4AVPA

Crystal structure of the dna-binding domain of human etv1.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS TRANSLOCATION VARIANT 1
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4avpA00
2HKOA 4ENNA 3ZMSA 3RYRA 2HWVA 5DEQA 1QNTA 4PCQA 3MZYA 3H3ZA 2FBHA 3FMQA 2X4HA 1SD7A 4E70A 3TO7A 2IP2A 2LSOA 5E20A 2NYXA 3FXQA 2ISYA 3O6BB 4M74A 2CO5A 5HDNA 3WTWC 1R1TA 5F1RA 2HTJA 4EJTA 5D5VB 1Z1DA 2HQRA 3WTZA 3C7JA 3BJAA 4ESJA 3GFJA 1NHAA 3RKXA 2UWMA 4IRGA 4IRIA 2F5DA 1YLFA 1EV7A 1S3JA 2IA0A 1MJ9A 2IVMA 2FMYA 5LHGA 2OD5A 4PDKA 2DPDA 3EYYA 3ECHA 3GF2A 2O61A 3V7RA 1B9MA 1K78A 1D3YA 5ICGA 4EGZA 2XV4S 3F3XA 4RB0A 3TKYA 1ON2A 1TQPA 1XDSA 2DQRA 3VOEA 2CGPA 1HW5A 3CO6C 4IJAA 4P5OA 4L0YB 2QWWA 2A6HF 5D5WB 2GAUA 1SFEA 2DFIA 2R3SA 1G3WA 2G7HA 4FX4A 1LVAA 4HX7A 3GWZA 3E6BA 5FLXK 1BIBA 4PGHA 2DI3A 3KP7A 4IHTA 2HTSA 5LGUA 1KGSA 1IN5A 2XKPA 3QU3A 4M71A 4YIFA 5FFXA 5CVJA 4BH9A 2V1DA 3S2WA 2RC4A 1T6SA 4ZZDA 3DPLC 4D0PA 1O3QA 2EK5A 2NRAC 2EV6A 2YX7A 2OA4A 5D8LB 3F6VA 6PAXA 1BM9A 2EFNA 4Q5SF 1P2FA 1TTYA 2A6EF 4EMSA 3ZN1A 2MC3A 4EJWA 1HSTA 1Z7UA 4M9ZA 5FD5A 3REOA 2Z33A 3ML6A 1Q1HA 3I5UA 2L02A 3IKTA 4HF0A 3KLOA 2EJRA 2V1UA 1K79A 4HQMA 3U2RA 4GYIA 3ABUA 1RUOA 1JHHA 3MEXA 3BOQA 1FYKA 4LLNA 2DBBA 2ZO4A 2KIFA 3IKVA 1ZAOA 5DUIA 3WG9A 2HQNA 1LEBA 3AAFA 3TDZC 3TDUC 4ZYGA 4WWCA 5H6RA 3LA3A 3W6KB 1T2KA 1RNLA 2D1VA 3R0JA 2OQGA 1XCBA 3K1NA 3HTSB 1CF7A 2EA4A 1XD7A 5TRDA 1MDMB 2DK8A 4RGSA 2DK5A 4LG0B 2GQQA 1AWCA 2NAZA 2FRHA 2V9VA 1SFXA 2QQBA 4WF2A 3HOSA 1RZ4A 1XGOA 2W25A 2XHKA 1LDJA 4G8XA 2P5KA 1U8RA 2XGXA 4LJZF 5D4RA 3F22A 3FHZA 1L0OC 2HS5A 2P8TA 4ZYHA 2J5OA 4I98B 1Z9CA 1ODDA 5CVUA 1IW7F 1FP1D 3ELKA 4AIJA 4B8XA 1UCRA 2FA5A 5L3DA 2YR2A 3F8CA 4I09A 3HRSA 2IPQX 5E1WA 2AXLA 4HX8A 4KN4X 4AIHA 4HV5A 1YS6A 3V7CA 2VOPA 4G7ZF 3KEOA 4M6YA 1ZG5A 2VE8A 3QAHA 1KU2A 2IRFG 1OYYA 1R00A 3I53A 4L9NA 4RAZA 5K5RA 4ZYDA 3LSTA 3QOPA 2P7VB 2KIMA 2P6TA 3HSRA 5HS8A 3M7GA 1R22A 2QZ8A 1YW7A 4Q47A 3TGNA 4LLGF 3J81K 4G7OF 3DFGA 2IJLA 4GCVA 3VB2A 2YPRA 2M30A 5LGNA 3OOPA 5KK1A 1I1GA 1HW2A 3ZMDA 1TNSA 2VONA 2BEOA 4LB5A 3HUGA 5HS7A 1SFUA 3O2PE 2VBXA 2Z99A 4KFCA 1U5TA 4U7DA 3I4PA 1FYLA 5HLHA 4MTDA 2PFBA 5ILVA 3QU6A 4OIPF 3I0TA 4U0WA 1P4AA 3KCCA 5ERIA 2YX4A 4O6JA 3SFZA 2DPUA 3T8RA 5IT9K 2XAHA 2H6BA 3FZVA 1YIOA 3BPVA 4FT8A 2GIVA 3HRUA 4KIGA 2ACJA 3MFKA 2OU2A 2O8XA 4AVPA 1K78B 2OQRA 3RPUA 1SMYF 3Q5FA 1QPMA 4G7HF 3K1MA 1DDNA 1ZGAA 1SD4A 2ZXJA 4HDUA 2D1HA 3DP7A 4KT5C 1W7PA 1XDUA 3DQVC 4I7HA 3DEUA 1XGMA 2O3FA 2FNPA 5FFZA 3ZMVA 2OBPA 4HF1A 4A5MA 2KKOA 3R4KA 4I0BA 1S6LA 4I02A 4L18B 4UNOA 5DCFA 4XLPF 2QENA 3I54A 2WC2A 1U78A 3FMSA 1W5TA 1HQCA 3GEZA 4JBAA 4NHJA 4OMZA 4JQFA 3TO6A 1R23A 3TOAA 2QM3A 1P4XA 3GW2A 2ZNZA 3IC7A 4EM0B 3KZYA 2JT1A 4M9SA 3L2CA 3N4MA 1B1BA 1LEAA 1QQIA 4HV6A 2CYYA 4XLNF 2JRTA 5F6FA 2STWA 2FU4A 3HYIA 3GZ5A 1KYWA 3E6MA 3EQLF 3LA2A 2F5EA 1ZLJA 4S04A 1ZYRF 1DUXC 1BI3A 3BROA 2LKPA 1H9TA 3DKWA 1HSJA 2RKHA 2JPCA 3BJOA 4A5NA 5LRSA 3IRRA 3P7NA 1KA8A 3M8EA 3ROUA 1CF7B 1PUEE 4G6QA 3RTRA 1TW2A 2W24A 3E6DA 3O3KA 1FPQA 1PP8F 5AIQA 4KIBA 1W4MA 3KEQA 3IWZA 2M45A 2EFPA 4UUVA 2ZFWA 2K7LA 3WGIA 3CLOA 4ZZLA 3KETA 3QP5A 3J80Z 4P96A 1XMAA 1B9NA 4UVCA 1MD0A 3KFWX 5FB2A 2GXBA 1I6XA 3V8JA 2ADUA 2DW4A 2CFXA 3I64A 1RIOH 4IRHA 2MLKA 4XRFA 5BMZA 4TV7A 3RDIA 3FM5A 1USTA 3LQQA 3K2ZA 4N9HA 2WWYA 5D5XB 4A6DA 3PQJA 2K4JA 1FP2A 4MTEA 2GA1A 2IW5A 2XKOA 2ZNYA 3CDHA 1FBSA 1MJAA 3WGGA 4U0VA 1S8NA 4OIQF 4GYGA 2IA2A 1BI1A 4P9UA 1IF1A 3GO5A 2XAJA 1F9NA 2DQLA 4Q4ZF 3ZPLA 3GYHX 3M1EA 4DQ2A 1FSHA 1ZHFA 2ETHA 3G73A 4LK1F 4WCGA 1D5VA 5J6XA 2RN7A 2VT2A 1DP7P 3JW4A 1UFMA 2CWEA 1YO5C 3P9IA 3JSPA 4R1HA 3F72A 4L9VA 1BOAA 5DUKA 3CO7C 3ABTA 5HVQC 3SZTA 2L3DA 1EH8A 2RQPA 1T98A 3GX4X 3CUQA 2PMHA 1XMKA 1YW8A 3K1PA 1LNWA 1U5TB 1YS7A 5E18F 4LD5A 4FX0A 4EV0A 3DXJF 2CQKA 3WTXC 2E7XA 3F23A 2GXGA 1O3SA 1FOKA 1WKMA 2BV6A 2CG4A 3F6OA 3VODA 2UXXA 1IN4A 4AD9A 3EUHA 3KLNA 3MZHA 4MQVA 4A6EA 4XSZF 5DCMA 1W7PD 1BJAA 1ONVA 2K86A 2FE3A 2CW0F 3JTHA 4MGRA 1JGSA 2K4BA 3MAJA 1J0RA 3E5XA 3E5UA 4WXCA 5ICFA 4CICA 2EFWA 3QPTA 3I59A 1O3TA 3FMRA 1FWZA 4ZH4F 1HBXG 2LF8A 1AOYA 3KE2A 5BOXA 2M8EA 4MEXF 2XVCA 3C3WA 1Z05A 2PG4A 5L3EA 3LAJA 1L3LA 1IXRC 3QPHA 3LFKA 4YG2F 1ZLKA 5AIPA 4IPAA 1EH7A 2Z3YA 4MNUA 2C6YA 1XGSA 1ZG1A 5A2QZ 3V7SA 3IL2A 3E5QA 4G6DA 3M9AA 2EV0A 1S7AA 3ULQB 5LHHA 2STTA 1TNTA 5D4SA 3EDPA 3FWEA 5FO5A 4KYWA 3Q9VA 1XGNA 1J7KA 2YU3A 2PI0A 1E2XA 2TDXA 2MLGA 2EFQA 1TQIA 1GVJA 3ZQ7A 2L4AA 1P4WA 4U0YA 1XSDA 4BNCA 2EA2A 3R60A 1TLHB 1LDKB 5CVRA 1QGPA 3VFZA 2XAQA 2QQAA 4I0AA 4HX4A 2HEOA 1BC7C 1REPC 5L3BA 1UB9A 2IT0A 5LLQA 3TQNA 1QO0D 3F8BA 2FEZA 1K7AA 2QVOA 3CTAA 4UVAA 1U3EM 3R61A 3WODF 2DO7A 3B73A 4RB3C 4YFXF 4MEYF 3E97A 2FOKA 3NRVA 2FXAA 1WWXA 3PQKA 2PJPA 5DDGA 1F4KA 3W6JB 1LB2A 2XAFA 1ZRFA 2KJBA 5D6EA 3QRFF 4KNYA 2E1CA 3P9KA 1MGTA 1IN6A 5L3CA 4HZFA 4LLLA 3I58A 5FD6A 2FBIA 1JXSA 3RPQA 2FF4A 2R7FA 4KIFA 4BXUA 4RB1A 4FHTA 2BBYA 2BE5F 2VC0A 3L9FA 3LQRA 4UVBA 1OYWA 4B09A 2MBFA 5JVTA 1JE8A 4O5VA 4HAMA 1FLIA 1RUNA 2H09A 1SD5A 4RS8A 3BDDA 5FGMA 1K6OA 5LHIA 2KIUA 2D2WA 2COMA 1WQ2A 1WRJA 1Y0UA 4I2OA 3I71A 2JPBA 3COAC 1GXPA 4ENKA 1TW3A 3JAMZ 1YG2A 1R58A 2E1NA 2K27A 1ZRCA 3F8MA 4NQWA 4RGXA 3V8KA 1J59A 4ASNA 2F5FA 4L9JA 1YFHA 3K69A 1HXDA 3RIRA 4CO8A 5DYMA 2ZMEA 1UHMA 4KMUX 4O3MA 4OIOF 1F5TA 5L3FA 4NB5A 5HLGA 1O7LA 2O0YA 4M6XA 3T5XA 1OYIA 3CUQB 4ESFA 2ZKZA 5LEKA 2L4MA 4LGWA 3BPXA 3HOTA 4F7ZA 2VBZA 3T8TA 3G3ZA 1HKQA 3VEPA 4HLXA 1MZBA 2HR3A 1Z6TA 3BP8A 2OZ6A 3C1DA 2H27A 2P6SA 1UHWA 2JSCA 3ZMUA 2PN6A 3FX3A 2WTEA 4AWXB 3WE2A 1O3RA 5IT3A 1LQ1A 1R7JA 2MA3A 1A04A 4HDVA 4CDGA 4LG0A 2Y0MA 4Z2YA 3N97A 3RYPA 1V4RA 2XIGA 5JHUA 2V6CA 2Y48A 4H0EA 3WTVC 1G3YA 4LFUA 3RI4A 3I59B 5H20A 1S29A 2Q0OA 3L7WA 2XROA 3CUOA 1LJ9A 1TBXA 1IRGA 4Y17A 5ICEA 4MHGA 4IVNA 4PGGA 4KICA 3SQNA 2GZWA 5CJ9A 2LF7A 4XBFA 1B4AA 1P6RA 3HSEA 1SMTA 4KUMA 5E1ZB 5E1XA 2LDUA 2BGCA 2L54A 3GFLA 3BY6A 5CVIA 5BPIA 1J5YA 1O57A 2PEXA 3R6SA 1KQ8A 3ZMTA 3WTYC 1IUYA 1R5HA 1IN7A 5K5OA 2W85A 2PBIA 3IWFA 1QBJA 1QZYA 1U5TC 3C18A 3J7AO 4DNCA 2PLYA 2VT3A 1XSXA 1DPUA 1ULYA 4G9YA 3HHHA 1I1SA 2RV8A 3F8NA 5ED4A 3HHGA 2XUBA 5D5UB 1YW9A 3U9GA 4YIIA 2EV5A 2YSRA 1STZA 5D6FA 5H6QA 2VC1A 3K0LA 4AIKA 2Q2EA 2XAGA 2X0LA 3BZ6A 1FT9A 1IXSB 3RJPA 5BS6A 5LGTA 4K2EA 5FLXZ 4UHTA 3H92A 3K9TA 4KA4A 4KDPA 4IXAA 5K1YA 1KQ0A 1FC3A 2RNJA 4L0ZB 2ESHA 1VTNC 1BC8C 1XN7A 1JHFA 5CVVA 3FXUA 1G3SA 1XB4A 1CGPA 3GXOA 4EVIA 2E7WA 3JTGA 2HDCA 4WX9A 4M9XA 2VODA 2GA2A 2FNAA 3GVAA 2DT5A 4UXNA 1OPCA 2MH9A 3V4GA 3JSOA 4HW0A 4N9IA 2DAOA 3D5LA 1C0WA 2QBYA 1IRFA 3SHFA 5JI6A 4L9TA 1P92A 1BI2A 2NS0A 2VBYA 2VN2A 5HOOA 3J80K 2ZBKA 2XASA 2A3SA 4P55A 4M72A 3HTUA 2FSWA 4HA8A 4XSXF 2VE9A 1J75A 1G4DA 4GGGA 4IF4A 2NNNA 1KU7A 1R36A 2LNBA 4U88A 3ZN0A 2GWRA 1FX7A 1J2XA 2Q8KA 2A68F 4HLYA 3HRMA 2VXZA 4R8HA 2F5CA 1T38A 2VBWA 4HQEA 1ZREA 2Y75A 3LA7A 3IHUA 5HLIA 2M5WA 1W5SA 3WE3A 4Q48A 1ZRDA 4OINF 3EETA 4UV9A 3MQ0A 1IZ1A 3P9CA 5DD8A 2HOEA 3H3UA 2Z9OA 2WV0A 5LEJA 4ON0A 2DLLA 3QP6A 4CZZA 2DU9A 1GXQA 1WSUA 1HW1A 3FXRA 4RB2C 4I01A 2FQ3A 4BHPA 1W7PB 2P4WA 1FBQA 5E8GA 3E6CC 2ZMEB 5ILUA 4PZJA 5D8KB 3WU0A 2HKXA 1ON1A 1F1ZA 2EWNA 5JFRA 4CYDA 3CJNA 2ESNA 4U7BA 3OV8A 2ELHA 1OKRA 1LDDA 4EM1A 2UZKA 1ZARA 2AS5F 3NQOA 5DV5A 5KVRA 3GFIA 2D45A 3KP3A 5J8CA 2QYOA 5ICCA 1ZG3A 3WGHA 3U1DA 4RGRA 2J5PA 4EJUA 3ERED 2XRNA 1G6NA 2P5LC 5LBQA 2O03A 3KP6A 2A5YB 1FZPB 4A0XA 1J9IA 1FBUA 2W57A 4A0YA 4RAYA 2A69F 4Y13A 2QLZA 1EH6A 4HOBA 3WTUC 1Z6RA 2RDPA 3J81Z 2F2EA 1HKSA 2V79A 2W84A 2JTVA 4MQ9F 4BQAA 5CLSA 2PMUA 4UV8A 4OOIA 4WXHA 3B02A 3RKWA 3GFMA 1ZH5A 3WU1B 2NNYA 2ZCWA 1D8KA 1G3TA 1QZZA 2Z5UA 1WI9A 3M8FA 4EGYA 3BJ6A 3LWFA 5J8FA 5IT9Z 1R5GA 3CUQC 4OU0A 4G94A 3E3VA 1MJBA 2OZUA 1R1UA 3BWGA 3LAPA 4A0ZA 5A2QK 1OMIA 4KN7X 3TOBA 1FSEA 3ZP5A 5F64A 1H9GA 5HS9A 2JZYA 3V8LA 2H94A 1FYMA 2ISZA 2MH2A 4OIRF 2ZJ2A 4EJVA 1YYVA 4OMYA 1YQAA 3HRTA 2K02A 4A12A 2H6CA 4QLCU 4WXDA 4HYEA 1H0MA 1S7OA 4A2UA 2RGVA 1OR7A 5E17F 2G7UA 4ETSA 4WK8F 1FNNA 3RKYA 1E17A 4Y15A 4LB6B 5CYVA 4EQQA 4BYYA 5EEHA 1XSVA 3KP2A 1I5ZA 2L01A 5BQTA 1V3FA 4ESBA 4LMYA 2BYVE 2M87A 3GZ6A 4ZYEA 3FF5A 4CHUA 3FM3A 3HSFA 1U2WA 3PFIA 1T0FA 1IN8A 1GHCA 2KJCA 1PDNC 1B6AA 4M73A 3HIFA 4YFKF 2R7DA 1U6GA 3KZZA 5E8IA 2QBYB 4BHBA 1XCVA 4EM2A 1BI0A 1ZGJA 5K5QA 1HKTA 1TQMA 3F21A 1SAXA 1BN5A 2B0LA 5DD4A 1KU3A 1KYZA 4N0BA 2RVCA 3SZPA 2HZTA 3EYIA 2FBKA 4L5JA 5AONA 4IHSA 3DPTA 4RGUA 2FMLA 1ZN2A 4GXOA 2MD5A 3IRQA 3R0AA 2PQ8A 4EJOA 4R79A 1PP7U 2P5VA 4ENMA 3GUDA 1SD6A 4P9FA 5JR3A 4S05A 2DTRA 3F8FA 4HBLA 2O6GE 2QUFA 5TJJA 1X3UA 1T39A 3T0YA 3L09A 3NEUA 1O7FA 1KU9A 2KRFA 3KP5A 2VOOA 1RI7A 1I27A 1MDMA 2EB7A 5DCMB 1YTYA 2UXNA 1R1VA 2HYGD 3JAMK 2P7CB 1D8JA 2HGCA 2OAZA 2IA1A 4JK1X 4QWQA 4ENJA 3MCZA 4GO1A 4L5IA 3L00A 5HDGA 2G9WA 3GLXA 3KP4A 5BPDA 3SXYA 1DPRA 3Q9SA 1IAWA 3ISPA 5L3GA 1BIAA 4BAYA 3T1BA 2A61A 2HYFA 4HF2A 1KQ9A 3DF8A 3D0SA 2A07F 2CSOA 3TO9A 1MKMA 2V1XA 2QQ9A 1USSA 1B59A 1IXCA 3ECOA 5EEGA 1BBYA 5ILSA 1Z91A 4KMFA 3WTSC 4CXFA 2M1BA 3DV8A 4LK0F 4BHCA 2EFOA 1FY7A 4CGZA 2HFHA 3MWMA 5HDKA 3WTTC 5LRRA 3ZMZA 4YFNF
chains in the Genus database with same CATH superfamily
5KHDA 2HKOA 2O9LA 2DA5A 4ENNA 4XM3A 3ZMSA 5FKNA 3RYRA 9ANTA 2HWVA 2TRTA 4YIRX 1T33A 5DEQA 1D5YA 1QNTA 2OTLI 4PCQA 2VXDA 3RZOJ 3VSKA 1VQKI 3MZYA 3H3ZA 2FBHA 3FMQA 2X4HA 3W6VA 3EUAA 1SD7A 4E70A 5F0HA 3TO7A 2KISA 2IP2A 2M3AA 1W5CC 2LSOA 3OL4A 5E20A 4KISA 1P7JA 2XGEA 2NYXA 3FXQA 3QPSA 2ISYA 3O6BB 3HC7A 4M74A 1FIPA 1QPIA 1ZTRA 2DA7A 2CO5A 2ZMEC 5HDNA 3RSNA 3BT9A 4MLOA 3H9QA 2BY3A 3WTWC 1DGWY 4C3IJ 3OSFA 1R1TA 5F1RA 2HTJA 2X6YA 1VQMI 3ABKH 4EJTA 5D5VB 1W1WE 1Z1DA 2HQRA 1MIJA 3WTZA 3C7JA 3BJAA 4ESJA 3GFJA 2XPWA 1NHAA 4BY7J 3RKXA 3S32A 2UWMA 3IAM2 4IRGA 4IRIA 4FQGA 1OJLA 2Y9YA 2VI6A 2F5DA 1YLFA 1EV7A 1S3JA 1LVKA 2IA0A 2LP0A 1MJ9A 2IVMA 2FMYA 2OD5A 2X1CA 4PDKA 1R4MB 5LHGA 3EYYA 3O8HA 2DPDA 2GLOA 1JI8A 2ZJQF 4JYKA 3A02A 2VASA 3OY9A 3ECHA 3GF2A 1V5EA 2O61A 3V7RA 1B9MA 2DA3A 3L2WA 3X2QH 1K78A 1D3YA 4JX4A 5ICGA 2JA8J 2BHZA 3S17J 4EGZA 2XV4S 1JKQC 3F3XA 4RB0A 3TKYA 1ON2A 1TQPA 2Y30A 1XDSA 2DQRA 3VOEA 3I4NJ 2CGPA 1AKHB 1HW5A 3BTCA 3CO6C 4IJAA 4P5OA 1DU0A 4L0YB 5E3OA 2QWWA 3JCUC 3QYBA 2A6HF 5D5WB 2GAUA 1SFEA 2DFIA 3LL7A 2ELKA 2F4OB 2R3SA 3K6GA 1G3WA 1W36C 2G7HA 3AG1H 3F9KA 3UNGC 3A0BC 4FX4A 5IP9J 3DLAA 1LVAA 1GV2A 3QQAA 3FIWA 4HX7A 4CCJA 4CZCA 4LOCA 1PUFA 3GWZA 4PJLA 3OWTA 3QYFA 3E6BA 1S72I 5FLXK 1BIBA 1E0EA 4PGHA 4CCMA 2DOFA 2DI3A 3KP7A 4IHTA 1OCPA 4ANJA 2HTSA 5LGUA 1KGSA 1IN5A 2ZSIB 4ZDPA 4J00A 2XKPA 3QU3A 4M71A 4YIFA 5J40A 1R4NB 2L9RA 5FFXA 1R5ID 5CVJA 2R5YB 1LUJB 4BH9A 2V1DA 3S2WA 2RC4A 2ZXIA 1T6SA 4RDUA 4RAFA 3CJQB 4ZZDA 3DPLC 4D0PA 1YE9A 3BR6A 5DM6F 4D1QA 1O3QA 2EK5A 2NRAC 2EILH 2EV6A 3SDGA 1GDTA 1RKWA 2HOSA 2CW8A 2YX7A 2OA4A 5D8LB 3F6VA 6PAXA 1BM9A 1WJAA 1WFXA 2EFNA 4Q5SF 1P2FA 1SANA 2KHMA 5HLTA 1TTYA 2A6EF 2EINH 5C3EJ 1YJWI 5JLWA 2LY1A 3G2BA 3U21A 5GAHJ 4EMSA 3ZN1A 2LVSA 2MC3A 4EJWA 1HSTA 1D0YA 1Z7UA 4M9ZA 5FD5A 4CYCA 4F93B 1MH3A 2R7SA 5B1AH 1OCZH 3WHCA 3REOA 2Z33A 2EIJH 5FKKA 3ML6A 1EF4A 3CCVI 1Q1HA 3I5UA 2L02A 2K9LA 3IKTA 2CUJA 3KEYA 2DOAA 4HF0A 3KLOA 2E5ZA 2EJRA 2V1UA 4RMNA 5K7FA 2QGUA 1K79A 4HQMA 3U2RA 2HZDA 4JP0A 4GYIA 3SEZA 3ABUA 2QSGX 1RUOA 3QODA 1JHHA 3PL8A 3MEXA 3ZRGA 3BOQA 4B48A 2R92J 1FYKA 4AU7A 2AO9A 2E2JJ 4MIMA 4LLNA 1Y6IA 2DBBA 2ZO4A 2KIFA 2MC4A 3IKVA 1ZAOA 2XPVA 5DUIA 1XS9A 3WG9A 2HQNA 2DMQA 4E7ZA 3M8JA 4L5EA 3FBNB 3K70C 3CD6I 1LEBA 4P1WA 3S8PA 3AAFA 3TDZC 3CCRI 4G12A 3I3LA 1UAAA 3K10A 2QKLB 3TDUC 2L7FP 1HDPA 4ZYGA 1N75A 2COBA 4WWCA 5H6RA 3LA3A 3W6KB 