2JQ7A

Model for thiostrepton binding to the ribosomal l11-rna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L11
publication title L11 Domain Rearrangement Upon Binding to RNA and Thiostrepton Studied by NMR Spectroscopy
pubmed doi rcsb
source organism Thermotoga maritima
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2jq7A02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2jq7A01
1VQMI 1YJ9I 4IOCF 3PIOF 3PIPF 1YIJI 3G4SI 3CCQI 2NXNB 5GAHJ 3CCRI 3CC4I 1QA6A 3CCVI 1HC8A 2OTJI 3CCJI 1YHQI 5GAGJ 1VQNI 3CJRB 4V19K 1MMSA 3CCLI 1VQ9I 3CJQB 3CF5F 1VQLI 1VQ4I 3CCUI 1YITI 3I56I 2K3FA 4IO9F 1YJWI 2E35A 5DM6F 1YI2I 5GAEJ 2JQ7A 1YJNI 5GADJ 3J7YJ 1ACIA 2E34A 1FOXA 2ZJQF 4IOAF 1VQPI 3CCMI 1Y39A 4UY8I 3CJTB 2ZJRF 1VQ7I 3CMAI 2OTLI 2FOWA 2H8WA 1S72I 1FOYA 5DM7F 2QEXI 3CD6I 1WIBA 3CCSI 3CC2I 1VQ5I 2E36A 3G6EI 3CMEI 5JVGF 3J7ZI 3I55I 1VQOI 3CJSB 3DLLF 3EGVB 1FOWA 1VQKI 3CCEI 1VQ8I 2QA4I 3CC7I 2ZJPF 3G71I 1VQ6I
chains in the Genus database with same CATH superfamily
3RKXA 1YQAA 3H3ZA 3SYTA 3T8TA 3CLQA 4EJUA 4CXFA 1NTCA 3CQZJ 2DA1A 2DU9A 4ZYEA 1G2HA 2KJBA 4P96A 3WGGA 1AHDP 1T0FC 1AKHA 2VQLA 3EPZA 4RLFA 2K4BA 1DGRM 2P4WA 3T1BA 4YIIA 4B3XA 1RKTA 4BDYA 1WH7A 3K69A 1MGTA 2VE8A 2VQCA 2M8GX 2XAFA 4BXUA 5CVUA 4KITB 1K61A 4HX8A 1JE8A 5H2FC 2GBYA 3L2WA 1R71A 4HX7A 2O7OA 1GDTA 3OSGA 3MKYB 5BPDA 1YRNB 2MFZA 3L2UA 3H0DA 3I54A 4OIPF 5AIPA 4HNTA 1XSVA 1FOKA 1TQMA 4AVPA 5GAGJ 4RLQA 2L2OA 4XNFA 5DCMA 1ULYA 1FLIA 1A5JA 1PJRA 4LLNA 2DBBA 4XKCA 3H9JA 1SFXA 1ZN2A 3KPHA 1RPWA 2QGUA 3S3MA 2WB1A 4BXXJ 1NG7A 1TP4A 1YITI 3KP5A 5K7ZA 1SFKA 3BR0A 2Y0SN 1FJLA 2L3DA 2CW7A 3BZ6A 4JX4A 2XV4S 3HHHA 3P9IA 1A35A 1FTTA 1YE9A 3JR9A 2LTPA 3IHUA 4U0VA 1MBJA 2WAFA 2QENA 4BS9A 1O4XA 3VEPA 5FKMA 1GVDA 1PUEE 3HOZJ 5GADJ 1RUNA 2PEXA 1Z6RA 4OOIA 1MZBA 2DLLA 1K79A 1FOXA 6PAXA 3F8MA 3I59B 3DBHB 3PUBA 2HPIA 2PN6A 1IRZA 4ENKA 2M45A 3ZMTA 2QSGX 5E3OA 3HOTA 1MIJA 3F8NA 3CDIA 1KU7A 4ESFA 1UFMA 4DIQA 3J80K 1UG0A 3QPHA 2OBPA 2V79A 3BG7A 3GWZA 5FJ8J 3OYDA 2IPQX 3E97A 4N0BA 2A3SA 4AIKA 3LA2A 2JMWA 2ZNYA 3FF5A 2I5UA 1HBXG 2JA5J 5FLXZ 3KZIC 3WU1B 2DOAA 3OIQA 4ZYAA 1MJAA 5FFXA 3I55I 2A6TA 2OAZA 3CUQA 1KYWA 2ZXIA 3DEWA 1J75A 2FJ1A 3W3CA 3ONQA 1FSEA 3OV8A 1ORKA 1WJAA 3TO9A 2W7NA 3HXLA 1B8IB 4LIVA 1KONA 5TGTA 4XLHA 2X1CA 1TWAJ 5F27A 2GOXB 4IEJA 2B9SA 4A6DA 2V1UA 1EV7A 1RUOA 3B02A 3OR1C 2M0MA 5KCMA 3OL4A 4DW6A 4U7DA 5CVRA 2W4SA 1OCCH 1Y1VJ 3E1SA 3OYKA 4X6AJ 3W2VA 2QQAA 2VBXA 4TV7A 1QRYA 2W82A 5GAHJ 4Y13A 1KU2A 3CCRI 3H3UA 1XDUA 1ERDA 2VJJA 1EH7A 1QZZA 1Z77A 3ZQIA 1D8JA 1WCMJ 5GTIC 4G7ZF 5LGUA 4YRVA 2BW3B 1LDDA 3SXYA 1TLHB 3I3LA 4V19K 1LDKB 3NEUA 1BR1A 3OWTA 2G7HA 1JTXA 1N25A 2GQQA 2YX4A 1J59A 4YFXF 3E3VA 1GLNA 3KEYA 4FE4A 2G9WA 3GTGJ 1SAUA 2UUZA 3JRGA 2ZBKA 3FXKA 2CGPA 4FE7A 5CPRB 3IH2A 1FIPA 4PFOA 4LJZF 4WF2A 4FTHA 2VN2A 2ECCA 4BQNA 5FRMA 1BJAA 2E5NA 2DO7A 5ILVA 3FXQA 2KKOA 2L9SA 3QQAA 1B72B 1QGPA 4B47A 4R79A 2LMDA 3RJPA 1E0EA 1BI3A 2V9PA 4ENNA 2R7FA 2PX9A 2P7CB 2O03A 2Q0OA 1HXDA 4I01A 3HYIA 4LOCA 1ETOA 2FQ3A 4PUSA 2BY0A 3WTYC 1X2MA 1XDSA 5D4SA 3JRHA 2VOPA 4LG3A 3TOAA 2G0EA 2P0WA 4F92B 3C18A 2L9NA 3H5RA 3OS2A 2OC6A 3PUFA 4HLXA 1W7PB 1S8NA 1IJWC 4DBRA 5FKLA 4DJAA 3BR1A 2LG4A 3H5NA 1RIOH 2LVSA 1ON1A 2BV6A 2D2WA 1EF4A 1HA8A 3GFLA 1WHUA 2EWNA 1QPIA 1UCRA 2XF7A 3S1QJ 1STZA 2FMYA 2CW8A 5F1RA 2M4KA 3ZGKA 3DTKA 3N4MA 3K6GA 1YRNA 1B4AA 2ELKA 1JI8A 3LA3A 3I71A 1NG6A 3TW7A 2IA0A 1KA8A 1XGNA 2GXAA 4YG2F 2R7ZJ 3E5XA 3R60A 3JRDA 2ZFWA 4IOCF 3JRFA 1Z21A 4X1EA 2LY2A 2X48A 1FY7A 4I99C 4OAYA 1J9IA 4ZYHA 5CYVA 1ENHA 1UHMA 4ESJA 3GX4X 2DA3A 2IVMA 1SEUA 2PJRB 2XGDA 3ZMZA 4RGUA 4A5NA 3HB9A 2JPBA 5DCFA 1SFUA 1R36A 3ISPA 3HPHA 3AL0C 2FBIA 3BG5A 3HOVJ 1BC8C 3UNGC 3KCCA 2XF6A 2FOKA 3FISA 3IKVA 4A0XA 3I59A 3BR3A 3KLOA 1WI3A 2VJIA 1RKWA 1MMDA 2W57A 2WV0A 2QSHX 4D5FA 4RA2A 2KIFA 2IS2A 1R9TJ 2KRFA 2I8DA 4B4CA 3OYAA 5FROA 3ERED 5J4VA 2KIMA 5D8LB 2XGCA 3QYBA 4XR6A 2K4JA 4AWXB 4YFNF 3LSIA 2CV0A 3OYEA 2VASA 4BQOA 2IBDA 1YI2I 1OR7A 4U87A 1I3AA 4BE2A 3WTSC 3H92A 3GTQJ 1M1EB 3FM3A 1KU3A 5J6XA 3MFKA 4ITVA 4QPOA 1TQPA 1OCTC 2VIXA 3A0BC 5ED4A 4KUMA 2KRHA 3RYRA 1X58A 1B9MA 2RDPA 2L4AA 1TT0A 4UUTA 4ANJA 5J8FA 1SD5A 3BY6A 3K4JA 2Y75A 2VKVA 4FX4A 1ODDA 2IXSA 4F7ZA 5E20A 4IZZA 2LP0A 1V5GA 2HYJA 4CH7A 2RQPA 2GIZA 2M0CA 1TQIA 1AU7A 4A69C 2KQRA 1TWCJ 1D5VA 2CW0F 5HLGA 1QHGA 2QKLB 1VZ0A 2NS8A 5ICEA 3CUQC 1MBGA 2CUZA 3J7ZI 3TEDA 4I6ZA 4PJ0C 1BOAA 2BY2A 4S05A 3BR5A 2EQRA 4RGRA 1BIBA 1BOBA 2LKPA 3CP8A 5IT9Z 2FA5A 3LMMA 1EKEA 1N77A 1QZEA 2L9VA 3QP6A 1IC8A 1I6HJ 2AQFA 1BIAA 2DDBA 3I4PA 1OLTA 2BW3A 4XK4A 3EUHC 4BACA 1XCBA 2GOMA 3GLXA 3T5XA 3E6CC 2LK2A 2ZXJA 3HC7A 4LK0F 3RPQA 3Q0VA 3DBLB 4CCLA 3ASOH 2MC3A 2XRNA 2EK5A 2Y0MA 1U0JA 4XRMA 4MEXF 1VF9A 3JTGA 2NYXA 2MH2A 1UB9A 4PJMA 1S5LC 2JVGA 4UVAA 2CUFA 2LFBA 3HRUA 1D0ZA 2HXOA 3S3OA 2DJIA 5KHDA 3M8EA 1PYVA 1MMGA 1RR7A 1FNNA 5JLXA 5EJCA 4A12A 1U2WA 3PO3J 1I1GA 2BEOA 1FBUA 4BE0A 1YLFA 3ZQ7A 2R7TA 5KAIC 1MMSA 3CCLI 3OR2C 1FEXA 4A6EA 1LPQA 4E7SA 2E2IJ 3CUOA 3RIRA 1W5SA 2CUEA 3BTCA 1I50J 4IX7A 3G1OA 2D1VA 1A36A 4CCNA 5IP9J 5DM6F 3KETA 3HUGA 3FMQA 3F21A 4UHTA 2XGXA 4CSWA 1P6RA 1T6SA 2VBWA 3KZZA 5FKKA 1ZAOA 2W84A 1OCRH 3LAJA 4L0ZB 1BI0A 5EEGA 4J01A 1W5TA 3ZOBA 2QWWA 3DBRB 1LVKA 1IRGA 4P1WA 2NOGA 3DWLE 4A3BJ 2R7DA 2IGNA 1Y39A 4WXDA 2B63J 4BBRJ 4JK1X 3VOEA 3BJ6A 1TWGJ 5EZGA 5D5UB 2EZHA 1GUUA 5LRRA 3MN2A 5B1BH 4ZDPA 5M5WJ 4I02A 2CQQA 3LSHA 3BT9A 5IOYA 2LH9A 3WTXC 1RNLA 4M9XA 2COBA 2ME6A 5HDKA 2XF5A 5M3MJ 5E1XA 2LY1A 1MH3A 2RC4A 3HGYA 5FLMJ 2LKXA 2DODA 2XUBA 2WC2A 2KDZA 2Z9OA 1CQTA 2IS6A 4OAZA 5AIQA 2PJRA 3M1CA 1VQOI 3A02A 2HYGD 3CDLA 4HNVA 4F3QA 1I3QJ 3OYIA 1TT5B 4WCGA 3JW4A 3JRBA 2QUFA 3F8BA 3CCEI 4G6TB 2Z5UA 3G73A 4A0YA 1TNSA 2ZJPF 5F04A 1Y8QB 2EIMH 3HRTA 2HFHA 1IXRC 2VBZA 4QSHA 1H8AC 1ON2A 4IXAA 5JHFA 3MAJA 4MEYF 2Z33A 5L3GA 3N05A 2HYFA 3EDPA 4LLGF 3KP6A 5FKOA 1LKXA 4RB3C 1GXQA 1P7JA 1ZR4A 1T2KA 3C3WA 2CRGA 1XMAA 2DTRA 5D6EA 1J09A 3OOUA 2IA2A 4RAFA 1WKMA 2P6SA 2DA5A 4S04A 3M8JA 2CSOA 3H1CA 4XN0A 3VSKA 1K7AA 4A3KJ 1EA3A 4P55A 1G4DA 3P9CA 2GWRA 3IRRA 2FE3A 3TKYA 3QU3A 5LLQA 4Z6YA 2E19A 1Z3XA 2QM3A 3CCVI 1YYVA 2DA6A 4F52A 5B1AH 1HC8A 3MKWB 5HLTA 1RZ4A 3CTAA 1RR8C 2ESHA 4GYIA 1K6OA 1E3HA 3P5JA 5BNGA 2H1LA 5HNFA 3RPUD 3A01B 1BC7C 2C6YA 2LREA 4UUVA 4L0YB 3K4KA 3IL2A 1D1BA 1X3WB 1IN5A 4XL9A 1JJ6C 1VQ9I 5L3DA 3DEEA 3NQOA 4DNCA 5E3NA 3U9GA 