2JQ7A

Model for thiostrepton binding to the ribosomal l11-rna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L11
publication title L11 Domain Rearrangement Upon Binding to RNA and Thiostrepton Studied by NMR Spectroscopy
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Ribosome/antibiotic
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2jq7A02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2jq7A01
3CCQI 3CCEI 3G71I 2OTJI 3CJRB 2ZJPF 5DM6F 3EGVB 1VQ9I 1YJNI 1MMSA 4IO9F 1YITI 4UY8I 1WIBA 1HC8A 3CC2I 4IOAF 4V19K 1QA6A 1VQ5I 5GAEJ 2E35A 1VQPI 1VQ7I 1FOXA 1YHQI 1YJ9I 3CCRI 3CCSI 3CMAI 2ZJQF 3PIOF 3CF5F 3G4SI 3CD6I 3I56I 3CC4I 2FOWA 3J7ZI 1VQMI 1VQ4I 3CCJI 1VQNI 3J7YJ 1ACIA 1VQ8I 3CCUI 1S72I 2NXNB 2ZJRF 3G6EI 1VQKI 4IOCF 2E36A 1Y39A 2H8WA 3I55I 3CJTB 3CMEI 2JQ7A 3CC7I 1YI2I 2QA4I 3CCLI 5JVGF 5GAGJ 1YIJI 2QEXI 1VQOI 3CJQB 3DLLF 1YJWI 3CCMI 3CJSB 1VQLI 3PIPF 1FOWA 5GAHJ 5DM7F 2OTLI 5GADJ 2E34A 1FOYA 1VQ6I 3CCVI 2K3FA
chains in the Genus database with same CATH superfamily
2IAIA 4CXFA 2L4AA 2VQGA 3VDXA 2R7ZJ 2EIJH 5IY5H 2EFOA 2CYYA 4I09A 1FSHA 3OMYA 3S2WA 2KLOA 1MNEA 3DCFA 5DM6F 2JT1A 1YJNI 2AQFA 2FEZA 4C2TA 3HZJA 4LD5A 2JSPA 2X6YA 3GO5A 3CO6C 4KICA 4UV8A 1RPWA 1K6YA 5LBQA 3OYFA 2I5UA 2R7WA 1U9NA 5GAEJ 4KUMA 1W0TA 2OA4A 1DDNA 2V6CA 2ELJA 1ETQA 4ZTJA 1AWCA 4UVCA 2E2JJ 5DV5A 1STZA 4XRSA 4EJOA 3H5RA 3I9V2 1X4OA 5K7FA 2AHQA 3KFWX 2IP2A 5CPRB 5AIPA 3CMAI 4XOPA 4B1RA 3IRRA 2H1KA 2R5ZB 3HSFA 1OYWA 3LSMA 5LEJA 1J7KA 1OPCA 4XL9A 2HNHA 1QZZA 2FOKA 4RB0A 3PJRA 1D0ZA 1QZYA 2DA3A 4F93B 4LGWA 4HX7A 5F1RA 4XSXF 3S93A 1GVDA 3VB2A 1S5LC 2DMUA 3BG9A 3RPQA 3LOCA 1S8NA 3WU1B 4C2UA 1FC3A 1SFEA 4HX8A 1DGRM 1MBKA 2HWVA 2LR8A 4NDLA 4ZDPA 4U7DA 3FF5A 2EB7A 4EVIA 2ECBA 1XN7A 1JTYA 1BR2A 3JSOA 3PNTA 4P1WA 3ERED 3H36A 3OYMA 3F23A 1DP7P 3HUGA 1FTZA 4AC0A 2QVOA 2KDOA 3CO7C 4LLNA 1MBHA 3FXOA 3BT9A 2MC4A 4PSWA 2JJ7A 1K4SA 5J8FA 3DF8A 3WTTC 4DZJA 1JT0A 5HVQC 5JVGF 1HLVA 3PO3J 2V26A 4F55A 3GX4X 4PGHA 1CQTA 1TTYA 1USSA 2L4MA 3BP8A 2A68F 1HW2A 2WAEA 3B6CA 5FJ8J 2LRDA 5J1RA 2QBYB 2HYFA 4Y17A 2EJRA 5HLIA 4KFCA 3O8HA 2MGQA 1J59A 4XRFA 2ZMEB 1F36A 4QTRA 1DQUA 1TWFJ 4A3MJ 3CCEI 5KAIC 1SMTA 1ZQ3P 2KDZA 1DP3A 1X4PA 2DDAA 4G6QA 1R6RA 3BCAA 3U2RA 4KJZA 2LBFA 1HW1A 1ULYA 2YSRA 4HV6A 4PJNA 5E17F 2FF4A 1LKXA 2E1MC 3S14J 4BQNA 5ILSA 1RUNA 2DK5A 2WY8Q 1HC8A 3SXYA 3CC2I 4CCLA 2XC7A 5K5QA 2VKDA 1EH7A 3KE2A 4MO7A 3HBLA 2K9NA 1B9NA 2LVSA 3L09A 4EM1A 1MW7A 2HVRA 4M3GA 2Y31A 2MW8A 2ID6A 4XRSG 4B47A 2V1XA 4XLHA 3WTWC 1YJ9I 4S0HB 2HKOA 3CMMA 1JKPC 2DT5A 1ETXA 4EQQA 3LQRA 2OUMA 2HVSA 2OBPA 3J7AY 5M5YJ 3FMRA 1X3UA 1H0MA 3C18A 1HQCA 3O2PE 4UB8C 3F21A 3CD6I 4HF0A 1U0JA 1RC9A 1B8IB 3OYAA 3GXOA 2A5WA 3CJNA 5E79C 3TW6A 3ECOA 4BJ5C 3D1NI 3RQIA 2JA2A 2DYSH 1S7AA 2LLKA 3JR9A 1XGNA 2JRMA 4C30A 3QQAA 1ON1A 3KP7A 3K10A 3AL0B 3VFZA 1ETOA 4OWRB 4KISA 2E71A 1JE8A 1VQ8I 2RDPA 1TQIA 3C2BA 4BE2A 3FMSA 3GTPJ 3LQQA 2KZGA 3FIWA 3WGGA 3NWTA 1BI1A 2PEXA 5FO5A 3E5QA 5TGTA 1K78A 5EEAA 2DPDA 1YW7A 2X0LA 2L0KA 1FJLA 2JN6A 3H9GA 5CVJA 1WJAA 2XRNA 3IAS2 1QRYA 3V8JA 1DU6A 3GTGJ 2G0EA 2FU4A 3A2KA 2QWWA 2X1EA 2EWNA 2K4BA 1U5TA 2QF7A 1CF7A 4Q5SF 4IHXA 4PZJA 2K9LA 3CCLI 4OU0A 3OS0A 4HDUA 2Q2EB 1VQOI 4CH7A 3CJQB 4HF1A 3RCOA 3RDIA 1HA8A 4G6DA 3H3VK 4BBSJ 4H4KC 5L3GA 1FBSA 5K7HA 5LLQA 1IZ1A 3QODA 2W24A 1FOWA 4L9VA 2HVQA 1GXPA 4A3FJ 2QZ8A 1DUXC 4OIQF 1X1BA 3PO2J 3H5NA 4JQFA 9ANTA 3M4OJ 1D5YA 3BZCA 1R5ID 4XSZF 4LIUA 4I6ZA 2O0YA 1SD7A 3AKZA 2OTJI 1QGPA 4XLFA 2F48A 4HNTA 2CSOA 1OYYA 2D2WA 1NG6A 2YU9J 3H1CA 3DTKA 1BC7C 1K61A 4DJAA 4BHBA 2OF7A 3TL4X 4E7ZA 3BTJA 1U8RA 2OCEA 1I6XA 2F5VA 4HQEA 4RAFA 4A2UA 1D0YA 2JMWA 2YX7A 1YX3A 3SFZA 3VWBA 2VUMJ 5J4VA 1R36A 4A5MA 3LSGA 4E7LA 2OZUA 1QHHD 3BG7A 1T38A 3HOTA 4JX4A 3WHBA 2DOFA 2ZMEC 4B43A 3T1BA 2FMYA 2BV6A 2GOMA 1KZHA 4ZYGA 3RKWA 3AG2H 3RYRA 4OIPF 3GLLA 3IV5A 3UNGC 3PSIA 3R0JA 2ZSIB 4X1EA 4O3MA 2CV0A 4ZYDA 4ETSA 2X6XA 3J7YJ 3LFUA 5ILVA 3PQKA 2VE9A 2E60A 3IWZA 2R7DA 3B6AA 3KIOA 3K4MA 3L1PA 3ZOBA 3HRTA 4I01A 2JUGA 1I39A 2Y48A 3CUQA 1HDPA 4EJUA 2CQKA 1XGOA 2GOXB 4IZZA 1NK2P 4Q4ZF 2NVXJ 3NWSA 2R7VA 5ICEA 3CDIA 5K5RA 1XDUA 4RB3C 3DKYA 2X6OA 3PL8A 1Y0NA 3HJEA 4HA8A 4IL6C 2JK3A 2RNJA 2QQBA 1R71A 1KU9A 3HTUA 4DOZA 4NB5A 2WV0A 2HOAA 2CQNA 4U0YA 1YI2I 4BY1J 2Y0SA 1DU0A 1KA8A 3Q0VA 1N77A 4KA4A 2ME6A 4PSXA 4L9TA 3ASOH 2R93J 2HYJA 2DTRA 1P2FA 1R4NB 2I8DA 3SZPA 1YE9A 3CCMI 4A69C 2GAUA 3AL0C 1X1CA 5EGOA 1XD7A 6PAXA 1RR7A 4AIKA 3OY9A 1QU3A 1O4XA 2K5CA 1ODDA 2Y9YA 2EZLA 3OYLA 5J3LA 2DDBA 4RLFA 3EDPA 4KITB 2Q1ZB 2MH9A 2XPUA 2V9VA 2Y2ZA 1EH6A 3EETA 2F4MB 3DPTA 2VBZA 3O8GA 1Y8RB 3H0DA 1FWZA 1LDJA 2EV0A 4RM3A 5EG0B 3G3ZA 4MLOA 1EKEA 3MKWB 3DU6A 1JGGA 4KN4X 5HS7A 2DBBA 1ZHFA 5D4SA 2Q0OA 1FSEA 2XRLA 4P9FA 1RESA 1U3EM 3VYTB 2IEKA 5LHGA 1P7JA 2EFPA 2OD5A 3HGGA 2OZ6A 1HCRA 4LFUA 2PQ8A 3D0SA 5BQTA 1N25A 2HGCA 2VJ5A 4XMYA 4P5OA 4HX4A 1HKTA 3FWEA 4ESJA 3QRFF 3S16J 1RI7A 2Q8KA 5LFAA 1MNMC 2FA5A 2KMUA 2R7FA 1TQMA 2VBWA 1FNNA 2MLKA 4L9NA 4A0XA 4G9YA 1UAAA 4II2A 1USTA 3M1CA 3CCYA 3G4SI 1A35A 1J5YA 5D6EA 3DEWA 3PUFA 2B63J 3S8PA 1G3TA 3J7ZI 1VQMI 5M5WJ 1HDDC 5FGMA 2V1UA 1P6RA 1ZRFA 2LOOA 1V3FA 2F2EA 2MG4A 2ZFUA 1IXRC 3E5UA 4PFPA 4IJAA 5JLWA 1I1GA 1RETA 3VPRA 5D8KB 2JA7J 3KX2A 4IPAA 2NXNB 2VPRA 2FBIA 2PLYA 2W48A 3OYKA 5HDNA 4ZYAA 1IRZA 3GFLA 3GEZA 3I54A 1ZKGA 2CRGA 2XGXA 4KT6A 4KIBA 5JVTA 1IRXA 1D0XA 2X1CA 1HOMA 1K6OA 3L2RA 1O3TA 4BNCA 1GT0C 2GA1A 2O5RA 2CW8A 3K4LA 1R5HA 1WJ5A 2KZVA 3SHFA 2EBIA 1YRNA 3W2AA 2XUBA 1A36A 2JQ7A 2WAQA 3ERMA 2M8EA 4C2MJ 3EPZA 4KDPA 1Z6RA 1TBXA 4KT5C 3L2WA 2LDUA 1A6IA 2VT3A 1JKRC 2FQ3A 5GAGJ 3JRGA 4ZZLA 2HTSA 2CUEA 1KQ8A 1ORKA 4EEFG 1AU7A 3JAMK 4LITA 3ZQGA 3BJ6A 3DLLF 2DJNA 3BR6A 1ZARA 3GZ5A 2JUCA 5F6FA 3F8NA 3S2HJ 2GA2A 5CQGA 5DM7F 4LB5A 1H8AC 4CYDA 4JX5A 4RB2C 2G7UA 1G59A 3P7NA 3IH3A 3WODF 2QENA 4C3HJ 4M6VA 1ZG1A 1JUMA 3A0BC 4LG0A 3JSPA 1O7FA 1BJAA 1I5ZA 1UCRA 1MMAA 1NHAA 3JCUC 3ABKH 5E3OA 1P4WA 3DTEA 4OINF 3I4MJ 1FBUA 2L7KA 3ULQB 1LFPA 3S15J 1L0OC 2E2IJ 2VOPA 4IHSA 2WB1N 2QGUA 1IF1A 3IH2A 2O61A 2IGNA 4M9XA 3HHHA 2ZC2A 1OMIA 1T33A 4IVNA 3RKYA 1YIOA 2CWEA 3SDGA 4AIJA 2R7UA 1TWGJ 3ZQIA 2E7XA 4I0AA 3HOXJ 5EYRA 5LGTA 1MD0A 3BCBA 2XIGA 1WJEA 4UV9A 4BEHA 4HZFA 1MMDA 2G7HA 2NVQJ 4OIRF 2CH0A 3VSLA 1R4MB 4RLQA 3MKYB 5E1XA 3BPVA 1X2MA 5BNGA 2BEOA 1R22A 2DA7A 1MMGA 4Z2YA 4E7SA 2EPFA 1MH4A 4R8HA 1TWCJ 1NH3A 2HDCA 