3ABLH

Bovine heart cytochrome c oxidase at the fully oxidized state (15-s x-ray exposure dataset)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
total genus 27
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ablH00
2EINH 2DYSH 3ABKH 3ABMH 5B1AH 2EILH 3X2QH 3AG2H 1OCZH 1OCCH 1V54H 3WG7H 2EIKH 2DYRH 5B1BH 3AG3H 2OCCH 5IY5H 3ASNH 1OCOH 3ABLH 3AG4H 5B3SH 2EIJH 1V55H 2EIMH 2Y69H 3ASOH 2ZXWH 3AG1H 1OCRH
chains in the Genus database with same CATH superfamily
2KRFA 3M9AA 2X48A 2Q0OA 2DA1A 3ROUA 4Y7NJ 3HBLA 2NXNB 3MKLA 2LDUA 1B9MA 3FZVA 2TCTA 4EVIA 3H9QA 4PCQA 1MBFA 1WJEA 1NK3P 4YIIA 2FX0A 3I56I 2QCOA 3T0YA 1HDDC 1X1PA 2FJ1A 2GA2A 4Q47A 4IHSA 1LEBA 3CCQI 2UV1A 3HOYJ 2EFQA 4ENNA 2QA4I 5BMZA 3WGIA 2DLLA 1ERDA 5EJCA 1R49A 1K7AA 2VOPA 2OQRA 2X9DA 3EETA 2XHKA 1IG7A 4A3FJ 1FYLA 2DMTA 3QPLA 1VFCA 4XQFA 4BY1J 2DMUA 1FX7A 2DK8A 1RC9A 3DFGA 2UWMA 1Y8RB 4A3JJ 2CO5A 1MGTA 2LKSA 2E60A 2L01A 3G1MA 2KQRA 2W1OA 5K5QA 2ME6A 3V7CA 1QO0D 2F5CA 3A01A 3ZMZA 3QP6A 1B1BA 2EV0A 1OCRH 5ICCA 4BHCA 4ZDOA 1ETQA 2DA3A 3KP4A 2G7UA 3PUFA 5DDGA 2KIQA 2Y30A 2AO9A 2VQCA 3I53A 5HODA 2OZUA 2MSYA 3ZMDA 4OIOF 3R0JA 1DGWY 2F2EA 3I64A 3PNVA 1UAAA 5LEJA 1JI8A 1ZELA 1POGA 1W5TA 2GQQA 4RAZA 4ESJA 2W85A 1ETKA 2KL4A 3TL4X 4XN0A 2K7LA 2EFNA 4HDVA 2XGCA 1KGSA 2Y48A 4DZJA 5AIQA 1ZKGA 2JZYA 5FFZA 4CYCB 2CQKA 2VE9A 2Y69H 3GWZA 3HJEA 3L09A 5FLMJ 2DDAA 1LNWA 4CICA 5B5EC 1S72I 3FXLA 3E7LA 2XAQA 3RPUD 2IS4A 5F6FA 4DBQA 1VQMI 4BQQA 1MNEA 4PZJA 3EUHC 1ULYA 3ZQGA 2R5ZA 3UNGC 2X6WA 5EF6A 2R93J 4CCMA 1IC8A 2G9WA 1S8NA 2DTRA 2HGCA 2MC4A 1REPC 2BVLA 3NRVA 1ZGAA 1UHMA 2AS5F 4CDGA 2FOKA 3O6BB 4IOAF 4ZJZA 1W7PD 4MFDA 3GCMA 4DZPA 4AU7A 4FQGA 3AKZA 2V1NA 1BI2A 1B72B 4XICA 3HG9A 4HRIA 3KYDB 2J5PA 2X0LA 4HQMA 1UFMA 1FMVA 3K4LA 1AU7A 3TP0A 3F8BA 3MQ0A 4CYDA 2ISZA 1QZYA 1ZH5A 2EV5A 2Q2EA 3S3MA 2R7XA 4IL6C 1GUUA 1LFBA 3BPVA 4BACA 1X3WB 3WTSC 1GDTA 5E18F 4A12A 3BR5A 4UHTA 3LMMA 3KYCB 2XAFA 3ZRGA 2BGCA 3K1NA 1TNTA 3K4MA 1ZQ3P 2M9HA 2ZMEA 4KNYA 2CFOA 3EUAA 2IRFG 4FHTA 2ZFUA 2MW8A 3IWFA 3TOBA 2M34A 3H3ZA 2IP2A 1IF1A 3PO3J 2FE3A 3WG7H 2DPDA 4WXCA 2B0LA 1ETOA 4WF2A 1EH6A 4L9VA 2KT0A 3KP2A 5D4SA 2OCCH 2PG4A 3IRQA 3W6VA 4ABZA 2XPVA 1TWCJ 2NVYJ 3DTKA 3EDPA 4PJ0C 2OC6A 4GO1A 4IHXA 4II3A 3DKYA 3F0CA 5F0CA 1U8BA 2DQLA 4Y52J 3ZMVA 3JTHA 4V2GA 4Q5SF 4I2OA 2EA4A 2VQLA 2BHYA 5J3LA 3HHGA 1S7AA 2QLZA 2CUEA 1XMAA 4PFPA 3BG6A 1DGRM 3Q9SA 5J47A 2EZHA 2OCEA 3CTAA 2G7HA 1QU3A 4KMFA 4BKXA 1ZHFA 1TLHB 3ZMTA 3WTVC 1TZLA 4W1UA 2H1KA 2FUG2 1GV2A 4MO7A 3EQLF 2DA7A 5HNFA 1YHQI 2BW3A 1R71A 4BXUA 3SDGA 2Y9ZA 2LK2A 2E35A 2EINH 1JHFA 4DIQA 4HDUA 1AWCA 1I5ZA 1I1SA 1T2KA 4UVCA 4CCKA 3VFZA 4A93J 1Z6RA 3IAM2 1UG0A 5CVIA 1IXRC 1I50J 3K4CA 2L7FP 3BTLA 3JSOA 5JVGF 3GBGA 5FRMA 3CUQC 1N77A 2JA5J 2XAHA 2VOOA 4XLHA 1JJ6C 5LD2C 4UVAA 2MD5A 1ITYA 1W7PA 1JE8A 3CF2A 2BHZA 4BYYA 2HQRA 4CXFA 3VODA 5K7FA 3GF2A 3VYTB 4HBLA 5B3SH 3TDUC 2VLAA 3KE2A 2R7FA 5CVJA 3B73A 5L3BA 3NWSA 3TQNA 4D7MA 4MTEA 2DOFA 4E7ZA 1J0RA 2MC3A 2M1BA 3LOCA 2HOAA 3KLNA 1P6RA 3DTIA 5J1YA 5FKKA 3VWBA 2ZFWA 1RZ4A 2FA5A 1V5GA 1IDZA 2ESNA 4L18B 1W0TA 2PN6A 4HEA2 4JBAA 2MFZA 1JKPC 4ASNA 5EZGA 2E71A 4Z2YA 3PSIA 5IPAA 4RB3C 2PI0A 3BR0A 3KPHA 4MQ9F 2K5CA 2H09A 5FB2A 2OZ6A 2P7VB 1G3TA 3CCEI 4HF2A 2VBWA 5D8LB 3DPUA 3S1MJ 3FMRA 1OYIA 4FTHA 5FLVA 1GHCA 2MLGA 2PMHA 1XG1A 4XOPA 2WAEA 1SD7A 2PQ8A 5DS9A 4HX7A 1FP2A 3CLQA 3CUQB 2RKHA 3SQNA 4L5IA 5J4YA 4A3BJ 4H0EA 2CRGA 3GVAA 1P7JA 2EV6A 2O7OA 2QM3A 5AONA 2OV7A 2KZVA 3FXRA 3CC7I 1LDKB 2NS0A 2QQ8A 3KZZA 1XC5A 5H20A 3FXUA 1IN6A 1YRNA 1H88C 3NQOA 3OYGA 1F1ZA 2VPLA 1P4AA 3QPTA 1LEAA 2E7XA 1ENHA 4RB0A 2HZDA 1QVUA 3CLOA 3O2PE 1IO2A 1CGPA 2CQ7A 2OAZA 3DKXA 1G8XA 3QQAA 4CA0A 1FOKA 3IWZA 2XB5A 1TTYA 4MTDA 1KU7A 3SZPA 2VI6A 4RAFA 4MEXF 2N8GA 1MH3A 1QHHD 3ZR8X 4CCJA 2VODA 4RGUA 1QNTA 4UUTA 2PFBA 1J7KA 1ZGWA 3L9FA 3KX2A 3M07A 3W2AA 5HDGA 3I4PA 3RQIA 5HDNA 1VQ6I 2O6GE 4RBOA 3DEUA 4XNFA 5F0FA 4L0ZB 3LA2A 1XCVA 2LMDA 4I76A 4M71A 2F5EA 2DXIA 1QPIA 3DLLF 3TKYA 2MBFA 2A6HF 2EILH 2W48A 3L2WA 1SAUA 2R7SA 2HNHA 1OCZH 3HKZN 3RTRA 1TT0A 2K3PA 3BZ6A 1T8IA 3HSRA 2ZCWA 4JYKA 3W6JB 1HLVA 2IGOA 2XC7A 4BXXJ 2Y75A 1TQIA 2LNBA 2E19A 1AOYA 4B48A 3CCRI 3OMYA 3PO2J 4ZH4F 1J5YA 2DW4A 1B4AA 3FK7A 3VDXA 1MBGA 3LAJA 3WTWC 2V79A 3FKIJ 3QYEA 1N78A 5JVTA 1A35A 2MLKA 5HLTA 3FM3A 2JA6J 4UUSB 5FKLA 4I0AA 2KJBA 3RI4A 5DCMB 3ELKA 3I55I 2VJ4A 1GLNA 1FSEA 1LVKA 1X2MA 1LQ1A 2KDZA 3B6AA 4XMYA 2ESHA 2EZLA 1P4XA 2LRDA 3S2WA 1I1GA 5E3MA 4XN3A 3WU2C 1UCRA 3GW2A 4BEHA 5KNLA 3L2CA 4N9IA 4UY8I 2HOTA 3K10A 3LA7A 3LSJA 2ICWG 2IS1A 1TWFJ 4ZYHA 2UZKA 2GZWA 4IOCF 4PJJA 1U5TA 5C4JJ 4JX4A 4Y15A 2HR3A 3HTUA 2LREA 4H4KC 5D8KB 1IDYA 2VQGA 1J2XA 1S9HA 3OYDA 4IVNA 3U1DA 2MA3A 2P5KA 4U7BA 2ELHA 4WXDA 2HDWA 2DA2A 3DU6A 1T0FA 4I09A 5LRSA 4Q4ZF 1MMDA 4QWQA 1CF7A 1P2FA 1E3HA 3S3OA 4CCNA 1H0MA 3CESA 1YJWI 2LVSA 5LEKA 4J00A 2R7OA 5CLSA 2K3FA 1X19A 4G9YA 3A01B 4YIFA 1R23A 1M1EB 4P9UA 4X1EA 3WGHA 1HW5A 3KEYA 3RPQA 1N75A 2E2JJ 5IT9K 1MJ9A 5E3LA 1VNDA 1B59A 3BT9A 2CU7A 3HOWJ 4AVZA 1TQMA 5E20A 3BROA 3VOEA 4AM3A 3ZN1A 4XRMA 3OYFA 4UV9A 1ACIA 2RQPA 4CCOA 1Q1HA 3M7GA 4Y13A 1WVRA 1MH4A 1WGXA 1Z21A 1K79A 2LLKA 4BXFA 2QENA 1HCRA 1E3PA 4P55A 3ZGKA 4BHPA 3JW4A 3S1QJ 2QKLB 4FE7A 1FC3A 1OISA 5JLWA 5KAIC 5CKTA 5AIPA 3BTIA 3FX3A 5LHGA 4HA8A 1AHDP 2LG4A 3BG7A 3VSLA 1ZRFA 2LP0A 3OL3A 2BBYA 2R5ZB 1HKQA 1TW2A 4B44A 5LGNA 5FGMA 2FRHA 3IH4A 2D45A 1F4KA 2PEXA 3RQ4A 2IVMA 2VKDA 5JI6A 5IP9J 1F43A 2VB6A 3JR9A 2XF5A 3Q9VA 1U0JA 2P6TA 1R00A 4C2MJ 2JVGA 3S17J 1MSEC 3VYRB 2IPQX 2F5DA 5IT9Z 4XKBA 3LA3A 1XSVA 2VN2A 1U8RA 4B43A 2CSOA 2I5UA 2V1DA 3QP5A 5DUIA 1ZRCA 3H5RA 4ZDLA 5GPAA 3J7AO 2L4AA 4BL0B 5D5WB 1YW8A 3F22A 2HWVA 5F08A 1G3SA 1GXQA 3E6CC 1R5HA 2DU9A 1NG6A 2Q2EB 4IX7A 3CCLI 5B1AH 3DTEA 2Q8KA 3HRSA 4O6JA 5EDNA 3OYHA 2ZJQF 1V5FA 4GGGA 1Z9CA 2L9SA 3F6OA 1SFXA 2DOEA 4DJAA 1FTTA 3LSMA 1O3QA 3WE2A 3K4KA 2ZMEB 3LL7A 2JRMA 2XASA 3H5AA 3R60A 4C3JJ 4RDUA 4JK1X 2YU3A 2M87A 2FQ3A 5BPDA 1LFUP 2A61A 2R7VA 2LKPA 4PK4A 4RM3A 5BPIA 3E1SA 4M74A 3CMEI 1STZA 1PDNC 4ITVA 4YFKF 2DFFA 4OMZA 1XGNA 2CGPA 3BJAA 1E0EA 1SD4A 2Y31A 2HEOA 3H3VK 1QZEA 3BLYA 1HC8A 