3CUQC

Integrated structural and functional model of the human escrt-ii complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
173
Chain Sequence
SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
total genus 46
structure length 173
sequence length 173
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 3cuqC01
1P4XA 2DPUA 3GFLA 4ZYGA 1T98A 2XROA 5BOXA 1D5VA 3K1MA 2EWNA 4CICA 2R7DA 1PP8F 2A68F 2ACJA 1B9MA 5D4SA 4KIBA 1BI3A 5HDNA 3ERED 2H94A 4EM0B 3C1DA 3FXUA 1G3SA 3JTHA 5HLIA 2FBKA 5FB2A 1LJ9A 2P5KA 2FQ3A 4QWQA 3QOPA 4EJTA 3C18A 4L9JA 2FSWA 1WI9A 5J6XA 4EJOA 1Z7UA 3BPXA 3M8FA 2HGCA 2QUFA 1J2XA 5J8FA 5LRSA 1T0FA 4HF1A 4O5VA 3HOTA 3V8LA 1TW2A 1XSVA 4IPAA 2EV5A 1HSJA 3OOPA 4O3MA 2QENA 4L5IA 3GW2A 3HRMA 4FHTA 3ECOA 3RPUA 2K4JA 3ABTA 1BIBA 4Y15A 1QGPA 1UHMA 4KUMA 4EVIA 4IRHA 4OU0A 5HLHA 4S04A 3M1EA 3K9TA 4IJAA 1O3TA 5E1XA 3IHUA 3KP3A 4HQMA 1PP7U 5ILVA 5L3GA 3RKXA 3W6JB 3IRRA 3O6BB 3F8NA 4A12A 4G94A 5L3FA 2QM3A 3H92A 3KP6A 2RDPA 1W5TA 5JVTA 1ZGAA 2ZJ2A 2HDCA 1RUOA 2NRAC 3DF8A 2DQRA 5DDGA 2UZKA 1SD4A 1TW3A 1KU9A 3I59A 4L0YB 1FYKA 2Z99A 1CF7A 3RI4A 1AWCA 2WTEA 1F1ZA 4YFXF 4K2EA 4GYGA 1R23A 2P5VA 1MKMA 5DUIA 5J8CA 5ILSA 5TRDA 2Y75A 2QBYA 1BJAA 2O6GE 3K2ZA 4OOIA 1ZRFA 1B59A 2UWMA 2EFQA 1JE8A 1BI0A 4ZZLA 4MNUA 2GZWA 2R7FA 4HLXA 1IXCA 3FM3A 4L9NA 5K5RA 4A2UA 5KVRA 2H27A 4EMSA 2HOEA 1TQPA 3ULQB 2RC4A 2MBFA 4HQEA 5DYMA 3KLNA 3DPLC 4LLNA 4GYIA 4I98B 1T39A 3HRTA 4L0ZB 3VEPA 3CDHA 3TGNA 2PQ8A 3WU0A 4IVNA 2CO5A 2BV6A 4WCGA 2HYFA 5D6EA 1FWZA 1H9GA 4LK1F 1UFMA 4UNOA 4HYEA 1BBYA 1IUYA 3TO9A 1OYYA 2ZO4A 5EEGA 2LNBA 3GFMA 2W57A 3LFKA 2FOKA 3WTYC 1FZPB 1YLFA 1SAXA 4R79A 1IXRC 1TBXA 1MJ9A 1L3LA 4KMUX 1OYIA 2CSOA 1T6SA 4N9IA 2V1DA 2L02A 3F72A 4HAMA 1RZ4A 2ELHA 1KQ8A 4U7DA 2DT5A 5AIPA 3JW4A 1F5TA 1SFUA 1S29A 1MJAA 4CDGA 1LDDA 5LEJA 2OA4A 5ICGA 2FBIA 1ODDA 3LWFA 1HKTA 1P2FA 1FX7A 3P9KA 1ZAOA 1USSA 5FLXZ 1XDSA 1YQAA 1CF7B 2E1CA 4I09A 5FLXK 2KKOA 3F8BA 1JXSA 2CQKA 2Z5UA 4UV9A 3BPVA 2EV6A 5L3EA 4O6JA 2E7XA 4FX0A 1FP2A 5CLSA 2QBYB 1LDJA 3LQRA 3VODA 4UXNA 3KETA 2P5LC 3T5XA 2VBYA 5LGNA 5HOOA 1U5TC 4U88A 1XDUA 3JAMK 2D2WA 3GLXA 1IAWA 2FA5A 5DEQA 1Q1HA 1ULYA 2XAQA 4MQVA 2G9WA 4Z2YA 3WODF 3T0YA 2RGVA 4P5OA 4M9SA 2M5WA 2DBBA 4A0ZA 1OKRA 1U6GA 1GXQA 1E17A 3R0JA 2D1HA 2ZXJA 1J59A 3F3XA 1SMYF 4ESJA 3QU6A 4KT5C 4P96A 1YS7A 3WGHA 2LSOA 1XGOA 3MZHA 4L9VA 4I02A 1WSUA 1STZA 3J80Z 1Z6TA 2V9VA 2J5PA 2O61A 2DAOA 1MJBA 2Z33A 4KNYA 3BJAA 4BHCA 4HLYA 3BJOA 5ICFA 4RB3C 2OAZA 4L18B 5FGMA 1ONVA 3M7GA 4AD9A 3VFZA 2FXAA 2YSRA 3WTXC 3WTZA 2BBYA 3ECHA 4EJWA 1LNWA 1ZRDA 3HRUA 4R1HA 2H6BA 4KA4A 1Z91A 3EYYA 2YR2A 2K7LA 3HRSA 4Q5SF 5CJ9A 3GF2A 3HOSA 3P9IA 4PGHA 5HLGA 3SHFA 2K27A 4P9UA 3W6KB 1BC8C 4KIGA 1KA8A 1F9NA 3RKYA 2RN7A 5H20A 4CHUA 2WWYA 3IC7A 5DD4A 3E6DA 3FHZA 4AIJA 1G3YA 1AOYA 3QAHA 1I5ZA 1I6XA 3E97A 4HV6A 5K1YA 4JK1X 3M8EA 3JTGA 3BZ6A 3HHGA 5E20A 1X3UA 1SMTA 2BGCA 3BY6A 2V79A 3TDZC 2MD5A 4BQAA 1JHHA 1SD6A 3HIFA 1H0MA 3GFJA 2KRFA 3ZP5A 1USTA 1T2KA 3R6SA 1BM9A 2IA1A 2L54A 4D0PA 2YX4A 5ERIA 3ZN1A 2VONA 1FSEA 4WF2A 2VODA 2DU9A 2P8TA 1KQ9A 4UVBA 3PQJA 2OQRA 3SXYA 2LDUA 1TTYA 3FX3A 1ZGJA 5AONA 2ISZA 3V4GA 2J5OA 1B1BA 2A5YB 1EV7A 3HTSB 3L7WA 1WRJA 2XHKA 2H09A 2VBXA 3E5QA 5F64A 2BEOA 2OU2A 2A3SA 3OV8A 3WTTC 1TQIA 4NB5A 5CVIA 5BPIA 4P9FA 5HS9A 1IN6A 2MC3A 3V8JA 1U3EM 1IW7F 4G7ZF 5FFZA 2A6HF 1OR7A 4JBAA 2JT1A 2DI3A 1D8KA 2F5FA 3I64A 1KQ0A 2AXLA 3GUDA 3C3WA 1VTNC 1DP7P 4M74A 5D8LB 5LLQA 5D6FA 3FXRA 1TQMA 2NNYA 2GXBA 5LGTA 5E18F 4WK8F 1ZLJA 3LAJA 3KCCA 2GIVA 3LA2A 3HSRA 5LRRA 4WXHA 4LB6B 3RJPA 2LF8A 4EGZA 2XKPA 1U2WA 1Z9CA 4G6QA 1YO5C 1ZG5A 2P6SA 4M72A 4ZH4F 3N4MA 4ENNA 5L3BA 5TJJA 5L3DA 4AWXB 1GVJA 4Y13A 3ELKA 4HA8A 3I5UA 1HKSA 3J80K 4G7OF 3FWEA 1U5TA 2IP2A 1MZBA 2D1VA 3D0SA 3KP2A 1O3RA 5JI6A 1HKQA 2EFPA 1IN5A 3F23A 3IL2A 3H3ZA 2Z3YA 2W24A 5CYVA 1R1TA 2EFNA 1XN7A 3KE2A 2FNAA 4WWCA 3QRFF 1XCBA 5LHGA 1Z6RA 4YIFA 4LMYA 4WXCA 2OBPA 1FPQA 5D5VB 3KP5A 1B4AA 3G73A 4KMFA 2XAJA 3BROA 2ZMEB 2NNNA 1Y0UA 1E2XA 3T8TA 2M87A 3HTUA 1KU2A 2FNPA 4NHJA 3WTWC 3EETA 5CVJA 4EM2A 3HUGA 3TDUC 2CFXA 1EH8A 2KJCA 2XASA 2KIFA 1IRFA 2V6CA 1XSXA 5DUKA 4XLPF 4LD5A 2O03A 4CYDA 4WXDA 2GWRA 2NYXA 5HS7A 4KIFA 4OIQF 2BE5F 4ZYEA 2F5EA 3SQNA 2PBIA 3QP6A 3RYRA 3CJNA 3GWZA 4XBFA 4AVPA 4RB0A 2EFWA 1O57A 2W85A 4XRFA 2L4AA 1IXSB 2MH2A 3I71A 4L5JA 1ZLKA 1MD0A 3U1DA 2DK5A 3BP8A 1SD5A 4IXAA 4U0VA 3ZN0A 1WWXA 1RI7A 2XUBA 3E3VA 2B0LA 3V7RA 4BHPA 2FMYA 3T1BA 5LGUA 1R22A 3KP4A 5DV5A 4XLNF 4B09A 4EJUA 4E70A 2VT3A 4GXOA 3I53A 2F5CA 4YIIA 2YPRA 2NAZA 2DO7A 2K02A 2ETHA 4UVAA 2E1NA 1OYWA 3KLOA 3K0LA 3LQQA 4IRGA 1S6LA 2IPQX 2V1XA 4A0XA 5D5XB 1S7OA 2JRTA 1V4RA 2UXXA 5CVUA 2FF4A 2PFBA 1FP1D 5ED4A 2EA4A 1FC3A 2H6CA 1O3SA 1D3YA 3L9FA 5E1WA 1BN5A 1YTYA 3KP7A 3IKTA 1A04A 1TNSA 2QQ9A 3F6VA 2DQLA 2GA1A 4M9XA 3L00A 2DPDA 2XKOA 4PGGA 2VT2A 2PJPA 2ZNYA 2OD5A 3FF5A 4IRIA 1YW7A 2A69F 2NS0A 4BYYA 4HF2A 4P55A 4WX9A 2PMHA 2HR3A 3S2WA 2PI0A 2L4MA 2QWWA 3GVAA 3GO5A 1QZYA 2O0YA 3F6OA 1IZ1A 5E17F 5IT9Z 4ASNA 4ETSA 1H9TA 4RGUA 3JSOA 2GAUA 3CO7C 1UB9A 1ZHFA 2P4WA 4I01A 2FEZA 5H6QA 3F8CA 2VBWA 3HSFA 3MQ0A 3Q9VA 3DKWA 2QQBA 1QBJA 4M6XA 1DPUA 3CUOA 3I54A 5HVQC 1ZYRF 4HF0A 4LK0F 4HBLA 3I0TA 3N97A 4UV8A 3I59B 1MGTA 1JHFA 2W25A 3KEOA 4OMZA 5LEKA 5FD5A 3COAC 3ZMVA 4DQ2A 3Q9SA 2MLGA 1OPCA 5HDGA 3E6CC 4HV5A 2PLYA 1ZG1A 4A5NA 3O3KA 2PEXA 1FBQA 2VC0A 2O8XA 4ENKA 2HKOA 1UCRA 1UHWA 1QPMA 2M30A 4KDPA 2DTRA 2A6EF 3EDPA 3GEZA 4M73A 1HQCA 3ZMZA 4HW0A 5ICEA 2M45A 1P4AA 2EB7A 1F4KA 4FT8A 3NQOA 4JQFA 3WTSC 4YG2F 2G7UA 4LLLA 2PMUA 1XGMA 2X0LA 4HOBA 3CO6C 3GXOA 3V7CA 2ZNZA 5IT3A 2GQQA 2MH9A 1YW8A 4TV7A 1IN4A 4A0YA 1RUNA 2ZFWA 1R58A 2E7WA 2DLLA 2QVOA 1XMKA 3WGIA 1R7JA 1R1UA 3MAJA 3J7AO 4ZZDA 1SFEA 3V7SA 4L9TA 4RGXA 4BXUA 3I58A 3QP5A 1BOAA 1ZREA 3KZYA 1ON2A 4U0YA 1TNTA 4QLCU 5IT9K 3F8MA 3KZZA 1HW5A 4KN7X 1XCVA 4F7ZA 4I2OA 4CZZA 2JZYA 4UVCA 2HQNA 3SFZA 1U8RA 1JGSA 2K86A 5CVVA 4AIHA 3TO6A 2XGXA 1PUEE 5D5UB 1G3WA 5FO5A 3JAMZ 1B6AA 2OQGA 1FBUA 1XGSA 2TDXA 3FM5A 1G3TA 3AAFA 2RNJA 3HHHA 4GCVA 1QO0D 4MTDA 2IA0A 4Q48A 5HS8A 2CG4A 4G8XA 4BH9A 4ZYHA 2R3SA 3F21A 1I27A 4M6YA 1S8NA 4U7BA 3RIRA 2KIUA 3FZVA 3E5XA 4EJVA 3M9AA 3KEQA 2Y0MA 1G6NA 3PFIA 1W7PD 4RAYA 2CGPA 4UHTA 2X4HA 4LGWA 1G4DA 1IRGA 5JHUA 3O2PE 1K79A 3DXJF 2O3FA 3GFIA 3E6MA 5EEHA 1I1GA 4A6DA 4ON0A 3U9GA 4A5MA 2STWA 3WTVC 4Q4ZF 4PCQA 2EJRA 3J81Z 2Y48A 1R5HA 3J81K 4N9HA 2IVMA 2XAGA 4HDUA 1FNNA 3IRQA 2W84A 1O7LA 1ZRCA 3RYPA 3F22A 3B73A 5HDKA 1R36A 1LEBA 1K78B 2HWVA 2RQPA 2VOPA 1QQIA 4OINF 2VE8A 3R4KA 5JFRA 5F6FA 4S05A 2VOOA 6PAXA 2A07F 1T38A 4I7HA 5L3CA 4LG0B 3E5UA 3BJ6A 1OMIA 4LB5A 2XAFA 1J7KA 4OMYA 3LA3A 3CUQA 2L01A 3GYHX 3GX4X 1YW9A 1CGPA 3GZ6A 2BYVE 3ROUA 2CW0F 3ZPLA 4GO1A 1KU3A 3EQLF 2Q0OA 1REPC 4RB1A 3WU1B 1QZZA 1XGNA 2AS5F 5DD8A 4OIPF 3BDDA 2G7HA 2RV8A 1ZARA 3R0AA 3ZMUA 3DEUA 3ZMDA 3F8FA 3LA7A 1DPRA 1IN7A 3FMRA 1HXDA 3ZMSA 2VBZA 4DNCA 2K4BA 4LJZF 4KYWA 1BC7C 2FU4A 4H0EA 1L0OC 4MQ9F 1V3FA 2RVCA 2STTA 3WE3A 4YFKF 1XB4A 1LDKB 2OZ6A 4RGSA 2EFOA 4Q47A 1C0WA 2XVCA 3PQKA 3ABUA 2IRFG 3RTRA 3WTUC 2HYGD 2GXGA 2LF7A 5A2QK 1K6OA 1KGSA 2ZMEC 4IF4A 3MFKA 3ZQ7A 4HDVA 2VC1A 1BIAA 2ESNA 4CGZA 2ZKZA 3HYIA 5D5WB 3IKVA 3BWGA 4A6EA 3MWMA 3TOBA 2Z9OA 2LKPA 4HX7A 2HS5A 4XSXF 1U78A 2VXZA 4OIOF 4KICA 4XSZF 3FMQA 3ISPA 3DV8A 3SZPA 1LB2A 2WV0A 1W5SA 1FLIA 2EK5A 4G7HF 1YFHA 2XAHA 2ZCWA 1KYWA 2ESHA 4MHGA 4LG0A 5E8IA 2VE9A 1SFXA 5D4RA 2ISYA 5K5OA 1HBXG 2QLZA 3QPTA 3GZ5A 5BQTA 1DUXC 1MDMA 4EGYA 1BI1A 5FFXA 1KYZA 3WG9A 3WE2A 2KJBA 4PZJA 3K1NA 4MEXF 2HFHA 1EH6A 4HX8A 4N0BA 1W7PB 2M1BA 1GXPA 1I1SA 3CLOA 4AIKA 3L09A 2CWEA 5LHHA 4B8XA 1EH7A 2HTJA 2FRHA 2JPCA 2DK8A 3D5LA 5F1RA 4OIRF 3B02A 3MZYA 5BMZA 4U0WA 4PDKA 4EQQA 3REOA 2QYOA 3QPHA 1P6RA 3FMSA 4ENJA 2JSCA 1FT9A 1J75A 3LAPA 3TQNA 1LQ1A 3TOAA 2VN2A 4G9YA 3DFGA 2HKXA 2EV0A 1ON1A 3H3UA 3U2RA 1IF1A 1R1VA 1HW1A 3LSTA 1O7FA 5D8KB 2XIGA 2FBHA 1WQ2A 5BPDA 2HQRA 2JTVA 2F2EA 1YS6A 2CYYA 1XSDA 1S3JA 3JSPA 3DPTA 3MEXA 5BS6A 4ESBA 1LEAA 1P92A 2A61A 2ADUA 1P4WA 4M9ZA 1Z1DA 4BAYA 1K7AA 4RGRA 4LFUA 5DCFA 4NQWA 2DW4A 1HW2A 2IA2A 3CUQC 2MLKA 4CO8A 4RAZA 4MEYF 3K1PA 2M8EA 3NRVA 3K69A 2GA2A 1Z05A 2OZUA 3CUQB 3KFWX 4EM1A 1WKMA 3DQVC 1R5GA 2HZTA 5JR3A 3ZMTA 1RIOH 1YYVA 1FSHA 2D45A 1BI2A 3FXQA 4CXFA 1DDNA 2FE3A 5KK1A 2DFIA 4UUVA 2XRNA 5LHIA 2YX7A 2XV4S 5DCMA 1B9NA 3NEUA 3WGGA 3EUHA 2Q8KA 2RKHA 1IN8A 2C6YA 2P6TA 1FYLA 2HEOA 3SZTA 5E8GA 2EA2A 4KN4X 1RNLA 3Q5FA 1O3QA 4ESFA 2HTSA 5FD6A 4G6DA 5ILUA 2Q2EA 4BNCA 2P7CB 5A2QZ 3HSEA 5LBQA 1FBSA 4HX4A 1YG2A 1U5TB 4RB2C 2COMA 4R8HA 1FYMA 3RPQA 2F5DA 3P9CA 1S7AA 3C7JA 2IJLA 3P7NA 4IHTA 2P7VB 4ENMA 3RKWA 4MGRA 3TKYA 1J9IA 3R60A 3MCZA 4LLGF 5AIQA 4FX4A 1W4MA 4EV0A 1KU7A 3ML6A 2QZ8A 2L3DA 2IW5A 3IWZA 3BOQA 2PN6A 3G3ZA 1ZH5A 3DP7A 1TLHB 3L2CA 2ZMEA 5ICCA 3VB2A 2QQAA 1XMAA 1ZG3A 1NHAA 1ZN2A 2MA3A 1LVAA 2UXNA 4Y17A 2IT0A 5CVRA 3QU3A 4RS8A 4ZYDA 1GHCA 3VOEA 4I0AA 1MDMB 3IWFA 2FMLA 5H6RA 4YFNF 2WC2A 3CTAA 4HZFA 3EYIA 3V8KA 1FY7A 1J0RA 1W7PA 1SD7A 4GGGA 5K5QA 4KFCA 4I0BA 1PDNC 1FOKA 4BHBA 3R61A 2V1UA 1YIOA 3RDIA 2YU3A 3I4PA 4MTEA 3T8RA 2JPBA 1K78A 4M71A 5DCMB 3TO7A 2ZBKA 1QNTA 2PG4A 1HSTA 1D8JA 1R00A 4IHSA 1J5YA 3E6BA 2KIMA 1XD7A 5E1ZB
chains in the Genus database with same CATH superfamily
