4OMZA

Crystal structure of nolr from sinorhizobium fredii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
98
structure length
98
Chain Sequence
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NolR
publication title Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
pubmed doi rcsb
source organism Sinorhizobium fredii
molecule tags Transcription
total genus 34
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4omzA00
3COAC 1FT9A 2QBYB 3GFIA 3DFGA 5LGTA 3QPTA 2W84A 4AWXB 1I5ZA 1UCRA 1ZH5A 2RDPA 4M6XA 1HBXG 1B4AA 4ZYGA 2EFWA 3ZMDA 4HV5A 2ZXJA 4RGSA 1T39A 3WTZA 3L7WA 3F8MA 3FHZA 2IA0A 2XAQA 1IN4A 4WCGA 2CWEA 1K78A 2ESNA 5CYVA 3T5XA 4MQVA 3T8TA 2G9WA 5E1XA 2LDUA 4I01A 1DUXC 3GFJA 3IRRA 3ABUA 1R58A 1FWZA 1WRJA 4G6DA 2GIVA 2DW4A 3HRSA 2Y48A 4EGZA 2HR3A 5F1RA 1OYYA 4OIQF 2JPCA 2F5CA 3LQQA 4A6DA 3EDPA 4OIRF 1S7AA 3ZN1A 2MLGA 1HW2A 1BC8C 3R6SA 5FD6A 1BM9A 1SFUA 1LEAA 4ENNA 5LRRA 2PI0A 3OV8A 5D4SA 3F23A 1BI2A 3JTHA 1YLFA 3N97A 1H0MA 4P55A 1HSJA 4FX0A 4O3MA 2VE8A 2PMHA 2QENA 5BMZA 1FYMA 2Q0OA 1GVJA 2DI3A 1T6SA 4RAZA 2LSOA 3U9GA 5AONA 2Z5UA 1RUNA 4GXOA 3ULQB 3E5UA 1S7OA 1O7FA 1JGSA 3W6JB 1BC7C 4ENKA 1Z6RA 2XAGA 1V3FA 3M7GA 3G3ZA 3JSPA 3F3XA 3BOQA 5LRSA 2H94A 3BJOA 1XSVA 3BP8A 4WX9A 5ICFA 1P4XA 4LLGF 1XSXA 3EETA 4I98B 1TNTA 4I2OA 2A3SA 2QWWA 2BE5F 1HKQA 2DK8A 1IN7A 4KMUX 5HS7A 5D6EA 1VTNC 5K5QA 3JSOA 3GX4X 3EYIA 3FMSA 4ESJA 2JRTA 3K1NA 3V8KA 3RPQA 1G6NA 4CICA 2J5OA 2L3DA 1UHMA 1U2WA 2NAZA 2NYXA 1SD6A 4OIPF 3LWFA 1LNWA 2DBBA 3R0AA 1O3TA 2RGVA 3CLOA 1AOYA 4S04A 3IHUA 1W7PD 2FMYA 1SD7A 2ZMEA 2KJBA 2WTEA 1MDMA 4XSZF 1P6RA 4L9NA 1NHAA 2PJPA 3ZMZA 2HZTA 2V1DA 2GA2A 4HZFA 4IHSA 3QPHA 2KIFA 4IVNA 2Y0MA 4BNCA 5D5XB 3J80Z 3EQLF 2ZNZA 4LFUA 4EJTA 3OOPA 1KQ8A 3SZTA 4A5NA 3DPLC 3MAJA 3KFWX 3I58A 3VODA 5BS6A 1G3TA 1LB2A 1SMYF 1SMTA 1IW7F 5FFZA 1D8JA 1W7PA 4XRFA 1EH7A 1KGSA 1TW2A 3I59A 4MTDA 1BN5A 3C3WA 1XGMA 4RGUA 3ZQ7A 1GHCA 2IT0A 1EH6A 1B9MA 2L4MA 3MFKA 3RKXA 3W6KB 5LLQA 2VBXA 2WV0A 3Q5FA 4CDGA 3F8BA 3BJAA 1OR7A 3VFZA 4RGRA 3FXUA 1G4DA 1IUYA 2RQPA 2O3FA 1YFHA 4LG0B 2QQ9A 3DP7A 2NS0A 2EFPA 1J7KA 1XN7A 4KICA 5A2QZ 4N0BA 1O3RA 3F21A 4ZH4F 2Z9OA 5D6FA 4U7DA 4MHGA 2EFNA 3Q9SA 3HSRA 4N9HA 4Q47A 2HYGD 4UUVA 2JZYA 2K27A 4HQEA 3KP6A 2F5FA 1I27A 2K4BA 3F8CA 1O3SA 1LEBA 4BAYA 4L9VA 5LEKA 2BEOA 1ON1A 4FX4A 4XLPF 1FZPB 1PP8F 1BOAA 2XAJA 1PP7U 3MZHA 2W25A 2FXAA 5LHHA 2BBYA 3DEUA 1HQCA 1P2FA 4U0YA 2CGPA 4OU0A 2P6SA 2MH2A 4XBFA 1UFMA 2PLYA 1FP1D 3LQRA 2ELHA 4P96A 2QLZA 1YG2A 3CTAA 2EB7A 2XHKA 4A0XA 4HLYA 4EQQA 5H6RA 5J8CA 2VC1A 3M8FA 2JT1A 3IWFA 3C18A 4KN4X 5ED4A 2ZKZA 5FB2A 3GFLA 1ZHFA 4E70A 4RB3C 1OYWA 4YFXF 4RGXA 4P9FA 1K6OA 2V1UA 5AIPA 2DT5A 1H9TA 1WKMA 4S05A 2HYFA 1R7JA 3SHFA 5J6XA 3PQKA 5D5UB 3BROA 4M9ZA 3KETA 2NRAC 5HVQC 2VT3A 1TQMA 3KP7A 4PGGA 1R23A 2HS5A 2VODA 4M73A 3IKTA 5IT9Z 2O8XA 1I6XA 3J7AO 2ZNYA 3SQNA 4ETSA 2XIGA 2M8EA 1BIAA 3M9AA 2W85A 1IF1A 3HHGA 5D4RA 3KZYA 2MBFA 1IN6A 1YW8A 4LK1F 3EYYA 4QWQA 4IF4A 4OMYA 2QZ8A 2RN7A 2DQLA 2OA4A 1BI3A 5HLHA 5BPIA 2COMA 4PDKA 2DAOA 3FZVA 1IN5A 4LD5A 5FGMA 3HTUA 3FF5A 1QGPA 1FSHA 2DK5A 5AIQA 4A2UA 1XGSA 1SD4A 1IRGA 1Z91A 4ASNA 4R1HA 2QUFA 5JHUA 3BJ6A 4Q4ZF 3GO5A 5CVJA 4ZZDA 3FXRA 5JR3A 1QZYA 1U3EM 2DQRA 2RVCA 4KA4A 2WWYA 2YU3A 3HOSA 5K5OA 4HF1A 1XCVA 2AXLA 2F5DA 3V4GA 3GWZA 2L4AA 3M1EA 4HF2A 3RKYA 4HX4A 2VBZA 2O6GE 3KP4A 4D0PA 3RYPA 1LDKB 5H6QA 3P9KA 2GAUA 2P7VB 1STZA 5DCMB 5DEQA 1U78A 1PUEE 2M30A 5DCFA 2C6YA 3CO7C 1IXSB 2HFHA 4AVPA 2A68F 4KDPA 2FF4A 1JHFA 2OAZA 4GYGA 2ISYA 3CUQC 4ESBA 1CF7A 1H9GA 2EA4A 4L5IA 1T38A 4Y17A 3WU0A 3F8FA 1B6AA 3WTSC 2PBIA 4MNUA 1S6LA 3HUGA 3D0SA 2GQQA 3K1PA 2QBYA 1OKRA 2R7FA 4HBLA 3C1DA 2OD5A 1R5HA 5CJ9A 4G7ZF 2H27A 3O3KA 1IXCA 1K79A 4UV8A 3R0JA 2IPQX 1W5SA 1OYIA 3ECOA 3TKYA 4O6JA 4L5JA 1LDJA 4EJVA 3FM5A 2OBPA 2XROA 3ROUA 2VONA 2IVMA 4UXNA 3GW2A 4UNOA 3V7SA 1TW3A 1XGOA 5HDKA 2FU4A 1RZ4A 1JE8A 2V6CA 2OZ6A 1Y0UA 4LJZF 2A5YB 3Q9VA 1UHWA 4CHUA 4HAMA 2X0LA 1J9IA 4IPAA 1REPC 1MGTA 1R5GA 2E7XA 3O2PE 1U5TC 3GLXA 1SAXA 2FE3A 5ICGA 2GZWA 4N9IA 4LLLA 2O61A 5DD4A 3GUDA 3IL2A 3LA7A 4XLNF 1FC3A 4IXAA 2YX4A 1Z6TA 2A6EF 1SD5A 2MLKA 3KEQA 3R4KA 3E5QA 3SZPA 3CUOA 1XCBA 3HSEA 4OMZA 2XGXA 1USSA 3GXOA 1WWXA 2BV6A 2VOPA 2A61A 2HTSA 3K69A 4OINF 4G9YA 5LGNA 4M72A 4GYIA 1G3WA 2VN2A 2PN6A 4PGHA 3R61A 1D5VA 1DPUA 1FPQA 2KIMA 2EFQA 2FNPA 3NRVA 3KZZA 2M1BA 1Z9CA 5BQTA 3TDUC 3F6VA 4KIFA 3DV8A 1FP2A 1HW1A 1CGPA 2PFBA 3D5LA 1QPMA 2EWNA 2QQBA 3V8LA 2OQRA 4DNCA 5CVRA 2FMLA 2Q2EA 3U1DA 3IC7A 2XUBA 2EFOA 3MCZA 4PCQA 5CVVA 3HRTA 3B02A 1MZBA 3I71A 4KFCA 2IRFG 1FYKA 4HDUA 4ZYHA 4HA8A 3P7NA 3LAJA 5E17F 2XAHA 1FYLA 4HX8A 4LB6B 2VT2A 1R1TA 3K0LA 3J81K 2Z3YA 1ZAOA 4IRIA 4AIKA 1XDUA 3BDDA 4L9JA 4UV9A 4YG2F 3WTWC 1R1VA 3L9FA 2DTRA 1J5YA 3ZP5A 4JBAA 2L01A 1J0RA 1R36A 1ZN2A 1KQ9A 5F6FA 4EJOA 2XVCA 4A5MA 3GZ6A 2K86A 2E7WA 4JQFA 3FX3A 5DYMA 3IKVA 2O0YA 2K4JA 2MH9A 2H6BA 4L0YB 1LJ9A 4BHPA 2ZO4A 3GFMA 4MGRA 3K1MA 2V9VA 4M9XA 3E6CC 3EUHA 3QU3A 1J75A 1BJAA 1RIOH 1MJBA 2CSOA 4GCVA 1W5TA 2OU2A 1IZ1A 2HDCA 5E18F 3QOPA 4QLCU 2Q8KA 1BI0A 1ULYA 5JI6A 2W57A 4YFNF 3KP3A 2B0LA 2XKOA 4P9UA 1YS7A 4LG0A 2IW5A 2AS5F 5HOOA 4CYDA 2MD5A 4HF0A 2LKPA 3E6DA 2HTJA 3M8EA 2HQRA 2JTVA 4M6YA 3WGHA 1XB4A 2VBWA 3MZYA 5E8GA 3CUQB 4AD9A 1U6GA 1ZG5A 1UB9A 4U0VA 1MJAA 3JAMK 2NNYA 4MTEA 4AIJA 1QNTA 1FOKA 3FMRA 2DFIA 1GXPA 3FM3A 1ON2A 1HXDA 2MA3A 4OIOF 3V8JA 4HLXA 1L0OC 3KE2A 2UWMA 4G7OF 2EA2A 3N4MA 2TDXA 2MC3A 3WTYC 1FBQA 5ICCA 5TRDA 2CFXA 1KYWA 1YO5C 5EEHA 2ZFWA 1B59A 1ZYRF 5DDGA 3LA2A 3ABTA 1J59A 2HQNA 5CLSA 3DQVC 4B09A 5ICEA 4KUMA 3E6BA 4A12A 3HOTA 4RAYA 5ILVA 4WK8F 3CO6C 5IT3A 2CYYA 4EJWA 1U5TB 1R1UA 4HV6A 1YYVA 4CO8A 3F6OA 4MQ9F 4HOBA 2F2EA 3HYIA 3K2ZA 4EM2A 2IJLA 1YIOA 1QO0D 3I0TA 1Z1DA 3C7JA 1K7AA 2E1NA 1QBJA 1XGNA 3CDHA 4HX7A 1I1SA 3B73A 3I4PA 2R3SA 3GF2A 5KVRA 1TQIA 3RYRA 1MD0A 4O5VA 1G3YA 1R00A 1EV7A 1FY7A 3RJPA 3TQNA 4TV7A 2RC4A 5DUIA 3T8RA 2CO5A 4HW0A 1GXQA 1X3UA 3NQOA 3GEZA 1RNLA 3SFZA 1TNSA 2X4HA 2EV5A 3U2RA 5E8IA 1YQAA 1P92A 3PQJA 1USTA 2LF7A 4G94A 5BOXA 5BPDA 2P5VA 3BPVA 3TO9A 4IHTA 2JPBA 4L9TA 3WGGA 1S8NA 2RNJA 3MWMA 5HLIA 5JFRA 6PAXA 3RIRA 2EJRA 2VBYA 4KMFA 2GA1A 1BI1A 2K02A 1LQ1A 1KU7A 2FEZA 4YIFA 2D1VA 4UVBA 1RI7A 4U88A 2FBHA 3HHHA 5LHIA 2VC0A 2P8TA 2XV4S 2P5LC 1ZG3A 4R8HA 5L3FA 4Z2YA 2P7CB 4U7BA 2IA2A 1KU9A 1FBSA 3KEOA 1XMKA 1L3LA 3FWEA 4ZYEA 4I0AA 5FFXA 1I1GA 1XMAA 4KIBA 3GVAA 3ELKA 5DCMA 5E20A 5DV5A 2GXGA 3HSFA 4BYYA 2L54A 2D1HA 1T0FA 5HLGA 4KN7X 4EJUA 3H3UA 4I0BA 3ECHA 2V1XA 1IXRC 2KKOA 1C0WA 2BGCA 1S29A 2J5PA 3FXQA 2EV0A 1F4KA 3DPTA 1YTYA 4RB1A 2Z33A 1Z05A 3S2WA 4ZZLA 3I54A 2ZCWA 2IP2A 4UVCA 3ZMTA 3ISPA 4IRGA 2H6CA 5ILUA 3RPUA 3BWGA 4JK1X 1BBYA 5HS9A 3WTXC 5ILSA 2XAFA 4A0ZA 3HRMA 4GGGA 3RTRA 2ETHA 2K7LA 1FBUA 3KLOA 3TDZC 3TO7A 4WXCA 2NNNA 4EMSA 2FBKA 3L00A 1B1BA 2DO7A 2EV6A 2ZBKA 2IA1A 3G73A 1AWCA 1TQPA 3KLNA 5E1ZB 4G7HF 3I53A 3WG9A 2FSWA 3LSTA 5D5VB 1FSEA 5J8FA 3VB2A 4I09A 3MQ0A 4ZYDA 1ZLJA 1WI9A 2L02A 2XKPA 2KJCA 1IN8A 1LVAA 3F8NA 3K9TA 4M74A 3H3ZA 2W24A 2FRHA 1D3YA 2ZMEB 2R7DA 1ZGJA 1ODDA 2VE9A 4WXDA 4BHBA 2GWRA 1MDMB 4UHTA 4ENJA 1WSUA 1ZREA 1QQIA 4I02A 1RUOA 2LF8A 2FQ3A 3KP5A 5D8LB 3P9IA 5LBQA 4BXUA 2D45A 2DLLA 3WTUC 1LDDA 5FO5A 4A0YA 3T0YA 3RI4A 1KYZA 3ERED 2XASA 3MEXA 1FNNA 3QAHA 3TOAA 4CXFA 1V4RA 4NB5A 2OQGA 5L3DA 2FNAA 1KU3A 1O7LA 1XDSA 3CJNA 3IWZA 1W7PB 4LB5A 2HKOA 3O6BB 3WGIA 2UXXA 3J80K 2F5EA 3I59B 1O3QA 4OOIA 4WXHA 5H20A 2RV8A 5CVUA 1E17A 3HIFA 4G6QA 1S3JA 4EM0B 1JHHA 2HOEA 5LHGA 4G8XA 2M5WA 3ZMSA 1HW5A 3WE2A 2ZJ2A 4EV0A 2V79A 2PEXA 1KQ0A 3ZMUA 3J81Z 1J2XA 2QVOA 3DXJF 4LLNA 4F7ZA 2H09A 2UZKA 3GYHX 4GO1A 2CW0F 2A6HF 1O57A 5D8KB 3F72A 1SFEA 1R22A 2QM3A 2HKXA 3R60A 2KIUA 4LMYA 4A6EA 3RDIA 2QQAA 1ZGAA 3T1BA 3WTVC 4CZZA 3E3VA 4MEXF 4HQMA 1YS6A 4M9SA 1P4WA 3E5XA 5A2QK 4Y13A 1T2KA 3DF8A 1TBXA 3H92A 3WE3A 3SXYA 4BHCA 1QZZA 1DPRA 5L3GA 1DDNA 5TJJA 2YR2A 1FX7A 3NEUA 5E1WA 2M45A 2PQ8A 4Q48A 2FBIA 3REOA 4L18B 4KT5C 1XD7A 2D2WA 1T98A 2RKHA 2VOOA 3LAPA 1F1ZA 1F9NA 3I64A 1Q1HA 4EGYA 3HRUA 1TTYA 1A04A 2DPDA 2P5KA 3LFKA 3P9CA 5L3BA 2WC2A 4ESFA 4BQAA 3QU6A 4UVAA 2P6TA 4H0EA 4RS8A 5D5WB 4IRHA 2OZUA 4HDVA 2GXBA 1IRFA 5DUKA 3QRFF 2A07F 1W4MA 2P4WA 4PZJA 2G7UA 2VXZA 1KU2A 1EH8A 3KCCA 4MEYF 2STWA 1SFXA 2Z99A 5KK1A 1HSTA 4KIGA 1ONVA 4K2EA 3E6MA 1DP7P 2HEOA 4HYEA 1ZRFA 4YIIA 3JAMZ 3VOEA 1ZRDA 2PMUA 3BZ6A 4Q5SF 3IRQA 5K5RA 2G7HA 1OMIA 1TLHB 4P5OA 4KNYA 1Z7UA 4M71A 3CUQA 4IJAA 4Y15A 5CVIA 5HS8A 4DQ2A 4XSXF 4RB0A 4CGZA 3FMQA 4EVIA 2FOKA 2O03A 1B9NA 5IT9K 2ISZA 4U0WA 5HDGA 2M87A 1HKTA 2XRNA 3ZMVA 3QP5A 1ZG1A 2ADUA 3DKWA 2A69F 1YW7A 1OPCA 2HWVA 2Y75A 3RKWA 3ZN0A 3PFIA 2LNBA 1YW9A 5JVTA 2DPUA 4AIHA 1ZRCA 2DU9A 3JW4A 3TGNA 2CG4A 2YSRA 1F5TA 3TOBA 4LGWA 3TO6A 5FLXK 5L3EA 2KRFA 2E1CA 4I7HA 4BH9A 3VEPA 4EM1A 1G3SA 3LA3A 2STTA 2YPRA 3L2CA 1P4AA 1JXSA 5FD5A 1KA8A 5FLXZ 4LK0F 1WQ2A 3WU1B 1ZARA 2EK5A 5F64A 3QP6A 2UXNA 2CQKA 2FA5A 3V7CA 1IAWA 4NHJA 4FHTA 5LGUA 3HTSB 3WTTC 3WODF 4WF2A 3BPXA 1U5TA 2HGCA 3ZPLA 3JTGA 5EEGA 5L3CA 2ACJA 4L0ZB 2QYOA 2ESHA 1MKMA 1ZLKA 5DD8A 1D8KA 4NQWA 2YX7A 3ML6A 1FLIA 1U8RA 4KYWA 1E2XA 4R79A 3BY6A 1XSDA 3E97A 2JSCA 4WWCA 4ENMA 4FT8A 5LEJA 3F22A 4ON0A 3V7RA 5ERIA 4RB2C 1BIBA 2PG4A 5K1YA 4YFKF 1CF7B 2BYVE 4B8XA 1K78B 3GZ5A 1HKSA 1PDNC 3L09A 5HDNA 3KP2A 3AAFA 1MJ9A 3I5UA
chains in the Genus database with same CATH superfamily
2BOLA 3COAC 1FT9A 3HUGB 1QU3A 2XPUA 2QBYB 1WJCA 3GTQJ 1X1AA 1W36D 3Q0WA 4IEJA 4NUBA 3GFIA 5FLVA 3DFGA 5LGTA 4A3GJ 3QPTA 2W84A 1KZHA 4AWXB 3CCMI 1I5ZA 1UCRA 1ZH5A 1ETQA 2RDPA 4M6XA 2CQNA 4E7LA 1I3QJ 1HBXG 1B4AA 4ZYGA 2LY9A 2EFWA 3ZMDA 4HV5A 3QPSA 3K4LA 5FLMJ 2ZXJA 4RGSA 2L9RA 1T39A 5F0HA 3WTZA 1YHQI 2DFEA 3L7WA 3F8MA 2MABA 3FHZA 2D5VA 1HCRA 1BW6A 3ASOH 2IA0A 2XAQA 1FOYA 1S5LC 1IN4A 4WCGA 2M4GA 4BL0B 2CWEA 3OYCA 1K78A 2ESNA 5CYVA 3T5XA 5LFAA 4MQVA 3T8TA 2G9WA 5E1XA 3L2VA 2VKHA 2LDUA 5C3EJ 4I01A 1DUXC 3DKYA 3GFJA 3IRRA 3S3MA 3CC4I 3ABUA 1R58A 1FWZA 1BR1A 1WRJA 2KFDA 4G6DA 2GIVA 2DW4A 3HRSA 3WG7H 2CW7A 3EUAA 2Y48A 2X6OA 4EGZA 2H1LA 2HR3A 5F1RA 3GTOJ 1OYYA 4OIQF 2JPCA 2F5CA 1GLNA 4BQOA 2JMWA 1JI8A 3LQQA 4A6DA 2R7ZJ 1RPWA 3EDPA 4OIRF 1IJWC 2LG4A 3CDIA 4P1WA 2F48A 1S7AA 1SANA 3ZN1A 2MLGA 1HW2A 1BC8C 3R6SA 5FD6A 1BM9A 1SFUA 1LEAA 4ENNA 1R4MB 2MFZA 5LRRA 3HOXJ 3CCQI 4CSWA 2PI0A 3OV8A 4BE2A 3S3NA 5D4SA 1QPIA 3F23A 3ZQLA 5FRMA 5KAFC 2HDDA 1BI2A 2MD0A 3JTHA 1YLFA 3N97A 1H0MA 5FROA 2PMZN 4P55A 1HSJA 4FX0A 2BY0A 2B9SA 2VJJA 4O3MA 3PUFA 2VE8A 3PIOF 2M4KA 2IS4A 2HYJA 2PMHA 2QENA 4E4HA 5BMZA 1VNDA 1FYMA 1G8XA 5HNFA 3BG3A 2Q0OA 2R5YB 4A3MJ 2DFHA 4MLOA 1F36A 1GVJA 3BG5A 2DI3A 1T6SA 1WJFA 4RAZA 2LSOA 3U9GA 1EJ9A 5AONA 2Z5UA 1ZTRA 3LSHA 3BC8A 2R7RA 1RUNA 1I6HJ 3FXLA 4GXOA 3ULQB 4ABZA 4DIQA 3HPGA 2HQAA 3A01A 3PJRA 3E5UA 2L2OA 3S1MJ 5BNGA 1S7OA 3ABKH 1O7FA 3DLAA 1JGSA 3W6JB 1BC7C 4G12A 4ENKA 2Z1DA 1Z6RA 2XAGA 1MW7A 1V3FA 3IV5A 2JSPA 1V5GA 3H9GA 3M7GA 2PX9A 4A3BJ 3QYEA 3G3ZA 3JSPA 3F3XA 3BOQA 5LRSA 3C2HA 3EPZA 3I4MJ 2M8GX 2H94A 2R0QC 1IUFA 3BJOA 1XSVA 3BP8A 4Z6YA 4WX9A 2BY1A 5ICFA 2OV7A 1ETOA 1P4XA 4LLGF 1XSXA 3EETA 3OYGA 4I98B 1TC3C 1TNTA 4I2OA 2A3SA 2QWWA 2BE5F 4W97A 1HKQA 2DK8A 1IN7A 4KMUX 1DP3A 2M34A 5HS7A 5D6EA 4IZZA 4I6ZA 1VTNC 5K5QA 3JSOA 3GX4X 1LVKA 3EYIA 2EIKH 4QTRA 3FMSA 2Q2EB 3LSPA 4ESJA 2JRTA 2K40A 3SYTA 5B1AH 3K1NA 5HODA 3V8KA 3RPQA 1G6NA 5B3SH 4CICA 2J5OA 3V42A 1B8IB 2AHQA 1VQLI 2L3DA 3G1OA 1UHMA 1U2WA 2NAZA 2NYXA 1SD6A 4E7IA 2QF7A 3SEQA 5F0FA 4YRVA 3SDBA 4OIPF 3LWFA 1LNWA 2DBBA 3OL4A 1CQTA 3R0AA 1O3TA 3UNGC 2RGVA 3VWBA 3CLOA 1AOYA 4S04A 3H5AA 1X2MA 3IHUA 1SVMA 2EBIA 