4OMZA

Crystal structure of nolr from sinorhizobium fredii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
98
structure length
98
Chain Sequence
b'QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NolR
publication title Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
pubmed doi rcsb
source organism Sinorhizobium fredii
molecule tags Transcription
total genus 34
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4omzA00
4KIGA 3RYRA 1S29A 5E17F 2H09A 4M9SA 1QO0D 3KLNA 4G8XA 3IHUA 3LA7A 2EJRA 3H3UA 5CVJA 3M8EA 2DFIA 4IRIA 3RKYA 1B4AA 1J75A 1IXSB 1MD0A 1Q1HA 4HLXA 3N97A 2V1DA 1MDMB 2ESNA 2EV5A 1KYWA 2VC1A 3CDHA 4LMYA 3WG9A 1TQIA 4Q47A 2HKOA 4XSXF 5J8CA 2NAZA 2RDPA 3HSRA 3HOSA 4HQEA 4MTDA 1SMYF 4KNYA 3JAMK 3CTAA 4HX7A 3TDUC 5FO5A 4PGGA 2O6GE 2KRFA 2VC0A 4XRFA 5IT9K 2VT2A 3M9AA 1JE8A 1U5TC 2Z5UA 2F5FA 3HRTA 1HKTA 2V1UA 4TV7A 2QWWA 4QLCU 4P9UA 3ZP5A 3PQJA 3L9FA 5TRDA 1YO5C 2M8EA 2PMUA 5LRSA 3P9KA 1SFEA 1F5TA 3EDPA 2QZ8A 2CG4A 3L7WA 2EV0A 1MZBA 2F2EA 4Y17A 1QNTA 4ENKA 1BJAA 3WU0A 1KQ8A 1O3QA 4XBFA 4WK8F 5D5UB 2X0LA 3VEPA 4ESFA 1OPCA 3HSFA 5E8IA 2DPUA 2YX4A 1MJBA 3KP2A 1T98A 4D0PA 4OU0A 1KYZA 5L3DA 2ZO4A 2AXLA 5ICEA 3ZMTA 2OZUA 3MFKA 2XAQA 3K0LA 1QZZA 1XSDA 4ZYEA 4I0BA 5LEKA 2VN2A 4A6DA 3FMRA 1TW2A 1P4AA 3GVAA 4WX9A 3RDIA 5HOOA 2H6BA 5A2QK 4F7ZA 3DV8A 4L0YB 2IA2A 4HDUA 1G3SA 3KZYA 1P4WA 4GYIA 1SD7A 2VBWA 3TO9A 1RNLA 2HGCA 4AD9A 1HSTA 4RGXA 4RS8A 2KIUA 4RAYA 3FMSA 1XD7A 1A04A 2QYOA 3E5QA 3E97A 3V8JA 3F21A 2GZWA 4EGZA 3KEOA 1XN7A 3LFKA 2DO7A 4A6EA 3TOBA 1JHHA 1Z05A 1IUYA 3I54A 2XAFA 1P6RA 3MCZA 2HTSA 3C7JA 1I27A 3WGHA 2HTJA 5BS6A 2OA4A 1FSHA 3HHHA 2K86A 2STTA 3I71A 3DEUA 3DF8A 4EMSA 3Q5FA 1RIOH 2IT0A 4OIOF 3KP5A 4KMUX 1QBJA 1XMKA 5F1RA 1BOAA 1SD6A 2KKOA 1D3YA 1LVAA 1S8NA 5J8FA 5LGUA 3K1MA 5JVTA 5CVRA 2M1BA 2QLZA 5LGNA 1DPUA 2H6CA 4N9IA 2FXAA 1FPQA 2FBKA 3K9TA 2ZNZA 4JBAA 1TNSA 1J59A 3EETA 3FXRA 4L9NA 2W85A 1J7KA 4I09A 3WTVC 4ZZLA 2DK5A 4CXFA 1KU9A 1F4KA 2KIFA 2GXGA 1HW1A 1X3UA 1U3EM 3ZN0A 3T8RA 1T38A 4EV0A 4LLGF 3HOTA 4HZFA 2BYVE 5LHHA 3I4PA 3NEUA 3LA3A 1R7JA 2FBHA 4DQ2A 3WGGA 3ZPLA 3OOPA 1MKMA 5HS7A 5L3BA 1XSVA 2RN7A 5CVUA 1WSUA 4AIHA 5BPDA 4KFCA 1LB2A 1KU7A 3E3VA 2ZFWA 4G7HF 1LQ1A 3IC7A 2RNJA 2ZJ2A 4A2UA 3LAJA 2B0LA 3HRMA 2A6EF 4PCQA 1GHCA 1V4RA 5IT3A 3JSOA 1R5HA 4GGGA 3FF5A 4LFUA 4KN4X 5LLQA 5LRRA 1LDKB 1UFMA 2M30A 4B8XA 1UCRA 4PZJA 4RGRA 3RYPA 3F3XA 5E18F 2A69F 3V7RA 1YS6A 4UVCA 4BH9A 3IRRA 1ZRCA 1K7AA 2W57A 4WCGA 1YQAA 5KK1A 5L3FA 1FBQA 3L00A 2TDXA 4M71A 4E70A 2OZ6A 2D1VA 3IWFA 1CF7A 3GFIA 2A07F 3BOQA 2P5VA 3O6BB 3WTUC 5FLXZ 3GXOA 2GAUA 2ZMEB 2JPCA 1QPMA 2XIGA 2UWMA 3QU3A 2Z99A 5HVQC 4CO8A 1LEAA 3J80K 5K5QA 2HR3A 5D6EA 5FGMA 3ZMZA 1SD4A 3ABUA 5HDGA 2MBFA 1KU3A 2FF4A 1PP8F 1YW9A 4U0YA 1IF1A 1MJ9A 1EV7A 2MD5A 2Q8KA 2GWRA 3R0AA 5JR3A 4G94A 2VBXA 1WWXA 5DD8A 1XGMA 1K78A 3DFGA 4IXAA 3B02A 4G6DA 3CO7C 3FZVA 1ZAOA 1ZRFA 4FHTA 2CGPA 4BYYA 3U1DA 5DCFA 4P55A 5J6XA 2GA1A 2W25A 3BDDA 2YPRA 3W6JB 2W84A 1DPRA 1EH8A 2VOOA 4OIRF 2EWNA 4OINF 4I02A 5ILSA 2RV8A 2JZYA 4CHUA 3D0SA 2XKOA 1BI0A 2H27A 3V7SA 2WV0A 2IA1A 3KCCA 1J2XA 3HYIA 1XDSA 1ZLJA 4UUVA 2VBYA 4U0WA 3MZYA 2HZTA 4Z2YA 2XGXA 1WI9A 3GFLA 1XGOA 5BOXA 4O6JA 2V6CA 2ETHA 3CJNA 2IP2A 2W24A 3BWGA 5K1YA 4IVNA 3FXUA 2PI0A 3GX4X 5E1ZB 4JK1X 4L9JA 4UNOA 3V8LA 3JAMZ 2Z3YA 2VOPA 4HBLA 1JXSA 2OQGA 4O5VA 2KJCA 1FC3A 4BNCA 1CF7B 4R79A 5IT9Z 4MQVA 3TQNA 4MNUA 3M7GA 4HF0A 4NQWA 4UHTA 2FE3A 5BPIA 4R8HA 2PLYA 4MEYF 1QQIA 3P9IA 4UV8A 3SFZA 2RKHA 3C1DA 1IN6A 1B59A 2WTEA 3J7AO 3TO6A 2GA2A 3FMQA 5LBQA 2CWEA 2CSOA 4GXOA 2MH2A 3JSPA 5LHIA 4RB3C 3VFZA 4I2OA 3VB2A 2DQLA 3DP7A 1FP1D 1LDDA 3M8FA 4ESBA 1K78B 3QPHA 4HLYA 1I1GA 4K2EA 1I1SA 5CLSA 1R36A 1S7OA 4YIIA 1IXCA 3ECOA 1USTA 2E7WA 3HHGA 4LB5A 5K5RA 4HF2A 2F5EA 1W5TA 4A12A 1G3TA 3C18A 1ODDA 1RI7A 4I01A 1B1BA 1VTNC 2O61A 4BHBA 3ZQ7A 3K1PA 3TDZC 1I6XA 1ZGAA 4ENNA 3F8NA 2E1CA 3ERED 5ICFA 2GQQA 3FHZA 1R1UA 2IA0A 2PMHA 2V9VA 5A2QZ 3J81K 4RGSA 1Z6RA 2K27A 3NRVA 1I5ZA 3F22A 1R58A 4L18B 1HW5A 5H20A 1MGTA 5AIQA 1BM9A 1LDJA 2ZXJA 2H94A 4I98B 4S05A 3R60A 1S6LA 3FM3A 1ULYA 2R3SA 3HRSA 3CUOA 5E1WA 4GO1A 1J5YA 4HX4A 2RVCA 5AIPA 3T5XA 3I59A 2LSOA 2VONA 2KJBA 1U78A 1LEBA 3SXYA 1C0WA 1EH6A 2Z33A 2EFNA 1LNWA 5HLGA 3FM5A 3G3ZA 4LG0A 4I7HA 4KMFA 4UVAA 2ZCWA 5FD6A 5D8LB 3DPLC 3M1EA 4ON0A 3E6CC 1XCBA 3GEZA 4KT5C 2V79A 4LLNA 3JW4A 4EGYA 5HLIA 1YIOA 1QGPA 1R22A 4L0ZB 2G7HA 1K6OA 1SFUA 2EFQA 2WC2A 4NB5A 3RKWA 4RAZA 3KLOA 3T0YA 2M87A 4EJOA 3GFJA 1B9MA 2ZMEA 3CUQA 2G9WA 1HKQA 4IHTA 3F72A 4OMZA 1IRFA 1G3YA 2PG4A 3RKXA 5EEGA 3TKYA 4YIFA 3OV8A 4M9ZA 5E20A 3S2WA 2OD5A 4I0AA 4RB0A 1E2XA 5FB2A 5HDKA 1S3JA 5HS8A 5D4SA 2VXZA 4HDVA 2M5WA 4RB2C 4AWXB 4ZZDA 1FBSA 4G9YA 3KP7A 3RPQA 5LEJA 2E1NA 3MQ0A 3QP5A 4M9XA 2DTRA 3E6DA 1W7PA 4KYWA 1U8RA 5E8GA 4MTEA 4L9VA 2G7UA 4U88A 1QZYA 3V4GA 4P5OA 3TGNA 4YG2F 1FWZA 2Q2EA 1AWCA 2NRAC 3F23A 3IKTA 2HQRA 1UHMA 4M6YA 3I64A 1BIAA 1T0FA 2DT5A 1DDNA 3GZ6A 3NQOA 4ENJA 4G7OF 1EH7A 1OYYA 3E5UA 2GIVA 4LLLA 5CYVA 1RUNA 5DCMB 2XROA 2LF7A 4CZZA 4EQQA 2RQPA 3ZMDA 4YFNF 3PQKA 1BIBA 5D5XB 3E6BA 1UB9A 1IRGA 3BPXA 3I59B 2DAOA 2YR2A 3COAC 1U6GA 3GO5A 1BBYA 3DPTA 4LG0B 3WODF 5LGTA 2Y48A 4HF1A 2QQBA 3I5UA 3GZ5A 1J9IA 5ERIA 4EM0B 5D4RA 1W7PD 3J80Z 1PDNC 2IW5A 2HYFA 3F8MA 1T39A 1IN5A 3REOA 1D8JA 2K02A 2UXNA 3ROUA 1BN5A 2HQNA 3CUQB 2MLKA 5FFXA 2P6TA 2P5KA 3DXJF 4KDPA 2MA3A 4LB6B 2VT3A 1TW3A 3GW2A 4OIPF 1P2FA 1BI1A 3U2RA 4MQ9F 1ZHFA 5F64A 3I58A 3T8TA 5BMZA 2OU2A 3WU1B 4IJAA 3F8CA 3N4MA 2P6SA 3CLOA 4ZYHA 4ASNA 3EYYA 2NS0A 4HQMA 1ON1A 3BJOA 1FZPB 2JTVA 5DEQA 3SHFA 1W7PB 2FMLA 3FWEA 5FD5A 2R7DA 2D45A 1T2KA 2GXBA 2STWA 3WTYC 3F8BA 4PGHA 4M6XA 2ELHA 2P7CB 1FY7A 2COMA 1E17A 1IZ1A 1IXRC 1SAXA 4KA4A 1HXDA 1HKSA 3K1NA 1ZRDA 3CUQC 1HW2A 1ZGJA 4PDKA 2FMYA 2M45A 2ZKZA 3EYIA 5CVVA 4RGUA 2QUFA 2XRNA 1O7FA 4UXNA 1XDUA 1Z6TA 4A0YA 4ZYDA 3FXQA 4AIJA 4GCVA 1IN4A 2DK8A 2MLGA 2L02A 2HFHA 2X4HA 1KU2A 1U2WA 2FQ3A 1GXQA 2OBPA 2CYYA 1GVJA 1NHAA 4HV5A 1KA8A 3TO7A 2L54A 3HTUA 3HRUA 2QM3A 4M73A 2ZNYA 5FFZA 5L3GA 1F9NA 4HYEA 4UVBA 3WE3A 2XVCA 1STZA 3QP6A 4KICA 2A5YB 2Y75A 4U7DA 2XAHA 2ZBKA 4QWQA 4LK1F 1F1ZA 3AAFA 4JQFA 1MJAA 4YFXF 2PN6A 2XASA 4A5MA 2AS5F 1OR7A 3VODA 4P9FA 4EJUA 3IL2A 3I0TA 1RUOA 3GWZA 4OIQF 1YYVA 3ECHA 2BGCA 4G6QA 3E5XA 4BXUA 4OOIA 3SQNA 5ILUA 3MZHA 2PFBA 5ICCA 1FYLA 1REPC 1FT9A 2V1XA 2VBZA 3HIFA 3HTSB 2CFXA 3ZMVA 1YTYA 3IKVA 3Q9SA 5F6FA 1YS7A 6PAXA 3DKWA 1FNNA 3KETA 2EB7A 3F8FA 4EJTA 3ISPA 2ISZA 1D5VA 2O3FA 4IHSA 2EFWA 3Q9VA 5L3EA 1ONVA 4M72A 4LJZF 4ZH4F 3J81Z 2RGVA 4U7BA 2QVOA 3RTRA 2OAZA 1B9NA 1S7AA 3SZTA 5DYMA 4L5IA 1P92A 2LNBA 3R61A 1ZARA 2YX7A 2LKPA 2FNPA 3BY6A 1LJ9A 1ZREA 4P96A 4L5JA 3KP3A 2JT1A 3LSTA 4IRHA 3BP8A 4CYDA 4XSZF 5D5WB 4Q4ZF 1B6AA 3WTWC 1XMAA 3QPTA 3IWZA 3CO6C 1ZLKA 1O7LA 5JFRA 1XGSA 2DW4A 3H3ZA 2QBYA 1P4XA 4AIKA 5KVRA 1Z91A 1YFHA 3EQLF 3E6MA 4IRGA 3F6VA 1YW7A 2O03A 2FEZA 3VOEA 3GLXA 1XGNA 3F6OA 3TOAA 1BI3A 3WTXC 2XUBA 5DCMA 2Z9OA 2BBYA 5DUIA 2XAGA 1G3WA 1H9TA 5DUKA 4YFKF 5L3CA 2FU4A 1KGSA 1R1VA 1D8KA 2EA4A 3R4KA 3LQQA 2A6HF 2DPDA 2F5DA 4EVIA 2F5CA 1OYIA 1TTYA 2FSWA 5D5VB 2DI3A 4IF4A 2IRFG 5TJJA 2K7LA 5LHGA 3JTGA 2J5PA 4CGZA 1O57A 1ZG3A 2L4MA 4EM2A 5K5OA 2DBBA 4KUMA 2JRTA 3FX3A 3RPUA 4A5NA 2P4WA 1H9GA 2YU3A 4Q5SF 2MC3A 1WQ2A 5E1XA 1KQ9A 1YG2A 1V3FA 4BAYA 1TBXA 4A0ZA 1FOKA 1SD5A 1Z9CA 2OQRA 4OMYA 3BZ6A 1HSJA 1GXPA 2QENA 3W6KB 4Y13A 3QOPA 1ZN2A 2A68F 3HUGA 1PUEE 3I53A 1ZG1A 1SFXA 3QAHA 1R5GA 4N0BA 2L3DA 1PP7U 4HAMA 4WXDA 1FYMA 3V8KA 5AONA 3ML6A 3WTZA 4BHCA 2K4JA 3KE2A 1IW7F 2Q0OA 4FT8A 1FBUA 3ELKA 3O3KA 1R00A 4UV9A 1XB4A 3EUHA 5CVIA 3QRFF 2VODA 1RZ4A 1UHWA 1G4DA 5HDNA 3KP4A 3HSEA 1Y0UA 1ZG5A 3BPVA 5HLHA 4XLNF 2HOEA 1TQMA 4U0VA 5HS9A 3IRQA 1FP2A 5ILVA 2KIMA 2CO5A 1ON2A 1O3TA 1IN7A 2PQ8A 5D8KB 2HKXA 4ESJA 4HV6A 1Z1DA 1TLHB 4NHJA 3WTTC 3H92A 3ZN1A 3B73A 4Q48A 4CICA 3DQVC 1JGSA 1IAWA 5D6FA 1O3SA 2JSCA 2D1HA 4GYGA 1DP7P 1YLFA 2QBYB 2A61A 4AVPA 1HQCA 1BC8C 4LGWA 3ZMUA 4EM1A 4ENMA 4L9TA 5BQTA 2XHKA 2YSRA 3KEQA 3D5LA 1Z7UA 2K4BA 3QU6A 4WWCA 2XAJA 3GYHX 3L2CA 3P9CA 2HYGD 5JI6A 2D2WA 3R0JA 2P5LC 1L0OC 2EV6A 2VE8A 4WXHA 2ISYA 1O3RA 2CQKA 2NNYA 2ESHA 4HW0A 4R1HA 4CDGA 2HEOA 4O3MA 2MH9A 4KIFA 1FSEA 1XCVA 1HBXG 1OYWA 2P7VB 5ED4A 2ACJA 1YW8A 4BHPA 4S04A 2XV4S 2FBIA 3K2ZA 2FRHA 2EK5A 3KFWX 2EFPA 4RB1A 3WGIA 4IPAA 2P8TA 3PFIA 1U5TA 3ABTA 5H6QA 3R6SA 1BI2A 1SMTA 4EJWA 2UXXA 1FX7A 4M74A 2JPBA 2L4AA 4WXCA 2VE9A 2C6YA 4MHGA 3G73A 2DLLA 2CW0F 1WKMA 2LF8A 1WRJA 2EA2A 1IN8A 4MEXF 2BE5F 1FYKA 3MEXA 4BQAA 1BC7C 1K79A 2Y0MA 1TNTA 4N9HA 1W4MA 2J5OA 4ZYGA 3BROA 2O0YA 2PJPA 1R23A 2QQ9A 3MWMA 1TQPA 3RI4A 2BEOA 4DNCA 2FNAA 2DQRA 1MDMA 3ULQB 2RC4A 2XKPA 1CGPA 4HX8A 1T6SA 4G7ZF 1H0MA 2L01A 4B09A 4A0XA 4FX4A 1ZH5A 4HOBA 2DU9A 2EFOA 2PEXA 4KN7X 5EEHA 3BJAA 1AOYA 2IVMA 1L3LA 3C3WA 1ZYRF 5ICGA 2A3SA 2R7FA 3K69A 4ETSA 3GF2A 4HA8A 3LAPA 4MGRA 5FLXK 5CJ9A 2HS5A 3JTHA 5JHUA 2ADUA 4EJVA 3WTSC 4Y15A 4LD5A 4XLPF 2LDUA 1R1TA 3KP6A 2QQAA 2FA5A 1USSA 2O8XA 2BV6A 3LA2A 3T1BA 2NNNA 2HDCA 5H6RA 5DD4A 1FLIA 3GFMA 1XSXA 1G6NA 2E7XA 2IPQX 4KIBA 4WF2A 1KQ0A 3GUDA 1DUXC 3O2PE 4H0EA 1OKRA 2UZKA 3LQRA 3U9GA 3MAJA 5DV5A 2FOKA 2NYXA 3KZZA 2HWVA 4FX0A 1JHFA 3WE2A 4LK0F 1OMIA 1W5SA 3RIRA 2IJLA 3BJ6A 3LWFA 2PBIA 1J0RA 1U5TB 5DDGA 3ZMSA 3RJPA 3P7NA 3V7CA 3L09A 2WWYA 3SZPA
chains in the Genus database with same CATH superfamily
4KIGA 3RYRA 3FK7A 1S29A 5E17F 2H09A 3K4KA 4M9SA 3CMEI 1DU0A 1QO0D 3KLNA 1QPIA 2HVSA 2W4SA 4G8XA 2VPLA 3IHUA 1VQ7I 3LA7A 2EJRA 3H3UA 5CVJA 3M8EA 4E7HA 2LMDA 2DFIA 1N78A 4IRIA 4A3BJ 3S2DJ 3RKYA 5CQEA 1B4AA 3KIOA 1J75A 1IXSB 1K83J 1MD0A 2EZKA 2BHZA 4GRIA 1Q1HA 4HLXA 3N97A 1RR8C 1DGRM 2XF7A 3HEFA 4S0HB 2V1DA 4C2MJ 1MDMB 1WJ5A 1XTAA 2V7FA 2WB1N 3KYDB 2ESNA 2EV5A 5EJCA 1KYWA 2VC1A 3CDHA 4LMYA 3WG9A 1TQIA 4Q47A 2HKOA 4XSXF 5F0CA 5J8CA 4B4CA 2NAZA 1P7JA 2RDPA 3WHBA 3HSRA 1FOXA 3HOSA 2LY9A 1MMSA 3ZGKA 4HQEA 4MTDA 4QIWN 1SMYF 4KNYA 3JAMK 4E7JA 3CTAA 3BTIA 4HX7A 3TDUC 5FO5A 4D5FA 4PGGA 3UNGC 3N05A 4CZCA 5GTHC 2O6GE 2F6CA 2EIJH 3FHNA 4Y52J 4Y3OA 2JA6J 3TP0A 4RLQA 2KRFA 3SFIA 4A3JJ 1WJCA 2VC0A 2K9QA 2PMZA 3M8JA 4XRFA 2CJJA 2X1EA 4C2TA 5IT9K 3SZGA 2VT2A 5FKMA 3M9AA 2DT6A 3G4SI 1JE8A 1U5TC 2EZLA 2HQAA 2Z5UA 5IYBJ 2F5FA 2E2JJ 3HRTA 1HKTA 2V1UA 4TV7A 3L2VA 2R5ZA 3I3LA 2QWWA 3EUAA 4QLCU 4P9UA 4DBRA 3ZP5A 3TMOA 1VQ5I 4JX5A 3PQJA 3L9FA 3CCYA 5TRDA 4QTRA 1TWCJ 1YO5C 2M8EA 2PMUA 2XRLA 5LRSA 3CCMI 3P9KA 1SFEA 2RNGA 3I4MJ 2R4GA 2CQ7A 2EILH 1F5TA 2JA2A 2HVQA 1QZEA 3JRCA 3EDPA 2QZ8A 2CG4A 3L7WA 2EV0A 1MZBA 2F2EA 3CJRB 4Y17A 4UUSA 2YUSA 1QNTA 4GDFA 2DJIA 4ENKA 1BJAA 2CFOA 3FKJA 3WU0A 3OYHA 3BR0A 5DM6F 1TWHJ 1KQ8A 2XGEA 1RC9A 1I39A 1O3QA 4ANJA 4IO9F 1JKOC 4XBFA 4WK8F 1X2NA 5D5UB 2X0LA 3AG4H 3NAUA 3VEPA 2M7AA 3GTPJ 4ESFA 1OPCA 1ACIA 3HSFA 4LG3A 2R93J 2M8GX 5E8IA 1YOVB 1PJRA 4Z6YA 3BZKA 4XKWA 2DPUA 2YX4A 3H9JA 1MJBA 3AL0C 2ZXHA 3KP2A 1T98A 4D0PA 1XMXA 4OU0A 1KYZA 5L3DA 2ZO4A 2AXLA 5ICEA 3ZMTA 2OZUA 3MFKA 2XAQA 3BTCA 3K0LA 1YHQI 2F4MB 3LFUA 1QZZA 4XOTA 3PIPF 1XSDA 4ZYEA 4I0BA 5LEKA 2VN2A 3DEWA 4A6DA 3FMRA 2HXIA 1R4NB 3SDGA 1TW2A 1P4AA 3GVAA 5JVGF 4WX9A 1X2MA 4II2A 1N77A 1K61A 4NC8A 3P5JA 2I5UA 2O9LA 1ZK8A 3RDIA 3W3CA 1MH4A 5HOOA 4E7IA 2H6BA 2CS3A 2RAEA 4NBQA 5A2QK 4F7ZA 1TWFJ 3DV8A 4L0YB 2IA2A 4HDUA 2W82A 3G6EI 3BTLA 1G3SA 4PSXA 3LOCA 3KZYA 1P4WA 1JT0A 4GYIA 2K9MA 1SD7A 2HXOA 2VBWA 3TO9A 2NS8A 3CQZJ 3J7YJ 1RNLA 2HGCA 4AD9A 1QU3A 1E3HA 3BLYA 3F9KA 1HSTA 3GLLA 2HNHA 4RGXA 4RS8A 2R7QA 2KIUA 4RAYA 2M3AA 1D1CA 2LFBA 3FMSA 2MW8A 2VKDA 2E34A 1XD7A 3V42A 1A04A 3RQIA 1OQYA 2QYOA 3E5QA 4XOPA 3E97A 