1Z7UA

Crystal structure of the putitive transcriptional regulator of marr family from enterococcus faecalis v583
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
111
structure length
111
Chain Sequence
SNAMTTDKQTSINLALSTINGKWKLSLMDELFQGTKRNGELMRALDGITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHWGETFAQKKARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein EF0647
publication title Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 31
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z7uA00
3K0LA 1YW7A 2R3SA 1ZG5A 3QP6A 4UHTA 1USSA 3PFIA 3HSRA 1FP1D 1QO0D 1UCRA 5ILVA 4WCGA 3WTYC 3GLXA 3T5XA 1YO5C 1R36A 4UV9A 5DDGA 3EYYA 2F5CA 2MA3A 3G3ZA 1R22A 3WG9A 1J5YA 4JBAA 2P7VB 5AIQA 1Z6TA 3TKYA 2NNNA 1XMKA 4OMYA 1R7JA 1V3FA 1HKSA 2RC4A 4HLXA 1XB4A 4RB1A 4KIBA 4KDPA 3GFJA 1P4XA 4MEYF 3JAMZ 4IRIA 4BXUA 4Q5SF 1QZYA 1W7PA 1P4AA 1MDMB 3IHUA 3WU0A 1T0FA 1LDKB 1FBQA 2A6HF 5JHUA 3P9CA 3IWFA 1UFMA 1O3RA 1YG2A 4L18B 2A5YB 3GYHX 3CDHA 2CQKA 1T2KA 4RB0A 1HSJA 1MD0A 4AWXB 3FXQA 2ZO4A 4BAYA 2HWVA 3ISPA 2IA2A 4PDKA 4WXHA 1HW1A 1GXPA 4YG2F 3JTHA 4LB5A 3CJNA 1S7AA 3F23A 4EJUA 2OU2A 3LA2A 3HSEA 1YQAA 1H9TA 1BI2A 2VODA 2NRAC 1IN6A 1R23A 4UUVA 2KRFA 3GZ6A 1SD6A 4ETSA 3RIRA 2P5VA 1JXSA 4IRGA 3GEZA 1XSVA 4ZYEA 2W84A 2V1XA 1OPCA 4HDUA 2DTRA 3ZMSA 1STZA 3HRSA 5D4SA 3P7NA 2DAOA 2D2WA 5BQTA 3ZPLA 3F6OA 4M9XA 4MEXF 3DFGA 3I59A 1IF1A 1QNTA 5JI6A 1YW9A 2X0LA 4P96A 1FYLA 2Z3YA 2XAHA 4XLNF 5J6XA 1KQ0A 1WRJA 4NB5A 5DYMA 2ZJ2A 4EMSA 3WTWC 4G7HF 2A07F 3TO6A 2MLGA 2MBFA 1O7FA 2JSCA 2EA4A 2COMA 3MEXA 1XD7A 2MC3A 2D1VA 4Q4ZF 5TRDA 2Q8KA 2K4BA 2G7HA 3R0AA 3R60A 3MCZA 3RYRA 3KLNA 1HW5A 3CUQA 2VXZA 5DD8A 4WWCA 4MHGA 1HKTA 2OQGA 2ACJA 4A6EA 5H6QA 5D6FA 5ICEA 3DEUA 2M8EA 3NEUA 4MQ9F 1XCVA 3V8KA 2HFHA 3FHZA 3VOEA 2JZYA 4EV0A 4QLCU 3W6JB 4EJWA 3CLOA 4FX0A 2ZFWA 1XSDA 3HHGA 5CVVA 2YSRA 4M71A 1XCBA 4G9YA 5HDKA 2VOOA 5FD5A 2BV6A 1ODDA 3E6BA 1TQIA 3R4KA 2L01A 1RZ4A 4HX4A 2PQ8A 2A69F 1BBYA 4Z2YA 3HSFA 2Y75A 4LGWA 1OMIA 1YLFA 2LKPA 3P9IA 4ENMA 4L0ZB 2FMYA 4L9JA 5DCFA 2XUBA 5L3DA 3KP2A 1AWCA 3HHHA 4YIFA 3JSPA 4BYYA 4M73A 2RNJA 1REPC 5HLIA 4HBLA 3I4PA 4DQ2A 1TW3A 4A12A 1IRGA 1W7PB 4IF4A 3RPUA 3BJOA 1VTNC 3GFIA 3EDPA 4CDGA 2TDXA 1TLHB 2G7UA 3HRTA 1SFEA 1K79A 3Q9SA 3K1NA 3RKWA 2V1UA 3F8NA 4LFUA 4LG0A 2YX4A 4CXFA 4XBFA 3H3ZA 4A2UA 1PP7U 4UVCA 2ZCWA 5CVRA 3MZHA 1LEAA 3WTVC 3E5UA 1Q1HA 4I02A 1O3QA 1ZAOA 2IA0A 3P9KA 3WE2A 3EUHA 4CICA 2HKOA 1YS7A 4BQAA 3BROA 1XGSA 4U7DA 2ZKZA 1KQ8A 2RV8A 3C7JA 1KU3A 3TQNA 1HBXG 3KP7A 4L9TA 1ZG3A 1ONVA 1FY7A 1UHMA 1WI9A 1SFUA 2KIMA 4E70A 4D0PA 2PG4A 4GYIA 1U2WA 2OA4A 3I59B 1P4WA 3I0TA 2R7DA 1IN5A 3ECOA 5E1ZB 2GIVA 5E8GA 2VE8A 3B02A 3HOTA 3FMSA 2ZMEA 4Q48A 1FX7A 2GA1A 3LQRA 4G94A 2P8TA 4KN7X 3ZMUA 2FF4A 2VN2A 4HX8A 1ZLKA 2GQQA 2QYOA 2F5EA 2Z99A 2QLZA 5D4RA 4HF0A 5JFRA 4WXCA 1ZH5A 2CWEA 4RGUA 3R6SA 4M74A 2Y48A 2NNYA 3FM5A 4LLNA 2E1NA 3MWMA 3OV8A 3FM3A 2DK8A 2EFNA 3T0YA 3CUQB 4I2OA 4N0BA 1XN7A 2IP2A 3J81K 4U0VA 5CVIA 3CTAA 2WC2A 3ZMDA 5IT9K 2K02A 5HOOA 5ERIA 4WF2A 4RAZA 1FPQA 3VB2A 5BOXA 2DLLA 1EH7A 3ULQB 5LLQA 5J8CA 2V6CA 4NHJA 3B73A 1YS6A 2O61A 4EQQA 3Q5FA 1U8RA 2EV6A 5DEQA 5L3EA 3WTUC 1RNLA 2P6SA 1QQIA 1Z6RA 4EJTA 1V4RA 2BYVE 3RKXA 5BPDA 2VBZA 5D8KB 1G6NA 2L3DA 4YFKF 5ICFA 2QBYA 3BWGA 4OIPF 2MH2A 1BI0A 3DF8A 4GCVA 2RN7A 1IZ1A 2K27A 1Z1DA 2X4HA 1T39A 2F5DA 4I98B 3HUGA 1XSXA 1I6XA 4KN4X 2OD5A 1BJAA 5DCMA 3C3WA 1DDNA 1TW2A 1EH6A 2VBXA 4PGGA 5D8LB 1OYIA 5CVJA 4CHUA 2EJRA 3ZN0A 3L00A 2HR3A 4LG0B 4XSXF 1FSHA 2XRNA 2CO5A 3E5QA 4OMZA 4U0YA 4N9IA 2ZBKA 1FOKA 5CYVA 3OOPA 2VC0A 2VT3A 1L0OC 1KU2A 1QBJA 2W24A 4HQEA 4JK1X 1AOYA 4CGZA 1YYVA 4Y15A 1SMYF 4Q47A 5H6RA 4GXOA 3KETA 2WTEA 3HTSB 1D8JA 2JTVA 1IRFA 3WTXC 1JHFA 2PFBA 3U2RA 2JPBA 2DI3A 2HYGD 1J75A 2HOEA 3F8CA 5ED4A 1C0WA 1DP7P 1MZBA 1FYKA 2DPUA 1KU7A 3EETA 1U6GA 4N9HA 1ZLJA 5EEHA 2QVOA 3LA7A 4M9ZA 4YFXF 1IW7F 5D5WB 2UZKA 2ZMEB 3ZMZA 3WTZA 2FQ3A 3T8TA 2QWWA 4HV5A 3DPTA 4B09A 4HZFA 3ZQ7A 3QRFF 2EV0A 1K7AA 1R5HA 5KVRA 2PEXA 4O6JA 3EQLF 3R61A 4DNCA 1WWXA 4BHCA 1T98A 3HRUA 3F22A 4ZYHA 4ON0A 5DUIA 5JVTA 3BP8A 4LK1F 4R8HA 3VEPA 1SD5A 1ZGJA 2L4MA 2GAUA 1HSTA 4UNOA 2XHKA 4KIGA 3RDIA 1R1UA 4K2EA 3K1MA 2H6BA 4OINF 2RDPA 3Q9VA 3F6VA 5FFZA 4MQVA 3AAFA 1XGOA 5LEJA 1RIOH 5HS8A 3U9GA 1B9NA 2ETHA 1SFXA 1KA8A 3IKVA 5A2QK 1HW2A 3J80K 2RQPA 3F21A 5AIPA 4P5OA 2HEOA 4ESFA 3J81Z 4ZYGA 3QU6A 5IT9Z 4KMUX 4H0EA 2M87A 2QBYB 3BPVA 5E17F 2JRTA 2EB7A 1WSUA 5DV5A 2XAQA 3D5LA 3IWZA 2O0YA 2LF7A 2UXNA 2H94A 5DCMB 3ZMTA 5L3FA 3GUDA 4ENNA 3ERED 1FP2A 5FB2A 2FBKA 1ZRDA 2IT0A 2L54A 4AVPA 1J9IA 1Z9CA 4PGHA 1G4DA 2O6GE 3G73A 3DXJF 3WTSC 4IHTA 3BZ6A 1ZRFA 3LA3A 2YR2A 3ZP5A 1FWZA 2ISZA 4R79A 2EWNA 2XAJA 5D5XB 2EA2A 5HDNA 4UV8A 4EM0B 1IXRC 4EGZA 2GA2A 4KA4A 1CF7A 3QOPA 3R0JA 1IXCA 5HS9A 5E1WA 1UHWA 4TV7A 3V8LA 3SZPA 1HXDA 5LEKA 2Z33A 1XDUA 3TOBA 5L3CA 1R5GA 4A5NA 2PLYA 4O3MA 1XMAA 4IHSA 3E6CC 2L4AA 2FBHA 2ELHA 5E18F 3HIFA 1TTYA 2LDUA 3ROUA 3O2PE 2NS0A 2PMHA 4EJOA 4A0XA 5D5UB 2FXAA 1BC7C 2VE9A 1P2FA 4L9NA 2IA1A 3GO5A 4MTEA 2HKXA 1J0RA 5HS7A 2EV5A 4NQWA 2G9WA 4QWQA 4FX4A 3F8BA 2P7CB 2KIUA 4HDVA 1O7LA 3V7CA 3U1DA 3KCCA 1TQMA 2VOPA 1F1ZA 1G3YA 3H92A 3K2ZA 4G6DA 1S3JA 2NYXA 2W85A 1ZREA 4OOIA 3QPHA 1BC8C 1F9NA 1IXSB 4EGYA 2ESNA 3WGGA 1RUOA 3JTGA 4ESJA 1ZG1A 4P9FA 4UVAA 1B59A 2EFPA 2ZNZA 2KJBA 2WWYA 4KFCA 4YIIA 3RKYA 3WGHA 4U0WA 3J7AO 1PDNC 1FSEA 2OZ6A 2OZUA 4EJVA 1XGMA 1EH8A 4BHBA 1D3YA 3T1BA 4A0YA 1FZPB 1LDDA 4BNCA 3TO7A 3DKWA 2HTJA 2NAZA 3KP6A 2EFQA 4HQMA 3IRRA 4L5JA 3E5XA 1A04A 2LNBA 2C6YA 2IJLA 2VT2A 1TNSA 3SFZA 2DQLA 2CW0F 3L7WA 1IN8A 4O5VA 4P9UA 1T6SA 3MAJA 3F8FA 5DUKA 1MKMA 3KEOA 2HTSA 4XSZF 1E17A 2K4JA 4WX9A 1IAWA 4KICA 2FE3A 4M6YA 3NQOA 3GFMA 3BY6A 1FNNA 2BGCA 1ULYA 2R7FA 4HW0A 3KZZA 5A2QZ 4I0AA 1U5TA 4HOBA 3J80Z 3ML6A 1BIBA 1KQ9A 5K5RA 5IT3A 4KMFA 2Q0OA 2QQBA 5E20A 3RJPA 2IRFG 1IN7A 3WU1B 1J7KA 3TOAA 3S2WA 1O3SA 1GVJA 4IPAA 4A5MA 1L3LA 5K5OA 1I27A 2ISYA 2D45A 4B8XA 3MQ0A 5ILSA 1HKQA 2P4WA 2E1CA 4G8XA 4UVBA 1BI3A 1CF7B 4R1HA 3I54A 1PUEE 3DP7A 1Z05A 1R1VA 3BJ6A 5CJ9A 3TDUC 4ZZDA 1BIAA 4GGGA 4ZZLA 1YTYA 4KYWA 5LRSA 3DPLC 3VODA 2KIFA 1TBXA 1K6OA 2AXLA 2QENA 2PI0A 1P6RA 4M9SA 4FT8A 2EK5A 4XLPF 4ZH4F 2L02A 1YW8A 2W57A 2B0LA 2MLKA 3K9TA 1S8NA 2BEOA 1G3WA 4Y17A 2EFWA 3LWFA 2FMLA 1K78A 1OYWA 1X3UA 3K69A 4KIFA 1Z91A 2PMUA 3IRQA 2Z5UA 2OQRA 1P92A 3JW4A 3HTUA 2YU3A 1B6AA 4CZZA 5K5QA 3HOSA 3V7SA 1W7PD 4RB2C 2XKPA 2M30A 5F6FA 4KUMA 2ZXJA 4LMYA 5L3BA 1WQ2A 1RUNA 3M7GA 1XGNA 4HX7A 2FBIA 1ZHFA 1LQ1A 3E97A 3EYIA 4LLLA 1W4MA 1F4KA 5H20A 3DQVC 2DO7A 1B9MA 4WXDA 3GZ5A 1J2XA 3KEQA 2XROA 4RS8A 5LRRA 1FYMA 2H6CA 1LDJA 2LF8A 2QUFA 2CGPA 1UB9A 1ZARA 2DPDA 1G3TA 3CUQC 4HF1A 1MJ9A 2FU4A 3M8EA 3IC7A 3F8MA 4CYDA 2V9VA 4KT5C 3N4MA 3I71A 3F72A 2STTA 2WV0A 2DBBA 3GW2A 1OKRA 1B1BA 1Z7UA 2VBYA 3L9FA 4ESBA 1E2XA 5E1XA 4IRHA 1FT9A 4BH9A 5JR3A 2XASA 3FXUA 4AIKA 5HLHA 4I01A 4LB6B 5ILUA 4GO1A 1ZN2A 2VBWA 4OIOF 4PCQA 4AD9A 4I0BA 5CLSA 2PJPA 5HDGA 5K1YA 3O6BB 3ZMVA 4EVIA 2GZWA 2FA5A 2HGCA 4LJZF 3KP4A 1J59A 2JT1A 3WGIA 1T38A 1KYWA 1HQCA 5LGUA 4Y13A 2DU9A 1U5TB 2CFXA 1GXQA 3MZYA 4HAMA 5DD4A 3D0SA 3WODF 1MJAA 3SHFA 1MGTA 2MH9A 3LAJA 3E6DA 2UXXA 3CUOA 3LAPA 3H3UA 5E8IA 4JQFA 4XRFA 4I09A 3KP3A 1SD7A 5HLGA 2KKOA 3I5UA 4L9VA 1R1TA 2W25A 4HLYA 3TDZC 1BN5A 3MFKA 2XAFA 2K86A 4LLGF 5J8FA 4MTDA 2FRHA 2P6TA 2HDCA 2LSOA 2GXGA 4L0YB 2D1HA 5D5VB 3GFLA 4OU0A 2Y0MA 2FNAA 2DFIA 3RTRA 2IVMA 1I1SA 2J5OA 3ABUA 2MD5A 4IVNA 1K78B 3CO7C 2IW5A 4EM2A 3QAHA 3BDDA 1SAXA 3I64A 2A6EF 3BOQA 2Z9OA 2OAZA 3WTTC 3QP5A 5LBQA 2RVCA 2AS5F 5FGMA 5TJJA 1TQPA 3V7RA 3HYIA 5L3GA 1YIOA 1FBSA 1LJ9A 3TGNA 2RGVA 2J5PA 4LD5A 1S7OA 3KE2A 3REOA 4MGRA 3GXOA 3CO6C 4HV6A 2HS5A 2E7XA 2JPCA 5KK1A 1I1GA 3SZTA 1FC3A 4CO8A 2A3SA 3ECHA 3L2CA 5FLXZ 1OYYA 1LVAA 3QU3A 1TNTA 5BS6A 2YPRA 3GWZA 4RAYA 1JHHA 1QGPA 3GF2A 2BBYA 1I5ZA 1ON1A 5AONA 1DUXC 2A68F 5LHGA 1U3EM 3WE3A 3VFZA 4G6QA 2DQRA 2M1BA 5FO5A 2QQ9A 4OIRF 5LHHA 4ZYDA 4U7BA 3KZYA 2ZNYA 1U5TC 5ICCA 4HF2A 2O8XA 3COAC 2GWRA 2VC1A 4AIJA 1S29A 4L5IA 3M8FA 5LGTA 5F1RA 5FD6A 1D8KA 3GX4X 1SMTA 1LB2A 2XKOA 4RGXA 3IKTA 5BPIA 1O57A 2ADUA 2XVCA 5CVUA 3V4GA 2DK5A 3HRMA 3C18A 2M5WA 4ASNA 3LQQA 4F7ZA 3C1DA 1B4AA 4HYEA 2EFOA 2QM3A 3TO9A 1DPRA 3JAMK 1MJBA 3PQJA 2CG4A 5FFXA 3QPTA 4YFNF 1G3SA 4IXAA 2UWMA 3KFWX 4PZJA 1JE8A 1H9GA 1ZYRF 1W5SA 3L09A 4UXNA 2P5KA 5EEGA 1DPUA 3ZN1A 4EM1A 3I58A 1R58A 2PBIA 4G7OF 1KU9A 1Y0UA 6PAXA 3LFKA 4HA8A 1WKMA 2CYYA 3GVAA 1U78A 1FLIA 2XGXA 1XDSA 4M72A 1LEBA 3RI4A 2XAGA 2HQRA 3I53A 3E6MA 3T8RA 2QQAA 1ZRCA 1W5TA 4FHTA 1SD4A 1QZZA 2K7LA 5BMZA 2M45A 4RGSA 2F2EA 4I7HA 4OIQF 2HQNA 1R00A 3IL2A 1NHAA 5ICGA 3FMRA 1MDMA 4M6XA 3W6KB 2H09A 3V8JA 2V1DA 2BE5F 2YX7A 2GXBA 2FOKA 3JSOA 3M1EA 4IJAA 1RI7A 4U88A 1IN4A 3M9AA 3KLOA 1PP8F 1ZGAA 3FMQA 4BHPA 2Q2EA 5F64A 4G7ZF 3KP5A 4RB3C 4KNYA 3RYPA 1QPMA 4P55A 3PQKA 3F3XA 2E7WA 3FX3A 2O03A 3LSTA 2P5LC 2HZTA 4ENKA 1KGSA 4S05A 3FZVA 1OR7A 1YFHA 3SQNA 1IUYA 4LK0F 2H27A 1D5VA 1CGPA 3K1PA 4MNUA 1BM9A 2O3FA 1EV7A 2KJCA 4AIHA 1JGSA 2FNPA 2CSOA 3FWEA 3BJAA 4ENJA 2VONA 1BOAA 3NRVA 5LGNA 2DT5A 5D6EA 3FXRA 2V79A 2FEZA 3O3KA 5FLXK 2QZ8A 1KYZA 4S04A 2A61A 5HVQC 2XV4S 3ELKA 4A6DA 4WK8F 3E3VA 1BI1A 1O3TA 2RKHA 1FBUA 2HYFA 5LHIA 1ON2A 3DV8A 1USTA 2F5FA 2OBPA 3BPXA 3FF5A 2STWA 2FSWA 4GYGA 3RPQA 1S6LA 2PN6A 3ABTA 1F5TA 1H0MA 1LNWA 3N97A 2ESHA 3SXYA 2IPQX 2DW4A 2XIGA 4RGRA 1GHCA 4A0ZA
chains in the Genus database with same CATH superfamily
5LFAA 3K0LA 1YW7A 2R3SA 1ZG5A 3QP6A 4C2MJ 4UHTA 1USSA 2L9VA 3PFIA 3HSRA 1FP1D 2GLOA 1QO0D 1MBFA 1UCRA 3A03A 5ILVA 1GV2A 4WCGA 4XMYA 3WTYC 4D9JA 3GLXA 3T5XA 1R49A 2I10A 2DMQA 1KZHA 1YO5C 1R36A 1JKQC 3NARA 2CV0A 4UV9A 1MNEA 5DDGA 1SVOA 3MN2A 3EYYA 1IUFA 1I50J 2F5CA 2XSDC 1AKHA 2MA3A 3G3ZA 3BZKA 1R22A 2JMWA 1R5ID 2CW8A 3WG9A 1J5YA 4JBAA 2O5RA 4HNTA 5EEAA 2P7VB 2COBA 5AIQA 1Z6TA 3TKYA 2IGOA 2NNNA 2W00A 1XMKA 3EUAA 4OMYA 4BS9A 1VZ0A 1R7JA 3HXLA 3PUFA 1V3FA 1HKSA 3KYDB 5C4XJ 1YI2I 1F43A 2RC4A 3BG7A 4HLXA 1XB4A 4RB1A 3MD2A 1MBKA 4KIBA 4KDPA 3GFJA 4DBQA 1P4XA 2MYSA 4MEYF 3JAMZ 2ELJA 4IRIA 3FBIB 4BXUA 2EZKA 4Q5SF 1K83J 4F52A 2ZFUA 1QZYA 3GTJJ 2VJ5A 1W7PA 4HSRA 1VQPI 4BY7J 5EDNA 1W36D 4GRIA 3TL4X 1P4AA 1MDMB 2LOOA 3G2BA 3IHUA 3WU0A 2YU9J 2F4OB 3A4CA 1T0FA 2H1LA 2HYJA 1LDKB 1FBQA 2A6HF 5JHUA 1QHHD 3P9CA 3IWFA 1UFMA 1O3RA 4CH7A 1YG2A 1HLVA 4L18B 1SVMA 2IS6A 2A5YB 3GYHX 3CDHA 3FDYA 2CQKA 1T2KA 5B1AH 4RB0A 3L1PA 2FD5A 1HSJA 2E1OA 1MD0A 2E2IJ 3KYCB 3D5RC 4AWXB 3FXQA 2ZO4A 4BAYA 2XPVA 2HWVA 3ISPA 2IA2A 4PDKA 4WXHA 4XIDA 4E7SA 3BTJA 1HW1A 1V5FA 2Q2EB 3K4MA 3CP8A 4JX5A 1GXPA 2CU7A 2KISA 4YG2F 3H9JA 3JTHA 4LB5A 3CJNA 1S7AA 2HZDA 3LSRA 3BC8A 3F23A 3KZIC 2OU2A 2JVGA 4EJUA 4BDZA 3LA2A 1G2HA 1VQ7I 3HSEA 4D7MA 1YQAA 2HVSA 2ZSIB 3S14J 1H9TA 3B6AA 5LD2C 1BI2A 2VODA 2NRAC 3LL7A 3EUKL 1IJWC 1QVTA 1IN6A 3GCMA 1D0ZA 2NS8A 1R23A 4UUVA 2KRFA 4RAFA 2CRGA 3U21A 2XPUA 3AL0C 3K10A 1YE9A 3GZ6A 1SD6A 4ETSA 3RIRA 2P5VA 5B66C 1JXSA 2LFBA 3K4KA 2QF7A 3GEZA 4IRGA 1XSVA 2LH9A 4ZYEA 2W84A 3FKIJ 2L7ZA 2ME6A 1JT0A 2V1XA 1OPCA 4HDUA 3PO2J 3ONQA 2DTRA 2M7AA 3ZMSA 1STZA 3HRSA 5D4SA 3P7NA 3HPHA 2OPTA 3OYHA 2DAOA 4J00A 2D2WA 5BQTA 3OSFA 3ZPLA 3F6OA 4M9XA 4MEXF 3DFGA 5GADJ 2PJRA 3I59A 1IF1A 1HDPA 1QNTA 5JI6A 1YW9A 4PJMA 2X0LA 1WJCA 2CQXA 3DTEA 1GLNA 4P96A 1IG7A 1FYLA 3OYBA 2QQ8A 2Z3YA 2XAHA 2HI3A 4XLNF 5J6XA 1HF0A 3ZOBA 1K4TA 1KQ0A 1WRJA 2W4SA 4NB5A 5DYMA 2ZJ2A 4EMSA 1AA7A 3WTWC 1IV8A 4G7HF 3PSFA 2A07F 3TO6A 2MLGA 2MBFA 1O7FA 3QPLA 1V54H 4XORA 3ZRGA 1B8IB 2JSCA 2EA4A 2V7FA 2COMA 3BQZA 3MEXA 1ETKA 3AFHA 3ZQGA 3SDBA 1XD7A 2MC3A 1X2NA 3CJTB 