1FEXA

Solution structure of myb-domain of human rap1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
GRIAFTDADDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords TRF2-INTERACTING TELOMERIC RAP1 PROTEIN
publication title NMR structure of the hRap1 Myb motif reveals a canonical three-helix bundle lacking the positive surface charge typical of Myb DNA-binding domains.
pubmed doi rcsb
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fexA00
4ABZA 2EBIA 3GTMJ 3IH3A 3G1MA 5JLWA 4AUXA 4C3IJ 1TWHJ 3FK7A 4IHXA 4RBOA 2FJ1A 1VI0A 1IDZA 5K7HA 2JWTA 3TP3A 5FKLA 2DA6A 3OSFA 1XG1A 2COBA 2XRLA 3BTJA 5GPAA 2CRGA 1U9OA 3ZQGA 3Q0WA 4C3HJ 2DA5A 2R5ZA 3W6VA 3ZQLA 3BR2A 1OFCX 3LSGA 1LFUP 1BW5A 2ID3A 5EEAA 5E3MA 3TP0A 2LFBA 3GTJJ 2XPWA 3BTIA 4FCYA 3HEFA 2X9DA 2LKXA 4Y7NJ 1GVDA 3NAUA 2JMWA 2O9LA 2WAQN 3BTCA 4B4CA 5E3LA 1HOMA 4QTRA 4DYRA 1I3QJ 3JRGA 3D1NI 5K7ZA 5FLVA 1FTTA 5C4JJ 2ELKA 5IYBJ 5EDNA 3G1OA 1I50J 2R7ZJ 1X2MA 4EEFG 5M5WJ 4XK4A 1G2HA 3S1NJ 2DTZA 2LVSA 2DMNA 1TWGJ 1WCMJ 2EZIA 2DMQA 2R5ZB 4D7NA 3BR0A 2FD5A 4LOCA 1OJLA 3Q3SA 2B63J 2HXOA 3RZDJ 5IYCJ 3MVPA 1VNDA 3HDDA 2EZLA 2DN0A 2NVYJ 1U78A 4CYCA 3DEWA 2GLOA 2LP0A 2XPUA 3DCFA 5DS9A 5J1UA 2ZB9A 3HB9A 3OSGA 3BR6A 2E19A 2JA8J 3S15J 5C4XJ 1JT0A 1IG7A 2JA7J 2JK3A 1RKTA 3JRBA 3JRAA 1D5YA 2AO9A 1ITYA 3WHCA 2AHQA 2ECCA 2VKEA 4DYCA 1P7JA 3HOVJ 3BR5A 1ZK8A 3S2HJ 4X6AJ 1S7EA 3CQZJ 2E2IJ 1FEXA 2MG4A 2MSYA 1ETVA 2CQQA 2HOSA 2E1OA 3S14J 4M3FA 1EF4A 1ZGWA 1OCTC 1APLC 3HGGA 4UUTA 2NS8A 1POGA 2DA4A 2PMZN 1IJWC 2G0EA 3HOWJ 3HOYJ 5EG0A 4IHYA 4A3JJ 1RETA 4BBSJ 5FLMJ 3HGYA 1IV6A 4M3GA 5EYRA 3HKZN 2Y0SN 4M3EA 3S2DJ 1UHSA 4CYCB 1UG2A 1AKHA 4D7MA 1YRNA 4MLOA 1MNMC 1ETQA 1JTXA 1WGXA 4FISA 2CUFA 4V2FA 3IH2A 1T56A 4B1RA 2XGCA 2OPTA 2LR8A 3IH4A 1GDTA 2EQRA 2DMPA 4V2GA 2O7OA 5EGOA 3BR1A 5FKKA 3JR9A 1A6IA 3ZOBA 1TWFJ 5IP9J 3JRIA 3GTLJ 3ZQIA 1ZKGA 3GTOJ 2X6OA 5EZHA 2XB0X 2XPVA 1XC5A 3TW7A 1BL0A 2N8GA 3JREA 1JJ8C 3Q0VA 3RKQA 1AU7A 2H1KA 4UUSA 3LNQA 2JN6A 2D5VA 3GTKJ 3QQAA 4A3IJ 4FE7A 5EZGA 1BW6A 1JUMA 2XGDA 3OIOA 4AYBN 5EG0B 1MBGA 9ANTA 4W97A 1MSEC 1TWAJ 2GM4A 1FIAA 1WPKA 2Y2ZA 5IYDJ 5IP7J 2M34A 4A3FJ 2DA2A 2HOTA 1AKHB 3BG3A 1YRNB 2P81A 4M6VA 1WI3A 5DTDA 4W1UA 1FIPA 3PO2J 4C2MJ 1Z77A 2DMUA 3S1MJ 2K9QA 5EGOB 1JKOC 2MGQA 1DU6A 4JP0A 2M8GX 1SFOJ 2HOAA 1ZTRA 4BY1J 2EH3A 3HOXJ 1E3OC 5E3NA 2ID6A 3H0GJ 1RESA 3K2AA 4DW6A 1H8AC 1W0TA 2LK2A 3A02A 4MIMA 2WV1A 5JLXA 3F0CA 1RKWA 4JX6A 4UUSB 3JRHA 1R9TJ 1TC3C 1UMQA 2KT0A 2HYJA 2HI3A 4MFEA 2X48A 4XIDA 3LSRA 4M3BA 4MO7A 5M3FJ 2DA7A 3K7AJ 5GP9A 1TWCJ 4XRSG 1FJLA 3M4OJ 3B6CA 2LTPA 1GV5A 2CJJA 5IPAA 1ZR4A 4A3BJ 3M3YJ 3CDLA 5FKNA 3LSPA 2R93J 1IUFA 3VPRA 1P7IA 4XICA 1VF9A 2QF7A 2XB5A 3SJMA 3I4MJ 2M0CA 2DMTA 1HDDC 2MW8A 1GV2A 3CCYA 1BA5A 3JRCA 5J1RA 1ENHA 5C44J 1ZQ3P 3E7LA 3BG5A 3MKLA 1WH5A 5HODA 2GBYA 2WB1N 1B8IA 2L7FP 5F08A 5F27A 2JJ7A 3G1LA 3O8HA 4A3DJ 2LLKA 3IV5A 2JA6J 2ME0A 1JKQC 2M2EA 1MSFC 2LY9A 2L9RA 2NS7A 1F43A 3O8GA 3I4NJ 2E2JJ 2IEKA 2Y31A 3S1QJ 4DZPA 3FK6A 4D5FA 5FJ8J 3C2BA 3A03A 1JT6A 3PM1A 1K61A 1MBHA 1K83J 2YUSA 3TW6A 2YU9J 1MBEA 4JYKA 5F1JA 2R0QC 4A3LJ 4AC0A 1W0UA 3MN2A 1GT0C 1QRYA 2Y9ZA 4FTHA 2XGEA 5F0FA 3CMYA 2Y9YA 1ETXA 4A3MJ 2XSDC 4XRMA 1B8IB 4JX4A 3FIWA 1JKRC 1VFCA 5FKOA 4FE4A 2L7MP 1MBJA 1PUFA 1CQTA 4BY7J 2L7ZA 4I6ZA 1HCRA 2DA1A 3GTPJ 2M9HA 4QSHA 1Q1VA 2VUMJ 1MBFA 2E2HJ 1HF0A 1OCPA 3QPSA 1ORKA 5F0HA 1B72A 2CUEA 2OF7A 3RQIA 5F0CA 3SDGA 1O4XA 1QVTA 1JTYA 4A93J 1LE8B 2IAIA 3QPLA 3S17J 5J1YA 3LSJA 4M3DA 1NK3P 3GTGJ 4JX5A 1F36A 1Y1VJ 3JRFA 2NVTJ 1LFBA 1DU0A 1MBKA 1H88C 4DZJA 2IBDA 4A69C 4J19A 3LOCA 2EZKA 2O8KA 3BR3A 3PO3J 3HM5A 4HNVA 4Y52J 1PUFB 1I6HJ 4GFBA 1A5JA 1JUPA 5FKMA 1MH3A 4A3GJ 2R5YA 1SANA 2CQXA 4G12A 2VI6A 1B72B 4I76A 4BBRJ 5K7FA 1JUSA 2I10A 5C3EJ 1GUUA 4IHVA 3BG9A 3L1PA 1T33A 4A3KJ 3A01A 3GTQJ 4IHWA 2NOGA 3OOUA 5M3MJ 1QPIA 2HXIA 1XS9A 1HLVA 3UKGA 3HOZJ 5IOZA 1HDPA 1QVUA 3FKIJ 2JA5J 5J3LA 1X2NA 5F04A 3SFIA 1ETOA 2HDDA 1ETKA 4XRSA 1U8BA 3S1RJ 1IGNA 3H3VK 3BTLA 2K9NA 3WHBA 1JKPC 2TCTA 2VPRA 1U9NA 4MFDA 4A3EJ 1Z0XA 4BKXA 2LD5A 5BNGA 4QIWN 4L5EA 2DA3A 3GBGA 2R5YB 3ZQCA 2NVQJ 4D5CA 4C3JJ 2NVXJ 2ECBA 2QCOA 4B3AA 5IP6A 5M5YJ 4IEJA 4BXXJ 2K40A 1H89C 3TEDA 1Y1WJ 1IRZA 3A01B 5IOYA 3NARA 3RZOJ 1WH7A 3BQYA 2HQ5A 3ZQFA 2H8RA 3B6AA 2DJNA 1X58A 4S0HB 3HBLA 1IDYA 1LE8A 3JRDA 3Q0UA 3FISA 2K9SA 1RR7A 4NDLA 2YS9A 2ME6A 1RPWA 3S16J 3ZQHA 1JGGA 2VKVA 2EZHA 3BT9A 5E3OA 1IC8A 5GPCA 4RDUA 5M5XJ 1MH4A 4X1EA 2W48A 2R92J 1NTCA 4A3CJ 1ETWA 2FQ4A 2RAEA 2TRTA 1NK2P 2KDZA 3HOUJ 2FX0A 4DYQA 1ZR2A 1FTZA 1JJ6C 1BJZA 1AHDP 5EF6A 2Y30A 1ETYA 3BQZA 2L0KA 2CU7A
chains in the Genus database with same CATH superfamily
4KUMA 1J5YA 3HPGA 2LYCA 2P7CB 3BP8A 1R00A 4AUXA 4HW0A 4C3IJ 3FMRA 3FK7A 3CCJI 2M3AA 2D1VA 3GLLA 4AWXB 1VI0A 1R5ID 2V4JC 4WF2A 3RYRA 5DYMA 3ZXSA 4RB3C 2R7UA 4OIOF 4OIPF 2DOEA 3TP3A 4EV0A 1JI8A 2DA6A 5IY5H 2FOKA 2XRLA 2X0LA 1RNLA 3FBIB 3CUQB 1MJBA 4YFKF 4C3HJ 2R5ZA 1ZLKA 2P8TA 3W6VA 4EM2A 4LJZF 4AM3A 2DOAA 2CV2A 1LFUP 3LSGA 5DD4A 4IZZA 3GCMA 1SMTA 2D1HA 1LNWA 5E3MA 4GYIA 2W82A 5CQEA 2XAJA 3VYSB 2ZMEB 2M4GA 2L4MA 3OYGA 2F5CA 2K3PA 2X9DA 1UB9A 4AIDA 1HW2A 4DGWB 5HVQC 4JK1X 3I71A 2PN6A 2W57A 3NAUA 4HLYA 2WAQN 1HOMA 2OCCH 2RDPA 1SVOA 4QTRA 3T8RA 4PSWA 4KYWA 4KN4X 2XAQA 4U88A 4O5VA 3ZMSA 2KIMA 4XOTA 1DP7P 2TDXA 2R7ZJ 2X1DA 4E7LA 2HFHA 2M0MA 1X3WB 2LSOA 4HV6A 3S1NJ 1V54H 3K4MA 2IVMA 3RYPA 3EDPA 4E7ZA 2DMNA 1J2XA 2JPCA 1EH6A 3OL3A 2EZIA 5LEJA 4HRIA 3VB2A 2F5DA 2ESNA 1BR2A 1NG7A 4G8XA 2FD5A 4LOCA 1OKRA 1IN8A 4HA8A 2QSFX 3ASNH 1I1SA 3RZDJ 2Q2EA 1OMIA 3KEYA 2OZ6A 2DLLA 2JQ7A 3B73A 3V7CA 4BEHA 5CVJA 5F6FA 1N75A 2DN0A 4CCMA 1U78A 1Y0UA 2HTSA 1HBXG 3S3MA 1WJAA 2LP0A 2OBPA 2IA1A 3CUQC 2M7AA 2JT1A 3S15J 1JT0A 1IXRC 4KT5C 3JRBA 1U6GA 3JRAA 2MFZA 3H1CA 3CCQI 5KCMA 3ZR8X 2R7FA 3AG4H 3DBLB 3OYLA 3HOVJ 2QQ8A 2DTRA 1QHGA 2BE5F 2QKMB 2VBWA 2ZMEC 3BR5A 2VJJA 3E97A 2OD5A 1FEXA 3GF2A 3CDHA 5ICCA 3C2GA 3CC4I 4H4KC 1OCRH 2P4WA 1AA7A 2QGUA 2CW0F 3S14J 1IXSB 5E1ZB 4UUTA 1UG0A 3J7AO 5AONA 5EG0A 4BNCA 4NC7A 5BPDA 4ENMA 1E17A 5HS8A 4L9JA 4BE0A 4A5NA 3QOPA 2FSWA 3ESWB 2R7VA 4D7MA 4ANJA 4MLOA 3VSKA 1IF1A 3ERMA 4L18B 1WGXA 4FISA 2CUFA 2CW8A 2X51A 3IH2A 2LR8A 2JSCA 2ZBKA 3I54A 2XRNA 1TQIA 3FZVA 3GTLJ 3JRIA 3WG7H 4ZYDA 4FT8A 1OYYA 1WKMA 4RAZA 1S7OA 3IHUA 3RTRA 2A6TA 2NAZA 2XB0X 3ML6A 4IQ4A 1YE9A 1BL0A 3JREA 3J81Z 2UV1A 3ZMZA 1WI9A 3OIPA 3NEUA 2JN6A 1KGSA 4GGGA 3N4MA 1TTYA 3OYDA 1XMAA 4ZDOA 1EA3A 4K2EA 4Q47A 1FOYA 3ABKH 2WWYA 1BW6A 1JUMA 3OIOA 1N78A 4TV7A 4ZC3A 1UFMA 2WY7Q 3JTHA 4YG2F 1VQ5I 1FIAA 1WPKA 2Y2ZA 3R61A 5CVUA 2STTA 4E7JA 1AKHB 1YRNB 1P2FA 2P81A 2DQRA 2MD5A 5JFRA 1VTNC 3CLQA 2E34A 3M7GA 4ESFA 3PO2J 1QZZA 1S6LA 3CESA 1M1EB 3M8JA 2ZNZA 4CA0A 2EV5A 3OV8A 2R7TA 2VT3A 1ZTRA 4RGUA 4MHGA 2EH3A 3BCAA 1B4AA 1E3OC 2CO5A 1DGWY 4F93B 4O6JA 1RESA 1H8AC 4IX7A 3ZMUA 3A02A 3FXMA 2IS2A 3DQVC 4U0VA 2WV1A 1MJAA 1K7AA 5D8KB 2R4GA 5B1AH 3BC8A 2KT0A 4MQ9F 4KIFA 2XF6A 2HI3A 1I5ZA 1R71A 3U1KA 3N97A 1TWCJ 3M4OJ 1FJLA 3B6CA 2CJJA 5IPAA 1ZG1A 3M3YJ 3E5XA 1IUFA 3K1PA 2H8WA 4ON0A 3JSOA 3AG3H 2XB5A 4XSXF 2L5QA 3TQNA 3BZKA 3FXOA 5D6EA 3Q9VA 1F5TA 3CCYA 2MLKA 5L3EA 1TNSA 3K4LA 3JRCA 1SD7A 5C44J 1FZPB 3E7LA 3BG5A 3MKLA 1OR7A 2CYYA 3J80K 5HODA 2GBYA 2IS6A 2L7FP 5F27A 2JJ7A 3CF2A 4J01A 4XKVA 4NHJA 2WAFA 1WJFA 4PUSA 4G7HF 2HYFA 5L3DA 3KP7A 3LSKA 2ME0A 4ESBA 1JKQC 4XLHA 1MSFC 3QU6A 3E0JB 1LKXA 4IF4A 1MDMA 3I4NJ 5KVRA 1OISA 1XCVA 4DZPA 2QLZA 3E1SA 3FK6A 5HOOA 3C2BA 3A03A 2LG4A 4PJJA 2L7KA 1K83J 2YU9J 1W4MA 5GAEJ 4L0YB 4A3LJ 4WCGA 1W0UA 3BPVA 3H3ZA 4P96A 2Y9YA 2HPMA 4FETA 1ETXA 2BV6A 4A3MJ 2X1EA 5L3GA 2OQGA 2XSDC 3EPZA 1B8IB 1OYIA 2CGPA 2A07F 3OL4A 3J7YJ 5K1YA 3IP4B 1VFCA 3I9V2 4L5IA 2HVRA 2L7MP 1X1PA 2V79A 1R23A 4CZZA 3JAMK 4LG0B 2DU9A 2AXTC 2EPFA 3JTGA 1HCRA 3ZRGA 5A2QK 4XLAA 3ZMVA 4QSHA 2W84A 1HKTA 4BHBA 1I27A 2QENA 3LWFA 1MBFA 2EILH 2GXBA 1HF0A 4ZYAA 3ABTA 1ZGAA 1BOAA 4E4HA 1B72A 3GWZA 4PGHA 3M1EA 2IGOA 2L9NA 1O4XA 2Z3YA 1X3ZB 2WA0A 5B66C 2K5CA 2V26A 3HOTA 5HNFA 3X2QH 3DKWA 2VKDA 4PZJA 4RB2C 3S17J 1BC8C 5LRSA 2L01A 1RUNA 3JRFA 1Y1VJ 3GTGJ 3LSIA 1J9IA 1LFBA 4RM2A 2EINH 1FY7A 3AG1H 1H9GA 2IGKA 5KAFC 4RLFA 4PK4A 3L2CA 2G7UA 4HNVA 2JUGA 5DD8A 4Y52J 2DT5A 1HC8A 1KA8A 4NNJA 1TW3A 1XSVA 1I6HJ 4GFBA 3WU2C 1A5JA 1JUPA 5E18F 2DDBA 4P9UA 1V3FA 1YITI 3L2VA 3OYNA 1F9NA 2BW3B 4BBRJ 5K7FA 2I10A 3M9AA 3DTEA 4IHVA 3IWFA 3L1PA 3DU5A 5HNHA 4A3KJ 4I09A 3GTQJ 4IHWA 2M5WA 3TDUC 1VQPI 3H5RA 1HQCA 3TO7A 2NOGA 3OOUA 2I8DA 4F3QA 1SEUA 2B7EA 4QPOA 5DUIA 3HOZJ 1QVUA 2CV0A 5J3LA 1X2NA 1TT5B 4L9NA 4KIGA 3S1RJ 3I55I 2K9NA 3WHBA 5J8CA 2VPRA 4OMZA 1RIOH 4UV9A 2ADUA 1U9NA 3LAJA 4MFDA 