3S14J 3V8JA 3F21A 1WH7A 2GZWA 4EGZA 3KEOA 1XN7A 3LFKA 2DO7A 4A6EA 5GAGJ 3TOBA 3OYCA 3CCJI 3AG2H 3HGGA 3OYGA 1JHHA 1Z05A 1QVUA 1IUYA 3I54A 2XAFA 2N8GA 1OCPA 3K4CA 2D5VA 1UHSA 1P6RA 4KITB 3MCZA 1YI2I 2HTSA 2HVRA 3C7JA 1E3PA 1I27A 2VL8A 3WGHA 5TGTA 2HTJA 4LITA 3QPLA 2UV1A 3GZNB 4C3JJ 5BS6A 2OA4A 4W1UA 1FSHA 3OYJA 3HHHA 2IEKA 2K86A 1U8BA 2STTA 3I71A 3DEUA 1SEUA 3DF8A 4EMSA 2HI3A 1JUMA 3A0BC 3DU6A 5KAFC 3Q5FA 1RIOH 2IT0A 4OIOF 3RQ4A 3KP5A 1VFCA 4B3XA 1Z67A 5EZGA 4KMUX 1QBJA 1XMKA 5F1RA 1BOAA 2R5ZB 5M3FJ 1SD6A 2QF7A 2KKOA 1D3YA 3BR3A 1LVAA 2CQXA 1S8NA 5J8FA 4D9JA 1OISA 5LGUA 3K1MA 5JVTA 2M1BA 5CVRA 2QLZA 5LGNA 1DPUA 2H6CA 4N9IA 2FXAA 1FPQA 2FBKA 4ZDLA 1OJLA 1P7IA 2OJED 2IXSA 3K9TA 4XRSA 2DT7B 2ZNZA 4JBAA 1TNSA 2JA7J 3S1MJ 4XLCA 3LSJA 1J59A 3EETA 3FXRA 4L9NA 2W85A 3BQZA 3DKYA 4XQFA 2KZGA 4UUSB 1LVKA 2QCOA 1J7KA 1B8IA 4I09A 3WTVC 3Q0WA 4ZZLA 2DK5A 1S5LC 4CXFA 1KU9A 2KPMA 1F4KA 2Y0SA 2KIFA 2M4KA 2GXGA 4PJ0C 3ZR8X 1HW1A 1X3UA 1U3EM 3ZN0A 3T8RA 1VQ4I 5C44J 1T38A 4EV0A 4LLGF 1IJWC 3HOTA 4F52A 5LD2C 3HL2A 4HZFA 2B9SA 1RPWA 2BYVE 5LHHA 4CCLA 2KZVA 2NVYJ 3I4PA 1T95A 1ETQA 4UB6C 3NEUA 3LA3A 1R7JA 2FBHA 4DQ2A 3WGGA 3ZPLA 4AC0A 4ZTFA 1LFPA 2G0EA 3OOPA 1JI8A 1MKMA 2GBYA 5HS7A 5L3BA 1XSVA 2K9NA 4V19K 2RN7A 1FMWA 2VJ5A 2PJRA 3RCOA 2XPUA 4D7MA 5CVUA 1WSUA 4A3GJ 4AIHA 5B3SH 5BPDA 4KFCA 1SAUA 3HOXJ 4AU7A 4DZJA 1LB2A 1KU7A 2R7OA 5CPRB 3E3VA 2ZFWA 4JYKA 5K7ZA 4X0GA 2ZJRF 4G7HF 1I3QJ 1XG1A 1EF4A 1LQ1A 3IC7A 2UUZA 2RNJA 2ZJ2A 4A2UA 4F3QA 3LAJA 2B0LA 3HRMA 1TL8A 1LFUP 2ID3A 3E1SA 1Y56A 2A6EF 3CJTB 4PCQA 1GHCA 4C9YA 2OCEA 3TP3A 1V4RA 5IT3A 3JSOA 1R5HA 4GGGA 3FF5A 2FOWA 4BEHA 4LFUA 4KN4X 3ASNH 3PO3J 5LLQA 5F27A 5LRRA 3ABMH 2V6EA 3H5RA 2OPTA 4IHVA 2AXTC 1LDKB 2MYSA 2WB1A 1QA6A 1UFMA 2DMNA 2M30A 3M3YJ 4G6TB 4B8XA 4XIDA 3K7AJ 4XM3A 4PFOA 2HPMA 3FXJA 2VJ4A 5K7FA 4FISA 1UCRA 4PZJA 4RGRA 3RYPA 1FOYA 5E3LA 3F3XA 5BNGA 1WCMJ 3A1YA 1IDYA 2VJIA 5E18F 1MSEC 2A69F 3V7RA 1YS6A 4UVCA 1D1BA 4BH9A 3IRRA 5IPAA 3HOZJ 3E7LA 5JLWA 1ZRCA 1K7AA 1VQKI 2W57A 4WCGA 1JGGA 1YQAA 2BY1A 3UR3C 5KK1A 1WJFA 2L2OA 5L3FA 1FBQA 3L00A 2TDXA 3FXMA 4M71A 1RR7A 4NDLA 4E70A 3L2WA 2OZ6A 2JUGA 4HSRA 3KYCB 1RETA 2D1VA 2KP6A 3IWFA 4ABZA 4RBOA 3GFIA 4I6ZA 1CF7A 2A07F 2KHMA 3BOQA 2P5VA 5HLTA 2VKHA 3MVPA 3O6BB 3WTUC 5FLXZ 3OYAA 1RKWA 2GAUA 3GXOA 1BOBA 1H89C 2ZMEB 2JPCA 1QPMA 2QSHX 2XIGA 2VKEA 3ZOBA 5F0FA 1I50J 2LYCA 2UWMA 2VIXA 1T33A 2ZB9A 2LP0A 1ZQ3P 3QU3A 2Z99A 5HVQC 4CO8A 2CUJA 1LEAA 5DS9A 1YJNI 3J80K 5K5QA 2HR3A 5D6EA 2LR8A 5FGMA 4PSWA 3HJEA 3JRBA 3CCLI 3ZMZA 3D5RC 1SD4A 3O8HA 1FTTA 3K4MA 3L2QA 2X9DA 3ABUA 3OWTA 4JOMA 4CCOA 4NC7A 3QQAA 5HDGA 2MBFA 1KU3A 2FF4A 3AG1H 3LSKA 1IC8A 4N4OB 3K4JA 3SEZA 1B72A 1PP8F 2DFEA 1YW9A 3IH2A 4U0YA 1IF1A 1MJ9A 1EV7A 2MD5A 1UZCA 3DKXA 3VYRB 2Q8KA 2GWRA 3R0AA 3TEDA 2JA5J 2A6TA 5JR3A 1MIJA 4G94A 2VBXA 1WWXA 3FXOA 1XGMA 5DD8A 1K78A 3DFGA 4IXAA 4HNUA 2CV1A 4LIUA 3B02A 4G6DA 3CO7C 3KYLA 3OYEA 4MFEA 1I6HJ 3FZVA 3MD2A 1ZAOA 1ZRFA 4FHTA 2CGPA 4BYYA 3U1DA 5DCFA 4P55A 4V2GA 5J6XA 3GTMJ 2GA1A 2W25A 3BDDA 3BZCA 2YPRA 3W6JB 2W84A 1DPRA 1EH8A 3BT9A 3C2BA 2VOOA 3Q0VA 4OIRF 2EWNA 1OCCH 2QKMB 4OINF 3TW7A 2R7UA 4I02A 1V55H 5ILSA 1JKQC 5IP9J 2HOTA 1MMDA 5CQGA 2RV8A 2JZYA 3A4CA 2PJRB 5IP7J 4UY8I 4CHUA 4Y4RA 3D0SA 2XKOA 4PJJA 1BI0A 2DMPA 2H27A 1VQ8I 3V7SA 2OCCH 4MFDA 1A31A 2WV0A 2IA1A 3LMMA 3CDIA 3HG9A 3KCCA 1J2XA 3HYIA 1ZELA 1XDSA 1ZLJA 3MN2A 4UUVA 1AHDP 1BR4A 2ECCA 2VBYA 2R7SA 4U0WA 3MZYA 3PIOF 5CKTA 2HZTA 1NTCA 2ELKA 5FJ8J 1E0EA 1PVEA 3DCFA 4Z2YA 2TCTA 1PUFA 2XGXA 1WI9A 3L2UA 4BEHB 3GFLA 1A5JA 1XGOA 4KJZA 5BOXA 2ICWG 4O6JA 1P9QC 2V6CA 2ETHA 3CJNA 2IP2A 3DBRB 5J40A 2LY2A 2W24A 3W2VA 3BWGA 5K1YA 2LY1A 4IVNA 3FXUA 3BR6A 5J1UA 2PI0A 3GX4X 5E1ZB 5IYDJ 4JK1X 2VQGA 3HKZA 3OYKA 1FOWA 2XDVA 4L9JA 4F91B 4HNTA 3MKYB 4U87A 4UNOA 2AHQA 3PUFA 4XK4A 5HNHA 3V8LA 3JAMZ 2Z3YA 2XB5A 1RRJA 1MBHA 3L1PA 2VOPA 1R5ID 2IGOA 2MFZA 5HODA 2AQFA 4DOZA 1GDTA 4HBLA 1JXSA 5EGOB 1FIAA 2OQGA 4O5VA 3QYEA 2KJCA 1FC3A 3H3VK 4JX4A 4BNCA 1CF7B 4R79A 2VUMJ 5IT9Z 4MQVA 3TQNA 4MNUA 3HOUJ 3M7GA 2R5YA 5EEAA 1NK3P 4HF0A 2X1CA 3H36A 4NQWA 4UHTA 2FE3A 2E5ZA 4NC6A 1DGWY 3H0DA 2R7RA 2X6OA 4XN3A 4IOCF 3CCRI 5TISC 5BPIA 4R8HA 4D7NA 2PLYA 1SVOA 1QQIA 4MEYF 2R7VA 3P9IA 4UV8A 2XGDA 4AVZA 2HU9A 1VNDA 2JRMA 3SFZA 2RKHA 3C1DA 3KZIC 3SEQA 3OR1C 1IN6A 1B59A 3ZQHA 2XAUA 2WTEA 3J7AO 3TO6A 1VQ6I 1JUSA 2GA2A 3FMQA 4DIQA 5LBQA 2CWEA 4FE4A 2EBIA 4AUXA 2CSOA 3RZDJ 4E7KA 4GXOA 4ZDPA 1JTYA 2E19A 2MH2A 1T08B 3JSPA 4IOAF 5LHIA 3JRAA 4RB3C 3WU2C 1LE8A 3VFZA 4I2OA 2LH9A 2X48A 3VB2A 1WVRA 1X3ZB 1B72B 3G71I 2DQLA 2X51A 1Y39A 3DP7A 4IKFA 1FP1D 3OL4A 1R4MB 1LDDA 4AIDA 4IQ4A 2X1DA 2DOAA 3M8FA 4ESBA 1Z3YA 2E60A 1K78B 5F0HA 3QPHA 2DA7A 4BQOA 4HLYA 1I1GA 4K2EA 1I1SA 5CLSA 1R36A 1JKPC 3DBHB 2VQHA 1RKTA 1S7OA 4YIIA 3LSRA 1IXCA 3ECOA 3OR2C 1USTA 2E7WA 3HHGA 1BJZA 4LB5A 3BG5A 5K5RA 5M3MJ 2F5EA 3L2RA 1VQMI 4HF2A 1W5TA 1MBJA 4EEFG 3KEYA 4A12A 1G3TA 3ZXSA 3C18A 1ODDA 4KT6A 2Y31A 4BE0A 1RI7A 2F4IA 4I01A 5IP6A 1B1BA 1Y8QB 1VTNC 2O61A 1WFXA 4BHBA 1POGA 3ZQ7A 4BL0B 1D0ZA 3FXLA 3K1PA 3TDZC 3JRGA 1I6XA 1DU6A 1U9OA 1X58A 4RAGA 2LD5A 2GLOA 1A36A 4II3A 1ZGAA 1YJ9I 4ENNA 3F8NA 5GP9A 2E1CA 3ERED 5ICFA 1N25A 2GQQA 2E71A 3FHZA 4B1RA 1R1UA 2IA0A 2PMHA 2V9VA 5A2QZ 3J81K 3KPHA 3K4NA 3GTQJ 4RGSA 1Z6RA 4I76A 2K27A 2L0KA 1JJ6C 1S7EA 3NRVA 1I5ZA 1MMNA 3F22A 1Z7LA 2R0QC 1R58A 4L18B 3DBLB 2RREA 1HW5A 5H20A 3WG7H 1PUFB 4RAFA 3H9GA 1MGTA 3S3MA 5AIQA 1BM9A 3S15J 2Y69H 4RMNA 1LDJA 2ZXJA 4BQQA 3CP8A 4CUGA 2H94A 4I98B 4S05A 3R60A 1S6LA 3FM3A 1ULYA 2FJ1A 2JMWA 2R3SA 3HRSA 3CUOA 5E1WA 1MH3A 2ID6A 4GO1A 1J5YA 4HX4A 4XRSG 2H1LA 2RVCA 3EPZA 5AIPA 4I99C 1X1DA 3T5XA 1GVDA 3G2BA 3I59A 2LSOA 2WWYA 2VONA 2IS6A 1UG2A 4A3FJ 2KJBA 1U78A 1LEBA 1TT5B 3SXYA 1C0WA 3HZJA 4OAZA 1EH6A 3FBIB 4XL9A 3I56I 2YU9J 3HC7A 2Z33A 3OYLA 5DM7F 2EFNA 1YRNB 1LNWA 5HLGA 3A2KA 3FM5A 3G3ZA 4LG0A 4I7HA 2CV2A 3GTJJ 1UMQA 4KMFA 2E1MB 4UVAA 4AM3A 4M3GA 2ZCWA 1TC3C 5FD6A 3CLQA 2R5YB 4RLFA 3OYNA 1Y1VJ 4NQWB 5D8LB 3DPLC 3M1EA 3OYFA 3G1MA 3A01A 5FRMA 4ON0A 3E6CC 3DTKA 1XCBA 3GEZA 2VI6A 4KT5C 2V79A 4LLNA 4BKXA 3JW4A 5IYCJ 5HLIA 4EGYA 1YIOA 1O4XA 1QGPA 1R22A 2LG4A 4L0ZB 5E3OA 2A05A 3X2QH 3PSIA 1IO2A 2G7HA 2GOMA 1K6OA 3JREA 2BVLA 2BY2A 3H0GJ 1SFUA 1NG7A 2EFQA 4MLOA 2WC2A 4NB5A 2W00A 3RKWA 4RAZA 3KLOA 3T0YA 2M87A 1SVLA 2JWTA 3NWTA 4QPOA 4YEJA 3S93A 3TW6A 4EJOA 3J7AY 3GFJA 1A35A 5F04A 1LE8B 1B9MA 2ZMEA 3CESA 1V5GA 3CUQA 2G9WA 3HBLA 2ME6A 4BDZA 4PK4A 1HKQA 4QSHA 3BTJA 4IHTA 5GPAA 3F72A 4OMZA 1IRFA 1MSFC 4BDYA 1G3YA 3ZQFA 2PG4A 4OAYA 3RKXA 2VKVA 1UG0A 3C2GA 5EEGA 3CZ6A 1K4TA 3TKYA 2ZJQF 4YIFA 3OV8A 2ZXWH 4M9ZA 5E20A 2DMUA 3S2WA 3S1RJ 2OD5A 5GAEJ 3ZRGA 4I0AA 4RB0A 4M3EA 1MNDA 1FIPA 2L7FP 1XX5A 1E2XA 4ZC3A 1R49A 5FB2A 1QHHD 5HDKA 1S3JA 3FK6A 5D4SA 5HS8A 1SFOJ 2L7ZA 2VXZA 1HDPA 2F5VA 4HDVA 3HXLA 4PJMA 2M5WA 5KCMA 4RB2C 3D1NI 2DA2A 2E36A 2R7ZJ 3PJRA 2E1MC 1V54H 4AWXB 4ZZDA 1FBSA 4G9YA 3ZQLA 3KP7A 3RPQA 5LEJA 2E1NA 4Y7NJ 1KZHA 1GV5A 3IAS2 3VYUB 3MQ0A 1ZGWA 3QP5A 3A02A 4M9XA 2DTRA 1TWGJ 2DA5A 1W7PA 3E6DA 5IOYA 1D5YA 4KYWA 3BG7A 4BJ6C 3RPUD 1U8RA 3MMYB 2K3PA 5E8GA 3E0JB 4MTEA 1IRZA 2BXZA 4L9VA 1T8IA 2G7UA 4U88A 1QZYA 1X4PA 2KT0A 3V4GA 4CCKA 1VI0A 2ZSIB 4P5OA 3TGNA 4YG2F 1JUPA 2JVHA 2KQRA 1FWZA 1HLVA 2Q2EA 1AWCA 2NRAC 2DDBA 3F23A 3QWLA 3IKTA 2XPWA 2HQRA 1UHMA 2MABA 3B6CA 3M07A 4M6YA 3I64A 4QPQA 1WHUA 1RESA 1BIAA 1T0FA 2DT5A 5FKKA 1DDNA 3GZ6A 1ORKA 3K2AA 3NQOA 4ENJA 4G7OF 1EH7A 1OYYA 3CC2I 3E5UA 2CUEA 2GIVA 2X6XA 5GPCA 3Q0UA 4LLLA 5CYVA 1RUNA 5DCMB 2XROA 3OYMA 2LF7A 3ZQIA 4CZZA 4ZJZA 4EQQA 2LOOA 1G59A 3S2HJ 4N4NB 3K70D 2CW8A 2RQPA 4C30A 2K85A 1YJWI 2OF7A 3ZMDA 3PNTA 4YFNF 3PQKA 4CSWA 1BIBA 5D5XB 5B1AH 3E6BA 1ZR4A 1UB9A 1AKHA 1IRGA 3BPXA 3I59B 4F92B 2DAOA 1VF9A 2YR2A 3COAC 1U6GA 3GO5A 3LSIA 5KNLA 1ETWA 3HPGA 3S1NJ 1BBYA 1SANA 1VQOI 2Y2ZA 2L9RA 1E3OC 1R71A 2QEXI 1Z21A 2EH3A 3BC8A 3DPTA 4LG0B 2L7MP 1MBGA 3WODF 1NK2P 5LGTA 2Y48A 4E7ZA 4HF1A 2CUFA 3CMMA 4FETA 3G1LA 2QQBA 3S3NA 2P81A 3I5UA 3GZ5A 3A01B 3BG9A 1J9IA 5ERIA 4EM0B 1U9NA 3ONQA 5D4RA 1W7PD 3VYTB 3PSFA 3J80Z 1PDNC 2IW5A 3ABLH 2HYFA 3F8MA 2LTPA 1T39A 1IN5A 2K9LA 4HG2A 4DJAA 5E3MA 3REOA 2BZTA 1D8JA 2K02A 3ESWB 2CRGA 3MKZA 4AYBN 2IBDA 4YIRX 2IS4A 1D0XA 5M5WJ 1ETOA 5KHDA 5EGOA 3HUGB 1XPXA 2UXNA 2VJJA 3ROUA 4C2UA 2VQLA 1BN5A 5GADJ 2R7TA 1EKEA 2EIMH 2OUMA 2HQNA 3IAM2 3CUQB 1Y0NA 4DGWB 1SVMA 2L5QA 4E4HA 2MLKA 2XF5A 5GAHJ 2NVQJ 1G8XA 5FFXA 2P6TA 1HC8A 2L9NA 2QSFX 4XKCA 3NARA 2GOXB 2W7NA 1PYVA 2P5KA 3DXJF 4KDPA 2MA3A 4LB6B 2HDDA 2KLOA 2VT3A 1TW3A 3GW2A 4OIPF 1P2FA 2OC6A 3H5NA 3OS0A 1BR2A 1BI1A 3WHCA 4HEA2 1NG6A 3U2RA 4MQ9F 1ZHFA 5F64A 3I58A 2KIQA 3T8TA 5BMZA 2OU2A 3WU1B 3K6GA 3F8CA 4IJAA 3N4MA 1BA5A 2DA4A 2P6SA 4XRMA 2L9SA 3BR5A 3CLOA 3GTKJ 3OSFA 3GMEA 4D5CA 4DYCA 4ZYHA 2WY7Q 4ASNA 3EYYA 4OWRB 2I8DA 3FIWA 2M0CA 2XSJC 2NS0A 2CMPA 4HQMA 2LBFA 1A6IA 1ON1A 3BJOA 1FZPB 1K6YA 2DMTA 2JTVA 5DEQA 3SHFA 4DBQA 2E2HJ 1W7PB 2FMLA 1JTXA 1QVTA 1DQUA 2AQEA 3FWEA 3OS1A 3UKGA 3DEEA 5FD5A 3ZQCA 5EYRA 2R7DA 4M3BA 3GBGA 2KISA 3CF2A 2D45A 2ME0A 3HOYJ 2WAQN 1T2KA 4BACA 4PUSA 2GXBA 2STWA 3WTYC 3F8BA 4BE2A 4M3DA 4PGHA 2Q2EB 5DTDA 1WH5A 3EUKL 1Z0XA 2HOAA 4M6XA 5FRNA 2ELHA 2V9PA 2P7CB 1FY7A 2COMA 4M6VA 1E17A 2CU7A 2GM4A 1IZ1A 2QGUA 1IXRC 3A03A 4EATA 1SAXA 4KA4A 1HXDA 3M4OJ 1HKSA 3K1NA 2ZMEC 1ZRDA 4J19A 3CUQC 1H88C 2IGNA 2V9KA 3CDLA 2EINH 1ZGJA 1HW2A 5IOZA 3CD6I 4PDKA 2FMYA 3RKQA 1H8AC 4DW6A 2GIZA 1WJDA 2M45A 5KAIC 3F0CA 5IY5H 5EDNA 2IS2A 2ZKZA 3EYIA 5CVVA 3U1KA 1LKXA 2HPIA 5FKNA 4RGUA 3K70C 2QUFA 4JX6A 4CCMA 1OFCX 1SC7A 1GLNA 4FQGA 4IEJA 1MW7A 4ITVA 5EF6A 2XRNA 4E7LA 1F36A 1O7FA 4J00A 4UXNA 1XDUA 1Z6TA 4A0YA 4ZYDA 1UJ8A 3FXQA 1NH3A 4AIJA 1AKHB 4GCVA 4JP0A 1IN4A 2DK8A 2MLGA 3OYDA 2P0WA 2R92J 3K4LA 2L02A 2HFHA 1YE9A 3HB9A 2X4HA 5J3LA 1KU2A 4V2FA 3TBIA 3OIPA 1U2WA 2FQ3A 3PFYA 1GXQA 2OBPA 2CYYA 4BU2A 1GVJA 1NHAA 1XS9A 2PX9A 4HV5A 2MG4A 3HDDA 3FBNB 4XR6A 1KA8A 3TO7A 2HOSA 4CYCB 2L54A 3HTUA 3CMYA 2V26A 3HRUA 2QM3A 4M73A 4BXFA 2M0MA 2KMUA 2ZNYA 1JT6A 2DJNA 5FFZA 1JJ8C 5L3GA 4NNJA 1F9NA 4HYEA 4UVBA 3WE3A 2XVCA 1STZA 3QP6A 3K4BA 3CP2A 2NOJB 1ENHA 1X3WB 1ZR2A 4KICA 2FQ4A 2A5YB 2Y75A 4U7DA 4PJLA 2XAHA 2ZBKA 1YRNA 1YX5A 4QWQA 4LK1F 1F1ZA 3ERMA 2JSPA 1MJAA 4JQFA 4YFXF 3AAFA 2PN6A 1Y8RB 4ZYAA 2WV1A 3QODA 1T0FC 2DDAA 2XASA 4A5MA 2IGMA 2AS5F 1OR7A 3VODA 3G1OA 4P9FA 4E6KG 3U21A 4EJUA 1MBKA 2MGQA 3IL2A 2ELJA 3I0TA 3LSPA 1RUOA 3GWZA 1KONA 3LSGA 1YITI 3W6VA 1LFBA 2DA1A 2ZSHB 4UUTA 4OIQF 5FLVA 2B63J 9ANTA 2I10A 1YYVA 3ECHA 1U0JA 2BGCA 2ZXIA 4G6QA 3CMAI 3E5XA 4BXUA 4MIMA 4G12A 4OOIA 3M1CA 4A3CJ 4XLHA 2K5CA 3JCUC 3SQNA 5ILUA 3MZHA 1VQPI 2V1NA 3SDBA 2O8KA 4ZDOA 1ETKA 2DCEA 3BG6A 2H8RA 2PFBA 5ICCA 1FYLA 1REPC 1FT9A 2V1XA 2VBZA 3HIFA 2B7EA 3HTSB 2CFXA 4XKBA 3ZMVA 3H9QA 1APLC 1CQTA 1Z3XA 2JQ7A 4XORA 4HSTA 1YTYA 3IKVA 3Q9SA 3GTOJ 2BVMA 5F6FA 1YS7A 5K7HA 6PAXA 1F43A 2Y9ZA 4IX7A 3DKWA 3CF5F 1FNNA 4XN0A 4A3EJ 2M4GA 3KETA 3AL0B 1UELB 2EB7A 3F8FA 4EJTA 3ISPA 2KRCA 2ISZA 1D5VA 2O3FA 4IHSA 2EFWA 3Q9VA 2LBFB 4A93J 1MBEA 5L3EA 2E2IJ 1ONVA 2DA6A 5J1YA 2K40A 4M72A 4LJZF 4RM3A 3CC7I 1X1CA 1Y6IA 2WY8Q 3QOEA 1ETYA 4ZH4F 2VB6A 3S32A 4XLEA 3J81Z 2RGVA 1FTZA 3DLAA 4B48A 1X1PA 2IGKA 4FCYA 4U7BA 2QVOA 2ZJPF 3SJMA 3DLLF 3RTRA 2OAZA 2W1OA 1B9NA 2H8WA 1S7AA 3SZTA 5DYMA 1IV8A 2XF6A 2OTJI 1WJEA 4L5IA 1P92A 4H4KC 2LNBA 2WBMA 3R61A 1ZARA 2LKPA 3AKZA 5FLMJ 3CJQB 3AG3H 2FNPA 3BY6A 1GUUA 1LJ9A 3ASOH 5F08A 1ZREA 1X1AA 4P96A 4XKVA 2BW3A 1EA3A 1QRYA 4L5JA 4LOCA 3ABKH 4HRIA 3KP3A 2BOLA 2JT1A 3LSTA 1IG7A 4IRHA 1TZLA 3BP8A 4CYDA 4XSZF 5D5WB 4Q4ZF 