1YOVB 1RKWA 2D1VA 4Q4ZF 4KISA 5EG0A 4PSXA 5TRDA 1WJDA 2Q8KA 2K4BA 2HOAA 4XKBA 3AG4H 3GTGJ 2G7HA 3R0AA 2VASA 3L2QA 3R60A 3BTCA 4PJJA 2XGCA 1YHQI 3MCZA 3RYRA 2CUEA 5F1JA 3KLNA 1HW5A 1JKRC 3CUQA 2VXZA 5DD8A 4WWCA 4MHGA 1HKTA 1K61A 2OQGA 1OCZH 2ACJA 2F4MB 1EA3A 4A6EA 5H6QA 1DU6A 5D6FA 5ICEA 3A2KA 3DEUA 1ZELA 2M8EA 4J19A 2BXYA 2DCEA 2L7FP 3NEUA 4MQ9F 1XCVA 3H35A 2HFHA 3V8KA 3FHZA 4B3AA 3VOEA 4HRIA 1OCPA 4HSTA 2LRDA 2JZYA 2EH3A 1D1CA 4EV0A 4QLCU 2L7MP 2UUZA 3WHBA 3W2VA 3W6JB 5H2FC 4EJWA 3CLOA 3CCUI 4FX0A 2ZFWA 1VF9A 1XSDA 3HHGA 5DM7F 5CVVA 1R71A 2YSRA 3I4NJ 4XRMA 5KAFC 4M71A 1XCBA 4G9YA 1TL8A 3QODA 2FJ1A 3KX2A 2RREA 1TC3C 1Y0NA 2K9MA 2VL8A 5HDKA 2VOOA 5M3MJ 3DPUA 5FD5A 4BXXJ 2K3PA 2BV6A 1ODDA 5EF6A 2LD5A 3E6BA 5K7HA 1TQIA 3PM1A 3R4KA 2L01A 1RZ4A 1AKHB 4HX4A 2X6YA 2WAQN 4CUGA 2DDAA 2A69F 2PQ8A 1BBYA 4Z2YA 2E35A 3J7ZI 1GV5A 5F0HA 2RAEA 1D1BA 2Y75A 3HSFA 4LGWA 4XRSA 3H5AA 1OMIA 5JHFA 1YLFA 2LKPA 3AG1H 3P9IA 4ENMA 1FJLA 1BJZA 4L0ZB 3W2WA 2MG4A 2CJJA 3DEWA 2VQHA 2FMYA 4L9JA 5DCFA 2E19A 2XUBA 1LPQA 2HU9A 5L3DA 4HG2A 5M5YJ 3KP2A 5E3LA 4XLEA 2CUFA 1AWCA 3HHHA 3OYMA 2XB5A 4YIFA 3JSPA 1HDDC 2M3AA 1WI3A 4BYYA 4M73A 1I3AA 2RNJA 2QEXI 1REPC 2X6OA 3UNGC 3S2DJ 3OIQA 4PJLA 3BCBA 2LG4A 5HLIA 2K40A 4HBLA 4CCJA 4DGWB 2EIKH 4LIUA 3I4PA 4DQ2A 1MBEA 1TW3A 3JCUC 2W7NA 4A12A 2OTLI 3VDXA 4AM3A 1IRGA 1W7PB 4IF4A 3BQYA 3OYAA 3DKXA 3RPUA 1S9HA 3BJOA 1OR7C 2MD0A 3RZDJ 1VTNC 3GFIA 3EDPA 4CDGA 3OS0A 1V5GA 2TDXA 4PFPA 4BGDA 1N77A 1TLHB 2G7UA 2MSYA 3HRTA 3CESA 2LBFA 2XC7A 1SFEA 1K79A 3CJQB 3Q9SA 3PSIA 3K1NA 3RKWA 5IYCJ 2V1UA 3HOUJ 3F8NA 4LFUA 4LG0A 2YX4A 2IS4A 4CXFA 4XBFA 2VUMJ 4AVZA 3K6GA 3K70C 3H3ZA 4A2UA 2M4GA 1PP7U 4UVCA 2ZCWA 5CVRA 3MZHA 1LEAA 2KFDA 3WTVC 1P9QC 3E5UA 1Q1HA 4I02A 3VYSB 1O3QA 2V26A 3M3YJ 3GBGA 1ZAOA 2X51A 3LSPA 2IA0A 2QSHX 3P9KA 1R4NB 1FMWA 3WE2A 3EUHA 2L9NA 3MMYB 2L7KA 4CICA 2HKOA 2Y30A 3OYFA 1PVEA 3MKYB 1A31A 5EZGA 2OCEA 2MGQA 1YS7A 3HB9A 1V55H 4B47A 4B48A 4BQAA 3BROA 1XGSA 3ZQLA 4U7DA 2ZKZA 2R7TA 1KQ8A 4MO7A 4ANJA 2CQ7A 2ME0A 2RV8A 3C7JA 3S1QJ 3OYEA 1KU3A 3TQNA 1OCOH 4A3GJ 5KAIC 1S5LC 1X1BA 4OWRB 1ZK8A 5J47A 1HBXG 3ZQFA 2BW3A 3KP7A 4L9TA 1ONVA 1X3ZB 1ZG3A 1FY7A 3M1CA 4MLOA 1UHMA 4XOPA 3HOXJ 3GTOJ 1WI9A 1JKPC 3L2RA 1MH4A 1SFUA 2KIMA 1D0XA 2X9DA 2L9SA 4E70A 4RLFA 1XG1A 4D0PA 2PG4A 4GYIA 1U2WA 1X1PA 3SFIA 2LMDA 4PSWA 4E7HA 2OA4A 2ZXWH 3CMEI 3I59B 1P4WA 3MKZA 3I0TA 2JA7J 2R7DA 1IN5A 3ECOA 5E1ZB 3JRGA 2GIVA 5E8GA 2VE8A 3DLAA 1SFKA 3B02A 3HOTA 3FMSA 1U0JA 2DA4A 4V2GA 5HNHA 5J4VA 2ZMEA 3NWSA 4Q48A 1FX7A 2EINH 2GA1A 2Z2SB 3K70D 3LQRA 4G94A 2P8TA 4KN7X 2DFEA 2KDZA 3ZMUA 3GZNB 1MW7A 2FF4A 2VN2A 5F0FA 4HX8A 1ZLKA 1VQNI 1TZLA 2JQ7A 2GQQA 2QYOA 2F5EA 4XNFA 2O7OA 2Z99A 4NUBA 2QLZA 5D4RA 1I6HJ 4HF0A 3TEDA 5JFRA 4WXCA 1ZH5A 2CWEA 5E3NA 3ZXSA 4RGUA 4ZTJA 4FE7A 3R6SA 2AQEA 2WV1A 2Y48A 4M74A 2NNYA 1Z0XA 5C4JJ 3FM5A 1D0YA 4A3KJ 5TGTA 2CUJA 3VYTB 4LLNA 2E1NA 4RMNA 4DJAA 2AHQA 3MWMA 3OV8A 3HOYJ 3MKWB 3FM3A 2DK8A 2EFNA 4FTHA 3T0YA 3CUQB 1DGRM 4I2OA 4YEJA 4QTRA 4N0BA 1B72A 3BR1A 1XN7A 2E2HJ 2IP2A 4ITVA 3J81K 3VSKA 1MMGA 1Z67A 3PUBA 4U0VA 1Y1VJ 1RESA 3CTAA 3HJEA 5CVIA 2WC2A 3ZMDA 4CCLA 1OCTC 5IT9K 5CQGA 2DOEA 2K02A 4AUXA 5HOOA 2B7EA 5ERIA 4WF2A 1MSFC 4GDFA 2VKVA 4NC7A 1FTZA 4RAZA 5E79C 2F5VA 1FPQA 3VB2A 5BOXA 2WADA 3GTMJ 1WVRA 4G6TB 5IOYA 4X6AJ 2BHZA 2DLLA 1EH7A 2MFZA 3ULQB 3OYJA 4A0ZA 2VB6A 5EJCA 5J8CA 5LLQA 2V6CA 4NHJA 3B73A 1YS6A 5CPRB 2Y2ZA 2O61A 4EQQA 2M8GX 2VKHA 4BJTA 3SJMA 3Q5FA 2HDDA 2M0CA 1U8RA 2EV6A 5DEQA 2KIQA 4JX6A 5L3EA 5BNGA 5K7ZA 2QSFX 3J7AY 3JREA 3TW7A 3WTUC 1R4MB 1RNLA 2P6SA 4KJZA 4A3LJ 1QQIA 1Z6RA 3CJRB 4EJTA 5HODA 1V4RA 3DWLE 3GMEA 2GXAA 3CCQI 3K7AJ 2BYVE 3BTIA 2XDVA 3RKXA 5BPDA 2VBZA 5D8KB 1G6NA 4BBSJ 2L3DA 3P5JA 4YFKF 2VQLA 5ICFA 2QBYA 3HOWJ 2HOSA 4XONA 3BWGA 4OIPF 2MH2A 1BI0A 3DF8A 4GCVA 4A3BJ 2RN7A 3M4OJ 1IZ1A 2K27A 1Z1DA 2X4HA 1T39A 4B4CA 2F5DA 3Q0WA 4I98B 3HOZJ 2BY0A 2ZXHA 1BA5A 3HUGA 5J40A 5DS9A 1XSXA 1I6XA 1Z3YA 4KN4X 2OD5A 3G1OA 1BJAA 4DYRA 5DCMA 3C3WA 3D5SC 4BJ6C 1DDNA 4ABZA 1TW2A 1EH6A 1XPXA 2VBXA 5FKNA 2HPIA 4RM2A 4PGGA 5D8LB 2NOJB 3CP2A 4M3FA 3D1NI 1OYIA 5C44J 5CVJA 2A6TA 3RZOJ 2LBFB 4CHUA 2EJRA 3ZN0A 3L00A 2HR3A 5K7FA 1RC9A 4LG0B 2VLAA 4XSXF 1OCRH 1FSHA 2XRNA 4ZYAA 2CO5A 3E5QA 2E36A 4IOAF 1W5CC 3CDLA 4OMZA 4U0YA 4N9IA 1EF4A 1QA6A 3IUOA 5FLMJ 2ZBKA 4UUSA 4U87A 3RKQA 1FOKA 5CYVA 2K9LA 3OOPA 2VC0A 4E7IA 1NG7A 2CMPA 2VT3A 3OYLA 1L0OC 4W97A 2HPMA 3S3MA 5F08A 1JT6A 4IHYA 1KU2A 2E5ZA 1QBJA 2W24A 3FISA 4HQEA 4JK1X 1AOYA 4L5EA 2QKLB 4JYKA 4A3JJ 4CGZA 4C3JJ 1YYVA 4Y15A 3I56I 4RBOA 1SMYF 1APLC 1VQKI 3QWLA 4Q47A 5H6RA 2BHYA 4GXOA 2WB1N 3M8JA 2WTEA 4CCOA 3KETA 4IQJA 5EYRA 3HTSB 2R7UA 1D8JA 2JTVA 3OY9A 2IGMA 2IGNA 1IRFA 3WTXC 3CC2I 1JHFA 2PFBA 3U2RA 1YIJI 3CC4I 1P7JA 2JPBA 2DI3A 2HYGD 2GM4A 4OAZA 1J75A 3CD6I 2HOEA 2E71A 3F8CA 2E34A 3OMYA 5ED4A 1C0WA 3DU5A 5M3FJ 1DP7P 2JA8J 1MZBA 1FYKA 3BG6A 2DPUA 4BQNA 1LFBA 1KU7A 3EETA 2TCTA 1U6GA 4HNUA 2BY1A 4N9HA 1ZQ3P 1ZLJA 2KZGA 2DMPA 5EEHA 2QVOA 3KYLA 3LA7A 4M9ZA 4YFXF 4BE2A 1NH3A 2CUZA 2OUMA 1IW7F 4DZPA 1FTTA 5D5WB 2UZKA 2ZMEB 3ZMZA 5FKOA 1OCCH 2JRMA 3WTZA 2FQ3A 3T8TA 2QWWA 3W2AA 1HCRA 1XX5A 4HV5A 3DPTA 3ZQIA 3CCRI 4B09A 1RETA 4M3BA 2ZJQF 4HZFA 3ZQ7A 3F9KA 4A3DJ 3CF5F 2JSPA 1J09A 3QRFF 2EV0A 1K7AA 1K6YA 1R5HA 1QVUA 5KVRA 2PEXA 4AC0A 4O6JA 4B43A 3EQLF 1BW5A 3R61A 4DNCA 1WWXA 2WAQA 1UG0A 4BHCA 3Q0VA 1SEUA 3DLLF 1T98A 3HRUA 2KRCA 5J4YA 3F22A 2DT6A 1JUSA 4ZYHA 4ON0A 5DUIA 5JVTA 1UZCA 2VQGA 3LMMA 5E3OA 1B72B 4D5FA 4J01A 2HXIA 3E7LA 4CYCB 3BP8A 2X1CA 4JX4A 1MBJA 3FKJA 3FXLA 4LK1F 3BLYA 4R8HA 1JUPA 3VEPA 1SD5A 1ZGJA 2L4MA 2GAUA 4B3XA 1LVKA 2PMZN 2JA6J 4JOMA 3LSKA 2NVYJ 1HSTA 3OYNA 4UNOA 1WZ2A 4UB8C 2XHKA 4HPQA 4KIGA 3RDIA 1R1UA 3A0BC 3TW6A 4K2EA 3K4JA 3ABKH 2K9QA 3K1MA 2H6BA 1W0TA 2LYCA 4OINF 2RDPA 3Q9VA 3FXJA 3F6VA 1Y39A 4IL6C 5FFZA 2EPFA 1E3OC 4N4NB 4MQVA 2WAFA 3AAFA 2NVQJ 1XC5A 1LFUP 1XGOA 5LEJA 1RIOH 3Q3SA 1MH3A 1B9NA 3U9GA 3NAUA 5HS8A 1YJWI 2ETHA 2B63J 4LIVA 1SFXA 3VPRA 1KA8A 3IKVA 5A2QK 3K4LA 1HW2A 3J80K 2RQPA 4NC6A 3F21A 2GOMA 3CF2A 3BR5A 5AIPA 4P5OA 4DYQA 2HEOA 4FISA 4ESFA 3H0DA 3QYBA 4RA2A 4MIMA 3J81Z 4ZYGA 3ZCOA 3QU6A 4RAGA 2DMUA 2BXZA 5E3MA 3ZGKA 5IT9Z 4KMUX 3CCJI 4H0EA 2M87A 5DTDA 3GTPJ 3HG9A 5GP9A 2G0EA 2QBYB 2VI6A 1FOXA 5F04A 1AHDP 3BPVA 5EZHA 4XKWA 5E17F 5GPAA 1E3PA 2JRTA 2EB7A 1WSUA 5DV5A 2XAQA 3IP4B 3EUHC 4BQQA 3D5LA 3AG2H 1DU0A 3S1MJ 1P7IA 3EPZA 3HUGB 3IWZA 2O0YA 2LF7A 4RM3A 2UXNA 2H94A 1G8XA 5DCMB 3ZMTA 2LLKA 1PUFA 3L2UA 3DTKA 5L3FA 1LE8A 4PUSA 3GUDA 4ENNA 4IOCF 3ERED 2HQ5A 1FP2A 5FB2A 1VQ4I 2FBKA 1ZRDA 2IT0A 2L54A 1YX5A 1Z3XA 4AVPA 1J9IA 1Z9CA 4PGHA 1G4DA 2O6GE 3CCYA 2R0QC 3G73A 1U9OA 3DXJF 1MMDA 3WTSC 4IHTA 2KLOA 3BZ6A 1ZRFA 3IH2A 3LA3A 1JTXA 3A0HC 2YR2A 2R93J 5FROA 4HEA2 3ZP5A 4UUSB 2E1MB 4ZC3A 1FWZA 2X1DA 4C3HJ 2Z1DA 3BZCA 2ISZA 3IH4A 4IKFA 4R79A 2M9HA 3IV5A 2EWNA 1AU7A 2XAJA 5D5XB 2EA2A 5HDNA 4UV8A 1NK2P 4EM0B 1IXRC 4EGZA 2ZMEC 2GA2A 4KA4A 3S1NJ 2VJJA 1CF7A 1A5JA 3CCLI 3JRBA 3QOPA 3R0JA 4NDLA 5KHDA 1IXCA 2CS3A 5HS9A 2OCCH 3ASOH 3O8GA 4CCMA 5E1WA 1UHWA 4TV7A 2DJIA 3V8LA 3SZPA 1HXDA 5LEKA 3H5NA 2Z33A 1IGNA 1XDUA 1Q1VA 4DZJA 1VQ8I 3TOBA 2NXNB 1U9NA 2LK2A 4Y4RA 5L3CA 3A1YA 4EEFG 2LP0A 2V9KA 1R5GA 4C30A 4A5NA 2PLYA 4O3MA 2F6CA 1XMAA 2EZHA 4IHSA 2MC4A 4BUPA 1HOMA 3PIOF 3E6CC 3G6EI 2L4AA 2FBHA 3LSJA 2R7XA 2ELHA 5E18F 2VPRA 4IO9F 3HIFA 2I5UA 1TT0A 1TTYA 2M0MA 3A01A 3G1LA 2LDUA 2KDOA 3C2BA 5KCMA 3ROUA 2R5YA 3O2PE 2OC6A 3JRDA 2NS0A 1DQUA 2PMHA 4XL9A 2L9RA 4EJOA 2XRLA 4A0XA 5D5UB 2X6WA 1W1WE 2WY8Q 2FXAA 1BC7C 2BVLA 1P2FA 2K9NA 2IA1A 2Y9YA 4L9NA 3GO5A 2LKSA 4P1WA 4MTEA 2XGEA 1ZGWA 3JRIA 3FXMA 2HKXA 1J0RA 5HS7A 3GTKJ 2EV5A 1MIJA 4NQWA 3HPGA 2D5VA 2G9WA 2ECCA 4QWQA 4FX4A 3F8BA 2DA5A 1OLTA 5EGOA 2P7CB 2KIUA 4HDVA 4C2UA 3ZQQA 1O7LA 3V7CA 3OYDA 1RR7A 1VI0A 3U1DA 2NVTJ 3KCCA 1TQMA 3PO3J 2VOPA 3QQAA 4A3EJ 1F1ZA 4I99C 1G3YA 1VQ5I 3CMAI 3H92A 3K2ZA 1IDZA 4G6DA 1S3JA 2TRTA 2NYXA 2W85A 1ZREA 4OOIA 3QPHA 1BC8C 1F9NA 1IXSB 5J1RA 4EGYA 2ESNA 1WH7A 3UR3C 3WGGA 2M4KA 2QSGX 4I76A 1X1CA 1RUOA 3BTLA 3JTGA 4ESJA 1ZG1A 4BY1J 4P9FA 4UVAA 1I3QJ 2DJNA 3OIPA 3TP0A 1B59A 2DYRH 3TBIA 3LSHA 2EFPA 1X58A 3OSGA 2ZNZA 2KJBA 5IP6A 3ZR8X 2WWYA 4KFCA 4YIIA 3RKYA 3LFUA 3WGHA 3BR0A 4U0WA 1ETYA 4BDYA 3J7AO 1PDNC 2JN6A 1FSEA 1XTAA 2OZ6A 2OZUA 3H9GA 2HXOA 4EJVA 1XGMA 1EH8A 1E0EA 4CCKA 1BR4A 4BHBA 4A3MJ 4BKXA 3PNYA 2Y69H 1D3YA 3KPHA 3T1BA 4A0YA 1FZPB 1LDDA 2QA4I 2PJRB 4BNCA 3TO7A 1X1AA 3DKWA 2HTJA 2NAZA 2EIJH 3OOUA 3KP6A 5IYBJ 2EFQA 4HQMA 3HGYA 3IRRA 4L5JA 2Y9ZA 1QRYA 1A04A 2LNBA 3E5XA 2C6YA 5GAHJ 2IJLA 4BEHA 5DM6F 4FASD 2VT2A 1TNSA 4X1EA 4CSWA 2VE9A 3OS1A 1JJ6C 1RRJA 3PIPF 3SFZA 2DQLA 4A93J 2CW0F 5KNLA 3RQ4A 3L7WA 4A3IJ 1IN8A 3UKGA 2LVSA 4O5VA 2KL4A 4QPQA 1N75A 2R7OA 4P9UA 2KT0A 4A69C 1T6SA 3MAJA 3F8FA 5EG0B 1JGGA 1TWCJ 2I8DA 1EKEA 5DUKA 5HLTA 3LSMA 5JVGF 1MMAA 4C2TA 1MKMA 3KEOA 1DP3A 2HTSA 5FKKA 4XSZF 3Q0UA 1E17A 2K4JA 3JR9A 4WX9A 1PUFB 1IAWA 4KICA 2FE3A 2LY2A 4M6YA 1LE8B 3NQOA 2WB1A 3GFMA 4XN0A 4FQGA 3BY6A 1FNNA 2BGCA 4XN3A 1ULYA 2R7FA 3DCFA 5J1UA 4HW0A 1SFOJ 2FOWA 3KZZA 4I0AA 5A2QZ 1U5TA 4HOBA 3J80Z 1WH5A 3N05A 3ML6A 1BIBA 3QYFA 5CQEA 1I39A 1KQ9A 2LR8A 3OWTA 5K5RA 1JJ8C 5IT3A 4KMFA 2Q0OA 2QQBA 5E20A 1T95A 3A02A 2FQ4A 3RJPA 2BOLA 2IRFG 1IN7A 3WU1B 1J7KA 2NVXJ 3TOAA 3S2WA 1O3SA 1UG2A 1UAAA 3E0JB 1GVJA 4IPAA 4A5MA 4JP0A 1L3LA 5K5OA 5GTIC 1I27A 2ISYA 2D45A 1T8IA 1SVLA 4B8XA 3MQ0A 4B44A 1T0FC 5ILSA 1HKQA 2P4WA 2E1CA 1JI8A 4G8XA 1U8BA 4UVBA 1BI3A 2HOTA 1CF7B 4R1HA 3I54A 2QKMB 1PUEE 4BXFA 3K4BA 2JWTA 4AYBN 3DP7A 5IP9J 1Z05A 1R1VA 3BJ6A 2VKDA 5CJ9A 2DT7B 3TDUC 4ZZDA 1BIAA 3NWTA 4GGGA 4MFEA 4ZZLA 1YTYA 1FOYA 4KYWA 4LG3A 2KP6A 1ACIA 2X48A 5LRSA 1BW6A 1TWHJ 3DPLC 3VODA 4YIRX 2AQFA 3SDGA 1XMXA 1N25A 1TBXA 2KIFA 3M07A 2W1OA 2DODA 1K6OA 2AXLA 2QENA 2PI0A 1P6RA 1HC8A 4M9SA 4FT8A 1WJFA 3IAM2 2DOAA 2LC2A 1H89C 1HA8A 1A6IA 2EK5A 3QPSA 4XLPF 4ZH4F 1ENHA 3A01B 2VKEA 1ERDA 2L02A 1YW8A 2W57A 2B0LA 2MLKA 3K9TA 2JJ7A 4PJ0C 2R5YB 3BCAA 4BBRJ 1S8NA 3BR2A 3H5RA 2BEOA 1G3WA 4Y17A 4F92B 3LWFA 2EFWA 2FMLA 1K78A 3S17J 1OYWA 1X3UA 1OQYA 2VXDA 2PMZA 2WA0A 3K69A 4KIFA 2YS9A 1Z91A 2PMUA 2IXSA 3IRQA 2Z5UA 2OQRA 2EZLA 1P92A 4PK4A 5FJ8J 1ETXA 3JW4A 3HTUA 2XF5A 2YU3A 1B6AA 2ID3A 3AL0B 5B1BH 4CZZA 5K5QA 3E1SA 2P0WA 1WFXA 3HOSA 4M3EA 3V7SA 3AG3H 1W7PD 4NQWB 1VQ9I 4RB2C 2XKPA 1M1EB 2EZIA 2JUGA 2M30A 5F6FA 1YX3A 4KUMA 3ZQCA 2ZXJA 4BQOA 4LMYA 2FUG2 3CCMI 1BOBA 5GAEJ 3F0CA 3LSGA 5L3BA 1WQ2A 2BZTA 1MSEC 1RUNA 1G59A 3M7GA 1XGNA 3HL2A 2ZJPF 3HOVJ 3G71I 1Y6IA 4HX7A 2CW7A 2FBIA 2R7QA 2XF6A 1ZHFA 5J3LA 4CCNA 1LQ1A 3E97A 3FXKA 3EYIA 4LLLA 2V4JC 2CFOA 1W4MA 1W36C 2JK3A 1F4KA 5H20A 1Z21A 3DQVC 4XKVA 2DO7A 1B9MA 4WXDA 3GZ5A 4QPOA 2A5WA 1J2XA 3KEQA 3H1CA 4QIWN 2R7VA 1GUUA 4N4OB 3H36A 2XROA 2M34A 1X4OA 3CDIA 1RPWA 4DW6A 4RS8A 2VPLA 5LRRA 1FYMA 2H6CA 2BVMA 2X1EA 2OTJI 1LDJA 2BW3B 2LF8A 2N8GA 2QUFA 3V42A 4I6ZA 2H1KA 2DDBA 3ESWB 2KMUA 2CGPA 1WJ5A 1UB9A 1ZARA 2DPDA 2O8KA 3B6CA 1G3TA 3CUQC 4HF1A 1MJ9A 1PJRA 3OYGA 2FU4A 2XB0X 3ZQHA 3M8EA 2IGKA 1UELB 3IC7A 4XLHA 3S15J 4B1RA 3F8MA 4CYDA 5IP7J 1X2MA 4Y52J 3OS2A 3C2GA 3JRFA 2V9VA 4KT5C 3N4MA 1JTYA 1R9TJ 3I71A 4E6KG 3HDDA 3F72A 3I3LA 2CV2A 4BEHB 2HQAA 1TT5B 1BL0A 3ASNH 2STTA 2WV0A 2DBBA 3GW2A 1OKRA 2L0KA 1B1BA 1Z7UA 1NK3P 2VBYA 3L2VA 3L9FA 1IRZA 1NG6A 1H8AC 2XSJC 1QPIA 4ESBA 1E2XA 5E1XA 4IRHA 1FT9A 3QOEA 4BH9A 5JR3A 2XASA 3FXUA 2DFHA 4UUTA 4AIKA 5HLHA 4I01A 4LB6B 5ILUA 4GO1A 1LUJB 1ZN2A 2VBWA 4NC8A 4E7ZA 3FBNB 4OIOF 4PCQA 4AD9A 4I0BA 3CCVI 4BE0A 1SAUA 1WGXA 2F4IA 5CLSA 2K3FA 2PJPA 2DMNA 5HDGA 5K1YA 3O6BB 2LREA 