3MZHA 2V9PA 1G3YA 2PLYA 4QIWN 1J09A 5L3CA 3ZN1A 1XMKA 5LLQA 4P55A 3OWTA 4D5CA 1MGTA 4XN3A 4LG0A 1IN6A 4C3JJ 2NVXJ 4MTEA 5LRRA 2VT2A 2QCOA 1G3TA 3F3XA 1YI2I 1EV7A 1USSA 4BE1A 1Z9CA 4G9YA 1UCRA 4RAFA 3PJRA 3ABMH 3NARA 2MD0A 1K78A 1LFPA 2H8RA 3B6AA 4RA2A 1FBUA 2GAUA 2O3FA 4S0HB 2LOOA 1ODDA 2FRHA 4BHPA 1FP2A 3KYDB 2VONA 4HV5A 2YS9A 5DCFA 3K70C 2M7BA 5FFXA 3IC7A 3ZQHA 1ZG3A 4NC8A 1K79A 3CJNA 3W2WA 5K5QA 1IC8A 2VODA 2WADA 5GPCA 1Y8RB 4X1EA 2Z1DA 5CVIA 4RGSA 5HDKA 4AVPA 2H09A 3BJOA 2LY2A 2KDZA 3EYIA 4L0ZB 5FLXK 2W25A 1MMNA 2OCEA 3F8NA 2GOXB 1ZR2A 1PYVA 4DJAA 2MH2A 3P9IA 3L2WA 3TMOA 3QAHA 4A6EA 4LIUA 3FXLA 3KEQA 3HL2A 4HNUA 3TOAA 1XDUA 4UHTA 5DEQA 4XOPA 1FMVA 2L0KA 2XASA 3NQOA 1D1AA 4Q48A 2DQLA 4XKCA 1S7AA 2KIQA 1G3SA 1W7PB 5JHFA 2O5RA 1TWHJ 1W1WE 1PUEE 5DDGA 2OTLI 1J59A 2PBIA 4CCJA 2P6TA 3ULQB 5K7HA 2JWTA 5FFZA 2IJLA 1O57A 4OWRB 3W3CA 4HLXA 2YSRA 1XG1A 3ABUA 4XSZF 1XSDA 3HSEA 5GPAA 1G3WA 2CRGA 2JA2A 1U9OA 3RKXA 3NRVA 2L9SA 3F9KA 1ZG5A 3Q0WA 4UVCA 4PJ0C 3UR3C 4RS8A 4U0YA 4OIRF 4U87A 2DFIA 2ID3A 2VBYA 2PJPA 3T0YA 2HQRA 1JHHA 2XPWA 1MMAA 3BTIA 4HBLA 4FCYA 1ZHFA 4UY8I 5D5WB 1K6YA 1TZLA 1PVEA 3I58A 3HPHA 4U0WA 1GVDA 1HW5A 5BPIA 5ERIA 2JMWA 1DPUA 2NXNB 3BTCA 3WTSC 2RQPA 3D0SA 3DF8A 2VXDA 5ILSA 3HKZA 2Y0SA 1I3QJ 4KDPA 1V5FA 5K7ZA 2GA1A 3L2QA 3KEOA 4KT6A 2WV0A 3K4JA 3G1OA 1I50J 4XR6A 3W6JB 4AD9A 4EEFG 3U2RA 4KFCA 1R49A 5E17F 3QYBA 3IL2A 1O7LA 2DTZA 2LVSA 1UELB 1WCMJ 2DMQA 2E60A 1ULYA 3D5RC 1T95A 2R5ZB 2MH9A 2XV4S 3HSRA 3BR0A 1BI3A 2XF7A 1WJBA 3EUKL 2E5NA 3GVAA 3FMSA 2QYOA 2DK5A 1LDKB 4YRVA 1BR1A 1CF7A 1U2WA 4EGZA 1QO0D 3KPHA 1VNDA 2OV7A 5CLSA 4EM0B 3ELKA 4CYCA 1D0ZA 1DGRM 1T0FC 1Z21A 2LDUA 3C7JA 2ZFWA 5J1UA 2ZB9A 1DUXC 4AYBA 4OINF 3LA7A 4CSWA 2XIGA 2KLOA 3ZQQA 3BG6A 4G7ZF 4U7DA 2C6YA 2CS3A 1T8IA 2KDOA 3WHCA 2AHQA 2ECCA 2OJED 1PJRA 4BQNA 1FMWA 5LEKA 4DYCA 1MD0A 3S2HJ 1S7EA 1IW7F 1MZBA 1R58A 3CQZJ 1B6AA 2PMHA 5FRNA 2MSYA 4II2A 2R7RA 4M3FA 5B1BH 1ZGWA 3DTKA 4PJMA 2OAZA 2NS8A 1POGA 1ZRDA 1YJ9I 3CCSI 2GXGA 2Q2EB 4HX7A 2CFXA 2CFOA 2A61A 1P4XA 4JBAA 5CVRA 5FLMJ 3VYRB 5EYRA 3HKZN 3K4NA 1LDJA 2Y0SN 4M3EA 4BEHB 1EKEA 3DKYA 1UHSA 1UG2A 3CP8A 2CG4A 5GAHJ 2ZJQF 4UXNA 2ZXIA 4L9TA 1WHUA 1ETQA 2K9MA 3QWLA 4B1RA 2XGCA 2LF8A 1YS7A 4XKWA 3KYCB 4LMYA 3OOPA 2KIFA 2HGCA 3WTYC 2O7OA 3BR1A 3JR9A 2FEZA 3K4CA 1TWFJ 2CSOA 2GIZA 3MMYB 1ZKGA 5LD2C 1VQ8I 3KZZA 2DOFA 2L54A 1TLHB 3F6VA 4KJZA 2N8GA 4HNTA 1JJ8C 2O0YA 3RKQA 1AU7A 4BU2A 2RKHA 3GFIA 5HLIA 4XMYA 2IPQX 2Z2SB 3JCUC 3P5JA 3LNQA 3ERED 1G4DA 1D8KA 5H6RA 2KPMA 3BJ6A 5IT9K 4AYBN 5EG0B 3MEXA 2JRTA 2E5ZA 9ANTA 1MSEC 4XL9A 1TWAJ 4NC6A 1A6QA 5LHIA 3WTWC 5IP7J 4Y13A 2DA2A 1MW7A 2BXYA 2MABA 2QQAA 2V6EA 1ZLJA 2DFEA 3W2AA 3LSHA 2DT7B 4GRIA 1WI3A 3CJRB 3G3ZA 4W1UA 4JQFA 2EJRA 4N4NB 2HYGD 1KU7A 1JKOC 2ZCWA 5J47A 1OLTA 2W24A 4DBRA 2QQBA 3HG9A 2HOAA 2CW7A 2JTVA 1JE8A 1SMYF 5E3NA 2OU2A 3VEPA 2ID6A 3H0GJ 4YFXF 2K4BA 1XSXA 2BY1A 3FXQA 4MIMA 3CD6I 2ZJ2A 3GEZA 3F0CA 5JLXA 1LJ9A 3JRHA 2LBFA 1TC3C 4LK1F 1UMQA 3FHZA 3K10A 4MFEA 2X48A 4XIDA 3LSRA 4M3BA 5M3FJ 2ACJA 2DA7A 1BM9A 1OQYA 2LY1A 5GP9A 3RQ4A 4KNYA 3FX3A 2PEXA 2JSPA 2MBFA 3RKWA 1BR4A 3BOQA 3F72A 4XN0A 2F4OB 1GV5A 5LGUA 3CDLA 2P6SA 3RSNA 3LSPA 3VPRA 2B0LA 3QU3A 4PJNA 3SJMA 3I4MJ 3JSPA 2X4HA 3QPTA 2DMTA 2P0WA 3I5UA 2QBYA 2EFQA 3KFWX 4EGYA 2FUG2 1YW9A 2W85A 2VC1A 1ENHA 3H92A 3VYTB 3OS1A 3OYAA 5F08A 5ICFA 3G1LA 4A3DJ 1NH3A 4BYYA 1S3JA 3QYFA 3PNVA 2IGMA 2VJ4A 3GX4X 1FSHA 1VQ4I 3DLAA 2ETHA 1XMXA 1R4NB 1Z05A 2M2EA 3FKJA 5E8IA 2ZKZA 3CCRI 2I5UA 3FMQA 1OCZH 1IRGA 2L9RA 3O8GA 4I2OA 2R7SA 3C1DA 3AKZA 4PSXA 4D5FA 1S8NA 3A0HC 3PM1A 4A6DA 3AG2H 3MCZA 2IW5A 2RQQA 1K61A 2YUSA 4GYGA 1ERDA 3BG7A 5F1JA 3K2ZA 1T2KA 1ZAOA 3LA2A 3MN2A 2EV6A 3S3OA 1QRYA 4G6DA 2XGEA 4Y17A 5F0FA 1X1AA 1SD5A 2V9VA 3H35A 3QP6A 4RM3A 1ONVA 2LC2A 1IO2A 3PL8A 3LFKA 4IOCF 5HDNA 2HVQA 4HF1A 5EJCA 1G59A 3Q9SA 1KQ9A 3LSTA 1V5EA 1Y8QB 1BIAA 1SVLA 4BGDA 3L2RA 1PUFA 5E79C 3WODF 1X1BA 1CQTA 1WZ2A 1IUYA 3KETA 3GTPJ 4L9VA 2Z99A 1MDMB 2M9HA 3CDIA 2O6GE 4IHTA 3Q5FA 3C18A 2HEOA 3TGNA 3HTSB 5E8GA 2VUMJ 2L2OA 1OCPA 2A3SA 3OIQA 3ROUA 1USTA 1X1DA 3DEUA 4DNCA 3K70D 1PP7U 1FOKA 3K1NA 2RVCA 3OYJA 3TOBA 3P7NA 4FQGA 3KCCA 2ZO4A 1QVTA 1JTYA 1V55H 2BVMA 2IAIA 3QPLA 3WGIA 5J1YA 4DBQA 2FNAA 1NK3P 1FBQA 2BHYA 2YX7A 2NVTJ 4MEYF 4NB5A 4LLGF 3T8TA 4AVZA 1RZ4A 5FB2A 4RB1A 4DZJA 2IBDA 1VQ9I 5H20A 4A69C 4CCKA 3I59A 2EZKA 3BR3A 3QODA 3PO3J 3WTZA 2ZXHA 1BI2A 3UNGC 3AAFA 4CH7A 2HVSA 4QPQA 5ED4A 2RC4A 2A6EF 2DK8A 2XHKA 3T1BA 5K5RA 1XN7A 2FA5A 3T5XA 2KZGA 3SZTA 5JVGF 1KQ8A 2VC0A 3I56I 1FYLA 2IXSA 4E7SA 1MH3A 1GXPA 2R5YA 2F48A 2CQXA 1OR7C 1AOYA 3AL0B 4G12A 4HQMA 5ILVA 1B72B 4I76A 1JUSA 2HQNA 4WXDA 3TO9A 2XROA 1S72I 1HW1A 2Y69H 2QVOA 2PI0A 5GADJ 1XB4A 1YX3A 1MIJA 4I0BA 4UUVA 1A04A 4LB5A 1X3UA 1YIOA 5HLGA 1QPIA 4RGXA 1XS9A 2Q0OA 1QGPA 3UKGA 2EIMH 3FKIJ 2JA5J 1ZRCA 5F04A 3SFIA 1IAWA 1ETOA 1U8BA 3ISPA 4PDKA 4BAYA 3V8KA 1IGNA 3H3VK 3BTLA 1JKPC 5DUKA 3ZP5A 4A3EJ 5AIPA 2FBIA 4A12A 1KYWA 1REPC 2LMDA 3FM5A 3ZQCA 2NVQJ 1EH8A 4M6XA 4A0XA 3H9GA 2IT0A 3GYHX 3ASOH 4B3AA 5J8FA 4CDGA 4EJVA 2V7FA 3F8FA 5J4YA 3CMMA 4LLLA 2K40A 2P7VB 1UAAA 3G2BA 1Y1WJ 2R7QA 5IOYA 3RZOJ 3R60A 3TL4X 3WTTC 4XNFA 5LFAA 4BQAA 3PFYA 2JRMA 1X58A 1W7PD 3EETA 2KJCA 2HNHA 1IN5A 1WFXA 4HYEA 1XGMA 3EUHA 2ME6A 3H9JA 3I64A 3OMYA 1JGGA 1TQPA 1XCBA 2VKVA 3COAC 4WK8F 1O7FA 1XX5A 2EZHA 3K4KA 1J75A 4MGRA 3IKTA 1JXSA 2NVUB 2E1NA 5M5XJ 2G9WA 3CP2A 4X0GA 1ETWA 3VWBA 1QBJA 3WE3A 1YW8A 2IA0A 1Y39A 2FQ4A 3KLOA 4PFOA 2TRTA 3KYLA 5H6QA 1R1UA 1ZELA 3HOUJ 4M72A 1SFEA 1FTZA 3E6MA 3P9KA 3S93A 1DQUA 1YIJI 1AHDP 2K86A 3FBNB 4QWQA 1LDDA 2J5PA 1K6OA 5CJ9A 1K78B 1PP8F 2CQNA 1KU2A 4F55A 2CU7A 5KK1A 4ABZA 2EBIA 2P5LC 3N05A 3U21A 2KJBA 2HWVA 2MC4A 1SFUA 1SFKA 3DEEA 2VKHA 3ONQA 4RBOA 2FJ1A 2HKOA 3B02A 4LD5A 3ZMDA 1WJ5A 1IDZA 1B1BA 2Y48A 1RR8C 1U0JA 3RPUA 5FKLA 2M45A 1UHWA 1Z7LA 1R1VA 4PCQA 5D5VB 3BTJA 4C9YA 4UNOA 4JOMA 4I7HA 1JGSA 3ZQGA 2DA5A 4BDZA 1FT9A 3BR2A 4GCVA 3LMMA 1OFCX 1VQLI 3OYFA 1SFXA 2YX4A 4NQWA 4HF2A 1BW5A 4IRHA 3V42A 4YIFA 4CICA 3TP0A 2LFBA 3GTJJ 4E7IA 2PMUA 1O3TA 4IPAA 3LL7A 3HEFA 2DYSH 3CO7C 4ZZDA 1TQMA 2PX9A 1WVRA 2LKXA 1R1TA 4Y7NJ 3CTAA 3CC7I 4C30A 3E6CC 1YFHA 3QPHA 1KU3A 2Z16A 1Y6IA 2CH0A 3V8JA 3DV8A 3VYUB 3E6DA 3D1NI 5CVVA 1Z7UA 3K4BA 1TBXA 5IYBJ 5EDNA 1D5VA 4LFUA 2RNJA 1D0XA 4I99C 3J7AY 1Z3XA 4A2UA 1G2HA 3RDIA 3HUGA 2KZVA 2UUZA 3HRSA 2HZTA 2XGXA 2CMPA 2ZSIB 4D7NA 2V1UA 2NOJB 3BCBA 4G6QA 4BDYA 1W5TA 1OJLA 3Q3SA 3MAJA 2QA4I 3K0LA 2B63J 2HXOA 3VOEA 1FSEA 2STWA 3BLYA 2R7DA 3MVPA 2FOWA 4P5OA 2R7WA 4WX9A 3WU1B 3WTUC 4IOAF 2NVYJ 4BS9A 1L3LA 3DEWA 3FHNA 2M30A 2L3DA 4RAGA 5KAIC 4Q4ZF 2HQAA 2WBMA 3C2HA 4OOIA 3L9FA 1DDNA 1ON1A 1FPQA 2E19A 3BR6A 5C4XJ 4LG3A 3L00A 1IG7A 2JK3A 4EJTA 3CUOA 4CUGA 1LQ1A 1D5YA 5F1RA 4FHTA 2ESHA 1N77A 1ZK8A 2QUFA 3HHGA 1W36D 1QZYA 2E2IJ 3LSMA 1D1CA 1U5TA 1ETVA 2CQQA 2HOSA 1VZ0A 3REOA 1EF4A 1OCTC 1APLC 3HGGA 2K85A 1IJWC 2G0EA 1AWCA 3MZ8A 4BJ6C 4LLNA 4A3JJ 1CF7B 3S32A 1IV6A 4M3GA 3OS0A 2BGCA 1QU3A 2VBZA 2F6CA 4IL6C 5LBQA 4CYCB 3FDYA 4P9FA 1GLNA 3H9QA 4XRFA 5KHDA 1VQOI 2KRHA 1MJ9A 1JTXA 2H6CA 1YJNI 2F4IA 2XAGA 1MNDA 3IH4A 1LUJB 1GDTA 2FXAA 1X1CA 2EQRA 2DMPA 4V2GA 2Y0MA 5EGOA 4H0EA 5FKKA 4UVAA 1A6IA 4BE2A 3ZOBA 2EB7A 2EFNA 1KU9A 2DODA 2NS0A 2CV1A 4KISA 2F5FA 3E5QA 2GIVA 3GTOJ 2XC7A 2X6OA 4E7KA 1FNNA 3CC2I 1B59A 4KITB 1ZREA 2XPVA 1XC5A 2EWNA 1UJ8A 2E7XA 1STZA 3DP7A 3HTUA 1J7KA 1YOVB 1E3PA 4HF0A 4UUSA 1OCCH 1F1ZA 3SQNA 3SZGA 2D5VA 5TISC 3CCUI 4A3IJ 2Z9OA 4FE7A 1P4WA 5TJJA 2B9SA 5DV5A 2WB1A 4BJ5C 2XGDA 4E70A 1MBGA 3J80Z 1O3QA 3OYMA 2FMLA 4CXFA 2VN2A 1ZN2A 3HRUA 1LVAA 3EUAA 4A3FJ 2HOTA 2KISA 3F8MA 2X6WA 2Q1ZB 4M6VA 4F92B 2UXNA 3G4SI 1FYKA 4O3MA 4C2MJ 1Z77A 2DMUA 3S1MJ 3CCMI 1DU6A 2MGQA 4JP0A 5BS6A 2R7OA 2M8GX 1SFOJ 3RI4A 5LHHA 4G6TB 4BY1J 3HOXJ 1SAUA 1J0RA 1FOWA 1H9TA 2DAOA 2H27A 4MQVA 3F23A 2DXIA 1ACIA 3R0AA 4ZH4F 3WGGA 2LK2A 2RREA 3ABLH 3HOSA 3PIPF 4AIHA 1RKWA 3JW4A 2DDAA 2CQKA 5L3FA 2HYJA 2BBYA 3MKYB 4L5JA 3K9TA 5CKTA 1C0WA 2RV8A 5FROA 3DFGA 4XRSG 3OYCA 2BYVE 1SD4A 1I39A 3KP5A 4A3BJ 3SXYA 4ENNA 1Y0NA 1FP1D 1KQ0A 1P7IA 2XAFA 3CJQB 3JAMZ 4PFPA 3PIOF 1G8XA 2OTJI 2PG4A 3BPXA 5A2QZ 3BWGA 3SEZA 3J81K 1HDDC 2COMA 1GV2A 3GW2A 3IKVA 4HDUA 4N9IA 5KNLA 2FF4A 4Y15A 4EJWA 5CPRB 1A36A 2PJRA 3BJAA 4HG2A 1WH5A 3CCEI 2WB1N 1A35A 4YIRX 2E1MB 4IVNA 4ZDLA 3O8HA 2HU9A 5TRDA 2ZFUA 1VQMI 2V1XA 2LBFB 2JA6J 3OYEA 3HHHA 2ZXWH 4MNUA 3FXJA 2M8EA 1IZ1A 2JZYA 2LY9A 3VFZA 5E1XA 4S05A 4M9SA 2NS7A 1Z6RA 2EA2A 3DBRB 3MKZA 2NRAC 3VSLA 4S04A 1MMDA 3PSIA 4I02A 5FGMA 2FE3A 5JI6A 3VDXA 2L4AA 2XKOA 3S1QJ 2Q8KA 3HRMA 5D4SA 3IRRA 3IRQA 4A0YA 5HDGA 2LREA 1Z6TA 