4AVPA

Crystal structure of the dna-binding domain of human etv1.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords ETS TRANSLOCATION VARIANT 1
total genus 28
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4avpA00
1HW1A 1IRGA 4ENNA 4NB5A 3I59B 1XMAA 3IWZA 5IT9K 4PDKA 1SMYF 2L02A 4DQ2A 1SFXA 2KJCA 1YW9A 4LGWA 2ZMEB 4HQEA 3V8LA 1Z1DA 4UUVA 2HQRA 3HSRA 4G6DA 1U6GA 3HOSA 2RDPA 4KIBA 4B09A 3CDHA 2H6CA 1GXQA 2EWNA 1IF1A 2PMHA 3D0SA 3SZPA 3FZVA 4ZYGA 4MQVA 1XD7A 1KYWA 1KYZA 3KP3A 3QP6A 4AWXB 4CDGA 1XDUA 3F8MA 2L54A 2BGCA 4S04A 3I64A 4EM1A 2W24A 1ZARA 1WQ2A 3EETA 3REOA 3KP6A 2M45A 2QENA 4WXCA 2P7CB 3DEUA 1A04A 1R5GA 2P5LC 3PQJA 4Y17A 3KP2A 1QZYA 2P4WA 1HXDA 1OYYA 2NAZA 4YFKF 1TW3A 1P4AA 2PFBA 2FNAA 3P9KA 1FBSA 4KMFA 2OZ6A 5HS8A 4LB5A 5D5VB 1J2XA 2QYOA 1I5ZA 4G7ZF 4A0YA 1J9IA 3RPQA 4LB6B 1ZN2A 3ABUA 1DDNA 2Y75A 4NQWA 4GXOA 5AONA 4IVNA 1Z6TA 4HBLA 2V9VA 4WX9A 3W6KB 4L9NA 3JAMK 1E17A 2P5KA 2DT5A 5LEKA 3VOEA 3Q5FA 1TBXA 4UXNA 1C0WA 3MAJA 3HRSA 2FSWA 3E6CC 1MJAA 3E5QA 3I4PA 2KIFA 1PDNC 3HRMA 1EH8A 2NYXA 2F2EA 4U0YA 4IJAA 2LNBA 3V8KA 4ESJA 1Z05A 1EV7A 1J75A 1BC8C 3E6BA 3F22A 5DUKA 3LAJA 4EJUA 4MGRA 2A68F 2ZNYA 5DCMA 2BE5F 2H09A 4I2OA 1O57A 2P6SA 4HX4A 3WTVC 4O6JA 5IT9Z 1FNNA 4HV5A 5AIPA 4M6XA 3WTTC 1ZRFA 3R6SA 1TLHB 3WE2A 5BMZA 2DK5A 1MGTA 4FX4A 3CUOA 1O3TA 4HOBA 3ISPA 2XAJA 4U7DA 3DQVC 4M72A 2M87A 3K1PA 2MH9A 5TJJA 1D8KA 3GXOA 3RYPA 2E7XA 2JPBA 2OD5A 3SFZA 1R1UA 2GA2A 5FO5A 1U5TA 4RGXA 1BI2A 3I71A 2W57A 2TDXA 1F5TA 3JTHA 4RS8A 3RTRA 2YR2A 1REPC 3KZYA 2Q2EA 5LHIA 3GFJA 4BHCA 5ICEA 1TW2A 3U2RA 3HIFA 1USTA 3CTAA 3F8NA 3JAMZ 3NQOA 3CLOA 4G94A 4ON0A 3KP4A 4KDPA 4JQFA 1L0OC 4FT8A 5D4SA 4BHPA 4R79A 5EEGA 2R3SA 2P5VA 1T39A 1RIOH 2M8EA 5L3DA 2PQ8A 2IW5A 4HF0A 5HS7A 3FMQA 1XGSA 2JSCA 1LDKB 5DD4A 4CXFA 3K1NA 3KZZA 1G6NA 2X0LA 2HGCA 2K4JA 4IF4A 3HHGA 4LK1F 4I98B 2HYFA 2L3DA 4QWQA 4LLNA 2VN2A 1KU3A 1YW7A 3ERED 2VC0A 2DPDA 1F9NA 4EV0A 5CVVA 1LEBA 2IA1A 2OAZA 2YU3A 2A6HF 2OQRA 4KN4X 3IKTA 4HX8A 2K4BA 3IHUA 3BWGA 2PBIA 2Q8KA 4P55A 4O5VA 4EGZA 1AWCA 5LGNA 5JHUA 1JXSA 2EV6A 3K9TA 4ASNA 2PEXA 3RPUA 4YIIA 2MLGA 5L3GA 5FD5A 5FGMA 2ZBKA 1FY7A 2HTSA 6PAXA 5E17F 2EK5A 3H3ZA 2FMYA 4RB0A 4U88A 5E1WA 5LHHA 3N97A 2RV8A 1ZRCA 2VOOA 3F21A 5ICGA 1J0RA 3NRVA 4RB1A 2GIVA 2LDUA 3QOPA 2D45A 1K7AA 3BROA 1UHWA 2B0LA 2UXXA 3BDDA 5DCFA 3C7JA 3E6MA 1XGMA 5HLGA 3VODA 1ULYA 5DYMA 1HKSA 3BJ6A 1FBQA 3SQNA 4ENMA 4D0PA 2CGPA 3P9IA 3KE2A 1AOYA 3GF2A 2ACJA 2UWMA 4G6QA 2PLYA 2YX4A 2G9WA 4O3MA 3K1MA 1CF7B 2QBYA 1G3TA 3WTUC 5D5UB 1UHMA 2DQLA 4OU0A 3KLNA 1HSTA 1P4WA 3BJAA 4G9YA 3H3UA 1I1GA 4KIGA 3BOQA 4I0BA 3ABTA 2G7UA 1HKQA 1P4XA 5LEJA 3U1DA 1I6XA 3DP7A 2HKOA 4MEXF 2NRAC 1DPRA 1TTYA 4DNCA 5H6QA 2FU4A 2XRNA 4AVPA 2QWWA 3GX4X 2EFNA 3FXRA 2IVMA 3L7WA 2EJRA 1Z91A 4MTDA 1BN5A 3TDZC 2ZO4A 3QU3A 1KQ9A 1GVJA 4HYEA 3HTUA 2CWEA 2W25A 1T38A 5CYVA 1IRFA 3T8RA 3MWMA 1QPMA 4ZH4F 2ESNA 5L3CA 4BQAA 4HA8A 1CGPA 3FX3A 3RIRA 3F6VA 1YQAA 1T2KA 4E70A 2STWA 1QBJA 1O3RA 1U3EM 2EV5A 2PJPA 1YLFA 4Q4ZF 4HAMA 2YSRA 4M9SA 1STZA 1XCVA 4GYIA 3HOTA 4N9HA 1LDJA 1LNWA 4P96A 2E1NA 1RI7A 5ED4A 5CVRA 2K86A 3FXQA 5L3EA 2D1VA 1YW8A 2IJLA 1UB9A 2JRTA 2Z33A 3GYHX 4RGRA 5ILUA 2FOKA 3HYIA 2MBFA 3WTYC 5K5QA 5HDNA 3RKWA 2M5WA 3GFLA 2IA0A 3QAHA 4UHTA 5JR3A 5K5OA 2L4MA 2KIMA 3ULQB 3U9GA 3FHZA 2O6GE 1MKMA 3W6JB 3DXJF 1G3SA 5D5WB 1ZG5A 1W5SA 5L3FA 3HSFA 3DV8A 3N4MA 1BJAA 1D5VA 2VBYA 1IN7A 1TNSA 5DV5A 2H27A 2H6BA 2F5EA 4KICA 3T1BA 2DBBA 5CLSA 2NS0A 3O2PE 3GVAA 2VBWA 4I01A 1P92A 2XAGA 2BBYA 2AXLA 1R7JA 1MD0A 3DPLC 1HBXG 4IRHA 4IRGA 1I27A 1BIAA 5D6FA 1FSHA 2JT1A 5LGTA 3KEOA 4EJOA 5HDGA 3V7CA 1ZAOA 2FNPA 1F4KA 5DD8A 2HYGD 3E6DA 3S2WA 4YFXF 3F72A 1XGNA 2P8TA 1LQ1A 3TKYA 3V7RA 4HF2A 3BZ6A 1JE8A 1HW2A 4HLXA 2FXAA 5FB2A 1ZG1A 2BEOA 3CO7C 4GGGA 1FYMA 4Y13A 3L09A 4EJVA 4ZZLA 4ETSA 2V79A 3ZMZA 2JTVA 3KEQA 3AAFA 2DW4A 3LSTA 2OBPA 1XDSA 5FD6A 1ZG3A 1D3YA 1WKMA 2KJBA 4NHJA 3B02A 4A6EA 3J81Z 2QM3A 1HW5A 1OYIA 5FFXA 1EH7A 4HW0A 4EM0B 1YO5C 2MH2A 2QQAA 1LVAA 4LMYA 2F5CA 2HKXA 1PP7U 3KETA 1FWZA 3M8FA 4IRIA 2R7DA 4ZYHA 5F64A 2XKPA 1IXRC 1BBYA 2ISZA 5BQTA 3HRTA 1MJ9A 5F6FA 4A0XA 1FP1D 1G4DA 4GO1A 3WTZA 3ZMSA 3P7NA 1EH6A 2HOEA 1D8JA 1SFEA 1WSUA 4XBFA 2R7FA 5LHGA 3E5XA 5LBQA 1T98A 1S7OA 4A5MA 2ZNZA 5KVRA 3F8CA 5J8CA 3H92A 2RQPA 1R58A 4HDUA 2HDCA 5A2QK 3L00A 3VEPA 3GFMA 4G7HF 2L4AA 1U8RA 2KRFA 1K78B 4IHSA 3DFGA 3TO9A 4MTEA 5D8KB 2CQKA 3L2CA 5E18F 2QVOA 5CVIA 1XCBA 3NEUA 2MLKA 4MNUA 1IUYA 3K69A 2WC2A 2L01A 1FX7A 1T0FA 4L9VA 3BJOA 1TQIA 3HTSB 1HQCA 1B59A 4L9JA 3FM5A 4KA4A 3RI4A 1XGOA 4LK0F 4FX0A 2DAOA 1U5TC 4RGSA 2QBYB 2MA3A 5LRRA 1K6OA 5FLXZ 4I7HA 3GO5A 1J5YA 5ERIA 3JSPA 4Q5SF 1J7KA 4EMSA 2VONA 4HZFA 4G8XA 2QZ8A 4MHGA 1R23A 2RN7A 1LEAA 2GQQA 1VTNC 1WRJA 2QLZA 1JGSA 4UVCA 1S8NA 4KT5C 3LFKA 3FMSA 3FM3A 3MFKA 2YX7A 1YS7A 2XVCA 2GA1A 2EFWA 2FE3A 4JBAA 4KIFA 2PN6A 1GHCA 1ODDA 1XSVA 2VBXA 2JZYA 4OMZA 1Q1HA 2FF4A 2CFXA 3EDPA 2XIGA 4LD5A 5BS6A 4L0ZB 4GYGA 3ZMVA 2E7WA 1KGSA 3LQQA 2QQBA 4OINF 2G7HA 1IN4A 3KFWX 5K5RA 1J59A 3RJPA 3JW4A 3TO6A 3F23A 2O03A 3EYYA 2XUBA 2NNYA 2A07F 1OKRA 4P9UA 1FP2A 2ZCWA 2XAQA 3IC7A 4JK1X 5E1XA 5H6RA 2HR3A 4HX7A 4Z2YA 4AIKA 1KQ8A 1Z9CA 3HHHA 1YFHA 3LA7A 1IXSB 3ELKA 5E8GA 4CHUA 1B1BA 1V4RA 4K2EA 2RGVA 2COMA 1ONVA 4YFNF 3QU6A 4A5NA 2RKHA 1RUOA 3I54A 2CO5A 2QQ9A 1V3FA 4YIFA 1R00A 2H94A 1ZLJA 3E97A 1LJ9A 4WF2A 3WE3A 3KCCA 1U78A 1FC3A 2V1UA 5DEQA 4QLCU 2DFIA 2XHKA 3IRRA 4XRFA 3CUQA 3C3WA 5KK1A 4H0EA 4L0YB 3F6OA 4RAYA 4FHTA 4BXUA 1KA8A 4A0ZA 3QP5A 1B9MA 3CUQC 3QPHA 2UZKA 4RGUA 5HDKA 1FYLA 3KP5A 1R1TA 5HLIA 2PI0A 3CO6C 1R5HA 3MZHA 3TOBA 1W7PA 1FT9A 1RNLA 2RNJA 5IT3A 2XAHA 5HLHA 1QZZA 1YYVA 2VODA 3OV8A 1DUXC 4ZYEA 1K78A 1DPUA 4R8HA 3R0JA 5DDGA 4OOIA 5E20A 4PZJA 3I58A 1T6SA 3WG9A 1F1ZA 1B4AA 3C1DA 4BNCA 3KLOA 4OIRF 1FZPB 1W7PB 3JTGA 3R60A 3HRUA 3ZQ7A 5E1ZB 5BPIA 5DUIA 4EJWA 4EM2A 1FOKA 3ZMTA 1XN7A 1UCRA 1ON2A 1HSJA 4OIPF 1BI3A 1P6RA 3RYRA 4UV8A 5TRDA 3GUDA 4RAZA 3OOPA 4M9XA 4BYYA 4WXDA 5D8LB 4S05A 3SHFA 3GZ6A 5ICCA 1UFMA 4M9ZA 2K02A 2FBKA 4TV7A 1KQ0A 4U0WA 4A12A 3GWZA 2K7LA 3WTSC 2ZKZA 4LG0A 4XLPF 4OIOF 2XROA 3T8TA 3ZPLA 2XV4S 1ZYRF 2BYVE 2J5PA 2ESHA 1BC7C 2VE9A 4KYWA 5FFZA 3BPXA 1XSDA 2WTEA 4M74A 1SFUA 1IN6A 4L9TA 4CO8A 1S29A 1B9NA 5LRSA 3O6BB 2F5FA 4LJZF 5JVTA 2GXBA 4WK8F 2FA5A 4KMUX 3Q9VA 1O3QA 2Z5UA 2VE8A 2CG4A 1R22A 1L3LA 3I59A 2FRHA 1QQIA 1ZRDA 5JFRA 2F5DA 1SMTA 3M1EA 1TQMA 3WGGA 2O3FA 3J80Z 5BOXA 4GCVA 4A2UA 3ECHA 1O7LA 2LF8A 5D4RA 1YS6A 2BV6A 4HV6A 2ZFWA 3DF8A 3E5UA 4ENJA 2KIUA 1G3WA 4B8XA 3WODF 4M73A 4EGYA 1R36A 1ZGAA 2KKOA 1Z6RA 2EA2A 4EVIA 5LGUA 2IP2A 1ZHFA 4AIHA 3WU1B 4HQMA 1OYWA 4ESFA 2Y48A 2HQNA 2MD5A 1PP8F 2VC1A 3EQLF 2Y0MA 5AIQA 1DP7P 1NHAA 5ILSA 2EV0A 5CJ9A 5FLXK 3PFIA 3WTWC 2OQGA 2WWYA 2RVCA 3SZTA 2HFHA 4RB2C 1IN5A 2IPQX 3MCZA 3LQRA 4HDVA 5J8FA 2HS5A 3ZN0A 4YG2F 3LAPA 3RDIA 4PCQA 3TDUC 2O8XA 3HSEA 5D6EA 3M9AA 5K1YA 1Y0UA 2P6TA 3RKYA 2DU9A 2STTA 3GW2A 3J7AO 2DLLA 1LDDA 2Z3YA 1YIOA 4R1HA 2HWVA 3D5LA 3K0LA 4M6YA 4MEYF 3LWFA 4PGHA 4CGZA 4CYDA 2E1CA 3FWEA 1RUNA 3IRQA 1FPQA 3TOAA 1S7AA 1OPCA 1K79A 2O0YA 4IXAA 1IN8A 4KNYA 2Q0OA 2JPCA 3COAC 4KFCA 2MC3A 3LA2A 4XLNF 4UNOA 2K27A 3DPTA 2FQ3A 2HEOA 5DCMB 4IPAA 3ZN1A 1QGPA 4ENKA 1KU2A 4IHTA 1R1VA 2DO7A 2A69F 5L3BA 3IKVA 3IWFA 1H0MA 4P9FA 3WTXC 2V1DA 1JHHA 1X3UA 4HF1A 3F8FA 2A3SA 4ESBA 1YG2A 1WWXA 2EFPA 3JSOA 2YPRA 4F7ZA 1ZGJA 4P5OA 5HS9A 1IZ1A 1H9GA 2VT3A 1RZ4A 1IW7F 1QO0D 2VOPA 1BOAA 4L5JA 1ON1A 4M71A 2P7VB 2NNNA 1SAXA 3DKWA 2ADUA 4WCGA 1JHFA 4MQ9F 2ZXJA 4L5IA 5ILVA 3G3ZA 3BP8A 1MDMA 1SD4A 3BY6A 2VT2A 4Q47A 2Z99A 4ZYDA 4UVBA 2W85A 4N9IA 2DTRA 3PQKA 2ELHA 2W84A 4LFUA 4UV9A 3SXYA 5CVJA 3LA3A 2PG4A 2ETHA 4BHBA 3MEXA 1MJBA 2IRFG 3I0TA 3VB2A 3R61A 3Q9SA 4A6DA 5J6XA 2GWRA 1OR7A 1SD6A 1MDMB 4N0BA 3ZP5A 2OA4A 4U0VA 3WGIA 2OU2A 4BH9A 5ICFA 2DI3A 2XGXA 4UVAA 2M30A 2XASA 1O3SA 3ZMUA 2LKPA 3R4KA 1KU7A 4CICA 2VBZA 1ZLKA 2ISYA 3V8JA 4ZZDA 1QNTA 2FMLA 3R0AA 2O61A 3QPTA 1USSA 5EEHA 4Q48A 1TNTA 3MZYA 1E2XA 1S3JA 3KP7A 3VFZA 4KN7X 2DPUA 3V4GA 2A5YB 5HOOA 2Z9OA 3I53A 3TO7A 1IXCA 2QUFA 1HKTA 3T0YA 3WU0A 2D2WA 1BM9A 4AD9A 4LLGF 4WXHA 4WWCA 1W4MA 5LLQA 2PMUA 2D1HA 4OIQF 3EUHA 1OMIA 4EJTA 2RC4A 2CYYA 1SD5A 3TQNA 3G73A 2GZWA 3M7GA 5E8IA 4EQQA 3GZ5A 4LG0B 3WGHA 1TQPA 2X4HA 1SD7A 1LB2A 3J81K 3ECOA 4OMYA 3IL2A 2CW0F 1GXPA 3EYIA 3ROUA 1WI9A 1MZBA 2VXZA 3FXUA 3ML6A 4U7BA 2DK8A 1XSXA 1P2FA 4XSZF 4L18B 3HUGA 2ZJ2A 5CVUA 3CUQB 2V6CA 2EFOA 2GXGA 2HTJA 5BPDA 1U2WA 1B6AA 2FBHA 1W5TA 1KU9A 5A2QZ 5F1RA 1FBUA 1BI1A 2GAUA 3MQ0A 1FLIA 3T5XA 2A61A 5D5XB 2ZMEA 2CSOA 2EA4A 1BIBA 2V1XA 2OZUA 2EB7A 3GLXA 3V7SA 2A6EF 1IAWA 4I09A 2M1BA 4G7OF 3FF5A 2LSOA 2DQRA 3O3KA 4AIJA 2XAFA 3B73A 2AS5F 2WV0A 2FBIA 2UXNA 1FSEA 4I02A 3I5UA 2J5OA 3GEZA 1ZREA 3F3XA 1O7FA 4LLLA 5JI6A 1YTYA 1U5TB 1BI0A 3E3VA 2LF7A 3TGNA 3C18A 3M8EA 1XMKA 3QRFF 2C6YA 1FYKA 3CJNA 4I0AA 2IA2A 1H9TA 1CF7A 2IT0A 5HVQC 2XKOA 3F8BA 3J80K 1Z7UA 2EFQA 4Y15A 4CZZA 3L9FA 3GFIA 1ZH5A 3K2ZA 3RKXA 1S6LA 1W7PD 1I1SA 2HZTA 4XSXF 1G3YA 3P9CA 5H20A 2FEZA 4RB3C 4KUMA 4HLYA 1PUEE 1XB4A 3ZMDA 3FMRA 3BPVA 4BAYA 4PGGA
chains in the Genus database with same CATH superfamily
1HW1A 1IRGA 3MZ8A 2MD0A 3MKWB 4ENNA 4NB5A 3I59B 2GXAA 2NS8A 1XMAA 3JRGA 2F4MB 3IWZA 5IT9K 4PDKA 1SMYF 1YX5A 2L02A 5JLWA 4DQ2A 1SFXA 2KJCA 2K9NA 1YW9A 4PSXA 3FKJA 1MNMC 2E1MC 4LGWA 2DJIA 3HEFA 3PNYA 5KCMA 2YS9A 2ZMEB 4ZJZA 4HQEA 2PJRA 3A0BC 4G6TB 2X1EA 2L7ZA 3V8LA 4E7JA 1Z1DA 4JX5A 4UUVA 3LSKA 2HQRA 3HSRA 3OYKA 2QEXI 2ZSHB 4G6DA 4N4OB 1JUPA 1EF4A 1U6GA 4NC6A 3ZQGA 3HOSA 2RDPA 4ZDPA 2JA5J 2OPTA 4RAGA 4KIBA 1MNEA 4B09A 2HOTA 3QODA 3DU6A 3CDHA 2H6CA 4XR6A 3AL0C 1GXQA 1ERDA 2EWNA 1IF1A 1SFOJ 2CUEA 3OIQA 4M3EA 2PMHA 2QSGX 3D0SA 3SZPA 3FZVA 4ZYGA 4MQVA 2LY9A 2M4GA 1XD7A 1KYWA 1WH7A 5FLMJ 1KONA 1KYZA 3CP8A 1AKHA 1B72A 3KP3A 3WU2C 2XRLA 3G1MA 3QP6A 4AWXB 4CDGA 1XDUA 4BQOA 3F8MA 2L54A 2BGCA 2Z1DA 4S04A 4BUPA 2TCTA 3PSIA 3I64A 1Y56A 4IQJA 4FE4A 4EM1A 2ZB9A 2W24A 3OYCA 2WY8Q 1ZARA 1WQ2A 4UUSB 3EETA 3REOA 2F4OB 3KP6A 3TL4X 2M45A 2QENA 3OYHA 4WXCA 1EKEA 2I5UA 2P7CB 2WA0A 3DEUA 1A04A 3ZRGA 4EATA 1DU6A 1R5GA 1IG7A 2QGUA 1JTXA 1OISA 3A1YA 2Y9YA 2P5LC 3PQJA 4Y17A 3VYUB 3KP2A 1QZYA 2P4WA 4D9JA 1E0EA 2HYJA 1W0UA 1HXDA 1OYYA 3HKZN 3K4BA 4LIVA 2NAZA 4YFKF 2H8RA 1A6IA 2LVSA 1TW3A 1P4AA 3S14J 2PFBA 2FNAA 2KLOA 3P9KA 1FBSA 4UB6C 2OZ6A 4CCNA 4KMFA 2LMDA 2VKDA 5HS8A 3LSIA 4CYCA 4LB5A 5D5VB 1J2XA 3GTMJ 5EG0A 2QYOA 3E0JB 1NK2P 1I5ZA 2Y2ZA 4IEJA 4G7ZF 1MW7A 4KISA 4BL0B 4A0YA 1J9IA 1R71A 1RPWA 2CQ7A 3RPQA 4LB6B 5KAFC 1JJ8C 3VDXA 1POGA 5GAGJ 1ZN2A 2MYSA 3CLQA 3ABUA 1E3PA 2Y75A 4NQWA 1DDNA 4GXOA 5AONA 2IS4A 2HXIA 4IVNA 1Z6TA 4PJMA 5E79C 2XPWA 4HBLA 4DYRA 3W3CA 3HPGA 5JLXA 1QHGA 2V9VA 4WX9A 3W6KB 4L9NA 3JAMK 2MFZA 1E17A 3K4LA 1I3AA 1Z67A 2P5KA 1WPKA 2DT5A 4V19K 1SVMA 5LEKA 3VOEA 3Q5FA 1VZ0A 1TBXA 4UXNA 1C0WA 3MAJA 3GBGA 3HRSA 3RPUD 3VYRB 2FSWA 1JKRC 3E6CC 4B1RA 1MJAA 1K4SA 3E5QA 1Y0NA 3I4PA 4CYCB 2KIFA 3G1LA 4AYBA 3MD2A 3HRMA 1PDNC 1EH8A 2NYXA 5KAIC 4XIDA 4E6KG 2F2EA 4NDLA 4U0YA 4C30A 4IJAA 2LNBA 2HPMA 3W6VA 3V8KA 4ESJA 1QHHD 1EV7A 1Z05A 1J75A 1BC8C 2X6XA 1OQYA 3E6BA 1JI8A 3F22A 3JR9A 4DW6A 3DWLE 2WADA 2E1OA 1B72B 3CJTB 5DUKA 1AKHB 1APLC 3ZR8X 4E7LA 3DU5A 3LAJA 1P7JA 4EJUA 4LG3A 4MGRA 2IGOA 2A68F 2ZNYA 5DCMA 2XPVA 1ZKGA 2BE5F 2H09A 2HDDA 4I2OA 4C3IJ 3CCVI 5E3OA 1O57A 2P6SA 4HX4A 2FJ1A 3J7AY 3WTVC 3CCRI 1D1CA 4O6JA 3GTJJ 5IT9Z 2DCEA 3CCLI 4JP0A 1FNNA 4HV5A 4CCKA 2VJJA 2ME0A 5AIPA 4M6XA 1BR2A 2GOXB 4Y3OA 3WTTC 2XC7A 1ZRFA 3R6SA 1TLHB 3Q3SA 5IOYA 1FIAA 3WE2A 3ZQLA 2N8GA 5BMZA 