3LFUA 5E3OA 5IYBJ 3BJOA 3LWFA 4QPOA 5ILSA 2F6CA 2AXLA 2F5VA 3ESWB 4BJ6C 3U1KA 3SZGA 3MZ8A 1X3ZB 1MNMC 4OMYA 3OYNA 3VPRA 1YJNI 3BZKA 2KZGA 3RYPA 1OJLA 1Z91A 2ZO4A 3ULQB 4MIMA 2JA8J 1JGGA 4Y33A 2O0YA 3CCSI 1QVTA 3HOVJ 3OYAA 2I8DA 3WTTC 3MZHA 1VQPI 3NARA 4HZFA 1K78B 3JRBA 3M8FA 3DXJF 1R7JA 3JRDA 3H5NA 1ETWA 4ZYDA 1W5CC 5BS6A 5DM6F 1WH7A 4P5OA 3V8LA 4HNTA 3BQYA 3CCVI 2CV2A 2IGMA 1FPQA 1DDNA 3P9KA 1YI2I 4AIDA 4I7HA 3H0DA 4BS9A 1F9NA 2BEOA 2MYSA 2DODA 1KU2A 2NNNA 3OSGA 4HLXA 3BPXA 3M4OJ 4NUBA 4AC0A 1PVEA 5CVRA 2PMZN 1D8JA 1I3QJ 4LB5A 2A05A 1Y8QB 2VQHA 3C3WA 2W82A 5ERIA 4E7IA 1ZG5A 5M5YJ 1PYVA 1WJFA 4EMSA 2EK5A 4PGHA 4OWRB 5LHHA 2Z1DA 2CUZA 4V19K 4IHYA 2VBYA 1RKTA 2EFPA 2EIJH 3E6BA 2O8KA 1SFKA 1JHHA 4IHVA 1IJWC 3EYYA 1O57A 2FNAA 4DW6A 3QU3A 3F6VA 4IJAA 4D5CA 1KQ8A 4NNJA 1XX5A 5BNGA 3HOTA 2V6EA 4NC7A 4RMNA 1FY7A 3CQZJ 4RGSA 1YLFA 4A5NA 2FQ4A 1S29A 3CZ6A 4O5VA 2X6YA 4XKVA 2VPRA 3OOPA 2FMLA 4MNUA 4HX4A 1HSJA 2KJCA 2IAIA 4FE4A 4NC8A 3A0HC 5D5XB 4BDYA 3WHCA 5K7ZA 4KYWA 2LY2A 4ENMA 1O7FA 1FWZA 4XRFA 4EGYA 2VL8A 3I4MJ 2STWA 1J75A 3I59A 3M8JA 4BAYA 1MIJA 1QRYA 3PSFA 2M45A 3BR3A 3SEZA 4RGXA 4BHBA 3PNYA 1VQ4I 1SANA 4JX5A 2CQQA 3OYEA 3GUDA 4HOBA 2LKXA 3DQVC 4MLOA 1T38A 3M3YJ 3HIFA 4BGDA 1Z7LA 2F4MB 5LHIA 2GLOA 4IHTA 2AQFA 1VQ9I 1JUSA 2FEZA 2K9QA 2WV0A 2X85A 1UHWA 2YX4A 2RVCA 1S5LC 1EKEA 2ZBKA 3ABMH 1DQUA 1XMKA 1PUFA 3MZYA 3GTOJ 4DYCA 3DWLE 2MG4A 1R1TA 1RKWA 3LQQA 5K5RA 1QBJA 2EPFA 4BU2A 1YX3A 3OYLA 1VQ5I 5C44J 4OIRF 2RDPA 4QLCU 2O9LA 5GAHJ 1YW7A 2IEKA 1APLC 5FROA 2E5ZA 4A6EA 3ML6A 2CJJA 5E8GA 5D6FA 3J7ZI 2HTSA 2Z16A 2DTZA 3ZQLA 1TBXA 2V9PA 4G6QA 2CUJA 3HGYA 4LIVA 4M73A 3PJRA 1IXCA 3OWTA 2JVHA 3MD2A 3J81Z 2KKOA 2BXYA 2V4JC 3OR2C 2ME0A 3LFKA 4BY7J 3CCMI 2ZXIA 3RDIA 2YUSA 2ZJPF 4L5EA 3BDDA 3GO5A 1YS6A 1R4MB 4P9FA 1ON1A 5E3NA 5J8FA 2KRCA 2LY1A 1HA8A 2RC4A 2OUMA 5ILUA 1YO5C 4IRIA 3CCUI 1Y0UA 2V1XA 1T98A 2QQBA 4A3LJ 1VZ0A 1EF4A 2ACJA 2V1UA 5K5OA 2R7RA 1U6GA 2NRAC 2XB0X 1WHUA 3K69A 2ZKZA 1OCPA 3ZXSA 2QSGX 3QPHA 1BI3A 3G4SI 4E7JA 3PFIA 3CP2A 1ZN2A 1K83J 1XTAA 3E97A 5JHUA 1VQKI 4M9SA 4E7SA 3V7SA 1R6RA 3ISPA 4FCYA 1BI0A 2E2HJ 1WCMJ 2H6BA 2DFIA 2L7MP 4A5MA 1U5TB 1UB9A 1T56A 3JRCA 3MVPA 3Q3SA 1HOMA 3QOEA 3F8CA 2JPBA 5FFXA 2GIVA 4M3GA 3N05A 2H8WA 2NVTJ 2PBIA 4RAYA 3KP7A 4LLNA 3QYFA 5IP6A 2NNYA 4A2UA 4KN4X 3VB2A 2Z33A 4XORA 4AYBA 5DV5A 3OIOA 1U3EM 2DPUA 1LUJB 1I6HJ 2CG4A 2M0CA 2TRTA 2VBXA 4B3AA 1CF7B 1XMXA 2HQAA 4BE0A 4IHWA 1G59A 2CH0A 4I01A 3U9GA 4ON0A 5BOXA 4OU0A 3OV8A 2K9SA 3ZQCA 1GT0C 2LF8A 5ICEA 2VONA 1TWAJ 2EWNA 2HTJA 4EJWA 1EA3A 1D8KA 1JJ8C 1JXSA 1D5VA 2Y0SA 4LK0F 1X3UA 2A5YB 4G12A 4EATA 1D0XA 1O7LA 4K2EA 3CCJI 4ENKA 2LC2A 2PJRB 2XVCA 1OLTA 3QPSA 3V8KA 3C1DA 3CD6I 1T6SA 3TP3A 4LG3A 4EJOA 4KT6A 2QSFX 2R5YB 2RNJA 5EEHA 3F21A 4EQQA 3HPHA 2HVQA 2WA0A 2R7QA 2NOGA 4OIQF 1JTYA 2DT7B 4HV5A 4YEJA 3JTGA 3RPUA 1CQTA 4X0GA 3QRFF 2DT6A 1TQPA 2DYSH 4R1HA 1BR4A 2LFBA 3C2GA 2WAFA 2CFXA 1SMTA 4KA4A 1I3AA 1ZTRA 1BJAA 4LG0B 1J9IA 2DA6A 3KP3A 5E1XA 1HDPA 2YX7A 4IPAA 3FHZA 4EJVA 4F93B 2CQNA 3GYHX 4Y17A 1YFHA 2WAQN 1HKSA 4KJZA 3I9V2 1DU0A 4Y3OA 2ETHA 2L4MA 1R1VA 3HHHA 3T1BA 2WADA 1OR7C 3SJMA 1TWGJ 3FMQA 4HNVA 2EBIA 1NH3A 1H9TA 2WY7Q 2STTA 4M9XA 5EEGA 4M6VA 1G2HA 5D5VB 5H6RA 2JMWA 3MCZA 3J80Z 2Z9OA 4S0HB 4V2FA 1IN8A 3FBIB 2OF7A 5F27A 2NS8A 2ISYA 1BI1A 1UZCA 2DFHA 2F48A 3OR1C 2OTJI 2GAUA 4XLPF 2BY2A 2DAOA 2HKXA 2R7ZJ 1HW1A 1T33A 2R3SA 3TMOA 3Q0WA 2LH9A 4XLCA 3FBNB 2BV6A 2K4BA 4L9JA 5J40A 4I6ZA 3DV8A 3HPGA 3I3LA 3HEFA 2E1MB 3DBRB 5DYMA 4IRGA 4C3IJ 1RI7A 1GVJA 2ADUA 4C30A 1MDMA 1Z6TA 4U0WA 3HGGA 2IA1A 2XIGA 4EV0A 1BIBA 1R5GA 4ZTFA 2M8EA 2L7ZA 2HXIA 3FIWA 1MJBA 1G3YA 1P9QC 2A3SA 5FJ8J 2DQRA 2YU9J 2NOJB 2KPMA 5J4VA 5CQEA 3E5XA 2JJ7A 1WJCA 4D9JA 5IOYA 2DI3A 3DEEA 2KDOA 3MAJA 1W1WE 3CUOA 3C2HA 4A3MJ 1KQ0A 3K4NA 3F9KA 4IKFA 1ZG3A 6PAXA 3NAUA 2R0QC 4UNOA 2R92J 2D1HA 4B09A 4BE2A 1XDSA 2ELKA 2LR8A 1P4WA 3CDLA 4CO8A 3GTGJ 4KUMA 3ZQFA 1HW2A 2HOEA 4JQFA 3L2UA 4XLAA 3H36A 1YIOA 4U0YA 2A6TA 3C2BA 4LLGF 2OTLI 3OS1A 1RNLA 3KEQA 1RETA 2XF7A 1Y1WJ 3CDHA 2HVSA 3T8RA 2HXOA 1R58A 1WJAA 3Q5FA 3F72A 4W97A 4CZCA 4RLFA 4ENJA 2IJLA 1ZLJA 4PSXA 2ZSIB 3MKWB 4OOIA 1QHGA 1BOBA 2M5WA 1FJLA 3QYBA 5F1JA 1B6AA 1IRFA 2GOXB 1BC7C 2CV1A 3I5UA 4E6KG 3BP8A 2C6YA 3K6GA 3L2VA 4A0YA 3B02A 1UMQA 4IEJA 3ZQHA 1A5JA 2XAUA 2MABA 2XGXA 3ERMA 1ZARA 2O8XA 3KEOA 4GYIA 3TBIA 5J1RA 3PIOF 2O3FA 3RKWA 5C3EJ 3OOUA 4CYCA 1LPQA 4NQWA 1FP1D 3BR2A 4RAGA 3FMSA 4HX8A 1BM9A 3FXOA 3RZDJ 2FF4A 4EEFG 4XKCA 4D1QA 5FLXK 3FHNA 5HS7A 3JRAA 5A2QK 1MMAA 5GP9A 2GIZA 3AG4H 1YITI 4BH9A 4RGRA 1SEUA 2DCEA 4M72A 1BOAA 3DBLB 4FISA 4ZZDA 2A5WA 2VBZA 2COBA 2L7KA 4LJZF 4KMUX 4Q48A 3SFIA 2MGQA 3P9IA 1OCCH 1Y56A 4YIRX 1DP3A 1JKQC 5DUKA 2DMQA 5L3DA 3F3XA 1R1UA 4C9YA 4BUPA 2IW5A 2WB1N 1B72A 2K9LA 3HOSA 4KN7X 2FBHA 4YRVA 3A1YA 2YSRA 3H3UA 5M3MJ 2GA1A 3W6KB 1PJRA 3MMYB 3COAC 3IAS2 1YYVA 2L9RA 2XAJA 3CJTB 4G94A 3K1MA 1R9TJ 4G6TB 3V4GA 3JRFA 1ZAOA 1FBSA 4ESBA 1TL8A 3L7WA 2MH2A 4KIBA 5FLXZ 1TC3C 3D5RC 4L9NA 1FEXA 3RYRA 1FZPB 2BE5F 3O8HA 5TJJA 5A2QZ 3H35A 1LDDA 4G7ZF 2DO7A 3OYIA 1YW9A 4ETSA 1RESA 3EUHA 1BR2A 2EIMH 2HFHA 2M7BA 2XGDA 3TGNA 2JRTA 3G1LA 3G2BA 3GTKJ 2X1DA 3WHBA 2W00A 5DM7F 3FWEA 1K4TA 1XGMA 4FX4A 5M5WJ 2DFEA 4BNCA 1PP8F 1BL0A 4GXOA 4HW0A 2CMPA 5HLGA 2DYRH 2LF7A 1FMWA 4WXHA 3TW6A 3GLLA 3CMAI 2WAQA 3HRUA 2LYCA 2EZIA 2ZMEC 1W4MA 4GYGA 4XLEA 2HYGD 4XOTA 2AQEA 4AIJA 2HPMA 3Q0VA 4PFOA 1AKHA 2JWTA 2QKMB 4G7OF 2V6CA 3WTYC 3TEDA 2X6OA 2Y9YA 2OD5A 2L9VA 2M4KA 3FXJA 2ZJ2A 3H0GJ 4A3GJ 4LIUA 3NEUA 3OIPA 4UVBA 1OFCX 2WY8Q 1FSHA 3I71A 3LSHA 5HS9A 1KQ9A 3ZMUA 1A6QA 2W4SA 3DCFA 1E3OC 3EPZA 1OMIA 4BQAA 2EFWA 1VI0A 2J5OA 1G4DA 2DJNA 2IA2A 3FM5A 3ZN0A 2X1EA 1ZLKA 3GX4X 1FT9A 2WBMA 3LSPA 4IQJA 2Z99A 3MEXA 1MZBA 4CH7A 3S1RJ 1Y1VJ 1O4XA 2MH9A 1MBHA 3KZYA 4NDLA 5TRDA 2WV1A 4C2TA 5ILVA 4MFEA 2R7UA 3TO6A 1ETXA 4A3IJ 1W36C 3GFMA 4UB8C 2CWEA 5F64A 2QQAA 5IY5H 2XDVA 2X51A 1OCOH 3ABLH 4R8HA 4BJ5C 1MBEA 5GTIC 3J7YJ 1LFPA 4QIWN 3OY9A 1Z0XA 3MFKA 3HSEA 4IF4A 2YS9A 1XGSA 4F92B 5CPRB 3V7RA 3TO7A 2P0WA 1JKRC 3WTUC 3PIPF 3OS0A 4ZYGA 2XPWA 3I58A 1XGOA 3S2HJ 5L3FA 2NVXJ 4XIDA 4KITB 