1FEXA

Solution structure of myb-domain of human rap1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
GRIAFTDADDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRF2-INTERACTING TELOMERIC RAP1 PROTEIN
publication title NMR structure of the hRap1 Myb motif reveals a canonical three-helix bundle lacking the positive surface charge typical of Myb DNA-binding domains.
pubmed doi rcsb
molecule tags Structural protein
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fexA00
1AHDP 3VPRA 1PUFA 2JMWA 2LFBA 3JRBA 3GTPJ 3RKQA 2HOAA 1PUFB 4A93J 5C44J 3LSPA 1ZKGA 1VNDA 3JRFA 9ANTA 2Y2ZA 1LFUP 2EZHA 2R0QC 5J1RA 3TW7A 3BR2A 3WHCA 2E1OA 4XICA 1ZK8A 3DCFA 1QRYA 3Q0UA 5FKMA 1BL0A 3ZOBA 1Q1VA 2TRTA 5JLXA 5F0CA 3MVPA 4GFBA 3S16J 1B72A 3JREA 2LD5A 1SFOJ 2ECBA 1B72B 3JRIA 1FJLA 2HOSA 3ZQFA 1CQTA 4A3DJ 1ORKA 2VPRA 4A69C 1ITYA 1TWFJ 3GTKJ 5FKLA 4A3CJ 3BG5A 1WPKA 4M3FA 1MH3A 2XB5A 2DA6A 4B3AA 4MFEA 1POGA 1K83J 3K2AA 3HOVJ 3GTMJ 2NS7A 4M6VA 3HOWJ 2K9NA 3I4MJ 2QCOA 1OCPA 1ENHA 1MSEC 4M3GA 3LSRA 3OSGA 2NVYJ 3HOYJ 5C4JJ 4FCYA 3OSFA 2JN6A 2HYJA 1TC3C 2IBDA 1LFBA 3H3VK 3S1NJ 2YU9J 3PM1A 5IYBJ 2DMUA 1RETA 2LP0A 2XPVA 4X6AJ 1I3QJ 3ZQIA 4XRSA 1SANA 1GT0C 3BQYA 1OCTC 2CRGA 3S17J 2B63J 3S1QJ 3HGYA 3A01A 3UKGA 5M5XJ 3BG3A 2ID6A 3TP0A 3A01B 3BR6A 1LE8A 4Y52J 1ETQA 1IC8A 5FLMJ 2EZKA 3HEFA 1LE8B 2GM4A 2R93J 1F36A 1JUMA 1IUFA 3CDLA 4L5EA 2E19A 1GDTA 1OFCX 1IRZA 1WCMJ 2HQ5A 4RBOA 4UUSA 5EYRA 1IDYA 2CUFA 2NS8A 4M3BA 5IYCJ 4UUSB 3NAUA 5DS9A 2L7FP 1JKQC 2N8GA 1GUUA 4BKXA 1X2NA 4A3GJ 1IJWC 1APLC 4DZPA 3FK7A 4JYKA 1QVTA 1JT0A 1JGGA 2R7ZJ 4X1EA 3HB9A 2XGDA 1DU0A 2WV1A 5EGOB 5FLVA 2NVTJ 1A6IA 2VKEA 3QPLA 1Z77A 2YUSA 4BY1J 2KDZA 1JJ6C 5GPCA 1NK3P 2D5VA 4DYRA 2Y30A 1ZQ3P 3I4NJ 4AUXA 2K40A 2M0CA 2L0KA 5F0HA 2HI3A 2K9QA 2DMNA 3NARA 2EBIA 1TWAJ 1X58A 5HODA 1TWGJ 1GV2A 2LTPA 2ZB9A 3CMYA 1H89C 2JA5J 4A3JJ 1XS9A 2DTZA 1UHSA 3S1RJ 3M4OJ 2LVSA 2HDDA 2HXOA 4V2FA 3A02A 4A3IJ 1WGXA 4RDUA 2DA4A 1S7EA 1JKOC 5K7HA 1ETXA 3L1PA 1ZTRA 5GPAA 1MBHA 4D5FA 1Y1WJ 3HOUJ 5K7ZA 1ETVA 2XPWA 2YS9A 4M3DA 3O8HA 4NDLA 1O4XA 3BR0A 3RZDJ 1VFCA 1FIAA 2CU7A 1MSFC 4MIMA 3BT9A 2NVXJ 1GVDA 3BR5A 1QPIA 5J1UA 1VI0A 1OJLA 2ELKA 4D5CA 1MH4A 2JK3A 2ME0A 2LLKA 4A3MJ 5EDNA 4C3IJ 5C4XJ 3GTGJ 2DA2A 1EF4A 5IYDJ 4S0HB 3BG9A 5IP9J 2MG4A 2MSYA 2XRLA 3PO3J 1JUSA 5F0FA 2JWTA 2ID3A 1ZR4A 4D7MA 5FJ8J 5J3LA 4BBRJ 5IPAA 2HXIA 5E3OA 3D1NI 2E2IJ 3BTCA 1U9OA 4A3BJ 1WH7A 3ZQHA 3LSJA 1HOMA 2NOGA 1Z0XA 3GTJJ 3S14J 2O7OA 4W1UA 2LR8A 1G2HA 1JJ8C 1W0UA 5F27A 1YRNA 2JA6J 4UUTA 1YRNB 2VUMJ 1WH5A 1XC5A 1RPWA 5EG0A 4C3HJ 1JUPA 1GV5A 5EG0B 2DMQA 2M2EA 1P7IA 3C2BA 3B6CA 3Q3SA 2RAEA 1MBJA 3RZOJ 4XIDA 2LK2A 2PMZN 3MKLA 1QVUA 2IAIA 5C3EJ 3E7LA 3QPSA 5M5YJ 5EZHA 4A3FJ 2K9SA 3JRHA 3IH4A 3A03A 3JR9A 5M3FJ 2M34A 2CQQA 5M5WJ 3HGGA 1B8IA 3S15J 4BY7J 2GBYA 4FE7A 4HNVA 3CQZJ 1U8BA 1HCRA 1MBKA 5JLWA 1B8IB 4C3JJ 1IGNA 2AHQA 2WB1N 1MNMC 2MGQA 5IOYA 1TWCJ 2R5YA 1HF0A 4DW6A 3G1MA 5IP7J 2H8RA 1IG7A 3LOCA 1ETWA 2R5YB 3TW6A 5F1JA 5M3MJ 1FTTA 1ETOA 4XK4A 2JJ7A 4BBSJ 2Y9ZA 1JTYA 2KT0A 2DA3A 4CYCA 1U78A 1AKHA 1FIPA 5E3MA 1NTCA 4CYCB 3BTLA 4MO7A 1AKHB 1TWHJ 2X9DA 3W6VA 5GP9A 1JKPC 2H1KA 4MLOA 1ZR2A 5EF6A 4XRSG 3QQAA 4I6ZA 4AC0A 1H8AC 2L7ZA 4IHWA 4FISA 3HKZN 4D7NA 2I10A 1IDZA 3H0GJ 3BR3A 4DYCA 1HLVA 2CQXA 4Y7NJ 4A3LJ 4J19A 3TEDA 4M3EA 1MBGA 5J1YA 2R5ZA 4FE4A 2L7MP 2X6OA 1D5YA 5IOZA 2R5ZB 5F04A 4DYQA 2COBA 2EH3A 4EEFG 3IH2A 3G1OA 3Q0VA 1FTZA 4JX5A 2XGEA 2XPUA 4JX6A 5BNGA 1BW5A 2JA8J 1FEXA 3PO2J 3WHBA 5F08A 4C2MJ 3JRCA 1MBEA 2P81A 1P7JA 2W48A 1NK2P 1H88C 4JP0A 3K7AJ 1RKTA 1T56A 1BW6A 2NVQJ 4W97A 3OOUA 4V2GA 4QTRA 4LOCA 1VF9A 2FD5A 3SJMA 3BTIA 4B4CA 2OPTA 2IEKA 2ME6A 3OIOA 3TP3A 1IV6A 2O9LA 3JRAA 3BQZA 1ETKA 4G12A 5FKOA 3S1MJ 3ZQGA 1K61A 2CJJA 2ECCA 3O8GA 1ETYA 2DJNA 5FKKA 2XGCA 2DN0A 2DA1A 3GTQJ 1F43A 2X48A 1XG1A 3SDGA 5EEAA 3FISA 3F0CA 4JX4A 1U9NA 4I76A 3IH3A 1HDPA 3LSGA 3HDDA 4B1RA 3JRDA 4IEJA 5IP6A 3HOXJ 2E2JJ 2OF7A 2FJ1A 3FKIJ 2VI6A 2E2HJ 2AO9A 2DMPA 3GBGA 2VKVA 2HOTA 2EQRA 5EZGA 2FQ4A 2O8KA 3FK6A 2CUEA 3LNQA 2Y31A 3HOZJ 4AYBN 2R92J 2LY9A 3HM5A 2EZLA 3Q0WA 2JA7J 2DA5A 2XSDC 4QIWN 4IHXA 1JT6A 2Y9YA 4DZJA 1ZGWA 2DA7A 2L9RA 3BTJA 3ZQCA 3JRGA 4BXXJ 3S2DJ 5DTDA 2QF7A 2WAQN 3B6AA 1R9TJ 4IHVA 2FX0A 1JTXA 3SFIA 4FTHA 3GTOJ 4XRMA 3BR1A 2TCTA 1T33A 1UG2A 1Y1VJ 1UMQA 1X2MA 5E3NA 2GLOA 1MBFA 1WI3A 4QSHA 3S2HJ 2DMTA 1DU6A 5EGOA 5FKNA 1RKWA 3DEWA 1I6HJ 2M8GX 3GTLJ 2XB0X 1HDDC 2Y0SN 1W0TA 3HBLA 3RQIA 1JKRC 2MW8A 1A5JA 5E3LA 3FIWA 1BJZA 5K7FA 1AU7A 1I50J 3CCYA 4IHYA 4A3EJ 4MFDA 4ABZA 1RESA 1E3OC 4A3KJ 3ZQLA 2LKXA 3M3YJ 3G1LA 2M9HA 2EZIA 2G0EA 1BA5A 3MN2A 1RR7A 3IV5A
chains in the Genus database with same CATH superfamily
2Q8KA 1AHDP 2CW7A 5EEGA 3L2CA 2LFBA 2NOJB 3PQKA 3JRBA 2OZ6A 3I3LA 1K6OA 2HOAA 5LHGA 5TGTA 4A93J 3F8NA 2KP6A 2QKMB 4PFPA 3L2RA 2Y2ZA 4Y33A 1D8JA 2MFZA 1A35A 4L0YB 4G7HF 4BXFA 3TW7A 2BVLA 2MYSA 4M74A 4NQWA 1B59A 3OYBA 4XICA 2DFEA 1U2WA 3TL4X 2CQ7A 3KETA 1T08B 1QRYA 2BGCA 3DCFA 1BL0A 3ZOBA 3S16J 5FD5A 4IOAF 3O2PE 1B72B 4UVCA 3JRIA 2BYVE 3S32A 1FJLA 2HOSA 1V55H 2DDBA 2ZSHB 5HLTA 1TNSA 4EJVA 1ITYA 1TWFJ 1X1AA 3RTRA 4X0GA 2VKHA 4O6JA 1PVEA 3BG5A 4BEHB 3C1DA 1MH3A 2A68F 4C2TA 1YX3A 2XB5A 5BS6A 3SZGA 3M1CA 2NNYA 1X3UA 5CJ9A 2ZMEB 4D0PA 2DT5A 4ZDPA 2K4JA 3GO5A 1OQYA 2X1EA 5TISC 2Z99A 3DPUA 3LSRA 2CWEA 3I53A 2M0MA 2HQNA 1RUOA 1XSDA 5C4JJ 2LOOA 1OKRA 2VB6A 3CCUI 2IGNA 1MD0A 3E6DA 4D9JA 3AL0B 2MLKA 3PM1A 3V7CA 2LF7A 2DMUA 3HHHA 4HEA2 2VIXA 2XPVA 4X6AJ 2FNAA 2LY1A 2ZO4A 5FO5A 5CLSA 3C7JA 3B73A 1R5HA 1UHWA 3ECOA 3EQLF 1WI9A 1W1WE 4UV9A 2CG4A 2F5DA 1ETQA 3LSHA 2EZKA 1LE8B 2R93J 1OYWA 2CUZA 2DK8A 1O57A 1F9NA 4EV0A 3LL7A 5DD4A 3K4LA 5FRMA 1GDTA 3J7ZI 1KU2A 3CCVI 1OCZH 4KIBA 4EJWA 1MJAA 4KISA 1DUXC 3P7NA 4UUSA 1STZA 2XAJA 1IDYA 4M3BA 2NS8A 4E7KA 3BLYA 2P7CB 5DS9A 2L7FP 1JKQC 3I71A 1YO5C 4V19K 5IT9Z 4ESJA 2C6YA 3GW2A 3OMYA 4HF2A 2FBHA 4YRVA 1IJWC 1APLC 4B09A 4DZPA 2E7WA 2LC2A 4UNOA 3V42A 2OA4A 4P55A 2R7ZJ 3HB9A 3PUFA 2HTJA 1DP7P 3RJPA 4MEYF 1TW3A 3QWLA 1TW2A 3AFHA 4D1QA 4M6XA 1OYIA 2Y75A 2M7AA 2V9VA 5GAGJ 5GPCA 4H0EA 2L9NA 3QPHA 2JUGA 4DYRA 5LHHA 4AUXA 2K40A 1YI2I 2E35A 2A69F 4WXHA 2MD0A 2AQFA 4PZJA 4BL0B 4UB8C 1F1ZA 1TWAJ 2VONA 2VBZA 1N78A 1W7PA 1TWGJ 1ZYRF 2LTPA 2ZFUA 2VJ5A 4U7DA 3HOSA 3CMYA 1FC3A 2LSOA 2F5EA 2PMUA 5D8KB 1XS9A 3S1RJ 1UHSA 3M4OJ 2LVSA 2COMA 3A02A 3KP5A 4A3IJ 1WGXA 2EWNA 4CA0A 1JKOC 5K7HA 2WV0A 2OD5A 2P7VB 2YU3A 1MBHA 2DQLA 5K7ZA 3DXJF 2ADUA 2FU4A 3CJTB 3K4CA 3LFUA 1YW7A 5FGMA 5CQEA 5JVGF 2YS9A 4M3DA 3O8HA 3BR0A 3M7GA 1VFCA 1XGOA 3F8BA 4UV8A 5ILVA 1L0OC 1QPIA 1MDMB 3GF2A 5KNLA 2Y69H 3GEZA 4KT6A 1MMSA 1OLTA 3H36A 3Q9SA 2ELKA 1TQIA 4I0AA 3KP3A 2LLKA 2L2OA 2NNNA 1R5ID 2HDCA 2FMYA 2LDUA 5EDNA 1YQAA 3EUHC 5C4XJ 3GTGJ 2DA2A 3K4BA 5IYDJ 1T95A 2VC0A 2OTJI 3BG9A 4N9HA 2D45A 1U6GA 2FF4A 2MG4A 2ZXWH 3DP7A 1Y0UA 5HVQC 3DBHB 5F0FA 1HKQA 2JWTA 1YIJI 4NC6A 1F5TA 2GOXB 4II3A 3RYRA 3CLQA 3F3XA 1R1TA 4HBLA 4BS9A 2CV0A 4MTDA 2FXAA 2DQRA 1OMIA 2QZ8A 3A1YA 3TO6A 1FWZA 4L18B 2PLYA 5GTHC 2E1CA 2I8DA 4XLHA 3LSJA 4YEJA 5CQGA 1HOMA 3BZCA 2NOGA 2O7OA 2BOLA 4W1UA 1W0UA 1E3HA 3EUKL 3OYEA 5IT9K 4M72A 4JK1X 4QLCU 1OCOH 3FXOA 4CYDA 4L9TA 1ONVA 1WH5A 2HZTA 1W5TA 2CQNA 4IRHA 4AIHA 1RPWA 1ZGJA 5JFRA 1K78A 4RA2A 2IA1A 2PX9A 4XONA 4FHTA 3K70C 5EG0B 2P5VA 3D5SC 2M2EA 2Y0MA 1ODDA 1WZ2A 3S3OA 3R0AA 3CUQC 2K3PA 5BOXA 3G71I 1MBJA 3DQVC 2DXIA 2ETHA 4CCOA 5DDGA 2QBYB 3H1CA 2W4SA 1QVUA 5HS8A 2IAIA 1BOBA 1O3SA 3BG6A 3E7LA 4ZZLA 5FLXZ 4E7IA 4II2A 4A3FJ 4ASNA 4R1HA 3DWLE 2FSWA 3DPTA 1G59A 2CV1A 2KLOA 4AYBA 2ACJA 3KEYA 4XM3A 1B8IA 2R4GA 3RPUA 4FE7A 4HNVA 1ZLJA 1LDDA 1T38A 2ISYA 2GXAA 5D6EA 3ZQ7A 3KIOA 5E8IA 2DOEA 5H6RA 5IOYA 1TWCJ 3OIQA 4UY8I 1HF0A 3G1MA 2DPUA 1IG7A 3HPGA 2WB1A 4JQFA 4BXUA 3I54A 3TW6A 2JQ7A 4ZYHA 4OAYA 4U88A 2DO7A 5J40A 3SDBA 5M3MJ 4XK4A 2JJ7A 1Z9CA 2PMHA 3Q9VA 4XSZF 1RRJA 3W2VA 2UV1A 3KX2A 4I0BA 2DT7B 1FOKA 3GFIA 4CYCB 4MTEA 1TWHJ 1SVMA 1S5LC 3KP2A 3HG9A 4PSWA 3GMEA 3TMOA 2VBYA 4P1WA 4MLOA 1ZR2A 4ZDOA 2OQRA 5BMZA 3CMAI 4HW0A 5ICGA 4BJ5C 3DTKA 3HKZN 4D7NA 2IRFG 4A0ZA 3P9CA 1VQLI 3ZRGA 2GQQA 1P4AA 3IAM2 4OMZA 1HBXG 1QBJA 3CDHA 1G3SA 4IRIA 5HOOA 2CQKA 3LSKA 4BHBA 4FE4A 2W00A 3R4KA 2X51A 2R7TA 4LLGF 2JVGA 2IS4A 2O5RA 3D5LA 5F04A 1VTNC 1BM9A 2EH3A 1D1BA 2FOKA 3MZ8A 2BEOA 1TZLA 4CUGA 4FASD 4F92B 1IN5A 2YR2A 3VYUB 5BNGA 5FD6A 1BW5A 1A6QA 3PO2J 1BI3A 2K7LA 3LAPA 1MBEA 1P7JA 2W48A 3CP2A 1GHCA 2WC2A 1T56A 1FZPB 1BW6A 2BW3A 4W97A 3CLOA 3V4GA 3ROUA 2AXTC 2DBBA 3KEQA 1NG6A 3LSTA 3BTIA 4XBFA 2TDXA 4B4CA 5D5WB 3QYEA 2IEKA 2O8XA 3MCZA 2F5VA 3TP3A 1IV6A 2MD5A 5J6XA 4ON0A 2E34A 3L9FA 2FEZA 2H6CA 1S8NA 3JRAA 1FLIA 