1VQ6I 2DK5A 4J01A 1MGTA 2FX0A 2DA5A 4FQGA 3CUOA 4V2GA 4FX4A 1O3TA 1D0YA 4HOBA 3ISPA 2DOFA 3FK7A 4BJ5C 2XAJA 4U7DA 3DQVC 2M2EA 1TC3C 4M72A 3BR1A 2M87A 1T95A 3LSMA 3K1PA 2MH9A 3DTIA 2M0MA 3IP4B 5TJJA 4P1WA 1D0ZA 1UJ8A 1D8KA 3GXOA 2CH0A 3RYPA 2E7XA 2JPBA 2OD5A 3SFZA 2IGKA 2VPRA 1R1UA 3OYNA 4W1UA 1ZQ3P 3VSKA 2GA2A 5FO5A 1U5TA 4RGXA 3A01B 1BI2A 3I71A 3S1MJ 2W57A 2TDXA 2E5NA 1F5TA 3JTHA 2JVGA 1W1WE 4RS8A 2YR2A 3RTRA 1REPC 4BACA 1OCRH 3KZYA 5GAEJ 2Q2EA 2K9QA 4B3AA 2L0KA 2V4JC 5LHIA 3GFJA 4BHCA 2MG4A 5ICEA 1JGGA 1TW2A 3U2RA 3HIFA 1USTA 3CTAA 3F8NA 3HGGA 3K4NA 3NQOA 4MIMA 3CLOA 4PSWA 4G94A 2DYSH 4ON0A 3JAMZ 3KP4A 4Y52J 4KDPA 4JQFA 1L0OC 5J1RA 1F36A 4D7MA 4FT8A 3CCYA 5D4SA 4BHPA 2R7QA 1MH4A 1X4OA 4R79A 5EEGA 3CCJI 2QA4I 2R3SA 2P5VA 1T39A 1RIOH 2VLAA 1YITI 2M8EA 3P5JA 4BY7J 4DIQA 3B6CA 5GPAA 5L3DA 2HOAA 1Z21A 2KP6A 2PQ8A 2IW5A 4HF0A 5HS7A 3FMQA 1XGSA 4A3LJ 2JSCA 1XMXA 3GLLA 4UB8C 1LDKB 5DD4A 4V2FA 4CXFA 1IRZA 2KISA 3K1NA 2VASA 2CUFA 3KZZA 1G6NA 2VJ4A 2EZKA 1GVDA 2X0LA 2HGCA 4HSRA 1MMGA 2K4JA 4IF4A 1FJLA 2WB1N 3HHGA 3CP2A 4I98B 4LK1F 2HYFA 2L3DA 1TZLA 3SFIA 1WFXA 3LOCA 4QWQA 1KZHA 4LLNA 2VN2A 4F52A 1IRXA 1KU3A 1YW7A 3ERED 3O8HA 2VC0A 2DPDA 1F9NA 4EV0A 5CVVA 1JKOC 2IA1A 1LEBA 2OAZA 1W36C 2ID3A 2YU3A 2A6HF 4E7IA 2OQRA 2K9LA 1VF9A 4XKBA 5EYRA 5E3MA 1FMVA 4KN4X 1BA5A 3IKTA 2CUJA 3WHBA 2O5RA 5F1JA 3BG5A 5EG0B 4U87A 1W0TA 4HX8A 2K4BA 3IHUA 4IOCF 1OCOH 3HOWJ 3BWGA 2R7TA 2PBIA 2Q8KA 2HVSA 4P55A 1VQPI 3MVPA 1DU0A 3PNVA 4O5VA 4EGZA 3QPLA 1AWCA 1LE8A 5LGNA 2Y30A 3FISA 5JHUA 4B47A 4PJLA 1JXSA 1E3OC 2EV6A 3K9TA 4ASNA 2PEXA 2V9KA 3RPUA 4BGDA 4YIIA 2R7SA 2MLGA 5L3GA 1Y6IA 1HC8A 1I6HJ 5TGTA 2BW3A 5FD5A 2LR8A 5FGMA 2JQ7A 2XGDA 5K7FA 2CQXA 1F43A 3ASOH 2VPLA 1QZEA 2DA2A 2ZBKA 1V5EA 1FY7A 2HTSA 2Z16A 3LL7A 6PAXA 5E17F 2EZIA 3PUFA 4II2A 3HM5A 2EK5A 3H3ZA 2FMYA 4RB0A 4U88A 5E1WA 5LHHA 3N97A 2RV8A 1T33A 2DDBA 2W00A 1ZRCA 2VOOA 3KYDB 3F21A 5ICGA 1J0RA 2L9RA 2ELKA 3NRVA 4RB1A 2GIVA 2LDUA 3QOPA 2A5WA 2D45A 1K7AA 3BROA 1UHWA 4CH7A 2B0LA 2UXXA 3BDDA 5DCFA 3AG2H 3E6MA 3C7JA 4MFEA 5GPCA 1XGMA 2Y0SA 3VODA 1ULYA 4DGWB 5HLGA 5DYMA 4XL9A 1HKSA 3G6EI 4XRMA 3BJ6A 1FBQA 3SQNA 4ENMA 4D0PA 2CGPA 3P9IA 3KE2A 3JRAA 1AOYA 3GF2A 2ACJA 2GIZA 4G6QA 2UWMA 4ZYAA 2PLYA 2YX4A 2G9WA 4O3MA 3ZQFA 3K1MA 1CF7B 1MMDA 3NARA 2QBYA 2RREA 1G3TA 3OSGA 3RKQA 3WTUC 3EUKL 1AHDP 5D5UB 3M3YJ 1UHMA 2DQLA 4OU0A 3NWTA 3KLNA 3SEZA 1HSTA 1P4WA 1FTTA 2ICWG 3BR5A 3M1CA 2KRCA 5EZHA 5C44J 5F08A 1SFKA 3BJAA 4G9YA 4A3CJ 4IZZA 3H3UA 1TL8A 4ABZA 1D1BA 1H89C 1I1GA 3DBLB 3N05A 2E2IJ 4KIGA 3TP3A 3BOQA 4I0BA 2JMWA 3ABTA 2G7UA 1HDDC 1HKQA 2DT7B 2ZC2A 1P4XA 4A3KJ 4A3JJ 2X48A 2GOMA 3HB9A 5LEJA 3U1DA 3IV5A 1OCCH 1I6XA 3DP7A 2HKOA 4MEXF 2NRAC 2CU7A 1XC5A 4M3DA 1DPRA 5IPAA 3CC7I 1TTYA 4DNCA 5H6QA 3SYTA 2FU4A 2R7OA 3HKZA 2XRNA 4PJJA 4AVPA 3J7ZI 2QWWA 3GX4X 2EFNA 3HBLA 3IH4A 1ETWA 3FXRA 3CDLA 2IVMA 3HL2A 3G71I 3L7WA 4IHXA 3LFUA 2D5VA 2EJRA 2FQ4A 1Z91A 1WJ5A 2E35A 1N75A 2R7XA 3MKYB 4MTDA 1BN5A 4F55A 4CCLA 3TDZC 2BZTA 1T0FC 1K4TA 2JN6A 2ZO4A 3BTLA 3QU3A 3IUOA 1KQ9A 2VQGA 4A3FJ 1LUJB 4C2TA 1B8IA 5EJCA 1GVJA 4HYEA 3HTUA 2CWEA 2W25A 3H0GJ 3OIOA 2ZJPF 3LSRA 1T38A 5CYVA 4PJNA 1LFBA 5TISC 1IRFA 3T8RA 4BEHB 2O9LA 3MWMA 2JA2A 4RLFA 1QPMA 5F27A 4ZH4F 3W2AA 3DEWA 2ESNA 4BE2A 5L3CA 4BQAA 4HA8A 1CGPA 4JYKA 3FX3A 3RIRA 3F6VA 3HOZJ 2E1MB 2PX9A 1YQAA 3OMYA 4NNJA 1T2KA 2HU9A 4AYBN 1E3HA 3HOUJ 1VQ7I 4E70A 2STWA 1MBGA 1QBJA 1O3RA 1U3EM 2EV5A 2PJPA 3QQAA 4B48A 1YLFA 4Q4ZF 3LSJA 4FETA 1H8AC 2DOEA 4HAMA 2YSRA 4M9SA 1STZA 2RNGA 1XCVA 4GYIA 3HOTA 4X1EA 2NXNB 4N9HA 3S93A 4DJAA 1LDJA 1LNWA 2E2HJ 4P96A 3MMYB 1Y1VJ 2ECBA 2E1NA 1RI7A 5ED4A 5CVRA 4D7NA 1HF0A 3OYJA 2EBIA 2K86A 1RKTA 3FXQA 5L3EA 2HQ5A 3S8PA 1G8XA 2D1VA 1VFCA 1YW8A 2IJLA 1UB9A 2JRTA 3QPSA 2Z33A 5FRNA 3GYHX 2W1OA 4RGRA 1BL0A 5B66C 4BDYA 3A0HC 5ILUA 2FOKA 3HYIA 2MBFA 3PFYA 1S5LC 3IAS2 4C9YA 4CCJA 3WTYC 5K5QA 5M5WJ 5HDNA 1EJ9A 3OL3A 5FROA 3NWSA 2IS2A 4XLEA 4HNUA 3RKWA 3C2HA 2YUSA 2EZLA 2M5WA 1N78A 1IV6A 3GFLA 1DQUA 2IA0A 3QAHA 4UHTA 5JR3A 5K5OA 2E36A 4FASD 1N77A 3OS2A 4AU7A 3HOVJ 2IS6A 1ZTRA 2L4MA 5EDNA 2KIMA 3ULQB 3U9GA 3FHZA 1ETOA 5F0CA 2O6GE 1MKMA 3W6JB 1MMNA 3DXJF 3BR2A 3CCUI 1G3SA 5D5WB 1ZG5A 3TBIA 1W5SA 3QWLA 3RSNA 5L3FA 3HSFA 4RLQA 4XN0A 3DV8A 1Z3XA 3VSLA 3N4MA 1BJAA 3CDIA 2XAUA 2DA7A 1D5VA 4DBQA 4ZC3A 5B1AH 2VBYA 5DM6F 1IN7A 1TNSA 1X1PA 2DXIA 3D5SC 2GM4A 5DV5A 2H27A 2H6BA 2F5EA 4KICA 4Y4RA 3T1BA 2DBBA 5CLSA 2OF7A 2NS0A 1A6QA 3VYTB 3O2PE 3GVAA 2X51A 2VBWA 4I01A 1P92A 2XAGA 5EZGA 3JRDA 3LSGA 2BBYA 3K4MA 2AXLA 2KRHA 2NVUB 1R7JA 1X19A 4XOTA 1MD0A 1U9NA 3DPLC 1HBXG 1P9QC 4IRHA 4IRGA 2EPFA 5DTDA 1I27A 1BIAA 3QOEA 4XLCA 5D6FA 1LE8B 1Y8RB 3OYEA 2H1LA 2CW8A 4GDFA 3FK6A 2JT1A 2K3PA 5LGTA 1FSHA 3KEOA 4EJOA 5HDGA 3V7CA 1ZAOA 2JA7J 2FNPA 2IBDA 5DD8A 1YE9A 2HYGD 1F4KA 3E6DA 3HJEA 5J40A 1VQ8I 3I4NJ 3S2WA 2DT6A 2ECCA 4J19A 1H88C 4QIWN 4YFXF 1GDTA 2M8GX 3ABLH 2X6YA 3F72A 1XGNA 4S0HB 5FKNA 1I50J 5HNHA 4YEJA 2P8TA 1LQ1A 5FKOA 3TKYA 3V7RA 4HF2A 3BZ6A 4BQQA 1JE8A 1HW2A 4HLXA 2FXAA 2M9HA 4AM3A 5F0HA 5FB2A 2A05A 1ZG1A 1A35A 2BEOA 2VIXA 3CO7C 4GGGA 1FYMA 2OCCH 4Y13A 4DYCA 3L09A 4EJVA 2WAQN 3K6GA 1PJRA 4ZZLA 1QU3A 2XSJC 4HEA2 4ETSA 4XONA 2V79A 3ZMZA 2KDZA 4X6AJ 2JTVA 3KEQA 3AAFA 2CV1A 2DW4A 4PUSA 1ETYA 2F6CA 3CZ6A 1FOYA 3H35A 3LSTA 1Y39A 2BY1A 3ONQA 2OBPA 1XDSA 2V9PA 2X9DA 5FD6A 1ZG3A 1D3YA 3S1RJ 1WKMA 3AFHA 2KJBA 4NHJA 3B02A 4IHWA 5IYDJ 4A6EA 3CCMI 2M4KA 3J81Z 2QM3A 1HW5A 4E7HA 1OYIA 5FFXA 3SDBA 1EH7A 3DKXA 2WAEA 1JUSA 2AXTC 2HQAA 3ABMH 4HW0A 2DMQA 4EM0B 1YO5C 1A36A 2MH2A 2E19A 4HSTA 2QQAA 1OLTA 1LVAA 1SVOA 2HXOA 4LMYA 1K6YA 4RM2A 1VQ9I 2COBA 2MC4A 1FOWA 2F5CA 2HKXA 4BXXJ 1PP7U 3KETA 1FWZA 3M8FA 1ZR2A 1WHUA 1FIPA 4IRIA 1J09A 4NC8A 2R7DA 4ZYHA 3GTKJ 5F64A 4LIUA 2XKPA 2P81A 1IXRC 1BBYA 2ISZA 1DP3A 1JKQC 5BQTA 2CQQA 3HRTA 4DZPA 1MJ9A 5F6FA 4A0XA 1FP1D 3LNQA 1G4DA 2M7AA 4G12A 2CQNA 4GO1A 3WTZA 4RBOA 3FKIJ 2Y0SN 5FKLA 3ZMSA 3P7NA 2LKSA 4UY8I 1EH6A 2HOEA 2RAEA 2MGQA 1D8JA 1SFEA 1WSUA 4XBFA 4BKXA 3PSFA 2R7FA 1HCRA 5LHGA 3CC4I 3E5XA 3HZJA 5LBQA 1T98A 2R5ZB 5IP7J 2DODA 3L1PA 1S7OA 4CUGA 2LC2A 3OYFA 2F5VA 4A5MA 2ZNZA 4B43A 3K70D 5KVRA 3F8CA 5J8CA 4XICA 2X85A 3H92A 2RQPA 2E5ZA 1R58A 4HDUA 2F48A 2HDCA 5K7ZA 3G4SI 2XB5A 5A2QK 3L00A 3ERMA 3VEPA 3GFMA 5B3SH 4G7HF 3CD6I 2L4AA 2LH9A 1U8RA 2KRFA 4IX7A 2HPIA 3EUAA 4A3EJ 1K78B 4IHSA 2VB6A 3DFGA 4MO7A 2DTZA 3A01A 3TO9A 2DMTA 4MTEA 5D8KB 2CQKA 3L2CA 1LFUP 5E18F 1QVUA 2QVOA 2XF5A 3K4CA 2DJNA 3HGYA 5EGOA 4UUTA 3I9V2 3OYMA 1XPXA 4N4NB 5CVIA 4AIDA 1XCBA 3NEUA 4DBRA 4OWRB 2MLKA 3ZQCA 4J00A 1UG2A 4MNUA 1IUYA 3K69A 4FISA 2WC2A 2R4GA 2W7NA 1WI3A 2L01A 3HOYJ 1FX7A 1HOMA 2WV1A 1T0FA 4L9VA 4F92B 1ZGWA 3BJOA 2LG4A 1TQIA 2VJIA 5FRMA 3HTSB 1HQCA 1B59A 4L9JA 3H1CA 3FM5A 2JA8J 4KA4A 3S32A 2QF7A 4M3GA 5CKTA 2AO9A 1BJZA 2BXZA 4DYQA 3RI4A 1XGOA 3H9JA 3TEDA 5EGOB 4LK0F 2L9SA 4FX0A 1LFPA 4RMNA 2DAOA 1U5TC 4RGSA 2QBYB 2MA3A 1VQKI 5LRRA 1K6OA 1ETQA 1MNDA 1WH5A 5HNFA 4ZTJA 5FLXZ 5DS9A 4BQNA 2RQQA 3QYEA 4I7HA 3GO5A 1J5YA 2AQFA 2LOOA 1W36D 3JRHA 5ERIA 2AHQA 3JSPA 4Q5SF 1J7KA 4EMSA 2VONA 4HZFA 4G8XA 3IH2A 2QZ8A 2BVMA 4MHGA 1ETVA 3L2QA 1R23A 2BY3A 2RN7A 3BG3A 3OYLA 1LEAA 4FCYA 3E7LA 2XPUA 2GQQA 1VTNC 1WRJA 2GBYA 2QLZA 3BG7A 1JGSA 3ABKH 2ZJRF 1JT0A 1TT0A 3KEYA 4UVCA 1ZK8A 4A69C 3GTOJ 1S8NA 4M3FA 3W2VA 2OJED 3KIOA 4KT5C 3LFKA 3FMSA 3S3NA 3FM3A 3MFKA 2YX7A 1OR7C 1YS7A 2HI3A 3DEEA 3FXJA 2XVCA 2ZMEC 2GA1A 3MKZA 2EFWA 4QPQA 2FE3A 2WY7Q 2BHYA 4PFOA 1ITYA 3MKLA 3PO2J 2MW8A 4JBAA 1Q1VA 4KIFA 4AVZA 2PN6A 1GHCA 1ODDA 1XSVA 2VBXA 2HVRA 3FXOA 2JZYA 4OMZA 1Q1HA 2FF4A 2CFXA 3EDPA 1GUUA 1X2MA 2MSYA 2DOAA 2XIGA 3C2BA 4LD5A 5BS6A 4L0ZB 4ZDLA 2LRDA 4GYGA 5HODA 2PMZN 3CCEI 3OYIA 3S15J 1B8IB 3ZMVA 4HRIA 1YHQI 2E7WA 1KGSA 3B6AA 3LQQA 2QQBA 2IXSA 4OINF 4PGGA 2G7HA 3OYAA 1IN4A 1MSEC 1Y8QB 3KFWX 3D5RC 1MSFC 2AQEA 5K5RA 5C4JJ 4D1QA 1J59A 2EH3A 1K61A 1YOVB 3GTGJ 1ZELA 3RJPA 1X1CA 3JW4A 3TO6A 4AC0A 3F23A 1WJAA 4M3BA 1PVEA 2IEKA 2B7EA 2O03A 3EYYA 2XUBA 2NNYA 2A07F 1OKRA 3U1KA 4P9UA 2LFBA 1FP2A 2ZCWA 2L5QA 2EINH 3X2QH 1WJCA 1YRNB 2XAQA 2V6EA 3IC7A 4JK1X 5E1XA 3K70C 3PO3J 1MIJA 3BQZA 3EPZA 3JREA 5GADJ 3GCMA 5H6RA 2HR3A 4HX7A 4Z2YA 4AIKA 1XS9A 1IV8A 1KQ8A 3MN2A 1TT5B 3S16J 1Z9CA 3HHHA 4XLAA 1NH3A 1YFHA 1BOBA 3LA7A 1IXSB 1Z0XA 3ELKA 3K7AJ 5E8GA 4CHUA 1B1BA 1V4RA 2R7ZJ 2ZXWH 4K2EA 2M34A 4XORA 2RGVA 1TWCJ 2COMA 1ONVA 4YFNF 3QU6A 2CMPA 4BXFA 3GTPJ 4A5NA 2XGEA 4KJZA 2RKHA 1RUOA 3I54A 2CO5A 4XQFA 4E7KA 2QQ9A 1V3FA 4YIFA 1R00A 2H94A 1ZLJA 3E97A 1LJ9A 4WF2A 3WE3A 3VPRA 2L7MP 2K3FA 3KCCA 1U78A 2VUMJ 1FC3A 2FD5A 1LVKA 3BLYA 1IGNA 5DEQA 2V1UA 4QLCU 2JWTA 4FE7A 2DFIA 1SVLA 1V5FA 2XHKA 3IRRA 4XRFA 3CUQA 2R5YB 3C3WA 5J47A 1UHSA 5KK1A 3PJRA 4H0EA 4L0YB 3F6OA 4KT6A 4RAYA 2DMUA 4FHTA 4XLHA 4BXUA 2JUGA 1KA8A 4A0ZA 3QP5A 2BY2A 1B9MA 3CUQC 5C4XJ 5CPRB 3QPHA 2CS3A 3BZCA 4II3A 2H8WA 2UZKA 2IAIA 4IKFA 3I4MJ 4RGUA 1D5YA 3CMMA 5HDKA 3H9QA 1P7IA 4BE1A 1K83J 2NVQJ 4DZJA 5JHFA 1FYLA 3KP5A 3TW6A 2JJ7A 1R1TA 5HLIA 1WJFA 2PI0A 1ETKA 3CO6C 1R5HA 2DA3A 3TOBA 2DA1A 3MZHA 1W7PA 1FT9A 1RNLA 2RNJA 5IT3A 2EQRA 3BCAA 5KNLA 2XAHA 1OFCX 3PIPF 1QA6A 5HLHA 1QZZA 1YYVA 2VODA 1IC8A 3OV8A 1DUXC 2L7KA 1X2NA 4ZYEA 1K78A 4OAYA 1DPUA 3HC7A 1YJWI 4R8HA 2CFOA 4BE0A 1WCMJ 3R0JA 5DDGA 3PIOF 4OOIA 1R5ID 5E20A 4HNTA 4PZJA 3JRBA 3BZKA 3I58A 1T6SA 3WG9A 1X3WB 3OS1A 4YELA 3UKGA 1WJBA 3DLLF 4I6ZA 1F1ZA 1B4AA 2XF7A 3C1DA 5J1UA 4RM3A 3OYDA 3TMOA 5IP9J 2L7FP 4XK4A 3HOXJ 3KLOA 4BNCA 2M7BA 1D1AA 1VNDA 4B4CA 4OIRF 3H5NA 1MBHA 1SAUA 2NOJB 1FZPB 1W7PB 1MBJA 3JTGA 3R60A 4XRSG 3HRUA 5IYCJ 4YRVA 3ZQ7A 5B1BH 4CSWA 3K10A 5H2FC 5E1ZB 5BPIA 5DUIA 1Z77A 4EJWA 2OC6A 2OTLI 1UG0A 4EM2A 1NK3P 1FOKA 4XKCA 3ZMTA 4PFPA 4C2MJ 2H1KA 1XN7A 1UCRA 1MH3A 3Q0UA 1ON2A 3CMEI 3FHNA 2K40A 4IOAF 5F0FA 1HSJA 3G1OA 1BI3A 4OIPF 3PM1A 2R7WA 5M5XJ 4ZDOA 1P6RA 3RYRA 2KFDA 1YI2I 4UV8A 5TRDA 4A3GJ 3FDYA 4XKVA 1DGWY 1BR1A 3GUDA 4RAZA 3OOPA 1RKWA 4M9XA 4BYYA 4WXDA 5D8LB 4S05A 3SHFA 1LPQA 3GZ6A 3CESA 5ICCA 1UFMA 4M9ZA 2X1CA 4FTHA 2XF6A 2M3AA 1Z3YA 2K02A 2FBKA 4TV7A 5GTIC 3J7YJ 1KQ0A 1WGXA 3KYLA 3CF5F 1ACIA 3RZOJ 4BBRJ 4C3HJ 3E1SA 4U0WA 3LMMA 4A12A 2O8KA 4E7SA 3GWZA 3K2AA 2W48A 3ZCOA 2K7LA 4ANJA 3WTSC 2ZKZA 4LG0A 3CC2I 4XLPF 1JT6A 4OIOF 2XROA 2X6OA 5K7HA 3LSPA 3T8TA 3ZPLA 4IQ4A 3OR2C 2JRMA 2XV4S 1ZYRF 1N25A 2BYVE 2J5PA 2ESHA 1T8IA 4QPOA 1BC7C 2VE9A 4KYWA 5FFZA 1TWGJ 2R7UA 3BPXA 1WJEA 1XSDA 3QYBA 2P0WA 2VQHA 3AG1H 2WTEA 2HNHA 2W82A 2IGMA 2E71A 4M74A 1SFUA 1IN6A 1HDPA 2E34A 1X3ZB 4L9TA 4CO8A 4AUXA 1S29A 2R92J 1B9NA 3OR1C 5LRSA 2R5ZA 3O6BB 2F5FA 3VWBA 4LJZF 5JVTA 3Q0WA 2GXBA 2OTJI 4WK8F 2FA5A 1CQTA 2DN0A 1WJDA 4KMUX 1R4NB 1R9TJ 4NC7A 3GTLJ 3Q9VA 1O3QA 2Z5UA 1VQMI 2VE8A 3CJRB 2CG4A 4BY1J 1R22A 1L3LA 3FXLA 3I59A 3M8JA 1QPIA 2FRHA 1QQIA 4E4HA 1ZRDA 1QRYA 5JFRA 2F5DA 1SMTA 3M1EA 4A3MJ 2DFFA 1TWFJ 1TQMA 3WGGA 2O3FA 3J80Z 5BOXA 3KZIC 4GCVA 3H5AA 4XNFA 3AKZA 4D5FA 2VL8A 4ZTFA 2BHZA 3DCFA 2HDWA 3JRIA 4A2UA 3ECHA 1O7LA 2WBMA 2LF8A 5D4RA 1YS6A 2BV6A 2BOLA 1NTCA 1ENHA 4HV6A 3V42A 1XG1A 2ZFWA 5FKKA 3DF8A 1R4MB 1VQ5I 2O7OA 3E5UA 2DFEA 4ENJA 2KIUA 1G3WA 4B8XA 3WODF 1AU7A 4M73A 4EGYA 2PMZA 1R36A 5M3FJ 2Y31A 1ZGAA 2KKOA 1Z6RA 2EA2A 1IDYA 3CQZJ 4EVIA 3A02A 5LGUA 2IP2A 4QTRA 1ZHFA 2MABA 3BR6A 4AIHA 3WU1B 2ME6A 2DYRH 4HQMA 1OYWA 2JSPA 1M1EB 4H4KC 1RRJA 4ESFA 2OCEA 5CQEA 1RR8C 9ANTA 1FOXA 1U0JA 3LSHA 2Y48A 4YIRX 1EA3A 3GMEA 3F9KA 3DTKA 2HVQA 3PL8A 3U21A 2HQNA 1O4XA 2XDVA 3L2VA 1V54H 2L2OA 2MD5A 1PP8F 2VC1A 3EQLF 2Y0MA 1SANA 5CQGA 5AIQA 1JKPC 5GTHC 1DP7P 1NHAA 3BCBA 5ILSA 5B5EC 3SEQA 4BDZA 