1T2KA 1RNLA 1YRNA 2D1VA 4DBRA 3R0JA 3EUKL 2JVGA 2OQGA 1XCBA 4V2GA 3K1NA 3HTSB 4XN0A 1CF7A 2GXAA 2EA4A 3BLYA 3WU2C 1XD7A 5TRDA 1Y8RB 1MDMB 5EF6A 1I50J 3PNVA 1VFCA 2DK8A 2DT7B 4RGSA 2DK5A 3HPHA 4LG0B 3BC8A 2GQQA 3OMYA 3BTLA 1AWCA 2E1MC 1UMQA 2NAZA 3IUOA 3QPLA 4DBQA 4UY8I 2FRHA 2V9VA 3TBIA 1SFXA 3SJMA 4BEHB 2QQBA 2EZHA 2L7MP 3KIOA 4WF2A 3HOSA 4M3EA 4RM3A 1RZ4A 3VSLA 2KQRA 1VQOI 2XHKA 1XGOA 2W25A 1LDJA 1X4OA 4JX5A 4FASD 4H4KC 4G8XA 2HVRA 1BL0A 2P5KA 1MBFA 1U8RA 2XGXA 1X2MA 4LJZF 5D4RA 4CH7A 4ABZA 3F22A 2K85A 1L0OC 2HS5A 3FHZA 2P8TA 1A35A 5KAIC 2LBFB 4ZYHA 2J5OA 4I98B 1Z9CA 1B72A 1ODDA 5CVUA 3W2VA 2R7TA 1OLTA 1IW7F 1D0XA 2DODA 3OYNA 2PJRA 4LITA 5FRMA 1FP1D 2V4JC 1M1EB 3ELKA 2MW8A 4AIJA 3S1RJ 4U87A 4B8XA 3PM1A 1UCRA 3ASNH 2FA5A 5L3DA 2YR2A 4F92B 2BY1A 3F8CA 1YX5A 2VQCA 4I09A 5GPAA 3HRSA 3LSHA 2IPQX 1NH3A 5E1WA 2AXLA 4HX8A 1BA5A 3H9GA 3O8GA 4KN4X 4AIHA 4A3DJ 2DA6A 4HV5A 1YS6A 3V7CA 1YITI 2ME0A 2VOPA 2E34A 3LSRA 2MFZA 3S2DJ 1X1AA 3KEOA 4G7ZF 4M6YA 1ZG5A 3Q0UA 2JRMA 4W1UA 2VE8A 2N8GA 4W97A 2DT6A 2R7OA 2CV2A 2DA4A 3VPRA 3QAHA 1KU2A 2QF7A 2X6OA 2IRFG 2HU9A 1OYYA 1R00A 2QQ8A 1IGNA 3QWLA 3I53A 4L9NA 4RAZA 3AL0B 5K5RA 4XR6A 4B44A 4ZYDA 2GIZA 3LSTA 3QOPA 3CJTB 2P7VB 2KIMA 2LR8A 2HQ5A 3LSKA 2K9NA 2P6TA 3HSRA 1OFCX 4HSTA 1POGA 3W2WA 2MD0A 4OAYA 5HS8A 3M7GA 5J1UA 1A31A 1LKXA 1BOBA 4M3BA 1R22A 1A6QA 3K4JA 1G59A 2QZ8A 1YW7A 1XMXA 3FXLA 3HM5A 4ZTJA 1SC7A 4Q47A 3TGNA 4XOTA 4LLGF 4BQQA 2HOAA 3J81K 4G7OF 4AUXA 3DFGA 2NVXJ 2IJLA 1K4TA 2X48A 4GCVA 3VB2A 2YPRA 2M30A 5LGNA 3OOPA 1JKRC 5KK1A 1I1GA 1HW2A 3ZMDA 1TNSA 2VONA 2BEOA 3A1YA 2CH0A 1WZ2A 1PVEA 4LB5A 1WVRA 1RESA 1FEXA 2HXIA 2RQQA 3HUGA 5HS7A 1SFUA 3O2PE 2VBXA 3OYEA 4OWRB 4IHWA 2Z99A 4KFCA 1U5TA 2LY9A 2WAQA 4U7DA 3I4PA 1FYLA 2NS8A 5HLHA 3H0DA 3ZQIA 4MTDA 2GOMA 1XX5A 2PMZA 1Z77A 2PFBA 5ILVA 3QU6A 4OIPF 3CCEI 1OISA 3I0TA 2VQHA 4U0WA 1P4AA 3KCCA 5ERIA 3ZQCA 2YX4A 4O6JA 3SFZA 2DPUA 2WAQN 3T8RA 5IT9K 2WY8Q 3OYAA 2XAHA 2H6BA 3FZVA 1YIOA 2Q1ZB 3BPVA 4FT8A 2GIVA 2PMZN 4XICA 2I10A 3HRUA 2VUMJ 4KIGA 2IBDA 2K5CA 4BJ5C 2ACJA 3MFKA 2OU2A 3PFYA 1OQYA 2O8XA 4AVPA 1K78B 1I3AA 2OQRA 3RPUA 3HBLA 1NK3P 5LD2C 1SMYF 5C4XJ 3Q5FA 1QPMA 4G7HF 3K1MA 1K4SA 1DDNA 1D1CA 4MFDA 2FX0A 4XQFA 3RCOA 4BKXA 2WADA 1ZGAA 2E71A 2JK3A 3H36A 1V54H 1SD4A 1OCCH 2ZXJA 3BR2A 3G71I 2D1HA 4HDUA 4ZYAA 3ZXSA 3DP7A 4KT5C 3GTKJ 2BZTA 1W7PA 1XDUA 2DA1A 3DQVC 5TISC 4I7HA 3DEUA 1ORKA 1XGMA 2O3FA 2FNPA 4CCNA 5B3SH 4B47A 1IDZA 5GP9A 3BCAA 2F48A 1RR7A 5FFZA 3IAS2 1H88C 3VWBA 3H3VK 3ZMVA 3A03A 3PO2J 2B63J 1PUFB 1FOXA 2OBPA 1R49A 3OIOA 4A5MA 4HF1A 2KKOA 1YJNI 3R4KA 4I0BA 1S6LA 4I02A 4L18B 4UNOA 2F6CA 4D7MA 5DCFA 5CQEA 2QENA 4XLPF 3AKZA 4Y3OA 2HPMA 1RPWA 3I54A 4IOCF 1LE8A 2WC2A 1U78A 3FMSA 4FE7A 4KT6A 2EBIA 1ETKA 1W5TA 4E7JA 2BHYA 2K9MA 1HQCA 3GEZA 4JBAA 2DFHA 5K7ZA 3L2RA 5E3LA 4M3GA 4NHJA 2W48A 4OMZA 4JQFA 3TO6A 2FOWA 2NVUB 4A3LJ 1R23A 3TOAA 2MSYA 2QM3A 1P4XA 4BQOA 3GW2A 2ZNZA 4NUBA 5J1RA 3IC7A 2O5RA 4EM0B 3MKZA 3KZYA 2OPTA 2JT1A 4M9SA 1V55H 3L2CA 3N4MA 1EJ9A 1LFPA 1B1BA 3IP4B 1LEAA 2CJJA 1QQIA 4HV6A 2CYYA 3HXLA 4XLNF 2JRTA 3OYMA 5F6FA 1X1PA 5IYDJ 1QHGA 3MMYB 2STWA 2FU4A 3HYIA 3GZ5A 4PJJA 1KYWA 3E6MA 3EQLF 3Q3SA 4PUSA 2YU9J 3LA2A 3ERMA 3ZQLA 2LY2A 2F5EA 1ZLJA 4A3EJ 4S04A 1ZYRF 4XRSA 1XPXA 1LFBA 3PJRA 1DUXC 1BI3A 2VJ5A 3BROA 1ETYA 1UELB 2LKPA 3JRDA 3S3OA 2ID6A 1OR7C 3M3YJ 1H9TA 2ECCA 3DKWA 1HSJA 1WJDA 1Z21A 2JPCA 2RKHA 3BJOA 2CRGA 4A5NA 5LRSA 1S7EA 2IS6A 1SFOJ 3HEFA 3MKYB 4DYQA 1YRNB 2D5VA 4F3QA 1X2NA 3IRRA 3P7NA 2KT0A 1ZR4A 3QOEA 1KA8A 3CP2A 3M8EA 5GPCA 3ROUA 4UUTA 3FK6A 1CF7B 3SZGA 1PUEE 4G6QA 2VPRA 4Z6YA 3RTRA 1XTAA 1BJZA 2OCEA 1TW2A 2IGNA 2W24A 3J7AY 2XDVA 3E6DA 2RAEA 2QSHX 3O3KA 1FPQA 1TWAJ 5AIQA 1PP8F 4PJ0C 1DQUA 1K83J 4I76A 4KIBA 4YELA 1W4MA 5IYBJ 3KEQA 5HNFA 1X3WB 1ETOA 3OS1A 3IWZA 2YS9A 2M45A 3PSFA 2EFPA 1HC8A 1T0FC 5K7HA 4UUVA 2ZFWA 2K7LA 2CQ7A 4QPOA 3WGIA 3GMEA 2JWTA 1S9HA 3CLOA 4ZZLA 3J80Z 3QP5A 3KETA 4P96A 1XMAA 1B9NA 4G6TB 4UVCA 3F0CA 1MD0A 3KFWX 5FB2A 4N4OB 2WV1A 3Q0WA 2GXBA 1I6XA 4HSRA 3V8JA 2ADUA 1MSFC 3DCFA 2DW4A 4BDYA 2CFXA 2XSJC 4BQNA 1GLNA 3I64A 1MNMC 2PJRB 3KPHA 2JJ7A 1RIOH 3GTMJ 2P0WA 4IRHA 2MLKA 3G1OA 1EA3A 4XRFA 5BMZA 4TV7A 2L9SA 3RDIA 3FM5A 1USTA 1TWHJ 3LQQA 3K2ZA 4N9HA 2WWYA 4XOPA 5D5XB 2LH9A 4A6DA 5M5XJ 3PQJA 2K4JA 3PSIA 4X6AJ 1FP2A 4MTEA 2GA1A 4RA2A 2IW5A 2XKOA 2ZNYA 3CDHA 1FBSA 3GTOJ 3N05A 1X1BA 4RAGA 2W7NA 1NG6A 1YX3A 3E7LA 3GTJJ 3K4NA 1MJAA 2AQFA 3WGGA 2XRLA 4U0VA 1S8NA 4OIQF 2EH3A 4GYGA 2IA2A 1BI1A 2DN0A 4P9UA 1IF1A 4Y7NJ 3GO5A 2XAJA 1F9NA 2DQLA 3BG9A 2LMDA 1W0UA 4Q4ZF 2HXOA 2M7BA 2EZKA 3ZPLA 3GYHX 3GTQJ 3DEEA 3M1EA 1ZELA 4DQ2A 4E7LA 3GLLA 1FSHA 3DBRB 2VPLA 1ZHFA 2ETHA 1T56A 3G73A 4LK1F 4WCGA 2JA5J 5EZGA 3FDYA 1D5VA 5J6XA 2RN7A 2VT2A 2H1LA 1DP7P 1X1DA 3ZQQA 1VQ9I 3JW4A 1UFMA 2CWEA 3IH4A 1YO5C 2H8WA 3LMMA 1JGGA 2KL4A 3WHBA 3P9IA 3A01B 2L0KA 3CC7I 3HOUJ 3JSPA 4R1HA 3ZGKA 3F72A 4L9VA 1BOAA 4ZDOA 5DUKA 3K4LA 4IHVA 4D5FA 4B3AA 3OYJA 5J4YA 2ELJA 3CO7C 4IOAF 1TP4A 2R7ZJ 2XPUA 4AM3A 4IO9F 4YRVA 4ZDLA 3JRBA 3ABTA 5HVQC 3SZTA 2L3DA 1EH8A 4I6ZA 2IS4A 1D0ZA 3S93A 5B66C 2DA2A 2IAIA 2R7RA 2QCOA 2RQPA 1T98A 3GX4X 2VKHA 3S16J 3MKWB 3BTIA 3CUQA 1I3QJ 2PMHA 1JJ6C 1VQ7I 5GAGJ 1XMKA 1YW8A 3A0HC 3K1PA 3OL3A 1LNWA 4RLFA 1U5TB 1YS7A 1Z3XA 5E18F 3L2VA 1PYVA 4LD5A 3TP3A 4FX0A 4EV0A 3DXJF 3HL2A 3BCBA 2CQKA 3WTXC 2E7XA 3F23A 4C30A 2GXGA 2M9HA 4NDLA 5M3MJ 1O3SA 2WBMA 3RPUD 2IEKA 1FOKA 2H8RA 1WKMA 2BV6A 2CG4A 3F6OA 4NNJA 3VODA 3S15J 1YOVB 2UXXA 1IN4A 3PUFA 1BW6A 2M7AA 4AD9A 3OYLA 3JRAA 1UG0A 3KYCB 3EUHA 3HDDA 3KLNA 4B43A 2OF7A 3MZHA 4MQVA 4A6EA 2CUZA 4XSZF 2KMUA 5DCMA 1W7PD 1BJAA 1ONVA 2K86A 2LTPA 2FE3A 3PNYA 2CW0F 2NOGA 2W82A 3JTHA 4C2TA 2XSDC 1JTYA 4MGRA 1JGSA 2K4BA 5EDNA 2ZJRF 3MAJA 2DMPA 2LG4A 4KITB 1J0RA 3E5XA 3E5UA 4WXCA 5ICFA 3OYGA 2L9NA 1Z3YA 2BW3A 4CICA 2EFWA 3QPTA 3ABMH 2E36A 1I39A 3I59A 3AL0C 4PSWA 1A6IA 1O3TA 3FMRA 1I6HJ 1FWZA 4ZH4F 3H5NA 1HBXG 2LC2A 5IY5H 2LF8A 1R71A 1AOYA 3KE2A 3UR3C 4UUSA 1P9QC 2G0EA 2Z16A 5J4VA 3K4BA 3TEDA 3PIOF 1LPQA 3ZQHA 2KPMA 3C2GA 5BOXA 1T8IA 3WG7H 1ETXA 2M8EA 1MBHA 5KNLA 4BXXJ 1Y39A 5EG0B 4MEXF 2XVCA 4DYRA 2DYRH 3C3WA 1Z05A 2PG4A 3I4MJ 5L3EA 3LAJA 1L3LA 3IH3A 4AVZA 1LE8B 1IXRC 3S2HJ 4CCOA 4ZJZA 3KYLA 3QPHA 3LFKA 4D9JA 1WJFA 4YG2F 4A69C 1ZLKA 4J01A 4RBOA 4HG2A 5AIPA 4IPAA 1EH7A 2Z3YA 4MNUA 2C6YA 1XGSA 5FROA 2L2OA 1KONA 3K4KA 5A2QZ 1ZG1A 3V7SA 3IL2A 3E5QA 2KZGA 4B4CA 4G6DA 2R5ZA 1EKEA 1VQ5I 3M9AA 2EV0A 4HEA2 5FKOA 2VQLA 1KZHA 1S7AA 3ULQB 5LHHA 2CV1A 2STTA 1TNTA 2K9SA 4XORA 5D4SA 1SAUA 4XRSG 1W36D 3EDPA 1YJ9I 2XAUA 3FWEA 5FO5A 4KYWA 3S14J 1N25A 3Q9VA 1XGNA 1J7KA 2YU3A 5KCMA 1H8AC 1E2XA 1HF0A 2PI0A 2EPFA 2TDXA 2VJIA 3H1CA 5EGOA 2MLGA 3HOZJ 2EFQA 1TQIA 1VNDA 1GVJA 2R0QC 3ZQ7A 4BL0B 2L4AA 1SEUA 1P4WA 4U0YA 1XSDA 1RRJA 1VI0A 4BNCA 2EA2A 3R60A 4BE0A 1TLHB 3V42A 1VQ6I 1LDKB 2X9DA 5CVRA 1QGPA 3VFZA 3TL4X 3VDXA 1BW5A 2JSPA 2XAQA 2QQAA 4I0AA 4HX4A 1JJ8C 2HEOA 3ZQFA 3TMOA 1SVLA 1BR2A 1BC7C 1REPC 5KAFC 1GVDA 3L2QA 4BBSJ 1WH7A 4FETA 3HKZA 1GT0C 5L3BA 5HNHA 3H35A 4DJAA 1UB9A 1R9TJ 2IT0A 5LLQA 2VKVA 3JRHA 3TQNA 1QO0D 4A3JJ 3F8BA 4BE2A 2DYSH 2FEZA 1K7AA 2QVOA 3CTAA 1MBGA 3MZ8A 4UVAA 3R61A 1U3EM 1JT6A 3HKZN 5IOZA 3DEWA 3ZCOA 3WODF 2DO7A 2MYSA 3M1CA 3B73A 3ZR8X 3D5RC 4RB3C 4YFXF 4MEYF 3E97A 2FOKA 3NRVA 3DBLB 2FXAA 1WWXA 3PQKA 4CA0A 4IEJA 3CCLI 2PJPA 5DDGA 1F4KA 2A05A 1VF9A 3HGGA 3W6JB 1LB2A 4I99C 2XAFA 4XONA 1ZRFA 2KJBA 3LOCA 5D6EA 3QRFF 4KNYA 2E1CA 3P9KA 1MGTA 1IN6A 1Y1VJ 5L3CA 3CCUI 1QRYA 2W4SA 4HZFA 4LLLA 3OYKA 1RC9A 3I58A 5J3LA 5FD6A 1AA7A 4BJTA 1TT0A 2HDDA 2FBIA 3HOVJ 2KRHA 2DJNA 1JXSA 3RPQA 2FF4A 2R7FA 4KIFA 4BXUA 1NG7A 3ESWB 4RB1A 2WA0A 5IYCJ 4FHTA 1GUUA 2BBYA 2BE5F 2VC0A 3G1MA 1D1AA 3L9FA 3LQRA 2NVTJ 2X85A 5JHFA 4UVBA 3BZCA 4LIVA 2MABA 1OYWA 4B09A 2MBFA 3HOXJ 1ACIA 5JVTA 2VJJA 2IGOA 1JE8A 3S1NJ 4DZJA 2M4KA 4O5VA 4HAMA 3CC2I 1FLIA 1D1BA 1RUNA 2H09A 1SD5A 2FQ4A 4RS8A 3J7ZI 2W00A 3BDDA 3ONQA 4QSHA 5FGMA 1R6RA 2GM4A 1K6OA 5LHIA 2KIUA 1U9OA 1MW7A 1W0TA 3MD2A 2D2WA 4IHYA 1DP3A 1WQ2A 1Y0UA 1WRJA 1QVTA 2COMA 4I2OA 3I71A 2JPBA 5F0CA 3COAC 2VQGA 5DM7F 1ETWA 2E2HJ 1IRZA 1UG2A 3FXJA 1GXPA 4ENKA 1ZKGA 1IUFA 3I56I 4FTHA 1TW3A 2VKDA 3B6AA 3CMAI 4IKFA 3D1NI 3JAMZ 1PJRA 3JREA 1YG2A 3E0JB 3JRIA 1R58A 2E1NA 2K27A 4BY1J 1ZRCA 2M0MA 4Y33A 1J09A 3M4OJ 4F55A 3F8MA 4NQWA 1FMWA 4BUPA 4RGXA 1MBKA 2HI3A 4AC0A 3V8KA 3S1MJ 1F43A 1J59A 2GBYA 4ASNA 2F5FA 4L9JA 1YFHA 5FRNA 3SFIA 1V5FA 3K69A 3BR3A 1HXDA 3RIRA 2V9KA 4XNFA 4CO8A 2Z2SB 5DYMA 2ZMEA 1UHMA 4KMUX 4A3CJ 4O3MA 2CUEA 4OIOF 2CQQA 1RKTA 1F5TA 5L3FA 1RR8C 2CS3A 4V19K 3OYBA 2Z1DA 3HJEA 1VZ0A 4NB5A 5HLGA 1O7LA 2O0YA 4M6XA 3T5XA 3ZQGA 4JX6A 2MGQA 5FKLA 3BQYA 2EIKH 2FUG2 1OYIA 3CUQB 1MNDA 3CMYA 2E19A 4QPQA 4PK4A 4ESFA 2DJIA 2ZKZA 3NAUA 4E7HA 5LEKA 2L4MA 4LGWA 2DTZA 4A3MJ 3BPXA 3HOTA 2VKEA 3OYIA 2KLOA 3H5AA 4F7ZA 2XF6A 5IP7J 2VBZA 3T8TA 2HVQA 2LOOA 1HKQA 3G3ZA 3OYFA 3VEPA 4HLXA 2ZXWH 1MZBA 2HR3A 1JKPC 1Z6TA 2ME6A 3BP8A 2OZ6A 3C1DA 2H27A 2P6SA 3NWTA 2VL8A 4NC6A 1AU7A 2NXNB 1ZR2A 3NARA 1UHWA 2JSCA 3FKJA 2XGCA 4E4HA 2QEXI 1IDYA 2L7ZA 2DMTA 5M5WJ 3ZMUA 2PN6A 2UUZA 2ZSHB 3FX3A 2WTEA 4CYCB 4AWXB 3WE2A 1O3RA 2VLAA 3AG3H 5IT3A 1LQ1A 1R7JA 2MA3A 2K3PA 1DGRM 3S1QJ 2CQXA 1A04A 4HDVA 1SFKA 4CDGA 3CQZJ 4LG0A 2Y0MA 4Z2YA 4E7SA 3HZJA 3CDIA 3N97A 3RYPA 1V4RA 2XIGA 2LRDA 5JHUA 2V6CA 2Y48A 2BW3B 4H0EA 3WTVC 1IJWC 2A5WA 1G3YA 4LFUA 3RI4A 3I59B 3K2AA 4CUGA 2ECBA 5H20A 1S29A 1ZGWA 2Q0OA 3L7WA 2CUFA 2XROA 4KJZA 2KIQA 5E3NA 3CUOA 2XB5A 4XKCA 5GTIC 3LNQA 1FMVA 1LJ9A 1TBXA 1IRGA 4Y17A 1VQ4I 5ICEA 2R4GA 4IZZA 2XF5A 1ZK8A 2E5NA 4MHGA 4IVNA 3BQZA 3FBIB 1YIJI 4PGGA 4KICA 3SQNA 3OS0A 2X6WA 5FLVA 1WH5A 2GZWA 3LSJA 4RLQA 5CJ9A 2R7WA 2LF7A 4XBFA 1WJCA 4IL6C 2HPIA 2V26A 1B4AA 1P6RA 4PJNA 3HSEA 4E7KA 1SMTA 2M0CA 4KUMA 5E1ZB 3BG3A 3A4CA 5E1XA 1HCRA 2LDUA 2BXYA 2BGCA 2L54A 2KFDA 3CLQA 3GFLA 4F91B 3BY6A 5CVIA 5EZHA 2QSFX 5BPIA 2O8KA 1J5YA 1O57A 2PEXA 2M34A 3R6SA 1ITYA 1KQ8A 3ZMTA 2V1NA 3BG6A 3WTYC 1IUYA 2QKMB 1R5HA 2KDZA 1IN7A 5K5OA 4GRIA 2OC6A 2W85A 2PBIA 3IWFA 1QA6A 4NC7A 1QBJA 1JUMA 1QZYA 1U5TC 3LFUA 3C18A 3HB9A 1Y1WJ 2R5ZB 3J7AO 2Y0SA 3AG2H 4DNCA 2R7QA 2PLYA 2ICWG 4BS9A 4XKVA 2VT3A 3DBHB 1XSXA 2K3FA 2DMNA 1DPUA 5FLMJ 1ULYA 4G9YA 3DTEA 3HHHA 4QIWN 3S3MA 2L9VA 2Y0SN 5E79C 1I1SA 2RV8A 2E1OA 3F8NA 5ED4A 3HHGA 5F08A 1APLC 4A93J 2XUBA 3FHNA 5EGOB 5D5UB 2LD5A 1B72B 3TW6A 1YW9A 3U9GA 4YIIA 2EV5A 2AXTC 2YSRA 1STZA 1UJ8A 4II3A 3MKLA 3CMEI 1JKOC 5D6FA 5H6QA 1VQ8I 2VC1A 4HPQA 2Y69H 3K0LA 2W1OA 3VYRB 5EEAA 4AIKA 3RKQA 2Q2EA 2XAGA 5C44J 2X0LA 2XB0X 3BZ6A 4AIDA 1FT9A 1IXSB 3RJPA 5BS6A 1GV5A 2KDOA 3G4SI 5LGTA 4K2EA 5FLXZ 4PFPA 4UHTA 5IOYA 3KX2A 3H92A 1MMGA 1N78A 2R7VA 1MSEC 3K9TA 4KA4A 4KDPA 4IXAA 5K1YA 1KQ0A 3PO3J 2A6TA 1FC3A 2RNJA 3P5JA 3UKGA 4L0ZB 2ESHA 1VTNC 1U8BA 1BC8C 1E3PA 2LLKA 3HGYA 1XN7A 1JHFA 4M3FA 5CVVA 3OR1C 3FXUA 1G3SA 2Y31A 1XB4A 3CC4I 1CGPA 3DKYA 3GXOA 2CMPA 4EEFG 4M3DA 4EVIA 2E7WA 2LKSA 4BJ6C 3JTGA 2HDCA 4WX9A 4M9XA 4A3KJ 2VODA 2GA2A 2BVMA 4FISA 2FNAA 2B7EA 3C2BA 1V5GA 3GVAA 5FKMA 2DFEA 2DT5A 3DWLE 4UXNA 1OPCA 2MH9A 3LSGA 3V4GA 3BG5A 3JSOA 4HW0A 4N9IA 2DAOA 3D5LA 3RQIA 1C0WA 1X1CA 3DPUA 4ZC3A 1BR4A 2QBYA 1IRFA 4XMYA 3SHFA 5JI6A 4L9TA 1P92A 2PX9A 4XK4A 1BI2A 1U0JA 2NS0A 3K4CA 2VBYA 3D5SC 2VN2A 2UV1A 5HOOA 3LSIA 3J80K 2ZBKA 1TT5B 2XASA 3SYTA 4XLHA 2M2EA 2A3SA 4RM2A 3K7AJ 3CF5F 4P55A 2M4GA 2X6XA 4M72A 3RZDJ 3HTUA 2FSWA 2HQAA 3PNTA 4HA8A 3DTKA 4XSXF 3GZNB 2VE9A 1J75A 3HUGB 1MMAA 1K61A 1WJBA 4NC8A 1G4DA 4HNVA 2DOEA 4X1EA 4HRIA 4GGGA 4IF4A 3NWSA 2K40A 2NNNA 4XIDA 1KU7A 