4AVPA

Crystal structure of the dna-binding domain of human etv1.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords ETS TRANSLOCATION VARIANT 1
total genus 28
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4avpA00
2Z99A 1HXDA 2RDPA 4BHPA 2FQ3A 5HLHA 1U2WA 2NS0A 5KVRA 3H3UA 1V3FA 2NAZA 3CTAA 5CVIA 1ZLJA 4HX4A 2DU9A 1FY7A 4XBFA 4KDPA 4XLPF 3MZYA 2ELHA 2D2WA 4N0BA 5EEGA 5J8FA 1O3TA 4KYWA 1IN5A 3CUQB 1O57A 4O5VA 1W7PA 3ABUA 2VOOA 3J80Z 5IT9K 4RB0A 2QQ9A 3J81Z 4OMYA 2PG4A 4EMSA 5D4RA 2ZXJA 4KMUX 2V1DA 1H9TA 2FRHA 4N9HA 2EA4A 3KETA 2XAFA 2STWA 2DI3A 1HW5A 4EM0B 2H09A 5JI6A 2XHKA 5E17F 3JSOA 3C1DA 2RNJA 2W25A 1S7OA 3N97A 2IT0A 1LB2A 2ZNZA 1R23A 2Q8KA 4G6QA 5FFZA 1K79A 3GFJA 5LEJA 3WTZA 3QOPA 1K78A 4HLXA 3EYIA 1G4DA 4MQ9F 3HOSA 3SHFA 4IRIA 1R58A 1J0RA 1P4XA 2LF8A 4I02A 3WTSC 2H27A 4HOBA 1U5TC 5F64A 4EJTA 2P5LC 3HTSB 4JK1X 2UWMA 4RGRA 2L3DA 2EFWA 1Z05A 1HKQA 4I01A 1I27A 1YW9A 1ZGJA 3C3WA 1JHFA 2XGXA 1ZREA 2Z3YA 1KQ0A 4U7DA 4HZFA 1QPMA 1B6AA 2O3FA 2LNBA 4IRHA 1I1GA 2HQNA 5DUIA 4PCQA 5L3GA 1KU9A 2QZ8A 2XKPA 2ZMEB 2QENA 3P9KA 4CHUA 2YR2A 1MKMA 1SD5A 5IT9Z 2EB7A 4KIBA 5DCMB 1IN4A 4G8XA 4CYDA 3QPHA 2YX7A 2O6GE 3ECHA 3DEUA 1SAXA 3IHUA 3QRFF 1DDNA 4EJOA 2GAUA 1B1BA 2PQ8A 2QQBA 2PLYA 2Y0MA 5FLXZ 5J8CA 2L4MA 4LG0A 4BQAA 2RN7A 3I0TA 3SFZA 1ON2A 4UV8A 5LGTA 1PDNC 5ICFA 1TW3A 2IA2A 5CVJA 3JTGA 3KP3A 1O7FA 3V8KA 3HRTA 3I59A 1QZZA 2PMHA 2STTA 4HDUA 4BAYA 2ISZA 1FWZA 4AD9A 5FLXK 2PN6A 3F6OA 2ACJA 3KZZA 1IN7A 5FFXA 2RVCA 4PZJA 1YFHA 1G3SA 1P4AA 1G3YA 2YPRA 3REOA 5DCMA 4YG2F 2XAGA 2ZKZA 2XROA 2A6HF 4LLNA 1ON1A 3EDPA 3G73A 3KLNA 4HLYA 1XSDA 1J7KA 1IAWA 4G9YA 1KYWA 2QQAA 3TQNA 3R4KA 3LA2A 3WGIA 4U0VA 3MWMA 1F9NA 4P5OA 2OAZA 5EEHA 4OU0A 2LKPA 5FD6A 1FC3A 4A2UA 1UFMA 5CVVA 3H92A 2AXLA 1SFXA 1UHMA 3VODA 3HHGA 5DV5A 2YSRA 3IL2A 4L9VA 1K7AA 2HQRA 1MGTA 4ENKA 5BMZA 4P55A 1ZAOA 2VBZA 5JVTA 2G7UA 4L5JA 1BIAA 4S04A 3WG9A 1I6XA 2HR3A 1Z1DA 1XGNA 1ULYA 3HSFA 3E97A 5FD5A 1S6LA 4UVAA 5L3FA 5E20A 2MA3A 2MH2A 2KIFA 1H0MA 4AIKA 3ZMZA 3DKWA 4UUVA 2IRFG 3WU0A 1YQAA 1B59A 1BN5A 4MQVA 2PMUA 3E6BA 3I53A 3WTVC 3MFKA 4OINF 2YU3A 3F21A 4YFKF 3TO6A 1ZYRF 2FA5A 4Q48A 3EQLF 3LAPA 1P4WA 3DPTA 4ASNA 3CJNA 2IJLA 5ILUA 1GVJA 3F3XA 4GXOA 3S2WA 1A04A 4ENJA 4NQWA 3ZMVA 1FYKA 4KN7X 2LF7A 3KEQA 2DK5A 1W7PD 3E6CC 4QLCU 2DPUA 4ESFA 4KN4X 3HTUA 5HOOA 3AAFA 3BPVA 4KT5C 2O03A 2WC2A 4FHTA 2GWRA 2IW5A 2EFOA 2G9WA 2HFHA 3QPTA 2HS5A 5BOXA 3O6BB 4CXFA 4P9FA 2R7FA 2JPCA 1ZHFA 2OQGA 3MQ0A 2FMYA 1HSJA 3GLXA 2EFQA 1VTNC 4LG0B 4RAYA 1Z7UA 1H9GA 4G7OF 3F23A 1B9NA 3BOQA 3DPLC 1BBYA 1IN8A 2EA2A 3FXUA 4EVIA 4CZZA 1R1UA 1Y0UA 2RGVA 1TQIA 5JHUA 5K5OA 3V8JA 1ZARA 2JT1A 4G6DA 3R0JA 4GCVA 2JZYA 2HGCA 1XGMA 2UZKA 1B9MA 1IUYA 1BM9A 1ONVA 3GXOA 4IXAA 2OU2A 3RTRA 2JRTA 1SFEA 5LRRA 5H6RA 4EJUA 1XD7A 4IHTA 2GZWA 1TQMA 5DD4A 3GW2A 4L0YB 1XDSA 4GYGA 2P6TA 5HLGA 3RI4A 4MTEA 4WK8F 1KQ8A 3JTHA 2FMLA 2V6CA 5AIPA 2IP2A 3GVAA 4P96A 4WXHA 1U78A 1TQPA 2MBFA 4LD5A 3F22A 1ZRFA 2F5CA 3I5UA 3WTYC 3RJPA 1KA8A 1XB4A 2CFXA 3WTTC 1ZRCA 3I54A 1QO0D 1O7LA 1BI3A 4IF4A 3KZYA 5ILVA 5BS6A 3WODF 3LWFA 4YFNF 2XASA 4DQ2A 4HYEA 1LJ9A 3M9AA 4EJWA 5BPDA 1IZ1A 4UHTA 2L02A 2R3SA 1S3JA 3VEPA 4PDKA 5D8KB 4AVPA 2O8XA 4LLGF 4RAZA 3LQRA 4B09A 3LAJA 1RUOA 4L9TA 4GGGA 2P6SA 1USSA 1HW2A 1KU2A 2ESNA 2K7LA 1T98A 2DFIA 2FOKA 3ML6A 3F72A 3G3ZA 1S29A 2K4JA 4IPAA 3ZN1A 1LNWA 3TKYA 2NNNA 1L0OC 3RYPA 4OIOF 2E1NA 2K86A 4OOIA 4BH9A 2DT5A 5ICEA 1T2KA 4FT8A 5AONA 5E1WA 2KIMA 2HTSA 2TDXA 4S05A 3SQNA 3V7CA 3ZMDA 3R60A 1F4KA 3R61A 1K78B 2IA0A 2XAHA 3COAC 5L3BA 4A0XA 3EYYA 1MZBA 2V9VA 3WE2A 5K5RA 5J6XA 2P7CB 3TGNA 3GF2A 4ZYEA 1CF7A 3T1BA 2OBPA 5D5XB 4IVNA 2A6EF 1D8JA 4RS8A 2RKHA 4L9JA 4A0YA 4ZYHA 2Z5UA 3GX4X 4CDGA 2RQPA 3BJ6A 1E17A 3OOPA 2W85A 4E70A 1ZLKA 1JGSA 4IRGA 2X4HA 2NNYA 2KIUA 4KUMA 3IWFA 3I59B 4MEYF 2D1VA 1EH6A 1P6RA 4DNCA 1XMAA 3M8FA 5HS8A 1QNTA 5L3EA 2PEXA 4ENNA 2H6CA 4RGXA 3FMQA 3VOEA 5CJ9A 3U1DA 3KCCA 2CO5A 2PI0A 1FX7A 1TNSA 4KIGA 3WTUC 4LB5A 1UCRA 1J59A 1DP7P 1QQIA 2KJCA 3K2ZA 3CLOA 2XKOA 3RPQA 1T39A 2BV6A 4A12A 1ODDA 4LB6B 2EFPA 5A2QZ 4MHGA 1Q1HA 1LVAA 4QWQA 2FBIA 4K2EA 1V4RA 3W6JB 3IRQA 5FB2A 2BGCA 3C18A 4A0ZA 2HWVA 1R5GA 2MLKA 4B8XA 1YG2A 2NYXA 4AIHA 1XCVA 4ENMA 5CLSA 2UXNA 1FP2A 1IXSB 3L9FA 4M72A 1U5TB 3ZMSA 4U88A 3KP5A 1D5VA 5D5UB 2Q2EA 2V1UA 1T6SA 2L4AA 2Z9OA 3LA7A 2ZFWA 2GXGA 2VE9A 2H6BA 1SMYF 3MAJA 2VE8A 2EV6A 1IRGA 1FZPB 2GQQA 4FX4A 1G3TA 3M8EA 2J5PA 3K1MA 2FNAA 1HW1A 1AWCA 3ZMUA 3GYHX 2GA1A 3CO6C 1O3SA 2M1BA 4N9IA 3RDIA 4JBAA 3E6MA 4CICA 1FLIA 4I0AA 2F5EA 4MEXF 4G94A 1MJAA 1WI9A 3BJOA 4OIPF 1GXPA 1SFUA 2M45A 2QBYB 1OMIA 5HS7A 3F8MA 4XSZF 4L5IA 4M71A 3ISPA 1OPCA 1BOAA 5ERIA 5K5QA 3DF8A 4R1HA 3BP8A 1ZN2A 2JSCA 4CO8A 5FGMA 1OYWA 1S8NA 2C6YA 2YX4A 2UXXA 3CUQA 4G7ZF 2DLLA 4M74A 3ABTA 3CO7C 5JFRA 2V1XA 2IVMA 1RI7A 3L2CA 3E5XA 5HDKA 4KA4A 4R79A 1HBXG 5E8GA 3GO5A 1HKSA 5HDGA 3QP6A 4BNCA 4YIIA 2CG4A 3R6SA 1YW8A 5ICCA 2PJPA 3LQQA 4BYYA 2F5DA 3PQKA 5LHIA 2WWYA 1PP8F 1OKRA 5E8IA 2D1HA 1USTA 4M9XA 5TRDA 4FX0A 1BI1A 1U8RA 3RIRA 1XCBA 2EFNA 1TW2A 1BC7C 3LA3A 3OV8A 3FF5A 4Q5SF 1LDDA 1XDUA 1UHWA 4YFXF 2XAQA 4HAMA 1O3QA 4BXUA 4Z2YA 3E5QA 3KP4A 1F1ZA 2FSWA 2E7WA 4L9NA 3T0YA 2W24A 3GUDA 5BPIA 4KFCA 2DTRA 3K1NA 5DDGA 1X3UA 5FO5A 1YIOA 4R8HA 4XLNF 2PFBA 2HKOA 4HV5A 4LK1F 2DQRA 2RC4A 3H3ZA 2KRFA 4HW0A 2ESHA 2HTJA 2O61A 2DQLA 3FX3A 3V8LA 2FE3A 3I4PA 3BJAA 1OYYA 3U2RA 3JAMK 3W6KB 3K1PA 4EM1A 2A5YB 4KIFA 1GXQA 3KFWX 1UB9A 3CUQC 2VC0A 5DUKA 4JQFA 2HYGD 1EH8A 2ZMEA 2DK8A 1WKMA 1EH7A 1DUXC 1TTYA 3SZTA 2CQKA 2Q0OA 3IKTA 2HYFA 4Q4ZF 4M6XA 2Z33A 3V7SA 3CDHA 3B02A 3HSEA 3GEZA 2FBKA 2QLZA 1RZ4A 1SD4A 2CW0F 3IKVA 3KP7A 2CGPA 2W57A 5A2QK 4EJVA 1GHCA 3PFIA 1YS7A 3J81K 4YIFA 4HF0A 4NB5A 3M7GA 4LLLA 5BQTA 2GA2A 2JTVA 1BJAA 4BHBA 5H20A 3TO7A 4PGGA 1E2XA 1BIBA 4M9ZA 3T8RA 3V7RA 1L3LA 2R7DA 1YW7A 2M30A 4A5NA 3RKYA 1ZGAA 2OZ6A 1TBXA 1YYVA 2ZNYA 4A6EA 4I0BA 2RV8A 2L01A 3HUGA 4LMYA 4ZZDA 4ZZLA 2D45A 2LSOA 4I7HA 1BC8C 3FHZA 4L18B 2XIGA 5D6EA 1REPC 3E3VA 2OA4A 3Q5FA 2NRAC 4HQEA 4LGWA 3M1EA 2WV0A 1LDKB 4WF2A 3O3KA 5E1XA 3MZHA 3TOAA 2A07F 4WWCA 1S7AA 3GFMA 1R36A 1FBQA 1KU3A 1Z9CA 1ZG1A 3BDDA 1K6OA 3ELKA 3MCZA 3BZ6A 3LSTA 5AIQA 2VBYA 1BI0A 4O6JA 4OMZA 1F5TA 4HF1A 3NEUA 1MD0A 3TO9A 1KYZA 3T8TA 1R5HA 1IRFA 3QU3A 4P9UA 1XGOA 1IXCA 4ESBA 4NHJA 4CGZA 4UXNA 2B0LA 3ZQ7A 3KP6A 1FSHA 2DW4A 1ZG5A 3KEOA 1FBUA 1ZG3A 1MDMB 1P2FA 4ZYGA 1W7PB 1XMKA 2V79A 2Y75A 5CVUA 1R00A 3HRSA 3SXYA 3F8CA 2J5OA 2EV0A 3F6VA 3JSPA 2AS5F 1KU7A 3WGGA 1MJBA 4RB1A 4AIJA 3GWZA 3ERED 4KNYA 1T0FA 4U7BA 3JAMZ 1W5SA 3VB2A 2OD5A 3ZN0A 2VBXA 3F8BA 4KMFA 1CGPA 4RB3C 3IWZA 2EJRA 4GYIA 4A5MA 2ADUA 2ZO4A 2VT3A 3GZ5A 1QBJA 1DPRA 2O0YA 1J9IA 3BWGA 3MEXA 3RPUA 2BE5F 4UNOA 4GO1A 2HOEA 2FF4A 2F5FA 3KLOA 1J2XA 3EUHA 2QUFA 1HKTA 1MDMA 3E6DA 3SZPA 2GIVA 4PGHA 3F8NA 5CVRA 2VXZA 1Z6TA 4HDVA 3FZVA 1T38A 3P7NA 4I98B 3DQVC 3ECOA 2DO7A 5ICGA 3HSRA 3HIFA 1XN7A 2BBYA 1B4AA 2P4WA 1D8KA 1R1VA 2HEOA 2P8TA 1Z6RA 3ROUA 3P9CA 1XSXA 1O3RA 2EK5A 3HYIA 1NHAA 5ILSA 1QZYA 4IHSA 2FNPA 1Z91A 1RUNA 2CYYA 1YS6A 1XSVA 3EETA 2IPQX 3TOBA 3ULQB 4M73A 2QVOA 4L0ZB 1DPUA 1LEBA 3L7WA 2H94A 3D0SA 2EV5A 1PUEE 5LGUA 2VBWA 5LEKA 2K27A 3RYRA 1PP7U 4UVCA 2A61A 2ETHA 1U3EM 3K0LA 2A69F 4ESJA 2KJBA 1FBSA 1AOYA 5KK1A 6PAXA 3L00A 5D4SA 3ZMTA 1U6GA 4Y13A 4XSXF 1QGPA 2HZTA 3Q9VA 4WX9A 2Y48A 3RKXA 3FMSA 1WQ2A 2QM3A 4IJAA 4Q47A 2MLGA 2A68F 2LDUA 2XVCA 5DEQA 3QAHA 4H0EA 5CYVA 1LDJA 3WE3A 2XV4S 4ETSA 2FEZA 2ZBKA 5LHGA 2P5KA 1W5TA 1R7JA 3P9IA 3I71A 3NQOA 1IXRC 1LEAA 2M8EA 5L3DA 3I58A 4M9SA 2MC3A 3E5UA 3WGHA 2XAJA 1J5YA 3TDUC 1FYLA 3Q9SA 3BY6A 4ZH4F 3TDZC 2GXBA 2ZJ2A 5TJJA 2QBYA 4HX7A 5H6QA 3DFGA 2VC1A 5DD8A 1G6NA 4UVBA 3QP5A 4HA8A 2VT2A 4WCGA 3VFZA 1WSUA 4KICA 5IT3A 2WTEA 4BHCA 3C7JA 3IC7A 3CUOA 3DXJF 4HV6A 4U0WA 3O2PE 4LK0F 3WU1B 1IW7F 1SD6A 3GFLA 1OR7A 3K9TA 1WRJA 3U9GA 2A3SA 5E18F 5LHHA 5D8LB 2DBBA 4MGRA 3ZPLA 5LBQA 3PQJA 1SD7A 2MH9A 4EQQA 1ZH5A 2FXAA 3WTXC 2OQRA 2ZCWA 4O3MA 1I5ZA 2ISYA 2QYOA 4OIQF 5DCFA 3JW4A 2XUBA 3N4MA 2EWNA 3FM3A 3HHHA 3DV8A 2L54A 5JR3A 5HS9A 2COMA 2HKXA 4TV7A 5ED4A 4HQMA 2W84A 2CSOA 4MTDA 5L3CA 5F1RA 1R1TA 2CWEA 1YO5C 4G7HF 1TLHB 5HDNA 3J7AO 5DYMA 2KKOA 3FWEA 3HRUA 2IA1A 5HLIA 4WXDA 1ZRDA 5K1YA 1G3WA 1FSEA 4EV0A 4I2OA 5LGNA 1W4MA 2E7XA 4ZYDA 4M6YA 1KQ9A 4HBLA 3IRRA 5D6FA 1XGSA 1OYIA 3QU6A 3BROA 5LLQA 1TNTA 4MNUA 5HVQC 1LQ1A 3K69A 2BEOA 1MJ9A 2K02A 1RNLA 1C0WA 5D5VB 3T5XA 2QWWA 1RIOH 3D5LA 2M5WA 5E1ZB 2XRNA 3FM5A 4RGSA 2E1CA 1IN6A 3NRVA 5D5WB 3KE2A 3WTWC 1STZA 1FPQA 3DP7A 2OZUA 1EV7A 3ZP5A 3GFIA 4ON0A 2DPDA 5LRSA 2VOPA 1FOKA 3L09A 4EGYA 4WXCA 4XRFA 4OIRF 1P92A 4Y15A 3LFKA 3FMRA 2DAOA 1KGSA 4LFUA 3I64A 2P7VB 1YTYA 1BI2A 3B73A 2MD5A 1I1SA 2K4BA 3HRMA 3R0AA 2VONA 4LJZF 3GZ6A 2VN2A 2X0LA 3KP2A 1FT9A 4RB2C 4AWXB 1CF7B 1HQCA 4HF2A 1SMTA 4I09A 3HOTA 3F8FA 1J75A 2PBIA 5F6FA 4U0YA 4EM2A 1WWXA 2HDCA 2FU4A 4HX8A 1IF1A 2FBHA 4Y17A 4A6DA 3FXQA 1JXSA 1FNNA 4EGZA 3FXRA 2M87A 1FP1D 1HSTA 3V4GA 2F2EA 1R22A 2JPBA 4RGUA 2G7HA 4D0PA 2VODA 1YLFA 1JHHA 1FYMA 1JE8A 2P5VA 4F7ZA 3RKWA 3J80K 2BYVE 4UV9A 3BPXA 1U5TA 1D3YA
chains in the Genus database with same CATH superfamily
3S3MA 2JWTA 2Z99A 1HXDA 2RDPA 4BHPA 1Z3YA 2FQ3A 2PMZA 5HLHA 2EQRA 1U2WA 2NS0A 3SEZA 2BY0A 2IXSA 4FISA 5KVRA 3H3UA 3CDIA 1GDTA 1V3FA 2NAZA 3CTAA 5CVIA 1ZLJA 4HX4A 3TW6A 3IV5A 2DU9A 2LY2A 1FY7A 3OYGA 4XBFA 4KDPA 4XLPF 3MZYA 1WFXA 2ELHA 5C4JJ 2IS4A 2DA2A 3WU2C 1V5FA 4LOCA 3S2DJ 2D2WA 4N0BA 5EEGA 5J8FA 1O3TA 4KYWA 2DA7A 1IN5A 4BACA 3CUQB 1O57A 1IDYA 4O5VA 4A3EJ 1W7PA 3ABUA 2VOOA 3A1YA 3J80Z 5IT9K 4RB0A 2QQ9A 3LSKA 1R4NB 3J81Z 3BTCA 4OMYA 2PG4A 4EMSA 5D4RA 3OL4A 4ZTJA 3DU5A 1VQOI 2KT0A 3K10A 4QSHA 5GPCA 4IL6C 1BR2A 2ZXJA 4KMUX 2V1DA 4OAYA 2KLOA 1SC7A 2FRHA 4N9HA 1H9TA 2EA4A 2A5WA 2CQXA 3U1KA 1A35A 3KETA 2XAFA 4D7NA 1YX3A 2STWA 2CJJA 2DI3A 2BW3A 1HW5A 4EM0B 4B43A 2H09A 5JI6A 2XHKA 5E17F 2RNGA 3JSOA 3C1DA 2RNJA 2W25A 1S7OA 2P81A 2CQ7A 2V9KA 3N97A 2IT0A 3H9QA 1LB2A 3IAS2 2ZNZA 1R23A 2Q8KA 4G6QA 4UUTA 5FFZA 3SDBA 1K79A 1G8XA 3GFJA 1X58A 5LEJA 5EF6A 1SVMA 2WY7Q 3WTZA 3ZQHA 2K85A 3QOPA 1K78A 2PJRB 3ZR8X 3TW7A 4HLXA 3EYIA 3GTMJ 3G2BA 1G4DA 4MQ9F 3O8GA 3QOEA 3HOSA 3BG5A 2R7ZJ 3SHFA 4IRIA 1R58A 2OF7A 1J0RA 1P7JA 1P4XA 2LF8A 3SZGA 4I02A 3F9KA 3WTSC 2H27A 1DP3A 4HOBA 1U5TC 5F64A 4EJTA 2P5LC 4OAZA 1GV5A 3HTSB 4JK1X 1S5LC 1X3ZB 2UWMA 4DOZA 4RGRA 3I55I 2L3DA 3CCJI 2EFWA 1Z05A 3ZQQA 2IS6A 1HKQA 4RA2A 4I01A 1I27A 3KX2A 1UHSA 1YW9A 1T33A 1A5JA 1ZGJA 2UV1A 3C3WA 1UAAA 1JHFA 3HGGA 5DM6F 1U9NA 3LSGA 3BR2A 2XGXA 4AVZA 1ZREA 1Q1VA 2V26A 4UUSB 3LMMA 3K4MA 2Z3YA 4XKBA 1KQ0A 3PNTA 2BW3B 4HZFA 4U7DA 1QPMA 2TRTA 1MMAA 1B6AA 2O3FA 1JUPA 2LNBA 4IRHA 1I1GA 4NC6A 2HQNA 5DUIA 4PCQA 5L3GA 1KU9A 2QZ8A 2MSYA 1SEUA 3M8JA 3PIPF 2XKPA 2ZMEB 2QENA 3GMEA 3P9KA 4CHUA 2YR2A 2ZXIA 1MKMA 2BHZA 1SD5A 3OIQA 1KZHA 5IT9Z 1DGWY 2EB7A 4KIBA 5DCMB 2XSDC 5J4VA 3M1CA 2DMNA 1IN4A 4BUPA 4G8XA 4XIDA 4CYDA 3IH2A 3QPHA 2YX7A 2BZTA 2O6GE 3ECHA 2W48A 3DEUA 3OWTA 1SAXA 3IHUA 3QRFF 1JJ8C 1DDNA 2LY1A 2GAUA 1B1BA 2PQ8A 2QQBA 4DYCA 4EJOA 1GT0C 4ZC3A 2PLYA 5M5WJ 2Y0MA 4A69C 5FLXZ 5J8CA 2L4MA 1ORKA 4LG0A 2MABA 3ESWB 2NOGA 3BR3A 4BQAA 4AU7A 2QSGX 2RN7A 3I0TA 3SFZA 1ON2A 4UV8A 5LGTA 2VJ5A 1PDNC 3BZCA 5ICFA 4BXXJ 1TW3A 5J3LA 3A02A 2HDWA 1IV8A 3DBHB 2E1OA 1V5EA 1T08B 2IA2A 3PSFA 5CVJA 2HQAA 3JTGA 3KP3A 3MZ8A 5EGOB 1IGNA 1O7FA 3V8KA 3HRTA 1Y0NA 2XPWA 4CYCB 4ABZA 3I59A 1QZZA 2E2JJ 2PMHA 3L1PA 2STTA 4HDUA 2ID6A 4BAYA 2KFDA 1HA8A 2ISZA 1FWZA 4AD9A 5FLXK 1JTXA 2PN6A 3F6OA 1U0JA 2ACJA 2NVTJ 4F91B 3KZZA 2K3PA 2OUMA 1IN7A 