4FASD 1PUFB 3ZQHA 1SFOJ 1P4XA 2KISA 2DPUA 4GFBA 2E34A 2M7AA 1VQMI 3GFLA 3QYBA 4ZYGA 4HNVA 1HDDC 3DU6A 2PMZN 4RDUA 2Y30A 3TMOA 1T98A 2XROA 5BOXA 1D5VA 3K1MA 1JT6A 2EWNA 5F0CA 4CICA 1AU7A 2R7DA 1PP8F 2BW3B 3CC4I 4ANJA 2A68F 2ACJA 1B9MA 1WJ5A 5D4SA 4KIBA 1GT0C 1XMXA 4NBQA 3CCEI 1BI3A 5HDNA 1OCZH 3ERED 2H94A 5FKOA 5F0HA 1S5LC 2E60A 1GV2A 4CZCA 2DOEA 4CYCA 1V5GA 4EM0B 4RLFA 4B1RA 3C1DA 2KPMA 3FXUA 1WJCA 3RQ4A 1G3SA 4BDYA 3JTHA 5HLIA 1ZR2A 4MFDA 1X2MA 1JKPC 4ITVA 2FBKA 2E5NA 5FB2A 4M3GA 2KZVA 1VQLI 2DYRH 2JUCA 2WAEA 3TL4X 1LJ9A 2P5KA 3HOUJ 4Y33A 2FQ3A 4XNFA 1T8IA 3VWBA 4QWQA 5K7HA 2ECBA 3H0GJ 1YIJI 4PK4A 2M8GX 1IC8A 3QOPA 4EJTA 3CF2A 3C18A 2W4SA 4L9JA 4GDFA 1TWGJ 2DN0A 3MD2A 2WB1A 2FSWA 4FQGA 2DFFA 1WI9A 5J6XA 1MNMC 5HODA 4EJOA 1H88C 3FXKA 2WADA 4AU7A 3CCQI 4XM3A 1Z7UA 2DOAA 2XB0X 3BPXA 4RAGA 3OL3A 2R5YB 3M8FA 4A3JJ 5B66C 3KIOA 2VB6A 2HGCA 1RESA 2QUFA 2B63J 4A93J 1J2XA 3PUFA 4LOCA 5J8FA 5LRSA 5J1YA 3JR9A 2R5ZB 1T0FA 4HF1A 1WPKA 4O5VA 3HOTA 3V8LA 2H1KA 1TW2A 1XSVA 2KT0A 4IPAA 2EV5A 3KYCB 1HSJA 3DU5A 2DA1A 2VKHA 1ETQA 3OOPA 2EZLA 2QENA 2LK2A 4O3MA 3S3MA 4L5IA 3GW2A 2HNHA 4UY8I 2A6TA 3A1YA 3HRMA 4FHTA 2DODA 3L1PA 3OYJA 4XLAA 3ECOA 2CV1A 1QHHD 3H1CA 1DU6A 3RPUA 2K4JA 3ABTA 1BIBA 3BG5A 4Y15A 1QGPA 2R7SA 1UHMA 4KUMA 3A2KA 4EVIA 4DW6A 4IRHA 1N25A 5IPAA 4OU0A 1WJFA 3WG7H 1A5JA 5HLHA 3IH2A 4S04A 3M1EA 4XKWA 3K9TA 2L7ZA 2HZDA 4IJAA 1O3TA 4BDZA 5E1XA 3IHUA 3KP3A 4HQMA 2VQLA 1TL8A 2VPLA 1PP7U 3CMAI 5ILVA 5L3GA 1TWCJ 1R4NB 4ABZA 3RKXA 2MYSA 1PUFA 3W6JB 3IRRA 3O6BB 3F8NA 4A12A 1ZKGA 4BQNA 4G94A 5L3FA 2QM3A 3H92A 3EUKL 3KP6A 4ZJZA 5B5EC 3B6CA 2RDPA 1W5TA 5JVTA 1ZGAA 2H8WA 2ZJ2A 2AO9A 2HDCA 2ME0A 1RUOA 5EGOB 1FTTA 2NRAC 2HPIA 4BACA 3DF8A 5J4YA 2DQRA 4NC7A 5DDGA 4XL9A 4G6TB 1SD4A 2UZKA 1Z0XA 1TW3A 1KU9A 3K4JA 3I59A 3L2RA 1UG2A 4L0YB 1FYKA 2Z99A 1AKHB 1CF7A 2JA6J 3RI4A 1A35A 1AWCA 1GUUA 2WTEA 1F1ZA 2WY7Q 2Z16A 3ZQIA 4HSRA 4YFXF 4K2EA 3HKZA 3FK6A 2FD5A 2V9PA 4GYGA 1R23A 2P5VA 2CUEA 4XICA 1G59A 1UZCA 1MKMA 5HNHA 5DUIA 5J8CA 5ILSA 2HDDA 5TRDA 1WCMJ 2Y75A 2QBYA 1TC3C 1BJAA 2KMUA 2O6GE 2VKEA 4UUSB 1JUSA 3Q3SA 3K2ZA 4OOIA 3S32A 1ZRFA 1B59A 3OYBA 1X1AA 2UWMA 2EFQA 1JE8A 3I4NJ 1BI0A 4ZZLA 3TP0A 3CCMI 4MNUA 1JJ6C 4CSWA 2GZWA 2R7FA 4HLXA 1RC9A 1IXCA 2A05A 3FM3A 4L9NA 5K5RA 4A2UA 5KVRA 2CUFA 2H27A 2JRMA 3NARA 4EMSA 2HOEA 1TQPA 3ULQB 3S15J 2RC4A 3LSMA 2L7MP 2MBFA 1HLVA 1P7IA 4HQEA 5GADJ 2DA3A 2BVMA 3KLNA 2WV1A 3DPLC 4GYIA 4HG2A 5DYMA 4LLNA 4ZC3A 4I98B 4UB8C 4DJAA 1T39A 2JA2A 3CCLI 2CUZA 3HRTA 1GV5A 3D1NI 4XK4A 3OYLA 4L0ZB 5J4VA 3VEPA 3CDHA 1PVEA 3TGNA 2PQ8A 3HKZN 3WU0A 4IVNA 2CO5A 2BV6A 2QSFX 1LUJB 2KRHA 4XKVA 4M6VA 4WCGA 1IDZA 2HYFA 2TCTA 5D6EA 1FWZA 1H9GA 2VIXA 2X6OA 1QPIA 4LK1F 1FOYA 1UFMA 4UNOA 4HYEA 1BBYA 5J40A 4IEJA 4X6AJ 3TBIA 1IUYA 4II2A 1W1WE 1OYYA 3TO9A 3CF5F 3AL0C 1HDPA 2ZO4A 3FIWA 3H36A 2DTZA 3UKGA 4L5EA 5EEGA 1VQ6I 2LNBA 3GFMA 2W57A 2KIQA 3LFKA 4V2GA 4XLEA 2FOKA 3WTYC 1FZPB 2AQFA 1YLFA 4CCOA 3CP2A 2PJRB 1SAXA 1X58A 4R79A 5E3LA 1IXRC 1TBXA 1MJ9A 1L3LA 4KMUX 1OYIA 2CSOA 1T6SA 4N9IA 2V1DA 2L02A 1IO2A 3F72A 1SFKA 3SEZA 4HAMA 3GTMJ 1V5EA 1JI8A 1I3QJ 1RZ4A 2ELHA 2R7UA 1T08B 1KQ8A 3OS1A 2M7BA 3OIOA 1RETA 4U7DA 2ZSIB 2DT5A 5AIPA 5JLXA 3JW4A 1F5TA 3HEFA 3IAS2 1SFUA 1S29A 2HVQA 3MN2A 3JREA 4QPQA 3JRDA 2BW3A 1OCRH 1X1DA 5E3NA 1MJAA 3QQAA 4CDGA 1LDDA 1JTYA 1T95A 5LEJA 2K9SA 2OA4A 5ICGA 1ODDA 2FBIA 3LWFA 2QSHX 4OWRB 4B3XA 2KFDA 3TW6A 1HKTA 4KT6A 5FLMJ 1P2FA 1FX7A 1GVDA 2HXIA 5M5WJ 3P9KA 3DBRB 3OOUA 4BY7J 1ZAOA 1USSA 4IHYA 1AA7A 2DMQA 4B48A 3OYFA 5FLXZ 1XDSA 1LVKA 1YQAA 2EBIA 1CF7B 3TP3A 4I09A 2E1CA 3GCMA 3WU2C 2KKOA 3IAM2 5FLXK 5E3OA 4A69C 3F8BA 1JXSA 2CQKA 3OR2C 4ZYAA 2Z5UA 4UV9A 5J47A 3BPVA 2M0CA 2EV6A 5L3EA 2W48A 4O6JA 2E7XA 4FX0A 4B3AA 1FP2A 5CLSA 2QBYB 2DT7B 4X1EA 1ZQ3P 3HDDA 3ZXSA 4ZTJA 3GTKJ 1LDJA 4BQQA 2IGOA 3LQRA 5IYCJ 3VODA 2QF7A 2LC2A 1ENHA 4E7HA 4UXNA 3KETA 2P5LC 2HOSA 3FXMA 3W6VA 3T5XA 2VBYA 5LGNA 5HOOA 1N78A 1U5TC 1A6IA 4U88A 1OCOH 1XDUA 5IOZA 3JAMK 1Q1VA 2D2WA 3GLXA 1XS9A 1IAWA 3MKYB 2FA5A 5DEQA 4DBRA 1FMVA 1Q1HA 1ULYA 2WBMA 2XAQA 4MQVA 5EG0A 3PSIA 1UG0A 2IBDA 2G9WA 3VYUB 4M3BA 4Z2YA 1BOBA 3WODF 3T0YA 3SDBA 1VQ7I 1MSFC 2RGVA 4UB6C 2DA2A 3E7LA 4P5OA 4M9SA 2M5WA 1RR7A 2DOFA 2DBBA 2BXZA 2E1MB 4A0ZA 1OKRA 1U6GA 1GXQA 1E17A 5C44J 3R0JA 2D1HA 3PNTA 2JA7J 2ZXJA 1J59A 3F3XA 4PSWA 1SMYF 4ESJA 4AC0A 2DA7A 3FXLA 3QU6A 4KT5C 4P96A 1YS7A 3HOZJ 3V42A 3VYTB 3WGHA 4I99C 4C9YA 1ZELA 2LSOA 1F43A 3GBGA 1XGOA 1Z7LA 2DFHA 3MZHA 4L9VA 2LY9A 4I02A 3BQZA 2CQXA 3RSNA 1WSUA 1STZA 1NG7A 3K7AJ 3J80Z 3RZOJ 1Z6TA 4MIMA 2V9VA 2E5ZA 1WI3A 2J5PA 2O61A 2MC4A 2XPUA 2DAOA 4F55A 1MJBA 2Z33A 2KDOA 2B7EA 4KNYA 1WVRA 3BG9A 3BJAA 1OLTA 3OY9A 4BHCA 4HLYA 3BJOA 3I3LA 3F9KA 2A5WA 5ICFA 1YX5A 4RB3C 2OAZA 4BJTA 4L18B 5FGMA 2DT6A 1ONVA 3H9JA 3M7GA 1SAUA 4AD9A 2ZJQF 4C2UA 1WFXA 3VYRB 3VFZA 2I8DA 2FXAA 1D5YA 2YSRA 2R92J 3DPUA 3WTXC 3WTZA 2MW8A 1MMAA 3PIPF 2BBYA 5CQGA 4QSHA 2R7WA 3ECHA 4EJWA 1LNWA 2R7OA 1ZRDA 3HRUA 5FKMA 3H5NA 2EINH 4R1HA 1ETVA 2H6BA 1BW5A 2EZKA 4W1UA 4KA4A 2NS7A 1Z91A 3EYYA 2LLKA 2YR2A 3S14J 2K7LA 3HRSA 4Q5SF 1RRJA 5TGTA 2K3FA 4E7KA 5CJ9A 3ABKH 3GF2A 4XR6A 3HOSA 3P9IA 4PGHA 4FE7A 5HLGA 3SHFA 2K27A 4P9UA 2CH0A 1QHGA 3W6KB 4DZPA 1BC8C 2QGUA 4C3IJ 3S16J 4KIGA 1IGNA 3G1OA 2JMWA 1KA8A 1F9NA 2F4OB 3RKYA 1W5CC 2RN7A 5H20A 1VQKI 4CHUA 1QA6A 2NXNB 4XOTA 1E3PA 3LMMA 2WWYA 3IC7A 2NVXJ 5DD4A 2CQNA 2GIZA 3E6DA 1FIAA 3FHZA 1YX3A 4MFEA 2JA8J 3W2VA 1G3YA 4AIJA 1AOYA 1APLC 4NC8A 2QKLB 5EZGA 3ESWB 1JUMA 4AYBA 3QAHA 1I5ZA 1LPQA 1I6XA 3E97A 4HV6A 3SZGA 4IX7A 5K1YA 4JK1X 5EEAA 2R4GA 2ID6A 3M8EA 3JTGA 3BZ6A 5M5XJ 5EYRA 3HHGA 2RNGA 4D5CA 5E20A 1X3UA 2KL4A 1SMTA 2BGCA 4Y52J 3BY6A 2V79A 3TDZC 2LKXA 2JWTA 4YELA 2EILH 2MD5A 4BQAA 3S8PA 1JHHA 1SD6A 4EATA 3HIFA 4G12A 3GFJA 4JYKA 1H0MA 1EA3A 2KRFA 1YRNA 1LFUP 4BXXJ 4C30A 3E0JB 3ZP5A 4A3KJ 1USTA 3G1MA 3AKZA 1T2KA 5GTIC 1B72A 4J00A 3R6SA 2VJ4A 1BM9A 3CCSI 2Y9YA 2IA1A 1QZEA 1SEUA 2L54A 1NG6A 1MBKA 1SVOA 4D0PA 2YX4A 5ERIA 3ZN1A 1RR8C 2IXSA 2VONA 1FSEA 4WF2A 2VODA 2DU9A 2EH3A 3IP4B 2YU9J 2P8TA 1KQ9A 3BR0A 4UVBA 4C3HJ 4DYCA 3PQJA 2OQRA 4XLHA 2NVTJ 2Q1ZB 3SXYA 2LDUA 1TTYA 3FX3A 1ZGJA 3K4BA 2JJ7A 3IUOA 5AONA 1XX5A 3JRAA 2ISZA 2DA4A 3V4GA 2J5OA 1B1BA 2A5YB 3FXJA 4F91B 1EV7A 3QYFA 1OCPA 3HOYJ 3LSGA 2E19A 3HTSB 2OPTA 3G6EI 3G71I 3L7WA 1WRJA 2WB1N 4W97A 3GTGJ 2RAEA 3I9V2 2K5CA 2XHKA 2HU9A 2H09A 2XRLA 2VBXA 3E5QA 5F64A 3HGYA 5BNGA 1MH4A 2HQ5A 3OMYA 2BEOA 3TEDA 4J01A 3L2WA 3VPRA 2L2OA 2OU2A 2A3SA 3OV8A 3WTTC 1TQIA 4NB5A 5CVIA 5BPIA 4IZZA 4P9FA 1YJNI 1I3AA 3CMEI 2E1MC 4YRVA 3SFIA 5HS9A 3TW7A 1MBFA 5IYBJ 1IN6A 3H9GA 2MC3A 3SYTA 2JVHA 4E7LA 3BLYA 4BS9A 3V8JA 4A3BJ 1U3EM 1IW7F 3BT9A 2NVUB 4G7ZF 2AXTC 3ZQLA 5FFZA 2A6HF 2KZGA 2L0KA 1OR7A 4JBAA 3CCUI 2JT1A 2DXIA 1X3ZB 2DI3A 2OC6A 1D8KA 1R6RA 2F5FA 2V1NA 5H2FC 3G4SI 3S2HJ 3D5RC 3OYNA 3OYDA 5FJ8J 3I64A 1KQ0A 3S3NA 2G0EA 3C2GA 2AXLA 3GUDA 3C3WA 2MFZA 1VTNC 1POGA 1DP7P 4M74A 5D8LB 4IHXA 5LLQA 1Z77A 5D6FA 2F4IA 3FXRA 2F4MB 1TQMA 2MSYA 5FKLA 2NNYA 2GXBA 5LGTA 5E18F 4WK8F 2Y69H 2Y9ZA 1ZLJA 3LAJA 3KCCA 2GIVA 3LA2A 3HSRA 5LRRA 2KP6A 3S2DJ 3LNQA 5B3SH 4WXHA 4Z6YA 4LB6B 1I6HJ 3CC2I 3RJPA 4JX5A 2LF8A 4EGZA 2XKPA 3OYKA 1IJWC 1U2WA 1Z9CA 2ELKA 4G6QA 1YO5C 2ZFUA 3QOEA 2VXDA 1K61A 1U8BA 1ZG5A 2P6SA 4HRIA 4M72A 2HQAA 2VKDA 3RPUD 4ZH4F 3K6GA 4ENNA 5L3BA 3N4MA 2NOJB 3W2AA 1ZR4A 5TJJA 1K83J 1FEXA 5L3DA 4AWXB 1GVJA 4Y13A 3ELKA 3IV5A 4HA8A 2DYSH 3I5UA 1E3OC 3BR6A 1HKSA 3J80K 1WZ2A 3J7AY 4G7OF 3FWEA 2LFBA 4JP0A 1U5TA 1V55H 1MZBA 2IP2A 4LIUA 2D1VA 3D0SA 3KP2A 1O3RA 5JI6A 1HKQA 2EFPA 2M4GA 3DTIA 3KPHA 1IN5A 5F27A 3F23A 3M3YJ 2LG4A 2K40A 4F52A 4CCMA 2QCOA 3IL2A 1ETWA 3H3ZA 5B1BH 2VQHA 1KZHA 2Z3YA 2W24A 3ZQCA 3K4NA 1BA5A 5CYVA 2X51A 5IYDJ 1R1TA 2EFNA 1XN7A 4QIWN 5IOYA 3KE2A 1WHUA 4IOAF 2FNAA 4WWCA 3QRFF 1XCBA 1FIPA 3BG3A 3PSFA 1MBGA 1SVMA 2R7ZJ 1FOXA 5LHGA 2W00A 1Z6RA 4YIFA 4LMYA 4WXCA 2OBPA 1FPQA 1V5FA 2B9SA 1F36A 5D5VB 1ITYA 3KP5A 1B4AA 3G73A 4KMFA 2XAJA 2E35A 4BY1J 3Q0WA 4PSXA 1K4TA 1UJ8A 4KJZA 1Y0NA 3BROA 3MZ8A 1LE8A 2ZMEB 2P0WA 2NNNA 1T56A 3WHCA 3BC8A 1Y0UA 5E3MA 4D5FA 1E2XA 3T8TA 2M87A 3OIQA 2UUZA 3HTUA 4RBOA 1HF0A 1KU2A 3H3VK 1BR1A 2K9LA 2FNPA 4NHJA 4XIDA 1E0EA 3WTWC 4V19K 3EETA 3A0HC 1FTZA 5CVJA 2L7KA 4EM2A 1XTAA 2Y0SA 3CMYA 2IS4A 1T0FC 3HUGA 3NAUA 2LYCA 3FKIJ 3TDUC 2CFXA 4XN3A 1EH8A 2KJCA 1WGXA 2XF5A 2KIFA 2XASA 3HZJA 3DLLF 4FCYA 1IRFA 2LVSA 2V6CA 1XSXA 5DUKA 4XLPF 2E71A 4LD5A 4H4KC 5FKNA 2F5VA 4DIQA 3FK7A 1OCTC 3MKZA 2O03A 4CYDA 4WXDA 2GWRA 3Q0VA 2P81A 2Y0SN 4IO9F 4EEFG 1HOMA 2GOMA 1MW7A 4A3IJ 2NYXA 3OIPA 5HS7A 4KIFA 3BR5A 4OIQF 2BE5F 1T33A 2F5EA 4ZYEA 3SQNA 2PBIA 5E79C 2YUSA 2WAFA 3QP6A 3RYRA 2PMZA 3CJNA 3GWZA 4XBFA 4C2TA 4ZDLA 2KLOA 1D1BA 2BY1A 4AVPA 3RCOA 4RB0A 2EFWA 2NS8A 2O5RA 1YITI 1O57A 2XPVA 2W85A 4JX6A 2XC7A 1PJRA 4N4OB 4LIVA 2LREA 4XRFA 4BL0B 2L4AA 1IXSB 2MH2A 3I71A 2L5QA 4L5JA 1WJBA 1MD0A 3PNVA 3U1DA 2DK5A 2XAUA 4DBQA 3BP8A 1ZLKA 3VYSB 1RKWA 4PJNA 1SD5A 3BR1A 4IXAA 2N8GA 2VLAA 2HYJA 4U0VA 3OYCA 1WWXA 1RI7A 3ZN0A 2XUBA 3E3VA 4S0HB 2B0LA 3V7RA 4AIDA 4BE1A 2OCEA 4BHPA 4CCLA 3HPGA 2FMYA 4QPOA 4CA0A 3T1BA 5LGUA 1BW6A 1MBEA 2VASA 1R22A 1IV6A 2ZB9A 4IQJA 3KP4A 5DV5A 2BZTA 4XLNF 4XONA 4B09A 4EJUA 3VSKA 4XMYA 4E70A 4XRMA 2CFOA 2GBYA 2VT3A 4GXOA 4E7IA 3I53A 2F5CA 3ZQQA 4NDLA 2YPRA 4YIIA 5HLTA 2I10A 2NAZA 2DO7A 2K02A 2JA5J 2QEXI 2DMPA 2ETHA 4UVAA 4E6KG 2JQ7A 4A3GJ 5JVGF 2E1NA 2E2IJ 1OYWA 3KLOA 2EQRA 3K0LA 1N75A 3LQQA 3QWLA 4IRGA 5GAGJ 1S6LA 2IPQX 2V1XA 4A0XA 5C4XJ 5D5XB 2IAIA 3BCAA 3GTJJ 1S7OA 2JRTA 2E2JJ 1V4RA 2UXXA 3CCYA 5CVUA 1OR7C 2FF4A 2M4KA 2X6XA 1OJLA 3A01B 2PFBA 1FP1D 5ED4A 3KYDB 1D0YA 1RKTA 1D0ZA 2EA4A 1FC3A 2KRCA 4PFOA 1BR2A 3HBLA 2H6CA 2IS6A 1O3SA 1D3YA 1MH3A 3K2AA 3L9FA 5E1WA 1BN5A 1K4SA 1FOWA 1YTYA 5IP6A 3KP7A 3IKTA 1VF9A 2R5YA 1VFCA 1A04A 4BEHB 1JT0A 3JRBA 3CD6I 3HOXJ 4PJJA 1OFCX 1HC8A 1XG1A 4F92B 1TNSA 2QQ9A 3PO3J 3F6VA 2DQLA 5CKTA 2GA1A 5FLVA 1YJ9I 4M9XA 5IY5H 2KHMA 3L00A 3DTEA 1V54H 2DPDA 1QVTA 2XKOA 4PGGA 1DGRM 2VT2A 3CJRB 2PJPA 2ZNYA 2OD5A 3KX2A 3FF5A 4II3A 4IRIA 2NVQJ 1YW7A 2R0QC 2DA6A 3AG4H 4PFPA 3RQIA 4AUXA 2A69F 4DZJA 2NS0A 1TWAJ 5DS9A 4BYYA 1B8IB 1OQYA 1MSEC 4HF2A 4P55A 3PFYA 4WX9A 2PMHA 2GLOA 3L2VA 2JUGA 2HR3A 2HI3A 1G8XA 3S2WA 2PI0A 2L4MA 1GDTA 2QWWA 2XGDA 2OCCH 2FQ4A 3GVAA 1NH3A 1NK3P 4LITA 2QQ8A 1WH5A 3CC7I 1XPXA 3GO5A 1YI2I 1QZYA 2O0YA 3F6OA 2ZXHA 1IZ1A 5E17F 