1E3OC 4XN3A 1R36A 2LNBA 4U88A 3ZN0A 2GWRA 2L5QA 1FX7A 1J2XA 3BTJA 3IH2A 2Q8KA 2A68F 4UB8C 4HLYA 2TCTA 3HRMA 4DOZA 1B8IA 3SDBA 3JRCA 2VXZA 4LIUA 4R8HA 2F5CA 4ZTFA 1T38A 3OIPA 4XLEA 2CU7A 2VBWA 3FXMA 4HQEA 1JT0A 1Y8QB 1FOWA 2WAEA 1ZREA 2Y75A 3LA7A 3IHUA 5HLIA 4BXFA 2M5WA 1TWFJ 1W5SA 1WI3A 3BR5A 3WE3A 3CF2A 4Q48A 4GDFA 1IG7A 1ZRDA 3OR2C 3EETA 4OINF 4NQWB 1T08B 4UV9A 3KYDB 5BNGA 3MQ0A 1IZ1A 3P9CA 5DD8A 2HOEA 4CCLA 2MG4A 3H3UA 5GADJ 4DIQA 2Z9OA 2WV0A 4HNUA 5LEJA 4ON0A 3IV5A 2DLLA 3QP6A 4CZZA 1U9NA 4BDZA 2DU9A 1GXQA 4MFEA 1WSUA 2LYCA 1HW1A 1Q1VA 3FXRA 4RB2C 4I01A 2FQ3A 2XC7A 4BHPA 1W7PB 3DU6A 2P4WA 4MO7A 5F1JA 1FBQA 5E8GA 1X58A 3E6CC 4IHXA 1QVUA 2ID3A 4GFBA 2V9PA 3DTIA 2ZMEB 2KP6A 3MN2A 2VIXA 5ILUA 4PSXA 1HDDC 2EZIA 4PZJA 2L7KA 2V6EA 5D8KB 3WU0A 2AQEA 1ON1A 2HKXA 1IV6A 1TWCJ 1F1ZA 1ZQ3P 5IP6A 5JLXA 2EWNA 3DLLF 5JFRA 2KRCA 1IRXA 1MBEA 2M8GX 4CYDA 2I8DA 2JQ7A 3CJNA 2ESNA 3I55I 4U7BA 3OV8A 2ELHA 1OKRA 4C3JJ 1LDDA 2BXZA 2JA7J 5J1YA 4EM1A 2UZKA 2E60A 2R7UA 1S5LC 1ZARA 2AS5F 3NQOA 5DV5A 5KVRA 3ASOH 5B5EC 3GFIA 3S3NA 2D45A 3KP3A 2EZLA 5J8CA 1XC5A 2QYOA 5ICCA 1ZG3A 4II2A 5GTHC 3WGHA 3U1DA 4RGRA 2NVQJ 2JMWA 2J5PA 4C3HJ 4EJUA 3ERED 2XRNA 1WJ5A 5TGTA 3C2HA 2XF7A 4FE4A 1G6NA 2QA4I 2P5LC 3CDLA 4FCYA 1FTZA 2DMUA 5LBQA 3FXKA 2O03A 3KP6A 3HOWJ 2A5YB 1X19A 1FZPB 2HVSA 1IO2A 4A0XA 3BG7A 1J9IA 1FBUA 2W57A 2OCCH 4A0YA 4RAYA 5H2FC 2A69F 1A36A 3CMMA 4Y13A 3H5RA 1WJEA 3K4MA 4XKWA 3CZ6A 3W2AA 1N77A 1WPKA 2QLZA 2CV0A 1EH6A 4A3FJ 2HYJA 4HOBA 3WTUC 1Z6RA 2RDPA 3J81Z 3SEQA 2F2EA 1HKSA 2V79A 5F27A 4XLFA 2W84A 2JTVA 4MQ9F 4V2FA 3OYHA 4BQAA 5CLSA 2BY0A 4Y4RA 2R93J 5E3MA 1MMSA 5HODA 3BR0A 5C4JJ 2X1EA 2PMUA 4UV8A 3JRGA 3OYDA 3OYCA 4OOIA 4WXHA 1FIAA 3VYTB 1TC3C 3B02A 3RKWA 5JVGF 4A3GJ 5F0FA 5FJ8J 4EATA 1LFUP 3GFMA 1ZH5A 2WAFA 2EQRA 2E2IJ 3WU1B 2NNYA 2ZCWA 1D8KA 1G3TA 1QZZA 2ZXHA 2GOXB 1OCOH 2Z5UA 1WI9A 3M8FA 5M3FJ 2BVLA 4XL9A 2B9SA 2ZC2A 3FK7A 1FTTA 5EJCA 4DZPA 4EGYA 1Z67A 2JA2A 2WY7Q 1TZLA 2JUCA 3BJ6A 3LWFA 5J8FA 5CPRB 3HPGA 5IT9Z 3EPZA 2VJ4A 1R5GA 3CUQC 1X3ZB 4OU0A 5J47A 4G94A 3GTGJ 3E3VA 1MJBA 2OZUA 3OOUA 3LSPA 2DCEA 1R1UA 2JVHA 3BWGA 3I9V2 3LAPA 1FJLA 4A0ZA 1YHQI 1AHDP 2P81A 4OAZA 4BBRJ 5A2QK 4XLAA 1OMIA 4KN7X 4AYBA 3TOBA 2IGKA 3KZIC 1Z0XA 5M5YJ 5F04A 1FSEA 3ZP5A 5F64A 1H9GA 5HS9A 4BACA 5IPAA 2JZYA 3V8LA 2VB6A 1HA8A 1E3HA 2H94A 4N4NB 1FYMA 2E35A 1XG1A 4AYBN 4CSWA 2LKXA 1TL8A 3K70D 3CP8A 4S0HB 2ISZA 1H89C 1MMNA 2MH2A 4OIRF 2ZJ2A 3EUHC 5CQGA 1YYVA 4JOMA 4YEJA 4EJVA 1TWGJ 1AKHA 2H1KA 3HOYJ 4OMYA 1YQAA 3HRTA 2K02A 2ZB9A 1A5JA 4A12A 2H6CA 1NK2P 3PUBA 4QLCU 4WXDA 4HYEA 3A01A 3CCYA 1H0MA 1S7OA 2HNHA 2Q2EB 4XRMA 4BGDA 4A2UA 1Y0NA 4D7NA 1VQPI 2RGVA 1OR7A 4F52A 5E17F 2OTJI 2G7UA 1MBJA 4ETSA 4WK8F 1FNNA 3RKYA 2R7XA 1E17A 2X51A 1OCRH 4Y15A 4DYCA 2V7FA 4LB6B 3DKXA 2OJED 2NOJB 5CYVA 4EQQA 4BYYA 5EEHA 3MVPA 3GBGA 3DU5A 1XSVA 3KP2A 2WB1A 4DW6A 1I5ZA 3GTPJ 1SVMA 2L01A 4UB6C 2HOTA 5BQTA 1V3FA 4A3BJ 4ESBA 4LMYA 1UHSA 2E1MB 2JA6J 2BYVE 2M87A 4E7IA 2R5YA 3GZ6A 4ZYEA 3FF5A 4CHUA 3FM3A 3HSFA 1U2WA 2DXIA 3W3CA 2WB1N 3PFIA 1T0FA 1IN8A 1GHCA 2EIMH 2KJCA 1VQNI 1PDNC 4DGWB 1B6AA 4M73A 3HIFA 3E1SA 3CCMI 4YFKF 2R7DA 1QHHD 3CCJI 1JTXA 1WCMJ 3L1PA 1U6GA 1MH4A 2HDWA 4HNTA 3FISA 3KZZA 4B1RA 5E8IA 4PJMA 3TP0A 4D5CA 2QBYB 5CKTA 4BHBA 1T95A 1XCVA 4EM2A 3AG4H 1BI0A 1ZGJA 5K5QA 2KZVA 4C2UA 1HKTA 4XKBA 3AFHA 1HOMA 1TQMA 3F21A 1SAXA 1BN5A 1JUPA 3BR1A 2RREA 2B0LA 5DD4A 3A2KA 1KU3A 4PFOA 1KYZA 4N0BA 2RVCA 3SZPA 2HZTA 3EYIA 3TW7A 2FBKA 4L5JA 5AONA 3U1KA 4C9YA 4IHSA 3DPTA 4RGUA 5DTDA 2CFOA 2FMLA 1ZN2A 1QU3A 4GXOA 2MD5A 3IRQA 4IQ4A 1VQLI 2K9QA 3R0AA 2PQ8A 2FD5A 3HG9A 4C2MJ 5DS9A 3J7YJ 1IC8A 4EJOA 4R79A 1PP7U 3GCMA 2P5VA 4ENMA 3GUDA 1SD6A 1YI2I 4P9FA 5JR3A 4S05A 1F36A 2DTRA 2F5VA 1MMDA 3CESA 3F8FA 3OSGA 4BE1A 2IGMA 4HBLA 3CCQI 3H9JA 2OV7A 1WHUA 2O6GE 5EG0A 2IXSA 1IV8A 4BU2A 2QUFA 5TJJA 2BOLA 1Z7LA 3BZKA 3CJRB 1B8IB 1X3UA 1T39A 3T0YA 3L09A 3NEUA 1O7FA 2O7OA 2IS1A 1KU9A 2F4IA 1NTCA 2KRFA 2YUSA 2OUMA 3QYEA 3KP5A 3RQ4A 3OS2A 1HLVA 1ETVA 2VOOA 2DDAA 2JUGA 2CW7A 4J19A 3M07A 3G6EI 1RI7A 3GTLJ 1I27A 5EYRA 1MDMA 2I5UA 2EB7A 5DCMB 4NBQA 1YTYA 2UXNA 1R1VA 2HYGD 3JAMK 1G2HA 3JR9A 2P7CB 2LREA 1D8JA 2HGCA 2OAZA 3OIQA 2IA1A 4JK1X 4QWQA 4ENJA 3MCZA 3Q0VA 4BEHA 2JN6A 4QTRA 1X4PA 2RNGA 4GO1A 4L5IA 4ITVA 1G8XA 1JUSA 3L00A 5HDGA 2NS7A 4XLCA 2G9WA 3GLXA 4UUSB 3KP4A 5BPDA 3SXYA 1DPRA 2LBFA 3Q9SA 3G1LA 3JRFA 1IAWA 3ISPA 5L3GA 3B6CA 3ZOBA 4Y52J 1WGXA 3L2UA 1BIAA 4A3IJ 2Y2ZA 4BAYA 3T1BA 3VYUB 1BR1A 2A61A 2HYFA 4HF2A 3FXOA 4LG3A 2IS2A 1KQ9A 3LSMA 3DF8A 3D0SA 3VYSB 2A07F 2CSOA 3TO9A 1MKMA 1RETA 1K6YA 2V1XA 2LFBA 4E6KG 2XGDA 1OCTC 3H0GJ 3ABLH 2QQ9A 1USSA 1B59A 1ENHA 1DU6A 1IXCA 3PIPF 1UZCA 5B1BH 2BY2A 3ECOA 5EEGA 1BBYA 4CCKA 5ILSA 2ZJPF 1Z91A 2NVYJ 5LFAA 4IQJA 2LK2A 2ZFUA 4X0GA 2AHQA 2F4MB 2CQNA 4B3XA 4IX7A 1O4XA 4KMFA 2FJ1A 1FOYA 3CCSI 3WTSC 1ERDA 4CXFA 2M1BA 3DV8A 1ETQA 1P7IA 1MNEA 3FKIJ 4LK0F 4BHCA 1CQTA 2EFOA 1FY7A 4M6VA 4CGZA 2DDBA 1SVOA 2HFHA 5GAEJ 2Y9ZA 3MWMA 1QZEA 5HDKA 2DFFA 3WTTC 2X1DA 5LRRA 3ZMZA 1Y56A 4YFNF
chains in the Genus database with same CATH topology
2HKOA 4ENNA 3ZMSA 3RYRA 2HWVA 5DEQA 1QNTA 4PCQA 3MZYA 3H3ZA 2FBHA 3FMQA 2X4HA 1SD7A 4E70A 3TO7A 2IP2A 2LSOA 5E20A 2NYXA 3FXQA 2ISYA 3O6BB 4M74A 2CO5A 5HDNA 3WTWC 1R1TA 5F1RA 2HTJA 4EJTA 5D5VB 1Z1DA 2HQRA 3WTZA 3C7JA 3BJAA 4ESJA 3GFJA 1NHAA 3RKXA 2UWMA 4IRGA 4IRIA 2F5DA 1YLFA 1EV7A 1S3JA 2IA0A 1MJ9A 2IVMA 2FMYA 5LHGA 2OD5A 4PDKA 2DPDA 3EYYA 3ECHA 3GF2A 2O61A 3V7RA 1B9MA 1K78A 1D3YA 5ICGA 4EGZA 2XV4S 3F3XA 4RB0A 3TKYA 1ON2A 1TQPA 1XDSA 2DQRA 3VOEA 2CGPA 1HW5A 3CO6C 4IJAA 4P5OA 4L0YB 2QWWA 2A6HF 5D5WB 2GAUA 1SFEA 2DFIA 2R3SA 1G3WA 2G7HA 4FX4A 1LVAA 4HX7A 3GWZA 3E6BA 5FLXK 1BIBA 4PGHA 2DI3A 3KP7A 4IHTA 2HTSA 5LGUA 1KGSA 1IN5A 2XKPA 3QU3A 4M71A 4YIFA 5FFXA 5CVJA 4BH9A 2V1DA 3S2WA 2RC4A 1T6SA 4ZZDA 3DPLC 4D0PA 1O3QA 2EK5A 2NRAC 2EV6A 2YX7A 2OA4A 5D8LB 3F6VA 6PAXA 1BM9A 2EFNA 4Q5SF 1P2FA 1TTYA 2A6EF 4EMSA 3ZN1A 2MC3A 4EJWA 1HSTA 1Z7UA 4M9ZA 5FD5A 3REOA 2Z33A 3ML6A 1Q1HA 3I5UA 2L02A 3IKTA 4HF0A 3KLOA 2EJRA 2V1UA 1K79A 4HQMA 3U2RA 4GYIA 3ABUA 1RUOA 1JHHA 3MEXA 3BOQA 1FYKA 4LLNA 2DBBA 2ZO4A 2KIFA 3IKVA 1ZAOA 5DUIA 3WG9A 2HQNA 1LEBA 3AAFA 3TDZC 3TDUC 4ZYGA 4WWCA 5H6RA 3LA3A 3W6KB 1T2KA 1RNLA 2D1VA 3R0JA 2OQGA 1XCBA 3K1NA 3HTSB 1CF7A 2EA4A 1XD7A 5TRDA 1MDMB 2DK8A 4RGSA 2DK5A 4LG0B 2GQQA 1AWCA 2NAZA 2FRHA 2V9VA 1SFXA 2QQBA 4WF2A 3HOSA 1RZ4A 1XGOA 2W25A 2XHKA 1LDJA 4G8XA 2P5KA 1U8RA 2XGXA 4LJZF 5D4RA 3F22A 3FHZA 1L0OC 2HS5A 2P8TA 4ZYHA 2J5OA 4I98B 1Z9CA 1ODDA 5CVUA 1IW7F 1FP1D 3ELKA 4AIJA 4B8XA 1UCRA 2FA5A 5L3DA 2YR2A 3F8CA 4I09A 3HRSA 2IPQX 5E1WA 2AXLA 4HX8A 4KN4X 4AIHA 4HV5A 1YS6A 3V7CA 2VOPA 4G7ZF 3KEOA 4M6YA 1ZG5A 2VE8A 3QAHA 1KU2A 2IRFG 1OYYA 1R00A 3I53A 4L9NA 4RAZA 5K5RA 4ZYDA 3LSTA 3QOPA 2P7VB 2KIMA 2P6TA 3HSRA 5HS8A 3M7GA 1R22A 2QZ8A 1YW7A 4Q47A 3TGNA 4LLGF 3J81K 4G7OF 3DFGA 2IJLA 4GCVA 3VB2A 2YPRA 2M30A 5LGNA 3OOPA 5KK1A 1I1GA 1HW2A 3ZMDA 1TNSA 2VONA 2BEOA 4LB5A 3HUGA 5HS7A 1SFUA 3O2PE 2VBXA 2Z99A 4KFCA 1U5TA 4U7DA 3I4PA 1FYLA 5HLHA 4MTDA 2PFBA 5ILVA 3QU6A 4OIPF 3I0TA 4U0WA 1P4AA 3KCCA 5ERIA 2YX4A 4O6JA 3SFZA 2DPUA 3T8RA 5IT9K 2XAHA 2H6BA 3FZVA 1YIOA 3BPVA 4FT8A 2GIVA 3HRUA 4KIGA 2ACJA 3MFKA 2OU2A 2O8XA 4AVPA 1K78B 2OQRA 3RPUA 1SMYF 3Q5FA 1QPMA 4G7HF 3K1MA 1DDNA 1ZGAA 1SD4A 2ZXJA 4HDUA 2D1HA 3DP7A 4KT5C 1W7PA 1XDUA 3DQVC 4I7HA 3DEUA 1XGMA 2O3FA 2FNPA 5FFZA 3ZMVA 2OBPA 4HF1A 4A5MA 2KKOA 3R4KA 4I0BA 1S6LA 4I02A 4L18B 4UNOA 5DCFA 4XLPF 2QENA 3I54A 2WC2A 1U78A 3FMSA 1W5TA 1HQCA 3GEZA 4JBAA 4NHJA 4OMZA 4JQFA 3TO6A 1R23A 3TOAA 2QM3A 1P4XA 3GW2A 2ZNZA 3IC7A 4EM0B 3KZYA 2JT1A 4M9SA 3L2CA 3N4MA 1B1BA 1LEAA 1QQIA 4HV6A 2CYYA 4XLNF 2JRTA 5F6FA 2STWA 2FU4A 3HYIA 3GZ5A 1KYWA 3E6MA 3EQLF 3LA2A 2F5EA 1ZLJA 4S04A 1ZYRF 1DUXC 1BI3A 3BROA 2LKPA 1H9TA 3DKWA 1HSJA 2RKHA 2JPCA 3BJOA 4A5NA 5LRSA 3IRRA 3P7NA 1KA8A 3M8EA 3ROUA 1CF7B 1PUEE 4G6QA 3RTRA 1TW2A 2W24A 3E6DA 3O3KA 1FPQA 1PP8F 5AIQA 4KIBA 1W4MA 3KEQA 3IWZA 2M45A 2EFPA 4UUVA 2ZFWA 2K7LA 3WGIA 3CLOA 4ZZLA 3KETA 3QP5A 3J80Z 4P96A 1XMAA 1B9NA 4UVCA 1MD0A 3KFWX 5FB2A 2GXBA 1I6XA 3V8JA 2ADUA 2DW4A 2CFXA 3I64A 1RIOH 4IRHA 2MLKA 4XRFA 5BMZA 4TV7A 3RDIA 3FM5A 1USTA 3LQQA 3K2ZA 4N9HA 2WWYA 5D5XB 4A6DA 3PQJA 2K4JA 1FP2A 4MTEA 2GA1A 2IW5A 2XKOA 2ZNYA 3CDHA 1FBSA 1MJAA 3WGGA 4U0VA 1S8NA 4OIQF 4GYGA 2IA2A 1BI1A 4P9UA 1IF1A 3GO5A 2XAJA 1F9NA 2DQLA 4Q4ZF 3ZPLA 3GYHX 3M1EA 4DQ2A 1FSHA 1ZHFA 2ETHA 3G73A 4LK1F 4WCGA 1D5VA 5J6XA 2RN7A 2VT2A 1DP7P 3JW4A 1UFMA 2CWEA 1YO5C 3P9IA 3JSPA 4R1HA 3F72A 4L9VA 1BOAA 5DUKA 3CO7C 3ABTA 5HVQC 3SZTA 2L3DA 1EH8A 2RQPA 1T98A 3GX4X 3CUQA 2PMHA 1XMKA 1YW8A 3K1PA 1LNWA 1U5TB 1YS7A 5E18F 4LD5A 4FX0A 4EV0A 3DXJF 2CQKA 3WTXC 2E7XA 3F23A 2GXGA 1O3SA 1FOKA 1WKMA 2BV6A 2CG4A 3F6OA 3VODA 2UXXA 1IN4A 4AD9A 3EUHA 3KLNA 3MZHA 4MQVA 4A6EA 4XSZF 5DCMA 1W7PD 1BJAA 1ONVA 2K86A 2FE3A 2CW0F 3JTHA 4MGRA 1JGSA 2K4BA 3MAJA 1J0RA 3E5XA 3E5UA 4WXCA 5ICFA 4CICA 2EFWA 3QPTA 3I59A 1O3TA 3FMRA 1FWZA 4ZH4F 1HBXG 2LF8A 1AOYA 3KE2A 5BOXA 2M8EA 4MEXF 2XVCA 3C3WA 1Z05A 2PG4A 5L3EA 3LAJA 1L3LA 1IXRC 3QPHA 3LFKA 4YG2F 1ZLKA 5AIPA 4IPAA 1EH7A 2Z3YA 4MNUA 2C6YA 1XGSA 1ZG1A 5A2QZ 3V7SA 3IL2A 3E5QA 4G6DA 3M9AA 2EV0A 1S7AA 3ULQB 5LHHA 2STTA 1TNTA 5D4SA 3EDPA 3FWEA 5FO5A 4KYWA 3Q9VA 1XGNA 1J7KA 2YU3A 2PI0A 1E2XA 2TDXA 2MLGA 2EFQA 1TQIA 1GVJA 3ZQ7A 2L4AA 1P4WA 4U0YA 1XSDA 4BNCA 2EA2A 3R60A 1TLHB 1LDKB 5CVRA 1QGPA 3VFZA 2XAQA 2QQAA 4I0AA 4HX4A 2HEOA 1BC7C 1REPC 5L3BA 1UB9A 2IT0A 5LLQA 3TQNA 1QO0D 3F8BA 2FEZA 1K7AA 2QVOA 3CTAA 4UVAA 1U3EM 3R61A 3WODF 2DO7A 3B73A 4RB3C 4YFXF 4MEYF 3E97A 2FOKA 3NRVA 2FXAA 1WWXA 3PQKA 2PJPA 5DDGA 1F4KA 3W6JB 1LB2A 2XAFA 1ZRFA 2KJBA 5D6EA 3QRFF 4KNYA 2E1CA 3P9KA 1MGTA 1IN6A 5L3CA 4HZFA 4LLLA 3I58A 5FD6A 2FBIA 1JXSA 3RPQA 2FF4A 2R7FA 4KIFA 4BXUA 4RB1A 4FHTA 2BBYA 2BE5F 2VC0A 3L9FA 3LQRA 4UVBA 1OYWA 4B09A 2MBFA 5JVTA 1JE8A 4O5VA 4HAMA 1FLIA 1RUNA 2H09A 1SD5A 4RS8A 3BDDA 5FGMA 1K6OA 5LHIA 2KIUA 2D2WA 2COMA 1WQ2A 1WRJA 1Y0UA 4I2OA 3I71A 2JPBA 3COAC 1GXPA 4ENKA 1TW3A 3JAMZ 1YG2A 1R58A 2E1NA 2K27A 1ZRCA 3F8MA 4NQWA 4RGXA 3V8KA 1J59A 4ASNA 2F5FA 4L9JA 1YFHA 3K69A 1HXDA 3RIRA 4CO8A 5DYMA 2ZMEA 1UHMA 4KMUX 4O3MA 4OIOF 1F5TA 5L3FA 4NB5A 5HLGA 1O7LA 2O0YA 4M6XA 3T5XA 1OYIA 3CUQB 4ESFA 2ZKZA 5LEKA 2L4MA 4LGWA 3BPXA 3HOTA 4F7ZA 2VBZA 3T8TA 3G3ZA 1HKQA 3VEPA 4HLXA 1MZBA 2HR3A 1Z6TA 3BP8A 2OZ6A 3C1DA 2H27A 2P6SA 1UHWA 2JSCA 3ZMUA 2PN6A 3FX3A 2WTEA 4AWXB 3WE2A 1O3RA 5IT3A 1LQ1A 1R7JA 2MA3A 1A04A 4HDVA 4CDGA 4LG0A 2Y0MA 4Z2YA 3N97A 3RYPA 1V4RA 2XIGA 5JHUA 2V6CA 2Y48A 4H0EA 3WTVC 1G3YA 4LFUA 3RI4A 3I59B 5H20A 1S29A 2Q0OA 3L7WA 2XROA 3CUOA 1LJ9A 1TBXA 1IRGA 4Y17A 5ICEA 4MHGA 4IVNA 4PGGA 4KICA 3SQNA 2GZWA 5CJ9A 2LF7A 4XBFA 1B4AA 1P6RA 3HSEA 1SMTA 4KUMA 5E1ZB 5E1XA 2LDUA 2BGCA 2L54A 3GFLA 3BY6A 5CVIA 5BPIA 1J5YA 1O57A 2PEXA 3R6SA 1KQ8A 3ZMTA 3WTYC 1IUYA 1R5HA 1IN7A 5K5OA 2W85A 2PBIA 3IWFA 1QBJA 1QZYA 1U5TC 3C18A 3J7AO 4DNCA 2PLYA 2VT3A 1XSXA 1DPUA 1ULYA 4G9YA 3HHHA 1I1SA 2RV8A 3F8NA 5ED4A 3HHGA 2XUBA 5D5UB 1YW9A 3U9GA 4YIIA 2EV5A 2YSRA 1STZA 5D6FA 5H6QA 2VC1A 3K0LA 4AIKA 2Q2EA 2XAGA 2X0LA 3BZ6A 1FT9A 1IXSB 3RJPA 5BS6A 5LGTA 4K2EA 5FLXZ 4UHTA 3H92A 3K9TA 4KA4A 4KDPA 4IXAA 5K1YA 1KQ0A 1FC3A 2RNJA 4L0ZB 2ESHA 1VTNC 1BC8C 1XN7A 1JHFA 5CVVA 3FXUA 1G3SA 1XB4A 1CGPA 3GXOA 4EVIA 2E7WA 3JTGA 2HDCA 4WX9A 4M9XA 2VODA 2GA2A 2FNAA 3GVAA 2DT5A 4UXNA 1OPCA 2MH9A 3V4GA 3JSOA 4HW0A 4N9IA 2DAOA 3D5LA 1C0WA 2QBYA 1IRFA 3SHFA 5JI6A 4L9TA 1P92A 1BI2A 2NS0A 2VBYA 2VN2A 5HOOA 3J80K 2ZBKA 2XASA 