1Z7UA

Crystal structure of the putitive transcriptional regulator of marr family from enterococcus faecalis v583
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
111
structure length
111
Chain Sequence
SNAMTTDKQTSINLALSTINGKWKLSLMDELFQGTKRNGELMRALDGITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHWGETFAQKKARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein EF0647
publication title Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 31
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z7uA00
4DQ2A 4FX0A 1T0FA 3L2CA 1F5TA 1YYVA 3F8FA 4HYEA 3GO5A 1WKMA 3TOAA 5LGTA 1JXSA 2YSRA 4GCVA 3H92A 1SFXA 1XMAA 2FEZA 1R1UA 2VOPA 2QBYA 4EM0B 1YS7A 1G3TA 2QQ9A 2GA2A 1S3JA 2ZBKA 1T39A 1DUXC 1T2KA 3QP5A 2DLLA 1BI1A 1I5ZA 2OZ6A 3ZMDA 5ILUA 2H6CA 1CF7B 2FF4A 3ZN1A 2WWYA 1KGSA 1QZZA 1FLIA 1QGPA 2CQKA 1SMYF 3G3ZA 2ISYA 3V8KA 2PI0A 3J7AO 3L00A 2ZMEA 1YW7A 4IVNA 3BROA 1FYMA 1HKTA 3J81Z 3G73A 2VT3A 3WTXC 2CWEA 3C1DA 5DCMB 1MKMA 1BBYA 3Q9VA 5TRDA 1U3EM 1P2FA 3EUHA 6PAXA 1IF1A 3TOBA 3E5XA 5HLGA 3LAPA 1BJAA 3V7RA 4OOIA 2ZNZA 3T5XA 1FBQA 3R0AA 2L54A 1ZGJA 4CDGA 1HKQA 5FB2A 4M9ZA 4HOBA 3ROUA 2Y48A 4UXNA 4IRGA 1OR7A 3B73A 4XRFA 3R0JA 1P4AA 3F22A 5ICCA 4A12A 1UHMA 4WK8F 1X3UA 4UHTA 4RAZA 1TNTA 2IP2A 2H09A 2DK8A 3GXOA 1FC3A 3ABTA 5LHGA 2XAHA 4U0WA 2EJRA 3TGNA 4EGZA 5LBQA 4WCGA 3U1DA 4ETSA 4D0PA 2VXZA 1FBUA 1IXCA 1XDUA 3GW2A 4UVAA 3WTZA 5J6XA 3JSPA 1O3RA 4BH9A 4HV5A 3RKYA 1G3SA 1W5TA 2GAUA 2KRFA 4P55A 1G4DA 3EQLF 1IN7A 4R79A 1IRFA 5KK1A 3AAFA 1S8NA 2FMYA 2F5CA 4UVBA 5IT9Z 1I27A 3ABUA 3I71A 3DEUA 1TTYA 1ZG1A 2QM3A 1KU7A 4UNOA 4ZZLA 2VONA 2CSOA 1P4WA 1BM9A 3KP7A 3LQRA 3IKTA 5L3GA 4KIFA 4HAMA 2A3SA 4O5VA 1KYWA 4HQEA 3R60A 1J5YA 1GHCA 3K69A 4FT8A 1FP1D 2XKPA 4KICA 4AIJA 2WC2A 3L09A 1B9MA 3T0YA 2FBHA 2IRFG 4ASNA 1YO5C 1D3YA 2P5KA 1ZLKA 2EK5A 4MTDA 5HS8A 5L3CA 5H6RA 1ON2A 1YQAA 4EJTA 1T38A 2FNAA 2LDUA 1P92A 2RGVA 3IWZA 3N4MA 4UV8A 3E97A 3RI4A 4G7ZF 3KETA 3I59B 3J81K 2RC4A 2DQRA 1F4KA 1K6OA 3KZYA 3JW4A 3TDUC 4DNCA 1QZYA 2TDXA 3HRUA 2ESHA 3HSEA 1BI2A 4KFCA 4LMYA 2BEOA 2NNNA 2V9VA 3IHUA 3GFMA 4ENKA 3HTUA 2K7LA 1OYIA 1O3SA 3U2RA 4A5NA 3GZ5A 3QPHA 5LGUA 4M72A 4HX4A 3GFLA 3TDZC 2Y0MA 4BHBA 3CUQA 5LRSA 3VB2A 3WU1B 3MQ0A 5ED4A 3SFZA 2VE8A 3FM5A 5DYMA 5K5RA 1ZYRF 1TNSA 5DDGA 5J8FA 1STZA 5DD4A 2FU4A 5E1XA 4S05A 2RVCA 2DW4A 2HYFA 3QOPA 1LDKB 5D5UB 2ISZA 3MEXA 2DK5A 1U2WA 1FNNA 5BPDA 2F5DA 1W7PA 2LF8A 3HSRA 5HOOA 3P7NA 2R7DA 4R1HA 2NS0A 2FSWA 1KQ0A 5HLIA 4MGRA 3SHFA 3GFIA 3NRVA 5FFXA 4WXCA 2VC1A 1FSEA 4A6DA 3JTGA 4HX7A 4I01A 4ZH4F 4NHJA 4MEXF 4KUMA 4LK1F 3DKWA 4IJAA 1QPMA 1YLFA 2DAOA 1IW7F 3E5UA 2H27A 3TO7A 3RTRA 3P9CA 5DUKA 1LVAA 5A2QK 2OQGA 1J75A 1O3QA 1R22A 1BIAA 3I5UA 2A61A 4HV6A 1ZN2A 4A0ZA 1S6LA 4G9YA 1O3TA 1ONVA 2AS5F 1SD6A 2P5VA 1LB2A 2GA1A 2FBKA 4OIPF 4EMSA 2M8EA 3BWGA 3ERED 2LSOA 2DT5A 3KZZA 5E18F 3BY6A 1MJBA 2PEXA 3HHGA 1G6NA 5HDKA 3T1BA 2O0YA 1FSHA 1Z9CA 2BYVE 4XSXF 2X4HA 3W6JB 3HUGA 4HF0A 1BIBA 4N9IA 5D5VB 2HTSA 3RKXA 4E70A 2FBIA 5ERIA 4KIGA 3V8LA 3HSFA 2ZO4A 1EH6A 5K1YA 1MZBA 3FWEA 2PMHA 2EB7A 4WX9A 1AWCA 4GYIA 4N0BA 1B4AA 1J2XA 5F1RA 2K4JA 2PBIA 3TO6A 1KQ8A 2ZJ2A 4A6EA 4MTEA 2K86A 2BE5F 1YW8A 1ZREA 3OOPA 3H3ZA 4YFNF 2PMUA 1FY7A 2EFOA 2EFPA 1XGSA 1K79A 1FX7A 5BMZA 4HLYA 5D4SA 1ZH5A 3T8TA 4WXDA 2VBYA 3BJAA 1K78B 2Z3YA 1EH7A 3DFGA 2EWNA 4LD5A 3HTSB 1HQCA 2D1VA 3NQOA 2KKOA 5BOXA 3BOQA 4CYDA 1U5TA 3F8BA 3O3KA 3CO6C 1OMIA 2OD5A 1R5HA 3FZVA 1YFHA 2L4AA 4RAYA 5LLQA 2DTRA 1WI9A 4GGGA 1YTYA 4BYYA 1R7JA 2FNPA 2ZCWA 1UFMA 1ZG3A 3MWMA 5JFRA 4P9FA 3CDHA 5FLXK 2DU9A 1YIOA 2G9WA 4A0XA 3TQNA 2A68F 1XB4A 3F6OA 1IN5A 4BAYA 4RGSA 2VOOA 1RUNA 4P9UA 2EA2A 2VODA 1MDMA 2CW0F 2A69F 1SAXA 1P4XA 4YFXF 4GYGA 2M87A 4HA8A 3JTHA 1L3LA 2UXNA 1DP7P 1RI7A 3EDPA 3FXUA 3LA2A 4CXFA 3JAMK 1BI0A 1IXRC 5LHHA 3CLOA 3C18A 1K7AA 1IN4A 3LA7A 1XD7A 2IJLA 5E1WA 3KE2A 1OKRA 2P7CB 1U6GA 2DPDA 4O6JA 3DXJF 2NRAC 5AIQA 3GEZA 3DV8A 1LEBA 2O3FA 2HGCA 1DPRA 5D8KB 4IRHA 1W5SA 4L0ZB 4Q5SF 3I53A 3ZQ7A 3RPUA 4ESJA 4EV0A 2VE9A 1XDSA 4RS8A 3NEUA 5CVJA 2E1CA 3CUQC 3M7GA 5BS6A 1J59A 2UXXA 1QO0D 1D8KA 4LB6B 3M8EA 3RJPA 4N9HA 1HSJA 4AIHA 2EFNA 4LG0A 2FMLA 2GIVA 2F2EA 3IRRA 3U9GA 2VBWA 5E8GA 3WG9A 2XGXA 4PGGA 4LLGF 4FX4A 2HKXA 2ETHA 3LSTA 2YPRA 4ESFA 5D4RA 3ULQB 4BHCA 4WXHA 4AVPA 3QRFF 5ICEA 4U88A 3GZ6A 4LJZF 2GQQA 1XMKA 3WTYC 4A0YA 4HLXA 1S29A 1WQ2A 1HBXG 2YX4A 1ZHFA 5AIPA 1IN6A 4IRIA 2OZUA 1L0OC 2LNBA 3B02A 1FPQA 5CVRA 3F6VA 1OYYA 2D2WA 5HS7A 4NQWA 3RKWA 4CO8A 1H9TA 3GX4X 1XCBA 5LEKA 3F23A 4YIFA 5FGMA 3HOTA 1ZLJA 2NYXA 4OU0A 4EJWA 5DUIA 3WODF 3VFZA 2FQ3A 5A2QZ 2VBXA 3GF2A 2ACJA 5DCFA 5L3EA 2HFHA 3DF8A 2E7WA 1MJAA 3O6BB 1UCRA 3P9IA 3OV8A 1HW5A 1CF7A 4L9NA 3M9AA 4HX8A 4YG2F 2QZ8A 2KIFA 5CVVA 1LQ1A 1OPCA 1IRGA 1GVJA 1ZAOA 3FHZA 4P96A 4M74A 3CO7C 3E6DA 1ZARA 1CGPA 4MEYF 2IPQX 1XSDA 5CVIA 3ECOA 1VTNC 5DCMA 2EV6A 1Z05A 2ESNA 1FZPB 3CJNA 2J5PA 2FOKA 5EEGA 1DDNA 4UVCA 4EJVA 1RIOH 1HSTA 2JZYA 2P5LC 2IW5A 1TW2A 3RYPA 2EV0A 3IKVA 4L5JA 3WU0A 5JR3A 1TQPA 4L0YB 1HXDA 3ECHA 1B6AA 4PCQA 4BXUA 3FMRA 2KIMA 4PZJA 3WTTC 2V1UA 2BGCA 2Q0OA 3R6SA 4L9JA 1J0RA 3QP6A 1IN8A 2CFXA 2G7HA 2W57A 5ICFA 1RZ4A 4OINF 2CG4A 2V1DA 2M5WA 2Z99A 1R23A 3HRMA 4M6XA 4YFKF 2M30A 3V7CA 1DPUA 4L9VA 2FXAA 2X0LA 3R4KA 2Z5UA 4ON0A 4G7HF 4MHGA 3GVAA 1RUOA 2IA1A 3LA3A 2EA4A 4I0AA 4KT5C 1ZRCA 3LAJA 2HWVA 4CICA 3E5QA 1QBJA 3RDIA 3L9FA 2VT2A 2F5EA 2QUFA 1H0MA 1JHFA 4EJUA 5ICGA 4R8HA 4B8XA 3ZMZA 5JVTA 4QLCU 5KVRA 1SD4A 1OYWA 2NAZA 2KIUA 3V7SA 5FFZA 4OIRF 2HKOA 2QVOA 4Y13A 2R3SA 4HDUA 3ZPLA 1D5VA 4GO1A 2OAZA 4LLNA 3QU3A 3FM3A 1Z6RA 1KQ9A 5FLXZ 2P6SA 4IHTA 2B0LA 4Y17A 3K1NA 2A07F 3QPTA 2GXGA 4LK0F 1IUYA 2QBYB 3MAJA 5LHIA 2A6EF 1B59A 4M9SA 1J9IA 1JHHA 5CJ9A 1TLHB 5HLHA 4CZZA 3VODA 3P9KA 5TJJA 3S2WA 3KP2A 2NNYA 1LDDA 5DEQA 5D6FA 4AD9A 3M8FA 3JAMZ 3LQQA 3K2ZA 2UWMA 2M45A 1E2XA 1FBSA 4M9XA 1PP8F 1ZGAA 2G7UA 2CGPA 2E7XA 4XSZF 2HS5A 2ZFWA 2O03A 3EYYA 2ZMEB 4RGUA 3QAHA 2BBYA 4I98B 2OBPA 2Q8KA 3I59A 2L01A 5H20A 3K1PA 4HBLA 3GYHX 1WRJA 1B9NA 1SFUA 2A6HF 3ZN0A 3RPQA 5E8IA 1WSUA 1R00A 4IF4A 2QQBA 2WV0A 2XAQA 2E1NA 4Y15A 3I0TA 2EFQA 4RGXA 1YW9A 2PN6A 2XAGA 2P7VB 2H6BA 3HYIA 3RYRA 1FOKA 4Z2YA 3MZHA 2Q2EA 4ZYHA 2HOEA 1GXPA 2V79A 4Q47A 1XSVA 2PJPA 4XLPF 1KA8A 2EV5A 2HQRA 3L7WA 3WE2A 5CYVA 3ZMUA 2JT1A 5D8LB 2L02A 4U7DA 1MJ9A 1HW2A 1F9NA 4U0VA 4HW0A 4P5OA 3D5LA 4EGYA 1KU2A 3WE3A 3PQKA 2XROA 1EH8A 2KJBA 2ZKZA 2W85A 2A5YB 1TQMA 4CHUA 2DFIA 2D1HA 3IL2A 2YR2A 1BI3A 2IT0A 4AWXB 4BHPA 3WGIA 3FMSA 2Z33A 1FT9A 3RIRA 5L3BA 2W25A 4F7ZA 5HVQC 2M1BA 4AIKA 4LB5A 2QLZA 2J5OA 2AXLA 1SD5A 4G6DA 1FYLA 4ZYEA 4KMUX 1U8RA 3K0LA 1G3WA 2QWWA 2UZKA 2JSCA 1I1SA 2Y75A 3F8MA 2P6TA 2MBFA 4IHSA 2RNJA 2HR3A 5E17F 3FX3A 2DQLA 5HDGA 2VBZA 4ESBA 4RB3C 2HYGD 3WGGA 4I7HA 4UUVA 3F72A 5K5QA 3BP8A 5ILVA 1T6SA 3BZ6A 4OMYA 4MQVA 2COMA 3DPLC 4O3MA 1PUEE 3GUDA 1FYKA 5LEJA 4S04A 1IZ1A 4M73A 1Y0UA 3SXYA 3KP3A 2V6CA 2DPUA 3WGHA 4MNUA 3WTUC 5E1ZB 4PGHA 1R1TA 1BN5A 3F8NA 1I1GA 2LF7A 3Q9SA 4FHTA 5FO5A 5E20A 1LNWA 3T8RA 4IPAA 1PP7U 2STWA 2XVCA 1IXSB 1XGOA 4TV7A 4NB5A 1O7LA 2YX7A 1Q1HA 2W24A 1AOYA 3LFKA 4A5MA 3KEQA 5D5WB 2JPCA 2IA2A 4KMFA 4ENNA 4LGWA 2ZXJA 1TW3A 2HZTA 1SD7A 4IXAA 4CGZA 1LJ9A 3CUOA 2CO5A 5AONA 5HS9A 3KEOA 3HHHA 2RKHA 2RDPA 5FD5A 4YIIA 2XRNA 4ZYGA 4A2UA 4EJOA 1HKSA 3VEPA 3WTVC 2DO7A 3J80K 1XGNA 2HTJA 3REOA 3K1MA 3CUQB 1B1BA 3HOSA 3GWZA 2VN2A 3TKYA 3Q5FA 3N97A 3IWFA 1XSXA 2PG4A 2YU3A 1BC7C 4OIQF 4EQQA 3BJOA 5JI6A 5ILSA 4OMZA 4MQ9F 4Q48A 3E6CC 2EFWA 1K78A 3KFWX 4M71A 4EVIA 3EETA 3KCCA 2GXBA 1NHAA 3BJ6A 4B09A 1MD0A 3EYIA 3E3VA 1Z7UA 4XLNF 3ZMTA 2QYOA 5CVUA 1SMTA 1W7PB 2P8TA 3V4GA 1T98A 3QU6A 3IC7A 1W7PD 2FE3A 2K27A 4L18B 1H9GA 4K2EA 3FF5A 3F21A 1ON1A 3DP7A 2ELHA 5BQTA 1R36A 3JSOA 1O57A 1XCVA 4G94A 1ULYA 3WTSC 2OU2A 3C7JA 3W6KB 2XKOA 3HRSA 4U7BA 1O7FA 1IAWA 2JRTA 2RQPA 3F8CA 5CLSA 5LRRA 1WWXA 5DV5A 3HIFA 4KNYA 1LDJA 4KA4A 1V4RA 5H6QA 2JPBA 2HDCA 5EEHA 5LGNA 3IRQA 3E6MA 1S7OA 5L3FA 1A04A 2RN7A 3TO9A 4RB2C 3KP6A 1Z91A 5D6EA 4XBFA 3SQNA 3E6BA 1FWZA 2DI3A 2L3DA 1BC8C 2PFBA 2QENA 1YG2A 2IVMA 5JHUA 2BV6A 5DD8A 4L9TA 3H3UA 3BDDA 2STTA 4HZFA 3MZYA 2XUBA 2O61A 3KLNA 4LFUA 4I2OA 1Z1DA 3SZPA 4ZYDA 1QQIA 5HDNA 3KP5A 2O8XA 5L3DA 1GXQA 3FXRA 1PDNC 4KDPA 1XN7A 2P4WA 1ZRDA 1ODDA 2ADUA 2GZWA 4UV9A 3COAC 1LEAA 2MH2A 2O6GE 1BOAA 3HRTA 2MD5A 1V3FA 2XHKA 2XIGA 1USSA 4I0BA 2IA0A 2CYYA 1Z6TA 1ZG5A 1U5TC 3ELKA 2PLYA 2Z9OA 2KJCA 4BQAA 3KP4A 3I54A 1U5TB 4HDVA 2LKPA 1QNTA 4PDKA 4QWQA 5FD6A 1S7AA 3V8JA 5F64A 2GWRA 2L4MA 4G6QA 1R58A 3I64A 4I09A 2MLKA 4RB1A 1KU3A 4RGRA 1C0WA 4Q4ZF 2MH9A 1JE8A 3F3XA 5IT9K 1P6RA 2FA5A 3KLOA 3ML6A 2XV4S 1UB9A 4H0EA 4ENJA 1REPC 1E17A 3ZMSA 4WF2A 3I58A 5BPIA 3DQVC 2JTVA 1KU9A 4HF2A 4G7OF 4KN4X 2OA4A 4EM2A 4WWCA 2DBBA 1TQIA 2XASA 1R5GA 1EV7A 5IT3A 1MDMB 3D0SA 1G3YA 1D8JA 3VOEA 3M1EA 2XAJA 3LWFA 2ZNYA 5F6FA 2PQ8A 2HEOA 4GXOA 1SFEA 4RB0A 2R7FA 4G8XA 5J8CA 4EM1A 1JGSA 1U78A 5D5XB 3FMQA 1XGMA 4JQFA 1YS6A 4OIOF 3R61A 2HQNA 4JK1X 2C6YA 2MA3A 2F5FA 3K9TA 3BPXA 3ZP5A 3PFIA 1J7KA 1ZRFA 2H94A 3I4PA 3BPVA 3ZMVA 2RV8A 3ISPA 1HW1A 3J80Z 3C3WA 1TBXA 4KIBA 4KYWA 2D45A 2W84A 4HF1A 1R1VA 2K4BA 4ZZDA 3O2PE 3WTWC 3PQJA 4U0YA 3GLXA 4LLLA 4BNCA 3GFJA 2XAFA 4ENMA 2MLGA 1KYZA 4M6YA 1I6XA 2VC0A 3SZTA 3DPTA 5K5OA 1UHWA 1USTA 4LG0B 4I02A 2K02A 3FXQA 2WTEA 1F1ZA 4KN7X 2QQAA 3MCZA 1RNLA 1MGTA 4L5IA 4JBAA 3CTAA 3MFKA 1W4MA 2V1XA 4HQMA 2MC3A 2OQRA 1FP2A 2FRHA
chains in the Genus database with same CATH superfamily
2Y0SA 4DQ2A 4FX0A 1T0FA 1XC5A 5IY5H 2V4JC 3L2CA 4PSWA 1F5TA 2KFDA 1N77A 1YYVA 2L7ZA 3F8FA 2HQAA 4HYEA 3GO5A 4M3FA 1WKMA 2BVLA 2TCTA 4A3IJ 1FOWA 3TOAA 5LGTA 1AU7A 4A3GJ 2YSRA 1JXSA 2XGEA 3HKZN 4GCVA 1PVEA 3H92A 2BY3A 4NQWB 3BR1A 3GTMJ 1SFXA 3ABMH 1XMAA 3HZJA 4FETA 1JKQC 2KP6A 1ACIA 1AA7A 3F0CA 3CCEI 5FRNA 4XIDA 1R4NB 4XKWA 2FEZA 4C3HJ 2KDOA 4DOZA 1R1UA 5J4VA 2AQFA 2BHYA 2ID6A 2QBYA 2VOPA 4EM0B 1YS7A 1G3TA 2QQ9A 1POGA 3JRBA 1NK3P 2GA2A 1S3JA 4B4CA 4BL0B 5GADJ 3LFUA 4PJ0C 2ZBKA 3LNQA 3EUKL 3QYBA 1T39A 1DUXC 1SC7A 2ZSHB 1D0ZA 1T2KA 3QP5A 3JRIA 2DLLA 1PYVA 1D0YA 1BI1A 1I5ZA 2DJNA 2OZ6A 2R93J 1UZCA 2FJ1A 3ZMDA 1MIJA 1Z21A 2MGQA 4XLHA 5ILUA 2H6CA 3HOVJ 2KZVA 3BC8A 1W0TA 1CF7B 2FF4A 2M0CA 3ZN1A 2WWYA 1KGSA 2ZXWH 1QZZA 1FLIA 2E1MC 1QGPA 2DOEA 2CQKA 1JJ8C 1SMYF 2H1LA 2EH3A 1QVUA 3G3ZA 2ISYA 3DBLB 3M1CA 3S93A 1I6HJ 3P5JA 2QEXI 3V8KA 2XF6A 3W3CA 2PI0A 4XONA 3J7AO 3L00A 2ZMEA 3HOZJ 4HG2A 1YW7A 2KRHA 5J1UA 4IVNA 1IJWC 2WB1A 3BROA 1FYMA 2Y9YA 1HKTA 3J81Z 3W2WA 4UUSB 3G73A 2VT3A 3WTXC 4E6KG 3ABKH 1TWFJ 2I10A 2CWEA 1OCRH 3C1DA 1H88C 4G12A 3DU5A 4FISA 3E7LA 2M3AA 5DCMB 1MKMA 2JA5J 2NVTJ 2JVHA 1BBYA 3X2QH 3Q9VA 4A3LJ 5TRDA 3CCUI 1U3EM 1P2FA 3EUHA 3E1SA 6PAXA 1IF1A 2R92J 2VJIA 3TOBA 2IS4A 3ZQCA 3JR9A 1QHGA 3E5XA 5HLGA 3LAPA 1BJAA 3V7RA 2XF5A 1OCOH 4OOIA 2HDWA 2ZNZA 2JVGA 3HC7A 2LBFA 3T5XA 1HLVA 3OIOA 3NWSA 1TWGJ 1FBQA 1HDPA 1G8XA 3A0HC 4XMYA 5H2FC 3R0AA 2E2HJ 3ZCOA 2L54A 1ZGJA 4CDGA 3SZGA 1HKQA 2XF7A 4HRIA 5FB2A 1X58A 2R7OA 4ZC3A 4M9ZA 4NC8A 4B44A 2DMUA 4HOBA 3ROUA 3OYNA 3L2WA 2HI3A 2Y48A 4UXNA 4IRGA 1X1CA 1OR7A 3B73A 4XRFA 3R0JA 1P4AA 1T08B 3F22A 5ICCA 4XN0A 4A12A 4XICA 1UHMA 3HKZA 4WK8F 1X3UA 3BTCA 4UHTA 1TT0A 1BOBA 1ZK8A 4RAZA 1TNTA 2IP2A 2H09A 4A93J 2DK8A 2LREA 3PUFA 2HVQA 3GXOA 1FC3A 3ABTA 3F9KA 2DTZA 5LHGA 2XAHA 4U0WA 2EJRA 2LOOA 3TGNA 4EGZA 2I8DA 1B8IA 5LBQA 2W1OA 2P81A 2LY1A 4WCGA 3U1DA 2B9SA 1UG2A 4ETSA 4F52A 4D0PA 2VXZA 4PJJA 1FBUA 3VWBA 3Q0UA 2NVXJ 1IXCA 1XDUA 1W1WE 4RA2A 1IUFA 3BG9A 3GW2A 2EZLA 4UVAA 4F3QA 3DTEA 3CF5F 3LL7A 3WTZA 5J6XA 3A02A 3JSPA 1YRNB 3FK7A 1O3RA 2DMQA 3WHCA 2K9MA 4BH9A 1HA8A 