4AVPA

Crystal structure of the dna-binding domain of human etv1.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
b'SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS TRANSLOCATION VARIANT 1
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4avpA00
3TQNA 4A0ZA 3CUQB 4OIPF 2EV5A 1BM9A 2RVCA 4WWCA 5F6FA 2HZTA 4HF2A 3EYYA 1FSEA 3H3ZA 3K0LA 1CGPA 1FT9A 4S04A 1XGOA 4XRFA 5LGNA 1TQPA 1R58A 2MLGA 4UUVA 2AXLA 1H9GA 4ZZLA 3P9CA 5HLIA 2PI0A 5D8LB 2P5KA 3RYPA 4JK1X 2CG4A 1XN7A 2A07F 1IRGA 2WC2A 1R00A 3GYHX 1ZN2A 5E17F 3BP8A 3IKVA 1E2XA 4HX4A 4HX7A 4ZZDA 3QP5A 1K79A 2GXGA 3VB2A 3K9TA 3ZMDA 1Y0UA 3WGIA 4L9VA 4I0BA 2L02A 2PMUA 1RI7A 3CDHA 1S8NA 2M87A 2TDXA 3KZZA 4O3MA 2F5EA 3ZMSA 1TQIA 1HKSA 5IT9Z 4CHUA 4HBLA 3WE2A 1XB4A 4MTDA 1LJ9A 5F1RA 1DDNA 3DXJF 2RNJA 4LB6B 4UVAA 2QUFA 3HSEA 4OOIA 4RAYA 4R79A 2FXAA 3KP4A 1XSXA 4PDKA 2ISZA 3L9FA 3WE3A 5E1XA 2DTRA 1MKMA 2BGCA 3ZMVA 2HS5A 5D5WB 2PFBA 1MGTA 2AS5F 1ZLKA 2ETHA 3FWEA 3IKTA 4FHTA 5LLQA 3EDPA 2D2WA 2EK5A 1W7PD 1ULYA 3GZ5A 3ECHA 1W5TA 2EFQA 3TDUC 2F2EA 5D5XB 5H20A 2CW0F 1U5TB 3QRFF 1R1UA 2XGXA 3ELKA 4A5NA 2NNNA 4LMYA 3V8JA 4ZYGA 3Q5FA 4BYYA 3I0TA 3VODA 1OPCA 2IP2A 3M1EA 5LEJA 3L00A 5AIPA 3TO7A 2GWRA 2DAOA 1ON2A 2ZKZA 1K78A 3T8RA 1UHMA 2M45A 4G6QA 3KE2A 4LB5A 2FBHA 1R23A 2NNYA 4L0ZB 3T0YA 5D5VB 1LNWA 4S05A 3GXOA 2M30A 1UHWA 4TV7A 2MD5A 1LEBA 1WKMA 1W7PB 1YS6A 3K69A 4IRHA 4RB2C 1LB2A 2HKXA 5CVUA 1D8KA 1U6GA 2VC0A 1ZRCA 2GQQA 1J75A 2HDCA 2NYXA 2ZMEA 4UVBA 3V7RA 4A2UA 4A0XA 2YX4A 1XMAA 4GO1A 2EWNA 4A6DA 1BJAA 4G7ZF 1TW2A 3IWFA 2OQRA 2P8TA 1B6AA 5HS8A 1SFXA 3HSRA 2DFIA 3DQVC 3H3UA 3F6VA 1BC7C 2UWMA 4PGGA 1VTNC 5D4RA 1BN5A 2XRNA 2P5LC 3BPXA 5DYMA 4GYGA 2IA2A 1QO0D 3FXUA 5JR3A 3U1DA 1B9MA 2W85A 4MTEA 4WXCA 1FYKA 4KUMA 4P5OA 1FNNA 4KIBA 1JE8A 2DBBA 3Q9VA 3FM3A 1WI9A 4CGZA 4CO8A 5LHGA 2CWEA 4LG0A 4OIQF 2NRAC 2GA2A 2EFNA 2FA5A 1FSHA 2W24A 2W57A 1O7FA 2ZCWA 1DPRA 2CO5A 1IN5A 2XIGA 3R60A 1K78B 2MH2A 3BDDA 2O03A 2LDUA 2XAHA 3FXRA 5ICEA 5HOOA 2XKPA 1B1BA 1G3SA 4M6YA 3I53A 1HW2A 2J5OA 2C6YA 4RGXA 2G7UA 2VXZA 4F7ZA 1BI2A 4HV6A 4KT5C 2IJLA 3LA3A 1IRFA 4ESBA 4BNCA 4PCQA 3L2CA 4HLXA 3O3KA 4M9ZA 2FMLA 4HF0A 2X4HA 4LK0F 1J0RA 3MEXA 4YIFA 2YU3A 3HRSA 2ZMEB 3IRQA 1T38A 2O61A 3GX4X 1U2WA 2E1CA 2VOOA 3BZ6A 5DCFA 2XAFA 5D5UB 5D4SA 2VONA 2V1XA 2KKOA 4P55A 2ELHA 2M8EA 2O8XA 2OZ6A 3H92A 4B8XA 1S3JA 2CQKA 2IA0A 2QLZA 4M73A 3HRTA 1AWCA 4KA4A 2HTJA 3K1NA 2BE5F 4I98B 2QWWA 3BOQA 4A0YA 2OZUA 3E6CC 3BJ6A 1TW3A 2P7CB 4YFNF 1HXDA 1KU3A 4RGSA 1XDUA 5L3BA 4PZJA 1FBUA 1EH7A 1R22A 3R6SA 1QZYA 2VT3A 1KQ8A 4I0AA 4MHGA 3M9AA 1RNLA 3C7JA 3RYRA 2DW4A 3CTAA 4EGZA 2PJPA 1JHHA 3FHZA 2VT2A 2DK8A 5J8FA 2QBYA 4UNOA 3WG9A 4LG0B 3V8LA 5CLSA 2QENA 4ESFA 1ZGAA 3JAMK 3ZPLA 1P92A 2EFOA 1J5YA 1SD6A 1U8RA 2KIMA 2R7FA 1Z9CA 2EA4A 4CXFA 1WRJA 2XVCA 2PBIA 4YG2F 1I6XA 3LSTA 3MCZA 5CJ9A 5EEHA 3COAC 1LVAA 4KMUX 2GIVA 3SZTA 2V1UA 1RUNA 1FBSA 2VN2A 1S29A 1UCRA 3KP5A 2RGVA 2D1HA 4I7HA 5LEKA 4KDPA 4KMFA 2EFWA 3E6DA 2A61A 3WTUC 3HSFA 4OMZA 1T2KA 1OKRA 2K4BA 4FT8A 5K1YA 1I27A 4AVPA 3GFLA 1ZRFA 4O5VA 5H6QA 1Z6RA 3V7CA 2FNPA 2IW5A 3JTGA 1YO5C 3K2ZA 2RC4A 5D8KB 1SFUA 3F8NA 4KN7X 1ZG1A 2ACJA 2FRHA 3LQRA 2XAGA 2EV0A 3ABUA 2GAUA 2HTSA 3M7GA 3QOPA 2VC1A 2H94A 1B9NA 5BPIA 3GZ6A 3NEUA 2HKOA 3EYIA 5KK1A 1R1TA 3NQOA 2RV8A 1XMKA 4JQFA 5ILVA 5LGTA 3KP2A 2A6EF 4XLPF 1IN6A 3ZMTA 1KYZA 1U78A 4IXAA 2Z33A 2A5YB 2VBWA 2QBYB 3HYIA 4LK1F 4L9NA 3ISPA 2QQBA 1YYVA 2R7DA 4M71A 1HW5A 1ZHFA 3F3XA 1FLIA 1QZZA 1ZREA 5TRDA 3GW2A 5CVJA 5LBQA 3N97A 3KFWX 1PDNC 4WF2A 1MJ9A 4P9FA 2KJBA 1QBJA 1ZAOA 5L3GA 1YQAA 4G8XA 1O3TA 1R5GA 1B59A 1RZ4A 3FMRA 5IT3A 4D0PA 5JVTA 3DFGA 3MFKA 5DD8A 2OA4A 2W84A 2COMA 3VFZA 4HQMA 1IXRC 2JSCA 2LF7A 5LRSA 1LDDA 4GCVA 5LHIA 3F8MA 4LGWA 1G4DA 1Z91A 3FZVA 4NQWA 1J2XA 5HDGA 4GXOA 5FLXK 3J81Z 1BC8C 2STTA 4N9IA 3KEOA 1F5TA 2VODA 2NAZA 1SMTA 4EM1A 2KJCA 2JTVA 3IWZA 4RGUA 1YW8A 4GYIA 2P5VA 1QQIA 5DUIA 5E8IA 4L5JA 4AIHA 4ON0A 3QPTA 3CLOA 2OU2A 2DT5A 5CVRA 3QU3A 1FYMA 1SMYF 1O57A 3CO7C 1HKQA 1CF7A 4LJZF 2FBKA 1IN4A 2JZYA 2VOPA 4L5IA 1YG2A 2G7HA 2UXXA 1G3TA 1IUYA 1Z1DA 4EJVA 4HQEA 3J81K 1XGSA 5DD4A 3WODF 5CVVA 2K86A 3GFIA 3ZMZA 5BMZA 3FMSA 5D6FA 1FC3A 1JHFA 1F9NA 3LWFA 2GA1A 1P4XA 2EB7A 2Y0MA 2DPDA 4IRIA 4OINF 3REOA 4Q48A 4DNCA 3HTSB 1HKTA 2L3DA 1D3YA 3KCCA 1FX7A 3W6KB 1X3UA 5KVRA 3HUGA 1FZPB 4I02A 1XDSA 4UV8A 4Q4ZF 4IRGA 3WTSC 4IPAA 1MD0A 2V6CA 1USSA 1IAWA 3DF8A 1D5VA 4EJWA 3GFJA 1KQ9A 4UV9A 4A5MA 3ZN0A 5FD5A 1ONVA 2KIUA 2YX7A 1ZG3A 3P9KA 3LA7A 2ZO4A 3ML6A 1IF1A 2RQPA 5ICFA 1ZRDA 3BPVA 3G3ZA 4LFUA 2IA1A 2WWYA 1TLHB 1ZG5A 2VBXA 4IVNA 3LAPA 2EV6A 2A6HF 2HGCA 3J80K 4ENMA 1FPQA 1OYWA 2L4MA 4AWXB 3SZPA 1FOKA 5DEQA 3WTTC 4RB0A 4B09A 2ZJ2A 3SFZA 4ENKA 2ZNZA 3PQKA 2QVOA 1FP2A 3MZHA 2EFPA 1IXCA 1CF7B 2HYFA 5HS9A 5L3DA 1P2FA 5HVQC 3O6BB 3R4KA 3M8EA 4WCGA 4N0BA 1FYLA 2DK5A 3AAFA 1LEAA 4U7BA 4OIRF 4DQ2A 4BHBA 4ZYEA 2DQLA 2PLYA 3L09A 4KIFA 2F5FA 5FO5A 1IW7F 4RB3C 4IHSA 3WGHA 1TNTA 3I5UA 3RPUA 2E7WA 3FF5A 4H0EA 2IRFG 1E17A 2P6TA 4ZYHA 4HX8A 2MLKA 2WTEA 4I09A 4CZZA 3TOAA 2FQ3A 1FWZA 4AD9A 3E5XA 3BWGA 4NB5A 3D0SA 4YFKF 4P96A 1GVJA 1QNTA 3R0AA 2ZBKA 1JXSA 2GXBA 4XSXF 4HA8A 2ZNYA 1IN7A 2MA3A 1GXQA 5FB2A 3G73A 3D5LA 5HLHA 3IHUA 1QPMA 5JI6A 1AOYA 2M1BA 4CDGA 2FE3A 3FM5A 3JAMZ 3OOPA 4WX9A 5BS6A 4HV5A 2FU4A 2R3SA 1ZARA 3T8TA 3GUDA 2DO7A 5LRRA 1T39A 1SD5A 1XGNA 3JW4A 5L3FA 2Z5UA 1Z7UA 2CFXA 4MGRA 1DPUA 4KIGA 3DPLC 5E18F 1USTA 2HQRA 1SD7A 1HBXG 2BYVE 3BROA 5ILUA 1W4MA 3CUQC 4M9XA 1ZYRF 4GGGA 3VOEA 3HIFA 3WTVC 5E1WA 4E70A 1DUXC 3KP7A 2HWVA 2P6SA 4IF4A 1S7OA 2W25A 3NRVA 4Z2YA 3ZMUA 2X0LA 2K02A 3GEZA 4LLLA 2LKPA 2ESHA 2LSOA 5F64A 4ETSA 1ON1A 5DCMA 1BOAA 2FEZA 1J7KA 3WGGA 1I1GA 2Q2EA 2OQGA 1K6OA 1XGMA 2QZ8A 3HRMA 4HLYA 4A6EA 1NHAA 1YTYA 3DP7A 3K1PA 3I64A 4Q5SF 3F8CA 4L9TA 5FGMA 4XBFA 3B73A 3WTYC 3KP6A 2STWA 1L3LA 1HSJA 3HOSA 3R61A 1G6NA 2BBYA 5H6RA 3C1DA 4MEYF 3M8FA 4R8HA 5LHHA 3DPTA 1EV7A 1ZLJA 4YIIA 1XSVA 1Z6TA 3GLXA 1Z05A 3F8BA 3V4GA 4HDVA 2EJRA 1REPC 2FMYA 2YSRA 3RKYA 2FF4A 4N9HA 3KP3A 2Z9OA 1RIOH 1MDMA 3B02A 2DQRA 5ILSA 1O7LA 4ZH4F 3OV8A 2PEXA 1G3WA 1YIOA 1KQ0A 3QP6A 3RIRA 4BHCA 1EH6A 1U3EM 3I4PA 2XASA 2DI3A 2K4JA 2XKOA 2A68F 1EH8A 4HOBA 1U5TA 1B4AA 3E97A 1U5TC 2VE8A 2HQNA 4NHJA 3I71A 4R1HA 4UXNA 3LAJA 3WTZA 3LQQA 5BPDA 5FLXZ 4ENJA 1KA8A 1A04A 1Q1HA 3ECOA 2A69F 5DDGA 3JSOA 2HEOA 4LLGF 3FMQA 1KU9A 4AIKA 2QQ9A 4PGHA 5E8GA 4MQVA 1OR7A 4QWQA 5DCMB 1KU2A 3HHGA 3LA2A 3FX3A 5K5RA 1IN8A 2JT1A 3GF2A 3ULQB 3W6JB 3IC7A 4EM2A 4BXUA 3DKWA 2JPCA 5K5OA 4FX0A 3TGNA 6PAXA 3Q9SA 1R36A 3ERED 2L01A 3DV8A 5BOXA 2YPRA 2QYOA 4O6JA 4HDUA 3GWZA 2DPUA 3P7NA 3S2WA 3BY6A 1GHCA 2P7VB 2ADUA 1W7PA 2PMHA 2XUBA 3T1BA 5JHUA 5E20A 4KNYA 4OU0A 1R5HA 3BJOA 2GZWA 5CVIA 5E1ZB 5FFXA 2MH9A 2L54A 2QM3A 1UB9A 3TO9A 2ZFWA 3I59A 2LNBA 2IT0A 2RN7A 3CO6C 4U0YA 1O3SA 3SHFA 2CSOA 3F21A 1P4AA 2QQAA 3F22A 5ED4A 4RAZA 4KFCA 2Y48A 1WWXA 2IVMA 4XLNF 1MDMB 3E6BA 4QLCU 2HFHA 2Z3YA 4BHPA 4HF1A 1ZGJA 2XV4S 2YR2A 2D45A 1BI0A 4Y17A 5ERIA 4LLNA 3T5XA 5IT9K 4EJUA 4I2OA 2O6GE 3EETA 2NS0A 3BJAA 4KYWA 1PUEE 2J5PA 4RB1A 2ESNA 2DU9A 3GFMA 1FY7A 2Q0OA 3PQJA 4ZYDA 2B0LA 3TOBA 2DLLA 3ZQ7A 3GO5A 5FD6A 2UZKA 4JBAA 2H27A 5J6XA 1STZA 4Y15A 2ZXJA 2HYGD 4Q47A 2F5DA 1BI1A 3CUOA 4EGYA 1LDKB 3P9IA 3ZN1A 3J80Z 1S7AA 1V3FA 3JTHA 1TBXA 5LGUA 1JGSA 4WK8F 4CICA 2A3SA 4EQQA 1H9TA 5ICGA 2CYYA 2PG4A 2K27A 3IL2A 3KLOA 4M72A 1OYIA 4I01A 3VEPA 2PQ8A 1WQ2A 2H6CA 1MJAA 1WSUA 1PP8F 1H0MA 4MQ9F 1R1VA 2L4AA 5AONA 1SAXA 2O0YA 3QU6A 3I59B 1QGPA 3TKYA 3KLNA 4G6DA 1TTYA 3J7AO 3R0JA 1OMIA 4HYEA 2VE9A 2KRFA 1XSDA 4K2EA 3E5QA 3WU0A 3V8KA 2O3FA 2FOKA 3KETA 3F6OA 4EM0B 3FXQA 2RKHA 2OD5A 2VBYA 5L3EA 5BQTA 4U88A 4Y13A 2BEOA 2Q8KA 4LD5A 3SQNA 3C18A 2WV0A 3RJPA 2E7XA 5FFZA 4WXDA 3HTUA 1KGSA 1SD4A 2JPBA 2FSWA 4ESJA 4YFXF 2XAQA 3TO6A 3WTWC 1F1ZA 1T98A 1PP7U 1C0WA 3O2PE 3JSPA 1YLFA 3PFIA 1YS7A 3HHHA 2HOEA 5TJJA 2MC3A 2G9WA 3V7SA 2V1DA 1TQMA 4A12A 1BI3A 5EEGA 3SXYA 5A2QZ 2CGPA 2Z99A 2XHKA 3DEUA 3U2RA 3N4MA 5JFRA 5HDNA 3RKWA 3EUHA 1D8JA 4IJAA 1O3QA 1ODDA 3MAJA 4XSZF 2OAZA 4BH9A 1T0FA 3ABTA 5HS7A 2V9VA 5DUKA 1OYYA 3MWMA 1W5SA 4EJOA 3F8FA 4HAMA 4WXHA 4M9SA 2H6BA 1J59A 5K5QA 4M74A 3MQ0A 2FBIA 2ISYA 5HLGA 3KEQA 2P4WA 1T6SA 1DP7P 4IHTA 3RDIA 4M6XA 2IPQX 1YW7A 2RDPA 1BBYA 3RI4A 4ENNA 1RUOA 2JRTA 2VBZA 3CUQA 1BIBA 4ASNA 2KIFA 5A2QK 5HDKA 1LQ1A 4L9JA 4EVIA 1MJBA 1LDJA 4EV0A 1YFHA 2UXNA 3F72A 5ICCA 1G3YA 5DV5A 3GVAA 2H09A 4AIJA 3QAHA 3HRUA 4UVCA 3MZYA 4RGRA 4OMYA 4BAYA 3K1MA 4P9UA 1IZ1A 2XAJA 1FP1D 3ZP5A 3U9GA 4EMSA 1I5ZA 3WU1B 3RKXA 1XD7A 4EJTA 1UFMA 3CJNA 1P6RA 4HW0A 1GXPA 4HZFA 1V4RA 3RTRA 2K7LA 1F4KA 1I1SA 1P4WA 3IRRA 2BV6A 1HSTA 4FX4A 3F23A 1KYWA 4U0WA 4G7HF 3TDZC 2XROA 4UHTA 2FNAA 2F5CA 5J8CA 1O3RA 3ROUA 1HQCA 1BIAA 1TNSA 1K7AA 3E6MA 5D6EA 4RS8A 2E1NA 3QPHA 4U7DA 4BQAA 4G9YA 2PN6A 4L0YB 3E3VA 5L3CA 1YW9A 1J9IA 2V79A 1S6LA 4MNUA 3EQLF 3I54A 2M5WA 2EA2A 5CYVA 3RPQA 1IXSB 4CYDA 4KICA 1L0OC 1R7JA 2MBFA 3L7WA 3C3WA 4KN4X 2Y75A 2HR3A 1MZBA 3I58A 2D1VA 1ZH5A 3HOTA 1KU7A 1XCVA 4L18B 4MEXF 1FBQA 2OBPA 3WTXC 1SFEA 3KZYA 2LF8A 4G94A 3LFKA 5AIQA 4G7OF 3E5UA 1HW1A 1XCBA 4U0VA 4OIOF
chains in the Genus database with same CATH superfamily
4BEHA 2AXTC 1X1CA 2K9MA 3TQNA 2YU9J 4A0ZA 3CUQB 3V42A 5IPAA 3FXMA 4OIPF 1VZ0A 2EV5A 1VQ5I 1BM9A 2RVCA 3AL0B 4WWCA 2QF7A 5F6FA 2HZTA 1GT0C 4HF2A 3EYYA 1FSEA 3BTCA 3H3ZA 3TP3A 1X3ZB 3K0LA 1CGPA 1FT9A 2OCCH 4S04A 3HPHA 3N05A 1XGOA 3U1KA 4XRFA 5LGNA 1BW5A 1TQPA 3C2BA 1R58A 2BVLA 2MLGA 1MNDA 4UUVA 2AXLA 4B3AA 1H9GA 2K9LA 4ZZLA 3FIWA 3P9CA 1MBKA 2BY0A 5HLIA 2PI0A 1ZKGA 5D8LB 2LVSA 2P5KA 3Q0WA 3J7AY 3RYPA 4AYBN 4JK1X 3DBRB 2K3PA 2VPRA 1RKTA 3MN2A 2CG4A 1XN7A 2W00A 2A07F 1IRGA 2WC2A 1FTZA 1R00A 3TW7A 4BDYA 3GYHX 1ZN2A 2Q2EB 5F0FA 2ME0A 4J19A 1RC9A 5E17F 3BP8A 3IKVA 1FTTA 1E2XA 3BZCA 4HX4A 4HX7A 1N78A 4ZZDA 3QP5A 4NDLA 5C4JJ 2UV1A 2GXGA 3VB2A 3K9TA 3ABKH 3ZMDA 1K79A 1Y0UA 3WGIA 4L9VA 4I0BA 2L02A 2PMUA 1RI7A 1JKPC 5HLTA 5JLWA 3CDHA 4IEJA 1S8NA 2H1LA 1W1WE 2M87A 2TDXA 3PNTA 3KZZA 5FROA 4O3MA 5K7ZA 1FOXA 2F5EA 3SDGA 3ZMSA 1TQIA 1HKSA 1EA3A 4FCYA 4BQQA 3OYMA 1WJFA 3JRIA 5IT9Z 1K4SA 4CHUA 1MBEA 4HBLA 1SC7A 1O4XA 3WE2A 5JHFA 1VQ6I 4D9JA 1TL8A 1XB4A 4MTDA 3DWLE 1LJ9A 1E3PA 2EIJH 5F1RA 4F55A 1FMVA 1YE9A 3DXJF 1DDNA 3ERMA 4FE7A 1Y6IA 3DTKA 2RNJA 5E79C 1LFBA 2WV1A 1K83J 4HEA2 4LB6B 4UVAA 2QUFA 3B6CA 4A3CJ 1YIJI 2DFHA 2VUMJ 3TEDA 4RMNA 2VPLA 3HSEA 4OOIA 5EF6A 2ZJQF 4RAYA 1WI3A 4R79A 2FXAA 1GLNA 2AO9A 1YJWI 3G4SI 2R7VA 2H8WA 1DU0A 3ABLH 4HNVA 3KP4A 1XSXA 4JOMA 4PDKA 2VJIA 2ISZA 2M7BA 3L9FA 2YS9A 4FE4A 3WE3A 5E1XA 2DTRA 1MKMA 2BGCA 3ZMVA 2HS5A 5D5WB 2QCOA 1QRYA 4BBSJ 1AA7A 3NWSA 1VQ9I 2PFBA 1D0ZA 1MGTA 2AS5F 4CA0A 1ZLKA 2ETHA 3FWEA 1OCZH 3IKTA 4FHTA 4LOCA 5LLQA 3EDPA 1K61A 2D2WA 3BG9A 3OYHA 2EK5A 1W7PD 1ULYA 3GZ5A 3FXLA 3ECHA 4IHVA 4BEHB 2GIZA 1W5TA 1BR2A 1WZ2A 2EFQA 3TDUC 2F2EA 4BGDA 3DEEA 2HI3A 5M5XJ 2DOAA 3S3MA 1QPIA 5D5XB 5H20A 2CW0F 1U5TB 3QRFF 1R1UA 2XGXA 3ELKA 1IJWC 4YELA 4A5NA 5BNGA 5KNLA 2NNNA 1Z77A 3ZQCA 2DJNA 2CV0A 2DMTA 4LMYA 3V8JA 4ZYGA 3Q5FA 4BYYA 2L7MP 1U9NA 2B7EA 4J00A 1CQTA 1MMGA 3I0TA 3VODA 2CU7A 3L2VA 1OPCA 3QYEA 2IP2A 1YJ9I 3M1EA 1S5LC 2K5CA 4LIVA 5LEJA 4JP0A 3L00A 3CCMI 5AIPA 3SZGA 3TO7A 2GWRA 2DAOA 2A5WA 2DOEA 3EUAA 1ON2A 2ZKZA 1FMWA 2RREA 1K78A 1KZHA 1RESA 2IGNA 2MABA 3KEYA 3T8RA 1UHMA 5CKTA 2M45A 1JGGA 1SANA 2W7NA 3LL7A 1Z0XA 3OYJA 3A01A 1X19A 1SVOA 4G6QA 3KE2A 3OS0A 2DT7B 2FBHA 1LPQA 2HOTA 4LB5A 2JUCA 1LE8A 1R23A 2NNYA 3M8JA 4L0ZB 2HVSA 3T0YA 1A6QA 1YX5A 4IHYA 4PSXA 5D5VB 1A5JA 1NK2P 1LNWA 3K4MA 4S05A 3GXOA 