1SFUA

Crystal structure of the viral zalpha domain bound to left-handed z-dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*T*CP*GP*CP*GP*CP*G)-3'
publication title A poxvirus protein forms a complex with left-handed Z-DNA: crystal structure of a Yatapoxvirus Zalpha bound to DNA.
pubmed doi rcsb
source organism Yaba-like disease virus
total genus 17
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sfuA00
3MFKA 1KU9A 2RGVA 1ULYA 4WXHA 3FMSA 2PI0A 3QP5A 3M1EA 2VT2A 4AIJA 1JGSA 3REOA 1X3UA 4R8HA 1ZG3A 1ZGJA 1MZBA 2DK5A 2QQ9A 1HW2A 3E5XA 2O0YA 4BQAA 1YS7A 3MCZA 4HA8A 2RNJA 5ILUA 3RYRA 1SMYF 5JVTA 2PBIA 2ISYA 4HX7A 4Z2YA 4LLGF 2A3SA 2HGCA 2NAZA 1ON1A 3LFKA 2VC1A 3GVAA 2VBYA 2EFQA 2PQ8A 3KP5A 1LQ1A 3LQQA 4HZFA 1J59A 2ISZA 1KQ9A 1BJAA 1FP2A 4GXOA 4HW0A 3HHGA 3J80Z 1MD0A 3DXJF 3RDIA 3R0AA 2DFIA 1XSDA 4CZZA 2COMA 2QM3A 2RC4A 4EQQA 3IC7A 5CLSA 4A12A 1DDNA 2Q0OA 1WRJA 2V1DA 3H3UA 4EJOA 2DQRA 3FM5A 4KA4A 2G7HA 4S05A 2M8EA 2OQGA 2DAOA 2FXAA 1YO5C 2LNBA 1T39A 1B59A 2OA4A 1F9NA 4UVCA 3ZMTA 3SHFA 3LA7A 4G7HF 1Z7UA 3F8CA 5D5WB 4KMFA 1OPCA 4EVIA 3ZP5A 1IAWA 2A5YB 4DQ2A 4UUVA 1K78B 3FMQA 4BHCA 1ZRFA 3DV8A 3O2PE 2JSCA 1IZ1A 1XB4A 4YIFA 3QU3A 1Q1HA 5F1RA 4I98B 5J6XA 4LB6B 1BC8C 4M73A 2O8XA 3WTXC 3FXRA 3KETA 5CVRA 1XGSA 3VODA 1TBXA 4A6DA 5FFZA 2P8TA 3TO7A 5AONA 2EK5A 4I0AA 1O57A 3HTUA 4UXNA 4TV7A 5H20A 4HOBA 2FSWA 4LB5A 3RPQA 3F8MA 4Q48A 3ERED 1DPRA 3K69A 3CUOA 5BOXA 1BBYA 1QZZA 4M9ZA 4XLNF 5DUIA 5FD6A 2ZFWA 4M6XA 2Z3YA 2ZCWA 1H9GA 1KQ0A 1YFHA 4Q5SF 2JTVA 1IXRC 2CQKA 4P96A 2GWRA 1KU3A 2C6YA 5HLIA 3R4KA 4R1HA 3GZ5A 4BYYA 2D2WA 5HVQC 3IKVA 2YX7A 2YPRA 3J7AO 4IPAA 5D6FA 5JFRA 4L18B 3BPXA 1FOKA 1Z6TA 3BJ6A 1Z6RA 4G7OF 3PQKA 3GFLA 2FQ3A 5L3BA 1R00A 2DK8A 3RI4A 1BIBA 4CXFA 3J81Z 4I02A 4G8XA 3DKWA 4B09A 3V7RA 5CVUA 5ERIA 2P5KA 1HQCA 2DLLA 4HAMA 4EMSA 3FMRA 2EFWA 3GFJA 4LD5A 2RQPA 2M87A 3KLOA 2XAHA 1CF7A 2D45A 2EA4A 5JR3A 3RKXA 1ZG5A 2LDUA 1O3RA 5LEJA 4H0EA 3IRQA 1FBUA 3JTHA 4U0VA 2EJRA 4KN4X 2R7DA 4ESFA 1YLFA 1EH7A 1FX7A 2QQAA 1ZRDA 4M74A 3FHZA 5E1WA 5EEGA 2XUBA 3WE2A 3K1NA 1GVJA 2GAUA 4KIGA 1IUYA 2HFHA 3CUQC 2F5DA 4XLPF 4HYEA 2IP2A 2JZYA 3KE2A 3RKYA 2DO7A 1QGPA 2FMYA 1TQIA 3QAHA 4LJZF 2OZ6A 2P7VB 2JPBA 2BYVE 2VE8A 3MZHA 4ON0A 4KNYA 1F5TA 4AVPA 1WWXA 4BHBA 4HX4A 3BY6A 1XDSA 3DPTA 1J9IA 2CG4A 2XVCA 2PLYA 4A0XA 3I53A 2ETHA 4IRGA 3TO6A 4U0YA 2PMUA 3L00A 1J7KA 3WGGA 4OOIA 4AWXB 4A0ZA 5JI6A 4OIPF 3I5UA 1ZHFA 2EWNA 2A68F 3I71A 4XBFA 1TQMA 5BPIA 4EGZA 4YFKF 3ZPLA 1ZG1A 2FF4A 2QLZA 1REPC 1NHAA 4FX0A 3J81K 1K7AA 1BI0A 1RNLA 2G7UA 5HS9A 3TDUC 5D4RA 1LDKB 4WXCA 1G3SA 1P6RA 4YG2F 2DPUA 1K78A 3P9IA 3GYHX 4HF2A 3I59A 4O3MA 5FD5A 3G3ZA 1G3TA 3DF8A 3V8JA 1HBXG 2ELHA 5E18F 4ENMA 2J5PA 3WTZA 1SFXA 4FT8A 4L0ZB 5D5XB 2VBWA 4L9VA 3V7CA 4RB3C 1FLIA 2IT0A 1IF1A 1LDJA 2HTSA 1ZN2A 1FC3A 4LLLA 1LNWA 2IA0A 3QPTA 2PFBA 5ICGA 2OZUA 1P4XA 1PP7U 5HS8A 4BH9A 4HV5A 1AWCA 2QWWA 1BOAA 2XKOA 5DV5A 3B02A 3E6DA 5DDGA 3EQLF 2LSOA 1W7PD 3BDDA 2STWA 3E5QA 1QBJA 1HKSA 2ESHA 5ICEA 3I64A 5F64A 3D0SA 2V79A 3WGHA 4I01A 1T6SA 4CDGA 2KIFA 4L9NA 4A6EA 3KEQA 3DFGA 1G3WA 1USTA 1EH8A 5F6FA 3ZN1A 4RGSA 3WTSC 5J8FA 2XROA 2UXNA 1XSVA 1CGPA 3BP8A 2M30A 1CF7B 1ZREA 3WGIA 1ZYRF 3QPHA 4NQWA 4LGWA 3IKTA 4A5NA 2Z5UA 3CTAA 3M8FA 2P5LC 2D1VA 2JRTA 4LG0B 5LEKA 3GW2A 2Q8KA 2GA2A 2M1BA 3RYPA 5D6EA 2L3DA 3BZ6A 3HRTA 1KU7A 2XGXA 5KK1A 2O61A 2MH2A 2AS5F 1V3FA 2O3FA 3W6KB 3FZVA 3F8FA 3MQ0A 2FBIA 2BE5F 4HF1A 3GF2A 2QVOA 2KRFA 3GWZA 5CVIA 2VXZA 4KMUX 1R1TA 2FRHA 5L3GA 2HTJA 3CUQA 1J2XA 3ZMSA 1U2WA 1F1ZA 5A2QK 3ZMVA 1QZYA 4EJTA 1LDDA 2GQQA 4KICA 2M5WA 3HSEA 2HKXA 3RIRA 3COAC 1V4RA 3E5UA 4G94A 1I1SA 2V1UA 2MC3A 1FZPB 4UV8A 5HS7A 5JHUA 3WG9A 1S6LA 1P92A 2XHKA 2VE9A 1B1BA 5IT3A 2AXLA 1R5HA 4MTDA 3VOEA 1FBSA 1FYKA 2HYGD 1IRGA 3TQNA 1ZGAA 5AIPA 2K4BA 4G7ZF 1HSJA 4PDKA 4KT5C 1TTYA 3JW4A 4EM1A 5DD4A 2DU9A 2ZBKA 1OYYA 4OINF 5HDGA 3ZMDA 2XAJA 1QQIA 2IA2A 3TGNA 2KKOA 4BHPA 2VC0A 3GFMA 3I59B 2MD5A 1Z05A 4GGGA 4ZH4F 1O7LA 3LAPA 3BJOA 4UNOA 3L7WA 3Q9VA 1R36A 4MEYF 1MJBA 1TW3A 2KIUA 1P2FA 3KLNA 4I0BA 4IRHA 4FX4A 1ODDA 2KJBA 3K2ZA 3ULQB 3PFIA 2GZWA 1S29A 1I27A 2MH9A 2YR2A 2KJCA 3R0JA 2DQLA 5DD8A 4RB1A 1S7OA 1TNSA 3QP6A 5E1XA 2OBPA 5HLHA 1U78A 1G3YA 3I4PA 1MKMA 1YQAA 2A6EF 2EV6A 1OYIA 1DP7P 4U88A 3N97A 2IJLA 3E6MA 2WV0A 1W5TA 3I58A 2PEXA 1B9MA 3JTGA 2W57A 4MQVA 4EM0B 4PGGA 4ZYGA 3U1DA 2A61A 3KP4A 3U2RA 1SD7A 2E7XA 1LB2A 2EV0A 1RZ4A 5H6RA 4K2EA 4A2UA 1XMAA 3E6BA 5ILVA 5HDNA 3G73A 4PCQA 5BPDA 3JAMZ 2MBFA 4L5JA 3J80K 3KZZA 3WTYC 4HQMA 2IA1A 1S3JA 3QRFF 4DNCA 1YTYA 1JE8A 2RV8A 3ELKA 4ENKA 5D8KB 1XSXA 3QOPA 3RKWA 5LGNA 3IL2A 4O6JA 4L5IA 2W85A 3TDZC 4N0BA 4PZJA 4B8XA 3PQJA 2V6CA 4WX9A 1YS6A 2M45A 1QPMA 4RAYA 2RDPA 3GLXA 1XN7A 2XKPA 4YFXF 3N4MA 3GEZA 1D8KA 3CUQB 1BI2A 1O3QA 1XMKA 2ZO4A 2XAFA 3TOAA 4NB5A 2QZ8A 3EYIA 5AIQA 3FF5A 4EJUA 4LG0A 5HOOA 2WC2A 1P4AA 2XASA 4LK1F 3HRMA 4CYDA 1KU2A 1U5TB 3FX3A 3Q9SA 2L02A 5FLXZ 2EFPA 2LKPA 3JSOA 3RPUA 5IT9Z 1XCVA 1FP1D 2K02A 3T5XA 2FBHA 1Y0UA 1C0WA 1KA8A 2GXGA 5TRDA 2P5VA 3R61A 1HKTA 1U5TC 2CW0F 1MGTA 4UV9A 5L3EA 3BPVA 5EEHA 1S7AA 3V7SA 2FU4A 4N9IA 1KQ8A 3KP2A 3HSRA 3TKYA 3IRRA 2W84A 4P55A 1WI9A 1I6XA 1F4KA 3CJNA 1ZLJA 4S04A 5DCMA 2YSRA 5ILSA 1DPUA 2HOEA 3GFIA 4P9FA 3E3VA 4MEXF 1FSHA 2DBBA 4RAZA 4CICA 4LLNA 3HTSB 1EV7A 3MWMA 4GCVA 5BS6A 3GX4X 1WQ2A 4IHSA 3U9GA 4ENJA 2NNNA 3L9FA 5CYVA 1W4MA 1H9TA 5E1ZB 2KIMA 1H0MA 4KIBA 4UHTA 1XGNA 5L3FA 1B9NA 3Q5FA 2QYOA 5LRRA 3ML6A 5KVRA 4UVAA 2P6SA 3VEPA 1Z9CA 4HF0A 4G6DA 4MQ9F 5ICFA 3NEUA 2L01A 2EB7A 2GA1A 3E97A 2FE3A 1L3LA 1R7JA 1OMIA 1FBQA 2FA5A 3RTRA 3WTUC 2HEOA 2P7CB 2K27A 1R1UA 1GXPA 1IRFA 4ETSA 1LJ9A 4D0PA 1AOYA 1I5ZA 2ZXJA 2P4WA 1O7FA 1HXDA 2RKHA 3SZPA 3SFZA 4NHJA 3LQRA 1BM9A 1FYLA 4LMYA 3H92A 2L4AA 1OKRA 2B0LA 2K86A 1FNNA 3P9KA 2Z9OA 3I54A 3GUDA 1O3TA 1OR7A 1XGOA 4GYGA 2VOOA 4IF4A 3FWEA 2H94A 1IW7F 4HBLA 2W25A 2A07F 2H27A 3GO5A 1TQPA 2JT1A 2E1CA 1D3YA 4BNCA 4A0YA 1Z91A 1BI1A 5D5VB 1TNTA 4KDPA 1UHMA 1BI3A 4OMZA 3K9TA 2NS0A 2O6GE 1MJAA 5LHHA 4KFCA 3KP7A 1UFMA 4WCGA 3KP6A 2RVCA 4EGYA 3WODF 5BQTA 1TLHB 4Y15A 3BOQA 3WU0A 3SZTA 1JXSA 2HDCA 2HWVA 2Q2EA 3K0LA 3R60A 2ZJ2A 2X0LA 1BN5A 2BGCA 4AD9A 2ESNA 1T0FA 4FHTA 4ESJA 1O3SA 1A04A 4M71A 3C1DA 3NRVA 4ZYHA 2XAGA 3BWGA 1YG2A 5FO5A 5E8IA 4U7DA 3HUGA 2ZMEA 5DEQA 2UWMA 4ENNA 2F5EA 2IRFG 3WTWC 4XRFA 1RI7A 3VB2A 5L3DA 3C3WA 3VFZA 1RUOA 2Z33A 1U3EM 3MEXA 4HDVA 1UB9A 3WU1B 2FBKA 3HYIA 4EJVA 5DCMB 2QENA 2GXBA 3HIFA 4HDUA 5D5UB 1U5TA 4RGXA 3F8NA 2HYFA 3KFWX 4Y13A 1HSTA 5DUKA 4IRIA 4F7ZA 2OQRA 2A6HF 3V8LA 5D8LB 4CGZA 2YX4A 1T38A 4Q4ZF 2E1NA 2LF7A 5LHIA 2RN7A 1YW8A 2Y0MA 2HS5A 1W7PA 1XCBA 2X4HA 3HRSA 1J5YA 1BC7C 4KIFA 4BXUA 2PN6A 3DP7A 4P5OA 1YW9A 1LVAA 2DT5A 1MJ9A 3QU6A 3DQVC 4CHUA 1FY7A 3K1MA 2HR3A 1YIOA 2NNYA 3O3KA 2TDXA 2LF8A 3ECHA 2PJPA 3WE3A 3TOBA 2QUFA 4MGRA 2CSOA 3JSPA 2O03A 3HSFA 1E2XA 4L9TA 3HRUA 2CO5A 5FFXA 1Z1DA 4BAYA 2HQRA 2QBYA 3E6CC 2W24A 1B6AA 5E8GA 3K1PA 3W6JB 4MNUA 3WTTC 4MTEA 3C7JA 2MLGA 3F8BA 1HW5A 5D4SA 1R5GA 2XV4S 4I09A 5H6QA 1UCRA 1T2KA 2MA3A 1PUEE 1I1GA 4ZYDA 2K4JA 1SD4A 4QWQA 3M9AA 4WXDA 2VODA 3CO7C 2JPCA 3LAJA 1ZAOA 1JHHA 2V1XA 2QQBA 3EETA 2YU3A 5BMZA 4OIQF 3MZYA 2CYYA 3F3XA 2UZKA 1FYMA 2NYXA 1SAXA 5FB2A 3O6BB 4EM2A 1ZH5A 2EFOA 5CVJA 2HQNA 4OU0A 3SXYA 5CJ9A 1U6GA 3HOTA 4KN7X 2VBXA 3DEUA 4LK0F 2NRAC 3M8EA 5K5OA 1IN6A 3CO6C 2WTEA 2HZTA 3P7NA 1WSUA 1HW1A 5DCFA 4XSXF 1HKQA 1WKMA 2OD5A 4KYWA 2H6BA 3T8TA 4M72A 4Y17A 4IJAA 4N9HA 3NQOA 2BV6A 2V9VA 2HKOA 4P9UA 3T8RA 5LBQA 3IHUA 3F6VA 1R22A 3ISPA 4O5VA 1KYWA 3BJAA 4ZZDA 2A69F 2CFXA 1IN5A 2ZMEB 3FM3A 1MDMA 2XIGA 1EH6A 4G9YA 4HQEA 2ADUA 4R79A 2DTRA 3ROUA 3P9CA 2F2EA 4ZYEA 3LSTA 3V8KA 5K5RA 3TO9A 2EA2A 1R23A 3ZN0A 1J0RA 3OOPA 1PP8F 4KUMA 1RIOH 4IHTA 1UHWA 2IW5A 3BROA 2D1HA 4YFNF 1IXSB 5LRSA 5ICCA 5DYMA 3EYYA 2Y48A 4EJWA 1T98A 1DUXC 1GXQA 2PMHA 2VT3A 2VN2A 4WWCA 4JK1X 4M9XA 2ZNYA 2ZKZA 5ED4A 1FT9A 1PDNC 4XSZF 3F23A 4WK8F 2OAZA 1BIAA 1YYVA 4L0YB 2DW4A 2BEOA 1W7PB 3LWFA 3ZQ7A 2R3SA 2ACJA 2Y75A 3C18A 3HOSA 1TW2A 2MLKA 3R6SA 2FEZA 4GYIA 4QLCU 4EV0A 4AIKA 3EDPA 1YW7A 3FXQA 4GO1A 5LGUA 3LA2A 3OV8A 3DPLC 1ON2A 1L0OC 1D8JA 5L3CA 1KGSA 2H6CA 1LEAA 3GZ6A 2CGPA 1ZRCA 5E17F 1GHCA 1IN8A 4ZZLA 4RGUA 3JAMK 4MHGA 1XGMA 4HLYA 2F5FA 2QBYB 1IN7A 5LGTA 3IWZA 4JQFA 4ESBA 2IVMA 1STZA 3LA3A 2GIVA 1E17A 1FPQA 2FNAA 3ZMUA 1SD6A 2VBZA 6PAXA 4OIOF 4ASNA 5LLQA 3WTVC 1W5SA 4RGRA 4HV6A 2L4MA 2E7WA 4IVNA 1ZARA 1JHFA 1IXCA 1SD5A 2WWYA 3D5LA 1RUNA 3F21A 2XRNA 3KP3A 2G9WA 2STTA 5A2QZ 2EV5A 3S2WA 2VONA 2ZNZA 1G6NA 4YIIA 2FMLA 5E20A 3H3ZA 4HLXA 3RJPA 1SMTA 3FXUA 1FWZA 4IXAA 2L54A 3GXOA 2FOKA 1QNTA 2OU2A 5HLGA 3ABUA 1B4AA 2PG4A 2P6TA 4E70A 4UVBA 3F72A 3EUHA 4LFUA 3CDHA 1SFEA 2F5CA 1VTNC 3F6OA 5FGMA 3M7GA 3I0TA 2K7LA 1R58A 4G6QA 1KYZA 5FLXK 3L2CA 3B73A 5K1YA 1QO0D 2DI3A 3KEOA 2H09A 5CVVA 3KCCA 4RB0A 2IPQX 1IN4A 4L9JA 5IT9K 1XDUA 4OIRF 4PGHA 1USSA 4OMYA 1R1VA 1XD7A 2R7FA 4RS8A 1SFUA 3ECOA 2Z99A 4M6YA 5TJJA 4A5MA 2FNPA 5HDKA 1U8RA 1S8NA 2BBYA 2DPDA 1ONVA 5LHGA 5K5QA 1P4WA 1K79A 4I2OA 3F22A 1LEBA 2J5OA 3AAFA 4Q47A 4HX8A 3HHHA 2XAQA 1MDMB 1J75A 1K6OA 1D5VA 4I7HA 4JBAA 1ZLKA 4AIHA 3V4GA 3SQNA 2EFNA 4U0WA 3KZYA 3ABTA 3CLOA 2VOPA 2CWEA 4RB2C 3IWFA 3MAJA 3ZMZA 2UXXA 4WF2A 1G4DA 1OYWA 5J8CA 4CO8A 1FSEA 4M9SA 4U7BA 3T0YA 3L09A 3T1BA
chains in the Genus database with same CATH superfamily
3A2KA 3MFKA 4BY1J 1KU9A 2RGVA 1ULYA 3LSJA 4WXHA 2PMZN 2Y31A 3FMSA 2PI0A 4KITB 3QP5A 2EIMH 4X0GA 3M1EA 2E71A 1YJWI 2VT2A 4AIJA 1TWAJ 2K85A 1JGSA 1RR7A 4PUSA 4CCLA 3REOA 3OYHA 1X3UA 2LVSA 3H0DA 4R8HA 1ZG3A 2HDDA 1D0XA 1ZGJA 1MZBA 2DK5A 3BR0A 5K7FA 2QQ9A 1HW2A 3E5XA 5KCMA 2EZKA 2O0YA 4BQAA 1YS7A 2DA7A 3QYEA 4BL0B 2HVRA 3MCZA 2X48A 4HA8A 1VQPI 3H35A 2LLKA 4A3MJ 2RNJA 4MLOA 2QKLB 4S0HB 3PFYA 4ZDPA 5ILUA 3RYRA 1SMYF 5JVTA 2PBIA 2K9SA 2ISYA 4HX7A 2A05A 4XM3A 2JN6A 4Z2YA 4BJ5C 3CCRI 2LP0A 5E3MA 3TW7A 2ZJQF 3FXKA 5CQGA 1U8BA 1YHQI 1VQ5I 2B9SA 4LLGF 2A3SA 2XB0X 2HGCA 2NAZA 1ON1A 2L9NA 2QF7A 1LFPA 1ERDA 3LFKA 2VC1A 3GVAA 2VBYA 2X6OA 2DODA 2EFQA 2PQ8A 3CF2A 3KP5A 1QVTA 1ZTRA 3OMYA 2V7FA 1Z21A 1UJ8A 1LQ1A 2XF6A 4HNUA 2R7WA 1UZCA 3LQQA 4HZFA 3ZQLA 1JKQC 1J59A 2ISZA 1KQ9A 1BJAA 1FP2A 1SFKA 4GXOA 2NXNB 4HW0A 1JT6A 3B6AA 1YX3A 3HHGA 5FKMA 3CDIA 1AA7A 3J80Z 1MD0A 1MMNA 3DXJF 3RDIA 3BTLA 2JUCA 1Y8QB 3R0AA 4F55A 2DFIA 3MD2A 2GOMA 3ZQHA 2M4KA 4FTHA 3PIPF 1MMGA 1XSDA 4RLQA 4CZZA 2COMA 2QM3A 2RC4A 4EQQA 3IC7A 3VWBA 5CLSA 4A12A 1DDNA 2Q0OA 1WRJA 2V1DA 1MSEC 3H3UA 4EJOA 4D5CA 4ANJA 2DQRA 3EUAA 3FM5A 4B4CA 4KA4A 2E19A 2L9RA 2G7HA 2VKVA 3BR6A 3H1CA 4B43A 2R7OA 1X19A 4S05A 2M8EA 2OQGA 2GLOA 2DAOA 2FXAA 1YO5C 2E5ZA 2LNBA 1T39A 1B59A 4HEA2 2WAEA 4Z6YA 1XC5A 2OA4A 1F9NA 4UVCA 2K9NA 1MW7A 3ZMTA 3SHFA 3OYGA 3LA7A 4G7HF 1Z7UA 3F8CA 5D5WB 1ZR2A 3ERMA 1DGRM 3HC7A 4KMFA 4OWRB 1OPCA 1LUJB 4EVIA 3ZP5A 2X9DA 1W0UA 2K3FA 1IAWA 2A5YB 4DQ2A 1SANA 4UUVA 3GTOJ 3HXLA 1K78B 3OSFA 1IDYA 3FMQA 1WZ2A 4BHCA 1ZRFA 3F0CA 3DV8A 2BY0A 3KPHA 3WHCA 3O2PE 3K70D 1BOBA 1YITI 3SZGA 2JSCA 1IZ1A 2CH0A 1XB4A 4JOMA 4YIFA 4D5FA 3QU3A 1Q1HA 5B5EC 5F1RA 3OS1A 4I98B 2NS7A 5J6XA 3KEYA 4LB6B 1BC8C 4M73A 2O8XA 3WTXC 3DEEA 1MBEA 3FXRA 3BG6A 3KETA 1ACIA 5CVRA 2DMPA 1XGSA 2XPWA 3KIOA 3VODA 1TBXA 4YEJA 4A6DA 1VQ8I 3DTEA 5FFZA 2P8TA 3TO7A 5AONA 2EK5A 4I0AA 2HPMA 2AHQA 2DA3A 1O57A 1T33A 3HTUA 1SC7A 2JMWA 4BACA 4ZYAA 4UXNA 4TV7A 5H20A 3VYTB 4HOBA 1PJRA 2FSWA 4BDZA 4LB5A 3RPQA 1TL8A 3A4CA 3F8MA 4Q48A 4DYCA 1T95A 3UNGC 2DMUA 3ERED 2L0KA 1DPRA 4PJJA 3AG2H 3CUOA 1UMQA 3K69A 2VPRA 1BBYA 1QZZA 4M9ZA 1TZLA 4XLNF 5FD6A 5DUIA 5FJ8J 2ZFWA 4M6XA 2Z3YA 2ZCWA 1H9GA 