4OMZA

Crystal structure of nolr from sinorhizobium fredii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
98
structure length
98
Chain Sequence
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NolR
publication title Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
pubmed doi rcsb
source organism Sinorhizobium fredii
total genus 34
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4omzA00
4M9ZA 2YU3A 4Y13A 4HX4A 3HSRA 4KFCA 2F5DA 2MH9A 3J7AO 1R1TA 3C7JA 1R00A 5H6QA 2O8XA 4LGWA 4B8XA 3LSTA 3QPHA 3RI4A 3LAJA 4HBLA 3I64A 1LB2A 1SD7A 4RAYA 5F64A 3TO9A 1X3UA 3MQ0A 1BI1A 3KEOA 2YX4A 2P6TA 2LF7A 4P55A 3QAHA 3T5XA 4FT8A 4L18B 4YIFA 5LHGA 1R36A 2FOKA 5E8GA 3WTUC 4HV6A 1G3WA 3LA7A 4U0YA 5D5WB 3KP6A 1P4XA 1YIOA 3ZPLA 2XRNA 1R58A 1RNLA 3HRSA 2ISYA 2GIVA 3GFLA 4HQEA 4I02A 2DFIA 3DXJF 3BDDA 1QZZA 4UNOA 2RQPA 4ESJA 2Q8KA 1S7OA 3BROA 1G4DA 1QO0D 2EV5A 2VBXA 3Q9SA 3JSOA 3F8NA 4U0VA 2JSCA 1L3LA 3V7CA 3IRRA 3IKTA 1ZG1A 2M8EA 4YFNF 3D5LA 1O57A 1FP2A 1D8JA 2O3FA 3CDHA 4OIPF 1HBXG 1FPQA 1IUYA 1HQCA 5L3FA 1XDSA 2W24A 1B9MA 3QP5A 3GX4X 4D0PA 5ILUA 3E6CC 3JTHA 1IZ1A 3F3XA 1IN5A 1Z9CA 3CUOA 3QPTA 1YQAA 5BOXA 4XSZF 5CVJA 5LGTA 1XGNA 2XAQA 3FXRA 2ZJ2A 3J81Z 3GW2A 4ZYGA 5BPDA 3KZZA 4O6JA 2LNBA 1XDUA 2Y75A 4ENJA 1W7PB 1KQ9A 2L4AA 2D45A 1ZHFA 2TDXA 4YFXF 2OZUA 2M5WA 2K4JA 4AVPA 2H6BA 3BY6A 2XUBA 3SXYA 5E1WA 3H92A 1MJBA 3WGGA 1FBQA 2COMA 1Q1HA 1HKSA 2XVCA 4BQAA 2YX7A 3DFGA 2XIGA 2UZKA 3NRVA 3WGHA 1TQPA 5F1RA 1HXDA 2FEZA 2VONA 2EFWA 1ZYRF 4KIGA 4HYEA 4WXHA 1XSDA 1IRGA 4I2OA 1HKTA 2MH2A 1XGOA 4LFUA 4ZYEA 1SD5A 5E17F 2XASA 4LLLA 4BHPA 5D6FA 5D5UB 3IHUA 1TQMA 4ZZLA 3GZ5A 4NB5A 4OOIA 5ICCA 1U5TA 2MBFA 2HKXA 5HOOA 2RKHA 4ETSA 3N97A 2JPCA 2RN7A 3E3VA 3TO6A 1W5TA 1FNNA 4UV8A 3GZ6A 5H20A 5CVVA 1U8RA 4IHTA 2P4WA 3KP5A 3V8LA 5J8CA 3I71A 3NEUA 4WXDA 2K86A 2KKOA 1ZRDA 3QU3A 2Q2EA 2Z33A 1OKRA 1Y0UA 4DNCA 4UXNA 4HZFA 4AIHA 3SHFA 3T1BA 3HUGA 3CTAA 2JPBA 4FHTA 3HYIA 1FLIA 5KK1A 1YW7A 5HS9A 3WTYC 1MDMB 2ESHA 4KUMA 4I7HA 1Z7UA 4L0ZB 2CSOA 2ZMEA 1ZN2A 1KQ8A 1I27A 4CICA 3WTSC 3WU1B 3MZHA 3C1DA 2ZCWA 5CJ9A 2A69F 2HYFA 3DPLC 4MQVA 5K1YA 1O3TA 1SFXA 2DI3A 3QU6A 5BMZA 4M9SA 4CGZA 2EFNA 1XSVA 2GWRA 1G6NA 1GXQA 3WTZA 2EFOA 3DQVC 2OA4A 1FC3A 1R7JA 4G7OF 4M6YA 1T39A 3I5UA 1JHHA 1KU9A 6PAXA 5DCMA 2Z99A 1KQ0A 2ZFWA 3TOBA 2GA1A 1YW8A 2L02A 3FMSA 4EVIA 1S7AA 3U2RA 2IPQX 4EJWA 3HRUA 4HDUA 2VE9A 4HAMA 2EWNA 3P9IA 3J80Z 1ONVA 3HHHA 3ECHA 4CHUA 2VXZA 1FY7A 1O3QA 4I0AA 5L3GA 1F4KA 3FXQA 2W25A 3DF8A 2A68F 1XB4A 2IJLA 2DO7A 1ZG3A 3BJOA 3ZQ7A 3TGNA 1TTYA 1P2FA 3K2ZA 4EJOA 3ABUA 1LDDA 4BHBA 2HFHA 1I6XA 1CF7A 1G3SA 1ZRFA 4A12A 2C6YA 4EJTA 2B0LA 4L9JA 3B02A 4U0WA 5DD8A 2IA2A 2PMUA 2O03A 5LEJA 3E6MA 1P4WA 5D4RA 2FU4A 4HX7A 5HS7A 4WCGA 2DK5A 5BPIA 2O0YA 4M73A 5E18F 1IXSB 2OD5A 2FBKA 4L9NA 2R7FA 4HA8A 3F6VA 1ON2A 3OV8A 2ESNA 4HW0A 1IN6A 1R5HA 1QQIA 2OU2A 3L09A 2WC2A 2CWEA 5FD6A 2DQRA 1XMKA 3DEUA 4KNYA 2BV6A 3TO7A 2WTEA 2V79A 3F8CA 2H27A 3RYPA 1BN5A 4LD5A 5ED4A 5L3DA 4XLNF 3HIFA 2QZ8A 1BC8C 4OIOF 1HW2A 1EH7A 5TRDA 3R61A 3FWEA 4UVCA 2ETHA 4ENNA 3EYIA 2Y0MA 4HV5A 5L3BA 5A2QZ 1K7AA 2KJBA 1ZREA 1FOKA 3EUHA 4QWQA 3GEZA 3GFIA 4QLCU 3CUQB 4KIBA 2PQ8A 1BIAA 1FYMA 1LVAA 4O3MA 5D6EA 2DPDA 3RPUA 4LG0A 1L0OC 4M6XA 2VBZA 4KT5C 3VODA 5JFRA 3PFIA 4IVNA 5HDNA 4LB5A 2IA1A 3M8FA 4CYDA 3S2WA 5BQTA 5L3EA 3T8TA 5LHIA 3LAPA 2FSWA 3FM5A 4PDKA 2Z3YA 1R5GA 2X0LA 3L7WA 2IT0A 1BBYA 3T0YA 3WE2A 4MTEA 1IAWA 2HEOA 4LB6B 3ABTA 5CYVA 3L00A 1BOAA 2JTVA 4I0BA 3D0SA 3HRMA 4HF1A 3FHZA 4MTDA 4FX4A 2GAUA 2EV6A 2ELHA 3BP8A 2GXBA 2QUFA 1K78B 3DP7A 3P7NA 1LQ1A 2EK5A 1ZGJA 3EDPA 3J81K 4LK1F 1R23A 5FLXZ 2R3SA 2F5CA 4U88A 4RB3C 4Z2YA 1UFMA 3MFKA 4JK1X 1DP7P 1XGMA 4AD9A 1XN7A 4AWXB 3R0AA 3KP2A 2H09A 4G6QA 4I98B 2HTJA 3ELKA 1IN7A 1O7LA 2FMYA 3K9TA 2STWA 4G9YA 2LSOA 2IP2A 4OMZA 1BM9A 2WWYA 4XSXF 4WK8F 4RGXA 5LRRA 1BC7C 3K1PA 4Q48A 4IRIA 3KLNA 2EV0A 3HRTA 5DUKA 1CGPA 4N9HA 1HSTA 5JI6A 4IPAA 3WTTC 2JT1A 2QM3A 5FFXA 1RUNA 2XAJA 4O5VA 3LQQA 2XAHA 3R0JA 4RB0A 5LGUA 1KGSA 1OPCA 1OYWA 5LEKA 2A61A 2FMLA 5LBQA 3WG9A 3V7RA 3E97A 4M74A 4Q47A 1BI3A 4OIQF 1JHFA 5EEGA 3R6SA 1FX7A 1TBXA 3I59B 2A5YB 1P6RA 3SQNA 2XKOA 2VBYA 1RI7A 3I54A 1REPC 4YG2F 2VE8A 2DLLA 4OIRF 4LLGF 1IF1A 1KYZA 2E7WA 5BS6A 3ROUA 1ZGAA 3KFWX 1S3JA 3IRQA 1K6OA 2FQ3A 3FMRA 4YIIA 1YW9A 2HOEA 4LK0F 4MEYF 3ZMSA 2Z9OA 1ZG5A 2IVMA 4EGYA 3WE3A 3M9AA 4PCQA 2FNPA 1RIOH 2IW5A 1FWZA 1KA8A 2OAZA 5CVIA 5AONA 2XKPA 1MZBA 4RAZA 5K5QA 2W85A 1ZLKA 5ICEA 5H6RA 3RJPA 4M72A 4Y17A 1UHMA 3GWZA 3ECOA 3HTUA 2D1HA 5LHHA 1VTNC 2FF4A 4U7DA 4UUVA 4IRGA 2FBHA 1XGSA 1GHCA 4EMSA 1B9NA 1LDKB 1ZLJA 4JBAA 4KDPA 4GYGA 1OYIA 1U5TB 2CGPA 1FYLA 2DTRA 3W6JB 3CUQC 4EJVA 1BJAA 2O61A 5J6XA 5DCFA 4MEXF 4HQMA 4A5MA 2PN6A 5TJJA 3TDZC 3QP6A 4GYIA 1UB9A 2P6SA 1T0FA 2KIUA 3O6BB 4L9TA 4L5JA 1P4AA 2MA3A 3J80K 2J5PA 1FZPB 5HDKA 4P5OA 2QQAA 3BZ6A 2PBIA 1T38A 3ML6A 3I58A 1JGSA 2D1VA 3HTSB 1EH8A 1YLFA 2V1DA 2M1BA 1MKMA 1FBSA 4M9XA 2QENA 4ENMA 1MJAA 3E5XA 3COAC 2RC4A 1I5ZA 1HW1A 1YTYA 2NNNA 4CZZA 2HZTA 1WKMA 3FF5A 5FFZA 1G3YA 1OR7A 1H9GA 3C3WA 2ZMEB 3ZMUA 2AS5F 2Z5UA 1XD7A 1XCVA 4P9UA 1QPMA 4XLPF 4EQQA 3BPXA 4NHJA 3O2PE 4R1HA 3KP7A 5ILVA 4XRFA 5J8FA 2VN2A 5IT9Z 2YPRA 2XAGA 3JSPA 2EFPA 2H6CA 3BJ6A 1D5VA 2KRFA 4EGZA 3W6KB 3KZYA 4E70A 1Z6TA 2MLGA 5HVQC 1DPRA 2EJRA 2ADUA 1SFEA 5JHUA 2F2EA 2PJPA 2VC0A 1U2WA 2GZWA 3F6OA 4P9FA 1LEAA 2E7XA 3WTVC 2OZ6A 3PQKA 3HOSA 5A2QK 1WSUA 2KIFA 4KA4A 1V4RA 2G7HA 4B09A 3LWFA 2PG4A 3VOEA 1USTA 1KU3A 3KETA 2A3SA 3LA3A 3F8BA 2GQQA 2ZNZA 3PQJA 5E20A 1E2XA 3FMQA 3P9CA 5D8LB 4N0BA 1CF7B 1S6LA 1IXRC 4RB1A 5D5VB 3KE2A 2L01A 2OQRA 2ZKZA 2OQGA 4A6EA 2ZXJA 1OMIA 2HYGD 4GCVA 1U78A 5HS8A 4CO8A 4EM0B 1TLHB 5FGMA 2VOPA 3GYHX 1HSJA 2UWMA 4NQWA 5F6FA 5DD4A 3G3ZA 2FNAA 1FBUA 3SFZA 4WF2A 4ENKA 3GLXA 1A04A 4A0ZA 3CO7C 4PGGA 1ZRCA 3EQLF 5HLHA 2QVOA 2J5OA 3V8KA 5DV5A 3Q9VA 3K0LA 2Q0OA 2PI0A 5LGNA 2L4MA 2MC3A 4ZYHA 5AIQA 4KN7X 5FLXK 4BNCA 4RGSA 2PMHA 3BJAA 3HHGA 4FX0A 3MWMA 2BGCA 3R4KA 3CUQA 2QBYA 3GFMA 2PEXA 3EETA 2HWVA 4A0YA 4F7ZA 2AXLA 2JRTA 5ERIA 4CXFA 4ON0A 3GVAA 1U5TC 3B73A 4EM2A 1TNTA 3IL2A 1Z6RA 4H0EA 1KYWA 1BIBA 4UV9A 1YS7A 2M87A 3GFJA 4MNUA 3K1MA 1SD4A 4RB2C 4KICA 4A2UA 2DBBA 4ASNA 4LG0B 2UXNA 1FSEA 2A6EF 2DT5A 3GUDA 5D4SA 1PP7U 5IT3A 2QQ9A 3KCCA 2RGVA 3ZN0A 3RKYA 3L2CA 1LEBA 1WQ2A 4WWCA 1O7FA 3R60A 1D3YA 3HSEA 1P92A 1SMYF 3H3ZA 4PZJA 5D5XB 4JQFA 4BYYA 3JAMK 2BYVE 2CYYA 1K78A 4PGHA 1IRFA 3ULQB 2YSRA 1Z1DA 1ZARA 3RKWA 3TKYA 1ON1A 3F8MA 2DQLA 3GO5A 2P5KA 4BAYA 3E5QA 3Q5FA 2KJCA 4HX8A 3VEPA 4UVAA 2F5EA 3WGIA 4IXAA 2R7DA 3E6BA 1ZAOA 3BWGA 2A07F 1UCRA 3I0TA 3K69A 1IW7F 1E17A 4EV0A 1WRJA 3IKVA 3V7SA 3ZP5A 2BE5F 4IF4A 1MD0A 3BPVA 3V8JA 1WWXA 2ZO4A 1BI2A 2CG4A 3DPTA 3LQRA 4N9IA 4HF2A 1QBJA 1U6GA 1O3RA 1ZH5A 2HR3A 2XROA 5EEHA 4EM1A 3FXUA 3MEXA 1Z05A 1PDNC 4I09A 1EH6A 4HDVA 4TV7A 1ODDA 3ZMZA 4IRHA 3IC7A 2UXXA 4KMUX 3QOPA 5HLGA 1IN8A 4IHSA 3M8EA 3JAMZ 2EB7A 2JZYA 3BOQA 3VB2A 1FYKA 4L9VA 1OYYA 1QNTA 1J7KA 2RNJA 2E1NA 2OBPA 2XHKA 4GO1A 3RIRA 4EJUA 3I59A 1W7PA 2W84A 5JR3A 2Y48A 3KP3A 4G94A 3ZN1A 4ZYDA 4ESFA 1R1VA 2P8TA 3WTWC 2RV8A 5E1ZB 4ZZDA 3C18A 3F8FA 5HDGA 4L5IA 1T98A 3M1EA 2DAOA 1XCBA 2LDUA 2DU9A 4I01A 2P5LC 4WXCA 4MHGA 4G7ZF 1GXPA 2EA4A 3CO6C 4G8XA 3ZMTA 1F9NA 1T2KA 3TQNA 2HGCA 2STTA 2A6HF 3MAJA 2V9VA 1U3EM 2IRFG 2ISZA 2RVCA 1J9IA 4M71A 1TQIA 1XSXA 1B4AA 2HQRA 3EYYA 4A5NA 2VC1A 4K2EA 1XMAA 4A0XA 2K02A 5KVRA 3REOA 2MLKA 1SFUA 5LRSA 3SZPA 4BHCA 5LLQA 3P9KA 1NHAA 4G6DA 3IWFA 4HF0A 3GF2A 4U7BA 1HKQA 1RZ4A 2FXAA 5E8IA 4BXUA 5E1XA 2L3DA 1R1UA 2ACJA 4BH9A 1EV7A 2P7VB 4UHTA 2V6CA 3RPQA 2HDCA 5IT9K 2VT3A 2H94A 2O6GE 1H0MA 4R79A 1LNWA 3NQOA 2NRAC 2NNYA 2E1CA 5K5OA 2HTSA 1KU7A 5ICFA 1TNSA 2HS5A 3N4MA 3F22A 4S05A 1PP8F 4RGUA 2DW4A 1USSA 4XBFA 4GGGA 4HLXA 1I1SA 3HOTA 1B1BA 1T6SA 4S04A 2MD5A 3IWZA 1UHWA 2GA2A 1MDMA 5FB2A 5CVUA 1S8NA 4MQ9F 2BBYA 1MGTA 1B6AA 2VBWA 1HW5A 4R8HA 1FSHA 1ULYA 5DYMA 5K5RA 3ZMDA 2L54A 3FZVA 3U1DA 2CFXA 1JXSA 3LA2A 3T8RA 1B59A 3TDUC 1J5YA 4HLYA 2BEOA 2FRHA 2HKOA 3JTGA 5ICGA 2EA2A 1YS6A 3GXOA 3RKXA 2F5FA 3RDIA 2P7CB 1W7PD 2NAZA 2HQNA 2V1UA 2FE3A 1J2XA 1AOYA 4Q4ZF 1H9TA 4DQ2A 3L9FA 2K27A 1PUEE 3RTRA 1FP1D 3WTXC 2DK8A 4MGRA 5CLSA 1WI9A 4LJZF 3DKWA 2NYXA 1R22A 3K1NA 3OOPA 2P5VA 4GXOA 1SAXA 3WU0A 1K79A 3WODF 5DEQA 5DCMB 4AIJA 3H3UA 4OU0A 3CLOA 3FM3A 1AWCA 4KYWA 1QZYA 3I53A 4OINF 1YFHA 4YFKF 2NS0A 1Z91A 2CW0F 2KIMA 3ZMVA 1FT9A 5D8KB 1S29A 1I1GA 4LMYA 2CO5A 2ZNYA 5JVTA 1LDJA 1YO5C 3G73A 2PFBA 1STZA 4KIFA 1J75A 5ILSA 2VODA 4AIKA 1YG2A 3HSFA 3ISPA 4P96A 5CVRA 1DUXC 4A6DA 4ESBA 2XAFA 2M30A 1DPUA 3VFZA 1KU2A 2LKPA 4HOBA 2FA5A 4UVBA 4LLNA 3RYRA 1D8KA 4ZH4F 2PLYA 1GVJA 1W5SA 1RUOA 2QQBA 3V4GA 1C0WA 2V1XA 2RDPA 1IXCA 1W4MA 2XV4S 1LJ9A 4CDGA 1QGPA 1F5TA 3M7GA 1O3SA 4WX9A 3CJNA 4Y15A 2G9WA 4Q5SF 4KMFA 3FX3A 1SMTA 2K7LA 2DPUA 2QYOA 4RS8A 2K4BA 4L0YB 1F1ZA 5FD5A 3O3KA 3JW4A 1J0RA 3U9GA 1SD6A 5L3CA 3F72A 3TOAA 5FO5A 5DUIA 5HLIA 5DDGA 1V3FA 2G7UA 1IN4A 3F21A 2LF8A 2CQKA 3MCZA 2IA0A 3E5UA 2VOOA 4G7HF 4OMYA 2VT2A 3I4PA 1MJ9A 1TW3A 2D2WA 1G3TA 2YR2A 4RGRA 5AIPA 3F23A 3KLOA 2M45A 3LFKA 1JE8A 2X4HA 3E6DA 1DDNA 3SZTA 4IJAA 1J59A 2QWWA 3DV8A 2WV0A 2EFQA 2QBYB 1BI0A 3QRFF 3ERED 2GXGA 3MZYA 4KN4X 2QLZA 3AAFA 1YYVA 3KP4A 1TW2A 3KEQA 2XGXA 2ZBKA 2FBIA 2W57A
chains in the Genus database with same CATH superfamily
4KJZA 2M0MA 4M9ZA 2YU3A 4Y13A 4HX4A 4I6ZA 3HSRA 2JVHA 3A0BC 2ZXHA 3J7ZI 4E7JA 2I8DA 4KFCA 2F5DA 2MH9A 3H9GA 3J7AO 3EUKL 1IRZA 1R1TA 3C7JA 1R00A 1T0FC 4BS9A 2O8KA 5H6QA 3S1QJ 2O8XA 3K4NA 4HG2A 2DJIA 3FXLA 4LGWA 3PJRA 4J00A 4B8XA 3LSTA 3QPHA 3RI4A 3LAJA 2DMUA 4HBLA 1JJ6C 4QTRA 3RKQA 1VQ4I 2LD5A 1JJ8C 4G12A 3I64A 1HDDC 1XMXA 1LB2A 1SD7A 4RAYA 2VPLA 4S0HB 3OL3A 5F64A 3TO9A 1RETA 1I39A 1JUMA 1X3UA 2OUMA 2E71A 3AG4H 1DU6A 2MSYA 3MQ0A 2DA7A 1BI1A 2DA1A 3DU6A 3KYCB 3ZQCA 3KEOA 2M4KA 2AQFA 3CC7I 2YX4A 2P6TA 2LF7A 4P55A 3OYGA 3QAHA 3PM1A 4FT8A 3T5XA 4L18B 2BOLA 4YIFA 3JRAA 1TL8A 5LHGA 1R36A 2FOKA 2XB5A 5E8GA 3CZ6A 3WTUC 3G1MA 4HV6A 4IOAF 1G3WA 4JX6A 2R7OA 2OTJI 2V1NA 3LA7A 4AYBA 3ASOH 4U0YA 2JA6J 5D5WB 3SEZA 1M1EB 1P4XA 1YIOA 3KP6A 3ZPLA 2XRNA 1R58A 1RNLA 2WAQN 4PJMA 3HRSA 2DOAA 2ISYA 2GIVA 4U87A 4BJ5C 2L9RA 1FJLA 3GFLA 4HQEA 4KT6A 4DBRA 4I02A 2DFIA 4AVZA 1OISA 2CUZA 1UG0A 2HU9A 3DXJF 3OS1A 4XLHA 2VXDA 1OR7C 2XSDC 3I4NJ 3BDDA 4NC7A 1QZZA 4UNOA 2RQPA 1JUSA 1OCRH 3VSLA 3ASNH 4ESJA 2Q8KA 1S7OA 3BROA 2R4GA 1G4DA 1UZCA 2CQNA 2E1OA 1QO0D 2EV5A 2QA4I 1BR4A 2VBXA 3Q9SA 4KISA 3JSOA 1ITYA 3DU5A 3F8NA 3ERMA 3H0GJ 2IXSA 4U0VA 1GV2A 2JSCA 1L3LA 1TWHJ 3V7CA 4QPQA 3IRRA 4H4KC 3IKTA 2E60A 3CF5F 1ZG1A 4C3JJ 2JMWA 2M8EA 4YFNF 3M8JA 1P7IA 3ZQIA 3D5LA 4M3DA 4BY7J 1O57A 1FP2A 4DYRA 1AU7A 1N25A 2O3FA 2V9PA 3CDHA 1D8JA 4OIPF 3SEQA 5E79C 1HBXG 1FPQA 1IUYA 1HQCA 1R5ID 1EF4A 4NDLA 5L3FA 4HSRA 2X6WA 1XDSA 2W24A 1B9MA 4A69C 3QP5A 2KMUA 4OAZA 3GX4X 4D0PA 5EG0A 3GZNB 5ILUA 2KFDA 3E6CC 3JTHA 2MW8A 1IZ1A 1S72I 3F3XA 1IN5A 3S2HJ 5GTHC 3CDLA 3LNQA 1IDZA 2GBYA 1H8AC 1Z9CA 3CUOA 2CU7A 3QPTA 2VKVA 2XAUA 4UUSB 1YX3A 4F91B 1YQAA 5BOXA 2GXAA 4XSZF 5CVJA 2RAEA 5LGTA 2M9HA 1XGNA 4DJAA 1AKHB 2XAQA 3FXRA 4CCOA 2ZJ2A 3OYDA 1ACIA 2DFFA 2B9SA 2HPIA 3J81Z 1ZQ3P 4CYCA 3GW2A 4G6TB 2IS2A 3W2VA 5FLVA 2QKMB 4ZYGA 3W2WA 5BPDA 3KZZA 1VNDA 4O6JA 4E7SA 2LNBA 1XDUA 3FK7A 2V26A 2DA2A 2Y75A 3WG7H 1Z0XA 4ENJA 5C3EJ 1W7PB 1KQ9A 2L4AA 2XGCA 4A3KJ 2D45A 2COBA 4PSXA 2Y9YA 1QVTA 1FIAA 2KRHA 2EQRA 1ZHFA 2TDXA 3IUOA 5EGOB 4YFXF 2CS3A 2OZUA 2M5WA 2K4JA 1X1CA 4AVPA 2H6BA 3BY6A 2QSHX 1WHUA 2DT7B 3B6AA 2M7AA 1WVRA 2XUBA 2K9MA 4M6VA 3SXYA 5EEAA 5E1WA 3CMEI 2L7KA 