5IT9Z 4B47A 2CUJA 4ASNA 3CQZJ 4LG3A 4ETSA 1H9TA 2XB5A 2LBFB 2VQGA 4RGUA 3HL2A 3JSOA 4XRSG 2VUMJ 2GAUA 3CO7C 2X1CA 1UB9A 1ZHFA 2P4WA 3ONQA 4IQ4A 2ZSHB 3FDYA 4I01A 2FEZA 5H6QA 2R7QA 4Y7NJ 2W7NA 2QSGX 1WJDA 2CRGA 2FOWA 2I5UA 3F8CA 1IDYA 2VBWA 2XGEA 3HSFA 3HOVJ 3DEWA 3MQ0A 4DGWB 2X6YA 3PUBA 3FBIB 3Q9VA 3FKJA 3S17J 2TRTA 1I50J 3DKWA 2QQBA 1QBJA 4M6XA 3BTJA 5LD2C 1DPUA 3CUOA 3I54A 5TISC 5HVQC 3DBLB 4RAFA 1ZYRF 4HF0A 4LK0F 4HBLA 3I0TA 1MMSA 3N97A 4UV8A 4A3CJ 3I59B 1MGTA 5FROA 1H89C 4DYQA 1JHFA 1AKHA 2W25A 4PJ0C 9ANTA 3KEOA 4OMZA 3B6AA 5LEKA 5FD5A 3COAC 4XQFA 1EJ9A 3ZMVA 4DQ2A 3Q9SA 4M3DA 1Y6IA 2AHQA 2MLGA 2R7VA 1OPCA 2WY8Q 1D0XA 2L7FP 1W0UA 5HDGA 3E6CC 4HV5A 4HNUA 2PLYA 3U21A 4U87A 1ZG1A 2GXAA 4A5NA 3ABMH 3O3KA 4XN0A 5DM6F 2PEXA 1FBQA 4D7NA 1A36A 2VC0A 2O8XA 4ENKA 3ABLH 2HKOA 1UCRA 1ZGWA 1UHWA 1QPMA 2M30A 1P7JA 4KDPA 1MBHA 2DTRA 2A6EF 3EDPA 3RZDJ 2WA0A 3VSLA 4RLQA 5M3FJ 3GEZA 3HOWJ 4M73A 3A02A 1HQCA 2MGQA 3ZMZA 4HW0A 3BG7A 1CQTA 5ICEA 2M45A 1X1BA 4RA2A 2HPMA 1SVLA 3M1CA 2IGKA 3BTCA 5HNFA 1OCCH 3HB9A 1P4AA 2EB7A 1F4KA 4FT8A 4B43A 3NQOA 2XF7A 4JQFA 2EIKH 2WAQA 3WTSC 4YG2F 2G7UA 4C3JJ 3KZIC 2K9NA 3JCUC 1MMGA 4LLLA 5GPAA 2ME6A 3JRFA 4BXFA 1PYVA 3PL8A 2PMUA 2LMDA 4RM2A 1XGMA 2X0LA 3CCRI 1B8IA 4HOBA 3CO6C 3GXOA 3V7CA 2ZNZA 5IT3A 2EZIA 2GQQA 2MH9A 4KITB 2CQQA 2K9MA 1IUFA 1YW8A 4TV7A 1IN4A 3L2QA 4A0YA 1RUNA 3DTKA 2ZFWA 2DDBA 1R58A 2F6CA 1YHQI 1TWFJ 4BGDA 1JTXA 3A0BC 4HNTA 2E7WA 3OYIA 2DLLA 1JKOC 2XF6A 1ZTRA 5K7FA 2OV7A 1YOVB 2QVOA 1XMKA 5JHFA 2CJJA 5M3MJ 3WGIA 2CW8A 1R7JA 1QRYA 4A3DJ 3OYAA 1R1UA 3MAJA 2K9QA 3J7AO 4ZZDA 2OTJI 1SFEA 3V7SA 4L9TA 4RGXA 1DGWY 3AFHA 4BXUA 3OSGA 3I58A 3QP5A 1BOAA 1VQPI 1ZREA 3OR1C 3KZYA 1ON2A 4U0YA 1VQ5I 1TNTA 4QLCU 3EPZA 3H35A 3S1QJ 1TT0A 2DFEA 3SDGA 5IT9K 3F8MA 3KZZA 3EUHC 3FBNB 5DM7F 1HW5A 1BR4A 4KN7X 1XCVA 4F7ZA 3L2UA 4I2OA 4CZZA 2JZYA 2DJIA 2HQNA 3HM5A 4UVCA 3SFZA 4CCJA 4YIRX 1U8RA 1JGSA 2K86A 2X48A 5CVVA 2CQ7A 4AIHA 2XDVA 2VJJA 2XGXA 3TO6A 1PUEE 3DKYA 4DYRA 4I76A 1OISA 5D5UB 4E7ZA 1G3WA 5FO5A 2RQQA 3JAMZ 1B6AA 1MNEA 2OQGA 3OS2A 1FBUA 2E2HJ 3NWSA 3QODA 1XGSA 2TDXA 3FM5A 1G3TA 1FMWA 3QPSA 3AAFA 1VQOI 2RNJA 3HHHA 5CQEA 2DMNA 4GCVA 1QO0D 4MTDA 2IA0A 3JRCA 4Q48A 5HS8A 2CG4A 4BU2A 4G8XA 4BH9A 1Y8RB 2VQCA 4ZYHA 2R3SA 3G2BA 3F21A 1I27A 4M6YA 2BOLA 2ZC2A 1S8NA 4GRIA 4U7BA 1TWHJ 2HOAA 3RIRA 2KIUA 3FZVA 4XOPA 4CCNA 3E5XA 4EJVA 3M9AA 3KEQA 2Y0MA 2M0MA 1G6NA 3S93A 3PFIA 4BQOA 2FX0A 3FISA 1W7PD 4PJMA 4RAYA 2CGPA 4UHTA 2LD5A 2X4HA 2GOXB 4E7JA 4LGWA 1G4DA 4BBSJ 4BE2A 3C2HA 1IRGA 4OAYA 5JHUA 2IS2A 3O2PE 1Y39A 3JRGA 1K79A 3DXJF 5EJCA 2O3FA 4B4CA 3GFIA 3E6MA 3K70D 3CCJI 5EEHA 1I1GA 1H8AC 4A6DA 3AG3H 4ON0A 3JRHA 1S9HA 3LL7A 1VZ0A 3U9GA 1U9OA 2LOOA 4A5MA 2STWA 3WTVC 4Q4ZF 3HPHA 4PCQA 3RKQA 2EJRA 3J81Z 2Y48A 3E1SA 5F04A 1R5HA 1W36D 1IRZA 2KQRA 3J81K 4N9HA 2IVMA 1Z67A 2XAGA 3OYMA 1FNNA 2M9HA 4HDUA 3IRQA 2W84A 1O7LA 2XGCA 4E7SA 2LH9A 3RYPA 2O7OA 1ZRCA 2H1LA 3F22A 3B73A 5HDKA 1R36A 1LEBA 3LSPA 4F3QA 3O8GA 3KYLA 1K78B 3OYEA 2LBFA 1X3WB 2HWVA 2RQPA 2VOPA 1QQIA 4OINF 2VE8A 3R4KA 1MMNA 1VNDA 4N4NB 5JFRA 5F6FA 4S05A 2VOOA 2EPFA 1A6QA 6PAXA 1UMQA 2H8RA 2A07F 3NWTA 1T38A 2OUMA 3HC7A 4NQWB 4I7HA 2HXOA 5L3CA 4Y3OA 1WJEA 3S1RJ 1WH7A 4IOCF 4LG0B 3E5UA 3BJ6A 1OMIA 2DDAA 3O8HA 4LB5A 1YJWI 3HUGB 2XAFA 1ETKA 3BR3A 1J7KA 3ZQFA 4OMYA 3LA3A 3CUQA 2L01A 2HOTA 3GYHX 1S7EA 4A3FJ 3GX4X 1YW9A 1CGPA 3GZ6A 2BYVE 3GTQJ 3ROUA 2CW0F 2DA5A 3ZPLA 4GO1A 2MG4A 1KU3A 3EQLF 2Q0OA 4D1QA 1REPC 4JOMA 1QZZA 2LKSA 1ETYA 1XGNA 4RB1A 3WU1B 2AS5F 2LRDA 1VI0A 2BHYA 5DD8A 4OIPF 3CJTB 3BDDA 1W0TA 2G7HA 5C3EJ 2RV8A 1ZARA 3R0AA 1U0JA 3ZMUA 1HCRA 1D1AA 3DEUA 3K70C 1ZK8A 5IP7J 3ZMDA 1ETOA 4HEA2 3F8FA 3CP8A 3LA7A 1DPRA 1D1CA 1TP4A 3FMRA 1IN7A 1HXDA 2R7TA 3ZMSA 3K4LA 3SEQA 4HSTA 3AG1H 3FXOA 2V26A 2VBZA 4DNCA 2K4BA 4LJZF 4KYWA 1BC7C 2FU4A 4H0EA 1L0OC 3N05A 1YE9A 5EG0B 4MQ9F 3DKXA 4M3EA 4OAZA 1MMDA 5J3LA 5B1AH 1ETXA 1V3FA 2ECCA 1LFBA 2QKMB 2RVCA 2STTA 3S1NJ 4AVZA 3BTIA 3WE3A 2CU7A 2Q2EB 1Z3YA 1XB4A 4YFKF 1LDKB 5EZHA 2W1OA 2OZ6A 5GTHC 4RGSA 2EFOA 4Q47A 1C0WA 3MVPA 4A3LJ 2XVCA 2BVLA 4IKFA 1X1PA 3PQKA 3I56I 1LFPA 1YRNB 3ABUA 2IRFG 3RTRA 3WTUC 2HYGD 2GXGA 2LF7A 2HDWA 2LP0A 1O4XA 4M3FA 1HA8A 5A2QK 1K6OA 1KGSA 1MNDA 2ZMEC 4CCKA 4IF4A 5KHDA 3MFKA 1DQUA 2Y31A 3ZQ7A 2GM4A 4QTRA 4YEJA 4HDVA 2VC1A 1BIAA 2ESNA 2IEKA 4CGZA 3ERMA 2KDZA 2ZKZA 3HYIA 2CS3A 5D5WB 1TZLA 3IKVA 5LFAA 3CLQA 4XKBA 3BWGA 3ZR8X 3A01A 4A6EA 4I6ZA 3GMEA 3MWMA 3TOBA 2Z9OA 2LKPA 2NOGA 4HX7A 5M5YJ 2HS5A 4J19A 2V9KA 2ZJRF 2W82A 4XSXF 1Y1WJ 1U78A 3SJMA 2VXZA 4OIOF 4KICA 4XSZF 3FMQA 3ISPA 3DV8A 4V2FA 3SZPA 1LB2A 2WV0A 1W5SA 3MMYB 4CH7A 1UAAA 3Q0UA 1FLIA 2X6WA 2EK5A 4G7HF 1TT5B 1YFHA 4BEHA 2XAHA 1GLNA 2ZCWA 1KYWA 2Z2SB 2ESHA 3I4MJ 4MHGA 2E1OA 1N77A 4LG0A 5E8IA 2VE9A 1SFXA 1ERDA 5D4RA 2ISYA 5K5OA 1HBXG 2QLZA 3QPTA 3GZ5A 5BQTA 1X4OA 5EGOA 1VQNI 1DUXC 5FKKA 1MDMA 4EGYA 2E36A 3F0CA 3G1LA 3FHNA 5GPCA 5J1RA 3LFUA 1BI1A 4NUBA 5FFXA 1KYZA 1IV8A 3WG9A 4BKXA 1JUPA 3WE2A 3OWTA 2KJBA 4PZJA 3K1NA 4MEXF 2HFHA 1EH6A 4HX8A 3C2BA 4N0BA 1QU3A 3BG6A 3ASOH 1W7PB 2M1BA 4FISA 4IL6C 1G2HA 1GXPA 2R7RA 2EIJH 2FUG2 3QPLA 3OYGA 1IG7A 1VQ8I 2MD0A 5FRNA 1I1SA 3DCFA 3CLOA 2JN6A 3MKLA 4AIKA 2R7XA 3L09A 2R93J 2CWEA 5LHHA 4BJ6C 2O8KA 4B8XA 1SC7A 1EH7A 2OF7A 3J7YJ 3PIOF 2HTJA 3HXLA 4PJLA 2FRHA 3A4CA 2JPCA 4A3MJ 2DK8A 3D5LA 5F1RA 2DMUA 2X9DA 4OIRF 2M3AA 2X1EA 3B02A 1LKXA 3MZYA 5BMZA 3LSKA 4MO7A 4U0WA 2QA4I 2F48A 3AG2H 4PUSA 4PDKA 4EQQA 1EF4A 3CMMA 3REOA 2QYOA 1RPWA 3M4OJ 2LR8A 3ZOBA 5GAEJ 5GAHJ 2ZXIA 3QPHA 1P9QC 1P6RA 3FMSA 4ENJA 1JGGA 2JSCA 4ZDPA 1J09A 1R49A 1BJZA 1FT9A 3D5SC 1J75A 4C2MJ 4IHWA 1MBJA 3HJEA 3LAPA 3TQNA 1LQ1A 2BY2A 1B72B 3TOAA 4D9JA 2VN2A 1X2NA 4G9YA 3QYEA 4FE4A 3DFGA 3BZKA 4CYCB 2ELJA 2VL8A 2HKXA 2VI6A 3VDXA 3H3UA 2EV0A 1ON1A 3U2RA 1IF1A 1R1VA 1HW1A 3LSTA 5IP9J 1BL0A 1O7FA 1Z3XA 5D8KB 3A03A 2XIGA 2FBHA 1WQ2A 1A31A 3GTPJ 1DP3A 5BPDA 2HQRA 1R9TJ 2JTVA 2F2EA 4F93B 3M8JA 5GP9A 4X0GA 1VQ9I 1YS6A 2CYYA 1XSDA 1S3JA 3JSPA 3DPTA 3MEXA 4AM3A 1ORKA 5BS6A 4ESBA 2PX9A 1LEAA 2VKVA 5JLWA 2K3PA 1P92A 2A61A 2ADUA 1P4WA 2JVGA 4M9ZA 2PJRA 1Z1DA 4JX4A 4BAYA 1K7AA 4RGRA 4LFUA 3WHBA 5KAFC 4HPQA 5DCFA 4NQWA 2DW4A 2LY2A 1ACIA 1HW2A 3BTLA 2CV0A 1JKQC 3H0DA 2IA2A 4FETA 3UR3C 3CUQC 2AQEA 4ZDOA 1LE8B 2MLKA 3PM1A 4CO8A 4RAZA 4MEYF 3OYHA 4UUTA 3ZRGA 3K1PA 2M8EA 2BXYA 1UHSA 3K10A 3K4MA 3K69A 1KONA 3NRVA 1VQ4I 5F08A 4XKCA 5EDNA 1QVUA 2GA2A 1Z05A 3UNGC 4B44A 2OZUA 3CUQB 2M2EA 1E3HA 5KNLA 3KFWX 4EM1A 2M34A 2V4JC 1WKMA 3DQVC 1R5GA 2HZTA 3K4CA 3CZ6A 3CCVI 5JR3A 3ZMTA 3M07A 3DLAA 2X1DA 1RIOH 1YYVA 2ID3A 2IGMA 1FSHA 2D45A 1R71A 2MABA 2LTPA 1BI2A 2BY0A 3FXQA 4CXFA 4DOZA 3MKWB 1DDNA 2FE3A 5KK1A 2DFIA 4ZTFA 4UUVA 2NVYJ 2XRNA 4MLOA 4BJ5C 3S1MJ 5F0FA 2IGNA 2D5VA 2HVSA 5LHIA 2YX7A 2XV4S 5DCMA 3X2QH 1K6YA 4RMNA 1B9NA 1R4MB 3NEUA 3WGGA 1Y56A 3EUHA 2Q8KA 2RKHA 1EKEA 1SANA 4BE0A 3S3OA 5J1UA 1IN8A 1Z21A 3IH3A 2C6YA 2P6TA 1FYLA 2HEOA 2VJIA 3SZTA 3ZCOA 5E8GA 1R5ID 2EA2A 2JK3A 4KN4X 3KEYA 3OS0A 2ZJPF 3OSFA 4KISA 4E4HA 1RNLA 3Q5FA 1O3QA 4ESFA 2HTSA 2XPWA 5FD6A 1X4PA 2XSJC 4A3EJ 3IH4A 4G6DA 2RREA 3LSRA 1JKRC 1DU0A 5ILUA 2FJ1A 3K4KA 3CDLA 5EF6A 2Q2EA 5K7ZA 4BNCA 2P7CB 5A2QZ 3HSEA 3ASNH 5LBQA 2X85A 2LY1A 4RM3A 1W36C 1FBSA 4HX4A 1YG2A 3DEEA 1I39A 5FRMA 1WJAA 1U5TB 4RB2C 3ZGKA 4P1WA 2IS1A 2K85A 2COMA 4R8HA 3GTLJ 2Z1DA 1FYMA 3RPQA 2F5DA 3LOCA 2BY3A 2L9NA 3P9CA 3LSHA 1S7AA 3C7JA 4XLFA 2IJLA 3P7NA 4XORA 4IHTA 2P7VB 2VJ5A 2L9RA 4ENMA 3RKWA 3BQYA 4MGRA 3TKYA 3W3CA 3CESA 1J9IA 3R60A 3MCZA 4LLGF 4XRSA 1JJ8C 5CPRB 3PNYA 5AIQA 4BUPA 4FX4A 5C4JJ 1W4MA 1Y8QB 4XLCA 4EV0A 3PJRA 2YS9A 1M1EB 3GLLA 4UUSA 1KU7A 3ML6A 2QZ8A 2L3DA 2IW5A 3IWZA 3BOQA 2PN6A 3G3ZA 2V6EA 1ZH5A 3DP7A 3GTOJ 1TLHB 3L2CA 5F1JA 2ZMEA 3HG9A 2CMPA 4AYBN 2DMTA 5ICCA 3VB2A 3H5AA 1AHDP 4Y4RA 2QQAA 2CV2A 2O9LA 1XMAA 5KCMA 1ZG3A 3CJQB 3J7ZI 1NHAA 2R5ZA 3OL4A 3HGGA 1ZN2A 3BZCA 1NTCA 2MA3A 1LVAA 2UXNA 3CDIA 3W2WA 4D7MA 4Y17A 2IT0A 3QU3A 4RS8A 5CVRA 4ZYDA 1GHCA 2COBA 3P5JA 2EIMH 3VOEA 1UELB 4I0AA 1MDMB 3IWFA 2FMLA 5KAIC 5H6RA 2L9SA 3DWLE 4YFNF 1NK2P 2BHZA 2WC2A 3CTAA 4HZFA 2ZXWH 2EZHA 3LSJA 2VPRA 3EYIA 3V8KA 1FY7A 2OJED 4FTHA 2OTLI 1J0RA 1W7PA 3DBHB 1SD7A 2V7FA 4GGGA 1X19A 1XC5A 3H9QA 2Y2ZA 5K5QA 3U1KA 4KFCA 4I0BA 4NC6A 1X1CA 1PDNC 4BBRJ 2UV1A 2WAQN 3I55I 1U9NA 2HVRA 1FOKA 4BHBA 2XSDC 3PO2J 3BR2A 2JSPA 3R61A 1YIOA 2ICWG 3RDIA 3JRIA 5DTDA 2V1UA 4IHVA 2YU3A 3I4PA 3LSIA 4MTEA 3T8RA 1IRXA 3AL0B 1MIJA 2JPBA 1S72I 2DCEA 3EUAA 4M71A 2CW7A 3H5RA 3GZNB 2ZBKA 5DCMB 3TO7A 1K78A 3ZQGA 1QNTA 3BCBA 1Y1VJ 4NNJA 2PG4A 1HSTA 1D8JA 1R00A 4IHSA 1J5YA 2DJNA 3E6BA 2KIMA 1XD7A 2L9VA 1FJLA 5E1ZB 4CUGA
chains in the Genus database with same CATH topology