1KQ0A 1IC8A 3DBLB 5IP9J 3DU6A 1YFHA 3CCMI 4Q5SF 5JHFA 4NNJA 2JTVA 2LBFA 1IXRC 2K3PA 1DQUA 2CQKA 1VNDA 4P96A 2GWRA 5M5XJ 1KU3A 4XONA 2C6YA 2HQAA 1B8IB 1WI3A 1K4SA 2IGOA 3CMAI 2WB1N 2BY2A 5HNHA 5HLIA 3R4KA 4R1HA 4C9YA 2DOAA 3OYDA 2H1KA 3CCYA 3HM5A 1YI2I 3FXMA 4C3IJ 3GZ5A 4BYYA 2D2WA 5HVQC 3E1SA 2LK2A 4B48A 3IKVA 2YX7A 2UV1A 2F4IA 2YPRA 3J7AO 4IPAA 1R5ID 5D6FA 5JFRA 4L18B 2HU9A 3S32A 3BPXA 1FOKA 3GTQJ 1Z6TA 3BJ6A 1Z6RA 1JGGA 4G7OF 2BOLA 3PQKA 3LL7A 3AL0B 3GFLA 3IP4B 2FQ3A 3K10A 5L3BA 1R00A 5C3EJ 4E4HA 2ELKA 2PX9A 3C2GA 5GTIC 2DK8A 1Y8RB 3RI4A 1R49A 2M2EA 3W3CA 3V42A 1S9HA 1BIBA 4P1WA 4CXFA 5HNFA 2KHMA 3BTCA 3J81Z 3RZOJ 4I02A 3SJMA 2L9SA 3QOEA 4G8XA 4A3DJ 3BQZA 1X3WB 2R92J 5TISC 3UKGA 5IP6A 3DKWA 4B09A 3V7RA 5CVUA 1VQMI 3BQYA 3DBHB 3OYMA 5ERIA 4XKVA 2DMTA 3O8HA 2P5KA 4M3DA 3PL8A 4RAGA 3AL0C 1FEXA 1HQCA 2VB6A 2DLLA 1U9OA 2LY2A 4HAMA 4EMSA 1S7EA 3FMRA 2EFWA 1A31A 3MMYB 2V4JC 4V2GA 2DA5A 3GFJA 4LD5A 3FK7A 1QPIA 5KHDA 1JKPC 3BG9A 2RQPA 3W2WA 1FTTA 2M87A 3KLOA 2BHZA 1X3ZB 2XAHA 1R9TJ 4C2TA 2GOXB 2TRTA 3U21A 3I9V2 1CF7A 4H4KC 2D45A 2KMUA 2EA4A 2R5YA 5JR3A 3RKXA 3BG7A 1ZG5A 4GFBA 2LDUA 1O3RA 1WGXA 5LEJA 2GXAA 5DTDA 4H0EA 3IRQA 1Y1WJ 1FBUA 3JTHA 4U0VA 4W1UA 2EJRA 4KN4X 2R7DA 4ESFA 1YLFA 1EH7A 2NS8A 2CFOA 1FX7A 2QQAA 4ITVA 1ZRDA 4M74A 3FHZA 5E1WA 1W36C 5EEGA 2XUBA 3TBIA 1XTAA 3WE2A 4E7JA 3K1NA 3OL4A 1GVJA 2CV1A 2GAUA 2HI3A 2HNHA 4KIGA 1YJNI 1IUYA 3ZRGA 2HFHA 4OAYA 5B1AH 3OR2C 3IV5A 3CUQC 1BW6A 1HLVA 1BW5A 1ETVA 2RREA 2F5DA 2XPVA 4XLPF 4M3BA 4HYEA 2IP2A 4KT6A 2JZYA 3KE2A 3PNYA 3RKYA 1ORKA 1Z3YA 2DO7A 4QTRA 1QGPA 2QSHX 2FMYA 4F52A 1TQIA 3QAHA 4LJZF 4BE1A 2OZ6A 4QPOA 3JRDA 2P7VB 2JPBA 1NK2P 3M4OJ 2BYVE 1B72A 3W2AA 2VE8A 3MZHA 5CKTA 4ON0A 4KNYA 1F5TA 2HVQA 4AVPA 4J00A 1WWXA 4BHBA 4HX4A 3BY6A 1XDSA 2OV7A 3DPTA 2LKXA 1J9IA 2K5CA 2CG4A 1M1EB 2XVCA 3LSMA 4A3JJ 2PLYA 4A3EJ 5CPRB 3OIPA 4A0XA 5EDNA 3H5AA 2CUJA 2ETHA 3I53A 4IRGA 3TO6A 4BY7J 3ZCOA 1O4XA 4U0YA 2PMUA 3NWTA 2Y30A 2MYSA 2XDVA 3L00A 5BNGA 1J7KA 3WGGA 5LFAA 4OOIA 4AWXB 4A0ZA 2CMPA 3OS0A 5JI6A 4OIPF 5HLTA 3I5UA 1ZHFA 2EWNA 1AU7A 4A3GJ 5EZGA 3M3YJ 3S1MJ 3S17J 3JREA 2A68F 4NDLA 1GT0C 2MSYA 4XIDA 3I71A 2UUZA 2DFFA 4XBFA 2XC7A 1TQMA 3CC2I 1IG7A 5BPIA 3GCMA 4EGZA 3LSRA 4YFKF 3ZPLA 2DOFA 1ZG1A 1ZELA 3X2QH 2FF4A 1OLTA 2QLZA 4D7MA 5J4VA 1REPC 1NHAA 3OYBA 4FX0A 3J81K 2F6CA 3L2UA 2LR8A 1K7AA 1OJLA 1BI0A 2HOSA 4B47A 1BL0A 1D5YA 1X1PA 1RNLA 2G7UA 5HS9A 3TDUC 4JYKA 5D4RA 4XLFA 1G2HA 1LDKB 4WXCA 3PSFA 1G3SA 1Y0NA 3BTJA 1P6RA 3BR3A 4YG2F 3ESWB 1K61A 2DPUA 4G6TB 1K78A 3P9IA 4JX5A 3GYHX 4HF2A 2VPLA 2LBFB 3I59A 4O3MA 1IV8A 3K6GA 3CJQB 1EA3A 5FD5A 2O9LA 3G3ZA 3SEQA 1FTZA 5LD2C 1G3TA 2WBMA 4FE7A 3DF8A 2XB5A 2DTZA 2XRLA 3V8JA 1HBXG 1RETA 2IBDA 3HL2A 3CF5F 3J7YJ 4IO9F 2ELHA 5E18F 1HDPA 4ENMA 1GDTA 2ME0A 2J5PA 3WTZA 1SFXA 4FT8A 4L0ZB 5D5XB 1Q1VA 2VBWA 3JCUC 2DMQA 2O8KA 3QWLA 1HA8A 4L9VA 3V7CA 3HKZA 3K2AA 4RB3C 1FLIA 4C3HJ 2IT0A 1IF1A 1LDJA 2E35A 2HTSA 1ZN2A 1FC3A 1T56A 4LLLA 1LNWA 2IA0A 2OUMA 2PFBA 3QPTA 4XLAA 2JK3A 3OYFA 2R93J 5ICGA 2F5VA 2OZUA 2E2HJ 1P4XA 4C2UA 5M3MJ 1PP7U 2JJ7A 4BH9A 5HS8A 1ETQA 4HV5A 1JJ6C 1AWCA 2QWWA 1BOAA 4AC0A 2XKOA 5DV5A 2ME6A 4CCJA 1SVOA 3S2HJ 5EYRA 1QU3A 4UY8I 3B02A 3E6DA 5DDGA 4NC6A 1XG1A 3EQLF 2LSOA 3LMMA 1E3HA 1W7PD 3BDDA 1X1DA 4EATA 2XSDC 2CJJA 3S1NJ 3BLYA 5GAHJ 5IYDJ 5C4XJ 1WJAA 2STWA 3E5QA 1XMXA 1QBJA 1HKSA 2DA1A 2ESHA 4XRSG 1YX5A 3WU2C 1Y1VJ 5ICEA 3I64A 5F64A 1D0ZA 3OYLA 3D0SA 2V79A 3WGHA 2KLOA 2LMDA 4I01A 2ZJPF 1T6SA 3S3NA 4CDGA 2KIFA 3MZ8A 4L9NA 4A6EA 1JJ8C 3KEQA 3DFGA 3DCFA 3HOXJ 1G3WA 1USTA 1EH8A 5F6FA 3ZN1A 1PUFA 3BZKA 4RGSA 3WTSC 5J8FA 2H8RA 2XROA 2UXNA 1HDDC 1XSVA 4E7KA 1CGPA 3BP8A 2M30A 1CF7B 2QCOA 3WGIA 1ZREA 1ZYRF 3QPHA 4NQWA 4LGWA 2R5YB 3IKTA 4A5NA 3JRCA 2Z5UA 2R7VA 1MBKA 3CTAA 3M8FA 3ZQIA 4RMNA 3OSGA 1WFXA 5GTHC 2P5LC 2ECCA 2IS1A 3CJTB 2D1VA 2JRTA 1DU6A 1P7JA 4LG0B 2KP6A 5LEKA 3GW2A 2Q8KA 2GA2A 1DP3A 3ZQGA 2M1BA 3RYPA 5F04A 2KISA 5D6EA 3LSKA 2L3DA 3BZ6A 4MIMA 4NBQA 3HRTA 3MKZA 1KONA 3HOZJ 3LSHA 4CA0A 1KU7A 1MMSA 2XGXA 3N05A 5KK1A 2O61A 1RESA 2MH2A 2AS5F 1EJ9A 5FLVA 2E2JJ 4XNFA 1HOMA 1V3FA 2O3FA 3W6KB 3FZVA 2DT7B 5FKKA 1IGNA 2MW8A 3F8FA 3CQZJ 1GVDA 3MQ0A 2A5WA 2FBIA 2BE5F 4HF1A 3GF2A 2QVOA 3FBIB 2KRFA 3GWZA 5IYCJ 5CVIA 1B72B 3VYRB 2VXZA 4KMUX 1P9QC 2PJRB 3KYCB 2B7EA 1R1TA 2FRHA 3CUQA 1OFCX 2HTJA 5L3GA 4M3GA 1J2XA 5J3LA 3ZMSA 4CYCB 3TL4X 1U2WA 1F1ZA 3A02A 4BJTA 3ZMVA 5A2QK 3LNQA 5C4JJ 1G59A 1QZYA 4EJTA 1LDDA 1X4OA 4PFPA 2DA4A 3G6EI 2GQQA 2K9QA 4KICA 2M5WA 3K4NA 1ETWA 3JRHA 1TT5B 3HSEA 2HKXA 3RIRA 3HG9A 3COAC 3DU5A 1V4RA 3E5UA 4G94A 5B3SH 1I1SA 4MFEA 5J40A 2V1UA 2MC3A 2ZJRF 2NOJB 3C2HA 1FZPB 4UV8A 5FRMA 5IY5H 1FJLA 5HS7A 5JHUA 2HVSA 3WG9A 1S6LA 1P92A 4ZTJA 2XHKA 4QIWN 2VE9A 2VJ5A 1B1BA 5IT3A 2NVXJ 2AXLA 3ZOBA 1R5HA 4MTDA 2Z1DA 3OYEA 2KQRA 4RAFA 3VOEA 1FBSA 2LH9A 1BJZA 1ETOA 5IYBJ 1FYKA 3CCEI 2HYGD 2R7TA 3TQNA 1IRGA 2FOWA 1ZGAA 4GRIA 1VQ7I 4BQOA 5AIPA 2K4BA 3QYBA 1HC8A 3TEDA 4G7ZF 1HSJA 2DMNA 2GBYA 2VQCA 3GTMJ 2V1NA 4PDKA 3BG3A 4AYBA 4KT5C 1TTYA 2JVHA 2JVGA 4HRIA 5M3FJ 1LE8A 3JW4A 2H8WA 2R7UA 1MMAA 4EM1A 5DD4A 2DU9A 2ZBKA 1OYYA 4OINF 5HDGA 1QHGA 3ZMDA 1JUMA 5EG0A 2MD0A 1APLC 4XLCA 3HPGA 2M0MA 3NARA 3U1KA 2XAJA 1QQIA 2IA2A 3TGNA 2KKOA 4BHPA 2VC0A 3GFMA 3PIOF 3I59B 3I3LA 1A36A 3F9KA 1I6HJ 2MD5A 1Z05A 4GGGA 2LKSA 4ZH4F 1O7LA 3LAPA 1LKXA 1V55H 4XMYA 3BJOA 2JA8J 4UNOA 1WCMJ 3L7WA 3Q9VA 1R36A 1X58A 4MEYF 1P7IA 1MJBA 1TW3A 2KIUA 2QGUA 1P2FA 5C44J 3KLNA 4I0BA 1ETYA 4IRHA 4FX4A 3KYLA 1ODDA 2KFDA 2DYSH 2KJBA 3K2ZA 3B6CA 3ULQB 3PFIA 2DDAA 2HPIA 4E7LA 2AQFA 3BR1A 2GZWA 2V9KA 1S29A 1I27A 3GLLA 1A6QA 2MH9A 3E7LA 2YR2A 1BR4A 2DJIA 3ASOH 3CESA 3GTKJ 2KJCA 3M07A 4CSWA 4HNTA 3R0JA 2DQLA 5DD8A 4RB1A 1S7OA 2P81A 2BXYA 1TNSA 3QP6A 3UR3C 5E1XA 2OBPA 3LSIA 5HLHA 1U78A 2E1OA 4II3A 1G3YA 2MFZA 3A03A 3PUFA 5E3OA 1VQ4I 3I4PA 4ZDLA 3K7AJ 1MKMA 1YQAA 2KL4A 1YOVB 3OYKA 2A6EF 2EV6A 1OYIA 2L7KA 4HSTA 4BUPA 1PYVA 1DP7P 4U88A 3N97A 2IJLA 4MO7A 3E6MA 2WV0A 1OCTC 1D1BA 3BCAA 1HCRA 1W5TA 2XSJC 3I58A 2VQHA 5BOXA 2PEXA 3ABKH 1B9MA 3JTGA 3W6VA 2DXIA 2W57A 1RKTA 4MQVA 4EM0B 5EGOA 4PGGA 4Y4RA 4ZYGA 2VKDA 3U1DA 2A61A 3KP4A 3H3VK 3U2RA 3DKYA 2BVLA 2G0EA 5DS9A 1SD7A 2E7XA 4RM2A 1HF0A 1LB2A 1W0TA 2JRMA 2EV0A 1RZ4A 5H6RA 4I6ZA 2O7OA 2CUZA 4K2EA 4ZC3A 2VLAA 2OTJI 1MIJA 2P0WA 3HBLA 4A2UA 1K4TA 3BC8A 5F0HA 1PUFB 3GBGA 4IHWA 1XMAA 1R71A 1BR2A 3E6BA 5ILVA 5HDNA 4NQWB 4PCQA 2X85A 3G73A 3JAMZ 4EEFG 5BPDA 1WJFA 2CQ7A 4DBRA 1VI0A 2MBFA 4L5JA 3J80K 3KZZA 5FRNA 1VFCA 3SEZA 3WTYC 4E7IA 4HQMA 5JLXA 2M7AA 3CP2A 2IA1A 3G4SI 1S3JA 3QRFF 1VQKI 4DNCA 3FXLA 1TWGJ 3QPSA 2DN0A 1YTYA 1JE8A 5H2FC 1T08B 1SVLA 4HPQA 1RR8C 4IHVA 2RV8A 3ELKA 4ENKA 2VQGA 5D8KB 2VKHA 1XSXA 2CW8A 3QOPA 2LOOA 3RKWA 5LGNA 3ASNH 3IL2A 4NC7A 4O6JA 2ICWG 2M34A 3J7AY 4L5IA 2ID3A 2KZGA 2W85A 3TDZC 2X6XA 4N0BA 4PZJA 4D9JA 4B8XA 3PQJA 2D5VA 2V6CA 4WX9A 2FD5A 1YS6A 2M45A 1QPMA 1W1WE 4V2FA 2R4GA 4RAYA 2RDPA 2EZIA 4F3QA 1VQNI 2CS3A 1XN7A 3GLXA 3QQAA 2XKPA 3S2DJ 4YFXF 3N4MA 2ZB9A 4FETA 1U9NA 3GEZA 4KJZA 1D8KA 2DOEA 3CUQB 1BI2A 1OCPA 4A3IJ 2MG4A 1O3QA 1N25A 3CCVI 1XMKA 5IP7J 2LRDA 2ZO4A 4IQJA 1T8IA 2XAFA 1T0FC 3TOAA 4IHYA 4NB5A 2IGMA 1VQ9I 2QZ8A 3EYIA 2IGKA 5AIQA 2K40A 3FF5A 4EJUA 4LG0A 2R7SA 1V5GA 1JKOC 1J09A 2HYJA 4LIVA 5IPAA 5HOOA 5J1YA 2WC2A 1P4AA 1GUUA 2XASA 3TP0A 1I3AA 1WVRA 4LK1F 3DPUA 3HRMA 4CYDA 1KU2A 1U5TB 3L2WA 2Y9ZA 3FX3A 2ZMEC 3Q9SA 2L02A 5FLXZ 2EFPA 2FQ4A 4BEHA 2WAQN 1IO2A 2LKPA 2ID6A 3JSOA 3O8GA 2Z2SB 4UB6C 3IH4A 1RRJA 3S3OA 1LPQA 3RPUA 4MFDA 2R7QA 5IT9Z 1XCVA 1FP1D 2KIQA 4QSHA 4AM3A 2K02A 4NUBA 3CCJI 2W82A 1DU0A 3CDLA 3T5XA 2FBHA 1Y0UA 1MH4A 2WADA 1C0WA 1KA8A 2GXGA 2PJRA 1ZGWA 5TRDA 2P5VA 1YJ9I 3R61A 2NVYJ 2VJ4A 1U5TC 4F93B 1HKTA 5F08A 2CW0F 3BT9A 1MGTA 4CYCA 4UV9A 5L3EA 4BBRJ 3BPVA 1OQYA 5EEHA 5GPAA 4Y33A 1OISA 1LE8B 1S7AA 3HOWJ 3V7SA 2FU4A 4N9IA 1QHHD 2V26A 4M3EA 1KQ8A 3KP2A 3HSRA 3TKYA 3IRRA 2CUFA 2W84A 5EG0B 4P55A 1WI9A 2Y0SN 3GTPJ 3OWTA 1I6XA 1F4KA 3CJNA 2OCCH 1ZLJA 4S04A 2E36A 5DCMA 3JRFA 2YSRA 4E7SA 3CCUI 5ILSA 2QKMB 1DPUA 2HOEA 3GFIA 5K7HA 4P9FA 3E3VA 1OCCH 4MEXF 3M1CA 1IDZA 1FSHA 3OYCA 2LFBA 2EZLA 5GAEJ 2DBBA 4N4NB 4PK4A 3DWLE 2Q1ZB 4RAZA 2KPMA 4CICA 4LLNA 3H9QA 3HTSB 3CC4I 5KAIC 2ZSHB 4A3BJ 1EV7A 3MWMA 4GCVA 5BS6A 3GX4X 4W97A 5K7ZA 3VYSB 2XGEA 4PJMA 1WQ2A 4IHSA 3U9GA 4ENJA 3S15J 1VQLI 2JA2A 2NNNA 3L9FA 4DW6A 2K9LA 5CYVA 1W4MA 4J01A 1H9TA 3JRIA 3IH2A 3ZQFA 5E1ZB 2KIMA 1X1CA 4XICA 3MKYB 1H0MA 4KIBA 4UHTA 3PNVA 1XGNA 2FX0A 5L3FA 1B9NA 3Q5FA 9ANTA 2QYOA 2JWTA 4RA2A 5LRRA 2YUSA 3RCOA 3ML6A 5KVRA 4UVAA 2P6SA 3VEPA 1Z9CA 1LFUP 1OCOH 2L7FP 4HF0A 2WA0A 4G6DA 4MQ9F 3L1PA 1ITYA 3H5NA 5ICFA 2LY1A 3NEUA 2OJED 2OF7A 3S93A 1W36D 2L01A 2EB7A 5F1JA 4BXFA 4BBSJ 1FMWA 2GA1A 3E97A 3AG4H 1ZR4A 4FASD 2BW3A 1UG0A 3FK6A 2WY8Q 2FE3A 5FLMJ 3S1RJ 1L3LA 5E79C 3H5RA 1R7JA 1OMIA 4BXXJ 1FBQA 4D7NA 5EGOB 1F43A 2FA5A 3RTRA 1FMVA 3WTUC 4E6KG 1Y56A 2HEOA 2DT6A 4UUSA 2E1MC 2P7CB 2X6WA 2K27A 2CW7A 3E0JB 1QVUA 1Y6IA 1R1UA 1GXPA 1IRFA 4ETSA 1LJ9A 1VF9A 4D0PA 1I5ZA 2ZXJA 2P4WA 1AOYA 5J47A 1O7FA 1HXDA 3PM1A 1MBHA 2EH3A 2RKHA 3SZPA 3Q0WA 3SFZA 2JUGA 3SDGA 2YU9J 4NHJA 3LQRA 4M6VA 4BQNA 1BM9A 1FYLA 4LMYA 3H92A 2L4AA 4FCYA 1OKRA 3HKZN 3JRBA 2B0LA 3OY9A 2W4SA 2K86A 3K4BA 2Y2ZA 1FNNA 3IUOA 3P9KA 1EF4A 5FKLA 2Z9OA 3I54A 3GUDA 1VQOI 1SVMA 1O3TA 1OR7A 4B3XA 1XGOA 1A6IA 4GYGA 1RC9A 3MKLA 3SFIA 2O5RA 2EBIA 1W5CC 5B1BH 2VOOA 4CUGA 4IF4A 4DZPA 2QSGX 3FWEA 3L2VA 3PO3J 3OYJA 2XAUA 2LY9A 2H94A 4XKBA 3QPLA 1IW7F 4ZTFA 2M0CA 4HBLA 5JLWA 2X51A 4B3AA 2WV1A 2W25A 4HSRA 5JVGF 3ZR8X 2KT0A 2A07F 2H27A 3GO5A 1WJDA 1TQPA 2JT1A 2E1CA 1D3YA 1RPWA 4BNCA 4A0YA 2LTPA 1Z91A 1BI1A 4BQQA 1R4MB 4A3FJ 1DGWY 2QSFX 3OIOA 2R7ZJ 2GIZA 4PSWA 4LITA 5D5VB 2VASA 1JTXA 1TNTA 4KDPA 2CU7A 1UHMA 2CQQA 3FKJA 2Y69H 1BI3A 4OMZA 3K9TA 4BU2A 1JKRC 4BJ6C 2ECBA 2X1EA 2NS0A 1YRNA 4BE2A 2O6GE 2E60A 1MJAA 5LHHA 2PMZA 4FE4A 3KP7A 4KFCA 1UFMA 3FKIJ 1POGA 4WCGA 3KP6A 2RVCA 1MNMC 4EGYA 2DA6A 1ETXA 4XQFA 2EIKH 2COBA 2BY3A 3IAS2 3WODF 5F27A 5BQTA 1WH5A 1TLHB 4IHXA 3ABLH 4Y15A 1JUSA 3PNTA 3K4LA 3BOQA 5GADJ 3CMYA 4PSXA 3WU0A 3SZTA 4IEJA 3A1YA 1JXSA 4BEHB 2IXSA 2HDCA 4IOAF 2HWVA 2I8DA 2Q2EA 3K0LA 3R60A 2ZJ2A 2E2IJ 2X0LA 1BN5A 2BGCA 3K4MA 2ESNA 4AD9A 1T0FA 4FHTA 4ESJA 3AG1H 1O3SA 1SAUA 1WHUA 3K70C 1A04A 4IOCF 4E7HA 2X6YA 1BA5A 4M71A 2JQ7A 3C1DA 1UAAA 3Q0VA 4BE0A 3CP8A 3NRVA 4ZYHA 2XAGA 3BWGA 3I4MJ 4XOPA 1YG2A 5FO5A 5E8IA 3OYNA 4U7DA 3HUGA 2ZMEA 5DEQA 2M3AA 1V54H 2R5ZA 2LD5A 2UWMA 4ENNA 2F5EA 3VPRA 4XORA 3WTWC 2IRFG 4LIUA 4XRFA 1RI7A 3FDYA 5L3DA 3C3WA 3VB2A 3VFZA 3RQIA 1H8AC 1AKHA 2VUMJ 1RUOA 4XN3A 1ZK8A 2OCEA 4A3LJ 1R6RA 2Z33A 1U3EM 4YRVA 2YS9A 3MEXA 4CCMA 4HDVA 1UB9A 2M7BA 4F92B 3WU1B 1MBJA 2KDOA 3H0GJ 2FBKA 3HYIA 4EJVA 2L2OA 5DCMB 3CCSI 2QENA 3C2BA 3FHNA 3H9GA 2GXBA 3VYUB 3HIFA 4HDUA 2W48A 5D5UB 2OPTA 3PO2J 1U5TA 1ENHA 3HGYA 4RGXA 4AVZA 1H88C 3SYTA 3F8NA 2HYFA 3KFWX 4Y13A 5GP9A 4YELA 4XR6A 1HSTA 5DUKA 4CCKA 1IRXA 2QQ8A 4Y7NJ 3ZGKA 4IRIA 3LFUA 2HQ5A 3K4CA 1I39A 4B44A 2DA2A 3QODA 3G1LA 4F7ZA 5DM7F 1XS9A 1GLNA 2OQRA 2A6HF 3V8LA 1JUPA 3G1OA 4LOCA 2IS6A 2DFEA 5D8LB 2YX4A 4CGZA 2VXDA 3CMEI 1T38A 4Q4ZF 1NG6A 2E5NA 2CRGA 1D1CA 2E1NA 2LF7A 5LHIA 2RN7A 3S16J 4DYQA 3AKZA 1YW8A 2X1CA 2Y0MA 2HS5A 1W7PA 1XCBA 2X4HA 3HRSA 1J5YA 1BC7C 4KIFA 4BXUA 2PN6A 3CLQA 3HDDA 4X1EA 4CH7A 1JT0A 1SFOJ 4XN0A 3DP7A 5DM6F 4P5OA 1D0YA 1YW9A 1QZEA 1RKWA 2JA5J 4BS9A 1LVAA 2DT5A 2I5UA 3BG5A 1NK3P 1MJ9A 3QU6A 3DQVC 4CHUA 4L5EA 1FY7A 2M4GA 4A93J 1X2MA 3H9JA 3BZCA 2XF5A 4AYBN 1A5JA 3K1MA 2HR3A 3RZDJ 1MBFA 1YIOA 2NNYA 2W00A 3O3KA 2TDXA 2LF8A 