3H92A 1MJBA 3WGGA 1V5GA 1FBQA 2KZGA 2COMA 1Q1HA 1HKSA 5GAHJ 1A5JA 2XVCA 3CMAI 4BQAA 3MZ8A 3HOZJ 3AFHA 4AM3A 1MBFA 1Z21A 2YX7A 2Y0SN 3DFGA 3H9QA 2XIGA 2UZKA 3NRVA 4BL0B 4XOTA 3ZRGA 1JGGA 3WGHA 1TQPA 4XM3A 4Y7NJ 5J4YA 5F1RA 1HXDA 4GDFA 2FEZA 2VONA 1R71A 4B47A 2EFWA 1SAUA 1ZYRF 4KIGA 1SANA 4HYEA 4WXHA 1LKXA 1XSDA 3S17J 2AQEA 4HEA2 1IRGA 2TRTA 4I2OA 3LSHA 1MMGA 4YEJA 4A3CJ 1VZ0A 1HKTA 2MH2A 1XGOA 4LFUA 3CESA 1SD5A 3K4KA 4ZYEA 5E17F 2XASA 2W82A 4LLLA 4BHPA 1Z3XA 5D6FA 2NVQJ 5C4XJ 4XQFA 5D5UB 3IHUA 1TQMA 2A6TA 4ZZLA 2XF7A 4BDZA 2V6EA 3GZ5A 4NB5A 4OOIA 1H88C 2Y30A 5ICCA 1U5TA 2MBFA 3C2HA 2DDAA 2HKXA 4CUGA 5HOOA 1FMWA 2RKHA 2LP0A 2HI3A 4ETSA 3N97A 1QZEA 4P1WA 2M8GX 2JPCA 2DA6A 1OLTA 3IP4B 5M3FJ 1K4SA 1N78A 2RN7A 2Y9ZA 4BUPA 3OIQA 2HVSA 3FXMA 3E3VA 3TO6A 1W5TA 1FNNA 4UV8A 3GZ6A 4D5CA 2LOOA 2XDVA 5H20A 5CVVA 1PUFA 4BQQA 1U8RA 4IHTA 2P4WA 3KP5A 3V8LA 3QOEA 1FTZA 3OYMA 3M3YJ 5J8CA 2FUG2 3I71A 3NEUA 1LFBA 4V19K 4WXDA 3PO3J 2A5WA 4MO7A 2K86A 4FE7A 3VDXA 2KKOA 1ZRDA 4DIQA 3QU3A 2Q2EA 2XC7A 4BU2A 1W1WE 3OYAA 2Z33A 1ZK8A 1OKRA 1Y0UA 4DNCA 2DYSH 2DYRH 4HZFA 4UXNA 1Y6IA 4AIHA 1XPXA 3SHFA 2LRDA 3L2QA 3T1BA 2K9NA 2KIQA 3HUGA 1LFPA 3CTAA 4PUSA 2JPBA 4FHTA 4IHYA 3HYIA 3ZQGA 3X2QH 3HOYJ 2BVLA 1FLIA 4XIDA 3HG9A 2Q1ZB 5KK1A 1WH5A 1YW7A 5HS9A 3WTYC 5GPCA 2L7FP 1Y39A 5IY5H 3OYBA 1MDMB 2ESHA 5J47A 4KUMA 2O9LA 2F5VA 3F9KA 3H1CA 4I7HA 3QYFA 1Z7UA 1IRXA 1WJAA 4L0ZB 2CSOA 3JRIA 4BEHA 2ZMEA 2JK3A 2Z2SB 1ZN2A 1KQ8A 3ZCOA 1YITI 5J1YA 1I27A 4AIDA 1APLC 3GLLA 3H0DA 2VIXA 4CICA 3WTSC 3WU1B 3MZHA 3C1DA 2R7RA 2N8GA 2QEXI 2ZCWA 3ZQHA 5CJ9A 2A69F 2HYFA 3DPLC 1ENHA 4MQVA 3RQIA 5K1YA 2R7QA 1O3TA 1SFXA 5IOZA 2DI3A 2W48A 3QU6A 3U1KA 1XTAA 5BMZA 4M9SA 2OPTA 4CGZA 2EFNA 1XSVA 2GWRA 4XKCA 5EF6A 1G6NA 2JRMA 2KLOA 1GXQA 3WTZA 5IYCJ 1HCRA 2KHMA 2EFOA 3DQVC 2OA4A 1FC3A 3JR9A 3OWTA 1LE8A 1R7JA 4G7OF 2ELJA 3HL2A 3MKZA 4M6YA 4E4HA 1T39A 3I5UA 1JHHA 4PJ0C 1KU9A 6PAXA 5DCMA 3G4SI 2Z99A 1KQ0A 2X6XA 2ZFWA 1A6IA 3LSGA 3CCJI 2CUFA 1EKEA 3TOBA 3G1OA 2GA1A 3SDGA 1W36C 1XG1A 2DOFA 2LKXA 3MMYB 3GTQJ 5M5WJ 5HNFA 5IYDJ 1YW8A 2L02A 3FMSA 4EVIA 1S7AA 1ZTRA 3BR6A 3U2RA 1S5LC 2IPQX 2X1EA 4EJWA 3HRUA 5KCMA 3JRHA 4HDUA 4OWRB 3U21A 2VE9A 1MNEA 4DOZA 4DYCA 4HAMA 1OQYA 2EWNA 3P9IA 3J80Z 1I50J 3RCOA 4II3A 1ONVA 3HHHA 4CCJA 3ECHA 4V2FA 4CHUA 2VXZA 1FY7A 3CCQI 1O3QA 2LFBA 1OCCH 4I0AA 5L3GA 1F4KA 2B63J 3J7AY 3FXQA 2W25A 1IC8A 3DF8A 1R6RA 2A68F 1G2HA 1XB4A 2IJLA 1Z67A 2XGDA 4LITA 1IO2A 2DO7A 1ZG3A 3BJOA 3SFIA 3ZQ7A 3TGNA 2XPVA 4JX4A 2PMZA 1TTYA 1P2FA 3K2ZA 4EJOA 1T33A 1UELB 2JN6A 3ABUA 4DZJA 4YELA 5JHFA 4FTHA 1K61A 3BTCA 1LDDA 2VL8A 3LSKA 2K5CA 4BHBA 2BY1A 2HFHA 1I6XA 1CF7A 1G3SA 1ZRFA 4A12A 2C6YA 4EJTA 2B0LA 3UR3C 1QVUA 1R4NB 4L9JA 5J1RA 3S1RJ 3PSFA 3B02A 4U0WA 5DD8A 3ZGKA 2LH9A 2KRCA 3HKZN 3IH3A 1MMDA 2IA2A 2PMUA 2O03A 2IGKA 5LEJA 3SZGA 3G2BA 3E6MA 4XICA 2EPFA 1P4WA 4M3FA 1SVMA 5D4RA 4XL9A 2FU4A 3H5AA 2JA8J 3TW6A 5DM7F 3GTMJ 4FE4A 4HX7A 5HS7A 4WCGA 2DK5A 4F3QA 5BPIA 2QSFX 2O0YA 2DXIA 4M73A 1OCZH 3K6GA 5E18F 1W0UA 1IXSB 2OD5A 2FBKA 2R7UA 4L9NA 2R7FA 4LIUA 4HA8A 3DCFA 3F6VA 1ON2A 3OV8A 2NVUB 2OF7A 2W00A 2ESNA 4HW0A 2M4GA 1IN6A 3QODA 1FMVA 1R5HA 1QQIA 1X1AA 2OU2A 3PUFA 3L09A 2WC2A 2CWEA 5FD6A 2DQRA 1KONA 1XMKA 2DMNA 3DEUA 4NQWB 4KNYA 2BV6A 3TO7A 2WTEA 4XKBA 4ZC3A 4XRMA 2V79A 2HVQA 3F8CA 2H27A 5EDNA 1S7EA 1D1AA 3CCEI 3RYPA 1BN5A 4LD5A 5DS9A 3MD2A 4ZDOA 4PJLA 5ED4A 5L3DA 2DTZA 2HDDA 4XLNF 5B66C 1QHHD 2IEKA 3HIFA 3WU2C 2QZ8A 1BC8C 2R5YA 1QU3A 4OIOF 2FJ1A 4LOCA 1HW2A 1EH7A 3S14J 2NOGA 4ANJA 2ZJQF 5TRDA 4PSWA 2EBIA 3WHBA 3R61A 3FWEA 4A3JJ 1NH3A 4UVCA 2ETHA 2X51A 4ENNA 2EIKH 4KITB 3BC8A 4IQ4A 3EYIA 2PJRA 1HF0A 3OYLA 2Y0MA 4HV5A 3LSRA 1S9HA 5L3BA 5A2QZ 1K7AA 3OIPA 3BR0A 1J09A 2KJBA 2M3AA 3OYFA 1ZREA 1X58A 2W4SA 4HRIA 4PFOA 4XK4A 1FOKA 3EUHA 4QWQA 3GEZA 4XLCA 4BXFA 3GFIA 1BL0A 4QLCU 2AO9A 1RR7A 2MGQA 3CUQB 4KIBA 3GTOJ 2PQ8A 1BIAA 4BGDA 3GTPJ 2KT0A 2KDOA 1LVAA 2LY2A 3VYRB 1FYMA 4O3MA 1SVOA 3NWTA 5D6EA 3MKYB 2DPDA 3RPUA 3M07A 4LG0A 5B1BH 1L0OC 4M6XA 2VBZA 3BTIA 3QPLA 4KT5C 3VODA 4DYQA 5B3SH 3PFIA 5JFRA 5TGTA 4IVNA 2VKHA 4XKWA 5HDNA 1D0XA 4LB5A 2NVXJ 4RAGA 4BE0A 1YE9A 2IA1A 4RMNA 3M8FA 4CYDA 3S2WA 5BQTA 5L3EA 2WV1A 3T8TA 4ZTJA 2ZXIA 5LHIA 1YRNA 3CJRB 5GP9A 3LAPA 2FSWA 3FM5A 4PDKA 2Z3YA 5F08A 3A01A 4C2UA 1R5GA 2X0LA 2DA3A 3PIOF 2MD0A 3L7WA 1TT5B 1E3HA 2IT0A 2R93J 4D7MA 1BBYA 2W1OA 3T0YA 3WE2A 4MTEA 1IAWA 1BOBA 3BR5A 1JI8A 2HQ5A 5JVGF 3CJTB 3I3LA 4XRSG 2HEOA 5F1JA 2L9VA 4LB6B 4BKXA 3ABTA 2ZSHB 5CYVA 2GM4A 3L00A 1BOAA 2R5ZA 2JTVA 4I0BA 2IS1A 4IQJA 3D0SA 3HRMA 4HF1A 3FHZA 4MTDA 1X3WB 2LBFB 4FX4A 2GAUA 2EV6A 2KP6A 1R9TJ 1SC7A 2VI6A 2ELHA 1U8BA 4C3HJ 3BP8A 2GXBA 2QUFA 4RAFA 2ME6A 1K78B 1YIJI 3BQZA 3DP7A 3P7NA 1LQ1A 2MG4A 2EK5A 3MVPA 2EINH 3C2GA 1WCMJ 1ZGJA 4B3XA 2LYCA 3HOWJ 4QPOA 1Y1WJ 3EDPA 3J81K 4LK1F 3LSJA 5CQGA 1R23A 5FLXZ 3I56I 2R3SA 2F5CA 4U88A 5EZGA 5C44J 4RB3C 1DP3A 4C2TA 4Z2YA 1UFMA 4RM3A 3TP3A 3MFKA 3BCBA 4QIWN 4JK1X 5F0CA 2VJIA 1DP7P 1XGMA 1ETVA 4AD9A 1XN7A 4AWXB 3R0AA 2CV2A 3KP2A 2H09A 3BG9A 2BZTA 2ID6A 4G6QA 2LMDA 4XNFA 1X2MA 1VFCA 2DMPA 4I98B 2HTJA 4HPQA 3ELKA 2DCEA 2CMPA 2EZKA 4JYKA 3TW7A 5IOYA 1IN7A 1O7LA 1FTTA 2FMYA 2HYJA 1UG2A 1FEXA 3K9TA 2E5NA 2STWA 4G9YA 3FHNA 2LSOA 3VWBA 2E1MB 2IP2A 4OMZA 1BM9A 2K9LA 3HPHA 2WWYA 4XSXF 3S1NJ 4WK8F 4RGXA 5LRRA 1MMSA 1BC7C 1RRJA 3K1PA 3P5JA 4Q48A 4IRIA 2DJNA 3Q0WA 3H3VK 4FCYA 4M3BA 3S16J 3KLNA 2OCEA 3HOUJ 2EV0A 1TWGJ 3HRTA 5DUKA 1CGPA 3GTLJ 4A3DJ 4N9HA 2AHQA 1HSTA 2CQ7A 3A4CA 5JI6A 2JUGA 4IPAA 2EZIA 3WTTC 2JT1A 2QM3A 2V7FA 1X4PA 2ZSIB 3K4BA 5FFXA 2XSJC 1U9NA 1ZELA 1RUNA 2ICWG 2XAJA 4O5VA 3OYJA 3LQQA 2XAHA 4B1RA 3KIOA 1TWAJ 3R0JA 4RB0A 5LGUA 1KGSA 1OPCA 1OYWA 2Y2ZA 1TC3C 5LEKA 2JUCA 2A61A 4J01A 4BE2A 2FMLA 4MIMA 5LBQA 1TWCJ 2E19A 3WG9A 3V7RA 2Z1DA 4UUSA 3HB9A 3TEDA 2H1KA 4IX7A 3E97A 4M74A 1AKHA 2XRLA 3DEWA 4Q47A 1BI3A 4OIQF 1JHFA 1LVKA 3OR2C 2IS6A 1RR8C 1PYVA 3PNVA 1QRYA 1X3ZB 3FKIJ 2VQLA 2WAFA 1X4OA 3VYUB 1GLNA 5EEGA 3R6SA 1POGA 3BG3A 3OS0A 3PNYA 1FX7A 2NVTJ 4N4NB 1TBXA 3I59B 3K7AJ 3IH2A 2A5YB 2DT6A 3KYLA 2H8RA 1D0ZA 1P6RA 1WJCA 3SQNA 2XKOA 3H5NA 4E6KG 2VBYA 1RI7A 3I54A 1REPC 5KAFC 4YG2F 5LD2C 2NS8A 5EGOA 1YJNI 2VE8A 2DLLA 1MMNA 4OIRF 4LLGF 1WJEA 2LY1A 3V42A 1IF1A 1QPIA 2HOTA 1KYZA 5TISC 3RPUD 4CCLA 2E7WA 5BS6A 2WA0A 2B7EA 3LSPA 3ROUA 1ZGAA 3KFWX 5F27A 3JRBA 1S3JA 3IRQA 2OV7A 4BY1J 1K6OA 2FQ3A 3CLQA 3FMRA 4YIIA 1YW9A 2HOEA 4I99C 4LK0F 2WB1A 3CMYA 2ID3A 3ABKH 4MEYF 4FASD 3ZMSA 2Z9OA 1ZG5A 2EZLA 5GAEJ 2IVMA 4EGYA 1FOYA 3WE3A 3M9AA 4PCQA 1YOVB 2BVMA 1WJBA 5K7ZA 2FNPA 3PNTA 2R0QC 3A03A 1RIOH 2IW5A 4A3GJ 2L5QA 3CMMA 1UJ8A 2CV0A 1FWZA 1KA8A 2OAZA 5CVIA 3QPSA 5AONA 2XKPA 1MZBA 3OY9A 3G1LA 4QSHA 4RAZA 5K5QA 2W85A 2K9SA 1RKTA 3GCMA 5ICEA 3BTJA 1ZLKA 5H6RA 3RJPA 4M72A 2X6OA 1NG7A 4ZDPA 4Y17A 3ONQA 1HOMA 1WGXA 3CCMI 1UHMA 3VSKA 4RA2A 2LTPA 3GWZA 3ECOA 2E5ZA 3HTUA 3Q3SA 2D1HA 5LHHA 1VTNC 1AHDP 2FF4A 2ZJRF 4U7DA 1SVLA 4IRGA 5JLWA 4UUVA 1WFXA 3SYTA 2FBHA 4NBQA 1XGSA 1GDTA 1JT6A 3AG3H 1GHCA 5B1AH 4CCKA 4EMSA 1B9NA 1LDKB 1ZLJA 2FQ4A 1E0EA 1LUJB 4JBAA 3TP0A 4KDPA 5B5EC 3KZIC 4GYGA 2DA5A 1OYIA 1U5TB 2CGPA 2HXOA 1FYLA 1B72B 1IV6A 2DTRA 3AL0B 3W6JB 3W2AA 3CUQC 4EJVA 3KEYA 1BJAA 2I5UA 4D9JA 2O61A 4FETA 5J6XA 1K4TA 5DCFA 4MEXF 4HQMA 3JRDA 4A5MA 2WY8Q 4F55A 2PN6A 5TJJA 2WAQA 3TDZC 4A3IJ 1U9OA 3QP6A 4GYIA 2CW7A 1VQ8I 1UB9A 2P6SA 1T0FA 5IPAA 2KIUA 4C9YA 3O6BB 2LG4A 4L9TA 1DGWY 3GTGJ 4L5JA 1VQMI 1PUFB 1P4AA 2XF6A 4C2MJ 2MA3A 1YHQI 3OYKA 1UAAA 1IJWC 3J80K 2J5PA 1FZPB 2XGEA 1Z3YA 5HDKA 4P5OA 3OS2A 1W5CC 3H36A 2QQAA 3K4LA 3BZ6A 1HC8A 2PBIA 1T38A 2GOMA 3ML6A 3I58A 3OL4A 1VQNI 1JGSA 2BY0A 1V5FA 4I76A 1WI3A 2D1VA 3HTSB 1EH8A 1YLFA 5FLMJ 2CW8A 2V1DA 2M1BA 4EATA 2V4JC 1MKMA 4BXXJ 2VKDA 4HSTA 2OJED 1FBSA 3HUGB 3LMMA 4RDUA 3DWLE 3LFUA 4M9XA 2QENA 4ENMA 1ORKA 1MJAA 4C3IJ 3E5XA 3COAC 2RQQA 1MH3A 2RC4A 3FXKA 4NUBA 1I5ZA 1HW1A 2HOSA 1YTYA 2NNNA 3A02A 2L2OA 4CZZA 2HZTA 1WKMA 1XC5A 4PJJA 3FF5A 3OMYA 5FFZA 5FKLA 1G3YA 4CA0A 3S1MJ 1OR7A 2QGUA 3FIWA 3C3WA 1H9GA 1R4MB 4BEHB 2ZMEB 1JKQC 3ZMUA 2AS5F 2Z5UA 1MSEC 1EA3A 1XD7A 3DTEA 2YU9J 1AA7A 1XCVA 4P9UA 1VQKI 1QPMA 4XLPF 3UKGA 5F04A 1HLVA 5FKMA 4EQQA 2XPUA 2NOJB 1OCOH 4D1QA 4A3BJ 3BPXA 4NHJA 3QYBA 4HNUA 1JTYA 3O2PE 5H2FC 1X2NA 4HNVA 1W0TA 2K3PA 4R1HA 1VQ6I 2H8WA 2O5RA 3KP7A 4XRFA 5J8FA 5ILVA 1V5EA 2VN2A 5IT9Z 2YPRA 2XAGA 1GT0C 3JSPA 2CUEA 2EFPA 3BLYA 2UUZA 3PUBA 1MBJA 2H6CA 3BJ6A 1D5VA 4FISA 2KRFA 1LE8B 4L5EA 4EGZA 2EZHA 2DFHA 2E1MC 4PFPA 4X1EA 3W6KB 1IGNA 3K4CA 4NNJA 3KZYA 1Y0NA 1SFKA 2K9QA 4MFEA 4E70A 3Q0VA 1B8IA 3HDDA 1Z6TA 2MLGA 2HPMA 3BT9A 5HVQC 1DPRA 2EJRA 2ADUA 2M2EA 1SFEA 3TL4X 2EILH 5JHUA 2F2EA 4XMYA 2PJPA 1ETKA 1MNDA 2VC0A 3JREA 2E34A 4C30A 1U2WA 4CCNA 2GZWA 2R92J 3F6OA 4P9FA 1LEAA 4X6AJ 5IP7J 2IGOA 2FX0A 2Y0SA 2E7XA 4J19A 3D5SC 3K70D 4Y33A 3RZDJ 2WAEA 3WTVC 1JKRC 5J3LA 2OZ6A 2NXNB 3PQKA 5KAIC 3H5RA 3DBLB 3HOSA 1NK2P 3HJEA 2CQQA 2LREA 5A2QK 1DU0A 1WSUA 2KIFA 1VQOI 5HODA 3ABMH 3L2WA 4KA4A 4JP0A 1D1BA 1V4RA 4XLEA 4AYBN 2G7HA 3SDBA 4B09A 3LWFA 2PG4A 3VOEA 1OJLA 1USTA 3CCSI 1KU3A 3KETA 2X48A 2A3SA 4LIVA 1Y8QB 3LA3A 3F8BA 1GUUA 1MIJA 1HA8A 3OSGA 1YX5A 1BA5A 2GQQA 2JWTA 2ZNZA 3PQJA 4AUXA 5E20A 1VQ7I 1E2XA 3FMQA 3P9CA 1I3QJ 5D8LB 2HQAA 4N0BA 1CF7B 3AG1H 1S6LA 1IXRC 4RB1A 1H89C 3IH4A 4MLOA 3KE2A 5D5VB 3HGYA 2ZKZA 2L01A 2OQRA 2ZC2A 3ZQLA 4E7KA 2OQGA 3UNGC 4A6EA 2ZXJA 4JOMA 1OMIA 2HYGD 4GCVA 1U78A 4YRVA 3CCUI 3FXJA 4XLFA 5IP9J 5IP6A 2CFOA 5HS8A 4CO8A 4EM0B 2V9KA 1TLHB 5FGMA 4IHXA 3LSMA 2VOPA 3GYHX 3FISA 1HSJA 2UWMA 1N77A 2CH0A 9ANTA 4NQWA 5F6FA 2YUSA 5DD4A 3G3ZA 2FNAA 1FBUA 4B3AA 3LOCA 1JKOC 1A31A 3SFZA 4WF2A 2EIMH 2KZVA 1A35A 2QKLB 4ENKA 2R7ZJ 3GLXA 1MBKA 1A04A 4A0ZA 1BR1A 3CO7C 4PGGA 4YIRX 3EQLF 1ZRCA 5HLHA 4A3MJ 1WJFA 2JSPA 2QVOA 2J5OA 3V8KA 2GOXB 5DV5A 2ELKA 3Q9VA 3K0LA 2Q0OA 1QHGA 2TCTA 3S32A 2PI0A 2VQHA 3CD6I 5LGNA 2R7WA 2L4MA 2MC3A 3DLAA 4ZYHA 5AIQA 4KN7X 3CP8A 1D0YA 1E3PA 5FLXK 4BNCA 1VQ5I 1O4XA 4RGSA 2PMHA 3I9V2 3BJAA 3HHGA 4FX0A 3MWMA 2BGCA 3QWLA 2BW3A 2M0CA 4DBQA 3R4KA 2Y69H 3CUQA 1OCPA 2IBDA 1I6HJ 2QBYA 3GFMA 2PEXA 1V55H 3EETA 2HWVA 3BG6A 5E3LA 4A0YA 4F7ZA 3CCLI 2DMTA 2PJRB 2AXLA 3B6CA 2JRTA 5ERIA 4CXFA 1LPQA 3DTIA 4ON0A 1N75A 2F4MB 3GVAA 4IL6C 1R49A 1U5TC 1FOWA 3B73A 4EM2A 1JTXA 5HNHA 3AL0C 2K85A 1TNTA 2ZFUA 2A05A 4E7LA 3IL2A 1VQPI 1Z6RA 4DGWB 4H0EA 2M7BA 1KYWA 1BIBA 4UV9A 3OYCA 1MNMC 1YS7A 2M87A 3GFJA 4XN0A 2L0KA 3K1MA 1SD4A 4MNUA 4RB2C 4KICA 4A2UA 3GTJJ 1Y1VJ 2DBBA 4ASNA 4LG0B 2UXNA 1FSEA 2A6EF 3SJMA 2DT5A 3GUDA 5D4SA 2HNHA 5IT3A 1PP7U 2QQ9A 3KCCA 2VUMJ 2RGVA 3ZN0A 3RKYA 3L2CA 1LEBA 1WQ2A 4WWCA 1ETOA 1BW5A 3L2RA 2XPWA 3OOUA 5FJ8J 1YRNB 1O7FA 3RZOJ 3R60A 2CUJA 1D3YA 3CC2I 3A01B 3HSEA 1P92A 1SMYF 3H3ZA 4PZJA 5D5XB 1MBEA 2LBFA 4JQFA 4BYYA 1UHSA 3TBIA 3WHCA 1T8IA 1D5YA 2JA7J 3JAMK 2BYVE 2ZB9A 1MSFC 1RESA 2XF5A 1Y56A 2CYYA 1K78A 4PGHA 1LFUP 1IRFA 3ULQB 2R5ZB 2KL4A 2YSRA 2ECBA 2NS7A 3S2DJ 1Z1DA 4IHWA 1ZARA 3RKWA 3TKYA 2HVRA 2KDZA 1ON1A 3F8MA 1X1DA 4B43A 2IGNA 2DQLA 3GO5A 2P5KA 4BAYA 3E5QA 3Q5FA 4W1UA 2VJJA 2F4IA 2KJCA 2X9DA 3BQYA 4HX8A 3HBLA 2EH3A 3VEPA 1I3AA 3EPZA 4UVAA 2F5EA 1GV5A 3WGIA 4IXAA 2R7DA 3E6BA 2CJJA 2BHYA 2MC4A 1ZAOA 3HC7A 3BR3A 3BWGA 3QQAA 1K83J 4A3LJ 2A07F 5K7FA 1UCRA 2ZMEC 3I0TA 3K69A 3DBRB 1IW7F 4CH7A 1P7JA 2NVYJ 1MBGA 4A93J 4EV0A 1E17A 3KX2A 3FDYA 1WRJA 3HPGA 3IKVA 5EYRA 3V7SA 3ZP5A 2BE5F 4II2A 4IF4A 1MD0A 2VPRA 3BPVA 4RLQA 5E3OA 3V8JA 3VYSB 5DM6F 1WWXA 1IUFA 2LY9A 3HKZA 2ZO4A 1BI2A 2CG4A 3DPTA 3LQRA 4N9IA 4HF2A 1QBJA 1K6YA 4Y4RA 1U6GA 2R7VA 1O3RA 3L1PA 4DZPA 1ZH5A 2HR3A 1SEUA 2DDBA 2KISA 