1P4XA 2DPUA 3GFLA 4ZYGA 1T98A 2XROA 5BOXA 1D5VA 3K1MA 2EWNA 4CICA 2R7DA 1PP8F 2A68F 2ACJA 1B9MA 5D4SA 4KIBA 1BI3A 5HDNA 3ERED 2H94A 4EM0B 3C1DA 3FXUA 1G3SA 3JTHA 5HLIA 2FBKA 5FB2A 1LJ9A 2P5KA 2FQ3A 4QWQA 3QOPA 4EJTA 3C18A 4L9JA 2FSWA 1WI9A 5J6XA 4EJOA 1Z7UA 3BPXA 3M8FA 2HGCA 2QUFA 1J2XA 5J8FA 5LRSA 1T0FA 4HF1A 4O5VA 3HOTA 3V8LA 1TW2A 1XSVA 4IPAA 2EV5A 1HSJA 3OOPA 4O3MA 2QENA 4L5IA 3GW2A 3HRMA 4FHTA 3ECOA 3RPUA 2K4JA 3ABTA 1BIBA 4Y15A 1QGPA 1UHMA 4KUMA 4EVIA 4IRHA 4OU0A 5HLHA 4S04A 3M1EA 3K9TA 4IJAA 1O3TA 5E1XA 3IHUA 3KP3A 4HQMA 1PP7U 5ILVA 5L3GA 3RKXA 3W6JB 3IRRA 3O6BB 3F8NA 4A12A 4G94A 5L3FA 2QM3A 3H92A 3KP6A 2RDPA 1W5TA 5JVTA 1ZGAA 2ZJ2A 2HDCA 1RUOA 2NRAC 3DF8A 2DQRA 5DDGA 2UZKA 1SD4A 1TW3A 1KU9A 3I59A 4L0YB 1FYKA 2Z99A 1CF7A 3RI4A 1AWCA 2WTEA 1F1ZA 4YFXF 4K2EA 4GYGA 1R23A 2P5VA 1MKMA 5DUIA 5J8CA 5ILSA 5TRDA 2Y75A 2QBYA 1BJAA 2O6GE 3K2ZA 4OOIA 1ZRFA 1B59A 2UWMA 2EFQA 1JE8A 1BI0A 4ZZLA 4MNUA 2GZWA 2R7FA 4HLXA 1IXCA 3FM3A 4L9NA 5K5RA 4A2UA 5KVRA 2H27A 4EMSA 2HOEA 1TQPA 3ULQB 2RC4A 2MBFA 4HQEA 5DYMA 3KLNA 3DPLC 4LLNA 4GYIA 4I98B 1T39A 3HRTA 4L0ZB 3VEPA 3CDHA 3TGNA 2PQ8A 3WU0A 4IVNA 2CO5A 2BV6A 4WCGA 2HYFA 5D6EA 1FWZA 1H9GA 4LK1F 1UFMA 4UNOA 4HYEA 1BBYA 1IUYA 3TO9A 1OYYA 2ZO4A 5EEGA 2LNBA 3GFMA 2W57A 3LFKA 2FOKA 3WTYC 1FZPB 1YLFA 1SAXA 4R79A 1IXRC 1TBXA 1MJ9A 1L3LA 4KMUX 1OYIA 2CSOA 1T6SA 4N9IA 2V1DA 2L02A 3F72A 4HAMA 1RZ4A 2ELHA 1KQ8A 4U7DA 2DT5A 5AIPA 3JW4A 1F5TA 1SFUA 1S29A 1MJAA 4CDGA 1LDDA 5LEJA 2OA4A 5ICGA 2FBIA 1ODDA 3LWFA 1HKTA 1P2FA 1FX7A 3P9KA 1ZAOA 1USSA 5FLXZ 1XDSA 1YQAA 1CF7B 2E1CA 4I09A 5FLXK 2KKOA 3F8BA 1JXSA 2CQKA 2Z5UA 4UV9A 3BPVA 2EV6A 5L3EA 4O6JA 2E7XA 4FX0A 1FP2A 5CLSA 2QBYB 1LDJA 3LQRA 3VODA 4UXNA 3KETA 2P5LC 3T5XA 2VBYA 5LGNA 5HOOA 1U5TC 4U88A 1XDUA 3JAMK 2D2WA 3GLXA 1IAWA 2FA5A 5DEQA 1Q1HA 1ULYA 2XAQA 4MQVA 2G9WA 4Z2YA 3WODF 3T0YA 2RGVA 4P5OA 4M9SA 2M5WA 2DBBA 4A0ZA 1OKRA 1U6GA 1GXQA 1E17A 3R0JA 2D1HA 2ZXJA 1J59A 3F3XA 1SMYF 4ESJA 3QU6A 4KT5C 4P96A 1YS7A 3WGHA 2LSOA 1XGOA 3MZHA 4L9VA 4I02A 1WSUA 1STZA 3J80Z 1Z6TA 2V9VA 2J5PA 2O61A 2DAOA 1MJBA 2Z33A 4KNYA 3BJAA 4BHCA 4HLYA 3BJOA 5ICFA 4RB3C 2OAZA 4L18B 5FGMA 1ONVA 3M7GA 4AD9A 3VFZA 2FXAA 2YSRA 3WTXC 3WTZA 2BBYA 3ECHA 4EJWA 1LNWA 1ZRDA 3HRUA 4R1HA 2H6BA 4KA4A 1Z91A 3EYYA 2YR2A 2K7LA 3HRSA 4Q5SF 5CJ9A 3GF2A 3HOSA 3P9IA 4PGHA 5HLGA 3SHFA 2K27A 4P9UA 3W6KB 1BC8C 4KIGA 1KA8A 1F9NA 3RKYA 2RN7A 5H20A 4CHUA 2WWYA 3IC7A 5DD4A 3E6DA 3FHZA 4AIJA 1G3YA 1AOYA 3QAHA 1I5ZA 1I6XA 3E97A 4HV6A 5K1YA 4JK1X 3M8EA 3JTGA 3BZ6A 3HHGA 5E20A 1X3UA 1SMTA 2BGCA 3BY6A 2V79A 3TDZC 2MD5A 4BQAA 1JHHA 1SD6A 3HIFA 1H0MA 3GFJA 2KRFA 3ZP5A 1USTA 1T2KA 3R6SA 1BM9A 2IA1A 2L54A 4D0PA 2YX4A 5ERIA 3ZN1A 2VONA 1FSEA 4WF2A 2VODA 2DU9A 2P8TA 1KQ9A 4UVBA 3PQJA 2OQRA 3SXYA 2LDUA 1TTYA 3FX3A 1ZGJA 5AONA 2ISZA 3V4GA 2J5OA 1B1BA 2A5YB 1EV7A 3HTSB 3L7WA 1WRJA 2XHKA 2H09A 2VBXA 3E5QA 5F64A 2BEOA 2OU2A 2A3SA 3OV8A 3WTTC 1TQIA 4NB5A 5CVIA 5BPIA 4P9FA 5HS9A 1IN6A 2MC3A 3V8JA 1U3EM 1IW7F 4G7ZF 5FFZA 2A6HF 1OR7A 4JBAA 2JT1A 2DI3A 1D8KA 2F5FA 3I64A 1KQ0A 2AXLA 3GUDA 3C3WA 1VTNC 1DP7P 4M74A 5D8LB 5LLQA 5D6FA 3FXRA 1TQMA 2NNYA 2GXBA 5LGTA 5E18F 4WK8F 1ZLJA 3LAJA 3KCCA 2GIVA 3LA2A 3HSRA 5LRRA 4WXHA 4LB6B 3RJPA 2LF8A 4EGZA 2XKPA 1U2WA 1Z9CA 4G6QA 1YO5C 1ZG5A 2P6SA 4M72A 4ZH4F 3N4MA 4ENNA 5L3BA 5TJJA 5L3DA 4AWXB 1GVJA 4Y13A 3ELKA 4HA8A 3I5UA 1HKSA 3J80K 4G7OF 3FWEA 1U5TA 2IP2A 1MZBA 2D1VA 3D0SA 3KP2A 1O3RA 5JI6A 1HKQA 2EFPA 1IN5A 3F23A 3IL2A 3H3ZA 2Z3YA 2W24A 5CYVA 1R1TA 2EFNA 1XN7A 3KE2A 2FNAA 4WWCA 3QRFF 1XCBA 5LHGA 1Z6RA 4YIFA 4LMYA 4WXCA 2OBPA 1FPQA 5D5VB 3KP5A 1B4AA 3G73A 4KMFA 2XAJA 3BROA 2ZMEB 2NNNA 1Y0UA 1E2XA 3T8TA 2M87A 3HTUA 1KU2A 2FNPA 4NHJA 3WTWC 3EETA 5CVJA 4EM2A 3HUGA 3TDUC 2CFXA 1EH8A 2KJCA 2XASA 2KIFA 1IRFA 2V6CA 1XSXA 5DUKA 4XLPF 4LD5A 2O03A 4CYDA 4WXDA 2GWRA 2NYXA 5HS7A 4KIFA 4OIQF 2BE5F 4ZYEA 2F5EA 3SQNA 2PBIA 3QP6A 3RYRA 3CJNA 3GWZA 4XBFA 4AVPA 4RB0A 2EFWA 1O57A 2W85A 4XRFA 2L4AA 1IXSB 2MH2A 3I71A 4L5JA 1ZLKA 1MD0A 3U1DA 2DK5A 3BP8A 1SD5A 4IXAA 4U0VA 3ZN0A 1WWXA 1RI7A 2XUBA 3E3VA 2B0LA 3V7RA 4BHPA 2FMYA 3T1BA 5LGUA 1R22A 3KP4A 5DV5A 4XLNF 4B09A 4EJUA 4E70A 2VT3A 4GXOA 3I53A 2F5CA 4YIIA 2YPRA 2NAZA 2DO7A 2K02A 2ETHA 4UVAA 2E1NA 1OYWA 3KLOA 3K0LA 3LQQA 4IRGA 1S6LA 2IPQX 2V1XA 4A0XA 5D5XB 1S7OA 2JRTA 1V4RA 2UXXA 5CVUA 2FF4A 2PFBA 1FP1D 5ED4A 2EA4A 1FC3A 2H6CA 1O3SA 1D3YA 3L9FA 5E1WA 1BN5A 1YTYA 3KP7A 3IKTA 1A04A 1TNSA 2QQ9A 3F6VA 2DQLA 2GA1A 4M9XA 3L00A 2DPDA 2XKOA 4PGGA 2VT2A 2PJPA 2ZNYA 2OD5A 3FF5A 4IRIA 1YW7A 2A69F 2NS0A 4BYYA 4HF2A 4P55A 4WX9A 2PMHA 2HR3A 3S2WA 2PI0A 2L4MA 2QWWA 3GVAA 3GO5A 1QZYA 2O0YA 3F6OA 1IZ1A 5E17F 5IT9Z 4ASNA 4ETSA 1H9TA 4RGUA 3JSOA 2GAUA 3CO7C 1UB9A 1ZHFA 2P4WA 4I01A 2FEZA 5H6QA 3F8CA 2VBWA 3HSFA 3MQ0A 3Q9VA 3DKWA 2QQBA 1QBJA 4M6XA 1DPUA 3CUOA 3I54A 5HVQC 1ZYRF 4HF0A 4LK0F 4HBLA 3I0TA 3N97A 4UV8A 3I59B 1MGTA 1JHFA 2W25A 3KEOA 4OMZA 5LEKA 5FD5A 3COAC 3ZMVA 4DQ2A 3Q9SA 2MLGA 1OPCA 5HDGA 3E6CC 4HV5A 2PLYA 1ZG1A 4A5NA 3O3KA 2PEXA 1FBQA 2VC0A 2O8XA 4ENKA 2HKOA 1UCRA 1UHWA 1QPMA 2M30A 4KDPA 2DTRA 2A6EF 3EDPA 3GEZA 4M73A 1HQCA 3ZMZA 4HW0A 5ICEA 2M45A 1P4AA 2EB7A 1F4KA 4FT8A 3NQOA 4JQFA 3WTSC 4YG2F 2G7UA 4LLLA 2PMUA 1XGMA 2X0LA 4HOBA 3CO6C 3GXOA 3V7CA 2ZNZA 5IT3A 2GQQA 2MH9A 1YW8A 4TV7A 1IN4A 4A0YA 1RUNA 2ZFWA 1R58A 2E7WA 2DLLA 2QVOA 1XMKA 3WGIA 1R7JA 1R1UA 3MAJA 3J7AO 4ZZDA 1SFEA 3V7SA 4L9TA 4RGXA 4BXUA 3I58A 3QP5A 1BOAA 1ZREA 3KZYA 1ON2A 4U0YA 1TNTA 4QLCU 5IT9K 3F8MA 3KZZA 1HW5A 4KN7X 1XCVA 4F7ZA 4I2OA 4CZZA 2JZYA 4UVCA 2HQNA 3SFZA 1U8RA 1JGSA 2K86A 5CVVA 4AIHA 3TO6A 2XGXA 1PUEE 5D5UB 1G3WA 5FO5A 3JAMZ 1B6AA 2OQGA 1FBUA 1XGSA 2TDXA 3FM5A 1G3TA 3AAFA 2RNJA 3HHHA 4GCVA 1QO0D 4MTDA 2IA0A 4Q48A 5HS8A 2CG4A 4G8XA 4BH9A 4ZYHA 2R3SA 3F21A 1I27A 4M6YA 1S8NA 4U7BA 3RIRA 2KIUA 3FZVA 3E5XA 4EJVA 3M9AA 3KEQA 2Y0MA 1G6NA 3PFIA 1W7PD 4RAYA 2CGPA 4UHTA 2X4HA 4LGWA 1G4DA 1IRGA 5JHUA 3O2PE 1K79A 3DXJF 2O3FA 3GFIA 3E6MA 5EEHA 1I1GA 4A6DA 4ON0A 3U9GA 4A5MA 2STWA 3WTVC 4Q4ZF 4PCQA 2EJRA 3J81Z 2Y48A 1R5HA 3J81K 4N9HA 2IVMA 2XAGA 4HDUA 1FNNA 3IRQA 2W84A 1O7LA 1ZRCA 3RYPA 3F22A 3B73A 5HDKA 1R36A 1LEBA 1K78B 2HWVA 2RQPA 2VOPA 1QQIA 4OINF 2VE8A 3R4KA 5JFRA 5F6FA 4S05A 2VOOA 6PAXA 2A07F 1T38A 4I7HA 5L3CA 4LG0B 3E5UA 3BJ6A 1OMIA 4LB5A 2XAFA 1J7KA 4OMYA 3LA3A 3CUQA 2L01A 3GYHX 3GX4X 1YW9A 1CGPA 3GZ6A 2BYVE 3ROUA 2CW0F 3ZPLA 4GO1A 1KU3A 3EQLF 2Q0OA 1REPC 4RB1A 3WU1B 1QZZA 1XGNA 2AS5F 5DD8A 4OIPF 3BDDA 2G7HA 2RV8A 1ZARA 3R0AA 3ZMUA 3DEUA 3ZMDA 3F8FA 3LA7A 1DPRA 1IN7A 3FMRA 1HXDA 3ZMSA 2VBZA 4DNCA 2K4BA 4LJZF 4KYWA 1BC7C 2FU4A 4H0EA 1L0OC 4MQ9F 1V3FA 2RVCA 2STTA 3WE3A 4YFKF 1XB4A 1LDKB 2OZ6A 4RGSA 2EFOA 4Q47A 1C0WA 2XVCA 3PQKA 3ABUA 2IRFG 3RTRA 3WTUC 2HYGD 2GXGA 2LF7A 5A2QK 1K6OA 1KGSA 2ZMEC 4IF4A 3MFKA 3ZQ7A 4HDVA 2VC1A 1BIAA 2ESNA 4CGZA 2ZKZA 3HYIA 5D5WB 3IKVA 3BWGA 4A6EA 3MWMA 3TOBA 2Z9OA 2LKPA 4HX7A 2HS5A 4XSXF 1U78A 2VXZA 4OIOF 4KICA 4XSZF 3FMQA 3ISPA 3DV8A 3SZPA 1LB2A 2WV0A 1W5SA 1FLIA 2EK5A 4G7HF 1YFHA 2XAHA 2ZCWA 1KYWA 2ESHA 4MHGA 4LG0A 5E8IA 2VE9A 1SFXA 5D4RA 2ISYA 5K5OA 1HBXG 2QLZA 3QPTA 3GZ5A 5BQTA 1DUXC 1MDMA 4EGYA 1BI1A 5FFXA 1KYZA 3WG9A 3WE2A 2KJBA 4PZJA 3K1NA 4MEXF 2HFHA 1EH6A 4HX8A 4N0BA 1W7PB 2M1BA 1GXPA 1I1SA 3CLOA 4AIKA 3L09A 2CWEA 5LHHA 4B8XA 1EH7A 2HTJA 2FRHA 2JPCA 2DK8A 3D5LA 5F1RA 4OIRF 3B02A 3MZYA 5BMZA 4U0WA 4PDKA 4EQQA 3REOA 2QYOA 3QPHA 1P6RA 3FMSA 4ENJA 2JSCA 1FT9A 1J75A 3LAPA 3TQNA 1LQ1A 3TOAA 2VN2A 4G9YA 3DFGA 2HKXA 2EV0A 1ON1A 3H3UA 3U2RA 1IF1A 1R1VA 1HW1A 3LSTA 1O7FA 5D8KB 2XIGA 2FBHA 1WQ2A 5BPDA 2HQRA 2JTVA 2F2EA 1YS6A 2CYYA 1XSDA 1S3JA 3JSPA 3DPTA 3MEXA 5BS6A 4ESBA 1LEAA 1P92A 2A61A 2ADUA 1P4WA 4M9ZA 1Z1DA 4BAYA 1K7AA 4RGRA 4LFUA 5DCFA 4NQWA 2DW4A 1HW2A 2IA2A 3CUQC 2MLKA 4CO8A 4RAZA 4MEYF 3K1PA 2M8EA 3NRVA 3K69A 2GA2A 1Z05A 2OZUA 3CUQB 3KFWX 4EM1A 1WKMA 3DQVC 1R5GA 2HZTA 5JR3A 3ZMTA 1RIOH 1YYVA 1FSHA 2D45A 1BI2A 3FXQA 4CXFA 1DDNA 2FE3A 5KK1A 2DFIA 4UUVA 2XRNA 5LHIA 2YX7A 2XV4S 5DCMA 1B9NA 3NEUA 3WGGA 3EUHA 2Q8KA 2RKHA 1IN8A 2C6YA 2P6TA 1FYLA 2HEOA 3SZTA 5E8GA 2EA2A 4KN4X 1RNLA 3Q5FA 1O3QA 4ESFA 2HTSA 5FD6A 4G6DA 5ILUA 2Q2EA 4BNCA 2P7CB 5A2QZ 3HSEA 5LBQA 1FBSA 4HX4A 1YG2A 1U5TB 4RB2C 2COMA 4R8HA 1FYMA 3RPQA 2F5DA 3P9CA 1S7AA 3C7JA 2IJLA 3P7NA 4IHTA 2P7VB 4ENMA 3RKWA 4MGRA 3TKYA 1J9IA 3R60A 3MCZA 4LLGF 5AIQA 4FX4A 1W4MA 4EV0A 1KU7A 3ML6A 2QZ8A 2L3DA 2IW5A 3IWZA 3BOQA 2PN6A 3G3ZA 1ZH5A 3DP7A 1TLHB 3L2CA 2ZMEA 5ICCA 3VB2A 2QQAA 1XMAA 1ZG3A 1NHAA 1ZN2A 2MA3A 1LVAA 2UXNA 4Y17A 2IT0A 5CVRA 3QU3A 4RS8A 4ZYDA 1GHCA 3VOEA 4I0AA 1MDMB 3IWFA 2FMLA 5H6RA 4YFNF 2WC2A 3CTAA 4HZFA 3EYIA 3V8KA 1FY7A 1J0RA 1W7PA 1SD7A 4GGGA 5K5QA 4KFCA 4I0BA 1PDNC 1FOKA 4BHBA 3R61A 2V1UA 1YIOA 3RDIA 2YU3A 3I4PA 4MTEA 3T8RA 2JPBA 1K78A 4M71A 5DCMB 3TO7A 2ZBKA 1QNTA 2PG4A 1HSTA 1D8JA 1R00A 4IHSA 1J5YA 3E6BA 2KIMA 1XD7A 5E1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4X A;  2DPU A;  3GFL A;  4ZYG A;  1T98 A;  2XRO A;  5BOX A;  1D5V A;  3K1M A;  2EWN A;  4CIC A;  2R7D A;  1PP8 F;  2A68 F;  2ACJ A;  1B9M A;  5D4S A;  4KIB A;  1BI3 A;  5HDN A;  3ERE D;  2H94 A;  4EM0 B;  3C1D A;  3FXU A;  1G3S A;  3JTH A;  5HLI A;  2FBK A;  5FB2 A;  1LJ9 A;  2P5K A;  2FQ3 A;  4QWQ A;  3QOP A;  4EJT A;  3C18 A;  4L9J A;  2FSW A;  1WI9 A;  5J6X A;  4EJO A;  1Z7U A;  3BPX A;  3M8F A;  2HGC A;  2QUF A;  1J2X A;  5J8F A;  5LRS A;  1T0F A;  4HF1 A;  4O5V A;  3HOT A;  3V8L A;  1TW2 A;  1XSV A;  4IPA A;  2EV5 A;  1HSJ A;  3OOP A;  4O3M A;  2QEN A;  4L5I A;  3GW2 A;  3HRM A;  4FHT A;  3ECO A;  3RPU A;  2K4J A;  3ABT A;  1BIB A;  4Y15 A;  1QGP A;  1UHM A;  4KUM A;  4EVI A;  4IRH A;  4OU0 A;  5HLH A;  4S04 A;  3M1E A;  3K9T A;  4IJA A;  1O3T A;  5E1X A;  3IHU A;  3KP3 A;  4HQM A;  1PP7 U;  5ILV A;  5L3G A;  3RKX A;  3W6J B;  3IRR A;  3O6B B;  3F8N A;  4A12 A;  4G94 A;  5L3F A;  2QM3 A;  3H92 A;  3KP6 A;  2RDP A;  1W5T A;  5JVT A;  1ZGA A;  2ZJ2 A;  2HDC A;  1RUO A;  2NRA C;  3DF8 A;  2DQR A;  5DDG A;  2UZK A;  1SD4 A;  1TW3 A;  1KU9 A;  3I59 A;  4L0Y B;  1FYK A;  2Z99 A;  1CF7 A;  3RI4 A;  1AWC A;  2WTE A;  1F1Z A;  4YFX F;  4K2E A;  4GYG A;  1R23 A;  2P5V A;  1MKM A;  5DUI A;  5J8C A;  5ILS A;  5TRD A;  2Y75 A;  2QBY A;  1BJA A;  2O6G E;  3K2Z A;  4OOI A;  1ZRF A;  1B59 A;  2UWM A;  2EFQ A;  1JE8 A;  1BI0 A;  4ZZL A;  4MNU A;  2GZW A;  2R7F A;  4HLX A;  1IXC A;  3FM3 A;  4L9N A;  5K5R A;  4A2U A;  5KVR A;  2H27 A;  4EMS A;  2HOE A;  1TQP A;  3ULQ B;  2RC4 A;  2MBF A;  4HQE A;  5DYM A;  3KLN A;  3DPL C;  4LLN A;  4GYI A;  4I98 B;  1T39 A;  3HRT A;  4L0Z B;  3VEP A;  3CDH A;  3TGN A;  2PQ8 A;  3WU0 A;  4IVN A;  2CO5 A;  2BV6 A;  4WCG A;  2HYF A;  5D6E A;  1FWZ A;  1H9G A;  4LK1 F;  1UFM A;  4UNO A;  4HYE A;  1BBY A;  1IUY A;  3TO9 A;  1OYY A;  2ZO4 A;  5EEG A;  2LNB A;  3GFM A;  2W57 A;  3LFK A;  2FOK A;  3WTY C;  1FZP B;  1YLF A;  1SAX A;  4R79 A;  1IXR C;  1TBX A;  1MJ9 A;  1L3L A;  4KMU X;  1OYI