1V5FA 2NOJB 1WFXA 1ITYA 5JI6A 1J5YA 2HEOA 3LSKA 2X9DA 3HOYJ 2BE5F 2ZC2A 4FHTA 3FZVA 2HOSA 3GBGA 3DKWA 2VE9A 3CLOA 4I76A 4NQWB 2DFIA 3HIFA 4HAMA 2LF8A 1JKRC 4NNJA 3PQKA 3SZTA 2Z99A 4OMYA 2M2EA 2RREA 3LSJA 2X85A 1O7FA 4PK4A 3SJMA 1XPXA 2IJLA 2M30A 1G3TA 2H6CA 3GZ5A 4AIDA 3J7AY 4BKXA 1MDMB 3SZPA 4UY8I 3BZKA 3B73A 5CVJA 3L09A 3CJTB 2CH0A 1TZLA 4UUSB 1XMXA 1AA7A 4AIJA 4IHSA 4IJAA 1HW2A 1OYYA 2H8WA 3DTEA 2VKHA 3H9GA 4ZZDA 3RKYA 2GZWA 1DGWY 4DYQA 2Q2EB 2K9SA 1V4RA 1QZYA 1ZGAA 2WTEA 4GYGA 5EGOB 4CO8A 4WWCA 3SQNA 4RMNA 2OF7A 1T98A 1QO0D 3CJSB 3DLLF 2VPRA 4CYCB 2KISA 3V4GA 2OJED 4IHYA 2DQLA 1MH4A 2QKMB 4UB8C 3OIOA 1X4PA 2HVQA 3I0TA 1FSHA 3HKZN 2JZYA 3K1PA 3JAMK 2EFWA 4KMUX 3S1NJ 2PMZA 1SVMA 2JUGA 1OFCX 2L7FP 2EA4A 3S15J 3WTTC 2OU2A 3DTIA 1D5YA 3X2QH 2R0QC 4MHGA 2KIQA 1DQUA 3OYLA 2IT0A 3J81Z 3FK7A 4UV9A 3V7SA 1R7JA 4G6QA 2QCOA 5K5QA 2BY3A 1G6NA 2KP6A 2LF7A 2WAQN 1SVOA 2E1MC 2GM4A 1OCPA 4LB5A 3NRVA 1A6IA 2AQEA 4O6JA 2H6BA 4MNUA 1YS7A 3GZ6A 1VTNC 1H9GA 2JA7J 2LBFB 3GXOA 3HOSA 1HCRA 9ANTA 1X3UA 3RDIA 1IN8A 4NHJA 2Q1ZB 4O3MA 4GCVA 2Z3YA 3WU0A 5CJ9A 2EINH 2KLOA 3K4LA 3V42A 3CCUI 2NVYJ 3S17J 1LUJB 2RN7A 3NWSA 3OIPA 4LGWA 2LNBA 4CCJA 3EYIA 4H0EA 4EJOA 2HOAA 1T33A 4RB2C 4CDGA 2TCTA 3FK6A 1K4SA 4IHXA 2A69F 3DKXA 3S2DJ 4GRIA 2X6YA 3OYMA 1MBFA 1K78B 4II2A 2J5PA 2OCEA 3JSPA 1Q1HA 2VI6A 2Y48A 4FASD 4DBQA 2L9RA 1HKQA 1XX5A 2DMQA 2F6CA 2QVOA 1LE8B 1FPQA 2OA4A 2HVRA 1ZARA 2DK8A 2ZO4A 2KMUA 2MLGA 2QF7A 4B44A 4ZTJA 5J4YA 2CS3A 1R1TA 2D1HA 2L7ZA 3MD2A 3RQIA 1KQ9A 3BWGA 4JQFA 2XC7A 1JXSA 3ELKA 3IKTA 1W0TA 1HW1A 1R49A 2VOOA 2DW4A 4M72A 2E71A 5DS9A 2R7WA 1P4XA 2VL8A 3BCBA 2MD5A 1F43A 3TQNA 3PNVA 4I0BA 4HDVA 1POGA 2L4MA 3HG9A 2W1OA 4D0PA 1HSTA 2ZSHB 1D1CA 2L54A 4CUGA 4MO7A 3LSPA 3GTKJ 1OJLA 2KPMA 3LSRA 3OYCA 2JRTA 3PM1A 1ZRCA 2VODA 1IUYA 2K86A 4BEHA 4D5CA 3DPTA 3ECOA 1ETVA 4AIHA 4E7ZA 2L7MP 1DDNA 3WTUC 1O7LA 4EQQA 2F5EA 3A01A 1OCOH 2WAEA 4LFUA 4MQ9F 3WTWC 2HI3A 1L0OC 2GA1A 3BTIA 2PG4A 4UXNA 5K1YA 4M3EA 4IRHA 2V9VA 1FX7A 2EILH 3RI4A 3U1DA 3GO5A 1G59A 3QRFF 1QVTA 2VC1A 3RYPA 4P9FA 3MKLA 1O57A 3V7RA 2K9NA 4LD5A 4BY7J 1LVAA 3D5RC 5JLWA 4LITA 1IRFA 3WTVC 2QBYB 2M4GA 2XRLA 1U78A 4A2UA 1XGSA 2NRAC 1WI9A 1I5ZA 2XVCA 2E60A 1B1BA 2W85A 1IUFA 4U0YA 3V7CA 3CJNA 1XTAA 4XICA 1MDMA 4XLEA 5FD6A 3I4NJ 1YW8A 3KP3A 4FISA 2G7UA 3TDUC 1H0MA 3HOXJ 2DOFA 1U3EM 1ZGJA 4UB6C 2HVSA 2VPLA 1T8IA 2H94A 1QU3A 1OCZH 3BTJA 1JKOC 2R5YB 2L0KA 2XKOA 3KYCB 2DN0A 4BU2A 3TGNA 2Q2EA 3HTSB 3W6JB 3TDZC 2JJ7A 2V4JC 5EGOA 3D5LA 1FYKA 2O6GE 3J80Z 1USSA 2CU7A 4KN7X 4OU0A 3RSNA 1X19A 2EIKH 2KDOA 4KFCA 5E18F 3VB2A 5C4JJ 1DP7P 1WWXA 4LIUA 2JA2A 1T56A 4CYCA 1VQPI 5LEKA 3L2VA 2RNGA 1R4NB 1MW7A 4KIGA 3FWEA 1WH5A 1BJZA 2WV1A 3W2AA 3M3YJ 2IS4A 4UV8A 3L2RA 1ETQA 1XD7A 2W48A 4IF4A 1IDYA 3KP4A 2VC0A 4C30A 3KP2A 4IPAA 4Z2YA 1MJ9A 5F0FA 2JTVA 3ZR8X 3AG2H 4RAGA 4L5JA 3S3NA 4A3GJ 3CCSI 1IV6A 1RI7A 3WGIA 3CF2A 2WWYA 1WGXA 2HZTA 2O9LA 3I9V2 3K4BA 2PMHA 4PJJA 3HPGA 3FXJA 3FXRA 3E6DA 5FFZA 1EH6A 4CICA 1MD0A 3U2RA 2ZMEB 3TBIA 4F91B 4C9YA 3HZJA 2MABA 2E2JJ 3G71I 2BY1A 2LKSA 4HSTA 3BCAA 5LHHA 1WVRA 2JPCA 4ZZLA 2F4IA 4G94A 3BJOA 2P5LC 2LBFA 5A2QK 3Q3SA 1D3YA 2K9MA 4PGGA 1ZG1A 1FZPB 5ILSA 4Y4RA 1I1SA 2BYVE 3GTLJ 1MJBA 5ILUA 2YU3A 2YPRA 3LOCA 1R4MB 2RVCA 3TOBA 2LYCA 1U5TC 3ZQHA 2KZVA 2JK3A 4DYRA 2L5QA 2EIJH 1Z9CA 1JHFA 1EJ9A 4XLCA 3FXLA 3SHFA 4XQFA 3HSFA 3IAM2 4GGGA 1EH8A 3OYBA 1QBJA 2OTJI 4PFPA 1Y56A 1U9OA 1K78A 1X1BA 1HKTA 5K5OA 3GMEA 1WZ2A 2IEKA 2IRFG 1TC3C 5HS9A 2DDAA 5E3MA 3CJRB 2F48A 1VI0A 2EJRA 2XGEA 3OOPA 5ICCA 4YIRX 4XONA 3S1MJ 4A0ZA 1LE8A 3G2BA 5D4RA 5L3FA 1BA5A 4L18B 5L3CA 1VQ4I 4ZC3A 2EFOA 3C1DA 4MIMA 3ABMH 3KYDB 1A04A 3GLLA 3DF8A 4RS8A 4BXFA 3OYFA 1LQ1A 5FKNA 1SD7A 2HOTA 4M74A 4B3AA 1WPKA 2Y2ZA 2M34A 1SC7A 5IP7J 3F72A 4HYEA 2MC4A 2L02A 2ECBA 3TO6A 3AKZA 1ZLKA 2BVLA 4IOAF 1SFEA 2FNPA 1FTZA 4QPQA 3BG6A 1ZH5A 1ETXA 2DYSH 3CCMI 2ELJA 4RGSA 2E1NA 3VPRA 1Z6TA 2CQXA 1Z91A 3MEXA 2BZTA 3VODA 2CO5A 2ZJRF 4DGWB 3QU6A 1SMTA 1VFCA 5E1WA 3HSRA 1LDJA 3IH3A 2X1EA 4G6DA 5FGMA 3GW2A 5LHIA 2HXIA 3SEZA 1WIBA 2DAOA 3S32A 2E5ZA 3PL8A 3L1PA 3HOUJ 2DFEA 2ELHA 2A6EF 2JSCA 2O8KA 4Y3OA 4IL6C 1H88C 5F64A 2FEZA 1K83J 1V5EA 2P7VB 3FHNA 2HDCA 1TW3A 4B48A 3H36A 2N8GA 3CC7I 1B8IA 3GFJA 1BI2A 5EDNA 3NWTA 3D1NI 2KRCA 1MNMC 1I6XA 2DA4A 3AG1H 2VXZA 3ZQFA 3M4OJ 3IWFA 4AD9A 1FMWA 2WAQA 4E6KG 3PIPF 1WJBA 2DXIA 1J2XA 1YW7A 3S2WA 3OL3A 3DEUA 1YIJI 3OY9A 3CCQI 2DTZA 2HGCA 2J5OA 3H35A 1Q1VA 4M9ZA 4CZZA 1DP3A 2X6WA 3GTOJ 2AXLA 4I98B 3CDHA 3PSIA 3WHBA 1RETA 2A5WA 1XGMA 4MFDA 4RBOA 1E17A 1QA6A 4F55A 4HF2A 1ETWA 2WB1N 3TP3A 4FX0A 3H5AA 2B7EA 5EG0B 1MBHA 4K2EA 4M9SA 3ZQGA 1L3LA 4AYBN 3W6KB 2V1XA 4C2UA 3QODA 3KX2A 2HS5A 4XSZF 1Y0NA 4XRSA 4B09A 2W00A 5E8IA 3G1LA 4JX6A 2R4GA 2VKEA 1TL8A 4NC7A 1JTYA 3ZQCA 3M8FA 4BNCA 2AXTC 3CCYA 1DU6A 4A3DJ 4MQVA 2VBYA 4BHBA 1ONVA 2KL4A 2P81A 1B72A 3W6VA 3I4MJ 3K1NA 2PI0A 1PVEA 3J7YJ 3HRSA 2Y0SA 3SDGA 1ACIA 5CVVA 2ZMEA 5DD8A 4S0HB 2ZSIB 1D0XA 1O3QA 2Y9ZA 4MTEA 4A3EJ 3GVAA 2QQ9A 2LDUA 1BI1A 4U0WA 4BQQA 3BROA 1VQ7I 3C7JA 2F5FA 4M73A 1W7PA 3RPUA 4I7HA 2HDDA 1UAAA 4G7OF 2CV1A 3HL2A 2CFXA 1JGGA 2A61A 4C3HJ 3GUDA 3ZXSA 2M3AA 4BHCA 1HW5A 3JRAA 2RGVA 4CZCA 2FBKA 2ZXHA 2UXXA 3DU6A 3K10A 2ADUA 5JVGF 1I27A 2HKOA 5E1ZB 1T0FA 2CWEA 1JGSA 2OCCH 3K0LA 1W5CC 3R4KA 3ZN0A 2IAIA 3L9FA 1G3WA 2EV5A 2LR8A 2L7KA 4Q47A 3ZQLA 1VQ8I 3UR3C 4MFEA 4YEJA 3HHGA 3HRMA 4OIOF 4PGHA 2XPVA 2K27A 4YELA 1TW2A 3MZYA 1PUFB 4XKVA 5LRSA 3DFGA 2GXBA 3R61A 1W36C 3QYFA 4H4KC 3FXUA 2DT6A 2OQRA 4BYYA 1FC3A 1OISA 2K40A 4Y7NJ 3BDDA 3V8JA 2JVHA 4O5VA 3E0JB 3IV5A 4CYDA 2BOLA 2VJ5A 3S1RJ 4EV0A 4HA8A 1Z05A 5CQGA 4BJ6C 4E7LA 1P4AA 2F5VA 5BOXA 3FMSA 2NVXJ 5DUKA 2E1CA 4RB1A 3U21A 4C3IJ 1IXSB 2Z16A 3G3ZA 3KEOA 4BL0B 2EFQA 4FETA 4HEA2 3AL0B 3CESA 3PSFA 2PFBA 2VXDA 3EYYA 3EQLF 4D7MA 4W97A 5DCMB 1FP1D 1P92A 1HLVA 2ZB9A 5BMZA 4KT5C 4IQ4A 5DYMA 4EJWA 1N75A 3ZRGA 1YJWI 2X0LA 3U1KA 1JKQC 1XCVA 2QZ8A 2XASA 5B66C 1HKSA 5DDGA 3ZP5A 5FB2A 3PQJA 3RZOJ 3BLYA 2BVMA 3KFWX 1JUPA 3E6MA 3DV8A 2YR2A 4A3FJ 3PFYA 1FBQA 4DZPA 4QIWN 5LHGA 2K85A 4XKBA 2YUSA 4NDLA 3F8CA 3R6SA 2DCEA 4W1UA 3KIOA 1ZGWA 1GT0C 4CA0A 1Y0UA 4RAYA 2MYSA 4LG0B 4L9VA 1XSDA 5IY5H 2V6CA 1IN6A 3CO7C 1S3JA 3VYRB 4DOZA 2EV6A 1W0UA 1OR7C 5DEQA 1H9TA 2F4MB 5DM7F 4AVZA 3L2CA 1YO5C 1JUSA 1R1VA 2MA3A 5HS7A 4ZH4F 2R7UA 2ME0A 1GV5A 2VJ4A 3JSOA 2H1KA 4HG2A 3I64A 3FDYA 3O8HA 