3OIOA 4UB6C 2E35A 2XROA 3D1NI 4RM2A 5EEHA 2FD5A 4EM1A 3FXUA 2HOAA 1Z05A 3MEXA 1PVEA 4E7ZA 1PDNC 4I09A 1EH6A 4BE1A 4HDVA 4TV7A 5K7HA 1ODDA 1RKWA 3DKXA 3ZMZA 4CCMA 3DLLF 1VQLI 2Y31A 3HZJA 4IRHA 4E7HA 3IC7A 2UXXA 1E3OC 3BR2A 4KMUX 4D7NA 3QOPA 5GADJ 5HLGA 3W6VA 1T08B 3BTLA 1XX5A 1IN8A 4IHSA 4BQOA 3M8EA 3JAMZ 2EB7A 4DW6A 2JZYA 1ETQA 3L2UA 4M3EA 4CZCA 2YS9A 2VQGA 3N05A 3BOQA 3VB2A 5GTIC 1FYKA 3K4MA 4N4OB 4L9VA 5EG0B 1OYYA 1QNTA 5EZHA 1J7KA 2RNJA 2UV1A 2E1NA 3Q0UA 5JLXA 3PL8A 1ZGWA 2OBPA 1P9QC 2XHKA 2MYSA 4GO1A 3RIRA 3S93A 4EJUA 2DN0A 2FOWA 3I59A 5FRNA 5GAGJ 1W7PA 2W84A 2L7ZA 3ABLH 5JR3A 2Y48A 3O8HA 3KP3A 4G94A 3ZN1A 4ZYDA 4ESFA 1R1VA 2P8TA 3WTWC 2RV8A 5E1ZB 1RPWA 4ZZDA 5LFAA 3C18A 4CYCB 4CSWA 3F8FA 5HDGA 2DODA 3HM5A 4L5IA 1T98A 1F36A 3M1EA 4F92B 2DAOA 1ZR2A 2JJ7A 1XCBA 2LDUA 1PJRA 2DU9A 1MBHA 2QF7A 4I01A 4ZDLA 2R7TA 2WBMA 5FKKA 1MMAA 2P5LC 2RREA 2CQXA 2LC2A 3BR1A 3K10A 4WXCA 4MHGA 3FXOA 4G7ZF 1Q1VA 2IS4A 1GXPA 2EA4A 3CO6C 1BR2A 4G8XA 3ZMTA 1MW7A 1F9NA 5E3NA 4PJNA 3ZR8X 5C4JJ 1T2KA 3TQNA 4NC6A 4LG3A 2HGCA 2STTA 4E7IA 2DA4A 5FRMA 2A6HF 2P0WA 4IHVA 3MAJA 2V9VA 2VQCA 1U3EM 2IRFG 2ISZA 5FKOA 2BHZA 2RVCA 4AU7A 1J9IA 4M71A 1TQIA 1XSXA 5CPRB 1B4AA 2HQRA 3EYYA 3RQ4A 4A5NA 3S3NA 2VC1A 4ZJZA 3AKZA 2PMZN 1V54H 4K2EA 1XMAA 2BY3A 3C2BA 1X19A 2IAIA 4ZYAA 3TMOA 4A0XA 2JA5J 4UY8I 2K02A 5KVRA 3GTKJ 3REOA 2MLKA 4JX5A 4XKVA 1SFUA 3H9JA 5LRSA 3D5RC 2JQ7A 2XB0X 4IZZA 3SZPA 4X0GA 4BHCA 5LLQA 3W3CA 3GMEA 3MKLA 3P9KA 1NHAA 4G6DA 3IWFA 4HF0A 3FBNB 3GF2A 4U7BA 1G59A 3E0JB 1HKQA 1RZ4A 2FXAA 1WH7A 1U0JA 5E8IA 1G8XA 4BXUA 4RLFA 1B72A 5J1UA 2VJ4A 2DMQA 3ESWB 3IV5A 5E1XA 2L3DA 4F93B 4ABZA 1R1UA 3S3OA 2ACJA 4BH9A 4A3EJ 1EV7A 2VKEA 2P7VB 4UHTA 5M3MJ 1FOXA 1JT0A 2V6CA 3RPQA 2HDCA 5IT9K 1FIPA 3A1YA 3DBHB 4Y3OA 2H1LA 2H94A 2MFZA 2VT3A 2O6GE 1H0MA 3E7LA 4R79A 1W36D 1LNWA 5E3MA 3NQOA 3EUHC 2NRAC 1GVDA 2NNYA 2E1CA 1TT0A 2CV1A 5K5OA 2HTSA 1KU7A 5ICFA 1TNSA 2GIZA 2HS5A 3EUAA 2LR8A 3N4MA 3F22A 4S05A 3FK6A 4ZTFA 2PX9A 1IDYA 2BXYA 3CQZJ 1PP8F 4RGUA 2DW4A 1USSA 4XBFA 4Z6YA 4GGGA 4HLXA 1I1SA 3HOTA 1B1BA 2L9SA 1T6SA 4S04A 2MD5A 3IWZA 1BJZA 1UHWA 2K3FA 2W7NA 2GA2A 1WJDA 3IAM2 2Q2EB 5FKNA 1MDMA 5FB2A 5CVUA 3G6EI 1S8NA 3AG2H 4B44A 4MQ9F 4BBRJ 2BBYA 3NWSA 3VPRA 1MGTA 3CCYA 1B6AA 2VBWA 1IV8A 1QA6A 4BDYA 4F52A 2WY7Q 1HW5A 3OYNA 4R8HA 2OCCH 1FSHA 1ULYA 5DYMA 1T56A 5K5RA 3HOXJ 3ZMDA 2L54A 2GLOA 3FZVA 3U1DA 4FQGA 2CFXA 1JXSA 3LA2A 3T8RA 5J4VA 1B59A 5GPAA 1NTCA 3CC4I 1OFCX 5F0HA 2JA2A 3KPHA 4XONA 1JUPA 1JKPC 2LVSA 1NG6A 3TDUC 4NC8A 1J5YA 2X85A 4HLYA 1BW6A 2BEOA 2FRHA 2HKOA 2OTLI 3JTGA 2HZDA 3G71I 5ICGA 3ZQQA 2EA2A 3BG5A 2E2JJ 1YS6A 1TWFJ 3GXOA 3RKXA 2F5FA 3RDIA 2F48A 4A3FJ 4UB8C 3BCAA 3O8GA 1ETWA 1W7PD 4PK4A 2P7CB 4M3GA 5J40A 2NAZA 2HQNA 2V1UA 2FE3A 1J2XA 3LL7A 2F6CA 3VYTB 1AOYA 4Q4ZF 1H9TA 4DQ2A 2R7XA 3L9FA 2K27A 4BJTA 2ZXWH 5DTDA 1PUEE 3E1SA 3IAS2 1HDPA 2OC6A 3RTRA 3CCRI 1FP1D 3WTXC 2DK8A 1XS9A 4MGRA 5CLSA 1WI9A 3PIPF 1SFOJ 4LJZF 3DKWA 3H35A 2NYXA 1R22A 3K1NA 3OOPA 3PO2J 1Z77A 2P5VA 4GXOA 1SAXA 3DPUA 3WU0A 2JVGA 3WODF 1VF9A 1K79A 4XN3A 5DEQA 5DCMB 4AIJA 2DFEA 3H3UA 4OU0A 3CLOA 3FM3A 1AWCA 4GFBA 2I10A 4KYWA 1QZYA 3I53A 4OINF 1YFHA 4YFKF 2NS0A 1X1PA 1DGRM 1Z91A 2CW0F 3NAUA 4W97A 2D5VA 1ERDA 2BY2A 3ZQFA 3DTKA 2KIMA 3ZMVA 3RSNA 1FT9A 5D8KB 2RNGA 4IO9F 3S3MA 1S29A 1I1GA 2G0EA 3CF2A 2QSGX 2VJ5A 4LMYA 4XLAA 1T95A 1B8IB 2CO5A 2ZNYA 4IOCF 2CRGA 1ETXA 3A0HC 5JVTA 1A36A 2LKSA 1LDJA 3HEFA 1YO5C 3M4OJ 1TZLA 3MKWB 1ETYA 2PFBA 3G73A 3CP2A 4IEJA 1STZA 4KIFA 1ZR4A 4XRSA 1J75A 2WADA 5HLTA 2X6YA 3OR1C 3CDIA 2F4OB 2QCOA 1YJ9I 5ILSA 3PSIA 1MH4A 2VODA 2ECCA 4AIKA 1YG2A 1F43A 3HSFA 3BZCA 2K40A 3ISPA 3JRGA 2MABA 3JRCA 4P96A 5CVRA 4RBOA 1DUXC 4A6DA 3K2AA 4ESBA 2XAFA 3BG7A 3LSIA 2M30A 5F0FA 2P81A 1DPUA 3K4JA 5KNLA 2KPMA 3VFZA 1KU2A 3S8PA 4BACA 2DOEA 2LKPA 1Z7LA 4HOBA 1RC9A 4ITVA 2HDWA 2FA5A 2E36A 3L2VA 4UVBA 4AC0A 1IG7A 3RYRA 4LLNA 1D8KA 3ZXSA 4ZH4F 2PLYA 1GVJA 1W5SA 1CQTA 1RUOA 3FKJA 2O7OA 4V2GA 2R7SA 2QQBA 5IYBJ 3HGGA 3V4GA 1C0WA 2V1XA 2RDPA 1IXCA 1W4MA 2XV4S 3KYDB 3CCVI 3PFYA 1LJ9A 4UUTA 2X1CA 5BNGA 3FBIB 3S15J 4B4CA 4CDGA 3DKYA 1QGPA 1F5TA 3M7GA 3OYIA 1O3SA 2X1DA 4EEFG 4WX9A 3CJNA 5FROA 4Y15A 1TP4A 3J7YJ 2L9NA 3DEEA 2G9WA 4Q5SF 4KMFA 3FX3A 1SMTA 2K7LA 2DPUA 2QQ8A 3HXLA 2QYOA 3ZOBA 3F0CA 4RS8A 2EIJH 3OYHA 2K4BA 5KHDA 4L0YB 1F1ZA 5FD5A 4BJ6C 3OSFA 2L7MP 3O3KA 4Y52J 1D1CA 1J0RA 3JW4A 2VLAA 3U9GA 2HXIA 4XR6A 1SD6A 2M34A 5L3CA 3F72A 3TOAA 5FO5A 5DUIA 1WJ5A 5HLIA 5DDGA 1V3FA 1Y8RB 2ME0A 4MFDA 2G7UA 1IN4A 3F21A 1OCTC 3BZKA 2LF8A 2CQKA 4GRIA 1A6QA 3MCZA 2IA0A 4IKFA 4B48A 3E5UA 4XORA 2VOOA 4G7HF 3M1CA 4OMYA 2R5YB 3K70C 1VI0A 4HNTA 2VT2A 4XOPA 3I4MJ 5EJCA 5CKTA 1KZHA 3I4PA 2LK2A 1MJ9A 1TW3A 2D2WA 4OAYA 1X1BA 4BQNA 1G3TA 3A2KA 2YR2A 4RGRA 5AIPA 2E2IJ 4D5FA 3F23A 3JCUC 3KLOA 5M5YJ 1VQ9I 2KQRA 2Z16A 4BBSJ 3QYEA 3I55I 2M45A 3LFKA 3MN2A 1JE8A 2X4HA 3CJQB 3E6DA 5M5XJ 1DDNA 3SZTA 4IJAA 1J59A 2BW3B 2QWWA 3DV8A 2ZJPF 2WV0A 1WPKA 1UMQA 2EFQA 2LLKA 2QBYB 1BI0A 3QRFF 3ERED 1YJWI 2GXGA 2VB6A 3MZYA 3NARA 3GBGA 1DQUA 2QLZA 2WB1N 4KN4X 2E2HJ 3JRFA 3AAFA 1YYVA 3KP4A 3OYEA 1TW2A 2BXZA 1ZKGA 3HOVJ 3KEQA 1WZ2A 2XGXA 1NK3P 2IGMA 2ZBKA 5CQEA 2VASA 1YI2I 1EJ9A 2FBIA 2AXTC 2W57A
chains in the Genus database with same CATH topology
4M9ZA 2YU3A 4Y13A 4HX4A 3HSRA 4KFCA 2F5DA 2MH9A 3J7AO 1R1TA 3C7JA 1R00A 5H6QA 2O8XA 4LGWA 4B8XA 3LSTA 3QPHA 3RI4A 3LAJA 4HBLA 3I64A 1LB2A 1SD7A 4RAYA 5F64A 3TO9A 1X3UA 3MQ0A 1BI1A 3KEOA 2YX4A 2P6TA 2LF7A 4P55A 3QAHA 3T5XA 4FT8A 4L18B 4YIFA 5LHGA 1R36A 2FOKA 5E8GA 3WTUC 4HV6A 1G3WA 3LA7A 4U0YA 5D5WB 3KP6A 1P4XA 1YIOA 3ZPLA 2XRNA 1R58A 1RNLA 3HRSA 2ISYA 2GIVA 3GFLA 4HQEA 4I02A 2DFIA 3DXJF 3BDDA 1QZZA 4UNOA 2RQPA 4ESJA 2Q8KA 1S7OA 3BROA 1G4DA 1QO0D 2EV5A 2VBXA 3Q9SA 3JSOA 3F8NA 4U0VA 2JSCA 1L3LA 3V7CA 3IRRA 3IKTA 1ZG1A 2M8EA 4YFNF 3D5LA 1O57A 1FP2A 1D8JA 2O3FA 3CDHA 4OIPF 1HBXG 1FPQA 1IUYA 1HQCA 5L3FA 1XDSA 2W24A 1B9MA 3QP5A 3GX4X 4D0PA 5ILUA 3E6CC 3JTHA 1IZ1A 3F3XA 1IN5A 1Z9CA 3CUOA 3QPTA 1YQAA 5BOXA 4XSZF 5CVJA 5LGTA 1XGNA 2XAQA 3FXRA 2ZJ2A 3J81Z 3GW2A 4ZYGA 5BPDA 3KZZA 4O6JA 2LNBA 1XDUA 2Y75A 4ENJA 1W7PB 1KQ9A 2L4AA 2D45A 1ZHFA 2TDXA 4YFXF 2OZUA 2M5WA 2K4JA 4AVPA 2H6BA 3BY6A 2XUBA 3SXYA 5E1WA 3H92A 1MJBA 3WGGA 1FBQA 2COMA 1Q1HA 1HKSA 2XVCA 4BQAA 2YX7A 3DFGA 2XIGA 2UZKA 3NRVA 3WGHA 1TQPA 5F1RA 1HXDA 2FEZA 2VONA 2EFWA 1ZYRF 4KIGA 4HYEA 4WXHA 1XSDA 1IRGA 4I2OA 1HKTA 2MH2A 1XGOA 4LFUA 4ZYEA 1SD5A 5E17F 2XASA 4LLLA 4BHPA 5D6FA 5D5UB 3IHUA 1TQMA 4ZZLA 3GZ5A 4NB5A 4OOIA 5ICCA 1U5TA 2MBFA 2HKXA 5HOOA 2RKHA 4ETSA 3N97A 2JPCA 2RN7A 3E3VA 3TO6A 1W5TA 1FNNA 4UV8A 3GZ6A 5H20A 5CVVA 1U8RA 4IHTA 2P4WA 3KP5A 3V8LA 5J8CA 3I71A 3NEUA 4WXDA 2K86A 2KKOA 1ZRDA 3QU3A 2Q2EA 2Z33A 1OKRA 1Y0UA 4DNCA 4UXNA 4HZFA 4AIHA 3SHFA 3T1BA 3HUGA 3CTAA 2JPBA 4FHTA 3HYIA 1FLIA 5KK1A 1YW7A 5HS9A 3WTYC 1MDMB 2ESHA 4KUMA 4I7HA 1Z7UA 4L0ZB 2CSOA 2ZMEA 1ZN2A 1KQ8A 1I27A 4CICA 3WTSC 3WU1B 3MZHA 3C1DA 2ZCWA 5CJ9A 2A69F 2HYFA 3DPLC 4MQVA 5K1YA 1O3TA 1SFXA 2DI3A 3QU6A 5BMZA 4M9SA 4CGZA 2EFNA 1XSVA 2GWRA 1G6NA 1GXQA 3WTZA 2EFOA 3DQVC 2OA4A 1FC3A 1R7JA 4G7OF 4M6YA 1T39A 3I5UA 1JHHA 1KU9A 6PAXA 5DCMA 2Z99A 1KQ0A 2ZFWA 3TOBA 2GA1A 1YW8A 2L02A 3FMSA 4EVIA 1S7AA 3U2RA 2IPQX 4EJWA 3HRUA 4HDUA 2VE9A 4HAMA 2EWNA 3P9IA 3J80Z 1ONVA 3HHHA 3ECHA 4CHUA 2VXZA 1FY7A 1O3QA 4I0AA 5L3GA 1F4KA 3FXQA 2W25A 3DF8A 2A68F 1XB4A 2IJLA 2DO7A 1ZG3A 3BJOA 3ZQ7A 3TGNA 1TTYA 1P2FA 3K2ZA 4EJOA 3ABUA 1LDDA 4BHBA 2HFHA 1I6XA 1CF7A 1G3SA 1ZRFA 4A12A 2C6YA 4EJTA 2B0LA 4L9JA 3B02A 4U0WA 5DD8A 2IA2A 2PMUA 2O03A 5LEJA 3E6MA 1P4WA 5D4RA 2FU4A 4HX7A 5HS7A 4WCGA 2DK5A 5BPIA 2O0YA 4M73A 5E18F 1IXSB 2OD5A 2FBKA 4L9NA 2R7FA 4HA8A 3F6VA 1ON2A 3OV8A 2ESNA 4HW0A 1IN6A 1R5HA 1QQIA 2OU2A 3L09A 2WC2A 2CWEA 5FD6A 2DQRA 1XMKA 3DEUA 4KNYA 2BV6A 3TO7A 2WTEA 2V79A 3F8CA 2H27A 3RYPA 1BN5A 4LD5A 5ED4A 5L3DA 4XLNF 3HIFA 2QZ8A 1BC8C 4OIOF 1HW2A 1EH7A 5TRDA 3R61A 3FWEA 4UVCA 2ETHA 4ENNA 3EYIA 2Y0MA 4HV5A 5L3BA 5A2QZ 1K7AA 2KJBA 1ZREA 1FOKA 3EUHA 4QWQA 3GEZA 3GFIA 4QLCU 3CUQB 4KIBA 2PQ8A 1BIAA 1FYMA 1LVAA 4O3MA 5D6EA 2DPDA 3RPUA 4LG0A 1L0OC 4M6XA 2VBZA 4KT5C 3VODA 5JFRA 3PFIA 4IVNA 5HDNA 4LB5A 2IA1A 3M8FA 4CYDA 3S2WA 5BQTA 5L3EA 3T8TA 5LHIA 3LAPA 2FSWA 3FM5A 4PDKA 2Z3YA 1R5GA 2X0LA 3L7WA 2IT0A 1BBYA 3T0YA 3WE2A 4MTEA 1IAWA 2HEOA 4LB6B 3ABTA 5CYVA 3L00A 1BOAA 2JTVA 4I0BA 3D0SA 3HRMA 4HF1A 3FHZA 4MTDA 4FX4A 2GAUA 2EV6A 2ELHA 3BP8A 2GXBA 2QUFA 1K78B 3DP7A 3P7NA 1LQ1A 2EK5A 1ZGJA 3EDPA 3J81K 4LK1F 1R23A 5FLXZ 2R3SA 2F5CA 4U88A 4RB3C 4Z2YA 1UFMA 3MFKA 4JK1X 1DP7P 1XGMA 4AD9A 1XN7A 4AWXB 3R0AA 3KP2A 2H09A 4G6QA 4I98B 2HTJA 3ELKA 1IN7A 1O7LA 2FMYA 3K9TA 2STWA 4G9YA 2LSOA 2IP2A 4OMZA 1BM9A 2WWYA 4XSXF 4WK8F 4RGXA 5LRRA 1BC7C 3K1PA 4Q48A 4IRIA 3KLNA 2EV0A 3HRTA 5DUKA 1CGPA 4N9HA 1HSTA 5JI6A 4IPAA 3WTTC 2JT1A 2QM3A 5FFXA 1RUNA 2XAJA 4O5VA 3LQQA 2XAHA 3R0JA 4RB0A 5LGUA 1KGSA 1OPCA 1OYWA 5LEKA 2A61A 2FMLA 5LBQA 3WG9A 3V7RA 3E97A 4M74A 4Q47A 1BI3A 4OIQF 1JHFA 5EEGA 3R6SA 1FX7A 1TBXA 3I59B 2A5YB 1P6RA 3SQNA 2XKOA 2VBYA 1RI7A 3I54A 1REPC 4YG2F 2VE8A 2DLLA 4OIRF 4LLGF 1IF1A 1KYZA 2E7WA 5BS6A 3ROUA 1ZGAA 3KFWX 1S3JA 3IRQA 1K6OA 2FQ3A 3FMRA 4YIIA 1YW9A 2HOEA 4LK0F 4MEYF 3ZMSA 2Z9OA 1ZG5A 2IVMA 4EGYA 3WE3A 3M9AA 4PCQA 2FNPA 1RIOH 2IW5A 1FWZA 1KA8A 2OAZA 5CVIA 5AONA 2XKPA 1MZBA 4RAZA 5K5QA 2W85A 1ZLKA 5ICEA 5H6RA 3RJPA 4M72A 4Y17A 1UHMA 3GWZA 3ECOA 3HTUA 2D1HA 5LHHA 1VTNC 2FF4A 4U7DA 4UUVA 4IRGA 2FBHA 1XGSA 1GHCA 4EMSA 1B9NA 1LDKB 1ZLJA 4JBAA 4KDPA 4GYGA 1OYIA 1U5TB 2CGPA 1FYLA 2DTRA 3W6JB 3CUQC 4EJVA 1BJAA 2O61A 5J6XA 5DCFA 4MEXF 4HQMA 4A5MA 2PN6A 5TJJA 3TDZC 3QP6A 4GYIA 1UB9A 2P6SA 1T0FA 2KIUA 3O6BB 4L9TA 4L5JA 1P4AA 2MA3A 3J80K 2J5PA 1FZPB 5HDKA 4P5OA 2QQAA 3BZ6A 2PBIA 1T38A 3ML6A 3I58A 1JGSA 2D1VA 3HTSB 1EH8A 1YLFA 2V1DA 2M1BA 1MKMA 1FBSA 4M9XA 2QENA 4ENMA 1MJAA 3E5XA 3COAC 2RC4A 1I5ZA 1HW1A 1YTYA 2NNNA 4CZZA 2HZTA 1WKMA 3FF5A 5FFZA 1G3YA 1OR7A 1H9GA 3C3WA 2ZMEB 3ZMUA 2AS5F 2Z5UA 1XD7A 1XCVA 4P9UA 1QPMA 4XLPF 4EQQA 3BPXA 4NHJA 3O2PE 4R1HA 3KP7A 5ILVA 4XRFA 5J8FA 2VN2A 5IT9Z 2YPRA 2XAGA 3JSPA 2EFPA 2H6CA 3BJ6A 1D5VA 2KRFA 4EGZA 3W6KB 3KZYA 4E70A 1Z6TA 2MLGA 5HVQC 1DPRA 2EJRA 2ADUA 1SFEA 5JHUA 2F2EA 2PJPA 2VC0A 1U2WA 2GZWA 3F6OA 4P9FA 1LEAA 2E7XA 3WTVC 2OZ6A 3PQKA 3HOSA 5A2QK 1WSUA 2KIFA 4KA4A 1V4RA 2G7HA 4B09A 3LWFA 2PG4A 3VOEA 1USTA 1KU3A 3KETA 2A3SA 3LA3A 3F8BA 2GQQA 2ZNZA 3PQJA 5E20A 1E2XA 3FMQA 3P9CA 5D8LB 4N0BA 1CF7B 1S6LA 1IXRC 4RB1A 5D5VB 3KE2A 2L01A 2OQRA 2ZKZA 2OQGA 4A6EA 2ZXJA 1OMIA 2HYGD 4GCVA 1U78A 5HS8A 4CO8A 4EM0B 1TLHB 5FGMA 2VOPA 3GYHX 1HSJA 2UWMA 4NQWA 5F6FA 5DD4A 3G3ZA 2FNAA 1FBUA 3SFZA 4WF2A 4ENKA 3GLXA 1A04A 4A0ZA 3CO7C 4PGGA 1ZRCA 3EQLF 5HLHA 2QVOA 2J5OA 3V8KA 5DV5A 3Q9VA 3K0LA 2Q0OA 2PI0A 5LGNA 2L4MA 2MC3A 4ZYHA 5AIQA 4KN7X 5FLXK 4BNCA 4RGSA 2PMHA 3BJAA 3HHGA 4FX0A 3MWMA 2BGCA 3R4KA 3CUQA 2QBYA 3GFMA 2PEXA 3EETA 2HWVA 4A0YA 4F7ZA 2AXLA 2JRTA 5ERIA 4CXFA 4ON0A 3GVAA 1U5TC 3B73A 4EM2A 1TNTA 3IL2A 1Z6RA 4H0EA 1KYWA 1BIBA 4UV9A 1YS7A 2M87A 3GFJA 4MNUA 3K1MA 1SD4A 4RB2C 4KICA 4A2UA 2DBBA 4ASNA 4LG0B 2UXNA 1FSEA 2A6EF 2DT5A 3GUDA 5D4SA 1PP7U 5IT3A 2QQ9A 3KCCA 2RGVA 3ZN0A 3RKYA 3L2CA 1LEBA 1WQ2A 4WWCA 1O7FA 3R60A 1D3YA 3HSEA 1P92A 1SMYF 3H3ZA 4PZJA 5D5XB 4JQFA 4BYYA 3JAMK 2BYVE 2CYYA 1K78A 4PGHA 1IRFA 3ULQB 2YSRA 1Z1DA 1ZARA 3RKWA 3TKYA 1ON1A 3F8MA 2DQLA 3GO5A 2P5KA 4BAYA 3E5QA 3Q5FA 2KJCA 4HX8A 3VEPA 4UVAA 2F5EA 3WGIA 4IXAA 2R7DA 3E6BA 1ZAOA 3BWGA 2A07F 1UCRA 3I0TA 3K69A 1IW7F 1E17A 4EV0A 1WRJA 3IKVA 3V7SA 3ZP5A 2BE5F 4IF4A 1MD0A 3BPVA 3V8JA 1WWXA 2ZO4A 1BI2A 2CG4A 