4BJTA 1TWAJ 1MH4A 2JWTA 2LREA 2LVSA 4V19K 2X1DA 1W7PD 2FMYA 4ZC3A 1OQYA 4PK4A 1SD7A 3OYJA 5E3MA 2ZMEA 2KJBA 4X1EA 3S16J 2WTEA 3RQ4A 1VQ9I 4HRIA 3HOUJ 2DODA 5B1BH 5EGOA 1S7EA 2A05A 1MDMA 4XSZF 4IHWA 1P6RA 4L9NA 1MBKA 1Y56A 1NHAA 2PJPA 3ZMZA 2HZTA 2V1DA 2GA2A 4HZFA 4IHSA 3QPHA 3BT9A 2KIFA 2VJ5A 4IVNA 2Y0MA 2E19A 4BNCA 5GAHJ 5D5XB 4F91B 1U9OA 4PFOA 3J80Z 2DA3A 2LOOA 3EQLF 3PNVA 3W2AA 2ZNZA 2Y69H 3HL2A 4RLFA 4LFUA 4EJTA 1YITI 3F9KA 3OOPA 1KQ8A 3SZTA 1IO2A 4A5NA 2OTLI 3QODA 1XPXA 3CCLI 3A1YA 3DPLC 2L5QA 3MAJA 2BW3A 3KFWX 4BEHA 5EG0A 2L7FP 5GPCA 3I58A 3VODA 3HGYA 3LSIA 4OAYA 5F08A 5BS6A 3CCEI 1DU0A 1G3TA 1OCOH 1LB2A 1SMYF 1SMTA 1HDPA 1A6IA 2ZJPF 1XMXA 5IY5H 2I10A 1IW7F 5FFZA 5FKLA 2E2HJ 1D8JA 1W7PA 4UB6C 2HPIA 4XRFA 3MVPA 1EH7A 1KGSA 1TW2A 1V54H 3I59A 4MTDA 1HF0A 1BN5A 3DLLF 3C3WA 1PUFA 1XGMA 2IGMA 4PUSA 3AL0C 1WCMJ 1IGNA 3H0GJ 4RGUA 3ZQ7A 1MSEC 1GHCA 1MMGA 2M7BA 2IT0A 4A3LJ 1EH6A 1B9MA 2L4MA 3MFKA 3RKXA 3W6KB 4HNTA 5LLQA 2VBXA 2WV0A 4H4KC 3Q5FA 2XSDC 1K83J 4W1UA 4D9JA 4CDGA 2KL4A 5F1JA 3IAM2 3F8BA 2E35A 2LK2A 2WY8Q 1DGWY 4FISA 3BJAA 1OR7A 3VFZA 4RGRA 3FXUA 1G4DA 5M5XJ 3VSLA 1IUYA 2RQPA 3A0BC 3HKZA 2O3FA 1YFHA 2TCTA 4LG0B 2QQ9A 2BHYA 3DP7A 2H1KA 4RM2A 2NS0A 4BJ5C 1Q1VA 2EFPA 1J7KA 1XN7A 4KICA 5A2QZ 4N0BA 1O3RA 3F21A 1UAAA 3CCVI 4B1RA 4ZH4F 2Z9OA 1YX3A 1X2NA 3C2BA 1D1AA 3IP4B 5D6FA 1ETXA 2Y0SA 3H0DA 2PJRA 4U7DA 4MHGA 2EFNA 3Q9SA 3HSRA 4N9HA 2XAUA 4Q47A 1YIJI 2QSHX 2HYGD 3BR6A 3ONQA 4UUVA 2JZYA 2K27A 4HQEA 3KP6A 3CJRB 2FX0A 4JX5A 1V55H 2F5FA 4XRSA 4XLEA 1I27A 2K4BA 3F8CA 2H8RA 1FJLA 1O3SA 2R7XA 1LEBA 4BAYA 3GTMJ 4L9VA 1JT0A 4XRSG 4C30A 1T33A 2M9HA 1D1BA 5LEKA 3VYUB 1LE8B 1GV5A 4B3XA 5DS9A 3FKJA 2BEOA 2CH0A 4M6VA 3OYIA 1ON1A 3CMEI 4FX4A 4XLPF 4RAFA 4DZPA 4UUSB 1FZPB 4XN3A 1PP8F 1BOAA 2XAJA 1PP7U 3MZHA 1FTZA 4CCLA 2W25A 1T56A 2FXAA 5LHHA 4IOAF 2BBYA 3DEUA 1HQCA 2NVXJ 2LLKA 1P2FA 2CFOA 2LBFA 4B4CA 3BG7A 4U0YA 2CGPA 4OU0A 1UZCA 2P6SA 3PNTA 4M3GA 2MH2A 3HZJA 4XBFA 1AKHA 1UFMA 2R92J 2PLYA 1FP1D 3LQRA 3QWLA 2ELHA 3G71I 4P96A 2QLZA 1X3WB 4QSHA 4UY8I 1YG2A 4A3CJ 2L9SA 3CTAA 2EB7A 1IG7A 2XHKA 4A0XA 4HLYA 3CC2I 4EQQA 1BR4A 5H6RA 5IP7J 4A3KJ 2O9LA 5J8CA 2VC1A 3M8FA 2JT1A 1ETYA 1X58A 3IWFA 3C18A 4KN4X 2ZKZA 5ED4A 4XQFA 5FB2A 1K4SA 3GFLA 5M3FJ 3L2UA 2KHMA 3KYDB 1ZK8A 2CMPA 1ZHFA 4E70A 4RB3C 4J00A 3ZR8X 4A3FJ 1OYWA 2GXAA 4YFXF 1ITYA 4RGXA 4P9FA 1K6OA 3DBHB 3TEDA 3VYRB 2V1UA 1GV2A 4CZCA 5AIPA 2DT5A 2CS3A 2IXSA 1H9TA 4BJ6C 1MBGA 1WKMA 3DPUA 5K7FA 2I5UA 2LH9A 3UKGA 4EEFG 2EZLA 4S05A 4F3QA 1ZR2A 1WH7A 2HYFA 1R7JA 3SHFA 4V2FA 2OF7A 5J6XA 3PQKA 3MKLA 4V2GA 5D5UB 3BROA 4M9ZA 3KETA 2NRAC 5HVQC 4Y3OA 2VT3A 5FKNA 1TQMA 3KP7A 4XN0A 3H5NA 4PGGA 1R23A 3BTIA 1H89C 5GADJ 2MGQA 2HS5A 4E7ZA 2VODA 3K4NA 4M73A 3E7LA 3IKTA 4IX7A 5IT9Z 2NOGA 3ZXSA 2O8XA 1I6XA 3J7AO 2B63J 3HOZJ 2ZNYA 4NBQA 1LUJB 3SQNA 2CV1A 3CLQA 4JX4A 4ETSA 1VFCA 2FJ1A 2XIGA 3EUKL 5J1UA 3RZOJ 1PJRA 2QGUA 2JA7J 2M8EA 1BIAA 1FOWA 2IGKA 3BTLA 3M9AA 1VQOI 1WJ5A 2W85A 1IF1A 3HHGA 4CYCA 5D4RA 4BDZA 3KZYA 2MBFA 1N78A 1IN6A 1YW8A 4LK1F 3CC7I 4DBRA 3EYYA 4QWQA 4IF4A 2LD5A 5EZHA 3TL4X 3IH3A 4OMYA 1ZGWA 2QZ8A 2RN7A 4B43A 2DQLA 3VYTB 1LKXA 4C9YA 2OA4A 2BY3A 2KISA 3EUHC 2DOAA 2PMZA 3KYLA 4QPOA 3Q0UA 3H3VK 1BI3A 5HLHA 5M5YJ 5BPIA 2COMA 4PDKA 2DAOA 3FZVA 1IN5A 1RKTA 4LD5A 5FGMA 3HTUA 3FF5A 1ZELA 1QGPA 1FSHA 2DK5A 5AIQA 3S1QJ 1FMWA 4A2UA 2F6CA 1XGSA 1B72B 1SD4A 1VQ8I 4XKCA 2IS6A 1IRGA 1Z91A 4ASNA 2G0EA 1X1BA 3CCJI 4YELA 1EF4A 4R1HA 3RKQA 1YOVB 2QUFA 5JHUA 5EDNA 3BJ6A 1GUUA 3QPLA 1WVRA 4Q4ZF 3FK6A 1MMDA 2EPFA 3GO5A 5CVJA 4ZZDA 2V6EA 2E5NA 2EZKA 3FXRA 5JR3A 1QZYA 3OR2C 2W48A 1V5EA 1BJZA 1JGGA 1ENHA 1WJEA 1U3EM 2DQRA 2RVCA 4NDLA 3OIPA 4B44A 2UUZA 3GBGA 4KA4A 2WWYA 2YU3A 3HOSA 2R7OA 2W00A 3FXKA 5J3LA 3SFIA 5K5OA 1QVTA 4HF1A 1DQUA 2K9MA 2Y31A 2ZFUA 1JTXA 1XCVA 2AXLA 4A3JJ 1JKRC 1NK2P 2F5DA 3A02A 2LKSA 3K4MA 3V4GA 3GWZA 3WHBA 2L4AA 1E3HA 3M1EA 1WHUA 2VQCA 1A6QA 3MN2A 4HF2A 1FOXA 1PVEA 2JA2A 2KP6A 4HSRA 4GDFA 3RKYA 4J01A 1VQPI 2DT6A 3H1CA 4HX4A 1TT0A 4XLHA 2VBZA 5J1YA 1IV8A 1TWGJ 2O6GE 3KP4A 2RNGA 1K6YA 2Y9ZA 1F43A 2XGEA 4D0PA 3RYPA 1U9NA 1LDKB 5H6QA 3P9KA 2DCEA 1SVLA 2GAUA 2P7VB 4QIWN 2AO9A 1N25A 1ETVA 1STZA 5DCMB 5DEQA 1U78A 2I8DA 1PUEE 4E7KA 2R7SA 2HXOA 2AQEA 2M30A 5TISC 5DCFA 2WB1A 2C6YA 3CO7C 3BR1A 3CMMA 1IXSB 2LR8A 2HFHA 4AVPA 4E7HA 1GT0C 1I39A 3DU6A 2XF5A 4B48A 1RETA 2Y30A 1FIAA 2A68F 2NVUB 2QA4I 2FF4A 4KDPA 2NVYJ 1JHFA 2OAZA 4GYGA 3PO3J 2ISYA 5GTIC 3LFUA 5KNLA 1MNEA 5E3LA 3CUQC 4ESBA 1CF7A 1H9GA 2EA4A 4L5IA 3LSMA 4CCKA 3LSKA 1T38A 4C2UA 4HSTA 4Y17A 3OIQA 3I3LA 2OCCH 2CUZA 4LIUA 3WU0A 5J4VA 4DYQA 5CQEA 1V5FA 4LIVA 3F8FA 3I4NJ 1B6AA 2E2JJ 3WTSC 2YUSA 4D1QA 4YEJA 2PBIA 4MNUA 1S6LA 2XSJC 3HUGA 3JRHA 3D0SA 2DDAA 3OYLA 2GQQA 3K1PA 4HPQA 2QBYA 1OKRA 2R7FA 4D7MA 3DTIA 3C1DA 4HBLA 1VF9A 2OD5A 3ZQFA 3AL0B 1Z3XA 3G4SI 1R5HA 5CJ9A 3OYMA 4G7ZF 1NH3A 2H27A 1UG0A 3O3KA 3S2HJ 1IXCA 1K79A 2HOTA 3FXMA 4AYBN 1FIPA 3W2WA 4UV8A 2V7FA 3R0JA 3FISA 2IPQX 1W5SA 1JKQC 1OYIA 3ECOA 3HG9A 3TKYA 4O6JA 4L5JA 1LDJA 2V9KA 4EJVA 2WAEA 3FM5A 2OBPA 2XROA 3ROUA 2XF7A 2VONA 5J4YA 4U87A 2IVMA 2ME0A 4UXNA 4AIDA 2QSGX 3GTKJ 2R7WA 4D7NA 3GW2A 4UNOA 3V7SA 2IEKA 1TW3A 1XGOA 2Z16A 5HDKA 1G59A 2FU4A 1RZ4A 1JE8A 3H9QA 2V6CA 2OZ6A 1Y0UA 4LJZF 1IV6A 5IP9J 2A5YB 5J47A 4UUTA 3Q9VA 2X9DA 4IQJA 4N4OB 2NOJB 2TRTA 1UHWA 4CHUA 4HAMA 2OTJI 2LKXA 1SVOA 2X0LA 1J9IA 4IPAA 1R9TJ 1REPC 4F55A 1HLVA 1MGTA 1R5GA 3FIWA 4XOPA 2E7XA 3O2PE 2RAEA 4Y52J 3KIOA 1DU6A 1MSFC 4DBQA 3QQAA 3OSGA 1U5TC 3GLXA 4XORA 4JX6A 2FUG2 1SAXA 4XKBA 2FE3A 5ICGA 2GZWA 1Y1VJ 4NC7A 1U0JA 4N9IA 4LLLA 2Z2SB 3GCMA 2QQ8A 2E60A 1BOBA 2O61A 3TW7A 2CUFA 2XGCA 2DTZA 5DD4A 2GOXB 3W2VA 3GUDA 3PNYA 2CUJA 2RREA 1HC8A 3IL2A 3LA7A 1SFOJ 4XLNF 3TP0A 1FC3A 5DM6F 3JRDA 2LC2A 4IXAA 2YX4A 1Z6TA 2A6EF 3OYAA 1SD5A 2MLKA 2ZXHA 3KEQA 2X6YA 4XICA 3HJEA 3R4KA 2K85A 2JUGA 3E5QA 3SZPA 2R5YA 1A31A 3CUOA 1XCBA 3HSEA 4OMZA 2XGXA 3M4OJ 1USSA 2ECCA 3VPRA 3GXOA 2Y2ZA 1WWXA 2BV6A 3L2RA 2VOPA 1P9QC 1VQKI 2A61A 2HTSA 3K69A 4OINF 4G9YA 4PFPA 3MKYB 5LGNA 1MMNA 1TWHJ 4M72A 4QPQA 3S3OA 2KRHA 4ZTFA 4CCJA 4GYIA 2JQ7A 1G3WA 3GTGJ 2VN2A 3CCUI 1MIJA 2PN6A 4PGHA 2R5ZB 3R61A 4DJAA 1D5VA 1DPUA 1FPQA 2KIMA 3KX2A 3K6GA 3S17J 1IDZA 2EFQA 2FNPA 3NRVA 2NXNB 2H8WA 3KZZA 1NK3P 2M1BA 3BZCA 2VIXA 1Z9CA 5BQTA 3TDUC 1JJ6C 1NG7A 2F5VA 3F6VA 4KIFA 3DV8A 1FP2A 2EIMH 9ANTA 2XGDA 3JREA 1HW1A 4IKFA 3J7ZI 4ITVA 1RRJA 1CGPA 4IL6C 3C2GA 5FKMA 3OYFA 3K70D 2JN6A 2PFBA 3O8HA 3D5LA 2V4JC 1QPMA 2JJ7A 2EWNA 2QQBA 3V8LA 5E3NA 1HDDC 3BG6A 2WADA 2OQRA 4DNCA 5CVRA 5M5WJ 4JYKA 2FMLA 2Q2EA 3U1DA 3IC7A 2XUBA 3FDYA 3M1CA 2EFOA 1T95A 3MCZA 4PCQA 3TW6A 1M1EB 5CVVA 3HRTA 1JUMA 1T0FC 2DA7A 3B02A 1MZBA 3I71A 3ZQHA 1B8IA 4KFCA 2IRFG 2R7QA 1FYKA 1P7JA 4FASD 4ZYHA 4HDUA 1ZKGA 3DU5A 3A2KA 1S9HA 4HA8A 4ZTJA 3P7NA 3LAJA 1Y0NA 2DMPA 1UG2A 3QYBA 3S14J 2XAHA 5E17F 4PSXA 1FYLA 4HX8A 4KJZA 5CQGA 3G1MA 3PSFA 2NVTJ 5KAIC 4LB6B 2VT2A 1R1TA 1EKEA 2K3PA 3K0LA 3J81K 2WAQA 3BQYA 4E7JA 2JA6J 1FTTA 2Z3YA 1ZAOA 4IRIA 4ZDOA 1WJDA 4AIKA 3PM1A 3HM5A 4BY1J 1XDUA 3BDDA 4L9JA 2L7KA 1QZEA 2BXYA 4UV9A 2LMDA 3ESWB 4YG2F 1ACIA 1IRZA 1R1VA 3WTWC 4C3JJ 3L9FA 1RESA 2DTRA 3K2AA 1J5YA 5GP9A 3ZP5A 4FQGA 4JBAA 1Z7LA 3JRAA 1BA5A 2L01A 4F92B 1J0RA 2BZTA 2BHZA 1R36A 1ZN2A 1KQ9A 5F6FA 4M3BA 4EJOA 4E7SA 2DJNA 2XVCA 4A5MA 4A93J 3OIOA 4PJJA 2CV0A 1WH5A 2VJ4A 3GZNB 2KZGA 3GZ6A 2IBDA 2K86A 2KZVA 2E7WA 2HVQA 4C3HJ 5FRNA 4JQFA 3FX3A 2VQGA 5DYMA 1YJNI 1IC8A 3IKVA 2O0YA 2K4JA 2MH9A 2H6BA 3JRCA 4L0YB 1LJ9A 3OYBA 1MBEA 2N8GA 4BHPA 2ZO4A 3GFMA 4MGRA 3K1MA 1ZQ3P 2V9VA 4DYCA 2OC6A 4YIRX 4M9XA 4BQQA 3E6CC 3BZKA 3EUHA 2NS8A 5HLTA 1OCPA 3K7AJ 2X51A 1MBHA 3QU3A 5KCMA 1BJAA 2A5WA 5E3OA 2AQFA 1RIOH 1J75A 1MJBA 1D1CA 2CSOA 1ETWA 3ABLH 4GCVA 2XB5A 1QHHD 1W5TA 2OU2A 2QSFX 2GM4A 1IZ1A 2HDCA 1YE9A 3S8PA 2DOFA 2K9NA 5E18F 4J19A 3QOPA 3PO2J 5JLXA 3TMOA 4QLCU 4CH7A 2Q8KA 2ZXWH 1BI0A 1ULYA 5JI6A 4GFBA 1W0TA 2W57A 5F27A 4YFNF 1E0EA 3KP3A 2B0LA 2VUMJ 2CUEA 2XKOA 2L9NA 4P9UA 1YS7A 4LG0A 2IW5A 1MNDA 3DBLB 2AS5F 2OJED 5HOOA 1ETKA 4BXFA 4CYDA 1R71A 2MD5A 4HF0A 2BY2A 2JA8J 3QOEA 2CW8A 2K9LA 2LKPA 3E6DA 2GLOA 2HTJA 3M8EA 2HQRA 2CRGA 2JTVA 3OSFA 3CCSI 1HA8A 4M6YA 2ZC2A 3WGHA 1XB4A 2VBWA 1SC7A 3MZYA 4IHYA 5E8GA 3CUQB 3TBIA 4AD9A 3HGGA 1TT5B 1U6GA 2BVMA 4XLAA 5FJ8J 1XX5A 3A4CA 1ZG5A 1OISA 2VJIA 1UB9A 2R7UA 4U0VA 1MJAA 2FD5A 3JAMK 3WHCA 3MMYB 2NNYA 4MTEA 3VDXA 4AIJA 2LYCA 1QNTA 1FOKA 3FMRA 4PJ0C 2DFIA 1GXPA 2ZMEC 3FM3A 1ON2A 4C3IJ 1HXDA 4XLFA 3F0CA 2MA3A 1Y8RB 4OIOF 3KPHA 1E3OC 1R49A 1LE8A 2VKDA 2KDZA 3V8JA 3S1RJ 3OS0A 3HB9A 1QHGA 4HLXA 1L0OC 3KE2A 3OS2A 1OCZH 2UWMA 4G7OF 2EA2A 4UUSA 1ZR4A 2NVQJ 1Z0XA 3S32A 3N4MA 2TDXA 2MC3A 3D5SC 3WTYC 2WA0A 1FBQA 3ZQQA 5ICCA 5TRDA 2HPMA 2CFXA 1KYWA 4XM3A 4I76A 1YO5C 2KQRA 5EEHA 3CD6I 2DYRH 4MIMA 2ZFWA 1B59A 3CCRI 1ZYRF 4FETA 5EEAA 2IS2A 5DDGA 3LA2A 1WJBA 3ABTA 1J59A 4LITA 1JKPC 1WGXA 2HQNA 1JT6A 3OWTA 5CLSA 3DQVC 1P7IA 2Y9YA 5JHFA 3MKZA 3DEWA 2R7VA 3BCBA 4B3AA 4B09A 5ICEA 3J7YJ 4KUMA 3E6BA 3HPHA 2L0KA 4CCOA 3BLYA 2AXTC 4E6KG 4A12A 3HOTA 4RAYA 5ILVA 4WK8F 1A35A 2DA4A 2K5CA 3LMMA 4AYBA 4KITB 1X4PA 1TWFJ 5IT3A 3CO6C 1WPKA 4A3EJ 2BXZA 2MSYA 2XPWA 2CYYA 2E1OA 4EJWA 1U5TB 1VQMI 1W5CC 1R1UA 3NARA 4HV6A 2HXIA 1TP4A 2GIZA 3CESA 3ZCOA 1YYVA 1OFCX 4CO8A 3D1NI 3F6OA 4MQ9F 2L9VA 5IOZA 4HOBA 2F2EA 1IDYA 1W1WE 3HYIA 3IAS2 1J09A 3HBLA 4NQWB 3K2ZA 3DKXA 1APLC 3U21A 4EM2A 2IJLA 1YIOA 1OR7C 4B47A 4PSWA 4DGWB 1QO0D 1PYVA 3I0TA 1Z1DA 3C7JA 3UR3C 4RDUA 2E1NA 1K7AA 1QBJA 1XGNA 3CDHA 3HKZN 4HX7A 1LPQA 2DYSH 3B73A 1I1SA 3I4PA 1OLTA 2ECBA 2R3SA 4JP0A 3U1KA 1JJ8C 2O8KA 3GF2A 5KVRA 3BR5A 3O8GA 1MMSA 3H35A 1TQIA 3RYRA 1MD0A 3FBNB 2QKMB 4O5VA 1G3YA 1R00A 1Y1WJ 2LY1A 3RSNA 1EV7A 1FY7A 2EH3A 3RJPA 2XRLA 4IHVA 3TQNA 3K10A 2UV1A 4TV7A 2RC4A 5DUIA 1D0XA 4HG2A 1T8IA 3T8RA 4XMYA 2CO5A 4HW0A 1GXQA 1X3UA 3NQOA 2DA2A 3GEZA 2HNHA 1RNLA 3SFZA 1TNSA 2W7NA 2X4HA 1RR7A 3OYHA 2EV5A 3H36A 1E3PA 3U2RA 5E8IA 4XKWA 4OWRB 1YQAA 3CCYA 3VYSB 1P92A 1MH3A 1Z77A 2E1MC 2L7MP 2EZIA 2X85A 3PQJA 3L1PA 1USTA 4XL9A 2COBA 2LF7A 4G94A 5BOXA 5BPDA 1ERDA 2P5VA 3BPVA 2E36A 3TO9A 4IHTA 4RBOA 4NNJA 1TZLA 2JPBA 1RR8C 4L9TA 3WGGA 1UHSA 2EILH 1AHDP 3DCFA 1S8NA 1B72A 2RNJA 3MWMA 5HLIA 3E1SA 5JFRA 6PAXA 3RIRA 5IYBJ 2EJRA 3B6CA 2VBYA 4KMFA 5F04A 2GA1A 1BI1A 5EZGA 2K02A 3DTEA 1LQ1A 1KU7A 4RAGA 2VASA 2FEZA 5JLWA 3HOVJ 4YIFA 2D1VA 3HXLA 5IP6A 4UVBA 3MD2A 1RI7A 2RQQA 4LOCA 3ABMH 2M0MA 4U88A 2MW8A 2FBHA 3HHHA 3OOUA 5LHIA 2VC0A 3BQZA 2P8TA 2XV4S 5HNHA 1ZG3A 2P5LC 1VQ7I 4R8HA 2XPVA 1G2HA 5L3FA 4Z2YA 2X1CA 2P7CB 4U7BA 2IA2A 1KU9A 4HNVA 1FBSA 3K4CA 3KEOA 3OY9A 2M2EA 4RM3A 1XMKA 2VL8A 4XKVA 1L3LA 3FWEA 3PFYA 3CDLA 4ZYEA 1FEXA 1Y6IA 4I0AA 3DTKA 5FFXA 1WI3A 1I1GA 1MMAA 1XMAA 1TWCJ 4G6TB 2FOWA 4KIBA 1AU7A 3GVAA 3ELKA 5DCMA 4XK4A 2YS9A 5E20A 3RPUD 2F4MB 5DV5A 2GXGA 3HSFA 3WU2C 2L54A 4BYYA 2D1HA 1T0FA 3SEZA 5HLGA 2XF6A 4KN7X 4EJUA 3GTJJ 3H3UA 3PSIA 4A3DJ 4I0BA 3ECHA 3KYCB 2V1XA 4D5CA 1WZ2A 1IXRC 4MFEA 3PIPF 2KKOA 3OS1A 4NC6A 1C0WA 2BGCA 3RZDJ 3AG3H 5CPRB 1YJWI 1S29A 4BY7J 2J5PA 5B66C 1ORKA 3FXQA 2EV0A 5DM7F 4FE7A 3OMYA 1JUSA 2HVRA 2ZSHB 3A01B 1F4KA 2VQHA 3DPTA 2E5ZA 1YTYA 2WBMA 1AA7A 3L2WA 2HU9A 2KIQA 3GLLA 2IAIA 1XS9A 2VQLA 1I50J 4RB1A 2Z33A 2HDWA 2B7EA 4PJNA 2KMUA 3OR1C 1JKOC 1Z05A 1VQ4I 1QA6A 3S2WA 2ZB9A 3LSGA 1D0ZA 1VQNI 4ZZLA 3I54A 2ZCWA 2IP2A 3K4KA 4F93B 4X0GA 1RC9A 4UVCA 3ISPA 3ZMTA 2OUMA 4XRMA 2Q1ZB 5K7ZA 3HC7A 2W82A 4IRGA 3G6EI 2H6CA 3AG1H 5ILUA 3CMYA 3RPUA 3BWGA 4JK1X 1BBYA 2BVLA 5HS9A 3WTXC 5IOYA 1K4TA 1OCTC 4ZDLA 1K61A 4ZDPA 5ILSA 2XAFA 4A0ZA 3OYEA 3LSRA 3HRMA 2CQQA 