1E3PA 1WJCA 3FHZA 3C2BA 2QQ8A 5HNHA 3S8PA 1FOWA 3I58A 1S6LA 1LFPA 3CUQB 3BPXA 4L9JA 4V2GA 2K7LA 2MD0A 3CP2A 1IN4A 5JR3A 1IF1A 5DTDA 1Y1WJ 2X6OA 5DV5A 5FO5A 2UZKA 1WRJA 3I5UA 4NC8A 4RB0A 3OYGA 3F23A 4XLAA 1UHWA 1U8BA 3K70C 5BQTA 4HV6A 1F36A 4PDKA 2VT3A 3PIOF 3T8RA 4UVCA 1NK2P 2R92J 5F0CA 5TRDA 1R5GA 2K9QA 1IGNA 1IW7F 4BJTA 5M5XJ 2JA6J 1R00A 5F6FA 3ULQB 4D1QA 5CQEA 4B43A 3F6OA 1ZQ3P 2DPDA 3K1MA 1F5TA 2DMTA 2ZCWA 5D5WB 3QOEA 1NHAA 1HOMA 3F22A 5K7HA 4A93J 2XB5A 1T95A 1UJ8A 4KN4X 1D8KA 3CF5F 1Z0XA 1IG7A 5L3EA 2A05A 1YOVB 3RTRA 1UMQA 5FRNA 5B5EC 2CG4A 2H27A 2UWMA 2AS5F 2DA7A 2OZUA 5TJJA 4A3IJ 2IGKA 3GTJJ 2VQHA 3BPVA 2X51A 3LL7A 1SANA 5D5VB 2LLKA 5HS8A 1YJNI 2CQ7A 4BH9A 3MZ8A 2OZ6A 2MG4A 5EEAA 1LEBA 1ZK8A 2PJPA 2LSOA 1UZCA 2FU4A 2BBYA 1B6AA 3DPLC 2TDXA 3VYUB 3GYHX 2STWA 1XMKA 1KQ8A 1O3TA 3LSGA 3S2HJ 3IWZA 2RKHA 3QPLA 2DMNA 3ZQQA 4XLNF 3MMYB 4HZFA 2RV8A 2BHZA 1PUFA 3CMAI 3ZCOA 5J1UA 1HDPA 1MKMA 4WX9A 3F3XA 4ON0A 2ZFUA 3DP7A 4M6YA 2LC2A 3M7GA 4MLOA 1IN7A 5IT3A 2UV1A 1WQ2A 3JAMZ 5JFRA 1VQ5I 1ZELA 1JKPC 4PZJA 2A6HF 1ETYA 2BHYA 2DI3A 3W2WA 3CMEI 3Q5FA 2NVTJ 3EETA 4F93B 3WE2A 1YS6A 2HDWA 4FQGA 4RM2A 1I39A 2EB7A 4EJVA 2XKPA 1BN5A 5J40A 3K2ZA 3JTHA 3BR6A 4D7NA 1CGPA 1KGSA 5FLXK 3IP4B 2M1BA 4OIRF 4XIDA 4KDPA 3BTLA 1G8XA 3E5UA 2MSYA 1SD4A 2YS9A 2ACJA 3BC8A 4OIQF 2BXYA 2O61A 2QQBA 2WADA 5KNLA 4MTDA 5LFAA 3H0GJ 4QTRA 1IZ1A 4CCKA 5CVIA 2HQAA 3AAFA 3ABUA 2KJCA 2DPUA 2Y31A 1LEAA 2DFFA 2W25A 2BGCA 5GPCA 2IGMA 1LJ9A 1IO2A 4IRIA 3O6BB 5D5XB 4AYBA 4C2MJ 2ISYA 3KLNA 1ZRDA 3DKYA 2Y30A 3QAHA 1APLC 2V26A 4A3CJ 2FMLA 2ID6A 2RQQA 3WU2C 2HQ5A 5J47A 2V6EA 1VQLI 4P5OA 4XOPA 1OYIA 1J7KA 4LG0A 2ZJ2A 4ABZA 1XGOA 1UG2A 1VNDA 2CFOA 3AG3H 4UNOA 2NNNA 4KYWA 4NQWA 1ZR2A 5LEJA 3DQVC 2DMUA 4XSXF 2QSFX 2A07F 3WE3A 4HSRA 2L01A 5GAEJ 1YG2A 2X4HA 3Q9VA 1DU0A 3K4MA 2XB0X 2JQ7A 1QNTA 3HBLA 5F08A 1TWHJ 2F4OB 4I2OA 3PO2J 4CCOA 2HU9A 2KZGA 2ZJQF 2XDVA 3PNTA 3LSMA 2M87A 3ZMSA 1Z3YA 2D5VA 4UUSA 3ABTA 3LQRA 4HRIA 5IYBJ 1FYLA 4E7JA 1OPCA 2RNJA 2FXAA 1JT0A 1DPRA 2ICWG 1R5ID 1P4WA 2DYRH 2YSRA 2EZLA 3MVPA 5J3LA 2XAJA 1WJDA 2P8TA 3EUHA 2WY7Q 2Z2SB 1S7OA 2MGQA 5M3FJ 4KIFA 3CD6I 2M7AA 2CYYA 2EZIA 3BR2A 4JX5A 2ZNZA 2E36A 3DU5A 3ZMUA 1BW5A 2JRMA 5IOZA 2STTA 2CV2A 2DT5A 2OQGA 1CF7B 3QYEA 5JHUA 3EGVB 3R0AA 2LY9A 5GP9A 3SDBA 1TTYA 1U9NA 4I0AA 2DJNA 2MBFA 3MQ0A 4ETSA 2QA4I 4ZYDA 2RAEA 2LOOA 1USTA 1X1AA 4L5IA 4KICA 1VQMI 2MLKA 4A5MA 4IQJA 4KJZA 2ETHA 2KHMA 3OS1A 3WODF 1YJ9I 2PLYA 1W1WE 1MMNA 1X2NA 3HEFA 2XIGA 5BS6A 4AM3A 1FWZA 2MH9A 2EH3A 3M9AA 2YX7A 3S14J 2HOEA 3OYJA 5M5YJ 1P2FA 4PJNA 2VLAA 5K5RA 2FX0A 4ZYGA 4B1RA 2KFDA 3JREA 1HQCA 1Y6IA 3O2PE 4RGXA 1MSEC 2I10A 2FQ4A 1ZREA 5ERIA 4NC6A 2K5CA 3K7AJ 3H9QA 4Y15A 5DUIA 2IGOA 2VUMJ 2WBMA 4BUPA 2P5KA 2XPWA 3BQYA 3LQQA 3Q0UA 3REOA 1KU9A 5E3LA 3CC4I 3E7LA 3A4CA 1IXCA 3D5SC 2E1MB 4N9HA 3VFZA 3QOPA 1ZYRF 1IDZA 1BM9A 3WHCA 5AONA 1YHQI 3M1EA 1S9HA 3TW6A 4KISA 1YFHA 2JA8J 2A68F 2HKXA 4BBSJ 4BE1A 2CQKA 5FLVA 2GXGA 1E3OC 5C44J 1X1PA 3J7AO 1HF0A 4P9UA 3ML6A 2NNYA 3DPUA 3ROUA 1ZLJA 4Y33A 3A0HC 1YTYA 3AFHA 2JSPA 3ZMDA 4HF1A 4IHVA 2FNAA 3FXMA 4IVNA 2B0LA 2DA2A 2FF4A 3HUGB 2Y69H 4C2TA 4HQEA 4D9JA 2R5ZB 4LK1F 1KQ0A 3DCFA 2QYOA 4EMSA 1AOYA 3SFIA 3K4NA 4ZTFA 3Q9SA 3ERMA 2Q8KA 4JOMA 2JUCA 5K7FA 3CMMA 1F1ZA 1MMAA 2DK5A 4HQMA 3TP0A 1LFUP 1ZHFA 3RKQA 3FKJA 4RM3A 1T08B 4E7IA 5H20A 3WTZA 3GFMA 2MW8A 2CJJA 3FXOA 1FIAA 1S72I 1T39A 1OYWA 1X3ZB 1PP8F 3GTMJ 1SVLA 2OV7A 3A03A 1WJ5A 3LWFA 4G9YA 4ZDOA 3SZGA 4IRGA 5A2QZ 1MSFC 4ZDLA 4XN3A 2PMZN 2JT1A 4E4HA 1FMVA 4ASNA 2K9LA 2X6XA 2HPMA 5D8KB 2FBHA 3MCZA 1O3RA 2IA1A 3HDDA 1YIOA 4XBFA 3WG7H 2K02A 3BZCA 4BQAA 4LMYA 2KIUA 3E6BA 5HDGA 5CKTA 4PJLA 3IC7A 4IHWA 2XHKA 4DYCA 4U7BA 2M5WA 4R1HA 2LD5A 1IAWA 2WA0A 1S29A 1PP7U 2DOEA 1LB2A 2H09A 1TWFJ 1BR4A 3HKZA 5IT9K 2GAUA 1UHSA 4EM2A 4GO1A 4AUXA 2ESNA 3KYLA 1SFOJ 2XAGA 3S16J 3EUAA 3ASNH 3HSEA 2IP2A 2CQNA 4DZJA 3FMRA 1H89C 4NUBA 3JCUC 4U88A 4J19A 2QBYA 4XLFA 3PJRA 1Y8RB 4B8XA 5L3BA 3LA7A 5H6RA 3KE2A 4A3MJ 1X1DA 3HOWJ 1WJFA 5LGTA 4WXCA 2H8RA 1KZHA 3AG4H 3GZNB 3TO7A 4BJ5C 5JVTA 2XROA 4Q4ZF 1B9NA 2NS0A 3UKGA 4Q48A 3IAS2 3L2QA 3CJQB 3O3KA 2FD5A 1W36D 4C3JJ 1E2XA 3Q0WA 3HJEA 3PNYA 1R1UA 4KT6A 1BR2A 3RCOA 3I56I 2R5YA 4IO9F 3MZHA 2R93J 4X0GA 2O8XA 2F2EA 2P6TA 3K4CA 5EZHA 1B59A 2COMA 2M7BA 3RQ4A 3ZMVA 4KMFA 2R7SA 5GTHC 1QHHD 4XORA 5TISC 1GXPA 1G3SA 4OWRB 3BJAA 4YIFA 2O0YA 5LGNA 1S7EA 3OYHA 2V1DA 3I53A 1JJ8C 3PFIA 4A3JJ 1GVJA 2ZXWH 4JYKA 1CF7A 2EZKA 4GFBA 4XKWA 5HLHA 2FUG2 3L7WA 2W24A 2V9KA 4M71A 1ETKA 2JWTA 4II3A 2EV0A 1ZG5A 1F4KA 1R58A 1SAXA 3HGGA 2QLZA 3V8LA 1MBKA 1Z1DA 4M3DA 3VSLA 1FYMA 4KA4A 2QEXI 5CLSA 5FD5A 3IH4A 3CC2I 1A6QA 3GCMA 3JRCA 3CMYA 2GIVA 5IYDJ 2EFPA 4L9TA 3BQZA 4WXHA 4ENMA 4M3BA 3F0CA 5KAFC 5HVQC 4Q5SF 3WGHA 1NK3P 3BOQA 3OYNA 4HPQA 3FIWA 1VQKI 1U6GA 1X1CA 2HQRA 5E17F 3G1MA 3NARA 3QP5A 1R6RA 2KT0A 2O5RA 3CZ6A 1QVUA 1BBYA 2AHQA 3FBNB 5IP6A 2P5VA 2PMUA 4RDUA 2D45A 2R7QA 4M6VA 4M3FA 5LD2C 2YU9J 1DUXC 1LNWA 4E7KA 2V7FA 1IV8A 1DPUA 2E7XA 3R0JA 3JRIA 3RKWA 3HM5A 1FBSA 1V55H 1JHHA 2HWVA 2NVQJ 2FRHA 4KIBA 1GV2A 2NXNB 1WJEA 3ESWB 1ZTRA 1OMIA 3VYTB 5C4XJ 3RZDJ 3KP7A 1U5TB 2R3SA 3S93A 1REPC 3A2KA 2R5ZA 3CCJI 3NAUA 4BY1J 4ESBA 4HX4A 4LLLA 4XLPF 1Z7UA 2R7VA 4IKFA 4HBLA 2FSWA 4QLCU 4HW0A 1JT6A 3GEZA 3K70D 4JBAA 1AKHB 4M3GA 4N4NB 3QPSA 4QWQA 2DT7B 4FCYA 3F9KA 2E1OA 4EGYA 2E35A 1ZRFA 1Z7LA 3K2AA 4E70A 1KYZA 3COAC 4JP0A 5KVRA 4NBQA 3IUOA 4HNUA 4XRFA 1ZKGA 4XRSG 4V2FA 2HQNA 1ZG3A 2HTJA 2E34A 3LSTA 1O3SA 2VQGA 2X1DA 1P9QC 5HOOA 3LNQA 2XAUA 2HTSA 1XG1A 4XOTA 4IHTA 3C2HA 1YW9A 4UVBA 4EEFG 4LB6B 2DFHA 5EEHA 1YX5A 5ICGA 3WG9A 3GFIA 1J0RA 1TNTA 1FT9A 2PQ8A 4I09A 4OINF 2NVUB 5B3SH 2F5DA 3P7NA 1HDDC 3EUKL 4G7HF 3V8KA 1OKRA 1YX3A 3QWLA 4L5EA 5DD4A 3MKZA 4HOBA 3BG9A 2OD5A 2BXZA 1GHCA 2OUMA 4ENJA 5BPIA 1RRJA 2TRTA 1FP2A 5GPAA 3G6EI 1C0WA 4RAZA 5HODA 4NB5A 1JUMA 3ZPLA 3B6AA 2R7RA 2M8EA 2DMPA 3DXJF 3OS0A 1WSUA 5H6QA 5E8GA 4HDUA 1R5HA 1BL0A 4YFKF 2HZDA 2GLOA 1D1AA 4BEHB 1VQ6I 1F9NA 4A3LJ 4R8HA 3F6VA 1OQYA 2XSJC 4PSXA 4EGZA 1P7IA 3FM5A 4Y52J 1W7PD 4HLYA 4CHUA 2WY8Q 4BGDA 4CGZA 5KK1A 3BG3A 3P9KA 1XN7A 3FKIJ 4XM3A 4AU7A 4EM0B 4N9IA 3KZYA 2E2HJ 3LAPA 1XB4A 1K6YA 3G4SI 1RC9A 1V54H 1T38A 1BW6A 3E5QA 2EPFA 2XPUA 2CUJA 1QPMA 5IPAA 1AWCA 2EA2A 4G8XA 3MWMA 2NAZA 3F8FA 3VYSB 1K4TA 4N4OB 2AO9A 1U8RA 3B6CA 1D0YA 5EG0A 2DQRA 3LFKA 3GTPJ 4G12A 5C3EJ 5F0HA 1R22A 2A5YB 1PDNC 1VQNI 3TMOA 2CMPA 4BAYA 4AC0A 3J81K 5EYRA 3FX3A 2XAQA 3T0YA 1A31A 4OMZA 1MBEA 4HV5A 3L00A 1SD6A 5ICFA 5J1YA 3ABLH 2EBIA 3H3VK 3LFUA 3A1YA 3KEQA 2K3PA 4E7HA 1N78A 2R7XA 3SFZA 4EM1A 3VDXA 1SMYF 2K3FA 2O3FA 1XSXA 4FT8A 3SEQA 1X4OA 4GDFA 2HNHA 4EJTA 1MNEA 1S7AA 3HTUA 2XSDC 2ID3A 4L9NA 1R23A 2IS1A 2VKDA 3C2GA 3N97A 5IYCJ 1W4MA 2OPTA 4BHPA 3OMYA 2LRDA 1RESA 2IW5A 3CO6C 1XC5A 5F1JA 4J00A 4BDZA 1V3FA 2Z1DA 1G3YA 2EFNA 3TL4X 1Z67A 2JN6A 4XMYA 2E7WA 3O8GA 5EF6A 4HF0A 4KNYA 3D0SA 2VB6A 2M9HA 1QQIA 5J1RA 3K9TA 3ECHA 1UELB 4EVIA 1LFBA 2FOWA 2GA2A 2OTLI 4PCQA 2Y9YA 4M6XA 1FOYA 4MGRA 3IRQA 2NS7A 1TBXA 4WK8F 4EATA 2R7OA 2F5CA 1MNDA 3QPTA 4Y17A 4CCMA 5HLIA 2PBIA 2ZMEC 3FBIB 3DLAA 2ISZA 2VT2A 1NH3A 4GXOA 3BP8A 4PSWA 5LBQA 2V1NA 2VONA 3M07A 3OSFA 1IRXA 2UXNA 5E79C 3ABKH 4DQ2A 1HSJA 1XS9A 3ZN1A 2HR3A 3GF2A 1U5TA 5D6FA 2ZKZA 5HDNA 5J8CA 2XAHA 4ZJZA 3VWBA