4HV5A 4II3A 3RKYA 1G3SA 2HQ5A 3OSGA 1W5TA 3CESA 4PFPA 2GAUA 2KRFA 4P55A 1G4DA 2ZB9A 1JUMA 3G2BA 3EQLF 3KZIC 1IN7A 3I56I 4NC7A 2K85A 1GT0C 4D1QA 2OJED 2CV0A 1SANA 1TT5B 4R79A 1MBHA 1IRFA 5KK1A 2JA8J 3DKXA 3AAFA 1S8NA 4XLAA 2FMYA 2VJJA 2G0EA 5CQEA 2F5CA 4F93B 5M5YJ 4UVBA 5IT9Z 4CCJA 1I27A 2MD0A 3ABUA 3I71A 3OYFA 3UR3C 1QZEA 5FLVA 3DEUA 1TTYA 3JRGA 1ZG1A 2QM3A 1KU7A 3JRFA 3IAM2 4UNOA 4QSHA 4ZZLA 3K4NA 2VONA 4E7JA 3FDYA 3IH3A 4XQFA 2CSOA 1P4WA 1BM9A 3FXOA 4LITA 3KP7A 3LQRA 3IKTA 1W0UA 5L3GA 1TP4A 1X1DA 4KIFA 2R5YB 4HAMA 2A3SA 4O5VA 5FKLA 5J40A 2IS2A 1KYWA 1SFKA 5B66C 4HQEA 3R60A 3C2GA 4JOMA 1J5YA 1GHCA 3K69A 3KYCB 4BE0A 1X1BA 2OPTA 5FKOA 2LG4A 4C2TA 4FT8A 1FP1D 2XKPA 1U9NA 1VQMI 2GOXB 1WVRA 4KICA 2HOAA 4AIJA 3PIOF 3OY9A 2WC2A 1JUPA 1YOVB 1B9MA 1ZTRA 3L09A 1SEUA 4GRIA 4JX6A 3T0YA 2FBHA 2IRFG 4ASNA 3I4MJ 1OISA 1YO5C 1D3YA 2P5KA 3C2BA 1ZLKA 5IPAA 2EK5A 3DKYA 4MTDA 4PJMA 5HS8A 2CH0A 2XB5A 5L3CA 2H1KA 5IP6A 1JKPC 1BL0A 5EG0A 5H6RA 4IKFA 2VJ5A 3MKLA 1ON2A 1YQAA 4EJTA 1T38A 3I9V2 2Z1DA 2FNAA 3HOUJ 3CQZJ 2M7AA 1XPXA 1S7EA 2LDUA 5GAEJ 3Q0WA 1P92A 2RGVA 3IWZA 3TMOA 3N4MA 4UV8A 3CP2A 3H5RA 3E97A 3KPHA 4HPQA 3RI4A 4BUPA 4G7ZF 3BG6A 3KETA 3CCVI 3I59B 1P7JA 2QQ8A 2Z2SB 3J81K 3GTGJ 2RC4A 2JMWA 3OL4A 2DQRA 1F4KA 1K6OA 3KZYA 3JW4A 3TDUC 4ZDLA 4DNCA 1QZYA 2TDXA 3OIQA 3TW7A 1MW7A 3MVPA 3GBGA 3BZKA 3HRUA 2ESHA 3HSEA 4YIRX 1BI2A 3I4NJ 4OWRB 4LG3A 2EZKA 4KFCA 3FBIB 4D7NA 3G4SI 4LMYA 3MKZA 1QPIA 1IDYA 2BEOA 2R7VA 2NNNA 3OR2C 2V9VA 3IHUA 3GFMA 4ENKA 3HBLA 3HTUA 2K7LA 1OYIA 2M34A 1O3SA 3U2RA 4BU2A 3OS2A 4A5NA 3GZ5A 3TBIA 3QPHA 3S3OA 5LGUA 4M72A 4HX4A 3B6AA 3GFLA 3TDZC 2OC6A 2Y0MA 4BHBA 2H8WA 3CUQA 5LRSA 3VB2A 2CQNA 2Q2EB 1WHUA 2GM4A 4CCOA 3MQ0A 3WU1B 2PJRB 3S17J 3PO2J 4RAGA 5ED4A 1MMGA 3SFZA 2MG4A 1ETXA 3FBNB 2VE8A 3FM5A 5DYMA 1PUFB 4B43A 3CC2I 5K5RA 1ZYRF 1TNSA 5DDGA 5J8FA 4BXXJ 1JTYA 3C2HA 3ZQHA 1DP3A 1STZA 1I39A 5DD4A 4BJ6C 2HVRA 5IOYA 1QU3A 2FU4A 4IHVA 5E1XA 4S05A 1W5CC 2R5ZB 2RVCA 2DW4A 2HYFA 3QOPA 5F27A 2OV7A 3J7YJ 1DU6A 3KYDB 1LDKB 2WBMA 5D5UB 2ISZA 3MEXA 2EIMH 2EPFA 2DK5A 1U2WA 1FNNA 2YU9J 2X1DA 3GTLJ 4PSXA 3OYDA 5BPDA 1AKHA 2F5DA 3GTQJ 2QKLB 2RREA 2E60A 4CCLA 3GLLA 3H5NA 2R7QA 1W7PA 2CRGA 3OYKA 2LF8A 2ID3A 3HSRA 1FMWA 5HOOA 3P7NA 2R7DA 1WJDA 1X19A 4R1HA 1W36D 2L7KA 1JUSA 4BACA 1ZELA 2NS0A 1U9OA 2FSWA 1KQ0A 5HLIA 2BVMA 4MGRA 3SHFA 3DEEA 2KL4A 3GFIA 4BDYA 3NRVA 3VSKA 5FFXA 3FKIJ 2XC7A 2ECBA 4WXCA 2VC1A 1FSEA 4A6DA 3JTGA 4HX7A 1S72I 2DCEA 5J1YA 1WJBA 3HEFA 3EPZA 4I01A 1NK2P 4ZH4F 4NHJA 4MEXF 1GVDA 4KUMA 4LK1F 1V5GA 5TISC 3DKWA 4IJAA 1QPMA 1YLFA 3KX2A 4X1EA 3ZXSA 2DAOA 5JVGF 1IW7F 2V26A 3E5UA 1FEXA 3NAUA 4N4NB 2QGUA 2H27A 2E19A 1WI3A 4XKVA 3TO7A 2EILH 5CKTA 3TL4X 3RTRA 3P9CA 5DUKA 2D5VA 2TRTA 1LVAA 1WJAA 3L2RA 2MYSA 2OQGA 5A2QK 1J75A 2CUZA 1XG1A 4F92B 1O3QA 4IHWA 1R22A 3BG5A 4XLCA 2M4KA 2DFEA 1BIAA 2K9NA 1HF0A 1JTXA 3I5UA 2A61A 4HV6A 3A01B 3CD6I 4B1RA 3SJMA 2VKEA 1ZN2A 3ZQIA 3ESWB 2AQEA 4A0ZA 1S6LA 4G9YA 1O3TA 1ONVA 2ZC2A 1ITYA 3OR1C 2AS5F 1SD6A 2P5VA 1LB2A 2GA1A 3CC4I 4YEJA 2FBKA 2ZMEC 4OIPF 4EMSA 2M8EA 4HNTA 3BWGA 3ERED 2QF7A 2LMDA 2B7EA 2LSOA 2LK2A 2DT5A 3Q3SA 3KZZA 1JT0A 2K3FA 5E18F 2W7NA 1MBKA 1Y8RB 2WAFA 3BY6A 1MJBA 3V42A 2L0KA 2ICWG 2PEXA 2EQRA 3HHGA 1G6NA 3LSMA 1UAAA 5HDKA 5LFAA 3T1BA 1I50J 2W4SA 4UY8I 2O0YA 1EJ9A 3K4CA 3CMEI 1FSHA 1Z9CA 1VI0A 1YJNI 4XNFA 2BYVE 4XSXF 4ABZA 5KHDA 2X4HA 3S1QJ 1OJLA 3EUHC 2E5ZA 4XL9A 3ZQQA 3W6JB 3HUGA 4HF0A 1BIBA 2DMNA 4N9IA 4BGDA 5JLWA 4OAYA 5D5VB 3PNYA 5EZHA 2HTSA 3RKXA 4E70A 2FBIA 5ERIA 4KIGA 1IGNA 1LE8B 2O5RA 2LKXA 3K4MA 3V8LA 3ABLH 1OCTC 3HSFA 2ZO4A 1EH6A 2CUFA 2DMTA 4Y3OA 5EDNA 5K1YA 4Y4RA 4YELA 1MZBA 3FWEA 2PMHA 4CYCB 2EB7A 3S1NJ 1Z3XA 4WX9A 1AWCA 4GYIA 4N0BA 2BHZA 4J01A 3CJQB 2HXOA 1B4AA 1J2XA 5F1RA 1OCPA 1OR7C 2EINH 4E7IA 3S3NA 2K4JA 2PBIA 1Y1VJ 1ZKGA 3K4JA 2Y30A 3TO6A 3K70C 1N78A 1KQ8A 1YX3A 2ZJ2A 4A6EA 4MTEA 2WB1N 3BR2A 2K86A 2BE5F 1YW8A 2DFHA 2K3PA 3CCSI 1ZREA 4AIDA 3OOPA 2KISA 3H3ZA 1Z67A 4YFNF 2PMUA 1FY7A 2EFOA 3HB9A 5GPCA 2EFPA 4PFOA 5EGOA 1FIPA 1XGSA 2OCCH 2YUSA 1IDZA 1K79A 2ME6A 1AHDP 3AL0B 1FX7A 5BMZA 2KT0A 5D4SA 4HLYA 3OWTA 2E2IJ 2L9SA 3CMMA 1ZH5A 3T8TA 4WXDA 2VBYA 4IOCF 2X9DA 3BJAA 1R49A 4XKCA 1ERDA 1K78B 4MIMA 5GTIC 2Z3YA 1EH7A 2VPLA 4BEHB 3DFGA 1IRXA 2DYRH 2EWNA 2XB0X 4LD5A 3S8PA 1VQKI 1F43A 4NNJA 5FKNA 4ZDPA 3HTSB 1HQCA 2D1VA 1ZR2A 3NQOA 2VKVA 5K7FA 1UELB 4W97A 2HYJA 4FE4A 2KKOA 3FXMA 2R0QC 1BW5A 5BOXA 3BOQA 5JLXA 4UB8C 4CYDA 3I3LA 1U5TA 3F8BA 2CW8A 1IG7A 2ZFUA 3O3KA 3CO6C 1H89C 1FTZA 1OMIA 2OD5A 1R5HA 3FZVA 3GMEA 1YFHA 2JA6J 2L4AA 4RAYA 5IOZA 4XR6A 1MSFC 5LLQA 2DTRA 3MMYB 1WI9A 4GGGA 4CSWA 3CLQA 3W6VA 1YTYA 2LH9A 5KAFC 1O4XA 1ZQ3P 4BYYA 2AHQA 1R7JA 1K6YA 2FNPA 3PM1A 3RZOJ 2K9LA 4KITB 3IP4B 2ZCWA 4RM3A 2GOMA 1UFMA 3WU2C 5B1AH 1X1PA 3CCJI 2DN0A 4BE2A 1ZG3A 2VKHA 3MWMA 5JFRA 2EIJH 3CCQI 4Y7NJ 1QA6A 2MW8A 4P9FA 1D1BA 1SVOA 3CDHA 5FLXK 3CCYA 2DU9A 1YIOA 2G9WA 4A0XA 2LC2A 3CCRI 3TQNA 4HNUA 2A68F 1XB4A 2DA4A 1IN5A 3F6OA 2X1CA 4BAYA 1LFBA 5E3NA 2A5WA 4RGSA 1RUNA 2VOOA 4P9UA 1ETWA 2EA2A 1SFOJ 5LD2C 1FOYA 3LOCA 2XPUA 2VODA 1MDMA 2CW0F 2A69F 2KRCA 3H35A 1SAXA 1B72A 1P4XA 4YFXF 4GYGA 2M87A 1VQ6I 3OL3A 4HA8A 2E36A 3JTHA 1VQNI 1L3LA 3AG3H 3BG3A 2UXNA 1DP7P 2E1MB 1RI7A 2NVUB 3BTJA 2LRDA 3OYIA 3EDPA 3FXUA 3LA2A 5F04A 4CXFA 1ZR4A 1P7IA 3JAMK 3CDIA 4RBOA 1BI0A 3CDLA 2DOAA 1IXRC 1J09A 5LHHA 1MNEA 3CLOA 3C18A 1K7AA 1IN4A 3LA7A 5TGTA 2LVSA 1MMDA 1XD7A 5FKMA 2IJLA 5E1WA 5IP9J 3KE2A 1OKRA 2P7CB 2DT6A 2BW3B 1U6GA 4PJNA 2DPDA 4O6JA 3CJTB 3DXJF 2NRAC 3H9JA 4AVZA 5AIQA 3GEZA 3AG1H 1E3OC 2XGCA 2EIKH 1Y0NA 3DV8A 1CQTA 1LEBA 2O3FA 1LFUP 2HGCA 1FOXA 1DPRA 5D8KB 4IRHA 1W5SA 4L0ZB 1APLC 4Q5SF 2DA6A 4QTRA 3I53A 1HOMA 4RAFA 2VIXA 2VQCA 3ZQ7A 3RPUA 4ESJA 4EV0A 2VE9A 1XDSA 4RS8A 3BR6A 1IO2A 3NEUA 5CVJA 3ERMA 3AFHA 2E1CA 3CUQC 4AYBA 2NOJB 3M7GA 5BS6A 3RZDJ 1A31A 3CF2A 5FRMA 5J1RA 3L2VA 1J59A 1UHSA 2UXXA 1QO0D 1D8KA 2WV1A 4LB6B 5C44J 2M2EA 2R7SA 2HOSA 1V55H 3M8EA 2CMPA 3K4LA 3A2KA 3RJPA 1Y39A 4N9HA 1HSJA 4AIHA 2EFNA 2FQ4A 4LG0A 2FMLA 3BT9A 2GIVA 2LYCA 3E0JB 4FE7A 1FJLA 2DA1A 2LR8A 2F2EA 2VLAA 3ZOBA 3IRRA 3U9GA 2VBWA 5E8GA 4F91B 4YRVA 3WG9A 2XGXA 4PGGA 2E34A 5J47A 4LLGF 3CCMI 1MBGA 2HKXA 4JX4A 4FX4A 2ETHA 3LSTA 2QSFX 1JJ6C 2YPRA 4ESFA 1Y8QB 3SFIA 1WH5A 3ULQB 5D4RA 4BHCA 4WXHA 2X85A 4AVPA 3HJEA 1QVTA 3QRFF 4IL6C 4FTHA 5ICEA 2X48A 2VUMJ 5IYCJ 3L1PA 3PUBA 4U88A 2HNHA 2LD5A 3JREA 3S15J 5M3FJ 4CZCA 5IYDJ 3GZ6A 4LJZF 1YE9A 2GQQA 2KZGA 1XMKA 2DA7A 3WTYC 2BY0A 2IAIA 4A0YA 4HLXA 3KEYA 1S29A 1WQ2A 4XK4A 1HBXG 2ZSIB 1WCMJ 1ZGWA 2YX4A 3J7ZI 1ZHFA 3BG7A 2X6OA 5AIPA 2VKDA 2JUCA 3ZR8X 4GFBA 4IX7A 1IN6A 4IRIA 2OZUA 1L0OC 2LNBA 3B02A 1FPQA 3K4KA 1FTTA 5CVRA 3F6VA 1OYYA 2D2WA 5HS7A 4NQWA 2ELKA 3RKWA 1MH4A 4CO8A 1IV6A 1H9TA 3D5SC 3GX4X 1XCBA 2MFZA 5LEKA 2FX0A 3F23A 4YIFA 5FGMA 4E7HA 2I5UA 2K40A 3HOTA 1ZLJA 2NYXA 4PK4A 2HOTA 3OSFA 4OU0A 4QIWN 4EJWA 2FUG2 5DUIA 3WODF 3VFZA 3BQYA 2WA0A 2FQ3A 1MMAA 2DA5A 5A2QZ 2VBXA 3GF2A 5DM6F 4BBSJ 2LY2A 1RESA 4W1UA 2ACJA 5DCFA 2N8GA 3UNGC 4IHXA 5L3EA 2MC4A 2HFHA 3DF8A 4XRSG 2E7WA 1F36A 1MJAA 3O6BB 2CW7A 1UCRA 1D5YA 1WJEA 3P9IA 3DEWA 3OV8A 1Z3YA 1EA3A 1HW5A 3AG2H 3G71I 3QPLA 3S14J 4J19A 1YITI 1CF7A 4PUSA 4L9NA 1G2HA 3M9AA 2JA2A 4HX8A 4YG2F 2JK3A 2QZ8A 2KIFA 5CVVA 5GPAA 4IO9F 1LQ1A 1OPCA 1IRGA 4KJZA 1GVJA 1ZAOA 3FHZA 4BJTA 3PNTA 4P96A 4M74A 3CO7C 3E6DA 1ZARA 2ZXHA 4AM3A 4UUSA 1A35A 4DBRA 1CGPA 1MBEA 3VYTB 3HPHA 4MEYF 2IPQX 1GDTA 1XSDA 5CVIA 3ECOA 1VTNC 1VQ9I 2CQXA 2EV6A 5DCMA 3VYUB 1Z05A 2V1NA 3OYLA 2ESNA 2R7TA 1FZPB 1NG7A 3CJNA 2J5PA 2FOKA 5EEGA 1DDNA 4UVCA 2VPRA 4EJVA 1RIOH 1HSTA 2JZYA 2P5LC 2IW5A 4C9YA 1BR4A 1TW2A 1MNDA 3RYPA 2EV0A 4B48A 2XDVA 3IKVA 1ETQA 4L5JA 3WU0A 2VQLA 1TQPA 5JR3A 3LSIA 4L0YB 4IEJA 1MMNA 1HXDA 2OF7A 3ECHA 1MSEC 1B6AA 4PCQA 4BXUA 5C3EJ 3FMRA 1X2NA 2KIMA 4PZJA 4IHYA 3WTTC 1DQUA 4A3KJ 2WY7Q 3ASOH 2V1UA 2Y69H 4JX5A 3DLLF 2K9QA 1VQLI 2BGCA 2PX9A 2Q0OA 3R6SA 2Y9ZA 4L9JA 4FCYA 1J0RA 3BCAA 3QP6A 3AG4H 1RETA 1IN8A 2CFXA 3S3MA 2G7HA 2W57A 5ICFA 1RZ4A 4OINF 2OCEA 4RMNA 2CG4A 2V1DA 3HGYA 4LIVA 2M5WA 2Z99A 1R23A 3HRMA 4M6XA 4YFKF 2M30A 2X1EA 3V7CA 1DPUA 2JA7J 4CH7A 4L9VA 2FXAA 1VF9A 2X0LA 3WHBA 5BNGA 2JWTA 2IGOA 5B1BH 3R4KA 2Z5UA 4XLFA 4ON0A 4G7HF 4MHGA 1DGWY 3GVAA 1RUOA 2KLOA 2IA1A 2VQHA 3LA3A 3S1MJ 2EA4A 1JKRC 4I0AA 4KT5C 2O8KA 1RPWA 1KONA 1ZRCA 3LAJA 3DU6A 2HWVA 3VSLA 4DGWB 1YI2I 4CICA 3E5QA 1XTAA 2A05A 5M5WJ 1QBJA 2X6WA 1YRNA 3RDIA 3L9FA 3BR5A 1VQ7I 1ETOA 1SVLA 2VT2A 3QOEA 4ZTJA 3CC7I 4OAZA 3HGGA 3ZGKA 2F5EA 4DZPA 2QUFA 3NARA 3BZCA 1H0MA 4C3JJ 1JHFA 4EJUA 5FJ8J 2LTPA 5ICGA 3S16J 1YHQI 4R8HA 1TZLA 4B8XA 3ZMZA 5JVTA 4QLCU 1T0FC 5KVRA 1SD4A 1OYWA 2NAZA 2KIUA 2UUZA 4QPQA 3V7SA 5FFZA 2R7WA 2ECCA 2AO9A 4OIRF 2JSPA 2HKOA 2QVOA 3A4CA 4I76A 4Y13A 3GTKJ 4CCNA 2QSGX 4S0HB 1XS9A 1NTCA 2R3SA 4BS9A 4HDUA 2BY1A 3ZPLA 3HOXJ 1D5VA 4GO1A 4XRSA 1MBJA 2OAZA 2JQ7A 4LLNA 4RLFA 1M1EB 3QU3A 5GAHJ 3G1MA 3W2VA 3S1RJ 2Y31A 3FM3A 3H5AA 1Z6RA 3HXLA 3ZRGA 1KQ9A 3GZNB 5FLXZ 1K61A 3CMAI 2P6SA 2F4IA 2B0LA 4B3AA 4Y17A 1I3QJ 2R5YA 4IHTA 3J7AY 3K1NA 2A07F 4E4HA 2E71A 2LKSA 3LSHA 4EEFG 3QPTA 3OOUA 1OQYA 2GXGA 4LK0F 2H8RA 1UJ8A 1IUYA 2V7FA 5GTHC 1XX5A 1T95A 2QBYB 3M07A 3MAJA 5LHIA 2A6EF 1B59A 4M9SA 1J9IA 1JHHA 2XGDA 5CJ9A 1TLHB 3JRDA 1Z7LA 5HLHA 2HPIA 2NS7A 4CZZA 4HSRA 3GTJJ 3VODA 3P9KA 4L5EA 3IH2A 5TJJA 1Z77A 3S2WA 3KP2A 2NNYA 4A3BJ 2HDDA 5J4YA 1LDDA 3QYEA 5DEQA 5D6FA 4ZJZA 2DA3A 3Q0VA 4AD9A 4IQ4A 3M8FA 3K10A 3JAMZ 4HNVA 3LQQA 1S5LC 3K2ZA 1NG6A 9ANTA 2UWMA 2M45A 1E2XA 3VYRB 3OYCA 1MMSA 1D1CA 1FBSA 1Q1VA 2Y2ZA 3L2UA 2V6EA 4M9XA 1PP8F 1ZGAA 2G7UA 4Z6YA 2CGPA 3BR3A 2E7XA 4XSZF 2CU7A 3LSRA 2LY9A 2HS5A 3OIPA 2ZFWA 2O03A 3EYYA 2ZMEB 3A03A 4RGUA 3QAHA 2BBYA 2X6XA 4I98B 3ZQFA 2OBPA 2Q8KA 2OTJI 3I59A 5K7ZA 3OYMA 2L01A 5H20A 2CV1A 1Y1WJ 3K1PA 4HBLA 4V2FA 1WRJA 3GYHX 4A3DJ 1WJFA 3D5RC 1B9NA 1SFUA 2A6HF 3ZN0A 3RPQA 2VQGA 5E8IA 1WSUA 4KT6A 3DCFA 1R00A 4IF4A 3CCLI 2QQBA 2WV0A 4X6AJ 2XPVA 1VQ8I 2KQRA 2XAQA 2E1NA 5E79C 2XPWA 4Y15A 2LBFB 3I0TA 2EFQA 4RGXA 1YW9A 3FIWA 2PN6A 3FXKA 4AC0A 2XAGA 1OCZH 2OUMA 2P7VB 4HSTA 2IGNA 4ZYAA 3WG7H 2H6BA 3HYIA 3RYRA 3IV5A 4C3IJ 1FOKA 4BQOA 3NWTA 4Z2YA 3MZHA 3OYEA 2Q2EA 4ZYHA 3PIPF 2HOEA 2PJRA 4B3XA 4BBRJ 1GXPA 2GXAA 2X6YA 1TWHJ 1PUFA 5JHFA 2V79A 4B47A 4Q47A 3G1LA 3BTIA 1XSVA 3FHNA 2PJPA 4XLPF 1KA8A 3SEQA 2EV5A 2HQRA 3TP3A 3K70D 3DPUA 3H9GA 3L7WA 3WE2A 1V54H 5CYVA 4N4OB 3ZMUA 2JT1A 5D8LB 2L02A 3LSPA 3QYFA 4U7DA 4ZDOA 1MJ9A 2L9NA 2R5ZA 3IAS2 4M3BA 1HW2A 1D1AA 2ELJA 1F9NA 2A6TA 4U0VA 4HW0A 4E7SA 1B8IB 4C2MJ 1DU0A 3H0DA 4P5OA 3D5LA 4F55A 1A5JA 4EGYA 2AXTC 1KU2A 3WE3A 3PQKA 3FISA 5FROA 2XROA 1EH8A 4V2GA 2KJBA 2KDZA 1VQOI 2ZKZA 2W85A 5EYRA 2A5YB 1TQMA 1IV8A 3ZQGA 4CHUA 4BY1J 2DFIA 2D1HA 3IL2A 2BXZA 2YR2A 1BI3A 2BXYA 3K4BA 4A3JJ 4AWXB 2IT0A 4BHPA 3WGIA 3FMSA 1FT9A 3RIRA 5L3BA 2Z33A 1LVKA 2W25A 2IEKA 4AYBN 5F0CA 3DWLE 1YIJI 2M4GA 4F7ZA 2KMUA 5HVQC 2M1BA 4AIKA 2DOFA 2LP0A 4LB5A 1U8BA 2QLZA 2J5OA 5C4XJ 2AXLA 1SD5A 1OFCX 4G6DA 2E35A 4G6TB 1FYLA 3DTKA 4ZYEA 3OMYA 2LLKA 4KMUX 1E3HA 1U8RA 3A0BC 1G3WA 3K0LA 2QWWA 2UZKA 2JSCA 1I1SA 3BTLA 2Y75A 1RKTA 3F8MA 4J00A 2M0MA 2P6TA 1R6RA 2MBFA 4IHSA 4JP0A 4XN3A 2RNJA 2L2OA 3PSIA 2HR3A 5E17F 3FX3A 2DQLA 5HDGA 1MH3A 2VBZA 3BR0A 4ESBA 4RB3C 1HC8A 2HYGD 2DODA 3SEZA 4I7HA 3WGGA 3O8HA 5HODA 4UUVA 3F72A 5K5QA 3DBHB 2QSHX 3BP8A 3RSNA 4AU7A 5ILVA 2R7RA 1T6SA 3BZ6A 4MO7A 4OMYA 4MQVA 2IBDA 4JYKA 2COMA 3DPLC 3A01A 3U1KA 3VPRA 3HOYJ 2DDBA 3OYAA 4O3MA 2NS8A 1PUEE 3GUDA 1FYKA 2MSYA 4IZZA 5KNLA 1ORKA 4X0GA 2VB6A 5LEJA 4S04A 1IZ1A 4M73A 4HEA2 1T8IA 1T56A 1Y0UA 1YX5A 