 3LQRA 3ZMTA 1KU7A 1IG7A 1Z6RA 1UB9A 3T1BA 3U21A 5HLHA 2FF4A 2NNNA 4BHPA 2L54A 1B9NA 1OCCH 3F22A 4CSWA 2LYCA 1R7JA 5CPRB 1NG7A 4EM1A 2R7UA 2FNAA 4PZJA 5TRDA 1T6SA 5B5EC 1D5VA 1OR7A 1TP4A 3FMQA 2HVSA 3BTLA 4ENJA 1FC3A 1DDNA 2BV6A 3IWZA 2XAGA 1QGPA 3BWGA 4YIRX 3CC2I 4N4NB 2R7DA 3ZRGA 4DZJA 3HTSB 2JN6A 1S6LA 4BU2A 3CCVI 1S9HA 3ULQB 3BQYA 1H8AC 4N9HA 4BY1J 4AYBA 2WAFA 1P4XA 1R4NB 3AG4H 1KZHA 3RKQA 4IRHA 2DI3A 5C4XJ 2GXAA 3CCEI 2CV2A 2TDXA 4QSHA 4AWXB 2ZXWH 4L0ZB 5EF6A 1RUOA 2EZIA 3L2QA 1ETKA 3ZGKA 2J5OA 4BUPA 4AVZA 5AONA 2OD5A 2H8WA 3ECHA 3SXYA 2DMPA 4G6QA 3TP0A 3I53A 2XPWA 4KN7X 1GUUA 1YX5A 2YX7A 4Y15A 2XB5A 3E6DA 4MLOA 5F0CA 4IHYA 1IXRC 2M8GX 2LG4A 2AXTC 3BQZA 3BDDA 3HSEA 4U0WA 4C30A 4AVPA 2FBHA 2LF7A 4HOBA 3BOQA 2MLGA 5M3MJ 5EDNA 3CMEI 1TQPA 2KQRA 2QENA 4X0GA 4A5NA 4WF2A 2O9LA 5CVVA 3B6CA 3BR2A 2Y30A 3CP2A 4CCKA 4ENKA 3FISA 1JHFA 2DODA 2OUMA 3RQ4A 3OYDA 2MBFA 4GGGA 1S7EA 2E7XA 3ZQFA 4RGRA 5ICGA 3JRIA 2VBXA 1W0TA 2O8KA 2IS4A 5HNHA 3H1CA 3ASNH 3OIQA 5KVRA 4NC6A 2NS7A 1BI0A 2E35A 5F27A 2V79A 3KZYA 2A6HF 1GV2A 1BA5A 3QPTA 1S7AA 2E1MC 5J6XA 2IGMA 2VJJA 1K78B 3S32A 3KPHA 3D0SA 3PNYA 5H6QA 4CCNA 1R4MB 4EGZA 1ETWA 2RAEA 3HTUA 1OCTC 3DKWA 1KYZA 5B1BH 3TGNA 4V19K 5D4SA 4BQOA 1SVLA 2QQ9A 1OYYA 3BZ6A 4A3EJ 2EFWA 3J7AY 2KISA 3K9TA 1LB2A 4HRIA 4L9NA 3ZQCA 1V4RA 4XN0A 5HDKA 1KQ9A 1FYLA 4N9IA 2V9KA 2JA5J 1MSFC 5L3EA 3QYFA 3E6MA 2W24A 4LG3A 3E1SA 3JRGA 5EG0A 1SAXA 4QIWN 3VOEA 2EQRA 3G1OA 1R49A 2OBPA 1UHMA 3A2KA 2UWMA 2ADUA 1E0EA 2NAZA 3FXUA 1J59A 1O3QA 3S15J 3G1LA 2X9DA 4JX4A 4DNCA 4CO8A 3IKVA 3EUHC 1E3PA 2Y9YA 2ZKZA 4B3XA 1QVTA 1W5SA 2XGEA 2DK8A 3KE2A 2Q2EA 2ESNA 3GFIA 2KIMA 3QWLA 5FKLA 1DGRM 4CZCA 4U7DA 4I6ZA 1VTNC 1IGNA 5GTIC 4IHXA 1O57A 2GQQA 2P81A 5M5XJ 2K85A 3CCYA 2MFZA 3IV5A 3S8PA 4DIQA 3WTVC 3J7AO 5FJ8J 4MTDA 2L5QA 1B9MA 1XSXA 2EV6A 2HYFA 4FE4A 5C4JJ 2X1EA 1O7LA 2H09A 3NAUA 5C44J 4D5FA 3EUHA 3MQ0A 3BG7A 4C3HJ 1RKTA 2P5KA 2HU9A 2W1OA 1ON2A 1ZG5A 1IW7F 4XM3A 4H0EA 4GYGA 3QYBA 2LY1A 3REOA 1ZK8A 2GAUA 3CMAI 1S3JA 2HR3A 5IP9J 5JVGF 1D0ZA 3IHUA 2IS2A 3TW7A 2FOKA 3V7RA 1W4MA 2FMYA 4QTRA 1HF0A 2ZC2A 1JI8A 2DMNA 1P7JA 3DBHB 4HF1A 3C3WA 3L2CA 2CWEA 3FK6A 1LUJB 5D6EA 3OYEA 1YJWI 4PUSA 1WJ5A 4OOIA 1HDPA 1LEBA 2E1OA 1QA6A 3RPUA 5J8FA 5GAGJ 5ILSA 2ID6A 2QBYA 3OYFA 5E1WA 3F72A 5DUKA 2DK5A 1B8IB 1WJEA 3H9GA 2MC3A 5K5RA 1H9TA 4JBAA 4C3JJ 1G3TA 1MMGA 1K79A 3TOAA 1D1AA 1EH6A 2CV0A 1KU3A 3F8NA 3WHCA 5DM6F 4IHSA 2QKLB 4IX7A 2L0KA 4HW0A 2CMPA 4IPAA 2XF5A 2R5ZA 3QOPA 3K70D 2DPUA 1N78A 3FXMA 4BQAA 2HKXA 2XRLA 3I55I 4LLNA 2DMUA 1OCOH 2OA4A 2K40A 2G7HA 1D8JA 3F8MA 1ZLKA 4XLFA 1TT5B 4IZZA 1XCBA 2XROA 4F91B 1B72A 1T8IA 1TZLA 5CVJA 1FWZA 1MNDA 2RNJA 2CQKA 1CF7A 3K6GA 4XKWA 3CZ6A 2X85A 3BJAA 2XB0X 3SDGA 5IPAA 2EWNA 2DOFA 1Y1VJ 2X51A 4BQQA 2CV1A 2FQ3A 2ZJQF 2ZFUA 1VQ8I 1OYIA 2OTJI 2X6OA 4XSZF 1PVEA 3TO9A 5E17F 2L7ZA 3TEDA 3PNTA 4B3AA 5E18F 3AG1H 5DDGA 3SFIA 2YX4A 4A3KJ 3VYSB 2ZB9A 3BTIA 1FPQA 4PJNA 1PP7U 3BJOA 3LAJA 4F93B 2HDDA 2M0CA 2QEXI 1MW7A 5M5YJ 3ZR8X 4IHVA 3LNQA 2AQFA 1VQ4I 4I7HA 2HS5A 5DD4A 4CH7A 3I59B 1GHCA 5DCFA 2KDZA 2VB6A 1WPKA 5IYBJ 2VIXA 1SVOA 3OYCA 3DBLB 2OPTA 1G59A 4XRSA 2GBYA 1BIBA 3T8RA 1LFUP 3A0HC 3K4CA 1SD4A 1UZCA 2BW3A 1IAWA 1UJ8A 4QPOA 5D5XB 4WXHA 2DLLA 2FA5A 1K61A 2TCTA 5LFAA 2CJJA 1Q1HA 3TBIA 1MJBA 4BGDA 1PUFB 2JA6J 4E7KA 1FY7A 1SD6A 1KU9A 2HQNA 3F0CA 2AHQA 1LVAA 3LWFA 3CUQC 1MJAA 4NNJA 3H36A 2TRTA 3ESWB 2WB1N 5HOOA 4LMYA 2JJ7A 2STWA 1APLC 3LOCA 2W25A 5IY5H 2DFIA 2PMZA 5HODA 4RB3C 4MIMA 2RKHA 2PJRB 3HDDA 1YYVA 1TQMA 3JSPA 4U0VA 1G2HA 2CH0A 1LFPA 2XAJA 3KETA 2WV1A 5GPAA 4A12A 1EA3A 3KP5A 2YU9J 2ZXHA 2OF7A 5FKNA 4P9UA 3ZP5A 1EF4A 4LIVA 3HGGA 3A03A 5E20A 2OQRA 4BJ5C 4E7ZA 3GTGJ 2FU4A 1LJ9A 2JRMA 4Y52J 2X6XA 1P6RA 1NH3A 4GYIA 1FLIA 4KA4A 2IA0A 2A69F 4F55A 2NYXA 2ZMEC 1N75A 2D45A 2E19A 4XLPF 4HNVA 4I2OA 3H92A 2Y9ZA 3H3ZA 4J01A 3O3KA 4UB8C 1YTYA 4BJ6C 1MMAA 3VFZA 3K7AJ 4KIBA 1QHGA 3WGHA 2OV7A 2HWVA 3OYLA 2Z1DA 3LSRA 1K78A 3PNVA 1V3FA 4GO1A 5FO5A 3DWLE 1FOWA 4XOTA 1F9NA 4ZTJA 2ZMEA 3LMMA 3RZDJ 5F04A 3GX4X 5HDNA 5FD6A 3HXLA 2CW8A 3CC7I 3CCRI 1V5EA 1CQTA 1IXSB 2PFBA 4E7JA 4UUTA 4UVAA 4UUVA 2IVMA 1ERDA 1Z3YA 1CGPA 3S3MA 4E7HA 4PGHA 5EJCA 4B4CA 3CMMA 1FIAA 1UG2A 3WTUC 3E5UA 2VLAA 1Z3XA 5EEGA 4HDUA 1JJ6C 2CW0F 4ZDLA 5K1YA 1ZTRA 3SZGA 2K4BA 2PG4A 2Y0SA 1T98A 2LDUA 3HEFA 3HKZA 2OTLI 1FBSA 3DKYA 1GXPA 4AC0A 1IDYA 1JTXA 2WBMA 5FRNA 2ZNZA 4L5IA 3ZCOA 4A3JJ 3BC8A 3IKTA 4XLCA 2E1NA 4KYWA 2ZCWA 3GTLJ 3QQAA 4BXUA 3SQNA 4WWCA 4Q5SF 1BI1A 3HYIA 2BVLA 3GZNB 3I9V2 3I56I 1DPRA 3E5XA 1QNTA 2RQQA 3OYNA 4CHUA 2O7OA 1S8NA 1TWHJ 2O6GE 1MH4A 3GMEA 3MCZA 3TOBA 4HPQA 1B59A 2E5NA 2QUFA 2Q8KA 1IV6A 3ABTA 4FQGA 1WCMJ 3BZCA 4MO7A 3LFKA 3DQVC 2NRAC 2HQ5A 1XS9A 5EG0B 4YIFA 4IO9F 2XDVA 4I02A 1TQIA 2E1MB 4RAGA 1V5GA 4M6VA 3WTWC 1LPQA 3GFMA 1JKQC 2VOPA 1DGWY 1BI2A 1A5JA 2LTPA 1Z21A 2EFOA 3WTZA 1VQLI 3SEZA 5FLXZ 1ITYA 3B02A 2EA4A 3KFWX 4LITA 5JHUA 2WTEA 4HDVA 2M5WA 2Q2EB 1K4TA 2LD5A 1GVJA 2K3FA 2F4MB 2M4KA 1TNTA 5ICEA 3DLAA 1B8IA 2HZTA 4YELA 1FMVA 4L9JA 2D1VA 5JLWA 3FKJA 1ZRFA 5CQEA 1NK2P 1KQ8A 1UFMA 2XSDC 2EIMH 4P9FA 4XLNF 4I01A 3K4NA 1U78A 3IAS2 1MGTA 5D6FA 2K4JA 1QPIA 3FM3A 3HJEA 3FXKA 2VC1A 4OMZA 4CYCA 3D1NI 1ZGWA 1HKQA 2RC4A 4A0XA 2K02A 2A07F 2FX0A 2DA2A 4HZFA 2FEZA 3RJPA 1WQ2A 2BHZA 2M45A 4XIDA 3EDPA 5GTHC 2HVRA 2VI6A 4OAZA 1IDZA 1BOBA 2CRGA 2WAQA 4UUSB 1HW5A 4A2UA 4ABZA 4J00A 1TWGJ 3KCCA 4L9VA 1WWXA 2JK3A 3KX2A 4E4HA 3DXJF 3H5NA 1OFCX 2CQXA 3PFIA 5EEAA 4KDPA 5L3GA 2KIFA 1ETVA 4ASNA 1R1UA 4PSXA 4BE1A 1REPC 3GZ5A 1DU6A 1S5LC 4MHGA 1ZYRF 1I27A 3QPSA 1JGSA 5D8LB 2H1KA 2W4SA 3AAFA 1DQUA 2ISYA 1Y8RB 4G6TB 4V2GA 2STTA 3I59A 3OIPA 4XL9A 2QQ8A 2RDPA 4A3GJ 2CUEA 2VKEA 3PIOF 3OYMA 3COAC 3CJRB 5FKMA 3NRVA 1XTAA 3FM5A 2DA5A 3K10A 4CCLA 2IRFG 1SVMA 4LOCA 3MKYB 3RTRA 3M9AA 2DYSH 1G3WA 1TWFJ 2V1XA 4XLHA 5FFXA 3DP7A 1Z7UA 3A01B 5E1ZB 1FSEA 3P5JA 2EA2A 2HTSA 2ELJA 4LB6B 5LEKA 1PUFA 1AA7A 2IXSA 4IRGA 3ZOBA 4FCYA 1CF7B 1WRJA 5L3FA 3CF5F 4B47A 1XSDA 1U8BA 3FDYA 4LIUA 4XLEA 5E3LA 3KLNA 3M07A 2M30A 1PYVA 4HF0A 3ZMUA 2BZTA 4ZDPA 2CQQA 2VL8A 2XRNA 1Y39A 1HC8A 1YOVB 2L7FP 4RM2A 3KP3A 3V7SA 2IT0A 2V9VA 2KPMA 2QWWA 2PJRA 3O2PE 1YJNI 3TO7A 3RI4A 2ZJRF 3K4JA 5E3MA 1QQIA 2WAEA 2ZXIA 4IQJA 3VYRB 2V1UA 2XV4S 2KRHA 3GLXA 3P7NA 2BYVE 2L2OA 2M2EA 3HRUA 3S3OA 2CGPA 1YQAA 2XKOA 2ECCA 3W2VA 4XKVA 2MGQA 5DUIA 3DEWA 4X6AJ 4BL0B 1NTCA 3J80Z 4GXOA 2V6EA 3I4MJ 5J1UA 2XHKA 4BHCA 3RKYA 3M3YJ 2P6SA 1YIJI 2GZWA 1VQMI 2ECBA 1G4DA 2BW3B 4A3FJ 3W3CA 3Q5FA 3K1NA 4AYBN 1BW5A 1BC8C 3M8FA 3GEZA 1YS7A 4N0BA 3VYUB 4CDGA 4BHBA 4LK0F 3TL4X 2M4GA 2L7MP 2GIZA 2IS1A 1BR1A 1ZR2A 2M7AA 3ROUA 1Z0XA 2HI3A 3A0BC 4XOPA 3M8JA 3N05A 3BG6A 5K7FA 1TBXA 4JQFA 2VBYA 4NHJA 3ZMZA 4AIHA 2LKXA 4O5VA 2K27A 2PMHA 2XASA 4LJZF 3TQNA 2GOXB 4NB5A 3RDIA 4HSRA 2NVTJ 2H8RA 1ETQA 4HAMA 4ETSA 1IN5A 5JVTA 3GTJJ 3KEYA 1TC3C 1IN8A 3HHHA 2MC4A 3A4CA 2UZKA 1ON1A 3GYHX 1ZELA 3CUQB 4K2EA 2HEOA 2R7FA 4ESBA 1ULYA 3F3XA 4HQMA 5J40A 2JA2A 1X19A 2IS6A 4U0YA 1HA8A 4CUGA 5IT9K 2EILH 2F48A 2IJLA 5LGUA 1J9IA 1DP3A 3F23A 2EK5A 5BNGA 1XC5A 2M7BA 2OZ6A 3J7YJ 3QPLA 4Y4RA 5B66C 3GO5A 4BQNA 2WWYA 2AQEA 2BY0A 3FBNB 2R93J 2F5VA 3FXOA 1ZLJA 3HG9A 4KJZA 3E6CC 4GCVA 2EFQA 2ZBKA 4F52A 2QCOA 2R7TA 3PSIA 5BS6A 1SC7A 3PO3J 1Y56A 1U5TC 1IUYA 1HSJA 1BR2A 2FRHA 5IYDJ 3C2GA 2AS5F 4II3A 2JSPA 1IJWC 2EIJH 1H88C 1J0RA 2ICWG 2ZMEB 1X1CA 2HDWA 4HV6A 2KHMA 1FOXA 1BC7C 1B1BA 2WADA 5TJJA 1BIAA 5LGNA 4DBQA 1JE8A 1FP1D 4L0YB 4PDKA 5J1YA 2LY2A 3QAHA 1NG6A 4CZZA 4PJLA 2P4WA 2COBA 1R71A 1LNWA 2GLOA 4HNTA 2FE3A 2DA6A 1YW8A 4D7MA 5AIPA 2L9SA 1VQNI 2HOSA 2HPMA 1OCRH 2VJIA 1TWCJ 2XGXA 1ZKGA 4EQQA 4S04A 4A3DJ 3E3VA 2EZKA 3PM1A 1OKRA 4WXCA 2QVOA 2VT2A 3L7WA 3HPHA 2DW4A 3GCMA 1OQYA 2WY8Q 1YLFA 3V8KA 2VXZA 2VASA 5LHHA 4DOZA 3OSGA 2ACJA 3QRFF 4AM3A 2XSJC 1X2MA 2QYOA 2HGCA 4Y7NJ 3JAMZ 1U3EM 4BEHA 1TW2A 2FBKA 1T2KA 3KEQA 4CXFA 4IHTA 2O5RA 1I1GA 1YIOA 3CESA 2MW8A 3CDLA 1R5HA 4DQ2A 2K7LA 3R6SA 5J4YA 4AIKA 1ODDA 3U1DA 5FROA 2LVSA 1YJ9I 3BY6A 3TO6A 4EVIA 4LB5A 2ETHA 5HS8A 1SD5A 4DZPA 5FKKA 5BMZA 2GM4A 3BJ6A 4MQVA 4IRIA 3D5RC 5KNLA 3ZMDA 2ZJ2A 3F8FA 1JXSA 2Z2SB 1MJ9A 4UUSA 3JSOA 3H5RA 3CO6C 2HFHA 4C2TA 1A6IA 3VSKA 5HNFA 3CMYA 4OIPF 3EUAA 1USSA 3SZPA 2NXNB 3K4LA 1ETOA 3WE2A 2VKHA 3EQLF 3JCUC 3HSRA 3LSKA 1VQOI 1N77A 3R4KA 4WX9A 4BDYA 3SDBA 2VN2A 4FISA 5B3SH 1V5FA 1ZARA 1O3RA 1R36A 2L01A 4M74A 4BAYA 3DEEA 5E8IA 2KT0A 3ZN1A 2VQGA 1JT6A 4HX8A 3BTJA 5F0FA 4XK4A 2V26A 1FP2A 1XSVA 3CF2A 2G0EA 4NQWA 2DFFA 4CYCB 3L2WA 4IL6C 2KFDA 5JR3A 5EZGA 3CP8A 2A6EF 1UELB 2ZO4A 3OIOA 1MDMB 1ZRDA 4L5EA 4UB6C 1WZ2A 1BW6A 4G7OF 3ZQLA 5IP7J 1HKSA 3A01A 4WCGA 2B63J 1WH7A 3JRDA 4BBSJ 2EINH 2LFBA 1QPMA 1FOKA 4RLFA 4XMYA 2VPLA 2CUZA 1T0FC 2VQCA 4KFCA 1YX3A 4EM2A 2D5VA 1YW7A 2BBYA 2LH9A 2FNPA 4B09A 4FX4A 3C2HA 4U7BA 5BQTA 2O0YA 3MFKA 1K7AA 1SMTA 3JW4A 1RETA 2VOOA 3BR6A 1BJZA 5CQGA 1WFXA 2FD5A 1VZ0A 2F5FA 2PMUA 2R7QA 3MZ8A 4ZZLA 5HS7A 2MYSA 4G6DA 1LDDA 1U6GA 2E34A 3LA2A 3HOZJ 2EJRA 1HSTA 1QRYA 1UMQA 2R7XA 3I3LA 2DMTA 1M1EB 1R00A 1RPWA 3WTYC 1VF9A 4U88A 5DCMA 1V55H 4XONA 1IXCA 2LKSA 1SANA 2ZNYA 3E6BA 4A0YA 3MVPA 2JA8J 3UNGC 3MZYA 2KMUA 2ZXJA 2YUSA 3LL7A 3QU6A 2ZJPF 2I10A 1KQ0A 4XR6A 1ZREA 3R0JA 2L3DA 4M3EA 2KDOA 4A93J 2CG4A 1WH5A 3BPXA 2EFPA 1IN4A 4BYYA 2F2EA 3I0TA 1SFOJ 3ABUA 1E3HA 2KIQA 5K7ZA 1MMNA 2YSRA 4DYCA 3MEXA 2G7UA 2A68F 1QVUA 2VKDA 3GBGA 3J81Z 3CTAA 2Q0OA 2Z33A 1OYWA 1TW3A 2KRCA 3ZPLA 1BR4A 1R6RA 3DLLF 4HLXA 3ABMH 2PMZN 1XDUA 1RUNA 5CLSA 2F4IA 1VQ7I 1I1SA 4ZC3A 2CO5A 1VQKI 1Q1VA 5J1RA 3ZQ7A 3L2UA 2E7WA 2A3SA 3S1QJ 2MD5A 1TNSA 2P7CB 2P7VB 2R5YB 3PUBA 1HXDA 3N4MA 2OZUA 4LGWA 4YFNF 4ZYEA 1HBXG 4R79A 3I58A 3H0GJ 4EJVA 2A5WA 1J2XA 1BOAA 3DPUA 2R92J 3LA3A 3I64A 3VWBA 3CUQA 4HBLA 3ZQHA 2OCEA 1RZ4A 3FXQA 2QSHX 2JMWA 3LSHA 4D0PA 1VI0A 1GVDA 1K83J 2V1DA 1MBFA 3GWZA 1MBEA 3R0AA 5TISC 1OLTA 3H5AA 1VNDA 4NBQA 5J4VA 3HBLA 2M1BA 