3ZMVA 4EVIA 2GZWA 2FA5A 2HGCA 4LJZF 3KP4A 1J59A 3CQZJ 2JT1A 3WGIA 2IEKA 2R7WA 3DBHB 1KYWA 1T38A 3BG3A 2NVUB 2RQQA 1HQCA 5LGUA 2IBDA 4Y13A 2R4GA 2DU9A 3SEQA 1ETOA 4CZCA 1UHSA 4UB6C 4ZDPA 4II3A 1U5TB 1Y8RB 4XK4A 2CFXA 2ZXIA 3FK6A 1GXQA 3MZYA 4HAMA 2KHMA 1D1AA 3ERMA 2JA2A 3GTLJ 4H4KC 5DD4A 5IYDJ 3I9V2 2DA2A 5F0CA 4V2FA 2DMTA 1FMVA 2IS1A 2A05A 3D0SA 3MKLA 3WODF 2WY7Q 1MJAA 3KEYA 3SHFA 2DXIA 1OISA 3HKZN 3HGGA 1Y1WJ 1MGTA 2GOXB 2MH9A 3LAJA 3E6DA 2UXXA 1T56A 3FXOA 1FEXA 3H3VK 2HVRA 3CUOA 3PNTA 3H3UA 5E8IA 3LAPA 4Y3OA 4JQFA 4XRFA 2M7BA 4I09A 3DTIA 2W82A 3KP3A 4MFDA 1SD7A 2EIMH 2KKOA 5HLGA 1BR1A 3I5UA 4L9VA 3OYKA 2DFFA 2DA3A 1R1TA 2W25A 3IH3A 3PJRA 1Y8QB 3RQIA 3TDZC 4HLYA 1BN5A 3MFKA 3AKZA 3S16J 2XAFA 2VJ4A 2R5ZA 2Y0SN 2K86A 4M3DA 4LLGF 5J8FA 4MTDA 2FRHA 3WHCA 3CCEI 2JA5J 5F27A 2P6TA 3PNVA 2HDCA 3G4SI 1TWGJ 2LSOA 2ZB9A 2GXGA 4L0YB 4DIQA 2D1HA 4AIDA 1Z7LA 5D5VB 2ZJRF 3GFLA 4OU0A 2Y0MA 5IY5H 2FNAA 2DFIA 3OL4A 2DOFA 3RTRA 4D7NA 3FHNA 2IVMA 2RNGA 3DBRB 1O4XA 1I1SA 2J5OA 5B5EC 2V1NA 2HVQA 3ABUA 2MD5A 4D1QA 2IAIA 4IVNA 3GTQJ 1K78B 3CO7C 2IW5A 4EM2A 3OL3A 1ORKA 3BDDA 3QAHA 2GBYA 2X6XA 3I64A 5B3SH 1SAXA 4XLFA 1YITI 2A6EF 3DEEA 3WG7H 1X3WB 1S72I 1N78A 4X0GA 2P81A 3BOQA 3H9QA 1A6QA 2OAZA 3WTTC 2Z9OA 3JRHA 2EBIA 3QP5A 5LBQA 1VQOI 3O8HA 1RKTA 3MZ8A 4NBQA 5FRNA 2RVCA 4S0HB 2AS5F 1YJNI 1F36A 4V19K 5FGMA 1TWAJ 2ZC2A 3I4MJ 5TJJA 1TQPA 3RPUD 3V7RA 5HNFA 2EQRA 4XM3A 4IEJA 2EILH 3HYIA 1X1DA 2HNHA 2LTPA 1H88C 2GIZA 5L3GA 2H8RA 2K85A 1YIOA 4DBRA 1VFCA 1FBSA 1LJ9A 3JRAA 2HDWA 3TGNA 5CKTA 2RGVA 3SYTA 2J5PA 4LD5A 3DBLB 1S7OA 3OYIA 4XLCA 3KE2A 3REOA 1LKXA 4E7LA 4MGRA 3GXOA 2DA7A 3CO6C 4HV6A 2HS5A 2E7XA 2JPCA 2L2OA 5KK1A 3CZ6A 3S3NA 1IRXA 1I1GA 3SZTA 3KIOA 1ZKGA 1FC3A 4Y7NJ 4E7KA 1UJ8A 4CO8A 1GT0C 1VQ6I 3VWBA 2A3SA 3ECHA 3WU2C 3L2CA 5FLXZ 1OYYA 1CQTA 5J1YA 2F48A 1LVAA 4RDUA 3QU3A 1TNTA 5BS6A 2YPRA 1ETVA 5JLWA 3GWZA 2WAEA 4RAYA 1UMQA 1JHHA 3K4NA 1QGPA 4XKCA 3GF2A 1YRNA 2BBYA 1XS9A 1I5ZA 1ON1A 5AONA 3S32A 1SC7A 1DUXC 2A68F 2Z16A 2VIXA 5LHGA 2KPMA 1ETWA 3FIWA 2KRHA 1Y56A 3WE3A 1U3EM 2DYSH 3VFZA 4G6QA 4F93B 4EATA 2DQRA 2M1BA 3VYUB 3QYEA 5FKLA 4BJ5C 3LNQA 5FO5A 2H8WA 2QQ9A 4OIRF 5LHHA 4XQFA 4DYCA 4ZYDA 4U7BA 2FX0A 3KZYA 4YELA 2ZNYA 1ITYA 3OR1C 1IV6A 1U5TC 5ICCA 4IQ4A 4HF2A 4RLQA 2O8XA 3COAC 2GWRA 2VC1A 3RCOA 1E3HA 1R6RA 1VNDA 1VQMI 4AIJA 1S29A 1JUMA 2Y31A 4L5IA 4D5CA 1V5EA 3M8FA 3W3CA 3HEFA 4XLAA 5LGTA 5F1RA 1GDTA 1TP4A 3PL8A 5FD6A 3CMMA 1D8KA 4AU7A 3OR2C 4OAYA 3GX4X 1D5YA 1SMTA 3LOCA 2JVHA 1DGWY 1OJLA 2E2JJ 3K2AA 4ZDLA 1LB2A 2XKOA 2K9SA 1MNDA 4RGXA 3X2QH 3IKTA 5BPIA 2VJIA 4XICA 1O57A 2CV1A 1OFCX 1K4SA 2ADUA 2XVCA 5CVUA 3V4GA 2DK5A 3HRMA 4AYBA 5C3EJ 3C18A 2M5WA 4ASNA 3HM5A 3LQQA 4F7ZA 3CCSI 2MABA 3C1DA 2DTZA 1B4AA 4HYEA 5TISC 1T33A 2CQQA 2NS7A 4BL0B 3SZGA 1MNMC 2V6EA 5M5WJ 3TP3A 2EFOA 2QM3A 1MBHA 2M2EA 1FOWA 3TO9A 1DPRA 4LITA 2OV7A 3JAMK 3S8PA 1MJBA 1T08B 3PQJA 2CG4A 5FFXA 4W1UA 1TWFJ 3QPTA 4LOCA 4YFNF 4ZTFA 1G3SA 2XF7A 4F91B 4IXAA 2UWMA 3KFWX 3G1MA 3BR3A 4PZJA 1JE8A 2MW8A 4F55A 1H9GA 1ZYRF 2CQNA 1W5SA 3L09A 4UXNA 2P5KA 2QGUA 2XGDA 5EEGA 4F3QA 3C2HA 1DPUA 3ZN1A 4EM1A 3I58A 1R58A 2BY3A 2PBIA 3IAS2 2LY1A 2DA1A 1VQLI 2R7SA 1W0UA 9ANTA 5FKMA 4G7OF 1KU9A 1POGA 1Y0UA 6PAXA 3VSLA 3LFKA 2YUSA 4HA8A 1WKMA 2CYYA 3GVAA 1WPKA 2CH0A 1U78A 1FLIA 2XGXA 4Y33A 2ID6A 2B9SA 1XDSA 1QHGA 3OYCA 3RSNA 4M72A 1LEBA 2Q1ZB 1IO2A 2R92J 3RI4A 4A3FJ 2XAGA 3CMYA 1X19A 2R5ZB 2WBMA 2HQRA 3S2HJ 3I53A 3E6MA 1WJBA 3T8RA 2QQAA 1ZRCA 1W5TA 4FHTA 1SD4A 4ZDOA 1QZZA 2E1MC 4XOTA 2K7LA 5BMZA 5GTHC 2M45A 4RGSA 1WJEA 2F2EA 4M6VA 1Z77A 4I7HA 4OIQF 2HQNA 1R00A 3IL2A 1NHAA 2KQRA 5ICGA 1ZR2A 3FMRA 4FETA 1MDMA 4FCYA 3U1KA 3JRCA 1WJAA 4M6XA 5FRMA 3W6KB 4C3IJ 2H09A 4FE4A 3V8JA 2V1DA 1YJ9I 3LSIA 2BE5F 5GPCA 2YX7A 2GXBA 2FOKA 2ZSHB 2QCOA 3JSOA 3M1EA 4IX7A 4IJAA 3PFYA 1RI7A 3BG9A 4U88A 2UV1A 3GLLA 1LFPA 1IN4A 3M9AA 2ECBA 3SEZA 3KLOA 4IZZA 1PP8F 3S1RJ 1ZGAA 4GFBA 3FMQA 4BHPA 2Q2EA 5F64A 1IDYA 4G7ZF 3H0GJ 3W6VA 3KP5A 4RB3C 4KNYA 3FK7A 5FLVA 3RYPA 1QPMA 4P55A 4BE1A 3PQKA 3F3XA 2E7WA 4M3GA 1RR8C 4IHVA 2JUCA 4ZJZA 4UY8I 2R7RA 4Z6YA 1ZR4A 3FX3A 4II2A 5JLXA 3HBLA 2O03A 4CYCA 3ABLH 2OJED 3CLQA 3LSTA 4DOZA 2O9LA 2P5LC 3K4CA 2HZTA 1NTCA 4ENKA 3BT9A 4KITB 1KGSA 2X85A 4S05A 3FZVA 2E60A 1OR7A 1YFHA 3SQNA 1IUYA 4PJNA 4LK0F 3S3OA 2H27A 1D5VA 2AXTC 1QZEA 2ELKA 4HNVA 1CGPA 3K1PA 4MNUA 1KONA 1BM9A 1BR2A 2O3FA 3I55I 1EV7A 2KJCA 4AIHA 1JGSA 2FNPA 4E4HA 3BR6A 1ETQA 1IC8A 2CSOA 3FWEA 3ABMH 3BJAA 2BY2A 1MMNA 2R7ZJ 1YRNB 5GAGJ 4ENJA 3S93A 4KT6A 2DN0A 1JKOC 2VONA 3MVPA 5IOZA 4XR6A 3DU6A 1BOAA 3NRVA 5M5XJ 3CC7I 4IHXA 4IHWA 2XAUA 4QSHA 5LGNA 1A36A 3L2WA 2DT5A 1MBGA 2ICWG 5D6EA 2V9PA 1GVDA 3FXRA 1PYVA 2V79A 2FEZA 2VQCA 4NNJA 3TMOA 2LKXA 2OF7A 4BACA 3O3KA 5FLXK 2QZ8A 4A3CJ 3HC7A 4YRVA 1KYZA 3DKYA 2XPWA 4S04A 2A61A 1B8IA 5HVQC 2XV4S 3ELKA 4A6DA 2K5CA 3OIOA 4WK8F 2W48A 1X4PA 3E3VA 1S7EA 1ZTRA 2E5NA 1BI1A 4C9YA 1O3TA 2RKHA 3HKZA 4E7JA 1FBUA 2HYFA 5LHIA 1ON2A 4BU2A 1A35A 3DV8A 2PX9A 1USTA 5IPAA 2F5FA 5EGOB 2OBPA 1QU3A 1FIAA 2NOGA 3BPXA 3FF5A 2DA6A 4CA0A 1EJ9A 2STWA 2AO9A 1WCMJ 2FSWA 4G12A 4GYGA 1S6LA 3RPQA 2PN6A 3ABTA 3BG5A 1F5TA 1MMSA 2LY9A 2KZVA 3VYRB 3J7YJ 1FIPA 4XRSG 1LNWA 1H0MA 2IS2A 4PFOA 3N97A 2ESHA 3SXYA 2L5QA 2IPQX 2DW4A 2XIGA 3HZJA 4RGRA 1GHCA 2Y0SA 1WHUA 1SANA
chains in the Genus database with same CATH topology
3K0LA 1YW7A 2R3SA 1ZG5A 3QP6A 4UHTA 1USSA 3PFIA 3HSRA 1FP1D 1QO0D 1UCRA 5ILVA 4WCGA 3WTYC 3GLXA 3T5XA 1YO5C 1R36A 4UV9A 5DDGA 3EYYA 2F5CA 2MA3A 3G3ZA 1R22A 3WG9A 1J5YA 4JBAA 2P7VB 5AIQA 1Z6TA 3TKYA 2NNNA 1XMKA 4OMYA 1R7JA 1V3FA 1HKSA 2RC4A 4HLXA 1XB4A 4RB1A 4KIBA 4KDPA 3GFJA 1P4XA 4MEYF 3JAMZ 4IRIA 4BXUA 4Q5SF 1QZYA 1W7PA 1P4AA 1MDMB 3IHUA 3WU0A 1T0FA 1LDKB 1FBQA 2A6HF 5JHUA 3P9CA 3IWFA 1UFMA 1O3RA 1YG2A 4L18B 2A5YB 3GYHX 3CDHA 2CQKA 1T2KA 4RB0A 1HSJA 1MD0A 4AWXB 3FXQA 2ZO4A 4BAYA 2HWVA 3ISPA 2IA2A 4PDKA 4WXHA 1HW1A 1GXPA 4YG2F 3JTHA 4LB5A 3CJNA 1S7AA 3F23A 4EJUA 2OU2A 3LA2A 3HSEA 1YQAA 1H9TA 1BI2A 2VODA 2NRAC 1IN6A 1R23A 4UUVA 2KRFA 3GZ6A 1SD6A 4ETSA 3RIRA 2P5VA 1JXSA 4IRGA 3GEZA 1XSVA 4ZYEA 2W84A 2V1XA 1OPCA 4HDUA 2DTRA 3ZMSA 1STZA 3HRSA 5D4SA 3P7NA 2DAOA 2D2WA 5BQTA 3ZPLA 3F6OA 4M9XA 4MEXF 3DFGA 3I59A 1IF1A 1QNTA 5JI6A 1YW9A 2X0LA 4P96A 1FYLA 2Z3YA 2XAHA 4XLNF 5J6XA 1KQ0A 1WRJA 4NB5A 5DYMA 2ZJ2A 4EMSA 3WTWC 4G7HF 2A07F 3TO6A 2MLGA 2MBFA 1O7FA 2JSCA 2EA4A 2COMA 3MEXA 1XD7A 2MC3A 2D1VA 4Q4ZF 5TRDA 2Q8KA 2K4BA 2G7HA 3R0AA 3R60A 3MCZA 3RYRA 3KLNA 1HW5A 3CUQA 2VXZA 5DD8A 4WWCA 4MHGA 1HKTA 2OQGA 2ACJA 4A6EA 5H6QA 5D6FA 5ICEA 3DEUA 2M8EA 3NEUA 4MQ9F 1XCVA 3V8KA 2HFHA 3FHZA 3VOEA 2JZYA 4EV0A 4QLCU 3W6JB 4EJWA 3CLOA 4FX0A 2ZFWA 1XSDA 3HHGA 5CVVA 2YSRA 4M71A 1XCBA 4G9YA 5HDKA 2VOOA 5FD5A 2BV6A 1ODDA 3E6BA 1TQIA 3R4KA 2L01A 1RZ4A 4HX4A 2PQ8A 2A69F 1BBYA 4Z2YA 3HSFA 2Y75A 4LGWA 1OMIA 1YLFA 2LKPA 3P9IA 4ENMA 4L0ZB 2FMYA 4L9JA 5DCFA 2XUBA 5L3DA 3KP2A 1AWCA 3HHHA 4YIFA 3JSPA 4BYYA 4M73A 2RNJA 1REPC 5HLIA 4HBLA 3I4PA 4DQ2A 1TW3A 4A12A 1IRGA 1W7PB 4IF4A 3RPUA 3BJOA 1VTNC 3GFIA 3EDPA 4CDGA 2TDXA 1TLHB 2G7UA 3HRTA 1SFEA 1K79A 3Q9SA 3K1NA 3RKWA 2V1UA 3F8NA 4LFUA 4LG0A 2YX4A 4CXFA 4XBFA 3H3ZA 4A2UA 1PP7U 4UVCA 2ZCWA 5CVRA 3MZHA 1LEAA 3WTVC 3E5UA 1Q1HA 4I02A 1O3QA 1ZAOA 2IA0A 3P9KA 3WE2A 3EUHA 4CICA 2HKOA 1YS7A 4BQAA 3BROA 1XGSA 4U7DA 2ZKZA 1KQ8A 2RV8A 3C7JA 1KU3A 3TQNA 1HBXG 3KP7A 4L9TA 1ZG3A 1ONVA 1FY7A 1UHMA 1WI9A 1SFUA 2KIMA 4E70A 4D0PA 2PG4A 4GYIA 1U2WA 2OA4A 3I59B 1P4WA 3I0TA 2R7DA 1IN5A 3ECOA 5E1ZB 2GIVA 5E8GA 2VE8A 3B02A 3HOTA 3FMSA 2ZMEA 4Q48A 1FX7A 2GA1A 3LQRA 4G94A 2P8TA 4KN7X 3ZMUA 2FF4A 2VN2A 4HX8A 1ZLKA 2GQQA 2QYOA 2F5EA 2Z99A 2QLZA 5D4RA 4HF0A 5JFRA 4WXCA 1ZH5A 2CWEA 4RGUA 3R6SA 4M74A 2Y48A 2NNYA 3FM5A 4LLNA 2E1NA 3MWMA 3OV8A 3FM3A 2DK8A 2EFNA 3T0YA 3CUQB 4I2OA 4N0BA 1XN7A 2IP2A 3J81K 4U0VA 5CVIA 3CTAA 2WC2A 3ZMDA 5IT9K 2K02A 5HOOA 5ERIA 4WF2A 4RAZA 1FPQA 3VB2A 5BOXA 2DLLA 1EH7A 3ULQB 5LLQA 5J8CA 2V6CA 4NHJA 3B73A 1YS6A 2O61A 4EQQA 3Q5FA 1U8RA 2EV6A 5DEQA 5L3EA 3WTUC 1RNLA 2P6SA 1QQIA 1Z6RA 4EJTA 1V4RA 2BYVE 3RKXA 5BPDA 2VBZA 5D8KB 1G6NA 2L3DA 4YFKF 5ICFA 2QBYA 3BWGA 4OIPF 2MH2A 1BI0A 3DF8A 4GCVA 2RN7A 1IZ1A 2K27A 1Z1DA 2X4HA 1T39A 2F5DA 4I98B 3HUGA 1XSXA 1I6XA 4KN4X 2OD5A 1BJAA 5DCMA 3C3WA 1DDNA 1TW2A 1EH6A 2VBXA 4PGGA 5D8LB 1OYIA 5CVJA 4CHUA 2EJRA 3ZN0A 3L00A 2HR3A 4LG0B 4XSXF 1FSHA 2XRNA 2CO5A 3E5QA 4OMZA 4U0YA 4N9IA 2ZBKA 1FOKA 5CYVA 3OOPA 2VC0A 2VT3A 1L0OC 1KU2A 1QBJA 2W24A 4HQEA 4JK1X 1AOYA 4CGZA 1YYVA 4Y15A 1SMYF 4Q47A 5H6RA 4GXOA 3KETA 2WTEA 3HTSB 1D8JA 2JTVA 1IRFA 3WTXC 1JHFA 2PFBA 3U2RA 2JPBA 2DI3A 2HYGD 1J75A 2HOEA 3F8CA 5ED4A 1C0WA 1DP7P 1MZBA 1FYKA 2DPUA 1KU7A 3EETA 1U6GA 4N9HA 1ZLJA 5EEHA 2QVOA 3LA7A 4M9ZA 4YFXF 1IW7F 5D5WB 2UZKA 2ZMEB 3ZMZA 3WTZA 2FQ3A 3T8TA 2QWWA 4HV5A 3DPTA 4B09A 4HZFA 3ZQ7A 3QRFF 2EV0A 1K7AA 1R5HA 5KVRA 2PEXA 4O6JA 3EQLF 3R61A 4DNCA 1WWXA 4BHCA 1T98A 3HRUA 3F22A 4ZYHA 4ON0A 5DUIA 5JVTA 3BP8A 4LK1F 4R8HA 3VEPA 1SD5A 1ZGJA 2L4MA 2GAUA 1HSTA 4UNOA 2XHKA 4KIGA 3RDIA 1R1UA 4K2EA 3K1MA 2H6BA 4OINF 2RDPA 3Q9VA 3F6VA 5FFZA 4MQVA 3AAFA 1XGOA 5LEJA 1RIOH 5HS8A 3U9GA 1B9NA 2ETHA 1SFXA 1KA8A 3IKVA 5A2QK 1HW2A 3J80K 2RQPA 3F21A 5AIPA 4P5OA 2HEOA 4ESFA 3J81Z 4ZYGA 3QU6A 5IT9Z 4KMUX 4H0EA 2M87A 2QBYB 3BPVA 5E17F 2JRTA 2EB7A 1WSUA 5DV5A 2XAQA 3D5LA 3IWZA 2O0YA 2LF7A 2UXNA 2H94A 5DCMB 3ZMTA 5L3FA 3GUDA 4ENNA 3ERED 1FP2A 5FB2A 2FBKA 1ZRDA 2IT0A 2L54A 4AVPA 1J9IA 1Z9CA 4PGHA 1G4DA 2O6GE 3G73A 3DXJF 3WTSC 4IHTA 3BZ6A 1ZRFA 3LA3A 2YR2A 3ZP5A 1FWZA 2ISZA 4R79A 2EWNA 2XAJA 5D5XB 2EA2A 5HDNA 4UV8A 4EM0B 1IXRC 4EGZA 2GA2A 4KA4A 1CF7A 3QOPA 3R0JA 1IXCA 5HS9A 5E1WA 1UHWA 4TV7A 3V8LA 3SZPA 1HXDA 5LEKA 2Z33A 1XDUA 3TOBA 5L3CA 1R5GA 4A5NA 2PLYA 4O3MA 1XMAA 4IHSA 3E6CC 2L4AA 2FBHA 2ELHA 5E18F 3HIFA 1TTYA 2LDUA 3ROUA 3O2PE 2NS0A 2PMHA 4EJOA 4A0XA 5D5UB 2FXAA 1BC7C 2VE9A 1P2FA 4L9NA 2IA1A 3GO5A 4MTEA 2HKXA 1J0RA 5HS7A 2EV5A 4NQWA 2G9WA 4QWQA 4FX4A 3F8BA 2P7CB 2KIUA 4HDVA 1O7LA 3V7CA 3U1DA 3KCCA 1TQMA 2VOPA 1F1ZA 1G3YA 3H92A 3K2ZA 4G6DA 1S3JA 2NYXA 2W85A 1ZREA 4OOIA 3QPHA 1BC8C 1F9NA 1IXSB 4EGYA 2ESNA 3WGGA 1RUOA 3JTGA 4ESJA 1ZG1A 4P9FA 4UVAA 1B59A 2EFPA 2ZNZA 2KJBA 2WWYA 4KFCA 4YIIA 3RKYA 3WGHA 4U0WA 3J7AO 1PDNC 1FSEA 2OZ6A 2OZUA 4EJVA 1XGMA 1EH8A 4BHBA 1D3YA 3T1BA 4A0YA 1FZPB 1LDDA 4BNCA 3TO7A 3DKWA 2HTJA 2NAZA 3KP6A 2EFQA 4HQMA 3IRRA 4L5JA 3E5XA 1A04A 2LNBA 2C6YA 2IJLA 2VT2A 1TNSA 3SFZA 2DQLA 2CW0F 3L7WA 1IN8A 4O5VA 4P9UA 1T6SA 3MAJA 3F8FA 5DUKA 1MKMA 3KEOA 2HTSA 4XSZF 1E17A 2K4JA 4WX9A 1IAWA 4KICA 2FE3A 4M6YA 3NQOA 3GFMA 3BY6A 1FNNA 2BGCA 1ULYA 2R7FA 4HW0A 3KZZA 5A2QZ 4I0AA 1U5TA 4HOBA 3J80Z 3ML6A 1BIBA 1KQ9A 5K5RA 5IT3A 4KMFA 2Q0OA 2QQBA 5E20A 3RJPA 2IRFG 1IN7A 3WU1B 1J7KA 3TOAA 3S2WA 1O3SA 1GVJA 4IPAA 4A5MA 1L3LA 5K5OA 1I27A 2ISYA 2D45A 4B8XA 3MQ0A 5ILSA 1HKQA 2P4WA 2E1CA 4G8XA 4UVBA 1BI3A 1CF7B 4R1HA 3I54A 1PUEE 3DP7A 1Z05A 1R1VA 3BJ6A 5CJ9A 3TDUC 4ZZDA 1BIAA 4GGGA 4ZZLA 1YTYA 4KYWA 5LRSA 3DPLC 3VODA 2KIFA 1TBXA 1K6OA 2AXLA 2QENA 2PI0A 1P6RA 4M9SA 4FT8A 2EK5A 4XLPF 4ZH4F 2L02A 1YW8A 2W57A 2B0LA 2MLKA 3K9TA 1S8NA 2BEOA 1G3WA 4Y17A 2EFWA 3LWFA 2FMLA 1K78A 1OYWA 1X3UA 3K69A 4KIFA 1Z91A 2PMUA 3IRQA 2Z5UA 2OQRA 1P92A 3JW4A 3HTUA 2YU3A 1B6AA 4CZZA 5K5QA 3HOSA 3V7SA 1W7PD 4RB2C 2XKPA 2M30A 5F6FA 4KUMA 2ZXJA 4LMYA 5L3BA 1WQ2A 1RUNA 3M7GA 1XGNA 4HX7A 2FBIA 1ZHFA 1LQ1A 3E97A 3EYIA 4LLLA 1W4MA 1F4KA 5H20A 3DQVC 2DO7A 1B9MA 4WXDA 3GZ5A 1J2XA 3KEQA 2XROA 4RS8A 5LRRA 1FYMA 2H6CA 1LDJA 2LF8A 2QUFA 2CGPA 1UB9A 1ZARA 2DPDA 1G3TA 3CUQC 4HF1A 1MJ9A 2FU4A 3M8EA 3IC7A 3F8MA 4CYDA 2V9VA 4KT5C 3N4MA 3I71A 3F72A 