2M30A 3ZOBA 2VB6A 1UHWA 2I8DA 4TV7A 2MD5A 1LEBA 4XL9A 1WKMA 3L2QA 4E7JA 1W7PB 1RETA 1YS6A 3DCFA 4W97A 2HDDA 2BY3A 3K69A 2LY9A 4IRHA 1VQMI 4RB2C 1LB2A 1GVDA 2HKXA 3OY9A 5CVUA 2OPTA 1D8KA 1U6GA 2LR8A 2VC0A 2Y69H 4HG2A 2X6WA 1ZRCA 2GQQA 5K7HA 5LFAA 1J75A 2M0MA 2NYXA 2ZMEA 4UVBA 2HDCA 4U87A 3V7RA 4A2UA 2Z2SB 1UHSA 3OYNA 4A0XA 2E71A 2YX4A 2BXYA 1XMAA 2VI6A 5J4VA 3E0JB 4GO1A 2EWNA 4A6DA 3AG4H 3S93A 1BJAA 4G6TB 4PFOA 4B44A 4G7ZF 2PJRA 1Q1VA 3BTLA 1TW2A 3BG7A 2IS6A 1EKEA 2LH9A 2XRLA 3IWFA 2OQRA 2P8TA 1B6AA 5HS8A 3KYCB 2R7UA 2KMUA 3IH3A 1SFXA 2ELKA 1ZR4A 2VJJA 3HSRA 2NVUB 2DFIA 3DQVC 3H3UA 2M0CA 3F6VA 1BC7C 1BW6A 1MBHA 2UWMA 4PGGA 1VTNC 1UELB 2VASA 3CJQB 5FKLA 1U8BA 5D4RA 1BN5A 2CQXA 2XRNA 3BCBA 3TL4X 2P5LC 3GTQJ 5F27A 3A03A 1XTAA 5FKMA 3BPXA 1LFUP 3K70C 5DYMA 2ELJA 3BR2A 4GYGA 2K9NA 2XPVA 2A6TA 2IA2A 1QO0D 3FXUA 5JR3A 2IXSA 2QSGX 2O7OA 3U1DA 1B9MA 3PM1A 2W85A 4MTEA 4WXCA 3K4LA 1FYKA 4KUMA 4P5OA 4E7IA 4OAYA 1FNNA 4KIBA 4UY8I 1JE8A 4XKBA 2WY8Q 2DBBA 3Q9VA 1VQKI 2ZJPF 3FM3A 1WI9A 4CGZA 4CO8A 3JRFA 3FK6A 2DMUA 5LHGA 2CWEA 4BU2A 4LG0A 5F0HA 2NRAC 1OCRH 2GA2A 2EFNA 2FA5A 3QYBA 4OIQF 5CPRB 1FSHA 2W24A 2H1KA 2W57A 3VPRA 1O7FA 2MC4A 3PSIA 4RM2A 2ZCWA 1DPRA 9ANTA 2CO5A 1IN5A 2BY1A 2XIGA 3R60A 3W2VA 3BG6A 3CESA 2MH2A 1K78B 3C2HA 3BDDA 2O03A 2LDUA 2XAHA 3FXRA 5ICEA 5HOOA 1E0EA 2E1MB 1HDPA 2XKPA 1B1BA 2KRHA 1G3SA 1GUUA 3A01B 4M6YA 4DBRA 2Y31A 1BR4A 3BG5A 1LE8B 2EBIA 3I53A 1WPKA 2D5VA 1HW2A 3I4MJ 2J5OA 2C6YA 4RGXA 1YX3A 1RPWA 4X6AJ 1VF9A 4A3FJ 2G7UA 2VXZA 4F7ZA 1BI2A 2OUMA 3QPLA 4HV6A 2K9QA 2L9RA 4BXFA 4KT5C 2IJLA 3LA3A 4PJMA 4LITA 4DJAA 1IRFA 2ID3A 4XLFA 4ESBA 1YRNB 4BNCA 1P7JA 4PCQA 5GADJ 3L2CA 4RM3A 4V2GA 2V6EA 4HLXA 5FKOA 2DMPA 3O3KA 4M9ZA 1HC8A 2FMLA 4HF0A 2X4HA 4LK0F 3HOZJ 1J0RA 3MEXA 2CRGA 2YU3A 3HRSA 4YIFA 2ZMEB 1IUFA 3IRQA 1T38A 2O61A 3GX4X 1U2WA 5H2FC 2E2IJ 2V26A 2VL8A 2E1CA 2VOOA 4QPQA 3BZ6A 5DCFA 2XAFA 4QPOA 5FKNA 5D5UB 3S17J 4E7SA 5D4SA 2VONA 2AQFA 2V1XA 3Q0UA 5M5YJ 3S1MJ 2KKOA 4ANJA 1MMDA 4P55A 4JYKA 2ELHA 2M8EA 2O8XA 5B3SH 2PJRB 2OZ6A 3H92A 3A1YA 5CQEA 4B8XA 1S3JA 2CQKA 2IA0A 1TWGJ 2QLZA 4M73A 3HRTA 1E3OC 2E1OA 1AWCA 3W2WA 1R6RA 4KA4A 2HTJA 3K1NA 2BE5F 3DTEA 4I98B 2QWWA 3BOQA 4A0YA 2OZUA 3E6CC 3BJ6A 1P9QC 4A69C 2Y9YA 3DPUA 1RR8C 3LSHA 1TW3A 5IP9J 4BS9A 4IO9F 2Z1DA 2P7CB 3IUOA 4YFNF 2LP0A 1HXDA 3ABMH 1KU3A 2VKEA 4RGSA 1XDUA 4CCMA 4F92B 4PZJA 5L3BA 2LKXA 1APLC 4IOCF 4KISA 1FBUA 4XICA 1EH7A 2JA7J 1R22A 1V55H 2R7QA 3R6SA 3A02A 1Y1WJ 1QZYA 4IHXA 2X1DA 2GOXB 2VT3A 1KQ8A 4UB8C 3CC4I 4I0AA 4MHGA 2VKVA 3M9AA 1RNLA 3QYFA 3EPZA 2F4IA 3G6EI 1JJ6C 5FLVA 3C7JA 4XQFA 4DZPA 3FISA 3RYRA 2DW4A 3CTAA 4EGZA 4D5CA 2PJPA 1JHHA 2VLAA 1HLVA 3FHZA 3AG2H 1M1EB 2EZLA 2VT2A 2DK8A 3K4BA 5J8FA 4CCJA 2QBYA 4UNOA 3WG9A 2IGOA 4LG0B 5EG0A 1X2NA 4FETA 3V8LA 2CUJA 5CLSA 2QENA 1G8XA 3S2HJ 4XLCA 4ESFA 4NC8A 3OSFA 3S1NJ 1EF4A 1ZGAA 2XSJC 3LOCA 3GBGA 1P92A 3JAMK 2EFOA 2NOJB 4FISA 3ZPLA 2NVYJ 1J5YA 1SD6A 1U8RA 2KIMA 2PMZN 2BY2A 2R7FA 2EA4A 1Z9CA 4CXFA 2CW7A 2M3AA 1WRJA 2O5RA 2XVCA 4YEJA 2DOFA 3S15J 1DGWY 2PBIA 4YG2F 1X1AA 2HZDA 1I6XA 3LSTA 3MCZA 5CJ9A 2Z16A 5EEHA 3COAC 1LVAA 3A0HC 4N4OB 2FQ4A 4KMUX 1RR7A 2GIVA 3SZTA 2V1UA 1LFPA 1RUNA 1FBSA 2VN2A 4XRSA 1S29A 2Y0SA 2ZSIB 3OYKA 2AQEA 2F5VA 1UCRA 3KP5A 3UR3C 2RGVA 3EUKL 2D1HA 3E1SA 4I7HA 5LEKA 3DBLB 3TBIA 4B48A 2KFDA 3FBNB 5KHDA 2NOGA 4XIDA 2KQRA 1ZGWA 4KDPA 4NUBA 1OLTA 4KMFA 3I9V2 2EFWA 3E6DA 2A61A 2V9PA 3WTUC 3HSFA 4OMZA 1SEUA 2R7RA 2NVTJ 1AU7A 1T2KA 3GTPJ 2JRMA 5EDNA 1OKRA 2K4BA 4KT6A 4FT8A 5K1YA 3BR6A 1W36D 3PSFA 2XSDC 3L2WA 1I27A 1X2MA 4AVPA 3GFLA 1ZRFA 3G1OA 4O5VA 1S7EA 4DYRA 3CMAI 2K85A 5H6QA 5CQGA 3I4NJ 1Z6RA 1X1PA 2IEKA 3V7CA 2FNPA 1Y8RB 2IW5A 1IO2A 3JTGA 1ETKA 2CUEA 1YO5C 1DQUA 3K2ZA 2RC4A 5D8KB 2BZTA 2LOOA 1SFUA 4DBQA 4M6VA 3F8NA 4PUSA 4KN7X 4C3IJ 1ZG1A 2ACJA 2FRHA 3LQRA 2XAGA 4BKXA 2EV0A 3FBIB 3ABUA 4XLAA 2R7OA 2GAUA 2HTSA 4F93B 2DA3A 3MKWB 2L9NA 1X3WB 3M7GA 5HNFA 3QOPA 5GAEJ 3H35A 2VC1A 3HJEA 1W0UA 2H94A 1B9NA 3PNVA 5BPIA 3GZ6A 3NEUA 2A05A 1UJ8A 2HKOA 4PFPA 3CCJI 2QA4I 3CF5F 3EYIA 1H89C 5KK1A 1WJCA 1R1TA 2VJ4A 2RV8A 3NQOA 1XMKA 4JQFA 4CUGA 4EEFG 5ILVA 5LGTA 1A36A 2XGEA 3KP2A 1QU3A 4JX5A 2IAIA 1G2HA 1D1BA 2A6EF 5TISC 4XLPF 1IN6A 4DIQA 3ZMTA 5M3MJ 3CZ6A 1KYZA 3VYSB 1Y0NA 1WH5A 4S0HB 1U78A 4IXAA 4P1WA 2Z33A 2A5YB 2VBWA 1MMAA 2QBYB 3CD6I 4MFDA 3HYIA 4D7NA 4LK1F 3BTJA 3MMYB 2M9HA 3OOUA 4L9NA 3ISPA 2QQBA 1YYVA 2R7DA 5GTIC 4M71A 1HW5A 1ZHFA 4XRSG 1BA5A 4XR6A 3F3XA 1FLIA 1QZZA 1ZREA 5TRDA 2NVQJ 3GW2A 5CVJA 5DS9A 2QGUA 5LBQA 3N97A 3KFWX 1PDNC 4WF2A 1ZQ3P 2ID6A 1MJ9A 2WB1A 4P9FA 2KJBA 3OIOA 1QBJA 2M8GX 1ZAOA 5L3GA 1YQAA 4G8XA 1O3TA 1R5GA 4IZZA 1B59A 1RZ4A 2HU9A 2DDAA 3FMRA 5F08A 2QQ8A 1LKXA 5IT3A 1R49A 4D0PA 5JVTA 2X48A 2E60A 5EGOB 3BTIA 3DFGA 4QTRA 2R93J 5JVGF 2M4GA 5DD8A 3MFKA 2OA4A 3FDYA 2W84A 3HBLA 2COMA 4NC6A 3VFZA 3QOEA 1MSEC 4HQMA 1IXRC 4UUTA 2LTPA 1YITI 2JSCA 2LF7A 1YHQI 1IV6A 5HNHA 1LDDA 5LRSA 4GCVA 5LHIA 2JK3A 1MNEA 1OCCH 3F8MA 1ETWA 4LGWA 1G4DA 1Z91A 1H88C 1X58A 5F04A 2DODA 3FZVA 1A6IA 4NQWA 3GZNB 1J2XA 5HDGA 2WAFA 4ZDOA 2R0QC 4GXOA 4RLQA 3J81Z 1BC8C 2STTA 5FLXK 4N9IA 3H5RA 3KEOA 1F5TA 1B8IA 1WGXA 2VIXA 2VODA 3F9KA 2NAZA 2QEXI 2X6OA 3K4CA 1V54H 3JRBA 4E7KA 3UKGA 1SMTA 3GLLA 4Z6YA 2OTJI 4EM1A 2KJCA 1XC5A 4RA2A 2JTVA 3IWZA 3CJTB 4RGUA 3LNQA 3JR9A 1YW8A 1N25A 2ZXWH 4GYIA 3DTIA 2P5VA 2R5YA 1N75A 1QQIA 1Z3XA 5DUIA 3HZJA 3HL2A 1ZTRA 5E8IA 4L5JA 5IOZA 4AIHA 1MMNA 3QPTA 3CLOA 4ON0A 2OU2A 2DT5A 5CVRA 3QU3A 2ZXHA 2LBFA 1OCOH 1VQNI 1FYMA 1SMYF 4CSWA 2LG4A 2BXZA 1R5ID 1O57A 1B72A 1W5CC 4Y7NJ 2XF6A 1HKQA 2DDBA 2HXOA 4LJZF 2FBKA 3CO7C 1CF7A 3PUBA 3RQ4A 1IN4A 1V5EA 2JZYA 2VOPA 4L5IA 1IRXA 1YG2A 2CQNA 2IGMA 2BVMA 2G7HA 4PJNA 2UXXA 3PIOF 1G3TA 1I3AA 1IUYA 4C2TA 1S9HA 1Z1DA 2LY1A 1IGNA 4EJVA 1ENHA 4HQEA 1OISA 2HOSA 1Z7LA 1XGSA 5DD4A 3WODF 5C3EJ 3J81K 5CVVA 4BJ6C 2K86A 3CCEI 2LMDA 3GFIA 3ZMZA 5BMZA 4C30A 3FMSA 3HXLA 2LC2A 2L5QA 5D6FA 3SEZA 1ETOA 1FC3A 5IP6A 1JHFA 1F9NA 3LWFA 2DA1A 1Z3YA 2GA1A 2M4KA 1P4XA 2EB7A 2L0KA 1J09A 2Y0MA 3BT9A 2DPDA 4UUSA 4ZTJA 4IRIA 2I10A 3GMEA 4OINF 3MVPA 3REOA 4Q48A 4DNCA 3HTSB 1HKTA 2L3DA 3PNYA 3QWLA 1D3YA 2DA5A 3KCCA 1FX7A 1D0YA 5HODA 1MBGA 3W6KB 3OYGA 1X3UA 2N8GA 5KVRA 3HUGA 1JKQC 4G12A 1HA8A 2ZJRF 1FZPB 4CCLA 4I02A 2JA8J 3AKZA 2CH0A 1XDSA 2HVRA 4AU7A 3I3LA 5J4YA 4UV8A 4Q4ZF 4IRGA 3WTSC 4IPAA 4BJ5C 1ETVA 2HOAA 1OJLA 2FD5A 1MD0A 2V6CA 1TP4A 1VQLI 3HOVJ 1USSA 1IAWA 2IS1A 2R7TA 3DF8A 4A3IJ 4EJWA 1D5VA 4PJLA 2CUFA 3GFJA 3GTMJ 1KQ9A 4UV9A 4A5MA 3HOXJ 3ZN0A 5FD5A 2IGKA 2DA2A 1ONVA 2KIUA 2YX7A 1ZG3A 3NWTA 3P9KA 2XF7A 3LA7A 4BXXJ 2ZO4A 3H3VK 3VYRB 1UG2A 3OR2C 3ML6A 2FJ1A 1WVRA 1IF1A 2RQPA 2W1OA 1B8IB 1WJBA 2GXAA 1Y1VJ 5ICFA 1ZRDA 3BPVA 3G3ZA 2KP6A 1ZR2A 4LFUA 2IA1A 2WWYA 2M7AA 1TLHB 3H5AA 2YUSA 1PUFA 1MBJA 2DTZA 1ZG5A 2VBXA 4IVNA 3LAPA 2EV6A 1UG0A 2W4SA 5FKKA 4C2UA 3HOUJ 2A6HF 4A93J 1F36A 4M3BA 2DN0A 4XRMA 2R5YB 1N77A 1T33A 2XPWA 2HGCA 1BR1A 4BQNA 2X6XA 3J80K 4ENMA 1FPQA 1QA6A 1OYWA 2L4MA 4AWXB 2KPMA 5KCMA 3SZPA 1QZEA 2JA5J 1FOKA 4N4NB 5DEQA 4XNFA 2LBFB 3WTTC 4RB0A 4AVZA 3DU6A 4B09A 2ZJ2A 4HPQA 3SFZA 4ENKA 2ZNZA 2IS2A 3ASNH 2QVOA 3PQKA 1TWFJ 1FP2A 3BZKA 4NNJA 4DZJA 3MZHA 2EFPA 3S2DJ 1IXCA 1V5GA 1CF7B 1TZLA 2HYFA 2EIMH 3PJRA 5HS9A 5L3DA 3OL4A 2NS8A 3HEFA 2HQAA 4M3GA 1P2FA 1PVEA 5HVQC 3O6BB 3R4KA 1S72I 3M8EA 3SJMA 2TCTA 4WCGA 2EINH 4N0BA 2KDOA 3CP8A 1FYLA 2XPUA 4CYCA 1IC8A 2DK5A 2F4OB 3AAFA 1LEAA 1XS9A 5B1BH 4U7BA 2DA4A 4OIRF 4BHBA 4DQ2A 4ZYEA 2DQLA 4EATA 2B63J 2EH3A 3IV5A 1QVUA 1R4MB 3L09A 4KIFA 4M3FA 2PLYA 3OYEA 2F5FA 5GPCA 5EZHA 4ITVA 5FO5A 2DT6A 3QQAA 3RKQA 2CV1A 2MG4A 5C44J 3VSLA 1IW7F 3CQZJ 4RB3C 4IHSA 1IRZA 3WGHA 1TNTA 5TGTA 3I5UA 3RPUA 2E7WA 3FF5A 4H0EA 4BE0A 2OC6A 4ZYAA 4RDUA 2IRFG 1E17A 4LG3A 4C3JJ 2P6TA 4IL6C 4GRIA 4ZYHA 4HX8A 1UZCA 1V5FA 2MLKA 5GPAA 2WTEA 4I09A 4CZZA 3KPHA 2FQ3A 3TOAA 3FXKA 1FWZA 4AIDA 4AD9A 1IG7A 1WCMJ 3E5XA 3BG3A 3BWGA 4NB5A 3D0SA 1JT0A 4YFKF 3FXJA 1ITYA 1D1CA 4W1UA 4P96A 1GVJA 1QNTA 3R0AA 2ZBKA 3HB9A 1JXSA 2GXBA 4XSXF 4HA8A 3RZDJ 2K3FA 1JT6A 2ZNYA 4E4HA 1IN7A 3JRHA 4DW6A 2MA3A 2X6YA 3CCQI 2O9LA 1ERDA 1GXQA 1MW7A 4IX7A 1NTCA 3A4CA 2V7FA 5FB2A 2W82A 3G73A 4ZC3A 3D5LA 5HLHA 2F6CA 4V19K 3IHUA 3LSKA 3H0GJ 1QPMA 3LSIA 5JI6A 3S1QJ 5DM6F 2BHZA 1MH3A 1HCRA 2M1BA 4LIUA 4PJ0C 4CDGA 1AKHA 1AOYA 4XKVA 2E2HJ 4A3MJ 1FEXA 1JUMA 2E19A 3FXOA 5E3LA 2DFEA 2FE3A 3FM5A 4AYBA 2OCEA 1SFKA 3G1MA 1LVKA 1T0FC 3JAMZ 3OOPA 1RKWA 3OYDA 4D1QA 2K40A 2MW8A 4D5FA 5BS6A 4HV5A 2FU4A 4WX9A 3GTKJ 2R3SA 1ZARA 3WHCA 3T8TA 2DCEA 3GUDA 2DO7A 5LRRA 1T39A 1SD5A 1XGNA 3JW4A 5L3FA 4HRIA 2Z5UA 1Z7UA 4ZJZA 1IDYA 2CFXA 2RQQA 4MGRA 2DXIA 4KIGA 1DPUA 1HF0A 3DPLC 2XC7A 2Y30A 4MIMA 1WJEA 5E18F 4XORA 4XOTA 1USTA 2HQRA 2BOLA 3M3YJ 2HQ5A 1SD7A 1HBXG 2HYJA 2BYVE 3BROA 5ILUA 1NH3A 1TWCJ 3OIPA 1I50J 2P0WA 3TMOA 3UNGC 5J1YA 1I6HJ 1W4MA 3CUQC 4A3JJ 3D1NI 1SAUA 5K7FA 4M9XA 1ZYRF 4GGGA 3AL0C 4PSWA 2WADA 3VOEA 3HIFA 3HGYA 3S1RJ 3WTVC 1WHUA 3BR0A 5E1WA 1XX5A 4E70A 2E35A 4BY1J 5GP9A 5E3NA 1WFXA 2DJIA 1DUXC 2WAEA 1OCTC 3KP7A 2HWVA 2P6SA 1QVTA 4IF4A 1S7OA 2KISA 4XMYA 2F4MB 2W25A 3NRVA 4Z2YA 3ZMUA 2X0LA 2K02A 4CYCB 4B43A 3GEZA 4LLLA 3SFIA 2LKPA 1VQPI 3CCYA 3CC7I 2ESHA 2LSOA 2L2OA 2CQQA 5F64A 2PX9A 4ETSA 2L9VA 3K4KA 4UB6C 1ON1A 4A3BJ 5DCMA 2L9SA 4DGWB 1BOAA 1T56A 2FEZA 1J7KA 3CCLI 3CDLA 3HKZN 3WGGA 1JTYA 1I1GA 2Q2EA 4XLHA 2OQGA 4BACA 1K6OA 1XGMA 2QZ8A 3HRMA 1HDDC 4HLYA 1HOMA 4B47A 4GFBA 1WH7A 4A6EA 1ETXA 1NHAA 3OR1C 1YTYA 3DP7A 3K1PA 2HVQA 3I64A 4Q5SF 3F8CA 2BHYA 4L9TA 4YIRX 1X1DA 3BCAA 5FGMA 3RZOJ 4XBFA 4B4CA 2LD5A 4CZCA 1A35A 2E34A 4KJZA 3PFYA 3B73A 3WTYC 3KP6A 2STWA 1L3LA 2KRCA 3IP4B 1IDZA 1HSJA 3HOSA 3R61A 1T8IA 4A3KJ 3DU5A 1G6NA 2BBYA 5H6RA 3C1DA 1MIJA 1PYVA 4MEYF 3M8FA 3PO3J 4R8HA 3ZR8X 5LHHA 3DPTA 1EV7A 1Y8QB 1ZLJA 3GTGJ 2R7SA 2LFBA 4YIIA 2M2EA 2I5UA 2BW3A 1XSVA 5J3LA 1Z6TA 4CCNA 3ZQGA 2GBYA 2JA2A 3GLXA 1AKHB 4H4KC 1Z05A 3S3OA 3LSJA 2WAQN 5E3OA 3HDDA 4YRVA 3HGGA 2VKDA 4I6ZA 4Y4RA 2EZIA 3F8BA 3V4GA 4HDVA 1GDTA 3D5SC 2Q1ZB 5FJ8J 2KL4A 2COBA 2EJRA 1REPC 1X4PA 3K2AA 2FMYA 2YSRA 3BC8A 1I39A 4V2FA 3RKYA 2FF4A 4N9HA 5B5EC 3KP3A 3G71I 2Z9OA 4XM3A 4ZDPA 1RIOH 1MDMA 3B02A 2DQRA 5ILSA 3RSNA 1O7LA 3OS1A 1JI8A 4ZH4F 1VFCA 3ASOH 3ZRGA 3OV8A 2PEXA 1G3WA 3DEWA 2Y9ZA 1YIOA 1KQ0A 3QP6A 1GV2A 3RIRA 4BHCA 1EH6A 1U3EM 3I4PA 2XASA 5GAGJ 2DI3A 5IY5H 2K4JA 2XKOA 1SVLA 2A68F 1EH8A 4HOBA 4X0GA 1U5TA 3SYTA 1B4AA 3E97A 1U5TC 2VE8A 3WG7H 4A3LJ 2HQNA 3DKYA 5E3MA 4NHJA 2JN6A 2ZB9A 3K10A 5F0CA 1BOBA 3I71A 2MSYA 4J01A 4R1HA 3DLAA 1ORKA 4UXNA 3LAJA 3WTZA 3LQQA 5BPDA 2E5ZA 3X2QH 5FLXZ 4ENJA 1X4OA 3W6VA 1KA8A 1U9OA 3LFUA 1A04A 5EG0B 1UMQA 1Q1HA 3ECOA 2A69F 1JUSA 3ZCOA 5DDGA 2X51A 3JSOA 2HEOA 2O8KA 3PUFA 4LLGF 3FMQA 3KX2A 4XKWA 1KU9A 4AIKA 4QSHA 4IHWA 2LKSA 2QQ9A 4PGHA 1ETYA 5E8GA 2R4GA 4MQVA 1OR7A 3OMYA 4QWQA 5DCMB 1OR7C 3WHBA 3Q0VA 2VJ5A 4XOPA 2XAUA 1KU2A 2X1CA 3HHGA 3LA2A 3LSMA 2DYRH 3K4NA 5DM7F 3L1PA 3FX3A 2LK2A 3OYFA 1BL0A 5K5RA 1AHDP 1IN8A 4ZDLA 2JVGA 2JT1A 3B6AA 3GF2A 2HDWA 3ULQB 3W6JB 4F52A 3IC7A 4EM2A 4BXUA 3DKWA 2JPCA 3VSKA 5K5OA 2OJED 4HSRA 5J40A 4FX0A 3TGNA 2LREA 2VQHA 5EEAA 6PAXA 3Q9SA 3CLQA 1R36A 3ERED 2L01A 3DV8A 3ZQQA 5BOXA 2YPRA 2E5NA 4FQGA 3J7ZI 2QYOA 3S8PA 4O6JA 4HDUA 3GWZA 4Y33A 5JLXA 3ESWB 2DMQA 2DPUA 3P7NA 3CC2I 2KZGA 2QSFX 3BY6A 3RQIA 3S2WA 1GHCA 2P7VB 2X85A 2ADUA 1W7PA 2LLKA 2PMHA 2XUBA 3GTOJ 3T1BA 2G0EA 5JHUA 5E20A 4KNYA 4OU0A 1R5HA 3BJOA 3L2UA 2W48A 1DU6A 2GZWA 2HNHA 4MO7A 5J1UA 5CVIA 5F1JA 3JRAA 2EZKA 5E1ZB 1FIAA 4RAFA 3FHNA 5FFXA 2EILH 2MH9A 4MFEA 4XLEA 4BBRJ 2L54A 2OV7A 5GTHC 