2HNHA 2PQ8A 2AXLA 5KAFC 1JUSA 1DUXC 1OCZH 2FQ4A 3IUOA 4IEJA 3GVAA 3Q0VA 3I71A 3W6KB 2DTZA 3CQZJ 4B44A 4BXXJ 2OQGA 1X1BA 2KL4A 3EYYA 5D5VB 2L02A 4PK4A 3KP4A 3KP2A 3SHFA 4A3CJ 4RM3A 4FASD 1DU0A 1GXQA 3NWTA 2ZFWA 4LD5A 2VJ5A 4Q48A 3WTSC 2LMDA 1BN5A 2CQNA 2NS0A 3HRTA 4EJWA 1K6YA 3BZKA 3S1MJ 1QO0D 3EETA 1LFBA 1Y8QB 4UVBA 3OYKA 1YO5C 1I6HJ 2IA1A 3J80K 3FX3A 1I3QJ 2HOAA 4PJ0C 4S05A 3C7JA 2JTVA 1OISA 2X0LA 1WKMA 4UXNA 1AOYA 5D4RA 2Y0SN 2DAOA 3HKZN 3C18A 1UCRA 2HQRA 1HCRA 2H6BA 3WGIA 3U2RA 4YIIA 2EV5A 2LOOA 3M4OJ 2GIVA 3HIFA 3G71I 3I54A 3KP6A 3FMSA 1TT0A 3B6AA 1JHHA 3ZQGA 3RQIA 1ZG1A 4G94A 2PN6A 3NEUA 4DYQA 1JKPC 5LEJA 3GLLA 3KLOA 4NDLA 1MKMA 3CDHA 1USTA 2M8EA 2B0LA 5HLIA 2VE9A 2DA4A 1H9GA 2V1NA 1XX5A 1W5CC 4Q4ZF 3HL2A 1Z1DA 3RPQA 5LD2C 3HSFA 4IF4A 2DBBA 1T95A 3LSMA 4S0HB 4KITB 6PAXA 2JA7J 3G3ZA 1D0YA 2W7NA 3PFYA 4RGUA 4BH9A 3HOXJ 2EFNA 4A5MA 3RSNA 3GTOJ 5DS9A 1WGXA 2RNGA 2JT1A 4WXDA 2FMLA 3HOUJ 1X1DA 4O3MA 3HOYJ 4E7LA 4PFPA 3M8EA 2BE5F 3PJRA 3S2WA 4ANJA 3KZZA 4CCMA 2ELKA 3HPGA 2QA4I 2RVCA 2LK2A 1XG1A 5E1XA 2G9WA 3WTXC 3PUFA 3HZJA 4RAZA 2MD0A 2XAHA 2B9SA 1F43A 2F5CA 2P8TA 1WJFA 1MBGA 1UHSA 3HUGB 1E2XA 3F6OA 1FMWA 3RYPA 3N97A 3HGYA 1YS6A 5K5QA 5KHDA 2X1DA 4EM0B 2VQLA 2NOJB 4KIFA 4KT6A 4B1RA 4IOAF 3TKYA 1D1BA 1R58A 2UUZA 3A1YA 3DFGA 3LAPA 2H6CA 1IC8A 3OR2C 1NK3P 3MMYB 4UHTA 4LFUA 2CQ7A 4XSXF 2XKPA 5CKTA 4KMFA 2YR2A 3LA7A 2VONA 2KP6A 3GFJA 3H0DA 2QSGX 4BEHB 3L2VA 2DDBA 1ACIA 2BY3A 2M0MA 4Z2YA 2DJIA 1YITI 4I99C 1DP7P 5D5UB 3DF8A 4XKCA 2A61A 5GADJ 3CO7C 3H9QA 1JKRC 4JX6A 2ZSIB 4RGXA 1X2NA 3E0JB 2K9MA 2IAIA 3WODF 2UXNA 2I5UA 1X4OA 3V7CA 3ZN0A 1MDMA 3WU2C 3KEOA 3JRFA 1J7KA 3CLOA 2WAQN 1FT9A 2E36A 4GRIA 2XPUA 2NVUB 2L9RA 3F8CA 1T38A 3H3UA 2DTRA 3IP4B 4H4KC 4ON0A 3DTKA 2MG4A 2WC2A 2IPQX 1FYKA 3DPLC 3MWMA 4I76A 4ESFA 2CUJA 2F5DA 3OL3A 2QM3A 1ZH5A 4EV0A 2M34A 3BG9A 3OYGA 2QLZA 2DJNA 5EEHA 2BY2A 1SFUA 2NOGA 2FBIA 2JVGA 3LSIA 3I4PA 3JRAA 1X58A 3Q0UA 1YG2A 4BBRJ 4CCOA 1FX7A 2P5LC 1TL8A 2XAUA 3FZVA 1AWCA 1XMKA 3F8BA 4D5CA 2XAQA 4FT8A 1F1ZA 4HSTA 2V7FA 3GTQJ 4HNUA 3ZXSA 3OYAA 3CCUI 3GF2A 1O3SA 1LDKB 4PFOA 1T33A 5HLTA 2WV0A 1MNEA 5ICCA 4UV9A 5LGTA 1XGMA 2CS3A 1BM9A 3QU3A 4JYKA 5F64A 3CJQB 1PDNC 4E7IA 1W7PD 3ZQIA 3ZMSA 3FIWA 1Y0NA 2DFHA 3LSGA 3BCAA 2NVYJ 4NQWB 2F6CA 4WK8F 4KICA 5E3OA 2F5EA 2J5PA 2R7VA 1RC9A 3V42A 1KYWA 5GAHJ 1ENHA 5ERIA 2DCEA 4HF2A 2DO7A 4JX5A 4XLAA 4XRSG 2UV1A 1MH3A 2CSOA 1YRNB 2JPCA 1QHHD 3FF5A 1D3YA 4A3BJ 3FXLA 5F1JA 2MSYA 3QPHA 5H20A 1LKXA 3OOUA 4BXFA 5HLGA 2EZLA 2RN7A 1AHDP 2DA7A 2ISZA 2W00A 3ERED 9ANTA 1H89C 3K4KA 3PIPF 1WSUA 1XGOA 2OC6A 2Z99A 3S16J 2R5YA 4PSWA 4RAFA 3D5LA 3CLQA 5JI6A 4LG0A 2O8XA 1FIPA 1X1PA 1IRXA 4KUMA 5DCMB 3BLYA 3BR0A 4ZJZA 1XMAA 2QF7A 2IGNA 4EMSA 1MBHA 3W2AA 4C3IJ 5FRMA 4RGSA 2FOWA 2FJ1A 3KYCB 2ESHA 3U1KA 3JRCA 2Y0MA 2RREA 3HOWJ 1OR7C 5FGMA 4B43A 4F7ZA 1WVRA 2DXIA 2W84A 3ZMVA 3IL2A 3DU5A 4M6YA 1OJLA 1Z6TA 2K9NA 2HTJA 3EUKL 3H35A 1BJAA 5A2QZ 5EZHA 5CJ9A 4OIOF 3DV8A 2DDAA 1BL0A 3F9KA 2EIKH 3HC7A 5FLVA 2R7SA 3VPRA 4DW6A 3HRSA 2VPRA 3NQOA 1Z05A 1ZGAA 2RQPA 4HV5A 5KCMA 2HOEA 1FYMA 4RS8A 3T5XA 1WI9A 1FBUA 2QGUA 4G8XA 5KAIC 2R0QC 3L2RA 1G8XA 1I6XA 1D8KA 2JPBA 1GLNA 1RESA 5F6FA 3GTMJ 2E2HJ 4Q47A 2F4OB 4KT5C 3KIOA 3BR3A 4BACA 1ZRCA 3MZHA 3DCFA 1R23A 1RR8C 2OJED 3S2DJ 3WU0A 1Z67A 3I4NJ 3OYIA 2L7KA 4EJTA 5EYRA 5H6RA 3P9KA 5H2FC 1RNLA 1W36C 2HVQA 3K1MA 3QODA 3W2WA 4A0ZA 4BS9A 2EZHA 1TTYA 2E5ZA 4FHTA 3LSPA 1FOYA 2YS9A 2LRDA 2LF8A 2DPDA 2W48A 4G12A 3FXRA 1R9TJ 1X3ZB 5LHIA 4XICA 1R5GA 1K6OA 2H27A 2E71A 2MH2A 4LLLA 2CFOA 4ZH4F 2ME0A 3BT9A 3J81K 4B8XA 1SFEA 1QZYA 2XPVA 3PSFA 5J3LA 2Z3YA 3U9GA 2I8DA 2ZSHB 4JOMA 5D5WB 4F3QA 2MABA 4N4OB 2BGCA 3JRBA 3ECOA 2BOLA 4DYRA 4IVNA 4M9XA 1XMXA 3TW6A 1MMDA 3OR1C 3QP6A 3CCMI 4CICA 1IRFA 2MLKA 4ITVA 2GXGA 2DOEA 4M3GA 1WJAA 1P7IA 2GOMA 4IXAA 4A3MJ 2X4HA 1LDJA 3WG9A 3QP5A 1IO2A 3DU6A 3IRQA 2JUCA 4IKFA 2MA3A 2VE8A 1IF1A 3O8HA 3K2AA 4P5OA 2GXBA 5FLMJ 5KK1A 5JFRA 1W36D 4KNYA 3H3VK 4EGYA 1SD7A 3J7ZI 4MEXF 5JLXA 3OYBA 2JRTA 5LLQA 3BG3A 2XC7A 2Q1ZB 5BPIA 4BNCA 1Y6IA 1FBQA 1U5TA 3AG3H 2FXAA 1HDDC 4RAYA 2DT6A 2M87A 2H94A 3EPZA 3LFUA 3ASOH 4J19A 3HUGA 3WE3A 2KLOA 3CUOA 3FWEA 2Z16A 3M7GA 3CCLI 1GDTA 1O3TA 1STZA 3G2BA 2VXDA 2EH3A 1RIOH 2V6CA 3E5QA 1I5ZA 1P4AA 1YFHA 1G3YA 4E7SA 3DKXA 3OSFA 1I3AA 2UXXA 1LEAA 3L1PA 3TP3A 3Q9SA 3WGGA 4I0BA 3EYIA 2W57A 3IH4A 1T56A 4HX4A 1FSHA 3ZQQA 2K3PA 4EJOA 1Z77A 4AD9A 1RI7A 2KJCA 3BR1A 3M1CA 2KIUA 3SJMA 3KZIC 1XD7A 3L09A 3KYDB 1OCPA 2LR8A 4HX7A 3G1MA 1P2FA 3F21A 4D7NA 1JUPA 1XGNA 2DFEA 3GUDA 3WHBA 2R7ZJ 1IRZA 4F92B 4PJMA 2NVXJ 2OAZA 1VQ5I 4M71A 4AU7A 3K70C 4YFXF 2OU2A 3CCQI 4OWRB 2LP0A 3AL0C 1XDSA 1PP8F 5ILVA 1EH8A 2LBFB 3NARA 4AUXA 1S7OA 2DN0A 5EGOB 2VKVA 1FTTA 3RKXA 4HQEA 1ONVA 3H9JA 5HS9A 3TMOA 3MKWB 5LBQA 1ZHFA 3I5UA 1QZZA 2IW5A 2GA2A 2DQLA 3C1DA 1YI2I 3OOPA 2K9QA 2E1CA 1HOMA 2E60A 5FFZA 4L9TA
chains in the Genus database with same CATH topology
4P96A 4EJUA 2O3FA 3T0YA 5BPDA 4HA8A 4I09A 2HYGD 2KJBA 2VBWA 3P9CA 2QZ8A 1F4KA 3HOTA 3PQKA 3DPTA 5CVUA 1KGSA 3LQQA 5DD8A 1EV7A 4G7HF 2JZYA 1NHAA 5FLXK 4KIGA 3V8LA 4MTEA 1W7PB 3RKWA 3OV8A 4LLGF 1FNNA 4YFKF 5DV5A 2BEOA 4R8HA 1XGSA 3R60A 1R1TA 3MAJA 2QQBA 3K69A 4AIJA 1T0FA 5CVIA 4OIRF 1BI3A 4UVCA 1O7FA 1SMYF 1BBYA 3HOSA 1B4AA 4G7ZF 4ZYDA 1FZPB 1IN7A 1L3LA 5LRSA 2KRFA 2Y75A 1Z91A 4QLCU 4HYEA 2PEXA 1XB4A 2Z5UA 3K2ZA 1OMIA 3P9IA 2W85A 2EB7A 4MEYF 1MZBA 4CYDA 3GZ6A 3CJNA 5DEQA 2CYYA 4FX0A 1U8RA 2P5VA 5IT9Z 5ED4A 2L4MA 4UV8A 4LG0B 3WTTC 3LSTA 4G9YA 4OIQF 5K5OA 3PQJA 3B73A 2VT3A 4ENNA 1HW2A 2YU3A 4M73A 2PJPA 2DU9A 4E70A 2HDCA 3W6JB 3RIRA 1S29A 1Y0UA 4KMUX 4QWQA 5L3CA 3V8JA 3GFLA 3M1EA 5ILUA 3ML6A 4LK1F 3BP8A 2XIGA 2XAFA 1IZ1A 2O61A 1E17A 4JK1X 1T39A 2IA2A 1UHWA 2JSCA 2FSWA 1KU2A 5L3DA 2EV0A 4PCQA 5HVQC 2XVCA 2Z9OA 4L5JA 1ZAOA 2LKPA 1YW9A 3FHZA 1F5TA 1R1VA 1TLHB 4RB2C 1XCVA 4MNUA 5A2QK 5HDGA 2A5YB 1P92A 1J75A 2COMA 1OPCA 3BROA 2PI0A 4IJAA 4P55A 2L4AA 2R3SA 2VC0A 3VODA 2LNBA 3KP7A 4YG2F 5J8CA 4M72A 1PUEE 1R22A 5LHGA 3L00A 4I0AA 2VODA 5L3BA 4XBFA 1ZG3A 2LSOA 3GW2A 1HKTA 5F1RA 1G6NA 1HQCA 1U5TB 3L9FA 3VB2A 2D1HA 1X3UA 5ICFA 4HLYA 1QBJA 4TV7A 3DEUA 4M9ZA 2GA1A 5IT3A 3WU1B 3K1PA 2P6TA 5CYVA 1IN6A 1Z9CA 3ELKA 4OMYA 2DQRA 1U2WA 3F6VA 4RB0A 3TDUC 1DPUA 2VBZA 1KA8A 1ZGJA 3K0LA 3HHGA 1W5TA 1HW1A 4RB1A 2C6YA 4A6DA 2ELHA 1XN7A 4ESJA 3IWFA 3G73A 1IRGA 2RV8A 3Q9VA 2O03A 2XUBA 1B6AA 4M6XA 5BOXA 3FMRA 1W7PA 4L18B 3JTHA 1MD0A 4R1HA 2DT5A 3T8TA 1ZN2A 2PBIA 4ENMA 3JAMK 1C0WA 3JTGA 4I98B 3GXOA 1LQ1A 3E97A 1H0MA 2MH9A 4CGZA 2RGVA 4UNOA 2PLYA 5AIQA 4Y17A 4ZYGA 4OINF 5LRRA 2IP2A 5FD5A 2QBYB 2YPRA 5CVRA 3O6BB 4A6EA 5D8KB 3IRRA 4KN4X 2KKOA 2K86A 2D2WA 3RYRA 1SFXA 4ZZDA 3SZTA 4ZYHA 2CFXA 4MGRA 2GWRA 4OU0A 1P4WA 3V4GA 2NNYA 3ISPA 4M9SA 1A04A 3R61A 3VEPA 1EH7A 1G3SA 4MQ9F 3TDZC 4O6JA 3BPVA 1L0OC 1J5YA 2HKOA 4XRFA 2QQAA 5DYMA 5E8GA 2Y48A 3SFZA 5FB2A 3IC7A 4Y13A 4PGGA 3HRMA 3LQRA 3ZMTA 1KU7A 1Z6RA 1UB9A 3T1BA 5HLHA 2FF4A 2NNNA 4BHPA 2L54A 1B9NA 3F22A 1R7JA 4EM1A 2FNAA 4PZJA 5TRDA 1T6SA 1D5VA 1OR7A 3FMQA 4ENJA 1FC3A 1DDNA 2BV6A 3IWZA 2XAGA 1QGPA 3BWGA 2R7DA 3HTSB 1S6LA 3ULQB 4N9HA 1P4XA 4IRHA 2DI3A 2TDXA 4AWXB 4L0ZB 1RUOA 2J5OA 5AONA 2OD5A 3ECHA 3SXYA 4G6QA 3I53A 4KN7X 2YX7A 4Y15A 3E6DA 1IXRC 3BDDA 3HSEA 4U0WA 4AVPA 2FBHA 2LF7A 4HOBA 3BOQA 2MLGA 1TQPA 2QENA 4A5NA 4WF2A 5CVVA 4ENKA 1JHFA 2MBFA 4GGGA 2E7XA 5ICGA 4RGRA 2VBXA 5KVRA 1BI0A 2V79A 3KZYA 2A6HF 3QPTA 1S7AA 5J6XA 1K78B 3D0SA 5H6QA 4EGZA 3HTUA 3DKWA 1KYZA 3TGNA 5D4SA 2QQ9A 1OYYA 3BZ6A 2EFWA 3K9TA 1LB2A 4L9NA 1V4RA 5HDKA 1KQ9A 1FYLA 4N9IA 5L3EA 3E6MA 2W24A 1SAXA 3VOEA 2OBPA 1UHMA 2UWMA 2ADUA 2NAZA 3FXUA 1J59A 1O3QA 4DNCA 4CO8A 3IKVA 2ZKZA 1W5SA 2DK8A 3KE2A 2Q2EA 2ESNA 3GFIA 2KIMA 4U7DA 1VTNC 1O57A 2GQQA 3WTVC 3J7AO 4MTDA 1B9MA 1XSXA 2EV6A 2HYFA 1O7LA 2H09A 3EUHA 3MQ0A 2P5KA 1ON2A 1ZG5A 1IW7F 4H0EA 4GYGA 3REOA 2GAUA 1S3JA 2HR3A 3IHUA 2FOKA 3V7RA 1W4MA 2FMYA 4HF1A 3C3WA 3L2CA 2CWEA 5D6EA 4OOIA 1LEBA 3RPUA 5J8FA 5ILSA 2QBYA 5E1WA 3F72A 5DUKA 2DK5A 2MC3A 5K5RA 1H9TA 4JBAA 1G3TA 1K79A 3TOAA 1EH6A 1KU3A 3F8NA 4IHSA 4HW0A 4IPAA 3QOPA 2DPUA 4BQAA 2HKXA 4LLNA 2OA4A 2G7HA 1D8JA 3F8MA 1ZLKA 1XCBA 2XROA 5CVJA 1FWZA 2RNJA 2CQKA 1CF7A 3BJAA 2EWNA 2FQ3A 1OYIA 4XSZF 3TO9A 5E17F 5E18F 5DDGA 2YX4A 1PP7U 1FPQA 3BJOA 3LAJA 4I7HA 2HS5A 5DD4A 3I59B 1GHCA 5DCFA 1BIBA 3T8RA 1SD4A 1IAWA 5D5XB 4WXHA 2DLLA 2FA5A 1Q1HA 1MJBA 1FY7A 1SD6A 1KU9A 2HQNA 1LVAA 3LWFA 3CUQC 1MJAA 5HOOA 4LMYA 2STWA 2W25A 2DFIA 4RB3C 2RKHA 1YYVA 1TQMA 3JSPA 4U0VA 2XAJA 3KETA 4A12A 3KP5A 3ZP5A 4P9UA 5E20A 2OQRA 2FU4A 1LJ9A 1P6RA 1FLIA 4GYIA 4KA4A 2IA0A 2A69F 2NYXA 2D45A 4XLPF 4I2OA 3H92A 3H3ZA 3O3KA 1YTYA 3VFZA 4KIBA 3WGHA 2HWVA 1K78A 1V3FA 4GO1A 5FO5A 1F9NA 2ZMEA 3GX4X 5HDNA 5FD6A 1IXSB 2PFBA 4UVAA 4UUVA 2IVMA 1CGPA 4PGHA 3WTUC 3E5UA 5EEGA 4HDUA 2CW0F 5K1YA 2K4BA 2PG4A 1T98A 2LDUA 1FBSA 1GXPA 2ZNZA 4L5IA 3IKTA 4KYWA 2E1NA 2ZCWA 4BXUA 3SQNA 4WWCA 4Q5SF 1BI1A 3HYIA 1DPRA 3E5XA 1QNTA 4CHUA 1S8NA 2O6GE 3MCZA 3TOBA 1B59A 2QUFA 2Q8KA 3ABTA 3LFKA 3DQVC 2NRAC 4YIFA 4I02A 1TQIA 3WTWC 3GFMA 2VOPA 1BI2A 2EFOA 3WTZA 5FLXZ 3B02A 2EA4A 3KFWX 5JHUA 2WTEA 4HDVA 2M5WA 1GVJA 1TNTA 5ICEA 2HZTA 4L9JA 2D1VA 1ZRFA 1KQ8A 1UFMA 4P9FA 4XLNF 4I01A 1U78A 1MGTA 5D6FA 2K4JA 3FM3A 4OMZA 2VC1A 1HKQA 2RC4A 4A0XA 2K02A 2A07F 4HZFA 2FEZA 3RJPA 1WQ2A 2M45A 3EDPA 1HW5A 4A2UA 3KCCA 4L9VA 1WWXA 3DXJF 3PFIA 4KDPA 5L3GA 2KIFA 4ASNA 1R1UA 1REPC 3GZ5A 4MHGA 1ZYRF 1I27A 1JGSA 5D8LB 3AAFA 2ISYA 2STTA 3I59A 2RDPA 3COAC 3NRVA 3FM5A 2IRFG 3RTRA 3M9AA 1G3WA 2V1XA 5FFXA 3DP7A 1Z7UA 5E1ZB 1FSEA 2EA2A 2HTSA 4LB6B 5LEKA 4IRGA 1CF7B 1WRJA 5L3FA 1XSDA 3KLNA 2M30A 4HF0A 3ZMUA 2XRNA 3KP3A 3V7SA 2IT0A 2V9VA 2QWWA 3O2PE 3TO7A 3RI4A 1QQIA 2V1UA 2XV4S 3P7NA 3GLXA 2BYVE 3HRUA 2CGPA 1YQAA 2XKOA 5DUIA 3J80Z 4GXOA 2XHKA 4BHCA 3RKYA 2P6SA 2GZWA 1G4DA 3Q5FA 3K1NA 1BC8C 3M8FA 3GEZA 1YS7A 4N0BA 