3IL2A 5GAGJ 4CZZA 1V54H 1Z3XA 3BWGA 1VQNI 4R79A 2PMUA 5HNHA 5D5UB 2VE8A 1D1CA 5L3EA 2H6CA 4KIGA 2Z2SB 1A31A 2KRHA 3L1PA 1DPRA 3CUQA 3DEWA 1HF0A 2CQXA 1V55H 4TV7A 4OINF 4BQNA 3D5LA 4HPQA 5LLQA 1NTCA 2VKEA 3AL0B 2JTVA 2E1CA 1OQYA 2A68F 3ZP5A 4YG2F 3D0SA 1IAWA 4D5FA 4RLQA 3GZNB 2LTPA 5HOOA 1FTZA 2BW3B 3HKZA 3P9CA 1EH7A 2R7TA 1RR8C 1HSTA 1BBYA 3PQKA 3F23A 1V3FA 1IRZA 1LJ9A 5K7HA 4GDFA 1RIOH 4JX6A 4CSWA 4E7KA 5E79C 1VTNC 2H1LA 1HBXG 3A4CA 4DYQA 4F55A 2UXNA 1SC7A 2VC1A 1YE9A 1W7PB 2V9VA 2E1OA 4EJTA 1X1AA 3H9JA 3RCOA 1Z05A 3G1OA 3FF5A 1NG7A 3ECOA 3L00A 1FIPA 1G6NA 5J8CA 1RRJA 1BC8C 4A69C 2EIKH 1D3YA 2CW8A 3K2AA 1ETYA 4G7HF 2X1CA 1WH5A 3BG3A 4B4CA 4F7ZA 1LKXA 2IGKA 4EM1A 2IS6A 1JUPA 1Y0NA 2W7NA 5E17F 3SYTA 1XSDA 5DTDA 2E1NA 1WQ2A 2L9NA 3C7JA 3PUBA 4BBSJ 1A36A 3R0AA 5IYDJ 5FKNA 5L3GA 3DPLC 2F4IA 4E4HA 1IN5A 3BCAA 4QSHA 5LBQA 5B1BH 4XRSA 1FYKA 4HAMA 3GTJJ 4AIKA 2HKOA 1B8IA 3W2VA 5DCMA 1O3TA 2IS2A 4XRSG 2M4GA 3TO9A 3BJ6A 4B3XA 4LB6B 1MDMB 2Z3YA 4B1RA 4I0BA 4J01A 1WJDA 4UUVA 4HF0A 2P5LC 2DJIA 3BQZA 3PM1A 3P7NA 4MQVA 3IKVA 3J81K 1HXDA 2RGVA 3GXOA 1YRNB 3PL8A 1XN7A 1WI9A 3WTXC 3JAMK 3SXYA 3L2QA 3RIRA 4A3CJ 1K6YA 4HYEA 3AG3H 1WFXA 2LY9A 1QQIA 2FOWA 2WC2A 5LRRA 1X2NA 3RKQA 4LFUA 3I4NJ 1B9NA 4KICA 4P96A 4C3HJ 4L5JA 5FKMA 4L9TA 3TOAA 2B63J 2VJ5A 2VKHA 2NYXA 3DPTA 3BTCA 2ZSHB 3KFWX 3BR6A 3HOZJ 4PUSA 1BN5A 2XROA 2OJED 3G71I 2W24A 3F8NA 3E6MA 2VXDA 1ZR4A 1MMGA 4BE1A 1X1DA 5LFAA 2OU2A 4N0BA 4BQOA 5F1RA 4HNUA 4E7HA 3BG9A 4XSXF 5GADJ 2D1VA 2BYVE 3WG9A 1X58A 3SZTA 4EJUA 2LBFA 5IOZA 3IRRA 2KLOA 1U5TC 2EB7A 3CC4I 3RZOJ 2ID6A 2R7DA 3LSGA 4FT8A 1SD6A 3VYSB 3JRIA 4F91B 3HDDA 3CO7C 2A69F 1V4RA 3S2DJ 3PFYA 5TGTA 4HSRA 2AXTC 4G6DA 4RM2A 3S16J 2XRNA 2KIMA 3U2RA 3QODA 2YR2A 2G0EA 4U88A 1RPWA 2JA2A 1YIJI 4A3KJ 1RR7A 3JAMZ 5BQTA 3A2KA 1T0FC 4FASD 2H8RA 5FD6A 4ANJA 2ZJRF 1Z3YA 1IGNA 1NK2P 2D2WA 4OAYA 3RKXA 4KISA 2HQ5A 1ZREA 1SVLA 2ZNZA 2AHQA 4BJTA 3A02A 1ORKA 4WX9A 1TP4A 2L3DA 2XSJC 3OYCA 2EA2A 4NQWB 1MKMA 2JUCA 4JOMA 4WCGA 4PSWA 3DF8A 3CP8A 1IXSB 4ZZLA 3BZCA 2HI3A 2HZTA 2ZNYA 1R5ID 2D5VA 1W36D 4LOCA 1XB4A 4MEYF 2PX9A 1FYMA 2VC0A 4AIHA 5TISC 3ERED 3R6SA 4ZC3A 4BEHB 2BOLA 2VT2A 2L54A 3VSKA 3CMMA 1ZK8A 1WI3A 3M8EA 2JQ7A 4U7DA 3KCCA 3WGGA 3NWTA 1FOXA 3K0LA 5EG0A 2HOSA 2BZTA 2M0MA 1SAXA 3W3CA 5HS8A 1UJ8A 1FIAA 3AG1H 1IZ1A 5L3CA 5GTHC 1I39A 1XCBA 3LQRA 4XR6A 1IRGA 4S04A 1YS7A 3RJPA 3F8MA 1K6OA 2E7WA 4EM2A 5KAFC 3KETA 1VQ7I 1V5EA 2Y0MA 3N97A 2JUGA 2VJIA 1VF9A 1D1AA 3ZQ7A 4IZZA 1KYZA 4IO9F 3I54A 4WK8F 1LE8A 1SMYF 2ZB9A 3E6DA 1HQCA 2CV0A 4I98B 3LSTA 4PJNA 3A03A 2ZXJA 5FO5A 3ZQQA 5H2FC 1F5TA 3ONQA 2EJRA 5M5XJ 2EQRA 2QQ9A 1FBQA 2DMPA 4A3DJ 2L0KA 5HVQC 2GM4A 2YPRA 2ZC2A 5FKOA 2QZ8A 2COMA 3H92A 3J80K 3LNQA 2DDBA 4Y4RA 4KFCA 3QU6A 2GXAA 1IRXA 3BC8A 4JP0A 4RB1A 3GLXA 3IH2A 2VIXA 3IH3A 2JN6A 5CVUA 3J7AY 2XV4S 1T08B 1WJBA 2CW7A 1D1BA 2K85A 2E2IJ 3S1NJ 1MMSA 4YELA 2ZXWH 3VYUB 2XF6A 4M3EA 2DN0A 1P7IA 2RQQA 4XKWA 1IN4A 1OCTC 2W25A 3OYMA 2HVRA 3N4MA 3REOA 3WU0A 4E70A 1MNDA 2E1MC 2PMZA 2KISA 1WSUA 2M30A 4UV8A 3V8JA 1AKHB 5JR3A 3KZIC 4M6YA 4KDPA 4G8XA 3T5XA 2M8GX 2BXZA 5IYCJ 2TDXA 3CDIA 3M1CA 3UR3C 2P4WA 3HRTA 4U0VA 4YFXF 1T95A 5K1YA 2K9NA 3ABTA 1K78A 3WODF 2FSWA 3JRGA 4OAZA 4CHUA 3QWLA 1VQLI 2RAEA 2KP6A 4HG2A 3MN2A 3HUGA 4HF1A 1JTXA 2JSCA 2M3AA 1MBJA 2KMUA 1OPCA 3KIOA 2VT3A 2V7FA 5KHDA 1C0WA 1X4OA 1DU6A 3DU5A 1K4SA 2Y2ZA 4ZDPA 1OKRA 4AD9A 2BY0A 1OYYA 3HOUJ 2RNGA 5EEAA 1O3SA 3GZ6A 4XSZF 1G3WA 3RKYA 1IN7A 2M2EA 1WZ2A 4J19A 2IA0A 5J6XA 4IXAA 1FOYA 3OYBA 4E7LA 2DMNA 1O3RA 1WJ5A 2GXGA 1W0UA 1L0OC 2OA4A 3OIQA 2QEXI 4LMYA 3GZ5A 2F5FA 2HU9A 2QBYA 1GXPA 5IP7J 2KIFA 1LVAA 4XL9A 1BA5A 2GWRA 3CJNA 5EGOA 2XUBA 1I27A 4ZYAA 3HL2A 3E0JB 1IV6A 2GBYA 4CCLA 4LD5A 3FK6A 3LSRA 3EYIA 5HDKA 4UXNA 4DOZA 2JSPA 4DYRA 5ED4A 4BDZA 3CJQB 2FBIA 1XS9A 3PQJA 2XRLA 3SFZA 4D0PA 4HV6A 2VASA 2A6EF 1BIAA 1IUFA 3UKGA 4MHGA 2PLYA 1QZZA 2DA4A 5HLIA 3CJRB 3GEZA 1KA8A 5FRNA 4N9HA 2K86A 1WKMA 1UELB 1BW6A 2CW0F 3GFJA 1D5YA 4IRHA 3C18A 4CGZA 1FBUA 3ZPLA 4L0YB 2IBDA 3LSKA 4M3BA 4LLLA 2JPCA 5LGUA 3IUOA 1WPKA 1XD7A 4NC6A 4CUGA 3OSFA 2NS7A 3FISA 5EYRA 1U9NA 1R36A 5H6QA 3CF5F 3L2RA 1H9GA 3IP4B 1I6XA 1VQ8I 2KFDA 1S3JA 3QAHA 4DGWB 1QA6A 3MWMA 3AG2H 1UHSA 1Z67A 2K4JA 2X4HA 1LDJA 4FX0A 1N25A 3VEPA 3U21A 1UG2A 2P8TA 5KVRA 3ZCOA 4PJMA 2UXXA 4WWCA 1TW3A 2FU4A 3GTLJ 1JUMA 2O03A 2MD0A 3MKZA 4KIFA 1X4PA 3CO6C 1X1CA 1SVMA 2E5NA 1Q1VA 3HYIA 3IHUA 3KYLA 1OYWA 2DOAA 2HQNA 4A3EJ 2IT0A 2ELJA 2QGUA 2LD5A 3QOPA 3I0TA 2B7EA 2CS3A 4C2UA 3LAPA 5DD8A 3HRMA 4U87A 2W84A 3FKJA 3KLOA 3WU1B 1S7OA 2I10A 4GRIA 1QGPA 1WRJA 2QVOA 3GTMJ 4LITA 4RA2A 3FXMA 2VUMJ 3HM5A 3CMYA 1YTYA 3HTSB 1A04A 1YOVB 5CVVA 1MJAA 2M7AA 1D0ZA 3PNTA 1ZGJA 2XAGA 2DBBA 3RSNA 4RB2C 1PUEE 2RREA 2JT1A 2HYFA 5JFRA 1JT6A 2E36A 3H1CA 2L5QA 2XSDC 3OYKA 2XKOA 3S32A 4DBRA 1FOWA 4MGRA 1WWXA 1TT5B 1B8IB 1XSXA 2K40A 4NB5A 2CYYA 2BY3A 3K4JA 1W5SA 4FETA 1EV7A 4M6XA 3X2QH 2EZKA 5ICGA 5JHFA 3IKTA 3ZQIA 4ZTJA 3HC7A 3ZOBA 2KHMA 2H27A 5CYVA 3I59B 2V9KA 5D4RA 4AVPA 2NVQJ 2W57A 2K27A 5DD4A 4S05A 1Y39A 2EH3A 1U9OA 3K70C 4XONA 4HSTA 1YQAA 2FD5A 2V26A 1H8AC 4LK1F 1KU9A 3S15J 1SD5A 3OL4A 4AWXB 3DP7A 3M1EA 2B9SA 3S93A 4A0ZA 2O5RA 4M3DA 3HZJA 1DUXC 3BY6A 1PUFB 3IV5A 1Z1DA 3B6CA 2OQGA 1IV8A 3GFLA 1FNNA 2LOOA 1HKTA 3E3VA 1RUNA 5M3FJ 5KK1A 3S8PA 3JCUC 3K7AJ 4GCVA 4B8XA 1U78A 3AFHA 2R7WA 2LBFB 3BOQA 1EH8A 1MD0A 1MMNA 4BBRJ 3A0BC 2QUFA 1YG2A 1IUYA 3T8TA 2XKPA 3K1PA 1JKOC 3MKYB 3G6EI 2PJRA 5B66C 1USTA 4IQ4A 4XLNF 2VKVA 2IXSA 2XGEA 4M3FA 2X6XA 3E5UA 4GFBA 5GPCA 3K9TA 1P92A 4PGGA 3P5JA 2R5YA 3KP6A 1ZRDA 3JSPA 5E1WA 3K4BA 2FBKA 3FDYA 4II2A 4PDKA 1ZYRF 9ANTA 2Q1ZB 2QSHX 1PP7U 1K61A 1USSA 2KIUA 1KONA 3ASNH 1T39A 4M9ZA 2L02A 2LSOA 5F04A 2WWYA 4N4OB 4LG0A 3R61A 2JK3A 1ETVA 3DKWA 1NHAA 3BTJA 4LGWA 5D6EA 1IW7F 1J09A 4O3MA 5HLHA 1DPUA 4F3QA 1DP7P 3AL0C 4XLFA 1JT0A 2FXAA 4ESFA 5EG0B 3S14J 3EUKL 2K9MA 1H89C 1TNSA 3ABUA 1Y6IA 2DA5A 4QTRA 4XM3A 5EZHA 3OS2A 3HXLA 4YFNF 2ECBA 3BR1A 1AA7A 1E2XA 1XPXA 1D0YA 1KYWA 1GVDA 1ONVA 1SFUA 5FD5A 2BVMA 2GXBA 4EGZA 4AUXA 3LSIA 2Z5UA 2HDDA 5GAEJ 2E34A 5DEQA 3KP5A 1ZR2A 1LE8B 5LGTA 3ZMSA 3FXQA 