3JRHA 1B6AA 5C4XJ 1XMAA 3WTWC 2OTLI 2MC4A 3QPTA 3IWZA 3CO6C 3QYFA 4IHYA 1ZLKA 1ZTRA 2LKSA 1O7LA 4BQNA 2ZC2A 2TRTA 3DTEA 5JFRA 2QQ8A 1XGSA 1V5EA 2DW4A 1LPQA 3I9V2 3H3ZA 2QBYA 5M5YJ 4IZZA 1P4XA 3BR1A 3FDYA 4AIKA 1XC5A 3HGYA 3CCSI 2WA0A 5E79C 5KVRA 2XGCA 1IRXA 1Z91A 2DOEA 1YFHA 3EQLF 3E6MA 2QSGX 1WPKA 4IRGA 3F6VA 1YW7A 2O03A 3OIOA 2DA3A 2FEZA 3VOEA 3GLXA 1XGNA 3S17J 3CCEI 4LIVA 3F6OA 3TOAA 1BI3A 3WTXC 2XUBA 2AO9A 3HOWJ 5DCMA 2Z9OA 1D1AA 3HOVJ 2BBYA 5DUIA 1S9HA 2XAGA 2YS9A 4XLFA 2DMQA 4AYBA 1G3WA 1H9TA 5DUKA 4YFKF 5L3CA 3VWBA 4DZPA 4IQJA 2FU4A 4J01A 4A3KJ 2O7OA 1KGSA 1R1VA 1D8KA 2Q1ZB 2EPFA 2EA4A 2XPVA 3R4KA 3LQQA 4P1WA 4XNFA 2A6HF 2DPDA 2F5DA 4EVIA 2F5CA 1OYIA 1TTYA 2FSWA 5D5VB 3VSLA 2DI3A 4IF4A 2Y9YA 2IRFG 4XMYA 5TJJA 2K7LA 5LHGA 3JTGA 2J5PA 4CGZA 1O57A 1ZG3A 2L4MA 4MO7A 4EM2A 1X1BA 5K5OA 2DBBA 4KUMA 2JRTA 3FX3A 3RPUA 3A0HC 2KRHA 4A5NA 5JLXA 3W2AA 2P4WA 1H9GA 2YU3A 3CC4I 4Q5SF 2MC3A 1WQ2A 5E1XA 2HZDA 5J1RA 1KQ9A 1X19A 1YG2A 3JRDA 1V3FA 4BAYA 1TBXA 4A0ZA 1FOKA 4PJNA 1BW6A 1W0TA 1G2HA 1SD5A 2VXDA 1AU7A 3VYSB 1Z9CA 4BJ5C 2OQRA 5GTIC 5EZHA 4OMYA 2Z16A 3BZ6A 1HSJA 2QKLB 2WADA 4A3IJ 1GXPA 2QENA 3LNQA 5B5EC 3HM5A 1TWAJ 4XICA 3W6KB 4Y13A 1W0UA 3QOPA 1ZN2A 2KL4A 3AFHA 2A68F 3HUGA 3MZ8A 3I53A 1PUEE 3TL4X 1ZG1A 1SFXA 3QAHA 3OYBA 1JKRC 1R5GA 2DOFA 2NVXJ 1T56A 4N0BA 4F93B 2L3DA 1PP7U 4HAMA 3S3OA 3BR2A 4WXDA 3OY9A 1FYMA 3V8KA 5AONA 2F48A 3HKZN 3ML6A 3WTZA 4BHCA 2K4JA 3KE2A 1IW7F 2Q0OA 4FT8A 1FBUA 3ELKA 3O3KA 2WAQA 1R00A 1W5CC 5HNFA 4UV9A 1XB4A 3EUHA 3QPSA 5CVIA 4B44A 3FXKA 3QRFF 3MKWB 3LSMA 2Y30A 4CCJA 2VODA 1RZ4A 4DYQA 1K4SA 1UHWA 2FX0A 1G4DA 5HDNA 2JUCA 1ZKGA 3HSEA 3KP4A 1GT0C 1Y0UA 2MSYA 1ZG5A 3BPVA 5HLHA 3J7ZI 3JR9A 4XLNF 2HOEA 1TQMA 4BBSJ 3QYBA 2E35A 4U0VA 1FMVA 3CCVI 5HS9A 4BGDA 3JRIA 3CCQI 3IRQA 1FP2A 5ILVA 2FD5A 2KIMA 2BW3B 2CO5A 1ON2A 1OR7C 1O3TA 4IL6C 1IN7A 3DPUA 2PQ8A 3RSNA 1ETXA 2HKXA 5D8KB 3S16J 1N75A 4ESJA 4HV6A 1Z1DA 1TLHB 4NHJA 3WTTC 1IV6A 3BCBA 3H92A 3ZN1A 2JN6A 3B73A 4Q48A 4CICA 4YELA 3DQVC 3OIQA 1JGSA 1IAWA 5D6FA 1OCOH 5J4VA 4B3AA 1O3SA 2JSCA 2D1HA 2W48A 2RQQA 1HDDC 4FTHA 3H35A 4GYGA 1DP7P 1YLFA 3PM1A 2QBYB 4A3DJ 3C2HA 3DU5A 2A61A 1V5FA 2WAEA 4AVPA 2PMZN 1Q1VA 1HQCA 2M2EA 2NVUB 4B47A 1SFKA 1BC8C 4LGWA 3ZMUA 4EM1A 4UB8C 3SYTA 2HQ5A 3PO2J 2MD0A 4ENMA 4L9TA 2IAIA 5BQTA 1W36D 2XHKA 1HOMA 2E5NA 1VQLI 2YSRA 3PNYA 3KEQA 3D5LA 3OS2A 1Z7UA 3FKIJ 4CA0A 2CUZA 2K4BA 2LREA 3Q3SA 4B43A 2LVSA 3QU6A 4WWCA 2XAJA 3GYHX 1OCTC 1Z77A 3L2CA 2M34A 3BQYA 1VZ0A 2CW7A 2VLAA 3P9CA 3PNVA 1VQ9I 2L7KA 3I4NJ 1IUFA 2HYGD 3I55I 4RDUA 1UAAA 5JI6A 2D2WA 3R0JA 2LKXA 4BY7J 4YRVA 1HCRA 2P5LC 1L0OC 1QHGA 2EV6A 4HNVA 4CCNA 2VE8A 5E3NA 4WXHA 2ISYA 1O3RA 2VQCA 1BW5A 2CQKA 2NNYA 2VASA 2ESHA 1I3AA 2COBA 2E1OA 2GXAA 2HYJA 4HW0A 4R1HA 4Y33A 4CDGA 2HEOA 4O3MA 2X6YA 3OOUA 1MBFA 2MH9A 4KIFA 1FSEA 1XCVA 1HBXG 2K9SA 1OYWA 2P7VB 5ED4A 4CYCA 2ACJA 1YW8A 3S8PA 1ERDA 4GFBA 2BY0A 4BE1A 1FEXA 4BHPA 4L5EA 4RM2A 4S04A 3OSGA 3FISA 2XV4S 2FBIA 2A5WA 1ETVA 5EG0A 3K2ZA 4BXXJ 2FRHA 2EK5A 2DFFA 2EFPA 3KFWX 4A69C 2KFDA 1WJBA 1TT0A 4RB1A 1MNEA 2ZFUA 3DTIA 3WGIA 4IPAA 2P8TA 3PFIA 1U5TA 3ABTA 5H6QA 3R6SA 2M7BA 4BS9A 4D1QA 1BI2A 1SMTA 1WZ2A 3RZOJ 4EJWA 2Z1DA 2UXXA 1FX7A 4M74A 5J4YA 2JPBA 2L4AA 4WXCA 2VE9A 2C6YA 3O8GA 4BBRJ 1A6QA 4MHGA 2LK2A 2KDZA 3G73A 2DLLA 2CW0F 1WKMA 2LF8A 1WRJA 2EA2A 3IUOA 4XONA 3PUBA 1IN8A 4BJTA 3HPHA 5C3EJ 2BE5F 1FYKA 4MEXF 3MEXA 2BHYA 2X6WA 1BC7C 3VPRA 1K79A 4BQAA 2Y0MA 1MNMC 4KISA 2H1KA 1BL0A 1TNTA 4N9HA 1W4MA 2J5OA 4ZYGA 2KDOA 3BROA 2DFHA 2O0YA 3OL3A 1J09A 2PJPA 1R23A 2QQ9A 3ZQQA 5LFAA 3MWMA 3K10A 2CQNA 3IH3A 1TQPA 1FJLA 5F1JA 3RI4A 3S1QJ 4FE7A 4CH7A 2DTZA 2BEOA 4DNCA 2CQQA 2FNAA 2DODA 3D5SC 1M1EB 2DQRA 3NWSA 1OCZH 4RA2A 4W97A 4XLAA 1MDMA 3ULQB 2RC4A 2XKPA 1OCRH 1CGPA 4HX8A 1MMGA 1T6SA 3PL8A 3GTGJ 1WGXA 4G7ZF 1H0MA 2L01A 2BY3A 4B09A 4A0XA 5FKLA 4FX4A 1ZH5A 4HOBA 2DU9A 5FROA 2OV7A 2EFOA 5J47A 3IV5A 2PEXA 4KN7X 5EEHA 3GCMA 3BJAA 4X1EA 5FKOA 1MMAA 1AOYA 2IVMA 1S72I 3CCUI 2NXNB 2LRDA 3LSHA 1L3LA 3H5AA 4F55A 4C3HJ 3C3WA 1ZYRF 5C4JJ 2R7WA 2K3FA 2BXYA 2VPRA 1OLTA 5ICGA 2EQRA 2HDWA 5B1BH 2XC7A 2A3SA 2R7FA 1X4OA 3K69A 1VQNI 4ETSA 3GF2A 4HA8A 3LAPA 2WAFA 4MGRA 3DWLE 5CJ9A 3W2WA 4A3LJ 5FLXK 3IH4A 2HS5A 2CV0A 1AA7A 2F4OB 1B8IB 3JTHA 1IDZA 2EZHA 5JHUA 2R7XA 3ZQGA 1HA8A 1W36C 2LLKA 2ADUA 4M3FA 1Y1WJ 4EJVA 3JRFA 4A3MJ 5M5XJ 3WTSC 2XB0X 2EZIA 4Y15A 4LD5A 3KX2A 1W1WE 3OMYA 2JJ7A 4XLPF 2LDUA 1R1TA 1ITYA 3KP6A 2O5RA 2NOGA 2X85A 3GTLJ 2QQAA 3H1CA 4BY1J 1WJAA 2FA5A 5H2FC 3BG3A 1R9TJ 1USSA 2FUG2 4IHWA 1DP3A 2O8XA 2CH0A 2BV6A 2DYRH 2L9VA 3EUHC 3LA2A 3T1BA 2NNNA 4ZTJA 1EJ9A 2HDCA 1TP4A 5H6RA 5DD4A 3VSKA 1FLIA 1HF0A 3GFMA 1XSXA 1G6NA 2IS1A 2ECBA 2E7XA 2JVGA 3ZCOA 2IPQX 4KIBA 3LL7A 4WF2A 3IP4B 1KQ0A 3GUDA 1DUXC 1R6RA 4E7SA 3O2PE 1BR1A 4C3IJ 4H0EA 1OKRA 2UZKA 1WI3A 2Y0SN 3LQRA 3BCAA 4X6AJ 1LUJB 2LC2A 3U9GA 3MAJA 5DV5A 3VDXA 2EIKH 2FOKA 2NYXA 3B6AA 1D0YA 2DN0A 2DYSH 3KZZA 4BUPA 4IHXA 2Z2SB 2M9HA 2XSDC 2JA8J 1YX3A 1GV2A 2HWVA 4FX0A 2DXIA 1JHFA 4NUBA 4DYRA 3OYIA 2V4JC 2NS7A 1YIJI 3WE2A 4LK0F 1OMIA 5EG0B 2QA4I 1W5SA 3RIRA 2IJLA 1IGNA 3BJ6A 3LWFA 2PBIA 1J0RA 2JK3A 1U5TB 2NVTJ 5B66C 4PFPA 4FASD 5DDGA 3ZMSA 3MKLA 3RJPA 4HPQA 5JHFA 3P7NA 3V7CA 3L09A 2YX7A 3SZPA
chains in the Genus database with same CATH topology
4KIGA 3RYRA 1S29A 5E17F 2H09A 4M9SA 1QO0D 3KLNA 4G8XA 3IHUA 3LA7A 2EJRA 3H3UA 5CVJA 3M8EA 2DFIA 4IRIA 3RKYA 1B4AA 1J75A 1IXSB 1MD0A 1Q1HA 4HLXA 3N97A 2V1DA 1MDMB 2ESNA 2EV5A 1KYWA 2VC1A 3CDHA 4LMYA 3WG9A 1TQIA 4Q47A 2HKOA 4XSXF 5J8CA 2NAZA 2RDPA 3HSRA 3HOSA 4HQEA 4MTDA 1SMYF 4KNYA 3JAMK 3CTAA 4HX7A 3TDUC 5FO5A 4PGGA 2O6GE 2KRFA 2VC0A 4XRFA 5IT9K 2VT2A 3M9AA 1JE8A 1U5TC 2Z5UA 2F5FA 3HRTA 1HKTA 2V1UA 4TV7A 2QWWA 4QLCU 4P9UA 3ZP5A 3PQJA 3L9FA 5TRDA 1YO5C 2M8EA 2PMUA 5LRSA 3P9KA 1SFEA 1F5TA 3EDPA 2QZ8A 2CG4A 3L7WA 2EV0A 1MZBA 2F2EA 4Y17A 1QNTA 4ENKA 1BJAA 3WU0A 1KQ8A 1O3QA 4XBFA 4WK8F 5D5UB 2X0LA 3VEPA 4ESFA 1OPCA 3HSFA 5E8IA 2DPUA 2YX4A 1MJBA 3KP2A 1T98A 4D0PA 4OU0A 1KYZA 5L3DA 2ZO4A 2AXLA 5ICEA 3ZMTA 2OZUA 3MFKA 2XAQA 3K0LA 1QZZA 1XSDA 4ZYEA 4I0BA 5LEKA 2VN2A 4A6DA 3FMRA 1TW2A 1P4AA 3GVAA 4WX9A 3RDIA 5HOOA 2H6BA 5A2QK 4F7ZA 3DV8A 4L0YB 2IA2A 4HDUA 1G3SA 3KZYA 1P4WA 4GYIA 1SD7A 2VBWA 3TO9A 1RNLA 2HGCA 4AD9A 1HSTA 4RGXA 4RS8A 2KIUA 4RAYA 3FMSA 1XD7A 1A04A 2QYOA 3E5QA 3E97A 3V8JA 3F21A 2GZWA 4EGZA 3KEOA 1XN7A 3LFKA 2DO7A 4A6EA 3TOBA 1JHHA 1Z05A 1IUYA 3I54A 2XAFA 1P6RA 3MCZA 2HTSA 3C7JA 1I27A 3WGHA 2HTJA 5BS6A 2OA4A 1FSHA 3HHHA 2K86A 2STTA 3I71A 3DEUA 3DF8A 4EMSA 3Q5FA 1RIOH 2IT0A 4OIOF 3KP5A 4KMUX 1QBJA 1XMKA 5F1RA 1BOAA 1SD6A 2KKOA 1D3YA 1LVAA 1S8NA 5J8FA 5LGUA 3K1MA 5JVTA 5CVRA 2M1BA 2QLZA 5LGNA 1DPUA 2H6CA 4N9IA 2FXAA 1FPQA 2FBKA 3K9TA 2ZNZA 4JBAA 1TNSA 1J59A 3EETA 3FXRA 4L9NA 2W85A 1J7KA 4I09A 3WTVC 4ZZLA 2DK5A 4CXFA 1KU9A 1F4KA 2KIFA 2GXGA 1HW1A 1X3UA 1U3EM 3ZN0A 3T8RA 1T38A 4EV0A 4LLGF 3HOTA 4HZFA 2BYVE 5LHHA 3I4PA 3NEUA 3LA3A 1R7JA 2FBHA 4DQ2A 3WGGA 3ZPLA 3OOPA 1MKMA 5HS7A 5L3BA 1XSVA 2RN7A 5CVUA 1WSUA 4AIHA 5BPDA 4KFCA 1LB2A 1KU7A 3E3VA 2ZFWA 4G7HF 1LQ1A 3IC7A 2RNJA 2ZJ2A 4A2UA 3LAJA 2B0LA 3HRMA 2A6EF 4PCQA 1GHCA 1V4RA 5IT3A 3JSOA 1R5HA 4GGGA 3FF5A 4LFUA 4KN4X 5LLQA 5LRRA 1LDKB 1UFMA 2M30A 4B8XA 1UCRA 4PZJA 4RGRA 3RYPA 3F3XA 5E18F 2A69F 3V7RA 1YS6A 4UVCA 4BH9A 3IRRA 1ZRCA 1K7AA 2W57A 4WCGA 1YQAA 5KK1A 5L3FA 1FBQA 3L00A 2TDXA 4M71A 4E70A 2OZ6A 2D1VA 3IWFA 1CF7A 3GFIA 2A07F 3BOQA 2P5VA 3O6BB 3WTUC 5FLXZ 3GXOA 2GAUA 2ZMEB 2JPCA 1QPMA 2XIGA 2UWMA 3QU3A 2Z99A 5HVQC 4CO8A 1LEAA 3J80K 5K5QA 2HR3A 5D6EA 5FGMA 3ZMZA 1SD4A 3ABUA 5HDGA 2MBFA 1KU3A 2FF4A 1PP8F 1YW9A 4U0YA 1IF1A 1MJ9A 1EV7A 2MD5A 2Q8KA 2GWRA 3R0AA 5JR3A 4G94A 2VBXA 1WWXA 5DD8A 1XGMA 1K78A 3DFGA 4IXAA 3B02A 4G6DA 3CO7C 3FZVA 1ZAOA 1ZRFA 4FHTA 2CGPA 4BYYA 3U1DA 5DCFA 4P55A 5J6XA 2GA1A 2W25A 3BDDA 2YPRA 3W6JB 2W84A 1DPRA 1EH8A 2VOOA 4OIRF 2EWNA 4OINF 4I02A 5ILSA 2RV8A 2JZYA 4CHUA 3D0SA 2XKOA 1BI0A 2H27A 3V7SA 2WV0A 2IA1A 3KCCA 1J2XA 3HYIA 1XDSA 1ZLJA 4UUVA 2VBYA 4U0WA 3MZYA 2HZTA 4Z2YA 2XGXA 1WI9A 3GFLA 1XGOA 5BOXA 4O6JA 2V6CA 2ETHA 3CJNA 2IP2A 2W24A 3BWGA 5K1YA 4IVNA 3FXUA 2PI0A 3GX4X 5E1ZB 4JK1X 4L9JA 4UNOA 3V8LA 3JAMZ 2Z3YA 2VOPA 4HBLA 1JXSA 2OQGA 4O5VA 2KJCA 1FC3A 4BNCA 1CF7B 4R79A 5IT9Z 4MQVA 3TQNA 4MNUA 3M7GA 4HF0A 4NQWA 4UHTA 2FE3A 5BPIA 4R8HA 2PLYA 4MEYF 1QQIA 3P9IA 4UV8A 3SFZA 2RKHA 3C1DA 1IN6A 1B59A 2WTEA 3J7AO 3TO6A 2GA2A 3FMQA 5LBQA 2CWEA 2CSOA 4GXOA 2MH2A 3JSPA 5LHIA 4RB3C 3VFZA 4I2OA 3VB2A 2DQLA 3DP7A 1FP1D 1LDDA 3M8FA 4ESBA 1K78B 3QPHA 4HLYA 1I1GA 4K2EA 1I1SA 5CLSA 1R36A 1S7OA 4YIIA 1IXCA 3ECOA 1USTA 2E7WA 3HHGA 4LB5A 5K5RA 4HF2A 2F5EA 1W5TA 4A12A 1G3TA 3C18A 1ODDA 1RI7A 4I01A 1B1BA 1VTNC 2O61A 4BHBA 3ZQ7A 3K1PA 3TDZC 1I6XA 1ZGAA 4ENNA 3F8NA 2E1CA 3ERED 5ICFA 2GQQA 3FHZA 1R1UA 2IA0A 2PMHA 2V9VA 5A2QZ 3J81K 4RGSA 1Z6RA 2K27A 3NRVA 1I5ZA 3F22A 1R58A 4L18B 1HW5A 5H20A 1MGTA 5AIQA 1BM9A 1LDJA 2ZXJA 2H94A 4I98B 4S05A 3R60A 1S6LA 3FM3A 1ULYA 2R3SA 3HRSA 3CUOA 5E1WA 4GO1A 1J5YA 4HX4A 2RVCA 5AIPA 3T5XA 3I59A 2LSOA 2VONA 2KJBA 1U78A 1LEBA 3SXYA 1C0WA 1EH6A 2Z33A 2EFNA 1LNWA 5HLGA 3FM5A 3G3ZA 4LG0A 4I7HA 4KMFA 4UVAA 2ZCWA 5FD6A 5D8LB 3DPLC 3M1EA 4ON0A 3E6CC 1XCBA 3GEZA 4KT5C 2V79A 4LLNA 3JW4A 4EGYA 5HLIA 1YIOA 1QGPA 1R22A 4L0ZB 2G7HA 1K6OA 1SFUA 2EFQA 2WC2A 4NB5A 3RKWA 4RAZA 3KLOA 3T0YA 2M87A 4EJOA 3GFJA 1B9MA 2ZMEA 3CUQA 2G9WA 1HKQA 4IHTA 3F72A 4OMZA 1IRFA 1G3YA 2PG4A 3RKXA 5EEGA 3TKYA 4YIFA 3OV8A 4M9ZA 5E20A 3S2WA 2OD5A 4I0AA 4RB0A 1E2XA 5FB2A 5HDKA 1S3JA 5HS8A 5D4SA 2VXZA 4HDVA 2M5WA 4RB2C 4AWXB 4ZZDA 1FBSA 4G9YA 3KP7A 3RPQA 5LEJA 2E1NA 3MQ0A 3QP5A 4M9XA 2DTRA 3E6DA 1W7PA 4KYWA 1U8RA 5E8GA 4MTEA 4L9VA 2G7UA 4U88A 1QZYA 3V4GA 4P5OA 3TGNA 4YG2F 1FWZA 2Q2EA 1AWCA 2NRAC 3F23A 3IKTA 2HQRA 1UHMA 4M6YA 3I64A 1BIAA 1T0FA 2DT5A 1DDNA 3GZ6A 3NQOA 4ENJA 4G7OF 1EH7A 1OYYA 3E5UA 2GIVA 4LLLA 5CYVA 1RUNA 5DCMB 2XROA 2LF7A 4CZZA 4EQQA 2RQPA 3ZMDA 4YFNF 3PQKA 1BIBA 5D5XB 3E6BA 1UB9A 1IRGA 3BPXA 3I59B 2DAOA 2YR2A 3COAC 1U6GA 3GO5A 1BBYA 3DPTA 4LG0B 3WODF 5LGTA 2Y48A 4HF1A 2QQBA 3I5UA 3GZ5A 1J9IA 5ERIA 4EM0B 5D4RA 1W7PD 3J80Z 1PDNC 2IW5A 2HYFA 3F8MA 1T39A 1IN5A 3REOA 1D8JA 2K02A 2UXNA 3ROUA 1BN5A 2HQNA 3CUQB 2MLKA 5FFXA 2P6TA 2P5KA 3DXJF 4KDPA 2MA3A 4LB6B 2VT3A 1TW3A 3GW2A 4OIPF 1P2FA 1BI1A 3U2RA 4MQ9F 1ZHFA 5F64A 3I58A 3T8TA 5BMZA 2OU2A 3WU1B 4IJAA 3F8CA 3N4MA 2P6SA 3CLOA 4ZYHA 4ASNA 3EYYA 2NS0A 4HQMA 1ON1A 3BJOA 1FZPB 2JTVA 5DEQA 3SHFA 1W7PB 2FMLA 3FWEA 5FD5A 2R7DA 2D45A 1T2KA 2GXBA 2STWA 3WTYC 3F8BA 4PGHA 4M6XA 2ELHA 2P7CB 1FY7A 2COMA 1E17A 1IZ1A 1IXRC 1SAXA 4KA4A 1HXDA 1HKSA 3K1NA 1ZRDA 3CUQC 1HW2A 1ZGJA 4PDKA 2FMYA 2M45A 2ZKZA 3EYIA 5CVVA 4RGUA 2QUFA 2XRNA 1O7FA 4UXNA 1XDUA 1Z6TA 4A0YA 4ZYDA 3FXQA 4AIJA 4GCVA 1IN4A 2DK8A 2MLGA 2L02A 2HFHA 2X4HA 1KU2A 1U2WA 2FQ3A 1GXQA 2OBPA 2CYYA 1GVJA 1NHAA 4HV5A 1KA8A 3TO7A 2L54A 3HTUA 3HRUA 2QM3A 4M73A 2ZNYA 5FFZA 5L3GA 1F9NA 4HYEA 4UVBA 3WE3A 2XVCA 1STZA 3QP6A 4KICA 2A5YB 2Y75A 4U7DA 2XAHA 2ZBKA 4QWQA 4LK1F 1F1ZA 3AAFA 4JQFA 1MJAA 4YFXF 2PN6A 2XASA 4A5MA 2AS5F 1OR7A 3VODA 4P9FA 4EJUA 3IL2A 3I0TA 1RUOA 3GWZA 4OIQF 1YYVA 3ECHA 2BGCA 4G6QA 3E5XA 4BXUA 4OOIA 3SQNA 5ILUA 3MZHA 2PFBA 5ICCA 1FYLA 1REPC 1FT9A 2V1XA 2VBZA 3HIFA 3HTSB 2CFXA 3ZMVA 1YTYA 3IKVA 3Q9SA 5F6FA 1YS7A 6PAXA 3DKWA 1FNNA 3KETA 2EB7A 3F8FA 4EJTA 3ISPA 2ISZA 1D5VA 2O3FA 4IHSA 2EFWA 3Q9VA 5L3EA 1ONVA 4M72A 4LJZF 4ZH4F 3J81Z 2RGVA 4U7BA 2QVOA 3RTRA 2OAZA 1B9NA 1S7AA 3SZTA 5DYMA 4L5IA 1P92A 2LNBA 3R61A 1ZARA 2YX7A 2LKPA 2FNPA 3BY6A 1LJ9A 1ZREA 4P96A 4L5JA 3KP3A 2JT1A 3LSTA 4IRHA 3BP8A 4CYDA 4XSZF 