3SXYA 5F0FA 3KP3A 5F1JA 1R4MB 2V6CA 4CCKA 3H9QA 2DPUA 5EG0B 3WGHA 4BKXA 4MNUA 3WTUC 5E1ZB 4PGHA 4D7MA 5E3OA 1R1TA 1BN5A 2BZTA 3F8NA 1I1GA 2LF7A 3Q9SA 4FHTA 1N25A 5FO5A 4H4KC 5E20A 1GV5A 3IUOA 1LNWA 3CZ6A 2ZJRF 5J3LA 1TL8A 3T8RA 4IPAA 1PP7U 2STWA 2ME0A 1A6IA 2XVCA 3DLAA 2R7ZJ 1RR7A 1UG0A 4BJ5C 2XAUA 1IXSB 2JN6A 4M3EA 1XGOA 2CS3A 3PJRA 1WJ5A 4TV7A 2CFOA 4NB5A 2JJ7A 1LE8A 4DZJA 2ZXIA 1O7LA 3FK6A 2YX7A 2F6CA 1Q1HA 2GIZA 2W24A 3H0GJ 1AOYA 3LFKA 2VXDA 3I55I 4A5MA 2KIQA 3HOWJ 3KEQA 3RCOA 1K4TA 4DJAA 5D5WB 2JPCA 2IA2A 4KMFA 4ENNA 1VQPI 4C30A 4LGWA 2ZXJA 1TW3A 3QWLA 1R9TJ 2BOLA 4CYCA 3TP0A 2HZTA 1SD7A 2WAEA 3SYTA 4IXAA 4CGZA 3S2HJ 1LJ9A 4AUXA 3CUOA 1GLNA 2CO5A 3CP8A 5CPRB 1IRZA 5AONA 4A3MJ 5HS9A 3KEOA 3SDBA 1R5ID 3HHHA 2RKHA 2PMZA 2RDPA 5FD5A 4YIIA 2XRNA 4ZYGA 2Z16A 4A2UA 4EJOA 1HKSA 2HU9A 3VEPA 1H8AC 1VNDA 2DO7A 3WTVC 4XOPA 3J80K 1XGNA 5HNFA 2HTJA 3REOA 3K1MA 1MBFA 3CUQB 1B1BA 4A3CJ 4DYCA 2M9HA 1X3ZB 1ETKA 3HOSA 1X4OA 3GWZA 2VN2A 3PL8A 3TKYA 4E7KA 3Q5FA 1WH7A 2L9RA 3IWFA 3N97A 1XSXA 1VFCA 2DMPA 3BLYA 1ETVA 1IC8A 2PG4A 2YU3A 1BC7C 4OIQF 4EQQA 3BJOA 5JI6A 5ILSA 3DTIA 4OMZA 4MQ9F 4Q48A 2XSDC 3E6CC 2EFWA 3RKQA 1K78A 1HDDC 1K83J 3KFWX 4M71A 2NXNB 3RQ4A 4EVIA 4BEHA 3EETA 3KCCA 2CQQA 1RRJA 2GXBA 1NHAA 1BW6A 3QODA 2RAEA 4CA0A 3OYHA 3BJ6A 4B09A 1MD0A 3EYIA 1BA5A 2K9SA 1V5FA 1WGXA 1Z7UA 3BCBA 1X1AA 3E3VA 4BY7J 4XLNF 4DYRA 3ZMTA 1PJRA 3QQAA 3OYJA 2NVYJ 1Y6IA 2QYOA 1AKHB 4M6VA 5CVUA 2OTLI 1TC3C 4BXFA 4C2UA 4DW6A 5GP9A 1SMTA 1W7PB 2P8TA 3V4GA 1T98A 2CQ7A 1Z0XA 3QU6A 2F48A 1T33A 2VJ4A 3IC7A 1W7PD 2VI6A 2FE3A 3OS1A 2K27A 4L18B 1H9GA 4K2EA 3MN2A 3FF5A 3AKZA 3F21A 4A3FJ 4MFDA 1HCRA 4KISA 1EF4A 2HPMA 3MKWB 1ON1A 3DP7A 2QA4I 3ONQA 2HZDA 2W48A 2IS1A 2ELHA 2EZIA 5BQTA 2NVQJ 2F5VA 1FMVA 1R36A 3JSOA 1O57A 1XCVA 2GBYA 4G94A 5IYBJ 5M5XJ 1ULYA 3WTSC 2OU2A 2DJIA 4A69C 3K2AA 3C7JA 1TWAJ 2V9PA 3W6KB 2CJJA 5GAGJ 2XKOA 2FOWA 3HRSA 5F08A 3K7AJ 2JUGA 4U7BA 4NBQA 1GUUA 1O7FA 4IOAF 1IAWA 2JRTA 5DTDA 5HNHA 2RQPA 4XLEA 4XM3A 2ZJPF 3F8CA 2O7OA 5CLSA 5LRRA 5HLTA 4MFEA 5FLMJ 1WWXA 5DV5A 3HIFA 4KNYA 1LDJA 4BE1A 4KA4A 1V4RA 2V9KA 2WY8Q 3QPSA 5H6QA 1WJCA 1WFXA 3OS0A 5DM7F 2JPBA 2HDCA 5EEHA 1G59A 2KPMA 5LGNA 3IRQA 3E6MA 1S7OA 1YJWI 2YS9A 5L3FA 4DIQA 2CUJA 5K7HA 1A04A 2RN7A 4CCMA 3TO9A 4RB2C 3KP6A 1Z91A 5M3MJ 5D6EA 1OLTA 4XBFA 2BW3A 3SQNA 3E6BA 5F0HA 3JCUC 1FWZA 3OYGA 5E3LA 1YJ9I 2DI3A 1BJZA 2L3DA 3HUGB 5B5EC 3S2DJ 1BC8C 2XSJC 2PFBA 4UUTA 2K5CA 2QENA 2KHMA 1YG2A 2IVMA 1S9HA 5JHUA 2BV6A 2M8GX 5DD8A 4L9TA 3PO3J 4LIUA 2E1OA 3H3UA 4IQJA 2QKMB 3BDDA 2IGKA 2STTA 3MD2A 3IH4A 4HZFA 3MZYA 2XUBA 2O61A 1V5EA 2LFBA 3KLNA 4II2A 2DXIA 3VDXA 4LFUA 4I2OA 1Z1DA 2DT7B 2DFFA 3SZPA 4P1WA 2IGMA 3L2QA 4ZYDA 1QQIA 5HDNA 2VL8A 1OCCH 2DDAA 1JKOC 5C4JJ 4RM2A 1A36A 4ITVA 3JRCA 3KP5A 2O8XA 5L3DA 1BR1A 4ANJA 1GXQA 3FXRA 1PDNC 3GTPJ 3HPGA 1KZHA 5EGOB 1EKEA 1SVMA 4KDPA 5EZGA 1XN7A 2P4WA 3G1OA 2W00A 1ZRDA 1LFPA 2BY2A 4FASD 1ODDA 2ADUA 3EUAA 3SDGA 4NUBA 2GZWA 4UV9A 3KIOA 1K4SA 3COAC 1RR8C 4ZTFA 3GCMA 1LEAA 2GLOA 2MH2A 2O6GE 3H3VK 1BOAA 3HRTA 2MD5A 1V3FA 2WADA 1W36C 2XHKA 2XIGA 1USSA 4I0BA 1ENHA 2EBIA 3H1CA 4BQQA 2IA0A 4BQNA 2CYYA 1Z6TA 4XKBA 1ZG5A 1U5TC 2F4MB 3ELKA 4D5CA 3O8GA 4A3EJ 1A6QA 4RDUA 2PLYA 4DYQA 2Z9OA 3TW6A 2KJCA 2R7UA 4FQGA 4BDZA 2EZHA 4PJLA 4BQAA 4Y52J 3KP4A 5E3MA 3I54A 4I6ZA 3OYBA 2WAQN 3U21A 1FIAA 1U5TB 3FXLA 2L5QA 4HDVA 2LKPA 1QNTA 2FD5A 2QCOA 4PDKA 1JI8A 4QWQA 5FD6A 3CMYA 1S7AA 3H36A 3V8JA 5F64A 2M7BA 2GWRA 1I3AA 2L4MA 4G6QA 1R58A 1SAUA 3I64A 1NH3A 1VZ0A 5KAIC 4I09A 2MLKA 4RB1A 1KU3A 4RGRA 1C0WA 4Q4ZF 2MH9A 1WPKA 4XRMA 2X51A 3JRHA 1JE8A 1XMXA 3F3XA 5IT9K 1P6RA 2FA5A 2W82A 3KYLA 2F4OB 5IP7J 3KLOA 3ML6A 3D1NI 2XV4S 1UB9A 4H0EA 4ENJA 1REPC 2RNGA 3HDDA 1E17A 3ZMSA 4WF2A 3I58A 4XOTA 4Y33A 5BPIA 3DQVC 3G6EI 2JTVA 5EEAA 1KU9A 4HF2A 5EJCA 4G7OF 5DS9A 4KN4X 3S32A 1MNMC 2OA4A 4EM2A 5B3SH 4D9JA 4NDLA 4WWCA 2DBBA 1TQIA 2XASA 1R5GA 1EV7A 5IT3A 1MDMB 3D0SA 1G3YA 2UV1A 1B72B 1D8JA 3DBRB 3VOEA 4UB6C 3M1EA 1GV2A 2RQQA 2Y0SN 1JT6A 2XAJA 3LWFA 3LSKA 4EATA 2ZNYA 5F6FA 3RQIA 1DGRM 2PQ8A 2HEOA 4GXOA 1SFEA 4RB0A 2R7FA 1X3WB 2XRLA 5EF6A 5KCMA 1QRYA 4G8XA 1QHHD 2NOGA 3M3YJ 5J8CA 4EM1A 1JGSA 1VQ4I 1U78A 4V19K 2R7XA 5D5XB 3FMQA 2VASA 1JGGA 1XGMA 1RC9A 4JQFA 1YS6A 2Q1ZB 3B6CA 4OIOF 3R61A 2HQNA 4JK1X 2C6YA 3UKGA 4NC6A 2MA3A 3HL2A 2F5FA 3BQZA 3K9TA 3BPXA 3ZP5A 3PFIA 1J7KA 1ZRFA 1UMQA 2H94A 3I4PA 4QPOA 2COBA 5CQGA 3LMMA 2R4GA 1LKXA 2L7MP 3BPVA 3ZMVA 2RV8A 1LUJB 3ISPA 1HW1A 2MABA 2E5NA 3K6GA 1R71A 3J80Z 3C3WA 1U0JA 1TBXA 4KIBA 1WZ2A 4KYWA 3ASNH 2WAQA 3HG9A 4D5FA 2CUEA 2D45A 2W84A 4HF1A 1R1VA 1P9QC 3LSGA 2B63J 4RLQA 2K4BA 4ZZDA 2DYSH 3O2PE 1X4PA 3FKJA 3PQJA 4U0YA 3WTWC 3ZQLA 3GLXA 2ZJQF 1LPQA 4LLLA 4BNCA 3RPUD 3MKYB 2O9LA 3GFJA 2L9VA 2XAFA 1RKWA 4I99C 2MLGA 4ENMA 4GDFA 1KYZA 4M6YA 2HVSA 3AL0C 1I6XA 2VC0A 3SZTA 3LSJA 3M4OJ 3DPTA 3FXJA 4LOCA 1VQ5I 1E0EA 1D0XA 5K5OA 1UHWA 1USTA 2DA2A 3PSFA 4LG0B 4I02A 2K02A 3FXQA 2WTEA 4E7LA 4M3GA 3PNVA 1F1ZA 2IXSA 4KN7X 4XORA 2QQAA 4CUGA 1BR2A 1ETYA 1TWCJ 3MCZA 1RNLA 3TEDA 4MLOA 1MGTA 4DBQA 3PFYA 3CJRB 4L5IA 1Y56A 2P0WA 2L7FP 2HXIA 3N05A 3A1YA 5FKKA 1E3PA 4JBAA 3JRAA 2CV2A 1X2MA 4E7ZA 3M8JA 3CTAA 3HM5A 3MFKA 3GTOJ 1W4MA 2V1XA 2E2JJ 4M3DA 4HQMA 2JRMA 4U87A 2IS6A 3W2AA 2MC3A 2PMZN 2OQRA 3VYSB 1FP2A 1N75A 3MZ8A 2FRHA
chains in the Genus database with same CATH topology
4DQ2A 4FX0A 1T0FA 3L2CA 1F5TA 1YYVA 3F8FA 4HYEA 3GO5A 1WKMA 3TOAA 5LGTA 1JXSA 2YSRA 4GCVA 3H92A 1SFXA 1XMAA 2FEZA 1R1UA 2VOPA 2QBYA 4EM0B 1YS7A 1G3TA 2QQ9A 2GA2A 1S3JA 2ZBKA 1T39A 1DUXC 1T2KA 3QP5A 2DLLA 1BI1A 1I5ZA 2OZ6A 3ZMDA 5ILUA 2H6CA 1CF7B 2FF4A 3ZN1A 2WWYA 1KGSA 1QZZA 1FLIA 1QGPA 2CQKA 1SMYF 3G3ZA 2ISYA 3V8KA 2PI0A 3J7AO 3L00A 2ZMEA 1YW7A 4IVNA 3BROA 1FYMA 1HKTA 3J81Z 3G73A 2VT3A 3WTXC 2CWEA 3C1DA 5DCMB 1MKMA 1BBYA 3Q9VA 5TRDA 1U3EM 1P2FA 3EUHA 6PAXA 1IF1A 3TOBA 3E5XA 5HLGA 3LAPA 1BJAA 3V7RA 4OOIA 2ZNZA 3T5XA 1FBQA 3R0AA 2L54A 1ZGJA 4CDGA 1HKQA 5FB2A 4M9ZA 4HOBA 3ROUA 2Y48A 4UXNA 4IRGA 1OR7A 3B73A 4XRFA 3R0JA 1P4AA 3F22A 5ICCA 4A12A 1UHMA 4WK8F 1X3UA 4UHTA 4RAZA 1TNTA 2IP2A 2H09A 2DK8A 3GXOA 1FC3A 3ABTA 5LHGA 2XAHA 4U0WA 2EJRA 3TGNA 4EGZA 5LBQA 4WCGA 3U1DA 4ETSA 4D0PA 2VXZA 1FBUA 1IXCA 1XDUA 3GW2A 4UVAA 3WTZA 5J6XA 3JSPA 1O3RA 4BH9A 4HV5A 3RKYA 1G3SA 1W5TA 2GAUA 2KRFA 4P55A 1G4DA 3EQLF 1IN7A 4R79A 1IRFA 5KK1A 3AAFA 1S8NA 2FMYA 2F5CA 4UVBA 5IT9Z 1I27A 3ABUA 3I71A 3DEUA 1TTYA 1ZG1A 2QM3A 1KU7A 4UNOA 4ZZLA 2VONA 2CSOA 1P4WA 1BM9A 3KP7A 3LQRA 3IKTA 5L3GA 4KIFA 4HAMA 2A3SA 4O5VA 1KYWA 4HQEA 3R60A 1J5YA 1GHCA 3K69A 4FT8A 1FP1D 2XKPA 4KICA 4AIJA 2WC2A 3L09A 1B9MA 3T0YA 2FBHA 2IRFG 4ASNA 1YO5C 1D3YA 2P5KA 1ZLKA 2EK5A 4MTDA 5HS8A 5L3CA 5H6RA 1ON2A 1YQAA 4EJTA 1T38A 2FNAA 2LDUA 1P92A 2RGVA 3IWZA 3N4MA 4UV8A 3E97A 3RI4A 4G7ZF 3KETA 3I59B 3J81K 2RC4A 2DQRA 1F4KA 1K6OA 3KZYA 3JW4A 3TDUC 4DNCA 1QZYA 2TDXA 3HRUA 2ESHA 3HSEA 1BI2A 4KFCA 4LMYA 2BEOA 2NNNA 2V9VA 3IHUA 3GFMA 4ENKA 3HTUA 2K7LA 1OYIA 1O3SA 3U2RA 4A5NA 3GZ5A 3QPHA 5LGUA 4M72A 4HX4A 3GFLA 3TDZC 2Y0MA 4BHBA 3CUQA 5LRSA 3VB2A 3WU1B 3MQ0A 5ED4A 3SFZA 2VE8A 3FM5A 5DYMA 5K5RA 1ZYRF 1TNSA 5DDGA 5J8FA 1STZA 5DD4A 2FU4A 5E1XA 4S05A 2RVCA 2DW4A 2HYFA 3QOPA 1LDKB 5D5UB 2ISZA 3MEXA 2DK5A 1U2WA 1FNNA 5BPDA 2F5DA 1W7PA 2LF8A 3HSRA 5HOOA 3P7NA 2R7DA 4R1HA 2NS0A 2FSWA 1KQ0A 5HLIA 4MGRA 3SHFA 3GFIA 3NRVA 5FFXA 4WXCA 2VC1A 1FSEA 4A6DA 3JTGA 4HX7A 4I01A 4ZH4F 4NHJA 4MEXF 4KUMA 4LK1F 3DKWA 4IJAA 1QPMA 1YLFA 2DAOA 1IW7F 3E5UA 2H27A 3TO7A 3RTRA 3P9CA 5DUKA 1LVAA 5A2QK 2OQGA 1J75A 1O3QA 1R22A 1BIAA 3I5UA 2A61A 4HV6A 1ZN2A 4A0ZA 1S6LA 4G9YA 1O3TA 1ONVA 2AS5F 1SD6A 2P5VA 1LB2A 2GA1A 2FBKA 4OIPF 4EMSA 2M8EA 3BWGA 3ERED 2LSOA 2DT5A 3KZZA 5E18F 3BY6A 1MJBA 2PEXA 3HHGA 1G6NA 5HDKA 3T1BA 2O0YA 1FSHA 1Z9CA 2BYVE 4XSXF 2X4HA 3W6JB 3HUGA 4HF0A 1BIBA 4N9IA 5D5VB 2HTSA 3RKXA 4E70A 2FBIA 5ERIA 4KIGA 3V8LA 3HSFA 2ZO4A 1EH6A 5K1YA 1MZBA 3FWEA 2PMHA 2EB7A 4WX9A 1AWCA 4GYIA 4N0BA 1B4AA 1J2XA 5F1RA 2K4JA 2PBIA 3TO6A 1KQ8A 2ZJ2A 4A6EA 4MTEA 2K86A 2BE5F 1YW8A 1ZREA 3OOPA 3H3ZA 4YFNF 2PMUA 1FY7A 2EFOA 2EFPA 1XGSA 1K79A 1FX7A 5BMZA 4HLYA 5D4SA 1ZH5A 3T8TA 4WXDA 2VBYA 3BJAA 1K78B 2Z3YA 1EH7A 3DFGA 2EWNA 4LD5A 3HTSB 1HQCA 2D1VA 3NQOA 2KKOA 5BOXA 3BOQA 4CYDA 1U5TA 3F8BA 3O3KA 3CO6C 1OMIA 2OD5A 1R5HA 3FZVA 1YFHA 2L4AA 4RAYA 5LLQA 2DTRA 1WI9A 4GGGA 1YTYA 4BYYA 1R7JA 2FNPA 2ZCWA 1UFMA 1ZG3A 3MWMA 5JFRA 4P9FA 3CDHA 5FLXK 2DU9A 1YIOA 2G9WA 4A0XA 3TQNA 2A68F 1XB4A 3F6OA 1IN5A 4BAYA 4RGSA 2VOOA 1RUNA 4P9UA 2EA2A 2VODA 1MDMA 2CW0F 2A69F 1SAXA 1P4XA 4YFXF 4GYGA 2M87A 4HA8A 3JTHA 1L3LA 2UXNA 1DP7P 1RI7A 3EDPA 3FXUA 3LA2A 4CXFA 3JAMK 1BI0A 1IXRC 5LHHA 3CLOA 3C18A 1K7AA 1IN4A 3LA7A 1XD7A 2IJLA 5E1WA 3KE2A 1OKRA 2P7CB 1U6GA 2DPDA 4O6JA 3DXJF 2NRAC 5AIQA 3GEZA 3DV8A 1LEBA 2O3FA 2HGCA 1DPRA 5D8KB 4IRHA 1W5SA 4L0ZB 4Q5SF 3I53A 3ZQ7A 3RPUA 4ESJA 4EV0A 2VE9A 1XDSA 4RS8A 3NEUA 5CVJA 2E1CA 3CUQC 3M7GA 5BS6A 1J59A 2UXXA 1QO0D 1D8KA 4LB6B 3M8EA 3RJPA 4N9HA 1HSJA 4AIHA 2EFNA 4LG0A 2FMLA 2GIVA 2F2EA 3IRRA 3U9GA 2VBWA 5E8GA 3WG9A 2XGXA 4PGGA 4LLGF 4FX4A 2HKXA 2ETHA 3LSTA 2YPRA 4ESFA 5D4RA 3ULQB 4BHCA 4WXHA 4AVPA 3QRFF 5ICEA 4U88A 3GZ6A 4LJZF 2GQQA 1XMKA 3WTYC 4A0YA 4HLXA 1S29A 1WQ2A 1HBXG 2YX4A 1ZHFA 5AIPA 1IN6A 4IRIA 2OZUA 1L0OC 2LNBA 3B02A 1FPQA 5CVRA 3F6VA 1OYYA 2D2WA 5HS7A 4NQWA 3RKWA 4CO8A 1H9TA 3GX4X 1XCBA 5LEKA 3F23A 4YIFA 5FGMA 3HOTA 1ZLJA 2NYXA 4OU0A 4EJWA 5DUIA 3WODF 3VFZA 2FQ3A 5A2QZ 2VBXA 3GF2A 2ACJA 5DCFA 5L3EA 2HFHA 3DF8A 2E7WA 1MJAA 3O6BB 1UCRA 3P9IA 3OV8A 1HW5A 1CF7A 4L9NA 3M9AA 4HX8A 4YG2F 2QZ8A 2KIFA 5CVVA 1LQ1A 1OPCA 1IRGA 1GVJA 1ZAOA 3FHZA 4P96A 4M74A 3CO7C 3E6DA 1ZARA 1CGPA 4MEYF 2IPQX 1XSDA 5CVIA 3ECOA 1VTNC 5DCMA 2EV6A 1Z05A 2ESNA 1FZPB 3CJNA 2J5PA 2FOKA 5EEGA 1DDNA 4UVCA 4EJVA 1RIOH 1HSTA 2JZYA 2P5LC 2IW5A 1TW2A 3RYPA 2EV0A 3IKVA 4L5JA 3WU0A 5JR3A 1TQPA 4L0YB 1HXDA 3ECHA 1B6AA 4PCQA 4BXUA 3FMRA 2KIMA 4PZJA 3WTTC 2V1UA 2BGCA 2Q0OA 3R6SA 4L9JA 1J0RA 3QP6A 1IN8A 2CFXA 2G7HA 2W57A 5ICFA 1RZ4A 4OINF 2CG4A 2V1DA 2M5WA 2Z99A 1R23A 3HRMA 4M6XA 4YFKF 2M30A 3V7CA 1DPUA 4L9VA 2FXAA 2X0LA 3R4KA 2Z5UA 4ON0A 4G7HF 4MHGA 3GVAA 1RUOA 2IA1A 3LA3A 2EA4A 4I0AA 4KT5C 1ZRCA 3LAJA 2HWVA 4CICA 3E5QA 1QBJA 3RDIA 3L9FA 2VT2A 2F5EA 2QUFA 1H0MA 1JHFA 4EJUA 5ICGA 4R8HA 4B8XA 3ZMZA 5JVTA 4QLCU 5KVRA 1SD4A 1OYWA 2NAZA 2KIUA 3V7SA 5FFZA 4OIRF 2HKOA 2QVOA 4Y13A 2R3SA 4HDUA 3ZPLA 1D5VA 4GO1A 2OAZA 4LLNA 3QU3A 3FM3A 1Z6RA 1KQ9A 5FLXZ 2P6SA 4IHTA 2B0LA 4Y17A 3K1NA 2A07F 3QPTA 2GXGA 4LK0F 1IUYA 2QBYB 3MAJA 5LHIA 2A6EF 1B59A 4M9SA 1J9IA 1JHHA 5CJ9A 1TLHB 5HLHA 4CZZA 3VODA 3P9KA 5TJJA 3S2WA 3KP2A 2NNYA 1LDDA 5DEQA 5D6FA 4AD9A 3M8FA 3JAMZ 3LQQA 3K2ZA 2UWMA 2M45A 1E2XA 1FBSA 4M9XA 1PP8F 1ZGAA 2G7UA 2CGPA 2E7XA 4XSZF 2HS5A 2ZFWA 2O03A 3EYYA 2ZMEB 4RGUA 3QAHA 2BBYA 4I98B 2OBPA 2Q8KA 3I59A 2L01A 5H20A 3K1PA 4HBLA 3GYHX 1WRJA 1B9NA 1SFUA 2A6HF 3ZN0A 3RPQA 5E8IA 1WSUA 1R00A 4IF4A 2QQBA 2WV0A 2XAQA 2E1NA 4Y15A 3I0TA 2EFQA 4RGXA 1YW9A 2PN6A 2XAGA 2P7VB 2H6BA 3HYIA 3RYRA 1FOKA 4Z2YA 3MZHA 2Q2EA 4ZYHA 2HOEA 1GXPA 2V79A 4Q47A 1XSVA 2PJPA 4XLPF 1KA8A 2EV5A 2HQRA 3L7WA 3WE2A 5CYVA 3ZMUA 2JT1A 5D8LB 2L02A 4U7DA 1MJ9A 1HW2A 1F9NA 4U0VA 4HW0A 4P5OA 3D5LA 4EGYA 1KU2A 3WE3A 3PQKA 2XROA 1EH8A 2KJBA 2ZKZA 2W85A 2A5YB 1TQMA 4CHUA 2DFIA 2D1HA 3IL2A 2YR2A 1BI3A 2IT0A 4AWXB 4BHPA 3WGIA 3FMSA 2Z33A 1FT9A 3RIRA 5L3BA 2W25A 4F7ZA 5HVQC 2M1BA 4AIKA 4LB5A 2QLZA 2J5OA 2AXLA 1SD5A 4G6DA 1FYLA 4ZYEA 4KMUX 1U8RA 3K0LA 1G3WA 2QWWA 2UZKA 2JSCA 1I1SA 2Y75A 3F8MA 2P6TA 2MBFA 4IHSA 2RNJA 2HR3A 5E17F 3FX3A 2DQLA 5HDGA 2VBZA 4ESBA 4RB3C 2HYGD 3WGGA 4I7HA 4UUVA 3F72A 