3DPTA 3LQRA 4N9IA 4HF2A 1QBJA 1U6GA 1O3RA 1ZH5A 2HR3A 2XROA 5EEHA 4EM1A 3FXUA 3MEXA 1Z05A 1PDNC 4I09A 1EH6A 4HDVA 4TV7A 1ODDA 3ZMZA 4IRHA 3IC7A 2UXXA 4KMUX 3QOPA 5HLGA 1IN8A 4IHSA 3M8EA 3JAMZ 2EB7A 2JZYA 3BOQA 3VB2A 1FYKA 4L9VA 1OYYA 1QNTA 1J7KA 2RNJA 2E1NA 2OBPA 2XHKA 4GO1A 3RIRA 4EJUA 3I59A 1W7PA 2W84A 5JR3A 2Y48A 3KP3A 4G94A 3ZN1A 4ZYDA 4ESFA 1R1VA 2P8TA 3WTWC 2RV8A 5E1ZB 4ZZDA 3C18A 3F8FA 5HDGA 4L5IA 1T98A 3M1EA 2DAOA 1XCBA 2LDUA 2DU9A 4I01A 2P5LC 4WXCA 4MHGA 4G7ZF 1GXPA 2EA4A 3CO6C 4G8XA 3ZMTA 1F9NA 1T2KA 3TQNA 2HGCA 2STTA 2A6HF 3MAJA 2V9VA 1U3EM 2IRFG 2ISZA 2RVCA 1J9IA 4M71A 1TQIA 1XSXA 1B4AA 2HQRA 3EYYA 4A5NA 2VC1A 4K2EA 1XMAA 4A0XA 2K02A 5KVRA 3REOA 2MLKA 1SFUA 5LRSA 3SZPA 4BHCA 5LLQA 3P9KA 1NHAA 4G6DA 3IWFA 4HF0A 3GF2A 4U7BA 1HKQA 1RZ4A 2FXAA 5E8IA 4BXUA 5E1XA 2L3DA 1R1UA 2ACJA 4BH9A 1EV7A 2P7VB 4UHTA 2V6CA 3RPQA 2HDCA 5IT9K 2VT3A 2H94A 2O6GE 1H0MA 4R79A 1LNWA 3NQOA 2NRAC 2NNYA 2E1CA 5K5OA 2HTSA 1KU7A 5ICFA 1TNSA 2HS5A 3N4MA 3F22A 4S05A 1PP8F 4RGUA 2DW4A 1USSA 4XBFA 4GGGA 4HLXA 1I1SA 3HOTA 1B1BA 1T6SA 4S04A 2MD5A 3IWZA 1UHWA 2GA2A 1MDMA 5FB2A 5CVUA 1S8NA 4MQ9F 2BBYA 1MGTA 1B6AA 2VBWA 1HW5A 4R8HA 1FSHA 1ULYA 5DYMA 5K5RA 3ZMDA 2L54A 3FZVA 3U1DA 2CFXA 1JXSA 3LA2A 3T8RA 1B59A 3TDUC 1J5YA 4HLYA 2BEOA 2FRHA 2HKOA 3JTGA 5ICGA 2EA2A 1YS6A 3GXOA 3RKXA 2F5FA 3RDIA 2P7CB 1W7PD 2NAZA 2HQNA 2V1UA 2FE3A 1J2XA 1AOYA 4Q4ZF 1H9TA 4DQ2A 3L9FA 2K27A 1PUEE 3RTRA 1FP1D 3WTXC 2DK8A 4MGRA 5CLSA 1WI9A 4LJZF 3DKWA 2NYXA 1R22A 3K1NA 3OOPA 2P5VA 4GXOA 1SAXA 3WU0A 1K79A 3WODF 5DEQA 5DCMB 4AIJA 3H3UA 4OU0A 3CLOA 3FM3A 1AWCA 4KYWA 1QZYA 3I53A 4OINF 1YFHA 4YFKF 2NS0A 1Z91A 2CW0F 2KIMA 3ZMVA 1FT9A 5D8KB 1S29A 1I1GA 4LMYA 2CO5A 2ZNYA 5JVTA 1LDJA 1YO5C 3G73A 2PFBA 1STZA 4KIFA 1J75A 5ILSA 2VODA 4AIKA 1YG2A 3HSFA 3ISPA 4P96A 5CVRA 1DUXC 4A6DA 4ESBA 2XAFA 2M30A 1DPUA 3VFZA 1KU2A 2LKPA 4HOBA 2FA5A 4UVBA 4LLNA 3RYRA 1D8KA 4ZH4F 2PLYA 1GVJA 1W5SA 1RUOA 2QQBA 3V4GA 1C0WA 2V1XA 2RDPA 1IXCA 1W4MA 2XV4S 1LJ9A 4CDGA 1QGPA 1F5TA 3M7GA 1O3SA 4WX9A 3CJNA 4Y15A 2G9WA 4Q5SF 4KMFA 3FX3A 1SMTA 2K7LA 2DPUA 2QYOA 4RS8A 2K4BA 4L0YB 1F1ZA 5FD5A 3O3KA 3JW4A 1J0RA 3U9GA 1SD6A 5L3CA 3F72A 3TOAA 5FO5A 5DUIA 5HLIA 5DDGA 1V3FA 2G7UA 1IN4A 3F21A 2LF8A 2CQKA 3MCZA 2IA0A 3E5UA 2VOOA 4G7HF 4OMYA 2VT2A 3I4PA 1MJ9A 1TW3A 2D2WA 1G3TA 2YR2A 4RGRA 5AIPA 3F23A 3KLOA 2M45A 3LFKA 1JE8A 2X4HA 3E6DA 1DDNA 3SZTA 4IJAA 1J59A 2QWWA 3DV8A 2WV0A 2EFQA 2QBYB 1BI0A 3QRFF 3ERED 2GXGA 3MZYA 4KN4X 2QLZA 3AAFA 1YYVA 3KP4A 1TW2A 3KEQA 2XGXA 2ZBKA 2FBIA 2W57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9Z A;  2YU3 A;  4Y13 A;  4HX4 A;  3HSR A;  4KFC A;  2F5D A;  2MH9 A;  3J7A O;  1R1T A;  3C7J A;  1R00 A;  5H6Q A;  2O8X A;  4LGW A;  4B8X A;  3LST A;  3QPH A;  3RI4 A;  3LAJ A;  4HBL A;  3I64 A;  1LB2 A;  1SD7 A;  4RAY A;  5F64 A;  3TO9 A;  1X3U A;  3MQ0 A;  1BI1 A;  3KEO A;  2YX4 A;  2P6T A;  2LF7 A;  4P55 A;  3QAH A;  3T5X A;  4FT8 A;  4L18 B;  4YIF A;  5LHG A;  1R36 A;  2FOK A;  5E8G A;  3WTU C;  4HV6 A;  1G3W A;  3LA7 A;  4U0Y A;  5D5W B;  3KP6 A;  1P4X A;  1YIO A;  3ZPL A;  2XRN A;  1R58 A;  1RNL A;  3HRS A;  2ISY A;  2GIV A;  3GFL A;  4HQE A;  4I02 A;  2DFI A;  3DXJ F;  3BDD A;  1QZZ A;  4UNO A;  2RQP A;  4ESJ A;  2Q8K A;  1S7O A;  3BRO A;  1G4D A;  1QO0 D;  2EV5 A;  2VBX A;  3Q9S A;  3JSO A;  3F8N A;  4U0V A;  2JSC A;  1L3L A;  3V7C A;  3IRR A;  3IKT A;  1ZG1 A;  2M8E A;  4YFN F;  3D5L A;  1O57 A;  1FP2 A;  1D8J A;  2O3F A;  3CDH A;  4OIP F;  1HBX G;  1FPQ A;  1IUY A;  1HQC A;  5L3F A;  1XDS A;  2W24 A;  1B9M A;  3QP5 A;  3GX4 X;  4D0P A;  5ILU A;  3E6C C;  3JTH A;  1IZ1 A;  3F3X A;  1IN5 A;  1Z9C A;  3CUO A;  3QPT A;  1YQA A;  5BOX A;  4XSZ F;  5CVJ A;  5LGT A;  1XGN A;  2XAQ A;  3FXR A;  2ZJ2 A;  3J81 Z;  3GW2 A;  4ZYG A;  5BPD A;  3KZZ A;  4O6J A;  2LNB A;  1XDU A;  2Y75 A;  4ENJ A;  1W7P B;  1KQ9 A;  2L4A A;  2D45 A;  1ZHF A;  2TDX A;  4YFX F;  2OZU A;  2M5W A;  2K4J A;  4AVP A;  2H6B A;  3BY6 A;  2XUB A;  3SXY A;  5E1W A;  3H92 A;  1MJB A;  3WGG A;  1FBQ A;  2COM A;  1Q1H A;  1HKS A;  2XVC A;  4BQA A;  2YX7 A;  3DFG A;  2XIG A;  2UZK A;  3NRV A;  3WGH A;  1TQP A;  5F1R A;  1HXD A;  2FEZ A;  2VON A;  2EFW A;  1ZYR F;  4KIG A;  4HYE A;  4WXH A;  1XSD A;  1IRG A;  4I2O A;  1HKT A;  2MH2 A;  1XGO A;  4LFU A;  4ZYE A;  1SD5 A;  5E17 F;  2XAS A;  4LLL A;  4BHP A;  5D6F A;  5D5U B;  3IHU A;  1TQM A;  4ZZL A;  3GZ5 A;  4NB5 A;  4OOI A;  5ICC A;  1U5T A;  2MBF A;  2HKX A;  5HOO A;  2RKH A;  4ETS A;  3N97 A;  2JPC A;  2RN7 A;  3E3V A;  3TO6 A;  1W5T A;  1FNN A;  4UV8 A;  3GZ6 A;  5H20 A;  5CVV A;  1U8R A;  4IHT A;  2P4W A;  3KP5 A;  3V8L A;  5J8C A;  3I71 A;  3NEU A;  4WXD A;  2K86 A;  2KKO A;  1ZRD A;  3QU3 A;  2Q2E A;  2Z33 A;  1OKR A;  1Y0U A;  4DNC A;  4UXN A;  4HZF A;  4AIH A;  3SHF A;  3T1B A;  3HUG A;  3CTA A;  2JPB A;  4FHT A;  3HYI A;  1FLI A;  5KK1 A;  1YW7 A;  5HS9 A;  3WTY C;  1MDM B;  2ESH A;  4KUM A;  4I7H A;  1Z7U A;  4L0Z B;  2CSO A;  2ZME A;  1ZN2 A;  1KQ8 A;  1I27 A;  4CIC A;  3WTS C;  3WU1 B;  3MZH A;  3C1D A;  2ZCW A;  5CJ9 A;  2A69 F;  2HYF A;  3DPL C;  4MQV A;  5K1Y A;  1O3T A;  1SFX A;  2DI3 A;  3QU6 A;  5BMZ A;  4M9S A;  4CGZ A;  2EFN A;  1XSV A;  2GWR A;  1G6N A;  1GXQ A;  3WTZ A;  2EFO A;  3DQV C;  2OA4 A;  1FC3 A;  1R7J A;  4G7O F;  4M6Y A;  1T39 A;  3I5U A;  1JHH A;  1KU9 A;  6PAX A;  5DCM A;  2Z99 A;  1KQ0 A;  2ZFW A;  3TOB A;  2GA1 A;  1YW8 A;  2L02 A;  3FMS A;  4EVI A;  1S7A A;  3U2R A;  2IPQ X;  4EJW A;  3HRU A;  4HDU A;  2VE9 A;  4HAM A;  2EWN A;  3P9I A;  3J80 Z;  1ONV A;  3HHH A;  3ECH A;  4CHU A;  2VXZ A;  1FY7 A;  1O3Q A;  4I0A A;  5L3G A;  1F4K A;  3FXQ A;  2W25 A;  3DF8 A;  2A68 F;  1XB4 A;  2IJL A;  2DO7 A;  1ZG3 A;  3BJO A;  3ZQ7 A;  3TGN A;  1TTY A;  1P2F A;  3K2Z A;  4EJO A;  3ABU A;  1LDD A;  4BHB A;  2HFH A;  1I6X A;  1CF7 A;  1G3S A;  1ZRF A;  4A12 A;  2C6Y A;  4EJT A;  2B0L A;  4L9J A;  3B02 A;  4U0W A;  5DD8 A;  2IA2 A;  2PMU A;  2O03 A;  5LEJ A;  3E6M A;  1P4W A;  5D4R A;  2FU4 A;  4HX7 A;  5HS7 A;  4WCG A;  2DK5 A;  5BPI A;  2O0Y A;  4M73 A;  5E18 F;  1IXS B;  2OD5 A;  2FBK A;  4L9N A;  2R7F A;  4HA8 A;  3F6V A;  1ON2 A;  3OV8 A;  2ESN A;  4HW0 A;  1IN6 A;  1R5H A;  1QQI A;  2OU2 A;  3L09 A;  2WC2 A;  2CWE A;  5FD6 A;  2DQR A;  1XMK A;  3DEU A;  4KNY A;  2BV6 A;  3TO7 A;  2WTE A;  2V79 A;  3F8C A;  2H27 A;  3RYP A;  1BN5 A;  4LD5 A;  5ED4 A;  5L3D A;  4XLN F;  3HIF A;  2QZ8 A;  1BC8 C;  4OIO F;  1HW2 A;  1EH7 A;  5TRD A;  3R61 A;  3FWE A;  4UVC A;  2ETH A;  4ENN A;  3EYI A;  2Y0M A;  4HV5 A;  5L3B A;  5A2Q Z;  1K7A A;  2KJB A;  1ZRE A;  1FOK A;  3EUH A;  4QWQ A;  3GEZ A;  3GFI A;  4QLC U;  3CUQ B;  4KIB A;  2PQ8 A;  1BIA A;  1FYM A;  1LVA A;  4O3M A;  5D6E A;  2DPD A;  3RPU A;  4LG0 A;  1L0O C;  4M6X A;  2VBZ A;  4KT5 C;  3VOD A;  5JFR A;  3PFI A;  4IVN A;  5HDN A;  4LB5 A;  2IA1 A;  3M8F A;  4CYD A;  3S2W A;  5BQT A;  5L3E A;  3T8T A;  5LHI A;  3LAP A;  2FSW A;  3FM5 A;  4PDK A;  2Z3Y A;  1R5G A;  2X0L A;  3L7W A;  2IT0 A;  1BBY A;  3T0Y A;  3WE2 A;  4MTE A;  1IAW A;  2HEO A;  4LB6 B;  3ABT A;  5CYV A;  3L00 A;  1BOA A;  2JTV A;  4I0B A;  3D0S A;  3HRM A;  4HF1 A;  3FHZ A;  4MTD A;  4FX4 A;  2GAU A;  2EV6 A;  2ELH A;  3BP8 A;  2GXB A;  2QUF A;  1K78 B;  3DP7 A;  3P7N A;  1LQ1 A;  2EK5 A;  1ZGJ A;  3EDP A;  3J81 K;  4LK1 F;  1R23 A;  5FLX Z;  2R3S A;  2F5C A;  4U88 A;  4RB3 C;  4Z2Y A;  1UFM A;  3MFK A;  4JK1 X;  1DP7 P;  1XGM A;  4AD9 A;  1XN7 A;  4AWX B;  3R0A A;  3KP2 A;  2H09 A;  4G6Q A;  4I98 B;  2HTJ A;  3ELK A;  1IN7 A;  1O7L A;  2FMY A;  3K9T A;  2STW A;  4G9Y A;  2LSO A;  2IP2 A;  4OMZ A;  1BM9 A;  2WWY A;  4XSX F;  4WK8 F;  4RGX A;  5LRR A;  1BC7 C;  3K1P A;  4Q48 A;  4IRI A;  3KLN A;  2EV0 A;  3HRT A;  5DUK A;  1CGP A;  4N9H A;  1HST A;  5JI6 A;  4IPA A;  3WTT C;  2JT1 A;  2QM3 A;  5FFX A;  1RUN A;  2XAJ A;  4O5V A;  3LQQ A;  2XAH A;  3R0J A;  4RB0 A;  5LGU A;  1KGS A;  1OPC A;  1OYW A;  5LEK A;  2A61 A;  2FML A;  5LBQ A;  3WG9 A;  3V7R A;  3E97 A;  4M74 A;  4Q47 A;  1BI3 A;  4OIQ F;  1JHF A;  5EEG A;  3R6S A;  1FX7 A;  1TBX A;  3I59 B;  2A5Y B;  1P6R A;  3SQN A;  2XKO A;  2VBY A;  1RI7 A;  3I54 A;  1REP C;  4YG2 F;  2VE8 A;  2DLL A;  4OIR F;  4LLG F;  1IF1 A;  1KYZ A;  2E7W A;  5BS6 A;  3ROU A;  1ZGA A;  3KFW X;  1S3J A;  3IRQ A;  1K6O A;  2FQ3 A;  3FMR A;  4YII A;  1YW9 A;  2HOE A;  4LK0 F;  4MEY F;  3ZMS A;  2Z9O A;  1ZG5 A;  2IVM A;  4EGY A;  3WE3 A;  3M9A A;  4PCQ A;  2FNP A;  1RIO H;  2IW5 A;  1FWZ A;  1KA8 A;  2OAZ A;  5CVI A;  5AON A;  2XKP A;  1MZB A;  4RAZ A;  5K5Q A;  2W85 A;  1ZLK A;  5ICE A;  5H6R A;  3RJP A;  4M72 A;  4Y17 A;  1UHM A;  3GWZ A;  3ECO A;  3HTU A;  2D1H A;  5LHH A;  1VTN C;  2FF4 A;  4U7D A;  4UUV A;  4IRG A;  2FBH A;  1XGS A;  1GHC A;  4EMS A;  1B9N A;  1LDK B;  1ZLJ A;  4JBA A;  4KDP A;  4GYG A;  1OYI A;  1U5T B;  2CGP A;  1FYL A;  2DTR A;  3W6J B;  3CUQ C;  4EJV A;  1BJA A;  2O61 A;  5J6X A;  5DCF A;  4MEX F;  4HQM A;  4A5M A;  2PN6 A;  5TJJ A;  3TDZ C;  3QP6 A;  4GYI A;  1UB9 A;  2P6S A;  1T0F A;  2KIU A;  3O6B B;  4L9T A;  4L5J A;  1P4A A;  2MA3 A;  3J80 K;  2J5P A;  1FZP B;  5HDK A;  4P5O A;  2QQA A;  3BZ6 A;  2PBI A;  1T38 A;  3ML6 A;  3I58 A;  1JGS A;  2D1V A;  3HTS B;  1EH8 A;  1YLF A;  2V1D A;  2M1B A;  1MKM A;  1FBS A;  4M9X A;  2QEN A;  4ENM A;  1MJA A;  3E5X A;  3COA C;  2RC4 A;  1I5Z A;  1HW1 A;  1YTY A;  2NNN A;  4CZZ A;  2HZT A;  1WKM A;  3FF5 A;  5FFZ A;  1G3Y A;  1OR7 A;  1H9G A;  3C3W A;  2ZME B;  3ZMU A;  2AS5 F;  2Z5U A;  1XD7 A;  1XCV A;  4P9U A;  1QPM A;  4XLP F;  4EQQ A;  3BPX A;  4NHJ A;  3O2P E;  4R1H A;  3KP7 A;  5ILV A;  4XRF A;  5J8F A;  2VN2 A;  5IT9 Z;  2YPR A;  2XAG A;  3JSP A;  2EFP A;  2H6C A;  3BJ6 A;  1D5V A;  2KRF A;  4EGZ A;  3W6K B;  3KZY A;  4E70 A;  1Z6T A;  2MLG A;  5HVQ C;  1DPR A;  2EJR A;  2ADU A;  1SFE A;  5JHU A;  2F2E A;  2PJP A;  2VC0 A;  1U2W A;  2GZW A;  3F6O A;  4P9F A;  1LEA A;  2E7X A;  3WTV C;  2OZ6 A;  3PQK A;  3HOS A;  5A2Q K;  1WSU A;  2KIF A;  4KA4 A;  1V4R A;  2G7H A;  4B09 A;  3LWF A;  2PG4 A;  3VOE A;  1UST A;  1KU3 A;  3KET A;  2A3S A;  3LA3 A;  3F8B A;  2GQQ A;  2ZNZ A;  3PQJ A;  5E20 A;  1E2X A;  3FMQ A;  3P9C A;  5D8L B;  4N0B A;  1CF7 B;  1S6L A;  1IXR C;  4RB1 A;  5D5V B;  3KE2 A;  2L01 A;  2OQR A;  2ZKZ A;  2OQG A;  4A6E A;  2ZXJ A;  1OMI A;  2HYG D;  4GCV A;  1U78 A;  5HS8 A;  4CO8 A;  4EM0 B;  1TLH B;  5FGM A;  2VOP A;  3GYH X;  1HSJ A;  2UWM A;  4NQW A;  5F6F A;  5DD4 A;  3G3Z A;  2FNA A;  1FBU A;  3SFZ A;  4WF2 A;  4ENK A;  3GLX A;  1A04 A;  4A0Z A;  3CO7 C;  4PGG A;  1ZRC A;  3EQL F;  5HLH A;  2QVO A;  2J5O A;  3V8K A;  5DV5 A;  3Q9V A;  3K0L A;  2Q0O A;  2PI0 A;  5LGN A;  2L4M A;  2MC3 A;  4ZYH A;  5AIQ A;  4KN7 X;  5FLX K;  4BNC A;  4RGS A;  2PMH A;  3BJA A;  3HHG A;  4FX0 A;  3MWM A;  2BGC A;  3R4K A;  3CUQ A;  2QBY A;  3GFM A;  2PEX A;  3EET A;  2HWV A;  4A0Y A;  4F7Z A;  2AXL A;  2JRT A;  5ERI A;  4CXF A;  4ON0 A;  3GVA A;  1U5T C;  3B73 A;  4EM2 A;  1TNT A;  3IL2 A;  1Z6R A;  4H0E A;  1KYW A;  1BIB A;  4UV9 A;  1YS7 A;  2M87 A;  3GFJ A;  4MNU A;  3K1M A;  1SD4 A;  4RB2 C;  4KIC A;  4A2U A;  2DBB A;  4ASN A;  4LG0 B;  2UXN A;  1FSE A;  2A6E F;  2DT5 A;  3GUD A;  5D4S A;  1PP7 U;  5IT3 A;  2QQ9 A;  3KCC A;  2RGV A;  3ZN0 A;  3RKY A;  3L2C A;  1LEB A;  1WQ2 A;  4WWC A;  1O7F A;  3R60 A;  1D3Y A;  3HSE A;  1P92 A;  1SMY F;  3H3Z A;  4PZJ A;  5D5X B;  4JQF A;  4BYY A;  3JAM K;  2BYV