chains in the Genus database with same CATH topology
1VQMI 1YJ9I 4IOCF 3PIOF 3PIPF 1YIJI 3G4SI 3CCQI 2NXNB 5GAHJ 3CCRI 3CC4I 1QA6A 3CCVI 1HC8A 2OTJI 3CCJI 1YHQI 5GAGJ 1VQNI 3CJRB 4V19K 1MMSA 3CCLI 1VQ9I 3CJQB 3CF5F 1VQLI 1VQ4I 3CCUI 1YITI 3I56I 2K3FA 4IO9F 1YJWI 2E35A 5DM6F 1YI2I 5GAEJ 2JQ7A 1YJNI 5GADJ 3J7YJ 1ACIA 2E34A 1FOXA 2ZJQF 4IOAF 1VQPI 3CCMI 1Y39A 4UY8I 3CJTB 2ZJRF 1VQ7I 3CMAI 2OTLI 2FOWA 2H8WA 1S72I 1FOYA 5DM7F 2QEXI 3CD6I 1WIBA 3CCSI 3CC2I 1VQ5I 2E36A 3G6EI 3CMEI 5JVGF 3J7ZI 3I55I 1VQOI 3CJSB 3DLLF 3EGVB 1FOWA 1VQKI 3CCEI 1VQ8I 2QA4I 3CC7I 2ZJPF 3G71I 1VQ6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM I;  1YJ9 I;  4IOC F;  3PIO F;  3PIP F;  1YIJ I;  3G4S I;  3CCQ I;  2NXN B;  5GAH J;  3CCR I;  3CC4 I;  1QA6 A;  3CCV I;  1HC8 A;  2OTJ I;  3CCJ I;  1YHQ I;  5GAG J;  1VQN I;  3CJR B;  4V19 K;  1MMS A;  3CCL I;  1VQ9 I;  3CJQ B;  3CF5 F;  1VQL I;  1VQ4 I;  3CCU I;  1YIT I;  3I56 I;  2K3F A;  4IO9 F;  1YJW I;  2E35 A;  5DM6 F;  1YI2 I;  5GAE J;  2JQ7 A;  1YJN I;  5GAD J;  3J7Y J;  1ACI A;  2E34 A;  1FOX A;  2ZJQ F;  4IOA F;  1VQP I;  3CCM I;  1Y39 A;  4UY8 I;  3CJT B;  2ZJR F;  1VQ7 I;  3CMA I;  2OTL I;  2FOW A;  2H8W A;  1S72 I;  1FOY A;  5DM7 F;  2QEX I;  3CD6 I;  1WIB A;  3CCS I;  3CC2 I;  1VQ5 I;  2E36 A;  3G6E I;  3CME I;  5JVG F;  3J7Z I;  3I55 I;  1VQO I;  3CJS B;  3DLL F;  3EGV B;  1FOW A;  1VQK I;  3CCE I;  1VQ8 I;  2QA4 I;  3CC7 I;  2ZJP F;  3G71 I;  1VQ6 I; 
#chains in the Genus database with same CATH topology
 3RKX A;  1YQA A;  3H3Z A;  3SYT A;  3T8T A;  3CLQ A;  4EJU A;  4CXF A;  1NTC A;  3CQZ J;  2DA1 A;  2DU9 A;  4ZYE A;  1G2H A;  2KJB A;  4P96 A;  3WGG A;  1AHD P;  1T0F C;  1AKH A;  2VQL A;  3EPZ A;  4RLF A;  2K4B A;  1DGR M;  2P4W A;  3T1B A;  4YII A;  4B3X A;  1RKT A;  4BDY A;  1WH7 A;  3K69 A;  1MGT A;  2VE8 A;  2VQC A;  2M8G X;  2XAF A;  4BXU A;  5CVU A;  4KIT B;  1K61 A;  4HX8 A;  1JE8 A;  5H2F C;  2GBY A;  3L2W A;  1R71 A;  4HX7 A;  2O7O A;  1GDT A;  3OSG A;  3MKY B;  5BPD A;  1YRN B;  2MFZ A;  3L2U A;  3H0D A;  3I54 A;  4OIP F;  5AIP A;  4HNT A;  1XSV A;  1FOK A;  1TQM A;  4AVP A;  5GAG J;  4RLQ A;  2L2O A;  4XNF A;  5DCM A;  1ULY A;  1FLI A;  1A5J A;  1PJR A;  4LLN A;  2DBB A;  4XKC A;  3H9J A;  1SFX A;  1ZN2 A;  3KPH A;  1RPW A;  2QGU A;  3S3M A;  2WB1 A;  4BXX J;  1NG7 A;  1TP4 A;  1YIT I;  3KP5 A;  5K7Z A;  1SFK A;  3BR0 A;  2Y0S N;  1FJL A;  2L3D A;  2CW7 A;  3BZ6 A;  4JX4 A;  2XV4 S;  3HHH A;  3P9I A;  1A35 A;  1FTT A;  1YE9 A;  3JR9 A;  2LTP A;  3IHU A;  4U0V A;  1MBJ A;  2WAF A;  2QEN A;  4BS9 A;  1O4X A;  3VEP A;  5FKM A;  1GVD A;  1PUE E;  3HOZ J;  5GAD J;  1RUN A;  2PEX A;  1Z6R A;  4OOI A;  1MZB A;  2DLL A;  1K79 A;  1FOX A;  6PAX A;  3F8M A;  3I59 B;  3DBH B;  3PUB A;  2HPI A;  2PN6 A;  1IRZ A;  4ENK A;  2M45 A;  3ZMT A;  2QSG X;  5E3O A;  3HOT A;  1MIJ A;  3F8N A;  3CDI A;  1KU7 A;  4ESF A;  1UFM A;  4DIQ A;  3J80 K;  1UG0 A;  3QPH A;  2OBP A;  2V79 A;  3BG7 A;  3GWZ A;  5FJ8 J;  3OYD A;  2IPQ X;  3E97 A;  4N0B A;  2A3S A;  4AIK A;  3LA2 A;  2JMW A;  2ZNY A;  3FF5 A;  2I5U A;  1HBX G;  2JA5 J;  5FLX Z;  3KZI C;  3WU1 B;  2DOA A;  3OIQ A;  4ZYA A;  1MJA A;  5FFX A;  3I55 I;  2A6T A;  2OAZ A;  3CUQ A;  1KYW A;  2ZXI A;  3DEW A;  1J75 A;  2FJ1 A;  3W3C A;  3ONQ A;  1FSE A;  3OV8 A;  1ORK A;  1WJA A;  3TO9 A;  2W7N A;  3HXL A;  1B8I B;  4LIV A;  1KON A;  5TGT A;  4XLH A;  2X1C A;  1TWA J;  5F27 A;  2GOX B;  4IEJ A;  2B9S A;  4A6D A;  2V1U A;  1EV7 A;  1RUO A;  3B02 A;  3OR1 C;  2M0M A;  5KCM A;  3OL4 A;  4DW6 A;  4U7D A;  5CVR A;  2W4S A;  1OCC H;  1Y1V J;  3E1S A;  3OYK A;  4X6A J;  3W2V A;  2QQA A;  2VBX A;  4TV7 A;  1QRY A;  2W82 A;  5GAH J;  4Y13 A;  1KU2 A;  3CCR I;  3H3U A;  1XDU A;  1ERD A;  2VJJ A;  1EH7 A;  1QZZ A;  1Z77 A;  3ZQI A;  1D8J A;  1WCM J;  5GTI C;  4G7Z F;  5LGU A;  4YRV A;  2BW3 B;  1LDD A;  3SXY A;  1TLH B;  3I3L A;  4V19 K;  1LDK B;  3NEU A;  1BR1 A;  3OWT A;  2G7H A;  1JTX A;  1N25 A;  2GQQ A;  2YX4 A;  1J59 A;  4YFX F;  3E3V A;  1GLN A;  3KEY A;  4FE4 A;  2G9W A;  3GTG J;  1SAU A;  2UUZ A;  3JRG A;  2ZBK A;  3FXK A;  2CGP A;  4FE7 A;  5CPR B;  3IH2 A;  1FIP A;  4PFO A;  4LJZ F;  4WF2 A;  4FTH A;  2VN2 A;  2ECC A;  4BQN A;  5FRM A;  1BJA A;  2E5N A;  2DO7 A;  5ILV A;  3FXQ A;  2KKO A;  2L9S A;  3QQA A;  1B72 B;  1QGP A;  4B47 A;  4R79 A;  2LMD A;  3RJP A;  1E0E A;  1BI3 A;  2V9P A;  4ENN A;  2R7F A;  2PX9 A;  2P7C B;  2O03 A;  2Q0O A;  1HXD A;  4I01 A;  3HYI A;  4LOC A;  1ETO A;  2FQ3 A;  4PUS A;  2BY0 A;  3WTY C;  1X2M A;  1XDS A;  5D4S A;  3JRH A;  2VOP A;  4LG3 A;  3TOA A;  2G0E A;  2P0W A;  4F92 B;  3C18 A;  2L9N A;  3H5R A;  3OS2 A;  2OC6 A;  3PUF A;  4HLX A;  1W7P B;  1S8N A;  1IJW C;  4DBR A;  5FKL A;  4DJA A;  3BR1 A;  2LG4 A;  3H5N A;  1RIO H;  2LVS A;  1ON1 A;  2BV6 A;  2D2W A;  1EF4 A;  1HA8 A;  3GFL A;  1WHU A;  2EWN A;  1QPI A;  1UCR A;  2XF7 A;  3S1Q J;  1STZ A;  2FMY A;  2CW8 A;  5F1R A;  2M4K A;  3ZGK A;  3DTK A;  3N4M A;  3K6G A;  1YRN A;  1B4A A;  2ELK A;  1JI8 A;  3LA3 A;  3I71 A;  1NG6 A;  3TW7 A;  2IA0 A;  1KA8 A;  1XGN A;  2GXA A;  4YG2 F;  2R7Z J;  3E5X A;  3R60 A;  3JRD A;  2ZFW A;  4IOC F;  3JRF A;  1Z21 A;  4X1E A;  2LY2 A;  2X48 A;  1FY7 A;  4I99 C;  4OAY A;  1J9I A;  4ZYH A;  5CYV A;  1ENH A;  1UHM A;  4ESJ A;  3GX4 X;  2DA3 A;  2IVM A;  1SEU A;  2PJR B;  2XGD A;  3ZMZ A;  4RGU A;  4A5N A;  3HB9 A;  2JPB A;  