5K5QA 3BP8A 5ILVA 1T6SA 3BZ6A 4OMYA 4MQVA 2COMA 3DPLC 4O3MA 1PUEE 3GUDA 1FYKA 5LEJA 4S04A 1IZ1A 4M73A 1Y0UA 3SXYA 3KP3A 2V6CA 2DPUA 3WGHA 4MNUA 3WTUC 5E1ZB 4PGHA 1R1TA 1BN5A 3F8NA 1I1GA 2LF7A 3Q9SA 4FHTA 5FO5A 5E20A 1LNWA 3T8RA 4IPAA 1PP7U 2STWA 2XVCA 1IXSB 1XGOA 4TV7A 4NB5A 1O7LA 2YX7A 1Q1HA 2W24A 1AOYA 3LFKA 4A5MA 3KEQA 5D5WB 2JPCA 2IA2A 4KMFA 4ENNA 4LGWA 2ZXJA 1TW3A 2HZTA 1SD7A 4IXAA 4CGZA 1LJ9A 3CUOA 2CO5A 5AONA 5HS9A 3KEOA 3HHHA 2RKHA 2RDPA 5FD5A 4YIIA 2XRNA 4ZYGA 4A2UA 4EJOA 1HKSA 3VEPA 3WTVC 2DO7A 3J80K 1XGNA 2HTJA 3REOA 3K1MA 3CUQB 1B1BA 3HOSA 3GWZA 2VN2A 3TKYA 3Q5FA 3N97A 3IWFA 1XSXA 2PG4A 2YU3A 1BC7C 4OIQF 4EQQA 3BJOA 5JI6A 5ILSA 4OMZA 4MQ9F 4Q48A 3E6CC 2EFWA 1K78A 3KFWX 4M71A 4EVIA 3EETA 3KCCA 2GXBA 1NHAA 3BJ6A 4B09A 1MD0A 3EYIA 3E3VA 1Z7UA 4XLNF 3ZMTA 2QYOA 5CVUA 1SMTA 1W7PB 2P8TA 3V4GA 1T98A 3QU6A 3IC7A 1W7PD 2FE3A 2K27A 4L18B 1H9GA 4K2EA 3FF5A 3F21A 1ON1A 3DP7A 2ELHA 5BQTA 1R36A 3JSOA 1O57A 1XCVA 4G94A 1ULYA 3WTSC 2OU2A 3C7JA 3W6KB 2XKOA 3HRSA 4U7BA 1O7FA 1IAWA 2JRTA 2RQPA 3F8CA 5CLSA 5LRRA 1WWXA 5DV5A 3HIFA 4KNYA 1LDJA 4KA4A 1V4RA 5H6QA 2JPBA 2HDCA 5EEHA 5LGNA 3IRQA 3E6MA 1S7OA 5L3FA 1A04A 2RN7A 3TO9A 4RB2C 3KP6A 1Z91A 5D6EA 4XBFA 3SQNA 3E6BA 1FWZA 2DI3A 2L3DA 1BC8C 2PFBA 2QENA 1YG2A 2IVMA 5JHUA 2BV6A 5DD8A 4L9TA 3H3UA 3BDDA 2STTA 4HZFA 3MZYA 2XUBA 2O61A 3KLNA 4LFUA 4I2OA 1Z1DA 3SZPA 4ZYDA 1QQIA 5HDNA 3KP5A 2O8XA 5L3DA 1GXQA 3FXRA 1PDNC 4KDPA 1XN7A 2P4WA 1ZRDA 1ODDA 2ADUA 2GZWA 4UV9A 3COAC 1LEAA 2MH2A 2O6GE 1BOAA 3HRTA 2MD5A 1V3FA 2XHKA 2XIGA 1USSA 4I0BA 2IA0A 2CYYA 1Z6TA 1ZG5A 1U5TC 3ELKA 2PLYA 2Z9OA 2KJCA 4BQAA 3KP4A 3I54A 1U5TB 4HDVA 2LKPA 1QNTA 4PDKA 4QWQA 5FD6A 1S7AA 3V8JA 5F64A 2GWRA 2L4MA 4G6QA 1R58A 3I64A 4I09A 2MLKA 4RB1A 1KU3A 4RGRA 1C0WA 4Q4ZF 2MH9A 1JE8A 3F3XA 5IT9K 1P6RA 2FA5A 3KLOA 3ML6A 2XV4S 1UB9A 4H0EA 4ENJA 1REPC 1E17A 3ZMSA 4WF2A 3I58A 5BPIA 3DQVC 2JTVA 1KU9A 4HF2A 4G7OF 4KN4X 2OA4A 4EM2A 4WWCA 2DBBA 1TQIA 2XASA 1R5GA 1EV7A 5IT3A 1MDMB 3D0SA 1G3YA 1D8JA 3VOEA 3M1EA 2XAJA 3LWFA 2ZNYA 5F6FA 2PQ8A 2HEOA 4GXOA 1SFEA 4RB0A 2R7FA 4G8XA 5J8CA 4EM1A 1JGSA 1U78A 5D5XB 3FMQA 1XGMA 4JQFA 1YS6A 4OIOF 3R61A 2HQNA 4JK1X 2C6YA 2MA3A 2F5FA 3K9TA 3BPXA 3ZP5A 3PFIA 1J7KA 1ZRFA 2H94A 3I4PA 3BPVA 3ZMVA 2RV8A 3ISPA 1HW1A 3J80Z 3C3WA 1TBXA 4KIBA 4KYWA 2D45A 2W84A 4HF1A 1R1VA 2K4BA 4ZZDA 3O2PE 3WTWC 3PQJA 4U0YA 3GLXA 4LLLA 4BNCA 3GFJA 2XAFA 4ENMA 2MLGA 1KYZA 4M6YA 1I6XA 2VC0A 3SZTA 3DPTA 5K5OA 1UHWA 1USTA 4LG0B 4I02A 2K02A 3FXQA 2WTEA 1F1ZA 4KN7X 2QQAA 3MCZA 1RNLA 1MGTA 4L5IA 4JBAA 3CTAA 3MFKA 1W4MA 2V1XA 4HQMA 2MC3A 2OQRA 1FP2A 2FRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQ2 A;  4FX0 A;  1T0F A;  3L2C A;  1F5T A;  1YYV A;  3F8F A;  4HYE A;  3GO5 A;  1WKM A;  3TOA A;  5LGT A;  1JXS A;  2YSR A;  4GCV A;  3H92 A;  1SFX A;  1XMA A;  2FEZ A;  1R1U A;  2VOP A;  2QBY A;  4EM0 B;  1YS7 A;  1G3T A;  2QQ9 A;  2GA2 A;  1S3J A;  2ZBK A;  1T39 A;  1DUX C;  1T2K A;  3QP5 A;  2DLL A;  1BI1 A;  1I5Z A;  2OZ6 A;  3ZMD A;  5ILU A;  2H6C A;  1CF7 B;  2FF4 A;  3ZN1 A;  2WWY A;  1KGS A;  1QZZ A;  1FLI A;  1QGP A;  2CQK A;  1SMY F;  3G3Z A;  2ISY A;  3V8K A;  2PI0 A;  3J7A O;  3L00 A;  2ZME A;  1YW7 A;  4IVN A;  3BRO A;  1FYM A;  1HKT A;  3J81 Z;  3G73 A;  2VT3 A;  3WTX C;  2CWE A;  3C1D A;  5DCM B;  1MKM A;  1BBY A;  3Q9V A;  5TRD A;  1U3E M;  1P2F A;  3EUH A;  6PAX A;  1IF1 A;  3TOB A;  3E5X A;  5HLG A;  3LAP A;  1BJA A;  3V7R A;  4OOI A;  2ZNZ A;  3T5X A;  1FBQ A;  3R0A A;  2L54 A;  1ZGJ A;  4CDG A;  1HKQ A;  5FB2 A;  4M9Z A;  4HOB A;  3ROU A;  2Y48 A;  4UXN A;  4IRG A;  1OR7 A;  3B73 A;  4XRF A;  3R0J A;  1P4A A;  3F22 A;  5ICC A;  4A12 A;  1UHM A;  4WK8 F;  1X3U A;  4UHT A;  4RAZ A;  1TNT A;  2IP2 A;  2H09 A;  2DK8 A;  3GXO A;  1FC3 A;  3ABT A;  5LHG A;  2XAH A;  4U0W A;  2EJR A;  3TGN A;  4EGZ A;  5LBQ A;  4WCG A;  3U1D A;  4ETS A;  4D0P A;  2VXZ A;  1FBU A;  1IXC A;  1XDU A;  3GW2 A;  4UVA A;  3WTZ A;  5J6X A;  3JSP A;  1O3R A;  4BH9 A;  4HV5 A;  3RKY A;  1G3S A;  1W5T A;  2GAU A;  2KRF A;  4P55 A;  1G4D A;  3EQL F;  1IN7 A;  4R79 A;  1IRF A;  5KK1 A;  3AAF A;  1S8N A;  2FMY A;  2F5C A;  4UVB A;  5IT9 Z;  1I27 A;  3ABU A;  3I71 A;  3DEU A;  1TTY A;  1ZG1 A;  2QM3 A;  1KU7 A;  4UNO A;  4ZZL A;  2VON A;  2CSO A;  1P4W A;  1BM9 A;  3KP7 A;  3LQR A;  3IKT A;  5L3G A;  4KIF A;  4HAM A;  2A3S A;  4O5V A;  1KYW A;  4HQE A;  3R60 A;  1J5Y A;  1GHC A;  3K69 A;  4FT8 A;  1FP1 D;  2XKP A;  4KIC A;  4AIJ A;  2WC2 A;  3L09 A;  1B9M A;  3T0Y A;  2FBH A;  2IRF G;  4ASN A;  1YO5 C;  1D3Y A;  2P5K A;  1ZLK A;  2EK5 A;  4MTD A;  5HS8 A;  5L3C A;  5H6R A;  1ON2 A;  1YQA A;  4EJT A;  1T38 A;  2FNA A;  2LDU A;  1P92 A;  2RGV A;  3IWZ A;  3N4M A;  4UV8 A;  3E97 A;  3RI4 A;  4G7Z F;  3KET A;  3I59 B;  3J81 K;  2RC4 A;  2DQR A;  1F4K A;  1K6O A;  3KZY A;  3JW4 A;  3TDU C;  4DNC A;  1QZY A;  2TDX A;  3HRU A;  2ESH A;  3HSE A;  1BI2 A;  4KFC A;  4LMY A;  2BEO A;  2NNN A;  2V9V A;  3IHU A;  3GFM A;  4ENK A;  3HTU A;  2K7L A;  1OYI A;  1O3S A;  3U2R A;  4A5N A;  3GZ5 A;  3QPH A;  5LGU A;  4M72 A;  4HX4 A;  3GFL A;  3TDZ C;  2Y0M A;  4BHB A;  3CUQ A;  5LRS A;  3VB2 A;  3WU1 B;  3MQ0 A;  5ED4 A;  3SFZ A;  2VE8 A;  3FM5 A;  5DYM A;  5K5R A;  1ZYR F;  1TNS A;  5DDG A;  5J8F A;  1STZ A;  5DD4 A;  2FU4 A;  5E1X A;  4S05 A;  2RVC A;  2DW4 A;  2HYF A;  3QOP A;  1LDK B;  5D5U B;  2ISZ A;  3MEX A;  2DK5 A;  1U2W A;  1FNN A;  5BPD A;  2F5D A;  1W7P A;  2LF8 A;  3HSR A;  5HOO A;  3P7N A;  2R7D A;  4R1H A;  2NS0 A;  2FSW A;  1KQ0 A;  5HLI A;  4MGR A;  3SHF A;  3GFI A;  3NRV A;  5FFX A;  4WXC A;  2VC1 A;  1FSE A;  4A6D A;  3JTG A;  4HX7 A;  4I01 A;  4ZH4 F;  4NHJ A;  4MEX F;  4KUM A;  4LK1 F;  3DKW A;  4IJA A;  1QPM A;  1YLF A;  2DAO A;  1IW7 F;  3E5U A;  2H27 A;  3TO7 A;  3RTR A;  3P9C A;  5DUK A;  1LVA A;  5A2Q K;  2OQG A;  1J75 A;  1O3Q A;  1R22 A;  1BIA A;  3I5U A;  2A61 A;  4HV6 A;  1ZN2 A;  4A0Z A;  1S6L A;  4G9Y A;  1O3T A;  1ONV A;  2AS5 F;  1SD6 A;  2P5V A;  1LB2 A;  2GA1 A;  2FBK A;  4OIP F;  4EMS A;  2M8E A;  3BWG A;  3ERE D;  2LSO A;  2DT5 A;  3KZZ A;  5E18 F;  3BY6 A;  1MJB A;  2PEX A;  3HHG A;  1G6N A;  5HDK A;  3T1B A;  2O0Y A;  1FSH A;  1Z9C A;  2BYV E;  4XSX F;  2X4H A;  3W6J B;  3HUG A;  4HF0 A;  1BIB A;  4N9I A;  5D5V B;  2HTS A;  3RKX A;  4E70 A;  2FBI A;  5ERI A;  4KIG A;  3V8L A;  3HSF A;  2ZO4 A;  1EH6 A;  5K1Y A;  1MZB A;  3FWE A;  2PMH A;  2EB7 A;  4WX9 A;  1AWC A;  4GYI A;  4N0B A;  1B4A A;  1J2X A;  5F1R A;  2K4J A;  2PBI A;  3TO6 A;  1KQ8 A;  2ZJ2 A;  4A6E A;  4MTE A;  2K86 A;  2BE5 F;  1YW8 A;  1ZRE A;  3OOP A;  3H3Z A;  4YFN F;  2PMU A;  1FY7 A;  2EFO A;  2EFP A;  1XGS A;  1K79 A;  1FX7 A;  5BMZ A;  4HLY A;  5D4S A;  1ZH5 A;  3T8T A;  4WXD A;  2VBY A;  3BJA A;  1K78 B;  2Z3Y A;  1EH7 A;  3DFG A;  2EWN A;  4LD5 A;  3HTS B;  1HQC A;  2D1V A;  3NQO A;  2KKO A;  5BOX A;  3BOQ A;  4CYD A;  1U5T A;  3F8B A;  3O3K A;  3CO6 C;  1OMI A;  2OD5 A;  1R5H A;  3FZV A;  1YFH A;  2L4A A;  4RAY A;  5LLQ A;  2DTR A;  1WI9 A;  4GGG A;  1YTY A;  4BYY A;  1R7J A;  2FNP A;  2ZCW A;  1UFM A;  1ZG3 A;  3MWM A;  5JFR A;  4P9F A;  3CDH A;  5FLX K;  2DU9 A;  1YIO A;  2G9W A;  4A0X A;  3TQN A;  2A68 F;  1XB4 A;  3F6O A;  1IN5 A;  4BAY A;  4RGS A;  2VOO A;  1RUN A;  4P9U A;  2EA2 A;  2VOD A;  1MDM A;  2CW0 F;  2A69 F;  1SAX A;  1P4X A;  4YFX F;  4GYG A;  2M87 A;  4HA8 A;  3JTH A;  1L3L A;  2UXN A;  1DP7 P;  1RI7 A;  3EDP A;  3FXU A;  3LA2 A;  4CXF A;  3JAM K;  1BI0 A;  1IXR C;  5LHH A;  3CLO A;  3C18 A;  1K7A A;  1IN4 A;  3LA7 A;  1XD7 A;  2IJL A;  5E1W A;  3KE2 A;  1OKR A;  2P7C B;  1U6G A;  2DPD A;  4O6J A;  3DXJ F;  2NRA C;  5AIQ A;  3GEZ A;  3DV8 A;  1LEB A;  2O3F A;  2HGC A;  1DPR A;  5D8K B;  4IRH A;  1W5S A;  4L0Z B;  4Q5S F;  3I53 A;  3ZQ7 A;  3RPU A;  4ESJ A;  4EV0 A;  2VE9 A;  1XDS A;  4RS8 A;  3NEU A;  5CVJ A;  2E1C A;  3CUQ C;  3M7G A;  5BS6 A;  1J59 A;  2UXX A;  1QO0 D;  1D8K A;  4LB6 B;  3M8E A;  3RJP A;  4N9H A;  1HSJ A;  4AIH A;  2EFN A;  4LG0 A;  2FML A;  2GIV A;  2F2E A;  3IRR A;  3U9G A;  2VBW A;  5E8G A;  3WG9 A;  2XGX A;  4PGG A;  4LLG F;  4FX4 A;  2HKX A;  2ETH A;  3LST A;  2YPR A;  4ESF A;  5D4R A;  3ULQ B;  4BHC A;  4WXH A;  4AVP A;  3QRF F;  5ICE A;  4U88 A;  3GZ6 A;  4LJZ F;  2GQQ A;  1XMK A;  3WTY C;  4A0Y A;  4HLX A;  1S29 A;  1WQ2 A;  1HBX G;  2YX4 A;  1ZHF A;  5AIP A;  1IN6 A;  4IRI A;  2OZU A;  1L0O C;  2LNB A;  3B02 A;  1FPQ A;  5CVR A;  3F6V A;  1OYY A;  2D2W A;  5HS7 A;  4NQW A;  3RKW A;  4CO8 A;  1H9T A;  3GX4 X;  1XCB A;  5LEK A;  3F23 A;  4YIF A;  5FGM A;  3HOT A;  1ZLJ A;  2NYX A;  4OU0 A;  4EJW A;  5DUI A;  3WOD F;  3VFZ A;  2FQ3 A;  5A2Q Z;  2VBX A;  3GF2 A;  2ACJ A;  5DCF A;  5L3E A;  2HFH A;  3DF8 A;  2E7W A;  1MJA A;  3O6B B;  1UCR A;  3P9I A;  3OV8 A;  1HW5 A;  1CF7 A;  4L9N A;  3M9A A;  4HX8 A;  4YG2 F;  2QZ8 A;  2KIF A;  5CVV A;  1LQ1 A;  1OPC A;  1IRG A;  1GVJ A;  1ZAO A;  3FHZ A;  4P96 A;  4M74 A;  3CO7 C;  3E6D A;  1ZAR A;  1CGP A;  4MEY F;  2IPQ X;  1XSD A;  5CVI A;  3ECO A;  1VTN C;  5DCM A;  2EV6 A;  1Z05 A;  2ESN A;  1FZP B;  3CJN A;  2J5P A;  2FOK A;  5EEG A;  1DDN A;  4UVC A;  4EJV A;  1RIO H;  1HST A;  2JZY A;  2P5L C;  2IW5 A;  1TW2 A;  3RYP A;  2EV0 A;  3IKV A;  4L5J A;  3WU0 A;  5JR3 A;  1TQP A;  4L0Y B;  1HXD A;  3ECH A;  1B6A A;  4PCQ A;  4BXU A;  3FMR A;  2KIM A;  4PZJ A;  3WTT C;  2V1U A;  2BGC A;  2Q0O A;  3R6S A;  4L9J A;  1J0R A;  3QP6 A;  1IN8 A;  2CFX A;  2G7H A;  2W57 A;  5ICF A;  1RZ4 A;  4OIN F;  2CG4 A;  2V1D A;  2M5W A;  2Z99 A;  1R23 A;  3HRM A;  4M6X A;  4YFK F;  2M30 A;  3V7C A;  1DPU A;  4L9V A;  2FXA A;  2X0L A;  3R4K A;  2Z5U A;  4ON0 A;  4G7H F;  4MHG A;  3GVA A;  1RUO A;  2IA1 A;  3LA3 A;  2EA4 A;  4I0A A;  4KT5 C;  1ZRC A;  3LAJ A;  2HWV A;  4CIC A;  3E5Q A;  1QBJ A;  3RDI A;  3L9F A;  2VT2 A;  2F5E A;  2QUF A;  1H0M A;  1JHF A;  4EJU A;  5ICG A;  4R8H A;  4B8X A;  3ZMZ A;  5JVT A;  4QLC U;  5KVR A;  1SD4 A;  1OYW A;  2NAZ A;  2KIU A;  3V7S A;  5FFZ A;  4OIR F;  2HKO A;  2QVO A;  4Y13 A;  2R3S A;  4HDU A;  3ZPL A;  1D5V A;  4GO1 A;  2OAZ A;  4LLN A;  3QU3 A;  3FM3 A;  1Z6R A;  1KQ9 A;  5FLX Z;  2P6S A;  4IHT A;  2B0L A;  4Y17 A;  3K1N A;  2A07 F;  3QPT A;  2GXG A;  4LK0 F;  1IUY A;  2QBY B;  3MAJ A;  5LHI A;  2A6E F;  1B59 A;  4M9S A;  1J9I A;  1JHH A;  5CJ9 A;  1TLH B;  5HLH A;  4CZZ A;  3VOD A;  3P9K A;  5TJJ A;  3S2W A;  3KP2 A;  2NNY A;  1LDD A;  5DEQ A;  5D6F A;  4AD9 A;  3M8F A;  3JAM Z;  3LQQ A;  3K2Z A;  2UWM A;  2M45 A;  1E2X A;  1FBS A;  4M9X A;  1PP8 F;  1ZGA A;  2G7U A;  2CGP A;  2E7X A;  4XSZ F;  2HS5 A;  2ZFW A;  2O03 A;  3EYY A;  2ZME B;  4RGU A;  3QAH A;  2BBY A;  4I98 B;  2OBP A;  2Q8K A;  3I59 A;  2L01 A;  5H20 A;  3K1P A;  4HBL A;  3GYH X;  1WRJ A;  1B9N A;  1SFU A;  2A6H F;  3ZN0 A;  3RPQ A;  5E8I A;  1WSU A;  1R00 A;  4IF4 A;  2QQB A;  2WV0 A;  2XAQ A;  2E1N A;  4Y15 A;  3I0T A;  2EFQ A;  4RGX A;  1YW9 A;  2PN6 A;  2XAG A;  2P7V B;  2H6B A;  3HYI A;  3RYR A;  1FOK A;  4Z2Y A;  3MZH A;  2Q2E A;  4ZYH A;  2HOE A;  1GXP A;  2V79 A;  4Q47 A;  1XSV A;  2PJP A;  4XLP F;  1KA8 A;  2EV5 A;  2HQR A;  3L7W A;  3WE2 A;  5CYV A;  3ZMU A;  2JT1 A;  5D8L B;  2L02 A;  4U7D A;  1MJ9 A;  1HW2 A;  1F9N A;  4U0V A;  4HW0 A;  4P5O A;  3D5L A;  4EGY A;  1KU2 A;  3WE3 A;  3PQK A;  2XRO A;  1EH8 A;  2KJB A;  2ZKZ A;  2W85 A;  2A5Y B;  1TQM A;  4CHU A;  2DFI A;  2D1H A;  3IL2 A;  2YR2 A;  1BI3 A;  2IT0 A;  4AWX B;  4BHP A;  3WGI A;  