2A3SA 4P55A 4M72A 3HTUA 2FSWA 4HA8A 4XSXF 2VE9A 1J75A 1G4DA 4GGGA 4IF4A 2NNNA 1KU7A 1R36A 2LNBA 4U88A 3ZN0A 2GWRA 1FX7A 1J2XA 2Q8KA 2A68F 4HLYA 3HRMA 2VXZA 4R8HA 2F5CA 1T38A 2VBWA 4HQEA 1ZREA 2Y75A 3LA7A 3IHUA 5HLIA 2M5WA 1W5SA 3WE3A 4Q48A 1ZRDA 4OINF 3EETA 4UV9A 3MQ0A 1IZ1A 3P9CA 5DD8A 2HOEA 3H3UA 2Z9OA 2WV0A 5LEJA 4ON0A 2DLLA 3QP6A 4CZZA 2DU9A 1GXQA 1WSUA 1HW1A 3FXRA 4RB2C 4I01A 2FQ3A 4BHPA 1W7PB 2P4WA 1FBQA 5E8GA 3E6CC 2ZMEB 5ILUA 4PZJA 5D8KB 3WU0A 2HKXA 1ON1A 1F1ZA 2EWNA 5JFRA 4CYDA 3CJNA 2ESNA 4U7BA 3OV8A 2ELHA 1OKRA 1LDDA 4EM1A 2UZKA 1ZARA 2AS5F 3NQOA 5DV5A 5KVRA 3GFIA 2D45A 3KP3A 5J8CA 2QYOA 5ICCA 1ZG3A 3WGHA 3U1DA 4RGRA 2J5PA 4EJUA 3ERED 2XRNA 1G6NA 2P5LC 5LBQA 2O03A 3KP6A 2A5YB 1FZPB 4A0XA 1J9IA 1FBUA 2W57A 4A0YA 4RAYA 2A69F 4Y13A 2QLZA 1EH6A 4HOBA 3WTUC 1Z6RA 2RDPA 3J81Z 2F2EA 1HKSA 2V79A 2W84A 2JTVA 4MQ9F 4BQAA 5CLSA 2PMUA 4UV8A 4OOIA 4WXHA 3B02A 3RKWA 3GFMA 1ZH5A 3WU1B 2NNYA 2ZCWA 1D8KA 1G3TA 1QZZA 2Z5UA 1WI9A 3M8FA 4EGYA 3BJ6A 3LWFA 5J8FA 5IT9Z 1R5GA 3CUQC 4OU0A 4G94A 3E3VA 1MJBA 2OZUA 1R1UA 3BWGA 3LAPA 4A0ZA 5A2QK 1OMIA 4KN7X 3TOBA 1FSEA 3ZP5A 5F64A 1H9GA 5HS9A 2JZYA 3V8LA 2H94A 1FYMA 2ISZA 2MH2A 4OIRF 2ZJ2A 4EJVA 1YYVA 4OMYA 1YQAA 3HRTA 2K02A 4A12A 2H6CA 4QLCU 4WXDA 4HYEA 1H0MA 1S7OA 4A2UA 2RGVA 1OR7A 5E17F 2G7UA 4ETSA 4WK8F 1FNNA 3RKYA 1E17A 4Y15A 4LB6B 5CYVA 4EQQA 4BYYA 5EEHA 1XSVA 3KP2A 1I5ZA 2L01A 5BQTA 1V3FA 4ESBA 4LMYA 2BYVE 2M87A 3GZ6A 4ZYEA 3FF5A 4CHUA 3FM3A 3HSFA 1U2WA 3PFIA 1T0FA 1IN8A 1GHCA 2KJCA 1PDNC 1B6AA 4M73A 3HIFA 4YFKF 2R7DA 1U6GA 3KZZA 5E8IA 2QBYB 4BHBA 1XCVA 4EM2A 1BI0A 1ZGJA 5K5QA 1HKTA 1TQMA 3F21A 1SAXA 1BN5A 2B0LA 5DD4A 1KU3A 1KYZA 4N0BA 2RVCA 3SZPA 2HZTA 3EYIA 2FBKA 4L5JA 5AONA 4IHSA 3DPTA 4RGUA 2FMLA 1ZN2A 4GXOA 2MD5A 3IRQA 3R0AA 2PQ8A 4EJOA 4R79A 1PP7U 2P5VA 4ENMA 3GUDA 1SD6A 4P9FA 5JR3A 4S05A 2DTRA 3F8FA 4HBLA 2O6GE 2QUFA 5TJJA 1X3UA 1T39A 3T0YA 3L09A 3NEUA 1O7FA 1KU9A 2KRFA 3KP5A 2VOOA 1RI7A 1I27A 1MDMA 2EB7A 5DCMB 1YTYA 2UXNA 1R1VA 2HYGD 3JAMK 2P7CB 1D8JA 2HGCA 2OAZA 2IA1A 4JK1X 4QWQA 4ENJA 3MCZA 4GO1A 4L5IA 3L00A 5HDGA 2G9WA 3GLXA 3KP4A 5BPDA 3SXYA 1DPRA 3Q9SA 1IAWA 3ISPA 5L3GA 1BIAA 4BAYA 3T1BA 2A61A 2HYFA 4HF2A 1KQ9A 3DF8A 3D0SA 2A07F 2CSOA 3TO9A 1MKMA 2V1XA 2QQ9A 1USSA 1B59A 1IXCA 3ECOA 5EEGA 1BBYA 5ILSA 1Z91A 4KMFA 3WTSC 4CXFA 2M1BA 3DV8A 4LK0F 4BHCA 2EFOA 1FY7A 4CGZA 2HFHA 3MWMA 5HDKA 3WTTC 5LRRA 3ZMZA 4YFNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKO A;  4ENN A;  3ZMS A;  3RYR A;  2HWV A;  5DEQ A;  1QNT A;  4PCQ A;  3MZY A;  3H3Z A;  2FBH A;  3FMQ A;  2X4H A;  1SD7 A;  4E70 A;  3TO7 A;  2IP2 A;  2LSO A;  5E20 A;  2NYX A;  3FXQ A;  2ISY A;  3O6B B;  4M74 A;  2CO5 A;  5HDN A;  3WTW C;  1R1T A;  5F1R A;  2HTJ A;  4EJT A;  5D5V B;  1Z1D A;  2HQR A;  3WTZ A;  3C7J A;  3BJA A;  4ESJ A;  3GFJ A;  1NHA A;  3RKX A;  2UWM A;  4IRG A;  4IRI A;  2F5D A;  1YLF A;  1EV7 A;  1S3J A;  2IA0 A;  1MJ9 A;  2IVM A;  2FMY A;  5LHG A;  2OD5 A;  4PDK A;  2DPD A;  3EYY A;  3ECH A;  3GF2 A;  2O61 A;  3V7R A;  1B9M A;  1K78 A;  1D3Y A;  5ICG A;  4EGZ A;  2XV4 S;  3F3X A;  4RB0 A;  3TKY A;  1ON2 A;  1TQP A;  1XDS A;  2DQR A;  3VOE A;  2CGP A;  1HW5 A;  3CO6 C;  4IJA A;  4P5O A;  4L0Y B;  2QWW A;  2A6H F;  5D5W B;  2GAU A;  1SFE A;  2DFI A;  2R3S A;  1G3W A;  2G7H A;  4FX4 A;  1LVA A;  4HX7 A;  3GWZ A;  3E6B A;  5FLX K;  1BIB A;  4PGH A;  2DI3 A;  3KP7 A;  4IHT A;  2HTS A;  5LGU A;  1KGS A;  1IN5 A;  2XKP A;  3QU3 A;  4M71 A;  4YIF A;  5FFX A;  5CVJ A;  4BH9 A;  2V1D A;  3S2W A;  2RC4 A;  1T6S A;  4ZZD A;  3DPL C;  4D0P A;  1O3Q A;  2EK5 A;  2NRA C;  2EV6 A;  2YX7 A;  2OA4 A;  5D8L B;  3F6V A;  6PAX A;  1BM9 A;  2EFN A;  4Q5S F;  1P2F A;  1TTY A;  2A6E F;  4EMS A;  3ZN1 A;  2MC3 A;  4EJW A;  1HST A;  1Z7U A;  4M9Z A;  5FD5 A;  3REO A;  2Z33 A;  3ML6 A;  1Q1H A;  3I5U A;  2L02 A;  3IKT A;  4HF0 A;  3KLO A;  2EJR A;  2V1U A;  1K79 A;  4HQM A;  3U2R A;  4GYI A;  3ABU A;  1RUO A;  1JHH A;  3MEX A;  3BOQ A;  1FYK A;  4LLN A;  2DBB A;  2ZO4 A;  2KIF A;  3IKV A;  1ZAO A;  5DUI A;  3WG9 A;  2HQN A;  1LEB A;  3AAF A;  3TDZ C;  3TDU C;  4ZYG A;  4WWC A;  5H6R A;  3LA3 A;  3W6K B;  1T2K A;  1RNL A;  2D1V A;  3R0J A;  2OQG A;  1XCB A;  3K1N A;  3HTS B;  1CF7 A;  2EA4 A;  1XD7 A;  5TRD A;  1MDM B;  2DK8 A;  4RGS A;  2DK5 A;  4LG0 B;  2GQQ A;  1AWC A;  2NAZ A;  2FRH A;  2V9V A;  1SFX A;  2QQB A;  4WF2 A;  3HOS A;  1RZ4 A;  1XGO A;  2W25 A;  2XHK A;  1LDJ A;  4G8X A;  2P5K A;  1U8R A;  2XGX A;  4LJZ F;  5D4R A;  3F22 A;  3FHZ A;  1L0O C;  2HS5 A;  2P8T A;  4ZYH A;  2J5O A;  4I98 B;  1Z9C A;  1ODD A;  5CVU A;  1IW7 F;  1FP1 D;  3ELK A;  4AIJ A;  4B8X A;  1UCR A;  2FA5 A;  5L3D A;  2YR2 A;  3F8C A;  4I09 A;  3HRS A;  2IPQ X;  5E1W A;  2AXL A;  4HX8 A;  4KN4 X;  4AIH A;  4HV5 A;  1YS6 A;  3V7C A;  2VOP A;  4G7Z F;  3KEO A;  4M6Y A;  1ZG5 A;  2VE8 A;  3QAH A;  1KU2 A;  2IRF G;  1OYY A;  1R00 A;  3I53 A;  4L9N A;  4RAZ A;  5K5R A;  4ZYD A;  3LST A;  3QOP A;  2P7V B;  2KIM A;  2P6T A;  3HSR A;  5HS8 A;  3M7G A;  1R22 A;  2QZ8 A;  1YW7 A;  4Q47 A;  3TGN A;  4LLG F;  3J81 K;  4G7O F;  3DFG A;  2IJL A;  4GCV A;  3VB2 A;  2YPR A;  2M30 A;  5LGN A;  3OOP A;  5KK1 A;  1I1G A;  1HW2 A;  3ZMD A;  1TNS A;  2VON A;  2BEO A;  4LB5 A;  3HUG A;  5HS7 A;  1SFU A;  3O2P E;  2VBX A;  2Z99 A;  4KFC A;  1U5T A;  4U7D A;  3I4P A;  1FYL A;  5HLH A;  4MTD A;  2PFB A;  5ILV A;  3QU6 A;  4OIP F;  3I0T A;  4U0W A;  1P4A A;  3KCC A;  5ERI A;  2YX4 A;  4O6J A;  3SFZ A;  2DPU A;  3T8R A;  5IT9 K;  2XAH A;  2H6B A;  3FZV A;  1YIO A;  3BPV A;  4FT8 A;  2GIV A;  3HRU A;  4KIG A;  2ACJ A;  3MFK A;  2OU2 A;  2O8X A;  4AVP A;  1K78 B;  2OQR A;  3RPU A;  1SMY F;  3Q5F A;  1QPM A;  4G7H F;  3K1M A;  1DDN A;  1ZGA A;  1SD4 A;  2ZXJ A;  4HDU A;  2D1H A;  3DP7 A;  4KT5 C;  1W7P A;  1XDU A;  3DQV C;  4I7H A;  3DEU A;  1XGM A;  2O3F A;  2FNP A;  5FFZ A;  3ZMV A;  2OBP A;  4HF1 A;  4A5M A;  2KKO A;  3R4K A;  4I0B A;  1S6L A;  4I02 A;  4L18 B;  4UNO A;  5DCF A;  4XLP F;  2QEN A;  3I54 A;  2WC2 A;  1U78 A;  3FMS A;  1W5T A;  1HQC A;  3GEZ A;  4JBA A;  4NHJ A;  4OMZ A;  4JQF A;  3TO6 A;  1R23 A;  3TOA A;  2QM3 A;  1P4X A;  3GW2 A;  2ZNZ A;  3IC7 A;  4EM0 B;  3KZY A;  2JT1 A;  4M9S A;  3L2C A;  3N4M A;  1B1B A;  1LEA A;  1QQI A;  4HV6 A;  2CYY A;  4XLN F;  2JRT A;  5F6F A;  2STW A;  2FU4 A;  3HYI A;  3GZ5 A;  1KYW A;  3E6M A;  3EQL F;  3LA2 A;  2F5E A;  1ZLJ A;  4S04 A;  1ZYR F;  1DUX C;  1BI3 A;  3BRO A;  2LKP A;  1H9T A;  3DKW A;  1HSJ A;  2RKH A;  2JPC A;  3BJO A;  4A5N A;  5LRS A;  3IRR A;  3P7N A;  1KA8 A;  3M8E A;  3ROU A;  1CF7 B;  1PUE E;  4G6Q A;  3RTR A;  1TW2 A;  2W24 A;  3E6D A;  3O3K A;  1FPQ A;  1PP8 F;  5AIQ A;  4KIB A;  1W4M A;  3KEQ A;  3IWZ A;  2M45 A;  2EFP A;  4UUV A;  2ZFW A;  2K7L A;  3WGI A;  3CLO A;  4ZZL A;  3KET A;  3QP5 A;  3J80 Z;  4P96 A;  1XMA A;  1B9N A;  4UVC A;  1MD0 A;  3KFW X;  5FB2 A;  2GXB A;  1I6X A;  3V8J A;  2ADU A;  2DW4 A;  2CFX A;  3I64 A;  1RIO H;  4IRH A;  2MLK A;  4XRF A;  5BMZ A;  4TV7 A;  3RDI A;  3FM5 A;  1UST A;  3LQQ A;  3K2Z A;  4N9H A;  2WWY A;  5D5X B;  4A6D A;  3PQJ A;  2K4J A;  1FP2 A;  4MTE A;  2GA1 A;  2IW5 A;  2XKO A;  2ZNY A;  3CDH A;  1FBS A;  1MJA A;  3WGG A;  4U0V A;  1S8N A;  4OIQ F;  4GYG A;  2IA2 A;  1BI1 A;  4P9U A;  1IF1 A;  3GO5 A;  2XAJ A;  1F9N A;  2DQL A;  4Q4Z F;  3ZPL A;  3GYH X;  3M1E A;  4DQ2 A;  1FSH A;  1ZHF A;  2ETH A;  3G73 A;  4LK1 F;  4WCG A;  1D5V A;  5J6X A;  2RN7 A;  2VT2 A;  1DP7 P;  3JW4 A;  1UFM A;  2CWE A;  1YO5 C;  3P9I A;  3JSP A;  4R1H A;  3F72 A;  4L9V A;  1BOA A;  5DUK A;  3CO7 C;  3ABT A;  5HVQ C;  3SZT A;  2L3D A;  1EH8 A;  2RQP A;  1T98 A;  3GX4 X;  3CUQ A;  2PMH A;  1XMK A;  1YW8 A;  3K1P A;  1LNW A;  1U5T B;  1YS7 A;  5E18 F;  4LD5 A;  4FX0 A;  4EV0 A;  3DXJ F;  2CQK A;  3WTX C;  2E7X A;  3F23 A;  2GXG A;  1O3S A;  1FOK A;  1WKM A;  2BV6 A;  2CG4 A;  3F6O A;  3VOD A;  2UXX A;  1IN4 A;  4AD9 A;  3EUH A;  3KLN A;  3MZH A;  4MQV A;  4A6E A;  4XSZ F;  5DCM A;  1W7P D;  1BJA A;  1ONV A;  2K86 A;  2FE3 A;  2CW0 F;  3JTH A;  4MGR A;  1JGS A;  2K4B A;  3MAJ A;  1J0R A;  3E5X A;  3E5U A;  4WXC A;  5ICF A;  4CIC A;  2EFW A;  3QPT A;  3I59 A;  1O3T A;  3FMR A;  1FWZ A;  4ZH4 F;  1HBX G;  2LF8 A;  1AOY A;  3KE2 A;  5BOX A;  2M8E A;  4MEX F;  2XVC A;  3C3W A;  1Z05 A;  2PG4 A;  5L3E A;  3LAJ A;  1L3L A;  1IXR C;  3QPH A;  3LFK A;  4YG2 F;  1ZLK A;  5AIP A;  4IPA A;  1EH7 A;  2Z3Y A;  4MNU A;  2C6Y A;  1XGS A;  1ZG1 A;  5A2Q Z;  3V7S A;  3IL2 A;  3E5Q A;  4G6D A;  3M9A A;  2EV0 A;  1S7A A;  3ULQ B;  5LHH A;  2STT A;  1TNT A;  5D4S A;  3EDP A;  3FWE A;  5FO5 A;  4KYW A;  3Q9V A;  1XGN A;  1J7K A;  2YU3 A;  2PI0 A;  1E2X A;  2TDX A;  2MLG A;  2EFQ A;  1TQI A;  1GVJ A;  3ZQ7 A;  2L4A A;  1P4W A;  4U0Y A;  1XSD A;  4BNC A;  2EA2 A;  3R60 A;  1TLH B;  1LDK B;  5CVR A;  1QGP A;  3VFZ A;  2XAQ A;  2QQA A;  4I0A A;  4HX4 A;  2HEO A;  1BC7 C;  1REP C;  5L3B A;  1UB9 A;  2IT0 A;  5LLQ A;  3TQN A;  1QO0 D;  3F8B A;  2FEZ A;  1K7A A;  2QVO A;  3CTA A;  4UVA A;  1U3E M;  3R61 A;  3WOD F;  2DO7 A;  3B73 A;  4RB3 C;  4YFX F;  4MEY F;  3E97 A;  2FOK A;  3NRV A;  2FXA A;  1WWX A;  3PQK A;  2PJP A;  5DDG A;  1F4K A;  3W6J B;  1LB2 A;  2XAF A;  1ZRF A;  2KJB A;  5D6E A;  3QRF F;  4KNY A;  2E1C A;  3P9K A;  1MGT A;  1IN6 A;  5L3C A;  4HZF A;  4LLL A;  3I58 A;  5FD6 A;  2FBI A;  1JXS A;  3RPQ A;  2FF4 A;  2R7F A;  4KIF A;  4BXU A;  4RB1 A;  4FHT A;  2BBY A;  2BE5 F;  2VC0 A;  3L9F A;  3LQR A;  4UVB A;  1OYW A;  4B09 A;  2MBF A;  5JVT A;  1JE8 A;  4O5V A;  4HAM A;  1FLI A;  1RUN A;  2H09 A;  1SD5 A;  4RS8 A;  3BDD A;  5FGM A;  1K6O A;  5LHI A;  2KIU A;  2D2W A;  2COM A;  1WQ2 A;  1WRJ A;  1Y0U A;  4I2O A;  3I71 A;  2JPB A;  3COA C;  1GXP A;  4ENK A;  1TW3 A;  3JAM Z;  1YG2 A;  1R58 A;  2E1N A;  2K27 A;  1ZRC A;  3F8M A;  4NQW A;  4RGX A;  3V8K A;  1J59 A;  4ASN A;  2F5F A;  4L9J A;  1YFH A;  3K69 A;  1HXD A;  3RIR A;  4CO8 A;  5DYM A;  2ZME A;  1UHM A;  4KMU X;  4O3M A;  4OIO F;  1F5T A;  5L3F A;  4NB5 A;  5HLG A;  1O7L A;  2O0Y A;  4M6X A;  3T5X A;  1OYI A;  3CUQ B;  4ESF A;  2ZKZ A;  5LEK A;  2L4M A;  4LGW A;  3BPX A;  3HOT A;  4F7Z A;  2VBZ A;  3T8T A;  3G3Z A;  1HKQ A;  3VEP A;  4HLX A;  1MZB A;  2HR3 A;  1Z6T A;  3BP8 A;  2OZ6 A;  3C1D A;  2H27 A;  2P6S A;  1UHW A;  2JSC A;  3ZMU A;  2PN6 A;  3FX3 A;  2WTE A;  4AWX B;  3WE2 A;  1O3R A;  5IT3 A;  1LQ1 A;  1R7J A;  2MA3 A;  1A04 A;  4HDV A;  4CDG A;  4LG0 A;  2Y0M A;  4Z2Y A;  3N97 A;  3RYP A;  1V4R A;  2XIG A;  5JHU A;  2V6C A;  2Y48 A;  4H0E A;  3WTV C;  1G3Y A;  4LFU A;  3RI4 A;  3I59 B;  5H20 A;  1S29 A;  2Q0O A;  3L7W A;  2XRO A;  3CUO A;  1LJ9 A;  1TBX A;  1IRG A;  4Y17 A;  5ICE A;  4MHG A;  4IVN A;  4PGG A;  4KIC A;  3SQN A;  2GZW A;  5CJ9 A;  2LF7 A;  4XBF A;  1B4A A;  1P6R A;  3HSE A;  1SMT A;  4KUM A;  5E1Z B;  5E1X A;  2LDU A;  2BGC A;  2L54 A;  3GFL A;  3BY6 A;  5CVI A;  5BPI A;  1J5Y A;  1O57 A;  2PEX A;  3R6S A;  1KQ8 A;  3ZMT A;  3WTY C;  1IUY A;  1R5H A;  1IN7 A;  5K5O A;  2W85 A;  2PBI A;  3IWF A;  1QBJ A;  1QZY A;  1U5T C;  3C18 A;  3J7A O;  4DNC A;  2PLY A;  2VT3 A;  1XSX A;  1DPU A;  1ULY A;  4G9Y A;  3HHH A;  1I1S A;  2RV8 A;  3F8N A;  5ED4 A;  3HHG A;  2XUB A;  5D5U B;  1YW9 A;  3U9G A;  4YII A;  2EV5 A;  2YSR A;  1STZ A;  5D6F A;  5H6Q A;  2VC1 A;  3K0L A;  4AIK A;  2Q2E A;  2XAG A;  2X0L A;  3BZ6 A;  1FT9 A;  1IXS B;  3RJP A;  5BS6 A;  5LGT