4GGGA 2X6WA 3RTRA 4CCMA 2XC7A 2ETHA 4XLCA 2K7LA 4AC0A 1FBUA 1N77A 3CF2A 3KLOA 3TDZC 3TO7A 2ID3A 1R4NB 4WXCA 3FXOA 3SJMA 2NNNA 3ZRGA 4IO9F 4EMSA 2FBKA 3L00A 1B1BA 1POGA 2HOAA 2DO7A 1BR2A 2EV6A 2ZBKA 2LP0A 2O7OA 2KT0A 2IA1A 3BR2A 3G73A 2ZJQF 1AWCA 2DMQA 2CQ7A 1TQPA 3KLNA 2DN0A 3ERMA 2MC4A 5E1ZB 4G7HF 2HQ5A 3I53A 3B6AA 3FXJA 3WG9A 2FSWA 3LSTA 2M3AA 5D5VB 1FSEA 2CQXA 2VKVA 1JUPA 5J8FA 2DT7B 3VB2A 2OPTA 2R4GA 3MQ0A 4I09A 1ZLJA 4ZYDA 1WI9A 2L02A 2VI6A 4BS9A 1SFKA 2XKPA 2KJCA 1YJ9I 1IN8A 1LVAA 3F8NA 2L7ZA 3K9TA 1A36A 1UELB 4M74A 3H3ZA 2W24A 3HEFA 2FRHA 5IYCJ 1D3YA 2ZMEB 2R7DA 2DOEA 1ZGJA 2QCOA 1XTAA 1ODDA 5EGOB 2VE9A 4WXDA 4BHBA 2GWRA 2HOSA 1MDMB 4UHTA 4ENJA 1WSUA 4RLQA 2JRMA 1ZREA 1QQIA 4I02A 1RUOA 2LF8A 2FQ3A 2P81A 1IRXA 3KP5A 3KZIC 5D8LB 4FTHA 3P9IA 3HOYJ 5LBQA 4BXUA 2CV2A 2OCEA 2WB1N 2D45A 3CP8A 2DA5A 2DLLA 3WTUC 3OL3A 1LFUP 2HZDA 1LDDA 3GMEA 3IH4A 4CUGA 5FO5A 2KLOA 5GAGJ 4A0YA 1X1DA 1DGRM 2DA6A 5H2FC 3T0YA 3RI4A 1KYZA 3ERED 5J40A 2A6TA 2ICWG 2WAFA 2XASA 3MEXA 3G1LA 1FNNA 3FKIJ 2BW3B 2V9PA 3QAHA 3KEYA 3ZOBA 3TOAA 4CXFA 4BEHB 4Y7NJ 5EG0B 3K4JA 1T08B 1V4RA 4HEA2 4FCYA 2IGOA 2DXIA 4NB5A 3OYKA 5EF6A 5GTHC 2M7AA 2V26A 2R5ZA 2OQGA 4IHXA 4KISA 5L3DA 2FNAA 1KU3A 1O7LA 1XDSA 2ME6A 3CJNA 3IWZA 1W7PB 4LB5A 4XR6A 2HKOA 3O6BB 2JVGA 4N4NB 3WGIA 2UXXA 3J80K 2LY2A 2F5EA 3I59B 3JRFA 1O3QA 1PUFB 4OOIA 1UJ8A 4OAZA 4WXHA 4AU7A 5H20A 2RV8A 3LOCA 5C44J 2E71A 2VB6A 5CVUA 1W36C 2WY7Q 3ZQIA 1E17A 2ELJA 3H9JA 3HIFA 4G6QA 2W1OA 1S3JA 4EM0B 3I9V2 3BR0A 2VPLA 1JHHA 2HOEA 3BCAA 5LHGA 2QKLB 1HOMA 2EIJH 2K9QA 2MYSA 3S1NJ 4G8XA 2M5WA 4BBSJ 3BG9A 3ZMSA 1HW5A 3HOWJ 4RA2A 2KDOA 3WE2A 4AVZA 3FBIB 5KHDA 4JOMA 2ZJ2A 3NWTA 4EV0A 2V79A 3L2QA 2K9SA 2PEXA 1KQ0A 3ZMUA 3J81Z 1J2XA 2QVOA 3DXJF 4I99C 4AM3A 4LLNA 4F7ZA 4BDYA 1SEUA 4Y33A 1Z21A 2H09A 4A69C 2JUCA 5EYRA 3CQZJ 1KONA 3S15J 3W3CA 2UZKA 5GAEJ 1JTYA 3J7AY 3GYHX 3Q0VA 4GO1A 4AUXA 4BU2A 2KRCA 2CW0F 4II2A 2A6HF 1O57A 5D8KB 2ELKA 3BTCA 3F72A 1SFEA 2QM3A 1R22A 2JK3A 2PJRB 2HKXA 3R60A 4DZJA 4GRIA 2KIUA 3AG2H 4LMYA 4A6EA 3RDIA 2F4OB 2QQAA 2ZXIA 1ZGAA 3T1BA 1UMQA 1R6RA 1VZ0A 5CKTA 2O5RA 3WTVC 2QEXI 4CZZA 3E3VA 5JVGF 1X3ZB 3CJTB 3IUOA 2CJJA 4UB8C 2DDBA 4MEXF 4BUPA 4HQMA 1YS6A 3K4BA 4M9SA 1P4WA 3E5XA 1MBJA 5DTDA 5A2QK 3OYNA 4Y13A 1T2KA 3DF8A 3CZ6A 1TBXA 4II3A 1BL0A 3H92A 1D5YA 3WE3A 3PUBA 3SXYA 2E1MB 4BHCA 1QZZA 3LL7A 1DPRA 5L3GA 1DDNA 5TJJA 1X4OA 3JRBA 2YR2A 3Q3SA 2X1EA 5LD2C 3M07A 1FX7A 1LFBA 3JRGA 2GBYA 3NEUA 5E1WA 2M45A 2PQ8A 4Q48A 2FBIA 3REOA 4L18B 1W0UA 4DOZA 4KT5C 4LG3A 1XD7A 2D2WA 3TP3A 1T98A 1Y8QB 2RKHA 2LBFB 2VOOA 3LAPA 1F1ZA 1F9NA 3I64A 3CF5F 1Q1HA 4EGYA 4DYRA 3HRUA 1AKHB 1TTYA 1A04A 3S2DJ 3LSJA 2P5KA 4ZYAA 2DPDA 3LFKA 1S72I 4Y4RA 3P9CA 3PL8A 5L3BA 3MKWB 4NC8A 2WC2A 1U8BA 2R7TA 4ESFA 4BQAA 3VSKA 3QU6A 4UVAA 3N05A 2P6TA 5F0CA 3AG4H 2X48A 1GVDA 4H0EA 4RS8A 4BBRJ 4C2TA 2JA5J 3ZGKA 1BW5A 5D5WB 4IRHA 3G2BA 2OZUA 1VI0A 4HDVA 2GXBA 3ASNH 1IRFA 2W4SA 5DUKA 3ZQCA 3GTPJ 3QRFF 2YU9J 2A07F 1W4MA 3SZGA 4EATA 5GPAA 4X6AJ 3SDGA 2P4WA 4PZJA 2R93J 2G7UA 2V1NA 2VXZA 1KU2A 1EH8A 3KCCA 2DMNA 4HNUA 4MEYF 4M3DA 2STWA 3NWSA 2EINH 1LFPA 1Z3YA 4M3EA 1SFXA 2Z99A 3ZQGA 5KK1A 1HSTA 4KIGA 1ONVA 2DFFA 4K2EA 5C4XJ 3E6MA 1DP7P 2GOMA 2HEOA 4HYEA 1ZRFA 4YIIA 3JAMZ 3RQIA 3D5RC 1OCCH 3VOEA 1ZRDA 4BXXJ 1GDTA 2PMUA 2ID6A 3BZ6A 4Q5SF 3NAUA 3IRQA 5K5RA 3I56I 2G7HA 3JCUC 1OJLA 1OMIA 1TLHB 4P5OA 3I55I 2F4IA 4DW6A 1XC5A 3QYFA 4KNYA 2EQRA 1NTCA 4BACA 1Z7UA 3DBRB 1NG6A 4M71A 3CUQA 4XNFA 4IJAA 4Y15A 5CVIA 5HS8A 2LFBA 4DQ2A 4XSXF 3GTLJ 4RB0A 4CGZA 4CYCB 3CMAI 3FMQA 4EVIA 2FOKA 1MNMC 5FKKA 2WV1A 2KPMA 2O03A 4F52A 1B9NA 5IT9K 2ISZA 4U0WA 5HDGA 2M87A 2VKEA 2WAQN 2XRNA 3ZMVA 1HKTA 2DMUA 3QP5A 1ZG1A 3K70C 2IGNA 2ADUA 4A3IJ 3DKWA 2A69F 1YW7A 4ANJA 1OPCA 2E2IJ 3FHNA 2HWVA 2NS7A 2Y75A 1YI2I 3RKWA 2DMTA 3ZN0A 3PFIA 1XG1A 2LNBA 2DA1A 1YW9A 1WJAA 5JVTA 2DPUA 3DEEA 4AIHA 1H8AC 1ZRCA 3MZ8A 5TGTA 1OCRH 1Z67A 3E0JB 1N75A 3DWLE 2DU9A 3JW4A 3TGNA 2CG4A 5C4JJ 1X1CA 2YSRA 1F5TA 5M3MJ 4BE0A 1X19A 2X6XA 4PJMA 3TOBA 4LGWA 3TO6A 5FLXK 3H5RA 4RMNA 5L3EA 2KRFA 2E1CA 5B5EC 2ZJRF 4I7HA 4IQ4A 4BH9A 3VEPA 4C2MJ 4EM1A 1G3SA 2VLAA 1H88C 3AFHA 3A03A 3IH2A 3RCOA 3LA3A 3JR9A 2STTA 1FMVA 4CCNA 2XDVA 4D5FA 2YPRA 1QVUA 3L2CA 1P4AA 1JXSA 5FD5A 3FK7A 4BKXA 1KA8A 2IS1A 5FLXZ 3CP2A 1VQ6I 4LK0F 1WQ2A 3BR3A 3P5JA 5FKOA 3WU1B 1ZARA 1SAUA 2EK5A 5EJCA 4M3FA 5F64A 3QP6A 2UXNA 2CQKA 2FA5A 3M8JA 3V7CA 1IAWA 4ZJZA 4NHJA 4FHTA 5IPAA 1A5JA 5LGUA 3HDDA 3HTSB 4S0HB 4MO7A 3WTTC 3WODF 4WF2A 3BPXA 2Y0SN 3X2QH 1U5TA 4KT6A 1YRNB 4BGDA 2HGCA 4BQNA 4PJLA 1R5ID 3CJQB 1O4XA 3ZPLA 3JTGA 1EA3A 5EEGA 5L3CA 1I3AA 5E79C 3OYDA 1WFXA 2VXDA 2ACJA 4L0ZB 2ZSIB 2QYOA 3LNQA 3W6VA 2ESHA 1MKMA 3A0HC 5DD8A 1ZLKA 1D8KA 1MBFA 2K3FA 4NQWA 2M0CA 1X1PA 2LRDA 2MG4A 2YX7A 4CA0A 2XB0X 1VQ5I 1YX5A 3ML6A 1FLIA 1U8RA 3M3YJ 5IYDJ 4KYWA 1E2XA 4XONA 1D0YA 3BY6A 3S93A 4R79A 1XSDA 4BE1A 3E97A 2JSCA 4XIDA 3JRIA 4WWCA 1RKWA 4XOTA 2CU7A 4ENMA 3BTJA 4FT8A 5LEJA 3F22A 4ON0A 3V7RA 5ERIA 4RB2C 1BIBA 2DJIA 2PG4A 5K1YA 1QRYA 4YFKF 2EZHA 2HVSA 1CF7B 5J1RA 4L5EA 2BYVE 4B8XA 1K78B 2FQ4A 3GZ5A 1HKSA 5K7HA 1Y39A 3L09A 1PDNC 1YRNA 2LTPA 5HDNA 3AKZA 2HI3A 3KP2A 4MFDA 2JVHA 3AAFA 2VPRA 4IOCF 2P0WA 2E34A 1TL8A 4FE4A 1MJ9A 3I5UA
chains in the Genus database with same CATH topology
3COAC 1FT9A 2QBYB 3GFIA 3DFGA 5LGTA 3QPTA 2W84A 4AWXB 1I5ZA 1UCRA 1ZH5A 2RDPA 4M6XA 1HBXG 1B4AA 4ZYGA 2EFWA 3ZMDA 4HV5A 2ZXJA 4RGSA 1T39A 3WTZA 3L7WA 3F8MA 3FHZA 2IA0A 2XAQA 1IN4A 4WCGA 2CWEA 1K78A 2ESNA 5CYVA 3T5XA 4MQVA 3T8TA 2G9WA 5E1XA 2LDUA 4I01A 1DUXC 3GFJA 3IRRA 3ABUA 1R58A 1FWZA 1WRJA 4G6DA 2GIVA 2DW4A 3HRSA 2Y48A 4EGZA 2HR3A 5F1RA 1OYYA 4OIQF 2JPCA 2F5CA 3LQQA 4A6DA 3EDPA 4OIRF 1S7AA 3ZN1A 2MLGA 1HW2A 1BC8C 3R6SA 5FD6A 1BM9A 1SFUA 1LEAA 4ENNA 5LRRA 2PI0A 3OV8A 5D4SA 3F23A 1BI2A 3JTHA 1YLFA 3N97A 1H0MA 4P55A 1HSJA 4FX0A 4O3MA 2VE8A 2PMHA 2QENA 5BMZA 1FYMA 2Q0OA 1GVJA 2DI3A 1T6SA 4RAZA 2LSOA 3U9GA 5AONA 2Z5UA 1RUNA 4GXOA 3ULQB 3E5UA 1S7OA 1O7FA 1JGSA 3W6JB 1BC7C 4ENKA 1Z6RA 2XAGA 1V3FA 3M7GA 3G3ZA 3JSPA 3F3XA 3BOQA 5LRSA 2H94A 3BJOA 1XSVA 3BP8A 4WX9A 5ICFA 1P4XA 4LLGF 1XSXA 3EETA 4I98B 1TNTA 4I2OA 2A3SA 2QWWA 2BE5F 1HKQA 2DK8A 1IN7A 4KMUX 5HS7A 5D6EA 1VTNC 5K5QA 3JSOA 3GX4X 3EYIA 3FMSA 4ESJA 2JRTA 3K1NA 3V8KA 3RPQA 1G6NA 4CICA 2J5OA 2L3DA 1UHMA 1U2WA 2NAZA 2NYXA 1SD6A 4OIPF 3LWFA 1LNWA 2DBBA 3R0AA 1O3TA 2RGVA 3CLOA 1AOYA 4S04A 3IHUA 1W7PD 2FMYA 1SD7A 2ZMEA 2KJBA 2WTEA 1MDMA 4XSZF 1P6RA 4L9NA 1NHAA 2PJPA 3ZMZA 2HZTA 2V1DA 2GA2A 4HZFA 4IHSA 3QPHA 2KIFA 4IVNA 2Y0MA 4BNCA 5D5XB 3J80Z 3EQLF 2ZNZA 4LFUA 4EJTA 3OOPA 1KQ8A 3SZTA 4A5NA 3DPLC 3MAJA 3KFWX 3I58A 3VODA 5BS6A 1G3TA 1LB2A 1SMYF 1SMTA 1IW7F 5FFZA 1D8JA 1W7PA 4XRFA 1EH7A 1KGSA 1TW2A 3I59A 4MTDA 1BN5A 3C3WA 1XGMA 4RGUA 3ZQ7A 1GHCA 2IT0A 1EH6A 1B9MA 2L4MA 3MFKA 3RKXA 3W6KB 5LLQA 2VBXA 2WV0A 3Q5FA 4CDGA 3F8BA 3BJAA 1OR7A 3VFZA 4RGRA 3FXUA 1G4DA 1IUYA 2RQPA 2O3FA 1YFHA 4LG0B 2QQ9A 3DP7A 2NS0A 2EFPA 1J7KA 1XN7A 4KICA 5A2QZ 4N0BA 1O3RA 3F21A 4ZH4F 2Z9OA 5D6FA 4U7DA 4MHGA 2EFNA 3Q9SA 3HSRA 4N9HA 4Q47A 2HYGD 4UUVA 2JZYA 2K27A 4HQEA 3KP6A 2F5FA 1I27A 2K4BA 3F8CA 1O3SA 1LEBA 4BAYA 4L9VA 5LEKA 2BEOA 1ON1A 4FX4A 4XLPF 1FZPB 1PP8F 1BOAA 2XAJA 1PP7U 3MZHA 2W25A 2FXAA 5LHHA 2BBYA 3DEUA 1HQCA 1P2FA 4U0YA 2CGPA 4OU0A 2P6SA 2MH2A 4XBFA 1UFMA 2PLYA 1FP1D 3LQRA 2ELHA 4P96A 2QLZA 1YG2A 3CTAA 2EB7A 2XHKA 4A0XA 4HLYA 4EQQA 5H6RA 5J8CA 2VC1A 3M8FA 2JT1A 3IWFA 3C18A 4KN4X 5ED4A 2ZKZA 5FB2A 3GFLA 1ZHFA 4E70A 4RB3C 1OYWA 4YFXF 4RGXA 4P9FA 1K6OA 2V1UA 5AIPA 2DT5A 1H9TA 1WKMA 4S05A 2HYFA 1R7JA 3SHFA 5J6XA 3PQKA 5D5UB 3BROA 4M9ZA 3KETA 2NRAC 5HVQC 2VT3A 1TQMA 3KP7A 4PGGA 1R23A 2HS5A 2VODA 4M73A 3IKTA 5IT9Z 2O8XA 1I6XA 3J7AO 2ZNYA 3SQNA 4ETSA 2XIGA 2M8EA 1BIAA 3M9AA 2W85A 1IF1A 3HHGA 5D4RA 3KZYA 2MBFA 1IN6A 1YW8A 4LK1F 3EYYA 4QWQA 4IF4A 4OMYA 2QZ8A 2RN7A 2DQLA 2OA4A 1BI3A 5HLHA 5BPIA 2COMA 4PDKA 2DAOA 3FZVA 1IN5A 4LD5A 5FGMA 3HTUA 3FF5A 1QGPA 1FSHA 2DK5A 5AIQA 4A2UA 1XGSA 1SD4A 1IRGA 1Z91A 4ASNA 4R1HA 2QUFA 5JHUA 3BJ6A 4Q4ZF 3GO5A 5CVJA 4ZZDA 3FXRA 5JR3A 1QZYA 1U3EM 2DQRA 2RVCA 4KA4A 2WWYA 2YU3A 3HOSA 5K5OA 4HF1A 1XCVA 2AXLA 2F5DA 3V4GA 3GWZA 2L4AA 3M1EA 4HF2A 3RKYA 4HX4A 2VBZA 2O6GE 3KP4A 4D0PA 3RYPA 1LDKB 5H6QA 3P9KA 2GAUA 2P7VB 1STZA 5DCMB 5DEQA 1U78A 1PUEE 2M30A 5DCFA 2C6YA 3CO7C 1IXSB 2HFHA 4AVPA 2A68F 4KDPA 2FF4A 1JHFA 2OAZA 4GYGA 2ISYA 3CUQC 4ESBA 1CF7A 1H9GA 2EA4A 4L5IA 1T38A 4Y17A 3WU0A 3F8FA 1B6AA 3WTSC 2PBIA 4MNUA 1S6LA 3HUGA 3D0SA 2GQQA 3K1PA 2QBYA 1OKRA 2R7FA 4HBLA 3C1DA 2OD5A 1R5HA 5CJ9A 4G7ZF 2H27A 3O3KA 1IXCA 1K79A 4UV8A 3R0JA 2IPQX 1W5SA 1OYIA 3ECOA 3TKYA 4O6JA 4L5JA 1LDJA 4EJVA 3FM5A 2OBPA 2XROA 3ROUA 2VONA 2IVMA 4UXNA 3GW2A 4UNOA 3V7SA 1TW3A 1XGOA 5HDKA 2FU4A 1RZ4A 1JE8A 2V6CA 2OZ6A 1Y0UA 4LJZF 2A5YB 3Q9VA 1UHWA 4CHUA 4HAMA 2X0LA 1J9IA 4IPAA 1REPC 1MGTA 1R5GA 2E7XA 3O2PE 1U5TC 3GLXA 1SAXA 2FE3A 5ICGA 2GZWA 4N9IA 4LLLA 2O61A 5DD4A 3GUDA 3IL2A 3LA7A 4XLNF 1FC3A 4IXAA 2YX4A 1Z6TA 2A6EF 1SD5A 2MLKA 3KEQA 3R4KA 3E5QA 3SZPA 3CUOA 1XCBA 3HSEA 4OMZA 2XGXA 1USSA 3GXOA 1WWXA 2BV6A 2VOPA 2A61A 2HTSA 3K69A 4OINF 4G9YA 5LGNA 4M72A 4GYIA 1G3WA 2VN2A 2PN6A 4PGHA 3R61A 1D5VA 1DPUA 1FPQA 2KIMA 2EFQA 2FNPA 3NRVA 3KZZA 2M1BA 1Z9CA 5BQTA 3TDUC 3F6VA 4KIFA 3DV8A 1FP2A 1HW1A 1CGPA 2PFBA 3D5LA 1QPMA 2EWNA 2QQBA 3V8LA 2OQRA 4DNCA 5CVRA 2FMLA 2Q2EA 3U1DA 3IC7A 2XUBA 2EFOA 3MCZA 4PCQA 5CVVA 3HRTA 3B02A 1MZBA 3I71A 4KFCA 2IRFG 1FYKA 4HDUA 4ZYHA 4HA8A 3P7NA 3LAJA 5E17F 2XAHA 1FYLA 4HX8A 4LB6B 2VT2A 1R1TA 3K0LA 3J81K 2Z3YA 1ZAOA 4IRIA 4AIKA 1XDUA 3BDDA 4L9JA 4UV9A 4YG2F 3WTWC 1R1VA 3L9FA 2DTRA 1J5YA 3ZP5A 4JBAA 2L01A 1J0RA 1R36A 1ZN2A 1KQ9A 5F6FA 4EJOA 2XVCA 4A5MA 3GZ6A 2K86A 2E7WA 4JQFA 3FX3A 5DYMA 3IKVA 2O0YA 2K4JA 2MH9A 2H6BA 4L0YB 1LJ9A 4BHPA 2ZO4A 3GFMA 4MGRA 3K1MA 2V9VA 4M9XA 3E6CC 3EUHA 3QU3A 1J75A 1BJAA 1RIOH 1MJBA 2CSOA 4GCVA 1W5TA 2OU2A 1IZ1A 2HDCA 5E18F 3QOPA 4QLCU 2Q8KA 1BI0A 1ULYA 5JI6A 2W57A 4YFNF 3KP3A 2B0LA 2XKOA 4P9UA 1YS7A 4LG0A 2IW5A 2AS5F 5HOOA 4CYDA 2MD5A 4HF0A 2LKPA 3E6DA 2HTJA 3M8EA 2HQRA 2JTVA 4M6YA 3WGHA 1XB4A 2VBWA 3MZYA 5E8GA 3CUQB 4AD9A 1U6GA 1ZG5A 1UB9A 4U0VA 1MJAA 3JAMK 2NNYA 4MTEA 4AIJA 1QNTA 1FOKA 3FMRA 2DFIA 1GXPA 3FM3A 1ON2A 1HXDA 2MA3A 4OIOF 3V8JA 4HLXA 1L0OC 3KE2A 2UWMA 4G7OF 2EA2A 3N4MA 2TDXA 2MC3A 3WTYC 1FBQA 5ICCA 5TRDA 2CFXA 1KYWA 1YO5C 5EEHA 2ZFWA 1B59A 1ZYRF 5DDGA 3LA2A 3ABTA 1J59A 2HQNA 5CLSA 3DQVC 4B09A 5ICEA 4KUMA 3E6BA 4A12A 3HOTA 4RAYA 5ILVA 4WK8F 3CO6C 5IT3A 2CYYA 4EJWA 1U5TB 1R1UA 4HV6A 1YYVA 4CO8A 3F6OA 4MQ9F 4HOBA 2F2EA 3HYIA 3K2ZA 4EM2A 2IJLA 1YIOA 1QO0D 3I0TA 1Z1DA 3C7JA 1K7AA 2E1NA 1QBJA 1XGNA 3CDHA 4HX7A 1I1SA 3B73A 3I4PA 2R3SA 3GF2A 5KVRA 1TQIA 3RYRA 1MD0A 4O5VA 1G3YA 1R00A 1EV7A 1FY7A 3RJPA 3TQNA 4TV7A 2RC4A 5DUIA 3T8RA 2CO5A 4HW0A 1GXQA 1X3UA 3NQOA 3GEZA 1RNLA 3SFZA 1TNSA 2X4HA 2EV5A 3U2RA 5E8IA 1YQAA 1P92A 3PQJA 1USTA 2LF7A 4G94A 5BOXA 5BPDA 2P5VA 3BPVA 3TO9A 4IHTA 2JPBA 4L9TA 3WGGA 1S8NA 2RNJA 3MWMA 5HLIA 5JFRA 6PAXA 3RIRA 2EJRA 2VBYA 4KMFA 2GA1A 1BI1A 2K02A 1LQ1A 1KU7A 2FEZA 4YIFA 2D1VA 4UVBA 1RI7A 4U88A 2FBHA 3HHHA 5LHIA 2VC0A 2P8TA 2XV4S 2P5LC 1ZG3A 4R8HA 5L3FA 4Z2YA 2P7CB 4U7BA 2IA2A 1KU9A 1FBSA 3KEOA 1XMKA 1L3LA 3FWEA 4ZYEA 4I0AA 5FFXA 1I1GA 1XMAA 4KIBA 3GVAA 3ELKA 5DCMA 5E20A 5DV5A 2GXGA 3HSFA 4BYYA 2L54A 2D1HA 1T0FA 5HLGA 4KN7X 4EJUA 3H3UA 4I0BA 3ECHA 2V1XA 1IXRC 2KKOA 1C0WA 2BGCA 1S29A 2J5PA 3FXQA 2EV0A 1F4KA 3DPTA 1YTYA 4RB1A 2Z33A 1Z05A 3S2WA 4ZZLA 3I54A 2ZCWA 2IP2A 4UVCA 3ZMTA 3ISPA 4IRGA 2H6CA 5ILUA 3RPUA 3BWGA 4JK1X 1BBYA 5HS9A 3WTXC 5ILSA 2XAFA 4A0ZA 