3FMS A;  2Z33 A;  1FT9 A;  3RIR A;  5L3B A;  2W25 A;  4F7Z A;  5HVQ C;  2M1B A;  4AIK A;  4LB5 A;  2QLZ A;  2J5O A;  2AXL A;  1SD5 A;  4G6D A;  1FYL A;  4ZYE A;  4KMU X;  1U8R A;  3K0L A;  1G3W A;  2QWW A;  2UZK A;  2JSC A;  1I1S A;  2Y75 A;  3F8M A;  2P6T A;  2MBF A;  4IHS A;  2RNJ A;  2HR3 A;  5E17 F;  3FX3 A;  2DQL A;  5HDG A;  2VBZ A;  4ESB A;  4RB3 C;  2HYG D;  3WGG A;  4I7H A;  4UUV A;  3F72 A;  5K5Q A;  3BP8 A;  5ILV A;  1T6S A;  3BZ6 A;  4OMY A;  4MQV A;  2COM A;  3DPL C;  4O3M A;  1PUE E;  3GUD A;  1FYK A;  5LEJ A;  4S04 A;  1IZ1 A;  4M73 A;  1Y0U A;  3SXY A;  3KP3 A;  2V6C A;  2DPU A;  3WGH A;  4MNU A;  3WTU C;  5E1Z B;  4PGH A;  1R1T A;  1BN5 A;  3F8N A;  1I1G A;  2LF7 A;  3Q9S A;  4FHT A;  5FO5 A;  5E20 A;  1LNW A;  3T8R A;  4IPA A;  1PP7 U;  2STW A;  2XVC A;  1IXS B;  1XGO A;  4TV7 A;  4NB5 A;  1O7L A;  2YX7 A;  1Q1H A;  2W24 A;  1AOY A;  3LFK A;  4A5M A;  3KEQ A;  5D5W B;  2JPC A;  2IA2 A;  4KMF A;  4ENN A;  4LGW A;  2ZXJ A;  1TW3 A;  2HZT A;  1SD7 A;  4IXA A;  4CGZ A;  1LJ9 A;  3CUO A;  2CO5 A;  5AON A;  5HS9 A;  3KEO A;  3HHH A;  2RKH A;  2RDP A;  5FD5 A;  4YII A;  2XRN A;  4ZYG A;  4A2U A;  4EJO A;  1HKS A;  3VEP A;  3WTV C;  2DO7 A;  3J80 K;  1XGN A;  2HTJ A;  3REO A;  3K1M A;  3CUQ B;  1B1B A;  3HOS A;  3GWZ A;  2VN2 A;  3TKY A;  3Q5F A;  3N97 A;  3IWF A;  1XSX A;  2PG4 A;  2YU3 A;  1BC7 C;  4OIQ F;  4EQQ A;  3BJO A;  5JI6 A;  5ILS A;  4OMZ A;  4MQ9 F;  4Q48 A;  3E6C C;  2EFW A;  1K78 A;  3KFW X;  4M71 A;  4EVI A;  3EET A;  3KCC A;  2GXB A;  1NHA A;  3BJ6 A;  4B09 A;  1MD0 A;  3EYI A;  3E3V A;  1Z7U A;  4XLN F;  3ZMT A;  2QYO A;  5CVU A;  1SMT A;  1W7P B;  2P8T A;  3V4G A;  1T98 A;  3QU6 A;  3IC7 A;  1W7P D;  2FE3 A;  2K27 A;  4L18 B;  1H9G A;  4K2E A;  3FF5 A;  3F21 A;  1ON1 A;  3DP7 A;  2ELH A;  5BQT A;  1R36 A;  3JSO A;  1O57 A;  1XCV A;  4G94 A;  1ULY A;  3WTS C;  2OU2 A;  3C7J A;  3W6K B;  2XKO A;  3HRS A;  4U7B A;  1O7F A;  1IAW A;  2JRT A;  2RQP A;  3F8C A;  5CLS A;  5LRR A;  1WWX A;  5DV5 A;  3HIF A;  4KNY A;  1LDJ A;  4KA4 A;  1V4R A;  5H6Q A;  2JPB A;  2HDC A;  5EEH A;  5LGN A;  3IRQ A;  3E6M A;  1S7O A;  5L3F A;  1A04 A;  2RN7 A;  3TO9 A;  4RB2 C;  3KP6 A;  1Z91 A;  5D6E A;  4XBF A;  3SQN A;  3E6B A;  1FWZ A;  2DI3 A;  2L3D A;  1BC8 C;  2PFB A;  2QEN A;  1YG2 A;  2IVM A;  5JHU A;  2BV6 A;  5DD8 A;  4L9T A;  3H3U A;  3BDD A;  2STT A;  4HZF A;  3MZY A;  2XUB A;  2O61 A;  3KLN A;  4LFU A;  4I2O A;  1Z1D A;  3SZP A;  4ZYD A;  1QQI A;  5HDN A;  3KP5 A;  2O8X A;  5L3D A;  1GXQ A;  3FXR A;  1PDN C;  4KDP A;  1XN7 A;  2P4W A;  1ZRD A;  1ODD A;  2ADU A;  2GZW A;  4UV9 A;  3COA C;  1LEA A;  2MH2 A;  2O6G E;  1BOA A;  3HRT A;  2MD5 A;  1V3F A;  2XHK A;  2XIG A;  1USS A;  4I0B A;  2IA0 A;  2CYY A;  1Z6T A;  1ZG5 A;  1U5T C;  3ELK A;  2PLY A;  2Z9O A;  2KJC A;  4BQA A;  3KP4 A;  3I54 A;  1U5T B;  4HDV A;  2LKP A;  1QNT A;  4PDK A;  4QWQ A;  5FD6 A;  1S7A A;  3V8J A;  5F64 A;  2GWR A;  2L4M A;  4G6Q A;  1R58 A;  3I64 A;  4I09 A;  2MLK A;  4RB1 A;  1KU3 A;  4RGR A;  1C0W A;  4Q4Z F;  2MH9 A;  1JE8 A;  3F3X A;  5IT9 K;  1P6R A;  2FA5 A;  3KLO A;  3ML6 A;  2XV4 S;  1UB9 A;  4H0E A;  4ENJ A;  1REP C;  1E17 A;  3ZMS A;  4WF2 A;  3I58 A;  5BPI A;  3DQV C;  2JTV A;  1KU9 A;  4HF2 A;  4G7O F;  4KN4 X;  2OA4 A;  4EM2 A;  4WWC A;  2DBB A;  1TQI A;  2XAS A;  1R5G A;  1EV7 A;  5IT3 A;  1MDM B;  3D0S A;  1G3Y A;  1D8J A;  3VOE A;  3M1E A;  2XAJ A;  3LWF A;  2ZNY A;  5F6F A;  2PQ8 A;  2HEO A;  4GXO A;  1SFE A;  4RB0 A;  2R7F A;  4G8X A;  5J8C A;  4EM1 A;  1JGS A;  1U78 A;  5D5X B;  3FMQ A;  1XGM A;  4JQF A;  1YS6 A;  4OIO F;  3R61 A;  2HQN A;  4JK1 X;  2C6Y A;  2MA3 A;  2F5F A;  3K9T A;  3BPX A;  3ZP5 A;  3PFI A;  1J7K A;  1ZRF A;  2H94 A;  3I4P A;  3BPV A;  3ZMV A;  2RV8 A;  3ISP A;  1HW1 A;  3J80 Z;  3C3W A;  1TBX A;  4KIB A;  4KYW A;  2D45 A;  2W84 A;  4HF1 A;  1R1V A;  2K4B A;  4ZZD A;  3O2P E;  3WTW C;  3PQJ A;  4U0Y A;  3GLX A;  4LLL A;  4BNC A;  3GFJ A;  2XAF A;  4ENM A;  2MLG A;  1KYZ A;  4M6Y A;  1I6X A;  2VC0 A;  3SZT A;  3DPT A;  5K5O A;  1UHW A;  1UST A;  4LG0 B;  4I02 A;  2K02 A;  3FXQ A;  2WTE A;  1F1Z A;  4KN7 X;  2QQA A;  3MCZ A;  1RNL A;  1MGT A;  4L5I A;  4JBA A;  3CTA A;  3MFK A;  1W4M A;  2V1X A;  4HQM A;  2MC3 A;  2OQR A;  1FP2 A;  2FRH A; 
#chains in the Genus database with same CATH topology
 2Y0S A;  4DQ2 A;  4FX0 A;  1T0F A;  1XC5 A;  5IY5 H;  2V4J C;  3L2C A;  4PSW A;  1F5T A;  2KFD A;  1N77 A;  1YYV A;  2L7Z A;  3F8F A;  2HQA A;  4HYE A;  3GO5 A;  4M3F A;  1WKM A;  2BVL A;  2TCT A;  4A3I J;  1FOW A;  3TOA A;  5LGT A;  1AU7 A;  4A3G J;  2YSR A;  1JXS A;  2XGE A;  3HKZ N;  4GCV A;  1PVE A;  3H92 A;  2BY3 A;  4NQW B;  3BR1 A;  3GTM J;  1SFX A;  3ABM H;  1XMA A;  3HZJ A;  4FET A;  1JKQ C;  2KP6 A;  1ACI A;  1AA7 A;  3F0C A;  3CCE I;  5FRN A;  4XID A;  1R4N B;  4XKW A;  2FEZ A;  4C3H J;  2KDO A;  4DOZ A;  1R1U A;  5J4V A;  2AQF A;  2BHY A;  2ID6 A;  2QBY A;  2VOP A;  4EM0 B;  1YS7 A;  1G3T A;  2QQ9 A;  1POG A;  3JRB A;  1NK3 P;  2GA2 A;  1S3J A;  4B4C A;  4BL0 B;  5GAD J;  3LFU A;  4PJ0 C;  2ZBK A;  3LNQ A;  3EUK L;  3QYB A;  1T39 A;  1DUX C;  1SC7 A;  2ZSH B;  1D0Z A;  1T2K A;  3QP5 A;  3JRI A;  2DLL A;  1PYV A;  1D0Y A;  1BI1 A;  1I5Z A;  2DJN A;  2OZ6 A;  2R93 J;  1UZC A;  2FJ1 A;  3ZMD A;  1MIJ A;  1Z21 A;  2MGQ A;  4XLH A;  5ILU A;  2H6C A;  3HOV J;  2KZV A;  3BC8 A;  1W0T A;  1CF7 B;  2FF4 A;  2M0C A;  3ZN1 A;  2WWY A;  1KGS A;  2ZXW H;  1QZZ A;  1FLI A;  2E1M C;  1QGP A;  2DOE A;  2CQK A;  1JJ8 C;  1SMY F;  2H1L A;  2EH3 A;  1QVU A;  3G3Z A;  2ISY A;  3DBL B;  3M1C A;  3S93 A;  1I6H J;  3P5J A;  2QEX I;  3V8K A;  2XF6 A;  3W3C A;  2PI0 A;  4XON A;  3J7A O;  3L00 A;  2ZME A;  3HOZ J;  4HG2 A;  1YW7 A;  2KRH A;  5J1U A;  4IVN A;  1IJW C;  2WB1 A;  3BRO A;  1FYM A;  2Y9Y A;  1HKT A;  3J81 Z;  3W2W A;  4UUS B;  3G73 A;  2VT3 A;  3WTX C;  4E6K G;  3ABK H;  1TWF J;  2I10 A;  2CWE A;  1OCR H;  3C1D A;  1H88 C;  4G12 A;  3DU5 A;  4FIS A;  3E7L A;  2M3A A;  5DCM B;  1MKM A;  2JA5 J;  2NVT J;  2JVH A;  1BBY A;  3X2Q H;  3Q9V A;  4A3L J;  5TRD A;  3CCU I;  1U3E M;  1P2F A;  3EUH A;  3E1S A;  6PAX A;  1IF1 A;  2R92 J;  2VJI A;  3TOB A;  2IS4 A;  3ZQC A;  3JR9 A;  1QHG A;  3E5X A;  5HLG A;  3LAP A;  1BJA A;  3V7R A;  2XF5 A;  1OCO H;  4OOI A;  2HDW A;  2ZNZ A;  2JVG A;  3HC7 A;  2LBF A;  3T5X A;  1HLV A;  3OIO A;  3NWS A;  1TWG J;  1FBQ A;  1HDP A;  1G8X A;  3A0H C;  4XMY A;  5H2F C;  3R0A A;  2E2H J;  3ZCO A;  2L54 A;  1ZGJ A;  4CDG A;  3SZG A;  1HKQ A;  2XF7 A;  4HRI A;  5FB2 A;  1X58 A;  2R7O A;  4ZC3 A;  4M9Z A;  4NC8 A;  4B44 A;  2DMU A;  4HOB A;  3ROU A;  3OYN A;  3L2W A;  2HI3 A;  2Y48 A;  4UXN A;  4IRG A;  1X1C A;  1OR7 A;  3B73 A;  4XRF A;  3R0J A;  1P4A A;  1T08 B;  3F22 A;  5ICC A;  4XN0 A;  4A12 A;  4XIC A;  1UHM A;  3HKZ A;  4WK8 F;  1X3U A;  3BTC A;  4UHT A;  1TT0 A;  1BOB A;  1ZK8 A;  4RAZ A;  1TNT A;  2IP2 A;  2H09 A;  4A93 J;  2DK8 A;  2LRE A;  3PUF A;  2HVQ A;  3GXO A;  1FC3 A;  3ABT A;  3F9K A;  2DTZ A;  5LHG A;  2XAH A;  4U0W A;  2EJR A;  2LOO A;  3TGN A;  4EGZ A;  2I8D A;  1B8I A;  5LBQ A;  2W1O A;  2P81 A;  2LY1 A;  4WCG A;  3U1D A;  2B9S A;  1UG2 A;  4ETS A;  4F52 A;  4D0P A;  2VXZ A;  4PJJ A;  1FBU A;  3VWB A;  3Q0U A;  2NVX J;  1IXC A;  1XDU A;  1W1W E;  4RA2 A;  1IUF A;  3BG9 A;  3GW2 A;  2EZL A;  4UVA A;  4F3Q A;  3DTE A;  3CF5 F;  3LL7 A;  3WTZ A;  5J6X A;  3A02 A;  3JSP A;  1YRN B;  3FK7 A;  1O3R A;  2DMQ A;  3WHC A;  2K9M A;  4BH9 A;  1HA8 A;  4HV5 A;  4II3 A;  3RKY A;  1G3S A;  2HQ5 A;  3OSG A;  1W5T A;  3CES A;  4PFP A;  2GAU A;  2KRF A;  4P55 A;  1G4D A;  2ZB9 A;  1JUM A;  3G2B A;  3EQL F;  3KZI C;  1IN7 A;  3I56 I;  4NC7 A;  2K85 A;  1GT0 C;  4D1Q A;  2OJE D;  2CV0 A;  1SAN A;  1TT5 B;  4R79 A;  1MBH A;  1IRF A;  5KK1 A;  2JA8 J;  3DKX A;  3AAF A;  1S8N A;  4XLA A;  2FMY A;  2VJJ A;  2G0E A;  5CQE A;  2F5C A;  4F93 B;  5M5Y J;  4UVB A;  5IT9 Z;  4CCJ A;  1I27 A;  2MD0 A;  3ABU A;  3I71 A;  3OYF A;  3UR3 C;  1QZE A;  5FLV A;  3DEU A;  1TTY A;  3JRG A;  1ZG1 A;  2QM3 A;  1KU7 A;  3JRF A;  3IAM 2;  4UNO A;  4QSH A;  4ZZL A;  3K4N A;  2VON A;  4E7J A;  3FDY A;  3IH3 A;  4XQF A;  2CSO A;  1P4W A;  1BM9 A;  3FXO A;  4LIT A;  3KP7 A;  3LQR A;  3IKT A;  1W0U A;  5L3G A;  1TP4 A;  1X1D A;  4KIF A;  2R5Y B;  4HAM A;  2A3S A;  4O5V A;  5FKL A;  5J40 A;  2IS2 A;  1KYW A;  1SFK A;  5B66 C;  4HQE A;  3R60 A;  3C2G A;  4JOM A;  1J5Y A;  1GHC A;  3K69 A;  3KYC B;  4BE0 A;  1X1B A;  2OPT A;  5FKO A;  2LG4 A;  4C2T A;  4FT8 A;  1FP1 D;  2XKP A;  1U9N A;  1VQM I;  2GOX B;  1WVR A;  4KIC A;  2HOA A;  4AIJ A;  3PIO F;  3OY9 A;  2WC2 A;  1JUP A;  1YOV B;  1B9M A;  1ZTR A;  3L09 A;  1SEU A;  4GRI A;  4JX6 A;  3T0Y A;  2FBH A;  2IRF G;  4ASN A;  3I4M J;  1OIS A;  1YO5 C;  1D3Y A;  2P5K A;  3C2B A;  1ZLK A;  5IPA A;  2EK5 A;  3DKY A;  4MTD A;  4PJM A;  5HS8 A;  2CH0 A;  2XB5 A;  5L3C A;  2H1K A;  5IP6 A;  1JKP C;  1BL0 A;  5EG0 A;  5H6R A;  4IKF A;  2VJ5 A;  3MKL A;  1ON2 A;  1YQA A;  4EJT A;  1T38 A;  3I9V 2;  2Z1D A;  2FNA A;  3HOU J;  3CQZ J;  2M7A A;  1XPX A;  1S7E A;  2LDU A;  5GAE J;  3Q0W A;  1P92 A;  2RGV A;  3IWZ A;  3TMO A;  3N4M A;  4UV8 A;  3CP2 A;  3H5R A;  3E97 A;  3KPH A;  4HPQ A;  3RI4 A;  4BUP A;  4G7Z F;  3BG6 A;  3KET A;  3CCV I;  3I59 B;  1P7J A;  2QQ8 A;  2Z2S B;  3J81 K;  3GTG J;  2RC4 A;  2JMW A;  3OL4 A;  2DQR A;  1F4K A;  1K6O A;  3KZY A;  3JW4 A;  3TDU C;  4ZDL A;  4DNC A;  1QZY A;  2TDX A;  3OIQ A;  3TW7 A;  1MW7 A;  3MVP A;  3GBG A;  3BZK A;  3HRU A;  2ESH A;  3HSE A;  4YIR X;  1BI2 A;  3I4N J;  4OWR B;  4LG3 A;  2EZK A;  4KFC A;  3FBI B;  4D7N A;  3G4S I;  4LMY A;  3MKZ A;  1QPI A;  1IDY A;  2BEO A;  2R7V A;  2NNN A;  3OR2 C;  2V9V A;  3IHU A;  3GFM A;  4ENK A;  3HBL A;  3HTU A;  2K7L A;  1OYI A;  2M34 A;  1O3S A;  3U2R A;  4BU2 A;  3OS2 A;  4A5N A;  3GZ5 A;  3TBI A;  3QPH A;  3S3O A;  5LGU A;  4M72 A;  4HX4 A;  3B6A A;  3GFL A;  3TDZ C;  2OC6 A;  2Y0M A;  4BHB A;  2H8W A;  3CUQ A;  5LRS A;  3VB2 A;  2CQN A;  2Q2E B;  1WHU A;  2GM4 A;  4CCO A;  3MQ0 A;  3WU1 B;  2PJR B;  3S17 J;  3PO2 J;  4RAG A;  5ED4 A;  1MMG A;  3SFZ A;  2MG4 A;  1ETX A;  3FBN B;  2VE8 A;  3FM5 A;  5DYM A;  1PUF B;  4B43 A;  3CC2 I;  5K5R A;  1ZYR F;  1TNS A;  5DDG A;  5J8F A;  4BXX J;  1JTY A;  3C2H A;  3ZQH A;  1DP3 A;  1STZ A;  1I39 A;  5DD4 A;  4BJ6 C;  2HVR A;  5IOY A;  1QU3 A;  2FU4 A;  4IHV A;  5E1X A;  4S05 A;  1W5C C;  2R5Z B;  2RVC A;  2DW4 A;  2HYF A;  3QOP A;  5F27 A;  2OV7 A;  3J7Y J;  1DU6 A;  3KYD B;  1LDK B;  2WBM A;  5D5U B;  2ISZ A;  3MEX A;  2EIM H;  2EPF A;  2DK5 A;  1U2W A;  1FNN A;  2YU9 J;  2X1D A;  3GTL J;  4PSX A;  3OYD A;  5BPD A;  1AKH A;  2F5D A;  3GTQ J;  2QKL B;  2RRE A;  2E60 A;  4CCL A;  3GLL A;  3H5N A;  2R7Q A;  1W7P A;  2CRG A;  3OYK A;  2LF8 A;  2ID3 A;  3HSR A;  1FMW A;  5HOO A;  3P7N A;  2R7D A;  1WJD A;  1X19 A;  4R1H A;  1W36 D;  2L7K A;  1JUS A;  4BAC A;  1ZEL A;  2NS0 A;  1U9O A;  2FSW A;  1KQ0 A;  5HLI A;  2BVM A;  4MGR A;  3SHF A;  3DEE A;  2KL4 A;  3GFI A;  4BDY A;  3NRV A;  3VSK A;  5FFX A;  3FKI J;  2XC7 A;  2ECB A;  4WXC A;  2VC1 A;  1FSE A;  4A6D A;  3JTG A;  4HX7 A;  1S72 I;  2DCE A;  5J1Y A;  1WJB A;  3HEF A;  3EPZ A;  4I01 A;  1NK2 P;  4ZH4 F;  4NHJ A;  4MEX F;  1GVD A;  4KUM A;  4LK1 F;  1V5G A;  5TIS C;  3DKW A;  4IJA A;  1QPM A;  1YLF A;  3KX2 A;  4X1E A;  3ZXS A;  2DAO A;  5JVG F;  1IW7 F;  2V26 A;  3E5U