3RZDJ 2E5ZA 2GXGA 2LC2A 1GVJA 3LSTA 5DCMB 1ONVA 3I5UA 2J5OA 1O7LA 2EZIA 2ZCWA 2A5YB 2O3FA 3CCUI 1ITYA 3SYTA 2RKHA 1MBJA 2MYSA 1X3ZB 3KZYA 4IF4A 5E8GA 1XDSA 3CP8A 2ZJRF 1J75A 2QSFX 3JREA 2L7MP 5DDGA 1WZ2A 5J47A 2JVGA 4IOCF 1UG0A 2A61A 3I4PA 1MBFA 2DLLA 4RBOA 2H09A 4HRIA 3HXLA 2FNPA 4JBAA 4C3JJ 5E3LA 2DOEA 4PJ0C 2NVUB 4BHCA 2LG4A 4MGRA 2ZXIA 2KKOA 2L7FP 3C1DA 3HC7A 2QLZA 3V42A 1MSFC 3BQZA 3H3UA 4PJMA 3BG3A 1KQ0A 1WVRA 4GRIA 2K7LA 4MTDA 1D1CA 2GQQA 4A3DJ 4XM3A 3EUAA 2XSJC 3SEZA 2IGOA 1XC5A 3FHZA 4XONA 2E7WA 3ABLH 2EIMH 3WTSC 4ASNA 4X6AJ 4BHPA 3L00A 2QQAA 1T39A 4E7IA 3O6BB 2IGMA 2OTLI 3TO7A 1BBYA 1ZG5A 3K4JA 2Z3YA 1J2XA 2PMZN 2ZXJA 1JT6A 2B0LA 1R49A 5FLXK 3QPTA 1YYVA 3V8KA 3WE2A 2BHZA 3BZKA 5LHHA 2CUZA 4IHVA 1BC8C 5FRNA 3ASNH 1Z3XA 4EJVA 3H5AA 1U8BA 4L5JA 4CHUA 2E1MB 5ICFA 4I76A 3BQYA 2WWYA 4WCGA 1IDYA 2R92J 4Y52J 2CQXA 1MMNA 3A1YA 5KK1A 2KHMA 1VQ9I 2KJBA 2BHYA 4EATA 3E1SA 1JXSA 4XORA 4ANJA 2GIVA 3K6GA 2HR3A 2HPMA 3QPSA 1G3SA 3K70C 1BOAA 3HUGB 4H0EA 2XGDA 2BY3A 3WHCA 5HDGA 4NHJA 2M8GX 2DA5A 3LSRA 2R7RA 4I7HA 2MA3A 4CA0A 2FMLA 2OAZA 3JAMZ 1R58A 3DU5A 3F8MA 4K2EA 2ESNA 5IYBJ 3HSEA 4LIVA 4AIDA 2HYGD 3LSHA 1IV8A 1B72A 2DCEA 3W2VA 1B59A 1SANA 3NRVA 3W6JB 1KGSA 1LFBA 4HAMA 4M71A 5IT3A 3RKQA 5F04A 4CUGA 2VASA 3HOWJ 2ID3A 2XHKA 4FETA 4D7NA 5IYDJ 2F4OB 4AIHA 5JLXA 2LY2A 4DBRA 4XR6A 1YOVB 1FTTA 3TW7A 5A2QK 5DUKA 4DYCA 1JTXA 1W1WE 4YFNF 1PUFA 3SZTA 4NC8A 4B09A 2K9SA 3BC8A 2LBFB 3TO9A 3N97A 4HSRA 2V1DA 4M3DA 3SDBA 1UHSA 3HRMA 1E17A 2GZWA 1KYWA 4EV0A 2KJCA 5F64A 3CJTB 1X1DA 1JKQC 3U9GA 3OS2A 3CMEI 4ZDLA 4X0GA 4A5NA 2O8KA 2COBA 4MNUA 3LSPA 4CO8A 4NQWA 1OCRH 4HDVA 2V79A 3MMYB 2V9KA 3S2DJ 4Y15A 1FP2A 2EZHA 2G9WA 3C3WA 3F8CA 3P5JA 4BXXJ 2DODA 2ISYA 4MQVA 5GAHJ 3ZQHA 2EFQA 3UKGA 4XKVA 5IOYA 2RN7A 5D5WB 2HU9A 1Z77A 4XQFA 4LK1F 4HYEA 4D7MA 1VQ6I 2BOLA 3QU6A 4HOBA 3RTRA 3OYHA 3DPLC 2WAQN 2VONA 1MKMA 1U9OA 1V54H 4IHWA 2VXZA 5IT9Z 4A3BJ 4L9JA 4WF2A 3Q5FA 4EMSA 2E2HJ 2DW4A 3KETA 2KPMA 4MIMA 2NVTJ 2M0MA 5HLTA 2FQ4A 5DYMA 3KP5A 3S3MA 1IC8A 4UY8I 2Z2SB 4BBRJ 2HQ5A 3V4GA 3E7LA 1V5GA 2XB0X 4YIFA 2XAJA 4BQQA 2EQRA 5IPAA 5EJCA 1G3WA 2RNGA 2D1VA 4BXUA 4LB6B 1E3HA 2JTVA 3PNVA 2VLAA 3RYPA 1CF7B 3N05A 3Q9SA 3TO6A 3CUOA 4NBQA 1QBJA 4WX9A 4RGUA 2JA6J 4GYIA 4U87A 1XPXA 2ELKA 1BJZA 3I56I 3LFKA 4RAGA 1WI9A 2BZTA 2QM3A 2EFWA 4EGYA 1FOKA 1T95A 1D1BA 2QUFA 3E97A 2HQAA 1W5CC 5HLGA 3OYGA 3GWZA 4BUPA 4RA2A 3ZQFA 1IDZA 4A93J 3PFIA 2NS7A 2VB6A 5C4XJ 3K2AA 1ZYRF 3FXQA 4I98B 5KHDA 2B9SA 1OFCX 2DT6A 4LG3A 2I10A 1YW9A 3ZP5A 1V55H 2H6BA 3T8RA 2L7ZA 3RIRA 3WTXC 2UXNA 5BOXA 1MDMA 5D5VB 2XAQA 1T98A 1LVAA 1XCVA 3HSRA 1BR1A 4AYBA 4PK4A 2K86A 3V7CA 5J4YA 1IUYA 1POGA 4JK1X 4ENJA 2K9MA 2E36A 1EV7A 2H8WA 1WCMJ 4RMNA 1OCTC 3O3KA 3KYCB 2H94A 5L3CA 2DK8A 3BROA 2UXXA 1TLHB 2O8XA 4F3QA 4PGGA 1WKMA 2P5KA 1F1ZA 2ZB9A 4A3LJ 1A04A 2LMDA 1VI0A 4YEJA 2QA4I 2UV1A 1XSVA 2ETHA 2EH3A 2IA2A 4Z6YA 2LTPA 2HS5A 4KMFA 1LFUP 3F6VA 2ZJ2A 1SFXA 2JPBA 2PMHA 1R5GA 1FX7A 1NTCA 2CUJA 4M73A 1TT5B 3EYIA 4RM2A 1D3YA 1XMXA 3CLOA 1P4XA 5BPIA 1IUFA 2LKSA 4BACA 5HOOA 4AM3A 1FOYA 2L9NA 2CMPA 1GUUA 1B9MA 3EUKL 2YPRA 1VF9A 2DJIA 2HXIA 1XMAA 5B1AH 1AOYA 5EZGA 3RKXA 5E20A 4P9UA 1LEAA 4A3IJ 3CTAA 3BPXA 2LNBA 3E6MA 4M9SA 3HOUJ 1IN5A 4U7BA 3CUQB 3KP3A 2AXLA 3EGVB 5HS9A 3VYSB 3KZIC 1RNLA 2RV8A 1LE8A 1YX5A 5ICCA 3P9KA 3GFJA 2YR2A 5JHUA 2KRHA 1VQ5I 4BJ6C 1WI3A 2H1LA 2O7OA 3BR2A 4QSHA 3S1MJ 2PX9A 2Y69H 3R0AA 3REOA 1WFXA 1FYKA 1Z6TA 2EFNA 1HSTA 5F0HA 1WJFA 2DFFA 3D5LA 4FISA 5DCFA 4FHTA 5E1ZB 2NNNA 5K7ZA 4XK4A 3OR2C 3MCZA 1B1BA 2DTZA 3UR3C 4IQJA 1D5VA 2WA0A 2LY1A 4IEJA 3DWLE 4CSWA 1UHMA 5EGOB 1YG2A 3GTOJ 1VQ4I 2UWMA 3BWGA 4ZTFA 3VEPA 1XG1A 3IAM2 3A0HC 2CV2A 2W85A 2ZFWA 4ZZDA 2BGCA 1H89C 1WWXA 2XAUA 2ICWG 3WTYC 3GTJJ 3PM1A 2Z16A 2L9SA 2EA4A 2HXOA 4F91B 2PG4A 1B8IA 2QQ9A 4XKBA 4JP0A 2ZNZA 4Q48A 4I02A 4G7OF 2P5LC 2Y0MA 1ZR2A 1U5TC 1UFMA 3BR3A 1Y39A 5F0FA 2NYXA 2GWRA 3IWFA 5KVRA 1TWHJ 4BQOA 1BIAA 3EUHA 3L2UA 4UNOA 1FYMA 3LWFA 3F8FA 4U0WA 1WJDA 3KPHA 1YLFA 4WK8F 5C3EJ 1ZLJA 3ZPLA 3DXJF 4A3EJ 4KIFA 3OSGA 3K7AJ 1QZEA 4M3FA 2BVLA 2K02A 1E0EA 5FLVA 3K4BA 1SFKA 1LDKB 2P6TA 1I1SA 1A6QA 3I64A 1HW5A 2PFBA 2VPLA 3ZMTA 1XCBA 3KP2A 5GADJ 4OOIA 4BXFA 3FBNB 5F0CA 3TDZC 1IGNA 2F4IA 1K83J 4O5VA 3FBIB 2X6WA 2ZBKA 3K9TA 4L5EA 2FBHA 1ZELA 5TJJA 2MC3A 3W6KB 1I50J 5DEQA 2XSDC 1HKQA 4G94A 3QU3A 1TZLA 1SVMA 1BR4A 4JX6A 1JUSA 3CF2A 4ZC3A 4B48A 4EJWA 3C2HA 4YG2F 2X1DA 1G4DA 3MZ8A 5CVVA 2CFXA 3OSFA 4GO1A 3ZMZA 4HSTA 1TW2A 3ELKA 1WIBA 1V5EA 1Y6IA 4M6YA 4V19K 4ZJZA 5LEKA 1RR8C 2CW0F 2VQCA 4PDKA 1ZGWA 3LL7A 4BYYA 2A6TA 2KRFA 3QP6A 1YRNB 5CYVA 3ZRGA 4AWXB 2F5EA 1EH8A 3FM3A 3NAUA 3GBGA 5E3NA 3CDHA 2F6CA 2CUFA 2XV4S 1SVLA 3F22A 5TRDA 2VE8A 4LK0F 4YFKF 1MJBA 1M1EB 1FPQA 4R1HA 3D5RC 3EUHC 3PIOF 4BH9A 4FT8A 2KL4A 2FBKA 2JRTA 3KZZA 4D5CA 1IRGA 4GGGA 1LNWA 1VNDA 3BOQA 3MWMA 4BE1A 2M0CA 4HV5A 3CUQC 4CZZA 1VQNI 2CQ7A 5EDNA 2P7VB 2DPUA 1Z67A 4I2OA 1X19A 2MBFA 2WADA 3Q0WA 4HQMA 3WTUC 3WG9A 4A3CJ 4Y4RA 3TMOA 4XN0A 2GLOA 2XKPA 2WBMA 3M3YJ 3RJPA 1RKWA 3J80K 2DOAA 1V4RA 2XDVA 1YQAA 2XKOA 4NNJA 2K4JA 3BJAA 2LKXA 1E3OC 2XAFA 3GTKJ 4DGWB 1BN5A 5JHFA 4OMYA 3JRDA 2OV7A 4ZDOA 1TT0A 5IP7J 1AA7A 2RREA 4KIGA 3MZHA 4GDFA 4HF2A 2P7CB 3R6SA 1GHCA 3OYDA 1XX5A 4G8XA 1N75A 4MEYF 1SC7A 2NS8A 3I59A 3MEXA 3CC7I 1IN6A 3WTVC 1PP8F 3MAJA 1TNSA 4ENKA 1FMVA 4II3A 3LNQA 4BEHB 1XTAA 3ZMSA 4IHYA 1ETWA 4ZH4F 4WXHA 5FKMA 2R5YA 3CJSB 3G73A 2O6GE 4KN7X 2PJRA 4AYBN 2XPVA 4N4NB 4IKFA 1YW8A 2IA0A 2BVMA 4G6TB 3LA3A 3HOYJ 1RZ4A 1MJAA 2XVCA 4QIWN 5KAFC 4IXAA 2ISZA 3HL2A 3CCQI 1MIJA 2Z5UA 3HPGA 1Z21A 3G1LA 4BKXA 4XIDA 4M74A 4OAZA 3EYYA 1IV6A 2KT0A 5H20A 3KYLA 2LF8A 4ESFA 2RQPA 2Y9ZA 4D0PA 1Z1DA 4ZYHA 3PSFA 3OL3A 2E35A 2LYCA 3G1OA 3K2ZA 5DUIA 4JOMA 3K70D 1S9HA 1AKHA 5EG0A 4V2GA 4IQ4A 3ZCOA 3CCSI 3DFGA 2VI6A 3BTLA 5B3SH 3R4KA 3DBRB 5JI6A 2OQRA 2L3DA 2M4GA 2CQQA 3HIFA 4UXNA 3B02A 3TBIA 4A6DA 3LSJA 5LD2C 1NG7A 4D9JA 1B6AA 2LP0A 1G3YA 2EA2A 2Z1DA 2R7QA 2NVYJ 2ADUA 4RDUA 2KIMA 1QQIA 4L0YB 5M3FJ 2M7BA 1ZLKA 1J09A 4N4OB 2IRFG 4BQAA 2A6EF 2DFHA 2ZXWH 3C7JA 5TISC 3JRCA 3A02A 4XOTA 4QLCU 1S72I 3K69A 2K85A 5CJ9A 1U2WA 3OOPA 5AONA 2XF7A 5HNHA 1J0RA 1TW3A 2RVCA 2MH2A 1UELB 2V6EA 1R1TA 3D5SC 3TKYA 2Y75A 1P4AA 3VYRB 1F9NA 1ERDA 3I4NJ 3JRAA 1MGTA 4S05A 3ABUA 2GXAA 1T6SA 3H9QA 3HYIA 3ONQA 2W7NA 3OIPA 5FKOA 2K40A 4CCNA 1BL0A 1HKSA 1JJ8C 3LA2A 4BAYA 2BXYA 4GFBA 1W4MA 