4AVPA

Crystal structure of the dna-binding domain of human etv1.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS TRANSLOCATION VARIANT 1
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4avpA00
1T39A 5HLIA 3IC7A 1W7PA 2XHKA 1S3JA 5FLXK 5CYVA 1FPQA 2V9VA 4EV0A 1WQ2A 2DTRA 4WX9A 3R0JA 4P9FA 2KIUA 3OV8A 2JTVA 2A69F 5DV5A 1ZYRF 4Y15A 2FNAA 3ZMSA 2FF4A 2FSWA 5BS6A 2MD5A 5BPDA 4LLLA 1L3LA 1IN8A 1PP7U 3EYYA 3ECOA 4YG2F 2A61A 1TW2A 2XROA 1TBXA 1G6NA 3QAHA 3TQNA 3I64A 1MJAA 1D8JA 1ZRCA 5FFXA 2K02A 3Q9SA 2XVCA 2XIGA 1KQ8A 3P9KA 2HEOA 3I5UA 1G3WA 1JHHA 3MFKA 4Z2YA 4PZJA 3KEOA 5TJJA 3PFIA 1CF7A 3I4PA 3V4GA 4UXNA 4L9VA 1UCRA 5CVUA 4O6JA 3WTSC 4M9SA 3T8TA 3EUHA 4RAYA 3KP7A 1O3TA 2GAUA 5A2QZ 3TDZC 4KICA 3NQOA 4AVPA 1DPUA 1TLHB 1S7AA 2HKOA 2HYGD 4ON0A 3IRRA 2KIFA 3BWGA 3ULQB 2STTA 3JTGA 2FNPA 3RI4A 2MBFA 3IKTA 4HAMA 1LDDA 1SAXA 2CQKA 4GCVA 2EV0A 5CVIA 5ILVA 1J7KA 2CO5A 2A6HF 2HOEA 3M7GA 4KN7X 1ON2A 2OAZA 2VN2A 4BHPA 4HZFA 3N4MA 1K79A 4WXDA 3WU1B 2DLLA 2EFQA 1D8KA 1YW7A 4ETSA 3IL2A 2CWEA 3E6BA 3JAMK 3NRVA 4KIGA 3V7RA 3F8MA 4B8XA 3GX4X 3GO5A 4I0AA 2XAFA 2O61A 3DPTA 1P4AA 3LA7A 1IUYA 4G7OF 3LAJA 3BDDA 3HSRA 5K5OA 3GFLA 4UHTA 1ZLKA 2HKXA 1QO0D 1WRJA 4LD5A 3F6OA 3TO9A 2G7UA 4RGXA 1HW2A 1IN5A 2VOPA 1OYWA 1KU2A 1BBYA 1K78B 1E17A 5CVJA 3REOA 4XLNF 2ZKZA 3JSOA 1FBSA 2DI3A 4LB6B 1MD0A 3J81K 2YSRA 4WCGA 2ZFWA 1FOKA 2JZYA 4EJVA 2EV6A 3RDIA 4OINF 4P5OA 2RN7A 2HQNA 1KQ9A 3F6VA 4ESBA 2RDPA 2G7HA 2KJCA 4PGHA 3RTRA 2VONA 1S8NA 1B6AA 3KP2A 2V79A 3KP6A 5JHUA 4KYWA 1STZA 5CJ9A 4PGGA 1LEAA 3HYIA 3QP6A 3ZP5A 2R7DA 2XAGA 3CTAA 3DV8A 5FB2A 3ML6A 1S29A 4AIHA 1O7LA 4F7ZA 4O3MA 3JAMZ 1BN5A 4ZYHA 5LRRA 3U2RA 3BZ6A 3ZN0A 2E7XA 3BP8A 4NB5A 4E70A 1DP7P 2PFBA 3HIFA 1SMYF 2IJLA 5ICFA 4IXAA 1BI0A 2HR3A 1P2FA 4EVIA 2ESHA 3WODF 2GA1A 3TKYA 2EK5A 1YS7A 1QZZA 2D1VA 2J5OA 3WGGA 4DQ2A 4L9TA 2ESNA 2P5KA 1ZN2A 1XCBA 5IT3A 2DQLA 3ERED 2ZCWA 2O6GE 5E18F 3P9IA 4HX7A 3FZVA 2EFNA 4CDGA 4S04A 3TO6A 4EM1A 2KJBA 2OU2A 1R36A 5J8FA 3EYIA 2E1CA 4A12A 3T5XA 2LKPA 2Y75A 2IA0A 3HRUA 4MNUA 4ENKA 2W84A 4PCQA 5DDGA 3G3ZA 3J81Z 5D5UB 3FM5A 4KT5C 3FWEA 4LK1F 3CO6C 5EEHA 4YFNF 2LDUA 5ERIA 1FYKA 2DAOA 1HKSA 1HQCA 1IRGA 3VEPA 3ZN1A 1PDNC 5LGUA 1HXDA 1UFMA 4HQEA 2EJRA 1VTNC 4AWXB 4D0PA 3ZPLA 4MGRA 1Z6TA 2MLKA 5K5RA 3Q5FA 3MEXA 2GQQA 1J2XA 5AIQA 1SFUA 3TO7A 3U9GA 5HDKA 1H0MA 4NHJA 2FOKA 2UZKA 2MLGA 2GXBA 1R7JA 1P4XA 3ZMDA 2FBHA 2YX4A 2B0LA 2FE3A 3BJ6A 2DO7A 1MDMA 2LNBA 2Z33A 3C7JA 3R4KA 2COMA 2Z5UA 3WG9A 2HQRA 3F8NA 1C0WA 2PI0A 1MJBA 3IHUA 4LMYA 3V7SA 4HLYA 5FD5A 4OIPF 1T0FA 2EFPA 1R5HA 3FMSA 1RUOA 2QBYA 2BGCA 3J80Z 3KETA 1OYIA 4CZZA 2P7VB 4EM0B 1LJ9A 5D4RA 3E6DA 2W85A 1OR7A 2H6CA 1ZRFA 3GVAA 2NS0A 1EH7A 2GIVA 2VT2A 3P9CA 2GXGA 1KU3A 3MZHA 5L3EA 4KMUX 2P5LC 5BOXA 2O8XA 4BAYA 2K4BA 1I5ZA 3Q9VA 4WXHA 2FXAA 4BNCA 3U1DA 2D45A 1EH6A 4JBAA 5FD6A 1EH8A 4GYGA 4OIRF 4OU0A 1J59A 4I7HA 1IW7F 4HX4A 5DD4A 3HUGA 1ZG5A 4XRFA 2D1HA 2VE8A 3DF8A 3DQVC 4P9UA 1R5GA 1BOAA 2QQBA 4HA8A 2FMYA 4EGYA 2H94A 3N97A 4ZZDA 1QZYA 3COAC 3HHHA 3FMRA 1O3QA 4RB0A 3B02A 2ZXJA 1ZREA 5BQTA 1WSUA 1LDKB 1RNLA 2EV5A 3KP5A 4R1HA 1OYYA 1B59A 4JQFA 1ZARA 3J7AO 2ISZA 4LGWA 1B1BA 4KIFA 3T1BA 1XCVA 2IW5A 3LA2A 1QNTA 1QGPA 4WWCA 3HTUA 2DK8A 5E1WA 4HQMA 3CUQB 4KA4A 2FQ3A 5L3CA 4GXOA 2P6TA 2VXZA 1G4DA 3DPLC 1HBXG 2Y48A 3VB2A 4TV7A 2LSOA 3S2WA 2V1DA 1XD7A 2QM3A 3M8EA 1O3SA 2QQAA 4CHUA 2IA2A 1BI3A 2A68F 4LJZF 1ZGAA 4LG0A 1SFEA 4UVCA 4YFKF 2M5WA 2Z99A 3I0TA 1IN6A 1I27A 3JTHA 3JSPA 1T6SA 2PJPA 1TNSA 4GYIA 3SFZA 4BQAA 2VOOA 4A5MA 2DPUA 3I71A 2RV8A 4G7HF 1REPC 3HSEA 5JI6A 5DUKA 1LVAA 3FMQA 4ZYGA 4MTEA 1FP2A 1K78A 1S7OA 2ACJA 2Q0OA 5HDGA 4YIFA 3C3WA 3WTZA 5FLXZ 3L7WA 3LQRA 1BIAA 3FF5A 2L54A 2IVMA 1R1UA 2JRTA 2FBIA 2F5FA 3GYHX 2XUBA 3GEZA 3MQ0A 2ZJ2A 2HS5A 2WC2A 1SD6A 4RAZA 1FY7A 5F6FA 2Z9OA 2FBKA 1UB9A 4ENNA 1JGSA 4U0WA 3K1PA 2F5EA 2CGPA 3KCCA 4R79A 1JXSA 2OZUA 4BHBA 3E5UA 3DP7A 1SD4A 3FXUA 4ENMA 1BC8C 1Z05A 2HTSA 2XAQA 4P96A 2OBPA 4EJTA 1J5YA 1XSXA 2K4JA 2PG4A 4EMSA 1U2WA 2EWNA 3WTXC 3V7CA 1Q1HA 1SFXA 1J9IA 3GXOA 3E5XA 1PUEE 5L3DA 2EA4A 2CFXA 3RYPA 1W4MA 2XAJA 4A6DA 1EV7A 2GZWA 2O3FA 5J8CA 4P55A 1B9NA 3QRFF 2E7WA 4MEYF 4IRIA 4UVAA 4Y17A 5DCMA 5IT9K 2GWRA 4ASNA 1USTA 4M6XA 4HDVA 5HS9A 3LSTA 5E1XA 3O3KA 3GZ6A 3ZMUA 1TQIA 3ZMZA 4YFXF 3GFMA 5L3GA 1U8RA 1YIOA 2MH9A 3BJAA 5JVTA 1T98A 2QENA 3G73A 4LB5A 2ISYA 2XRNA 2VT3A 4CO8A 2M45A 4RS8A 2D2WA 4HV5A 2IPQX 1ZG3A 3QPTA 5D6FA 3I59B 1HKQA 2F5DA 2XKOA 4ESFA 4MHGA 4R8HA 1IN7A 1I1GA 5FO5A 3KP4A 1DDNA 4A0XA 1IXRC 2AS5F 2VC1A 4CICA 4UVBA 2RVCA 2RC4A 1B9MA 3E97A 1TNTA 3DXJF 1OPCA 4HYEA 1RZ4A 3K1NA 4BXUA 3F23A 5BMZA 1ZH5A 5H6RA 1KA8A 1CGPA 5HDNA 2YX7A 4L5JA 3ABUA 5HLGA 3QPHA 5LBQA 5E8GA 3IRQA 1KYWA 2JSCA 4UNOA 3KP3A 4L0ZB 3WTUC 4XBFA 2M87A 4G8XA 1TTYA 5ICEA 4AIKA 3RJPA 2YU3A 4I2OA 2VE9A 4KN4X 2CSOA 5ILUA 1H9TA 2DU9A 1GHCA 1YYVA 5CVRA 2ELHA 4AD9A 1W5TA 2L4AA 4HX8A 5DEQA 5F64A 2NNYA 4RGRA 4WF2A 2P6SA 1FWZA 4OOIA 1BI2A 4U0VA 4FX4A 2ZNYA 1BM9A 2HZTA 2PMHA 5ILSA 2L3DA 5D5XB 4EM2A 3WU0A 1YG2A 3FX3A 2XAHA 2YR2A 1WKMA 1QQIA 1Z1DA 2H6BA 5EEGA 5LEJA 2PQ8A 3DEUA 1G3SA 2L02A 3BPVA 2KKOA 2E1NA 1MGTA 2M8EA 5JR3A 3EETA 3DKWA 5BPIA 3E6CC 3V8LA 1F4KA 5ICGA 3WTWC 3D0SA 2QZ8A 3I58A 3HOTA 4EJUA 1MJ9A 4XLPF 4A0ZA 1I6XA 1FBQA 4L9NA 3K69A 3F22A 3F8CA 2UWMA 4N9IA 2H27A 3F8FA 3M9AA 3L09A 2QUFA 3WTYC 3K2ZA 1YTYA 1F9NA 1Y0UA 3V8JA 3CLOA 5LHHA 1GVJA 3K0LA 2NYXA 3TDUC 1XGNA 1YS6A 4L9JA 1DUXC 4ZYDA 3H92A 3O6BB 1I1SA 1X3UA 2NRAC 1P4WA 4MEXF 3CUQA 2EA2A 3QU3A 1BI1A 5H6QA 2UXXA 3RYRA 2OD5A 4GGGA 5ICCA 3T0YA 2F2EA 1F1ZA 1RI7A 4HF1A 1FZPB 3RKWA 4S05A 1O7FA 4M72A 5K1YA 3CJNA 3RKXA 2DPDA 2IP2A 5J6XA 5DD8A 2BE5F 5HS7A 3R0AA 1FP1D 4UV9A 4L0YB 3GFJA 2FA5A 1PP8F 3MWMA 1SMTA 3I54A 4FX0A 2IA1A 4BHCA 4A2UA 2EFWA 3BY6A 2A3SA 1BJAA 1ZLJA 2HWVA 3ZMVA 1LDJA 4QLCU 5E8IA 4U7BA 1MDMB 1LEBA 4N0BA 1XGOA 5LHGA 1BIBA 1ULYA 1LB2A 2LF7A 4CGZA 1U5TB 4HBLA 5DCFA 3LWFA 1XN7A 4HLXA 5E20A 1ONVA 3K1MA 3K9TA 4U88A 1KU7A 1WWXA 1V4RA 4A0YA 3M1EA 1FBUA 4ZZLA 3T8RA 3BROA 4ESJA 4NQWA 4IHTA 5D5WB 3IWFA 1HW1A 3VODA 4YIIA 4RB1A 3GUDA 1LQ1A 2OQRA 5HS8A 1TQMA 1YW8A 3IWZA 3TOAA 5TRDA 4M9ZA 4IRGA 4JK1X 4OIOF 4KUMA 4MTDA 4G6DA 1KU9A 2XKPA 2W24A 2BEOA 5HLHA 4GO1A 3RPQA 2PEXA 4KMFA 3W6KB 4M6YA 4AIJA 3R6SA 1T2KA 2L4MA 3SHFA 4G6QA 2BBYA 2V1XA 4EGZA 2IRFG 2HDCA 2M1BA 3BJOA 5D4SA 3KEQA 3SZPA 2W57A 1KYZA 2AXLA 3HHGA 3M8FA 3QOPA 2DW4A 2OQGA 2RGVA 1IZ1A 1FYLA 4LFUA 5LLQA 2ZMEB 3SXYA 2MH2A 2M30A 1YW9A 2A5YB 1E2XA 2QWWA 2P5VA 3LFKA 3I53A 1GXQA 2JT1A 3H3UA 2J5PA 2JPBA 4K2EA 4I01A 3ABTA 2V6CA 2KRFA 4G9YA 3DFGA 2PMUA 2L01A 2DK5A 2P4WA 3WE2A 4G94A 4IRHA 3VFZA 1IN4A 1ZRDA 2RQPA 1QPMA 4M74A 3WGIA 1ZGJA 4B09A 2WV0A 5D8KB 1ODDA 2VBZA 2ZNZA 3F21A 2BYVE 1W7PB 4EJWA 1B4AA 4N9HA 4O5VA 2FU4A 4LLNA 5DYMA 1FT9A 4I98B 3AAFA 1YQAA 2QYOA 1L0OC 2ADUA 1K6OA 1R22A 3FXQA 3GF2A 4XSZF 1R00A 5L3BA 1Z9CA 1LNWA 3EQLF 1F5TA 2GA2A 2K27A 1HSJA 2CYYA 3I59A 1J75A 3MAJA 1OKRA 4A6EA 1U78A 4XSXF 2UXNA 1UHMA 1RIOH 1SD5A 2VBYA 4A5NA 2TDXA 6PAXA 2K7LA 4LG0B 2H09A 4IHSA 5LRSA 1JHFA 1Z91A 1XDUA 5D6EA 1O57A 2PLYA 1CF7B 3WGHA 1O3RA 1A04A 4Q4ZF 2O0YA 3WE3A 3C18A 1AWCA 4RB3C 3ISPA 4MQVA 3HOSA 3FHZA 1ZAOA 3KFWX 5D5VB 2IT0A 3HSFA 4L5IA 3MCZA 2Q8KA 5CLSA 3HTSB 4G7ZF 1AOYA 4HV6A 2P7CB 1H9GA 2DT5A 2EB7A 2VODA 5E17F 3HRMA 4HF2A 1FSEA 4Y13A 3QP5A 2HYFA 5HVQC 1XGSA 5LGNA 5LEKA 1P6RA 4QWQA 3F72A 2Z3YA 1TQPA 2DBBA 3LQQA 4BH9A 5D8LB 3RIRA 4M71A 1XSVA 4UV8A 1RUNA 3SZTA 3EDPA 3W6JB 1HSTA 2FMLA 3GWZA 4I02A 4M9XA 2NAZA 5FGMA 4KIBA 1MKMA 2ETHA 1ON1A 4ZYEA 2YPRA 3BPXA 1TW3A 1HW5A 1XMKA 1BC7C 5LGTA 3R60A 1YFHA 3QU6A 1G3YA 1T38A 4RB2C 3E5QA 4Q47A 2WWYA 5E1ZB 2Y0MA 3ZMTA 4EJOA 4CYDA 3NEUA 2V1UA 2OZ6A 3F3XA 2VBWA 2RKHA 3L9FA 3R61A 3HRTA 4KDPA 3E6MA 4IPAA 1FC3A 5AIPA 1GXPA 1U3EM 1XMAA 3PQJA 5IT9Z 3H3ZA 2XGXA 2CG4A 2MC3A 2ZO4A 4IVNA 3ZQ7A 1XB4A 1U5TC 1W5SA 2HGCA 5H20A 2QQ9A 4MQ9F 3J80K 5DCMB 3KE2A 2ZBKA 3GZ5A 4WK8F 3L00A 4L18B 2FEZA 4LK0F 3WTTC 2PBIA 1R58A 3CUQC 4IJAA 3P7NA 3LAPA 3FXRA 1JE8A 1J0RA 4HW0A 2EFOA 1V3FA 2R3SA 4I09A 4U0YA 1SD7A 4EQQA 1MZBA 4Q5SF 3KZYA 2A6EF 3GLXA 3F8BA 2A07F 5L3FA 2PN6A 2QVOA 3KLOA 3LA3A 2P8TA 4DNCA 1D5VA 5LHIA 1IF1A 5K5QA 2DQRA 5CVVA 1YO5C 1IXSB 1KQ0A 4KFCA 2R7FA 3FM3A 1G3TA 1P92A 4HDUA 5ED4A 5KK1A 3RPUA 4U7DA 3BOQA 1XSDA 1R1TA 2LF8A 3SQNA 1ZHFA 1HKTA 2NNNA 1K7AA 1FSHA 3L2CA 4OMZA 4HOBA 2HTJA 4H0EA 1Z7UA 3RKYA 2O03A 3ECHA 4FHTA 3TGNA 1U5TA 4IF4A 2Q2EA 1QBJA 4M73A 4LLGF 4WXCA 2STWA 2OA4A 1FX7A 2XASA 2QLZA 2G9WA 1OMIA 4I0BA 4BYYA 3WTVC 2FRHA 4CXFA 3D5LA 1DPRA 3KLNA 1R23A 1IRFA 1D3YA 2WTEA 4OIQF 1R1VA 5DUIA 2KIMA 3CDHA 4FT8A 3GW2A 3JW4A 2MA3A 2VC0A 4RGSA 1FYMA 4OMYA 3HRSA 1IXCA 1Z6RA 3ROUA 3GFIA 4Q48A 5HOOA 3KZZA 3V8KA 1W7PD 1USSA 3ELKA 5FFZA 4ENJA 1IAWA 2K86A 1UHWA 1XDSA 4ZH4F 5F1RA 1FNNA 3CUOA 5AONA 5KVRA 1YLFA 3C1DA 3TOBA 2VBXA 4UUVA 4PDKA 2CW0F 2XV4S 2BV6A 1FLIA 2ZMEA 3B73A 1WI9A 3VOEA 2RNJA 4RGUA 1NHAA 5JFRA 2F5CA 4HF0A 3O2PE 2HFHA 1U6GA 2JPCA 3CO7C 2W25A 3IKVA 4KNYA 2X4HA 1S6LA 3E3VA 1ZG1A 5A2QK 2DFIA 2X0LA 3PQKA 2QBYB 2C6YA 1KGSA 3OOPA 1XGMA 3MZYA
chains in the Genus database with same CATH superfamily
1W36C 2KQRA 1T39A 3ZQQA 5HLIA 3IC7A 4IKFA 4A3JJ 4IOCF 1W7PA 2XHKA 5J47A 1S3JA 3HOXJ 1OJLA 3OS2A 3FIWA 5CYVA 5FLXK 1FPQA 2V9VA 3FDYA 4EV0A 1W36D 1WQ2A 2JA2A 2DTRA 4WX9A 3HG9A 2O7OA 4II3A 1ETVA 3C2GA 3R0JA 2JA5J 4P9FA 1WH7A 2XGCA 2KIUA 3OV8A 2JTVA 2A69F 2TRTA 1ZYRF 2QKMB 5DV5A 4HRIA 4Y15A 2FNAA 3ZMSA 2FF4A 4C3HJ 3BR6A 2FSWA 5BS6A 2MD5A 1KONA 1MMDA 5FKLA 1T95A 3G2BA 4LLLA 5BPDA 1L3LA 1FIAA 1IN8A 1PP7U 4BGDA 1UG2A 3EYYA 3ECOA 1X4OA 4YG2F 5EG0B 2ZFUA 2A61A 1O4XA 1TW2A 2XROA 2ZSIB 2AQEA 4A3BJ 1TBXA 2XSJC 1G6NA 3QAHA 2JA7J 4BXXJ 3TQNA 1A5JA 2EILH 1PVEA 3X2QH 2KFDA 4FQGA 3W2WA 2LOOA 3OS0A 3I64A 1ACIA 4GDFA 1MJAA 1D8JA 1JT6A 1ZRCA 5FLMJ 5FFXA 2K02A 3S93A 1Z7LA 3M8JA 3Q9SA 2XVCA 2XIGA 5FKKA 3OYHA 4U87A 1KQ8A 3P9KA 3LSJA 2HEOA 3I5UA 3VPRA 1G3WA 1JHHA 3MFKA 5IYBJ 4Z2YA 4PZJA 3KEOA 2MD0A 5TJJA 5IYDJ 3PFIA 2CQQA 4A3KJ 1CF7A 5E3MA 3I4PA 3SEZA 4DZJA 3V4GA 1I3AA 1PUFA 4UXNA 2Z2SB 4L9VA 2PMZA 3D5SC 2DA3A 3Q0UA 1UCRA 1AA7A 4O6JA 5CVUA 4IQJA 1UHSA 1YX5A 1N78A 3WTSC 4M9SA 3SEQA 3T8TA 3EUHA 4OWRB 4AVZA 2ME0A 4RAYA 2DOFA 3KP7A 3GMEA 4CYCA 1O3TA 4DBRA 2GAUA 2OPTA 3MMYB 5A2QZ 3TDZC 4KICA 3NQOA 4AVPA 1DPUA 2WV1A 4BEHA 1TC3C 1TLHB 2LK2A 1S7AA 3L2RA 2HKOA 2HYGD 4ON0A 3IRRA 1D1BA 2WAEA 3PFYA 2VL8A 2EZHA 2KIFA 3I4MJ 1JTYA 3UNGC 4PJLA 3D1NI 3BWGA 3ULQB 2STTA 2CQXA 3JTGA 2CV0A 4BE2A 5FRMA 2FNPA 2LTPA 3BG9A 2W7NA 3RI4A 2MBFA 2XRLA 1I3QJ 3IKTA 2K9NA 2VKEA 4HAMA 3HOUJ 5EEAA 1LDDA 1VQPI 1SAXA 3CC7I 1RPWA 2CQKA 4GCVA 1D1CA 2EV0A 3KPHA 5CVIA 5ILVA 5FJ8J 1J7KA 3ZQHA 4ABZA 2CO5A 3G6EI 2A6HF 4DOZA 5E79C 1X58A 2HOEA 2P0WA 3PSFA 3M7GA 1SANA 4KN7X 1ON2A 2VKVA 2OAZA 2JVHA 1B72B 3CDLA 2VN2A 3OYDA 2WY7Q 4BHPA 4HZFA 3N4MA 3BG6A 1ZELA 1K79A 3I55I 4WXDA 3WU1B 3LSMA 2DLLA 2EFQA 2CMPA 1OCOH 4KISA 1HF0A 1D8KA 1YW7A 4XLCA 4ETSA 5KHDA 3PO3J 2E1MB 3BTLA 3IL2A 2M7BA 3A2KA 2FX0A 2CWEA 1RR7A 3E6BA 4A3EJ 3JAMK 3OR1C 2CW7A 5GAEJ 3NRVA 4KIGA 1QHGA 2XGEA 3DEWA 3F8MA 3V7RA 4B8XA 5H2FC 3GX4X 3GO5A 2JN6A 3H5RA 4I0AA 2XAFA 2ZB9A 1S7EA 2EIKH 2FD5A 4HSRA 2O61A 3DTEA 5FRNA 3DPTA 1P4AA 2ZXWH 1X1AA 3LA7A 1IUYA 3W3CA 2V1NA 1JKPC 3LAJA 4G7OF 3BDDA 3CCYA 3HSRA 5K5OA 2DTZA 1FMWA 1MBHA 3GFLA 3PUFA 4UHTA 3I56I 3JRGA 1SVOA 1ZLKA 2DCEA 2HKXA 4CH7A 2WB1N 1MH3A 3CF2A 3DU6A 1QO0D 1WRJA 4LD5A 3F6OA 2X1CA 2CU7A 1WJFA 5J1YA 3TO9A 1QHHD 2G7UA 4RGXA 3L2WA 1GLNA 3QYEA 1HW2A 3BT9A 1IN5A 2VOPA 1OYWA 1FEXA 1KU2A 2BY1A 4E7KA 1BBYA 3FISA 1K78B 1E17A 