A;  1FEX A;  3NAU A;  4N4N B;  2QGU A;  2H27 A;  2E19 A;  1WI3 A;  4XKV A;  3TO7 A;  2EIL H;  5CKT A;  3TL4 X;  3RTR A;  3P9C A;  5DUK A;  2D5V A;  2TRT A;  1LVA A;  1WJA A;  3L2R A;  2MYS A;  2OQG A;  5A2Q K;  1J75 A;  2CUZ A;  1XG1 A;  4F92 B;  1O3Q A;  4IHW A;  1R22 A;  3BG5 A;  4XLC A;  2M4K A;  2DFE A;  1BIA A;  2K9N A;  1HF0 A;  1JTX A;  3I5U A;  2A61 A;  4HV6 A;  3A01 B;  3CD6 I;  4B1R A;  3SJM A;  2VKE A;  1ZN2 A;  3ZQI A;  3ESW B;  2AQE A;  4A0Z A;  1S6L A;  4G9Y A;  1O3T A;  1ONV A;  2ZC2 A;  1ITY A;  3OR1 C;  2AS5 F;  1SD6 A;  2P5V A;  1LB2 A;  2GA1 A;  3CC4 I;  4YEJ A;  2FBK A;  2ZME C;  4OIP F;  4EMS A;  2M8E A;  4HNT A;  3BWG A;  3ERE D;  2QF7 A;  2LMD A;  2B7E A;  2LSO A;  2LK2 A;  2DT5 A;  3Q3S A;  3KZZ A;  1JT0 A;  2K3F A;  5E18 F;  2W7N A;  1MBK A;  1Y8R B;  2WAF A;  3BY6 A;  1MJB A;  3V42 A;  2L0K A;  2ICW G;  2PEX A;  2EQR A;  3HHG A;  1G6N A;  3LSM A;  1UAA A;  5HDK A;  5LFA A;  3T1B A;  1I50 J;  2W4S A;  4UY8 I;  2O0Y A;  1EJ9 A;  3K4C A;  3CME I;  1FSH A;  1Z9C A;  1VI0 A;  1YJN I;  4XNF A;  2BYV E;  4XSX F;  4ABZ A;  5KHD A;  2X4H A;  3S1Q J;  1OJL A;  3EUH C;  2E5Z A;  4XL9 A;  3ZQQ A;  3W6J B;  3HUG A;  4HF0 A;  1BIB A;  2DMN A;  4N9I A;  4BGD A;  5JLW A;  4OAY A;  5D5V B;  3PNY A;  5EZH A;  2HTS A;  3RKX A;  4E70 A;  2FBI A;  5ERI A;  4KIG A;  1IGN A;  1LE8 B;  2O5R A;  2LKX A;  3K4M A;  3V8L A;  3ABL H;  1OCT C;  3HSF A;  2ZO4 A;  1EH6 A;  2CUF A;  2DMT A;  4Y3O A;  5EDN A;  5K1Y A;  4Y4R A;  4YEL A;  1MZB A;  3FWE A;  2PMH A;  4CYC B;  2EB7 A;  3S1N J;  1Z3X A;  4WX9 A;  1AWC A;  4GYI A;  4N0B A;  2BHZ A;  4J01 A;  3CJQ B;  2HXO A;  1B4A A;  1J2X A;  5F1R A;  1OCP A;  1OR7 C;  2EIN H;  4E7I A;  3S3N A;  2K4J A;  2PBI A;  1Y1V J;  1ZKG A;  3K4J A;  2Y30 A;  3TO6 A;  3K70 C;  1N78 A;  1KQ8 A;  1YX3 A;  2ZJ2 A;  4A6E A;  4MTE A;  2WB1 N;  3BR2 A;  2K86 A;  2BE5 F;  1YW8 A;  2DFH A;  2K3P A;  3CCS I;  1ZRE A;  4AID A;  3OOP A;  2KIS A;  3H3Z A;  1Z67 A;  4YFN F;  2PMU A;  1FY7 A;  2EFO A;  3HB9 A;  5GPC A;  2EFP A;  4PFO A;  5EGO A;  1FIP A;  1XGS A;  2OCC H;  2YUS A;  1IDZ A;  1K79 A;  2ME6 A;  1AHD P;  3AL0 B;  1FX7 A;  5BMZ A;  2KT0 A;  5D4S A;  4HLY A;  3OWT A;  2E2I J;  2L9S A;  3CMM A;  1ZH5 A;  3T8T A;  4WXD A;  2VBY A;  4IOC F;  2X9D A;  3BJA A;  1R49 A;  4XKC A;  1ERD A;  1K78 B;  4MIM A;  5GTI C;  2Z3Y A;  1EH7 A;  2VPL A;  4BEH B;  3DFG A;  1IRX A;  2DYR H;  2EWN A;  2XB0 X;  4LD5 A;  3S8P A;  1VQK I;  1F43 A;  4NNJ A;  5FKN A;  4ZDP A;  3HTS B;  1HQC A;  2D1V A;  1ZR2 A;  3NQO A;  2VKV A;  5K7F A;  1UEL B;  4W97 A;  2HYJ A;  4FE4 A;  2KKO A;  3FXM A;  2R0Q C;  1BW5 A;  5BOX A;  3BOQ A;  5JLX A;  4UB8 C;  4CYD A;  3I3L A;  1U5T A;  3F8B A;  2CW8 A;  1IG7 A;  2ZFU A;  3O3K A;  3CO6 C;  1H89 C;  1FTZ A;  1OMI A;  2OD5 A;  1R5H A;  3FZV A;  3GME A;  1YFH A;  2JA6 J;  2L4A A;  4RAY A;  5IOZ A;  4XR6 A;  1MSF C;  5LLQ A;  2DTR A;  3MMY B;  1WI9 A;  4GGG A;  4CSW A;  3CLQ A;  3W6V A;  1YTY A;  2LH9 A;  5KAF C;  1O4X A;  1ZQ3 P;  4BYY A;  2AHQ A;  1R7J A;  1K6Y A;  2FNP A;  3PM1 A;  3RZO J;  2K9L A;  4KIT B;  3IP4 B;  2ZCW A;  4RM3 A;  2GOM A;  1UFM A;  3WU2 C;  5B1A H;  1X1P A;  3CCJ I;  2DN0 A;  4BE2 A;  1ZG3 A;  2VKH A;  3MWM A;  5JFR A;  2EIJ H;  3CCQ I;  4Y7N J;  1QA6 A;  2MW8 A;  4P9F A;  1D1B A;  1SVO A;  3CDH A;  5FLX K;  3CCY A;  2DU9 A;  1YIO A;  2G9W A;  4A0X A;  2LC2 A;  3CCR I;  3TQN A;  4HNU A;  2A68 F;  1XB4 A;  2DA4 A;  1IN5 A;  3F6O A;  2X1C A;  4BAY A;  1LFB A;  5E3N A;  2A5W A;  4RGS A;  1RUN A;  2VOO A;  4P9U A;  1ETW A;  2EA2 A;  1SFO J;  5LD2 C;  1FOY A;  3LOC A;  2XPU A;  2VOD A;  1MDM A;  2CW0 F;  2A69 F;  2KRC A;  3H35 A;  1SAX A;  1B72 A;  1P4X A;  4YFX F;  4GYG A;  2M87 A;  1VQ6 I;  3OL3 A;  4HA8 A;  2E36 A;  3JTH A;  1VQN I;  1L3L A;  3AG3 H;  3BG3 A;  2UXN A;  1DP7 P;  2E1M B;  1RI7 A;  2NVU B;  3BTJ A;  2LRD A;  3OYI A;  3EDP A;  3FXU A;  3LA2 A;  5F04 A;  4CXF A;  1ZR4 A;  1P7I A;  3JAM K;  3CDI A;  4RBO A;  1BI0 A;  3CDL A;  2DOA A;  1IXR C;  1J09 A;  5LHH A;  1MNE A;  3CLO A;  3C18 A;  1K7A A;  1IN4 A;  3LA7 A;  5TGT A;  2LVS A;  1MMD A;  1XD7 A;  5FKM A;  2IJL A;  5E1W A;  5IP9 J;  3KE2 A;  1OKR A;  2P7C B;  2DT6 A;  2BW3 B;  1U6G A;  4PJN A;  2DPD A;  4O6J A;  3CJT B;  3DXJ F;  2NRA C;  3H9J A;  4AVZ A;  5AIQ A;  3GEZ A;  3AG1 H;  1E3O C;  2XGC A;  2EIK H;  1Y0N A;  3DV8 A;  1CQT A;  1LEB A;  2O3F A;  1LFU P;  2HGC A;  1FOX A;  1DPR A;  5D8K B;  4IRH A;  1W5S A;  4L0Z B;  1APL C;  4Q5S F;  2DA6 A;  4QTR A;  3I53 A;  1HOM A;  4RAF A;  2VIX A;  2VQC A;  3ZQ7 A;  3RPU A;  4ESJ A;  4EV0 A;  2VE9 A;  1XDS A;  4RS8 A;  3BR6 A;  1IO2 A;  3NEU A;  5CVJ A;  3ERM A;  3AFH A;  2E1C A;  3CUQ C;  4AYB A;  2NOJ B;  3M7G A;  5BS6 A;  3RZD J;  1A31 A;  3CF2 A;  5FRM A;  5J1R A;  3L2V A;  1J59 A;  1UHS A;  2UXX A;  1QO0 D;  1D8K A;  2WV1 A;  4LB6 B;  5C44 J;  2M2E A;  2R7S A;  2HOS A;  1V55 H;  3M8E A;  2CMP A;  3K4L A;  3A2K A;  3RJP A;  1Y39 A;  4N9H A;  1HSJ A;  4AIH A;  2EFN A;  2FQ4 A;  4LG0 A;  2FML A;  3BT9 A;  2GIV A;  2LYC A;  3E0J B;  4FE7 A;  1FJL A;  2DA1 A;  2LR8 A;  2F2E A;  2VLA A;  3ZOB A;  3IRR A;  3U9G A;  2VBW A;  5E8G A;  4F91 B;  4YRV A;  3WG9 A;  2XGX A;  4PGG A;  2E34 A;  5J47 A;  4LLG F;  3CCM I;  1MBG A;  2HKX A;  4JX4 A;  4FX4 A;  2ETH A;  3LST A;  2QSF X;  1JJ6 C;  2YPR A;  4ESF A;  1Y8Q B;  3SFI A;  1WH5 A;  3ULQ B;  5D4R A;  4BHC A;  4WXH A;  2X85 A;  4AVP A;  3HJE A;  1QVT A;  3QRF F;  4IL6 C;  4FTH A;  5ICE A;  2X48 A;  2VUM J;  5IYC J;  3L1P A;  3PUB A;  4U88 A;  2HNH A;  2LD5 A;  3JRE A;  3S15 J;  5M3F J;  4CZC A;  5IYD J;  3GZ6 A;  4LJZ F;  1YE9 A;  2GQQ A;  2KZG A;  1XMK A;  2DA7 A;  3WTY C;  2BY0 A;  2IAI A;  4A0Y A;  4HLX A;  3KEY A;  1S29 A;  1WQ2 A;  4XK4 A;  1HBX G;  2ZSI B;  1WCM J;  1ZGW A;  2YX4 A;  3J7Z I;  1ZHF A;  3BG7 A;  2X6O A;  5AIP A;  2VKD A;  2JUC A;  3ZR8 X;  4GFB A;  4IX7 A;  1IN6 A;  4IRI A;  2OZU A;  1L0O C;  2LNB A;  3B02 A;  1FPQ A;  3K4K A;  1FTT A;  5CVR A;  3F6V A;  1OYY A;  2D2W A;  5HS7 A;  4NQW A;  2ELK A;  3RKW A;  1MH4 A;  4CO8 A;  1IV6 A;  1H9T A;  3D5S C;  3GX4 X;  1XCB A;  2MFZ A;  5LEK A;  2FX0 A;  3F23 A;  4YIF A;  5FGM A;  4E7H A;  2I5U A;  2K40 A;  3HOT A;  1ZLJ A;  2NYX A;  4PK4 A;  2HOT A;  3OSF A;  4OU0 A;  4QIW N;  4EJW A;  2FUG 2;  5DUI A;  3WOD F;  3VFZ A;  3BQY A;  2WA0 A;  2FQ3 A;  1MMA A;  2DA5 A;  5A2Q Z;  2VBX A;  3GF2 A;  5DM6 F;  4BBS J;  2LY2 A;  1RES A;  4W1U A;  2ACJ A;  5DCF A;  2N8G A;  3UNG C;  4IHX A;  5L3E A;  2MC4 A;  2HFH A;  3DF8 A;  4XRS G;  2E7W A;  1F36 A;  1MJA A;  3O6B B;  2CW7 A;  1UCR A;  1D5Y A;  1WJE A;  3P9I A;  3DEW A;  3OV8 A;  1Z3Y A;  1EA3 A;  1HW5 A;  3AG2 H;  3G71 I;  3QPL A;  3S14 J;  4J19 A;  1YIT I;  1CF7 A;  4PUS A;  4L9N A;  1G2H A;  3M9A A;  2JA2 A;  4HX8 A;  4YG2 F;  2JK3 A;  2QZ8 A;  2KIF A;  5CVV A;  5GPA A;  4IO9 F;  1LQ1 A;  1OPC A;  1IRG A;  4KJZ A;  1GVJ A;  1ZAO A;  3FHZ A;  4BJT A;  3PNT A;  4P96 A;  4M74 A;  3CO7 C;  3E6D A;  1ZAR A;  2ZXH A;  4AM3 A;  4UUS A;  1A35 A;  4DBR A;  1CGP A;  1MBE A;  3VYT B;  3HPH A;  4MEY F;  2IPQ X;  1GDT A;  1XSD A;  5CVI A;  3ECO A;  1VTN C;  1VQ9 I;  2CQX A;  2EV6 A;  5DCM A;  3VYU B;  1Z05 A;  2V1N A;  3OYL A;  2ESN A;  2R7T A;  1FZP B;  1NG7 A;  3CJN A;  2J5P A;  2FOK A;  5EEG A;  1DDN A;  4UVC A;  2VPR A;  4EJV A;  1RIO H;  1HST A;  2JZY A;  2P5L C;  2IW5 A;  4C9Y A;  1BR4 A;  1TW2 A;  1MND A;  3RYP A;  2EV0 A;  4B48 A;  2XDV A;  3IKV A;  1ETQ A;  4L5J A;  3WU0 A;  2VQL A;  1TQP A;  5JR3 A;  3LSI A;  4L0Y B;  4IEJ A;  1MMN A;  1HXD A;  2OF7 A;  3ECH A;  1MSE C;  1B6A A;  4PCQ A;  4BXU A;  5C3E J;  3FMR A;  1X2N A;  2KIM A;  4PZJ A;  4IHY A;  3WTT C;  1DQU A;  4A3K J;  2WY7 Q;  3ASO H;  2V1U A;  2Y69 H;  4JX5 A;  3DLL F;  2K9Q A;  1VQL I;  2BGC A;  2PX9 A;  2Q0O A;  3R6S A;  2Y9Z A;  4L9J A;  4FCY A;  1J0R A;  3BCA A;  3QP6 A;  3AG4 H;  1RET A;  1IN8 A;  2CFX A;  3S3M A;  2G7H A;  2W57 A;  5ICF A;  1RZ4 A;  4OIN F;  2OCE A;  4RMN A;  2CG4 A;  2V1D A;  3HGY A;  4LIV A;  2M5W A;  2Z99 A;  1R23 A;  3HRM A;  4M6X A;  4YFK F;  2M30 A;  2X1E A;  3V7C A;  1DPU A;  2JA7 J;  4CH7 A;  4L9V A;  2FXA A;  1VF9 A;  2X0L A;  3WHB A;  5BNG A;  2JWT A;  2IGO A;  5B1B H;  3R4K A;  2Z5U A;  4XLF A;  4ON0 A;  4G7H F;  4MHG A;  1DGW Y;  3GVA A;  1RUO A;  2KLO A;  2IA1 A;  2VQH A;  3LA3 A;  3S1M J;  2EA4 A;  1JKR C;  4I0A A;  4KT5 C;  2O8K A;  1RPW A;  1KON A;  1ZRC A;  3LAJ A;  3DU6 A;  2HWV A;  3VSL A;  4DGW B;  1YI2 I;  4CIC A;  3E5Q A;  1XTA A;  2A05 A;  5M5W J;  1QBJ A;  2X6W A;  1YRN A;  3RDI A;  3L9F A;  3BR5 A;  1VQ7 I;  1ETO A;  1SVL A;  2VT2 A;  3QOE A;  4ZTJ A;  3CC7 I;  4OAZ A;  3HGG A;  3ZGK A;  2F5E A;  4DZP A;  2QUF A;  3NAR A;  3BZC A;  1H0M A;  4C3J J;  1JHF A;  4EJU A;  5FJ8 J;  2LTP A;  5ICG A;  3S16 J;  1YHQ I;  4R8H A;  1TZL A;  4B8X A;  3ZMZ A;  5JVT A;  4QLC U;  1T0F C;  5KVR A;  1SD4 A;  1OYW A;  2NAZ A;  2KIU A;  2UUZ A;  4QPQ A;  3V7S A;  5FFZ A;  2R7W A;  2ECC A;  2AO9 A;  4OIR F;  2JSP A;  2HKO A;  2QVO A;  3A4C A;  4I76 A;  4Y13 A;  3GTK J;  4CCN A;  2QSG X;  4S0H B;  1XS9 A;  1NTC A;  2R3S A;  4BS9 A;  4HDU A;  2BY1 A;  3ZPL A;  3HOX J;  1D5V A;  4GO1 A;  4XRS A;  1MBJ A;  2OAZ A;  2JQ7 A;  4LLN A;  4RLF A;  1M1E B;  3QU3 A;  5GAH J;  3G1M A;  3W2V A;  3S1R J;  2Y31 A;  3FM3 A;  3H5A A;  1Z6R A;  3HXL A;  3ZRG A;  1KQ9 A;  3GZN B;  5FLX Z;  1K61 A;  3CMA I;  2P6S A;  2F4I A;  2B0L A;  4B3A A;  4Y17 A;  1I3Q J;  2R5Y A;  4IHT A;  3J7A Y;  3K1N A;  2A07 F;  4E4H A;  2E71 A;  2LKS A;  3LSH A;  4EEF G;  3QPT A;  3OOU A;  1OQY A;  2GXG A;  4LK0 F;  2H8R A;  1UJ8 A;  1IUY A;  2V7F A;  5GTH C;  1XX5 A;  1T95 A;  2QBY B;  3M07 A;  3MAJ A;  5LHI A;  2A6E F;  1B59 A;  4M9S A;  1J9I A;  1JHH A;  2XGD A;  5CJ9 A;  1TLH B;  3JRD A;  1Z7L A;  5HLH A;  2HPI A;  2NS7 A;  4CZZ A;  4HSR A;  3GTJ J;  3VOD A;  3P9K A;  4L5E A;  3IH2 A;  5TJJ A;  1Z77 A;  3S2W A;  3KP2 A;  2NNY A;  4A3B J;  2HDD A;  5J4Y A;  1LDD A;  3QYE A;  5DEQ A;  5D6F A;  4ZJZ A;  2DA3 A;  3Q0V A;  4AD9 A;  4IQ4 A;  3M8F A;  3K10 A;  3JAM Z;  4HNV A;  3LQQ A;  1S5L C;  3K2Z A;  1NG6 A;  9ANT A;  2UWM A;  2M45 A;  1E2X A;  3VYR B;  3OYC A;  1MMS A;  1D1C A;  1FBS A;  1Q1V A;  2Y2Z A;  3L2U A;  2V6E A;  4M9X A;  1PP8 F;  1ZGA A;  2G7U A;  4Z6Y A;  2CGP A;  3BR3 A;  2E7X A;  4XSZ F;  2CU7 A;  3LSR A;  2LY9 A;  2HS5 A;  3OIP A;  2ZFW A;  2O03 A;  3EYY A;  2ZME B;  3A03 A;  4RGU A;  3QAH A;  2BBY A;  2X6X A;  4I98 B;  3ZQF A;  2OBP A;  2Q8K A;  2OTJ I;  3I59 A;  5K7Z A;  3OYM A;  2L01 A;  5H20 A;  2CV1 A;  1Y1W J;  3K1P A;  4HBL A;  4V2F A;  1WRJ A;  3GYH X;  4A3D J;  1WJF A;  3D5R C;  1B9N A;  1SFU A;  2A6H F;  3ZN0 A;  3RPQ A;  2VQG A;  5E8I A;  1WSU A;  4KT6 A;  3DCF A;  1R00 A;  4IF4 A;  3CCL I;  2QQB A;  2WV0 A;  4X6A J;  2XPV A;  1VQ8 I;  2KQR A;  2XAQ A;  2E1N A;  5E79 C;  2XPW A;  4Y15 A;  2LBF B;  3I0T A;  2EFQ A;  4RGX A;  1YW9 A;  3FIW A;  2PN6 A;  3FXK A;  4AC0 A;  2XAG A;  1OCZ H;  2OUM A;  2P7V B;  4HST A;  2IGN A;  4ZYA A;  3WG7 H;  2H6B A;  3HYI A;  3RYR A;  3IV5 A;  4C3I J;  1FOK A;  4BQO A;  3NWT A;  4Z2Y A;  3MZH A;  3OYE A;  2Q2E A;  4ZYH A;  3PIP F;  2HOE A;  2PJR A;  4B3X A;  4BBR J;  1GXP A;  2GXA A;  2X6Y A;  1TWH J;  1PUF A;  5JHF A;  2V79 A;  4B47 A;  4Q47 A;  3G1L A;  3BTI A;  1XSV A;  3FHN A;  2PJP A;  4XLP F;  1KA8 A;  3SEQ A;  2EV5 A;  2HQR A;  3TP3 A;  3K70 D;  3DPU A;  3H9G A;  3L7W A;  