3HRMA 4GGGA 3RTRA 2ETHA 2K7LA 1FBUA 3KLOA 3TDZC 3TO7A 4WXCA 2NNNA 4EMSA 2FBKA 3L00A 1B1BA 2DO7A 2EV6A 2ZBKA 2IA1A 3G73A 1AWCA 1TQPA 3KLNA 5E1ZB 4G7HF 3I53A 3WG9A 2FSWA 3LSTA 5D5VB 1FSEA 5J8FA 3VB2A 4I09A 3MQ0A 4ZYDA 1ZLJA 1WI9A 2L02A 2XKPA 2KJCA 1IN8A 1LVAA 3F8NA 3K9TA 4M74A 3H3ZA 2W24A 2FRHA 1D3YA 2ZMEB 2R7DA 1ZGJA 1ODDA 2VE9A 4WXDA 4BHBA 2GWRA 1MDMB 4UHTA 4ENJA 1WSUA 1ZREA 1QQIA 4I02A 1RUOA 2LF8A 2FQ3A 3KP5A 5D8LB 3P9IA 5LBQA 4BXUA 2D45A 2DLLA 3WTUC 1LDDA 5FO5A 4A0YA 3T0YA 3RI4A 1KYZA 3ERED 2XASA 3MEXA 1FNNA 3QAHA 3TOAA 4CXFA 1V4RA 4NB5A 2OQGA 5L3DA 2FNAA 1KU3A 1O7LA 1XDSA 3CJNA 3IWZA 1W7PB 4LB5A 2HKOA 3O6BB 3WGIA 2UXXA 3J80K 2F5EA 3I59B 1O3QA 4OOIA 4WXHA 5H20A 2RV8A 5CVUA 1E17A 3HIFA 4G6QA 1S3JA 4EM0B 1JHHA 2HOEA 5LHGA 4G8XA 2M5WA 3ZMSA 1HW5A 3WE2A 2ZJ2A 4EV0A 2V79A 2PEXA 1KQ0A 3ZMUA 3J81Z 1J2XA 2QVOA 3DXJF 4LLNA 4F7ZA 2H09A 2UZKA 3GYHX 4GO1A 2CW0F 2A6HF 1O57A 5D8KB 3F72A 1SFEA 1R22A 2QM3A 2HKXA 3R60A 2KIUA 4LMYA 4A6EA 3RDIA 2QQAA 1ZGAA 3T1BA 3WTVC 4CZZA 3E3VA 4MEXF 4HQMA 1YS6A 4M9SA 1P4WA 3E5XA 5A2QK 4Y13A 1T2KA 3DF8A 1TBXA 3H92A 3WE3A 3SXYA 4BHCA 1QZZA 1DPRA 5L3GA 1DDNA 5TJJA 2YR2A 1FX7A 3NEUA 5E1WA 2M45A 2PQ8A 4Q48A 2FBIA 3REOA 4L18B 4KT5C 1XD7A 2D2WA 1T98A 2RKHA 2VOOA 3LAPA 1F1ZA 1F9NA 3I64A 1Q1HA 4EGYA 3HRUA 1TTYA 1A04A 2DPDA 2P5KA 3LFKA 3P9CA 5L3BA 2WC2A 4ESFA 4BQAA 3QU6A 4UVAA 2P6TA 4H0EA 4RS8A 5D5WB 4IRHA 2OZUA 4HDVA 2GXBA 1IRFA 5DUKA 3QRFF 2A07F 1W4MA 2P4WA 4PZJA 2G7UA 2VXZA 1KU2A 1EH8A 3KCCA 4MEYF 2STWA 1SFXA 2Z99A 5KK1A 1HSTA 4KIGA 1ONVA 4K2EA 3E6MA 1DP7P 2HEOA 4HYEA 1ZRFA 4YIIA 3JAMZ 3VOEA 1ZRDA 2PMUA 3BZ6A 4Q5SF 3IRQA 5K5RA 2G7HA 1OMIA 1TLHB 4P5OA 4KNYA 1Z7UA 4M71A 3CUQA 4IJAA 4Y15A 5CVIA 5HS8A 4DQ2A 4XSXF 4RB0A 4CGZA 3FMQA 4EVIA 2FOKA 2O03A 1B9NA 5IT9K 2ISZA 4U0WA 5HDGA 2M87A 1HKTA 2XRNA 3ZMVA 3QP5A 1ZG1A 2ADUA 3DKWA 2A69F 1YW7A 1OPCA 2HWVA 2Y75A 3RKWA 3ZN0A 3PFIA 2LNBA 1YW9A 5JVTA 2DPUA 4AIHA 1ZRCA 2DU9A 3JW4A 3TGNA 2CG4A 2YSRA 1F5TA 3TOBA 4LGWA 3TO6A 5FLXK 5L3EA 2KRFA 2E1CA 4I7HA 4BH9A 3VEPA 4EM1A 1G3SA 3LA3A 2STTA 2YPRA 3L2CA 1P4AA 1JXSA 5FD5A 1KA8A 5FLXZ 4LK0F 1WQ2A 3WU1B 1ZARA 2EK5A 5F64A 3QP6A 2UXNA 2CQKA 2FA5A 3V7CA 1IAWA 4NHJA 4FHTA 5LGUA 3HTSB 3WTTC 3WODF 4WF2A 3BPXA 1U5TA 2HGCA 3ZPLA 3JTGA 5EEGA 5L3CA 2ACJA 4L0ZB 2QYOA 2ESHA 1MKMA 1ZLKA 5DD8A 1D8KA 4NQWA 2YX7A 3ML6A 1FLIA 1U8RA 4KYWA 1E2XA 4R79A 3BY6A 1XSDA 3E97A 2JSCA 4WWCA 4ENMA 4FT8A 5LEJA 3F22A 4ON0A 3V7RA 5ERIA 4RB2C 1BIBA 2PG4A 5K1YA 4YFKF 1CF7B 2BYVE 4B8XA 1K78B 3GZ5A 1HKSA 1PDNC 3L09A 5HDNA 3KP2A 3AAFA 1MJ9A 3I5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3COA C;  1FT9 A;  2QBY B;  3GFI A;  3DFG A;  5LGT A;  3QPT A;  2W84 A;  4AWX B;  1I5Z A;  1UCR A;  1ZH5 A;  2RDP A;  4M6X A;  1HBX G;  1B4A A;  4ZYG A;  2EFW A;  3ZMD A;  4HV5 A;  2ZXJ A;  4RGS A;  1T39 A;  3WTZ A;  3L7W A;  3F8M A;  3FHZ A;  2IA0 A;  2XAQ A;  1IN4 A;  4WCG A;  2CWE A;  1K78 A;  2ESN A;  5CYV A;  3T5X A;  4MQV A;  3T8T A;  2G9W A;  5E1X A;  2LDU A;  4I01 A;  1DUX C;  3GFJ A;  3IRR A;  3ABU A;  1R58 A;  1FWZ A;  1WRJ A;  4G6D A;  2GIV A;  2DW4 A;  3HRS A;  2Y48 A;  4EGZ A;  2HR3 A;  5F1R A;  1OYY A;  4OIQ F;  2JPC A;  2F5C A;  3LQQ A;  4A6D A;  3EDP A;  4OIR F;  1S7A A;  3ZN1 A;  2MLG A;  1HW2 A;  1BC8 C;  3R6S A;  5FD6 A;  1BM9 A;  1SFU A;  1LEA A;  4ENN A;  5LRR A;  2PI0 A;  3OV8 A;  5D4S A;  3F23 A;  1BI2 A;  3JTH A;  1YLF A;  3N97 A;  1H0M A;  4P55 A;  1HSJ A;  4FX0 A;  4O3M A;  2VE8 A;  2PMH A;  2QEN A;  5BMZ A;  1FYM A;  2Q0O A;  1GVJ A;  2DI3 A;  1T6S A;  4RAZ A;  2LSO A;  3U9G A;  5AON A;  2Z5U A;  1RUN A;  4GXO A;  3ULQ B;  3E5U A;  1S7O A;  1O7F A;  1JGS A;  3W6J B;  1BC7 C;  4ENK A;  1Z6R A;  2XAG A;  1V3F A;  3M7G A;  3G3Z A;  3JSP A;  3F3X A;  3BOQ A;  5LRS A;  2H94 A;  3BJO A;  1XSV A;  3BP8 A;  4WX9 A;  5ICF A;  1P4X A;  4LLG F;  1XSX A;  3EET A;  4I98 B;  1TNT A;  4I2O A;  2A3S A;  2QWW A;  2BE5 F;  1HKQ A;  2DK8 A;  1IN7 A;  4KMU X;  5HS7 A;  5D6E A;  1VTN C;  5K5Q A;  3JSO A;  3GX4 X;  3EYI A;  3FMS A;  4ESJ A;  2JRT A;  3K1N A;  3V8K A;  3RPQ A;  1G6N A;  4CIC A;  2J5O A;  2L3D A;  1UHM A;  1U2W A;  2NAZ A;  2NYX A;  1SD6 A;  4OIP F;  3LWF A;  1LNW A;  2DBB A;  3R0A A;  1O3T A;  2RGV A;  3CLO A;  1AOY A;  4S04 A;  3IHU A;  1W7P D;  2FMY A;  1SD7 A;  2ZME A;  2KJB A;  2WTE A;  1MDM A;  4XSZ F;  1P6R A;  4L9N A;  1NHA A;  2PJP A;  3ZMZ A;  2HZT A;  2V1D A;  2GA2 A;  4HZF A;  4IHS A;  3QPH A;  2KIF A;  4IVN A;  2Y0M A;  4BNC A;  5D5X B;  3J80 Z;  3EQL F;  2ZNZ A;  4LFU A;  4EJT A;  3OOP A;  1KQ8 A;  3SZT A;  4A5N A;  3DPL C;  3MAJ A;  3KFW X;  3I58 A;  3VOD A;  5BS6 A;  1G3T A;  1LB2 A;  1SMY F;  1SMT A;  1IW7 F;  5FFZ A;  1D8J A;  1W7P A;  4XRF A;  1EH7 A;  1KGS A;  1TW2 A;  3I59 A;  4MTD A;  1BN5 A;  3C3W A;  1XGM A;  4RGU A;  3ZQ7 A;  1GHC A;  2IT0 A;  1EH6 A;  1B9M A;  2L4M A;  3MFK A;  3RKX A;  3W6K B;  5LLQ A;  2VBX A;  2WV0 A;  3Q5F A;  4CDG A;  3F8B A;  3BJA A;  1OR7 A;  3VFZ A;  4RGR A;  3FXU A;  1G4D A;  1IUY A;  2RQP A;  2O3F A;  1YFH A;  4LG0 B;  2QQ9 A;  3DP7 A;  2NS0 A;  2EFP A;  1J7K A;  1XN7 A;  4KIC A;  5A2Q Z;  4N0B A;  1O3R A;  3F21 A;  4ZH4 F;  2Z9O A;  5D6F A;  4U7D A;  4MHG A;  2EFN A;  3Q9S A;  3HSR A;  4N9H A;  4Q47 A;  2HYG D;  4UUV A;  2JZY A;  2K27 A;  4HQE A;  3KP6 A;  2F5F A;  1I27 A;  2K4B A;  3F8C A;  1O3S A;  1LEB A;  4BAY A;  4L9V A;  5LEK A;  2BEO A;  1ON1 A;  4FX4 A;  4XLP F;  1FZP B;  1PP8 F;  1BOA A;  2XAJ A;  1PP7 U;  3MZH A;  2W25 A;  2FXA A;  5LHH A;  2BBY A;  3DEU A;  1HQC A;  1P2F A;  4U0Y A;  2CGP A;  4OU0 A;  2P6S A;  2MH2 A;  4XBF A;  1UFM A;  2PLY A;  1FP1 D;  3LQR A;  2ELH A;  4P96 A;  2QLZ A;  1YG2 A;  3CTA A;  2EB7 A;  2XHK A;  4A0X A;  4HLY A;  4EQQ A;  5H6R A;  5J8C A;  2VC1 A;  3M8F A;  2JT1 A;  3IWF A;  3C18 A;  4KN4 X;  5ED4 A;  2ZKZ A;  5FB2 A;  3GFL A;  1ZHF A;  4E70 A;  4RB3 C;  1OYW A;  4YFX F;  4RGX A;  4P9F A;  1K6O A;  2V1U A;  5AIP A;  2DT5 A;  1H9T A;  1WKM A;  4S05 A;  2HYF A;  1R7J A;  3SHF A;  5J6X A;  3PQK A;  5D5U B;  3BRO A;  4M9Z A;  3KET A;  2NRA C;  5HVQ C;  2VT3 A;  1TQM A;  3KP7 A;  4PGG A;  1R23 A;  2HS5 A;  2VOD A;  4M73 A;  3IKT A;  5IT9 Z;  2O8X A;  1I6X A;  3J7A O;  2ZNY A;  3SQN A;  4ETS A;  2XIG A;  2M8E A;  1BIA A;  3M9A A;  2W85 A;  1IF1 A;  3HHG A;  5D4R A;  3KZY A;  2MBF A;  1IN6 A;  1YW8 A;  4LK1 F;  3EYY A;  4QWQ A;  4IF4 A;  4OMY A;  2QZ8 A;  2RN7 A;  2DQL A;  2OA4 A;  1BI3 A;  5HLH A;  5BPI A;  2COM A;  4PDK A;  2DAO A;  3FZV A;  1IN5 A;  4LD5 A;  5FGM A;  3HTU A;  3FF5 A;  1QGP A;  1FSH A;  2DK5 A;  5AIQ A;  4A2U A;  1XGS A;  1SD4 A;  1IRG A;  1Z91 A;  4ASN A;  4R1H A;  2QUF A;  5JHU A;  3BJ6 A;  4Q4Z F;  3GO5 A;  5CVJ A;  4ZZD A;  3FXR A;  5JR3 A;  1QZY A;  1U3E M;  2DQR A;  2RVC A;  4KA4 A;  2WWY A;  2YU3 A;  3HOS A;  5K5O A;  4HF1 A;  1XCV A;  2AXL A;  2F5D A;  3V4G A;  3GWZ A;  2L4A A;  3M1E A;  4HF2 A;  3RKY A;  4HX4 A;  2VBZ A;  2O6G E;  3KP4 A;  4D0P A;  3RYP A;  1LDK B;  5H6Q A;  3P9K A;  2GAU A;  2P7V B;  1STZ A;  5DCM B;  5DEQ A;  1U78 A;  1PUE E;  2M30 A;  5DCF A;  2C6Y A;  3CO7 C;  1IXS B;  2HFH A;  4AVP A;  2A68 F;  4KDP A;  2FF4 A;  1JHF A;  2OAZ A;  4GYG A;  2ISY A;  3CUQ C;  4ESB A;  1CF7 A;  1H9G A;  2EA4 A;  4L5I A;  1T38 A;  4Y17 A;  3WU0 A;  3F8F A;  1B6A A;  3WTS C;  2PBI A;  4MNU A;  1S6L A;  3HUG A;  3D0S A;  2GQQ A;  3K1P A;  2QBY A;  1OKR A;  2R7F A;  4HBL A;  3C1D A;  2OD5 A;  1R5H A;  5CJ9 A;  4G7Z F;  2H27 A;  3O3K A;  1IXC A;  1K79 A;  4UV8 A;  3R0J A;  2IPQ X;  1W5S A;  1OYI A;  3ECO A;  3TKY A;  4O6J A;  4L5J A;  1LDJ A;  4EJV A;  3FM5 A;  2OBP A;  2XRO A;  3ROU A;  2VON A;  2IVM A;  4UXN A;  3GW2 A;  4UNO A;  3V7S A;  1TW3 A;  1XGO A;  5HDK A;  2FU4 A;  1RZ4 A;  1JE8 A;  2V6C A;  2OZ6 A;  1Y0U A;  4LJZ F;  2A5Y B;  3Q9V A;  1UHW A;  4CHU A;  4HAM A;  2X0L A;  1J9I A;  4IPA A;  1REP C;  1MGT A;  1R5G A;  2E7X A;  3O2P E;  1U5T C;  3GLX A;  1SAX A;  2FE3 A;  5ICG A;  2GZW A;  4N9I A;  4LLL A;  2O61 A;  5DD4 A;  3GUD A;  3IL2 A;  3LA7 A;  4XLN F;  1FC3 A;  4IXA A;  2YX4 A;  1Z6T A;  2A6E F;  1SD5 A;  2MLK A;  3KEQ A;  3R4K A;  3E5Q A;  3SZP A;  3CUO A;  1XCB A;  3HSE A;  4OMZ A;  2XGX A;  1USS A;  3GXO A;  1WWX A;  2BV6 A;  2VOP A;  2A61 A;  2HTS A;  3K69 A;  4OIN F;  4G9Y A;  5LGN A;  4M72 A;  4GYI A;  1G3W A;  2VN2 A;  2PN6 A;  4PGH A;  3R61 A;  1D5V A;  1DPU A;  1FPQ A;  2KIM A;  2EFQ A;  2FNP A;  3NRV A;  3KZZ A;  2M1B A;  1Z9C A;  5BQT A;  3TDU C;  3F6V A;  4KIF A;  3DV8 A;  1FP2 A;  1HW1 A;  1CGP A;  2PFB A;  3D5L A;  1QPM A;  2EWN A;  2QQB A;  3V8L A;  2OQR A;  4DNC A;  5CVR A;  2FML A;  2Q2E A;  3U1D A;  3IC7 A;  2XUB A;  2EFO A;  3MCZ A;  4PCQ A;  5CVV A;  3HRT A;  3B02 A;  1MZB A;  3I71 A;  4KFC A;  2IRF G;  1FYK A;  4HDU A;  4ZYH A;  4HA8 A;  3P7N A;  3LAJ A;  5E17 F;  2XAH A;  1FYL A;  4HX8 A;  4LB6 B;  2VT2 A;  1R1T A;  3K0L A;  3J81 K;  2Z3Y A;  1ZAO A;  4IRI A;  4AIK A;  1XDU A;  3BDD A;  4L9J A;  4UV9 A;  4YG2 F;  3WTW C;  1R1V A;  3L9F A;  2DTR A;  1J5Y A;  3ZP5 A;  4JBA A;  2L01 A;  1J0R A;  1R36 A;  1ZN2 A;  1KQ9 A;  5F6F A;  4EJO A;  2XVC A;  4A5M A;  3GZ6 A;  2K86 A;  2E7W A;  4JQF A;  3FX3 A;  5DYM A;  3IKV A;  2O0Y A;  2K4J A;  2MH9 A;  2H6B A;  4L0Y B;  1LJ9 A;  4BHP A;  2ZO4 A;  3GFM A;  4MGR A;  3K1M A;  2V9V A;  4M9X A;  3E6C C;  3EUH A;  3QU3 A;  1J75 A;  1BJA A;  1RIO H;  1MJB A;  2CSO A;  4GCV A;  1W5T A;  2OU2 A;  1IZ1 A;  2HDC A;  5E18 F;  3QOP A;  4QLC U;  2Q8K A;  1BI0 A;  1ULY A;  5JI6 A;  2W57 A;  4YFN F;  3KP3 A;  2B0L A;  2XKO A;  4P9U A;  1YS7 A;  4LG0 A;  2IW5 A;  2AS5 F;  5HOO A;  4CYD A;  2MD5 A;  4HF0 A;  2LKP A;  3E6D A;  2HTJ A;  3M8E A;  2HQR A;  2JTV A;  4M6Y A;  3WGH A;  1XB4 A;  2VBW A;  3MZY A;  5E8G A;  3CUQ B;  4AD9 A;  1U6G A;  1ZG5 A;  1UB9 A;  4U0V A;  1MJA A;  3JAM K;  2NNY A;  4MTE A;  4AIJ A;  1QNT A;  1FOK A;  3FMR A;  2DFI A;  1GXP A;  3FM3 A;  1ON2 A;  1HXD A;  2MA3 A;  4OIO F;  3V8J A;  4HLX A;  1L0O C;  3KE2 A;  2UWM A;  4G7O F;  2EA2 A;  3N4M A;  2TDX A;  2MC3 A;  3WTY C;  1FBQ A;  5ICC A;  5TRD A;  2CFX A;  1KYW A;  1YO5 C;  5EEH A;  2ZFW A;  1B59 A;  1ZYR F;  5DDG A;  3LA2 A;  3ABT A;  1J59 A;  2HQN A;  5CLS A;  3DQV C;  4B09 A;  5ICE A;  4KUM A;  3E6B A;  4A12 A;  3HOT A;  4RAY A;  5ILV A;  4WK8 F;  3CO6 C;  5IT3 A;  2CYY A;  4EJW A;  1U5T B;  1R1U A;  4HV6 A;  1YYV A;  4CO8 A;  3F6O A;  4MQ9 F;  4HOB A;  2F2E A;  3HYI A;  3K2Z A;  4EM2 A;  2IJL A;  1YIO A;  1QO0 D;  3I0T A;  1Z1D A;  3C7J A;  1K7A A;  2E1N A;  1QBJ A;  1XGN A;  3CDH A;  4HX7 A;  1I1S A;  3B73 A;  3I4P A;  2R3S A;  3GF2 A;  5KVR A;  1TQI A;  3RYR A;  1MD0 A;  4O5V A;  1G3Y A;  1R00 A;  1EV7 A;  1FY7 A;  3RJP A;  3TQN A;  4TV7 A;  2RC4 A;  5DUI A;  3T8R A;  2CO5 A;  4HW0 A;  1GXQ A;  1X3U A;  3NQO A;  3GEZ A;  1RNL A;  3SFZ A;  1TNS A;  2X4H A;  2EV5 A;  3U2R A;  5E8I A;  1YQA A;  1P92 A;  3PQJ A;  1UST A;  2LF7 A;  4G94 A;  5BOX A;  5BPD A;  2P5V A;  3BPV A;  3TO9 A;  4IHT A;  2JPB A;  4L9T A;  3WGG A;  1S8N A;  2RNJ A;  3MWM A;  5HLI A;  5JFR A;  6PAX A;  3RIR A;  2EJR A;  2VBY A;  4KMF A;  2GA1 A;  1BI1 A;  2K02 A;  1LQ1 A;  1KU7 A;  2FEZ A;  4YIF A;  2D1V A;  4UVB A;  1RI7 A;  4U88 A;  2FBH A;  3HHH A;  5LHI A;  2VC0 A;  2P8T A;  2XV4 S;  2P5L C;  1ZG3 A;  4R8H A;  5L3F A;  4Z2Y A;  2P7C B;  4U7B A;  2IA2 A;  1KU9 A;  1FBS A;  3KEO A;  1XMK A;  1L3L A;  3FWE A;  4ZYE A;  4I0A A;  5FFX A;  1I1G A;  1XMA A;  4KIB A;  3GVA A;  3ELK A;  5DCM A;  5E20 