4CDGA 4BHBA 4LK0F 3ROUA 1TBXA 4JQFA 2VBYA 4NHJA 3ZMZA 4AIHA 4O5VA 2K27A 2PMHA 2XASA 4LJZF 3TQNA 4NB5A 3RDIA 4HAMA 4ETSA 1IN5A 5JVTA 1IN8A 3HHHA 2UZKA 1ON1A 3GYHX 3CUQB 4K2EA 2HEOA 2R7FA 4ESBA 1ULYA 3F3XA 4HQMA 4U0YA 5IT9K 2IJLA 5LGUA 1J9IA 3F23A 2EK5A 2OZ6A 3GO5A 2WWYA 1ZLJA 3E6CC 4GCVA 2EFQA 2ZBKA 5BS6A 1U5TC 1IUYA 1HSJA 2FRHA 2AS5F 1J0RA 2ZMEB 4HV6A 1BC7C 1B1BA 5TJJA 1BIAA 5LGNA 1JE8A 1FP1D 4L0YB 4PDKA 3QAHA 4CZZA 2P4WA 1LNWA 2FE3A 1YW8A 5AIPA 2XGXA 4EQQA 4S04A 3E3VA 1OKRA 4WXCA 2QVOA 2VT2A 3L7WA 2DW4A 1YLFA 3V8KA 2VXZA 5LHHA 2ACJA 3QRFF 2QYOA 2HGCA 3JAMZ 1U3EM 1TW2A 2FBKA 1T2KA 3KEQA 4CXFA 4IHTA 1I1GA 1YIOA 1R5HA 4DQ2A 2K7LA 3R6SA 4AIKA 1ODDA 3U1DA 3BY6A 3TO6A 4EVIA 4LB5A 2ETHA 5HS8A 1SD5A 5BMZA 3BJ6A 4MQVA 4IRIA 3ZMDA 2ZJ2A 3F8FA 1JXSA 1MJ9A 3JSOA 3CO6C 2HFHA 4OIPF 3SZPA 1USSA 3WE2A 3EQLF 3HSRA 3R4KA 4WX9A 2VN2A 1ZARA 1O3RA 1R36A 2L01A 4M74A 4BAYA 5E8IA 3ZN1A 4HX8A 1FP2A 1XSVA 4NQWA 5JR3A 1ZRDA 1MDMB 2A6EF 2ZO4A 4G7OF 1HKSA 4WCGA 1FOKA 1QPMA 4KFCA 4EM2A 1YW7A 2BBYA 2FNPA 4B09A 4FX4A 4U7BA 5BQTA 2O0YA 3MFKA 1K7AA 1SMTA 3JW4A 2VOOA 2F5FA 2PMUA 4ZZLA 5HS7A 4G6DA 1LDDA 1U6GA 3LA2A 2EJRA 1HSTA 1R00A 3WTYC 4U88A 5DCMA 1IXCA 2ZNYA 3E6BA 4A0YA 3MZYA 2ZXJA 3QU6A 1KQ0A 1ZREA 3R0JA 2L3DA 2CG4A 3BPXA 2EFPA 1IN4A 4BYYA 2F2EA 3I0TA 3ABUA 2YSRA 3MEXA 2G7UA 2A68F 3J81Z 3CTAA 2Q0OA 2Z33A 1OYWA 1TW3A 3ZPLA 4HLXA 1XDUA 1RUNA 5CLSA 1I1SA 2CO5A 3ZQ7A 2E7WA 2A3SA 2MD5A 1TNSA 2P7CB 2P7VB 1HXDA 3N4MA 2OZUA 4LGWA 4YFNF 4ZYEA 1HBXG 4R79A 3I58A 4EJVA 1J2XA 1BOAA 3LA3A 3I64A 3CUQA 4HBLA 1RZ4A 3FXQA 4D0PA 2V1DA 3GWZA 3R0AA 2M1BA 2PQ8A 2AXLA 1DUXC 3GVAA 3I71A 3W6KB 2OQGA 3EYYA 5D5VB 2L02A 3KP4A 3KP2A 3SHFA 1GXQA 2ZFWA 4LD5A 4Q48A 3WTSC 1BN5A 2NS0A 3HRTA 4EJWA 1QO0D 3EETA 4UVBA 1YO5C 2IA1A 3J80K 3FX3A 4S05A 3C7JA 2JTVA 2X0LA 1WKMA 4UXNA 1AOYA 5D4RA 2DAOA 3C18A 1UCRA 2HQRA 2H6BA 3WGIA 3U2RA 4YIIA 2EV5A 2GIVA 3HIFA 3I54A 3KP6A 3FMSA 1JHHA 1ZG1A 4G94A 2PN6A 3NEUA 5LEJA 3KLOA 1MKMA 3CDHA 1USTA 2M8EA 2B0LA 5HLIA 2VE9A 1H9GA 4Q4ZF 1Z1DA 3RPQA 3HSFA 4IF4A 2DBBA 6PAXA 3G3ZA 4RGUA 4BH9A 2EFNA 4A5MA 4WXDA 2JT1A 2FMLA 4O3MA 3M8EA 2BE5F 3S2WA 3KZZA 2RVCA 5E1XA 2G9WA 3WTXC 4RAZA 2XAHA 2F5CA 2P8TA 1E2XA 3F6OA 3RYPA 3N97A 5K5QA 1YS6A 4EM0B 4KIFA 3TKYA 1R58A 3DFGA 3LAPA 2H6CA 4UHTA 4LFUA 4XSXF 2XKPA 4KMFA 2YR2A 3LA7A 2VONA 3GFJA 4Z2YA 1DP7P 5D5UB 3DF8A 2A61A 3CO7C 4RGXA 3WODF 2UXNA 3V7CA 1MDMA 3ZN0A 3KEOA 1J7KA 3CLOA 1FT9A 3F8CA 1T38A 3H3UA 2DTRA 4ON0A 2WC2A 2IPQX 1FYKA 3DPLC 3MWMA 4ESFA 2F5DA 2QM3A 1ZH5A 4EV0A 2QLZA 5EEHA 1SFUA 2FBIA 3I4PA 1YG2A 1FX7A 2P5LC 3FZVA 1AWCA 1XMKA 3F8BA 2XAQA 4FT8A 1F1ZA 1O3SA 3GF2A 1LDKB 2WV0A 5ICCA 4UV9A 5LGTA 1XGMA 1BM9A 3QU3A 5F64A 1PDNC 1W7PD 3ZMSA 4WK8F 4KICA 2F5EA 2J5PA 1KYWA 5ERIA 4HF2A 2DO7A 2CSOA 2JPCA 3FF5A 1D3YA 5H20A 3QPHA 5HLGA 2RN7A 2ISZA 3ERED 1WSUA 1XGOA 2Z99A 3D5LA 5JI6A 4LG0A 2O8XA 4KUMA 5DCMB 1XMAA 4EMSA 4RGSA 2ESHA 2Y0MA 5FGMA 4F7ZA 2W84A 3ZMVA 3IL2A 4M6YA 1Z6TA 2HTJA 1BJAA 5A2QZ 5CJ9A 4OIOF 3DV8A 3HRSA 3NQOA 1Z05A 1ZGAA 2RQPA 4HV5A 2HOEA 1FYMA 4RS8A 3T5XA 1WI9A 1FBUA 4G8XA 1I6XA 1D8KA 2JPBA 5F6FA 4Q47A 4KT5C 1ZRCA 3MZHA 1R23A 3WU0A 4EJTA 5H6RA 3P9KA 1RNLA 3K1MA 4A0ZA 1TTYA 4FHTA 2LF8A 2DPDA 3FXRA 5LHIA 1K6OA 1R5GA 2H27A 4LLLA 2MH2A 4ZH4F 3J81K 4B8XA 1SFEA 1QZYA 3U9GA 2Z3YA 5D5WB 2BGCA 3ECOA 4IVNA 4M9XA 3QP6A 4CICA 1IRFA 2MLKA 2GXGA 4IXAA 2X4HA 1LDJA 3WG9A 3QP5A 3IRQA 2MA3A 2VE8A 1IF1A 4P5OA 2GXBA 5KK1A 5JFRA 4KNYA 4EGYA 1SD7A 4MEXF 2JRTA 5LLQA 5BPIA 4BNCA 1FBQA 1U5TA 2FXAA 4RAYA 2M87A 2H94A 3HUGA 3WE3A 3CUOA 3FWEA 3M7GA 1O3TA 1STZA 1RIOH 2V6CA 3E5QA 1I5ZA 1P4AA 1YFHA 1G3YA 2UXXA 1LEAA 3Q9SA 3WGGA 4I0BA 3EYIA 2W57A 4HX4A 1FSHA 4EJOA 4AD9A 1RI7A 2KJCA 2KIUA 1XD7A 3L09A 4HX7A 1P2FA 3F21A 1XGNA 3GUDA 2OAZA 4M71A 4YFXF 2OU2A 1XDSA 1PP8F 5ILVA 1EH8A 1S7OA 3RKXA 4HQEA 1ONVA 5HS9A 5LBQA 1ZHFA 3I5UA 1QZZA 2IW5A 2GA2A 2DQLA 3C1DA 3OOPA 2E1CA 5FFZA 4L9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P96 A;  4EJU A;  2O3F A;  3T0Y A;  5BPD A;  4HA8 A;  4I09 A;  2HYG D;  2KJB A;  2VBW A;  3P9C A;  2QZ8 A;  1F4K A;  3HOT A;  3PQK A;  3DPT A;  5CVU A;  1KGS A;  3LQQ A;  5DD8 A;  1EV7 A;  4G7H F;  2JZY A;  1NHA A;  5FLX K;  4KIG A;  3V8L A;  4MTE A;  1W7P B;  3RKW A;  3OV8 A;  4LLG F;  1FNN A;  4YFK F;  5DV5 A;  2BEO A;  4R8H A;  1XGS A;  3R60 A;  1R1T A;  3MAJ A;  2QQB A;  3K69 A;  4AIJ A;  1T0F A;  5CVI A;  4OIR F;  1BI3 A;  4UVC A;  1O7F A;  1SMY F;  1BBY A;  3HOS A;  1B4A A;  4G7Z F;  4ZYD A;  1FZP B;  1IN7 A;  1L3L A;  5LRS A;  2KRF A;  2Y75 A;  1Z91 A;  4QLC U;  4HYE A;  2PEX A;  1XB4 A;  2Z5U A;  3K2Z A;  1OMI A;  3P9I A;  2W85 A;  2EB7 A;  4MEY F;  1MZB A;  4CYD A;  3GZ6 A;  3CJN A;  5DEQ A;  2CYY A;  4FX0 A;  1U8R A;  2P5V A;  5IT9 Z;  5ED4 A;  2L4M A;  4UV8 A;  4LG0 B;  3WTT C;  3LST A;  4G9Y A;  4OIQ F;  5K5O A;  3PQJ A;  3B73 A;  2VT3 A;  4ENN A;  1HW2 A;  2YU3 A;  4M73 A;  2PJP A;  2DU9 A;  4E70 A;  2HDC A;  3W6J B;  3RIR A;  1S29 A;  1Y0U A;  4KMU X;  4QWQ A;  5L3C A;  3V8J A;  3GFL A;  3M1E A;  5ILU A;  3ML6 A;  4LK1 F;  3BP8 A;  2XIG A;  2XAF A;  1IZ1 A;  2O61 A;  1E17 A;  4JK1 X;  1T39 A;  2IA2 A;  1UHW A;  2JSC A;  2FSW A;  1KU2 A;  5L3D A;  2EV0 A;  4PCQ A;  5HVQ C;  2XVC A;  2Z9O A;  4L5J A;  1ZAO A;  2LKP A;  1YW9 A;  3FHZ A;  1F5T A;  1R1V A;  1TLH B;  4RB2 C;  1XCV A;  4MNU A;  5A2Q K;  5HDG A;  2A5Y B;  1P92 A;  1J75 A;  2COM A;  1OPC A;  3BRO A;  2PI0 A;  4IJA A;  4P55 A;  2L4A A;  2R3S A;  2VC0 A;  3VOD A;  2LNB A;  3KP7 A;  4YG2 F;  5J8C A;  4M72 A;  1PUE E;  1R22 A;  5LHG A;  3L00 A;  4I0A A;  2VOD A;  5L3B A;  4XBF A;  1ZG3 A;  2LSO A;  3GW2 A;  1HKT A;  5F1R A;  1G6N A;  1HQC A;  1U5T B;  3L9F A;  3VB2 A;  2D1H A;  1X3U A;  5ICF A;  4HLY A;  1QBJ A;  4TV7 A;  3DEU A;  4M9Z A;  2GA1 A;  5IT3 A;  3WU1 B;  3K1P A;  2P6T A;  5CYV A;  1IN6 A;  1Z9C A;  3ELK A;  4OMY A;  2DQR A;  1U2W A;  3F6V A;  4RB0 A;  3TDU C;  1DPU A;  2VBZ A;  1KA8 A;  1ZGJ A;  3K0L A;  3HHG A;  1W5T A;  1HW1 A;  4RB1 A;  2C6Y A;  4A6D A;  2ELH A;  1XN7 A;  4ESJ A;  3IWF A;  3G73 A;  1IRG A;  2RV8 A;  3Q9V A;  2O03 A;  2XUB A;  1B6A A;  4M6X A;  5BOX A;  3FMR A;  1W7P A;  4L18 B;  3JTH A;  1MD0 A;  4R1H A;  2DT5 A;  3T8T A;  1ZN2 A;  2PBI A;  4ENM A;  3JAM K;  1C0W A;  3JTG A;  4I98 B;  3GXO A;  1LQ1 A;  3E97 A;  1H0M A;  2MH9 A;  4CGZ A;  2RGV A;  4UNO A;  2PLY A;  5AIQ A;  4Y17 A;  4ZYG A;  4OIN F;  5LRR A;  2IP2 A;  5FD5 A;  2QBY B;  2YPR A;  5CVR A;  3O6B B;  4A6E A;  5D8K B;  3IRR A;  4KN4 X;  2KKO A;  2K86 A;  2D2W A;  3RYR A;  1SFX A;  4ZZD A;  3SZT A;  4ZYH A;  2CFX A;  4MGR A;  2GWR A;  4OU0 A;  1P4W A;  3V4G A;  2NNY A;  3ISP A;  4M9S A;  1A04 A;  3R61 A;  3VEP A;  1EH7 A;  1G3S A;  4MQ9 F;  3TDZ C;  4O6J A;  3BPV A;  1L0O C;  1J5Y A;  2HKO A;  4XRF A;  2QQA A;  5DYM A;  5E8G A;  2Y48 A;  3SFZ A;  5FB2 A;  3IC7 A;  4Y13 A;  4PGG A;  3HRM A;  3LQR A;  3ZMT A;  1KU7 A;  1Z6R A;  1UB9 A;  3T1B A;  5HLH A;  2FF4 A;  2NNN A;  4BHP A;  2L54 A;  1B9N A;  3F22 A;  1R7J A;  4EM1 A;  2FNA A;  4PZJ A;  5TRD A;  1T6S A;  1D5V A;  1OR7 A;  3FMQ A;  4ENJ A;  1FC3 A;  1DDN A;  2BV6 A;  3IWZ A;  2XAG A;  1QGP A;  3BWG A;  2R7D A;  3HTS B;  1S6L A;  3ULQ B;  4N9H A;  1P4X A;  4IRH A;  2DI3 A;  2TDX A;  4AWX B;  4L0Z B;  1RUO A;  2J5O A;  5AON A;  2OD5 A;  3ECH A;  3SXY A;  4G6Q A;  3I53 A;  4KN7 X;  2YX7 A;  4Y15 A;  3E6D A;  1IXR C;  3BDD A;  3HSE A;  4U0W A;  4AVP A;  2FBH A;  2LF7 A;  4HOB A;  3BOQ A;  2MLG A;  1TQP A;  2QEN A;  4A5N A;  4WF2 A;  5CVV A;  4ENK A;  1JHF A;  2MBF A;  4GGG A;  2E7X A;  5ICG A;  4RGR A;  2VBX A;  5KVR A;  1BI0 A;  2V79 A;  3KZY A;  2A6H F;  3QPT A;  1S7A A;  5J6X A;  1K78 B;  3D0S A;  5H6Q A;  4EGZ A;  3HTU A;  3DKW A;  1KYZ A;  3TGN A;  5D4S A;  2QQ9 A;  1OYY A;  3BZ6 A;  2EFW A;  3K9T A;  1LB2 A;  4L9N A;  1V4R A;  5HDK A;  1KQ9 A;  1FYL A;  4N9I A;  5L3E A;  3E6M A;  2W24 A;  1SAX A;  3VOE A;  2OBP A;  1UHM A;  2UWM A;  2ADU A;  2NAZ A;  3FXU A;  1J59 A;  1O3Q A;  4DNC A;  4CO8 A;  3IKV A;  2ZKZ A;  1W5S A;  2DK8 A;  3KE2 A;  2Q2E A;  2ESN A;  3GFI A;  2KIM A;  4U7D A;  1VTN C;  1O57 A;  2GQQ A;  3WTV C;  3J7A O;  4MTD A;  1B9M A;  1XSX A;  2EV6 A;  2HYF A;  1O7L A;  2H09 A;  3EUH A;  3MQ0 A;  2P5K A;  1ON2 A;  1ZG5 A;  1IW7 F;  4H0E A;  4GYG A;  3REO A;  2GAU A;  1S3J A;  2HR3 A;  3IHU A;  2FOK A;  3V7R A;  1W4M A;  2FMY A;  4HF1 A;  3C3W A;  3L2C A;  2CWE A;  5D6E A;  4OOI A;  1LEB A;  3RPU A;  5J8F A;  5ILS A;  2QBY A;  5E1W A;  3F72 A;  5DUK A;  2DK5 A;  2MC3 A;  5K5R A;  1H9T A;  4JBA A;  1G3T A;  1K79 A;  3TOA A;  1EH6 A;  1KU3 A;  3F8N A;  4IHS A;  4HW0 A;  4IPA A;  3QOP A;  2DPU A;  4BQA A;  2HKX A;  4LLN A;  2OA4 A;  2G7H A;  1D8J A;  3F8M A;  1ZLK A;  1XCB A;  2XRO A;  5CVJ A;  1FWZ A;  2RNJ A;  2CQK A;  1CF7 A;  3BJA A;  2EWN A;  2FQ3 A;  1OYI A;  4XSZ F;  3TO9 A;  5E17 F;  5E18 F;  5DDG A;  2YX4 A;  1PP7 U;  1FPQ A;  3BJO A;  3LAJ A;  4I7H A;  2HS5 A;  5DD4 A;  3I59 B;  1GHC A;  5DCF A;  1BIB A;  3T8R A;  1SD4 A;  1IAW A;  5D5X B;  4WXH A;  2DLL A;  2FA5 A;  1Q1H A;  1MJB A;  1FY7 A;  1SD6 A;  1KU9 A;  2HQN A;  1LVA A;  3LWF A;  3CUQ C;  1MJA A;  5HOO A;  4LMY A;  2STW A;  2W25 A;  2DFI A;  4RB3 C;  2RKH A;  1YYV A;  1TQM A;  3JSP A;  4U0V A;  2XAJ A;  3KET A;  4A12 A;  3KP5 A;  3ZP5 A;  4P9U A;  5E20 A;  2OQR A;  2FU4 A;  1LJ9 A;  1P6R A;  1FLI A;  4GYI A;  4KA4 A;  2IA0 A;  2A69 F;  2NYX A;  2D45 A;  4XLP F;  4I2O A;  3H92 A;  3H3Z A;  3O3K A;  1YTY A;  3VFZ A;  4KIB A;  3WGH A;  2HWV A;  1K78 A;  1V3F A;  4GO1 A;  5FO5 A;  1F9N A;  2ZME A;  3GX4 X;  5HDN A;  5FD6 A;  1IXS B;  2PFB A;  4UVA A;  4UUV A;  2IVM A;  1CGP A;  4PGH A;  3WTU C;  3E5U A;  5EEG A;  4HDU A;  2CW0 F;  5K1Y A;  2K4B A;  2PG4 A;  1T98 A;  2LDU A;  1FBS A;  1GXP A;  2ZNZ A;  4L5I