2EV0A 5CJ9A 2KHMA 2E60A 1S9HA 2FOWA 3OIPA 5FLXK 1VQNI 3PFIA 4IL6C 3H0DA 3WTWC 2OQGA 2WWYA 4DOZA 4BJTA 3L2UA 2RVCA 1BW5A 2UUZA 4EEFG 1GLNA 3SZTA 3Q0VA 2HFHA 4RB2C 3JCUC 1UMQA 2JK3A 1IN5A 3D1NI 2IPQX 3MCZA 1HLVA 3LQRA 3I3LA 4HDVA 4XKWA 5J8FA 2HS5A 3ZN0A 4Z6YA 2EIMH 1LKXA 4YG2F 1TP4A 2K9SA 4MLOA 4NQWB 3LAPA 1NG7A 1IO2A 2L9VA 4PCQA 5GP9A 2QQ8A 3RDIA 3FXKA 3TDUC 2O8XA 3HSEA 5D6EA 3M9AA 5K1YA 1Y0UA 3ZQHA 3S1QJ 2P6TA 3RKYA 2KL4A 5J4VA 4CZCA 1OCPA 1QVTA 2DU9A 3SDGA 2STTA 2QSHX 2X1DA 3GW2A 3IAM2 3J7AO 3PUBA 4GFBA 2DLLA 1LDDA 2Z3YA 1YIOA 4R1HA 3SZGA 2HWVA 2OV7A 3DLAA 1T56A 3D5LA 3K0LA 4LITA 4M6YA 4MEYF 3LWFA 4PGHA 5E3LA 3TW7A 2HZDA 2QCOA 1VI0A 4CGZA 2DDAA 4CYDA 2E1CA 3FWEA 3RQ4A 3CMYA 1RUNA 3IRQA 1FPQA 3TOAA 1W5CC 1S7AA 2VKEA 1OPCA 2EIJH 2ZXIA 1K79A 2O0YA 1OJLA 2V26A 4Y7NJ 2I8DA 4IXAA 1NG6A 4QSHA 1YJNI 1IN8A 4KNYA 2Q0OA 4NBQA 5J1YA 2ZSIB 2JPCA 3COAC 4KFCA 2MC3A 3LA2A 4XLNF 4UNOA 2K27A 1Z7LA 3DPTA 5HLTA 3OOUA 2QSFX 3FBNB 2FQ3A 3G2BA 2HEOA 5DCMB 5IYBJ 3BC8A 4IPAA 3ZN1A 4XOPA 3UR3C 1QGPA 4ENKA 4PJ0C 1KU2A 1GV5A 4D5CA 5EF6A 3AL0B 1MBEA 3HPHA 1DGRM 1R1VA 4IHTA 4ITVA 2B9SA 1YRNA 2DMPA 2GLOA 2DO7A 2L9NA 2A69F 1S72I 5IOZA 5L3BA 3IKVA 3IWFA 3RCOA 3KPHA 2ELJA 1H0MA 3CCSI 1FEXA 4P9FA 3WTXC 2V1DA 3ZOBA 1JHHA 1X3UA 4HF1A 3F8FA 1IUFA 4F93B 2A3SA 3VYSB 4ESBA 4XRSA 2LKXA 1YG2A 3BG6A 2CV0A 1WWXA 3CF2A 1R49A 4CCOA 4BU2A 2EFPA 4IO9F 2LY1A 1BR4A 4W97A 3JSOA 1S7EA 3S3MA 3KX2A 2YPRA 4F7ZA 1ZGJA 4P5OA 2VQCA 3KYCB 5HS9A 1IZ1A 1H9GA 1GV2A 2VT3A 1RZ4A 3OYGA 1IW7F 3OS0A 1A5JA 1QO0D 5GAHJ 4PK4A 3DBRB 2DA4A 4C2UA 2VOPA 1BOAA 1ETXA 2JUCA 1MMAA 4L5JA 1ON1A 4M71A 2P7VB 2NNNA 1SAXA 3A03A 1XX5A 2ADUA 3DKWA 2Z2SB 3RQIA 4WCGA 3S1NJ 5BNGA 1JHFA 3CJQB 3EUHC 4MQ9F 1VQLI 2ZXJA 1GT0C 4L5IA 5ILVA 3CMAI 5LFAA 3JRFA 2EZHA 3G3ZA 3BP8A 1SD4A 3BY6A 2VT2A 4Q47A 2LBFA 2R5YA 1MDMA 2Z99A 2LTPA 4UVBA 4ZYDA 3M4OJ 2LYCA 2W85A 2W4SA 1FTZA 4NUBA 4N9IA 2EILH 3WHCA 2YU9J 2DTRA 3PQKA 2ELHA 2W84A 4LFUA 4UV9A 3SXYA 3FIWA 5CVJA 3ZQIA 4BS9A 3LA3A 2PG4A 3BTIA 1Y1WJ 4M6VA 2ZXHA 3HXLA 3ZXSA 2ETHA 4BHBA 5EEAA 3MEXA 3WG7H 1MJBA 2IRFG 1JTYA 3I0TA 3GTQJ 3VB2A 5FJ8J 2VQLA 3PNTA 1FMWA 2CUZA 4I76A 5JVGF 3R61A 3Q9SA 4A6DA 2DA6A 2NS7A 2WAFA 3S3OA 5J6XA 3A4CA 1YIJI 5M5YJ 2GWRA 5J4YA 2BW3B 2LP0A 3HDDA 1VQ4I 2E2JJ 1OR7A 4XM3A 1SD6A 1V5GA 2VKHA 2XSDC 1OCZH 1RESA 1MDMB 3ESWB 3BQYA 4N0BA 3ZP5A 1D0XA 2KZVA 2OA4A 4U0VA 3BTJA 1JUMA 3WGIA 2OU2A 3H9GA 1MBKA 4BH9A 1UELB 1X1AA 5ICFA 2BVLA 2KQRA 2DI3A 2XGXA 4UVAA 2M30A 2XASA 1O3SA 5M3MJ 3ZMUA 3JRCA 2F4IA 1RC9A 2LKPA 5F04A 1YJ9I 1XTAA 3R4KA 1KU7A 4CICA 2QKMB 2VBZA 1ZLKA 2JA6J 4BBSJ 5IY5H 3L2RA 2ISYA 5IP6A 2Y69H 3V8JA 2VJ5A 4ZZDA 1QNTA 1RETA 2LK2A 4LOCA 3OY9A 1R6RA 3OWTA 2FMLA 1X1BA 3R0AA 2O61A 3FXMA 3QPTA 4HPQA 1USSA 5EEHA 2FUG2 4Q48A 1TNTA 3MZYA 2VKVA 1HA8A 1E2XA 1S3JA 3KP7A 3VFZA 4KN7X 2DPUA 3ZQQA 3V4GA 2A5YB 3ASNH 5HOOA 2Z9OA 3I53A 1ORKA 1JJ6C 3RZDJ 3TO7A 3S2DJ 1IXCA 2QUFA 2PJRB 1I39A 1X58A 2V1NA 4XLFA 4GRIA 1I3QJ 1HKTA 3T0YA 3WU0A 4A3BJ 3L2WA 2Q2EB 2D2WA 2ID6A 1BM9A 4A93J 4RA2A 2KIQA 2LBFB 3H3VK 4XN3A 4AD9A 1PUFA 4LLGF 4WXHA 4WWCA 1TWHJ 1UAAA 1X1DA 1W4MA 1V55H 2IGNA 5LLQA 5LD2C 2PMUA 4X0GA 2D1HA 2BY0A 2CRGA 4OIQF 2DFHA 3EUHA 1OMIA 2EIKH 2VI6A 4EJTA 1U8BA 5FLVA 1PYVA 2RC4A 1VQOI 2CYYA 1SD5A 3TQNA 3G73A 2GZWA 4IHVA 3M7GA 5E8IA 1G59A 1YX3A 1SEUA 1MMSA 4EQQA 3GZ5A 4LG0B 3O8GA 3WGHA 1TQPA 1A31A 2K9MA 2X4HA 4HNVA 5DM7F 4Y33A 3BT9A 1SD7A 1LB2A 1WZ2A 4B44A 3M07A 3J81K 2KZGA 3ECOA 5C3EJ 4OMYA 4UUSA 3I56I 2Y9ZA 3IL2A 2CW0F 1PUFB 1GXPA 4F91B 3EYIA 3SJMA 3DTEA 1MBFA 2UV1A 3ROUA 1WI9A 1MZBA 4IHYA 2LREA 4JOMA 2VXDA 2VXZA 3FXUA 3ML6A 2M0CA 4U7BA 2DK8A 1XSXA 4A3DJ 4F3QA 2Q1ZB 1P2FA 4XSZF 4L18B 2NVTJ 3HUGA 2ZJ2A 5CVUA 2CW7A 3S2HJ 2JVHA 2OUMA 1UZCA 3CUQB 4B3XA 3I55I 2V6CA 2EFOA 2NOGA 2GXGA 2HTJA 5BPDA 3H5RA 3CCQI 4C3JJ 3C2GA 1B6AA 2A6TA 2FBHA 1W5TA 3TP0A 1KU9A 5A2QZ 4HG2A 1BW6A 5F1RA 1FBUA 1BI1A 3FBIB 2GAUA 3K4KA 4BJ6C 3MQ0A 3S17J 2K85A 2I10A 1FLIA 3T5XA 2K5CA 2A61A 5D5XB 3AG3H 2XB0X 1SC7A 2ZMEA 2CSOA 2EA4A 1BIBA 1WVRA 2V1XA 3OSFA 2G0EA 3QYFA 1U9OA 2OZUA 4A3IJ 2EB7A 3HUGB 3GLXA 3V7SA 2A6EF 4KITB 1IAWA 4OAZA 2R0QC 4I09A 5E3NA 2M1BA 4G7OF 3FF5A 2LSOA 2R93J 2DQRA 3AG4H 3O3KA 2LD5A 1ZR4A 4AIJA 2XAFA 3B73A 2AS5F 3H36A 2WV0A 3IH3A 2FBIA 2QKLB 2UXNA 3F0CA 1FSEA 4I02A 4MFDA 3I5UA 2IS1A 4JX6A 2J5OA 4CCMA 3GZNB 3GEZA 3NAUA 3HG9A 1ZREA 3F3XA 1RR7A 2WAQA 1O7FA 4LLLA 5JI6A 4JX4A 2LLKA 1YTYA 1U5TB 1BI0A 1G2HA 3E3VA 4BEHA 2LF7A 2HOSA 2NVYJ 3C18A 3M8EA 3TGNA 1XMKA 2ZFUA 3BG9A 3QRFF 2C6YA 3W2WA 2B63J 1FYKA 3CJNA 2ZJQF 4I0AA 3ZGKA 3OYBA 2IA2A 4L5EA 2V7FA 2CV2A 1H9TA 1CF7A 2R7RA 1IJWC 2CJJA 2IT0A 3BTCA 4I99C 3OL4A 2KT0A 5HVQC 3DBHB 4RAFA 1OCTC 2XKOA 3F8BA 3J80K 2NVXJ 1Z7UA 2EFQA 4Y15A 4CZZA 3L9FA 2X6WA 1TWAJ 3GFIA 4CA0A 1ZH5A 4E7ZA 4RDUA 2KDOA 3K2ZA 2WB1A 3UNGC 3RKXA 1S6LA 4XMYA 1W7PD 1I1SA 2KMUA 2HZTA 3K4JA 4XSXF 1T08B 3BR0A 1G3YA 3P9CA 5H20A 2FEZA 2KPMA 4RB3C 1AA7A 2DMNA 2BXYA 2R7VA 5KHDA 2XGCA 3DPUA 3BR3A 3DKYA 1IDZA 5J3LA 2TRTA 1X4PA 4KUMA 4HLYA 1PUEE 2LY2A 1XB4A 5FKMA 3FMRA 3ZMDA 3A2KA 3BPVA 4BAYA 1U2WA
chains in the Genus database with same CATH topology
1HW1A 1IRGA 4ENNA 4NB5A 3I59B 1XMAA 3IWZA 5IT9K 4PDKA 1SMYF 2L02A 4DQ2A 1SFXA 2KJCA 1YW9A 4LGWA 2ZMEB 4HQEA 3V8LA 1Z1DA 4UUVA 2HQRA 3HSRA 4G6DA 1U6GA 3HOSA 2RDPA 4KIBA 4B09A 3CDHA 2H6CA 1GXQA 2EWNA 1IF1A 2PMHA 3D0SA 3SZPA 3FZVA 4ZYGA 4MQVA 1XD7A 1KYWA 1KYZA 3KP3A 3QP6A 4AWXB 4CDGA 1XDUA 3F8MA 2L54A 2BGCA 4S04A 3I64A 4EM1A 2W24A 1ZARA 1WQ2A 3EETA 3REOA 3KP6A 2M45A 2QENA 4WXCA 2P7CB 3DEUA 1A04A 1R5GA 2P5LC 3PQJA 4Y17A 3KP2A 1QZYA 2P4WA 1HXDA 1OYYA 2NAZA 4YFKF 1TW3A 1P4AA 2PFBA 2FNAA 3P9KA 1FBSA 4KMFA 2OZ6A 5HS8A 4LB5A 5D5VB 1J2XA 2QYOA 1I5ZA 4G7ZF 4A0YA 1J9IA 3RPQA 4LB6B 1ZN2A 3ABUA 1DDNA 2Y75A 4NQWA 4GXOA 5AONA 4IVNA 1Z6TA 4HBLA 2V9VA 4WX9A 3W6KB 4L9NA 3JAMK 1E17A 2P5KA 2DT5A 5LEKA 3VOEA 3Q5FA 1TBXA 4UXNA 1C0WA 3MAJA 3HRSA 2FSWA 3E6CC 1MJAA 3E5QA 3I4PA 2KIFA 1PDNC 3HRMA 1EH8A 2NYXA 2F2EA 4U0YA 4IJAA 2LNBA 3V8KA 4ESJA 1Z05A 1EV7A 1J75A 1BC8C 3E6BA 3F22A 5DUKA 3LAJA 4EJUA 4MGRA 2A68F 2ZNYA 5DCMA 2BE5F 2H09A 4I2OA 1O57A 2P6SA 4HX4A 3WTVC 4O6JA 5IT9Z 1FNNA 4HV5A 5AIPA 4M6XA 3WTTC 1ZRFA 3R6SA 1TLHB 3WE2A 5BMZA 2DK5A 1MGTA 4FX4A 3CUOA 1O3TA 4HOBA 3ISPA 2XAJA 4U7DA 3DQVC 4M72A 2M87A 3K1PA 2MH9A 5TJJA 1D8KA 3GXOA 3RYPA 2E7XA 2JPBA 2OD5A 3SFZA 1R1UA 2GA2A 5FO5A 1U5TA 4RGXA 1BI2A 3I71A 2W57A 2TDXA 1F5TA 3JTHA 4RS8A 3RTRA 2YR2A 1REPC 3KZYA 2Q2EA 5LHIA 3GFJA 4BHCA 5ICEA 1TW2A 3U2RA 3HIFA 1USTA 3CTAA 3F8NA 3JAMZ 3NQOA 3CLOA 4G94A 4ON0A 3KP4A 4KDPA 4JQFA 1L0OC 4FT8A 5D4SA 4BHPA 4R79A 5EEGA 2R3SA 2P5VA 1T39A 1RIOH 2M8EA 5L3DA 2PQ8A 2IW5A 4HF0A 5HS7A 3FMQA 1XGSA 2JSCA 1LDKB 5DD4A 4CXFA 3K1NA 3KZZA 1G6NA 2X0LA 2HGCA 2K4JA 4IF4A 3HHGA 4LK1F 4I98B 2HYFA 2L3DA 4QWQA 4LLNA 2VN2A 1KU3A 1YW7A 3ERED 2VC0A 2DPDA 1F9NA 4EV0A 5CVVA 1LEBA 2IA1A 2OAZA 2YU3A 2A6HF 2OQRA 4KN4X 3IKTA 4HX8A 2K4BA 3IHUA 3BWGA 2PBIA 2Q8KA 4P55A 4O5VA 4EGZA 1AWCA 5LGNA 5JHUA 1JXSA 2EV6A 3K9TA 4ASNA 2PEXA 3RPUA 4YIIA 2MLGA 5L3GA 5FD5A 5FGMA 2ZBKA 1FY7A 2HTSA 6PAXA 5E17F 2EK5A 3H3ZA 2FMYA 4RB0A 4U88A 5E1WA 5LHHA 3N97A 2RV8A 1ZRCA 2VOOA 3F21A 5ICGA 1J0RA 3NRVA 4RB1A 2GIVA 2LDUA 3QOPA 2D45A 1K7AA 3BROA 1UHWA 2B0LA 2UXXA 3BDDA 5DCFA 3C7JA 3E6MA 1XGMA 5HLGA 3VODA 1ULYA 5DYMA 1HKSA 3BJ6A 1FBQA 3SQNA 4ENMA 4D0PA 2CGPA 3P9IA 3KE2A 1AOYA 3GF2A 2ACJA 2UWMA 4G6QA 2PLYA 2YX4A 2G9WA 4O3MA 3K1MA 1CF7B 2QBYA 1G3TA 3WTUC 5D5UB 1UHMA 2DQLA 4OU0A 3KLNA 1HSTA 1P4WA 3BJAA 4G9YA 3H3UA 1I1GA 4KIGA 3BOQA 4I0BA 3ABTA 2G7UA 1HKQA 1P4XA 5LEJA 3U1DA 1I6XA 3DP7A 2HKOA 4MEXF 2NRAC 1DPRA 1TTYA 4DNCA 5H6QA 2FU4A 2XRNA 4AVPA 2QWWA 3GX4X 2EFNA 3FXRA 2IVMA 3L7WA 2EJRA 1Z91A 4MTDA 1BN5A 3TDZC 2ZO4A 3QU3A 1KQ9A 1GVJA 4HYEA 3HTUA 2CWEA 2W25A 1T38A 5CYVA 1IRFA 3T8RA 3MWMA 1QPMA 4ZH4F 2ESNA 5L3CA 4BQAA 4HA8A 1CGPA 3FX3A 3RIRA 3F6VA 1YQAA 1T2KA 4E70A 2STWA 1QBJA 1O3RA 1U3EM 2EV5A 2PJPA 1YLFA 4Q4ZF 4HAMA 2YSRA 4M9SA 1STZA 1XCVA 4GYIA 3HOTA 4N9HA 1LDJA 1LNWA 4P96A 2E1NA 1RI7A 5ED4A 5CVRA 2K86A 3FXQA 5L3EA 2D1VA 1YW8A 2IJLA 1UB9A 2JRTA 2Z33A 3GYHX 4RGRA 5ILUA 2FOKA 3HYIA 2MBFA 3WTYC 5K5QA 5HDNA 3RKWA 2M5WA 3GFLA 2IA0A 3QAHA 4UHTA 5JR3A 5K5OA 2L4MA 2KIMA 3ULQB 3U9GA 3FHZA 2O6GE 1MKMA 3W6JB 3DXJF 1G3SA 5D5WB 1ZG5A 1W5SA 5L3FA 3HSFA 3DV8A 3N4MA 1BJAA 1D5VA 2VBYA 1IN7A 1TNSA 5DV5A 2H27A 2H6BA 2F5EA 4KICA 3T1BA 2DBBA 5CLSA 2NS0A 3O2PE 3GVAA 2VBWA 4I01A 1P92A 2XAGA 2BBYA 2AXLA 1R7JA 1MD0A 3DPLC 1HBXG 4IRHA 4IRGA 1I27A 1BIAA 5D6FA 1FSHA 2JT1A 5LGTA 3KEOA 4EJOA 5HDGA 3V7CA 1ZAOA 2FNPA 1F4KA 5DD8A 2HYGD 3E6DA 3S2WA 4YFXF 3F72A 1XGNA 2P8TA 1LQ1A 3TKYA 3V7RA 4HF2A 3BZ6A 1JE8A 1HW2A 4HLXA 2FXAA 5FB2A 1ZG1A 2BEOA 3CO7C 4GGGA 1FYMA 4Y13A 3L09A 4EJVA 4ZZLA 4ETSA 2V79A 3ZMZA 2JTVA 3KEQA 3AAFA 2DW4A 3LSTA 2OBPA 1XDSA 5FD6A 1ZG3A 1D3YA 1WKMA 2KJBA 4NHJA 3B02A 4A6EA 3J81Z 2QM3A 1HW5A 1OYIA 5FFXA 1EH7A 4HW0A 4EM0B 1YO5C 2MH2A 2QQAA 1LVAA 4LMYA 2F5CA 2HKXA 1PP7U 3KETA 1FWZA 3M8FA 4IRIA 2R7DA 4ZYHA 5F64A 2XKPA 1IXRC 1BBYA 2ISZA 5BQTA 3HRTA 1MJ9A 5F6FA 4A0XA 1FP1D 1G4DA 4GO1A 3WTZA 3ZMSA 3P7NA 1EH6A 2HOEA 1D8JA 1SFEA 1WSUA 4XBFA 2R7FA 5LHGA 3E5XA 5LBQA 1T98A 1S7OA 4A5MA 2ZNZA 5KVRA 3F8CA 5J8CA 3H92A 2RQPA 1R58A 4HDUA 2HDCA 5A2QK 3L00A 3VEPA 3GFMA 4G7HF 2L4AA 1U8RA 2KRFA 1K78B 4IHSA 3DFGA 3TO9A 4MTEA 5D8KB 2CQKA 3L2CA 5E18F 2QVOA 5CVIA 1XCBA 3NEUA 2MLKA 4MNUA 1IUYA 3K69A 2WC2A 2L01A 1FX7A 1T0FA 4L9VA 3BJOA 1TQIA 3HTSB 1HQCA 1B59A 4L9JA 3FM5A 4KA4A 3RI4A 1XGOA 4LK0F 4FX0A 2DAOA 1U5TC 4RGSA 2QBYB 2MA3A 5LRRA 1K6OA 5FLXZ 4I7HA 3GO5A 1J5YA 5ERIA 3JSPA 4Q5SF 1J7KA 4EMSA 2VONA 4HZFA 4G8XA 2QZ8A 4MHGA 1R23A 2RN7A 1LEAA 2GQQA 1VTNC 1WRJA 2QLZA 1JGSA 4UVCA 1S8NA 4KT5C 3LFKA 3FMSA 3FM3A 3MFKA 2YX7A 1YS7A 2XVCA 2GA1A 2EFWA 2FE3A 4JBAA 4KIFA 2PN6A 1GHCA 1ODDA 1XSVA 2VBXA 2JZYA 4OMZA 1Q1HA 2FF4A 2CFXA 3EDPA 2XIGA 4LD5A 5BS6A 4L0ZB 4GYGA 3ZMVA 2E7WA 1KGSA 3LQQA 2QQBA 4OINF 2G7HA 1IN4A 3KFWX 5K5RA 1J59A 3RJPA 3JW4A 3TO6A 3F23A 2O03A 3EYYA 2XUBA 2NNYA 2A07F 1OKRA 4P9UA 1FP2A 2ZCWA 2XAQA 3IC7A 4JK1X 5E1XA 5H6RA 2HR3A 4HX7A 4Z2YA 4AIKA 1KQ8A 1Z9CA 3HHHA 1YFHA 3LA7A 1IXSB 3ELKA 5E8GA 4CHUA 1B1BA 1V4RA 4K2EA 2RGVA 2COMA 1ONVA 4YFNF 3QU6A 4A5NA 2RKHA 1RUOA 3I54A 2CO5A 2QQ9A 1V3FA 4YIFA 1R00A 2H94A 1ZLJA 3E97A 1LJ9A 4WF2A 3WE3A 3KCCA 1U78A 1FC3A 2V1UA 5DEQA 4QLCU 2DFIA 2XHKA 3IRRA 4XRFA 3CUQA 3C3WA 5KK1A 4H0EA 4L0YB 3F6OA 4RAYA 4FHTA 4BXUA 1KA8A 4A0ZA 3QP5A 1B9MA 3CUQC 3QPHA 2UZKA 4RGUA 5HDKA 1FYLA 3KP5A 1R1TA 5HLIA 2PI0A 3CO6C 1R5HA 3MZHA 3TOBA 1W7PA 1FT9A 1RNLA 2RNJA 5IT3A 2XAHA 5HLHA 1QZZA 1YYVA 2VODA 3OV8A 1DUXC 4ZYEA 1K78A 1DPUA 4R8HA 3R0JA 5DDGA 4OOIA 5E20A 4PZJA 3I58A 1T6SA 3WG9A 1F1ZA 1B4AA 3C1DA 4BNCA 3KLOA 4OIRF 1FZPB 1W7PB 3JTGA 3R60A 3HRUA 3ZQ7A 5E1ZB 5BPIA 5DUIA 4EJWA 4EM2A 1FOKA 3ZMTA 1XN7A 1UCRA 1ON2A 1HSJA 4OIPF 1BI3A 1P6RA 3RYRA 4UV8A 5TRDA 3GUDA 4RAZA 3OOPA 4M9XA 4BYYA 4WXDA 5D8LB 4S05A 3SHFA 3GZ6A 5ICCA 1UFMA 4M9ZA 2K02A 2FBKA 4TV7A 1KQ0A 4U0WA 4A12A 3GWZA 2K7LA 3WTSC 2ZKZA 4LG0A 4XLPF 4OIOF 2XROA 3T8TA 3ZPLA 2XV4S 1ZYRF 2BYVE 2J5PA 2ESHA 1BC7C 2VE9A 4KYWA 5FFZA 3BPXA 1XSDA 2WTEA 4M74A 1SFUA 1IN6A 4L9TA 4CO8A 1S29A 1B9NA 5LRSA 3O6BB 2F5FA 4LJZF 5JVTA 2GXBA 4WK8F 2FA5A 4KMUX 3Q9VA 1O3QA 2Z5UA 2VE8A 2CG4A 1R22A 1L3LA 3I59A 2FRHA 1QQIA 1ZRDA 5JFRA 2F5DA 1SMTA 3M1EA 1TQMA 3WGGA 2O3FA 3J80Z 5BOXA 4GCVA 4A2UA 3ECHA 1O7LA 2LF8A 5D4RA 1YS6A 2BV6A 4HV6A 2ZFWA 3DF8A 3E5UA 4ENJA 2KIUA 1G3WA 4B8XA 3WODF 4M73A 4EGYA 1R36A 1ZGAA 2KKOA 1Z6RA 2EA2A 4EVIA 5LGUA 2IP2A 1ZHFA 4AIHA 3WU1B 4HQMA 1OYWA 4ESFA 2Y48A 