A;  2CSO A;  1T6S A;  4N9I A;  2V1D A;  2L02 A;  3F72 A;  4HAM A;  1RZ4 A;  2ELH A;  1KQ8 A;  4U7D A;  2DT5 A;  5AIP A;  3JW4 A;  1F5T A;  1SFU A;  1S29 A;  1MJA A;  4CDG A;  1LDD A;  5LEJ A;  2OA4 A;  5ICG A;  2FBI A;  1ODD A;  3LWF A;  1HKT A;  1P2F A;  1FX7 A;  3P9K A;  1ZAO A;  1USS A;  5FLX Z;  1XDS A;  1YQA A;  1CF7 B;  2E1C A;  4I09 A;  5FLX K;  2KKO A;  3F8B A;  1JXS A;  2CQK A;  2Z5U A;  4UV9 A;  3BPV A;  2EV6 A;  5L3E A;  4O6J A;  2E7X A;  4FX0 A;  1FP2 A;  5CLS A;  2QBY B;  1LDJ A;  3LQR A;  3VOD A;  4UXN A;  3KET A;  2P5L C;  3T5X A;  2VBY A;  5LGN A;  5HOO A;  1U5T C;  4U88 A;  1XDU A;  3JAM K;  2D2W A;  3GLX A;  1IAW A;  2FA5 A;  5DEQ A;  1Q1H A;  1ULY A;  2XAQ A;  4MQV A;  2G9W A;  4Z2Y A;  3WOD F;  3T0Y A;  2RGV A;  4P5O A;  4M9S A;  2M5W A;  2DBB A;  4A0Z A;  1OKR A;  1U6G A;  1GXQ A;  1E17 A;  3R0J A;  2D1H A;  2ZXJ A;  1J59 A;  3F3X A;  1SMY F;  4ESJ A;  3QU6 A;  4KT5 C;  4P96 A;  1YS7 A;  3WGH A;  2LSO A;  1XGO A;  3MZH A;  4L9V A;  4I02 A;  1WSU A;  1STZ A;  3J80 Z;  1Z6T A;  2V9V A;  2J5P A;  2O61 A;  2DAO A;  1MJB A;  2Z33 A;  4KNY A;  3BJA A;  4BHC A;  4HLY A;  3BJO A;  5ICF A;  4RB3 C;  2OAZ A;  4L18 B;  5FGM A;  1ONV A;  3M7G A;  4AD9 A;  3VFZ A;  2FXA A;  2YSR A;  3WTX C;  3WTZ A;  2BBY A;  3ECH A;  4EJW A;  1LNW A;  1ZRD A;  3HRU A;  4R1H A;  2H6B A;  4KA4 A;  1Z91 A;  3EYY A;  2YR2 A;  2K7L A;  3HRS A;  4Q5S F;  5CJ9 A;  3GF2 A;  3HOS A;  3P9I A;  4PGH A;  5HLG A;  3SHF A;  2K27 A;  4P9U A;  3W6K B;  1BC8 C;  4KIG A;  1KA8 A;  1F9N A;  3RKY A;  2RN7 A;  5H20 A;  4CHU A;  2WWY A;  3IC7 A;  5DD4 A;  3E6D A;  3FHZ A;  4AIJ A;  1G3Y A;  1AOY A;  3QAH A;  1I5Z A;  1I6X A;  3E97 A;  4HV6 A;  5K1Y A;  4JK1 X;  3M8E A;  3JTG A;  3BZ6 A;  3HHG A;  5E20 A;  1X3U A;  1SMT A;  2BGC A;  3BY6 A;  2V79 A;  3TDZ C;  2MD5 A;  4BQA A;  1JHH A;  1SD6 A;  3HIF A;  1H0M A;  3GFJ A;  2KRF A;  3ZP5 A;  1UST A;  1T2K A;  3R6S A;  1BM9 A;  2IA1 A;  2L54 A;  4D0P A;  2YX4 A;  5ERI A;  3ZN1 A;  2VON A;  1FSE A;  4WF2 A;  2VOD A;  2DU9 A;  2P8T A;  1KQ9 A;  4UVB A;  3PQJ A;  2OQR A;  3SXY A;  2LDU A;  1TTY A;  3FX3 A;  1ZGJ A;  5AON A;  2ISZ A;  3V4G A;  2J5O A;  1B1B A;  2A5Y B;  1EV7 A;  3HTS B;  3L7W A;  1WRJ A;  2XHK A;  2H09 A;  2VBX A;  3E5Q A;  5F64 A;  2BEO A;  2OU2 A;  2A3S A;  3OV8 A;  3WTT C;  1TQI A;  4NB5 A;  5CVI A;  5BPI A;  4P9F A;  5HS9 A;  1IN6 A;  2MC3 A;  3V8J A;  1U3E M;  1IW7 F;  4G7Z F;  5FFZ A;  2A6H F;  1OR7 A;  4JBA A;  2JT1 A;  2DI3 A;  1D8K A;  2F5F A;  3I64 A;  1KQ0 A;  2AXL A;  3GUD A;  3C3W A;  1VTN C;  1DP7 P;  4M74 A;  5D8L B;  5LLQ A;  5D6F A;  3FXR A;  1TQM A;  2NNY A;  2GXB A;  5LGT A;  5E18 F;  4WK8 F;  1ZLJ A;  3LAJ A;  3KCC A;  2GIV A;  3LA2 A;  3HSR A;  5LRR A;  4WXH A;  4LB6 B;  3RJP A;  2LF8 A;  4EGZ A;  2XKP A;  1U2W A;  1Z9C A;  4G6Q A;  1YO5 C;  1ZG5 A;  2P6S A;  4M72 A;  4ZH4 F;  3N4M A;  4ENN A;  5L3B A;  5TJJ A;  5L3D A;  4AWX B;  1GVJ A;  4Y13 A;  3ELK A;  4HA8 A;  3I5U A;  1HKS A;  3J80 K;  4G7O F;  3FWE A;  1U5T A;  2IP2 A;  1MZB A;  2D1V A;  3D0S A;  3KP2 A;  1O3R A;  5JI6 A;  1HKQ A;  2EFP A;  1IN5 A;  3F23 A;  3IL2 A;  3H3Z A;  2Z3Y A;  2W24 A;  5CYV A;  1R1T A;  2EFN A;  1XN7 A;  3KE2 A;  2FNA A;  4WWC A;  3QRF F;  1XCB A;  5LHG A;  1Z6R A;  4YIF A;  4LMY A;  4WXC A;  2OBP A;  1FPQ A;  5D5V B;  3KP5 A;  1B4A A;  3G73 A;  4KMF A;  2XAJ A;  3BRO A;  2ZME B;  2NNN A;  1Y0U A;  1E2X A;  3T8T A;  2M87 A;  3HTU A;  1KU2 A;  2FNP A;  4NHJ A;  3WTW C;  3EET A;  5CVJ A;  4EM2 A;  3HUG A;  3TDU C;  2CFX A;  1EH8 A;  2KJC A;  2XAS A;  2KIF A;  1IRF A;  2V6C A;  1XSX A;  5DUK A;  4XLP F;  4LD5 A;  2O03 A;  4CYD A;  4WXD A;  2GWR A;  2NYX A;  5HS7 A;  4KIF A;  4OIQ F;  2BE5 F;  4ZYE A;  2F5E A;  3SQN A;  2PBI A;  3QP6 A;  3RYR A;  3CJN A;  3GWZ A;  4XBF A;  4AVP A;  4RB0 A;  2EFW A;  1O57 A;  2W85 A;  4XRF A;  2L4A A;  1IXS B;  2MH2 A;  3I71 A;  4L5J A;  1ZLK A;  1MD0 A;  3U1D A;  2DK5 A;  3BP8 A;  1SD5 A;  4IXA A;  4U0V A;  3ZN0 A;  1WWX A;  1RI7 A;  2XUB A;  3E3V A;  2B0L A;  3V7R A;  4BHP A;  2FMY A;  3T1B A;  5LGU A;  1R22 A;  3KP4 A;  5DV5 A;  4XLN F;  4B09 A;  4EJU A;  4E70 A;  2VT3 A;  4GXO A;  3I53 A;  2F5C A;  4YII A;  2YPR A;  2NAZ A;  2DO7 A;  2K02 A;  2ETH A;  4UVA A;  2E1N A;  1OYW A;  3KLO A;  3K0L A;  3LQQ A;  4IRG A;  1S6L A;  2IPQ X;  2V1X A;  4A0X A;  5D5X B;  1S7O A;  2JRT A;  1V4R A;  2UXX A;  5CVU A;  2FF4 A;  2PFB A;  1FP1 D;  5ED4 A;  2EA4 A;  1FC3 A;  2H6C A;  1O3S A;  1D3Y A;  3L9F A;  5E1W A;  1BN5 A;  1YTY A;  3KP7 A;  3IKT A;  1A04 A;  1TNS A;  2QQ9 A;  3F6V A;  2DQL A;  2GA1 A;  4M9X A;  3L00 A;  2DPD A;  2XKO A;  4PGG A;  2VT2 A;  2PJP A;  2ZNY A;  2OD5 A;  3FF5 A;  4IRI A;  1YW7 A;  2A69 F;  2NS0 A;  4BYY A;  4HF2 A;  4P55 A;  4WX9 A;  2PMH A;  2HR3 A;  3S2W A;  2PI0 A;  2L4M A;  2QWW A;  3GVA A;  3GO5 A;  1QZY A;  2O0Y A;  3F6O A;  1IZ1 A;  5E17 F;  5IT9 Z;  4ASN A;  4ETS A;  1H9T A;  4RGU A;  3JSO A;  2GAU A;  3CO7 C;  1UB9 A;  1ZHF A;  2P4W A;  4I01 A;  2FEZ A;  5H6Q A;  3F8C A;  2VBW A;  3HSF A;  3MQ0 A;  3Q9V A;  3DKW A;  2QQB A;  1QBJ A;  4M6X A;  1DPU A;  3CUO A;  3I54 A;  5HVQ C;  1ZYR F;  4HF0 A;  4LK0 F;  4HBL A;  3I0T A;  3N97 A;  4UV8 A;  3I59 B;  1MGT A;  1JHF A;  2W25 A;  3KEO A;  4OMZ A;  5LEK A;  5FD5 A;  3COA C;  3ZMV A;  4DQ2 A;  3Q9S A;  2MLG A;  1OPC A;  5HDG A;  3E6C C;  4HV5 A;  2PLY A;  1ZG1 A;  4A5N A;  3O3K A;  2PEX A;  1FBQ A;  2VC0 A;  2O8X A;  4ENK A;  2HKO A;  1UCR A;  1UHW A;  1QPM A;  2M30 A;  4KDP A;  2DTR A;  2A6E F;  3EDP A;  3GEZ A;  4M73 A;  1HQC A;  3ZMZ A;  4HW0 A;  5ICE A;  2M45 A;  1P4A A;  2EB7 A;  1F4K A;  4FT8 A;  3NQO A;  4JQF A;  3WTS C;  4YG2 F;  2G7U A;  4LLL A;  2PMU A;  1XGM A;  2X0L A;  4HOB A;  3CO6 C;  3GXO A;  3V7C A;  2ZNZ A;  5IT3 A;  2GQQ A;  2MH9 A;  1YW8 A;  4TV7 A;  1IN4 A;  4A0Y A;  1RUN A;  2ZFW A;  1R58 A;  2E7W A;  2DLL A;  2QVO A;  1XMK A;  3WGI A;  1R7J A;  1R1U A;  3MAJ A;  3J7A O;  4ZZD A;  1SFE A;  3V7S A;  4L9T A;  4RGX A;  4BXU A;  3I58 A;  3QP5 A;  1BOA A;  1ZRE A;  3KZY A;  1ON2 A;  4U0Y A;  1TNT A;  4QLC U;  5IT9 K;  3F8M A;  3KZZ A;  1HW5 A;  4KN7 X;  1XCV A;  4F7Z A;  4I2O A;  4CZZ A;  2JZY A;  4UVC A;  2HQN A;  3SFZ A;  1U8R A;  1JGS A;  2K86 A;  5CVV A;  4AIH A;  3TO6 A;  2XGX A;  1PUE E;  5D5U B;  1G3W A;  5FO5 A;  3JAM Z;  1B6A A;  2OQG A;  1FBU A;  1XGS A;  2TDX A;  3FM5 A;  1G3T A;  3AAF A;  2RNJ A;  3HHH A;  4GCV A;  1QO0 D;  4MTD A;  2IA0 A;  4Q48 A;  5HS8 A;  2CG4 A;  4G8X A;  4BH9 A;  4ZYH A;  2R3S A;  3F21 A;  1I27 A;  4M6Y A;  1S8N A;  4U7B A;  3RIR A;  2KIU A;  3FZV A;  3E5X A;  4EJV A;  3M9A A;  3KEQ A;  2Y0M A;  1G6N A;  3PFI A;  1W7P D;  4RAY A;  2CGP A;  4UHT A;  2X4H A;  4LGW A;  1G4D A;  1IRG A;  5JHU A;  3O2P E;  1K79 A;  3DXJ F;  2O3F A;  3GFI A;  3E6M A;  5EEH A;  1I1G A;  4A6D A;  4ON0 A;  3U9G A;  4A5M A;  2STW A;  3WTV C;  4Q4Z F;  4PCQ A;  2EJR A;  3J81 Z;  2Y48 A;  1R5H A;  3J81 K;  4N9H A;  2IVM A;  2XAG A;  4HDU A;  1FNN A;  3IRQ A;  2W84 A;  1O7L A;  1ZRC A;  3RYP A;  3F22 A;  3B73 A;  5HDK A;  1R36 A;  1LEB A;  1K78 B;  2HWV A;  2RQP A;  2VOP A;  1QQI A;  4OIN F;  2VE8 A;  3R4K A;  5JFR A;  5F6F A;  4S05 A;  2VOO A;  6PAX A;  2A07 F;  1T38 A;  4I7H A;  5L3C A;  4LG0 B;  3E5U A;  3BJ6 A;  1OMI A;  4LB5 A;  2XAF A;  1J7K A;  4OMY A;  3LA3 A;  3CUQ A;  2L01 A;  3GYH X;  3GX4 X;  1YW9 A;  1CGP A;  3GZ6 A;  2BYV E;  3ROU A;  2CW0 F;  3ZPL A;  4GO1 A;  1KU3 A;  3EQL F;  2Q0O A;  1REP C;  4RB1 A;  3WU1 B;  1QZZ A;  1XGN A;  2AS5 F;  5DD8 A;  4OIP F;  3BDD A;  2G7H A;  2RV8 A;  1ZAR A;  3R0A A;  3ZMU A;  3DEU A;  3ZMD A;  3F8F A;  3LA7 A;  1DPR A;  1IN7 A;  3FMR A;  1HXD A;  3ZMS A;  2VBZ A;  4DNC A;  2K4B A;  4LJZ F;  4KYW A;  1BC7 C;  2FU4 A;  4H0E A;  1L0O C;  4MQ9 F;  1V3F A;  2RVC A;  2STT A;  3WE3 A;  4YFK F;  1XB4 A;  1LDK B;  2OZ6 A;  4RGS A;  2EFO A;  4Q47 A;  1C0W A;  2XVC A;  3PQK A;  3ABU A;  2IRF G;  3RTR A;  3WTU C;  2HYG D;  2GXG A;  2LF7 A;  5A2Q K;  1K6O A;  1KGS A;  2ZME C;  4IF4 A;  3MFK A;  3ZQ7 A;  4HDV A;  2VC1 A;  1BIA A;  2ESN A;  4CGZ A;  2ZKZ A;  3HYI A;  5D5W B;  3IKV A;  3BWG A;  4A6E A;  3MWM A;  3TOB A;  2Z9O A;  2LKP A;  4HX7 A;  2HS5 A;  4XSX F;  1U78 A;  2VXZ A;  4OIO F;  4KIC A;  4XSZ F;  3FMQ A;  3ISP A;  3DV8 A;  3SZP A;  1LB2 A;  2WV0 A;  1W5S A;  1FLI A;  2EK5 A;  4G7H F;  1YFH A;  2XAH A;  2ZCW A;  1KYW A;  2ESH A;  4MHG A;  4LG0 A;  5E8I A;  2VE9 A;  1SFX A;  5D4R A;  2ISY A;  5K5O A;  1HBX G;  2QLZ A;  3QPT A;  3GZ5 A;  5BQT A;  1DUX C;  1MDM A;  4EGY A;  1BI1 A;  5FFX A;  1KYZ A;  3WG9 A;  3WE2 A;  2KJB A;  4PZJ A;  3K1N A;  4MEX F;  2HFH A;  1EH6 A;  4HX8 A;  4N0B A;  1W7P B;  2M1B A;  1GXP A;  1I1S A;  3CLO A;  4AIK A;  3L09 A;  2CWE A;  5LHH A;  4B8X A;  1EH7 A;  2HTJ A;  2FRH A;  2JPC A;  2DK8 A;  3D5L A;  5F1R A;  4OIR F;  3B02 A;  3MZY A;  5BMZ A;  4U0W A;  4PDK A;  4EQQ A;  3REO A;  2QYO A;  3QPH A;  1P6R A;  3FMS A;  4ENJ A;  2JSC A;  1FT9 A;  1J75 A;  3LAP A;  3TQN A;  1LQ1 A;  3TOA A;  2VN2 A;  4G9Y A;  3DFG A;  2HKX A;  2EV0 A;  1ON1 A;  3H3U A;  3U2R A;  1IF1 A;  1R1V A;  1HW1 A;  3LST A;  1O7F A;  5D8K B;  2XIG A;  2FBH A;  1WQ2 A;  5BPD A;  2HQR A;  2JTV A;  2F2E A;  1YS6 A;  2CYY A;  1XSD A;  1S3J A;  3JSP A;  3DPT A;  3MEX A;  5BS6 A;  4ESB A;  1LEA A;  1P92 A;  2A61 A;  2ADU A;  1P4W A;  4M9Z A;  1Z1D A;  4BAY A;  1K7A A;  4RGR A;  4LFU A;  5DCF A;  4NQW A;  2DW4 A;  1HW2 A;  2IA2 A;  3CUQ C;  2MLK A;  4CO8 A;  4RAZ A;  4MEY F;  3K1P A;  2M8E A;  3NRV A;  3K69 A;  2GA2 A;  1Z05 A;  2OZU A;  3CUQ B;  3KFW X;  4EM1 A;  1WKM A;  3DQV C;  1R5G A;  2HZT A;  5JR3 A;  3ZMT A;  1RIO H;  1YYV A;  1FSH A;  2D45 A;  1BI2 A;  3FXQ A;  4CXF A;  1DDN A;  2FE3 A;  5KK1 A;  2DFI A;  4UUV A;  2XRN A;  5LHI A;  2YX7 A;  2XV4 S;  5DCM A;  1B9N A;  3NEU A;  3WGG A;  3EUH A;  2Q8K A;  2RKH A;  1IN8 A;  2C6Y A;  2P6T A;  1FYL A;  2HEO A;  3SZT A;  5E8G A;  2EA2 A;  4KN4 X;  1RNL A;  3Q5F A;  1O3Q A;  4ESF A;  2HTS A;  5FD6 A;  4G6D A;  5ILU A;  2Q2E A;  4BNC A;  2P7C B;  5A2Q Z;  3HSE A;  5LBQ A;  1FBS A;  4HX4 A;  1YG2 A;  1U5T B;  4RB2 C;  2COM A;  4R8H A;  1FYM A;  3RPQ A;  2F5D A;  3P9C A;  1S7A A;  3C7J A;  2IJL A;  3P7N A;  4IHT A;  2P7V B;  4ENM A;  3RKW A;  4MGR A;  3TKY A;  1J9I A;  3R60 A;  3MCZ A;  4LLG F;  5AIQ A;  4FX4 A;  1W4M A;  4EV0 A;  1KU7 A;  3ML6 A;  2QZ8 A;  2L3D A;  2IW5 A;  3IWZ A;  3BOQ A;  2PN6 A;  3G3Z A;  1ZH5 A;  3DP7 A;  1TLH B;  3L2C A;  2ZME A;  5ICC A;  3VB2 A;  2QQA A;  1XMA A;  1ZG3 A;  1NHA A;  1ZN2 A;  2MA3 A;  1LVA A;  2UXN A;  4Y17 A;  2IT0 A;  5CVR A;  3QU3 A;  4RS8 A;  4ZYD A;  1GHC A;  3VOE A;  4I0A A;  1MDM B;  3IWF A;  2FML A;  5H6R A;  4YFN F;  2WC2 A;  3CTA A;  4HZF A;  3EYI A;  3V8K A;  1FY7 A;  1J0R A;  1W7P A;  1SD7 A;  4GGG A;  5K5Q A;  4KFC A;  4I0B A;  1PDN C;  1FOK A;  4BHB A;  3R61 A;  2V1U A;  1YIO A;  3RDI A;  2YU3 A;  3I4P A;  4MTE A;  3T8R A;  2JPB A;  1K78 A;  4M71 A;  5DCM B;  3TO7 A;  2ZBK A;  1QNT A;  2PG4 A;  1HST A;  1D8J A;  1R00 A;  4IHS A;  1J5Y A;  3E6B A;  2KIM A;  1XD7 A;  5E1Z B; 