3LMMA 3NARA 1BI2A 1EF4A 3SZGA 3A03A 2UZKA 4HLYA 2M45A 3CESA 1V5FA 2M3AA 1OYIA 2XPWA 4DYRA 1B72B 2OU2A 4CZCA 1C0WA 2DA4A 1JKOC 3S1NJ 1JUPA 4CICA 5GTIC 5ILUA 2K9QA 2C6YA 3A01A 4AD9A 5IOZA 4PJJA 2FSWA 3MZYA 3V7SA 1Z7LA 1OKRA 3FISA 2B7EA 4EM2A 4L5IA 1KU3A 1ZREA 4QPOA 1KU2A 4CYCA 2NS0A 1PUFB 4FQGA 1Y0UA 3SJMA 4UUVA 1BOBA 4HLXA 3ZR8X 2NAZA 5HNFA 1YITI 2M7AA 3DKXA 1OJLA 3FDYA 4IOAF 1PJRA 3I0TA 3QYFA 2A07F 5FFZA 4ESBA 3BR1A 4PUSA 2O9LA 2STTA 2DT7B 3J81K 2VXDA 2R4GA 3GW2A 2KQRA 4A3GJ 2O03A 1MJ9A 2CU7A 2Y0SN 2OC6A 4NQWB 1PDNC 3L7WA 2L2OA 4RB1A 5DD8A 4LMYA 4XKWA 2QKLB 1T2KA 5FRMA 4MFEA 4IRIA 1JGSA 1OQYA 4EM0B 1W7PA 1F5TA 3TOBA 1LB2A 2CW7A 3GF2A 2PI0A 3BLYA 3KCCA 3W2WA 4XLNF 5LHIA 1LJ9A 5K5OA 3BZ6A 1U6GA 1OCOH 2MD0A 2F5DA 2YX4A 1GV5A 3LSKA 2HPIA 4MEXF 3DKWA 3ZQCA 1FT9A 2HOEA 3AG1H 3FKIJ 3JRHA 1ZGAA 1Q1HA 1L3LA 2DFIA 4HBLA 1NK3P 3M1EA 3RZOJ 4QWQA 2NRAC 5IYCJ 2IGKA 2VKHA 3MN2A 3H35A 1QO0D 3FZVA 5B66C 3MKZA 4A3JJ 3N4MA 1Y8QB 2EILH 4V2FA 2QSHX 2HEOA 1FBQA 1UHWA 2LREA 5DCMA 1QVTA 3S32A 1S3JA 2RQQA 2BW3A 2H27A 3DBHB 2P0WA 4WXCA 1O3QA 2P5VA 3BR0A 1O3SA 3E3VA 1D8JA 2HOSA 1R1UA 3HKZA 5GPAA 5CLSA 2EV5A 5M3MJ 3M9AA 2Z9OA 4P96A 4FE7A 1YIJI 5C4JJ 1Z3YA 1ZK8A 2FE3A 2VIXA 2IS2A 1IAWA 3P9CA 4HG2A 4YRVA 3CQZJ 4J01A 5BS6A 1WJBA 2F5CA 1IN8A 1T56A 2CJJA 3S1QJ 2DYRH 3VODA 4DYQA 4ZYEA 1X58A 2WAFA 1SD6A 4U0VA 3IRQA 2K3FA 3OYJA 5KCMA 1UB9A 3Q3SA 1FY7A 3RPUA 1WQ2A 1YFHA 1TP4A 1IN7A 2QCOA 4ITVA 3IL2A 1E2XA 3HHGA 2BE5F 4E7KA 1WRJA 2EZKA 4TV7A 4N0BA 1MMSA 3FKJA 1MDMB 2W1OA 4KMUX 4W1UA 4M3BA 2OPTA 4IO9F 5CVRA 2DMTA 1KQ9A 4ON0A 3RI4A 3QPHA 2XAGA 4KNYA 4S04A 5FROA 3OIOA 2LF7A 1OCZH 3OYCA 1REPC 3NQOA 4Y7NJ 3ROUA 2JZYA 3FK7A 5B1BH 4UUSA 3GTLJ 3TQNA 1IRFA 2JWTA 3BY6A 3GLXA 5CVUA 5J6XA 1K4TA 4YIRX 3OYIA 3ZXSA 2VOOA 1FIPA 2GM4A 2ZJQF 1MH3A 2M87A 4PFOA 3IC7A 1RUOA 3CF5F 1VZ0A 2QKMB 2UUZA 1K78B 5JR3A 1ZRCA 2FOWA 2LFBA 3TDUC 1JHHA 4HNUA 1A5JA 3GUDA 3K4KA 3HDDA 3H3ZA 4XN3A 2HKXA 4QPQA 4CCKA 2VC1A 2FRHA 3M8JA 2R0QC 1BM9A 5HDKA 4XLEA 3VOEA 1ZRDA 1X1AA 1U5TB 2EINH 3AG3H 1D8KA 3G6EI 3TGNA 2IS1A 5CVIA 5LRRA 3F0CA 4A0ZA 4BY7J 1ENHA 2PBIA 1T8IA 1H9TA 1LE8B 4LOCA 5FLXZ 1P92A 5F27A 3HB9A 3FM5A 3J81Z 4YELA 2IW5A 5FKLA 3T0YA 2ACJA 2LY9A 1TQPA 3U21A 3LSIA 3ZN1A 1G6NA 2KP6A 3SFIA 3MVPA 2QEXI 2R5ZA 1MNDA 3GVAA 4FX0A 4N9HA 4J00A 1GDTA 5L3EA 3RSNA 2MD5A 3CDLA 1VQLI 5FLMJ 1ZGJA 3KP4A 1J9IA 2KIQA 3V8LA 3QYBA 5E1WA 2A69F 1T0FA 3U1KA 1SFOJ 5LGUA 2H6CA 4YFXF 2K3PA 2HOTA 4XKCA 3E6DA 1D1AA 5D8LB 5FB2A 3L2CA 3PNYA 2E1OA 4A3KJ 1XGSA 3COAC 5F08A 3GTQJ 3QYEA 4XBFA 3S3OA 3BDDA 4GXOA 3CP2A 1B4AA 2LK2A 2YU3A 1KYZA 3KEOA 3MD2A 5ICGA 2TDXA 1ZH5A 2QYOA 3C2GA 3ESWB 1I3QJ 1KONA 5ERIA 4L18B 1XGMA 1PUEE 4RGSA 1BI3A 3HPHA 2FUG2 2QQ8A 3LA7A 4G7HF 1FLIA 1DPUA 1FOXA 5L3FA 3HOVJ 3SQNA 2COMA 2GIZA 2V9PA 3KLNA 3H9JA 2EIKH 2CGPA 4CCJA 5A2QZ 4DW6A 5HODA 4B3AA 4FASD 3TP0A 2M4KA 4UVAA 2QBYA 1HF0A 2JPCA 3KYDB 4O6JA 1TL8A 2WY7Q 1IXCA 2M34A 1SMYF 2ZMEA 1RKTA 3CCJI 3ABMH 3JTHA 2KRCA 3TEDA 2VC0A 3AG4H 4PCQA 4B8XA 4IRHA 2ZO4A 1Z7UA 3BG5A 4HPQA 3W3CA 2ZXHA 1A31A 2MFZA 4C3IJ 2VBYA 1T0FC 5DTDA 3BG6A 4LLGF 1LDDA 4IRGA 1WPKA 2WB1A 4D1QA 3KLOA 2HDWA 2W84A 1VTNC 2FNAA 3F9KA 2J5PA 3FHNA 4AUXA 4XNFA 2RAEA 4KYWA 3BR5A 1QPIA 2VQLA 1WJCA 4HW0A 3ZMUA 2D5VA 2QSGX 4A6EA 3VSKA 3WG7H 2OQGA 3I53A 2XGEA 4BL0B 2IS6A 1H88C 3AFHA 2XAHA 3OS1A 3IKTA 2R7XA 2PN6A 5D5XB 3GZ6A 1EA3A 2VT2A 2GBYA 2ZSHB 3AAFA 3GTMJ 2DXIA 3S1RJ 3FX3A 2BYVE 4LLLA 1X2NA 4NC7A 5H6RA 2WC2A 2IS4A 2CO5A 1LEBA 1LVKA 2V1NA 4XLPF 5DD4A 1R9TJ 3R60A 3BJOA 4BJTA 1S7EA 1I27A 3OL4A 3SEQA 3QWLA 3WU0A 1EJ9A 4RAZA 3HKZN 3ISPA 3G71I 1R23A 3NEUA 1I3AA 2VN2A 4Y3OA 4F7ZA 3E6CC 1Y1WJ 2K27A 3ECHA 2DA1A 1RRJA 2HFHA 2VBXA 1QHGA 3MKLA 4CCOA 2ZJPF 3WGHA 1ETVA 1Y56A 3HRSA 1IXSB 5FD6A 2BBYA 3GFMA 4CGZA 3CMYA 3E5XA 4DQ2A 4NC6A 2DA6A 1QA6A 4MTEA 2VODA 2FXAA 1MBEA 2DMNA 3GZNB 4A12A 2M2EA 5H2FC 2HI3A 2CV1A 1VQ7I 1Z9CA 3L2VA 2RC4A 4FCYA 3I59B 2V4JC 1GLNA 1XSDA 1OISA 1GV2A 2Q2EA 1YHQI 4WWCA 3HRUA 4WXDA 5J1YA 2HQRA 2W82A 1GXQA 2OJED 1HBXG 1U78A 2X4HA 2XROA 1R7JA 3A4CA 1SEUA 3I58A 4Y33A 4HNVA 3IHUA 3QP5A 4Q47A 2R5YB 5IP6A 2PMZA 4L0ZB 4C9YA 2RGVA 2PJRB 2X51A 5AIQA 2GXBA 1WGXA 3HEFA 3ZQ7A 3OYEA 3S3NA 5J8CA 2MABA 1P9QC 3S17J 2L02A 1ZTRA 2F5FA 1TWAJ 4UVBA 4OIOF 2JA8J 1TNTA 1Y1VJ 2N8GA 4ABZA 1OCCH 3X2QH 1K79A 2W57A 3DEUA 4F52A 3M8EA 3IKVA 3PQJA 2W4SA 4ENMA 1KU7A 3F3XA 1FZPB 4RAYA 1I6HJ 1ETYA 2BY1A 1OR7A 1VQKI 5EEGA 3ZQQA 5FKNA 2WTEA 2LD5A 2HZTA 3FXUA 3U1DA 2XF6A 3ZMVA 4JYKA 3FXKA 3KEQA 2JSCA 2R7OA 3FXJA 5L3DA 2VJIA 2TRTA 1HXDA 2FD5A 4FE4A 4J19A 2IPQX 5FFXA 5KNLA 2KISA 2DN0A 3K4NA 3MQ0A 4BE0A 4F92B 1UG2A 2XGCA 2ESHA 4XRMA 1N78A 2P81A 1ZAOA 4G12A 2Z33A 2EV6A 2P8TA 1RIOH 4LG0B 3GFIA 1APLC 1AKHB 2AQEA 3CLQA 2VL8A 1WSUA 5EEHA 4M72A 1W5TA 1S29A 2NNYA 2D1HA 1WH5A 2VJ4A 2DQRA 1Z05A 3PIPF 3HOZJ 3I3LA 4XICA 5J1UA 3IUOA 2E19A 2XASA 3PFYA 1W5SA 3BTIA 2IVMA 3DV8A 3DTIA 3FXRA 4OMZA 4B3XA 1YS6A 4IX7A 2R7TA 2NOGA 2HQNA 2DU9A 2LSOA 2DMPA 3HGYA 3CJRB 3QOEA 5FD5A 2AXTC 1XMKA 2L5QA 1O57A 1FP1D 2M5WA 2AS5F 2KIFA 1S7OA 5BPDA 2XF5A 2DAOA 1F43A 2JVHA 2KIUA 2E1NA 1LQ1A 2CG4A 2LKPA 3CZ6A 5J40A 2W25A 3L2QA 4BGDA 4BU2A 3DQVC 3I71A 2A05A 1E3PA 4CCMA 4FX4A 3JW4A 4EJTA 5B5EC 1VQPI 1OR7C 3OOUA 4OAYA 3V7RA 1PVEA 4XLAA 1Z91A 5CQEA 1FEXA 2Y30A 5CKTA 3CCRI 4ENNA 2ZKZA 3M7GA 2W00A 2LH9A 2DMQA 1X3WB 2P6SA 5DS9A 2CFOA 4UB6C 3E0JB 3CC4I 1BW5A 1FMWA 2MSYA 3QAHA 1G8XA 1SAXA 3IH4A 3PUBA 1BIBA 3OV8A 1WHUA 3WU2C 1SVOA 4D5FA 4DNCA 5L3BA 3JRFA 1IJWC 4E4HA 4YIIA 1MZBA 1FYLA 5LGNA 1W36D 2CS3A 3OWTA 3A01B 3HOSA 1F4KA 4XLCA 3FK6A 2D45A 4AVZA 2L01A 2P4WA 1BW6A 3ML6A 2DQLA 4BDYA 3Q0UA 2E1CA 1OLTA 2BY0A 1P7IA 5JFRA 1G2HA 4GYGA 1DGWY 4CYCB 2L54A 4RGRA 2R7SA 3K1NA 3ZMDA 2R3SA 2A6HF 1LUJB 4DBQA 5EF6A 2DFEA 2M1BA 1W0UA 3I55I 1ZR4A 5E3MA 3W6VA 1TC3C 3L9FA 2H8RA 3GCMA 2DI3A 2HZDA 4FTHA 5BMZA 2L9VA 4LJZF 2YS9A 3JRIA 4I0BA 2DO7A 1PP7U 5D4RA 2IA1A 1OCPA 3WTZA 1ZG3A 2V7FA 3WGIA 3OYBA 1H9GA 4RS8A 3WE3A 4HEA2 3G1MA 3BTCA 1ETKA 5E8IA 1IO2A 2MLGA 3QPLA 4MFDA 4N9IA 1Q1VA 3Q9VA 4M6XA 5GP9A 4I99C 2KFDA 3HTSB 2PMUA 3DP7A 4PJLA 1UJ8A 2E34A 3ABTA 3RQ4A 1W7PB 3HG9A 1XS9A 1IG7A 5ED4A 2PJPA 1XSXA 3DLAA 3CCVI 4W97A 1DPRA 1ON2A 4M3EA 3JRBA 2X85A 1ZN2A 3R61A 1MSEC 4IHTA 4DIQA 1SD4A 3P9IA 5D6FA 2IJLA 5H6QA 3LAPA 1R00A 1YTYA 4CDGA 1T08B 4BDZA 1JHFA 2VQHA 1SD5A 2OCCH 1YS7A 3ZGKA 1AHDP 3K4CA 4DZPA 1W7PD 4G7ZF 3OYNA 4EGZA 2ECCA 3KEYA 3DBLB 1WH7A 3F8BA 3K1PA 4A0YA 5D5UB 1HSJA 4E70A 2ME0A 2AO9A 3F6OA 2IT0A 5FKKA 2STWA 3HM5A 2M9HA 2BW3B 1Z0XA 5F1JA 5HLHA 4RGXA 5IT9K 2X9DA 4Y13A 1S6LA 1IN4A 3FXLA 5GPCA 3EQLF 4UHTA 3J80Z 1FIAA 4UUTA 4E6KG 1CGPA 3E6BA 1JJ6C 1MBGA 3FXMA 3OIQA 2VKVA 5E18F 5EZHA 4R79A 2NOJB 3DEEA 2VKEA 5K1YA 1X1PA 2VJJA 3H92A 2EK5A 3K1MA 3JTGA 3B73A 5M5XJ 3GMEA 2XB5A 2ELHA 3K0LA 3G2BA 4AU7A 1ACIA 4NUBA 3LAJA 3ZN0A 4B4CA 3J7AO 3DPUA 2HTJA 4MHGA 4B44A 3H0GJ 2ZNYA 3GYHX 3T8TA 4E7HA 3VYUB 2TCTA 3KP6A 2A3SA 1XB4A 3ZQLA 3MFKA 2BY2A 3OR1C 4P55A 2Z99A 1UZCA 2M30A 1QNTA 1W36C 2E5NA 5C44J 3RPUD 3IP4B 1K7AA 2IXSA 3T5XA 3M07A 5IP9J 3FMQA 1R1VA 4GCVA 2DA2A 4BS9A 2BXZA 3QOPA 1BA5A 1VFCA 5GTHC 4AVPA 2FX0A 5HS8A 1PYVA 1QVUA 4U88A 2JA5J 4UUSB 1O3RA 1QPMA 1BI0A 2YUSA 2X48A 5LRSA 2HDDA 1YJWI 2IBDA 3TP3A 4E7JA 4MQ9F 2WV1A 3TOAA 2FJ1A 1IW7F 1UMQA 3M8FA 1SAUA 3F72A 1YO5C 1LPQA 1SFUA 2L9RA 1JI8A 4M9ZA