3BQZA 4LIUA 4LD5A 3M8EA 5CVJA 1Z1DA 2CJJA 2LREA 2IW5A 5FLXK 3O8GA 2XGCA 2DN0A 1I5ZA 3FX3A 3CZ6A 3R6SA 3CUQA 4J01A 3P5JA 3WG9A 1T98A 2RQPA 3SDGA 3FISA 3F0CA 1U9NA 4I76A 4A5MA 3OYDA 2K5CA 3HRTA 3HOXJ 1IXRC 3H92A 3CCLI 3SEZA 2OF7A 5HS9A 4MQVA 4I98B 4ZYGA 3FKIJ 3QP6A 3ASNH 1BN5A 2DMPA 3ERED 4UHTA 5FFZA 2WY7Q 1Z7UA 5EZGA 3GZNB 4NC8A 1WSUA 4P5OA 2DPDA 3K1NA 3ZMTA 2HGCA 3BY6A 3LNQA 2Y31A 1X1BA 3CO6C 2QUFA 1B1BA 5LBQA 2CV2A 3MQ0A 4LGWA 3Q0WA 1TBXA 3DU6A 1G3YA 2Q1ZB 3PFYA 4IRGA 2EV5A 3HPHA 1KU9A 2G9WA 3ZQQA 2ZC2A 2XSJC 1ZGWA 3PJRA 2DA7A 5JI6A 4BJ6C 1D1CA 1XB4A 3P9IA 4XLFA 2R7DA 3EDPA 4UXNA 4ESFA 3V8KA 3WE3A 1BI1A 3BWGA 3GCMA 5DUIA 1J0RA 4OAZA 4RB1A 4HLXA 1P92A 1IO2A 1ULYA 2WAQA 3HRUA 4XRMA 2TCTA 3CCRI 4RAFA 1T33A 2E71A 4XMYA 3F21A 3CDIA 1MNEA 2KZGA 4EM0B 1MBFA 4QSHA 2HVRA 4OIOF 3S2HJ 4F55A 2Z1DA 3J7YJ 2O6GE 1RKWA 2VJJA 3DEWA 2M8GX 2V6CA 4JBAA 2GWRA 4ZJZA 4PDKA 1QA6A 4C9YA 1P6RA 4GYGA 4MHGA 3RDIA 2Y0SN 5DD8A 3RQIA 2HYGD 1I3AA 3BPVA 1FP2A 1AU7A 1I50J 3EETA 2ZJQF 3S3MA 3KZIC 2XHKA 4RAGA 2DT6A 4ENNA 4IHSA 2Z5UA 2LH9A 2FOWA 1Z67A 2HR3A 1DPUA 1YJWI 1ZRCA 2M9HA 1RR7A 1MGTA 2EFQA 2FQ3A 5B3SH 1PUFA 1HW5A 2AS5F 2JMWA 3VSLA 3PNYA 3GTPJ 1E2XA 2JSCA 2JPBA 1W7PD 4AVZA 2KIQA 2EINH 5GAHJ 1EJ9A 1MW7A 5C44J 1SFKA 1ZKGA 3MZHA 1W5CC 1AA7A 1IAWA 4HV6A 4BE2A 2EZHA 2NRAC 1WJEA 2R0QC 5HNHA 3DBLB 2W7NA 3BR2A 5LEKA 3I4PA 5HDGA 2JVHA 2E1OA 4Y13A 1ZK8A 3Q0UA 5FKMA 2XF6A 2TRTA 1PUEE 3M07A 4DOZA 4GFBA 3MVPA 4HNTA 4DJAA 3MZYA 4NUBA 1SFOJ 1OISA 2JUCA 1W4MA 3VOEA 2PJRB 1OR7C 1IW7F 3VB2A 4A3DJ 1ORKA 4XOPA 4A69C 4E4HA 3VYRB 2RQQA 1XCBA 2WADA 3K9TA 3K4MA 3CCEI 4LB6B 1IN7A 5L3BA 1VQ6I 2DA6A 3ISPA 2KDOA 3HZJA 4Y17A 2PI0A 4E7LA 1POGA 2F5CA 3LA2A 1K83J 5DYMA 5L3FA 3HOVJ 4WXDA 3QYBA 2NS7A 2CYYA 4M6VA 4RLQA 3KLOA 3E1SA 2K9NA 3GYHX 1SMTA 2QCOA 5KVRA 3ZR8X 1R23A 4M3GA 3OSGA 3HOYJ 2GIVA 5E79C 5KHDA 4ANJA 2HYJA 1TC3C 3GZ6A 1WQ2A 2YU9J 2M3AA 3JW4A 2EIJH 1VQOI 1I3QJ 3ZQIA 2E7XA 1SVLA 4ZTFA 2B63J 5F6FA 3A01A 1EH8A 5ILSA 3UKGA 2DODA 1FPQA 1FMWA 5M5XJ 2DOFA 3V7SA 3TP0A 1EH7A 3BR6A 4Y52J 2E36A 2OCCH 2ZXJA 5JVTA 4EGYA 4A12A 5KCMA 2GM4A 5TJJA 5L3EA 3CDLA 3HTUA 3H9QA 2HPMA 4N9IA 4E7SA 1EV7A 1D3YA 3DFGA 2CSOA 2A6EF 1WCMJ 5B66C 4C30A 1VQ8I 5KAIC 5TRDA 2PMZA 2MBFA 1QZYA 2CUFA 5JHFA 2K02A 4AIJA 4HRIA 2L4AA 1LKXA 2DYSH 3I58A 1LUJB 5L3GA 2LKPA 5H20A 5LGTA 4BKXA 2JSPA 4CCKA 2BY2A 3OYMA 4G6TB 4CICA 2CO5A 3H3UA 1QVTA 5E18F 1TT5B 1G3TA 5FLVA 2NVTJ 4M73A 1KQ9A 2F2EA 1BI0A 4XLNF 5BQTA 3FMSA 1Z77A 1DDNA 4CZZA 2YUSA 4HPQA 5GADJ 4BY1J 4EQQA 1A04A 3WTZA 1LDJA 5HNFA 4HDUA 3G4SI 3MFKA 2K9QA 3H3ZA 1OCCH 1NHAA 4LB5A 2DMNA 2ICWG 3NARA 2CW8A 2EBIA 1FYMA 3DEEA 1I1SA 4JOMA 2W85A 3O3KA 3CJRB 1Z91A 1RI7A 1D1AA 4PFOA 2GA2A 4PK4A 4YELA 2L01A 2DTZA 1ZRDA 2VE8A 2HXOA 2LG4A 4HQEA 3FMQA 2DA4A 1IXSB 4N4OB 1IZ1A 1OR7A 1JE8A 3L1PA 1R6RA 2GA1A 4L9JA 3K69A 2NVUB 2M87A 2E1NA 4WX9A 1Y1WJ 4O3MA 2L4MA 1IV8A 1SAXA 2L9VA 3A2KA 2HPIA 3P9KA 2L9SA 3I55I 4MEXF 1MNDA 3KYCB 3RZDJ 1FIAA 3BC8A 2A5YB 2CUJA 1S7OA 1Z21A 1GVDA 4U87A 1QQIA 1UJ8A 5LGNA 1S72I 4RAZA 3WU2C 4LG0A 1R4NB 5L3CA 2ME0A 1S6LA 1YOVB 4CO8A 4NB5A 1O3QA 5B1AH 4EJUA 1DP3A 3KZYA 2MSYA 2W57A 2XRLA 4EJOA 1BIBA 5A2QZ 1JUSA 2WBMA 1HSJA 3HUGB 1G3WA 2ID3A 1YS6A 4BAYA 4D7MA 4BYYA 3F22A 4BGDA 1IN4A 4MGRA 2F6CA 3HOUJ 2V9KA 3DF8A 1T2KA 4HX4A 2V4JC 3MMYB 3BROA 5CPRB 4ZYEA 3GTJJ 1PYVA 4IPAA 5K5OA 5J4YA 2BY0A 3K70D 1N77A 1LVAA 3F8CA 1YRNB 2X1CA 2KL4A 2W82A 3KPHA 1YJ9I 1WRJA 3L2UA 2EFNA 1MIJA 4IXAA 1HKTA 1GV5A 4PCQA 3S8PA 2RNJA 1P7IA 2PQ8A 3C2BA 4FT8A 4BJTA 4CCMA 1LB2A 3B6CA 4EVIA 1C0WA 1ACIA 5FFXA 3E3VA 4XIDA 2LK2A 1V54H 3OYNA 4BH9A 1KYZA 5LRRA 2YSRA 3ECHA 1TTYA 5CKTA 4G7OF 3QPSA 1Z7LA 2VXDA 2DAOA 3BOQA 3RKWA 1ZARA 2K9SA 3PUBA 1Z6RA 2H8WA 3JR9A 5D4SA 2IVMA 1YW9A 4K2EA 2M34A 2CQQA 2FUG2 2GBYA 2W24A 3CQZJ 1U8BA 4YFKF 1YJNI 1NH3A 1TLHB 3VDXA 1WJAA 3PSFA 2X6XA 4Z2YA 1CF7A 2WB1N 3J80Z 5E17F 3QRFF 1S9HA 2R5YA 2XVCA 3RIRA 2D1VA 4YIRX 3LOCA 1SD7A 2FBIA 2VQLA 1FNNA 1FTTA 1ETOA 3G3ZA 2ZKZA 1W36C 2P0WA 1BR4A 1JTYA 2KT0A 2DA3A 2Y9ZA 1U78A 1WJ5A 1FIPA 3HIFA 2HYFA 3V8LA 4GO1A 1UG0A 1AKHB 3B02A 4ZC3A 2X9DA 2ZNYA 3F6VA 3FHZA 3W6VA 1ZN2A 1JKPC 1RUNA 2H1KA 2L3DA 3H9JA 3DKWA 3I59B 1RIOH 5EF6A 1LJ9A 3FXJA 4XRSG 2YPRA 2XASA 3AG4H 4R8HA 2L7ZA 2YX7A 2I10A 1IDZA 1I27A 2Q2EA 5A2QK 4ETSA 2XRNA 3DKXA 4H4KC 3HHGA 4Y7NJ 2XAQA 2JA2A 4A3LJ 2QENA 4J19A 4HNUA 1MBGA 2RGVA 2OV7A 2E1MC 1IXCA 1RZ4A 3PSIA 2R5ZB 3G1OA 1UELB 3OY9A 3HOTA 3FM3A 1I39A 2XGEA 4JX6A 2RVCA 2B9SA 1J5YA 3FBNB 2FBKA 3FDYA 3QOEA 1NK2P 4JP0A 3PNVA 3K7AJ 2VL8A 1U3EM 3REOA 1X3WB 3CJQB 3W2AA 2UXNA 4LOCA 1FP1D 3SJMA 5CVRA 4A0XA 3RPQA 2QYOA 4RGUA 5J4VA 3M8FA 3IAS2 2ME6A 1FBUA 1D8KA 3OIOA 4IF4A 2O0YA 1RR8C 2V26A 2O9LA 3C2GA 2EJRA 4NHJA 1ZAOA 2X6YA 2AXLA 4G12A 2E60A 3ZN1A 2VODA 2VE9A 2EFOA 1UZCA 2DJNA 2R7FA 1KYWA 2VJ4A 4WF2A 5JHUA 2DA1A 2PBIA 3OL4A 4OIRF 1F43A 1J59A 1XG1A 1QPMA 4JX4A 4IVNA 3EPZA 3JRDA 3AG2H 2ZJ2A 2ZMEC 2XC7A 2FJ1A 4LMYA 3E6CC 3GLLA 4AU7A 1K79A 3J80K 1JHFA 4EM2A 2A5WA 2EQRA 2FQ4A 2CUEA 4HYEA 1GXQA 4CZCA 4PUSA 3SFZA 2E5ZA 3HOZJ 5GAEJ 1X4PA 4ITVA 3HM5A 4HSTA 2EZLA 4CGZA 1J9IA 2I5UA 4P96A 4E7HA 2EB7A 5BPIA 2DYRH 1KU7A 2XSDC 2CFOA 5HDKA 1R71A 1XDUA 3U1KA 4ZYDA 2ELHA 3KYLA 3ZQCA 3J7AY 3BDDA 5DCMB 5DTDA 3DEUA 3ULQB 3R61A 2WAQN 3B6AA 1R9TJ 3FXQA 4B48A 4LJZF 1AWCA 1IN8A 4IHVA 1JTXA 3U2RA 3SFIA 4FTHA 4CHUA 2QEXI 1XMKA 2MLGA 5E3NA 1X2MA 1WVRA 2M45A 2ZXHA 2JRTA 1WI3A 4G8XA 1ERDA 1YHQI 2DMTA 2EIMH 2RKHA 4RS8A 3U21A 3ESWB 3CC4I 1I6HJ 3FWEA 3QOPA 1X4OA 3MEXA 1W0TA 2GXBA 4ENJA 1X1DA 3WTUC 2MW8A 1A5JA 2JTVA 1QNTA 2KFDA 1BJZA 4M6YA 1R00A 1VQNI 2F48A 4UVBA 4A3EJ 4ABZA 4EMSA 4EJTA 1RESA 2IS6A 3IUOA 3CCQI 1U5TB 2HEOA 2V1XA 1O7FA 2LBFB 3W2WA 2G0EA 4KDPA 3BPXA 2JT1A 2R7XA 2KQRA 2X4HA 2K85A 4J00A 5F1RA 2GOMA 2HWVA 3RKQA 1IRFA 4LK0F 1LVKA 4U0YA 3K1PA 4N4NB 4OWRB 1H9TA 4LG3A 2HFHA 1BIAA 1LFUP 3IHUA 4HA8A 2IGMA 2KRHA 1XTAA 5D5UB 3L7WA 3JAMZ 3WHCA 3N05A 5LD2C 2ZFWA 4HX7A 2QA4I 3UNGC 4NQWB 5ED4A 5ERIA 1VQ7I 4OOIA 3FM5A 5JLXA 5F0CA 5CVUA 1B72A 3JREA 3AG3H 2LD5A 2EILH 1R58A 1X1CA 4HF1A 3VEPA 2VPRA 3KP4A 1ZG5A 1BJAA 4BEHA 4ZZDA 3GTKJ 5E20A 5FKLA 3ZP5A 1WPKA 3IWZA 3NQOA 4M3FA 2NYXA 1X3ZB 2ZMEA 5E1ZB 2D2WA 1WFXA 2DI3A 1OCRH 1YFHA 3K2AA 1SMYF 1V5FA 1VQPI 3HOWJ 3I4MJ 1MSEC 2NVYJ 3RCOA 1V3FA 4FCYA 3OSFA 2AQEA 2ZJPF 3HYIA 2IBDA 1LFBA 3BJAA 3S1NJ 1XPXA 3I9V2 2LP0A 1RETA 2X6WA 1D5VA 3MWMA 3C18A 1FYKA 3LSIA 4XRSA 4U7BA 1GT0C 3BQYA 1OCTC 2CRGA 3RKYA 4BQNA 4E70A 3S17J 2BY3A 3S1QJ 4FX0A 2IJLA 4L0ZB 3HGYA 1MMNA 5CVVA 3VFZA 4G6DA 1LE8A 4QPQA 1IC8A 3SEQA 5FLMJ 3I5UA 3ZGKA 4HF0A 5KAFC 2VC1A 2IPQX 1F36A 3R60A 3WGHA 3W3CA 1IUFA 3H5AA 2R7SA 1O3TA 1H9GA 1OFCX 4PJJA 2P5LC 2HQ5A 1Z3XA 3CESA 3NWSA 1IN6A 3BZ6A 2QSGX 5EYRA 1B9MA 4KITB 5DV5A 3VWBA 2WAEA 3FXKA 1XN7A 4UUSB 2QSHX 3NAUA 1KQ8A 2W84A 2GXGA 3L2VA 2EFWA 3LQRA 1N75A 1LDKB 3T8TA 1GUUA 4BE1A 6PAXA 3RYPA 3K4KA 4JYKA 3CO7C 2VLAA 1JT0A 1JGGA 3QPTA 2XGDA 1DU0A 2WV1A 3BP8A 1KZHA 5EGOB 1ZLKA 1KONA 3CD6I 3EYIA 2H94A 2XIGA 1LPQA 2VKEA 1VZ0A 3QPLA 3COAC 2RDPA 3JAMK 2UXXA 4EGZA 4F52A 4I99C 1TP4A 2QLZA 5EEHA 4I01A 4B8XA 2L02A 1NK3P 2D5VA 5HLGA 2P5KA 2XAFA 4Q48A 2Y30A 1ZQ3P 2H6BA 3I4NJ 2L0KA 2NAZA 3ABUA 1MMDA 4XSXF 2HI3A 2QQ9A 3SHFA 3OYFA 3OS0A 1SFUA 2VJIA 1X58A 5HODA 4IOCF 1GV2A 1I1GA 4ZDLA 1W5SA 2IA0A 1N25A 2BV6A 2BHYA 1H89C 3IRQA 1W7PB 3SZPA 4A3JJ 4S05A 5DUKA 2EPFA 4HSRA 2XKOA 3I56I 2HDDA 3J7AO 3HC7A 4V2FA 4RDUA 2XF7A 1U0JA 1YS7A 3RKXA 1GVJA 4E7JA 1XGSA 1ZTRA 5GPAA 4D5FA 4ENKA 5K1YA 4RMNA 2X0LA 3X2QH 1SD5A 3OOPA 1HA8A 3JSPA 1A36A 3S93A 3GUDA 3DV8A 3K10A 1MDMA 2IP2A 3ABLH 4MIMA 3QODA 2NVXJ 2PN6A 3JTGA 5D5XB 4LFUA 3T0YA 4GRIA 5AIPA 4KMFA 2B0LA 2VBWA 1VI0A 1OJLA 4D5CA 2JK3A 3K2ZA 4YFNF 3OWTA 4A3MJ 4FX4A 4RGRA 1LEBA 2A61A 2HTSA 4KT5C 4CCLA 3DLLF 4Y3OA 1H0MA 2BXYA 1EF4A 3OYLA 3MD2A 2HKXA 3G73A 4BHPA 3JSOA 3PO3J 1T39A 2IS2A 2RN7A 1HKSA 3DPLC 2F5FA 4GXOA 4RAYA 4MNUA 1OYYA 5KK1A 3TO7A 1KQ0A 4HQMA 4P9UA 3TOAA 4RLFA 4LLNA 3A4CA 5IPAA 2HXIA 3FF5A 4BQAA 1DGWY 4YIFA 3N97A 5DM7F 2IA2A 3IWFA 1R7JA 5J47A 4Q5SF 2FMLA 4A3BJ 1WH7A 3ASOH 3ZQHA 1USSA 3CJNA 1Z0XA 3S14J 3WU1B 4G94A 1FOYA 5HLIA 2NXNB 2LR8A 5ICEA 4XORA 1G2HA 1JJ8C 5H2FC 1XGMA 4WCGA 1KA8A 2VUMJ 2CH0A 1XC5A 2EV0A 4XKBA 2Z2SB 4RM3A 5EG0A 5HLHA 2QGUA 1JUPA 4TV7A 4DIQA 1K78B 1R1UA 3S3NA 3QU3A 1TQMA 1T0FC 2HDWA 1UCRA 3LQQA 4HG2A 5EJCA 4BACA 2RAEA 3CC2I 3AG1H 3L09A 2QBYA 3KYDB 5K5RA 3H5NA 2XAUA 4HAMA 1P4WA 5F64A 4QWQA 4BHCA 2KKOA 2XAHA 3ZCOA 5M5YJ 1OPCA 3DTIA 3JRHA 4OINF 1ZGAA 3A03A 3IH4A 4GDFA 1D0YA 4O5VA 5M5WJ 2BXZA 2KIUA 1Y39A 3E5QA 1YLFA 2A6TA 4CDGA 3RPUD 5JLWA 1B8IB 1E17A 4LIVA 2R7RA 2HVSA 3FXMA 1Y0NA 1W36D 2AHQA 2JPCA 1T8IA 