2O61A 4Z6YA 3D5SC 1J59A 1QPMA 5IT3A 2A07F 2P5VA 1RUOA 5E1ZB 3DLAA 2XPUA 2NVUB 1MW7A 3R4KA 3GFIA 1E17A 1A6IA 4PJLA 4UB6C 1ZG1A 2BY1A 3Q0UA 5DCFA 1MBKA 3AAFA 3ASOH 3D1NI 2ZXHA 4A6DA 3W2WA 2K02A 2QF7A 3ABKH 1F36A 4AYBN 2R4GA 5CJ9A 2HYJA 4XBFA 2ECCA 1ON2A 1OR7A 3JREA 2L2OA 2OPTA 4XK4A 1BW5A 4RS8A 5ICFA 2P7CB 2HS5A 3TW7A 4ZYEA 1XDUA 2CUFA 2ID3A 1SVOA 3WTZA 2DK5A 4P1WA 3BG5A 2QWWA 2WTEA 1BJZA 1KU3A 1SFEA 1S7EA 4N4NB 2JA7J 1Z7UA 1LB2A 2VJJA 1JGSA 3FXKA 2Y0SN 2NAZA 3TDZC 1X1BA 2QYOA 3WE3A 1YX5A 2P81A 4D7NA 4I99C 1MSFC 1TWHJ 5C4XJ 2GOMA 3HSFA 1L3LA 3S3NA 2FMYA 4NBQA 2RV8A 4HLYA 4DQ2A 5KCMA 3F8FA 4B47A 3SHFA 2DT5A 1BR1A 2FNPA 3K2ZA 2RN7A 1YJ9I 2H94A 3SDBA 3HUGB 3JRHA 1KZHA 3SEQA 3HOXJ 3O3KA 4EM0B 4I02A 1R4NB 1U2WA 3G3ZA 4X6AJ 5F0HA 4KT5C 1FLIA 4OIPF 5CQGA 3IC7A 4QPQA 5J1UA 2VXZA 3BCBA 3DBHB 3ECHA 3H9GA 2OBPA 4A0XA 2PJPA 3G73A 3V42A 1Z77A 5JLXA 2P6SA 1ODDA 1S6LA 3CCYA 4UUSA 3HB9A 3K70D 2UUZA 2HPIA 3GMEA 3GTPJ 5E8IA 2QBYB 2WB1A 1GV5A 2EFOA 3OYJA 2IGNA 3O8GA 2F4OB 5EGOB 1EJ9A 2HDCA 4NHJA 4DNCA 1R22A 1VQOI 4F52A 4HQEA 1SFOJ 3E5QA 3GTQJ 3CC2I
chains in the Genus database with same CATH topology
2EINH 2DYSH 3ABKH 3ABMH 5B1AH 2EILH 3X2QH 3AG2H 1OCZH 1OCCH 1V54H 3WG7H 2EIKH 2DYRH 5B1BH 3AG3H 2OCCH 5IY5H 3ASNH 1OCOH 3ABLH 3AG4H 5B3SH 2EIJH 1V55H 2EIMH 2Y69H 3ASOH 2ZXWH 3AG1H 1OCRH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN H;  2DYS H;  3ABK H;  3ABM H;  5B1A H;  2EIL H;  3X2Q H;  3AG2 H;  1OCZ H;  1OCC H;  1V54 H;  3WG7 H;  2EIK H;  2DYR H;  5B1B H;  3AG3 H;  2OCC H;  5IY5 H;  3ASN H;  1OCO H;  3ABL H;  3AG4 H;  5B3S H;  2EIJ H;  1V55 H;  2EIM H;  2Y69 H;  3ASO H;  2ZXW H;  3AG1 H;  1OCR H; 
#chains in the Genus database with same CATH topology
 2KRF A;  3M9A A;  2X48 A;  2Q0O A;  2DA1 A;  3ROU A;  4Y7N J;  3HBL A;  2NXN B;  3MKL A;  2LDU A;  1B9M A;  3FZV A;  2TCT A;  4EVI A;  3H9Q A;  4PCQ A;  1MBF A;  1WJE A;  1NK3 P;  4YII A;  2FX0 A;  3I56 I;  2QCO A;  3T0Y A;  1HDD C;  1X1P A;  2FJ1 A;  2GA2 A;  4Q47 A;  4IHS A;  1LEB A;  3CCQ I;  2UV1 A;  3HOY J;  2EFQ A;  4ENN A;  2QA4 I;  5BMZ A;  3WGI A;  2DLL A;  1ERD A;  5EJC A;  1R49 A;  1K7A A;  2VOP A;  2OQR A;  2X9D A;  3EET A;  2XHK A;  1IG7 A;  4A3F J;  1FYL A;  2DMT A;  3QPL A;  1VFC A;  4XQF A;  4BY1 J;  2DMU A;  1FX7 A;  2DK8 A;  1RC9 A;  3DFG A;  2UWM A;  1Y8R B;  4A3J J;  2CO5 A;  1MGT A;  2LKS A;  2E60 A;  2L01 A;  3G1M A;  2KQR A;  2W1O A;  5K5Q A;  2ME6 A;  3V7C A;  1QO0 D;  2F5C A;  3A01 A;  3ZMZ A;  3QP6 A;  1B1B A;  2EV0 A;  1OCR H;  5ICC A;  4BHC A;  4ZDO A;  1ETQ A;  2DA3 A;  3KP4 A;  2G7U A;  3PUF A;  5DDG A;  2KIQ A;  2Y30 A;  2AO9 A;  2VQC A;  3I53 A;  5HOD A;  2OZU A;  2MSY A;  3ZMD A;  4OIO F;  3R0J A;  1DGW Y;  2F2E A;  3I64 A;  3PNV A;  1UAA A;  5LEJ A;  1JI8 A;  1ZEL A;  1POG A;  1W5T A;  2GQQ A;  4RAZ A;  4ESJ A;  2W85 A;  1ETK A;  2KL4 A;  3TL4 X;  4XN0 A;  2K7L A;  2EFN A;  4HDV A;  2XGC A;  1KGS A;  2Y48 A;  4DZJ A;  5AIQ A;  1ZKG A;  2JZY A;  5FFZ A;  4CYC B;  2CQK A;  2VE9 A;  2Y69 H;  3GWZ A;  3HJE A;  3L09 A;  5FLM J;  2DDA A;  1LNW A;  4CIC A;  5B5E C;  1S72 I;  3FXL A;  3E7L A;  2XAQ A;  3RPU D;  2IS4 A;  5F6F A;  4DBQ A;  1VQM I;  4BQQ A;  1MNE A;  4PZJ A;  3EUH C;  1ULY A;  3ZQG A;  2R5Z A;  3UNG C;  2X6W A;  5EF6 A;  2R93 J;  4CCM A;  1IC8 A;  2G9W A;  1S8N A;  2DTR A;  2HGC A;  2MC4 A;  1REP C;  2BVL A;  3NRV A;  1ZGA A;  1UHM A;  2AS5 F;  4CDG A;  2FOK A;  3O6B B;  4IOA F;  4ZJZ A;  1W7P D;  4MFD A;  3GCM A;  4DZP A;  4AU7 A;  4FQG A;  3AKZ A;  2V1N A;  1BI2 A;  1B72 B;  4XIC A;  3HG9 A;  4HRI A;  3KYD B;  2J5P A;  2X0L A;  4HQM A;  1UFM A;  1FMV A;  3K4L A;  1AU7 A;  3TP0 A;  3F8B A;  3MQ0 A;  4CYD A;  2ISZ A;  1QZY A;  1ZH5 A;  2EV5 A;  2Q2E A;  3S3M A;  2R7X A;  4IL6 C;  1GUU A;  1LFB A;  3BPV A;  4BAC A;  1X3W B;  3WTS C;  1GDT A;  5E18 F;  4A12 A;  3BR5 A;  4UHT A;  3LMM A;  3KYC B;  2XAF A;  3ZRG A;  2BGC A;  3K1N A;  1TNT A;  3K4M A;  1ZQ3 P;  2M9H A;  2ZME A;  4KNY A;  2CFO A;  3EUA A;  2IRF G;  4FHT A;  2ZFU A;  2MW8 A;  3IWF A;  3TOB A;  2M34 A;  3H3Z A;  2IP2 A;  1IF1 A;  3PO3 J;  2FE3 A;  3WG7 H;  2DPD A;  4WXC A;  2B0L A;  1ETO A;  4WF2 A;  1EH6 A;  4L9V A;  2KT0 A;  3KP2 A;  5D4S A;  2OCC H;  2PG4 A;  3IRQ A;  3W6V A;  4ABZ A;  2XPV A;  1TWC J;  2NVY J;  3DTK A;  3EDP A;  4PJ0 C;  2OC6 A;  4GO1 A;  4IHX A;  4II3 A;  3DKY A;  3F0C A;  5F0C A;  1U8B A;  2DQL A;  4Y52 J;  3ZMV A;  3JTH A;  4V2G A;  4Q5S F;  4I2O A;  2EA4 A;  2VQL A;  2BHY A;  5J3L A;  3HHG A;  1S7A A;  2QLZ A;  2CUE A;  1XMA A;  4PFP A;  3BG6 A;  1DGR M;  3Q9S A;  5J47 A;  2EZH A;  2OCE A;  3CTA A;  2G7H A;  1QU3 A;  4KMF A;  4BKX A;  1ZHF A;  1TLH B;  3ZMT A;  3WTV C;  1TZL A;  4W1U A;  2H1K A;  2FUG 2;  1GV2 A;  4MO7 A;  3EQL F;  2DA7 A;  5HNF A;  1YHQ I;  2BW3 A;  1R71 A;  4BXU A;  3SDG A;  2Y9Z A;  2LK2 A;  2E35 A;  2EIN H;  1JHF A;  4DIQ A;  4HDU A;  1AWC A;  1I5Z A;  1I1S A;  1T2K A;  4UVC A;  4CCK A;  3VFZ A;  4A93 J;  1Z6R A;  3IAM 2;  1UG0 A;  5CVI A;  1IXR C;  1I50 J;  3K4C A;  2L7F P;  3BTL A;  3JSO A;  5JVG F;  3GBG A;  5FRM A;  3CUQ C;  1N77 A;  2JA5 J;  2XAH A;  2VOO A;  4XLH A;  1JJ6 C;  5LD2 C;  4UVA A;  2MD5 A;  1ITY A;  1W7P A;  1JE8 A;  3CF2 A;  2BHZ A;  4BYY A;  2HQR A;  4CXF A;  3VOD A;  5K7F A;  3GF2 A;  3VYT B;  4HBL A;  5B3S H;  3TDU C;  2VLA A;  3KE2 A;  2R7F A;  5CVJ A;  3B73 A;  5L3B A;  3NWS A;  3TQN A;  4D7M A;  4MTE A;  2DOF A;  4E7Z A;  1J0R A;  2MC3 A;  2M1B A;  3LOC A;  2HOA A;  3KLN A;  1P6R A;  3DTI A;  5J1Y A;  5FKK A;  3VWB A;  2ZFW A;  1RZ4 A;  2FA5 A;  1V5G A;  1IDZ A;  2ESN A;  4L18 B;  1W0T A;  2PN6 A;  4HEA 2;  4JBA A;  2MFZ A;  1JKP C;  4ASN A;  5EZG A;  2E71 A;  4Z2Y A;  3PSI A;  5IPA A;  4RB3 C;  2PI0 A;  3BR0 A;  3KPH A;  4MQ9 F;  2K5C A;  2H09 A;  5FB2 A;  2OZ6 A;  2P7V B;  1G3T A;  3CCE I;  4HF2 A;  2VBW A;  5D8L B;  3DPU A;  3S1M J;  3FMR A;  1OYI A;  4FTH A;  5FLV A;  1GHC A;  2MLG A;  2PMH A;  1XG1 A;  4XOP A;  2WAE A;  1SD7 A;  2PQ8 A;  5DS9 A;  4HX7 A;  1FP2 A;  3CLQ A;  3CUQ B;  2RKH A;  3SQN A;  4L5I A;  5J4Y