3ABLH

Bovine heart cytochrome c oxidase at the fully oxidized state (15-s x-ray exposure dataset)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
b'YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ablH00
3AG4H 2EIMH 2Y69H 2ZXWH 5IY5H 3WG7H 3AG3H 1OCOH 2EILH 2OCCH 3ASNH 2EINH 3AG1H 3AG2H 3ABMH 2EIKH 3X2QH 3ASOH 1OCZH 1V55H 2EIJH 1V54H 1OCCH 1OCRH 2DYSH 3ABKH 3ABLH 5B1AH 5B3SH 5B1BH 2DYRH
chains in the Genus database with same CATH superfamily
3HTSB 4MFEA 4ZYAA 3T1BA 3KLNA 3TDZC 4M3DA 4B43A 4A93J 3QQAA 5JHFA 3HEFA 2XAGA 3FXQA 4AIDA 3H9GA 5E3NA 3DQVC 3HGGA 5HS9A 5TJJA 2R5YA 2MD0A 1FBUA 1ZRFA 3KZIC 2NNYA 2K9LA 3AG2H 2EZIA 3Q3SA 3RKYA 5DV5A 4CYDA 1VQPI 2O6GE 2R93J 2P6TA 3JTHA 5B5EC 2QENA 4BBSJ 5IYCJ 2HOSA 3FXRA 2DT7B 2VPRA 3LSTA 3L2QA 1V54H 1MGTA 1ZN2A 4P96A 2CFOA 2GA1A 3RI4A 4RDUA 3GTQJ 1QRYA 2E35A 3COAC 1HDDC 4LK0F 1KA8A 3HOZJ 2CUFA 3CDIA 3ESWB 2M7AA 1C0WA 1Z3YA 3K2ZA 4MIMA 3AG1H 2DBBA 3E5XA 1YLFA 3OS1A 5E1WA 2RKHA 2QUFA 3ZP5A 2EJRA 4M73A 4PJ0C 1P6RA 1KQ0A 4XRSA 1BJZA 1PUEE 2VXZA 2XAHA 3ULQB 1BN5A 4HLYA 2DDAA 3BR5A 3ABKH 1KQ9A 1LFPA 3TMOA 2E1MC 2CUJA 5HDGA 2FBHA 3MZ8A 1IV8A 3I0TA 3ISPA 1BM9A 3B6AA 3K1PA 2DA5A 1R5GA 1BOAA 2R4GA 2KT0A 3E5UA 1Z6TA 2M3AA 2OQRA 3VWBA 4CUGA 1BI3A 3A4CA 3ECOA 3TW7A 3QPHA 2RGVA 3HM5A 2ESHA 1ZR4A 2L54A 2ZNYA 1LPQA 1H89C 2KRHA 4XSXF 1MMAA 2JA5J 2CH0A 2BY0A 1T08B 2W48A 1Q1HA 3ZQLA 2IJLA 3K4CA 1SD4A 2Y0MA 1N78A 3ZXSA 2X6WA 1CQTA 2Z16A 2ECCA 1UCRA 4A3JJ 1VQ4I 5LLQA 4XKBA 2OV7A 5DCMB 5H6QA 1DQUA 4W1UA 3C3WA 3GF2A 3I64A 5DM7F 3QODA 4L5EA 2LOOA 1OR7A 4JYKA 3WHCA 4L0YB 3L1PA 2CGPA 2GXGA 3F8BA 4LJZF 3BJ6A 2GOMA 3HRSA 1TC3C 1FOYA 4C9YA 1U2WA 1IN5A 2EZLA 4I7HA 5LD2C 1OCRH 3ABLH 3MKWB 4P55A 2IRFG 2HI3A 4NC7A 3JSOA 2I5UA 4YEJA 4B48A 3M9AA 3HOTA 1H8AC 3E6BA 3DU5A 5EG0A 2ETHA 1W1WE 1UHMA 1LDDA 3G71I 3H3ZA 1O7FA 3HOYJ 4KUMA 2VQHA 4HG2A 4BS9A 5KAIC 4L9JA 2MGQA 1WZ2A 1TQMA 2IA1A 2K7LA 4HBLA 1TW2A 1BC7C 4C2TA 5DM6F 4E4HA 3RYPA 2HEOA 3ZR8X 4U0VA 1WH5A 3FIWA 4CCJA 3P9IA 4PFOA 4A3DJ 2FXAA 1T0FC 2IGMA 1K6YA 5BMZA 2O8XA 2R7WA 1OJLA 5ICGA 2CQNA 4RB2C 2WY8Q 2XF5A 5LHIA 2DA2A 5GTHC 1OQYA 4I0BA 4U0WA 1FT9A 1O3QA 1X2NA 1GVDA 3ASOH 1IRFA 3J81K 3EUHC 4ASNA 5D5WB 2BE5F 2MH2A 4CCNA 4C3JJ 1WPKA 3S3OA 1WJFA 4FT8A 1HKSA 1R49A 1IG7A 2Z99A 5ICEA 1Y0UA 2A6HF 3AG4H 1W7PA 4E6KG 1T8IA 5J8CA 1AKHB 1MBJA 2DFFA 3MEXA 5HS8A 2EV0A 2ZXJA 4A3GJ 4XNFA 2PJPA 4RA2A 2KDOA 2V79A 4DIQA 1KU7A 1KONA 4Y13A 1TL8A 5JVGF 1Y6IA 2XAFA 3W6VA 1Z1DA 1XN7A 4N0BA 3H0GJ 2CWEA 5BQTA 1K6OA 3I4NJ 2FNPA 1A6QA 2Y30A 3VYSB 2ID6A 2EPFA 3F8MA 4BJ6C 4WF2A 2JA8J 4B3XA 3S17J 3F8FA 3OL4A 2CQ7A 1J59A 5AIQA 2MSYA 3K1NA 4XLAA 1IN8A 1D0XA 4WXHA 3VB2A 3C2BA 2WAEA 1TWAJ 3ASNH 3JRBA 5E79C 3HKZA 3RZOJ 1XSXA 1ZARA 3FK6A 4N4NB 3VOEA 3D1NI 2QQ8A 1LE8B 3BT9A 1VF9A 1VFCA 4Q5SF 1X1PA 2VQGA 3BG5A 2F6CA 3V8KA 4BXUA 4M74A 5B1BH 3HRMA 1IJWC 2PG4A 3OYKA 2EFQA 3OS2A 1SFUA 2V6EA 2WBMA 1Z77A 3L09A 2CFXA 4Y52J 4IHXA 2DMUA 4BUPA 2K3PA 4IX7A 5JI6A 4YG2F 5IP6A 5K5QA 3KP4A 2X0LA 2L7FP 2L5QA 2AQEA 3H92A 2NVUB 1SFOJ 4BQAA 1FX7A 3FHZA 4MHGA 1ETYA 4XRSG 5LGNA 3GWZA 1XSVA 2O3FA 3GW2A 4AVPA 2K40A 3EUKL 3M8JA 1V5GA 2EFOA 1D1BA 2KHMA 3N97A 1WWXA 2OU2A 2EWNA 1G3YA 4XLPF 3HJEA 4E7IA 3K4BA 4QSHA 1PDNC 2E2IJ 2H94A 3E7LA 3HPHA 2QQ9A 2WV0A 5DTDA 1JTXA 3DWLE 4Q4ZF 1FOXA 4JX6A 3WTUC 1QGPA 4B3AA 3H5RA 2HTJA 3F6OA 3NAUA 1R6RA 1UG2A 5HOOA 3ONQA 2VXDA 2L02A 5FD6A 1S7OA 1SAUA 3F9KA 3HXLA 3ZQQA 3ML6A 3SYTA 3ERED 1QZZA 3LSJA 1UB9A 5L3BA 1DDNA 3GO5A 1B1BA 2D1VA 4GYGA 3S2DJ 2R7FA 3RYRA 3FKIJ 1MD0A 2STTA 1BI0A 1WFXA 2HU9A 2JUGA 3CESA 2KISA 3CCVI 1MW7A 4OU0A 5B1AH 2GWRA 4FE7A 2HKXA 1ZELA 1WJBA 5KAFC 2YU3A 4NC6A 1F5TA 2YX7A 3GTOJ 5EZHA 2F5FA 2CUZA 3OMYA 4BBRJ 3TEDA 2G7UA 4CH7A 3OYNA 1WHUA 3K70D 1G3TA 3VPRA 4EJUA 4FETA 1I50J 2VKHA 5EYRA 4ENNA 3JRFA 3GTGJ 4LIVA 4BKXA 4M72A 2JTVA 2DMNA 3OYDA 5IYDJ 1FMVA 2AQFA 4AWXB 3JRGA 1OCZH 2COMA 2STWA 4E7SA 1ACIA 3LA2A 2D2WA 5CVVA 2F5EA 3MKYB 4ENJA 2A68F 2NVTJ 1A36A 3FMQA 3HC7A 3WG9A 2HFHA 4DGWB 1W0UA 4NC8A 3SDGA 1QA6A 3TO6A 4OMYA 1BW6A 2COBA 1QQIA 1WVRA 4M6YA 4BAYA 1SFKA 1FLIA 3ZMSA 4BDZA 3CD6I 1W5TA 2M5WA 2QCOA 4CGZA 5LRRA 1OKRA 3GFMA 3BC8A 2V9VA 3L9FA 4C2UA 2V1XA 3L00A 2I10A 3DEWA 2E71A 2P5LC 1ZG1A 2DT5A 2EV6A 2MABA 3M3YJ 1X3ZB 2FMLA 1R7JA 3RZDJ 5GP9A 5M5XJ 4Y15A 5FKKA 5F6FA 3LA7A 4GFBA 4KA4A 4EV0A 3PIOF 1S8NA 1J5YA 5ILSA 4I6ZA 4PJMA 3Q5FA 2W4SA 1YITI 4FTHA 2P0WA 3GCMA 2L7KA 3JRCA 1BR1A 3H3UA 4E7LA 2VBYA 2HZTA 1Y39A 1MMSA 1ZYRF 4BDYA 2ACJA 1DU0A 5HLIA 2R7RA 2KKOA 2P81A 2HS5A 2Z33A 3P9KA 2CU7A 4HX4A 4YFKF 3BR1A 1EH7A 3K4LA 3ZQIA 3F6VA 3F8CA 1FYMA 4PFPA 1X1AA 3FXJA 2BEOA 3RQIA 1U0JA 1B8IA 3U1DA 2NRAC 1W0TA 2XGXA 2M0CA 3WTYC 2M34A 3DEEA 1D3YA 2BXZA 1BR2A 1ZK8A 1HCRA 4ZYEA 3QOEA 3L2RA 2XV4S 2V7FA 2M87A 4C3HJ 1G6NA 1KYWA 3FKJA 2LD5A 2DMPA 4A2UA 2J5PA 2WADA 5HDNA 4ZTJA 2YR2A 4HPQA 2OBPA 3C2HA 1F4KA 2MC3A 1GXPA 3DV8A 3BG7A 5FJ8J 3J80Z 4EM1A 2L7MP 3DBHB 1BJAA 2A61A 3DEUA 4KICA 1KGSA 2W7NA 4TV7A 3CF5F 1WI3A 4KT5C 2LNBA 2HDCA 2JRTA 3PSIA 2GQQA 3CCUI 4JK1X 2XSJC 3AG3H 3I59A 2VT3A 3JRIA 1BIAA 2HDDA 5ICCA 3RPUA 4WXDA 4NDLA 2HVSA 1V5EA 1UG0A 4UB6C 1DP7P 1IV6A 1YYVA 3V42A 3GUDA 2DA6A 2XAJA 1FY7A 3IP4B 4F7ZA 1ZRCA 4HSRA 2HPIA 1GXQA 4HV5A 3NEUA 2CV1A 1XCBA 1LKXA 4IEJA 1T38A 3V7RA 3QAHA 3TW6A 2LG4A 1AU7A 1G4DA 1JI8A 4G6QA 4QWQA 4XLFA 5FD5A 1FIPA 4OIRF 4Y4RA 2CO5A 1NTCA 5HLGA 2ZSHB 2XHKA 3M4OJ 2RNJA 1YG2A 5LFAA 3PQJA 2YS9A 2HOAA 3WTXC 4IHVA 3W3CA 1FWZA 1YQAA 2H09A 4IF4A 3OYIA 2DO7A 2EQRA 1EH8A 2IBDA 4PJJA 4PUSA 3MCZA 2DA1A 2E34A 2YPRA 4XMYA 4ZYHA 2JT1A 2A07F 3KP3A 5CLSA 4EMSA 2IXSA 1I6HJ 3HZJA 4J19A 3RPUD 4JBAA 1Z21A 2VJIA 5EEAA 3DFGA 2R7VA 1DU6A 1HW5A 3R0AA 2M30A 2Y9ZA 1YIJI 1P4XA 1PVEA 4RAFA 2MC4A 3S1MJ 3L7WA 1SEUA 2BHZA 2A05A 3Q9SA 5D4RA 2DLLA 1OYYA 2PQ8A 3WU1B 3L2VA 1FYLA 4AIHA 1S5LC 4IRHA 3V4GA 3PNTA 4BE1A 4I2OA 4A5NA 1K61A 1E3HA 1DPRA 2RVCA 3QP5A 3OWTA 3BOQA 4S05A 3GFLA 5D8LB 2IGKA 4D9JA 1VQKI 3F0CA 4RGRA 2NNNA 4NB5A 5BNGA 3B02A 3M1CA 2DMTA 3JRDA 3KP7A 4HYEA 3GTMJ 1V3FA 2VQLA 5C4JJ 1RRJA 2M0MA 2D5VA 4XM3A 3FF5A 4OIPF 3TO9A 4BEHB 3K0LA 4H0EA 1QZEA 1QPIA 2WAQN 4BY1J 2ZC2A 2LY2A 1WJDA 4G7HF 1KQ8A 