1Y6IA 4FETA 1VQKI 2MGQA 3G6EI 2WTEA 4DW6A 1ZH5A 3DU5A 5IP7J 2PJPA 1QZZA 3E5XA 2D1HA 2M7BA 2M4KA 3QU6A 4BBSJ 2CGPA 3IRRA 4CYCA 4IQJA 3BTLA 5K5QA 4P9FA 3M1EA 1WJBA 1XDSA 1KU3A 2OZUA 2Z3YA 2OJED 3K0LA 3WTVC 1A31A 4GYIA 2GZWA 3LWFA 3EUAA 4XKWA 1VQ4I 3JCUC 1D0XA 1T6SA 2Y0SA 3WTYC 3QQAA 4AC0A 1H8AC 4IHWA 4FISA 4HX8A 4XLAA 4KYWA 2DJIA 2E1MB 1HSTA 1YW8A 2KRCA 2XF5A 2A6HF 3BR3A 2F4MB 2OUMA 1HLVA 2CQXA 3WGIA 2HQAA 3BZKA 1P4XA 3QAHA 3TEDA 3HL2A 3RSNA 5J1YA 3OR2C 4F93B 2VBXA 1J7KA 5IOZA 4XQFA 1PP8F 4ENMA 2L7KA 3L00A 4EEFG 3IH2A 1JI8A 2MH2A 1UB9A 4I2OA 3Q0VA 1FTZA 2EA2A 3TOBA 4JX5A 2QQ8A 4LLLA 4M71A 3VODA 5F08A 3CMMA 1H88C 2X85A 3T8RA 1IRGA 2ZNZA 2W1OA 2BVMA 4YG2F 5DCFA 3C2HA 4V2GA 2QQAA 4QTRA 2BW3B 3AKZA 4BE0A 1FY7A 4HZFA 1P2FA 3OYAA 4KMUX 3ZMSA 1FSEA 4NNJA 2ZXIA 3LFKA 3OL3A 1EKEA 2EK5A 3BJOA 4NC7A 1DGRM 3SZTA 2VOOA 1USTA 3K4NA 4IJAA 5FKOA 3S1MJ 2EA4A 1K61A 2Q0OA 3PL8A 1IF1A 4CXFA 2OTLI 1G4DA 3GTQJ 1T0FA 2X48A 2FRHA 2QKLB 3UR3C 3CUQB 3IH3A 3HDDA 3OYIA 2MABA 5IP6A 2VQCA 2VKDA 1K7AA 1YX5A 1R1VA 1FBQA 2KIMA 3ZMVA 2P6TA 2F4OB 3FBIB 2CW0F 3V7RA 2O8KA 4HV5A 4FQGA 4Q47A 2GIZA 2IS1A 2ZCWA 4LITA 3SQNA 5D8LB 3CC7I 3PIPF 3L2WA 3FHNA 5LLQA 2DTRA 4AYBN 2O61A 4IO9F 2LY9A 4RGSA 4WWCA 4Z6YA 4I09A 2DA5A 3WGGA 3ZPLA 4YIIA 4QIWN 3J81Z 4A2UA 1Z6TA 2OQGA 4IHXA 4DZJA 3HRMA 3BG7A 4PGGA 2L9RA 4A6EA 4CCNA 2XKPA 2KIFA 3BTJA 2BHZA 1XD7A 4XLCA 2M4GA 4WK8F 4BXXJ 1ON2A 3I64A 4XL9A 3OS1A 1SFEA 1ZG1A 2ESHA 2G7HA 4M9SA 3GTOJ 3E6MA 3OYKA 2WA0A 1UG2A 1Y1VJ 2E5NA 2DFFA 1WWXA 2GLOA 5BPDA 3HXLA 2OCEA 1SAUA 4B43A 3SYTA 4YFXF 2VQHA 5EGOA 5FKNA 1QHGA 2XB0X 4ZH4F 4IZZA 4C2UA 3F8MA 5IT3A 4KIFA 3R0JA 1WHUA 1R49A 5GTIC 3IC7A 4GGGA 1S7AA 4IHYA 3GFJA 1R4MB 4MFDA 2EIKH 3ZN0A 1BR1A 3ZQLA 3ABTA 4F91B 2LNBA 2LKXA 2HZDA 3G1LA 2O3FA 2P8TA 2EZIA 4PSXA 4IX7A 1BA5A 2VASA 3MN2A 1PP7U 4F7ZA 1V4RA 3VPRA 2HQRA 1XCVA 2JRMA 4ZYAA 4ESBA 1MZBA 1PUFB 1XSXA 1WKMA 5IY5H 4E6KG 1IRXA 3EYYA 3WE2A 3LSPA 1VNDA 2FE3A 3JRFA 9ANTA 3FKJA 3Q5FA 5J1RA 2BZTA 4AD9A 2LY2A 2VN2A 4UVAA 2XUBA 5HS7A 4KFCA 3PQJA 1R22A 1Q1VA 3OYHA 4M9XA 2XAGA 4EATA 3FMRA 2ZJRF 2PJRA 2V1DA 1MMGA 3W6KB 2ECBA 2R7QA 2IXSA 1BI2A 1FBSA 3ZQFA 3F6OA 1CQTA 1RC9A 2CFXA 2JZYA 2F4IA 1SD4A 4A6DA 4A3CJ 2K9MA 3BCAA 1UAAA 2V1UA 1SEUA 3KP6A 4G7ZF 3F8FA 4B3AA 1EH6A 2HNHA 3KFWX 3KCCA 4MFEA 1FX7A 2K86A 4XN3A 3AAFA 3NWTA 1TQPA 2RNGA 2IT0A 3GTMJ 3FXUA 1ON1A 2J5OA 2KZVA 5FB2A 3J81K 3N4MA 3LA3A 1OCPA 1ENHA 2OAZA 3PFIA 1LNWA 3V8JA 4A0YA 1XGNA 4RGXA 1PDNC 2QQBA 1GXPA 3D5RC 4RB3C 2JN6A 3WODF 3GX4X 3H3VK 3T5XA 2EFPA 5IYBJ 3CF2A 2STTA 3VSKA 2X1DA 1MKMA 1SANA 3MKYB 4AM3A 1E3PA 5H6QA 1VQ5I 1J2XA 1ZREA 2L54A 1WJDA 1YITI 3CCSI 3AL0C 4UB6C 3BG3A 2ID6A 3GZ5A 3A01B 4I7HA 3K1MA 2IGKA 1CGPA 1V5EA 3HEFA 3ZMDA 2NS0A 3E5UA 3DLAA 1E0EA 1JUMA 3M8JA 1BC8C 2DK5A 1Y56A 2OC6A 4L5EA 2DCEA 2E19A 1G6NA 2PFBA 3ERMA 4I02A 1QHHD 1IRZA 5D4RA 4Q4ZF 3D0SA 1X1PA 3RI4A 4WXCA 4RBOA 1YTYA 2R7VA 1YYVA 4F3QA 3K6GA 4DQ2A 1JHHA 5IYCJ 5DM6F 4KICA 2N8GA 1JGSA 3GLXA 3WU0A 3OYGA 3HJEA 1X2NA 4BUPA 3WTWC 4A3GJ 3G2BA 3FK7A 2PG4A 5B1BH 2P6SA 4X1EA 1FSHA 1DPRA 1QO0D 4EM1A 2V9PA 1A6IA 3L2QA 1HQCA 1S29A 2WAFA 4XRFA 2A07F 2KDZA 1JJ6C 2QSFX 4RM2A 1YE9A 1DQUA 3F9KA 3QP5A 4B3XA 2M0CA 3GFLA 5F0HA 1S3JA 4AWXB 3MKZA 4E7ZA 3CMEI 1MMAA 5CVIA 2EV6A 1WJCA 2GAUA 4G9YA 4R79A 2Z16A 4IL6C 2ZB9A 1SVOA 2JA5J 2V1NA 1J09A 1P9QC 4UUVA 3GXOA 4XN0A 1IUYA 3E0JB 2IGOA 3H9GA 2K27A 5ICFA 1R36A 1S7EA 2Z9OA 1ZG3A 3HSRA 1ETXA 1TT0A 3DBRB 4A5NA 4B47A 4BNCA 3A0BC 1ETVA 2XPWA 1SFXA 4XNFA 1O4XA 4NDLA 2VXZA 1EA3A 3EUHA 2XGXA 2CU7A 1MSFC 3KP7A 2M5WA 2R7UA 2MH9A 3BT9A 3H35A 2M1BA 3BR5A 5J1UA 1O3RA 3I0TA 3HTSB 4RB2C 1X19A 4L5IA 1MH4A 5DEQA 1J75A 4LG0B 4IQ4A 2Y48A 4BDZA 3NEUA 4C3IJ 4L9NA 3TBIA 2WWYA 4S0HB 1K6YA 5D6FA 5IP9J 3TDUC 3OS2A 3HUGA 3ABKH 3ML6A 1MJ9A 1ZR4A 4AIDA 5FJ8J 4PGHA 5J3LA 2VT2A 4BBRJ 3TDZC 5E3OA 3D1NI 2M8EA 3ONQA 1SD6A 2E2IJ 3CP8A 3BTCA 2CS3A 3ABMH 1U9OA 2KJCA 2DFIA 1ZELA 5FROA 2KMUA 3OYCA 2MA3A 3E6BA 4PJ0C 5F27A 2OU2A 2WY8Q 1YRNA 2JA6J 1Y8QB 1D0ZA 4UUTA 1LEAA 4HLYA 1B4AA 1UFMA 1G8XA 1BOAA 5E8GA 1BR2A 3S2WA 4C3HJ 2R7OA 4LK1F 1LFPA 3IKVA 3GVAA 2DMQA 2V7FA 2HS5A 4KIGA 3NRVA 4PJLA 1Y8RB 4AVPA 3ZMZA 3Q3SA 3RZOJ 4G6QA 2PMZN 3MKLA 2UWMA 2J5PA 2KISA 2R3SA 2VPLA 1BC7C 4DBQA 5C3EJ 5EZHA 1QGPA 4ZTJA 5J8FA 2LYCA 1HC8A 2B7EA 3GFMA 1BBYA 2V79A 2H09A 4IKFA 5M3FJ 3PNTA 4GCVA 3HGGA 3S15J 4BY7J 2KPMA 3WTTC 2RC4A 1K4SA 2H1LA 1HCRA 1HW2A 1MBKA 4BQOA 3CTAA 3F72A 2A3SA 1B9NA 3A0HC 4BQQA 1QZEA 4C3JJ 1F4KA 1IGNA 4BDYA 3OR1C 3PIOF 1MNMC 2VOPA 2HKOA 1CF7B 2H8RA 3H5RA 3SXYA 5E1WA 3T1BA 1ETWA 2R5YB 1XMXA 2YX4A 5F1JA 2H27A 3LA7A 1AKHA 3QYFA 1HXDA 5E3MA 1KGSA 1NTCA 2FNPA 4MO7A 5E1XA 3O6BB 3VYTB 3HRSA 3I59A 5GP9A 4KUMA 3LAJA 3K4JA 3ZMUA 1R5GA 3KEOA 3C3WA 1NG7A 2CMPA 2HU9A 4I6ZA 4XKVA 2XROA 2DDAA 1YG2A 2HOEA 3HSEA 3H0GJ 4DYCA 1ZHFA 5AONA 3HKZA 2QM3A 5LHIA 2MC4A 2Q2EB 1LQ1A 4M3EA 2R5ZA 2L7MP 2X6OA 3ELKA 4B44A 4XOTA 1D5YA 1U5TC 4U0WA 4XLEA 3CCJI 1TL8A 3RQ4A 4DYQA 2COBA 2ISZA 2QWWA 3WG7H 4S04A 4OMYA 1HW1A 2XPUA 2JA8J 1FEXA 2BY1A 3MKWB 3WHBA 1YIOA 4C2MJ 1Z3YA 2O03A 4DNCA 3JRCA 2P81A 4HOBA 5LEJA 5HDNA 2DU9A 5FRNA 4Y15A 1RKTA 2DOAA 5L3DA 4L9VA 3WTSC 1ZRFA 2ZSIB 2NVQJ 3U1DA 3OOUA 5D5VB 1VQMI 4OIPF 4XKCA 3TQNA 2V6EA 1VF9A 2DFHA 2FD5A 2P4WA 2LMDA 2OPTA 3ZXSA 4KA4A 1L3LA 1O7LA 1WJFA 2LRDA 2BBYA 2XV4S 3MAJA 4XLPF 1FYLA 1ETKA 5LFAA 2L5QA 3ZQGA 3LMMA 4L5JA 3F23A 1UHMA 2ECCA 2ZBKA 1ETYA 1GLNA 5FKKA 2KJBA 3CF5F 5EEAA 2K9LA 1Q1HA 1RNLA 1HDPA 3LSGA 4KJZA 4B1RA 4IEJA 2QVOA 2VT3A 5JR3A 2E2JJ 1QU3A 2RV8A 3W6JB 2ESNA 2K3FA 2VI6A 3KE2A 2AO9A 2VQGA 2UZKA 2E2HJ 3GBGA 2M30A 4OU0A 1I6XA 2VKVA 2HOTA 5LGUA 4CSWA 3H0DA 1VQ9I 3FK6A 1PJRA 2FA5A 3CCMI 4PJNA 3OV8A 3KLNA 2R7WA 2OBPA 3BCBA 1JXSA 3CUOA 1SC7A 2KHMA 4IHTA 4DBRA 2R92J 4NBQA 5CYVA 2KRFA 3OYJA 1FMVA 3FXLA 1AOYA 4U0VA 2JA7J 4OIQF 4AIKA 3DTEA 4MQ9F 3TKYA 1JT6A 1MJBA 2Y9YA 3BJ6A 5DCMA 2DLLA 1TNTA 3JRGA 2HVQA 3S2DJ 5ICCA 2MC3A 2RREA 2QF7A 4QPOA 3VYSB 4CH7A 2LKSA 1M1EB 2FX0A 1U8RA 4HDVA 4KN4X 4PJMA 4DGWB 3BR1A 2DW4A 1XX5A 3GWZA 1REPC 4CCJA 3M9AA 1UMQA 4XR6A 3IL2A 5LRSA 3HSFA 4N0BA 1K4TA 1V5GA 1DU6A 2STWA 4RB0A 2A05A 3IKTA 3TGNA 3KZZA 3GTLJ 2G7UA 3DKYA 2XDVA 2LF8A 2Z33A 1XSVA 1HDDC 2K4BA 3HBLA 1FOWA 3FZVA 1JKRC 3E97A 3LSMA 5E3LA 2BE5F 3FIWA 3WTXC 5K7FA 3CCYA 3JTHA 3OIPA 4M9ZA 3TO9A 1U5TA 5J8CA 3FXRA 1FOXA 3IP4B 5AIQA 1E3OC 3U9GA 2W25A 2LBFA 1Z05A 4A3KJ 4KNYA 4KN7X 3M3YJ 5ILUA 2ELJA 5B5EC 4Y4RA 1B6AA 2PEXA 2UUZA 4BU2A 1FT9A 1XMAA 3IV5A
chains in the Genus database with same CATH topology
1AHDP 3VPRA 1PUFA 2JMWA 2LFBA 3JRBA 3GTPJ 3RKQA 2HOAA 1PUFB 4A93J 5C44J 3LSPA 1ZKGA 1VNDA 3JRFA 9ANTA 2Y2ZA 1LFUP 2EZHA 2R0QC 5J1RA 3TW7A 3BR2A 3WHCA 2E1OA 4XICA 1ZK8A 3DCFA 1QRYA 3Q0UA 5FKMA 1BL0A 3ZOBA 1Q1VA 2TRTA 5JLXA 5F0CA 3MVPA 4GFBA 3S16J 1B72A 3JREA 2LD5A 1SFOJ 2ECBA 1B72B 3JRIA 1FJLA 2HOSA 3ZQFA 1CQTA 4A3DJ 1ORKA 2VPRA 4A69C 1ITYA 1TWFJ 3GTKJ 5FKLA 4A3CJ 3BG5A 1WPKA 4M3FA 1MH3A 2XB5A 2DA6A 4B3AA 4MFEA 1POGA 1K83J 3K2AA 3HOVJ 3GTMJ 2NS7A 4M6VA 3HOWJ 2K9NA 3I4MJ 2QCOA 1OCPA 1ENHA 1MSEC 4M3GA 3LSRA 3OSGA 2NVYJ 3HOYJ 5C4JJ 4FCYA 3OSFA 2JN6A 2HYJA 1TC3C 2IBDA 1LFBA 3H3VK 3S1NJ 2YU9J 3PM1A 5IYBJ 2DMUA 1RETA 2LP0A 2XPVA 4X6AJ 1I3QJ 3ZQIA 4XRSA 1SANA 1GT0C 3BQYA 1OCTC 2CRGA 3S17J 2B63J 3S1QJ 3HGYA 3A01A 3UKGA 5M5XJ 3BG3A 2ID6A 3TP0A 3A01B 3BR6A 1LE8A 4Y52J 1ETQA 1IC8A 5FLMJ 2EZKA 3HEFA 1LE8B 2GM4A 2R93J 1F36A 1JUMA 1IUFA 3CDLA 4L5EA 2E19A 1GDTA 1OFCX 1IRZA 1WCMJ 2HQ5A 4RBOA 4UUSA 5EYRA 1IDYA 2CUFA 2NS8A 4M3BA 5IYCJ 4UUSB 3NAUA 5DS9A 2L7FP 1JKQC 2N8GA 1GUUA 4BKXA 1X2NA 4A3GJ 1IJWC 1APLC 4DZPA 3FK7A 4JYKA 1QVTA 1JT0A 1JGGA 2R7ZJ 4X1EA 3HB9A 2XGDA 1DU0A 2WV1A 5EGOB 5FLVA 2NVTJ 1A6IA 2VKEA 3QPLA 1Z77A 2YUSA 4BY1J 2KDZA 1JJ6C 5GPCA 1NK3P 2D5VA 4DYRA 2Y30A 1ZQ3P 3I4NJ 4AUXA 2K40A 2M0CA 2L0KA 5F0HA 2HI3A 2K9QA 2DMNA 3NARA 2EBIA 1TWAJ 1X58A 5HODA 1TWGJ 1GV2A 2LTPA 2ZB9A 3CMYA 1H89C 2JA5J 4A3JJ 1XS9A 2DTZA 1UHSA 3S1RJ 3M4OJ 2LVSA 2HDDA 2HXOA 4V2FA 3A02A 4A3IJ 1WGXA 4RDUA 2DA4A 1S7EA 1JKOC 5K7HA 1ETXA 3L1PA 1ZTRA 5GPAA 1MBHA 4D5FA 1Y1WJ 3HOUJ 5K7ZA 1ETVA 2XPWA 2YS9A 4M3DA 3O8HA 4NDLA 1O4XA 3BR0A 3RZDJ 1VFCA 1FIAA 2CU7A 1MSFC 4MIMA 3BT9A 2NVXJ 1GVDA 3BR5A 1QPIA 5J1UA 1VI0A 1OJLA 2ELKA 4D5CA 1MH4A 2JK3A 2ME0A 2LLKA 4A3MJ 5EDNA 4C3IJ 5C4XJ 3GTGJ 2DA2A 1EF4A 5IYDJ 4S0HB 3BG9A 5IP9J 2MG4A 2MSYA 2XRLA 3PO3J 1JUSA 5F0FA 2JWTA 2ID3A 1ZR4A 4D7MA 5FJ8J 5J3LA 4BBRJ 5IPAA 2HXIA 5E3OA 3D1NI 2E2IJ 3BTCA 1U9OA 4A3BJ 1WH7A 3ZQHA 3LSJA 1HOMA 2NOGA 1Z0XA 3GTJJ 3S14J 2O7OA 4W1UA 2LR8A 1G2HA 1JJ8C 1W0UA 5F27A 1YRNA 2JA6J 4UUTA 1YRNB 2VUMJ 1WH5A 1XC5A 1RPWA 5EG0A 4C3HJ 1JUPA 1GV5A 5EG0B 2DMQA 2M2EA 1P7IA 