2STTA 2WV0A 2DBBA 3GW2A 1OKRA 1B1BA 1Z7UA 2VBYA 3L9FA 4ESBA 1E2XA 5E1XA 4IRHA 1FT9A 4BH9A 5JR3A 2XASA 3FXUA 4AIKA 5HLHA 4I01A 4LB6B 5ILUA 4GO1A 1ZN2A 2VBWA 4OIOF 4PCQA 4AD9A 4I0BA 5CLSA 2PJPA 5HDGA 5K1YA 3O6BB 3ZMVA 4EVIA 2GZWA 2FA5A 2HGCA 4LJZF 3KP4A 1J59A 2JT1A 3WGIA 1T38A 1KYWA 1HQCA 5LGUA 4Y13A 2DU9A 1U5TB 2CFXA 1GXQA 3MZYA 4HAMA 5DD4A 3D0SA 3WODF 1MJAA 3SHFA 1MGTA 2MH9A 3LAJA 3E6DA 2UXXA 3CUOA 3LAPA 3H3UA 5E8IA 4JQFA 4XRFA 4I09A 3KP3A 1SD7A 5HLGA 2KKOA 3I5UA 4L9VA 1R1TA 2W25A 4HLYA 3TDZC 1BN5A 3MFKA 2XAFA 2K86A 4LLGF 5J8FA 4MTDA 2FRHA 2P6TA 2HDCA 2LSOA 2GXGA 4L0YB 2D1HA 5D5VB 3GFLA 4OU0A 2Y0MA 2FNAA 2DFIA 3RTRA 2IVMA 1I1SA 2J5OA 3ABUA 2MD5A 4IVNA 1K78B 3CO7C 2IW5A 4EM2A 3QAHA 3BDDA 1SAXA 3I64A 2A6EF 3BOQA 2Z9OA 2OAZA 3WTTC 3QP5A 5LBQA 2RVCA 2AS5F 5FGMA 5TJJA 1TQPA 3V7RA 3HYIA 5L3GA 1YIOA 1FBSA 1LJ9A 3TGNA 2RGVA 2J5PA 4LD5A 1S7OA 3KE2A 3REOA 4MGRA 3GXOA 3CO6C 4HV6A 2HS5A 2E7XA 2JPCA 5KK1A 1I1GA 3SZTA 1FC3A 4CO8A 2A3SA 3ECHA 3L2CA 5FLXZ 1OYYA 1LVAA 3QU3A 1TNTA 5BS6A 2YPRA 3GWZA 4RAYA 1JHHA 1QGPA 3GF2A 2BBYA 1I5ZA 1ON1A 5AONA 1DUXC 2A68F 5LHGA 1U3EM 3WE3A 3VFZA 4G6QA 2DQRA 2M1BA 5FO5A 2QQ9A 4OIRF 5LHHA 4ZYDA 4U7BA 3KZYA 2ZNYA 1U5TC 5ICCA 4HF2A 2O8XA 3COAC 2GWRA 2VC1A 4AIJA 1S29A 4L5IA 3M8FA 5LGTA 5F1RA 5FD6A 1D8KA 3GX4X 1SMTA 1LB2A 2XKOA 4RGXA 3IKTA 5BPIA 1O57A 2ADUA 2XVCA 5CVUA 3V4GA 2DK5A 3HRMA 3C18A 2M5WA 4ASNA 3LQQA 4F7ZA 3C1DA 1B4AA 4HYEA 2EFOA 2QM3A 3TO9A 1DPRA 3JAMK 1MJBA 3PQJA 2CG4A 5FFXA 3QPTA 4YFNF 1G3SA 4IXAA 2UWMA 3KFWX 4PZJA 1JE8A 1H9GA 1ZYRF 1W5SA 3L09A 4UXNA 2P5KA 5EEGA 1DPUA 3ZN1A 4EM1A 3I58A 1R58A 2PBIA 4G7OF 1KU9A 1Y0UA 6PAXA 3LFKA 4HA8A 1WKMA 2CYYA 3GVAA 1U78A 1FLIA 2XGXA 1XDSA 4M72A 1LEBA 3RI4A 2XAGA 2HQRA 3I53A 3E6MA 3T8RA 2QQAA 1ZRCA 1W5TA 4FHTA 1SD4A 1QZZA 2K7LA 5BMZA 2M45A 4RGSA 2F2EA 4I7HA 4OIQF 2HQNA 1R00A 3IL2A 1NHAA 5ICGA 3FMRA 1MDMA 4M6XA 3W6KB 2H09A 3V8JA 2V1DA 2BE5F 2YX7A 2GXBA 2FOKA 3JSOA 3M1EA 4IJAA 1RI7A 4U88A 1IN4A 3M9AA 3KLOA 1PP8F 1ZGAA 3FMQA 4BHPA 2Q2EA 5F64A 4G7ZF 3KP5A 4RB3C 4KNYA 3RYPA 1QPMA 4P55A 3PQKA 3F3XA 2E7WA 3FX3A 2O03A 3LSTA 2P5LC 2HZTA 4ENKA 1KGSA 4S05A 3FZVA 1OR7A 1YFHA 3SQNA 1IUYA 4LK0F 2H27A 1D5VA 1CGPA 3K1PA 4MNUA 1BM9A 2O3FA 1EV7A 2KJCA 4AIHA 1JGSA 2FNPA 2CSOA 3FWEA 3BJAA 4ENJA 2VONA 1BOAA 3NRVA 5LGNA 2DT5A 5D6EA 3FXRA 2V79A 2FEZA 3O3KA 5FLXK 2QZ8A 1KYZA 4S04A 2A61A 5HVQC 2XV4S 3ELKA 4A6DA 4WK8F 3E3VA 1BI1A 1O3TA 2RKHA 1FBUA 2HYFA 5LHIA 1ON2A 3DV8A 1USTA 2F5FA 2OBPA 3BPXA 3FF5A 2STWA 2FSWA 4GYGA 3RPQA 1S6LA 2PN6A 3ABTA 1F5TA 1H0MA 1LNWA 3N97A 2ESHA 3SXYA 2IPQX 2DW4A 2XIGA 4RGRA 1GHCA 4A0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0L A;  1YW7 A;  2R3S A;  1ZG5 A;  3QP6 A;  4UHT A;  1USS A;  3PFI A;  3HSR A;  1FP1 D;  1QO0 D;  1UCR A;  5ILV A;  4WCG A;  3WTY C;  3GLX A;  3T5X A;  1YO5 C;  1R36 A;  4UV9 A;  5DDG A;  3EYY A;  2F5C A;  2MA3 A;  3G3Z A;  1R22 A;  3WG9 A;  1J5Y A;  4JBA A;  2P7V B;  5AIQ A;  1Z6T A;  3TKY A;  2NNN A;  1XMK A;  4OMY A;  1R7J A;  1V3F A;  1HKS A;  2RC4 A;  4HLX A;  1XB4 A;  4RB1 A;  4KIB A;  4KDP A;  3GFJ A;  1P4X A;  4MEY F;  3JAM Z;  4IRI A;  4BXU A;  4Q5S F;  1QZY A;  1W7P A;  1P4A A;  1MDM B;  3IHU A;  3WU0 A;  1T0F A;  1LDK B;  1FBQ A;  2A6H F;  5JHU A;  3P9C A;  3IWF A;  1UFM A;  1O3R A;  1YG2 A;  4L18 B;  2A5Y B;  3GYH X;  3CDH A;  2CQK A;  1T2K A;  4RB0 A;  1HSJ A;  1MD0 A;  4AWX B;  3FXQ A;  2ZO4 A;  4BAY A;  2HWV A;  3ISP A;  2IA2 A;  4PDK A;  4WXH A;  1HW1 A;  1GXP A;  4YG2 F;  3JTH A;  4LB5 A;  3CJN A;  1S7A A;  3F23 A;  4EJU A;  2OU2 A;  3LA2 A;  3HSE A;  1YQA A;  1H9T A;  1BI2 A;  2VOD A;  2NRA C;  1IN6 A;  1R23 A;  4UUV A;  2KRF A;  3GZ6 A;  1SD6 A;  4ETS A;  3RIR A;  2P5V A;  1JXS A;  4IRG A;  3GEZ A;  1XSV A;  4ZYE A;  2W84 A;  2V1X A;  1OPC A;  4HDU A;  2DTR A;  3ZMS A;  1STZ A;  3HRS A;  5D4S A;  3P7N A;  2DAO A;  2D2W A;  5BQT A;  3ZPL A;  3F6O A;  4M9X A;  4MEX F;  3DFG A;  3I59 A;  1IF1 A;  1QNT A;  5JI6 A;  1YW9 A;  2X0L A;  4P96 A;  1FYL A;  2Z3Y A;  2XAH A;  4XLN F;  5J6X A;  1KQ0 A;  1WRJ A;  4NB5 A;  5DYM A;  2ZJ2 A;  4EMS A;  3WTW C;  4G7H F;  2A07 F;  3TO6 A;  2MLG A;  2MBF A;  1O7F A;  2JSC A;  2EA4 A;  2COM A;  3MEX A;  1XD7 A;  2MC3 A;  2D1V A;  4Q4Z F;  5TRD A;  2Q8K A;  2K4B A;  2G7H A;  3R0A A;  3R60 A;  3MCZ A;  3RYR A;  3KLN A;  1HW5 A;  3CUQ A;  2VXZ A;  5DD8 A;  4WWC A;  4MHG A;  1HKT A;  2OQG A;  2ACJ A;  4A6E A;  5H6Q A;  5D6F A;  5ICE A;  3DEU A;  2M8E A;  3NEU A;  4MQ9 F;  1XCV A;  3V8K A;  2HFH A;  3FHZ A;  3VOE A;  2JZY A;  4EV0 A;  4QLC U;  3W6J B;  4EJW A;  3CLO A;  4FX0 A;  2ZFW A;  1XSD A;  3HHG A;  5CVV A;  2YSR A;  4M71 A;  1XCB A;  4G9Y A;  5HDK A;  2VOO A;  5FD5 A;  2BV6 A;  1ODD A;  3E6B A;  1TQI A;  3R4K A;  2L01 A;  1RZ4 A;  4HX4 A;  2PQ8 A;  2A69 F;  1BBY A;  4Z2Y A;  3HSF A;  2Y75 A;  4LGW A;  1OMI A;  1YLF A;  2LKP A;  3P9I A;  4ENM A;  4L0Z B;  2FMY A;  4L9J A;  5DCF A;  2XUB A;  5L3D A;  3KP2 A;  1AWC A;  3HHH A;  4YIF A;  3JSP A;  4BYY A;  4M73 A;  2RNJ A;  1REP C;  5HLI A;  4HBL A;  3I4P A;  4DQ2 A;  1TW3 A;  4A12 A;  1IRG A;  1W7P B;  4IF4 A;  3RPU A;  3BJO A;  1VTN C;  3GFI A;  3EDP A;  4CDG A;  2TDX A;  1TLH B;  2G7U A;  3HRT A;  1SFE A;  1K79 A;  3Q9S A;  3K1N A;  3RKW A;  2V1U A;  3F8N A;  4LFU A;  4LG0 A;  2YX4 A;  4CXF A;  4XBF A;  3H3Z A;  4A2U A;  1PP7 U;  4UVC A;  2ZCW A;  5CVR A;  3MZH A;  1LEA A;  3WTV C;  3E5U A;  1Q1H A;  4I02 A;  1O3Q A;  1ZAO A;  2IA0 A;  3P9K A;  3WE2 A;  3EUH A;  4CIC A;  2HKO A;  1YS7 A;  4BQA A;  3BRO A;  1XGS A;  4U7D A;  2ZKZ A;  1KQ8 A;  2RV8 A;  3C7J A;  1KU3 A;  3TQN A;  1HBX G;  3KP7 A;  4L9T A;  1ZG3 A;  1ONV A;  1FY7 A;  1UHM A;  1WI9 A;  1SFU A;  2KIM A;  4E70 A;  4D0P A;  2PG4 A;  4GYI A;  1U2W A;  2OA4 A;  3I59 B;  1P4W A;  3I0T A;  2R7D A;  1IN5 A;  3ECO A;  5E1Z B;  2GIV A;  5E8G A;  2VE8 A;  3B02 A;  3HOT A;  3FMS A;  2ZME A;  4Q48 A;  1FX7 A;  2GA1 A;  3LQR A;  4G94 A;  2P8T A;  4KN7 X;  3ZMU A;  2FF4 A;  2VN2 A;  4HX8 A;  1ZLK A;  2GQQ A;  2QYO A;  2F5E A;  2Z99 A;  2QLZ A;  5D4R A;  4HF0 A;  5JFR A;  4WXC A;  1ZH5 A;  2CWE A;  4RGU A;  3R6S A;  4M74 A;  2Y48 A;  2NNY A;  3FM5 A;  4LLN A;  2E1N A;  3MWM A;  3OV8 A;  3FM3 A;  2DK8 A;  2EFN A;  3T0Y A;  3CUQ B;  4I2O A;  4N0B A;  1XN7 A;  2IP2 A;  3J81 K;  4U0V A;  5CVI A;  3CTA A;  2WC2 A;  3ZMD A;  5IT9 K;  2K02 A;  5HOO A;  5ERI A;  4WF2 A;  4RAZ A;  1FPQ A;  3VB2 A;  5BOX A;  2DLL A;  1EH7 A;  3ULQ B;  5LLQ A;  5J8C A;  2V6C A;  4NHJ A;  3B73 A;  1YS6 A;  2O61 A;  4EQQ A;  3Q5F A;  1U8R A;  2EV6 A;  5DEQ A;  5L3E A;  3WTU C;  1RNL A;  2P6S A;  1QQI A;  1Z6R A;  4EJT A;  1V4R A;  2BYV E;  3RKX A;  5BPD A;  2VBZ A;  5D8K B;  1G6N A;  2L3D A;  4YFK F;  5ICF A;  2QBY A;  3BWG A;  4OIP F;  2MH2 A;  1BI0 A;  3DF8 A;  4GCV A;  2RN7 A;  1IZ1 A;  2K27 A;  1Z1D A;  2X4H A;  1T39 A;  2F5D A;  4I98 B;  3HUG A;  1XSX A;  1I6X A;  4KN4 X;  2OD5 A;  1BJA A;  5DCM A;  3C3W A;  1DDN A;  1TW2 A;  1EH6 A;  2VBX A;  4PGG A;  5D8L B;  1OYI A;  5CVJ A;  4CHU A;  2EJR A;  3ZN0 A;  3L00 A;  2HR3 A;  4LG0 B;  4XSX F;  1FSH A;  2XRN A;  2CO5 A;  3E5Q A;  4OMZ A;  4U0Y A;  4N9I A;  2ZBK A;  1FOK A;  5CYV A;  3OOP A;  2VC0 A;  2VT3 A;  1L0O C;  1KU2 A;  1QBJ A;  2W24 A;  4HQE A;  4JK1 X;  1AOY A;  4CGZ A;  1YYV A;  4Y15 A;  1SMY F;  4Q47 A;  5H6R A;  4GXO A;  3KET A;  2WTE A;  3HTS B;  1D8J A;  2JTV A;  1IRF A;  3WTX C;  1JHF A;  2PFB A;  3U2R A;  2JPB A;  2DI3 A;  2HYG D;  1J75 A;  2HOE A;  3F8C A;  5ED4 A;  1C0W A;  1DP7 P;  1MZB A;  1FYK A;  2DPU A;  1KU7 A;  3EET A;  1U6G A;  4N9H A;  1ZLJ A;  5EEH A;  2QVO A;  3LA7 A;  4M9Z A;  4YFX F;  1IW7 F;  5D5W B;  2UZK A;  2ZME B;  3ZMZ A;  3WTZ A;  2FQ3 A;  3T8T A;  2QWW A;  4HV5 A;  3DPT A;  4B09 A;  4HZF A;  3ZQ7 A;  3QRF F;  2EV0 A;  1K7A A;  1R5H A;  5KVR A;  2PEX A;  4O6J A;  3EQL F;  3R61 A;  4DNC A;  1WWX A;  4BHC A;  1T98 A;  3HRU A;  3F22 A;  4ZYH A;  4ON0 A;  5DUI A;  5JVT A;  3BP8 A;  4LK1 F;  4R8H A;  3VEP A;  1SD5 A;  1ZGJ A;  2L4M A;  2GAU A;  1HST A;  4UNO A;  2XHK A;  4KIG A;  3RDI A;  1R1U A;  4K2E A;  3K1M A;  2H6B A;  4OIN F;  2RDP A;  3Q9V A;  3F6V A;  5FFZ A;  4MQV A;  3AAF A;  1XGO A;  5LEJ A;  1RIO H;  5HS8 A;  3U9G A;  1B9N A;  2ETH A;  1SFX A;  1KA8 A;  3IKV A;  5A2Q K;  1HW2 A;  3J80 K;  2RQP A;  3F21 A;  5AIP A;  4P5O A;  2HEO A;  4ESF A;  3J81 Z;  4ZYG A;  3QU6 A;  5IT9 Z;  4KMU X;  4H0E A;  2M87 A;  2QBY B;  3BPV A;  5E17 F;  2JRT A;  2EB7 A;  1WSU A;  5DV5 A;  2XAQ A;  3D5L A;  3IWZ A;  2O0Y A;  2LF7 A;  2UXN A;  2H94 A;  5DCM B;  3ZMT A;  5L3F A;  3GUD A;  4ENN A;  3ERE D;  1FP2 A;  5FB2 A;  2FBK A;  1ZRD A;  2IT0 A;  2L54 A;  4AVP A;  1J9I A;  1Z9C A;  4PGH A;  1G4D A;  2O6G E;  3G73 A;  3DXJ F;  3WTS C;  4IHT A;  3BZ6 A;  1ZRF A;  3LA3 A;  2YR2 A;  3ZP5 A;  1FWZ A;  2ISZ A;  4R79 A;  2EWN A;  2XAJ A;  5D5X B;  2EA2 A;  5HDN A;  4UV8 A;  4EM0 B;  1IXR C;  4EGZ A;  2GA2 A;  4KA4 A;  1CF7 A;  3QOP A;  3R0J A;  1IXC A;  5HS9 A;  5E1W A;  1UHW A;  4TV7 A;  3V8L A;  3SZP A;  1HXD A;  5LEK A;  2Z33 A;  1XDU A;  3TOB A;  5L3C A;  1R5G A;  4A5N A;  2PLY A;  4O3M A;  1XMA A;  4IHS A;  3E6C C;  2L4A A;  2FBH A;  2ELH A;  5E18 F;  3HIF A;  1TTY A;  2LDU A;  3ROU A;  3O2P E;  2NS0 A;  2PMH A;  4EJO A;  4A0X A;  5D5U B;  2FXA A;  1BC7 C;  2VE9 A;  1P2F A;  4L9N A;  2IA1 A;  3GO5 A;  4MTE A;  2HKX A;  1J0R A;  5HS7 A;  2EV5 A;  4NQW A;  2G9W A;  4QWQ A;  4FX4 A;  3F8B A;  2P7C B;  2KIU A;  4HDV A;  1O7L A;  3V7C A;  3U1D A;  3KCC A;  1TQM A;  2VOP A;  1F1Z A;  1G3Y A;  3H92 A;  3K2Z A;  4G6D A;  1S3J A;  2NYX A;  2W85 A;  1ZRE A;  4OOI A;  3QPH A;  1BC8 C;  1F9N A;  1IXS B;  4EGY A;  2ESN A;  3WGG A;  1RUO A;  3JTG A;  4ESJ A;  1ZG1 A;  4P9F A;  4UVA A;  1B59 A;  2EFP A;  2ZNZ A;  2KJB A;  2WWY A;  4KFC A;  4YII A;  3RKY A;  3WGH A;  4U0W A;  3J7A O;  1PDN C;  1FSE A;  2OZ6 A;  2OZU A;  4EJV A;  1XGM A;  1EH8 A;  4BHB A;  1D3Y A;  3T1B A;  4A0Y A;  1FZP B;  1LDD A;  4BNC A;  3TO7 A;  3DKW A;  2HTJ A;  2NAZ A;  3KP6 A;  2EFQ A;  4HQM A;  3IRR A;  4L5J A;  3E5X A;  1A04 A;  2LNB A;  2C6Y A;  2IJL A;  2VT2 A;  1TNS A;  3SFZ A;  2DQL A;  2CW0 F;  3L7W A;  1IN8 A;  4O5V A;  4P9U A;  1T6S A;  3MAJ A;  3F8F A;  5DUK A;  1MKM A;  3KEO A;  2HTS A;  4XSZ F;  1E17 A;  2K4J A;  4WX9 A;  1IAW A;  4KIC A;  2FE3 A;  4M6Y A;  3NQO A;  3GFM A;  3BY6 A;  1FNN A;  2BGC A;  1ULY A;  2R7F A;  4HW0 A;  3KZZ A;  5A2Q Z;  4I0A A;  1U5T A;  4HOB A;  3J80 Z;  3ML6 A;  1BIB A;  1KQ9 A;  5K5R A;  5IT3 A;  4KMF A;  2Q0O A;  2QQB A;  5E20 A;  3RJP A;  2IRF G;  1IN7 A;  3WU1 B;  1J7K A;  3TOA A;  3S2W A;  1O3S A;  1GVJ A;  4IPA A;  4A5M A;  1L3L A;  5K5O A;  1I27 A;  2ISY A;  2D45 A;  4B8X A;  3MQ0 A;  5ILS A;  1HKQ A;  2P4W A;  2E1C A;  4G8X A;  4UVB A;  1BI3 A;  1CF7 B;  4R1H A;  3I54 A;  1PUE E;  3DP7 A;  1Z05 A;  1R1V A;  3BJ6 A;  5CJ9 A;  3TDU C;  4ZZD A;  1BIA A;  4GGG A;  4ZZL A;  1YTY A;  4KYW A;  5LRS A;  3DPL C;  3VOD A;  2KIF A;  1TBX A;  1K6O A;  2AXL A;  2QEN A;  2PI0 A;  1P6R A;  4M9S A;  4FT8 A;  2EK5 A;  4XLP F;  4ZH4 F;  2L02 A;  1YW8 A;  2W57 A;  2B0L A;  2MLK A;  3K9T A;  1S8N A;  2BEO A;  1G3W A;  4Y17 A;  2EFW A;  3LWF A;  2FML A;  1K78 A;  1OYW A;  1X3U A;  3K69 A;  4KIF A;  1Z91 A;  2PMU A;  3IRQ A;  2Z5U A;  2OQR A;  1P92 A;  3JW4 A;  3HTU A;  2YU3 A;  1B6A A;  4CZZ A;  5K5Q A;  3HOS A;  3V7S A;  1W7P D;  4RB2 C;  2XKP A;  2M30 A;  5F6F A;  4KUM A;  2ZXJ A;  4LMY A;  5L3B A;  1WQ2 A;  1RUN A;  