2CV0A 1Z7LA 3ECHA 3ZQCA 2PJPA 3WE3A 2BW3B 3TOBA 1UHSA 2QUFA 3BCBA 2A6TA 4MGRA 2BZTA 2CSOA 3JSPA 2O03A 1FIPA 1X1BA 3HSFA 1E2XA 4L9TA 3HRUA 5KNLA 1LVKA 2CO5A 3EUKL 2WAFA 4UUSB 2B63J 5FFXA 2CQXA 1Z1DA 2JSPA 4BAYA 1MMDA 2HQRA 3OR1C 2QBYA 3E6CC 2W24A 1B6AA 2L5QA 5E8GA 2NVQJ 3HJEA 2L7ZA 2VKEA 2ZXIA 3K1PA 3W6JB 4MNUA 3WTTC 4MTEA 3ONQA 2VJJA 3C7JA 3HOUJ 3SDBA 1X4PA 1TWFJ 2OC6A 2MLGA 3F8BA 1HW5A 5D4SA 1R5GA 2VI6A 2XV4S 4I09A 4A3CJ 3HOYJ 5H6QA 1UCRA 3KX2A 1QA6A 1T2KA 3RPUD 2NVTJ 2MA3A 1PUEE 1I1GA 4II2A 4DGWB 4PJ0C 4ZYDA 3CMMA 4RBOA 2K4JA 1SD4A 3NAUA 4RDUA 4QWQA 3M9AA 1I3QJ 1S72I 4IZZA 2EINH 2WB1A 4WXDA 2VODA 3CO7C 2JPCA 3LAJA 1VZ0A 1ZAOA 2KZVA 1JHHA 2FJ1A 3AFHA 1MNEA 3AG3H 3JRGA 1N77A 4F91B 1MNDA 2QQBA 2V1XA 3EUHC 3EETA 4U87A 2Z16A 1Z67A 1E3PA 2HZDA 2YU3A 5BMZA 4OIQF 2E34A 1JTYA 3MZYA 3ZXSA 2CYYA 3F3XA 2UZKA 3CD6I 3GZNB 1FYMA 2XF7A 4N4OB 2NYXA 4DJAA 4Y52J 1U0JA 2XPUA 1SAXA 3TMOA 5FB2A 4HG2A 1OR7C 3O6BB 4EM2A 1Z3XA 1S5LC 2F48A 1ZH5A 5EEAA 2EFOA 5CVJA 2EIJH 2HQNA 4OU0A 3SXYA 1WJBA 2MABA 5CJ9A 1U6GA 5J1UA 3HOTA 4KN7X 2VBXA 2HDWA 3DEUA 1QRYA 4LK0F 1AHDP 2NRAC 1YRNB 2ZFUA 3M8EA 5K5OA 3K4KA 2OTLI 4I99C 1IN6A 3GTGJ 3CO6C 2WTEA 2HZTA 4UUTA 2HOAA 1Y39A 3P7NA 1WSUA 3G2BA 1MH3A 1HW1A 2KRCA 4CCOA 4IQ4A 2DYRH 1MSFC 5DCFA 4XSXF 1N78A 4ABZA 1HKQA 1WKMA 2OD5A 1OCZH 4KYWA 2H6BA 3T8TA 2ZXWH 4M72A 3DLAA 4Y17A 4IJAA 4N9HA 4YIRX 4E7ZA 3NQOA 1V5FA 4C3JJ 4KISA 3A01A 3H36A 1PVEA 1YIJI 2BV6A 2Q2EB 2V9VA 4XOTA 5CQEA 4HNVA 2VL8A 2BHYA 3OL3A 2HKOA 2TCTA 3I56I 1FOXA 4P9UA 3T8RA 1TWCJ 1Z0XA 4ZDOA 5LBQA 4BGDA 3IHUA 3KYDB 3F6VA 1R22A 3ISPA 3J7ZI 4PFOA 4O5VA 1TC3C 1KYWA 3PSIA 3BJAA 4ZZDA 1F36A 2A69F 3FISA 2CFXA 4A3KJ 1IN5A 5IOYA 3HUGB 2ZMEB 2R5ZB 3FM3A 4XKCA 1MDMA 2XIGA 1EH6A 4G9YA 3CCLI 3L2RA 4HQEA 2ADUA 4R79A 2VQLA 1AKHB 2DTRA 2X1DA 3ROUA 4DZJA 3P9CA 4XLEA 1E0EA 2ZXHA 2F4OB 2F2EA 3RQ4A 4JX4A 4ZYEA 2QEXI 2NOGA 2MC4A 2KDZA 2XGCA 4XRSA 3LSTA 3V8KA 1TT0A 2IS2A 5K5RA 3TO9A 2EA2A 2HXIA 1R23A 3ZN0A 1J0RA 3OOPA 1PP8F 2V6EA 2DJNA 3FXJA 3VSLA 3MN2A 1FOYA 4XLHA 4KUMA 5B66C 2QA4I 3S14J 1RIOH 1K6YA 2HXOA 3ABMH 3HB9A 4IHTA 1UHWA 2WAQA 3M8JA 2IW5A 3BROA 2D1HA 1XPXA 4YFNF 1IXSB 1WPKA 5LRSA 5HODA 1MBGA 5ICCA 5DYMA 1ETKA 3EYYA 2Y48A 4EJWA 4CZCA 1T98A 5GPCA 1DUXC 1GXQA 2AXTC 2PMHA 2VT3A 2VN2A 3VDXA 4WWCA 1X1AA 4JK1X 4M9XA 5IOZA 2ZNYA 2ZKZA 5ED4A 1FT9A 4RM3A 1PDNC 3HPHA 3CC7I 4XSZF 2EPFA 3F23A 3DTIA 4WK8F 3CJRB 4UB8C 2OAZA 3IAM2 1YE9A 1BIAA 1YYVA 5J4YA 1K83J 3BR2A 2DW4A 4L0YB 2GM4A 1WJ5A 3DBRB 2BEOA 5E3NA 1FIAA 2CUEA 1A35A 1W7PB 3A0HC 3RKQA 3JR9A 3LWFA 2RQQA 1EKEA 2CV2A 5GAGJ 4V19K 2Y0SA 3GMEA 2W1OA 3ZQ7A 5M5YJ 2R3SA 2ACJA 1SEUA 2Y75A 3C18A 3HOSA 4JX6A 4IKFA 2BXZA 3HEFA 1I50J 4X6AJ 1TW2A 2MLKA 2LG4A 3S1QJ 3R6SA 1ZKGA 1WJCA 2FEZA 4GYIA 1G8XA 4QLCU 2R7RA 4EV0A 2FUG2 3D1NI 4AIKA 4C30A 3EDPA 1YW7A 3FXQA 4GO1A 1UG2A 1IRZA 5LGUA 3EPZA 3LA2A 3A0BC 3OV8A 3DPLC 2JA6J 1ON2A 1L0OC 1D8JA 4OAZA 5L3CA 1KGSA 2H6CA 2AO9A 3JRAA 2VJIA 1LEAA 3GZ6A 2CGPA 4XL9A 3RSNA 4G12A 1ZRCA 1Z77A 2RNGA 5E17F 1GHCA 3D5RC 1TP4A 1IN8A 3DEWA 5FKOA 4ZZLA 4RGUA 1R4NB 4DBQA 4MHGA 3JAMK 4RLFA 3OIQA 4GDFA 3TP3A 1XGMA 4B1RA 4HLYA 2F5FA 2QBYB 1IN7A 3Q0UA 5LGTA 2RAEA 3BR5A 2EILH 3IWZA 4D1QA 4JQFA 3CCQI 3G1MA 4ESBA 2IVMA 4I76A 1H89C 1STZA 1X2NA 2KRHA 3LA3A 3OYIA 4ZJZA 2GIVA 1E17A 1FPQA 1JI8A 2FNAA 2L9VA 2M9HA 3ZMUA 3LSGA 1SD6A 5EJCA 1ZQ3P 2VBZA 6PAXA 4OIOF 4ASNA 5LLQA 3WTVC 1W5SA 2EQRA 4FQGA 3LSPA 2LREA 2E1MB 1XX5A 4RGRA 2LYCA 5F0CA 2K9MA 2ELJA 4HV6A 2L4MA 2E7WA 4IVNA 1ZARA 5E3LA 2MGQA 2VIXA 1JHFA 3HGGA 4FISA 4C2MJ 4JP0A 1IXCA 4M3FA 1SD5A 2CQNA 2WWYA 3D5LA 4QPQA 1RUNA 5FROA 3F21A 3P5JA 4XRMA 1WH7A 2XRNA 3KP3A 1NG7A 3Q3SA 5M5WJ 1BR1A 2G9WA 5A2QZ 2EV5A 1CQTA 3S2WA 2STTA 2VONA 2R7XA 3WHBA 3DKXA 2ZNZA 1G6NA 1IUFA 4YIIA 1GV2A 2XGDA 2FMLA 3H3ZA 5E20A 4HLXA 1NH3A 3RJPA 1SMTA 3FXUA 1FWZA 5EZHA 4IXAA 2L54A 2R0QC 2JA7J 1N75A 2H1LA 3GXOA 2F4MB 2FOKA 2LC2A 1QNTA 2OU2A 5HLGA 3ABUA 1B4AA 3DLLF 2PG4A 2P6TA 2AQEA 3L2QA 4E70A 3GTJJ 4UVBA 4BDYA 3F72A 3EUHA 4LFUA 3CDHA 1SFEA 2F5CA 2WY7Q 4Y3OA 5J1RA 3F6OA 3LOCA 3I55I 5FGMA 3M7GA 1VTNC 3KZIC 3I0TA 2IEKA 3MVPA 3OS2A 2K7LA 1R58A 4J19A 4G6QA 3DTKA 1KYZA 4IL6C 2N8GA 3B73A 3L2CA 5K1YA 2IS4A 1QO0D 5FLXK 4DYRA 2DI3A 3KEOA 2H09A 5CVVA 3KCCA 4IX7A 4RB0A 2IPQX 1IN4A 1GV5A 3PUBA 4L9JA 4A69C 1IV6A 5TGTA 5IT9K 2V9PA 1XDUA 2BVMA 4OIRF 1IJWC 2ZC2A 2IAIA 1KZHA 1WJEA 4PGHA 1USSA 3S3MA 4OMYA 1R1VA 1XD7A 1FOWA 3CZ6A 2R7FA 4RS8A 1SFUA 4NC8A 3ECOA 2Z99A 4M6YA 4XKWA 5TJJA 3OYAA 3MKWB 4A5MA 3A01B 1UELB 4XK4A 3GTLJ 2FNPA 3K4JA 5HDKA 4BKXA 4DOZA 1LFBA 2ZSIB 3QYFA 2HOTA 5FKNA 3PJRA 3FBNB 1U8RA 1S8NA 2M8GX 2BBYA 3WG7H 3VSKA 2DPDA 2BY1A 4PJNA 3OOUA 1ONVA 5LHGA 5K5QA 1P4WA 2L7MP 1K79A 3F22A 4I2OA 1LEBA 1B8IA 2J5OA 3FIWA 2DFHA 3IH3A 4Q47A 3AAFA 3D5SC 1VQ6I 4AIDA 4LG3A 4PJLA 4AUXA 2Y9YA 2I10A 4HX8A 3HHHA 2XAQA 1D1AA 3S8PA 1MDMB 1J75A 1K6OA 1D5VA 3BTIA 4I7HA 4JBAA 1ZLKA 4AIHA 3V4GA 3SQNA 2EFNA 1E3OC 4U0WA 3NWSA 1OCRH 3KZYA 3ABTA 3CLOA 2DCEA 2VOPA 2CWEA 4RB2C 1V5EA 5EF6A 2W7NA 3IWFA 3G71I 3MAJA 3TW6A 3ZQQA 3ZMZA 3HOVJ 4CCNA 1NTCA 2UXXA 4WF2A 2DDBA 1G4DA 1OYWA 5J8CA 3FXOA 5F0FA 2NVUB 2EZHA 3W2VA 4CO8A 4AU7A 1FSEA 4M9SA 2IGNA 3HZJA 4DIQA 4U7BA 1TWHJ 3T0YA 3L09A 3I4NJ 5KAFC 3T1BA
chains in the Genus database with same CATH topology
3MFKA 1KU9A 2RGVA 1ULYA 4WXHA 3FMSA 2PI0A 3QP5A 3M1EA 2VT2A 4AIJA 1JGSA 3REOA 1X3UA 4R8HA 1ZG3A 1ZGJA 1MZBA 2DK5A 2QQ9A 1HW2A 3E5XA 2O0YA 4BQAA 1YS7A 3MCZA 4HA8A 2RNJA 5ILUA 3RYRA 1SMYF 5JVTA 2PBIA 2ISYA 4HX7A 4Z2YA 4LLGF 2A3SA 2HGCA 2NAZA 1ON1A 3LFKA 2VC1A 3GVAA 2VBYA 2EFQA 2PQ8A 3KP5A 1LQ1A 3LQQA 4HZFA 1J59A 2ISZA 1KQ9A 1BJAA 1FP2A 4GXOA 4HW0A 3HHGA 3J80Z 1MD0A 3DXJF 3RDIA 3R0AA 2DFIA 1XSDA 4CZZA 2COMA 2QM3A 2RC4A 4EQQA 3IC7A 5CLSA 4A12A 1DDNA 2Q0OA 1WRJA 2V1DA 3H3UA 4EJOA 2DQRA 3FM5A 4KA4A 2G7HA 4S05A 2M8EA 2OQGA 2DAOA 2FXAA 1YO5C 2LNBA 1T39A 1B59A 2OA4A 1F9NA 4UVCA 3ZMTA 3SHFA 3LA7A 4G7HF 1Z7UA 3F8CA 5D5WB 4KMFA 1OPCA 4EVIA 3ZP5A 1IAWA 2A5YB 4DQ2A 4UUVA 1K78B 3FMQA 4BHCA 1ZRFA 3DV8A 3O2PE 2JSCA 1IZ1A 1XB4A 4YIFA 3QU3A 1Q1HA 5F1RA 4I98B 5J6XA 4LB6B 1BC8C 4M73A 2O8XA 3WTXC 3FXRA 3KETA 5CVRA 1XGSA 3VODA 1TBXA 4A6DA 5FFZA 2P8TA 3TO7A 5AONA 2EK5A 4I0AA 1O57A 3HTUA 4UXNA 4TV7A 5H20A 4HOBA 2FSWA 4LB5A 3RPQA 3F8MA 4Q48A 3ERED 1DPRA 3K69A 3CUOA 5BOXA 1BBYA 1QZZA 4M9ZA 4XLNF 5DUIA 5FD6A 2ZFWA 4M6XA 2Z3YA 2ZCWA 1H9GA 1KQ0A 1YFHA 4Q5SF 2JTVA 1IXRC 2CQKA 4P96A 2GWRA 1KU3A 2C6YA 5HLIA 3R4KA 4R1HA 3GZ5A 4BYYA 2D2WA 5HVQC 3IKVA 2YX7A 2YPRA 3J7AO 4IPAA 5D6FA 5JFRA 4L18B 3BPXA 1FOKA 1Z6TA 3BJ6A 1Z6RA 4G7OF 3PQKA 3GFLA 2FQ3A 5L3BA 1R00A 2DK8A 3RI4A 1BIBA 4CXFA 3J81Z 4I02A 4G8XA 3DKWA 4B09A 3V7RA 5CVUA 5ERIA 2P5KA 1HQCA 2DLLA 4HAMA 4EMSA 3FMRA 2EFWA 3GFJA 4LD5A 2RQPA 2M87A 3KLOA 2XAHA 1CF7A 2D45A 2EA4A 5JR3A 3RKXA 1ZG5A 2LDUA 1O3RA 5LEJA 4H0EA 3IRQA 1FBUA 3JTHA 4U0VA 2EJRA 4KN4X 2R7DA 4ESFA 1YLFA 1EH7A 1FX7A 2QQAA 1ZRDA 4M74A 3FHZA 5E1WA 5EEGA 2XUBA 3WE2A 3K1NA 1GVJA 2GAUA 4KIGA 1IUYA 2HFHA 3CUQC 2F5DA 4XLPF 4HYEA 2IP2A 2JZYA 3KE2A 3RKYA 2DO7A 1QGPA 2FMYA 1TQIA 3QAHA 4LJZF 2OZ6A 2P7VB 2JPBA 2BYVE 2VE8A 3MZHA 4ON0A 4KNYA 1F5TA 4AVPA 1WWXA 4BHBA 4HX4A 3BY6A 1XDSA 3DPTA 1J9IA 2CG4A 2XVCA 2PLYA 4A0XA 3I53A 2ETHA 4IRGA 3TO6A 4U0YA 2PMUA 3L00A 1J7KA 3WGGA 4OOIA 4AWXB 4A0ZA 5JI6A 4OIPF 3I5UA 1ZHFA 2EWNA 2A68F 3I71A 4XBFA 1TQMA 5BPIA 4EGZA 4YFKF 3ZPLA 1ZG1A 2FF4A 2QLZA 1REPC 1NHAA 4FX0A 3J81K 1K7AA 1BI0A 1RNLA 2G7UA 5HS9A 3TDUC 5D4RA 1LDKB 4WXCA 1G3SA 1P6RA 4YG2F 2DPUA 1K78A 3P9IA 3GYHX 4HF2A 3I59A 4O3MA 5FD5A 3G3ZA 1G3TA 3DF8A 3V8JA 1HBXG 2ELHA 5E18F 4ENMA 2J5PA 3WTZA 1SFXA 4FT8A 4L0ZB 5D5XB 2VBWA 4L9VA 3V7CA 4RB3C 1FLIA 2IT0A 1IF1A 1LDJA 2HTSA 1ZN2A 1FC3A 4LLLA 1LNWA 2IA0A 3QPTA 2PFBA 5ICGA 2OZUA 1P4XA 1PP7U 5HS8A 4BH9A 4HV5A 1AWCA 2QWWA 1BOAA 2XKOA 5DV5A 3B02A 3E6DA 5DDGA 3EQLF 2LSOA 1W7PD 3BDDA 2STWA 3E5QA 1QBJA 1HKSA 2ESHA 5ICEA 3I64A 5F64A 3D0SA 2V79A 3WGHA 4I01A 1T6SA 4CDGA 2KIFA 4L9NA 4A6EA 3KEQA 3DFGA 1G3WA 1USTA 1EH8A 5F6FA 3ZN1A 4RGSA 3WTSC 5J8FA 2XROA 2UXNA 1XSVA 1CGPA 3BP8A 2M30A 1CF7B 1ZREA 3WGIA 1ZYRF 3QPHA 4NQWA 4LGWA 3IKTA 4A5NA 2Z5UA 3CTAA 3M8FA 2P5LC 2D1VA 2JRTA 4LG0B 5LEKA 3GW2A 2Q8KA 2GA2A 2M1BA 3RYPA 5D6EA 2L3DA 3BZ6A 3HRTA 1KU7A 2XGXA 5KK1A 2O61A 2MH2A 2AS5F 1V3FA 2O3FA 3W6KB 3FZVA 3F8FA 3MQ0A 2FBIA 2BE5F 4HF1A 3GF2A 2QVOA 2KRFA 3GWZA 5CVIA 2VXZA 4KMUX 1R1TA 2FRHA 5L3GA 2HTJA 3CUQA 1J2XA 3ZMSA 1U2WA 1F1ZA 5A2QK 3ZMVA 1QZYA 4EJTA 1LDDA 2GQQA 4KICA 2M5WA 3HSEA 2HKXA 3RIRA 3COAC 1V4RA 3E5UA 4G94A 1I1SA 2V1UA 2MC3A 1FZPB 4UV8A 5HS7A 5JHUA 3WG9A 1S6LA 1P92A 2XHKA 2VE9A 1B1BA 5IT3A 2AXLA 1R5HA 4MTDA 3VOEA 1FBSA 1FYKA 2HYGD 1IRGA 3TQNA 1ZGAA 5AIPA 2K4BA 4G7ZF 1HSJA 4PDKA 4KT5C 1TTYA 3JW4A 4EM1A 5DD4A 2DU9A 2ZBKA 1OYYA 4OINF 5HDGA 3ZMDA 2XAJA 1QQIA 2IA2A 3TGNA 2KKOA 4BHPA 2VC0A 3GFMA 3I59B 2MD5A 1Z05A 4GGGA 4ZH4F 1O7LA 3LAPA 3BJOA 4UNOA 3L7WA 3Q9VA 1R36A 4MEYF 1MJBA 1TW3A 2KIUA 1P2FA 3KLNA 4I0BA 4IRHA 4FX4A 1ODDA 2KJBA 3K2ZA 3ULQB 3PFIA 2GZWA 1S29A 1I27A 2MH9A 2YR2A 2KJCA 3R0JA 2DQLA 5DD8A 4RB1A 1S7OA 1TNSA 3QP6A 5E1XA 2OBPA 5HLHA 1U78A 1G3YA 3I4PA 1MKMA 1YQAA 2A6EF 2EV6A 1OYIA 1DP7P 4U88A 3N97A 2IJLA 3E6MA 2WV0A 1W5TA 3I58A 2PEXA 1B9MA 3JTGA 2W57A 4MQVA 4EM0B 4PGGA 4ZYGA 3U1DA 2A61A 3KP4A 3U2RA 1SD7A 2E7XA 1LB2A 2EV0A 1RZ4A 5H6RA 4K2EA 4A2UA 1XMAA 3E6BA 5ILVA 5HDNA 3G73A 4PCQA 5BPDA 3JAMZ 2MBFA 4L5JA 3J80K 3KZZA 3WTYC 4HQMA 2IA1A 1S3JA 3QRFF 4DNCA 1YTYA 1JE8A 2RV8A 3ELKA 4ENKA 5D8KB 1XSXA 3QOPA 3RKWA 5LGNA 3IL2A 4O6JA 4L5IA 2W85A 3TDZC 4N0BA 4PZJA 4B8XA 3PQJA 2V6CA 4WX9A 1YS6A 2M45A 1QPMA 4RAYA 2RDPA 3GLXA 1XN7A 2XKPA 4YFXF 3N4MA 3GEZA 1D8KA 3CUQB 1BI2A 1O3QA 1XMKA 2ZO4A 2XAFA 3TOAA 4NB5A 2QZ8A 3EYIA 5AIQA 3FF5A 4EJUA 4LG0A 5HOOA 2WC2A 1P4AA 2XASA 4LK1F 3HRMA 4CYDA 1KU2A 1U5TB 3FX3A 3Q9SA 2L02A 5FLXZ 2EFPA 2LKPA 3JSOA 3RPUA 5IT9Z 1XCVA 1FP1D 2K02A 3T5XA 2FBHA 1Y0UA 1C0WA 1KA8A 2GXGA 5TRDA 2P5VA 3R61A 1HKTA 1U5TC 2CW0F 1MGTA 4UV9A 5L3EA 3BPVA 5EEHA 1S7AA 3V7SA 2FU4A 4N9IA 1KQ8A 3KP2A 3HSRA 3TKYA 3IRRA 2W84A 4P55A 1WI9A 1I6XA 1F4KA 3CJNA 1ZLJA 4S04A 5DCMA 2YSRA 5ILSA 1DPUA 2HOEA 3GFIA 4P9FA 3E3VA 4MEXF 1FSHA 2DBBA 4RAZA 4CICA 4LLNA 3HTSB 1EV7A 3MWMA 4GCVA 5BS6A 3GX4X 1WQ2A 4IHSA 3U9GA 4ENJA 2NNNA 3L9FA 5CYVA 1W4MA 1H9TA 5E1ZB 2KIMA 1H0MA 4KIBA 4UHTA 1XGNA 5L3FA 1B9NA 3Q5FA 2QYOA 5LRRA 3ML6A 5KVRA 4UVAA 2P6SA 3VEPA 1Z9CA 4HF0A 4G6DA 4MQ9F 5ICFA 3NEUA 2L01A 2EB7A 2GA1A 3E97A 2FE3A 1L3LA 1R7JA 1OMIA 1FBQA 2FA5A 3RTRA 3WTUC 2HEOA 2P7CB 2K27A 1R1UA 1GXPA 1IRFA 4ETSA 1LJ9A 4D0PA 1AOYA 1I5ZA 2ZXJA 2P4WA 1O7FA 1HXDA 2RKHA 3SZPA 3SFZA 4NHJA 3LQRA 1BM9A 1FYLA 4LMYA 3H92A 2L4AA 1OKRA 2B0LA 2K86A 1FNNA 3P9KA 2Z9OA 3I54A 3GUDA 1O3TA 1OR7A 1XGOA 4GYGA 2VOOA 4IF4A 3FWEA 2H94A 1IW7F 4HBLA 2W25A 2A07F 2H27A 3GO5A 1TQPA 2JT1A 2E1CA 1D3YA 4BNCA 4A0YA 1Z91A 1BI1A 5D5VB 1TNTA 4KDPA 1UHMA 1BI3A 4OMZA 3K9TA 2NS0A 2O6GE 1MJAA 5LHHA 4KFCA 3KP7A 1UFMA 4WCGA 3KP6A 2RVCA 4EGYA 3WODF 5BQTA 1TLHB 4Y15A 3BOQA 3WU0A 3SZTA 1JXSA 2HDCA 2HWVA 2Q2EA 3K0LA 3R60A 2ZJ2A 2X0LA 1BN5A 2BGCA 4AD9A 2ESNA 1T0FA 4FHTA 4ESJA 1O3SA 1A04A 4M71A 3C1DA 3NRVA 4ZYHA 2XAGA 3BWGA 1YG2A 5FO5A 5E8IA 4U7DA 3HUGA 2ZMEA 5DEQA 2UWMA 4ENNA 2F5EA 2IRFG 3WTWC 4XRFA 1RI7A 3VB2A 5L3DA 3C3WA 3VFZA 1RUOA 2Z33A 1U3EM 3MEXA 4HDVA 1UB9A 3WU1B 2FBKA 3HYIA 4EJVA 5DCMB 2QENA 2GXBA 3HIFA 4HDUA 5D5UB 1U5TA 4RGXA 3F8NA 2HYFA 3KFWX 4Y13A 1HSTA 5DUKA 4IRIA 4F7ZA 2OQRA 2A6HF 3V8LA 5D8LB 4CGZA 2YX4A 1T38A 4Q4ZF 2E1NA 2LF7A 5LHIA 2RN7A 1YW8A 2Y0MA 2HS5A 1W7PA 1XCBA 2X4HA 3HRSA 1J5YA 1BC7C 4KIFA 4BXUA 2PN6A 3DP7A 4P5OA 1YW9A 1LVAA 2DT5A 1MJ9A 