3C2BA 3B6CA 3Q3SA 2RAEA 1MBJA 3RZOJ 4XIDA 2LK2A 2PMZN 3MKLA 1QVUA 2IAIA 5C3EJ 3E7LA 3QPSA 5M5YJ 5EZHA 4A3FJ 2K9SA 3JRHA 3IH4A 3A03A 3JR9A 5M3FJ 2M34A 2CQQA 5M5WJ 3HGGA 1B8IA 3S15J 4BY7J 2GBYA 4FE7A 4HNVA 3CQZJ 1U8BA 1HCRA 1MBKA 5JLWA 1B8IB 4C3JJ 1IGNA 2AHQA 2WB1N 1MNMC 2MGQA 5IOYA 1TWCJ 2R5YA 1HF0A 4DW6A 3G1MA 5IP7J 2H8RA 1IG7A 3LOCA 1ETWA 2R5YB 3TW6A 5F1JA 5M3MJ 1FTTA 1ETOA 4XK4A 2JJ7A 4BBSJ 2Y9ZA 1JTYA 2KT0A 2DA3A 4CYCA 1U78A 1AKHA 1FIPA 5E3MA 1NTCA 4CYCB 3BTLA 4MO7A 1AKHB 1TWHJ 2X9DA 3W6VA 5GP9A 1JKPC 2H1KA 4MLOA 1ZR2A 5EF6A 4XRSG 3QQAA 4I6ZA 4AC0A 1H8AC 2L7ZA 4IHWA 4FISA 3HKZN 4D7NA 2I10A 1IDZA 3H0GJ 3BR3A 4DYCA 1HLVA 2CQXA 4Y7NJ 4A3LJ 4J19A 3TEDA 4M3EA 1MBGA 5J1YA 2R5ZA 4FE4A 2L7MP 2X6OA 1D5YA 5IOZA 2R5ZB 5F04A 4DYQA 2COBA 2EH3A 4EEFG 3IH2A 3G1OA 3Q0VA 1FTZA 4JX5A 2XGEA 2XPUA 4JX6A 5BNGA 1BW5A 2JA8J 1FEXA 3PO2J 3WHBA 5F08A 4C2MJ 3JRCA 1MBEA 2P81A 1P7JA 2W48A 1NK2P 1H88C 4JP0A 3K7AJ 1RKTA 1T56A 1BW6A 2NVQJ 4W97A 3OOUA 4V2GA 4QTRA 4LOCA 1VF9A 2FD5A 3SJMA 3BTIA 4B4CA 2OPTA 2IEKA 2ME6A 3OIOA 3TP3A 1IV6A 2O9LA 3JRAA 3BQZA 1ETKA 4G12A 5FKOA 3S1MJ 3ZQGA 1K61A 2CJJA 2ECCA 3O8GA 1ETYA 2DJNA 5FKKA 2XGCA 2DN0A 2DA1A 3GTQJ 1F43A 2X48A 1XG1A 3SDGA 5EEAA 3FISA 3F0CA 4JX4A 1U9NA 4I76A 3IH3A 1HDPA 3LSGA 3HDDA 4B1RA 3JRDA 4IEJA 5IP6A 3HOXJ 2E2JJ 2OF7A 2FJ1A 3FKIJ 2VI6A 2E2HJ 2AO9A 2DMPA 3GBGA 2VKVA 2HOTA 2EQRA 5EZGA 2FQ4A 2O8KA 3FK6A 2CUEA 3LNQA 2Y31A 3HOZJ 4AYBN 2R92J 2LY9A 3HM5A 2EZLA 3Q0WA 2JA7J 2DA5A 2XSDC 4QIWN 4IHXA 1JT6A 2Y9YA 4DZJA 1ZGWA 2DA7A 2L9RA 3BTJA 3ZQCA 3JRGA 4BXXJ 3S2DJ 5DTDA 2QF7A 2WAQN 3B6AA 1R9TJ 4IHVA 2FX0A 1JTXA 3SFIA 4FTHA 3GTOJ 4XRMA 3BR1A 2TCTA 1T33A 1UG2A 1Y1VJ 1UMQA 1X2MA 5E3NA 2GLOA 1MBFA 1WI3A 4QSHA 3S2HJ 2DMTA 1DU6A 5EGOA 5FKNA 1RKWA 3DEWA 1I6HJ 2M8GX 3GTLJ 2XB0X 1HDDC 2Y0SN 1W0TA 3HBLA 3RQIA 1JKRC 2MW8A 1A5JA 5E3LA 3FIWA 1BJZA 5K7FA 1AU7A 1I50J 3CCYA 4IHYA 4A3EJ 4MFDA 4ABZA 1RESA 1E3OC 4A3KJ 3ZQLA 2LKXA 3M3YJ 3G1LA 2M9HA 2EZIA 2G0EA 1BA5A 3MN2A 1RR7A 3IV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHD P;  3VPR A;  1PUF A;  2JMW A;  2LFB A;  3JRB A;  3GTP J;  3RKQ A;  2HOA A;  1PUF B;  4A93 J;  5C44 J;  3LSP A;  1ZKG A;  1VND A;  3JRF A;  9ANT A;  2Y2Z A;  1LFU P;  2EZH A;  2R0Q C;  5J1R A;  3TW7 A;  3BR2 A;  3WHC A;  2E1O A;  4XIC A;  1ZK8 A;  3DCF A;  1QRY A;  3Q0U A;  5FKM A;  1BL0 A;  3ZOB A;  1Q1V A;  2TRT A;  5JLX A;  5F0C A;  3MVP A;  4GFB A;  3S16 J;  1B72 A;  3JRE A;  2LD5 A;  1SFO J;  2ECB A;  1B72 B;  3JRI A;  1FJL A;  2HOS A;  3ZQF A;  1CQT A;  4A3D J;  1ORK A;  2VPR A;  4A69 C;  1ITY A;  1TWF J;  3GTK J;  5FKL A;  4A3C J;  3BG5 A;  1WPK A;  4M3F A;  1MH3 A;  2XB5 A;  2DA6 A;  4B3A A;  4MFE A;  1POG A;  1K83 J;  3K2A A;  3HOV J;  3GTM J;  2NS7 A;  4M6V A;  3HOW J;  2K9N A;  3I4M J;  2QCO A;  1OCP A;  1ENH A;  1MSE C;  4M3G A;  3LSR A;  3OSG A;  2NVY J;  3HOY J;  5C4J J;  4FCY A;  3OSF A;  2JN6 A;  2HYJ A;  1TC3 C;  2IBD A;  1LFB A;  3H3V K;  3S1N J;  2YU9 J;  3PM1 A;  5IYB J;  2DMU A;  1RET A;  2LP0 A;  2XPV A;  4X6A J;  1I3Q J;  3ZQI A;  4XRS A;  1SAN A;  1GT0 C;  3BQY A;  1OCT C;  2CRG A;  3S17 J;  2B63 J;  3S1Q J;  3HGY A;  3A01 A;  3UKG A;  5M5X J;  3BG3 A;  2ID6 A;  3TP0 A;  3A01 B;  3BR6 A;  1LE8 A;  4Y52 J;  1ETQ A;  1IC8 A;  5FLM J;  2EZK A;  3HEF A;  1LE8 B;  2GM4 A;  2R93 J;  1F36 A;  1JUM A;  1IUF A;  3CDL A;  4L5E A;  2E19 A;  1GDT A;  1OFC X;  1IRZ A;  1WCM J;  2HQ5 A;  4RBO A;  4UUS A;  5EYR A;  1IDY A;  2CUF A;  2NS8 A;  4M3B A;  5IYC J;  4UUS B;  3NAU A;  5DS9 A;  2L7F P;  1JKQ C;  2N8G A;  1GUU A;  4BKX A;  1X2N A;  4A3G J;  1IJW C;  1APL C;  4DZP A;  3FK7 A;  4JYK A;  1QVT A;  1JT0 A;  1JGG A;  2R7Z J;  4X1E A;  3HB9 A;  2XGD A;  1DU0 A;  2WV1 A;  5EGO B;  5FLV A;  2NVT J;  1A6I A;  2VKE A;  3QPL A;  1Z77 A;  2YUS A;  4BY1 J;  2KDZ A;  1JJ6 C;  5GPC A;  1NK3 P;  2D5V A;  4DYR A;  2Y30 A;  1ZQ3 P;  3I4N J;  4AUX A;  2K40 A;  2M0C A;  2L0K A;  5F0H A;  2HI3 A;  2K9Q A;  2DMN A;  3NAR A;  2EBI A;  1TWA J;  1X58 A;  5HOD A;  1TWG J;  1GV2 A;  2LTP A;  2ZB9 A;  3CMY A;  1H89 C;  2JA5 J;  4A3J J;  1XS9 A;  2DTZ A;  1UHS A;  3S1R J;  3M4O J;  2LVS A;  2HDD A;  2HXO A;  4V2F A;  3A02 A;  4A3I J;  1WGX A;  4RDU A;  2DA4 A;  1S7E A;  1JKO C;  5K7H A;  1ETX A;  3L1P A;  1ZTR A;  5GPA A;  1MBH A;  4D5F A;  1Y1W J;  3HOU J;  5K7Z A;  1ETV A;  2XPW A;  2YS9 A;  4M3D A;  3O8H A;  4NDL A;  1O4X A;  3BR0 A;  3RZD J;  1VFC A;  1FIA A;  2CU7 A;  1MSF C;  4MIM A;  3BT9 A;  2NVX J;  1GVD A;  3BR5 A;  1QPI A;  5J1U A;  1VI0 A;  1OJL A;  2ELK A;  4D5C A;  1MH4 A;  2JK3 A;  2ME0 A;  2LLK A;  4A3M J;  5EDN A;  4C3I J;  5C4X J;  3GTG J;  2DA2 A;  1EF4 A;  5IYD J;  4S0H B;  3BG9 A;  5IP9 J;  2MG4 A;  2MSY A;  2XRL A;  3PO3 J;  1JUS A;  5F0F A;  2JWT A;  2ID3 A;  1ZR4 A;  4D7M A;  5FJ8 J;  5J3L A;  4BBR J;  5IPA A;  2HXI A;  5E3O A;  3D1N I;  2E2I J;  3BTC A;  1U9O A;  4A3B J;  1WH7 A;  3ZQH A;  3LSJ A;  1HOM A;  2NOG A;  1Z0X A;  3GTJ J;  3S14 J;  2O7O A;  4W1U A;  2LR8 A;  1G2H A;  1JJ8 C;  1W0U A;  5F27 A;  1YRN A;  2JA6 J;  4UUT A;  1YRN B;  2VUM J;  1WH5 A;  1XC5 A;  1RPW A;  5EG0 A;  4C3H J;  1JUP A;  1GV5 A;  5EG0 B;  2DMQ A;  2M2E A;  1P7I A;  3C2B A;  3B6C A;  3Q3S A;  2RAE A;  1MBJ A;  3RZO J;  4XID A;  2LK2 A;  2PMZ N;  3MKL A;  1QVU A;  2IAI A;  5C3E J;  3E7L A;  3QPS A;  5M5Y J;  5EZH A;  4A3F J;  2K9S A;  3JRH A;  3IH4 A;  3A03 A;  3JR9 A;  5M3F J;  2M34 A;  2CQQ A;  5M5W J;  3HGG A;  1B8I A;  3S15 J;  4BY7 J;  2GBY A;  4FE7 A;  4HNV A;  3CQZ J;  1U8B A;  1HCR A;  1MBK A;  5JLW A;  1B8I B;  4C3J J;  1IGN A;  2AHQ A;  2WB1 N;  1MNM C;  2MGQ A;  5IOY A;  1TWC J;  2R5Y A;  1HF0 A;  4DW6 A;  3G1M A;  5IP7 J;  2H8R A;  1IG7 A;  3LOC A;  1ETW A;  2R5Y B;  3TW6 A;  5F1J A;  5M3M J;  1FTT A;  1ETO A;  4XK4 A;  2JJ7 A;  4BBS J;  2Y9Z A;  1JTY A;  2KT0 A;  2DA3 A;  4CYC A;  1U78 A;  1AKH A;  1FIP A;  5E3M A;  1NTC A;  4CYC B;  3BTL A;  4MO7 A;  1AKH B;  1TWH J;  2X9D A;  3W6V A;  5GP9 A;  1JKP C;  2H1K A;  4MLO A;  1ZR2 A;  5EF6 A;  4XRS G;  3QQA A;  4I6Z A;  4AC0 A;  1H8A C;  2L7Z A;  4IHW A;  4FIS A;  3HKZ N;  4D7N A;  2I10 A;  1IDZ A;  3H0G J;  3BR3 A;  4DYC A;  1HLV A;  2CQX A;  4Y7N J;  4A3L J;  4J19 A;  3TED A;  4M3E A;  1MBG A;  5J1Y A;  2R5Z A;  4FE4 A;  2L7M P;  2X6O A;  1D5Y A;  5IOZ A;  2R5Z B;  5F04 A;  4DYQ A;  2COB A;  2EH3 A;  4EEF G;  3IH2 A;  3G1O A;  3Q0V A;  1FTZ A;  4JX5 A;  2XGE A;  2XPU A;  4JX6 A;  5BNG A;  1BW5 A;  2JA8 J;  1FEX A;  3PO2 J;  3WHB A;  5F08 A;  4C2M J;  3JRC A;  1MBE A;  2P81 A;  1P7J A;  2W48 A;  1NK2 P;  1H88 C;  4JP0 A;  3K7A J;  1RKT A;  1T56 A;  1BW6 A;  2NVQ J;  4W97 A;  3OOU A;  4V2G A;  4QTR A;  4LOC A;  1VF9 A;  2FD5 A;  3SJM A;  3BTI A;  4B4C A;  2OPT A;  2IEK A;  2ME6 A;  3OIO A;  3TP3 A;  1IV6 A;  2O9L A;  3JRA A;  3BQZ A;  1ETK A;  4G12 A;  5FKO A;  3S1M J;  3ZQG A;  1K61 A;  2CJJ A;  2ECC A;  3O8G A;  1ETY A;  2DJN A;  5FKK A;  2XGC A;  2DN0 A;  2DA1 A;  3GTQ J;  1F43 A;  2X48 A;  1XG1 A;  3SDG A;  5EEA A;  3FIS A;  3F0C A;  4JX4 A;  1U9N A;  4I76 A;  3IH3 A;  1HDP A;  3LSG A;  3HDD A;  4B1R A;  3JRD A;  4IEJ A;  5IP6 A;  3HOX J;  2E2J J;  2OF7 A;  2FJ1 A;  3FKI J;  2VI6 A;  2E2H J;  2AO9 A;  2DMP A;  3GBG A;  2VKV A;  2HOT A;  2EQR A;  5EZG A;  2FQ4 A;  2O8K A;  3FK6 A;  2CUE A;  3LNQ A;  2Y31 A;  3HOZ J;  4AYB N;  2R92 J;  2LY9 A;  3HM5 A;  2EZL A;  3Q0W A;  2JA7 J;  2DA5 A;  2XSD C;  4QIW N;  4IHX A;  1JT6 A;  2Y9Y A;  4DZJ A;  1ZGW A;  2DA7 A;  2L9R A;  3BTJ A;  3ZQC A;  3JRG A;  4BXX J;  3S2D J;  5DTD A;  2QF7 A;  2WAQ N;  3B6A A;  1R9T J;  4IHV A;  2FX0 A;  1JTX A;  3SFI A;  4FTH A;  3GTO J;  4XRM A;  3BR1 A;  2TCT A;  1T33 A;  1UG2 A;  1Y1V J;  1UMQ A;  1X2M A;  5E3N A;  2GLO A;  1MBF A;  1WI3 A;  4QSH A;  3S2H J;  2DMT A;  1DU6 A;  5EGO A;  5FKN A;  1RKW A;  3DEW A;  1I6H J;  2M8G X;  3GTL J;  2XB0 X;  1HDD C;  2Y0S N;  1W0T A;  3HBL A;  3RQI A;  1JKR C;  2MW8 A;  1A5J A;  5E3L A;  3FIW A;  1BJZ A;  5K7F A;  1AU7 A;  1I50 J;  3CCY A;  4IHY A;  4A3E J;  4MFD A;  4ABZ A;  1RES A;  1E3O C;  4A3K J;  3ZQL A;  2LKX A;  3M3Y J;  3G1L A;  2M9H A;  2EZI A;  2G0E A;  1BA5 A;  3MN2 A;  1RR7 A;  3IV5 A; 
#chains in the Genus database with same CATH topology