2HQNA 2MD5A 1PP8F 2VC1A 3EQLF 2Y0MA 5AIQA 1DP7P 1NHAA 5ILSA 2EV0A 5CJ9A 5FLXK 3PFIA 3WTWC 2OQGA 2WWYA 2RVCA 3SZTA 2HFHA 4RB2C 1IN5A 2IPQX 3MCZA 3LQRA 4HDVA 5J8FA 2HS5A 3ZN0A 4YG2F 3LAPA 3RDIA 4PCQA 3TDUC 2O8XA 3HSEA 5D6EA 3M9AA 5K1YA 1Y0UA 2P6TA 3RKYA 2DU9A 2STTA 3GW2A 3J7AO 2DLLA 1LDDA 2Z3YA 1YIOA 4R1HA 2HWVA 3D5LA 3K0LA 4M6YA 4MEYF 3LWFA 4PGHA 4CGZA 4CYDA 2E1CA 3FWEA 1RUNA 3IRQA 1FPQA 3TOAA 1S7AA 1OPCA 1K79A 2O0YA 4IXAA 1IN8A 4KNYA 2Q0OA 2JPCA 3COAC 4KFCA 2MC3A 3LA2A 4XLNF 4UNOA 2K27A 3DPTA 2FQ3A 2HEOA 5DCMB 4IPAA 3ZN1A 1QGPA 4ENKA 1KU2A 4IHTA 1R1VA 2DO7A 2A69F 5L3BA 3IKVA 3IWFA 1H0MA 4P9FA 3WTXC 2V1DA 1JHHA 1X3UA 4HF1A 3F8FA 2A3SA 4ESBA 1YG2A 1WWXA 2EFPA 3JSOA 2YPRA 4F7ZA 1ZGJA 4P5OA 5HS9A 1IZ1A 1H9GA 2VT3A 1RZ4A 1IW7F 1QO0D 2VOPA 1BOAA 4L5JA 1ON1A 4M71A 2P7VB 2NNNA 1SAXA 3DKWA 2ADUA 4WCGA 1JHFA 4MQ9F 2ZXJA 4L5IA 5ILVA 3G3ZA 3BP8A 1MDMA 1SD4A 3BY6A 2VT2A 4Q47A 2Z99A 4ZYDA 4UVBA 2W85A 4N9IA 2DTRA 3PQKA 2ELHA 2W84A 4LFUA 4UV9A 3SXYA 5CVJA 3LA3A 2PG4A 2ETHA 4BHBA 3MEXA 1MJBA 2IRFG 3I0TA 3VB2A 3R61A 3Q9SA 4A6DA 5J6XA 2GWRA 1OR7A 1SD6A 1MDMB 4N0BA 3ZP5A 2OA4A 4U0VA 3WGIA 2OU2A 4BH9A 5ICFA 2DI3A 2XGXA 4UVAA 2M30A 2XASA 1O3SA 3ZMUA 2LKPA 3R4KA 1KU7A 4CICA 2VBZA 1ZLKA 2ISYA 3V8JA 4ZZDA 1QNTA 2FMLA 3R0AA 2O61A 3QPTA 1USSA 5EEHA 4Q48A 1TNTA 3MZYA 1E2XA 1S3JA 3KP7A 3VFZA 4KN7X 2DPUA 3V4GA 2A5YB 5HOOA 2Z9OA 3I53A 3TO7A 1IXCA 2QUFA 1HKTA 3T0YA 3WU0A 2D2WA 1BM9A 4AD9A 4LLGF 4WXHA 4WWCA 1W4MA 5LLQA 2PMUA 2D1HA 4OIQF 3EUHA 1OMIA 4EJTA 2RC4A 2CYYA 1SD5A 3TQNA 3G73A 2GZWA 3M7GA 5E8IA 4EQQA 3GZ5A 4LG0B 3WGHA 1TQPA 2X4HA 1SD7A 1LB2A 3J81K 3ECOA 4OMYA 3IL2A 2CW0F 1GXPA 3EYIA 3ROUA 1WI9A 1MZBA 2VXZA 3FXUA 3ML6A 4U7BA 2DK8A 1XSXA 1P2FA 4XSZF 4L18B 3HUGA 2ZJ2A 5CVUA 3CUQB 2V6CA 2EFOA 2GXGA 2HTJA 5BPDA 1U2WA 1B6AA 2FBHA 1W5TA 1KU9A 5A2QZ 5F1RA 1FBUA 1BI1A 2GAUA 3MQ0A 1FLIA 3T5XA 2A61A 5D5XB 2ZMEA 2CSOA 2EA4A 1BIBA 2V1XA 2OZUA 2EB7A 3GLXA 3V7SA 2A6EF 1IAWA 4I09A 2M1BA 4G7OF 3FF5A 2LSOA 2DQRA 3O3KA 4AIJA 2XAFA 3B73A 2AS5F 2WV0A 2FBIA 2UXNA 1FSEA 4I02A 3I5UA 2J5OA 3GEZA 1ZREA 3F3XA 1O7FA 4LLLA 5JI6A 1YTYA 1U5TB 1BI0A 3E3VA 2LF7A 3TGNA 3C18A 3M8EA 1XMKA 3QRFF 2C6YA 1FYKA 3CJNA 4I0AA 2IA2A 1H9TA 1CF7A 2IT0A 5HVQC 2XKOA 3F8BA 3J80K 1Z7UA 2EFQA 4Y15A 4CZZA 3L9FA 3GFIA 1ZH5A 3K2ZA 3RKXA 1S6LA 1W7PD 1I1SA 2HZTA 4XSXF 1G3YA 3P9CA 5H20A 2FEZA 4RB3C 4KUMA 4HLYA 1PUEE 1XB4A 3ZMDA 3FMRA 3BPVA 4BAYA 4PGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW1 A;  1IRG A;  4ENN A;  4NB5 A;  3I59 B;  1XMA A;  3IWZ A;  5IT9 K;  4PDK A;  1SMY F;  2L02 A;  4DQ2 A;  1SFX A;  2KJC A;  1YW9 A;  4LGW A;  2ZME B;  4HQE A;  3V8L A;  1Z1D A;  4UUV A;  2HQR A;  3HSR A;  4G6D A;  1U6G A;  3HOS A;  2RDP A;  4KIB A;  4B09 A;  3CDH A;  2H6C A;  1GXQ A;  2EWN A;  1IF1 A;  2PMH A;  3D0S A;  3SZP A;  3FZV A;  4ZYG A;  4MQV A;  1XD7 A;  1KYW A;  1KYZ A;  3KP3 A;  3QP6 A;  4AWX B;  4CDG A;  1XDU A;  3F8M A;  2L54 A;  2BGC A;  4S04 A;  3I64 A;  4EM1 A;  2W24 A;  1ZAR A;  1WQ2 A;  3EET A;  3REO A;  3KP6 A;  2M45 A;  2QEN A;  4WXC A;  2P7C B;  3DEU A;  1A04 A;  1R5G A;  2P5L C;  3PQJ A;  4Y17 A;  3KP2 A;  1QZY A;  2P4W A;  1HXD A;  1OYY A;  2NAZ A;  4YFK F;  1TW3 A;  1P4A A;  2PFB A;  2FNA A;  3P9K A;  1FBS A;  4KMF A;  2OZ6 A;  5HS8 A;  4LB5 A;  5D5V B;  1J2X A;  2QYO A;  1I5Z A;  4G7Z F;  4A0Y A;  1J9I A;  3RPQ A;  4LB6 B;  1ZN2 A;  3ABU A;  1DDN A;  2Y75 A;  4NQW A;  4GXO A;  5AON A;  4IVN A;  1Z6T A;  4HBL A;  2V9V A;  4WX9 A;  3W6K B;  4L9N A;  3JAM K;  1E17 A;  2P5K A;  2DT5 A;  5LEK A;  3VOE A;  3Q5F A;  1TBX A;  4UXN A;  1C0W A;  3MAJ A;  3HRS A;  2FSW A;  3E6C C;  1MJA A;  3E5Q A;  3I4P A;  2KIF A;  1PDN C;  3HRM A;  1EH8 A;  2NYX A;  2F2E A;  4U0Y A;  4IJA A;  2LNB A;  3V8K A;  4ESJ A;  1Z05 A;  1EV7 A;  1J75 A;  1BC8 C;  3E6B A;  3F22 A;  5DUK A;  3LAJ A;  4EJU A;  4MGR A;  2A68 F;  2ZNY A;  5DCM A;  2BE5 F;  2H09 A;  4I2O A;  1O57 A;  2P6S A;  4HX4 A;  3WTV C;  4O6J A;  5IT9 Z;  1FNN A;  4HV5 A;  5AIP A;  4M6X A;  3WTT C;  1ZRF A;  3R6S A;  1TLH B;  3WE2 A;  5BMZ A;  2DK5 A;  1MGT A;  4FX4 A;  3CUO A;  1O3T A;  4HOB A;  3ISP A;  2XAJ A;  4U7D A;  3DQV C;  4M72 A;  2M87 A;  3K1P A;  2MH9 A;  5TJJ A;  1D8K A;  3GXO A;  3RYP A;  2E7X A;  2JPB A;  2OD5 A;  3SFZ A;  1R1U A;  2GA2 A;  5FO5 A;  1U5T A;  4RGX A;  1BI2 A;  3I71 A;  2W57 A;  2TDX A;  1F5T A;  3JTH A;  4RS8 A;  3RTR A;  2YR2 A;  1REP C;  3KZY A;  2Q2E A;  5LHI A;  3GFJ A;  4BHC A;  5ICE A;  1TW2 A;  3U2R A;  3HIF A;  1UST A;  3CTA A;  3F8N A;  3JAM Z;  3NQO A;  3CLO A;  4G94 A;  4ON0 A;  3KP4 A;  4KDP A;  4JQF A;  1L0O C;  4FT8 A;  5D4S A;  4BHP A;  4R79 A;  5EEG A;  2R3S A;  2P5V A;  1T39 A;  1RIO H;  2M8E A;  5L3D A;  2PQ8 A;  2IW5 A;  4HF0 A;  5HS7 A;  3FMQ A;  1XGS A;  2JSC A;  1LDK B;  5DD4 A;  4CXF A;  3K1N A;  3KZZ A;  1G6N A;  2X0L A;  2HGC A;  2K4J A;  4IF4 A;  3HHG A;  4LK1 F;  4I98 B;  2HYF A;  2L3D A;  4QWQ A;  4LLN A;  2VN2 A;  1KU3 A;  1YW7 A;  3ERE D;  2VC0 A;  2DPD A;  1F9N A;  4EV0 A;  5CVV A;  1LEB A;  2IA1 A;  2OAZ A;  2YU3 A;  2A6H F;  2OQR A;  4KN4 X;  3IKT A;  4HX8 A;  2K4B A;  3IHU A;  3BWG A;  2PBI A;  2Q8K A;  4P55 A;  4O5V A;  4EGZ A;  1AWC A;  5LGN A;  5JHU A;  1JXS A;  2EV6 A;  3K9T A;  4ASN A;  2PEX A;  3RPU A;  4YII A;  2MLG A;  5L3G A;  5FD5 A;  5FGM A;  2ZBK A;  1FY7 A;  2HTS A;  6PAX A;  5E17 F;  2EK5 A;  3H3Z A;  2FMY A;  4RB0 A;  4U88 A;  5E1W A;  5LHH A;  3N97 A;  2RV8 A;  1ZRC A;  2VOO A;  3F21 A;  5ICG A;  1J0R A;  3NRV A;  4RB1 A;  2GIV A;  2LDU A;  3QOP A;  2D45 A;  1K7A A;  3BRO A;  1UHW A;  2B0L A;  2UXX A;  3BDD A;  5DCF A;  3C7J A;  3E6M A;  1XGM A;  5HLG A;  3VOD A;  1ULY A;  5DYM A;  1HKS A;  3BJ6 A;  1FBQ A;  3SQN A;  4ENM A;  4D0P A;  2CGP A;  3P9I A;  3KE2 A;  1AOY A;  3GF2 A;  2ACJ A;  2UWM A;  4G6Q A;  2PLY A;  2YX4 A;  2G9W A;  4O3M A;  3K1M A;  1CF7 B;  2QBY A;  1G3T A;  3WTU C;  5D5U B;  1UHM A;  2DQL A;  4OU0 A;  3KLN A;  1HST A;  1P4W A;  3BJA A;  4G9Y A;  3H3U A;  1I1G A;  4KIG A;  3BOQ A;  4I0B A;  3ABT A;  2G7U A;  1HKQ A;  1P4X A;  5LEJ A;  3U1D A;  1I6X A;  3DP7 A;  2HKO A;  4MEX F;  2NRA C;  1DPR A;  1TTY A;  4DNC A;  5H6Q A;  2FU4 A;  2XRN A;  4AVP A;  2QWW A;  3GX4 X;  2EFN A;  3FXR A;  2IVM A;  3L7W A;  2EJR A;  1Z91 A;  4MTD A;  1BN5 A;  3TDZ C;  2ZO4 A;  3QU3 A;  1KQ9 A;  1GVJ A;  4HYE A;  3HTU A;  2CWE A;  2W25 A;  1T38 A;  5CYV A;  1IRF A;  3T8R A;  3MWM A;  1QPM A;  4ZH4 F;  2ESN A;  5L3C A;  4BQA A;  4HA8 A;  1CGP A;  3FX3 A;  3RIR A;  3F6V A;  1YQA A;  1T2K A;  4E70 A;  2STW A;  1QBJ A;  1O3R A;  1U3E M;  2EV5 A;  2PJP A;  1YLF A;  4Q4Z F;  4HAM A;  2YSR A;  4M9S A;  1STZ A;  1XCV A;  4GYI A;  3HOT A;  4N9H A;  1LDJ A;  1LNW A;  4P96 A;  2E1N A;  1RI7 A;  5ED4 A;  5CVR A;  2K86 A;  3FXQ A;  5L3E A;  2D1V A;  1YW8 A;  2IJL A;  1UB9 A;  2JRT A;  2Z33 A;  3GYH X;  4RGR A;  5ILU A;  2FOK A;  3HYI A;  2MBF A;  3WTY C;  5K5Q A;  5HDN A;  3RKW A;  2M5W A;  3GFL A;  2IA0 A;  3QAH A;  4UHT A;  5JR3 A;  5K5O A;  2L4M A;  2KIM A;  3ULQ B;  3U9G A;  3FHZ A;  2O6G E;  1MKM A;  3W6J B;  3DXJ F;  1G3S A;  5D5W B;  1ZG5 A;  1W5S A;  5L3F A;  3HSF A;  3DV8 A;  3N4M A;  1BJA A;  1D5V A;  2VBY A;  1IN7 A;  1TNS A;  5DV5 A;  2H27 A;  2H6B A;  2F5E A;  4KIC A;  3T1B A;  2DBB A;  5CLS A;  2NS0 A;  3O2P E;  3GVA A;  2VBW A;  4I01 A;  1P92 A;  2XAG A;  2BBY A;  2AXL A;  1R7J A;  1MD0 A;  3DPL C;  1HBX G;  4IRH A;  4IRG A;  1I27 A;  1BIA A;  5D6F A;  1FSH A;  2JT1 A;  5LGT A;  3KEO A;  4EJO A;  5HDG A;  3V7C A;  1ZAO A;  2FNP A;  1F4K A;  5DD8 A;  2HYG D;  3E6D A;  3S2W A;  4YFX F;  3F72 A;  1XGN A;  2P8T A;  1LQ1 A;  3TKY A;  3V7R A;  4HF2 A;  3BZ6 A;  1JE8 A;  1HW2 A;  4HLX A;  2FXA A;  5FB2 A;  1ZG1 A;  2BEO A;  3CO7 C;  4GGG A;  1FYM A;  4Y13 A;  3L09 A;  4EJV A;  4ZZL A;  4ETS A;  2V79 A;  3ZMZ A;  2JTV A;  3KEQ A;  3AAF A;  2DW4 A;  3LST A;  2OBP A;  1XDS A;  5FD6 A;  1ZG3 A;  1D3Y A;  1WKM A;  2KJB A;  4NHJ A;  3B02 A;  4A6E A;  3J81 Z;  2QM3 A;  1HW5 A;  1OYI A;  5FFX A;  1EH7 A;  4HW0 A;  4EM0 B;  1YO5 C;  2MH2 A;  2QQA A;  1LVA A;  4LMY A;  2F5C A;  2HKX A;  1PP7 U;  3KET A;  1FWZ A;  3M8F A;  4IRI A;  2R7D A;  4ZYH A;  5F64 A;  2XKP A;  1IXR C;  1BBY A;  2ISZ A;  5BQT A;  3HRT A;  1MJ9 A;  5F6F A;  4A0X A;  1FP1 D;  1G4D A;  4GO1 A;  3WTZ A;  3ZMS A;  3P7N A;  1EH6 A;  2HOE A;  1D8J A;  1SFE A;  1WSU A;  4XBF A;  2R7F A;  5LHG A;  3E5X A;  5LBQ A;  1T98 A;  1S7O A;  4A5M A;  2ZNZ A;  5KVR A;  3F8C A;  5J8C A;  3H92 A;  2RQP A;  1R58 A;  4HDU A;  2HDC A;  5A2Q K;  3L00 A;  3VEP A;  3GFM A;  4G7H F;  2L4A A;  1U8R A;  2KRF A;  1K78 B;  4IHS A;  3DFG A;  3TO9 A;  4MTE A;  5D8K B;  2CQK A;  3L2C A;  5E18 F;  2QVO A;  5CVI A;  1XCB A;  3NEU A;  2MLK A;  4MNU A;  1IUY A;  3K69 A;  2WC2 A;  2L01 A;  1FX7 A;  1T0F A;  4L9V A;  3BJO A;  1TQI A;  3HTS B;  1HQC A;  1B59 A;  4L9J A;  3FM5 A;  4KA4 A;  3RI4 A;  1XGO A;  4LK0 F;  4FX0 A;  2DAO A;  1U5T C;  4RGS A;  2QBY B;  2MA3 A;  5LRR A;  1K6O A;  5FLX Z;  4I7H A;  3GO5 A;  1J5Y A;  5ERI A;  3JSP A;  4Q5S F;  1J7K A;  4EMS A;  2VON A;  4HZF A;  4G8X A;  2QZ8 A;  4MHG A;  1R23 A;  2RN7 A;  1LEA A;  2GQQ A;  1VTN C;  1WRJ A;  2QLZ A;  1JGS A;  4UVC A;  1S8N A;  4KT5 C;  3LFK A;  3FMS A;  3FM3 A;  3MFK A;  2YX7 A;  1YS7 A;  2XVC A;  2GA1 A;  2EFW A;  2FE3 A;  4JBA A;  4KIF A;  2PN6 A;  1GHC A;  1ODD A;  1XSV A;  2VBX A;  2JZY A;  4OMZ A;  1Q1H A;  2FF4 A;  2CFX A;  3EDP A;  2XIG A;  4LD5 A;  5BS6 A;  4L0Z B;  4GYG A;  3ZMV A;  2E7W A;  1KGS A;  3LQQ A;  2QQB A;  4OIN F;  2G7H A;  1IN4 A;  3KFW X;  5K5R A;  1J59 A;  3RJP A;  3JW4 A;  3TO6 A;  3F23 A;  2O03 A;  3EYY A;  2XUB A;  2NNY A;  2A07 F;  1OKR A;  4P9U A;  1FP2 A;  2ZCW A;  2XAQ A;  3IC7 A;  4JK1 X;  5E1X A;  5H6R A;  2HR3 A;  4HX7 A;  4Z2Y A;  4AIK A;  1KQ8 A;  1Z9C A;  3HHH A;  1YFH A;  3LA7 A;  1IXS B;  3ELK A;  5E8G A;  4CHU A;  1B1B A;  1V4R A;  4K2E A;  2RGV A;  2COM A;  1ONV A;  4YFN F;  3QU6 A;  4A5N A;  2RKH A;  1RUO A;  3I54 A;  2CO5 A;  2QQ9 A;  1V3F A;  4YIF A;  1R00 A;  2H94 A;  1ZLJ A;  3E97 A;  1LJ9 A;  4WF2 A;  3WE3 A;  3KCC A;  1U78 A;  1FC3 A;  2V1U A;  5DEQ A;  4QLC U;  2DFI A;  2XHK A;  3IRR A;  4XRF A;  3CUQ A;  3C3W A;  5KK1 A;  4H0E A;  4L0Y B;  3F6O A;  4RAY A;  4FHT A;  4BXU A;  1KA8 A;  4A0Z A;  3QP5 A;  1B9M A;  3CUQ C;  3QPH A;  2UZK A;  4RGU A;  5HDK A;  1FYL A;  3KP5 A;  1R1T A;  5HLI A;  2PI0 A;  3CO6 C;  1R5H A;  3MZH A;  3TOB A;  1W7P A;  1FT9 A;  1RNL A;  2RNJ A;  5IT3 A;  2XAH A;  5HLH A;  1QZZ A;  1YYV A;  2VOD A;  3OV8 A;  1DUX C;  4ZYE A;  1K78 A;  1DPU A;  4R8H A;  3R0J A;  5DDG A;  4OOI A;  5E20 A;  4PZJ A;  3I58 A;  1T6S A;  3WG9 A;  1F1Z A;  1B4A A;  3C1D A;  4BNC A;  3KLO A;  4OIR F;  1FZP B;  1W7P B;  3JTG A;  3R60 A;  3HRU A;  3ZQ7 A;  5E1Z B;  5BPI A;  5DUI A;  4EJW A;  4EM2 A;  1FOK A;  3ZMT A;  1XN7 A;  1UCR A;  1ON2 A;  1HSJ A;  4OIP F;  1BI3 A;  1P6R A;  3RYR A;  4UV8 A;  5TRD A;  3GUD A;  4RAZ A;  3OOP A;  4M9X A;  4BYY A;  4WXD A;  5D8L B;  4S05 A;  3SHF A;  3GZ6 A;  5ICC A;  1UFM A;  4M9Z A;  2K02 A;  2FBK A;  4TV7 A;  1KQ0 A;  4U0W A;  4A12 A;  3GWZ A;  2K7L A;  3WTS C;  2ZKZ A;  4LG0 A;  4XLP F;  4OIO F;  2XRO A;  3T8T A;  3ZPL A;  2XV4 S;  1ZYR F;  2BYV E;  2J5P A;  2ESH A;  1BC7 C;  2VE9 A;  4KYW A;  5FFZ A;  3BPX A;  1XSD A;  2WTE A;  4M74 A;  1SFU A;  1IN6 A;  4L9T A;  4CO8 A;  1S29 A;  1B9N A;  5LRS A;  3O6B B;  2F5F A;  4LJZ F;  5JVT