A;  4K2E A;  5FLX Z;  4UHT A;  3H92 A;  3K9T A;  4KA4 A;  4KDP A;  4IXA A;  5K1Y A;  1KQ0 A;  1FC3 A;  2RNJ A;  4L0Z B;  2ESH A;  1VTN C;  1BC8 C;  1XN7 A;  1JHF A;  5CVV A;  3FXU A;  1G3S A;  1XB4 A;  1CGP A;  3GXO A;  4EVI A;  2E7W A;  3JTG A;  2HDC A;  4WX9 A;  4M9X A;  2VOD A;  2GA2 A;  2FNA A;  3GVA A;  2DT5 A;  4UXN A;  1OPC A;  2MH9 A;  3V4G A;  3JSO A;  4HW0 A;  4N9I A;  2DAO A;  3D5L A;  1C0W A;  2QBY A;  1IRF A;  3SHF A;  5JI6 A;  4L9T A;  1P92 A;  1BI2 A;  2NS0 A;  2VBY A;  2VN2 A;  5HOO A;  3J80 K;  2ZBK A;  2XAS A;  2A3S A;  4P55 A;  4M72 A;  3HTU A;  2FSW A;  4HA8 A;  4XSX F;  2VE9 A;  1J75 A;  1G4D A;  4GGG A;  4IF4 A;  2NNN A;  1KU7 A;  1R36 A;  2LNB A;  4U88 A;  3ZN0 A;  2GWR A;  1FX7 A;  1J2X A;  2Q8K A;  2A68 F;  4HLY A;  3HRM A;  2VXZ A;  4R8H A;  2F5C A;  1T38 A;  2VBW A;  4HQE A;  1ZRE A;  2Y75 A;  3LA7 A;  3IHU A;  5HLI A;  2M5W A;  1W5S A;  3WE3 A;  4Q48 A;  1ZRD A;  4OIN F;  3EET A;  4UV9 A;  3MQ0 A;  1IZ1 A;  3P9C A;  5DD8 A;  2HOE A;  3H3U A;  2Z9O A;  2WV0 A;  5LEJ A;  4ON0 A;  2DLL A;  3QP6 A;  4CZZ A;  2DU9 A;  1GXQ A;  1WSU A;  1HW1 A;  3FXR A;  4RB2 C;  4I01 A;  2FQ3 A;  4BHP A;  1W7P B;  2P4W A;  1FBQ A;  5E8G A;  3E6C C;  2ZME B;  5ILU A;  4PZJ A;  5D8K B;  3WU0 A;  2HKX A;  1ON1 A;  1F1Z A;  2EWN A;  5JFR A;  4CYD A;  3CJN A;  2ESN A;  4U7B A;  3OV8 A;  2ELH A;  1OKR A;  1LDD A;  4EM1 A;  2UZK A;  1ZAR A;  2AS5 F;  3NQO A;  5DV5 A;  5KVR A;  3GFI A;  2D45 A;  3KP3 A;  5J8C A;  2QYO A;  5ICC A;  1ZG3 A;  3WGH A;  3U1D A;  4RGR A;  2J5P A;  4EJU A;  3ERE D;  2XRN A;  1G6N A;  2P5L C;  5LBQ A;  2O03 A;  3KP6 A;  2A5Y B;  1FZP B;  4A0X A;  1J9I A;  1FBU A;  2W57 A;  4A0Y A;  4RAY A;  2A69 F;  4Y13 A;  2QLZ A;  1EH6 A;  4HOB A;  3WTU C;  1Z6R A;  2RDP A;  3J81 Z;  2F2E A;  1HKS A;  2V79 A;  2W84 A;  2JTV A;  4MQ9 F;  4BQA A;  5CLS A;  2PMU A;  4UV8 A;  4OOI A;  4WXH A;  3B02 A;  3RKW A;  3GFM A;  1ZH5 A;  3WU1 B;  2NNY A;  2ZCW A;  1D8K A;  1G3T A;  1QZZ A;  2Z5U A;  1WI9 A;  3M8F A;  4EGY A;  3BJ6 A;  3LWF A;  5J8F A;  5IT9 Z;  1R5G A;  3CUQ C;  4OU0 A;  4G94 A;  3E3V A;  1MJB A;  2OZU A;  1R1U A;  3BWG A;  3LAP A;  4A0Z A;  5A2Q K;  1OMI A;  4KN7 X;  3TOB A;  1FSE A;  3ZP5 A;  5F64 A;  1H9G A;  5HS9 A;  2JZY A;  3V8L A;  2H94 A;  1FYM A;  2ISZ A;  2MH2 A;  4OIR F;  2ZJ2 A;  4EJV A;  1YYV A;  4OMY A;  1YQA A;  3HRT A;  2K02 A;  4A12 A;  2H6C A;  4QLC U;  4WXD A;  4HYE A;  1H0M A;  1S7O A;  4A2U A;  2RGV A;  1OR7 A;  5E17 F;  2G7U A;  4ETS A;  4WK8 F;  1FNN A;  3RKY A;  1E17 A;  4Y15 A;  4LB6 B;  5CYV A;  4EQQ A;  4BYY A;  5EEH A;  1XSV A;  3KP2 A;  1I5Z A;  2L01 A;  5BQT A;  1V3F A;  4ESB A;  4LMY A;  2BYV E;  2M87 A;  3GZ6 A;  4ZYE A;  3FF5 A;  4CHU A;  3FM3 A;  3HSF A;  1U2W A;  3PFI A;  1T0F A;  1IN8 A;  1GHC A;  2KJC A;  1PDN C;  1B6A A;  4M73 A;  3HIF A;  4YFK F;  2R7D A;  1U6G A;  3KZZ A;  5E8I A;  2QBY B;  4BHB A;  1XCV A;  4EM2 A;  1BI0 A;  1ZGJ A;  5K5Q A;  1HKT A;  1TQM A;  3F21 A;  1SAX A;  1BN5 A;  2B0L A;  5DD4 A;  1KU3 A;  1KYZ A;  4N0B A;  2RVC A;  3SZP A;  2HZT A;  3EYI A;  2FBK A;  4L5J A;  5AON A;  4IHS A;  3DPT A;  4RGU A;  2FML A;  1ZN2 A;  4GXO A;  2MD5 A;  3IRQ A;  3R0A A;  2PQ8 A;  4EJO A;  4R79 A;  1PP7 U;  2P5V A;  4ENM A;  3GUD A;  1SD6 A;  4P9F A;  5JR3 A;  4S05 A;  2DTR A;  3F8F A;  4HBL A;  2O6G E;  2QUF A;  5TJJ A;  1X3U A;  1T39 A;  3T0Y A;  3L09 A;  3NEU A;  1O7F A;  1KU9 A;  2KRF A;  3KP5 A;  2VOO A;  1RI7 A;  1I27 A;  1MDM A;  2EB7 A;  5DCM B;  1YTY A;  2UXN A;  1R1V A;  2HYG D;  3JAM K;  2P7C B;  1D8J A;  2HGC A;  2OAZ A;  2IA1 A;  4JK1 X;  4QWQ A;  4ENJ A;  3MCZ A;  4GO1 A;  4L5I A;  3L00 A;  5HDG A;  2G9W A;  3GLX A;  3KP4 A;  5BPD A;  3SXY A;  1DPR A;  3Q9S A;  1IAW A;  3ISP A;  5L3G A;  1BIA A;  4BAY A;  3T1B A;  2A61 A;  2HYF A;  4HF2 A;  1KQ9 A;  3DF8 A;  3D0S A;  2A07 F;  2CSO A;  3TO9 A;  1MKM A;  2V1X A;  2QQ9 A;  1USS A;  1B59 A;  1IXC A;  3ECO A;  5EEG A;  1BBY A;  5ILS A;  1Z91 A;  4KMF A;  3WTS C;  4CXF A;  2M1B A;  3DV8 A;  4LK0 F;  4BHC A;  2EFO A;  1FY7 A;  4CGZ A;  2HFH A;  3MWM A;  5HDK A;  3WTT C;  5LRR A;  3ZMZ A;  4YFN F; 
#chains in the Genus database with same CATH topology
 5KHD A;  2HKO A;  2O9L A;  2DA5 A;  4ENN A;  4XM3 A;  3ZMS A;  5FKN A;  3RYR A;  9ANT A;  2HWV A;  2TRT A;  4YIR X;  1T33 A;  5DEQ A;  1D5Y A;  1QNT A;  2OTL I;  4PCQ A;  2VXD A;  3RZO J;  3VSK A;  1VQK I;  3MZY A;  3H3Z A;  2FBH A;  3FMQ A;  2X4H A;  3W6V A;  3EUA A;  1SD7 A;  4E70 A;  5F0H A;  3TO7 A;  2KIS A;  2IP2 A;  2M3A A;  1W5C C;  2LSO A;  3OL4 A;  5E20 A;  4KIS A;  1P7J A;  2XGE A;  2NYX A;  3FXQ A;  3QPS A;  2ISY A;  3O6B B;  3HC7 A;  4M74 A;  1FIP A;  1QPI A;  1ZTR A;  2DA7 A;  2CO5 A;  2ZME C;  5HDN A;  3RSN A;  3BT9 A;  4MLO A;  3H9Q A;  2BY3 A;  3WTW C;  1DGW Y;  4C3I J;  3OSF A;  1R1T A;  5F1R A;  2HTJ A;  2X6Y A;  1VQM I;  3ABK H;  4EJT A;  5D5V B;  1W1W E;  1Z1D A;  2HQR A;  1MIJ A;  3WTZ A;  3C7J A;  3BJA A;  4ESJ A;  3GFJ A;  2XPW A;  1NHA A;  4BY7 J;  3RKX A;  3S32 A;  2UWM A;  3IAM 2;  4IRG A;  4IRI A;  4FQG A;  1OJL A;  2Y9Y A;  2VI6 A;  2F5D A;  1YLF A;  1EV7 A;  1S3J A;  1LVK A;  2IA0 A;  2LP0 A;  1MJ9 A;  2IVM A;  2FMY A;  2OD5 A;  2X1C A;  4PDK A;  1R4M B;  5LHG A;  3EYY A;  3O8H A;  2DPD A;  2GLO A;  1JI8 A;  2ZJQ F;  4JYK A;  3A02 A;  2VAS A;  3OY9 A;  3ECH A;  3GF2 A;  1V5E A;  2O61 A;  3V7R A;  1B9M A;  2DA3 A;  3L2W A;  3X2Q H;  1K78 A;  1D3Y A;  4JX4 A;  5ICG A;  2JA8 J;  2BHZ A;  3S17 J;  4EGZ A;  2XV4 S;  1JKQ C;  3F3X A;  4RB0 A;  3TKY A;  1ON2 A;  1TQP A;  2Y30 A;  1XDS A;  2DQR A;  3VOE A;  3I4N J;  2CGP A;  1AKH B;  1HW5 A;  3BTC A;  3CO6 C;  4IJA A;  4P5O A;  1DU0 A;  4L0Y B;  5E3O A;  2QWW A;  3JCU C;  3QYB A;  2A6H F;  5D5W B;  2GAU A;  1SFE A;  2DFI A;  3LL7 A;  2ELK A;  2F4O B;  2R3S A;  3K6G A;  1G3W A;  1W36 C;  2G7H A;  3AG1 H;  3F9K A;  3UNG C;  3A0B C;  4FX4 A;  5IP9 J;  3DLA A;  1LVA A;  1GV2 A;  3QQA A;  3FIW A;  4HX7 A;  4CCJ A;  4CZC A;  4LOC A;  1PUF A;  3GWZ A;  4PJL A;  3OWT A;  3QYF A;  3E6B A;  1S72 I;  5FLX K;  1BIB A;  1E0E A;  4PGH A;  4CCM A;  2DOF A;  2DI3 A;  3KP7 A;  4IHT A;  1OCP A;  4ANJ A;  2HTS A;  5LGU A;  1KGS A;  1IN5 A;  2ZSI B;  4ZDP A;  4J00 A;  2XKP A;  3QU3 A;  4M71 A;  4YIF A;  5J40 A;  1R4N B;  2L9R A;  5FFX A;  1R5I D;  5CVJ A;  2R5Y B;  1LUJ B;  4BH9 A;  2V1D A;  3S2W A;  2RC4 A;  2ZXI A;  1T6S A;  4RDU A;  4RAF A;  3CJQ B;  4ZZD A;  3DPL C;  4D0P A;  1YE9 A;  3BR6 A;  5DM6 F;  4D1Q A;  1O3Q A;  2EK5 A;  2NRA C;  2EIL H;  2EV6 A;  3SDG A;  1GDT A;  1RKW A;  2HOS A;  2CW8 A;  2YX7 A;  2OA4 A;  5D8L B;  3F6V A;  6PAX A;  1BM9 A;  1WJA A;  1WFX A;  2EFN A;  4Q5S F;  1P2F A;  1SAN A;  2KHM A;  5HLT A;  1TTY A;  2A6E F;  2EIN H;  5C3E J;  1YJW I;  5JLW A;  2LY1 A;  3G2B A;  3U21 A;  5GAH J;  4EMS A;  3ZN1 A;  2LVS A;  2MC3 A;  4EJW A;  1HST A;  1D0Y A;  1Z7U A;  4M9Z A;  5FD5 A;  4CYC A;  4F93 B;  1MH3 A;  2R7S A;  5B1A H;  1OCZ H;  3WHC A;  3REO A;  2Z33 A;  2EIJ H;  5FKK A;  3ML6 A;  1EF4 A;  3CCV I;  1Q1H A;  3I5U A;  2L02 A;  2K9L A;  3IKT A;  2CUJ A;  3KEY A;  2DOA A;  4HF0 A;  3KLO A;  2E5Z A;  2EJR A;  2V1U A;  4RMN A;  5K7F A;  2QGU A;  1K79 A;  4HQM A;  3U2R A;  2HZD A;  4JP0 A;  4GYI A;  3SEZ A;  3ABU A;  2QSG X;  1RUO A;  3QOD A;  1JHH A;  3PL8 A;  3MEX A;  3ZRG A;  3BOQ A;  4B48 A;  2R92 J;  1FYK A;  4AU7 A;  2AO9 A;  2E2J J;  4MIM A;  4LLN A;  1Y6I A;  2DBB A;  2ZO4 A;  2KIF A;  2MC4 A;  3IKV A;  1ZAO A;  2XPV A;  5DUI A;  1XS9 A;  3WG9 A;  2HQN A;  2DMQ A;  4E7Z A;  3M8J A;  4L5E A;  3FBN B;  3K70 C;  3CD6 I;  1LEB A;  4P1W A;  3S8P A;  3AAF A;  3TDZ C;  3CCR I;  4G12 A;  3I3L A;  1UAA A;  3K10 A;  2QKL B;  3TDU C;  2L7F P;  1HDP A;  4ZYG A;  1N75 A;  2COB A;  4WWC A;  5H6R A;  3LA3 A;  3W6K B;  1T2K A;  1RNL A;  1YRN A;  2D1V A;  4DBR A;  3R0J A;  3EUK L;  2JVG A;  2OQG A;  1XCB A;  4V2G A;  3K1N A;  3HTS B;  4XN0 A;  1CF7 A;  2GXA A;  2EA4 A;  3BLY A;  3WU2 C;  1XD7 A;  5TRD A;  1Y8R B;  1MDM B;  5EF6 A;  1I50 J;  3PNV A;  1VFC A;  2DK8 A;  2DT7 B;  4RGS A;  2DK5 A;  3HPH A;  4LG0 B;  3BC8 A;  2GQQ A;  3OMY A;  3BTL A;  1AWC A;  2E1M C;  1UMQ A;  2NAZ A;  3IUO A;  3QPL A;  4DBQ A;  4UY8 I;  2FRH A;  2V9V A;  3TBI A;  1SFX A;  3SJM A;  4BEH B;  2QQB A;  2EZH A;  2L7M P;  3KIO A;  4WF2 A;  3HOS A;  4M3E A;  4RM3 A;  1RZ4 A;  3VSL A;  2KQR A;  1VQO I;  2XHK A;  1XGO A;  2W25 A;  1LDJ A;  1X4O A;  4JX5 A;  4FAS D;  4H4K C;  4G8X A;  2HVR A;  1BL0 A;  2P5K A;  1MBF A;  1U8R A;  2XGX A;  1X2M A;  4LJZ F;  5D4R A;  4CH7 A;  4ABZ A;  3F22 A;  2K85 A;  1L0O C;  2HS5 A;  3FHZ A;  2P8T A;  1A35 A;  5KAI C;  2LBF B;  4ZYH A;  2J5O A;  4I98 B;  1Z9C A;  1B72 A;  1ODD A;  5CVU A;  3W2V A;  2R7T A;  1OLT A;  1IW7 F;  1D0X A;  2DOD A;  3OYN A;  2PJR A;  4LIT A;  5FRM A;  1FP1 D;  2V4J C;  1M1E B;  3ELK A;  2MW8 A;  4AIJ A;  3S1R J;  4U87 A;  4B8X A;  3PM1 A;  1UCR A;  3ASN H;  2FA5 A;  5L3D A;  2YR2 A;  4F92 B;  2BY1 A;  3F8C A;  1YX5 A;  2VQC A;  4I09 A;  5GPA A;  3HRS A;  3LSH A;  2IPQ X;  1NH3 A;  5E1W A;  2AXL A;  4HX8 A;  1BA5 A;  3H9G A;  3O8G A;  4KN4 X;  4AIH A;  4A3D J;  2DA6 A;  4HV5 A;  1YS6 A;  3V7C A;  1YIT I;  2ME0 A;  2VOP A;  2E34 A;  3LSR A;  2MFZ A;  3S2D J;  1X1A A;  3KEO A;  4G7Z F;  4M6Y A;  1ZG5 A;  3Q0U A;  2JRM A;  4W1U A;  2VE8 A;  2N8G A;  4W97 A;  2DT6 A;  2R7O A;  2CV2 A;  2DA4 A;  3VPR A;  3QAH A;  1KU2 A;  2QF7 A;  2X6O A;  2IRF G;  2HU9 A;  1OYY A;  1R00 A;  2QQ8 A;  1IGN A;  3QWL A;  3I53 A;  4L9N A;  4RAZ A;  3AL0 B;  5K5R A;  4XR6 A;  4B44 A;  4ZYD A;  2GIZ A;  3LST A;  3QOP A;  3CJT B;  2P7V B;  2KIM A;  2LR8 A;  2HQ5 A;  3LSK A;  2K9N A;  2P6T A;  3HSR A;  1OFC X;  4HST A;  1POG A;  3W2W A;  2MD0 A;  4OAY A;  5HS8 A;  3M7G A;  5J1U A;  1A31 A;  1LKX A;  1BOB A;  4M3B A;  1R22 A;  1A6Q A;  3K4J A;  1G59 A;  2QZ8 A;  1YW7 A;  1XMX A;  3FXL A;  3HM5 A;  4ZTJ A;  1SC7 A;  4Q47 A;  3TGN A;  4XOT A;  4LLG F;  4BQQ A;  2HOA A;  3J81 K;  4G7O F;  4AUX A;  3DFG A;  2NVX J;  2IJL A;  1K4T A;  2X48 A;  4GCV A;  3VB2 A;  2YPR A;  2M30 A;  5LGN A;  3OOP A;  1JKR C;  5KK1 A;  1I1G A;  1HW2 A;  3ZMD A;  1TNS A;  2VON A;  2BEO A;  3A1Y A;  2CH0 A;  1WZ2 A;  1PVE A;  4LB5 A;  1WVR A;  1RES A;  1FEX A;  2HXI A;  2RQQ A;  3HUG A;  5HS7 A;  1SFU A;  3O2P E;  2VBX A;  3OYE A;  4OWR B;  4IHW A;  2Z99 A;  4KFC A;  1U5T A;  2LY9 A;  2WAQ A;  4U7D A;  3I4P A;  1FYL A;  2NS8 A;  5HLH A;  3H0D A;  3ZQI A;  4MTD A;  2GOM A;  1XX5 A;  2PMZ A;  1Z77 A;  2PFB A;  5ILV A;  3QU6 A;  4OIP F;  3CCE I;  1OIS A;  3I0T A;  2VQH A;  4U0W A;  1P4A A;  3KCC A;  5ERI A;  3ZQC A;  2YX4 A;  4O6J A;  3SFZ A;  2DPU A;  2WAQ N;  3T8R A;  5IT9 K;  2WY8 Q;  3OYA A;  2XAH A;  2H6B A;  3FZV A;  1YIO A;  2Q1Z B;  3BPV A;  4FT8 A;  2GIV A;  2PMZ N;  4XIC A;  2I10 A;  3HRU A;  2VUM J;  4KIG A;  2IBD A;  2K5C A;  4BJ5 C;  2ACJ A;  3MFK A;  2OU2 A;  3PFY A;  1OQY A;  2O8X A;  4AVP A;  1K78 B;  1I3A A;  2OQR A;  3RPU A;  3HBL A;  1NK3 P;  5LD2 C;  1SMY F;  5C4X J;  3Q5F A;  1QPM A;  4G7H F;  3K1M A;  1K4S A;  1DDN A;  1D1C A;  4MFD A;  2FX0 A;  4XQF A;  3RCO A;  4BKX A;  2WAD A;  1ZGA A;  2E71 A;  2JK3 A;  3H36 A;  1V54 H;  1SD4 A;  1OCC H;  2ZXJ A;  3BR2 A;  3G71 I;  2D1H A;  4HDU A;  4ZYA A;  3ZXS A;  3DP7 A;  4KT5 C;  3GTK J;  2BZT A;  1W7P A;  1XDU A;  2DA1 A;  3DQV C;  5TIS C;  4I7H A;  3DEU A;  1ORK A;  1XGM A;  2O3F A;  2FNP