A;  5DV5 A;  2GXG A;  3HSF A;  4BYY A;  2L54 A;  2D1H A;  1T0F A;  5HLG A;  4KN7 X;  4EJU A;  3H3U A;  4I0B A;  3ECH A;  2V1X A;  1IXR C;  2KKO A;  1C0W A;  2BGC A;  1S29 A;  2J5P A;  3FXQ A;  2EV0 A;  1F4K A;  3DPT A;  1YTY A;  4RB1 A;  2Z33 A;  1Z05 A;  3S2W A;  4ZZL A;  3I54 A;  2ZCW A;  2IP2 A;  4UVC A;  3ZMT A;  3ISP A;  4IRG A;  2H6C A;  5ILU A;  3RPU A;  3BWG A;  4JK1 X;  1BBY A;  5HS9 A;  3WTX C;  5ILS A;  2XAF A;  4A0Z A;  3HRM A;  4GGG A;  3RTR A;  2ETH A;  2K7L A;  1FBU A;  3KLO A;  3TDZ C;  3TO7 A;  4WXC A;  2NNN A;  4EMS A;  2FBK A;  3L00 A;  1B1B A;  2DO7 A;  2EV6 A;  2ZBK A;  2IA1 A;  3G73 A;  1AWC A;  1TQP A;  3KLN A;  5E1Z B;  4G7H F;  3I53 A;  3WG9 A;  2FSW A;  3LST A;  5D5V B;  1FSE A;  5J8F A;  3VB2 A;  4I09 A;  3MQ0 A;  4ZYD A;  1ZLJ A;  1WI9 A;  2L02 A;  2XKP A;  2KJC A;  1IN8 A;  1LVA A;  3F8N A;  3K9T A;  4M74 A;  3H3Z A;  2W24 A;  2FRH A;  1D3Y A;  2ZME B;  2R7D A;  1ZGJ A;  1ODD A;  2VE9 A;  4WXD A;  4BHB A;  2GWR A;  1MDM B;  4UHT A;  4ENJ A;  1WSU A;  1ZRE A;  1QQI A;  4I02 A;  1RUO A;  2LF8 A;  2FQ3 A;  3KP5 A;  5D8L B;  3P9I A;  5LBQ A;  4BXU A;  2D45 A;  2DLL A;  3WTU C;  1LDD A;  5FO5 A;  4A0Y A;  3T0Y A;  3RI4 A;  1KYZ A;  3ERE D;  2XAS A;  3MEX A;  1FNN A;  3QAH A;  3TOA A;  4CXF A;  1V4R A;  4NB5 A;  2OQG A;  5L3D A;  2FNA A;  1KU3 A;  1O7L A;  1XDS A;  3CJN A;  3IWZ A;  1W7P B;  4LB5 A;  2HKO A;  3O6B B;  3WGI A;  2UXX A;  3J80 K;  2F5E A;  3I59 B;  1O3Q A;  4OOI A;  4WXH A;  5H20 A;  2RV8 A;  5CVU A;  1E17 A;  3HIF A;  4G6Q A;  1S3J A;  4EM0 B;  1JHH A;  2HOE A;  5LHG A;  4G8X A;  2M5W A;  3ZMS A;  1HW5 A;  3WE2 A;  2ZJ2 A;  4EV0 A;  2V79 A;  2PEX A;  1KQ0 A;  3ZMU A;  3J81 Z;  1J2X A;  2QVO A;  3DXJ F;  4LLN A;  4F7Z A;  2H09 A;  2UZK A;  3GYH X;  4GO1 A;  2CW0 F;  2A6H F;  1O57 A;  5D8K B;  3F72 A;  1SFE A;  1R22 A;  2QM3 A;  2HKX A;  3R60 A;  2KIU A;  4LMY A;  4A6E A;  3RDI A;  2QQA A;  1ZGA A;  3T1B A;  3WTV C;  4CZZ A;  3E3V A;  4MEX F;  4HQM A;  1YS6 A;  4M9S A;  1P4W A;  3E5X A;  5A2Q K;  4Y13 A;  1T2K A;  3DF8 A;  1TBX A;  3H92 A;  3WE3 A;  3SXY A;  4BHC A;  1QZZ A;  1DPR A;  5L3G A;  1DDN A;  5TJJ A;  2YR2 A;  1FX7 A;  3NEU A;  5E1W A;  2M45 A;  2PQ8 A;  4Q48 A;  2FBI A;  3REO A;  4L18 B;  4KT5 C;  1XD7 A;  2D2W A;  1T98 A;  2RKH A;  2VOO A;  3LAP A;  1F1Z A;  1F9N A;  3I64 A;  1Q1H A;  4EGY A;  3HRU A;  1TTY A;  1A04 A;  2DPD A;  2P5K A;  3LFK A;  3P9C A;  5L3B A;  2WC2 A;  4ESF A;  4BQA A;  3QU6 A;  4UVA A;  2P6T A;  4H0E A;  4RS8 A;  5D5W B;  4IRH A;  2OZU A;  4HDV A;  2GXB A;  1IRF A;  5DUK A;  3QRF F;  2A07 F;  1W4M A;  2P4W A;  4PZJ A;  2G7U A;  2VXZ A;  1KU2 A;  1EH8 A;  3KCC A;  4MEY F;  2STW A;  1SFX A;  2Z99 A;  5KK1 A;  1HST A;  4KIG A;  1ONV A;  4K2E A;  3E6M A;  1DP7 P;  2HEO A;  4HYE A;  1ZRF A;  4YII A;  3JAM Z;  3VOE A;  1ZRD A;  2PMU A;  3BZ6 A;  4Q5S F;  3IRQ A;  5K5R A;  2G7H A;  1OMI A;  1TLH B;  4P5O A;  4KNY A;  1Z7U A;  4M71 A;  3CUQ A;  4IJA A;  4Y15 A;  5CVI A;  5HS8 A;  4DQ2 A;  4XSX F;  4RB0 A;  4CGZ A;  3FMQ A;  4EVI A;  2FOK A;  2O03 A;  1B9N A;  5IT9 K;  2ISZ A;  4U0W A;  5HDG A;  2M87 A;  1HKT A;  2XRN A;  3ZMV A;  3QP5 A;  1ZG1 A;  2ADU A;  3DKW A;  2A69 F;  1YW7 A;  1OPC A;  2HWV A;  2Y75 A;  3RKW A;  3ZN0 A;  3PFI A;  2LNB A;  1YW9 A;  5JVT A;  2DPU A;  4AIH A;  1ZRC A;  2DU9 A;  3JW4 A;  3TGN A;  2CG4 A;  2YSR A;  1F5T A;  3TOB A;  4LGW A;  3TO6 A;  5FLX K;  5L3E A;  2KRF A;  2E1C A;  4I7H A;  4BH9 A;  3VEP A;  4EM1 A;  1G3S A;  3LA3 A;  2STT A;  2YPR A;  3L2C A;  1P4A A;  1JXS A;  5FD5 A;  1KA8 A;  5FLX Z;  4LK0 F;  1WQ2 A;  3WU1 B;  1ZAR A;  2EK5 A;  5F64 A;  3QP6 A;  2UXN A;  2CQK A;  2FA5 A;  3V7C A;  1IAW A;  4NHJ A;  4FHT A;  5LGU A;  3HTS B;  3WTT C;  3WOD F;  4WF2 A;  3BPX A;  1U5T A;  2HGC A;  3ZPL A;  3JTG A;  5EEG A;  5L3C A;  2ACJ A;  4L0Z B;  2QYO A;  2ESH A;  1MKM A;  1ZLK A;  5DD8 A;  1D8K A;  4NQW A;  2YX7 A;  3ML6 A;  1FLI A;  1U8R A;  4KYW A;  1E2X A;  4R79 A;  3BY6 A;  1XSD A;  3E97 A;  2JSC A;  4WWC A;  4ENM A;  4FT8 A;  5LEJ A;  3F22 A;  4ON0 A;  3V7R A;  5ERI A;  4RB2 C;  1BIB A;  2PG4 A;  5K1Y A;  4YFK F;  1CF7 B;  2BYV E;  4B8X A;  1K78 B;  3GZ5 A;  1HKS A;  1PDN C;  3L09 A;  5HDN A;  3KP2 A;  3AAF A;  1MJ9 A;  3I5U A; 
#chains in the Genus database with same CATH topology
 2BOL A;  3COA C;  1FT9 A;  3HUG B;  1QU3 A;  2XPU A;  2QBY B;  1WJC A;  3GTQ J;  1X1A A;  1W36 D;  3Q0W A;  4IEJ A;  4NUB A;  3GFI A;  5FLV A;  3DFG A;  5LGT A;  4A3G J;  3QPT A;  2W84 A;  1KZH A;  4AWX B;  3CCM I;  1I5Z A;  1UCR A;  1ZH5 A;  1ETQ A;  2RDP A;  4M6X A;  2CQN A;  4E7L A;  1I3Q J;  1HBX G;  1B4A A;  4ZYG A;  2LY9 A;  2EFW A;  3ZMD A;  4HV5 A;  3QPS A;  3K4L A;  5FLM J;  2ZXJ A;  4RGS A;  2L9R A;  1T39 A;  5F0H A;  3WTZ A;  1YHQ I;  2DFE A;  3L7W A;  3F8M A;  2MAB A;  3FHZ A;  2D5V A;  1HCR A;  1BW6 A;  3ASO H;  2IA0 A;  2XAQ A;  1FOY A;  1S5L C;  1IN4 A;  4WCG A;  2M4G A;  4BL0 B;  2CWE A;  3OYC A;  1K78 A;  2ESN A;  5CYV A;  3T5X A;  5LFA A;  4MQV A;  3T8T A;  2G9W A;  5E1X A;  3L2V A;  2VKH A;  2LDU A;  5C3E J;  4I01 A;  1DUX C;  3DKY A;  3GFJ A;  3IRR A;  3S3M A;  3CC4 I;  3ABU A;  1R58 A;  1FWZ A;  1BR1 A;  1WRJ A;  2KFD A;  4G6D A;  2GIV A;  2DW4 A;  3HRS A;  3WG7 H;  2CW7 A;  3EUA A;  2Y48 A;  2X6O A;  4EGZ A;  2H1L A;  2HR3 A;  5F1R A;  3GTO J;  1OYY A;  4OIQ F;  2JPC A;  2F5C A;  1GLN A;  4BQO A;  2JMW A;  1JI8 A;  3LQQ A;  4A6D A;  2R7Z J;  1RPW A;  3EDP A;  4OIR F;  1IJW C;  2LG4 A;  3CDI A;  4P1W A;  2F48 A;  1S7A A;  1SAN A;  3ZN1 A;  2MLG A;  1HW2 A;  1BC8 C;  3R6S A;  5FD6 A;  1BM9 A;  1SFU A;  1LEA A;  4ENN A;  1R4M B;  2MFZ A;  5LRR A;  3HOX J;  3CCQ I;  4CSW A;  2PI0 A;  3OV8 A;  4BE2 A;  3S3N A;  5D4S A;  1QPI A;  3F23 A;  3ZQL A;  5FRM A;  5KAF C;  2HDD A;  1BI2 A;  2MD0 A;  3JTH A;  1YLF A;  3N97 A;  1H0M A;  5FRO A;  2PMZ N;  4P55 A;  1HSJ A;  4FX0 A;  2BY0 A;  2B9S A;  2VJJ A;  4O3M A;  3PUF A;  2VE8 A;  3PIO F;  2M4K A;  2IS4 A;  2HYJ A;  2PMH A;  2QEN A;  4E4H A;  5BMZ A;  1VND A;  1FYM A;  1G8X A;  5HNF A;  3BG3 A;  2Q0O A;  2R5Y B;  4A3M J;  2DFH A;  4MLO A;  1F36 A;  1GVJ A;  3BG5 A;  2DI3 A;  1T6S A;  1WJF A;  4RAZ A;  2LSO A;  3U9G A;  1EJ9 A;  5AON A;  2Z5U A;  1ZTR A;  3LSH A;  3BC8 A;  2R7R A;  1RUN A;  1I6H J;  3FXL A;  4GXO A;  3ULQ B;  4ABZ A;  4DIQ A;  3HPG A;  2HQA A;  3A01 A;  3PJR A;  3E5U A;  2L2O A;  3S1M J;  5BNG A;  1S7O A;  3ABK H;  1O7F A;  3DLA A;  1JGS A;  3W6J B;  1BC7 C;  4G12 A;  4ENK A;  2Z1D A;  1Z6R A;  2XAG A;  1MW7 A;  1V3F A;  3IV5 A;  2JSP A;  1V5G A;  3H9G A;  3M7G A;  2PX9 A;  4A3B J;  3QYE A;  3G3Z A;  3JSP A;  3F3X A;  3BOQ A;  5LRS A;  3C2H A;  3EPZ A;  3I4M J;  2M8G X;  2H94 A;  2R0Q C;  1IUF A;  3BJO A;  1XSV A;  3BP8 A;  4Z6Y A;  4WX9 A;  2BY1 A;  5ICF A;  2OV7 A;  1ETO A;  1P4X A;  4LLG F;  1XSX A;  3EET A;  3OYG A;  4I98 B;  1TC3 C;  1TNT A;  4I2O A;  2A3S A;  2QWW A;  2BE5 F;  4W97 A;  1HKQ A;  2DK8 A;  1IN7 A;  4KMU X;  1DP3 A;  2M34 A;  5HS7 A;  5D6E A;  4IZZ A;  4I6Z A;  1VTN C;  5K5Q A;  3JSO A;  3GX4 X;  1LVK A;  3EYI A;  2EIK H;  4QTR A;  3FMS A;  2Q2E B;  3LSP A;  4ESJ A;  2JRT A;  2K40 A;  3SYT A;  5B1A H;  3K1N A;  5HOD A;  3V8K A;  3RPQ A;  1G6N A;  5B3S H;  4CIC A;  2J5O A;  3V42 A;  1B8I B;  2AHQ A;  1VQL I;  2L3D A;  3G1O A;  1UHM A;  1U2W A;  2NAZ A;  2NYX A;  1SD6 A;  4E7I A;  2QF7 A;  3SEQ A;  5F0F A;  4YRV A;  3SDB A;  4OIP F;  3LWF A;  1LNW A;  2DBB A;  3OL4 A;  1CQT A;  3R0A A;  1O3T A;  3UNG C;  2RGV A;  3VWB A;  3CLO A;  1AOY A;  4S04 A;  3H5A A;  1X2M A;  3IHU A;  1SVM A;  2EBI A;  4BJT A;  1TWA J;  1MH4 A;  2JWT A;  2LRE A;  2LVS A;  4V19 K;  2X1D A;  1W7P D;  2FMY A;  4ZC3 A;  1OQY A;  4PK4 A;  1SD7 A;  3OYJ A;  5E3M A;  2ZME A;  2KJB A;  4X1E A;  3S16 J;  2WTE A;  3RQ4 A;  1VQ9 I;  4HRI A;  3HOU J;  2DOD A;  5B1B H;  5EGO A;  1S7E A;  2A05 A;  1MDM A;  4XSZ F;  4IHW A;  1P6R A;  4L9N A;  1MBK A;  1Y56 A;  1NHA A;  2PJP A;  3ZMZ A;  2HZT A;  2V1D A;  2GA2 A;  4HZF A;  4IHS A;  3QPH A;  3BT9 A;  2KIF A;  2VJ5 A;  4IVN A;  2Y0M A;  2E19 A;  4BNC A;  5GAH J;  5D5X B;  4F91 B;  1U9O A;  4PFO A;  3J80 Z;  2DA3 A;  2LOO A;  3EQL F;  3PNV A;  3W2A A;  2ZNZ A;  2Y69 H;  3HL2 A;  4RLF A;  4LFU A;  4EJT A;  1YIT I;  3F9K A;  3OOP A;  1KQ8 A;  3SZT A;  1IO2 A;  4A5N A;  2OTL I;  3QOD A;  1XPX A;  3CCL I;  3A1Y A;  3DPL C;  2L5Q A;  3MAJ A;  2BW3 A;  3KFW X;  4BEH A;  5EG0 A;  2L7F P;  5GPC A;  3I58 A;  3VOD A;  3HGY A;  3LSI A;  4OAY A;  5F08 A;  5BS6 A;  3CCE I;  1DU0 A;  1G3T A;  1OCO H;  1LB2 A;  1SMY F;  1SMT A;  1HDP A;  1A6I A;  2ZJP F;  1XMX A;  5IY5 H;  2I10 A;  1IW7 F;  5FFZ A;  5FKL A;  2E2H J;  1D8J A;  1W7P A;  4UB6 C;  2HPI A;  4XRF A;  3MVP A;  1EH7 A;  1KGS A;  1TW2 A;  1V54 H;  3I59 A;  4MTD A;  1HF0 A;  1BN5 A;  3DLL F;  3C3W A;  1PUF A;  1XGM A;  2IGM A;  4PUS A;  3AL0 C;  1WCM J;  1IGN A;  3H0G J;  4RGU A;  3ZQ7 A;  1MSE C;  1GHC A;  1MMG A;  2M7B A;  2IT0 A;  4A3L J;  1EH6 A;  1B9M A;  2L4M A;  3MFK A;  3RKX A;  3W6K B;  4HNT A;  5LLQ A;  2VBX A;  2WV0 A;  4H4K C;  3Q5F A;  2XSD C;  1K83 J;  4W1U A;  4D9J A;  4CDG A;  2KL4 A;  5F1J A;  3IAM 2;  3F8B A;  2E35 A;  2LK2 A;  2WY8 Q;  1DGW Y;  4FIS A;  3BJA A;  1OR7 A;  3VFZ A;  4RGR A;  3FXU A;  1G4D A;  5M5X J;  3VSL A;  1IUY A;  2RQP A;  3A0B C;  3HKZ A;  2O3F A;  1YFH A;  2TCT A;  4LG0 B;  2QQ9 A;  2BHY A;  3DP7 A;  2H1K A;  4RM2 A;  2NS0 A;  4BJ5 C;  1Q1V A;  2EFP A;  1J7K A;  1XN7 A;  4KIC A;  5A2Q Z;  4N0B A;  1O3R A;  3F21 A;  1UAA A;  3CCV I;  4B1R A;  4ZH4 F;  2Z9O A;  1YX3 A;  1X2N A;  3C2B A;  1D1A A;  3IP4 B;  5D6F A;  1ETX A;  2Y0S A;  3H0D A;  2PJR A;  4U7D A;  4MHG A;  2EFN A;  3Q9S A;  3HSR A;  4N9H A;  2XAU A;  4Q47 A;  1YIJ I;  2QSH X;  2HYG D;  3BR6 A;  3ONQ A;  4UUV A;  2JZY A;  2K27 A;  4HQE A;  3KP6 A;  3CJR B;  2FX0 A;  4JX5 A;  1V55 H;  2F5F A;  4XRS A;  4XLE A;  1I27 A;  2K4B A;  3F8C A;  2H8R A;  1FJL A;  1O3S A;  2R7X A;  1LEB A;  4BAY A;  3GTM J;  4L9V A;  1JT0 A;  4XRS G;  4C30 A;  1T33 A;  2M9H A;  1D1B A;  5LEK A;  3VYU B;  1LE8 B;  1GV5 A;  4B3X A;  5DS9 A;  3FKJ A;  2BEO A;  2CH0 A;  4M6V A;  3OYI A;  1ON1 A;  3CME I;  4FX4 A;  4XLP F;  4RAF A;  4DZP A;  4UUS B;  1FZP B;  4XN3 A;  1PP8 F;  1BOA A;  2XAJ A;  1PP7 U;  3MZH A;  1FTZ A;  4CCL A;  2W25 A;  1T56 A;  2FXA A;  5LHH A;  4IOA F;  2BBY A;  3DEU A;  1HQC A;  2NVX J;  2LLK A;  1P2F A;  2CFO A;  2LBF A;  4B4C A;  3BG7 A;  4U0Y A;  2CGP A;  4OU0 A;  1UZC A;  2P6S A;  3PNT A;  4M3G A;  2MH2 A;  3HZJ A;  4XBF A;  1AKH A;  1UFM A;  2R92 J;  2PLY A;  1FP1 D;  3LQR A;  3QWL A;  2ELH A;  3G71 I;  4P96 A;  2QLZ A;  1X3W B;  4QSH A;  4UY8 I;  1YG2 A;  4A3C J;  2L9S A;  3CTA A;  2EB7 A;  1IG7 A;  2XHK A;  4A0X A;  4HLY A;  3CC2 I;  4EQQ A;  1BR4 A;  5H6R A;  5IP7 J;  4A3K J;  2O9L A;  5J8C A;  2VC1 A;  3M8F A;  2JT1 A;  1ETY A;  1X58 A;  3IWF A;  3C18 A;  4KN4 X;  2ZKZ A;  5ED4 A;  4XQF A;  5FB2 A;  1K4S A;  3GFL A;  5M3F J;  3L2U A;  2KHM A;  3KYD B;  1ZK8 A;  2CMP A;  1ZHF A;  4E70 A;  4RB3 C;  4J00 A;  3ZR8 X;  4A3F J;  1OYW A;  2GXA A;  4YFX F;  1ITY A;  4RGX A;  4P9F A;  1K6O A;  3DBH B;  3TED A;  3VYR B;  2V1U A;  1GV2 A;  4CZC A;  5AIP A;  2DT5 A;  2CS3 A;  2IXS A;  1H9T A;  4BJ6 C;  1MBG A;  1WKM A;  3DPU A;  5K7F A;  2I5U A;  2LH9 A;  3UKG A;  4EEF G;  2EZL A;  4S05 A;  4F3Q A;  1ZR2 A;  1WH7 A;  2HYF A;  1R7J A;  3SHF A;  4V2F A;  2OF7 A;  5J6X A;  3PQK A;  