1D5YA 2CJJA 2QM3A 3CF2A 2BW3B 2VKHA 1UB9A 3OSGA 4RLFA 3TO9A 2ZFWA 4E6KG 3I59A 2FOWA 3TW6A 2LNBA 2VQLA 1OCPA 3M07A 2IT0A 2CFOA 4FTHA 2RN7A 4U0YA 3CO6C 1MBFA 1W0TA 3CCVI 4CH7A 1O3SA 3SHFA 2CSOA 2V4JC 2IS4A 1MH4A 3F21A 4BY7J 3K4JA 3OS2A 1P4AA 2QQAA 3F22A 4ZTFA 1NG6A 5ED4A 4RAZA 4KFCA 4Y52J 1DGRM 2Y48A 1WWXA 2IVMA 4XLNF 1MDMB 3BQYA 1VQ4I 3E6BA 3IAM2 4QLCU 2HFHA 2Z3YA 2VXDA 4BHPA 4DYCA 4HF1A 2Y0SN 5DTDA 2RAEA 1ZGJA 2XV4S 2YR2A 4FASD 2D45A 1BI0A 1POGA 2WA0A 4Y17A 3L2RA 4C2MJ 2EPFA 3GTJJ 2OTLI 2EZHA 2L7FP 5ERIA 1R71A 2JQ7A 4LLNA 2VQCA 3Q3SA 3T5XA 1X1BA 5IT9K 2MFZA 3FKJA 1FOWA 1VQOI 2R7WA 4EJUA 4I76A 2X9DA 1JUPA 4I2OA 4IKFA 3W3CA 2O6GE 3ONQA 3EETA 2GOMA 1DP3A 2ICWG 1OQYA 4AUXA 5B1AH 2NS0A 3BJAA 4KYWA 1PUEE 4AC0A 2J5PA 4HNTA 4RB1A 2ESNA 2DU9A 3GFMA 1FY7A 2Q0OA 1D0XA 3CJRB 3PQJA 4ZYDA 2B0LA 3TOBA 1Z67A 4L5EA 2DLLA 5IYDJ 4B1RA 3ZQ7A 2X1EA 3BQZA 3GO5A 2E2JJ 5FD6A 2FUG2 2UZKA 4JBAA 2CW8A 2MGQA 3CCSI 3OYCA 2H27A 2JJ7A 5J6XA 1STZA 4RAGA 2JA6J 4Y15A 2ZXJA 3ZQIA 3KYLA 2E1MC 2HYGD 2R5ZA 4Q47A 2F5DA 1BI1A 3CUOA 4EGYA 1LDKB 3P9IA 4NBQA 3ZN1A 3I55I 3JCUC 2KZVA 5IOYA 3J80Z 1S7AA 4HSTA 5LD2C 1MNMC 1V3FA 2FX0A 3JTHA 1TBXA 5LGUA 1QHHD 4IQ4A 3ZGKA 1JGSA 4WK8F 4CICA 2A3SA 4EQQA 4HNUA 3LMMA 1H9TA 4XK4A 3CP2A 3H36A 5ICGA 2CYYA 1RRJA 1GV5A 2PG4A 3VYUB 2XF5A 4XONA 1XPXA 1YRNA 2K27A 3IL2A 3KLOA 3P5JA 4M72A 1K6YA 2L7ZA 1OYIA 4I01A 3VEPA 2PQ8A 4ABZA 2CV2A 1WQ2A 3JRCA 3MZ8A 2H6CA 1MJAA 2E36A 4NQWB 3OYAA 3HPGA 5J47A 4XKCA 1Y39A 4BQOA 1WSUA 1PP8F 3OYBA 1H0MA 3WU2C 2HPMA 4MQ9F 4DOZA 2ZMEC 1R1VA 2L4AA 5AONA 1SAXA 1T95A 4AM3A 2O0YA 3QU6A 3I59B 3QODA 2L7KA 2R7ZJ 4RBOA 1QGPA 5J1RA 3TKYA 1QHGA 3KLNA 4G6DA 1TTYA 3J7AO 4OAZA 4DYQA 5FRMA 3R0JA 1OMIA 4HYEA 2VE9A 2KRFA 2WB1N 1YI2I 1XSDA 1BJZA 4K2EA 3MKYB 3FK7A 4IQJA 3E5QA 2B9SA 2WBMA 3WU0A 2PMZA 3HKZA 2K9SA 3V8KA 2O3FA 2FOKA 3KETA 3SDBA 2XB5A 3F6OA 2MYSA 2NXNB 2RKHA 2OD5A 3FXQA 4EM0B 2NVXJ 2VBYA 1WJ5A 5L3EA 1KONA 1VI0A 5BQTA 1FOYA 1B72B 4U88A 3ZQFA 1K4TA 3CDIA 4Y13A 2CS3A 3ZQHA 2BEOA 2JWTA 2Q8KA 1TWAJ 4LD5A 2QKLB 3SQNA 4D7MA 1H8AC 3MKLA 3C18A 2WV0A 3RJPA 2E7XA 5FFZA 3HM5A 3KIOA 4QIWN 1VQ7I 4WXDA 3HTUA 3DLLF 1KGSA 1R4NB 1SD4A 2JPBA 2FSWA 3QPSA 3IH4A 2H8RA 4ESJA 4YFXF 2XAQA 4Y3OA 3TO6A 2VQGA 2XB0X 4JX6A 5EJCA 3WTWC 3G2BA 1F1ZA 3AFHA 1OFCX 3AG3H 3VWBA 1T98A 1PP7U 4CCKA 1C0WA 3CMYA 2CUZA 3O2PE 3JSPA 4BE2A 1YLFA 3PFIA 5KAFC 5FLMJ 1YS7A 5M5WJ 3HHHA 2GM4A 2JVHA 3K70D 4PK4A 1Z21A 4M3DA 2HOEA 3C2GA 5TJJA 4UUSB 2HXIA 4XN3A 4NC7A 2MC3A 1E3HA 2WAQA 2DYSH 3M1CA 3A0BC 2G9WA 3I56I 4I99C 2R5ZB 3BR3A 3HUGB 3V7SA 2V1DA 1TQMA 3SEQA 3W2AA 2ECBA 1BI3A 4A12A 3VYTB 3DBHB 3OWTA 2V1NA 4F3QA 2QKMB 5EEGA 1IV8A 1NG7A 2DA6A 3SXYA 2GLOA 5A2QZ 2CGPA 1EJ9A 5FRNA 2Z99A 3S14J 3GCMA 2XHKA 4B3XA 3KZIC 4X1EA 4XN0A 3DEUA 1G59A 1D1AA 3U2RA 3N4MA 4BE1A 2RNGA 5JFRA 5HDNA 3RKWA 1JKRC 4A3DJ 1ACIA 3EUHA 4M3EA 2XGDA 2F48A 3F0CA 3LSRA 2CMPA 1D8JA 3EUHC 4IJAA 1TT5B 1O3QA 3MD2A 1T08B 1LUJB 1ODDA 3MAJA 4C3HJ 4XSZF 2OAZA 4BH9A 3ZQLA 1T0FA 3ABTA 3RPUD 5HS7A 1FJLA 3AG1H 1MSFC 2V9VA 3S32A 5DUKA 4E7LA 2DMNA 5IP7J 3GTLJ 1OYYA 3S3NA 4IOAF 3MWMA 2ZXIA 1W5SA 4EJOA 3F8FA 2DA7A 4HAMA 4WXHA 4M9SA 2H6BA 1J59A 5K5QA 4M74A 1PUFB 3MQ0A 3MKZA 2FBIA 2ISYA 3H9GA 5HLGA 3KEQA 3K7AJ 2MD0A 2P4WA 1T6SA 1DP7P 3KYDB 4E7HA 3H9JA 2V9KA 4IHTA 3RDIA 4M6XA 2XDVA 2IPQX 2ZFUA 1YW7A 2RDPA 4BL0B 1BBYA 5IYBJ 3RI4A 4C9YA 3DKXA 4ENNA 1TWHJ 1VNDA 1RUOA 2JRTA 1XMXA 3U21A 2VBZA 3CUQA 1MMSA 2Y2ZA 1BIBA 4ASNA 2KIFA 5A2QK 3RCOA 4II2A 3LSPA 5HDKA 4BDZA 1JTXA 2KT0A 1LQ1A 4L9JA 4EVIA 1MJBA 1LDJA 4A3GJ 4EV0A 3IAS2 3TP0A 3HG9A 1YFHA 4MLOA 4CCOA 2UXNA 2OF7A 1FIPA 3F72A 2EIKH 3JRDA 3HC7A 5ICCA 1G3YA 5DV5A 3GVAA 3J7YJ 2LYCA 1A31A 3BLYA 2H09A 3G1LA 2QSHX 3JREA 2WY7Q 4AIJA 3QAHA 1WJDA 3HRUA 1Y56A 4UVCA 4OWRB 3H0DA 3E7LA 3MZYA 3JRGA 2DFFA 4RGRA 4OMYA 4BAYA 3K1MA 1XG1A 2JMWA 2KIQA 4P9UA 3CCUI 2P81A 4JX4A 1IZ1A 2XAJA 1FP1D 3ZP5A 5EZGA 3IH2A 3OL3A 3U9GA 4EMSA 3BR5A 1I5ZA 1WJAA 3WU1B 3RKXA 1XD7A 4EJTA 1UFMA 4II3A 3OYIA 3CJNA 1P6RA 2JUGA 4HW0A 1GXPA 3M4OJ 4HZFA 1V4RA 3RTRA 3NARA 2K7LA 4E7ZA 1F4KA 5EYRA 3K6GA 1YOVB 4BJTA 1I1SA 1P4WA 4BUPA 3LSGA 2BV6A 1HSTA 5GAHJ 3OYLA 3IRRA 1W36C 3BR1A 2R7XA 3NAUA 1SFOJ 1ETQA 1ZK8A 3F23A 4FX4A 1KYWA 3H1CA 4U0WA 2LRDA 1PJRA 4G7HF 3TDZC 2XROA 3CMMA 1JKOC 4UHTA 1VQ8I 1TT0A 2FNAA 2F5CA 2XGCA 3H5NA 1YJNI 1ZELA 3D5RC 5J8CA 1P7IA 1O3RA 4A3EJ 3ROUA 1HQCA 1BIAA 1TNSA 2TRTA 3CCRI 1K7AA 5EGOA 4KITB 2CQ7A 1NK3P 3E6MA 5D6EA 4RS8A 1JJ8C 2E1NA 3S16J 1UAAA 2ME6A 3PO2J 2R92J 4F91B 3QPHA 4U7DA 4BQAA 1SVMA 4G9YA 4PJJA 1R9TJ 2PN6A 4L0YB 3CMEI 2KHMA 3E3VA 1YW9A 5L3CA 2KLOA 2V79A 1S6LA 1J9IA 2UUZA 4MNUA 3HOWJ 3EQLF 3I54A 2M5WA 2EA2A 5CYVA 3RPQA 4GDFA 2ZC2A 1IXSB 3FKIJ 3HOYJ 4CYDA 4KICA 1TC3C 2LY2A 1L0OC 2ECCA 1R7JA 2MBFA 2HPIA 3L7WA 3C3WA 4KN4X 2Y75A 2HR3A 1MZBA 3I58A 3VDXA 1F43A 2D1VA 1ZH5A 2JSPA 3HOTA 1KU7A 3H9QA 3O8GA 1U0JA 1XCVA 5KAIC 3ZXSA 5IYCJ 4L18B 5C4XJ 3A2KA 3PL8A 5B66C 4MEXF 1FBQA 2OBPA 3WTXC 1SFEA 3KZYA 2LF8A 2ZSHB 2AHQA 3O8HA 4G94A 5M3FJ 3LFKA 5AIQA 3OIQA 2M34A 2EQRA 3PIPF 2NS7A 2KDZA 1I3QJ 4G7OF 3E5UA 1HW1A 1XCBA 2IBDA 4U0VA 4OIOF
chains in the Genus database with same CATH topology
3TQNA 4A0ZA 3CUQB 4OIPF 2EV5A 1BM9A 2RVCA 4WWCA 5F6FA 2HZTA 4HF2A 3EYYA 1FSEA 3H3ZA 3K0LA 1CGPA 1FT9A 4S04A 1XGOA 4XRFA 5LGNA 1TQPA 1R58A 2MLGA 4UUVA 2AXLA 1H9GA 4ZZLA 3P9CA 5HLIA 2PI0A 5D8LB 2P5KA 3RYPA 4JK1X 2CG4A 1XN7A 2A07F 1IRGA 2WC2A 1R00A 3GYHX 1ZN2A 5E17F 3BP8A 3IKVA 1E2XA 4HX4A 4HX7A 4ZZDA 3QP5A 1K79A 2GXGA 3VB2A 3K9TA 3ZMDA 1Y0UA 3WGIA 4L9VA 4I0BA 2L02A 2PMUA 1RI7A 3CDHA 1S8NA 2M87A 2TDXA 3KZZA 4O3MA 2F5EA 3ZMSA 1TQIA 1HKSA 5IT9Z 4CHUA 4HBLA 3WE2A 1XB4A 4MTDA 1LJ9A 5F1RA 1DDNA 3DXJF 2RNJA 4LB6B 4UVAA 2QUFA 3HSEA 4OOIA 4RAYA 4R79A 2FXAA 3KP4A 1XSXA 4PDKA 2ISZA 3L9FA 3WE3A 5E1XA 2DTRA 1MKMA 2BGCA 3ZMVA 2HS5A 5D5WB 2PFBA 1MGTA 2AS5F 1ZLKA 2ETHA 3FWEA 3IKTA 4FHTA 5LLQA 3EDPA 2D2WA 2EK5A 1W7PD 1ULYA 3GZ5A 3ECHA 1W5TA 2EFQA 3TDUC 2F2EA 5D5XB 5H20A 2CW0F 1U5TB 3QRFF 1R1UA 2XGXA 3ELKA 4A5NA 2NNNA 4LMYA 3V8JA 4ZYGA 3Q5FA 4BYYA 3I0TA 3VODA 1OPCA 2IP2A 3M1EA 5LEJA 3L00A 5AIPA 3TO7A 2GWRA 2DAOA 1ON2A 2ZKZA 1K78A 3T8RA 1UHMA 2M45A 4G6QA 3KE2A 4LB5A 2FBHA 1R23A 2NNYA 4L0ZB 3T0YA 5D5VB 1LNWA 4S05A 3GXOA 2M30A 1UHWA 4TV7A 2MD5A 1LEBA 1WKMA 1W7PB 1YS6A 3K69A 4IRHA 4RB2C 1LB2A 2HKXA 5CVUA 1D8KA 1U6GA 2VC0A 1ZRCA 2GQQA 1J75A 2HDCA 2NYXA 2ZMEA 4UVBA 3V7RA 4A2UA 4A0XA 2YX4A 1XMAA 4GO1A 2EWNA 4A6DA 1BJAA 4G7ZF 1TW2A 3IWFA 2OQRA 2P8TA 1B6AA 5HS8A 1SFXA 3HSRA 2DFIA 3DQVC 3H3UA 3F6VA 1BC7C 2UWMA 4PGGA 1VTNC 5D4RA 1BN5A 2XRNA 2P5LC 3BPXA 5DYMA 4GYGA 2IA2A 1QO0D 3FXUA 5JR3A 3U1DA 1B9MA 2W85A 4MTEA 4WXCA 1FYKA 4KUMA 4P5OA 1FNNA 4KIBA 1JE8A 2DBBA 3Q9VA 3FM3A 1WI9A 4CGZA 4CO8A 5LHGA 2CWEA 4LG0A 4OIQF 2NRAC 2GA2A 2EFNA 2FA5A 1FSHA 2W24A 2W57A 1O7FA 2ZCWA 1DPRA 2CO5A 1IN5A 2XIGA 3R60A 1K78B 2MH2A 3BDDA 2O03A 2LDUA 2XAHA 3FXRA 5ICEA 5HOOA 2XKPA 1B1BA 1G3SA 4M6YA 3I53A 1HW2A 2J5OA 2C6YA 4RGXA 2G7UA 2VXZA 4F7ZA 1BI2A 4HV6A 4KT5C 2IJLA 3LA3A 1IRFA 4ESBA 4BNCA 4PCQA 3L2CA 4HLXA 3O3KA 4M9ZA 2FMLA 4HF0A 2X4HA 4LK0F 1J0RA 3MEXA 4YIFA 2YU3A 3HRSA 2ZMEB 3IRQA 1T38A 2O61A 3GX4X 1U2WA 2E1CA 2VOOA 3BZ6A 5DCFA 2XAFA 5D5UB 5D4SA 2VONA 2V1XA 2KKOA 4P55A 2ELHA 2M8EA 2O8XA 2OZ6A 3H92A 4B8XA 1S3JA 2CQKA 2IA0A 2QLZA 4M73A 3HRTA 1AWCA 4KA4A 2HTJA 3K1NA 2BE5F 4I98B 2QWWA 3BOQA 4A0YA 2OZUA 3E6CC 3BJ6A 1TW3A 2P7CB 4YFNF 1HXDA 1KU3A 4RGSA 1XDUA 5L3BA 4PZJA 1FBUA 1EH7A 1R22A 3R6SA 1QZYA 2VT3A 1KQ8A 4I0AA 4MHGA 3M9AA 1RNLA 3C7JA 3RYRA 2DW4A 3CTAA 4EGZA 2PJPA 1JHHA 3FHZA 2VT2A 2DK8A 5J8FA 2QBYA 4UNOA 3WG9A 4LG0B 3V8LA 5CLSA 2QENA 4ESFA 1ZGAA 3JAMK 3ZPLA 1P92A 2EFOA 1J5YA 1SD6A 1U8RA 2KIMA 2R7FA 1Z9CA 2EA4A 4CXFA 1WRJA 2XVCA 2PBIA 4YG2F 1I6XA 3LSTA 3MCZA 5CJ9A 5EEHA 3COAC 1LVAA 4KMUX 2GIVA 3SZTA 2V1UA 1RUNA 1FBSA 2VN2A 1S29A 1UCRA 3KP5A 2RGVA 2D1HA 4I7HA 5LEKA 4KDPA 4KMFA 2EFWA 3E6DA 2A61A 3WTUC 3HSFA 4OMZA 1T2KA 1OKRA 2K4BA 4FT8A 5K1YA 1I27A 4AVPA 3GFLA 1ZRFA 4O5VA 5H6QA 1Z6RA 3V7CA 2FNPA 2IW5A 3JTGA 1YO5C 3K2ZA 2RC4A 5D8KB 1SFUA 3F8NA 4KN7X 1ZG1A 2ACJA 2FRHA 3LQRA 2XAGA 2EV0A 3ABUA 2GAUA 2HTSA 3M7GA 3QOPA 2VC1A 2H94A 1B9NA 5BPIA 3GZ6A 3NEUA 2HKOA 3EYIA 5KK1A 1R1TA 3NQOA 2RV8A 1XMKA 4JQFA 5ILVA 5LGTA 3KP2A 2A6EF 4XLPF 1IN6A 3ZMTA 1KYZA 1U78A 4IXAA 2Z33A 2A5YB 2VBWA 2QBYB 3HYIA 4LK1F 4L9NA 3ISPA 2QQBA 1YYVA 2R7DA 4M71A 1HW5A 1ZHFA 3F3XA 1FLIA 1QZZA 1ZREA 5TRDA 3GW2A 5CVJA 5LBQA 3N97A 3KFWX 1PDNC 4WF2A 1MJ9A 4P9FA 2KJBA 1QBJA 1ZAOA 5L3GA 1YQAA 4G8XA 1O3TA 1R5GA 1B59A 1RZ4A 3FMRA 5IT3A 4D0PA 5JVTA 3DFGA 3MFKA 5DD8A 2OA4A 2W84A 2COMA 3VFZA 4HQMA 1IXRC 2JSCA 2LF7A 5LRSA 1LDDA 4GCVA 5LHIA 3F8MA 4LGWA 1G4DA 1Z91A 3FZVA 4NQWA 1J2XA 5HDGA 4GXOA 5FLXK 3J81Z 1BC8C 2STTA 4N9IA 3KEOA 1F5TA 2VODA 2NAZA 1SMTA 4EM1A 2KJCA 2JTVA 3IWZA 4RGUA 1YW8A 4GYIA 2P5VA 1QQIA 5DUIA 5E8IA 4L5JA 4AIHA 4ON0A 3QPTA 3CLOA 2OU2A 2DT5A 5CVRA 3QU3A 1FYMA 1SMYF 1O57A 3CO7C 1HKQA 1CF7A 4LJZF 2FBKA 1IN4A 2JZYA 2VOPA 4L5IA 1YG2A 2G7HA 2UXXA 1G3TA 1IUYA 1Z1DA 4EJVA 4HQEA 3J81K 1XGSA 5DD4A 3WODF 5CVVA 2K86A 3GFIA 3ZMZA 5BMZA 3FMSA 5D6FA 1FC3A 1JHFA 1F9NA 3LWFA 2GA1A 1P4XA 2EB7A 2Y0MA 2DPDA 4IRIA 4OINF 3REOA 4Q48A 4DNCA 3HTSB 1HKTA 2L3DA 1D3YA 3KCCA 1FX7A 3W6KB 1X3UA 5KVRA 3HUGA 1FZPB 4I02A 1XDSA 4UV8A 4Q4ZF 4IRGA 3WTSC 4IPAA 1MD0A 2V6CA 1USSA 1IAWA 3DF8A 1D5VA 4EJWA 3GFJA 1KQ9A 4UV9A 4A5MA 3ZN0A 5FD5A 1ONVA 2KIUA 2YX7A 1ZG3A 3P9KA 3LA7A 2ZO4A 3ML6A 1IF1A 2RQPA 5ICFA 1ZRDA 3BPVA 3G3ZA 4LFUA 2IA1A 2WWYA 1TLHB 1ZG5A 2VBXA 4IVNA 3LAPA 2EV6A 2A6HF 2HGCA 3J80K 4ENMA 1FPQA 1OYWA 2L4MA 4AWXB 3SZPA 1FOKA 5DEQA 3WTTC 4RB0A 4B09A 2ZJ2A 3SFZA 4ENKA 2ZNZA 3PQKA 2QVOA 1FP2A 3MZHA 2EFPA 1IXCA 1CF7B 2HYFA 5HS9A 5L3DA 1P2FA 5HVQC 3O6BB 3R4KA 3M8EA 4WCGA 4N0BA 1FYLA 2DK5A 3AAFA 1LEAA 4U7BA 4OIRF 4DQ2A 4BHBA 4ZYEA 2DQLA 2PLYA 3L09A 4KIFA 2F5FA 5FO5A 1IW7F 4RB3C 4IHSA 3WGHA 1TNTA 3I5UA 3RPUA 2E7WA 3FF5A 4H0EA 2IRFG 1E17A 2P6TA 4ZYHA 4HX8A 2MLKA 2WTEA 4I09A 4CZZA 3TOAA 2FQ3A 1FWZA 4AD9A 3E5XA 3BWGA 4NB5A 3D0SA 4YFKF 4P96A 1GVJA 1QNTA 3R0AA 2ZBKA 1JXSA 2GXBA 4XSXF 4HA8A 2ZNYA 1IN7A 2MA3A 1GXQA 5FB2A 3G73A 3D5LA 5HLHA 3IHUA 1QPMA 5JI6A 1AOYA 2M1BA 4CDGA 2FE3A 3FM5A 3JAMZ 3OOPA 4WX9A 5BS6A 4HV5A 2FU4A 2R3SA 1ZARA 3T8TA 3GUDA 2DO7A 5LRRA 1T39A 1SD5A 1XGNA 3JW4A 5L3FA 2Z5UA 1Z7UA 2CFXA 4MGRA 1DPUA 4KIGA 3DPLC 5E18F 1USTA 2HQRA 1SD7A 1HBXG 2BYVE 3BROA 5ILUA 1W4MA 3CUQC 4M9XA 1ZYRF 4GGGA 3VOEA 3HIFA 3WTVC 5E1WA 4E70A 1DUXC 3KP7A 2HWVA 2P6SA 4IF4A 1S7OA 2W25A 3NRVA 4Z2YA 3ZMUA 2X0LA 2K02A 3GEZA 4LLLA 2LKPA 2ESHA 2LSOA 5F64A 4ETSA 1ON1A 5DCMA 1BOAA 2FEZA 1J7KA 3WGGA 1I1GA 2Q2EA 2OQGA 1K6OA 1XGMA 2QZ8A 3HRMA 4HLYA 4A6EA 1NHAA 1YTYA 3DP7A 3K1PA 3I64A 4Q5SF 3F8CA 4L9TA 5FGMA 4XBFA 3B73A 3WTYC 3KP6A 2STWA 1L3LA 1HSJA 3HOSA 3R61A 1G6NA 2BBYA 5H6RA 3C1DA 4MEYF 3M8FA 4R8HA 5LHHA 3DPTA 1EV7A 1ZLJA 4YIIA 1XSVA 1Z6TA 3GLXA 1Z05A 3F8BA 3V4GA 4HDVA 2EJRA 1REPC 2FMYA 2YSRA 3RKYA 2FF4A 4N9HA 3KP3A 2Z9OA 1RIOH 1MDMA 3B02A 2DQRA 5ILSA 1O7LA 4ZH4F 3OV8A 2PEXA 1G3WA 1YIOA 1KQ0A 3QP6A 3RIRA 4BHCA 1EH6A 1U3EM 3I4PA 2XASA 2DI3A 2K4JA 2XKOA 2A68F 1EH8A 4HOBA 1U5TA 1B4AA 3E97A 1U5TC 2VE8A 2HQNA 4NHJA 3I71A 4R1HA 4UXNA 3LAJA 3WTZA 3LQQA 5BPDA 5FLXZ 4ENJA 1KA8A 1A04A 1Q1HA 3ECOA 2A69F 5DDGA 3JSOA 2HEOA 4LLGF 3FMQA 1KU9A 4AIKA 2QQ9A 4PGHA 5E8GA 4MQVA 1OR7A 4QWQA 5DCMB 1KU2A 3HHGA 3LA2A 3FX3A 5K5RA 1IN8A 2JT1A 3GF2A 3ULQB 3W6JB 3IC7A 4EM2A 4BXUA 3DKWA 2JPCA 5K5OA 4FX0A 3TGNA 6PAXA 3Q9SA 1R36A 3ERED 2L01A 3DV8A 5BOXA 2YPRA 2QYOA 4O6JA 4HDUA 3GWZA 2DPUA 3P7NA 3S2WA 3BY6A 1GHCA 2P7VB 2ADUA 1W7PA 2PMHA 