A;  4CCN A;  5B3S H;  4B47 A;  1IDZ A;  5GP9 A;  3BCA A;  2F48 A;  1RR7 A;  5FFZ A;  3IAS 2;  1H88 C;  3VWB A;  3H3V K;  3ZMV A;  3A03 A;  3PO2 J;  2B63 J;  1PUF B;  1FOX A;  2OBP A;  1R49 A;  3OIO A;  4A5M A;  4HF1 A;  2KKO A;  1YJN I;  3R4K A;  4I0B A;  1S6L A;  4I02 A;  4L18 B;  4UNO A;  2F6C A;  4D7M A;  5DCF A;  5CQE A;  2QEN A;  4XLP F;  3AKZ A;  4Y3O A;  2HPM A;  1RPW A;  3I54 A;  4IOC F;  1LE8 A;  2WC2 A;  1U78 A;  3FMS A;  4FE7 A;  4KT6 A;  2EBI A;  1ETK A;  1W5T A;  4E7J A;  2BHY A;  2K9M A;  1HQC A;  3GEZ A;  4JBA A;  2DFH A;  5K7Z A;  3L2R A;  5E3L A;  4M3G A;  4NHJ A;  2W48 A;  4OMZ A;  4JQF A;  3TO6 A;  2FOW A;  2NVU B;  4A3L J;  1R23 A;  3TOA A;  2MSY A;  2QM3 A;  1P4X A;  4BQO A;  3GW2 A;  2ZNZ A;  4NUB A;  5J1R A;  3IC7 A;  2O5R A;  4EM0 B;  3MKZ A;  3KZY A;  2OPT A;  2JT1 A;  4M9S A;  1V55 H;  3L2C A;  3N4M A;  1EJ9 A;  1LFP A;  1B1B A;  3IP4 B;  1LEA A;  2CJJ A;  1QQI A;  4HV6 A;  2CYY A;  3HXL A;  4XLN F;  2JRT A;  3OYM A;  5F6F A;  1X1P A;  5IYD J;  1QHG A;  3MMY B;  2STW A;  2FU4 A;  3HYI A;  3GZ5 A;  4PJJ A;  1KYW A;  3E6M A;  3EQL F;  3Q3S A;  4PUS A;  2YU9 J;  3LA2 A;  3ERM A;  3ZQL A;  2LY2 A;  2F5E A;  1ZLJ A;  4A3E J;  4S04 A;  1ZYR F;  4XRS A;  1XPX A;  1LFB A;  3PJR A;  1DUX C;  1BI3 A;  2VJ5 A;  3BRO A;  1ETY A;  1UEL B;  2LKP A;  3JRD A;  3S3O A;  2ID6 A;  1OR7 C;  3M3Y J;  1H9T A;  2ECC A;  3DKW A;  1HSJ A;  1WJD A;  1Z21 A;  2JPC A;  2RKH A;  3BJO A;  2CRG A;  4A5N A;  5LRS A;  1S7E A;  2IS6 A;  1SFO J;  3HEF A;  3MKY B;  4DYQ A;  1YRN B;  2D5V A;  4F3Q A;  1X2N A;  3IRR A;  3P7N A;  2KT0 A;  1ZR4 A;  3QOE A;  1KA8 A;  3CP2 A;  3M8E A;  5GPC A;  3ROU A;  4UUT A;  3FK6 A;  1CF7 B;  3SZG A;  1PUE E;  4G6Q A;  2VPR A;  4Z6Y A;  3RTR A;  1XTA A;  1BJZ A;  2OCE A;  1TW2 A;  2IGN A;  2W24 A;  3J7A Y;  2XDV A;  3E6D A;  2RAE A;  2QSH X;  3O3K A;  1FPQ A;  1TWA J;  5AIQ A;  1PP8 F;  4PJ0 C;  1DQU A;  1K83 J;  4I76 A;  4KIB A;  4YEL A;  1W4M A;  5IYB J;  3KEQ A;  5HNF A;  1X3W B;  1ETO A;  3OS1 A;  3IWZ A;  2YS9 A;  2M45 A;  3PSF A;  2EFP A;  1HC8 A;  1T0F C;  5K7H A;  4UUV A;  2ZFW A;  2K7L A;  2CQ7 A;  4QPO A;  3WGI A;  3GME A;  2JWT A;  1S9H A;  3CLO A;  4ZZL A;  3J80 Z;  3QP5 A;  3KET A;  4P96 A;  1XMA A;  1B9N A;  4G6T B;  4UVC A;  3F0C A;  1MD0 A;  3KFW X;  5FB2 A;  4N4O B;  2WV1 A;  3Q0W A;  2GXB A;  1I6X A;  4HSR A;  3V8J A;  2ADU A;  1MSF C;  3DCF A;  2DW4 A;  4BDY A;  2CFX A;  2XSJ C;  4BQN A;  1GLN A;  3I64 A;  1MNM C;  2PJR B;  3KPH A;  2JJ7 A;  1RIO H;  3GTM J;  2P0W A;  4IRH A;  2MLK A;  3G1O A;  1EA3 A;  4XRF A;  5BMZ A;  4TV7 A;  2L9S A;  3RDI A;  3FM5 A;  1UST A;  1TWH J;  3LQQ A;  3K2Z A;  4N9H A;  2WWY A;  4XOP A;  5D5X B;  2LH9 A;  4A6D A;  5M5X J;  3PQJ A;  2K4J A;  3PSI A;  4X6A J;  1FP2 A;  4MTE A;  2GA1 A;  4RA2 A;  2IW5 A;  2XKO A;  2ZNY A;  3CDH A;  1FBS A;  3GTO J;  3N05 A;  1X1B A;  4RAG A;  2W7N A;  1NG6 A;  1YX3 A;  3E7L A;  3GTJ J;  3K4N A;  1MJA A;  2AQF A;  3WGG A;  2XRL A;  4U0V A;  1S8N A;  4OIQ F;  2EH3 A;  4GYG A;  2IA2 A;  1BI1 A;  2DN0 A;  4P9U A;  1IF1 A;  4Y7N J;  3GO5 A;  2XAJ A;  1F9N A;  2DQL A;  3BG9 A;  2LMD A;  1W0U A;  4Q4Z F;  2HXO A;  2M7B A;  2EZK A;  3ZPL A;  3GYH X;  3GTQ J;  3DEE A;  3M1E A;  1ZEL A;  4DQ2 A;  4E7L A;  3GLL A;  1FSH A;  3DBR B;  2VPL A;  1ZHF A;  2ETH A;  1T56 A;  3G73 A;  4LK1 F;  4WCG A;  2JA5 J;  5EZG A;  3FDY A;  1D5V A;  5J6X A;  2RN7 A;  2VT2 A;  2H1L A;  1DP7 P;  1X1D A;  3ZQQ A;  1VQ9 I;  3JW4 A;  1UFM A;  2CWE A;  3IH4 A;  1YO5 C;  2H8W A;  3LMM A;  1JGG A;  2KL4 A;  3WHB A;  3P9I A;  3A01 B;  2L0K A;  3CC7 I;  3HOU J;  3JSP A;  4R1H A;  3ZGK A;  3F72 A;  4L9V A;  1BOA A;  4ZDO A;  5DUK A;  3K4L A;  4IHV A;  4D5F A;  4B3A A;  3OYJ A;  5J4Y A;  2ELJ A;  3CO7 C;  4IOA F;  1TP4 A;  2R7Z J;  2XPU A;  4AM3 A;  4IO9 F;  4YRV A;  4ZDL A;  3JRB A;  3ABT A;  5HVQ C;  3SZT A;  2L3D A;  1EH8 A;  4I6Z A;  2IS4 A;  1D0Z A;  3S93 A;  5B66 C;  2DA2 A;  2IAI A;  2R7R A;  2QCO A;  2RQP A;  1T98 A;  3GX4 X;  2VKH A;  3S16 J;  3MKW B;  3BTI A;  3CUQ A;  1I3Q J;  2PMH A;  1JJ6 C;  1VQ7 I;  5GAG J;  1XMK A;  1YW8 A;  3A0H C;  3K1P A;  3OL3 A;  1LNW A;  4RLF A;  1U5T B;  1YS7 A;  1Z3X A;  5E18 F;  3L2V A;  1PYV A;  4LD5 A;  3TP3 A;  4FX0 A;  4EV0 A;  3DXJ F;  3HL2 A;  3BCB A;  2CQK A;  3WTX C;  2E7X A;  3F23 A;  4C30 A;  2GXG A;  2M9H A;  4NDL A;  5M3M J;  1O3S A;  2WBM A;  3RPU D;  2IEK A;  1FOK A;  2H8R A;  1WKM A;  2BV6 A;  2CG4 A;  3F6O A;  4NNJ A;  3VOD A;  3S15 J;  1YOV B;  2UXX A;  1IN4 A;  3PUF A;  1BW6 A;  2M7A A;  4AD9 A;  3OYL A;  3JRA A;  1UG0 A;  3KYC B;  3EUH A;  3HDD A;  3KLN A;  4B43 A;  2OF7 A;  3MZH A;  4MQV A;  4A6E A;  2CUZ A;  4XSZ F;  2KMU A;  5DCM A;  1W7P D;  1BJA A;  1ONV A;  2K86 A;  2LTP A;  2FE3 A;  3PNY A;  2CW0 F;  2NOG A;  2W82 A;  3JTH A;  4C2T A;  2XSD C;  1JTY A;  4MGR A;  1JGS A;  2K4B A;  5EDN A;  2ZJR F;  3MAJ A;  2DMP A;  2LG4 A;  4KIT B;  1J0R A;  3E5X A;  3E5U A;  4WXC A;  5ICF A;  3OYG A;  2L9N A;  1Z3Y A;  2BW3 A;  4CIC A;  2EFW A;  3QPT A;  3ABM H;  2E36 A;  1I39 A;  3I59 A;  3AL0 C;  4PSW A;  1A6I A;  1O3T A;  3FMR A;  1I6H J;  1FWZ A;  4ZH4 F;  3H5N A;  1HBX G;  2LC2 A;  5IY5 H;  2LF8 A;  1R71 A;  1AOY A;  3KE2 A;  3UR3 C;  4UUS A;  1P9Q C;  2G0E A;  2Z16 A;  5J4V A;  3K4B A;  3TED A;  3PIO F;  1LPQ A;  3ZQH A;  2KPM A;  3C2G A;  5BOX A;  1T8I A;  3WG7 H;  1ETX A;  2M8E A;  1MBH A;  5KNL A;  4BXX J;  1Y39 A;  5EG0 B;  4MEX F;  2XVC A;  4DYR A;  2DYR H;  3C3W A;  1Z05 A;  2PG4 A;  3I4M J;  5L3E A;  3LAJ A;  1L3L A;  3IH3 A;  4AVZ A;  1LE8 B;  1IXR C;  3S2H J;  4CCO A;  4ZJZ A;  3KYL A;  3QPH A;  3LFK A;  4D9J A;  1WJF A;  4YG2 F;  4A69 C;  1ZLK A;  4J01 A;  4RBO A;  4HG2 A;  5AIP A;  4IPA A;  1EH7 A;  2Z3Y A;  4MNU A;  2C6Y A;  1XGS A;  5FRO A;  2L2O A;  1KON A;  3K4K A;  5A2Q Z;  1ZG1 A;  3V7S A;  3IL2 A;  3E5Q A;  2KZG A;  4B4C A;  4G6D A;  2R5Z A;  1EKE A;  1VQ5 I;  3M9A A;  2EV0 A;  4HEA 2;  5FKO A;  2VQL A;  1KZH A;  1S7A A;  3ULQ B;  5LHH A;  2CV1 A;  2STT A;  1TNT A;  2K9S A;  4XOR A;  5D4S A;  1SAU A;  4XRS G;  1W36 D;  3EDP A;  1YJ9 I;  2XAU A;  3FWE A;  5FO5 A;  4KYW A;  3S14 J;  1N25 A;  3Q9V A;  1XGN A;  1J7K A;  2YU3 A;  5KCM A;  1H8A C;  1E2X A;  1HF0 A;  2PI0 A;  2EPF A;  2TDX A;  2VJI A;  3H1C A;  5EGO A;  2MLG A;  3HOZ J;  2EFQ A;  1TQI A;  1VND A;  1GVJ A;  2R0Q C;  3ZQ7 A;  4BL0 B;  2L4A A;  1SEU A;  1P4W A;  4U0Y A;  1XSD A;  1RRJ A;  1VI0 A;  4BNC A;  2EA2 A;  3R60 A;  4BE0 A;  1TLH B;  3V42 A;  1VQ6 I;  1LDK B;  2X9D A;  5CVR A;  1QGP A;  3VFZ A;  3TL4 X;  3VDX A;  1BW5 A;  2JSP A;  2XAQ A;  2QQA A;  4I0A A;  4HX4 A;  1JJ8 C;  2HEO A;  3ZQF A;  3TMO A;  1SVL A;  1BR2 A;  1BC7 C;  1REP C;  5KAF C;  1GVD A;  3L2Q A;  4BBS J;  1WH7 A;  4FET A;  3HKZ A;  1GT0 C;  5L3B A;  5HNH A;  3H35 A;  4DJA A;  1UB9 A;  1R9T J;  2IT0 A;  5LLQ A;  2VKV A;  3JRH A;  3TQN A;  1QO0 D;  4A3J J;  3F8B A;  4BE2 A;  2DYS H;  2FEZ A;  1K7A A;  2QVO A;  3CTA A;  1MBG A;  3MZ8 A;  4UVA A;  3R61 A;  1U3E M;  1JT6 A;  3HKZ N;  5IOZ A;  3DEW A;  3ZCO A;  3WOD F;  2DO7 A;  2MYS A;  3M1C A;  3B73 A;  3ZR8 X;  3D5R C;  4RB3 C;  4YFX F;  4MEY F;  3E97 A;  2FOK A;  3NRV A;  3DBL B;  2FXA A;  1WWX A;  3PQK A;  4CA0 A;  4IEJ A;  3CCL I;  2PJP A;  5DDG A;  1F4K A;  2A05 A;  1VF9 A;  3HGG A;  3W6J B;  1LB2 A;  4I99 C;  2XAF A;  4XON A;  1ZRF A;  2KJB A;  3LOC A;  5D6E A;  3QRF F;  4KNY A;  2E1C A;  3P9K A;  1MGT A;  1IN6 A;  1Y1V J;  5L3C A;  3CCU I;  1QRY A;  2W4S A;  4HZF A;  4LLL A;  3OYK A;  1RC9 A;  3I58 A;  5J3L A;  5FD6 A;  1AA7 A;  4BJT A;  1TT0 A;  2HDD A;  2FBI A;  3HOV J;  2KRH A;  2DJN A;  1JXS A;  3RPQ A;  2FF4 A;  2R7F A;  4KIF A;  4BXU A;  1NG7 A;  3ESW B;  4RB1 A;  2WA0 A;  5IYC J;  4FHT A;  1GUU A;  2BBY A;  2BE5 F;  2VC0 A;  3G1M A;  1D1A A;  3L9F A;  3LQR A;  2NVT J;  2X85 A;  5JHF A;  4UVB A;  3BZC A;  4LIV A;  2MAB A;  1OYW A;  4B09 A;  2MBF A;  3HOX J;  1ACI A;  5JVT A;  2VJJ A;  2IGO A;  1JE8 A;  3S1N J;  4DZJ A;  2M4K A;  4O5V A;  4HAM A;  3CC2 I;  1FLI A;  1D1B A;  1RUN A;  2H09 A;  1SD5 A;  2FQ4 A;  4RS8 A;  3J7Z I;  2W00 A;  3BDD A;  3ONQ A;  4QSH A;  5FGM A;  1R6R A;  2GM4 A;  1K6O A;  5LHI A;  2KIU A;  1U9O A;  1MW7 A;  1W0T A;  3MD2 A;  2D2W A;  4IHY A;  1DP3 A;  1WQ2 A;  1Y0U A;  1WRJ A;  1QVT A;  2COM A;  4I2O A;  3I71 A;  2JPB A;  5F0C A;  3COA C;  2VQG A;  5DM7 F;  1ETW A;  2E2H J;  1IRZ A;  1UG2 A;  3FXJ A;  1GXP A;  4ENK A;  1ZKG A;  1IUF A;  3I56 I;  4FTH A;  1TW3 A;  2VKD A;  3B6A A;  3CMA I;  4IKF A;  3D1N I;  3JAM Z;  1PJR A;  3JRE A;  1YG2 A;  3E0J B;  3JRI A;  1R58 A;  2E1N A;  2K27 A;  4BY1 J;  1ZRC A;  2M0M A;  4Y33 A;  1J09 A;  3M4O J;  4F55 A;  3F8M A;  4NQW A;  1FMW A;  4BUP A;  4RGX A;  1MBK A;  2HI3 A;  4AC0 A;  3V8K A;  3S1M J;  1F43 A;  1J59 A;  2GBY A;  4ASN A;  2F5F A;  4L9J A;  1YFH A;  5FRN A;  3SFI A;  1V5F A;  3K69 A;  3BR3 A;  1HXD A;  3RIR A;  2V9K A;  4XNF A;  4CO8 A;  2Z2S B;  5DYM A;  2ZME A;  1UHM A;  4KMU X;  4A3C J;  4O3M A;  2CUE A;  4OIO F;  2CQQ A;  1RKT A;  1F5T A;  5L3F A;  1RR8 C;  2CS3 A;  4V19 K;  3OYB A;  2Z1D A;  3HJE A;  1VZ0 A;  4NB5 A;  5HLG A;  1O7L A;  2O0Y A;  4M6X A;  3T5X A;  3ZQG A;  4JX6 A;  2MGQ A;  5FKL A;  3BQY A;  2EIK H;  2FUG 2;  1OYI A;  3CUQ B;  1MND A;  3CMY A;  2E19 A;  4QPQ A;  4PK4 A;  4ESF A;  2DJI A;  2ZKZ A;  3NAU A;  4E7H A;  5LEK A;  2L4M A;  4LGW A;  2DTZ A;  4A3M J;  3BPX A;  3HOT A;  2VKE A;  3OYI A;  2KLO A;  3H5A A;  4F7Z A;  2XF6 A;  5IP7 J;  2VBZ A;  3T8T A;  2HVQ A;  2LOO A;  1HKQ A;  3G3Z A;  3OYF A;  3VEP A;  4HLX A;  2ZXW H;  1MZB A;  2HR3 A;  1JKP C;  1Z6T A;  2ME6 A;  3BP8 A;  2OZ6 A;  3C1D A;  2H27 A;  2P6S A;  3NWT A;  2VL8 A;  4NC6 A;  1AU7 A;  2NXN B;  1ZR2 A;  3NAR A;  1UHW A;  2JSC A;  3FKJ A;  2XGC A;  4E4H A;  2QEX I;  1IDY A;  2L7Z A;  2DMT A;  5M5W J;  3ZMU A;  2PN6 A;  2UUZ A;  2ZSH B;  3FX3 A;  2WTE A;  4CYC B;  4AWX B;  3WE2 A;  1O3R A;  2VLA A;  3AG3 H;  5IT3 A;  1LQ1 A;  1R7J A;  2MA3 A;  2K3P A;  1DGR M;  3S1Q J;  2CQX A;  1A04 A;  4HDV A;  1SFK A;  4CDG A;  3CQZ J;  4LG0 A;  2Y0M A;  4Z2Y A;  4E7S A;  3HZJ A;  3CDI A;  3N97 A;  3RYP A;  1V4R A;  2XIG A;  2LRD A;  5JHU A;  2V6C A;  2Y48 A;  2BW3 B;  4H0E A;  3WTV C;  1IJW C;  2A5W A;  1G3Y A;  4LFU A;  3RI4 A;  3I59 B;  3K2A A;  4CUG A;  2ECB A;  5H20 A;  1S29 A;  1ZGW A;  2Q0O A;  3L7W A;  2CUF A;  2XRO A;  4KJZ A;  2KIQ A;  5E3N A;  3CUO A;  2XB5 A;  4XKC A;  5GTI C;  3LNQ A;  1FMV A;  1LJ9 A;  1TBX A;  1IRG A;  4Y17 A;  1VQ4 I;  5ICE A;  2R4G A;  4IZZ A;  2XF5 A;  1ZK8 A;  2E5N A;  4MHG A;  4IVN A;  3BQZ A;  3FBI B;  1YIJ I;  4PGG A;  4KIC A;  3SQN A;  3OS0 A;  2X6W A;  5FLV A;  1WH5 A;  2GZW A;  3LSJ A;  4RLQ A;  5CJ9 A;  2R7W A;  2LF7 A;  4XBF A;  1WJC A;  4IL6 C;  2HPI A;  2V26 A;  1B4A A;  1P6R A;  4PJN A;  3HSE A;  4E7K A;  1SMT A;  2M0C A;  4KUM A;  5E1Z B;  3BG3 A;  3A4C A;  5E1X A;  1HCR A;  2LDU A;  2BXY A;  2BGC A;  2L54 A;  2KFD A;  3CLQ A;  3GFL A;  4F91 B;  3BY6 A;  5CVI A;  5EZH A;  2QSF X;  5BPI A;  2O8K A;  1J5Y A;  1O57 A;  2PEX A;  2M34 A;  3R6S A;  1ITY A;  1KQ8 A;  3ZMT A;  2V1N A;  3BG6 A;  3WTY C;  1IUY A;  2QKM B;  1R5H A;  2KDZ A;  1IN7 A;  5K5O A;  4GRI A;  2OC6 A;  2W85 A;  2PBI A;  3IWF A;  1QA6 A;  4NC7 A;  1QBJ A;  1JUM A;  1QZY A;  1U5T C;  3LFU A;  3C18 A;  3HB9 A;  1Y1W J;  2R5Z B;  3J7A O;  2Y0S A;  3AG2 H;  4DNC A;  2R7Q