4HX8A 3TW6A 1MBEA 4HSRA 2R0QC 4AC0A 1H0MA 2QBYB 1GT0C 2RN7A 2VQLA 3GZ6A 4FTHA 4FX0A 2DI3A 3KZIC 4HZFA 2IA2A 4CHUA 5ILUA 2JUCA 4M9ZA 3MWMA 3DTIA 4XRMA 5GTIC 1T0FA 1X4OA 2CQ7A 4RMNA 3CCVI 1JKRC 3CO6C 5FKOA 4CGZA 1Y56A 1P92A 2A05A 3A4CA 4EJOA 2LRDA 2BOLA 1V4RA 4CCNA 3ECOA 1R4MB 2DA1A 1Q1VA 4R8HA 1TW2A 2E2HJ 3KE2A 2OQRA 5F0HA 1ZRFA 1D1BA 3U1DA 2E1MC 2CUEA 2OF7A 3DPTA 1FC3A 2MLGA 4LB6B 5DM7F 3RKYA 2R3SA 1RUOA 1R6RA 3CZ6A 4M3DA 3SFZA 3WTVC 1F36A 4ZTJA 1YS6A 3RPUD 3OY9A 3RIRA 1MBKA 1OCOH 5ICGA 1T39A 3I0TA 2WC2A 3KP4A 1TL8A 1KYZA 3LOCA 3OR1C 1P9QC 4HX4A 4KICA 4U7BA 3O2PE 1VQ6I 3DPUA 4HPQA 1FOXA 2D45A 1PUFB 2AQFA 2E7WA 3KP6A 3EQLF 2ZJPF 3PUFA 3IUOA 4BL0B 3SZPA 1U8RA 5IT3A 4A3GJ 2XAHA 3GZ5A 2M4KA 2AXLA 4YFNF 5LGTA 2O8XA 1YJWI 5CQGA 1IXCA 2VI6A 2JVHA 1ZYRF 1HSTA 1YO5C 3F6OA 3IWZA 4OIQF 4DIQA 1ON2A 4B44A 3A01A 4ZDPA 2W4SA 2BY2A 1V5GA 2K27A 2O03A 3OYIA 2FQ3A 3CCLI 5M3MJ 3R0JA 4CO8A 1W36C 5FLXZ 2HXIA 4UB8C 1HLVA 2VQHA 4A0ZA 3PFIA 3E6BA 2E1CA 5DCMA 5IOZA 5J4VA 4HQEA 3I59B 2VOOA 2HDDA 3H3UA 4IO9F 1ETKA 4XRSA 3MKWB 1U3EM 3E3VA 5EEGA 4B3XA 4UV8A 4KMUX 2TCTA 2VBXA 4EATA 4J00A 4BKXA 1NG6A 3QYEA 5BNGA 1VQNI 4L5EA 3GBGA 2R5YB 3QP5A 3MQ0A 2KIUA 3TKYA 2VE8A 4OAZA 1LB2A 2K3FA 5E1WA 4BXUA 3R6SA 4A5MA 1YTYA 4MEXF 2ECBA 3PSFA 1R22A 2QKLB 5IP6A 3HYIA 1QZEA 2DFHA 2VQGA 2IGNA 4IJAA 1D3YA 5M5YJ 4EM1A 3GO5A 5B3SH 3F21A 4B43A 1N25A 1H89C 3BZ6A 1IRZA 1YHQI 1WH7A 2VASA 1D0YA 3ZQFA 3DLLF 2NNNA 3RCOA 4DQ2A 4LK0F 2DJNA 4P1WA 2UXXA 3HBLA 1QNTA 3DBHB 1IDYA 3JRDA 3Q0UA 3FISA 4CZCA 2K9SA 1WJDA 4ITVA 4NDLA 1S9HA 4NBQA 5FD6A 3GUDA 5JVTA 1PDNC 3A0BC 5E3OA 3M8EA 4RDUA 1QPMA 1WWXA 2MC3A 1MH4A 3WE2A 2VB6A 3CUQA 1RI7A 1NTCA 2W48A 3U9GA 2KP6A 4A3CJ 2EK5A 1P6RA 4XQFA 2RAEA 2HTJA 2YU3A 2BVLA 1YQAA 2HKXA 3NWTA 1XGNA 2KHMA 3GFLA 4ENKA 1Z67A 2ZMEA 5EF6A 4D0PA 5L3BA 2X85A 2K02A 5J6XA 4EVIA 1VQ7I 4HOBA 3GTMJ 2LKPA 2P5KA 1Z1DA 5D5UB 2LH9A 3OS2A 3IH3A 2W00A 3W2VA 4ENJA 3G1MA 5TGTA 5JLWA 4KA4A 1A31A 3A2KA 3CMEI 4I98B 4OAYA 2QSHX 4IHXA 3BZCA 4B09A 3CJTB 3SDBA 3R4KA 1IRFA 2EV0A 4M74A 3PQJA 3V7RA 3V8LA 3H0DA 3OSFA 1I6XA 2COBA 3DKXA 3KZYA 2GZWA 5GTHC 1ZGJA 2BY0A 2VL8A 3K6GA 3ZQLA 2A68F 1S5LC 1BN5A 3ZGKA 4F7ZA 3WU0A 2IRFG 1KZHA 5EEAA 5GAGJ 3ECHA 3MFKA 2KL4A 4AIJA 1E3HA 1T38A 3AFHA 4KMFA 2HDWA 3DU6A 1FYMA 2IS4A 4I0AA 2RNGA 2A69F 3LFUA 1IN7A 5FO5A 4Q5SF 2PMZA 1R7JA 1LPQA 4BH9A 2O9LA 2RGVA 3E5UA 4B4CA 5D4RA 5E3LA 2PFBA 2XSJC 4DYRA 2K9LA 3JRGA 2X6XA 5FLVA 1FTTA 5C4JJ 4ESJA 1VQKI 2ELKA 1X2MA 5M5WJ 3H5NA 4XK4A 2V1NA 1F4KA 2Z33A 1HA8A 3L2UA 3KLNA 1TWGJ 3S8PA 1K4TA 4I01A 2W1OA 3WGHA 2ZXJA 2E36A 1FWZA 2WAEA 4PGGA 2K7LA 4NQWB 5IYCJ 3OYKA 3GZNB 4MTDA 4N0BA 3GXOA 3EUHC 2FBKA 2ZNYA 3HDDA 3S3NA 2EZLA 1R36A 5BMZA 2BEOA 1XTAA 3F8BA 2G7HA 1GVJA 1WJCA 2GLOA 4EQQA 2XPUA 3DCFA 3W6KB 5DS9A 2V6CA 2UZKA 3HB9A 2DYRH 5IT9Z 3OSGA 2PQ8A 2JA8J 2JA7J 1Z3YA 3HJEA 1RKTA 2CUJA 4XORA 3ZN0A 1W5SA 2AO9A 2K4JA 4XONA 1ITYA 2FU4A 3TBIA 1SC7A 2VKEA 4M73A 1P7JA 3HUGB 4B8XA 2YPRA 5BOXA 2V1DA 3HRTA 3P9CA 4D9JA 4X6AJ 2DBBA 2JVGA 3AL0C 2GA2A 2MG4A 1LEAA 3FWEA 4GDFA 3LQQA 2E1OA 2GXAA 4Y33A 2DA4A 4ZTFA 1E0EA 2PMZN 1MNEA 4OMYA 3HOWJ 3HOYJ 4IHYA 1RETA 4XM3A 4BBSJ 1EH7A 2H6BA 3HGYA 1MMGA 3WTXC 3HSFA 5LGNA 4RLQA 2A6HF 3S2DJ 4G94A 3L7WA 5DM6F 5D6FA 1AKHA 2KQRA 1YRNA 3ZPLA 2DPDA 5D8LB 1MNMC 1P4AA 4V2FA 4YIIA 3CF5F 1T56A 2WTEA 2OPTA 1Q1HA 4ASNA 2ELJA 4ETSA 2P5VA 4AU7A 3GLXA 1UZCA 3D5LA 1I3AA 4XBFA 2W7NA 5IP9J 2XKPA 4BJTA 2DT6A 3ZQIA 2MYSA 3L09A 1EJ9A 5EZHA 4R1HA 2X1CA 1W5CC 2EFWA 2EIJH 3TW7A 4NUBA 3IAS2 3F22A 3Q0VA 1U5TB 4B48A 2H1KA 1YX5A 1B9NA 4GXOA 4ZYEA 2E71A 3CMAI 3GTKJ 2NNYA 1T08B 3QQAA 3WG9A 4Z6YA 5EZGA 3V7SA 5FRMA 4ZZLA 1YLFA 1KONA 2XUBA 4UB6C 1IN4A 2HPIA 4W97A 1RC9A 2GM4A 3NWSA 4HEA2 4ZYHA 5IYDJ 2M34A 3M07A 4RAYA 2AQEA 3BG3A 3H36A 3F8CA 4QLCU 5HLHA 1ZH5A 2QQ9A 3K1MA 3OYHA 1QHHD 5DTDA 1BJAA 1FIPA 2BHZA 3PNTA 4HDVA 1HSJA 2K9QA 5EGOB 1MMSA 1WSUA 1D8JA 2J5OA 1S29A 3K2AA 4DW6A 4F52A 1XGOA 1W0TA 3D5SC 4EJUA 3HXLA 2CWEA 3EYYA 1XGSA 3FXKA 1K4SA 2F2EA 4JX6A 4UUSB 1R9TJ 5FD5A 2LF7A 1GHCA 4KIBA 4BACA 4G7OF 4MO7A 3IAM2 3K7AJ 4LITA 2H94A 1XDSA 2OZUA 3OYBA 2KFDA 3FXUA 2QM3A 1ZR4A 2LTPA 5F64A 4R79A 2DCEA 2WY8Q 2QZ8A 3CLOA 5FKNA 1YYVA 2R93J 2HOEA 4M71A 4XICA 1SD6A 3RPQA 2QSGX 1VF9A 1U5TC 2QF7A 1X4PA 4XLPF 2Y75A 2M0CA 4IKFA 1BIBA 4BUPA 2MW8A 3ZQ7A 2XDVA 1BA5A 1CGPA 2DJIA 2KRFA 4M9XA 3DXJF 1I1GA 5J1RA 4V19K 1ZQ3P 4C2UA 1Z91A 5D5XB 4RB0A 1T98A 3FF5A 1B8IA 2IS1A 5ICEA 4BQQA 2LLKA 1NHAA 1FBSA 4CCOA 1BC7C 2CUZA 3IV5A 2R7XA 2M87A 4YEJA 2H1LA 2VJIA 1GXQA 5H2FC 2VE9A 2XF5A 2HR3A 1F43A 2E2JJ 3GMEA 2IEKA 2Y31A 4LIVA 3SEQA 3I53A 3KX2A 5FJ8J 4XKBA 3LA3A 2F4MB 1JT6A 3LQRA 3PUBA 1MBHA 4JYKA 2Z5UA 3LAPA 1BOBA 4WWCA 2EFPA 3BROA 2HS5A 2Y9ZA 1MKMA 2DW4A 3CMYA 1QQIA 1SVMA 1QA6A 2PJRB 5JR3A 2DFFA 1DPRA 2FNPA 2HZDA 1UHMA 2GWRA 4JX4A 4LGWA 1IV8A 2D2WA 3FIWA 5E20A 4CYDA 2LKSA 2A5YB 1OPCA 3FM3A 4WXCA 2XVCA 4Y3OA 4ZJZA 4FE4A 1MBJA 2F5EA 4N9HA 2EFOA 4BY7J 2IP2A 1HKSA 2L7ZA 2VJ5A 4I6ZA 2L9VA 4CCLA 3M1CA 5B5EC 2VXZA 3GFJA 4GO1A 2OUMA 2ELHA 1SAXA 4M6YA 1HKQA 3MZYA 3FXRA 3KP2A 3QPSA 1ORKA 2XAUA 4FASD 2MA3A 2BW3A 3DWLE 5EEHA 1RRJA 1L0OC 4AIKA 3RQIA 5F0CA 2EIKH 3SDGA 1FX7A 3VODA 4A93J 3G73A 3I3LA 1LE8B 4RGRA 3LSJA 3H5AA 4F91B 4JX5A 3C3WA 1DU0A 1H88C 5K5OA 3KP3A 3O6BB 4J19A 2KRCA 3HZJA 1HXDA 2O8KA 2O61A 1FLIA 3HM5A 4OU0A 2VLAA 1YG2A 5BQTA 3I4PA 2KMUA 1WRJA 2ZC2A 5FKMA 1XD7A 2FBHA 2DO7A 4PJLA 1SANA 1B9MA 3OR2C 3SHFA 4BXFA 2VPLA 2V9KA 3ZMTA 1G6NA 5C3EJ 2M1BA 1GUUA 3GFMA 2DPUA 4C2TA 3BG9A 2ZJRF 4XLCA 3SYTA 1T33A 4YELA 1ZARA 1YW7A 4IQJA 4II3A 2UWMA 4IXAA 2FMYA 3BY6A 1R5GA 3TDZC 1TP4A 4FX4A 2OC6A 1HDPA 1TT0A 1T6SA 2BY3A 2HDCA 1WQ2A 4D1QA 4IHSA 3TO6A 1E2XA 2LNBA 5CYVA 1R5HA 2GQQA 4DOZA 4B47A 2VQCA 1OYWA 3K69A 4Z2YA 1Z0XA 2LD5A 4UVBA 1O3RA 4E6KG 3QRFF 3KIOA 1BBYA 1WJEA 2DA3A 3PNYA 2ZSHB 6PAXA 3DPLC 3PQKA 3ZCOA 4HSTA 2EA4A 4KN7X 1O3SA 3S2WA 2ISYA 3HC7A 4E7HA 2JPBA 2YR2A 4IEJA 4XLNF 3J7ZI 2ICWG 2VOPA 1BI1A 2BZTA 4BXXJ 3TEDA 3HIFA 3A1YA 3A01B 1TNTA 4EMSA 3BQYA 4XLFA 2HQ5A 5LHGA 1BI0A 4ZYGA 3BDDA 1JHFA 4N4OB 3V4GA 4BHCA 3G71I 4WXHA 1W7PA 5DCMB 1LE8A 1RR7A 2A5WA 3S16J 1RPWA 5AIQA 5HS9A 5JHUA 2GOMA 2ISZA 2QEXI 2WAQA 4Y4RA 1DP3A 5J40A 2BXZA 3BT9A 2KKOA 1IRXA 2R92J 2X6YA 1LVKA 2AS5F 4IRGA 2L02A 3RJPA 5HLTA 1NK2P 2E35A 1X19A 5HS7A 4IRIA 2NYXA 2FX0A 3M8FA 4DYQA 2VIXA 1JJ6C 1BJZA 3G6EI 4HAMA 2F5VA 3MD2A 2Y30A 3O3KA 1ETYA 4BQOA 1LEBA 2OA4A 3BQZA 3QOEA 2QWWA 4XLEA 1XPXA
chains in the Genus database with same CATH topology
4ABZA 2EBIA 3GTMJ 3IH3A 3G1MA 5JLWA 4AUXA 4C3IJ 1TWHJ 3FK7A 4IHXA 4RBOA 2FJ1A 1VI0A 1IDZA 5K7HA 2JWTA 3TP3A 5FKLA 2DA6A 3OSFA 1XG1A 2COBA 2XRLA 3BTJA 5GPAA 2CRGA 1U9OA 3ZQGA 3Q0WA 4C3HJ 2DA5A 2R5ZA 3W6VA 3ZQLA 3BR2A 1OFCX 3LSGA 1LFUP 1BW5A 2ID3A 5EEAA 5E3MA 3TP0A 2LFBA 3GTJJ 2XPWA 3BTIA 4FCYA 3HEFA 2X9DA 2LKXA 4Y7NJ 1GVDA 3NAUA 2JMWA 2O9LA 2WAQN 3BTCA 4B4CA 5E3LA 1HOMA 4QTRA 4DYRA 1I3QJ 3JRGA 3D1NI 5K7ZA 5FLVA 1FTTA 5C4JJ 2ELKA 5IYBJ 5EDNA 3G1OA 1I50J 2R7ZJ 1X2MA 4EEFG 5M5WJ 4XK4A 1G2HA 3S1NJ 2DTZA 2LVSA 2DMNA 1TWGJ 1WCMJ 2EZIA 2DMQA 2R5ZB 4D7NA 3BR0A 2FD5A 4LOCA 1OJLA 3Q3SA 2B63J 2HXOA 3RZDJ 5IYCJ 3MVPA 1VNDA 3HDDA 2EZLA 2DN0A 2NVYJ 1U78A 4CYCA 3DEWA 2GLOA 2LP0A 2XPUA 3DCFA 5DS9A 5J1UA 2ZB9A 3HB9A 3OSGA 3BR6A 2E19A 2JA8J 3S15J 5C4XJ 1JT0A 1IG7A 2JA7J 2JK3A 1RKTA 3JRBA 3JRAA 1D5YA 2AO9A 1ITYA 3WHCA 2AHQA 2ECCA 2VKEA 4DYCA 1P7JA 3HOVJ 3BR5A 1ZK8A 3S2HJ 4X6AJ 1S7EA 3CQZJ 2E2IJ 1FEXA 2MG4A 2MSYA 1ETVA 2CQQA 2HOSA 2E1OA 3S14J 4M3FA 1EF4A 1ZGWA 1OCTC 1APLC 3HGGA 4UUTA 2NS8A 1POGA 2DA4A 2PMZN 1IJWC 2G0EA 3HOWJ 3HOYJ 5EG0A 4IHYA 4A3JJ 1RETA 4BBSJ 5FLMJ 3HGYA 1IV6A 4M3GA 5EYRA 3HKZN 2Y0SN 4M3EA 3S2DJ 1UHSA 4CYCB 1UG2A 1AKHA 4D7MA 1YRNA 4MLOA 1MNMC 1ETQA 1JTXA 1WGXA 4FISA 2CUFA 4V2FA 3IH2A 1T56A 4B1RA 2XGCA 2OPTA 2LR8A 3IH4A 1GDTA 2EQRA 2DMPA 4V2GA 2O7OA 5EGOA 3BR1A 5FKKA 3JR9A 1A6IA 3ZOBA 1TWFJ 5IP9J 3JRIA 3GTLJ 3ZQIA 1ZKGA 3GTOJ 2X6OA 5EZHA 2XB0X 2XPVA 1XC5A 3TW7A 1BL0A 2N8GA 3JREA 1JJ8C 3Q0VA 3RKQA 1AU7A 2H1KA 4UUSA 3LNQA 2JN6A 2D5VA 3GTKJ 3QQAA 4A3IJ 4FE7A 5EZGA 1BW6A 1JUMA 2XGDA 3OIOA 4AYBN 5EG0B 1MBGA 9ANTA 4W97A 1MSEC 1TWAJ 2GM4A 1FIAA 1WPKA 2Y2ZA 5IYDJ 5IP7J 2M34A 4A3FJ 2DA2A 2HOTA 1AKHB 3BG3A 1YRNB 2P81A 4M6VA 1WI3A 5DTDA 4W1UA 1FIPA 3PO2J 4C2MJ 1Z77A 2DMUA 3S1MJ 2K9QA 5EGOB 1JKOC 2MGQA 1DU6A 4JP0A 2M8GX 1SFOJ 2HOAA 1ZTRA 4BY1J 2EH3A 3HOXJ 1E3OC 5E3NA 2ID6A 3H0GJ 1RESA 3K2AA 4DW6A 1H8AC 1W0TA 2LK2A 3A02A 4MIMA 2WV1A 5JLXA 3F0CA 1RKWA 4JX6A 4UUSB 3JRHA 1R9TJ 1TC3C 1UMQA 2KT0A 2HYJA 2HI3A 4MFEA 2X48A 4XIDA 3LSRA 4M3BA 4MO7A 5M3FJ 2DA7A 3K7AJ 5GP9A 1TWCJ 4XRSG 1FJLA 3M4OJ 3B6CA 2LTPA 1GV5A 