3QU6A 3DQVC 4CHUA 1FY7A 3K1MA 2HR3A 1YIOA 2NNYA 3O3KA 2TDXA 2LF8A 3ECHA 2PJPA 3WE3A 3TOBA 2QUFA 4MGRA 2CSOA 3JSPA 2O03A 3HSFA 1E2XA 4L9TA 3HRUA 2CO5A 5FFXA 1Z1DA 4BAYA 2HQRA 2QBYA 3E6CC 2W24A 1B6AA 5E8GA 3K1PA 3W6JB 4MNUA 3WTTC 4MTEA 3C7JA 2MLGA 3F8BA 1HW5A 5D4SA 1R5GA 2XV4S 4I09A 5H6QA 1UCRA 1T2KA 2MA3A 1PUEE 1I1GA 4ZYDA 2K4JA 1SD4A 4QWQA 3M9AA 4WXDA 2VODA 3CO7C 2JPCA 3LAJA 1ZAOA 1JHHA 2V1XA 2QQBA 3EETA 2YU3A 5BMZA 4OIQF 3MZYA 2CYYA 3F3XA 2UZKA 1FYMA 2NYXA 1SAXA 5FB2A 3O6BB 4EM2A 1ZH5A 2EFOA 5CVJA 2HQNA 4OU0A 3SXYA 5CJ9A 1U6GA 3HOTA 4KN7X 2VBXA 3DEUA 4LK0F 2NRAC 3M8EA 5K5OA 1IN6A 3CO6C 2WTEA 2HZTA 3P7NA 1WSUA 1HW1A 5DCFA 4XSXF 1HKQA 1WKMA 2OD5A 4KYWA 2H6BA 3T8TA 4M72A 4Y17A 4IJAA 4N9HA 3NQOA 2BV6A 2V9VA 2HKOA 4P9UA 3T8RA 5LBQA 3IHUA 3F6VA 1R22A 3ISPA 4O5VA 1KYWA 3BJAA 4ZZDA 2A69F 2CFXA 1IN5A 2ZMEB 3FM3A 1MDMA 2XIGA 1EH6A 4G9YA 4HQEA 2ADUA 4R79A 2DTRA 3ROUA 3P9CA 2F2EA 4ZYEA 3LSTA 3V8KA 5K5RA 3TO9A 2EA2A 1R23A 3ZN0A 1J0RA 3OOPA 1PP8F 4KUMA 1RIOH 4IHTA 1UHWA 2IW5A 3BROA 2D1HA 4YFNF 1IXSB 5LRSA 5ICCA 5DYMA 3EYYA 2Y48A 4EJWA 1T98A 1DUXC 1GXQA 2PMHA 2VT3A 2VN2A 4WWCA 4JK1X 4M9XA 2ZNYA 2ZKZA 5ED4A 1FT9A 1PDNC 4XSZF 3F23A 4WK8F 2OAZA 1BIAA 1YYVA 4L0YB 2DW4A 2BEOA 1W7PB 3LWFA 3ZQ7A 2R3SA 2ACJA 2Y75A 3C18A 3HOSA 1TW2A 2MLKA 3R6SA 2FEZA 4GYIA 4QLCU 4EV0A 4AIKA 3EDPA 1YW7A 3FXQA 4GO1A 5LGUA 3LA2A 3OV8A 3DPLC 1ON2A 1L0OC 1D8JA 5L3CA 1KGSA 2H6CA 1LEAA 3GZ6A 2CGPA 1ZRCA 5E17F 1GHCA 1IN8A 4ZZLA 4RGUA 3JAMK 4MHGA 1XGMA 4HLYA 2F5FA 2QBYB 1IN7A 5LGTA 3IWZA 4JQFA 4ESBA 2IVMA 1STZA 3LA3A 2GIVA 1E17A 1FPQA 2FNAA 3ZMUA 1SD6A 2VBZA 6PAXA 4OIOF 4ASNA 5LLQA 3WTVC 1W5SA 4RGRA 4HV6A 2L4MA 2E7WA 4IVNA 1ZARA 1JHFA 1IXCA 1SD5A 2WWYA 3D5LA 1RUNA 3F21A 2XRNA 3KP3A 2G9WA 2STTA 5A2QZ 2EV5A 3S2WA 2VONA 2ZNZA 1G6NA 4YIIA 2FMLA 5E20A 3H3ZA 4HLXA 3RJPA 1SMTA 3FXUA 1FWZA 4IXAA 2L54A 3GXOA 2FOKA 1QNTA 2OU2A 5HLGA 3ABUA 1B4AA 2PG4A 2P6TA 4E70A 4UVBA 3F72A 3EUHA 4LFUA 3CDHA 1SFEA 2F5CA 1VTNC 3F6OA 5FGMA 3M7GA 3I0TA 2K7LA 1R58A 4G6QA 1KYZA 5FLXK 3L2CA 3B73A 5K1YA 1QO0D 2DI3A 3KEOA 2H09A 5CVVA 3KCCA 4RB0A 2IPQX 1IN4A 4L9JA 5IT9K 1XDUA 4OIRF 4PGHA 1USSA 4OMYA 1R1VA 1XD7A 2R7FA 4RS8A 1SFUA 3ECOA 2Z99A 4M6YA 5TJJA 4A5MA 2FNPA 5HDKA 1U8RA 1S8NA 2BBYA 2DPDA 1ONVA 5LHGA 5K5QA 1P4WA 1K79A 4I2OA 3F22A 1LEBA 2J5OA 3AAFA 4Q47A 4HX8A 3HHHA 2XAQA 1MDMB 1J75A 1K6OA 1D5VA 4I7HA 4JBAA 1ZLKA 4AIHA 3V4GA 3SQNA 2EFNA 4U0WA 3KZYA 3ABTA 3CLOA 2VOPA 2CWEA 4RB2C 3IWFA 3MAJA 3ZMZA 2UXXA 4WF2A 1G4DA 1OYWA 5J8CA 4CO8A 1FSEA 4M9SA 4U7BA 3T0YA 3L09A 3T1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFK A;  1KU9 A;  2RGV A;  1ULY A;  4WXH A;  3FMS A;  2PI0 A;  3QP5 A;  3M1E A;  2VT2 A;  4AIJ A;  1JGS A;  3REO A;  1X3U A;  4R8H A;  1ZG3 A;  1ZGJ A;  1MZB A;  2DK5 A;  2QQ9 A;  1HW2 A;  3E5X A;  2O0Y A;  4BQA A;  1YS7 A;  3MCZ A;  4HA8 A;  2RNJ A;  5ILU A;  3RYR A;  1SMY F;  5JVT A;  2PBI A;  2ISY A;  4HX7 A;  4Z2Y A;  4LLG F;  2A3S A;  2HGC A;  2NAZ A;  1ON1 A;  3LFK A;  2VC1 A;  3GVA A;  2VBY A;  2EFQ A;  2PQ8 A;  3KP5 A;  1LQ1 A;  3LQQ A;  4HZF A;  1J59 A;  2ISZ A;  1KQ9 A;  1BJA A;  1FP2 A;  4GXO A;  4HW0 A;  3HHG A;  3J80 Z;  1MD0 A;  3DXJ F;  3RDI A;  3R0A A;  2DFI A;  1XSD A;  4CZZ A;  2COM A;  2QM3 A;  2RC4 A;  4EQQ A;  3IC7 A;  5CLS A;  4A12 A;  1DDN A;  2Q0O A;  1WRJ A;  2V1D A;  3H3U A;  4EJO A;  2DQR A;  3FM5 A;  4KA4 A;  2G7H A;  4S05 A;  2M8E A;  2OQG A;  2DAO A;  2FXA A;  1YO5 C;  2LNB A;  1T39 A;  1B59 A;  2OA4 A;  1F9N A;  4UVC A;  3ZMT A;  3SHF A;  3LA7 A;  4G7H F;  1Z7U A;  3F8C A;  5D5W B;  4KMF A;  1OPC A;  4EVI A;  3ZP5 A;  1IAW A;  2A5Y B;  4DQ2 A;  4UUV A;  1K78 B;  3FMQ A;  4BHC A;  1ZRF A;  3DV8 A;  3O2P E;  2JSC A;  1IZ1 A;  1XB4 A;  4YIF A;  3QU3 A;  1Q1H A;  5F1R A;  4I98 B;  5J6X A;  4LB6 B;  1BC8 C;  4M73 A;  2O8X A;  3WTX C;  3FXR A;  3KET A;  5CVR A;  1XGS A;  3VOD A;  1TBX A;  4A6D A;  5FFZ A;  2P8T A;  3TO7 A;  5AON A;  2EK5 A;  4I0A A;  1O57 A;  3HTU A;  4UXN A;  4TV7 A;  5H20 A;  4HOB A;  2FSW A;  4LB5 A;  3RPQ A;  3F8M A;  4Q48 A;  3ERE D;  1DPR A;  3K69 A;  3CUO A;  5BOX A;  1BBY A;  1QZZ A;  4M9Z A;  4XLN F;  5DUI A;  5FD6 A;  2ZFW A;  4M6X A;  2Z3Y A;  2ZCW A;  1H9G A;  1KQ0 A;  1YFH A;  4Q5S F;  2JTV A;  1IXR C;  2CQK A;  4P96 A;  2GWR A;  1KU3 A;  2C6Y A;  5HLI A;  3R4K A;  4R1H A;  3GZ5 A;  4BYY A;  2D2W A;  5HVQ C;  3IKV A;  2YX7 A;  2YPR A;  3J7A O;  4IPA A;  5D6F A;  5JFR A;  4L18 B;  3BPX A;  1FOK A;  1Z6T A;  3BJ6 A;  1Z6R A;  4G7O F;  3PQK A;  3GFL A;  2FQ3 A;  5L3B A;  1R00 A;  2DK8 A;  3RI4 A;  1BIB A;  4CXF A;  3J81 Z;  4I02 A;  4G8X A;  3DKW A;  4B09 A;  3V7R A;  5CVU A;  5ERI A;  2P5K A;  1HQC A;  2DLL A;  4HAM A;  4EMS A;  3FMR A;  2EFW A;  3GFJ A;  4LD5 A;  2RQP A;  2M87 A;  3KLO A;  2XAH A;  1CF7 A;  2D45 A;  2EA4 A;  5JR3 A;  3RKX A;  1ZG5 A;  2LDU A;  1O3R A;  5LEJ A;  4H0E A;  3IRQ A;  1FBU A;  3JTH A;  4U0V A;  2EJR A;  4KN4 X;  2R7D A;  4ESF A;  1YLF A;  1EH7 A;  1FX7 A;  2QQA A;  1ZRD A;  4M74 A;  3FHZ A;  5E1W A;  5EEG A;  2XUB A;  3WE2 A;  3K1N A;  1GVJ A;  2GAU A;  4KIG A;  1IUY A;  2HFH A;  3CUQ C;  2F5D A;  4XLP F;  4HYE A;  2IP2 A;  2JZY A;  3KE2 A;  3RKY A;  2DO7 A;  1QGP A;  2FMY A;  1TQI A;  3QAH A;  4LJZ F;  2OZ6 A;  2P7V B;  2JPB A;  2BYV E;  2VE8 A;  3MZH A;  4ON0 A;  4KNY A;  1F5T A;  4AVP A;  1WWX A;  4BHB A;  4HX4 A;  3BY6 A;  1XDS A;  3DPT A;  1J9I A;  2CG4 A;  2XVC A;  2PLY A;  4A0X A;  3I53 A;  2ETH A;  4IRG A;  3TO6 A;  4U0Y A;  2PMU A;  3L00 A;  1J7K A;  3WGG A;  4OOI A;  4AWX B;  4A0Z A;  5JI6 A;  4OIP F;  3I5U A;  1ZHF A;  2EWN A;  2A68 F;  3I71 A;  4XBF A;  1TQM A;  5BPI A;  4EGZ A;  4YFK F;  3ZPL A;  1ZG1 A;  2FF4 A;  2QLZ A;  1REP C;  1NHA A;  4FX0 A;  3J81 K;  1K7A A;  1BI0 A;  1RNL A;  2G7U A;  5HS9 A;  3TDU C;  5D4R A;  1LDK B;  4WXC A;  1G3S A;  1P6R A;  4YG2 F;  2DPU A;  1K78 A;  3P9I A;  3GYH X;  4HF2 A;  3I59 A;  4O3M A;  5FD5 A;  3G3Z A;  1G3T A;  3DF8 A;  3V8J A;  1HBX G;  2ELH A;  5E18 F;  4ENM A;  2J5P A;  3WTZ A;  1SFX A;  4FT8 A;  4L0Z B;  5D5X B;  2VBW A;  4L9V A;  3V7C A;  4RB3 C;  1FLI A;  2IT0 A;  1IF1 A;  1LDJ A;  2HTS A;  1ZN2 A;  1FC3 A;  4LLL A;  1LNW A;  2IA0 A;  3QPT A;  2PFB A;  5ICG A;  2OZU A;  1P4X A;  1PP7 U;  5HS8 A;  4BH9 A;  4HV5 A;  1AWC A;  2QWW A;  1BOA A;  2XKO A;  5DV5 A;  3B02 A;  3E6D A;  5DDG A;  3EQL F;  2LSO A;  1W7P D;  3BDD A;  2STW A;  3E5Q A;  1QBJ A;  1HKS A;  2ESH A;  5ICE A;  3I64 A;  5F64 A;  3D0S A;  2V79 A;  3WGH A;  4I01 A;  1T6S A;  4CDG A;  2KIF A;  4L9N A;  4A6E A;  3KEQ A;  3DFG A;  1G3W A;  1UST A;  1EH8 A;  5F6F A;  3ZN1 A;  4RGS A;  3WTS C;  5J8F A;  2XRO A;  2UXN A;  1XSV A;  1CGP A;  3BP8 A;  2M30 A;  1CF7 B;  1ZRE A;  3WGI A;  1ZYR F;  3QPH A;  4NQW A;  4LGW A;  3IKT A;  4A5N A;  2Z5U A;  3CTA A;  3M8F A;  2P5L C;  2D1V A;  2JRT A;  4LG0 B;  5LEK A;  3GW2 A;  2Q8K A;  2GA2 A;  2M1B A;  3RYP A;  5D6E A;  2L3D A;  3BZ6 A;  3HRT A;  1KU7 A;  2XGX A;  5KK1 A;  2O61 A;  2MH2 A;  2AS5 F;  1V3F A;  2O3F A;  3W6K B;  3FZV A;  3F8F A;  3MQ0 A;  2FBI A;  2BE5 F;  4HF1 A;  3GF2 A;  2QVO A;  2KRF A;  3GWZ A;  5CVI A;  2VXZ A;  4KMU X;  1R1T A;  2FRH A;  5L3G A;  2HTJ A;  3CUQ A;  1J2X A;  3ZMS A;  1U2W A;  1F1Z A;  5A2Q K;  3ZMV A;  1QZY A;  4EJT A;  1LDD A;  2GQQ A;  4KIC A;  2M5W A;  3HSE A;  2HKX A;  3RIR A;  3COA C;  1V4R A;  3E5U A;  4G94 A;  1I1S A;  2V1U A;  2MC3 A;  1FZP B;  4UV8 A;  5HS7 A;  5JHU A;  3WG9 A;  1S6L A;  1P92 A;  2XHK A;  2VE9 A;  1B1B A;  5IT3 A;  2AXL A;  1R5H A;  4MTD A;  3VOE A;  1FBS A;  1FYK A;  2HYG D;  1IRG A;  3TQN A;  1ZGA A;  5AIP A;  2K4B A;  4G7Z F;  1HSJ A;  4PDK A;  4KT5 C;  1TTY A;  3JW4 A;  4EM1 A;  5DD4 A;  2DU9 A;  2ZBK A;  1OYY A;  4OIN F;  5HDG A;  3ZMD A;  2XAJ A;  1QQI A;  2IA2 A;  3TGN A;  2KKO A;  4BHP A;  2VC0 A;  3GFM A;  3I59 B;  2MD5 A;  1Z05 A;  4GGG A;  4ZH4 F;  1O7L A;  3LAP A;  3BJO A;  4UNO A;  3L7W A;  3Q9V A;  1R36 A;  4MEY F;  1MJB A;  1TW3 A;  2KIU A;  1P2F A;  3KLN A;  4I0B A;  4IRH A;  4FX4 A;  1ODD A;  2KJB A;  3K2Z A;  3ULQ B;  3PFI A;  2GZW A;  1S29 A;  1I27 A;  2MH9 A;  2YR2 A;  2KJC A;  3R0J A;  2DQL A;  5DD8 A;  4RB1 A;  1S7O A;  1TNS A;  3QP6 A;  5E1X A;  2OBP A;  5HLH A;  1U78 A;  1G3Y A;  3I4P A;  1MKM A;  1YQA A;  2A6E F;  2EV6 A;  1OYI A;  1DP7 P;  4U88 A;  3N97 A;  2IJL A;  3E6M A;  2WV0 A;  1W5T A;  3I58 A;  2PEX A;  1B9M A;  3JTG A;  2W57 A;  4MQV A;  4EM0 B;  4PGG A;  4ZYG A;  3U1D A;  2A61 A;  3KP4 A;  3U2R A;  1SD7 A;  2E7X A;  1LB2 A;  2EV0 A;  1RZ4 A;  5H6R A;  4K2E A;  4A2U A;  1XMA A;  3E6B A;  5ILV A;  5HDN A;  3G73 A;  4PCQ A;  5BPD A;  3JAM Z;  2MBF A;  4L5J A;  3J80 K;  3KZZ A;  3WTY C;  4HQM A;  2IA1 A;  1S3J A;  3QRF F;  4DNC A;  1YTY A;  1JE8 A;  2RV8 A;  3ELK A;  4ENK A;  5D8K B;  1XSX A;  3QOP A;  3RKW A;  5LGN A;  3IL2 A;  4O6J A;  4L5I A;  2W85 A;  3TDZ C;  4N0B A;  4PZJ A;  4B8X A;  3PQJ A;  2V6C A;  4WX9 A;  1YS6 A;  2M45 A;  1QPM A;  4RAY A;  2RDP A;  3GLX A;  1XN7 A;  2XKP A;  4YFX F;  3N4M A;  3GEZ A;  1D8K A;  3CUQ B;  1BI2 A;  1O3Q A;  1XMK A;  2ZO4 A;  2XAF A;  3TOA A;  4NB5 A;  2QZ8 A;  3EYI A;  5AIQ A;  3FF5 A;  4EJU A;  4LG0 A;  5HOO A;  2WC2 A;  1P4A A;  2XAS A;  4LK1 F;  3HRM A;  4CYD A;  1KU2 A;  1U5T B;  3FX3 A;  3Q9S A;  2L02 A;  5FLX Z;  2EFP A;  2LKP A;  3JSO A;  3RPU A;  5IT9 Z;  1XCV A;  1FP1 D;  2K02 A;  3T5X A;  2FBH A;  1Y0U A;  1C0W A;  1KA8 A;  2GXG A;  5TRD A;  2P5V A;  3R61 A;  1HKT A;  1U5T C;  2CW0 F;  1MGT A;  4UV9 A;  5L3E A;  3BPV A;  5EEH A;  1S7A A;  3V7S A;  2FU4 A;  4N9I A;  1KQ8 A;  3KP2 A;  3HSR A;  3TKY A;  3IRR A;  2W84 A;  4P55 A;  1WI9 A;  1I6X A;  1F4K A;  3CJN A;  1ZLJ A;  4S04 A;  5DCM A;  2YSR A;  5ILS A;  1DPU A;  2HOE A;  3GFI A;  4P9F A;  3E3V A;  4MEX F;  1FSH A;  2DBB A;  4RAZ A;  4CIC A;  4LLN A;  3HTS B;  1EV7 A;  3MWM A;  4GCV A;  5BS6 A;  3GX4 X;  1WQ2 A;  4IHS A;  3U9G A;  4ENJ A;  2NNN A;  3L9F A;  5CYV A;  1W4M A;  1H9T A;  5E1Z B;  2KIM A;  1H0M A;  4KIB A;  4UHT A;  1XGN A;  5L3F A;  1B9N A;  3Q5F A;  2QYO A;  5LRR A;  3ML6 A;  5KVR A;  4UVA A;  2P6S A;  3VEP A;  1Z9C A;  4HF0 A;  4G6D A;  4MQ9 F;  5ICF A;  3NEU A;  2L01 A;  2EB7 A;  2GA1 A;  3E97 A;  2FE3 A;  1L3L A;  1R7J A;  1OMI A;  1FBQ A;  2FA5 A;  3RTR A;  3WTU C;  2HEO A;  2P7C B;  2K27 A;  1R1U A;  1GXP A;  1IRF A;  4ETS A;  1LJ9 A;  4D0P A;  1AOY A;  1I5Z A;  2ZXJ A;  2P4W A;  1O7F A;  1HXD A;  2RKH A;  3SZP A;  3SFZ A;  4NHJ A;  3LQR A;  1BM9 A;  1FYL A;  4LMY A;  3H92 A;  2L4A A;  1OKR A;  2B0L A;  2K86 A;  1FNN A;  3P9K A;  2Z9O A;  3I54 A;  3GUD A;  1O3T A;  1OR7 A;  1XGO A;  4GYG A;  2VOO A;  4IF4 A;  3FWE A;  2H94 A;  1IW7 F;  4HBL A;  2W25 A;  2A07 F;  2H27 A;  3GO5 A;  1TQP A;  2JT1 A;  2E1C A;  1D3Y A;  4BNC A;  4A0Y A;  1Z91 A;  1BI1 A;  5D5V B;  1TNT A;  4KDP A;  1UHM A;  1BI3 A;  4OMZ A;  3K9T A;  2NS0 A;  2O6G E;  1MJA A;  5LHH A;  4KFC A;  3KP7 A;  1UFM A;  4WCG A;  3KP6 A;  2RVC A;  4EGY A;  3WOD F;  5BQT A;  1TLH B;  4Y15 A;  3BOQ A;  3WU0 A;  3SZT A;  1JXS A;  2HDC A;  2HWV A;  2Q2E A;  3K0L A;  3R60 A;  2ZJ2 A;  2X0L A;  1BN5 A;  2BGC A;  4AD9 A;  2ESN A;  1T0F A;  4FHT A;  4ESJ A;  1O3S A;  1A04 A;  4M71 A;  3C1D A;  3NRV A;  4ZYH A;  2XAG A;  3BWG A;  1YG2 A;  5FO5 A;  5E8I A;  4U7D A;  3HUG A;  2ZME A;  5DEQ A;  2UWM A;  4ENN A;  2F5E A;  2IRF G;  3WTW C;  4XRF A;  1RI7 A;  3VB2 A;  5L3D A;  3C3W A;  3VFZ A;  1RUO A;  2Z33 A;  1U3E M;  3MEX A;  4HDV A;  1UB9 A;  3WU1 