3WE2 A;  1V54 H;  5CYV A;  4N4O B;  3ZMU A;  2JT1 A;  5D8L B;  2L02 A;  3LSP A;  3QYF A;  4U7D A;  4ZDO A;  1MJ9 A;  2L9N A;  2R5Z A;  3IAS 2;  4M3B A;  1HW2 A;  1D1A A;  2ELJ A;  1F9N A;  2A6T A;  4U0V A;  4HW0 A;  4E7S A;  1B8I B;  4C2M J;  1DU0 A;  3H0D A;  4P5O A;  3D5L A;  4F55 A;  1A5J A;  4EGY A;  2AXT C;  1KU2 A;  3WE3 A;  3PQK A;  3FIS A;  5FRO A;  2XRO A;  1EH8 A;  4V2G A;  2KJB A;  2KDZ A;  1VQO I;  2ZKZ A;  2W85 A;  5EYR A;  2A5Y B;  1TQM A;  1IV8 A;  3ZQG A;  4CHU A;  4BY1 J;  2DFI A;  2D1H A;  3IL2 A;  2BXZ A;  2YR2 A;  1BI3 A;  2BXY A;  3K4B A;  4A3J J;  4AWX B;  2IT0 A;  4BHP A;  3WGI A;  3FMS A;  1FT9 A;  3RIR A;  5L3B A;  2Z33 A;  1LVK A;  2W25 A;  2IEK A;  4AYB N;  5F0C A;  3DWL E;  1YIJ I;  2M4G A;  4F7Z A;  2KMU A;  5HVQ C;  2M1B A;  4AIK A;  2DOF A;  2LP0 A;  4LB5 A;  1U8B A;  2QLZ A;  2J5O A;  5C4X J;  2AXL A;  1SD5 A;  1OFC X;  4G6D A;  2E35 A;  4G6T B;  1FYL A;  3DTK A;  4ZYE A;  3OMY A;  2LLK A;  4KMU X;  1E3H A;  1U8R A;  3A0B C;  1G3W A;  3K0L A;  2QWW A;  2UZK A;  2JSC A;  1I1S A;  3BTL A;  2Y75 A;  1RKT A;  3F8M A;  4J00 A;  2M0M A;  2P6T A;  1R6R A;  2MBF A;  4IHS A;  4JP0 A;  4XN3 A;  2RNJ A;  2L2O A;  3PSI A;  2HR3 A;  5E17 F;  3FX3 A;  2DQL A;  5HDG A;  1MH3 A;  2VBZ A;  3BR0 A;  4ESB A;  4RB3 C;  1HC8 A;  2HYG D;  2DOD A;  3SEZ A;  4I7H A;  3WGG A;  3O8H A;  5HOD A;  4UUV A;  3F72 A;  5K5Q A;  3DBH B;  2QSH X;  3BP8 A;  3RSN A;  4AU7 A;  5ILV A;  2R7R A;  1T6S A;  3BZ6 A;  4MO7 A;  4OMY A;  4MQV A;  2IBD A;  4JYK A;  2COM A;  3DPL C;  3A01 A;  3U1K A;  3VPR A;  3HOY J;  2DDB A;  3OYA A;  4O3M A;  2NS8 A;  1PUE E;  3GUD A;  1FYK A;  2MSY A;  4IZZ A;  5KNL A;  1ORK A;  4X0G A;  2VB6 A;  5LEJ A;  4S04 A;  1IZ1 A;  4M73 A;  4HEA 2;  1T8I A;  1T56 A;  1Y0U A;  1YX5 A;  3SXY A;  5F0F A;  3KP3 A;  5F1J A;  1R4M B;  2V6C A;  4CCK A;  3H9Q A;  2DPU A;  5EG0 B;  3WGH A;  4BKX A;  4MNU A;  3WTU C;  5E1Z B;  4PGH A;  4D7M A;  5E3O A;  1R1T A;  1BN5 A;  2BZT A;  3F8N A;  1I1G A;  2LF7 A;  3Q9S A;  4FHT A;  1N25 A;  5FO5 A;  4H4K C;  5E20 A;  1GV5 A;  3IUO A;  1LNW A;  3CZ6 A;  2ZJR F;  5J3L A;  1TL8 A;  3T8R A;  4IPA A;  1PP7 U;  2STW A;  2ME0 A;  1A6I A;  2XVC A;  3DLA A;  2R7Z J;  1RR7 A;  1UG0 A;  4BJ5 C;  2XAU A;  1IXS B;  2JN6 A;  4M3E A;  1XGO A;  2CS3 A;  3PJR A;  1WJ5 A;  4TV7 A;  2CFO A;  4NB5 A;  2JJ7 A;  1LE8 A;  4DZJ A;  2ZXI A;  1O7L A;  3FK6 A;  2YX7 A;  2F6C A;  1Q1H A;  2GIZ A;  2W24 A;  3H0G J;  1AOY A;  3LFK A;  2VXD A;  3I55 I;  4A5M A;  2KIQ A;  3HOW J;  3KEQ A;  3RCO A;  1K4T A;  4DJA A;  5D5W B;  2JPC A;  2IA2 A;  4KMF A;  4ENN A;  1VQP I;  4C30 A;  4LGW A;  2ZXJ A;  1TW3 A;  3QWL A;  1R9T J;  2BOL A;  4CYC A;  3TP0 A;  2HZT A;  1SD7 A;  2WAE A;  3SYT A;  4IXA A;  4CGZ A;  3S2H J;  1LJ9 A;  4AUX A;  3CUO A;  1GLN A;  2CO5 A;  3CP8 A;  5CPR B;  1IRZ A;  5AON A;  4A3M J;  5HS9 A;  3KEO A;  3SDB A;  1R5I D;  3HHH A;  2RKH A;  2PMZ A;  2RDP A;  5FD5 A;  4YII A;  2XRN A;  4ZYG A;  2Z16 A;  4A2U A;  4EJO A;  1HKS A;  2HU9 A;  3VEP A;  1H8A C;  1VND A;  2DO7 A;  3WTV C;  4XOP A;  3J80 K;  1XGN A;  5HNF A;  2HTJ A;  3REO A;  3K1M A;  1MBF A;  3CUQ B;  1B1B A;  4A3C J;  4DYC A;  2M9H A;  1X3Z B;  1ETK A;  3HOS A;  1X4O A;  3GWZ A;  2VN2 A;  3PL8 A;  3TKY A;  4E7K A;  3Q5F A;  1WH7 A;  2L9R A;  3IWF A;  3N97 A;  1XSX A;  1VFC A;  2DMP A;  3BLY A;  1ETV A;  1IC8 A;  2PG4 A;  2YU3 A;  1BC7 C;  4OIQ F;  4EQQ A;  3BJO A;  5JI6 A;  5ILS A;  3DTI A;  4OMZ A;  4MQ9 F;  4Q48 A;  2XSD C;  3E6C C;  2EFW A;  3RKQ A;  1K78 A;  1HDD C;  1K83 J;  3KFW X;  4M71 A;  2NXN B;  3RQ4 A;  4EVI A;  4BEH A;  3EET A;  3KCC A;  2CQQ A;  1RRJ A;  2GXB A;  1NHA A;  1BW6 A;  3QOD A;  2RAE A;  4CA0 A;  3OYH A;  3BJ6 A;  4B09 A;  1MD0 A;  3EYI A;  1BA5 A;  2K9S A;  1V5F A;  1WGX A;  1Z7U A;  3BCB A;  1X1A A;  3E3V A;  4BY7 J;  4XLN F;  4DYR A;  3ZMT A;  1PJR A;  3QQA A;  3OYJ A;  2NVY J;  1Y6I A;  2QYO A;  1AKH B;  4M6V A;  5CVU A;  2OTL I;  1TC3 C;  4BXF A;  4C2U A;  4DW6 A;  5GP9 A;  1SMT A;  1W7P B;  2P8T A;  3V4G A;  1T98 A;  2CQ7 A;  1Z0X A;  3QU6 A;  2F48 A;  1T33 A;  2VJ4 A;  3IC7 A;  1W7P D;  2VI6 A;  2FE3 A;  3OS1 A;  2K27 A;  4L18 B;  1H9G A;  4K2E A;  3MN2 A;  3FF5 A;  3AKZ A;  3F21 A;  4A3F J;  4MFD A;  1HCR A;  4KIS A;  1EF4 A;  2HPM A;  3MKW B;  1ON1 A;  3DP7 A;  2QA4 I;  3ONQ A;  2HZD A;  2W48 A;  2IS1 A;  2ELH A;  2EZI A;  5BQT A;  2NVQ J;  2F5V A;  1FMV A;  1R36 A;  3JSO A;  1O57 A;  1XCV A;  2GBY A;  4G94 A;  5IYB J;  5M5X J;  1ULY A;  3WTS C;  2OU2 A;  2DJI A;  4A69 C;  3K2A A;  3C7J A;  1TWA J;  2V9P A;  3W6K B;  2CJJ A;  5GAG J;  2XKO A;  2FOW A;  3HRS A;  5F08 A;  3K7A J;  2JUG A;  4U7B A;  4NBQ A;  1GUU A;  1O7F A;  4IOA F;  1IAW A;  2JRT A;  5DTD A;  5HNH A;  2RQP A;  4XLE A;  4XM3 A;  2ZJP F;  3F8C A;  2O7O A;  5CLS A;  5LRR A;  5HLT A;  4MFE A;  5FLM J;  1WWX A;  5DV5 A;  3HIF A;  4KNY A;  1LDJ A;  4BE1 A;  4KA4 A;  1V4R A;  2V9K A;  2WY8 Q;  3QPS A;  5H6Q A;  1WJC A;  1WFX A;  3OS0 A;  5DM7 F;  2JPB A;  2HDC A;  5EEH A;  1G59 A;  2KPM A;  5LGN A;  3IRQ A;  3E6M A;  1S7O A;  1YJW I;  2YS9 A;  5L3F A;  4DIQ A;  2CUJ A;  5K7H A;  1A04 A;  2RN7 A;  4CCM A;  3TO9 A;  4RB2 C;  3KP6 A;  1Z91 A;  5M3M J;  5D6E A;  1OLT A;  4XBF A;  2BW3 A;  3SQN A;  3E6B A;  5F0H A;  3JCU C;  1FWZ A;  3OYG A;  5E3L A;  1YJ9 I;  2DI3 A;  1BJZ A;  2L3D A;  3HUG B;  5B5E C;  3S2D J;  1BC8 C;  2XSJ C;  2PFB A;  4UUT A;  2K5C A;  2QEN A;  2KHM A;  1YG2 A;  2IVM A;  1S9H A;  5JHU A;  2BV6 A;  2M8G X;  5DD8 A;  4L9T A;  3PO3 J;  4LIU A;  2E1O A;  3H3U A;  4IQJ A;  2QKM B;  3BDD A;  2IGK A;  2STT A;  3MD2 A;  3IH4 A;  4HZF A;  3MZY A;  2XUB A;  2O61 A;  1V5E A;  2LFB A;  3KLN A;  4II2 A;  2DXI A;  3VDX A;  4LFU A;  4I2O A;  1Z1D A;  2DT7 B;  2DFF A;  3SZP A;  4P1W A;  2IGM A;  3L2Q A;  4ZYD A;  1QQI A;  5HDN A;  2VL8 A;  1OCC H;  2DDA A;  1JKO C;  5C4J J;  4RM2 A;  1A36 A;  4ITV A;  3JRC A;  3KP5 A;  2O8X A;  5L3D A;  1BR1 A;  4ANJ A;  1GXQ A;  3FXR A;  1PDN C;  3GTP J;  3HPG A;  1KZH A;  5EGO B;  1EKE A;  1SVM A;  4KDP A;  5EZG A;  1XN7 A;  2P4W A;  3G1O A;  2W00 A;  1ZRD A;  1LFP A;  2BY2 A;  4FAS D;  1ODD A;  2ADU A;  3EUA A;  3SDG A;  4NUB A;  2GZW A;  4UV9 A;  3KIO A;  1K4S A;  3COA C;  1RR8 C;  4ZTF A;  3GCM A;  1LEA A;  2GLO A;  2MH2 A;  2O6G E;  3H3V K;  1BOA A;  3HRT A;  2MD5 A;  1V3F A;  2WAD A;  1W36 C;  2XHK A;  2XIG A;  1USS A;  4I0B A;  1ENH A;  2EBI A;  3H1C A;  4BQQ A;  2IA0 A;  4BQN A;  2CYY A;  1Z6T A;  4XKB A;  1ZG5 A;  1U5T C;  2F4M B;  3ELK A;  4D5C A;  3O8G A;  4A3E J;  1A6Q A;  4RDU A;  2PLY A;  4DYQ A;  2Z9O A;  3TW6 A;  2KJC A;  2R7U A;  4FQG A;  4BDZ A;  2EZH A;  4PJL A;  4BQA A;  4Y52 J;  3KP4 A;  5E3M A;  3I54 A;  4I6Z A;  3OYB A;  2WAQ N;  3U21 A;  1FIA A;  1U5T B;  3FXL A;  2L5Q A;  4HDV A;  2LKP A;  1QNT A;  2FD5 A;  2QCO A;  4PDK A;  1JI8 A;  4QWQ A;  5FD6 A;  3CMY A;  1S7A A;  3H36 A;  3V8J A;  5F64 A;  2M7B A;  2GWR A;  1I3A A;  2L4M A;  4G6Q A;  1R58 A;  1SAU A;  3I64 A;  1NH3 A;  1VZ0 A;  5KAI C;  4I09 A;  2MLK A;  4RB1 A;  1KU3 A;  4RGR A;  1C0W A;  4Q4Z F;  2MH9 A;  1WPK A;  4XRM A;  2X51 A;  3JRH A;  1JE8 A;  1XMX A;  3F3X A;  5IT9 K;  1P6R A;  2FA5 A;  2W82 A;  3KYL A;  2F4O B;  5IP7 J;  3KLO A;  3ML6 A;  3D1N I;  2XV4 S;  1UB9 A;  4H0E A;  4ENJ A;  1REP C;  2RNG A;  3HDD A;  1E17 A;  3ZMS A;  4WF2 A;  3I58 A;  4XOT A;  4Y33 A;  5BPI A;  3DQV C;  3G6E I;  2JTV A;  5EEA A;  1KU9 A;  4HF2 A;  5EJC A;  4G7O F;  5DS9 A;  4KN4 X;  3S32 A;  1MNM C;  2OA4 A;  4EM2 A;  5B3S H;  4D9J A;  4NDL A;  4WWC A;  2DBB A;  1TQI A;  2XAS A;  1R5G A;  1EV7 A;  5IT3 A;  1MDM B;  3D0S A;  1G3Y A;  2UV1 A;  1B72 B;  1D8J A;  3DBR B;  3VOE A;  4UB6 C;  3M1E A;  1GV2 A;  2RQQ A;  2Y0S N;  1JT6 A;  2XAJ A;  3LWF A;  3LSK A;  4EAT A;  2ZNY A;  5F6F A;  3RQI A;  1DGR M;  2PQ8 A;  2HEO A;  4GXO A;  1SFE A;  4RB0 A;  2R7F A;  1X3W B;  2XRL A;  5EF6 A;  5KCM A;  1QRY A;  4G8X A;  1QHH D;  2NOG A;  3M3Y J;  5J8C A;  4EM1 A;  1JGS A;  1VQ4 I;  1U78 A;  4V19 K;  2R7X A;  5D5X B;  3FMQ A;  2VAS A;  1JGG A;  1XGM A;  1RC9 A;  4JQF A;  1YS6 A;  2Q1Z B;  3B6C A;  4OIO F;  3R61 A;  2HQN A;  4JK1 X;  2C6Y A;  3UKG A;  4NC6 A;  2MA3 A;  3HL2 A;  2F5F A;  3BQZ A;  3K9T A;  3BPX A;  3ZP5 A;  3PFI A;  1J7K A;  1ZRF A;  1UMQ A;  2H94 A;  3I4P A;  4QPO A;  2COB A;  5CQG A;  3LMM A;  2R4G A;  1LKX A;  2L7M P;  3BPV A;  3ZMV A;  2RV8 A;  1LUJ B;  3ISP A;  1HW1 A;  2MAB A;  2E5N A;  3K6G A;  1R71 A;  3J80 Z;  3C3W A;  1U0J A;  1TBX A;  4KIB A;  1WZ2 A;  4KYW A;  3ASN H;  2WAQ A;  3HG9 A;  4D5F A;  2CUE A;  2D45 A;  2W84 A;  4HF1 A;  1R1V A;  1P9Q C;  3LSG A;  2B63 J;  4RLQ A;  2K4B A;  4ZZD A;  2DYS H;  3O2P E;  1X4P A;  3FKJ A;  3PQJ A;  4U0Y A;  3WTW C;  3ZQL A;  3GLX A;  2ZJQ F;  1LPQ A;  4LLL A;  4BNC A;  3RPU D;  3MKY B;  2O9L A;  3GFJ A;  2L9V A;  2XAF A;  1RKW A;  4I99 C;  2MLG A;  4ENM A;  4GDF A;  1KYZ A;  4M6Y A;  2HVS A;  3AL0 C;  1I6X A;  2VC0 A;  3SZT A;  3LSJ A;  3M4O J;  3DPT A;  3FXJ A;  4LOC A;  1VQ5 I;  1E0E A;  1D0X A;  5K5O A;  1UHW A;  1UST A;  2DA2 A;  3PSF A;  4LG0 B;  4I02 A;  2K02 A;  3FXQ A;  2WTE A;  4E7L A;  4M3G A;  3PNV A;  1F1Z A;  2IXS A;  4KN7 X;  4XOR A;  2QQA A;  4CUG A;  1BR2 A;  1ETY A;  1TWC J;  3MCZ A;  1RNL A;  3TED A;  4MLO A;  1MGT A;  4DBQ A;  3PFY A;  3CJR B;  4L5I A;  1Y56 A;  2P0W A;  2L7F P;  2HXI A;  3N05 A;  3A1Y A;  5FKK A;  1E3P A;  4JBA A;  3JRA A;  2CV2 A;  1X2M A;  4E7Z A;  3M8J A;  3CTA A;  3HM5 A;  3MFK A;  3GTO J;  1W4M A;  2V1X A;  2E2J J;  4M3D A;  4HQM A;  2JRM A;  4U87 A;  2IS6 A;  3W2A A;  2MC3 A;  2PMZ N;  2OQR A;  3VYS B;  1FP2 A;  1N75 A;  3MZ8 A;  2FRH A; 
#chains in the Genus database with same CATH homology
 4DQ2 A;  4FX0 A;  1T0F A;  3L2C A;  1F5T A;  1YYV A;  3F8F A;  4HYE A;  3GO5 A;  1WKM A;  3TOA A;  5LGT A;  1JXS A;  2YSR A;  4GCV A;  3H92 A;  1SFX A;  1XMA A;  2FEZ A;  1R1U A;  2VOP A;  2QBY A;  4EM0 B;  1YS7 A;  1G3T A;  2QQ9 A;  2GA2 A;  1S3J A;  2ZBK A;  1T39 A;  1DUX C;  1T2K A;  3QP5 A;  2DLL A;  1BI1 A;  1I5Z A;  2OZ6 A;  3ZMD A;  5ILU A;  2H6C A;  1CF7 B;  2FF4 A;  3ZN1 A;  2WWY A;  1KGS A;  1QZZ A;  1FLI A;  1QGP A;  2CQK A;  1SMY F;  3G3Z A;  2ISY A;  3V8K A;  2PI0 A;  3J7A O;  3L00 A;  2ZME A;  1YW7 A;  4IVN A;  3BRO A;  1FYM A;  1HKT A;  3J81 Z;  3G73 A;  2VT3 A;  3WTX C;  2CWE A;  3C1D A;  5DCM B;  1MKM A;  1BBY A;  3Q9V A;  5TRD A;  1U3E M;  1P2F A;  3EUH A;  6PAX A;  1IF1 A;  3TOB A;  3E5X A;  5HLG A;  3LAP A;  1BJA A;  3V7R A;  4OOI A;  2ZNZ A;  3T5X A;  1FBQ A;  3R0A A;  2L54 A;  1ZGJ A;  4CDG A;  1HKQ A;  5FB2 A;  4M9Z A;  4HOB A;  3ROU A;  2Y48 A;  4UXN A;  4IRG A;  1OR7 A;  3B73 A;  4XRF A;  3R0J A;  1P4A A;  3F22 A;  5ICC A;  4A12 A;  1UHM A;  4WK8 F;  1X3U A;  4UHT A;  4RAZ A;  1TNT A;  2IP2 A;  2H09 A;  2DK8 A;  3GXO A;  1FC3 A;  3ABT A;  5LHG A;  2XAH A;  4U0W A;  2EJR A;  3TGN A;  4EGZ A;  5LBQ A;  4WCG A;  3U1D A;  4ETS A;  4D0P A;  2VXZ A;  1FBU A;  1IXC A;  1XDU A;  3GW2 A;  4UVA A;  3WTZ A;  5J6X A;  3JSP A;  1O3R A;  4BH9 A;  4HV5 A;  3RKY A;  1G3S A;  1W5T A;  2GAU A;  2KRF A;  4P55 A;  1G4D A;  3EQL F;  1IN7 A;  4R79 A;  1IRF A;  5KK1 A;  3AAF A;  1S8N A;  2FMY A;  2F5C A;  4UVB A;  5IT9 Z;  1I27 A;  3ABU A;  3I71 A;  3DEU A;  1TTY A;  1ZG1 A;  2QM3 A;  1KU7 A;  4UNO A;  4ZZL A;  2VON A;  2CSO A;  1P4W A;  1BM9 A;  3KP7 A;  3LQR A;  3IKT A;  5L3G A;  4KIF A;  4HAM A;  2A3S A;  4O5V A;  