chains in the Genus database with same CATH topology
3CCQI 3CCEI 3G71I 2OTJI 3CJRB 2ZJPF 5DM6F 3EGVB 1VQ9I 1YJNI 1MMSA 4IO9F 1YITI 4UY8I 1WIBA 1HC8A 3CC2I 4IOAF 4V19K 1QA6A 1VQ5I 5GAEJ 2E35A 1VQPI 1VQ7I 1FOXA 1YHQI 1YJ9I 3CCRI 3CCSI 3CMAI 2ZJQF 3PIOF 3CF5F 3G4SI 3CD6I 3I56I 3CC4I 2FOWA 3J7ZI 1VQMI 1VQ4I 3CCJI 1VQNI 3J7YJ 1ACIA 1VQ8I 3CCUI 1S72I 2NXNB 2ZJRF 3G6EI 1VQKI 4IOCF 2E36A 1Y39A 2H8WA 3I55I 3CJTB 3CMEI 2JQ7A 3CC7I 1YI2I 2QA4I 3CCLI 5JVGF 5GAGJ 1YIJI 2QEXI 1VQOI 3CJQB 3DLLF 1YJWI 3CCMI 3CJSB 1VQLI 3PIPF 1FOWA 5GAHJ 5DM7F 2OTLI 5GADJ 2E34A 1FOYA 1VQ6I 3CCVI 2K3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ I;  3CCE I;  3G71 I;  2OTJ I;  3CJR B;  2ZJP F;  5DM6 F;  3EGV B;  1VQ9 I;  1YJN I;  1MMS A;  4IO9 F;  1YIT I;  4UY8 I;  1WIB A;  1HC8 A;  3CC2 I;  4IOA F;  4V19 K;  1QA6 A;  1VQ5 I;  5GAE J;  2E35 A;  1VQP I;  1VQ7 I;  1FOX A;  1YHQ I;  1YJ9 I;  3CCR I;  3CCS I;  3CMA I;  2ZJQ F;  3PIO F;  3CF5 F;  3G4S I;  3CD6 I;  3I56 I;  3CC4 I;  2FOW A;  3J7Z I;  1VQM I;  1VQ4 I;  3CCJ I;  1VQN I;  3J7Y J;  1ACI A;  1VQ8 I;  3CCU I;  1S72 I;  2NXN B;  2ZJR F;  3G6E I;  1VQK I;  4IOC F;  2E36 A;  1Y39 A;  2H8W A;  3I55 I;  3CJT B;  3CME I;  2JQ7 A;  3CC7 I;  1YI2 I;  2QA4 I;  3CCL I;  5JVG F;  5GAG J;  1YIJ I;  2QEX I;  1VQO I;  3CJQ B;  3DLL F;  1YJW I;  3CCM I;  3CJS B;  1VQL I;  3PIP F;  1FOW A;  5GAH J;  5DM7 F;  2OTL I;  5GAD J;  2E34 A;  1FOY A;  1VQ6 I;  3CCV I;  2K3F A; 
#chains in the Genus database with same CATH topology
 2IAI A;  4CXF A;  2L4A A;  2VQG A;  3VDX A;  2R7Z J;  2EIJ H;  5IY5 H;  2EFO A;  2CYY A;  4I09 A;  1FSH A;  3OMY A;  3S2W A;  2KLO A;  1MNE A;  3DCF A;  5DM6 F;  2JT1 A;  1YJN I;  2AQF A;  2FEZ A;  4C2T A;  3HZJ A;  4LD5 A;  2JSP A;  2X6Y A;  3GO5 A;  3CO6 C;  4KIC A;  4UV8 A;  1RPW A;  1K6Y A;  5LBQ A;  3OYF A;  2I5U A;  2R7W A;  1U9N A;  5GAE J;  4KUM A;  1W0T A;  2OA4 A;  1DDN A;  2V6C A;  2ELJ A;  1ETQ A;  4ZTJ A;  1AWC A;  4UVC A;  2E2J J;  5DV5 A;  1STZ A;  4XRS A;  4EJO A;  3H5R A;  3I9V 2;  1X4O A;  5K7F A;  2AHQ A;  3KFW X;  2IP2 A;  5CPR B;  5AIP A;  3CMA I;  4XOP A;  4B1R A;  3IRR A;  2H1K A;  2R5Z B;  3HSF A;  1OYW A;  3LSM A;  5LEJ A;  1J7K A;  1OPC A;  4XL9 A;  2HNH A;  1QZZ A;  2FOK A;  4RB0 A;  3PJR A;  1D0Z A;  1QZY A;  2DA3 A;  4F93 B;  4LGW A;  4HX7 A;  5F1R A;  4XSX F;  3S93 A;  1GVD A;  3VB2 A;  1S5L C;  2DMU A;  3BG9 A;  3RPQ A;  3LOC A;  1S8N A;  3WU1 B;  4C2U A;  1FC3 A;  1SFE A;  4HX8 A;  1DGR M;  1MBK A;  2HWV A;  2LR8 A;  4NDL A;  4ZDP A;  4U7D A;  3FF5 A;  2EB7 A;  4EVI A;  2ECB A;  1XN7 A;  1JTY A;  1BR2 A;  3JSO A;  3PNT A;  4P1W A;  3ERE D;  3H36 A;  3OYM A;  3F23 A;  1DP7 P;  3HUG A;  1FTZ A;  4AC0 A;  2QVO A;  2KDO A;  3CO7 C;  4LLN A;  1MBH A;  3FXO A;  3BT9 A;  2MC4 A;  4PSW A;  2JJ7 A;  1K4S A;  5J8F A;  3DF8 A;  3WTT C;  4DZJ A;  1JT0 A;  5HVQ C;  5JVG F;  1HLV A;  3PO3 J;  2V26 A;  4F55 A;  3GX4 X;  4PGH A;  1CQT A;  1TTY A;  1USS A;  2L4M A;  3BP8 A;  2A68 F;  1HW2 A;  2WAE A;  3B6C A;  5FJ8 J;  2LRD A;  5J1R A;  2QBY B;  2HYF A;  4Y17 A;  2EJR A;  5HLI A;  4KFC A;  3O8H A;  2MGQ A;  1J59 A;  4XRF A;  2ZME B;  1F36 A;  4QTR A;  1DQU A;  1TWF J;  4A3M J;  3CCE I;  5KAI C;  1SMT A;  1ZQ3 P;  2KDZ A;  1DP3 A;  1X4P A;  2DDA A;  4G6Q A;  1R6R A;  3BCA A;  3U2R A;  4KJZ A;  2LBF A;  1HW1 A;  1ULY A;  2YSR A;  4HV6 A;  4PJN A;  5E17 F;  2FF4 A;  1LKX A;  2E1M C;  3S14 J;  4BQN A;  5ILS A;  1RUN A;  2DK5 A;  2WY8 Q;  1HC8 A;  3SXY A;  3CC2 I;  4CCL A;  2XC7 A;  5K5Q A;  2VKD A;  1EH7 A;  3KE2 A;  4MO7 A;  3HBL A;  2K9N A;  1B9N A;  2LVS A;  3L09 A;  4EM1 A;  1MW7 A;  2HVR A;  4M3G A;  2Y31 A;  2MW8 A;  2ID6 A;  4XRS G;  4B47 A;  2V1X A;  4XLH A;  3WTW C;  1YJ9 I;  4S0H B;  2HKO A;  3CMM A;  1JKP C;  2DT5 A;  1ETX A;  4EQQ A;  3LQR A;  2OUM A;  2HVS A;  2OBP A;  3J7A Y;  5M5Y J;  3FMR A;  1X3U A;  1H0M A;  3C18 A;  1HQC A;  3O2P E;  4UB8 C;  3F21 A;  3CD6 I;  4HF0 A;  1U0J A;  1RC9 A;  1B8I B;  3OYA A;  3GXO A;  2A5W A;  3CJN A;  5E79 C;  3TW6 A;  3ECO A;  4BJ5 C;  3D1N I;  3RQI A;  2JA2 A;  2DYS H;  1S7A A;  2LLK A;  3JR9 A;  1XGN A;  2JRM A;  4C30 A;  3QQA A;  1ON1 A;  3KP7 A;  3K10 A;  3AL0 B;  3VFZ A;  1ETO A;  4OWR B;  4KIS A;  2E71 A;  1JE8 A;  1VQ8 I;  2RDP A;  1TQI A;  3C2B A;  4BE2 A;  3FMS A;  3GTP J;  3LQQ A;  2KZG A;  3FIW A;  3WGG A;  3NWT A;  1BI1 A;  2PEX A;  5FO5 A;  3E5Q A;  5TGT A;  1K78 A;  5EEA A;  2DPD A;  1YW7 A;  2X0L A;  2L0K A;  1FJL A;  2JN6 A;  3H9G A;  5CVJ A;  1WJA A;  2XRN A;  3IAS 2;  1QRY A;  3V8J A;  1DU6 A;  3GTG J;  2G0E A;  2FU4 A;  3A2K A;  2QWW A;  2X1E A;  2EWN A;  2K4B A;  1U5T A;  2QF7 A;  1CF7 A;  4Q5S F;  4IHX A;  4PZJ A;  2K9L A;  3CCL I;  4OU0 A;  3OS0 A;  4HDU A;  2Q2E B;  1VQO I;  4CH7 A;  3CJQ B;  4HF1 A;  3RCO A;  3RDI A;  1HA8 A;  4G6D A;  3H3V K;  4BBS J;  4H4K C;  5L3G A;  1FBS A;  5K7H A;  5LLQ A;  1IZ1 A;  3QOD A;  2W24 A;  1FOW A;  4L9V A;  2HVQ A;  1GXP A;  4A3F J;  2QZ8 A;  1DUX C;  4OIQ F;  1X1B A;  3PO2 J;  3H5N A;  4JQF A;  9ANT A;  3M4O J;  1D5Y A;  3BZC A;  1R5I D;  4XSZ F;  4LIU A;  4I6Z A;  2O0Y A;  1SD7 A;  3AKZ A;  2OTJ I;  1QGP A;  4XLF A;  2F48 A;  4HNT A;  2CSO A;  1OYY A;  2D2W A;  1NG6 A;  2YU9 J;  3H1C A;  3DTK A;  1BC7 C;  1K61 A;  4DJA A;  4BHB A;  2OF7 A;  3TL4 X;  4E7Z A;  3BTJ A;  1U8R A;  2OCE A;  1I6X A;  2F5V A;  4HQE A;  4RAF A;  4A2U A;  1D0Y A;  2JMW