1BR1A 2RVCA 1T56A 4PZJA 3K4NA 5FFXA 4DYRA 1XC5A 2ELJA 3FXJA 2QQ8A 3I9V2 1R71A 1YFHA 3C2GA 1G3SA 1P4AA 2F4MB 3IP4B 1G3YA 2YPRA 3REOA 5DCMA 4YG2F 2XAGA 3JCUC 3WG7H 4X6AJ 4IHVA 1IRXA 2ZKZA 2XROA 2A6HF 5M3MJ 4LLNA 1W5CC 3DTKA 1ON1A 3EDPA 4RM3A 3G73A 3KLNA 4HLYA 5CKTA 1XSDA 1J7KA 4CZCA 2KMUA 1IAWA 3OIPA 4G9YA 4ZDLA 4PSWA 1KYWA 2EBIA 2QQAA 4CCLA 3TQNA 3ZQCA 3SYTA 3R4KA 1ZELA 3LA2A 3WGIA 2CV2A 1UELB 2ZJRF 4U0VA 2GXAA 3MWMA 3LSJA 1F9NA 4P5OA 2OAZA 3ABMH 5EEHA 4C30A 4RAGA 3FXLA 4OU0A 2LKPA 4BL0B 5FD6A 1FC3A 4A3JJ 4A2UA 3DBLB 1UFMA 3H35A 5CVVA 2CH0A 3K6GA 3H92A 4A3GJ 2HU9A 3QYEA 2LLKA 5EGOA 2AXLA 1SFXA 1UHMA 3VODA 2R7XA 3HHGA 5DV5A 3JRGA 1FEXA 2YSRA 3BC8A 3IL2A 4L9VA 4HSRA 2HQRA 1K7AA 4QPQA 3G1OA 1MGTA 4ENKA 1UG0A 3BTIA 5BMZA 4P55A 3H5AA 2TCTA 1X4PA 1ZAOA 4XK4A 5K7ZA 3G4SI 2L5QA 2XGDA 4XNFA 2JA6J 4F92B 2VBZA 5JVTA 3NAUA 2G7UA 2L7KA 1MH4A 3AG4H 4L5JA 1BIAA 5FRNA 3EPZA 5J40A 4PJ0C 2CMPA 4S04A 1I6XA 2HNHA 3WG9A 2HR3A 1Z1DA 3S1QJ 2F48A 4FQGA 1XGNA 3H3VK 1ETKA 1ULYA 2WAQN 3HSFA 1AU7A 1I39A 4HEA2 4XKWA 3E97A 5FD5A 1S6LA 3LL7A 2IS2A 4UVAA 5L3FA 5E20A 3HDDA 2MA3A 2V6EA 2MH2A 2KIFA 1BW6A 4AIKA 3ZMZA 1H0MA 3DKWA 3HPHA 2IRFG 1X4OA 4UUVA 2LG4A 2QEXI 3W2AA 3WU0A 5E3NA 4QTRA 1YQAA 1B59A 1EA3A 1BN5A 1P9QC 3D5RC 2LH9A 2WB1N 2M3AA 1VQ8I 3PO3J 3F0CA 2XF7A 4MQVA 2PMUA 2R4GA 5EYRA 3OYFA 3E6BA 3I53A 2ME0A 3KYCB 5IP9J 3WTVC 1MBGA 5LD2C 3OIOA 1YRNA 2DA3A 3MFKA 4OINF 2YU3A 2LKSA 3F21A 2VIXA 3G71I 1OCOH 3DU6A 2R7RA 4YFKF 4IOCF 1NK2P 3TO6A 3CCVI 1ZYRF 2FA5A 2YUSA 4Q48A 3EQLF 3UNGC 2M7AA 4B4CA 3LAPA 2R93J 4B48A 5B5EC 3S3OA 1P4WA 1Y39A 3JR9A 3DPTA 4ASNA 3PJRA 2LR8A 1VQPI 3UR3C 5FLVA 3IUOA 2ZSIB 2JRMA 2R7SA 3CJNA 2IJLA 3DEEA 5ILUA 3GTLJ 2NS8A 1GVJA 3F3XA 1MBFA 4GXOA 4C3HJ 4BKXA 4BY1J 3S2WA 1RETA 1A04A 4ENJA 4NQWA 2MFZA 2Q2EB 3ZMVA 1H8AC 2Y30A 1FYKA 4KN7X 1NK3P 2LF7A 3KEQA 4A3BJ 2DK5A 3J7AY 1W7PD 3E6CC 1A6IA 1RKWA 3AG3H 4QLCU 5EJCA 1NTCA 2DPUA 1VNDA 2KPMA 2AQEA 3OYEA 4ESFA 4XQFA 5E3MA 5J4YA 1MMSA 1RPWA 4KN4X 2O8KA 4G12A 3HTUA 5HOOA 3AAFA 4QIWN 3BPVA 2Y31A 2DMPA 4KT5C 2O03A 3OR2C 4IOAF 3SEQA 5GTIC 2WC2A 2W1OA 2GWRA 2IW5A 3H0GJ 4FHTA 2WBMA 2EFOA 2PX9A 2G9WA 3J7ZI 2ZJQF 5M5YJ 2E35A 2EIJH 2HFHA 3QPTA 2HS5A 4W97A 4RLQA 4DBRA 3ABKH 4F55A 3PIOF 5BOXA 4HRIA 2R92J 3O6BB 4P9FA 4CXFA 2DMTA 2Y69H 2R7FA 3ONQA 4ZJZA 1G2HA 2JPCA 4ZTFA 1W36D 2QA4I 1ZHFA 2OQGA 3MQ0A 1PVEA 2FMYA 3HEFA 1HSJA 3GLXA 4AIDA 4BEHB 2EFQA 1VTNC 5K7HA 4LG0B 4RAYA 2LC2A 3GTGJ 3BR5A 1Z7UA 1H9GA 2BXZA 2JJ7A 2XC7A 3BCAA 4G7OF 2LOOA 3F23A 1B9NA 1K4TA 2BVLA 3BOQA 4A3MJ 2IEKA 3DPLC 1BBYA 1IN8A 3IAM2 3OS0A 2EA2A 4DW6A 1QVTA 3C2HA 2YS9A 2L9VA 1VZ0A 3A01A 2MGQA 1Y6IA 3FXUA 4YRVA 1OCRH 4EVIA 5IYBJ 4CZZA 2M4KA 4XLCA 3OYIA 3JREA 1R1UA 3QPSA 5GPAA 1Y0UA 2M7BA 2RGVA 1TQIA 1PYVA 3BG7A 3GTQJ 5JHUA 5K5OA 3V8JA 2WY8Q 1ZARA 2GIZA 2JT1A 1V54H 1N77A 4PUSA 4G6DA 3R0JA 4GCVA 2JZYA 4JX4A 2HGCA 1NG6A 1XGMA 2L9SA 3ZGKA 2UZKA 1B9MA 3HBLA 1IUYA 1G59A 1BM9A 1ONVA 3OL3A 1TT5B 3GXOA 4IXAA 3HOZJ 1XTAA 4DIQA 2VKDA 1Z77A 3BLYA 2IGMA 2OU2A 2JRTA 1SFEA 3RTRA 5LRRA 1AA7A 2KDOA 3CCLI 1DU0A 2GM4A 3OYBA 5IP7J 4X1EA 5H6RA 2EZKA 3CMYA 4EJUA 2PMZN 3UKGA 1XD7A 5FKMA 4LITA 4IHTA 4CH7A 2GZWA 5H2FC 1TQMA 5DD4A 3GW2A 4C2MJ 5JVGF 3RKQA 1BA5A 4L0YB 1XDSA 3CDLA 4GYGA 2P6TA 5HLGA 2CUZA 4JX6A 2X1EA 3RI4A 1IUFA 4HSTA 4MTEA 3KYDB 4LIUA 4WK8F 1Z21A 2OTLI 3OS1A 3JTHA 1KQ8A 2FMLA 2V6CA 2H8WA 5AIPA 2K9SA 3PNYA 2IP2A 3GVAA 4P96A 4WXHA 5CQEA 2HOTA 1EF4A 4AYBN 3DKYA 2JUGA 3K4JA 5GAEJ 5GAGJ 1U78A 2JA5J 1SVLA 1TQPA 2MBFA 4LD5A 3F22A 2LFBA 3OSFA 1ZRFA 1RR8C 2F5CA 3I5UA 3LOCA 3MMYB 3RJPA 4S0HB 3WTYC 1AKHB 4MFEA 1KA8A 1XB4A 2CFXA 3BG3A 3WTTC 1ZRCA 1ITYA 3AKZA 3I54A 3J7YJ 1QO0D 3CESA 1O4XA 2LK2A 1O7LA 3ERMA 4BBRJ 1MSEC 3FHNA 1BI3A 1FMWA 3LSMA 2LKXA 4AM3A 4IF4A 5J1YA 3KZYA 2W82A 2F4IA 3CCSI 3HOYJ 1R9TJ 2JMWA 5ILVA 5BS6A 3WODF 2D5VA 3BR6A 2LYCA 3LWFA 4YFNF 2OCCH 2XASA 2HXIA 1XMXA 4DQ2A 4HYEA 4NUBA 1LJ9A 4CCJA 2MYSA 1HCRA 4BDZA 5EDNA 3M9AA 2NVQJ 4JP0A 4EJWA 5BPDA 1IZ1A 4UHTA 1FIAA 1POGA 2L02A 3FDYA 2ID3A 1F43A 2R3SA 1S3JA 1WJDA 5KNLA 3CC4I 3VEPA 2EPFA 2XPVA 4PDKA 3ZQLA 3OYNA 5D8KB 1XS9A 4AVPA 2ZC2A 2O8XA 4LLGF 3S1MJ 4RAZA 3LQRA 4B09A 2LP0A 3WHCA 5IOYA 3LAJA 1RUOA 3GLLA 2WA0A 3H5RA 4L9TA 5DTDA 4B1RA 3DTIA 4GGGA 2P6SA 1ZTRA 3W2WA 2GLOA 1USSA 4CCNA 1HW2A 1KU2A 2O5RA 5J47A 2ESNA 3NWTA 3HZJA 2K7LA 1T98A 2DFIA 1OCCH 2FOKA 3ML6A 2Y9YA 3F72A 4IKFA 3G3ZA 4CSWA 1S29A 2DDAA 2K4JA 5EZHA 2KP6A 2NXNB 4IPAA 3ZN1A 1Y8QB 2ECCA 2X51A 1LNWA 3S1RJ 2VQCA 3TKYA 3AL0C 4Y52J 4XLHA 2NNNA 1L0OC 1XX5A 1I50J 2NVUB 3OYMA 2BY2A 1QRYA 3MKLA 3H9GA 3RYPA 4OIOF 4KITB 2E1NA 2DN0A 1BOBA 2K86A 4OOIA 4BH9A 2DT5A 5ICEA 1T2KA 3CCYA 4FT8A 5AONA 4HNTA 5E1WA 2KIMA 2HTSA 2TDXA 5J1RA 4S05A 3LSPA 3SQNA 4BE2A 5FRMA 5B3SH 1FTZA 2K9NA 3ZQGA 3V7CA 3E7LA 3ZMDA 3R60A 1WJBA 3GZNB 4BBSJ 1F4KA 1VQ5I 3M07A 2F6CA 3R61A 2MW8A 4M3BA 1K78B 1K6YA 3I4NJ 2IA0A 2XAHA 3COAC 2E34A 1WJ5A 1I6HJ 3BT9A 4E6KG 5L3BA 4A0XA 3CCEI 3AFHA 3EYYA 4B3XA 1MZBA 2MC4A 2V9VA 3WE2A 3HPGA 5K5RA 3P5JA 1MH3A 5J6XA 2DOAA 2P7CB 3TGNA 3HJEA 3GF2A 4ZYEA 3IH4A 3T1BA 1CF7A 2OBPA 5D5XB 3A0HC 3HKZN 3JRBA 4IVNA 2A6EF 1D8JA 4RS8A 2RKHA 4L9JA 4A0YA 2DODA 1UG2A 2Z5UA 4ZYHA 3DKXA 3QYFA 3V42A 3GX4X 4CDGA 2OTJI 2RQPA 3BJ6A 3DLLF 2E1MC 2CW7A 1E17A 1FOXA 3HC7A 2W85A 3OOPA 4E70A 3WHBA 5C44J 1D5YA 1ZLKA 1JGSA 2IGNA 4IRGA 2X4HA 2X1DA 3RCOA 3MKWB 2NNYA 2W7NA 2CUJA 2KIUA 2WV1A 4KUMA 3IWFA 3I59B 4MEYF 5M5XJ 4JOMA 2D1VA 2DA5A 1EH6A 1P6RA 4DNCA 1JJ6C 4UB8C 1JKOC 3CJQB 3E0JB 4AYBA 1XMAA 3FXKA 3M8FA 3PUBA 1T0FC 5F0CA 5E3LA 5HS8A 4E7ZA 2JK3A 3TP0A 1QNTA 5L3EA 1XPXA 2DFFA 2PEXA 3FKIJ 2E5NA 2R5ZA 4ENNA 2DA4A 2K9QA 2H6CA 3BTLA 4OWRB 4J01A 4RGXA 1B72B 3FMQA 2FOWA 3VOEA 5CJ9A 1D1BA 2VI6A 3U1DA 4V2FA 3ZOBA 3KCCA 4IX7A 3S16J 2CO5A 2PI0A 1FX7A 1TNSA 4KIGA 4I76A 2BVMA 3WTUC 4LB5A 1UCRA 1J59A 1DP7P 1QQIA 2KJCA 2XPUA 3K2ZA 1X1DA 3CLOA 2XKOA 2EZHA 1M1EB 2VL8A 3RPQA 1T39A 2WADA 3ASNH 2BV6A 4A12A 1ODDA 2AO9A 5K7FA 4LB6B 2EFPA 2DTZA 5A2QZ 4CCOA 4MHGA 1Q1HA 5IPAA 1LVAA 4QWQA 2FBIA 4K2EA 1OJLA 2NOJB 2ZSHB 1V4RA 2XF6A 4QPOA 3KIOA 3I4MJ 1JT6A 3W6JB 3IRQA 5FB2A 2YU9J 1I3QJ 2LVSA 2BGCA 1WI3A 4V2GA 3C18A 4IEJA 2X6OA 4A0ZA 2HWVA 5IOZA 1E0EA 1R5GA 2MLKA 4B8XA 2FX0A 4BJ5C 1YG2A 2NYXA 5GADJ 4AIHA 2X85A 4YELA 1XCVA 4NBQA 5CLSA 4ENMA 2VPRA 2UXNA 1BL0A 4XRSA 1FP2A 1S9HA 3M4OJ 3A4CA 1IXSB 3L9FA 4M72A 1A6QA 1U5TB 3ZMSA 4U88A 4RBOA 3KP5A 1D5VA 2XGCA 5D5UB 2Q2EA 5B66C 2V1UA 1T6SA 2L4AA 2QF7A 2Z9OA 1ERDA 3LA7A 2ZFWA 2GXGA 2VKVA 1X1AA 2H6BA 2VE9A 4Y4RA 4FE7A 1SMYF 3MAJA 2VE8A 2EV6A 4YEJA 2QCOA 1IRGA 1FZPB 2GQQA 4FX4A 2I5UA 1G3TA 3M8EA 2J5PA 4ZDPA 2FD5A 2F5VA 3K1MA 3CZ6A 2FNAA 3Q0UA 3BQZA 1HW1A 1AWCA 3ZMUA 3GYHX 2M2EA 4II3A 2GA1A 4XRSG 3OYCA 3CO6C 1T95A 1D1CA 2VQGA 3OS2A 2QSHX 1O3SA 2M1BA 1JI8A 2DJIA 3A0BC 3S17J 3CD6I 4N9IA 3K4KA 3RDIA 4JBAA 4II2A 2M8GX 2COBA 2AQFA 4HNUA 1W0UA 3E6MA 2H8RA 4CICA 4U87A 1FLIA 4N4NB 1WH7A 1OCZH 2ICWG 4I0AA 2LD5A 2F5EA 4MEXF 3FIWA 4G94A 4AC0A 1YHQI 1YJ9I 1Z7LA 1FOYA 1MJAA 1WI9A 3BJOA 4OIPF 3RZOJ 2LRDA 1LVKA 1GXPA 1SFUA 1RR7A 4GFBA 2M45A 2QBYB 1OMIA 4C2UA 2X9DA 4MIMA 5HS7A 3H1CA 3F8MA 1X1CA 2H1LA 4RAFA 2R7TA 3CCUI 3CCRI 4XSZF 2JA2A 4D5FA 4L5IA 2K9LA 3ISPA 1OPCA 4M71A 4IHXA 1BOAA 5ERIA 1FTTA 5K5QA 1J09A 2ZXHA 2VJJA 4RM2A 3DF8A 4IZZA 2E19A 4R1HA 1YJNI 3BP8A 4BS9A 3CP2A 2F4OB 1ZN2A 2KQRA 1SANA 2JSCA 2N8GA 2MG4A 4BE0A 4FETA 1ACIA 4CO8A 5FGMA 3BR1A 1X1BA 1OYWA 1X19A 2ZMEC 1S8NA 2C6YA 3K4LA 2YX4A 4D1QA 2LREA 3HOXJ 1BW5A 2UXXA 3CUQA 2EINH 4G7ZF 2DLLA 3HOVJ 4M74A 1OQYA 3QPLA 5KAFC 1WJEA 3ABTA 4E7KA 3CO7C 5JFRA 2V1XA 4XLEA 2I10A 4PFOA 2IVMA 1RI7A 4YIRX 3L2CA 4MFDA 3E5XA 5HDKA 4KA4A 4R79A 2VJIA 1HBXG 5E8GA 2P0WA 3L2QA 3GO5A 1HKSA 5HDGA 3QP6A 1ETWA 4BNCA 3CP8A 1OLTA 4YIIA 2O7OA 1QHGA 3K4BA 1MSFC 3S3NA 2CG4A 1VQ9I 3R6SA 1YW8A 2OC6A 3D1NI 5ICCA 2PJPA 5FLMJ 3LQQA 2L7ZA 4BYYA 4B3AA 2F5DA 3HGYA 1XG1A 3PQKA 1DU6A 5LHIA 1UZCA 2WWYA 1PP8F 1OKRA 5E8IA 4PJMA 2VKEA 4PSXA 5B1AH 2OJED 2D1HA 1H89C 1USTA 4M9XA 5TRDA 3PSIA 1MMDA 4FX0A 1SAUA 1BI1A 1U8RA 1WJFA 3SFIA 4IHWA 4E7IA 3RIRA 1XCBA 2EFNA 1TW2A 1A31A 3FISA 1BC7C 1ZK8A 2VUMJ 3LA3A 3OV8A 2ELKA 3PO2J 3ASOH 2I8DA 3FF5A 4Q5SF 4PK4A 1LDDA 1XDUA 1UHWA 2M0CA 4YFXF 2XAQA 4A3CJ 4HAMA 5EEAA 1O3QA 4BXUA 3LSIA 3SJMA 2Y2ZA 4Z2YA 3VSKA 3E5QA 3KP4A 5JLWA 1F1ZA 2CW8A 1LE8A 3H0DA 1QZEA 1NH3A 2R5ZB 1B72A 3EUKL 4FE4A 1I3AA 3JRIA 2K9MA 2JA7J 3L2UA 2WB1A 2FSWA 2X1CA 4CYCA 2E7WA 2JSPA 3Q0WA 4L9NA 3T0YA 5F0FA 4Y7NJ 2W24A 3GUDA 5BPIA 4BQNA 4KFCA 2RAEA 2XB0X 5BNGA 2DTRA 1RC9A 3K1NA 5DDGA 1HDPA 1X3UA 5FO5A 1YIOA 4R8HA 4PFPA 2HZDA 4XLNF 2PFBA 5TISC 2HKOA 1W1WE 4HV5A 4LK1F 2DQRA 2RC4A 4BJTA 5GTHC 1LFUP 1HOMA 3H3ZA 5F08A 1X2MA 2JUCA 2KRFA 3JRCA 4HW0A 2ESHA 4E4HA 3FK7A 2HTJA 2O61A 3OYJA 1H88C 2DQLA 3JRFA 3A2KA 2HDDA 5TGTA 3FX3A 3V8LA 4GDFA 2DCEA 2FE3A 5C3EJ 3I4PA 2AXTC 5EG0A 3BJAA 1OYYA 3U2RA 3JAMK 3W6KB 1D1AA 4CUGA 2DFHA 1ETOA 4IQ4A 3K1PA 1WJCA 4EM1A 2A5YB 4KIFA 2DJNA 1GUUA 1GXQA 3KFWX 3BG6A 1UB9A 1V55H 5IY5H 3CUQC 2VC0A 5DUKA 4JQFA 2HYGD 1EH8A 3PL8A 4BDYA 4V19K 2ZMEA 2DK8A 1WKMA 4XICA 1EH7A 1DUXC 1TTYA 3OYKA 3C2BA 3SZTA 1MIJA 2CQKA 3I56I 4E7JA 2Q0OA 2VB6A 3CQZJ 3IKTA 2HYFA 4UB6C 4Q4ZF 4M6XA 2Z33A 3V7SA 4A93J 4CCMA 3CDHA 3B02A 2X48A 3HSEA 3GEZA 2FBKA 5B1BH 2QLZA 1RZ4A 1SD4A 2CW0F 3IKVA 2VQHA 3KP7A 4M3EA 1Z3XA 2HYJA 3M3YJ 2CGPA 2W57A 1KONA 5A2QK 2BY1A 1LKXA 3OR1C 1OCPA 4EJVA 1GHCA 3PFIA 2V9PA 3KYLA 2NS7A 1YS7A 3J81K 3ZXSA 5FKKA 5IYDJ 2RQQA 4YIFA 2H1KA 4HF0A 3HUGB 1HLVA 4NB5A 4EATA 3HM5A 3M7GA 4LLLA 1AKHA 2ZJPF 5BQTA 1ZR4A 1NG7A 2GA2A 2JTVA 1BJAA 4BHBA 5H20A 3TO7A 4PGGA 2MD0A 3AG2H 2GOXB 3EUAA 1MNDA 4Z6YA 1JGGA 3W6VA 1E2XA 1BIBA 4M9ZA 5KAIC 3T8RA 1S7EA 4NC7A 4FASD 3V7RA 1L3LA 2R7DA 1YW7A 1VQKI 2R7VA 5DS9A 1VF9A 2M30A 2VKHA 3W3CA 3RKYA 4A5NA 1ZGAA 1MBHA 2W00A 2E36A 2EIMH 2IAIA 2M34A 2OZ6A 1TBXA 4RDUA 4XONA 1YYVA 2ZNYA 2ZXWH 4A6EA 4I0BA 2RV8A 3VWBA 2L01A 3HUGA 4LMYA 4ZZDA 1TWFJ 1ETXA 4ZZLA 3QQAA 2D45A 2A6TA 2LSOA 1WGXA 4I7HA 4B44A 1BC8C 3E1SA 3Q0VA 1K83J 3FHZA 4L18B 2XIGA 5D6EA 2R0QC 1S72I 1REPC 4DYQA 3E3VA 1B8IA 4IHYA 1QA6A 1WHUA 1E3PA 4P1WA 2OA4A 3Q5FA 2NRAC 4HQEA 1QU3A 4LGWA 2HVQA 3M1EA 1JKPC 2WV0A 1LDKB 3K2AA 4WF2A 3O3KA 5E1XA 1W36C 2XAUA 3MZHA 3TOAA 3OYDA 2A07F 4WWCA 3GFMA 1S7AA 1R36A 2DFEA 2E60A 1FBQA 4NC8A 1KU3A 1Z9CA 1TZLA 3BR0A 1ZG1A 3BDDA 2HOSA 3NARA 2BXYA 1OR7C 1K6OA 2VJ4A 2VXDA 2K3FA 2EZIA 1IO2A 3ELKA 5KCMA 1DGRM 3MCZA 3BZ6A 3LSTA 2EIKH 5AIQA 2VBYA 3GTJJ 1BI0A 4O6JA 2B9SA 3TBIA 4OMZA 1F5TA 4HF1A 3NEUA 5FJ8J 4KJZA 1YITI 1MD0A 1OCTC 3TO9A 4BQQA 2IS1A 2DOEA 3MVPA 1KYZA 3T8TA 1OISA 1R5HA 1IRFA 3VYTB 3QU3A 4C3JJ 4P9UA 1MW7A 1XGOA 5HODA 1FOWA 5FKLA 1RESA 1IXCA 3JRDA 4ESBA 3KZIC 2HVSA 4NHJA 4CGZA 3ZQIA 4UXNA 1JKRC 2B0LA 3B6AA 3ZQ7A 3KP6A 1FSHA 2DW4A 1ZG5A 3KEOA 1X1PA 2CFOA 1FBUA 1ZG3A 4XORA 1MDMB 1P2FA 1TC3C 1QPIA 4ZYGA 4D7MA 1W7PB 4RLFA 3HOUJ 5GP9A 1XMKA 2V79A 2EH3A 2Y75A 4D9JA 4PJNA 4CCKA 5CVUA 3DLAA 1MNMC 1R00A 1VI0A 3HRSA 1ETVA 1YE9A 3SXYA 2LBFB 3F8CA 2DT6A 2EV0A 2J5OA 3F6VA 3JSPA 2AS5F 1WCMJ 3VPRA 2GBYA 1R5ID 2K5CA 1SFKA 2QGUA 3LFUA 2KIQA 1R49A 1KU7A 1D0ZA 5KHDA 2HOAA 3GBGA 1MBJA 2IBDA 3WGGA 1MJBA 4RB1A 4AIJA 1FMVA 3GWZA 4ZYAA 1WH5A 2CU7A 3ERED 1T0FA 4KNYA 3H36A 2M4GA 1W5SA 2Z2SB 3JAMZ 4U7BA 3VB2A 4KISA 2OV7A 2OD5A 3A01B 3DEWA 5J1UA 4UY8I 2CRGA 3ZN0A 4D5CA 4E7HA 2VBXA 3ZCOA 1VQLI 2E1MB 2XGEA 3D5SC 3F8BA 4BU2A 2L2OA 4BY7J 1ENHA 4KMFA 1CGPA 4RB3C 3IWZA 2EJRA 2HQ5A 4GYIA 4A5MA 3U21A 1APLC 3VYUB 2WAEA 2ADUA 2ZO4A 3OYLA 2VT3A 3GZ5A 1QBJA 1DPRA 1LE8B 2O0YA 5HLTA 3BWGA 3MEXA 4GRIA 1K61A 1J9IA 2KRCA 3G1LA 3RPUA 2BE5F 4UNOA 