3MKL A;  4V2G A;  5D5U B;  3BRO A;  4M9Z A;  3KET A;  2NRA C;  5HVQ C;  4Y3O A;  2VT3 A;  5FKN A;  1TQM A;  3KP7 A;  4XN0 A;  3H5N A;  4PGG A;  1R23 A;  3BTI A;  1H89 C;  5GAD J;  2MGQ A;  2HS5 A;  4E7Z A;  2VOD A;  3K4N A;  4M73 A;  3E7L A;  3IKT A;  4IX7 A;  5IT9 Z;  2NOG A;  3ZXS A;  2O8X A;  1I6X A;  3J7A O;  2B63 J;  3HOZ J;  2ZNY A;  4NBQ A;  1LUJ B;  3SQN A;  2CV1 A;  3CLQ A;  4JX4 A;  4ETS A;  1VFC A;  2FJ1 A;  2XIG A;  3EUK L;  5J1U A;  3RZO J;  1PJR A;  2QGU A;  2JA7 J;  2M8E A;  1BIA A;  1FOW A;  2IGK A;  3BTL A;  3M9A A;  1VQO I;  1WJ5 A;  2W85 A;  1IF1 A;  3HHG A;  4CYC A;  5D4R A;  4BDZ A;  3KZY A;  2MBF A;  1N78 A;  1IN6 A;  1YW8 A;  4LK1 F;  3CC7 I;  4DBR A;  3EYY A;  4QWQ A;  4IF4 A;  2LD5 A;  5EZH A;  3TL4 X;  3IH3 A;  4OMY A;  1ZGW A;  2QZ8 A;  2RN7 A;  4B43 A;  2DQL A;  3VYT B;  1LKX A;  4C9Y A;  2OA4 A;  2BY3 A;  2KIS A;  3EUH C;  2DOA A;  2PMZ A;  3KYL A;  4QPO A;  3Q0U A;  3H3V K;  1BI3 A;  5HLH A;  5M5Y J;  5BPI A;  2COM A;  4PDK A;  2DAO A;  3FZV A;  1IN5 A;  1RKT A;  4LD5 A;  5FGM A;  3HTU A;  3FF5 A;  1ZEL A;  1QGP A;  1FSH A;  2DK5 A;  5AIQ A;  3S1Q J;  1FMW A;  4A2U A;  2F6C A;  1XGS A;  1B72 B;  1SD4 A;  1VQ8 I;  4XKC A;  2IS6 A;  1IRG A;  1Z91 A;  4ASN A;  2G0E A;  1X1B A;  3CCJ I;  4YEL A;  1EF4 A;  4R1H A;  3RKQ A;  1YOV B;  2QUF A;  5JHU A;  5EDN A;  3BJ6 A;  1GUU A;  3QPL A;  1WVR A;  4Q4Z F;  3FK6 A;  1MMD A;  2EPF A;  3GO5 A;  5CVJ A;  4ZZD A;  2V6E A;  2E5N A;  2EZK A;  3FXR A;  5JR3 A;  1QZY A;  3OR2 C;  2W48 A;  1V5E A;  1BJZ A;  1JGG A;  1ENH A;  1WJE A;  1U3E M;  2DQR A;  2RVC A;  4NDL A;  3OIP A;  4B44 A;  2UUZ A;  3GBG A;  4KA4 A;  2WWY A;  2YU3 A;  3HOS A;  2R7O A;  2W00 A;  3FXK A;  5J3L A;  3SFI A;  5K5O A;  1QVT A;  4HF1 A;  1DQU A;  2K9M A;  2Y31 A;  2ZFU A;  1JTX A;  1XCV A;  2AXL A;  4A3J J;  1JKR C;  1NK2 P;  2F5D A;  3A02 A;  2LKS A;  3K4M A;  3V4G A;  3GWZ A;  3WHB A;  2L4A A;  1E3H A;  3M1E A;  1WHU A;  2VQC A;  1A6Q A;  3MN2 A;  4HF2 A;  1FOX A;  1PVE A;  2JA2 A;  2KP6 A;  4HSR A;  4GDF A;  3RKY A;  4J01 A;  1VQP I;  2DT6 A;  3H1C A;  4HX4 A;  1TT0 A;  4XLH A;  2VBZ A;  5J1Y A;  1IV8 A;  1TWG J;  2O6G E;  3KP4 A;  2RNG A;  1K6Y A;  2Y9Z A;  1F43 A;  2XGE A;  4D0P A;  3RYP A;  1U9N A;  1LDK B;  5H6Q A;  3P9K A;  2DCE A;  1SVL A;  2GAU A;  2P7V B;  4QIW N;  2AO9 A;  1N25 A;  1ETV A;  1STZ A;  5DCM B;  5DEQ A;  1U78 A;  2I8D A;  1PUE E;  4E7K A;  2R7S A;  2HXO A;  2AQE A;  2M30 A;  5TIS C;  5DCF A;  2WB1 A;  2C6Y A;  3CO7 C;  3BR1 A;  3CMM A;  1IXS B;  2LR8 A;  2HFH A;  4AVP A;  4E7H A;  1GT0 C;  1I39 A;  3DU6 A;  2XF5 A;  4B48 A;  1RET A;  2Y30 A;  1FIA A;  2A68 F;  2NVU B;  2QA4 I;  2FF4 A;  4KDP A;  2NVY J;  1JHF A;  2OAZ A;  4GYG A;  3PO3 J;  2ISY A;  5GTI C;  3LFU A;  5KNL A;  1MNE A;  5E3L A;  3CUQ C;  4ESB A;  1CF7 A;  1H9G A;  2EA4 A;  4L5I A;  3LSM A;  4CCK A;  3LSK A;  1T38 A;  4C2U A;  4HST A;  4Y17 A;  3OIQ A;  3I3L A;  2OCC H;  2CUZ A;  4LIU A;  3WU0 A;  5J4V A;  4DYQ A;  5CQE A;  1V5F A;  4LIV A;  3F8F A;  3I4N J;  1B6A A;  2E2J J;  3WTS C;  2YUS A;  4D1Q A;  4YEJ A;  2PBI A;  4MNU A;  1S6L A;  2XSJ C;  3HUG A;  3JRH A;  3D0S A;  2DDA A;  3OYL A;  2GQQ A;  3K1P A;  4HPQ A;  2QBY A;  1OKR A;  2R7F A;  4D7M A;  3DTI A;  3C1D A;  4HBL A;  1VF9 A;  2OD5 A;  3ZQF A;  3AL0 B;  1Z3X A;  3G4S I;  1R5H A;  5CJ9 A;  3OYM A;  4G7Z F;  1NH3 A;  2H27 A;  1UG0 A;  3O3K A;  3S2H J;  1IXC A;  1K79 A;  2HOT A;  3FXM A;  4AYB N;  1FIP A;  3W2W A;  4UV8 A;  2V7F A;  3R0J A;  3FIS A;  2IPQ X;  1W5S A;  1JKQ C;  1OYI A;  3ECO A;  3HG9 A;  3TKY A;  4O6J A;  4L5J A;  1LDJ A;  2V9K A;  4EJV A;  2WAE A;  3FM5 A;  2OBP A;  2XRO A;  3ROU A;  2XF7 A;  2VON A;  5J4Y A;  4U87 A;  2IVM A;  2ME0 A;  4UXN A;  4AID A;  2QSG X;  3GTK J;  2R7W A;  4D7N A;  3GW2 A;  4UNO A;  3V7S A;  2IEK A;  1TW3 A;  1XGO A;  2Z16 A;  5HDK A;  1G59 A;  2FU4 A;  1RZ4 A;  1JE8 A;  3H9Q A;  2V6C A;  2OZ6 A;  1Y0U A;  4LJZ F;  1IV6 A;  5IP9 J;  2A5Y B;  5J47 A;  4UUT A;  3Q9V A;  2X9D A;  4IQJ A;  4N4O B;  2NOJ B;  2TRT A;  1UHW A;  4CHU A;  4HAM A;  2OTJ I;  2LKX A;  1SVO A;  2X0L A;  1J9I A;  4IPA A;  1R9T J;  1REP C;  4F55 A;  1HLV A;  1MGT A;  1R5G A;  3FIW A;  4XOP A;  2E7X A;  3O2P E;  2RAE A;  4Y52 J;  3KIO A;  1DU6 A;  1MSF C;  4DBQ A;  3QQA A;  3OSG A;  1U5T C;  3GLX A;  4XOR A;  4JX6 A;  2FUG 2;  1SAX A;  4XKB A;  2FE3 A;  5ICG A;  2GZW A;  1Y1V J;  4NC7 A;  1U0J A;  4N9I A;  4LLL A;  2Z2S B;  3GCM A;  2QQ8 A;  2E60 A;  1BOB A;  2O61 A;  3TW7 A;  2CUF A;  2XGC A;  2DTZ A;  5DD4 A;  2GOX B;  3W2V A;  3GUD A;  3PNY A;  2CUJ A;  2RRE A;  1HC8 A;  3IL2 A;  3LA7 A;  1SFO J;  4XLN F;  3TP0 A;  1FC3 A;  5DM6 F;  3JRD A;  2LC2 A;  4IXA A;  2YX4 A;  1Z6T A;  2A6E F;  3OYA A;  1SD5 A;  2MLK A;  2ZXH A;  3KEQ A;  2X6Y A;  4XIC A;  3HJE A;  3R4K A;  2K85 A;  2JUG A;  3E5Q A;  3SZP A;  2R5Y A;  1A31 A;  3CUO A;  1XCB A;  3HSE A;  4OMZ A;  2XGX A;  3M4O J;  1USS A;  2ECC A;  3VPR A;  3GXO A;  2Y2Z A;  1WWX A;  2BV6 A;  3L2R A;  2VOP A;  1P9Q C;  1VQK I;  2A61 A;  2HTS A;  3K69 A;  4OIN F;  4G9Y A;  4PFP A;  3MKY B;  5LGN A;  1MMN A;  1TWH J;  4M72 A;  4QPQ A;  3S3O A;  2KRH A;  4ZTF A;  4CCJ A;  4GYI A;  2JQ7 A;  1G3W A;  3GTG J;  2VN2 A;  3CCU I;  1MIJ A;  2PN6 A;  4PGH A;  2R5Z B;  3R61 A;  4DJA A;  1D5V A;  1DPU A;  1FPQ A;  2KIM A;  3KX2 A;  3K6G A;  3S17 J;  1IDZ A;  2EFQ A;  2FNP A;  3NRV A;  2NXN B;  2H8W A;  3KZZ A;  1NK3 P;  2M1B A;  3BZC A;  2VIX A;  1Z9C A;  5BQT A;  3TDU C;  1JJ6 C;  1NG7 A;  2F5V A;  3F6V A;  4KIF A;  3DV8 A;  1FP2 A;  2EIM H;  9ANT A;  2XGD A;  3JRE A;  1HW1 A;  4IKF A;  3J7Z I;  4ITV A;  1RRJ A;  1CGP A;  4IL6 C;  3C2G A;  5FKM A;  3OYF A;  3K70 D;  2JN6 A;  2PFB A;  3O8H A;  3D5L A;  2V4J C;  1QPM A;  2JJ7 A;  2EWN A;  2QQB A;  3V8L A;  5E3N A;  1HDD C;  3BG6 A;  2WAD A;  2OQR A;  4DNC A;  5CVR A;  5M5W J;  4JYK A;  2FML A;  2Q2E A;  3U1D A;  3IC7 A;  2XUB A;  3FDY A;  3M1C A;  2EFO A;  1T95 A;  3MCZ A;  4PCQ A;  3TW6 A;  1M1E B;  5CVV A;  3HRT A;  1JUM A;  1T0F C;  2DA7 A;  3B02 A;  1MZB A;  3I71 A;  3ZQH A;  1B8I A;  4KFC A;  2IRF G;  2R7Q A;  1FYK A;  1P7J A;  4FAS D;  4ZYH A;  4HDU A;  1ZKG A;  3DU5 A;  3A2K A;  1S9H A;  4HA8 A;  4ZTJ A;  3P7N A;  3LAJ A;  1Y0N A;  2DMP A;  1UG2 A;  3QYB A;  3S14 J;  2XAH A;  5E17 F;  4PSX A;  1FYL A;  4HX8 A;  4KJZ A;  5CQG A;  3G1M A;  3PSF A;  2NVT J;  5KAI C;  4LB6 B;  2VT2 A;  1R1T A;  1EKE A;  2K3P A;  3K0L A;  3J81 K;  2WAQ A;  3BQY A;  4E7J A;  2JA6 J;  1FTT A;  2Z3Y A;  1ZAO A;  4IRI A;  4ZDO A;  1WJD A;  4AIK A;  3PM1 A;  3HM5 A;  4BY1 J;  1XDU A;  3BDD A;  4L9J A;  2L7K A;  1QZE A;  2BXY A;  4UV9 A;  2LMD A;  3ESW B;  4YG2 F;  1ACI A;  1IRZ A;  1R1V A;  3WTW C;  4C3J J;  3L9F A;  1RES A;  2DTR A;  3K2A A;  1J5Y A;  5GP9 A;  3ZP5 A;  4FQG A;  4JBA A;  1Z7L A;  3JRA A;  1BA5 A;  2L01 A;  4F92 B;  1J0R A;  2BZT A;  2BHZ A;  1R36 A;  1ZN2 A;  1KQ9 A;  5F6F A;  4M3B A;  4EJO A;  4E7S A;  2DJN A;  2XVC A;  4A5M A;  4A93 J;  3OIO A;  4PJJ A;  2CV0 A;  1WH5 A;  2VJ4 A;  3GZN B;  2KZG A;  3GZ6 A;  2IBD A;  2K86 A;  2KZV A;  2E7W A;  2HVQ A;  4C3H J;  5FRN A;  4JQF A;  3FX3 A;  2VQG A;  5DYM A;  1YJN I;  1IC8 A;  3IKV A;  2O0Y A;  2K4J A;  2MH9 A;  2H6B A;  3JRC A;  4L0Y B;  1LJ9 A;  3OYB A;  1MBE A;  2N8G A;  4BHP A;  2ZO4 A;  3GFM A;  4MGR A;  3K1M A;  1ZQ3 P;  2V9V A;  4DYC A;  2OC6 A;  4YIR X;  4M9X A;  4BQQ A;  3E6C C;  3BZK A;  3EUH A;  2NS8 A;  5HLT A;  1OCP A;  3K7A J;  2X51 A;  1MBH A;  3QU3 A;  5KCM A;  1BJA A;  2A5W A;  5E3O A;  2AQF A;  1RIO H;  1J75 A;  1MJB A;  1D1C A;  2CSO A;  1ETW A;  3ABL H;  4GCV A;  2XB5 A;  1QHH D;  1W5T A;  2OU2 A;  2QSF X;  2GM4 A;  1IZ1 A;  2HDC A;  1YE9 A;  3S8P A;  2DOF A;  2K9N A;  5E18 F;  4J19 A;  3QOP A;  3PO2 J;  5JLX A;  3TMO A;  4QLC U;  4CH7 A;  2Q8K A;  2ZXW H;  1BI0 A;  1ULY A;  5JI6 A;  4GFB A;  1W0T A;  2W57 A;  5F27 A;  4YFN F;  1E0E A;  3KP3 A;  2B0L A;  2VUM J;  2CUE A;  2XKO A;  2L9N A;  4P9U A;  1YS7 A;  4LG0 A;  2IW5 A;  1MND A;  3DBL B;  2AS5 F;  2OJE D;  5HOO A;  1ETK A;  4BXF A;  4CYD A;  1R71 A;  2MD5 A;  4HF0 A;  2BY2 A;  2JA8 J;  3QOE A;  2CW8 A;  2K9L A;  2LKP A;  3E6D A;  2GLO A;  2HTJ A;  3M8E A;  2HQR A;  2CRG A;  2JTV A;  3OSF A;  3CCS I;  1HA8 A;  4M6Y A;  2ZC2 A;  3WGH A;  1XB4 A;  2VBW A;  1SC7 A;  3MZY A;  4IHY A;  5E8G A;  3CUQ B;  3TBI A;  4AD9 A;  3HGG A;  1TT5 B;  1U6G A;  2BVM A;  4XLA A;  5FJ8 J;  1XX5 A;  3A4C A;  1ZG5 A;  1OIS A;  2VJI A;  1UB9 A;  2R7U A;  4U0V A;  1MJA A;  2FD5 A;  3JAM K;  3WHC A;  3MMY B;  2NNY A;  4MTE A;  3VDX A;  4AIJ A;  2LYC A;  1QNT A;  1FOK A;  3FMR A;  4PJ0 C;  2DFI A;  1GXP A;  2ZME C;  3FM3 A;  1ON2 A;  4C3I J;  1HXD A;  4XLF A;  3F0C A;  2MA3 A;  1Y8R B;  4OIO F;  3KPH A;  1E3O C;  1R49 A;  1LE8 A;  2VKD A;  2KDZ A;  3V8J A;  3S1R J;  3OS0 A;  3HB9 A;  1QHG A;  4HLX A;  1L0O C;  3KE2 A;  3OS2 A;  1OCZ H;  2UWM A;  4G7O F;  2EA2 A;  4UUS A;  1ZR4 A;  2NVQ J;  1Z0X A;  3S32 A;  3N4M A;  2TDX A;  2MC3 A;  3D5S C;  3WTY C;  2WA0 A;  1FBQ A;  3ZQQ A;  5ICC A;  5TRD A;  2HPM A;  2CFX A;  1KYW A;  4XM3 A;  4I76 A;  1YO5 C;  2KQR A;  5EEH A;  3CD6 I;  2DYR H;  4MIM A;  2ZFW A;  1B59 A;  3CCR I;  1ZYR F;  4FET A;  5EEA A;  2IS2 A;  5DDG A;  3LA2 A;  1WJB A;  3ABT A;  1J59 A;  4LIT A;  1JKP C;  1WGX A;  2HQN A;  1JT6 A;  3OWT A;  5CLS A;  3DQV C;  1P7I A;  2Y9Y A;  5JHF A;  3MKZ A;  3DEW A;  2R7V A;  3BCB A;  4B3A A;  4B09 A;  5ICE A;  3J7Y J;  4KUM A;  3E6B A;  3HPH A;  2L0K A;  4CCO A;  3BLY A;  2AXT C;  4E6K G;  4A12 A;  3HOT A;  4RAY A;  5ILV A;  4WK8 F;  1A35 A;  2DA4 A;  2K5C A;  3LMM A;  4AYB A;  4KIT B;  1X4P A;  1TWF J;  5IT3 A;  3CO6 C;  1WPK A;  4A3E J;  2BXZ A;  2MSY A;  2XPW A;  2CYY A;  2E1O A;  4EJW A;  1U5T B;  1VQM I;  1W5C C;  1R1U A;  3NAR A;  4HV6 A;  2HXI A;  1TP4 A;  2GIZ A;  3CES A;  3ZCO A;  1YYV A;  1OFC X;  4CO8 A;  3D1N I;  3F6O A;  4MQ9 F;  2L9V A;  5IOZ A;  4HOB A;  2F2E A;  1IDY A;  1W1W E;  3HYI A;  3IAS 2;  1J09 A;  3HBL A;  4NQW B;  3K2Z A;  3DKX A;  1APL C;  3U21 A;  4EM2 A;  2IJL A;  1YIO A;  1OR7 C;  4B47 A;  4PSW A;  4DGW B;  1QO0 D;  1PYV A;  3I0T A;  1Z1D A;  3C7J A;  3UR3 C;  4RDU A;  2E1N A;  1K7A A;  1QBJ A;  1XGN A;  3CDH A;  3HKZ N;  4HX7 A;  1LPQ A;  2DYS H;  3B73 A;  1I1S A;  3I4P A;  1OLT A;  2ECB A;  2R3S A;  4JP0 A;  3U1K A;  1JJ8 C;  2O8K A;  3GF2 A;  5KVR A;  3BR5 A;  3O8G A;  1MMS A;  3H35 A;  1TQI A;  3RYR A;  1MD0 A;  3FBN B;  2QKM B;  4O5V A;  1G3Y A;  1R00 A;  1Y1W J;  2LY1 A;  3RSN A;  1EV7 A;  1FY7 A;  2EH3 A;  3RJP A;  2XRL A;  4IHV A;  3TQN A;  3K10 A;  2UV1 A;  4TV7 A;  2RC4 A;  5DUI A;  1D0X A;  4HG2 A;  1T8I A;  3T8R A;  4XMY A;  2CO5 A;  4HW0 A;  1GXQ A;  1X3U A;  3NQO A;  2DA2 A;  3GEZ A;  2HNH A;  1RNL A;  3SFZ A;  1TNS A;  2W7N A;  2X4H A;  1RR7 A;  3OYH A;  2EV5 A;  3H36 A;  1E3P A;  3U2R A;  5E8I A;  4XKW A;  4OWR B;  1YQA A;  3CCY A;  3VYS B;  1P92 A;  1MH3 A;  1Z77 A;  2E1M C;  2L7M P;  2EZI A;  2X85 A;  3PQJ A;  3L1P A;  1UST A;  4XL9 A;  2COB A;  2LF7 A;  4G94 A;  5BOX A;  5BPD A;  1ERD A;  2P5V A;  3BPV A;  2E36 A;  3TO9 A;  4IHT A;  4RBO A;  4NNJ A;  1TZL A;  2JPB A;  1RR8 C;  4L9T A;  3WGG A;  1UHS A;  2EIL H;  1AHD P;  3DCF A;  1S8N A;  1B72 A;  2RNJ A;  3MWM A;  5HLI A;  3E1S A;  5JFR A;  6PAX A;  3RIR A;  5IYB J;  2EJR A;  3B6C A;  2VBY A;  4KMF A;  5F04 A;  2GA1 A;  1BI1 A;  5EZG A;  2K02 A;  3DTE A;  1LQ1 A;  