5D5WB 4Q4ZF 1B6AA 3WTWC 1XMAA 3QPTA 3IWZA 3CO6C 1ZLKA 1O7LA 5JFRA 1XGSA 2DW4A 3H3ZA 2QBYA 1P4XA 4AIKA 5KVRA 1Z91A 1YFHA 3EQLF 3E6MA 4IRGA 3F6VA 1YW7A 2O03A 2FEZA 3VOEA 3GLXA 1XGNA 3F6OA 3TOAA 1BI3A 3WTXC 2XUBA 5DCMA 2Z9OA 2BBYA 5DUIA 2XAGA 1G3WA 1H9TA 5DUKA 4YFKF 5L3CA 2FU4A 1KGSA 1R1VA 1D8KA 2EA4A 3R4KA 3LQQA 2A6HF 2DPDA 2F5DA 4EVIA 2F5CA 1OYIA 1TTYA 2FSWA 5D5VB 2DI3A 4IF4A 2IRFG 5TJJA 2K7LA 5LHGA 3JTGA 2J5PA 4CGZA 1O57A 1ZG3A 2L4MA 4EM2A 5K5OA 2DBBA 4KUMA 2JRTA 3FX3A 3RPUA 4A5NA 2P4WA 1H9GA 2YU3A 4Q5SF 2MC3A 1WQ2A 5E1XA 1KQ9A 1YG2A 1V3FA 4BAYA 1TBXA 4A0ZA 1FOKA 1SD5A 1Z9CA 2OQRA 4OMYA 3BZ6A 1HSJA 1GXPA 2QENA 3W6KB 4Y13A 3QOPA 1ZN2A 2A68F 3HUGA 1PUEE 3I53A 1ZG1A 1SFXA 3QAHA 1R5GA 4N0BA 2L3DA 1PP7U 4HAMA 4WXDA 1FYMA 3V8KA 5AONA 3ML6A 3WTZA 4BHCA 2K4JA 3KE2A 1IW7F 2Q0OA 4FT8A 1FBUA 3ELKA 3O3KA 1R00A 4UV9A 1XB4A 3EUHA 5CVIA 3QRFF 2VODA 1RZ4A 1UHWA 1G4DA 5HDNA 3KP4A 3HSEA 1Y0UA 1ZG5A 3BPVA 5HLHA 4XLNF 2HOEA 1TQMA 4U0VA 5HS9A 3IRQA 1FP2A 5ILVA 2KIMA 2CO5A 1ON2A 1O3TA 1IN7A 2PQ8A 5D8KB 2HKXA 4ESJA 4HV6A 1Z1DA 1TLHB 4NHJA 3WTTC 3H92A 3ZN1A 3B73A 4Q48A 4CICA 3DQVC 1JGSA 1IAWA 5D6FA 1O3SA 2JSCA 2D1HA 4GYGA 1DP7P 1YLFA 2QBYB 2A61A 4AVPA 1HQCA 1BC8C 4LGWA 3ZMUA 4EM1A 4ENMA 4L9TA 5BQTA 2XHKA 2YSRA 3KEQA 3D5LA 1Z7UA 2K4BA 3QU6A 4WWCA 2XAJA 3GYHX 3L2CA 3P9CA 2HYGD 5JI6A 2D2WA 3R0JA 2P5LC 1L0OC 2EV6A 2VE8A 4WXHA 2ISYA 1O3RA 2CQKA 2NNYA 2ESHA 4HW0A 4R1HA 4CDGA 2HEOA 4O3MA 2MH9A 4KIFA 1FSEA 1XCVA 1HBXG 1OYWA 2P7VB 5ED4A 2ACJA 1YW8A 4BHPA 4S04A 2XV4S 2FBIA 3K2ZA 2FRHA 2EK5A 3KFWX 2EFPA 4RB1A 3WGIA 4IPAA 2P8TA 3PFIA 1U5TA 3ABTA 5H6QA 3R6SA 1BI2A 1SMTA 4EJWA 2UXXA 1FX7A 4M74A 2JPBA 2L4AA 4WXCA 2VE9A 2C6YA 4MHGA 3G73A 2DLLA 2CW0F 1WKMA 2LF8A 1WRJA 2EA2A 1IN8A 4MEXF 2BE5F 1FYKA 3MEXA 4BQAA 1BC7C 1K79A 2Y0MA 1TNTA 4N9HA 1W4MA 2J5OA 4ZYGA 3BROA 2O0YA 2PJPA 1R23A 2QQ9A 3MWMA 1TQPA 3RI4A 2BEOA 4DNCA 2FNAA 2DQRA 1MDMA 3ULQB 2RC4A 2XKPA 1CGPA 4HX8A 1T6SA 4G7ZF 1H0MA 2L01A 4B09A 4A0XA 4FX4A 1ZH5A 4HOBA 2DU9A 2EFOA 2PEXA 4KN7X 5EEHA 3BJAA 1AOYA 2IVMA 1L3LA 3C3WA 1ZYRF 5ICGA 2A3SA 2R7FA 3K69A 4ETSA 3GF2A 4HA8A 3LAPA 4MGRA 5FLXK 5CJ9A 2HS5A 3JTHA 5JHUA 2ADUA 4EJVA 3WTSC 4Y15A 4LD5A 4XLPF 2LDUA 1R1TA 3KP6A 2QQAA 2FA5A 1USSA 2O8XA 2BV6A 3LA2A 3T1BA 2NNNA 2HDCA 5H6RA 5DD4A 1FLIA 3GFMA 1XSXA 1G6NA 2E7XA 2IPQX 4KIBA 4WF2A 1KQ0A 3GUDA 1DUXC 3O2PE 4H0EA 1OKRA 2UZKA 3LQRA 3U9GA 3MAJA 5DV5A 2FOKA 2NYXA 3KZZA 2HWVA 4FX0A 1JHFA 3WE2A 4LK0F 1OMIA 1W5SA 3RIRA 2IJLA 3BJ6A 3LWFA 2PBIA 1J0RA 1U5TB 5DDGA 3ZMSA 3RJPA 3P7NA 3V7CA 3L09A 2WWYA 3SZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIG A;  3RYR A;  1S29 A;  5E17 F;  2H09 A;  4M9S A;  1QO0 D;  3KLN A;  4G8X A;  3IHU A;  3LA7 A;  2EJR A;  3H3U A;  5CVJ A;  3M8E A;  2DFI A;  4IRI A;  3RKY A;  1B4A A;  1J75 A;  1IXS B;  1MD0 A;  1Q1H A;  4HLX A;  3N97 A;  2V1D A;  1MDM B;  2ESN A;  2EV5 A;  1KYW A;  2VC1 A;  3CDH A;  4LMY A;  3WG9 A;  1TQI A;  4Q47 A;  2HKO A;  4XSX F;  5J8C A;  2NAZ A;  2RDP A;  3HSR A;  3HOS A;  4HQE A;  4MTD A;  1SMY F;  4KNY A;  3JAM K;  3CTA A;  4HX7 A;  3TDU C;  5FO5 A;  4PGG A;  2O6G E;  2KRF A;  2VC0 A;  4XRF A;  5IT9 K;  2VT2 A;  3M9A A;  1JE8 A;  1U5T C;  2Z5U A;  2F5F A;  3HRT A;  1HKT A;  2V1U A;  4TV7 A;  2QWW A;  4QLC U;  4P9U A;  3ZP5 A;  3PQJ A;  3L9F A;  5TRD A;  1YO5 C;  2M8E A;  2PMU A;  5LRS A;  3P9K A;  1SFE A;  1F5T A;  3EDP A;  2QZ8 A;  2CG4 A;  3L7W A;  2EV0 A;  1MZB A;  2F2E A;  4Y17 A;  1QNT A;  4ENK A;  1BJA A;  3WU0 A;  1KQ8 A;  1O3Q A;  4XBF A;  4WK8 F;  5D5U B;  2X0L A;  3VEP A;  4ESF A;  1OPC A;  3HSF A;  5E8I A;  2DPU A;  2YX4 A;  1MJB A;  3KP2 A;  1T98 A;  4D0P A;  4OU0 A;  1KYZ A;  5L3D A;  2ZO4 A;  2AXL A;  5ICE A;  3ZMT A;  2OZU A;  3MFK A;  2XAQ A;  3K0L A;  1QZZ A;  1XSD A;  4ZYE A;  4I0B A;  5LEK A;  2VN2 A;  4A6D A;  3FMR A;  1TW2 A;  1P4A A;  3GVA A;  4WX9 A;  3RDI A;  5HOO A;  2H6B A;  5A2Q K;  4F7Z A;  3DV8 A;  4L0Y B;  2IA2 A;  4HDU A;  1G3S A;  3KZY A;  1P4W A;  4GYI A;  1SD7 A;  2VBW A;  3TO9 A;  1RNL A;  2HGC A;  4AD9 A;  1HST A;  4RGX A;  4RS8 A;  2KIU A;  4RAY A;  3FMS A;  1XD7 A;  1A04 A;  2QYO A;  3E5Q A;  3E97 A;  3V8J A;  3F21 A;  2GZW A;  4EGZ A;  3KEO A;  1XN7 A;  3LFK A;  2DO7 A;  4A6E A;  3TOB A;  1JHH A;  1Z05 A;  1IUY A;  3I54 A;  2XAF A;  1P6R A;  3MCZ A;  2HTS A;  3C7J A;  1I27 A;  3WGH A;  2HTJ A;  5BS6 A;  2OA4 A;  1FSH A;  3HHH A;  2K86 A;  2STT A;  3I71 A;  3DEU A;  3DF8 A;  4EMS A;  3Q5F A;  1RIO H;  2IT0 A;  4OIO F;  3KP5 A;  4KMU X;  1QBJ A;  1XMK A;  5F1R A;  1BOA A;  1SD6 A;  2KKO A;  1D3Y A;  1LVA A;  1S8N A;  5J8F A;  5LGU A;  3K1M A;  5JVT A;  5CVR A;  2M1B A;  2QLZ A;  5LGN A;  1DPU A;  2H6C A;  4N9I A;  2FXA A;  1FPQ A;  2FBK A;  3K9T A;  2ZNZ A;  4JBA A;  1TNS A;  1J59 A;  3EET A;  3FXR A;  4L9N A;  2W85 A;  1J7K A;  4I09 A;  3WTV C;  4ZZL A;  2DK5 A;  4CXF A;  1KU9 A;  1F4K A;  2KIF A;  2GXG A;  1HW1 A;  1X3U A;  1U3E M;  3ZN0 A;  3T8R A;  1T38 A;  4EV0 A;  4LLG F;  3HOT A;  4HZF A;  2BYV E;  5LHH A;  3I4P A;  3NEU A;  3LA3 A;  1R7J A;  2FBH A;  4DQ2 A;  3WGG A;  3ZPL A;  3OOP A;  1MKM A;  5HS7 A;  5L3B A;  1XSV A;  2RN7 A;  5CVU A;  1WSU A;  4AIH A;  5BPD A;  4KFC A;  1LB2 A;  1KU7 A;  3E3V A;  2ZFW A;  4G7H F;  1LQ1 A;  3IC7 A;  2RNJ A;  2ZJ2 A;  4A2U A;  3LAJ A;  2B0L A;  3HRM A;  2A6E F;  4PCQ A;  1GHC A;  1V4R A;  5IT3 A;  3JSO A;  1R5H A;  4GGG A;  3FF5 A;  4LFU A;  4KN4 X;  5LLQ A;  5LRR A;  1LDK B;  1UFM A;  2M30 A;  4B8X A;  1UCR A;  4PZJ A;  4RGR A;  3RYP A;  3F3X A;  5E18 F;  2A69 F;  3V7R A;  1YS6 A;  4UVC A;  4BH9 A;  3IRR A;  1ZRC A;  1K7A A;  2W57 A;  4WCG A;  1YQA A;  5KK1 A;  5L3F A;  1FBQ A;  3L00 A;  2TDX A;  4M71 A;  4E70 A;  2OZ6 A;  2D1V A;  3IWF A;  1CF7 A;  3GFI A;  2A07 F;  3BOQ A;  2P5V A;  3O6B B;  3WTU C;  5FLX Z;  3GXO A;  2GAU A;  2ZME B;  2JPC A;  1QPM A;  2XIG A;  2UWM A;  3QU3 A;  2Z99 A;  5HVQ C;  4CO8 A;  1LEA A;  3J80 K;  5K5Q A;  2HR3 A;  5D6E A;  5FGM A;  3ZMZ A;  1SD4 A;  3ABU A;  5HDG A;  2MBF A;  1KU3 A;  2FF4 A;  1PP8 F;  1YW9 A;  4U0Y A;  1IF1 A;  1MJ9 A;  1EV7 A;  2MD5 A;  2Q8K A;  2GWR A;  3R0A A;  5JR3 A;  4G94 A;  2VBX A;  1WWX A;  5DD8 A;  1XGM A;  1K78 A;  3DFG A;  4IXA A;  3B02 A;  4G6D A;  3CO7 C;  3FZV A;  1ZAO A;  1ZRF A;  4FHT A;  2CGP A;  4BYY A;  3U1D A;  5DCF A;  4P55 A;  5J6X A;  2GA1 A;  2W25 A;  3BDD A;  2YPR A;  3W6J B;  2W84 A;  1DPR A;  1EH8 A;  2VOO A;  4OIR F;  2EWN A;  4OIN F;  4I02 A;  5ILS A;  2RV8 A;  2JZY A;  4CHU A;  3D0S A;  2XKO A;  1BI0 A;  2H27 A;  3V7S A;  2WV0 A;  2IA1 A;  3KCC A;  1J2X A;  3HYI A;  1XDS A;  1ZLJ A;  4UUV A;  2VBY A;  4U0W A;  3MZY A;  2HZT A;  4Z2Y A;  2XGX A;  1WI9 A;  3GFL A;  1XGO A;  5BOX A;  4O6J A;  2V6C A;  2ETH A;  3CJN A;  2IP2 A;  2W24 A;  3BWG A;  5K1Y A;  4IVN A;  3FXU A;  2PI0 A;  3GX4 X;  5E1Z B;  4JK1 X;  4L9J A;  4UNO A;  3V8L A;  3JAM Z;  2Z3Y A;  2VOP A;  4HBL A;  1JXS A;  2OQG A;  4O5V A;  2KJC A;  1FC3 A;  4BNC A;  1CF7 B;  4R79 A;  5IT9 Z;  4MQV A;  3TQN A;  4MNU A;  3M7G A;  4HF0 A;  4NQW A;  4UHT A;  2FE3 A;  5BPI A;  4R8H A;  2PLY A;  4MEY F;  1QQI A;  3P9I A;  4UV8 A;  3SFZ A;  2RKH A;  3C1D A;  1IN6 A;  1B59 A;  2WTE A;  3J7A O;  3TO6 A;  2GA2 A;  3FMQ A;  5LBQ A;  2CWE A;  2CSO A;  4GXO A;  2MH2 A;  3JSP A;  5LHI A;  4RB3 C;  3VFZ A;  4I2O A;  3VB2 A;  2DQL A;  3DP7 A;  1FP1 D;  1LDD A;  3M8F A;  4ESB A;  1K78 B;  3QPH A;  4HLY A;  1I1G A;  4K2E A;  1I1S A;  5CLS A;  1R36 A;  1S7O A;  4YII A;  1IXC A;  3ECO A;  1UST A;  2E7W A;  3HHG A;  4LB5 A;  5K5R A;  4HF2 A;  2F5E A;  1W5T A;  4A12 A;  1G3T A;  3C18 A;  1ODD A;  1RI7 A;  4I01 A;  1B1B A;  1VTN C;  2O61 A;  4BHB A;  3ZQ7 A;  3K1P A;  3TDZ C;  1I6X A;  1ZGA A;  4ENN A;  3F8N A;  2E1C A;  3ERE D;  5ICF A;  2GQQ A;  3FHZ A;  1R1U A;  2IA0 A;  2PMH A;  2V9V A;  5A2Q Z;  3J81 K;  4RGS A;  1Z6R A;  2K27 A;  3NRV A;  1I5Z A;  3F22 A;  1R58 A;  4L18 B;  1HW5 A;  5H20 A;  1MGT A;  5AIQ A;  1BM9 A;  1LDJ A;  2ZXJ A;  2H94 A;  4I98 B;  4S05 A;  3R60 A;  1S6L A;  3FM3 A;  1ULY A;  2R3S A;  3HRS A;  3CUO A;  5E1W A;  4GO1 A;  1J5Y A;  4HX4 A;  2RVC A;  5AIP A;  3T5X A;  3I59 A;  2LSO A;  2VON A;  2KJB A;  1U78 A;  1LEB A;  3SXY A;  1C0W A;  1EH6 A;  2Z33 A;  2EFN A;  1LNW A;  5HLG A;  3FM5 A;  3G3Z A;  4LG0 A;  4I7H A;  4KMF A;  4UVA A;  2ZCW A;  5FD6 A;  5D8L B;  3DPL C;  3M1E A;  4ON0 A;  3E6C C;  1XCB A;  3GEZ A;  4KT5 C;  2V79 A;  4LLN A;  3JW4 A;  4EGY A;  5HLI A;  1YIO A;  1QGP A;  1R22 A;  4L0Z B;  2G7H A;  1K6O A;  1SFU A;  2EFQ A;  2WC2 A;  4NB5 A;  3RKW A;  4RAZ A;  3KLO A;  3T0Y A;  2M87 A;  4EJO A;  3GFJ A;  1B9M A;  2ZME A;  3CUQ A;  2G9W A;  1HKQ A;  4IHT A;  3F72 A;  4OMZ A;  1IRF A;  1G3Y A;  2PG4 A;  3RKX A;  5EEG A;  3TKY A;  4YIF A;  3OV8 A;  4M9Z A;  5E20 A;  3S2W A;  2OD5 A;  4I0A A;  4RB0 A;  1E2X A;  5FB2 A;  5HDK A;  1S3J A;  5HS8 A;  5D4S A;  2VXZ A;  4HDV A;  2M5W A;  4RB2 C;  4AWX B;  4ZZD A;  1FBS A;  4G9Y A;  3KP7 A;  3RPQ A;  5LEJ A;  2E1N A;  3MQ0 A;  3QP5 A;  4M9X A;  2DTR A;  3E6D A;  1W7P A;  4KYW A;  1U8R A;  5E8G A;  4MTE A;  4L9V A;  2G7U A;  4U88 A;  1QZY A;  3V4G A;  4P5O A;  3TGN A;  4YG2 F;  1FWZ A;  2Q2E A;  1AWC A;  2NRA C;  3F23 A;  3IKT A;  2HQR A;  1UHM A;  4M6Y A;  3I64 A;  1BIA A;  1T0F A;  2DT5 A;  1DDN A;  3GZ6 A;  3NQO A;  4ENJ A;  4G7O F;  1EH7 A;  1OYY A;  3E5U A;  2GIV A;  4LLL A;  5CYV A;  1RUN A;  5DCM B;  2XRO A;  2LF7 A;  4CZZ A;  4EQQ A;  2RQP A;  3ZMD A;  4YFN F;  3PQK A;  1BIB A;  5D5X B;  3E6B A;  1UB9 A;  1IRG A;  3BPX A;  3I59 B;  2DAO A;  2YR2 A;  3COA C;  1U6G A;  3GO5 A;  1BBY A;  3DPT A;  4LG0 B;  3WOD F;  5LGT A;  2Y48 A;  4HF1 A;  2QQB A;  3I5U A;  3GZ5 A;  1J9I A;  5ERI A;  4EM0 B;  5D4R A;  1W7P D;  3J80 Z;  1PDN C;  2IW5 A;  2HYF A;  3F8M A;  1T39 A;  1IN5 A;  3REO A;  1D8J A;  2K02 A;  2UXN A;  3ROU A;  1BN5 A;  2HQN A;  3CUQ B;  2MLK A;  5FFX A;  2P6T A;  2P5K A;  3DXJ F;  4KDP A;  2MA3 A;  4LB6 B;  2VT3 A;  1TW3 A;  3GW2 A;  4OIP F;  1P2F A;  1BI1 A;  3U2R A;  4MQ9 F;  1ZHF A;  5F64 A;  3I58 A;  3T8T A;  5BMZ A;  2OU2 A;  3WU1 B;  4IJA A;  3F8C A;  3N4M A;  2P6S A;  3CLO A;  4ZYH A;  4ASN A;  3EYY A;  2NS0 A;  4HQM A;  1ON1 A;  3BJO A;  1FZP B;  2JTV A;  5DEQ A;  3SHF A;  1W7P B;  2FML A;  3FWE A;  5FD5 A;  2R7D A;  2D45 A;  1T2K A;  2GXB A;  2STW A;  3WTY C;  3F8B A;  4PGH A;  4M6X A;  2ELH A;  2P7C B;  1FY7 A;  2COM A;  1E17 A;  1IZ1 A;  1IXR C;  1SAX A;  4KA4 A;  1HXD A;  1HKS A;  3K1N A;  1ZRD A;  3CUQ C;  1HW2 A;  1ZGJ A;  4PDK A;  2FMY A;  2M45 A;  2ZKZ A;  3EYI A;  5CVV A;  4RGU A;  2QUF A;  2XRN A;  1O7F A;  4UXN A;  1XDU A;  1Z6T A;  4A0Y A;  4ZYD A;  3FXQ A;  4AIJ A;  4GCV A;  1IN4 A;  2DK8 A;  2MLG A;  2L02 A;  2HFH A;  2X4H A;  1KU2 A;  1U2W A;  2FQ3 A;  1GXQ A;  2OBP A;  2CYY A;  1GVJ A;  1NHA A;  4HV5 A;  1KA8 A;  3TO7 A;  2L54 A;  3HTU A;  3HRU A;  2QM3 A;  4M73 A;  2ZNY A;  5FFZ A;  5L3G A;  1F9N A;  4HYE A;  4UVB A;  3WE3 A;  2XVC A;  1STZ A;  3QP6 A;  4KIC A;  2A5Y B;  2Y75 A;  4U7D A;  2XAH A;  2ZBK A;  4QWQ A;  4LK1 F;  1F1Z A;  3AAF A;  4JQF A;  1MJA A;  4YFX F;  2PN6 A;  2XAS A;  4A5M A;  2AS5 F;  1OR7 A;  3VOD A;  4P9F A;  4EJU A;  3IL2 A;  3I0T A;  1RUO A;  3GWZ A;  4OIQ F;  1YYV A;  3ECH A;  2BGC A;  4G6Q A;  3E5X A;  4BXU A;  4OOI A;  3SQN A;  5ILU A;  3MZH A;  2PFB A;  5ICC A;  1FYL A;  1REP C;  1FT9 A;  2V1X A;  2VBZ A;  3HIF A;  3HTS B;  2CFX A;  3ZMV A;  1YTY A;  3IKV A;  3Q9S A;  5F6F A;  1YS7 A;  6PAX