3CMEI 2ZB9A 2DYRH 4GO1A 3ZRGA 2HOEA 2FF4A 3H9JA 2F5FA 1TL8A 2LY9A 1Y1VJ 3KLOA 1J2XA 3EUHA 2QUFA 3GTPJ 2CV0A 5EG0B 1HKTA 1SVOA 1MDMA 3E6DA 3GCMA 3SZPA 2GIVA 4PGHA 3F8NA 1YI2I 3GTOJ 5CVRA 2VXZA 1VQ7I 2LMDA 1Z6TA 1Y8RB 2JVHA 3JRAA 1E3OC 4BEHA 3FZVA 4HDVA 2JQ7A 3DBRB 1T38A 2DT7B 3P7NA 3N05A 4I98B 3DQVC 2LBFA 2RREA 3ECOA 2FJ1A 2DO7A 1ZGWA 5ICGA 3HSRA 2BY3A 3HIFA 1Z0XA 3K70C 1XN7A 2BBYA 3PNVA 3LNQA 1LFBA 2QKMB 3HOWJ 5E79C 1B4AA 2P4WA 1K4SA 1D8KA 1U9OA 3B6CA 1R1VA 2HEOA 2P8TA 1Z6RA 2CV1A 3MD2A 3ROUA 3G1MA 3P9CA 1XSXA 4M3DA 2EILH 1BJZA 3DTEA 1AHDP 1VFCA 1O3RA 2JVGA 4M6VA 2EK5A 3HYIA 2E71A 1F36A 4C3IJ 2WAFA 1NHAA 3QWLA 1W0TA 5ILSA 1QZYA 4IHSA 4FTHA 2FNPA 2K40A 1Z91A 5F1JA 1RUNA 2CYYA 5E3OA 1YS6A 4E7LA 3G6EI 3ZQFA 1IRZA 1XSVA 4IO9F 3EETA 4A3LJ 2IPQX 3K4CA 3TOBA 2Y0SA 3ULQB 3RZDJ 4M73A 2QVOA 3K70D 4L0ZB 1GLNA 4DJAA 1LEBA 1DPUA 3L7WA 2H94A 3D0SA 2EV5A 1PUEE 5LGUA 2VBWA 5LEKA 2HPMA 2L9NA 2HPIA 2K27A 3RYRA 3OSGA 1PP7U 4XOTA 1DQUA 3TP3A 3CLQA 4UVCA 1UMQA 2Z1DA 4PJJA 1CQTA 1HC8A 3QYBA 2R5YA 4DZJA 5EZGA 2A61A 2DDBA 2ETHA 3HG9A 3K0LA 2A69F 1U3EM 1WZ2A 1MNEA 4ESJA 2V7FA 1GV2A 3OYHA 1B8IB 1RKTA 2KJBA 1FBSA 1EJ9A 1AOYA 5KK1A 6PAXA 3L00A 5D4SA 3ZMTA 1U6GA 3AL0B 1QHHD 4Y13A 4UUSA 3CJRB 4XSXF 1QGPA 4XMYA 2HZTA 3Q3SA 3Q9VA 4A3DJ 4M3FA 1ZKGA 3OYAA 3PM1A 4WX9A 2ME6A 4X0GA 2AHQA 3CC7I 2Y48A 3RKXA 2DOFA 1X2NA 3JRHA 4NQWB 3FMSA 1BR4A 1WQ2A 3PFYA 3DWLE 2QM3A 4AUXA 1VQ6I 4IJAA 4F93B 4Q47A 4XN0A 2MLGA 2NVYJ 2A68F 4DGWB 4HNVA 2LDUA 2M9HA 2XVCA 1LPQA 1RRJA 5DEQA 1A36A 1JUMA 3S93A 4MO7A 2JN6A 3QAHA 4H0EA 5CYVA 3IH3A 2ECBA 1LDJA 3WE3A 2XV4S 1EKEA 4ETSA 2FEZA 3HB9A 2ZBKA 9ANTA 5LHGA 2R7QA 2P5KA 1W5TA 2Z16A 3BQYA 1WVRA 3S32A 2A05A 1TWHJ 1R7JA 3P9IA 3I71A 1OFCX 2GOMA 3NQOA 1HDDC 2PJRA 2L7MP 1IXRC 2HVRA 1LEAA 2B63J 2DA1A 2M8EA 4ANJA 1ZR2A 5L3DA 3I58A 1V5GA 4M9SA 2OPTA 5LFAA 2MC3A 3L2VA 1VQNI 2DYSH 2Y0SN 3E5UA 3WGHA 2X6WA 3KPHA 2XAJA 1YIJI 4LG3A 1J5YA 3TDUC 1FYLA 2KZGA 2WAQA 3BY6A 3Q9SA 4ZH4F 3RQIA 3TDZC 1QVUA 2ZJ2A 4A3IJ 2IGKA 2GXBA 4E7SA 1YOVB 2BOLA 5TJJA 2QBYA 4HX7A 5H6QA 3DFGA 5C4XJ 2VC1A 2E5ZA 5DD8A 2BHYA 1G6NA 4W1UA 1LUJB 4CA0A 1IDZA 1JTYA 4UVBA 3QP5A 4HA8A 4B47A 3GTKJ 3LSRA 4EEFG 2JA8J 2KHMA 2VT2A 4WCGA 3VFZA 3CCQI 1TWCJ 4A3KJ 1WSUA 4KICA 5IT3A 2WTEA 5JLXA 1JUSA 3OOUA 4BHCA 1VQMI 1D0YA 3C7JA 2QSFX 5DM7F 3IC7A 2Q1ZB 3CUOA 1MMNA 4JYKA 3DXJF 4DBQA 4HV6A 4U0WA 1YX5A 3O2PE 3HKZA 3NWSA 4LK0F 1TP4A 3WU1B 3QODA 1FJLA 1IW7F 1SD6A 3RPUD 2M0MA 1OR7A 3GFLA 3K9TA 1WRJA 3U9GA 2DMUA 3FXOA 2A3SA 5E18F 5LHHA 5D8LB 3CF5F 3BZKA 5CQGA 5FKNA 3S2HJ 2DBBA 2DMQA 4MGRA 1P7IA 5HNHA 4G6TB 4J00A 3ZPLA 5LBQA 3PQJA 4XLFA 1SD7A 3L2WA 1T8IA 2MH9A 1ETYA 4EQQA 1ZH5A 2FXAA 2ZCWA 1MMGA 2OQRA 4H4KC 3WTXC 2ISYA 1I5ZA 2QYOA 4O3MA 4OIQF 2VLAA 5DCFA 3JW4A 2CUEA 2XUBA 3TL4X 5F04A 3N4MA 3RSNA 3X2QH 2EWNA 3FM3A 3HHHA 3DV8A 2L54A 3L2RA 1TT0A 5JR3A 5HS9A 4IQJA 4ZDOA 2COMA 4J19A 1D0XA 2HKXA 4TV7A 5ED4A 3FBNB 3DCFA 4HQMA 2W84A 3HL2A 2CSOA 4MTDA 1N78A 5L3CA 3BCBA 2V4JC 3S15J 5F1RA 5M3FJ 1HF0A 2CQQA 1R1TA 3EUHC 4DZPA 2CWEA 1YO5C 4G7HF 1TLHB 3K7AJ 3ABLH 5F27A 5HDNA 1R6RA 3J7AO 5DYMA 2KKOA 4N4OB 5IYCJ 1JKQC 2R5YB 1SFOJ 3FWEA 2DA6A 3HRUA 2XB5A 2IA1A 3CF2A 4WXDA 5HLIA 3RQ4A 4BJ6C 4XKCA 1ZRDA 3BTJA 5K1YA 3FBIB 1JT0A 1G3WA 1R4MB 3S8PA 1ZQ3P 1FSEA 4XOPA 4EV0A 2XDVA 4I2OA 1U8BA 2R7UA 1WPKA 3VDXA 1W4MA 5LGNA 3CMAI 2Y9ZA 2E7XA 2XRLA 5HNFA 4ZYDA 3A03A 1N75A 1KQ9A 4M6YA 4HBLA 3IRRA 5D6FA 4PJLA 4MLOA 2CQNA 3BG9A 1XGSA 3MN2A 1IJWC 1OYIA 3QU6A 2X6XA 3CMMA 3MKZA 3BROA 2L0KA 2CUFA 5LLQA 3FK6A 2OCEA 3HXLA 4JX5A 1TWAJ 2ZFUA 2HXOA 1TNTA 3FKJA 4XLAA 4C9YA 4C2TA 1MBKA 4MNUA 4F3QA 5HVQC 3AG1H 1LQ1A 3K69A 2BEOA 2K02A 1MJ9A 1RNLA 1TWGJ 3OMYA 5D5VB 1C0WA 3T5XA 2QWWA 1RIOH 2V1NA 3D5LA 2M5WA 5E1ZB 2R7OA 4F52A 2XRNA 3W2VA 3PUFA 3FM5A 4RGSA 3NRVA 1IN6A 5D5WB 2E1CA 2FQ4A 3KE2A 3WTWC 1STZA 1FPQA 3OY9A 5IP6A 3DP7A 3VSLA 2L7FP 2OZUA 1EV7A 2E2HJ 3ZP5A 4Y3OA 3GFIA 4ON0A 2L9RA 2DPDA 2HI3A 5LRSA 4Y33A 2VOPA 1FOKA 3L09A 3S1NJ 1PUFB 1E3HA 4EGYA 4BXFA 4L5EA 4WXCA 4XRFA 4OIRF 1GVDA 3CCMI 1P92A 4Y15A 2R7WA 3LFKA 3FMRA 2DAOA 1KGSA 4LFUA 3VYRB 3I64A 2P7VB 5FROA 1YTYA 1FIPA 1BI2A 4XM3A 2O9LA 1Z67A 3LSHA 3B73A 2MD5A 3SDGA 1I1SA 2E2IJ 2K4BA 3HRMA 3R0AA 4BE1A 3I3LA 5F0HA 2KDZA 2IGOA 3O8HA 2VONA 4LJZF 3GZ6A 2VN2A 2X0LA 2FUG2 3KP2A 4XN3A 1LFPA 1FT9A 1PJRA 2XSJC 4RB2C 2XF5A 4AWXB 1CF7B 1HQCA 2G0EA 2KZVA 4HF2A 1SMTA 4I09A 2LTPA 1X3WB 1IV6A 3HOTA 3F8FA 5JHFA 1IG7A 1J75A 3CC2I 4XR6A 4KT6A 3DPUA 1MBEA 4I99C 2PBIA 4M3GA 2KL4A 4BQOA 5GAHJ 1YJWI 2UUZA 4NNJA 2W4SA 5F6FA 1N25A 4ITVA 4U0YA 4HG2A 4EM2A 2CS3A 1WWXA 4XL9A 4NDLA 5FKOA 2HDCA 2FU4A 4HX8A 4XKVA 4I6ZA 1IF1A 2FBHA 4Y17A 4A6DA 3H5NA 3FXQA 3VYSB 1JXSA 2DXIA 1FNNA 4EGZA 3S14J 3KEYA 3FXRA 2M87A 1FP1D 2KISA 2VASA 4FCYA 1YRNB 1HSTA 2B7EA 4RMNA 3V4GA 2F2EA 1R22A 3CJTB 4A3FJ 2JPBA 1IC8A 2VQLA 1VQ4I 2KRHA 4RGUA 2VPLA 2G7HA 2X6YA 3TEDA 4D0PA 1ETQA 1Y56A 1PUFA 2VODA 1YLFA 1JHHA 1FYMA 1JE8A 2P5VA 2NVXJ 4BGDA 4F7ZA 3RKWA 4XRMA 5CPRB 1Y1WJ 4LIVA 3MKYB 3TMOA 3J80K 1WJAA 2BYVE 4UV9A 3BPXA 2QKLB 2EZLA 1U5TA 1D3YA 3FXMA 1UJ8A 4HPQA
chains in the Genus database with same CATH topology
2Z99A 1HXDA 2RDPA 4BHPA 2FQ3A 5HLHA 1U2WA 2NS0A 5KVRA 3H3UA 1V3FA 2NAZA 3CTAA 5CVIA 1ZLJA 4HX4A 2DU9A 1FY7A 4XBFA 4KDPA 4XLPF 3MZYA 2ELHA 2D2WA 4N0BA 5EEGA 5J8FA 1O3TA 4KYWA 1IN5A 3CUQB 1O57A 4O5VA 1W7PA 3ABUA 2VOOA 3J80Z 5IT9K 4RB0A 2QQ9A 3J81Z 4OMYA 2PG4A 4EMSA 5D4RA 2ZXJA 4KMUX 2V1DA 1H9TA 2FRHA 4N9HA 2EA4A 3KETA 2XAFA 2STWA 2DI3A 1HW5A 4EM0B 2H09A 5JI6A 2XHKA 5E17F 3JSOA 3C1DA 2RNJA 2W25A 1S7OA 3N97A 2IT0A 1LB2A 2ZNZA 1R23A 2Q8KA 4G6QA 5FFZA 1K79A 3GFJA 5LEJA 3WTZA 3QOPA 1K78A 4HLXA 3EYIA 1G4DA 4MQ9F 3HOSA 3SHFA 4IRIA 1R58A 1J0RA 1P4XA 2LF8A 4I02A 3WTSC 2H27A 4HOBA 1U5TC 5F64A 4EJTA 2P5LC 3HTSB 4JK1X 2UWMA 4RGRA 2L3DA 2EFWA 1Z05A 1HKQA 4I01A 1I27A 1YW9A 1ZGJA 3C3WA 1JHFA 2XGXA 1ZREA 2Z3YA 1KQ0A 4U7DA 4HZFA 1QPMA 1B6AA 2O3FA 2LNBA 4IRHA 1I1GA 2HQNA 5DUIA 4PCQA 5L3GA 1KU9A 2QZ8A 2XKPA 2ZMEB 2QENA 3P9KA 4CHUA 2YR2A 1MKMA 1SD5A 5IT9Z 2EB7A 4KIBA 5DCMB 1IN4A 4G8XA 4CYDA 3QPHA 2YX7A 2O6GE 3ECHA 3DEUA 1SAXA 3IHUA 3QRFF 1DDNA 4EJOA 2GAUA 1B1BA 2PQ8A 2QQBA 2PLYA 2Y0MA 5FLXZ 5J8CA 2L4MA 4LG0A 4BQAA 2RN7A 3I0TA 3SFZA 1ON2A 4UV8A 5LGTA 1PDNC 5ICFA 1TW3A 2IA2A 5CVJA 3JTGA 3KP3A 1O7FA 3V8KA 3HRTA 3I59A 1QZZA 2PMHA 2STTA 4HDUA 4BAYA 2ISZA 1FWZA 4AD9A 5FLXK 2PN6A 3F6OA 2ACJA 3KZZA 1IN7A 5FFXA 2RVCA 4PZJA 1YFHA 1G3SA 1P4AA 1G3YA 2YPRA 3REOA 5DCMA 4YG2F 2XAGA 2ZKZA 2XROA 2A6HF 4LLNA 1ON1A 3EDPA 3G73A 3KLNA 4HLYA 1XSDA 1J7KA 1IAWA 4G9YA 1KYWA 2QQAA 3TQNA 3R4KA 3LA2A 3WGIA 4U0VA 3MWMA 1F9NA 4P5OA 2OAZA 5EEHA 4OU0A 2LKPA 5FD6A 1FC3A 4A2UA 1UFMA 5CVVA 3H92A 2AXLA 1SFXA 1UHMA 3VODA 3HHGA 5DV5A 2YSRA 3IL2A 4L9VA 1K7AA 2HQRA 1MGTA 4ENKA 5BMZA 4P55A 1ZAOA 2VBZA 5JVTA 2G7UA 4L5JA 1BIAA 4S04A 3WG9A 1I6XA 2HR3A 1Z1DA 1XGNA 1ULYA 3HSFA 3E97A 5FD5A 1S6LA 4UVAA 5L3FA 5E20A 2MA3A 2MH2A 2KIFA 1H0MA 4AIKA 3ZMZA 3DKWA 4UUVA 2IRFG 3WU0A 1YQAA 1B59A 1BN5A 4MQVA 2PMUA 3E6BA 3I53A 3WTVC 3MFKA 4OINF 2YU3A 3F21A 4YFKF 3TO6A 1ZYRF 2FA5A 4Q48A 3EQLF 3LAPA 1P4WA 3DPTA 4ASNA 3CJNA 2IJLA 5ILUA 1GVJA 3F3XA 4GXOA 3S2WA 1A04A 4ENJA 4NQWA 3ZMVA 1FYKA 4KN7X 2LF7A 3KEQA 2DK5A 1W7PD 3E6CC 4QLCU 2DPUA 4ESFA 4KN4X 3HTUA 5HOOA 3AAFA 3BPVA 4KT5C 2O03A 2WC2A 4FHTA 2GWRA 2IW5A 2EFOA 2G9WA 2HFHA 3QPTA 2HS5A 5BOXA 3O6BB 4CXFA 4P9FA 2R7FA 2JPCA 1ZHFA 2OQGA 3MQ0A 2FMYA 1HSJA 3GLXA 2EFQA 1VTNC 4LG0B 4RAYA 1Z7UA 1H9GA 4G7OF 3F23A 1B9NA 3BOQA 3DPLC 1BBYA 1IN8A 2EA2A 3FXUA 4EVIA 4CZZA 1R1UA 1Y0UA 2RGVA 1TQIA 5JHUA 5K5OA 3V8JA 1ZARA 2JT1A 4G6DA 3R0JA 4GCVA 2JZYA 2HGCA 1XGMA 2UZKA 1B9MA 1IUYA 1BM9A 1ONVA 3GXOA 4IXAA 2OU2A 3RTRA 2JRTA 1SFEA 5LRRA 5H6RA 4EJUA 1XD7A 4IHTA 2GZWA 1TQMA 5DD4A 3GW2A 4L0YB 1XDSA 4GYGA 2P6TA 5HLGA 3RI4A 4MTEA 4WK8F 1KQ8A 3JTHA 2FMLA 2V6CA 5AIPA 2IP2A 3GVAA 4P96A 4WXHA 1U78A 1TQPA 2MBFA 4LD5A 3F22A 1ZRFA 2F5CA 3I5UA 3WTYC 3RJPA 1KA8A 1XB4A 2CFXA 3WTTC 1ZRCA 3I54A 1QO0D 1O7LA 1BI3A 4IF4A 3KZYA 5ILVA 5BS6A 3WODF 3LWFA 4YFNF 2XASA 4DQ2A 4HYEA 1LJ9A 3M9AA 4EJWA 5BPDA 1IZ1A 4UHTA 2L02A 2R3SA 1S3JA 3VEPA 4PDKA 5D8KB 4AVPA 2O8XA 4LLGF 4RAZA 3LQRA 4B09A 3LAJA 1RUOA 4L9TA 4GGGA 2P6SA 1USSA 1HW2A 1KU2A 2ESNA 2K7LA 1T98A 2DFIA 2FOKA 3ML6A 3F72A 3G3ZA 1S29A 2K4JA 4IPAA 3ZN1A 1LNWA 3TKYA 2NNNA 1L0OC 3RYPA 4OIOF 2E1NA 2K86A 4OOIA 4BH9A 2DT5A 5ICEA 1T2KA 4FT8A 5AONA 5E1WA 2KIMA 2HTSA 2TDXA 4S05A 3SQNA 3V7CA 3ZMDA 3R60A 1F4KA 3R61A 1K78B 2IA0A 2XAHA 3COAC 5L3BA 4A0XA 3EYYA 1MZBA 2V9VA 3WE2A 5K5RA 5J6XA 2P7CB 3TGNA 3GF2A 4ZYEA 1CF7A 3T1BA 2OBPA 5D5XB 4IVNA 2A6EF 1D8JA 4RS8A 2RKHA 4L9JA 4A0YA 4ZYHA 2Z5UA 3GX4X 4CDGA 2RQPA 3BJ6A 1E17A 3OOPA 2W85A 4E70A 1ZLKA 1JGSA 4IRGA 2X4HA 2NNYA 2KIUA 4KUMA 3IWFA 3I59B 4MEYF 2D1VA 1EH6A 1P6RA 4DNCA 1XMAA 3M8FA 5HS8A 1QNTA 5L3EA 2PEXA 4ENNA 2H6CA 4RGXA 3FMQA 3VOEA 5CJ9A 3U1DA 3KCCA 2CO5A 2PI0A 1FX7A 1TNSA 4KIGA 3WTUC 4LB5A 1UCRA 1J59A 1DP7P 1QQIA 2KJCA 3K2ZA 3CLOA 2XKOA 3RPQA 1T39A 2BV6A 4A12A 1ODDA 4LB6B 2EFPA 5A2QZ 4MHGA 1Q1HA 1LVAA 4QWQA 2FBIA 4K2EA 1V4RA 3W6JB 3IRQA 5FB2A 2BGCA 3C18A 4A0ZA 2HWVA 1R5GA 2MLKA 4B8XA 1YG2A 2NYXA 4AIHA 1XCVA 4ENMA 5CLSA 2UXNA 1FP2A 1IXSB 3L9FA 4M72A 1U5TB 3ZMSA 4U88A 3KP5A 1D5VA 5D5UB 2Q2EA 2V1UA 1T6SA 2L4AA 2Z9OA 3LA7A 2ZFWA 2GXGA 2VE9A 2H6BA 1SMYF 3MAJA 2VE8A 2EV6A 1IRGA 1FZPB 2GQQA 4FX4A 1G3TA 3M8EA 2J5PA 3K1MA 2FNAA 1HW1A 1AWCA 3ZMUA 3GYHX 2GA1A 3CO6C 1O3SA 2M1BA 4N9IA 3RDIA 4JBAA 3E6MA 4CICA 1FLIA 4I0AA 2F5EA 4MEXF 4G94A 1MJAA 1WI9A 3BJOA 4OIPF 1GXPA 1SFUA 2M45A 2QBYB 1OMIA 5HS7A 3F8MA 4XSZF 4L5IA 4M71A 3ISPA 1OPCA 1BOAA 5ERIA 5K5QA 3DF8A 4R1HA 3BP8A 1ZN2A 2JSCA 4CO8A 5FGMA 1OYWA 1S8NA 2C6YA 2YX4A 2UXXA 3CUQA 4G7ZF 2DLLA 4M74A 3ABTA 3CO7C 5JFRA 2V1XA 2IVMA 1RI7A 3L2CA 3E5XA 5HDKA 4KA4A 4R79A 1HBXG 5E8GA 3GO5A 1HKSA 5HDGA 3QP6A 4BNCA 4YIIA 2CG4A 3R6SA 1YW8A 5ICCA 2PJPA 3LQQA 4BYYA 2F5DA 3PQKA 5LHIA 2WWYA 1PP8F 1OKRA 5E8IA 2D1HA 1USTA 4M9XA 5TRDA 4FX0A 1BI1A 1U8RA 3RIRA 1XCBA 2EFNA 1TW2A 1BC7C 3LA3A 3OV8A 3FF5A 4Q5SF 1LDDA 1XDUA 1UHWA 4YFXF 2XAQA 4HAMA 1O3QA 4BXUA 4Z2YA 3E5QA 3KP4A 1F1ZA 2FSWA 2E7WA 4L9NA 3T0YA 2W24A 3GUDA 5BPIA 4KFCA 2DTRA 3K1NA 5DDGA 1X3UA 5FO5A 1YIOA 4R8HA 4XLNF 2PFBA 2HKOA 4HV5A 4LK1F 2DQRA 2RC4A 3H3ZA 2KRFA 4HW0A 2ESHA 2HTJA 2O61A 2DQLA 3FX3A 3V8LA 2FE3A 3I4PA 3BJAA 1OYYA 3U2RA 3JAMK 3W6KB 3K1PA 4EM1A 2A5YB 4KIFA 1GXQA 3KFWX 1UB9A 3CUQC 2VC0A 5DUKA 4JQFA 2HYGD 1EH8A 2ZMEA 2DK8A 1WKMA 1EH7A 1DUXC 1TTYA 3SZTA 2CQKA 2Q0OA 3IKTA 2HYFA 4Q4ZF 4M6XA 2Z33A 3V7SA 3CDHA 3B02A 3HSEA 3GEZA 2FBKA 2QLZA 1RZ4A 1SD4A 2CW0F 3IKVA 3KP7A 2CGPA 2W57A 5A2QK 4EJVA 1GHCA 3PFIA 1YS7A 3J81K 4YIFA 4HF0A 4NB5A 3M7GA 4LLLA 5BQTA 2GA2A 2JTVA 1BJAA 4BHBA 5H20A 3TO7A 4PGGA 1E2XA 1BIBA 4M9ZA 3T8RA 3V7RA 1L3LA 2R7DA 1YW7A 2M30A 4A5NA 3RKYA 1ZGAA 2OZ6A 1TBXA 1YYVA 2ZNYA 4A6EA 4I0BA 2RV8A 2L01A 3HUGA 4LMYA 4ZZDA 4ZZLA 2D45A 2LSOA 4I7HA 1BC8C 3FHZA 4L18B 2XIGA 5D6EA 1REPC 3E3VA 2OA4A 3Q5FA 2NRAC 4HQEA 4LGWA 3M1EA 2WV0A 1LDKB 4WF2A 3O3KA 5E1XA 3MZHA 3TOAA 2A07F 4WWCA 1S7AA 3GFMA 1R36A 1FBQA 1KU3A 1Z9CA 1ZG1A 3BDDA 1K6OA 3ELKA 3MCZA 3BZ6A 3LSTA 5AIQA 2VBYA 1BI0A 4O6JA 4OMZA 1F5TA 4HF1A 3NEUA 1MD0A 3TO9A 1KYZA 3T8TA 1R5HA 1IRFA 3QU3A 4P9UA 1XGOA 1IXCA 4ESBA 4NHJA 4CGZA 4UXNA 2B0LA 3ZQ7A 3KP6A 1FSHA 2DW4A 1ZG5A 3KEOA 1FBUA 1ZG3A 1MDMB 1P2FA 4ZYGA 1W7PB 1XMKA 2V79A 2Y75A 5CVUA 1R00A 3HRSA 3SXYA 3F8CA 2J5OA 2EV0A 3F6VA 3JSPA 2AS5F 1KU7A 3WGGA 1MJBA 4RB1A 4AIJA 3GWZA 3ERED 4KNYA 1T0FA 4U7BA 3JAMZ 1W5SA 3VB2A 2OD5A 3ZN0A 2VBXA 3F8BA 4KMFA 1CGPA 4RB3C 3IWZA 2EJRA 4GYIA 4A5MA 2ADUA 