 2Q8K A;  1AHD P;  2CW7 A;  5EEG A;  3L2C A;  2LFB A;  2NOJ B;  3PQK A;  3JRB A;  2OZ6 A;  3I3L A;  1K6O A;  2HOA A;  5LHG A;  5TGT A;  4A93 J;  3F8N A;  2KP6 A;  2QKM B;  4PFP A;  3L2R A;  2Y2Z A;  4Y33 A;  1D8J A;  2MFZ A;  1A35 A;  4L0Y B;  4G7H F;  4BXF A;  3TW7 A;  2BVL A;  2MYS A;  4M74 A;  4NQW A;  1B59 A;  3OYB A;  4XIC A;  2DFE A;  1U2W A;  3TL4 X;  2CQ7 A;  3KET A;  1T08 B;  1QRY A;  2BGC A;  3DCF A;  1BL0 A;  3ZOB A;  3S16 J;  5FD5 A;  4IOA F;  3O2P E;  1B72 B;  4UVC A;  3JRI A;  2BYV E;  3S32 A;  1FJL A;  2HOS A;  1V55 H;  2DDB A;  2ZSH B;  5HLT A;  1TNS A;  4EJV A;  1ITY A;  1TWF J;  1X1A A;  3RTR A;  4X0G A;  2VKH A;  4O6J A;  1PVE A;  3BG5 A;  4BEH B;  3C1D A;  1MH3 A;  2A68 F;  4C2T A;  1YX3 A;  2XB5 A;  5BS6 A;  3SZG A;  3M1C A;  2NNY A;  1X3U A;  5CJ9 A;  2ZME B;  4D0P A;  2DT5 A;  4ZDP A;  2K4J A;  3GO5 A;  1OQY A;  2X1E A;  5TIS C;  2Z99 A;  3DPU A;  3LSR A;  2CWE A;  3I53 A;  2M0M A;  2HQN A;  1RUO A;  1XSD A;  5C4J J;  2LOO A;  1OKR A;  2VB6 A;  3CCU I;  2IGN A;  1MD0 A;  3E6D A;  4D9J A;  3AL0 B;  2MLK A;  3PM1 A;  3V7C A;  2LF7 A;  2DMU A;  3HHH A;  4HEA 2;  2VIX A;  2XPV A;  4X6A J;  2FNA A;  2LY1 A;  2ZO4 A;  5FO5 A;  5CLS A;  3C7J A;  3B73 A;  1R5H A;  1UHW A;  3ECO A;  3EQL F;  1WI9 A;  1W1W E;  4UV9 A;  2CG4 A;  2F5D A;  1ETQ A;  3LSH A;  2EZK A;  1LE8 B;  2R93 J;  1OYW A;  2CUZ A;  2DK8 A;  1O57 A;  1F9N A;  4EV0 A;  3LL7 A;  5DD4 A;  3K4L A;  5FRM A;  1GDT A;  3J7Z I;  1KU2 A;  3CCV I;  1OCZ H;  4KIB A;  4EJW A;  1MJA A;  4KIS A;  1DUX C;  3P7N A;  4UUS A;  1STZ A;  2XAJ A;  1IDY A;  4M3B A;  2NS8 A;  4E7K A;  3BLY A;  2P7C B;  5DS9 A;  2L7F P;  1JKQ C;  3I71 A;  1YO5 C;  4V19 K;  5IT9 Z;  4ESJ A;  2C6Y A;  3GW2 A;  3OMY A;  4HF2 A;  2FBH A;  4YRV A;  1IJW C;  1APL C;  4B09 A;  4DZP A;  2E7W A;  2LC2 A;  4UNO A;  3V42 A;  2OA4 A;  4P55 A;  2R7Z J;  3HB9 A;  3PUF A;  2HTJ A;  1DP7 P;  3RJP A;  4MEY F;  1TW3 A;  3QWL A;  1TW2 A;  3AFH A;  4D1Q A;  4M6X A;  1OYI A;  2Y75 A;  2M7A A;  2V9V A;  5GAG J;  5GPC A;  4H0E A;  2L9N A;  3QPH A;  2JUG A;  4DYR A;  5LHH A;  4AUX A;  2K40 A;  1YI2 I;  2E35 A;  2A69 F;  4WXH A;  2MD0 A;  2AQF A;  4PZJ A;  4BL0 B;  4UB8 C;  1F1Z A;  1TWA J;  2VON A;  2VBZ A;  1N78 A;  1W7P A;  1TWG J;  1ZYR F;  2LTP A;  2ZFU A;  2VJ5 A;  4U7D A;  3HOS A;  3CMY A;  1FC3 A;  2LSO A;  2F5E A;  2PMU A;  5D8K B;  1XS9 A;  3S1R J;  1UHS A;  3M4O J;  2LVS A;  2COM A;  3A02 A;  3KP5 A;  4A3I J;  1WGX A;  2EWN A;  4CA0 A;  1JKO C;  5K7H A;  2WV0 A;  2OD5 A;  2P7V B;  2YU3 A;  1MBH A;  2DQL A;  5K7Z A;  3DXJ F;  2ADU A;  2FU4 A;  3CJT B;  3K4C A;  3LFU A;  1YW7 A;  5FGM A;  5CQE A;  5JVG F;  2YS9 A;  4M3D A;  3O8H A;  3BR0 A;  3M7G A;  1VFC A;  1XGO A;  3F8B A;  4UV8 A;  5ILV A;  1L0O C;  1QPI A;  1MDM B;  3GF2 A;  5KNL A;  2Y69 H;  3GEZ A;  4KT6 A;  1MMS A;  1OLT A;  3H36 A;  3Q9S A;  2ELK A;  1TQI A;  4I0A A;  3KP3 A;  2LLK A;  2L2O A;  2NNN A;  1R5I D;  2HDC A;  2FMY A;  2LDU A;  5EDN A;  1YQA A;  3EUH C;  5C4X J;  3GTG J;  2DA2 A;  3K4B A;  5IYD J;  1T95 A;  2VC0 A;  2OTJ I;  3BG9 A;  4N9H A;  2D45 A;  1U6G A;  2FF4 A;  2MG4 A;  2ZXW H;  3DP7 A;  1Y0U A;  5HVQ C;  3DBH B;  5F0F A;  1HKQ A;  2JWT A;  1YIJ I;  4NC6 A;  1F5T A;  2GOX B;  4II3 A;  3RYR A;  3CLQ A;  3F3X A;  1R1T A;  4HBL A;  4BS9 A;  2CV0 A;  4MTD A;  2FXA A;  2DQR A;  1OMI A;  2QZ8 A;  3A1Y A;  3TO6 A;  1FWZ A;  4L18 B;  2PLY A;  5GTH C;  2E1C A;  2I8D A;  4XLH A;  3LSJ A;  4YEJ A;  5CQG A;  1HOM A;  3BZC A;  2NOG A;  2O7O A;  2BOL A;  4W1U A;  1W0U A;  1E3H A;  3EUK L;  3OYE A;  5IT9 K;  4M72 A;  4JK1 X;  4QLC U;  1OCO H;  3FXO A;  4CYD A;  4L9T A;  1ONV A;  1WH5 A;  2HZT A;  1W5T A;  2CQN A;  4IRH A;  4AIH A;  1RPW A;  1ZGJ A;  5JFR A;  1K78 A;  4RA2 A;  2IA1 A;  2PX9 A;  4XON A;  4FHT A;  3K70 C;  5EG0 B;  2P5V A;  3D5S C;  2M2E A;  2Y0M A;  1ODD A;  1WZ2 A;  3S3O A;  3R0A A;  3CUQ C;  2K3P A;  5BOX A;  3G71 I;  1MBJ A;  3DQV C;  2DXI A;  2ETH A;  4CCO A;  5DDG A;  2QBY B;  3H1C A;  2W4S A;  1QVU A;  5HS8 A;  2IAI A;  1BOB A;  1O3S A;  3BG6 A;  3E7L A;  4ZZL A;  5FLX Z;  4E7I A;  4II2 A;  4A3F J;  4ASN A;  4R1H A;  3DWL E;  2FSW A;  3DPT A;  1G59 A;  2CV1 A;  2KLO A;  4AYB A;  2ACJ A;  3KEY A;  4XM3 A;  1B8I A;  2R4G A;  3RPU A;  4FE7 A;  4HNV A;  1ZLJ A;  1LDD A;  1T38 A;  2ISY A;  2GXA A;  5D6E A;  3ZQ7 A;  3KIO A;  5E8I A;  2DOE A;  5H6R A;  5IOY A;  1TWC J;  3OIQ A;  4UY8 I;  1HF0 A;  3G1M A;  2DPU A;  1IG7 A;  3HPG A;  2WB1 A;  4JQF A;  4BXU A;  3I54 A;  3TW6 A;  2JQ7 A;  4ZYH A;  4OAY A;  4U88 A;  2DO7 A;  5J40 A;  3SDB A;  5M3M J;  4XK4 A;  2JJ7 A;  1Z9C A;  2PMH A;  3Q9V A;  4XSZ F;  1RRJ A;  3W2V A;  2UV1 A;  3KX2 A;  4I0B A;  2DT7 B;  1FOK A;  3GFI A;  4CYC B;  4MTE A;  1TWH J;  1SVM A;  1S5L C;  3KP2 A;  3HG9 A;  4PSW A;  3GME A;  3TMO A;  2VBY A;  4P1W A;  4MLO A;  1ZR2 A;  4ZDO A;  2OQR A;  5BMZ A;  3CMA I;  4HW0 A;  5ICG A;  4BJ5 C;  3DTK A;  3HKZ N;  4D7N A;  2IRF G;  4A0Z A;  3P9C A;  1VQL I;  3ZRG A;  2GQQ A;  1P4A A;  3IAM 2;  4OMZ A;  1HBX G;  1QBJ A;  3CDH A;  1G3S A;  4IRI A;  5HOO A;  2CQK A;  3LSK A;  4BHB A;  4FE4 A;  2W00 A;  3R4K A;  2X51 A;  2R7T A;  4LLG F;  2JVG A;  2IS4 A;  2O5R A;  3D5L A;  5F04 A;  1VTN C;  1BM9 A;  2EH3 A;  1D1B A;  2FOK A;  3MZ8 A;  2BEO A;  1TZL A;  4CUG A;  4FAS D;  4F92 B;  1IN5 A;  2YR2 A;  3VYU B;  5BNG A;  5FD6 A;  1BW5 A;  1A6Q A;  3PO2 J;  1BI3 A;  2K7L A;  3LAP A;  1MBE A;  1P7J A;  2W48 A;  3CP2 A;  1GHC A;  2WC2 A;  1T56 A;  1FZP B;  1BW6 A;  2BW3 A;  4W97 A;  3CLO A;  3V4G A;  3ROU A;  2AXT C;  2DBB A;  3KEQ A;  1NG6 A;  3LST A;  3BTI A;  4XBF A;  2TDX A;  4B4C A;  5D5W B;  3QYE A;  2IEK A;  2O8X A;  3MCZ A;  2F5V A;  3TP3 A;  1IV6 A;  2MD5 A;  5J6X A;  4ON0 A;  2E34 A;  3L9F A;  2FEZ A;  2H6C A;  1S8N A;  3JRA A;  1FLI A;  3BQZ A;  4LIU A;  4LD5 A;  3M8E A;  5CVJ A;  1Z1D A;  2CJJ A;  2LRE A;  2IW5 A;  5FLX K;  3O8G A;  2XGC A;  2DN0 A;  1I5Z A;  3FX3 A;  3CZ6 A;  3R6S A;  3CUQ A;  4J01 A;  3P5J A;  3WG9 A;  1T98 A;  2RQP A;  3SDG A;  3FIS A;  3F0C A;  1U9N A;  4I76 A;  4A5M A;  3OYD A;  2K5C A;  3HRT A;  3HOX J;  1IXR C;  3H92 A;  3CCL I;  3SEZ A;  2OF7 A;  5HS9 A;  4MQV A;  4I98 B;  4ZYG A;  3FKI J;  3QP6 A;  3ASN H;  1BN5 A;  2DMP A;  3ERE D;  4UHT A;  5FFZ A;  2WY7 Q;  1Z7U A;  5EZG A;  3GZN B;  4NC8 A;  1WSU A;  4P5O A;  2DPD A;  3K1N A;  3ZMT A;  2HGC A;  3BY6 A;  3LNQ A;  2Y31 A;  1X1B A;  3CO6 C;  2QUF A;  1B1B A;  5LBQ A;  2CV2 A;  3MQ0 A;  4LGW A;  3Q0W A;  1TBX A;  3DU6 A;  1G3Y A;  2Q1Z B;  3PFY A;  4IRG A;  2EV5 A;  3HPH A;  1KU9 A;  2G9W A;  3ZQQ A;  2ZC2 A;  2XSJ C;  1ZGW A;  3PJR A;  2DA7 A;  5JI6 A;  4BJ6 C;  1D1C A;  1XB4 A;  3P9I A;  4XLF A;  2R7D A;  3EDP A;  4UXN A;  4ESF A;  3V8K A;  3WE3 A;  1BI1 A;  3BWG A;  3GCM A;  5DUI A;  1J0R A;  4OAZ A;  4RB1 A;  4HLX A;  1P92 A;  1IO2 A;  1ULY A;  2WAQ A;  3HRU A;  4XRM A;  2TCT A;  3CCR I;  4RAF A;  1T33 A;  2E71 A;  4XMY A;  3F21 A;  3CDI A;  1MNE A;  2KZG A;  4EM0 B;  1MBF A;  4QSH A;  2HVR A;  4OIO F;  3S2H J;  4F55 A;  2Z1D A;  3J7Y J;  2O6G E;  1RKW A;  2VJJ A;  3DEW A;  2M8G X;  2V6C A;  4JBA A;  2GWR A;  4ZJZ A;  4PDK A;  1QA6 A;  4C9Y A;  1P6R A;  4GYG A;  4MHG A;  3RDI A;  2Y0S N;  5DD8 A;  3RQI A;  2HYG D;  1I3A A;  3BPV A;  1FP2 A;  1AU7 A;  1I50 J;  3EET A;  2ZJQ F;  3S3M A;  3KZI C;  2XHK A;  4RAG A;  2DT6 A;  4ENN A;  4IHS A;  2Z5U A;  2LH9 A;  2FOW A;  1Z67 A;  2HR3 A;  1DPU A;  1YJW I;  1ZRC A;  2M9H A;  1RR7 A;  1MGT A;  2EFQ A;  2FQ3 A;  5B3S H;  1PUF A;  1HW5 A;  2AS5 F;  2JMW A;  3VSL A;  3PNY A;  3GTP J;  1E2X A;  2JSC A;  2JPB A;  1W7P D;  4AVZ A;  2KIQ A;  2EIN H;  5GAH J;  1EJ9 A;  1MW7 A;  5C44 J;  1SFK A;  1ZKG A;  3MZH A;  1W5C C;  1AA7 A;  1IAW A;  4HV6 A;  4BE2 A;  2EZH A;  2NRA C;  1WJE A;  2R0Q C;  5HNH A;  3DBL B;  2W7N A;  3BR2 A;  5LEK A;  3I4P A;  5HDG A;  2JVH A;  2E1O A;  4Y13 A;  1ZK8 A;  3Q0U A;  5FKM A;  2XF6 A;  2TRT A;  1PUE E;  3M07 A;  4DOZ A;  4GFB A;  3MVP A;  4HNT A;  4DJA A;  3MZY A;  4NUB A;  1SFO J;  1OIS A;  2JUC A;  1W4M A;  3VOE A;  2PJR B;  1OR7 C;  1IW7 F;  3VB2 A;  4A3D J;  1ORK A;  4XOP A;  4A69 C;  4E4H A;  3VYR B;  2RQQ A;  1XCB A;  2WAD A;  3K9T A;  3K4M A;  3CCE I;  4LB6 B;  1IN7 A;  5L3B A;  1VQ6 I;  2DA6 A;  3ISP A;  2KDO A;  3HZJ A;  4Y17 A;  2PI0 A;  4E7L A;  1POG A;  2F5C A;  3LA2 A;  1K83 J;  5DYM A;  5L3F A;  3HOV J;  4WXD A;  3QYB A;  2NS7 A;  2CYY A;  4M6V A;  4RLQ A;  3KLO A;  3E1S A;  2K9N A;  3GYH X;  1SMT A;  2QCO A;  5KVR A;  3ZR8 X;  1R23 A;  4M3G A;  3OSG A;  3HOY J;  2GIV A;  5E79 C;  5KHD A;  4ANJ A;  2HYJ A;  1TC3 C;  3GZ6 A;  1WQ2 A;  2YU9 J;  2M3A A;  3JW4 A;  2EIJ H;  1VQO I;  1I3Q J;  3ZQI A;  2E7X A;  1SVL A;  4ZTF A;  2B63 J;  5F6F A;  3A01 A;  1EH8 A;  5ILS A;  3UKG A;  2DOD A;  1FPQ A;  1FMW A;  5M5X J;  2DOF