A;  3IKT A;  4KYW A;  2E1N A;  2ZCW A;  4BXU A;  3SQN A;  4WWC A;  4Q5S F;  1BI1 A;  3HYI A;  1DPR A;  3E5X A;  1QNT A;  4CHU A;  1S8N A;  2O6G E;  3MCZ A;  3TOB A;  1B59 A;  2QUF A;  2Q8K A;  3ABT A;  3LFK A;  3DQV C;  2NRA C;  4YIF A;  4I02 A;  1TQI A;  3WTW C;  3GFM A;  2VOP A;  1BI2 A;  2EFO A;  3WTZ A;  5FLX Z;  3B02 A;  2EA4 A;  3KFW X;  5JHU A;  2WTE A;  4HDV A;  2M5W A;  1GVJ A;  1TNT A;  5ICE A;  2HZT A;  4L9J A;  2D1V A;  1ZRF A;  1KQ8 A;  1UFM A;  4P9F A;  4XLN F;  4I01 A;  1U78 A;  1MGT A;  5D6F A;  2K4J A;  3FM3 A;  4OMZ A;  2VC1 A;  1HKQ A;  2RC4 A;  4A0X A;  2K02 A;  2A07 F;  4HZF A;  2FEZ A;  3RJP A;  1WQ2 A;  2M45 A;  3EDP A;  1HW5 A;  4A2U A;  3KCC A;  4L9V A;  1WWX A;  3DXJ F;  3PFI A;  4KDP A;  5L3G A;  2KIF A;  4ASN A;  1R1U A;  1REP C;  3GZ5 A;  4MHG A;  1ZYR F;  1I27 A;  1JGS A;  5D8L B;  3AAF A;  2ISY A;  2STT A;  3I59 A;  2RDP A;  3COA C;  3NRV A;  3FM5 A;  2IRF G;  3RTR A;  3M9A A;  1G3W A;  2V1X A;  5FFX A;  3DP7 A;  1Z7U A;  5E1Z B;  1FSE A;  2EA2 A;  2HTS A;  4LB6 B;  5LEK A;  4IRG A;  1CF7 B;  1WRJ A;  5L3F A;  1XSD A;  3KLN A;  2M30 A;  4HF0 A;  3ZMU A;  2XRN A;  3KP3 A;  3V7S A;  2IT0 A;  2V9V A;  2QWW A;  3O2P E;  3TO7 A;  3RI4 A;  1QQI A;  2V1U A;  2XV4 S;  3P7N A;  3GLX A;  2BYV E;  3HRU A;  2CGP A;  1YQA A;  2XKO A;  5DUI A;  3J80 Z;  4GXO A;  2XHK A;  4BHC A;  3RKY A;  2P6S A;  2GZW A;  1G4D A;  3Q5F A;  3K1N A;  1BC8 C;  3M8F A;  3GEZ A;  1YS7 A;  4N0B A;  4CDG A;  4BHB A;  4LK0 F;  3ROU A;  1TBX A;  4JQF A;  2VBY A;  4NHJ A;  3ZMZ A;  4AIH A;  4O5V A;  2K27 A;  2PMH A;  2XAS A;  4LJZ F;  3TQN A;  4NB5 A;  3RDI A;  4HAM A;  4ETS A;  1IN5 A;  5JVT A;  1IN8 A;  3HHH A;  2UZK A;  1ON1 A;  3GYH X;  3CUQ B;  4K2E A;  2HEO A;  2R7F A;  4ESB A;  1ULY A;  3F3X A;  4HQM A;  4U0Y A;  5IT9 K;  2IJL A;  5LGU A;  1J9I A;  3F23 A;  2EK5 A;  2OZ6 A;  3GO5 A;  2WWY A;  1ZLJ A;  3E6C C;  4GCV A;  2EFQ A;  2ZBK A;  5BS6 A;  1U5T C;  1IUY A;  1HSJ A;  2FRH A;  2AS5 F;  1J0R A;  2ZME B;  4HV6 A;  1BC7 C;  1B1B A;  5TJJ A;  1BIA A;  5LGN A;  1JE8 A;  1FP1 D;  4L0Y B;  4PDK A;  3QAH A;  4CZZ A;  2P4W A;  1LNW A;  2FE3 A;  1YW8 A;  5AIP A;  2XGX A;  4EQQ A;  4S04 A;  3E3V A;  1OKR A;  4WXC A;  2QVO A;  2VT2 A;  3L7W A;  2DW4 A;  1YLF A;  3V8K A;  2VXZ A;  5LHH A;  2ACJ A;  3QRF F;  2QYO A;  2HGC A;  3JAM Z;  1U3E M;  1TW2 A;  2FBK A;  1T2K A;  3KEQ A;  4CXF A;  4IHT A;  1I1G A;  1YIO A;  1R5H A;  4DQ2 A;  2K7L A;  3R6S A;  4AIK A;  1ODD A;  3U1D A;  3BY6 A;  3TO6 A;  4EVI A;  4LB5 A;  2ETH A;  5HS8 A;  1SD5 A;  5BMZ A;  3BJ6 A;  4MQV A;  4IRI A;  3ZMD A;  2ZJ2 A;  3F8F A;  1JXS A;  1MJ9 A;  3JSO A;  3CO6 C;  2HFH A;  4OIP F;  3SZP A;  1USS A;  3WE2 A;  3EQL F;  3HSR A;  3R4K A;  4WX9 A;  2VN2 A;  1ZAR A;  1O3R A;  1R36 A;  2L01 A;  4M74 A;  4BAY A;  5E8I A;  3ZN1 A;  4HX8 A;  1FP2 A;  1XSV A;  4NQW A;  5JR3 A;  1ZRD A;  1MDM B;  2A6E F;  2ZO4 A;  4G7O F;  1HKS A;  4WCG A;  1FOK A;  1QPM A;  4KFC A;  4EM2 A;  1YW7 A;  2BBY A;  2FNP A;  4B09 A;  4FX4 A;  4U7B A;  5BQT A;  2O0Y A;  3MFK A;  1K7A A;  1SMT A;  3JW4 A;  2VOO A;  2F5F A;  2PMU A;  4ZZL A;  5HS7 A;  4G6D A;  1LDD A;  1U6G A;  3LA2 A;  2EJR A;  1HST A;  1R00 A;  3WTY C;  4U88 A;  5DCM A;  1IXC A;  2ZNY A;  3E6B A;  4A0Y A;  3MZY A;  2ZXJ A;  3QU6 A;  1KQ0 A;  1ZRE A;  3R0J A;  2L3D A;  2CG4 A;  3BPX A;  2EFP A;  1IN4 A;  4BYY A;  2F2E A;  3I0T A;  3ABU A;  2YSR A;  3MEX A;  2G7U A;  2A68 F;  3J81 Z;  3CTA A;  2Q0O A;  2Z33 A;  1OYW A;  1TW3 A;  3ZPL A;  4HLX A;  1XDU A;  1RUN A;  5CLS A;  1I1S A;  2CO5 A;  3ZQ7 A;  2E7W A;  2A3S A;  2MD5 A;  1TNS A;  2P7C B;  2P7V B;  1HXD A;  3N4M A;  2OZU A;  4LGW A;  4YFN F;  4ZYE A;  1HBX G;  4R79 A;  3I58 A;  4EJV A;  1J2X A;  1BOA A;  3LA3 A;  3I64 A;  3CUQ A;  4HBL A;  1RZ4 A;  3FXQ A;  4D0P A;  2V1D A;  3GWZ A;  3R0A A;  2M1B A;  2PQ8 A;  2AXL A;  1DUX C;  3GVA A;  3I71 A;  3W6K B;  2OQG A;  3EYY A;  5D5V B;  2L02 A;  3KP4 A;  3KP2 A;  3SHF A;  1GXQ A;  2ZFW A;  4LD5 A;  4Q48 A;  3WTS C;  1BN5 A;  2NS0 A;  3HRT A;  4EJW A;  1QO0 D;  3EET A;  4UVB A;  1YO5 C;  2IA1 A;  3J80 K;  3FX3 A;  4S05 A;  3C7J A;  2JTV A;  2X0L A;  1WKM A;  4UXN A;  1AOY A;  5D4R A;  2DAO A;  3C18 A;  1UCR A;  2HQR A;  2H6B A;  3WGI A;  3U2R A;  4YII A;  2EV5 A;  2GIV A;  3HIF A;  3I54 A;  3KP6 A;  3FMS A;  1JHH A;  1ZG1 A;  4G94 A;  2PN6 A;  3NEU A;  5LEJ A;  3KLO A;  1MKM A;  3CDH A;  1UST A;  2M8E A;  2B0L A;  5HLI A;  2VE9 A;  1H9G A;  4Q4Z F;  1Z1D A;  3RPQ A;  3HSF A;  4IF4 A;  2DBB A;  6PAX A;  3G3Z A;  4RGU A;  4BH9 A;  2EFN A;  4A5M A;  4WXD A;  2JT1 A;  2FML A;  4O3M A;  3M8E A;  2BE5 F;  3S2W A;  3KZZ A;  2RVC A;  5E1X A;  2G9W A;  3WTX C;  4RAZ A;  2XAH A;  2F5C A;  2P8T A;  1E2X A;  3F6O A;  3RYP A;  3N97 A;  5K5Q A;  1YS6 A;  4EM0 B;  4KIF A;  3TKY A;  1R58 A;  3DFG A;  3LAP A;  2H6C A;  4UHT A;  4LFU A;  4XSX F;  2XKP A;  4KMF A;  2YR2 A;  3LA7 A;  2VON A;  3GFJ A;  4Z2Y A;  1DP7 P;  5D5U B;  3DF8 A;  2A61 A;  3CO7 C;  4RGX A;  3WOD F;  2UXN A;  3V7C A;  1MDM A;  3ZN0 A;  3KEO A;  1J7K A;  3CLO A;  1FT9 A;  3F8C A;  1T38 A;  3H3U A;  2DTR A;  4ON0 A;  2WC2 A;  2IPQ X;  1FYK A;  3DPL C;  3MWM A;  4ESF A;  2F5D A;  2QM3 A;  1ZH5 A;  4EV0 A;  2QLZ A;  5EEH A;  1SFU A;  2FBI A;  3I4P A;  1YG2 A;  1FX7 A;  2P5L C;  3FZV A;  1AWC A;  1XMK A;  3F8B A;  2XAQ A;  4FT8 A;  1F1Z A;  1O3S A;  3GF2 A;  1LDK B;  2WV0 A;  5ICC A;  4UV9 A;  5LGT A;  1XGM A;  1BM9 A;  3QU3 A;  5F64 A;  1PDN C;  1W7P D;  3ZMS A;  4WK8 F;  4KIC A;  2F5E A;  2J5P A;  1KYW A;  5ERI A;  4HF2 A;  2DO7 A;  2CSO A;  2JPC A;  3FF5 A;  1D3Y A;  5H20 A;  3QPH A;  5HLG A;  2RN7 A;  2ISZ A;  3ERE D;  1WSU A;  1XGO A;  2Z99 A;  3D5L A;  5JI6 A;  4LG0 A;  2O8X A;  4KUM A;  5DCM B;  1XMA A;  4EMS A;  4RGS A;  2ESH A;  2Y0M A;  5FGM A;  4F7Z A;  2W84 A;  3ZMV A;  3IL2 A;  4M6Y A;  1Z6T A;  2HTJ A;  1BJA A;  5A2Q Z;  5CJ9 A;  4OIO F;  3DV8 A;  3HRS A;  3NQO A;  1Z05 A;  1ZGA A;  2RQP A;  4HV5 A;  2HOE A;  1FYM A;  4RS8 A;  3T5X A;  1WI9 A;  1FBU A;  4G8X A;  1I6X A;  1D8K A;  2JPB A;  5F6F A;  4Q47 A;  4KT5 C;  1ZRC A;  3MZH A;  1R23 A;  3WU0 A;  4EJT A;  5H6R A;  3P9K A;  1RNL A;  3K1M A;  4A0Z A;  1TTY A;  4FHT A;  2LF8 A;  2DPD A;  3FXR A;  5LHI A;  1K6O A;  1R5G A;  2H27 A;  4LLL A;  2MH2 A;  4ZH4 F;  3J81 K;  4B8X A;  1SFE A;  1QZY A;  3U9G A;  2Z3Y A;  5D5W B;  2BGC A;  3ECO A;  4IVN A;  4M9X A;  3QP6 A;  4CIC A;  1IRF A;  2MLK A;  2GXG A;  4IXA A;  2X4H A;  1LDJ A;  3WG9 A;  3QP5 A;  3IRQ A;  2MA3 A;  2VE8 A;  1IF1 A;  4P5O A;  2GXB A;  5KK1 A;  5JFR A;  4KNY A;  4EGY A;  1SD7 A;  4MEX F;  2JRT A;  5LLQ A;  5BPI A;  4BNC A;  1FBQ A;  1U5T A;  2FXA A;  4RAY A;  2M87 A;  2H94 A;  3HUG A;  3WE3 A;  3CUO A;  3FWE A;  3M7G A;  1O3T A;  1STZ A;  1RIO H;  2V6C A;  3E5Q A;  1I5Z A;  1P4A A;  1YFH A;  1G3Y A;  2UXX A;  1LEA A;  3Q9S A;  3WGG A;  4I0B A;  3EYI A;  2W57 A;  4HX4 A;  1FSH A;  4EJO A;  4AD9 A;  1RI7 A;  2KJC A;  2KIU A;  1XD7 A;  3L09 A;  4HX7 A;  1P2F A;  3F21 A;  1XGN A;  3GUD A;  2OAZ A;  4M71 A;  4YFX F;  2OU2 A;  1XDS A;  1PP8 F;  5ILV A;  1EH8 A;  1S7O A;  3RKX A;  4HQE A;  1ONV A;  5HS9 A;  5LBQ A;  1ZHF A;  3I5U A;  1QZZ A;  2IW5 A;  2GA2 A;  2DQL A;  3C1D A;  3OOP A;  2E1C A;  5FFZ A;  4L9T A; 
#chains in the Genus database with same CATH topology
 3ERM A;  1D5Y A;  4M3F A;  3OMY A;  4P96 A;  1U9N A;  3E7L A;  3C2B A;  4EJU A;  2O3F A;  2HOT A;  1FJL A;  3T0Y A;  1A6Q A;  4XN3 A;  5BPD A;  4HA8 A;  4I09 A;  4Y33 A;  2HYG D;  2KJB A;  2VBW A;  3D5S C;  3P9C A;  2QZ8 A;  5IOZ A;  1F4K A;  3HOT A;  1X1A A;  2JWT A;  3PQK A;  3DPT A;  2IGO A;  5CVU A;  3BR5 A;  1KGS A;  5GP9 A;  4RLQ A;  3LQQ A;  5DD8 A;  2R4G A;  1EV7 A;  4G7H F;  1X3W B;  2JZY A;  3MKZ A;  4EEF G;  1NHA A;  4GDF A;  2QKM B;  3GTP J;  2Y69 H;  1Z7L A;  5FLX K;  1AKH B;  1VQP I;  1YRN A;  4KIG A;  1WJD A;  3V8L A;  4IOC F;  4MTE A;  1W7P B;  1W0U A;  3RKW A;  3OV8 A;  4LLG F;  1FNN A;  2NS8 A;  4YFK F;  3S1N J;  4E6K G;  1ZQ3 P;  3A02 A;  5DV5 A;  3RPU D;  2BEO A;  2R7O A;  2A05 A;  2DA3 A;  4M3B A;  4R8H A;  1XGS A;  4M3D A;  3R60 A;  1IV8 A;  3BG5 A;  5FKO A;  1R1T A;  4NUB A;  3PL8 A;  3MAJ A;  1MBK A;  2BXZ A;  1Y1W J;  1JT0 A;  1UAA A;  3AG2 H;  1ZR4 A;  4HEA 2;  2QQB A;  3K69 A;  4AIJ A;  2LC2 A;  1T0F A;  5CVI A;  4OIR F;  4C9Y A;  1BI3 A;  4ZYA A;  1EJ9 A;  4EAT A;  1F36 A;  1ORK A;  4UVC A;  2IEK A;  1XPX A;  1O7F A;  3S1R J;  4MFD A;  2VUM J;  1SMY F;  2DA1 A;  5E79 C;  1BBY A;  5IOY A;  1B4A A;  1IUF A;  4Z6Y A;  3HOS A;  3MN2 A;  4G7Z F;  1O4X A;  1I39 A;  4ZYD A;  4DBR A;  1FZP B;  1IN7 A;  4II2 A;  5LRS A;  2KRF A;  1L3L A;  2Y75 A;  1Z91 A;  4QLC U;  4HYE A;  4A3I J;  2PEX A;  1XB4 A;  4DGW B;  2Z5U A;  2W82 A;  3K2Z A;  1OMI A;  3MKL A;  3P9I A;  4C2M J;  4IQ4 A;  2W85 A;  2EB7 A;  4MEY F;  1MZB A;  4CYD A;  3GZ6 A;  2L9V A;  1E3O C;  3ABL H;  1JTY A;  1WHU A;  2OCC H;  3CCJ I;  3CJN A;  3KYL A;  5DEQ A;  2LY9 A;  2CYY A;  4FX0 A;  1U8R A;  2P5V A;  5IT9 Z;  4CA0 A;  5ED4 A;  2L4M A;  2ME6 A;  4UV8 A;  4LG0 B;  4X1E A;  1EKE A;  3IH2 A;  3WTT C;  1KON A;  2X6Y A;  3LST A;  4G9Y A;  4HG2 A;  4OIQ F;  3S14 J;  4IHW A;  2IGK A;  4FE7 A;  5K5O A;  3PQJ A;  3B73 A;  2VT3 A;  4ENN A;  2FUG 2;  1HW2 A;  4BKX A;  2EBI A;  2V4J C;  2VQH A;  1D0X A;  1VQ6 I;  2YU3 A;  4BY7 J;  4M73 A;  2PJP A;  2DU9 A;  2HZD A;  2HYJ A;  2WB1 A;  3CCS I;  3BTC A;  1LE8 B;  5DM7 F;  4KIS A;  2A6T A;  4E70 A;  4D1Q A;  2HDC A;  3W6J B;  3QOE A;  3RIR A;  1S29 A;  1Y0U A;  4KMU X;  4QWQ A;  5L3C A;  3V8J A;  5DTD A;  2WY7 Q;  3GFL A;  3M1E A;  1POG A;  1A36 A;  5ILU A;  3ML6 A;  4LK1 F;  3JRH A;  2Y2Z A;  3BP8 A;  3RZO J;  2HXO A;  2XIG A;  2XAF A;  1IZ1 A;  4OAY A;  