A;  3DKW A;  1FNN A;  3KET A;  2EB7 A;  3F8F A;  4EJT A;  3ISP A;  2ISZ A;  1D5V A;  2O3F A;  4IHS A;  2EFW A;  3Q9V A;  5L3E A;  1ONV A;  4M72 A;  4LJZ F;  4ZH4 F;  3J81 Z;  2RGV A;  4U7B A;  2QVO A;  3RTR A;  2OAZ A;  1B9N A;  1S7A A;  3SZT A;  5DYM A;  4L5I A;  1P92 A;  2LNB A;  3R61 A;  1ZAR A;  2YX7 A;  2LKP A;  2FNP A;  3BY6 A;  1LJ9 A;  1ZRE A;  4P96 A;  4L5J A;  3KP3 A;  2JT1 A;  3LST A;  4IRH A;  3BP8 A;  4CYD A;  4XSZ F;  5D5W B;  4Q4Z F;  1B6A A;  3WTW C;  1XMA A;  3QPT A;  3IWZ A;  3CO6 C;  1ZLK A;  1O7L A;  5JFR A;  1XGS A;  2DW4 A;  3H3Z A;  2QBY A;  1P4X A;  4AIK A;  5KVR A;  1Z91 A;  1YFH A;  3EQL F;  3E6M A;  4IRG A;  3F6V A;  1YW7 A;  2O03 A;  2FEZ A;  3VOE A;  3GLX A;  1XGN A;  3F6O A;  3TOA A;  1BI3 A;  3WTX C;  2XUB A;  5DCM A;  2Z9O A;  2BBY A;  5DUI A;  2XAG A;  1G3W A;  1H9T A;  5DUK A;  4YFK F;  5L3C A;  2FU4 A;  1KGS A;  1R1V A;  1D8K A;  2EA4 A;  3R4K A;  3LQQ A;  2A6H F;  2DPD A;  2F5D A;  4EVI A;  2F5C A;  1OYI A;  1TTY A;  2FSW A;  5D5V B;  2DI3 A;  4IF4 A;  2IRF G;  5TJJ A;  2K7L A;  5LHG A;  3JTG A;  2J5P A;  4CGZ A;  1O57 A;  1ZG3 A;  2L4M A;  4EM2 A;  5K5O A;  2DBB A;  4KUM A;  2JRT A;  3FX3 A;  3RPU A;  4A5N A;  2P4W A;  1H9G A;  2YU3 A;  4Q5S F;  2MC3 A;  1WQ2 A;  5E1X A;  1KQ9 A;  1YG2 A;  1V3F A;  4BAY A;  1TBX A;  4A0Z A;  1FOK A;  1SD5 A;  1Z9C A;  2OQR A;  4OMY A;  3BZ6 A;  1HSJ A;  1GXP A;  2QEN A;  3W6K B;  4Y13 A;  3QOP A;  1ZN2 A;  2A68 F;  3HUG A;  1PUE E;  3I53 A;  1ZG1 A;  1SFX A;  3QAH A;  1R5G A;  4N0B A;  2L3D A;  1PP7 U;  4HAM A;  4WXD A;  1FYM A;  3V8K A;  5AON A;  3ML6 A;  3WTZ A;  4BHC A;  2K4J A;  3KE2 A;  1IW7 F;  2Q0O A;  4FT8 A;  1FBU A;  3ELK A;  3O3K A;  1R00 A;  4UV9 A;  1XB4 A;  3EUH A;  5CVI A;  3QRF F;  2VOD A;  1RZ4 A;  1UHW A;  1G4D A;  5HDN A;  3KP4 A;  3HSE A;  1Y0U A;  1ZG5 A;  3BPV A;  5HLH A;  4XLN F;  2HOE A;  1TQM A;  4U0V A;  5HS9 A;  3IRQ A;  1FP2 A;  5ILV A;  2KIM A;  2CO5 A;  1ON2 A;  1O3T A;  1IN7 A;  2PQ8 A;  5D8K B;  2HKX A;  4ESJ A;  4HV6 A;  1Z1D A;  1TLH B;  4NHJ A;  3WTT C;  3H92 A;  3ZN1 A;  3B73 A;  4Q48 A;  4CIC A;  3DQV C;  1JGS A;  1IAW A;  5D6F A;  1O3S A;  2JSC A;  2D1H A;  4GYG A;  1DP7 P;  1YLF A;  2QBY B;  2A61 A;  4AVP A;  1HQC A;  1BC8 C;  4LGW A;  3ZMU A;  4EM1 A;  4ENM A;  4L9T A;  5BQT A;  2XHK A;  2YSR A;  3KEQ A;  3D5L A;  1Z7U A;  2K4B A;  3QU6 A;  4WWC A;  2XAJ A;  3GYH X;  3L2C A;  3P9C A;  2HYG D;  5JI6 A;  2D2W A;  3R0J A;  2P5L C;  1L0O C;  2EV6 A;  2VE8 A;  4WXH A;  2ISY A;  1O3R A;  2CQK A;  2NNY A;  2ESH A;  4HW0 A;  4R1H A;  4CDG A;  2HEO A;  4O3M A;  2MH9 A;  4KIF A;  1FSE A;  1XCV A;  1HBX G;  1OYW A;  2P7V B;  5ED4 A;  2ACJ A;  1YW8 A;  4BHP A;  4S04 A;  2XV4 S;  2FBI A;  3K2Z A;  2FRH A;  2EK5 A;  3KFW X;  2EFP A;  4RB1 A;  3WGI A;  4IPA A;  2P8T A;  3PFI A;  1U5T A;  3ABT A;  5H6Q A;  3R6S A;  1BI2 A;  1SMT A;  4EJW A;  2UXX A;  1FX7 A;  4M74 A;  2JPB A;  2L4A A;  4WXC A;  2VE9 A;  2C6Y A;  4MHG A;  3G73 A;  2DLL A;  2CW0 F;  1WKM A;  2LF8 A;  1WRJ A;  2EA2 A;  1IN8 A;  4MEX F;  2BE5 F;  1FYK A;  3MEX A;  4BQA A;  1BC7 C;  1K79 A;  2Y0M A;  1TNT A;  4N9H A;  1W4M A;  2J5O A;  4ZYG A;  3BRO A;  2O0Y A;  2PJP A;  1R23 A;  2QQ9 A;  3MWM A;  1TQP A;  3RI4 A;  2BEO A;  4DNC A;  2FNA A;  2DQR A;  1MDM A;  3ULQ B;  2RC4 A;  2XKP A;  1CGP A;  4HX8 A;  1T6S A;  4G7Z F;  1H0M A;  2L01 A;  4B09 A;  4A0X A;  4FX4 A;  1ZH5 A;  4HOB A;  2DU9 A;  2EFO A;  2PEX A;  4KN7 X;  5EEH A;  3BJA A;  1AOY A;  2IVM A;  1L3L A;  3C3W A;  1ZYR F;  5ICG A;  2A3S A;  2R7F A;  3K69 A;  4ETS A;  3GF2 A;  4HA8 A;  3LAP A;  4MGR A;  5FLX K;  5CJ9 A;  2HS5 A;  3JTH A;  5JHU A;  2ADU A;  4EJV A;  3WTS C;  4Y15 A;  4LD5 A;  4XLP F;  2LDU A;  1R1T A;  3KP6 A;  2QQA A;  2FA5 A;  1USS A;  2O8X A;  2BV6 A;  3LA2 A;  3T1B A;  2NNN A;  2HDC A;  5H6R A;  5DD4 A;  1FLI A;  3GFM A;  1XSX A;  1G6N A;  2E7X A;  2IPQ X;  4KIB A;  4WF2 A;  1KQ0 A;  3GUD A;  1DUX C;  3O2P E;  4H0E A;  1OKR A;  2UZK A;  3LQR A;  3U9G A;  3MAJ A;  5DV5 A;  2FOK A;  2NYX A;  3KZZ A;  2HWV A;  4FX0 A;  1JHF A;  3WE2 A;  4LK0 F;  1OMI A;  1W5S A;  3RIR A;  2IJL A;  3BJ6 A;  3LWF A;  2PBI A;  1J0R A;  1U5T B;  5DDG A;  3ZMS A;  3RJP A;  3P7N A;  3V7C A;  3L09 A;  2WWY A;  3SZP A; 
#chains in the Genus database with same CATH topology
 4KIG A;  3RYR A;  3FK7 A;  1S29 A;  5E17 F;  2H09 A;  3K4K A;  4M9S A;  3CME I;  1DU0 A;  1QO0 D;  3KLN A;  1QPI A;  2HVS A;  2W4S A;  4G8X A;  2VPL A;  3IHU A;  1VQ7 I;  3LA7 A;  2EJR A;  3H3U A;  5CVJ A;  3M8E A;  4E7H A;  2LMD A;  2DFI A;  1N78 A;  4IRI A;  4A3B J;  3S2D J;  3RKY A;  5CQE A;  1B4A A;  3KIO A;  1J75 A;  1IXS B;  1K83 J;  1MD0 A;  2EZK A;  2BHZ A;  4GRI A;  1Q1H A;  4HLX A;  3N97 A;  1RR8 C;  1DGR M;  2XF7 A;  3HEF A;  4S0H B;  2V1D A;  4C2M J;  1MDM B;  1WJ5 A;  1XTA A;  2V7F A;  2WB1 N;  3KYD B;  2ESN A;  2EV5 A;  5EJC A;  1KYW A;  2VC1 A;  3CDH A;  4LMY A;  3WG9 A;  1TQI A;  4Q47 A;  2HKO A;  4XSX F;  5F0C A;  5J8C A;  4B4C A;  2NAZ A;  1P7J A;  2RDP A;  3WHB A;  3HSR A;  1FOX A;  3HOS A;  2LY9 A;  1MMS A;  3ZGK A;  4HQE A;  4MTD A;  4QIW N;  1SMY F;  4KNY A;  3JAM K;  4E7J A;  3CTA A;  3BTI A;  4HX7 A;  3TDU C;  5FO5 A;  4D5F A;  4PGG A;  3UNG C;  3N05 A;  4CZC A;  5GTH C;  2O6G E;  2F6C A;  2EIJ H;  3FHN A;  4Y52 J;  4Y3O A;  2JA6 J;  3TP0 A;  4RLQ A;  2KRF A;  3SFI A;  4A3J J;  1WJC A;  2VC0 A;  2K9Q A;  2PMZ A;  3M8J A;  4XRF A;  2CJJ A;  2X1E A;  4C2T A;  5IT9 K;  3SZG A;  2VT2 A;  5FKM A;  3M9A A;  2DT6 A;  3G4S I;  1JE8 A;  1U5T C;  2EZL A;  2HQA A;  2Z5U A;  5IYB J;  2F5F A;  2E2J J;  3HRT A;  1HKT A;  2V1U A;  4TV7 A;  3L2V A;  2R5Z A;  3I3L A;  2QWW A;  3EUA A;  4QLC U;  4P9U A;  4DBR A;  3ZP5 A;  3TMO A;  1VQ5 I;  4JX5 A;  3PQJ A;  3L9F A;  3CCY A;  5TRD A;  4QTR A;  1TWC J;  1YO5 C;  2M8E A;  2PMU A;  2XRL A;  5LRS A;  3CCM I;  3P9K A;  1SFE A;  2RNG A;  3I4M J;  2R4G A;  2CQ7 A;  2EIL H;  1F5T A;  2JA2 A;  2HVQ A;  1QZE A;  3JRC A;  3EDP A;  2QZ8 A;  2CG4 A;  3L7W A;  2EV0 A;  1MZB A;  2F2E A;  3CJR B;  4Y17 A;  4UUS A;  2YUS A;  1QNT A;  4GDF A;  2DJI A;  4ENK A;  1BJA A;  2CFO A;  3FKJ A;  3WU0 A;  3OYH A;  3BR0 A;  5DM6 F;  1TWH J;  1KQ8 A;  2XGE A;  1RC9 A;  1I39 A;  1O3Q A;  4ANJ A;  4IO9 F;  1JKO C;  4XBF A;  4WK8 F;  1X2N A;  5D5U B;  2X0L A;  3AG4 H;  3NAU A;  3VEP A;  2M7A A;  3GTP J;  4ESF A;  1OPC A;  1ACI A;  3HSF A;  4LG3 A;  2R93 J;  2M8G X;  5E8I A;  1YOV B;  1PJR A;  4Z6Y A;  3BZK A;  4XKW A;  2DPU A;  2YX4 A;  3H9J A;  1MJB A;  3AL0 C;  2ZXH A;  3KP2 A;  1T98 A;  4D0P A;  1XMX A;  4OU0 A;  1KYZ A;  5L3D A;  2ZO4 A;  2AXL A;  5ICE A;  3ZMT A;  2OZU A;  3MFK A;  2XAQ A;  3BTC A;  3K0L A;  1YHQ I;  2F4M B;  3LFU A;  1QZZ A;  4XOT A;  3PIP F;  1XSD A;  4ZYE A;  4I0B A;  5LEK A;  2VN2 A;  3DEW A;  4A6D A;  3FMR A;  2HXI A;  1R4N B;  3SDG A;  1TW2 A;  1P4A A;  3GVA A;  5JVG F;  4WX9 A;  1X2M A;  4II2 A;  1N77 A;  1K61 A;  4NC8 A;  3P5J A;  2I5U A;  2O9L A;  1ZK8 A;  3RDI A;  3W3C A;  1MH4 A;  5HOO A;  4E7I A;  2H6B A;  2CS3 A;  2RAE A;  4NBQ A;  5A2Q K;  4F7Z A;  1TWF J;  3DV8 A;  4L0Y B;  2IA2 A;  4HDU A;  2W82 A;  3G6E I;  3BTL A;  1G3S A;  4PSX A;  3LOC A;  3KZY A;  1P4W A;  1JT0 A;  4GYI A;  2K9M A;  1SD7 A;  2HXO A;  2VBW A;  3TO9 A;  2NS8 A;  3CQZ J;  3J7Y J;  1RNL A;  2HGC A;  4AD9 A;  1QU3 A;  1E3H A;  3BLY A;  3F9K A;  1HST A;  3GLL A;  2HNH A;  4RGX A;  4RS8 A;  2R7Q A;  2KIU A;  4RAY A;  2M3A A;  1D1C A;  2LFB A;  3FMS A;  2MW8 A;  2VKD A;  2E34 A;  1XD7 A;  3V42 A;  1A04 A;  3RQI A;  1OQY A;  2QYO A;  3E5Q A;  4XOP A;  3E97 A;  3S14 J;  3V8J A;  3F21 A;  1WH7 A;  2GZW A;  4EGZ A;  3KEO A;  1XN7 A;  3LFK A;  2DO7 A;  4A6E A;  5GAG J;  3TOB A;  3OYC A;  3CCJ I;  3AG2 H;  3HGG A;  3OYG A;  1JHH A;  1Z05 A;  1QVU A;  1IUY A;  3I54 A;  2XAF A;  2N8G A;  1OCP A;  3K4C A;  2D5V A;  1UHS A;  1P6R A;  4KIT B;  3MCZ A;  1YI2 I;  2HTS A;  2HVR A;  3C7J A;  1E3P A;  1I27 A;  2VL8 A;  3WGH A;  5TGT A;  2HTJ A;  4LIT A;  3QPL A;  2UV1 A;  3GZN B;  4C3J J;  5BS6 A;  2OA4 A;  4W1U A;  1FSH A;  3OYJ A;  3HHH A;  2IEK A;  2K86 A;  1U8B A;  2STT A;  3I71 A;  3DEU A;  1SEU A;  3DF8 A;  4EMS A;  2HI3 A;  1JUM A;  3A0B C;  3DU6 A;  5KAF C;  3Q5F A;  1RIO H;  2IT0 A;  4OIO F;  3RQ4 A;  3KP5 A;  1VFC A;  4B3X A;  1Z67 A;  5EZG A;  4KMU X;  1QBJ A;  1XMK A;  5F1R A;  1BOA A;  2R5Z B;  5M3F J;  1SD6 A;  2QF7 A;  2KKO A;  1D3Y A;  3BR3 A;  1LVA A;  2CQX A;  1S8N A;  5J8F A;  4D9J A;  1OIS A;  5LGU A;  3K1M A;  5JVT A;  2M1B A;  5CVR A;  2QLZ A;  5LGN A;  1DPU A;  2H6C A;  4N9I A;  2FXA A;  1FPQ A;  2FBK A;  4ZDL A;  1OJL A;  1P7I A;  2OJE D;  2IXS A;  3K9T A;  4XRS A;  2DT7 B;  2ZNZ A;  4JBA A;  1TNS A;  2JA7 J;  3S1M J;  4XLC A;  3LSJ A;  1J59 A;  3EET A;  3FXR A;  4L9N A;  2W85 A;  3BQZ A;  3DKY A;  4XQF A;  2KZG A;  4UUS B;  1LVK A;  2QCO A;  1J7K A;  1B8I A;  4I09 A;  3WTV C;  3Q0W A;  4ZZL A;  2DK5 A;  1S5L C;  4CXF A;  1KU9 A;  2KPM A;  1F4K A;  2Y0S A;  2KIF A;  2M4K A;  2GXG A;  4PJ0 C;  3ZR8 X;  1HW1 A;  1X3U A;  1U3E M;  3ZN0 A;  3T8R A;  1VQ4 I;  5C44 J;  1T38 A;  4EV0 A;  4LLG F;  1IJW C;  3HOT A;  4F52 A;  5LD2 C;  3HL2 A;  4HZF A;  2B9S A;  1RPW A;  2BYV E;  5LHH A;  4CCL A;  2KZV A;  2NVY J;  3I4P A;  1T95 A;  1ETQ A;  4UB6 C;  3NEU A;  3LA3 A;  1R7J A;  2FBH A;  4DQ2 A;  3WGG A;  3ZPL A;  4AC0 A;  4ZTF A;  1LFP A;  2G0E A;  3OOP A;  1JI8 A;  1MKM A;  2GBY A;  5HS7 A;  5L3B A;  1XSV A;  2K9N A;  4V19 K;  2RN7 A;  1FMW A;  2VJ5 A;  2PJR A;  3RCO A;  2XPU A;  4D7M A;  5CVU A;  1WSU A;  4A3G J;  4AIH A;  5B3S H;  5BPD A;  4KFC A;  1SAU A;  3HOX J;  4AU7 A;  4DZJ A;  1LB2 A;  1KU7 A;  2R7O A;  5CPR B;  3E3V A;  2ZFW A;  4JYK A;  5K7Z A;  4X0G A;  2ZJR F;  4G7H F;  1I3Q J;  1XG1 A;  1EF4 A;  1LQ1 A;  3IC7 A;  2UUZ A;  2RNJ A;  2ZJ2 A;  4A2U A;  4F3Q A;  3LAJ A;  2B0L A;  3HRM A;  1TL8 A;  1LFU P;  2ID3 A;  3E1S A;  1Y56 A;  2A6E F;  3CJT B;  4PCQ A;  1GHC A;  4C9Y A;  2OCE A;  3TP3 A;  1V4R A;  5IT3 A;  3JSO A;  1R5H A;  4GGG A;  3FF5 A;  2FOW A;  4BEH A;  4LFU A;  4KN4 X;  3ASN H;  3PO3 J;  5LLQ A;  5F27 A;  5LRR A;  3ABM H;  2V6E A;  3H5R A;  2OPT A;  4IHV A;  2AXT C;  1LDK B;  2MYS A;  2WB1 A;  1QA6 A;  1UFM A;  2DMN A;  2M30 A;  3M3Y J;  4G6T B;  4B8X A;  4XID A;  3K7A J;  4XM3 A;  4PFO A;  2HPM A;  3FXJ A;  2VJ4 A;  5K7F A;  4FIS A;  1UCR A;  4PZJ A;  4RGR A;  3RYP A;  1FOY A;  5E3L A;  3F3X A;  5BNG A;  1WCM J;  3A1Y A;  1IDY A;  2VJI A;  5E18 F;  1MSE C;  2A69 F;  3V7R A;  1YS6 A;  4UVC A;  1D1B A;  4BH9 A;  3IRR A;  5IPA A;  3HOZ J;  3E7L A;  5JLW A;  1ZRC A;  1K7A A;  1VQK I;  2W57 A;  4WCG A;  1JGG A;  1YQA A;  2BY1 A;  3UR3 C;  5KK1 A;  1WJF A;  2L2O A;  5L3F A;  1FBQ A;  3L00 A;  2TDX A;  3FXM A;  4M71 A;  1RR7 A;  4NDL A;  4E70 A;  3L2W A;  2OZ6 A;  2JUG A;  4HSR A;  3KYC B;  1RET A;  2D1V A;  2KP6 A;  3IWF A;  4ABZ A;  4RBO A;  3GFI A;  4I6Z A;  1CF7 A;  2A07 F;  2KHM A;  3BOQ A;  2P5V A;  5HLT A;  2VKH A;  3MVP A;  3O6B B;  3WTU C;  5FLX Z;  3OYA A;  1RKW A;  2GAU A;  3GXO A;  1BOB A;  1H89 C;  2ZME B;  2JPC A;  1QPM A;  2QSH X;  2XIG A;  2VKE A;  3ZOB A;  5F0F A;  1I50 J;  2LYC A;  2UWM A;  2VIX A;  1T33 A;  2ZB9 A;  2LP0 A;  1ZQ3 P;  3QU3 A;  2Z99 A;  5HVQ C;  4CO8 A;  2CUJ A;  1LEA A;  5DS9 A;  1YJN I;  3J80 K;  5K5Q A;  2HR3 A;  5D6E A;  2LR8 A;  5FGM A;  4PSW A;  3HJE A;  3JRB A;  3CCL I;  3ZMZ A;  3D5R C;  1SD4 A;  3O8H A;  1FTT A;  3K4M A;  