E;  2CYY A;  1K78 A;  4PGH A;  1IRF A;  3ULQ B;  2YSR A;  1Z1D A;  1ZAR A;  3RKW A;  3TKY A;  1ON1 A;  3F8M A;  2DQL A;  3GO5 A;  2P5K A;  4BAY A;  3E5Q A;  3Q5F A;  2KJC A;  4HX8 A;  3VEP A;  4UVA A;  2F5E A;  3WGI A;  4IXA A;  2R7D A;  3E6B A;  1ZAO A;  3BWG A;  2A07 F;  1UCR A;  3I0T A;  3K69 A;  1IW7 F;  1E17 A;  4EV0 A;  1WRJ A;  3IKV A;  3V7S A;  3ZP5 A;  2BE5 F;  4IF4 A;  1MD0 A;  3BPV A;  3V8J A;  1WWX A;  2ZO4 A;  1BI2 A;  2CG4 A;  3DPT A;  3LQR A;  4N9I A;  4HF2 A;  1QBJ A;  1U6G A;  1O3R A;  1ZH5 A;  2HR3 A;  2XRO A;  5EEH A;  4EM1 A;  3FXU A;  3MEX A;  1Z05 A;  1PDN C;  4I09 A;  1EH6 A;  4HDV A;  4TV7 A;  1ODD A;  3ZMZ A;  4IRH A;  3IC7 A;  2UXX A;  4KMU X;  3QOP A;  5HLG A;  1IN8 A;  4IHS A;  3M8E A;  3JAM Z;  2EB7 A;  2JZY A;  3BOQ A;  3VB2 A;  1FYK A;  4L9V A;  1OYY A;  1QNT A;  1J7K A;  2RNJ A;  2E1N A;  2OBP A;  2XHK A;  4GO1 A;  3RIR A;  4EJU A;  3I59 A;  1W7P A;  2W84 A;  5JR3 A;  2Y48 A;  3KP3 A;  4G94 A;  3ZN1 A;  4ZYD A;  4ESF A;  1R1V A;  2P8T A;  3WTW C;  2RV8 A;  5E1Z B;  4ZZD A;  3C18 A;  3F8F A;  5HDG A;  4L5I A;  1T98 A;  3M1E A;  2DAO A;  1XCB A;  2LDU A;  2DU9 A;  4I01 A;  2P5L C;  4WXC A;  4MHG A;  4G7Z F;  1GXP A;  2EA4 A;  3CO6 C;  4G8X A;  3ZMT A;  1F9N A;  1T2K A;  3TQN A;  2HGC A;  2STT A;  2A6H F;  3MAJ A;  2V9V A;  1U3E M;  2IRF G;  2ISZ A;  2RVC A;  1J9I A;  4M71 A;  1TQI A;  1XSX A;  1B4A A;  2HQR A;  3EYY A;  4A5N A;  2VC1 A;  4K2E A;  1XMA A;  4A0X A;  2K02 A;  5KVR A;  3REO A;  2MLK A;  1SFU A;  5LRS A;  3SZP A;  4BHC A;  5LLQ A;  3P9K A;  1NHA A;  4G6D A;  3IWF A;  4HF0 A;  3GF2 A;  4U7B A;  1HKQ A;  1RZ4 A;  2FXA A;  5E8I A;  4BXU A;  5E1X A;  2L3D A;  1R1U A;  2ACJ A;  4BH9 A;  1EV7 A;  2P7V B;  4UHT A;  2V6C A;  3RPQ A;  2HDC A;  5IT9 K;  2VT3 A;  2H94 A;  2O6G E;  1H0M A;  4R79 A;  1LNW A;  3NQO A;  2NRA C;  2NNY A;  2E1C A;  5K5O A;  2HTS A;  1KU7 A;  5ICF A;  1TNS A;  2HS5 A;  3N4M A;  3F22 A;  4S05 A;  1PP8 F;  4RGU A;  2DW4 A;  1USS A;  4XBF A;  4GGG A;  4HLX A;  1I1S A;  3HOT A;  1B1B A;  1T6S A;  4S04 A;  2MD5 A;  3IWZ A;  1UHW A;  2GA2 A;  1MDM A;  5FB2 A;  5CVU A;  1S8N A;  4MQ9 F;  2BBY A;  1MGT A;  1B6A A;  2VBW A;  1HW5 A;  4R8H A;  1FSH A;  1ULY A;  5DYM A;  5K5R A;  3ZMD A;  2L54 A;  3FZV A;  3U1D A;  2CFX A;  1JXS A;  3LA2 A;  3T8R A;  1B59 A;  3TDU C;  1J5Y A;  4HLY A;  2BEO A;  2FRH A;  2HKO A;  3JTG A;  5ICG A;  2EA2 A;  1YS6 A;  3GXO A;  3RKX A;  2F5F A;  3RDI A;  2P7C B;  1W7P D;  2NAZ A;  2HQN A;  2V1U A;  2FE3 A;  1J2X A;  1AOY A;  4Q4Z F;  1H9T A;  4DQ2 A;  3L9F A;  2K27 A;  1PUE E;  3RTR A;  1FP1 D;  3WTX C;  2DK8 A;  4MGR A;  5CLS A;  1WI9 A;  4LJZ F;  3DKW A;  2NYX A;  1R22 A;  3K1N A;  3OOP A;  2P5V A;  4GXO A;  1SAX A;  3WU0 A;  1K79 A;  3WOD F;  5DEQ A;  5DCM B;  4AIJ A;  3H3U A;  4OU0 A;  3CLO A;  3FM3 A;  1AWC A;  4KYW A;  1QZY A;  3I53 A;  4OIN F;  1YFH A;  4YFK F;  2NS0 A;  1Z91 A;  2CW0 F;  2KIM A;  3ZMV A;  1FT9 A;  5D8K B;  1S29 A;  1I1G A;  4LMY A;  2CO5 A;  2ZNY A;  5JVT A;  1LDJ A;  1YO5 C;  3G73 A;  2PFB A;  1STZ A;  4KIF A;  1J75 A;  5ILS A;  2VOD A;  4AIK A;  1YG2 A;  3HSF A;  3ISP A;  4P96 A;  5CVR A;  1DUX C;  4A6D A;  4ESB A;  2XAF A;  2M30 A;  1DPU A;  3VFZ A;  1KU2 A;  2LKP A;  4HOB A;  2FA5 A;  4UVB A;  4LLN A;  3RYR A;  1D8K A;  4ZH4 F;  2PLY A;  1GVJ A;  1W5S A;  1RUO A;  2QQB A;  3V4G A;  1C0W A;  2V1X A;  2RDP A;  1IXC A;  1W4M A;  2XV4 S;  1LJ9 A;  4CDG A;  1QGP A;  1F5T A;  3M7G A;  1O3S A;  4WX9 A;  3CJN A;  4Y15 A;  2G9W A;  4Q5S F;  4KMF A;  3FX3 A;  1SMT A;  2K7L A;  2DPU A;  2QYO A;  4RS8 A;  2K4B A;  4L0Y B;  1F1Z A;  5FD5 A;  3O3K A;  3JW4 A;  1J0R A;  3U9G A;  1SD6 A;  5L3C A;  3F72 A;  3TOA A;  5FO5 A;  5DUI A;  5HLI A;  5DDG A;  1V3F A;  2G7U A;  1IN4 A;  3F21 A;  2LF8 A;  2CQK A;  3MCZ A;  2IA0 A;  3E5U A;  2VOO A;  4G7H F;  4OMY A;  2VT2 A;  3I4P A;  1MJ9 A;  1TW3 A;  2D2W A;  1G3T A;  2YR2 A;  4RGR A;  5AIP A;  3F23 A;  3KLO A;  2M45 A;  3LFK A;  1JE8 A;  2X4H A;  3E6D A;  1DDN A;  3SZT A;  4IJA A;  1J59 A;  2QWW A;  3DV8 A;  2WV0 A;  2EFQ A;  2QBY B;  1BI0 A;  3QRF F;  3ERE D;  2GXG A;  3MZY A;  4KN4 X;  2QLZ A;  3AAF A;  1YYV A;  3KP4 A;  1TW2 A;  3KEQ A;  2XGX A;  2ZBK A;  2FBI A;  2W57 A; 
#chains in the Genus database with same CATH topology
 4KJZ A;  2M0M A;  4M9Z A;  2YU3 A;  4Y13 A;  4HX4 A;  4I6Z A;  3HSR A;  2JVH A;  3A0B C;  2ZXH A;  3J7Z I;  4E7J A;  2I8D A;  4KFC A;  2F5D A;  2MH9 A;  3H9G A;  3J7A O;  3EUK L;  1IRZ A;  1R1T A;  3C7J A;  1R00 A;  1T0F C;  4BS9 A;  2O8K A;  5H6Q A;  3S1Q J;  2O8X A;  3K4N A;  4HG2 A;  2DJI A;  3FXL A;  4LGW A;  3PJR A;  4J00 A;  4B8X A;  3LST A;  3QPH A;  3RI4 A;  3LAJ A;  2DMU A;  4HBL A;  1JJ6 C;  4QTR A;  3RKQ A;  1VQ4 I;  2LD5 A;  1JJ8 C;  4G12 A;  3I64 A;  1HDD C;  1XMX A;  1LB2 A;  1SD7 A;  4RAY A;  2VPL A;  4S0H B;  3OL3 A;  5F64 A;  3TO9 A;  1RET A;  1I39 A;  1JUM A;  1X3U A;  2OUM A;  2E71 A;  3AG4 H;  1DU6 A;  2MSY A;  3MQ0 A;  2DA7 A;  1BI1 A;  2DA1 A;  3DU6 A;  3KYC B;  3ZQC A;  3KEO A;  2M4K A;  2AQF A;  3CC7 I;  2YX4 A;  2P6T A;  2LF7 A;  4P55 A;  3OYG A;  3QAH A;  3PM1 A;  4FT8 A;  3T5X A;  4L18 B;  2BOL A;  4YIF A;  3JRA A;  1TL8 A;  5LHG A;  1R36 A;  2FOK A;  2XB5 A;  5E8G A;  3CZ6 A;  3WTU C;  3G1M A;  4HV6 A;  4IOA F;  1G3W A;  4JX6 A;  2R7O A;  2OTJ I;  2V1N A;  3LA7 A;  4AYB A;  3ASO H;  4U0Y A;  2JA6 J;  5D5W B;  3SEZ A;  1M1E B;  1P4X A;  1YIO A;  3KP6 A;  3ZPL A;  2XRN A;  1R58 A;  1RNL A;  2WAQ N;  4PJM A;  3HRS A;  2DOA A;  2ISY A;  2GIV A;  4U87 A;  4BJ5 C;  2L9R A;  1FJL A;  3GFL A;  4HQE A;  4KT6 A;  4DBR A;  4I02 A;  2DFI A;  4AVZ A;  1OIS A;  2CUZ A;  1UG0 A;  2HU9 A;  3DXJ F;  3OS1 A;  4XLH A;  2VXD A;  1OR7 C;  2XSD C;  3I4N J;  3BDD A;  4NC7 A;  1QZZ A;  4UNO A;  2RQP A;  1JUS A;  1OCR H;  3VSL A;  3ASN H;  4ESJ A;  2Q8K A;  1S7O A;  3BRO A;  2R4G A;  1G4D A;  1UZC A;  2CQN A;  2E1O A;  1QO0 D;  2EV5 A;  2QA4 I;  1BR4 A;  2VBX A;  3Q9S A;  4KIS A;  3JSO A;  1ITY A;  3DU5 A;  3F8N A;  3ERM A;  3H0G J;  2IXS A;  4U0V A;  1GV2 A;  2JSC A;  1L3L A;  1TWH J;  3V7C A;  4QPQ A;  3IRR A;  4H4K C;  3IKT A;  2E60 A;  3CF5 F;  1ZG1 A;  4C3J J;  2JMW A;  2M8E A;  4YFN F;  3M8J A;  1P7I A;  3ZQI A;  3D5L A;  4M3D A;  4BY7 J;  1O57 A;  1FP2 A;  4DYR A;  1AU7 A;  1N25 A;  2O3F A;  2V9P A;  3CDH A;  1D8J A;  4OIP F;  3SEQ A;  5E79 C;  1HBX G;  1FPQ A;  1IUY A;  1HQC A;  1R5I D;  1EF4 A;  4NDL A;  5L3F A;  4HSR A;  2X6W A;  1XDS A;  2W24 A;  1B9M A;  4A69 C;  3QP5 A;  2KMU A;  4OAZ A;  3GX4 X;  4D0P A;  5EG0 A;  3GZN B;  5ILU A;  2KFD A;  3E6C C;  3JTH A;  2MW8 A;  1IZ1 A;  1S72 I;  3F3X A;  1IN5 A;  3S2H J;  5GTH C;  3CDL A;  3LNQ A;  1IDZ A;  2GBY A;  1H8A C;  1Z9C A;  3CUO A;  2CU7 A;  3QPT A;  2VKV A;  2XAU A;  4UUS B;  1YX3 A;  4F91 B;  1YQA A;  5BOX A;  2GXA A;  4XSZ F;  5CVJ A;  2RAE A;  5LGT A;  2M9H A;  1XGN A;  4DJA A;  1AKH B;  2XAQ A;  3FXR A;  4CCO A;  2ZJ2 A;  3OYD A;  1ACI A;  2DFF A;  2B9S A;  2HPI A;  3J81 Z;  1ZQ3 P;  4CYC A;  3GW2 A;  4G6T B;  2IS2 A;  3W2V A;  5FLV A;  2QKM B;  4ZYG A;  3W2W A;  5BPD A;  3KZZ A;  1VND A;  4O6J A;  4E7S A;  2LNB A;  1XDU A;  3FK7 A;  2V26 A;  2DA2 A;  2Y75 A;  3WG7 H;  1Z0X A;  4ENJ A;  5C3E J;  1W7P B;  1KQ9 A;  2L4A A;  2XGC A;  4A3K J;  2D45 A;  2COB A;  4PSX A;  2Y9Y A;  1QVT A;  1FIA A;  2KRH A;  2EQR A;  1ZHF A;  2TDX A;  3IUO A;  5EGO B;  4YFX F;  2CS3 A;  2OZU A;  2M5W A;  2K4J A;  1X1C A;  4AVP A;  2H6B A;  3BY6 A;  2QSH X;  1WHU A;  2DT7 B;  3B6A A;  2M7A A;  1WVR A;  2XUB A;  2K9M A;  4M6V A;  3SXY A;  5EEA A;  5E1W A;  3CME I;  2L7K A;  3H92 A;  1MJB A;  3WGG A;  1V5G A;  1FBQ A;  2KZG A;  2COM A;  1Q1H A;  1HKS A;  5GAH J;  1A5J A;  2XVC A;  3CMA I;  4BQA A;  3MZ8 A;  3HOZ J;  3AFH A;  4AM3 A;  1MBF A;  1Z21 A;  2YX7 A;  2Y0S N;  3DFG A;  3H9Q A;  2XIG A;  2UZK A;  3NRV A;  4BL0 B;  4XOT A;  3ZRG A;  1JGG A;  3WGH A;  1TQP A;  4XM3 A;  4Y7N J;  5J4Y A;  5F1R A;  1HXD A;  4GDF A;  2FEZ A;  2VON A;  1R71 A;  4B47 A;  2EFW A;  1SAU A;  1ZYR F;  4KIG A;  1SAN A;  4HYE A;  4WXH A;  1LKX A;  1XSD A;  3S17 J;  2AQE A;  4HEA 2;  1IRG A;  2TRT A;  4I2O A;  3LSH A;  1MMG A;  4YEJ A;  4A3C J;  1VZ0 A;  1HKT A;  2MH2 A;  1XGO A;  4LFU A;  3CES A;  1SD5 A;  3K4K A;  4ZYE A;  5E17 F;  2XAS A;  2W82 A;  4LLL A;  4BHP A;  1Z3X A;  5D6F A;  2NVQ J;  5C4X J;  4XQF A;  5D5U B;  3IHU A;  1TQM A;  2A6T A;  4ZZL A;  2XF7 A;  4BDZ A;  2V6E A;  3GZ5 A;  4NB5 A;  4OOI A;  1H88 C;  2Y30 A;  5ICC A;  1U5T A;  2MBF A;  3C2H A;  2DDA A;  2HKX A;  4CUG A;  5HOO A;  1FMW A;  2RKH A;  2LP0 A;  2HI3 A;  4ETS A;  3N97 A;  1QZE A;  4P1W A;  2M8G X;  2JPC A;  2DA6 A;  1OLT A;  3IP4 B;  5M3F J;  1K4S A;  1N78 A;  2RN7 A;  2Y9Z A;  4BUP A;  3OIQ A;  2HVS A;  3FXM A;  3E3V A;  3TO6 A;  1W5T A;  1FNN A;  4UV8 A;  3GZ6 A;  4D5C A;  2LOO A;  2XDV A;  5H20 A;  5CVV A;  1PUF A;  4BQQ A;  1U8R A;  4IHT A;  2P4W A;  3KP5 A;  3V8L A;  3QOE A;  1FTZ A;  3OYM A;  3M3Y J;  5J8C A;  2FUG 2;  3I71 A;  3NEU A;  1LFB A;  4V19 K;  4WXD A;  3PO3 J;  2A5W A;  4MO7 A;  2K86 A;  4FE7 A;  3VDX A;  2KKO A;  1ZRD A;  4DIQ A;  3QU3 A;  2Q2E A;  2XC7 A;  4BU2 A;  1W1W E;  3OYA A;  2Z33 A;  1ZK8 A;  1OKR A;  1Y0U A;  4DNC A;  2DYS H;  2DYR H;  4HZF A;  4UXN A;  1Y6I A;  4AIH A;  1XPX A;  3SHF A;  2LRD A;  3L2Q A;  3T1B A;  2K9N A;  2KIQ A;  3HUG A;  1LFP A;  3CTA A;  4PUS A;  2JPB A;  4FHT A;  4IHY A;  3HYI A;  3ZQG A;  3X2Q H;  3HOY J;  2BVL A;  1FLI A;  4XID A;  3HG9 A;  2Q1Z B;  5KK1 A;  1WH5 A;  1YW7 A;  5HS9 A;  3WTY C;  5GPC A;  2L7F P;  1Y39 A;  5IY5 H;  3OYB A;  1MDM B;  2ESH A;  5J47 A;  4KUM A;  2O9L A;  2F5V A;  3F9K A;  3H1C A;  4I7H A;  3QYF A;  1Z7U A;  1IRX A;  1WJA A;  4L0Z B;  2CSO A;  3JRI A;  4BEH A;  2ZME A;  2JK3 A;  2Z2S B;  1ZN2 A;  1KQ8 A;  3ZCO A;  1YIT I;  5J1Y A;  1I27 A;  4AID A;  1APL C;  3GLL A;  3H0D A;  2VIX A;  4CIC A;  3WTS C;  3WU1 B;  3MZH A;  3C1D A;  2R7R A;  2N8G A;  2QEX I;  2ZCW A;  3ZQH A;  5CJ9 A;  2A69 F;  2HYF A;  3DPL C;  1ENH A;  4MQV A;  3RQI A;  5K1Y A;  2R7Q A;  1O3T A;  1SFX A;  5IOZ A;  2DI3 A;  2W48 A;  3QU6 A;  3U1K A;  1XTA A;  5BMZ A;  4M9S A;  2OPT A;  4CGZ A;  2EFN A;  1XSV A;  2GWR A;  4XKC A;  5EF6 A;  1G6N A;  2JRM A;  2KLO A;  1GXQ A;  3WTZ A;  5IYC J;  1HCR A;  2KHM A;  2EFO A;  3DQV C;  2OA4 A;  1FC3 A;  3JR9 A;  3OWT A;  1LE8 A;  1R7J A;  4G7O F;  2ELJ A;  3HL2 A;  3MKZ A;  4M6Y A;  4E4H A;  1T39 A;  3I5U A;  1JHH A;  4PJ0 C;  1KU9 A;  6PAX A;  5DCM A;  3G4S I;  2Z99 A;  1KQ0 A;  2X6X A;  2ZFW A;  1A6I A;  3LSG A;  3CCJ I;  2CUF A;  1EKE A;  3TOB A;  3G1O A;  2GA1 A;  3SDG A;  1W36 C;  1XG1 A;  2DOF A;  2LKX A;  3MMY B;  3GTQ J;  5M5W J;  5HNF A;  5IYD J;  1YW8 A;  2L02 A;  3FMS A;  4EVI A;  1S7A A;  1ZTR A;  3BR6 A;  3U2R A;  1S5L C;  2IPQ X;  2X1E A;  4EJW A;  3HRU A;  5KCM A;  3JRH A;  4HDU A;  4OWR B;  3U21 A;  2VE9 A;  1MNE A;  4DOZ A;  4DYC A;  4HAM A;  1OQY A;  2EWN A;  3P9I A;  3J80 Z;  1I50 J;  3RCO A;  4II3 A;  1ONV A;  3HHH A;  4CCJ A;  3ECH A;  4V2F A;  4CHU A;  2VXZ A;  1FY7 A;  3CCQ I;  1O3Q A;  2LFB A;  1OCC H;  4I0A A;  5L3G A;  1F4K A;  2B63 J;  3J7A Y;  3FXQ A;  2W25 A;  1IC8 A;  3DF8 A;  1R6R A;  2A68 F;  1G2H A;  1XB4 A;  2IJL A;  1Z67 A;  2XGD A;  4LIT A;  1IO2 A;  2DO7 A;  1ZG3 A;  3BJO A;  3SFI A;  3ZQ7 A;  3TGN A;  2XPV A;  4JX4 A;  2PMZ A;  1TTY A;  1P2F A;  3K2Z A;  4EJO A;  1T33 A;  1UEL B;  2JN6 A;  