A;  2GXB A;  4WK8 F;  2FA5 A;  4KMU X;  3Q9V A;  1O3Q A;  2Z5U A;  2VE8 A;  2CG4 A;  1R22 A;  1L3L A;  3I59 A;  2FRH A;  1QQI A;  1ZRD A;  5JFR A;  2F5D A;  1SMT A;  3M1E A;  1TQM A;  3WGG A;  2O3F A;  3J80 Z;  5BOX A;  4GCV A;  4A2U A;  3ECH A;  1O7L A;  2LF8 A;  5D4R A;  1YS6 A;  2BV6 A;  4HV6 A;  2ZFW A;  3DF8 A;  3E5U A;  4ENJ A;  2KIU A;  1G3W A;  4B8X A;  3WOD F;  4M73 A;  4EGY A;  1R36 A;  1ZGA A;  2KKO A;  1Z6R A;  2EA2 A;  4EVI A;  5LGU A;  2IP2 A;  1ZHF A;  4AIH A;  3WU1 B;  4HQM A;  1OYW A;  4ESF A;  2Y48 A;  2HQN A;  2MD5 A;  1PP8 F;  2VC1 A;  3EQL F;  2Y0M A;  5AIQ A;  1DP7 P;  1NHA A;  5ILS A;  2EV0 A;  5CJ9 A;  5FLX K;  3PFI A;  3WTW C;  2OQG A;  2WWY A;  2RVC A;  3SZT A;  2HFH A;  4RB2 C;  1IN5 A;  2IPQ X;  3MCZ A;  3LQR A;  4HDV A;  5J8F A;  2HS5 A;  3ZN0 A;  4YG2 F;  3LAP A;  3RDI A;  4PCQ A;  3TDU C;  2O8X A;  3HSE A;  5D6E A;  3M9A A;  5K1Y A;  1Y0U A;  2P6T A;  3RKY A;  2DU9 A;  2STT A;  3GW2 A;  3J7A O;  2DLL A;  1LDD A;  2Z3Y A;  1YIO A;  4R1H A;  2HWV A;  3D5L A;  3K0L A;  4M6Y A;  4MEY F;  3LWF A;  4PGH A;  4CGZ A;  4CYD A;  2E1C A;  3FWE A;  1RUN A;  3IRQ A;  1FPQ A;  3TOA A;  1S7A A;  1OPC A;  1K79 A;  2O0Y A;  4IXA A;  1IN8 A;  4KNY A;  2Q0O A;  2JPC A;  3COA C;  4KFC A;  2MC3 A;  3LA2 A;  4XLN F;  4UNO A;  2K27 A;  3DPT A;  2FQ3 A;  2HEO A;  5DCM B;  4IPA A;  3ZN1 A;  1QGP A;  4ENK A;  1KU2 A;  4IHT A;  1R1V A;  2DO7 A;  2A69 F;  5L3B A;  3IKV A;  3IWF A;  1H0M A;  4P9F A;  3WTX C;  2V1D A;  1JHH A;  1X3U A;  4HF1 A;  3F8F A;  2A3S A;  4ESB A;  1YG2 A;  1WWX A;  2EFP A;  3JSO A;  2YPR A;  4F7Z A;  1ZGJ A;  4P5O A;  5HS9 A;  1IZ1 A;  1H9G A;  2VT3 A;  1RZ4 A;  1IW7 F;  1QO0 D;  2VOP A;  1BOA A;  4L5J A;  1ON1 A;  4M71 A;  2P7V B;  2NNN A;  1SAX A;  3DKW A;  2ADU A;  4WCG A;  1JHF A;  4MQ9 F;  2ZXJ A;  4L5I A;  5ILV A;  3G3Z A;  3BP8 A;  1MDM A;  1SD4 A;  3BY6 A;  2VT2 A;  4Q47 A;  2Z99 A;  4ZYD A;  4UVB A;  2W85 A;  4N9I A;  2DTR A;  3PQK A;  2ELH A;  2W84 A;  4LFU A;  4UV9 A;  3SXY A;  5CVJ A;  3LA3 A;  2PG4 A;  2ETH A;  4BHB A;  3MEX A;  1MJB A;  2IRF G;  3I0T A;  3VB2 A;  3R61 A;  3Q9S A;  4A6D A;  5J6X A;  2GWR A;  1OR7 A;  1SD6 A;  1MDM B;  4N0B A;  3ZP5 A;  2OA4 A;  4U0V A;  3WGI A;  2OU2 A;  4BH9 A;  5ICF A;  2DI3 A;  2XGX A;  4UVA A;  2M30 A;  2XAS A;  1O3S A;  3ZMU A;  2LKP A;  3R4K A;  1KU7 A;  4CIC A;  2VBZ A;  1ZLK A;  2ISY A;  3V8J A;  4ZZD A;  1QNT A;  2FML A;  3R0A A;  2O61 A;  3QPT A;  1USS A;  5EEH A;  4Q48 A;  1TNT A;  3MZY A;  1E2X A;  1S3J A;  3KP7 A;  3VFZ A;  4KN7 X;  2DPU A;  3V4G A;  2A5Y B;  5HOO A;  2Z9O A;  3I53 A;  3TO7 A;  1IXC A;  2QUF A;  1HKT A;  3T0Y A;  3WU0 A;  2D2W A;  1BM9 A;  4AD9 A;  4LLG F;  4WXH A;  4WWC A;  1W4M A;  5LLQ A;  2PMU A;  2D1H A;  4OIQ F;  3EUH A;  1OMI A;  4EJT A;  2RC4 A;  2CYY A;  1SD5 A;  3TQN A;  3G73 A;  2GZW A;  3M7G A;  5E8I A;  4EQQ A;  3GZ5 A;  4LG0 B;  3WGH A;  1TQP A;  2X4H A;  1SD7 A;  1LB2 A;  3J81 K;  3ECO A;  4OMY A;  3IL2 A;  2CW0 F;  1GXP A;  3EYI A;  3ROU A;  1WI9 A;  1MZB A;  2VXZ A;  3FXU A;  3ML6 A;  4U7B A;  2DK8 A;  1XSX A;  1P2F A;  4XSZ F;  4L18 B;  3HUG A;  2ZJ2 A;  5CVU A;  3CUQ B;  2V6C A;  2EFO A;  2GXG A;  2HTJ A;  5BPD A;  1U2W A;  1B6A A;  2FBH A;  1W5T A;  1KU9 A;  5A2Q Z;  5F1R A;  1FBU A;  1BI1 A;  2GAU A;  3MQ0 A;  1FLI A;  3T5X A;  2A61 A;  5D5X B;  2ZME A;  2CSO A;  2EA4 A;  1BIB A;  2V1X A;  2OZU A;  2EB7 A;  3GLX A;  3V7S A;  2A6E F;  1IAW A;  4I09 A;  2M1B A;  4G7O F;  3FF5 A;  2LSO A;  2DQR A;  3O3K A;  4AIJ A;  2XAF A;  3B73 A;  2AS5 F;  2WV0 A;  2FBI A;  2UXN A;  1FSE A;  4I02 A;  3I5U A;  2J5O A;  3GEZ A;  1ZRE A;  3F3X A;  1O7F A;  4LLL A;  5JI6 A;  1YTY A;  1U5T B;  1BI0 A;  3E3V A;  2LF7 A;  3TGN A;  3C18 A;  3M8E A;  1XMK A;  3QRF F;  2C6Y A;  1FYK A;  3CJN A;  4I0A A;  2IA2 A;  1H9T A;  1CF7 A;  2IT0 A;  5HVQ C;  2XKO A;  3F8B A;  3J80 K;  1Z7U A;  2EFQ A;  4Y15 A;  4CZZ A;  3L9F A;  3GFI A;  1ZH5 A;  3K2Z A;  3RKX A;  1S6L A;  1W7P D;  1I1S A;  2HZT A;  4XSX F;  1G3Y A;  3P9C A;  5H20 A;  2FEZ A;  4RB3 C;  4KUM A;  4HLY A;  1PUE E;  1XB4 A;  3ZMD A;  3FMR A;  3BPV A;  4BAY A;  4PGG A; 
#chains in the Genus database with same CATH topology
 1HW1 A;  1IRG A;  3MZ8 A;  2MD0 A;  3MKW B;  4ENN A;  4NB5 A;  3I59 B;  2GXA A;  2NS8 A;  1XMA A;  3JRG A;  2F4M B;  3IWZ A;  5IT9 K;  4PDK A;  1SMY F;  1YX5 A;  2L02 A;  5JLW A;  4DQ2 A;  1SFX A;  2KJC A;  2K9N A;  1YW9 A;  4PSX A;  3FKJ A;  1MNM C;  2E1M C;  4LGW A;  2DJI A;  3HEF A;  3PNY A;  5KCM A;  2YS9 A;  2ZME B;  4ZJZ A;  4HQE A;  2PJR A;  3A0B C;  4G6T B;  2X1E A;  2L7Z A;  3V8L A;  4E7J A;  1Z1D A;  4JX5 A;  4UUV A;  3LSK A;  2HQR A;  3HSR A;  3OYK A;  2QEX I;  2ZSH B;  4G6D A;  4N4O B;  1JUP A;  1EF4 A;  1U6G A;  4NC6 A;  3ZQG A;  3HOS A;  2RDP A;  4ZDP A;  2JA5 J;  2OPT A;  4RAG A;  4KIB A;  1MNE A;  4B09 A;  2HOT A;  3QOD A;  3DU6 A;  3CDH A;  2H6C A;  4XR6 A;  3AL0 C;  1GXQ A;  1ERD A;  2EWN A;  1IF1 A;  1SFO J;  2CUE A;  3OIQ A;  4M3E A;  2PMH A;  2QSG X;  3D0S A;  3SZP A;  3FZV A;  4ZYG A;  4MQV A;  2LY9 A;  2M4G A;  1XD7 A;  1KYW A;  1WH7 A;  5FLM J;  1KON A;  1KYZ A;  3CP8 A;  1AKH A;  1B72 A;  3KP3 A;  3WU2 C;  2XRL A;  3G1M A;  3QP6 A;  4AWX B;  4CDG A;  1XDU A;  4BQO A;  3F8M A;  2L54 A;  2BGC A;  2Z1D A;  4S04 A;  4BUP A;  2TCT A;  3PSI A;  3I64 A;  1Y56 A;  4IQJ A;  4FE4 A;  4EM1 A;  2ZB9 A;  2W24 A;  3OYC A;  2WY8 Q;  1ZAR A;  1WQ2 A;  4UUS B;  3EET A;  3REO A;  2F4O B;  3KP6 A;  3TL4 X;  2M45 A;  2QEN A;  3OYH A;  4WXC A;  1EKE A;  2I5U A;  2P7C B;  2WA0 A;  3DEU A;  1A04 A;  3ZRG A;  4EAT A;  1DU6 A;  1R5G A;  1IG7 A;  2QGU A;  1JTX A;  1OIS A;  3A1Y A;  2Y9Y A;  2P5L C;  3PQJ A;  4Y17 A;  3VYU B;  3KP2 A;  1QZY A;  2P4W A;  4D9J A;  1E0E A;  2HYJ A;  1W0U A;  1HXD A;  1OYY A;  3HKZ N;  3K4B A;  4LIV A;  2NAZ A;  4YFK F;  2H8R A;  1A6I A;  2LVS A;  1TW3 A;  1P4A A;  3S14 J;  2PFB A;  2FNA A;  2KLO A;  3P9K A;  1FBS A;  4UB6 C;  2OZ6 A;  4CCN A;  4KMF A;  2LMD A;  2VKD A;  5HS8 A;  3LSI A;  4CYC A;  4LB5 A;  5D5V B;  1J2X A;  3GTM J;  5EG0 A;  2QYO A;  3E0J B;  1NK2 P;  1I5Z A;  2Y2Z A;  4IEJ A;  4G7Z F;  1MW7 A;  4KIS A;  4BL0 B;  4A0Y A;  1J9I A;  1R71 A;  1RPW A;  2CQ7 A;  3RPQ A;  4LB6 B;  5KAF C;  1JJ8 C;  3VDX A;  1POG A;  5GAG J;  1ZN2 A;  2MYS A;  3CLQ A;  3ABU A;  1E3P A;  2Y75 A;  4NQW A;  1DDN A;  4GXO A;  5AON A;  2IS4 A;  2HXI A;  4IVN A;  1Z6T A;  4PJM A;  5E79 C;  2XPW A;  4HBL A;  4DYR A;  3W3C A;  3HPG A;  5JLX A;  1QHG A;  2V9V A;  4WX9 A;  3W6K B;  4L9N A;  3JAM K;  2MFZ A;  1E17 A;  3K4L A;  1I3A A;  1Z67 A;  2P5K A;  1WPK A;  2DT5 A;  4V19 K;  1SVM A;  5LEK A;  3VOE A;  3Q5F A;  1VZ0 A;  1TBX A;  4UXN A;  1C0W A;  3MAJ A;  3GBG A;  3HRS A;  3RPU D;  3VYR B;  2FSW A;  1JKR C;  3E6C C;  4B1R A;  1MJA A;  1K4S A;  3E5Q A;  1Y0N A;  3I4P A;  4CYC B;  2KIF A;  3G1L A;  4AYB A;  3MD2 A;  3HRM A;  1PDN C;  1EH8 A;  2NYX A;  5KAI C;  4XID A;  4E6K G;  2F2E A;  4NDL A;  4U0Y A;  4C30 A;  4IJA A;  2LNB A;  2HPM A;  3W6V A;  3V8K A;  4ESJ A;  1QHH D;  1EV7 A;  1Z05 A;  1J75 A;  1BC8 C;  2X6X A;  1OQY A;  3E6B A;  1JI8 A;  3F22 A;  3JR9 A;  4DW6 A;  3DWL E;  2WAD A;  2E1O A;  1B72 B;  3CJT B;  5DUK A;  1AKH B;  1APL C;  3ZR8 X;  4E7L A;  3DU5 A;  3LAJ A;  1P7J A;  4EJU A;  4LG3 A;  4MGR A;  2IGO A;  2A68 F;  2ZNY A;  5DCM A;  2XPV A;  1ZKG A;  2BE5 F;  2H09 A;  2HDD A;  4I2O A;  4C3I J;  3CCV I;  5E3O A;  1O57 A;  2P6S A;  4HX4 A;  2FJ1 A;  3J7A Y;  3WTV C;  3CCR I;  1D1C A;  4O6J A;  3GTJ J;  5IT9 Z;  2DCE A;  3CCL I;  4JP0 A;  1FNN A;  4HV5 A;  4CCK A;  2VJJ A;  2ME0 A;  5AIP A;  4M6X A;  1BR2 A;  2GOX B;  4Y3O A;  3WTT C;  2XC7 A;  1ZRF A;  3R6S A;  1TLH B;  3Q3S A;  5IOY A;  1FIA A;  3WE2 A;  3ZQL A;  2N8G A;  5BMZ A;  1VQ6 I;  2DK5 A;  4J01 A;  1MGT A;  2FX0 A;  2DA5 A;  4FQG A;  3CUO A;  4V2G A;  4FX4 A;  1O3T A;  1D0Y A;  4HOB A;  3ISP A;  2DOF A;  3FK7 A;  4BJ5 C;  2XAJ A;  4U7D A;  3DQV C;  2M2E A;  1TC3 C;  4M72 A;  3BR1 A;  2M87 A;  1T95 A;  3LSM A;  3K1P A;  2MH9 A;  3DTI A;  2M0M A;  3IP4 B;  5TJJ A;  4P1W A;  1D0Z A;  1UJ8 A;  1D8K A;  3GXO A;  2CH0 A;  3RYP A;  2E7X A;  2JPB A;  2OD5 A;  3SFZ A;  2IGK A;  2VPR A;  1R1U A;  3OYN A;  4W1U A;  1ZQ3 P;  3VSK A;  2GA2 A;  5FO5 A;  1U5T A;  4RGX A;  3A01 B;  1BI2 A;  3I71 A;  3S1M J;  2W57 A;  2TDX A;  2E5N A;  1F5T A;  3JTH A;  2JVG A;  1W1W E;  4RS8 A;  2YR2 A;  3RTR A;  1REP C;  4BAC A;  1OCR H;  3KZY A;  5GAE J;  2Q2E A;  2K9Q A;  4B3A A;  2L0K A;  2V4J C;  5LHI A;  3GFJ A;  4BHC A;  2MG4 A;  5ICE A;  1JGG A;  1TW2 A;  3U2R A;  3HIF A;  1UST A;  3CTA A;  3F8N A;  3HGG A;  3K4N A;  3NQO A;  4MIM A;  3CLO A;  4PSW A;  4G94 A;  2DYS H;  4ON0 A;  3JAM Z;  3KP4 A;  4Y52 J;  4KDP A;  4JQF A;  1L0O C;  5J1R A;  1F36 A;  4D7M A;  4FT8 A;  3CCY A;  5D4S A;  4BHP A;  2R7Q A;  1MH4 A;  1X4O A;  4R79 A;  5EEG A;  3CCJ I;  2QA4 I;  2R3S A;  2P5V A;  1T39 A;  1RIO H;  2VLA A;  1YIT I;  2M8E A;  3P5J A;  4BY7 J;  4DIQ A;  3B6C A;  5GPA A;  5L3D A;  2HOA A;  1Z21 A;  2KP6 A;  2PQ8 A;  2IW5 A;  4HF0 A;  5HS7 A;  3FMQ A;  1XGS A;  4A3L J;  2JSC A;  1XMX A;  3GLL A;  4UB8 C;  1LDK B;  5DD4 A;  4V2F A;  4CXF A;  1IRZ A;  2KIS A;  3K1N A;  2VAS A;  2CUF A;  3KZZ A;  1G6N A;  2VJ4 A;  2EZK A;  1GVD A;  2X0L A;  2HGC A;  4HSR A;  1MMG A;  2K4J A;  4IF4 A;  1FJL A;  2WB1 N;  3HHG A;  3CP2 A;  4I98 B;  4LK1 F;  2HYF A;  2L3D A;  1TZL A;  3SFI A;  1WFX A;  3LOC A;  4QWQ A;  1KZH A;  4LLN A;  2VN2 A;  4F52 A;  1IRX A;  1KU3 A;  1YW7 A;  3ERE D;  3O8H A;  2VC0 A;  2DPD A;  1F9N A;  4EV0 A;  5CVV A;  1JKO C;  2IA1 A;  1LEB A;  2OAZ A;  1W36 C;  2ID3 A;  2YU3 A;  2A6H F;  4E7I A;  2OQR A;  2K9L A;  1VF9 A;  4XKB A;  5EYR A;  5E3M A;  1FMV A;  4KN4 X;  1BA5 A;  3IKT A;  2CUJ A;  3WHB A;  2O5R A;  5F1J A;  3BG5 A;  5EG0 B;  4U87 A;  1W0T A;  4HX8 A;  2K4B A;  3IHU A;  4IOC F;  1OCO H;  3HOW J;  3BWG A;  2R7T A;  2PBI A;  2Q8K A;  2HVS A;  4P55 A;  1VQP I;  3MVP A;  1DU0 A;  3PNV A;  4O5V A;  4EGZ A;  3QPL A;  1AWC A;  1LE8 A;  5LGN A;  2Y30 A;  3FIS A;  5JHU A;  4B47 A;  4PJL A;  1JXS A;  1E3O C;  2EV6 A;  3K9T A;  4ASN A;  2PEX A;  2V9K A;  3RPU A;  4BGD A;  4YII A;  2R7S A;  2MLG A;  5L3G A;  1Y6I A;  1HC8 A;  1I6H J;  5TGT A;  2BW3 A;  5FD5 A;  2LR8 A;  5FGM A;  2JQ7 A;  2XGD A;  5K7F A;  2CQX A;  1F43 A;  3ASO H;  2VPL A;  1QZE A;  2DA2 A;  2ZBK A;  1V5E A;  1FY7 A;  2HTS A;  2Z16 A;  3LL7 A;  6PAX A;  5E17 F;  2EZI A;  3PUF A;  4II2 A;  3HM5 A;  2EK5 A;  3H3Z A;  2FMY A;  4RB0 A;  4U88 A;  5E1W A;  5LHH A;  3N97 A;  2RV8 A;  1T33 A;  2DDB A;  2W00 A;  1ZRC A;  2VOO A;  3KYD B;  3F21 A;  5ICG A;  1J0R A;  2L9R A;  2ELK A;  3NRV A;  4RB1 A;  2GIV A;  2LDU A;  3QOP A;  2A5W A;  2D45 A;  1K7A A;  3BRO A;  1UHW A;  4CH7 A;  2B0L A;  2UXX A;  3BDD A;  5DCF A;  3AG2 H;  3E6M A;  3C7J A;  4MFE A;  5GPC A;  1XGM A;  2Y0S A;  3VOD A;  1ULY A;  4DGW B;  5HLG A;  5DYM A;  4XL9 A;  1HKS A;  3G6E I;  4XRM A;  3BJ6 A;  1FBQ A;  3SQN A;  4ENM A;  4D0P A;  2CGP A;  3P9I A;  3KE2 A;  3JRA A;  1AOY A;  3GF2 A;  2ACJ A;  2GIZ A;  4G6Q A;  2UWM A;  4ZYA A;  2PLY A;  2YX4 A;  2G9W A;  4O3M A;  3ZQF A;  3K1M A;  1CF7 B;  1MMD A;  3NAR A;  2QBY A;  2RRE A;  1G3T A;  3OSG A;  3RKQ A;  3WTU C;  3EUK L;  1AHD P;  5D5U B;  3M3Y J;  1UHM A;  2DQL A;  4OU0 A;  3NWT A;  3KLN A;  3SEZ A;  1HST A;  1P4W A;  1FTT A;  2ICW G;  3BR5 A;  3M1C