1KYW A;  4HQE A;  3R60 A;  1J5Y A;  1GHC A;  3K69 A;  4FT8 A;  1FP1 D;  2XKP A;  4KIC A;  4AIJ A;  2WC2 A;  3L09 A;  1B9M A;  3T0Y A;  2FBH A;  2IRF G;  4ASN A;  1YO5 C;  1D3Y A;  2P5K A;  1ZLK A;  2EK5 A;  4MTD A;  5HS8 A;  5L3C A;  5H6R A;  1ON2 A;  1YQA A;  4EJT A;  1T38 A;  2FNA A;  2LDU A;  1P92 A;  2RGV A;  3IWZ A;  3N4M A;  4UV8 A;  3E97 A;  3RI4 A;  4G7Z F;  3KET A;  3I59 B;  3J81 K;  2RC4 A;  2DQR A;  1F4K A;  1K6O A;  3KZY A;  3JW4 A;  3TDU C;  4DNC A;  1QZY A;  2TDX A;  3HRU A;  2ESH A;  3HSE A;  1BI2 A;  4KFC A;  4LMY A;  2BEO A;  2NNN A;  2V9V A;  3IHU A;  3GFM A;  4ENK A;  3HTU A;  2K7L A;  1OYI A;  1O3S A;  3U2R A;  4A5N A;  3GZ5 A;  3QPH A;  5LGU A;  4M72 A;  4HX4 A;  3GFL A;  3TDZ C;  2Y0M A;  4BHB A;  3CUQ A;  5LRS A;  3VB2 A;  3WU1 B;  3MQ0 A;  5ED4 A;  3SFZ A;  2VE8 A;  3FM5 A;  5DYM A;  5K5R A;  1ZYR F;  1TNS A;  5DDG A;  5J8F A;  1STZ A;  5DD4 A;  2FU4 A;  5E1X A;  4S05 A;  2RVC A;  2DW4 A;  2HYF A;  3QOP A;  1LDK B;  5D5U B;  2ISZ A;  3MEX A;  2DK5 A;  1U2W A;  1FNN A;  5BPD A;  2F5D A;  1W7P A;  2LF8 A;  3HSR A;  5HOO A;  3P7N A;  2R7D A;  4R1H A;  2NS0 A;  2FSW A;  1KQ0 A;  5HLI A;  4MGR A;  3SHF A;  3GFI A;  3NRV A;  5FFX A;  4WXC A;  2VC1 A;  1FSE A;  4A6D A;  3JTG A;  4HX7 A;  4I01 A;  4ZH4 F;  4NHJ A;  4MEX F;  4KUM A;  4LK1 F;  3DKW A;  4IJA A;  1QPM A;  1YLF A;  2DAO A;  1IW7 F;  3E5U A;  2H27 A;  3TO7 A;  3RTR A;  3P9C A;  5DUK A;  1LVA A;  5A2Q K;  2OQG A;  1J75 A;  1O3Q A;  1R22 A;  1BIA A;  3I5U A;  2A61 A;  4HV6 A;  1ZN2 A;  4A0Z A;  1S6L A;  4G9Y A;  1O3T A;  1ONV A;  2AS5 F;  1SD6 A;  2P5V A;  1LB2 A;  2GA1 A;  2FBK A;  4OIP F;  4EMS A;  2M8E A;  3BWG A;  3ERE D;  2LSO A;  2DT5 A;  3KZZ A;  5E18 F;  3BY6 A;  1MJB A;  2PEX A;  3HHG A;  1G6N A;  5HDK A;  3T1B A;  2O0Y A;  1FSH A;  1Z9C A;  2BYV E;  4XSX F;  2X4H A;  3W6J B;  3HUG A;  4HF0 A;  1BIB A;  4N9I A;  5D5V B;  2HTS A;  3RKX A;  4E70 A;  2FBI A;  5ERI A;  4KIG A;  3V8L A;  3HSF A;  2ZO4 A;  1EH6 A;  5K1Y A;  1MZB A;  3FWE A;  2PMH A;  2EB7 A;  4WX9 A;  1AWC A;  4GYI A;  4N0B A;  1B4A A;  1J2X A;  5F1R A;  2K4J A;  2PBI A;  3TO6 A;  1KQ8 A;  2ZJ2 A;  4A6E A;  4MTE A;  2K86 A;  2BE5 F;  1YW8 A;  1ZRE A;  3OOP A;  3H3Z A;  4YFN F;  2PMU A;  1FY7 A;  2EFO A;  2EFP A;  1XGS A;  1K79 A;  1FX7 A;  5BMZ A;  4HLY A;  5D4S A;  1ZH5 A;  3T8T A;  4WXD A;  2VBY A;  3BJA A;  1K78 B;  2Z3Y A;  1EH7 A;  3DFG A;  2EWN A;  4LD5 A;  3HTS B;  1HQC A;  2D1V A;  3NQO A;  2KKO A;  5BOX A;  3BOQ A;  4CYD A;  1U5T A;  3F8B A;  3O3K A;  3CO6 C;  1OMI A;  2OD5 A;  1R5H A;  3FZV A;  1YFH A;  2L4A A;  4RAY A;  5LLQ A;  2DTR A;  1WI9 A;  4GGG A;  1YTY A;  4BYY A;  1R7J A;  2FNP A;  2ZCW A;  1UFM A;  1ZG3 A;  3MWM A;  5JFR A;  4P9F A;  3CDH A;  5FLX K;  2DU9 A;  1YIO A;  2G9W A;  4A0X A;  3TQN A;  2A68 F;  1XB4 A;  3F6O A;  1IN5 A;  4BAY A;  4RGS A;  2VOO A;  1RUN A;  4P9U A;  2EA2 A;  2VOD A;  1MDM A;  2CW0 F;  2A69 F;  1SAX A;  1P4X A;  4YFX F;  4GYG A;  2M87 A;  4HA8 A;  3JTH A;  1L3L A;  2UXN A;  1DP7 P;  1RI7 A;  3EDP A;  3FXU A;  3LA2 A;  4CXF A;  3JAM K;  1BI0 A;  1IXR C;  5LHH A;  3CLO A;  3C18 A;  1K7A A;  1IN4 A;  3LA7 A;  1XD7 A;  2IJL A;  5E1W A;  3KE2 A;  1OKR A;  2P7C B;  1U6G A;  2DPD A;  4O6J A;  3DXJ F;  2NRA C;  5AIQ A;  3GEZ A;  3DV8 A;  1LEB A;  2O3F A;  2HGC A;  1DPR A;  5D8K B;  4IRH A;  1W5S A;  4L0Z B;  4Q5S F;  3I53 A;  3ZQ7 A;  3RPU A;  4ESJ A;  4EV0 A;  2VE9 A;  1XDS A;  4RS8 A;  3NEU A;  5CVJ A;  2E1C A;  3CUQ C;  3M7G A;  5BS6 A;  1J59 A;  2UXX A;  1QO0 D;  1D8K A;  4LB6 B;  3M8E A;  3RJP A;  4N9H A;  1HSJ A;  4AIH A;  2EFN A;  4LG0 A;  2FML A;  2GIV A;  2F2E A;  3IRR A;  3U9G A;  2VBW A;  5E8G A;  3WG9 A;  2XGX A;  4PGG A;  4LLG F;  4FX4 A;  2HKX A;  2ETH A;  3LST A;  2YPR A;  4ESF A;  5D4R A;  3ULQ B;  4BHC A;  4WXH A;  4AVP A;  3QRF F;  5ICE A;  4U88 A;  3GZ6 A;  4LJZ F;  2GQQ A;  1XMK A;  3WTY C;  4A0Y A;  4HLX A;  1S29 A;  1WQ2 A;  1HBX G;  2YX4 A;  1ZHF A;  5AIP A;  1IN6 A;  4IRI A;  2OZU A;  1L0O C;  2LNB A;  3B02 A;  1FPQ A;  5CVR A;  3F6V A;  1OYY A;  2D2W A;  5HS7 A;  4NQW A;  3RKW A;  4CO8 A;  1H9T A;  3GX4 X;  1XCB A;  5LEK A;  3F23 A;  4YIF A;  5FGM A;  3HOT A;  1ZLJ A;  2NYX A;  4OU0 A;  4EJW A;  5DUI A;  3WOD F;  3VFZ A;  2FQ3 A;  5A2Q Z;  2VBX A;  3GF2 A;  2ACJ A;  5DCF A;  5L3E A;  2HFH A;  3DF8 A;  2E7W A;  1MJA A;  3O6B B;  1UCR A;  3P9I A;  3OV8 A;  1HW5 A;  1CF7 A;  4L9N A;  3M9A A;  4HX8 A;  4YG2 F;  2QZ8 A;  2KIF A;  5CVV A;  1LQ1 A;  1OPC A;  1IRG A;  1GVJ A;  1ZAO A;  3FHZ A;  4P96 A;  4M74 A;  3CO7 C;  3E6D A;  1ZAR A;  1CGP A;  4MEY F;  2IPQ X;  1XSD A;  5CVI A;  3ECO A;  1VTN C;  5DCM A;  2EV6 A;  1Z05 A;  2ESN A;  1FZP B;  3CJN A;  2J5P A;  2FOK A;  5EEG A;  1DDN A;  4UVC A;  4EJV A;  1RIO H;  1HST A;  2JZY A;  2P5L C;  2IW5 A;  1TW2 A;  3RYP A;  2EV0 A;  3IKV A;  4L5J A;  3WU0 A;  5JR3 A;  1TQP A;  4L0Y B;  1HXD A;  3ECH A;  1B6A A;  4PCQ A;  4BXU A;  3FMR A;  2KIM A;  4PZJ A;  3WTT C;  2V1U A;  2BGC A;  2Q0O A;  3R6S A;  4L9J A;  1J0R A;  3QP6 A;  1IN8 A;  2CFX A;  2G7H A;  2W57 A;  5ICF A;  1RZ4 A;  4OIN F;  2CG4 A;  2V1D A;  2M5W A;  2Z99 A;  1R23 A;  3HRM A;  4M6X A;  4YFK F;  2M30 A;  3V7C A;  1DPU A;  4L9V A;  2FXA A;  2X0L A;  3R4K A;  2Z5U A;  4ON0 A;  4G7H F;  4MHG A;  3GVA A;  1RUO A;  2IA1 A;  3LA3 A;  2EA4 A;  4I0A A;  4KT5 C;  1ZRC A;  3LAJ A;  2HWV A;  4CIC A;  3E5Q A;  1QBJ A;  3RDI A;  3L9F A;  2VT2 A;  2F5E A;  2QUF A;  1H0M A;  1JHF A;  4EJU A;  5ICG A;  4R8H A;  4B8X A;  3ZMZ A;  5JVT A;  4QLC U;  5KVR A;  1SD4 A;  1OYW A;  2NAZ A;  2KIU A;  3V7S A;  5FFZ A;  4OIR F;  2HKO A;  2QVO A;  4Y13 A;  2R3S A;  4HDU A;  3ZPL A;  1D5V A;  4GO1 A;  2OAZ A;  4LLN A;  3QU3 A;  3FM3 A;  1Z6R A;  1KQ9 A;  5FLX Z;  2P6S A;  4IHT A;  2B0L A;  4Y17 A;  3K1N A;  2A07 F;  3QPT A;  2GXG A;  4LK0 F;  1IUY A;  2QBY B;  3MAJ A;  5LHI A;  2A6E F;  1B59 A;  4M9S A;  1J9I A;  1JHH A;  5CJ9 A;  1TLH B;  5HLH A;  4CZZ A;  3VOD A;  3P9K A;  5TJJ A;  3S2W A;  3KP2 A;  2NNY A;  1LDD A;  5DEQ A;  5D6F A;  4AD9 A;  3M8F A;  3JAM Z;  3LQQ A;  3K2Z A;  2UWM A;  2M45 A;  1E2X A;  1FBS A;  4M9X A;  1PP8 F;  1ZGA A;  2G7U A;  2CGP A;  2E7X A;  4XSZ F;  2HS5 A;  2ZFW A;  2O03 A;  3EYY A;  2ZME B;  4RGU A;  3QAH A;  2BBY A;  4I98 B;  2OBP A;  2Q8K A;  3I59 A;  2L01 A;  5H20 A;  3K1P A;  4HBL A;  3GYH X;  1WRJ A;  1B9N A;  1SFU A;  2A6H F;  3ZN0 A;  3RPQ A;  5E8I A;  1WSU A;  1R00 A;  4IF4 A;  2QQB A;  2WV0 A;  2XAQ A;  2E1N A;  4Y15 A;  3I0T A;  2EFQ A;  4RGX A;  1YW9 A;  2PN6 A;  2XAG A;  2P7V B;  2H6B A;  3HYI A;  3RYR A;  1FOK A;  4Z2Y A;  3MZH A;  2Q2E A;  4ZYH A;  2HOE A;  1GXP A;  2V79 A;  4Q47 A;  1XSV A;  2PJP A;  4XLP F;  1KA8 A;  2EV5 A;  2HQR A;  3L7W A;  3WE2 A;  5CYV A;  3ZMU A;  2JT1 A;  5D8L B;  2L02 A;  4U7D A;  1MJ9 A;  1HW2 A;  1F9N A;  4U0V A;  4HW0 A;  4P5O A;  3D5L A;  4EGY A;  1KU2 A;  3WE3 A;  3PQK A;  2XRO A;  1EH8 A;  2KJB A;  2ZKZ A;  2W85 A;  2A5Y B;  1TQM A;  4CHU A;  2DFI A;  2D1H A;  3IL2 A;  2YR2 A;  1BI3 A;  2IT0 A;  4AWX B;  4BHP A;  3WGI A;  3FMS A;  2Z33 A;  1FT9 A;  3RIR A;  5L3B A;  2W25 A;  4F7Z A;  5HVQ C;  2M1B A;  4AIK A;  4LB5 A;  2QLZ A;  2J5O A;  2AXL A;  1SD5 A;  4G6D A;  1FYL A;  4ZYE A;  4KMU X;  1U8R A;  3K0L A;  1G3W A;  2QWW A;  2UZK A;  2JSC A;  1I1S A;  2Y75 A;  3F8M A;  2P6T A;  2MBF A;  4IHS A;  2RNJ A;  2HR3 A;  5E17 F;  3FX3 A;  2DQL A;  5HDG A;  2VBZ A;  4ESB A;  4RB3 C;  2HYG D;  3WGG A;  4I7H A;  4UUV A;  3F72 A;  5K5Q A;  3BP8 A;  5ILV A;  1T6S A;  3BZ6 A;  4OMY A;  4MQV A;  2COM A;  3DPL C;  4O3M A;  1PUE E;  3GUD A;  1FYK A;  5LEJ A;  4S04 A;  1IZ1 A;  4M73 A;  1Y0U A;  3SXY A;  3KP3 A;  2V6C A;  2DPU A;  3WGH A;  4MNU A;  3WTU C;  5E1Z B;  4PGH A;  1R1T A;  1BN5 A;  3F8N A;  1I1G A;  2LF7 A;  3Q9S A;  4FHT A;  5FO5 A;  5E20 A;  1LNW A;  3T8R A;  4IPA A;  1PP7 U;  2STW A;  2XVC A;  1IXS B;  1XGO A;  4TV7 A;  4NB5 A;  1O7L A;  2YX7 A;  1Q1H A;  2W24 A;  1AOY A;  3LFK A;  4A5M A;  3KEQ A;  5D5W B;  2JPC A;  2IA2 A;  4KMF A;  4ENN A;  4LGW A;  2ZXJ A;  1TW3 A;  2HZT A;  1SD7 A;  4IXA A;  4CGZ A;  1LJ9 A;  3CUO A;  2CO5 A;  5AON A;  5HS9 A;  3KEO A;  3HHH A;  2RKH A;  2RDP A;  5FD5 A;  4YII A;  2XRN A;  4ZYG A;  4A2U A;  4EJO A;  1HKS A;  3VEP A;  3WTV C;  2DO7 A;  3J80 K;  1XGN A;  2HTJ A;  3REO A;  3K1M A;  3CUQ B;  1B1B A;  3HOS A;  3GWZ A;  2VN2 A;  3TKY A;  3Q5F A;  3N97 A;  3IWF A;  1XSX A;  2PG4 A;  2YU3 A;  1BC7 C;  4OIQ F;  4EQQ A;  3BJO A;  5JI6 A;  5ILS A;  4OMZ A;  4MQ9 F;  4Q48 A;  3E6C C;  2EFW A;  1K78 A;  3KFW X;  4M71 A;  4EVI A;  3EET A;  3KCC A;  2GXB A;  1NHA A;  3BJ6 A;  4B09 A;  1MD0 A;  3EYI A;  3E3V A;  1Z7U A;  4XLN F;  3ZMT A;  2QYO A;  5CVU A;  1SMT A;  1W7P B;  2P8T A;  3V4G A;  1T98 A;  3QU6 A;  3IC7 A;  1W7P D;  2FE3 A;  2K27 A;  4L18 B;  1H9G A;  4K2E A;  3FF5 A;  3F21 A;  1ON1 A;  3DP7 A;  2ELH A;  5BQT A;  1R36 A;  3JSO A;  1O57 A;  1XCV A;  4G94 A;  1ULY A;  3WTS C;  2OU2 A;  3C7J A;  3W6K B;  2XKO A;  3HRS A;  4U7B A;  1O7F A;  1IAW A;  2JRT A;  2RQP A;  3F8C A;  5CLS A;  5LRR A;  1WWX A;  5DV5 A;  3HIF A;  4KNY A;  1LDJ A;  4KA4 A;  1V4R A;  5H6Q A;  2JPB A;  2HDC A;  5EEH A;  5LGN A;  3IRQ A;  3E6M A;  1S7O A;  5L3F A;  1A04 A;  2RN7 A;  3TO9 A;  4RB2 C;  3KP6 A;  1Z91 A;  5D6E A;  4XBF A;  3SQN A;  3E6B A;  1FWZ A;  2DI3 A;  2L3D A;  1BC8 C;  2PFB A;  2QEN A;  1YG2 A;  2IVM A;  5JHU A;  2BV6 A;  5DD8 A;  4L9T A;  3H3U A;  3BDD A;  2STT A;  4HZF A;  3MZY A;  2XUB A;  2O61 A;  3KLN A;  4LFU A;  4I2O A;  1Z1D A;  3SZP A;  4ZYD A;  1QQI A;  5HDN A;  3KP5 A;  2O8X A;  5L3D A;  1GXQ A;  3FXR A;  1PDN C;  4KDP A;  1XN7 A;  2P4W A;  1ZRD A;  1ODD A;  2ADU A;  2GZW A;  4UV9 A;  3COA C;  1LEA A;  2MH2 A;  2O6G E;  1BOA A;  3HRT A;  2MD5 A;  1V3F A;  2XHK A;  2XIG A;  1USS A;  4I0B A;  2IA0 A;  2CYY A;  1Z6T A;  1ZG5 A;  1U5T C;  3ELK A;  2PLY A;  2Z9O A;  2KJC A;  4BQA A;  3KP4 A;  3I54 A;  1U5T B;  4HDV A;  2LKP A;  1QNT A;  4PDK A;  4QWQ A;  5FD6 A;  1S7A A;  3V8J A;  5F64 A;  2GWR A;  2L4M A;  4G6Q A;  1R58 A;  3I64 A;  4I09 A;  2MLK A;  4RB1 A;  1KU3 A;  4RGR A;  1C0W A;  4Q4Z F;  2MH9 A;  1JE8 A;  3F3X A;  5IT9 K;  1P6R A;  2FA5 A;  3KLO A;  3ML6 A;  2XV4 S;  1UB9 A;  4H0E A;  4ENJ A;  1REP C;  1E17 A;  3ZMS A;  4WF2 A;  3I58 A;  5BPI A;  3DQV C;  2JTV A;  1KU9 A;  4HF2 A;  4G7O F;  4KN4 X;  2OA4 A;  4EM2 A;  4WWC A;  2DBB A;  1TQI A;  2XAS A;  1R5G A;  1EV7 A;  5IT3 A;  1MDM B;  3D0S A;  1G3Y A;  1D8J A;  3VOE A;  3M1E A;  2XAJ A;  3LWF A;  2ZNY A;  5F6F A;  2PQ8 A;  2HEO A;  4GXO A;  1SFE A;  4RB0 A;  2R7F A;  4G8X A;  5J8C A;  4EM1 A;  1JGS A;  1U78 A;  5D5X B;  3FMQ A;  1XGM A;  4JQF A;  1YS6 A;  4OIO F;  3R61 A;  2HQN A;  4JK1 X;  2C6Y A;  2MA3 A;  2F5F A;  3K9T A;  3BPX A;  3ZP5 A;  3PFI A;  1J7K A;  1ZRF A;  2H94 A;  3I4P A;  3BPV A;  3ZMV A;  2RV8 A;  3ISP A;  1HW1 A;  3J80 Z;  3C3W A;  1TBX A;  4KIB A;  4KYW A;  2D45 A;  2W84 A;  4HF1 A;  1R1V A;  2K4B A;  4ZZD A;  3O2P E;  3WTW C;  3PQJ A;  4U0Y A;  3GLX A;  4LLL A;  4BNC A;  3GFJ A;  2XAF A;  4ENM A;  2MLG A;  1KYZ A;  4M6Y A;  1I6X A;  2VC0 A;  3SZT A;  3DPT A;  5K5O A;  1UHW A;  1UST A;  4LG0 B;  4I02 A;  2K02 A;  3FXQ A;  2WTE A;  1F1Z A;  4KN7 X;  2QQA A;  3MCZ A;  1RNL A;  1MGT A;  4L5I A;  4JBA A;  3CTA A;  3MFK A;  1W4M A;  2V1X A;  4HQM A;  2MC3 A;  2OQR A;  1FP2 A;  2FRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...