2ZO4A 2VT3A 3GZ5A 1QBJA 1DPRA 2O0YA 1J9IA 3BWGA 3MEXA 3RPUA 2BE5F 4UNOA 4GO1A 2HOEA 2FF4A 2F5FA 3KLOA 1J2XA 3EUHA 2QUFA 1HKTA 1MDMA 3E6DA 3SZPA 2GIVA 4PGHA 3F8NA 5CVRA 2VXZA 1Z6TA 4HDVA 3FZVA 1T38A 3P7NA 4I98B 3DQVC 3ECOA 2DO7A 5ICGA 3HSRA 3HIFA 1XN7A 2BBYA 1B4AA 2P4WA 1D8KA 1R1VA 2HEOA 2P8TA 1Z6RA 3ROUA 3P9CA 1XSXA 1O3RA 2EK5A 3HYIA 1NHAA 5ILSA 1QZYA 4IHSA 2FNPA 1Z91A 1RUNA 2CYYA 1YS6A 1XSVA 3EETA 2IPQX 3TOBA 3ULQB 4M73A 2QVOA 4L0ZB 1DPUA 1LEBA 3L7WA 2H94A 3D0SA 2EV5A 1PUEE 5LGUA 2VBWA 5LEKA 2K27A 3RYRA 1PP7U 4UVCA 2A61A 2ETHA 1U3EM 3K0LA 2A69F 4ESJA 2KJBA 1FBSA 1AOYA 5KK1A 6PAXA 3L00A 5D4SA 3ZMTA 1U6GA 4Y13A 4XSXF 1QGPA 2HZTA 3Q9VA 4WX9A 2Y48A 3RKXA 3FMSA 1WQ2A 2QM3A 4IJAA 4Q47A 2MLGA 2A68F 2LDUA 2XVCA 5DEQA 3QAHA 4H0EA 5CYVA 1LDJA 3WE3A 2XV4S 4ETSA 2FEZA 2ZBKA 5LHGA 2P5KA 1W5TA 1R7JA 3P9IA 3I71A 3NQOA 1IXRC 1LEAA 2M8EA 5L3DA 3I58A 4M9SA 2MC3A 3E5UA 3WGHA 2XAJA 1J5YA 3TDUC 1FYLA 3Q9SA 3BY6A 4ZH4F 3TDZC 2GXBA 2ZJ2A 5TJJA 2QBYA 4HX7A 5H6QA 3DFGA 2VC1A 5DD8A 1G6NA 4UVBA 3QP5A 4HA8A 2VT2A 4WCGA 3VFZA 1WSUA 4KICA 5IT3A 2WTEA 4BHCA 3C7JA 3IC7A 3CUOA 3DXJF 4HV6A 4U0WA 3O2PE 4LK0F 3WU1B 1IW7F 1SD6A 3GFLA 1OR7A 3K9TA 1WRJA 3U9GA 2A3SA 5E18F 5LHHA 5D8LB 2DBBA 4MGRA 3ZPLA 5LBQA 3PQJA 1SD7A 2MH9A 4EQQA 1ZH5A 2FXAA 3WTXC 2OQRA 2ZCWA 4O3MA 1I5ZA 2ISYA 2QYOA 4OIQF 5DCFA 3JW4A 2XUBA 3N4MA 2EWNA 3FM3A 3HHHA 3DV8A 2L54A 5JR3A 5HS9A 2COMA 2HKXA 4TV7A 5ED4A 4HQMA 2W84A 2CSOA 4MTDA 5L3CA 5F1RA 1R1TA 2CWEA 1YO5C 4G7HF 1TLHB 5HDNA 3J7AO 5DYMA 2KKOA 3FWEA 3HRUA 2IA1A 5HLIA 4WXDA 1ZRDA 5K1YA 1G3WA 1FSEA 4EV0A 4I2OA 5LGNA 1W4MA 2E7XA 4ZYDA 4M6YA 1KQ9A 4HBLA 3IRRA 5D6FA 1XGSA 1OYIA 3QU6A 3BROA 5LLQA 1TNTA 4MNUA 5HVQC 1LQ1A 3K69A 2BEOA 1MJ9A 2K02A 1RNLA 1C0WA 5D5VB 3T5XA 2QWWA 1RIOH 3D5LA 2M5WA 5E1ZB 2XRNA 3FM5A 4RGSA 2E1CA 1IN6A 3NRVA 5D5WB 3KE2A 3WTWC 1STZA 1FPQA 3DP7A 2OZUA 1EV7A 3ZP5A 3GFIA 4ON0A 2DPDA 5LRSA 2VOPA 1FOKA 3L09A 4EGYA 4WXCA 4XRFA 4OIRF 1P92A 4Y15A 3LFKA 3FMRA 2DAOA 1KGSA 4LFUA 3I64A 2P7VB 1YTYA 1BI2A 3B73A 2MD5A 1I1SA 2K4BA 3HRMA 3R0AA 2VONA 4LJZF 3GZ6A 2VN2A 2X0LA 3KP2A 1FT9A 4RB2C 4AWXB 1CF7B 1HQCA 4HF2A 1SMTA 4I09A 3HOTA 3F8FA 1J75A 2PBIA 5F6FA 4U0YA 4EM2A 1WWXA 2HDCA 2FU4A 4HX8A 1IF1A 2FBHA 4Y17A 4A6DA 3FXQA 1JXSA 1FNNA 4EGZA 3FXRA 2M87A 1FP1D 1HSTA 3V4GA 2F2EA 1R22A 2JPBA 4RGUA 2G7HA 4D0PA 2VODA 1YLFA 1JHHA 1FYMA 1JE8A 2P5VA 4F7ZA 3RKWA 3J80K 2BYVE 4UV9A 3BPXA 1U5TA 1D3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z99 A;  1HXD A;  2RDP A;  4BHP A;  2FQ3 A;  5HLH A;  1U2W A;  2NS0 A;  5KVR A;  3H3U A;  1V3F A;  2NAZ A;  3CTA A;  5CVI A;  1ZLJ A;  4HX4 A;  2DU9 A;  1FY7 A;  4XBF A;  4KDP A;  4XLP F;  3MZY A;  2ELH A;  2D2W A;  4N0B A;  5EEG A;  5J8F A;  1O3T A;  4KYW A;  1IN5 A;  3CUQ B;  1O57 A;  4O5V A;  1W7P A;  3ABU A;  2VOO A;  3J80 Z;  5IT9 K;  4RB0 A;  2QQ9 A;  3J81 Z;  4OMY A;  2PG4 A;  4EMS A;  5D4R A;  2ZXJ A;  4KMU X;  2V1D A;  1H9T A;  2FRH A;  4N9H A;  2EA4 A;  3KET A;  2XAF A;  2STW A;  2DI3 A;  1HW5 A;  4EM0 B;  2H09 A;  5JI6 A;  2XHK A;  5E17 F;  3JSO A;  3C1D A;  2RNJ A;  2W25 A;  1S7O A;  3N97 A;  2IT0 A;  1LB2 A;  2ZNZ A;  1R23 A;  2Q8K A;  4G6Q A;  5FFZ A;  1K79 A;  3GFJ A;  5LEJ A;  3WTZ A;  3QOP A;  1K78 A;  4HLX A;  3EYI A;  1G4D A;  4MQ9 F;  3HOS A;  3SHF A;  4IRI A;  1R58 A;  1J0R A;  1P4X A;  2LF8 A;  4I02 A;  3WTS C;  2H27 A;  4HOB A;  1U5T C;  5F64 A;  4EJT A;  2P5L C;  3HTS B;  4JK1 X;  2UWM A;  4RGR A;  2L3D A;  2EFW A;  1Z05 A;  1HKQ A;  4I01 A;  1I27 A;  1YW9 A;  1ZGJ A;  3C3W A;  1JHF A;  2XGX A;  1ZRE A;  2Z3Y A;  1KQ0 A;  4U7D A;  4HZF A;  1QPM A;  1B6A A;  2O3F A;  2LNB A;  4IRH A;  1I1G A;  2HQN A;  5DUI A;  4PCQ A;  5L3G A;  1KU9 A;  2QZ8 A;  2XKP A;  2ZME B;  2QEN A;  3P9K A;  4CHU A;  2YR2 A;  1MKM A;  1SD5 A;  5IT9 Z;  2EB7 A;  4KIB A;  5DCM B;  1IN4 A;  4G8X A;  4CYD A;  3QPH A;  2YX7 A;  2O6G E;  3ECH A;  3DEU A;  1SAX A;  3IHU A;  3QRF F;  1DDN A;  4EJO A;  2GAU A;  1B1B A;  2PQ8 A;  2QQB A;  2PLY A;  2Y0M A;  5FLX Z;  5J8C A;  2L4M A;  4LG0 A;  4BQA A;  2RN7 A;  3I0T A;  3SFZ A;  1ON2 A;  4UV8 A;  5LGT A;  1PDN C;  5ICF A;  1TW3 A;  2IA2 A;  5CVJ A;  3JTG A;  3KP3 A;  1O7F A;  3V8K A;  3HRT A;  3I59 A;  1QZZ A;  2PMH A;  2STT A;  4HDU A;  4BAY A;  2ISZ A;  1FWZ A;  4AD9 A;  5FLX K;  2PN6 A;  3F6O A;  2ACJ A;  3KZZ A;  1IN7 A;  5FFX A;  2RVC A;  4PZJ A;  1YFH A;  1G3S A;  1P4A A;  1G3Y A;  2YPR A;  3REO A;  5DCM A;  4YG2 F;  2XAG A;  2ZKZ A;  2XRO A;  2A6H F;  4LLN A;  1ON1 A;  3EDP A;  3G73 A;  3KLN A;  4HLY A;  1XSD A;  1J7K A;  1IAW A;  4G9Y A;  1KYW A;  2QQA A;  3TQN A;  3R4K A;  3LA2 A;  3WGI A;  4U0V A;  3MWM A;  1F9N A;  4P5O A;  2OAZ A;  5EEH A;  4OU0 A;  2LKP A;  5FD6 A;  1FC3 A;  4A2U A;  1UFM A;  5CVV A;  3H92 A;  2AXL A;  1SFX A;  1UHM A;  3VOD A;  3HHG A;  5DV5 A;  2YSR A;  3IL2 A;  4L9V A;  1K7A A;  2HQR A;  1MGT A;  4ENK A;  5BMZ A;  4P55 A;  1ZAO A;  2VBZ A;  5JVT A;  2G7U A;  4L5J A;  1BIA A;  4S04 A;  3WG9 A;  1I6X A;  2HR3 A;  1Z1D A;  1XGN A;  1ULY A;  3HSF A;  3E97 A;  5FD5 A;  1S6L A;  4UVA A;  5L3F A;  5E20 A;  2MA3 A;  2MH2 A;  2KIF A;  1H0M A;  4AIK A;  3ZMZ A;  3DKW A;  4UUV A;  2IRF G;  3WU0 A;  1YQA A;  1B59 A;  1BN5 A;  4MQV A;  2PMU A;  3E6B A;  3I53 A;  3WTV C;  3MFK A;  4OIN F;  2YU3 A;  3F21 A;  4YFK F;  3TO6 A;  1ZYR F;  2FA5 A;  4Q48 A;  3EQL F;  3LAP A;  1P4W A;  3DPT A;  4ASN A;  3CJN A;  2IJL A;  5ILU A;  1GVJ A;  3F3X A;  4GXO A;  3S2W A;  1A04 A;  4ENJ A;  4NQW A;  3ZMV A;  1FYK A;  4KN7 X;  2LF7 A;  3KEQ A;  2DK5 A;  1W7P D;  3E6C C;  4QLC U;  2DPU A;  4ESF A;  4KN4 X;  3HTU A;  5HOO A;  3AAF A;  3BPV A;  4KT5 C;  2O03 A;  2WC2 A;  4FHT A;  2GWR A;  2IW5 A;  2EFO A;  2G9W A;  2HFH A;  3QPT A;  2HS5 A;  5BOX A;  3O6B B;  4CXF A;  4P9F A;  2R7F A;  2JPC A;  1ZHF A;  2OQG A;  3MQ0 A;  2FMY A;  1HSJ A;  3GLX A;  2EFQ A;  1VTN C;  4LG0 B;  4RAY A;  1Z7U A;  1H9G A;  4G7O F;  3F23 A;  1B9N A;  3BOQ A;  3DPL C;  1BBY A;  1IN8 A;  2EA2 A;  3FXU A;  4EVI A;  4CZZ A;  1R1U A;  1Y0U A;  2RGV A;  1TQI A;  5JHU A;  5K5O A;  3V8J A;  1ZAR A;  2JT1 A;  4G6D A;  3R0J A;  4GCV A;  2JZY A;  2HGC A;  1XGM A;  2UZK A;  1B9M A;  1IUY A;  1BM9 A;  1ONV A;  3GXO A;  4IXA A;  2OU2 A;  3RTR A;  2JRT A;  1SFE A;  5LRR A;  5H6R A;  4EJU A;  1XD7 A;  4IHT A;  2GZW A;  1TQM A;  5DD4 A;  3GW2 A;  4L0Y B;  1XDS A;  4GYG A;  2P6T A;  5HLG A;  3RI4 A;  4MTE A;  4WK8 F;  1KQ8 A;  3JTH A;  2FML A;  2V6C A;  5AIP A;  2IP2 A;  3GVA A;  4P96 A;  4WXH A;  1U78 A;  1TQP A;  2MBF A;  4LD5 A;  3F22 A;  1ZRF A;  2F5C A;  3I5U A;  3WTY C;  3RJP A;  1KA8 A;  1XB4 A;  2CFX A;  3WTT C;  1ZRC A;  3I54 A;  1QO0 D;  1O7L A;  1BI3 A;  4IF4 A;  3KZY A;  5ILV A;  5BS6 A;  3WOD F;  3LWF A;  4YFN F;  2XAS A;  4DQ2 A;  4HYE A;  1LJ9 A;  3M9A A;  4EJW A;  5BPD A;  1IZ1 A;  4UHT A;  2L02 A;  2R3S A;  1S3J A;  3VEP A;  4PDK A;  5D8K B;  4AVP A;  2O8X A;  4LLG F;  4RAZ A;  3LQR A;  4B09 A;  3LAJ A;  1RUO A;  4L9T A;  4GGG A;  2P6S A;  1USS A;  1HW2 A;  1KU2 A;  2ESN A;  2K7L A;  1T98 A;  2DFI A;  2FOK A;  3ML6 A;  3F72 A;  3G3Z A;  1S29 A;  2K4J A;  4IPA A;  3ZN1 A;  1LNW A;  3TKY A;  2NNN A;  1L0O C;  3RYP A;  4OIO F;  2E1N A;  2K86 A;  4OOI A;  4BH9 A;  2DT5 A;  5ICE A;  1T2K A;  4FT8 A;  5AON A;  5E1W A;  2KIM A;  2HTS A;  2TDX A;  4S05 A;  3SQN A;  3V7C A;  3ZMD A;  3R60 A;  1F4K A;  3R61 A;  1K78 B;  2IA0 A;  2XAH A;  3COA C;  5L3B A;  4A0X A;  3EYY A;  1MZB A;  2V9V A;  3WE2 A;  5K5R A;  5J6X A;  2P7C B;  3TGN A;  3GF2 A;  4ZYE A;  1CF7 A;  3T1B A;  2OBP A;  5D5X B;  4IVN A;  2A6E F;  1D8J A;  4RS8 A;  2RKH A;  4L9J A;  4A0Y A;  4ZYH A;  2Z5U A;  3GX4 X;  4CDG A;  2RQP A;  3BJ6 A;  1E17 A;  3OOP A;  2W85 A;  4E70 A;  1ZLK A;  1JGS A;  4IRG A;  2X4H A;  2NNY A;  2KIU A;  4KUM A;  3IWF A;  3I59 B;  4MEY F;  2D1V A;  1EH6 A;  1P6R A;  4DNC A;  1XMA A;  3M8F A;  5HS8 A;  1QNT A;  5L3E A;  2PEX A;  4ENN A;  2H6C A;  4RGX A;  3FMQ A;  3VOE A;  5CJ9 A;  3U1D A;  3KCC A;  2CO5 A;  2PI0 A;  1FX7 A;  1TNS A;  4KIG A;  3WTU C;  4LB5 A;  1UCR A;  1J59 A;  1DP7 P;  1QQI A;  2KJC A;  3K2Z A;  3CLO A;  2XKO A;  3RPQ A;  1T39 A;  2BV6 A;  4A12 A;  1ODD A;  4LB6 B;  2EFP A;  5A2Q Z;  4MHG A;  1Q1H A;  1LVA A;  4QWQ A;  2FBI A;  4K2E A;  1V4R A;  3W6J B;  3IRQ A;  5FB2 A;  2BGC A;  3C18 A;  4A0Z A;  2HWV A;  1R5G A;  2MLK A;  4B8X A;  1YG2 A;  2NYX A;  4AIH A;  1XCV A;  4ENM A;  5CLS A;  2UXN A;  1FP2 A;  1IXS B;  3L9F A;  4M72 A;  1U5T B;  3ZMS A;  4U88 A;  3KP5 A;  1D5V A;  5D5U B;  2Q2E A;  2V1U A;  1T6S A;  2L4A A;  2Z9O A;  3LA7 A;  2ZFW A;  2GXG A;  2VE9 A;  2H6B A;  1SMY F;  3MAJ A;  2VE8 A;  2EV6 A;  1IRG A;  1FZP B;  2GQQ A;  4FX4 A;  1G3T A;  3M8E A;  2J5P A;  3K1M A;  2FNA A;  1HW1 A;  1AWC A;  3ZMU A;  3GYH X;  2GA1 A;  3CO6 C;  1O3S A;  2M1B A;  4N9I A;  3RDI A;  4JBA A;  3E6M A;  4CIC A;  1FLI A;  4I0A A;  2F5E A;  4MEX F;  4G94 A;  1MJA A;  1WI9 A;  3BJO A;  4OIP F;  1GXP A;  1SFU A;  2M45 A;  2QBY B;  1OMI A;  5HS7 A;  3F8M A;  4XSZ F;  4L5I A;  4M71 A;  3ISP A;  1OPC A;  1BOA A;  5ERI A;  5K5Q A;  3DF8 A;  4R1H A;  3BP8 A;  1ZN2 A;  2JSC A;  4CO8 A;  5FGM A;  1OYW A;  1S8N A;  2C6Y A;  2YX4 A;  2UXX A;  3CUQ A;  4G7Z F;  2DLL A;  4M74 A;  3ABT A;  3CO7 C;  5JFR A;  2V1X A;  2IVM A;  1RI7 A;  3L2C A;  3E5X A;  5HDK A;  4KA4 A;  4R79 A;  1HBX G;  5E8G A;  3GO5 A;  1HKS A;  5HDG A;  3QP6 A;  4BNC A;  4YII A;  2CG4 A;  3R6S A;  1YW8 A;  5ICC A;  2PJP A;  3LQQ A;  4BYY A;  2F5D A;  3PQK A;  5LHI A;  2WWY A;  1PP8 F;  1OKR A;  5E8I A;  2D1H A;  1UST A;  4M9X A;  5TRD A;  4FX0 A;  1BI1 A;  1U8R A;  3RIR A;  1XCB A;  2EFN A;  1TW2 A;  1BC7 C;  3LA3 A;  3OV8 A;  3FF5 A;  4Q5S F;  1LDD A;  1XDU A;  1UHW A;  4YFX F;  2XAQ A;  4HAM A;  1O3Q A;  4BXU A;  4Z2Y A;  3E5Q A;  3KP4 A;  1F1Z A;  2FSW A;  2E7W A;  4L9N A;  3T0Y A;  2W24 A;  3GUD A;  5BPI A;  4KFC A;  2DTR A;  3K1N A;  5DDG A;  1X3U A;  5FO5 A;  1YIO A;  4R8H A;  4XLN F;  2PFB A;  2HKO A;  4HV5 A;  4LK1 F;  2DQR A;  2RC4 A;  3H3Z A;  2KRF A;  4HW0 A;  2ESH A;  2HTJ A;  2O61 A;  2DQL A;  3FX3 A;  3V8L A;  2FE3 A;  3I4P A;  3BJA A;  1OYY A;  3U2R A;  3JAM K;  3W6K B;  3K1P A;  4EM1 A;  2A5Y B;  4KIF A;  1GXQ A;  3KFW X;  1UB9 A;  3CUQ C;  2VC0 A;  5DUK A;  4JQF A;  2HYG D;  1EH8 A;  2ZME A;  2DK8 A;  1WKM A;  1EH7 A;  1DUX C;  1TTY A;  3SZT A;  2CQK A;  2Q0O A;  3IKT A;  2HYF A;  4Q4Z F;  4M6X A;  2Z33 A;  3V7S A;  3CDH A;  3B02 A;  3HSE A;  3GEZ A;  2FBK A;  2QLZ A;  1RZ4 A;  1SD4 A;  2CW0 F;  3IKV A;  3KP7 A;  2CGP A;  2W57 A;  5A2Q K;  4EJV A;  1GHC A;  3PFI A;  1YS7 A;  3J81 K;  4YIF A;  4HF0 A;  4NB5 A;  3M7G A;  4LLL A;  5BQT A;  2GA2 A;  2JTV A;  1BJA A;  4BHB A;  5H20 A;  3TO7 A;  4PGG A;  1E2X A;  1BIB A;  4M9Z A;  3T8R A;  3V7R A;  1L3L A;  2R7D A;  1YW7 A;  2M30 A;  4A5N A;  3RKY A;  1ZGA A;  2OZ6 A;  1TBX A;  1YYV A;  2ZNY A;  4A6E A;  4I0B A;  2RV8 A;  2L01 A;  3HUG A;  4LMY A;  4ZZD A;  4ZZL A;  2D45 A;  2LSO A;  4I7H A;  1BC8 C;  3FHZ A;  4L18 B;  2XIG A;  5D6E A;  1REP C;  3E3V A;  2OA4 A;  3Q5F A;  2NRA C;  4HQE A;  4LGW A;  3M1E A;  2WV0 A;  1LDK B;  4WF2 A;  3O3K A;  5E1X A;  3MZH A;  3TOA A;  2A07 F;  4WWC A;  1S7A A;  3GFM A;  1R36 A;  1FBQ A;  1KU3 A;  1Z9C A;  1ZG1 A;  3BDD A;  1K6O A;  3ELK A;  3MCZ A;  3BZ6 A;  3LST A;  5AIQ A;  2VBY A;  1BI0 A;  4O6J A;  4OMZ A;  1F5T A;  4HF1 A;  3NEU A;  1MD0 A;  3TO9 A;  1KYZ A;  3T8T A;  1R5H A;  1IRF A;  3QU3 