3ABU A;  4DZJ A;  4YEL A;  5JHF A;  4FTH A;  1K61 A;  3BTC A;  1LDD A;  2VL8 A;  3LSK A;  2K5C A;  4BHB A;  2BY1 A;  2HFH A;  1I6X A;  1CF7 A;  1G3S A;  1ZRF A;  4A12 A;  2C6Y A;  4EJT A;  2B0L A;  3UR3 C;  1QVU A;  1R4N B;  4L9J A;  5J1R A;  3S1R J;  3PSF A;  3B02 A;  4U0W A;  5DD8 A;  3ZGK A;  2LH9 A;  2KRC A;  3HKZ N;  3IH3 A;  1MMD A;  2IA2 A;  2PMU A;  2O03 A;  2IGK A;  5LEJ A;  3SZG A;  3G2B A;  3E6M A;  4XIC A;  2EPF A;  1P4W A;  4M3F A;  1SVM A;  5D4R A;  4XL9 A;  2FU4 A;  3H5A A;  2JA8 J;  3TW6 A;  5DM7 F;  3GTM J;  4FE4 A;  4HX7 A;  5HS7 A;  4WCG A;  2DK5 A;  4F3Q A;  5BPI A;  2QSF X;  2O0Y A;  2DXI A;  4M73 A;  1OCZ H;  3K6G A;  5E18 F;  1W0U A;  1IXS B;  2OD5 A;  2FBK A;  2R7U A;  4L9N A;  2R7F A;  4LIU A;  4HA8 A;  3DCF A;  3F6V A;  1ON2 A;  3OV8 A;  2NVU B;  2OF7 A;  2W00 A;  2ESN A;  4HW0 A;  2M4G A;  1IN6 A;  3QOD A;  1FMV A;  1R5H A;  1QQI A;  1X1A A;  2OU2 A;  3PUF A;  3L09 A;  2WC2 A;  2CWE A;  5FD6 A;  2DQR A;  1KON A;  1XMK A;  2DMN A;  3DEU A;  4NQW B;  4KNY A;  2BV6 A;  3TO7 A;  2WTE A;  4XKB A;  4ZC3 A;  4XRM A;  2V79 A;  2HVQ A;  3F8C A;  2H27 A;  5EDN A;  1S7E A;  1D1A A;  3CCE I;  3RYP A;  1BN5 A;  4LD5 A;  5DS9 A;  3MD2 A;  4ZDO A;  4PJL A;  5ED4 A;  5L3D A;  2DTZ A;  2HDD A;  4XLN F;  5B66 C;  1QHH D;  2IEK A;  3HIF A;  3WU2 C;  2QZ8 A;  1BC8 C;  2R5Y A;  1QU3 A;  4OIO F;  2FJ1 A;  4LOC A;  1HW2 A;  1EH7 A;  3S14 J;  2NOG A;  4ANJ A;  2ZJQ F;  5TRD A;  4PSW A;  2EBI A;  3WHB A;  3R61 A;  3FWE A;  4A3J J;  1NH3 A;  4UVC A;  2ETH A;  2X51 A;  4ENN A;  2EIK H;  4KIT B;  3BC8 A;  4IQ4 A;  3EYI A;  2PJR A;  1HF0 A;  3OYL A;  2Y0M A;  4HV5 A;  3LSR A;  1S9H A;  5L3B A;  5A2Q Z;  1K7A A;  3OIP A;  3BR0 A;  1J09 A;  2KJB A;  2M3A A;  3OYF A;  1ZRE A;  1X58 A;  2W4S A;  4HRI A;  4PFO A;  4XK4 A;  1FOK A;  3EUH A;  4QWQ A;  3GEZ A;  4XLC A;  4BXF A;  3GFI A;  1BL0 A;  4QLC U;  2AO9 A;  1RR7 A;  2MGQ A;  3CUQ B;  4KIB A;  3GTO J;  2PQ8 A;  1BIA A;  4BGD A;  3GTP J;  2KT0 A;  2KDO A;  1LVA A;  2LY2 A;  3VYR B;  1FYM A;  4O3M A;  1SVO A;  3NWT A;  5D6E A;  3MKY B;  2DPD A;  3RPU A;  3M07 A;  4LG0 A;  5B1B H;  1L0O C;  4M6X A;  2VBZ A;  3BTI A;  3QPL A;  4KT5 C;  3VOD A;  4DYQ A;  5B3S H;  3PFI A;  5JFR A;  5TGT A;  4IVN A;  2VKH A;  4XKW A;  5HDN A;  1D0X A;  4LB5 A;  2NVX J;  4RAG A;  4BE0 A;  1YE9 A;  2IA1 A;  4RMN A;  3M8F A;  4CYD A;  3S2W A;  5BQT A;  5L3E A;  2WV1 A;  3T8T A;  4ZTJ A;  2ZXI A;  5LHI A;  1YRN A;  3CJR B;  5GP9 A;  3LAP A;  2FSW A;  3FM5 A;  4PDK A;  2Z3Y A;  5F08 A;  3A01 A;  4C2U A;  1R5G A;  2X0L A;  2DA3 A;  3PIO F;  2MD0 A;  3L7W A;  1TT5 B;  1E3H A;  2IT0 A;  2R93 J;  4D7M A;  1BBY A;  2W1O A;  3T0Y A;  3WE2 A;  4MTE A;  1IAW A;  1BOB A;  3BR5 A;  1JI8 A;  2HQ5 A;  5JVG F;  3CJT B;  3I3L A;  4XRS G;  2HEO A;  5F1J A;  2L9V A;  4LB6 B;  4BKX A;  3ABT A;  2ZSH B;  5CYV A;  2GM4 A;  3L00 A;  1BOA A;  2R5Z A;  2JTV A;  4I0B A;  2IS1 A;  4IQJ A;  3D0S A;  3HRM A;  4HF1 A;  3FHZ A;  4MTD A;  1X3W B;  2LBF B;  4FX4 A;  2GAU A;  2EV6 A;  2KP6 A;  1R9T J;  1SC7 A;  2VI6 A;  2ELH A;  1U8B A;  4C3H J;  3BP8 A;  2GXB A;  2QUF A;  4RAF A;  2ME6 A;  1K78 B;  1YIJ I;  3BQZ A;  3DP7 A;  3P7N A;  1LQ1 A;  2MG4 A;  2EK5 A;  3MVP A;  2EIN H;  3C2G A;  1WCM J;  1ZGJ A;  4B3X A;  2LYC A;  3HOW J;  4QPO A;  1Y1W J;  3EDP A;  3J81 K;  4LK1 F;  3LSJ A;  5CQG A;  1R23 A;  5FLX Z;  3I56 I;  2R3S A;  2F5C A;  4U88 A;  5EZG A;  5C44 J;  4RB3 C;  1DP3 A;  4C2T A;  4Z2Y A;  1UFM A;  4RM3 A;  3TP3 A;  3MFK A;  3BCB A;  4QIW N;  4JK1 X;  5F0C A;  2VJI A;  1DP7 P;  1XGM A;  1ETV A;  4AD9 A;  1XN7 A;  4AWX B;  3R0A A;  2CV2 A;  3KP2 A;  2H09 A;  3BG9 A;  2BZT A;  2ID6 A;  4G6Q A;  2LMD A;  4XNF A;  1X2M A;  1VFC A;  2DMP A;  4I98 B;  2HTJ A;  4HPQ A;  3ELK A;  2DCE A;  2CMP A;  2EZK A;  4JYK A;  3TW7 A;  5IOY A;  1IN7 A;  1O7L A;  1FTT A;  2FMY A;  2HYJ A;  1UG2 A;  1FEX A;  3K9T A;  2E5N A;  2STW A;  4G9Y A;  3FHN A;  2LSO A;  3VWB A;  2E1M B;  2IP2 A;  4OMZ A;  1BM9 A;  2K9L A;  3HPH A;  2WWY A;  4XSX F;  3S1N J;  4WK8 F;  4RGX A;  5LRR A;  1MMS A;  1BC7 C;  1RRJ A;  3K1P A;  3P5J A;  4Q48 A;  4IRI A;  2DJN A;  3Q0W A;  3H3V K;  4FCY A;  4M3B A;  3S16 J;  3KLN A;  2OCE A;  3HOU J;  2EV0 A;  1TWG J;  3HRT A;  5DUK A;  1CGP A;  3GTL J;  4A3D J;  4N9H A;  2AHQ A;  1HST A;  2CQ7 A;  3A4C A;  5JI6 A;  2JUG A;  4IPA A;  2EZI A;  3WTT C;  2JT1 A;  2QM3 A;  2V7F A;  1X4P A;  2ZSI B;  3K4B A;  5FFX A;  2XSJ C;  1U9N A;  1ZEL A;  1RUN A;  2ICW G;  2XAJ A;  4O5V A;  3OYJ A;  3LQQ A;  2XAH A;  4B1R A;  3KIO A;  1TWA J;  3R0J A;  4RB0 A;  5LGU A;  1KGS A;  1OPC A;  1OYW A;  2Y2Z A;  1TC3 C;  5LEK A;  2JUC A;  2A61 A;  4J01 A;  4BE2 A;  2FML A;  4MIM A;  5LBQ A;  1TWC J;  2E19 A;  3WG9 A;  3V7R A;  2Z1D A;  4UUS A;  3HB9 A;  3TED A;  2H1K A;  4IX7 A;  3E97 A;  4M74 A;  1AKH A;  2XRL A;  3DEW A;  4Q47 A;  1BI3 A;  4OIQ F;  1JHF A;  1LVK A;  3OR2 C;  2IS6 A;  1RR8 C;  1PYV A;  3PNV A;  1QRY A;  1X3Z B;  3FKI J;  2VQL A;  2WAF A;  1X4O A;  3VYU B;  1GLN A;  5EEG A;  3R6S A;  1POG A;  3BG3 A;  3OS0 A;  3PNY A;  1FX7 A;  2NVT J;  4N4N B;  1TBX A;  3I59 B;  3K7A J;  3IH2 A;  2A5Y B;  2DT6 A;  3KYL A;  2H8R A;  1D0Z A;  1P6R A;  1WJC A;  3SQN A;  2XKO A;  3H5N A;  4E6K G;  2VBY A;  1RI7 A;  3I54 A;  1REP C;  5KAF C;  4YG2 F;  5LD2 C;  2NS8 A;  5EGO A;  1YJN I;  2VE8 A;  2DLL A;  1MMN A;  4OIR F;  4LLG F;  1WJE A;  2LY1 A;  3V42 A;  1IF1 A;  1QPI A;  2HOT A;  1KYZ A;  5TIS C;  3RPU D;  4CCL A;  2E7W A;  5BS6 A;  2WA0 A;  2B7E A;  3LSP A;  3ROU A;  1ZGA A;  3KFW X;  5F27 A;  3JRB A;  1S3J A;  3IRQ A;  2OV7 A;  4BY1 J;  1K6O A;  2FQ3 A;  3CLQ A;  3FMR A;  4YII A;  1YW9 A;  2HOE A;  4I99 C;  4LK0 F;  2WB1 A;  3CMY A;  2ID3 A;  3ABK H;  4MEY F;  4FAS D;  3ZMS A;  2Z9O A;  1ZG5 A;  2EZL A;  5GAE J;  2IVM A;  4EGY A;  1FOY A;  3WE3 A;  3M9A A;  4PCQ A;  1YOV B;  2BVM A;  1WJB A;  5K7Z A;  2FNP A;  3PNT A;  2R0Q C;  3A03 A;  1RIO H;  2IW5 A;  4A3G J;  2L5Q A;  3CMM A;  1UJ8 A;  2CV0 A;  1FWZ A;  1KA8 A;  2OAZ A;  5CVI A;  3QPS A;  5AON A;  2XKP A;  1MZB A;  3OY9 A;  3G1L A;  4QSH A;  4RAZ A;  5K5Q A;  2W85 A;  2K9S A;  1RKT A;  3GCM A;  5ICE A;  3BTJ A;  1ZLK A;  5H6R A;  3RJP A;  4M72 A;  2X6O A;  1NG7 A;  4ZDP A;  4Y17 A;  3ONQ A;  1HOM A;  1WGX A;  3CCM I;  1UHM A;  3VSK A;  4RA2 A;  2LTP A;  3GWZ A;  3ECO A;  2E5Z A;  3HTU A;  3Q3S A;  2D1H A;  5LHH A;  1VTN C;  1AHD P;  2FF4 A;  2ZJR F;  4U7D A;  1SVL A;  4IRG A;  5JLW A;  4UUV A;  1WFX A;  3SYT A;  2FBH A;  4NBQ A;  1XGS A;  1GDT A;  1JT6 A;  3AG3 H;  1GHC A;  5B1A H;  4CCK A;  4EMS A;  1B9N A;  1LDK B;  1ZLJ A;  2FQ4 A;  1E0E A;  1LUJ B;  4JBA A;  3TP0 A;  4KDP A;  5B5E C;  3KZI C;  4GYG A;  2DA5 A;  1OYI A;  1U5T B;  2CGP A;  2HXO A;  1FYL A;  1B72 B;  1IV6 A;  2DTR A;  3AL0 B;  3W6J B;  3W2A A;  3CUQ C;  4EJV A;  3KEY A;  1BJA A;  2I5U A;  4D9J A;  2O61 A;  4FET A;  5J6X A;  1K4T A;  5DCF A;  4MEX F;  4HQM A;  3JRD A;  4A5M A;  2WY8 Q;  4F55 A;  2PN6 A;  5TJJ A;  2WAQ A;  3TDZ C;  4A3I J;  1U9O A;  3QP6 A;  4GYI A;  2CW7 A;  1VQ8 I;  1UB9 A;  2P6S A;  1T0F A;  5IPA A;  2KIU A;  4C9Y A;  3O6B B;  2LG4 A;  4L9T A;  1DGW Y;  3GTG J;  4L5J A;  1VQM I;  1PUF B;  1P4A A;  2XF6 A;  4C2M J;  2MA3 A;  1YHQ I;  3OYK A;  1UAA A;  1IJW C;  3J80 K;  2J5P A;  1FZP B;  2XGE A;  1Z3Y A;  5HDK A;  4P5O A;  3OS2 A;  1W5C C;  3H36 A;  2QQA A;  3K4L A;  3BZ6 A;  1HC8 A;  2PBI A;  1T38 A;  2GOM A;  3ML6 A;  3I58 A;  3OL4 A;  1VQN I;  1JGS A;  2BY0 A;  1V5F A;  4I76 A;  1WI3 A;  2D1V A;  3HTS B;  1EH8 A;  1YLF A;  5FLM J;  2CW8 A;  2V1D A;  2M1B A;  4EAT A;  2V4J C;  1MKM A;  4BXX J;  2VKD A;  4HST A;  2OJE D;  1FBS A;  3HUG B;  3LMM A;  4RDU A;  3DWL E;  3LFU A;  4M9X A;  2QEN A;  4ENM A;  1ORK A;  1MJA A;  4C3I J;  3E5X A;  3COA C;  2RQQ A;  1MH3 A;  2RC4 A;  3FXK A;  4NUB A;  1I5Z A;  1HW1 A;  2HOS A;  1YTY A;  2NNN A;  3A02 A;  2L2O A;  4CZZ A;  2HZT A;  1WKM A;  1XC5 A;  4PJJ A;  3FF5 A;  3OMY A;  5FFZ A;  5FKL A;  1G3Y A;  4CA0 A;  3S1M J;  1OR7 A;  2QGU A;  3FIW A;  3C3W A;  1H9G A;  1R4M B;  4BEH B;  2ZME B;  1JKQ C;  3ZMU A;  2AS5 F;  2Z5U A;  1MSE C;  1EA3 A;  1XD7 A;  3DTE A;  2YU9 J;  1AA7 A;  1XCV A;  4P9U A;  1VQK I;  1QPM A;  4XLP F;  3UKG A;  5F04 A;  1HLV A;  5FKM A;  4EQQ A;  2XPU A;  2NOJ B;  1OCO H;  4D1Q A;  4A3B J;  3BPX A;  4NHJ A;  3QYB A;  4HNU A;  1JTY A;  3O2P E;  5H2F C;  1X2N A;  4HNV A;  1W0T A;  2K3P A;  4R1H A;  1VQ6 I;  2H8W A;  2O5R A;  3KP7 A;  4XRF A;  5J8F A;  5ILV A;  1V5E A;  2VN2 A;  5IT9 Z;  2YPR A;  2XAG A;  1GT0 C;  3JSP A;  2CUE A;  2EFP A;  3BLY A;  2UUZ A;  3PUB A;  1MBJ A;  2H6C A;  3BJ6 A;  1D5V A;  4FIS A;  2KRF A;  1LE8 B;  4L5E A;  4EGZ A;  2EZH A;  2DFH A;  2E1M C;  4PFP A;  4X1E A;  3W6K B;  1IGN A;  3K4C A;  4NNJ A;  3KZY A;  1Y0N A;  1SFK A;  2K9Q A;  4MFE A;  4E70 A;  3Q0V A;  1B8I A;  3HDD A;  1Z6T A;  2MLG A;  2HPM A;  3BT9 A;  5HVQ C;  1DPR A;  2EJR A;  2ADU A;  2M2E A;  1SFE A;  3TL4 X;  2EIL H;  5JHU A;  2F2E A;  4XMY A;  2PJP A;  1ETK A;  1MND A;  2VC0 A;  3JRE A;  2E34 A;  4C30 A;  1U2W A;  4CCN A;  2GZW A;  2R92 J;  3F6O A;  4P9F A;  1LEA A;  4X6A J;  5IP7 J;  2IGO A;  2FX0 A;  2Y0S A;  2E7X A;  4J19 A;  3D5S C;  3K70 D;  4Y33 A;  3RZD J;  2WAE A;  3WTV C;  1JKR C;  5J3L A;  2OZ6 A;  2NXN B;  3PQK A;  5KAI C;  3H5R A;  3DBL B;  3HOS A;  1NK2 P;  3HJE A;  2CQQ A;  2LRE A;  5A2Q K;  1DU0 A;  1WSU A;  2KIF A;  1VQO I;  5HOD A;  3ABM H;  3L2W A;  4KA4 A;  4JP0 A;  1D1B A;  1V4R A;  4XLE A;  4AYB N;  2G7H A;  3SDB A;  4B09 A;  3LWF A;  2PG4 A;  3VOE A;  1OJL A;  1UST A;  3CCS I;  1KU3 A;  3KET A;  2X48 A;  2A3S A;  4LIV A;  1Y8Q B;  3LA3 A;  3F8B A;  1GUU A;  1MIJ A;  1HA8 A;  3OSG A;  1YX5 A;  1BA5 A;  2GQQ A;  2JWT A;  2ZNZ A;  3PQJ A;  4AUX A;  5E20 A;  1VQ7 I;  1E2X A;  3FMQ A;  3P9C A;  1I3Q J;  5D8L B;  2HQA A;  4N0B A;  1CF7 B;  3AG1 H;  1S6L A;  1IXR C;  4RB1 A;  1H89 C;  3IH4 A;  4MLO A;  3KE2 A;  5D5V B;  3HGY A;  2ZKZ A;  2L01 A;  2OQR A;  2ZC2 A;  3ZQL A;  4E7K A;  2OQG A;  3UNG C;  4A6E A;  2ZXJ A;  4JOM A;  1OMI A;  2HYG D;  4GCV A;  1U78 A;  4YRV A;  3CCU I;  3FXJ A;  4XLF A;  5IP9 J;  5IP6 A;  2CFO A;  5HS8 A;  4CO8 A;  4EM0 B;  2V9K A;  1TLH B;  5FGM A;  4IHX A;  3LSM A;  2VOP A;  3GYH X;  3FIS A;  1HSJ A;  2UWM A;  1N77 A;  2CH0 A;  9ANT A;  4NQW A;  5F6F A;  2YUS A;  5DD4 A;  3G3Z A;  2FNA A;  1FBU A;  4B3A A;  3LOC A;  1JKO C;  1A31 A;  3SFZ A;  4WF2 A;  2EIM H;  2KZV A;  1A35 A;  2QKL B;  4ENK A;  2R7Z J;  3GLX A;  1MBK A;  1A04 A;  4A0Z A;  1BR1 A;  3CO7 C;  4PGG A;  4YIR X;  3EQL F;  1ZRC A;  5HLH A;  4A3M J;  1WJF A;  2JSP A;  2QVO A;  2J5O A;  3V8K A;  2GOX B;  5DV5 A;  2ELK A;  3Q9V A;  3K0L A;  2Q0O A;  1QHG A;  2TCT A;  3S32 A;  2PI0 A;  2VQH A;  3CD6 I;  5LGN A;  2R7W A;  2L4M A;  2MC3 A;  3DLA A;  4ZYH A;  5AIQ A;  4KN7 X;  3CP8 A;  1D0Y A;  1E3P A;  5FLX K;  4BNC A;  1VQ5 I;  1O4X A;  4RGS A;  2PMH A;  3I9V 2;  3BJA A;  3HHG A;  4FX0 A;  3MWM A;  2BGC A;  3QWL A;  2BW3 A;  2M0C A;  4DBQ A;  3R4K A;  2Y69 H;  3CUQ A;  1OCP A;  2IBD A;  1I6H J;  2QBY A;  3GFM A;  2PEX A;  1V55 H;  3EET A;  2HWV A;  3BG6 A;  5E3L A;  4A0Y A;  4F7Z A;  3CCL I;  2DMT A;  2PJR B;  2AXL A;  3B6C A;  2JRT A;  5ERI A;  4CXF A;  1LPQ A;  3DTI A;  4ON0 A;  1N75 A;  2F4M B;  3GVA A;  4IL6 C;  1R49 A;  1U5T C;  1FOW A;  3B73 A;  4EM2 A;  1JTX A;  5HNH A;  3AL0 C;  2K85 A;  1TNT A;  2ZFU A;  