A;  4A3B J;  4H0E A;  2CRG A;  3GVA A;  1P7J A;  2EV6 A;  2O7O A;  2QM3 A;  5AON A;  2OV7 A;  2KZV A;  3FXR A;  3CC7 I;  1LDK B;  2NS0 A;  2QQ8 A;  3KZZ A;  1XC5 A;  5H20 A;  3FXU A;  1IN6 A;  1YRN A;  1H88 C;  3NQO A;  3OYG A;  1F1Z A;  2VPL A;  1P4A A;  3QPT A;  1LEA A;  2E7X A;  1ENH A;  4RB0 A;  2HZD A;  1QVU A;  3CLO A;  3O2P E;  1IO2 A;  1CGP A;  2CQ7 A;  2OAZ A;  3DKX A;  1G8X A;  3QQA A;  4CA0 A;  1FOK A;  3IWZ A;  2XB5 A;  1TTY A;  4MTD A;  1KU7 A;  3SZP A;  2VI6 A;  4RAF A;  4MEX F;  2N8G A;  1MH3 A;  1QHH D;  3ZR8 X;  4CCJ A;  2VOD A;  4RGU A;  1QNT A;  4UUT A;  2PFB A;  1J7K A;  1ZGW A;  3L9F A;  3KX2 A;  3M07 A;  3W2A A;  5HDG A;  3I4P A;  3RQI A;  5HDN A;  1VQ6 I;  2O6G E;  4RBO A;  3DEU A;  4XNF A;  5F0F A;  4L0Z B;  3LA2 A;  1XCV A;  2LMD A;  4I76 A;  4M71 A;  2F5E A;  2DXI A;  1QPI A;  3DLL F;  3TKY A;  2MBF A;  2A6H F;  2EIL H;  2W48 A;  3L2W A;  1SAU A;  2R7S A;  2HNH A;  1OCZ H;  3HKZ N;  3RTR A;  1TT0 A;  2K3P A;  3BZ6 A;  1T8I A;  3HSR A;  2ZCW A;  4JYK A;  3W6J B;  1HLV A;  2IGO A;  2XC7 A;  4BXX J;  2Y75 A;  1TQI A;  2LNB A;  2E19 A;  1AOY A;  4B48 A;  3CCR I;  3OMY A;  3PO2 J;  4ZH4 F;  1J5Y A;  2DW4 A;  1B4A A;  3FK7 A;  3VDX A;  1MBG A;  3LAJ A;  3WTW C;  2V79 A;  3FKI J;  3QYE A;  1N78 A;  5JVT A;  1A35 A;  2MLK A;  5HLT A;  3FM3 A;  2JA6 J;  4UUS B;  5FKL A;  4I0A A;  2KJB A;  3RI4 A;  5DCM B;  3ELK A;  3I55 I;  2VJ4 A;  1GLN A;  1FSE A;  1LVK A;  1X2M A;  1LQ1 A;  2KDZ A;  3B6A A;  4XMY A;  2ESH A;  2EZL A;  1P4X A;  2LRD A;  3S2W A;  1I1G A;  5E3M A;  4XN3 A;  3WU2 C;  1UCR A;  3GW2 A;  4BEH A;  5KNL A;  3L2C A;  4N9I A;  4UY8 I;  2HOT A;  3K10 A;  3LA7 A;  3LSJ A;  2ICW G;  2IS1 A;  1TWF J;  4ZYH A;  2UZK A;  2GZW A;  4IOC F;  4PJJ A;  1U5T A;  5C4J J;  4JX4 A;  4Y15 A;  2HR3 A;  3HTU A;  2LRE A;  4H4K C;  5D8K B;  1IDY A;  2VQG A;  1J2X A;  1S9H A;  3OYD A;  4IVN A;  3U1D A;  2MA3 A;  2P5K A;  4U7B A;  2ELH A;  4WXD A;  2HDW A;  2DA2 A;  3DU6 A;  1T0F A;  4I09 A;  5LRS A;  4Q4Z F;  1MMD A;  4QWQ A;  1CF7 A;  1P2F A;  1E3H A;  3S3O A;  4CCN A;  1H0M A;  3CES A;  1YJW I;  2LVS A;  5LEK A;  4J00 A;  2R7O A;  5CLS A;  2K3F A;  1X19 A;  4G9Y A;  3A01 B;  4YIF A;  1R23 A;  1M1E B;  4P9U A;  4X1E A;  3WGH A;  1HW5 A;  3KEY A;  3RPQ A;  1N75 A;  2E2J J;  5IT9 K;  1MJ9 A;  5E3L A;  1VND A;  1B59 A;  3BT9 A;  2CU7 A;  3HOW J;  4AVZ A;  1TQM A;  5E20 A;  3BRO A;  3VOE A;  4AM3 A;  3ZN1 A;  4XRM A;  3OYF A;  4UV9 A;  1ACI A;  2RQP A;  4CCO A;  1Q1H A;  3M7G A;  4Y13 A;  1WVR A;  1MH4 A;  1WGX A;  1Z21 A;  1K79 A;  2LLK A;  4BXF A;  2QEN A;  1HCR A;  1E3P A;  4P55 A;  3ZGK A;  4BHP A;  3JW4 A;  3S1Q J;  2QKL B;  4FE7 A;  1FC3 A;  1OIS A;  5JLW A;  5KAI C;  5CKT A;  5AIP A;  3BTI A;  3FX3 A;  5LHG A;  4HA8 A;  1AHD P;  2LG4 A;  3BG7 A;  3VSL A;  1ZRF A;  2LP0 A;  3OL3 A;  2BBY A;  2R5Z B;  1HKQ A;  1TW2 A;  4B44 A;  5LGN A;  5FGM A;  2FRH A;  3IH4 A;  2D45 A;  1F4K A;  2PEX A;  3RQ4 A;  2IVM A;  2VKD A;  5JI6 A;  5IP9 J;  1F43 A;  2VB6 A;  3JR9 A;  2XF5 A;  3Q9V A;  1U0J A;  2P6T A;  1R00 A;  4C2M J;  2JVG A;  3S17 J;  1MSE C;  3VYR B;  2IPQ X;  2F5D A;  5IT9 Z;  4XKB A;  3LA3 A;  1XSV A;  2VN2 A;  1U8R A;  4B43 A;  2CSO A;  2I5U A;  2V1D A;  3QP5 A;  5DUI A;  1ZRC A;  3H5R A;  4ZDL A;  5GPA A;  3J7A O;  2L4A A;  4BL0 B;  5D5W B;  1YW8 A;  3F22 A;  2HWV A;  5F08 A;  1G3S A;  1GXQ A;  3E6C C;  1R5H A;  2DU9 A;  1NG6 A;  2Q2E B;  4IX7 A;  3CCL I;  5B1A H;  3DTE A;  2Q8K A;  3HRS A;  4O6J A;  5EDN A;  3OYH A;  2ZJQ F;  1V5F A;  4GGG A;  1Z9C A;  2L9S A;  3F6O A;  1SFX A;  2DOE A;  4DJA A;  1FTT A;  3LSM A;  1O3Q A;  3WE2 A;  3K4K A;  2ZME B;  3LL7 A;  2JRM A;  2XAS A;  3H5A A;  3R60 A;  4C3J J;  4RDU A;  4JK1 X;  2YU3 A;  2M87 A;  2FQ3 A;  5BPD A;  1LFU P;  2A61 A;  2R7V A;  2LKP A;  4PK4 A;  4RM3 A;  5BPI A;  3E1S A;  4M74 A;  3CME I;  1STZ A;  1PDN C;  4ITV A;  4YFK F;  2DFF A;  4OMZ A;  1XGN A;  2CGP A;  3BJA A;  1E0E A;  1SD4 A;  2Y31 A;  2HEO A;  3H3V K;  1QZE A;  3BLY A;  1HC8 A;  3LFU A;  5E3O A;  5IYB J;  3BJO A;  3LWF A;  4QPO A;  5ILS A;  2F6C A;  2AXL A;  2F5V A;  3ESW B;  4BJ6 C;  3U1K A;  3SZG A;  3MZ8 A;  1X3Z B;  1MNM C;  4OMY A;  3OYN A;  3VPR A;  1YJN I;  3BZK A;  2KZG A;  3RYP A;  1OJL A;  1Z91 A;  2ZO4 A;  3ULQ B;  4MIM A;  2JA8 J;  1JGG A;  4Y33 A;  2O0Y A;  3CCS I;  1QVT A;  3HOV J;  3OYA A;  2I8D A;  3WTT C;  3MZH A;  1VQP I;  3NAR A;  4HZF A;  1K78 B;  3JRB A;  3M8F A;  3DXJ F;  1R7J A;  3JRD A;  3H5N A;  1ETW A;  4ZYD A;  1W5C C;  5BS6 A;  5DM6 F;  1WH7 A;  4P5O A;  3V8L A;  4HNT A;  3BQY A;  3CCV I;  2CV2 A;  2IGM A;  1FPQ A;  1DDN A;  3P9K A;  1YI2 I;  4AID A;  4I7H A;  3H0D A;  4BS9 A;  1F9N A;  2BEO A;  2MYS A;  2DOD A;  1KU2 A;  2NNN A;  3OSG A;  4HLX A;  3BPX A;  3M4O J;  4NUB A;  4AC0 A;  1PVE A;  5CVR A;  2PMZ N;  1D8J A;  1I3Q J;  4LB5 A;  2A05 A;  1Y8Q B;  2VQH A;  3C3W A;  2W82 A;  5ERI A;  4E7I A;  1ZG5 A;  5M5Y J;  1PYV A;  1WJF A;  4EMS A;  2EK5 A;  4PGH A;  4OWR B;  5LHH A;  2Z1D A;  2CUZ A;  4V19 K;  4IHY A;  2VBY A;  1RKT A;  2EFP A;  2EIJ H;  3E6B A;  2O8K A;  1SFK A;  1JHH A;  4IHV A;  1IJW C;  3EYY A;  1O57 A;  2FNA A;  4DW6 A;  3QU3 A;  3F6V A;  4IJA A;  4D5C A;  1KQ8 A;  4NNJ A;  1XX5 A;  5BNG A;  3HOT A;  2V6E A;  4NC7 A;  4RMN A;  1FY7 A;  3CQZ J;  4RGS A;  1YLF A;  4A5N A;  2FQ4 A;  1S29 A;  3CZ6 A;  4O5V A;  2X6Y A;  4XKV A;  2VPR A;  3OOP A;  2FML A;  4MNU A;  4HX4 A;  1HSJ A;  2KJC A;  2IAI A;  4FE4 A;  4NC8 A;  3A0H C;  5D5X B;  4BDY A;  3WHC A;  5K7Z A;  4KYW A;  2LY2 A;  4ENM A;  1O7F A;  1FWZ A;  4XRF A;  4EGY A;  2VL8 A;  3I4M J;  2STW A;  1J75 A;  3I59 A;  3M8J A;  4BAY A;  1MIJ A;  1QRY A;  3PSF A;  2M45 A;  3BR3 A;  3SEZ A;  4RGX A;  4BHB A;  3PNY A;  1VQ4 I;  1SAN A;  4JX5 A;  2CQQ A;  3OYE A;  3GUD A;  4HOB A;  2LKX A;  3DQV C;  4MLO A;  1T38 A;  3M3Y J;  3HIF A;  4BGD A;  1Z7L A;  2F4M B;  5LHI A;  2GLO A;  4IHT A;  2AQF A;  1VQ9 I;  1JUS A;  2FEZ A;  2K9Q A;  2WV0 A;  2X85 A;  1UHW A;  2YX4 A;  2RVC A;  1S5L C;  1EKE A;  2ZBK A;  3ABM H;  1DQU A;  1XMK A;  1PUF A;  3MZY A;  3GTO J;  4DYC A;  3DWL E;  2MG4 A;  1R1T A;  1RKW A;  3LQQ A;  5K5R A;  1QBJ A;  2EPF A;  4BU2 A;  1YX3 A;  3OYL A;  1VQ5 I;  5C44 J;  4OIR F;  2RDP A;  4QLC U;  2O9L A;  5GAH J;  1YW7 A;  2IEK A;  1APL C;  5FRO A;  2E5Z A;  4A6E A;  3ML6 A;  2CJJ A;  5E8G A;  5D6F A;  3J7Z I;  2HTS A;  2Z16 A;  2DTZ A;  3ZQL A;  1TBX A;  2V9P A;  4G6Q A;  2CUJ A;  3HGY A;  4LIV A;  4M73 A;  3PJR A;  1IXC A;  3OWT A;  2JVH A;  3MD2 A;  3J81 Z;  2KKO A;  2BXY A;  2V4J C;  3OR2 C;  2ME0 A;  3LFK A;  4BY7 J;  3CCM I;  2ZXI A;  3RDI A;  2YUS A;  2ZJP F;  4L5E A;  3BDD A;  3GO5 A;  1YS6 A;  1R4M B;  4P9F A;  1ON1 A;  5E3N A;  5J8F A;  2KRC A;  2LY1 A;  1HA8 A;  2RC4 A;  2OUM A;  5ILU A;  1YO5 C;  4IRI A;  3CCU I;  1Y0U A;  2V1X A;  1T98 A;  2QQB A;  4A3L J;  1VZ0 A;  1EF4 A;  2ACJ A;  2V1U A;  5K5O A;  2R7R A;  1U6G A;  2NRA C;  2XB0 X;  1WHU A;  3K69 A;  2ZKZ A;  1OCP A;  3ZXS A;  2QSG X;  3QPH A;  1BI3 A;  3G4S I;  4E7J A;  3PFI A;  3CP2 A;  1ZN2 A;  1K83 J;  1XTA A;  3E97 A;  5JHU A;  1VQK I;  4M9S A;  4E7S A;  3V7S A;  1R6R A;  3ISP A;  4FCY A;  1BI0 A;  2E2H J;  1WCM J;  2H6B A;  2DFI A;  2L7M P;  4A5M A;  1U5T B;  1UB9 A;  1T56 A;  3JRC A;  3MVP A;  3Q3S A;  1HOM A;  3QOE A;  3F8C A;  2JPB A;  5FFX A;  2GIV A;  4M3G A;  3N05 A;  2H8W A;  2NVT J;  2PBI A;  4RAY A;  3KP7 A;  4LLN A;  3QYF A;  5IP6 A;  2NNY A;  4A2U A;  4KN4 X;  3VB2 A;  2Z33 A;  4XOR A;  4AYB A;  5DV5 A;  3OIO A;  1U3E M;  2DPU A;  1LUJ B;  1I6H J;  2CG4 A;  2M0C A;  2TRT A;  2VBX A;  4B3A A;  1CF7 B;  1XMX A;  2HQA A;  4BE0 A;  4IHW A;  1G59 A;  2CH0 A;  4I01 A;  3U9G A;  4ON0 A;  5BOX A;  4OU0 A;  3OV8 A;  2K9S A;  3ZQC A;  1GT0 C;  2LF8 A;  5ICE A;  2VON A;  1TWA J;  2EWN A;  2HTJ A;  4EJW A;  1EA3 A;  1D8K A;  1JJ8 C;  1JXS A;  1D5V A;  2Y0S A;  4LK0 F;  1X3U A;  2A5Y B;  4G12 A;  4EAT A;  1D0X A;  1O7L A;  4K2E A;  3CCJ I;  4ENK A;  2LC2 A;  2PJR B;  2XVC A;  1OLT A;  3QPS A;  3V8K A;  3C1D A;  3CD6 I;  1T6S A;  3TP3 A;  4LG3 A;  4EJO A;  4KT6 A;  2QSF X;  2R5Y B;  2RNJ A;  5EEH A;  3F21 A;  4EQQ A;  3HPH A;  2HVQ A;  2WA0 A;  2R7Q A;  2NOG A;  4OIQ F;  1JTY A;  2DT7 B;  4HV5 A;  4YEJ A;  3JTG A;  3RPU A;  1CQT A;  4X0G A;  3QRF F;  2DT6 A;  1TQP A;  2DYS H;  4R1H A;  1BR4 A;  2LFB A;  3C2G A;  2WAF A;  2CFX A;  1SMT A;  4KA4 A;  1I3A A;  1ZTR A;  1BJA A;  4LG0 B;  1J9I A;  2DA6 A;  3KP3 A;  5E1X A;  1HDP A;  2YX7 A;  4IPA A;  3FHZ A;  4EJV A;  4F93 B;  2CQN A;  3GYH X;  4Y17 A;  1YFH A;  2WAQ N;  1HKS A;  4KJZ A;  3I9V 2;  1DU0 A;  4Y3O A;  2ETH A;  2L4M A;  1R1V A;  3HHH A;  3T1B A;  2WAD A;  1OR7 C;  3SJM A;  1TWG J;  3FMQ A;  4HNV A;  2EBI A;  1NH3 A;  1H9T A;  2WY7 Q;  2STT A;  4M9X A;  5EEG A;  4M6V A;  1G2H A;  5D5V B;  5H6R A;  2JMW A;  3MCZ A;  3J80 Z;  2Z9O A;  4S0H B;  4V2F A;  1IN8 A;  3FBI B;  2OF7 A;  5F27 A;  2NS8 A;  2ISY A;  1BI1 A;  1UZC A;  2DFH A;  2F48 A;  3OR1 C;  2OTJ I;  2GAU A;  4XLP F;  2BY2 A;  2DAO A;  2HKX A;  2R7Z J;  1HW1 A;  1T33 A;  2R3S A;  3TMO A;  3Q0W A;  2LH9 A;  4XLC A;  3FBN B;  2BV6 A;  2K4B A;  4L9J A;  5J40 A;  4I6Z A;  3DV8 A;  3HPG A;  3I3L A;  3HEF A;  2E1M B;  3DBR B;  5DYM A;  4IRG A;  4C3I J;  1RI7 A;  1GVJ A;  2ADU A;  4C30 A;  1MDM A;  1Z6T A;  4U0W A;  3HGG A;  2IA1 A;  2XIG A;  4EV0 A;  1BIB A;  1R5G A;  4ZTF A;  2M8E A;  2L7Z A;  2HXI A;  3FIW A;  1MJB A;  1G3Y A;  1P9Q C;  2A3S A;  5FJ8 J;  2DQR A;  2YU9 J;  2NOJ B;  2KPM A;  5J4V A;  5CQE A;  3E5X A;  2JJ7 A;  1WJC A;  4D9J A;  5IOY A;  2DI3 A;  3DEE A;  2KDO A;  3MAJ A;  1W1W E;  3CUO A;  3C2H A;  4A3M J;  1KQ0 A;  3K4N A;  3F9K A;  4IKF A;  1ZG3 A;  6PAX A;  3NAU A;  2R0Q C;  4UNO A;  2R92 J;  2D1H A;  4B09 A;  4BE2 A;  1XDS A;  2ELK A;  2LR8 A;  1P4W A;  3CDL A;  4CO8 A;  3GTG J;  4KUM A;  3ZQF A;  1HW2 A;  2HOE A;  4JQF A;  3L2U A;  4XLA A;  3H36 A;  1YIO A;  4U0Y A;  2A6T A;  3C2B A;  4LLG F;  2OTL I;  3OS1 A;  1RNL A;  3KEQ A;  1RET A;  2XF7 A;  1Y1W J;  3CDH A;  2HVS A;  3T8R A;  2HXO A;  1R58 A;  1WJA A;  3Q5F A;  3F72 A;  4W97 A;  4CZC A;  4RLF A;  4ENJ A;  2IJL A;  1ZLJ A;  4PSX A;  2ZSI B;  3MKW B;  4OOI A;  1QHG A;  1BOB A;  2M5W A;  1FJL A;  3QYB A;  5F1J A;  1B6A A;  1IRF A;  2GOX B;  1BC7 C;  2CV1 A;  3I5U A;  4E6K G;  3BP8 A;  2C6Y A;  3K6G A;  3L2V A;  4A0Y A;  3B02 A;  1UMQ A;  4IEJ A;  3ZQH A;  1A5J A;  2XAU A;  2MAB A;  2XGX A;  3ERM A;  1ZAR A;  2O8X A;  3KEO A;  4GYI A;  3TBI A;  5J1R A;  3PIO F;  2O3F A;  3RKW A;  5C3E J;  3OOU A;  4CYC A;  1LPQ A;  4NQW A;  1FP1 D;  3BR2 A;  4RAG A;  3FMS A;  4HX8 A;  1BM9 A;  3FXO A;  3RZD J;  2FF4 A;  4EEF G;  4XKC A;  4D1Q A;  5FLX K;  3FHN A;  5HS7 A;  3JRA A;  5A2Q K;  1MMA A;  5GP9 A;  2GIZ A;  3AG4 H;  1YIT I;  4BH9 A;  4RGR A;  1SEU A;  2DCE A;  4M72 A;  1BOA A;  3DBL B;  4FIS A;  4ZZD A;  2A5W A;  2VBZ A;  2COB A;  2L7K A;  4LJZ F;  4KMU X;  4Q48 A;  3SFI A;  2MGQ A;  3P9I A;  1OCC H;  1Y56 A;  4YIR X;  1DP3 A;  1JKQ C;  5DUK A;  2DMQ A;  5L3D A;  3F3X A;  1R1U A;  4C9Y A;  4BUP A;  2IW5 A;  2WB1 N;  1B72 A;  2K9L A;  3HOS A;  4KN7 X;  2FBH A;  4YRV A;  3A1Y A;  2YSR A;  3H3U A;  5M3M J;  2GA1 A;  3W6K B;  1PJR A;  3MMY B;  3COA C;  3IAS 2;  1YYV A;  2L9R A;  2XAJ A;  3CJT B;  4G94 A;  3K1M A;  1R9T J;  4G6T B;  3V4G A;  3JRF A;  1ZAO A;  1FBS A;  4ESB A;  1TL8 A;  3L7W A;  2MH2 A;  4KIB A;  5FLX Z;  1TC3 C;  3D5R C;  4L9N A;  1FEX A;  3RYR A;  1FZP B;  2BE5 F;  3O8H A;  5TJJ A;  5A2Q Z;  3H35 A;  1LDD A;  4G7Z F;  2DO7 A;  3OYI A;  1YW9 A;  4ETS A;  1RES A;  3EUH A;  1BR2 A;  2EIM H;  2HFH A;  2M7B A;  2XGD A;  3TGN A;  2JRT A;  3G1L A;  3G2B A;  3GTK J;  2X1D A;  3WHB A;  2W00 A;  5DM7 F;  3FWE A;  1K4T A;  1XGM A;  4FX4 A;  5M5W J;  2DFE A;  4BNC A;  1PP8 F;  1BL0 A;  4GXO A;  4HW0 A;  2CMP A;  5HLG A;  2DYR H;  2LF7 A;  1FMW A;  4WXH A;  3TW6 A;  3GLL A;  3CMA I;  2WAQ A;  3HRU A;  2LYC A;  2EZI A;  2ZME C;  1W4M A;  4GYG A;  4XLE A;  2HYG D;  4XOT A;  2AQE A;  4AIJ A;  2HPM A;  3Q0V A;  4PFO A;  1AKH A;  2JWT A;  2QKM B;  4G7O F;  2V6C A;  3WTY C;  