4D1QA 1LVAA 4KFCA 2W25A 4BL0B 5LEJA 3F23A 2QSGX 4KN7X 5ICFA 3VSKA 4ZZLA 3V7SA 1OPCA 1MNEA 2DYRH 4HQMA 3GTLJ 1JGGA 4HX8A 4ENKA 3FBNB 2BVLA 2LR8A 4B44A 2V26A 2HQNA 1BIBA 1KU9A 1LDJA 1VQOI 4MGRA 2O61A 1JGSA 1CF7B 3G1OA 2MD5A 4Y33A 4A3LJ 3RQ4A 1EV7A 1UFMA 1XMAA 4MLOA 1T56A 1VQ6I 5C4XJ 2QQAA 1I3QJ 2FUG2 2M45A 3QP6A 3R61A 3GVAA 2WA0A 2DOAA 1KYZA 4HAMA 4BJTA 3M8FA 1TWHJ 2F48A 3HSRA 2JK3A 2QSFX 3QWLA 2X6YA 2GOXB 2IEKA 2OCCH 3MKZA 4LIUA 2HQ5A 1O57A 2XIGA 2JPCA 3MQ0A 3DTKA 3LAJA 1JKRC 1W5SA 3TQNA 5L3GA 3TBIA 3HHHA 1EH6A 2M9HA 2VBWA 1BL0A 4AYBN 3G2BA 4B47A 1LEBA 4JOMA 2L9VA 4IPAA 2BV6A 3CLOA 4XONA 3SXYA 4AUXA 3HG9A 3ZQHA 3BTJA 2MW8A 2MYSA 5CYVA 2RQPA 1BA5A 3CCEI 2EIMH 3QPSA 2UWMA 1YX3A 2E1NA 2F5CA 3ZGKA 2XSDC 4IOCF 4E7JA 2X9DA 1T0FA 4HNTA 3G4SI 2XVCA 5ILVA 1IDYA 3FMRA 5M5YJ 3IKTA 3L2UA 1UHWA 2LF7A 2PX9A 4ZZDA 1E3PA 1AKHA 1HSTA 3IKVA 2IW5A 4M9XA 3K2AA 3Q0UA 4HNVA 2VKEA 2ME6A 1TW3A 4DJAA 4R8HA 4XLEA 4JP0A 1IO2A 3EUHA 3KCCA 1SFEA 1D0ZA 2H1LA 3BJOA 4LG3A 1ERDA 5E18F 3OR2C 1S3JA 1ETQA 1G2HA 3ZRGA 4EM2A 3LFUA 5K7FA 5IP7J 1ZREA 4IRIA 4M9ZA 5LBQA 5F0HA 1JE8A 1SFXA 1ZLKA 3D5SC 4MTEA 1IW7F 4GXOA 3KYCB 2BVMA 3TKYA 3LAPA 4LLLA 2AS5F 2KDZA 2CQQA 3WE2A 3CMMA 3J81Z 2E1MB 2K02A 1NH3A 4UUTA 1LE8A 5IT9Z 3V7CA 2KIUA 3E0JB 2ZMEC 4B8XA 3MVPA 1E0EA 2E60A 1TQIA 2EA4A 3D0SA 2EA2A 3ZMVA 1X4OA 3MKLA 4F55A 5CVUA 4FE4A 5EGOB 2XGEA 1DUXC 1PUFB 4PJLA 4A12A 3UKGA 1S6LA 1BI2A 2KIMA 2NOJB 3FISA 3S93A 2Y9YA 2CW8A 2EIKH 1P4AA 1XD7A 4I02A 3H0DA 3OYLA 4HQEA 2H6CA 2F2EA 1QU3A 1R4MB 2WWYA 1LEAA 2FMYA 2IVMA 3S1NJ 2KPMA 1XMXA 5FFXA 3V8JA 1RZ4A 2LFBA 5DUKA 3S1RJ 3FM5A 2B7EA 2IS2A 5M3MJ 1YRNA 2WB1N 3S1QJ 3HOWJ 1YE9A 3FM3A 2XF6A 1E2XA 1YW7A 2DN0A 3UNGC 4XL9A 1YS6A 4H4KC 4UV8A 3SZTA 1RUOA 3ZOBA 2DYSH 2QA4I 1JTYA 3DPLC 3G1LA 1NK2P 1F36A 4A3MJ 2K86A 1T33A 5HNHA 1T95A 2EH3A 1TQPA 1HXDA 1I6XA 4QPOA 3FDYA 2K9MA 2QQBA 3BPVA 1RI7A 4U0YA 2HR3A 1LQ1A 2XRLA 1LUJB 1XG1A 5JHUA 1H9GA 2FU4A 4A3EJ 2IAIA 2VPLA 3BQYA 1GVJA 3WHBA 2HKOA 4II2A 1ETOA 2NVQJ 1VNDA 4GDFA 1RESA 4YFNF 2JWTA 2KJBA 4IQ4A 2D45A 3M1EA 1Y1VJ 3RKWA 2W82A 3LMMA 3TL4X 1EJ9A 4BQQA 2AXLA 2MFZA 3EYIA 3H1CA 3CP8A 3FMSA 3OYJA 1Y56A 3GZ6A 4S0HB 2PI0A 3D5RC 3ABTA 3BQZA 3HHGA 3A2KA 5A2QZ 1IXCA 2M8GX 3SQNA 2DK8A 2J5OA 3KPHA 3WGGA 4IHTA 2XAUA 4Y17A 2VN2A 2YSRA 4F93B 4YELA 1UJ8A 4CDGA 3OYGA 4C2MJ 5HNFA 4HF0A 1T2KA 5IPAA 1A35A 1V4RA 3WODF 5HS7A 1E17A 1TTYA 2OCEA 3EDPA 3I4PA 4CZCA 1HC8A 2LF8A 2WAQA 3C7JA 1VQNI 4C30A 1S7AA 5E3LA 3U21A 3QOPA 2V1NA 3GXOA 2D1HA 3HBLA 2KJCA 4M6XA 1MH4A 1OCPA 3P9CA 4V2GA 4XBFA 3IL2A 1WJAA 4UUSA 4WK8F 2HTSA 2VJ5A 1USSA 1ZG3A 5D8KB 4G7ZF 4AC0A 1OCTC 2ZO4A 2E2HJ 2VKDA 1YX5A 4DYQA 1E3OC 4UNOA 2BBYA 2FRHA 3O8GA 1I5ZA 2RQQA 2L9SA 2GXBA 4X6AJ 4IHYA 3CCRI 2E7WA 3BR2A 2CW0F 3H5NA 5DS9A 4BY7J 3DXJF 4UB8C 5E8GA 4YRVA 3BG9A 3E6DA 4L5IA 3RPQA 2KIQA 4Q47A 5FKNA 1R1VA 1J7KA 1IXSB 4LGWA 5C3EJ 1ON2A 4CICA 2QVOA 4RB1A 3WTSC 4OWRB 2JVHA 1TP4A 5FLMJ 1SC7A 1U8BA 3PSFA 1IRZA 2VIXA 2W24A 3BJAA 5EJCA 3TOAA 3W6KB 1U5TC 5AIPA 3S32A 1XS9A 4Y7NJ 1YRNB 4HSTA 4L5JA 2Y0SN 1A31A 3G6EI 1TLHB 2A69F 1P9QC 4RS8A 5K1YA 1KZHA 2YX4A 4AIJA 2LREA 4AIKA 4FX0A 2O5RA 4AYBA 3MFKA 5LGUA 1ZG5A 1R4NB 2GM4A 1MSFC 3HB9A 4UVBA 1IRXA 5HODA 2DPDA 1XGMA 2HPMA 3HUGA 3P5JA 3DU6A 2L9NA 2XF7A 1K79A 3RIRA 3GLLA 4CCMA 1MSEC 2O8KA 4F52A 3KZYA 3NRVA 2K3FA 1EF4A 3MAJA 3MN2A 1ITYA 5FO5A 3K4KA 3F3XA 4RM2A 3AL0C 1MBFA 2Z2SB 2DODA 2RC4A 3DP7A 3E6MA 3KFWX 4QLCU 4CO8A 3OOPA 3DKXA 1SD7A 2XGCA 2HOTA 1ETWA 1TT5B 3RKQA 4D5FA 5JVTA 1S9HA 1MJAA 1X4PA 5TRDA 3SEQA 4AM3A 2IS4A 3Q0WA 3CJTB 1EA3A 4CHUA 4HF2A 1FSHA 2A5YB 2OPTA 3GBGA 3G3ZA 5BPIA 2XPWA 2E2JJ 3PJRA 2BY1A 3RSNA 1FIAA 1BI1A 1FMWA 2X6OA 1STZA 3WE3A 5J40A 1EKEA 1ZGJA 2Y69H 2E19A 1MZBA 5BOXA 1FBSA 4RB3C 1GLNA 2W84A 3PIPF 5K7HA 2B0LA 2FBIA 2OA4A 5F1RA 2OD5A 2E36A 4B09A 5LEKA 2DMQA 1DGWY 3L2CA 3FXLA 3ECHA 3VYUB 1P92A 4A0XA 4CA0A 1D8KA 3S3MA 3R6SA 4RLQA 1ZR2A 1WJCA 3LA3A 5D6EA 1ZHFA 1K78B 1FP1D 2K4JA 2PFBA 2QBYB 3HSEA 3A01B 2DDBA 5IY5H 4UUSB 4I01A 3KIOA 1Z3XA 1RUNA 5D5UB 1REPC 2ID3A 2BGCA 4BH9A 2G9WA 2K27A 1IF1A 1WKMA 1O3RA 3NQOA 1XX5A 3K9TA 3TGNA 4P9UA 1JKOC 5JR3A 1IXRC 2DFIA 4DYRA 1R71A 1AOYA 2WB1A 4G9YA 1N25A 3E6CC 1YJNI 5B66C 2UXNA 1RNLA 5HDKA 1B9MA 3KLOA 3BTLA 3I9V2 1D8JA 1K7AA 3MZYA 4O3MA 5FKLA 3JSPA 4RGUA 1WJEA 3HPGA 3PQKA 2QLZA 1YFHA 5E3MA 3M07A 2M1BA 2V4JC 4HNUA 4WXCA 3KYDB 5DEQA 3LQQA 4IJAA 2UV1A 3VEPA 3HOXJ 2B9SA 1ZQ3P 2R7ZJ 4OMZA 4XOPA 2E1OA 2KIFA 2VKVA 1I27A 2ZFWA 4HDUA 1O7LA 3IRQA 4R1HA 2BY2A 3W2WA 5J47A 4W97A 3P7NA 2QWWA 1P2FA 2Z9OA 4P5OA 1Q1VA 3V8LA 2HWVA 1ZGWA 3F22A 2EFPA 2BW3B 4D5CA 3HUGB 3VYRB 2H8RA 2H6BA 1QZYA 1APLC 1RPWA 1TT0A 2P7VB 4XOTA 5DUIA 1LDKB 1G59A 4LFUA 5KVRA 4IQJA 4XK4A 5L3DA 4A5MA 2GBYA 3FWEA 1ETVA 1I39A 3RCOA 5HVQC 4QPQA 2BY3A 4DBQA 2JQ7A 3Q9VA 1RC9A 1L3LA 1HSJA 1JUSA 1T98A 2Z1DA 1JXSA 2N8GA 4KJZA 3SHFA 2E5NA 4G12A 4RLFA 2BZTA 4XN0A 4UXNA 1O3TA 2F4OB 3CJNA 4HA8A 4BEHA 4KYWA 3J7ZI 2QM3A 4XR6A 4EJTA 6PAXA 1G8XA 2K9NA 4XKCA 2R7SA 3IH2A 3HRUA 1B6AA 1WCMJ 2LY1A 2O0YA 5D5VB 1W4MA 1NG7A 4M3FA 1U9NA 4XLNF 4RGXA 3VFZA 1W5CC 4CXFA 1R23A 5GADJ 4ETSA 4V19K 2LSOA 2MLGA 3E97A 4PGGA 3PUFA 4A0YA 4BYYA 4LOCA 1PP7U 3JAMZ 4CCKA 1IDZA 4DZJA 2OTJI 2JZYA 4U88A 1CF7A 2FD5A 3OOUA 5DYMA 3JRHA 2CYYA 2QKMB 1Z7UA 3EUAA 3LSHA 3H3VK 2JA2A 2GZWA 2PLYA 3RJPA 5H2FC 2Z5UA 4P1WA 4J01A 3PUBA 2XKOA 3JRAA 3ZCOA 1FJLA 3LFKA 5IOYA 1OISA 1L0OC 3IAS2 4WCGA 1O4XA 4BXXJ 2EV5A 4OOIA 5DD8A 3Q0VA 4CYCB 1HBXG 1P7JA 2ESNA 4N9IA 2CV2A 4JX5A 4WWCA 1MMDA 1HF0A 1ZLJA 1HW2A 1LVKA 1UAAA 1OMIA 2ZXIA 4IVNA 2F5VA 4ZYDA 1W36D 2FQ3A 1JUMA 1AHDP 2L2OA 2HGCA 1DP3A 3IRRA 5FROA 4IHSA 2X48A 3A0HC 2PJRB 2FEZA 1MJBA 2V9KA 3LNQA 1JT0A 3S14J 2PMUA 2Y0SA 2PMHA 4OIOF 1P4WA 2DT6A 4U7BA 2ISZA 2Y75A 3IHUA 4MO7A 2V6CA 1GV2A 2VLAA 1LFBA 2NOGA 4EJOA 3ZMUA 4LITA 4EGYA 5KCMA 3E5QA 4RB0A 3KETA 4UY8I 4A3IJ 3QRFF 2NXNB 1HQCA 1MNDA 3W2VA 4BHCA 5F64A 1FEXA 2K9SA 3FZVA 2MBFA 4BQOA 3O3KA 4UUVA 1UHSA 4KDPA 5KK1A 1R9TJ 2WC2A 2A3SA 3IC7A 1YO5C 5FFZA 4FISA 2ADUA 4DOZA 5TISC 2XKPA 2JA6J 2DI3A 3ZN0A 2VASA 3IAM2 1Z9CA 1VZ0A 1QVUA 2R3SA 1FTZA 3OY9A 1OCCH 2R5ZB 1X1DA 2VL8A 2DTRA 2LLKA 3SZGA 