5DCF A;  1SFU A;  1R36 A;  3ISP A;  3HPH A;  3AL0 C;  2FBI A;  3BG5 A;  3HOV J;  1BC8 C;  3UNG C;  3KCC A;  2XF6 A;  2FOK A;  3FIS A;  3IKV A;  4A0X A;  3I59 A;  3BR3 A;  3KLO A;  1WI3 A;  2VJI A;  1RKW A;  1MMD A;  2W57 A;  2WV0 A;  2QSH X;  4D5F A;  4RA2 A;  2KIF A;  2IS2 A;  1R9T J;  2KRF A;  2I8D A;  4B4C A;  3OYA A;  5FRO A;  3ERE D;  5J4V A;  2KIM A;  5D8L B;  2XGC A;  3QYB A;  4XR6 A;  2K4J A;  4AWX B;  4YFN F;  3LSI A;  2CV0 A;  3OYE A;  2VAS A;  4BQO A;  2IBD A;  1YI2 I;  1OR7 A;  4U87 A;  1I3A A;  4BE2 A;  3WTS C;  3H92 A;  3GTQ J;  1M1E B;  3FM3 A;  1KU3 A;  5J6X A;  3MFK A;  4ITV A;  4QPO A;  1TQP A;  1OCT C;  2VIX A;  3A0B C;  5ED4 A;  4KUM A;  2KRH A;  3RYR A;  1X58 A;  1B9M A;  2RDP A;  2L4A A;  1TT0 A;  4UUT A;  4ANJ A;  5J8F A;  1SD5 A;  3BY6 A;  3K4J A;  2Y75 A;  2VKV A;  4FX4 A;  1ODD A;  2IXS A;  4F7Z A;  5E20 A;  4IZZ A;  2LP0 A;  1V5G A;  2HYJ A;  4CH7 A;  2RQP A;  2GIZ A;  2M0C A;  1TQI A;  1AU7 A;  4A69 C;  2KQR A;  1TWC J;  1D5V A;  2CW0 F;  5HLG A;  1QHG A;  2QKL B;  1VZ0 A;  2NS8 A;  5ICE A;  3CUQ C;  1MBG A;  2CUZ A;  3J7Z I;  3TED A;  4I6Z A;  4PJ0 C;  1BOA A;  2BY2 A;  4S05 A;  3BR5 A;  2EQR A;  4RGR A;  1BIB A;  1BOB A;  2LKP A;  3CP8 A;  5IT9 Z;  2FA5 A;  3LMM A;  1EKE A;  1N77 A;  1QZE A;  2L9V A;  3QP6 A;  1IC8 A;  1I6H J;  2AQF A;  1BIA A;  2DDB A;  3I4P A;  1OLT A;  2BW3 A;  4XK4 A;  3EUH C;  4BAC A;  1XCB A;  2GOM A;  3GLX A;  3T5X A;  3E6C C;  2LK2 A;  2ZXJ A;  3HC7 A;  4LK0 F;  3RPQ A;  3Q0V A;  3DBL B;  4CCL A;  3ASO H;  2MC3 A;  2XRN A;  2EK5 A;  2Y0M A;  1U0J A;  4XRM A;  4MEX F;  1VF9 A;  3JTG A;  2NYX A;  2MH2 A;  1UB9 A;  4PJM A;  1S5L C;  2JVG A;  4UVA A;  2CUF A;  2LFB A;  3HRU A;  1D0Z A;  2HXO A;  3S3O A;  2DJI A;  5KHD A;  3M8E A;  1PYV A;  1MMG A;  1RR7 A;  1FNN A;  5JLX A;  5EJC A;  4A12 A;  1U2W A;  3PO3 J;  1I1G A;  2BEO A;  1FBU A;  4BE0 A;  1YLF A;  3ZQ7 A;  2R7T A;  5KAI C;  1MMS A;  3CCL I;  3OR2 C;  1FEX A;  4A6E A;  1LPQ A;  4E7S A;  2E2I J;  3CUO A;  3RIR A;  1W5S A;  2CUE A;  3BTC A;  1I50 J;  4IX7 A;  3G1O A;  2D1V A;  1A36 A;  4CCN A;  5IP9 J;  5DM6 F;  3KET A;  3HUG A;  3FMQ A;  3F21 A;  4UHT A;  2XGX A;  4CSW A;  1P6R A;  1T6S A;  2VBW A;  3KZZ A;  5FKK A;  1ZAO A;  2W84 A;  1OCR H;  3LAJ A;  4L0Z B;  1BI0 A;  5EEG A;  4J01 A;  1W5T A;  3ZOB A;  2QWW A;  3DBR B;  1LVK A;  1IRG A;  4P1W A;  2NOG A;  3DWL E;  4A3B J;  2R7D A;  2IGN A;  1Y39 A;  4WXD A;  2B63 J;  4BBR J;  4JK1 X;  3VOE A;  3BJ6 A;  1TWG J;  5EZG A;  5D5U B;  2EZH A;  1GUU A;  5LRR A;  3MN2 A;  5B1B H;  4ZDP A;  5M5W J;  4I02 A;  2CQQ A;  3LSH A;  3BT9 A;  5IOY A;  2LH9 A;  3WTX C;  1RNL A;  4M9X A;  2COB A;  2ME6 A;  5HDK A;  2XF5 A;  5M3M J;  5E1X A;  2LY1 A;  1MH3 A;  2RC4 A;  3HGY A;  5FLM J;  2LKX A;  2DOD A;  2XUB A;  2WC2 A;  2KDZ A;  2Z9O A;  1CQT A;  2IS6 A;  4OAZ A;  5AIQ A;  2PJR A;  3M1C A;  1VQO I;  3A02 A;  2HYG D;  3CDL A;  4HNV A;  4F3Q A;  1I3Q J;  3OYI A;  1TT5 B;  4WCG A;  3JW4 A;  3JRB A;  2QUF A;  3F8B A;  3CCE I;  4G6T B;  2Z5U A;  3G73 A;  4A0Y A;  1TNS A;  2ZJP F;  5F04 A;  1Y8Q B;  2EIM H;  3HRT A;  2HFH A;  1IXR C;  2VBZ A;  4QSH A;  1H8A C;  1ON2 A;  4IXA A;  5JHF A;  3MAJ A;  4MEY F;  2Z33 A;  5L3G A;  3N05 A;  2HYF A;  3EDP A;  4LLG F;  3KP6 A;  5FKO A;  1LKX A;  4RB3 C;  1GXQ A;  1P7J A;  1ZR4 A;  1T2K A;  3C3W A;  2CRG A;  1XMA A;  2DTR A;  5D6E A;  1J09 A;  3OOU A;  2IA2 A;  4RAF A;  1WKM A;  2P6S A;  2DA5 A;  4S04 A;  3M8J A;  2CSO A;  3H1C A;  4XN0 A;  3VSK A;  1K7A A;  4A3K J;  1EA3 A;  4P55 A;  1G4D A;  3P9C A;  2GWR A;  3IRR A;  2FE3 A;  3TKY A;  3QU3 A;  5LLQ A;  4Z6Y A;  2E19 A;  1Z3X A;  2QM3 A;  3CCV I;  1YYV A;  2DA6 A;  4F52 A;  5B1A H;  1HC8 A;  3MKW B;  5HLT A;  1RZ4 A;  3CTA A;  1RR8 C;  2ESH A;  4GYI A;  1K6O A;  1E3H A;  3P5J A;  5BNG A;  2H1L A;  5HNF A;  3RPU D;  3A01 B;  1BC7 C;  2C6Y A;  2LRE A;  4UUV A;  4L0Y B;  3K4K A;  3IL2 A;  1D1B A;  1X3W B;  1IN5 A;  4XL9 A;  1JJ6 C;  1VQ9 I;  5L3D A;  3DEE A;  3NQO A;  4DNC A;  5E3N A;  3U9G A;  1V5F A;  2NOJ B;  1WFX A;  1ITY A;  5JI6 A;  1J5Y A;  2HEO A;  3LSK A;  2X9D A;  3HOY J;  2BE5 F;  2ZC2 A;  4FHT A;  3FZV A;  2HOS A;  3GBG A;  3DKW A;  2VE9 A;  3CLO A;  4I76 A;  4NQW B;  2DFI A;  3HIF A;  4HAM A;  2LF8 A;  1JKR C;  4NNJ A;  3PQK A;  3SZT A;  2Z99 A;  4OMY A;  2M2E A;  2RRE A;  3LSJ A;  2X85 A;  1O7F A;  4PK4 A;  3SJM A;  1XPX A;  2IJL A;  2M30 A;  1G3T A;  2H6C A;  3GZ5 A;  4AID A;  3J7A Y;  4BKX A;  1MDM B;  3SZP A;  4UY8 I;  3BZK A;  3B73 A;  5CVJ A;  3L09 A;  3CJT B;  2CH0 A;  1TZL A;  4UUS B;  1XMX A;  1AA7 A;  4AIJ A;  4IHS A;  4IJA A;  1HW2 A;  1OYY A;  2H8W A;  3DTE A;  2VKH A;  3H9G A;  4ZZD A;  3RKY A;  2GZW A;  1DGW Y;  4DYQ A;  2Q2E B;  2K9S A;  1V4R A;  1QZY A;  1ZGA A;  2WTE A;  4GYG A;  5EGO B;  4CO8 A;  4WWC A;  3SQN A;  4RMN A;  2OF7 A;  1T98 A;  1QO0 D;  3CJS B;  3DLL F;  2VPR A;  4CYC B;  2KIS A;  3V4G A;  2OJE D;  4IHY A;  2DQL A;  1MH4 A;  2QKM B;  4UB8 C;  3OIO A;  1X4P A;  2HVQ A;  3I0T A;  1FSH A;  3HKZ N;  2JZY A;  3K1P A;  3JAM K;  2EFW A;  4KMU X;  3S1N J;  2PMZ A;  1SVM A;  2JUG A;  1OFC X;  2L7F P;  2EA4 A;  3S15 J;  3WTT C;  2OU2 A;  3DTI A;  1D5Y A;  3X2Q H;  2R0Q C;  4MHG A;  2KIQ A;  1DQU A;  3OYL A;  2IT0 A;  3J81 Z;  3FK7 A;  4UV9 A;  3V7S A;  1R7J A;  4G6Q A;  2QCO A;  5K5Q A;  2BY3 A;  1G6N A;  2KP6 A;  2LF7 A;  2WAQ N;  1SVO A;  2E1M C;  2GM4 A;  1OCP A;  4LB5 A;  3NRV A;  1A6I A;  2AQE A;  4O6J A;  2H6B A;  4MNU A;  1YS7 A;  3GZ6 A;  1VTN C;  1H9G A;  2JA7 J;  2LBF B;  3GXO A;  3HOS A;  1HCR A;  9ANT A;  1X3U A;  3RDI A;  1IN8 A;  4NHJ A;  2Q1Z B;  4O3M A;  4GCV A;  2Z3Y A;  3WU0 A;  5CJ9 A;  2EIN H;  2KLO A;  3K4L A;  3V42 A;  3CCU I;  2NVY J;  3S17 J;  1LUJ B;  2RN7 A;  3NWS A;  3OIP A;  4LGW A;  2LNB A;  4CCJ A;  3EYI A;  4H0E A;  4EJO A;  2HOA A;  1T33 A;  4RB2 C;  4CDG A;  2TCT A;  3FK6 A;  1K4S A;  4IHX A;  2A69 F;  3DKX A;  3S2D J;  4GRI A;  2X6Y A;  3OYM A;  1MBF A;  1K78 B;  4II2 A;  2J5P A;  2OCE A;  3JSP A;  1Q1H A;  2VI6 A;  2Y48 A;  4FAS D;  4DBQ A;  2L9R A;  1HKQ A;  1XX5 A;  2DMQ A;  2F6C A;  2QVO A;  1LE8 B;  1FPQ A;  2OA4 A;  2HVR A;  1ZAR A;  2DK8 A;  2ZO4 A;  2KMU A;  2MLG A;  2QF7 A;  4B44 A;  4ZTJ A;  5J4Y A;  2CS3 A;  1R1T A;  2D1H A;  2L7Z A;  3MD2 A;  3RQI