A;  2KRC A;  5EZH A;  5C44 J;  5F08 A;  1SFK A;  3BJA A;  4G9Y A;  4A3C J;  4IZZ A;  3H3U A;  1TL8 A;  4ABZ A;  1D1B A;  1H89 C;  1I1G A;  3DBL B;  3N05 A;  2E2I J;  4KIG A;  3TP3 A;  3BOQ A;  4I0B A;  2JMW A;  3ABT A;  2G7U A;  1HDD C;  1HKQ A;  2DT7 B;  2ZC2 A;  1P4X A;  4A3K J;  4A3J J;  2X48 A;  2GOM A;  3HB9 A;  5LEJ A;  3U1D A;  3IV5 A;  1OCC H;  1I6X A;  3DP7 A;  2HKO A;  4MEX F;  2NRA C;  2CU7 A;  1XC5 A;  4M3D A;  1DPR A;  5IPA A;  3CC7 I;  1TTY A;  4DNC A;  5H6Q A;  3SYT A;  2FU4 A;  2R7O A;  3HKZ A;  2XRN A;  4PJJ A;  4AVP A;  3J7Z I;  2QWW A;  3GX4 X;  2EFN A;  3HBL A;  3IH4 A;  1ETW A;  3FXR A;  3CDL A;  2IVM A;  3HL2 A;  3G71 I;  3L7W A;  4IHX A;  3LFU A;  2D5V A;  2EJR A;  2FQ4 A;  1Z91 A;  1WJ5 A;  2E35 A;  1N75 A;  2R7X A;  3MKY B;  4MTD A;  1BN5 A;  4F55 A;  4CCL A;  3TDZ C;  2BZT A;  1T0F C;  1K4T A;  2JN6 A;  2ZO4 A;  3BTL A;  3QU3 A;  3IUO A;  1KQ9 A;  2VQG A;  4A3F J;  1LUJ B;  4C2T A;  1B8I A;  5EJC A;  1GVJ A;  4HYE A;  3HTU A;  2CWE A;  2W25 A;  3H0G J;  3OIO A;  2ZJP F;  3LSR A;  1T38 A;  5CYV A;  4PJN A;  1LFB A;  5TIS C;  1IRF A;  3T8R A;  4BEH B;  2O9L A;  3MWM A;  2JA2 A;  4RLF A;  1QPM A;  5F27 A;  4ZH4 F;  3W2A A;  3DEW A;  2ESN A;  4BE2 A;  5L3C A;  4BQA A;  4HA8 A;  1CGP A;  4JYK A;  3FX3 A;  3RIR A;  3F6V A;  3HOZ J;  2E1M B;  2PX9 A;  1YQA A;  3OMY A;  4NNJ A;  1T2K A;  2HU9 A;  4AYB N;  1E3H A;  3HOU J;  1VQ7 I;  4E70 A;  2STW A;  1MBG A;  1QBJ A;  1O3R A;  1U3E M;  2EV5 A;  2PJP A;  3QQA A;  4B48 A;  1YLF A;  4Q4Z F;  3LSJ A;  4FET A;  1H8A C;  2DOE A;  4HAM A;  2YSR A;  4M9S A;  1STZ A;  2RNG A;  1XCV A;  4GYI A;  3HOT A;  4X1E A;  2NXN B;  4N9H A;  3S93 A;  4DJA A;  1LDJ A;  1LNW A;  2E2H J;  4P96 A;  3MMY B;  1Y1V J;  2ECB A;  2E1N A;  1RI7 A;  5ED4 A;  5CVR A;  4D7N A;  1HF0 A;  3OYJ A;  2EBI A;  2K86 A;  1RKT A;  3FXQ A;  5L3E A;  2HQ5 A;  3S8P A;  1G8X A;  2D1V A;  1VFC A;  1YW8 A;  2IJL A;  1UB9 A;  2JRT A;  3QPS A;  2Z33 A;  5FRN A;  3GYH X;  2W1O A;  4RGR A;  1BL0 A;  5B66 C;  4BDY A;  3A0H C;  5ILU A;  2FOK A;  3HYI A;  2MBF A;  3PFY A;  1S5L C;  3IAS 2;  4C9Y A;  4CCJ A;  3WTY C;  5K5Q A;  5M5W J;  5HDN A;  1EJ9 A;  3OL3 A;  5FRO A;  3NWS A;  2IS2 A;  4XLE A;  4HNU A;  3RKW A;  3C2H A;  2YUS A;  2EZL A;  2M5W A;  1N78 A;  1IV6 A;  3GFL A;  1DQU A;  2IA0 A;  3QAH A;  4UHT A;  5JR3 A;  5K5O A;  2E36 A;  4FAS D;  1N77 A;  3OS2 A;  4AU7 A;  3HOV J;  2IS6 A;  1ZTR A;  2L4M A;  5EDN A;  2KIM A;  3ULQ B;  3U9G A;  3FHZ A;  1ETO A;  5F0C A;  2O6G E;  1MKM A;  3W6J B;  1MMN A;  3DXJ F;  3BR2 A;  3CCU I;  1G3S A;  5D5W B;  1ZG5 A;  3TBI A;  1W5S A;  3QWL A;  3RSN A;  5L3F A;  3HSF A;  4RLQ A;  4XN0 A;  3DV8 A;  1Z3X A;  3VSL A;  3N4M A;  1BJA A;  3CDI A;  2XAU A;  2DA7 A;  1D5V A;  4DBQ A;  4ZC3 A;  5B1A H;  2VBY A;  5DM6 F;  1IN7 A;  1TNS A;  1X1P A;  2DXI A;  3D5S C;  2GM4 A;  5DV5 A;  2H27 A;  2H6B A;  2F5E A;  4KIC A;  4Y4R A;  3T1B A;  2DBB A;  5CLS A;  2OF7 A;  2NS0 A;  1A6Q A;  3VYT B;  3O2P E;  3GVA A;  2X51 A;  2VBW A;  4I01 A;  1P92 A;  2XAG A;  5EZG A;  3JRD A;  3LSG A;  2BBY A;  3K4M A;  2AXL A;  2KRH A;  2NVU B;  1R7J A;  1X19 A;  4XOT A;  1MD0 A;  1U9N A;  3DPL C;  1HBX G;  1P9Q C;  4IRH A;  4IRG A;  2EPF A;  5DTD A;  1I27 A;  1BIA A;  3QOE A;  4XLC A;  5D6F A;  1LE8 B;  1Y8R B;  3OYE A;  2H1L A;  2CW8 A;  4GDF A;  3FK6 A;  2JT1 A;  2K3P A;  5LGT A;  1FSH A;  3KEO A;  4EJO A;  5HDG A;  3V7C A;  1ZAO A;  2JA7 J;  2FNP A;  2IBD A;  5DD8 A;  1YE9 A;  2HYG D;  1F4K A;  3E6D A;  3HJE A;  5J40 A;  1VQ8 I;  3I4N J;  3S2W A;  2DT6 A;  2ECC A;  4J19 A;  1H88 C;  4QIW N;  4YFX F;  1GDT A;  2M8G X;  3ABL H;  2X6Y A;  3F72 A;  1XGN A;  4S0H B;  5FKN A;  1I50 J;  5HNH A;  4YEJ A;  2P8T A;  1LQ1 A;  5FKO A;  3TKY A;  3V7R A;  4HF2 A;  3BZ6 A;  4BQQ A;  1JE8 A;  1HW2 A;  4HLX A;  2FXA A;  2M9H A;  4AM3 A;  5F0H A;  5FB2 A;  2A05 A;  1ZG1 A;  1A35 A;  2BEO A;  2VIX A;  3CO7 C;  4GGG A;  1FYM A;  2OCC H;  4Y13 A;  4DYC A;  3L09 A;  4EJV A;  2WAQ N;  3K6G A;  1PJR A;  4ZZL A;  1QU3 A;  2XSJ C;  4HEA 2;  4ETS A;  4XON A;  2V79 A;  3ZMZ A;  2KDZ A;  4X6A J;  2JTV A;  3KEQ A;  3AAF A;  2CV1 A;  2DW4 A;  4PUS A;  1ETY A;  2F6C A;  3CZ6 A;  1FOY A;  3H35 A;  3LST A;  1Y39 A;  2BY1 A;  3ONQ A;  2OBP A;  1XDS A;  2V9P A;  2X9D A;  5FD6 A;  1ZG3 A;  1D3Y A;  3S1R J;  1WKM A;  3AFH A;  2KJB A;  4NHJ A;  3B02 A;  4IHW A;  5IYD J;  4A6E A;  3CCM I;  2M4K A;  3J81 Z;  2QM3 A;  1HW5 A;  4E7H A;  1OYI A;  5FFX A;  3SDB A;  1EH7 A;  3DKX A;  2WAE A;  1JUS A;  2AXT C;  2HQA A;  3ABM H;  4HW0 A;  2DMQ A;  4EM0 B;  1YO5 C;  1A36 A;  2MH2 A;  2E19 A;  4HST A;  2QQA A;  1OLT A;  1LVA A;  1SVO A;  2HXO A;  4LMY A;  1K6Y A;  4RM2 A;  1VQ9 I;  2COB A;  2MC4 A;  1FOW A;  2F5C A;  2HKX A;  4BXX J;  1PP7 U;  3KET A;  1FWZ A;  3M8F A;  1ZR2 A;  1WHU A;  1FIP A;  4IRI A;  1J09 A;  4NC8 A;  2R7D A;  4ZYH A;  3GTK J;  5F64 A;  4LIU A;  2XKP A;  2P81 A;  1IXR C;  1BBY A;  2ISZ A;  1DP3 A;  1JKQ C;  5BQT A;  2CQQ A;  3HRT A;  4DZP A;  1MJ9 A;  5F6F A;  4A0X A;  1FP1 D;  3LNQ A;  1G4D A;  2M7A A;  4G12 A;  2CQN A;  4GO1 A;  3WTZ A;  4RBO A;  3FKI J;  2Y0S N;  5FKL A;  3ZMS A;  3P7N A;  2LKS A;  4UY8 I;  1EH6 A;  2HOE A;  2RAE A;  2MGQ A;  1D8J A;  1SFE A;  1WSU A;  4XBF A;  4BKX A;  3PSF A;  2R7F A;  1HCR A;  5LHG A;  3CC4 I;  3E5X A;  3HZJ A;  5LBQ A;  1T98 A;  2R5Z B;  5IP7 J;  2DOD A;  3L1P A;  1S7O A;  4CUG A;  2LC2 A;  3OYF A;  2F5V A;  4A5M A;  2ZNZ A;  4B43 A;  3K70 D;  5KVR A;  3F8C A;  5J8C A;  4XIC A;  2X85 A;  3H92 A;  2RQP A;  2E5Z A;  1R58 A;  4HDU A;  2F48 A;  2HDC A;  5K7Z A;  3G4S I;  2XB5 A;  5A2Q K;  3L00 A;  3ERM A;  3VEP A;  3GFM A;  5B3S H;  4G7H F;  3CD6 I;  2L4A A;  2LH9 A;  1U8R A;  2KRF A;  4IX7 A;  2HPI A;  3EUA A;  4A3E J;  1K78 B;  4IHS A;  2VB6 A;  3DFG A;  4MO7 A;  2DTZ A;  3A01 A;  3TO9 A;  2DMT A;  4MTE A;  5D8K B;  2CQK A;  3L2C A;  1LFU P;  5E18 F;  1QVU A;  2QVO A;  2XF5 A;  3K4C A;  2DJN A;  3HGY A;  5EGO A;  4UUT A;  3I9V 2;  3OYM A;  1XPX A;  4N4N B;  5CVI A;  4AID A;  1XCB A;  3NEU A;  4DBR A;  4OWR B;  2MLK A;  3ZQC A;  4J00 A;  1UG2 A;  4MNU A;  1IUY A;  3K69 A;  4FIS A;  2WC2 A;  2R4G A;  2W7N A;  1WI3 A;  2L01 A;  3HOY J;  1FX7 A;  1HOM A;  2WV1 A;  1T0F A;  4L9V A;  4F92 B;  1ZGW A;  3BJO A;  2LG4 A;  1TQI A;  2VJI A;  5FRM A;  3HTS B;  1HQC A;  1B59 A;  4L9J A;  3H1C A;  3FM5 A;  2JA8 J;  4KA4 A;  3S32 A;  2QF7 A;  4M3G A;  5CKT A;  2AO9 A;  1BJZ A;  2BXZ A;  4DYQ A;  3RI4 A;  1XGO A;  3H9J A;  3TED A;  5EGO B;  4LK0 F;  2L9S A;  4FX0 A;  1LFP A;  4RMN A;  2DAO A;  1U5T C;  4RGS A;  2QBY B;  2MA3 A;  1VQK I;  5LRR A;  1K6O A;  1ETQ A;  1MND A;  1WH5 A;  5HNF A;  4ZTJ A;  5FLX Z;  5DS9 A;  4BQN A;  2RQQ A;  3QYE A;  4I7H A;  3GO5 A;  1J5Y A;  2AQF A;  2LOO A;  1W36 D;  3JRH A;  5ERI A;  2AHQ A;  3JSP A;  4Q5S F;  1J7K A;  4EMS A;  2VON A;  4HZF A;  4G8X A;  3IH2 A;  2QZ8 A;  2BVM A;  4MHG A;  1ETV A;  3L2Q A;  1R23 A;  2BY3 A;  2RN7 A;  3BG3 A;  3OYL A;  1LEA A;  4FCY A;  3E7L A;  2XPU A;  2GQQ A;  1VTN C;  1WRJ A;  2GBY A;  2QLZ A;  3BG7 A;  1JGS A;  3ABK H;  2ZJR F;  1JT0 A;  1TT0 A;  3KEY A;  4UVC A;  1ZK8 A;  4A69 C;  3GTO J;  1S8N A;  4M3F A;  3W2V A;  2OJE D;  3KIO A;  4KT5 C;  3LFK A;  3FMS A;  3S3N A;  3FM3 A;  3MFK A;  2YX7 A;  1OR7 C;  1YS7 A;  2HI3 A;  3DEE A;  3FXJ A;  2XVC A;  2ZME C;  2GA1 A;  3MKZ A;  2EFW A;  4QPQ A;  2FE3 A;  2WY7 Q;  2BHY A;  4PFO A;  1ITY A;  3MKL A;  3PO2 J;  2MW8 A;  4JBA A;  1Q1V A;  4KIF A;  4AVZ A;  2PN6 A;  1GHC A;  1ODD A;  1XSV A;  2VBX A;  2HVR A;  3FXO A;  2JZY A;  4OMZ A;  1Q1H A;  2FF4 A;  2CFX A;  3EDP A;  1GUU A;  1X2M A;  2MSY A;  2DOA A;  2XIG A;  3C2B A;  4LD5 A;  5BS6 A;  4L0Z B;  4ZDL A;  2LRD A;  4GYG A;  5HOD A;  2PMZ N;  3CCE I;  3OYI A;  3S15 J;  1B8I B;  3ZMV A;  4HRI A;  1YHQ I;  2E7W A;  1KGS A;  3B6A A;  3LQQ A;  2QQB A;  2IXS A;  4OIN F;  4PGG A;  2G7H A;  3OYA A;  1IN4 A;  1MSE C;  1Y8Q B;  3KFW X;  3D5R C;  1MSF C;  2AQE A;  5K5R A;  5C4J J;  4D1Q A;  1J59 A;  2EH3 A;  1K61 A;  1YOV B;  3GTG J;  1ZEL A;  3RJP A;  1X1C A;  3JW4 A;  3TO6 A;  4AC0 A;  3F23 A;  1WJA A;  4M3B A;  1PVE A;  2IEK A;  2B7E A;  2O03 A;  3EYY A;  2XUB A;  2NNY A;  2A07 F;  1OKR A;  3U1K A;  4P9U A;  2LFB A;  1FP2 A;  2ZCW A;  2L5Q A;  2EIN H;  3X2Q H;  1WJC A;  1YRN B;  2XAQ A;  2V6E A;  3IC7 A;  4JK1 X;  5E1X A;  3K70 C;  3PO3 J;  1MIJ A;  3BQZ A;  3EPZ A;  3JRE A;  5GAD J;  3GCM A;  5H6R A;  2HR3 A;  4HX7 A;  4Z2Y A;  4AIK A;  1XS9 A;  1IV8 A;  1KQ8 A;  3MN2 A;  1TT5 B;  3S16 J;  1Z9C A;  3HHH A;  4XLA A;  1NH3 A;  1YFH A;  1BOB A;  3LA7 A;  1IXS B;  1Z0X A;  3ELK A;  3K7A J;  5E8G A;  4CHU A;  1B1B A;  1V4R A;  2R7Z J;  2ZXW H;  4K2E A;  2M34 A;  4XOR A;  2RGV A;  1TWC J;  2COM A;  1ONV A;  4YFN F;  3QU6 A;  2CMP A;  4BXF A;  3GTP J;  4A5N A;  2XGE A;  4KJZ A;  2RKH A;  1RUO A;  3I54 A;  2CO5 A;  4XQF A;  4E7K A;  2QQ9 A;  1V3F A;  4YIF A;  1R00 A;  2H94 A;  1ZLJ A;  3E97 A;  1LJ9 A;  4WF2 A;  3WE3 A;  3VPR A;  2L7M P;  2K3F A;  3KCC A;  1U78 A;  2VUM J;  1FC3 A;  2FD5 A;  1LVK A;  3BLY A;  1IGN A;  5DEQ A;  2V1U A;  4QLC U;  2JWT A;  4FE7 A;  2DFI A;  1SVL A;  1V5F A;  2XHK A;  3IRR A;  4XRF A;  3CUQ A;  2R5Y B;  3C3W A;  5J47 A;  1UHS A;  5KK1 A;  3PJR A;  4H0E A;  4L0Y B;  3F6O A;  4KT6 A;  4RAY A;  2DMU A;  4FHT A;  4XLH A;  4BXU A;  2JUG A;  1KA8 A;  4A0Z A;  3QP5 A;  2BY2 A;  1B9M A;  3CUQ C;  5C4X J;  5CPR B;  3QPH A;  2CS3 A;  3BZC A;  4II3 A;  2H8W A;  2UZK A;  2IAI A;  4IKF A;  3I4M J;  4RGU A;  1D5Y A;  3CMM A;  5HDK A;  3H9Q A;  1P7I A;  4BE1 A;  1K83 J;  2NVQ J;  4DZJ A;  5JHF A;  1FYL A;  3KP5 A;  3TW6 A;  2JJ7 A;  1R1T A;  5HLI A;  1WJF A;  2PI0 A;  1ETK A;  3CO6 C;  1R5H A;  2DA3 A;  3TOB A;  2DA1 A;  3MZH A;  1W7P A;  1FT9 A;  1RNL A;  2RNJ A;  5IT3 A;  2EQR A;  3BCA A;  5KNL A;  2XAH A;  1OFC X;  3PIP F;  1QA6 A;  5HLH A;  1QZZ A;  1YYV A;  2VOD A;  1IC8 A;  3OV8 A;  1DUX C;  2L7K A;  1X2N A;  4ZYE A;  1K78 A;  4OAY A;  1DPU A;  3HC7 A;  1YJW I;  4R8H A;  2CFO A;  4BE0 A;  1WCM J;  3R0J A;  5DDG A;  3PIO F;  4OOI A;  1R5I D;  5E20 A;  4HNT A;  4PZJ A;  3JRB A;  3BZK A;  3I58 A;  1T6S A;  3WG9 A;  1X3W B;  3OS1 A;  4YEL A;  3UKG A;  1WJB A;  3DLL F;  4I6Z A;  1F1Z A;  1B4A A;  2XF7 A;  3C1D A;  5J1U A;  4RM3 A;  3OYD A;  3TMO A;  5IP9 J;  2L7F P;  4XK4 A;  3HOX J;  3KLO A;  4BNC A;  2M7B A;  1D1A A;  1VND A;  4B4C A;  4OIR F;  3H5N A;  1MBH A;  1SAU A;  2NOJ B;  1FZP B;  1W7P B;  1MBJ A;  3JTG A;  3R60 A;  4XRS G;  3HRU A;  5IYC J;  4YRV A;  3ZQ7 A;  5B1B H;  4CSW A;  3K10 A;  5H2F C;  5E1Z B;  5BPI A;  5DUI A;  1Z77 A;  4EJW A;  2OC6 A;  2OTL I;  1UG0 A;  4EM2 A;  1NK3 P;  1FOK A;  4XKC A;  3ZMT A;  4PFP A;  4C2M J;  2H1K A;  1XN7 A;  1UCR A;  1MH3 A;  3Q0U A;  1ON2 A;  3CME I;  3FHN A;  2K40 A;  4IOA F;  5F0F A;  1HSJ A;  3G1O A;  1BI3 A;  4OIP F;  3PM1 A;  2R7W A;  5M5X J;  4ZDO A;  1P6R A;  3RYR A;  2KFD A;  1YI2 I;  4UV8 A;  5TRD A;  4A3G J;  3FDY A;  4XKV A;  1DGW Y;  1BR1 A;  3GUD A;  4RAZ A;  3OOP A;  1RKW A;  4M9X A;  4BYY A;  4WXD A;  5D8L B;  4S05 A;  3SHF A;  1LPQ A;  3GZ6 A;  3CES A;  5ICC A;  1UFM A;  4M9Z A;  2X1C A;  4FTH A;  2XF6 A;  2M3A A;  1Z3Y A;  2K02 A;  2FBK A;  4TV7 A;  5GTI C;  3J7Y J;  1KQ0 A;  1WGX A;  3KYL A;  3CF5 F;  1ACI A;  3RZO J;  4BBR J;  4C3H J;  3E1S A;  4U0W A;  3LMM A;  4A12 A;  2O8K A;  4E7S A;  3GWZ A;  