3OYBA 5D4SA 3BPXA 4ON0A 4E7HA 3CJQB 1D5VA 2HYGD 3GFIA 3ZQCA 2Q2EB 4B1RA 1MKMA 2F5DA 3BR0A 3CCYA 4UVAA 3ZPLA 2R7XA 1I1GA 4FX4A 1IAWA 1U8RA 3DTIA 2F4IA 4DNCA 4LMYA 1X1BA 3J80K 4G94A 2MG4A 5EGOA 3MWMA 3WGHA 5HLHA 2LK2A 4MQ9F 2ELKA 1PUFA 1IUYA 2JMWA 3ZQFA 4S04A 3CUQC 1FTTA 2L3DA 4L0ZB 4D0PA 2H1KA 2R7TA 3GTJJ 2HOEA 1MH3A 5E1ZB 2L0KA 3DLAA 3TDUC 4XRMA 3IUOA 4BGDA 3OYEA 2HQRA 3CC2I 5J1UA 1VQ7I 2YUSA 1VTNC 1HLVA 1SVMA 1X19A 2GIZA 5L3CA 3BTCA 3W2AA 1JUPA 1RR7A 3FXUA 3SEZA 2PMZN 3BWGA 3ELKA 3QPLA 1TWGJ 4YIFA 4I76A 5EF6A 3GZNB 4B4CA 3HKZN 4PZJA 3WU0A 3PL8A 3QYEA 1A04A 2EBIA 1P7IA 2M4GA 1TZLA 3LSGA 3HDDA 1IN4A 2M8EA 3S16J 4XQFA 2JA7J 1QBJA 4EATA 5ERIA 1VQ5I 2LY9A 1GT0C 4IZZA 3UR3C 4PCQA 5TGTA 5CKTA 4I0AA 1BC8C 3QU3A 2RDPA 1Y8QB 3DF8A 1HOMA 1HA8A 5FKOA 3BDDA 2DQRA 4IO9F 2LKSA 3KEOA 3OYAA 3BROA 3CC4I 1Z05A 1YI2I 1ZTRA 4EGZA 1OYWA 1QNTA 2YU9J 1FSEA 1LJ9A 4M9SA 4RMNA 3BLYA 1I3AA 1PYVA 2E7XA 3D5LA 3REOA 3WTTC 1WSUA 3IWFA 4DZPA 3FBIB 1Y0NA 2R7UA 5FLXK 3LSPA 1J09A 2WV1A 4JX4A 2P7CB 2BOLA 2TCTA 2FBKA 3X2QH 2CQKA 3AFHA 2EFWA 1QHHD 3FXOA 1PJRA 2O03A 5FB2A 2VI6A 4LLNA 1K4SA 1F1ZA 1FBQA 1XB4A 3CLQA 2LBFA 4N4OB 4MFDA 3ZMDA 4A6EA 1SAXA 1R1UA 2AHQA 3GFJA 1D1CA 3MMYB 1QO0D 1QPMA 4I98B 4NHJA 3I53A 2P5VA 1SMTA 4EQQA 1ZKGA 1ORKA 2ISYA 5CQGA 1FZPB 1R36A 2PBIA 2DCEA 2X85A 4EM0B 3EYYA 1ODDA 3CO6C 2DJNA 3NARA 1BBYA 2LRDA 2OQGA 3TP0A 3ZN1A 3DBRB 2IGNA 1MNMC 3GTKJ 4XLHA 4MTDA 3KP5A 3IH3A 4PSWA 3HIFA 4HLXA 3S2HJ 2UXXA 4ITVA 3PO2J 4FASD 1Z7LA 1JJ6C 3A0BC 1NK3P 2EINH 3N05A 5CQEA 1IC8A 1FNNA 4XORA 3OSFA 2QEXI 1M1EB 3E1SA 4ESJA 1IN6A 5GPCA 3VDXA 2LTPA 2W85A 5CJ9A 3TO7A 1TBXA 1YIOA 4RAGA 3LSIA 3HL2A 2KFDA 3DTEA 4FQGA 2ZXHA 2JVGA 5D5XB 4GRIA 2ZMEB 4QTRA 1H9TA 2KL4A 1T6SA 2LH9A 2RAEA 2JJ7A 4LG0A 1ONVA 4GO1A 1YJWI 2XAQA 4A69C 3SFZA 5F0FA 1U78A 3SZPA 4F3QA 5ILUA 4RAYA 2P8TA 2M4KA 4XRFA 2IT0A 3QU6A 3IWZA 3AKZA 2NAZA 2XB5A 5E3OA 1MBEA 1NHAA 2HDWA 4E70A 2JN6A 2OUMA 1R58A 4ESFA 5F1JA 5K7ZA 1VQ9I 1JKQC 3R60A 2KMUA 4QIWN 1U5TA 3LSRA 1X3WB 2ZXWH 4UVCA 5GTIC 3OIPA 4D7MA 4II3A 3HRTA 1X1CA 2XGDA 1U9OA 4D7NA 1RKTA 3GTPJ 5F0CA 2JPBA 4ESBA 3CMAI 1IGNA 2JUCA 3HTUA 4CCLA 1G3WA 4BE0A 3GMEA 3HOSA 3BR3A 1MJ9A 3QPTA 3KYLA 3T8TA 2HZDA 1ON1A 1R1TA 3E3VA 5B3SH 1XGSA 3S15J 3ZMZA 3K4JA 4IHWA 5AONA 2V1UA 4LB5A 3CCLI 2R5YB 4LK1F 2DA3A 1X3UA 3KP6A 3GYHX 4YIIA 1DGRM 3BCAA 3M8EA 2FQ4A 3K1MA 2MH9A 2RN7A 2DOEA 5JLXA 2OZ6A 2FX0A 5D6FA 5FGMA 2K4BA 1SVLA 1XTAA 1BR4A 3OYCA 1TNSA 4F91B 1G3SA 2KZGA 1F43A 2L4MA 3JTGA 3PO3J 1JHHA 1TWFJ 2ELHA 3BR6A 3NWSA 3KZZA 4L9VA 2LBFB 1H0MA 1A6IA 4KN4X 4OAZA 4KISA 3OS0A 1TWCJ 3I5UA 5IT9K 2VUMJ 3M7GA 2KQRA 3H5AA 4AVZA 4NBQA 2CUEA 2X6XA 5CVJA 2ZJ2A 2TDXA 3H35A 5HLTA 3WTVC 3HOUJ 3I55I 3QYBA 2GA2A 2ZB9A 2HYJA 2EILH 4GYIA 1K78A 2P4WA 4EJVA 2QBYA 1RETA 4ZDPA 3A01A 2O7OA 1S29A 5K5RA 2VC1A 1WI9A 3F8NA 1B59A 3BG6A 2DFEA 4ZJZA 4DBRA 3S3NA 5IP9J 1F9NA 2DTZA 2L9RA 4HDVA 1USTA 1RKWA 4A3CJ 1X58A 2A5WA 2UZKA 2Y2ZA 4DYCA 4L18B 2PMZA 1ZGAA 1H88C 4XKVA 4LB6B 3OR1C 1OR7C 5CPRB 1POGA 1XDSA 3I71A 2Q0OA 1ZRDA 1AA7A 1Y1WJ 2EFNA 3WTWC 1U3EM 1MBGA 4N9HA 3F21A 3CMYA 3WU2C 2IGOA 2AO9A 3K7AJ 1BW5A 1N77A 1GDTA 1WGXA 2CRGA 2FSWA 2DOFA 4BJ5C 3FX3A 3DBLB 1IRGA 2Q8KA 4O5VA 4LG0B 1W7PD 4EJWA 2HXOA 4A3FJ 1YOVB 1MDMA 3OYMA 3DPTA 2FOKA 2M2EA 1XGOA 4HOBA 3O2PE 2FF4A 2R92J 3JCUC 4OAYA 4L9NA 2V9PA 2LMDA 3PFIA 3K10A 1KU2A 1XDUA 4OIQF 2BW3A 4C3IJ 2VODA 3K4NA 1IUFA 5L3FA 5J1YA 2NYXA 1I1SA 4XKWA 3U1KA 2R7QA 3I56I 3VODA 3R0JA 3B73A 3JW4A 1YW8A 3DLLF 3O8HA 5ED4A 2QGUA 1U5TB 5EG0B 1HW1A 3C1DA 3J7YJ 3RDIA 3OYHA 2QF7A 5CVIA 4YIRX 2DQLA 2FJ1A 4KNYA 2ME0A 3CC7I 3KE2A 2FOWA 2XROA 4E7ZA 4M3BA 4KIFA 3FHNA 1NG6A 1KU3A 2CJJA 1WRJA 4PDKA 5BPDA 1QHGA 2CW7A 5A2QK 1WH7A 2XB0X 5KHDA 4IXAA 4LD5A 2L7ZA 2ZBKA 2WY7Q 3C2GA 3CCMI 1B72A 2A6TA 1FYKA 1XC5A 1WJ5A 5GAEJ 4HF1A 4HV6A 4P9FA 4XICA 3ZMTA 2NS0A 3SDBA 3I58A 4Y3OA 3OV8A 4CCOA 2OJED 4PSXA 3RTRA 3AL0B 1JHFA 5LHHA 4NUBA 2NS7A 1X2MA 3EQLF 4PJNA 3OSGA 4IL6C 2GLOA 3G73A 5FLVA 3H9QA 1QVTA 4Z2YA 1YS7A 2XDVA 3BTIA 3HSFA 3LSKA 4BU2A 4K2EA 2LKPA 1D0YA 1U6GA 2KP6A 1B4AA 2P5KA 4Q48A 1FOWA 2AXTC 2R7OA 2LDUA 1V55H 2W1OA 1SD6A 2OC6A 3NWTA 1W7PB 2NS8A 4BXFA 2LKXA 4BNCA 2EZKA 4KITB 2VOPA 2P6SA 2QKLB 2W57A 4CYCA 5FRNA 4A3BJ 2GXAA 4BACA 1PP8F 1ETKA 2PN6A 1UELB 2F4MB 1D1AA 5J4YA 1MMNA 4G8XA 2K85A 4A6DA 5H20A 2X1EA 2EB7A 2K9QA 1XCVA 1XSDA 1LFUP 2CMPA 2IS1A 3ABMH 4R79A 5GPAA 5J1RA 5GAGJ 1WQ2A 1YW9A 2PJRA 3BZKA 2HVRA 1GUUA 3RKXA 4M6VA 2BYVE 3HYIA 1AWCA 2VBZA 2JSPA 2LVSA 4ZH4F 1UMQA 2IA0A 1O3SA 4G6TB 2XUBA 3TOBA 3T8RA 2CS3A 2LP0A 1R5ID 2RV8A 4HZFA 2HYFA 1N75A 5DDGA 3PNYA 3K69A 1OFCX 3CUOA 2FNAA 3LOCA 3J7AY 4UHTA 2OZUA 2HXIA 4A0ZA 1MDMB 1IN7A 2JSCA 2NVYJ 4ZYGA 1FOKA 4BE2A 2Z3YA 1FPQA 2VC0A 3BCBA 3PM1A 4G7OF 4NQWA 2XC7A 2VOOA 2X51A 2R5ZA 1J0RA 3MD2A 2IA2A 5LHGA 2OTLI 1LB2A 4LLGF 1HKTA 2IP2A 3K70C 4XIDA 1J75A 3LL7A 2DW4A 2ZKZA 5LGTA 1SMYF 2Q2EA 4AD9A 2X1CA 5DD4A 2GIVA 3TP3A 2EIJH 4ZDLA 2XRNA 1Z91A 3I4MJ 2QSHX 2Y31A 3MZHA 3DKWA 2UUZA 3BY6A 3LSMA 2VE9A 4HW0A 1IZ1A 2OF7A 4GGGA 4V2FA 2VQCA 5E8IA 4U87A 1ETXA 2ZJPF 1B72B 2DPUA 3IV5A 2G7HA 4XSZF 2VONA 3DCFA 4EVIA 5F27A 3FK7A 5E17F 2HQAA 4BHPA 3JR9A 1V5FA 4ENMA 2L01A 4O6JA 5EDNA 3J7AO 2XASA 5L3EA 2EZHA 3SJMA 2WTEA 3ROUA 3W6JB 1GV5A 3A02A 2WAFA 1ENHA 4IOAF 1T39A 3CCJI 1XGNA 3CDHA 3CUQA 3GEZA 1ZAOA 3GLXA 3K4MA 4J00A 1RR8C 2H27A 1OYIA 5IOZA 1UZCA 4WX9A 1MMGA 3N4MA 1FC3A 1XMKA 3BP8A 2CV0A 3C18A 4PK4A 1Z67A 2X4HA 4HX7A 2C6YA 2V1DA 2IPQX 3B6CA 4XN3A 2VJJA 5C44J 2FE3A 4KMFA 2ICWG 3CCSI 2R0QC 3O6BB 5J3LA 4I99C 5M3FJ 2VT2A 4CZZA 1VQMI 2QZ8A 2B63J 4G6DA 3T5XA 4RBOA 2CQXA 2NVXJ 1JKPC 3PNVA 9ANTA 5J8FA 3BZ6A 2Y48A 1YTYA 5FRMA 4DQ2A 3A03A 2RNGA 2VE8A 3OIQA 5JLWA 4HRIA 4ZDOA 4KIBA 2IS6A 2PEXA 2MA3A 1Z6RA 3CCQI 3WGIA 2ECBA 2TRTA 2A6EF 4F92B 1K4TA 4ZC3A 1Y8RB 2H8WA 2VBXA 4MEXF 4PGHA 4ANJA 2DK5A 2I8DA 5E1XA 2DXIA 2ZCWA 3ERMA 3EPZA 1VQ8I 2E1CA 5GAHJ 4MNUA 3S8PA 4BHBA 1MBKA 1Z0XA 2K5CA 4KT6A 4XLCA 2KRFA 3OL3A 4M3GA 4FCYA 2XPVA 3ZQ7A 2DA4A 3R4KA 4NNJA 4BQNA 2CG4A 2OAZA 1ZH5A 5F08A 3U2RA 2VB6A 2DAOA 4RM3A 3G1MA 1R00A 2X1DA 4ABZA 2ZNZA 3U9GA 4UV9A 3K6GA 3KX2A 3FXMA 4RGSA 1R22A 