A;  2YX7 A;  1YX3 A;  3SFZ A;  3VWB A;  2VUM J;  5J4V A;  1R36 A;  4A5M A;  3LSG A;  4E7L A;  2OZU A;  1QHH D;  3BG7 A;  1T38 A;  3HOT A;  4JX4 A;  3WHB A;  2DOF A;  2ZME C;  4B43 A;  3T1B A;  2FMY A;  2BV6 A;  2GOM A;  1KZH A;  4ZYG A;  3RKW A;  3AG2 H;  3RYR A;  4OIP F;  3GLL A;  3IV5 A;  3UNG C;  3PSI A;  3R0J A;  2ZSI B;  4X1E A;  4O3M A;  2CV0 A;  4ZYD A;  4ETS A;  2X6X A;  3J7Y J;  3LFU A;  5ILV A;  3PQK A;  2VE9 A;  2E60 A;  3IWZ A;  2R7D A;  3B6A A;  3KIO A;  3K4M A;  3L1P A;  3ZOB A;  3HRT A;  4I01 A;  2JUG A;  1I39 A;  2Y48 A;  3CUQ A;  1HDP A;  4EJU A;  2CQK A;  1XGO A;  2GOX B;  4IZZ A;  1NK2 P;  4Q4Z F;  2NVX J;  3NWS A;  2R7V A;  5ICE A;  3CDI A;  5K5R A;  1XDU A;  4RB3 C;  3DKY A;  2X6O A;  3PL8 A;  1Y0N A;  3HJE A;  4HA8 A;  4IL6 C;  2JK3 A;  2RNJ A;  2QQB A;  1R71 A;  1KU9 A;  3HTU A;  4DOZ A;  4NB5 A;  2WV0 A;  2HOA A;  2CQN A;  4U0Y A;  1YI2 I;  4BY1 J;  2Y0S A;  1DU0 A;  1KA8 A;  3Q0V A;  1N77 A;  4KA4 A;  2ME6 A;  4PSX A;  4L9T A;  3ASO H;  2R93 J;  2HYJ A;  2DTR A;  1P2F A;  1R4N B;  2I8D A;  3SZP A;  1YE9 A;  3CCM I;  4A69 C;  2GAU A;  3AL0 C;  1X1C A;  5EGO A;  1XD7 A;  6PAX A;  1RR7 A;  4AIK A;  3OY9 A;  1QU3 A;  1O4X A;  2K5C A;  1ODD A;  2Y9Y A;  2EZL A;  3OYL A;  5J3L A;  2DDB A;  4RLF A;  3EDP A;  4KIT B;  2Q1Z B;  2MH9 A;  2XPU A;  2V9V A;  2Y2Z A;  1EH6 A;  3EET A;  2F4M B;  3DPT A;  2VBZ A;  3O8G A;  1Y8R B;  3H0D A;  1FWZ A;  1LDJ A;  2EV0 A;  4RM3 A;  5EG0 B;  3G3Z A;  4MLO A;  1EKE A;  3MKW B;  3DU6 A;  1JGG A;  4KN4 X;  5HS7 A;  2DBB A;  1ZHF A;  5D4S A;  2Q0O A;  1FSE A;  2XRL A;  4P9F A;  1RES A;  1U3E M;  3VYT B;  2IEK A;  5LHG A;  1P7J A;  2EFP A;  2OD5 A;  3HGG A;  2OZ6 A;  1HCR A;  4LFU A;  2PQ8 A;  3D0S A;  5BQT A;  1N25 A;  2HGC A;  2VJ5 A;  4XMY A;  4P5O A;  4HX4 A;  1HKT A;  3FWE A;  4ESJ A;  3QRF F;  3S16 J;  1RI7 A;  2Q8K A;  5LFA A;  1MNM C;  2FA5 A;  2KMU A;  2R7F A;  1TQM A;  2VBW A;  1FNN A;  2MLK A;  4L9N A;  4A0X A;  4G9Y A;  1UAA A;  4II2 A;  1UST A;  3M1C A;  3CCY A;  3G4S I;  1A35 A;  1J5Y A;  5D6E A;  3DEW A;  3PUF A;  2B63 J;  3S8P A;  1G3T A;  3J7Z I;  1VQM I;  5M5W J;  1HDD C;  5FGM A;  2V1U A;  1P6R A;  1ZRF A;  2LOO A;  1V3F A;  2F2E A;  2MG4 A;  2ZFU A;  1IXR C;  3E5U A;  4PFP A;  4IJA A;  5JLW A;  1I1G A;  1RET A;  3VPR A;  5D8K B;  2JA7 J;  3KX2 A;  4IPA A;  2NXN B;  2VPR A;  2FBI A;  2PLY A;  2W48 A;  3OYK A;  5HDN A;  4ZYA A;  1IRZ A;  3GFL A;  3GEZ A;  3I54 A;  1ZKG A;  2CRG A;  2XGX A;  4KT6 A;  4KIB A;  5JVT A;  1IRX A;  1D0X A;  2X1C A;  1HOM A;  1K6O A;  3L2R A;  1O3T A;  4BNC A;  1GT0 C;  2GA1 A;  2O5R A;  2CW8 A;  3K4L A;  1R5H A;  1WJ5 A;  2KZV A;  3SHF A;  2EBI A;  1YRN A;  3W2A A;  2XUB A;  1A36 A;  2JQ7 A;  2WAQ A;  3ERM A;  2M8E A;  4C2M J;  3EPZ A;  4KDP A;  1Z6R A;  1TBX A;  4KT5 C;  3L2W A;  2LDU A;  1A6I A;  2VT3 A;  1JKR C;  2FQ3 A;  5GAG J;  3JRG A;  4ZZL A;  2HTS A;  2CUE A;  1KQ8 A;  1ORK A;  4EEF G;  1AU7 A;  3JAM K;  4LIT A;  3ZQG A;  3BJ6 A;  3DLL F;  2DJN A;  3BR6 A;  1ZAR A;  3GZ5 A;  2JUC A;  5F6F A;  3F8N A;  3S2H J;  2GA2 A;  5CQG A;  5DM7 F;  4LB5 A;  1H8A C;  4CYD A;  4JX5 A;  4RB2 C;  2G7U A;  1G59 A;  3P7N A;  3IH3 A;  3WOD F;  2QEN A;  4C3H J;  4M6V A;  1ZG1 A;  1JUM A;  3A0B C;  4LG0 A;  3JSP A;  1O7F A;  1BJA A;  1I5Z A;  1UCR A;  1MMA A;  1NHA A;  3JCU C;  3ABK H;  5E3O A;  1P4W A;  3DTE A;  4OIN F;  3I4M J;  1FBU A;  2L7K A;  3ULQ B;  1LFP A;  3S15 J;  1L0O C;  2E2I J;  2VOP A;  4IHS A;  2WB1 N;  2QGU A;  1IF1 A;  3IH2 A;  2O61 A;  2IGN A;  4M9X A;  3HHH A;  2ZC2 A;  1OMI A;  1T33 A;  4IVN A;  3RKY A;  1YIO A;  2CWE A;  3SDG A;  4AIJ A;  2R7U A;  1TWG J;  3ZQI A;  2E7X A;  4I0A A;  3HOX J;  5EYR A;  5LGT A;  1MD0 A;  3BCB A;  2XIG A;  1WJE A;  4UV9 A;  4BEH A;  4HZF A;  1MMD A;  2G7H A;  2NVQ J;  4OIR F;  2CH0 A;  3VSL A;  1R4M B;  4RLQ A;  3MKY B;  5E1X A;  3BPV A;  1X2M A;  5BNG A;  2BEO A;  1R22 A;  2DA7 A;  1MMG A;  4Z2Y A;  4E7S A;  2EPF A;  1MH4 A;  4R8H A;  1TWC J;  1NH3 A;  2HDC A;  3RZD J;  2E5Z A;  2GXG A;  2LC2 A;  1GVJ A;  3LST A;  5DCM B;  1ONV A;  3I5U A;  2J5O A;  1O7L A;  2EZI A;  2ZCW A;  2A5Y B;  2O3F A;  3CCU I;  1ITY A;  3SYT A;  2RKH A;  1MBJ A;  2MYS A;  1X3Z B;  3KZY A;  4IF4 A;  5E8G A;  1XDS A;  3CP8 A;  2ZJR F;  1J75 A;  2QSF X;  3JRE A;  2L7M P;  5DDG A;  1WZ2 A;  5J47 A;  2JVG A;  4IOC F;  1UG0 A;  2A61 A;  3I4P A;  1MBF A;  2DLL A;  4RBO A;  2H09 A;  4HRI A;  3HXL A;  2FNP A;  4JBA A;  4C3J J;  5E3L A;  2DOE A;  4PJ0 C;  2NVU B;  4BHC A;  2LG4 A;  4MGR A;  2ZXI A;  2KKO A;  2L7F P;  3C1D A;  3HC7 A;  2QLZ A;  3V42 A;  1MSF C;  3BQZ A;  3H3U A;  4PJM A;  3BG3 A;  1KQ0 A;  1WVR A;  4GRI A;  2K7L A;  4MTD A;  1D1C A;  2GQQ A;  4A3D J;  4XM3 A;  3EUA A;  2XSJ C;  3SEZ A;  2IGO A;  1XC5 A;  3FHZ A;  4XON A;  2E7W A;  3ABL H;  2EIM H;  3WTS C;  4ASN A;  4X6A J;  4BHP A;  3L00 A;  2QQA A;  1T39 A;  4E7I A;  3O6B B;  2IGM A;  2OTL I;  3TO7 A;  1BBY A;  1ZG5 A;  3K4J A;  2Z3Y A;  1J2X A;  2PMZ N;  2ZXJ A;  1JT6 A;  2B0L A;  1R49 A;  5FLX K;  3QPT A;  1YYV A;  3V8K A;  3WE2 A;  2BHZ A;  3BZK A;  5LHH A;  2CUZ A;  4IHV A;  1BC8 C;  5FRN A;  3ASN H;  1Z3X A;  4EJV A;  3H5A A;  1U8B A;  4L5J A;  4CHU A;  2E1M B;  5ICF A;  4I76 A;  3BQY A;  2WWY A;  4WCG A;  1IDY A;  2R92 J;  4Y52 J;  2CQX A;  1MMN A;  3A1Y A;  5KK1 A;  2KHM A;  1VQ9 I;  2KJB A;  2BHY A;  4EAT A;  3E1S A;  1JXS A;  4XOR A;  4ANJ A;  2GIV A;  3K6G A;  2HR3 A;  2HPM A;  3QPS A;  1G3S A;  3K70 C;  1BOA A;  3HUG B;  4H0E A;  2XGD A;  2BY3 A;  3WHC A;  5HDG A;  4NHJ A;  2M8G X;  2DA5 A;  3LSR A;  2R7R A;  4I7H A;  2MA3 A;  4CA0 A;  2FML A;  2OAZ A;  3JAM Z;  1R58 A;  3DU5 A;  3F8M A;  4K2E A;  2ESN A;  5IYB J;  3HSE A;  4LIV A;  4AID A;  2HYG D;  3LSH A;  1IV8 A;  1B72 A;  2DCE A;  3W2V A;  1B59 A;  1SAN A;  3NRV A;  3W6J B;  1KGS A;  1LFB A;  4HAM A;  4M71 A;  5IT3 A;  3RKQ A;  5F04 A;  4CUG A;  2VAS A;  3HOW J;  2ID3 A;  2XHK A;  4FET A;  4D7N A;  5IYD J;  2F4O B;  4AIH A;  5JLX A;  2LY2 A;  4DBR A;  4XR6 A;  1YOV B;  1FTT A;  3TW7 A;  5A2Q K;  5DUK A;  4DYC A;  1JTX A;  1W1W E;  4YFN F;  1PUF A;  3SZT A;  4NC8 A;  4B09 A;  2K9S A;  3BC8 A;  2LBF B;  3TO9 A;  3N97 A;  4HSR A;  2V1D A;  4M3D A;  3SDB A;  1UHS A;  3HRM A;  1E17 A;  2GZW A;  1KYW A;  4EV0 A;  2KJC A;  5F64 