2CJJA 5IPAA 1ZR4A 4A3BJ 3M3YJ 3CDLA 5FKNA 3LSPA 2R93J 1IUFA 3VPRA 1P7IA 4XICA 1VF9A 2QF7A 2XB5A 3SJMA 3I4MJ 2M0CA 2DMTA 1HDDC 2MW8A 1GV2A 3CCYA 1BA5A 3JRCA 5J1RA 1ENHA 5C44J 1ZQ3P 3E7LA 3BG5A 3MKLA 1WH5A 5HODA 2GBYA 2WB1N 1B8IA 2L7FP 5F08A 5F27A 2JJ7A 3G1LA 3O8HA 4A3DJ 2LLKA 3IV5A 2JA6J 2ME0A 1JKQC 2M2EA 1MSFC 2LY9A 2L9RA 2NS7A 1F43A 3O8GA 3I4NJ 2E2JJ 2IEKA 2Y31A 3S1QJ 4DZPA 3FK6A 4D5FA 5FJ8J 3C2BA 3A03A 1JT6A 3PM1A 1K61A 1MBHA 1K83J 2YUSA 3TW6A 2YU9J 1MBEA 4JYKA 5F1JA 2R0QC 4A3LJ 4AC0A 1W0UA 3MN2A 1GT0C 1QRYA 2Y9ZA 4FTHA 2XGEA 5F0FA 3CMYA 2Y9YA 1ETXA 4A3MJ 2XSDC 4XRMA 1B8IB 4JX4A 3FIWA 1JKRC 1VFCA 5FKOA 4FE4A 2L7MP 1MBJA 1PUFA 1CQTA 4BY7J 2L7ZA 4I6ZA 1HCRA 2DA1A 3GTPJ 2M9HA 4QSHA 1Q1VA 2VUMJ 1MBFA 2E2HJ 1HF0A 1OCPA 3QPSA 1ORKA 5F0HA 1B72A 2CUEA 2OF7A 3RQIA 5F0CA 3SDGA 1O4XA 1QVTA 1JTYA 4A93J 1LE8B 2IAIA 3QPLA 3S17J 5J1YA 3LSJA 4M3DA 1NK3P 3GTGJ 4JX5A 1F36A 1Y1VJ 3JRFA 2NVTJ 1LFBA 1DU0A 1MBKA 1H88C 4DZJA 2IBDA 4A69C 4J19A 3LOCA 2EZKA 2O8KA 3BR3A 3PO3J 3HM5A 4HNVA 4Y52J 1PUFB 1I6HJ 4GFBA 1A5JA 1JUPA 5FKMA 1MH3A 4A3GJ 2R5YA 1SANA 2CQXA 4G12A 2VI6A 1B72B 4I76A 4BBRJ 5K7FA 1JUSA 2I10A 5C3EJ 1GUUA 4IHVA 3BG9A 3L1PA 1T33A 4A3KJ 3A01A 3GTQJ 4IHWA 2NOGA 3OOUA 5M3MJ 1QPIA 2HXIA 1XS9A 1HLVA 3UKGA 3HOZJ 5IOZA 1HDPA 1QVUA 3FKIJ 2JA5J 5J3LA 1X2NA 5F04A 3SFIA 1ETOA 2HDDA 1ETKA 4XRSA 1U8BA 3S1RJ 1IGNA 3H3VK 3BTLA 2K9NA 3WHBA 1JKPC 2TCTA 2VPRA 1U9NA 4MFDA 4A3EJ 1Z0XA 4BKXA 2LD5A 5BNGA 4QIWN 4L5EA 2DA3A 3GBGA 2R5YB 3ZQCA 2NVQJ 4D5CA 4C3JJ 2NVXJ 2ECBA 2QCOA 4B3AA 5IP6A 5M5YJ 4IEJA 4BXXJ 2K40A 1H89C 3TEDA 1Y1WJ 1IRZA 3A01B 5IOYA 3NARA 3RZOJ 1WH7A 3BQYA 2HQ5A 3ZQFA 2H8RA 3B6AA 2DJNA 1X58A 4S0HB 3HBLA 1IDYA 1LE8A 3JRDA 3Q0UA 3FISA 2K9SA 1RR7A 4NDLA 2YS9A 2ME6A 1RPWA 3S16J 3ZQHA 1JGGA 2VKVA 2EZHA 3BT9A 5E3OA 1IC8A 5GPCA 4RDUA 5M5XJ 1MH4A 4X1EA 2W48A 2R92J 1NTCA 4A3CJ 1ETWA 2FQ4A 2RAEA 2TRTA 1NK2P 2KDZA 3HOUJ 2FX0A 4DYQA 1ZR2A 1FTZA 1JJ6C 1BJZA 1AHDP 5EF6A 2Y30A 1ETYA 3BQZA 2L0KA 2CU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ABZ A;  2EBI A;  3GTM J;  3IH3 A;  3G1M A;  5JLW A;  4AUX A;  4C3I J;  1TWH J;  3FK7 A;  4IHX A;  4RBO A;  2FJ1 A;  1VI0 A;  1IDZ A;  5K7H A;  2JWT A;  3TP3 A;  5FKL A;  2DA6 A;  3OSF A;  1XG1 A;  2COB A;  2XRL A;  3BTJ A;  5GPA A;  2CRG A;  1U9O A;  3ZQG A;  3Q0W A;  4C3H J;  2DA5 A;  2R5Z A;  3W6V A;  3ZQL A;  3BR2 A;  1OFC X;  3LSG A;  1LFU P;  1BW5 A;  2ID3 A;  5EEA A;  5E3M A;  3TP0 A;  2LFB A;  3GTJ J;  2XPW A;  3BTI A;  4FCY A;  3HEF A;  2X9D A;  2LKX A;  4Y7N J;  1GVD A;  3NAU A;  2JMW A;  2O9L A;  2WAQ N;  3BTC A;  4B4C A;  5E3L A;  1HOM A;  4QTR A;  4DYR A;  1I3Q J;  3JRG A;  3D1N I;  5K7Z A;  5FLV A;  1FTT A;  5C4J J;  2ELK A;  5IYB J;  5EDN A;  3G1O A;  1I50 J;  2R7Z J;  1X2M A;  4EEF G;  5M5W J;  4XK4 A;  1G2H A;  3S1N J;  2DTZ A;  2LVS A;  2DMN A;  1TWG J;  1WCM J;  2EZI A;  2DMQ A;  2R5Z B;  4D7N A;  3BR0 A;  2FD5 A;  4LOC A;  1OJL A;  3Q3S A;  2B63 J;  2HXO A;  3RZD J;  5IYC J;  3MVP A;  1VND A;  3HDD A;  2EZL A;  2DN0 A;  2NVY J;  1U78 A;  4CYC A;  3DEW A;  2GLO A;  2LP0 A;  2XPU A;  3DCF A;  5DS9 A;  5J1U A;  2ZB9 A;  3HB9 A;  3OSG A;  3BR6 A;  2E19 A;  2JA8 J;  3S15 J;  5C4X J;  1JT0 A;  1IG7 A;  2JA7 J;  2JK3 A;  1RKT A;  3JRB A;  3JRA A;  1D5Y A;  2AO9 A;  1ITY A;  3WHC A;  2AHQ A;  2ECC A;  2VKE A;  4DYC A;  1P7J A;  3HOV J;  3BR5 A;  1ZK8 A;  3S2H J;  4X6A J;  1S7E A;  3CQZ J;  2E2I J;  1FEX A;  2MG4 A;  2MSY A;  1ETV A;  2CQQ A;  2HOS A;  2E1O A;  3S14 J;  4M3F A;  1EF4 A;  1ZGW A;  1OCT C;  1APL C;  3HGG A;  4UUT A;  2NS8 A;  1POG A;  2DA4 A;  2PMZ N;  1IJW C;  2G0E A;  3HOW J;  3HOY J;  5EG0 A;  4IHY A;  4A3J J;  1RET A;  4BBS J;  5FLM J;  3HGY A;  1IV6 A;  4M3G A;  5EYR A;  3HKZ N;  2Y0S N;  4M3E A;  3S2D J;  1UHS A;  4CYC B;  1UG2 A;  1AKH A;  4D7M A;  1YRN A;  4MLO A;  1MNM C;  1ETQ A;  1JTX A;  1WGX A;  4FIS A;  2CUF A;  4V2F A;  3IH2 A;  1T56 A;  4B1R A;  2XGC A;  2OPT A;  2LR8 A;  3IH4 A;  1GDT A;  2EQR A;  2DMP A;  4V2G A;  2O7O A;  5EGO A;  3BR1 A;  5FKK A;  3JR9 A;  1A6I A;  3ZOB A;  1TWF J;  5IP9 J;  3JRI A;  3GTL J;  3ZQI A;  1ZKG A;  3GTO J;  2X6O A;  5EZH A;  2XB0 X;  2XPV A;  1XC5 A;  3TW7 A;  1BL0 A;  2N8G A;  3JRE A;  1JJ8 C;  3Q0V A;  3RKQ A;  1AU7 A;  2H1K A;  4UUS A;  3LNQ A;  2JN6 A;  2D5V A;  3GTK J;  3QQA A;  4A3I J;  4FE7 A;  5EZG A;  1BW6 A;  1JUM A;  2XGD A;  3OIO A;  4AYB N;  5EG0 B;  1MBG A;  9ANT A;  4W97 A;  1MSE C;  1TWA J;  2GM4 A;  1FIA A;  1WPK A;  2Y2Z A;  5IYD J;  5IP7 J;  2M34 A;  4A3F J;  2DA2 A;  2HOT A;  1AKH B;  3BG3 A;  1YRN B;  2P81 A;  4M6V A;  1WI3 A;  5DTD A;  4W1U A;  1FIP A;  3PO2 J;  4C2M J;  1Z77 A;  2DMU A;  3S1M J;  2K9Q A;  5EGO B;  1JKO C;  2MGQ A;  1DU6 A;  4JP0 A;  2M8G X;  1SFO J;  2HOA A;  1ZTR A;  4BY1 J;  2EH3 A;  3HOX J;  1E3O C;  5E3N A;  2ID6 A;  3H0G J;  1RES A;  3K2A A;  4DW6 A;  1H8A C;  1W0T A;  2LK2 A;  3A02 A;  4MIM A;  2WV1 A;  5JLX A;  3F0C A;  1RKW A;  4JX6 A;  4UUS B;  3JRH A;  1R9T J;  1TC3 C;  1UMQ A;  2KT0 A;  2HYJ A;  2HI3 A;  4MFE A;  2X48 A;  4XID A;  3LSR A;  4M3B A;  4MO7 A;  5M3F J;  2DA7 A;  3K7A J;  5GP9 A;  1TWC J;  4XRS G;  1FJL A;  3M4O J;  3B6C A;  2LTP A;  1GV5 A;  2CJJ A;  5IPA A;  1ZR4 A;  4A3B J;  3M3Y J;  3CDL A;  5FKN A;  3LSP A;  2R93 J;  1IUF A;  3VPR A;  1P7I A;  4XIC A;  1VF9 A;  2QF7 A;  2XB5 A;  3SJM A;  3I4M J;  2M0C A;  2DMT A;  1HDD C;  2MW8 A;  1GV2 A;  3CCY A;  1BA5 A;  3JRC A;  5J1R A;  1ENH A;  5C44 J;  1ZQ3 P;  3E7L A;  3BG5 A;  3MKL A;  1WH5 A;  5HOD A;  2GBY A;  2WB1 N;  1B8I A;  2L7F P;  5F08 A;  5F27 A;  2JJ7 A;  3G1L A;  3O8H A;  4A3D J;  2LLK A;  3IV5 A;  2JA6 J;  2ME0 A;  1JKQ C;  2M2E A;  1MSF C;  2LY9 A;  2L9R A;  2NS7 A;  1F43 A;  3O8G A;  3I4N J;  2E2J J;  2IEK A;  2Y31 A;  3S1Q J;  4DZP A;  3FK6 A;  4D5F A;  5FJ8 J;  3C2B A;  3A03 A;  1JT6 A;  3PM1 A;  1K61 A;  1MBH A;  1K83 J;  2YUS A;  3TW6 A;  2YU9 J;  1MBE A;  4JYK A;  5F1J A;  2R0Q C;  4A3L J;  4AC0 A;  1W0U A;  3MN2 A;  1GT0 C;  1QRY A;  2Y9Z A;  4FTH A;  2XGE A;  5F0F A;  3CMY A;  2Y9Y A;  1ETX A;  4A3M J;  2XSD C;  4XRM A;  1B8I B;  4JX4 A;  3FIW A;  1JKR C;  1VFC A;  5FKO A;  4FE4 A;  2L7M P;  1MBJ A;  1PUF A;  1CQT A;  4BY7 J;  2L7Z A;  4I6Z A;  1HCR A;  2DA1 A;  3GTP J;  2M9H A;  4QSH A;  1Q1V A;  2VUM J;  1MBF A;  2E2H J;  1HF0 A;  1OCP A;  3QPS A;  1ORK A;  5F0H A;  1B72 A;  2CUE A;  2OF7 A;  3RQI A;  5F0C A;  3SDG A;  1O4X A;  1QVT A;  1JTY A;  4A93 J;  1LE8 B;  2IAI A;  3QPL A;  3S17 J;  5J1Y A;  3LSJ A;  4M3D A;  1NK3 P;  3GTG J;  4JX5 A;  1F36 A;  1Y1V J;  3JRF A;  2NVT J;  1LFB A;  1DU0 A;  1MBK A;  1H88 C;  4DZJ A;  2IBD A;  4A69 C;  4J19 A;  3LOC A;  2EZK A;  2O8K A;  3BR3 A;  3PO3 J;  3HM5 A;  4HNV A;  4Y52 J;  1PUF B;  1I6H J;  4GFB A;  1A5J A;  1JUP A;  5FKM A;  1MH3 A;  4A3G J;  2R5Y A;  1SAN A;  2CQX A;  4G12 A;  2VI6 A;  1B72 B;  4I76 A;  4BBR J;  5K7F A;  1JUS A;  2I10 A;  5C3E J;  1GUU A;  4IHV A;  3BG9 A;  3L1P A;  1T33 A;  4A3K J;  3A01 A;  3GTQ J;  4IHW A;  2NOG A;  3OOU A;  5M3M J;  1QPI A;  2HXI A;  1XS9 A;  1HLV A;  3UKG A;  3HOZ J;  5IOZ A;  1HDP A;  1QVU A;  3FKI J;  2JA5 J;  5J3L A;  1X2N A;  5F04 A;  3SFI A;  1ETO A;  2HDD A;  1ETK A;  4XRS A;  1U8B A;  3S1R J;  1IGN A;  3H3V K;  3BTL A;  2K9N A;  3WHB A;  1JKP C;  2TCT A;  2VPR A;  1U9N A;  4MFD A;  4A3E J;  1Z0X A;  4BKX A;  2LD5 A;  5BNG A;  4QIW N;  4L5E A;  2DA3 A;  3GBG A;  2R5Y B;  3ZQC A;  2NVQ J;  4D5C A;  4C3J J;  2NVX J;  2ECB A;  2QCO A;  4B3A A;  5IP6 A;  5M5Y J;  4IEJ A;  4BXX J;  2K40 A;  1H89 C;  3TED A;  1Y1W J;  1IRZ A;  3A01 B;  5IOY A;  3NAR A;  3RZO J;  1WH7 A;  3BQY A;  2HQ5 A;  3ZQF A;  2H8R A;  3B6A A;  2DJN A;  1X58 A;  4S0H B;  3HBL A;  1IDY A;  1LE8 A;  3JRD A;  3Q0U A;  3FIS A;  2K9S A;  1RR7 A;  4NDL A;  2YS9 A;  2ME6 A;  1RPW A;  3S16 J;  3ZQH A;  1JGG A;  2VKV A;  2EZH A;  3BT9 A;  5E3O A;  1IC8 A;  5GPC A;  4RDU A;  5M5X J;  1MH4 A;  4X1E A;  2W48 A;  2R92 J;  1NTC A;  4A3C J;  1ETW A;  2FQ4 A;  2RAE A;  2TRT A;  1NK2 P;  2KDZ A;  3HOU J;  2FX0 A;  4DYQ A;  1ZR2 A;  1FTZ A;  1JJ6 C;  1BJZ A;  1AHD P;  5EF6 A;  2Y30 A;  1ETY A;  3BQZ A;  2L0K A;  2CU7 A; 
#chains in the Genus database with same CATH topology