3L2Q A;  2X9D A;  3ABU A;  3OWT A;  4JOM A;  4CCO A;  4NC7 A;  3QQA A;  5HDG A;  2MBF A;  1KU3 A;  2FF4 A;  3AG1 H;  3LSK A;  1IC8 A;  4N4O B;  3K4J A;  3SEZ A;  1B72 A;  1PP8 F;  2DFE A;  1YW9 A;  3IH2 A;  4U0Y A;  1IF1 A;  1MJ9 A;  1EV7 A;  2MD5 A;  1UZC A;  3DKX A;  3VYR B;  2Q8K A;  2GWR A;  3R0A A;  3TED A;  2JA5 J;  2A6T A;  5JR3 A;  1MIJ A;  4G94 A;  2VBX A;  1WWX A;  3FXO A;  1XGM A;  5DD8 A;  1K78 A;  3DFG A;  4IXA A;  4HNU A;  2CV1 A;  4LIU A;  3B02 A;  4G6D A;  3CO7 C;  3KYL A;  3OYE A;  4MFE A;  1I6H J;  3FZV A;  3MD2 A;  1ZAO A;  1ZRF A;  4FHT A;  2CGP A;  4BYY A;  3U1D A;  5DCF A;  4P55 A;  4V2G A;  5J6X A;  3GTM J;  2GA1 A;  2W25 A;  3BDD A;  3BZC A;  2YPR A;  3W6J B;  2W84 A;  1DPR A;  1EH8 A;  3BT9 A;  3C2B A;  2VOO A;  3Q0V A;  4OIR F;  2EWN A;  1OCC H;  2QKM B;  4OIN F;  3TW7 A;  2R7U A;  4I02 A;  1V55 H;  5ILS A;  1JKQ C;  5IP9 J;  2HOT A;  1MMD A;  5CQG A;  2RV8 A;  2JZY A;  3A4C A;  2PJR B;  5IP7 J;  4UY8 I;  4CHU A;  4Y4R A;  3D0S A;  2XKO A;  4PJJ A;  1BI0 A;  2DMP A;  2H27 A;  1VQ8 I;  3V7S A;  2OCC H;  4MFD A;  1A31 A;  2WV0 A;  2IA1 A;  3LMM A;  3CDI A;  3HG9 A;  3KCC A;  1J2X A;  3HYI A;  1ZEL A;  1XDS A;  1ZLJ A;  3MN2 A;  4UUV A;  1AHD P;  1BR4 A;  2ECC A;  2VBY A;  2R7S A;  4U0W A;  3MZY A;  3PIO F;  5CKT A;  2HZT A;  1NTC A;  2ELK A;  5FJ8 J;  1E0E A;  1PVE A;  3DCF A;  4Z2Y A;  2TCT A;  1PUF A;  2XGX A;  1WI9 A;  3L2U A;  4BEH B;  3GFL A;  1A5J A;  1XGO A;  4KJZ A;  5BOX A;  2ICW G;  4O6J A;  1P9Q C;  2V6C A;  2ETH A;  3CJN A;  2IP2 A;  3DBR B;  5J40 A;  2LY2 A;  2W24 A;  3W2V A;  3BWG A;  5K1Y A;  2LY1 A;  4IVN A;  3FXU A;  3BR6 A;  5J1U A;  2PI0 A;  3GX4 X;  5E1Z B;  5IYD J;  4JK1 X;  2VQG A;  3HKZ A;  3OYK A;  1FOW A;  2XDV A;  4L9J A;  4F91 B;  4HNT A;  3MKY B;  4U87 A;  4UNO A;  2AHQ A;  3PUF A;  4XK4 A;  5HNH A;  3V8L A;  3JAM Z;  2Z3Y A;  2XB5 A;  1RRJ A;  1MBH A;  3L1P A;  2VOP A;  1R5I D;  2IGO A;  2MFZ A;  5HOD A;  2AQF A;  4DOZ A;  1GDT A;  4HBL A;  1JXS A;  5EGO B;  1FIA A;  2OQG A;  4O5V A;  3QYE A;  2KJC A;  1FC3 A;  3H3V K;  4JX4 A;  4BNC A;  1CF7 B;  4R79 A;  2VUM J;  5IT9 Z;  4MQV A;  3TQN A;  4MNU A;  3HOU J;  3M7G A;  2R5Y A;  5EEA A;  1NK3 P;  4HF0 A;  2X1C A;  3H36 A;  4NQW A;  4UHT A;  2FE3 A;  2E5Z A;  4NC6 A;  1DGW Y;  3H0D A;  2R7R A;  2X6O A;  4XN3 A;  4IOC F;  3CCR I;  5TIS C;  5BPI A;  4R8H A;  4D7N A;  2PLY A;  1SVO A;  1QQI A;  4MEY F;  2R7V A;  3P9I A;  4UV8 A;  2XGD A;  4AVZ A;  2HU9 A;  1VND A;  2JRM A;  3SFZ A;  2RKH A;  3C1D A;  3KZI C;  3SEQ A;  3OR1 C;  1IN6 A;  1B59 A;  3ZQH A;  2XAU A;  2WTE A;  3J7A O;  3TO6 A;  1VQ6 I;  1JUS A;  2GA2 A;  3FMQ A;  4DIQ A;  5LBQ A;  2CWE A;  4FE4 A;  2EBI A;  4AUX A;  2CSO A;  3RZD J;  4E7K A;  4GXO A;  4ZDP A;  1JTY A;  2E19 A;  2MH2 A;  1T08 B;  3JSP A;  4IOA F;  5LHI A;  3JRA A;  4RB3 C;  3WU2 C;  1LE8 A;  3VFZ A;  4I2O A;  2LH9 A;  2X48 A;  3VB2 A;  1WVR A;  1X3Z B;  1B72 B;  3G71 I;  2DQL A;  2X51 A;  1Y39 A;  3DP7 A;  4IKF A;  1FP1 D;  3OL4 A;  1R4M B;  1LDD A;  4AID A;  4IQ4 A;  2X1D A;  2DOA A;  3M8F A;  4ESB A;  1Z3Y A;  2E60 A;  1K78 B;  5F0H A;  3QPH A;  2DA7 A;  4BQO A;  4HLY A;  1I1G A;  4K2E A;  1I1S A;  5CLS A;  1R36 A;  1JKP C;  3DBH B;  2VQH A;  1RKT A;  1S7O A;  4YII A;  3LSR A;  1IXC A;  3ECO A;  3OR2 C;  1UST A;  2E7W A;  3HHG A;  1BJZ A;  4LB5 A;  3BG5 A;  5K5R A;  5M3M J;  2F5E A;  3L2R A;  1VQM I;  4HF2 A;  1W5T A;  1MBJ A;  4EEF G;  3KEY A;  4A12 A;  1G3T A;  3ZXS A;  3C18 A;  1ODD A;  4KT6 A;  2Y31 A;  4BE0 A;  1RI7 A;  2F4I A;  4I01 A;  5IP6 A;  1B1B A;  1Y8Q B;  1VTN C;  2O61 A;  1WFX A;  4BHB A;  1POG A;  3ZQ7 A;  4BL0 B;  1D0Z A;  3FXL A;  3K1P A;  3TDZ C;  3JRG A;  1I6X A;  1DU6 A;  1U9O A;  1X58 A;  4RAG A;  2LD5 A;  2GLO A;  1A36 A;  4II3 A;  1ZGA A;  1YJ9 I;  4ENN A;  3F8N A;  5GP9 A;  2E1C A;  3ERE D;  5ICF A;  1N25 A;  2GQQ A;  2E71 A;  3FHZ A;  4B1R A;  1R1U A;  2IA0 A;  2PMH A;  2V9V A;  5A2Q Z;  3J81 K;  3KPH A;  3K4N A;  3GTQ J;  4RGS A;  1Z6R A;  4I76 A;  2K27 A;  2L0K A;  1JJ6 C;  1S7E A;  3NRV A;  1I5Z A;  1MMN A;  3F22 A;  1Z7L A;  2R0Q C;  1R58 A;  4L18 B;  3DBL B;  2RRE A;  1HW5 A;  5H20 A;  3WG7 H;  1PUF B;  4RAF A;  3H9G A;  1MGT A;  3S3M A;  5AIQ A;  1BM9 A;  3S15 J;  2Y69 H;  4RMN A;  1LDJ A;  2ZXJ A;  4BQQ A;  3CP8 A;  4CUG A;  2H94 A;  4I98 B;  4S05 A;  3R60 A;  1S6L A;  3FM3 A;  1ULY A;  2FJ1 A;  2JMW A;  2R3S A;  3HRS A;  3CUO A;  5E1W A;  1MH3 A;  2ID6 A;  4GO1 A;  1J5Y A;  4HX4 A;  4XRS G;  2H1L A;  2RVC A;  3EPZ A;  5AIP A;  4I99 C;  1X1D A;  3T5X A;  1GVD A;  3G2B A;  3I59 A;  2LSO A;  2WWY A;  2VON A;  2IS6 A;  1UG2 A;  4A3F J;  2KJB A;  1U78 A;  1LEB A;  1TT5 B;  3SXY A;  1C0W A;  3HZJ A;  4OAZ A;  1EH6 A;  3FBI B;  4XL9 A;  3I56 I;  2YU9 J;  3HC7 A;  2Z33 A;  3OYL A;  5DM7 F;  2EFN A;  1YRN B;  1LNW A;  5HLG A;  3A2K A;  3FM5 A;  3G3Z A;  4LG0 A;  4I7H A;  2CV2 A;  3GTJ J;  1UMQ A;  4KMF A;  2E1M B;  4UVA A;  4AM3 A;  4M3G A;  2ZCW A;  1TC3 C;  5FD6 A;  3CLQ A;  2R5Y B;  4RLF A;  3OYN A;  1Y1V J;  4NQW B;  5D8L B;  3DPL C;  3M1E A;  3OYF A;  3G1M A;  3A01 A;  5FRM A;  4ON0 A;  3E6C C;  3DTK A;  1XCB A;  3GEZ A;  2VI6 A;  4KT5 C;  2V79 A;  4LLN A;  4BKX A;  3JW4 A;  5IYC J;  5HLI A;  4EGY A;  1YIO A;  1O4X A;  1QGP A;  1R22 A;  2LG4 A;  4L0Z B;  5E3O A;  2A05 A;  3X2Q H;  3PSI A;  1IO2 A;  2G7H A;  2GOM A;  1K6O A;  3JRE A;  2BVL A;  2BY2 A;  3H0G J;  1SFU A;  1NG7 A;  2EFQ A;  4MLO A;  2WC2 A;  4NB5 A;  2W00 A;  3RKW A;  4RAZ A;  3KLO A;  3T0Y A;  2M87 A;  1SVL A;  2JWT A;  3NWT A;  4QPO A;  4YEJ A;  3S93 A;  3TW6 A;  4EJO A;  3J7A Y;  3GFJ A;  1A35 A;  5F04 A;  1LE8 B;  1B9M A;  2ZME A;  3CES A;  1V5G A;  3CUQ A;  2G9W A;  3HBL A;  2ME6 A;  4BDZ A;  4PK4 A;  1HKQ A;  4QSH A;  3BTJ A;  4IHT A;  5GPA A;  3F72 A;  4OMZ A;  1IRF A;  1MSF C;  4BDY A;  1G3Y A;  3ZQF A;  2PG4 A;  4OAY A;  3RKX A;  2VKV A;  1UG0 A;  3C2G A;  5EEG A;  3CZ6 A;  1K4T A;  3TKY A;  2ZJQ F;  4YIF A;  3OV8 A;  2ZXW H;  4M9Z A;  5E20 A;  2DMU A;  3S2W A;  3S1R J;  2OD5 A;  5GAE J;  3ZRG A;  4I0A A;  4RB0 A;  4M3E A;  1MND A;  1FIP A;  2L7F P;  1XX5 A;  1E2X A;  4ZC3 A;  1R49 A;  5FB2 A;  1QHH D;  5HDK A;  1S3J A;  3FK6 A;  5D4S A;  5HS8 A;  1SFO J;  2L7Z A;  2VXZ A;  1HDP A;  2F5V A;  4HDV A;  3HXL A;  4PJM A;  2M5W A;  5KCM A;  4RB2 C;  3D1N I;  2DA2 A;  2E36 A;  2R7Z J;  3PJR A;  2E1M C;  1V54 H;  4AWX B;  4ZZD A;  1FBS A;  4G9Y A;  3ZQL A;  3KP7 A;  3RPQ A;  5LEJ A;  2E1N A;  4Y7N J;  1KZH A;  1GV5 A;  3IAS 2;  3VYU B;  3MQ0 A;  1ZGW A;  3QP5 A;  3A02 A;  4M9X A;  2DTR A;  1TWG J;  2DA5 A;  1W7P A;  3E6D A;  5IOY A;  1D5Y A;  4KYW A;  3BG7 A;  4BJ6 C;  3RPU D;  1U8R A;  3MMY B;  2K3P A;  5E8G A;  3E0J B;  4MTE A;  1IRZ A;  2BXZ A;  4L9V A;  1T8I A;  2G7U A;  4U88 A;  1QZY A;  1X4P A;  2KT0 A;  3V4G A;  4CCK A;  1VI0 A;  2ZSI B;  4P5O A;  3TGN A;  4YG2 F;  1JUP A;  2JVH A;  2KQR A;  1FWZ A;  1HLV A;  2Q2E A;  1AWC A;  2NRA C;  2DDB A;  3F23 A;  3QWL A;  3IKT A;  2XPW A;  2HQR A;  1UHM A;  2MAB A;  3B6C A;  3M07 A;  4M6Y A;  3I64 A;  4QPQ A;  1WHU A;  1RES A;  1BIA A;  1T0F A;  2DT5 A;  5FKK A;  1DDN A;  3GZ6 A;  1ORK A;  3K2A A;  3NQO A;  4ENJ A;  4G7O F;  1EH7 A;  1OYY A;  3CC2 I;  3E5U A;  2CUE A;  2GIV A;  2X6X A;  5GPC A;  3Q0U A;  4LLL A;  5CYV A;  1RUN A;  5DCM B;  2XRO A;  3OYM A;  2LF7 A;  3ZQI A;  4CZZ A;  4ZJZ A;  4EQQ A;  2LOO A;  1G59 A;  3S2H J;  4N4N B;  3K70 D;  2CW8 A;  2RQP A;  4C30 A;  2K85 A;  1YJW I;  2OF7 A;  3ZMD A;  3PNT A;  4YFN F;  3PQK A;  4CSW A;  1BIB A;  5D5X B;  5B1A H;  3E6B A;  1ZR4 A;  1UB9 A;  1AKH A;  1IRG A;  3BPX A;  3I59 B;  4F92 B;  2DAO A;  1VF9 A;  2YR2 A;  3COA C;  1U6G A;  3GO5 A;  3LSI A;  5KNL A;  1ETW A;  3HPG A;  3S1N J;  1BBY A;  1SAN A;  1VQO I;  2Y2Z A;  2L9R A;  1E3O C;  1R71 A;  2QEX I;  1Z21 A;  2EH3 A;  3BC8 A;  3DPT A;  4LG0 B;  2L7M P;  1MBG A;  3WOD F;  1NK2 P;  5LGT A;  2Y48 A;  4E7Z A;  4HF1 A;  2CUF A;  3CMM A;  4FET A;  3G1L A;  2QQB A;  3S3N A;  2P81 A;  3I5U A;  3GZ5 A;  3A01 B;  3BG9 A;  1J9I A;  5ERI A;  4EM0 B;  1U9N A;  3ONQ A;  5D4R A;  1W7P D;  3VYT B;  3PSF A;  3J80 Z;  1PDN C;  2IW5 A;  3ABL H;  2HYF A;  3F8M A;  2LTP A;  1T39 A;  1IN5 A;  2K9L A;  4HG2 A;  4DJA A;  5E3M A;  3REO A;  2BZT A;  1D8J A;  2K02 A;  3ESW B;  2CRG A;  3MKZ A;  4AYB N;  2IBD A;  4YIR X;  2IS4 A;  1D0X A;  5M5W J;  1ETO A;  5KHD A;  5EGO A;  3HUG B;  1XPX A;  2UXN A;  2VJJ A;  3ROU A;  4C2U A;  2VQL A;  1BN5 A;  5GAD J;  2R7T A;  1EKE A;  2EIM H;  2OUM A;  2HQN A;  3IAM 2;  3CUQ B;  1Y0N A;  4DGW B;  1SVM A;  2L5Q A;  4E4H A;  2MLK A;  2XF5 A;  5GAH J;  2NVQ J;  1G8X A;  5FFX A;  2P6T A;  1HC8 A;  2L9N A;  2QSF X;  4XKC A;  3NAR A;  2GOX B;  2W7N A;  1PYV A;  2P5K A;  3DXJ F;  4KDP A;  2MA3 A;  4LB6 B;  2HDD A;  2KLO A;  2VT3 A;  1TW3 A;  3GW2 A;  4OIP F;  1P2F A;  2OC6 A;  3H5N A;  3OS0 A;  1BR2 A;  1BI1 A;  3WHC A;  4HEA 2;  1NG6 A;  3U2R A;  4MQ9 F;  1ZHF A;  5F64 A;  3I58 A;  2KIQ A;  3T8T A;  5BMZ A;  2OU2 A;  3WU1 B;  3K6G A;  3F8C A;  4IJA A;  3N4M A;  1BA5 A;  2DA4 A;  2P6S A;  4XRM A;  2L9S A;  3BR5 A;  3CLO A;  3GTK J;  3OSF A;  3GME A;  4D5C A;  4DYC A;  4ZYH A;  2WY7 Q;  4ASN A;  3EYY A;  4OWR B;  2I8D A;  3FIW A;  2M0C A;  2XSJ C;  2NS0 A;  2CMP A;  4HQM A;  2LBF A;  1A6I A;  1ON1 A;  3BJO A;  1FZP B;  1K6Y A;  2DMT A;  2JTV A;  5DEQ A;  3SHF A;  4DBQ A;  2E2H J;  1W7P B;  2FML A;  1JTX A;  1QVT A;  1DQU A;  2AQE A;  3FWE A;  3OS1 A;  3UKG A;  3DEE A;  5FD5 A;  3ZQC A;  5EYR A;  2R7D A;  4M3B A;  3GBG A;  2KIS A;  3CF2 A;  2D45 A;  2ME0 A;  3HOY J;  2WAQ N;  1T2K A;  4BAC A;  4PUS A;  2GXB A;  2STW A;  3WTY C;  3F8B A;  4BE2 A;  4M3D A;  4PGH A;  2Q2E B;  5DTD A;  1WH5 A;  3EUK L;  1Z0X A;  2HOA A;  4M6X A;  5FRN A;  2ELH A;  2V9P A;  2P7C B;  1FY7 A;  2COM A;  4M6V A;  1E17 A;  2CU7 A;  2GM4 A;  1IZ1 A;  2QGU A;  1IXR C;  3A03 A;  4EAT A;  1SAX A;  4KA4 A;  1HXD A;  3M4O J;  1HKS A;  3K1N A;  2ZME C;  1ZRD A;  4J19 A;  3CUQ C;  1H88 C;  2IGN A;  2V9K A;  3CDL A;  2EIN H;  1ZGJ A;  1HW2 A;  5IOZ A;  3CD6 I;  4PDK A;  2FMY A;  3RKQ A;  1H8A C;  4DW6 A;  2GIZ A;  1WJD A;  2M45 A;  5KAI C;  3F0C A;  5IY5 H;  5EDN A;  2IS2 A;  2ZKZ A;  3EYI A;  5CVV A;  3U1K A;  1LKX A;  2HPI A;  5FKN A;  4RGU A;  3K70 C;  2QUF A;  4JX6 A;  4CCM A;  1OFC X;  1SC7 A;  1GLN A;  4FQG A;  4IEJ A;  1MW7 A;  4ITV A;  5EF6 A;  2XRN A;  4E7L A;  1F36 A;  1O7F A;  4J00 A;  4UXN A;  1XDU A;  1Z6T A;  4A0Y A;  4ZYD A;  1UJ8 A;  3FXQ A;  1NH3 A;  4AIJ A;  1AKH B;  4GCV A;  4JP0 A;  1IN4 A;  2DK8 A;  2MLG A;  3OYD A;  2P0W A;  2R92 J;  3K4L A;  2L02 A;  2HFH A;  1YE9 A;  3HB9 A;  2X4H A;  5J3L A;  1KU2 A;  4V2F A;  3TBI A;  3OIP A;  1U2W A;  2FQ3 A;  3PFY A;  1GXQ A;  2OBP A;  2CYY A;  4BU2 A;  1GVJ A;  1NHA A;  1XS9 A;  2PX9 A;  4HV5 A;  2MG4 A;  3HDD A;  3FBN B;  4XR6 A;  1KA8 A;  3TO7 A;  2HOS A;  4CYC B;  2L54 A;  3HTU A;  3CMY A;  2V26 A;  3HRU A;  2QM3 A;  4M73 A;  4BXF A;  2M0M A;  2KMU A;  2ZNY A;  1JT6 A;  2DJN A;  5FFZ A;  1JJ8 C;  5L3G A;  4NNJ A;  1F9N A;  4HYE A;  4UVB A;  3WE3 A;  2XVC A;  1STZ A;  3QP6 A;  3K4B A;  3CP2 A;  2NOJ B;  1ENH A;  1X3W B;  1ZR2 A;  4KIC A;  2FQ4 A;  2A5Y B;  2Y75 A;  4U7D A;  4PJL A;  2XAH A;  2ZBK A;  1YRN A;  1YX5 A;  4QWQ A;  4LK1 F;  1F1Z A;  3ERM A;  2JSP A;  1MJA A;  4JQF A;  4YFX F;  3AAF A;  2PN6 A;  1Y8R B;  4ZYA A;  2WV1 A;  3QOD A;  1T0F C;  2DDA A;  2XAS A;  