A;  4P9U A;  1XGO A;  1IXC A;  4ESB A;  4NHJ A;  4CGZ A;  4UXN A;  2B0L A;  3ZQ7 A;  3KP6 A;  1FSH A;  2DW4 A;  1ZG5 A;  3KEO A;  1FBU A;  1ZG3 A;  1MDM B;  1P2F A;  4ZYG A;  1W7P B;  1XMK A;  2V79 A;  2Y75 A;  5CVU A;  1R00 A;  3HRS A;  3SXY A;  3F8C A;  2J5O A;  2EV0 A;  3F6V A;  3JSP A;  2AS5 F;  1KU7 A;  3WGG A;  1MJB A;  4RB1 A;  4AIJ A;  3GWZ A;  3ERE D;  4KNY A;  1T0F A;  4U7B A;  3JAM Z;  1W5S A;  3VB2 A;  2OD5 A;  3ZN0 A;  2VBX A;  3F8B A;  4KMF A;  1CGP A;  4RB3 C;  3IWZ A;  2EJR A;  4GYI A;  4A5M A;  2ADU A;  2ZO4 A;  2VT3 A;  3GZ5 A;  1QBJ A;  1DPR A;  2O0Y A;  1J9I A;  3BWG A;  3MEX A;  3RPU A;  2BE5 F;  4UNO A;  4GO1 A;  2HOE A;  2FF4 A;  2F5F A;  3KLO A;  1J2X A;  3EUH A;  2QUF A;  1HKT A;  1MDM A;  3E6D A;  3SZP A;  2GIV A;  4PGH A;  3F8N A;  5CVR A;  2VXZ A;  1Z6T A;  4HDV A;  3FZV A;  1T38 A;  3P7N A;  4I98 B;  3DQV C;  3ECO A;  2DO7 A;  5ICG A;  3HSR A;  3HIF A;  1XN7 A;  2BBY A;  1B4A A;  2P4W A;  1D8K A;  1R1V A;  2HEO A;  2P8T A;  1Z6R A;  3ROU A;  3P9C A;  1XSX A;  1O3R A;  2EK5 A;  3HYI A;  1NHA A;  5ILS A;  1QZY A;  4IHS A;  2FNP A;  1Z91 A;  1RUN A;  2CYY A;  1YS6 A;  1XSV A;  3EET A;  2IPQ X;  3TOB A;  3ULQ B;  4M73 A;  2QVO A;  4L0Z B;  1DPU A;  1LEB A;  3L7W A;  2H94 A;  3D0S A;  2EV5 A;  1PUE E;  5LGU A;  2VBW A;  5LEK A;  2K27 A;  3RYR A;  1PP7 U;  4UVC A;  2A61 A;  2ETH A;  1U3E M;  3K0L A;  2A69 F;  4ESJ A;  2KJB A;  1FBS A;  1AOY A;  5KK1 A;  6PAX A;  3L00 A;  5D4S A;  3ZMT A;  1U6G A;  4Y13 A;  4XSX F;  1QGP A;  2HZT A;  3Q9V A;  4WX9 A;  2Y48 A;  3RKX A;  3FMS A;  1WQ2 A;  2QM3 A;  4IJA A;  4Q47 A;  2MLG A;  2A68 F;  2LDU A;  2XVC A;  5DEQ A;  3QAH A;  4H0E A;  5CYV A;  1LDJ A;  3WE3 A;  2XV4 S;  4ETS A;  2FEZ A;  2ZBK A;  5LHG A;  2P5K A;  1W5T A;  1R7J A;  3P9I A;  3I71 A;  3NQO A;  1IXR C;  1LEA A;  2M8E A;  5L3D A;  3I58 A;  4M9S A;  2MC3 A;  3E5U A;  3WGH A;  2XAJ A;  1J5Y A;  3TDU C;  1FYL A;  3Q9S A;  3BY6 A;  4ZH4 F;  3TDZ C;  2GXB A;  2ZJ2 A;  5TJJ A;  2QBY A;  4HX7 A;  5H6Q A;  3DFG A;  2VC1 A;  5DD8 A;  1G6N A;  4UVB A;  3QP5 A;  4HA8 A;  2VT2 A;  4WCG A;  3VFZ A;  1WSU A;  4KIC A;  5IT3 A;  2WTE A;  4BHC A;  3C7J A;  3IC7 A;  3CUO A;  3DXJ F;  4HV6 A;  4U0W A;  3O2P E;  4LK0 F;  3WU1 B;  1IW7 F;  1SD6 A;  3GFL A;  1OR7 A;  3K9T A;  1WRJ A;  3U9G A;  2A3S A;  5E18 F;  5LHH A;  5D8L B;  2DBB A;  4MGR A;  3ZPL A;  5LBQ A;  3PQJ A;  1SD7 A;  2MH9 A;  4EQQ A;  1ZH5 A;  2FXA A;  3WTX C;  2OQR A;  2ZCW A;  4O3M A;  1I5Z A;  2ISY A;  2QYO A;  4OIQ F;  5DCF A;  3JW4 A;  2XUB A;  3N4M A;  2EWN A;  3FM3 A;  3HHH A;  3DV8 A;  2L54 A;  5JR3 A;  5HS9 A;  2COM A;  2HKX A;  4TV7 A;  5ED4 A;  4HQM A;  2W84 A;  2CSO A;  4MTD A;  5L3C A;  5F1R A;  1R1T A;  2CWE A;  1YO5 C;  4G7H F;  1TLH B;  5HDN A;  3J7A O;  5DYM A;  2KKO A;  3FWE A;  3HRU A;  2IA1 A;  5HLI A;  4WXD A;  1ZRD A;  5K1Y A;  1G3W A;  1FSE A;  4EV0 A;  4I2O A;  5LGN A;  1W4M A;  2E7X A;  4ZYD A;  4M6Y A;  1KQ9 A;  4HBL A;  3IRR A;  5D6F A;  1XGS A;  1OYI A;  3QU6 A;  3BRO A;  5LLQ A;  1TNT A;  4MNU A;  5HVQ C;  1LQ1 A;  3K69 A;  2BEO A;  1MJ9 A;  2K02 A;  1RNL A;  1C0W A;  5D5V B;  3T5X A;  2QWW A;  1RIO H;  3D5L A;  2M5W A;  5E1Z B;  2XRN A;  3FM5 A;  4RGS A;  2E1C A;  1IN6 A;  3NRV A;  5D5W B;  3KE2 A;  3WTW C;  1STZ A;  1FPQ A;  3DP7 A;  2OZU A;  1EV7 A;  3ZP5 A;  3GFI A;  4ON0 A;  2DPD A;  5LRS A;  2VOP A;  1FOK A;  3L09 A;  4EGY A;  4WXC A;  4XRF A;  4OIR F;  1P92 A;  4Y15 A;  3LFK A;  3FMR A;  2DAO A;  1KGS A;  4LFU A;  3I64 A;  2P7V B;  1YTY A;  1BI2 A;  3B73 A;  2MD5 A;  1I1S A;  2K4B A;  3HRM A;  3R0A A;  2VON A;  4LJZ F;  3GZ6 A;  2VN2 A;  2X0L A;  3KP2 A;  1FT9 A;  4RB2 C;  4AWX B;  1CF7 B;  1HQC A;  4HF2 A;  1SMT A;  4I09 A;  3HOT A;  3F8F A;  1J75 A;  2PBI A;  5F6F A;  4U0Y A;  4EM2 A;  1WWX A;  2HDC A;  2FU4 A;  4HX8 A;  1IF1 A;  2FBH A;  4Y17 A;  4A6D A;  3FXQ A;  1JXS A;  1FNN A;  4EGZ A;  3FXR A;  2M87 A;  1FP1 D;  1HST A;  3V4G A;  2F2E A;  1R22 A;  2JPB A;  4RGU A;  2G7H A;  4D0P A;  2VOD A;  1YLF A;  1JHH A;  1FYM A;  1JE8 A;  2P5V A;  4F7Z A;  3RKW A;  3J80 K;  2BYV E;  4UV9 A;  3BPX A;  1U5T A;  1D3Y A; 
#chains in the Genus database with same CATH topology
 3S3M A;  2JWT A;  2Z99 A;  1HXD A;  2RDP A;  4BHP A;  1Z3Y A;  2FQ3 A;  2PMZ A;  5HLH A;  2EQR A;  1U2W A;  2NS0 A;  3SEZ A;  2BY0 A;  2IXS A;  4FIS A;  5KVR A;  3H3U A;  3CDI A;  1GDT A;  1V3F A;  2NAZ A;  3CTA A;  5CVI A;  1ZLJ A;  4HX4 A;  3TW6 A;  3IV5 A;  2DU9 A;  2LY2 A;  1FY7 A;  3OYG A;  4XBF A;  4KDP A;  4XLP F;  3MZY A;  1WFX A;  2ELH A;  5C4J J;  2IS4 A;  2DA2 A;  3WU2 C;  1V5F A;  4LOC A;  3S2D J;  2D2W A;  4N0B A;  5EEG A;  5J8F A;  1O3T A;  4KYW A;  2DA7 A;  1IN5 A;  4BAC A;  3CUQ B;  1O57 A;  1IDY A;  4O5V A;  4A3E J;  1W7P A;  3ABU A;  2VOO A;  3A1Y A;  3J80 Z;  5IT9 K;  4RB0 A;  2QQ9 A;  3LSK A;  1R4N B;  3J81 Z;  3BTC A;  4OMY A;  2PG4 A;  4EMS A;  5D4R A;  3OL4 A;  4ZTJ A;  3DU5 A;  1VQO I;  2KT0 A;  3K10 A;  4QSH A;  5GPC A;  4IL6 C;  1BR2 A;  2ZXJ A;  4KMU X;  2V1D A;  4OAY A;  2KLO A;  1SC7 A;  2FRH A;  4N9H A;  1H9T A;  2EA4 A;  2A5W A;  2CQX A;  3U1K A;  1A35 A;  3KET A;  2XAF A;  4D7N A;  1YX3 A;  2STW A;  2CJJ A;  2DI3 A;  2BW3 A;  1HW5 A;  4EM0 B;  4B43 A;  2H09 A;  5JI6 A;  2XHK A;  5E17 F;  2RNG A;  3JSO A;  3C1D A;  2RNJ A;  2W25 A;  1S7O A;  2P81 A;  2CQ7 A;  2V9K A;  3N97 A;  2IT0 A;  3H9Q A;  1LB2 A;  3IAS 2;  2ZNZ A;  1R23 A;  2Q8K A;  4G6Q A;  4UUT A;  5FFZ A;  3SDB A;  1K79 A;  1G8X A;  3GFJ A;  1X58 A;  5LEJ A;  5EF6 A;  1SVM A;  2WY7 Q;  3WTZ A;  3ZQH A;  2K85 A;  3QOP A;  1K78 A;  2PJR B;  3ZR8 X;  3TW7 A;  4HLX A;  3EYI A;  3GTM J;  3G2B A;  1G4D A;  4MQ9 F;  3O8G A;  3QOE A;  3HOS A;  3BG5 A;  2R7Z J;  3SHF A;  4IRI A;  1R58 A;  2OF7 A;  1J0R A;  1P7J A;  1P4X A;  2LF8 A;  3SZG A;  4I02 A;  3F9K A;  3WTS C;  2H27 A;  1DP3 A;  4HOB A;  1U5T C;  5F64 A;  4EJT A;  2P5L C;  4OAZ A;  1GV5 A;  3HTS B;  4JK1 X;  1S5L C;  1X3Z B;  2UWM A;  4DOZ A;  4RGR A;  3I55 I;  2L3D A;  3CCJ I;  2EFW A;  1Z05 A;  3ZQQ A;  2IS6 A;  1HKQ A;  4RA2 A;  4I01 A;  1I27 A;  3KX2 A;  1UHS A;  1YW9 A;  1T33 A;  1A5J A;  1ZGJ A;  2UV1 A;  3C3W A;  1UAA A;  1JHF A;  3HGG A;  5DM6 F;  1U9N A;  3LSG A;  3BR2 A;  2XGX A;  4AVZ A;  1ZRE A;  1Q1V A;  2V26 A;  4UUS B;  3LMM A;  3K4M A;  2Z3Y A;  4XKB A;  1KQ0 A;  3PNT A;  2BW3 B;  4HZF A;  4U7D A;  1QPM A;  2TRT A;  1MMA A;  1B6A A;  2O3F A;  1JUP A;  2LNB A;  4IRH A;  1I1G A;  4NC6 A;  2HQN A;  5DUI A;  4PCQ A;  5L3G A;  1KU9 A;  2QZ8 A;  2MSY A;  1SEU A;  3M8J A;  3PIP F;  2XKP A;  2ZME B;  2QEN A;  3GME A;  3P9K A;  4CHU A;  2YR2 A;  2ZXI A;  1MKM A;  2BHZ A;  1SD5 A;  3OIQ A;  1KZH A;  5IT9 Z;  1DGW Y;  2EB7 A;  4KIB A;  5DCM B;  2XSD C;  5J4V A;  3M1C A;  2DMN A;  1IN4 A;  4BUP A;  4G8X A;  4XID A;  4CYD A;  3IH2 A;  3QPH A;  2YX7 A;  2BZT A;  2O6G E;  3ECH A;  2W48 A;  3DEU A;  3OWT A;  1SAX A;  3IHU A;  3QRF F;  1JJ8 C;  1DDN A;  2LY1 A;  2GAU A;  1B1B A;  2PQ8 A;  2QQB A;  4DYC A;  4EJO A;  1GT0 C;  4ZC3 A;  2PLY A;  5M5W J;  2Y0M A;  4A69 C;  5FLX Z;  5J8C A;  2L4M A;  1ORK A;  4LG0 A;  2MAB A;  3ESW B;  2NOG A;  3BR3 A;  4BQA A;  4AU7 A;  2QSG X;  2RN7 A;  3I0T A;  3SFZ A;  1ON2 A;  4UV8 A;  5LGT A;  2VJ5 A;  1PDN C;  3BZC A;  5ICF A;  4BXX J;  1TW3 A;  5J3L A;  3A02 A;  2HDW A;  1IV8 A;  3DBH B;  2E1O A;  1V5E A;  1T08 B;  2IA2 A;  3PSF A;  5CVJ A;  2HQA A;  3JTG A;  3KP3 A;  3MZ8 A;  5EGO B;  1IGN A;  1O7F A;  3V8K A;  3HRT A;  1Y0N A;  2XPW A;  4CYC B;  4ABZ A;  3I59 A;  1QZZ A;  2E2J J;  2PMH A;  3L1P A;  2STT A;  4HDU A;  2ID6 A;  4BAY A;  2KFD A;  1HA8 A;  2ISZ A;  1FWZ A;  4AD9 A;  5FLX K;  1JTX A;  2PN6 A;  3F6O A;  1U0J A;  2ACJ A;  2NVT J;  4F91 B;  3KZZ A;  2K3P A;  2OUM A;  1IN7 A;  1BR1 A;  2RVC A;  1T56 A;  4PZJ A;  3K4N A;  5FFX A;  4DYR A;  1XC5 A;  2ELJ A;  3FXJ A;  2QQ8 A;  3I9V 2;  1R71 A;  1YFH A;  3C2G A;  1G3S A;  1P4A A;  2F4M B;  3IP4 B;  1G3Y A;  2YPR A;  3REO A;  5DCM A;  4YG2 F;  2XAG A;  3JCU C;  3WG7 H;  4X6A J;  4IHV A;  1IRX A;  2ZKZ A;  2XRO A;  2A6H F;  5M3M J;  4LLN A;  1W5C C;  3DTK A;  1ON1 A;  3EDP A;  4RM3 A;  3G73 A;  3KLN A;  4HLY A;  5CKT A;  1XSD A;  1J7K A;  4CZC A;  2KMU A;  1IAW A;  3OIP A;  4G9Y A;  4ZDL A;  4PSW A;  1KYW A;  2EBI A;  2QQA A;  4CCL A;  3TQN A;  3ZQC A;  3SYT A;  3R4K A;  1ZEL A;  3LA2 A;  3WGI A;  2CV2 A;  1UEL B;  2ZJR F;  4U0V A;  2GXA A;  3MWM A;  3LSJ A;  1F9N A;  4P5O A;  2OAZ A;  3ABM H;  5EEH A;  4C30 A;  4RAG A;  3FXL A;  4OU0 A;  2LKP A;  4BL0 B;  5FD6 A;  1FC3 A;  4A3J J;  4A2U A;  3DBL B;  1UFM A;  3H35 A;  5CVV A;  2CH0 A;  3K6G A;  3H92 A;  4A3G J;  2HU9 A;  3QYE A;  2LLK A;  5EGO A;  2AXL A;  1SFX A;  1UHM A;  3VOD A;  2R7X A;  3HHG A;  5DV5 A;  3JRG A;  1FEX A;  2YSR A;  3BC8 A;  3IL2 A;  4L9V A;  4HSR A;  2HQR A;  1K7A A;  4QPQ A;  3G1O A;  1MGT A;  4ENK A;  1UG0 A;  3BTI A;  5BMZ A;  4P55 A;  3H5A A;  2TCT A;  1X4P A;  1ZAO A;  4XK4 A;  5K7Z A;  3G4S I;  2L5Q A;  2XGD A;  4XNF A;  2JA6 J;  4F92 B;  2VBZ A;  5JVT A;  3NAU A;  2G7U A;  2L7K A;  1MH4 A;  3AG4 H;  4L5J A;  1BIA A;  5FRN A;  3EPZ A;  5J40 A;  4PJ0 C;  2CMP A;  4S04 A;  1I6X A;  2HNH A;  3WG9 A;  2HR3 A;  1Z1D A;  3S1Q J;  2F48 A;  4FQG A;  1XGN A;  3H3V K;  1ETK A;  1ULY A;  2WAQ N;  3HSF A;  1AU7 A;  1I39 A;  4HEA 2;  4XKW A;  3E97 A;  5FD5 A;  1S6L A;  3LL7 A;  2IS2 A;  4UVA A;  5L3F A;  5E20 A;  3HDD A;  2MA3 A;  2V6E A;  2MH2 A;  2KIF A;  1BW6 A;  4AIK A;  3ZMZ A;  1H0M A;  3DKW A;  3HPH A;  2IRF G;  1X4O A;  4UUV A;  2LG4 A;  2QEX I;  3W2A A;  3WU0 A;  5E3N A;  4QTR A;  1YQA A;  1B59 A;  1EA3 A;  1BN5 A;  1P9Q C;  3D5R C;  2LH9 A;  2WB1 N;  2M3A A;  1VQ8 I;  3PO3 J;  3F0C A;  2XF7 A;  4MQV A;  2PMU A;  2R4G A;  5EYR A;  3OYF A;  3E6B A;  3I53 A;  2ME0 A;  3KYC B;  5IP9 J;  3WTV C;  1MBG A;  5LD2 C;  3OIO A;  1YRN A;  2DA3 A;  3MFK A;  4OIN F;  2YU3 A;  2LKS A;  3F21 A;  2VIX A;  3G71 I;  1OCO H;  3DU6 A;  2R7R A;  4YFK F;  4IOC F;  1NK2 P;  3TO6 A;  3CCV I;  1ZYR F;  2FA5 A;  2YUS A;  4Q48 A;  3EQL F;  3UNG C;  2M7A A;  4B4C A;  3LAP A;  2R93 J;  4B48 A;  5B5E C;  3S3O A;  1P4W A;  1Y39 A;  3JR9 A;  3DPT A;  4ASN A;  3PJR A;  2LR8 A;  1VQP I;  3UR3 C;  5FLV A;  3IUO A;  2ZSI B;  2JRM A;  2R7S A;  3CJN A;  2IJL A;  3DEE A;  5ILU A;  3GTL J;  2NS8 A;  1GVJ A;  3F3X A;  1MBF A;  4GXO A;  4C3H J;  4BKX A;  4BY1 J;  3S2W A;  1RET A;  1A04 A;  4ENJ A;  4NQW A;  2MFZ A;  2Q2E B;  3ZMV A;  1H8A C;  2Y30 A;  1FYK A;  4KN7 X;  1NK3 P;  2LF7 A;  3KEQ A;  4A3B J;  2DK5 A;  3J7A Y;  1W7P D;  3E6C C;  1A6I A;  1RKW A;  3AG3 H;  4QLC U;  5EJC A;  1NTC A;  2DPU A;  1VND A;  2KPM A;  2AQE A;  3OYE A;  4ESF A;  4XQF A;  5E3M A;  5J4Y A;  1MMS A;  1RPW A;  4KN4 X;  2O8K A;  4G12 A;  3HTU A;  5HOO A;  3AAF A;  4QIW N;  3BPV A;  2Y31 A;  2DMP A;  4KT5 C;  2O03 A;  3OR2 C;  4IOA F;  3SEQ A;  5GTI C;  2WC2 A;  2W1O A;  2GWR A;  2IW5 A;  3H0G J;  4FHT A;  2WBM A;  2EFO A;  2PX9 A;  2G9W A;  3J7Z I;  2ZJQ F;  5M5Y J;  2E35 A;  2EIJ H;  2HFH A;  3QPT A;  2HS5 A;  4W97 A;  4RLQ A;  4DBR A;  3ABK H;  4F55 A;  3PIO F;  5BOX A;  4HRI A;  2R92 J;  3O6B B;  4P9F A;  4CXF A;  2DMT A;  2Y69 H;  2R7F A;  3ONQ A;  4ZJZ A;  1G2H A;  2JPC A;  4ZTF A;  1W36 D;  2QA4 I;  1ZHF A;  2OQG A;  3MQ0 A;  1PVE A;  2FMY A;  3HEF A;  1HSJ A;  3GLX A;  4AID A;  4BEH B;  2EFQ A;  1VTN C;  5K7H A;  4LG0 B;  4RAY A;  2LC2 A;  3GTG J;  3BR5 A;  1Z7U A;  1H9G A;  2BXZ A;  2JJ7 A;  2XC7 A;  3BCA A;  4G7O F;  2LOO A;  3F23 A;  1B9N A;  1K4T A;  2BVL A;  3BOQ A;  4A3M J;  2IEK A;  3DPL C;  1BBY A;  1IN8 A;  3IAM 2;  3OS0 A;  2EA2 A;  4DW6 A;  1QVT A;  3C2H A;  2YS9 A;  2L9V A;  1VZ0 A;  3A01 A;  2MGQ A;  1Y6I A;  3FXU A;  4YRV A;  1OCR H;  4EVI A;  5IYB J;  4CZZ A;  2M4K A;  4XLC A;  3OYI A;  3JRE A;  1R1U A;  3QPS A;  5GPA A;  1Y0U A;  2M7B A;  2RGV A;  1TQI A;  1PYV A;  3BG7 A;  3GTQ J;  5JHU A;  5K5O A;  3V8J A;  2WY8 Q;  1ZAR A;  2GIZ A;  2JT1 A;  1V54 H;  1N77 A;  4PUS A;  4G6D A;  3R0J A;  4GCV A;  2JZY A;  4JX4 A;  2HGC A;  1NG6 A;  1XGM A;  2L9S A;  3ZGK A;  2UZK A;  1B9M A;  3HBL A;  1IUY A;  1G59 A;  1BM9 A;  1ONV A;  3OL3 A;  1TT5 B;  3GXO A;  4IXA A;  3HOZ J;  1XTA A;  4DIQ A;  2VKD A;  1Z77 A;  3BLY A;  2IGM A;  2OU2 A;  2JRT A;  1SFE A;  3RTR A;  5LRR A;  1AA7 A;  2KDO A;  3CCL I;  1DU0 A;  2GM4 A;  3OYB A;  5IP7 J;  4X1E A;  5H6R A;  2EZK A;  3CMY A;  4EJU A;  2PMZ N;  3UKG A;  1XD7 A;  5FKM A;  4LIT A;  4IHT A;  4CH7 A;  2GZW A;  5H2F C;  1TQM A;  5DD4 A;  3GW2 A;  4C2M J;  5JVG F;  3RKQ A;  1BA5 A;  4L0Y B;  1XDS A;  3CDL A;  4GYG A;  2P6T A;  5HLG A;  2CUZ A;  4JX6 A;  2X1E A;  3RI4 A;  1IUF A;  4HST A;  4MTE A;  3KYD B;  4LIU A;  4WK8 F;  1Z21 A;  2OTL I;  3OS1 A;  3JTH A;  1KQ8 A;  2FML A;  2V6C A;  2H8W A;  5AIP A;  2K9S A;  3PNY A;  2IP2 A;  3GVA A;  4P96 A;  4WXH A;  5CQE A;  2HOT A;  1EF4 A;  4AYB N;  3DKY A;  2JUG A;  3K4J A;  5GAE J;  5GAG J;  1U78 A;  2JA5 J;  1SVL A;  1TQP A;  2MBF A;  4LD5 A;  3F22 A;  2LFB A;  3OSF A;  1ZRF A;  1RR8 C;  2F5C A;  3I5U A;  3LOC A;  3MMY B;  3RJP A;  4S0H B;  3WTY C;  1AKH B;  4MFE A;  1KA8 A;  1XB4 A;  2CFX A;  3BG3 A;  3WTT C;  1ZRC A;  1ITY A;  3AKZ A;  3I54 A;  3J7Y J;  1QO0 D;  3CES A;  1O4X A;  2LK2 A;  1O7L A;  3ERM A;  4BBR J;  1MSE C;  3FHN A;  1BI3 A;  1FMW A;  3LSM A;  2LKX A;  4AM3 A;  4IF4 A;  5J1Y A;  3KZY A;  2W82 A;  2F4I A;  3CCS I;  3HOY J;  1R9T J;  2JMW A;  5ILV A;  5BS6 A;  3WOD F;  2D5V A;  3BR6 A;  2LYC A;  3LWF A;  4YFN F;  2OCC H;  2XAS A;  2HXI A;  1XMX A;  4DQ2 A;  4HYE A;  4NUB A;  1LJ9 A;  4CCJ A;  2MYS A;  1HCR A;  4BDZ A;  5EDN A;  3M9A A;  2NVQ J;  4JP0 A;  4EJW A;  5BPD A;  1IZ1 A;  4UHT A;  1FIA A;  1POG A;  2L02 A;  3FDY A;  2ID3 A;  1F43 A;  2R3S A;  1S3J A;  1WJD A;  5KNL A;  3CC4 I;  3VEP A;  2EPF A;  2XPV A;  4PDK A;  3ZQL A;  3OYN A;  5D8K B;  1XS9 A;  4AVP A;  2ZC2 A;  2O8X A;  4LLG F;  3S1M J;  4RAZ A;  3LQR A;  4B09 A;  2LP0 A;  3WHC A;  5IOY A;  3LAJ A;  1RUO A;  3GLL A;  2WA0 A;  3H5R A;  4L9T A;  5DTD A;  4B1R A;  3DTI A;  4GGG A;  2P6S A;  1ZTR A;  3W2W A;  2GLO A;  1USS A;  4CCN A;  1HW2 A;  1KU2 A;  2O5R A;  5J47 A;  2ESN A;  3NWT A;  3HZJ A;  2K7L A;  1T98 A;  2DFI A;  1OCC H;  2FOK A;  3ML6 A;  2Y9Y A;  3F72 A;  4IKF A;  3G3Z A;  4CSW A;  1S29 A;  2DDA A;  2K4J A;  5EZH A;  2KP6 A;  2NXN B;  4IPA A;  3ZN1 A;  1Y8Q B;  2ECC A;  2X51 A;  1LNW A;  3S1R J;  2VQC A;  3TKY A;  3AL0 C;  4Y52 J;  4XLH A;  2NNN A;  1L0O C;  1XX5 A;  1I50 J;  2NVU B;  3OYM A;  2BY2 A;  1QRY A;  3MKL A;  3H9G A;  3RYP A;  4OIO F;  4KIT B;  2E1N A;  2DN0 A;  1BOB A;  2K86 A;  4OOI A;  4BH9 A;  2DT5 A;  5ICE A;  1T2K A;  3CCY A;  4FT8 A;  5AON A;  4HNT A;  5E1W A;  2KIM A;  2HTS A;  2TDX A;  5J1R A;  4S05 A;  3LSP A;  3SQN A;  4BE2 A;  5FRM A;  5B3S H;  1FTZ A;  2K9N A;  3ZQG A;  3V7C A;  3E7L A;  3ZMD A;  3R60 A;  1WJB A;  3GZN B;  4BBS J;  1F4K A;  1VQ5 I;  3M07 A;  2F6C A;  3R61 A;  2MW8 A;  4M3B A;  1K78 B;  1K6Y A;  3I4N J;  2IA0 A;  2XAH A;  3COA C;  2E34 A;  1WJ5 A;  1I6H J;  3BT9 A;  4E6K G;  5L3B A;  4A0X A;  3CCE I;  3AFH A;  3EYY A;  4B3X A;  1MZB A;  2MC4 A;  2V9V A;  3WE2 A;  3HPG A;  5K5R A;  3P5J A;  1MH3 A;  5J6X A;  2DOA A;  2P7C B;  3TGN A;  3HJE A;  3GF2 A;  4ZYE A;  3IH4 A;  3T1B A;  1CF7 A;  2OBP A;  5D5X B;  3A0H C;  3HKZ N;  3JRB A;  4IVN A;  2A6E F;  1D8J A;  4RS8 A;  2RKH A;  4L9J A;  4A0Y A;  2DOD A;  1UG2 A;  2Z5U A;  4ZYH A;  3DKX A;  3QYF A;  3V42 A;  3GX4 X;  4CDG A;  2OTJ I;  2RQP A;  3BJ6 A;  3DLL F;  2E1M C;  2CW7 A;  1E17 A;  1FOX A;  3HC7 A;  2W85 A;  3OOP A;  4E70 A;  3WHB A;  5C44 J;  1D5Y A;  1ZLK A;  1JGS A;  2IGN A;  4IRG A;  2X4H A;  2X1D A;  3RCO A;  3MKW B;  2NNY A;  2W7N A;  2CUJ A;  2KIU A;  2WV1 A;  4KUM A;  3IWF A;  3I59 B;  4MEY F;  5M5X J;  4JOM A;  2D1V A;  2DA5 A;  1EH6 A;  1P6R A;  4DNC A;  1JJ6 C;  4UB8 C;  1JKO C;  3CJQ B;  3E0J B;  4AYB A;  1XMA A;  3FXK A;  3M8F A;  3PUB A;  1T0F C;  5F0C A;  5E3L A;  5HS8 A;  4E7Z A;  2JK3 A;  3TP0 A;  1QNT A;  5L3E A;  1XPX A;  2DFF A;  2PEX A;  3FKI J;  2E5N A;  2R5Z A;  4ENN A;  2DA4 A;  2K9Q A;  2H6C A;  3BTL A;  4OWR B;  4J01 A;  4RGX A;  1B72 B;  3FMQ A;  2FOW A;  3VOE A;  5CJ9 A;  1D1B A;  2VI6 A;  3U1D A;  4V2F A;  3ZOB A;  3KCC A;  4IX7 A;  3S16 J;  2CO5 A;  2PI0 A;  1FX7 A;  1TNS A;  4KIG A;  4I76 A;  2BVM A;  3WTU C;  4LB5 A;  1UCR A;  1J59 A;  1DP7 P;  1QQI A;  2KJC A;  2XPU A;  3K2Z A;  1X1D A;  3CLO A;  2XKO A;  2EZH A;  1M1E B;  2VL8 A;  3RPQ A;  1T39 A;  2WAD A;  3ASN H;  2BV6 A;  4A12 A;  1ODD A;  2AO9 A;  5K7F A;  4LB6 B;  2EFP A;  2DTZ A;  5A2Q Z;  4CCO A;  4MHG A;  1Q1H A;  5IPA A;  1LVA A;  4QWQ A;  2FBI A;  4K2E A;  1OJL A;  2NOJ B;  2ZSH B;  1V4R A;  2XF6 A;  4QPO A;  3KIO A;  3I4M J;  1JT6 A;  3W6J B;  3IRQ A;  5FB2 A;  2YU9 J;  1I3Q J;  2LVS A;  2BGC A;  1WI3 A;  4V2G A;  3C18 A;  4IEJ A;  2X6O A;  4A0Z A;  2HWV A;  5IOZ A;  1E0E A;  1R5G A;  2MLK A;  4B8X A;  2FX0 A;  4BJ5 C;  1YG2 A;  2NYX A;  5GAD J;  4AIH A;  2X85 A;  4YEL A;  1XCV A;  4NBQ A;  5CLS A;  4ENM A;  2VPR A;  2UXN A;  1BL0 A;  4XRS A;  1FP2 A;  1S9H A;  3M4O J;  3A4C A;  1IXS B;  3L9F A;  4M72 A;  1A6Q A;  1U5T B;  3ZMS A;  4U88 A;  4RBO A;  3KP5 A;  1D5V A;  2XGC A;  5D5U B;  2Q2E A;  5B66 C;  2V1U A;  1T6S A;  2L4A A;  2QF7 A;  2Z9O A;  1ERD A;  3LA7 A;  2ZFW A;  2GXG A;  2VKV A;  1X1A A;  2H6B A;  2VE9 A;  4Y4R A;  4FE7 A;  1SMY F;  3MAJ A;  2VE8 A;  2EV6 A;  4YEJ A;  2QCO A;  1IRG A;  1FZP B;  2GQQ A;  4FX4 A;  2I5U A;  1G3T A;  3M8E A;  2J5P A;  4ZDP A;  2FD5 A;  2F5V A;  3K1M A;  3CZ6 A;  2FNA A;  3Q0U A;  3BQZ A;  1HW1 A;  1AWC A;  3ZMU A;  3GYH X;  2M2E A;  4II3 A;  2GA1 A;  4XRS G;  3OYC A;  3CO6 C;  1T95 A;  1D1C A;  2VQG A;  3OS2 A;  2QSH X;  1O3S A;  2M1B A;  1JI8 A;  2DJI A;  3A0B C;  3S17 J;  3CD6 I;  4N9I A;  3K4K A;  3RDI A;  4JBA A;  4II2 A;  2M8G X;  2COB A;  2AQF A;  4HNU A;  1W0U A;  3E6M A;  2H8R A;  4CIC A;  4U87 A;  1FLI A;  4N4N B;  1WH7 A;  1OCZ H;  2ICW G;  4I0A A;  2LD5 A;  2F5E A;  4MEX F;  3FIW A;  4G94 A;  4AC0 A;  1YHQ I;  1YJ9 I;  1Z7L A;  1FOY A;  1MJA A;  1WI9 A;  3BJO A;  4OIP F;  3RZO J;  2LRD A;  1LVK A;  1GXP A;  1SFU A;  1RR7 A;  4GFB A;  2M45 A;  2QBY B;  1OMI A;  4C2U A;  2X9D A;  4MIM A;  5HS7 A;  3H1C A;  3F8M A;  1X1C A;  2H1L A;  4RAF A;  2R7T A;  3CCU I;  3CCR I;  4XSZ F;  2JA2 A;  4D5F A;  4L5I A;  2K9L A;  3ISP A;  1OPC A;  4M71 A;  4IHX A;  1BOA A;  5ERI A;  1FTT A;  5K5Q A;  1J09 A;  2ZXH A;  2VJJ A;  4RM2 A;  3DF8 A;  4IZZ A;  2E19 A;  4R1H A;  1YJN I;  3BP8 A;  4BS9 A;  3CP2 A;  2F4O B;  1ZN2 A;  2KQR A;  1SAN A;  2JSC A;  2N8G A;  2MG4 A;  4BE0 A;  4FET A;  1ACI A;  4CO8 A;  5FGM A;  3BR1 A;  1X1B A;  1OYW A;  1X19 A;  2ZME C;  1S8N A;  2C6Y A;  3K4L A;  2YX4 A;  4D1Q A;  2LRE A;  3HOX J;  1BW5 A;  2UXX A;  3CUQ A;  2EIN H;  4G7Z F;  2DLL A;  3HOV J;  4M74 A;  1OQY A;  3QPL A;  5KAF C;  1WJE A;  3ABT A;  4E7K A;  3CO7 C;  5JFR A;  2V1X A;  4XLE A;  2I10 A;  4PFO A;  2IVM A;  1RI7 A;  4YIR X;  3L2C A;  4MFD A;  3E5X A;  5HDK A;  4KA4 A;  4R79 A;  2VJI A;  1HBX G;  5E8G A;  2P0W A;  3L2Q A;  3GO5 A;  1HKS A;  5HDG A;  3QP6 A;  1ETW A;  4BNC A;  3CP8 A;  1OLT A;  4YII A;  2O7O A;  1QHG A;  3K4B A;  1MSF C;  3S3N A;  2CG4 A;  1VQ9 I;  3R6S A;  1YW8 A;  2OC6 A;  3D1N I;  5ICC A;  2PJP A;  5FLM J;  3LQQ A;  2L7Z A;  4BYY A;  4B3A A;  2F5D A;  3HGY A;  1XG1 A;  3PQK A;  1DU6 A;  5LHI A;  1UZC A;  2WWY A;  1PP8 F;  1OKR A;  5E8I A;  4PJM A;  2VKE A;  4PSX A;  5B1A H;  2OJE D;  2D1H A;  1H89 C;  1UST A;  4M9X A;  5TRD A;  3PSI A;  1MMD A;  4FX0 A;  1SAU A;  1BI1 A;  1U8R A;  1WJF A;  3SFI A;  4IHW A;  4E7I A;  3RIR A;  1XCB A;  2EFN A;  1TW2 A;  1A31 A;  3FIS A;  1BC7 C;  1ZK8 A;  2VUM J;  3LA3 A;  3OV8 A;  2ELK A;  3PO2 J;  3ASO H;  2I8D A;  3FF5 A;  4Q5S F;  4PK4 A;  1LDD A;  1XDU A;  1UHW A;  2M0C A;  4YFX F;  2XAQ A;  4A3C J;  4HAM A;  5EEA A;  1O3Q A;  4BXU A;  3LSI A;  3SJM A;  2Y2Z A;  4Z2Y A;  3VSK A;  3E5Q A;  3KP4 A;  5JLW A;  1F1Z A;  2CW8 A;  1LE8 A;  3H0D A;  1QZE A;  1NH3 A;  2R5Z B;  1B72 A;  3EUK L;  4FE4 A;  1I3A A;  3JRI A;  2K9M A;  2JA7 J;  3L2U A;  2WB1 A;  2FSW A;  2X1C A;  4CYC A;  2E7W A;  2JSP A;  3Q0W A;  4L9N A;  3T0Y A;  5F0F A;  4Y7N J;  2W24 A;  3GUD A;  5BPI A;  4BQN A;  4KFC A;  2RAE A;  2XB0 X;  5BNG A;  2DTR A;  1RC9 A;  3K1N A;  5DDG A;  1HDP A;  1X3U A;  5FO5 A;  1YIO A;  4R8H A;  4PFP A;  2HZD A;  4XLN F;  2PFB A;  5TIS C;  2HKO A;  1W1W E;  4HV5 A;  4LK1 F;  2DQR A;  2RC4 A;  4BJT A;  5GTH C;  1LFU P;  1HOM A;  3H3Z A;  5F08 A;  1X2M A;  2JUC A;  2KRF A;  3JRC A;  4HW0 A;  2ESH A;  4E4H A;  3FK7 A;  2HTJ A;  2O61 A;  3OYJ A;  1H88 C;  2DQL A;  3JRF A;  3A2K A;  2HDD A;  5TGT A;  3FX3 A;  3V8L A;  4GDF A;  2DCE A;  2FE3 A;  5C3E J;  3I4P A;  2AXT C;  5EG0 A;  3BJA A;  1OYY A;  3U2R A;  3JAM K;  3W6K B;  1D1A A;  4CUG A;  2DFH A;  1ETO A;  4IQ4 A;  3K1P A;  1WJC A;  4EM1 A;  2A5Y B;  4KIF A;  2DJN A;  1GUU A;  1GXQ A;  3KFW X;  3BG6 A;  1UB9 A;  1V55 H;  5IY5 H;  3CUQ C;  2VC0 A;  5DUK A;  4JQF A;  2HYG D;  1EH8 A;  3PL8 A;  4BDY A;  4V19 K;  2ZME A;  2DK8 A;  1WKM A;  4XIC A;  1EH7 A;  1DUX C;  1TTY A;  3OYK A;  3C2B A;  3SZT A;  1MIJ A;  2CQK A;  3I56 I;  4E7J A;  2Q0O A;  2VB6 A;  3CQZ J;  3IKT A;  2HYF A;  4UB6 C;  4Q4Z F;  4M6X A;  2Z33 A;  3V7S A;  4A93 J;  4CCM A;  3CDH A;  3B02 A;  2X48 A;  3HSE A;  3GEZ A;  2FBK A;  5B1B H;  2QLZ A;  1RZ4 A;  1SD4 A;  2CW0 F;  3IKV A;  2VQH A;  3KP7 A;  4M3E A;  1Z3X A;  2HYJ A;  3M3Y J;  2CGP A;  2W57 A;  1KON A;  5A2Q K;  2BY1 A;  1LKX A;  3OR1 C;  1OCP A;  4EJV A;  1GHC A;  3PFI A;  2V9P A;  3KYL A;  2NS7 A;  1YS7 A;  3J81 K;  3ZXS A;  5FKK A;  5IYD J;  2RQQ A;  4YIF A;  2H1K A;  4HF0 A;  3HUG B;  1HLV A;  4NB5 A;  4EAT A;  3HM5 A;  3M7G A;  4LLL A;  1AKH A;  2ZJP F;  5BQT A;  1ZR4 A;  1NG7 A;  2GA2 A;  2JTV A;  1BJA A;  4BHB A;  5H20 A;  3TO7 A;  4PGG A;  2MD0 A;  3AG2 H;  2GOX B;  3EUA A;  1MND A;  4Z6Y A;  1JGG A;  3W6V A;  1E2X A;  1BIB A;  4M9Z A;  5KAI C;  3T8R A;  1S7E A;  4NC7 A;  4FAS D;  3V7R A;  1L3L A;  2R7D A;  1YW7 A;  1VQK I;  2R7V A;  5DS9 A;  1VF9 A;  2M30 A;  2VKH A;  3W3C A;  3RKY A;  4A5N A;  1ZGA A;  1MBH A;  2W00 A;  2E36 A;  2EIM H;  2IAI A;  2M34 A;  2OZ6 A;  1TBX A;  4RDU A;  4XON A;  1YYV A;  2ZNY A;  2ZXW H;  4A6E A;  4I0B A;  2RV8 A;  3VWB A;  2L01 A;  3HUG A;  4LMY A;  4ZZD A;  1TWF J;  1ETX A;  4ZZL A;  3QQA A;  2D45 A;  2A6T A;  2LSO A;  1WGX A;  4I7H A;  4B44 A;  1BC8 C;  3E1S A;  3Q0V A;  1K83 J;  3FHZ A;  4L18 B;  2XIG A;  5D6E A;  2R0Q C;  1S72 I;  1REP C;  4DYQ A;  3E3V A;  1B8I A;  4IHY A;  1QA6 A;  1WHU A;  1E3P A;  4P1W A;  2OA4 A;  3Q5F A;  2NRA C;  4HQE A;  1QU3 A;  4LGW A;  2HVQ A;  3M1E A;  1JKP C;  2WV0 A;  1LDK B;  3K2A A;  4WF2 A;  3O3K A;  