 4KUM A;  1J5Y A;  3HPG A;  2LYC A;  2P7C B;  3BP8 A;  1R00 A;  4AUX A;  4HW0 A;  4C3I J;  3FMR A;  3FK7 A;  3CCJ I;  2M3A A;  2D1V A;  3GLL A;  4AWX B;  1VI0 A;  1R5I D;  2V4J C;  4WF2 A;  3RYR A;  5DYM A;  3ZXS A;  4RB3 C;  2R7U A;  4OIO F;  4OIP F;  2DOE A;  3TP3 A;  4EV0 A;  1JI8 A;  2DA6 A;  5IY5 H;  2FOK A;  2XRL A;  2X0L A;  1RNL A;  3FBI B;  3CUQ B;  1MJB A;  4YFK F;  4C3H J;  2R5Z A;  1ZLK A;  2P8T A;  3W6V A;  4EM2 A;  4LJZ F;  4AM3 A;  2DOA A;  2CV2 A;  1LFU P;  3LSG A;  5DD4 A;  4IZZ A;  3GCM A;  1SMT A;  2D1H A;  1LNW A;  5E3M A;  4GYI A;  2W82 A;  5CQE A;  2XAJ A;  3VYS B;  2ZME B;  2M4G A;  2L4M A;  3OYG A;  2F5C A;  2K3P A;  2X9D A;  1UB9 A;  4AID A;  1HW2 A;  4DGW B;  5HVQ C;  4JK1 X;  3I71 A;  2PN6 A;  2W57 A;  3NAU A;  4HLY A;  2WAQ N;  1HOM A;  2OCC H;  2RDP A;  1SVO A;  4QTR A;  3T8R A;  4PSW A;  4KYW A;  4KN4 X;  2XAQ A;  4U88 A;  4O5V A;  3ZMS A;  2KIM A;  4XOT A;  1DP7 P;  2TDX A;  2R7Z J;  2X1D A;  4E7L A;  2HFH A;  2M0M A;  1X3W B;  2LSO A;  4HV6 A;  3S1N J;  1V54 H;  3K4M A;  2IVM A;  3RYP A;  3EDP A;  4E7Z A;  2DMN A;  1J2X A;  2JPC A;  1EH6 A;  3OL3 A;  2EZI A;  5LEJ A;  4HRI A;  3VB2 A;  2F5D A;  2ESN A;  1BR2 A;  1NG7 A;  4G8X A;  2FD5 A;  4LOC A;  1OKR A;  1IN8 A;  4HA8 A;  2QSF X;  3ASN H;  1I1S A;  3RZD J;  2Q2E A;  1OMI A;  3KEY A;  2OZ6 A;  2DLL A;  2JQ7 A;  3B73 A;  3V7C A;  4BEH A;  5CVJ A;  5F6F A;  1N75 A;  2DN0 A;  4CCM A;  1U78 A;  1Y0U A;  2HTS A;  1HBX G;  3S3M A;  1WJA A;  2LP0 A;  2OBP A;  2IA1 A;  3CUQ C;  2M7A A;  2JT1 A;  3S15 J;  1JT0 A;  1IXR C;  4KT5 C;  3JRB A;  1U6G A;  3JRA A;  2MFZ A;  3H1C A;  3CCQ I;  5KCM A;  3ZR8 X;  2R7F A;  3AG4 H;  3DBL B;  3OYL A;  3HOV J;  2QQ8 A;  2DTR A;  1QHG A;  2BE5 F;  2QKM B;  2VBW A;  2ZME C;  3BR5 A;  2VJJ A;  3E97 A;  2OD5 A;  1FEX A;  3GF2 A;  3CDH A;  5ICC A;  3C2G A;  3CC4 I;  4H4K C;  1OCR H;  2P4W A;  1AA7 A;  2QGU A;  2CW0 F;  3S14 J;  1IXS B;  5E1Z B;  4UUT A;  1UG0 A;  3J7A O;  5AON A;  5EG0 A;  4BNC A;  4NC7 A;  5BPD A;  4ENM A;  1E17 A;  5HS8 A;  4L9J A;  4BE0 A;  4A5N A;  3QOP A;  2FSW A;  3ESW B;  2R7V A;  4D7M A;  4ANJ A;  4MLO A;  3VSK A;  1IF1 A;  3ERM A;  4L18 B;  1WGX A;  4FIS A;  2CUF A;  2CW8 A;  2X51 A;  3IH2 A;  2LR8 A;  2JSC A;  2ZBK A;  3I54 A;  2XRN A;  1TQI A;  3FZV A;  3GTL J;  3JRI A;  3WG7 H;  4ZYD A;  4FT8 A;  1OYY A;  1WKM A;  4RAZ A;  1S7O A;  3IHU A;  3RTR A;  2A6T A;  2NAZ A;  2XB0 X;  3ML6 A;  4IQ4 A;  1YE9 A;  1BL0 A;  3JRE A;  3J81 Z;  2UV1 A;  3ZMZ A;  1WI9 A;  3OIP A;  3NEU A;  2JN6 A;  1KGS A;  4GGG A;  3N4M A;  1TTY A;  3OYD A;  1XMA A;  4ZDO A;  1EA3 A;  4K2E A;  4Q47 A;  1FOY A;  3ABK H;  2WWY A;  1BW6 A;  1JUM A;  3OIO A;  1N78 A;  4TV7 A;  4ZC3 A;  1UFM A;  2WY7 Q;  3JTH A;  4YG2 F;  1VQ5 I;  1FIA A;  1WPK A;  2Y2Z A;  3R61 A;  5CVU A;  2STT A;  4E7J A;  1AKH B;  1YRN B;  1P2F A;  2P81 A;  2DQR A;  2MD5 A;  5JFR A;  1VTN C;  3CLQ A;  2E34 A;  3M7G A;  4ESF A;  3PO2 J;  1QZZ A;  1S6L A;  3CES A;  1M1E B;  3M8J A;  2ZNZ A;  4CA0 A;  2EV5 A;  3OV8 A;  2R7T A;  2VT3 A;  1ZTR A;  4RGU A;  4MHG A;  2EH3 A;  3BCA A;  1B4A A;  1E3O C;  2CO5 A;  1DGW Y;  4F93 B;  4O6J A;  1RES A;  1H8A C;  4IX7 A;  3ZMU A;  3A02 A;  3FXM A;  2IS2 A;  3DQV C;  4U0V A;  2WV1 A;  1MJA A;  1K7A A;  5D8K B;  2R4G A;  5B1A H;  3BC8 A;  2KT0 A;  4MQ9 F;  4KIF A;  2XF6 A;  2HI3 A;  1I5Z A;  1R71 A;  3U1K A;  3N97 A;  1TWC J;  3M4O J;  1FJL A;  3B6C A;  2CJJ A;  5IPA A;  1ZG1 A;  3M3Y J;  3E5X A;  1IUF A;  3K1P A;  2H8W A;  4ON0 A;  3JSO A;  3AG3 H;  2XB5 A;  4XSX F;  2L5Q A;  3TQN A;  3BZK A;  3FXO A;  5D6E A;  3Q9V A;  1F5T A;  3CCY A;  2MLK A;  5L3E A;  1TNS A;  3K4L A;  3JRC A;  1SD7 A;  5C44 J;  1FZP B;  3E7L A;  3BG5 A;  3MKL A;  1OR7 A;  2CYY A;  3J80 K;  5HOD A;  2GBY A;  2IS6 A;  2L7F P;  5F27 A;  2JJ7 A;  3CF2 A;  4J01 A;  4XKV A;  4NHJ A;  2WAF A;  1WJF A;  4PUS A;  4G7H F;  2HYF A;  5L3D A;  3KP7 A;  3LSK A;  2ME0 A;  4ESB A;  1JKQ C;  4XLH A;  1MSF C;  3QU6 A;  3E0J B;  1LKX A;  4IF4 A;  1MDM A;  3I4N J;  5KVR A;  1OIS A;  1XCV A;  4DZP A;  2QLZ A;  3E1S A;  3FK6 A;  5HOO A;  3C2B A;  3A03 A;  2LG4 A;  4PJJ A;  2L7K A;  1K83 J;  2YU9 J;  1W4M A;  5GAE J;  4L0Y B;  4A3L J;  4WCG A;  1W0U A;  3BPV A;  3H3Z A;  4P96 A;  2Y9Y A;  2HPM A;  4FET A;  1ETX A;  2BV6 A;  4A3M J;  2X1E A;  5L3G A;  2OQG A;  2XSD C;  3EPZ A;  1B8I B;  1OYI A;  2CGP A;  2A07 F;  3OL4 A;  3J7Y J;  5K1Y A;  3IP4 B;  1VFC A;  3I9V 2;  4L5I A;  2HVR A;  2L7M P;  1X1P A;  2V79 A;  1R23 A;  4CZZ A;  3JAM K;  4LG0 B;  2DU9 A;  2AXT C;  2EPF A;  3JTG A;  1HCR A;  3ZRG A;  5A2Q K;  4XLA A;  3ZMV A;  4QSH A;  2W84 A;  1HKT A;  4BHB A;  1I27 A;  2QEN A;  3LWF A;  1MBF A;  2EIL H;  2GXB A;  1HF0 A;  4ZYA A;  3ABT A;  1ZGA A;  1BOA A;  4E4H A;  1B72 A;  3GWZ A;  4PGH A;  3M1E A;  2IGO A;  2L9N A;  1O4X A;  2Z3Y A;  1X3Z B;  2WA0 A;  5B66 C;  2K5C A;  2V26 A;  3HOT A;  5HNF A;  3X2Q H;  3DKW A;  2VKD A;  4PZJ A;  4RB2 C;  3S17 J;  1BC8 C;  5LRS A;  2L01 A;  1RUN A;  3JRF A;  1Y1V J;  3GTG J;  3LSI A;  1J9I A;  1LFB A;  4RM2 A;  2EIN H;  1FY7 A;  3AG1 H;  1H9G A;  2IGK A;  5KAF C;  4RLF A;  4PK4 A;  3L2C A;  2G7U A;  4HNV A;  2JUG A;  5DD8 A;  4Y52 J;  2DT5 A;  1HC8 A;  1KA8 A;  4NNJ A;  1TW3 A;  1XSV A;  1I6H J;  4GFB A;  3WU2 C;  1A5J A;  1JUP A;  5E18 F;  2DDB A;  4P9U A;  1V3F A;  1YIT I;  3L2V A;  3OYN A;  1F9N A;  2BW3 B;  4BBR J;  5K7F A;  2I10 A;  3M9A A;  3DTE A;  4IHV A;  3IWF A;  3L1P A;  3DU5 A;  5HNH A;  4A3K J;  4I09 A;  3GTQ J;  4IHW A;  2M5W A;  3TDU C;  1VQP I;  3H5R A;  1HQC A;  3TO7 A;  2NOG A;  3OOU A;  2I8D A;  4F3Q A;  1SEU A;  2B7E A;  4QPO A;  5DUI A;  3HOZ J;  1QVU A;  2CV0 A;  5J3L A;  1X2N A;  1TT5 B;  4L9N A;  4KIG A;  3S1R J;  3I55 I;  2K9N A;  3WHB A;  5J8C A;  2VPR A;  4OMZ A;  1RIO H;  4UV9 A;  2ADU A;  1U9N A;  3LAJ A;  4MFD A;  3MZH A;  2V9P A;  1G3Y A;  2PLY A;  4QIW N;  1J09 A;  5L3C A;  3ZN1 A;  1XMK A;  5LLQ A;  4P55 A;  3OWT A;  4D5C A;  1MGT A;  4XN3 A;  4LG0 A;  1IN6 A;  4C3J J;  2NVX J;  4MTE A;  5LRR A;  2VT2 A;  2QCO A;  1G3T A;  3F3X A;  1YI2 I;  1EV7 A;  1USS A;  4BE1 A;  1Z9C A;  4G9Y A;  1UCR A;  4RAF A;  3PJR A;  3ABM H;  3NAR A;  2MD0 A;  1K78 A;  1LFP A;  2H8R A;  3B6A A;  4RA2 A;  1FBU A;  2GAU A;  2O3F A;  4S0H B;  2LOO A;  1ODD A;  2FRH A;  4BHP A;  1FP2 A;  3KYD B;  2VON A;  4HV5 A;  2YS9 A;  5DCF A;  3K70 C;  2M7B A;  5FFX A;  3IC7 A;  3ZQH A;  1ZG3 A;  4NC8 A;  1K79 A;  3CJN A;  3W2W A;  5K5Q A;  1IC8 A;  2VOD A;  2WAD A;  5GPC A;  1Y8R B;  4X1E A;  2Z1D A;  5CVI A;  4RGS A;  5HDK A;  4AVP A;  2H09 A;  3BJO A;  2LY2 A;  2KDZ A;  3EYI A;  4L0Z B;  5FLX K;  2W25 A;  1MMN A;  2OCE A;  3F8N A;  2GOX B;  1ZR2 A;  1PYV A;  4DJA A;  2MH2 A;  3P9I A;  3L2W A;  3TMO A;  3QAH A;  4A6E A;  4LIU A;  3FXL A;  3KEQ A;  3HL2 A;  4HNU A;  3TOA A;  1XDU A;  4UHT A;  5DEQ A;  4XOP A;  1FMV A;  2L0K A;  2XAS A;  3NQO A;  1D1A A;  4Q48 A;  2DQL A;  4XKC A;  1S7A A;  2KIQ A;  1G3S A;  1W7P B;  5JHF A;  2O5R A;  1TWH J;  1W1W E;  1PUE E;  5DDG A;  2OTL I;  1J59 A;  2PBI A;  4CCJ A;  2P6T A;  3ULQ B;  5K7H A;  2JWT A;  5FFZ A;  2IJL A;  1O57 A;  4OWR B;  3W3C A;  4HLX A;  2YSR A;  1XG1 A;  3ABU A;  4XSZ F;  1XSD A;  3HSE A;  5GPA A;  1G3W A;  2CRG A;  2JA2 A;  1U9O A;  3RKX A;  3NRV A;  2L9S A;  3F9K A;  1ZG5 A;  3Q0W A;  4UVC A;  4PJ0 C;  3UR3 C;  4RS8 A;  4U0Y A;  4OIR F;  4U87 A;  2DFI A;  2ID3 A;  2VBY A;  2PJP A;  3T0Y A;  2HQR A;  1JHH A;  2XPW A;  1MMA A;  3BTI A;  4HBL A;  4FCY A;  1ZHF A;  4UY8 I;  5D5W B;  1K6Y A;  1TZL A;  1PVE A;  3I58 A;  3HPH A;  4U0W A;  1GVD A;  1HW5 A;  5BPI A;  5ERI A;  2JMW A;  1DPU A;  2NXN B;  3BTC A;  3WTS C;  2RQP A;  3D0S A;  3DF8 A;  2VXD A;  5ILS A;  3HKZ A;  2Y0S A;  1I3Q J;  4KDP A;  1V5F A;  5K7Z A;  2GA1 A;  3L2Q A;  3KEO A;  4KT6 A;  2WV0 A;  3K4J A;  3G1O A;  1I50 J;  4XR6 A;  3W6J B;  4AD9 A;  4EEF G;  3U2R A;  4KFC A;  1R49 A;  5E17 F;  3QYB A;  3IL2 A;  1O7L A;  2DTZ A;  2LVS A;  1UEL B;  1WCM J;  2DMQ A;  2E60 A;  1ULY A;  3D5R C;  1T95 A;  2R5Z B;  2MH9 A;  2XV4 S;  3HSR A;  3BR0 A;  1BI3 A;  2XF7 A;  1WJB A;  3EUK L;  2E5N A;  3GVA A;  3FMS A;  2QYO A;  2DK5 A;  1LDK B;  4YRV A;  1BR1 A;  1CF7 A;  1U2W A;  4EGZ A;  1QO0 D;  3KPH A;  1VND A;  2OV7 A;  5CLS A;  4EM0 B;  3ELK A;  4CYC A;  1D0Z A;  1DGR M;  1T0F C;  1Z21 A;  2LDU A;  3C7J A;  2ZFW A;  5J1U A;  2ZB9 A;  1DUX C;  4AYB A;  4OIN F;  3LA7 A;  4CSW A;  2XIG A;  2KLO A;  3ZQQ A;  3BG6 A;  4G7Z F;  4U7D A;  2C6Y A;  2CS3 A;  1T8I A;  2KDO A;  3WHC A;  2AHQ A;  2ECC A;  2OJE D;  1PJR A;  4BQN A;  1FMW A;  5LEK A;  4DYC A;  1MD0 A;  3S2H J;  1S7E A;  1IW7 F;  1MZB A;  1R58 A;  3CQZ J;  1B6A A;  2PMH A;  5FRN A;  2MSY A;  4II2 A;  2R7R A;  4M3F A;  5B1B H;  1ZGW A;  3DTK A;  4PJM A;  2OAZ A;  2NS8 A;  1POG A;  1ZRD A;  1YJ9 I;  3CCS