4A5M A;  2IGM A;  2AS5 F;  1OR7 A;  3VOD A;  3G1O A;  4P9F A;  4E6K G;  3U21 A;  4EJU A;  1MBK A;  2MGQ A;  3IL2 A;  2ELJ A;  3I0T A;  3LSP A;  1RUO A;  3GWZ A;  1KON A;  3LSG A;  1YIT I;  3W6V A;  1LFB A;  2DA1 A;  2ZSH B;  4UUT A;  4OIQ F;  5FLV A;  2B63 J;  9ANT A;  2I10 A;  1YYV A;  3ECH A;  1U0J A;  2BGC A;  2ZXI A;  4G6Q A;  3CMA I;  3E5X A;  4BXU A;  4MIM A;  4G12 A;  4OOI A;  3M1C A;  4A3C J;  4XLH A;  2K5C A;  3JCU C;  3SQN A;  5ILU A;  3MZH A;  1VQP I;  2V1N A;  3SDB A;  2O8K A;  4ZDO A;  1ETK A;  2DCE A;  3BG6 A;  2H8R A;  2PFB A;  5ICC A;  1FYL A;  1REP C;  1FT9 A;  2V1X A;  2VBZ A;  3HIF A;  2B7E A;  3HTS B;  2CFX A;  4XKB A;  3ZMV A;  3H9Q A;  1APL C;  1CQT A;  1Z3X A;  2JQ7 A;  4XOR A;  4HST A;  1YTY A;  3IKV A;  3Q9S A;  3GTO J;  2BVM A;  5F6F A;  1YS7 A;  5K7H A;  6PAX A;  1F43 A;  2Y9Z A;  4IX7 A;  3DKW A;  3CF5 F;  1FNN A;  4XN0 A;  4A3E J;  2M4G A;  3KET A;  3AL0 B;  1UEL B;  2EB7 A;  3F8F A;  4EJT A;  3ISP A;  2KRC A;  2ISZ A;  1D5V A;  2O3F A;  4IHS A;  2EFW A;  3Q9V A;  2LBF B;  4A93 J;  1MBE A;  5L3E A;  2E2I J;  1ONV A;  2DA6 A;  5J1Y A;  2K40 A;  4M72 A;  4LJZ F;  4RM3 A;  3CC7 I;  1X1C A;  1Y6I A;  2WY8 Q;  3QOE A;  1ETY A;  4ZH4 F;  2VB6 A;  3S32 A;  4XLE A;  3J81 Z;  2RGV A;  1FTZ A;  3DLA A;  4B48 A;  1X1P A;  2IGK A;  4FCY A;  4U7B A;  2QVO A;  2ZJP F;  3SJM A;  3DLL F;  3RTR A;  2OAZ A;  2W1O A;  1B9N A;  2H8W A;  1S7A A;  3SZT A;  5DYM A;  1IV8 A;  2XF6 A;  2OTJ I;  1WJE A;  4L5I A;  1P92 A;  4H4K C;  2LNB A;  2WBM A;  3R61 A;  1ZAR A;  2LKP A;  3AKZ A;  5FLM J;  3CJQ B;  3AG3 H;  2FNP A;  3BY6 A;  1GUU A;  1LJ9 A;  3ASO H;  5F08 A;  1ZRE A;  1X1A A;  4P96 A;  4XKV A;  2BW3 A;  1EA3 A;  1QRY A;  4L5J A;  4LOC A;  3ABK H;  4HRI A;  3KP3 A;  2BOL A;  2JT1 A;  3LST A;  1IG7 A;  4IRH A;  1TZL A;  3BP8 A;  4CYD A;  4XSZ F;  5D5W B;  4Q4Z F;  3JRH A;  1B6A A;  5C4X J;  1XMA A;  3WTW C;  2OTL I;  2MC4 A;  3QPT A;  3IWZ A;  3CO6 C;  3QYF A;  4IHY A;  1ZLK A;  1ZTR A;  2LKS A;  1O7L A;  4BQN A;  2ZC2 A;  2TRT A;  3DTE A;  5JFR A;  2QQ8 A;  1XGS A;  1V5E A;  2DW4 A;  1LPQ A;  3I9V 2;  3H3Z A;  2QBY A;  5M5Y J;  4IZZ A;  1P4X A;  3BR1 A;  3FDY A;  4AIK A;  1XC5 A;  3HGY A;  3CCS I;  2WA0 A;  5E79 C;  5KVR A;  2XGC A;  1IRX A;  1Z91 A;  2DOE A;  1YFH A;  3EQL F;  3E6M A;  2QSG X;  1WPK A;  4IRG A;  3F6V A;  1YW7 A;  2O03 A;  3OIO A;  2DA3 A;  2FEZ A;  3VOE A;  3GLX A;  1XGN A;  3S17 J;  3CCE I;  4LIV A;  3F6O A;  3TOA A;  1BI3 A;  3WTX C;  2XUB A;  2AO9 A;  3HOW J;  5DCM A;  2Z9O A;  1D1A A;  3HOV J;  2BBY A;  5DUI A;  1S9H A;  2XAG A;  2YS9 A;  4XLF A;  2DMQ A;  4AYB A;  1G3W A;  1H9T A;  5DUK A;  4YFK F;  5L3C A;  3VWB A;  4DZP A;  4IQJ A;  2FU4 A;  4J01 A;  4A3K J;  2O7O A;  1KGS A;  1R1V A;  1D8K A;  2Q1Z B;  2EPF A;  2EA4 A;  2XPV A;  3R4K A;  3LQQ A;  4P1W A;  4XNF A;  2A6H F;  2DPD A;  2F5D A;  4EVI A;  2F5C A;  1OYI A;  1TTY A;  2FSW A;  5D5V B;  3VSL A;  2DI3 A;  4IF4 A;  2Y9Y A;  2IRF G;  4XMY A;  5TJJ A;  2K7L A;  5LHG A;  3JTG A;  2J5P A;  4CGZ A;  1O57 A;  1ZG3 A;  2L4M A;  4MO7 A;  4EM2 A;  1X1B A;  5K5O A;  2DBB A;  4KUM A;  2JRT A;  3FX3 A;  3RPU A;  3A0H C;  2KRH A;  4A5N A;  5JLX A;  3W2A A;  2P4W A;  1H9G A;  2YU3 A;  3CC4 I;  4Q5S F;  2MC3 A;  1WQ2 A;  5E1X A;  2HZD A;  5J1R A;  1KQ9 A;  1X19 A;  1YG2 A;  3JRD A;  1V3F A;  4BAY A;  1TBX A;  4A0Z A;  1FOK A;  4PJN A;  1BW6 A;  1W0T A;  1G2H A;  1SD5 A;  2VXD A;  1AU7 A;  3VYS B;  1Z9C A;  4BJ5 C;  2OQR A;  5GTI C;  5EZH A;  4OMY A;  2Z16 A;  3BZ6 A;  1HSJ A;  2QKL B;  2WAD A;  4A3I J;  1GXP A;  2QEN A;  3LNQ A;  5B5E C;  3HM5 A;  1TWA J;  4XIC A;  3W6K B;  4Y13 A;  1W0U A;  3QOP A;  1ZN2 A;  2KL4 A;  3AFH A;  2A68 F;  3HUG A;  3MZ8 A;  3I53 A;  1PUE E;  3TL4 X;  1ZG1 A;  1SFX A;  3QAH A;  3OYB A;  1JKR C;  1R5G A;  2DOF A;  2NVX J;  1T56 A;  4N0B A;  4F93 B;  2L3D A;  1PP7 U;  4HAM A;  3S3O A;  3BR2 A;  4WXD A;  3OY9 A;  1FYM A;  3V8K A;  5AON A;  2F48 A;  3HKZ N;  3ML6 A;  3WTZ A;  4BHC A;  2K4J A;  3KE2 A;  1IW7 F;  2Q0O A;  4FT8 A;  1FBU A;  3ELK A;  3O3K A;  2WAQ A;  1R00 A;  1W5C C;  5HNF A;  4UV9 A;  1XB4 A;  3EUH A;  3QPS A;  5CVI A;  4B44 A;  3FXK A;  3QRF F;  3MKW B;  3LSM A;  2Y30 A;  4CCJ A;  2VOD A;  1RZ4 A;  4DYQ A;  1K4S A;  1UHW A;  2FX0 A;  1G4D A;  5HDN A;  2JUC A;  1ZKG A;  3HSE A;  3KP4 A;  1GT0 C;  1Y0U A;  2MSY A;  1ZG5 A;  3BPV A;  5HLH A;  3J7Z I;  3JR9 A;  4XLN F;  2HOE A;  1TQM A;  4BBS J;  3QYB A;  2E35 A;  4U0V A;  1FMV A;  3CCV I;  5HS9 A;  4BGD A;  3JRI A;  3CCQ I;  3IRQ A;  1FP2 A;  5ILV A;  2FD5 A;  2KIM A;  2BW3 B;  2CO5 A;  1ON2 A;  1OR7 C;  1O3T A;  4IL6 C;  1IN7 A;  3DPU A;  2PQ8 A;  3RSN A;  1ETX A;  2HKX A;  5D8K B;  3S16 J;  1N75 A;  4ESJ A;  4HV6 A;  1Z1D A;  1TLH B;  4NHJ A;  3WTT C;  1IV6 A;  3BCB A;  3H92 A;  3ZN1 A;  2JN6 A;  3B73 A;  4Q48 A;  4CIC A;  4YEL A;  3DQV C;  3OIQ A;  1JGS A;  1IAW A;  5D6F A;  1OCO H;  5J4V A;  4B3A A;  1O3S A;  2JSC A;  2D1H A;  2W48 A;  2RQQ A;  1HDD C;  4FTH A;  3H35 A;  4GYG A;  1DP7 P;  1YLF A;  3PM1 A;  2QBY B;  4A3D J;  3C2H A;  3DU5 A;  2A61 A;  1V5F A;  2WAE A;  4AVP A;  2PMZ N;  1Q1V A;  1HQC A;  2M2E A;  2NVU B;  4B47 A;  1SFK A;  1BC8 C;  4LGW A;  3ZMU A;  4EM1 A;  4UB8 C;  3SYT A;  2HQ5 A;  3PO2 J;  2MD0 A;  4ENM A;  4L9T A;  2IAI A;  5BQT A;  1W36 D;  2XHK A;  1HOM A;  2E5N A;  1VQL I;  2YSR A;  3PNY A;  3KEQ A;  3D5L A;  3OS2 A;  1Z7U A;  3FKI J;  4CA0 A;  2CUZ A;  2K4B A;  2LRE A;  3Q3S A;  4B43 A;  2LVS A;  3QU6 A;  4WWC A;  2XAJ A;  3GYH X;  1OCT C;  1Z77 A;  3L2C A;  2M34 A;  3BQY A;  1VZ0 A;  2CW7 A;  2VLA A;  3P9C A;  3PNV A;  1VQ9 I;  2L7K A;  3I4N J;  1IUF A;  2HYG D;  3I55 I;  4RDU A;  1UAA A;  5JI6 A;  2D2W A;  3R0J A;  2LKX A;  4BY7 J;  4YRV A;  1HCR A;  2P5L C;  1L0O C;  1QHG A;  2EV6 A;  4HNV A;  4CCN A;  2VE8 A;  5E3N A;  4WXH A;  2ISY A;  1O3R A;  2VQC A;  1BW5 A;  2CQK A;  2NNY A;  2VAS A;  2ESH A;  1I3A A;  2COB A;  2E1O A;  2GXA A;  2HYJ A;  4HW0 A;  4R1H A;  4Y33 A;  4CDG A;  2HEO A;  4O3M A;  2X6Y A;  3OOU A;  1MBF A;  2MH9 A;  4KIF A;  1FSE A;  1XCV A;  1HBX G;  2K9S A;  1OYW A;  2P7V B;  5ED4 A;  4CYC A;  2ACJ A;  1YW8 A;  3S8P A;  1ERD A;  4GFB A;  2BY0 A;  4BE1 A;  1FEX A;  4BHP A;  4L5E A;  4RM2 A;  4S04 A;  3OSG A;  3FIS A;  2XV4 S;  2FBI A;  2A5W A;  1ETV A;  5EG0 A;  3K2Z A;  4BXX J;  2FRH A;  2EK5 A;  2DFF A;  2EFP A;  3KFW X;  4A69 C;  2KFD A;  1WJB A;  1TT0 A;  4RB1 A;  1MNE A;  2ZFU A;  3DTI A;  3WGI A;  4IPA A;  2P8T A;  3PFI A;  1U5T A;  3ABT A;  5H6Q A;  3R6S A;  2M7B A;  4BS9 A;  4D1Q A;  1BI2 A;  1SMT A;  1WZ2 A;  3RZO J;  4EJW A;  2Z1D A;  2UXX A;  1FX7 A;  4M74 A;  5J4Y A;  2JPB A;  2L4A A;  4WXC A;  2VE9 A;  2C6Y A;  3O8G A;  4BBR J;  1A6Q A;  4MHG A;  2LK2 A;  2KDZ A;  3G73 A;  2DLL A;  2CW0 F;  1WKM A;  2LF8 A;  1WRJ A;  2EA2 A;  3IUO A;  4XON A;  3PUB A;  1IN8 A;  4BJT A;  3HPH A;  5C3E J;  2BE5 F;  1FYK A;  4MEX F;  3MEX A;  2BHY A;  2X6W A;  1BC7 C;  3VPR A;  1K79 A;  4BQA A;  2Y0M A;  1MNM C;  4KIS A;  2H1K A;  1BL0 A;  1TNT A;  4N9H A;  1W4M A;  2J5O A;  4ZYG A;  2KDO A;  3BRO A;  2DFH A;  2O0Y A;  3OL3 A;  1J09 A;  2PJP A;  1R23 A;  2QQ9 A;  3ZQQ A;  5LFA A;  3MWM A;  3K10 A;  2CQN A;  3IH3 A;  1TQP A;  1FJL A;  5F1J A;  3RI4 A;  3S1Q J;  4FE7 A;  4CH7 A;  2DTZ A;  2BEO A;  4DNC A;  2CQQ A;  2FNA A;  2DOD A;  3D5S C;  1M1E B;  2DQR A;  3NWS A;  1OCZ H;  4RA2 A;  4W97 A;  4XLA A;  1MDM A;  3ULQ B;  2RC4 A;  2XKP A;  1OCR H;  1CGP A;  4HX8 A;  1MMG A;  1T6S A;  3PL8 A;  3GTG J;  1WGX A;  4G7Z F;  1H0M A;  2L01 A;  2BY3 A;  4B09 A;  4A0X A;  5FKL A;  4FX4 A;  1ZH5 A;  4HOB A;  2DU9 A;  5FRO A;  2OV7 A;  2EFO A;  5J47 A;  3IV5 A;  2PEX A;  4KN7 X;  5EEH A;  3GCM A;  3BJA A;  4X1E A;  5FKO A;  1MMA A;  1AOY A;  2IVM A;  1S72 I;  3CCU I;  2NXN B;  2LRD A;  3LSH A;  1L3L A;  3H5A A;  4F55 A;  4C3H J;  3C3W A;  1ZYR F;  5C4J J;  2R7W A;  2K3F A;  2BXY A;  2VPR A;  1OLT A;  5ICG A;  2EQR A;  2HDW A;  5B1B H;  2XC7 A;  2A3S A;  2R7F A;  1X4O A;  3K69 A;  1VQN I;  4ETS A;  3GF2 A;  4HA8 A;  3LAP A;  2WAF A;  4MGR A;  3DWL E;  5CJ9 A;  3W2W A;  4A3L J;  5FLX K;  3IH4 A;  2HS5 A;  2CV0 A;  1AA7 A;  2F4O B;  1B8I B;  3JTH A;  1IDZ A;  2EZH A;  5JHU A;  2R7X A;  3ZQG A;  1HA8 A;  1W36 C;  2LLK A;  2ADU A;  4M3F A;  1Y1W J;  4EJV A;  3JRF A;  4A3M J;  5M5X J;  3WTS C;  2XB0 X;  2EZI A;  4Y15 A;  4LD5 A;  3KX2 A;  1W1W E;  3OMY A;  2JJ7 A;  4XLP F;  2LDU A;  1R1T A;  1ITY A;  3KP6 A;  2O5R A;  2NOG A;  2X85 A;  3GTL J;  2QQA A;  3H1C A;  4BY1 J;  1WJA A;  2FA5 A;  5H2F C;  3BG3 A;  1R9T J;  1USS A;  2FUG 2;  4IHW A;  1DP3 A;  2O8X A;  2CH0 A;  2BV6 A;  2DYR H;  2L9V A;  3EUH C;  3LA2 A;  3T1B A;  2NNN A;  4ZTJ A;  1EJ9 A;  2HDC A;  1TP4 A;  5H6R A;  5DD4 A;  3VSK A;  1FLI A;  1HF0 A;  3GFM A;  1XSX A;  1G6N A;  2IS1 A;  2ECB A;  2E7X A;  2JVG A;  3ZCO A;  2IPQ X;  4KIB A;  3LL7 A;  4WF2 A;  3IP4 B;  1KQ0 A;  3GUD A;  1DUX C;  1R6R A;  4E7S A;  3O2P E;  1BR1 A;  4C3I J;  4H0E A;  1OKR A;  2UZK A;  1WI3 A;  2Y0S N;  3LQR A;  3BCA A;  4X6A J;  1LUJ B;  2LC2 A;  3U9G A;  3MAJ A;  5DV5 A;  3VDX A;  2EIK H;  2FOK A;  2NYX A;  3B6A A;  1D0Y A;  2DN0 A;  2DYS H;  3KZZ A;  4BUP A;  4IHX A;  2Z2S B;  2M9H A;  2XSD C;  2JA8 J;  1YX3 A;  1GV2 A;  2HWV A;  4FX0 A;  2DXI A;  1JHF A;  4NUB A;  4DYR A;  3OYI A;  2V4J C;  2NS7 A;  1YIJ I;  3WE2 A;  4LK0 F;  1OMI A;  5EG0 B;  2QA4 I;  1W5S A;  3RIR A;  2IJL A;  1IGN A;  3BJ6 A;  3LWF A;  2PBI A;  1J0R A;  2JK3 A;  1U5T B;  2NVT J;  5B66 C;  4PFP A;  4FAS D;  5DDG A;  3ZMS A;  3MKL A;  3RJP A;  4HPQ A;  5JHF A;  3P7N A;  3V7C A;  3L09 A;  2YX7 A;  3SZP A; 
#chains in the Genus database with same CATH homology
 4KIG A;  3RYR A;  1S29 A;  5E17 F;  2H09 A;  4M9S A;  1QO0 D;  3KLN A;  4G8X A;  3IHU A;  3LA7 A;  2EJR A;  3H3U A;  5CVJ A;  3M8E A;  2DFI A;  4IRI A;  3RKY A;  1B4A A;  1J75 A;  1IXS B;  1MD0 A;  1Q1H A;  4HLX A;  3N97 A;  2V1D A;  1MDM B;  2ESN A;  2EV5 A;  1KYW A;  2VC1 A;  3CDH A;  4LMY A;  3WG9 A;  1TQI A;  4Q47 A;  2HKO A;  4XSX F;  5J8C A;  2NAZ A;  2RDP A;  3HSR A;  3HOS A;  4HQE A;  4MTD A;  1SMY F;  4KNY A;  3JAM K;  3CTA A;  4HX7 A;  3TDU C;  5FO5 A;  4PGG A;  2O6G E;  2KRF A;  2VC0 A;  4XRF A;  5IT9 K;  2VT2 A;  3M9A A;  1JE8 A;  1U5T C;  2Z5U A;  2F5F A;  3HRT A;  1HKT A;  2V1U A;  4TV7 A;  2QWW A;  4QLC U;  4P9U A;  3ZP5 A;  3PQJ A;  3L9F A;  5TRD A;  1YO5 C;  2M8E A;  2PMU A;  5LRS A;  3P9K A;  1SFE A;  1F5T A;  3EDP A;  2QZ8 A;  2CG4 A;  3L7W A;  2EV0 A;  1MZB A;  2F2E A;  4Y17 A;  1QNT A;  4ENK A;  1BJA A;  3WU0 A;  1KQ8 A;  1O3Q A;  4XBF A;  4WK8 F;  5D5U B;  2X0L A;  3VEP A;  4ESF A;  1OPC A;  3HSF A;  5E8I A;  2DPU A;  2YX4 A;  1MJB A;  3KP2 A;  1T98 A;  4D0P A;  4OU0 A;  1KYZ A;  5L3D A;  2ZO4 A;  2AXL A;  5ICE A;  3ZMT A;  2OZU A;  3MFK A;  2XAQ A;  3K0L A;  1QZZ A;  1XSD A;  4ZYE A;  4I0B A;  5LEK A;  2VN2 A;  4A6D A;  3FMR A;  1TW2 A;  1P4A A;  3GVA A;  4WX9 A;  3RDI A;  5HOO A;  2H6B A;  5A2Q K;  4F7Z A;  3DV8 A;  4L0Y B;  2IA2 A;  4HDU A;  1G3S A;  3KZY A;  1P4W A;  4GYI A;  1SD7 A;  2VBW A;  3TO9 A;  1RNL A;  2HGC A;  4AD9 A;  1HST A;  4RGX A;  4RS8 A;  2KIU A;  4RAY A;  3FMS A;  1XD7 A;  1A04 A;  2QYO A;  3E5Q A;  3E97 A;  3V8J A;  3F21 A;  2GZW A;  4EGZ A;  3KEO A;  1XN7 A;  3LFK A;  2DO7 A;  4A6E A;  3TOB A;  1JHH A;  1Z05 A;  1IUY A;  3I54 A;  2XAF A;  1P6R A;  3MCZ A;  2HTS A;  3C7J A;  1I27 A;  