A;  3CJT B;  1X1D A;  1JKQ C;  3U9G A;  3OS2 A;  3CME I;  4ZDL A;  4X0G A;  4A5N A;  2O8K A;  2COB A;  4MNU A;  3LSP A;  4CO8 A;  4NQW A;  1OCR H;  4HDV A;  2V79 A;  3MMY B;  2V9K A;  3S2D J;  4Y15 A;  1FP2 A;  2EZH A;  2G9W A;  3C3W A;  3F8C A;  3P5J A;  4BXX J;  2DOD A;  2ISY A;  4MQV A;  5GAH J;  3ZQH A;  2EFQ A;  3UKG A;  4XKV A;  5IOY A;  2RN7 A;  5D5W B;  2HU9 A;  1Z77 A;  4XQF A;  4LK1 F;  4HYE A;  4D7M A;  1VQ6 I;  2BOL A;  3QU6 A;  4HOB A;  3RTR A;  3OYH A;  3DPL C;  2WAQ N;  2VON A;  1MKM A;  1U9O A;  1V54 H;  4IHW A;  2VXZ A;  5IT9 Z;  4A3B J;  4L9J A;  4WF2 A;  3Q5F A;  4EMS A;  2E2H J;  2DW4 A;  3KET A;  2KPM A;  4MIM A;  2NVT J;  2M0M A;  5HLT A;  2FQ4 A;  5DYM A;  3KP5 A;  3S3M A;  1IC8 A;  4UY8 I;  2Z2S B;  4BBR J;  2HQ5 A;  3V4G A;  3E7L A;  1V5G A;  2XB0 X;  4YIF A;  2XAJ A;  4BQQ A;  2EQR A;  5IPA A;  5EJC A;  1G3W A;  2RNG A;  2D1V A;  4BXU A;  4LB6 B;  1E3H A;  2JTV A;  3PNV A;  2VLA A;  3RYP A;  1CF7 B;  3N05 A;  3Q9S A;  3TO6 A;  3CUO A;  4NBQ A;  1QBJ A;  4WX9 A;  4RGU A;  2JA6 J;  4GYI A;  4U87 A;  1XPX A;  2ELK A;  1BJZ A;  3I56 I;  3LFK A;  4RAG A;  1WI9 A;  2BZT A;  2QM3 A;  2EFW A;  4EGY A;  1FOK A;  1T95 A;  1D1B A;  2QUF A;  3E97 A;  2HQA A;  1W5C C;  5HLG A;  3OYG A;  3GWZ A;  4BUP A;  4RA2 A;  3ZQF A;  1IDZ A;  4A93 J;  3PFI A;  2NS7 A;  2VB6 A;  5C4X J;  3K2A A;  1ZYR F;  3FXQ A;  4I98 B;  5KHD A;  2B9S A;  1OFC X;  2DT6 A;  4LG3 A;  2I10 A;  1YW9 A;  3ZP5 A;  1V55 H;  2H6B A;  3T8R A;  2L7Z A;  3RIR A;  3WTX C;  2UXN A;  5BOX A;  1MDM A;  5D5V B;  2XAQ A;  1T98 A;  1LVA A;  1XCV A;  3HSR A;  1BR1 A;  4AYB A;  4PK4 A;  2K86 A;  3V7C A;  5J4Y A;  1IUY A;  1POG A;  4JK1 X;  4ENJ A;  2K9M A;  2E36 A;  1EV7 A;  2H8W A;  1WCM J;  4RMN A;  1OCT C;  3O3K A;  3KYC B;  2H94 A;  5L3C A;  2DK8 A;  3BRO A;  2UXX A;  1TLH B;  2O8X A;  4F3Q A;  4PGG A;  1WKM A;  2P5K A;  1F1Z A;  2ZB9 A;  4A3L J;  1A04 A;  2LMD A;  1VI0 A;  4YEJ A;  2QA4 I;  2UV1 A;  1XSV A;  2ETH A;  2EH3 A;  2IA2 A;  4Z6Y A;  2LTP A;  2HS5 A;  4KMF A;  1LFU P;  3F6V A;  2ZJ2 A;  1SFX A;  2JPB A;  2PMH A;  1R5G A;  1FX7 A;  1NTC A;  2CUJ A;  4M73 A;  1TT5 B;  3EYI A;  4RM2 A;  1D3Y A;  1XMX A;  3CLO A;  1P4X A;  5BPI A;  1IUF A;  2LKS A;  4BAC A;  5HOO A;  4AM3 A;  1FOY A;  2L9N A;  2CMP A;  1GUU A;  1B9M A;  3EUK L;  2YPR A;  1VF9 A;  2DJI A;  2HXI A;  1XMA A;  5B1A H;  1AOY A;  5EZG A;  3RKX A;  5E20 A;  4P9U A;  1LEA A;  4A3I J;  3CTA A;  3BPX A;  2LNB A;  3E6M A;  4M9S A;  3HOU J;  1IN5 A;  4U7B A;  3CUQ B;  3KP3 A;  2AXL A;  3EGV B;  5HS9 A;  3VYS B;  3KZI C;  1RNL A;  2RV8 A;  1LE8 A;  1YX5 A;  5ICC A;  3P9K A;  3GFJ A;  2YR2 A;  5JHU A;  2KRH A;  1VQ5 I;  4BJ6 C;  1WI3 A;  2H1L A;  2O7O A;  3BR2 A;  4QSH A;  3S1M J;  2PX9 A;  2Y69 H;  3R0A A;  3REO A;  1WFX A;  1FYK A;  1Z6T A;  2EFN A;  1HST A;  5F0H A;  1WJF A;  2DFF A;  3D5L A;  4FIS A;  5DCF A;  4FHT A;  5E1Z B;  2NNN A;  5K7Z A;  4XK4 A;  3OR2 C;  3MCZ A;  1B1B A;  2DTZ A;  3UR3 C;  4IQJ A;  1D5V A;  2WA0 A;  2LY1 A;  4IEJ A;  3DWL E;  4CSW A;  1UHM A;  5EGO B;  1YG2 A;  3GTO J;  1VQ4 I;  2UWM A;  3BWG A;  4ZTF A;  3VEP A;  1XG1 A;  3IAM 2;  3A0H C;  2CV2 A;  2W85 A;  2ZFW A;  4ZZD A;  2BGC A;  1H89 C;  1WWX A;  2XAU A;  2ICW G;  3WTY C;  3GTJ J;  3PM1 A;  2Z16 A;  2L9S A;  2EA4 A;  2HXO A;  4F91 B;  2PG4 A;  1B8I A;  2QQ9 A;  4XKB A;  4JP0 A;  2ZNZ A;  4Q48 A;  4I02 A;  4G7O F;  2P5L C;  2Y0M A;  1ZR2 A;  1U5T C;  1UFM A;  3BR3 A;  1Y39 A;  5F0F A;  2NYX A;  2GWR A;  3IWF A;  5KVR A;  1TWH J;  4BQO A;  1BIA A;  3EUH A;  3L2U A;  4UNO A;  1FYM A;  3LWF A;  3F8F A;  4U0W A;  1WJD A;  3KPH A;  1YLF A;  4WK8 F;  5C3E J;  1ZLJ A;  3ZPL A;  3DXJ F;  4A3E J;  4KIF A;  3OSG A;  3K7A J;  1QZE A;  4M3F A;  2BVL A;  2K02 A;  1E0E A;  5FLV A;  3K4B A;  1SFK A;  1LDK B;  2P6T A;  1I1S A;  1A6Q A;  3I64 A;  1HW5 A;  2PFB A;  2VPL A;  3ZMT A;  1XCB A;  3KP2 A;  5GAD J;  4OOI A;  4BXF A;  3FBN B;  5F0C A;  3TDZ C;  1IGN A;  2F4I A;  1K83 J;  4O5V A;  3FBI B;  2X6W A;  2ZBK A;  3K9T A;  4L5E A;  2FBH A;  1ZEL A;  5TJJ A;  2MC3 A;  3W6K B;  1I50 J;  5DEQ A;  2XSD C;  1HKQ A;  4G94 A;  3QU3 A;  1TZL A;  1SVM A;  1BR4 A;  4JX6 A;  1JUS A;  3CF2 A;  4ZC3 A;  4B48 A;  4EJW A;  3C2H A;  4YG2 F;  2X1D A;  1G4D A;  3MZ8 A;  5CVV A;  2CFX A;  3OSF A;  4GO1 A;  3ZMZ A;  4HST A;  1TW2 A;  3ELK A;  1WIB A;  1V5E A;  1Y6I A;  4M6Y A;  4V19 K;  4ZJZ A;  5LEK A;  1RR8 C;  2CW0 F;  2VQC A;  4PDK A;  1ZGW A;  3LL7 A;  4BYY A;  2A6T A;  2KRF A;  3QP6 A;  1YRN B;  5CYV A;  3ZRG A;  4AWX B;  2F5E A;  1EH8 A;  3FM3 A;  3NAU A;  3GBG A;  5E3N A;  3CDH A;  2F6C A;  2CUF A;  2XV4 S;  1SVL A;  3F22 A;  5TRD A;  2VE8 A;  4LK0 F;  4YFK F;  1MJB A;  1M1E B;  1FPQ A;  4R1H A;  3D5R C;  3EUH C;  3PIO F;  4BH9 A;  4FT8 A;  2KL4 A;  2FBK A;  2JRT A;  3KZZ A;  4D5C A;  1IRG A;  4GGG A;  1LNW A;  1VND A;  3BOQ A;  3MWM A;  4BE1 A;  2M0C A;  4HV5 A;  3CUQ C;  4CZZ A;  1VQN I;  2CQ7 A;  5EDN A;  2P7V B;  2DPU A;  1Z67 A;  4I2O A;  1X19 A;  2MBF A;  2WAD A;  3Q0W A;  4HQM A;  3WTU C;  3WG9 A;  4A3C J;  4Y4R A;  3TMO A;  4XN0 A;  2GLO A;  2XKP A;  2WBM A;  3M3Y J;  3RJP A;  1RKW A;  3J80 K;  2DOA A;  1V4R A;  2XDV A;  1YQA A;  2XKO A;  4NNJ A;  2K4J A;  3BJA A;  2LKX A;  1E3O C;  2XAF A;  3GTK J;  4DGW B;  1BN5 A;  5JHF A;  4OMY A;  3JRD A;  2OV7 A;  4ZDO A;  1TT0 A;  5IP7 J;  1AA7 A;  2RRE A;  4KIG A;  3MZH A;  4GDF A;  4HF2 A;  2P7C B;  3R6S A;  1GHC A;  3OYD A;  1XX5 A;  4G8X A;  1N75 A;  4MEY F;  1SC7 A;  2NS8 A;  3I59 A;  3MEX A;  3CC7 I;  1IN6 A;  3WTV C;  1PP8 F;  3MAJ A;  1TNS A;  4ENK A;  1FMV A;  4II3 A;  3LNQ A;  4BEH B;  1XTA A;  3ZMS A;  4IHY A;  1ETW A;  4ZH4 F;  4WXH A;  5FKM A;  2R5Y A;  3CJS B;  3G73 A;  2O6G E;  4KN7 X;  2PJR A;  4AYB N;  2XPV A;  4N4N B;  4IKF A;  1YW8 A;  2IA0 A;  2BVM A;  4G6T B;  3LA3 A;  3HOY J;  1RZ4 A;  1MJA A;  2XVC A;  4QIW N;  5KAF C;  4IXA A;  2ISZ A;  3HL2 A;  3CCQ I;  1MIJ A;  2Z5U A;  3HPG A;  1Z21 A;  3G1L A;  4BKX A;  4XID A;  4M74 A;  4OAZ A;  3EYY A;  1IV6 A;  2KT0 A;  5H20 A;  3KYL A;  2LF8 A;  4ESF A;  2RQP A;  2Y9Z A;  4D0P A;  1Z1D A;  4ZYH A;  3PSF A;  3OL3 A;  2E35 A;  2LYC A;  3G1O A;  3K2Z A;  5DUI A;  4JOM A;  3K70 D;  1S9H A;  1AKH A;  5EG0 A;  4V2G A;  4IQ4 A;  3ZCO A;  3CCS I;  3DFG A;  2VI6 