#chains in the Genus database with same CATH topology
 4FAS D;  1PUF B;  3ZQH A;  1SFO J;  1P4X A;  2KIS A;  2DPU A;  4GFB A;  2E34 A;  2M7A A;  1VQM I;  3GFL A;  3QYB A;  4ZYG A;  4HNV A;  1HDD C;  3DU6 A;  2PMZ N;  4RDU A;  2Y30 A;  3TMO A;  1T98 A;  2XRO A;  5BOX A;  1D5V A;  3K1M A;  1JT6 A;  2EWN A;  5F0C A;  4CIC A;  1AU7 A;  2R7D A;  1PP8 F;  2BW3 B;  3CC4 I;  4ANJ A;  2A68 F;  2ACJ A;  1B9M A;  1WJ5 A;  5D4S A;  4KIB A;  1GT0 C;  1XMX A;  4NBQ A;  3CCE I;  1BI3 A;  5HDN A;  1OCZ H;  3ERE D;  2H94 A;  5FKO A;  5F0H A;  1S5L C;  2E60 A;  1GV2 A;  4CZC A;  2DOE A;  4CYC A;  1V5G A;  4EM0 B;  4RLF A;  4B1R A;  3C1D A;  2KPM A;  3FXU A;  1WJC A;  3RQ4 A;  1G3S A;  4BDY A;  3JTH A;  5HLI A;  1ZR2 A;  4MFD A;  1X2M A;  1JKP C;  4ITV A;  2FBK A;  2E5N A;  5FB2 A;  4M3G A;  2KZV A;  1VQL I;  2DYR H;  2JUC A;  2WAE A;  3TL4 X;  1LJ9 A;  2P5K A;  3HOU J;  4Y33 A;  2FQ3 A;  4XNF A;  1T8I A;  3VWB A;  4QWQ A;  5K7H A;  2ECB A;  3H0G J;  1YIJ I;  4PK4 A;  2M8G X;  1IC8 A;  3QOP A;  4EJT A;  3CF2 A;  3C18 A;  2W4S A;  4L9J A;  4GDF A;  1TWG J;  2DN0 A;  3MD2 A;  2WB1 A;  2FSW A;  4FQG A;  2DFF A;  1WI9 A;  5J6X A;  1MNM C;  5HOD A;  4EJO A;  1H88 C;  3FXK A;  2WAD A;  4AU7 A;  3CCQ I;  4XM3 A;  1Z7U A;  2DOA A;  2XB0 X;  3BPX A;  4RAG A;  3OL3 A;  2R5Y B;  3M8F A;  4A3J J;  5B66 C;  3KIO A;  2VB6 A;  2HGC A;  1RES A;  2QUF A;  2B63 J;  4A93 J;  1J2X A;  3PUF A;  4LOC A;  5J8F A;  5LRS A;  5J1Y A;  3JR9 A;  2R5Z B;  1T0F A;  4HF1 A;  1WPK A;  4O5V A;  3HOT A;  3V8L A;  2H1K A;  1TW2 A;  1XSV A;  2KT0 A;  4IPA A;  2EV5 A;  3KYC B;  1HSJ A;  3DU5 A;  2DA1 A;  2VKH A;  1ETQ A;  3OOP A;  2EZL A;  2QEN A;  2LK2 A;  4O3M A;  3S3M A;  4L5I A;  3GW2 A;  2HNH A;  4UY8 I;  2A6T A;  3A1Y A;  3HRM A;  4FHT A;  2DOD A;  3L1P A;  3OYJ A;  4XLA A;  3ECO A;  2CV1 A;  1QHH D;  3H1C A;  1DU6 A;  3RPU A;  2K4J A;  3ABT A;  1BIB A;  3BG5 A;  4Y15 A;  1QGP A;  2R7S A;  1UHM A;  4KUM A;  3A2K A;  4EVI A;  4DW6 A;  4IRH A;  1N25 A;  5IPA A;  4OU0 A;  1WJF A;  3WG7 H;  1A5J A;  5HLH A;  3IH2 A;  4S04 A;  3M1E A;  4XKW A;  3K9T A;  2L7Z A;  2HZD A;  4IJA A;  1O3T A;  4BDZ A;  5E1X A;  3IHU A;  3KP3 A;  4HQM A;  2VQL A;  1TL8 A;  2VPL A;  1PP7 U;  3CMA I;  5ILV A;  5L3G A;  1TWC J;  1R4N B;  4ABZ A;  3RKX A;  2MYS A;  1PUF A;  3W6J B;  3IRR A;  3O6B B;  3F8N A;  4A12 A;  1ZKG A;  4BQN A;  4G94 A;  5L3F A;  2QM3 A;  3H92 A;  3EUK L;  3KP6 A;  4ZJZ A;  5B5E C;  3B6C A;  2RDP A;  1W5T A;  5JVT A;  1ZGA A;  2H8W A;  2ZJ2 A;  2AO9 A;  2HDC A;  2ME0 A;  1RUO A;  5EGO B;  1FTT A;  2NRA C;  2HPI A;  4BAC A;  3DF8 A;  5J4Y A;  2DQR A;  4NC7 A;  5DDG A;  4XL9 A;  4G6T B;  1SD4 A;  2UZK A;  1Z0X A;  1TW3 A;  1KU9 A;  3K4J A;  3I59 A;  3L2R A;  1UG2 A;  4L0Y B;  1FYK A;  2Z99 A;  1AKH B;  1CF7 A;  2JA6 J;  3RI4 A;  1A35 A;  1AWC A;  1GUU A;  2WTE A;  1F1Z A;  2WY7 Q;  2Z16 A;  3ZQI A;  4HSR A;  4YFX F;  4K2E A;  3HKZ A;  3FK6 A;  2FD5 A;  2V9P A;  4GYG A;  1R23 A;  2P5V A;  2CUE A;  4XIC A;  1G59 A;  1UZC A;  1MKM A;  5HNH A;  5DUI A;  5J8C A;  5ILS A;  2HDD A;  5TRD A;  1WCM J;  2Y75 A;  2QBY A;  1TC3 C;  1BJA A;  2KMU A;  2O6G E;  2VKE A;  4UUS B;  1JUS A;  3Q3S A;  3K2Z A;  4OOI A;  3S32 A;  1ZRF A;  1B59 A;  3OYB A;  1X1A A;  2UWM A;  2EFQ A;  1JE8 A;  3I4N J;  1BI0 A;  4ZZL A;  3TP0 A;  3CCM I;  4MNU A;  1JJ6 C;  4CSW A;  2GZW A;  2R7F A;  4HLX A;  1RC9 A;  1IXC A;  2A05 A;  3FM3 A;  4L9N A;  5K5R A;  4A2U A;  5KVR A;  2CUF A;  2H27 A;  2JRM A;  3NAR A;  4EMS A;  2HOE A;  1TQP A;  3ULQ B;  3S15 J;  2RC4 A;  3LSM A;  2L7M P;  2MBF A;  1HLV A;  1P7I A;  4HQE A;  5GAD J;  2DA3 A;  2BVM A;  3KLN A;  2WV1 A;  3DPL C;  4GYI A;  4HG2 A;  5DYM A;  4LLN A;  4ZC3 A;  4I98 B;  4UB8 C;  4DJA A;  1T39 A;  2JA2 A;  3CCL I;  2CUZ A;  3HRT A;  1GV5 A;  3D1N I;  4XK4 A;  3OYL A;  4L0Z B;  5J4V A;  3VEP A;  3CDH A;  1PVE A;  3TGN A;  2PQ8 A;  3HKZ N;  3WU0 A;  4IVN A;  2CO5 A;  2BV6 A;  2QSF X;  1LUJ B;  2KRH A;  4XKV A;  4M6V A;  4WCG A;  1IDZ A;  2HYF A;  2TCT A;  5D6E A;  1FWZ A;  1H9G A;  2VIX A;  2X6O A;  1QPI A;  4LK1 F;  1FOY A;  1UFM A;  4UNO A;  4HYE A;  1BBY A;  5J40 A;  4IEJ A;  4X6A J;  3TBI A;  1IUY A;  4II2 A;  1W1W E;  1OYY A;  3TO9 A;  3CF5 F;  3AL0 C;  1HDP A;  2ZO4 A;  3FIW A;  3H36 A;  2DTZ A;  3UKG A;  4L5E A;  5EEG A;  1VQ6 I;  2LNB A;  3GFM A;  2W57 A;  2KIQ A;  3LFK A;  4V2G A;  4XLE A;  2FOK A;  3WTY C;  1FZP B;  2AQF A;  1YLF A;  4CCO A;  3CP2 A;  2PJR B;  1SAX A;  1X58 A;  4R79 A;  5E3L A;  1IXR C;  1TBX A;  1MJ9 A;  1L3L A;  4KMU X;  1OYI A;  2CSO A;  1T6S A;  4N9I A;  2V1D A;  2L02 A;  1IO2 A;  3F72 A;  1SFK A;  3SEZ A;  4HAM A;  3GTM J;  1V5E A;  1JI8 A;  1I3Q J;  1RZ4 A;  2ELH A;  2R7U A;  1T08 B;  1KQ8 A;  3OS1 A;  2M7B A;  3OIO A;  1RET A;  4U7D A;  2ZSI B;  2DT5 A;  5AIP A;  5JLX A;  3JW4 A;  1F5T A;  3HEF A;  3IAS 2;  1SFU A;  1S29 A;  2HVQ A;  3MN2 A;  3JRE A;  4QPQ A;  3JRD A;  2BW3 A;  1OCR H;  1X1D A;  5E3N A;  1MJA A;  3QQA A;  4CDG A;  1LDD A;  1JTY A;  1T95 A;  5LEJ A;  2K9S A;  2OA4 A;  5ICG A;  1ODD A;  2FBI A;  3LWF A;  2QSH X;  4OWR B;  4B3X A;  2KFD A;  3TW6 A;  1HKT A;  4KT6 A;  5FLM J;  1P2F A;  1FX7 A;  1GVD A;  2HXI A;  5M5W J;  3P9K A;  3DBR B;  3OOU A;  4BY7 J;  1ZAO A;  1USS A;  4IHY A;  1AA7 A;  2DMQ A;  4B48 A;  3OYF A;  5FLX Z;  1XDS A;  1LVK A;  1YQA A;  2EBI A;  1CF7 B;  3TP3 A;  4I09 A;  2E1C A;  3GCM A;  3WU2 C;  2KKO A;  3IAM 2;  5FLX K;  5E3O A;  4A69 C;  3F8B A;  1JXS A;  2CQK A;  3OR2 C;  4ZYA A;  2Z5U A;  4UV9 A;  5J47 A;  3BPV A;  2M0C A;  2EV6 A;  5L3E A;  2W48 A;  4O6J A;  2E7X A;  4FX0 A;  4B3A A;  1FP2 A;  5CLS A;  2QBY B;  2DT7 B;  4X1E A;  1ZQ3 P;  3HDD A;  3ZXS A;  4ZTJ A;  3GTK J;  1LDJ A;  4BQQ A;  2IGO A;  3LQR A;  5IYC J;  3VOD A;  2QF7 A;  2LC2 A;  1ENH A;  4E7H A;  4UXN A;  3KET A;  2P5L C;  2HOS A;  3FXM A;  3W6V A;  3T5X A;  2VBY A;  5LGN A;  5HOO A;  1N78 A;  1U5T C;  1A6I A;  4U88 A;  1OCO H;  1XDU A;  5IOZ A;  3JAM K;  1Q1V A;  2D2W A;  3GLX A;  1XS9 A;  1IAW A;  3MKY B;  2FA5 A;  5DEQ A;  4DBR A;  1FMV A;  1Q1H A;  1ULY A;  2WBM A;  2XAQ A;  4MQV A;  5EG0 A;  3PSI A;  1UG0 A;  2IBD A;  2G9W A;  3VYU B;  4M3B A;  4Z2Y A;  1BOB A;  3WOD F;  3T0Y A;  3SDB A;  1VQ7 I;  1MSF C;  2RGV A;  4UB6 C;  2DA2 A;  3E7L A;  4P5O A;  4M9S A;  2M5W A;  1RR7 A;  2DOF A;  2DBB A;  2BXZ A;  2E1M B;  4A0Z A;  1OKR A;  1U6G A;  1GXQ A;  1E17 A;  5C44 J;  3R0J A;  2D1H A;  3PNT A;  2JA7 J;  2ZXJ A;  1J59 A;  3F3X A;  4PSW A;  1SMY F;  4ESJ A;  4AC0 A;  2DA7 A;  3FXL A;  3QU6 A;  4KT5 C;  4P96 A;  1YS7 A;  3HOZ J;  3V42 A;  3VYT B;  3WGH A;  4I99 C;  4C9Y A;  1ZEL A;  2LSO A;  1F43 A;  3GBG A;  1XGO A;  1Z7L A;  2DFH A;  3MZH A;  4L9V A;  2LY9 A;  4I02 A;  3BQZ A;  2CQX A;  3RSN A;  1WSU A;  1STZ A;  1NG7 A;  3K7A J;  3J80 Z;  3RZO J;  1Z6T A;  4MIM A;  2V9V A;  2E5Z A;  1WI3 A;  2J5P A;  2O61 A;  2MC4 A;  2XPU A;  2DAO A;  4F55 A;  1MJB A;  2Z33 A;  2KDO A;  2B7E A;  4KNY A;  1WVR A;  3BG9 A;  3BJA A;  1OLT A;  3OY9 A;  4BHC A;  4HLY A;  3BJO A;  3I3L A;  3F9K A;  2A5W A;  5ICF A;  1YX5 A;  4RB3 C;  2OAZ A;  4BJT A;  4L18 B;  5FGM A;  2DT6 A;  1ONV A;  3H9J A;  3M7G A;  1SAU A;  4AD9 A;  2ZJQ F;  4C2U A;  1WFX A;  3VYR B;  3VFZ A;  2I8D A;  2FXA A;  1D5Y A;  2YSR A;  2R92 J;  3DPU A;  3WTX C;  3WTZ A;  2MW8 A;  1MMA A;  3PIP F;  2BBY A;  5CQG A;  4QSH A;  2R7W A;  3ECH A;  4EJW A;  1LNW A;  2R7O A;  1ZRD A;  3HRU A;  5FKM A;  3H5N A;  2EIN H;  4R1H A;  1ETV A;  2H6B A;  1BW5 A;  2EZK A;  4W1U A;  4KA4 A;  2NS7 A;  1Z91 A;  3EYY A;  2LLK A;  2YR2 A;  3S14 J;  2K7L A;  3HRS A;  4Q5S F;  1RRJ A;  5TGT A;  2K3F A;  4E7K A;  5CJ9 A;  3ABK H;  3GF2 A;  4XR6 A;  3HOS A;  3P9I A;  4PGH A;  4FE7 A;  5HLG A;  3SHF A;  2K27 A;  4P9U A;  2CH0 A;  1QHG A;  3W6K B;  4DZP A;  1BC8 C;  2QGU A;  4C3I J;  3S16 J;  4KIG A;  1IGN A;  3G1O A;  2JMW A;  1KA8 A;  1F9N A;  2F4O B;  3RKY A;  1W5C C;  2RN7 A;  5H20 A;  1VQK I;  4CHU A;  1QA6 A;  2NXN B;  4XOT A;  1E3P A;  3LMM A;  2WWY A;  3IC7 A;  2NVX J;  5DD4 A;  2CQN A;  2GIZ A;  3E6D A;  1FIA A;  3FHZ A;  1YX3 A;  4MFE A;  2JA8 J;  3W2V A;  1G3Y A;  4AIJ A;  1AOY A;  1APL C;  4NC8 A;  2QKL B;  5EZG A;  3ESW B;  1JUM A;  4AYB A;  3QAH A;  1I5Z A;  1LPQ A;  1I6X A;  3E97 A;  4HV6 A;  3SZG A;  