3M7G A;  1XGN A;  4HX7 A;  2FBI A;  1ZHF A;  1LQ1 A;  3E97 A;  3EYI A;  4LLL A;  1W4M A;  1F4K A;  5H20 A;  3DQV C;  2DO7 A;  1B9M A;  4WXD A;  3GZ5 A;  1J2X A;  3KEQ A;  2XRO A;  4RS8 A;  5LRR A;  1FYM A;  2H6C A;  1LDJ A;  2LF8 A;  2QUF A;  2CGP A;  1UB9 A;  1ZAR A;  2DPD A;  1G3T A;  3CUQ C;  4HF1 A;  1MJ9 A;  2FU4 A;  3M8E A;  3IC7 A;  3F8M A;  4CYD A;  2V9V A;  4KT5 C;  3N4M A;  3I71 A;  3F72 A;  2STT A;  2WV0 A;  2DBB A;  3GW2 A;  1OKR A;  1B1B A;  1Z7U A;  2VBY A;  3L9F A;  4ESB A;  1E2X A;  5E1X A;  4IRH A;  1FT9 A;  4BH9 A;  5JR3 A;  2XAS A;  3FXU A;  4AIK A;  5HLH A;  4I01 A;  4LB6 B;  5ILU A;  4GO1 A;  1ZN2 A;  2VBW A;  4OIO F;  4PCQ A;  4AD9 A;  4I0B A;  5CLS A;  2PJP A;  5HDG A;  5K1Y A;  3O6B B;  3ZMV A;  4EVI A;  2GZW A;  2FA5 A;  2HGC A;  4LJZ F;  3KP4 A;  1J59 A;  2JT1 A;  3WGI A;  1T38 A;  1KYW A;  1HQC A;  5LGU A;  4Y13 A;  2DU9 A;  1U5T B;  2CFX A;  1GXQ A;  3MZY A;  4HAM A;  5DD4 A;  3D0S A;  3WOD F;  1MJA A;  3SHF A;  1MGT A;  2MH9 A;  3LAJ A;  3E6D A;  2UXX A;  3CUO A;  3LAP A;  3H3U A;  5E8I A;  4JQF A;  4XRF A;  4I09 A;  3KP3 A;  1SD7 A;  5HLG A;  2KKO A;  3I5U A;  4L9V A;  1R1T A;  2W25 A;  4HLY A;  3TDZ C;  1BN5 A;  3MFK A;  2XAF A;  2K86 A;  4LLG F;  5J8F A;  4MTD A;  2FRH A;  2P6T A;  2HDC A;  2LSO A;  2GXG A;  4L0Y B;  2D1H A;  5D5V B;  3GFL A;  4OU0 A;  2Y0M A;  2FNA A;  2DFI A;  3RTR A;  2IVM A;  1I1S A;  2J5O A;  3ABU A;  2MD5 A;  4IVN A;  1K78 B;  3CO7 C;  2IW5 A;  4EM2 A;  3QAH A;  3BDD A;  1SAX A;  3I64 A;  2A6E F;  3BOQ A;  2Z9O A;  2OAZ A;  3WTT C;  3QP5 A;  5LBQ A;  2RVC A;  2AS5 F;  5FGM A;  5TJJ A;  1TQP A;  3V7R A;  3HYI A;  5L3G A;  1YIO A;  1FBS A;  1LJ9 A;  3TGN A;  2RGV A;  2J5P A;  4LD5 A;  1S7O A;  3KE2 A;  3REO A;  4MGR A;  3GXO A;  3CO6 C;  4HV6 A;  2HS5 A;  2E7X A;  2JPC A;  5KK1 A;  1I1G A;  3SZT A;  1FC3 A;  4CO8 A;  2A3S A;  3ECH A;  3L2C A;  5FLX Z;  1OYY A;  1LVA A;  3QU3 A;  1TNT A;  5BS6 A;  2YPR A;  3GWZ A;  4RAY A;  1JHH A;  1QGP A;  3GF2 A;  2BBY A;  1I5Z A;  1ON1 A;  5AON A;  1DUX C;  2A68 F;  5LHG A;  1U3E M;  3WE3 A;  3VFZ A;  4G6Q A;  2DQR A;  2M1B A;  5FO5 A;  2QQ9 A;  4OIR F;  5LHH A;  4ZYD A;  4U7B A;  3KZY A;  2ZNY A;  1U5T C;  5ICC A;  4HF2 A;  2O8X A;  3COA C;  2GWR A;  2VC1 A;  4AIJ A;  1S29 A;  4L5I A;  3M8F A;  5LGT A;  5F1R A;  5FD6 A;  1D8K A;  3GX4 X;  1SMT A;  1LB2 A;  2XKO A;  4RGX A;  3IKT A;  5BPI A;  1O57 A;  2ADU A;  2XVC A;  5CVU A;  3V4G A;  2DK5 A;  3HRM A;  3C18 A;  2M5W A;  4ASN A;  3LQQ A;  4F7Z A;  3C1D A;  1B4A A;  4HYE A;  2EFO A;  2QM3 A;  3TO9 A;  1DPR A;  3JAM K;  1MJB A;  3PQJ A;  2CG4 A;  5FFX A;  3QPT A;  4YFN F;  1G3S A;  4IXA A;  2UWM A;  3KFW X;  4PZJ A;  1JE8 A;  1H9G A;  1ZYR F;  1W5S A;  3L09 A;  4UXN A;  2P5K A;  5EEG A;  1DPU A;  3ZN1 A;  4EM1 A;  3I58 A;  1R58 A;  2PBI A;  4G7O F;  1KU9 A;  1Y0U A;  6PAX A;  3LFK A;  4HA8 A;  1WKM A;  2CYY A;  3GVA A;  1U78 A;  1FLI A;  2XGX A;  1XDS A;  4M72 A;  1LEB A;  3RI4 A;  2XAG A;  2HQR A;  3I53 A;  3E6M A;  3T8R A;  2QQA A;  1ZRC A;  1W5T A;  4FHT A;  1SD4 A;  1QZZ A;  2K7L A;  5BMZ A;  2M45 A;  4RGS A;  2F2E A;  4I7H A;  4OIQ F;  2HQN A;  1R00 A;  3IL2 A;  1NHA A;  5ICG A;  3FMR A;  1MDM A;  4M6X A;  3W6K B;  2H09 A;  3V8J A;  2V1D A;  2BE5 F;  2YX7 A;  2GXB A;  2FOK A;  3JSO A;  3M1E A;  4IJA A;  1RI7 A;  4U88 A;  1IN4 A;  3M9A A;  3KLO A;  1PP8 F;  1ZGA A;  3FMQ A;  4BHP A;  2Q2E A;  5F64 A;  4G7Z F;  3KP5 A;  4RB3 C;  4KNY A;  3RYP A;  1QPM A;  4P55 A;  3PQK A;  3F3X A;  2E7W A;  3FX3 A;  2O03 A;  3LST A;  2P5L C;  2HZT A;  4ENK A;  1KGS A;  4S05 A;  3FZV A;  1OR7 A;  1YFH A;  3SQN A;  1IUY A;  4LK0 F;  2H27 A;  1D5V A;  1CGP A;  3K1P A;  4MNU A;  1BM9 A;  2O3F A;  1EV7 A;  2KJC A;  4AIH A;  1JGS A;  2FNP A;  2CSO A;  3FWE A;  3BJA A;  4ENJ A;  2VON A;  1BOA A;  3NRV A;  5LGN A;  2DT5 A;  5D6E A;  3FXR A;  2V79 A;  2FEZ A;  3O3K A;  5FLX K;  2QZ8 A;  1KYZ A;  4S04 A;  2A61 A;  5HVQ C;  2XV4 S;  3ELK A;  4A6D A;  4WK8 F;  3E3V A;  1BI1 A;  1O3T A;  2RKH A;  1FBU A;  2HYF A;  5LHI A;  1ON2 A;  3DV8 A;  1UST A;  2F5F A;  2OBP A;  3BPX A;  3FF5 A;  2STW A;  2FSW A;  4GYG A;  3RPQ A;  1S6L A;  2PN6 A;  3ABT A;  1F5T A;  1H0M A;  1LNW A;  3N97 A;  2ESH A;  3SXY A;  2IPQ X;  2DW4 A;  2XIG A;  4RGR A;  1GHC A;  4A0Z A; 
#chains in the Genus database with same CATH topology
 5LFA A;  3K0L A;  1YW7 A;  2R3S A;  1ZG5 A;  3QP6 A;  4C2M J;  4UHT A;  1USS A;  2L9V A;  3PFI A;  3HSR A;  1FP1 D;  2GLO A;  1QO0 D;  1MBF A;  1UCR A;  3A03 A;  5ILV A;  1GV2 A;  4WCG A;  4XMY A;  3WTY C;  4D9J A;  3GLX A;  3T5X A;  1R49 A;  2I10 A;  2DMQ A;  1KZH A;  1YO5 C;  1R36 A;  1JKQ C;  3NAR A;  2CV0 A;  4UV9 A;  1MNE A;  5DDG A;  1SVO A;  3MN2 A;  3EYY A;  1IUF A;  1I50 J;  2F5C A;  2XSD C;  1AKH A;  2MA3 A;  3G3Z A;  3BZK A;  1R22 A;  2JMW A;  1R5I D;  2CW8 A;  3WG9 A;  1J5Y A;  4JBA A;  2O5R A;  4HNT A;  5EEA A;  2P7V B;  2COB A;  5AIQ A;  1Z6T A;  3TKY A;  2IGO A;  2NNN A;  2W00 A;  1XMK A;  3EUA A;  4OMY A;  4BS9 A;  1VZ0 A;  1R7J A;  3HXL A;  3PUF A;  1V3F A;  1HKS A;  3KYD B;  5C4X J;  1YI2 I;  1F43 A;  2RC4 A;  3BG7 A;  4HLX A;  1XB4 A;  4RB1 A;  3MD2 A;  1MBK A;  4KIB A;  4KDP A;  3GFJ A;  4DBQ A;  1P4X A;  2MYS A;  4MEY F;  3JAM Z;  2ELJ A;  4IRI A;  3FBI B;  4BXU A;  2EZK A;  4Q5S F;  1K83 J;  4F52 A;  2ZFU A;  1QZY A;  3GTJ J;  2VJ5 A;  1W7P A;  4HSR A;  1VQP I;  4BY7 J;  5EDN A;  1W36 D;  4GRI A;  3TL4 X;  1P4A A;  1MDM B;  2LOO A;  3G2B A;  3IHU A;  3WU0 A;  2YU9 J;  2F4O B;  3A4C A;  1T0F A;  2H1L A;  2HYJ A;  1LDK B;  1FBQ A;  2A6H F;  5JHU A;  1QHH D;  3P9C A;  3IWF A;  1UFM A;  1O3R A;  4CH7 A;  1YG2 A;  1HLV A;  4L18 B;  1SVM A;  2IS6 A;  2A5Y B;  3GYH X;  3CDH A;  3FDY A;  2CQK A;  1T2K A;  5B1A H;  4RB0 A;  3L1P A;  2FD5 A;  1HSJ A;  2E1O A;  1MD0 A;  2E2I J;  3KYC B;  3D5R C;  4AWX B;  3FXQ A;  2ZO4 A;  4BAY A;  2XPV A;  2HWV A;  3ISP A;  2IA2 A;  4PDK A;  4WXH A;  4XID A;  4E7S A;  3BTJ A;  1HW1 A;  1V5F A;  2Q2E B;  3K4M A;  3CP8 A;  4JX5 A;  1GXP A;  2CU7 A;  2KIS A;  4YG2 F;  3H9J A;  3JTH A;  4LB5 A;  3CJN A;  1S7A A;  2HZD A;  3LSR A;  3BC8 A;  3F23 A;  3KZI C;  2OU2 A;  2JVG A;  4EJU A;  4BDZ A;  3LA2 A;  1G2H A;  1VQ7 I;  3HSE A;  4D7M A;  1YQA A;  2HVS A;  2ZSI B;  3S14 J;  1H9T A;  3B6A A;  5LD2 C;  1BI2 A;  2VOD A;  2NRA C;  3LL7 A;  3EUK L;  1IJW C;  1QVT A;  1IN6 A;  3GCM A;  1D0Z A;  2NS8 A;  1R23 A;  4UUV A;  2KRF A;  4RAF A;  2CRG A;  3U21 A;  2XPU A;  3AL0 C;  3K10 A;  1YE9 A;  3GZ6 A;  1SD6 A;  4ETS A;  3RIR A;  2P5V A;  5B66 C;  1JXS A;  2LFB A;  3K4K A;  2QF7 A;  3GEZ A;  4IRG A;  1XSV A;  2LH9 A;  4ZYE A;  2W84 A;  3FKI J;  2L7Z A;  2ME6 A;  1JT0 A;  2V1X A;  1OPC A;  4HDU A;  3PO2 J;  3ONQ A;  2DTR A;  2M7A A;  3ZMS A;  1STZ A;  3HRS A;  5D4S A;  3P7N A;  3HPH A;  2OPT A;  3OYH A;  2DAO A;  4J00 A;  2D2W A;  5BQT A;  3OSF A;  3ZPL A;  3F6O A;  4M9X A;  4MEX F;  3DFG A;  5GAD J;  2PJR A;  3I59 A;  1IF1 A;  1HDP A;  1QNT A;  5JI6 A;  1YW9 A;  4PJM A;  2X0L A;  1WJC A;  2CQX A;  3DTE A;  1GLN A;  4P96 A;  1IG7 A;  1FYL A;  3OYB A;  2QQ8 A;  2Z3Y A;  2XAH A;  2HI3 A;  4XLN F;  5J6X A;  1HF0 A;  3ZOB A;  1K4T A;  1KQ0 A;  1WRJ A;  2W4S A;  4NB5 A;  5DYM A;  2ZJ2 A;  4EMS A;  1AA7 A;  3WTW C;  1IV8 A;  4G7H F;  3PSF A;  2A07 F;  3TO6 A;  2MLG A;  2MBF A;  1O7F A;  3QPL A;  1V54 H;  4XOR A;  3ZRG A;  1B8I B;  2JSC A;  2EA4 A;  2V7F A;  2COM A;  3BQZ A;  3MEX A;  1ETK A;  3AFH A;  3ZQG A;  3SDB A;  1XD7 A;  2MC3 A;  1X2N A;  3CJT B;  1YOV B;  1RKW A;  2D1V A;  4Q4Z F;  4KIS A;  5EG0 A;  4PSX A;  5TRD A;  1WJD A;  2Q8K A;  2K4B A;  2HOA A;  4XKB A;  3AG4 H;  3GTG J;  2G7H A;  3R0A A;  2VAS A;  3L2Q A;  3R60 A;  3BTC A;  4PJJ A;  2XGC A;  1YHQ I;  3MCZ A;  3RYR A;  2CUE A;  5F1J A;  3KLN A;  1HW5 A;  1JKR C;  3CUQ A;  2VXZ A;  5DD8 A;  4WWC A;  4MHG A;  1HKT A;  1K61 A;  2OQG A;  1OCZ H;  2ACJ A;  2F4M B;  1EA3 A;  4A6E A;  5H6Q A;  1DU6 A;  5D6F A;  5ICE A;  3A2K A;  3DEU A;  1ZEL A;  2M8E A;  4J19 A;  2BXY A;  2DCE A;  2L7F P;  3NEU A;  4MQ9 F;  1XCV A;  3H35 A;  2HFH A;  3V8K A;  3FHZ A;  4B3A A;  3VOE A;  4HRI A;  1OCP A;  4HST A;  2LRD A;  2JZY A;  2EH3 A;  1D1C A;  4EV0 A;  4QLC U;  2L7M P;  2UUZ A;  3WHB A;  3W2V A;  3W6J B;  5H2F C;  4EJW A;  3CLO A;  3CCU I;  4FX0 A;  2ZFW A;  1VF9 A;  1XSD A;  3HHG A;  5DM7 F;  5CVV A;  1R71 A;  2YSR A;  3I4N J;  4XRM A;  5KAF C;  4M71 A;  1XCB A;  4G9Y A;  1TL8 A;  3QOD A;  2FJ1 A;  3KX2 A;  2RRE A;  1TC3 C;  1Y0N A;  2K9M A;  2VL8 A;  5HDK A;  2VOO A;  5M3M J;  3DPU A;  5FD5 A;  4BXX J;  2K3P A;  2BV6 A;  1ODD A;  5EF6 A;  2LD5 A;  3E6B A;  5K7H A;  1TQI A;  3PM1 A;  3R4K A;  2L01 A;  1RZ4 A;  1AKH B;  4HX4 A;  2X6Y A;  2WAQ N;  4CUG A;  2DDA A;  2A69 F;  2PQ8 A;  1BBY A;  4Z2Y A;  2E35 A;  3J7Z I;  1GV5 A;  5F0H A;  2RAE A;  1D1B A;  2Y75 A;  3HSF A;  4LGW A;  4XRS A;  3H5A A;  1OMI A;  5JHF A;  1YLF A;  2LKP A;  3AG1 H;  3P9I A;  4ENM A;  1FJL A;  1BJZ A;  4L0Z B;  3W2W A;  2MG4 A;  2CJJ A;  3DEW A;  2VQH A;  2FMY A;  4L9J A;  5DCF A;  2E19 A;  2XUB A;  1LPQ A;  2HU9 A;  5L3D A;  4HG2 A;  5M5Y J;  3KP2 A;  5E3L A;  4XLE A;  2CUF A;  1AWC A;  3HHH A;  3OYM A;  2XB5 A;  4YIF A;  3JSP A;  1HDD C;  2M3A A;  1WI3 A;  4BYY A;  4M73 A;  1I3A A;  2RNJ A;  2QEX I;  1REP C;  2X6O A;  3UNG C;  3S2D J;  3OIQ A;  4PJL A;  3BCB A;  2LG4 A;  5HLI A;  2K40 A;  4HBL A;  4CCJ A;  4DGW B;  2EIK H;  4LIU A;  3I4P A;  4DQ2 A;  1MBE A;  1TW3 A;  3JCU C;  2W7N A;  4A12 A;  2OTL I;  3VDX A;  4AM3 A;  1IRG A;  1W7P B;  4IF4 A;  3BQY A;  3OYA A;  3DKX A;  3RPU A;  1S9H A;  3BJO A;  1OR7 C;  2MD0 A;  3RZD J;  1VTN C;  3GFI A;  3EDP A;  4CDG A;  3OS0 A;  1V5G A;  2TDX A;  4PFP A;  4BGD A;  1N77 A;  1TLH B;  2G7U A;  2MSY A;  3HRT A;  3CES A;  2LBF A;  2XC7 A;  1SFE A;  1K79 A;  3CJQ B;  3Q9S A;  3PSI A;  3K1N A;  3RKW A;  5IYC J;  2V1U A;  3HOU J;  3F8N A;  4LFU A;  4LG0 A;  2YX4 A;  2IS4 A;  4CXF A;  4XBF A;  2VUM J;  4AVZ A;  3K6G A;  3K70 C;  3H3Z A;  4A2U A;  2M4G A;  1PP7 U;  4UVC A;  2ZCW A;  5CVR A;  3MZH A;  1LEA A;  2KFD A;  3WTV C;  1P9Q C;  3E5U A;  1Q1H A;  4I02 A;  3VYS B;  1O3Q A;  2V26 A;  3M3Y J;  3GBG A;  1ZAO A;  2X51 A;  3LSP A;  2IA0 A;  2QSH X;  3P9K A;  1R4N B;  1FMW A;  3WE2 A;  3EUH A;  2L9N A;  3MMY B;  2L7K A;  4CIC A;  2HKO A;  2Y30 A;  3OYF A;  1PVE A;  3MKY B;  1A31 A;  5EZG A;  2OCE A;  2MGQ A;  1YS7 A;  3HB9 A;  1V55 H;  4B47 A;  4B48 A;  4BQA A;  3BRO A;  1XGS A;  3ZQL A;  4U7D A;  2ZKZ A;  2R7T A;  1KQ8 A;  4MO7 A;  4ANJ A;  2CQ7 A;  2ME0 A;  2RV8 A;  3C7J A;  3S1Q J;  3OYE A;  1KU3 A;  3TQN A;  1OCO H;  4A3G J;  5KAI C;  1S5L C;  1X1B A;  4OWR B;  1ZK8 A;  5J47 A;  1HBX G;  3ZQF A;  2BW3 A;  3KP7 A;  4L9T A;  1ONV A;  1X3Z B;  1ZG3 A;  1FY7 A;  3M1C A;  4MLO A;  1UHM A;  4XOP A;  3HOX J;  3GTO J;  1WI9 A;  1JKP C;  3L2R A;  1MH4 A;  1SFU A;  2KIM A;  1D0X A;  2X9D A;  2L9S A;  4E70 A;  4RLF A;  1XG1 A;  4D0P A;  2PG4 A;  4GYI A;  1U2W A;  1X1P A;  3SFI A;  2LMD A;  4PSW A;  4E7H A;  2OA4 A;  2ZXW H;  3CME I;  3I59 B;  1P4W A;  3MKZ A;  3I0T A;  2JA7 J;  2R7D A;  1IN5 A;  3ECO A;  5E1Z B;  3JRG A;  2GIV A;  5E8G A;  2VE8 A;  3DLA A;  1SFK A;  3B02 A;  3HOT A;  3FMS A;  1U0J A;  2DA4 A;  4V2G A;  5HNH A;  5J4V A;  2ZME A;  3NWS A;  4Q48 A;  1FX7 A;  2EIN H;  2GA1 A;  2Z2S B;  3K70 D;  3LQR A;  4G94 A;  2P8T A;  4KN7 X;  2DFE A;  2KDZ A;  3ZMU A;  3GZN B;  1MW7 A;  2FF4 A;  2VN2 