B;  2FBK A;  3HYI A;  4EJV A;  5DCM B;  2QEN A;  2GXB A;  3HIF A;  4HDU A;  5D5U B;  1U5T A;  4RGX A;  3F8N A;  2HYF A;  3KFW X;  4Y13 A;  1HST A;  5DUK A;  4IRI A;  4F7Z A;  2OQR A;  2A6H F;  3V8L A;  5D8L B;  4CGZ A;  2YX4 A;  1T38 A;  4Q4Z F;  2E1N A;  2LF7 A;  5LHI A;  2RN7 A;  1YW8 A;  2Y0M A;  2HS5 A;  1W7P A;  1XCB A;  2X4H A;  3HRS A;  1J5Y A;  1BC7 C;  4KIF A;  4BXU A;  2PN6 A;  3DP7 A;  4P5O A;  1YW9 A;  1LVA A;  2DT5 A;  1MJ9 A;  3QU6 A;  3DQV C;  4CHU A;  1FY7 A;  3K1M A;  2HR3 A;  1YIO A;  2NNY A;  3O3K A;  2TDX A;  2LF8 A;  3ECH A;  2PJP A;  3WE3 A;  3TOB A;  2QUF A;  4MGR A;  2CSO A;  3JSP A;  2O03 A;  3HSF A;  1E2X A;  4L9T A;  3HRU A;  2CO5 A;  5FFX A;  1Z1D A;  4BAY A;  2HQR A;  2QBY A;  3E6C C;  2W24 A;  1B6A A;  5E8G A;  3K1P A;  3W6J B;  4MNU A;  3WTT C;  4MTE A;  3C7J A;  2MLG A;  3F8B A;  1HW5 A;  5D4S A;  1R5G A;  2XV4 S;  4I09 A;  5H6Q A;  1UCR A;  1T2K A;  2MA3 A;  1PUE E;  1I1G A;  4ZYD A;  2K4J A;  1SD4 A;  4QWQ A;  3M9A A;  4WXD A;  2VOD A;  3CO7 C;  2JPC A;  3LAJ A;  1ZAO A;  1JHH A;  2V1X A;  2QQB A;  3EET A;  2YU3 A;  5BMZ A;  4OIQ F;  3MZY A;  2CYY A;  3F3X A;  2UZK A;  1FYM A;  2NYX A;  1SAX A;  5FB2 A;  3O6B B;  4EM2 A;  1ZH5 A;  2EFO A;  5CVJ A;  2HQN A;  4OU0 A;  3SXY A;  5CJ9 A;  1U6G A;  3HOT A;  4KN7 X;  2VBX A;  3DEU A;  4LK0 F;  2NRA C;  3M8E A;  5K5O A;  1IN6 A;  3CO6 C;  2WTE A;  2HZT A;  3P7N A;  1WSU A;  1HW1 A;  5DCF A;  4XSX F;  1HKQ A;  1WKM A;  2OD5 A;  4KYW A;  2H6B A;  3T8T A;  4M72 A;  4Y17 A;  4IJA A;  4N9H A;  3NQO A;  2BV6 A;  2V9V A;  2HKO A;  4P9U A;  3T8R A;  5LBQ A;  3IHU A;  3F6V A;  1R22 A;  3ISP A;  4O5V A;  1KYW A;  3BJA A;  4ZZD A;  2A69 F;  2CFX A;  1IN5 A;  2ZME B;  3FM3 A;  1MDM A;  2XIG A;  1EH6 A;  4G9Y A;  4HQE A;  2ADU A;  4R79 A;  2DTR A;  3ROU A;  3P9C A;  2F2E A;  4ZYE A;  3LST A;  3V8K A;  5K5R A;  3TO9 A;  2EA2 A;  1R23 A;  3ZN0 A;  1J0R A;  3OOP A;  1PP8 F;  4KUM A;  1RIO H;  4IHT A;  1UHW A;  2IW5 A;  3BRO A;  2D1H A;  4YFN F;  1IXS B;  5LRS A;  5ICC A;  5DYM A;  3EYY A;  2Y48 A;  4EJW A;  1T98 A;  1DUX C;  1GXQ A;  2PMH A;  2VT3 A;  2VN2 A;  4WWC A;  4JK1 X;  4M9X A;  2ZNY A;  2ZKZ A;  5ED4 A;  1FT9 A;  1PDN C;  4XSZ F;  3F23 A;  4WK8 F;  2OAZ A;  1BIA A;  1YYV A;  4L0Y B;  2DW4 A;  2BEO A;  1W7P B;  3LWF A;  3ZQ7 A;  2R3S A;  2ACJ A;  2Y75 A;  3C18 A;  3HOS A;  1TW2 A;  2MLK A;  3R6S A;  2FEZ A;  4GYI A;  4QLC U;  4EV0 A;  4AIK A;  3EDP A;  1YW7 A;  3FXQ A;  4GO1 A;  5LGU A;  3LA2 A;  3OV8 A;  3DPL C;  1ON2 A;  1L0O C;  1D8J A;  5L3C A;  1KGS A;  2H6C A;  1LEA A;  3GZ6 A;  2CGP A;  1ZRC A;  5E17 F;  1GHC A;  1IN8 A;  4ZZL A;  4RGU A;  3JAM K;  4MHG A;  1XGM A;  4HLY A;  2F5F A;  2QBY B;  1IN7 A;  5LGT A;  3IWZ A;  4JQF A;  4ESB A;  2IVM A;  1STZ A;  3LA3 A;  2GIV A;  1E17 A;  1FPQ A;  2FNA A;  3ZMU A;  1SD6 A;  2VBZ A;  6PAX A;  4OIO F;  4ASN A;  5LLQ A;  3WTV C;  1W5S A;  4RGR A;  4HV6 A;  2L4M A;  2E7W A;  4IVN A;  1ZAR A;  1JHF A;  1IXC A;  1SD5 A;  2WWY A;  3D5L A;  1RUN A;  3F21 A;  2XRN A;  3KP3 A;  2G9W A;  2STT A;  5A2Q Z;  2EV5 A;  3S2W A;  2VON A;  2ZNZ A;  1G6N A;  4YII A;  2FML A;  5E20 A;  3H3Z A;  4HLX A;  3RJP A;  1SMT A;  3FXU A;  1FWZ A;  4IXA A;  2L54 A;  3GXO A;  2FOK A;  1QNT A;  2OU2 A;  5HLG A;  3ABU A;  1B4A A;  2PG4 A;  2P6T A;  4E70 A;  4UVB A;  3F72 A;  3EUH A;  4LFU A;  3CDH A;  1SFE A;  2F5C A;  1VTN C;  3F6O A;  5FGM A;  3M7G A;  3I0T A;  2K7L A;  1R58 A;  4G6Q A;  1KYZ A;  5FLX K;  3L2C A;  3B73 A;  5K1Y A;  1QO0 D;  2DI3 A;  3KEO A;  2H09 A;  5CVV A;  3KCC A;  4RB0 A;  2IPQ X;  1IN4 A;  4L9J A;  5IT9 K;  1XDU A;  4OIR F;  4PGH A;  1USS A;  4OMY A;  1R1V A;  1XD7 A;  2R7F A;  4RS8 A;  1SFU A;  3ECO A;  2Z99 A;  4M6Y A;  5TJJ A;  4A5M A;  2FNP A;  5HDK A;  1U8R A;  1S8N A;  2BBY A;  2DPD A;  1ONV A;  5LHG A;  5K5Q A;  1P4W A;  1K79 A;  4I2O A;  3F22 A;  1LEB A;  2J5O A;  3AAF A;  4Q47 A;  4HX8 A;  3HHH A;  2XAQ A;  1MDM B;  1J75 A;  1K6O A;  1D5V A;  4I7H A;  4JBA A;  1ZLK A;  4AIH A;  3V4G A;  3SQN A;  2EFN A;  4U0W A;  3KZY A;  3ABT A;  3CLO A;  2VOP A;  2CWE A;  4RB2 C;  3IWF A;  3MAJ A;  3ZMZ A;  2UXX A;  4WF2 A;  1G4D A;  1OYW A;  5J8C A;  4CO8 A;  1FSE A;  4M9S A;  4U7B A;  3T0Y A;  3L09 A;  3T1B A; 
#chains in the Genus database with same CATH topology
 3A2K A;  3MFK A;  4BY1 J;  1KU9 A;  2RGV A;  1ULY A;  3LSJ A;  4WXH A;  2PMZ N;  2Y31 A;  3FMS A;  2PI0 A;  4KIT B;  3QP5 A;  2EIM H;  4X0G A;  3M1E A;  2E71 A;  1YJW I;  2VT2 A;  4AIJ A;  1TWA J;  2K85 A;  1JGS A;  1RR7 A;  4PUS A;  4CCL A;  3REO A;  3OYH A;  1X3U A;  2LVS A;  3H0D A;  4R8H A;  1ZG3 A;  2HDD A;  1D0X A;  1ZGJ A;  1MZB A;  2DK5 A;  3BR0 A;  5K7F A;  2QQ9 A;  1HW2 A;  3E5X A;  5KCM A;  2EZK A;  2O0Y A;  4BQA A;  1YS7 A;  2DA7 A;  3QYE A;  4BL0 B;  2HVR A;  3MCZ A;  2X48 A;  4HA8 A;  1VQP I;  3H35 A;  2LLK A;  4A3M J;  2RNJ A;  4MLO A;  2QKL B;  4S0H B;  3PFY A;  4ZDP A;  5ILU A;  3RYR A;  1SMY F;  5JVT A;  2PBI A;  2K9S A;  2ISY A;  4HX7 A;  2A05 A;  4XM3 A;  2JN6 A;  4Z2Y A;  4BJ5 C;  3CCR I;  2LP0 A;  5E3M A;  3TW7 A;  2ZJQ F;  3FXK A;  5CQG A;  1U8B A;  1YHQ I;  1VQ5 I;  2B9S A;  4LLG F;  2A3S A;  2XB0 X;  2HGC A;  2NAZ A;  1ON1 A;  2L9N A;  2QF7 A;  1LFP A;  1ERD A;  3LFK A;  2VC1 A;  3GVA A;  2VBY A;  2X6O A;  2DOD A;  2EFQ A;  2PQ8 A;  3CF2 A;  3KP5 A;  1QVT A;  1ZTR A;  3OMY A;  2V7F A;  1Z21 A;  1UJ8 A;  1LQ1 A;  2XF6 A;  4HNU A;  2R7W A;  1UZC A;  3LQQ A;  4HZF A;  3ZQL A;  1JKQ C;  1J59 A;  2ISZ A;  1KQ9 A;  1BJA A;  1FP2 A;  1SFK A;  4GXO A;  2NXN B;  4HW0 A;  1JT6 A;  3B6A A;  1YX3 A;  3HHG A;  5FKM A;  3CDI A;  1AA7 A;  3J80 Z;  1MD0 A;  1MMN A;  3DXJ F;  3RDI A;  3BTL A;  2JUC A;  1Y8Q B;  3R0A A;  4F55 A;  2DFI A;  3MD2 A;  2GOM A;  3ZQH A;  2M4K A;  4FTH A;  3PIP F;  1MMG A;  1XSD A;  4RLQ A;  4CZZ A;  2COM A;  2QM3 A;  2RC4 A;  4EQQ A;  3IC7 A;  3VWB A;  5CLS A;  4A12 A;  1DDN A;  2Q0O A;  1WRJ A;  2V1D A;  1MSE C;  3H3U A;  4EJO A;  4D5C A;  4ANJ A;  2DQR A;  3EUA A;  3FM5 A;  4B4C A;  4KA4 A;  2E19 A;  2L9R A;  2G7H A;  2VKV A;  3BR6 A;  3H1C A;  4B43 A;  2R7O A;  1X19 A;  4S05 A;  2M8E A;  2OQG A;  2GLO A;  2DAO A;  2FXA A;  1YO5 C;  2E5Z A;  2LNB A;  1T39 A;  1B59 A;  4HEA 2;  2WAE A;  4Z6Y A;  1XC5 A;  2OA4 A;  1F9N A;  4UVC A;  2K9N A;  1MW7 A;  3ZMT A;  3SHF A;  3OYG A;  3LA7 A;  4G7H F;  1Z7U A;  3F8C A;  5D5W B;  1ZR2 A;  3ERM A;  1DGR M;  3HC7 A;  4KMF A;  4OWR B;  1OPC A;  1LUJ B;  4EVI A;  3ZP5 A;  2X9D A;  1W0U A;  2K3F A;  1IAW A;  2A5Y B;  4DQ2 A;  1SAN A;  4UUV A;  3GTO J;  3HXL A;  1K78 B;  3OSF A;  1IDY A;  3FMQ A;  1WZ2 A;  4BHC A;  1ZRF A;  3F0C A;  3DV8 A;  2BY0 A;  3KPH A;  3WHC A;  3O2P E;  3K70 D;  1BOB A;  1YIT I;  3SZG A;  2JSC A;  1IZ1 A;  2CH0 A;  1XB4 A;  4JOM A;  4YIF A;  4D5F A;  3QU3 A;  1Q1H A;  5B5E C;  5F1R A;  3OS1 A;  4I98 B;  2NS7 A;  5J6X A;  3KEY A;  4LB6 B;  1BC8 C;  4M73 A;  2O8X A;  3WTX C;  3DEE A;  1MBE A;  3FXR A;  3BG6 A;  3KET A;  1ACI A;  5CVR A;  2DMP A;  1XGS A;  2XPW A;  3KIO A;  3VOD A;  1TBX A;  4YEJ A;  4A6D A;  1VQ8 I;  3DTE A;  5FFZ A;  2P8T A;  3TO7 A;  5AON A;  2EK5 A;  4I0A A;  2HPM A;  2AHQ A;  2DA3 A;  1O57 A;  1T33 A;  3HTU A;  1SC7 A;  2JMW A;  4BAC A;  4ZYA A;  4UXN A;  4TV7 A;  5H20 A;  3VYT B;  4HOB A;  1PJR A;  2FSW A;  4BDZ A;  4LB5 A;  3RPQ A;  1TL8 A;  3A4C A;  3F8M A;  4Q48 A;  4DYC A;  1T95 A;  3UNG C;  2DMU A;  3ERE D;  2L0K A;  1DPR A;  4PJJ A;  3AG2 H;  3CUO A;  1UMQ A;  3K69 A;  2VPR A;  1BBY A;  1QZZ A;  4M9Z A;  1TZL A;  4XLN F;  5FD6 A;  5DUI A;  5FJ8 J;  2ZFW A;  4M6X A;  2Z3Y A;  2ZCW A;  1H9G A;  1KQ0 A;  1IC8 A;  3DBL B;  5IP9 J;  3DU6 A;  1YFH A;  3CCM I;  4Q5S F;  5JHF A;  4NNJ A;  2JTV A;  2LBF A;  1IXR C;  2K3P A;  1DQU A;  2CQK A;  1VND A;  4P96 A;  2GWR A;  5M5X J;  1KU3 A;  4XON A;  2C6Y A;  2HQA A;  1B8I B;  1WI3 A;  1K4S A;  2IGO A;  3CMA I;  2WB1 N;  2BY2 A;  5HNH A;  5HLI A;  3R4K A;  4R1H A;  4C9Y A;  2DOA A;  3OYD A;  2H1K A;  3CCY A;  3HM5 A;  1YI2 I;  3FXM A;  4C3I J;  3GZ5 A;  4BYY A;  2D2W A;  5HVQ C;  3E1S A;  2LK2 A;  4B48 A;  3IKV A;  2YX7 A;  2UV1 A;  2F4I A;  2YPR A;  3J7A O;  4IPA A;  1R5I D;  5D6F A;  5JFR A;  4L18 B;  2HU9 A;  3S32 A;  3BPX A;  1FOK A;  3GTQ J;  1Z6T A;  3BJ6 A;  1Z6R A;  1JGG A;  4G7O F;  2BOL A;  3PQK A;  3LL7 A;  3AL0 B;  3GFL A;  3IP4 B;  2FQ3 A;  3K10 A;  5L3B A;  1R00 A;  5C3E J;  4E4H A;  2ELK A;  2PX9 A;  3C2G A;  5GTI C;  2DK8 A;  1Y8R B;  3RI4 A;  1R49 A;  2M2E A;  3W3C A;  3V42 A;  1S9H A;  1BIB A;  4P1W A;  4CXF A;  5HNF A;  2KHM A;  3BTC A;  3J81 Z;  3RZO J;  4I02 A;  3SJM A;  2L9S A;  3QOE A;  4G8X A;  4A3D J;  3BQZ A;  1X3W B;  2R92 J;  5TIS C;  3UKG A;  5IP6 A;  3DKW A;  4B09 A;  3V7R A;  5CVU A;  1VQM I;  3BQY A;  3DBH B;  3OYM A;  5ERI A;  4XKV A;  2DMT A;  3O8H A;  2P5K A;  4M3D A;  3PL8 A;  4RAG A;  3AL0 C;  1FEX A;  1HQC A;  2VB6 A;  2DLL A;  1U9O A;  2LY2 A;  4HAM A;  4EMS A;  1S7E A;  3FMR A;  2EFW A;  1A31 A;  3MMY B;  2V4J C;  4V2G A;  2DA5 A;  3GFJ A;  4LD5 A;  3FK7 A;  1QPI A;  5KHD A;  1JKP C;  3BG9 A;  2RQP A;  3W2W A;  1FTT A;  2M87 A;  3KLO A;  2BHZ A;  1X3Z B;  2XAH A;  1R9T J;  4C2T A;  2GOX B;  2TRT A;  3U21 A;  3I9V 2;  1CF7 A;  4H4K C;  2D45 A;  2KMU A;  2EA4 A;  2R5Y A;  5JR3 A;  3RKX A;  3BG7 A;  1ZG5 A;  4GFB A;  2LDU A;  1O3R A;  1WGX A;  5LEJ A;  2GXA A;  5DTD A;  4H0E A;  3IRQ A;  1Y1W J;  1FBU A;  3JTH A;  4U0V A;  4W1U A;  2EJR A;  4KN4 X;  2R7D A;  4ESF A;  1YLF A;  1EH7 A;  2NS8 A;  2CFO A;  1FX7 A;  2QQA A;  4ITV A;  1ZRD A;  4M74 A;  3FHZ A;  5E1W A;  1W36 C;  5EEG A;  2XUB A;  3TBI A;  1XTA A;  3WE2 A;  4E7J A;  3K1N A;  3OL4 A;  1GVJ A;  2CV1 A;  2GAU A;  2HI3 A;  2HNH A;  4KIG A;  1YJN I;  1IUY A;  3ZRG A;  2HFH A;  4OAY A;  5B1A H;  3OR2 C;  3IV5 A;  3CUQ C;  1BW6 A;  1HLV A;  1BW5 A;  1ETV A;  2RRE A;  2F5D A;  2XPV A;  4XLP F;  4M3B A;  4HYE A;  2IP2 A;  4KT6 A;  2JZY A;  3KE2 A;  3PNY A;  3RKY A;  1ORK A;  1Z3Y A;  2DO7 A;  4QTR A;  1QGP A;  2QSH X;  2FMY A;  4F52 A;  1TQI A;  3QAH A;  4LJZ F;  4BE1 A;  2OZ6 A;  4QPO A;  3JRD A;  2P7V B;  2JPB A;  1NK2 P;  3M4O J;  2BYV E;  1B72 A;  3W2A A;  2VE8 A;  3MZH A;  5CKT A;  4ON0 A;  4KNY A;  1F5T A;  2HVQ A;  4AVP A;  4J00 A;  1WWX A;  4BHB A;  4HX4 A;  3BY6 A;  1XDS A;  2OV7 A;  3DPT A;  2LKX A;  1J9I A;  2K5C A;  2CG4 A;  1M1E B;  2XVC A;  3LSM A;  4A3J J;  2PLY A;  4A3E J;  5CPR B;  3OIP A;  4A0X A;  5EDN A;  3H5A A;  2CUJ A;  2ETH A;  3I53 A;  4IRG A;  3TO6 A;  4BY7 J;  3ZCO A;  1O4X A;  4U0Y A;  2PMU A;  3NWT A;  2Y30 A;  2MYS A;  2XDV A;  3L00 A;  5BNG A;  1J7K A;  3WGG A;  5LFA A;  4OOI A;  4AWX B;  4A0Z A;  2CMP A;  3OS0 A;  5JI6 A;  4OIP F;  5HLT A;  3I5U A;  1ZHF A;  2EWN A;  1AU7 A;  4A3G J;  5EZG A;  3M3Y J;  3S1M J;  3S17 J;  3JRE A;  2A68 F;  4NDL A;  1GT0 C;  2MSY A;  4XID A;  3I71 A;  2UUZ A;  2DFF A;  4XBF A;  2XC7 A;  1TQM A;  3CC2 I;  1IG7 A;  5BPI A;  3GCM A;  4EGZ A;  3LSR A;  4YFK F;  3ZPL A;  2DOF A;  1ZG1 A;  1ZEL A;  3X2Q H;  2FF4 A;  1OLT A;  2QLZ A;  4D7M A;  5J4V A;  1REP C;  1NHA A;  3OYB A;  4FX0 A;  3J81 K;  2F6C A;  3L2U A;  2LR8 A;  1K7A A;  1OJL A;  1BI0 A;  2HOS A;  4B47 A;  1BL0 A;  1D5Y A;  1X1P A;  1RNL A;  2G7U A;  5HS9 A;  3TDU C;  4JYK A;  5D4R A;  4XLF A;  1G2H A;  1LDK B;  4WXC A;  3PSF A;  1G3S A;  1Y0N A;  3BTJ A;  1P6R A;  3BR3 A;  4YG2 F;  3ESW B;  1K61 A;  2DPU A;  4G6T B;  1K78 A;  3P9I A;  4JX5 A;  3GYH