2XUBA 3T1BA 5JHUA 5E20A 4KNYA 4OU0A 1R5HA 3BJOA 2GZWA 5CVIA 5E1ZB 5FFXA 2MH9A 2L54A 2QM3A 1UB9A 3TO9A 2ZFWA 3I59A 2LNBA 2IT0A 2RN7A 3CO6C 4U0YA 1O3SA 3SHFA 2CSOA 3F21A 1P4AA 2QQAA 3F22A 5ED4A 4RAZA 4KFCA 2Y48A 1WWXA 2IVMA 4XLNF 1MDMB 3E6BA 4QLCU 2HFHA 2Z3YA 4BHPA 4HF1A 1ZGJA 2XV4S 2YR2A 2D45A 1BI0A 4Y17A 5ERIA 4LLNA 3T5XA 5IT9K 4EJUA 4I2OA 2O6GE 3EETA 2NS0A 3BJAA 4KYWA 1PUEE 2J5PA 4RB1A 2ESNA 2DU9A 3GFMA 1FY7A 2Q0OA 3PQJA 4ZYDA 2B0LA 3TOBA 2DLLA 3ZQ7A 3GO5A 5FD6A 2UZKA 4JBAA 2H27A 5J6XA 1STZA 4Y15A 2ZXJA 2HYGD 4Q47A 2F5DA 1BI1A 3CUOA 4EGYA 1LDKB 3P9IA 3ZN1A 3J80Z 1S7AA 1V3FA 3JTHA 1TBXA 5LGUA 1JGSA 4WK8F 4CICA 2A3SA 4EQQA 1H9TA 5ICGA 2CYYA 2PG4A 2K27A 3IL2A 3KLOA 4M72A 1OYIA 4I01A 3VEPA 2PQ8A 1WQ2A 2H6CA 1MJAA 1WSUA 1PP8F 1H0MA 4MQ9F 1R1VA 2L4AA 5AONA 1SAXA 2O0YA 3QU6A 3I59B 1QGPA 3TKYA 3KLNA 4G6DA 1TTYA 3J7AO 3R0JA 1OMIA 4HYEA 2VE9A 2KRFA 1XSDA 4K2EA 3E5QA 3WU0A 3V8KA 2O3FA 2FOKA 3KETA 3F6OA 4EM0B 3FXQA 2RKHA 2OD5A 2VBYA 5L3EA 5BQTA 4U88A 4Y13A 2BEOA 2Q8KA 4LD5A 3SQNA 3C18A 2WV0A 3RJPA 2E7XA 5FFZA 4WXDA 3HTUA 1KGSA 1SD4A 2JPBA 2FSWA 4ESJA 4YFXF 2XAQA 3TO6A 3WTWC 1F1ZA 1T98A 1PP7U 1C0WA 3O2PE 3JSPA 1YLFA 3PFIA 1YS7A 3HHHA 2HOEA 5TJJA 2MC3A 2G9WA 3V7SA 2V1DA 1TQMA 4A12A 1BI3A 5EEGA 3SXYA 5A2QZ 2CGPA 2Z99A 2XHKA 3DEUA 3U2RA 3N4MA 5JFRA 5HDNA 3RKWA 3EUHA 1D8JA 4IJAA 1O3QA 1ODDA 3MAJA 4XSZF 2OAZA 4BH9A 1T0FA 3ABTA 5HS7A 2V9VA 5DUKA 1OYYA 3MWMA 1W5SA 4EJOA 3F8FA 4HAMA 4WXHA 4M9SA 2H6BA 1J59A 5K5QA 4M74A 3MQ0A 2FBIA 2ISYA 5HLGA 3KEQA 2P4WA 1T6SA 1DP7P 4IHTA 3RDIA 4M6XA 2IPQX 1YW7A 2RDPA 1BBYA 3RI4A 4ENNA 1RUOA 2JRTA 2VBZA 3CUQA 1BIBA 4ASNA 2KIFA 5A2QK 5HDKA 1LQ1A 4L9JA 4EVIA 1MJBA 1LDJA 4EV0A 1YFHA 2UXNA 3F72A 5ICCA 1G3YA 5DV5A 3GVAA 2H09A 4AIJA 3QAHA 3HRUA 4UVCA 3MZYA 4RGRA 4OMYA 4BAYA 3K1MA 4P9UA 1IZ1A 2XAJA 1FP1D 3ZP5A 3U9GA 4EMSA 1I5ZA 3WU1B 3RKXA 1XD7A 4EJTA 1UFMA 3CJNA 1P6RA 4HW0A 1GXPA 4HZFA 1V4RA 3RTRA 2K7LA 1F4KA 1I1SA 1P4WA 3IRRA 2BV6A 1HSTA 4FX4A 3F23A 1KYWA 4U0WA 4G7HF 3TDZC 2XROA 4UHTA 2FNAA 2F5CA 5J8CA 1O3RA 3ROUA 1HQCA 1BIAA 1TNSA 1K7AA 3E6MA 5D6EA 4RS8A 2E1NA 3QPHA 4U7DA 4BQAA 4G9YA 2PN6A 4L0YB 3E3VA 5L3CA 1YW9A 1J9IA 2V79A 1S6LA 4MNUA 3EQLF 3I54A 2M5WA 2EA2A 5CYVA 3RPQA 1IXSB 4CYDA 4KICA 1L0OC 1R7JA 2MBFA 3L7WA 3C3WA 4KN4X 2Y75A 2HR3A 1MZBA 3I58A 2D1VA 1ZH5A 3HOTA 1KU7A 1XCVA 4L18B 4MEXF 1FBQA 2OBPA 3WTXC 1SFEA 3KZYA 2LF8A 4G94A 3LFKA 5AIQA 4G7OF 3E5UA 1HW1A 1XCBA 4U0VA 4OIOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQN A;  4A0Z A;  3CUQ B;  4OIP F;  2EV5 A;  1BM9 A;  2RVC A;  4WWC A;  5F6F A;  2HZT A;  4HF2 A;  3EYY A;  1FSE A;  3H3Z A;  3K0L A;  1CGP A;  1FT9 A;  4S04 A;  1XGO A;  4XRF A;  5LGN A;  1TQP A;  1R58 A;  2MLG A;  4UUV A;  2AXL A;  1H9G A;  4ZZL A;  3P9C A;  5HLI A;  2PI0 A;  5D8L B;  2P5K A;  3RYP A;  4JK1 X;  2CG4 A;  1XN7 A;  2A07 F;  1IRG A;  2WC2 A;  1R00 A;  3GYH X;  1ZN2 A;  5E17 F;  3BP8 A;  3IKV A;  1E2X A;  4HX4 A;  4HX7 A;  4ZZD A;  3QP5 A;  1K79 A;  2GXG A;  3VB2 A;  3K9T A;  3ZMD A;  1Y0U A;  3WGI A;  4L9V A;  4I0B A;  2L02 A;  2PMU A;  1RI7 A;  3CDH A;  1S8N A;  2M87 A;  2TDX A;  3KZZ A;  4O3M A;  2F5E A;  3ZMS A;  1TQI A;  1HKS A;  5IT9 Z;  4CHU A;  4HBL A;  3WE2 A;  1XB4 A;  4MTD A;  1LJ9 A;  5F1R A;  1DDN A;  3DXJ F;  2RNJ A;  4LB6 B;  4UVA A;  2QUF A;  3HSE A;  4OOI A;  4RAY A;  4R79 A;  2FXA A;  3KP4 A;  1XSX A;  4PDK A;  2ISZ A;  3L9F A;  3WE3 A;  5E1X A;  2DTR A;  1MKM A;  2BGC A;  3ZMV A;  2HS5 A;  5D5W B;  2PFB A;  1MGT A;  2AS5 F;  1ZLK A;  2ETH A;  3FWE A;  3IKT A;  4FHT A;  5LLQ A;  3EDP A;  2D2W A;  2EK5 A;  1W7P D;  1ULY A;  3GZ5 A;  3ECH A;  1W5T A;  2EFQ A;  3TDU C;  2F2E A;  5D5X B;  5H20 A;  2CW0 F;  1U5T B;  3QRF F;  1R1U A;  2XGX A;  3ELK A;  4A5N A;  2NNN A;  4LMY A;  3V8J A;  4ZYG A;  3Q5F A;  4BYY A;  3I0T A;  3VOD A;  1OPC A;  2IP2 A;  3M1E A;  5LEJ A;  3L00 A;  5AIP A;  3TO7 A;  2GWR A;  2DAO A;  1ON2 A;  2ZKZ A;  1K78 A;  3T8R A;  1UHM A;  2M45 A;  4G6Q A;  3KE2 A;  4LB5 A;  2FBH A;  1R23 A;  2NNY A;  4L0Z B;  3T0Y A;  5D5V B;  1LNW A;  4S05 A;  3GXO A;  2M30 A;  1UHW A;  4TV7 A;  2MD5 A;  1LEB A;  1WKM A;  1W7P B;  1YS6 A;  3K69 A;  4IRH A;  4RB2 C;  1LB2 A;  2HKX A;  5CVU A;  1D8K A;  1U6G A;  2VC0 A;  1ZRC A;  2GQQ A;  1J75 A;  2HDC A;  2NYX A;  2ZME A;  4UVB A;  3V7R A;  4A2U A;  4A0X A;  2YX4 A;  1XMA A;  4GO1 A;  2EWN A;  4A6D A;  1BJA A;  4G7Z F;  1TW2 A;  3IWF A;  2OQR A;  2P8T A;  1B6A A;  5HS8 A;  1SFX A;  3HSR A;  2DFI A;  3DQV C;  3H3U A;  3F6V A;  1BC7 C;  2UWM A;  4PGG A;  1VTN C;  5D4R A;  1BN5 A;  2XRN A;  2P5L C;  3BPX A;  5DYM A;  4GYG A;  2IA2 A;  1QO0 D;  3FXU A;  5JR3 A;  3U1D A;  1B9M A;  2W85 A;  4MTE A;  4WXC A;  1FYK A;  4KUM A;  4P5O A;  1FNN A;  4KIB A;  1JE8 A;  2DBB A;  3Q9V A;  3FM3 A;  1WI9 A;  4CGZ A;  4CO8 A;  5LHG A;  2CWE A;  4LG0 A;  4OIQ F;  2NRA C;  2GA2 A;  2EFN A;  2FA5 A;  1FSH A;  2W24 A;  2W57 A;  1O7F A;  2ZCW A;  1DPR A;  2CO5 A;  1IN5 A;  2XIG A;  3R60 A;  1K78 B;  2MH2 A;  3BDD A;  2O03 A;  2LDU A;  2XAH A;  3FXR A;  5ICE A;  5HOO A;  2XKP A;  1B1B A;  1G3S A;  4M6Y A;  3I53 A;  1HW2 A;  2J5O A;  2C6Y A;  4RGX A;  2G7U A;  2VXZ A;  4F7Z A;  1BI2 A;  4HV6 A;  4KT5 C;  2IJL A;  3LA3 A;  1IRF A;  4ESB A;  4BNC A;  4PCQ A;  3L2C A;  4HLX A;  3O3K A;  4M9Z A;  2FML A;  4HF0 A;  2X4H A;  4LK0 F;  1J0R A;  3MEX A;  4YIF A;  2YU3 A;  3HRS A;  2ZME B;  3IRQ A;  1T38 A;  2O61 A;  3GX4 X;  1U2W A;  2E1C A;  2VOO A;  3BZ6 A;  5DCF A;  2XAF A;  5D5U B;  5D4S A;  2VON A;  2V1X A;  2KKO A;  4P55 A;  2ELH A;  2M8E A;  2O8X A;  2OZ6 A;  3H92 A;  4B8X A;  1S3J A;  2CQK A;  2IA0 A;  2QLZ A;  4M73 A;  3HRT A;  1AWC A;  4KA4 A;  2HTJ A;  3K1N A;  2BE5 F;  4I98 B;  2QWW A;  3BOQ A;  4A0Y A;  2OZU A;  3E6C C;  3BJ6 A;  1TW3 A;  2P7C B;  4YFN F;  1HXD A;  1KU3 A;  4RGS A;  1XDU A;  5L3B A;  4PZJ A;  1FBU A;  1EH7 A;  1R22 A;  3R6S A;  1QZY A;  2VT3 A;  1KQ8 A;  4I0A A;  4MHG A;  3M9A A;  1RNL A;  3C7J A;  3RYR A;  2DW4 A;  3CTA A;  4EGZ A;  2PJP A;  1JHH A;  3FHZ A;  2VT2 A;  2DK8 A;  5J8F A;  2QBY A;  4UNO A;  3WG9 A;  4LG0 B;  3V8L A;  5CLS A;  2QEN A;  4ESF A;  1ZGA A;  3JAM K;  3ZPL A;  1P92 A;  2EFO A;  1J5Y A;  1SD6 A;  1U8R A;  2KIM A;  2R7F A;  1Z9C A;  2EA4 A;  4CXF A;  1WRJ A;  2XVC A;  2PBI A;  4YG2 F;  1I6X A;  3LST A;  3MCZ A;  5CJ9 A;  5EEH A;  3COA C;  1LVA A;  4KMU X;  2GIV A;  3SZT A;  2V1U A;  1RUN A;  1FBS A;  2VN2 A;  1S29 A;  1UCR A;  3KP5 A;  2RGV A;  2D1H A;  4I7H A;  5LEK A;  4KDP A;  4KMF A;  2EFW A;  3E6D A;  2A61 A;  3WTU C;  3HSF A;  4OMZ A;  1T2K A;  1OKR A;  2K4B A;  4FT8 A;  5K1Y A;  1I27 A;  4AVP A;  3GFL A;  1ZRF A;  4O5V A;  5H6Q A;  1Z6R A;  3V7C A;  2FNP A;  2IW5 A;  3JTG A;  1YO5 C;  3K2Z A;  2RC4 A;  5D8K B;  1SFU A;  3F8N A;  4KN7 X;  1ZG1 A;  2ACJ A;  2FRH A;  3LQR A;  2XAG A;  2EV0 A;  3ABU A;  2GAU A;  2HTS A;  3M7G A;  3QOP A;  2VC1 A;  2H94 A;  1B9N A;  5BPI A;  3GZ6 A;  3NEU A;  2HKO A;  3EYI A;  5KK1 A;  1R1T A;  3NQO A;  2RV8 A;  1XMK A;  4JQF A;  5ILV A;  5LGT A;  3KP2 A;  2A6E F;  4XLP F;  1IN6 A;  3ZMT A;  1KYZ A;  1U78 A;  4IXA A;  2Z33 A;  2A5Y B;  2VBW A;  2QBY B;  3HYI A;  4LK1 F;  4L9N A;  3ISP A;  2QQB A;  1YYV A;  2R7D A;  4M71 A;  1HW5 A;  1ZHF A;  3F3X A;  1FLI A;  1QZZ A;  1ZRE A;  5TRD A;  3GW2 A;  5CVJ A;  5LBQ A;  3N97 A;  3KFW X;  1PDN C;  4WF2 A;  1MJ9 A;  4P9F A;  2KJB A;  1QBJ A;  1ZAO A;  5L3G A;  1YQA A;  4G8X A;  1O3T A;  1R5G A;  1B59 A;  1RZ4 A;  3FMR A;  5IT3 A;  4D0P A;  5JVT A;  3DFG A;  3MFK A;  5DD8 A;  2OA4 A;  2W84 A;  2COM A;  3VFZ A;  4HQM A;  1IXR C;  2JSC A;  2LF7 A;  5LRS A;  1LDD A;  4GCV A;  5LHI A;  3F8M A;  4LGW A;  1G4D A;  1Z91 A;  3FZV A;  4NQW A;  1J2X A;  5HDG A;  4GXO A;  5FLX K;  3J81 Z;  1BC8 C;  2STT A;  4N9I A;  3KEO A;  1F5T A;  2VOD A;  2NAZ A;  1SMT A;  4EM1 A;  2KJC A;  2JTV A;  3IWZ A;  4RGU A;  1YW8 A;  4GYI A;  2P5V A;  1QQI A;  5DUI A;  5E8I A;  4L5J A;  4AIH A;  4ON0 A;  3QPT A;  3CLO A;  2OU2 A;  2DT5 A;  5CVR A;  3QU3 A;  1FYM A;  1SMY F;  1O57 A;  3CO7 C;  1HKQ A;  1CF7 A;  4LJZ F;  2FBK A;  1IN4 A;  2JZY A;  2VOP A;  4L5I A;  1YG2 A;  2G7H A;  2UXX A;  1G3T A;  1IUY A;  1Z1D A;  4EJV A;  4HQE A;  3J81 K;  1XGS A;  5DD4 A;  3WOD F;  5CVV A;  2K86 A;  3GFI A;  3ZMZ A;  5BMZ A;  3FMS A;  5D6F A;  1FC3 A;  1JHF A;  1F9N A;  3LWF A;  2GA1 A;  1P4X A;  2EB7 A;  2Y0M A;  2DPD A;  4IRI A;  4OIN F;  3REO A;  4Q48 A;  4DNC A;  3HTS B;  1HKT A;  2L3D A;  1D3Y A;  3KCC A;  1FX7 A;  3W6K B;  1X3U A;  5KVR A;  3HUG A;  1FZP B;  4I02 A;  1XDS A;  4UV8 A;  4Q4Z F;  4IRG A;  3WTS C;  4IPA A;  1MD0 A;  2V6C A;  1USS A;  1IAW A;  3DF8 A;  1D5V A;  4EJW A;  3GFJ A;  1KQ9 A;  4UV9 A;  4A5M A;  3ZN0 A;  5FD5 A;  1ONV A;  2KIU A;  2YX7 A;  1ZG3 A;  3P9K A;  3LA7 A;  2ZO4 A;  3ML6 A;  1IF1 A;  2RQP A;  5ICF A;  1ZRD A;  3BPV A;  3G3Z A;  4LFU A;  2IA1 A;  2WWY A;  1TLH B;  1ZG5 A;  2VBX A;  4IVN A;  3LAP A;  2EV6 A;  2A6H F;  2HGC A;  3J80 K;  4ENM A;  1FPQ A;  1OYW A;  2L4M A;  4AWX B;  3SZP A;  1FOK A;  5DEQ A;  3WTT C;  4RB0 A;  4B09 A;  2ZJ2 A;  3SFZ A;  4ENK A;  2ZNZ A;  3PQK A;  2QVO A;  1FP2 A;  3MZH A;  2EFP A;  1IXC A;  1CF7 B;  2HYF A;  5HS9 A;  5L3D A;  1P2F A;  5HVQ C;  3O6B B;  3R4K A;  3M8E A;  4WCG A;  4N0B A;  1FYL A;  2DK5 A;  3AAF A;  1LEA A;  4U7B A;  4OIR F;  4DQ2 A;  4BHB A;  4ZYE A;  2DQL A;  2PLY A;  3L09 A;  4KIF A;  2F5F A;  5FO5 A;  1IW7 F;  4RB3 C;  4IHS A;  3WGH A;  1TNT A;  3I5U A;  3RPU A;  2E7W A;  3FF5 A;  4H0E A;  2IRF G;  1E17 A;  2P6T A;  4ZYH A;  4HX8 A;  2MLK A;  2WTE A;  4I09 A;  4CZZ A;  3TOA A;  2FQ3 A;  1FWZ A;  4AD9 A;  3E5X A;  3BWG A;  4NB5 A;  3D0S A;  4YFK F;  4P96 A;  1GVJ A;  1QNT A;  3R0A A;  2ZBK A;  1JXS A;  2GXB A;  4XSX F;  4HA8 A;  2ZNY A;  1IN7 A;  2MA3 A;  1GXQ A;  5FB2 A;  3G73 A;  3D5L A;  5HLH A;  3IHU A;  1QPM A;  5JI6 A;  1AOY A;  2M1B A;  4CDG A;  2FE3 A;  3FM5 A;  3JAM Z;  3OOP A;  4WX9 A;  5BS6 A;  4HV5 A;  2FU4 A;  2R3S A;  1ZAR A;  3T8T A;  3GUD A;  2DO7 A;  5LRR A;  1T39 A;  1SD5 A;  1XGN A;  3JW4 A;  5L3F A;  2Z5U A;  1Z7U A;  2CFX A;  4MGR A;  1DPU A;  4KIG A;  3DPL C;  5E18 F;  1UST A;  2HQR A;  1SD7 A;  1HBX G;  2BYV E;  3BRO A;  5ILU A;  1W4M A;  3CUQ C;  4M9X A;  1ZYR F;  4GGG A;  3VOE A;  3HIF A;  3WTV C;  5E1W A;  4E70 A;  1DUX C;  3KP7 A;  2HWV A;  2P6S A;  4IF4 A;  1S7O A;  2W25 A;  3NRV A;  4Z2Y A;  3ZMU A;  2X0L A;  2K02 A;  3GEZ A;  4LLL A;  2LKP A;  2ESH A;  2LSO A;  5F64 A;  4ETS A;  1ON1 A;  5DCM A;  1BOA A;  2FEZ A;  1J7K A;  3WGG A;  1I1G A;  2Q2E A;  2OQG A;  1K6O A;  1XGM A;  2QZ8 A;  3HRM A;  4HLY A;  4A6E A;  1NHA A;  1YTY A;  3DP7 A;  3K1P A;  3I64 A;  4Q5S F;  3F8C A;  4L9T A;  5FGM A;  4XBF A;  3B73 A;  3WTY C;  3KP6 A;  2STW A;  1L3L A;  1HSJ A;  3HOS A;  3R61 A;  1G6N A;  2BBY A;  5H6R A;  3C1D A;  4MEY F;  3M8F A;  4R8H A;  5LHH A;  3DPT A;  1EV7 A;  1ZLJ A;  4YII A;  1XSV A;  1Z6T A;  3GLX A;  1Z05 A;  3F8B A;  3V4G A;  4HDV A;  2EJR A;  1REP C;  2FMY A;  2YSR A;  3RKY A;  2FF4 A;  4N9H A;  3KP3 A;  2Z9O A;  1RIO H;  1MDM A;  3B02 A;  2DQR A;  5ILS A;  1O7L A;  4ZH4 F;  3OV8 A;  2PEX A;  1G3W A;  1YIO A;  1KQ0 A;  3QP6 A;  3RIR A;  4BHC A;  1EH6 A;  1U3E M;  3I4P A;  2XAS A;  2DI3 A;  2K4J A;  2XKO A;  2A68 F;  1EH8 A;  4HOB A;  1U5T A;  1B4A A;  3E97 A;  1U5T C;  2VE8 A;  2HQN A;  4NHJ A;  3I71 A;  4R1H A;  4UXN A;  3LAJ A;  3WTZ A;  3LQQ A;  5BPD A;  5FLX Z;  4ENJ A;  1KA8 