2O61 A;  1X4P A;  3OS2 A;  2CUF A;  1E17 A;  4JK1 X;  4MFE A;  1U0J A;  1T39 A;  4FTH A;  2IA2 A;  2E2J J;  1T08 B;  3FKI J;  3IH3 A;  4JP0 A;  1UHW A;  2JSC A;  4QPQ A;  4Y3O A;  2IBD A;  2FSW A;  2JQ7 A;  1KU2 A;  4RMN A;  3JR9 A;  3UKG A;  5L3D A;  2EV0 A;  2QSF X;  4PCQ A;  3S93 A;  3AFH A;  5HVQ C;  1LVK A;  2K9L A;  2DMQ A;  2XVC A;  1QU3 A;  2Z9O A;  4L5J A;  3S17 J;  1ZAO A;  4RBO A;  2LKP A;  3VDX A;  3Q0W A;  1YW9 A;  3FHZ A;  1F5T A;  1R1V A;  1UG0 A;  1SAU A;  4BE0 A;  1TLH B;  4RB2 C;  1YE9 A;  1XCV A;  5IYC J;  4MNU A;  1GT0 C;  3G4S I;  5A2Q K;  3HM5 A;  1MMS A;  5HDG A;  2A5Y B;  1P92 A;  2BVM A;  1QZE A;  2K9S A;  2DOA A;  1J75 A;  2COM A;  5IP6 A;  3DBR B;  4UY8 I;  1OPC A;  4XNF A;  4AID A;  3BRO A;  2PI0 A;  4U87 A;  2AO9 A;  1HLV A;  4IJA A;  3SEQ A;  4B48 A;  4P55 A;  1D1C A;  2L4A A;  2LRE A;  2R3S A;  4YRV A;  2VC0 A;  2L9N A;  4RA2 A;  3VOD A;  3FK7 A;  4GFB A;  3GTK J;  1P9Q C;  2LNB A;  2V9P A;  3KP7 A;  1R5I D;  1WI3 A;  4YG2 F;  3Q3S A;  5J47 A;  2JUG A;  2XF7 A;  5F0H A;  5J8C A;  4M72 A;  4XKB A;  3DTE A;  1PUE E;  3HOV J;  1R22 A;  5LHG A;  3L00 A;  2HQA A;  4I0A A;  2BXY A;  2X48 A;  2VOD A;  5L3B A;  3UR3 C;  3S3N A;  2N8G A;  2DYR H;  4XBF A;  1RRJ A;  2BHY A;  2B7E A;  1ZG3 A;  3FXJ A;  2LSO A;  3GW2 A;  4P1W A;  4BE2 A;  2LLK A;  1HKT A;  5F1R A;  1G6N A;  4D9J A;  2X6W A;  1HQC A;  1U5T B;  2KZV A;  1MIJ A;  3L9F A;  1AU7 A;  2H1L A;  3VB2 A;  3K4M A;  2D1H A;  4DJA A;  2LBF A;  2PX9 A;  3OS1 A;  1X3U A;  5EGO A;  2M9H A;  5ICF A;  3PO2 J;  3X2Q H;  4HLY A;  3ONQ A;  2P0W A;  1QBJ A;  3K4B A;  4TV7 A;  1ETY A;  2XGC A;  3DEU A;  4M9Z A;  2Y31 A;  2GA1 A;  5IT3 A;  3WU1 B;  3K1P A;  2HPI A;  2P6T A;  1A35 A;  1GV5 A;  3CDI A;  5CYV A;  1IN6 A;  4W97 A;  1Z9C A;  3ELK A;  5E3N A;  3DTI A;  1WJB A;  2CW7 A;  3CC4 I;  2DQR A;  4OMY A;  1U2W A;  3F6V A;  4RB0 A;  3TDU C;  1DPU A;  2VBZ A;  1KA8 A;  1ZGJ A;  3FBI B;  3K0L A;  3HHG A;  1YHQ I;  1FEX A;  1MNM C;  5GPC A;  3OY9 A;  1JKO C;  5B1A H;  2WA0 A;  3BCB A;  1W5T A;  3OYH A;  1HW1 A;  1N25 A;  1V54 H;  4RB1 A;  4RDU A;  2XGD A;  2C6Y A;  1W1W E;  4A6D A;  1ETX A;  2ELH A;  3VSL A;  1XN7 A;  4ESJ A;  3IWF A;  3G73 A;  2M3A A;  4W1U A;  1IRG A;  2RV8 A;  3Q9V A;  1AKH A;  1S72 I;  5M5W J;  2O03 A;  2XUB A;  1B6A A;  4M6X A;  5BOX A;  1JUM A;  4ZDO A;  3FMR A;  1W7P A;  5K7H A;  4L18 B;  1VFC A;  3JTH A;  2HXI A;  1MD0 A;  4R1H A;  2DT5 A;  4V2F A;  2VJ4 A;  3T8T A;  1ZN2 A;  3HB9 A;  2PBI A;  4ENM A;  3JAM K;  3OWT A;  1J09 A;  5TGT A;  1C0W A;  3OL4 A;  3JTG A;  4I98 B;  3CJT B;  3GXO A;  4XRM A;  4XQF A;  1LQ1 A;  3ABK H;  3E97 A;  1K4S A;  1H0M A;  2MH9 A;  4BJT A;  1RKW A;  1A31 A;  4CGZ A;  3AL0 B;  4PJJ A;  3VYT B;  3W6V A;  2RGV A;  4UNO A;  2PLY A;  5AIQ A;  1RR7 A;  2R7W A;  4Y17 A;  4ZYG A;  5C3E J;  1SFK A;  4OIN F;  5LRR A;  4NC8 A;  2IP2 A;  5FD5 A;  5M3F J;  2QBY B;  2YPR A;  3CD6 I;  5CVR A;  3O6B B;  3SYT A;  4A6E A;  5D8K B;  4KN4 X;  3IRR A;  1VQ9 I;  2KKO A;  3NWS A;  2K86 A;  2D2W A;  2XF6 A;  4XOR A;  4NC7 A;  3FHN A;  2E2I J;  2ID3 A;  3RYR A;  5GAE J;  3G6E I;  3LSJ A;  1SFX A;  4ZZD A;  3S2H J;  4YEJ A;  4CCJ A;  3SZT A;  4ZYH A;  2R5Z B;  2CFX A;  4MGR A;  2GWR A;  2CU7 A;  3IAM 2;  4OU0 A;  5JHF A;  1TWA J;  1P4W A;  2JVH A;  2DT7 B;  1WJC A;  3V4G A;  3RCO A;  2KZG A;  1JJ8 C;  2NNY A;  1JGG A;  4C2U A;  3ISP A;  2NVQ J;  4M9S A;  1A04 A;  4FET A;  3WG7 H;  3MD2 A;  3R61 A;  1B72 B;  1MSE C;  2EPF A;  2X1C A;  1EH7 A;  3VEP A;  1G3S A;  1U9O A;  4MQ9 F;  3TDZ C;  3OS0 A;  4O6J A;  2BY1 A;  3BPV A;  1L0O C;  4BDZ A;  1J5Y A;  2R7R A;  2HKO A;  3JRE A;  1SEU A;  4XRF A;  2QQA A;  3O8G A;  5DYM A;  4A69 C;  5E8G A;  2Y48 A;  1I50 J;  1MBJ A;  3SFZ A;  5FB2 A;  3AKZ A;  3OYJ A;  4A3L J;  1FTZ A;  3IC7 A;  4Y13 A;  1LE8 A;  2K5C A;  4ZTF A;  1PJR A;  3QYE A;  4PGG A;  5F08 A;  3HRM A;  3LQR A;  3ZMT A;  1KU7 A;  1IG7 A;  1Z6R A;  1UB9 A;  3T1B A;  3U21 A;  5HLH A;  2FF4 A;  2NNN A;  4BHP A;  2L54 A;  1B9N A;  1OCC H;  3F22 A;  4CSW A;  2LYC A;  1R7J A;  5CPR B;  1NG7 A;  4EM1 A;  2R7U A;  2FNA A;  4PZJ A;  5TRD A;  1T6S A;  5B5E C;  1D5V A;  1OR7 A;  1TP4 A;  3FMQ A;  2HVS A;  3BTL A;  4ENJ A;  1FC3 A;  1DDN A;  2BV6 A;  3IWZ A;  2XAG A;  1QGP A;  3BWG A;  4YIR X;  3CC2 I;  4N4N B;  2R7D A;  3ZRG A;  4DZJ A;  3HTS B;  2JN6 A;  1S6L A;  4BU2 A;  3CCV I;  1S9H A;  3ULQ B;  3BQY A;  1H8A C;  4N9H A;  4BY1 J;  4AYB A;  2WAF A;  1P4X A;  1R4N B;  3AG4 H;  1KZH A;  3RKQ A;  4IRH A;  2DI3 A;  5C4X J;  2GXA A;  3CCE I;  2CV2 A;  2TDX A;  4QSH A;  4AWX B;  2ZXW H;  4L0Z B;  5EF6 A;  1RUO A;  2EZI A;  3L2Q A;  1ETK A;  3ZGK A;  2J5O A;  4BUP A;  4AVZ A;  5AON A;  2OD5 A;  2H8W A;  3ECH A;  3SXY A;  2DMP A;  4G6Q A;  3TP0 A;  3I53 A;  2XPW A;  4KN7 X;  1GUU A;  1YX5 A;  2YX7 A;  4Y15 A;  2XB5 A;  3E6D A;  4MLO A;  5F0C A;  4IHY A;  1IXR C;  2M8G X;  2LG4 A;  2AXT C;  3BQZ A;  3BDD A;  3HSE A;  4U0W A;  4C30 A;  4AVP A;  2FBH A;  2LF7 A;  4HOB A;  3BOQ A;  2MLG A;  5M3M J;  5EDN A;  3CME I;  1TQP A;  2KQR A;  2QEN A;  4X0G A;  4A5N A;  4WF2 A;  2O9L A;  5CVV A;  3B6C A;  3BR2 A;  2Y30 A;  3CP2 A;  4CCK A;  4ENK A;  3FIS A;  1JHF A;  2DOD A;  2OUM A;  3RQ4 A;  3OYD A;  2MBF A;  4GGG A;  1S7E A;  2E7X A;  3ZQF A;  4RGR A;  5ICG A;  3JRI A;  2VBX A;  1W0T A;  2O8K A;  2IS4 A;  5HNH A;  3H1C A;  3ASN H;  3OIQ A;  5KVR A;  4NC6 A;  2NS7 A;  1BI0 A;  2E35 A;  5F27 A;  2V79 A;  3KZY A;  2A6H F;  1GV2 A;  1BA5 A;  3QPT A;  1S7A A;  2E1M C;  5J6X A;  2IGM A;  2VJJ A;  1K78 B;  3S32 A;  3KPH A;  3D0S A;  3PNY A;  5H6Q A;  4CCN A;  1R4M B;  4EGZ A;  1ETW A;  2RAE A;  3HTU A;  1OCT C;  3DKW A;  1KYZ A;  5B1B H;  3TGN A;  4V19 K;  5D4S A;  4BQO A;  1SVL A;  2QQ9 A;  1OYY A;  3BZ6 A;  4A3E J;  2EFW A;  3J7A Y;  2KIS A;  3K9T A;  1LB2 A;  4HRI A;  4L9N A;  3ZQC A;  1V4R A;  4XN0 A;  5HDK A;  1KQ9 A;  1FYL A;  4N9I A;  2V9K A;  2JA5 J;  1MSF C;  5L3E A;  3QYF A;  3E6M A;  2W24 A;  4LG3 A;  3E1S A;  3JRG A;  5EG0 A;  1SAX A;  4QIW N;  3VOE A;  2EQR A;  3G1O A;  1R49 A;  2OBP A;  1UHM A;  3A2K A;  2UWM A;  2ADU A;  1E0E A;  2NAZ A;  3FXU A;  1J59 A;  1O3Q A;  3S15 J;  3G1L A;  2X9D A;  4JX4 A;  4DNC A;  4CO8 A;  3IKV A;  3EUH C;  1E3P A;  2Y9Y A;  2ZKZ A;  4B3X A;  1QVT A;  1W5S A;  2XGE A;  2DK8 A;  3KE2 A;  2Q2E A;  2ESN A;  3GFI A;  2KIM A;  3QWL A;  5FKL A;  1DGR M;  4CZC A;  4U7D A;  4I6Z A;  1VTN C;  1IGN A;  5GTI C;  4IHX A;  1O57 A;  2GQQ A;  2P81 A;  5M5X J;  2K85 A;  3CCY A;  2MFZ A;  3IV5 A;  3S8P A;  4DIQ A;  3WTV C;  3J7A O;  5FJ8 J;  4MTD A;  2L5Q A;  1B9M A;  1XSX A;  2EV6 A;  2HYF A;  4FE4 A;  5C4J J;  2X1E A;  1O7L A;  2H09 A;  3NAU A;  5C44 J;  4D5F A;  3EUH A;  3MQ0 A;  3BG7 A;  4C3H J;  1RKT A;  2P5K A;  2HU9 A;  2W1O A;  1ON2 A;  1ZG5 A;  1IW7 F;  4XM3 A;  4H0E A;  4GYG A;  3QYB A;  2LY1 A;  3REO A;  1ZK8 A;  2GAU A;  3CMA I;  1S3J A;  2HR3 A;  5IP9 J;  5JVG F;  1D0Z A;  3IHU A;  2IS2 A;  3TW7 A;  2FOK A;  3V7R A;  1W4M A;  2FMY A;  4QTR A;  1HF0 A;  2ZC2 A;  1JI8 A;  2DMN A;  1P7J A;  3DBH B;  4HF1 A;  3C3W A;  3L2C A;  2CWE A;  3FK6 A;  1LUJ B;  5D6E A;  3OYE A;  1YJW I;  4PUS A;  1WJ5 A;  4OOI A;  1HDP A;  1LEB A;  2E1O A;  1QA6 A;  3RPU A;  5J8F A;  5GAG J;  5ILS A;  2ID6 A;  2QBY A;  3OYF A;  5E1W A;  3F72 A;  5DUK A;  2DK5 A;  1B8I B;  1WJE A;  3H9G A;  2MC3 A;  5K5R A;  1H9T A;  4JBA A;  4C3J J;  1G3T A;  1MMG A;  1K79 A;  3TOA A;  1D1A A;  1EH6 A;  2CV0 A;  1KU3 A;  3F8N A;  3WHC A;  5DM6 F;  4IHS A;  2QKL B;  4IX7 A;  2L0K A;  4HW0 A;  2CMP A;  4IPA A;  2XF5 A;  2R5Z A;  3QOP A;  3K70 D;  2DPU A;  1N78 A;  3FXM A;  4BQA A;  2HKX A;  2XRL A;  3I55 I;  4LLN A;  2DMU A;  1OCO H;  2OA4 A;  2K40 A;  2G7H A;  1D8J A;  3F8M A;  1ZLK A;  4XLF A;  1TT5 B;  4IZZ A;  1XCB A;  2XRO A;  4F91 B;  1B72 A;  1T8I A;  1TZL A;  5CVJ A;  1FWZ A;  1MND A;  2RNJ A;  2CQK A;  1CF7 A;  3K6G A;  4XKW A;  3CZ6 A;  2X85 A;  3BJA A;  2XB0 X;  3SDG A;  5IPA A;  2EWN A;  2DOF A;  1Y1V J;  2X51 A;  4BQQ A;  2CV1 A;  2FQ3 A;  2ZJQ F;  2ZFU A;  1VQ8 I;  1OYI A;  2OTJ I;  2X6O A;  4XSZ F;  1PVE A;  3TO9 A;  5E17 F;  2L7Z A;  3TED A;  3PNT A;  4B3A A;  5E18 F;  3AG1 H;  5DDG A;  3SFI A;  2YX4 A;  4A3K J;  3VYS B;  2ZB9 A;  3BTI A;  1FPQ A;  4PJN A;  1PP7 U;  3BJO A;  3LAJ A;  4F93 B;  2HDD A;  2M0C A;  2QEX I;  1MW7 A;  5M5Y J;  3ZR8 X;  4IHV A;  3LNQ A;  2AQF A;  1VQ4 I;  4I7H A;  2HS5 A;  5DD4 A;  4CH7 A;  3I59 B;  1GHC A;  5DCF A;  2KDZ A;  2VB6 A;  1WPK A;  5IYB J;  2VIX A;  1SVO A;  3OYC A;  3DBL B;  2OPT A;  1G59 A;  4XRS A;  2GBY A;  1BIB A;  3T8R A;  1LFU P;  3A0H C;  3K4C A;  1SD4 A;  1UZC A;  2BW3 A;  1IAW A;  1UJ8 A;  4QPO A;  5D5X B;  4WXH A;  2DLL A;  2FA5 A;  1K61 A;  2TCT A;  5LFA A;  2CJJ A;  1Q1H A;  3TBI A;  1MJB A;  4BGD A;  1PUF B;  2JA6 J;  4E7K A;  1FY7 A;  1SD6 A;  1KU9 A;  2HQN A;  3F0C A;  2AHQ A;  1LVA A;  3LWF A;  3CUQ C;  1MJA A;  4NNJ A;  3H36 A;  2TRT A;  3ESW B;  2WB1 N;  5HOO A;  4LMY A;  2JJ7 A;  2STW A;  1APL C;  3LOC A;  2W25 A;  5IY5 H;  2DFI A;  2PMZ A;  5HOD A;  4RB3 C;  4MIM A;  2RKH A;  2PJR B;  3HDD A;  1YYV A;  1TQM A;  3JSP A;  4U0V A;  1G2H A;  2CH0 A;  1LFP A;  2XAJ A;  3KET A;  2WV1 A;  5GPA A;  4A12 A;  1EA3 A;  3KP5 A;  2YU9 J;  2ZXH A;  2OF7 A;  5FKN A;  4P9U A;  3ZP5 A;  1EF4 A;  4LIV A;  3HGG A;  3A03 A;  5E20 A;  2OQR A;  4BJ5 C;  4E7Z A;  3GTG J;  2FU4 A;  1LJ9 A;  2JRM A;  4Y52 J;  2X6X A;  1P6R A;  1NH3 A;  4GYI A;  1FLI A;  4KA4 A;  2IA0 A;  2A69 F;  4F55 A;  2NYX A;  2ZME C;  1N75 A;  2D45 A;  2E19 A;  4XLP F;  4HNV A;  4I2O A;  3H92 A;  2Y9Z A;  3H3Z A;  4J01 A;  3O3K A;  4UB8 C;  1YTY A;  4BJ6 C;  1MMA A;  3VFZ A;  3K7A J;  4KIB A;  1QHG A;  3WGH A;  2OV7 A;  