I;  2GXG A;  2Q2E B;  4HX7 A;  2CFX A;  2CFO A;  2A61 A;  1P4X A;  4JBA A;  5CVR A;  5FLM J;  3VYR B;  5EYR A;  3HKZ N;  3K4N A;  1LDJ A;  2Y0S N;  4M3E A;  4BEH B;  1EKE A;  3DKY A;  1UHS A;  1UG2 A;  3CP8 A;  2CG4 A;  5GAH J;  2ZJQ F;  4UXN A;  2ZXI A;  4L9T A;  1WHU A;  1ETQ A;  2K9M A;  3QWL A;  4B1R A;  2XGC A;  2LF8 A;  1YS7 A;  4XKW A;  3KYC B;  4LMY A;  3OOP A;  2KIF A;  2HGC A;  3WTY C;  2O7O A;  3BR1 A;  3JR9 A;  2FEZ A;  3K4C A;  1TWF J;  2CSO A;  2GIZ A;  3MMY B;  1ZKG A;  5LD2 C;  1VQ8 I;  3KZZ A;  2DOF A;  2L54 A;  1TLH B;  3F6V A;  4KJZ A;  2N8G A;  4HNT A;  1JJ8 C;  2O0Y A;  3RKQ A;  1AU7 A;  4BU2 A;  2RKH A;  3GFI A;  5HLI A;  4XMY A;  2IPQ X;  2Z2S B;  3JCU C;  3P5J A;  3LNQ A;  3ERE D;  1G4D A;  1D8K A;  5H6R A;  2KPM A;  3BJ6 A;  5IT9 K;  4AYB N;  5EG0 B;  3MEX A;  2JRT A;  2E5Z A;  9ANT A;  1MSE C;  4XL9 A;  1TWA J;  4NC6 A;  1A6Q A;  5LHI A;  3WTW C;  5IP7 J;  4Y13 A;  2DA2 A;  1MW7 A;  2BXY A;  2MAB A;  2QQA A;  2V6E A;  1ZLJ A;  2DFE A;  3W2A A;  3LSH A;  2DT7 B;  4GRI A;  1WI3 A;  3CJR B;  3G3Z A;  4W1U A;  4JQF A;  2EJR A;  4N4N B;  2HYG D;  1KU7 A;  1JKO C;  2ZCW A;  5J47 A;  1OLT A;  2W24 A;  4DBR A;  2QQB A;  3HG9 A;  2HOA A;  2CW7 A;  2JTV A;  1JE8 A;  1SMY F;  5E3N A;  2OU2 A;  3VEP A;  2ID6 A;  3H0G J;  4YFX F;  2K4B A;  1XSX A;  2BY1 A;  3FXQ A;  4MIM A;  3CD6 I;  2ZJ2 A;  3GEZ A;  3F0C A;  5JLX A;  1LJ9 A;  3JRH A;  2LBF A;  1TC3 C;  4LK1 F;  1UMQ A;  3FHZ A;  3K10 A;  4MFE A;  2X48 A;  4XID A;  3LSR A;  4M3B A;  5M3F J;  2ACJ A;  2DA7 A;  1BM9 A;  1OQY A;  2LY1 A;  5GP9 A;  3RQ4 A;  4KNY A;  3FX3 A;  2PEX A;  2JSP A;  2MBF A;  3RKW A;  1BR4 A;  3BOQ A;  3F72 A;  4XN0 A;  2F4O B;  1GV5 A;  5LGU A;  3CDL A;  2P6S A;  3RSN A;  3LSP A;  3VPR A;  2B0L A;  3QU3 A;  4PJN A;  3SJM A;  3I4M J;  3JSP A;  2X4H A;  3QPT A;  2DMT A;  2P0W A;  3I5U A;  2QBY A;  2EFQ A;  3KFW X;  4EGY A;  2FUG 2;  1YW9 A;  2W85 A;  2VC1 A;  1ENH A;  3H92 A;  3VYT B;  3OS1 A;  3OYA A;  5F08 A;  5ICF A;  3G1L A;  4A3D J;  1NH3 A;  4BYY A;  1S3J A;  3QYF A;  3PNV A;  2IGM A;  2VJ4 A;  3GX4 X;  1FSH A;  1VQ4 I;  3DLA A;  2ETH A;  1XMX A;  1R4N B;  1Z05 A;  2M2E A;  3FKJ A;  5E8I A;  2ZKZ A;  3CCR I;  2I5U A;  3FMQ A;  1OCZ H;  1IRG A;  2L9R A;  3O8G A;  4I2O A;  2R7S A;  3C1D A;  3AKZ A;  4PSX A;  4D5F A;  1S8N A;  3A0H C;  3PM1 A;  4A6D A;  3AG2 H;  3MCZ A;  2IW5 A;  2RQQ A;  1K61 A;  2YUS A;  4GYG A;  1ERD A;  3BG7 A;  5F1J A;  3K2Z A;  1T2K A;  1ZAO A;  3LA2 A;  3MN2 A;  2EV6 A;  3S3O A;  1QRY A;  4G6D A;  2XGE A;  4Y17 A;  5F0F A;  1X1A A;  1SD5 A;  2V9V A;  3H35 A;  3QP6 A;  4RM3 A;  1ONV A;  2LC2 A;  1IO2 A;  3PL8 A;  3LFK A;  4IOC F;  5HDN A;  2HVQ A;  4HF1 A;  5EJC A;  1G59 A;  3Q9S A;  1KQ9 A;  3LST A;  1V5E A;  1Y8Q B;  1BIA A;  1SVL A;  4BGD A;  3L2R A;  1PUF A;  5E79 C;  3WOD F;  1X1B A;  1CQT A;  1WZ2 A;  1IUY A;  3KET A;  3GTP J;  4L9V A;  2Z99 A;  1MDM B;  2M9H A;  3CDI A;  2O6G E;  4IHT A;  3Q5F A;  3C18 A;  2HEO A;  3TGN A;  3HTS B;  5E8G A;  2VUM J;  2L2O A;  1OCP A;  2A3S A;  3OIQ A;  3ROU A;  1UST A;  1X1D A;  3DEU A;  4DNC A;  3K70 D;  1PP7 U;  1FOK A;  3K1N A;  2RVC A;  3OYJ A;  3TOB A;  3P7N A;  4FQG A;  3KCC A;  2ZO4 A;  1QVT A;  1JTY A;  1V55 H;  2BVM A;  2IAI A;  3QPL A;  3WGI A;  5J1Y A;  4DBQ A;  2FNA A;  1NK3 P;  1FBQ A;  2BHY A;  2YX7 A;  2NVT J;  4MEY F;  4NB5 A;  4LLG F;  3T8T A;  4AVZ A;  1RZ4 A;  5FB2 A;  4RB1 A;  4DZJ A;  2IBD A;  1VQ9 I;  5H20 A;  4A69 C;  4CCK A;  3I59 A;  2EZK A;  3BR3 A;  3QOD A;  3PO3 J;  3WTZ A;  2ZXH A;  1BI2 A;  3UNG C;  3AAF A;  4CH7 A;  2HVS A;  4QPQ A;  5ED4 A;  2RC4 A;  2A6E F;  2DK8 A;  2XHK A;  3T1B A;  5K5R A;  1XN7 A;  2FA5 A;  3T5X A;  2KZG A;  3SZT A;  5JVG F;  1KQ8 A;  2VC0 A;  3I56 I;  1FYL A;  2IXS A;  4E7S A;  1MH3 A;  1GXP A;  2R5Y A;  2F48 A;  2CQX A;  1OR7 C;  1AOY A;  3AL0 B;  4G12 A;  4HQM A;  5ILV A;  1B72 B;  4I76 A;  1JUS A;  2HQN A;  4WXD A;  3TO9 A;  2XRO A;  1S72 I;  1HW1 A;  2Y69 H;  2QVO A;  2PI0 A;  5GAD J;  1XB4 A;  1YX3 A;  1MIJ A;  4I0B A;  4UUV A;  1A04 A;  4LB5 A;  1X3U A;  1YIO A;  5HLG A;  1QPI A;  4RGX A;  1XS9 A;  2Q0O A;  1QGP A;  3UKG A;  2EIM H;  3FKI J;  2JA5 J;  1ZRC A;  5F04 A;  3SFI A;  1IAW A;  1ETO A;  1U8B A;  3ISP A;  4PDK A;  4BAY A;  3V8K A;  1IGN A;  3H3V K;  3BTL A;  1JKP C;  5DUK A;  3ZP5 A;  4A3E J;  5AIP A;  2FBI A;  4A12 A;  1KYW A;  1REP C;  2LMD A;  3FM5 A;  3ZQC A;  2NVQ J;  1EH8 A;  4M6X A;  4A0X A;  3H9G A;  2IT0 A;  3GYH X;  3ASO H;  4B3A A;  5J8F A;  4CDG A;  4EJV A;  2V7F A;  3F8F A;  5J4Y A;  3CMM A;  4LLL A;  2K40 A;  2P7V B;  1UAA A;  3G2B A;  1Y1W J;  2R7Q A;  5IOY A;  3RZO J;  3R60 A;  3TL4 X;  3WTT C;  4XNF A;  5LFA A;  4BQA A;  3PFY A;  2JRM A;  1X58 A;  1W7P D;  3EET A;  2KJC A;  2HNH A;  1IN5 A;  1WFX A;  4HYE A;  1XGM A;  3EUH A;  2ME6 A;  3H9J A;  3I64 A;  3OMY A;  1JGG A;  1TQP A;  1XCB A;  2VKV A;  3COA C;  4WK8 F;  1O7F A;  1XX5 A;  2EZH A;  3K4K A;  1J75 A;  4MGR A;  3IKT A;  1JXS A;  2NVU B;  2E1N A;  5M5X J;  2G9W A;  3CP2 A;  4X0G A;  1ETW A;  3VWB A;  1QBJ A;  3WE3 A;  1YW8 A;  2IA0 A;  1Y39 A;  2FQ4 A;  3KLO A;  4PFO A;  2TRT A;  3KYL A;  5H6Q A;  1R1U A;  1ZEL A;  3HOU J;  4M72 A;  1SFE A;  1FTZ A;  3E6M A;  3P9K A;  3S93 A;  1DQU A;  1YIJ I;  1AHD P;  2K86 A;  3FBN B;  4QWQ A;  1LDD A;  2J5P A;  1K6O A;  5CJ9 A;  1K78 B;  1PP8 F;  2CQN A;  1KU2 A;  4F55 A;  2CU7 A;  5KK1 A;  4ABZ A;  2EBI A;  2P5L C;  3N05 A;  3U21 A;  2KJB A;  2HWV A;  2MC4 A;  1SFU A;  1SFK A;  3DEE A;  2VKH A;  3ONQ A;  4RBO A;  2FJ1 A;  2HKO A;  3B02 A;  4LD5 A;  3ZMD A;  1WJ5 A;  1IDZ A;  1B1B A;  2Y48 A;  1RR8 C;  1U0J A;  3RPU A;  5FKL A;  2M45 A;  1UHW A;  1Z7L A;  1R1V A;  4PCQ A;  5D5V B;  3BTJ A;  4C9Y A;  4UNO A;  4JOM A;  4I7H A;  1JGS A;  3ZQG A;  2DA5 A;  4BDZ A;  1FT9 A;  3BR2 A;  4GCV A;  3LMM A;  1OFC X;  1VQL I;  3OYF A;  1SFX A;  2YX4 A;  4NQW A;  4HF2 A;  1BW5 A;  4IRH A;  3V42 A;  4YIF A;  4CIC A;  3TP0 A;  2LFB A;  3GTJ J;  4E7I A;  2PMU A;  1O3T A;  4IPA A;  3LL7 A;  3HEF A;  2DYS H;  3CO7 C;  4ZZD A;  1TQM A;  2PX9 A;  1WVR A;  2LKX A;  1R1T A;  4Y7N J;  3CTA A;  3CC7 I;  4C30 A;  3E6C C;  1YFH A;  3QPH A;  1KU3 A;  2Z16 A;  1Y6I A;  2CH0 A;  3V8J A;  3DV8 A;  3VYU B;  3E6D A;  3D1N I;  5CVV A;  1Z7U A;  3K4B A;  1TBX A;  5IYB J;  5EDN A;  1D5V A;  4LFU A;  2RNJ A;  1D0X A;  4I99 C;  3J7A Y;  1Z3X A;  4A2U A;  1G2H A;  3RDI A;  3HUG A;  2KZV A;  2UUZ A;  3HRS A;  2HZT A;  2XGX A;  2CMP A;  2ZSI B;  4D7N A;  2V1U A;  2NOJ B;  3BCB A;  4G6Q A;  4BDY A;  1W5T A;  1OJL A;  3Q3S A;  3MAJ A;  2QA4 I;  3K0L A;  2B63 J;  2HXO A;  3VOE A;  1FSE A;  2STW A;  3BLY A;  2R7D A;  3MVP A;  2FOW A;  4P5O A;  2R7W A;  4WX9 A;  3WU1 B;  3WTU C;  4IOA F;  2NVY J;  4BS9 A;  1L3L A;  3DEW A;  3FHN A;  2M30 A;  2L3D A;  4RAG A;  5KAI C;  4Q4Z F;  2HQA A;  2WBM A;  3C2H A;  4OOI A;  3L9F A;  1DDN A;  1ON1 A;  1FPQ A;  2E19 A;  3BR6 A;  5C4X J;  4LG3 A;  3L00 A;  1IG7 A;  2JK3 A;  4EJT A;  3CUO A;  4CUG A;  1LQ1 A;  1D5Y A;  5F1R A;  4FHT A;  2ESH A;  1N77 A;  1ZK8 A;  2QUF A;  3HHG A;  1W36 D;  1QZY A;  2E2I J;  3LSM A;  1D1C A;  1U5T A;  1ETV A;  2CQQ A;  2HOS A;  1VZ0 A;  3REO A;  1EF4 A;  1OCT C;  1APL C;  3HGG A;  2K85 A;  1IJW C;  2G0E A;  1AWC A;  3MZ8 A;  4BJ6 C;  4LLN A;  4A3J J;  1CF7 B;  3S32 A;  1IV6 A;  4M3G A;  3OS0 A;  2BGC A;  1QU3 A;  2VBZ A;  2F6C A;  4IL6 C;  5LBQ A;  4CYC B;  3FDY A;  4P9F A;  1GLN A;  3H9Q A;  4XRF A;  5KHD A;  1VQO I;  2KRH A;  1MJ9 A;  1JTX A;  2H6C A;  1YJN I;  2F4I A;  2XAG A;  1MND A;  3IH4 A;  1LUJ B;  1GDT A;  2FXA A;  1X1C A;  2EQR A;  2DMP A;  4V2G A;  2Y0M A;  5EGO A;  4H0E A;  5FKK A;  4UVA A;  1A6I A;  4BE2 A;  3ZOB A;  2EB7 A;  2EFN A;  1KU9 A;  2DOD A;  2NS0 A;  2CV1 A;  4KIS A;  2F5F A;  3E5Q A;  2GIV A;  3GTO J;  2XC7 A;  2X6O A;  4E7K A;  1FNN A;  3CC2 I;  1B59 A;  4KIT B;  1ZRE A;  2XPV A;  1XC5 A;  2EWN A;  1UJ8 A;  2E7X A;  1STZ A;  3DP7 A;  3HTU A;  1J7K A;  1YOV B;  1E3P A;  4HF0 A;  4UUS A;  1OCC H;  1F1Z A;  3SQN A;  3SZG A;  2D5V A;  5TIS C;  3CCU I;  4A3I J;  2Z9O A;  4FE7 A;  1P4W A;  5TJJ A;  2B9S A;  5DV5 A;  2WB1 A;  4BJ5 C;  2XGD A;  4E70 A;  1MBG A;  3J80 Z;  1O3Q A;  3OYM A;  2FML A;  4CXF A;  2VN2 A;  1ZN2 A;  3HRU A;  1LVA A;  3EUA A;  4A3F J;  2HOT A;  2KIS A;  3F8M A;  2X6W A;  2Q1Z B;  4M6V A;  4F92 B;  2UXN A;  3G4S I;  1FYK A;  4O3M A;  4C2M J;  1Z77 A;  2DMU A;  3S1M J;  3CCM I;  1DU6 A;  2MGQ A;  4JP0 A;  5BS6 A;  2R7O A;  2M8G X;  1SFO J;  