5CVJA 3REOA 2LY1A 4XLNF 3WHCA 2ZKZA 4PJNA 1AKHB 3H3VK 1IV8A 3JSOA 1YIJI 2IS2A 1VQOI 2DJNA 1FBSA 2DI3A 4BS9A 4XONA 4LB6B 1MD0A 3J81K 2YSRA 5GTIC 1FOYA 4WCGA 2HOAA 1BW6A 1P7JA 1WI3A 2DA4A 2ZFWA 3K4BA 2JZYA 4EJVA 1FOKA 2EV6A 3RDIA 1VF9A 4OINF 1G8XA 4FASD 4P5OA 3EUKL 3PNYA 4LOCA 4CCLA 3RZOJ 2RN7A 2F5VA 2HQNA 1KQ9A 3F6VA 4ESBA 2RDPA 2G7HA 2KJCA 4ANJA 4PGHA 3RTRA 1Y8QB 1MSEC 2VONA 2CFOA 2F6CA 1R5ID 2ID3A 4ZDPA 2KMUA 1S8NA 3HEFA 1B6AA 3KP2A 2V79A 2HQAA 1G59A 2WY8Q 3DBLB 4RDUA 3KP6A 5JHUA 4KYWA 1STZA 2R92J 3AKZA 2VPLA 5CJ9A 4PGGA 4BY7J 1LEAA 3HYIA 3HGYA 3QP6A 2R7DA 2XAGA 3DV8A 3CTAA 3ZP5A 3M4OJ 5FB2A 2BW3A 2M0CA 3ML6A 2F4IA 2LFBA 4QTRA 1S29A 2PJRA 3TP3A 4AIHA 3FHNA 4XM3A 3AG4H 2VI6A 5GP9A 2DA6A 1O7LA 1MMGA 4F7ZA 3ESWB 4O3MA 3JRIA 3JAMZ 2M8GX 1BN5A 4PSWA 1S72I 4ZYHA 5LRRA 3U2RA 4XR6A 3BZ6A 3FXJA 3ZN0A 2E7XA 2HXIA 1WH5A 3BP8A 4NB5A 4E70A 1DP7P 2PFBA 2L9VA 1Z21A 3HIFA 3AL0C 1SMYF 1DU0A 2EIJH 2IJLA 3PJRA 5ICFA 4IXAA 5B3SH 5F08A 1BI0A 1X2NA 3KZIC 1WFXA 5E3LA 2HR3A 4NDLA 1P2FA 4EVIA 2ESHA 2R5YB 2LG4A 1IDYA 3TL4X 2GA1A 3WODF 1QU3A 3TKYA 2EK5A 1YS7A 1QZZA 4JX4A 2QKLB 2D1VA 2J5OA 1UELB 3WGGA 3W2VA 4DQ2A 1JUPA 2M2EA 4L9TA 2L7FP 2ESNA 4MLOA 1VQNI 2P5KA 4XQFA 1E0EA 3OR2C 1ZN2A 1XCBA 3CCRI 5IT3A 2B9SA 2DQLA 4A3GJ 3ERED 1BR1A 1R71A 2ZCWA 2O6GE 5E18F 3P9IA 1DQUA 2E5NA 4HX7A 4P1WA 3FZVA 2EFNA 1P7IA 5EYRA 5K7HA 1ZR2A 1X4PA 4CDGA 4S04A 4XNFA 3TO6A 4EM1A 2KJBA 1X1BA 2OU2A 1R36A 5J8FA 3EYIA 4C9YA 4BQNA 2E1CA 4A12A 3OYAA 4JOMA 2LKPA 2Y75A 2IA0A 3HRUA 4MNUA 3T5XA 2HVRA 2CUEA 4ENKA 1WZ2A 1FOWA 2L5QA 2W84A 4PCQA 3TBIA 1D1AA 5IY5H 5DDGA 4DBQA 1FMVA 2Y69H 3G3ZA 3J81Z 2LLKA 5D5UB 1YRNA 3CMAI 3FM5A 4KT5C 3FWEA 4A3IJ 1F43A 4LK1F 1TWGJ 4PJMA 3CO6C 5EEHA 1YJ9I 2LVSA 4YFNF 3BLYA 4NC7A 4LG3A 5EGOB 3S16J 4XLAA 1BJZA 1XTAA 2ECCA 2LDUA 5ERIA 2ZJQF 1X19A 1FYKA 1D0XA 5M5YJ 2DAOA 5CQEA 1HKSA 1HQCA 1IRGA 2BXZA 4N4NB 3VEPA 1IJWC 1P9QC 2HNHA 3ZN1A 1PDNC 2X51A 3HC7A 2KP6A 4ZJZA 1HXDA 1UFMA 5LGUA 4HQEA 1OR7C 4DZPA 2EJRA 4XKBA 1VTNC 1LE8A 3S3MA 1EA3A 3K4NA 4V2GA 4AWXB 2LKXA 3S8PA 2DXIA 2E5ZA 4JP0A 3CP2A 2V9KA 4MGRA 1MMAA 4D0PA 2KLOA 3ZPLA 1QVTA 1Z6TA 2MLKA 5K5RA 3Q5FA 3MEXA 2GQQA 2KPMA 2DMPA 1HCRA 1J2XA 2Z1DA 1GT0C 5AIQA 3ZRGA 2L9SA 1FOXA 3A01B 1SFUA 1VQ7I 3TO7A 3U9GA 5HDKA 4OAZA 1H0MA 4NHJA 2FOKA 3K6GA 4L5EA 2UZKA 5F0CA 2MLGA 3CD6I 2GXBA 4XKCA 1R7JA 1P4XA 3RQ4A 1ETKA 3G1MA 3ZMDA 2FBHA 2YX4A 2RQQA 3A03A 2B0LA 3FKJA 4D5FA 3CQZJ 3IAM2 2FE3A 3CF5F 3J7ZI 1D5YA 3BJ6A 2Y2ZA 4JX6A 2BHYA 2DO7A 1MDMA 2LNBA 3OYFA 2Z33A 3C7JA 4M3FA 4UUSA 3G4SI 1OLTA 1YE9A 3R4KA 1DGWY 2COMA 3CMEI 3UKGA 1OCZH 3QPLA 2Z5UA 3WG9A 2JA6J 2HQRA 1JGGA 2BOLA 3F8NA 3MKWB 4HPQA 2O9LA 1C0WA 2PI0A 3HL2A 1MJBA 3IHUA 4IHXA 2VQGA 2W48A 4LMYA 3WU2C 3V7SA 4HLYA 5FD5A 4OIPF 2PMZN 1T0FA 2EFPA 1R5HA 3FMSA 1RUOA 1BOBA 4BJ5C 2QBYA 2BGCA 5LD2C 3J80Z 3GZNB 3KETA 3CCVI 2CJJA 5HLTA 1OYIA 2LBFB 4BY1J 2X6OA 2MSYA 4CZZA 3GBGA 2NS7A 3PNVA 3JRDA 2P7VB 5M5XJ 1Z3YA 4E6KG 2L9RA 4EM0B 4Y52J 1LJ9A 3K70C 4J01A 1SC7A 2EBIA 3HB9A 5D4RA 3E6DA 4B3XA 2W85A 1OR7A 2H6CA 2OTLI 1LFPA 3S32A 3G71I 1EJ9A 1ZRFA 2VKHA 3GVAA 2NS0A 1EH7A 4XN3A 4IO9F 2OJED 2GIVA 2VT2A 3P9CA 3GTGJ 3RKQA 2GXGA 3A0BC 1KU3A 4C3JJ 4X0GA 3MZHA 3CJTB 5L3EA 4KMUX 2P5LC 5BOXA 2O8XA 2XB5A 4BAYA 4EEFG 2K4BA 1I5ZA 3Q9VA 4WXHA 2FXAA 4BNCA 5FKMA 4BJ6C 3QQAA 3IUOA 3U1DA 3H9GA 2D45A 2DT7B 5B66C 5B1BH 1R49A 1EH6A 3TEDA 4JBAA 5FD6A 2A05A 5EG0A 2ELKA 1EH8A 1KZHA 4GYGA 4OIRF 4OU0A 1J59A 3CCJI 4I7HA 2W00A 1IW7F 2E1OA 4HX4A 5DD4A 4KITB 3HUGA 1ZG5A 4XRFA 2D1HA 3LSPA 5GTHC 3H0DA 2VE8A 3GCMA 3DF8A 3DQVC 4E7IA 4P9UA 2CQ7A 2VIXA 2XC7A 3BR5A 1R5GA 1BOAA 2F48A 2R7ZJ 2VQCA 2QQBA 4HA8A 4M3DA 2MG4A 5C3EJ 2FMYA 3W6VA 4EGYA 1Y39A 2H94A 3N97A 4ZZDA 5M3FJ 1XG1A 3FXKA 3GTKJ 1QZYA 1Z3XA 3COAC 3HHHA 3FMRA 3CCUI 5IOZA 1N75A 3ZGKA 2NVTJ 3H5AA 1ZTRA 1NH3A 1O3QA 2Y31A 3B02A 4RB0A 1A31A 3PM1A 2X6YA 4RLFA 2ZXJA 1XC5A 1ZREA 3OY9A 5BQTA 1WSUA 1LDKB 1V54H 3EUHC 1RNLA 4E7HA 2EV5A 2X6WA 3OYCA 1I39A 3KP5A 4R1HA 4H4KC 1YJNI 1OYYA 1B59A 4JQFA 4Y3OA 1ZARA 3J7AO 2ISZA 2GOXB 2OCEA 4LGWA 1B1BA 1A6QA 4KIFA 3T1BA 4AUXA 3CP8A 2L9NA 1XCVA 2CS3A 2DMNA 2IW5A 3LA2A 3A02A 3W2AA 5FKOA 1VQLI 3DEEA 3EPZA 2QF7A 1QNTA 2NVUB 3OYJA 1QGPA 3BCAA 4WWCA 3HTUA 4BDYA 2DK8A 5E1WA 5IP7J 4HQMA 3CUQB 4KA4A 4LITA 2FQ3A 3K4KA 5L3CA 4GXOA 2Z16A 2DFFA 3K4CA 4BBSJ 2P6TA 2VXZA 3AFHA 1G4DA 3DPLC 1HBXG 2Y48A 3K4MA 1S5LC 3VB2A 4TV7A 1H89C 2KRHA 3MVPA 3MZ8A 2LSOA 1JTXA 1B72A 3S2WA 3VYRB 4MO7A 2V1DA 1XD7A 2OC6A 2QM3A 1VQ5I 2LREA 2BVLA 4XK4A 3M8EA 4G12A 3K4JA 1O3SA 2QQAA 4B3AA 4CHUA 3PUBA 2IA2A 1NG6A 1BA5A 1OQYA 1BI3A 4IHWA 4PK4A 2A68F 4LJZF 2XPUA 5C44J 1ZGAA 4JX5A 2NOJB 4LG0A 1SFEA 4UVCA 4YFKF 2M5WA 2V9PA 2EIMH 2Z99A 5EF6A 4DYQA 1R4NB 2LD5A 3I0TA 1YHQI 2HPIA 2GXAA 3LSIA 1IN6A 3K2AA 1I27A 5GPAA 2OCCH 3JTHA 4BE0A 1IRXA 3JSPA 2VLAA 1T6SA 4Y7NJ 1PYVA 2PJPA 1TNSA 4GYIA 2XDVA 3H35A 2CH0A 2ZJPF 3LMMA 3SFZA 3OSFA 4BQAA 1WJBA 2RAEA 2VOOA 4A5MA 2DPUA 3I71A 2RV8A 2OF7A 4G7HF 3BR1A 3ZQFA 1REPC 3HSEA 2X48A 5JI6A 5DUKA 4D7NA 2E2IJ 1LVAA 3FMQA 3GTQJ 2DODA 4ZYGA 4MFEA 2KZGA 4MTEA 1FP2A 1K78A 1B8IB 3HOVJ 4C3IJ 1S7OA 2ACJA 1AKHA 1IC8A 3JRAA 1QZEA 2Q0OA 5HDGA 4YIFA 3C3WA 3WTZA 1MW7A 2LC2A 4IZZA 5FLXZ 2L7ZA 5EZHA 2BXYA 3L7WA 3LQRA 3WG7H 1E3OC 1BIAA 2UV1A 4F3QA 4I99C 1UJ8A 3FF5A 2L54A 4NQWB 1YOVB 2IVMA 5J1UA 1R1UA 2JRTA 2FBIA 2F5FA 3LSHA 3BZCA 3GYHX 2XUBA 1PJRA 4HEA2 3GEZA 3MQ0A 4I6ZA 2ZJ2A 1JT0A 3TW6A 2HS5A 2ZC2A 2WC2A 1DP3A 1SD6A 1OCCH 4RAZA 1FY7A 5F6FA 2BVMA 2MW8A 2Z9OA 1MMNA 2FBKA 4HG2A 2MABA 1UB9A 4ENNA 1RR8C 2KT0A 4BBRJ 1JGSA 4U0WA 3K1PA 2OV7A 2F5EA 1POGA 2CGPA 1E3PA 3KCCA 4R79A 1TT5B 1JXSA 2F4OB 2E36A 1LFUP 2IGKA 2OZUA 4CCKA 2DJIA 4BHBA 3E5UA 3DP7A 1SD4A 2DMUA 3E0JB 3FXUA 1AHDP 4ENMA 1BC8C 4UB8C 4EATA 3FKIJ 3ZXSA 1Z05A 2QSHX 2QQ8A 2HTSA 3CLQA 3SJMA 2XGDA 3JR9A 5JHFA 2XAQA 4P96A 2OBPA 3C2HA 3KYLA 2VQHA 4EJTA 3ZCOA 1H88C 2HXOA 2Y9YA 1J5YA 2R5YA 3GTMJ 1XSXA 2K4JA 4PUSA 4S0HB 2YU9J 2PG4A 3ZOBA 4EMSA 1U2WA 2EWNA 3WTXC 3V7CA 1Q1HA 1SFXA 4FETA 1J9IA 3GXOA 3E5XA 3ZR8X 2K40A 5L3DA 1PUFB 1PUEE 2R7XA 2E2JJ 2EA4A 2CFXA 3RYPA 1W4MA 4PFOA 2XAJA 4A6DA 3OYLA 1EV7A 2GZWA 2M7AA 2Y0SA 2O3FA 2CQNA 5J8CA 1YITI 2Y30A 4P55A 1ETWA 2M4KA 1HC8A 3ZQGA 1B9NA 3QRFF 4B44A 2E7WA 4M3EA 4MEYF 2D5VA 3HOWJ 2K9LA 2WA0A 3MD2A 3CC2I 2VKDA 3DBHB 2G0EA 2JMWA 4IRIA 4UVAA 2FQ4A 4Y17A 4F52A 2IS4A 3VDXA 1T8IA 2K3PA 2PX9A 5DCMA 3TP0A 1JKRC 4J00A 3EUAA 5IT9K 2GWRA 3C2BA 1QRYA 4ASNA 1IRZA 1USTA 4M6XA 2VPRA 3BTCA 4HDVA 2UUZA 5HS9A 3LSTA 5E1XA 1IO2A 2WBMA 5EGOA 3O3KA 3AG1H 3GZ6A 2M4GA 3ZMUA 1TQIA 2L7KA 3ZMZA 4YFXF 5K7FA 4BXFA 3DLLF 5EDNA 4GFBA 3GFMA 5L3GA 1U8RA 2WAQA 1YIOA 4NNJA 1XPXA 2MH9A 3BJAA 5JVTA 1T98A 2QENA 2DA7A 2QA4I 3VYTB 2GM4A 3G73A 4XRSA 4LB5A 2ISYA 2XRNA 2VT3A 4B48A 3K4LA 4CO8A 1X1DA 2M45A 4RS8A 2D2WA 4HV5A 2IPQX 1ZG3A 3QPTA 5D6FA 2AXTC 2DA2A 3I59B 1HKQA 4OAYA 4XLHA 2F5DA 1IGNA 3LFUA 5HNFA 2XKOA 4ESFA 2ME6A 4MHGA 4R8HA 5IOYA 1IN7A 1I1GA 5FO5A 1JKOC 3KP4A 1DDNA 3BR2A 4A0XA 3A01A 1IXRC 2AS5F 2VC1A 2MC4A 4CICA 2K9MA 4UVBA 2RVCA 3I3LA 2R7UA 2RC4A 1B9MA 3B6CA 3E97A 1TNTA 1GDTA 4M6VA 3IV5A 3DXJF 3G1LA 3JRCA 2VJIA 4BKXA 3GTPJ 1OPCA 2DN0A 4HYEA 1RZ4A 3K1NA 4BXUA 1R6RA 3F23A 3CCLI 5BMZA 1ZH5A 5H6RA 2XSDC 1D0YA 3L1PA 5HNHA 2QCOA 1KA8A 2CW8A 1CGPA 5HDNA 1Z67A 1GUUA 2YX7A 3OIPA 3ERMA 4L5JA 3ABUA 5HLGA 1TWHJ 3QPHA 2M3AA 2COBA 5LBQA 2MFZA 5JLXA 4NBQA 5E8GA 1Y8RB 3IRQA 3K7AJ 1I6HJ 5J4VA 1KYWA 3B6AA 3G1OA 2KISA 2JSCA 3GTOJ 1Y6IA 4UNOA 2M9HA 2R93J 3KP3A 5J3LA 1ZR4A 4L0ZB 3WTUC 1YX3A 4XBFA 5GADJ 2M87A 1K4TA 4G8XA 1RESA 1TTYA 4XL9A 1MBGA 1WJCA 4J19A 2DFEA 3HOYJ 1BR2A 5ICEA 4AIKA 2E35A 2IBDA 1T56A 3RJPA 3J7AY 2YU3A 4IHVA 2JJ7A 3HPHA 4I2OA 2LBFA 1VI0A 1T0FC 1VQKI 2HYJA 2X6XA 2VE9A 4KN4X 3TW7A 1T33A 2L0KA 1EF4A 3L2UA 2CSOA 5ILUA 2OUMA 1K6YA 1H9TA 2DU9A 3DWLE 1GHCA 1YYVA 3LSGA 2ELHA 4W97A 5CVRA 4AD9A 1W5TA 2L4AA 2HU9A 4HX8A 3HOZJ 3ABKH 4AM3A 5DEQA 5F64A 1QVUA 2NNYA 1X1PA 4RGRA 1ZGWA 4WF2A 2GOMA 2P6SA 3D5RC 1FWZA 5C4XJ 4OOIA 1BI2A 4U0VA 4FX4A 2ZNYA 3S1RJ 3ABMH 2MYSA 1BM9A 2HZTA 4XKWA 2PMHA 5ILSA 2L3DA 3QOEA 5D5XB 4EM2A 4NC6A 3RQIA 1OCPA 3WU0A 1YG2A 4N4OB 1LKXA 5B5EC 3PO2J 3OOUA 3H0GJ 3FX3A 2XAHA 2YR2A 2QEXI 1WKMA 4X6AJ 1QQIA 1Z1DA 4IL6C 2H6BA 5EEGA 4BACA 5LEJA 4AC0A 2NVQJ 2R7QA 1LPQA 2PQ8A 3DEUA 1G3SA 2L02A 4A3CJ 3OS1A 4HNUA 1J09A 5TISC 4CZCA 3BPVA 1FIPA 2E1NA 2KKOA 1VFCA 1MGTA 2M8EA 5F0HA 5JR3A 1WPKA 2Q1ZB 1X2MA 1TP4A 5E3NA 1V5FA 1DGRM 1WVRA 3EETA 3DKWA 5K7ZA 3QYBA 2I5UA 2K9QA 5BPIA 4NUBA 1UG0A 1TT0A 4HSTA 1GV5A 2XPVA 3E6CC 3V8LA 5FROA 1F4KA 5ICGA 3WTWC 3D0SA 2QZ8A 4XRSG 3FXMA 3I58A 3HOTA 3A1YA 4EJUA 1MJ9A 4I76A 4XLPF 4A0ZA 2HDWA 1I6XA 1FBQA 4L9NA 1X3ZB 3F9KA 2EH3A 3K69A 3F22A 3HZJA 3JRHA 3F8CA 2UWMA 4N9IA 2H27A 3CCQI 3F8FA 5EZGA 3M9AA 3L09A 2QUFA 3WTYC 3K2ZA 1AU7A 1YTYA 1F9NA 2IGMA 2KIQA 3S14J 2VB6A 1Y0UA 1APLC 1K61A 1H8AC 3H9QA 3V8JA 1V55H 3PSIA 3JCUC 2HVSA 3CLOA 3AG2H 5LHHA 1GVJA 3K0LA 3BTIA 4AYBA 2M34A 2BHZA 4RM2A 2NYXA 3TDUC 3VSLA 2Y9ZA 4A93J 4AU7A 1XGNA 5E3OA 1N77A 3A0HC 3H36A 2DA1A 1YS6A 4L9JA 1DU6A 3TMOA 4RA2A 5F27A 2YS9A 1DUXC 2IS6A 4ZYDA 3H92A 3O6BB 1I1SA 1X3UA 2NRAC 2ZJRF 1P4WA 4MEXF 3NWTA 2IXSA 3CUQA 2EA2A 1G2HA 3QU3A 3DKXA 1BI1A 1ERDA 5H6QA 1I50J 3OYEA 1A36A 2V6EA 2UXXA 3RYRA 3U1KA 2OD5A 2ICWG 3P5JA 4GGGA 4F92B 3NWSA 2KZVA 2CUZA 4ZYAA 5ICCA 3T0YA 3JRFA 1VQ9I 2F2EA 1F1ZA 1RI7A 2VJJA 3QYFA 4HF1A 1FZPB 3RKWA 4S05A 4A3DJ 1O7FA 4M72A 5K1YA 3CJNA 3ONQA 1LE8B 4F91B 3RKXA 1ITYA 2DPDA 2IP2A 5GAHJ 5J6XA 4X1EA 3OYMA 5DD8A 2X1EA 2BE5F 5HS7A 2ZSHB 3PIPF 3AL0B 2E19A 1FP1D 3R0AA 4UV9A 3CCMI 1BR4A 4L0YB 1LFBA 2E1MC 3GFJA 1A35A 2FA5A 4DYRA 2O5RA 3DBRB 1PP8F 3KIOA 3MWMA 1SMTA 3I54A 3VYUB 2R5ZB 1XS9A 4QIWN 2HOSA 4FX0A 1IUFA 2IGNA 4XKVA 2IA1A 2LH9A 4BHCA 3OL3A 4E7JA 4A2UA 2EFWA 3BY6A 2A3SA 1BJAA 1ZLJA 2HWVA 3IP4B 3ZMVA 1LDJA 4QLCU 5E8IA 4U7BA 1MDMB 2HVQA 3O8GA 1LEBA 4N0BA 1XGOA 5LHGA 2K9SA 4UUTA 2XB0X 1BIBA 3O8HA 1ULYA 4DIQA 2NOGA 1LB2A 2LF7A 1W0UA 1W1WE 4CGZA 1U5TB 4HBLA 5DCFA 2Q2EB 2FOWA 3ZQLA 3CC4I 3LWFA 3E7LA 1WJ5A 1XN7A 2EPFA 4HLXA 3CESA 2LY9A 2FJ1A 5E20A 3IAS2 4D7MA 1K83J 1ONVA 4CSWA 4FISA 3K1MA 3CCEI 1TZLA 2WADA 3K9TA 4U88A 5KAIC 1KU7A 2LRDA 2W82A 3OYGA 1WWXA 1V4RA 4YRVA 4A0YA 3M1EA 1FBUA 4ZZLA 5FKNA 3T8RA 2Y0SN 1WGXA 3BROA 4ESJA 5IPAA 4NQWA 4IHTA 3IWFA 3VODA 1HW1A 4XLFA 1GV2A 2FUG2 4YIIA 5D5WB 4RB1A 3GUDA 3FBNB 1LQ1A 2JRMA 2OQRA 3OYNA 1UAAA 5HS8A 1TQMA 1YW8A 2NXNB 3IWZA 3HKZA 3TOAA 4E7SA 1ETOA 5TRDA 4M9ZA 3NARA 4IRGA 2EINH 1TWAJ 5J1RA 4JK1X 4OIOF 4KUMA 4MTDA 4G6DA 1KU9A 2VJ5A 2XKPA 4XICA 1YI2I 2W24A 3ZQIA 4BJTA 2BEOA 4LIVA 4CCMA 1SVLA 5HLHA 2DOEA 4GO1A 4RAGA 3SDGA 3RPQA 3JRBA 2PEXA 4KMFA 3W6KB 3HGGA 2ZXIA 4M6YA 4RBOA 4IX7A 3BG7A 3FBIB 4AIJA 1CQTA 3OMYA 3LSRA 1A6IA 3R6SA 1T2KA 2EZIA 2L4MA 5JVGF 3SHFA 4XN0A 3HM5A 4G6QA 2BBYA 1Y1WJ 3SZGA 2JSPA 3BTJA 1FTZA 2V1XA 4EGZA 2IRFG 2HDCA 2WAQN 2M1BA 1NK2P 3BJOA 5D4SA 3KEQA 2AQFA 3SZPA 2W57A 1KYZA 3PNTA 2L2OA 1E3HA 2AXLA 1X3WB 3HHGA 4D9JA 3CMMA 3M8FA 5IP6A 4RAFA 5CKTA 3MKYB 3QOPA 2DW4A 2OQGA 2JUCA 4QSHA 2RGVA 1IZ1A 3HUGB 3LNQA 3BG3A 2HDDA 3S1NJ 1FYLA 4LFUA 5LLQA 3CJRB 4CUGA 2LY2A 5KCMA 2ZMEB 3SXYA 3BCBA 2N8GA 2IEKA 2MH2A 2M30A 1YW9A 2A5YB 3FK7A 1E2XA 2DA5A 3CMYA 2QWWA 1ETQA 2X9DA 2VASA 3HBLA 2P5VA 3LFKA 3I53A 1GXQA 2JT1A 3H3UA 3IH3A 2J5PA 2JPBA 4K2EA 4I01A 3ABTA 2H8RA 2DOAA 2V6CA 2I10A 4E7ZA 2KRFA 4G9YA 4B43A 3DFGA 2PMUA 2L01A 2XF7A 3BR0A 2CRGA 3OSGA 2DK5A 3H9JA 5DM6F 2P4WA 3WE2A 4G94A 2V4JC 4DYCA 3S2DJ 4IRHA 3VFZA 1IN4A 1ZRDA 2CV2A 2RQPA 1QPMA 3VSKA 4RM3A 4M74A 2H1KA 4LIUA 3V42A 5J40A 3WGIA 1ZGJA 2RREA 2YUSA 3ZQCA 4B09A 