A;  5F0F A;  4HX8 A;  1ZLK A;  1VQN I;  1TZL A;  2JQ7 A;  2GQQ A;  2QYO A;  2F5E A;  4XNF A;  2O7O A;  2Z99 A;  4NUB A;  2QLZ A;  5D4R A;  1I6H J;  4HF0 A;  3TED A;  5JFR A;  4WXC A;  1ZH5 A;  2CWE A;  5E3N A;  3ZXS A;  4RGU A;  4ZTJ A;  4FE7 A;  3R6S A;  2AQE A;  2WV1 A;  2Y48 A;  4M74 A;  2NNY A;  1Z0X A;  5C4J J;  3FM5 A;  1D0Y A;  4A3K J;  5TGT A;  2CUJ A;  3VYT B;  4LLN A;  2E1N A;  4RMN A;  4DJA A;  2AHQ A;  3MWM A;  3OV8 A;  3HOY J;  3MKW B;  3FM3 A;  2DK8 A;  2EFN A;  4FTH A;  3T0Y A;  3CUQ B;  1DGR M;  4I2O A;  4YEJ A;  4QTR A;  4N0B A;  1B72 A;  3BR1 A;  1XN7 A;  2E2H J;  2IP2 A;  4ITV A;  3J81 K;  3VSK A;  1MMG A;  1Z67 A;  3PUB A;  4U0V A;  1Y1V J;  1RES A;  3CTA A;  3HJE A;  5CVI A;  2WC2 A;  3ZMD A;  4CCL A;  1OCT C;  5IT9 K;  5CQG A;  2DOE A;  2K02 A;  4AUX A;  5HOO A;  2B7E A;  5ERI A;  4WF2 A;  1MSF C;  4GDF A;  2VKV A;  4NC7 A;  1FTZ A;  4RAZ A;  5E79 C;  2F5V A;  1FPQ A;  3VB2 A;  5BOX A;  2WAD A;  3GTM J;  1WVR A;  4G6T B;  5IOY A;  4X6A J;  2BHZ A;  2DLL A;  1EH7 A;  2MFZ A;  3ULQ B;  3OYJ A;  4A0Z A;  2VB6 A;  5EJC A;  5J8C A;  5LLQ A;  2V6C A;  4NHJ A;  3B73 A;  1YS6 A;  5CPR B;  2Y2Z A;  2O61 A;  4EQQ A;  2M8G X;  2VKH A;  4BJT A;  3SJM A;  3Q5F A;  2HDD A;  2M0C A;  1U8R A;  2EV6 A;  5DEQ A;  2KIQ A;  4JX6 A;  5L3E A;  5BNG A;  5K7Z A;  2QSF X;  3J7A Y;  3JRE A;  3TW7 A;  3WTU C;  1R4M B;  1RNL A;  2P6S A;  4KJZ A;  4A3L J;  1QQI A;  1Z6R A;  3CJR B;  4EJT A;  5HOD A;  1V4R A;  3DWL E;  3GME A;  2GXA A;  3CCQ I;  3K7A J;  2BYV E;  3BTI A;  2XDV A;  3RKX A;  5BPD A;  2VBZ A;  5D8K B;  1G6N A;  4BBS J;  2L3D A;  3P5J A;  4YFK F;  2VQL A;  5ICF A;  2QBY A;  3HOW J;  2HOS A;  4XON A;  3BWG A;  4OIP F;  2MH2 A;  1BI0 A;  3DF8 A;  4GCV A;  4A3B J;  2RN7 A;  3M4O J;  1IZ1 A;  2K27 A;  1Z1D A;  2X4H A;  1T39 A;  4B4C A;  2F5D A;  3Q0W A;  4I98 B;  3HOZ J;  2BY0 A;  2ZXH A;  1BA5 A;  3HUG A;  5J40 A;  5DS9 A;  1XSX A;  1I6X A;  1Z3Y A;  4KN4 X;  2OD5 A;  3G1O A;  1BJA A;  4DYR A;  5DCM A;  3C3W A;  3D5S C;  4BJ6 C;  1DDN A;  4ABZ A;  1TW2 A;  1EH6 A;  1XPX A;  2VBX A;  5FKN A;  2HPI A;  4RM2 A;  4PGG A;  5D8L B;  2NOJ B;  3CP2 A;  4M3F A;  3D1N I;  1OYI A;  5C44 J;  5CVJ A;  2A6T A;  3RZO J;  2LBF B;  4CHU A;  2EJR A;  3ZN0 A;  3L00 A;  2HR3 A;  5K7F A;  1RC9 A;  4LG0 B;  2VLA A;  4XSX F;  1OCR H;  1FSH A;  2XRN A;  4ZYA A;  2CO5 A;  3E5Q A;  2E36 A;  4IOA F;  1W5C C;  3CDL A;  4OMZ A;  4U0Y A;  4N9I A;  1EF4 A;  1QA6 A;  3IUO A;  5FLM J;  2ZBK A;  4UUS A;  4U87 A;  3RKQ A;  1FOK A;  5CYV A;  2K9L A;  3OOP A;  2VC0 A;  4E7I A;  1NG7 A;  2CMP A;  2VT3 A;  3OYL A;  1L0O C;  4W97 A;  2HPM A;  3S3M A;  5F08 A;  1JT6 A;  4IHY A;  1KU2 A;  2E5Z A;  1QBJ A;  2W24 A;  3FIS A;  4HQE A;  4JK1 X;  1AOY A;  4L5E A;  2QKL B;  4JYK A;  4A3J J;  4CGZ A;  4C3J J;  1YYV A;  4Y15 A;  3I56 I;  4RBO A;  1SMY F;  1APL C;  1VQK I;  3QWL A;  4Q47 A;  5H6R A;  2BHY A;  4GXO A;  2WB1 N;  3M8J A;  2WTE A;  4CCO A;  3KET A;  4IQJ A;  5EYR A;  3HTS B;  2R7U A;  1D8J A;  2JTV A;  3OY9 A;  2IGM A;  2IGN A;  1IRF A;  3WTX C;  3CC2 I;  1JHF A;  2PFB A;  3U2R A;  1YIJ I;  3CC4 I;  1P7J A;  2JPB A;  2DI3 A;  2HYG D;  2GM4 A;  4OAZ A;  1J75 A;  3CD6 I;  2HOE A;  2E71 A;  3F8C A;  2E34 A;  3OMY A;  5ED4 A;  1C0W A;  3DU5 A;  5M3F J;  1DP7 P;  2JA8 J;  1MZB A;  1FYK A;  3BG6 A;  2DPU A;  4BQN A;  1LFB A;  1KU7 A;  3EET A;  2TCT A;  1U6G A;  4HNU A;  2BY1 A;  4N9H A;  1ZQ3 P;  1ZLJ A;  2KZG A;  2DMP A;  5EEH A;  2QVO A;  3KYL A;  3LA7 A;  4M9Z A;  4YFX F;  4BE2 A;  1NH3 A;  2CUZ A;  2OUM A;  1IW7 F;  4DZP A;  1FTT A;  5D5W B;  2UZK A;  2ZME B;  3ZMZ A;  5FKO A;  1OCC H;  2JRM A;  3WTZ A;  2FQ3 A;  3T8T A;  2QWW A;  3W2A A;  1HCR A;  1XX5 A;  4HV5 A;  3DPT A;  3ZQI A;  3CCR I;  4B09 A;  1RET A;  4M3B A;  2ZJQ F;  4HZF A;  3ZQ7 A;  3F9K A;  4A3D J;  3CF5 F;  2JSP A;  1J09 A;  3QRF F;  2EV0 A;  1K7A A;  1K6Y A;  1R5H A;  1QVU A;  5KVR A;  2PEX A;  4AC0 A;  4O6J A;  4B43 A;  3EQL F;  1BW5 A;  3R61 A;  4DNC A;  1WWX A;  2WAQ A;  1UG0 A;  4BHC A;  3Q0V A;  1SEU A;  3DLL F;  1T98 A;  3HRU A;  2KRC A;  5J4Y A;  3F22 A;  2DT6 A;  1JUS A;  4ZYH A;  4ON0 A;  5DUI A;  5JVT A;  1UZC A;  2VQG A;  3LMM A;  5E3O A;  1B72 B;  4D5F A;  4J01 A;  2HXI A;  3E7L A;  4CYC B;  3BP8 A;  2X1C A;  4JX4 A;  1MBJ A;  3FKJ A;  3FXL A;  4LK1 F;  3BLY A;  4R8H A;  1JUP A;  3VEP A;  1SD5 A;  1ZGJ A;  2L4M A;  2GAU A;  4B3X A;  1LVK A;  2PMZ N;  2JA6 J;  4JOM A;  3LSK A;  2NVY J;  1HST A;  3OYN A;  4UNO A;  1WZ2 A;  4UB8 C;  2XHK A;  4HPQ A;  4KIG A;  3RDI A;  1R1U A;  3A0B C;  3TW6 A;  4K2E A;  3K4J A;  3ABK H;  2K9Q A;  3K1M A;  2H6B A;  1W0T A;  2LYC A;  4OIN F;  2RDP A;  3Q9V A;  3FXJ A;  3F6V A;  1Y39 A;  4IL6 C;  5FFZ A;  2EPF A;  1E3O C;  4N4N B;  4MQV A;  2WAF A;  3AAF A;  2NVQ J;  1XC5 A;  1LFU P;  1XGO A;  5LEJ A;  1RIO H;  3Q3S A;  1MH3 A;  1B9N A;  3U9G A;  3NAU A;  5HS8 A;  1YJW I;  2ETH A;  2B63 J;  4LIV A;  1SFX A;  3VPR A;  1KA8 A;  3IKV A;  5A2Q K;  3K4L A;  1HW2 A;  3J80 K;  2RQP A;  4NC6 A;  3F21 A;  2GOM A;  3CF2 A;  3BR5 A;  5AIP A;  4P5O A;  4DYQ A;  2HEO A;  4FIS A;  4ESF A;  3H0D A;  3QYB A;  4RA2 A;  4MIM A;  3J81 Z;  4ZYG A;  3ZCO A;  3QU6 A;  4RAG A;  2DMU A;  2BXZ A;  5E3M A;  3ZGK A;  5IT9 Z;  4KMU X;  3CCJ I;  4H0E A;  2M87 A;  5DTD A;  3GTP J;  3HG9 A;  5GP9 A;  2G0E A;  2QBY B;  2VI6 A;  1FOX A;  5F04 A;  1AHD P;  3BPV A;  5EZH A;  4XKW A;  5E17 F;  5GPA A;  1E3P A;  2JRT A;  2EB7 A;  1WSU A;  5DV5 A;  2XAQ A;  3IP4 B;  3EUH C;  4BQQ A;  3D5L A;  3AG2 H;  1DU0 A;  3S1M J;  1P7I A;  3EPZ A;  3HUG B;  3IWZ A;  2O0Y A;  2LF7 A;  4RM3 A;  2UXN A;  2H94 A;  1G8X A;  5DCM B;  3ZMT A;  2LLK A;  1PUF A;  3L2U A;  3DTK A;  5L3F A;  1LE8 A;  4PUS A;  3GUD A;  4ENN A;  4IOC F;  3ERE D;  2HQ5 A;  1FP2 A;  5FB2 A;  1VQ4 I;  2FBK A;  1ZRD A;  2IT0 A;  2L54 A;  1YX5 A;  1Z3X A;  4AVP A;  1J9I A;  1Z9C A;  4PGH A;  1G4D A;  2O6G E;  3CCY A;  2R0Q C;  3G73 A;  1U9O A;  3DXJ F;  1MMD A;  3WTS C;  4IHT A;  2KLO A;  3BZ6 A;  1ZRF A;  3IH2 A;  3LA3 A;  1JTX A;  3A0H C;  2YR2 A;  2R93 J;  5FRO A;  4HEA 2;  3ZP5 A;  4UUS B;  2E1M B;  4ZC3 A;  1FWZ A;  2X1D A;  4C3H J;  2Z1D A;  3BZC A;  2ISZ A;  3IH4 A;  4IKF A;  4R79 A;  2M9H A;  3IV5 A;  2EWN A;  1AU7 A;  2XAJ A;  5D5X B;  2EA2 A;  5HDN A;  4UV8 A;  1NK2 P;  4EM0 B;  1IXR C;  4EGZ A;  2ZME C;  2GA2 A;  4KA4 A;  3S1N J;  2VJJ A;  1CF7 A;  1A5J A;  3CCL I;  3JRB A;  3QOP A;  3R0J A;  4NDL A;  5KHD A;  1IXC A;  2CS3 A;  5HS9 A;  2OCC H;  3ASO H;  3O8G A;  4CCM A;  5E1W A;  1UHW A;  4TV7 A;  2DJI A;  3V8L A;  3SZP A;  1HXD A;  5LEK A;  3H5N A;  2Z33 A;  1IGN A;  1XDU A;  1Q1V A;  4DZJ A;  1VQ8 I;  3TOB A;  2NXN B;  1U9N A;  2LK2 A;  4Y4R A;  5L3C A;  3A1Y A;  4EEF G;  2LP0 A;  2V9K A;  1R5G A;  4C30 A;  4A5N A;  2PLY A;  4O3M A;  2F6C A;  1XMA A;  2EZH A;  4IHS A;  2MC4 A;  4BUP A;  1HOM A;  3PIO F;  3E6C C;  3G6E I;  2L4A A;  2FBH A;  3LSJ A;  2R7X A;  2ELH A;  5E18 F;  2VPR A;  4IO9 F;  3HIF A;  2I5U A;  1TT0 A;  1TTY A;  2M0M A;  3A01 A;  3G1L A;  2LDU A;  2KDO A;  3C2B A;  5KCM A;  3ROU A;  2R5Y A;  3O2P E;  2OC6 A;  3JRD A;  2NS0 A;  1DQU A;  2PMH A;  4XL9 A;  2L9R A;  4EJO A;  2XRL A;  4A0X A;  5D5U B;  2X6W A;  1W1W E;  2WY8 Q;  2FXA A;  1BC7 C;  2BVL A;  1P2F A;  2K9N A;  2IA1 A;  2Y9Y A;  4L9N A;  3GO5 A;  2LKS A;  4P1W A;  4MTE A;  2XGE A;  1ZGW A;  3JRI A;  3FXM A;  2HKX A;  1J0R A;  5HS7 A;  3GTK J;  2EV5 A;  1MIJ A;  4NQW A;  3HPG A;  2D5V A;  2G9W A;  2ECC A;  4QWQ A;  4FX4 A;  3F8B A;  2DA5 A;  1OLT A;  5EGO A;  2P7C B;  2KIU A;  4HDV A;  4C2U A;  3ZQQ A;  1O7L A;  3V7C A;  3OYD A;  1RR7 A;  1VI0 A;  3U1D A;  2NVT J;  3KCC A;  1TQM A;  3PO3 J;  2VOP A;  3QQA A;  4A3E J;  1F1Z A;  4I99 C;  1G3Y A;  1VQ5 I;  3CMA I;  3H92 A;  3K2Z A;  1IDZ A;  4G6D A;  1S3J A;  2TRT A;  2NYX A;  2W85 A;  1ZRE A;  4OOI A;  3QPH A;  1BC8 C;  1F9N A;  1IXS B;  5J1R A;  4EGY A;  2ESN A;  1WH7 A;  3UR3 C;  3WGG A;  2M4K A;  2QSG X;  4I76 A;  1X1C A;  1RUO A;  3BTL A;  3JTG A;  4ESJ A;  1ZG1 A;  4BY1 J;  4P9F A;  4UVA A;  1I3Q J;  2DJN A;  3OIP A;  3TP0 A;  1B59 A;  2DYR H;  3TBI A;  3LSH A;  2EFP A;  1X58 A;  3OSG A;  2ZNZ A;  2KJB A;  5IP6 A;  3ZR8 X;  2WWY A;  4KFC A;  4YII A;  3RKY A;  3LFU A;  3WGH A;  3BR0 A;  4U0W A;  1ETY A;  4BDY A;  3J7A O;  1PDN C;  2JN6 A;  1FSE A;  1XTA A;  2OZ6 A;  2OZU A;  3H9G A;  2HXO A;  4EJV A;  1XGM A;  1EH8 A;  1E0E A;  4CCK A;  1BR4 A;  4BHB A;  4A3M J;  4BKX A;  3PNY A;  2Y69 H;  1D3Y A;  3KPH A;  3T1B A;  4A0Y A;  1FZP B;  1LDD A;  2QA4 I;  2PJR B;  4BNC A;  3TO7 A;  1X1A A;  3DKW A;  2HTJ A;  2NAZ A;  2EIJ H;  3OOU A;  3KP6 A;  5IYB J;  2EFQ A;  4HQM A;  3HGY A;  3IRR A;  4L5J A;  2Y9Z A;  1QRY A;  1A04 A;  2LNB A;  3E5X A;  2C6Y A;  5GAH J;  2IJL A;  4BEH A;  5DM6 F;  4FAS D;  2VT2 A;  1TNS A;  4X1E A;  4CSW A;  2VE9 A;  3OS1 A;  1JJ6 C;  1RRJ A;  3PIP F;  3SFZ A;  2DQL A;  4A93 J;  2CW0 F;  5KNL A;  3RQ4 A;  3L7W A;  4A3I J;  1IN8 A;  3UKG A;  2LVS A;  4O5V A;  2KL4 A;  4QPQ A;  1N75 A;  2R7O A;  4P9U A;  2KT0 A;  4A69 C;  1T6S A;  3MAJ A;  3F8F A;  5EG0 B;  1JGG A;  1TWC J;  2I8D A;  1EKE A;  5DUK A;  5HLT A;  3LSM A;  5JVG F;  1MMA A;  4C2T A;  1MKM A;  3KEO A;  1DP3 A;  2HTS A;  5FKK A;  4XSZ F;  3Q0U A;  1E17 A;  2K4J A;  3JR9 A;  4WX9 A;  1PUF B;  1IAW A;  4KIC A;  2FE3 A;  2LY2 A;  4M6Y A;  1LE8 B;  3NQO A;  2WB1 A;  3GFM A;  4XN0 A;  4FQG A;  3BY6 A;  1FNN A;  2BGC A;  4XN3 A;  1ULY A;  2R7F A;  3DCF A;  5J1U A;  4HW0 A;  1SFO J;  2FOW A;  3KZZ A;  4I0A A;  5A2Q Z;  1U5T A;  4HOB A;  3J80 Z;  1WH5 A;  3N05 A;  3ML6 A;  1BIB A;  3QYF A;  5CQE A;  1I39 A;  1KQ9 A;  2LR8 A;  3OWT A;  5K5R A;  1JJ8 C;  5IT3 A;  4KMF A;  2Q0O A;  2QQB A;  5E20 A;  1T95 A;  3A02 A;  2FQ4 A;  3RJP A;  2BOL A;  2IRF G;  1IN7 A;  3WU1 B;  1J7K A;  2NVX J;  3TOA A;  3S2W A;  1O3S A;  1UG2 A;  1UAA A;  3E0J B;  1GVJ A;  4IPA A;  4A5M A;  4JP0 A;  1L3L A;  5K5O A;  5GTI C;  1I27 A;  2ISY A;  2D45 A;  1T8I A;  1SVL A;  4B8X A;  3MQ0 A;  4B44 A;  1T0F C;  5ILS A;  1HKQ A;  2P4W A;  2E1C A;  1JI8 A;  4G8X A;  1U8B A;  4UVB A;  1BI3 A;  2HOT A;  1CF7 B;  4R1H A;  3I54 A;  2QKM B;  1PUE E;  4BXF A;  3K4B A;  2JWT A;  4AYB N;  3DP7 A;  5IP9 J;  1Z05 A;  1R1V A;  3BJ6 A;  2VKD A;  5CJ9 A;  2DT7 B;  3TDU C;  4ZZD A;  1BIA A;  3NWT A;  4GGG A;  4MFE A;  4ZZL A;  1YTY A;  1FOY A;  4KYW A;  4LG3 A;  2KP6 A;  1ACI A;  2X48 A;  5LRS A;  1BW6 A;  1TWH J;  3DPL C;  3VOD A;  4YIR X;  2AQF A;  3SDG A;  1XMX A;  1N25 A;  1TBX A;  2KIF A;  3M07 A;  2W1O A;  2DOD A;  1K6O A;  2AXL A;  2QEN A;  2PI0 A;  1P6R A;  1HC8 A;  4M9S A;  4FT8 A;  1WJF A;  3IAM 2;  2DOA A;  2LC2 A;  1H89 C;  1HA8 A;  1A6I A;  2EK5 A;  3QPS A;  4XLP F;  4ZH4 F;  1ENH A;  3A01 B;  2VKE A;  1ERD A;  2L02 A;  1YW8 A;  2W57 A;  2B0L A;  2MLK A;  3K9T A;  2JJ7 A;  4PJ0 C;  2R5Y B;  3BCA A;  4BBR J;  1S8N A;  3BR2 A;  3H5R A;  2BEO A;  1G3W A;  4Y17 A;  4F92 B;  3LWF A;  2EFW A;  2FML A;  1K78 A;  3S17 J;  1OYW A;  1X3U A;  1OQY A;  2VXD A;  2PMZ A;  2WA0 A;  3K69 A;  4KIF A;  2YS9 A;  1Z91 A;  2PMU A;  2IXS A;  3IRQ A;  2Z5U A;  2OQR A;  2EZL A;  1P92 A;  4PK4 A;  5FJ8 J;  1ETX A;  3JW4 A;  3HTU A;  2XF5 A;  2YU3 A;  1B6A A;  2ID3 A;  3AL0 B;  5B1B H;  4CZZ A;  5K5Q A;  3E1S A;  2P0W A;  1WFX A;  3HOS A;  4M3E A;  3V7S A;  3AG3 H;  1W7P D;  4NQW B;  1VQ9 I;  4RB2 C;  2XKP A;  1M1E B;  2EZI A;  2JUG A;  2M30 A;  5F6F A;  