A;  1KQ9 A;  3BWG A;  4JQF A;  2XC7 A;  1JXS A;  3ELK A;  3IKT A;  1W0T A;  1HW1 A;  1R49 A;  2VOO A;  2DW4 A;  4M72 A;  2E71 A;  5DS9 A;  2R7W A;  1P4X A;  2VL8 A;  3BCB A;  2MD5 A;  1F43 A;  3TQN A;  3PNV A;  4I0B A;  4HDV A;  1POG A;  2L4M A;  3HG9 A;  2W1O A;  4D0P A;  1HST A;  2ZSH B;  1D1C A;  2L54 A;  4CUG A;  4MO7 A;  3LSP A;  3GTK J;  1OJL A;  2KPM A;  3LSR A;  3OYC A;  2JRT A;  3PM1 A;  1ZRC A;  2VOD A;  1IUY A;  2K86 A;  4BEH A;  4D5C A;  3DPT A;  3ECO A;  1ETV A;  4AIH A;  4E7Z A;  2L7M P;  1DDN A;  3WTU C;  1O7L A;  4EQQ A;  2F5E A;  3A01 A;  1OCO H;  2WAE A;  4LFU A;  4MQ9 F;  3WTW C;  2HI3 A;  1L0O C;  2GA1 A;  3BTI A;  2PG4 A;  4UXN A;  5K1Y A;  4M3E A;  4IRH A;  2V9V A;  1FX7 A;  2EIL H;  3RI4 A;  3U1D A;  3GO5 A;  1G59 A;  3QRF F;  1QVT A;  2VC1 A;  3RYP A;  4P9F A;  3MKL A;  1O57 A;  3V7R A;  2K9N A;  4LD5 A;  4BY7 J;  1LVA A;  3D5R C;  5JLW A;  4LIT A;  1IRF A;  3WTV C;  2QBY B;  2M4G A;  2XRL A;  1U78 A;  4A2U A;  1XGS A;  2NRA C;  1WI9 A;  1I5Z A;  2XVC A;  2E60 A;  1B1B A;  2W85 A;  1IUF A;  4U0Y A;  3V7C A;  3CJN A;  1XTA A;  4XIC A;  1MDM A;  4XLE A;  5FD6 A;  3I4N J;  1YW8 A;  3KP3 A;  4FIS A;  2G7U A;  3TDU C;  1H0M A;  3HOX J;  2DOF A;  1U3E M;  1ZGJ A;  4UB6 C;  2HVS A;  2VPL A;  1T8I A;  2H94 A;  1QU3 A;  1OCZ H;  3BTJ A;  1JKO C;  2R5Y B;  2L0K A;  2XKO A;  3KYC B;  2DN0 A;  4BU2 A;  3TGN A;  2Q2E A;  3HTS B;  3W6J B;  3TDZ C;  2JJ7 A;  2V4J C;  5EGO A;  3D5L A;  1FYK A;  2O6G E;  3J80 Z;  1USS A;  2CU7 A;  4KN7 X;  4OU0 A;  3RSN A;  1X19 A;  2EIK H;  2KDO A;  4KFC A;  5E18 F;  3VB2 A;  5C4J J;  1DP7 P;  1WWX A;  4LIU A;  2JA2 A;  1T56 A;  4CYC A;  1VQP I;  5LEK A;  3L2V A;  2RNG A;  1R4N B;  1MW7 A;  4KIG A;  3FWE A;  1WH5 A;  1BJZ A;  2WV1 A;  3W2A A;  3M3Y J;  2IS4 A;  4UV8 A;  3L2R A;  1ETQ A;  1XD7 A;  2W48 A;  4IF4 A;  1IDY A;  3KP4 A;  2VC0 A;  4C30 A;  3KP2 A;  4IPA A;  4Z2Y A;  1MJ9 A;  5F0F A;  2JTV A;  3ZR8 X;  3AG2 H;  4RAG A;  4L5J A;  3S3N A;  4A3G J;  3CCS I;  1IV6 A;  1RI7 A;  3WGI A;  3CF2 A;  2WWY A;  1WGX A;  2HZT A;  2O9L A;  3I9V 2;  3K4B A;  2PMH A;  4PJJ A;  3HPG A;  3FXJ A;  3FXR A;  3E6D A;  5FFZ A;  1EH6 A;  4CIC A;  1MD0 A;  3U2R A;  2ZME B;  3TBI A;  4F91 B;  4C9Y A;  3HZJ A;  2MAB A;  2E2J J;  3G71 I;  2BY1 A;  2LKS A;  4HST A;  3BCA A;  5LHH A;  1WVR A;  2JPC A;  4ZZL A;  2F4I A;  4G94 A;  3BJO A;  2P5L C;  2LBF A;  5A2Q K;  3Q3S A;  1D3Y A;  2K9M A;  4PGG A;  1ZG1 A;  1FZP B;  5ILS A;  4Y4R A;  1I1S A;  2BYV E;  3GTL J;  1MJB A;  5ILU A;  2YU3 A;  2YPR A;  3LOC A;  1R4M B;  2RVC A;  3TOB A;  2LYC A;  1U5T C;  3ZQH A;  2KZV A;  2JK3 A;  4DYR A;  2L5Q A;  2EIJ H;  1Z9C A;  1JHF A;  1EJ9 A;  4XLC A;  3FXL A;  3SHF A;  4XQF A;  3HSF A;  3IAM 2;  4GGG A;  1EH8 A;  3OYB A;  1QBJ A;  2OTJ I;  4PFP A;  1Y56 A;  1U9O A;  1K78 A;  1X1B A;  1HKT A;  5K5O A;  3GME A;  1WZ2 A;  2IEK A;  2IRF G;  1TC3 C;  5HS9 A;  2DDA A;  5E3M A;  3CJR B;  2F48 A;  1VI0 A;  2EJR A;  2XGE A;  3OOP A;  5ICC A;  4YIR X;  4XON A;  3S1M J;  4A0Z A;  1LE8 A;  3G2B A;  5D4R A;  5L3F A;  1BA5 A;  4L18 B;  5L3C A;  1VQ4 I;  4ZC3 A;  2EFO A;  3C1D A;  4MIM A;  3ABM H;  3KYD B;  1A04 A;  3GLL A;  3DF8 A;  4RS8 A;  4BXF A;  3OYF A;  1LQ1 A;  5FKN A;  1SD7 A;  2HOT A;  4M74 A;  4B3A A;  1WPK A;  2Y2Z A;  2M34 A;  1SC7 A;  5IP7 J;  3F72 A;  4HYE A;  2MC4 A;  2L02 A;  2ECB A;  3TO6 A;  3AKZ A;  1ZLK A;  2BVL A;  4IOA F;  1SFE A;  2FNP A;  1FTZ A;  4QPQ A;  3BG6 A;  1ZH5 A;  1ETX A;  2DYS H;  3CCM I;  2ELJ A;  4RGS A;  2E1N A;  3VPR A;  1Z6T A;  2CQX A;  1Z91 A;  3MEX A;  2BZT A;  3VOD A;  2CO5 A;  2ZJR F;  4DGW B;  3QU6 A;  1SMT A;  1VFC A;  5E1W A;  3HSR A;  1LDJ A;  3IH3 A;  2X1E A;  4G6D A;  5FGM A;  3GW2 A;  5LHI A;  2HXI A;  3SEZ A;  1WIB A;  2DAO A;  3S32 A;  2E5Z A;  3PL8 A;  3L1P A;  3HOU J;  2DFE A;  2ELH A;  2A6E F;  2JSC A;  2O8K A;  4Y3O A;  4IL6 C;  1H88 C;  5F64 A;  2FEZ A;  1K83 J;  1V5E A;  2P7V B;  3FHN A;  2HDC A;  1TW3 A;  4B48 A;  3H36 A;  2N8G A;  3CC7 I;  1B8I A;  3GFJ A;  1BI2 A;  5EDN A;  3NWT A;  3D1N I;  2KRC A;  1MNM C;  1I6X A;  2DA4 A;  3AG1 H;  2VXZ A;  3ZQF A;  3M4O J;  3IWF A;  4AD9 A;  1FMW A;  2WAQ A;  4E6K G;  3PIP F;  1WJB A;  2DXI A;  1J2X A;  1YW7 A;  3S2W A;  3OL3 A;  3DEU A;  1YIJ I;  3OY9 A;  3CCQ I;  2DTZ A;  2HGC A;  2J5O A;  3H35 A;  1Q1V A;  4M9Z A;  4CZZ A;  1DP3 A;  2X6W A;  3GTO J;  2AXL A;  4I98 B;  3CDH A;  3PSI A;  3WHB A;  1RET A;  2A5W A;  1XGM A;  4MFD A;  4RBO A;  1E17 A;  1QA6 A;  4F55 A;  4HF2 A;  1ETW A;  2WB1 N;  3TP3 A;  4FX0 A;  3H5A A;  2B7E A;  5EG0 B;  1MBH A;  4K2E A;  4M9S A;  3ZQG A;  1L3L A;  4AYB N;  3W6K B;  2V1X A;  4C2U A;  3QOD A;  3KX2 A;  2HS5 A;  4XSZ F;  1Y0N A;  4XRS A;  4B09 A;  2W00 A;  5E8I A;  3G1L A;  4JX6 A;  2R4G A;  2VKE A;  1TL8 A;  4NC7 A;  1JTY A;  3ZQC A;  3M8F A;  4BNC A;  2AXT C;  3CCY A;  1DU6 A;  4A3D J;  4MQV A;  2VBY A;  4BHB A;  1ONV A;  2KL4 A;  2P81 A;  1B72 A;  3W6V A;  3I4M J;  3K1N A;  2PI0 A;  1PVE A;  3J7Y J;  3HRS A;  2Y0S A;  3SDG A;  1ACI A;  5CVV A;  2ZME A;  5DD8 A;  4S0H B;  2ZSI B;  1D0X A;  1O3Q A;  2Y9Z A;  4MTE A;  4A3E J;  3GVA A;  2QQ9 A;  2LDU A;  1BI1 A;  4U0W A;  4BQQ A;  3BRO A;  1VQ7 I;  3C7J A;  2F5F A;  4M73 A;  1W7P A;  3RPU A;  4I7H A;  2HDD A;  1UAA A;  4G7O F;  2CV1 A;  3HL2 A;  2CFX A;  1JGG A;  2A61 A;  4C3H J;  3GUD A;  3ZXS A;  2M3A A;  4BHC A;  1HW5 A;  3JRA A;  2RGV A;  4CZC A;  2FBK A;  2ZXH A;  2UXX A;  3DU6 A;  3K10 A;  2ADU A;  5JVG F;  1I27 A;  2HKO A;  5E1Z B;  1T0F A;  2CWE A;  1JGS A;  2OCC H;  3K0L A;  1W5C C;  3R4K A;  3ZN0 A;  2IAI A;  3L9F A;  1G3W A;  2EV5 A;  2LR8 A;  2L7K A;  4Q47 A;  3ZQL A;  1VQ8 I;  3UR3 C;  4MFE A;  4YEJ A;  3HHG A;  3HRM A;  4OIO F;  4PGH A;  2XPV A;  2K27 A;  4YEL A;  1TW2 A;  3MZY A;  1PUF B;  4XKV A;  5LRS A;  3DFG A;  2GXB A;  3R61 A;  1W36 C;  3QYF A;  4H4K C;  3FXU A;  2DT6 A;  2OQR A;  4BYY A;  1FC3 A;  1OIS A;  2K40 A;  4Y7N J;  3BDD A;  3V8J A;  2JVH A;  4O5V A;  3E0J B;  3IV5 A;  4CYD A;  2BOL A;  2VJ5 A;  3S1R J;  4EV0 A;  4HA8 A;  1Z05 A;  5CQG A;  4BJ6 C;  4E7L A;  1P4A A;  2F5V A;  5BOX A;  3FMS A;  2NVX J;  5DUK A;  2E1C A;  4RB1 A;  3U21 A;  4C3I J;  1IXS B;  2Z16 A;  3G3Z A;  3KEO A;  4BL0 B;  2EFQ A;  4FET A;  4HEA 2;  3AL0 B;  3CES A;  3PSF A;  2PFB