3DTIA 2WV0A 3SYTA 3SFIA 5J4YA 2AHQA 5D8KB 1ODDA 3S3NA 2VBZA 2ZNZA 3F21A 4PJJA 1ETYA 3OYBA 4V2FA 1FJLA 2BYVE 2X85A 1W7PB 4UB6C 4EJWA 1B4AA 4MFDA 4CA0A 4N9HA 2DYRH 4O5VA 2FU4A 4LLNA 5DYMA 1FT9A 2AO9A 4Z6YA 1RC9A 3BR3A 4I98B 2NVYJ 2E34A 3AAFA 2IGOA 3KEYA 3GTJJ 4FTHA 1YQAA 2QYOA 1UMQA 1L0OC 2ADUA 3DLAA 1M1EB 1K6OA 1R22A 1HA8A 3FXQA 3GF2A 4XSZF 1R00A 5L3BA 1Z9CA 2V26A 1LNWA 4IQ4A 4KT6A 3EQLF 1F5TA 2GA2A 1JJ8C 3L2QA 2K27A 3KYCB 1HSJA 2CYYA 3I59A 4XOTA 4B47A 1J75A 1VZ0A 3MAJA 3OIQA 1OKRA 4KJZA 1RRJA 4A6EA 1U78A 1K4SA 4XSXF 2E71A 2UXNA 1UHMA 1TL8A 2H8WA 1RIOH 1SD5A 2VJ4A 2VBYA 4BQOA 1T08B 1MBKA 1HDDC 2DFHA 1N25A 2HI3A 4A5NA 2DMQA 1MMSA 2TDXA 3HJEA 1RKTA 4Y33A 6PAXA 2F4MB 5BNGA 1VQ4I 2K7LA 1SEUA 2H09A 4LG0B 5HODA 5LRSA 4IHSA 1JHFA 1Z91A 1XDUA 5D6EA 1O57A 2PLYA 2IAIA 2LKSA 1CF7B 3WGHA 1O3RA 1OCTC 4BE1A 1A04A 2BY3A 2NVXJ 4Q4ZF 2O0YA 3WE3A 3C18A 1AWCA 4RB3C 4DJAA 3ISPA 5DS9A 2QSGX 1RKWA 4MQVA 3HOSA 3FHZA 1ZAOA 2K5CA 3KFWX 4G6TB 5D5VB 3RCOA 2R7WA 5CPRB 3BG5A 9ANTA 3OL4A 5F0FA 4C2MJ 3DPUA 2IT0A 3M1CA 2E60A 3HSFA 4L5IA 3SDBA 4CYCB 2LMDA 1SFKA 4YEJA 3MCZA 2Q8KA 5CLSA 3HTSB 4M3BA 4G7ZF 1AOYA 1WJDA 4D5CA 4HV6A 2P7CB 2R4GA 3CZ6A 4BEHB 1H9GA 2DT5A 2EB7A 2VODA 5E17F 4JYKA 3HRMA 4XLEA 4AIDA 4HF2A 1FSEA 4Y13A 3WHBA 4A69C 2HQ5A 2H1LA 3QP5A 2HYFA 5HVQC 3S2HJ 3OIOA 4C30A 1XGSA 2ECBA 5LGNA 5LEKA 1P6RA 2ELJA 4QWQA 3OYKA 3F72A 2Z3YA 5DTDA 3S1QJ 3H1CA 1TQPA 2DBBA 3LQQA 3S15J 4BH9A 4AYBN 5D8LB 3RIRA 4M71A 4BDZA 4DGWB 2CUJA 4FE4A 1MBEA 1XSVA 4UV8A 1RUNA 3SZTA 4DW6A 1LUJB 4ZC3A 3EDPA 2HOTA 4GRIA 3W6JB 1HSTA 2TCTA 1IDZA 3HXLA 2FMLA 3GWZA 5TGTA 2XF6A 1ZKGA 4I02A 4M9XA 4C2UA 3ASNH 4HNVA 3Q0WA 2NAZA 2KRCA 5IYCJ 2KDOA 5FGMA 1NTCA 3PIOF 4KIBA 1MKMA 2ETHA 2EZKA 1ON1A 4IOAF 1MIJA 2JWTA 4ZYEA 1UZCA 2YPRA 3BPXA 4BUPA 5KNLA 2HPMA 1TW3A 2DMTA 4D1QA 1HW5A 1XMKA 1MSFC 3RSNA 4FE7A 2P81A 3ABLH 1MNEA 2M0MA 1BC7C 2A5WA 2DT6A 4C2TA 5LGTA 1EKEA 3DKYA 2VUMJ 3R60A 3BQZA 1YFHA 3LSKA 2QSFX 3QU6A 3UR3C 1JJ6C 1MNDA 4BQQA 1G3YA 4V19K 1T38A 1WJEA 4RB2C 1ENHA 2ID6A 3E5QA 4Q47A 2L7MP 1OFCX 4FCYA 2WWYA 5E1ZB 2Y0MA 3ZMTA 5JLWA 2KDZA 2O8KA 3RZDJ 1RETA 4EJOA 4CYDA 1JUMA 3NEUA 2QGUA 2V1UA 1U9NA 1F36A 4A3FJ 3S1MJ 2OTJI 3E1SA 2OZ6A 3F3XA 4ZDOA 5M5WJ 2VBWA 2RKHA 4NC8A 3IH4A 3L9FA 4ZDLA 3R61A 3U21A 5M3MJ 3L2VA 3VWBA 3MKZA 2LYCA 3FXLA 1ZK8A 3HRTA 3CCSI 5DM7F 2DDBA 4KDPA 3E6MA 4QPOA 2B63J 4IPAA 3HPGA 3RPUD 1FC3A 4W1UA 5AIPA 1GXPA 4F93B 1U3EM 1XMAA 3VYSB 3F0CA 3PQJA 5IT9Z 3H3ZA 4II2A 3FK6A 1W0TA 2XGXA 1HDPA 2CG4A 2MC3A 2ZO4A 4IVNA 2XAUA 3ZQ7A 1XB4A 1U5TC 1VQ6I 1OISA 1W5SA 2HGCA 4CCNA 1Z77A 4PFPA 1R9TJ 5H20A 2QQ9A 4MQ9F 3J80K 5DCMB 5IP9J 3KE2A 3Q3SA 2EZLA 1VQMI 2ZBKA 3GZ5A 3MKLA 3M3YJ 1Y1VJ 3N05A 4WK8F 4A3LJ 3Q0VA 3L00A 3PL8A 4L18B 5LFAA 3LL7A 2FEZA 3CDIA 4M3GA 4LK0F 3WTTC 2PBIA 1R58A 1XMXA 2I8DA 1ORKA 3CUQC 3P7NA 3FXRA 4IJAA 3LAPA 5GPCA 2JVGA 1OCRH 1JE8A 2DYSH 1J0RA 4YELA 4XRMA 4HW0A 3S17J 2EFOA 1JI8A 1V3FA 2R3SA 4I09A 4U0YA 1SD7A 4EQQA 1MZBA 4Q5SF 3KZYA 2A6EF 2X1DA 1W5CC 4CCOA 3GLXA 2RNGA 2BY0A 3F8BA 3NAUA 4IHYA 3HKZN 1NK3P 2A07F 5L3FA 2PN6A 2BW3B 2QVOA 2W4SA 4F55A 3KLOA 1TWCJ 2PJRB 3LA3A 2P8TA 4DNCA 1D5VA 3LOCA 3QPSA 5LHIA 2BZTA 1IF1A 2KL4A 5K5QA 1JKQC 2DQRA 3I4NJ 5CVVA 2GIZA 1YO5C 4XIDA 1IXSB 3DTKA 1KQ0A 4BL0B 2WB1A 4KFCA 2R7RA 2JUGA 1S9HA 1QPIA 2R7FA 3FM3A 3I9V2 2JA8J 2VQLA 4PSXA 2R5ZA 1G3TA 1P92A 4HDUA 5C4JJ 2CUFA 2BY2A 5ED4A 5KK1A 3RPUA 4U7DA 3BOQA 1JUSA 1XSDA 2GBYA 1MBFA 1NG7A 2LP0A 4UY8I 2XPWA 1R1TA 2LF8A 1Y0NA 3BC8A 4RLQA 2ZMEC 3SQNA 1ZHFA 1HKTA 2NNNA 4PJ0C 1K7AA 1LVKA 1FSHA 3L2CA 4OMZA 3MN2A 4HOBA 2HTJA 4H0EA 1Z7UA 3RKYA 2O03A 3ECHA 4FHTA 3TGNA 1U5TA 4IF4A 3HDDA 2Q2EA 1QBJA 1MNMC 4M73A 1XX5A 3GLLA 1Q1VA 4LLGF 5FLVA 2K3FA 4WXCA 2K85A 2STWA 2OA4A 1FX7A 3QODA 4XORA 3BZKA 2XASA 2QLZA 3ASOH 2G9WA 1IG7A 1OMIA 3IH2A 2NS8A 4I0BA 3OWTA 4IEJA 5CQGA 1TWFJ 1YRNB 5EJCA 1U0JA 4BYYA 3WTVC 1U8BA 2FRHA 3A4CA 4CXFA 2HZDA 3D5LA 1DPRA 3KLNA 1R23A 1IRFA 1D3YA 2WTEA 4OIQF 1R1VA 5DUIA 1VNDA 2MGQA 3FXOA 2KIMA 3CDHA 3KYDB 4FT8A 2GLOA 3GW2A 3H5NA 3JW4A 1GVDA 2MA3A 2VC0A 4YIRX 4E4HA 4RGSA 1U9OA 1WCMJ 1FYMA 4OMYA 3HRSA 1IXCA 3K70D 1Z6RA 3KX2A 1Y56A 1BL0A 3ROUA 3GFIA 1BW5A 2XF5A 3K10A 4Q48A 5HOOA 3KZZA 1SFOJ 2R7OA 5KAFC 2JQ7A 3V8KA 1W7PD 1USSA 3ELKA 5FFZA 2R7VA 4MIMA 4ENJA 1IAWA 2K86A 1Z0XA 1UHWA 4Y4RA 3AG3H 1XDSA 5B1AH 2B7EA 4QPQA 4ZH4F 5F1RA 1FNNA 3CUOA 5AONA 5KVRA 2R7SA 3GTLJ 1YLFA 3C1DA 1ZQ3P 3TOBA 3CJQB 4BU2A 4A3MJ 1WJAA 2VBXA 1WHUA 3M07A 2W1OA 1ETXA 4UUVA 4PDKA 1V5EA 2CW0F 2XV4S 2BV6A 1FLIA 1IV6A 2ZMEA 4ZTFA 3B73A 1WI9A 5F1JA 3OYIA 1YJWI 2EQRA 3VOEA 1FTTA 2RNJA 4RGUA 1NHAA 4HNTA 5JFRA 5F04A 2F5CA 4HF0A 2A6TA 3O2PE 4XMYA 2HFHA 1U6GA 4UUSB 4ZTJA 3DCFA 2ZXHA 2KHMA 3QWLA 4CCJA 2JPCA 4E7LA 3BQYA 3CO7C 1HOMA 1VQ8I 2W25A 1MH4A 4RMNA 3IKVA 5GAGJ 4ITVA 1SVMA 1D0ZA 4KNYA 2WAFA 2R0QC 2V7FA 3J7YJ 2X4HA 1B8IA 2CV1A 1S6LA 2LR8A 1MBJA 2DDAA 3E3VA 3DU5A 3S3OA 1ZG1A 4B4CA 5A2QK 2DFIA 1HLVA 1QA6A 4XOPA 2R7TA 2X0LA 3PQKA 2VXDA 2E2HJ 2QBYB 3JREA 2C6YA 1KGSA 1V5GA 3OOPA 1R4MB 1SAUA 1X1CA 1XGMA 2IS1A 2JK3A 3MZYA 4B1RA
chains in the Genus database with same CATH topology
1T39A 5HLIA 3IC7A 1W7PA 2XHKA 1S3JA 5FLXK 5CYVA 1FPQA 2V9VA 4EV0A 1WQ2A 2DTRA 4WX9A 3R0JA 4P9FA 2KIUA 3OV8A 2JTVA 2A69F 5DV5A 1ZYRF 4Y15A 2FNAA 3ZMSA 2FF4A 2FSWA 5BS6A 2MD5A 5BPDA 4LLLA 1L3LA 1IN8A 1PP7U 3EYYA 3ECOA 4YG2F 2A61A 1TW2A 2XROA 1TBXA 1G6NA 3QAHA 3TQNA 3I64A 1MJAA 1D8JA 1ZRCA 5FFXA 2K02A 3Q9SA 2XVCA 2XIGA 1KQ8A 3P9KA 2HEOA 3I5UA 1G3WA 1JHHA 3MFKA 4Z2YA 4PZJA 3KEOA 5TJJA 3PFIA 1CF7A 3I4PA 3V4GA 4UXNA 4L9VA 1UCRA 5CVUA 4O6JA 3WTSC 4M9SA 3T8TA 3EUHA 4RAYA 3KP7A 1O3TA 2GAUA 5A2QZ 3TDZC 4KICA 3NQOA 4AVPA 1DPUA 1TLHB 1S7AA 2HKOA 2HYGD 4ON0A 3IRRA 2KIFA 3BWGA 3ULQB 2STTA 3JTGA 2FNPA 3RI4A 2MBFA 3IKTA 4HAMA 1LDDA 1SAXA 2CQKA 4GCVA 2EV0A 5CVIA 5ILVA 1J7KA 2CO5A 2A6HF 2HOEA 3M7GA 4KN7X 1ON2A 2OAZA 2VN2A 4BHPA 4HZFA 3N4MA 1K79A 4WXDA 3WU1B 2DLLA 2EFQA 1D8KA 1YW7A 4ETSA 3IL2A 2CWEA 3E6BA 3JAMK 3NRVA 4KIGA 3V7RA 3F8MA 4B8XA 3GX4X 3GO5A 4I0AA 2XAFA 2O61A 3DPTA 1P4AA 3LA7A 1IUYA 4G7OF 3LAJA 3BDDA 3HSRA 5K5OA 3GFLA 4UHTA 1ZLKA 2HKXA 1QO0D 1WRJA 4LD5A 3F6OA 3TO9A 2G7UA 4RGXA 1HW2A 1IN5A 2VOPA 1OYWA 1KU2A 1BBYA 1K78B 1E17A 5CVJA 3REOA 4XLNF 2ZKZA 3JSOA 1FBSA 2DI3A 4LB6B 1MD0A 3J81K 2YSRA 4WCGA 2ZFWA 1FOKA 2JZYA 4EJVA 2EV6A 3RDIA 4OINF 4P5OA 2RN7A 2HQNA 1KQ9A 3F6VA 4ESBA 2RDPA 2G7HA 2KJCA 4PGHA 3RTRA 2VONA 1S8NA 1B6AA 3KP2A 2V79A 3KP6A 5JHUA 4KYWA 1STZA 5CJ9A 4PGGA 1LEAA 3HYIA 3QP6A 3ZP5A 2R7DA 2XAGA 3CTAA 3DV8A 5FB2A 3ML6A 1S29A 4AIHA 1O7LA 4F7ZA 4O3MA 3JAMZ 1BN5A 4ZYHA 5LRRA 3U2RA 3BZ6A 3ZN0A 2E7XA 3BP8A 4NB5A 4E70A 1DP7P 2PFBA 3HIFA 1SMYF 2IJLA 5ICFA 4IXAA 1BI0A 2HR3A 1P2FA 4EVIA 2ESHA 3WODF 2GA1A 3TKYA 2EK5A 1YS7A 1QZZA 2D1VA 2J5OA 3WGGA 4DQ2A 4L9TA 2ESNA 2P5KA 1ZN2A 1XCBA 5IT3A 2DQLA 3ERED 2ZCWA 2O6GE 5E18F 3P9IA 4HX7A 3FZVA 2EFNA 4CDGA 4S04A 3TO6A 4EM1A 2KJBA 2OU2A 1R36A 5J8FA 3EYIA 2E1CA 4A12A 3T5XA 2LKPA 2Y75A 2IA0A 3HRUA 4MNUA 4ENKA 2W84A 4PCQA 5DDGA 3G3ZA 3J81Z 5D5UB 3FM5A 4KT5C 3FWEA 4LK1F 3CO6C 5EEHA 4YFNF 2LDUA 5ERIA 1FYKA 2DAOA 1HKSA 1HQCA 1IRGA 3VEPA 3ZN1A 1PDNC 5LGUA 1HXDA 1UFMA 4HQEA 2EJRA 1VTNC 4AWXB 4D0PA 3ZPLA 4MGRA 1Z6TA 2MLKA 5K5RA 3Q5FA 3MEXA 2GQQA 1J2XA 5AIQA 1SFUA 3TO7A 3U9GA 5HDKA 1H0MA 4NHJA 2FOKA 2UZKA 2MLGA 2GXBA 1R7JA 1P4XA 3ZMDA 2FBHA 2YX4A 2B0LA 2FE3A 3BJ6A 2DO7A 1MDMA 2LNBA 2Z33A 3C7JA 3R4KA 2COMA 2Z5UA 3WG9A 2HQRA 3F8NA 1C0WA 2PI0A 1MJBA 3IHUA 4LMYA 3V7SA 4HLYA 5FD5A 4OIPF 1T0FA 2EFPA 1R5HA 3FMSA 1RUOA 2QBYA 2BGCA 3J80Z 3KETA 1OYIA 4CZZA 2P7VB 4EM0B 1LJ9A 5D4RA 3E6DA 2W85A 1OR7A 2H6CA 1ZRFA 3GVAA 2NS0A 1EH7A 2GIVA 2VT2A 3P9CA 2GXGA 1KU3A 3MZHA 5L3EA 4KMUX 2P5LC 5BOXA 2O8XA 4BAYA 2K4BA 1I5ZA 3Q9VA 4WXHA 2FXAA 4BNCA 3U1DA 2D45A 1EH6A 4JBAA 5FD6A 1EH8A 4GYGA 4OIRF 4OU0A 1J59A 4I7HA 1IW7F 4HX4A 5DD4A 3HUGA 1ZG5A 4XRFA 2D1HA 2VE8A 3DF8A 3DQVC 4P9UA 1R5GA 1BOAA 2QQBA 4HA8A 2FMYA 4EGYA 2H94A 3N97A 4ZZDA 1QZYA 3COAC 3HHHA 3FMRA 1O3QA 4RB0A 3B02A 2ZXJA 1ZREA 5BQTA 1WSUA 1LDKB 1RNLA 2EV5A 3KP5A 4R1HA 1OYYA 1B59A 4JQFA 1ZARA 3J7AO 2ISZA 4LGWA 1B1BA 4KIFA 3T1BA 1XCVA 2IW5A 3LA2A 1QNTA 1QGPA 4WWCA 3HTUA 2DK8A 5E1WA 4HQMA 3CUQB 4KA4A 2FQ3A 5L3CA 4GXOA 2P6TA 2VXZA 1G4DA 3DPLC 1HBXG 2Y48A 3VB2A 4TV7A 2LSOA 3S2WA 2V1DA 1XD7A 2QM3A 3M8EA 1O3SA 2QQAA 4CHUA 2IA2A 1BI3A 2A68F 4LJZF 1ZGAA 4LG0A 1SFEA 4UVCA 4YFKF 2M5WA 2Z99A 3I0TA 1IN6A 1I27A 3JTHA 3JSPA 1T6SA 2PJPA 1TNSA 4GYIA 3SFZA 4BQAA 2VOOA 4A5MA 2DPUA 3I71A 2RV8A 4G7HF 1REPC 3HSEA 5JI6A 5DUKA 1LVAA 3FMQA 4ZYGA 4MTEA 1FP2A 1K78A 1S7OA 2ACJA 2Q0OA 5HDGA 4YIFA 3C3WA 3WTZA 5FLXZ 3L7WA 3LQRA 1BIAA 3FF5A 2L54A 2IVMA 1R1UA 2JRTA 2FBIA 2F5FA 3GYHX 2XUBA 3GEZA 3MQ0A 2ZJ2A 2HS5A 2WC2A 1SD6A 4RAZA 1FY7A 5F6FA 2Z9OA 2FBKA 1UB9A 4ENNA 1JGSA 4U0WA 3K1PA 2F5EA 2CGPA 3KCCA 4R79A 1JXSA 2OZUA 4BHBA 3E5UA 3DP7A 1SD4A 3FXUA 4ENMA 1BC8C 1Z05A 2HTSA 2XAQA 4P96A 2OBPA 4EJTA 1J5YA 1XSXA 2K4JA 2PG4A 4EMSA 1U2WA 2EWNA 3WTXC 3V7CA 1Q1HA 1SFXA 1J9IA 3GXOA 3E5XA 1PUEE 5L3DA 2EA4A 2CFXA 3RYPA 1W4MA 2XAJA 4A6DA 1EV7A 2GZWA 2O3FA 5J8CA 4P55A 1B9NA 3QRFF 2E7WA 4MEYF 4IRIA 4UVAA 4Y17A 5DCMA 5IT9K 2GWRA 4ASNA 1USTA 4M6XA 4HDVA 5HS9A 3LSTA 5E1XA 3O3KA 3GZ6A 3ZMUA 1TQIA 3ZMZA 4YFXF 3GFMA 5L3GA 1U8RA 1YIOA 2MH9A 3BJAA 5JVTA 1T98A 2QENA 3G73A 4LB5A 2ISYA 2XRNA 2VT3A 4CO8A 2M45A 4RS8A 2D2WA 4HV5A 2IPQX 1ZG3A 3QPTA 5D6FA 3I59B 1HKQA 2F5DA 2XKOA 4ESFA 4MHGA 4R8HA 1IN7A 1I1GA 5FO5A 3KP4A 1DDNA 4A0XA 1IXRC 2AS5F 2VC1A 4CICA 4UVBA 2RVCA 2RC4A 1B9MA 3E97A 1TNTA 3DXJF 1OPCA 4HYEA 1RZ4A 3K1NA 4BXUA 3F23A 5BMZA 1ZH5A 5H6RA 1KA8A 1CGPA 5HDNA 2YX7A 4L5JA 3ABUA 5HLGA 3QPHA 5LBQA 5E8GA 3IRQA 1KYWA 2JSCA 4UNOA 3KP3A 4L0ZB 3WTUC 4XBFA 2M87A 4G8XA 1TTYA 5ICEA 4AIKA 3RJPA 2YU3A 4I2OA 2VE9A 4KN4X 2CSOA 5ILUA 1H9TA 2DU9A 1GHCA 1YYVA 5CVRA 2ELHA 4AD9A 1W5TA 2L4AA 4HX8A 5DEQA 5F64A 2NNYA 4RGRA 4WF2A 2P6SA 1FWZA 4OOIA 1BI2A 4U0VA 4FX4A 2ZNYA 1BM9A 2HZTA 2PMHA 5ILSA 2L3DA 5D5XB 4EM2A 3WU0A 1YG2A 3FX3A 2XAHA 2YR2A 1WKMA 1QQIA 1Z1DA 2H6BA 5EEGA 5LEJA 2PQ8A 3DEUA 1G3SA 2L02A 3BPVA 2KKOA 2E1NA 1MGTA 2M8EA 5JR3A 3EETA 3DKWA 5BPIA 3E6CC 3V8LA 1F4KA 5ICGA 3WTWC 3D0SA 2QZ8A 3I58A 3HOTA 4EJUA 1MJ9A 4XLPF 4A0ZA 1I6XA 1FBQA 4L9NA 3K69A 3F22A 3F8CA 2UWMA 4N9IA 2H27A 3F8FA 3M9AA 3L09A 2QUFA 3WTYC 3K2ZA 1YTYA 1F9NA 1Y0UA 3V8JA 3CLOA 5LHHA 1GVJA 3K0LA 2NYXA 3TDUC 1XGNA 1YS6A 4L9JA 1DUXC 4ZYDA 3H92A 3O6BB 1I1SA 1X3UA 2NRAC 1P4WA 4MEXF 3CUQA 2EA2A 3QU3A 1BI1A 5H6QA 2UXXA 3RYRA 2OD5A 4GGGA 5ICCA 3T0YA 2F2EA 1F1ZA 1RI7A 4HF1A 1FZPB 3RKWA 4S05A 1O7FA 4M72A 5K1YA 3CJNA 3RKXA 2DPDA 2IP2A 5J6XA 5DD8A 2BE5F 5HS7A 3R0AA 1FP1D 4UV9A 4L0YB 3GFJA 2FA5A 1PP8F 3MWMA 1SMTA 3I54A 4FX0A 2IA1A 4BHCA 4A2UA 2EFWA 3BY6A 2A3SA 1BJAA 1ZLJA 2HWVA 3ZMVA 1LDJA 4QLCU 5E8IA 4U7BA 1MDMB 1LEBA 4N0BA 1XGOA 5LHGA 1BIBA 1ULYA 1LB2A 2LF7A 4CGZA 1U5TB 4HBLA 5DCFA 3LWFA 1XN7A 4HLXA 5E20A 1ONVA 3K1MA 3K9TA 4U88A 1KU7A 1WWXA 1V4RA 4A0YA 3M1EA 1FBUA 4ZZLA 3T8RA 3BROA 4ESJA 4NQWA 4IHTA 5D5WB 3IWFA 1HW1A 3VODA 4YIIA 4RB1A 3GUDA 1LQ1A 2OQRA 5HS8A 1TQMA 1YW8A 3IWZA 3TOAA 5TRDA 4M9ZA 4IRGA 4JK1X 4OIOF 4KUMA 4MTDA 4G6DA 1KU9A 2XKPA 2W24A 2BEOA 5HLHA 4GO1A 3RPQA 2PEXA 4KMFA 3W6KB 4M6YA 4AIJA 3R6SA 1T2KA 2L4MA 3SHFA 4G6QA 2BBYA 2V1XA 4EGZA 2IRFG 2HDCA 2M1BA 3BJOA 5D4SA 3KEQA 3SZPA 2W57A 1KYZA 2AXLA 3HHGA 3M8FA 3QOPA 2DW4A 2OQGA 2RGVA 1IZ1A 1FYLA 4LFUA 5LLQA 2ZMEB 3SXYA 2MH2A 2M30A 1YW9A 2A5YB 1E2XA 2QWWA 2P5VA 3LFKA 3I53A 1GXQA 2JT1A 3H3UA 2J5PA 2JPBA 4K2EA 4I01A 3ABTA 2V6CA 2KRFA 4G9YA 3DFGA 2PMUA 2L01A 2DK5A 2P4WA 3WE2A 4G94A 4IRHA 3VFZA 1IN4A 