3TED A;  2X6O A;  2Y9Y A;  2OD5 A;  2L9V A;  2M4K A;  3FXJ A;  2ZJ2 A;  3H0G J;  4A3G J;  4LIU A;  3NEU A;  3OIP A;  4UVB A;  1OFC X;  2WY8 Q;  1FSH A;  3I71 A;  3LSH A;  5HS9 A;  1KQ9 A;  3ZMU A;  1A6Q A;  2W4S A;  3DCF A;  1E3O C;  3EPZ A;  1OMI A;  4BQA A;  2EFW A;  1VI0 A;  2J5O A;  1G4D A;  2DJN A;  2IA2 A;  3FM5 A;  3ZN0 A;  2X1E A;  1ZLK A;  3GX4 X;  1FT9 A;  2WBM A;  3LSP A;  4IQJ A;  2Z99 A;  3MEX A;  1MZB A;  4CH7 A;  3S1R J;  1Y1V J;  1O4X A;  2MH9 A;  1MBH A;  3KZY A;  4NDL A;  5TRD A;  2WV1 A;  4C2T A;  5ILV A;  4MFE A;  2R7U A;  3TO6 A;  1ETX A;  4A3I J;  1W36 C;  3GFM A;  4UB8 C;  2CWE A;  5F64 A;  2QQA A;  5IY5 H;  2XDV A;  2X51 A;  1OCO H;  3ABL H;  4R8H A;  4BJ5 C;  1MBE A;  5GTI C;  3J7Y J;  1LFP A;  4QIW N;  3OY9 A;  1Z0X A;  3MFK A;  3HSE A;  4IF4 A;  2YS9 A;  1XGS A;  4F92 B;  5CPR B;  3V7R A;  3TO7 A;  2P0W A;  1JKR C;  3WTU C;  3PIP F;  3OS0 A;  4ZYG A;  2XPW A;  3I58 A;  1XGO A;  3S2H J;  5L3F A;  2NVX J;  4XID A;  4KIT B;  3IL2 A;  5GAG J;  4CZZ A;  1V54 H;  1Z3X A;  3BWG A;  1VQN I;  4R79 A;  2PMU A;  5HNH A;  5D5U B;  2VE8 A;  1D1C A;  5L3E A;  2H6C A;  4KIG A;  2Z2S B;  1A31 A;  2KRH A;  3L1P A;  1DPR A;  3CUQ A;  3DEW A;  1HF0 A;  2CQX A;  1V55 H;  4TV7 A;  4OIN F;  4BQN A;  3D5L A;  4HPQ A;  5LLQ A;  1NTC A;  2VKE A;  3AL0 B;  2JTV A;  2E1C A;  1OQY A;  2A68 F;  3ZP5 A;  4YG2 F;  3D0S A;  1IAW A;  4D5F A;  4RLQ A;  3GZN B;  2LTP A;  5HOO A;  1FTZ A;  2BW3 B;  3HKZ A;  3P9C A;  1EH7 A;  2R7T A;  1RR8 C;  1HST A;  1BBY A;  3PQK A;  3F23 A;  1V3F A;  1IRZ A;  1LJ9 A;  5K7H A;  4GDF A;  1RIO H;  4JX6 A;  4CSW A;  4E7K A;  5E79 C;  1VTN C;  2H1L A;  1HBX G;  3A4C A;  4DYQ A;  4F55 A;  2UXN A;  1SC7 A;  2VC1 A;  1YE9 A;  1W7P B;  2V9V A;  2E1O A;  4EJT A;  1X1A A;  3H9J A;  3RCO A;  1Z05 A;  3G1O A;  3FF5 A;  1NG7 A;  3ECO A;  3L00 A;  1FIP A;  1G6N A;  5J8C A;  1RRJ A;  1BC8 C;  4A69 C;  2EIK H;  1D3Y A;  2CW8 A;  3K2A A;  1ETY A;  4G7H F;  2X1C A;  1WH5 A;  3BG3 A;  4B4C A;  4F7Z A;  1LKX A;  2IGK A;  4EM1 A;  2IS6 A;  1JUP A;  1Y0N A;  2W7N A;  5E17 F;  3SYT A;  1XSD A;  5DTD A;  2E1N A;  1WQ2 A;  2L9N A;  3C7J A;  3PUB A;  4BBS J;  1A36 A;  3R0A A;  5IYD J;  5FKN A;  5L3G A;  3DPL C;  2F4I A;  4E4H A;  1IN5 A;  3BCA A;  4QSH A;  5LBQ A;  5B1B H;  4XRS A;  1FYK A;  4HAM A;  3GTJ J;  4AIK A;  2HKO A;  1B8I A;  3W2V A;  5DCM A;  1O3T A;  2IS2 A;  4XRS G;  2M4G A;  3TO9 A;  3BJ6 A;  4B3X A;  4LB6 B;  1MDM B;  2Z3Y A;  4B1R A;  4I0B A;  4J01 A;  1WJD A;  4UUV A;  4HF0 A;  2P5L C;  2DJI A;  3BQZ A;  3PM1 A;  3P7N A;  4MQV A;  3IKV A;  3J81 K;  1HXD A;  2RGV A;  3GXO A;  1YRN B;  3PL8 A;  1XN7 A;  1WI9 A;  3WTX C;  3JAM K;  3SXY A;  3L2Q A;  3RIR A;  4A3C J;  1K6Y A;  4HYE A;  3AG3 H;  1WFX A;  2LY9 A;  1QQI A;  2FOW A;  2WC2 A;  5LRR A;  1X2N A;  3RKQ A;  4LFU A;  3I4N J;  1B9N A;  4KIC A;  4P96 A;  4C3H J;  4L5J A;  5FKM A;  4L9T A;  3TOA A;  2B63 J;  2VJ5 A;  2VKH A;  2NYX A;  3DPT A;  3BTC A;  2ZSH B;  3KFW X;  3BR6 A;  3HOZ J;  4PUS A;  1BN5 A;  2XRO A;  2OJE D;  3G71 I;  2W24 A;  3F8N A;  3E6M A;  2VXD A;  1ZR4 A;  1MMG A;  4BE1 A;  1X1D A;  5LFA A;  2OU2 A;  4N0B A;  4BQO A;  5F1R A;  4HNU A;  4E7H A;  3BG9 A;  4XSX F;  5GAD J;  2D1V A;  2BYV E;  3WG9 A;  1X58 A;  3SZT A;  4EJU A;  2LBF A;  5IOZ A;  3IRR A;  2KLO A;  1U5T C;  2EB7 A;  3CC4 I;  3RZO J;  2ID6 A;  2R7D A;  3LSG A;  4FT8 A;  1SD6 A;  3VYS B;  3JRI A;  4F91 B;  3HDD A;  3CO7 C;  2A69 F;  1V4R A;  3S2D J;  3PFY A;  5TGT A;  4HSR A;  2AXT C;  4G6D A;  4RM2 A;  3S16 J;  2XRN A;  2KIM A;  3U2R A;  3QOD A;  2YR2 A;  2G0E A;  4U88 A;  1RPW A;  2JA2 A;  1YIJ I;  4A3K J;  1RR7 A;  3JAM Z;  5BQT A;  3A2K A;  1T0F C;  4FAS D;  2H8R A;  5FD6 A;  4ANJ A;  2ZJR F;  1Z3Y A;  1IGN A;  1NK2 P;  2D2W A;  4OAY A;  3RKX A;  4KIS A;  2HQ5 A;  1ZRE A;  1SVL A;  2ZNZ A;  2AHQ A;  4BJT A;  3A02 A;  1ORK A;  4WX9 A;  1TP4 A;  2L3D A;  2XSJ C;  3OYC A;  2EA2 A;  4NQW B;  1MKM A;  2JUC A;  4JOM A;  4WCG A;  4PSW A;  3DF8 A;  3CP8 A;  1IXS B;  4ZZL A;  3BZC A;  2HI3 A;  2HZT A;  2ZNY A;  1R5I D;  2D5V A;  1W36 D;  4LOC A;  1XB4 A;  4MEY F;  2PX9 A;  1FYM A;  2VC0 A;  4AIH A;  5TIS C;  3ERE D;  3R6S A;  4ZC3 A;  4BEH B;  2BOL A;  2VT2 A;  2L54 A;  3VSK A;  3CMM A;  1ZK8 A;  1WI3 A;  3M8E A;  2JQ7 A;  4U7D A;  3KCC A;  3WGG A;  3NWT A;  1FOX A;  3K0L A;  5EG0 A;  2HOS A;  2BZT A;  2M0M A;  1SAX A;  3W3C A;  5HS8 A;  1UJ8 A;  1FIA A;  3AG1 H;  1IZ1 A;  5L3C A;  5GTH C;  1I39 A;  1XCB A;  3LQR A;  4XR6 A;  1IRG A;  4S04 A;  1YS7 A;  3RJP A;  3F8M A;  1K6O A;  2E7W A;  4EM2 A;  5KAF C;  3KET A;  1VQ7 I;  1V5E A;  2Y0M A;  3N97 A;  2JUG A;  2VJI A;  1VF9 A;  1D1A A;  3ZQ7 A;  4IZZ A;  1KYZ A;  4IO9 F;  3I54 A;  4WK8 F;  1LE8 A;  1SMY F;  2ZB9 A;  3E6D A;  1HQC A;  2CV0 A;  4I98 B;  3LST A;  4PJN A;  3A03 A;  2ZXJ A;  5FO5 A;  3ZQQ A;  5H2F C;  1F5T A;  3ONQ A;  2EJR A;  5M5X J;  2EQR A;  2QQ9 A;  1FBQ A;  2DMP A;  4A3D J;  2L0K A;  5HVQ C;  2GM4 A;  2YPR A;  2ZC2 A;  5FKO A;  2QZ8 A;  2COM A;  3H92 A;  3J80 K;  3LNQ A;  2DDB A;  4Y4R A;  4KFC A;  3QU6 A;  2GXA A;  1IRX A;  3BC8 A;  4JP0 A;  4RB1 A;  3GLX A;  3IH2 A;  2VIX A;  3IH3 A;  2JN6 A;  5CVU A;  3J7A Y;  2XV4 S;  1T08 B;  1WJB A;  2CW7 A;  1D1B A;  2K85 A;  2E2I J;  3S1N J;  1MMS A;  4YEL A;  2ZXW H;  3VYU B;  2XF6 A;  4M3E A;  2DN0 A;  1P7I A;  2RQQ A;  4XKW A;  1IN4 A;  1OCT C;  2W25 A;  3OYM A;  2HVR A;  3N4M A;  3REO A;  3WU0 A;  4E70 A;  1MND A;  2E1M C;  2PMZ A;  2KIS A;  1WSU A;  2M30 A;  4UV8 A;  3V8J A;  1AKH B;  5JR3 A;  3KZI C;  4M6Y A;  4KDP A;  4G8X A;  3T5X A;  2M8G X;  2BXZ A;  5IYC J;  2TDX A;  3CDI A;  3M1C A;  3UR3 C;  2P4W A;  3HRT A;  4U0V A;  4YFX F;  1T95 A;  5K1Y A;  2K9N A;  3ABT A;  1K78 A;  3WOD F;  2FSW A;  3JRG A;  4OAZ A;  4CHU A;  3QWL A;  1VQL I;  2RAE A;  2KP6 A;  4HG2 A;  3MN2 A;  3HUG A;  4HF1 A;  1JTX A;  2JSC A;  2M3A A;  1MBJ A;  2KMU A;  1OPC A;  3KIO A;  2VT3 A;  2V7F A;  5KHD A;  1C0W A;  1X4O A;  1DU6 A;  3DU5 A;  1K4S A;  2Y2Z A;  4ZDP A;  1OKR A;  4AD9 A;  2BY0 