A;  2VXD A;  3EYY A;  3EQL F;  4D7M A;  4W97 A;  5DCM B;  1FP1 D;  1P92 A;  1HLV A;  2ZB9 A;  5BMZ A;  4KT5 C;  4IQ4 A;  5DYM A;  4EJW A;  1N75 A;  3ZRG A;  1YJW I;  2X0L A;  3U1K A;  1JKQ C;  1XCV A;  2QZ8 A;  2XAS A;  5B66 C;  1HKS A;  5DDG A;  3ZP5 A;  5FB2 A;  3PQJ A;  3RZO J;  3BLY A;  2BVM A;  3KFW X;  1JUP A;  3E6M A;  3DV8 A;  2YR2 A;  4A3F J;  3PFY A;  1FBQ A;  4DZP A;  4QIW N;  5LHG A;  2K85 A;  4XKB A;  2YUS A;  4NDL A;  3F8C A;  3R6S A;  2DCE A;  4W1U A;  3KIO A;  1ZGW A;  1GT0 C;  4CA0 A;  1Y0U A;  4RAY A;  2MYS A;  4LG0 B;  4L9V A;  1XSD A;  5IY5 H;  2V6C A;  1IN6 A;  3CO7 C;  1S3J A;  3VYR B;  4DOZ A;  2EV6 A;  1W0U A;  1OR7 C;  5DEQ A;  1H9T A;  2F4M B;  5DM7 F;  4AVZ A;  3L2C A;  1YO5 C;  1JUS A;  1R1V A;  2MA3 A;  5HS7 A;  4ZH4 F;  2R7U A;  2ME0 A;  1GV5 A;  2VJ4 A;  3JSO A;  2H1K A;  4HG2 A;  3I64 A;  3FDY A;  3O8H A;  1E3P A;  1WJC A;  3FHZ A;  3C2B A;  2QQ8 A;  5HNH A;  3S8P A;  1FOW A;  3I58 A;  1S6L A;  1LFP A;  3CUQ B;  3BPX A;  4L9J A;  4V2G A;  2K7L A;  2MD0 A;  3CP2 A;  1IN4 A;  5JR3 A;  1IF1 A;  5DTD A;  1Y1W J;  2X6O A;  5DV5 A;  5FO5 A;  2UZK A;  1WRJ A;  3I5U A;  4NC8 A;  4RB0 A;  3OYG A;  3F23 A;  4XLA A;  1UHW A;  1U8B A;  3K70 C;  5BQT A;  4HV6 A;  1F36 A;  4PDK A;  2VT3 A;  3PIO F;  3T8R A;  4UVC A;  1NK2 P;  2R92 J;  5F0C A;  5TRD A;  1R5G A;  2K9Q A;  1IGN A;  1IW7 F;  4BJT A;  5M5X J;  2JA6 J;  1R00 A;  5F6F A;  3ULQ B;  4D1Q A;  5CQE A;  4B43 A;  3F6O A;  1ZQ3 P;  2DPD A;  3K1M A;  1F5T A;  2DMT A;  2ZCW A;  5D5W B;  3QOE A;  1NHA A;  1HOM A;  3F22 A;  5K7H A;  4A93 J;  2XB5 A;  1T95 A;  1UJ8 A;  4KN4 X;  1D8K A;  3CF5 F;  1Z0X A;  1IG7 A;  5L3E A;  2A05 A;  1YOV B;  3RTR A;  1UMQ A;  5FRN A;  5B5E C;  2CG4 A;  2H27 A;  2UWM A;  2AS5 F;  2DA7 A;  2OZU A;  5TJJ A;  4A3I J;  2IGK A;  3GTJ J;  2VQH A;  3BPV A;  2X51 A;  3LL7 A;  1SAN A;  5D5V B;  2LLK A;  5HS8 A;  1YJN I;  2CQ7 A;  4BH9 A;  3MZ8 A;  2OZ6 A;  2MG4 A;  5EEA A;  1LEB A;  1ZK8 A;  2PJP A;  2LSO A;  1UZC A;  2FU4 A;  2BBY A;  1B6A A;  3DPL C;  2TDX A;  3VYU B;  3GYH X;  2STW A;  1XMK A;  1KQ8 A;  1O3T A;  3LSG A;  3S2H J;  3IWZ A;  2RKH A;  3QPL A;  2DMN A;  3ZQQ A;  4XLN F;  3MMY B;  4HZF A;  2RV8 A;  2BHZ A;  1PUF A;  3CMA I;  3ZCO A;  5J1U A;  1HDP A;  1MKM A;  4WX9 A;  3F3X A;  4ON0 A;  2ZFU A;  3DP7 A;  4M6Y A;  2LC2 A;  3M7G A;  4MLO A;  1IN7 A;  5IT3 A;  2UV1 A;  1WQ2 A;  3JAM Z;  5JFR A;  1VQ5 I;  1ZEL A;  1JKP C;  4PZJ A;  2A6H F;  1ETY A;  2BHY A;  2DI3 A;  3W2W A;  3CME I;  3Q5F A;  2NVT J;  3EET A;  4F93 B;  3WE2 A;  1YS6 A;  2HDW A;  4FQG A;  4RM2 A;  1I39 A;  2EB7 A;  4EJV A;  2XKP A;  1BN5 A;  5J40 A;  3K2Z A;  3JTH A;  3BR6 A;  4D7N A;  1CGP A;  1KGS A;  5FLX K;  3IP4 B;  2M1B A;  4OIR F;  4XID A;  4KDP A;  3BTL A;  1G8X A;  3E5U A;  2MSY A;  1SD4 A;  2YS9 A;  2ACJ A;  3BC8 A;  4OIQ F;  2BXY A;  2O61 A;  2QQB A;  2WAD A;  5KNL A;  4MTD A;  5LFA A;  3H0G J;  4QTR A;  1IZ1 A;  4CCK A;  5CVI A;  2HQA A;  3AAF A;  3ABU A;  2KJC A;  2DPU A;  2Y31 A;  1LEA A;  2DFF A;  2W25 A;  2BGC A;  5GPC A;  2IGM A;  1LJ9 A;  1IO2 A;  4IRI A;  3O6B B;  5D5X B;  4AYB A;  4C2M J;  2ISY A;  3KLN A;  1ZRD A;  3DKY A;  2Y30 A;  3QAH A;  1APL C;  2V26 A;  4A3C J;  2FML A;  2ID6 A;  2RQQ A;  3WU2 C;  2HQ5 A;  5J47 A;  2V6E A;  1VQL I;  4P5O A;  4XOP A;  1OYI A;  1J7K A;  4LG0 A;  2ZJ2 A;  4ABZ A;  1XGO A;  1UG2 A;  1VND A;  2CFO A;  3AG3 H;  4UNO A;  2NNN A;  4KYW A;  4NQW A;  1ZR2 A;  5LEJ A;  3DQV C;  2DMU A;  4XSX F;  2QSF X;  2A07 F;  3WE3 A;  4HSR A;  2L01 A;  5GAE J;  1YG2 A;  2X4H A;  3Q9V A;  1DU0 A;  3K4M A;  2XB0 X;  2JQ7 A;  1QNT A;  3HBL A;  5F08 A;  1TWH J;  2F4O B;  4I2O A;  3PO2 J;  4CCO A;  2HU9 A;  2KZG A;  2ZJQ F;  2XDV A;  3PNT A;  3LSM A;  2M87 A;  3ZMS A;  1Z3Y A;  2D5V A;  4UUS A;  3ABT A;  3LQR A;  4HRI A;  5IYB J;  1FYL A;  4E7J A;  1OPC A;  2RNJ A;  2FXA A;  1JT0 A;  1DPR A;  2ICW G;  1R5I D;  1P4W A;  2DYR H;  2YSR A;  2EZL A;  3MVP A;  5J3L A;  2XAJ A;  1WJD A;  2P8T A;  3EUH A;  2WY7 Q;  2Z2S B;  1S7O A;  2MGQ A;  5M3F J;  4KIF A;  3CD6 I;  2M7A A;  2CYY A;  2EZI A;  3BR2 A;  4JX5 A;  2ZNZ A;  2E36 A;  3DU5 A;  3ZMU A;  1BW5 A;  2JRM A;  5IOZ A;  2STT A;  2CV2 A;  2DT5 A;  2OQG A;  1CF7 B;  3QYE A;  5JHU A;  3EGV B;  3R0A A;  2LY9 A;  5GP9 A;  3SDB A;  1TTY A;  1U9N A;  4I0A A;  2DJN A;  2MBF A;  3MQ0 A;  4ETS A;  2QA4 I;  4ZYD A;  2RAE A;  2LOO A;  1UST A;  1X1A A;  4L5I A;  4KIC A;  1VQM I;  2MLK A;  4A5M A;  4IQJ A;  4KJZ A;  2ETH A;  2KHM A;  3OS1 A;  3WOD F;  1YJ9 I;  2PLY A;  1W1W E;  1MMN A;  1X2N A;  3HEF A;  2XIG A;  5BS6 A;  4AM3 A;  1FWZ A;  2MH9 A;  2EH3 A;  3M9A A;  2YX7 A;  3S14 J;  2HOE A;  3OYJ A;  5M5Y J;  1P2F A;  4PJN A;  2VLA A;  5K5R A;  2FX0 A;  4ZYG A;  4B1R A;  2KFD A;  3JRE A;  1HQC A;  1Y6I A;  3O2P E;  4RGX A;  1MSE C;  2I10 A;  2FQ4 A;  1ZRE A;  5ERI A;  4NC6 A;  2K5C A;  3K7A J;  3H9Q A;  4Y15 A;  5DUI A;  2IGO A;  2VUM J;  2WBM A;  4BUP A;  2P5K A;  2XPW A;  3BQY A;  3LQQ A;  3Q0U A;  3REO A;  1KU9 A;  5E3L A;  3CC4 I;  3E7L A;  3A4C A;  1IXC A;  3D5S C;  2E1M B;  4N9H A;  3VFZ A;  3QOP A;  1ZYR F;  1IDZ A;  1BM9 A;  3WHC A;  5AON A;  1YHQ I;  3M1E A;  1S9H A;  3TW6 A;  4KIS A;  1YFH A;  2JA8 J;  2A68 F;  2HKX A;  4BBS J;  4BE1 A;  2CQK A;  5FLV A;  2GXG A;  1E3O C;  5C44 J;  1X1P A;  3J7A O;  1HF0 A;  4P9U A;  3ML6 A;  2NNY A;  3DPU A;  3ROU A;  1ZLJ A;  4Y33 A;  3A0H C;  1YTY A;  3AFH A;  2JSP A;  3ZMD A;  4HF1 A;  4IHV A;  2FNA A;  3FXM A;  4IVN A;  2B0L A;  2DA2 A;  2FF4 A;  3HUG B;  2Y69 H;  4C2T A;  4HQE A;  4D9J A;  2R5Z B;  4LK1 F;  1KQ0 A;  3DCF A;  2QYO A;  4EMS A;  1AOY A;  3SFI A;  3K4N A;  4ZTF A;  3Q9S A;  3ERM A;  2Q8K A;  4JOM A;  2JUC A;  5K7F A;  3CMM A;  1F1Z A;  1MMA A;  2DK5 A;  4HQM A;  3TP0 A;  1LFU P;  1ZHF A;  3RKQ A;  3FKJ A;  4RM3 A;  1T08 B;  4E7I A;  5H20 A;  3WTZ A;  3GFM A;  2MW8 A;  2CJJ A;  3FXO A;  1FIA A;  1S72 I;  1T39 A;  1OYW A;  1X3Z B;  1PP8 F;  3GTM J;  1SVL A;  2OV7 A;  3A03 A;  1WJ5 A;  3LWF A;  4G9Y A;  4ZDO A;  3SZG A;  4IRG A;  5A2Q Z;  1MSF C;  4ZDL A;  4XN3 A;  2PMZ N;  2JT1 A;  4E4H A;  1FMV A;  4ASN A;  2K9L A;  2X6X A;  2HPM A;  5D8K B;  2FBH A;  3MCZ A;  1O3R A;  2IA1 A;  3HDD A;  1YIO A;  4XBF A;  3WG7 H;  2K02 A;  3BZC A;  4BQA A;  4LMY A;  2KIU A;  