A;  3BTL A;  5B3S H;  3R4K A;  3DBR B;  5JI6 A;  2OQR A;  2L3D A;  2M4G A;  2CQQ A;  3HIF A;  4UXN A;  3B02 A;  3TBI A;  4A6D A;  3LSJ A;  5LD2 C;  1NG7 A;  4D9J A;  1B6A A;  2LP0 A;  1G3Y A;  2EA2 A;  2Z1D A;  2R7Q A;  2NVY J;  2ADU A;  4RDU A;  2KIM A;  1QQI A;  4L0Y B;  5M3F J;  2M7B A;  1ZLK A;  1J09 A;  4N4O B;  2IRF G;  4BQA A;  2A6E F;  2DFH A;  2ZXW H;  3C7J A;  5TIS C;  3JRC A;  3A02 A;  4XOT A;  4QLC U;  1S72 I;  3K69 A;  2K85 A;  5CJ9 A;  1U2W A;  3OOP A;  5AON A;  2XF7 A;  5HNH A;  1J0R A;  1TW3 A;  2RVC A;  2MH2 A;  1UEL B;  2V6E A;  1R1T A;  3D5S C;  3TKY A;  2Y75 A;  1P4A A;  3VYR B;  1F9N A;  1ERD A;  3I4N J;  3JRA A;  1MGT A;  4S05 A;  3ABU A;  2GXA A;  1T6S A;  3H9Q A;  3HYI A;  3ONQ A;  2W7N A;  3OIP A;  5FKO A;  2K40 A;  4CCN A;  1BL0 A;  1HKS A;  1JJ8 C;  3LA2 A;  4BAY A;  2BXY A;  4GFB A;  1W4M A;  3LMM A;  3NAR A;  1BI2 A;  1EF4 A;  3SZG A;  3A03 A;  2UZK A;  4HLY A;  2M45 A;  3CES A;  1V5F A;  2M3A A;  1OYI A;  2XPW A;  4DYR A;  1B72 B;  2OU2 A;  4CZC A;  1C0W A;  2DA4 A;  1JKO C;  3S1N J;  1JUP A;  4CIC A;  5GTI C;  5ILU A;  2K9Q A;  2C6Y A;  3A01 A;  4AD9 A;  5IOZ A;  4PJJ A;  2FSW A;  3MZY A;  3V7S A;  1Z7L A;  1OKR A;  3FIS A;  2B7E A;  4EM2 A;  4L5I A;  1KU3 A;  1ZRE A;  4QPO A;  1KU2 A;  4CYC A;  2NS0 A;  1PUF B;  4FQG A;  1Y0U A;  3SJM A;  4UUV A;  1BOB A;  4HLX A;  3ZR8 X;  2NAZ A;  5HNF A;  1YIT I;  2M7A A;  3DKX A;  1OJL A;  3FDY A;  4IOA F;  1PJR A;  3I0T A;  3QYF A;  2A07 F;  5FFZ A;  4ESB A;  3BR1 A;  4PUS A;  2O9L A;  2STT A;  2DT7 B;  3J81 K;  2VXD A;  2R4G A;  3GW2 A;  2KQR A;  4A3G J;  2O03 A;  1MJ9 A;  2CU7 A;  2Y0S N;  2OC6 A;  4NQW B;  1PDN C;  3L7W A;  2L2O A;  4RB1 A;  5DD8 A;  4LMY A;  4XKW A;  2QKL B;  1T2K A;  5FRM A;  4MFE A;  4IRI A;  1JGS A;  1OQY A;  4EM0 B;  1W7P A;  1F5T A;  3TOB A;  1LB2 A;  2CW7 A;  3GF2 A;  2PI0 A;  3BLY A;  3KCC A;  3W2W A;  4XLN F;  5LHI A;  1LJ9 A;  5K5O A;  3BZ6 A;  1U6G A;  1OCO H;  2MD0 A;  2F5D A;  2YX4 A;  1GV5 A;  3LSK A;  2HPI A;  4MEX F;  3DKW A;  3ZQC A;  1FT9 A;  2HOE A;  3AG1 H;  3FKI J;  3JRH A;  1ZGA A;  1Q1H A;  1L3L A;  2DFI A;  4HBL A;  1NK3 P;  3M1E A;  3RZO J;  4QWQ A;  2NRA C;  5IYC J;  2IGK A;  2VKH A;  3MN2 A;  3H35 A;  1QO0 D;  3FZV A;  5B66 C;  3MKZ A;  4A3J J;  3N4M A;  1Y8Q B;  2EIL H;  4V2F A;  2QSH X;  2HEO A;  1FBQ A;  1UHW A;  2LRE A;  5DCM A;  1QVT A;  3S32 A;  1S3J A;  2RQQ A;  2BW3 A;  2H27 A;  3DBH B;  2P0W A;  4WXC A;  1O3Q A;  2P5V A;  3BR0 A;  1O3S A;  3E3V A;  1D8J A;  2HOS A;  1R1U A;  3HKZ A;  5GPA A;  5CLS A;  2EV5 A;  5M3M J;  3M9A A;  2Z9O A;  4P96 A;  4FE7 A;  1YIJ I;  5C4J J;  1Z3Y A;  1ZK8 A;  2FE3 A;  2VIX A;  2IS2 A;  1IAW A;  3P9C A;  4HG2 A;  4YRV A;  3CQZ J;  4J01 A;  5BS6 A;  1WJB A;  2F5C A;  1IN8 A;  1T56 A;  2CJJ A;  3S1Q J;  2DYR H;  3VOD A;  4DYQ A;  4ZYE A;  1X58 A;  2WAF A;  1SD6 A;  4U0V A;  3IRQ A;  2K3F A;  3OYJ A;  5KCM A;  1UB9 A;  3Q3S A;  1FY7 A;  3RPU A;  1WQ2 A;  1YFH A;  1TP4 A;  1IN7 A;  2QCO A;  4ITV A;  3IL2 A;  1E2X A;  3HHG A;  2BE5 F;  4E7K A;  1WRJ A;  2EZK A;  4TV7 A;  4N0B A;  1MMS A;  3FKJ A;  1MDM B;  2W1O A;  4KMU X;  4W1U A;  4M3B A;  2OPT A;  4IO9 F;  5CVR A;  2DMT A;  1KQ9 A;  4ON0 A;  3RI4 A;  3QPH A;  2XAG A;  4KNY A;  4S04 A;  5FRO A;  3OIO A;  2LF7 A;  1OCZ H;  3OYC A;  1REP C;  3NQO A;  4Y7N J;  3ROU A;  2JZY A;  3FK7 A;  5B1B H;  4UUS A;  3GTL J;  3TQN A;  1IRF A;  2JWT A;  3BY6 A;  3GLX A;  5CVU A;  5J6X A;  1K4T A;  4YIR X;  3OYI A;  3ZXS A;  2VOO A;  1FIP A;  2GM4 A;  2ZJQ F;  1MH3 A;  2M87 A;  4PFO A;  3IC7 A;  1RUO A;  3CF5 F;  1VZ0 A;  2QKM B;  2UUZ A;  1K78 B;  5JR3 A;  1ZRC A;  2FOW A;  2LFB A;  3TDU C;  1JHH A;  4HNU A;  1A5J A;  3GUD A;  3K4K A;  3HDD A;  3H3Z A;  4XN3 A;  2HKX A;  4QPQ A;  4CCK A;  2VC1 A;  2FRH A;  3M8J A;  2R0Q C;  1BM9 A;  5HDK A;  4XLE A;  3VOE A;  1ZRD A;  1X1A A;  1U5T B;  2EIN H;  3AG3 H;  1D8K A;  3G6E I;  3TGN A;  2IS1 A;  5CVI A;  5LRR A;  3F0C A;  4A0Z A;  4BY7 J;  1ENH A;  2PBI A;  1T8I A;  1H9T A;  1LE8 B;  4LOC A;  5FLX Z;  1P92 A;  5F27 A;  3HB9 A;  3FM5 A;  3J81 Z;  4YEL A;  2IW5 A;  5FKL A;  3T0Y A;  2ACJ A;  2LY9 A;  1TQP A;  3U21 A;  3LSI A;  3ZN1 A;  1G6N A;  2KP6 A;  3SFI A;  3MVP A;  2QEX I;  2R5Z A;  1MND A;  3GVA A;  4FX0 A;  4N9H A;  4J00 A;  1GDT A;  5L3E A;  3RSN A;  2MD5 A;  3CDL A;  1VQL I;  5FLM J;  1ZGJ A;  3KP4 A;  1J9I A;  2KIQ A;  3V8L A;  3QYB A;  5E1W A;  2A69 F;  1T0F A;  3U1K A;  1SFO J;  5LGU A;  2H6C A;  4YFX F;  2K3P A;  2HOT A;  4XKC A;  3E6D A;  1D1A A;  5D8L B;  5FB2 A;  3L2C A;  3PNY A;  2E1O A;  4A3K J;  1XGS A;  3COA C;  5F08 A;  3GTQ J;  3QYE A;  4XBF A;  3S3O A;  3BDD A;  4GXO A;  3CP2 A;  1B4A A;  2LK2 A;  2YU3 A;  1KYZ A;  3KEO A;  3MD2 A;  5ICG A;  2TDX A;  1ZH5 A;  2QYO A;  3C2G A;  3ESW B;  1I3Q J;  1KON A;  5ERI A;  4L18 B;  1XGM A;  1PUE E;  4RGS A;  1BI3 A;  3HPH A;  2FUG 2;  2QQ8 A;  3LA7 A;  4G7H F;  1FLI A;  1DPU A;  1FOX A;  5L3F A;  3HOV J;  3SQN A;  2COM A;  2GIZ A;  2V9P A;  3KLN A;  3H9J A;  2EIK H;  2CGP A;  4CCJ A;  5A2Q Z;  4DW6 A;  5HOD A;  4B3A A;  4FAS D;  3TP0 A;  2M4K A;  4UVA A;  2QBY A;  1HF0 A;  2JPC A;  3KYD B;  4O6J A;  1TL8 A;  2WY7 Q;  1IXC A;  2M34 A;  1SMY F;  2ZME A;  1RKT A;  3CCJ I;  3ABM H;  3JTH A;  2KRC A;  3TED A;  2VC0 A;  3AG4 H;  4PCQ A;  4B8X A;  4IRH A;  2ZO4 A;  1Z7U A;  3BG5 A;  4HPQ A;  3W3C A;  2ZXH A;  1A31 A;  2MFZ A;  4C3I J;  2VBY A;  1T0F C;  5DTD A;  3BG6 A;  4LLG F;  1LDD A;  4IRG A;  1WPK A;  2WB1 A;  4D1Q A;  3KLO A;  2HDW A;  2W84 A;  1VTN C;  2FNA A;  3F9K A;  2J5P A;  3FHN A;  4AUX A;  4XNF A;  2RAE A;  4KYW A;  3BR5 A;  1QPI A;  2VQL A;  1WJC A;  4HW0 A;  3ZMU A;  2D5V A;  2QSG X;  4A6E A;  3VSK A;  3WG7 H;  2OQG A;  3I53 A;  2XGE A;  4BL0 B;  2IS6 A;  1H88 C;  3AFH A;  2XAH A;  3OS1 A;  3IKT A;  2R7X A;  2PN6 A;  5D5X B;  3GZ6 A;  1EA3 A;  2VT2 A;  2GBY A;  2ZSH B;  3AAF A;  3GTM J;  2DXI A;  3S1R J;  3FX3 A;  2BYV E;  4LLL A;  1X2N A;  4NC7 A;  5H6R A;  2WC2 A;  2IS4 A;  2CO5 A;  1LEB A;  1LVK A;  2V1N A;  4XLP F;  5DD4 A;  1R9T J;  3R60 A;  3BJO A;  4BJT A;  1S7E A;  1I27 A;  3OL4 A;  3SEQ A;  3QWL A;  3WU0 A;  1EJ9 A;  4RAZ A;  3HKZ N;  3ISP A;  3G71 I;  1R23 A;  3NEU A;  1I3A A;  2VN2 A;  4Y3O A;  4F7Z A;  3E6C C;  1Y1W J;  2K27 A;  3ECH A;  2DA1 