1ZRDA 2RQPA 1QPMA 4M74A 3WGIA 1ZGJA 4B09A 2WV0A 5D8KB 1ODDA 2VBZA 2ZNZA 3F21A 2BYVE 1W7PB 4EJWA 1B4AA 4N9HA 4O5VA 2FU4A 4LLNA 5DYMA 1FT9A 4I98B 3AAFA 1YQAA 2QYOA 1L0OC 2ADUA 1K6OA 1R22A 3FXQA 3GF2A 4XSZF 1R00A 5L3BA 1Z9CA 1LNWA 3EQLF 1F5TA 2GA2A 2K27A 1HSJA 2CYYA 3I59A 1J75A 3MAJA 1OKRA 4A6EA 1U78A 4XSXF 2UXNA 1UHMA 1RIOH 1SD5A 2VBYA 4A5NA 2TDXA 6PAXA 2K7LA 4LG0B 2H09A 4IHSA 5LRSA 1JHFA 1Z91A 1XDUA 5D6EA 1O57A 2PLYA 1CF7B 3WGHA 1O3RA 1A04A 4Q4ZF 2O0YA 3WE3A 3C18A 1AWCA 4RB3C 3ISPA 4MQVA 3HOSA 3FHZA 1ZAOA 3KFWX 5D5VB 2IT0A 3HSFA 4L5IA 3MCZA 2Q8KA 5CLSA 3HTSB 4G7ZF 1AOYA 4HV6A 2P7CB 1H9GA 2DT5A 2EB7A 2VODA 5E17F 3HRMA 4HF2A 1FSEA 4Y13A 3QP5A 2HYFA 5HVQC 1XGSA 5LGNA 5LEKA 1P6RA 4QWQA 3F72A 2Z3YA 1TQPA 2DBBA 3LQQA 4BH9A 5D8LB 3RIRA 4M71A 1XSVA 4UV8A 1RUNA 3SZTA 3EDPA 3W6JB 1HSTA 2FMLA 3GWZA 4I02A 4M9XA 2NAZA 5FGMA 4KIBA 1MKMA 2ETHA 1ON1A 4ZYEA 2YPRA 3BPXA 1TW3A 1HW5A 1XMKA 1BC7C 5LGTA 3R60A 1YFHA 3QU6A 1G3YA 1T38A 4RB2C 3E5QA 4Q47A 2WWYA 5E1ZB 2Y0MA 3ZMTA 4EJOA 4CYDA 3NEUA 2V1UA 2OZ6A 3F3XA 2VBWA 2RKHA 3L9FA 3R61A 3HRTA 4KDPA 3E6MA 4IPAA 1FC3A 5AIPA 1GXPA 1U3EM 1XMAA 3PQJA 5IT9Z 3H3ZA 2XGXA 2CG4A 2MC3A 2ZO4A 4IVNA 3ZQ7A 1XB4A 1U5TC 1W5SA 2HGCA 5H20A 2QQ9A 4MQ9F 3J80K 5DCMB 3KE2A 2ZBKA 3GZ5A 4WK8F 3L00A 4L18B 2FEZA 4LK0F 3WTTC 2PBIA 1R58A 3CUQC 4IJAA 3P7NA 3LAPA 3FXRA 1JE8A 1J0RA 4HW0A 2EFOA 1V3FA 2R3SA 4I09A 4U0YA 1SD7A 4EQQA 1MZBA 4Q5SF 3KZYA 2A6EF 3GLXA 3F8BA 2A07F 5L3FA 2PN6A 2QVOA 3KLOA 3LA3A 2P8TA 4DNCA 1D5VA 5LHIA 1IF1A 5K5QA 2DQRA 5CVVA 1YO5C 1IXSB 1KQ0A 4KFCA 2R7FA 3FM3A 1G3TA 1P92A 4HDUA 5ED4A 5KK1A 3RPUA 4U7DA 3BOQA 1XSDA 1R1TA 2LF8A 3SQNA 1ZHFA 1HKTA 2NNNA 1K7AA 1FSHA 3L2CA 4OMZA 4HOBA 2HTJA 4H0EA 1Z7UA 3RKYA 2O03A 3ECHA 4FHTA 3TGNA 1U5TA 4IF4A 2Q2EA 1QBJA 4M73A 4LLGF 4WXCA 2STWA 2OA4A 1FX7A 2XASA 2QLZA 2G9WA 1OMIA 4I0BA 4BYYA 3WTVC 2FRHA 4CXFA 3D5LA 1DPRA 3KLNA 1R23A 1IRFA 1D3YA 2WTEA 4OIQF 1R1VA 5DUIA 2KIMA 3CDHA 4FT8A 3GW2A 3JW4A 2MA3A 2VC0A 4RGSA 1FYMA 4OMYA 3HRSA 1IXCA 1Z6RA 3ROUA 3GFIA 4Q48A 5HOOA 3KZZA 3V8KA 1W7PD 1USSA 3ELKA 5FFZA 4ENJA 1IAWA 2K86A 1UHWA 1XDSA 4ZH4F 5F1RA 1FNNA 3CUOA 5AONA 5KVRA 1YLFA 3C1DA 3TOBA 2VBXA 4UUVA 4PDKA 2CW0F 2XV4S 2BV6A 1FLIA 2ZMEA 3B73A 1WI9A 3VOEA 2RNJA 4RGUA 1NHAA 5JFRA 2F5CA 4HF0A 3O2PE 2HFHA 1U6GA 2JPCA 3CO7C 2W25A 3IKVA 4KNYA 2X4HA 1S6LA 3E3VA 1ZG1A 5A2QK 2DFIA 2X0LA 3PQKA 2QBYB 2C6YA 1KGSA 3OOPA 1XGMA 3MZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T39 A;  5HLI A;  3IC7 A;  1W7P A;  2XHK A;  1S3J A;  5FLX K;  5CYV A;  1FPQ A;  2V9V A;  4EV0 A;  1WQ2 A;  2DTR A;  4WX9 A;  3R0J A;  4P9F A;  2KIU A;  3OV8 A;  2JTV A;  2A69 F;  5DV5 A;  1ZYR F;  4Y15 A;  2FNA A;  3ZMS A;  2FF4 A;  2FSW A;  5BS6 A;  2MD5 A;  5BPD A;  4LLL A;  1L3L A;  1IN8 A;  1PP7 U;  3EYY A;  3ECO A;  4YG2 F;  2A61 A;  1TW2 A;  2XRO A;  1TBX A;  1G6N A;  3QAH A;  3TQN A;  3I64 A;  1MJA A;  1D8J A;  1ZRC A;  5FFX A;  2K02 A;  3Q9S A;  2XVC A;  2XIG A;  1KQ8 A;  3P9K A;  2HEO A;  3I5U A;  1G3W A;  1JHH A;  3MFK A;  4Z2Y A;  4PZJ A;  3KEO A;  5TJJ A;  3PFI A;  1CF7 A;  3I4P A;  3V4G A;  4UXN A;  4L9V A;  1UCR A;  5CVU A;  4O6J A;  3WTS C;  4M9S A;  3T8T A;  3EUH A;  4RAY A;  3KP7 A;  1O3T A;  2GAU A;  5A2Q Z;  3TDZ C;  4KIC A;  3NQO A;  4AVP A;  1DPU A;  1TLH B;  1S7A A;  2HKO A;  2HYG D;  4ON0 A;  3IRR A;  2KIF A;  3BWG A;  3ULQ B;  2STT A;  3JTG A;  2FNP A;  3RI4 A;  2MBF A;  3IKT A;  4HAM A;  1LDD A;  1SAX A;  2CQK A;  4GCV A;  2EV0 A;  5CVI A;  5ILV A;  1J7K A;  2CO5 A;  2A6H F;  2HOE A;  3M7G A;  4KN7 X;  1ON2 A;  2OAZ A;  2VN2 A;  4BHP A;  4HZF A;  3N4M A;  1K79 A;  4WXD A;  3WU1 B;  2DLL A;  2EFQ A;  1D8K A;  1YW7 A;  4ETS A;  3IL2 A;  2CWE A;  3E6B A;  3JAM K;  3NRV A;  4KIG A;  3V7R A;  3F8M A;  4B8X A;  3GX4 X;  3GO5 A;  4I0A A;  2XAF A;  2O61 A;  3DPT A;  1P4A A;  3LA7 A;  1IUY A;  4G7O F;  3LAJ A;  3BDD A;  3HSR A;  5K5O A;  3GFL A;  4UHT A;  1ZLK A;  2HKX A;  1QO0 D;  1WRJ A;  4LD5 A;  3F6O A;  3TO9 A;  2G7U A;  4RGX A;  1HW2 A;  1IN5 A;  2VOP A;  1OYW A;  1KU2 A;  1BBY A;  1K78 B;  1E17 A;  5CVJ A;  3REO A;  4XLN F;  2ZKZ A;  3JSO A;  1FBS A;  2DI3 A;  4LB6 B;  1MD0 A;  3J81 K;  2YSR A;  4WCG A;  2ZFW A;  1FOK A;  2JZY A;  4EJV A;  2EV6 A;  3RDI A;  4OIN F;  4P5O A;  2RN7 A;  2HQN A;  1KQ9 A;  3F6V A;  4ESB A;  2RDP A;  2G7H A;  2KJC A;  4PGH A;  3RTR A;  2VON A;  1S8N A;  1B6A A;  3KP2 A;  2V79 A;  3KP6 A;  5JHU A;  4KYW A;  1STZ A;  5CJ9 A;  4PGG A;  1LEA A;  3HYI A;  3QP6 A;  3ZP5 A;  2R7D A;  2XAG A;  3CTA A;  3DV8 A;  5FB2 A;  3ML6 A;  1S29 A;  4AIH A;  1O7L A;  4F7Z A;  4O3M A;  3JAM Z;  1BN5 A;  4ZYH A;  5LRR A;  3U2R A;  3BZ6 A;  3ZN0 A;  2E7X A;  3BP8 A;  4NB5 A;  4E70 A;  1DP7 P;  2PFB A;  3HIF A;  1SMY F;  2IJL A;  5ICF A;  4IXA A;  1BI0 A;  2HR3 A;  1P2F A;  4EVI A;  2ESH A;  3WOD F;  2GA1 A;  3TKY A;  2EK5 A;  1YS7 A;  1QZZ A;  2D1V A;  2J5O A;  3WGG A;  4DQ2 A;  4L9T A;  2ESN A;  2P5K A;  1ZN2 A;  1XCB A;  5IT3 A;  2DQL A;  3ERE D;  2ZCW A;  2O6G E;  5E18 F;  3P9I A;  4HX7 A;  3FZV A;  2EFN A;  4CDG A;  4S04 A;  3TO6 A;  4EM1 A;  2KJB A;  2OU2 A;  1R36 A;  5J8F A;  3EYI A;  2E1C A;  4A12 A;  3T5X A;  2LKP A;  2Y75 A;  2IA0 A;  3HRU A;  4MNU A;  4ENK A;  2W84 A;  4PCQ A;  5DDG A;  3G3Z A;  3J81 Z;  5D5U B;  3FM5 A;  4KT5 C;  3FWE A;  4LK1 F;  3CO6 C;  5EEH A;  4YFN F;  2LDU A;  5ERI A;  1FYK A;  2DAO A;  1HKS A;  1HQC A;  1IRG A;  3VEP A;  3ZN1 A;  1PDN C;  5LGU A;  1HXD A;  1UFM A;  4HQE A;  2EJR A;  1VTN C;  4AWX B;  4D0P A;  3ZPL A;  4MGR A;  1Z6T A;  2MLK A;  5K5R A;  3Q5F A;  3MEX A;  2GQQ A;  1J2X A;  5AIQ A;  1SFU A;  3TO7 A;  3U9G A;  5HDK A;  1H0M A;  4NHJ A;  2FOK A;  2UZK A;  2MLG A;  2GXB A;  1R7J A;  1P4X A;  3ZMD A;  2FBH A;  2YX4 A;  2B0L A;  2FE3 A;  3BJ6 A;  2DO7 A;  1MDM A;  2LNB A;  2Z33 A;  3C7J A;  3R4K A;  2COM A;  2Z5U A;  3WG9 A;  2HQR A;  3F8N A;  1C0W A;  2PI0 A;  1MJB A;  3IHU A;  4LMY A;  3V7S A;  4HLY A;  5FD5 A;  4OIP F;  1T0F A;  2EFP A;  1R5H A;  3FMS A;  1RUO A;  2QBY A;  2BGC A;  3J80 Z;  3KET A;  1OYI A;  4CZZ A;  2P7V B;  4EM0 B;  1LJ9 A;  5D4R A;  3E6D A;  2W85 A;  1OR7 A;  2H6C A;  1ZRF A;  3GVA A;  2NS0 A;  1EH7 A;  2GIV A;  2VT2 A;  3P9C A;  2GXG A;  1KU3 A;  3MZH A;  5L3E A;  4KMU X;  2P5L C;  5BOX A;  2O8X A;  4BAY A;  2K4B A;  1I5Z A;  3Q9V A;  4WXH A;  2FXA A;  4BNC A;  3U1D A;  2D45 A;  1EH6 A;  4JBA A;  5FD6 A;  1EH8 A;  4GYG A;  4OIR F;  4OU0 A;  1J59 A;  4I7H A;  1IW7 F;  4HX4 A;  5DD4 A;  3HUG A;  1ZG5 A;  4XRF A;  2D1H A;  2VE8 A;  3DF8 A;  3DQV C;  4P9U A;  1R5G A;  1BOA A;  2QQB A;  4HA8 A;  2FMY A;  4EGY A;  2H94 A;  3N97 A;  4ZZD A;  1QZY A;  3COA C;  3HHH A;  3FMR A;  1O3Q A;  4RB0 A;  3B02 A;  2ZXJ A;  1ZRE A;  5BQT A;  1WSU A;  1LDK B;  1RNL A;  2EV5 A;  3KP5 A;  4R1H A;  1OYY A;  1B59 A;  4JQF A;  1ZAR A;  3J7A O;  2ISZ A;  4LGW A;  1B1B A;  4KIF A;  3T1B A;  1XCV A;  2IW5 A;  3LA2 A;  1QNT A;  1QGP A;  4WWC A;  3HTU A;  2DK8 A;  5E1W A;  4HQM A;  3CUQ B;  4KA4 A;  2FQ3 A;  5L3C A;  4GXO A;  2P6T A;  2VXZ A;  1G4D A;  3DPL C;  1HBX G;  2Y48 A;  3VB2 A;  4TV7 A;  2LSO A;  3S2W A;  2V1D A;  1XD7 A;  2QM3 A;  3M8E A;  1O3S A;  2QQA A;  4CHU A;  2IA2 A;  1BI3 A;  2A68 F;  4LJZ F;  1ZGA A;  4LG0 A;  1SFE A;  4UVC A;  4YFK F;  2M5W A;  2Z99 A;  3I0T A;  1IN6 A;  1I27 A;  3JTH A;  3JSP A;  1T6S A;  2PJP A;  1TNS A;  4GYI A;  3SFZ A;  4BQA A;  2VOO A;  4A5M A;  2DPU A;  3I71 A;  2RV8 A;  4G7H F;  1REP C;  3HSE A;  5JI6 A;  5DUK A;  1LVA A;  3FMQ A;  4ZYG A;  4MTE A;  1FP2 A;  1K78 A;  1S7O A;  2ACJ A;  2Q0O A;  5HDG A;  4YIF A;  3C3W A;  3WTZ A;  5FLX Z;  3L7W A;  3LQR A;  1BIA A;  3FF5 A;  2L54 A;  2IVM A;  1R1U A;  2JRT A;  2FBI A;  2F5F A;  3GYH X;  2XUB A;  3GEZ A;  3MQ0 A;  2ZJ2 A;  2HS5 A;  2WC2 A;  1SD6 A;  4RAZ A;  1FY7 A;  5F6F A;  2Z9O A;  2FBK A;  1UB9 A;  4ENN A;  1JGS A;  4U0W A;  3K1P A;  2F5E A;  2CGP A;  3KCC A;  4R79 A;  1JXS A;  2OZU A;  4BHB A;  3E5U A;  3DP7 A;  1SD4 A;  3FXU A;  4ENM A;  1BC8 C;  1Z05 A;  2HTS A;  2XAQ A;  4P96 A;  2OBP A;  4EJT A;  1J5Y A;  1XSX A;  2K4J A;  2PG4 A;  4EMS A;  1U2W A;  2EWN A;  3WTX C;  3V7C A;  1Q1H A;  1SFX A;  1J9I A;  3GXO A;  3E5X A;  1PUE E;  5L3D A;  2EA4 A;  2CFX A;  3RYP A;  1W4M A;  2XAJ A;  4A6D A;  1EV7 A;  2GZW A;  2O3F A;  5J8C A;  4P55 A;  1B9N A;  3QRF F;  2E7W A;  4MEY F;  4IRI A;  4UVA A;  4Y17 A;  5DCM A;  5IT9 K;  2GWR A;  4ASN A;  1UST A;  4M6X A;  4HDV A;  5HS9 A;  3LST A;  5E1X A;  3O3K A;  3GZ6 A;  3ZMU A;  1TQI A;  3ZMZ A;  4YFX F;  3GFM A;  5L3G A;  1U8R A;  1YIO A;  2MH9 A;  3BJA A;  5JVT A;  1T98 A;  2QEN A;  3G73 A;  4LB5 A;  2ISY A;  2XRN A;  2VT3 A;  4CO8 A;  2M45 A;  4RS8 A;  2D2W A;  4HV5 A;  2IPQ X;  1ZG3 A;  3QPT A;  5D6F A;  3I59 B;  1HKQ A;  2F5D A;  2XKO A;  4ESF A;  4MHG A;  4R8H A;  1IN7 A;  1I1G A;  5FO5 A;  3KP4 A;  1DDN A;  4A0X A;  1IXR C;  2AS5 F;  2VC1 A;  4CIC A;  4UVB A;  2RVC A;  2RC4 A;  1B9M A;  3E97 A;  1TNT A;  3DXJ F;  1OPC A;  4HYE A;  1RZ4 A;  3K1N A;  4BXU A;  3F23 A;  5BMZ A;  1ZH5 A;  5H6R A;  1KA8 A;  1CGP A;  5HDN A;  2YX7 A;  4L5J A;  3ABU A;  5HLG A;  3QPH A;  5LBQ A;  5E8G A;  3IRQ A;  1KYW A;  2JSC A;  4UNO A;  3KP3 A;  4L0Z B;  3WTU C;  4XBF A;  2M87 A;  4G8X A;  1TTY A;  5ICE A;  4AIK A;  3RJP A;  2YU3 A;  4I2O A;  2VE9 A;  4KN4 X;  2CSO A;  5ILU A;  1H9T A;  2DU9 A;  1GHC A;  1YYV A;  5CVR A;  2ELH A;  4AD9 A;  1W5T A;  2L4A A;  4HX8 A;  5DEQ A;  5F64 A;  2NNY A;  4RGR A;  4WF2 A;  2P6S A;  1FWZ A;  4OOI A;  1BI2 A;  4U0V A;  4FX4 A;  2ZNY A;  1BM9 A;  2HZT A;  2PMH A;  5ILS A;  2L3D A;  5D5X B;  4EM2 A;  3WU0 A;  1YG2 A;  3FX3 A;  2XAH A;  2YR2 A;  1WKM A;  1QQI A;  1Z1D A;  2H6B A;  5EEG A;  5LEJ A;  2PQ8 A;  3DEU A;  1G3S A;  2L02 A;  3BPV A;  2KKO A;  2E1N A;  1MGT A;  2M8E A;  5JR3 A;  3EET A;  3DKW A;  5BPI A;  3E6C C;  3V8L A;  1F4K A;  5ICG A;  3WTW C;  3D0S A;  2QZ8 A;  3I58 A;  3HOT A;  4EJU A;  1MJ9 A;  4XLP F;  4A0Z A;  1I6X A;  1FBQ A;  4L9N A;  3K69 A;  3F22 A;  3F8C A;  2UWM A;  4N9I A;  2H27 A;  3F8F A;  3M9A A;  3L09 A;  2QUF A;  3WTY C;  3K2Z A;  1YTY A;  1F9N A;  1Y0U A;  3V8J A;  3CLO A;  5LHH A;  1GVJ A;  3K0L A;  2NYX A;  3TDU C;  1XGN A;  1YS6 A;  4L9J A;  1DUX C;  4ZYD A;  3H92 A;  3O6B B;  1I1S A;  1X3U A;  2NRA C;  1P4W A;  4MEX F;  3CUQ A;  2EA2 A;  3QU3 A;  1BI1 A;  5H6Q A;  2UXX A;  3RYR A;  2OD5 A;  4GGG A;  5ICC A;  3T0Y A;  2F2E A;  1F1Z A;  1RI7 A;  4HF1 A;  1FZP B;  3RKW A;  4S05 A;  1O7F A;  4M72 A;  5K1Y A;  3CJN A;  3RKX A;  2DPD A;  2IP2 A;  5J6X A;  5DD8 A;  2BE5 F;  5HS7 A;  3R0A A;  1FP1 D;  4UV9 A;  4L0Y B;  3GFJ A;  2FA5 A;  1PP8 F;  3MWM A;  1SMT A;  3I54 A;  4FX0 A;  2IA1 A;  4BHC A;  4A2U A;  2EFW A;  3BY6 A;  2A3S A;  1BJA A;  1ZLJ A;  2HWV A;  3ZMV A;  1LDJ A;  4QLC U;  5E8I A;  4U7B A;  1MDM B;  1LEB A;  4N0B A;  1XGO A;  5LHG A;  1BIB A;  1ULY A;  1LB2 A;  2LF7 A;  4CGZ A;  1U5T B;  4HBL A;  5DCF A;  3LWF A;  1XN7 A;  4HLX A;  5E20 A;  1ONV A;  3K1M A;  3K9T A;  4U88 A;  1KU7 A;  1WWX A;  1V4R A;  4A0Y A;  3M1E A;  1FBU A;  4ZZL A;  3T8R A;  3BRO A;  4ESJ A;  4NQW A;  4IHT A;  5D5W B;  3IWF A;  1HW1 A;  3VOD A;  4YII A;  4RB1 A;  3GUD A;  1LQ1 A;  2OQR A;  5HS8 A;  1TQM A;  1YW8 A;  3IWZ A;  3TOA A;  5TRD A;  4M9Z A;  4IRG A;  4JK1 X;  4OIO F;  4KUM A;  4MTD A;  4G6D A;  1KU9 A;  2XKP A;  2W24 A;  2BEO A;  5HLH A;  4GO1 A;  3RPQ A;  2PEX A;  4KMF A;  3W6K B;  4M6Y A;  4AIJ A;  3R6S