A;  1OYY A;  3HOU J;  2RNG A;  5EEA A;  1O3S A;  3GZ6 A;  4XSZ F;  1G3W A;  3RKY A;  1IN7 A;  2M2E A;  1WZ2 A;  4J19 A;  2IA0 A;  5J6X A;  4IXA A;  1FOY A;  3OYB A;  4E7L A;  2DMN A;  1O3R A;  1WJ5 A;  2GXG A;  1W0U A;  1L0O C;  2OA4 A;  3OIQ A;  2QEX I;  4LMY A;  3GZ5 A;  2F5F A;  2HU9 A;  2QBY A;  1GXP A;  5IP7 J;  2KIF A;  1LVA A;  4XL9 A;  1BA5 A;  2GWR A;  3CJN A;  5EGO A;  2XUB A;  1I27 A;  4ZYA A;  3HL2 A;  3E0J B;  1IV6 A;  2GBY A;  4CCL A;  4LD5 A;  3FK6 A;  3LSR A;  3EYI A;  5HDK A;  4UXN A;  4DOZ A;  2JSP A;  4DYR A;  5ED4 A;  4BDZ A;  3CJQ B;  2FBI A;  1XS9 A;  3PQJ A;  2XRL A;  3SFZ A;  4D0P A;  4HV6 A;  2VAS A;  2A6E F;  1BIA A;  1IUF A;  3UKG A;  4MHG A;  2PLY A;  1QZZ A;  2DA4 A;  5HLI A;  3CJR B;  3GEZ A;  1KA8 A;  5FRN A;  4N9H A;  2K86 A;  1WKM A;  1UEL B;  1BW6 A;  2CW0 F;  3GFJ A;  1D5Y A;  4IRH A;  3C18 A;  4CGZ A;  1FBU A;  3ZPL A;  4L0Y B;  2IBD A;  3LSK A;  4M3B A;  4LLL A;  2JPC A;  5LGU A;  3IUO A;  1WPK A;  1XD7 A;  4NC6 A;  4CUG A;  3OSF A;  2NS7 A;  3FIS A;  5EYR A;  1U9N A;  1R36 A;  5H6Q A;  3CF5 F;  3L2R A;  1H9G A;  3IP4 B;  1I6X A;  1VQ8 I;  2KFD A;  1S3J A;  3QAH A;  4DGW B;  1QA6 A;  3MWM A;  3AG2 H;  1UHS A;  1Z67 A;  2K4J A;  2X4H A;  1LDJ A;  4FX0 A;  1N25 A;  3VEP A;  3U21 A;  1UG2 A;  2P8T A;  5KVR A;  3ZCO A;  4PJM A;  2UXX A;  4WWC A;  1TW3 A;  2FU4 A;  3GTL J;  1JUM A;  2O03 A;  2MD0 A;  3MKZ A;  4KIF A;  1X4P A;  3CO6 C;  1X1C A;  1SVM A;  2E5N A;  1Q1V A;  3HYI A;  3IHU A;  3KYL A;  1OYW A;  2DOA A;  2HQN A;  4A3E J;  2IT0 A;  2ELJ A;  2QGU A;  2LD5 A;  3QOP A;  3I0T A;  2B7E A;  2CS3 A;  4C2U A;  3LAP A;  5DD8 A;  3HRM A;  4U87 A;  2W84 A;  3FKJ A;  3KLO A;  3WU1 B;  1S7O A;  2I10 A;  4GRI A;  1QGP A;  1WRJ A;  2QVO A;  3GTM J;  4LIT A;  4RA2 A;  3FXM A;  2VUM J;  3HM5 A;  3CMY A;  1YTY A;  3HTS B;  1A04 A;  1YOV B;  5CVV A;  1MJA A;  2M7A A;  1D0Z A;  3PNT A;  1ZGJ A;  2XAG A;  2DBB A;  3RSN A;  4RB2 C;  1PUE E;  2RRE A;  2JT1 A;  2HYF A;  5JFR A;  1JT6 A;  2E36 A;  3H1C A;  2L5Q A;  2XSD C;  3OYK A;  2XKO A;  3S32 A;  4DBR A;  1FOW A;  4MGR A;  1WWX A;  1TT5 B;  1B8I B;  1XSX A;  2K40 A;  4NB5 A;  2CYY A;  2BY3 A;  3K4J A;  1W5S A;  4FET A;  1EV7 A;  4M6X A;  3X2Q H;  2EZK A;  5ICG A;  5JHF A;  3IKT A;  3ZQI A;  4ZTJ A;  3HC7 A;  3ZOB A;  2KHM A;  2H27 A;  5CYV A;  3I59 B;  2V9K A;  5D4R A;  4AVP A;  2NVQ J;  2W57 A;  2K27 A;  5DD4 A;  4S05 A;  1Y39 A;  2EH3 A;  1U9O A;  3K70 C;  4XON A;  4HST A;  1YQA A;  2FD5 A;  2V26 A;  1H8A C;  4LK1 F;  1KU9 A;  3S15 J;  1SD5 A;  3OL4 A;  4AWX B;  3DP7 A;  3M1E A;  2B9S A;  3S93 A;  4A0Z A;  2O5R A;  4M3D A;  3HZJ A;  1DUX C;  3BY6 A;  1PUF B;  3IV5 A;  1Z1D A;  3B6C A;  2OQG A;  1IV8 A;  3GFL A;  1FNN A;  2LOO A;  1HKT A;  3E3V A;  1RUN A;  5M3F J;  5KK1 A;  3S8P A;  3JCU C;  3K7A J;  4GCV A;  4B8X A;  1U78 A;  3AFH A;  2R7W A;  2LBF B;  3BOQ A;  1EH8 A;  1MD0 A;  1MMN A;  4BBR J;  3A0B C;  2QUF A;  1YG2 A;  1IUY A;  3T8T A;  2XKP A;  3K1P A;  1JKO C;  3MKY B;  3G6E I;  2PJR A;  5B66 C;  1UST A;  4IQ4 A;  4XLN F;  2VKV A;  2IXS A;  2XGE A;  4M3F A;  2X6X A;  3E5U A;  4GFB A;  5GPC A;  3K9T A;  1P92 A;  4PGG A;  3P5J A;  2R5Y A;  3KP6 A;  1ZRD A;  3JSP A;  5E1W A;  3K4B A;  2FBK A;  3FDY A;  4II2 A;  4PDK A;  1ZYR F;  9ANT A;  2Q1Z B;  2QSH X;  1PP7 U;  1K61 A;  1USS A;  2KIU A;  1KON A;  3ASN H;  1T39 A;  4M9Z A;  2L02 A;  2LSO A;  5F04 A;  2WWY A;  4N4O B;  4LG0 A;  3R61 A;  2JK3 A;  1ETV A;  3DKW A;  1NHA A;  3BTJ A;  4LGW A;  5D6E A;  1IW7 F;  1J09 A;  4O3M A;  5HLH A;  1DPU A;  4F3Q A;  1DP7 P;  3AL0 C;  4XLF A;  1JT0 A;  2FXA A;  4ESF A;  5EG0 B;  3S14 J;  3EUK L;  2K9M A;  1H89 C;  1TNS A;  3ABU A;  1Y6I A;  2DA5 A;  4QTR A;  4XM3 A;  5EZH A;  3OS2 A;  3HXL A;  4YFN F;  2ECB A;  3BR1 A;  1AA7 A;  1E2X A;  1XPX A;  1D0Y A;  1KYW A;  1GVD A;  1ONV A;  1SFU A;  5FD5 A;  2BVM A;  2GXB A;  4EGZ A;  4AUX A;  3LSI A;  2Z5U A;  2HDD A;  5GAE J;  2E34 A;  5DEQ A;  3KP5 A;  1ZR2 A;  1LE8 B;  5LGT A;  3ZMS A;  3FXQ A;  2O61 A;  4Z6Y A;  3D5S C;  1J59 A;  1QPM A;  5IT3 A;  2A07 F;  2P5V A;  1RUO A;  5E1Z B;  3DLA A;  2XPU A;  2NVU B;  1MW7 A;  3R4K A;  3GFI A;  1E17 A;  1A6I A;  4PJL A;  4UB6 C;  1ZG1 A;  2BY1 A;  3Q0U A;  5DCF A;  1MBK A;  3AAF A;  3ASO H;  3D1N I;  2ZXH A;  4A6D A;  3W2W A;  2K02 A;  2QF7 A;  3ABK H;  1F36 A;  4AYB N;  2R4G A;  5CJ9 A;  2HYJ A;  4XBF A;  2ECC A;  1ON2 A;  1OR7 A;  3JRE A;  2L2O A;  2OPT A;  4XK4 A;  1BW5 A;  4RS8 A;  5ICF A;  2P7C B;  2HS5 A;  3TW7 A;  4ZYE A;  1XDU A;  2CUF A;  2ID3 A;  1SVO A;  3WTZ A;  2DK5 A;  4P1W A;  3BG5 A;  2QWW A;  2WTE A;  1BJZ A;  1KU3 A;  1SFE A;  1S7E A;  4N4N B;  2JA7 J;  1Z7U A;  1LB2 A;  2VJJ A;  1JGS A;  3FXK A;  2Y0S N;  2NAZ A;  3TDZ C;  1X1B A;  2QYO A;  3WE3 A;  1YX5 A;  2P81 A;  4D7N A;  4I99 C;  1MSF C;  1TWH J;  5C4X J;  2GOM A;  3HSF A;  1L3L A;  3S3N A;  2FMY A;  4NBQ A;  2RV8 A;  4HLY A;  4DQ2 A;  5KCM A;  3F8F A;  4B47 A;  3SHF A;  2DT5 A;  1BR1 A;  2FNP A;  3K2Z A;  2RN7 A;  1YJ9 I;  2H94 A;  3SDB A;  3HUG B;  3JRH A;  1KZH A;  3SEQ A;  3HOX J;  3O3K A;  4EM0 B;  4I02 A;  1R4N B;  1U2W A;  3G3Z A;  4X6A J;  5F0H A;  4KT5 C;  1FLI A;  4OIP F;  5CQG A;  3IC7 A;  4QPQ A;  5J1U A;  2VXZ A;  3BCB A;  3DBH B;  3ECH A;  3H9G A;  2OBP A;  4A0X A;  2PJP A;  3G73 A;  3V42 A;  1Z77 A;  5JLX A;  2P6S A;  1ODD A;  1S6L A;  3CCY A;  4UUS A;  3HB9 A;  3K70 D;  2UUZ A;  2HPI A;  3GME A;  3GTP J;  5E8I A;  2QBY B;  2WB1 A;  1GV5 A;  2EFO A;  3OYJ A;  2IGN A;  3O8G A;  2F4O B;  5EGO B;  1EJ9 A;  2HDC A;  4NHJ A;  4DNC A;  1R22 A;  1VQO I;  4F52 A;  4HQE A;  1SFO J;  3E5Q A;  3GTQ J;  3CC2 I; 
#chains in the Genus database with same CATH homology
 2EIN H;  2DYS H;  3ABK H;  3ABM H;  5B1A H;  2EIL H;  3X2Q H;  3AG2 H;  1OCZ H;  1OCC H;  1V54 H;  3WG7 H;  2EIK H;  2DYR H;  5B1B H;  3AG3 H;  2OCC H;  5IY5 H;  3ASN H;  1OCO H;  3ABL H;  3AG4 H;  5B3S H;  2EIJ H;  1V55 H;  2EIM H;  2Y69 H;  3ASO H;  2ZXW H;  3AG1 H;  1OCR H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...