A;  1A04 A;  1Q1H A;  3ECO A;  2A69 F;  5DDG A;  3JSO A;  2HEO A;  4LLG F;  3FMQ A;  1KU9 A;  4AIK A;  2QQ9 A;  4PGH A;  5E8G A;  4MQV A;  1OR7 A;  4QWQ A;  5DCM B;  1KU2 A;  3HHG A;  3LA2 A;  3FX3 A;  5K5R A;  1IN8 A;  2JT1 A;  3GF2 A;  3ULQ B;  3W6J B;  3IC7 A;  4EM2 A;  4BXU A;  3DKW A;  2JPC A;  5K5O A;  4FX0 A;  3TGN A;  6PAX A;  3Q9S A;  1R36 A;  3ERE D;  2L01 A;  3DV8 A;  5BOX A;  2YPR A;  2QYO A;  4O6J A;  4HDU A;  3GWZ A;  2DPU A;  3P7N A;  3S2W A;  3BY6 A;  1GHC A;  2P7V B;  2ADU A;  1W7P A;  2PMH A;  2XUB A;  3T1B A;  5JHU A;  5E20 A;  4KNY A;  4OU0 A;  1R5H A;  3BJO A;  2GZW A;  5CVI A;  5E1Z B;  5FFX A;  2MH9 A;  2L54 A;  2QM3 A;  1UB9 A;  3TO9 A;  2ZFW A;  3I59 A;  2LNB A;  2IT0 A;  2RN7 A;  3CO6 C;  4U0Y A;  1O3S A;  3SHF A;  2CSO A;  3F21 A;  1P4A A;  2QQA A;  3F22 A;  5ED4 A;  4RAZ A;  4KFC A;  2Y48 A;  1WWX A;  2IVM A;  4XLN F;  1MDM B;  3E6B A;  4QLC U;  2HFH A;  2Z3Y A;  4BHP A;  4HF1 A;  1ZGJ A;  2XV4 S;  2YR2 A;  2D45 A;  1BI0 A;  4Y17 A;  5ERI A;  4LLN A;  3T5X A;  5IT9 K;  4EJU A;  4I2O A;  2O6G E;  3EET A;  2NS0 A;  3BJA A;  4KYW A;  1PUE E;  2J5P A;  4RB1 A;  2ESN A;  2DU9 A;  3GFM A;  1FY7 A;  2Q0O A;  3PQJ A;  4ZYD A;  2B0L A;  3TOB A;  2DLL A;  3ZQ7 A;  3GO5 A;  5FD6 A;  2UZK A;  4JBA A;  2H27 A;  5J6X A;  1STZ A;  4Y15 A;  2ZXJ A;  2HYG D;  4Q47 A;  2F5D A;  1BI1 A;  3CUO A;  4EGY A;  1LDK B;  3P9I A;  3ZN1 A;  3J80 Z;  1S7A A;  1V3F A;  3JTH A;  1TBX A;  5LGU A;  1JGS A;  4WK8 F;  4CIC A;  2A3S A;  4EQQ A;  1H9T A;  5ICG A;  2CYY A;  2PG4 A;  2K27 A;  3IL2 A;  3KLO A;  4M72 A;  1OYI A;  4I01 A;  3VEP A;  2PQ8 A;  1WQ2 A;  2H6C A;  1MJA A;  1WSU A;  1PP8 F;  1H0M A;  4MQ9 F;  1R1V A;  2L4A A;  5AON A;  1SAX A;  2O0Y A;  3QU6 A;  3I59 B;  1QGP A;  3TKY A;  3KLN A;  4G6D A;  1TTY A;  3J7A O;  3R0J A;  1OMI A;  4HYE A;  2VE9 A;  2KRF A;  1XSD A;  4K2E A;  3E5Q A;  3WU0 A;  3V8K A;  2O3F A;  2FOK A;  3KET A;  3F6O A;  4EM0 B;  3FXQ A;  2RKH A;  2OD5 A;  2VBY A;  5L3E A;  5BQT A;  4U88 A;  4Y13 A;  2BEO A;  2Q8K A;  4LD5 A;  3SQN A;  3C18 A;  2WV0 A;  3RJP A;  2E7X A;  5FFZ A;  4WXD A;  3HTU A;  1KGS A;  1SD4 A;  2JPB A;  2FSW A;  4ESJ A;  4YFX F;  2XAQ A;  3TO6 A;  3WTW C;  1F1Z A;  1T98 A;  1PP7 U;  1C0W A;  3O2P E;  3JSP A;  1YLF A;  3PFI A;  1YS7 A;  3HHH A;  2HOE A;  5TJJ A;  2MC3 A;  2G9W A;  3V7S A;  2V1D A;  1TQM A;  4A12 A;  1BI3 A;  5EEG A;  3SXY A;  5A2Q Z;  2CGP A;  2Z99 A;  2XHK A;  3DEU A;  3U2R A;  3N4M A;  5JFR A;  5HDN A;  3RKW A;  3EUH A;  1D8J A;  4IJA A;  1O3Q A;  1ODD A;  3MAJ A;  4XSZ F;  2OAZ A;  4BH9 A;  1T0F A;  3ABT A;  5HS7 A;  2V9V A;  5DUK A;  1OYY A;  3MWM A;  1W5S A;  4EJO A;  3F8F A;  4HAM A;  4WXH A;  4M9S A;  2H6B A;  1J59 A;  5K5Q A;  4M74 A;  3MQ0 A;  2FBI A;  2ISY A;  5HLG A;  3KEQ A;  2P4W A;  1T6S A;  1DP7 P;  4IHT A;  3RDI A;  4M6X A;  2IPQ X;  1YW7 A;  2RDP A;  1BBY A;  3RI4 A;  4ENN A;  1RUO A;  2JRT A;  2VBZ A;  3CUQ A;  1BIB A;  4ASN A;  2KIF A;  5A2Q K;  5HDK A;  1LQ1 A;  4L9J A;  4EVI A;  1MJB A;  1LDJ A;  4EV0 A;  1YFH A;  2UXN A;  3F72 A;  5ICC A;  1G3Y A;  5DV5 A;  3GVA A;  2H09 A;  4AIJ A;  3QAH A;  3HRU A;  4UVC A;  3MZY A;  4RGR A;  4OMY A;  4BAY A;  3K1M A;  4P9U A;  1IZ1 A;  2XAJ A;  1FP1 D;  3ZP5 A;  3U9G A;  4EMS A;  1I5Z A;  3WU1 B;  3RKX A;  1XD7 A;  4EJT A;  1UFM A;  3CJN A;  1P6R A;  4HW0 A;  1GXP A;  4HZF A;  1V4R A;  3RTR A;  2K7L A;  1F4K A;  1I1S A;  1P4W A;  3IRR A;  2BV6 A;  1HST A;  4FX4 A;  3F23 A;  1KYW A;  4U0W A;  4G7H F;  3TDZ C;  2XRO A;  4UHT A;  2FNA A;  2F5C A;  5J8C A;  1O3R A;  3ROU A;  1HQC A;  1BIA A;  1TNS A;  1K7A A;  3E6M A;  5D6E A;  4RS8 A;  2E1N A;  3QPH A;  4U7D A;  4BQA A;  4G9Y A;  2PN6 A;  4L0Y B;  3E3V A;  5L3C A;  1YW9 A;  1J9I A;  2V79 A;  1S6L A;  4MNU A;  3EQL F;  3I54 A;  2M5W A;  2EA2 A;  5CYV A;  3RPQ A;  1IXS B;  4CYD A;  4KIC A;  1L0O C;  1R7J A;  2MBF A;  3L7W A;  3C3W A;  4KN4 X;  2Y75 A;  2HR3 A;  1MZB A;  3I58 A;  2D1V A;  1ZH5 A;  3HOT A;  1KU7 A;  1XCV A;  4L18 B;  4MEX F;  1FBQ A;  2OBP A;  3WTX C;  1SFE A;  3KZY A;  2LF8 A;  4G94 A;  3LFK A;  5AIQ A;  4G7O F;  3E5U A;  1HW1 A;  1XCB A;  4U0V A;  4OIO F; 
#chains in the Genus database with same CATH topology
 4BEH A;  2AXT C;  1X1C A;  2K9M A;  3TQN A;  2YU9 J;  4A0Z A;  3CUQ B;  3V42 A;  5IPA A;  3FXM A;  4OIP F;  1VZ0 A;  2EV5 A;  1VQ5 I;  1BM9 A;  2RVC A;  3AL0 B;  4WWC A;  2QF7 A;  5F6F A;  2HZT A;  1GT0 C;  4HF2 A;  3EYY A;  1FSE A;  3BTC A;  3H3Z A;  3TP3 A;  1X3Z B;  3K0L A;  1CGP A;  1FT9 A;  2OCC H;  4S04 A;  3HPH A;  3N05 A;  1XGO A;  3U1K A;  4XRF A;  5LGN A;  1BW5 A;  1TQP A;  3C2B A;  1R58 A;  2BVL A;  2MLG A;  1MND A;  4UUV A;  2AXL A;  4B3A A;  1H9G A;  2K9L A;  4ZZL A;  3FIW A;  3P9C A;  1MBK A;  2BY0 A;  5HLI A;  2PI0 A;  1ZKG A;  5D8L B;  2LVS A;  2P5K A;  3Q0W A;  3J7A Y;  3RYP A;  4AYB N;  4JK1 X;  3DBR B;  2K3P A;  2VPR A;  1RKT A;  3MN2 A;  2CG4 A;  1XN7 A;  2W00 A;  2A07 F;  1IRG A;  2WC2 A;  1FTZ A;  1R00 A;  3TW7 A;  4BDY A;  3GYH X;  1ZN2 A;  2Q2E B;  5F0F A;  2ME0 A;  4J19 A;  1RC9 A;  5E17 F;  3BP8 A;  3IKV A;  1FTT A;  1E2X A;  3BZC A;  4HX4 A;  4HX7 A;  1N78 A;  4ZZD A;  3QP5 A;  4NDL A;  5C4J J;  2UV1 A;  2GXG A;  3VB2 A;  3K9T A;  3ABK H;  3ZMD A;  1K79 A;  1Y0U A;  3WGI A;  4L9V A;  4I0B A;  2L02 A;  2PMU A;  1RI7 A;  1JKP C;  5HLT A;  5JLW A;  3CDH A;  4IEJ A;  1S8N A;  2H1L A;  1W1W E;  2M87 A;  2TDX A;  3PNT A;  3KZZ A;  5FRO A;  4O3M A;  5K7Z A;  1FOX A;  2F5E A;  3SDG A;  3ZMS A;  1TQI A;  1HKS A;  1EA3 A;  4FCY A;  4BQQ A;  3OYM A;  1WJF A;  3JRI A;  5IT9 Z;  1K4S A;  4CHU A;  1MBE A;  4HBL A;  1SC7 A;  1O4X A;  3WE2 A;  5JHF A;  1VQ6 I;  4D9J A;  1TL8 A;  1XB4 A;  4MTD A;  3DWL E;  1LJ9 A;  1E3P A;  2EIJ H;  5F1R A;  4F55 A;  1FMV A;  1YE9 A;  3DXJ F;  1DDN A;  3ERM A;  4FE7 A;  1Y6I A;  3DTK A;  2RNJ A;  5E79 C;  1LFB A;  2WV1 A;  1K83 J;  4HEA 2;  4LB6 B;  4UVA A;  2QUF A;  3B6C A;  4A3C J;  1YIJ I;  2DFH A;  2VUM J;  3TED A;  4RMN A;  2VPL A;  3HSE A;  4OOI A;  5EF6 A;  2ZJQ F;  4RAY A;  1WI3 A;  4R79 A;  2FXA A;  1GLN A;  2AO9 A;  1YJW I;  3G4S I;  2R7V A;  2H8W A;  1DU0 A;  3ABL H;  4HNV A;  3KP4 A;  1XSX A;  4JOM A;  4PDK A;  2VJI A;  2ISZ A;  2M7B A;  3L9F A;  2YS9 A;  4FE4 A;  3WE3 A;  5E1X A;  2DTR A;  1MKM A;  2BGC A;  3ZMV A;  2HS5 A;  5D5W B;  2QCO A;  1QRY A;  4BBS J;  1AA7 A;  3NWS A;  1VQ9 I;  2PFB A;  1D0Z A;  1MGT A;  2AS5 F;  4CA0 A;  1ZLK A;  2ETH A;  3FWE A;  1OCZ H;  3IKT A;  4FHT A;  4LOC A;  5LLQ A;  3EDP A;  1K61 A;  2D2W A;  3BG9 A;  3OYH A;  2EK5 A;  1W7P D;  1ULY A;  3GZ5 A;  3FXL A;  3ECH A;  4IHV A;  4BEH B;  2GIZ A;  1W5T A;  1BR2 A;  1WZ2 A;  2EFQ A;  3TDU C;  2F2E A;  4BGD A;  3DEE A;  2HI3 A;  5M5X J;  2DOA A;  3S3M A;  1QPI A;  5D5X B;  5H20 A;  2CW0 F;  1U5T B;  3QRF F;  1R1U A;  2XGX A;  3ELK A;  1IJW C;  4YEL A;  4A5N A;  5BNG A;  5KNL A;  2NNN A;  1Z77 A;  3ZQC A;  2DJN A;  2CV0 A;  2DMT A;  4LMY A;  3V8J A;  4ZYG A;  3Q5F A;  4BYY A;  2L7M P;  1U9N A;  2B7E A;  4J00 A;  1CQT A;  1MMG A;  3I0T A;  3VOD A;  2CU7 A;  3L2V A;  1OPC A;  3QYE A;  2IP2 A;  1YJ9 I;  3M1E A;  1S5L C;  2K5C A;  4LIV A;  5LEJ A;  4JP0 A;  3L00 A;  3CCM I;  5AIP A;  3SZG A;  3TO7 A;  2GWR A;  2DAO A;  2A5W A;  2DOE A;  3EUA A;  1ON2 A;  2ZKZ A;  1FMW A;  2RRE A;  1K78 A;  1KZH A;  1RES A;  2IGN A;  2MAB A;  3KEY A;  3T8R A;  1UHM A;  5CKT A;  2M45 A;  1JGG A;  1SAN A;  2W7N A;  3LL7 A;  1Z0X A;  3OYJ A;  3A01 A;  1X19 A;  1SVO A;  4G6Q A;  3KE2 A;  3OS0 A;  2DT7 B;  2FBH A;  1LPQ A;  2HOT A;  4LB5 A;  2JUC A;  1LE8 A;  1R23 A;  2NNY A;  3M8J A;  4L0Z B;  2HVS A;  3T0Y A;  1A6Q A;  1YX5 A;  4IHY A;  4PSX A;  5D5V B;  1A5J A;  1NK2 P;  1LNW A;  3K4M A;  4S05 A;  3GXO A;  2M30 A;  3ZOB A;  2VB6 A;  1UHW A;  2I8D A;  4TV7 A;  2MD5 A;  1LEB A;  4XL9 A;  1WKM A;  3L2Q A;  4E7J A;  1W7P B;  1RET A;  1YS6 A;  3DCF A;  4W97 A;  2HDD A;  2BY3 A;  3K69 A;  2LY9 A;  4IRH A;  1VQM I;  4RB2 C;  1LB2 A;  1GVD A;  2HKX A;  3OY9 A;  5CVU A;  2OPT A;  1D8K A;  1U6G A;  2LR8 A;  2VC0 A;  2Y69 H;  4HG2 A;  2X6W A;  1ZRC A;  2GQQ A;  5K7H A;  5LFA A;  1J75 A;  2M0M A;  2NYX A;  2ZME A;  4UVB A;  2HDC A;  4U87 A;  3V7R A;  4A2U A;  2Z2S B;  1UHS A;  3OYN A;  4A0X A;  2E71 A;  2YX4 A;  2BXY A;  1XMA A;  2VI6 A;  5J4V A;  3E0J B;  4GO1 A;  2EWN A;  4A6D A;  3AG4 H;  3S93 A;  1BJA A;  4G6T B;  4PFO A;  4B44 A;  4G7Z F;  2PJR A;  1Q1V A;  3BTL A;  1TW2 A;  3BG7 A;  2IS6 A;  1EKE A;  2LH9 A;  2XRL A;  3IWF A;  2OQR A;  2P8T A;  1B6A A;  5HS8 A;  3KYC B;  2R7U A;  2KMU A;  3IH3 A;  1SFX A;  2ELK A;  1ZR4 A;  2VJJ A;  3HSR A;  2NVU B;  2DFI A;  3DQV C;  3H3U A;  2M0C A;  3F6V A;  1BC7 C;  1BW6 A;  1MBH A;  2UWM A;  4PGG A;  1VTN C;  1UEL B;  2VAS A;  3CJQ B;  5FKL A;  1U8B A;  5D4R A;  1BN5 A;  2CQX A;  2XRN A;  3BCB A;  3TL4 X;  2P5L C;  3GTQ J;  5F27 A;  3A03 A;  1XTA A;  5FKM A;  3BPX A;  1LFU P;  3K70 C;  5DYM A;  2ELJ A;  3BR2 A;  4GYG A;  2K9N A;  2XPV A;  2A6T A;  2IA2 A;  1QO0 D;  3FXU A;  5JR3 A;  2IXS A;  2QSG X;  2O7O A;  3U1D A;  1B9M A;  3PM1 A;  2W85 A;  4MTE A;  4WXC A;  3K4L A;  1FYK A;  4KUM A;  4P5O A;  4E7I A;  4OAY A;  1FNN A;  4KIB A;  4UY8 I;  1JE8 A;  4XKB A;  2WY8 Q;  2DBB A;  3Q9V A;  1VQK I;  2ZJP F;  3FM3 A;  1WI9 A;  4CGZ A;  4CO8 A;  3JRF A;  3FK6 A;  2DMU A;  5LHG A;  2CWE A;  4BU2 A;  4LG0 A;  5F0H A;  2NRA C;  1OCR H;  2GA2 A;  2EFN A;  2FA5 A;  3QYB A;  4OIQ F;  5CPR B;  1FSH A;  2W24 A;  2H1K A;  2W57 A;  3VPR A;  1O7F A;  2MC4 A;  3PSI A;  4RM2 A;  2ZCW A;  1DPR A;  9ANT A;  2CO5 A;  1IN5 A;  2BY1 A;  2XIG A;  3R60 A;  3W2V A;  3BG6 A;  3CES A;  2MH2 A;  1K78 B;  3C2H A;  3BDD A;  2O03 A;  2LDU A;  2XAH A;  3FXR A;  5ICE A;  5HOO A;  1E0E A;  2E1M B;  1HDP A;  2XKP A;  1B1B A;  2KRH A;  1G3S A;  1GUU A;  3A01 B;  4M6Y A;  4DBR A;  2Y31 A;  1BR4 A;  3BG5 A;  1LE8 B;  2EBI A;  3I53 A;  1WPK A;  2D5V A;  1HW2 A;  3I4M J;  2J5O A;  2C6Y A;  4RGX A;  1YX3 A;  1RPW A;  4X6A J;  1VF9 A;  4A3F J;  2G7U A;  2VXZ A;  4F7Z A;  1BI2 A;  2OUM A;  3QPL A;  4HV6 A;  2K9Q A;  2L9R A;  4BXF A;  4KT5 C;  2IJL A;  3LA3 A;  4PJM A;  4LIT A;  4DJA A;  1IRF A;  2ID3 A;  4XLF A;  4ESB A;  1YRN B;  4BNC A;  1P7J A;  4PCQ A;  5GAD J;  3L2C A;  4RM3 A;  4V2G A;  2V6E A;  4HLX A;  5FKO A;  2DMP A;  3O3K A;  4M9Z A;  1HC8 A;  2FML A;  4HF0 A;  2X4H A;  4LK0 F;  3HOZ J;  1J0R A;  3MEX A;  2CRG A;  2YU3 A;  3HRS A;  4YIF A;  2ZME B;  1IUF A;  3IRQ A;  1T38 A;  2O61 A;  3GX4 X;  1U2W A;  5H2F C;  2E2I J;  2V26 A;  2VL8 A;  2E1C A;  2VOO A;  4QPQ A;  3BZ6 A;  5DCF A;  2XAF A;  4QPO A;  5FKN A;  5D5U B;  3S17 J;  4E7S A;  5D4S A;  2VON A;  2AQF A;  2V1X A;  3Q0U A;  5M5Y J;  3S1M J;  2KKO A;  4ANJ A;  1MMD A;  4P55 A;  4JYK A;  2ELH A;  2M8E A;  2O8X A;  5B3S H;  2PJR B;  2OZ6 A;  3H92 A;  3A1Y A;  5CQE A;  4B8X A;  1S3J A;  2CQK A;  2IA0 A;  1TWG J;  2QLZ A;  4M73 A;  3HRT A;  1E3O C;  2E1O A;  1AWC A;  3W2W A;  1R6R A;  4KA4 A;  2HTJ A;  3K1N A;  2BE5 F;  3DTE A;  4I98 B;  2QWW A;  3BOQ A;  4A0Y A;  2OZU A;  3E6C C;  3BJ6 A;  1P9Q C;  4A69 C;  2Y9Y A;  3DPU A;  1RR8 C;  3LSH A;  1TW3 A;  5IP9 J;  4BS9 A;  4IO9 F;  2Z1D A;  2P7C B;  3IUO A;  4YFN F;  2LP0 A;  1HXD A;  3ABM H;  1KU3 A;  2VKE A;  4RGS A;  1XDU A;  4CCM A;  4F92 B;  4PZJ A;  5L3B A;  2LKX A;  1APL C;  4IOC F;  4KIS A;  1FBU A;  4XIC A;  1EH7 A;  2JA7 J;  1R22 A;  1V55 H;  2R7Q A;  