3PFYA 1S72I 4NQWB 3ABUA 3CDLA 5EEHA 1FP2A 2BHYA 2FA5A 4GCVA 1HKQA 4M3EA 4MEYF 3A1YA 1DPUA 3FXKA 2ZJQF 2HVQA 4IRGA 4A3KJ 3L2WA 1HDPA 1B9NA 3WTZA 3CTAA 3LWFA 1GHCA 3AAFA 2Q1ZB 2GAUA 5FKMA 2G0EA 5J4VA 2QYOA 3SFIA 1JT6A 4DW6A 1OCOH 3LQRA 2DU9A 3HGYA 4X0GA 1TNTA 2L4AA 2DA7A 2DFHA 5J6XA 1YJ9I 2LYCA 1D5YA 3BZCA 4ZTFA 4AU7A 3CZ6A 3JAMK 3CJRB 2W00A 3CQZJ 2KZVA 2ZSIB 1A5JA 4FHTA 3CO7C 5M5WJ 5FLXZ 1ULYA 3DPUA 1MBHA 4KIGA 3BG3A 1BOBA 2ELJA 1OLTA 4U7DA 5LRSA 2CSOA 3CP2A 5KNLA 3S2WA 3OYFA 5H6RA 1W36C 2HNHA 2JRMA 2XPUA 3F72A 1S7EA 1J2XA 5IT3A 2KLOA 5K5OA 1B8IB 2ZJRF 3I54A 2DJIA 1CGPA 2ZMEA 5E20A 4E7KA 1J9IA 5DCMA 3KP2A 4I09A 5JFRA 3QYFA 3ZQGA 2O9LA 3CF2A 2RREA 3CUQB 3GX4X 4HEA2 2LC2A 5CVRA 4YFXF 2KRCA 3DKYA 3JREA 3H9JA 3T0YA 4EEFG 2VJ4A 4M71A 5BS6A 1VQLI 4MQVA 3EETA 4KMUX 1R5HA 3VYTB 1JJ8C 2MLKA 3WG7H 4CSWA 5DCFA 3KEYA 1YHQI 4IKFA 3KEQA 3H36A 1SANA 1LNWA 3VSLA 1XPXA 1RIOH 4RAZA 1K83J 2BXYA 1SVOA 1VI0A 1MIJA 4OINF 5IYBJ 2EK5A 5EZGA 3CMEI 5EEGA 4JQFA 2ZFUA 4L9TA 2M7BA 3HOVJ 3OIOA 4Z6YA 1SD5A 2E5ZA 3I59B 5F04A 2R7DA 3IH4A 3GZ5A 3I3LA 4X1EA
chains in the Genus database with same CATH topology
3AG4H 2EIMH 2Y69H 2ZXWH 5IY5H 3WG7H 3AG3H 1OCOH 2EILH 2OCCH 3ASNH 2EINH 3AG1H 3AG2H 3ABMH 2EIKH 3X2QH 3ASOH 1OCZH 1V55H 2EIJH 1V54H 1OCCH 1OCRH 2DYSH 3ABKH 3ABLH 5B1AH 5B3SH 5B1BH 2DYRH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG4 H;  2EIM H;  2Y69 H;  2ZXW H;  5IY5 H;  3WG7 H;  3AG3 H;  1OCO H;  2EIL H;  2OCC H;  3ASN H;  2EIN H;  3AG1 H;  3AG2 H;  3ABM H;  2EIK H;  3X2Q H;  3ASO H;  1OCZ H;  1V55 H;  2EIJ H;  1V54 H;  1OCC H;  1OCR H;  2DYS H;  3ABK H;  3ABL H;  5B1A H;  5B3S H;  5B1B H;  2DYR H; 
#chains in the Genus database with same CATH topology
 3HTS B;  4MFE A;  4ZYA A;  3T1B A;  3KLN A;  3TDZ C;  4M3D A;  4B43 A;  4A93 J;  3QQA A;  5JHF A;  3HEF A;  2XAG A;  3FXQ A;  4AID A;  3H9G A;  5E3N A;  3DQV C;  3HGG A;  5HS9 A;  5TJJ A;  2R5Y A;  2MD0 A;  1FBU A;  1ZRF A;  3KZI C;  2NNY A;  2K9L A;  3AG2 H;  2EZI A;  3Q3S A;  3RKY A;  5DV5 A;  4CYD A;  1VQP I;  2O6G E;  2R93 J;  2P6T A;  3JTH A;  5B5E C;  2QEN A;  4BBS J;  5IYC J;  2HOS A;  3FXR A;  2DT7 B;  2VPR A;  3LST A;  3L2Q A;  1V54 H;  1MGT A;  1ZN2 A;  4P96 A;  2CFO A;  2GA1 A;  3RI4 A;  4RDU A;  3GTQ J;  1QRY A;  2E35 A;  3COA C;  1HDD C;  4LK0 F;  1KA8 A;  3HOZ J;  2CUF A;  3CDI A;  3ESW B;  2M7A A;  1C0W A;  1Z3Y A;  3K2Z A;  4MIM A;  3AG1 H;  2DBB A;  3E5X A;  1YLF A;  3OS1 A;  5E1W A;  2RKH A;  2QUF A;  3ZP5 A;  2EJR A;  4M73 A;  4PJ0 C;  1P6R A;  1KQ0 A;  4XRS A;  1BJZ A;  1PUE E;  2VXZ A;  2XAH A;  3ULQ B;  1BN5 A;  4HLY A;  2DDA A;  3BR5 A;  3ABK H;  1KQ9 A;  1LFP A;  3TMO A;  2E1M C;  2CUJ A;  5HDG A;  2FBH A;  3MZ8 A;  1IV8 A;  3I0T A;  3ISP A;  1BM9 A;  3B6A A;  3K1P A;  2DA5 A;  1R5G A;  1BOA A;  2R4G A;  2KT0 A;  3E5U A;  1Z6T A;  2M3A A;  2OQR A;  3VWB A;  4CUG A;  1BI3 A;  3A4C A;  3ECO A;  3TW7 A;  3QPH A;  2RGV A;  3HM5 A;  2ESH A;  1ZR4 A;  2L54 A;  2ZNY A;  1LPQ A;  1H89 C;  2KRH A;  4XSX F;  1MMA A;  2JA5 J;  2CH0 A;  2BY0 A;  1T08 B;  2W48 A;  1Q1H A;  3ZQL A;  2IJL A;  3K4C A;  1SD4 A;  2Y0M A;  1N78 A;  3ZXS A;  2X6W A;  1CQT A;  2Z16 A;  2ECC A;  1UCR A;  4A3J J;  1VQ4 I;  5LLQ A;  4XKB A;  2OV7 A;  5DCM B;  5H6Q A;  1DQU A;  4W1U A;  3C3W A;  3GF2 A;  3I64 A;  5DM7 F;  3QOD A;  4L5E A;  2LOO A;  1OR7 A;  4JYK A;  3WHC A;  4L0Y B;  3L1P A;  2CGP A;  2GXG A;  3F8B A;  4LJZ F;  3BJ6 A;  2GOM A;  3HRS A;  1TC3 C;  1FOY A;  4C9Y A;  1U2W A;  1IN5 A;  2EZL A;  4I7H A;  5LD2 C;  1OCR H;  3ABL H;  3MKW B;  4P55 A;  2IRF G;  2HI3 A;  4NC7 A;  3JSO A;  2I5U A;  4YEJ A;  4B48 A;  3M9A A;  3HOT A;  1H8A C;  3E6B A;  3DU5 A;  5EG0 A;  2ETH A;  1W1W E;  1UHM A;  1LDD A;  3G71 I;  3H3Z A;  1O7F A;  3HOY J;  4KUM A;  2VQH A;  4HG2 A;  4BS9 A;  5KAI C;  4L9J A;  2MGQ A;  1WZ2 A;  1TQM A;  2IA1 A;  2K7L A;  4HBL A;  1TW2 A;  1BC7 C;  4C2T A;  5DM6 F;  4E4H A;  3RYP A;  2HEO A;  3ZR8 X;  4U0V A;  1WH5 A;  3FIW A;  4CCJ A;  3P9I A;  4PFO A;  4A3D J;  2FXA A;  1T0F C;  2IGM A;  1K6Y A;  5BMZ A;  2O8X A;  2R7W A;  1OJL A;  5ICG A;  2CQN A;  4RB2 C;  2WY8 Q;  2XF5 A;  5LHI A;  2DA2 A;  5GTH C;  1OQY A;  4I0B A;  4U0W A;  1FT9 A;  1O3Q A;  1X2N A;  1GVD A;  3ASO H;  1IRF A;  3J81 K;  3EUH C;  4ASN A;  5D5W B;  2BE5 F;  2MH2 A;  4CCN A;  4C3J J;  1WPK A;  3S3O A;  1WJF A;  4FT8 A;  1HKS A;  1R49 A;  1IG7 A;  2Z99 A;  5ICE A;  1Y0U A;  2A6H F;  3AG4 H;  1W7P A;  4E6K G;  1T8I A;  5J8C A;  1AKH B;  1MBJ A;  2DFF A;  3MEX A;  5HS8 A;  2EV0 A;  2ZXJ A;  4A3G J;  4XNF A;  2PJP A;  4RA2 A;  2KDO A;  2V79 A;  4DIQ A;  1KU7 A;  1KON A;  4Y13 A;  1TL8 A;  5JVG F;  1Y6I A;  2XAF A;  3W6V A;  1Z1D A;  1XN7 A;  4N0B A;  3H0G J;  2CWE A;  5BQT A;  1K6O A;  3I4N J;  2FNP A;  1A6Q A;  2Y30 A;  3VYS B;  2ID6 A;  2EPF A;  3F8M A;  4BJ6 C;  4WF2 A;  2JA8 J;  4B3X A;  3S17 J;  3F8F A;  3OL4 A;  2CQ7 A;  1J59 A;  5AIQ A;  2MSY A;  3K1N A;  4XLA A;  1IN8 A;  1D0X A;  4WXH A;  3VB2 A;  3C2B A;  2WAE A;  1TWA J;  3ASN H;  3JRB A;  5E79 C;  3HKZ A;  3RZO J;  1XSX A;  1ZAR A;  3FK6 A;  4N4N B;  3VOE A;  3D1N I;  2QQ8 A;  1LE8 B;  3BT9 A;  1VF9 A;  1VFC A;  4Q5S F;  1X1P A;  2VQG A;  3BG5 A;  2F6C A;  3V8K A;  4BXU A;  4M74 A;  5B1B H;  3HRM A;  1IJW C;  2PG4 A;  3OYK A;  2EFQ A;  3OS2 A;  1SFU A;  2V6E A;  2WBM A;  1Z77 A;  3L09 A;  2CFX A;  4Y52 J;  4IHX A;  2DMU A;  4BUP A;  2K3P A;  4IX7 A;  5JI6 A;  4YG2 F;  5IP6 A;  5K5Q A;  3KP4 A;  2X0L A;  2L7F P;  2L5Q A;  2AQE A;  3H92 A;  2NVU B;  1SFO J;  4BQA A;  1FX7 A;  3FHZ A;  4MHG A;  1ETY A;  4XRS G;  5LGN A;  3GWZ A;  1XSV A;  2O3F A;  3GW2 A;  4AVP A;  2K40 A;  3EUK L;  3M8J A;  1V5G A;  2EFO A;  1D1B A;  2KHM A;  3N97 A;  1WWX A;  2OU2 A;  2EWN A;  1G3Y A;  4XLP F;  3HJE A;  4E7I A;  3K4B A;  4QSH A;  1PDN C;  2E2I J;  2H94 A;  3E7L A;  3HPH A;  2QQ9 A;  2WV0 A;  5DTD A;  1JTX A;  3DWL E;  4Q4Z F;  1FOX A;  4JX6 A;  3WTU C;  1QGP A;  4B3A A;  3H5R A;  2HTJ A;  3F6O A;  3NAU A;  1R6R A;  1UG2 A;  5HOO A;  3ONQ A;  2VXD A;  2L02 A;  5FD6 A;  1S7O A;  