2HWV A;  3OYL A;  2Z1D A;  3LSR A;  1K78 A;  3PNV A;  1V3F A;  4GO1 A;  5FO5 A;  3DWL E;  1FOW A;  4XOT A;  1F9N A;  4ZTJ A;  2ZME A;  3LMM A;  3RZD J;  5F04 A;  3GX4 X;  5HDN A;  5FD6 A;  3HXL A;  2CW8 A;  3CC7 I;  3CCR I;  1V5E A;  1CQT A;  1IXS B;  2PFB A;  4E7J A;  4UUT A;  4UVA A;  4UUV A;  2IVM A;  1ERD A;  1Z3Y A;  1CGP A;  3S3M A;  4E7H A;  4PGH A;  5EJC A;  4B4C A;  3CMM A;  1FIA A;  1UG2 A;  3WTU C;  3E5U A;  2VLA A;  1Z3X A;  5EEG A;  4HDU A;  1JJ6 C;  2CW0 F;  4ZDL A;  5K1Y A;  1ZTR A;  3SZG A;  2K4B A;  2PG4 A;  2Y0S A;  1T98 A;  2LDU A;  3HEF A;  3HKZ A;  2OTL I;  1FBS A;  3DKY A;  1GXP A;  4AC0 A;  1IDY A;  1JTX A;  2WBM A;  5FRN A;  2ZNZ A;  4L5I A;  3ZCO A;  4A3J J;  3BC8 A;  3IKT A;  4XLC A;  2E1N A;  4KYW A;  2ZCW A;  3GTL J;  3QQA A;  4BXU A;  3SQN A;  4WWC A;  4Q5S F;  1BI1 A;  3HYI A;  2BVL A;  3GZN B;  3I9V 2;  3I56 I;  1DPR A;  3E5X A;  1QNT A;  2RQQ A;  3OYN A;  4CHU A;  2O7O A;  1S8N A;  1TWH J;  2O6G E;  1MH4 A;  3GME A;  3MCZ A;  3TOB A;  4HPQ A;  1B59 A;  2E5N A;  2QUF A;  2Q8K A;  1IV6 A;  3ABT A;  4FQG A;  1WCM J;  3BZC A;  4MO7 A;  3LFK A;  3DQV C;  2NRA C;  2HQ5 A;  1XS9 A;  5EG0 B;  4YIF A;  4IO9 F;  2XDV A;  4I02 A;  1TQI A;  2E1M B;  4RAG A;  1V5G A;  4M6V A;  3WTW C;  1LPQ A;  3GFM A;  1JKQ C;  2VOP A;  1DGW Y;  1BI2 A;  1A5J A;  2LTP A;  1Z21 A;  2EFO A;  3WTZ A;  1VQL I;  3SEZ A;  5FLX Z;  1ITY A;  3B02 A;  2EA4 A;  3KFW X;  4LIT A;  5JHU A;  2WTE A;  4HDV A;  2M5W A;  2Q2E B;  1K4T A;  2LD5 A;  1GVJ A;  2K3F A;  2F4M B;  2M4K A;  1TNT A;  5ICE A;  3DLA A;  1B8I A;  2HZT A;  4YEL A;  1FMV A;  4L9J A;  2D1V A;  5JLW A;  3FKJ A;  1ZRF A;  5CQE A;  1NK2 P;  1KQ8 A;  1UFM A;  2XSD C;  2EIM H;  4P9F A;  4XLN F;  4I01 A;  3K4N A;  1U78 A;  3IAS 2;  1MGT A;  5D6F A;  2K4J A;  1QPI A;  3FM3 A;  3HJE A;  3FXK A;  2VC1 A;  4OMZ A;  4CYC A;  3D1N I;  1ZGW A;  1HKQ A;  2RC4 A;  4A0X A;  2K02 A;  2A07 F;  2FX0 A;  2DA2 A;  4HZF A;  2FEZ A;  3RJP A;  1WQ2 A;  2BHZ A;  2M45 A;  4XID A;  3EDP A;  5GTH C;  2HVR A;  2VI6 A;  4OAZ A;  1IDZ A;  1BOB A;  2CRG A;  2WAQ A;  4UUS B;  1HW5 A;  4A2U A;  4ABZ A;  4J00 A;  1TWG J;  3KCC A;  4L9V A;  1WWX A;  2JK3 A;  3KX2 A;  4E4H A;  3DXJ F;  3H5N A;  1OFC X;  2CQX A;  3PFI A;  5EEA A;  4KDP A;  5L3G A;  2KIF A;  1ETV A;  4ASN A;  1R1U A;  4PSX A;  4BE1 A;  1REP C;  3GZ5 A;  1DU6 A;  1S5L C;  4MHG A;  1ZYR F;  1I27 A;  3QPS A;  1JGS A;  5D8L B;  2H1K A;  2W4S A;  3AAF A;  1DQU A;  2ISY A;  1Y8R B;  4G6T B;  4V2G A;  2STT A;  3I59 A;  3OIP A;  4XL9 A;  2QQ8 A;  2RDP A;  4A3G J;  2CUE A;  2VKE A;  3PIO F;  3OYM A;  3COA C;  3CJR B;  5FKM A;  3NRV A;  1XTA A;  3FM5 A;  2DA5 A;  3K10 A;  4CCL A;  2IRF G;  1SVM A;  4LOC A;  3MKY B;  3RTR A;  3M9A A;  2DYS H;  1G3W A;  1TWF J;  2V1X A;  4XLH A;  5FFX A;  3DP7 A;  1Z7U A;  3A01 B;  5E1Z B;  1FSE A;  3P5J A;  2EA2 A;  2HTS A;  2ELJ A;  4LB6 B;  5LEK A;  1PUF A;  1AA7 A;  2IXS A;  4IRG A;  3ZOB A;  4FCY A;  1CF7 B;  1WRJ A;  5L3F A;  3CF5 F;  4B47 A;  1XSD A;  1U8B A;  3FDY A;  4LIU A;  4XLE A;  5E3L A;  3KLN A;  3M07 A;  2M30 A;  1PYV A;  4HF0 A;  3ZMU A;  2BZT A;  4ZDP A;  2CQQ A;  2VL8 A;  2XRN A;  1Y39 A;  1HC8 A;  1YOV B;  2L7F P;  4RM2 A;  3KP3 A;  3V7S A;  2IT0 A;  2V9V A;  2KPM A;  2QWW A;  2PJR A;  3O2P E;  1YJN I;  3TO7 A;  3RI4 A;  2ZJR F;  3K4J A;  5E3M A;  1QQI A;  2WAE A;  2ZXI A;  4IQJ A;  3VYR B;  2V1U A;  2XV4 S;  2KRH A;  3GLX A;  3P7N A;  2BYV E;  2L2O A;  2M2E A;  3HRU A;  3S3O A;  2CGP A;  1YQA A;  2XKO A;  2ECC A;  3W2V A;  4XKV A;  2MGQ A;  5DUI A;  3DEW A;  4X6A J;  4BL0 B;  1NTC A;  3J80 Z;  4GXO A;  2V6E A;  3I4M J;  5J1U A;  2XHK A;  4BHC A;  3RKY A;  3M3Y J;  2P6S A;  1YIJ I;  2GZW A;  1VQM I;  2ECB A;  1G4D A;  2BW3 B;  4A3F J;  3W3C A;  3Q5F A;  3K1N A;  4AYB N;  1BW5 A;  1BC8 C;  3M8F A;  3GEZ A;  1YS7 A;  4N0B A;  3VYU B;  4CDG A;  4BHB A;  4LK0 F;  3TL4 X;  2M4G A;  2L7M P;  2GIZ A;  2IS1 A;  1BR1 A;  1ZR2 A;  2M7A A;  3ROU A;  1Z0X A;  2HI3 A;  3A0B C;  4XOP A;  3M8J A;  3N05 A;  3BG6 A;  5K7F A;  1TBX A;  4JQF A;  2VBY A;  4NHJ A;  3ZMZ A;  4AIH A;  2LKX A;  4O5V A;  2K27 A;  2PMH A;  2XAS A;  4LJZ F;  3TQN A;  2GOX B;  4NB5 A;  3RDI A;  4HSR A;  2NVT J;  2H8R A;  1ETQ A;  4HAM A;  4ETS A;  1IN5 A;  5JVT A;  3GTJ J;  3KEY A;  1TC3 C;  1IN8 A;  3HHH A;  2MC4 A;  3A4C A;  2UZK A;  1ON1 A;  3GYH X;  1ZEL A;  3CUQ B;  4K2E A;  2HEO A;  2R7F A;  4ESB A;  1ULY A;  3F3X A;  4HQM A;  5J40 A;  2JA2 A;  1X19 A;  2IS6 A;  4U0Y A;  1HA8 A;  4CUG A;  5IT9 K;  2EIL H;  2F48 A;  2IJL A;  5LGU A;  1J9I A;  1DP3 A;  3F23 A;  2EK5 A;  5BNG A;  1XC5 A;  2M7B A;  2OZ6 A;  3J7Y J;  3QPL A;  4Y4R A;  5B66 C;  3GO5 A;  4BQN A;  2WWY A;  2AQE A;  2BY0 A;  3FBN B;  2R93 J;  2F5V A;  3FXO A;  1ZLJ A;  3HG9 A;  4KJZ A;  3E6C C;  4GCV A;  2EFQ A;  2ZBK A;  4F52 A;  2QCO A;  2R7T A;  3PSI A;  5BS6 A;  1SC7 A;  3PO3 J;  1Y56 A;  1U5T C;  1IUY A;  1HSJ A;  1BR2 A;  2FRH A;  5IYD J;  3C2G A;  2AS5 F;  4II3 A;  2JSP A;  1IJW C;  2EIJ H;  1H88 C;  1J0R A;  2ICW G;  2ZME B;  1X1C A;  2HDW A;  4HV6 A;  2KHM A;  1FOX A;  1BC7 C;  1B1B A;  2WAD A;  5TJJ A;  1BIA A;  5LGN A;  4DBQ A;  1JE8 A;  1FP1 D;  4L0Y B;  4PDK A;  5J1Y A;  2LY2 A;  3QAH A;  1NG6 A;  4CZZ A;  4PJL A;  2P4W A;  2COB A;  1R71 A;  1LNW A;  2GLO A;  4HNT A;  2FE3 A;  2DA6 A;  1YW8 A;  4D7M A;  5AIP A;  2L9S A;  1VQN I;  2HOS A;  2HPM A;  1OCR H;  2VJI A;  1TWC J;  2XGX A;  1ZKG A;  4EQQ A;  4S04 A;  4A3D J;  3E3V A;  2EZK A;  3PM1 A;  1OKR A;  4WXC A;  2QVO A;  2VT2 A;  3L7W A;  3HPH A;  2DW4 A;  3GCM A;  1OQY A;  2WY8 Q;  1YLF A;  3V8K A;  2VXZ A;  2VAS A;  5LHH A;  4DOZ A;  3OSG A;  2ACJ A;  3QRF F;  4AM3 A;  2XSJ C;  1X2M A;  2QYO A;  2HGC A;  4Y7N J;  3JAM Z;  1U3E M;  4BEH A;  1TW2 A;  2FBK A;  1T2K A;  3KEQ A;  4CXF A;  4IHT A;  2O5R A;  1I1G A;  1YIO A;  3CES A;  2MW8 A;  3CDL A;  1R5H A;  4DQ2 A;  2K7L A;  3R6S A;  5J4Y A;  4AIK A;  1ODD A;  3U1D A;  5FRO A;  2LVS A;  1YJ9 I;  3BY6 A;  3TO6 A;  4EVI A;  4LB5 A;  2ETH A;  5HS8 A;  1SD5 A;  4DZP A;  5FKK A;  5BMZ A;  2GM4 A;  3BJ6 A;  4MQV A;  4IRI A;  3D5R C;  5KNL A;  3ZMD A;  2ZJ2 A;  3F8F A;  1JXS A;  2Z2S B;  1MJ9 A;  4UUS A;  3JSO A;  3H5R A;  3CO6 C;  2HFH A;  4C2T A;  1A6I A;  3VSK A;  5HNF A;  3CMY A;  4OIP F;  3EUA A;  1USS A;  3SZP A;  2NXN B;  3K4L A;  1ETO A;  3WE2 A;  2VKH A;  3EQL F;  3JCU C;  3HSR A;  3LSK A;  1VQO I;  1N77 A;  3R4K A;  4WX9 A;  4BDY A;  3SDB A;  2VN2 A;  4FIS A;  5B3S H;  1V5F A;  1ZAR A;  1O3R A;  1R36 A;  2L01 A;  4M74 A;  4BAY A;  3DEE A;  5E8I A;  2KT0 A;  3ZN1 A;  2VQG A;  1JT6 A;  4HX8 A;  3BTJ A;  5F0F A;  4XK4 A;  2V26 A;  1FP2 A;  1XSV A;  3CF2 A;  2G0E A;  4NQW A;  2DFF A;  4CYC B;  3L2W A;  4IL6 C;  2KFD A;  5JR3 A;  5EZG A;  3CP8 A;  2A6E F;  1UEL B;  2ZO4 A;  3OIO A;  1MDM B;  1ZRD A;  4L5E A;  4UB6 C;  1WZ2 A;  1BW6 A;  4G7O F;  3ZQL A;  5IP7 J;  1HKS A;  3A01 A;  4WCG A;  2B63 J;  1WH7 A;  3JRD A;  4BBS J;  2EIN H;  2LFB A;  1QPM A;  1FOK A;  4RLF A;  4XMY A;  2VPL A;  2CUZ A;  1T0F C;  2VQC A;  4KFC A;  1YX3 A;  4EM2 A;  2D5V A;  1YW7 A;  2BBY A;  2LH9 A;  2FNP A;  4B09 A;  4FX4 A;  3C2H A;  4U7B A;  5BQT A;  2O0Y A;  3MFK A;  1K7A A;  1SMT A;  3JW4 A;  1RET A;  2VOO A;  3BR6 A;  1BJZ A;  5CQG A;  1WFX A;  2FD5 A;  1VZ0 A;  2F5F A;  2PMU A;  2R7Q A;  3MZ8 A;  4ZZL A;  5HS7 A;  2MYS A;  4G6D A;  1LDD A;  1U6G A;  2E34 A;  3LA2 A;  3HOZ J;  2EJR A;  1HST A;  1QRY A;  1UMQ A;  2R7X A;  3I3L A;  2DMT A;  1M1E B;  1R00 A;  1RPW A;  3WTY C;  1VF9 A;  4U88 A;  5DCM A;  1V55 H;  4XON A;  1IXC A;  2LKS A;  1SAN A;  2ZNY A;  3E6B A;  4A0Y A;  3MVP A;  2JA8 J;  3UNG C;  3MZY A;  2KMU A;  2ZXJ A;  2YUS A;  3LL7 A;  3QU6 A;  2ZJP F;  2I10 A;  1KQ0 A;  4XR6 A;  1ZRE A;  3R0J A;  2L3D A;  4M3E A;  2KDO A;  4A93 J;  2CG4 A;  1WH5 A;  3BPX A;  2EFP A;  1IN4 A;  4BYY A;  2F2E A;  3I0T A;  1SFO J;  3ABU A;  1E3H A;  2KIQ A;  5K7Z A;  1MMN A;  2YSR A;  4DYC A;  3MEX A;  2G7U A;  2A68 F;  1QVU A;  2VKD A;  3GBG A;  3J81 Z;  3CTA A;  2Q0O A;  2Z33 A;  1OYW A;  1TW3 A;  2KRC A;  3ZPL A;  1BR4 A;  1R6R A;  3DLL F;  4HLX A;  3ABM H;  2PMZ N;  1XDU A;  1RUN A;  5CLS A;  2F4I A;  1VQ7 I;  1I1S A;  4ZC3 A;  2CO5 A;  1VQK I;  1Q1V A;  5J1R A;  3ZQ7 A;  3L2U A;  2E7W A;  2A3S A;  3S1Q J;  2MD5 A;  1TNS A;  2P7C B;  2P7V B;  2R5Y B;  3PUB A;  1HXD A;  3N4M A;  2OZU A;  4LGW A;  4YFN F;  4ZYE A;  1HBX G;  4R79 A;  3I58 A;  3H0G J;  4EJV A;  2A5W A;  1J2X A;  1BOA A;  3DPU A;  2R92 J;  3LA3 A;  3I64 A;  3VWB A;  3CUQ A;  4HBL A;  3ZQH A;  2OCE A;  1RZ4 A;  3FXQ A;  2QSH X;  2JMW A;  3LSH A;  4D0P A;  1VI0 A;  1GVD A;  1K83 J;  2V1D A;  1MBF A;  3GWZ A;  1MBE A;  3R0A A;  5TIS C;  1OLT A;  3H5A A;  1VND A;  4NBQ A;  5J4V A;  3HBL A;  2M1B A;  2HNH A;  2PQ8 A;  2AXL A;  5KAF C;  1JUS A;  1DUX C;  1OCZ H;  2FQ4 A;  3IUO A;  4IEJ A;  3GVA A;  3Q0V A;  3I71 A;  3W6K B;  2DTZ A;  3CQZ J;  4B44 A;  4BXX J;  2OQG A;  1X1B A;  2KL4 A;  3EYY A;  5D5V B;  2L02 A;  4PK4 A;  3KP4 A;  3KP2 A;  3SHF A;  4A3C J;  4RM3 A;  4FAS D;  1DU0 A;  1GXQ A;  3NWT A;  2ZFW A;  4LD5 A;  2VJ5 A;  4Q48 A;  3WTS C;  2LMD A;  1BN5 A;  2CQN A;  2NS0 A;  3HRT A;  4EJW A;  1K6Y A;  3BZK A;  3S1M J;  1QO0 D;  3EET A;  1LFB A;  1Y8Q B;  4UVB A;  3OYK A;  1YO5 C;  1I6H J;  2IA1 A;  3J80 K;  3FX3 A;  1I3Q J;  2HOA A;  4PJ0 C;  4S05 A;  3C7J A;  2JTV A;  1OIS A;  2X0L A;  1WKM A;  4UXN A;  1AOY A;  5D4R A;  2Y0S N;  2DAO A;  3HKZ N;  3C18 A;  1UCR A;  2HQR A;  1HCR A;  2H6B A;  3WGI A;  3U2R A;  4YII A;  2EV5 A;  2LOO A;  3M4O J;  2GIV A;  3HIF A;  3G71 I;  3I54 A;  3KP6 A;  3FMS A;  1TT0 A;  3B6A A;  1JHH A;  3ZQG A;  3RQI A;  1ZG1 A;  4G94 A;  2PN6 A;  3NEU A;  4DYQ A;  1JKP C;  5LEJ A;  3GLL A;  3KLO A;  4NDL A;  1MKM A;  3CDH A;  1UST A;  2M8E A;  2B0L A;  5HLI A;  2VE9 A;  2DA4 A;  1H9G A;  2V1N A;  1XX5 A;  1W5C C;  4Q4Z F;  3HL2 A;  1Z1D A;  3RPQ A;  5LD2 C;  3HSF A;  4IF4 A;  2DBB A;  1T95 A;  3LSM A;  4S0H B;  4KIT B;  6PAX A;  2JA7 J;  3G3Z A;  1D0Y A;  2W7N A;  3PFY A;  4RGU A;  4BH9 A;  3HOX J;  2EFN A;  4A5M A;  3RSN A;  3GTO J;  5DS9 A;  1WGX A;  2RNG A;  2JT1 A;  4WXD A;  2FML A;  3HOU J;  1X1D A;  4O3M A;  3HOY J;  4E7L A;  4PFP A;  3M8E A;  2BE5 F;  3PJR A;  3S2W A;  4ANJ A;  3KZZ A;  4CCM A;  2ELK A;  3HPG A;  2QA4 I;  2RVC A;  2LK2 A;  1XG1 A;  5E1X A;  2G9W A;  3WTX C;  3PUF A;  3HZJ A;  4RAZ A;  2MD0 A;  2XAH A;  2B9S A;  1F43 A;  2F5C A;  2P8T A;  1WJF A;  1MBG A;  1UHS A;  3HUG B;  1E2X A;  3F6O A;  1FMW A;  3RYP A;  3N97 A;  3HGY A;  1YS6 A;  5K5Q A;  5KHD A;  2X1D A;  4EM0 B;  2VQL A;  2NOJ B;  4KIF A;  4KT6 A;  4B1R A;  4IOA F;  3TKY A;  1D1B A;  1R58 A;  2UUZ A;  3A1Y A;  3DFG A;  3LAP A;  2H6C A;  1IC8 A;  3OR2 C;  1NK3 P;  3MMY B;  4UHT A;  4LFU A;  2CQ7 A;  4XSX F;  2XKP A;  5CKT A;  4KMF A;  2YR2 A;  3LA7 A;  2VON A;  2KP6 A;  3GFJ A;  3H0D A;  2QSG X;  4BEH B;  3L2V A;  2DDB A;  1ACI A;  2BY3 A;  2M0M A;  4Z2Y A;  2DJI A;  1YIT I;  4I99 C;  1DP7 P;  5D5U B;  3DF8 A;  4XKC A;  2A61 A;  5GAD J;  3CO7 C;  3H9Q A;  1JKR C;  4JX6 A;  2ZSI B;  4RGX A;  1X2N A;  3E0J B;  2K9M A;  2IAI A;  3WOD F;  2UXN A;  2I5U A;  1X4O A;  3V7C A;  3ZN0 A;  1MDM A;  3WU2 C;  3KEO A;  3JRF A;  1J7K A;  3CLO A;  2WAQ N;  1FT9 A;  2E36 A;  4GRI A;  2XPU A;  2NVU B;  2L9R A;  3F8C A;  1T38 A;  3H3U A;  2DTR A;  3IP4 B;  4H4K C;  4ON0 A;  3DTK A;  2MG4 A;  2WC2 A;  2IPQ X;  1FYK A;  3DPL C;  3MWM A;  4I76 A;  4ESF A;  2CUJ A;  2F5D A;  3OL3 A;  2QM3 A;  1ZH5 A;  4EV0 A;  2M34 A;  3BG9 A;  3OYG A;  2QLZ A;  2DJN A;  5EEH A;  2BY2 A;  1SFU A;  2NOG A;  2FBI A;  2JVG A;  3LSI A;  3I4P A;  3JRA A;  1X58 A;  3Q0U A;  1YG2 A;  4BBR J;  4CCO A;  1FX7 A;  2P5L C;  1TL8 A;  2XAU A;  3FZV A;  1AWC A;  1XMK A;  3F8B A;  4D5C A;  2XAQ A;  4FT8 A;  1F1Z A;  4HST A;  2V7F A;  3GTQ J;  4HNU A;  3ZXS A;  3OYA A;  3CCU I;  3GF2 A;  1O3S A;  1LDK B;  4PFO A;  1T33 A;  5HLT A;  2WV0 A;  1MNE A;  5ICC A;  4UV9 A;  5LGT A;  1XGM A;  2CS3 A;  1BM9 A;  3QU3 A;  4JYK A;  5F64 A;  3CJQ B;  1PDN C;  4E7I A;  1W7P D;  3ZQI A;  3ZMS A;  3FIW A;  1Y0N A;  2DFH A;  3LSG A;  3BCA A;  2NVY J;  4NQW B;  2F6C A;  4WK8 F;  4KIC A;  5E3O A;  2F5E A;  2J5P A;  2R7V A;  1RC9 A;  3V42 A;  1KYW A;  5GAH J;  1ENH A;  5ERI A;  2DCE A;  4HF2 A;  2DO7 A;  4JX5 A;  4XLA A;  4XRS G;  2UV1 A;  1MH3 A;  2CSO A;  1YRN B;  2JPC A;  1QHH D;  3FF5 A;  1D3Y A;  4A3B J;  3FXL A;  5F1J A;  2MSY A;  3QPH A;  5H20 A;  1LKX A;  3OOU A;  4BXF A;  5HLG A;  2EZL A;  2RN7 A;  1AHD P;  2DA7 A;  2ISZ A;  2W00 A;  3ERE D;  9ANT A;  1H89 C;  3K4K A;  3PIP F;  1WSU A;  1XGO A;  2OC6 A;  2Z99 A;  3S16 J;  2R5Y A;  4PSW A;  4RAF A;  3D5L A;  3CLQ A;  5JI6 A;  4LG0 A;  2O8X A;  1FIP A;  1X1P A;  1IRX A;  4KUM A;  5DCM B;  3BLY A;  3BR0 A;  4ZJZ A;  1XMA A;  2QF7 A;  2IGN A;  4EMS A;  1MBH A;  3W2A A;  4C3I J;  5FRM A;  4RGS A;  2FOW A;  2FJ1 A;  3KYC B;  2ESH A;  3U1K A;  3JRC A;  2Y0M A;  2RRE A;  3HOW J;  1OR7 C;  5FGM A;  4B43 A;  4F7Z A;  1WVR A;  2DXI A;  2W84 A;  3ZMV A;  3IL2 A;  3DU5 A;  4M6Y A;  1OJL A;  1Z6T A;  2K9N A;  2HTJ A;  3EUK L;  3H35 A;  1BJA A;  5A2Q Z;  5EZH A;  5CJ9 A;  4OIO F;  3DV8 A;  2DDA A;  1BL0 A;  3F9K A;  2EIK H;  3HC7 A;  5FLV A;  2R7S A;  3VPR A;  4DW6 A;  3HRS A;  2VPR A;  3NQO A;  1Z05 A;  1ZGA A;  2RQP A;  4HV5 A;  5KCM A;  2HOE A;  1FYM A;  4RS8 A;  3T5X A;  1WI9 A;  1FBU A;  2QGU A;  4G8X A;  5KAI C;  2R0Q C;  3L2R A;  1G8X A;  1I6X A;  1D8K A;  2JPB A;  1GLN A;  1RES A;  5F6F A;  3GTM J;  2E2H J;  4Q47 A;  2F4O B;  4KT5 C;  3KIO A;  3BR3 A;  4BAC A;  1ZRC A;  3MZH A;  3DCF A;  1R23 A;  1RR8 C;  2OJE D;  3S2D J;  3WU0 A;  1Z67 A;  3I4N J;  3OYI A;  2L7K A;  4EJT A;  5EYR A;  5H6R A;  3P9K A;  5H2F C;  1RNL A;  1W36 C;  2HVQ A;  3K1M A;  3QOD A;  3W2W A;  4A0Z A;  4BS9 A;  2EZH A;  1TTY A;  2E5Z A;  4FHT A;  3LSP A;  1FOY A;  2YS9 A;  2LRD A;  2LF8 A;  2DPD A;  2W48 A;  4G12 A;  3FXR A;  1R9T J;  1X3Z B;  5LHI A;  4XIC A;  1R5G A;  1K6O A;  2H27 A;  2E71 A;  2MH2 A;  4LLL A;  2CFO A;  4ZH4 F;  2ME0 A;  3BT9 A;  3J81 K;  4B8X A;  1SFE A;  1QZY A;  2XPV A;  3PSF A;  5J3L A;  2Z3Y A;  3U9G A;  2I8D A;  2ZSH B;  4JOM A;  5D5W B;  4F3Q A;  2MAB A;  4N4O B;  2BGC A;  3JRB A;  3ECO A;  2BOL A;  4DYR A;  4IVN A;  4M9X A;  1XMX A;  3TW6 A;  1MMD A;  3OR1 C;  3QP6 A;  3CCM I;  4CIC A;  1IRF A;  2MLK A;  4ITV A;  2GXG A;  2DOE A;  4M3G A;  1WJA A;  1P7I A;  2GOM A;  4IXA A;  4A3M J;  2X4H A;  1LDJ A;  3WG9 A;  3QP5 A;  1IO2 A;  3DU6 A;  3IRQ A;  2JUC A;  4IKF A;  2MA3 A;  2VE8 A;  1IF1 A;  3O8H A;  3K2A A;  4P5O A;  2GXB A;  5FLM J;  5KK1 A;  5JFR A;  1W36 D;  4KNY A;  3H3V K;  4EGY A;  1SD7 A;  3J7Z I;  4MEX F;  5JLX A;  3OYB A;  2JRT A;  5LLQ A;  3BG3 A;  2XC7 A;  2Q1Z B;  5BPI A;  4BNC A;  1Y6I A;  1FBQ A;  1U5T A;  3AG3 H;  2FXA A;  1HDD C;  4RAY A;  2DT6 A;  2M87 A;  2H94 A;  3EPZ A;  3LFU A;  3ASO H;  4J19 A;  3HUG A;  3WE3 A;  2KLO A;  3CUO A;  3FWE A;  2Z16 A;  3M7G A;  3CCL I;  1GDT A;  1O3T A;  1STZ A;  3G2B A;  2VXD A;  2EH3 A;  1RIO H;  2V6C A;  3E5Q A;  1I5Z A;  1P4A A;  1YFH A;  1G3Y A;  4E7S A;  3DKX A;  3OSF A;  1I3A A;  2UXX A;  1LEA A;  3L1P A;  3TP3 A;  3Q9S A;  3WGG A;  4I0B A;  3EYI A;  2W57 A;  3IH4 A;  1T56 A;  4HX4 A;  1FSH A;  3ZQQ A;  2K3P A;  4EJO A;  1Z77 A;  4AD9 A;  1RI7 A;  2KJC A;  3BR1 A;  3M1C A;  2KIU A;  3SJM A;  3KZI C;  1XD7 A;  3L09 A;  3KYD B;  1OCP A;  2LR8 A;  4HX7 A;  3G1M A;  1P2F A;  3F21 A;  4D7N A;  1JUP A;  1XGN A;  2DFE A;  3GUD A;  3WHB A;  2R7Z J;  1IRZ A;  4F92 B;  4PJM A;  2NVX J;  2OAZ A;  1VQ5 I;  4M71 A;  4AU7 A;  3K70 C;  4YFX F;  2OU2 A;  3CCQ I;  4OWR B;  2LP0 A;  3AL0 C;  1XDS A;  1PP8 F;  5ILV A;  1EH8 A;  2LBF B;  3NAR A;  4AUX A;  1S7O A;  2DN0 A;  5EGO B;  2VKV A;  1FTT A;  3RKX A;  4HQE A;  1ONV A;  3H9J A;  5HS9 A;  3TMO A;  3MKW B;  5LBQ A;  1ZHF A;  3I5U A;  1QZZ A;  2IW5 A;  2GA2 A;  2DQL A;  3C1D A;  1YI2 I;  3OOP A;  2K9Q A;  2E1C A;  1HOM A;  2E60 A;  5FFZ A;  4L9T A; 
#chains in the Genus database with same CATH homology
 4P96 A;  4EJU A;  2O3F A;  3T0Y A;  5BPD A;  4HA8 A;  4I09 A;  2HYG D;  2KJB A;  2VBW A;  3P9C A;  2QZ8 A;  1F4K A;  3HOT A;  3PQK A;  3DPT A;  5CVU A;  1KGS A;  3LQQ A;  5DD8 A;  1EV7 A;  4G7H F;  2JZY A;  1NHA A;  5FLX K;  4KIG A;  3V8L A;  4MTE A;  1W7P B;  3RKW A;  3OV8 A;  4LLG F;  1FNN A;  4YFK F;  5DV5 A;  2BEO A;  4R8H A;  1XGS A;  3R60 A;  1R1T A;  3MAJ A;  2QQB A;  3K69 A;  4AIJ A;  1T0F A;  5CVI A;  4OIR F;  1BI3 A;  4UVC A;  1O7F A;  1SMY F;  1BBY A;  3HOS A;  1B4A A;  4G7Z F;  4ZYD A;  1FZP B;  1IN7 A;  1L3L A;  5LRS A;  2KRF A;  2Y75 A;  1Z91 A;  4QLC U;  4HYE A;  2PEX A;  1XB4 A;  2Z5U A;  3K2Z A;  1OMI A;  3P9I A;  2W85 A;  2EB7 A;  4MEY F;  1MZB A;  4CYD A;  3GZ6 A;  3CJN A;  5DEQ A;  2CYY A;  4FX0 A;  1U8R A;  2P5V A;  5IT9 Z;  5ED4 A;  2L4M A;  4UV8 A;  4LG0 B;  3WTT C;  3LST A;  4G9Y A;  4OIQ F;  5K5O A;  3PQJ A;  3B73 A;  2VT3 A;  4ENN A;  1HW2 A;  2YU3 A;  4M73 A;  2PJP A;  2DU9 A;  4E70 A;  2HDC A;  3W6J B;  3RIR A;  1S29 A;  1Y0U A;  4KMU X;  4QWQ A;  5L3C A;  3V8J A;  3GFL A;  3M1E A;  5ILU A;  3ML6 A;  4LK1 F;  3BP8 A;  2XIG A;  2XAF A;  1IZ1 A;  2O61 A;  1E17 A;  4JK1 X;  1T39 A;  2IA2 A;  1UHW A;  2JSC A;  2FSW A;  1KU2 A;  5L3D A;  2EV0 A;  4PCQ A;  5HVQ C;  2XVC A;  2Z9O A;  4L5J A;  1ZAO A;  2LKP A;  1YW9 A;  3FHZ A;  1F5T A;  1R1V A;  1TLH B;  4RB2 C;  1XCV A;  4MNU A;  5A2Q K;  5HDG A;  2A5Y B;  1P92 A;  1J75 A;  2COM A;  1OPC A;  3BRO A;  2PI0 A;  4IJA A;  4P55 A;  2L4A A;  2R3S A;  2VC0 A;  3VOD A;  2LNB A;  3KP7 A;  4YG2 F;  5J8C A;  4M72 A;  1PUE E;  1R22 A;  5LHG A;  3L00 A;  4I0A A;  2VOD A;  5L3B A;  4XBF A;  1ZG3 A;  2LSO A;  3GW2 A;  1HKT A;  5F1R A;  1G6N A;  1HQC A;  1U5T B;  3L9F A;  3VB2 A;  2D1H A;  1X3U A;  5ICF A;  4HLY A;  1QBJ A;  4TV7 A;  3DEU A;  4M9Z A;  2GA1 A;  5IT3 A;  3WU1 B;  3K1P A;  2P6T A;  5CYV A;  1IN6 A;  1Z9C A;  3ELK A;  4OMY A;  2DQR A;  1U2W A;  3F6V A;  4RB0 A;  3TDU C;  1DPU A;  2VBZ A;  1KA8 A;  1ZGJ A;  3K0L A;  3HHG A;  1W5T A;  1HW1 A;  4RB1 A;  2C6Y A;  4A6D A;  2ELH A;  1XN7 A;  4ESJ A;  3IWF A;  3G73 A;  1IRG A;  2RV8 A;  3Q9V A;  2O03 A;  2XUB A;  1B6A A;  4M6X A;  5BOX A;  3FMR A;  1W7P A;  4L18 B;  3JTH A;  1MD0 A;  4R1H A;  2DT5 A;  3T8T A;  1ZN2 A;  2PBI A;  4ENM A;  3JAM K;  1C0W A;  3JTG A;  4I98 B;  3GXO A;  1LQ1 A;  3E97 A;  1H0M A;  2MH9 A;  4CGZ A;  2RGV A;  4UNO A;  2PLY A;  5AIQ A;  4Y17 A;  4ZYG A;  4OIN F;  5LRR A;  2IP2 A;  5FD5 A;  2QBY B;  2YPR A;  5CVR A;  3O6B B;  4A6E A;  5D8K B;  3IRR A;  4KN4 X;  2KKO A;  2K86 A;  2D2W A;  3RYR A;  1SFX A;  4ZZD A;  3SZT A;  4ZYH A;  2CFX A;  4MGR A;  2GWR A;  4OU0 A;  1P4W A;  3V4G A;  2NNY A;  3ISP A;  4M9S A;  1A04 A;  3R61 A;  3VEP A;  1EH7 A;  1G3S A;  4MQ9 F;  3TDZ C;  4O6J A;  3BPV A;  1L0O C;  1J5Y A;  2HKO A;  4XRF A;  2QQA A;  5DYM A;  5E8G A;  2Y48 A;  3SFZ A;  5FB2 A;  3IC7 A;  4Y13 A;  4PGG A;  3HRM A;  3LQR A;  3ZMT A;  1KU7 A;  1Z6R A;  1UB9 A;  3T1B A;  5HLH A;  2FF4 A;  2NNN A;  4BHP A;  2L54 A;  1B9N A;  3F22 A;  1R7J A;  4EM1 A;  2FNA A;  4PZJ A;  5TRD A;  1T6S A;  1D5V A;  1OR7 A;  3FMQ A;  4ENJ A;  1FC3 A;  1DDN A;  2BV6 A;  3IWZ A;  2XAG A;  1QGP A;  3BWG A;  2R7D A;  3HTS B;  1S6L A;  3ULQ B;  4N9H A;  1P4X A;  4IRH A;  2DI3 A;  2TDX A;  4AWX B;  4L0Z B;  1RUO A;  2J5O A;  5AON A;  2OD5 A;  3ECH A;  3SXY A;  4G6Q A;  3I53 A;  4KN7 X;  2YX7 A;  4Y15 A;  3E6D A;  