3R6S A;  3A02 A;  1Y1W J;  1QZY A;  4IHX A;  2X1D A;  2GOX B;  2VT3 A;  1KQ8 A;  4UB8 C;  3CC4 I;  4I0A A;  4MHG A;  2VKV A;  3M9A A;  1RNL A;  3QYF A;  3EPZ A;  2F4I A;  3G6E I;  1JJ6 C;  5FLV A;  3C7J A;  4XQF A;  4DZP A;  3FIS A;  3RYR A;  2DW4 A;  3CTA A;  4EGZ A;  4D5C A;  2PJP A;  1JHH A;  2VLA A;  1HLV A;  3FHZ A;  3AG2 H;  1M1E B;  2EZL A;  2VT2 A;  2DK8 A;  3K4B A;  5J8F A;  4CCJ A;  2QBY A;  4UNO A;  3WG9 A;  2IGO A;  4LG0 B;  5EG0 A;  1X2N A;  4FET A;  3V8L A;  2CUJ A;  5CLS A;  2QEN A;  1G8X A;  3S2H J;  4XLC A;  4ESF A;  4NC8 A;  3OSF A;  3S1N J;  1EF4 A;  1ZGA A;  2XSJ C;  3LOC A;  3GBG A;  1P92 A;  3JAM K;  2EFO A;  2NOJ B;  4FIS A;  3ZPL A;  2NVY J;  1J5Y A;  1SD6 A;  1U8R A;  2KIM A;  2PMZ N;  2BY2 A;  2R7F A;  2EA4 A;  1Z9C A;  4CXF A;  2CW7 A;  2M3A A;  1WRJ A;  2O5R A;  2XVC A;  4YEJ A;  2DOF A;  3S15 J;  1DGW Y;  2PBI A;  4YG2 F;  1X1A A;  2HZD A;  1I6X A;  3LST A;  3MCZ A;  5CJ9 A;  2Z16 A;  5EEH A;  3COA C;  1LVA A;  3A0H C;  4N4O B;  2FQ4 A;  4KMU X;  1RR7 A;  2GIV A;  3SZT A;  2V1U A;  1LFP A;  1RUN A;  1FBS A;  2VN2 A;  4XRS A;  1S29 A;  2Y0S A;  2ZSI B;  3OYK A;  2AQE A;  2F5V A;  1UCR A;  3KP5 A;  3UR3 C;  2RGV A;  3EUK L;  2D1H A;  3E1S A;  4I7H A;  5LEK A;  3DBL B;  3TBI A;  4B48 A;  2KFD A;  3FBN B;  5KHD A;  2NOG A;  4XID A;  2KQR A;  1ZGW A;  4KDP A;  4NUB A;  1OLT A;  4KMF A;  3I9V 2;  2EFW A;  3E6D A;  2A61 A;  2V9P A;  3WTU C;  3HSF A;  4OMZ A;  1SEU A;  2R7R A;  2NVT J;  1AU7 A;  1T2K A;  3GTP J;  2JRM A;  5EDN A;  1OKR A;  2K4B A;  4KT6 A;  4FT8 A;  5K1Y A;  3BR6 A;  1W36 D;  3PSF A;  2XSD C;  3L2W A;  1I27 A;  1X2M A;  4AVP A;  3GFL A;  1ZRF A;  3G1O A;  4O5V A;  1S7E A;  4DYR A;  3CMA I;  2K85 A;  5H6Q A;  5CQG A;  3I4N J;  1Z6R A;  1X1P A;  2IEK A;  3V7C A;  2FNP A;  1Y8R B;  2IW5 A;  1IO2 A;  3JTG A;  1ETK A;  2CUE A;  1YO5 C;  1DQU A;  3K2Z A;  2RC4 A;  5D8K B;  2BZT A;  2LOO A;  1SFU A;  4DBQ A;  4M6V A;  3F8N A;  4PUS A;  4KN7 X;  4C3I J;  1ZG1 A;  2ACJ A;  2FRH A;  3LQR A;  2XAG A;  4BKX A;  2EV0 A;  3FBI B;  3ABU A;  4XLA A;  2R7O A;  2GAU A;  2HTS A;  4F93 B;  2DA3 A;  3MKW B;  2L9N A;  1X3W B;  3M7G A;  5HNF A;  3QOP A;  5GAE J;  3H35 A;  2VC1 A;  3HJE A;  1W0U A;  2H94 A;  1B9N A;  3PNV A;  5BPI A;  3GZ6 A;  3NEU A;  2A05 A;  1UJ8 A;  2HKO A;  4PFP A;  3CCJ I;  2QA4 I;  3CF5 F;  3EYI A;  1H89 C;  5KK1 A;  1WJC A;  1R1T A;  2VJ4 A;  2RV8 A;  3NQO A;  1XMK A;  4JQF A;  4CUG A;  4EEF G;  5ILV A;  5LGT A;  1A36 A;  2XGE A;  3KP2 A;  1QU3 A;  4JX5 A;  2IAI A;  1G2H A;  1D1B A;  2A6E F;  5TIS C;  4XLP F;  1IN6 A;  4DIQ A;  3ZMT A;  5M3M J;  3CZ6 A;  1KYZ A;  3VYS B;  1Y0N A;  1WH5 A;  4S0H B;  1U78 A;  4IXA A;  4P1W A;  2Z33 A;  2A5Y B;  2VBW A;  1MMA A;  2QBY B;  3CD6 I;  4MFD A;  3HYI A;  4D7N A;  4LK1 F;  3BTJ A;  3MMY B;  2M9H A;  3OOU A;  4L9N A;  3ISP A;  2QQB A;  1YYV A;  2R7D A;  5GTI C;  4M71 A;  1HW5 A;  1ZHF A;  4XRS G;  1BA5 A;  4XR6 A;  3F3X A;  1FLI A;  1QZZ A;  1ZRE A;  5TRD A;  2NVQ J;  3GW2 A;  5CVJ A;  5DS9 A;  2QGU A;  5LBQ A;  3N97 A;  3KFW X;  1PDN C;  4WF2 A;  1ZQ3 P;  2ID6 A;  1MJ9 A;  2WB1 A;  4P9F A;  2KJB A;  3OIO A;  1QBJ A;  2M8G X;  1ZAO A;  5L3G A;  1YQA A;  4G8X A;  1O3T A;  1R5G A;  4IZZ A;  1B59 A;  1RZ4 A;  2HU9 A;  2DDA A;  3FMR A;  5F08 A;  2QQ8 A;  1LKX A;  5IT3 A;  1R49 A;  4D0P A;  5JVT A;  2X48 A;  2E60 A;  5EGO B;  3BTI A;  3DFG A;  4QTR A;  2R93 J;  5JVG F;  2M4G A;  5DD8 A;  3MFK A;  2OA4 A;  3FDY A;  2W84 A;  3HBL A;  2COM A;  4NC6 A;  3VFZ A;  3QOE A;  1MSE C;  4HQM A;  1IXR C;  4UUT A;  2LTP A;  1YIT I;  2JSC A;  2LF7 A;  1YHQ I;  1IV6 A;  5HNH A;  1LDD A;  5LRS A;  4GCV A;  5LHI A;  2JK3 A;  1MNE A;  1OCC H;  3F8M A;  1ETW A;  4LGW A;  1G4D A;  1Z91 A;  1H88 C;  1X58 A;  5F04 A;  2DOD A;  3FZV A;  1A6I A;  4NQW A;  3GZN B;  1J2X A;  5HDG A;  2WAF A;  4ZDO A;  2R0Q C;  4GXO A;  4RLQ A;  3J81 Z;  1BC8 C;  2STT A;  5FLX K;  4N9I A;  3H5R A;  3KEO A;  1F5T A;  1B8I A;  1WGX A;  2VIX A;  2VOD A;  3F9K A;  2NAZ A;  2QEX I;  2X6O A;  3K4C A;  1V54 H;  3JRB A;  4E7K A;  3UKG A;  1SMT A;  3GLL A;  4Z6Y A;  2OTJ I;  4EM1 A;  2KJC A;  1XC5 A;  4RA2 A;  2JTV A;  3IWZ A;  3CJT B;  4RGU A;  3LNQ A;  3JR9 A;  1YW8 A;  1N25 A;  2ZXW H;  4GYI A;  3DTI A;  2P5V A;  2R5Y A;  1N75 A;  1QQI A;  1Z3X A;  5DUI A;  3HZJ A;  3HL2 A;  1ZTR A;  5E8I A;  4L5J A;  5IOZ A;  4AIH A;  1MMN A;  3QPT A;  3CLO A;  4ON0 A;  2OU2 A;  2DT5 A;  5CVR A;  3QU3 A;  2ZXH A;  2LBF A;  1OCO H;  1VQN I;  1FYM A;  1SMY F;  4CSW A;  2LG4 A;  2BXZ A;  1R5I D;  1O57 A;  1B72 A;  1W5C C;  4Y7N J;  2XF6 A;  1HKQ A;  2DDB A;  2HXO A;  4LJZ F;  2FBK A;  3CO7 C;  1CF7 A;  3PUB A;  3RQ4 A;  1IN4 A;  1V5E A;  2JZY A;  2VOP A;  4L5I A;  1IRX A;  1YG2 A;  2CQN A;  2IGM A;  2BVM A;  2G7H A;  4PJN A;  2UXX A;  3PIO F;  1G3T A;  1I3A A;  1IUY A;  4C2T A;  1S9H A;  1Z1D A;  2LY1 A;  1IGN A;  4EJV A;  1ENH A;  4HQE A;  1OIS A;  2HOS A;  1Z7L A;  1XGS A;  5DD4 A;  3WOD F;  5C3E J;  3J81 K;  5CVV A;  4BJ6 C;  2K86 A;  3CCE I;  2LMD A;  3GFI A;  3ZMZ A;  5BMZ A;  4C30 A;  3FMS A;  3HXL A;  2LC2 A;  2L5Q A;  5D6F A;  3SEZ A;  1ETO A;  1FC3 A;  5IP6 A;  1JHF A;  1F9N A;  3LWF A;  2DA1 A;  1Z3Y A;  2GA1 A;  2M4K A;  1P4X A;  2EB7 A;  2L0K A;  1J09 A;  2Y0M A;  3BT9 A;  2DPD A;  4UUS A;  4ZTJ A;  4IRI A;  2I10 A;  3GME A;  4OIN F;  3MVP A;  3REO A;  4Q48 A;  4DNC A;  3HTS B;  1HKT A;  2L3D A;  3PNY A;  3QWL A;  1D3Y A;  2DA5 A;  3KCC A;  1FX7 A;  1D0Y A;  5HOD A;  1MBG A;  3W6K B;  3OYG A;  1X3U A;  2N8G A;  5KVR A;  3HUG A;  1JKQ C;  4G12 A;  1HA8 A;  2ZJR F;  1FZP B;  4CCL A;  4I02 A;  2JA8 J;  3AKZ A;  2CH0 A;  1XDS A;  2HVR A;  4AU7 A;  3I3L A;  5J4Y A;  4UV8 A;  4Q4Z F;  4IRG A;  3WTS C;  4IPA A;  4BJ5 C;  1ETV A;  2HOA A;  1OJL A;  2FD5 A;  1MD0 A;  2V6C A;  1TP4 A;  1VQL I;  3HOV J;  1USS A;  1IAW A;  2IS1 A;  2R7T A;  3DF8 A;  4A3I J;  4EJW A;  1D5V A;  4PJL A;  2CUF A;  3GFJ A;  3GTM J;  1KQ9 A;  4UV9 A;  4A5M A;  3HOX J;  3ZN0 A;  5FD5 A;  2IGK A;  2DA2 A;  1ONV A;  2KIU A;  2YX7 A;  1ZG3 A;  3NWT A;  3P9K A;  2XF7 A;  3LA7 A;  4BXX J;  2ZO4 A;  3H3V K;  3VYR B;  1UG2 A;  3OR2 C;  3ML6 A;  2FJ1 A;  1WVR A;  1IF1 A;  2RQP A;  2W1O A;  1B8I B;  1WJB A;  2GXA A;  1Y1V J;  5ICF A;  1ZRD A;  3BPV A;  3G3Z A;  2KP6 A;  1ZR2 A;  4LFU A;  2IA1 A;  2WWY A;  2M7A A;  1TLH B;  3H5A A;  2YUS A;  1PUF A;  1MBJ A;  2DTZ A;  1ZG5 A;  2VBX A;  4IVN A;  3LAP A;  2EV6 A;  1UG0 A;  2W4S A;  5FKK A;  4C2U A;  3HOU J;  2A6H F;  4A93 J;  1F36 A;  4M3B A;  2DN0 A;  4XRM A;  2R5Y B;  1N77 A;  1T33 A;  2XPW A;  2HGC A;  1BR1 A;  4BQN A;  2X6X A;  3J80 K;  4ENM A;  1FPQ A;  1QA6 A;  1OYW A;  2L4M A;  4AWX B;  2KPM A;  5KCM A;  3SZP A;  1QZE A;  2JA5 J;  1FOK A;  4N4N B;  5DEQ A;  4XNF A;  2LBF B;  3WTT C;  4RB0 A;  4AVZ A;  3DU6 A;  4B09 A;  2ZJ2 A;  4HPQ A;  3SFZ A;  4ENK A;  2ZNZ A;  2IS2 A;  3ASN H;  2QVO A;  3PQK A;  1TWF J;  1FP2 A;  3BZK A;  4NNJ A;  4DZJ A;  3MZH A;  2EFP A;  3S2D J;  1IXC A;  1V5G A;  1CF7 B;  1TZL A;  2HYF A;  2EIM H;  3PJR A;  5HS9 A;  5L3D A;  3OL4 A;  2NS8 A;  3HEF A;  2HQA A;  4M3G A;  1P2F A;  1PVE A;  5HVQ C;  3O6B B;  3R4K A;  1S72 I;  3M8E A;  3SJM A;  2TCT A;  4WCG A;  2EIN H;  4N0B A;  2KDO A;  3CP8 A;  1FYL A;  2XPU A;  4CYC A;  1IC8 A;  2DK5 A;  2F4O B;  3AAF A;  1LEA A;  1XS9 A;  5B1B H;  4U7B A;  2DA4 A;  4OIR F;  4BHB A;  4DQ2 A;  4ZYE A;  2DQL A;  4EAT A;  2B63 J;  2EH3 A;  3IV5 A;  1QVU A;  1R4M B;  3L09 A;  4KIF A;  4M3F A;  2PLY A;  3OYE A;  2F5F A;  5GPC A;  5EZH A;  4ITV A;  5FO5 A;  2DT6 A;  3QQA A;  3RKQ A;  2CV1 A;  2MG4 A;  5C44 J;  3VSL A;  1IW7 F;  3CQZ J;  4RB3 C;  4IHS A;  1IRZ A;  3WGH A;  1TNT A;  5TGT A;  3I5U A;  3RPU A;  2E7W A;  3FF5 A;  4H0E A;  4BE0 A;  2OC6 A;  4ZYA A;  4RDU A;  2IRF G;  1E17 A;  4LG3 A;  4C3J J;  2P6T A;  4IL6 C;  4GRI A;  4ZYH A;  4HX8 A;  1UZC A;  1V5F A;  2MLK A;  5GPA A;  2WTE A;  4I09 A;  4CZZ A;  3KPH A;  2FQ3 A;  3TOA A;  3FXK A;  1FWZ A;  4AID A;  4AD9 A;  1IG7 A;  1WCM J;  3E5X A;  3BG3 A;  3BWG A;  4NB5 A;  3D0S A;  1JT0 A;  4YFK F;  3FXJ A;  1ITY A;  1D1C A;  4W1U A;  4P96 A;  1GVJ A;  1QNT A;  3R0A A;  2ZBK A;  3HB9 A;  1JXS A;  2GXB A;  4XSX F;  4HA8 A;  3RZD J;  2K3F A;  1JT6 A;  2ZNY A;  4E4H A;  1IN7 A;  3JRH A;  4DW6 A;  2MA3 A;  2X6Y A;  3CCQ I;  2O9L A;  1ERD A;  1GXQ A;  1MW7 A;  4IX7 A;  1NTC A;  3A4C A;  2V7F A;  5FB2 A;  2W82 A;  3G73 A;  4ZC3 A;  3D5L A;  5HLH A;  2F6C A;  4V19 K;  3IHU A;  3LSK A;  3H0G J;  1QPM A;  3LSI A;  5JI6 A;  3S1Q J;  5DM6 F;  2BHZ A;  1MH3 A;  1HCR A;  2M1B A;  4LIU A;  4PJ0 C;  4CDG A;  1AKH A;  1AOY A;  4XKV A;  2E2H J;  4A3M J;  1FEX A;  1JUM A;  2E19 A;  3FXO A;  5E3L A;  2DFE A;  2FE3 A;  3FM5 A;  4AYB A;  2OCE A;  1SFK A;  3G1M A;  1LVK A;  1T0F C;  3JAM Z;  3OOP A;  1RKW A;  3OYD A;  4D1Q A;  2K40 A;  2MW8 A;  4D5F A;  5BS6 A;  4HV5 A;  2FU4 A;  4WX9 A;  3GTK J;  2R3S A;  1ZAR A;  3WHC A;  3T8T A;  2DCE A;  3GUD A;  2DO7 A;  5LRR A;  1T39 A;  1SD5 A;  1XGN A;  3JW4 A;  5L3F A;  4HRI A;  2Z5U A;  1Z7U A;  4ZJZ A;  1IDY A;  2CFX A;  2RQQ A;  4MGR A;  2DXI A;  4KIG A;  1DPU A;  1HF0 A;  3DPL C;  2XC7 A;  2Y30 A;  4MIM A;  1WJE A;  5E18 F;  4XOR A;  4XOT A;  1UST A;  2HQR A;  2BOL A;  3M3Y J;  2HQ5 A;  1SD7 A;  1HBX G;  2HYJ A;  2BYV E;  3BRO A;  5ILU A;  1NH3 A;  1TWC J;  3OIP A;  1I50 J;  2P0W A;  3TMO A;  3UNG C;  5J1Y A;  1I6H J;  1W4M A;  3CUQ C;  4A3J J;  3D1N I;  1SAU A;  5K7F A;  4M9X A;  1ZYR F;  4GGG A;  3AL0 C;  4PSW A;  2WAD A;  3VOE A;  3HIF A;  3HGY A;  3S1R J;  3WTV C;  1WHU A;  3BR0 A;  5E1W A;  1XX5 A;  4E70 A;  2E35 A;  4BY1 J;  5GP9 A;  5E3N A;  1WFX A;  2DJI A;  1DUX C;  2WAE A;  1OCT C;  3KP7 A;  2HWV A;  2P6S A;  1QVT A;  4IF4 A;  1S7O A;  2KIS A;  4XMY A;  2F4M B;  2W25 A;  3NRV A;  4Z2Y A;  3ZMU A;  2X0L A;  2K02 A;  4CYC B;  4B43 A;  3GEZ A;  4LLL A;  3SFI A;  2LKP A;  1VQP I;  3CCY A;  3CC7 I;  2ESH A;  2LSO A;  2L2O A;  2CQQ A;  5F64 A;  2PX9 A;  4ETS A;  2L9V A;  3K4K A;  4UB6 C;  1ON1 A;  4A3B J;  5DCM A;  2L9S A;  4DGW B;  1BOA A;  1T56 A;  2FEZ A;  1J7K A;  3CCL I;  3CDL A;  3HKZ N;  3WGG A;  1JTY A;  1I1G A;  2Q2E A;  4XLH A;  2OQG A;  4BAC A;  1K6O A;  1XGM A;  2QZ8 A;  3HRM A;  1HDD C;  4HLY A;  1HOM A;  4B47 A;  4GFB A;  1WH7 A;  4A6E A;  1ETX A;  1NHA A;  3OR1 C;  1YTY A;  3DP7 A;  3K1P A;  2HVQ A;  3I64 A;  4Q5S F;  3F8C A;  2BHY A;  4L9T A;  4YIR X;  1X1D A;  3BCA A;  5FGM A;  3RZO J;  4XBF A;  4B4C A;  2LD5 A;  4CZC A;  1A35 A;  2E34 A;  4KJZ A;  3PFY A;  3B73 A;  3WTY C;  3KP6 A;  2STW A;  1L3L A;  2KRC A;  3IP4 B;  1IDZ A;  1HSJ A;  3HOS A;  3R61 A;  1T8I A;  4A3K J;  3DU5 A;  1G6N A;  2BBY A;  5H6R A;  3C1D A;  1MIJ A;  1PYV A;  4MEY F;  3M8F A;  3PO3 J;  4R8H A;  3ZR8 X;  5LHH A;  3DPT A;  1EV7 A;  1Y8Q B;  1ZLJ A;  3GTG J;  2R7S A;  2LFB A;  4YII A;  2M2E A;  2I5U A;  2BW3 A;  1XSV A;  5J3L A;  1Z6T A;  4CCN A;  3ZQG A;  2GBY A;  2JA2 A;  3GLX A;  1AKH B;  4H4K C;  1Z05 A;  3S3O A;  3LSJ A;  2WAQ N;  5E3O A;  3HDD A;  4YRV A;  3HGG A;  2VKD A;  4I6Z A;  4Y4R A;  2EZI A;  3F8B A;  3V4G A;  4HDV A;  1GDT A;  3D5S C;  2Q1Z B;  5FJ8 J;  2KL4 A;  2COB A;  2EJR A;  1REP C;  1X4P A;  3K2A A;  2FMY A;  2YSR A;  3BC8 A;  1I39 A;  4V2F A;  3RKY A;  2FF4 A;  4N9H A;  5B5E C;  3KP3 A;  3G71 I;  2Z9O A;  4XM3 A;  4ZDP A;  1RIO H;  1MDM A;  3B02 A;  2DQR A;  5ILS A;  3RSN A;  1O7L A;  