1SAU A;  3F9K A;  3HXL A;  3ZQQ A;  3ML6 A;  3SYT A;  3ERE D;  1QZZ A;  3LSJ A;  1UB9 A;  5L3B A;  1DDN A;  3GO5 A;  1B1B A;  2D1V A;  4GYG A;  3S2D J;  2R7F A;  3RYR A;  3FKI J;  1MD0 A;  2STT A;  1BI0 A;  1WFX A;  2HU9 A;  2JUG A;  3CES A;  2KIS A;  3CCV I;  1MW7 A;  4OU0 A;  5B1A H;  2GWR A;  4FE7 A;  2HKX A;  1ZEL A;  1WJB A;  5KAF C;  2YU3 A;  4NC6 A;  1F5T A;  2YX7 A;  3GTO J;  5EZH A;  2F5F A;  2CUZ A;  3OMY A;  4BBR J;  3TED A;  2G7U A;  4CH7 A;  3OYN A;  1WHU A;  3K70 D;  1G3T A;  3VPR A;  4EJU A;  4FET A;  1I50 J;  2VKH A;  5EYR A;  4ENN A;  3JRF A;  3GTG J;  4LIV A;  4BKX A;  4M72 A;  2JTV A;  2DMN A;  3OYD A;  5IYD J;  1FMV A;  2AQF A;  4AWX B;  3JRG A;  1OCZ H;  2COM A;  2STW A;  4E7S A;  1ACI A;  3LA2 A;  2D2W A;  5CVV A;  2F5E A;  3MKY B;  4ENJ A;  2A68 F;  2NVT J;  1A36 A;  3FMQ A;  3HC7 A;  3WG9 A;  2HFH A;  4DGW B;  1W0U A;  4NC8 A;  3SDG A;  1QA6 A;  3TO6 A;  4OMY A;  1BW6 A;  2COB A;  1QQI A;  1WVR A;  4M6Y A;  4BAY A;  1SFK A;  1FLI A;  3ZMS A;  4BDZ A;  3CD6 I;  1W5T A;  2M5W A;  2QCO A;  4CGZ A;  5LRR A;  1OKR A;  3GFM A;  3BC8 A;  2V9V A;  3L9F A;  4C2U A;  2V1X A;  3L00 A;  2I10 A;  3DEW A;  2E71 A;  2P5L C;  1ZG1 A;  2DT5 A;  2EV6 A;  2MAB A;  3M3Y J;  1X3Z B;  2FML A;  1R7J A;  3RZD J;  5GP9 A;  5M5X J;  4Y15 A;  5FKK A;  5F6F A;  3LA7 A;  4GFB A;  4KA4 A;  4EV0 A;  3PIO F;  1S8N A;  1J5Y A;  5ILS A;  4I6Z A;  4PJM A;  3Q5F A;  2W4S A;  1YIT I;  4FTH A;  2P0W A;  3GCM A;  2L7K A;  3JRC A;  1BR1 A;  3H3U A;  4E7L A;  2VBY A;  2HZT A;  1Y39 A;  1MMS A;  1ZYR F;  4BDY A;  2ACJ A;  1DU0 A;  5HLI A;  2R7R A;  2KKO A;  2P81 A;  2HS5 A;  2Z33 A;  3P9K A;  2CU7 A;  4HX4 A;  4YFK F;  3BR1 A;  1EH7 A;  3K4L A;  3ZQI A;  3F6V A;  3F8C A;  1FYM A;  4PFP A;  1X1A A;  3FXJ A;  2BEO A;  3RQI A;  1U0J A;  1B8I A;  3U1D A;  2NRA C;  1W0T A;  2XGX A;  2M0C A;  3WTY C;  2M34 A;  3DEE A;  1D3Y A;  2BXZ A;  1BR2 A;  1ZK8 A;  1HCR A;  4ZYE A;  3QOE A;  3L2R A;  2XV4 S;  2V7F A;  2M87 A;  4C3H J;  1G6N A;  1KYW A;  3FKJ A;  2LD5 A;  2DMP A;  4A2U A;  2J5P A;  2WAD A;  5HDN A;  4ZTJ A;  2YR2 A;  4HPQ A;  2OBP A;  3C2H A;  1F4K A;  2MC3 A;  1GXP A;  3DV8 A;  3BG7 A;  5FJ8 J;  3J80 Z;  4EM1 A;  2L7M P;  3DBH B;  1BJA A;  2A61 A;  3DEU A;  4KIC A;  1KGS A;  2W7N A;  4TV7 A;  3CF5 F;  1WI3 A;  4KT5 C;  2LNB A;  2HDC A;  2JRT A;  3PSI A;  2GQQ A;  3CCU I;  4JK1 X;  2XSJ C;  3AG3 H;  3I59 A;  2VT3 A;  3JRI A;  1BIA A;  2HDD A;  5ICC A;  3RPU A;  4WXD A;  4NDL A;  2HVS A;  1V5E A;  1UG0 A;  4UB6 C;  1DP7 P;  1IV6 A;  1YYV A;  3V42 A;  3GUD A;  2DA6 A;  2XAJ A;  1FY7 A;  3IP4 B;  4F7Z A;  1ZRC A;  4HSR A;  2HPI A;  1GXQ A;  4HV5 A;  3NEU A;  2CV1 A;  1XCB A;  1LKX A;  4IEJ A;  1T38 A;  3V7R A;  3QAH A;  3TW6 A;  2LG4 A;  1AU7 A;  1G4D A;  1JI8 A;  4G6Q A;  4QWQ A;  4XLF A;  5FD5 A;  1FIP A;  4OIR F;  4Y4R A;  2CO5 A;  1NTC A;  5HLG A;  2ZSH B;  2XHK A;  3M4O J;  2RNJ A;  1YG2 A;  5LFA A;  3PQJ A;  2YS9 A;  2HOA A;  3WTX C;  4IHV A;  3W3C A;  1FWZ A;  1YQA A;  2H09 A;  4IF4 A;  3OYI A;  2DO7 A;  2EQR A;  1EH8 A;  2IBD A;  4PJJ A;  4PUS A;  3MCZ A;  2DA1 A;  2E34 A;  2YPR A;  4XMY A;  4ZYH A;  2JT1 A;  2A07 F;  3KP3 A;  5CLS A;  4EMS A;  2IXS A;  1I6H J;  3HZJ A;  4J19 A;  3RPU D;  4JBA A;  1Z21 A;  2VJI A;  5EEA A;  3DFG A;  2R7V A;  1DU6 A;  1HW5 A;  3R0A A;  2M30 A;  2Y9Z A;  1YIJ I;  1P4X A;  1PVE A;  4RAF A;  2MC4 A;  3S1M J;  3L7W A;  1SEU A;  2BHZ A;  2A05 A;  3Q9S A;  5D4R A;  2DLL A;  1OYY A;  2PQ8 A;  3WU1 B;  3L2V A;  1FYL A;  4AIH A;  1S5L C;  4IRH A;  3V4G A;  3PNT A;  4BE1 A;  4I2O A;  4A5N A;  1K61 A;  1E3H A;  1DPR A;  2RVC A;  3QP5 A;  3OWT A;  3BOQ A;  4S05 A;  3GFL A;  5D8L B;  2IGK A;  4D9J A;  1VQK I;  3F0C A;  4RGR A;  2NNN A;  4NB5 A;  5BNG A;  3B02 A;  3M1C A;  2DMT A;  3JRD A;  3KP7 A;  4HYE A;  3GTM J;  1V3F A;  2VQL A;  5C4J J;  1RRJ A;  2M0M A;  2D5V A;  4XM3 A;  3FF5 A;  4OIP F;  3TO9 A;  4BEH B;  3K0L A;  4H0E A;  1QZE A;  1QPI A;  2WAQ N;  4BY1 J;  2ZC2 A;  2LY2 A;  1WJD A;  4G7H F;  1KQ8 A;  4D1Q A;  1LVA A;  4KFC A;  2W25 A;  4BL0 B;  5LEJ A;  3F23 A;  2QSG X;  4KN7 X;  5ICF A;  3VSK A;  4ZZL A;  3V7S A;  1OPC A;  1MNE A;  2DYR H;  4HQM A;  3GTL J;  1JGG A;  4HX8 A;  4ENK A;  3FBN B;  2BVL A;  2LR8 A;  4B44 A;  2V26 A;  2HQN A;  1BIB A;  1KU9 A;  1LDJ A;  1VQO I;  4MGR A;  2O61 A;  1JGS A;  1CF7 B;  3G1O A;  2MD5 A;  4Y33 A;  4A3L J;  3RQ4 A;  1EV7 A;  1UFM A;  1XMA A;  4MLO A;  1T56 A;  1VQ6 I;  5C4X J;  2QQA A;  1I3Q J;  2FUG 2;  2M45 A;  3QP6 A;  3R61 A;  3GVA A;  2WA0 A;  2DOA A;  1KYZ A;  4HAM A;  4BJT A;  3M8F A;  1TWH J;  2F48 A;  3HSR A;  2JK3 A;  2QSF X;  3QWL A;  2X6Y A;  2GOX B;  2IEK A;  2OCC H;  3MKZ A;  4LIU A;  2HQ5 A;  1O57 A;  2XIG A;  2JPC A;  3MQ0 A;  3DTK A;  3LAJ A;  1JKR C;  1W5S A;  3TQN A;  5L3G A;  3TBI A;  3HHH A;  1EH6 A;  2M9H A;  2VBW A;  1BL0 A;  4AYB N;  3G2B A;  4B47 A;  1LEB A;  4JOM A;  2L9V A;  4IPA A;  2BV6 A;  3CLO A;  4XON A;  3SXY A;  4AUX A;  3HG9 A;  3ZQH A;  3BTJ A;  2MW8 A;  2MYS A;  5CYV A;  2RQP A;  1BA5 A;  3CCE I;  2EIM H;  3QPS A;  2UWM A;  1YX3 A;  2E1N A;  2F5C A;  3ZGK A;  2XSD C;  4IOC F;  4E7J A;  2X9D A;  1T0F A;  4HNT A;  3G4S I;  2XVC A;  5ILV A;  1IDY A;  3FMR A;  5M5Y J;  3IKT A;  3L2U A;  1UHW A;  2LF7 A;  2PX9 A;  4ZZD A;  1E3P A;  1AKH A;  1HST A;  3IKV A;  2IW5 A;  4M9X A;  3K2A A;  3Q0U A;  4HNV A;  2VKE A;  2ME6 A;  1TW3 A;  4DJA A;  4R8H A;  4XLE A;  4JP0 A;  1IO2 A;  3EUH A;  3KCC A;  1SFE A;  1D0Z A;  2H1L A;  3BJO A;  4LG3 A;  1ERD A;  5E18 F;  3OR2 C;  1S3J A;  1ETQ A;  1G2H A;  3ZRG A;  4EM2 A;  3LFU A;  5K7F A;  5IP7 J;  1ZRE A;  4IRI A;  4M9Z A;  5LBQ A;  5F0H A;  1JE8 A;  1SFX A;  1ZLK A;  3D5S C;  4MTE A;  1IW7 F;  4GXO A;  3KYC B;  2BVM A;  3TKY A;  3LAP A;  4LLL A;  2AS5 F;  2KDZ A;  2CQQ A;  3WE2 A;  3CMM A;  3J81 Z;  2E1M B;  2K02 A;  1NH3 A;  4UUT A;  1LE8 A;  5IT9 Z;  3V7C A;  2KIU A;  3E0J B;  2ZME C;  4B8X A;  3MVP A;  1E0E A;  2E60 A;  1TQI A;  2EA4 A;  3D0S A;  2EA2 A;  3ZMV A;  1X4O A;  3MKL A;  4F55 A;  