1YX3 A;  4KUM A;  3ZQC A;  2ZXJ A;  4BQO A;  4LMY A;  2FUG 2;  3CCM I;  1BOB A;  5GAE J;  3F0C A;  3LSG A;  5L3B A;  1WQ2 A;  2BZT A;  1MSE C;  1RUN A;  1G59 A;  3M7G A;  1XGN A;  3HL2 A;  2ZJP F;  3HOV J;  3G71 I;  1Y6I A;  4HX7 A;  2CW7 A;  2FBI A;  2R7Q A;  2XF6 A;  1ZHF A;  5J3L A;  4CCN A;  1LQ1 A;  3E97 A;  3FXK A;  3EYI A;  4LLL A;  2V4J C;  2CFO A;  1W4M A;  1W36 C;  2JK3 A;  1F4K A;  5H20 A;  1Z21 A;  3DQV C;  4XKV A;  2DO7 A;  1B9M A;  4WXD A;  3GZ5 A;  4QPO A;  2A5W A;  1J2X A;  3KEQ A;  3H1C A;  4QIW N;  2R7V A;  1GUU A;  4N4O B;  3H36 A;  2XRO A;  2M34 A;  1X4O A;  3CDI A;  1RPW A;  4DW6 A;  4RS8 A;  2VPL A;  5LRR A;  1FYM A;  2H6C A;  2BVM A;  2X1E A;  2OTJ I;  1LDJ A;  2BW3 B;  2LF8 A;  2N8G A;  2QUF A;  3V42 A;  4I6Z A;  2H1K A;  2DDB A;  3ESW B;  2KMU A;  2CGP A;  1WJ5 A;  1UB9 A;  1ZAR A;  2DPD A;  2O8K A;  3B6C A;  1G3T A;  3CUQ C;  4HF1 A;  1MJ9 A;  1PJR A;  3OYG A;  2FU4 A;  2XB0 X;  3ZQH A;  3M8E A;  2IGK A;  1UEL B;  3IC7 A;  4XLH A;  3S15 J;  4B1R A;  3F8M A;  4CYD A;  5IP7 J;  1X2M A;  4Y52 J;  3OS2 A;  3C2G A;  3JRF A;  2V9V A;  4KT5 C;  3N4M A;  1JTY A;  1R9T J;  3I71 A;  4E6K G;  3HDD A;  3F72 A;  3I3L A;  2CV2 A;  4BEH B;  2HQA A;  1TT5 B;  1BL0 A;  3ASN H;  2STT A;  2WV0 A;  2DBB A;  3GW2 A;  1OKR A;  2L0K A;  1B1B A;  1Z7U A;  1NK3 P;  2VBY A;  3L2V A;  3L9F A;  1IRZ A;  1NG6 A;  1H8A C;  2XSJ C;  1QPI A;  4ESB A;  1E2X A;  5E1X A;  4IRH A;  1FT9 A;  3QOE A;  4BH9 A;  5JR3 A;  2XAS A;  3FXU A;  2DFH A;  4UUT A;  4AIK A;  5HLH A;  4I01 A;  4LB6 B;  5ILU A;  4GO1 A;  1LUJ B;  1ZN2 A;  2VBW A;  4NC8 A;  4E7Z A;  3FBN B;  4OIO F;  4PCQ A;  4AD9 A;  4I0B A;  3CCV I;  4BE0 A;  1SAU A;  1WGX A;  2F4I A;  5CLS A;  2K3F A;  2PJP A;  2DMN A;  5HDG A;  5K1Y A;  3O6B B;  2LRE A;  3ZMV A;  4EVI A;  2GZW A;  2FA5 A;  2HGC A;  4LJZ F;  3KP4 A;  1J59 A;  3CQZ J;  2JT1 A;  3WGI A;  2IEK A;  2R7W A;  3DBH B;  1KYW A;  1T38 A;  3BG3 A;  2NVU B;  2RQQ A;  1HQC A;  5LGU A;  2IBD A;  4Y13 A;  2R4G A;  2DU9 A;  3SEQ A;  1ETO A;  4CZC A;  1UHS A;  4UB6 C;  4ZDP A;  4II3 A;  1U5T B;  1Y8R B;  4XK4 A;  2CFX A;  2ZXI A;  3FK6 A;  1GXQ A;  3MZY A;  4HAM A;  2KHM A;  1D1A A;  3ERM A;  2JA2 A;  3GTL J;  4H4K C;  5DD4 A;  5IYD J;  3I9V 2;  2DA2 A;  5F0C A;  4V2F A;  2DMT A;  1FMV A;  2IS1 A;  2A05 A;  3D0S A;  3MKL A;  3WOD F;  2WY7 Q;  1MJA A;  3KEY A;  3SHF A;  2DXI A;  1OIS A;  3HKZ N;  3HGG A;  1Y1W J;  1MGT A;  2GOX B;  2MH9 A;  3LAJ A;  3E6D A;  2UXX A;  1T56 A;  3FXO A;  1FEX A;  3H3V K;  2HVR A;  3CUO A;  3PNT A;  3H3U A;  5E8I A;  3LAP A;  4Y3O A;  4JQF A;  4XRF A;  2M7B A;  4I09 A;  3DTI A;  2W82 A;  3KP3 A;  4MFD A;  1SD7 A;  2EIM H;  2KKO A;  5HLG A;  1BR1 A;  3I5U A;  4L9V A;  3OYK A;  2DFF A;  2DA3 A;  1R1T A;  2W25 A;  3IH3 A;  3PJR A;  1Y8Q B;  3RQI A;  3TDZ C;  4HLY A;  1BN5 A;  3MFK A;  3AKZ A;  3S16 J;  2XAF A;  2VJ4 A;  2R5Z A;  2Y0S N;  2K86 A;  4M3D A;  4LLG F;  5J8F A;  4MTD A;  2FRH A;  3WHC A;  3CCE I;  2JA5 J;  5F27 A;  2P6T A;  3PNV A;  2HDC A;  3G4S I;  1TWG J;  2LSO A;  2ZB9 A;  2GXG A;  4L0Y B;  4DIQ A;  2D1H A;  4AID A;  1Z7L A;  5D5V B;  2ZJR F;  3GFL A;  4OU0 A;  2Y0M A;  5IY5 H;  2FNA A;  2DFI A;  3OL4 A;  2DOF A;  3RTR A;  4D7N A;  3FHN A;  2IVM A;  2RNG A;  3DBR B;  1O4X A;  1I1S A;  2J5O A;  5B5E C;  2V1N A;  2HVQ A;  3ABU A;  2MD5 A;  4D1Q A;  2IAI A;  4IVN A;  3GTQ J;  1K78 B;  3CO7 C;  2IW5 A;  4EM2 A;  3OL3 A;  1ORK A;  3BDD A;  3QAH A;  2GBY A;  2X6X A;  3I64 A;  5B3S H;  1SAX A;  4XLF A;  1YIT I;  2A6E F;  3DEE A;  3WG7 H;  1X3W B;  1S72 I;  1N78 A;  4X0G A;  2P81 A;  3BOQ A;  3H9Q A;  1A6Q A;  2OAZ A;  3WTT C;  2Z9O A;  3JRH A;  2EBI A;  3QP5 A;  5LBQ A;  1VQO I;  3O8H A;  1RKT A;  3MZ8 A;  4NBQ A;  5FRN A;  2RVC A;  4S0H B;  2AS5 F;  1YJN I;  1F36 A;  4V19 K;  5FGM A;  1TWA J;  2ZC2 A;  3I4M J;  5TJJ A;  1TQP A;  3RPU D;  3V7R A;  5HNF A;  2EQR A;  4XM3 A;  4IEJ A;  2EIL H;  3HYI A;  1X1D A;  2HNH A;  2LTP A;  1H88 C;  2GIZ A;  5L3G A;  2H8R A;  2K85 A;  1YIO A;  4DBR A;  1VFC A;  1FBS A;  1LJ9 A;  3JRA A;  2HDW A;  3TGN A;  5CKT A;  2RGV A;  3SYT A;  2J5P A;  4LD5 A;  3DBL B;  1S7O A;  3OYI A;  4XLC A;  3KE2 A;  3REO A;  1LKX A;  4E7L A;  4MGR A;  3GXO A;  2DA7 A;  3CO6 C;  4HV6 A;  2HS5 A;  2E7X A;  2JPC A;  2L2O A;  5KK1 A;  3CZ6 A;  3S3N A;  1IRX A;  1I1G A;  3SZT A;  3KIO A;  1ZKG A;  1FC3 A;  4Y7N J;  4E7K A;  1UJ8 A;  4CO8 A;  1GT0 C;  1VQ6 I;  3VWB A;  2A3S A;  3ECH A;  3WU2 C;  3L2C A;  5FLX Z;  1OYY A;  1CQT A;  5J1Y A;  2F48 A;  1LVA A;  4RDU A;  3QU3 A;  1TNT A;  5BS6 A;  2YPR A;  1ETV A;  5JLW A;  3GWZ A;  2WAE A;  4RAY A;  1UMQ A;  1JHH A;  3K4N A;  1QGP A;  4XKC A;  3GF2 A;  1YRN A;  2BBY A;  1XS9 A;  1I5Z A;  1ON1 A;  5AON A;  3S32 A;  1SC7 A;  1DUX C;  2A68 F;  2Z16 A;  2VIX A;  5LHG A;  2KPM A;  1ETW A;  3FIW A;  2KRH A;  1Y56 A;  3WE3 A;  1U3E M;  2DYS H;  3VFZ A;  4G6Q A;  4F93 B;  4EAT A;  2DQR A;  2M1B A;  3VYU B;  3QYE A;  5FKL A;  4BJ5 C;  3LNQ A;  5FO5 A;  2H8W A;  2QQ9 A;  4OIR F;  5LHH A;  4XQF A;  4DYC A;  4ZYD A;  4U7B A;  2FX0 A;  3KZY A;  4YEL A;  2ZNY A;  1ITY A;  3OR1 C;  1IV6 A;  1U5T C;  5ICC A;  4IQ4 A;  4HF2 A;  4RLQ A;  2O8X A;  3COA C;  2GWR A;  2VC1 A;  3RCO A;  1E3H A;  1R6R A;  1VND A;  1VQM I;  4AIJ A;  1S29 A;  1JUM A;  2Y31 A;  4L5I A;  4D5C A;  1V5E A;  3M8F A;  3W3C A;  3HEF A;  4XLA A;  5LGT A;  5F1R A;  1GDT A;  1TP4 A;  3PL8 A;  5FD6 A;  3CMM A;  1D8K A;  4AU7 A;  3OR2 C;  4OAY A;  3GX4 X;  1D5Y A;  1SMT A;  3LOC A;  2JVH A;  1DGW Y;  1OJL A;  2E2J J;  3K2A A;  4ZDL A;  1LB2 A;  2XKO A;  2K9S A;  1MND A;  4RGX A;  3X2Q H;  3IKT A;  5BPI A;  2VJI A;  4XIC A;  1O57 A;  2CV1 A;  1OFC X;  1K4S A;  2ADU A;  2XVC A;  5CVU A;  3V4G A;  2DK5 A;  3HRM A;  4AYB A;  5C3E J;  3C18 A;  2M5W A;  4ASN A;  3HM5 A;  3LQQ A;  4F7Z A;  3CCS I;  2MAB A;  3C1D A;  2DTZ A;  1B4A A;  4HYE A;  5TIS C;  1T33 A;  2CQQ A;  2NS7 A;  4BL0 B;  3SZG A;  1MNM C;  2V6E A;  5M5W J;  3TP3 A;  2EFO A;  2QM3 A;  1MBH A;  2M2E A;  1FOW A;  3TO9 A;  1DPR A;  4LIT A;  2OV7 A;  3JAM K;  3S8P A;  1MJB A;  1T08 B;  3PQJ A;  2CG4 A;  5FFX A;  4W1U A;  1TWF J;  3QPT A;  4LOC A;  4YFN F;  4ZTF A;  1G3S A;  2XF7 A;  4F91 B;  4IXA A;  2UWM A;  3KFW X;  3G1M A;  3BR3 A;  4PZJ A;  1JE8 A;  2MW8 A;  4F55 A;  1H9G A;  1ZYR F;  2CQN A;  1W5S A;  3L09 A;  4UXN A;  2P5K A;  2QGU A;  2XGD A;  5EEG A;  4F3Q A;  3C2H A;  1DPU A;  3ZN1 A;  4EM1 A;  3I58 A;  1R58 A;  2BY3 A;  2PBI A;  3IAS 2;  2LY1 A;  2DA1 A;  1VQL I;  2R7S A;  1W0U A;  9ANT A;  5FKM A;  4G7O F;  1KU9 A;  1POG A;  1Y0U A;  6PAX A;  3VSL A;  3LFK A;  2YUS A;  4HA8 A;  1WKM A;  2CYY A;  3GVA A;  1WPK A;  2CH0 A;  1U78 A;  1FLI A;  2XGX A;  4Y33 A;  2ID6 A;  2B9S A;  1XDS A;  1QHG A;  3OYC A;  3RSN A;  4M72 A;  1LEB A;  2Q1Z B;  1IO2 A;  2R92 J;  3RI4 A;  4A3F J;  2XAG A;  3CMY A;  1X19 A;  2R5Z B;  2WBM A;  2HQR A;  3S2H J;  3I53 A;  3E6M A;  1WJB A;  3T8R A;  2QQA A;  1ZRC A;  1W5T A;  4FHT A;  1SD4 A;  4ZDO A;  1QZZ A;  2E1M C;  4XOT A;  2K7L A;  5BMZ A;  5GTH C;  2M45 A;  4RGS A;  1WJE A;  2F2E A;  4M6V A;  1Z77 A;  4I7H A;  4OIQ F;  2HQN A;  1R00 A;  3IL2 A;  1NHA A;  2KQR A;  5ICG A;  1ZR2 A;  3FMR A;  4FET A;  1MDM A;  4FCY A;  3U1K A;  3JRC A;  1WJA A;  4M6X A;  5FRM A;  3W6K B;  4C3I J;  2H09 A;  4FE4 A;  3V8J A;  2V1D A;  1YJ9 I;  3LSI A;  2BE5 F;  5GPC A;  2YX7 A;  2GXB A;  2FOK A;  2ZSH B;  2QCO A;  3JSO A;  3M1E A;  4IX7 A;  4IJA A;  3PFY A;  1RI7 A;  3BG9 A;  4U88 A;  2UV1 A;  3GLL A;  1LFP A;  1IN4 A;  3M9A A;  2ECB A;  3SEZ A;  3KLO A;  4IZZ A;  1PP8 F;  3S1R J;  1ZGA A;  4GFB A;  3FMQ A;  4BHP A;  2Q2E A;  5F64 A;  1IDY A;  4G7Z F;  3H0G J;  3W6V A;  3KP5 A;  4RB3 C;  4KNY A;  3FK7 A;  5FLV A;  3RYP A;  1QPM A;  4P55 A;  4BE1 A;  3PQK A;  3F3X A;  2E7W A;  4M3G A;  1RR8 C;  4IHV A;  2JUC A;  4ZJZ A;  4UY8 I;  2R7R A;  4Z6Y A;  1ZR4 A;  3FX3 A;  4II2 A;  5JLX A;  3HBL A;  2O03 A;  4CYC A;  3ABL H;  2OJE D;  3CLQ A;  3LST A;  4DOZ A;  2O9L A;  2P5L C;  3K4C A;  2HZT A;  1NTC A;  4ENK A;  3BT9 A;  4KIT B;  1KGS A;  2X85 A;  4S05 A;  3FZV A;  2E60 A;  1OR7 A;  1YFH A;  3SQN A;  1IUY A;  4PJN A;  4LK0 F;  3S3O A;  2H27 A;  1D5V A;  2AXT C;  1QZE A;  2ELK A;  4HNV A;  1CGP A;  3K1P A;  4MNU A;  1KON A;  1BM9 A;  1BR2 A;  2O3F A;  3I55 I;  1EV7 A;  2KJC A;  4AIH A;  1JGS A;  2FNP A;  4E4H A;  3BR6 A;  1ETQ A;  1IC8 A;  2CSO A;  3FWE A;  3ABM H;  3BJA A;  2BY2 A;  1MMN A;  2R7Z J;  1YRN B;  5GAG J;  4ENJ A;  3S93 A;  4KT6 A;  2DN0 A;  1JKO C;  2VON A;  3MVP A;  5IOZ A;  4XR6 A;  3DU6 A;  1BOA A;  3NRV A;  5M5X J;  3CC7 I;  4IHX A;  4IHW A;  2XAU A;  4QSH A;  5LGN A;  1A36 A;  3L2W A;  2DT5 A;  1MBG A;  2ICW G;  5D6E A;  2V9P A;  1GVD A;  3FXR A;  1PYV A;  2V79 A;  2FEZ A;  2VQC A;  4NNJ A;  3TMO A;  2LKX A;  2OF7 A;  4BAC A;  3O3K A;  5FLX K;  2QZ8 A;  4A3C J;  3HC7 A;  4YRV A;  1KYZ A;  3DKY A;  2XPW A;  4S04 A;  2A61 A;  1B8I A;  5HVQ C;  2XV4 S;  3ELK A;  4A6D A;  2K5C A;  3OIO A;  4WK8 F;  2W48 A;  1X4P A;  3E3V A;  1S7E A;  1ZTR A;  2E5N A;  1BI1 A;  4C9Y A;  1O3T A;  2RKH A;  3HKZ A;  4E7J A;  1FBU A;  2HYF A;  5LHI A;  1ON2 A;  4BU2 A;  1A35 A;  3DV8 A;  2PX9 A;  1UST A;  5IPA A;  2F5F A;  5EGO B;  2OBP A;  1QU3 A;  1FIA A;  2NOG A;  3BPX A;  3FF5 A;  2DA6 A;  4CA0 A;  1EJ9 A;  2STW A;  2AO9 A;  1WCM J;  2FSW A;  4G12 A;  4GYG A;  1S6L A;  3RPQ A;  2PN6 A;  3ABT A;  3BG5 A;  1F5T A;  1MMS A;  2LY9 A;  2KZV A;  3VYR B;  3J7Y J;  1FIP A;  4XRS G;  1LNW A;  1H0M A;  2IS2 A;  4PFO A;  3N97 A;  2ESH A;  3SXY A;  2L5Q A;  2IPQ X;  2DW4 A;  2XIG A;  3HZJ A;  4RGR A;  1GHC A;  2Y0S A;  1WHU A;  1SAN A; 
#chains in the Genus database with same CATH homology
 3K0L A;  1YW7 A;  2R3S A;  1ZG5 A;  3QP6 A;  4UHT A;  1USS A;  3PFI A;  3HSR A;  1FP1 D;  1QO0 D;  1UCR A;  5ILV A;  4WCG A;  3WTY C;  3GLX A;  3T5X A;  1YO5 C;  1R36 A;  4UV9 A;  5DDG A;  3EYY A;  2F5C A;  2MA3 A;  3G3Z A;  1R22 A;  3WG9 A;  1J5Y A;  4JBA A;  2P7V B;  5AIQ A;  1Z6T A;  3TKY A;  2NNN A;  1XMK A;  4OMY A;  1R7J A;  1V3F A;  1HKS A;  2RC4 A;  4HLX A;  1XB4 A;  4RB1 A;  4KIB A;  4KDP A;  3GFJ A;  1P4X A;  4MEY F;  3JAM Z;  4IRI A;  4BXU A;  4Q5S F;  1QZY A;  1W7P A;  1P4A A;  1MDM B;  3IHU A;  3WU0 A;  1T0F A;  1LDK B;  1FBQ A;  2A6H F;  5JHU A;  3P9C A;  3IWF A;  1UFM A;  1O3R A;  1YG2 A;  4L18 B;  2A5Y B;  3GYH X;  3CDH A;  2CQK A;  1T2K A;  4RB0 A;  1HSJ A;  1MD0 A;  4AWX B;  3FXQ A;  2ZO4 A;  4BAY A;  2HWV A;  3ISP A;  2IA2 A;  4PDK A;  4WXH A;  1HW1 A;  1GXP A;  4YG2 F;  3JTH A;  4LB5 A;  3CJN A;  1S7A A;  3F23 A;  4EJU A;  2OU2 A;  3LA2 A;  3HSE A;  1YQA A;  1H9T A;  1BI2 A;  2VOD A;  2NRA C;  1IN6 A;  1R23 A;  4UUV A;  2KRF A;  3GZ6 A;  1SD6 A;  4ETS A;  3RIR A;  2P5V A;  1JXS A;  4IRG A;  3GEZ A;  1XSV A;  4ZYE A;  2W84 A;  2V1X A;  1OPC A;  4HDU A;  2DTR A;  3ZMS A;  1STZ A;  3HRS A;  5D4S A;  3P7N A;  2DAO A;  2D2W A;  5BQT A;  3ZPL A;  3F6O A;  4M9X A;  4MEX F;  3DFG A;  3I59 A;  1IF1 A;  1QNT A;  5JI6 A;  1YW9 A;  2X0L A;  4P96 A;  1FYL A;  2Z3Y A;  2XAH A;  4XLN F;  5J6X A;  1KQ0 A;  1WRJ A;  4NB5 A;  5DYM A;  2ZJ2 A;  4EMS A;  3WTW C;  4G7H F;  2A07 F;  3TO6 A;  2MLG A;  2MBF A;  1O7F A;  2JSC A;  2EA4 A;  2COM A;  3MEX A;  1XD7 A;  2MC3 A;  2D1V A;  4Q4Z F;  5TRD A;  2Q8K A;  2K4B A;  2G7H A;  3R0A A;  3R60 A;  3MCZ A;  3RYR A;  3KLN A;  1HW5 A;  3CUQ A;  2VXZ A;  5DD8 A;  4WWC A;  4MHG A;  