5E1X A;  1W36 C;  2XAU A;  3MZH A;  3TOA A;  3OYD A;  2A07 F;  4WWC A;  3GFM A;  1S7A A;  1R36 A;  2DFE A;  2E60 A;  1FBQ A;  4NC8 A;  1KU3 A;  1Z9C A;  1TZL A;  3BR0 A;  1ZG1 A;  3BDD A;  2HOS A;  3NAR A;  2BXY A;  1OR7 C;  1K6O A;  2VJ4 A;  2VXD A;  2K3F A;  2EZI A;  1IO2 A;  3ELK A;  5KCM A;  1DGR M;  3MCZ A;  3BZ6 A;  3LST A;  2EIK H;  5AIQ A;  2VBY A;  3GTJ J;  1BI0 A;  4O6J A;  2B9S A;  3TBI A;  4OMZ A;  1F5T A;  4HF1 A;  3NEU A;  5FJ8 J;  4KJZ A;  1YIT I;  1MD0 A;  1OCT C;  3TO9 A;  4BQQ A;  2IS1 A;  2DOE A;  3MVP A;  1KYZ A;  3T8T A;  1OIS A;  1R5H A;  1IRF A;  3VYT B;  3QU3 A;  4C3J J;  4P9U A;  1MW7 A;  1XGO A;  5HOD A;  1FOW A;  5FKL A;  1RES A;  1IXC A;  3JRD A;  4ESB A;  3KZI C;  2HVS A;  4NHJ A;  4CGZ A;  3ZQI A;  4UXN A;  1JKR C;  2B0L A;  3B6A A;  3ZQ7 A;  3KP6 A;  1FSH A;  2DW4 A;  1ZG5 A;  3KEO A;  1X1P A;  2CFO A;  1FBU A;  1ZG3 A;  4XOR A;  1MDM B;  1P2F A;  1TC3 C;  1QPI A;  4ZYG A;  4D7M A;  1W7P B;  4RLF A;  3HOU J;  5GP9 A;  1XMK A;  2V79 A;  2EH3 A;  2Y75 A;  4D9J A;  4PJN A;  4CCK A;  5CVU A;  3DLA A;  1MNM C;  1R00 A;  1VI0 A;  3HRS A;  1ETV A;  1YE9 A;  3SXY A;  2LBF B;  3F8C A;  2DT6 A;  2EV0 A;  2J5O A;  3F6V A;  3JSP A;  2AS5 F;  1WCM J;  3VPR A;  2GBY A;  1R5I D;  2K5C A;  1SFK A;  2QGU A;  3LFU A;  2KIQ A;  1R49 A;  1KU7 A;  1D0Z A;  5KHD A;  2HOA A;  3GBG A;  1MBJ A;  2IBD A;  3WGG A;  1MJB A;  4RB1 A;  4AIJ A;  1FMV A;  3GWZ A;  4ZYA A;  1WH5 A;  2CU7 A;  3ERE D;  1T0F A;  4KNY A;  3H36 A;  2M4G A;  1W5S A;  2Z2S B;  3JAM Z;  4U7B A;  3VB2 A;  4KIS A;  2OV7 A;  2OD5 A;  3A01 B;  3DEW A;  5J1U A;  4UY8 I;  2CRG A;  3ZN0 A;  4D5C A;  4E7H A;  2VBX A;  3ZCO A;  1VQL I;  2E1M B;  2XGE A;  3D5S C;  3F8B A;  4BU2 A;  2L2O A;  4BY7 J;  1ENH A;  4KMF A;  1CGP A;  4RB3 C;  3IWZ A;  2EJR A;  2HQ5 A;  4GYI A;  4A5M A;  3U21 A;  1APL C;  3VYU B;  2WAE A;  2ADU A;  2ZO4 A;  3OYL A;  2VT3 A;  3GZ5 A;  1QBJ A;  1DPR A;  1LE8 B;  2O0Y A;  5HLT A;  3BWG A;  3MEX A;  4GRI A;  1K61 A;  1J9I A;  2KRC A;  3G1L A;  3RPU A;  2BE5 F;  4UNO A;  3CME I;  2ZB9 A;  2DYR H;  4GO1 A;  3ZRG A;  2HOE A;  2FF4 A;  3H9J A;  2F5F A;  1TL8 A;  2LY9 A;  1Y1V J;  3KLO A;  1J2X A;  3EUH A;  2QUF A;  3GTP J;  2CV0 A;  5EG0 B;  1HKT A;  1SVO A;  1MDM A;  3E6D A;  3GCM A;  3SZP A;  2GIV A;  4PGH A;  3F8N A;  1YI2 I;  3GTO J;  5CVR A;  2VXZ A;  1VQ7 I;  2LMD A;  1Z6T A;  1Y8R B;  2JVH A;  3JRA A;  1E3O C;  4BEH A;  3FZV A;  4HDV A;  2JQ7 A;  3DBR B;  1T38 A;  2DT7 B;  3P7N A;  3N05 A;  4I98 B;  3DQV C;  2LBF A;  2RRE A;  3ECO A;  2FJ1 A;  2DO7 A;  1ZGW A;  5ICG A;  3HSR A;  2BY3 A;  3HIF A;  1Z0X A;  3K70 C;  1XN7 A;  2BBY A;  3PNV A;  3LNQ A;  1LFB A;  2QKM B;  3HOW J;  5E79 C;  1B4A A;  2P4W A;  1K4S A;  1D8K A;  1U9O A;  3B6C A;  1R1V A;  2HEO A;  2P8T A;  1Z6R A;  2CV1 A;  3MD2 A;  3ROU A;  3G1M A;  3P9C A;  1XSX A;  4M3D A;  2EIL H;  1BJZ A;  3DTE A;  1AHD P;  1VFC A;  1O3R A;  2JVG A;  4M6V A;  2EK5 A;  3HYI A;  2E71 A;  1F36 A;  4C3I J;  2WAF A;  1NHA A;  3QWL A;  1W0T A;  5ILS A;  1QZY A;  4IHS A;  4FTH A;  2FNP A;  2K40 A;  1Z91 A;  5F1J A;  1RUN A;  2CYY A;  5E3O A;  1YS6 A;  4E7L A;  3G6E I;  3ZQF A;  1IRZ A;  1XSV A;  4IO9 F;  3EET A;  4A3L J;  2IPQ X;  3K4C A;  3TOB A;  2Y0S A;  3ULQ B;  3RZD J;  4M73 A;  2QVO A;  3K70 D;  4L0Z B;  1GLN A;  4DJA A;  1LEB A;  1DPU A;  3L7W A;  2H94 A;  3D0S A;  2EV5 A;  1PUE E;  5LGU A;  2VBW A;  5LEK A;  2HPM A;  2L9N A;  2HPI A;  2K27 A;  3RYR A;  3OSG A;  1PP7 U;  4XOT A;  1DQU A;  3TP3 A;  3CLQ A;  4UVC A;  1UMQ A;  2Z1D A;  4PJJ A;  1CQT A;  1HC8 A;  3QYB A;  2R5Y A;  4DZJ A;  5EZG A;  2A61 A;  2DDB A;  2ETH A;  3HG9 A;  3K0L A;  2A69 F;  1U3E M;  1WZ2 A;  1MNE A;  4ESJ A;  2V7F A;  1GV2 A;  3OYH A;  1B8I B;  1RKT A;  2KJB A;  1FBS A;  1EJ9 A;  1AOY A;  5KK1 A;  6PAX A;  3L00 A;  5D4S A;  3ZMT A;  1U6G A;  3AL0 B;  1QHH D;  4Y13 A;  4UUS A;  3CJR B;  4XSX F;  1QGP A;  4XMY A;  2HZT A;  3Q3S A;  3Q9V A;  4A3D J;  4M3F A;  1ZKG A;  3OYA A;  3PM1 A;  4WX9 A;  2ME6 A;  4X0G A;  2AHQ A;  3CC7 I;  2Y48 A;  3RKX A;  2DOF A;  1X2N A;  3JRH A;  4NQW B;  3FMS A;  1BR4 A;  1WQ2 A;  3PFY A;  3DWL E;  2QM3 A;  4AUX A;  1VQ6 I;  4IJA A;  4F93 B;  4Q47 A;  4XN0 A;  2MLG A;  2NVY J;  2A68 F;  4DGW B;  4HNV A;  2LDU A;  2M9H A;  2XVC A;  1LPQ A;  1RRJ A;  5DEQ A;  1A36 A;  1JUM A;  3S93 A;  4MO7 A;  2JN6 A;  3QAH A;  4H0E A;  5CYV A;  3IH3 A;  2ECB A;  1LDJ A;  3WE3 A;  2XV4 S;  1EKE A;  4ETS A;  2FEZ A;  3HB9 A;  2ZBK A;  9ANT A;  5LHG A;  2R7Q A;  2P5K A;  1W5T A;  2Z16 A;  3BQY A;  1WVR A;  3S32 A;  2A05 A;  1TWH J;  1R7J A;  3P9I A;  3I71 A;  1OFC X;  2GOM A;  3NQO A;  1HDD C;  2PJR A;  2L7M P;  1IXR C;  2HVR A;  1LEA A;  2B63 J;  2DA1 A;  2M8E A;  4ANJ A;  1ZR2 A;  5L3D A;  3I58 A;  1V5G A;  4M9S A;  2OPT A;  5LFA A;  2MC3 A;  3L2V A;  1VQN I;  2DYS H;  2Y0S N;  3E5U A;  3WGH A;  2X6W A;  3KPH A;  2XAJ A;  1YIJ I;  4LG3 A;  1J5Y A;  3TDU C;  1FYL A;  2KZG A;  2WAQ A;  3BY6 A;  3Q9S A;  4ZH4 F;  3RQI A;  3TDZ C;  1QVU A;  2ZJ2 A;  4A3I J;  2IGK A;  2GXB A;  4E7S A;  1YOV B;  2BOL A;  5TJJ A;  2QBY A;  4HX7 A;  5H6Q A;  3DFG A;  5C4X J;  2VC1 A;  2E5Z A;  5DD8 A;  2BHY A;  1G6N A;  4W1U A;  1LUJ B;  4CA0 A;  1IDZ A;  1JTY A;  4UVB A;  3QP5 A;  4HA8 A;  4B47 A;  3GTK J;  3LSR A;  4EEF G;  2JA8 J;  2KHM A;  2VT2 A;  4WCG A;  3VFZ A;  3CCQ I;  1TWC J;  4A3K J;  1WSU A;  4KIC A;  5IT3 A;  2WTE A;  5JLX A;  1JUS A;  3OOU A;  4BHC A;  1VQM I;  1D0Y A;  3C7J A;  2QSF X;  5DM7 F;  3IC7 A;  2Q1Z B;  3CUO A;  1MMN A;  4JYK A;  3DXJ F;  4DBQ A;  4HV6 A;  4U0W A;  1YX5 A;  3O2P E;  3HKZ A;  3NWS A;  4LK0 F;  1TP4 A;  3WU1 B;  3QOD A;  1FJL A;  1IW7 F;  1SD6 A;  3RPU D;  2M0M A;  1OR7 A;  3GFL A;  3K9T A;  1WRJ A;  3U9G A;  2DMU A;  3FXO A;  2A3S A;  5E18 F;  5LHH A;  5D8L B;  3CF5 F;  3BZK A;  5CQG A;  5FKN A;  3S2H J;  2DBB A;  2DMQ A;  4MGR A;  1P7I A;  5HNH A;  4G6T B;  4J00 A;  3ZPL A;  5LBQ A;  3PQJ A;  4XLF A;  1SD7 A;  3L2W A;  1T8I A;  2MH9 A;  1ETY A;  4EQQ A;  1ZH5 A;  2FXA A;  2ZCW A;  1MMG A;  2OQR A;  4H4K C;  3WTX C;  2ISY A;  1I5Z A;  2QYO A;  4O3M A;  4OIQ F;  2VLA A;  5DCF A;  3JW4 A;  2CUE A;  2XUB A;  3TL4 X;  5F04 A;  3N4M A;  3RSN A;  3X2Q H;  2EWN A;  3FM3 A;  3HHH A;  3DV8 A;  2L54 A;  3L2R A;  1TT0 A;  5JR3 A;  5HS9 A;  4IQJ A;  4ZDO A;  2COM A;  4J19 A;  1D0X A;  2HKX A;  4TV7 A;  5ED4 A;  3FBN B;  3DCF A;  4HQM A;  2W84 A;  3HL2 A;  2CSO A;  4MTD A;  1N78 A;  5L3C A;  3BCB A;  2V4J C;  3S15 J;  5F1R A;  5M3F J;  1HF0 A;  2CQQ A;  1R1T A;  3EUH C;  4DZP A;  2CWE A;  1YO5 C;  4G7H F;  1TLH B;  3K7A J;  3ABL H;  5F27 A;  5HDN A;  1R6R A;  3J7A O;  5DYM A;  2KKO A;  4N4O B;  5IYC J;  1JKQ C;  2R5Y B;  1SFO J;  3FWE A;  2DA6 A;  3HRU A;  2XB5 A;  2IA1 A;  3CF2 A;  4WXD A;  5HLI A;  3RQ4 A;  4BJ6 C;  4XKC A;  1ZRD A;  3BTJ A;  5K1Y A;  3FBI B;  1JT0 A;  1G3W A;  1R4M B;  3S8P A;  1ZQ3 P;  1FSE A;  4XOP A;  4EV0 A;  2XDV A;  4I2O A;  1U8B A;  2R7U A;  1WPK A;  3VDX A;  1W4M A;  5LGN A;  3CMA I;  2Y9Z A;  2E7X A;  2XRL A;  5HNF A;  4ZYD A;  3A03 A;  1N75 A;  1KQ9 A;  4M6Y A;  4HBL A;  3IRR A;  5D6F A;  4PJL A;  4MLO A;  2CQN A;  3BG9 A;  1XGS A;  3MN2 A;  1IJW C;  1OYI A;  3QU6 A;  2X6X A;  3CMM A;  3MKZ A;  3BRO A;  2L0K A;  2CUF A;  5LLQ A;  3FK6 A;  2OCE A;  3HXL A;  4JX5 A;  1TWA J;  2ZFU A;  2HXO A;  1TNT A;  3FKJ A;  4XLA A;  4C9Y A;  4C2T A;  1MBK A;  4MNU A;  4F3Q A;  5HVQ C;  3AG1 H;  1LQ1 A;  3K69 A;  2BEO A;  2K02 A;  1MJ9 A;  1RNL A;  1TWG J;  3OMY A;  5D5V B;  1C0W A;  3T5X A;  2QWW A;  1RIO H;  2V1N A;  3D5L A;  2M5W A;  5E1Z B;  2R7O A;  4F52 A;  2XRN A;  3W2V A;  3PUF A;  3FM5 A;  4RGS A;  3NRV A;  1IN6 A;  5D5W B;  2E1C A;  2FQ4 A;  3KE2 A;  3WTW C;  1STZ A;  1FPQ A;  3OY9 A;  5IP6 A;  3DP7 A;  3VSL A;  2L7F P;  2OZU A;  1EV7 A;  2E2H J;  3ZP5 A;  4Y3O A;  3GFI A;  4ON0 A;  2L9R A;  2DPD A;  2HI3 A;  5LRS A;  4Y33 A;  2VOP A;  1FOK A;  3L09 A;  3S1N J;  1PUF B;  1E3H A;  4EGY A;  4BXF A;  4L5E A;  4WXC A;  4XRF A;  4OIR F;  1GVD A;  3CCM I;  1P92 A;  4Y15 A;  2R7W A;  3LFK A;  3FMR A;  2DAO A;  1KGS A;  4LFU A;  3VYR B;  3I64 A;  2P7V B;  5FRO A;  1YTY A;  1FIP A;  1BI2 A;  4XM3 A;  2O9L A;  1Z67 A;  3LSH A;  3B73 A;  2MD5 A;  3SDG A;  1I1S A;  2E2I J;  2K4B A;  3HRM A;  3R0A A;  4BE1 A;  3I3L A;  5F0H A;  2KDZ A;  2IGO A;  3O8H A;  2VON A;  4LJZ F;  3GZ6 A;  2VN2 A;  2X0L A;  2FUG 2;  3KP2 A;  4XN3 A;  1LFP A;  1FT9 A;  1PJR A;  2XSJ C;  4RB2 C;  2XF5 A;  4AWX B;  1CF7 B;  1HQC A;  2G0E A;  2KZV A;  4HF2 A;  1SMT A;  4I09 A;  2LTP A;  1X3W B;  1IV6 A;  3HOT A;  3F8F A;  5JHF A;  1IG7 A;  1J75 A;  3CC2 I;  4XR6 A;  4KT6 A;  3DPU A;  1MBE A;  4I99 C;  2PBI A;  4M3G A;  2KL4 A;  4BQO A;  5GAH J;  1YJW I;  2UUZ A;  4NNJ A;  2W4S A;  5F6F A;  1N25 A;  4ITV A;  4U0Y A;  4HG2 A;  4EM2 A;  2CS3 A;  1WWX A;  4XL9 A;  4NDL A;  5FKO A;  2HDC A;  2FU4 A;  4HX8 A;  4XKV A;  4I6Z A;  1IF1 A;  2FBH A;  4Y17 A;  4A6D A;  3H5N A;  3FXQ A;  3VYS B;  1JXS A;  2DXI A;  1FNN A;  4EGZ A;  3S14 J;  3KEY A;  3FXR A;  2M87 A;  1FP1 D;  2KIS A;  2VAS A;  4FCY A;  1YRN B;  1HST A;  2B7E A;  4RMN A;  3V4G A;  2F2E A;  1R22 A;  3CJT B;  4A3F J;  2JPB A;  1IC8 A;  2VQL A;  1VQ4 I;  2KRH A;  4RGU A;  2VPL A;  2G7H A;  2X6Y A;  3TED A;  4D0P A;  1ETQ A;  1Y56 A;  1PUF A;  2VOD A;  1YLF A;  1JHH A;  1FYM A;  1JE8 A;  2P5V A;  2NVX J;  4BGD A;  4F7Z A;  3RKW A;  4XRM A;  5CPR B;  1Y1W J;  4LIV A;  3MKY B;  3TMO A;  3J80 K;  1WJA A;  2BYV E;  4UV9 A;  3BPX A;  2QKL B;  2EZL A;  1U5T A;  1D3Y A;  3FXM A;  1UJ8 A;  4HPQ A; 
#chains in the Genus database with same CATH homology
 2Z99 A;  1HXD A;  2RDP A;  4BHP A;  2FQ3 A;  5HLH A;  1U2W A;  2NS0 A;  5KVR A;  3H3U A;  1V3F A;  2NAZ A;  3CTA A;  5CVI A;  1ZLJ A;  4HX4 A;  2DU9 A;  1FY7 A;  4XBF A;  4KDP A;  4XLP F;  3MZY A;  2ELH A;  2D2W A;  4N0B A;  5EEG A;  5J8F A;  1O3T A;  4KYW A;  1IN5 A;  3CUQ B;  1O57 A;  4O5V A;  1W7P A;  3ABU A;  2VOO A;  3J80 Z;  5IT9 K;  4RB0 A;  2QQ9 A;  3J81 Z;  4OMY A;  2PG4 A;  4EMS A;  5D4R A;  2ZXJ A;  4KMU X;  2V1D A;  1H9T A;  2FRH A;  4N9H A;  2EA4 A;  3KET A;  2XAF A;  2STW A;  2DI3 A;  1HW5 A;  4EM0 B;  2H09 A;  5JI6 A;  2XHK A;  5E17 F;  3JSO A;  3C1D A;  2RNJ A;  2W25 A;  1S7O A;  3N97 A;  2IT0 A;  1LB2 A;  2ZNZ A;  1R23 A;  2Q8K A;  4G6Q A;  5FFZ A;  1K79 A;  3GFJ A;  5LEJ A;  3WTZ A;  3QOP A;  1K78 A;  4HLX A;  3EYI A;  1G4D A;  4MQ9 F;  3HOS A;  3SHF A;  4IRI A;  1R58 A;  1J0R A;  1P4X A;  2LF8 A;  4I02 A;  3WTS C;  2H27 A;  4HOB A;  1U5T C;  5F64 A;  4EJT A;  2P5L C;  3HTS B;  4JK1 X;  2UWM A;  4RGR A;  2L3D A;  2EFW A;  1Z05 A;  1HKQ A;  4I01 A;  1I27 A;  1YW9 A;  1ZGJ A;  3C3W A;  1JHF A;  2XGX A;  1ZRE A;  2Z3Y A;  1KQ0 A;  4U7D A;  4HZF A;  1QPM A;  1B6A A;  2O3F A;  2LNB A;  4IRH A;  1I1G A;  2HQN A;  5DUI A;  4PCQ A;  5L3G A;  1KU9 A;  2QZ8 A;  2XKP A;  2ZME B;  2QEN A;  3P9K A;  4CHU A;  2YR2 A;  1MKM A;  1SD5 A;  5IT9 Z;  2EB7 A;  4KIB A;  5DCM B;  1IN4 A;  4G8X A;  4CYD A;  3QPH A;  2YX7 A;  2O6G E;  3ECH A;  3DEU A;  1SAX A;  3IHU A;  3QRF F;  1DDN A;  4EJO A;  2GAU A;  1B1B A;  2PQ8 A;  2QQB A;  2PLY A;  2Y0M A;  5FLX Z;  5J8C A;  2L4M A;  4LG0 A;  4BQA A;  2RN7 A;  3I0T A;  3SFZ A;  1ON2 A;  4UV8 A;  5LGT A;  1PDN C;  5ICF A;  1TW3 A;  2IA2 A;  5CVJ A;  3JTG A;  3KP3 A;  1O7F A;  3V8K A;  3HRT A;  3I59 A;  1QZZ A;  2PMH A;  