5CVU A;  4FE4 A;  5EGO B;  2XGE A;  1DUX C;  1PUF B;  4PJL A;  4A12 A;  3UKG A;  1S6L A;  1BI2 A;  2KIM A;  2NOJ B;  3FIS A;  3S93 A;  2Y9Y A;  2CW8 A;  2EIK H;  1P4A A;  1XD7 A;  4I02 A;  3H0D A;  3OYL A;  4HQE A;  2H6C A;  2F2E A;  1QU3 A;  1R4M B;  2WWY A;  1LEA A;  2FMY A;  2IVM A;  3S1N J;  2KPM A;  1XMX A;  5FFX A;  3V8J A;  1RZ4 A;  2LFB A;  5DUK A;  3S1R J;  3FM5 A;  2B7E A;  2IS2 A;  5M3M J;  1YRN A;  2WB1 N;  3S1Q J;  3HOW J;  1YE9 A;  3FM3 A;  2XF6 A;  1E2X A;  1YW7 A;  2DN0 A;  3UNG C;  4XL9 A;  1YS6 A;  4H4K C;  4UV8 A;  3SZT A;  1RUO A;  3ZOB A;  2DYS H;  2QA4 I;  1JTY A;  3DPL C;  3G1L A;  1NK2 P;  1F36 A;  4A3M J;  2K86 A;  1T33 A;  5HNH A;  1T95 A;  2EH3 A;  1TQP A;  1HXD A;  1I6X A;  4QPO A;  3FDY A;  2K9M A;  2QQB A;  3BPV A;  1RI7 A;  4U0Y A;  2HR3 A;  1LQ1 A;  2XRL A;  1LUJ B;  1XG1 A;  5JHU A;  1H9G A;  2FU4 A;  4A3E J;  2IAI A;  2VPL A;  3BQY A;  1GVJ A;  3WHB A;  2HKO A;  4II2 A;  1ETO A;  2NVQ J;  1VND A;  4GDF A;  1RES A;  4YFN F;  2JWT A;  2KJB A;  4IQ4 A;  2D45 A;  3M1E A;  1Y1V J;  3RKW A;  2W82 A;  3LMM A;  3TL4 X;  1EJ9 A;  4BQQ A;  2AXL A;  2MFZ A;  3EYI A;  3H1C A;  3CP8 A;  3FMS A;  3OYJ A;  1Y56 A;  3GZ6 A;  4S0H B;  2PI0 A;  3D5R C;  3ABT A;  3BQZ A;  3HHG A;  3A2K A;  5A2Q Z;  1IXC A;  2M8G X;  3SQN A;  2DK8 A;  2J5O A;  3KPH A;  3WGG A;  4IHT A;  2XAU A;  4Y17 A;  2VN2 A;  2YSR A;  4F93 B;  4YEL A;  1UJ8 A;  4CDG A;  3OYG A;  4C2M J;  5HNF A;  4HF0 A;  1T2K A;  5IPA A;  1A35 A;  1V4R A;  3WOD F;  5HS7 A;  1E17 A;  1TTY A;  2OCE A;  3EDP A;  3I4P A;  4CZC A;  1HC8 A;  2LF8 A;  2WAQ A;  3C7J A;  1VQN I;  4C30 A;  1S7A A;  5E3L A;  3U21 A;  3QOP A;  2V1N A;  3GXO A;  2D1H A;  3HBL A;  2KJC A;  4M6X A;  1MH4 A;  1OCP A;  3P9C A;  4V2G A;  4XBF A;  3IL2 A;  1WJA A;  4UUS A;  4WK8 F;  2HTS A;  2VJ5 A;  1USS A;  1ZG3 A;  5D8K B;  4G7Z F;  4AC0 A;  1OCT C;  2ZO4 A;  2E2H J;  2VKD A;  1YX5 A;  4DYQ A;  1E3O C;  4UNO A;  2BBY A;  2FRH A;  3O8G A;  1I5Z A;  2RQQ A;  2L9S A;  2GXB A;  4X6A J;  4IHY A;  3CCR I;  2E7W A;  3BR2 A;  2CW0 F;  3H5N A;  5DS9 A;  4BY7 J;  3DXJ F;  4UB8 C;  5E8G A;  4YRV A;  3BG9 A;  3E6D A;  4L5I A;  3RPQ A;  2KIQ A;  4Q47 A;  5FKN A;  1R1V A;  1J7K A;  1IXS B;  4LGW A;  5C3E J;  1ON2 A;  4CIC A;  2QVO A;  4RB1 A;  3WTS C;  4OWR B;  2JVH A;  1TP4 A;  5FLM J;  1SC7 A;  1U8B A;  3PSF A;  1IRZ A;  2VIX A;  2W24 A;  3BJA A;  5EJC A;  3TOA A;  3W6K B;  1U5T C;  5AIP A;  3S32 A;  1XS9 A;  4Y7N J;  1YRN B;  4HST A;  4L5J A;  2Y0S N;  1A31 A;  3G6E I;  1TLH B;  2A69 F;  1P9Q C;  4RS8 A;  5K1Y A;  1KZH A;  2YX4 A;  4AIJ A;  2LRE A;  4AIK A;  4FX0 A;  2O5R A;  4AYB A;  3MFK A;  5LGU A;  1ZG5 A;  1R4N B;  2GM4 A;  1MSF C;  3HB9 A;  4UVB A;  1IRX A;  5HOD A;  2DPD A;  1XGM A;  2HPM A;  3HUG A;  3P5J A;  3DU6 A;  2L9N A;  2XF7 A;  1K79 A;  3RIR A;  3GLL A;  4CCM A;  1MSE C;  2O8K A;  4F52 A;  3KZY A;  3NRV A;  2K3F A;  1EF4 A;  3MAJ A;  3MN2 A;  1ITY A;  5FO5 A;  3K4K A;  3F3X A;  4RM2 A;  3AL0 C;  1MBF A;  2Z2S B;  2DOD A;  2RC4 A;  3DP7 A;  3E6M A;  3KFW X;  4QLC U;  4CO8 A;  3OOP A;  3DKX A;  1SD7 A;  2XGC A;  2HOT A;  1ETW A;  1TT5 B;  3RKQ A;  4D5F A;  5JVT A;  1S9H A;  1MJA A;  1X4P A;  5TRD A;  3SEQ A;  4AM3 A;  2IS4 A;  3Q0W A;  3CJT B;  1EA3 A;  4CHU A;  4HF2 A;  1FSH A;  2A5Y B;  2OPT A;  3GBG A;  3G3Z A;  5BPI A;  2XPW A;  2E2J J;  3PJR A;  2BY1 A;  3RSN A;  1FIA A;  1BI1 A;  1FMW A;  2X6O A;  1STZ A;  3WE3 A;  5J40 A;  1EKE A;  1ZGJ A;  2Y69 H;  2E19 A;  1MZB A;  5BOX A;  1FBS A;  4RB3 C;  1GLN A;  2W84 A;  3PIP F;  5K7H A;  2B0L A;  2FBI A;  2OA4 A;  5F1R A;  2OD5 A;  2E36 A;  4B09 A;  5LEK A;  2DMQ A;  1DGW Y;  3L2C A;  3FXL A;  3ECH A;  3VYU B;  1P92 A;  4A0X A;  4CA0 A;  1D8K A;  3S3M A;  3R6S A;  4RLQ A;  1ZR2 A;  1WJC A;  3LA3 A;  5D6E A;  1ZHF A;  1K78 B;  1FP1 D;  2K4J A;  2PFB A;  2QBY B;  3HSE A;  3A01 B;  2DDB A;  5IY5 H;  4UUS B;  4I01 A;  3KIO A;  1Z3X A;  1RUN A;  5D5U B;  1REP C;  2ID3 A;  2BGC A;  4BH9 A;  2G9W A;  2K27 A;  1IF1 A;  1WKM A;  1O3R A;  3NQO A;  1XX5 A;  3K9T A;  3TGN A;  4P9U A;  1JKO C;  5JR3 A;  1IXR C;  2DFI A;  4DYR A;  1R71 A;  1AOY A;  2WB1 A;  4G9Y A;  1N25 A;  3E6C C;  1YJN I;  5B66 C;  2UXN A;  1RNL A;  5HDK A;  1B9M A;  3KLO A;  3BTL A;  3I9V 2;  1D8J A;  1K7A A;  3MZY A;  4O3M A;  5FKL A;  3JSP A;  4RGU A;  1WJE A;  3HPG A;  3PQK A;  2QLZ A;  1YFH A;  5E3M A;  3M07 A;  2M1B A;  2V4J C;  4HNU A;  4WXC A;  3KYD B;  5DEQ A;  3LQQ A;  4IJA A;  2UV1 A;  3VEP A;  3HOX J;  2B9S A;  1ZQ3 P;  2R7Z J;  4OMZ A;  4XOP A;  2E1O A;  2KIF A;  2VKV A;  1I27 A;  2ZFW A;  4HDU A;  1O7L A;  3IRQ A;  4R1H A;  2BY2 A;  3W2W A;  5J47 A;  4W97 A;  3P7N A;  2QWW A;  1P2F A;  2Z9O A;  4P5O A;  1Q1V A;  3V8L A;  2HWV A;  1ZGW A;  3F22 A;  2EFP A;  2BW3 B;  4D5C A;  3HUG B;  3VYR B;  2H8R A;  2H6B A;  1QZY A;  1APL C;  1RPW A;  1TT0 A;  2P7V B;  4XOT A;  5DUI A;  1LDK B;  1G59 A;  4LFU A;  5KVR A;  4IQJ A;  4XK4 A;  5L3D A;  4A5M A;  2GBY A;  3FWE A;  1ETV A;  1I39 A;  3RCO A;  5HVQ C;  4QPQ A;  2BY3 A;  4DBQ A;  2JQ7 A;  3Q9V A;  1RC9 A;  1L3L A;  1HSJ A;  1JUS A;  1T98 A;  2Z1D A;  1JXS A;  2N8G A;  4KJZ A;  3SHF A;  2E5N A;  4G12 A;  4RLF A;  2BZT A;  4XN0 A;  4UXN A;  1O3T A;  2F4O B;  3CJN A;  4HA8 A;  4BEH A;  4KYW A;  3J7Z I;  2QM3 A;  4XR6 A;  4EJT A;  6PAX A;  1G8X A;  2K9N A;  4XKC A;  2R7S A;  3IH2 A;  3HRU A;  1B6A A;  1WCM J;  2LY1 A;  2O0Y A;  5D5V B;  1W4M A;  1NG7 A;  4M3F A;  1U9N A;  4XLN F;  4RGX A;  3VFZ A;  1W5C C;  4CXF A;  1R23 A;  5GAD J;  4ETS A;  4V19 K;  2LSO A;  2MLG A;  3E97 A;  4PGG A;  3PUF A;  4A0Y A;  4BYY A;  4LOC A;  1PP7 U;  3JAM Z;  4CCK A;  1IDZ A;  4DZJ A;  2OTJ I;  2JZY A;  4U88 A;  1CF7 A;  2FD5 A;  3OOU A;  5DYM A;  3JRH A;  2CYY A;  2QKM B;  1Z7U A;  3EUA A;  3LSH A;  3H3V K;  2JA2 A;  2GZW A;  2PLY A;  3RJP A;  5H2F C;  2Z5U A;  4P1W A;  4J01 A;  3PUB A;  2XKO A;  3JRA A;  3ZCO A;  1FJL A;  3LFK A;  5IOY A;  1OIS A;  1L0O C;  3IAS 2;  4WCG A;  1O4X A;  4BXX J;  2EV5 A;  4OOI A;  5DD8 A;  3Q0V A;  4CYC B;  1HBX