1KU7 A;  4RAG A;  2VAS A;  2FEZ A;  5JLW A;  3HOV J;  4YIF A;  2D1V A;  3HXL A;  5IP6 A;  4UVB A;  3MD2 A;  1RI7 A;  2RQQ A;  4LOC A;  3ABM H;  2M0M A;  4U88 A;  2MW8 A;  2FBH A;  3HHH A;  3OOU A;  5LHI A;  2VC0 A;  3BQZ A;  2P8T A;  2XV4 S;  5HNH A;  1ZG3 A;  2P5L C;  1VQ7 I;  4R8H A;  2XPV A;  1G2H A;  5L3F A;  4Z2Y A;  2X1C A;  2P7C B;  4U7B A;  2IA2 A;  1KU9 A;  4HNV A;  1FBS A;  3K4C A;  3KEO A;  3OY9 A;  2M2E A;  4RM3 A;  1XMK A;  2VL8 A;  4XKV A;  1L3L A;  3FWE A;  3PFY A;  3CDL A;  4ZYE A;  1FEX A;  1Y6I A;  4I0A A;  3DTK A;  5FFX A;  1WI3 A;  1I1G A;  1MMA A;  1XMA A;  1TWC J;  4G6T B;  2FOW A;  4KIB A;  1AU7 A;  3GVA A;  3ELK A;  5DCM A;  4XK4 A;  2YS9 A;  5E20 A;  3RPU D;  2F4M B;  5DV5 A;  2GXG A;  3HSF A;  3WU2 C;  2L54 A;  4BYY A;  2D1H A;  1T0F A;  3SEZ A;  5HLG A;  2XF6 A;  4KN7 X;  4EJU A;  3GTJ J;  3H3U A;  3PSI A;  4A3D J;  4I0B A;  3ECH A;  3KYC B;  2V1X A;  4D5C A;  1WZ2 A;  1IXR C;  4MFE A;  3PIP F;  2KKO A;  3OS1 A;  4NC6 A;  1C0W A;  2BGC A;  3RZD J;  3AG3 H;  5CPR B;  1YJW I;  1S29 A;  4BY7 J;  2J5P A;  5B66 C;  1ORK A;  3FXQ A;  2EV0 A;  5DM7 F;  4FE7 A;  3OMY A;  1JUS A;  2HVR A;  2ZSH B;  3A01 B;  1F4K A;  2VQH A;  3DPT A;  2E5Z A;  1YTY A;  2WBM A;  1AA7 A;  3L2W A;  2HU9 A;  2KIQ A;  3GLL A;  2IAI A;  1XS9 A;  2VQL A;  1I50 J;  4RB1 A;  2Z33 A;  2HDW A;  2B7E A;  4PJN A;  2KMU A;  3OR1 C;  1JKO C;  1Z05 A;  1VQ4 I;  1QA6 A;  3S2W A;  2ZB9 A;  3LSG A;  1D0Z A;  1VQN I;  4ZZL A;  3I54 A;  2ZCW A;  2IP2 A;  3K4K A;  4F93 B;  4X0G A;  1RC9 A;  4UVC A;  3ISP A;  3ZMT A;  2OUM A;  4XRM A;  2Q1Z B;  5K7Z A;  3HC7 A;  2W82 A;  4IRG A;  3G6E I;  2H6C A;  3AG1 H;  5ILU A;  3CMY A;  3RPU A;  3BWG A;  4JK1 X;  1BBY A;  2BVL A;  5HS9 A;  3WTX C;  5IOY A;  1K4T A;  1OCT C;  4ZDL A;  1K61 A;  4ZDP A;  5ILS A;  2XAF A;  4A0Z A;  3OYE A;  3LSR A;  3HRM A;  2CQQ A;  4GGG A;  2X6W A;  3RTR A;  4CCM A;  2XC7 A;  2ETH A;  4XLC A;  2K7L A;  4AC0 A;  1FBU A;  1N77 A;  3CF2 A;  3KLO A;  3TDZ C;  3TO7 A;  2ID3 A;  1R4N B;  4WXC A;  3FXO A;  3SJM A;  2NNN A;  3ZRG A;  4IO9 F;  4EMS A;  2FBK A;  3L00 A;  1B1B A;  1POG A;  2HOA A;  2DO7 A;  1BR2 A;  2EV6 A;  2ZBK A;  2LP0 A;  2O7O A;  2KT0 A;  2IA1 A;  3BR2 A;  3G73 A;  2ZJQ F;  1AWC A;  2DMQ A;  2CQ7 A;  1TQP A;  3KLN A;  2DN0 A;  3ERM A;  2MC4 A;  5E1Z B;  4G7H F;  2HQ5 A;  3I53 A;  3B6A A;  3FXJ A;  3WG9 A;  2FSW A;  3LST A;  2M3A A;  5D5V B;  1FSE A;  2CQX A;  2VKV A;  1JUP A;  5J8F A;  2DT7 B;  3VB2 A;  2OPT A;  2R4G A;  3MQ0 A;  4I09 A;  1ZLJ A;  4ZYD A;  1WI9 A;  2L02 A;  2VI6 A;  4BS9 A;  1SFK A;  2XKP A;  2KJC A;  1YJ9 I;  1IN8 A;  1LVA A;  3F8N A;  2L7Z A;  3K9T A;  1A36 A;  1UEL B;  4M74 A;  3H3Z A;  2W24 A;  3HEF A;  2FRH A;  5IYC J;  1D3Y A;  2ZME B;  2R7D A;  2DOE A;  1ZGJ A;  2QCO A;  1XTA A;  1ODD A;  5EGO B;  2VE9 A;  4WXD A;  4BHB A;  2GWR A;  2HOS A;  1MDM B;  4UHT A;  4ENJ A;  1WSU A;  4RLQ A;  2JRM A;  1ZRE A;  1QQI A;  4I02 A;  1RUO A;  2LF8 A;  2FQ3 A;  2P81 A;  1IRX A;  3KP5 A;  3KZI C;  5D8L B;  4FTH A;  3P9I A;  3HOY J;  5LBQ A;  4BXU A;  2CV2 A;  2OCE A;  2WB1 N;  2D45 A;  3CP8 A;  2DA5 A;  2DLL A;  3WTU C;  3OL3 A;  1LFU P;  2HZD A;  1LDD A;  3GME A;  3IH4 A;  4CUG A;  5FO5 A;  2KLO A;  5GAG J;  4A0Y A;  1X1D A;  1DGR M;  2DA6 A;  5H2F C;  3T0Y A;  3RI4 A;  1KYZ A;  3ERE D;  5J40 A;  2A6T A;  2ICW G;  2WAF A;  2XAS A;  3MEX A;  3G1L A;  1FNN A;  3FKI J;  2BW3 B;  2V9P A;  3QAH A;  3KEY A;  3ZOB A;  3TOA A;  4CXF A;  4BEH B;  4Y7N J;  5EG0 B;  3K4J A;  1T08 B;  1V4R A;  4HEA 2;  4FCY A;  2IGO A;  2DXI A;  4NB5 A;  3OYK A;  5EF6 A;  5GTH C;  2M7A A;  2V26 A;  2R5Z A;  2OQG A;  4IHX A;  4KIS A;  5L3D A;  2FNA A;  1KU3 A;  1O7L A;  1XDS A;  2ME6 A;  3CJN A;  3IWZ A;  1W7P B;  4LB5 A;  4XR6 A;  2HKO A;  3O6B B;  2JVG A;  4N4N B;  3WGI A;  2UXX A;  3J80 K;  2LY2 A;  2F5E A;  3I59 B;  3JRF A;  1O3Q A;  1PUF B;  4OOI A;  1UJ8 A;  4OAZ A;  4WXH A;  4AU7 A;  5H20 A;  2RV8 A;  3LOC A;  5C44 J;  2E71 A;  2VB6 A;  5CVU A;  1W36 C;  2WY7 Q;  3ZQI A;  1E17 A;  2ELJ A;  3H9J A;  3HIF A;  4G6Q A;  2W1O A;  1S3J A;  4EM0 B;  3I9V 2;  3BR0 A;  2VPL A;  1JHH A;  2HOE A;  3BCA A;  5LHG A;  2QKL B;  1HOM A;  2EIJ H;  2K9Q A;  2MYS A;  3S1N J;  4G8X A;  2M5W A;  4BBS J;  3BG9 A;  3ZMS A;  1HW5 A;  3HOW J;  4RA2 A;  2KDO A;  3WE2 A;  4AVZ A;  3FBI B;  5KHD A;  4JOM A;  2ZJ2 A;  3NWT A;  4EV0 A;  2V79 A;  3L2Q A;  2K9S A;  2PEX A;  1KQ0 A;  3ZMU A;  3J81 Z;  1J2X A;  2QVO A;  3DXJ F;  4I99 C;  4AM3 A;  4LLN A;  4F7Z A;  4BDY A;  1SEU A;  4Y33 A;  1Z21 A;  2H09 A;  4A69 C;  2JUC A;  5EYR A;  3CQZ J;  1KON A;  3S15 J;  3W3C A;  2UZK A;  5GAE J;  1JTY A;  3J7A Y;  3GYH X;  3Q0V A;  4GO1 A;  4AUX A;  4BU2 A;  2KRC A;  2CW0 F;  4II2 A;  2A6H F;  1O57 A;  5D8K B;  2ELK A;  3BTC A;  3F72 A;  1SFE A;  2QM3 A;  1R22 A;  2JK3 A;  2PJR B;  2HKX A;  3R60 A;  4DZJ A;  4GRI A;  2KIU A;  3AG2 H;  4LMY A;  4A6E A;  3RDI A;  2F4O B;  2QQA A;  2ZXI A;  1ZGA A;  3T1B A;  1UMQ A;  1R6R A;  1VZ0 A;  5CKT A;  2O5R A;  3WTV C;  2QEX I;  4CZZ A;  3E3V A;  5JVG F;  1X3Z B;  3CJT B;  3IUO A;  2CJJ A;  4UB8 C;  2DDB A;  4MEX F;  4BUP A;  4HQM A;  1YS6 A;  3K4B A;  4M9S A;  1P4W A;  3E5X A;  1MBJ A;  5DTD A;  5A2Q K;  3OYN A;  4Y13 A;  1T2K A;  3DF8 A;  3CZ6 A;  1TBX A;  4II3 A;  1BL0 A;  3H92 A;  1D5Y A;  3WE3 A;  3PUB A;  3SXY A;  2E1M B;  4BHC A;  1QZZ A;  3LL7 A;  1DPR A;  5L3G A;  1DDN A;  5TJJ A;  1X4O A;  3JRB A;  2YR2 A;  3Q3S A;  2X1E A;  5LD2 C;  3M07 A;  1FX7 A;  1LFB A;  3JRG A;  2GBY A;  3NEU A;  5E1W A;  2M45 A;  2PQ8 A;  4Q48 A;  2FBI A;  3REO A;  4L18 B;  1W0U A;  4DOZ A;  4KT5 C;  4LG3 A;  1XD7 A;  2D2W A;  3TP3 A;  1T98 A;  1Y8Q B;  2RKH A;  2LBF B;  2VOO A;  3LAP A;  1F1Z A;  1F9N A;  3I64 A;  3CF5 F;  1Q1H A;  4EGY A;  4DYR A;  3HRU A;  1AKH B;  1TTY A;  1A04 A;  3S2D J;  3LSJ A;  2P5K A;  4ZYA A;  2DPD A;  3LFK A;  1S72 I;  4Y4R A;  3P9C A;  3PL8 A;  5L3B A;  3MKW B;  4NC8 A;  2WC2 A;  1U8B A;  2R7T A;  4ESF A;  4BQA A;  3VSK A;  3QU6 A;  4UVA A;  3N05 A;  2P6T A;  5F0C A;  3AG4 H;  2X48 A;  1GVD A;  4H0E A;  4RS8 A;  4BBR J;  4C2T A;  2JA5 J;  3ZGK A;  1BW5 A;  5D5W B;  4IRH A;  3G2B A;  2OZU A;  1VI0 A;  4HDV A;  2GXB A;  3ASN H;  1IRF A;  2W4S A;  5DUK A;  3ZQC A;  3GTP J;  3QRF F;  2YU9 J;  2A07 F;  1W4M A;  3SZG A;  4EAT A;  5GPA A;  4X6A J;  3SDG A;  2P4W A;  4PZJ A;  2R93 J;  2G7U A;  2V1N A;  2VXZ A;  1KU2 A;  1EH8 A;  3KCC A;  2DMN A;  4HNU A;  4MEY F;  4M3D A;  2STW A;  3NWS A;  2EIN H;  1LFP A;  1Z3Y A;  4M3E A;  1SFX A;  2Z99 A;  3ZQG A;  5KK1 A;  1HST A;  4KIG A;  1ONV A;  2DFF A;  4K2E A;  5C4X J;  3E6M A;  1DP7 P;  2GOM A;  2HEO A;  4HYE A;  1ZRF A;  4YII A;  3JAM Z;  3RQI A;  3D5R C;  1OCC H;  3VOE A;  1ZRD A;  4BXX J;  1GDT A;  2PMU A;  2ID6 A;  3BZ6 A;  4Q5S F;  3NAU A;  3IRQ A;  5K5R A;  3I56 I;  2G7H A;  3JCU C;  1OJL A;  1OMI A;  1TLH B;  4P5O A;  3I55 I;  2F4I A;  4DW6 A;  1XC5 A;  3QYF A;  4KNY A;  2EQR A;  1NTC A;  4BAC A;  1Z7U A;  3DBR B;  1NG6 A;  4M71 A;  3CUQ A;  4XNF A;  4IJA A;  4Y15 A;  5CVI A;  5HS8 A;  2LFB A;  4DQ2 A;  4XSX F;  3GTL J;  4RB0 A;  4CGZ A;  4CYC B;  3CMA I;  3FMQ A;  4EVI A;  2FOK A;  1MNM C;  5FKK A;  2WV1 A;  2KPM A;  2O03 A;  4F52 A;  1B9N A;  5IT9 K;  2ISZ A;  4U0W A;  5HDG A;  2M87 A;  2VKE A;  2WAQ N;  2XRN A;  3ZMV A;  1HKT A;  2DMU A;  3QP5 A;  1ZG1 A;  3K70 C;  2IGN A;  2ADU A;  4A3I J;  3DKW A;  2A69 F;  1YW7 A;  4ANJ A;  1OPC A;  2E2I J;  3FHN A;  2HWV A;  2NS7 A;  2Y75 A;  1YI2 I;  3RKW A;  2DMT A;  3ZN0 A;  3PFI A;  1XG1 A;  2LNB A;  2DA1 A;  1YW9 A;  1WJA A;  5JVT A;  2DPU A;  3DEE A;  4AIH A;  1H8A C;  1ZRC A;  3MZ8 A;  5TGT A;  1OCR H;  1Z67 A;  3E0J B;  1N75 A;  3DWL E;  2DU9 A;  3JW4 A;  3TGN A;  2CG4 A;  5C4J J;  1X1C A;  2YSR A;  1F5T A;  5M3M J;  4BE0 A;  1X19 A;  2X6X A;  4PJM A;  3TOB A;  4LGW A;  3TO6 A;  5FLX K;  3H5R A;  4RMN A;  5L3E A;  2KRF A;  2E1C A;  5B5E C;  2ZJR F;  4I7H A;  4IQ4 A;  4BH9 A;  3VEP A;  4C2M J;  4EM1 A;  1G3S A;  2VLA A;  1H88 C;  3AFH A;  3A03 A;  3IH2 A;  3RCO A;  3LA3 A;  3JR9 A;  2STT A;  1FMV A;  4CCN A;  2XDV A;  4D5F A;  2YPR A;  1QVU A;  3L2C A;  1P4A A;  1JXS A;  5FD5 A;  3FK7 A;  4BKX A;  1KA8 A;  2IS1 A;  5FLX Z;  3CP2 A;  1VQ6 I;  4LK0 F;  1WQ2 A;  3BR3 A;  3P5J A;  5FKO A;  3WU1 B;  1ZAR A;  1SAU A;  2EK5 A;  5EJC A;  4M3F A;  5F64 A;  3QP6 A;  2UXN A;  2CQK A;  2FA5 A;  3M8J A;  3V7C A;  1IAW A;  4ZJZ A;  4NHJ A;  4FHT A;  5IPA A;  1A5J A;  5LGU A;  3HDD A;  3HTS B;  4S0H B;  4MO7 A;  3WTT C;  3WOD F;  4WF2 A;  3BPX A;  2Y0S N;  3X2Q H;  1U5T A;  4KT6 A;  1YRN B;  4BGD A;  2HGC A;  4BQN A;  4PJL A;  1R5I D;  3CJQ B;  1O4X A;  3ZPL A;  3JTG A;  1EA3 A;  5EEG A;  5L3C A;  1I3A A;  5E79 C;  3OYD A;  1WFX A;  2VXD A;  2ACJ A;  4L0Z B;  2ZSI B;  2QYO A;  3LNQ A;  3W6V A;  2ESH A;  1MKM A;  3A0H C;  5DD8 A;  1ZLK A;  1D8K A;  1MBF A;  2K3F A;  4NQW A;  2M0C A;  1X1P A;  2LRD A;  2MG4 A;  2YX7 A;  4CA0 A;  2XB0 X;  1VQ5 I;  1YX5 A;  3ML6 A;  1FLI A;  1U8R A;  3M3Y J;  5IYD J;  4KYW A;  1E2X A;  4XON A;  1D0Y A;  3BY6 A;  3S93 A;  4R79 A;  1XSD A;  4BE1 A;  3E97 A;  2JSC A;  4XID A;  3JRI A;  4WWC A;  1RKW A;  4XOT A;  2CU7 A;  4ENM A;  3BTJ A;  4FT8 A;  5LEJ A;  3F22 A;  4ON0 A;  3V7R A;  5ERI A;  4RB2 C;  1BIB A;  2DJI A;  2PG4 A;  5K1Y A;  1QRY A;  4YFK F;  2EZH A;  2HVS A;  1CF7 B;  5J1R A;  4L5E A;  2BYV E;  4B8X A;  1K78 B;  2FQ4 A;  3GZ5 A;  1HKS A;  5K7H A;  1Y39 A;  3L09 A;  1PDN C;  1YRN A;  2LTP A;  5HDN A;  3AKZ A;  2HI3 A;  3KP2 A;  4MFD A;  2JVH A;  3AAF A;  2VPR A;  4IOC F;  2P0W A;  2E34 A;  1TL8 A;  4FE4 A;  1MJ9 A;  3I5U A; 
#chains in the Genus database with same CATH homology
 3COA C;  1FT9 A;  2QBY B;  3GFI A;  3DFG A;  5LGT A;  3QPT A;  2W84 A;  4AWX B;  1I5Z A;  1UCR A;  1ZH5 A;  2RDP A;  4M6X A;  1HBX G;  1B4A A;  4ZYG A;  2EFW A;  3ZMD A;  4HV5 A;  2ZXJ A;  4RGS A;  1T39 A;  3WTZ A;  3L7W A;  3F8M A;  3FHZ A;  2IA0 A;  2XAQ A;  1IN4 A;  4WCG A;  2CWE A;  1K78 A;  2ESN A;  5CYV A;  3T5X A;  4MQV A;  3T8T A;  2G9W A;  5E1X A;  2LDU A;  4I01 A;  1DUX C;  3GFJ A;  3IRR A;  3ABU A;  1R58 A;  1FWZ A;  1WRJ A;  4G6D A;  2GIV A;  2DW4 A;  3HRS A;  2Y48 A;  4EGZ A;  2HR3 A;  5F1R A;  1OYY A;  4OIQ F;  2JPC A;  2F5C A;  3LQQ A;  4A6D A;  3EDP A;  4OIR F;  1S7A A;  3ZN1 A;  2MLG A;  1HW2 A;  1BC8 C;  3R6S A;  5FD6 A;  1BM9 A;  1SFU A;  1LEA A;  4ENN A;  5LRR A;  2PI0 A;  3OV8 A;  5D4S A;  3F23 A;  1BI2 A;  3JTH A;  1YLF A;  3N97 A;  1H0M A;  4P55 A;  1HSJ A;  4FX0 A;  4O3M A;  2VE8 A;  2PMH A;  2QEN A;  5BMZ A;  1FYM A;  2Q0O A;  1GVJ A;  2DI3 A;  1T6S A;  4RAZ A;  2LSO A;  3U9G A;  5AON A;  2Z5U A;  1RUN A;  4GXO A;  3ULQ B;  3E5U A;  1S7O A;  1O7F A;  1JGS A;  3W6J B;  1BC7 C;  4ENK A;  1Z6R A;  2XAG A;  1V3F A;  3M7G A;  3G3Z A;  3JSP A;  3F3X A;  3BOQ A;  5LRS A;  2H94 A;  3BJO A;  1XSV A;  3BP8 A;  4WX9 A;  5ICF A;  1P4X A;  4LLG F;  1XSX A;  3EET A;  4I98 B;  1TNT A;  4I2O A;  2A3S A;  2QWW A;  2BE5 F;  1HKQ A;  2DK8 A;  1IN7 A;  4KMU X;  5HS7 A;  5D6E A;  1VTN C;  5K5Q A;  3JSO A;  3GX4 X;  3EYI A;  3FMS A;  4ESJ A;  2JRT A;  3K1N A;  3V8K A;  3RPQ A;  1G6N A;  4CIC A;  2J5O A;  2L3D A;  1UHM A;  1U2W A;  2NAZ A;  2NYX A;  1SD6 A;  4OIP F;  3LWF A;  1LNW A;  2DBB A;  3R0A A;  1O3T A;  2RGV A;  3CLO A;  1AOY A;  4S04 A;  3IHU A;  1W7P D;  2FMY A;  1SD7 A;  2ZME A;  2KJB A;  2WTE A;  1MDM A;  4XSZ F;  