A;  2PLY A;  2ICW G;  4BS9 A;  4XKV A;  2VT3 A;  3DBH B;  1XSX A;  2K3F A;  2DMN A;  1DPU A;  5FLM J;  1ULY A;  4G9Y A;  3DTE A;  3HHH A;  4QIW N;  3S3M A;  2L9V A;  2Y0S N;  5E79 C;  1I1S A;  2RV8 A;  2E1O A;  3F8N A;  5ED4 A;  3HHG A;  5F08 A;  1APL C;  4A93 J;  2XUB A;  3FHN A;  5EGO B;  5D5U B;  2LD5 A;  1B72 B;  3TW6 A;  1YW9 A;  3U9G A;  4YII A;  2EV5 A;  2AXT C;  2YSR A;  1STZ A;  1UJ8 A;  4II3 A;  3MKL A;  3CME I;  1JKO C;  5D6F A;  5H6Q A;  1VQ8 I;  2VC1 A;  4HPQ A;  2Y69 H;  3K0L A;  2W1O A;  3VYR B;  5EEA A;  4AIK A;  3RKQ A;  2Q2E A;  2XAG A;  5C44 J;  2X0L A;  2XB0 X;  3BZ6 A;  4AID A;  1FT9 A;  1IXS B;  3RJP A;  5BS6 A;  1GV5 A;  2KDO A;  3G4S I;  5LGT A;  4K2E A;  5FLX Z;  4PFP A;  4UHT A;  5IOY A;  3KX2 A;  3H92 A;  1MMG A;  1N78 A;  2R7V A;  1MSE C;  3K9T A;  4KA4 A;  4KDP A;  4IXA A;  5K1Y A;  1KQ0 A;  3PO3 J;  2A6T A;  1FC3 A;  2RNJ A;  3P5J A;  3UKG A;  4L0Z B;  2ESH A;  1VTN C;  1U8B A;  1BC8 C;  1E3P A;  2LLK A;  3HGY A;  1XN7 A;  1JHF A;  4M3F A;  5CVV A;  3OR1 C;  3FXU A;  1G3S A;  2Y31 A;  1XB4 A;  3CC4 I;  1CGP A;  3DKY A;  3GXO A;  2CMP A;  4EEF G;  4M3D A;  4EVI A;  2E7W A;  2LKS A;  4BJ6 C;  3JTG A;  2HDC A;  4WX9 A;  4M9X A;  4A3K J;  2VOD A;  2GA2 A;  2BVM A;  4FIS A;  2FNA A;  2B7E A;  3C2B A;  1V5G A;  3GVA A;  5FKM A;  2DFE A;  2DT5 A;  3DWL E;  4UXN A;  1OPC A;  2MH9 A;  3LSG A;  3V4G A;  3BG5 A;  3JSO A;  4HW0 A;  4N9I A;  2DAO A;  3D5L A;  3RQI A;  1C0W A;  1X1C A;  3DPU A;  4ZC3 A;  1BR4 A;  2QBY A;  1IRF A;  4XMY A;  3SHF A;  5JI6 A;  4L9T A;  1P92 A;  2PX9 A;  4XK4 A;  1BI2 A;  1U0J A;  2NS0 A;  3K4C A;  2VBY A;  3D5S C;  2VN2 A;  2UV1 A;  5HOO A;  3LSI A;  3J80 K;  2ZBK A;  1TT5 B;  2XAS A;  3SYT A;  4XLH A;  2M2E A;  2A3S A;  4RM2 A;  3K7A J;  3CF5 F;  4P55 A;  2M4G A;  2X6X A;  4M72 A;  3RZD J;  3HTU A;  2FSW A;  2HQA A;  3PNT A;  4HA8 A;  3DTK A;  4XSX F;  3GZN B;  2VE9 A;  1J75 A;  3HUG B;  1MMA A;  1K61 A;  1WJB A;  4NC8 A;  1G4D A;  4HNV A;  2DOE A;  4X1E A;  4HRI A;  4GGG A;  4IF4 A;  3NWS A;  2K40 A;  2NNN A;  4XID A;  1KU7 A;  1E3O C;  4XN3 A;  1R36 A;  2LNB A;  4U88 A;  3ZN0 A;  2GWR A;  2L5Q A;  1FX7 A;  1J2X A;  3BTJ A;  3IH2 A;  2Q8K A;  2A68 F;  4UB8 C;  4HLY A;  2TCT A;  3HRM A;  4DOZ A;  1B8I A;  3SDB A;  3JRC A;  2VXZ A;  4LIU A;  4R8H A;  2F5C A;  4ZTF A;  1T38 A;  3OIP A;  4XLE A;  2CU7 A;  2VBW A;  3FXM A;  4HQE A;  1JT0 A;  1Y8Q B;  1FOW A;  2WAE A;  1ZRE A;  2Y75 A;  3LA7 A;  3IHU A;  5HLI A;  4BXF A;  2M5W A;  1TWF J;  1W5S A;  1WI3 A;  3BR5 A;  3WE3 A;  3CF2 A;  4Q48 A;  4GDF A;  1IG7 A;  1ZRD A;  3OR2 C;  3EET A;  4OIN F;  4NQW B;  1T08 B;  4UV9 A;  3KYD B;  5BNG A;  3MQ0 A;  1IZ1 A;  3P9C A;  5DD8 A;  2HOE A;  4CCL A;  2MG4 A;  3H3U A;  5GAD J;  4DIQ A;  2Z9O A;  2WV0 A;  4HNU A;  5LEJ A;  4ON0 A;  3IV5 A;  2DLL A;  3QP6 A;  4CZZ A;  1U9N A;  4BDZ A;  2DU9 A;  1GXQ A;  4MFE A;  1WSU A;  2LYC A;  1HW1 A;  1Q1V A;  3FXR A;  4RB2 C;  4I01 A;  2FQ3 A;  2XC7 A;  4BHP A;  1W7P B;  3DU6 A;  2P4W A;  4MO7 A;  5F1J A;  1FBQ A;  5E8G A;  1X58 A;  3E6C C;  4IHX A;  1QVU A;  2ID3 A;  4GFB A;  2V9P A;  3DTI A;  2ZME B;  2KP6 A;  3MN2 A;  2VIX A;  5ILU A;  4PSX A;  1HDD C;  2EZI A;  4PZJ A;  2L7K A;  2V6E A;  5D8K B;  3WU0 A;  2AQE A;  1ON1 A;  2HKX A;  1IV6 A;  1TWC J;  1F1Z A;  1ZQ3 P;  5IP6 A;  5JLX A;  2EWN A;  3DLL F;  5JFR A;  2KRC A;  1IRX A;  1MBE A;  2M8G X;  4CYD A;  2I8D A;  2JQ7 A;  3CJN A;  2ESN A;  3I55 I;  4U7B A;  3OV8 A;  2ELH A;  1OKR A;  4C3J J;  1LDD A;  2BXZ A;  2JA7 J;  5J1Y A;  4EM1 A;  2UZK A;  2E60 A;  2R7U A;  1S5L C;  1ZAR A;  2AS5 F;  3NQO A;  5DV5 A;  5KVR A;  3ASO H;  5B5E C;  3GFI A;  3S3N A;  2D45 A;  3KP3 A;  2EZL A;  5J8C A;  1XC5 A;  2QYO A;  5ICC A;  1ZG3 A;  4II2 A;  5GTH C;  3WGH A;  3U1D A;  4RGR A;  2NVQ J;  2JMW A;  2J5P A;  4C3H J;  4EJU A;  3ERE D;  2XRN A;  1WJ5 A;  5TGT A;  3C2H A;  2XF7 A;  4FE4 A;  1G6N A;  2QA4 I;  2P5L C;  3CDL A;  4FCY A;  1FTZ A;  2DMU A;  5LBQ A;  3FXK A;  2O03 A;  3KP6 A;  3HOW J;  2A5Y B;  1X19 A;  1FZP B;  2HVS A;  1IO2 A;  4A0X A;  3BG7 A;  1J9I A;  1FBU A;  2W57 A;  2OCC H;  4A0Y A;  4RAY A;  5H2F C;  2A69 F;  1A36 A;  3CMM A;  4Y13 A;  3H5R A;  1WJE A;  3K4M A;  4XKW A;  3CZ6 A;  3W2A A;  1N77 A;  1WPK A;  2QLZ A;  2CV0 A;  1EH6 A;  4A3F J;  2HYJ A;  4HOB A;  3WTU C;  1Z6R A;  2RDP A;  3J81 Z;  3SEQ A;  2F2E A;  1HKS A;  2V79 A;  5F27 A;  4XLF A;  2W84 A;  2JTV A;  4MQ9 F;  4V2F A;  3OYH A;  4BQA A;  5CLS A;  2BY0 A;  4Y4R A;  2R93 J;  5E3M A;  1MMS A;  5HOD A;  3BR0 A;  5C4J J;  2X1E A;  2PMU A;  4UV8 A;  3JRG A;  3OYD A;  3OYC A;  4OOI A;  4WXH A;  1FIA A;  3VYT B;  1TC3 C;  3B02 A;  3RKW A;  5JVG F;  4A3G J;  5F0F A;  5FJ8 J;  4EAT A;  1LFU P;  3GFM A;  1ZH5 A;  2WAF A;  2EQR A;  2E2I J;  3WU1 B;  2NNY A;  2ZCW A;  1D8K A;  1G3T A;  1QZZ A;  2ZXH A;  2GOX B;  1OCO H;  2Z5U A;  1WI9 A;  3M8F A;  5M3F J;  2BVL A;  4XL9 A;  2B9S A;  2ZC2 A;  3FK7 A;  1FTT A;  5EJC A;  4DZP A;  4EGY A;  1Z67 A;  2JA2 A;  2WY7 Q;  1TZL A;  2JUC A;  3BJ6 A;  3LWF A;  5J8F A;  5CPR B;  3HPG A;  5IT9 Z;  3EPZ A;  2VJ4 A;  1R5G A;  3CUQ C;  1X3Z B;  4OU0 A;  5J47 A;  4G94 A;  3GTG J;  3E3V A;  1MJB A;  2OZU A;  3OOU A;  3LSP A;  2DCE A;  1R1U A;  2JVH A;  3BWG A;  3I9V 2;  3LAP A;  1FJL A;  4A0Z A;  1YHQ I;  1AHD P;  2P81 A;  4OAZ A;  4BBR J;  5A2Q K;  4XLA A;  1OMI A;  4KN7 X;  4AYB A;  3TOB A;  2IGK A;  3KZI C;  1Z0X A;  5M5Y J;  5F04 A;  1FSE A;  3ZP5 A;  5F64 A;  1H9G A;  5HS9 A;  4BAC A;  5IPA A;  2JZY A;  3V8L A;  2VB6 A;  1HA8 A;  1E3H A;  2H94 A;  4N4N B;  1FYM A;  2E35 A;  1XG1 A;  4AYB N;  4CSW A;  2LKX A;  1TL8 A;  3K70 D;  3CP8 A;  4S0H B;  2ISZ A;  1H89 C;  1MMN A;  2MH2 A;  4OIR F;  2ZJ2 A;  3EUH C;  5CQG A;  1YYV A;  4JOM A;  4YEJ A;  4EJV A;  1TWG J;  1AKH A;  2H1K A;  3HOY J;  4OMY A;  1YQA A;  3HRT A;  2K02 A;  2ZB9 A;  1A5J A;  4A12 A;  2H6C A;  1NK2 P;  3PUB A;  4QLC U;  4WXD A;  4HYE A;  3A01 A;  3CCY A;  1H0M A;  1S7O A;  2HNH A;  2Q2E B;  4XRM A;  4BGD A;  4A2U A;  1Y0N A;  4D7N A;  1VQP I;  2RGV A;  1OR7 A;  4F52 A;  5E17 F;  2OTJ I;  2G7U A;  1MBJ A;  4ETS A;  4WK8 F;  1FNN A;  3RKY A;  2R7X A;  1E17 A;  2X51 A;  1OCR H;  4Y15 A;  4DYC A;  2V7F A;  4LB6 B;  3DKX A;  2OJE D;  2NOJ B;  5CYV A;  4EQQ A;  4BYY A;  5EEH A;  3MVP A;  3GBG A;  3DU5 A;  1XSV A;  3KP2 A;  2WB1 A;  4DW6 A;  1I5Z A;  3GTP J;  1SVM A;  2L01 A;  4UB6 C;  2HOT A;  5BQT A;  1V3F A;  4A3B J;  4ESB A;  4LMY A;  1UHS A;  2E1M B;  2JA6 J;  2BYV E;  2M87 A;  4E7I A;  2R5Y A;  3GZ6 A;  4ZYE A;  3FF5 A;  4CHU A;  3FM3 A;  3HSF A;  1U2W A;  2DXI A;  3W3C A;  2WB1 N;  3PFI A;  1T0F A;  1IN8 A;  1GHC A;  2EIM H;  2KJC A;  1VQN I;  1PDN C;  4DGW B;  1B6A A;  4M73 A;  3HIF A;  3E1S A;  3CCM I;  4YFK F;  2R7D A;  1QHH D;  3CCJ I;  1JTX A;  1WCM J;  3L1P A;  1U6G A;  1MH4 A;  2HDW A;  4HNT A;  3FIS A;  3KZZ A;  4B1R A;  5E8I A;  4PJM A;  3TP0 A;  4D5C A;  2QBY B;  5CKT A;  4BHB A;  1T95 A;  1XCV A;  4EM2 A;  3AG4 H;  1BI0 A;  1ZGJ A;  5K5Q A;  2KZV A;  4C2U A;  1HKT A;  4XKB A;  3AFH A;  1HOM A;  1TQM A;  3F21 A;  1SAX A;  1BN5 A;  1JUP A;  3BR1 A;  2RRE A;  2B0L A;  5DD4 A;  3A2K A;  1KU3 A;  4PFO A;  1KYZ A;  4N0B A;  2RVC A;  3SZP A;  2HZT A;  3EYI A;  3TW7 A;  2FBK A;  4L5J A;  5AON A;  3U1K A;  4C9Y A;  4IHS A;  3DPT A;  4RGU A;  5DTD A;  2CFO A;  2FML A;  1ZN2 A;  1QU3 A;  4GXO A;  2MD5 A;  3IRQ A;  4IQ4 A;  1VQL I;  2K9Q A;  3R0A A;  2PQ8 A;  2FD5 A;  3HG9 A;  4C2M J;  5DS9 A;  3J7Y J;  1IC8 A;  4EJO A;  4R79 A;  1PP7 U;  3GCM A;  2P5V A;  4ENM A;  3GUD A;  1SD6 A;  1YI2 I;  4P9F A;  5JR3 A;  4S05 A;  1F36 A;  2DTR A;  2F5V A;  1MMD A;  3CES A;  3F8F A;  3OSG A;  4BE1 A;  2IGM A;  4HBL A;  3CCQ I;  3H9J A;  2OV7 A;  1WHU A;  2O6G E;  5EG0 A;  2IXS A;  1IV8 A;  4BU2 A;  2QUF A;  5TJJ A;  2BOL A;  1Z7L A;  3BZK A;  3CJR B;  1B8I B;  1X3U A;  1T39 A;  3T0Y A;  3L09 A;  3NEU A;  1O7F A;  2O7O A;  2IS1 A;  1KU9 A;  2F4I A;  1NTC A;  2KRF A;  2YUS A;  2OUM A;  3QYE A;  3KP5 A;  3RQ4 A;  3OS2 A;  1HLV A;  1ETV A;  2VOO A;  2DDA A;  2JUG A;  2CW7 A;  4J19 A;  3M07 A;  3G6E I;  1RI7 A;  3GTL J;  1I27 A;  5EYR A;  1MDM A;  2I5U A;  2EB7 A;  5DCM B;  4NBQ A;  1YTY A;  2UXN A;  1R1V A;  2HYG D;  3JAM K;  1G2H A;  3JR9 A;  2P7C B;  2LRE A;  1D8J A;  2HGC A;  2OAZ A;  3OIQ A;  2IA1 A;  4JK1 X;  4QWQ A;  4ENJ A;  3MCZ A;  3Q0V A;  4BEH A;  2JN6 A;  4QTR A;  1X4P A;  2RNG A;  4GO1 A;  4L5I A;  4ITV A;  1G8X A;  1JUS A;  3L00 A;  5HDG A;  2NS7 A;  4XLC A;  2G9W A;  3GLX A;  4UUS B;  3KP4 A;  5BPD A;  3SXY A;  1DPR A;  2LBF A;  3Q9S A;  3G1L A;  3JRF A;  1IAW A;  3ISP A;  5L3G A;  3B6C A;  3ZOB A;  4Y52 J;  1WGX A;  3L2U A;  1BIA A;  4A3I J;  2Y2Z A;  4BAY A;  3T1B A;  3VYU B;  1BR1 A;  2A61 A;  2HYF A;  4HF2 A;  3FXO A;  4LG3 A;  2IS2 A;  1KQ9 A;  3LSM A;  3DF8 A;  3D0S A;  3VYS B;  2A07 F;  2CSO A;  3TO9 A;  1MKM A;  1RET A;  1K6Y A;  2V1X A;  2LFB A;  4E6K G;  2XGD A;  1OCT C;  3H0G J;  3ABL H;  2QQ9 A;  1USS A;  1B59 A;  1ENH A;  1DU6 A;  1IXC A;  3PIP F;  1UZC A;  5B1B H;  2BY2 A;  3ECO A;  5EEG A;  1BBY A;  4CCK A;  5ILS A;  2ZJP F;  1Z91 A;  2NVY J;  5LFA A;  4IQJ A;  2LK2 A;  2ZFU A;  4X0G A;  2AHQ A;  2F4M B;  2CQN A;  4B3X A;  4IX7 A;  1O4X A;  4KMF A;  2FJ1 A;  1FOY A;  3CCS I;  3WTS C;  1ERD A;  4CXF A;  2M1B A;  3DV8 A;  1ETQ A;  1P7I A;  1MNE A;  3FKI J;  4LK0 F;  4BHC A;  1CQT A;  2EFO A;  1FY7 A;  4M6V A;  4CGZ A;  2DDB A;  1SVO A;  2HFH A;  5GAE J;  2Y9Z A;  3MWM A;  1QZE A;  5HDK A;  2DFF A;  3WTT C;  2X1D A;  5LRR A;  3ZMZ A;  1Y56 A;  4YFN F; 
#chains in the Genus database with same CATH homology
 2HKO A;  4ENN A;  3ZMS A;  3RYR A;  2HWV A;  5DEQ A;  1QNT A;  4PCQ A;  3MZY A;  3H3Z A;  2FBH A;  3FMQ A;  2X4H A;  1SD7 A;  4E70 A;  3TO7 A;  2IP2 A;  2LSO A;  5E20 A;  2NYX A;  3FXQ A;  2ISY A;  3O6B B;  4M74 A;  2CO5 A;  5HDN A;  3WTW C;  1R1T A;  5F1R A;  2HTJ A;  4EJT A;  5D5V B;  1Z1D A;  2HQR A;  3WTZ A;  3C7J A;  3BJA A;  4ESJ A;  3GFJ A;  1NHA A;  3RKX A;  2UWM A;  4IRG A;  4IRI A;  2F5D A;  1YLF A;  1EV7 A;  1S3J A;  2IA0 A;  1MJ9 A;  2IVM A;  2FMY A;  5LHG A;  2OD5 A;  4PDK A;  2DPD A;  3EYY A;  3ECH A;  3GF2 A;  2O61 A;  3V7R A;  1B9M A;  1K78 A;  1D3Y A;  5ICG A;  4EGZ A;  2XV4 S;  3F3X A;  4RB0 A;  3TKY A;  1ON2 A;  1TQP A;  1XDS A;  2DQR A;  3VOE A;  2CGP A;  1HW5 A;  3CO6 C;  4IJA A;  4P5O A;  4L0Y B;  2QWW A;  2A6H F;  5D5W B;  2GAU A;  1SFE A;  2DFI A;  2R3S A;  1G3W A;  2G7H A;  4FX4 A;  1LVA A;  4HX7 A;  3GWZ A;  3E6B A;  5FLX K;  1BIB A;  4PGH A;  2DI3 A;  3KP7 A;  4IHT A;  2HTS A;  5LGU A;  1KGS A;  1IN5 A;  2XKP A;  3QU3 A;  4M71 A;  4YIF A;  5FFX A;  5CVJ A;  4BH9 A;  2V1D A;  3S2W A;  2RC4 A;  1T6S A;  4ZZD A;  3DPL C;  4D0P A;  1O3Q A;  2EK5 A;  2NRA C;  2EV6 A;  2YX7 A;  2OA4 A;  5D8L B;  3F6V A;  6PAX A;  1BM9 A;  2EFN A;  4Q5S F;  1P2F A;  1TTY A;  2A6E F;  4EMS A;  3ZN1 A;  2MC3 A;  4EJW A;  1HST A;  1Z7U A;  4M9Z A;  5FD5 A;  3REO A;  2Z33 A;  3ML6 A;  1Q1H A;  3I5U A;  2L02 A;  3IKT A;  4HF0 A;  3KLO A;  2EJR A;  2V1U A;  1K79 A;  4HQM A;  3U2R A;  4GYI A;  3ABU A;  1RUO A;  1JHH A;  3MEX A;  3BOQ A;  1FYK A;  4LLN A;  2DBB A;  2ZO4 A;  2KIF A;  3IKV A;  1ZAO A;  5DUI A;  3WG9 A;  2HQN A;  1LEB A;  3AAF A;  3TDZ C;  3TDU C;  4ZYG A;  4WWC A;  5H6R A;  3LA3 A;  3W6K B;  1T2K A;  1RNL A;  2D1V A;  3R0J A;  2OQG A;  1XCB A;  3K1N