4IX7 A;  5K1Y A;  4JK1 X;  5EEA A;  2R4G A;  2ID6 A;  3M8E A;  3JTG A;  3BZ6 A;  5M5X J;  5EYR A;  3HHG A;  2RNG A;  4D5C A;  5E20 A;  1X3U A;  2KL4 A;  1SMT A;  2BGC A;  4Y52 J;  3BY6 A;  2V79 A;  3TDZ C;  2LKX A;  2JWT A;  4YEL A;  2EIL H;  2MD5 A;  4BQA A;  3S8P A;  1JHH A;  1SD6 A;  4EAT A;  3HIF A;  4G12 A;  3GFJ A;  4JYK A;  1H0M A;  1EA3 A;  2KRF A;  1YRN A;  1LFU P;  4BXX J;  4C30 A;  3E0J B;  3ZP5 A;  4A3K J;  1UST A;  3G1M A;  3AKZ A;  1T2K A;  5GTI C;  1B72 A;  4J00 A;  3R6S A;  2VJ4 A;  1BM9 A;  3CCS I;  2Y9Y A;  2IA1 A;  1QZE A;  1SEU A;  2L54 A;  1NG6 A;  1MBK A;  1SVO A;  4D0P A;  2YX4 A;  5ERI A;  3ZN1 A;  1RR8 C;  2IXS A;  2VON A;  1FSE A;  4WF2 A;  2VOD A;  2DU9 A;  2EH3 A;  3IP4 B;  2YU9 J;  2P8T A;  1KQ9 A;  3BR0 A;  4UVB A;  4C3H J;  4DYC A;  3PQJ A;  2OQR A;  4XLH A;  2NVT J;  2Q1Z B;  3SXY A;  2LDU A;  1TTY A;  3FX3 A;  1ZGJ A;  3K4B A;  2JJ7 A;  3IUO A;  5AON A;  1XX5 A;  3JRA A;  2ISZ A;  2DA4 A;  3V4G A;  2J5O A;  1B1B A;  2A5Y B;  3FXJ A;  4F91 B;  1EV7 A;  3QYF A;  1OCP A;  3HOY J;  3LSG A;  2E19 A;  3HTS B;  2OPT A;  3G6E I;  3G71 I;  3L7W A;  1WRJ A;  2WB1 N;  4W97 A;  3GTG J;  2RAE A;  3I9V 2;  2K5C A;  2XHK A;  2HU9 A;  2H09 A;  2XRL A;  2VBX A;  3E5Q A;  5F64 A;  3HGY A;  5BNG A;  1MH4 A;  2HQ5 A;  3OMY A;  2BEO A;  3TED A;  4J01 A;  3L2W A;  3VPR A;  2L2O A;  2OU2 A;  2A3S A;  3OV8 A;  3WTT C;  1TQI A;  4NB5 A;  5CVI A;  5BPI A;  4IZZ A;  4P9F A;  1YJN I;  1I3A A;  3CME I;  2E1M C;  4YRV A;  3SFI A;  5HS9 A;  3TW7 A;  1MBF A;  5IYB J;  1IN6 A;  3H9G A;  2MC3 A;  3SYT A;  2JVH A;  4E7L A;  3BLY A;  4BS9 A;  3V8J A;  4A3B J;  1U3E M;  1IW7 F;  3BT9 A;  2NVU B;  4G7Z F;  2AXT C;  3ZQL A;  5FFZ A;  2A6H F;  2KZG A;  2L0K A;  1OR7 A;  4JBA A;  3CCU I;  2JT1 A;  2DXI A;  1X3Z B;  2DI3 A;  2OC6 A;  1D8K A;  1R6R A;  2F5F A;  2V1N A;  5H2F C;  3G4S I;  3S2H J;  3D5R C;  3OYN A;  3OYD A;  5FJ8 J;  3I64 A;  1KQ0 A;  3S3N A;  2G0E A;  3C2G A;  2AXL A;  3GUD A;  3C3W A;  2MFZ A;  1VTN C;  1POG A;  1DP7 P;  4M74 A;  5D8L B;  4IHX A;  5LLQ A;  1Z77 A;  5D6F A;  2F4I A;  3FXR A;  2F4M B;  1TQM A;  2MSY A;  5FKL A;  2NNY A;  2GXB A;  5LGT A;  5E18 F;  4WK8 F;  2Y69 H;  2Y9Z A;  1ZLJ A;  3LAJ A;  3KCC A;  2GIV A;  3LA2 A;  3HSR A;  5LRR A;  2KP6 A;  3S2D J;  3LNQ A;  5B3S H;  4WXH A;  4Z6Y A;  4LB6 B;  1I6H J;  3CC2 I;  3RJP A;  4JX5 A;  2LF8 A;  4EGZ A;  2XKP A;  3OYK A;  1IJW C;  1U2W A;  1Z9C A;  2ELK A;  4G6Q A;  1YO5 C;  2ZFU A;  3QOE A;  2VXD A;  1K61 A;  1U8B A;  1ZG5 A;  2P6S A;  4HRI A;  4M72 A;  2HQA A;  2VKD A;  3RPU D;  4ZH4 F;  3K6G A;  4ENN A;  5L3B A;  3N4M A;  2NOJ B;  3W2A A;  1ZR4 A;  5TJJ A;  1K83 J;  1FEX A;  5L3D A;  4AWX B;  1GVJ A;  4Y13 A;  3ELK A;  3IV5 A;  4HA8 A;  2DYS H;  3I5U A;  1E3O C;  3BR6 A;  1HKS A;  3J80 K;  1WZ2 A;  3J7A Y;  4G7O F;  3FWE A;  2LFB A;  4JP0 A;  1U5T A;  1V55 H;  1MZB A;  2IP2 A;  4LIU A;  2D1V A;  3D0S A;  3KP2 A;  1O3R A;  5JI6 A;  1HKQ A;  2EFP A;  2M4G A;  3DTI A;  3KPH A;  1IN5 A;  5F27 A;  3F23 A;  3M3Y J;  2LG4 A;  2K40 A;  4F52 A;  4CCM A;  2QCO A;  3IL2 A;  1ETW A;  3H3Z A;  5B1B H;  2VQH A;  1KZH A;  2Z3Y A;  2W24 A;  3ZQC A;  3K4N A;  1BA5 A;  5CYV A;  2X51 A;  5IYD J;  1R1T A;  2EFN A;  1XN7 A;  4QIW N;  5IOY A;  3KE2 A;  1WHU A;  4IOA F;  2FNA A;  4WWC A;  3QRF F;  1XCB A;  1FIP A;  3BG3 A;  3PSF A;  1MBG A;  1SVM A;  2R7Z J;  1FOX A;  5LHG A;  2W00 A;  1Z6R A;  4YIF A;  4LMY A;  4WXC A;  2OBP A;  1FPQ A;  1V5F A;  2B9S A;  1F36 A;  5D5V B;  1ITY A;  3KP5 A;  1B4A A;  3G73 A;  4KMF A;  2XAJ A;  2E35 A;  4BY1 J;  3Q0W A;  4PSX A;  1K4T A;  1UJ8 A;  4KJZ A;  1Y0N A;  3BRO A;  3MZ8 A;  1LE8 A;  2ZME B;  2P0W A;  2NNN A;  1T56 A;  3WHC A;  3BC8 A;  1Y0U A;  5E3M A;  4D5F A;  1E2X A;  3T8T A;  2M87 A;  3OIQ A;  2UUZ A;  3HTU A;  4RBO A;  1HF0 A;  1KU2 A;  3H3V K;  1BR1 A;  2K9L A;  2FNP A;  4NHJ A;  4XID A;  1E0E A;  3WTW C;  4V19 K;  3EET A;  3A0H C;  1FTZ A;  5CVJ A;  2L7K A;  4EM2 A;  1XTA A;  2Y0S A;  3CMY A;  2IS4 A;  1T0F C;  3HUG A;  3NAU A;  2LYC A;  3FKI J;  3TDU C;  2CFX A;  4XN3 A;  1EH8 A;  2KJC A;  1WGX A;  2XF5 A;  2KIF A;  2XAS A;  3HZJ A;  3DLL F;  4FCY A;  1IRF A;  2LVS A;  2V6C A;  1XSX A;  5DUK A;  4XLP F;  2E71 A;  4LD5 A;  4H4K C;  5FKN A;  2F5V A;  4DIQ A;  3FK7 A;  1OCT C;  3MKZ A;  2O03 A;  4CYD A;  4WXD A;  2GWR A;  3Q0V A;  2P81 A;  2Y0S N;  4IO9 F;  4EEF G;  1HOM A;  2GOM A;  1MW7 A;  4A3I J;  2NYX A;  3OIP A;  5HS7 A;  4KIF A;  3BR5 A;  4OIQ F;  2BE5 F;  1T33 A;  2F5E A;  4ZYE A;  3SQN A;  2PBI A;  5E79 C;  2YUS A;  2WAF A;  3QP6 A;  3RYR A;  2PMZ A;  3CJN A;  3GWZ A;  4XBF A;  4C2T A;  4ZDL A;  2KLO A;  1D1B A;  2BY1 A;  4AVP A;  3RCO A;  4RB0 A;  2EFW A;  2NS8 A;  2O5R A;  1YIT I;  1O57 A;  2XPV A;  2W85 A;  4JX6 A;  2XC7 A;  1PJR A;  4N4O B;  4LIV A;  2LRE A;  4XRF A;  4BL0 B;  2L4A A;  1IXS B;  2MH2 A;  3I71 A;  2L5Q A;  4L5J A;  1WJB A;  1MD0 A;  3PNV A;  3U1D A;  2DK5 A;  2XAU A;  4DBQ A;  3BP8 A;  1ZLK A;  3VYS B;  1RKW A;  4PJN A;  1SD5 A;  3BR1 A;  4IXA A;  2N8G A;  2VLA A;  2HYJ A;  4U0V A;  3OYC A;  1WWX A;  1RI7 A;  3ZN0 A;  2XUB A;  3E3V A;  4S0H B;  2B0L A;  3V7R A;  4AID A;  4BE1 A;  2OCE A;  4BHP A;  4CCL A;  3HPG A;  2FMY A;  4QPO A;  4CA0 A;  3T1B A;  5LGU A;  1BW6 A;  1MBE A;  2VAS A;  1R22 A;  1IV6 A;  2ZB9 A;  4IQJ A;  3KP4 A;  5DV5 A;  2BZT A;  4XLN F;  4XON A;  4B09 A;  4EJU A;  3VSK A;  4XMY A;  4E70 A;  4XRM A;  2CFO A;  2GBY A;  2VT3 A;  4GXO A;  4E7I A;  3I53 A;  2F5C A;  3ZQQ A;  4NDL A;  2YPR A;  4YII A;  5HLT A;  2I10 A;  2NAZ A;  2DO7 A;  2K02 A;  2JA5 J;  2QEX I;  2DMP A;  2ETH A;  4UVA A;  4E6K G;  2JQ7 A;  4A3G J;  5JVG F;  2E1N A;  2E2I J;  1OYW A;  3KLO A;  2EQR A;  3K0L A;  1N75 A;  3LQQ A;  3QWL A;  4IRG A;  5GAG J;  1S6L A;  2IPQ X;  2V1X A;  4A0X A;  5C4X J;  5D5X B;  2IAI A;  3BCA A;  3GTJ J;  1S7O A;  2JRT A;  2E2J J;  1V4R A;  2UXX A;  3CCY A;  5CVU A;  1OR7 C;  2FF4 A;  2M4K A;  2X6X A;  1OJL A;  3A01 B;  2PFB A;  1FP1 D;  5ED4 A;  3KYD B;  1D0Y A;  1RKT A;  1D0Z A;  2EA4 A;  1FC3 A;  2KRC A;  4PFO A;  1BR2 A;  3HBL A;  2H6C A;  2IS6 A;  1O3S A;  1D3Y A;  1MH3 A;  3K2A A;  3L9F A;  5E1W A;  1BN5 A;  1K4S A;  1FOW A;  1YTY A;  5IP6 A;  3KP7 A;  3IKT A;  1VF9 A;  2R5Y A;  1VFC A;  1A04 A;  4BEH B;  1JT0 A;  3JRB A;  3CD6 I;  3HOX J;  4PJJ A;  1OFC X;  1HC8 A;  1XG1 A;  4F92 B;  1TNS A;  2QQ9 A;  3PO3 J;  3F6V A;  2DQL A;  5CKT A;  2GA1 A;  5FLV A;  1YJ9 I;  4M9X A;  5IY5 H;  2KHM A;  3L00 A;  3DTE A;  1V54 H;  2DPD A;  1QVT A;  2XKO A;  4PGG A;  1DGR M;  2VT2 A;  3CJR B;  2PJP A;  2ZNY A;  2OD5 A;  3KX2 A;  3FF5 A;  4II3 A;  4IRI A;  2NVQ J;  1YW7 A;  2R0Q C;  2DA6 A;  3AG4 H;  4PFP A;  3RQI A;  4AUX A;  2A69 F;  4DZJ A;  2NS0 A;  1TWA J;  5DS9 A;  4BYY A;  1B8I B;  1OQY A;  1MSE C;  4HF2 A;  4P55 A;  3PFY A;  4WX9 A;  2PMH A;  2GLO A;  3L2V A;  2JUG A;  2HR3 A;  2HI3 A;  1G8X A;  3S2W A;  2PI0 A;  2L4M A;  1GDT A;  2QWW A;  2XGD A;  2OCC H;  2FQ4 A;  3GVA A;  1NH3 A;  1NK3 P;  4LIT A;  2QQ8 A;  1WH5 A;  3CC7 I;  1XPX A;  3GO5 A;  1YI2 I;  1QZY A;  2O0Y A;  3F6O A;  2ZXH A;  1IZ1 A;  5E17 F;  5IT9 Z;  4B47 A;  2CUJ A;  4ASN A;  3CQZ J;  4LG3 A;  4ETS A;  1H9T A;  2XB5 A;  2LBF B;  2VQG A;  4RGU A;  3HL2 A;  3JSO A;  4XRS G;  2VUM J;  2GAU A;  3CO7 C;  2X1C A;  1UB9 A;  1ZHF A;  2P4W A;  3ONQ A;  4IQ4 A;  2ZSH B;  3FDY A;  4I01 A;  2FEZ A;  5H6Q A;  2R7Q A;  4Y7N J;  2W7N A;  2QSG X;  1WJD A;  2CRG A;  2FOW A;  2I5U A;  3F8C A;  1IDY A;  2VBW A;  2XGE A;  3HSF A;  3HOV J;  3DEW A;  3MQ0 A;  4DGW B;  2X6Y A;  3PUB A;  3FBI B;  3Q9V A;  3FKJ A;  3S17 J;  2TRT A;  1I50 J;  3DKW A;  2QQB A;  1QBJ A;  4M6X A;  3BTJ A;  5LD2 C;  1DPU A;  3CUO A;  3I54 A;  5TIS C;  5HVQ C;  3DBL B;  4RAF A;  1ZYR F;  4HF0 A;  4LK0 F;  4HBL A;  3I0T A;  1MMS A;  3N97 A;  4UV8 A;  4A3C J;  3I59 B;  1MGT A;  5FRO A;  1H89 C;  4DYQ A;  1JHF A;  1AKH A;  2W25 A;  4PJ0 C;  9ANT A;  3KEO A;  4OMZ A;  3B6A A;  5LEK A;  5FD5 A;  3COA C;  4XQF A;  1EJ9 A;  3ZMV A;  4DQ2 A;  3Q9S A;  4M3D A;  1Y6I A;  2AHQ A;  2MLG A;  2R7V A;  1OPC A;  2WY8 Q;  1D0X A;  2L7F P;  1W0U A;  5HDG A;  3E6C C;  4HV5 A;  4HNU A;  2PLY A;  3U21 A;  4U87 A;  1ZG1 A;  2GXA A;  4A5N A;  3ABM H;  3O3K A;  4XN0 A;  5DM6 F;  2PEX A;  1FBQ A;  4D7N A;  1A36 A;  2VC0 A;  2O8X A;  4ENK A;  3ABL H;  2HKO A;  1UCR A;  1ZGW A;  1UHW A;  1QPM A;  2M30 A;  1P7J A;  4KDP A;  1MBH A;  2DTR A;  2A6E F;  3EDP A;  3RZD J;  2WA0 A;  3VSL A;  4RLQ A;  5M3F J;  3GEZ A;  3HOW J;  4M73 A;  3A02 A;  1HQC A;  2MGQ A;  3ZMZ A;  4HW0 A;  3BG7 A;  1CQT A;  5ICE A;  2M45 A;  1X1B A;  4RA2 A;  2HPM A;  1SVL A;  3M1C A;  2IGK A;  3BTC A;  5HNF A;  1OCC H;  3HB9 A;  1P4A A;  2EB7 A;  1F4K A;  4FT8 A;  4B43 A;  3NQO A;  2XF7 A;  4JQF A;  2EIK H;  2WAQ A;  3WTS C;  4YG2 F;  2G7U A;  4C3J J;  3KZI C;  2K9N A;  3JCU C;  1MMG A;  4LLL A;  5GPA A;  2ME6 A;  3JRF A;  4BXF A;  1PYV A;  3PL8 A;  2PMU A;  2LMD A;  4RM2 A;  1XGM A;  2X0L A;  3CCR I;  1B8I A;  4HOB A;  3CO6 C;  3GXO A;  3V7C A;  2ZNZ A;  5IT3 A;  2EZI A;  2GQQ A;  2MH9 A;  4KIT B;  2CQQ A;  2K9M A;  1IUF A;  1YW8 A;  4TV7 A;  1IN4 A;  3L2Q A;  4A0Y A;  1RUN A;  3DTK A;  2ZFW A;  2DDB A;  1R58 A;  2F6C A;  1YHQ I;  1TWF J;  4BGD A;  1JTX A;  3A0B C;  4HNT A;  2E7W A;  3OYI A;  2DLL A;  1JKO C;  2XF6 A;  1ZTR A;  5K7F A;  2OV7 A;  1YOV B;  2QVO A;  1XMK A;  5JHF A;  2CJJ A;  5M3M J;  3WGI A;  2CW8 A;  1R7J A;  1QRY A;  4A3D J;  3OYA A;  1R1U A;  3MAJ A;  2K9Q A;  3J7A O;  4ZZD A;  2OTJ I;  1SFE A;  3V7S A;  4L9T A;  4RGX A;  1DGW Y;  3AFH A;  4BXU A;  3OSG A;  3I58 A;  3QP5 A;  1BOA A;  1VQP I;  1ZRE A;  3OR1 C;  3KZY A;  1ON2 A;  4U0Y