A;  3V7S A;  3TP0 A;  1EH7 A;  3BR6 A;  4Y52 J;  2E36 A;  2OCC H;  2ZXJ A;  5JVT A;  4EGY A;  4A12 A;  5KCM A;  2GM4 A;  5TJJ A;  5L3E A;  3CDL A;  3HTU A;  3H9Q A;  2HPM A;  4N9I A;  4E7S A;  1EV7 A;  1D3Y A;  3DFG A;  2CSO A;  2A6E F;  1WCM J;  5B66 C;  4C30 A;  1VQ8 I;  5KAI C;  5TRD A;  2PMZ A;  2MBF A;  1QZY A;  2CUF A;  5JHF A;  2K02 A;  4AIJ A;  4HRI A;  2L4A A;  1LKX A;  2DYS H;  3I58 A;  1LUJ B;  5L3G A;  2LKP A;  5H20 A;  5LGT A;  4BKX A;  2JSP A;  4CCK A;  2BY2 A;  3OYM A;  4G6T B;  4CIC A;  2CO5 A;  3H3U A;  1QVT A;  5E18 F;  1TT5 B;  1G3T A;  5FLV A;  2NVT J;  4M73 A;  1KQ9 A;  2F2E A;  1BI0 A;  4XLN F;  5BQT A;  3FMS A;  1Z77 A;  1DDN A;  4CZZ A;  2YUS A;  4HPQ A;  5GAD J;  4BY1 J;  4EQQ A;  1A04 A;  3WTZ A;  1LDJ A;  5HNF A;  4HDU A;  3G4S I;  3MFK A;  2K9Q A;  3H3Z A;  1OCC H;  1NHA A;  4LB5 A;  2DMN A;  2ICW G;  3NAR A;  2CW8 A;  2EBI A;  1FYM A;  3DEE A;  1I1S A;  4JOM A;  2W85 A;  3O3K A;  3CJR B;  1Z91 A;  1RI7 A;  1D1A A;  4PFO A;  2GA2 A;  4PK4 A;  4YEL A;  2L01 A;  2DTZ A;  1ZRD A;  2VE8 A;  2HXO A;  2LG4 A;  4HQE A;  3FMQ A;  2DA4 A;  1IXS B;  4N4O B;  1IZ1 A;  1OR7 A;  1JE8 A;  3L1P A;  1R6R A;  2GA1 A;  4L9J A;  3K69 A;  2NVU B;  2M87 A;  2E1N A;  4WX9 A;  1Y1W J;  4O3M A;  2L4M A;  1IV8 A;  1SAX A;  2L9V A;  3A2K A;  2HPI A;  3P9K A;  2L9S A;  3I55 I;  4MEX F;  1MND A;  3KYC B;  3RZD J;  1FIA A;  3BC8 A;  2A5Y B;  2CUJ A;  1S7O A;  1Z21 A;  1GVD A;  4U87 A;  1QQI A;  1UJ8 A;  5LGN A;  1S72 I;  4RAZ A;  3WU2 C;  4LG0 A;  1R4N B;  5L3C A;  2ME0 A;  1S6L A;  1YOV B;  4CO8 A;  4NB5 A;  1O3Q A;  5B1A H;  4EJU A;  1DP3 A;  3KZY A;  2MSY A;  2W57 A;  2XRL A;  4EJO A;  1BIB A;  5A2Q Z;  1JUS A;  2WBM A;  1HSJ A;  3HUG B;  1G3W A;  2ID3 A;  1YS6 A;  4BAY A;  4D7M A;  4BYY A;  3F22 A;  4BGD A;  1IN4 A;  4MGR A;  2F6C A;  3HOU J;  2V9K A;  3DF8 A;  1T2K A;  4HX4 A;  2V4J C;  3MMY B;  3BRO A;  5CPR B;  4ZYE A;  3GTJ J;  1PYV A;  4IPA A;  5K5O A;  5J4Y A;  2BY0 A;  3K70 D;  1N77 A;  1LVA A;  3F8C A;  1YRN B;  2X1C A;  2KL4 A;  2W82 A;  3KPH A;  1YJ9 I;  1WRJ A;  3L2U A;  2EFN A;  1MIJ A;  4IXA A;  1HKT A;  1GV5 A;  4PCQ A;  3S8P A;  2RNJ A;  1P7I A;  2PQ8 A;  3C2B A;  4FT8 A;  4BJT A;  4CCM A;  1LB2 A;  3B6C A;  4EVI A;  1C0W A;  1ACI A;  5FFX A;  3E3V A;  4XID A;  2LK2 A;  1V54 H;  3OYN A;  4BH9 A;  1KYZ A;  5LRR A;  2YSR A;  3ECH A;  1TTY A;  5CKT A;  4G7O F;  3QPS A;  1Z7L A;  2VXD A;  2DAO A;  3BOQ A;  3RKW A;  1ZAR A;  2K9S A;  3PUB A;  1Z6R A;  2H8W A;  3JR9 A;  5D4S A;  2IVM A;  1YW9 A;  4K2E A;  2M34 A;  2CQQ A;  2FUG 2;  2GBY A;  2W24 A;  3CQZ J;  1U8B A;  4YFK F;  1YJN I;  1NH3 A;  1TLH B;  3VDX A;  1WJA A;  3PSF A;  2X6X A;  4Z2Y A;  1CF7 A;  2WB1 N;  3J80 Z;  5E17 F;  3QRF F;  1S9H A;  2R5Y A;  2XVC A;  3RIR A;  2D1V A;  4YIR X;  3LOC A;  1SD7 A;  2FBI A;  2VQL A;  1FNN A;  1FTT A;  1ETO A;  3G3Z A;  2ZKZ A;  1W36 C;  2P0W A;  1BR4 A;  1JTY A;  2KT0 A;  2DA3 A;  2Y9Z A;  1U78 A;  1WJ5 A;  1FIP A;  3HIF A;  2HYF A;  3V8L A;  4GO1 A;  1UG0 A;  1AKH B;  3B02 A;  4ZC3 A;  2X9D A;  2ZNY A;  3F6V A;  3FHZ A;  3W6V A;  1ZN2 A;  1JKP C;  1RUN A;  2H1K A;  2L3D A;  3H9J A;  3DKW A;  3I59 B;  1RIO H;  5EF6 A;  1LJ9 A;  3FXJ A;  4XRS G;  2YPR A;  2XAS A;  3AG4 H;  4R8H A;  2L7Z A;  2YX7 A;  2I10 A;  1IDZ A;  1I27 A;  2Q2E A;  5A2Q K;  4ETS A;  2XRN A;  3DKX A;  4H4K C;  3HHG A;  4Y7N J;  2XAQ A;  2JA2 A;  4A3L J;  2QEN A;  4J19 A;  4HNU A;  1MBG A;  2RGV A;  2OV7 A;  2E1M C;  1IXC A;  1RZ4 A;  3PSI A;  2R5Z B;  3G1O A;  1UEL B;  3OY9 A;  3HOT A;  3FM3 A;  1I39 A;  2XGE A;  4JX6 A;  2RVC A;  2B9S A;  1J5Y A;  3FBN B;  2FBK A;  3FDY A;  3QOE A;  1NK2 P;  4JP0 A;  3PNV A;  3K7A J;  2VL8 A;  1U3E M;  3REO A;  1X3W B;  3CJQ B;  3W2A A;  2UXN A;  4LOC A;  1FP1 D;  3SJM A;  5CVR A;  4A0X A;  3RPQ A;  2QYO A;  4RGU A;  5J4V A;  3M8F A;  3IAS 2;  2ME6 A;  1FBU A;  1D8K A;  3OIO A;  4IF4 A;  2O0Y A;  1RR8 C;  2V26 A;  2O9L A;  3C2G A;  2EJR A;  4NHJ A;  1ZAO A;  2X6Y A;  2AXL A;  4G12 A;  2E60 A;  3ZN1 A;  2VOD A;  2VE9 A;  2EFO A;  1UZC A;  2DJN A;  2R7F A;  1KYW A;  2VJ4 A;  4WF2 A;  5JHU A;  2DA1 A;  2PBI A;  3OL4 A;  4OIR F;  1F43 A;  1J59 A;  1XG1 A;  1QPM A;  4JX4 A;  4IVN A;  3EPZ A;  3JRD A;  3AG2 H;  2ZJ2 A;  2ZME C;  2XC7 A;  2FJ1 A;  4LMY A;  3E6C C;  3GLL A;  4AU7 A;  1K79 A;  3J80 K;  1JHF A;  4EM2 A;  2A5W A;  2EQR A;  2FQ4 A;  2CUE A;  4HYE A;  1GXQ A;  4CZC A;  4PUS A;  3SFZ A;  2E5Z A;  3HOZ J;  5GAE J;  1X4P A;  4ITV A;  3HM5 A;  4HST A;  2EZL A;  4CGZ A;  1J9I A;  2I5U A;  4P96 A;  4E7H A;  2EB7 A;  5BPI A;  2DYR H;  1KU7 A;  2XSD C;  2CFO A;  5HDK A;  1R71 A;  1XDU A;  3U1K A;  4ZYD A;  2ELH A;  3KYL A;  3ZQC A;  3J7A Y;  3BDD A;  5DCM B;  5DTD A;  3DEU A;  3ULQ B;  3R61 A;  2WAQ N;  3B6A A;  1R9T J;  3FXQ A;  4B48 A;  4LJZ F;  1AWC A;  1IN8 A;  4IHV A;  1JTX A;  3U2R A;  3SFI A;  4FTH A;  4CHU A;  2QEX I;  1XMK A;  2MLG A;  5E3N A;  1X2M A;  1WVR A;  2M45 A;  2ZXH A;  2JRT A;  1WI3 A;  4G8X A;  1ERD A;  1YHQ I;  2DMT A;  2EIM H;  2RKH A;  4RS8 A;  3U21 A;  3ESW B;  3CC4 I;  1I6H J;  3FWE A;  3QOP A;  1X4O A;  3MEX A;  1W0T A;  2GXB A;  4ENJ A;  1X1D A;  3WTU C;  2MW8 A;  1A5J A;  2JTV A;  1QNT A;  2KFD A;  1BJZ A;  4M6Y A;  1R00 A;  1VQN I;  2F48 A;  4UVB A;  4A3E J;  4ABZ A;  4EMS A;  4EJT A;  1RES A;  2IS6 A;  3IUO A;  3CCQ I;  1U5T B;  2HEO A;  2V1X A;  1O7F A;  2LBF B;  3W2W A;  2G0E A;  4KDP A;  3BPX A;  2JT1 A;  2R7X A;  2KQR A;  2X4H A;  2K85 A;  4J00 A;  5F1R A;  2GOM A;  2HWV A;  3RKQ A;  1IRF A;  4LK0 F;  1LVK A;  4U0Y A;  3K1P A;  4N4N B;  4OWR B;  1H9T A;  4LG3 A;  2HFH A;  1BIA A;  1LFU P;  3IHU A;  4HA8 A;  2IGM A;  2KRH A;  1XTA A;  5D5U B;  3L7W A;  3JAM Z;  3WHC A;  3N05 A;  5LD2 C;  2ZFW A;  4HX7 A;  2QA4 I;  3UNG C;  4NQW B;  5ED4 A;  5ERI A;  1VQ7 I;  4OOI A;  3FM5 A;  5JLX A;  5F0C A;  5CVU A;  1B72 A;  3JRE A;  3AG3 H;  2LD5 A;  2EIL H;  1R58 A;  1X1C A;  4HF1 A;  3VEP A;  2VPR A;  3KP4 A;  1ZG5 A;  1BJA A;  4BEH A;  4ZZD A;  3GTK J;  5E20 A;  5FKL A;  3ZP5 A;  1WPK A;  3IWZ A;  3NQO A;  4M3F A;  2NYX A;  1X3Z B;  2ZME A;  5E1Z B;  2D2W A;  1WFX A;  2DI3 A;  1OCR H;  1YFH A;  3K2A A;  1SMY F;  1V5F A;  1VQP I;  3HOW J;  3I4M J;  1MSE C;  2NVY J;  3RCO A;  1V3F A;  4FCY A;  3OSF A;  2AQE A;  2ZJP F;  3HYI A;  2IBD A;  1LFB A;  3BJA A;  3S1N J;  1XPX A;  3I9V 2;  2LP0 A;  1RET A;  2X6W A;  1D5V A;  3MWM A;  3C18 A;  1FYK A;  3LSI A;  4XRS A;  4U7B A;  1GT0 C;  3BQY A;  1OCT C;  2CRG A;  3RKY A;  4BQN A;  4E70 A;  3S17 J;  2BY3 A;  3S1Q J;  4FX0 A;  2IJL A;  4L0Z B;  3HGY A;  1MMN A;  5CVV A;  3VFZ A;  4G6D A;  1LE8 A;  4QPQ A;  1IC8 A;  3SEQ A;  5FLM J;  3I5U A;  3ZGK A;  4HF0 A;  5KAF C;  2VC1 A;  2IPQ X;  1F36 A;  3R60 A;  3WGH A;  3W3C A;  1IUF A;  3H5A A;  2R7S A;  1O3T A;  1H9G A;  1OFC X;  4PJJ A;  2P5L C;  2HQ5 A;  1Z3X A;  3CES A;  3NWS A;  1IN6 A;  3BZ6 A;  2QSG X;  5EYR A;  1B9M A;  4KIT B;  5DV5 A;  3VWB A;  2WAE A;  3FXK A;  1XN7 A;  4UUS B;  2QSH X;  3NAU A;  1KQ8 A;  2W84 A;  2GXG A;  3L2V A;  2EFW A;  3LQR A;  1N75 A;  1LDK B;  3T8T A;  1GUU A;  4BE1 A;  6PAX A;  3RYP A;  3K4K A;  4JYK A;  3CO7 C;  2VLA A;  1JT0 A;  1JGG A;  3QPT A;  2XGD A;  1DU0 A;  2WV1 A;  3BP8 A;  1KZH A;  5EGO B;  1ZLK A;  1KON A;  3CD6 I;  3EYI A;  2H94 A;  2XIG A;  1LPQ A;  2VKE A;  1VZ0 A;  3QPL A;  3COA C;  2RDP A;  3JAM K;  2UXX A;  4EGZ A;  4F52 A;  4I99 C;  1TP4 A;  2QLZ A;  5EEH A;  4I01 A;  4B8X A;  2L02 A;  1NK3 P;  2D5V A;  5HLG A;  2P5K A;  2XAF A;  4Q48 A;  2Y30 A;  1ZQ3 P;  2H6B A;  3I4N J;  2L0K A;  2NAZ A;  3ABU A;  1MMD A;  4XSX F;  2HI3 A;  2QQ9 A;  3SHF A;  3OYF A;  3OS0 A;  1SFU A;  2VJI A;  1X58 A;  5HOD A;  4IOC F;  1GV2 A;  1I1G A;  4ZDL A;  1W5S A;  2IA0 A;  1N25 A;  2BV6 A;  2BHY A;  1H89 C;  3IRQ A;  1W7P B;  3SZP A;  4A3J J;  4S05 A;  5DUK A;  2EPF A;  4HSR A;  2XKO A;  3I56 I;  2HDD A;  3J7A O;  3HC7 A;  4V2F A;  4RDU A;  2XF7 A;  1U0J A;  1YS7 A;  3RKX A;  1GVJ A;  4E7J A;  1XGS A;  1ZTR A;  5GPA A;  4D5F A;  4ENK A;  5K1Y A;  4RMN A;  2X0L A;  3X2Q H;  1SD5 A;  3OOP A;  1HA8 A;  3JSP A;  1A36 A;  3S93 A;  3GUD A;  3DV8 A;  3K10 A;  1MDM A;  2IP2 A;  3ABL H;  4MIM A;  3QOD A;  2NVX J;  2PN6 A;  3JTG A;  5D5X B;  4LFU A;  3T0Y A;  4GRI A;  5AIP A;  4KMF A;  2B0L A;  2VBW A;  1VI0 A;  1OJL A;  4D5C A;  2JK3 A;  3K2Z A;  4YFN F;  3OWT A;  4A3M J;  4FX4 A;  4RGR A;  1LEB A;  2A61 A;  2HTS A;  4KT5 C;  4CCL A;  3DLL F;  4Y3O A;  1H0M A;  2BXY A;  1EF4 A;  3OYL A;  3MD2 A;  2HKX