3K2A A;  2W48 A;  3ZCO A;  2K7L A;  4ANJ A;  3WTS C;  2ZKZ A;  4LG0 A;  3CC2 I;  4XLP F;  1JT6 A;  4OIO F;  2XRO A;  2X6O A;  5K7H A;  3LSP A;  3T8T A;  3ZPL A;  4IQ4 A;  3OR2 C;  2JRM A;  2XV4 S;  1ZYR F;  1N25 A;  2BYV E;  2J5P A;  2ESH A;  1T8I A;  4QPO A;  1BC7 C;  2VE9 A;  4KYW A;  5FFZ A;  1TWG J;  2R7U A;  3BPX A;  1WJE A;  1XSD A;  3QYB A;  2P0W A;  2VQH A;  3AG1 H;  2WTE A;  2HNH A;  2W82 A;  2IGM A;  2E71 A;  4M74 A;  1SFU A;  1IN6 A;  1HDP A;  2E34 A;  1X3Z B;  4L9T A;  4CO8 A;  4AUX A;  1S29 A;  2R92 J;  1B9N A;  3OR1 C;  5LRS A;  2R5Z A;  3O6B B;  2F5F A;  3VWB A;  4LJZ F;  5JVT A;  3Q0W A;  2GXB A;  2OTJ I;  4WK8 F;  2FA5 A;  1CQT A;  2DN0 A;  1WJD A;  4KMU X;  1R4N B;  1R9T J;  4NC7 A;  3GTL J;  3Q9V A;  1O3Q A;  2Z5U A;  1VQM I;  2VE8 A;  3CJR B;  2CG4 A;  4BY1 J;  1R22 A;  1L3L A;  3FXL A;  3I59 A;  3M8J A;  1QPI A;  2FRH A;  1QQI A;  4E4H A;  1ZRD A;  1QRY A;  5JFR A;  2F5D A;  1SMT A;  3M1E A;  4A3M J;  2DFF A;  1TWF J;  1TQM A;  3WGG A;  2O3F A;  3J80 Z;  5BOX A;  3KZI C;  4GCV A;  3H5A A;  4XNF A;  3AKZ A;  4D5F A;  2VL8 A;  4ZTF A;  2BHZ A;  3DCF A;  2HDW A;  3JRI A;  4A2U A;  3ECH A;  1O7L A;  2WBM A;  2LF8 A;  5D4R A;  1YS6 A;  2BV6 A;  2BOL A;  1NTC A;  1ENH A;  4HV6 A;  3V42 A;  1XG1 A;  2ZFW A;  5FKK A;  3DF8 A;  1R4M B;  1VQ5 I;  2O7O A;  3E5U A;  2DFE A;  4ENJ A;  2KIU A;  1G3W A;  4B8X A;  3WOD F;  1AU7 A;  4M73 A;  4EGY A;  2PMZ A;  1R36 A;  5M3F J;  2Y31 A;  1ZGA A;  2KKO A;  1Z6R A;  2EA2 A;  1IDY A;  3CQZ J;  4EVI A;  3A02 A;  5LGU A;  2IP2 A;  4QTR A;  1ZHF A;  2MAB A;  3BR6 A;  4AIH A;  3WU1 B;  2ME6 A;  2DYR H;  4HQM A;  1OYW A;  2JSP A;  1M1E B;  4H4K C;  1RRJ A;  4ESF A;  2OCE A;  5CQE A;  1RR8 C;  9ANT A;  1FOX A;  1U0J A;  3LSH A;  2Y48 A;  4YIR X;  1EA3 A;  3GME A;  3F9K A;  3DTK A;  2HVQ A;  3PL8 A;  3U21 A;  2HQN A;  1O4X A;  2XDV A;  3L2V A;  1V54 H;  2L2O A;  2MD5 A;  1PP8 F;  2VC1 A;  3EQL F;  2Y0M A;  1SAN A;  5CQG A;  5AIQ A;  1JKP C;  5GTH C;  1DP7 P;  1NHA A;  3BCB A;  5ILS A;  5B5E C;  3SEQ A;  4BDZ A;  2EV0 A;  5CJ9 A;  2KHM A;  2E60 A;  1S9H A;  2FOW A;  3OIP A;  5FLX K;  1VQN I;  3PFI A;  4IL6 C;  3H0D A;  3WTW C;  2OQG A;  2WWY A;  4DOZ A;  4BJT A;  3L2U A;  2RVC A;  1BW5 A;  2UUZ A;  4EEF G;  1GLN A;  3SZT A;  3Q0V A;  2HFH A;  4RB2 C;  3JCU C;  1UMQ A;  2JK3 A;  1IN5 A;  3D1N I;  2IPQ X;  3MCZ A;  1HLV A;  3LQR A;  3I3L A;  4HDV A;  4XKW A;  5J8F A;  2HS5 A;  3ZN0 A;  4Z6Y A;  2EIM H;  1LKX A;  4YG2 F;  1TP4 A;  2K9S A;  4MLO A;  4NQW B;  3LAP A;  1NG7 A;  1IO2 A;  2L9V A;  4PCQ A;  5GP9 A;  2QQ8 A;  3RDI A;  3FXK A;  3TDU C;  2O8X A;  3HSE A;  5D6E A;  3M9A A;  5K1Y A;  1Y0U A;  3ZQH A;  3S1Q J;  2P6T A;  3RKY A;  2KL4 A;  5J4V A;  4CZC A;  1OCP A;  1QVT A;  2DU9 A;  3SDG A;  2STT A;  2QSH X;  2X1D A;  3GW2 A;  3IAM 2;  3J7A O;  3PUB A;  4GFB A;  2DLL A;  1LDD A;  2Z3Y A;  1YIO A;  4R1H A;  3SZG A;  2HWV A;  2OV7 A;  3DLA A;  1T56 A;  3D5L A;  3K0L A;  4LIT A;  4M6Y A;  4MEY F;  3LWF A;  4PGH A;  5E3L A;  3TW7 A;  2HZD A;  2QCO A;  1VI0 A;  4CGZ A;  2DDA A;  4CYD A;  2E1C A;  3FWE A;  3RQ4 A;  3CMY A;  1RUN A;  3IRQ A;  1FPQ A;  3TOA A;  1W5C C;  1S7A A;  2VKE A;  1OPC A;  2EIJ H;  2ZXI A;  1K79 A;  2O0Y A;  1OJL A;  2V26 A;  4Y7N J;  2I8D A;  4IXA A;  1NG6 A;  4QSH A;  1YJN I;  1IN8 A;  4KNY A;  2Q0O A;  4NBQ A;  5J1Y A;  2ZSI B;  2JPC A;  3COA C;  4KFC A;  2MC3 A;  3LA2 A;  4XLN F;  4UNO A;  2K27 A;  1Z7L A;  3DPT A;  5HLT A;  3OOU A;  2QSF X;  3FBN B;  2FQ3 A;  3G2B A;  2HEO A;  5DCM B;  5IYB J;  3BC8 A;  4IPA A;  3ZN1 A;  4XOP A;  3UR3 C;  1QGP A;  4ENK A;  4PJ0 C;  1KU2 A;  1GV5 A;  4D5C A;  5EF6 A;  3AL0 B;  1MBE A;  3HPH A;  1DGR M;  1R1V A;  4IHT A;  4ITV A;  2B9S A;  1YRN A;  2DMP A;  2GLO A;  2DO7 A;  2L9N A;  2A69 F;  1S72 I;  5IOZ A;  5L3B A;  3IKV A;  3IWF A;  3RCO A;  3KPH A;  2ELJ A;  1H0M A;  3CCS I;  1FEX A;  4P9F A;  3WTX C;  2V1D A;  3ZOB A;  1JHH A;  1X3U A;  4HF1 A;  3F8F A;  1IUF A;  4F93 B;  2A3S A;  3VYS B;  4ESB A;  4XRS A;  2LKX A;  1YG2 A;  3BG6 A;  2CV0 A;  1WWX A;  3CF2 A;  1R49 A;  4CCO A;  4BU2 A;  2EFP A;  4IO9 F;  2LY1 A;  1BR4 A;  4W97 A;  3JSO A;  1S7E A;  3S3M A;  3KX2 A;  2YPR A;  4F7Z A;  1ZGJ A;  4P5O A;  2VQC A;  3KYC B;  5HS9 A;  1IZ1 A;  1H9G A;  1GV2 A;  2VT3 A;  1RZ4 A;  3OYG A;  1IW7 F;  3OS0 A;  1A5J A;  1QO0 D;  5GAH J;  4PK4 A;  3DBR B;  2DA4 A;  4C2U A;  2VOP A;  1BOA A;  1ETX A;  2JUC A;  1MMA A;  4L5J A;  1ON1 A;  4M71 A;  2P7V B;  2NNN A;  1SAX A;  3A03 A;  1XX5 A;  2ADU A;  3DKW A;  2Z2S B;  3RQI A;  4WCG A;  3S1N J;  5BNG A;  1JHF A;  3CJQ B;  3EUH C;  4MQ9 F;  1VQL I;  2ZXJ A;  1GT0 C;  4L5I A;  5ILV A;  3CMA I;  5LFA A;  3JRF A;  2EZH A;  3G3Z A;  3BP8 A;  1SD4 A;  3BY6 A;  2VT2 A;  4Q47 A;  2LBF A;  2R5Y A;  1MDM A;  2Z99 A;  2LTP A;  4UVB A;  4ZYD A;  3M4O J;  2LYC A;  2W85 A;  2W4S A;  1FTZ A;  4NUB A;  4N9I A;  2EIL H;  3WHC A;  2YU9 J;  2DTR A;  3PQK A;  2ELH A;  2W84 A;  4LFU A;  4UV9 A;  3SXY A;  3FIW A;  5CVJ A;  3ZQI A;  4BS9 A;  3LA3 A;  2PG4 A;  3BTI A;  1Y1W J;  4M6V A;  2ZXH A;  3HXL A;  3ZXS A;  2ETH A;  4BHB A;  5EEA A;  3MEX A;  3WG7 H;  1MJB A;  2IRF G;  1JTY A;  3I0T A;  3GTQ J;  3VB2 A;  5FJ8 J;  2VQL A;  3PNT A;  1FMW A;  2CUZ A;  4I76 A;  5JVG F;  3R61 A;  3Q9S A;  4A6D A;  2DA6 A;  2NS7 A;  2WAF A;  3S3O A;  5J6X A;  3A4C A;  1YIJ I;  5M5Y J;  2GWR A;  5J4Y A;  2BW3 B;  2LP0 A;  3HDD A;  1VQ4 I;  2E2J J;  1OR7 A;  4XM3 A;  1SD6 A;  1V5G A;  2VKH A;  2XSD C;  1OCZ H;  1RES A;  1MDM B;  3ESW B;  3BQY A;  4N0B A;  3ZP5 A;  1D0X A;  2KZV A;  2OA4 A;  4U0V A;  3BTJ A;  1JUM A;  3WGI A;  2OU2 A;  3H9G A;  1MBK A;  4BH9 A;  1UEL B;  1X1A A;  5ICF A;  2BVL A;  2KQR A;  2DI3 A;  2XGX A;  4UVA A;  2M30 A;  2XAS A;  1O3S A;  5M3M J;  3ZMU A;  3JRC A;  2F4I A;  1RC9 A;  2LKP A;  5F04 A;  1YJ9 I;  1XTA A;  3R4K A;  1KU7 A;  4CIC A;  2QKM B;  2VBZ A;  1ZLK A;  2JA6 J;  4BBS J;  5IY5 H;  3L2R A;  2ISY A;  5IP6 A;  2Y69 H;  3V8J A;  2VJ5 A;  4ZZD A;  1QNT A;  1RET A;  2LK2 A;  4LOC A;  3OY9 A;  1R6R A;  3OWT A;  2FML A;  1X1B A;  3R0A A;  2O61 A;  3FXM A;  3QPT A;  4HPQ A;  1USS A;  5EEH A;  2FUG 2;  4Q48 A;  1TNT A;  3MZY A;  2VKV A;  1HA8 A;  1E2X A;  1S3J A;  3KP7 A;  3VFZ A;  4KN7 X;  2DPU A;  3ZQQ A;  3V4G A;  2A5Y B;  3ASN H;  5HOO A;  2Z9O A;  3I53 A;  1ORK A;  1JJ6 C;  3RZD J;  3TO7 A;  3S2D J;  1IXC A;  2QUF A;  2PJR B;  1I39 A;  1X58 A;  2V1N A;  4XLF A;  4GRI A;  1I3Q J;  1HKT A;  3T0Y A;  3WU0 A;  4A3B J;  3L2W A;  2Q2E B;  2D2W A;  2ID6 A;  1BM9 A;  4A93 J;  4RA2 A;  2KIQ A;  2LBF B;  3H3V K;  4XN3 A;  4AD9 A;  1PUF A;  4LLG F;  4WXH A;  4WWC A;  1TWH J;  1UAA A;  1X1D A;  1W4M A;  1V55 H;  2IGN A;  5LLQ A;  5LD2 C;  2PMU A;  4X0G A;  2D1H A;  2BY0 A;  2CRG A;  4OIQ F;  2DFH A;  3EUH A;  1OMI A;  2EIK H;  2VI6 A;  4EJT A;  1U8B A;  5FLV A;  1PYV A;  2RC4 A;  1VQO I;  2CYY A;  1SD5 A;  3TQN A;  3G73 A;  2GZW A;  4IHV A;  3M7G A;  5E8I A;  1G59 A;  1YX3 A;  1SEU A;  1MMS A;  4EQQ A;  3GZ5 A;  4LG0 B;  3O8G A;  3WGH A;  1TQP A;  1A31 A;  2K9M A;  2X4H A;  4HNV A;  5DM7 F;  4Y33 A;  3BT9 A;  1SD7 A;  1LB2 A;  1WZ2 A;  4B44 A;  3M07 A;  3J81 K;  2KZG A;  3ECO A;  5C3E J;  4OMY A;  4UUS A;  3I56 I;  2Y9Z A;  3IL2 A;  2CW0 F;  1PUF B;  1GXP A;  4F91 B;  3EYI A;  3SJM A;  3DTE A;  1MBF A;  2UV1 A;  3ROU A;  1WI9 A;  1MZB A;  4IHY A;  2LRE A;  4JOM A;  2VXD A;  2VXZ A;  3FXU A;  3ML6 A;  2M0C A;  4U7B A;  2DK8 A;  1XSX A;  4A3D J;  4F3Q A;  2Q1Z B;  1P2F A;  4XSZ F;  4L18 B;  2NVT J;  3HUG A;  2ZJ2 A;  5CVU A;  2CW7 A;  3S2H J;  2JVH A;  2OUM A;  1UZC A;  3CUQ B;  4B3X A;  3I55 I;  2V6C A;  2EFO A;  2NOG A;  2GXG A;  2HTJ A;  5BPD A;  3H5R A;  3CCQ I;  4C3J J;  3C2G A;  1B6A A;  2A6T A;  2FBH A;  1W5T A;  3TP0 A;  1KU9 A;  5A2Q Z;  4HG2 A;  1BW6 A;  5F1R A;  1FBU A;  1BI1 A;  3FBI B;  2GAU A;  3K4K A;  4BJ6 C;  3MQ0 A;  3S17 J;  2K85 A;  2I10 A;  1FLI A;  3T5X A;  2K5C A;  2A61 A;  5D5X B;  3AG3 H;  2XB0 X;  1SC7 A;  2ZME A;  2CSO A;  2EA4 A;  1BIB A;  1WVR A;  2V1X A;  3OSF A;  2G0E A;  3QYF A;  1U9O A;  2OZU A;  4A3I J;  2EB7 A;  3HUG B;  3GLX A;  3V7S A;  2A6E F;  4KIT B;  1IAW A;  4OAZ A;  2R0Q C;  4I09 A;  5E3N A;  2M1B A;  4G7O F;  3FF5 A;  2LSO A;  2R93 J;  2DQR A;  3AG4 H;  3O3K A;  2LD5 A;  1ZR4 A;  4AIJ A;  2XAF A;  3B73 A;  2AS5 F;  3H36 A;  2WV0 A;  3IH3 A;  2FBI A;  2QKL B;  2UXN A;  3F0C A;  1FSE A;  4I02 A;  4MFD A;  3I5U A;  2IS1 A;  4JX6 A;  2J5O A;  4CCM A;  3GZN B;  3GEZ A;  3NAU A;  3HG9 A;  1ZRE A;  3F3X A;  1RR7 A;  2WAQ A;  1O7F A;  4LLL A;  5JI6 A;  4JX4 A;  2LLK A;  1YTY A;  1U5T B;  1BI0 A;  1G2H A;  3E3V A;  4BEH A;  2LF7 A;  2HOS A;  2NVY J;  3C18 A;  3M8E A;  3TGN A;  1XMK A;  2ZFU A;  3BG9 A;  3QRF F;  2C6Y A;  3W2W A;  2B63 J;  1FYK A;  3CJN A;  2ZJQ F;  4I0A A;  3ZGK A;  3OYB A;  2IA2 A;  4L5E A;  2V7F A;  2CV2 A;  1H9T A;  1CF7 A;  2R7R A;  1IJW C;  2CJJ A;  2IT0 A;  3BTC A;  4I99 C;  3OL4 A;  2KT0 A;  5HVQ C;  3DBH B;  4RAF A;  1OCT C;  2XKO A;  3F8B A;  3J80 K;  2NVX J;  1Z7U A;  2EFQ A;  4Y15 A;  4CZZ A;  3L9F A;  2X6W A;  1TWA J;  3GFI A;  4CA0 A;  1ZH5 A;  4E7Z A;  4RDU A;  2KDO A;  3K2Z A;  2WB1 A;  3UNG C;  3RKX A;  1S6L A;  4XMY A;  1W7P D;  1I1S A;  2KMU A;  2HZT A;  3K4J A;  4XSX F;  1T08 B;  3BR0 A;  1G3Y A;  3P9C A;  5H20 A;  2FEZ A;  2KPM A;  4RB3 C;  1AA7 A;  2DMN A;  2BXY A;  2R7V A;  5KHD A;  2XGC A;  3DPU A;  3BR3 A;  3DKY A;  1IDZ A;  5J3L A;  2TRT A;  1X4P A;  4KUM A;  4HLY A;  1PUE E;  2LY2 A;  1XB4 A;  5FKM A;  3FMR A;  3ZMD A;  3A2K A;  3BPV A;  4BAY A;  1U2W A; 
#chains in the Genus database with same CATH homology
 1HW1 A;  1IRG A;  4ENN A;  4NB5 A;  3I59 B;  1XMA A;  3IWZ A;  5IT9 K;  4PDK A;  1SMY F;  2L02 A;  4DQ2 A;  1SFX A;  2KJC A;  1YW9 A;  4LGW A;  2ZME B;  4HQE A;  3V8L A;  1Z1D A;  4UUV A;  2HQR A;  3HSR A;  4G6D A;  1U6G A;  3HOS A;  2RDP A;  4KIB A;  4B09 A;  3CDH A;  2H6C A;  1GXQ A;  2EWN A;  1IF1 A;  2PMH A;  3D0S A;  3SZP A;  3FZV A;  4ZYG A;  4MQV A;  1XD7 A;  1KYW A;  1KYZ A;  3KP3 A;  3QP6 A;  4AWX B;  4CDG A;  1XDU A;  3F8M A;  2L54 A;  2BGC A;  4S04 A;  3I64 A;  4EM1 A;  2W24 A;  1ZAR A;  1WQ2 A;  3EET A;  3REO A;  3KP6 A;  2M45 A;  2QEN A;  4WXC A;  2P7C B;  3DEU A;  1A04 A;  1R5G A;  2P5L C;  3PQJ A;  4Y17 A;  3KP2 A;  1QZY A;  2P4W A;  1HXD A;  1OYY A;  2NAZ A;  4YFK F;  1TW3 A;  1P4A A;  2PFB A;  2FNA A;  3P9K A;  1FBS A;  4KMF A;  2OZ6 A;  5HS8 A;  4LB5 A;  5D5V B;  1J2X A;  2QYO A;  1I5Z A;  4G7Z F;  4A0Y A;  1J9I A;  3RPQ A;  4LB6 B;  1ZN2 A;  3ABU A;  1DDN A;  2Y75 A;  4NQW A;  4GXO A;  5AON A;  4IVN A;  1Z6T A;  4HBL A;  2V9V A;  4WX9 A;  3W6K B;  4L9N A;  3JAM K;  1E17 A;  2P5K A;  2DT5 A;  5LEK A;  3VOE A;  3Q5F A;  1TBX A;  4UXN A;  1C0W A;  3MAJ A;  3HRS A;  2FSW A;  3E6C C;  1MJA A;  3E5Q A;  3I4P A;  2KIF A;  1PDN C;  3HRM A;  1EH8 A;  2NYX A;  2F2E A;  4U0Y A;  4IJA A;  2LNB A;  3V8K A;  4ESJ A;  1Z05 A;  1EV7 A;  1J75 A;  1BC8 C;  3E6B A;  3F22 A;  5DUK A;  3LAJ A;  4EJU A;  4MGR A;  2A68 F;  2ZNY A;  5DCM A;  2BE5 F;  2H09 A;  4I2O A;  1O57 A;  2P6S A;  4HX4 A;  3WTV C;  4O6J A;  5IT9 Z;  1FNN A;  4HV5 A;  5AIP A;  4M6X A;  3WTT C;  1ZRF A;  3R6S A;  1TLH B;  3WE2 A;  5BMZ A;  2DK5 A;  1MGT A;  4FX4 A;  3CUO A;  1O3T A;  4HOB A;  3ISP A;  2XAJ A;  4U7D A;  3DQV C;  4M72 A;  2M87 A;  3K1P A;  2MH9 A;  5TJJ A;  1D8K A;  3GXO A;  