1P6R A;  4L9N A;  1NHA A;  2PJP A;  3ZMZ A;  2HZT A;  2V1D A;  2GA2 A;  4HZF A;  4IHS A;  3QPH A;  2KIF A;  4IVN A;  2Y0M A;  4BNC A;  5D5X B;  3J80 Z;  3EQL F;  2ZNZ A;  4LFU A;  4EJT A;  3OOP A;  1KQ8 A;  3SZT A;  4A5N A;  3DPL C;  3MAJ A;  3KFW X;  3I58 A;  3VOD A;  5BS6 A;  1G3T A;  1LB2 A;  1SMY F;  1SMT A;  1IW7 F;  5FFZ A;  1D8J A;  1W7P A;  4XRF A;  1EH7 A;  1KGS A;  1TW2 A;  3I59 A;  4MTD A;  1BN5 A;  3C3W A;  1XGM A;  4RGU A;  3ZQ7 A;  1GHC A;  2IT0 A;  1EH6 A;  1B9M A;  2L4M A;  3MFK A;  3RKX A;  3W6K B;  5LLQ A;  2VBX A;  2WV0 A;  3Q5F A;  4CDG A;  3F8B A;  3BJA A;  1OR7 A;  3VFZ A;  4RGR A;  3FXU A;  1G4D A;  1IUY A;  2RQP A;  2O3F A;  1YFH A;  4LG0 B;  2QQ9 A;  3DP7 A;  2NS0 A;  2EFP A;  1J7K A;  1XN7 A;  4KIC A;  5A2Q Z;  4N0B A;  1O3R A;  3F21 A;  4ZH4 F;  2Z9O A;  5D6F A;  4U7D A;  4MHG A;  2EFN A;  3Q9S A;  3HSR A;  4N9H A;  4Q47 A;  2HYG D;  4UUV A;  2JZY A;  2K27 A;  4HQE A;  3KP6 A;  2F5F A;  1I27 A;  2K4B A;  3F8C A;  1O3S A;  1LEB A;  4BAY A;  4L9V A;  5LEK A;  2BEO A;  1ON1 A;  4FX4 A;  4XLP F;  1FZP B;  1PP8 F;  1BOA A;  2XAJ A;  1PP7 U;  3MZH A;  2W25 A;  2FXA A;  5LHH A;  2BBY A;  3DEU A;  1HQC A;  1P2F A;  4U0Y A;  2CGP A;  4OU0 A;  2P6S A;  2MH2 A;  4XBF A;  1UFM A;  2PLY A;  1FP1 D;  3LQR A;  2ELH A;  4P96 A;  2QLZ A;  1YG2 A;  3CTA A;  2EB7 A;  2XHK A;  4A0X A;  4HLY A;  4EQQ A;  5H6R A;  5J8C A;  2VC1 A;  3M8F A;  2JT1 A;  3IWF A;  3C18 A;  4KN4 X;  5ED4 A;  2ZKZ A;  5FB2 A;  3GFL A;  1ZHF A;  4E70 A;  4RB3 C;  1OYW A;  4YFX F;  4RGX A;  4P9F A;  1K6O A;  2V1U A;  5AIP A;  2DT5 A;  1H9T A;  1WKM A;  4S05 A;  2HYF A;  1R7J A;  3SHF A;  5J6X A;  3PQK A;  5D5U B;  3BRO A;  4M9Z A;  3KET A;  2NRA C;  5HVQ C;  2VT3 A;  1TQM A;  3KP7 A;  4PGG A;  1R23 A;  2HS5 A;  2VOD A;  4M73 A;  3IKT A;  5IT9 Z;  2O8X A;  1I6X A;  3J7A O;  2ZNY A;  3SQN A;  4ETS A;  2XIG A;  2M8E A;  1BIA A;  3M9A A;  2W85 A;  1IF1 A;  3HHG A;  5D4R A;  3KZY A;  2MBF A;  1IN6 A;  1YW8 A;  4LK1 F;  3EYY A;  4QWQ A;  4IF4 A;  4OMY A;  2QZ8 A;  2RN7 A;  2DQL A;  2OA4 A;  1BI3 A;  5HLH A;  5BPI A;  2COM A;  4PDK A;  2DAO A;  3FZV A;  1IN5 A;  4LD5 A;  5FGM A;  3HTU A;  3FF5 A;  1QGP A;  1FSH A;  2DK5 A;  5AIQ A;  4A2U A;  1XGS A;  1SD4 A;  1IRG A;  1Z91 A;  4ASN A;  4R1H A;  2QUF A;  5JHU A;  3BJ6 A;  4Q4Z F;  3GO5 A;  5CVJ A;  4ZZD A;  3FXR A;  5JR3 A;  1QZY A;  1U3E M;  2DQR A;  2RVC A;  4KA4 A;  2WWY A;  2YU3 A;  3HOS A;  5K5O A;  4HF1 A;  1XCV A;  2AXL A;  2F5D A;  3V4G A;  3GWZ A;  2L4A A;  3M1E A;  4HF2 A;  3RKY A;  4HX4 A;  2VBZ A;  2O6G E;  3KP4 A;  4D0P A;  3RYP A;  1LDK B;  5H6Q A;  3P9K A;  2GAU A;  2P7V B;  1STZ A;  5DCM B;  5DEQ A;  1U78 A;  1PUE E;  2M30 A;  5DCF A;  2C6Y A;  3CO7 C;  1IXS B;  2HFH A;  4AVP A;  2A68 F;  4KDP A;  2FF4 A;  1JHF A;  2OAZ A;  4GYG A;  2ISY A;  3CUQ C;  4ESB A;  1CF7 A;  1H9G A;  2EA4 A;  4L5I A;  1T38 A;  4Y17 A;  3WU0 A;  3F8F A;  1B6A A;  3WTS C;  2PBI A;  4MNU A;  1S6L A;  3HUG A;  3D0S A;  2GQQ A;  3K1P A;  2QBY A;  1OKR A;  2R7F A;  4HBL A;  3C1D A;  2OD5 A;  1R5H A;  5CJ9 A;  4G7Z F;  2H27 A;  3O3K A;  1IXC A;  1K79 A;  4UV8 A;  3R0J A;  2IPQ X;  1W5S A;  1OYI A;  3ECO A;  3TKY A;  4O6J A;  4L5J A;  1LDJ A;  4EJV A;  3FM5 A;  2OBP A;  2XRO A;  3ROU A;  2VON A;  2IVM A;  4UXN A;  3GW2 A;  4UNO A;  3V7S A;  1TW3 A;  1XGO A;  5HDK A;  2FU4 A;  1RZ4 A;  1JE8 A;  2V6C A;  2OZ6 A;  1Y0U A;  4LJZ F;  2A5Y B;  3Q9V A;  1UHW A;  4CHU A;  4HAM A;  2X0L A;  1J9I A;  4IPA A;  1REP C;  1MGT A;  1R5G A;  2E7X A;  3O2P E;  1U5T C;  3GLX A;  1SAX A;  2FE3 A;  5ICG A;  2GZW A;  4N9I A;  4LLL A;  2O61 A;  5DD4 A;  3GUD A;  3IL2 A;  3LA7 A;  4XLN F;  1FC3 A;  4IXA A;  2YX4 A;  1Z6T A;  2A6E F;  1SD5 A;  2MLK A;  3KEQ A;  3R4K A;  3E5Q A;  3SZP A;  3CUO A;  1XCB A;  3HSE A;  4OMZ A;  2XGX A;  1USS A;  3GXO A;  1WWX A;  2BV6 A;  2VOP A;  2A61 A;  2HTS A;  3K69 A;  4OIN F;  4G9Y A;  5LGN A;  4M72 A;  4GYI A;  1G3W A;  2VN2 A;  2PN6 A;  4PGH A;  3R61 A;  1D5V A;  1DPU A;  1FPQ A;  2KIM A;  2EFQ A;  2FNP A;  3NRV A;  3KZZ A;  2M1B A;  1Z9C A;  5BQT A;  3TDU C;  3F6V A;  4KIF A;  3DV8 A;  1FP2 A;  1HW1 A;  1CGP A;  2PFB A;  3D5L A;  1QPM A;  2EWN A;  2QQB A;  3V8L A;  2OQR A;  4DNC A;  5CVR A;  2FML A;  2Q2E A;  3U1D A;  3IC7 A;  2XUB A;  2EFO A;  3MCZ A;  4PCQ A;  5CVV A;  3HRT A;  3B02 A;  1MZB A;  3I71 A;  4KFC A;  2IRF G;  1FYK A;  4HDU A;  4ZYH A;  4HA8 A;  3P7N A;  3LAJ A;  5E17 F;  2XAH A;  1FYL A;  4HX8 A;  4LB6 B;  2VT2 A;  1R1T A;  3K0L A;  3J81 K;  2Z3Y A;  1ZAO A;  4IRI A;  4AIK A;  1XDU A;  3BDD A;  4L9J A;  4UV9 A;  4YG2 F;  3WTW C;  1R1V A;  3L9F A;  2DTR A;  1J5Y A;  3ZP5 A;  4JBA A;  2L01 A;  1J0R A;  1R36 A;  1ZN2 A;  1KQ9 A;  5F6F A;  4EJO A;  2XVC A;  4A5M A;  3GZ6 A;  2K86 A;  2E7W A;  4JQF A;  3FX3 A;  5DYM A;  3IKV A;  2O0Y A;  2K4J A;  2MH9 A;  2H6B A;  4L0Y B;  1LJ9 A;  4BHP A;  2ZO4 A;  3GFM A;  4MGR A;  3K1M A;  2V9V A;  4M9X A;  3E6C C;  3EUH A;  3QU3 A;  1J75 A;  1BJA A;  1RIO H;  1MJB A;  2CSO A;  4GCV A;  1W5T A;  2OU2 A;  1IZ1 A;  2HDC A;  5E18 F;  3QOP A;  4QLC U;  2Q8K A;  1BI0 A;  1ULY A;  5JI6 A;  2W57 A;  4YFN F;  3KP3 A;  2B0L A;  2XKO A;  4P9U A;  1YS7 A;  4LG0 A;  2IW5 A;  2AS5 F;  5HOO A;  4CYD A;  2MD5 A;  4HF0 A;  2LKP A;  3E6D A;  2HTJ A;  3M8E A;  2HQR A;  2JTV A;  4M6Y A;  3WGH A;  1XB4 A;  2VBW A;  3MZY A;  5E8G A;  3CUQ B;  4AD9 A;  1U6G A;  1ZG5 A;  1UB9 A;  4U0V A;  1MJA A;  3JAM K;  2NNY A;  4MTE A;  4AIJ A;  1QNT A;  1FOK A;  3FMR A;  2DFI A;  1GXP A;  3FM3 A;  1ON2 A;  1HXD A;  2MA3 A;  4OIO F;  3V8J A;  4HLX A;  1L0O C;  3KE2 A;  2UWM A;  4G7O F;  2EA2 A;  3N4M A;  2TDX A;  2MC3 A;  3WTY C;  1FBQ A;  5ICC A;  5TRD A;  2CFX A;  1KYW A;  1YO5 C;  5EEH A;  2ZFW A;  1B59 A;  1ZYR F;  5DDG A;  3LA2 A;  3ABT A;  1J59 A;  2HQN A;  5CLS A;  3DQV C;  4B09 A;  5ICE A;  4KUM A;  3E6B A;  4A12 A;  3HOT A;  4RAY A;  5ILV A;  4WK8 F;  3CO6 C;  5IT3 A;  2CYY A;  4EJW A;  1U5T B;  1R1U A;  4HV6 A;  1YYV A;  4CO8 A;  3F6O A;  4MQ9 F;  4HOB A;  2F2E A;  3HYI A;  3K2Z A;  4EM2 A;  2IJL A;  1YIO A;  1QO0 D;  3I0T A;  1Z1D A;  3C7J A;  1K7A A;  2E1N A;  1QBJ A;  1XGN A;  3CDH A;  4HX7 A;  1I1S A;  3B73 A;  3I4P A;  2R3S A;  3GF2 A;  5KVR A;  1TQI A;  3RYR A;  1MD0 A;  4O5V A;  1G3Y A;  1R00 A;  1EV7 A;  1FY7 A;  3RJP A;  3TQN A;  4TV7 A;  2RC4 A;  5DUI A;  3T8R A;  2CO5 A;  4HW0 A;  1GXQ A;  1X3U A;  3NQO A;  3GEZ A;  1RNL A;  3SFZ A;  1TNS A;  2X4H A;  2EV5 A;  3U2R A;  5E8I A;  1YQA A;  1P92 A;  3PQJ A;  1UST A;  2LF7 A;  4G94 A;  5BOX A;  5BPD A;  2P5V A;  3BPV A;  3TO9 A;  4IHT A;  2JPB A;  4L9T A;  3WGG A;  1S8N A;  2RNJ A;  3MWM A;  5HLI A;  5JFR A;  6PAX A;  3RIR A;  2EJR A;  2VBY A;  4KMF A;  2GA1 A;  1BI1 A;  2K02 A;  1LQ1 A;  1KU7 A;  2FEZ A;  4YIF A;  2D1V A;  4UVB A;  1RI7 A;  4U88 A;  2FBH A;  3HHH A;  5LHI A;  2VC0 A;  2P8T A;  2XV4 S;  2P5L C;  1ZG3 A;  4R8H A;  5L3F A;  4Z2Y A;  2P7C B;  4U7B A;  2IA2 A;  1KU9 A;  1FBS A;  3KEO A;  1XMK A;  1L3L A;  3FWE A;  4ZYE A;  4I0A A;  5FFX A;  1I1G A;  1XMA A;  4KIB A;  3GVA A;  3ELK A;  5DCM A;  5E20 A;  5DV5 A;  2GXG A;  3HSF A;  4BYY A;  2L54 A;  2D1H A;  1T0F A;  5HLG A;  4KN7 X;  4EJU A;  3H3U A;  4I0B A;  3ECH A;  2V1X A;  1IXR C;  2KKO A;  1C0W A;  2BGC A;  1S29 A;  2J5P A;  3FXQ A;  2EV0 A;  1F4K A;  3DPT A;  1YTY A;  4RB1 A;  2Z33 A;  1Z05 A;  3S2W A;  4ZZL A;  3I54 A;  2ZCW A;  2IP2 A;  4UVC A;  3ZMT A;  3ISP A;  4IRG A;  2H6C A;  5ILU A;  3RPU A;  3BWG A;  4JK1 X;  1BBY A;  5HS9 A;  3WTX C;  5ILS A;  2XAF A;  4A0Z A;  3HRM A;  4GGG A;  3RTR A;  2ETH A;  2K7L A;  1FBU A;  3KLO A;  3TDZ C;  3TO7 A;  4WXC A;  2NNN A;  4EMS A;  2FBK A;  3L00 A;  1B1B A;  2DO7 A;  2EV6 A;  2ZBK A;  2IA1 A;  3G73 A;  1AWC A;  1TQP A;  3KLN A;  5E1Z B;  4G7H F;  3I53 A;  3WG9 A;  2FSW A;  3LST A;  5D5V B;  1FSE A;  5J8F A;  3VB2 A;  4I09 A;  3MQ0 A;  4ZYD A;  1ZLJ A;  1WI9 A;  2L02 A;  2XKP A;  2KJC A;  1IN8 A;  1LVA A;  3F8N A;  3K9T A;  4M74 A;  3H3Z A;  2W24 A;  2FRH A;  1D3Y A;  2ZME B;  2R7D A;  1ZGJ A;  1ODD A;  2VE9 A;  4WXD A;  4BHB A;  2GWR A;  1MDM B;  4UHT A;  4ENJ A;  1WSU A;  1ZRE A;  1QQI A;  4I02 A;  1RUO A;  2LF8 A;  2FQ3 A;  3KP5 A;  5D8L B;  3P9I A;  5LBQ A;  4BXU A;  2D45 A;  2DLL A;  3WTU C;  1LDD A;  5FO5 A;  4A0Y A;  3T0Y A;  3RI4 A;  1KYZ A;  3ERE D;  2XAS A;  3MEX A;  1FNN A;  3QAH A;  3TOA A;  4CXF A;  1V4R A;  4NB5 A;  2OQG A;  5L3D A;  2FNA A;  1KU3 A;  1O7L A;  1XDS A;  3CJN A;  3IWZ A;  1W7P B;  4LB5 A;  2HKO A;  3O6B B;  3WGI A;  2UXX A;  3J80 K;  2F5E A;  3I59 B;  1O3Q A;  4OOI A;  4WXH A;  5H20 A;  2RV8 A;  5CVU A;  1E17 A;  3HIF A;  4G6Q A;  1S3J A;  4EM0 B;  1JHH A;  2HOE A;  5LHG A;  4G8X A;  2M5W A;  3ZMS A;  1HW5 A;  3WE2 A;  2ZJ2 A;  4EV0 A;  2V79 A;  2PEX A;  1KQ0 A;  3ZMU A;  3J81 Z;  1J2X A;  2QVO A;  3DXJ F;  4LLN A;  4F7Z A;  2H09 A;  2UZK A;  3GYH X;  4GO1 A;  2CW0 F;  2A6H F;  1O57 A;  5D8K B;  3F72 A;  1SFE A;  1R22 A;  2QM3 A;  2HKX A;  3R60 A;  2KIU A;  4LMY A;  4A6E A;  3RDI A;  2QQA A;  1ZGA A;  3T1B A;  3WTV C;  4CZZ A;  3E3V A;  4MEX F;  4HQM A;  1YS6 A;  4M9S A;  1P4W A;  3E5X A;  5A2Q K;  4Y13 A;  1T2K A;  3DF8 A;  1TBX A;  3H92 A;  3WE3 A;  3SXY A;  4BHC A;  1QZZ A;  1DPR A;  5L3G A;  1DDN A;  5TJJ A;  2YR2 A;  1FX7 A;  3NEU A;  5E1W A;  2M45 A;  2PQ8 A;  4Q48 A;  2FBI A;  3REO A;  4L18 B;  4KT5 C;  1XD7 A;  2D2W A;  1T98 A;  2RKH A;  2VOO A;  3LAP A;  1F1Z A;  1F9N A;  3I64 A;  1Q1H A;  4EGY A;  3HRU A;  1TTY A;  1A04 A;  2DPD A;  2P5K A;  3LFK A;  3P9C A;  5L3B A;  2WC2 A;  4ESF A;  4BQA A;  3QU6 A;  4UVA A;  2P6T A;  4H0E A;  4RS8 A;  5D5W B;  4IRH A;  2OZU A;  4HDV A;  2GXB A;  1IRF A;  5DUK A;  3QRF F;  2A07 F;  1W4M A;  2P4W A;  4PZJ A;  2G7U A;  2VXZ A;  1KU2 A;  1EH8 A;  3KCC A;  4MEY F;  2STW A;  1SFX A;  2Z99 A;  5KK1 A;  1HST A;  4KIG A;  1ONV A;  4K2E A;  3E6M A;  1DP7 P;  2HEO A;  4HYE A;  1ZRF A;  4YII A;  3JAM Z;  3VOE A;  1ZRD A;  2PMU A;  3BZ6 A;  4Q5S F;  3IRQ A;  5K5R A;  2G7H A;  1OMI A;  1TLH B;  4P5O A;  4KNY A;  1Z7U A;  4M71 A;  3CUQ A;  4IJA A;  4Y15 A;  5CVI A;  5HS8 A;  4DQ2 A;  4XSX F;  4RB0 A;  4CGZ A;  3FMQ A;  4EVI A;  2FOK A;  2O03 A;  1B9N A;  5IT9 K;  2ISZ A;  4U0W A;  5HDG A;  2M87 A;  1HKT A;  2XRN A;  3ZMV A;  3QP5 A;  1ZG1 A;  2ADU A;  3DKW A;  2A69 F;  1YW7 A;  1OPC A;  2HWV A;  2Y75 A;  3RKW A;  3ZN0 A;  3PFI A;  2LNB A;  1YW9 A;  5JVT A;  2DPU A;  4AIH A;  1ZRC A;  2DU9 A;  3JW4 A;  3TGN A;  2CG4 A;  2YSR A;  1F5T A;  3TOB A;  4LGW A;  3TO6 A;  5FLX K;  5L3E A;  2KRF A;  2E1C A;  4I7H A;  4BH9 A;  3VEP A;  4EM1 A;  1G3S A;  3LA3 A;  2STT A;  2YPR A;  3L2C A;  1P4A A;  1JXS A;  5FD5 A;  1KA8 A;  5FLX Z;  4LK0 F;  1WQ2 A;  3WU1 B;  1ZAR A;  2EK5 A;  5F64 A;  3QP6 A;  2UXN A;  2CQK A;  2FA5 A;  3V7C A;  1IAW A;  4NHJ A;  4FHT A;  5LGU A;  3HTS B;  3WTT C;  3WOD F;  4WF2 A;  3BPX A;  1U5T A;  2HGC A;  3ZPL A;  3JTG A;  5EEG A;  5L3C A;  2ACJ A;  4L0Z B;  2QYO A;  2ESH A;  1MKM A;  1ZLK A;  5DD8 A;  1D8K A;  4NQW A;  2YX7 A;  3ML6 A;  1FLI A;  1U8R A;  4KYW A;  1E2X A;  4R79 A;  3BY6 A;  1XSD A;  3E97 A;  2JSC A;  4WWC A;  4ENM A;  4FT8 A;  5LEJ A;  3F22 A;  4ON0 A;  3V7R A;  5ERI A;  4RB2 C;  1BIB A;  2PG4 A;  5K1Y A;  4YFK F;  1CF7 B;  2BYV E;  4B8X A;  1K78 B;  3GZ5 A;  1HKS A;  1PDN C;  3L09 A;  5HDN A;  3KP2 A;  3AAF A;  1MJ9 A;  3I5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...