A;  3G73 A;  4BHP A;  3JSO A;  3PO3 J;  1T39 A;  2IS2 A;  2RN7 A;  1HKS A;  3DPL C;  2F5F A;  4GXO A;  4RAY A;  4MNU A;  1OYY A;  5KK1 A;  3TO7 A;  1KQ0 A;  4HQM A;  4P9U A;  3TOA A;  4RLF A;  4LLN A;  3A4C A;  5IPA A;  2HXI A;  3FF5 A;  4BQA A;  1DGW Y;  4YIF A;  3N97 A;  5DM7 F;  2IA2 A;  3IWF A;  1R7J A;  5J47 A;  4Q5S F;  2FML A;  4A3B J;  1WH7 A;  3ASO H;  3ZQH A;  1USS A;  3CJN A;  1Z0X A;  3S14 J;  3WU1 B;  4G94 A;  1FOY A;  5HLI A;  2NXN B;  2LR8 A;  5ICE A;  4XOR A;  1G2H A;  1JJ8 C;  5H2F C;  1XGM A;  4WCG A;  1KA8 A;  2VUM J;  2CH0 A;  1XC5 A;  2EV0 A;  4XKB A;  2Z2S B;  4RM3 A;  5EG0 A;  5HLH A;  2QGU A;  1JUP A;  4TV7 A;  4DIQ A;  1K78 B;  1R1U A;  3S3N A;  3QU3 A;  1TQM A;  1T0F C;  2HDW A;  1UCR A;  3LQQ A;  4HG2 A;  5EJC A;  4BAC A;  2RAE A;  3CC2 I;  3AG1 H;  3L09 A;  2QBY A;  3KYD B;  5K5R A;  3H5N A;  2XAU A;  4HAM A;  1P4W A;  5F64 A;  4QWQ A;  4BHC A;  2KKO A;  2XAH A;  3ZCO A;  5M5Y J;  1OPC A;  3DTI A;  3JRH A;  4OIN F;  1ZGA A;  3A03 A;  3IH4 A;  4GDF A;  1D0Y A;  4O5V A;  5M5W J;  2BXZ A;  2KIU A;  1Y39 A;  3E5Q A;  1YLF A;  2A6T A;  4CDG A;  3RPU D;  5JLW A;  1B8I B;  1E17 A;  4LIV A;  2R7R A;  2HVS A;  3FXM A;  1Y0N A;  1W36 D;  2AHQ A;  2JPC A;  1T8I A;  1Y6I A;  4FET A;  1VQK I;  2MGQ A;  3G6E I;  2WTE A;  4DW6 A;  1ZH5 A;  3DU5 A;  5IP7 J;  2PJP A;  1QZZ A;  3E5X A;  2D1H A;  2M7B A;  2M4K A;  3QU6 A;  4BBS J;  2CGP A;  3IRR A;  4CYC A;  4IQJ A;  3BTL A;  5K5Q A;  4P9F A;  3M1E A;  1WJB A;  1XDS A;  1KU3 A;  2OZU A;  2Z3Y A;  2OJE D;  3K0L A;  3WTV C;  1A31 A;  4GYI A;  2GZW A;  3LWF A;  3EUA A;  4XKW A;  1VQ4 I;  3JCU C;  1D0X A;  1T6S A;  2Y0S A;  3WTY C;  3QQA A;  4AC0 A;  1H8A C;  4IHW A;  4FIS A;  4HX8 A;  4XLA A;  4KYW A;  2DJI A;  2E1M B;  1HST A;  1YW8 A;  2KRC A;  2XF5 A;  2A6H F;  3BR3 A;  2F4M B;  2OUM A;  1HLV A;  2CQX A;  3WGI A;  2HQA A;  3BZK A;  1P4X A;  3QAH A;  3TED A;  3HL2 A;  3RSN A;  5J1Y A;  3OR2 C;  4F93 B;  2VBX A;  1J7K A;  5IOZ A;  4XQF A;  1PP8 F;  4ENM A;  2L7K A;  3L00 A;  4EEF G;  3IH2 A;  1JI8 A;  2MH2 A;  1UB9 A;  4I2O A;  3Q0V A;  1FTZ A;  2EA2 A;  3TOB A;  4JX5 A;  2QQ8 A;  4LLL A;  4M71 A;  3VOD A;  5F08 A;  3CMM A;  1H88 C;  2X85 A;  3T8R A;  1IRG A;  2ZNZ A;  2W1O A;  2BVM A;  4YG2 F;  5DCF A;  3C2H A;  4V2G A;  2QQA A;  4QTR A;  2BW3 B;  3AKZ A;  4BE0 A;  1FY7 A;  4HZF A;  1P2F A;  3OYA A;  4KMU X;  3ZMS A;  1FSE A;  4NNJ A;  2ZXI A;  3LFK A;  3OL3 A;  1EKE A;  2EK5 A;  3BJO A;  4NC7 A;  1DGR M;  3SZT A;  2VOO A;  1UST A;  3K4N A;  4IJA A;  5FKO A;  3S1M J;  2EA4 A;  1K61 A;  2Q0O A;  3PL8 A;  1IF1 A;  4CXF A;  2OTL I;  1G4D A;  3GTQ J;  1T0F A;  2X48 A;  2FRH A;  2QKL B;  3UR3 C;  3CUQ B;  3IH3 A;  3HDD A;  3OYI A;  2MAB A;  5IP6 A;  2VQC A;  2VKD A;  1K7A A;  1YX5 A;  1R1V A;  1FBQ A;  2KIM A;  3ZMV A;  2P6T A;  2F4O B;  3FBI B;  2CW0 F;  3V7R A;  2O8K A;  4HV5 A;  4FQG A;  4Q47 A;  2GIZ A;  2IS1 A;  2ZCW A;  4LIT A;  3SQN A;  5D8L B;  3CC7 I;  3PIP F;  3L2W A;  3FHN A;  5LLQ A;  2DTR A;  4AYB N;  2O61 A;  4IO9 F;  2LY9 A;  4RGS A;  4WWC A;  4Z6Y A;  4I09 A;  2DA5 A;  3WGG A;  3ZPL A;  4YII A;  4QIW N;  3J81 Z;  4A2U A;  1Z6T A;  2OQG A;  4IHX A;  4DZJ A;  3HRM A;  3BG7 A;  4PGG A;  2L9R A;  4A6E A;  4CCN A;  2XKP A;  2KIF A;  3BTJ A;  2BHZ A;  1XD7 A;  4XLC A;  2M4G A;  4WK8 F;  4BXX J;  1ON2 A;  3I64 A;  4XL9 A;  3OS1 A;  1SFE A;  1ZG1 A;  2ESH A;  2G7H A;  4M9S A;  3GTO J;  3E6M A;  3OYK A;  2WA0 A;  1UG2 A;  1Y1V J;  2E5N A;  2DFF A;  1WWX A;  2GLO A;  5BPD A;  3HXL A;  2OCE A;  1SAU A;  4B43 A;  3SYT A;  4YFX F;  2VQH A;  5EGO A;  5FKN A;  1QHG A;  2XB0 X;  4ZH4 F;  4IZZ A;  4C2U A;  3F8M A;  5IT3 A;  4KIF A;  3R0J A;  1WHU A;  1R49 A;  5GTI C;  3IC7 A;  4GGG A;  1S7A A;  4IHY A;  3GFJ A;  1R4M B;  4MFD A;  2EIK H;  3ZN0 A;  1BR1 A;  3ZQL A;  3ABT A;  4F91 B;  2LNB A;  2LKX A;  2HZD A;  3G1L A;  2O3F A;  2P8T A;  2EZI A;  4PSX A;  4IX7 A;  1BA5 A;  2VAS A;  3MN2 A;  1PP7 U;  4F7Z A;  1V4R A;  3VPR A;  2HQR A;  1XCV A;  2JRM A;  4ZYA A;  4ESB A;  1MZB A;  1PUF B;  1XSX A;  1WKM A;  5IY5 H;  4E6K G;  1IRX A;  3EYY A;  3WE2 A;  3LSP A;  1VND A;  2FE3 A;  3JRF A;  9ANT A;  3FKJ A;  3Q5F A;  5J1R A;  2BZT A;  4AD9 A;  2LY2 A;  2VN2 A;  4UVA A;  2XUB A;  5HS7 A;  4KFC A;  3PQJ A;  1R22 A;  1Q1V A;  3OYH A;  4M9X A;  2XAG A;  4EAT A;  3FMR A;  2ZJR F;  2PJR A;  2V1D A;  1MMG A;  3W6K B;  2ECB A;  2R7Q A;  2IXS A;  1BI2 A;  1FBS A;  3ZQF A;  3F6O A;  1CQT A;  1RC9 A;  2CFX A;  2JZY A;  2F4I A;  1SD4 A;  4A6D A;  4A3C J;  2K9M A;  3BCA A;  1UAA A;  2V1U A;  1SEU A;  3KP6 A;  4G7Z F;  3F8F A;  4B3A A;  1EH6 A;  2HNH A;  3KFW X;  3KCC A;  4MFE A;  1FX7 A;  2K86 A;  4XN3 A;  3AAF A;  3NWT A;  1TQP A;  2RNG A;  2IT0 A;  3GTM J;  3FXU A;  1ON1 A;  2J5O A;  2KZV A;  5FB2 A;  3J81 K;  3N4M A;  3LA3 A;  1OCP A;  1ENH A;  2OAZ A;  3PFI A;  1LNW A;  3V8J A;  4A0Y A;  1XGN A;  4RGX A;  1PDN C;  2QQB A;  1GXP A;  3D5R C;  4RB3 C;  2JN6 A;  3WOD F;  3GX4 X;  3H3V K;  3T5X A;  2EFP A;  5IYB J;  3CF2 A;  2STT A;  3VSK A;  2X1D A;  1MKM A;  1SAN A;  3MKY B;  4AM3 A;  1E3P A;  5H6Q A;  1VQ5 I;  1J2X A;  1ZRE A;  2L54 A;  1WJD A;  1YIT I;  3CCS I;  3AL0 C;  4UB6 C;  3BG3 A;  2ID6 A;  3GZ5 A;  3A01 B;  4I7H A;  3K1M A;  2IGK A;  1CGP A;  1V5E A;  3HEF A;  3ZMD A;  2NS0 A;  3E5U A;  3DLA A;  1E0E A;  1JUM A;  3M8J A;  1BC8 C;  2DK5 A;  1Y56 A;  2OC6 A;  4L5E A;  2DCE A;  2E19 A;  1G6N A;  2PFB A;  3ERM A;  4I02 A;  1QHH D;  1IRZ A;  5D4R A;  4Q4Z F;  3D0S A;  1X1P A;  3RI4 A;  4WXC A;  4RBO A;  1YTY A;  2R7V A;  1YYV A;  4F3Q A;  3K6G A;  4DQ2 A;  1JHH A;  5IYC J;  5DM6 F;  4KIC A;  2N8G A;  1JGS A;  3GLX A;  3WU0 A;  3OYG A;  3HJE A;  1X2N A;  4BUP A;  3WTW C;  4A3G J;  3G2B A;  3FK7 A;  2PG4 A;  5B1B H;  2P6S A;  4X1E A;  1FSH A;  1DPR A;  1QO0 D;  4EM1 A;  2V9P A;  1A6I A;  3L2Q A;  1HQC A;  1S29 A;  2WAF A;  4XRF A;  2A07 F;  2KDZ A;  1JJ6 C;  2QSF X;  4RM2 A;  1YE9 A;  1DQU A;  3F9K A;  3QP5 A;  4B3X A;  2M0C A;  3GFL A;  5F0H A;  1S3J A;  4AWX B;  3MKZ A;  4E7Z A;  3CME I;  1MMA A;  5CVI A;  2EV6 A;  1WJC A;  2GAU A;  4G9Y A;  4R79 A;  2Z16 A;  4IL6 C;  2ZB9 A;  1SVO A;  2JA5 J;  2V1N A;  1J09 A;  1P9Q C;  4UUV A;  3GXO A;  4XN0 A;  1IUY A;  3E0J B;  2IGO A;  3H9G A;  2K27 A;  5ICF A;  1R36 A;  1S7E A;  2Z9O A;  1ZG3 A;  3HSR A;  1ETX A;  1TT0 A;  3DBR B;  4A5N A;  4B47 A;  4BNC A;  3A0B C;  1ETV A;  2XPW A;  1SFX A;  4XNF A;  1O4X A;  4NDL A;  2VXZ A;  1EA3 A;  3EUH A;  2XGX A;  2CU7 A;  1MSF C;  3KP7 A;  2M5W A;  2R7U A;  2MH9 A;  3BT9 A;  3H35 A;  2M1B A;  3BR5 A;  5J1U A;  1O3R A;  3I0T A;  3HTS B;  4RB2 C;  1X19 A;  4L5I A;  1MH4 A;  5DEQ A;  1J75 A;  4LG0 B;  4IQ4 A;  2Y48 A;  4BDZ A;  3NEU A;  4C3I J;  4L9N A;  3TBI A;  2WWY A;  4S0H B;  1K6Y A;  5D6F A;  5IP9 J;  3TDU C;  3OS2 A;  3HUG A;  3ABK H;  3ML6 A;  1MJ9 A;  1ZR4 A;  4AID A;  5FJ8 J;  4PGH A;  5J3L A;  2VT2 A;  4BBR J;  3TDZ C;  5E3O A;  3D1N I;  2M8E A;  3ONQ A;  1SD6 A;  2E2I J;  3CP8 A;  3BTC A;  2CS3 A;  3ABM H;  1U9O A;  2KJC A;  2DFI A;  1ZEL A;  5FRO A;  2KMU A;  3OYC A;  2MA3 A;  3E6B A;  4PJ0 C;  5F27 A;  2OU2 A;  2WY8 Q;  1YRN A;  2JA6 J;  1Y8Q B;  1D0Z A;  4UUT A;  1LEA A;  4HLY A;  1B4A A;  1UFM A;  1G8X A;  1BOA A;  5E8G A;  1BR2 A;  3S2W A;  4C3H J;  2R7O A;  4LK1 F;  1LFP A;  3IKV A;  3GVA A;  2DMQ A;  2V7F A;  2HS5 A;  4KIG A;  3NRV A;  4PJL A;  1Y8R B;  4AVP A;  3ZMZ A;  3Q3S A;  3RZO J;  4G6Q A;  2PMZ N;  3MKL A;  2UWM A;  2J5P A;  2KIS A;  2R3S A;  2VPL A;  1BC7 C;  4DBQ A;  5C3E J;  5EZH A;  1QGP A;  4ZTJ A;  5J8F A;  2LYC A;  1HC8 A;  2B7E A;  3GFM A;  1BBY A;  2V79 A;  2H09 A;  4IKF A;  5M3F J;  3PNT A;  4GCV A;  3HGG A;  3S15 J;  4BY7 J;  2KPM A;  3WTT C;  2RC4 A;  1K4S A;  2H1L A;  1HCR A;  1HW2 A;  1MBK A;  4BQO A;  3CTA A;  3F72 A;  2A3S A;  1B9N A;  3A0H C;  4BQQ A;  1QZE A;  4C3J J;  1F4K A;  1IGN A;  4BDY A;  3OR1 C;  3PIO F;  1MNM C;  2VOP A;  2HKO A;  1CF7 B;  2H8R A;  3H5R A;  3SXY A;  5E1W A;  3T1B A;  1ETW A;  2R5Y B;  1XMX A;  2YX4 A;  5F1J A;  2H27 A;  3LA7 A;  1AKH A;  3QYF A;  1HXD A;  5E3M A;  1KGS A;  1NTC A;  2FNP A;  4MO7 A;  5E1X A;  3O6B B;  3VYT B;  3HRS A;  3I59 A;  5GP9 A;  4KUM A;  3LAJ A;  3K4J A;  3ZMU A;  1R5G A;  3KEO A;  3C3W A;  1NG7 A;  2CMP A;  2HU9 A;  4I6Z A;  4XKV A;  2XRO A;  2DDA A;  1YG2 A;  2HOE A;  3HSE A;  3H0G J;  4DYC A;  1ZHF A;  5AON A;  3HKZ A;  2QM3 A;  5LHI A;  2MC4 A;  2Q2E B;  1LQ1 A;  4M3E A;  2R5Z A;  2L7M P;  2X6O A;  3ELK A;  4B44 A;  4XOT