A;  3HTS B;  1CF7 A;  2EA4 A;  1XD7 A;  5TRD A;  1MDM B;  2DK8 A;  4RGS A;  2DK5 A;  4LG0 B;  2GQQ A;  1AWC A;  2NAZ A;  2FRH A;  2V9V A;  1SFX A;  2QQB A;  4WF2 A;  3HOS A;  1RZ4 A;  1XGO A;  2W25 A;  2XHK A;  1LDJ A;  4G8X A;  2P5K A;  1U8R A;  2XGX A;  4LJZ F;  5D4R A;  3F22 A;  3FHZ A;  1L0O C;  2HS5 A;  2P8T A;  4ZYH A;  2J5O A;  4I98 B;  1Z9C A;  1ODD A;  5CVU A;  1IW7 F;  1FP1 D;  3ELK A;  4AIJ A;  4B8X A;  1UCR A;  2FA5 A;  5L3D A;  2YR2 A;  3F8C A;  4I09 A;  3HRS A;  2IPQ X;  5E1W A;  2AXL A;  4HX8 A;  4KN4 X;  4AIH A;  4HV5 A;  1YS6 A;  3V7C A;  2VOP A;  4G7Z F;  3KEO A;  4M6Y A;  1ZG5 A;  2VE8 A;  3QAH A;  1KU2 A;  2IRF G;  1OYY A;  1R00 A;  3I53 A;  4L9N A;  4RAZ A;  5K5R A;  4ZYD A;  3LST A;  3QOP A;  2P7V B;  2KIM A;  2P6T A;  3HSR A;  5HS8 A;  3M7G A;  1R22 A;  2QZ8 A;  1YW7 A;  4Q47 A;  3TGN A;  4LLG F;  3J81 K;  4G7O F;  3DFG A;  2IJL A;  4GCV A;  3VB2 A;  2YPR A;  2M30 A;  5LGN A;  3OOP A;  5KK1 A;  1I1G A;  1HW2 A;  3ZMD A;  1TNS A;  2VON A;  2BEO A;  4LB5 A;  3HUG A;  5HS7 A;  1SFU A;  3O2P E;  2VBX A;  2Z99 A;  4KFC A;  1U5T A;  4U7D A;  3I4P A;  1FYL A;  5HLH A;  4MTD A;  2PFB A;  5ILV A;  3QU6 A;  4OIP F;  3I0T A;  4U0W A;  1P4A A;  3KCC A;  5ERI A;  2YX4 A;  4O6J A;  3SFZ A;  2DPU A;  3T8R A;  5IT9 K;  2XAH A;  2H6B A;  3FZV A;  1YIO A;  3BPV A;  4FT8 A;  2GIV A;  3HRU A;  4KIG A;  2ACJ A;  3MFK A;  2OU2 A;  2O8X A;  4AVP A;  1K78 B;  2OQR A;  3RPU A;  1SMY F;  3Q5F A;  1QPM A;  4G7H F;  3K1M A;  1DDN A;  1ZGA A;  1SD4 A;  2ZXJ A;  4HDU A;  2D1H A;  3DP7 A;  4KT5 C;  1W7P A;  1XDU A;  3DQV C;  4I7H A;  3DEU A;  1XGM A;  2O3F A;  2FNP A;  5FFZ A;  3ZMV A;  2OBP A;  4HF1 A;  4A5M A;  2KKO A;  3R4K A;  4I0B A;  1S6L A;  4I02 A;  4L18 B;  4UNO A;  5DCF A;  4XLP F;  2QEN A;  3I54 A;  2WC2 A;  1U78 A;  3FMS A;  1W5T A;  1HQC A;  3GEZ A;  4JBA A;  4NHJ A;  4OMZ A;  4JQF A;  3TO6 A;  1R23 A;  3TOA A;  2QM3 A;  1P4X A;  3GW2 A;  2ZNZ A;  3IC7 A;  4EM0 B;  3KZY A;  2JT1 A;  4M9S A;  3L2C A;  3N4M A;  1B1B A;  1LEA A;  1QQI A;  4HV6 A;  2CYY A;  4XLN F;  2JRT A;  5F6F A;  2STW A;  2FU4 A;  3HYI A;  3GZ5 A;  1KYW A;  3E6M A;  3EQL F;  3LA2 A;  2F5E A;  1ZLJ A;  4S04 A;  1ZYR F;  1DUX C;  1BI3 A;  3BRO A;  2LKP A;  1H9T A;  3DKW A;  1HSJ A;  2RKH A;  2JPC A;  3BJO A;  4A5N A;  5LRS A;  3IRR A;  3P7N A;  1KA8 A;  3M8E A;  3ROU A;  1CF7 B;  1PUE E;  4G6Q A;  3RTR A;  1TW2 A;  2W24 A;  3E6D A;  3O3K A;  1FPQ A;  1PP8 F;  5AIQ A;  4KIB A;  1W4M A;  3KEQ A;  3IWZ A;  2M45 A;  2EFP A;  4UUV A;  2ZFW A;  2K7L A;  3WGI A;  3CLO A;  4ZZL A;  3KET A;  3QP5 A;  3J80 Z;  4P96 A;  1XMA A;  1B9N A;  4UVC A;  1MD0 A;  3KFW X;  5FB2 A;  2GXB A;  1I6X A;  3V8J A;  2ADU A;  2DW4 A;  2CFX A;  3I64 A;  1RIO H;  4IRH A;  2MLK A;  4XRF A;  5BMZ A;  4TV7 A;  3RDI A;  3FM5 A;  1UST A;  3LQQ A;  3K2Z A;  4N9H A;  2WWY A;  5D5X B;  4A6D A;  3PQJ A;  2K4J A;  1FP2 A;  4MTE A;  2GA1 A;  2IW5 A;  2XKO A;  2ZNY A;  3CDH A;  1FBS A;  1MJA A;  3WGG A;  4U0V A;  1S8N A;  4OIQ F;  4GYG A;  2IA2 A;  1BI1 A;  4P9U A;  1IF1 A;  3GO5 A;  2XAJ A;  1F9N A;  2DQL A;  4Q4Z F;  3ZPL A;  3GYH X;  3M1E A;  4DQ2 A;  1FSH A;  1ZHF A;  2ETH A;  3G73 A;  4LK1 F;  4WCG A;  1D5V A;  5J6X A;  2RN7 A;  2VT2 A;  1DP7 P;  3JW4 A;  1UFM A;  2CWE A;  1YO5 C;  3P9I A;  3JSP A;  4R1H A;  3F72 A;  4L9V A;  1BOA A;  5DUK A;  3CO7 C;  3ABT A;  5HVQ C;  3SZT A;  2L3D A;  1EH8 A;  2RQP A;  1T98 A;  3GX4 X;  3CUQ A;  2PMH A;  1XMK A;  1YW8 A;  3K1P A;  1LNW A;  1U5T B;  1YS7 A;  5E18 F;  4LD5 A;  4FX0 A;  4EV0 A;  3DXJ F;  2CQK A;  3WTX C;  2E7X A;  3F23 A;  2GXG A;  1O3S A;  1FOK A;  1WKM A;  2BV6 A;  2CG4 A;  3F6O A;  3VOD A;  2UXX A;  1IN4 A;  4AD9 A;  3EUH A;  3KLN A;  3MZH A;  4MQV A;  4A6E A;  4XSZ F;  5DCM A;  1W7P D;  1BJA A;  1ONV A;  2K86 A;  2FE3 A;  2CW0 F;  3JTH A;  4MGR A;  1JGS A;  2K4B A;  3MAJ A;  1J0R A;  3E5X A;  3E5U A;  4WXC A;  5ICF A;  4CIC A;  2EFW A;  3QPT A;  3I59 A;  1O3T A;  3FMR A;  1FWZ A;  4ZH4 F;  1HBX G;  2LF8 A;  1AOY A;  3KE2 A;  5BOX A;  2M8E A;  4MEX F;  2XVC A;  3C3W A;  1Z05 A;  2PG4 A;  5L3E A;  3LAJ A;  1L3L A;  1IXR C;  3QPH A;  3LFK A;  4YG2 F;  1ZLK A;  5AIP A;  4IPA A;  1EH7 A;  2Z3Y A;  4MNU A;  2C6Y A;  1XGS A;  1ZG1 A;  5A2Q Z;  3V7S A;  3IL2 A;  3E5Q A;  4G6D A;  3M9A A;  2EV0 A;  1S7A A;  3ULQ B;  5LHH A;  2STT A;  1TNT A;  5D4S A;  3EDP A;  3FWE A;  5FO5 A;  4KYW A;  3Q9V A;  1XGN A;  1J7K A;  2YU3 A;  2PI0 A;  1E2X A;  2TDX A;  2MLG A;  2EFQ A;  1TQI A;  1GVJ A;  3ZQ7 A;  2L4A A;  1P4W A;  4U0Y A;  1XSD A;  4BNC A;  2EA2 A;  3R60 A;  1TLH B;  1LDK B;  5CVR A;  1QGP A;  3VFZ A;  2XAQ A;  2QQA A;  4I0A A;  4HX4 A;  2HEO A;  1BC7 C;  1REP C;  5L3B A;  1UB9 A;  2IT0 A;  5LLQ A;  3TQN A;  1QO0 D;  3F8B A;  2FEZ A;  1K7A A;  2QVO A;  3CTA A;  4UVA A;  1U3E M;  3R61 A;  3WOD F;  2DO7 A;  3B73 A;  4RB3 C;  4YFX F;  4MEY F;  3E97 A;  2FOK A;  3NRV A;  2FXA A;  1WWX A;  3PQK A;  2PJP A;  5DDG A;  1F4K A;  3W6J B;  1LB2 A;  2XAF A;  1ZRF A;  2KJB A;  5D6E A;  3QRF F;  4KNY A;  2E1C A;  3P9K A;  1MGT A;  1IN6 A;  5L3C A;  4HZF A;  4LLL A;  3I58 A;  5FD6 A;  2FBI A;  1JXS A;  3RPQ A;  2FF4 A;  2R7F A;  4KIF A;  4BXU A;  4RB1 A;  4FHT A;  2BBY A;  2BE5 F;  2VC0 A;  3L9F A;  3LQR A;  4UVB A;  1OYW A;  4B09 A;  2MBF A;  5JVT A;  1JE8 A;  4O5V A;  4HAM A;  1FLI A;  1RUN A;  2H09 A;  1SD5 A;  4RS8 A;  3BDD A;  5FGM A;  1K6O A;  5LHI A;  2KIU A;  2D2W A;  2COM A;  1WQ2 A;  1WRJ A;  1Y0U A;  4I2O A;  3I71 A;  2JPB A;  3COA C;  1GXP A;  4ENK A;  1TW3 A;  3JAM Z;  1YG2 A;  1R58 A;  2E1N A;  2K27 A;  1ZRC A;  3F8M A;  4NQW A;  4RGX A;  3V8K A;  1J59 A;  4ASN A;  2F5F A;  4L9J A;  1YFH A;  3K69 A;  1HXD A;  3RIR A;  4CO8 A;  5DYM A;  2ZME A;  1UHM A;  4KMU X;  4O3M A;  4OIO F;  1F5T A;  5L3F A;  4NB5 A;  5HLG A;  1O7L A;  2O0Y A;  4M6X A;  3T5X A;  1OYI A;  3CUQ B;  4ESF A;  2ZKZ A;  5LEK A;  2L4M A;  4LGW A;  3BPX A;  3HOT A;  4F7Z A;  2VBZ A;  3T8T A;  3G3Z A;  1HKQ A;  3VEP A;  4HLX A;  1MZB A;  2HR3 A;  1Z6T A;  3BP8 A;  2OZ6 A;  3C1D A;  2H27 A;  2P6S A;  1UHW A;  2JSC A;  3ZMU A;  2PN6 A;  3FX3 A;  2WTE A;  4AWX B;  3WE2 A;  1O3R A;  5IT3 A;  1LQ1 A;  1R7J A;  2MA3 A;  1A04 A;  4HDV A;  4CDG A;  4LG0 A;  2Y0M A;  4Z2Y A;  3N97 A;  3RYP A;  1V4R A;  2XIG A;  5JHU A;  2V6C A;  2Y48 A;  4H0E A;  3WTV C;  1G3Y A;  4LFU A;  3RI4 A;  3I59 B;  5H20 A;  1S29 A;  2Q0O A;  3L7W A;  2XRO A;  3CUO A;  1LJ9 A;  1TBX A;  1IRG A;  4Y17 A;  5ICE A;  4MHG A;  4IVN A;  4PGG A;  4KIC A;  3SQN A;  2GZW A;  5CJ9 A;  2LF7 A;  4XBF A;  1B4A A;  1P6R A;  3HSE A;  1SMT A;  4KUM A;  5E1Z B;  5E1X A;  2LDU A;  2BGC A;  2L54 A;  3GFL A;  3BY6 A;  5CVI A;  5BPI A;  1J5Y A;  1O57 A;  2PEX A;  3R6S A;  1KQ8 A;  3ZMT A;  3WTY C;  1IUY A;  1R5H A;  1IN7 A;  5K5O A;  2W85 A;  2PBI A;  3IWF A;  1QBJ A;  1QZY A;  1U5T C;  3C18 A;  3J7A O;  4DNC A;  2PLY A;  2VT3 A;  1XSX A;  1DPU A;  1ULY A;  4G9Y A;  3HHH A;  1I1S A;  2RV8 A;  3F8N A;  5ED4 A;  3HHG A;  2XUB A;  5D5U B;  1YW9 A;  3U9G A;  4YII A;  2EV5 A;  2YSR A;  1STZ A;  5D6F A;  5H6Q A;  2VC1 A;  3K0L A;  4AIK A;  2Q2E A;  2XAG A;  2X0L A;  3BZ6 A;  1FT9 A;  1IXS B;  3RJP A;  5BS6 A;  5LGT A;  4K2E A;  5FLX Z;  4UHT A;  3H92 A;  3K9T A;  4KA4 A;  4KDP A;  4IXA A;  5K1Y A;  1KQ0 A;  1FC3 A;  2RNJ A;  4L0Z B;  2ESH A;  1VTN C;  1BC8 C;  1XN7 A;  1JHF A;  5CVV A;  3FXU A;  1G3S A;  1XB4 A;  1CGP A;  3GXO A;  4EVI A;  2E7W A;  3JTG A;  2HDC A;  4WX9 A;  4M9X A;  2VOD A;  2GA2 A;  2FNA A;  3GVA A;  2DT5 A;  4UXN A;  1OPC A;  2MH9 A;  3V4G A;  3JSO A;  4HW0 A;  4N9I A;  2DAO A;  3D5L A;  1C0W A;  2QBY A;  1IRF A;  3SHF A;  5JI6 A;  4L9T A;  1P92 A;  1BI2 A;  2NS0 A;  2VBY A;  2VN2 A;  5HOO A;  3J80 K;  2ZBK A;  2XAS A;  2A3S A;  4P55 A;  4M72 A;  3HTU A;  2FSW A;  4HA8 A;  4XSX F;  2VE9 A;  1J75 A;  1G4D A;  4GGG A;  4IF4 A;  2NNN A;  1KU7 A;  1R36 A;  2LNB A;  4U88 A;  3ZN0 A;  2GWR A;  1FX7 A;  1J2X A;  2Q8K A;  2A68 F;  4HLY A;  3HRM A;  2VXZ A;  4R8H A;  2F5C A;  1T38 A;  2VBW A;  4HQE A;  1ZRE A;  2Y75 A;  3LA7 A;  3IHU A;  5HLI A;  2M5W A;  1W5S A;  3WE3 A;  4Q48 A;  1ZRD A;  4OIN F;  3EET A;  4UV9 A;  3MQ0 A;  1IZ1 A;  3P9C A;  5DD8 A;  2HOE A;  3H3U A;  2Z9O A;  2WV0 A;  5LEJ A;  4ON0 A;  2DLL A;  3QP6 A;  4CZZ A;  2DU9 A;  1GXQ A;  1WSU A;  1HW1 A;  3FXR A;  4RB2 C;  4I01 A;  2FQ3 A;  4BHP A;  1W7P B;  2P4W A;  1FBQ A;  5E8G A;  3E6C C;  2ZME B;  5ILU A;  4PZJ A;  5D8K B;  3WU0 A;  2HKX A;  1ON1 A;  1F1Z A;  2EWN A;  5JFR A;  4CYD A;  3CJN A;  2ESN A;  4U7B A;  3OV8 A;  2ELH A;  1OKR A;  1LDD A;  4EM1 A;  2UZK A;  1ZAR A;  2AS5 F;  3NQO A;  5DV5 A;  5KVR A;  3GFI A;  2D45 A;  3KP3 A;  5J8C A;  2QYO A;  5ICC A;  1ZG3 A;  3WGH A;  3U1D A;  4RGR A;  2J5P A;  4EJU A;  3ERE D;  2XRN A;  1G6N A;  2P5L C;  5LBQ A;  2O03 A;  3KP6 A;  2A5Y B;  1FZP B;  4A0X A;  1J9I A;  1FBU A;  2W57 A;  4A0Y A;  4RAY A;  2A69 F;  4Y13 A;  2QLZ A;  1EH6 A;  4HOB A;  3WTU C;  1Z6R A;  2RDP A;  3J81 Z;  2F2E A;  1HKS A;  2V79 A;  2W84 A;  2JTV A;  4MQ9 F;  4BQA A;  5CLS A;  2PMU A;  4UV8 A;  4OOI A;  4WXH A;  3B02 A;  3RKW A;  3GFM A;  1ZH5 A;  3WU1 B;  2NNY A;  2ZCW A;  1D8K A;  1G3T A;  1QZZ A;  2Z5U A;  1WI9 A;  3M8F A;  4EGY A;  3BJ6 A;  3LWF A;  5J8F A;  5IT9 Z;  1R5G A;  3CUQ C;  4OU0 A;  4G94 A;  3E3V A;  1MJB A;  2OZU A;  1R1U A;  3BWG A;  3LAP A;  4A0Z A;  5A2Q K;  1OMI A;  4KN7 X;  3TOB A;  1FSE A;  3ZP5 A;  5F64 A;  1H9G A;  5HS9 A;  2JZY A;  3V8L A;  2H94 A;  1FYM A;  2ISZ A;  2MH2 A;  4OIR F;  2ZJ2 A;  4EJV A;  1YYV A;  4OMY A;  1YQA A;  3HRT A;  2K02 A;  4A12 A;  2H6C A;  4QLC U;  4WXD A;  4HYE A;  1H0M A;  1S7O A;  4A2U A;  2RGV A;  1OR7 A;  5E17 F;  2G7U A;  4ETS A;  4WK8 F;  1FNN A;  3RKY A;  1E17 A;  4Y15 A;  4LB6 B;  5CYV A;  4EQQ A;  4BYY A;  5EEH A;  1XSV A;  3KP2 A;  1I5Z A;  2L01 A;  5BQT A;  1V3F A;  4ESB A;  4LMY A;  2BYV E;  2M87 A;  3GZ6 A;  4ZYE A;  3FF5 A;  4CHU A;  3FM3 A;  3HSF A;  1U2W A;  3PFI A;  1T0F A;  1IN8 A;  1GHC A;  2KJC A;  1PDN C;  1B6A A;  4M73 A;  3HIF A;  4YFK F;  2R7D A;  1U6G A;  3KZZ A;  5E8I A;  2QBY B;  4BHB A;  1XCV A;  4EM2 A;  1BI0 A;  1ZGJ A;  5K5Q A;  1HKT A;  1TQM A;  3F21 A;  1SAX A;  1BN5 A;  2B0L A;  5DD4 A;  1KU3 A;  1KYZ A;  4N0B A;  2RVC A;  3SZP A;  2HZT A;  3EYI A;  2FBK A;  4L5J A;  5AON A;  4IHS A;  3DPT A;  4RGU A;  2FML A;  1ZN2 A;  4GXO A;  2MD5 A;  3IRQ A;  3R0A A;  2PQ8 A;  4EJO A;  4R79 A;  1PP7 U;  2P5V A;  4ENM A;  3GUD A;  1SD6 A;  4P9F A;  5JR3 A;  4S05 A;  2DTR A;  3F8F A;  4HBL A;  2O6G E;  2QUF A;  5TJJ A;  1X3U A;  1T39 A;  3T0Y A;  3L09 A;  3NEU A;  1O7F A;  1KU9 A;  2KRF A;  3KP5 A;  2VOO A;  1RI7 A;  1I27 A;  1MDM A;  2EB7 A;  5DCM B;  1YTY A;  2UXN A;  1R1V A;  2HYG D;  3JAM K;  2P7C B;  1D8J A;  2HGC A;  2OAZ A;  2IA1 A;  4JK1 X;  4QWQ A;  4ENJ A;  3MCZ A;  4GO1 A;  4L5I A;  3L00 A;  5HDG A;  2G9W A;  3GLX A;  3KP4 A;  5BPD A;  3SXY A;  1DPR A;  3Q9S A;  1IAW A;  3ISP A;  5L3G A;  1BIA A;  4BAY A;  3T1B A;  2A61 A;  2HYF A;  4HF2 A;  1KQ9 A;  3DF8 A;  3D0S A;  2A07 F;  2CSO A;  3TO9 A;  1MKM A;  2V1X A;  2QQ9 A;  1USS A;  1B59 A;  1IXC A;  3ECO A;  5EEG A;  1BBY A;  5ILS A;  1Z91 A;  4KMF A;  3WTS C;  4CXF A;  2M1B A;  3DV8 A;  4LK0 F;  4BHC A;  2EFO A;  1FY7 A;  4CGZ A;  2HFH A;  3MWM A;  5HDK A;  3WTT C;  5LRR A;  3ZMZ A;  4YFN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...