2A05 A;  4E7L A;  3IL2 A;  1VQP I;  1Z6R A;  4DGW B;  4H0E A;  2M7B A;  1KYW A;  1BIB A;  4UV9 A;  3OYC A;  1MNM C;  1YS7 A;  2M87 A;  3GFJ A;  4XN0 A;  2L0K A;  3K1M A;  1SD4 A;  4MNU A;  4RB2 C;  4KIC A;  4A2U A;  3GTJ J;  1Y1V J;  2DBB A;  4ASN A;  4LG0 B;  2UXN A;  1FSE A;  2A6E F;  3SJM A;  2DT5 A;  3GUD A;  5D4S A;  2HNH A;  5IT3 A;  1PP7 U;  2QQ9 A;  3KCC A;  2VUM J;  2RGV A;  3ZN0 A;  3RKY A;  3L2C A;  1LEB A;  1WQ2 A;  4WWC A;  1ETO A;  1BW5 A;  3L2R A;  2XPW A;  3OOU A;  5FJ8 J;  1YRN B;  1O7F A;  3RZO J;  3R60 A;  2CUJ A;  1D3Y A;  3CC2 I;  3A01 B;  3HSE A;  1P92 A;  1SMY F;  3H3Z A;  4PZJ A;  5D5X B;  1MBE A;  2LBF A;  4JQF A;  4BYY A;  1UHS A;  3TBI A;  3WHC A;  1T8I A;  1D5Y A;  2JA7 J;  3JAM K;  2BYV E;  2ZB9 A;  1MSF C;  1RES A;  2XF5 A;  1Y56 A;  2CYY A;  1K78 A;  4PGH A;  1LFU P;  1IRF A;  3ULQ B;  2R5Z B;  2KL4 A;  2YSR A;  2ECB A;  2NS7 A;  3S2D J;  1Z1D A;  4IHW A;  1ZAR A;  3RKW A;  3TKY A;  2HVR A;  2KDZ A;  1ON1 A;  3F8M A;  1X1D A;  4B43 A;  2IGN A;  2DQL A;  3GO5 A;  2P5K A;  4BAY A;  3E5Q A;  3Q5F A;  4W1U A;  2VJJ A;  2F4I A;  2KJC A;  2X9D A;  3BQY A;  4HX8 A;  3HBL A;  2EH3 A;  3VEP A;  1I3A A;  3EPZ A;  4UVA A;  2F5E A;  1GV5 A;  3WGI A;  4IXA A;  2R7D A;  3E6B A;  2CJJ A;  2BHY A;  2MC4 A;  1ZAO A;  3HC7 A;  3BR3 A;  3BWG A;  3QQA A;  1K83 J;  4A3L J;  2A07 F;  5K7F A;  1UCR A;  2ZME C;  3I0T A;  3K69 A;  3DBR B;  1IW7 F;  4CH7 A;  1P7J A;  2NVY J;  1MBG A;  4A93 J;  4EV0 A;  1E17 A;  3KX2 A;  3FDY A;  1WRJ A;  3HPG A;  3IKV A;  5EYR A;  3V7S A;  3ZP5 A;  2BE5 F;  4II2 A;  4IF4 A;  1MD0 A;  2VPR A;  3BPV A;  4RLQ A;  5E3O A;  3V8J A;  3VYS B;  5DM6 F;  1WWX A;  1IUF A;  2LY9 A;  3HKZ A;  2ZO4 A;  1BI2 A;  2CG4 A;  3DPT A;  3LQR A;  4N9I A;  4HF2 A;  1QBJ A;  1K6Y A;  4Y4R A;  1U6G A;  2R7V A;  1O3R A;  3L1P A;  4DZP A;  1ZH5 A;  2HR3 A;  1SEU A;  2DDB A;  2KIS A;  3OIO A;  4UB6 C;  2E35 A;  2XRO A;  3D1N I;  4RM2 A;  5EEH A;  2FD5 A;  4EM1 A;  3FXU A;  2HOA A;  1Z05 A;  3MEX A;  1PVE A;  4E7Z A;  1PDN C;  4I09 A;  1EH6 A;  4BE1 A;  4HDV A;  4TV7 A;  5K7H A;  1ODD A;  1RKW A;  3DKX A;  3ZMZ A;  4CCM A;  3DLL F;  1VQL I;  2Y31 A;  3HZJ A;  4IRH A;  4E7H A;  3IC7 A;  2UXX A;  1E3O C;  3BR2 A;  4KMU X;  4D7N A;  3QOP A;  5GAD J;  5HLG A;  3W6V A;  1T08 B;  3BTL A;  1XX5 A;  1IN8 A;  4IHS A;  4BQO A;  3M8E A;  3JAM Z;  2EB7 A;  4DW6 A;  2JZY A;  1ETQ A;  3L2U A;  4M3E A;  4CZC A;  2YS9 A;  2VQG A;  3N05 A;  3BOQ A;  3VB2 A;  5GTI C;  1FYK A;  3K4M A;  4N4O B;  4L9V A;  5EG0 B;  1OYY A;  1QNT A;  5EZH A;  1J7K A;  2RNJ A;  2UV1 A;  2E1N A;  3Q0U A;  5JLX A;  3PL8 A;  1ZGW A;  2OBP A;  1P9Q C;  2XHK A;  2MYS A;  4GO1 A;  3RIR A;  3S93 A;  4EJU A;  2DN0 A;  2FOW A;  3I59 A;  5FRN A;  5GAG J;  1W7P A;  2W84 A;  2L7Z A;  3ABL H;  5JR3 A;  2Y48 A;  3O8H A;  3KP3 A;  4G94 A;  3ZN1 A;  4ZYD A;  4ESF A;  1R1V A;  2P8T A;  3WTW C;  2RV8 A;  5E1Z B;  1RPW A;  4ZZD A;  5LFA A;  3C18 A;  4CYC B;  4CSW A;  3F8F A;  5HDG A;  2DOD A;  3HM5 A;  4L5I A;  1T98 A;  1F36 A;  3M1E A;  4F92 B;  2DAO A;  1ZR2 A;  2JJ7 A;  1XCB A;  2LDU A;  1PJR A;  2DU9 A;  1MBH A;  2QF7 A;  4I01 A;  4ZDL A;  2R7T A;  2WBM A;  5FKK A;  1MMA A;  2P5L C;  2RRE A;  2CQX A;  2LC2 A;  3BR1 A;  3K10 A;  4WXC A;  4MHG A;  3FXO A;  4G7Z F;  1Q1V A;  2IS4 A;  1GXP A;  2EA4 A;  3CO6 C;  1BR2 A;  4G8X A;  3ZMT A;  1MW7 A;  1F9N A;  5E3N A;  4PJN A;  3ZR8 X;  5C4J J;  1T2K A;  3TQN A;  4NC6 A;  4LG3 A;  2HGC A;  2STT A;  4E7I A;  2DA4 A;  5FRM A;  2A6H F;  2P0W A;  4IHV A;  3MAJ A;  2V9V A;  2VQC A;  1U3E M;  2IRF G;  2ISZ A;  5FKO A;  2BHZ A;  2RVC A;  4AU7 A;  1J9I A;  4M71 A;  1TQI A;  1XSX A;  5CPR B;  1B4A A;  2HQR A;  3EYY A;  3RQ4 A;  4A5N A;  3S3N A;  2VC1 A;  4ZJZ A;  3AKZ A;  2PMZ N;  1V54 H;  4K2E A;  1XMA A;  2BY3 A;  3C2B A;  1X19 A;  2IAI A;  4ZYA A;  3TMO A;  4A0X A;  2JA5 J;  4UY8 I;  2K02 A;  5KVR A;  3GTK J;  3REO A;  2MLK A;  4JX5 A;  4XKV A;  1SFU A;  3H9J A;  5LRS A;  3D5R C;  2JQ7 A;  2XB0 X;  4IZZ A;  3SZP A;  4X0G A;  4BHC A;  5LLQ A;  3W3C A;  3GME A;  3MKL A;  3P9K A;  1NHA A;  4G6D A;  3IWF A;  4HF0 A;  3FBN B;  3GF2 A;  4U7B A;  1G59 A;  3E0J B;  1HKQ A;  1RZ4 A;  2FXA A;  1WH7 A;  1U0J A;  5E8I A;  1G8X A;  4BXU A;  4RLF A;  1B72 A;  5J1U A;  2VJ4 A;  2DMQ A;  3ESW B;  3IV5 A;  5E1X A;  2L3D A;  4F93 B;  4ABZ A;  1R1U A;  3S3O A;  2ACJ A;  4BH9 A;  4A3E J;  1EV7 A;  2VKE A;  2P7V B;  4UHT A;  5M3M J;  1FOX A;  1JT0 A;  2V6C A;  3RPQ A;  2HDC A;  5IT9 K;  1FIP A;  3A1Y A;  3DBH B;  4Y3O A;  2H1L A;  2H94 A;  2MFZ A;  2VT3 A;  2O6G E;  1H0M A;  3E7L A;  4R79 A;  1W36 D;  1LNW A;  5E3M A;  3NQO A;  3EUH C;  2NRA C;  1GVD A;  2NNY A;  2E1C A;  1TT0 A;  2CV1 A;  5K5O A;  2HTS A;  1KU7 A;  5ICF A;  1TNS A;  2GIZ A;  2HS5 A;  3EUA A;  2LR8 A;  3N4M A;  3F22 A;  4S05 A;  3FK6 A;  4ZTF A;  2PX9 A;  1IDY A;  2BXY A;  3CQZ J;  1PP8 F;  4RGU A;  2DW4 A;  1USS A;  4XBF A;  4Z6Y A;  4GGG A;  4HLX A;  1I1S A;  3HOT A;  1B1B A;  2L9S A;  1T6S A;  4S04 A;  2MD5 A;  3IWZ A;  1BJZ A;  1UHW A;  2K3F A;  2W7N A;  2GA2 A;  1WJD A;  3IAM 2;  2Q2E B;  5FKN A;  1MDM A;  5FB2 A;  5CVU A;  3G6E I;  1S8N A;  3AG2 H;  4B44 A;  4MQ9 F;  4BBR J;  2BBY A;  3NWS A;  3VPR A;  1MGT A;  3CCY A;  1B6A A;  2VBW A;  1IV8 A;  1QA6 A;  4BDY A;  4F52 A;  2WY7 Q;  1HW5 A;  3OYN A;  4R8H A;  2OCC H;  1FSH A;  1ULY A;  5DYM A;  1T56 A;  5K5R A;  3HOX J;  3ZMD A;  2L54 A;  2GLO A;  3FZV A;  3U1D A;  4FQG A;  2CFX A;  1JXS A;  3LA2 A;  3T8R A;  5J4V A;  1B59 A;  5GPA A;  1NTC A;  3CC4 I;  1OFC X;  5F0H A;  2JA2 A;  3KPH A;  4XON A;  1JUP A;  1JKP C;  2LVS A;  1NG6 A;  3TDU C;  4NC8 A;  1J5Y A;  2X85 A;  4HLY A;  1BW6 A;  2BEO A;  2FRH A;  2HKO A;  2OTL I;  3JTG A;  2HZD A;  3G71 I;  5ICG A;  3ZQQ A;  2EA2 A;  3BG5 A;  2E2J J;  1YS6 A;  1TWF J;  3GXO A;  3RKX A;  2F5F A;  3RDI A;  2F48 A;  4A3F J;  4UB8 C;  3BCA A;  3O8G A;  1ETW A;  1W7P D;  4PK4 A;  2P7C B;  4M3G A;  5J40 A;  2NAZ A;  2HQN A;  2V1U A;  2FE3 A;  1J2X A;  3LL7 A;  2F6C A;  3VYT B;  1AOY A;  4Q4Z F;  1H9T A;  4DQ2 A;  2R7X A;  3L9F A;  2K27 A;  4BJT A;  2ZXW H;  5DTD A;  1PUE E;  3E1S A;  3IAS 2;  1HDP A;  2OC6 A;  3RTR A;  3CCR I;  1FP1 D;  3WTX C;  2DK8 A;  1XS9 A;  4MGR A;  5CLS A;  1WI9 A;  3PIP F;  1SFO J;  4LJZ F;  3DKW A;  3H35 A;  2NYX A;  1R22 A;  3K1N A;  3OOP A;  3PO2 J;  1Z77 A;  2P5V A;  4GXO A;  1SAX A;  3DPU A;  3WU0 A;  2JVG A;  3WOD F;  1VF9 A;  1K79 A;  4XN3 A;  5DEQ A;  5DCM B;  4AIJ A;  2DFE A;  3H3U A;  4OU0 A;  3CLO A;  3FM3 A;  1AWC A;  4GFB A;  2I10 A;  4KYW A;  1QZY A;  3I53 A;  4OIN F;  1YFH A;  4YFK F;  2NS0 A;  1X1P A;  1DGR M;  1Z91 A;  2CW0 F;  3NAU A;  4W97 A;  2D5V A;  1ERD A;  2BY2 A;  3ZQF A;  3DTK A;  2KIM A;  3ZMV A;  3RSN A;  1FT9 A;  5D8K B;  2RNG A;  4IO9 F;  3S3M A;  1S29 A;  1I1G A;  2G0E A;  3CF2 A;  2QSG X;  2VJ5 A;  4LMY A;  4XLA A;  1T95 A;  1B8I B;  2CO5 A;  2ZNY A;  4IOC F;  2CRG A;  1ETX A;  3A0H C;  5JVT A;  1A36 A;  2LKS A;  1LDJ A;  3HEF A;  1YO5 C;  3M4O J;  1TZL A;  3MKW B;  1ETY A;  2PFB A;  3G73 A;  3CP2 A;  4IEJ A;  1STZ A;  4KIF A;  1ZR4 A;  4XRS A;  1J75 A;  2WAD A;  5HLT A;  2X6Y A;  3OR1 C;  3CDI A;  2F4O B;  2QCO A;  1YJ9 I;  5ILS A;  3PSI A;  1MH4 A;  2VOD A;  2ECC A;  4AIK A;  1YG2 A;  1F43 A;  3HSF A;  3BZC A;  2K40 A;  3ISP A;  3JRG A;  2MAB A;  3JRC A;  4P96 A;  5CVR A;  4RBO A;  1DUX C;  4A6D A;  3K2A A;  4ESB A;  2XAF A;  3BG7 A;  3LSI A;  2M30 A;  5F0F A;  2P81 A;  1DPU A;  3K4J A;  5KNL A;  2KPM A;  3VFZ A;  1KU2 A;  3S8P A;  4BAC A;  2DOE A;  2LKP A;  1Z7L A;  4HOB A;  1RC9 A;  4ITV A;  2HDW A;  2FA5 A;  2E36 A;  3L2V A;  4UVB A;  4AC0 A;  1IG7 A;  3RYR A;  4LLN A;  1D8K A;  3ZXS A;  4ZH4 F;  2PLY A;  1GVJ A;  1W5S A;  1CQT A;  1RUO A;  3FKJ A;  2O7O A;  4V2G A;  2R7S A;  2QQB A;  5IYB J;  3HGG A;  3V4G A;  1C0W A;  2V1X A;  2RDP A;  1IXC A;  1W4M A;  2XV4 S;  3KYD B;  3CCV I;  3PFY A;  1LJ9 A;  4UUT A;  2X1C A;  5BNG A;  3FBI B;  3S15 J;  4B4C A;  4CDG A;  3DKY A;  1QGP A;  1F5T A;  3M7G A;  3OYI A;  1O3S A;  2X1D A;  4EEF G;  4WX9 A;  3CJN A;  5FRO A;  4Y15 A;  1TP4 A;  3J7Y J;  2L9N A;  3DEE A;  2G9W A;  4Q5S F;  4KMF A;  3FX3 A;  1SMT A;  2K7L A;  2DPU A;  2QQ8 A;  3HXL A;  2QYO A;  3ZOB A;  3F0C A;  4RS8 A;  2EIJ H;  3OYH A;  2K4B A;  5KHD A;  4L0Y B;  1F1Z A;  5FD5 A;  4BJ6 C;  3OSF A;  2L7M P;  3O3K A;  4Y52 J;  1D1C A;  1J0R A;  3JW4 A;  2VLA A;  3U9G A;  2HXI A;  4XR6 A;  1SD6 A;  2M34 A;  5L3C A;  3F72 A;  3TOA A;  5FO5 A;  5DUI A;  1WJ5 A;  5HLI A;  5DDG A;  1V3F A;  1Y8R B;  2ME0 A;  4MFD A;  2G7U A;  1IN4 A;  3F21 A;  1OCT C;  3BZK A;  2LF8 A;  2CQK A;  4GRI A;  1A6Q A;  3MCZ A;  2IA0 A;  4IKF A;  4B48 A;  3E5U A;  4XOR A;  2VOO A;  4G7H F;  3M1C A;  4OMY A;  2R5Y B;  3K70 C;  1VI0 A;  4HNT A;  2VT2 A;  4XOP A;  3I4M J;  5EJC A;  5CKT A;  1KZH A;  3I4P A;  2LK2 A;  1MJ9 A;  1TW3 A;  2D2W A;  4OAY A;  1X1B A;  4BQN A;  1G3T A;  3A2K A;  2YR2 A;  4RGR A;  5AIP A;  2E2I J;  4D5F A;  3F23 A;  3JCU C;  3KLO A;  5M5Y J;  1VQ9 I;  2KQR A;  2Z16 A;  4BBS J;  3QYE A;  3I55 I;  2M45 A;  3LFK A;  3MN2 A;  1JE8 A;  2X4H A;  3CJQ B;  3E6D A;  5M5X J;  1DDN A;  3SZT A;  4IJA A;  1J59 A;  2BW3 B;  2QWW A;  3DV8 A;  2ZJP F;  2WV0 A;  1WPK A;  1UMQ A;  2EFQ A;  2LLK A;  2QBY B;  1BI0 A;  3QRF F;  3ERE D;  1YJW I;  2GXG A;  2VB6 A;  3MZY A;  3NAR A;  3GBG A;  1DQU A;  2QLZ A;  2WB1 N;  4KN4 X;  2E2H J;  3JRF A;  3AAF A;  1YYV A;  3KP4 A;  3OYE A;  1TW2 A;  2BXZ A;  1ZKG A;  3HOV J;  3KEQ A;  1WZ2 A;  2XGX A;  1NK3 P;  2IGM A;  2ZBK A;  5CQE A;  2VAS A;  1YI2 I;  1EJ9 A;  2FBI A;  2AXT C;  2W57 A; 
#chains in the Genus database with same CATH homology
 4M9Z A;  2YU3 A;  4Y13 A;  4HX4 A;  3HSR A;  4KFC A;  2F5D A;  2MH9 A;  3J7A O;  1R1T A;  3C7J A;  1R00 A;  5H6Q A;  2O8X A;  4LGW A;  4B8X A;  3LST A;  3QPH A;  3RI4 A;  3LAJ A;  4HBL A;  3I64 A;  1LB2 A;  1SD7 A;  4RAY A;  5F64 A;  3TO9 A;  1X3U A;  3MQ0 A;  1BI1 A;  3KEO A;  2YX4 A;  2P6T A;  2LF7 A;  4P55 A;  3QAH A;  3T5X A;  4FT8 A;  4L18 B;  4YIF A;  5LHG A;  1R36 A;  2FOK A;  5E8G A;  3WTU C;  4HV6 A;  1G3W A;  3LA7 A;  4U0Y A;  5D5W B;  3KP6 A;  1P4X A;  1YIO A;  3ZPL A;  2XRN A;  1R58 A;  1RNL A;  3HRS A;  2ISY A;  2GIV A;  3GFL A;  4HQE A;  4I02 A;  2DFI A;  3DXJ F;  3BDD A;  1QZZ A;  4UNO A;  2RQP A;  4ESJ A;  2Q8K A;  1S7O A;  3BRO A;  1G4D A;  1QO0 D;  2EV5 A;  2VBX A;  3Q9S A;  3JSO A;  3F8N A;  4U0V A;  2JSC A;  1L3L A;  3V7C A;  3IRR A;  3IKT A;  1ZG1 A;  2M8E A;  4YFN F;  3D5L A;  1O57 A;  1FP2 A;  1D8J A;  2O3F A;  3CDH A;  4OIP F;  1HBX G;  1FPQ A;  1IUY A;  1HQC A;  5L3F A;  1XDS A;  2W24 A;  1B9M A;  3QP5 A;  3GX4 X;  4D0P A;  5ILU A;  3E6C C;  3JTH A;  1IZ1 A;  3F3X A;  1IN5 A;  1Z9C A;  3CUO A;  3QPT A;  1YQA A;  5BOX A;  4XSZ F;  5CVJ A;  5LGT A;  1XGN A;  2XAQ A;  3FXR A;  2ZJ2 A;  3J81 Z;  3GW2 A;  4ZYG A;  5BPD A;  3KZZ A;  4O6J A;  2LNB A;  1XDU A;  2Y75 A;  4ENJ A;  1W7P B;  1KQ9 A;  2L4A A;  2D45 A;  1ZHF A;  2TDX A;  4YFX F;  2OZU A;  2M5W A;  2K4J A;  4AVP A;  2H6B A;  3BY6 A;  2XUB A;  3SXY A;  5E1W A;  3H92 A;  1MJB A;  3WGG A;  1FBQ A;  2COM A;  1Q1H A;  1HKS A;  2XVC A;  4BQA A;  2YX7 A;  3DFG A;  2XIG A;  2UZK A;  3NRV A;  3WGH A;  1TQP A;  5F1R A;  1HXD A;  2FEZ A;  2VON A;  2EFW A;  1ZYR F;  4KIG A;  4HYE A;  4WXH A;  1XSD A;  1IRG A;  4I2O A;  1HKT A;  2MH2 A;  1XGO A;  4LFU A;  4ZYE A;  1SD5 