3RI4 A;  5LHH A;  4G6T B;  4BY1 J;  3HOX J;  1SAU A;  1J0R A;  1FOW A;  1H9T A;  2DAO A;  2H27 A;  4MQV A;  3F23 A;  2DXI A;  1ACI A;  3R0A A;  4ZH4 F;  3WGG A;  2LK2 A;  2RRE A;  3ABL H;  3HOS A;  3PIP F;  4AIH A;  1RKW A;  3JW4 A;  2DDA A;  2CQK A;  5L3F A;  2HYJ A;  2BBY A;  3MKY B;  4L5J A;  3K9T A;  5CKT A;  1C0W A;  2RV8 A;  5FRO A;  3DFG A;  4XRS G;  3OYC A;  2BYV E;  1SD4 A;  1I39 A;  3KP5 A;  4A3B J;  3SXY A;  4ENN A;  1Y0N A;  1FP1 D;  1KQ0 A;  1P7I A;  2XAF A;  3CJQ B;  3JAM Z;  4PFP A;  3PIO F;  1G8X A;  2OTJ I;  2PG4 A;  3BPX A;  5A2Q Z;  3BWG A;  3SEZ A;  3J81 K;  1HDD C;  2COM A;  1GV2 A;  3GW2 A;  3IKV A;  4HDU A;  4N9I A;  5KNL A;  2FF4 A;  4Y15 A;  4EJW A;  5CPR B;  1A36 A;  2PJR A;  3BJA A;  4HG2 A;  1WH5 A;  3CCE I;  2WB1 N;  1A35 A;  4YIR X;  2E1M B;  4IVN A;  4ZDL A;  3O8H A;  2HU9 A;  5TRD A;  2ZFU A;  1VQM I;  2V1X A;  2LBF B;  2JA6 J;  3OYE A;  3HHH A;  2ZXW H;  4MNU A;  3FXJ A;  2M8E A;  1IZ1 A;  2JZY A;  2LY9 A;  3VFZ A;  5E1X A;  4S05 A;  4M9S A;  2NS7 A;  1Z6R A;  2EA2 A;  3DBR B;  3MKZ A;  2NRA C;  3VSL A;  4S04 A;  1MMD A;  3PSI A;  4I02 A;  5FGM A;  2FE3 A;  5JI6 A;  3VDX A;  2L4A A;  2XKO A;  3S1Q J;  2Q8K A;  3HRM A;  5D4S A;  3IRR A;  3IRQ A;  4A0Y A;  5HDG A;  2LRE A;  1Z6T A;  4HX8 A;  3TW6 A;  1MBE A;  4HSR A;  2R0Q C;  4AC0 A;  1H0M A;  2QBY B;  1GT0 C;  2RN7 A;  2VQL A;  3GZ6 A;  4FTH A;  4FX0 A;  2DI3 A;  3KZI C;  4HZF A;  2IA2 A;  4CHU A;  5ILU A;  2JUC A;  4M9Z A;  3MWM A;  3DTI A;  4XRM A;  5GTI C;  1T0F A;  1X4O A;  2CQ7 A;  4RMN A;  3CCV I;  1JKR C;  3CO6 C;  5FKO A;  4CGZ A;  1Y56 A;  1P92 A;  2A05 A;  3A4C A;  4EJO A;  2LRD A;  2BOL A;  1V4R A;  4CCN A;  3ECO A;  1R4M B;  2DA1 A;  1Q1V A;  4R8H A;  1TW2 A;  2E2H J;  3KE2 A;  2OQR A;  5F0H A;  1ZRF A;  1D1B A;  3U1D A;  2E1M C;  2CUE A;  2OF7 A;  3DPT A;  1FC3 A;  2MLG A;  4LB6 B;  5DM7 F;  3RKY A;  2R3S A;  1RUO A;  1R6R A;  3CZ6 A;  4M3D A;  3SFZ A;  3WTV C;  1F36 A;  4ZTJ A;  1YS6 A;  3RPU D;  3OY9 A;  3RIR A;  1MBK A;  1OCO H;  5ICG A;  1T39 A;  3I0T A;  2WC2 A;  3KP4 A;  1TL8 A;  1KYZ A;  3LOC A;  3OR1 C;  1P9Q C;  4HX4 A;  4KIC A;  4U7B A;  3O2P E;  1VQ6 I;  3DPU A;  4HPQ A;  1FOX A;  2D45 A;  1PUF B;  2AQF A;  2E7W A;  3KP6 A;  3EQL F;  2ZJP F;  3PUF A;  3IUO A;  4BL0 B;  3SZP A;  1U8R A;  5IT3 A;  4A3G J;  2XAH A;  3GZ5 A;  2M4K A;  2AXL A;  4YFN F;  5LGT A;  2O8X A;  1YJW I;  5CQG A;  1IXC A;  2VI6 A;  2JVH A;  1ZYR F;  1HST A;  1YO5 C;  3F6O A;  3IWZ A;  4OIQ F;  4DIQ A;  1ON2 A;  4B44 A;  3A01 A;  4ZDP A;  2W4S A;  2BY2 A;  1V5G A;  2K27 A;  2O03 A;  3OYI A;  2FQ3 A;  3CCL I;  5M3M J;  3R0J A;  4CO8 A;  1W36 C;  5FLX Z;  2HXI A;  4UB8 C;  1HLV A;  2VQH A;  4A0Z A;  3PFI A;  3E6B A;  2E1C A;  5DCM A;  5IOZ A;  5J4V A;  4HQE A;  3I59 B;  2VOO A;  2HDD A;  3H3U A;  4IO9 F;  1ETK A;  4XRS A;  3MKW B;  1U3E M;  3E3V A;  5EEG A;  4B3X A;  4UV8 A;  4KMU X;  2TCT A;  2VBX A;  4EAT A;  4J00 A;  4BKX A;  1NG6 A;  3QYE A;  5BNG A;  1VQN I;  4L5E A;  3GBG A;  2R5Y B;  3QP5 A;  3MQ0 A;  2KIU A;  3TKY A;  2VE8 A;  4OAZ A;  1LB2 A;  2K3F A;  5E1W A;  4BXU A;  3R6S A;  4A5M A;  1YTY A;  4MEX F;  2ECB A;  3PSF A;  1R22 A;  2QKL B;  5IP6 A;  3HYI A;  1QZE A;  2DFH A;  2VQG A;  2IGN A;  4IJA A;  1D3Y A;  5M5Y J;  4EM1 A;  3GO5 A;  5B3S H;  3F21 A;  4B43 A;  1N25 A;  1H89 C;  3BZ6 A;  1IRZ A;  1YHQ I;  1WH7 A;  2VAS A;  1D0Y A;  3ZQF A;  3DLL F;  2NNN A;  3RCO A;  4DQ2 A;  4LK0 F;  2DJN A;  4P1W A;  2UXX A;  3HBL A;  1QNT A;  3DBH B;  1IDY A;  3JRD A;  3Q0U A;  3FIS A;  4CZC A;  2K9S A;  1WJD A;  4ITV A;  4NDL A;  1S9H A;  4NBQ A;  5FD6 A;  3GUD A;  5JVT A;  1PDN C;  3A0B C;  5E3O A;  3M8E A;  4RDU A;  1QPM A;  1WWX A;  2MC3 A;  1MH4 A;  3WE2 A;  2VB6 A;  3CUQ A;  1RI7 A;  1NTC A;  2W48 A;  3U9G A;  2KP6 A;  4A3C J;  2EK5 A;  1P6R A;  4XQF A;  2RAE A;  2HTJ A;  2YU3 A;  2BVL A;  1YQA A;  2HKX A;  3NWT A;  1XGN A;  2KHM A;  3GFL A;  4ENK A;  1Z67 A;  2ZME A;  5EF6 A;  4D0P A;  5L3B A;  2X85 A;  2K02 A;  5J6X A;  4EVI A;  1VQ7 I;  4HOB A;  3GTM J;  2LKP A;  2P5K A;  1Z1D A;  5D5U B;  2LH9 A;  3OS2 A;  3IH3 A;  2W00 A;  3W2V A;  4ENJ A;  3G1M A;  5TGT A;  5JLW A;  4KA4 A;  1A31 A;  3A2K A;  3CME I;  4I98 B;  4OAY A;  2QSH X;  4IHX A;  3BZC A;  4B09 A;  3CJT B;  3SDB A;  3R4K A;  1IRF A;  2EV0 A;  4M74 A;  3PQJ A;  3V7R A;  3V8L A;  3H0D A;  3OSF A;  1I6X A;  2COB A;  3DKX A;  3KZY A;  2GZW A;  5GTH C;  1ZGJ A;  2BY0 A;  2VL8 A;  3K6G A;  3ZQL A;  2A68 F;  1S5L C;  1BN5 A;  3ZGK A;  4F7Z A;  3WU0 A;  2IRF G;  1KZH A;  5EEA A;  5GAG J;  3ECH A;  3MFK A;  2KL4 A;  4AIJ A;  1E3H A;  1T38 A;  3AFH A;  4KMF A;  2HDW A;  3DU6 A;  1FYM A;  2IS4 A;  4I0A A;  2RNG A;  2A69 F;  3LFU A;  1IN7 A;  5FO5 A;  4Q5S F;  2PMZ A;  1R7J A;  1LPQ A;  4BH9 A;  2O9L A;  2RGV A;  3E5U A;  4B4C A;  5D4R A;  5E3L A;  2PFB A;  2XSJ C;  4DYR A;  2K9L A;  3JRG A;  2X6X A;  5FLV A;  1FTT A;  5C4J J;  4ESJ A;  1VQK I;  2ELK A;  1X2M A;  5M5W J;  3H5N A;  4XK4 A;  2V1N A;  1F4K A;  2Z33 A;  1HA8 A;  3L2U A;  3KLN A;  1TWG J;  3S8P A;  1K4T A;  4I01 A;  2W1O A;  3WGH A;  2ZXJ A;  2E36 A;  1FWZ A;  2WAE A;  4PGG A;  2K7L A;  4NQW B;  5IYC J;  3OYK A;  3GZN B;  4MTD A;  4N0B A;  3GXO A;  3EUH C;  2FBK A;  2ZNY A;  3HDD A;  3S3N A;  2EZL A;  1R36 A;  5BMZ A;  2BEO A;  1XTA A;  3F8B A;  2G7H A;  1GVJ A;  1WJC A;  2GLO A;  4EQQ A;  2XPU A;  3DCF A;  3W6K B;  5DS9 A;  2V6C A;  2UZK A;  3HB9 A;  2DYR H;  5IT9 Z;  3OSG A;  2PQ8 A;  2JA8 J;  2JA7 J;  1Z3Y A;  3HJE A;  1RKT A;  2CUJ A;  4XOR A;  3ZN0 A;  1W5S A;  2AO9 A;  2K4J A;  4XON A;  1ITY A;  2FU4 A;  3TBI A;  1SC7 A;  2VKE A;  4M73 A;  1P7J A;  3HUG B;  4B8X A;  2YPR A;  5BOX A;  2V1D A;  3HRT A;  3P9C A;  4D9J A;  4X6A J;  2DBB A;  2JVG A;  3AL0 C;  2GA2 A;  2MG4 A;  1LEA A;  3FWE A;  4GDF A;  3LQQ A;  2E1O A;  2GXA A;  4Y33 A;  2DA4 A;  4ZTF A;  1E0E A;  2PMZ N;  1MNE A;  4OMY A;  3HOW J;  3HOY J;  4IHY A;  1RET A;  4XM3 A;  4BBS J;  1EH7 A;  2H6B A;  3HGY A;  1MMG A;  3WTX C;  3HSF A;  5LGN A;  4RLQ A;  2A6H F;  3S2D J;  4G94 A;  3L7W A;  5DM6 F;  5D6F A;  1AKH A;  2KQR A;  1YRN A;  3ZPL A;  2DPD A;  5D8L B;  1MNM C;  1P4A A;  4V2F A;  4YII A;  3CF5 F;  1T56 A;  2WTE A;  2OPT A;  1Q1H A;  4ASN A;  2ELJ A;  4ETS A;  2P5V A;  4AU7 A;  3GLX A;  1UZC A;  3D5L A;  1I3A A;  4XBF A;  2W7N A;  5IP9 J;  2XKP A;  4BJT A;  2DT6 A;  3ZQI A;  2MYS A;  3L09 A;  1EJ9 A;  5EZH A;  4R1H A;  2X1C A;  1W5C C;  2EFW A;  2EIJ H;  3TW7 A;  4NUB A;  3IAS 2;  3F22 A;  3Q0V A;  1U5T B;  4B48 A;  2H1K A;  1YX5 A;  1B9N A;  4GXO A;  4ZYE A;  2E71 A;  3CMA I;  3GTK J;  2NNY A;  1T08 B;  3QQA A;  3WG9 A;  4Z6Y A;  5EZG A;  3V7S A;  5FRM A;  4ZZL A;  1YLF A;  1KON A;  2XUB A;  4UB6 C;  1IN4 A;  2HPI A;  4W97 A;  1RC9 A;  2GM4 A;  3NWS A;  4HEA 2;  4ZYH A;  5IYD J;  2M34 A;  3M07 A;  4RAY A;  2AQE A;  3BG3 A;  3H36 A;  3F8C A;  4QLC U;  5HLH A;  1ZH5 A;  2QQ9 A;  3K1M A;  3OYH A;  1QHH D;  5DTD A;  1BJA A;  1FIP A;  2BHZ A;  3PNT A;  4HDV A;  1HSJ A;  2K9Q A;  5EGO B;  1MMS A;  1WSU A;  1D8J A;  2J5O A;  1S29 A;  3K2A A;  4DW6 A;  4F52 A;  1XGO A;  1W0T A;  3D5S C;  4EJU A;  3HXL A;  2CWE A;  3EYY A;  1XGS A;  3FXK A;  1K4S A;  2F2E A;  4JX6 A;  4UUS B;  1R9T J;  5FD5 A;  2LF7 A;  1GHC A;  4KIB A;  4BAC A;  4G7O F;  4MO7 A;  3IAM 2;  3K7A J;  4LIT A;  2H94 A;  1XDS A;  2OZU A;  3OYB A;  2KFD A;  3FXU A;  2QM3 A;  1ZR4 A;  2LTP A;  5F64 A;  4R79 A;  2DCE A;  2WY8 Q;  2QZ8 A;  3CLO A;  5FKN A;  1YYV A;  2R93 J;  2HOE A;  4M71 A;  4XIC A;  1SD6 A;  3RPQ A;  2QSG X;  1VF9 A;  1U5T C;  2QF7 A;  1X4P A;  4XLP F;  2Y75 A;  2M0C A;  4IKF A;  1BIB A;  4BUP A;  2MW8 A;  3ZQ7 A;  2XDV A;  1BA5 A;  1CGP A;  2DJI A;  2KRF A;  4M9X A;  3DXJ F;  1I1G A;  5J1R A;  4V19 K;  1ZQ3 P;  4C2U A;  1Z91 A;  5D5X B;  4RB0 A;  1T98 A;  3FF5 A;  1B8I A;  2IS1 A;  5ICE A;  4BQQ A;  2LLK A;  1NHA A;  1FBS A;  4CCO A;  1BC7 C;  2CUZ A;  3IV5 A;  2R7X A;  2M87 A;  4YEJ A;  2H1L A;  2VJI A;  1GXQ A;  5H2F C;  2VE9 A;  2XF5 A;  2HR3 A;  1F43 A;  2E2J J;  3GME A;  2IEK A;  2Y31 A;  4LIV A;  3SEQ A;  3I53 A;  3KX2 A;  5FJ8 J;  4XKB A;  3LA3 A;  2F4M B;  1JT6 A;  3LQR A;  3PUB A;  1MBH A;  4JYK A;  2Z5U A;  3LAP A;  1BOB A;  4WWC A;  2EFP A;  3BRO A;  2HS5 A;  2Y9Z A;  1MKM A;  2DW4 A;  3CMY A;  1QQI A;  1SVM A;  1QA6 A;  2PJR B;  5JR3 A;  2DFF A;  1DPR A;  2FNP A;  2HZD A;  1UHM A;  2GWR A;  4JX4 A;  4LGW A;  1IV8 A;  2D2W A;  3FIW A;  5E20 A;  4CYD A;  2LKS A;  2A5Y B;  1OPC A;  3FM3 A;  4WXC A;  