A;  1T2K A;  2L4M A;  3SHF A;  4G6Q A;  2BBY A;  2V1X A;  4EGZ A;  2IRF G;  2HDC A;  2M1B A;  3BJO A;  5D4S A;  3KEQ A;  3SZP A;  2W57 A;  1KYZ A;  2AXL A;  3HHG A;  3M8F A;  3QOP A;  2DW4 A;  2OQG A;  2RGV A;  1IZ1 A;  1FYL A;  4LFU A;  5LLQ A;  2ZME B;  3SXY A;  2MH2 A;  2M30 A;  1YW9 A;  2A5Y B;  1E2X A;  2QWW A;  2P5V A;  3LFK A;  3I53 A;  1GXQ A;  2JT1 A;  3H3U A;  2J5P A;  2JPB A;  4K2E A;  4I01 A;  3ABT A;  2V6C A;  2KRF A;  4G9Y A;  3DFG A;  2PMU A;  2L01 A;  2DK5 A;  2P4W A;  3WE2 A;  4G94 A;  4IRH A;  3VFZ A;  1IN4 A;  1ZRD A;  2RQP A;  1QPM A;  4M74 A;  3WGI A;  1ZGJ A;  4B09 A;  2WV0 A;  5D8K B;  1ODD A;  2VBZ A;  2ZNZ A;  3F21 A;  2BYV E;  1W7P B;  4EJW A;  1B4A A;  4N9H A;  4O5V A;  2FU4 A;  4LLN A;  5DYM A;  1FT9 A;  4I98 B;  3AAF A;  1YQA A;  2QYO A;  1L0O C;  2ADU A;  1K6O A;  1R22 A;  3FXQ A;  3GF2 A;  4XSZ F;  1R00 A;  5L3B A;  1Z9C A;  1LNW A;  3EQL F;  1F5T A;  2GA2 A;  2K27 A;  1HSJ A;  2CYY A;  3I59 A;  1J75 A;  3MAJ A;  1OKR A;  4A6E A;  1U78 A;  4XSX F;  2UXN A;  1UHM A;  1RIO H;  1SD5 A;  2VBY A;  4A5N A;  2TDX A;  6PAX A;  2K7L A;  4LG0 B;  2H09 A;  4IHS A;  5LRS A;  1JHF A;  1Z91 A;  1XDU A;  5D6E A;  1O57 A;  2PLY A;  1CF7 B;  3WGH A;  1O3R A;  1A04 A;  4Q4Z F;  2O0Y A;  3WE3 A;  3C18 A;  1AWC A;  4RB3 C;  3ISP A;  4MQV A;  3HOS A;  3FHZ A;  1ZAO A;  3KFW X;  5D5V B;  2IT0 A;  3HSF A;  4L5I A;  3MCZ A;  2Q8K A;  5CLS A;  3HTS B;  4G7Z F;  1AOY A;  4HV6 A;  2P7C B;  1H9G A;  2DT5 A;  2EB7 A;  2VOD A;  5E17 F;  3HRM A;  4HF2 A;  1FSE A;  4Y13 A;  3QP5 A;  2HYF A;  5HVQ C;  1XGS A;  5LGN A;  5LEK A;  1P6R A;  4QWQ A;  3F72 A;  2Z3Y A;  1TQP A;  2DBB A;  3LQQ A;  4BH9 A;  5D8L B;  3RIR A;  4M71 A;  1XSV A;  4UV8 A;  1RUN A;  3SZT A;  3EDP A;  3W6J B;  1HST A;  2FML A;  3GWZ A;  4I02 A;  4M9X A;  2NAZ A;  5FGM A;  4KIB A;  1MKM A;  2ETH A;  1ON1 A;  4ZYE A;  2YPR A;  3BPX A;  1TW3 A;  1HW5 A;  1XMK A;  1BC7 C;  5LGT A;  3R60 A;  1YFH A;  3QU6 A;  1G3Y A;  1T38 A;  4RB2 C;  3E5Q A;  4Q47 A;  2WWY A;  5E1Z B;  2Y0M A;  3ZMT A;  4EJO A;  4CYD A;  3NEU A;  2V1U A;  2OZ6 A;  3F3X A;  2VBW A;  2RKH A;  3L9F A;  3R61 A;  3HRT A;  4KDP A;  3E6M A;  4IPA A;  1FC3 A;  5AIP A;  1GXP A;  1U3E M;  1XMA A;  3PQJ A;  5IT9 Z;  3H3Z A;  2XGX A;  2CG4 A;  2MC3 A;  2ZO4 A;  4IVN A;  3ZQ7 A;  1XB4 A;  1U5T C;  1W5S A;  2HGC A;  5H20 A;  2QQ9 A;  4MQ9 F;  3J80 K;  5DCM B;  3KE2 A;  2ZBK A;  3GZ5 A;  4WK8 F;  3L00 A;  4L18 B;  2FEZ A;  4LK0 F;  3WTT C;  2PBI A;  1R58 A;  3CUQ C;  4IJA A;  3P7N A;  3LAP A;  3FXR A;  1JE8 A;  1J0R A;  4HW0 A;  2EFO A;  1V3F A;  2R3S A;  4I09 A;  4U0Y A;  1SD7 A;  4EQQ A;  1MZB A;  4Q5S F;  3KZY A;  2A6E F;  3GLX A;  3F8B A;  2A07 F;  5L3F A;  2PN6 A;  2QVO A;  3KLO A;  3LA3 A;  2P8T A;  4DNC A;  1D5V A;  5LHI A;  1IF1 A;  5K5Q A;  2DQR A;  5CVV A;  1YO5 C;  1IXS B;  1KQ0 A;  4KFC A;  2R7F A;  3FM3 A;  1G3T A;  1P92 A;  4HDU A;  5ED4 A;  5KK1 A;  3RPU A;  4U7D A;  3BOQ A;  1XSD A;  1R1T A;  2LF8 A;  3SQN A;  1ZHF A;  1HKT A;  2NNN A;  1K7A A;  1FSH A;  3L2C A;  4OMZ A;  4HOB A;  2HTJ A;  4H0E A;  1Z7U A;  3RKY A;  2O03 A;  3ECH A;  4FHT A;  3TGN A;  1U5T A;  4IF4 A;  2Q2E A;  1QBJ A;  4M73 A;  4LLG F;  4WXC A;  2STW A;  2OA4 A;  1FX7 A;  2XAS A;  2QLZ A;  2G9W A;  1OMI A;  4I0B A;  4BYY A;  3WTV C;  2FRH A;  4CXF A;  3D5L A;  1DPR A;  3KLN A;  1R23 A;  1IRF A;  1D3Y A;  2WTE A;  4OIQ F;  1R1V A;  5DUI A;  2KIM A;  3CDH A;  4FT8 A;  3GW2 A;  3JW4 A;  2MA3 A;  2VC0 A;  4RGS A;  1FYM A;  4OMY A;  3HRS A;  1IXC A;  1Z6R A;  3ROU A;  3GFI A;  4Q48 A;  5HOO A;  3KZZ A;  3V8K A;  1W7P D;  1USS A;  3ELK A;  5FFZ A;  4ENJ A;  1IAW A;  2K86 A;  1UHW A;  1XDS A;  4ZH4 F;  5F1R A;  1FNN A;  3CUO A;  5AON A;  5KVR A;  1YLF A;  3C1D A;  3TOB A;  2VBX A;  4UUV A;  4PDK A;  2CW0 F;  2XV4 S;  2BV6 A;  1FLI A;  2ZME A;  3B73 A;  1WI9 A;  3VOE A;  2RNJ A;  4RGU A;  1NHA A;  5JFR A;  2F5C A;  4HF0 A;  3O2P E;  2HFH A;  1U6G A;  2JPC A;  3CO7 C;  2W25 A;  3IKV A;  4KNY A;  2X4H A;  1S6L A;  3E3V A;  1ZG1 A;  5A2Q K;  2DFI A;  2X0L A;  3PQK A;  2QBY B;  2C6Y A;  1KGS A;  3OOP A;  1XGM A;  3MZY A; 
#chains in the Genus database with same CATH topology
 1W36 C;  2KQR A;  1T39 A;  3ZQQ A;  5HLI A;  3IC7 A;  4IKF A;  4A3J J;  4IOC F;  1W7P A;  2XHK A;  5J47 A;  1S3J A;  3HOX J;  1OJL A;  3OS2 A;  3FIW A;  5CYV A;  5FLX K;  1FPQ A;  2V9V A;  3FDY A;  4EV0 A;  1W36 D;  1WQ2 A;  2JA2 A;  2DTR A;  4WX9 A;  3HG9 A;  2O7O A;  4II3 A;  1ETV A;  3C2G A;  3R0J A;  2JA5 J;  4P9F A;  1WH7 A;  2XGC A;  2KIU A;  3OV8 A;  2JTV A;  2A69 F;  2TRT A;  1ZYR F;  2QKM B;  5DV5 A;  4HRI A;  4Y15 A;  2FNA A;  3ZMS A;  2FF4 A;  4C3H J;  3BR6 A;  2FSW A;  5BS6 A;  2MD5 A;  1KON A;  1MMD A;  5FKL A;  1T95 A;  3G2B A;  4LLL A;  5BPD A;  1L3L A;  1FIA A;  1IN8 A;  1PP7 U;  4BGD A;  1UG2 A;  3EYY A;  3ECO A;  1X4O A;  4YG2 F;  5EG0 B;  2ZFU A;  2A61 A;  1O4X A;  1TW2 A;  2XRO A;  2ZSI B;  2AQE A;  4A3B J;  1TBX A;  2XSJ C;  1G6N A;  3QAH A;  2JA7 J;  4BXX J;  3TQN A;  1A5J A;  2EIL H;  1PVE A;  3X2Q H;  2KFD A;  4FQG A;  3W2W A;  2LOO A;  3OS0 A;  3I64 A;  1ACI A;  4GDF A;  1MJA A;  1D8J A;  1JT6 A;  1ZRC A;  5FLM J;  5FFX A;  2K02 A;  3S93 A;  1Z7L A;  3M8J A;  3Q9S A;  2XVC A;  2XIG A;  5FKK A;  3OYH A;  4U87 A;  1KQ8 A;  3P9K A;  3LSJ A;  2HEO A;  3I5U A;  3VPR A;  1G3W A;  1JHH A;  3MFK A;  5IYB J;  4Z2Y A;  4PZJ A;  3KEO A;  2MD0 A;  5TJJ A;  5IYD J;  3PFI A;  2CQQ A;  4A3K J;  1CF7 A;  5E3M A;  3I4P A;  3SEZ A;  4DZJ A;  3V4G A;  1I3A A;  1PUF A;  4UXN A;  2Z2S B;  4L9V A;  2PMZ A;  3D5S C;  2DA3 A;  3Q0U A;  1UCR A;  1AA7 A;  4O6J A;  5CVU A;  4IQJ A;  1UHS A;  1YX5 A;  1N78 A;  3WTS C;  4M9S A;  3SEQ A;  3T8T A;  3EUH A;  4OWR B;  4AVZ A;  2ME0 A;  4RAY A;  2DOF A;  3KP7 A;  3GME A;  4CYC A;  1O3T A;  4DBR A;  2GAU A;  2OPT A;  3MMY B;  5A2Q Z;  3TDZ C;  4KIC A;  3NQO A;  4AVP A;  1DPU A;  2WV1 A;  4BEH A;  1TC3 C;  1TLH B;  2LK2 A;  1S7A A;  3L2R A;  2HKO A;  2HYG D;  4ON0 A;  3IRR A;  1D1B A;  2WAE A;  3PFY A;  2VL8 A;  2EZH A;  2KIF A;  3I4M J;  1JTY A;  3UNG C;  4PJL A;  3D1N I;  3BWG A;  3ULQ B;  2STT A;  2CQX A;  3JTG A;  2CV0 A;  4BE2 A;  5FRM A;  2FNP A;  2LTP A;  3BG9 A;  2W7N A;  3RI4 A;  2MBF A;  2XRL A;  1I3Q J;  3IKT A;  2K9N A;  2VKE A;  4HAM A;  3HOU J;  5EEA A;  1LDD A;  1VQP I;  1SAX A;  3CC7 I;  1RPW A;  2CQK A;  4GCV A;  1D1C A;  2EV0 A;  3KPH A;  5CVI A;  5ILV A;  5FJ8 J;  1J7K A;  3ZQH A;  4ABZ A;  2CO5 A;  3G6E I;  2A6H F;  4DOZ A;  5E79 C;  1X58 A;  2HOE A;  2P0W A;  3PSF A;  3M7G A;  1SAN A;  4KN7 X;  1ON2 A;  2VKV A;  2OAZ A;  2JVH A;  1B72 B;  3CDL A;  2VN2 A;  3OYD A;  2WY7 Q;  4BHP A;  4HZF A;  3N4M A;  3BG6 A;  1ZEL A;  1K79 A;  3I55 I;  4WXD A;  3WU1 B;  3LSM A;  2DLL A;  2EFQ A;  2CMP A;  1OCO H;  4KIS A;  1HF0 A;  1D8K A;  1YW7 A;  4XLC A;  4ETS A;  5KHD A;  3PO3 J;  2E1M B;  3BTL A;  3IL2 A;  2M7B A;  3A2K A;  2FX0 A;  2CWE A;  1RR7 A;  3E6B A;  4A3E J;  3JAM K;  3OR1 C;  2CW7 A;  5GAE J;  3NRV A;  4KIG A;  1QHG A;  2XGE A;  3DEW A;  3F8M A;  3V7R A;  4B8X A;  5H2F C;  3GX4 X;  3GO5 A;  2JN6 A;  3H5R A;  4I0A A;  2XAF A;  2ZB9 A;  1S7E A;  2EIK H;  2FD5 A;  4HSR A;  2O61 A;  3DTE A;  5FRN A;  3DPT A;  1P4A A;  2ZXW H;  1X1A A;  3LA7 A;  1IUY A;  3W3C A;  2V1N A;  1JKP C;  3LAJ A;  4G7O F;  3BDD A;  3CCY A;  3HSR A;  5K5O A;  2DTZ A;  1FMW A;  1MBH A;  3GFL A;  3PUF A;  4UHT A;  3I56 I;  3JRG A;  1SVO A;  1ZLK A;  2DCE A;  2HKX A;  4CH7 A;  2WB1 N;  1MH3 A;  3CF2 A;  3DU6 A;  1QO0 D;  1WRJ A;  4LD5 A;  3F6O A;  2X1C A;  2CU7 A;  1WJF A;  5J1Y A;  3TO9 A;  1QHH D;  2G7U A;  4RGX A;  3L2W A;  1GLN A;  3QYE A;  1HW2 A;  3BT9 A;  1IN5 A;  2VOP A;  1OYW A;  1FEX A;  1KU2 A;  2BY1 A;  4E7K A;  1BBY A;  3FIS A;  1K78 B;  1E17 A;  5CVJ A;  3REO A;  2LY1 A;  4XLN F;  3WHC A;  2ZKZ A;  4PJN A;  1AKH B;  3H3V K;  1IV8 A;  3JSO A;  1YIJ I;  2IS2 A;  1VQO I;  2DJN A;  1FBS A;  2DI3 A;  4BS9 A;  4XON A;  4LB6 B;  1MD0 A;  3J81 K;  2YSR A;  5GTI C;  1FOY A;  4WCG A;  2HOA A;  1BW6 A;  1P7J A;  1WI3 A;  2DA4 A;  2ZFW A;  3K4B A;  2JZY A;  4EJV A;  1FOK A;  2EV6 A;  3RDI A;  1VF9 A;  4OIN F;  1G8X A;  4FAS D;  4P5O A;  3EUK L;  3PNY A;  4LOC A;  4CCL A;  3RZO J;  2RN7 A;  2F5V A;  2HQN A;  1KQ9 A;  3F6V A;  4ESB A;  2RDP A;  2G7H A;  2KJC A;  4ANJ A;  4PGH A;  3RTR A;  1Y8Q B;  1MSE C;  2VON A;  2CFO A;  2F6C A;  1R5I D;  2ID3 A;  4ZDP A;  2KMU A;  1S8N A;  3HEF A;  1B6A A;  3KP2 A;  2V79 A;  2HQA A;  1G59 A;  2WY8 Q;  3DBL B;  4RDU A;  3KP6 A;  5JHU A;  4KYW A;  1STZ A;  2R92 J;  3AKZ A;  2VPL A;  5CJ9 A;  4PGG A;  4BY7 J;  1LEA A;  3HYI A;  3HGY A;  3QP6 A;  2R7D A;  2XAG A;  3DV8 A;  3CTA A;  3ZP5 A;  3M4O J;  5FB2 A;  2BW3 A;  2M0C A;  3ML6 A;  2F4I A;  2LFB A;  4QTR A;  1S29 A;  2PJR A;  3TP3 A;  4AIH A;  3FHN A;  4XM3 A;  3AG4 H;  2VI6 A;  5GP9 A;  2DA6 A;  1O7L A;  1MMG A;  4F7Z A;  3ESW B;  4O3M A;  3JRI A;  3JAM Z;  2M8G X;  1BN5 A;  4PSW A;  1S72 I;  4ZYH A;  5LRR A;  3U2R A;  4XR6 A;  3BZ6 A;  3FXJ A;  3ZN0 A;  2E7X A;  2HXI A;  1WH5 A;  3BP8 A;  4NB5 A;  4E70 A;  1DP7 P;  2PFB A;  2L9V A;  1Z21 A;  3HIF A;  3AL0 C;  1SMY F;  1DU0 A;  2EIJ H;  2IJL A;  3PJR A;  5ICF A;  4IXA A;  5B3S H;  5F08 A;  1BI0 A;  1X2N A;  3KZI C;  1WFX A;  5E3L A;  2HR3 A;  4NDL A;  1P2F A;  4EVI A;  2ESH A;  2R5Y B;  2LG4 A;  1IDY A;  3TL4 X;  2GA1 A;  3WOD F;  1QU3 A;  3TKY A;  2EK5 A;  1YS7 A;  1QZZ A;  4JX4 A;  2QKL B;  2D1V A;  2J5O A;  1UEL B;  3WGG A;  3W2V A;  4DQ2 A;  1JUP A;  2M2E A;  4L9T A;  2L7F P;  2ESN A;  4MLO A;  1VQN I;  2P5K A;  4XQF A;  1E0E A;  3OR2 C;  1ZN2 A;  1XCB A;  3CCR I;  5IT3 A;  2B9S A;  2DQL A;  4A3G J;  3ERE D;  1BR1 A;  1R71 A;  2ZCW A;  2O6G E;  5E18 F;  3P9I A;  1DQU A;  2E5N A;  4HX7 A;  4P1W A;  3FZV A;  2EFN A;  1P7I A;  5EYR A;  5K7H A;  1ZR2 A;  1X4P A;  4CDG A;  4S04 A;  4XNF A;  3TO6 A;  4EM1 A;  2KJB A;  1X1B A;  2OU2 A;  1R36 A;  5J8F A;  3EYI A;  4C9Y A;  4BQN A;  2E1C A;  4A12 A;  3OYA A;  4JOM A;  2LKP A;  2Y75 A;  2IA0 A;  3HRU A;  4MNU A;  3T5X A;  2HVR A;  2CUE A;  4ENK A;  1WZ2 A;  1FOW A;  2L5Q A;  2W84 A;  4PCQ A;  3TBI A;  1D1A A;  5IY5 H;  5DDG A;  4DBQ A;  1FMV A;  2Y69 H;  3G3Z A;  3J81 Z;  2LLK A;  5D5U B;  1YRN A;  3CMA I;  3FM5 A;  4KT5 C;  3FWE A;  4A3I J;  1F43 A;  4LK1 F;  1TWG J;  4PJM A;  3CO6 C;  5EEH A;  1YJ9 I;  2LVS A;  4YFN F;  3BLY A;  4NC7 A;  4LG3 A;  5EGO B;  3S16 J;  4XLA A;  1BJZ A;  1XTA A;  2ECC A;  2LDU A;  5ERI A;  2ZJQ F;  1X19 A;  1FYK A;  1D0X A;  5M5Y J;  2DAO A;  5CQE A;  1HKS A;  1HQC A;  1IRG A;  2BXZ A;  4N4N B;  3VEP A;  1IJW C;  1P9Q C;  2HNH A;  3ZN1 A;  1PDN C;  2X51 A;  3HC7 A;  2KP6 A;  4ZJZ A;  1HXD A;  1UFM A;  5LGU A;  4HQE A;  1OR7 C;  4DZP A;  2EJR A;  4XKB A;  1VTN C;  1LE8 A;  3S3M A;  1EA3 A;  3K4N A;  4V2G A;  4AWX B;  2LKX A;  3S8P A;  2DXI A;  2E5Z A;  4JP0 A;  3CP2 A;  2V9K A;  4MGR A;  1MMA A;  4D0P A;  2KLO A;  3ZPL A;  1QVT A;  1Z6T A;  2MLK A;  5K5R A;  3Q5F A;  3MEX A;  2GQQ A;  2KPM A;  2DMP A;  1HCR A;  1J2X A;  2Z1D A;  1GT0 C;  5AIQ A;  3ZRG A;  2L9S A;  1FOX A;  3A01 B;  1SFU A;  1VQ7 I;  3TO7 A;  3U9G A;  5HDK A;  4OAZ A;  1H0M A;  4NHJ A;  2FOK A;  3K6G A;  4L5E A;  2UZK A;  5F0C A;  2MLG A;  3CD6 I;  2GXB A;  4XKC A;  1R7J A;  1P4X A;  3RQ4 A;  1ETK A;  3G1M A;  3ZMD A;  2FBH A;  2YX4 A;  2RQQ A;  3A03 A;  2B0L A;  3FKJ A;  4D5F A;  3CQZ J;  3IAM 2;  2FE3 A;  3CF5 F;  3J7Z I;  1D5Y A;  3BJ6 A;  2Y2Z A;  4JX6 A;  2BHY A;  2DO7 A;  1MDM A;  2LNB A;  3OYF A;  2Z33 A;  3C7J A;  4M3F A;  4UUS A;  3G4S I;  1OLT A;  1YE9 A;  3R4K A;  1DGW Y;  2COM A;  3CME I;  3UKG A;  1OCZ H;  3QPL A;  2Z5U A;  3WG9 A;  2JA6 J;  2HQR A;  1JGG A;  2BOL A;  3F8N A;  3MKW B;  4HPQ A;  2O9L A;  1C0W A;  2PI0 A;  3HL2 A;  1MJB A;  3IHU A;  4IHX A;  2VQG A;  2W48 A;  4LMY A;  3WU2 C;  3V7S A;  4HLY A;  5FD5 A;  4OIP F;  2PMZ N;  1T0F A;  2EFP A;  1R5H A;  3FMS A;  1RUO A;  1BOB A;  4BJ5 C;  2QBY A;  2BGC A;  5LD2 C;  3J80 Z;  3GZN B;  3KET A;  3CCV I;  2CJJ A;  5HLT A;  1OYI A;  2LBF B;  4BY1 J;  2X6O A;  2MSY A;  4CZZ A;  3GBG A;  2NS7 A;  3PNV A;  3JRD A;  2P7V B;  5M5X J;  1Z3Y A;  4E6K G;  2L9R A;  4EM0 B;  4Y52 J;  1LJ9 A;  3K70 C;  4J01 A;  1SC7 A;  2EBI A;  3HB9 A;  5D4R A;  3E6D A;  4B3X A;  2W85 A;  1OR7 A;  2H6C A;  2OTL I;  1LFP A;  3S32 A;  3G71 I;  1EJ9 A;  1ZRF A;  2VKH A;  3GVA A;  2NS0 A;  1EH7 A;  4XN3 A;  4IO9 F;  2OJE D;  2GIV A;  2VT2 A;  3P9C A;  3GTG J;  3RKQ A;  2GXG A;  3A0B C;  1KU3 A;  4C3J J;  4X0G A;  3MZH A;  3CJT B;  5L3E A;  4KMU X;  2P5L C;  5BOX A;  2O8X A;  2XB5 A;  4BAY A;  4EEF G;  2K4B A;  1I5Z A;  3Q9V A;  4WXH A;  2FXA A;  4BNC A;  5FKM A;  4BJ6 C;  3QQA A;  3IUO A;  3U1D A;  3H9G A;  2D45 A;  2DT7 B;  5B66 C;  5B1B H;  1R49 A;  1EH6 A;  3TED A;  4JBA A;  5FD6 A;  2A05 A;  5EG0 A;  2ELK A;  1EH8 A;  1KZH A;  4GYG A;  4OIR F;  4OU0 A;  1J59 A;  3CCJ I;  4I7H A;  2W00 A;  1IW7 F;  2E1O A;  4HX4 A;  5DD4 A;  4KIT B;  3HUG A;  1ZG5 A;  4XRF A;  2D1H A;  3LSP A;  5GTH C;  3H0D A;  2VE8 A;  3GCM A;  3DF8 A;  3DQV C;  4E7I A;  4P9U A;  2CQ7 A;  2VIX A;  2XC7 A;  3BR5 A;  1R5G A;  1BOA A;  2F48 A;  2R7Z J;  2VQC A;  2QQB A;  4HA8 A;  4M3D A;  2MG4 A;  5C3E J;  2FMY A;  3W6V A;  4EGY A;  1Y39 A;  2H94 A;  3N97 A;  4ZZD A;  5M3F J;  1XG1 A;  3FXK A;  3GTK J;  1QZY A;  1Z3X A;  3COA C;  3HHH A;  3FMR A;  3CCU I;  5IOZ A;  1N75 A;  3ZGK A;  2NVT J;  3H5A A;  1ZTR A;  1NH3 A;  1O3Q A;  2Y31 A;  3B02 A;  4RB0 A;  1A31 A;  3PM1 A;  2X6Y A;  4RLF A;  2ZXJ A;  1XC5 A;  1ZRE A;  3OY9 A;  5BQT A;  1WSU A;  1LDK B;  1V54 H;  3EUH C;  1RNL A;  4E7H A;  2EV5 A;  2X6W A;  3OYC A;  1I39 A;  3KP5 A;  4R1H A;  4H4K C;  1YJN I;  1OYY A;  1B59 A;  4JQF A;  4Y3O A;  1ZAR A;  3J7A O;  2ISZ A;  2GOX B;  2OCE A;  4LGW A;  1B1B A;  1A6Q A;  4KIF A;  3T1B A;  4AUX A;  3CP8 A;  2L9N A;  1XCV A;  2CS3 A;  2DMN A;  2IW5 A;  3LA2 A;  3A02 A;  3W2A A;  5FKO A;  1VQL I;  3DEE A;  3EPZ A;  2QF7 A;  1QNT A;  2NVU B;  3OYJ A;  1QGP A;  3BCA A;  4WWC A;  3HTU A;  4BDY A;  2DK8 A;  5E1W A;  5IP7 J;  4HQM A;  3CUQ B;  4KA4 A;  4LIT A;  2FQ3 A;  3K4K A;  5L3C A;  4GXO A;  2Z16 A;  2DFF A;  3K4C A;  4BBS J;  2P6T A;  2VXZ A;  3AFH A;  1G4D A;  3DPL C;  1HBX G;  2Y48 A;  3K4M A;  1S5L C;  3VB2 A;  4TV7 A;  1H89 C;  2KRH A;  3MVP A;  3MZ8 A;  2LSO A;  1JTX A;  1B72 A;  3S2W A;  3VYR B;  4MO7 A;  2V1D A;  1XD7 A;  2OC6 A;  2QM3 A;  1VQ5 I;  2LRE A;  2BVL A;  4XK4 A;  3M8E A;  4G12 A;  3K4J A;  1O3S A;  2QQA A;  4B3A A;  4CHU A;  3PUB A;  2IA2 A;  1NG6 A;  1BA5 A;  1OQY A;  1BI3 A;  4IHW A;  4PK4 A;  2A68 F;  4LJZ F;  2XPU A;  5C44 J;  1ZGA A;  4JX5 A;  2NOJ B;  4LG0 A;  1SFE A;  4UVC A;  4YFK F;  2M5W A;  2V9P A;  2EIM H;  2Z99 A;  5EF6 A;  4DYQ A;  1R4N B;  2LD5 A;  3I0T A;  1YHQ I;  2HPI A;  2GXA A;  3LSI A;  1IN6 A;  3K2A A;  1I27 A;  5GPA A;  2OCC H;  3JTH A;  4BE0 A;  1IRX A;  3JSP A;  2VLA A;  1T6S A;  4Y7N J;  1PYV A;  2PJP A;  1TNS A;  4GYI A;  2XDV A;  3H35 A;  2CH0 A;  2ZJP F;  3LMM A;  3SFZ A;  3OSF A;  4BQA A;  1WJB A;  2RAE A;  2VOO A;  4A5M A;  2DPU A;  3I71 A;  2RV8 A;  2OF7 A;  4G7H F;  3BR1 A;  3ZQF A;  1REP C;  3HSE A;  2X48 A;  5JI6 A;  5DUK A;  4D7N A;  2E2I J;  1LVA A;  3FMQ A;  3GTQ J;  2DOD A;  4ZYG A;  4MFE A;  2KZG A;  4MTE A;  1FP2 A;  1K78 A;  1B8I B;  3HOV J;  4C3I J;  1S7O A;  2ACJ A;  1AKH A;  1IC8 A;  3JRA A;  1QZE A;  2Q0O A;  5HDG A;  4YIF A;  3C3W A;  3WTZ A;  1MW7 A;  2LC2 A;  4IZZ A;  5FLX Z;  2L7Z A;  5EZH A;  2BXY A;  3L7W A;  3LQR A;  3WG7 H;  1E3O C;  1BIA A;  2UV1 A;  4F3Q A;  4I99 C;  1UJ8 A;  3FF5 A;  2L54 A;  4NQW B;  1YOV B;  2IVM A;  5J1U A;  1R1U A;  2JRT A;  2FBI A;  2F5F A;  3LSH A;  3BZC A;  3GYH X;  2XUB A;  1PJR A;  4HEA 2;  3GEZ A;  3MQ0 A;  4I6Z A;  2ZJ2 A;  1JT0 A;  3TW6 A;  2HS5 A;  2ZC2 A;  2WC2 A;  1DP3 A;  1SD6 A;  1OCC H;  4RAZ A;  1FY7 A;  5F6F A;  2BVM A;  2MW8 A;  2Z9O A;  1MMN A;  2FBK A;  4HG2 A;  2MAB A;  1UB9 A;  4ENN A;  1RR8 C;  2KT0 A;  4BBR J;  1JGS A;  4U0W A;  3K1P A;  2OV7 A;  2F5E A;  1POG A;  2CGP A;  1E3P A;  3KCC A;  4R79 A;  1TT5 B;  1JXS A;  2F4O B;  2E36 A;  1LFU P;  2IGK A;  2OZU A;  4CCK A;  2DJI A;  4BHB A;  3E5U A;  3DP7 A;  1SD4 A;  2DMU A;  3E0J B;  3FXU A;  1AHD P;  4ENM A;  1BC8 C;  4UB8 C;  4EAT A;  3FKI J;  3ZXS A;  1Z05 A;  2QSH X;  2QQ8 A;  2HTS A;  3CLQ A;  3SJM A;  2XGD A;  3JR9 A;  5JHF A;  2XAQ A;  4P96 A;  2OBP A;  3C2H A;  3KYL A;  2VQH A;  4EJT A;  3ZCO A;  1H88 C;  2HXO A;  2Y9Y A;  1J5Y A;  2R5Y A;  3GTM J;  1XSX A;  2K4J A;  4PUS A;  4S0H B;  2YU9 J;  2PG4 A;  3ZOB A;  4EMS A;  1U2W A;  2EWN A;  3WTX C;  3V7C A;  1Q1H A;  1SFX A;  4FET A;  1J9I A;  3GXO A;  3E5X A;  3ZR8 X;  2K40 A;  5L3D A;  1PUF B;  1PUE E;  2R7X A;  2E2J J;  2EA4 A;  2CFX A;  3RYP A;  1W4M A;  4PFO A;  2XAJ A;  4A6D A;  3OYL A;  1EV7 A;  2GZW A;  2M7A A;  2Y0S A;  2O3F A;  2CQN A;  5J8C A;  1YIT I;  2Y30 A;  4P55 A;  1ETW A;  2M4K A;  1HC8 A;  3ZQG A;  1B9N A;  3QRF F;  4B44 A;  2E7W A;  4M3E A;  4MEY F;  2D5V A;  3HOW J;  2K9L A;  2WA0 A;  3MD2 A;  3CC2 I;  2VKD A;  3DBH B;  2G0E A;  2JMW A;  4IRI A;  4UVA A;  2FQ4 A;  4Y17 A;  4F52 A;  2IS4 A;  3VDX A;  1T8I A;  2K3P A;  2PX9 A;  5DCM A;  3TP0 A;  1JKR C;  4J00 A;  3EUA A;  5IT9 K;  2GWR A;  3C2B A;  1QRY A;  4ASN A;  1IRZ A;  1UST A;  4M6X A;  2VPR A;  3BTC A;  4HDV A;  2UUZ A;  5HS9 A;  3LST A;  5E1X A;  1IO2 A;  2WBM A;  5EGO A;  3O3K A;  3AG1 H;  3GZ6 A;  2M4G A;  3ZMU A;  1TQI A;  2L7K A;  3ZMZ A;  4YFX F;  5K7F A;  4BXF A;  3DLL F;  5EDN A;  4GFB A;  3GFM A;  5L3G A;  1U8R A;  2WAQ A;  1YIO A;  4NNJ A;  1XPX A;  2MH9 A;  3BJA A;  5JVT A;  1T98 A;  2QEN A;  2DA7 A;  2QA4 I;  3VYT B;  2GM4 A;  3G73 A;  4XRS A;  4LB5 A;  2ISY A;  2XRN A;  2VT3 A;  4B48 A;  3K4L A;  4CO8 A;  1X1D A;  2M45 A;  4RS8 A;  2D2W A;  4HV5 A;  2IPQ X;  1ZG3 A;  3QPT A;  5D6F A;  2AXT C;  2DA2 A;  3I59 B;  1HKQ A;  4OAY A;  4XLH A;  2F5D A;  1IGN A;  3LFU A;  5HNF A;  2XKO A;  4ESF A;  2ME6 A;  4MHG A;  4R8H A;  5IOY A;  1IN7 A;  1I1G A;  5FO5 A;  1JKO C;  3KP4 A;  1DDN A;  3BR2 A;  4A0X A;  3A01 A;  1IXR C;  2AS5 F;  2VC1 A;  2MC4 A;  4CIC A;  2K9M A;  4UVB A;  2RVC A;  3I3L A;  2R7U A;  2RC4 A;  1B9M A;  3B6C A;  3E97 A;  1TNT A;  1GDT A;  4M6V A;  3IV5 A;  3DXJ F;  3G1L A;  3JRC A;  2VJI A;  4BKX A;  3GTP J;  1OPC A;  2DN0 A;  4HYE A;  1RZ4 A;  3K1N A;  4BXU A;  1R6R A;  3F23 A;  3CCL I;  5BMZ A;  1ZH5 A;  5H6R A;  2XSD C;  1D0Y A;  3L1P A;  5HNH A;  2QCO A;  1KA8 A;  2CW8 A;  1CGP A;  5HDN A;  1Z67 A;  1GUU A;  2YX7 A;  3OIP A;  3ERM A;  4L5J A;  3ABU A;  5HLG A;  1TWH J;  3QPH A;  2M3A A;  2COB A;  5LBQ A;  2MFZ A;  5JLX A;  4NBQ A;  5E8G A;  1Y8R B;  3IRQ A;  3K7A J;  1I6H J;  5J4V A;  1KYW A;  3B6A A;  3G1O A;  2KIS A;  2JSC A;  3GTO J;  1Y6I A;  4UNO A;  2M9H A;  2R93 J;  3KP3 A;  5J3L A;  1ZR4 A;  4L0Z B;  3WTU C;  1YX3 A;  4XBF A;  5GAD J;  2M87 A;  1K4T A;  4G8X A;  1RES A;  1TTY A;  4XL9 A;  1MBG A;  1WJC A;  4J19 A;  2DFE A;  3HOY J;  1BR2 A;  5ICE A;  4AIK A;  2E35 A;  2IBD A;  1T56 A;  3RJP A;  3J7A Y;  2YU3 A;  4IHV A;  2JJ7 A;  3HPH A;  4I2O A;  2LBF A;  1VI0 A;  1T0F C;  1VQK I;  2HYJ A;  2X6X A;  2VE9 A;  4KN4 X;  3TW7 A;  1T33 A;  2L0K A;  1EF4 A;  3L2U A;  2CSO A;  5ILU A;  2OUM A;  1K6Y A;  1H9T A;  2DU9 A;  3DWL E;  1GHC A;  1YYV A;  3LSG A;  2ELH A;  4W97 A;  5CVR A;  4AD9 A;  1W5T A;  2L4A A;  2HU9 A;  4HX8 A;  3HOZ J;  3ABK H;  4AM3 A;  5DEQ A;  5F64 A;  1QVU A;  2NNY A;  1X1P A;  4RGR A;  1ZGW A;  4WF2 A;  2GOM A;  2P6S A;  3D5R C;  1FWZ A;  5C4X J;  4OOI A;  1BI2 A;  4U0V A;  4FX4 A;  2ZNY A;  3S1R J;  3ABM H;  2MYS A;  1BM9 A;  2HZT A;  4XKW A;  2PMH A;  5ILS A;  2L3D A;  3QOE A;  5D5X B;  4EM2 A;  4NC6 A;  3RQI A;  1OCP A;  3WU0 A;  1YG2 A;  4N4O B;  1LKX A;  5B5E C;  3PO2 J;  3OOU A;  3H0G J;  3FX3 A;  2XAH A;  2YR2 A;  2QEX I;  1WKM A;  4X6A J;  1QQI A;  1Z1D A;  4IL6 C;  2H6B A;  5EEG A;  4BAC A;  5LEJ A;  4AC0 A;  2NVQ J;  2R7Q A;  1LPQ A;  2PQ8 A;  3DEU A;  1G3S A;  2L02 A;  4A3C J;  3OS1 A;  4HNU A;  1J09 A;  5TIS C;  4CZC A;  3BPV A;  1FIP A;  2E1N A;  2KKO A;  1VFC A;  1MGT A;  2M8E A;  5F0H A;  5JR3 A;  1WPK A;  2Q1Z B;  1X2M A;  1TP4 A;  5E3N A;  1V5F A;  1DGR M;  1WVR A;  3EET A;  3DKW A;  5K7Z A;  3QYB A;  2I5U A;  2K9Q A;  5BPI A;  4NUB A;  1UG0 A;  1TT0 A;  4HST A;  1GV5 A;  2XPV A;  3E6C C;  3V8L A;  5FRO A;  1F4K A;  5ICG A;  3WTW C;  3D0S A;  2QZ8 A;  4XRS G;  3FXM A;  3I58 A;  3HOT A;  3A1Y A;  4EJU A;  1MJ9 A;  4I76 A;  4XLP F;  4A0Z A;  2HDW A;  1I6X A;  1FBQ A;  4L9N A;  1X3Z B;  3F9K A;  2EH3 A;  3K69 A;  3F22 A;  3HZJ A;  3JRH A;  3F8C A;  2UWM A;  4N9I A;  2H27 A;  3CCQ I;  3F8F A;  5EZG A;  3M9A A;  3L09 A;  2QUF A;  3WTY C;  3K2Z A;  1AU7 A;  1YTY A;  1F9N A;  2IGM A;  2KIQ A;  3S14 J;  2VB6 A;  1Y0U A;  1APL C;  1K61 A;  1H8A C;  3H9Q A;  3V8J A;  1V55 H;  3PSI A;  3JCU C;  2HVS A;  3CLO A;  3AG2 H;  5LHH A;  1GVJ A;  3K0L A;  3BTI A;  4AYB A;  2M34 A;  2BHZ A;  4RM2 A;  2NYX A;  3TDU C;  3VSL A;  2Y9Z A;  4A93 J;  4AU7 A;  1XGN A;  5E3O A;  1N77 A;  3A0H C;  3H36 A;  2DA1 A;  1YS6 A;  4L9J A;  1DU6 A;  3TMO A;  4RA2 A;  5F27 A;  2YS9 A;  1DUX C;  2IS6 A;  4ZYD A;  3H92 A;  3O6B B;  1I1S A;  1X3U A;  2NRA C;  2ZJR F;  1P4W A;  4MEX F;  3NWT A;  2IXS A;  3CUQ A;  2EA2 A;  1G2H A;  3QU3 A;  3DKX A;  1BI1 A;  1ERD A;  5H6Q A;  1I50 J;  3OYE A;  1A36 A;  2V6E A;  2UXX A;  3RYR A;  3U1K A;  2OD5 A;  2ICW G;  3P5J A;  4GGG A;  4F92 B;  3NWS A;  2KZV A;  2CUZ A;  4ZYA A;  5ICC A;  3T0Y A;  3JRF A;  1VQ9 I;  2F2E A;  1F1Z A;  1RI7 A;  2VJJ A;  3QYF A;  4HF1 A;  1FZP B;  3RKW A;  4S05 A;  4A3D J;  1O7F A;  4M72 A;  5K1Y A;  3CJN A;  3ONQ A;  1LE8 B;  4F91 B;  3RKX A;  1ITY A;  2DPD A;  2IP2 A;  5GAH J;  5J6X A;  4X1E A;  3OYM A;  5DD8 A;  2X1E A;  2BE5 F;  5HS7 A;  2ZSH B;  3PIP F;  3AL0 B;  2E19 A;  1FP1 D;  3R0A A;  4UV9 A;  3CCM I;  1BR4 A;  4L0Y B;  1LFB A;  2E1M C;  3GFJ A;  1A35 A;  2FA5 A;  4DYR A;  2O5R A;  3DBR B;  1PP8 F;  3KIO A;  3MWM A;  1SMT A;  3I54 A;  3VYU B;  2R5Z B;  1XS9 A;  4QIW N;  2HOS A;  4FX0 A;  1IUF A;  2IGN A;  4XKV A;  2IA1 A;  2LH9 A;  4BHC A;  3OL3 A;  4E7J A;  4A2U A;  2EFW A;  3BY6 A;  2A3S A;  1BJA A;  1ZLJ A;  2HWV A;  3IP4 B;  3ZMV A;  1LDJ A;  4QLC U;  5E8I A;  4U7B A;  1MDM B;  2HVQ A;  3O8G A;  1LEB A;  4N0B A;  1XGO A;  5LHG A;  2K9S A;  4UUT A;  2XB0 X;  1BIB A;  3O8H A;  1ULY A;  4DIQ A;  2NOG A;  1LB2 A;  2LF7 A;  1W0U A;  1W1W E;  4CGZ A;  1U5T B;  4HBL A;  5DCF A;  2Q2E B;  2FOW A;  3ZQL A;  3CC4 I;  3LWF A;  3E7L A;  1WJ5 A;  1XN7 A;  2EPF A;  4HLX A;  3CES A;  2LY9 A;  2FJ1 A;  5E20 A;  3IAS 2;  4D7M A;  1K83 J;  1ONV A;  4CSW A;  4FIS A;  3K1M A;  3CCE I;  1TZL A;  2WAD A;  3K9T A;  4U88 A;  5KAI C;  1KU7 A;  2LRD A;  2W82 