3RYP A;  2E7X A;  2JPB A;  2OD5 A;  3SFZ A;  1R1U A;  2GA2 A;  5FO5 A;  1U5T A;  4RGX A;  1BI2 A;  3I71 A;  2W57 A;  2TDX A;  1F5T A;  3JTH A;  4RS8 A;  3RTR A;  2YR2 A;  1REP C;  3KZY A;  2Q2E A;  5LHI A;  3GFJ A;  4BHC A;  5ICE A;  1TW2 A;  3U2R A;  3HIF A;  1UST A;  3CTA A;  3F8N A;  3JAM Z;  3NQO A;  3CLO A;  4G94 A;  4ON0 A;  3KP4 A;  4KDP A;  4JQF A;  1L0O C;  4FT8 A;  5D4S A;  4BHP A;  4R79 A;  5EEG A;  2R3S A;  2P5V A;  1T39 A;  1RIO H;  2M8E A;  5L3D A;  2PQ8 A;  2IW5 A;  4HF0 A;  5HS7 A;  3FMQ A;  1XGS A;  2JSC A;  1LDK B;  5DD4 A;  4CXF A;  3K1N A;  3KZZ A;  1G6N A;  2X0L A;  2HGC A;  2K4J A;  4IF4 A;  3HHG A;  4LK1 F;  4I98 B;  2HYF A;  2L3D A;  4QWQ A;  4LLN A;  2VN2 A;  1KU3 A;  1YW7 A;  3ERE D;  2VC0 A;  2DPD A;  1F9N A;  4EV0 A;  5CVV A;  1LEB A;  2IA1 A;  2OAZ A;  2YU3 A;  2A6H F;  2OQR A;  4KN4 X;  3IKT A;  4HX8 A;  2K4B A;  3IHU A;  3BWG A;  2PBI A;  2Q8K A;  4P55 A;  4O5V A;  4EGZ A;  1AWC A;  5LGN A;  5JHU A;  1JXS A;  2EV6 A;  3K9T A;  4ASN A;  2PEX A;  3RPU A;  4YII A;  2MLG A;  5L3G A;  5FD5 A;  5FGM A;  2ZBK A;  1FY7 A;  2HTS A;  6PAX A;  5E17 F;  2EK5 A;  3H3Z A;  2FMY A;  4RB0 A;  4U88 A;  5E1W A;  5LHH A;  3N97 A;  2RV8 A;  1ZRC A;  2VOO A;  3F21 A;  5ICG A;  1J0R A;  3NRV A;  4RB1 A;  2GIV A;  2LDU A;  3QOP A;  2D45 A;  1K7A A;  3BRO A;  1UHW A;  2B0L A;  2UXX A;  3BDD A;  5DCF A;  3C7J A;  3E6M A;  1XGM A;  5HLG A;  3VOD A;  1ULY A;  5DYM A;  1HKS A;  3BJ6 A;  1FBQ A;  3SQN A;  4ENM A;  4D0P A;  2CGP A;  3P9I A;  3KE2 A;  1AOY A;  3GF2 A;  2ACJ A;  2UWM A;  4G6Q A;  2PLY A;  2YX4 A;  2G9W A;  4O3M A;  3K1M A;  1CF7 B;  2QBY A;  1G3T A;  3WTU C;  5D5U B;  1UHM A;  2DQL A;  4OU0 A;  3KLN A;  1HST A;  1P4W A;  3BJA A;  4G9Y A;  3H3U A;  1I1G A;  4KIG A;  3BOQ A;  4I0B A;  3ABT A;  2G7U A;  1HKQ A;  1P4X A;  5LEJ A;  3U1D A;  1I6X A;  3DP7 A;  2HKO A;  4MEX F;  2NRA C;  1DPR A;  1TTY A;  4DNC A;  5H6Q A;  2FU4 A;  2XRN A;  4AVP A;  2QWW A;  3GX4 X;  2EFN A;  3FXR A;  2IVM A;  3L7W A;  2EJR A;  1Z91 A;  4MTD A;  1BN5 A;  3TDZ C;  2ZO4 A;  3QU3 A;  1KQ9 A;  1GVJ A;  4HYE A;  3HTU A;  2CWE A;  2W25 A;  1T38 A;  5CYV A;  1IRF A;  3T8R A;  3MWM A;  1QPM A;  4ZH4 F;  2ESN A;  5L3C A;  4BQA A;  4HA8 A;  1CGP A;  3FX3 A;  3RIR A;  3F6V A;  1YQA A;  1T2K A;  4E70 A;  2STW A;  1QBJ A;  1O3R A;  1U3E M;  2EV5 A;  2PJP A;  1YLF A;  4Q4Z F;  4HAM A;  2YSR A;  4M9S A;  1STZ A;  1XCV A;  4GYI A;  3HOT A;  4N9H A;  1LDJ A;  1LNW A;  4P96 A;  2E1N A;  1RI7 A;  5ED4 A;  5CVR A;  2K86 A;  3FXQ A;  5L3E A;  2D1V A;  1YW8 A;  2IJL A;  1UB9 A;  2JRT A;  2Z33 A;  3GYH X;  4RGR A;  5ILU A;  2FOK A;  3HYI A;  2MBF A;  3WTY C;  5K5Q A;  5HDN A;  3RKW A;  2M5W A;  3GFL A;  2IA0 A;  3QAH A;  4UHT A;  5JR3 A;  5K5O A;  2L4M A;  2KIM A;  3ULQ B;  3U9G A;  3FHZ A;  2O6G E;  1MKM A;  3W6J B;  3DXJ F;  1G3S A;  5D5W B;  1ZG5 A;  1W5S A;  5L3F A;  3HSF A;  3DV8 A;  3N4M A;  1BJA A;  1D5V A;  2VBY A;  1IN7 A;  1TNS A;  5DV5 A;  2H27 A;  2H6B A;  2F5E A;  4KIC A;  3T1B A;  2DBB A;  5CLS A;  2NS0 A;  3O2P E;  3GVA A;  2VBW A;  4I01 A;  1P92 A;  2XAG A;  2BBY A;  2AXL A;  1R7J A;  1MD0 A;  3DPL C;  1HBX G;  4IRH A;  4IRG A;  1I27 A;  1BIA A;  5D6F A;  1FSH A;  2JT1 A;  5LGT A;  3KEO A;  4EJO A;  5HDG A;  3V7C A;  1ZAO A;  2FNP A;  1F4K A;  5DD8 A;  2HYG D;  3E6D A;  3S2W A;  4YFX F;  3F72 A;  1XGN A;  2P8T A;  1LQ1 A;  3TKY A;  3V7R A;  4HF2 A;  3BZ6 A;  1JE8 A;  1HW2 A;  4HLX A;  2FXA A;  5FB2 A;  1ZG1 A;  2BEO A;  3CO7 C;  4GGG A;  1FYM A;  4Y13 A;  3L09 A;  4EJV A;  4ZZL A;  4ETS A;  2V79 A;  3ZMZ A;  2JTV A;  3KEQ A;  3AAF A;  2DW4 A;  3LST A;  2OBP A;  1XDS A;  5FD6 A;  1ZG3 A;  1D3Y A;  1WKM A;  2KJB A;  4NHJ A;  3B02 A;  4A6E A;  3J81 Z;  2QM3 A;  1HW5 A;  1OYI A;  5FFX A;  1EH7 A;  4HW0 A;  4EM0 B;  1YO5 C;  2MH2 A;  2QQA A;  1LVA A;  4LMY A;  2F5C A;  2HKX A;  1PP7 U;  3KET A;  1FWZ A;  3M8F A;  4IRI A;  2R7D A;  4ZYH A;  5F64 A;  2XKP A;  1IXR C;  1BBY A;  2ISZ A;  5BQT A;  3HRT A;  1MJ9 A;  5F6F A;  4A0X A;  1FP1 D;  1G4D A;  4GO1 A;  3WTZ A;  3ZMS A;  3P7N A;  1EH6 A;  2HOE A;  1D8J A;  1SFE A;  1WSU A;  4XBF A;  2R7F A;  5LHG A;  3E5X A;  5LBQ A;  1T98 A;  1S7O A;  4A5M A;  2ZNZ A;  5KVR A;  3F8C A;  5J8C A;  3H92 A;  2RQP A;  1R58 A;  4HDU A;  2HDC A;  5A2Q K;  3L00 A;  3VEP A;  3GFM A;  4G7H F;  2L4A A;  1U8R A;  2KRF A;  1K78 B;  4IHS A;  3DFG A;  3TO9 A;  4MTE A;  5D8K B;  2CQK A;  3L2C A;  5E18 F;  2QVO A;  5CVI A;  1XCB A;  3NEU A;  2MLK A;  4MNU A;  1IUY A;  3K69 A;  2WC2 A;  2L01 A;  1FX7 A;  1T0F A;  4L9V A;  3BJO A;  1TQI A;  3HTS B;  1HQC A;  1B59 A;  4L9J A;  3FM5 A;  4KA4 A;  3RI4 A;  1XGO A;  4LK0 F;  4FX0 A;  2DAO A;  1U5T C;  4RGS A;  2QBY B;  2MA3 A;  5LRR A;  1K6O A;  5FLX Z;  4I7H A;  3GO5 A;  1J5Y A;  5ERI A;  3JSP A;  4Q5S F;  1J7K A;  4EMS A;  2VON A;  4HZF A;  4G8X A;  2QZ8 A;  4MHG A;  1R23 A;  2RN7 A;  1LEA A;  2GQQ A;  1VTN C;  1WRJ A;  2QLZ A;  1JGS A;  4UVC A;  1S8N A;  4KT5 C;  3LFK A;  3FMS A;  3FM3 A;  3MFK A;  2YX7 A;  1YS7 A;  2XVC A;  2GA1 A;  2EFW A;  2FE3 A;  4JBA A;  4KIF A;  2PN6 A;  1GHC A;  1ODD A;  1XSV A;  2VBX A;  2JZY A;  4OMZ A;  1Q1H A;  2FF4 A;  2CFX A;  3EDP A;  2XIG A;  4LD5 A;  5BS6 A;  4L0Z B;  4GYG A;  3ZMV A;  2E7W A;  1KGS A;  3LQQ A;  2QQB A;  4OIN F;  2G7H A;  1IN4 A;  3KFW X;  5K5R A;  1J59 A;  3RJP A;  3JW4 A;  3TO6 A;  3F23 A;  2O03 A;  3EYY A;  2XUB A;  2NNY A;  2A07 F;  1OKR A;  4P9U A;  1FP2 A;  2ZCW A;  2XAQ A;  3IC7 A;  4JK1 X;  5E1X A;  5H6R A;  2HR3 A;  4HX7 A;  4Z2Y A;  4AIK A;  1KQ8 A;  1Z9C A;  3HHH A;  1YFH A;  3LA7 A;  1IXS B;  3ELK A;  5E8G A;  4CHU A;  1B1B A;  1V4R A;  4K2E A;  2RGV A;  2COM A;  1ONV A;  4YFN F;  3QU6 A;  4A5N A;  2RKH A;  1RUO A;  3I54 A;  2CO5 A;  2QQ9 A;  1V3F A;  4YIF A;  1R00 A;  2H94 A;  1ZLJ A;  3E97 A;  1LJ9 A;  4WF2 A;  3WE3 A;  3KCC A;  1U78 A;  1FC3 A;  2V1U A;  5DEQ A;  4QLC U;  2DFI A;  2XHK A;  3IRR A;  4XRF A;  3CUQ A;  3C3W A;  5KK1 A;  4H0E A;  4L0Y B;  3F6O A;  4RAY A;  4FHT A;  4BXU A;  1KA8 A;  4A0Z A;  3QP5 A;  1B9M A;  3CUQ C;  3QPH A;  2UZK A;  4RGU A;  5HDK A;  1FYL A;  3KP5 A;  1R1T A;  5HLI A;  2PI0 A;  3CO6 C;  1R5H A;  3MZH A;  3TOB A;  1W7P A;  1FT9 A;  1RNL A;  2RNJ A;  5IT3 A;  2XAH A;  5HLH A;  1QZZ A;  1YYV A;  2VOD A;  3OV8 A;  1DUX C;  4ZYE A;  1K78 A;  1DPU A;  4R8H A;  3R0J A;  5DDG A;  4OOI A;  5E20 A;  4PZJ A;  3I58 A;  1T6S A;  3WG9 A;  1F1Z A;  1B4A A;  3C1D A;  4BNC A;  3KLO A;  4OIR F;  1FZP B;  1W7P B;  3JTG A;  3R60 A;  3HRU A;  3ZQ7 A;  5E1Z B;  5BPI A;  5DUI A;  4EJW A;  4EM2 A;  1FOK A;  3ZMT A;  1XN7 A;  1UCR A;  1ON2 A;  1HSJ A;  4OIP F;  1BI3 A;  1P6R A;  3RYR A;  4UV8 A;  5TRD A;  3GUD A;  4RAZ A;  3OOP A;  4M9X A;  4BYY A;  4WXD A;  5D8L B;  4S05 A;  3SHF A;  3GZ6 A;  5ICC A;  1UFM A;  4M9Z A;  2K02 A;  2FBK A;  4TV7 A;  1KQ0 A;  4U0W A;  4A12 A;  3GWZ A;  2K7L A;  3WTS C;  2ZKZ A;  4LG0 A;  4XLP F;  4OIO F;  2XRO A;  3T8T A;  3ZPL A;  2XV4 S;  1ZYR F;  2BYV E;  2J5P A;  2ESH A;  1BC7 C;  2VE9 A;  4KYW A;  5FFZ A;  3BPX A;  1XSD A;  2WTE A;  4M74 A;  1SFU A;  1IN6 A;  4L9T A;  4CO8 A;  1S29 A;  1B9N A;  5LRS A;  3O6B B;  2F5F A;  4LJZ F;  5JVT A;  2GXB A;  4WK8 F;  2FA5 A;  4KMU X;  3Q9V A;  1O3Q A;  2Z5U A;  2VE8 A;  2CG4 A;  1R22 A;  1L3L A;  3I59 A;  2FRH A;  1QQI A;  1ZRD A;  5JFR A;  2F5D A;  1SMT A;  3M1E A;  1TQM A;  3WGG A;  2O3F A;  3J80 Z;  5BOX A;  4GCV A;  4A2U A;  3ECH A;  1O7L A;  2LF8 A;  5D4R A;  1YS6 A;  2BV6 A;  4HV6 A;  2ZFW A;  3DF8 A;  3E5U A;  4ENJ A;  2KIU A;  1G3W A;  4B8X A;  3WOD F;  4M73 A;  4EGY A;  1R36 A;  1ZGA A;  2KKO A;  1Z6R A;  2EA2 A;  4EVI A;  5LGU A;  2IP2 A;  1ZHF A;  4AIH A;  3WU1 B;  4HQM A;  1OYW A;  4ESF A;  2Y48 A;  2HQN A;  2MD5 A;  1PP8 F;  2VC1 A;  3EQL F;  2Y0M A;  5AIQ A;  1DP7 P;  1NHA A;  5ILS A;  2EV0 A;  5CJ9 A;  5FLX K;  3PFI A;  3WTW C;  2OQG A;  2WWY A;  2RVC A;  3SZT A;  2HFH A;  4RB2 C;  1IN5 A;  2IPQ X;  3MCZ A;  3LQR A;  4HDV A;  5J8F A;  2HS5 A;  3ZN0 A;  4YG2 F;  3LAP A;  3RDI A;  4PCQ A;  3TDU C;  2O8X A;  3HSE A;  5D6E A;  3M9A A;  5K1Y A;  1Y0U A;  2P6T A;  3RKY A;  2DU9 A;  2STT A;  3GW2 A;  3J7A O;  2DLL A;  1LDD A;  2Z3Y A;  1YIO A;  4R1H A;  2HWV A;  3D5L A;  3K0L A;  4M6Y A;  4MEY F;  3LWF A;  4PGH A;  4CGZ A;  4CYD A;  2E1C A;  3FWE A;  1RUN A;  3IRQ A;  1FPQ A;  3TOA A;  1S7A A;  1OPC A;  1K79 A;  2O0Y A;  4IXA A;  1IN8 A;  4KNY A;  2Q0O A;  2JPC A;  3COA C;  4KFC A;  2MC3 A;  3LA2 A;  4XLN F;  4UNO A;  2K27 A;  3DPT A;  2FQ3 A;  2HEO A;  5DCM B;  4IPA A;  3ZN1 A;  1QGP A;  4ENK A;  1KU2 A;  4IHT A;  1R1V A;  2DO7 A;  2A69 F;  5L3B A;  3IKV A;  3IWF A;  1H0M A;  4P9F A;  3WTX C;  2V1D A;  1JHH A;  1X3U A;  4HF1 A;  3F8F A;  2A3S A;  4ESB A;  1YG2 A;  1WWX A;  2EFP A;  3JSO A;  2YPR A;  4F7Z A;  1ZGJ A;  4P5O A;  5HS9 A;  1IZ1 A;  1H9G A;  2VT3 A;  1RZ4 A;  1IW7 F;  1QO0 D;  2VOP A;  1BOA A;  4L5J A;  1ON1 A;  4M71 A;  2P7V B;  2NNN A;  1SAX A;  3DKW A;  2ADU A;  4WCG A;  1JHF A;  4MQ9 F;  2ZXJ A;  4L5I A;  5ILV A;  3G3Z A;  3BP8 A;  1MDM A;  1SD4 A;  3BY6 A;  2VT2 A;  4Q47 A;  2Z99 A;  4ZYD A;  4UVB A;  2W85 A;  4N9I A;  2DTR A;  3PQK A;  2ELH A;  2W84 A;  4LFU A;  4UV9 A;  3SXY A;  5CVJ A;  3LA3 A;  2PG4 A;  2ETH A;  4BHB A;  3MEX A;  1MJB A;  2IRF G;  3I0T A;  3VB2 A;  3R61 A;  3Q9S A;  4A6D A;  5J6X A;  2GWR A;  1OR7 A;  1SD6 A;  1MDM B;  4N0B A;  3ZP5 A;  2OA4 A;  4U0V A;  3WGI A;  2OU2 A;  4BH9 A;  5ICF A;  2DI3 A;  2XGX A;  4UVA A;  2M30 A;  2XAS A;  1O3S A;  3ZMU A;  2LKP A;  3R4K A;  1KU7 A;  4CIC A;  2VBZ A;  1ZLK A;  2ISY A;  3V8J A;  4ZZD A;  1QNT A;  2FML A;  3R0A A;  2O61 A;  3QPT A;  1USS A;  5EEH A;  4Q48 A;  1TNT A;  3MZY A;  1E2X A;  1S3J A;  3KP7 A;  3VFZ A;  4KN7 X;  2DPU A;  3V4G A;  2A5Y B;  5HOO A;  2Z9O A;  3I53 A;  3TO7 A;  1IXC A;  2QUF A;  1HKT A;  3T0Y A;  3WU0 A;  2D2W A;  1BM9 A;  4AD9 A;  4LLG F;  4WXH A;  4WWC A;  1W4M A;  5LLQ A;  2PMU A;  2D1H A;  4OIQ F;  3EUH A;  1OMI A;  4EJT A;  2RC4 A;  2CYY A;  1SD5 A;  3TQN A;  3G73 A;  2GZW A;  3M7G A;  5E8I A;  4EQQ A;  3GZ5 A;  4LG0 B;  3WGH A;  1TQP A;  2X4H A;  1SD7 A;  1LB2 A;  3J81 K;  3ECO A;  4OMY A;  3IL2 A;  2CW0 F;  1GXP A;  3EYI A;  3ROU A;  1WI9 A;  1MZB A;  2VXZ A;  3FXU A;  3ML6 A;  4U7B A;  2DK8 A;  1XSX A;  1P2F A;  4XSZ F;  4L18 B;  3HUG A;  2ZJ2 A;  5CVU A;  3CUQ B;  2V6C A;  2EFO A;  2GXG A;  2HTJ A;  5BPD A;  1U2W A;  1B6A A;  2FBH A;  1W5T A;  1KU9 A;  5A2Q Z;  5F1R A;  1FBU A;  1BI1 A;  2GAU A;  3MQ0 A;  1FLI A;  3T5X A;  2A61 A;  5D5X B;  2ZME A;  2CSO A;  2EA4 A;  1BIB A;  2V1X A;  2OZU A;  2EB7 A;  3GLX A;  3V7S A;  2A6E F;  1IAW A;  4I09 A;  2M1B A;  4G7O F;  3FF5 A;  2LSO A;  2DQR A;  3O3K A;  4AIJ A;  2XAF A;  3B73 A;  2AS5 F;  2WV0 A;  2FBI A;  2UXN A;  1FSE A;  4I02 A;  3I5U A;  2J5O A;  3GEZ A;  1ZRE A;  3F3X A;  1O7F A;  4LLL A;  5JI6 A;  1YTY A;  1U5T B;  1BI0 A;  3E3V A;  2LF7 A;  3TGN A;  3C18 A;  3M8E A;  1XMK A;  3QRF F;  2C6Y A;  1FYK A;  3CJN A;  4I0A A;  2IA2 A;  1H9T A;  1CF7 A;  2IT0 A;  5HVQ C;  2XKO A;  3F8B A;  3J80 K;  1Z7U A;  2EFQ A;  4Y15 A;  4CZZ A;  3L9F A;  3GFI A;  1ZH5 A;  3K2Z A;  3RKX A;  1S6L A;  1W7P D;  1I1S A;  2HZT A;  4XSX F;  1G3Y A;  3P9C A;  5H20 A;  2FEZ A;  4RB3 C;  4KUM A;  4HLY A;  1PUE E;  1XB4 A;  3ZMD A;  3FMR A;  3BPV A;  4BAY A;  4PGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...