3WGH A;  2HTJ A;  5BS6 A;  2OA4 A;  1FSH A;  3HHH A;  2K86 A;  2STT A;  3I71 A;  3DEU A;  3DF8 A;  4EMS A;  3Q5F A;  1RIO H;  2IT0 A;  4OIO F;  3KP5 A;  4KMU X;  1QBJ A;  1XMK A;  5F1R A;  1BOA A;  1SD6 A;  2KKO A;  1D3Y A;  1LVA A;  1S8N A;  5J8F A;  5LGU A;  3K1M A;  5JVT A;  5CVR A;  2M1B A;  2QLZ A;  5LGN A;  1DPU A;  2H6C A;  4N9I A;  2FXA A;  1FPQ A;  2FBK A;  3K9T A;  2ZNZ A;  4JBA A;  1TNS A;  1J59 A;  3EET A;  3FXR A;  4L9N A;  2W85 A;  1J7K A;  4I09 A;  3WTV C;  4ZZL A;  2DK5 A;  4CXF A;  1KU9 A;  1F4K A;  2KIF A;  2GXG A;  1HW1 A;  1X3U A;  1U3E M;  3ZN0 A;  3T8R A;  1T38 A;  4EV0 A;  4LLG F;  3HOT A;  4HZF A;  2BYV E;  5LHH A;  3I4P A;  3NEU A;  3LA3 A;  1R7J A;  2FBH A;  4DQ2 A;  3WGG A;  3ZPL A;  3OOP A;  1MKM A;  5HS7 A;  5L3B A;  1XSV A;  2RN7 A;  5CVU A;  1WSU A;  4AIH A;  5BPD A;  4KFC A;  1LB2 A;  1KU7 A;  3E3V A;  2ZFW A;  4G7H F;  1LQ1 A;  3IC7 A;  2RNJ A;  2ZJ2 A;  4A2U A;  3LAJ A;  2B0L A;  3HRM A;  2A6E F;  4PCQ A;  1GHC A;  1V4R A;  5IT3 A;  3JSO A;  1R5H A;  4GGG A;  3FF5 A;  4LFU A;  4KN4 X;  5LLQ A;  5LRR A;  1LDK B;  1UFM A;  2M30 A;  4B8X A;  1UCR A;  4PZJ A;  4RGR A;  3RYP A;  3F3X A;  5E18 F;  2A69 F;  3V7R A;  1YS6 A;  4UVC A;  4BH9 A;  3IRR A;  1ZRC A;  1K7A A;  2W57 A;  4WCG A;  1YQA A;  5KK1 A;  5L3F A;  1FBQ A;  3L00 A;  2TDX A;  4M71 A;  4E70 A;  2OZ6 A;  2D1V A;  3IWF A;  1CF7 A;  3GFI A;  2A07 F;  3BOQ A;  2P5V A;  3O6B B;  3WTU C;  5FLX Z;  3GXO A;  2GAU A;  2ZME B;  2JPC A;  1QPM A;  2XIG A;  2UWM A;  3QU3 A;  2Z99 A;  5HVQ C;  4CO8 A;  1LEA A;  3J80 K;  5K5Q A;  2HR3 A;  5D6E A;  5FGM A;  3ZMZ A;  1SD4 A;  3ABU A;  5HDG A;  2MBF A;  1KU3 A;  2FF4 A;  1PP8 F;  1YW9 A;  4U0Y A;  1IF1 A;  1MJ9 A;  1EV7 A;  2MD5 A;  2Q8K A;  2GWR A;  3R0A A;  5JR3 A;  4G94 A;  2VBX A;  1WWX A;  5DD8 A;  1XGM A;  1K78 A;  3DFG A;  4IXA A;  3B02 A;  4G6D A;  3CO7 C;  3FZV A;  1ZAO A;  1ZRF A;  4FHT A;  2CGP A;  4BYY A;  3U1D A;  5DCF A;  4P55 A;  5J6X A;  2GA1 A;  2W25 A;  3BDD A;  2YPR A;  3W6J B;  2W84 A;  1DPR A;  1EH8 A;  2VOO A;  4OIR F;  2EWN A;  4OIN F;  4I02 A;  5ILS A;  2RV8 A;  2JZY A;  4CHU A;  3D0S A;  2XKO A;  1BI0 A;  2H27 A;  3V7S A;  2WV0 A;  2IA1 A;  3KCC A;  1J2X A;  3HYI A;  1XDS A;  1ZLJ A;  4UUV A;  2VBY A;  4U0W A;  3MZY A;  2HZT A;  4Z2Y A;  2XGX A;  1WI9 A;  3GFL A;  1XGO A;  5BOX A;  4O6J A;  2V6C A;  2ETH A;  3CJN A;  2IP2 A;  2W24 A;  3BWG A;  5K1Y A;  4IVN A;  3FXU A;  2PI0 A;  3GX4 X;  5E1Z B;  4JK1 X;  4L9J A;  4UNO A;  3V8L A;  3JAM Z;  2Z3Y A;  2VOP A;  4HBL A;  1JXS A;  2OQG A;  4O5V A;  2KJC A;  1FC3 A;  4BNC A;  1CF7 B;  4R79 A;  5IT9 Z;  4MQV A;  3TQN A;  4MNU A;  3M7G A;  4HF0 A;  4NQW A;  4UHT A;  2FE3 A;  5BPI A;  4R8H A;  2PLY A;  4MEY F;  1QQI A;  3P9I A;  4UV8 A;  3SFZ A;  2RKH A;  3C1D A;  1IN6 A;  1B59 A;  2WTE A;  3J7A O;  3TO6 A;  2GA2 A;  3FMQ A;  5LBQ A;  2CWE A;  2CSO A;  4GXO A;  2MH2 A;  3JSP A;  5LHI A;  4RB3 C;  3VFZ A;  4I2O A;  3VB2 A;  2DQL A;  3DP7 A;  1FP1 D;  1LDD A;  3M8F A;  4ESB A;  1K78 B;  3QPH A;  4HLY A;  1I1G A;  4K2E A;  1I1S A;  5CLS A;  1R36 A;  1S7O A;  4YII A;  1IXC A;  3ECO A;  1UST A;  2E7W A;  3HHG A;  4LB5 A;  5K5R A;  4HF2 A;  2F5E A;  1W5T A;  4A12 A;  1G3T A;  3C18 A;  1ODD A;  1RI7 A;  4I01 A;  1B1B A;  1VTN C;  2O61 A;  4BHB A;  3ZQ7 A;  3K1P A;  3TDZ C;  1I6X A;  1ZGA A;  4ENN A;  3F8N A;  2E1C A;  3ERE D;  5ICF A;  2GQQ A;  3FHZ A;  1R1U A;  2IA0 A;  2PMH A;  2V9V A;  5A2Q Z;  3J81 K;  4RGS A;  1Z6R A;  2K27 A;  3NRV A;  1I5Z A;  3F22 A;  1R58 A;  4L18 B;  1HW5 A;  5H20 A;  1MGT A;  5AIQ A;  1BM9 A;  1LDJ A;  2ZXJ A;  2H94 A;  4I98 B;  4S05 A;  3R60 A;  1S6L A;  3FM3 A;  1ULY A;  2R3S A;  3HRS A;  3CUO A;  5E1W A;  4GO1 A;  1J5Y A;  4HX4 A;  2RVC A;  5AIP A;  3T5X A;  3I59 A;  2LSO A;  2VON A;  2KJB A;  1U78 A;  1LEB A;  3SXY A;  1C0W A;  1EH6 A;  2Z33 A;  2EFN A;  1LNW A;  5HLG A;  3FM5 A;  3G3Z A;  4LG0 A;  4I7H A;  4KMF A;  4UVA A;  2ZCW A;  5FD6 A;  5D8L B;  3DPL C;  3M1E A;  4ON0 A;  3E6C C;  1XCB A;  3GEZ A;  4KT5 C;  2V79 A;  4LLN A;  3JW4 A;  4EGY A;  5HLI A;  1YIO A;  1QGP A;  1R22 A;  4L0Z B;  2G7H A;  1K6O A;  1SFU A;  2EFQ A;  2WC2 A;  4NB5 A;  3RKW A;  4RAZ A;  3KLO A;  3T0Y A;  2M87 A;  4EJO A;  3GFJ A;  1B9M A;  2ZME A;  3CUQ A;  2G9W A;  1HKQ A;  4IHT A;  3F72 A;  4OMZ A;  1IRF A;  1G3Y A;  2PG4 A;  3RKX A;  5EEG A;  3TKY A;  4YIF A;  3OV8 A;  4M9Z A;  5E20 A;  3S2W A;  2OD5 A;  4I0A A;  4RB0 A;  1E2X A;  5FB2 A;  5HDK A;  1S3J A;  5HS8 A;  5D4S A;  2VXZ A;  4HDV A;  2M5W A;  4RB2 C;  4AWX B;  4ZZD A;  1FBS A;  4G9Y A;  3KP7 A;  3RPQ A;  5LEJ A;  2E1N A;  3MQ0 A;  3QP5 A;  4M9X A;  2DTR A;  3E6D A;  1W7P A;  4KYW A;  1U8R A;  5E8G A;  4MTE A;  4L9V A;  2G7U A;  4U88 A;  1QZY A;  3V4G A;  4P5O A;  3TGN A;  4YG2 F;  1FWZ A;  2Q2E A;  1AWC A;  2NRA C;  3F23 A;  3IKT A;  2HQR A;  1UHM A;  4M6Y A;  3I64 A;  1BIA A;  1T0F A;  2DT5 A;  1DDN A;  3GZ6 A;  3NQO A;  4ENJ A;  4G7O F;  1EH7 A;  1OYY A;  3E5U A;  2GIV A;  4LLL A;  5CYV A;  1RUN A;  5DCM B;  2XRO A;  2LF7 A;  4CZZ A;  4EQQ A;  2RQP A;  3ZMD A;  4YFN F;  3PQK A;  1BIB A;  5D5X B;  3E6B A;  1UB9 A;  1IRG A;  3BPX A;  3I59 B;  2DAO A;  2YR2 A;  3COA C;  1U6G A;  3GO5 A;  1BBY A;  3DPT A;  4LG0 B;  3WOD F;  5LGT A;  2Y48 A;  4HF1 A;  2QQB A;  3I5U A;  3GZ5 A;  1J9I A;  5ERI A;  4EM0 B;  5D4R A;  1W7P D;  3J80 Z;  1PDN C;  2IW5 A;  2HYF A;  3F8M A;  1T39 A;  1IN5 A;  3REO A;  1D8J A;  2K02 A;  2UXN A;  3ROU A;  1BN5 A;  2HQN A;  3CUQ B;  2MLK A;  5FFX A;  2P6T A;  2P5K A;  3DXJ F;  4KDP A;  2MA3 A;  4LB6 B;  2VT3 A;  1TW3 A;  3GW2 A;  4OIP F;  1P2F A;  1BI1 A;  3U2R A;  4MQ9 F;  1ZHF A;  5F64 A;  3I58 A;  3T8T A;  5BMZ A;  2OU2 A;  3WU1 B;  4IJA A;  3F8C A;  3N4M A;  2P6S A;  3CLO A;  4ZYH A;  4ASN A;  3EYY A;  2NS0 A;  4HQM A;  1ON1 A;  3BJO A;  1FZP B;  2JTV A;  5DEQ A;  3SHF A;  1W7P B;  2FML A;  3FWE A;  5FD5 A;  2R7D A;  2D45 A;  1T2K A;  2GXB A;  2STW A;  3WTY C;  3F8B A;  4PGH A;  4M6X A;  2ELH A;  2P7C B;  1FY7 A;  2COM A;  1E17 A;  1IZ1 A;  1IXR C;  1SAX A;  4KA4 A;  1HXD A;  1HKS A;  3K1N A;  1ZRD A;  3CUQ C;  1HW2 A;  1ZGJ A;  4PDK A;  2FMY A;  2M45 A;  2ZKZ A;  3EYI A;  5CVV A;  4RGU A;  2QUF A;  2XRN A;  1O7F A;  4UXN A;  1XDU A;  1Z6T A;  4A0Y A;  4ZYD A;  3FXQ A;  4AIJ A;  4GCV A;  1IN4 A;  2DK8 A;  2MLG A;  2L02 A;  2HFH A;  2X4H A;  1KU2 A;  1U2W A;  2FQ3 A;  1GXQ A;  2OBP A;  2CYY A;  1GVJ A;  1NHA A;  4HV5 A;  1KA8 A;  3TO7 A;  2L54 A;  3HTU A;  3HRU A;  2QM3 A;  4M73 A;  2ZNY A;  5FFZ A;  5L3G A;  1F9N A;  4HYE A;  4UVB A;  3WE3 A;  2XVC A;  1STZ A;  3QP6 A;  4KIC A;  2A5Y B;  2Y75 A;  4U7D A;  2XAH A;  2ZBK A;  4QWQ A;  4LK1 F;  1F1Z A;  3AAF A;  4JQF A;  1MJA A;  4YFX F;  2PN6 A;  2XAS A;  4A5M A;  2AS5 F;  1OR7 A;  3VOD A;  4P9F A;  4EJU A;  3IL2 A;  3I0T A;  1RUO A;  3GWZ A;  4OIQ F;  1YYV A;  3ECH A;  2BGC A;  4G6Q A;  3E5X A;  4BXU A;  4OOI A;  3SQN A;  5ILU A;  3MZH A;  2PFB A;  5ICC A;  1FYL A;  1REP C;  1FT9 A;  2V1X A;  2VBZ A;  3HIF A;  3HTS B;  2CFX A;  3ZMV A;  1YTY A;  3IKV A;  3Q9S A;  5F6F A;  1YS7 A;  6PAX A;  3DKW A;  1FNN A;  3KET A;  2EB7 A;  3F8F A;  4EJT A;  3ISP A;  2ISZ A;  1D5V A;  2O3F A;  4IHS A;  2EFW A;  3Q9V A;  5L3E A;  1ONV A;  4M72 A;  4LJZ F;  4ZH4 F;  3J81 Z;  2RGV A;  4U7B A;  2QVO A;  3RTR A;  2OAZ A;  1B9N A;  1S7A A;  3SZT A;  5DYM A;  4L5I A;  1P92 A;  2LNB A;  3R61 A;  1ZAR A;  2YX7 A;  2LKP A;  2FNP A;  3BY6 A;  1LJ9 A;  1ZRE A;  4P96 A;  4L5J A;  3KP3 A;  2JT1 A;  3LST A;  4IRH A;  3BP8 A;  4CYD A;  4XSZ F;  5D5W B;  4Q4Z F;  1B6A A;  3WTW C;  1XMA A;  3QPT A;  3IWZ A;  3CO6 C;  1ZLK A;  1O7L A;  5JFR A;  1XGS A;  2DW4 A;  3H3Z A;  2QBY A;  1P4X A;  4AIK A;  5KVR A;  1Z91 A;  1YFH A;  3EQL F;  3E6M A;  4IRG A;  3F6V A;  1YW7 A;  2O03 A;  2FEZ A;  3VOE A;  3GLX A;  1XGN A;  3F6O A;  3TOA A;  1BI3 A;  3WTX C;  2XUB A;  5DCM A;  2Z9O A;  2BBY A;  5DUI A;  2XAG A;  1G3W A;  1H9T A;  5DUK A;  4YFK F;  5L3C A;  2FU4 A;  1KGS A;  1R1V A;  1D8K A;  2EA4 A;  3R4K A;  3LQQ A;  2A6H F;  2DPD A;  2F5D A;  4EVI A;  2F5C A;  1OYI A;  1TTY A;  2FSW A;  5D5V B;  2DI3 A;  4IF4 A;  2IRF G;  5TJJ A;  2K7L A;  5LHG A;  3JTG A;  2J5P A;  4CGZ A;  1O57 A;  1ZG3 A;  2L4M A;  4EM2 A;  5K5O A;  2DBB A;  4KUM A;  2JRT A;  3FX3 A;  3RPU A;  4A5N A;  2P4W A;  1H9G A;  2YU3 A;  4Q5S F;  2MC3 A;  1WQ2 A;  5E1X A;  1KQ9 A;  1YG2 A;  1V3F A;  4BAY A;  1TBX A;  4A0Z A;  1FOK A;  1SD5 A;  1Z9C A;  2OQR A;  4OMY A;  3BZ6 A;  1HSJ A;  1GXP A;  2QEN A;  3W6K B;  4Y13 A;  3QOP A;  1ZN2 A;  2A68 F;  3HUG A;  1PUE E;  3I53 A;  1ZG1 A;  1SFX A;  3QAH A;  1R5G A;  4N0B A;  2L3D A;  1PP7 U;  4HAM A;  4WXD A;  1FYM A;  3V8K A;  5AON A;  3ML6 A;  3WTZ A;  4BHC A;  2K4J A;  3KE2 A;  1IW7 F;  2Q0O A;  4FT8 A;  1FBU A;  3ELK A;  3O3K A;  1R00 A;  4UV9 A;  1XB4 A;  3EUH A;  5CVI A;  3QRF F;  2VOD A;  1RZ4 A;  1UHW A;  1G4D A;  5HDN A;  3KP4 A;  3HSE A;  1Y0U A;  1ZG5 A;  3BPV A;  5HLH A;  4XLN F;  2HOE A;  1TQM A;  4U0V A;  5HS9 A;  3IRQ A;  1FP2 A;  5ILV A;  2KIM A;  2CO5 A;  1ON2 A;  1O3T A;  1IN7 A;  2PQ8 A;  5D8K B;  2HKX A;  4ESJ A;  4HV6 A;  1Z1D A;  1TLH B;  4NHJ A;  3WTT C;  3H92 A;  3ZN1 A;  3B73 A;  4Q48 A;  4CIC A;  3DQV C;  1JGS A;  1IAW A;  5D6F A;  1O3S A;  2JSC A;  2D1H A;  4GYG A;  1DP7 P;  1YLF A;  2QBY B;  2A61 A;  4AVP A;  1HQC A;  1BC8 C;  4LGW A;  3ZMU A;  4EM1 A;  4ENM A;  4L9T A;  5BQT A;  2XHK A;  2YSR A;  3KEQ A;  3D5L A;  1Z7U A;  2K4B A;  3QU6 A;  4WWC A;  2XAJ A;  3GYH X;  3L2C A;  3P9C A;  2HYG D;  5JI6 A;  2D2W A;  3R0J A;  2P5L C;  1L0O C;  2EV6 A;  2VE8 A;  4WXH A;  2ISY A;  1O3R A;  2CQK A;  2NNY A;  2ESH A;  4HW0 A;  4R1H A;  4CDG A;  2HEO A;  4O3M A;  2MH9 A;  4KIF A;  1FSE A;  1XCV A;  1HBX G;  1OYW A;  2P7V B;  5ED4 A;  2ACJ A;  1YW8 A;  4BHP A;  4S04 A;  2XV4 S;  2FBI A;  3K2Z A;  2FRH A;  2EK5 A;  3KFW X;  2EFP A;  4RB1 A;  3WGI A;  4IPA A;  2P8T A;  3PFI A;  1U5T A;  3ABT A;  5H6Q A;  3R6S A;  1BI2 A;  1SMT A;  4EJW A;  2UXX A;  1FX7 A;  4M74 A;  2JPB A;  2L4A A;  4WXC A;  2VE9 A;  2C6Y A;  4MHG A;  3G73 A;  2DLL A;  2CW0 F;  1WKM A;  2LF8 A;  1WRJ A;  2EA2 A;  1IN8 A;  4MEX F;  2BE5 F;  1FYK A;  3MEX A;  4BQA A;  1BC7 C;  1K79 A;  2Y0M A;  1TNT A;  4N9H A;  1W4M A;  2J5O A;  4ZYG A;  3BRO A;  2O0Y A;  2PJP A;  1R23 A;  2QQ9 A;  3MWM A;  1TQP A;  3RI4 A;  2BEO A;  4DNC A;  2FNA A;  2DQR A;  1MDM A;  3ULQ B;  2RC4 A;  2XKP A;  1CGP A;  4HX8 A;  1T6S A;  4G7Z F;  1H0M A;  2L01 A;  4B09 A;  4A0X A;  4FX4 A;  1ZH5 A;  4HOB A;  2DU9 A;  2EFO A;  2PEX A;  4KN7 X;  5EEH A;  3BJA A;  1AOY A;  2IVM A;  1L3L A;  3C3W A;  1ZYR F;  5ICG A;  2A3S A;  2R7F A;  3K69 A;  4ETS A;  3GF2 A;  4HA8 A;  3LAP A;  4MGR A;  5FLX K;  5CJ9 A;  2HS5 A;  3JTH A;  5JHU A;  2ADU A;  4EJV A;  3WTS C;  4Y15 A;  4LD5 A;  4XLP F;  2LDU A;  1R1T A;  3KP6 A;  2QQA A;  2FA5 A;  1USS A;  2O8X A;  2BV6 A;  3LA2 A;  3T1B A;  2NNN A;  2HDC A;  5H6R A;  5DD4 A;  1FLI A;  3GFM A;  1XSX A;  1G6N A;  2E7X A;  2IPQ X;  4KIB A;  4WF2 A;  1KQ0 A;  3GUD A;  1DUX C;  3O2P E;  4H0E A;  1OKR A;  2UZK A;  3LQR A;  3U9G A;  3MAJ A;  5DV5 A;  2FOK A;  2NYX A;  3KZZ A;  2HWV A;  4FX0 A;  1JHF A;  3WE2 A;  4LK0 F;  1OMI A;  1W5S A;  3RIR A;  2IJL A;  3BJ6 A;  3LWF A;  2PBI A;  1J0R A;  1U5T B;  5DDG A;  3ZMS A;  3RJP A;  3P7N A;  3V7C A;  3L09 A;  2WWY A;  3SZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...