A;  3OYG A;  1WWX A;  1V4R A;  4YRV A;  4A0Y A;  3M1E A;  1FBU A;  4ZZL A;  5FKN A;  3T8R A;  2Y0S N;  1WGX A;  3BRO A;  4ESJ A;  5IPA A;  4NQW A;  4IHT A;  3IWF A;  3VOD A;  1HW1 A;  4XLF A;  1GV2 A;  2FUG 2;  4YII A;  5D5W B;  4RB1 A;  3GUD A;  3FBN B;  1LQ1 A;  2JRM A;  2OQR A;  3OYN A;  1UAA A;  5HS8 A;  1TQM A;  1YW8 A;  2NXN B;  3IWZ A;  3HKZ A;  3TOA A;  4E7S A;  1ETO A;  5TRD A;  4M9Z A;  3NAR A;  4IRG A;  2EIN H;  1TWA J;  5J1R A;  4JK1 X;  4OIO F;  4KUM A;  4MTD A;  4G6D A;  1KU9 A;  2VJ5 A;  2XKP A;  4XIC A;  1YI2 I;  2W24 A;  3ZQI A;  4BJT A;  2BEO A;  4LIV A;  4CCM A;  1SVL A;  5HLH A;  2DOE A;  4GO1 A;  4RAG A;  3SDG A;  3RPQ A;  3JRB A;  2PEX A;  4KMF A;  3W6K B;  3HGG A;  2ZXI A;  4M6Y A;  4RBO A;  4IX7 A;  3BG7 A;  3FBI B;  4AIJ A;  1CQT A;  3OMY A;  3LSR A;  1A6I A;  3R6S A;  1T2K A;  2EZI A;  2L4M A;  5JVG F;  3SHF A;  4XN0 A;  3HM5 A;  4G6Q A;  2BBY A;  1Y1W J;  3SZG A;  2JSP A;  3BTJ A;  1FTZ A;  2V1X A;  4EGZ A;  2IRF G;  2HDC A;  2WAQ N;  2M1B A;  1NK2 P;  3BJO A;  5D4S A;  3KEQ A;  2AQF A;  3SZP A;  2W57 A;  1KYZ A;  3PNT A;  2L2O A;  1E3H A;  2AXL A;  1X3W B;  3HHG A;  4D9J A;  3CMM A;  3M8F A;  5IP6 A;  4RAF A;  5CKT A;  3MKY B;  3QOP A;  2DW4 A;  2OQG A;  2JUC A;  4QSH A;  2RGV A;  1IZ1 A;  3HUG B;  3LNQ A;  3BG3 A;  2HDD A;  3S1N J;  1FYL A;  4LFU A;  5LLQ A;  3CJR B;  4CUG A;  2LY2 A;  5KCM A;  2ZME B;  3SXY A;  3BCB A;  2N8G A;  2IEK A;  2MH2 A;  2M30 A;  1YW9 A;  2A5Y B;  3FK7 A;  1E2X A;  2DA5 A;  3CMY A;  2QWW A;  1ETQ A;  2X9D A;  2VAS A;  3HBL A;  2P5V A;  3LFK A;  3I53 A;  1GXQ A;  2JT1 A;  3H3U A;  3IH3 A;  2J5P A;  2JPB A;  4K2E A;  4I01 A;  3ABT A;  2H8R A;  2DOA A;  2V6C A;  2I10 A;  4E7Z A;  2KRF A;  4G9Y A;  4B43 A;  3DFG A;  2PMU A;  2L01 A;  2XF7 A;  3BR0 A;  2CRG A;  3OSG A;  2DK5 A;  3H9J A;  5DM6 F;  2P4W A;  3WE2 A;  4G94 A;  2V4J C;  4DYC A;  3S2D J;  4IRH A;  3VFZ A;  1IN4 A;  1ZRD A;  2CV2 A;  2RQP A;  1QPM A;  3VSK A;  4RM3 A;  4M74 A;  2H1K A;  4LIU A;  3V42 A;  5J40 A;  3WGI A;  1ZGJ A;  2RRE A;  2YUS A;  3ZQC A;  4B09 A;  3DTI A;  2WV0 A;  3SYT A;  3SFI A;  5J4Y A;  2AHQ A;  5D8K B;  1ODD A;  3S3N A;  2VBZ A;  2ZNZ A;  3F21 A;  4PJJ A;  1ETY A;  3OYB A;  4V2F A;  1FJL A;  2BYV E;  2X85 A;  1W7P B;  4UB6 C;  4EJW A;  1B4A A;  4MFD A;  4CA0 A;  4N9H A;  2DYR H;  4O5V A;  2FU4 A;  4LLN A;  5DYM A;  1FT9 A;  2AO9 A;  4Z6Y A;  1RC9 A;  3BR3 A;  4I98 B;  2NVY J;  2E34 A;  3AAF A;  2IGO A;  3KEY A;  3GTJ J;  4FTH A;  1YQA A;  2QYO A;  1UMQ A;  1L0O C;  2ADU A;  3DLA A;  1M1E B;  1K6O A;  1R22 A;  1HA8 A;  3FXQ A;  3GF2 A;  4XSZ F;  1R00 A;  5L3B A;  1Z9C A;  2V26 A;  1LNW A;  4IQ4 A;  4KT6 A;  3EQL F;  1F5T A;  2GA2 A;  1JJ8 C;  3L2Q A;  2K27 A;  3KYC B;  1HSJ A;  2CYY A;  3I59 A;  4XOT A;  4B47 A;  1J75 A;  1VZ0 A;  3MAJ A;  3OIQ A;  1OKR A;  4KJZ A;  1RRJ A;  4A6E A;  1U78 A;  1K4S A;  4XSX F;  2E71 A;  2UXN A;  1UHM A;  1TL8 A;  2H8W A;  1RIO H;  1SD5 A;  2VJ4 A;  2VBY A;  4BQO A;  1T08 B;  1MBK A;  1HDD C;  2DFH A;  1N25 A;  2HI3 A;  4A5N A;  2DMQ A;  1MMS A;  2TDX A;  3HJE A;  1RKT A;  4Y33 A;  6PAX A;  2F4M B;  5BNG A;  1VQ4 I;  2K7L A;  1SEU A;  2H09 A;  4LG0 B;  5HOD A;  5LRS A;  4IHS A;  1JHF A;  1Z91 A;  1XDU A;  5D6E A;  1O57 A;  2PLY A;  2IAI A;  2LKS A;  1CF7 B;  3WGH A;  1O3R A;  1OCT C;  4BE1 A;  1A04 A;  2BY3 A;  2NVX J;  4Q4Z F;  2O0Y A;  3WE3 A;  3C18 A;  1AWC A;  4RB3 C;  4DJA A;  3ISP A;  5DS9 A;  2QSG X;  1RKW A;  4MQV A;  3HOS A;  3FHZ A;  1ZAO A;  2K5C A;  3KFW X;  4G6T B;  5D5V B;  3RCO A;  2R7W A;  5CPR B;  3BG5 A;  9ANT A;  3OL4 A;  5F0F A;  4C2M J;  3DPU A;  2IT0 A;  3M1C A;  2E60 A;  3HSF A;  4L5I A;  3SDB A;  4CYC B;  2LMD A;  1SFK A;  4YEJ A;  3MCZ A;  2Q8K A;  5CLS A;  3HTS B;  4M3B A;  4G7Z F;  1AOY A;  1WJD A;  4D5C A;  4HV6 A;  2P7C B;  2R4G A;  3CZ6 A;  4BEH B;  1H9G A;  2DT5 A;  2EB7 A;  2VOD A;  5E17 F;  4JYK A;  3HRM A;  4XLE A;  4AID A;  4HF2 A;  1FSE A;  4Y13 A;  3WHB A;  4A69 C;  2HQ5 A;  2H1L A;  3QP5 A;  2HYF A;  5HVQ C;  3S2H J;  3OIO A;  4C30 A;  1XGS A;  2ECB A;  5LGN A;  5LEK A;  1P6R A;  2ELJ A;  4QWQ A;  3OYK A;  3F72 A;  2Z3Y A;  5DTD A;  3S1Q J;  3H1C A;  1TQP A;  2DBB A;  3LQQ A;  3S15 J;  4BH9 A;  4AYB N;  5D8L B;  3RIR A;  4M71 A;  4BDZ A;  4DGW B;  2CUJ A;  4FE4 A;  1MBE A;  1XSV A;  4UV8 A;  1RUN A;  3SZT A;  4DW6 A;  1LUJ B;  4ZC3 A;  3EDP A;  2HOT A;  4GRI A;  3W6J B;  1HST A;  2TCT A;  1IDZ A;  3HXL A;  2FML A;  3GWZ A;  5TGT A;  2XF6 A;  1ZKG A;  4I02 A;  4M9X A;  4C2U A;  3ASN H;  4HNV A;  3Q0W A;  2NAZ A;  2KRC A;  5IYC J;  2KDO A;  5FGM A;  1NTC A;  3PIO F;  4KIB A;  1MKM A;  2ETH A;  2EZK A;  1ON1 A;  4IOA F;  1MIJ A;  2JWT A;  4ZYE A;  1UZC A;  2YPR A;  3BPX A;  4BUP A;  5KNL A;  2HPM A;  1TW3 A;  2DMT A;  4D1Q A;  1HW5 A;  1XMK A;  1MSF C;  3RSN A;  4FE7 A;  2P81 A;  3ABL H;  1MNE A;  2M0M A;  1BC7 C;  2A5W A;  2DT6 A;  4C2T A;  5LGT A;  1EKE A;  3DKY A;  2VUM J;  3R60 A;  3BQZ A;  1YFH A;  3LSK A;  2QSF X;  3QU6 A;  3UR3 C;  1JJ6 C;  1MND A;  4BQQ A;  1G3Y A;  4V19 K;  1T38 A;  1WJE A;  4RB2 C;  1ENH A;  2ID6 A;  3E5Q A;  4Q47 A;  2L7M P;  1OFC X;  4FCY A;  2WWY A;  5E1Z B;  2Y0M A;  3ZMT A;  5JLW A;  2KDZ A;  2O8K A;  3RZD J;  1RET A;  4EJO A;  4CYD A;  1JUM A;  3NEU A;  2QGU A;  2V1U A;  1U9N A;  1F36 A;  4A3F J;  3S1M J;  2OTJ I;  3E1S A;  2OZ6 A;  3F3X A;  4ZDO A;  5M5W J;  2VBW A;  2RKH A;  4NC8 A;  3IH4 A;  3L9F A;  4ZDL A;  3R61 A;  3U21 A;  5M3M J;  3L2V A;  3VWB A;  3MKZ A;  2LYC A;  3FXL A;  1ZK8 A;  3HRT A;  3CCS I;  5DM7 F;  2DDB A;  4KDP A;  3E6M A;  4QPO A;  2B63 J;  4IPA A;  3HPG A;  3RPU D;  1FC3 A;  4W1U A;  5AIP A;  1GXP A;  4F93 B;  1U3E M;  1XMA A;  3VYS B;  3F0C A;  3PQJ A;  5IT9 Z;  3H3Z A;  4II2 A;  3FK6 A;  1W0T A;  2XGX A;  1HDP A;  2CG4 A;  2MC3 A;  2ZO4 A;  4IVN A;  2XAU A;  3ZQ7 A;  1XB4 A;  1U5T C;  1VQ6 I;  1OIS A;  1W5S A;  2HGC A;  4CCN A;  1Z77 A;  4PFP A;  1R9T J;  5H20 A;  2QQ9 A;  4MQ9 F;  3J80 K;  5DCM B;  5IP9 J;  3KE2 A;  3Q3S A;  2EZL A;  1VQM I;  2ZBK A;  3GZ5 A;  3MKL A;  3M3Y J;  1Y1V J;  3N05 A;  4WK8 F;  4A3L J;  3Q0V A;  3L00 A;  3PL8 A;  4L18 B;  5LFA A;  3LL7 A;  2FEZ A;  3CDI A;  4M3G A;  4LK0 F;  3WTT C;  2PBI A;  1R58 A;  1XMX A;  2I8D A;  1ORK A;  3CUQ C;  3P7N A;  3FXR A;  4IJA A;  3LAP A;  5GPC A;  2JVG A;  1OCR H;  1JE8 A;  2DYS H;  1J0R A;  4YEL A;  4XRM A;  4HW0 A;  3S17 J;  2EFO A;  1JI8 A;  1V3F A;  2R3S A;  4I09 A;  4U0Y A;  1SD7 A;  4EQQ A;  1MZB A;  4Q5S F;  3KZY A;  2A6E F;  2X1D A;  1W5C C;  4CCO A;  3GLX A;  2RNG A;  2BY0 A;  3F8B A;  3NAU A;  4IHY A;  3HKZ N;  1NK3 P;  2A07 F;  5L3F A;  2PN6 A;  2BW3 B;  2QVO A;  2W4S A;  4F55 A;  3KLO A;  1TWC J;  2PJR B;  3LA3 A;  2P8T A;  4DNC A;  1D5V A;  3LOC A;  3QPS A;  5LHI A;  2BZT A;  1IF1 A;  2KL4 A;  5K5Q A;  1JKQ C;  2DQR A;  3I4N J;  5CVV A;  2GIZ A;  1YO5 C;  4XID A;  1IXS B;  3DTK A;  1KQ0 A;  4BL0 B;  2WB1 A;  4KFC A;  2R7R A;  2JUG A;  1S9H A;  1QPI A;  2R7F A;  3FM3 A;  3I9V 2;  2JA8 J;  2VQL A;  4PSX A;  2R5Z A;  1G3T A;  1P92 A;  4HDU A;  5C4J J;  2CUF A;  2BY2 A;  5ED4 A;  5KK1 A;  3RPU A;  4U7D A;  3BOQ A;  1JUS A;  1XSD A;  2GBY A;  1MBF A;  1NG7 A;  2LP0 A;  4UY8 I;  2XPW A;  1R1T A;  2LF8 A;  1Y0N A;  3BC8 A;  4RLQ A;  2ZME C;  3SQN A;  1ZHF A;  1HKT A;  2NNN A;  4PJ0 C;  1K7A A;  1LVK A;  1FSH A;  3L2C A;  4OMZ A;  3MN2 A;  4HOB A;  2HTJ A;  4H0E A;  1Z7U A;  3RKY A;  2O03 A;  3ECH A;  4FHT A;  3TGN A;  1U5T A;  4IF4 A;  3HDD A;  2Q2E A;  1QBJ A;  1MNM C;  4M73 A;  1XX5 A;  3GLL A;  1Q1V A;  4LLG F;  5FLV A;  2K3F A;  4WXC A;  2K85 A;  2STW A;  2OA4 A;  1FX7 A;  3QOD A;  4XOR A;  3BZK A;  2XAS A;  2QLZ A;  3ASO H;  2G9W A;  1IG7 A;  1OMI A;  3IH2 A;  2NS8 A;  4I0B A;  3OWT A;  4IEJ A;  5CQG A;  1TWF J;  1YRN B;  5EJC A;  1U0J A;  4BYY A;  3WTV C;  1U8B A;  2FRH A;  3A4C A;  4CXF A;  2HZD A;  3D5L A;  1DPR A;  3KLN A;  1R23 A;  1IRF A;  1D3Y A;  2WTE A;  4OIQ F;  1R1V A;  5DUI A;  1VND A;  2MGQ A;  3FXO A;  2KIM A;  3CDH A;  3KYD B;  4FT8 A;  2GLO A;  3GW2 A;  3H5N A;  3JW4 A;  1GVD A;  2MA3 A;  2VC0 A;  4YIR X;  4E4H A;  4RGS A;  1U9O A;  1WCM J;  1FYM A;  4OMY A;  3HRS A;  1IXC A;  3K70 D;  1Z6R A;  3KX2 A;  1Y56 A;  1BL0 A;  3ROU A;  3GFI A;  1BW5 A;  2XF5 A;  3K10 A;  4Q48 A;  5HOO A;  3KZZ A;  1SFO J;  2R7O A;  5KAF C;  2JQ7 A;  3V8K A;  1W7P D;  1USS A;  3ELK A;  5FFZ A;  2R7V A;  4MIM A;  4ENJ A;  1IAW A;  2K86 A;  1Z0X A;  1UHW A;  4Y4R A;  3AG3 H;  1XDS A;  5B1A H;  2B7E A;  4QPQ A;  4ZH4 F;  5F1R A;  1FNN A;  3CUO A;  5AON A;  5KVR A;  2R7S A;  3GTL J;  1YLF A;  3C1D A;  1ZQ3 P;  3TOB A;  3CJQ B;  4BU2 A;  4A3M J;  1WJA A;  2VBX A;  1WHU A;  3M07 A;  2W1O A;  1ETX A;  4UUV A;  4PDK A;  1V5E A;  2CW0 F;  2XV4 S;  2BV6 A;  1FLI A;  1IV6 A;  2ZME A;  4ZTF A;  3B73 A;  1WI9 A;  5F1J A;  3OYI A;  1YJW I;  2EQR A;  3VOE A;  1FTT A;  2RNJ A;  4RGU A;  1NHA A;  4HNT A;  5JFR A;  5F04 A;  2F5C A;  4HF0 A;  2A6T A;  3O2P E;  4XMY A;  2HFH A;  1U6G A;  4UUS B;  4ZTJ A;  3DCF A;  2ZXH A;  2KHM A;  3QWL A;  4CCJ A;  2JPC A;  4E7L A;  3BQY A;  3CO7 C;  1HOM A;  1VQ8 I;  2W25 A;  1MH4 A;  4RMN A;  3IKV A;  5GAG J;  4ITV A;  1SVM A;  1D0Z A;  4KNY A;  2WAF A;  2R0Q C;  2V7F A;  3J7Y J;  2X4H A;  1B8I A;  2CV1 A;  1S6L A;  2LR8 A;  1MBJ A;  2DDA A;  3E3V A;  3DU5 A;  3S3O A;  1ZG1 A;  4B4C A;  5A2Q K;  2DFI A;  1HLV A;  1QA6 A;  4XOP A;  2R7T A;  2X0L A;  3PQK A;  2VXD A;  2E2H J;  2QBY B;  3JRE A;  2C6Y A;  1KGS A;  1V5G A;  3OOP A;  1R4M B;  1SAU A;  1X1C A;  1XGM A;  2IS1 A;  2JK3 A;  3MZY A;  4B1R A; 
#chains in the Genus database with same CATH homology
 1T39 A;  5HLI A;  3IC7 A;  1W7P A;  2XHK A;  1S3J A;  5FLX K;  5CYV A;  1FPQ A;  2V9V A;  4EV0 A;  1WQ2 A;  2DTR A;  4WX9 A;  3R0J A;  4P9F A;  2KIU A;  3OV8 A;  2JTV A;  2A69 F;  5DV5 A;  1ZYR F;  4Y15 A;  2FNA A;  3ZMS A;  2FF4 A;  2FSW A;  5BS6 A;  2MD5 A;  5BPD A;  4LLL A;  1L3L A;  1IN8 A;  1PP7 U;  3EYY A;  3ECO A;  4YG2 F;  2A61 A;  1TW2 A;  2XRO A;  1TBX A;  1G6N A;  3QAH A;  3TQN A;  3I64 A;  1MJA A;  1D8J A;  1ZRC A;  5FFX A;  2K02 A;  3Q9S A;  2XVC A;  2XIG A;  1KQ8 A;  3P9K A;  2HEO A;  3I5U A;  1G3W A;  1JHH A;  3MFK A;  4Z2Y A;  4PZJ A;  3KEO A;  5TJJ A;  3PFI A;  1CF7 A;  3I4P A;  3V4G A;  4UXN A;  4L9V A;  1UCR A;  5CVU A;  4O6J A;  3WTS C;  4M9S A;  3T8T A;  3EUH A;  4RAY A;  3KP7 A;  1O3T A;  2GAU A;  5A2Q Z;  3TDZ C;  4KIC A;  3NQO A;  4AVP A;  1DPU A;  1TLH B;  1S7A A;  2HKO A;  2HYG D;  4ON0 A;  3IRR A;  2KIF A;  3BWG A;  3ULQ B;  2STT A;  3JTG A;  2FNP A;  3RI4 A;  2MBF A;  3IKT A;  4HAM A;  1LDD A;  1SAX A;  2CQK A;  4GCV A;  2EV0 A;  5CVI A;  5ILV A;  1J7K A;  2CO5 A;  2A6H F;  2HOE A;  3M7G A;  4KN7 X;  1ON2 A;  2OAZ A;  2VN2 A;  4BHP A;  4HZF A;  3N4M A;  1K79 A;  4WXD A;  3WU1 B;  2DLL A;  2EFQ A;  1D8K A;  1YW7 A;  4ETS A;  3IL2 A;  2CWE A;  3E6B A;  3JAM K;  3NRV A;  4KIG A;  3V7R A;  3F8M A;  4B8X A;  3GX4 X;  3GO5 A;  4I0A A;  2XAF A;  2O61 A;  3DPT A;  1P4A A;  3LA7 A;  1IUY A;  4G7O F;  3LAJ A;  3BDD A;  3HSR A;  5K5O A;  3GFL A;  4UHT A;  1ZLK A;  2HKX A;  1QO0 D;  1WRJ A;  4LD5 A;  3F6O A;  3TO9 A;  2G7U A;  4RGX A;  1HW2 A;  1IN5 A;  2VOP A;  1OYW A;  1KU2 A;  1BBY A;  1K78 B;  1E17 A;  5CVJ A;  3REO A;  4XLN F;  2ZKZ A;  3JSO A;  1FBS A;  2DI3 A;  4LB6 B;  1MD0 A;  3J81 K;  2YSR A;  4WCG A;  2ZFW A;  1FOK A;  2JZY A;  4EJV