A;  1D5Y A;  1U5T C;  4U0W A;  4XLE A;  3CCJ I;  1TL8 A;  3RQ4 A;  4DYQ A;  2COB A;  2ISZ A;  2QWW A;  3WG7 H;  4S04 A;  4OMY A;  1HW1 A;  2XPU A;  2JA8 J;  1FEX A;  2BY1 A;  3MKW B;  3WHB A;  1YIO A;  4C2M J;  1Z3Y A;  2O03 A;  4DNC A;  3JRC A;  2P81 A;  4HOB A;  5LEJ A;  5HDN A;  2DU9 A;  5FRN A;  4Y15 A;  1RKT A;  2DOA A;  5L3D A;  4L9V A;  3WTS C;  1ZRF A;  2ZSI B;  2NVQ J;  3U1D A;  3OOU A;  5D5V B;  1VQM I;  4OIP F;  4XKC A;  3TQN A;  2V6E A;  1VF9 A;  2DFH A;  2FD5 A;  2P4W A;  2LMD A;  2OPT A;  3ZXS A;  4KA4 A;  1L3L A;  1O7L A;  1WJF A;  2LRD A;  2BBY A;  2XV4 S;  3MAJ A;  4XLP F;  1FYL A;  1ETK A;  5LFA A;  2L5Q A;  3ZQG A;  3LMM A;  4L5J A;  3F23 A;  1UHM A;  2ECC A;  2ZBK A;  1ETY A;  1GLN A;  5FKK A;  2KJB A;  3CF5 F;  5EEA A;  2K9L A;  1Q1H A;  1RNL A;  1HDP A;  3LSG A;  4KJZ A;  4B1R A;  4IEJ A;  2QVO A;  2VT3 A;  5JR3 A;  2E2J J;  1QU3 A;  2RV8 A;  3W6J B;  2ESN A;  2K3F A;  2VI6 A;  3KE2 A;  2AO9 A;  2VQG A;  2UZK A;  2E2H J;  3GBG A;  2M30 A;  4OU0 A;  1I6X A;  2VKV A;  2HOT A;  5LGU A;  4CSW A;  3H0D A;  1VQ9 I;  3FK6 A;  1PJR A;  2FA5 A;  3CCM I;  4PJN A;  3OV8 A;  3KLN A;  2R7W A;  2OBP A;  3BCB A;  1JXS A;  3CUO A;  1SC7 A;  2KHM A;  4IHT A;  4DBR A;  2R92 J;  4NBQ A;  5CYV A;  2KRF A;  3OYJ A;  1FMV A;  3FXL A;  1AOY A;  4U0V A;  2JA7 J;  4OIQ F;  4AIK A;  3DTE A;  4MQ9 F;  3TKY A;  1JT6 A;  1MJB A;  2Y9Y A;  3BJ6 A;  5DCM A;  2DLL A;  1TNT A;  3JRG A;  2HVQ A;  3S2D J;  5ICC A;  2MC3 A;  2RRE A;  2QF7 A;  4QPO A;  3VYS B;  4CH7 A;  2LKS A;  1M1E B;  2FX0 A;  1U8R A;  4HDV A;  4KN4 X;  4PJM A;  4DGW B;  3BR1 A;  2DW4 A;  1XX5 A;  3GWZ A;  1REP C;  4CCJ A;  3M9A A;  1UMQ A;  4XR6 A;  3IL2 A;  5LRS A;  3HSF A;  4N0B A;  1K4T A;  1V5G A;  1DU6 A;  2STW A;  4RB0 A;  2A05 A;  3IKT A;  3TGN A;  3KZZ A;  3GTL J;  2G7U A;  3DKY A;  2XDV A;  2LF8 A;  2Z33 A;  1XSV A;  1HDD C;  2K4B A;  3HBL A;  1FOW A;  3FZV A;  1JKR C;  3E97 A;  3LSM A;  5E3L A;  2BE5 F;  3FIW A;  3WTX C;  5K7F A;  3CCY A;  3JTH A;  3OIP A;  4M9Z A;  3TO9 A;  1U5T A;  5J8C A;  3FXR A;  1FOX A;  3IP4 B;  5AIQ A;  1E3O C;  3U9G A;  2W25 A;  2LBF A;  1Z05 A;  4A3K J;  4KNY A;  4KN7 X;  3M3Y J;  5ILU A;  2ELJ A;  5B5E C;  4Y4R A;  1B6A A;  2PEX A;  2UUZ A;  4BU2 A;  1FT9 A;  1XMA A;  3IV5 A; 
#chains in the Genus database with same CATH homology
 1AHD P;  3VPR A;  1PUF A;  2JMW A;  2LFB A;  3JRB A;  3GTP J;  3RKQ A;  2HOA A;  1PUF B;  4A93 J;  5C44 J;  3LSP A;  1ZKG A;  1VND A;  3JRF A;  9ANT A;  2Y2Z A;  1LFU P;  2EZH A;  2R0Q C;  5J1R A;  3TW7 A;  3BR2 A;  3WHC A;  2E1O A;  4XIC A;  1ZK8 A;  3DCF A;  1QRY A;  3Q0U A;  5FKM A;  1BL0 A;  3ZOB A;  1Q1V A;  2TRT A;  5JLX A;  5F0C A;  3MVP A;  4GFB A;  3S16 J;  1B72 A;  3JRE A;  2LD5 A;  1SFO J;  2ECB A;  1B72 B;  3JRI A;  1FJL A;  2HOS A;  3ZQF A;  1CQT A;  4A3D J;  1ORK A;  2VPR A;  4A69 C;  1ITY A;  1TWF J;  3GTK J;  5FKL A;  4A3C J;  3BG5 A;  1WPK A;  4M3F A;  1MH3 A;  2XB5 A;  2DA6 A;  4B3A A;  4MFE A;  1POG A;  1K83 J;  3K2A A;  3HOV J;  3GTM J;  2NS7 A;  4M6V A;  3HOW J;  2K9N A;  3I4M J;  2QCO A;  1OCP A;  1ENH A;  1MSE C;  4M3G A;  3LSR A;  3OSG A;  2NVY J;  3HOY J;  5C4J J;  4FCY A;  3OSF A;  2JN6 A;  2HYJ A;  1TC3 C;  2IBD A;  1LFB A;  3H3V K;  3S1N J;  2YU9 J;  3PM1 A;  5IYB J;  2DMU A;  1RET A;  2LP0 A;  2XPV A;  4X6A J;  1I3Q J;  3ZQI A;  4XRS A;  1SAN A;  1GT0 C;  3BQY A;  1OCT C;  2CRG A;  3S17 J;  2B63 J;  3S1Q J;  3HGY A;  3A01 A;  3UKG A;  5M5X J;  3BG3 A;  2ID6 A;  3TP0 A;  3A01 B;  3BR6 A;  1LE8 A;  4Y52 J;  1ETQ A;  1IC8 A;  5FLM J;  2EZK A;  3HEF A;  1LE8 B;  2GM4 A;  2R93 J;  1F36 A;  1JUM A;  1IUF A;  3CDL A;  4L5E A;  2E19 A;  1GDT A;  1OFC X;  1IRZ A;  1WCM J;  2HQ5 A;  4RBO A;  4UUS A;  5EYR A;  1IDY A;  2CUF A;  2NS8 A;  4M3B A;  5IYC J;  4UUS B;  3NAU A;  5DS9 A;  2L7F P;  1JKQ C;  2N8G A;  1GUU A;  4BKX A;  1X2N A;  4A3G J;  1IJW C;  1APL C;  4DZP A;  3FK7 A;  4JYK A;  1QVT A;  1JT0 A;  1JGG A;  2R7Z J;  4X1E A;  3HB9 A;  2XGD A;  1DU0 A;  2WV1 A;  5EGO B;  5FLV A;  2NVT J;  1A6I A;  2VKE A;  3QPL A;  1Z77 A;  2YUS A;  4BY1 J;  2KDZ A;  1JJ6 C;  5GPC A;  1NK3 P;  2D5V A;  4DYR A;  2Y30 A;  1ZQ3 P;  3I4N J;  4AUX A;  2K40 A;  2M0C A;  2L0K A;  5F0H A;  2HI3 A;  2K9Q A;  2DMN A;  3NAR A;  2EBI A;  1TWA J;  1X58 A;  5HOD A;  1TWG J;  1GV2 A;  2LTP A;  2ZB9 A;  3CMY A;  1H89 C;  2JA5 J;  4A3J J;  1XS9 A;  2DTZ A;  1UHS A;  3S1R J;  3M4O J;  2LVS A;  2HDD A;  2HXO A;  4V2F A;  3A02 A;  4A3I J;  1WGX A;  4RDU A;  2DA4 A;  1S7E A;  1JKO C;  5K7H A;  1ETX A;  3L1P A;  1ZTR A;  5GPA A;  1MBH A;  4D5F A;  1Y1W J;  3HOU J;  5K7Z A;  1ETV A;  2XPW A;  2YS9 A;  4M3D A;  3O8H A;  4NDL A;  1O4X A;  3BR0 A;  3RZD J;  1VFC A;  1FIA A;  2CU7 A;  1MSF C;  4MIM A;  3BT9 A;  2NVX J;  1GVD A;  3BR5 A;  1QPI A;  5J1U A;  1VI0 A;  1OJL A;  2ELK A;  4D5C A;  1MH4 A;  2JK3 A;  2ME0 A;  2LLK A;  4A3M J;  5EDN A;  4C3I J;  5C4X J;  3GTG J;  2DA2 A;  1EF4 A;  5IYD J;  4S0H B;  3BG9 A;  5IP9 J;  2MG4 A;  2MSY A;  2XRL A;  3PO3 J;  1JUS A;  5F0F A;  2JWT A;  2ID3 A;  1ZR4 A;  4D7M A;  5FJ8 J;  5J3L A;  4BBR J;  5IPA A;  2HXI A;  5E3O A;  3D1N I;  2E2I J;  3BTC A;  1U9O A;  4A3B J;  1WH7 A;  3ZQH A;  3LSJ A;  1HOM A;  2NOG A;  1Z0X A;  3GTJ J;  3S14 J;  2O7O A;  4W1U A;  2LR8 A;  1G2H A;  1JJ8 C;  1W0U A;  5F27 A;  1YRN A;  2JA6 J;  4UUT A;  1YRN B;  2VUM J;  1WH5 A;  1XC5 A;  1RPW A;  5EG0 A;  4C3H J;  1JUP A;  1GV5 A;  5EG0 B;  2DMQ A;  2M2E A;  1P7I A;  3C2B A;  3B6C A;  3Q3S A;  2RAE A;  1MBJ A;  3RZO J;  4XID A;  2LK2 A;  2PMZ N;  3MKL A;  1QVU A;  2IAI A;  5C3E J;  3E7L A;  3QPS A;  5M5Y J;  5EZH A;  4A3F J;  2K9S A;  3JRH A;  3IH4 A;  3A03 A;  3JR9 A;  5M3F J;  2M34 A;  2CQQ A;  5M5W J;  3HGG A;  1B8I A;  3S15 J;  4BY7 J;  2GBY A;  4FE7 A;  4HNV A;  3CQZ J;  1U8B A;  1HCR A;  1MBK A;  5JLW A;  1B8I B;  4C3J J;  1IGN A;  2AHQ A;  2WB1 N;  1MNM C;  2MGQ A;  5IOY A;  1TWC J;  2R5Y A;  1HF0 A;  4DW6 A;  3G1M A;  5IP7 J;  2H8R A;  1IG7 A;  3LOC A;  1ETW A;  2R5Y B;  3TW6 A;  5F1J A;  5M3M J;  1FTT A;  1ETO A;  4XK4 A;  2JJ7 A;  4BBS J;  2Y9Z A;  1JTY A;  2KT0 A;  2DA3 A;  4CYC A;  1U78 A;  1AKH A;  1FIP A;  5E3M A;  1NTC A;  4CYC B;  3BTL A;  4MO7 A;  1AKH B;  1TWH J;  2X9D A;  3W6V A;  5GP9 A;  1JKP C;  2H1K A;  4MLO A;  1ZR2 A;  5EF6 A;  4XRS G;  3QQA A;  4I6Z A;  4AC0 A;  1H8A C;  2L7Z A;  4IHW A;  4FIS A;  3HKZ N;  4D7N A;  2I10 A;  1IDZ A;  3H0G J;  3BR3 A;  4DYC A;  1HLV A;  2CQX A;  4Y7N J;  4A3L J;  4J19 A;  3TED A;  4M3E A;  1MBG A;  5J1Y A;  2R5Z A;  4FE4 A;  2L7M P;  2X6O A;  1D5Y A;  5IOZ A;  2R5Z B;  5F04 A;  4DYQ A;  2COB A;  2EH3 A;  4EEF G;  3IH2 A;  3G1O A;  3Q0V A;  1FTZ A;  4JX5 A;  2XGE A;  2XPU A;  4JX6 A;  5BNG A;  1BW5 A;  2JA8 J;  1FEX A;  3PO2 J;  3WHB A;  5F08 A;  4C2M J;  3JRC A;  1MBE A;  2P81 A;  1P7J A;  2W48 A;  1NK2 P;  1H88 C;  4JP0 A;  3K7A J;  1RKT A;  1T56 A;  1BW6 A;  2NVQ J;  4W97 A;  3OOU A;  4V2G A;  4QTR A;  4LOC A;  1VF9 A;  2FD5 A;  3SJM A;  3BTI A;  4B4C A;  2OPT A;  2IEK A;  2ME6 A;  3OIO A;  3TP3 A;  1IV6 A;  2O9L A;  3JRA A;  3BQZ A;  1ETK A;  4G12 A;  5FKO A;  3S1M J;  3ZQG A;  1K61 A;  2CJJ A;  2ECC A;  3O8G A;  1ETY A;  2DJN A;  5FKK A;  2XGC A;  2DN0 A;  2DA1 A;  3GTQ J;  1F43 A;  2X48 A;  1XG1 A;  3SDG A;  5EEA A;  3FIS A;  3F0C A;  4JX4 A;  1U9N A;  4I76 A;  3IH3 A;  1HDP A;  3LSG A;  3HDD A;  4B1R A;  3JRD A;  4IEJ A;  5IP6 A;  3HOX J;  2E2J J;  2OF7 A;  2FJ1 A;  3FKI J;  2VI6 A;  2E2H J;  2AO9 A;  2DMP A;  3GBG A;  2VKV A;  2HOT A;  2EQR A;  5EZG A;  2FQ4 A;  2O8K A;  3FK6 A;  2CUE A;  3LNQ A;  2Y31 A;  3HOZ J;  4AYB N;  2R92 J;  2LY9 A;  3HM5 A;  2EZL A;  3Q0W A;  2JA7 J;  2DA5 A;  2XSD C;  4QIW N;  4IHX A;  1JT6 A;  2Y9Y A;  4DZJ A;  1ZGW A;  2DA7 A;  2L9R A;  3BTJ A;  3ZQC A;  3JRG A;  4BXX J;  3S2D J;  5DTD A;  2QF7 A;  2WAQ N;  3B6A A;  1R9T J;  4IHV A;  2FX0 A;  1JTX A;  3SFI A;  4FTH A;  3GTO J;  4XRM A;  3BR1 A;  2TCT A;  1T33 A;  1UG2 A;  1Y1V J;  1UMQ A;  1X2M A;  5E3N A;  2GLO A;  1MBF A;  1WI3 A;  4QSH A;  3S2H J;  2DMT A;  1DU6 A;  5EGO A;  5FKN A;  1RKW A;  3DEW A;  1I6H J;  2M8G X;  3GTL J;  2XB0 X;  1HDD C;  2Y0S N;  1W0T A;  3HBL A;  3RQI A;  1JKR C;  2MW8 A;  1A5J A;  5E3L A;  3FIW A;  1BJZ A;  5K7F A;  1AU7 A;  1I50 J;  3CCY A;  4IHY A;  4A3E J;  4MFD A;  4ABZ A;  1RES A;  1E3O C;  4A3K J;  3ZQL A;  2LKX A;  3M3Y J;  3G1L A;  2M9H A;  2EZI A;  2G0E A;  1BA5 A;  3MN2 A;  1RR7 A;  3IV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...