X;  4HF2 A;  2VPL A;  2LBF B;  3I59 A;  4O3M A;  1IV8 A;  3K6G A;  3CJQ B;  1EA3 A;  5FD5 A;  2O9L A;  3G3Z A;  3SEQ A;  1FTZ A;  5LD2 C;  1G3T A;  2WBM A;  4FE7 A;  3DF8 A;  2XB5 A;  2DTZ A;  2XRL A;  3V8J A;  1HBX G;  1RET A;  2IBD A;  3HL2 A;  3CF5 F;  3J7Y J;  4IO9 F;  2ELH A;  5E18 F;  1HDP A;  4ENM A;  1GDT A;  2ME0 A;  2J5P A;  3WTZ A;  1SFX A;  4FT8 A;  4L0Z B;  5D5X B;  1Q1V A;  2VBW A;  3JCU C;  2DMQ A;  2O8K A;  3QWL A;  1HA8 A;  4L9V A;  3V7C A;  3HKZ A;  3K2A A;  4RB3 C;  1FLI A;  4C3H J;  2IT0 A;  1IF1 A;  1LDJ A;  2E35 A;  2HTS A;  1ZN2 A;  1FC3 A;  1T56 A;  4LLL A;  1LNW A;  2IA0 A;  2OUM A;  2PFB A;  3QPT A;  4XLA A;  2JK3 A;  3OYF A;  2R93 J;  5ICG A;  2F5V A;  2OZU A;  2E2H J;  1P4X A;  4C2U A;  5M3M J;  1PP7 U;  2JJ7 A;  4BH9 A;  5HS8 A;  1ETQ A;  4HV5 A;  1JJ6 C;  1AWC A;  2QWW A;  1BOA A;  4AC0 A;  2XKO A;  5DV5 A;  2ME6 A;  4CCJ A;  1SVO A;  3S2H J;  5EYR A;  1QU3 A;  4UY8 I;  3B02 A;  3E6D A;  5DDG A;  4NC6 A;  1XG1 A;  3EQL F;  2LSO A;  3LMM A;  1E3H A;  1W7P D;  3BDD A;  1X1D A;  4EAT A;  2XSD C;  2CJJ A;  3S1N J;  3BLY A;  5GAH J;  5IYD J;  5C4X J;  1WJA A;  2STW A;  3E5Q A;  1XMX A;  1QBJ A;  1HKS A;  2DA1 A;  2ESH A;  4XRS G;  1YX5 A;  3WU2 C;  1Y1V J;  5ICE A;  3I64 A;  5F64 A;  1D0Z A;  3OYL A;  3D0S A;  2V79 A;  3WGH A;  2KLO A;  2LMD A;  4I01 A;  2ZJP F;  1T6S A;  3S3N A;  4CDG A;  2KIF A;  3MZ8 A;  4L9N A;  4A6E A;  1JJ8 C;  3KEQ A;  3DFG A;  3DCF A;  3HOX J;  1G3W A;  1UST A;  1EH8 A;  5F6F A;  3ZN1 A;  1PUF A;  3BZK A;  4RGS A;  3WTS C;  5J8F A;  2H8R A;  2XRO A;  2UXN A;  1HDD C;  1XSV A;  4E7K A;  1CGP A;  3BP8 A;  2M30 A;  1CF7 B;  2QCO A;  3WGI A;  1ZRE A;  1ZYR F;  3QPH A;  4NQW A;  4LGW A;  2R5Y B;  3IKT A;  4A5N A;  3JRC A;  2Z5U A;  2R7V A;  1MBK A;  3CTA A;  3M8F A;  3ZQI A;  4RMN A;  3OSG A;  1WFX A;  5GTH C;  2P5L C;  2ECC A;  2IS1 A;  3CJT B;  2D1V A;  2JRT A;  1DU6 A;  1P7J A;  4LG0 B;  2KP6 A;  5LEK A;  3GW2 A;  2Q8K A;  2GA2 A;  1DP3 A;  3ZQG A;  2M1B A;  3RYP A;  5F04 A;  2KIS A;  5D6E A;  3LSK A;  2L3D A;  3BZ6 A;  4MIM A;  4NBQ A;  3HRT A;  3MKZ A;  1KON A;  3HOZ J;  3LSH A;  4CA0 A;  1KU7 A;  1MMS A;  2XGX A;  3N05 A;  5KK1 A;  2O61 A;  1RES A;  2MH2 A;  2AS5 F;  1EJ9 A;  5FLV A;  2E2J J;  4XNF A;  1HOM A;  1V3F A;  2O3F A;  3W6K B;  3FZV A;  2DT7 B;  5FKK A;  1IGN A;  2MW8 A;  3F8F A;  3CQZ J;  1GVD A;  3MQ0 A;  2A5W A;  2FBI A;  2BE5 F;  4HF1 A;  3GF2 A;  2QVO A;  3FBI B;  2KRF A;  3GWZ A;  5IYC J;  5CVI A;  1B72 B;  3VYR B;  2VXZ A;  4KMU X;  1P9Q C;  2PJR B;  3KYC B;  2B7E A;  1R1T A;  2FRH A;  3CUQ A;  1OFC X;  2HTJ A;  5L3G A;  4M3G A;  1J2X A;  5J3L A;  3ZMS A;  4CYC B;  3TL4 X;  1U2W A;  1F1Z A;  3A02 A;  4BJT A;  3ZMV A;  5A2Q K;  3LNQ A;  5C4J J;  1G59 A;  1QZY A;  4EJT A;  1LDD A;  1X4O A;  4PFP A;  2DA4 A;  3G6E I;  2GQQ A;  2K9Q A;  4KIC A;  2M5W A;  3K4N A;  1ETW A;  3JRH A;  1TT5 B;  3HSE A;  2HKX A;  3RIR A;  3HG9 A;  3COA C;  3DU5 A;  1V4R A;  3E5U A;  4G94 A;  5B3S H;  1I1S A;  4MFE A;  5J40 A;  2V1U A;  2MC3 A;  2ZJR F;  2NOJ B;  3C2H A;  1FZP B;  4UV8 A;  5FRM A;  5IY5 H;  1FJL A;  5HS7 A;  5JHU A;  2HVS A;  3WG9 A;  1S6L A;  1P92 A;  4ZTJ A;  2XHK A;  4QIW N;  2VE9 A;  2VJ5 A;  1B1B A;  5IT3 A;  2NVX J;  2AXL A;  3ZOB A;  1R5H A;  4MTD A;  2Z1D A;  3OYE A;  2KQR A;  4RAF A;  3VOE A;  1FBS A;  2LH9 A;  1BJZ A;  1ETO A;  5IYB J;  1FYK A;  3CCE I;  2HYG D;  2R7T A;  3TQN A;  1IRG A;  2FOW A;  1ZGA A;  4GRI A;  1VQ7 I;  4BQO A;  5AIP A;  2K4B A;  3QYB A;  1HC8 A;  3TED A;  4G7Z F;  1HSJ A;  2DMN A;  2GBY A;  2VQC A;  3GTM J;  2V1N A;  4PDK A;  3BG3 A;  4AYB A;  4KT5 C;  1TTY A;  2JVH A;  2JVG A;  4HRI A;  5M3F J;  1LE8 A;  3JW4 A;  2H8W A;  2R7U A;  1MMA A;  4EM1 A;  5DD4 A;  2DU9 A;  2ZBK A;  1OYY A;  4OIN F;  5HDG A;  1QHG A;  3ZMD A;  1JUM A;  5EG0 A;  2MD0 A;  1APL C;  4XLC A;  3HPG A;  2M0M A;  3NAR A;  3U1K A;  2XAJ A;  1QQI A;  2IA2 A;  3TGN A;  2KKO A;  4BHP A;  2VC0 A;  3GFM A;  3PIO F;  3I59 B;  3I3L A;  1A36 A;  3F9K A;  1I6H J;  2MD5 A;  1Z05 A;  4GGG A;  2LKS A;  4ZH4 F;  1O7L A;  3LAP A;  1LKX A;  1V55 H;  4XMY A;  3BJO A;  2JA8 J;  4UNO A;  1WCM J;  3L7W A;  3Q9V A;  1R36 A;  1X58 A;  4MEY F;  1P7I A;  1MJB A;  1TW3 A;  2KIU A;  2QGU A;  1P2F A;  5C44 J;  3KLN A;  4I0B A;  1ETY A;  4IRH A;  4FX4 A;  3KYL A;  1ODD A;  2KFD A;  2DYS H;  2KJB A;  3K2Z A;  3B6C A;  3ULQ B;  3PFI A;  2DDA A;  2HPI A;  4E7L A;  2AQF A;  3BR1 A;  2GZW A;  2V9K A;  1S29 A;  1I27 A;  3GLL A;  1A6Q A;  2MH9 A;  3E7L A;  2YR2 A;  1BR4 A;  2DJI A;  3ASO H;  3CES A;  3GTK J;  2KJC A;  3M07 A;  4CSW A;  4HNT A;  3R0J A;  2DQL A;  5DD8 A;  4RB1 A;  1S7O A;  2P81 A;  2BXY A;  1TNS A;  3QP6 A;  3UR3 C;  5E1X A;  2OBP A;  3LSI A;  5HLH A;  1U78 A;  2E1O A;  4II3 A;  1G3Y A;  2MFZ A;  3A03 A;  3PUF A;  5E3O A;  1VQ4 I;  3I4P A;  4ZDL A;  3K7A J;  1MKM A;  1YQA A;  2KL4 A;  1YOV B;  3OYK A;  2A6E F;  2EV6 A;  1OYI A;  2L7K A;  4HST A;  4BUP A;  1PYV A;  1DP7 P;  4U88 A;  3N97 A;  2IJL A;  4MO7 A;  3E6M A;  2WV0 A;  1OCT C;  1D1B A;  3BCA A;  1HCR A;  1W5T A;  2XSJ C;  3I58 A;  2VQH A;  5BOX A;  2PEX A;  3ABK H;  1B9M A;  3JTG A;  3W6V A;  2DXI A;  2W57 A;  1RKT A;  4MQV A;  4EM0 B;  5EGO A;  4PGG A;  4Y4R A;  4ZYG A;  2VKD A;  3U1D A;  2A61 A;  3KP4 A;  3H3V K;  3U2R A;  3DKY A;  2BVL A;  2G0E A;  5DS9 A;  1SD7 A;  2E7X A;  4RM2 A;  1HF0 A;  1LB2 A;  1W0T A;  2JRM A;  2EV0 A;  1RZ4 A;  5H6R A;  4I6Z A;  2O7O A;  2CUZ A;  4K2E A;  4ZC3 A;  2VLA A;  2OTJ I;  1MIJ A;  2P0W A;  3HBL A;  4A2U A;  1K4T A;  3BC8 A;  5F0H A;  1PUF B;  3GBG A;  4IHW A;  1XMA A;  1R71 A;  1BR2 A;  3E6B A;  5ILV A;  5HDN A;  4NQW B;  4PCQ A;  2X85 A;  3G73 A;  3JAM Z;  4EEF G;  5BPD A;  1WJF A;  2CQ7 A;  4DBR A;  1VI0 A;  2MBF A;  4L5J A;  3J80 K;  3KZZ A;  5FRN A;  1VFC A;  3SEZ A;  3WTY C;  4E7I A;  4HQM A;  5JLX A;  2M7A A;  3CP2 A;  2IA1 A;  3G4S I;  1S3J A;  3QRF F;  1VQK I;  4DNC A;  3FXL A;  1TWG J;  3QPS A;  2DN0 A;  1YTY A;  1JE8 A;  5H2F C;  1T08 B;  1SVL A;  4HPQ A;  1RR8 C;  4IHV A;  2RV8 A;  3ELK A;  4ENK A;  2VQG A;  5D8K B;  2VKH A;  1XSX A;  2CW8 A;  3QOP A;  2LOO A;  3RKW A;  5LGN A;  3ASN H;  3IL2 A;  4NC7 A;  4O6J A;  2ICW G;  2M34 A;  3J7A Y;  4L5I A;  2ID3 A;  2KZG A;  2W85 A;  3TDZ C;  2X6X A;  4N0B A;  4PZJ A;  4D9J A;  4B8X A;  3PQJ A;  2D5V A;  2V6C A;  4WX9 A;  2FD5 A;  1YS6 A;  2M45 A;  1QPM A;  1W1W E;  4V2F A;  2R4G A;  4RAY A;  2RDP A;  2EZI A;  4F3Q A;  1VQN I;  2CS3 A;  1XN7 A;  3GLX A;  3QQA A;  2XKP A;  3S2D J;  4YFX F;  3N4M A;  2ZB9 A;  4FET A;  1U9N A;  3GEZ A;  4KJZ A;  1D8K A;  2DOE A;  3CUQ B;  1BI2 A;  1OCP A;  4A3I J;  2MG4 A;  1O3Q A;  1N25 A;  3CCV I;  1XMK A;  5IP7 J;  2LRD A;  2ZO4 A;  4IQJ A;  1T8I A;  2XAF A;  1T0F C;  3TOA A;  4IHY A;  4NB5 A;  2IGM A;  1VQ9 I;  2QZ8 A;  3EYI A;  2IGK A;  5AIQ A;  2K40 A;  3FF5 A;  4EJU A;  4LG0 A;  2R7S A;  1V5G A;  1JKO C;  1J09 A;  2HYJ A;  4LIV A;  5IPA A;  5HOO A;  5J1Y A;  2WC2 A;  1P4A A;  1GUU A;  2XAS A;  3TP0 A;  1I3A A;  1WVR A;  4LK1 F;  3DPU A;  3HRM A;  4CYD A;  1KU2 A;  1U5T B;  3L2W A;  2Y9Z A;  3FX3 A;  2ZME C;  3Q9S A;  2L02 A;  5FLX Z;  2EFP A;  2FQ4 A;  4BEH A;  2WAQ N;  1IO2 A;  2LKP A;  2ID6 A;  3JSO A;  3O8G A;  2Z2S B;  4UB6 C;  3IH4 A;  1RRJ A;  3S3O A;  1LPQ A;  3RPU A;  4MFD A;  2R7Q A;  5IT9 Z;  1XCV A;  1FP1 D;  2KIQ A;  4QSH A;  4AM3 A;  2K02 A;  4NUB A;  3CCJ I;  2W82 A;  1DU0 A;  3CDL A;  3T5X A;  2FBH A;  1Y0U A;  1MH4 A;  2WAD A;  1C0W A;  1KA8 A;  2GXG A;  2PJR A;  1ZGW A;  5TRD A;  2P5V A;  1YJ9 I;  3R61 A;  2NVY J;  2VJ4 A;  1U5T C;  4F93 B;  1HKT A;  5F08 A;  2CW0 F;  3BT9 A;  1MGT A;  4CYC A;  4UV9 A;  5L3E A;  4BBR J;  3BPV A;  1OQY A;  5EEH A;  5GPA A;  4Y33 A;  1OIS A;  1LE8 B;  1S7A A;  3HOW J;  3V7S A;  2FU4 A;  4N9I A;  1QHH D;  2V26 A;  4M3E A;  1KQ8 A;  3KP2 A;  3HSR A;  3TKY A;  3IRR A;  2CUF A;  2W84 A;  5EG0 B;  4P55 A;  1WI9 A;  2Y0S N;  3GTP J;  3OWT A;  1I6X A;  1F4K A;  3CJN A;  2OCC H;  1ZLJ A;  4S04 A;  2E36 A;  5DCM A;  3JRF A;  2YSR A;  4E7S A;  3CCU I;  5ILS A;  2QKM B;  1DPU A;  2HOE A;  3GFI A;  5K7H A;  4P9F A;  3E3V A;  1OCC H;  4MEX F;  3M1C A;  1IDZ A;  1FSH A;  3OYC A;  2LFB A;  2EZL A;  5GAE J;  2DBB A;  4N4N B;  4PK4 A;  3DWL E;  2Q1Z B;  4RAZ A;  2KPM A;  4CIC A;  4LLN A;  3H9Q A;  3HTS B;  3CC4 I;  5KAI C;  2ZSH B;  4A3B J;  1EV7 A;  3MWM A;  4GCV A;  5BS6 A;  3GX4 X;  4W97 A;  5K7Z A;  3VYS B;  2XGE A;  4PJM A;  1WQ2 A;  4IHS A;  3U9G A;  4ENJ A;  3S15 J;  1VQL I;  2JA2 A;  2NNN A;  3L9F A;  4DW6 A;  2K9L A;  5CYV A;  1W4M A;  4J01 A;  1H9T A;  3JRI A;  3IH2 A;  3ZQF A;  5E1Z B;  2KIM A;  1X1C A;  4XIC A;  3MKY B;  1H0M A;  4KIB A;  4UHT A;  3PNV A;  1XGN A;  2FX0 A;  5L3F A;  1B9N A;  3Q5F A;  9ANT A;  2QYO A;  2JWT A;  4RA2 A;  5LRR A;  2YUS A;  3RCO A;  3ML6 A;  5KVR A;  4UVA A;  2P6S A;  3VEP A;  1Z9C A;  1LFU P;  1OCO H;  2L7F P;  4HF0 A;  2WA0 A;  4G6D A;  4MQ9 F;  3L1P A;  1ITY A;  3H5N A;  5ICF A;  2LY1 A;  3NEU A;  2OJE D;  2OF7 A;  3S93 A;  1W36 D;  2L01 A;  2EB7 A;  5F1J A;  4BXF A;  4BBS J;  1FMW A;  2GA1 A;  3E97 A;  3AG4 H;  1ZR4 A;  4FAS D;  2BW3 A;  1UG0 A;  3FK6 A;  2WY8 Q;  2FE3 A;  5FLM J;  3S1R J;  1L3L A;  5E79 C;  3H5R A;  1R7J A;  1OMI A;  4BXX J;  1FBQ A;  4D7N A;  5EGO B;  1F43 A;  2FA5 A;  3RTR A;  1FMV A;  3WTU C;  4E6K G;  1Y56 A;  2HEO A;  2DT6 A;  4UUS A;  2E1M C;  2P7C B;  2X6W A;  2K27 A;  2CW7 A;  3E0J B;  1QVU A;  1Y6I A;  1R1U A;  1GXP A;  1IRF A;  4ETS A;  1LJ9 A;  1VF9 A;  4D0P A;  1I5Z A;  2ZXJ A;  2P4W A;  1AOY A;  5J47 A;  1O7F A;  1HXD A;  3PM1 A;  1MBH A;  2EH3 A;  2RKH A;  3SZP A;  3Q0W A;  3SFZ A;  2JUG A;  3SDG A;  2YU9 J;  4NHJ A;  3LQR A;  4M6V A;  4BQN A;  1BM9 A;  1FYL A;  4LMY A;  3H92 A;  2L4A A;  4FCY A;  1OKR A;  3HKZ N;  3JRB A;  2B0L A;  3OY9 A;  2W4S A;  2K86 A;  3K4B A;  2Y2Z A;  1FNN A;  3IUO A;  3P9K A;  1EF4 A;  5FKL A;  2Z9O A;  3I54 A;  3GUD A;  1VQO I;  1SVM A;  1O3T A;  1OR7 A;  4B3X A;  1XGO A;  1A6I A;  4GYG A;  1RC9 A;  3MKL A;  3SFI A;  2O5R A;  2EBI A;  1W5C C;  5B1B H;  2VOO A;  4CUG A;  4IF4 A;  4DZP A;  2QSG X;  3FWE A;  3L2V A;  3PO3 J;  3OYJ A;  2XAU A;  2LY9 A;  2H94 A;  4XKB A;  3QPL A;  1IW7 F;  4ZTF A;  2M0C A;  4HBL A;  5JLW A;  2X51 A;  4B3A A;  2WV1 A;  2W25 A;  4HSR A;  5JVG F;  3ZR8 X;  2KT0 A;  2A07 F;  2H27 A;  3GO5 A;  1WJD A;  1TQP A;  2JT1 A;  2E1C A;  1D3Y A;  1RPW A;  4BNC A;  4A0Y A;  2LTP A;  1Z91 A;  1BI1 A;  4BQQ A;  1R4M B;  4A3F J;  1DGW Y;  2QSF X;  3OIO A;  2R7Z J;  2GIZ A;  4PSW A;  4LIT A;  5D5V B;  2VAS A;  1JTX A;  1TNT A;  4KDP A;  2CU7 A;  1UHM A;  2CQQ A;  3FKJ A;  2Y69 H;  1BI3 A;  4OMZ A;  3K9T A;  4BU2 A;  1JKR C;  4BJ6 C;  2ECB A;  2X1E A;  2NS0 A;  1YRN A;  4BE2 A;  2O6G E;  2E60 A;  1MJA A;  5LHH A;  2PMZ A;  4FE4 A;  3KP7 A;  4KFC A;  1UFM A;  3FKI J;  1POG A;  4WCG A;  3KP6 A;  2RVC A;  1MNM C;  4EGY A;  2DA6 A;  1ETX A;  4XQF A;  2EIK H;  2COB A;  2BY3 A;  3IAS 2;  3WOD F;  5F27 A;  5BQT A;  1WH5 A;  1TLH B;  4IHX A;  3ABL H;  4Y15 A;  1JUS A;  3PNT A;  3K4L A;  3BOQ A;  5GAD J;  3CMY A;  4PSX A;  3WU0 A;  3SZT A;  4IEJ A;  3A1Y A;  1JXS A;  4BEH B;  2IXS A;  2HDC A;  4IOA F;  2HWV A;  2I8D A;  2Q2E A;  3K0L A;  3R60 A;  2ZJ2 A;  2E2I J;  2X0L A;  1BN5 A;  2BGC A;  3K4M A;  2ESN A;  4AD9 A;  1T0F A;  4FHT A;  4ESJ A;  3AG1 H;  1O3S A;  1SAU A;  1WHU A;  3K70 C;  1A04 A;  4IOC F;  4E7H