1HKT A;  2OQG A;  2ACJ A;  4A6E A;  5H6Q A;  5D6F A;  5ICE A;  3DEU A;  2M8E A;  3NEU A;  4MQ9 F;  1XCV A;  3V8K A;  2HFH A;  3FHZ A;  3VOE A;  2JZY A;  4EV0 A;  4QLC U;  3W6J B;  4EJW A;  3CLO A;  4FX0 A;  2ZFW A;  1XSD A;  3HHG A;  5CVV A;  2YSR A;  4M71 A;  1XCB A;  4G9Y A;  5HDK A;  2VOO A;  5FD5 A;  2BV6 A;  1ODD A;  3E6B A;  1TQI A;  3R4K A;  2L01 A;  1RZ4 A;  4HX4 A;  2PQ8 A;  2A69 F;  1BBY A;  4Z2Y A;  3HSF A;  2Y75 A;  4LGW A;  1OMI A;  1YLF A;  2LKP A;  3P9I A;  4ENM A;  4L0Z B;  2FMY A;  4L9J A;  5DCF A;  2XUB A;  5L3D A;  3KP2 A;  1AWC A;  3HHH A;  4YIF A;  3JSP A;  4BYY A;  4M73 A;  2RNJ A;  1REP C;  5HLI A;  4HBL A;  3I4P A;  4DQ2 A;  1TW3 A;  4A12 A;  1IRG A;  1W7P B;  4IF4 A;  3RPU A;  3BJO A;  1VTN C;  3GFI A;  3EDP A;  4CDG A;  2TDX A;  1TLH B;  2G7U A;  3HRT A;  1SFE A;  1K79 A;  3Q9S A;  3K1N A;  3RKW A;  2V1U A;  3F8N A;  4LFU A;  4LG0 A;  2YX4 A;  4CXF A;  4XBF A;  3H3Z A;  4A2U A;  1PP7 U;  4UVC A;  2ZCW A;  5CVR A;  3MZH A;  1LEA A;  3WTV C;  3E5U A;  1Q1H A;  4I02 A;  1O3Q A;  1ZAO A;  2IA0 A;  3P9K A;  3WE2 A;  3EUH A;  4CIC A;  2HKO A;  1YS7 A;  4BQA A;  3BRO A;  1XGS A;  4U7D A;  2ZKZ A;  1KQ8 A;  2RV8 A;  3C7J A;  1KU3 A;  3TQN A;  1HBX G;  3KP7 A;  4L9T A;  1ZG3 A;  1ONV A;  1FY7 A;  1UHM A;  1WI9 A;  1SFU A;  2KIM A;  4E70 A;  4D0P A;  2PG4 A;  4GYI A;  1U2W A;  2OA4 A;  3I59 B;  1P4W A;  3I0T A;  2R7D A;  1IN5 A;  3ECO A;  5E1Z B;  2GIV A;  5E8G A;  2VE8 A;  3B02 A;  3HOT A;  3FMS A;  2ZME A;  4Q48 A;  1FX7 A;  2GA1 A;  3LQR A;  4G94 A;  2P8T A;  4KN7 X;  3ZMU A;  2FF4 A;  2VN2 A;  4HX8 A;  1ZLK A;  2GQQ A;  2QYO A;  2F5E A;  2Z99 A;  2QLZ A;  5D4R A;  4HF0 A;  5JFR A;  4WXC A;  1ZH5 A;  2CWE A;  4RGU A;  3R6S A;  4M74 A;  2Y48 A;  2NNY A;  3FM5 A;  4LLN A;  2E1N A;  3MWM A;  3OV8 A;  3FM3 A;  2DK8 A;  2EFN A;  3T0Y A;  3CUQ B;  4I2O A;  4N0B A;  1XN7 A;  2IP2 A;  3J81 K;  4U0V A;  5CVI A;  3CTA A;  2WC2 A;  3ZMD A;  5IT9 K;  2K02 A;  5HOO A;  5ERI A;  4WF2 A;  4RAZ A;  1FPQ A;  3VB2 A;  5BOX A;  2DLL A;  1EH7 A;  3ULQ B;  5LLQ A;  5J8C A;  2V6C A;  4NHJ A;  3B73 A;  1YS6 A;  2O61 A;  4EQQ A;  3Q5F A;  1U8R A;  2EV6 A;  5DEQ A;  5L3E A;  3WTU C;  1RNL A;  2P6S A;  1QQI A;  1Z6R A;  4EJT A;  1V4R A;  2BYV E;  3RKX A;  5BPD A;  2VBZ A;  5D8K B;  1G6N A;  2L3D A;  4YFK F;  5ICF A;  2QBY A;  3BWG A;  4OIP F;  2MH2 A;  1BI0 A;  3DF8 A;  4GCV A;  2RN7 A;  1IZ1 A;  2K27 A;  1Z1D A;  2X4H A;  1T39 A;  2F5D A;  4I98 B;  3HUG A;  1XSX A;  1I6X A;  4KN4 X;  2OD5 A;  1BJA A;  5DCM A;  3C3W A;  1DDN A;  1TW2 A;  1EH6 A;  2VBX A;  4PGG A;  5D8L B;  1OYI A;  5CVJ A;  4CHU A;  2EJR A;  3ZN0 A;  3L00 A;  2HR3 A;  4LG0 B;  4XSX F;  1FSH A;  2XRN A;  2CO5 A;  3E5Q A;  4OMZ A;  4U0Y A;  4N9I A;  2ZBK A;  1FOK A;  5CYV A;  3OOP A;  2VC0 A;  2VT3 A;  1L0O C;  1KU2 A;  1QBJ A;  2W24 A;  4HQE A;  4JK1 X;  1AOY A;  4CGZ A;  1YYV A;  4Y15 A;  1SMY F;  4Q47 A;  5H6R A;  4GXO A;  3KET A;  2WTE A;  3HTS B;  1D8J A;  2JTV A;  1IRF A;  3WTX C;  1JHF A;  2PFB A;  3U2R A;  2JPB A;  2DI3 A;  2HYG D;  1J75 A;  2HOE A;  3F8C A;  5ED4 A;  1C0W A;  1DP7 P;  1MZB A;  1FYK A;  2DPU A;  1KU7 A;  3EET A;  1U6G A;  4N9H A;  1ZLJ A;  5EEH A;  2QVO A;  3LA7 A;  4M9Z A;  4YFX F;  1IW7 F;  5D5W B;  2UZK A;  2ZME B;  3ZMZ A;  3WTZ A;  2FQ3 A;  3T8T A;  2QWW A;  4HV5 A;  3DPT A;  4B09 A;  4HZF A;  3ZQ7 A;  3QRF F;  2EV0 A;  1K7A A;  1R5H A;  5KVR A;  2PEX A;  4O6J A;  3EQL F;  3R61 A;  4DNC A;  1WWX A;  4BHC A;  1T98 A;  3HRU A;  3F22 A;  4ZYH A;  4ON0 A;  5DUI A;  5JVT A;  3BP8 A;  4LK1 F;  4R8H A;  3VEP A;  1SD5 A;  1ZGJ A;  2L4M A;  2GAU A;  1HST A;  4UNO A;  2XHK A;  4KIG A;  3RDI A;  1R1U A;  4K2E A;  3K1M A;  2H6B A;  4OIN F;  2RDP A;  3Q9V A;  3F6V A;  5FFZ A;  4MQV A;  3AAF A;  1XGO A;  5LEJ A;  1RIO H;  5HS8 A;  3U9G A;  1B9N A;  2ETH A;  1SFX A;  1KA8 A;  3IKV A;  5A2Q K;  1HW2 A;  3J80 K;  2RQP A;  3F21 A;  5AIP A;  4P5O A;  2HEO A;  4ESF A;  3J81 Z;  4ZYG A;  3QU6 A;  5IT9 Z;  4KMU X;  4H0E A;  2M87 A;  2QBY B;  3BPV A;  5E17 F;  2JRT A;  2EB7 A;  1WSU A;  5DV5 A;  2XAQ A;  3D5L A;  3IWZ A;  2O0Y A;  2LF7 A;  2UXN A;  2H94 A;  5DCM B;  3ZMT A;  5L3F A;  3GUD A;  4ENN A;  3ERE D;  1FP2 A;  5FB2 A;  2FBK A;  1ZRD A;  2IT0 A;  2L54 A;  4AVP A;  1J9I A;  1Z9C A;  4PGH A;  1G4D A;  2O6G E;  3G73 A;  3DXJ F;  3WTS C;  4IHT A;  3BZ6 A;  1ZRF A;  3LA3 A;  2YR2 A;  3ZP5 A;  1FWZ A;  2ISZ A;  4R79 A;  2EWN A;  2XAJ A;  5D5X B;  2EA2 A;  5HDN A;  4UV8 A;  4EM0 B;  1IXR C;  4EGZ A;  2GA2 A;  4KA4 A;  1CF7 A;  3QOP A;  3R0J A;  1IXC A;  5HS9 A;  5E1W A;  1UHW A;  4TV7 A;  3V8L A;  3SZP A;  1HXD A;  5LEK A;  2Z33 A;  1XDU A;  3TOB A;  5L3C A;  1R5G A;  4A5N A;  2PLY A;  4O3M A;  1XMA A;  4IHS A;  3E6C C;  2L4A A;  2FBH A;  2ELH A;  5E18 F;  3HIF A;  1TTY A;  2LDU A;  3ROU A;  3O2P E;  2NS0 A;  2PMH A;  4EJO A;  4A0X A;  5D5U B;  2FXA A;  1BC7 C;  2VE9 A;  1P2F A;  4L9N A;  2IA1 A;  3GO5 A;  4MTE A;  2HKX A;  1J0R A;  5HS7 A;  2EV5 A;  4NQW A;  2G9W A;  4QWQ A;  4FX4 A;  3F8B A;  2P7C B;  2KIU A;  4HDV A;  1O7L A;  3V7C A;  3U1D A;  3KCC A;  1TQM A;  2VOP A;  1F1Z A;  1G3Y A;  3H92 A;  3K2Z A;  4G6D A;  1S3J A;  2NYX A;  2W85 A;  1ZRE A;  4OOI A;  3QPH A;  1BC8 C;  1F9N A;  1IXS B;  4EGY A;  2ESN A;  3WGG A;  1RUO A;  3JTG A;  4ESJ A;  1ZG1 A;  4P9F A;  4UVA A;  1B59 A;  2EFP A;  2ZNZ A;  2KJB A;  2WWY A;  4KFC A;  4YII A;  3RKY A;  3WGH A;  4U0W A;  3J7A O;  1PDN C;  1FSE A;  2OZ6 A;  2OZU A;  4EJV A;  1XGM A;  1EH8 A;  4BHB A;  1D3Y A;  3T1B A;  4A0Y A;  1FZP B;  1LDD A;  4BNC A;  3TO7 A;  3DKW A;  2HTJ A;  2NAZ A;  3KP6 A;  2EFQ A;  4HQM A;  3IRR A;  4L5J A;  3E5X A;  1A04 A;  2LNB A;  2C6Y A;  2IJL A;  2VT2 A;  1TNS A;  3SFZ A;  2DQL A;  2CW0 F;  3L7W A;  1IN8 A;  4O5V A;  4P9U A;  1T6S A;  3MAJ A;  3F8F A;  5DUK A;  1MKM A;  3KEO A;  2HTS A;  4XSZ F;  1E17 A;  2K4J A;  4WX9 A;  1IAW A;  4KIC A;  2FE3 A;  4M6Y A;  3NQO A;  3GFM A;  3BY6 A;  1FNN A;  2BGC A;  1ULY A;  2R7F A;  4HW0 A;  3KZZ A;  5A2Q Z;  4I0A A;  1U5T A;  4HOB A;  3J80 Z;  3ML6 A;  1BIB A;  1KQ9 A;  5K5R A;  5IT3 A;  4KMF A;  2Q0O A;  2QQB A;  5E20 A;  3RJP A;  2IRF G;  1IN7 A;  3WU1 B;  1J7K A;  3TOA A;  3S2W A;  1O3S A;  1GVJ A;  4IPA A;  4A5M A;  1L3L A;  5K5O A;  1I27 A;  2ISY A;  2D45 A;  4B8X A;  3MQ0 A;  5ILS A;  1HKQ A;  2P4W A;  2E1C A;  4G8X A;  4UVB A;  1BI3 A;  1CF7 B;  4R1H A;  3I54 A;  1PUE E;  3DP7 A;  1Z05 A;  1R1V A;  3BJ6 A;  5CJ9 A;  3TDU C;  4ZZD A;  1BIA A;  4GGG A;  4ZZL A;  1YTY A;  4KYW A;  5LRS A;  3DPL C;  3VOD A;  2KIF A;  1TBX A;  1K6O A;  2AXL A;  2QEN A;  2PI0 A;  1P6R A;  4M9S A;  4FT8 A;  2EK5 A;  4XLP F;  4ZH4 F;  2L02 A;  1YW8 A;  2W57 A;  2B0L A;  2MLK A;  3K9T A;  1S8N A;  2BEO A;  1G3W A;  4Y17 A;  2EFW A;  3LWF A;  2FML A;  1K78 A;  1OYW A;  1X3U A;  3K69 A;  4KIF A;  1Z91 A;  2PMU A;  3IRQ A;  2Z5U A;  2OQR A;  1P92 A;  3JW4 A;  3HTU A;  2YU3 A;  1B6A A;  4CZZ A;  5K5Q A;  3HOS A;  3V7S A;  1W7P D;  4RB2 C;  2XKP A;  2M30 A;  5F6F A;  4KUM A;  2ZXJ A;  4LMY A;  5L3B A;  1WQ2 A;  1RUN A;  3M7G A;  1XGN A;  4HX7 A;  2FBI A;  1ZHF A;  1LQ1 A;  3E97 A;  3EYI A;  4LLL A;  1W4M A;  1F4K A;  5H20 A;  3DQV C;  2DO7 A;  1B9M A;  4WXD A;  3GZ5 A;  1J2X A;  3KEQ A;  2XRO A;  4RS8 A;  5LRR A;  1FYM A;  2H6C A;  1LDJ A;  2LF8 A;  2QUF A;  2CGP A;  1UB9 A;  1ZAR A;  2DPD A;  1G3T A;  3CUQ C;  4HF1 A;  1MJ9 A;  2FU4 A;  3M8E A;  3IC7 A;  3F8M A;  4CYD A;  2V9V A;  4KT5 C;  3N4M A;  3I71 A;  3F72 A;  2STT A;  2WV0 A;  2DBB A;  3GW2 A;  1OKR A;  1B1B A;  1Z7U A;  2VBY A;  3L9F A;  4ESB A;  1E2X A;  5E1X A;  4IRH A;  1FT9 A;  4BH9 A;  5JR3 A;  2XAS A;  3FXU A;  4AIK A;  5HLH A;  4I01 A;  4LB6 B;  5ILU A;  4GO1 A;  1ZN2 A;  2VBW A;  4OIO F;  4PCQ A;  4AD9 A;  4I0B A;  5CLS A;  2PJP A;  5HDG A;  5K1Y A;  3O6B B;  3ZMV A;  4EVI A;  2GZW A;  2FA5 A;  2HGC A;  4LJZ F;  3KP4 A;  1J59 A;  2JT1 A;  3WGI A;  1T38 A;  1KYW A;  1HQC A;  5LGU A;  4Y13 A;  2DU9 A;  1U5T B;  2CFX A;  1GXQ A;  3MZY A;  4HAM A;  5DD4 A;  3D0S A;  3WOD F;  1MJA A;  3SHF A;  1MGT A;  2MH9 A;  3LAJ A;  3E6D A;  2UXX A;  3CUO A;  3LAP A;  3H3U A;  5E8I A;  4JQF A;  4XRF A;  4I09 A;  3KP3 A;  1SD7 A;  5HLG A;  2KKO A;  3I5U A;  4L9V A;  1R1T A;  2W25 A;  4HLY A;  3TDZ C;  1BN5 A;  3MFK A;  2XAF A;  2K86 A;  4LLG F;  5J8F A;  4MTD A;  2FRH A;  2P6T A;  2HDC A;  2LSO A;  2GXG A;  4L0Y B;  2D1H A;  5D5V B;  3GFL A;  4OU0 A;  2Y0M A;  2FNA A;  2DFI A;  3RTR A;  2IVM A;  1I1S A;  2J5O A;  3ABU A;  2MD5 A;  4IVN A;  1K78 B;  3CO7 C;  2IW5 A;  4EM2 A;  3QAH A;  3BDD A;  1SAX A;  3I64 A;  2A6E F;  3BOQ A;  2Z9O A;  2OAZ A;  3WTT C;  3QP5 A;  5LBQ A;  2RVC A;  2AS5 F;  5FGM A;  5TJJ A;  1TQP A;  3V7R A;  3HYI A;  5L3G A;  1YIO A;  1FBS A;  1LJ9 A;  3TGN A;  2RGV A;  2J5P A;  4LD5 A;  1S7O A;  3KE2 A;  3REO A;  4MGR A;  3GXO A;  3CO6 C;  4HV6 A;  2HS5 A;  2E7X A;  2JPC A;  5KK1 A;  1I1G A;  3SZT A;  1FC3 A;  4CO8 A;  2A3S A;  3ECH A;  3L2C A;  5FLX Z;  1OYY A;  1LVA A;  3QU3 A;  1TNT A;  5BS6 A;  2YPR A;  3GWZ A;  4RAY A;  1JHH A;  1QGP A;  3GF2 A;  2BBY A;  1I5Z A;  1ON1 A;  5AON A;  1DUX C;  2A68 F;  5LHG A;  1U3E M;  3WE3 A;  3VFZ A;  4G6Q A;  2DQR A;  2M1B A;  5FO5 A;  2QQ9 A;  4OIR F;  5LHH A;  4ZYD A;  4U7B A;  3KZY A;  2ZNY A;  1U5T C;  5ICC A;  4HF2 A;  2O8X A;  3COA C;  2GWR A;  2VC1 A;  4AIJ A;  1S29 A;  4L5I A;  3M8F A;  5LGT A;  5F1R A;  5FD6 A;  1D8K A;  3GX4 X;  1SMT A;  1LB2 A;  2XKO A;  4RGX A;  3IKT A;  5BPI A;  1O57 A;  2ADU A;  2XVC A;  5CVU A;  3V4G A;  2DK5 A;  3HRM A;  3C18 A;  2M5W A;  4ASN A;  3LQQ A;  4F7Z A;  3C1D A;  1B4A A;  4HYE A;  2EFO A;  2QM3 A;  3TO9 A;  1DPR A;  3JAM K;  1MJB A;  3PQJ A;  2CG4 A;  5FFX A;  3QPT A;  4YFN F;  1G3S A;  4IXA A;  2UWM A;  3KFW X;  4PZJ A;  1JE8 A;  1H9G A;  1ZYR F;  1W5S A;  3L09 A;  4UXN A;  2P5K A;  5EEG A;  1DPU A;  3ZN1 A;  4EM1 A;  3I58 A;  1R58 A;  2PBI A;  4G7O F;  1KU9 A;  1Y0U A;  6PAX A;  3LFK A;  4HA8 A;  1WKM A;  2CYY A;  3GVA A;  1U78 A;  1FLI A;  2XGX A;  1XDS A;  4M72 A;  1LEB A;  3RI4 A;  2XAG A;  2HQR A;  3I53 A;  3E6M A;  3T8R A;  2QQA A;  1ZRC A;  1W5T A;  4FHT A;  1SD4 A;  1QZZ A;  2K7L A;  5BMZ A;  2M45 A;  4RGS A;  2F2E A;  4I7H A;  4OIQ F;  2HQN A;  1R00 A;  3IL2 A;  1NHA A;  5ICG A;  3FMR A;  1MDM A;  4M6X A;  3W6K B;  2H09 A;  3V8J A;  2V1D A;  2BE5 F;  2YX7 A;  2GXB A;  2FOK A;  3JSO A;  3M1E A;  4IJA A;  1RI7 A;  4U88 A;  1IN4 A;  3M9A A;  3KLO A;  1PP8 F;  1ZGA A;  3FMQ A;  4BHP A;  2Q2E A;  5F64 A;  4G7Z F;  3KP5 A;  4RB3 C;  4KNY A;  3RYP A;  1QPM A;  4P55 A;  3PQK A;  3F3X A;  2E7W A;  3FX3 A;  2O03 A;  3LST A;  2P5L C;  2HZT A;  4ENK A;  1KGS A;  4S05 A;  3FZV A;  1OR7 A;  1YFH A;  3SQN A;  1IUY A;  4LK0 F;  2H27 A;  1D5V A;  1CGP A;  3K1P A;  4MNU A;  1BM9 A;  2O3F A;  1EV7 A;  2KJC A;  4AIH A;  1JGS A;  2FNP A;  2CSO A;  3FWE A;  3BJA A;  4ENJ A;  2VON A;  1BOA A;  3NRV A;  5LGN A;  2DT5 A;  5D6E A;  3FXR A;  2V79 A;  2FEZ A;  3O3K A;  5FLX K;  2QZ8 A;  1KYZ A;  4S04 A;  2A61 A;  5HVQ C;  2XV4 S;  3ELK A;  4A6D A;  4WK8 F;  3E3V A;  1BI1 A;  1O3T A;  2RKH A;  1FBU A;  2HYF A;  5LHI A;  1ON2 A;  3DV8 A;  1UST A;  2F5F A;  2OBP A;  3BPX A;  3FF5 A;  2STW A;  2FSW A;  4GYG A;  3RPQ A;  1S6L A;  2PN6 A;  3ABT A;  1F5T A;  1H0M A;  1LNW A;  3N97 A;  2ESH A;  3SXY A;  2IPQ X;  2DW4 A;  2XIG A;  4RGR A;  1GHC A;  4A0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...