A;  1RRJ A;  2HFH A;  2VBX A;  1QHG A;  3MKL A;  4CCO A;  2ZJP F;  3WGH A;  1ETV A;  1Y56 A;  3HRS A;  1IXS B;  5FD6 A;  2BBY A;  3GFM A;  4CGZ A;  3CMY A;  3E5X A;  4DQ2 A;  4NC6 A;  2DA6 A;  1QA6 A;  4MTE A;  2VOD A;  2FXA A;  1MBE A;  2DMN A;  3GZN B;  4A12 A;  2M2E A;  5H2F C;  2HI3 A;  2CV1 A;  1VQ7 I;  1Z9C A;  3L2V A;  2RC4 A;  4FCY A;  3I59 B;  2V4J C;  1GLN A;  1XSD A;  1OIS A;  1GV2 A;  2Q2E A;  1YHQ I;  4WWC A;  3HRU A;  4WXD A;  5J1Y A;  2HQR A;  2W82 A;  1GXQ A;  2OJE D;  1HBX G;  1U78 A;  2X4H A;  2XRO A;  1R7J A;  3A4C A;  1SEU A;  3I58 A;  4Y33 A;  4HNV A;  3IHU A;  3QP5 A;  4Q47 A;  2R5Y B;  5IP6 A;  2PMZ A;  4L0Z B;  4C9Y A;  2RGV A;  2PJR B;  2X51 A;  5AIQ A;  2GXB A;  1WGX A;  3HEF A;  3ZQ7 A;  3OYE A;  3S3N A;  5J8C A;  2MAB A;  1P9Q C;  3S17 J;  2L02 A;  1ZTR A;  2F5F A;  1TWA J;  4UVB A;  4OIO F;  2JA8 J;  1TNT A;  1Y1V J;  2N8G A;  4ABZ A;  1OCC H;  3X2Q H;  1K79 A;  2W57 A;  3DEU A;  4F52 A;  3M8E A;  3IKV A;  3PQJ A;  2W4S A;  4ENM A;  1KU7 A;  3F3X A;  1FZP B;  4RAY A;  1I6H J;  1ETY A;  2BY1 A;  1OR7 A;  1VQK I;  5EEG A;  3ZQQ A;  5FKN A;  2WTE A;  2LD5 A;  2HZT A;  3FXU A;  3U1D A;  2XF6 A;  3ZMV A;  4JYK A;  3FXK A;  3KEQ A;  2JSC A;  2R7O A;  3FXJ A;  5L3D A;  2VJI A;  2TRT A;  1HXD A;  2FD5 A;  4FE4 A;  4J19 A;  2IPQ X;  5FFX A;  5KNL A;  2KIS A;  2DN0 A;  3K4N A;  3MQ0 A;  4BE0 A;  4F92 B;  1UG2 A;  2XGC A;  2ESH A;  4XRM A;  1N78 A;  2P81 A;  1ZAO A;  4G12 A;  2Z33 A;  2EV6 A;  2P8T A;  1RIO H;  4LG0 B;  3GFI A;  1APL C;  1AKH B;  2AQE A;  3CLQ A;  2VL8 A;  1WSU A;  5EEH A;  4M72 A;  1W5T A;  1S29 A;  2NNY A;  2D1H A;  1WH5 A;  2VJ4 A;  2DQR A;  1Z05 A;  3PIP F;  3HOZ J;  3I3L A;  4XIC A;  5J1U A;  3IUO A;  2E19 A;  2XAS A;  3PFY A;  1W5S A;  3BTI A;  2IVM A;  3DV8 A;  3DTI A;  3FXR A;  4OMZ A;  4B3X A;  1YS6 A;  4IX7 A;  2R7T A;  2NOG A;  2HQN A;  2DU9 A;  2LSO A;  2DMP A;  3HGY A;  3CJR B;  3QOE A;  5FD5 A;  2AXT C;  1XMK A;  2L5Q A;  1O57 A;  1FP1 D;  2M5W A;  2AS5 F;  2KIF A;  1S7O A;  5BPD A;  2XF5 A;  2DAO A;  1F43 A;  2JVH A;  2KIU A;  2E1N A;  1LQ1 A;  2CG4 A;  2LKP A;  3CZ6 A;  5J40 A;  2W25 A;  3L2Q A;  4BGD A;  4BU2 A;  3DQV C;  3I71 A;  2A05 A;  1E3P A;  4CCM A;  4FX4 A;  3JW4 A;  4EJT A;  5B5E C;  1VQP I;  1OR7 C;  3OOU A;  4OAY A;  3V7R A;  1PVE A;  4XLA A;  1Z91 A;  5CQE A;  1FEX A;  2Y30 A;  5CKT A;  3CCR I;  4ENN A;  2ZKZ A;  3M7G A;  2W00 A;  2LH9 A;  2DMQ A;  1X3W B;  2P6S A;  5DS9 A;  2CFO A;  4UB6 C;  3E0J B;  3CC4 I;  1BW5 A;  1FMW A;  2MSY A;  3QAH A;  1G8X A;  1SAX A;  3IH4 A;  3PUB A;  1BIB A;  3OV8 A;  1WHU A;  3WU2 C;  1SVO A;  4D5F A;  4DNC A;  5L3B A;  3JRF A;  1IJW C;  4E4H A;  4YII A;  1MZB A;  1FYL A;  5LGN A;  1W36 D;  2CS3 A;  3OWT A;  3A01 B;  3HOS A;  1F4K A;  4XLC A;  3FK6 A;  2D45 A;  4AVZ A;  2L01 A;  2P4W A;  1BW6 A;  3ML6 A;  2DQL A;  4BDY A;  3Q0U A;  2E1C A;  1OLT A;  2BY0 A;  1P7I A;  5JFR A;  1G2H A;  4GYG A;  1DGW Y;  4CYC B;  2L54 A;  4RGR A;  2R7S A;  3K1N A;  3ZMD A;  2R3S A;  2A6H F;  1LUJ B;  4DBQ A;  5EF6 A;  2DFE A;  2M1B A;  1W0U A;  3I55 I;  1ZR4 A;  5E3M A;  3W6V A;  1TC3 C;  3L9F A;  2H8R A;  3GCM A;  2DI3 A;  2HZD A;  4FTH A;  5BMZ A;  2L9V A;  4LJZ F;  2YS9 A;  3JRI A;  4I0B A;  2DO7 A;  1PP7 U;  5D4R A;  2IA1 A;  1OCP A;  3WTZ A;  1ZG3 A;  2V7F A;  3WGI A;  3OYB A;  1H9G A;  4RS8 A;  3WE3 A;  4HEA 2;  3G1M A;  3BTC A;  1ETK A;  5E8I A;  1IO2 A;  2MLG A;  3QPL A;  4MFD A;  4N9I A;  1Q1V A;  3Q9V A;  4M6X A;  5GP9 A;  4I99 C;  2KFD A;  3HTS B;  2PMU A;  3DP7 A;  4PJL A;  1UJ8 A;  2E34 A;  3ABT A;  3RQ4 A;  1W7P B;  3HG9 A;  1XS9 A;  1IG7 A;  5ED4 A;  2PJP A;  1XSX A;  3DLA A;  3CCV I;  4W97 A;  1DPR A;  1ON2 A;  4M3E A;  3JRB A;  2X85 A;  1ZN2 A;  3R61 A;  1MSE C;  4IHT A;  4DIQ A;  1SD4 A;  3P9I A;  5D6F A;  2IJL A;  5H6Q A;  3LAP A;  1R00 A;  1YTY A;  4CDG A;  1T08 B;  4BDZ A;  1JHF A;  2VQH A;  1SD5 A;  2OCC H;  1YS7 A;  3ZGK A;  1AHD P;  3K4C A;  4DZP A;  1W7P D;  4G7Z F;  3OYN A;  4EGZ A;  2ECC A;  3KEY A;  3DBL B;  1WH7 A;  3F8B A;  3K1P A;  4A0Y A;  5D5U B;  1HSJ A;  4E70 A;  2ME0 A;  2AO9 A;  3F6O A;  2IT0 A;  5FKK A;  2STW A;  3HM5 A;  2M9H A;  2BW3 B;  1Z0X A;  5F1J A;  5HLH A;  4RGX A;  5IT9 K;  2X9D A;  4Y13 A;  1S6L A;  1IN4 A;  3FXL A;  5GPC A;  3EQL F;  4UHT A;  3J80 Z;  1FIA A;  4UUT A;  4E6K G;  1CGP A;  3E6B A;  1JJ6 C;  1MBG A;  3FXM A;  3OIQ A;  2VKV A;  5E18 F;  5EZH A;  4R79 A;  2NOJ B;  3DEE A;  2VKE A;  5K1Y A;  1X1P A;  2VJJ A;  3H92 A;  2EK5 A;  3K1M A;  3JTG A;  3B73 A;  5M5X J;  3GME A;  2XB5 A;  2ELH A;  3K0L A;  3G2B A;  4AU7 A;  1ACI A;  4NUB A;  3LAJ A;  3ZN0 A;  4B4C A;  3J7A O;  3DPU A;  2HTJ A;  4MHG A;  4B44 A;  3H0G J;  2ZNY A;  3GYH X;  3T8T A;  4E7H A;  3VYU B;  2TCT A;  3KP6 A;  2A3S A;  1XB4 A;  3ZQL A;  3MFK A;  2BY2 A;  3OR1 C;  4P55 A;  2Z99 A;  1UZC A;  2M30 A;  1QNT A;  1W36 C;  2E5N A;  5C44 J;  3RPU D;  3IP4 B;  1K7A A;  2IXS A;  3T5X A;  3M07 A;  5IP9 J;  3FMQ A;  1R1V A;  4GCV A;  2DA2 A;  4BS9 A;  2BXZ A;  3QOP A;  1BA5 A;  1VFC A;  5GTH C;  4AVP A;  2FX0 A;  5HS8 A;  1PYV A;  1QVU A;  4U88 A;  2JA5 J;  4UUS B;  1O3R A;  1QPM A;  1BI0 A;  2YUS A;  2X48 A;  5LRS A;  2HDD A;  1YJW I;  2IBD A;  3TP3 A;  4E7J A;  4MQ9 F;  2WV1 A;  3TOA A;  2FJ1 A;  1IW7 F;  1UMQ A;  3M8F A;  1SAU A;  3F72 A;  1YO5 C;  1LPQ A;  1SFU A;  2L9R A;  1JI8 A;  4M9Z A; 
#chains in the Genus database with same CATH homology
 3CCQ I;  3CCE I;  3G71 I;  2OTJ I;  3CJR B;  2ZJP F;  5DM6 F;  3EGV B;  1VQ9 I;  1YJN I;  1MMS A;  4IO9 F;  1YIT I;  4UY8 I;  1WIB A;  1HC8 A;  3CC2 I;  4IOA F;  4V19 K;  1QA6 A;  1VQ5 I;  5GAE J;  2E35 A;  1VQP I;  1VQ7 I;  1FOX A;  1YHQ I;  1YJ9 I;  3CCR I;  3CCS I;  3CMA I;  2ZJQ F;  3PIO F;  3CF5 F;  3G4S I;  3CD6 I;  3I56 I;  3CC4 I;  2FOW A;  3J7Z I;  1VQM I;  1VQ4 I;  3CCJ I;  1VQN I;  3J7Y J;  1ACI A;  1VQ8 I;  3CCU I;  1S72 I;  2NXN B;  2ZJR F;  3G6E I;  1VQK I;  4IOC F;  2E36 A;  1Y39 A;  2H8W A;  3I55 I;  3CJT B;  3CME I;  2JQ7 A;  3CC7 I;  1YI2 I;  2QA4 I;  3CCL I;  5JVG F;  5GAG J;  1YIJ I;  2QEX I;  1VQO I;  3CJQ B;  3DLL F;  1YJW I;  3CCM I;  3CJS B;  1VQL I;  3PIP F;  1FOW A;  5GAH J;  5DM7 F;  2OTL I;  5GAD J;  2E34 A;  1FOY A;  1VQ6 I;  3CCV I;  2K3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...