A;  2X6Y A;  1BA5 A;  4M71 A;  2JQ7 A;  3C1D A;  1UAA A;  3Q0V A;  4BE0 A;  3CP8 A;  3NRV A;  4ZYH A;  2XAG A;  3BWG A;  3I4M J;  4XOP A;  1YG2 A;  5FO5 A;  5E8I A;  3OYN A;  4U7D A;  3HUG A;  2ZME A;  5DEQ A;  2M3A A;  1V54 H;  2R5Z A;  2LD5 A;  2UWM A;  4ENN A;  2F5E A;  3VPR A;  4XOR A;  3WTW C;  2IRF G;  4LIU A;  4XRF A;  1RI7 A;  3FDY A;  5L3D A;  3C3W A;  3VB2 A;  3VFZ A;  3RQI A;  1H8A C;  1AKH A;  2VUM J;  1RUO A;  4XN3 A;  1ZK8 A;  2OCE A;  4A3L J;  1R6R A;  2Z33 A;  1U3E M;  4YRV A;  2YS9 A;  3MEX A;  4CCM A;  4HDV A;  1UB9 A;  2M7B A;  4F92 B;  3WU1 B;  1MBJ A;  2KDO A;  3H0G J;  2FBK A;  3HYI A;  4EJV A;  2L2O A;  5DCM B;  3CCS I;  2QEN A;  3C2B A;  3FHN A;  3H9G A;  2GXB A;  3VYU B;  3HIF A;  4HDU A;  2W48 A;  5D5U B;  2OPT A;  3PO2 J;  1U5T A;  1ENH A;  3HGY A;  4RGX A;  4AVZ A;  1H88 C;  3SYT A;  3F8N A;  2HYF A;  3KFW X;  4Y13 A;  5GP9 A;  4YEL A;  4XR6 A;  1HST A;  5DUK A;  4CCK A;  1IRX A;  2QQ8 A;  4Y7N J;  3ZGK A;  4IRI A;  3LFU A;  2HQ5 A;  3K4C A;  1I39 A;  4B44 A;  2DA2 A;  3QOD A;  3G1L A;  4F7Z A;  5DM7 F;  1XS9 A;  1GLN A;  2OQR A;  2A6H F;  3V8L A;  1JUP A;  3G1O A;  4LOC A;  2IS6 A;  2DFE A;  5D8L B;  2YX4 A;  4CGZ A;  2VXD A;  3CME I;  1T38 A;  4Q4Z F;  1NG6 A;  2E5N A;  2CRG A;  1D1C A;  2E1N A;  2LF7 A;  5LHI A;  2RN7 A;  3S16 J;  4DYQ A;  3AKZ A;  1YW8 A;  2X1C A;  2Y0M A;  2HS5 A;  1W7P A;  1XCB A;  2X4H A;  3HRS A;  1J5Y A;  1BC7 C;  4KIF A;  4BXU A;  2PN6 A;  3CLQ A;  3HDD A;  4X1E A;  4CH7 A;  1JT0 A;  1SFO J;  4XN0 A;  3DP7 A;  5DM6 F;  4P5O A;  1D0Y A;  1YW9 A;  1QZE A;  1RKW A;  2JA5 J;  4BS9 A;  1LVA A;  2DT5 A;  2I5U A;  3BG5 A;  1NK3 P;  1MJ9 A;  3QU6 A;  3DQV C;  4CHU A;  4L5E A;  1FY7 A;  2M4G A;  4A93 J;  1X2M A;  3H9J A;  3BZC A;  2XF5 A;  4AYB N;  1A5J A;  3K1M A;  2HR3 A;  3RZD J;  1MBF A;  1YIO A;  2NNY A;  2W00 A;  3O3K A;  2TDX A;  2LF8 A;  2CV0 A;  1Z7L A;  3ECH A;  3ZQC A;  2PJP A;  3WE3 A;  2BW3 B;  3TOB A;  1UHS A;  2QUF A;  3BCB A;  2A6T A;  4MGR A;  2BZT A;  2CSO A;  3JSP A;  2O03 A;  1FIP A;  1X1B A;  3HSF A;  1E2X A;  4L9T A;  3HRU A;  5KNL A;  1LVK A;  2CO5 A;  3EUK L;  2WAF A;  4UUS B;  2B63 J;  5FFX A;  2CQX A;  1Z1D A;  2JSP A;  4BAY A;  1MMD A;  2HQR A;  3OR1 C;  2QBY A;  3E6C C;  2W24 A;  1B6A A;  2L5Q A;  5E8G A;  2NVQ J;  3HJE A;  2L7Z A;  2VKE A;  2ZXI A;  3K1P A;  3W6J B;  4MNU A;  3WTT C;  4MTE A;  3ONQ A;  2VJJ A;  3C7J A;  3HOU J;  3SDB A;  1X4P A;  1TWF J;  2OC6 A;  2MLG A;  3F8B A;  1HW5 A;  5D4S A;  1R5G A;  2VI6 A;  2XV4 S;  4I09 A;  4A3C J;  3HOY J;  5H6Q A;  1UCR A;  3KX2 A;  1QA6 A;  1T2K A;  3RPU D;  2NVT J;  2MA3 A;  1PUE E;  1I1G A;  4II2 A;  4DGW B;  4PJ0 C;  4ZYD A;  3CMM A;  4RBO A;  2K4J A;  1SD4 A;  3NAU A;  4RDU A;  4QWQ A;  3M9A A;  1I3Q J;  1S72 I;  4IZZ A;  2EIN H;  2WB1 A;  4WXD A;  2VOD A;  3CO7 C;  2JPC A;  3LAJ A;  1VZ0 A;  1ZAO A;  2KZV A;  1JHH A;  2FJ1 A;  3AFH A;  1MNE A;  3AG3 H;  3JRG A;  1N77 A;  4F91 B;  1MND A;  2QQB A;  2V1X A;  3EUH C;  3EET A;  4U87 A;  2Z16 A;  1Z67 A;  1E3P A;  2HZD A;  2YU3 A;  5BMZ A;  4OIQ F;  2E34 A;  1JTY A;  3MZY A;  3ZXS A;  2CYY A;  3F3X A;  2UZK A;  3CD6 I;  3GZN B;  1FYM A;  2XF7 A;  4N4O B;  2NYX A;  4DJA A;  4Y52 J;  1U0J A;  2XPU A;  1SAX A;  3TMO A;  5FB2 A;  4HG2 A;  1OR7 C;  3O6B B;  4EM2 A;  1Z3X A;  1S5L C;  2F48 A;  1ZH5 A;  5EEA A;  2EFO A;  5CVJ A;  2EIJ H;  2HQN A;  4OU0 A;  3SXY A;  1WJB A;  2MAB A;  5CJ9 A;  1U6G A;  5J1U A;  3HOT A;  4KN7 X;  2VBX A;  2HDW A;  3DEU A;  1QRY A;  4LK0 F;  1AHD P;  2NRA C;  1YRN B;  2ZFU A;  3M8E A;  5K5O A;  3K4K A;  2OTL I;  4I99 C;  1IN6 A;  3GTG J;  3CO6 C;  2WTE A;  2HZT A;  4UUT A;  2HOA A;  1Y39 A;  3P7N A;  1WSU A;  3G2B A;  1MH3 A;  1HW1 A;  2KRC A;  4CCO A;  4IQ4 A;  2DYR H;  1MSF C;  5DCF A;  4XSX F;  1N78 A;  4ABZ A;  1HKQ A;  1WKM A;  2OD5 A;  1OCZ H;  4KYW A;  2H6B A;  3T8T A;  2ZXW H;  4M72 A;  3DLA A;  4Y17 A;  4IJA A;  4N9H A;  4YIR X;  4E7Z A;  3NQO A;  1V5F A;  4C3J J;  4KIS A;  3A01 A;  3H36 A;  1PVE A;  1YIJ I;  2BV6 A;  2Q2E B;  2V9V A;  4XOT A;  5CQE A;  4HNV A;  2VL8 A;  2BHY A;  3OL3 A;  2HKO A;  2TCT A;  3I56 I;  1FOX A;  4P9U A;  3T8R A;  1TWC J;  1Z0X A;  4ZDO A;  5LBQ A;  4BGD A;  3IHU A;  3KYD B;  3F6V A;  1R22 A;  3ISP A;  3J7Z I;  4PFO A;  4O5V A;  1TC3 C;  1KYW A;  3PSI A;  3BJA A;  4ZZD A;  1F36 A;  2A69 F;  3FIS A;  2CFX A;  4A3K J;  1IN5 A;  5IOY A;  3HUG B;  2ZME B;  2R5Z B;  3FM3 A;  4XKC A;  1MDM A;  2XIG A;  1EH6 A;  4G9Y A;  3CCL I;  3L2R A;  4HQE A;  2ADU A;  4R79 A;  2VQL A;  1AKH B;  2DTR A;  2X1D A;  3ROU A;  4DZJ A;  3P9C A;  4XLE A;  1E0E A;  2ZXH A;  2F4O B;  2F2E A;  3RQ4 A;  4JX4 A;  4ZYE A;  2QEX I;  2NOG A;  2MC4 A;  2KDZ A;  2XGC A;  4XRS A;  3LST A;  3V8K A;  1TT0 A;  2IS2 A;  5K5R A;  3TO9 A;  2EA2 A;  2HXI A;  1R23 A;  3ZN0 A;  1J0R A;  3OOP A;  1PP8 F;  2V6E A;  2DJN A;  3FXJ A;  3VSL A;  3MN2 A;  1FOY A;  4XLH A;  4KUM A;  5B66 C;  2QA4 I;  3S14 J;  1RIO H;  1K6Y A;  2HXO A;  3ABM H;  3HB9 A;  4IHT A;  1UHW A;  2WAQ A;  3M8J A;  2IW5 A;  3BRO A;  2D1H A;  1XPX A;  4YFN F;  1IXS B;  1WPK A;  5LRS A;  5HOD A;  1MBG A;  5ICC A;  5DYM A;  1ETK A;  3EYY A;  2Y48 A;  4EJW A;  4CZC A;  1T98 A;  5GPC A;  1DUX C;  1GXQ A;  2AXT C;  2PMH A;  2VT3 A;  2VN2 A;  3VDX A;  4WWC A;  1X1A A;  4JK1 X;  4M9X A;  5IOZ A;  2ZNY A;  2ZKZ A;  5ED4 A;  1FT9 A;  4RM3 A;  1PDN C;  3HPH A;  3CC7 I;  4XSZ F;  2EPF A;  3F23 A;  3DTI A;  4WK8 F;  3CJR B;  4UB8 C;  2OAZ A;  3IAM 2;  1YE9 A;  1BIA A;  1YYV A;  5J4Y A;  1K83 J;  3BR2 A;  2DW4 A;  4L0Y B;  2GM4 A;  1WJ5 A;  3DBR B;  2BEO A;  5E3N A;  1FIA A;  2CUE A;  1A35 A;  1W7P B;  3A0H C;  3RKQ A;  3JR9 A;  3LWF A;  2RQQ A;  1EKE A;  2CV2 A;  5GAG J;  4V19 K;  2Y0S A;  3GME A;  2W1O A;  3ZQ7 A;  5M5Y J;  2R3S A;  2ACJ A;  1SEU A;  2Y75 A;  3C18 A;  3HOS A;  4JX6 A;  4IKF A;  2BXZ A;  3HEF A;  1I50 J;  4X6A J;  1TW2 A;  2MLK A;  2LG4 A;  3S1Q J;  3R6S A;  1ZKG A;  1WJC A;  2FEZ A;  4GYI A;  1G8X A;  4QLC U;  2R7R A;  4EV0 A;  2FUG 2;  3D1N I;  4AIK A;  4C30 A;  3EDP A;  1YW7 A;  3FXQ A;  4GO1 A;  1UG2 A;  1IRZ A;  5LGU A;  3EPZ A;  3LA2 A;  3A0B C;  3OV8 A;  3DPL C;  2JA6 J;  1ON2 A;  1L0O C;  1D8J A;  4OAZ A;  5L3C A;  1KGS A;  2H6C A;  2AO9 A;  3JRA A;  2VJI A;  1LEA A;  3GZ6 A;  2CGP A;  4XL9 A;  3RSN A;  4G12 A;  1ZRC A;  1Z77 A;  2RNG A;  5E17 F;  1GHC A;  3D5R C;  1TP4 A;  1IN8 A;  3DEW A;  5FKO A;  4ZZL A;  4RGU A;  1R4N B;  4DBQ A;  4MHG A;  3JAM K;  4RLF A;  3OIQ A;  4GDF A;  3TP3 A;  1XGM A;  4B1R A;  4HLY A;  2F5F A;  2QBY B;  1IN7 A;  3Q0U A;  5LGT A;  2RAE A;  3BR5 A;  2EIL H;  3IWZ A;  4D1Q A;  4JQF A;  3CCQ I;  3G1M A;  4ESB A;  2IVM A;  4I76 A;  1H89 C;  1STZ A;  1X2N A;  2KRH A;  3LA3 A;  3OYI A;  4ZJZ A;  2GIV A;  1E17 A;  1FPQ A;  1JI8 A;  2FNA A;  2L9V A;  2M9H A;  3ZMU A;  3LSG A;  1SD6 A;  5EJC A;  1ZQ3 P;  2VBZ A;  6PAX A;  4OIO F;  4ASN A;  5LLQ A;  3WTV C;  1W5S A;  2EQR A;  4FQG A;  3LSP A;  2LRE A;  2E1M B;  1XX5 A;  4RGR A;  2LYC A;  5F0C A;  2K9M A;  2ELJ A;  4HV6 A;  2L4M A;  2E7W A;  4IVN A;  1ZAR A;  5E3L A;  2MGQ A;  2VIX A;  1JHF A;  3HGG A;  4FIS A;  4C2M J;  4JP0 A;  1IXC A;  4M3F A;  1SD5 A;  2CQN A;  2WWY A;  3D5L A;  4QPQ A;  1RUN A;  5FRO A;  3F21 A;  3P5J A;  4XRM A;  1WH7 A;  2XRN A;  3KP3 A;  1NG7 A;  3Q3S A;  5M5W J;  1BR1 A;  2G9W A;  5A2Q Z;  2EV5 A;  1CQT A;  3S2W A;  2STT A;  2VON A;  2R7X A;  3WHB A;  3DKX A;  2ZNZ A;  1G6N A;  1IUF A;  4YII A;  1GV2 A;  2XGD A;  2FML A;  3H3Z A;  5E20 A;  4HLX A;  1NH3 A;  3RJP A;  1SMT A;  3FXU A;  1FWZ A;  5EZH A;  4IXA A;  2L54 A;  2R0Q C;  2JA7 J;  1N75 A;  2H1L A;  3GXO A;  2F4M B;  2FOK A;  2LC2 A;  1QNT A;  2OU2 A;  5HLG A;  3ABU A;  1B4A A;  3DLL F;  2PG4 A;  2P6T A;  2AQE A;  3L2Q A;  4E70 A;  3GTJ J;  4UVB A;  4BDY A;  3F72 A;  3EUH A;  4LFU A;  3CDH A;  1SFE A;  2F5C A;  2WY7 Q;  4Y3O A;  5J1R A;  3F6O A;  3LOC A;  3I55 I;  5FGM A;  3M7G A;  1VTN C;  3KZI C;  3I0T A;  2IEK A;  3MVP A;  3OS2 A;  2K7L A;  1R58 A;  4J19 A;  4G6Q A;  3DTK A;  1KYZ A;  4IL6 C;  2N8G A;  3B73 A;  3L2C A;  5K1Y A;  2IS4 A;  1QO0 D;  5FLX K;  4DYR A;  2DI3 A;  3KEO A;  2H09 A;  5CVV A;  3KCC A;  4IX7 A;  4RB0 A;  2IPQ X;  1IN4 A;  1GV5 A;  3PUB A;  4L9J A;  4A69 C;  1IV6 A;  5TGT A;  5IT9 K;  2V9P A;  1XDU A;  2BVM A;  4OIR F;  1IJW C;  2ZC2 A;  2IAI A;  1KZH A;  1WJE A;  4PGH A;  1USS A;  3S3M A;  4OMY A;  1R1V A;  1XD7 A;  1FOW A;  3CZ6 A;  2R7F A;  4RS8 A;  1SFU A;  4NC8 A;  3ECO A;  2Z99 A;  4M6Y A;  4XKW A;  5TJJ A;  3OYA A;  3MKW B;  4A5M A;  3A01 B;  1UEL B;  4XK4 A;  3GTL J;  2FNP A;  3K4J A;  5HDK A;  4BKX A;  4DOZ A;  1LFB A;  2ZSI B;  3QYF A;  2HOT A;  5FKN A;  3PJR A;  3FBN B;  1U8R A;  1S8N A;  2M8G X;  2BBY A;  3WG7 H;  3VSK A;  2DPD A;  2BY1 A;  4PJN A;  3OOU A;  1ONV A;  5LHG A;  5K5Q A;  1P4W A;  2L7M P;  1K79 A;  3F22 A;  4I2O A;  1LEB A;  1B8I A;  2J5O A;  3FIW A;  2DFH A;  3IH3 A;  4Q47 A;  3AAF A;  3D5S C;  1VQ6 I;  4AID A;  4LG3 A;  4PJL A;  4AUX A;  2Y9Y A;  2I10 A;  4HX8 A;  3HHH A;  2XAQ A;  1D1A A;  3S8P A;  1MDM B;  1J75 A;  1K6O A;  1D5V A;  3BTI A;  4I7H A;  4JBA A;  1ZLK A;  4AIH A;  3V4G A;  3SQN A;  2EFN A;  1E3O C;  4U0W A;  3NWS A;  1OCR H;  3KZY A;  3ABT A;  3CLO A;  2DCE A;  2VOP A;  2CWE A;  4RB2 C;  1V5E A;  5EF6 A;  2W7N A;  3IWF A;  3G71 I;  3MAJ A;  3TW6 A;  3ZQQ A;  3ZMZ A;  3HOV J;  4CCN A;  1NTC A;  2UXX A;  4WF2 A;  2DDB A;  1G4D A;  1OYW A;  5J8C A;  3FXO A;  5F0F A;  2NVU B;  2EZH A;  3W2V A;  4CO8 A;  4AU7 A;  1FSE A;  4M9S A;  2IGN A;  3HZJ A;  4DIQ A;  4U7B A;  1TWH J;  3T0Y A;  3L09 A;  3I4N J;  5KAF C;  3T1B A; 
#chains in the Genus database with same CATH homology
 3MFK A;  1KU9 A;  2RGV A;  1ULY A;  4WXH A;  3FMS A;  2PI0 A;  3QP5 A;  3M1E A;  2VT2 A;  4AIJ A;  1JGS A;  3REO A;  1X3U A;  4R8H A;  1ZG3 A;  1ZGJ A;  1MZB A;  2DK5 A;  2QQ9 A;  1HW2 A;  3E5X A;  2O0Y A;  4BQA A;  1YS7 A;  3MCZ A;  4HA8 A;  2RNJ A;  5ILU A;  3RYR A;  1SMY F;  5JVT A;  2PBI A;  2ISY A;  4HX7 A;  4Z2Y A;  4LLG F;  2A3S A;  2HGC A;  2NAZ A;  1ON1 A;  3LFK A;  2VC1 A;  3GVA A;  2VBY A;  2EFQ A;  2PQ8 A;  3KP5 A;  1LQ1 A;  3LQQ A;  4HZF A;  1J59 A;  2ISZ A;  1KQ9 A;  1BJA A;  1FP2 A;  4GXO A;  4HW0 A;  3HHG A;  3J80 Z;  1MD0 A;  3DXJ F;  3RDI A;  3R0A A;  2DFI A;  1XSD A;  4CZZ A;  2COM A;  2QM3 A;  2RC4 A;  4EQQ A;  3IC7 A;  5CLS A;  4A12 A;  1DDN A;  2Q0O A;  1WRJ A;  2V1D A;  3H3U A;  4EJO A;  2DQR A;  3FM5 A;  4KA4 A;  2G7H A;  4S05 A;  2M8E A;  2OQG A;  2DAO A;  2FXA A;  1YO5 C;  2LNB A;  1T39 A;  1B59 A;  2OA4 A;  1F9N A;  4UVC A;  3ZMT A;  3SHF A;  3LA7 A;  4G7H F;  1Z7U A;  3F8C A;  5D5W B;  4KMF A;  1OPC A;  4EVI A;  3ZP5 A;  1IAW A;  2A5Y B;  4DQ2 A;  4UUV A;  1K78 B;  3FMQ A;  4BHC A;  1ZRF A;  3DV8 A;  3O2P E;  2JSC A;  1IZ1 A;  1XB4 A;  4YIF A;  3QU3 A;  1Q1H A;  5F1R A;  4I98 B;  5J6X A;  4LB6 B;  1BC8 C;  4M73 A;  2O8X A;  3WTX C;  3FXR A;  3KET A;  5CVR A;  1XGS A;  3VOD A;  1TBX A;  4A6D A;  5FFZ A;  2P8T A;  3TO7 A;  5AON A;  2EK5 A;  4I0A A;  1O57 A;  3HTU A;  4UXN A;  4TV7 A;  5H20 A;  4HOB A;  2FSW A;  4LB5 A;  3RPQ A;  3F8M A;  4Q48 A;  3ERE D;  1DPR A;  3K69 A;  3CUO A;  5BOX A;  1BBY A;  1QZZ A;  4M9Z A;  4XLN F;  5DUI A;  5FD6 A;  2ZFW A;  4M6X A;  2Z3Y A;  2ZCW A;  1H9G A;  1KQ0 A;  1YFH A;  4Q5S F;  2JTV A;  1IXR C;  2CQK A;  4P96 A;  2GWR A;  1KU3 A;  2C6Y A;  5HLI A;  3R4K A;  4R1H A;  3GZ5 