2XVC A;  4Y3O A;  4ZJZ A;  4FE4 A;  1MBJ A;  2F5E A;  4N9H A;  2EFO A;  4BY7 J;  2IP2 A;  1HKS A;  2L7Z A;  2VJ5 A;  4I6Z A;  2L9V A;  4CCL A;  3M1C A;  5B5E C;  2VXZ A;  3GFJ A;  4GO1 A;  2OUM A;  2ELH A;  1SAX A;  4M6Y A;  1HKQ A;  3MZY A;  3FXR A;  3KP2 A;  3QPS A;  1ORK A;  2XAU A;  4FAS D;  2MA3 A;  2BW3 A;  3DWL E;  5EEH A;  1RRJ A;  1L0O C;  4AIK A;  3RQI A;  5F0C A;  2EIK H;  3SDG A;  1FX7 A;  3VOD A;  4A93 J;  3G73 A;  3I3L A;  1LE8 B;  4RGR A;  3LSJ A;  3H5A A;  4F91 B;  4JX5 A;  3C3W A;  1DU0 A;  1H88 C;  5K5O A;  3KP3 A;  3O6B B;  4J19 A;  2KRC A;  3HZJ A;  1HXD A;  2O8K A;  2O61 A;  1FLI A;  3HM5 A;  4OU0 A;  2VLA A;  1YG2 A;  5BQT A;  3I4P A;  2KMU A;  1WRJ A;  2ZC2 A;  5FKM A;  1XD7 A;  2FBH A;  2DO7 A;  4PJL A;  1SAN A;  1B9M A;  3OR2 C;  3SHF A;  4BXF A;  2VPL A;  2V9K A;  3ZMT A;  1G6N A;  5C3E J;  2M1B A;  1GUU A;  3GFM A;  2DPU A;  4C2T A;  3BG9 A;  2ZJR F;  4XLC A;  3SYT A;  1T33 A;  4YEL A;  1ZAR A;  1YW7 A;  4IQJ A;  4II3 A;  2UWM A;  4IXA A;  2FMY A;  3BY6 A;  1R5G A;  3TDZ C;  1TP4 A;  4FX4 A;  2OC6 A;  1HDP A;  1TT0 A;  1T6S A;  2BY3 A;  2HDC A;  1WQ2 A;  4D1Q A;  4IHS A;  3TO6 A;  1E2X A;  2LNB A;  5CYV A;  1R5H A;  2GQQ A;  4DOZ A;  4B47 A;  2VQC A;  1OYW A;  3K69 A;  4Z2Y A;  1Z0X A;  2LD5 A;  4UVB A;  1O3R A;  4E6K G;  3QRF F;  3KIO A;  1BBY A;  1WJE A;  2DA3 A;  3PNY A;  2ZSH B;  6PAX A;  3DPL C;  3PQK A;  3ZCO A;  4HST A;  2EA4 A;  4KN7 X;  1O3S A;  3S2W A;  2ISY A;  3HC7 A;  4E7H A;  2JPB A;  2YR2 A;  4IEJ A;  4XLN F;  3J7Z I;  2ICW G;  2VOP A;  1BI1 A;  2BZT A;  4BXX J;  3TED A;  3HIF A;  3A1Y A;  3A01 B;  1TNT A;  4EMS A;  3BQY A;  4XLF A;  2HQ5 A;  5LHG A;  1BI0 A;  4ZYG A;  3BDD A;  1JHF A;  4N4O B;  3V4G A;  4BHC A;  3G71 I;  4WXH A;  1W7P A;  5DCM B;  1LE8 A;  1RR7 A;  2A5W A;  3S16 J;  1RPW A;  5AIQ A;  5HS9 A;  5JHU A;  2GOM A;  2ISZ A;  2QEX I;  2WAQ A;  4Y4R A;  1DP3 A;  5J40 A;  2BXZ A;  3BT9 A;  2KKO A;  1IRX A;  2R92 J;  2X6Y A;  1LVK A;  2AS5 F;  4IRG A;  2L02 A;  3RJP A;  5HLT A;  1NK2 P;  2E35 A;  1X19 A;  5HS7 A;  4IRI A;  2NYX A;  2FX0 A;  3M8F A;  4DYQ A;  2VIX A;  1JJ6 C;  1BJZ A;  3G6E I;  4HAM A;  2F5V A;  3MD2 A;  2Y30 A;  3O3K A;  1ETY A;  4BQO A;  1LEB A;  2OA4 A;  3BQZ A;  3QOE A;  2QWW A;  4XLE A;  1XPX A; 
#chains in the Genus database with same CATH homology
 4ABZ A;  2EBI A;  3GTM J;  3IH3 A;  3G1M A;  5JLW A;  4AUX A;  4C3I J;  1TWH J;  3FK7 A;  4IHX A;  4RBO A;  2FJ1 A;  1VI0 A;  1IDZ A;  5K7H A;  2JWT A;  3TP3 A;  5FKL A;  2DA6 A;  3OSF A;  1XG1 A;  2COB A;  2XRL A;  3BTJ A;  5GPA A;  2CRG A;  1U9O A;  3ZQG A;  3Q0W A;  4C3H J;  2DA5 A;  2R5Z A;  3W6V A;  3ZQL A;  3BR2 A;  1OFC X;  3LSG A;  1LFU P;  1BW5 A;  2ID3 A;  5EEA A;  5E3M A;  3TP0 A;  2LFB A;  3GTJ J;  2XPW A;  3BTI A;  4FCY A;  3HEF A;  2X9D A;  2LKX A;  4Y7N J;  1GVD A;  3NAU A;  2JMW A;  2O9L A;  2WAQ N;  3BTC A;  4B4C A;  5E3L A;  1HOM A;  4QTR A;  4DYR A;  1I3Q J;  3JRG A;  3D1N I;  5K7Z A;  5FLV A;  1FTT A;  5C4J J;  2ELK A;  5IYB J;  5EDN A;  3G1O A;  1I50 J;  2R7Z J;  1X2M A;  4EEF G;  5M5W J;  4XK4 A;  1G2H A;  3S1N J;  2DTZ A;  2LVS A;  2DMN A;  1TWG J;  1WCM J;  2EZI A;  2DMQ A;  2R5Z B;  4D7N A;  3BR0 A;  2FD5 A;  4LOC A;  1OJL A;  3Q3S A;  2B63 J;  2HXO A;  3RZD J;  5IYC J;  3MVP A;  1VND A;  3HDD A;  2EZL A;  2DN0 A;  2NVY J;  1U78 A;  4CYC A;  3DEW A;  2GLO A;  2LP0 A;  2XPU A;  3DCF A;  5DS9 A;  5J1U A;  2ZB9 A;  3HB9 A;  3OSG A;  3BR6 A;  2E19 A;  2JA8 J;  3S15 J;  5C4X J;  1JT0 A;  1IG7 A;  2JA7 J;  2JK3 A;  1RKT A;  3JRB A;  3JRA A;  1D5Y A;  2AO9 A;  1ITY A;  3WHC A;  2AHQ A;  2ECC A;  2VKE A;  4DYC A;  1P7J A;  3HOV J;  3BR5 A;  1ZK8 A;  3S2H J;  4X6A J;  1S7E A;  3CQZ J;  2E2I J;  1FEX A;  2MG4 A;  2MSY A;  1ETV A;  2CQQ A;  2HOS A;  2E1O A;  3S14 J;  4M3F A;  1EF4 A;  1ZGW A;  1OCT C;  1APL C;  3HGG A;  4UUT A;  2NS8 A;  1POG A;  2DA4 A;  2PMZ N;  1IJW C;  2G0E A;  3HOW J;  3HOY J;  5EG0 A;  4IHY A;  4A3J J;  1RET A;  4BBS J;  5FLM J;  3HGY A;  1IV6 A;  4M3G A;  5EYR A;  3HKZ N;  2Y0S N;  4M3E A;  3S2D J;  1UHS A;  4CYC B;  1UG2 A;  1AKH A;  4D7M A;  1YRN A;  4MLO A;  1MNM C;  1ETQ A;  1JTX A;  1WGX A;  4FIS A;  2CUF A;  4V2F A;  3IH2 A;  1T56 A;  4B1R A;  2XGC A;  2OPT A;  2LR8 A;  3IH4 A;  1GDT A;  2EQR A;  2DMP A;  4V2G A;  2O7O A;  5EGO A;  3BR1 A;  5FKK A;  3JR9 A;  1A6I A;  3ZOB A;  1TWF J;  5IP9 J;  3JRI A;  3GTL J;  3ZQI A;  1ZKG A;  3GTO J;  2X6O A;  5EZH A;  2XB0 X;  2XPV A;  1XC5 A;  3TW7 A;  1BL0 A;  2N8G A;  3JRE A;  1JJ8 C;  3Q0V A;  3RKQ A;  1AU7 A;  2H1K A;  4UUS A;  3LNQ A;  2JN6 A;  2D5V A;  3GTK J;  3QQA A;  4A3I J;  4FE7 A;  5EZG A;  1BW6 A;  1JUM A;  2XGD A;  3OIO A;  4AYB N;  5EG0 B;  1MBG A;  9ANT A;  4W97 A;  1MSE C;  1TWA J;  2GM4 A;  1FIA A;  1WPK A;  2Y2Z A;  5IYD J;  5IP7 J;  2M34 A;  4A3F J;  2DA2 A;  2HOT A;  1AKH B;  3BG3 A;  1YRN B;  2P81 A;  4M6V A;  1WI3 A;  5DTD A;  4W1U A;  1FIP A;  3PO2 J;  4C2M J;  1Z77 A;  2DMU A;  3S1M J;  2K9Q A;  5EGO B;  1JKO C;  2MGQ A;  1DU6 A;  4JP0 A;  2M8G X;  1SFO J;  2HOA A;  1ZTR A;  4BY1 J;  2EH3 A;  3HOX J;  1E3O C;  5E3N A;  2ID6 A;  3H0G J;  1RES A;  3K2A A;  4DW6 A;  1H8A C;  1W0T A;  2LK2 A;  3A02 A;  4MIM A;  2WV1 A;  5JLX A;  3F0C A;  1RKW A;  4JX6 A;  4UUS B;  3JRH A;  1R9T J;  1TC3 C;  1UMQ A;  2KT0 A;  2HYJ A;  2HI3 A;  4MFE A;  2X48 A;  4XID A;  3LSR A;  4M3B A;  4MO7 A;  5M3F J;  2DA7 A;  3K7A J;  5GP9 A;  1TWC J;  4XRS G;  1FJL A;  3M4O J;  3B6C A;  2LTP A;  1GV5 A;  2CJJ A;  5IPA A;  1ZR4 A;  4A3B J;  3M3Y J;  3CDL A;  5FKN A;  3LSP A;  2R93 J;  1IUF A;  3VPR A;  1P7I A;  4XIC A;  1VF9 A;  2QF7 A;  2XB5 A;  3SJM A;  3I4M J;  2M0C A;  2DMT A;  1HDD C;  2MW8 A;  1GV2 A;  3CCY A;  1BA5 A;  3JRC A;  5J1R A;  1ENH A;  5C44 J;  1ZQ3 P;  3E7L A;  3BG5 A;  3MKL A;  1WH5 A;  5HOD A;  2GBY A;  2WB1 N;  1B8I A;  2L7F P;  5F08 A;  5F27 A;  2JJ7 A;  3G1L A;  3O8H A;  4A3D J;  2LLK A;  3IV5 A;  2JA6 J;  2ME0 A;  1JKQ C;  2M2E A;  1MSF C;  2LY9 A;  2L9R A;  2NS7 A;  1F43 A;  3O8G A;  3I4N J;  2E2J J;  2IEK A;  2Y31 A;  3S1Q J;  4DZP A;  3FK6 A;  4D5F A;  5FJ8 J;  3C2B A;  3A03 A;  1JT6 A;  3PM1 A;  1K61 A;  1MBH A;  1K83 J;  2YUS A;  3TW6 A;  2YU9 J;  1MBE A;  4JYK A;  5F1J A;  2R0Q C;  4A3L J;  4AC0 A;  1W0U A;  3MN2 A;  1GT0 C;  1QRY A;  2Y9Z A;  4FTH A;  2XGE A;  5F0F A;  3CMY A;  2Y9Y A;  1ETX A;  4A3M J;  2XSD C;  4XRM A;  1B8I B;  4JX4 A;  3FIW A;  1JKR C;  1VFC A;  5FKO A;  4FE4 A;  2L7M P;  1MBJ A;  1PUF A;  1CQT A;  4BY7 J;  2L7Z A;  4I6Z A;  1HCR A;  2DA1 A;  3GTP J;  2M9H A;  4QSH A;  1Q1V A;  2VUM J;  1MBF A;  2E2H J;  1HF0 A;  1OCP A;  3QPS A;  1ORK A;  5F0H A;  1B72 A;  2CUE A;  2OF7 A;  3RQI A;  5F0C A;  3SDG A;  1O4X A;  1QVT A;  1JTY A;  4A93 J;  1LE8 B;  2IAI A;  3QPL A;  3S17 J;  5J1Y A;  3LSJ A;  4M3D A;  1NK3 P;  3GTG J;  4JX5 A;  1F36 A;  1Y1V J;  3JRF A;  2NVT J;  1LFB A;  1DU0 A;  1MBK A;  1H88 C;  4DZJ A;  2IBD A;  4A69 C;  4J19 A;  3LOC A;  2EZK A;  2O8K A;  3BR3 A;  3PO3 J;  3HM5 A;  4HNV A;  4Y52 J;  1PUF B;  1I6H J;  4GFB A;  1A5J A;  1JUP A;  5FKM A;  1MH3 A;  4A3G J;  2R5Y A;  1SAN A;  2CQX A;  4G12 A;  2VI6 A;  1B72 B;  4I76 A;  4BBR J;  5K7F A;  1JUS A;  2I10 A;  5C3E J;  1GUU A;  4IHV A;  3BG9 A;  3L1P A;  1T33 A;  4A3K J;  3A01 A;  3GTQ J;  4IHW A;  2NOG A;  3OOU A;  5M3M J;  1QPI A;  2HXI A;  1XS9 A;  1HLV A;  3UKG A;  3HOZ J;  5IOZ A;  1HDP A;  1QVU A;  3FKI J;  2JA5 J;  5J3L A;  1X2N A;  5F04 A;  3SFI A;  1ETO A;  2HDD A;  1ETK A;  4XRS A;  1U8B A;  3S1R J;  1IGN A;  3H3V K;  3BTL A;  2K9N A;  3WHB A;  1JKP C;  2TCT A;  2VPR A;  1U9N A;  4MFD A;  4A3E J;  1Z0X A;  4BKX A;  2LD5 A;  5BNG A;  4QIW N;  4L5E A;  2DA3 A;  3GBG A;  2R5Y B;  3ZQC A;  2NVQ J;  4D5C A;  4C3J J;  2NVX J;  2ECB A;  2QCO A;  4B3A A;  5IP6 A;  5M5Y J;  4IEJ A;  4BXX J;  2K40 A;  1H89 C;  3TED A;  1Y1W J;  1IRZ A;  3A01 B;  5IOY A;  3NAR A;  3RZO J;  1WH7 A;  3BQY A;  2HQ5 A;  3ZQF A;  2H8R A;  3B6A A;  2DJN A;  1X58 A;  4S0H B;  3HBL A;  1IDY A;  1LE8 A;  3JRD A;  3Q0U A;  3FIS A;  2K9S A;  1RR7 A;  4NDL A;  2YS9 A;  2ME6 A;  1RPW A;  3S16 J;  3ZQH A;  1JGG A;  2VKV A;  2EZH A;  3BT9 A;  5E3O A;  1IC8 A;  5GPC A;  4RDU A;  5M5X J;  1MH4 A;  4X1E A;  2W48 A;  2R92 J;  1NTC A;  4A3C J;  1ETW A;  2FQ4 A;  2RAE A;  2TRT A;  1NK2 P;  2KDZ A;  3HOU J;  2FX0 A;  4DYQ A;  1ZR2 A;  1FTZ A;  1JJ6 C;  1BJZ A;  1AHD P;  5EF6 A;  2Y30 A;  1ETY A;  3BQZ A;  2L0K A;  2CU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...