2STT A;  4HDU A;  4BAY A;  2ISZ A;  1FWZ A;  4AD9 A;  5FLX K;  2PN6 A;  3F6O A;  2ACJ A;  3KZZ A;  1IN7 A;  5FFX A;  2RVC A;  4PZJ A;  1YFH A;  1G3S A;  1P4A A;  1G3Y A;  2YPR A;  3REO A;  5DCM A;  4YG2 F;  2XAG A;  2ZKZ A;  2XRO A;  2A6H F;  4LLN A;  1ON1 A;  3EDP A;  3G73 A;  3KLN A;  4HLY A;  1XSD A;  1J7K A;  1IAW A;  4G9Y A;  1KYW A;  2QQA A;  3TQN A;  3R4K A;  3LA2 A;  3WGI A;  4U0V A;  3MWM A;  1F9N A;  4P5O A;  2OAZ A;  5EEH A;  4OU0 A;  2LKP A;  5FD6 A;  1FC3 A;  4A2U A;  1UFM A;  5CVV A;  3H92 A;  2AXL A;  1SFX A;  1UHM A;  3VOD A;  3HHG A;  5DV5 A;  2YSR A;  3IL2 A;  4L9V A;  1K7A A;  2HQR A;  1MGT A;  4ENK A;  5BMZ A;  4P55 A;  1ZAO A;  2VBZ A;  5JVT A;  2G7U A;  4L5J A;  1BIA A;  4S04 A;  3WG9 A;  1I6X A;  2HR3 A;  1Z1D A;  1XGN A;  1ULY A;  3HSF A;  3E97 A;  5FD5 A;  1S6L A;  4UVA A;  5L3F A;  5E20 A;  2MA3 A;  2MH2 A;  2KIF A;  1H0M A;  4AIK A;  3ZMZ A;  3DKW A;  4UUV A;  2IRF G;  3WU0 A;  1YQA A;  1B59 A;  1BN5 A;  4MQV A;  2PMU A;  3E6B A;  3I53 A;  3WTV C;  3MFK A;  4OIN F;  2YU3 A;  3F21 A;  4YFK F;  3TO6 A;  1ZYR F;  2FA5 A;  4Q48 A;  3EQL F;  3LAP A;  1P4W A;  3DPT A;  4ASN A;  3CJN A;  2IJL A;  5ILU A;  1GVJ A;  3F3X A;  4GXO A;  3S2W A;  1A04 A;  4ENJ A;  4NQW A;  3ZMV A;  1FYK A;  4KN7 X;  2LF7 A;  3KEQ A;  2DK5 A;  1W7P D;  3E6C C;  4QLC U;  2DPU A;  4ESF A;  4KN4 X;  3HTU A;  5HOO A;  3AAF A;  3BPV A;  4KT5 C;  2O03 A;  2WC2 A;  4FHT A;  2GWR A;  2IW5 A;  2EFO A;  2G9W A;  2HFH A;  3QPT A;  2HS5 A;  5BOX A;  3O6B B;  4CXF A;  4P9F A;  2R7F A;  2JPC A;  1ZHF A;  2OQG A;  3MQ0 A;  2FMY A;  1HSJ A;  3GLX A;  2EFQ A;  1VTN C;  4LG0 B;  4RAY A;  1Z7U A;  1H9G A;  4G7O F;  3F23 A;  1B9N A;  3BOQ A;  3DPL C;  1BBY A;  1IN8 A;  2EA2 A;  3FXU A;  4EVI A;  4CZZ A;  1R1U A;  1Y0U A;  2RGV A;  1TQI A;  5JHU A;  5K5O A;  3V8J A;  1ZAR A;  2JT1 A;  4G6D A;  3R0J A;  4GCV A;  2JZY A;  2HGC A;  1XGM A;  2UZK A;  1B9M A;  1IUY A;  1BM9 A;  1ONV A;  3GXO A;  4IXA A;  2OU2 A;  3RTR A;  2JRT A;  1SFE A;  5LRR A;  5H6R A;  4EJU A;  1XD7 A;  4IHT A;  2GZW A;  1TQM A;  5DD4 A;  3GW2 A;  4L0Y B;  1XDS A;  4GYG A;  2P6T A;  5HLG A;  3RI4 A;  4MTE A;  4WK8 F;  1KQ8 A;  3JTH A;  2FML A;  2V6C A;  5AIP A;  2IP2 A;  3GVA A;  4P96 A;  4WXH A;  1U78 A;  1TQP A;  2MBF A;  4LD5 A;  3F22 A;  1ZRF A;  2F5C A;  3I5U A;  3WTY C;  3RJP A;  1KA8 A;  1XB4 A;  2CFX A;  3WTT C;  1ZRC A;  3I54 A;  1QO0 D;  1O7L A;  1BI3 A;  4IF4 A;  3KZY A;  5ILV A;  5BS6 A;  3WOD F;  3LWF A;  4YFN F;  2XAS A;  4DQ2 A;  4HYE A;  1LJ9 A;  3M9A A;  4EJW A;  5BPD A;  1IZ1 A;  4UHT A;  2L02 A;  2R3S A;  1S3J A;  3VEP A;  4PDK A;  5D8K B;  4AVP A;  2O8X A;  4LLG F;  4RAZ A;  3LQR A;  4B09 A;  3LAJ A;  1RUO A;  4L9T A;  4GGG A;  2P6S A;  1USS A;  1HW2 A;  1KU2 A;  2ESN A;  2K7L A;  1T98 A;  2DFI A;  2FOK A;  3ML6 A;  3F72 A;  3G3Z A;  1S29 A;  2K4J A;  4IPA A;  3ZN1 A;  1LNW A;  3TKY A;  2NNN A;  1L0O C;  3RYP A;  4OIO F;  2E1N A;  2K86 A;  4OOI A;  4BH9 A;  2DT5 A;  5ICE A;  1T2K A;  4FT8 A;  5AON A;  5E1W A;  2KIM A;  2HTS A;  2TDX A;  4S05 A;  3SQN A;  3V7C A;  3ZMD A;  3R60 A;  1F4K A;  3R61 A;  1K78 B;  2IA0 A;  2XAH A;  3COA C;  5L3B A;  4A0X A;  3EYY A;  1MZB A;  2V9V A;  3WE2 A;  5K5R A;  5J6X A;  2P7C B;  3TGN A;  3GF2 A;  4ZYE A;  1CF7 A;  3T1B A;  2OBP A;  5D5X B;  4IVN A;  2A6E F;  1D8J A;  4RS8 A;  2RKH A;  4L9J A;  4A0Y A;  4ZYH A;  2Z5U A;  3GX4 X;  4CDG A;  2RQP A;  3BJ6 A;  1E17 A;  3OOP A;  2W85 A;  4E70 A;  1ZLK A;  1JGS A;  4IRG A;  2X4H A;  2NNY A;  2KIU A;  4KUM A;  3IWF A;  3I59 B;  4MEY F;  2D1V A;  1EH6 A;  1P6R A;  4DNC A;  1XMA A;  3M8F A;  5HS8 A;  1QNT A;  5L3E A;  2PEX A;  4ENN A;  2H6C A;  4RGX A;  3FMQ A;  3VOE A;  5CJ9 A;  3U1D A;  3KCC A;  2CO5 A;  2PI0 A;  1FX7 A;  1TNS A;  4KIG A;  3WTU C;  4LB5 A;  1UCR A;  1J59 A;  1DP7 P;  1QQI A;  2KJC A;  3K2Z A;  3CLO A;  2XKO A;  3RPQ A;  1T39 A;  2BV6 A;  4A12 A;  1ODD A;  4LB6 B;  2EFP A;  5A2Q Z;  4MHG A;  1Q1H A;  1LVA A;  4QWQ A;  2FBI A;  4K2E A;  1V4R A;  3W6J B;  3IRQ A;  5FB2 A;  2BGC A;  3C18 A;  4A0Z A;  2HWV A;  1R5G A;  2MLK A;  4B8X A;  1YG2 A;  2NYX A;  4AIH A;  1XCV A;  4ENM A;  5CLS A;  2UXN A;  1FP2 A;  1IXS B;  3L9F A;  4M72 A;  1U5T B;  3ZMS A;  4U88 A;  3KP5 A;  1D5V A;  5D5U B;  2Q2E A;  2V1U A;  1T6S A;  2L4A A;  2Z9O A;  3LA7 A;  2ZFW A;  2GXG A;  2VE9 A;  2H6B A;  1SMY F;  3MAJ A;  2VE8 A;  2EV6 A;  1IRG A;  1FZP B;  2GQQ A;  4FX4 A;  1G3T A;  3M8E A;  2J5P A;  3K1M A;  2FNA A;  1HW1 A;  1AWC A;  3ZMU A;  3GYH X;  2GA1 A;  3CO6 C;  1O3S A;  2M1B A;  4N9I A;  3RDI A;  4JBA A;  3E6M A;  4CIC A;  1FLI A;  4I0A A;  2F5E A;  4MEX F;  4G94 A;  1MJA A;  1WI9 A;  3BJO A;  4OIP F;  1GXP A;  1SFU A;  2M45 A;  2QBY B;  1OMI A;  5HS7 A;  3F8M A;  4XSZ F;  4L5I A;  4M71 A;  3ISP A;  1OPC A;  1BOA A;  5ERI A;  5K5Q A;  3DF8 A;  4R1H A;  3BP8 A;  1ZN2 A;  2JSC A;  4CO8 A;  5FGM A;  1OYW A;  1S8N A;  2C6Y A;  2YX4 A;  2UXX A;  3CUQ A;  4G7Z F;  2DLL A;  4M74 A;  3ABT A;  3CO7 C;  5JFR A;  2V1X A;  2IVM A;  1RI7 A;  3L2C A;  3E5X A;  5HDK A;  4KA4 A;  4R79 A;  1HBX G;  5E8G A;  3GO5 A;  1HKS A;  5HDG A;  3QP6 A;  4BNC A;  4YII A;  2CG4 A;  3R6S A;  1YW8 A;  5ICC A;  2PJP A;  3LQQ A;  4BYY A;  2F5D A;  3PQK A;  5LHI A;  2WWY A;  1PP8 F;  1OKR A;  5E8I A;  2D1H A;  1UST A;  4M9X A;  5TRD A;  4FX0 A;  1BI1 A;  1U8R A;  3RIR A;  1XCB A;  2EFN A;  1TW2 A;  1BC7 C;  3LA3 A;  3OV8 A;  3FF5 A;  4Q5S F;  1LDD A;  1XDU A;  1UHW A;  4YFX F;  2XAQ A;  4HAM A;  1O3Q A;  4BXU A;  4Z2Y A;  3E5Q A;  3KP4 A;  1F1Z A;  2FSW A;  2E7W A;  4L9N A;  3T0Y A;  2W24 A;  3GUD A;  5BPI A;  4KFC A;  2DTR A;  3K1N A;  5DDG A;  1X3U A;  5FO5 A;  1YIO A;  4R8H A;  4XLN F;  2PFB A;  2HKO A;  4HV5 A;  4LK1 F;  2DQR A;  2RC4 A;  3H3Z A;  2KRF A;  4HW0 A;  2ESH A;  2HTJ A;  2O61 A;  2DQL A;  3FX3 A;  3V8L A;  2FE3 A;  3I4P A;  3BJA A;  1OYY A;  3U2R A;  3JAM K;  3W6K B;  3K1P A;  4EM1 A;  2A5Y B;  4KIF A;  1GXQ A;  3KFW X;  1UB9 A;  3CUQ C;  2VC0 A;  5DUK A;  4JQF A;  2HYG D;  1EH8 A;  2ZME A;  2DK8 A;  1WKM A;  1EH7 A;  1DUX C;  1TTY A;  3SZT A;  2CQK A;  2Q0O A;  3IKT A;  2HYF A;  4Q4Z F;  4M6X A;  2Z33 A;  3V7S A;  3CDH A;  3B02 A;  3HSE A;  3GEZ A;  2FBK A;  2QLZ A;  1RZ4 A;  1SD4 A;  2CW0 F;  3IKV A;  3KP7 A;  2CGP A;  2W57 A;  5A2Q K;  4EJV A;  1GHC A;  3PFI A;  1YS7 A;  3J81 K;  4YIF A;  4HF0 A;  4NB5 A;  3M7G A;  4LLL A;  5BQT A;  2GA2 A;  2JTV A;  1BJA A;  4BHB A;  5H20 A;  3TO7 A;  4PGG A;  1E2X A;  1BIB A;  4M9Z A;  3T8R A;  3V7R A;  1L3L A;  2R7D A;  1YW7 A;  2M30 A;  4A5N A;  3RKY A;  1ZGA A;  2OZ6 A;  1TBX A;  1YYV A;  2ZNY A;  4A6E A;  4I0B A;  2RV8 A;  2L01 A;  3HUG A;  4LMY A;  4ZZD A;  4ZZL A;  2D45 A;  2LSO A;  4I7H A;  1BC8 C;  3FHZ A;  4L18 B;  2XIG A;  5D6E A;  1REP C;  3E3V A;  2OA4 A;  3Q5F A;  2NRA C;  4HQE A;  4LGW A;  3M1E A;  2WV0 A;  1LDK B;  4WF2 A;  3O3K A;  5E1X A;  3MZH A;  3TOA A;  2A07 F;  4WWC A;  1S7A A;  3GFM A;  1R36 A;  1FBQ A;  1KU3 A;  1Z9C A;  1ZG1 A;  3BDD A;  1K6O A;  3ELK A;  3MCZ A;  3BZ6 A;  3LST A;  5AIQ A;  2VBY A;  1BI0 A;  4O6J A;  4OMZ A;  1F5T A;  4HF1 A;  3NEU A;  1MD0 A;  3TO9 A;  1KYZ A;  3T8T A;  1R5H A;  1IRF A;  3QU3 A;  4P9U A;  1XGO A;  1IXC A;  4ESB A;  4NHJ A;  4CGZ A;  4UXN A;  2B0L A;  3ZQ7 A;  3KP6 A;  1FSH A;  2DW4 A;  1ZG5 A;  3KEO A;  1FBU A;  1ZG3 A;  1MDM B;  1P2F A;  4ZYG A;  1W7P B;  1XMK A;  2V79 A;  2Y75 A;  5CVU A;  1R00 A;  3HRS A;  3SXY A;  3F8C A;  2J5O A;  2EV0 A;  3F6V A;  3JSP A;  2AS5 F;  1KU7 A;  3WGG A;  1MJB A;  4RB1 A;  4AIJ A;  3GWZ A;  3ERE D;  4KNY A;  1T0F A;  4U7B A;  3JAM Z;  1W5S A;  3VB2 A;  2OD5 A;  3ZN0 A;  2VBX A;  3F8B A;  4KMF A;  1CGP A;  4RB3 C;  3IWZ A;  2EJR A;  4GYI A;  4A5M A;  2ADU A;  2ZO4 A;  2VT3 A;  3GZ5 A;  1QBJ A;  1DPR A;  2O0Y A;  1J9I A;  3BWG A;  3MEX A;  3RPU A;  2BE5 F;  4UNO A;  4GO1 A;  2HOE A;  2FF4 A;  2F5F A;  3KLO A;  1J2X A;  3EUH A;  2QUF A;  1HKT A;  1MDM A;  3E6D A;  3SZP A;  2GIV A;  4PGH A;  3F8N A;  5CVR A;  2VXZ A;  1Z6T A;  4HDV A;  3FZV A;  1T38 A;  3P7N A;  4I98 B;  3DQV C;  3ECO A;  2DO7 A;  5ICG A;  3HSR A;  3HIF A;  1XN7 A;  2BBY A;  1B4A A;  2P4W A;  1D8K A;  1R1V A;  2HEO A;  2P8T A;  1Z6R A;  3ROU A;  3P9C A;  1XSX A;  1O3R A;  2EK5 A;  3HYI A;  1NHA A;  5ILS A;  1QZY A;  4IHS A;  2FNP A;  1Z91 A;  1RUN A;  2CYY A;  1YS6 A;  1XSV A;  3EET A;  2IPQ X;  3TOB A;  3ULQ B;  4M73 A;  2QVO A;  4L0Z B;  1DPU A;  1LEB A;  3L7W A;  2H94 A;  3D0S A;  2EV5 A;  1PUE E;  5LGU A;  2VBW A;  5LEK A;  2K27 A;  3RYR A;  1PP7 U;  4UVC A;  2A61 A;  2ETH A;  1U3E M;  3K0L A;  2A69 F;  4ESJ A;  2KJB A;  1FBS A;  1AOY A;  5KK1 A;  6PAX A;  3L00 A;  5D4S A;  3ZMT A;  1U6G A;  4Y13 A;  4XSX F;  1QGP A;  2HZT A;  3Q9V A;  4WX9 A;  2Y48 A;  3RKX A;  3FMS A;  1WQ2 A;  2QM3 A;  4IJA A;  4Q47 A;  2MLG A;  2A68 F;  2LDU A;  2XVC A;  5DEQ A;  3QAH A;  4H0E A;  5CYV A;  1LDJ A;  3WE3 A;  2XV4 S;  4ETS A;  2FEZ A;  2ZBK A;  5LHG A;  2P5K A;  1W5T A;  1R7J A;  3P9I A;  3I71 A;  3NQO A;  1IXR C;  1LEA A;  2M8E A;  5L3D A;  3I58 A;  4M9S A;  2MC3 A;  3E5U A;  3WGH A;  2XAJ A;  1J5Y A;  3TDU C;  1FYL A;  3Q9S A;  3BY6 A;  4ZH4 F;  3TDZ C;  2GXB A;  2ZJ2 A;  5TJJ A;  2QBY A;  4HX7 A;  5H6Q A;  3DFG A;  2VC1 A;  5DD8 A;  1G6N A;  4UVB A;  3QP5 A;  4HA8 A;  2VT2 A;  4WCG A;  3VFZ A;  1WSU A;  4KIC A;  5IT3 A;  2WTE A;  4BHC A;  3C7J A;  3IC7 A;  3CUO A;  3DXJ F;  4HV6 A;  4U0W A;  3O2P E;  4LK0 F;  3WU1 B;  1IW7 F;  1SD6 A;  3GFL A;  1OR7 A;  3K9T A;  1WRJ A;  3U9G A;  2A3S A;  5E18 F;  5LHH A;  5D8L B;  2DBB A;  4MGR A;  3ZPL A;  5LBQ A;  3PQJ A;  1SD7 A;  2MH9 A;  4EQQ A;  1ZH5 A;  2FXA A;  3WTX C;  2OQR A;  2ZCW A;  4O3M A;  1I5Z A;  2ISY A;  2QYO A;  4OIQ F;  5DCF A;  3JW4 A;  2XUB A;  3N4M A;  2EWN A;  3FM3 A;  3HHH A;  3DV8 A;  2L54 A;  5JR3 A;  5HS9 A;  2COM A;  2HKX A;  4TV7 A;  5ED4 A;  4HQM A;  2W84 A;  2CSO A;  4MTD A;  5L3C A;  5F1R A;  1R1T A;  2CWE A;  1YO5 C;  4G7H F;  1TLH B;  5HDN A;  3J7A O;  5DYM A;  2KKO A;  3FWE A;  3HRU A;  2IA1 A;  5HLI A;  4WXD A;  1ZRD A;  5K1Y A;  1G3W A;  1FSE A;  4EV0 A;  4I2O A;  5LGN A;  1W4M A;  2E7X A;  4ZYD A;  4M6Y A;  1KQ9 A;  4HBL A;  3IRR A;  5D6F A;  1XGS A;  1OYI A;  3QU6 A;  3BRO A;  5LLQ A;  1TNT A;  4MNU A;  5HVQ C;  1LQ1 A;  3K69 A;  2BEO A;  1MJ9 A;  2K02 A;  1RNL A;  1C0W A;  5D5V B;  3T5X A;  2QWW A;  1RIO H;  3D5L A;  2M5W A;  5E1Z B;  2XRN A;  3FM5 A;  4RGS A;  2E1C A;  1IN6 A;  3NRV A;  5D5W B;  3KE2 A;  3WTW C;  1STZ A;  1FPQ A;  3DP7 A;  2OZU A;  1EV7 A;  3ZP5 A;  3GFI A;  4ON0 A;  2DPD A;  5LRS A;  2VOP A;  1FOK A;  3L09 A;  4EGY A;  4WXC A;  4XRF A;  4OIR F;  1P92 A;  4Y15 A;  3LFK A;  3FMR A;  2DAO A;  1KGS A;  4LFU A;  3I64 A;  2P7V B;  1YTY A;  1BI2 A;  3B73 A;  2MD5 A;  1I1S A;  2K4B A;  3HRM A;  3R0A A;  2VON A;  4LJZ F;  3GZ6 A;  2VN2 A;  2X0L A;  3KP2 A;  1FT9 A;  4RB2 C;  4AWX B;  1CF7 B;  1HQC A;  4HF2 A;  1SMT A;  4I09 A;  3HOT A;  3F8F A;  1J75 A;  2PBI A;  5F6F A;  4U0Y A;  4EM2 A;  1WWX A;  2HDC A;  2FU4 A;  4HX8 A;  1IF1 A;  2FBH A;  4Y17 A;  4A6D A;  3FXQ A;  1JXS A;  1FNN A;  4EGZ A;  3FXR A;  2M87 A;  1FP1 D;  1HST A;  3V4G A;  2F2E A;  1R22 A;  2JPB A;  4RGU A;  2G7H A;  4D0P A;  2VOD A;  1YLF A;  1JHH A;  1FYM A;  1JE8 A;  2P5V A;  4F7Z A;  3RKW A;  3J80 K;  2BYV E;  4UV9 A;  3BPX A;  1U5T A;  1D3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...