3OS1 A;  1JI8 A;  4ZH4 F;  1VFC A;  3ASO H;  3ZRG A;  3OV8 A;  2PEX A;  1G3W A;  3DEW A;  2Y9Z A;  1YIO A;  1KQ0 A;  3QP6 A;  1GV2 A;  3RIR A;  4BHC A;  1EH6 A;  1U3E M;  3I4P A;  2XAS A;  5GAG J;  2DI3 A;  5IY5 H;  2K4J A;  2XKO A;  1SVL A;  2A68 F;  1EH8 A;  4HOB A;  4X0G A;  1U5T A;  3SYT A;  1B4A A;  3E97 A;  1U5T C;  2VE8 A;  3WG7 H;  4A3L J;  2HQN A;  3DKY A;  5E3M A;  4NHJ A;  2JN6 A;  2ZB9 A;  3K10 A;  5F0C A;  1BOB A;  3I71 A;  2MSY A;  4J01 A;  4R1H A;  3DLA A;  1ORK A;  4UXN A;  3LAJ A;  3WTZ A;  3LQQ A;  5BPD A;  2E5Z A;  3X2Q H;  5FLX Z;  4ENJ A;  1X4O A;  3W6V A;  1KA8 A;  1U9O A;  3LFU A;  1A04 A;  5EG0 B;  1UMQ A;  1Q1H A;  3ECO A;  2A69 F;  1JUS A;  3ZCO A;  5DDG A;  2X51 A;  3JSO A;  2HEO A;  2O8K A;  3PUF A;  4LLG F;  3FMQ A;  3KX2 A;  4XKW A;  1KU9 A;  4AIK A;  4QSH A;  4IHW A;  2LKS A;  2QQ9 A;  4PGH A;  1ETY A;  5E8G A;  2R4G A;  4MQV A;  1OR7 A;  3OMY A;  4QWQ A;  5DCM B;  1OR7 C;  3WHB A;  3Q0V A;  2VJ5 A;  4XOP A;  2XAU A;  1KU2 A;  2X1C A;  3HHG A;  3LA2 A;  3LSM A;  2DYR H;  3K4N A;  5DM7 F;  3L1P A;  3FX3 A;  2LK2 A;  3OYF A;  1BL0 A;  5K5R A;  1AHD P;  1IN8 A;  4ZDL A;  2JVG A;  2JT1 A;  3B6A A;  3GF2 A;  2HDW A;  3ULQ B;  3W6J B;  4F52 A;  3IC7 A;  4EM2 A;  4BXU A;  3DKW A;  2JPC A;  3VSK A;  5K5O A;  2OJE D;  4HSR A;  5J40 A;  4FX0 A;  3TGN A;  2LRE A;  2VQH A;  5EEA A;  6PAX A;  3Q9S A;  3CLQ A;  1R36 A;  3ERE D;  2L01 A;  3DV8 A;  3ZQQ A;  5BOX A;  2YPR A;  2E5N A;  4FQG A;  3J7Z I;  2QYO A;  3S8P A;  4O6J A;  4HDU A;  3GWZ A;  4Y33 A;  5JLX A;  3ESW B;  2DMQ A;  2DPU A;  3P7N A;  3CC2 I;  2KZG A;  2QSF X;  3BY6 A;  3RQI A;  3S2W A;  1GHC A;  2P7V B;  2X85 A;  2ADU A;  1W7P A;  2LLK A;  2PMH A;  2XUB A;  3GTO J;  3T1B A;  2G0E A;  5JHU A;  5E20 A;  4KNY A;  4OU0 A;  1R5H A;  3BJO A;  3L2U A;  2W48 A;  1DU6 A;  2GZW A;  2HNH A;  4MO7 A;  5J1U A;  5CVI A;  5F1J A;  3JRA A;  2EZK A;  5E1Z B;  1FIA A;  4RAF A;  3FHN A;  5FFX A;  2EIL H;  2MH9 A;  4MFE A;  4XLE A;  4BBR J;  2L54 A;  2OV7 A;  5GTH C;  1D5Y A;  2CJJ A;  2QM3 A;  3CF2 A;  2BW3 B;  2VKH A;  1UB9 A;  3OSG A;  4RLF A;  3TO9 A;  2ZFW A;  4E6K G;  3I59 A;  2FOW A;  3TW6 A;  2LNB A;  2VQL A;  1OCP A;  3M07 A;  2IT0 A;  2CFO A;  4FTH A;  2RN7 A;  4U0Y A;  3CO6 C;  1MBF A;  1W0T A;  3CCV I;  4CH7 A;  1O3S A;  3SHF A;  2CSO A;  2V4J C;  2IS4 A;  1MH4 A;  3F21 A;  4BY7 J;  3K4J A;  3OS2 A;  1P4A A;  2QQA A;  3F22 A;  4ZTF A;  1NG6 A;  5ED4 A;  4RAZ A;  4KFC A;  4Y52 J;  1DGR M;  2Y48 A;  1WWX A;  2IVM A;  4XLN F;  1MDM B;  3BQY A;  1VQ4 I;  3E6B A;  3IAM 2;  4QLC U;  2HFH A;  2Z3Y A;  2VXD A;  4BHP A;  4DYC A;  4HF1 A;  2Y0S N;  5DTD A;  2RAE A;  1ZGJ A;  2XV4 S;  2YR2 A;  4FAS D;  2D45 A;  1BI0 A;  1POG A;  2WA0 A;  4Y17 A;  3L2R A;  4C2M J;  2EPF A;  3GTJ J;  2OTL I;  2EZH A;  2L7F P;  5ERI A;  1R71 A;  2JQ7 A;  4LLN A;  2VQC A;  3Q3S A;  3T5X A;  1X1B A;  5IT9 K;  2MFZ A;  3FKJ A;  1FOW A;  1VQO I;  2R7W A;  4EJU A;  4I76 A;  2X9D A;  1JUP A;  4I2O A;  4IKF A;  3W3C A;  2O6G E;  3ONQ A;  3EET A;  2GOM A;  1DP3 A;  2ICW G;  1OQY A;  4AUX A;  5B1A H;  2NS0 A;  3BJA A;  4KYW A;  1PUE E;  4AC0 A;  2J5P A;  4HNT A;  4RB1 A;  2ESN A;  2DU9 A;  3GFM A;  1FY7 A;  2Q0O A;  1D0X A;  3CJR B;  3PQJ A;  4ZYD A;  2B0L A;  3TOB A;  1Z67 A;  4L5E A;  2DLL A;  5IYD J;  4B1R A;  3ZQ7 A;  2X1E A;  3BQZ A;  3GO5 A;  2E2J J;  5FD6 A;  2FUG 2;  2UZK A;  4JBA A;  2CW8 A;  2MGQ A;  3CCS I;  3OYC A;  2H27 A;  2JJ7 A;  5J6X A;  1STZ A;  4RAG A;  2JA6 J;  4Y15 A;  2ZXJ A;  3ZQI A;  3KYL A;  2E1M C;  2HYG D;  2R5Z A;  4Q47 A;  2F5D A;  1BI1 A;  3CUO A;  4EGY A;  1LDK B;  3P9I A;  4NBQ A;  3ZN1 A;  3I55 I;  3JCU C;  2KZV A;  5IOY A;  3J80 Z;  1S7A A;  4HST A;  5LD2 C;  1MNM C;  1V3F A;  2FX0 A;  3JTH A;  1TBX A;  5LGU A;  1QHH D;  4IQ4 A;  3ZGK A;  1JGS A;  4WK8 F;  4CIC A;  2A3S A;  4EQQ A;  4HNU A;  3LMM A;  1H9T A;  4XK4 A;  3CP2 A;  3H36 A;  5ICG A;  2CYY A;  1RRJ A;  1GV5 A;  2PG4 A;  3VYU B;  2XF5 A;  4XON A;  1XPX A;  1YRN A;  2K27 A;  3IL2 A;  3KLO A;  3P5J A;  4M72 A;  1K6Y A;  2L7Z A;  1OYI A;  4I01 A;  3VEP A;  2PQ8 A;  4ABZ A;  2CV2 A;  1WQ2 A;  3JRC A;  3MZ8 A;  2H6C A;  1MJA A;  2E36 A;  4NQW B;  3OYA A;  3HPG A;  5J47 A;  4XKC A;  1Y39 A;  4BQO A;  1WSU A;  1PP8 F;  3OYB A;  1H0M A;  3WU2 C;  2HPM A;  4MQ9 F;  4DOZ A;  2ZME C;  1R1V A;  2L4A A;  5AON A;  1SAX A;  1T95 A;  4AM3 A;  2O0Y A;  3QU6 A;  3I59 B;  3QOD A;  2L7K A;  2R7Z J;  4RBO A;  1QGP A;  5J1R A;  3TKY A;  1QHG A;  3KLN A;  4G6D A;  1TTY A;  3J7A O;  4OAZ A;  4DYQ A;  5FRM A;  3R0J A;  1OMI A;  4HYE A;  2VE9 A;  2KRF A;  2WB1 N;  1YI2 I;  1XSD A;  1BJZ A;  4K2E A;  3MKY B;  3FK7 A;  4IQJ A;  3E5Q A;  2B9S A;  2WBM A;  3WU0 A;  2PMZ A;  3HKZ A;  2K9S A;  3V8K A;  2O3F A;  2FOK A;  3KET A;  3SDB A;  2XB5 A;  3F6O A;  2MYS A;  2NXN B;  2RKH A;  2OD5 A;  3FXQ A;  4EM0 B;  2NVX J;  2VBY A;  1WJ5 A;  5L3E A;  1KON A;  1VI0 A;  5BQT A;  1FOY A;  1B72 B;  4U88 A;  3ZQF A;  1K4T A;  3CDI A;  4Y13 A;  2CS3 A;  3ZQH A;  2BEO A;  2JWT A;  2Q8K A;  1TWA J;  4LD5 A;  2QKL B;  3SQN A;  4D7M A;  1H8A C;  3MKL A;  3C18 A;  2WV0 A;  3RJP A;  2E7X A;  5FFZ A;  3HM5 A;  3KIO A;  4QIW N;  1VQ7 I;  4WXD A;  3HTU A;  3DLL F;  1KGS A;  1R4N B;  1SD4 A;  2JPB A;  2FSW A;  3QPS A;  3IH4 A;  2H8R A;  4ESJ A;  4YFX F;  2XAQ A;  4Y3O A;  3TO6 A;  2VQG A;  2XB0 X;  4JX6 A;  5EJC A;  3WTW C;  3G2B A;  1F1Z A;  3AFH A;  1OFC X;  3AG3 H;  3VWB A;  1T98 A;  1PP7 U;  4CCK A;  1C0W A;  3CMY A;  2CUZ A;  3O2P E;  3JSP A;  4BE2 A;  1YLF A;  3PFI A;  5KAF C;  5FLM J;  1YS7 A;  5M5W J;  3HHH A;  2GM4 A;  2JVH A;  3K70 D;  4PK4 A;  1Z21 A;  4M3D A;  2HOE A;  3C2G A;  5TJJ A;  4UUS B;  2HXI A;  4XN3 A;  4NC7 A;  2MC3 A;  1E3H A;  2WAQ A;  2DYS H;  3M1C A;  3A0B C;  2G9W A;  3I56 I;  4I99 C;  2R5Z B;  3BR3 A;  3HUG B;  3V7S A;  2V1D A;  1TQM A;  3SEQ A;  3W2A A;  2ECB A;  1BI3 A;  4A12 A;  3VYT B;  3DBH B;  3OWT A;  2V1N A;  4F3Q A;  2QKM B;  5EEG A;  1IV8 A;  1NG7 A;  2DA6 A;  3SXY A;  2GLO A;  5A2Q Z;  2CGP A;  1EJ9 A;  5FRN A;  2Z99 A;  3S14 J;  3GCM A;  2XHK A;  4B3X A;  3KZI C;  4X1E A;  4XN0 A;  3DEU A;  1G59 A;  1D1A A;  3U2R A;  3N4M A;  4BE1 A;  2RNG A;  5JFR A;  5HDN A;  3RKW A;  1JKR C;  4A3D J;  1ACI A;  3EUH A;  4M3E A;  2XGD A;  2F48 A;  3F0C A;  3LSR A;  2CMP A;  1D8J A;  3EUH C;  4IJA A;  1TT5 B;  1O3Q A;  3MD2 A;  1T08 B;  1LUJ B;  1ODD A;  3MAJ A;  4C3H J;  4XSZ F;  2OAZ A;  4BH9 A;  3ZQL A;  1T0F A;  3ABT A;  3RPU D;  5HS7 A;  1FJL A;  3AG1 H;  1MSF C;  2V9V A;  3S32 A;  5DUK A;  4E7L A;  2DMN A;  5IP7 J;  3GTL J;  1OYY A;  3S3N A;  4IOA F;  3MWM A;  2ZXI A;  1W5S A;  4EJO A;  3F8F A;  2DA7 A;  4HAM A;  4WXH A;  4M9S A;  2H6B A;  1J59 A;  5K5Q A;  4M74 A;  1PUF B;  3MQ0 A;  3MKZ A;  2FBI A;  2ISY A;  3H9G A;  5HLG A;  3KEQ A;  3K7A J;  2MD0 A;  2P4W A;  1T6S A;  1DP7 P;  3KYD B;  4E7H A;  3H9J A;  2V9K A;  4IHT A;  3RDI A;  4M6X A;  2XDV A;  2IPQ X;  2ZFU A;  1YW7 A;  2RDP A;  4BL0 B;  1BBY A;  5IYB J;  3RI4 A;  4C9Y A;  3DKX A;  4ENN A;  1TWH J;  1VND A;  1RUO A;  2JRT A;  1XMX A;  3U21 A;  2VBZ A;  3CUQ A;  1MMS A;  2Y2Z A;  1BIB A;  4ASN A;  2KIF A;  5A2Q K;  3RCO A;  4II2 A;  3LSP A;  5HDK A;  4BDZ A;  1JTX A;  2KT0 A;  1LQ1 A;  4L9J A;  4EVI A;  1MJB A;  1LDJ A;  4A3G J;  4EV0 A;  3IAS 2;  3TP0 A;  3HG9 A;  1YFH A;  4MLO A;  4CCO A;  2UXN A;  2OF7 A;  1FIP A;  3F72 A;  2EIK H;  3JRD A;  3HC7 A;  5ICC A;  1G3Y A;  5DV5 A;  3GVA A;  3J7Y J;  2LYC A;  1A31 A;  3BLY A;  2H09 A;  3G1L A;  2QSH X;  3JRE A;  2WY7 Q;  4AIJ A;  3QAH A;  1WJD A;  3HRU A;  1Y56 A;  4UVC A;  4OWR B;  3H0D A;  3E7L A;  3MZY A;  3JRG A;  2DFF A;  4RGR A;  4OMY A;  4BAY A;  3K1M A;  1XG1 A;  2JMW A;  2KIQ A;  4P9U A;  3CCU I;  2P81 A;  4JX4 A;  1IZ1 A;  2XAJ A;  1FP1 D;  3ZP5 A;  5EZG A;  3IH2 A;  3OL3 A;  3U9G A;  4EMS A;  3BR5 A;  1I5Z A;  1WJA A;  3WU1 B;  3RKX A;  1XD7 A;  4EJT A;  1UFM A;  4II3 A;  3OYI A;  3CJN A;  1P6R A;  2JUG A;  4HW0 A;  1GXP A;  3M4O J;  4HZF A;  1V4R A;  3RTR A;  3NAR A;  2K7L A;  4E7Z A;  1F4K A;  5EYR A;  3K6G A;  1YOV B;  4BJT A;  1I1S A;  1P4W A;  4BUP A;  3LSG A;  2BV6 A;  1HST A;  5GAH J;  3OYL A;  3IRR A;  1W36 C;  3BR1 A;  2R7X A;  3NAU A;  1SFO J;  1ETQ A;  1ZK8 A;  3F23 A;  4FX4 A;  1KYW A;  3H1C A;  4U0W A;  2LRD A;  1PJR A;  4G7H F;  3TDZ C;  2XRO A;  3CMM A;  1JKO C;  4UHT A;  1VQ8 I;  1TT0 A;  2FNA A;  2F5C A;  2XGC A;  3H5N A;  1YJN I;  1ZEL A;  3D5R C;  5J8C A;  1P7I A;  1O3R A;  4A3E J;  3ROU A;  1HQC A;  1BIA A;  1TNS A;  2TRT A;  3CCR I;  1K7A A;  5EGO A;  4KIT B;  2CQ7 A;  1NK3 P;  3E6M A;  5D6E A;  4RS8 A;  1JJ8 C;  2E1N A;  3S16 J;  1UAA A;  2ME6 A;  3PO2 J;  2R92 J;  4F91 B;  3QPH A;  4U7D A;  4BQA A;  1SVM A;  4G9Y A;  4PJJ A;  1R9T J;  2PN6 A;  4L0Y B;  3CME I;  2KHM A;  3E3V A;  1YW9 A;  5L3C A;  2KLO A;  2V79 A;  1S6L A;  1J9I A;  2UUZ A;  4MNU A;  3HOW J;  3EQL F;  3I54 A;  2M5W A;  2EA2 A;  5CYV A;  3RPQ A;  4GDF A;  2ZC2 A;  1IXS B;  3FKI J;  3HOY J;  4CYD A;  4KIC A;  1TC3 C;  2LY2 A;  1L0O C;  2ECC A;  1R7J A;  2MBF A;  2HPI A;  3L7W A;  3C3W A;  4KN4 X;  2Y75 A;  2HR3 A;  1MZB A;  3I58 A;  3VDX A;  1F43 A;  2D1V A;  1ZH5 A;  2JSP A;  3HOT A;  1KU7 A;  3H9Q A;  3O8G A;  1U0J A;  1XCV A;  5KAI C;  3ZXS A;  5IYC J;  4L18 B;  5C4X J;  3A2K A;  3PL8 A;  5B66 C;  4MEX F;  1FBQ A;  2OBP A;  3WTX C;  1SFE A;  3KZY A;  2LF8 A;  2ZSH B;  2AHQ A;  3O8H A;  4G94 A;  5M3F J;  3LFK A;  5AIQ A;  3OIQ A;  2M34 A;  2EQR A;  3PIP F;  2NS7 A;  2KDZ A;  1I3Q J;  4G7O F;  3E5U A;  1HW1 A;  1XCB A;  2IBD A;  4U0V A;  4OIO F; 
#chains in the Genus database with same CATH homology
 3TQN A;  4A0Z A;  3CUQ B;  4OIP F;  2EV5 A;  1BM9 A;  2RVC A;  4WWC A;  5F6F A;  2HZT A;  4HF2 A;  3EYY A;  1FSE A;  3H3Z A;  3K0L A;  1CGP A;  1FT9 A;  4S04 A;  1XGO A;  4XRF A;  5LGN A;  1TQP A;  1R58 A;  2MLG A;  4UUV A;  2AXL A;  1H9G A;  4ZZL A;  3P9C A;  5HLI A;  2PI0 A;  5D8L B;  2P5K A;  3RYP A;  4JK1 X;  2CG4 A;  1XN7 A;  2A07 F;  1IRG A;  2WC2 A;  1R00 A;  3GYH X;  1ZN2 A;  5E17 F;  3BP8 A;  3IKV A;  1E2X A;  4HX4 A;  4HX7 A;  4ZZD A;  3QP5 A;  1K79 A;  2GXG A;  3VB2 A;  3K9T A;  3ZMD A;  1Y0U A;  3WGI A;  4L9V A;  4I0B A;  2L02 A;  2PMU A;  1RI7 A;  3CDH A;  1S8N A;  2M87 A;  2TDX A;  3KZZ A;  4O3M A;  2F5E A;  3ZMS A;  1TQI A;  1HKS A;  5IT9 Z;  4CHU A;  4HBL A;  3WE2 A;  1XB4 A;  4MTD A;  1LJ9 A;  5F1R A;  1DDN A;  3DXJ F;  2RNJ A;  4LB6 B;  4UVA A;  2QUF A;  3HSE A;  4OOI A;  4RAY A;  4R79 A;  2FXA A;  3KP4 A;  1XSX A;  4PDK A;  2ISZ A;  3L9F A;  3WE3 A;  5E1X A;  2DTR A;  1MKM A;  2BGC A;  3ZMV A;  2HS5 A;  5D5W B;  2PFB A;  1MGT A;  2AS5 F;  1ZLK A;  2ETH A;  3FWE A;  3IKT A;  4FHT A;  5LLQ A;  3EDP A;  2D2W A;  2EK5 A;  1W7P D;  1ULY A;  3GZ5 A;  3ECH A;  1W5T A;  2EFQ A;  3TDU C;  2F2E A;  5D5X B;  5H20 A;  2CW0 F;  1U5T B;  3QRF F;  1R1U A;  2XGX A;  3ELK A;  4A5N A;  2NNN A;  4LMY A;  3V8J A;  4ZYG A;  3Q5F A;  4BYY A;  3I0T A;  3VOD A;  1OPC A;  2IP2 A;  3M1E A;  5LEJ A;  3L00 A;  5AIP A;  3TO7 A;  2GWR A;  2DAO A;  1ON2 A;  2ZKZ A;  1K78 A;  3T8R A;  1UHM A;  2M45 A;  4G6Q A;  3KE2 A;  4LB5 A;  2FBH A;  1R23 A;  2NNY A;  4L0Z B;  3T0Y A;  5D5V B;  1LNW A;  4S05 A;  3GXO A;  2M30 A;  1UHW A;  4TV7 A;  2MD5 A;  1LEB A;  1WKM A;  1W7P B;  1YS6 A;  3K69 A;  4IRH A;  4RB2 C;  1LB2 A;  2HKX A;  5CVU A;  1D8K A;  1U6G A;  2VC0 A;  1ZRC A;  