A;  5E17 F;  2XAS A;  4LLL A;  4BHP A;  5D6F A;  5D5U B;  3IHU A;  1TQM A;  4ZZL A;  3GZ5 A;  4NB5 A;  4OOI A;  5ICC A;  1U5T A;  2MBF A;  2HKX A;  5HOO A;  2RKH A;  4ETS A;  3N97 A;  2JPC A;  2RN7 A;  3E3V A;  3TO6 A;  1W5T A;  1FNN A;  4UV8 A;  3GZ6 A;  5H20 A;  5CVV A;  1U8R A;  4IHT A;  2P4W A;  3KP5 A;  3V8L A;  5J8C A;  3I71 A;  3NEU A;  4WXD A;  2K86 A;  2KKO A;  1ZRD A;  3QU3 A;  2Q2E A;  2Z33 A;  1OKR A;  1Y0U A;  4DNC A;  4UXN A;  4HZF A;  4AIH A;  3SHF A;  3T1B A;  3HUG A;  3CTA A;  2JPB A;  4FHT A;  3HYI A;  1FLI A;  5KK1 A;  1YW7 A;  5HS9 A;  3WTY C;  1MDM B;  2ESH A;  4KUM A;  4I7H A;  1Z7U A;  4L0Z B;  2CSO A;  2ZME A;  1ZN2 A;  1KQ8 A;  1I27 A;  4CIC A;  3WTS C;  3WU1 B;  3MZH A;  3C1D A;  2ZCW A;  5CJ9 A;  2A69 F;  2HYF A;  3DPL C;  4MQV A;  5K1Y A;  1O3T A;  1SFX A;  2DI3 A;  3QU6 A;  5BMZ A;  4M9S A;  4CGZ A;  2EFN A;  1XSV A;  2GWR A;  1G6N A;  1GXQ A;  3WTZ A;  2EFO A;  3DQV C;  2OA4 A;  1FC3 A;  1R7J A;  4G7O F;  4M6Y A;  1T39 A;  3I5U A;  1JHH A;  1KU9 A;  6PAX A;  5DCM A;  2Z99 A;  1KQ0 A;  2ZFW A;  3TOB A;  2GA1 A;  1YW8 A;  2L02 A;  3FMS A;  4EVI A;  1S7A A;  3U2R A;  2IPQ X;  4EJW A;  3HRU A;  4HDU A;  2VE9 A;  4HAM A;  2EWN A;  3P9I A;  3J80 Z;  1ONV A;  3HHH A;  3ECH A;  4CHU A;  2VXZ A;  1FY7 A;  1O3Q A;  4I0A A;  5L3G A;  1F4K A;  3FXQ A;  2W25 A;  3DF8 A;  2A68 F;  1XB4 A;  2IJL A;  2DO7 A;  1ZG3 A;  3BJO A;  3ZQ7 A;  3TGN A;  1TTY A;  1P2F A;  3K2Z A;  4EJO A;  3ABU A;  1LDD A;  4BHB A;  2HFH A;  1I6X A;  1CF7 A;  1G3S A;  1ZRF A;  4A12 A;  2C6Y A;  4EJT A;  2B0L A;  4L9J A;  3B02 A;  4U0W A;  5DD8 A;  2IA2 A;  2PMU A;  2O03 A;  5LEJ A;  3E6M A;  1P4W A;  5D4R A;  2FU4 A;  4HX7 A;  5HS7 A;  4WCG A;  2DK5 A;  5BPI A;  2O0Y A;  4M73 A;  5E18 F;  1IXS B;  2OD5 A;  2FBK A;  4L9N A;  2R7F A;  4HA8 A;  3F6V A;  1ON2 A;  3OV8 A;  2ESN A;  4HW0 A;  1IN6 A;  1R5H A;  1QQI A;  2OU2 A;  3L09 A;  2WC2 A;  2CWE A;  5FD6 A;  2DQR A;  1XMK A;  3DEU A;  4KNY A;  2BV6 A;  3TO7 A;  2WTE A;  2V79 A;  3F8C A;  2H27 A;  3RYP A;  1BN5 A;  4LD5 A;  5ED4 A;  5L3D A;  4XLN F;  3HIF A;  2QZ8 A;  1BC8 C;  4OIO F;  1HW2 A;  1EH7 A;  5TRD A;  3R61 A;  3FWE A;  4UVC A;  2ETH A;  4ENN A;  3EYI A;  2Y0M A;  4HV5 A;  5L3B A;  5A2Q Z;  1K7A A;  2KJB A;  1ZRE A;  1FOK A;  3EUH A;  4QWQ A;  3GEZ A;  3GFI A;  4QLC U;  3CUQ B;  4KIB A;  2PQ8 A;  1BIA A;  1FYM A;  1LVA A;  4O3M A;  5D6E A;  2DPD A;  3RPU A;  4LG0 A;  1L0O C;  4M6X A;  2VBZ A;  4KT5 C;  3VOD A;  5JFR A;  3PFI A;  4IVN A;  5HDN A;  4LB5 A;  2IA1 A;  3M8F A;  4CYD A;  3S2W A;  5BQT A;  5L3E A;  3T8T A;  5LHI A;  3LAP A;  2FSW A;  3FM5 A;  4PDK A;  2Z3Y A;  1R5G A;  2X0L A;  3L7W A;  2IT0 A;  1BBY A;  3T0Y A;  3WE2 A;  4MTE A;  1IAW A;  2HEO A;  4LB6 B;  3ABT A;  5CYV A;  3L00 A;  1BOA A;  2JTV A;  4I0B A;  3D0S A;  3HRM A;  4HF1 A;  3FHZ A;  4MTD A;  4FX4 A;  2GAU A;  2EV6 A;  2ELH A;  3BP8 A;  2GXB A;  2QUF A;  1K78 B;  3DP7 A;  3P7N A;  1LQ1 A;  2EK5 A;  1ZGJ A;  3EDP A;  3J81 K;  4LK1 F;  1R23 A;  5FLX Z;  2R3S A;  2F5C A;  4U88 A;  4RB3 C;  4Z2Y A;  1UFM A;  3MFK A;  4JK1 X;  1DP7 P;  1XGM A;  4AD9 A;  1XN7 A;  4AWX B;  3R0A A;  3KP2 A;  2H09 A;  4G6Q A;  4I98 B;  2HTJ A;  3ELK A;  1IN7 A;  1O7L A;  2FMY A;  3K9T A;  2STW A;  4G9Y A;  2LSO A;  2IP2 A;  4OMZ A;  1BM9 A;  2WWY A;  4XSX F;  4WK8 F;  4RGX A;  5LRR A;  1BC7 C;  3K1P A;  4Q48 A;  4IRI A;  3KLN A;  2EV0 A;  3HRT A;  5DUK A;  1CGP A;  4N9H A;  1HST A;  5JI6 A;  4IPA A;  3WTT C;  2JT1 A;  2QM3 A;  5FFX A;  1RUN A;  2XAJ A;  4O5V A;  3LQQ A;  2XAH A;  3R0J A;  4RB0 A;  5LGU A;  1KGS A;  1OPC A;  1OYW A;  5LEK A;  2A61 A;  2FML A;  5LBQ A;  3WG9 A;  3V7R A;  3E97 A;  4M74 A;  4Q47 A;  1BI3 A;  4OIQ F;  1JHF A;  5EEG A;  3R6S A;  1FX7 A;  1TBX A;  3I59 B;  2A5Y B;  1P6R A;  3SQN A;  2XKO A;  2VBY A;  1RI7 A;  3I54 A;  1REP C;  4YG2 F;  2VE8 A;  2DLL A;  4OIR F;  4LLG F;  1IF1 A;  1KYZ A;  2E7W A;  5BS6 A;  3ROU A;  1ZGA A;  3KFW X;  1S3J A;  3IRQ A;  1K6O A;  2FQ3 A;  3FMR A;  4YII A;  1YW9 A;  2HOE A;  4LK0 F;  4MEY F;  3ZMS A;  2Z9O A;  1ZG5 A;  2IVM A;  4EGY A;  3WE3 A;  3M9A A;  4PCQ A;  2FNP A;  1RIO H;  2IW5 A;  1FWZ A;  1KA8 A;  2OAZ A;  5CVI A;  5AON A;  2XKP A;  1MZB A;  4RAZ A;  5K5Q A;  2W85 A;  1ZLK A;  5ICE A;  5H6R A;  3RJP A;  4M72 A;  4Y17 A;  1UHM A;  3GWZ A;  3ECO A;  3HTU A;  2D1H A;  5LHH A;  1VTN C;  2FF4 A;  4U7D A;  4UUV A;  4IRG A;  2FBH A;  1XGS A;  1GHC A;  4EMS A;  1B9N A;  1LDK B;  1ZLJ A;  4JBA A;  4KDP A;  4GYG A;  1OYI A;  1U5T B;  2CGP A;  1FYL A;  2DTR A;  3W6J B;  3CUQ C;  4EJV A;  1BJA A;  2O61 A;  5J6X A;  5DCF A;  4MEX F;  4HQM A;  4A5M A;  2PN6 A;  5TJJ A;  3TDZ C;  3QP6 A;  4GYI A;  1UB9 A;  2P6S A;  1T0F A;  2KIU A;  3O6B B;  4L9T A;  4L5J A;  1P4A A;  2MA3 A;  3J80 K;  2J5P A;  1FZP B;  5HDK A;  4P5O A;  2QQA A;  3BZ6 A;  2PBI A;  1T38 A;  3ML6 A;  3I58 A;  1JGS A;  2D1V A;  3HTS B;  1EH8 A;  1YLF A;  2V1D A;  2M1B A;  1MKM A;  1FBS A;  4M9X A;  2QEN A;  4ENM A;  1MJA A;  3E5X A;  3COA C;  2RC4 A;  1I5Z A;  1HW1 A;  1YTY A;  2NNN A;  4CZZ A;  2HZT A;  1WKM A;  3FF5 A;  5FFZ A;  1G3Y A;  1OR7 A;  1H9G A;  3C3W A;  2ZME B;  3ZMU A;  2AS5 F;  2Z5U A;  1XD7 A;  1XCV A;  4P9U A;  1QPM A;  4XLP F;  4EQQ A;  3BPX A;  4NHJ A;  3O2P E;  4R1H A;  3KP7 A;  5ILV A;  4XRF A;  5J8F A;  2VN2 A;  5IT9 Z;  2YPR A;  2XAG A;  3JSP A;  2EFP A;  2H6C A;  3BJ6 A;  1D5V A;  2KRF A;  4EGZ A;  3W6K B;  3KZY A;  4E70 A;  1Z6T A;  2MLG A;  5HVQ C;  1DPR A;  2EJR A;  2ADU A;  1SFE A;  5JHU A;  2F2E A;  2PJP A;  2VC0 A;  1U2W A;  2GZW A;  3F6O A;  4P9F A;  1LEA A;  2E7X A;  3WTV C;  2OZ6 A;  3PQK A;  3HOS A;  5A2Q K;  1WSU A;  2KIF A;  4KA4 A;  1V4R A;  2G7H A;  4B09 A;  3LWF A;  2PG4 A;  3VOE A;  1UST A;  1KU3 A;  3KET A;  2A3S A;  3LA3 A;  3F8B A;  2GQQ A;  2ZNZ A;  3PQJ A;  5E20 A;  1E2X A;  3FMQ A;  3P9C A;  5D8L B;  4N0B A;  1CF7 B;  1S6L A;  1IXR C;  4RB1 A;  5D5V B;  3KE2 A;  2L01 A;  2OQR A;  2ZKZ A;  2OQG A;  4A6E A;  2ZXJ A;  1OMI A;  2HYG D;  4GCV A;  1U78 A;  5HS8 A;  4CO8 A;  4EM0 B;  1TLH B;  5FGM A;  2VOP A;  3GYH X;  1HSJ A;  2UWM A;  4NQW A;  5F6F A;  5DD4 A;  3G3Z A;  2FNA A;  1FBU A;  3SFZ A;  4WF2 A;  4ENK A;  3GLX A;  1A04 A;  4A0Z A;  3CO7 C;  4PGG A;  1ZRC A;  3EQL F;  5HLH A;  2QVO A;  2J5O A;  3V8K A;  5DV5 A;  3Q9V A;  3K0L A;  2Q0O A;  2PI0 A;  5LGN A;  2L4M A;  2MC3 A;  4ZYH A;  5AIQ A;  4KN7 X;  5FLX K;  4BNC A;  4RGS A;  2PMH A;  3BJA A;  3HHG A;  4FX0 A;  3MWM A;  2BGC A;  3R4K A;  3CUQ A;  2QBY A;  3GFM A;  2PEX A;  3EET A;  2HWV A;  4A0Y A;  4F7Z A;  2AXL A;  2JRT A;  5ERI A;  4CXF A;  4ON0 A;  3GVA A;  1U5T C;  3B73 A;  4EM2 A;  1TNT A;  3IL2 A;  1Z6R A;  4H0E A;  1KYW A;  1BIB A;  4UV9 A;  1YS7 A;  2M87 A;  3GFJ A;  4MNU A;  3K1M A;  1SD4 A;  4RB2 C;  4KIC A;  4A2U A;  2DBB A;  4ASN A;  4LG0 B;  2UXN A;  1FSE A;  2A6E F;  2DT5 A;  3GUD A;  5D4S A;  1PP7 U;  5IT3 A;  2QQ9 A;  3KCC A;  2RGV A;  3ZN0 A;  3RKY A;  3L2C A;  1LEB A;  1WQ2 A;  4WWC A;  1O7F A;  3R60 A;  1D3Y A;  3HSE A;  1P92 A;  1SMY F;  3H3Z A;  4PZJ A;  5D5X B;  4JQF A;  4BYY A;  3JAM K;  2BYV E;  2CYY A;  1K78 A;  4PGH A;  1IRF A;  3ULQ B;  2YSR A;  1Z1D A;  1ZAR A;  3RKW A;  3TKY A;  1ON1 A;  3F8M A;  2DQL A;  3GO5 A;  2P5K A;  4BAY A;  3E5Q A;  3Q5F A;  2KJC A;  4HX8 A;  3VEP A;  4UVA A;  2F5E A;  3WGI A;  4IXA A;  2R7D A;  3E6B A;  1ZAO A;  3BWG A;  2A07 F;  1UCR A;  3I0T A;  3K69 A;  1IW7 F;  1E17 A;  4EV0 A;  1WRJ A;  3IKV A;  3V7S A;  3ZP5 A;  2BE5 F;  4IF4 A;  1MD0 A;  3BPV A;  3V8J A;  1WWX A;  2ZO4 A;  1BI2 A;  2CG4 A;  3DPT A;  3LQR A;  4N9I A;  4HF2 A;  1QBJ A;  1U6G A;  1O3R A;  1ZH5 A;  2HR3 A;  2XRO A;  5EEH A;  4EM1 A;  3FXU A;  3MEX A;  1Z05 A;  1PDN C;  4I09 A;  1EH6 A;  4HDV A;  4TV7 A;  1ODD A;  3ZMZ A;  4IRH A;  3IC7 A;  2UXX A;  4KMU X;  3QOP A;  5HLG A;  1IN8 A;  4IHS A;  3M8E A;  3JAM Z;  2EB7 A;  2JZY A;  3BOQ A;  3VB2 A;  1FYK A;  4L9V A;  1OYY A;  1QNT A;  1J7K A;  2RNJ A;  2E1N A;  2OBP A;  2XHK A;  4GO1 A;  3RIR A;  4EJU A;  3I59 A;  1W7P A;  2W84 A;  5JR3 A;  2Y48 A;  3KP3 A;  4G94 A;  3ZN1 A;  4ZYD A;  4ESF A;  1R1V A;  2P8T A;  3WTW C;  2RV8 A;  5E1Z B;  4ZZD A;  3C18 A;  3F8F A;  5HDG A;  4L5I A;  1T98 A;  3M1E A;  2DAO A;  1XCB A;  2LDU A;  2DU9 A;  4I01 A;  2P5L C;  4WXC A;  4MHG A;  4G7Z F;  1GXP A;  2EA4 A;  3CO6 C;  4G8X A;  3ZMT A;  1F9N A;  1T2K A;  3TQN A;  2HGC A;  2STT A;  2A6H F;  3MAJ A;  2V9V A;  1U3E M;  2IRF G;  2ISZ A;  2RVC A;  1J9I A;  4M71 A;  1TQI A;  1XSX A;  1B4A A;  2HQR A;  3EYY A;  4A5N A;  2VC1 A;  4K2E A;  1XMA A;  4A0X A;  2K02 A;  5KVR A;  3REO A;  2MLK A;  1SFU A;  5LRS A;  3SZP A;  4BHC A;  5LLQ A;  3P9K A;  1NHA A;  4G6D A;  3IWF A;  4HF0 A;  3GF2 A;  4U7B A;  1HKQ A;  1RZ4 A;  2FXA A;  5E8I A;  4BXU A;  5E1X A;  2L3D A;  1R1U A;  2ACJ A;  4BH9 A;  1EV7 A;  2P7V B;  4UHT A;  2V6C A;  3RPQ A;  2HDC A;  5IT9 K;  2VT3 A;  2H94 A;  2O6G E;  1H0M A;  4R79 A;  1LNW A;  3NQO A;  2NRA C;  2NNY A;  2E1C A;  5K5O A;  2HTS A;  1KU7 A;  5ICF A;  1TNS A;  2HS5 A;  3N4M A;  3F22 A;  4S05 A;  1PP8 F;  4RGU A;  2DW4 A;  1USS A;  4XBF A;  4GGG A;  4HLX A;  1I1S A;  3HOT A;  1B1B A;  1T6S A;  4S04 A;  2MD5 A;  3IWZ A;  1UHW A;  2GA2 A;  1MDM A;  5FB2 A;  5CVU A;  1S8N A;  4MQ9 F;  2BBY A;  1MGT A;  1B6A A;  2VBW A;  1HW5 A;  4R8H A;  1FSH A;  1ULY A;  5DYM A;  5K5R A;  3ZMD A;  2L54 A;  3FZV A;  3U1D A;  2CFX A;  1JXS A;  3LA2 A;  3T8R A;  1B59 A;  3TDU C;  1J5Y A;  4HLY A;  2BEO A;  2FRH A;  2HKO A;  3JTG A;  5ICG A;  2EA2 A;  1YS6 A;  3GXO A;  3RKX A;  2F5F A;  3RDI A;  2P7C B;  1W7P D;  2NAZ A;  2HQN A;  2V1U A;  2FE3 A;  1J2X A;  1AOY A;  4Q4Z F;  1H9T A;  4DQ2 A;  3L9F A;  2K27 A;  1PUE E;  3RTR A;  1FP1 D;  3WTX C;  2DK8 A;  4MGR A;  5CLS A;  1WI9 A;  4LJZ F;  3DKW A;  2NYX A;  1R22 A;  3K1N A;  3OOP A;  2P5V A;  4GXO A;  1SAX A;  3WU0 A;  1K79 A;  3WOD F;  5DEQ A;  5DCM B;  4AIJ A;  3H3U A;  4OU0 A;  3CLO A;  3FM3 A;  1AWC A;  4KYW A;  1QZY A;  3I53 A;  4OIN F;  1YFH A;  4YFK F;  2NS0 A;  1Z91 A;  2CW0 F;  2KIM A;  3ZMV A;  1FT9 A;  5D8K B;  1S29 A;  1I1G A;  4LMY A;  2CO5 A;  2ZNY A;  5JVT A;  1LDJ A;  1YO5 C;  3G73 A;  2PFB A;  1STZ A;  4KIF A;  1J75 A;  5ILS A;  2VOD A;  4AIK A;  1YG2 A;  3HSF A;  3ISP A;  4P96 A;  5CVR A;  1DUX C;  4A6D A;  4ESB A;  2XAF A;  2M30 A;  1DPU A;  3VFZ A;  1KU2 A;  2LKP A;  4HOB A;  2FA5 A;  4UVB A;  4LLN A;  3RYR A;  1D8K A;  4ZH4 F;  2PLY A;  1GVJ A;  1W5S A;  1RUO A;  2QQB A;  3V4G A;  1C0W A;  2V1X A;  2RDP A;  1IXC A;  1W4M A;  2XV4 S;  1LJ9 A;  4CDG A;  1QGP A;  1F5T A;  3M7G A;  1O3S A;  4WX9 A;  3CJN A;  4Y15 A;  2G9W A;  4Q5S F;  4KMF A;  3FX3 A;  1SMT A;  2K7L A;  2DPU A;  2QYO A;  4RS8 A;  2K4B A;  4L0Y B;  1F1Z A;  5FD5 A;  3O3K A;  3JW4 A;  1J0R A;  3U9G A;  1SD6 A;  5L3C A;  3F72 A;  3TOA A;  5FO5 A;  5DUI A;  5HLI A;  5DDG A;  1V3F A;  2G7U A;  1IN4 A;  3F21 A;  2LF8 A;  2CQK A;  3MCZ A;  2IA0 A;  3E5U A;  2VOO A;  4G7H F;  4OMY A;  2VT2 A;  3I4P A;  1MJ9 A;  1TW3 A;  2D2W A;  1G3T A;  2YR2 A;  4RGR A;  5AIP A;  3F23 A;  3KLO A;  2M45 A;  3LFK A;  1JE8 A;  2X4H A;  3E6D A;  1DDN A;  3SZT A;  4IJA A;  1J59 A;  2QWW A;  3DV8 A;  2WV0 A;  2EFQ A;  2QBY B;  1BI0 A;  3QRF F;  3ERE D;  2GXG A;  3MZY A;  4KN4 X;  2QLZ A;  3AAF A;  1YYV A;  3KP4 A;  1TW2 A;  3KEQ A;  2XGX A;  2ZBK A;  2FBI A;  2W57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...