3E6B A;  5HDG A;  5CKT A;  4PJL A;  3IC7 A;  4IHW A;  2XHK A;  4DYC A;  4U7B A;  2M5W A;  4R1H A;  2LD5 A;  1IAW A;  2WA0 A;  1S29 A;  1PP7 U;  2DOE A;  1LB2 A;  2H09 A;  1TWF J;  1BR4 A;  3HKZ A;  5IT9 K;  2GAU A;  1UHS A;  4EM2 A;  4GO1 A;  4AUX A;  2ESN A;  3KYL A;  1SFO J;  2XAG A;  3S16 J;  3EUA A;  3ASN H;  3HSE A;  2IP2 A;  2CQN A;  4DZJ A;  3FMR A;  1H89 C;  4NUB A;  3JCU C;  4U88 A;  4J19 A;  2QBY A;  4XLF A;  3PJR A;  1Y8R B;  4B8X A;  5L3B A;  3LA7 A;  5H6R A;  3KE2 A;  4A3M J;  1X1D A;  3HOW J;  1WJF A;  5LGT A;  4WXC A;  2H8R A;  1KZH A;  3AG4 H;  3GZN B;  3TO7 A;  4BJ5 C;  5JVT A;  2XRO A;  4Q4Z F;  1B9N A;  2NS0 A;  3UKG A;  4Q48 A;  3IAS 2;  3L2Q A;  3CJQ B;  3O3K A;  2FD5 A;  1W36 D;  4C3J J;  1E2X A;  3Q0W A;  3HJE A;  3PNY A;  1R1U A;  4KT6 A;  1BR2 A;  3RCO A;  3I56 I;  2R5Y A;  4IO9 F;  3MZH A;  2R93 J;  4X0G A;  2O8X A;  2F2E A;  2P6T A;  3K4C A;  5EZH A;  1B59 A;  2COM A;  2M7B A;  3RQ4 A;  3ZMV A;  4KMF A;  2R7S A;  5GTH C;  1QHH D;  4XOR A;  5TIS C;  1GXP A;  1G3S A;  4OWR B;  3BJA A;  4YIF A;  2O0Y A;  5LGN A;  1S7E A;  3OYH A;  2V1D A;  3I53 A;  1JJ8 C;  3PFI A;  4A3J J;  1GVJ A;  2ZXW H;  4JYK A;  1CF7 A;  2EZK A;  4GFB A;  4XKW A;  5HLH A;  2FUG 2;  3L7W A;  2W24 A;  2V9K A;  4M71 A;  1ETK A;  2JWT A;  4II3 A;  2EV0 A;  1ZG5 A;  1F4K A;  1R58 A;  1SAX A;  3HGG A;  2QLZ A;  3V8L A;  1MBK A;  1Z1D A;  4M3D A;  3VSL A;  1FYM A;  4KA4 A;  2QEX I;  5CLS A;  5FD5 A;  3IH4 A;  3CC2 I;  1A6Q A;  3GCM A;  3JRC A;  3CMY A;  2GIV A;  5IYD J;  2EFP A;  4L9T A;  3BQZ A;  4WXH A;  4ENM A;  4M3B A;  3F0C A;  5KAF C;  5HVQ C;  4Q5S F;  3WGH A;  1NK3 P;  3BOQ A;  3OYN A;  4HPQ A;  3FIW A;  1VQK I;  1U6G A;  1X1C A;  2HQR A;  5E17 F;  3G1M A;  3NAR A;  3QP5 A;  1R6R A;  2KT0 A;  2O5R A;  3CZ6 A;  1QVU A;  1BBY A;  2AHQ A;  3FBN B;  5IP6 A;  2P5V A;  2PMU A;  4RDU A;  2D45 A;  2R7Q A;  4M6V A;  4M3F A;  5LD2 C;  2YU9 J;  1DUX C;  1LNW A;  4E7K A;  2V7F A;  1IV8 A;  1DPU A;  2E7X A;  3R0J A;  3JRI A;  3RKW A;  3HM5 A;  1FBS A;  1V55 H;  1JHH A;  2HWV A;  2NVQ J;  2FRH A;  4KIB A;  1GV2 A;  2NXN B;  1WJE A;  3ESW B;  1ZTR A;  1OMI A;  3VYT B;  5C4X J;  3RZD J;  3KP7 A;  1U5T B;  2R3S A;  3S93 A;  1REP C;  3A2K A;  2R5Z A;  3CCJ I;  3NAU A;  4BY1 J;  4ESB A;  4HX4 A;  4LLL A;  4XLP F;  1Z7U A;  2R7V A;  4IKF A;  4HBL A;  2FSW A;  4QLC U;  4HW0 A;  1JT6 A;  3GEZ A;  3K70 D;  4JBA A;  1AKH B;  4M3G A;  4N4N B;  3QPS A;  4QWQ A;  2DT7 B;  4FCY A;  3F9K A;  2E1O A;  4EGY A;  2E35 A;  1ZRF A;  1Z7L A;  3K2A A;  4E70 A;  1KYZ A;  3COA C;  4JP0 A;  5KVR A;  4NBQ A;  3IUO A;  4HNU A;  4XRF A;  1ZKG A;  4XRS G;  4V2F A;  2HQN A;  1ZG3 A;  2HTJ A;  2E34 A;  3LST A;  1O3S A;  2VQG A;  2X1D A;  1P9Q C;  5HOO A;  3LNQ A;  2XAU A;  2HTS A;  1XG1 A;  4XOT A;  4IHT A;  3C2H A;  1YW9 A;  4UVB A;  4EEF G;  4LB6 B;  2DFH A;  5EEH A;  1YX5 A;  5ICG A;  3WG9 A;  3GFI A;  1J0R A;  1TNT A;  1FT9 A;  2PQ8 A;  4I09 A;  4OIN F;  2NVU B;  5B3S H;  2F5D A;  3P7N A;  1HDD C;  3EUK L;  4G7H F;  3V8K A;  1OKR A;  1YX3 A;  3QWL A;  4L5E A;  5DD4 A;  3MKZ A;  4HOB A;  3BG9 A;  2OD5 A;  2BXZ A;  1GHC A;  2OUM A;  4ENJ A;  5BPI A;  1RRJ A;  2TRT A;  1FP2 A;  5GPA A;  3G6E I;  1C0W A;  4RAZ A;  5HOD A;  4NB5 A;  1JUM A;  3ZPL A;  3B6A A;  2R7R A;  2M8E A;  2DMP A;  3DXJ F;  3OS0 A;  1WSU A;  5H6Q A;  5E8G A;  4HDU A;  1R5H A;  1BL0 A;  4YFK F;  2HZD A;  2GLO A;  1D1A A;  4BEH B;  1VQ6 I;  1F9N A;  4A3L J;  4R8H A;  3F6V A;  1OQY A;  2XSJ C;  4PSX A;  4EGZ A;  1P7I A;  3FM5 A;  4Y52 J;  1W7P D;  4HLY A;  4CHU A;  2WY8 Q;  4BGD A;  4CGZ A;  5KK1 A;  3BG3 A;  3P9K A;  1XN7 A;  3FKI J;  4XM3 A;  4AU7 A;  4EM0 B;  4N9I A;  3KZY A;  2E2H J;  3LAP A;  1XB4 A;  1K6Y A;  3G4S I;  1RC9 A;  1V54 H;  1T38 A;  1BW6 A;  3E5Q A;  2EPF A;  2XPU A;  2CUJ A;  1QPM A;  5IPA A;  1AWC A;  2EA2 A;  4G8X A;  3MWM A;  2NAZ A;  3F8F A;  3VYS B;  1K4T A;  4N4O B;  2AO9 A;  1U8R A;  3B6C A;  1D0Y A;  5EG0 A;  2DQR A;  3LFK A;  3GTP J;  4G12 A;  5C3E J;  5F0H A;  1R22 A;  2A5Y B;  1PDN C;  1VQN I;  3TMO A;  2CMP A;  4BAY A;  4AC0 A;  3J81 K;  5EYR A;  3FX3 A;  2XAQ A;  3T0Y A;  1A31 A;  4OMZ A;  1MBE A;  4HV5 A;  3L00 A;  1SD6 A;  5ICF A;  5J1Y A;  3ABL H;  2EBI A;  3H3V K;  3LFU A;  3A1Y A;  3KEQ A;  2K3P A;  4E7H A;  1N78 A;  2R7X A;  3SFZ A;  4EM1 A;  3VDX A;  1SMY F;  2K3F A;  2O3F A;  1XSX A;  4FT8 A;  3SEQ A;  1X4O A;  4GDF A;  2HNH A;  4EJT A;  1MNE A;  1S7A A;  3HTU A;  2XSD C;  2ID3 A;  4L9N A;  1R23 A;  2IS1 A;  2VKD A;  3C2G A;  3N97 A;  5IYC J;  1W4M A;  2OPT A;  4BHP A;  3OMY A;  2LRD A;  1RES A;  2IW5 A;  3CO6 C;  1XC5 A;  5F1J A;  4J00 A;  4BDZ A;  1V3F A;  2Z1D A;  1G3Y A;  2EFN A;  3TL4 X;  1Z67 A;  2JN6 A;  4XMY A;  2E7W A;  3O8G A;  5EF6 A;  4HF0 A;  4KNY A;  3D0S A;  2VB6 A;  2M9H A;  1QQI A;  5J1R A;  3K9T A;  3ECH A;  1UEL B;  4EVI A;  1LFB A;  2FOW A;  2GA2 A;  2OTL I;  4PCQ A;  2Y9Y A;  4M6X A;  1FOY A;  4MGR A;  3IRQ A;  2NS7 A;  1TBX A;  4WK8 F;  4EAT A;  2R7O A;  2F5C A;  1MND A;  3QPT A;  4Y17 A;  4CCM A;  5HLI A;  2PBI A;  2ZME C;  3FBI B;  3DLA A;  2ISZ A;  2VT2 A;  1NH3 A;  4GXO A;  3BP8 A;  4PSW A;  5LBQ A;  2V1N A;  2VON A;  3M07 A;  3OSF A;  1IRX A;  2UXN A;  5E79 C;  3ABK H;  4DQ2 A;  1HSJ A;  1XS9 A;  3ZN1 A;  2HR3 A;  3GF2 A;  1U5T A;  5D6F A;  2ZKZ A;  5HDN A;  5J8C A;  2XAH A;  4ZJZ A;  3VWB A; 
#chains in the Genus database with same CATH homology
 1VQM I;  1YJ9 I;  4IOC F;  3PIO F;  3PIP F;  1YIJ I;  3G4S I;  3CCQ I;  2NXN B;  5GAH J;  3CCR I;  3CC4 I;  1QA6 A;  3CCV I;  1HC8 A;  2OTJ I;  3CCJ I;  1YHQ I;  5GAG J;  1VQN I;  3CJR B;  4V19 K;  1MMS A;  3CCL I;  1VQ9 I;  3CJQ B;  3CF5 F;  1VQL I;  1VQ4 I;  3CCU I;  1YIT I;  3I56 I;  2K3F A;  4IO9 F;  1YJW I;  2E35 A;  5DM6 F;  1YI2 I;  5GAE J;  2JQ7 A;  1YJN I;  5GAD J;  3J7Y J;  1ACI A;  2E34 A;  1FOX A;  2ZJQ F;  4IOA F;  1VQP I;  3CCM I;  1Y39 A;  4UY8 I;  3CJT B;  2ZJR F;  1VQ7 I;  3CMA I;  2OTL I;  2FOW A;  2H8W A;  1S72 I;  1FOY A;  5DM7 F;  2QEX I;  3CD6 I;  1WIB A;  3CCS I;  3CC2 I;  1VQ5 I;  2E36 A;  3G6E I;  3CME I;  5JVG F;  3J7Z I;  3I55 I;  1VQO I;  3CJS B;  3DLL F;  3EGV B;  1FOW A;  1VQK I;  3CCE I;  1VQ8 I;  2QA4 I;  3CC7 I;  2ZJP F;  3G71 I;  1VQ6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...