G;  1P7J A;  2ESN A;  4N9I A;  2CV2 A;  4JX5 A;  4WWC A;  1MMD A;  1HF0 A;  1ZLJ A;  1HW2 A;  1LVK A;  1UAA A;  1OMI A;  2ZXI A;  4IVN A;  2F5V A;  4ZYD A;  1W36 D;  2FQ3 A;  1JUM A;  1AHD P;  2L2O A;  2HGC A;  1DP3 A;  3IRR A;  5FRO A;  4IHS A;  2X48 A;  3A0H C;  2PJR B;  2FEZ A;  1MJB A;  2V9K A;  3LNQ A;  1JT0 A;  3S14 J;  2PMU A;  2Y0S A;  2PMH A;  4OIO F;  1P4W A;  2DT6 A;  4U7B A;  2ISZ A;  2Y75 A;  3IHU A;  4MO7 A;  2V6C A;  1GV2 A;  2VLA A;  1LFB A;  2NOG A;  4EJO A;  3ZMU A;  4LIT A;  4EGY A;  5KCM A;  3E5Q A;  4RB0 A;  3KET A;  4UY8 I;  4A3I J;  3QRF F;  2NXN B;  1HQC A;  1MND A;  3W2V A;  4BHC A;  5F64 A;  1FEX A;  2K9S A;  3FZV A;  2MBF A;  4BQO A;  3O3K A;  4UUV A;  1UHS A;  4KDP A;  5KK1 A;  1R9T J;  2WC2 A;  2A3S A;  3IC7 A;  1YO5 C;  5FFZ A;  4FIS A;  2ADU A;  4DOZ A;  5TIS C;  2XKP A;  2JA6 J;  2DI3 A;  3ZN0 A;  2VAS A;  3IAM 2;  1Z9C A;  1VZ0 A;  1QVU A;  2R3S A;  1FTZ A;  3OY9 A;  1OCC H;  2R5Z B;  1X1D A;  2VL8 A;  2DTR A;  2LLK A;  3SZG A;  3OYB A;  5D4S A;  3BPX A;  4ON0 A;  4E7H A;  3CJQ B;  1D5V A;  2HYG D;  3GFI A;  3ZQC A;  2Q2E B;  4B1R A;  1MKM A;  2F5D A;  3BR0 A;  3CCY A;  4UVA A;  3ZPL A;  2R7X A;  1I1G A;  4FX4 A;  1IAW A;  1U8R A;  3DTI A;  2F4I A;  4DNC A;  4LMY A;  1X1B A;  3J80 K;  4G94 A;  2MG4 A;  5EGO A;  3MWM A;  3WGH A;  5HLH A;  2LK2 A;  4MQ9 F;  2ELK A;  1PUF A;  1IUY A;  2JMW A;  3ZQF A;  4S04 A;  3CUQ C;  1FTT A;  2L3D A;  4L0Z B;  4D0P A;  2H1K A;  2R7T A;  3GTJ J;  2HOE A;  1MH3 A;  5E1Z B;  2L0K A;  3DLA A;  3TDU C;  4XRM A;  3IUO A;  4BGD A;  3OYE A;  2HQR A;  3CC2 I;  5J1U A;  1VQ7 I;  2YUS A;  1VTN C;  1HLV A;  1SVM A;  1X19 A;  2GIZ A;  5L3C A;  3BTC A;  3W2A A;  1JUP A;  1RR7 A;  3FXU A;  3SEZ A;  2PMZ N;  3BWG A;  3ELK A;  3QPL A;  1TWG J;  4YIF A;  4I76 A;  5EF6 A;  3GZN B;  4B4C A;  3HKZ N;  4PZJ A;  3WU0 A;  3PL8 A;  3QYE A;  1A04 A;  2EBI A;  1P7I A;  2M4G A;  1TZL A;  3LSG A;  3HDD A;  1IN4 A;  2M8E A;  3S16 J;  4XQF A;  2JA7 J;  1QBJ A;  4EAT A;  5ERI A;  1VQ5 I;  2LY9 A;  1GT0 C;  4IZZ A;  3UR3 C;  4PCQ A;  5TGT A;  5CKT A;  4I0A A;  1BC8 C;  3QU3 A;  2RDP A;  1Y8Q B;  3DF8 A;  1HOM A;  1HA8 A;  5FKO A;  3BDD A;  2DQR A;  4IO9 F;  2LKS A;  3KEO A;  3OYA A;  3BRO A;  3CC4 I;  1Z05 A;  1YI2 I;  1ZTR A;  4EGZ A;  1OYW A;  1QNT A;  2YU9 J;  1FSE A;  1LJ9 A;  4M9S A;  4RMN A;  3BLY A;  1I3A A;  1PYV A;  2E7X A;  3D5L A;  3REO A;  3WTT C;  1WSU A;  3IWF A;  4DZP A;  3FBI B;  1Y0N A;  2R7U A;  5FLX K;  3LSP A;  1J09 A;  2WV1 A;  4JX4 A;  2P7C B;  2BOL A;  2TCT A;  2FBK A;  3X2Q H;  2CQK A;  3AFH A;  2EFW A;  1QHH D;  3FXO A;  1PJR A;  2O03 A;  5FB2 A;  2VI6 A;  4LLN A;  1K4S A;  1F1Z A;  1FBQ A;  1XB4 A;  3CLQ A;  2LBF A;  4N4O B;  4MFD A;  3ZMD A;  4A6E A;  1SAX A;  1R1U A;  2AHQ A;  3GFJ A;  1D1C A;  3MMY B;  1QO0 D;  1QPM A;  4I98 B;  4NHJ A;  3I53 A;  2P5V A;  1SMT A;  4EQQ A;  1ZKG A;  1ORK A;  2ISY A;  5CQG A;  1FZP B;  1R36 A;  2PBI A;  2DCE A;  2X85 A;  4EM0 B;  3EYY A;  1ODD A;  3CO6 C;  2DJN A;  3NAR A;  1BBY A;  2LRD A;  2OQG A;  3TP0 A;  3ZN1 A;  3DBR B;  2IGN A;  1MNM C;  3GTK J;  4XLH A;  4MTD A;  3KP5 A;  3IH3 A;  4PSW A;  3HIF A;  4HLX A;  3S2H J;  2UXX A;  4ITV A;  3PO2 J;  4FAS D;  1Z7L A;  1JJ6 C;  3A0B C;  1NK3 P;  2EIN H;  3N05 A;  5CQE A;  1IC8 A;  1FNN A;  4XOR A;  3OSF A;  2QEX I;  1M1E B;  3E1S A;  4ESJ A;  1IN6 A;  5GPC A;  3VDX A;  2LTP A;  2W85 A;  5CJ9 A;  3TO7 A;  1TBX A;  1YIO A;  4RAG A;  3LSI A;  3HL2 A;  2KFD A;  3DTE A;  4FQG A;  2ZXH A;  2JVG A;  5D5X B;  4GRI A;  2ZME B;  4QTR A;  1H9T A;  2KL4 A;  1T6S A;  2LH9 A;  2RAE A;  2JJ7 A;  4LG0 A;  1ONV A;  4GO1 A;  1YJW I;  2XAQ A;  4A69 C;  3SFZ A;  5F0F A;  1U78 A;  3SZP A;  4F3Q A;  5ILU A;  4RAY A;  2P8T A;  2M4K A;  4XRF A;  2IT0 A;  3QU6 A;  3IWZ A;  3AKZ A;  2NAZ A;  2XB5 A;  5E3O A;  1MBE A;  1NHA A;  2HDW A;  4E70 A;  2JN6 A;  2OUM A;  1R58 A;  4ESF A;  5F1J A;  5K7Z A;  1VQ9 I;  1JKQ C;  3R60 A;  2KMU A;  4QIW N;  1U5T A;  3LSR A;  1X3W B;  2ZXW H;  4UVC A;  5GTI C;  3OIP A;  4D7M A;  4II3 A;  3HRT A;  1X1C A;  2XGD A;  1U9O A;  4D7N A;  1RKT A;  3GTP J;  5F0C A;  2JPB A;  4ESB A;  3CMA I;  1IGN A;  2JUC A;  3HTU A;  4CCL A;  1G3W A;  4BE0 A;  3GME A;  3HOS A;  3BR3 A;  1MJ9 A;  3QPT A;  3KYL A;  3T8T A;  2HZD A;  1ON1 A;  1R1T A;  3E3V A;  5B3S H;  1XGS A;  3S15 J;  3ZMZ A;  3K4J A;  4IHW A;  5AON A;  2V1U A;  4LB5 A;  3CCL I;  2R5Y B;  4LK1 F;  2DA3 A;  1X3U A;  3KP6 A;  3GYH X;  4YII A;  1DGR M;  3BCA A;  3M8E A;  2FQ4 A;  3K1M A;  2MH9 A;  2RN7 A;  2DOE A;  5JLX A;  2OZ6 A;  2FX0 A;  5D6F A;  5FGM A;  2K4B A;  1SVL A;  1XTA A;  1BR4 A;  3OYC A;  1TNS A;  4F91 B;  1G3S A;  2KZG A;  1F43 A;  2L4M A;  3JTG A;  3PO3 J;  1JHH A;  1TWF J;  2ELH A;  3BR6 A;  3NWS A;  3KZZ A;  4L9V A;  2LBF B;  1H0M A;  1A6I A;  4KN4 X;  4OAZ A;  4KIS A;  3OS0 A;  1TWC J;  3I5U A;  5IT9 K;  2VUM J;  3M7G A;  2KQR A;  3H5A A;  4AVZ A;  4NBQ A;  2CUE A;  2X6X A;  5CVJ A;  2ZJ2 A;  2TDX A;  3H35 A;  5HLT A;  3WTV C;  3HOU J;  3I55 I;  3QYB A;  2GA2 A;  2ZB9 A;  2HYJ A;  2EIL H;  4GYI A;  1K78 A;  2P4W A;  4EJV A;  2QBY A;  1RET A;  4ZDP A;  3A01 A;  2O7O A;  1S29 A;  5K5R A;  2VC1 A;  1WI9 A;  3F8N A;  1B59 A;  3BG6 A;  2DFE A;  4ZJZ A;  4DBR A;  3S3N A;  5IP9 J;  1F9N A;  2DTZ A;  2L9R A;  4HDV A;  1UST A;  1RKW A;  4A3C J;  1X58 A;  2A5W A;  2UZK A;  2Y2Z A;  4DYC A;  4L18 B;  2PMZ A;  1ZGA A;  1H88 C;  4XKV A;  4LB6 B;  3OR1 C;  1OR7 C;  5CPR B;  1POG A;  1XDS A;  3I71 A;  2Q0O A;  1ZRD A;  1AA7 A;  1Y1W J;  2EFN A;  3WTW C;  1U3E M;  1MBG A;  4N9H A;  3F21 A;  3CMY A;  3WU2 C;  2IGO A;  2AO9 A;  3K7A J;  1BW5 A;  1N77 A;  1GDT A;  1WGX A;  2CRG A;  2FSW A;  2DOF A;  4BJ5 C;  3FX3 A;  3DBL B;  1IRG A;  2Q8K A;  4O5V A;  4LG0 B;  1W7P D;  4EJW A;  2HXO A;  4A3F J;  1YOV B;  1MDM A;  3OYM A;  3DPT A;  2FOK A;  2M2E A;  1XGO A;  4HOB A;  3O2P E;  2FF4 A;  2R92 J;  3JCU C;  4OAY A;  4L9N A;  2V9P A;  2LMD A;  3PFI A;  3K10 A;  1KU2 A;  1XDU A;  4OIQ F;  2BW3 A;  4C3I J;  2VOD A;  3K4N A;  1IUF