1IXR C;  3BDD A;  3HSE A;  4U0W A;  4AVP A;  2FBH A;  2LF7 A;  4HOB A;  3BOQ A;  2MLG A;  1TQP A;  2QEN A;  4A5N A;  4WF2 A;  5CVV A;  4ENK A;  1JHF A;  2MBF A;  4GGG A;  2E7X A;  5ICG A;  4RGR A;  2VBX A;  5KVR A;  1BI0 A;  2V79 A;  3KZY A;  2A6H F;  3QPT A;  1S7A A;  5J6X A;  1K78 B;  3D0S A;  5H6Q A;  4EGZ A;  3HTU A;  3DKW A;  1KYZ A;  3TGN A;  5D4S A;  2QQ9 A;  1OYY A;  3BZ6 A;  2EFW A;  3K9T A;  1LB2 A;  4L9N A;  1V4R A;  5HDK A;  1KQ9 A;  1FYL A;  4N9I A;  5L3E A;  3E6M A;  2W24 A;  1SAX A;  3VOE A;  2OBP A;  1UHM A;  2UWM A;  2ADU A;  2NAZ A;  3FXU A;  1J59 A;  1O3Q A;  4DNC A;  4CO8 A;  3IKV A;  2ZKZ A;  1W5S A;  2DK8 A;  3KE2 A;  2Q2E A;  2ESN A;  3GFI A;  2KIM A;  4U7D A;  1VTN C;  1O57 A;  2GQQ A;  3WTV C;  3J7A O;  4MTD A;  1B9M A;  1XSX A;  2EV6 A;  2HYF A;  1O7L A;  2H09 A;  3EUH A;  3MQ0 A;  2P5K A;  1ON2 A;  1ZG5 A;  1IW7 F;  4H0E A;  4GYG A;  3REO A;  2GAU A;  1S3J A;  2HR3 A;  3IHU A;  2FOK A;  3V7R A;  1W4M A;  2FMY A;  4HF1 A;  3C3W A;  3L2C A;  2CWE A;  5D6E A;  4OOI A;  1LEB A;  3RPU A;  5J8F A;  5ILS A;  2QBY A;  5E1W A;  3F72 A;  5DUK A;  2DK5 A;  2MC3 A;  5K5R A;  1H9T A;  4JBA A;  1G3T A;  1K79 A;  3TOA A;  1EH6 A;  1KU3 A;  3F8N A;  4IHS A;  4HW0 A;  4IPA A;  3QOP A;  2DPU A;  4BQA A;  2HKX A;  4LLN A;  2OA4 A;  2G7H A;  1D8J A;  3F8M A;  1ZLK A;  1XCB A;  2XRO A;  5CVJ A;  1FWZ A;  2RNJ A;  2CQK A;  1CF7 A;  3BJA A;  2EWN A;  2FQ3 A;  1OYI A;  4XSZ F;  3TO9 A;  5E17 F;  5E18 F;  5DDG A;  2YX4 A;  1PP7 U;  1FPQ A;  3BJO A;  3LAJ A;  4I7H A;  2HS5 A;  5DD4 A;  3I59 B;  1GHC A;  5DCF A;  1BIB A;  3T8R A;  1SD4 A;  1IAW A;  5D5X B;  4WXH A;  2DLL A;  2FA5 A;  1Q1H A;  1MJB A;  1FY7 A;  1SD6 A;  1KU9 A;  2HQN A;  1LVA A;  3LWF A;  3CUQ C;  1MJA A;  5HOO A;  4LMY A;  2STW A;  2W25 A;  2DFI A;  4RB3 C;  2RKH A;  1YYV A;  1TQM A;  3JSP A;  4U0V A;  2XAJ A;  3KET A;  4A12 A;  3KP5 A;  3ZP5 A;  4P9U A;  5E20 A;  2OQR A;  2FU4 A;  1LJ9 A;  1P6R A;  1FLI A;  4GYI A;  4KA4 A;  2IA0 A;  2A69 F;  2NYX A;  2D45 A;  4XLP F;  4I2O A;  3H92 A;  3H3Z A;  3O3K A;  1YTY A;  3VFZ A;  4KIB A;  3WGH A;  2HWV A;  1K78 A;  1V3F A;  4GO1 A;  5FO5 A;  1F9N A;  2ZME A;  3GX4 X;  5HDN A;  5FD6 A;  1IXS B;  2PFB A;  4UVA A;  4UUV A;  2IVM A;  1CGP A;  4PGH A;  3WTU C;  3E5U A;  5EEG A;  4HDU A;  2CW0 F;  5K1Y A;  2K4B A;  2PG4 A;  1T98 A;  2LDU A;  1FBS A;  1GXP A;  2ZNZ A;  4L5I A;  3IKT A;  4KYW A;  2E1N A;  2ZCW A;  4BXU A;  3SQN A;  4WWC A;  4Q5S F;  1BI1 A;  3HYI A;  1DPR A;  3E5X A;  1QNT A;  4CHU A;  1S8N A;  2O6G E;  3MCZ A;  3TOB A;  1B59 A;  2QUF A;  2Q8K A;  3ABT A;  3LFK A;  3DQV C;  2NRA C;  4YIF A;  4I02 A;  1TQI A;  3WTW C;  3GFM A;  2VOP A;  1BI2 A;  2EFO A;  3WTZ A;  5FLX Z;  3B02 A;  2EA4 A;  3KFW X;  5JHU A;  2WTE A;  4HDV A;  2M5W A;  1GVJ A;  1TNT A;  5ICE A;  2HZT A;  4L9J A;  2D1V A;  1ZRF A;  1KQ8 A;  1UFM A;  4P9F A;  4XLN F;  4I01 A;  1U78 A;  1MGT A;  5D6F A;  2K4J A;  3FM3 A;  4OMZ A;  2VC1 A;  1HKQ A;  2RC4 A;  4A0X A;  2K02 A;  2A07 F;  4HZF A;  2FEZ A;  3RJP A;  1WQ2 A;  2M45 A;  3EDP A;  1HW5 A;  4A2U A;  3KCC A;  4L9V A;  1WWX A;  3DXJ F;  3PFI A;  4KDP A;  5L3G A;  2KIF A;  4ASN A;  1R1U A;  1REP C;  3GZ5 A;  4MHG A;  1ZYR F;  1I27 A;  1JGS A;  5D8L B;  3AAF A;  2ISY A;  2STT A;  3I59 A;  2RDP A;  3COA C;  3NRV A;  3FM5 A;  2IRF G;  3RTR A;  3M9A A;  1G3W A;  2V1X A;  5FFX A;  3DP7 A;  1Z7U A;  5E1Z B;  1FSE A;  2EA2 A;  2HTS A;  4LB6 B;  5LEK A;  4IRG A;  1CF7 B;  1WRJ A;  5L3F A;  1XSD A;  3KLN A;  2M30 A;  4HF0 A;  3ZMU A;  2XRN A;  3KP3 A;  3V7S A;  2IT0 A;  2V9V A;  2QWW A;  3O2P E;  3TO7 A;  3RI4 A;  1QQI A;  2V1U A;  2XV4 S;  3P7N A;  3GLX A;  2BYV E;  3HRU A;  2CGP A;  1YQA A;  2XKO A;  5DUI A;  3J80 Z;  4GXO A;  2XHK A;  4BHC A;  3RKY A;  2P6S A;  2GZW A;  1G4D A;  3Q5F A;  3K1N A;  1BC8 C;  3M8F A;  3GEZ A;  1YS7 A;  4N0B A;  4CDG A;  4BHB A;  4LK0 F;  3ROU A;  1TBX A;  4JQF A;  2VBY A;  4NHJ A;  3ZMZ A;  4AIH A;  4O5V A;  2K27 A;  2PMH A;  2XAS A;  4LJZ F;  3TQN A;  4NB5 A;  3RDI A;  4HAM A;  4ETS A;  1IN5 A;  5JVT A;  1IN8 A;  3HHH A;  2UZK A;  1ON1 A;  3GYH X;  3CUQ B;  4K2E A;  2HEO A;  2R7F A;  4ESB A;  1ULY A;  3F3X A;  4HQM A;  4U0Y A;  5IT9 K;  2IJL A;  5LGU A;  1J9I A;  3F23 A;  2EK5 A;  2OZ6 A;  3GO5 A;  2WWY A;  1ZLJ A;  3E6C C;  4GCV A;  2EFQ A;  2ZBK A;  5BS6 A;  1U5T C;  1IUY A;  1HSJ A;  2FRH A;  2AS5 F;  1J0R A;  2ZME B;  4HV6 A;  1BC7 C;  1B1B A;  5TJJ A;  1BIA A;  5LGN A;  1JE8 A;  1FP1 D;  4L0Y B;  4PDK A;  3QAH A;  4CZZ A;  2P4W A;  1LNW A;  2FE3 A;  1YW8 A;  5AIP A;  2XGX A;  4EQQ A;  4S04 A;  3E3V A;  1OKR A;  4WXC A;  2QVO A;  2VT2 A;  3L7W A;  2DW4 A;  1YLF A;  3V8K A;  2VXZ A;  5LHH A;  2ACJ A;  3QRF F;  2QYO A;  2HGC A;  3JAM Z;  1U3E M;  1TW2 A;  2FBK A;  1T2K A;  3KEQ A;  4CXF A;  4IHT A;  1I1G A;  1YIO A;  1R5H A;  4DQ2 A;  2K7L A;  3R6S A;  4AIK A;  1ODD A;  3U1D A;  3BY6 A;  3TO6 A;  4EVI A;  4LB5 A;  2ETH A;  5HS8 A;  1SD5 A;  5BMZ A;  3BJ6 A;  4MQV A;  4IRI A;  3ZMD A;  2ZJ2 A;  3F8F A;  1JXS A;  1MJ9 A;  3JSO A;  3CO6 C;  2HFH A;  4OIP F;  3SZP A;  1USS A;  3WE2 A;  3EQL F;  3HSR A;  3R4K A;  4WX9 A;  2VN2 A;  1ZAR A;  1O3R A;  1R36 A;  2L01 A;  4M74 A;  4BAY A;  5E8I A;  3ZN1 A;  4HX8 A;  1FP2 A;  1XSV A;  4NQW A;  5JR3 A;  1ZRD A;  1MDM B;  2A6E F;  2ZO4 A;  4G7O F;  1HKS A;  4WCG A;  1FOK A;  1QPM A;  4KFC A;  4EM2 A;  1YW7 A;  2BBY A;  2FNP A;  4B09 A;  4FX4 A;  4U7B A;  5BQT A;  2O0Y A;  3MFK A;  1K7A A;  1SMT A;  3JW4 A;  2VOO A;  2F5F A;  2PMU A;  4ZZL A;  5HS7 A;  4G6D A;  1LDD A;  1U6G A;  3LA2 A;  2EJR A;  1HST A;  1R00 A;  3WTY C;  4U88 A;  5DCM A;  1IXC A;  2ZNY A;  3E6B A;  4A0Y A;  3MZY A;  2ZXJ A;  3QU6 A;  1KQ0 A;  1ZRE A;  3R0J A;  2L3D A;  2CG4 A;  3BPX A;  2EFP A;  1IN4 A;  4BYY A;  2F2E A;  3I0T A;  3ABU A;  2YSR A;  3MEX A;  2G7U A;  2A68 F;  3J81 Z;  3CTA A;  2Q0O A;  2Z33 A;  1OYW A;  1TW3 A;  3ZPL A;  4HLX A;  1XDU A;  1RUN A;  5CLS A;  1I1S A;  2CO5 A;  3ZQ7 A;  2E7W A;  2A3S A;  2MD5 A;  1TNS A;  2P7C B;  2P7V B;  1HXD A;  3N4M A;  2OZU A;  4LGW A;  4YFN F;  4ZYE A;  1HBX G;  4R79 A;  3I58 A;  4EJV A;  1J2X A;  1BOA A;  3LA3 A;  3I64 A;  3CUQ A;  4HBL A;  1RZ4 A;  3FXQ A;  4D0P A;  2V1D A;  3GWZ A;  3R0A A;  2M1B A;  2PQ8 A;  2AXL A;  1DUX C;  3GVA A;  3I71 A;  3W6K B;  2OQG A;  3EYY A;  5D5V B;  2L02 A;  3KP4 A;  3KP2 A;  3SHF A;  1GXQ A;  2ZFW A;  4LD5 A;  4Q48 A;  3WTS C;  1BN5 A;  2NS0 A;  3HRT A;  4EJW A;  1QO0 D;  3EET A;  4UVB A;  1YO5 C;  2IA1 A;  3J80 K;  3FX3 A;  4S05 A;  3C7J A;  2JTV A;  2X0L A;  1WKM A;  4UXN A;  1AOY A;  5D4R A;  2DAO A;  3C18 A;  1UCR A;  2HQR A;  2H6B A;  3WGI A;  3U2R A;  4YII A;  2EV5 A;  2GIV A;  3HIF A;  3I54 A;  3KP6 A;  3FMS A;  1JHH A;  1ZG1 A;  4G94 A;  2PN6 A;  3NEU A;  5LEJ A;  3KLO A;  1MKM A;  3CDH A;  1UST A;  2M8E A;  2B0L A;  5HLI A;  2VE9 A;  1H9G A;  4Q4Z F;  1Z1D A;  3RPQ A;  3HSF A;  4IF4 A;  2DBB A;  6PAX A;  3G3Z A;  4RGU A;  4BH9 A;  2EFN A;  4A5M A;  4WXD A;  2JT1 A;  2FML A;  4O3M A;  3M8E A;  2BE5 F;  3S2W A;  3KZZ A;  2RVC A;  5E1X A;  2G9W A;  3WTX C;  4RAZ A;  2XAH A;  2F5C A;  2P8T A;  1E2X A;  3F6O A;  3RYP A;  3N97 A;  5K5Q A;  1YS6 A;  4EM0 B;  4KIF A;  3TKY A;  1R58 A;  3DFG A;  3LAP A;  2H6C A;  4UHT A;  4LFU A;  4XSX F;  2XKP A;  4KMF A;  2YR2 A;  3LA7 A;  2VON A;  3GFJ A;  4Z2Y A;  1DP7 P;  5D5U B;  3DF8 A;  2A61 A;  3CO7 C;  4RGX A;  3WOD F;  2UXN A;  3V7C A;  1MDM A;  3ZN0 A;  3KEO A;  1J7K A;  3CLO A;  1FT9 A;  3F8C A;  1T38 A;  3H3U A;  2DTR A;  4ON0 A;  2WC2 A;  2IPQ X;  1FYK A;  3DPL C;  3MWM A;  4ESF A;  2F5D A;  2QM3 A;  1ZH5 A;  4EV0 A;  2QLZ A;  5EEH A;  1SFU A;  2FBI A;  3I4P A;  1YG2 A;  1FX7 A;  2P5L C;  3FZV A;  1AWC A;  1XMK A;  3F8B A;  2XAQ A;  4FT8 A;  1F1Z A;  1O3S A;  3GF2 A;  1LDK B;  2WV0 A;  5ICC A;  4UV9 A;  5LGT A;  1XGM A;  1BM9 A;  3QU3 A;  5F64 A;  1PDN C;  1W7P D;  3ZMS A;  4WK8 F;  4KIC A;  2F5E A;  2J5P A;  1KYW A;  5ERI A;  4HF2 A;  2DO7 A;  2CSO A;  2JPC A;  3FF5 A;  1D3Y A;  5H20 A;  3QPH A;  5HLG A;  2RN7 A;  2ISZ A;  3ERE D;  1WSU A;  1XGO A;  2Z99 A;  3D5L A;  5JI6 A;  4LG0 A;  2O8X A;  4KUM A;  5DCM B;  1XMA A;  4EMS A;  4RGS A;  2ESH A;  2Y0M A;  5FGM A;  4F7Z A;  2W84 A;  3ZMV A;  3IL2 A;  4M6Y A;  1Z6T A;  2HTJ A;  1BJA A;  5A2Q Z;  5CJ9 A;  4OIO F;  3DV8 A;  3HRS A;  3NQO A;  1Z05 A;  1ZGA A;  2RQP A;  4HV5 A;  2HOE A;  1FYM A;  4RS8 A;  3T5X A;  1WI9 A;  1FBU A;  4G8X A;  1I6X A;  1D8K A;  2JPB A;  5F6F A;  4Q47 A;  4KT5 C;  1ZRC A;  3MZH A;  1R23 A;  3WU0 A;  4EJT A;  5H6R A;  3P9K A;  1RNL A;  3K1M A;  4A0Z A;  1TTY A;  4FHT A;  2LF8 A;  2DPD A;  3FXR A;  5LHI A;  1K6O A;  1R5G A;  2H27 A;  4LLL A;  2MH2 A;  4ZH4 F;  3J81 K;  4B8X A;  1SFE A;  1QZY A;  3U9G A;  2Z3Y A;  5D5W B;  2BGC A;  3ECO A;  4IVN A;  4M9X A;  3QP6 A;  4CIC A;  1IRF A;  2MLK A;  2GXG A;  4IXA A;  2X4H A;  1LDJ A;  3WG9 A;  3QP5 A;  3IRQ A;  2MA3 A;  2VE8 A;  1IF1 A;  4P5O A;  2GXB A;  5KK1 A;  5JFR A;  4KNY A;  4EGY A;  1SD7 A;  4MEX F;  2JRT A;  5LLQ A;  5BPI A;  4BNC A;  1FBQ A;  1U5T A;  2FXA A;  4RAY A;  2M87 A;  2H94 A;  3HUG A;  3WE3 A;  3CUO A;  3FWE A;  3M7G A;  1O3T A;  1STZ A;  1RIO H;  2V6C A;  3E5Q A;  1I5Z A;  1P4A A;  1YFH A;  1G3Y A;  2UXX A;  1LEA A;  3Q9S A;  3WGG A;  4I0B A;  3EYI A;  2W57 A;  4HX4 A;  1FSH A;  4EJO A;  4AD9 A;  1RI7 A;  2KJC A;  2KIU A;  1XD7 A;  3L09 A;  4HX7 A;  1P2F A;  3F21 A;  1XGN A;  3GUD A;  2OAZ A;  4M71 A;  4YFX F;  2OU2 A;  1XDS A;  1PP8 F;  5ILV A;  1EH8 A;  1S7O A;  3RKX A;  4HQE A;  1ONV A;  5HS9 A;  5LBQ A;  1ZHF A;  3I5U A;  1QZZ A;  2IW5 A;  2GA2 A;  2DQL A;  3C1D A;  3OOP A;  2E1C A;  5FFZ A;  4L9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...