2GQQ A;  1J75 A;  2HDC A;  2NYX A;  2ZME A;  4UVB A;  3V7R A;  4A2U A;  4A0X A;  2YX4 A;  1XMA A;  4GO1 A;  2EWN A;  4A6D A;  1BJA A;  4G7Z F;  1TW2 A;  3IWF A;  2OQR A;  2P8T A;  1B6A A;  5HS8 A;  1SFX A;  3HSR A;  2DFI A;  3DQV C;  3H3U A;  3F6V A;  1BC7 C;  2UWM A;  4PGG A;  1VTN C;  5D4R A;  1BN5 A;  2XRN A;  2P5L C;  3BPX A;  5DYM A;  4GYG A;  2IA2 A;  1QO0 D;  3FXU A;  5JR3 A;  3U1D A;  1B9M A;  2W85 A;  4MTE A;  4WXC A;  1FYK A;  4KUM A;  4P5O A;  1FNN A;  4KIB A;  1JE8 A;  2DBB A;  3Q9V A;  3FM3 A;  1WI9 A;  4CGZ A;  4CO8 A;  5LHG A;  2CWE A;  4LG0 A;  4OIQ F;  2NRA C;  2GA2 A;  2EFN A;  2FA5 A;  1FSH A;  2W24 A;  2W57 A;  1O7F A;  2ZCW A;  1DPR A;  2CO5 A;  1IN5 A;  2XIG A;  3R60 A;  1K78 B;  2MH2 A;  3BDD A;  2O03 A;  2LDU A;  2XAH A;  3FXR A;  5ICE A;  5HOO A;  2XKP A;  1B1B A;  1G3S A;  4M6Y A;  3I53 A;  1HW2 A;  2J5O A;  2C6Y A;  4RGX A;  2G7U A;  2VXZ A;  4F7Z A;  1BI2 A;  4HV6 A;  4KT5 C;  2IJL A;  3LA3 A;  1IRF A;  4ESB A;  4BNC A;  4PCQ A;  3L2C A;  4HLX A;  3O3K A;  4M9Z A;  2FML A;  4HF0 A;  2X4H A;  4LK0 F;  1J0R A;  3MEX A;  4YIF A;  2YU3 A;  3HRS A;  2ZME B;  3IRQ A;  1T38 A;  2O61 A;  3GX4 X;  1U2W A;  2E1C A;  2VOO A;  3BZ6 A;  5DCF A;  2XAF A;  5D5U B;  5D4S A;  2VON A;  2V1X A;  2KKO A;  4P55 A;  2ELH A;  2M8E A;  2O8X A;  2OZ6 A;  3H92 A;  4B8X A;  1S3J A;  2CQK A;  2IA0 A;  2QLZ A;  4M73 A;  3HRT A;  1AWC A;  4KA4 A;  2HTJ A;  3K1N A;  2BE5 F;  4I98 B;  2QWW A;  3BOQ A;  4A0Y A;  2OZU A;  3E6C C;  3BJ6 A;  1TW3 A;  2P7C B;  4YFN F;  1HXD A;  1KU3 A;  4RGS A;  1XDU A;  5L3B A;  4PZJ A;  1FBU A;  1EH7 A;  1R22 A;  3R6S A;  1QZY A;  2VT3 A;  1KQ8 A;  4I0A A;  4MHG A;  3M9A A;  1RNL A;  3C7J A;  3RYR A;  2DW4 A;  3CTA A;  4EGZ A;  2PJP A;  1JHH A;  3FHZ A;  2VT2 A;  2DK8 A;  5J8F A;  2QBY A;  4UNO A;  3WG9 A;  4LG0 B;  3V8L A;  5CLS A;  2QEN A;  4ESF A;  1ZGA A;  3JAM K;  3ZPL A;  1P92 A;  2EFO A;  1J5Y A;  1SD6 A;  1U8R A;  2KIM A;  2R7F A;  1Z9C A;  2EA4 A;  4CXF A;  1WRJ A;  2XVC A;  2PBI A;  4YG2 F;  1I6X A;  3LST A;  3MCZ A;  5CJ9 A;  5EEH A;  3COA C;  1LVA A;  4KMU X;  2GIV A;  3SZT A;  2V1U A;  1RUN A;  1FBS A;  2VN2 A;  1S29 A;  1UCR A;  3KP5 A;  2RGV A;  2D1H A;  4I7H A;  5LEK A;  4KDP A;  4KMF A;  2EFW A;  3E6D A;  2A61 A;  3WTU C;  3HSF A;  4OMZ A;  1T2K A;  1OKR A;  2K4B A;  4FT8 A;  5K1Y A;  1I27 A;  4AVP A;  3GFL A;  1ZRF A;  4O5V A;  5H6Q A;  1Z6R A;  3V7C A;  2FNP A;  2IW5 A;  3JTG A;  1YO5 C;  3K2Z A;  2RC4 A;  5D8K B;  1SFU A;  3F8N A;  4KN7 X;  1ZG1 A;  2ACJ A;  2FRH A;  3LQR A;  2XAG A;  2EV0 A;  3ABU A;  2GAU A;  2HTS A;  3M7G A;  3QOP A;  2VC1 A;  2H94 A;  1B9N A;  5BPI A;  3GZ6 A;  3NEU A;  2HKO A;  3EYI A;  5KK1 A;  1R1T A;  3NQO A;  2RV8 A;  1XMK A;  4JQF A;  5ILV A;  5LGT A;  3KP2 A;  2A6E F;  4XLP F;  1IN6 A;  3ZMT A;  1KYZ A;  1U78 A;  4IXA A;  2Z33 A;  2A5Y B;  2VBW A;  2QBY B;  3HYI A;  4LK1 F;  4L9N A;  3ISP A;  2QQB A;  1YYV A;  2R7D A;  4M71 A;  1HW5 A;  1ZHF A;  3F3X A;  1FLI A;  1QZZ A;  1ZRE A;  5TRD A;  3GW2 A;  5CVJ A;  5LBQ A;  3N97 A;  3KFW X;  1PDN C;  4WF2 A;  1MJ9 A;  4P9F A;  2KJB A;  1QBJ A;  1ZAO A;  5L3G A;  1YQA A;  4G8X A;  1O3T A;  1R5G A;  1B59 A;  1RZ4 A;  3FMR A;  5IT3 A;  4D0P A;  5JVT A;  3DFG A;  3MFK A;  5DD8 A;  2OA4 A;  2W84 A;  2COM A;  3VFZ A;  4HQM A;  1IXR C;  2JSC A;  2LF7 A;  5LRS A;  1LDD A;  4GCV A;  5LHI A;  3F8M A;  4LGW A;  1G4D A;  1Z91 A;  3FZV A;  4NQW A;  1J2X A;  5HDG A;  4GXO A;  5FLX K;  3J81 Z;  1BC8 C;  2STT A;  4N9I A;  3KEO A;  1F5T A;  2VOD A;  2NAZ A;  1SMT A;  4EM1 A;  2KJC A;  2JTV A;  3IWZ A;  4RGU A;  1YW8 A;  4GYI A;  2P5V A;  1QQI A;  5DUI A;  5E8I A;  4L5J A;  4AIH A;  4ON0 A;  3QPT A;  3CLO A;  2OU2 A;  2DT5 A;  5CVR A;  3QU3 A;  1FYM A;  1SMY F;  1O57 A;  3CO7 C;  1HKQ A;  1CF7 A;  4LJZ F;  2FBK A;  1IN4 A;  2JZY A;  2VOP A;  4L5I A;  1YG2 A;  2G7H A;  2UXX A;  1G3T A;  1IUY A;  1Z1D A;  4EJV A;  4HQE A;  3J81 K;  1XGS A;  5DD4 A;  3WOD F;  5CVV A;  2K86 A;  3GFI A;  3ZMZ A;  5BMZ A;  3FMS A;  5D6F A;  1FC3 A;  1JHF A;  1F9N A;  3LWF A;  2GA1 A;  1P4X A;  2EB7 A;  2Y0M A;  2DPD A;  4IRI A;  4OIN F;  3REO A;  4Q48 A;  4DNC A;  3HTS B;  1HKT A;  2L3D A;  1D3Y A;  3KCC A;  1FX7 A;  3W6K B;  1X3U A;  5KVR A;  3HUG A;  1FZP B;  4I02 A;  1XDS A;  4UV8 A;  4Q4Z F;  4IRG A;  3WTS C;  4IPA A;  1MD0 A;  2V6C A;  1USS A;  1IAW A;  3DF8 A;  1D5V A;  4EJW A;  3GFJ A;  1KQ9 A;  4UV9 A;  4A5M A;  3ZN0 A;  5FD5 A;  1ONV A;  2KIU A;  2YX7 A;  1ZG3 A;  3P9K A;  3LA7 A;  2ZO4 A;  3ML6 A;  1IF1 A;  2RQP A;  5ICF A;  1ZRD A;  3BPV A;  3G3Z A;  4LFU A;  2IA1 A;  2WWY A;  1TLH B;  1ZG5 A;  2VBX A;  4IVN A;  3LAP A;  2EV6 A;  2A6H F;  2HGC A;  3J80 K;  4ENM A;  1FPQ A;  1OYW A;  2L4M A;  4AWX B;  3SZP A;  1FOK A;  5DEQ A;  3WTT C;  4RB0 A;  4B09 A;  2ZJ2 A;  3SFZ A;  4ENK A;  2ZNZ A;  3PQK A;  2QVO A;  1FP2 A;  3MZH A;  2EFP A;  1IXC A;  1CF7 B;  2HYF A;  5HS9 A;  5L3D A;  1P2F A;  5HVQ C;  3O6B B;  3R4K A;  3M8E A;  4WCG A;  4N0B A;  1FYL A;  2DK5 A;  3AAF A;  1LEA A;  4U7B A;  4OIR F;  4DQ2 A;  4BHB A;  4ZYE A;  2DQL A;  2PLY A;  3L09 A;  4KIF A;  2F5F A;  5FO5 A;  1IW7 F;  4RB3 C;  4IHS A;  3WGH A;  1TNT A;  3I5U A;  3RPU A;  2E7W A;  3FF5 A;  4H0E A;  2IRF G;  1E17 A;  2P6T A;  4ZYH A;  4HX8 A;  2MLK A;  2WTE A;  4I09 A;  4CZZ A;  3TOA A;  2FQ3 A;  1FWZ A;  4AD9 A;  3E5X A;  3BWG A;  4NB5 A;  3D0S A;  4YFK F;  4P96 A;  1GVJ A;  1QNT A;  3R0A A;  2ZBK A;  1JXS A;  2GXB A;  4XSX F;  4HA8 A;  2ZNY A;  1IN7 A;  2MA3 A;  1GXQ A;  5FB2 A;  3G73 A;  3D5L A;  5HLH A;  3IHU A;  1QPM A;  5JI6 A;  1AOY A;  2M1B A;  4CDG A;  2FE3 A;  3FM5 A;  3JAM Z;  3OOP A;  4WX9 A;  5BS6 A;  4HV5 A;  2FU4 A;  2R3S A;  1ZAR A;  3T8T A;  3GUD A;  2DO7 A;  5LRR A;  1T39 A;  1SD5 A;  1XGN A;  3JW4 A;  5L3F A;  2Z5U A;  1Z7U A;  2CFX A;  4MGR A;  1DPU A;  4KIG A;  3DPL C;  5E18 F;  1UST A;  2HQR A;  1SD7 A;  1HBX G;  2BYV E;  3BRO A;  5ILU A;  1W4M A;  3CUQ C;  4M9X A;  1ZYR F;  4GGG A;  3VOE A;  3HIF A;  3WTV C;  5E1W A;  4E70 A;  1DUX C;  3KP7 A;  2HWV A;  2P6S A;  4IF4 A;  1S7O A;  2W25 A;  3NRV A;  4Z2Y A;  3ZMU A;  2X0L A;  2K02 A;  3GEZ A;  4LLL A;  2LKP A;  2ESH A;  2LSO A;  5F64 A;  4ETS A;  1ON1 A;  5DCM A;  1BOA A;  2FEZ A;  1J7K A;  3WGG A;  1I1G A;  2Q2E A;  2OQG A;  1K6O A;  1XGM A;  2QZ8 A;  3HRM A;  4HLY A;  4A6E A;  1NHA A;  1YTY A;  3DP7 A;  3K1P A;  3I64 A;  4Q5S F;  3F8C A;  4L9T A;  5FGM A;  4XBF A;  3B73 A;  3WTY C;  3KP6 A;  2STW A;  1L3L A;  1HSJ A;  3HOS A;  3R61 A;  1G6N A;  2BBY A;  5H6R A;  3C1D A;  4MEY F;  3M8F A;  4R8H A;  5LHH A;  3DPT A;  1EV7 A;  1ZLJ A;  4YII A;  1XSV A;  1Z6T A;  3GLX A;  1Z05 A;  3F8B A;  3V4G A;  4HDV A;  2EJR A;  1REP C;  2FMY A;  2YSR A;  3RKY A;  2FF4 A;  4N9H A;  3KP3 A;  2Z9O A;  1RIO H;  1MDM A;  3B02 A;  2DQR A;  5ILS A;  1O7L A;  4ZH4 F;  3OV8 A;  2PEX A;  1G3W A;  1YIO A;  1KQ0 A;  3QP6 A;  3RIR A;  4BHC A;  1EH6 A;  1U3E M;  3I4P A;  2XAS A;  2DI3 A;  2K4J A;  2XKO A;  2A68 F;  1EH8 A;  4HOB A;  1U5T A;  1B4A A;  3E97 A;  1U5T C;  2VE8 A;  2HQN A;  4NHJ A;  3I71 A;  4R1H A;  4UXN A;  3LAJ A;  3WTZ A;  3LQQ A;  5BPD A;  5FLX Z;  4ENJ A;  1KA8 A;  1A04 A;  1Q1H A;  3ECO A;  2A69 F;  5DDG A;  3JSO A;  2HEO A;  4LLG F;  3FMQ A;  1KU9 A;  4AIK A;  2QQ9 A;  4PGH A;  5E8G A;  4MQV A;  1OR7 A;  4QWQ A;  5DCM B;  1KU2 A;  3HHG A;  3LA2 A;  3FX3 A;  5K5R A;  1IN8 A;  2JT1 A;  3GF2 A;  3ULQ B;  3W6J B;  3IC7 A;  4EM2 A;  4BXU A;  3DKW A;  2JPC A;  5K5O A;  4FX0 A;  3TGN A;  6PAX A;  3Q9S A;  1R36 A;  3ERE D;  2L01 A;  3DV8 A;  5BOX A;  2YPR A;  2QYO A;  4O6J A;  4HDU A;  3GWZ A;  2DPU A;  3P7N A;  3S2W A;  3BY6 A;  1GHC A;  2P7V B;  2ADU A;  1W7P A;  2PMH A;  2XUB A;  3T1B A;  5JHU A;  5E20 A;  4KNY A;  4OU0 A;  1R5H A;  3BJO A;  2GZW A;  5CVI A;  5E1Z B;  5FFX A;  2MH9 A;  2L54 A;  2QM3 A;  1UB9 A;  3TO9 A;  2ZFW A;  3I59 A;  2LNB A;  2IT0 A;  2RN7 A;  3CO6 C;  4U0Y A;  1O3S A;  3SHF A;  2CSO A;  3F21 A;  1P4A A;  2QQA A;  3F22 A;  5ED4 A;  4RAZ A;  4KFC A;  2Y48 A;  1WWX A;  2IVM A;  4XLN F;  1MDM B;  3E6B A;  4QLC U;  2HFH A;  2Z3Y A;  4BHP A;  4HF1 A;  1ZGJ A;  2XV4 S;  2YR2 A;  2D45 A;  1BI0 A;  4Y17 A;  5ERI A;  4LLN A;  3T5X A;  5IT9 K;  4EJU A;  4I2O A;  2O6G E;  3EET A;  2NS0 A;  3BJA A;  4KYW A;  1PUE E;  2J5P A;  4RB1 A;  2ESN A;  2DU9 A;  3GFM A;  1FY7 A;  2Q0O A;  3PQJ A;  4ZYD A;  2B0L A;  3TOB A;  2DLL A;  3ZQ7 A;  3GO5 A;  5FD6 A;  2UZK A;  4JBA A;  2H27 A;  5J6X A;  1STZ A;  4Y15 A;  2ZXJ A;  2HYG D;  4Q47 A;  2F5D A;  1BI1 A;  3CUO A;  4EGY A;  1LDK B;  3P9I A;  3ZN1 A;  3J80 Z;  1S7A A;  1V3F A;  3JTH A;  1TBX A;  5LGU A;  1JGS A;  4WK8 F;  4CIC A;  2A3S A;  4EQQ A;  1H9T A;  5ICG A;  2CYY A;  2PG4 A;  2K27 A;  3IL2 A;  3KLO A;  4M72 A;  1OYI A;  4I01 A;  3VEP A;  2PQ8 A;  1WQ2 A;  2H6C A;  1MJA A;  1WSU A;  1PP8 F;  1H0M A;  4MQ9 F;  1R1V A;  2L4A A;  5AON A;  1SAX A;  2O0Y A;  3QU6 A;  3I59 B;  1QGP A;  3TKY A;  3KLN A;  4G6D A;  1TTY A;  3J7A O;  3R0J A;  1OMI A;  4HYE A;  2VE9 A;  2KRF A;  1XSD A;  4K2E A;  3E5Q A;  3WU0 A;  3V8K A;  2O3F A;  2FOK A;  3KET A;  3F6O A;  4EM0 B;  3FXQ A;  2RKH A;  2OD5 A;  2VBY A;  5L3E A;  5BQT A;  4U88 A;  4Y13 A;  2BEO A;  2Q8K A;  4LD5 A;  3SQN A;  3C18 A;  2WV0 A;  3RJP A;  2E7X A;  5FFZ A;  4WXD A;  3HTU A;  1KGS A;  1SD4 A;  2JPB A;  2FSW A;  4ESJ A;  4YFX F;  2XAQ A;  3TO6 A;  3WTW C;  1F1Z A;  1T98 A;  1PP7 U;  1C0W A;  3O2P E;  3JSP A;  1YLF A;  3PFI A;  1YS7 A;  3HHH A;  2HOE A;  5TJJ A;  2MC3 A;  2G9W A;  3V7S A;  2V1D A;  1TQM A;  4A12 A;  1BI3 A;  5EEG A;  3SXY A;  5A2Q Z;  2CGP A;  2Z99 A;  2XHK A;  3DEU A;  3U2R A;  3N4M A;  5JFR A;  5HDN A;  3RKW A;  3EUH A;  1D8J A;  4IJA A;  1O3Q A;  1ODD A;  3MAJ A;  4XSZ F;  2OAZ A;  4BH9 A;  1T0F A;  3ABT A;  5HS7 A;  2V9V A;  5DUK A;  1OYY A;  3MWM A;  1W5S A;  4EJO A;  3F8F A;  4HAM A;  4WXH A;  4M9S A;  2H6B A;  1J59 A;  5K5Q A;  4M74 A;  3MQ0 A;  2FBI A;  2ISY A;  5HLG A;  3KEQ A;  2P4W A;  1T6S A;  1DP7 P;  4IHT A;  3RDI A;  4M6X A;  2IPQ X;  1YW7 A;  2RDP A;  1BBY A;  3RI4 A;  4ENN A;  1RUO A;  2JRT A;  2VBZ A;  3CUQ A;  1BIB A;  4ASN A;  2KIF A;  5A2Q K;  5HDK A;  1LQ1 A;  4L9J A;  4EVI A;  1MJB A;  1LDJ A;  4EV0 A;  1YFH A;  2UXN A;  3F72 A;  5ICC A;  1G3Y A;  5DV5 A;  3GVA A;  2H09 A;  4AIJ A;  3QAH A;  3HRU A;  4UVC A;  3MZY A;  4RGR A;  4OMY A;  4BAY A;  3K1M A;  4P9U A;  1IZ1 A;  2XAJ A;  1FP1 D;  3ZP5 A;  3U9G A;  4EMS A;  1I5Z A;  3WU1 B;  3RKX A;  1XD7 A;  4EJT A;  1UFM A;  3CJN A;  1P6R A;  4HW0 A;  1GXP A;  4HZF A;  1V4R A;  3RTR A;  2K7L A;  1F4K A;  1I1S A;  1P4W A;  3IRR A;  2BV6 A;  1HST A;  4FX4 A;  3F23 A;  1KYW A;  4U0W A;  4G7H F;  3TDZ C;  2XRO A;  4UHT A;  2FNA A;  2F5C A;  5J8C A;  1O3R A;  3ROU A;  1HQC A;  1BIA A;  1TNS A;  1K7A A;  3E6M A;  5D6E A;  4RS8 A;  2E1N A;  3QPH A;  4U7D A;  4BQA A;  4G9Y A;  2PN6 A;  4L0Y B;  3E3V A;  5L3C A;  1YW9 A;  1J9I A;  2V79 A;  1S6L A;  4MNU A;  3EQL F;  3I54 A;  2M5W A;  2EA2 A;  5CYV A;  3RPQ A;  1IXS B;  4CYD A;  4KIC A;  1L0O C;  1R7J A;  2MBF A;  3L7W A;  3C3W A;  4KN4 X;  2Y75 A;  2HR3 A;  1MZB A;  3I58 A;  2D1V A;  1ZH5 A;  3HOT A;  1KU7 A;  1XCV A;  4L18 B;  4MEX F;  1FBQ A;  2OBP A;  3WTX C;  1SFE A;  3KZY A;  2LF8 A;  4G94 A;  3LFK A;  5AIQ A;  4G7O F;  3E5U A;  1HW1 A;  1XCB A;  4U0V A;  4OIO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...