A;  5L3F A;  5J1Y A;  2NYX A;  1I1S A;  4XKW A;  3U1K A;  2R7Q A;  3I56 I;  3VOD A;  3R0J A;  3B73 A;  3JW4 A;  1YW8 A;  3DLL F;  3O8H A;  5ED4 A;  2QGU A;  1U5T B;  5EG0 B;  1HW1 A;  3C1D A;  3J7Y J;  3RDI A;  3OYH A;  2QF7 A;  5CVI A;  4YIR X;  2DQL A;  2FJ1 A;  4KNY A;  2ME0 A;  3CC7 I;  3KE2 A;  2FOW A;  2XRO A;  4E7Z A;  4M3B A;  4KIF A;  3FHN A;  1NG6 A;  1KU3 A;  2CJJ A;  1WRJ A;  4PDK A;  5BPD A;  1QHG A;  2CW7 A;  5A2Q K;  1WH7 A;  2XB0 X;  5KHD A;  4IXA A;  4LD5 A;  2L7Z A;  2ZBK A;  2WY7 Q;  3C2G A;  3CCM I;  1B72 A;  2A6T A;  1FYK A;  1XC5 A;  1WJ5 A;  5GAE J;  4HF1 A;  4HV6 A;  4P9F A;  4XIC A;  3ZMT A;  2NS0 A;  3SDB A;  3I58 A;  4Y3O A;  3OV8 A;  4CCO A;  2OJE D;  4PSX A;  3RTR A;  3AL0 B;  1JHF A;  5LHH A;  4NUB A;  2NS7 A;  1X2M A;  3EQL F;  4PJN A;  3OSG A;  4IL6 C;  2GLO A;  3G73 A;  5FLV A;  3H9Q A;  1QVT A;  4Z2Y A;  1YS7 A;  2XDV A;  3BTI A;  3HSF A;  3LSK A;  4BU2 A;  4K2E A;  2LKP A;  1D0Y A;  1U6G A;  2KP6 A;  1B4A A;  2P5K A;  4Q48 A;  1FOW A;  2AXT C;  2R7O A;  2LDU A;  1V55 H;  2W1O A;  1SD6 A;  2OC6 A;  3NWT A;  1W7P B;  2NS8 A;  4BXF A;  2LKX A;  4BNC A;  2EZK A;  4KIT B;  2VOP A;  2P6S A;  2QKL B;  2W57 A;  4CYC A;  5FRN A;  4A3B J;  2GXA A;  4BAC A;  1PP8 F;  1ETK A;  2PN6 A;  1UEL B;  2F4M B;  1D1A A;  5J4Y A;  1MMN A;  4G8X A;  2K85 A;  4A6D A;  5H20 A;  2X1E A;  2EB7 A;  2K9Q A;  1XCV A;  1XSD A;  1LFU P;  2CMP A;  2IS1 A;  3ABM H;  4R79 A;  5GPA A;  5J1R A;  5GAG J;  1WQ2 A;  1YW9 A;  2PJR A;  3BZK A;  2HVR A;  1GUU A;  3RKX A;  4M6V A;  2BYV E;  3HYI A;  1AWC A;  2VBZ A;  2JSP A;  2LVS A;  4ZH4 F;  1UMQ A;  2IA0 A;  1O3S A;  4G6T B;  2XUB A;  3TOB A;  3T8R A;  2CS3 A;  2LP0 A;  1R5I D;  2RV8 A;  4HZF A;  2HYF A;  1N75 A;  5DDG A;  3PNY A;  3K69 A;  1OFC X;  3CUO A;  2FNA A;  3LOC A;  3J7A Y;  4UHT A;  2OZU A;  2HXI A;  4A0Z A;  1MDM B;  1IN7 A;  2JSC A;  2NVY J;  4ZYG A;  1FOK A;  4BE2 A;  2Z3Y A;  1FPQ A;  2VC0 A;  3BCB A;  3PM1 A;  4G7O F;  4NQW A;  2XC7 A;  2VOO A;  2X51 A;  2R5Z A;  1J0R A;  3MD2 A;  2IA2 A;  5LHG A;  2OTL I;  1LB2 A;  4LLG F;  1HKT A;  2IP2 A;  3K70 C;  4XID A;  1J75 A;  3LL7 A;  2DW4 A;  2ZKZ A;  5LGT A;  1SMY F;  2Q2E A;  4AD9 A;  2X1C A;  5DD4 A;  2GIV A;  3TP3 A;  2EIJ H;  4ZDL A;  2XRN A;  1Z91 A;  3I4M J;  2QSH X;  2Y31 A;  3MZH A;  3DKW A;  2UUZ A;  3BY6 A;  3LSM A;  2VE9 A;  4HW0 A;  1IZ1 A;  2OF7 A;  4GGG A;  4V2F A;  2VQC A;  5E8I A;  4U87 A;  1ETX A;  2ZJP F;  1B72 B;  2DPU A;  3IV5 A;  2G7H A;  4XSZ F;  2VON A;  3DCF A;  4EVI A;  5F27 A;  3FK7 A;  5E17 F;  2HQA A;  4BHP A;  3JR9 A;  1V5F A;  4ENM A;  2L01 A;  4O6J A;  5EDN A;  3J7A O;  2XAS A;  5L3E A;  2EZH A;  3SJM A;  2WTE A;  3ROU A;  3W6J B;  1GV5 A;  3A02 A;  2WAF A;  1ENH A;  4IOA F;  1T39 A;  3CCJ I;  1XGN A;  3CDH A;  3CUQ A;  3GEZ A;  1ZAO A;  3GLX A;  3K4M A;  4J00 A;  1RR8 C;  2H27 A;  1OYI A;  5IOZ A;  1UZC A;  4WX9 A;  1MMG A;  3N4M A;  1FC3 A;  1XMK A;  3BP8 A;  2CV0 A;  3C18 A;  4PK4 A;  1Z67 A;  2X4H A;  4HX7 A;  2C6Y A;  2V1D A;  2IPQ X;  3B6C A;  4XN3 A;  2VJJ A;  5C44 J;  2FE3 A;  4KMF A;  2ICW G;  3CCS I;  2R0Q C;  3O6B B;  5J3L A;  4I99 C;  5M3F J;  2VT2 A;  4CZZ A;  1VQM I;  2QZ8 A;  2B63 J;  4G6D A;  3T5X A;  4RBO A;  2CQX A;  2NVX J;  1JKP C;  3PNV A;  9ANT A;  5J8F A;  3BZ6 A;  2Y48 A;  1YTY A;  5FRM A;  4DQ2 A;  3A03 A;  2RNG A;  2VE8 A;  3OIQ A;  5JLW A;  4HRI A;  4ZDO A;  4KIB A;  2IS6 A;  2PEX A;  2MA3 A;  1Z6R A;  3CCQ I;  3WGI A;  2ECB A;  2TRT A;  2A6E F;  4F92 B;  1K4T A;  4ZC3 A;  1Y8R B;  2H8W A;  2VBX A;  4MEX F;  4PGH A;  4ANJ A;  2DK5 A;  2I8D A;  5E1X A;  2DXI A;  2ZCW A;  3ERM A;  3EPZ A;  1VQ8 I;  2E1C A;  5GAH J;  4MNU A;  3S8P A;  4BHB A;  1MBK A;  1Z0X A;  2K5C A;  4KT6 A;  4XLC A;  2KRF A;  3OL3 A;  4M3G A;  4FCY A;  2XPV A;  3ZQ7 A;  2DA4 A;  3R4K A;  4NNJ A;  4BQN A;  2CG4 A;  2OAZ A;  1ZH5 A;  5F08 A;  3U2R A;  2VB6 A;  2DAO A;  4RM3 A;  3G1M A;  1R00 A;  2X1D A;  4ABZ A;  2ZNZ A;  3U9G A;  4UV9 A;  3K6G A;  3KX2 A;  3FXM A;  4RGS A;  1R22 A;  3PFY A;  1S72 I;  4NQW B;  3ABU A;  3CDL A;  5EEH A;  1FP2 A;  2BHY A;  2FA5 A;  4GCV A;  1HKQ A;  4M3E A;  4MEY F;  3A1Y A;  1DPU A;  3FXK A;  2ZJQ F;  2HVQ A;  4IRG A;  4A3K J;  3L2W A;  1HDP A;  1B9N A;  3WTZ A;  3CTA A;  3LWF A;  1GHC A;  3AAF A;  2Q1Z B;  2GAU A;  5FKM A;  2G0E A;  5J4V A;  2QYO A;  3SFI A;  1JT6 A;  4DW6 A;  1OCO H;  3LQR A;  2DU9 A;  3HGY A;  4X0G A;  1TNT A;  2L4A A;  2DA7 A;  2DFH A;  5J6X A;  1YJ9 I;  2LYC A;  1D5Y A;  3BZC A;  4ZTF A;  4AU7 A;  3CZ6 A;  3JAM K;  3CJR B;  2W00 A;  3CQZ J;  2KZV A;  2ZSI B;  1A5J A;  4FHT A;  3CO7 C;  5M5W J;  5FLX Z;  1ULY A;  3DPU A;  1MBH A;  4KIG A;  3BG3 A;  1BOB A;  2ELJ A;  1OLT A;  4U7D A;  5LRS A;  2CSO A;  3CP2 A;  5KNL A;  3S2W A;  3OYF A;  5H6R A;  1W36 C;  2HNH A;  2JRM A;  2XPU A;  3F72 A;  1S7E A;  1J2X A;  5IT3 A;  2KLO A;  5K5O A;  1B8I B;  2ZJR F;  3I54 A;  2DJI A;  1CGP A;  2ZME A;  5E20 A;  4E7K A;  1J9I A;  5DCM A;  3KP2 A;  4I09 A;  5JFR A;  3QYF A;  3ZQG A;  2O9L A;  3CF2 A;  2RRE A;  3CUQ B;  3GX4 X;  4HEA 2;  2LC2 A;  5CVR A;  4YFX F;  2KRC A;  3DKY A;  3JRE A;  3H9J A;  3T0Y A;  4EEF G;  2VJ4 A;  4M71 A;  5BS6 A;  1VQL I;  4MQV A;  3EET A;  4KMU X;  1R5H A;  3VYT B;  1JJ8 C;  2MLK A;  3WG7 H;  4CSW A;  5DCF A;  3KEY A;  1YHQ I;  4IKF A;  3KEQ A;  3H36 A;  1SAN A;  1LNW A;  3VSL A;  1XPX A;  1RIO H;  4RAZ A;  1K83 J;  2BXY A;  1SVO A;  1VI0 A;  1MIJ A;  4OIN F;  5IYB J;  2EK5 A;  5EZG A;  3CME I;  5EEG A;  4JQF A;  2ZFU A;  4L9T A;  2M7B A;  3HOV J;  3OIO A;  4Z6Y A;  1SD5 A;  2E5Z A;  3I59 B;  5F04 A;  2R7D A;  3IH4 A;  3GZ5 A;  3I3L A;  4X1E A; 
#chains in the Genus database with same CATH homology
 3AG4 H;  2EIM H;  2Y69 H;  2ZXW H;  5IY5 H;  3WG7 H;  3AG3 H;  1OCO H;  2EIL H;  2OCC H;  3ASN H;  2EIN H;  3AG1 H;  3AG2 H;  3ABM H;  2EIK H;  3X2Q H;  3ASO H;  1OCZ H;  1V55 H;  2EIJ H;  1V54 H;  1OCC H;  1OCR H;  2DYS H;  3ABK H;  3ABL H;  5B1A H;  5B3S H;  5B1B H;  2DYR H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...