A;  4BYY A;  2D2W A;  5HVQ C;  3IKV A;  2YX7 A;  2YPR A;  3J7A O;  4IPA A;  5D6F A;  5JFR A;  4L18 B;  3BPX A;  1FOK A;  1Z6T A;  3BJ6 A;  1Z6R A;  4G7O F;  3PQK A;  3GFL A;  2FQ3 A;  5L3B A;  1R00 A;  2DK8 A;  3RI4 A;  1BIB A;  4CXF A;  3J81 Z;  4I02 A;  4G8X A;  3DKW A;  4B09 A;  3V7R A;  5CVU A;  5ERI A;  2P5K A;  1HQC A;  2DLL A;  4HAM A;  4EMS A;  3FMR A;  2EFW A;  3GFJ A;  4LD5 A;  2RQP A;  2M87 A;  3KLO A;  2XAH A;  1CF7 A;  2D45 A;  2EA4 A;  5JR3 A;  3RKX A;  1ZG5 A;  2LDU A;  1O3R A;  5LEJ A;  4H0E A;  3IRQ A;  1FBU A;  3JTH A;  4U0V A;  2EJR A;  4KN4 X;  2R7D A;  4ESF A;  1YLF A;  1EH7 A;  1FX7 A;  2QQA A;  1ZRD A;  4M74 A;  3FHZ A;  5E1W A;  5EEG A;  2XUB A;  3WE2 A;  3K1N A;  1GVJ A;  2GAU A;  4KIG A;  1IUY A;  2HFH A;  3CUQ C;  2F5D A;  4XLP F;  4HYE A;  2IP2 A;  2JZY A;  3KE2 A;  3RKY A;  2DO7 A;  1QGP A;  2FMY A;  1TQI A;  3QAH A;  4LJZ F;  2OZ6 A;  2P7V B;  2JPB A;  2BYV E;  2VE8 A;  3MZH A;  4ON0 A;  4KNY A;  1F5T A;  4AVP A;  1WWX A;  4BHB A;  4HX4 A;  3BY6 A;  1XDS A;  3DPT A;  1J9I A;  2CG4 A;  2XVC A;  2PLY A;  4A0X A;  3I53 A;  2ETH A;  4IRG A;  3TO6 A;  4U0Y A;  2PMU A;  3L00 A;  1J7K A;  3WGG A;  4OOI A;  4AWX B;  4A0Z A;  5JI6 A;  4OIP F;  3I5U A;  1ZHF A;  2EWN A;  2A68 F;  3I71 A;  4XBF A;  1TQM A;  5BPI A;  4EGZ A;  4YFK F;  3ZPL A;  1ZG1 A;  2FF4 A;  2QLZ A;  1REP C;  1NHA A;  4FX0 A;  3J81 K;  1K7A A;  1BI0 A;  1RNL A;  2G7U A;  5HS9 A;  3TDU C;  5D4R A;  1LDK B;  4WXC A;  1G3S A;  1P6R A;  4YG2 F;  2DPU A;  1K78 A;  3P9I A;  3GYH X;  4HF2 A;  3I59 A;  4O3M A;  5FD5 A;  3G3Z A;  1G3T A;  3DF8 A;  3V8J A;  1HBX G;  2ELH A;  5E18 F;  4ENM A;  2J5P A;  3WTZ A;  1SFX A;  4FT8 A;  4L0Z B;  5D5X B;  2VBW A;  4L9V A;  3V7C A;  4RB3 C;  1FLI A;  2IT0 A;  1IF1 A;  1LDJ A;  2HTS A;  1ZN2 A;  1FC3 A;  4LLL A;  1LNW A;  2IA0 A;  3QPT A;  2PFB A;  5ICG A;  2OZU A;  1P4X A;  1PP7 U;  5HS8 A;  4BH9 A;  4HV5 A;  1AWC A;  2QWW A;  1BOA A;  2XKO A;  5DV5 A;  3B02 A;  3E6D A;  5DDG A;  3EQL F;  2LSO A;  1W7P D;  3BDD A;  2STW A;  3E5Q A;  1QBJ A;  1HKS A;  2ESH A;  5ICE A;  3I64 A;  5F64 A;  3D0S A;  2V79 A;  3WGH A;  4I01 A;  1T6S A;  4CDG A;  2KIF A;  4L9N A;  4A6E A;  3KEQ A;  3DFG A;  1G3W A;  1UST A;  1EH8 A;  5F6F A;  3ZN1 A;  4RGS A;  3WTS C;  5J8F A;  2XRO A;  2UXN A;  1XSV A;  1CGP A;  3BP8 A;  2M30 A;  1CF7 B;  1ZRE A;  3WGI A;  1ZYR F;  3QPH A;  4NQW A;  4LGW A;  3IKT A;  4A5N A;  2Z5U A;  3CTA A;  3M8F A;  2P5L C;  2D1V A;  2JRT A;  4LG0 B;  5LEK A;  3GW2 A;  2Q8K A;  2GA2 A;  2M1B A;  3RYP A;  5D6E A;  2L3D A;  3BZ6 A;  3HRT A;  1KU7 A;  2XGX A;  5KK1 A;  2O61 A;  2MH2 A;  2AS5 F;  1V3F A;  2O3F A;  3W6K B;  3FZV A;  3F8F A;  3MQ0 A;  2FBI A;  2BE5 F;  4HF1 A;  3GF2 A;  2QVO A;  2KRF A;  3GWZ A;  5CVI A;  2VXZ A;  4KMU X;  1R1T A;  2FRH A;  5L3G A;  2HTJ A;  3CUQ A;  1J2X A;  3ZMS A;  1U2W A;  1F1Z A;  5A2Q K;  3ZMV A;  1QZY A;  4EJT A;  1LDD A;  2GQQ A;  4KIC A;  2M5W A;  3HSE A;  2HKX A;  3RIR A;  3COA C;  1V4R A;  3E5U A;  4G94 A;  1I1S A;  2V1U A;  2MC3 A;  1FZP B;  4UV8 A;  5HS7 A;  5JHU A;  3WG9 A;  1S6L A;  1P92 A;  2XHK A;  2VE9 A;  1B1B A;  5IT3 A;  2AXL A;  1R5H A;  4MTD A;  3VOE A;  1FBS A;  1FYK A;  2HYG D;  1IRG A;  3TQN A;  1ZGA A;  5AIP A;  2K4B A;  4G7Z F;  1HSJ A;  4PDK A;  4KT5 C;  1TTY A;  3JW4 A;  4EM1 A;  5DD4 A;  2DU9 A;  2ZBK A;  1OYY A;  4OIN F;  5HDG A;  3ZMD A;  2XAJ A;  1QQI A;  2IA2 A;  3TGN A;  2KKO A;  4BHP A;  2VC0 A;  3GFM A;  3I59 B;  2MD5 A;  1Z05 A;  4GGG A;  4ZH4 F;  1O7L A;  3LAP A;  3BJO A;  4UNO A;  3L7W A;  3Q9V A;  1R36 A;  4MEY F;  1MJB A;  1TW3 A;  2KIU A;  1P2F A;  3KLN A;  4I0B A;  4IRH A;  4FX4 A;  1ODD A;  2KJB A;  3K2Z A;  3ULQ B;  3PFI A;  2GZW A;  1S29 A;  1I27 A;  2MH9 A;  2YR2 A;  2KJC A;  3R0J A;  2DQL A;  5DD8 A;  4RB1 A;  1S7O A;  1TNS A;  3QP6 A;  5E1X A;  2OBP A;  5HLH A;  1U78 A;  1G3Y A;  3I4P A;  1MKM A;  1YQA A;  2A6E F;  2EV6 A;  1OYI A;  1DP7 P;  4U88 A;  3N97 A;  2IJL A;  3E6M A;  2WV0 A;  1W5T A;  3I58 A;  2PEX A;  1B9M A;  3JTG A;  2W57 A;  4MQV A;  4EM0 B;  4PGG A;  4ZYG A;  3U1D A;  2A61 A;  3KP4 A;  3U2R A;  1SD7 A;  2E7X A;  1LB2 A;  2EV0 A;  1RZ4 A;  5H6R A;  4K2E A;  4A2U A;  1XMA A;  3E6B A;  5ILV A;  5HDN A;  3G73 A;  4PCQ A;  5BPD A;  3JAM Z;  2MBF A;  4L5J A;  3J80 K;  3KZZ A;  3WTY C;  4HQM A;  2IA1 A;  1S3J A;  3QRF F;  4DNC A;  1YTY A;  1JE8 A;  2RV8 A;  3ELK A;  4ENK A;  5D8K B;  1XSX A;  3QOP A;  3RKW A;  5LGN A;  3IL2 A;  4O6J A;  4L5I A;  2W85 A;  3TDZ C;  4N0B A;  4PZJ A;  4B8X A;  3PQJ A;  2V6C A;  4WX9 A;  1YS6 A;  2M45 A;  1QPM A;  4RAY A;  2RDP A;  3GLX A;  1XN7 A;  2XKP A;  4YFX F;  3N4M A;  3GEZ A;  1D8K A;  3CUQ B;  1BI2 A;  1O3Q A;  1XMK A;  2ZO4 A;  2XAF A;  3TOA A;  4NB5 A;  2QZ8 A;  3EYI A;  5AIQ A;  3FF5 A;  4EJU A;  4LG0 A;  5HOO A;  2WC2 A;  1P4A A;  2XAS A;  4LK1 F;  3HRM A;  4CYD A;  1KU2 A;  1U5T B;  3FX3 A;  3Q9S A;  2L02 A;  5FLX Z;  2EFP A;  2LKP A;  3JSO A;  3RPU A;  5IT9 Z;  1XCV A;  1FP1 D;  2K02 A;  3T5X A;  2FBH A;  1Y0U A;  1C0W A;  1KA8 A;  2GXG A;  5TRD A;  2P5V A;  3R61 A;  1HKT A;  1U5T C;  2CW0 F;  1MGT A;  4UV9 A;  5L3E A;  3BPV A;  5EEH A;  1S7A A;  3V7S A;  2FU4 A;  4N9I A;  1KQ8 A;  3KP2 A;  3HSR A;  3TKY A;  3IRR A;  2W84 A;  4P55 A;  1WI9 A;  1I6X A;  1F4K A;  3CJN A;  1ZLJ A;  4S04 A;  5DCM A;  2YSR A;  5ILS A;  1DPU A;  2HOE A;  3GFI A;  4P9F A;  3E3V A;  4MEX F;  1FSH A;  2DBB A;  4RAZ A;  4CIC A;  4LLN A;  3HTS B;  1EV7 A;  3MWM A;  4GCV A;  5BS6 A;  3GX4 X;  1WQ2 A;  4IHS A;  3U9G A;  4ENJ A;  2NNN A;  3L9F A;  5CYV A;  1W4M A;  1H9T A;  5E1Z B;  2KIM A;  1H0M A;  4KIB A;  4UHT A;  1XGN A;  5L3F A;  1B9N A;  3Q5F A;  2QYO A;  5LRR A;  3ML6 A;  5KVR A;  4UVA A;  2P6S A;  3VEP A;  1Z9C A;  4HF0 A;  4G6D A;  4MQ9 F;  5ICF A;  3NEU A;  2L01 A;  2EB7 A;  2GA1 A;  3E97 A;  2FE3 A;  1L3L A;  1R7J A;  1OMI A;  1FBQ A;  2FA5 A;  3RTR A;  3WTU C;  2HEO A;  2P7C B;  2K27 A;  1R1U A;  1GXP A;  1IRF A;  4ETS A;  1LJ9 A;  4D0P A;  1AOY A;  1I5Z A;  2ZXJ A;  2P4W A;  1O7F A;  1HXD A;  2RKH A;  3SZP A;  3SFZ A;  4NHJ A;  3LQR A;  1BM9 A;  1FYL A;  4LMY A;  3H92 A;  2L4A A;  1OKR A;  2B0L A;  2K86 A;  1FNN A;  3P9K A;  2Z9O A;  3I54 A;  3GUD A;  1O3T A;  1OR7 A;  1XGO A;  4GYG A;  2VOO A;  4IF4 A;  3FWE A;  2H94 A;  1IW7 F;  4HBL A;  2W25 A;  2A07 F;  2H27 A;  3GO5 A;  1TQP A;  2JT1 A;  2E1C A;  1D3Y A;  4BNC A;  4A0Y A;  1Z91 A;  1BI1 A;  5D5V B;  1TNT A;  4KDP A;  1UHM A;  1BI3 A;  4OMZ A;  3K9T A;  2NS0 A;  2O6G E;  1MJA A;  5LHH A;  4KFC A;  3KP7 A;  1UFM A;  4WCG A;  3KP6 A;  2RVC A;  4EGY A;  3WOD F;  5BQT A;  1TLH B;  4Y15 A;  3BOQ A;  3WU0 A;  3SZT A;  1JXS A;  2HDC A;  2HWV A;  2Q2E A;  3K0L A;  3R60 A;  2ZJ2 A;  2X0L A;  1BN5 A;  2BGC A;  4AD9 A;  2ESN A;  1T0F A;  4FHT A;  4ESJ A;  1O3S A;  1A04 A;  4M71 A;  3C1D A;  3NRV A;  4ZYH A;  2XAG A;  3BWG A;  1YG2 A;  5FO5 A;  5E8I A;  4U7D A;  3HUG A;  2ZME A;  5DEQ A;  2UWM A;  4ENN A;  2F5E A;  2IRF G;  3WTW C;  4XRF A;  1RI7 A;  3VB2 A;  5L3D A;  3C3W A;  3VFZ A;  1RUO A;  2Z33 A;  1U3E M;  3MEX A;  4HDV A;  1UB9 A;  3WU1 B;  2FBK A;  3HYI A;  4EJV A;  5DCM B;  2QEN A;  2GXB A;  3HIF A;  4HDU A;  5D5U B;  1U5T A;  4RGX A;  3F8N A;  2HYF A;  3KFW X;  4Y13 A;  1HST A;  5DUK A;  4IRI A;  4F7Z A;  2OQR A;  2A6H F;  3V8L A;  5D8L B;  4CGZ A;  2YX4 A;  1T38 A;  4Q4Z F;  2E1N A;  2LF7 A;  5LHI A;  2RN7 A;  1YW8 A;  2Y0M A;  2HS5 A;  1W7P A;  1XCB A;  2X4H A;  3HRS A;  1J5Y A;  1BC7 C;  4KIF A;  4BXU A;  2PN6 A;  3DP7 A;  4P5O A;  1YW9 A;  1LVA A;  2DT5 A;  1MJ9 A;  3QU6 A;  3DQV C;  4CHU A;  1FY7 A;  3K1M A;  2HR3 A;  1YIO A;  2NNY A;  3O3K A;  2TDX A;  2LF8 A;  3ECH A;  2PJP A;  3WE3 A;  3TOB A;  2QUF A;  4MGR A;  2CSO A;  3JSP A;  2O03 A;  3HSF A;  1E2X A;  4L9T A;  3HRU A;  2CO5 A;  5FFX A;  1Z1D A;  4BAY A;  2HQR A;  2QBY A;  3E6C C;  2W24 A;  1B6A A;  5E8G A;  3K1P A;  3W6J B;  4MNU A;  3WTT C;  4MTE A;  3C7J A;  2MLG A;  3F8B A;  1HW5 A;  5D4S A;  1R5G A;  2XV4 S;  4I09 A;  5H6Q A;  1UCR A;  1T2K A;  2MA3 A;  1PUE E;  1I1G A;  4ZYD A;  2K4J A;  1SD4 A;  4QWQ A;  3M9A A;  4WXD A;  2VOD A;  3CO7 C;  2JPC A;  3LAJ A;  1ZAO A;  1JHH A;  2V1X A;  2QQB A;  3EET A;  2YU3 A;  5BMZ A;  4OIQ F;  3MZY A;  2CYY A;  3F3X A;  2UZK A;  1FYM A;  2NYX A;  1SAX A;  5FB2 A;  3O6B B;  4EM2 A;  1ZH5 A;  2EFO A;  5CVJ A;  2HQN A;  4OU0 A;  3SXY A;  5CJ9 A;  1U6G A;  3HOT A;  4KN7 X;  2VBX A;  3DEU A;  4LK0 F;  2NRA C;  3M8E A;  5K5O A;  1IN6 A;  3CO6 C;  2WTE A;  2HZT A;  3P7N A;  1WSU A;  1HW1 A;  5DCF A;  4XSX F;  1HKQ A;  1WKM A;  2OD5 A;  4KYW A;  2H6B A;  3T8T A;  4M72 A;  4Y17 A;  4IJA A;  4N9H A;  3NQO A;  2BV6 A;  2V9V A;  2HKO A;  4P9U A;  3T8R A;  5LBQ A;  3IHU A;  3F6V A;  1R22 A;  3ISP A;  4O5V A;  1KYW A;  3BJA A;  4ZZD A;  2A69 F;  2CFX A;  1IN5 A;  2ZME B;  3FM3 A;  1MDM A;  2XIG A;  1EH6 A;  4G9Y A;  4HQE A;  2ADU A;  4R79 A;  2DTR A;  3ROU A;  3P9C A;  2F2E A;  4ZYE A;  3LST A;  3V8K A;  5K5R A;  3TO9 A;  2EA2 A;  1R23 A;  3ZN0 A;  1J0R A;  3OOP A;  1PP8 F;  4KUM A;  1RIO H;  4IHT A;  1UHW A;  2IW5 A;  3BRO A;  2D1H A;  4YFN F;  1IXS B;  5LRS A;  5ICC A;  5DYM A;  3EYY A;  2Y48 A;  4EJW A;  1T98 A;  1DUX C;  1GXQ A;  2PMH A;  2VT3 A;  2VN2 A;  4WWC A;  4JK1 X;  4M9X A;  2ZNY A;  2ZKZ A;  5ED4 A;  1FT9 A;  1PDN C;  4XSZ F;  3F23 A;  4WK8 F;  2OAZ A;  1BIA A;  1YYV A;  4L0Y B;  2DW4 A;  2BEO A;  1W7P B;  3LWF A;  3ZQ7 A;  2R3S A;  2ACJ A;  2Y75 A;  3C18 A;  3HOS A;  1TW2 A;  2MLK A;  3R6S A;  2FEZ A;  4GYI A;  4QLC U;  4EV0 A;  4AIK A;  3EDP A;  1YW7 A;  3FXQ A;  4GO1 A;  5LGU A;  3LA2 A;  3OV8 A;  3DPL C;  1ON2 A;  1L0O C;  1D8J A;  5L3C A;  1KGS A;  2H6C A;  1LEA A;  3GZ6 A;  2CGP A;  1ZRC A;  5E17 F;  1GHC A;  1IN8 A;  4ZZL A;  4RGU A;  3JAM K;  4MHG A;  1XGM A;  4HLY A;  2F5F A;  2QBY B;  1IN7 A;  5LGT A;  3IWZ A;  4JQF A;  4ESB A;  2IVM A;  1STZ A;  3LA3 A;  2GIV A;  1E17 A;  1FPQ A;  2FNA A;  3ZMU A;  1SD6 A;  2VBZ A;  6PAX A;  4OIO F;  4ASN A;  5LLQ A;  3WTV C;  1W5S A;  4RGR A;  4HV6 A;  2L4M A;  2E7W A;  4IVN A;  1ZAR A;  1JHF A;  1IXC A;  1SD5 A;  2WWY A;  3D5L A;  1RUN A;  3F21 A;  2XRN A;  3KP3 A;  2G9W A;  2STT A;  5A2Q Z;  2EV5 A;  3S2W A;  2VON A;  2ZNZ A;  1G6N A;  4YII A;  2FML A;  5E20 A;  3H3Z A;  4HLX A;  3RJP A;  1SMT A;  3FXU A;  1FWZ A;  4IXA A;  2L54 A;  3GXO A;  2FOK A;  1QNT A;  2OU2 A;  5HLG A;  3ABU A;  1B4A A;  2PG4 A;  2P6T A;  4E70 A;  4UVB A;  3F72 A;  3EUH A;  4LFU A;  3CDH A;  1SFE A;  2F5C A;  1VTN C;  3F6O A;  5FGM A;  3M7G A;  3I0T A;  2K7L A;  1R58 A;  4G6Q A;  1KYZ A;  5FLX K;  3L2C A;  3B73 A;  5K1Y A;  1QO0 D;  2DI3 A;  3KEO A;  2H09 A;  5CVV A;  3KCC A;  4RB0 A;  2IPQ X;  1IN4 A;  4L9J A;  5IT9 K;  1XDU A;  4OIR F;  4PGH A;  1USS A;  4OMY A;  1R1V A;  1XD7 A;  2R7F A;  4RS8 A;  1SFU A;  3ECO A;  2Z99 A;  4M6Y A;  5TJJ A;  4A5M A;  2FNP A;  5HDK A;  1U8R A;  1S8N A;  2BBY A;  2DPD A;  1ONV A;  5LHG A;  5K5Q A;  1P4W A;  1K79 A;  4I2O A;  3F22 A;  1LEB A;  2J5O A;  3AAF A;  4Q47 A;  4HX8 A;  3HHH A;  2XAQ A;  1MDM B;  1J75 A;  1K6O A;  1D5V A;  4I7H A;  4JBA A;  1ZLK A;  4AIH A;  3V4G A;  3SQN A;  2EFN A;  4U0W A;  3KZY A;  3ABT A;  3CLO A;  2VOP A;  2CWE A;  4RB2 C;  3IWF A;  3MAJ A;  3ZMZ A;  2UXX A;  4WF2 A;  1G4D A;  1OYW A;  5J8C A;  4CO8 A;  1FSE A;  4M9S A;  4U7B A;  3T0Y A;  3L09 A;  3T1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...