A;  2EV6 A;  3RDI A;  4OIN F;  4P5O A;  2RN7 A;  2HQN A;  1KQ9 A;  3F6V A;  4ESB A;  2RDP A;  2G7H A;  2KJC A;  4PGH A;  3RTR A;  2VON A;  1S8N A;  1B6A A;  3KP2 A;  2V79 A;  3KP6 A;  5JHU A;  4KYW A;  1STZ A;  5CJ9 A;  4PGG A;  1LEA A;  3HYI A;  3QP6 A;  3ZP5 A;  2R7D A;  2XAG A;  3CTA A;  3DV8 A;  5FB2 A;  3ML6 A;  1S29 A;  4AIH A;  1O7L A;  4F7Z A;  4O3M A;  3JAM Z;  1BN5 A;  4ZYH A;  5LRR A;  3U2R A;  3BZ6 A;  3ZN0 A;  2E7X A;  3BP8 A;  4NB5 A;  4E70 A;  1DP7 P;  2PFB A;  3HIF A;  1SMY F;  2IJL A;  5ICF A;  4IXA A;  1BI0 A;  2HR3 A;  1P2F A;  4EVI A;  2ESH A;  3WOD F;  2GA1 A;  3TKY A;  2EK5 A;  1YS7 A;  1QZZ A;  2D1V A;  2J5O A;  3WGG A;  4DQ2 A;  4L9T A;  2ESN A;  2P5K A;  1ZN2 A;  1XCB A;  5IT3 A;  2DQL A;  3ERE D;  2ZCW A;  2O6G E;  5E18 F;  3P9I A;  4HX7 A;  3FZV A;  2EFN A;  4CDG A;  4S04 A;  3TO6 A;  4EM1 A;  2KJB A;  2OU2 A;  1R36 A;  5J8F A;  3EYI A;  2E1C A;  4A12 A;  3T5X A;  2LKP A;  2Y75 A;  2IA0 A;  3HRU A;  4MNU A;  4ENK A;  2W84 A;  4PCQ A;  5DDG A;  3G3Z A;  3J81 Z;  5D5U B;  3FM5 A;  4KT5 C;  3FWE A;  4LK1 F;  3CO6 C;  5EEH A;  4YFN F;  2LDU A;  5ERI A;  1FYK A;  2DAO A;  1HKS A;  1HQC A;  1IRG A;  3VEP A;  3ZN1 A;  1PDN C;  5LGU A;  1HXD A;  1UFM A;  4HQE A;  2EJR A;  1VTN C;  4AWX B;  4D0P A;  3ZPL A;  4MGR A;  1Z6T A;  2MLK A;  5K5R A;  3Q5F A;  3MEX A;  2GQQ A;  1J2X A;  5AIQ A;  1SFU A;  3TO7 A;  3U9G A;  5HDK A;  1H0M A;  4NHJ A;  2FOK A;  2UZK A;  2MLG A;  2GXB A;  1R7J A;  1P4X A;  3ZMD A;  2FBH A;  2YX4 A;  2B0L A;  2FE3 A;  3BJ6 A;  2DO7 A;  1MDM A;  2LNB A;  2Z33 A;  3C7J A;  3R4K A;  2COM A;  2Z5U A;  3WG9 A;  2HQR A;  3F8N A;  1C0W A;  2PI0 A;  1MJB A;  3IHU A;  4LMY A;  3V7S A;  4HLY A;  5FD5 A;  4OIP F;  1T0F A;  2EFP A;  1R5H A;  3FMS A;  1RUO A;  2QBY A;  2BGC A;  3J80 Z;  3KET A;  1OYI A;  4CZZ A;  2P7V B;  4EM0 B;  1LJ9 A;  5D4R A;  3E6D A;  2W85 A;  1OR7 A;  2H6C A;  1ZRF A;  3GVA A;  2NS0 A;  1EH7 A;  2GIV A;  2VT2 A;  3P9C A;  2GXG A;  1KU3 A;  3MZH A;  5L3E A;  4KMU X;  2P5L C;  5BOX A;  2O8X A;  4BAY A;  2K4B A;  1I5Z A;  3Q9V A;  4WXH A;  2FXA A;  4BNC A;  3U1D A;  2D45 A;  1EH6 A;  4JBA A;  5FD6 A;  1EH8 A;  4GYG A;  4OIR F;  4OU0 A;  1J59 A;  4I7H A;  1IW7 F;  4HX4 A;  5DD4 A;  3HUG A;  1ZG5 A;  4XRF A;  2D1H A;  2VE8 A;  3DF8 A;  3DQV C;  4P9U A;  1R5G A;  1BOA A;  2QQB A;  4HA8 A;  2FMY A;  4EGY A;  2H94 A;  3N97 A;  4ZZD A;  1QZY A;  3COA C;  3HHH A;  3FMR A;  1O3Q A;  4RB0 A;  3B02 A;  2ZXJ A;  1ZRE A;  5BQT A;  1WSU A;  1LDK B;  1RNL A;  2EV5 A;  3KP5 A;  4R1H A;  1OYY A;  1B59 A;  4JQF A;  1ZAR A;  3J7A O;  2ISZ A;  4LGW A;  1B1B A;  4KIF A;  3T1B A;  1XCV A;  2IW5 A;  3LA2 A;  1QNT A;  1QGP A;  4WWC A;  3HTU A;  2DK8 A;  5E1W A;  4HQM A;  3CUQ B;  4KA4 A;  2FQ3 A;  5L3C A;  4GXO A;  2P6T A;  2VXZ A;  1G4D A;  3DPL C;  1HBX G;  2Y48 A;  3VB2 A;  4TV7 A;  2LSO A;  3S2W A;  2V1D A;  1XD7 A;  2QM3 A;  3M8E A;  1O3S A;  2QQA A;  4CHU A;  2IA2 A;  1BI3 A;  2A68 F;  4LJZ F;  1ZGA A;  4LG0 A;  1SFE A;  4UVC A;  4YFK F;  2M5W A;  2Z99 A;  3I0T A;  1IN6 A;  1I27 A;  3JTH A;  3JSP A;  1T6S A;  2PJP A;  1TNS A;  4GYI A;  3SFZ A;  4BQA A;  2VOO A;  4A5M A;  2DPU A;  3I71 A;  2RV8 A;  4G7H F;  1REP C;  3HSE A;  5JI6 A;  5DUK A;  1LVA A;  3FMQ A;  4ZYG A;  4MTE A;  1FP2 A;  1K78 A;  1S7O A;  2ACJ A;  2Q0O A;  5HDG A;  4YIF A;  3C3W A;  3WTZ A;  5FLX Z;  3L7W A;  3LQR A;  1BIA A;  3FF5 A;  2L54 A;  2IVM A;  1R1U A;  2JRT A;  2FBI A;  2F5F A;  3GYH X;  2XUB A;  3GEZ A;  3MQ0 A;  2ZJ2 A;  2HS5 A;  2WC2 A;  1SD6 A;  4RAZ A;  1FY7 A;  5F6F A;  2Z9O A;  2FBK A;  1UB9 A;  4ENN A;  1JGS A;  4U0W A;  3K1P A;  2F5E A;  2CGP A;  3KCC A;  4R79 A;  1JXS A;  2OZU A;  4BHB A;  3E5U A;  3DP7 A;  1SD4 A;  3FXU A;  4ENM A;  1BC8 C;  1Z05 A;  2HTS A;  2XAQ A;  4P96 A;  2OBP A;  4EJT A;  1J5Y A;  1XSX A;  2K4J A;  2PG4 A;  4EMS A;  1U2W A;  2EWN A;  3WTX C;  3V7C A;  1Q1H A;  1SFX A;  1J9I A;  3GXO A;  3E5X A;  1PUE E;  5L3D A;  2EA4 A;  2CFX A;  3RYP A;  1W4M A;  2XAJ A;  4A6D A;  1EV7 A;  2GZW A;  2O3F A;  5J8C A;  4P55 A;  1B9N A;  3QRF F;  2E7W A;  4MEY F;  4IRI A;  4UVA A;  4Y17 A;  5DCM A;  5IT9 K;  2GWR A;  4ASN A;  1UST A;  4M6X A;  4HDV A;  5HS9 A;  3LST A;  5E1X A;  3O3K A;  3GZ6 A;  3ZMU A;  1TQI A;  3ZMZ A;  4YFX F;  3GFM A;  5L3G A;  1U8R A;  1YIO A;  2MH9 A;  3BJA A;  5JVT A;  1T98 A;  2QEN A;  3G73 A;  4LB5 A;  2ISY A;  2XRN A;  2VT3 A;  4CO8 A;  2M45 A;  4RS8 A;  2D2W A;  4HV5 A;  2IPQ X;  1ZG3 A;  3QPT A;  5D6F A;  3I59 B;  1HKQ A;  2F5D A;  2XKO A;  4ESF A;  4MHG A;  4R8H A;  1IN7 A;  1I1G A;  5FO5 A;  3KP4 A;  1DDN A;  4A0X A;  1IXR C;  2AS5 F;  2VC1 A;  4CIC A;  4UVB A;  2RVC A;  2RC4 A;  1B9M A;  3E97 A;  1TNT A;  3DXJ F;  1OPC A;  4HYE A;  1RZ4 A;  3K1N A;  4BXU A;  3F23 A;  5BMZ A;  1ZH5 A;  5H6R A;  1KA8 A;  1CGP A;  5HDN A;  2YX7 A;  4L5J A;  3ABU A;  5HLG A;  3QPH A;  5LBQ A;  5E8G A;  3IRQ A;  1KYW A;  2JSC A;  4UNO A;  3KP3 A;  4L0Z B;  3WTU C;  4XBF A;  2M87 A;  4G8X A;  1TTY A;  5ICE A;  4AIK A;  3RJP A;  2YU3 A;  4I2O A;  2VE9 A;  4KN4 X;  2CSO A;  5ILU A;  1H9T A;  2DU9 A;  1GHC A;  1YYV A;  5CVR A;  2ELH A;  4AD9 A;  1W5T A;  2L4A A;  4HX8 A;  5DEQ A;  5F64 A;  2NNY A;  4RGR A;  4WF2 A;  2P6S A;  1FWZ A;  4OOI A;  1BI2 A;  4U0V A;  4FX4 A;  2ZNY A;  1BM9 A;  2HZT A;  2PMH A;  5ILS A;  2L3D A;  5D5X B;  4EM2 A;  3WU0 A;  1YG2 A;  3FX3 A;  2XAH A;  2YR2 A;  1WKM A;  1QQI A;  1Z1D A;  2H6B A;  5EEG A;  5LEJ A;  2PQ8 A;  3DEU A;  1G3S A;  2L02 A;  3BPV A;  2KKO A;  2E1N A;  1MGT A;  2M8E A;  5JR3 A;  3EET A;  3DKW A;  5BPI A;  3E6C C;  3V8L A;  1F4K A;  5ICG A;  3WTW C;  3D0S A;  2QZ8 A;  3I58 A;  3HOT A;  4EJU A;  1MJ9 A;  4XLP F;  4A0Z A;  1I6X A;  1FBQ A;  4L9N A;  3K69 A;  3F22 A;  3F8C A;  2UWM A;  4N9I A;  2H27 A;  3F8F A;  3M9A A;  3L09 A;  2QUF A;  3WTY C;  3K2Z A;  1YTY A;  1F9N A;  1Y0U A;  3V8J A;  3CLO A;  5LHH A;  1GVJ A;  3K0L A;  2NYX A;  3TDU C;  1XGN A;  1YS6 A;  4L9J A;  1DUX C;  4ZYD A;  3H92 A;  3O6B B;  1I1S A;  1X3U A;  2NRA C;  1P4W A;  4MEX F;  3CUQ A;  2EA2 A;  3QU3 A;  1BI1 A;  5H6Q A;  2UXX A;  3RYR A;  2OD5 A;  4GGG A;  5ICC A;  3T0Y A;  2F2E A;  1F1Z A;  1RI7 A;  4HF1 A;  1FZP B;  3RKW A;  4S05 A;  1O7F A;  4M72 A;  5K1Y A;  3CJN A;  3RKX A;  2DPD A;  2IP2 A;  5J6X A;  5DD8 A;  2BE5 F;  5HS7 A;  3R0A A;  1FP1 D;  4UV9 A;  4L0Y B;  3GFJ A;  2FA5 A;  1PP8 F;  3MWM A;  1SMT A;  3I54 A;  4FX0 A;  2IA1 A;  4BHC A;  4A2U A;  2EFW A;  3BY6 A;  2A3S A;  1BJA A;  1ZLJ A;  2HWV A;  3ZMV A;  1LDJ A;  4QLC U;  5E8I A;  4U7B A;  1MDM B;  1LEB A;  4N0B A;  1XGO A;  5LHG A;  1BIB A;  1ULY A;  1LB2 A;  2LF7 A;  4CGZ A;  1U5T B;  4HBL A;  5DCF A;  3LWF A;  1XN7 A;  4HLX A;  5E20 A;  1ONV A;  3K1M A;  3K9T A;  4U88 A;  1KU7 A;  1WWX A;  1V4R A;  4A0Y A;  3M1E A;  1FBU A;  4ZZL A;  3T8R A;  3BRO A;  4ESJ A;  4NQW A;  4IHT A;  5D5W B;  3IWF A;  1HW1 A;  3VOD A;  4YII A;  4RB1 A;  3GUD A;  1LQ1 A;  2OQR A;  5HS8 A;  1TQM A;  1YW8 A;  3IWZ A;  3TOA A;  5TRD A;  4M9Z A;  4IRG A;  4JK1 X;  4OIO F;  4KUM A;  4MTD A;  4G6D A;  1KU9 A;  2XKP A;  2W24 A;  2BEO A;  5HLH A;  4GO1 A;  3RPQ A;  2PEX A;  4KMF A;  3W6K B;  4M6Y A;  4AIJ A;  3R6S A;  1T2K A;  2L4M A;  3SHF A;  4G6Q A;  2BBY A;  2V1X A;  4EGZ A;  2IRF G;  2HDC A;  2M1B A;  3BJO A;  5D4S A;  3KEQ A;  3SZP A;  2W57 A;  1KYZ A;  2AXL A;  3HHG A;  3M8F A;  3QOP A;  2DW4 A;  2OQG A;  2RGV A;  1IZ1 A;  1FYL A;  4LFU A;  5LLQ A;  2ZME B;  3SXY A;  2MH2 A;  2M30 A;  1YW9 A;  2A5Y B;  1E2X A;  2QWW A;  2P5V A;  3LFK A;  3I53 A;  1GXQ A;  2JT1 A;  3H3U A;  2J5P A;  2JPB A;  4K2E A;  4I01 A;  3ABT A;  2V6C A;  2KRF A;  4G9Y A;  3DFG A;  2PMU A;  2L01 A;  2DK5 A;  2P4W A;  3WE2 A;  4G94 A;  4IRH A;  3VFZ A;  1IN4 A;  1ZRD A;  2RQP A;  1QPM A;  4M74 A;  3WGI A;  1ZGJ A;  4B09 A;  2WV0 A;  5D8K B;  1ODD A;  2VBZ A;  2ZNZ A;  3F21 A;  2BYV E;  1W7P B;  4EJW A;  1B4A A;  4N9H A;  4O5V A;  2FU4 A;  4LLN A;  5DYM A;  1FT9 A;  4I98 B;  3AAF A;  1YQA A;  2QYO A;  1L0O C;  2ADU A;  1K6O A;  1R22 A;  3FXQ A;  3GF2 A;  4XSZ F;  1R00 A;  5L3B A;  1Z9C A;  1LNW A;  3EQL F;  1F5T A;  2GA2 A;  2K27 A;  1HSJ A;  2CYY A;  3I59 A;  1J75 A;  3MAJ A;  1OKR A;  4A6E A;  1U78 A;  4XSX F;  2UXN A;  1UHM A;  1RIO H;  1SD5 A;  2VBY A;  4A5N A;  2TDX A;  6PAX A;  2K7L A;  4LG0 B;  2H09 A;  4IHS A;  5LRS A;  1JHF A;  1Z91 A;  1XDU A;  5D6E A;  1O57 A;  2PLY A;  1CF7 B;  3WGH A;  1O3R A;  1A04 A;  4Q4Z F;  2O0Y A;  3WE3 A;  3C18 A;  1AWC A;  4RB3 C;  3ISP A;  4MQV A;  3HOS A;  3FHZ A;  1ZAO A;  3KFW X;  5D5V B;  2IT0 A;  3HSF A;  4L5I A;  3MCZ A;  2Q8K A;  5CLS A;  3HTS B;  4G7Z F;  1AOY A;  4HV6 A;  2P7C B;  1H9G A;  2DT5 A;  2EB7 A;  2VOD A;  5E17 F;  3HRM A;  4HF2 A;  1FSE A;  4Y13 A;  3QP5 A;  2HYF A;  5HVQ C;  1XGS A;  5LGN A;  5LEK A;  1P6R A;  4QWQ A;  3F72 A;  2Z3Y A;  1TQP A;  2DBB A;  3LQQ A;  4BH9 A;  5D8L B;  3RIR A;  4M71 A;  1XSV A;  4UV8 A;  1RUN A;  3SZT A;  3EDP A;  3W6J B;  1HST A;  2FML A;  3GWZ A;  4I02 A;  4M9X A;  2NAZ A;  5FGM A;  4KIB A;  1MKM A;  2ETH A;  1ON1 A;  4ZYE A;  2YPR A;  3BPX A;  1TW3 A;  1HW5 A;  1XMK A;  1BC7 C;  5LGT A;  3R60 A;  1YFH A;  3QU6 A;  1G3Y A;  1T38 A;  4RB2 C;  3E5Q A;  4Q47 A;  2WWY A;  5E1Z B;  2Y0M A;  3ZMT A;  4EJO A;  4CYD A;  3NEU A;  2V1U A;  2OZ6 A;  3F3X A;  2VBW A;  2RKH A;  3L9F A;  3R61 A;  3HRT A;  4KDP A;  3E6M A;  4IPA A;  1FC3 A;  5AIP A;  1GXP A;  1U3E M;  1XMA A;  3PQJ A;  5IT9 Z;  3H3Z A;  2XGX A;  2CG4 A;  2MC3 A;  2ZO4 A;  4IVN A;  3ZQ7 A;  1XB4 A;  1U5T C;  1W5S A;  2HGC A;  5H20 A;  2QQ9 A;  4MQ9 F;  3J80 K;  5DCM B;  3KE2 A;  2ZBK A;  3GZ5 A;  4WK8 F;  3L00 A;  4L18 B;  2FEZ A;  4LK0 F;  3WTT C;  2PBI A;  1R58 A;  3CUQ C;  4IJA A;  3P7N A;  3LAP A;  3FXR A;  1JE8 A;  1J0R A;  4HW0 A;  2EFO A;  1V3F A;  2R3S A;  4I09 A;  4U0Y A;  1SD7 A;  4EQQ A;  1MZB A;  4Q5S F;  3KZY A;  2A6E F;  3GLX A;  3F8B A;  2A07 F;  5L3F A;  2PN6 A;  2QVO A;  3KLO A;  3LA3 A;  2P8T A;  4DNC A;  1D5V A;  5LHI A;  1IF1 A;  5K5Q A;  2DQR A;  5CVV A;  1YO5 C;  1IXS B;  1KQ0 A;  4KFC A;  2R7F A;  3FM3 A;  1G3T A;  1P92 A;  4HDU A;  5ED4 A;  5KK1 A;  3RPU A;  4U7D A;  3BOQ A;  1XSD A;  1R1T A;  2LF8 A;  3SQN A;  1ZHF A;  1HKT A;  2NNN A;  1K7A A;  1FSH A;  3L2C A;  4OMZ A;  4HOB A;  2HTJ A;  4H0E A;  1Z7U A;  3RKY A;  2O03 A;  3ECH A;  4FHT A;  3TGN A;  1U5T A;  4IF4 A;  2Q2E A;  1QBJ A;  4M73 A;  4LLG F;  4WXC A;  2STW A;  2OA4 A;  1FX7 A;  2XAS A;  2QLZ A;  2G9W A;  1OMI A;  4I0B A;  4BYY A;  3WTV C;  2FRH A;  4CXF A;  3D5L A;  1DPR A;  3KLN A;  1R23 A;  1IRF A;  1D3Y A;  2WTE A;  4OIQ F;  1R1V A;  5DUI A;  2KIM A;  3CDH A;  4FT8 A;  3GW2 A;  3JW4 A;  2MA3 A;  2VC0 A;  4RGS A;  1FYM A;  4OMY A;  3HRS A;  1IXC A;  1Z6R A;  3ROU A;  3GFI A;  4Q48 A;  5HOO A;  3KZZ A;  3V8K A;  1W7P D;  1USS A;  3ELK A;  5FFZ A;  4ENJ A;  1IAW A;  2K86 A;  1UHW A;  1XDS A;  4ZH4 F;  5F1R A;  1FNN A;  3CUO A;  5AON A;  5KVR A;  1YLF A;  3C1D A;  3TOB A;  2VBX A;  4UUV A;  4PDK A;  2CW0 F;  2XV4 S;  2BV6 A;  1FLI A;  2ZME A;  3B73 A;  1WI9 A;  3VOE A;  2RNJ A;  4RGU A;  1NHA A;  5JFR A;  2F5C A;  4HF0 A;  3O2P E;  2HFH A;  1U6G A;  2JPC A;  3CO7 C;  2W25 A;  3IKV A;  4KNY A;  2X4H A;  1S6L A;  3E3V A;  1ZG1 A;  5A2Q K;  2DFI A;  2X0L A;  3PQK A;  2QBY B;  2C6Y A;  1KGS A;  3OOP A;  1XGM A;  3MZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...