A;  1VQ5 I;  1TNT A;  4QLC U;  3EPZ A;  3H35 A;  3S1Q J;  1TT0 A;  2DFE A;  3SDG A;  5IT9 K;  3F8M A;  3KZZ A;  3EUH C;  3FBN B;  5DM7 F;  1HW5 A;  1BR4 A;  4KN7 X;  1XCV A;  4F7Z A;  3L2U A;  4I2O A;  4CZZ A;  2JZY A;  2DJI A;  2HQN A;  3HM5 A;  4UVC A;  3SFZ A;  4CCJ A;  4YIR X;  1U8R A;  1JGS A;  2K86 A;  2X48 A;  5CVV A;  2CQ7 A;  4AIH A;  2XDV A;  2VJJ A;  2XGX A;  3TO6 A;  1PUE E;  3DKY A;  4DYR A;  4I76 A;  1OIS A;  5D5U B;  4E7Z A;  1G3W A;  5FO5 A;  2RQQ A;  3JAM Z;  1B6A A;  1MNE A;  2OQG A;  3OS2 A;  1FBU A;  2E2H J;  3NWS A;  3QOD A;  1XGS A;  2TDX A;  3FM5 A;  1G3T A;  1FMW A;  3QPS A;  3AAF A;  1VQO I;  2RNJ A;  3HHH A;  5CQE A;  2DMN A;  4GCV A;  1QO0 D;  4MTD A;  2IA0 A;  3JRC A;  4Q48 A;  5HS8 A;  2CG4 A;  4BU2 A;  4G8X A;  4BH9 A;  1Y8R B;  2VQC A;  4ZYH A;  2R3S A;  3G2B A;  3F21 A;  1I27 A;  4M6Y A;  2BOL A;  2ZC2 A;  1S8N A;  4GRI A;  4U7B A;  1TWH J;  2HOA A;  3RIR A;  2KIU A;  3FZV A;  4XOP A;  4CCN A;  3E5X A;  4EJV A;  3M9A A;  3KEQ A;  2Y0M A;  2M0M A;  1G6N A;  3S93 A;  3PFI A;  4BQO A;  2FX0 A;  3FIS A;  1W7P D;  4PJM A;  4RAY A;  2CGP A;  4UHT A;  2LD5 A;  2X4H A;  2GOX B;  4E7J A;  4LGW A;  1G4D A;  4BBS J;  4BE2 A;  3C2H A;  1IRG A;  4OAY A;  5JHU A;  2IS2 A;  3O2P E;  1Y39 A;  3JRG A;  1K79 A;  3DXJ F;  5EJC A;  2O3F A;  4B4C A;  3GFI A;  3E6M A;  3K70 D;  3CCJ I;  5EEH A;  1I1G A;  1H8A C;  4A6D A;  3AG3 H;  4ON0 A;  3JRH A;  1S9H A;  3LL7 A;  1VZ0 A;  3U9G A;  1U9O A;  2LOO A;  4A5M A;  2STW A;  3WTV C;  4Q4Z F;  3HPH A;  4PCQ A;  3RKQ A;  2EJR A;  3J81 Z;  2Y48 A;  3E1S A;  5F04 A;  1R5H A;  1W36 D;  1IRZ A;  2KQR A;  3J81 K;  4N9H A;  2IVM A;  1Z67 A;  2XAG A;  3OYM A;  1FNN A;  2M9H A;  4HDU A;  3IRQ A;  2W84 A;  1O7L A;  2XGC A;  4E7S A;  2LH9 A;  3RYP A;  2O7O A;  1ZRC A;  2H1L A;  3F22 A;  3B73 A;  5HDK A;  1R36 A;  1LEB A;  3LSP A;  4F3Q A;  3O8G A;  3KYL A;  1K78 B;  3OYE A;  2LBF A;  1X3W B;  2HWV A;  2RQP A;  2VOP A;  1QQI A;  4OIN F;  2VE8 A;  3R4K A;  1MMN A;  1VND A;  4N4N B;  5JFR A;  5F6F A;  4S05 A;  2VOO A;  2EPF A;  1A6Q A;  6PAX A;  1UMQ A;  2H8R A;  2A07 F;  3NWT A;  1T38 A;  2OUM A;  3HC7 A;  4NQW B;  4I7H A;  2HXO A;  5L3C A;  4Y3O A;  1WJE A;  3S1R J;  1WH7 A;  4IOC F;  4LG0 B;  3E5U A;  3BJ6 A;  1OMI A;  2DDA A;  3O8H A;  4LB5 A;  1YJW I;  3HUG B;  2XAF A;  1ETK A;  3BR3 A;  1J7K A;  3ZQF A;  4OMY A;  3LA3 A;  3CUQ A;  2L01 A;  2HOT A;  3GYH X;  1S7E A;  4A3F J;  3GX4 X;  1YW9 A;  1CGP A;  3GZ6 A;  2BYV E;  3GTQ J;  3ROU A;  2CW0 F;  2DA5 A;  3ZPL A;  4GO1 A;  2MG4 A;  1KU3 A;  3EQL F;  2Q0O A;  4D1Q A;  1REP C;  4JOM A;  1QZZ A;  2LKS A;  1ETY A;  1XGN A;  4RB1 A;  3WU1 B;  2AS5 F;  2LRD A;  1VI0 A;  2BHY A;  5DD8 A;  4OIP F;  3CJT B;  3BDD A;  1W0T A;  2G7H A;  5C3E J;  2RV8 A;  1ZAR A;  3R0A A;  1U0J A;  3ZMU A;  1HCR A;  1D1A A;  3DEU A;  3K70 C;  1ZK8 A;  5IP7 J;  3ZMD A;  1ETO A;  4HEA 2;  3F8F A;  3CP8 A;  3LA7 A;  1DPR A;  1D1C A;  1TP4 A;  3FMR A;  1IN7 A;  1HXD A;  2R7T A;  3ZMS A;  3K4L A;  3SEQ A;  4HST A;  3AG1 H;  3FXO A;  2V26 A;  2VBZ A;  4DNC A;  2K4B A;  4LJZ F;  4KYW A;  1BC7 C;  2FU4 A;  4H0E A;  1L0O C;  3N05 A;  1YE9 A;  5EG0 B;  4MQ9 F;  3DKX A;  4M3E A;  4OAZ A;  1MMD A;  5J3L A;  5B1A H;  1ETX A;  1V3F A;  2ECC A;  1LFB A;  2QKM B;  2RVC A;  2STT A;  3S1N J;  4AVZ A;  3BTI A;  3WE3 A;  2CU7 A;  2Q2E B;  1Z3Y A;  1XB4 A;  4YFK F;  1LDK B;  5EZH A;  2W1O A;  2OZ6 A;  5GTH C;  4RGS A;  2EFO A;  4Q47 A;  1C0W A;  3MVP A;  4A3L J;  2XVC A;  2BVL A;  4IKF A;  1X1P A;  3PQK A;  3I56 I;  1LFP A;  1YRN B;  3ABU A;  2IRF G;  3RTR A;  3WTU C;  2HYG D;  2GXG A;  2LF7 A;  2HDW A;  2LP0 A;  1O4X A;  4M3F A;  1HA8 A;  5A2Q K;  1K6O A;  1KGS A;  1MND A;  2ZME C;  4CCK A;  4IF4 A;  5KHD A;  3MFK A;  1DQU A;  2Y31 A;  3ZQ7 A;  2GM4 A;  4QTR A;  4YEJ A;  4HDV A;  2VC1 A;  1BIA A;  2ESN A;  2IEK A;  4CGZ A;  3ERM A;  2KDZ A;  2ZKZ A;  3HYI A;  2CS3 A;  5D5W B;  1TZL A;  3IKV A;  5LFA A;  3CLQ A;  4XKB A;  3BWG A;  3ZR8 X;  3A01 A;  4A6E A;  4I6Z A;  3GME A;  3MWM A;  3TOB A;  2Z9O A;  2LKP A;  2NOG A;  4HX7 A;  5M5Y J;  2HS5 A;  4J19 A;  2V9K A;  2ZJR F;  2W82 A;  4XSX F;  1Y1W J;  1U78 A;  3SJM A;  2VXZ A;  4OIO F;  4KIC A;  4XSZ F;  3FMQ A;  3ISP A;  3DV8 A;  4V2F A;  3SZP A;  1LB2 A;  2WV0 A;  1W5S A;  3MMY B;  4CH7 A;  1UAA A;  3Q0U A;  1FLI A;  2X6W A;  2EK5 A;  4G7H F;  1TT5 B;  1YFH A;  4BEH A;  2XAH A;  1GLN A;  2ZCW A;  1KYW A;  2Z2S B;  2ESH A;  3I4M J;  4MHG A;  2E1O A;  1N77 A;  4LG0 A;  5E8I A;  2VE9 A;  1SFX A;  1ERD A;  5D4R A;  2ISY A;  5K5O A;  1HBX G;  2QLZ A;  3QPT A;  3GZ5 A;  5BQT A;  1X4O A;  5EGO A;  1VQN I;  1DUX C;  5FKK A;  1MDM A;  4EGY A;  2E36 A;  3F0C A;  3G1L A;  3FHN A;  5GPC A;  5J1R A;  3LFU A;  1BI1 A;  4NUB A;  5FFX A;  1KYZ A;  1IV8 A;  3WG9 A;  4BKX A;  1JUP A;  3WE2 A;  3OWT A;  2KJB A;  4PZJ A;  3K1N A;  4MEX F;  2HFH A;  1EH6 A;  4HX8 A;  3C2B A;  4N0B A;  1QU3 A;  3BG6 A;  3ASO H;  1W7P B;  2M1B A;  4FIS A;  4IL6 C;  1G2H A;  1GXP A;  2R7R A;  2EIJ H;  2FUG 2;  3QPL A;  3OYG A;  1IG7 A;  1VQ8 I;  2MD0 A;  5FRN A;  1I1S A;  3DCF A;  3CLO A;  2JN6 A;  3MKL A;  4AIK A;  2R7X A;  3L09 A;  2R93 J;  2CWE A;  5LHH A;  4BJ6 C;  2O8K A;  4B8X A;  1SC7 A;  1EH7 A;  2OF7 A;  3J7Y J;  3PIO F;  2HTJ A;  3HXL A;  4PJL A;  2FRH A;  3A4C A;  2JPC A;  4A3M J;  2DK8 A;  3D5L A;  5F1R A;  2DMU A;  2X9D A;  4OIR F;  2M3A A;  2X1E A;  3B02 A;  1LKX A;  3MZY A;  5BMZ A;  3LSK A;  4MO7 A;  4U0W A;  2QA4 I;  2F48 A;  3AG2 H;  4PUS A;  4PDK A;  4EQQ A;  1EF4 A;  3CMM A;  3REO A;  2QYO A;  1RPW A;  3M4O J;  2LR8 A;  3ZOB A;  5GAE J;  5GAH J;  2ZXI A;  3QPH A;  1P9Q C;  1P6R A;  3FMS A;  4ENJ A;  1JGG A;  2JSC A;  4ZDP A;  1J09 A;  1R49 A;  1BJZ A;  1FT9 A;  3D5S C;  1J75 A;  4C2M J;  4IHW A;  1MBJ A;  3HJE A;  3LAP A;  3TQN A;  1LQ1 A;  2BY2 A;  1B72 B;  3TOA A;  4D9J A;  2VN2 A;  1X2N A;  4G9Y A;  3QYE A;  4FE4 A;  3DFG A;  3BZK A;  4CYC B;  2ELJ A;  2VL8 A;  2HKX A;  2VI6 A;  3VDX A;  3H3U A;  2EV0 A;  1ON1 A;  3U2R A;  1IF1 A;  1R1V A;  1HW1 A;  3LST A;  5IP9 J;  1BL0 A;  1O7F A;  1Z3X A;  5D8K B;  3A03 A;  2XIG A;  2FBH A;  1WQ2 A;  1A31 A;  3GTP J;  1DP3 A;  5BPD A;  2HQR A;  1R9T J;  2JTV A;  2F2E A;  4F93 B;  3M8J A;  5GP9 A;  4X0G A;  1VQ9 I;  1YS6 A;  2CYY A;  1XSD A;  1S3J A;  3JSP A;  3DPT A;  3MEX A;  4AM3 A;  1ORK A;  5BS6 A;  4ESB A;  2PX9 A;  1LEA A;  2VKV A;  5JLW A;  2K3P A;  1P92 A;  2A61 A;  2ADU A;  1P4W A;  2JVG A;  4M9Z A;  2PJR A;  1Z1D A;  4JX4 A;  4BAY A;  1K7A A;  4RGR A;  4LFU A;  3WHB A;  5KAF C;  4HPQ A;  5DCF A;  4NQW A;  2DW4 A;  2LY2 A;  1ACI A;  1HW2 A;  3BTL A;  2CV0 A;  1JKQ C;  3H0D A;  2IA2 A;  4FET A;  3UR3 C;  3CUQ C;  2AQE A;  4ZDO A;  1LE8 B;  2MLK A;  3PM1 A;  4CO8 A;  4RAZ A;  4MEY F;  3OYH A;  4UUT A;  3ZRG A;  3K1P A;  2M8E A;  2BXY A;  1UHS A;  3K10 A;  3K4M A;  3K69 A;  1KON A;  3NRV A;  1VQ4 I;  5F08 A;  4XKC A;  5EDN A;  1QVU A;  2GA2 A;  1Z05 A;  3UNG C;  4B44 A;  2OZU A;  3CUQ B;  2M2E A;  1E3H A;  5KNL A;  3KFW X;  4EM1 A;  2M34 A;  2V4J C;  1WKM A;  3DQV C;  1R5G A;  2HZT A;  3K4C A;  3CZ6 A;  3CCV I;  5JR3 A;  3ZMT A;  3M07 A;  3DLA A;  2X1D A;  1RIO H;  1YYV A;  2ID3 A;  2IGM A;  1FSH A;  2D45 A;  1R71 A;  2MAB A;  2LTP A;  1BI2 A;  2BY0 A;  3FXQ A;  4CXF A;  4DOZ A;  3MKW B;  1DDN A;  2FE3 A;  5KK1 A;  2DFI A;  4ZTF A;  4UUV A;  2NVY J;  2XRN A;  4MLO A;  4BJ5 C;  3S1M J;  5F0F A;  2IGN A;  2D5V A;  2HVS A;  5LHI A;  2YX7 A;  2XV4 S;  5DCM A;  3X2Q H;  1K6Y A;  4RMN A;  1B9N A;  1R4M B;  3NEU A;  3WGG A;  1Y56 A;  3EUH A;  2Q8K A;  2RKH A;  1EKE A;  1SAN A;  4BE0 A;  3S3O A;  5J1U A;  1IN8 A;  1Z21 A;  3IH3 A;  2C6Y A;  2P6T A;  1FYL A;  2HEO A;  2VJI A;  3SZT A;  3ZCO A;  5E8G A;  1R5I D;  2EA2 A;  2JK3 A;  4KN4 X;  3KEY A;  3OS0 A;  2ZJP F;  3OSF A;  4KIS A;  4E4H A;  1RNL A;  3Q5F A;  1O3Q A;  4ESF A;  2HTS A;  2XPW A;  5FD6 A;  1X4P A;  2XSJ C;  4A3E J;  3IH4 A;  4G6D A;  2RRE A;  3LSR A;  1JKR C;  1DU0 A;  5ILU A;  2FJ1 A;  3K4K A;  3CDL A;  5EF6 A;  2Q2E A;  5K7Z A;  4BNC A;  2P7C B;  5A2Q Z;  3HSE A;  3ASN H;  5LBQ A;  2X85 A;  2LY1 A;  4RM3 A;  1W36 C;  1FBS A;  4HX4 A;  1YG2 A;  3DEE A;  1I39 A;  5FRM A;  1WJA A;  1U5T B;  4RB2 C;  3ZGK A;  4P1W A;  2IS1 A;  2K85 A;  2COM A;  4R8H A;  3GTL J;  2Z1D A;  1FYM A;  3RPQ A;  2F5D A;  3LOC A;  2BY3 A;  2L9N A;  3P9C A;  3LSH A;  1S7A A;  3C7J A;  4XLF A;  2IJL A;  3P7N A;  4XOR A;  4IHT A;  2P7V B;  2VJ5 A;  2L9R A;  4ENM A;  3RKW A;  3BQY A;  4MGR A;  3TKY A;  3W3C A;  3CES A;  1J9I A;  3R60 A;  3MCZ A;  4LLG F;  4XRS A;  1JJ8 C;  5CPR B;  3PNY A;  5AIQ A;  4BUP A;  4FX4 A;  5C4J J;  1W4M A;  1Y8Q B;  4XLC A;  4EV0 A;  3PJR A;  2YS9 A;  1M1E B;  3GLL A;  4UUS A;  1KU7 A;  3ML6 A;  2QZ8 A;  2L3D A;  2IW5 A;  3IWZ A;  3BOQ A;  2PN6 A;  3G3Z A;  2V6E A;  1ZH5 A;  3DP7 A;  3GTO J;  1TLH B;  3L2C A;  5F1J A;  2ZME A;  3HG9 A;  2CMP A;  4AYB N;  2DMT A;  5ICC A;  3VB2 A;  3H5A A;  1AHD P;  4Y4R A;  2QQA A;  2CV2 A;  2O9L A;  1XMA A;  5KCM A;  1ZG3 A;  3CJQ B;  3J7Z I;  1NHA A;  2R5Z A;  3OL4 A;  3HGG A;  1ZN2 A;  3BZC A;  1NTC A;  2MA3 A;  1LVA A;  2UXN A;  3CDI A;  3W2W A;  4D7M A;  4Y17 A;  2IT0 A;  3QU3 A;  4RS8 A;  5CVR A;  4ZYD A;  1GHC A;  2COB A;  3P5J A;  2EIM H;  3VOE A;  1UEL B;  4I0A A;  1MDM B;  3IWF A;  2FML A;  5KAI C;  5H6R A;  2L9S A;  3DWL E;  4YFN F;  1NK2 P;  2BHZ A;  2WC2 A;  3CTA A;  4HZF A;  2ZXW H;  2EZH A;  3LSJ A;  2VPR A;  3EYI A;  3V8K A;  1FY7 A;  2OJE D;  4FTH A;  2OTL I;  1J0R A;  1W7P A;  3DBH B;  1SD7 A;  2V7F A;  4GGG A;  1X19 A;  1XC5 A;  3H9Q A;  2Y2Z A;  5K5Q A;  3U1K A;  4KFC A;  4I0B A;  4NC6 A;  1X1C A;  1PDN C;  4BBR J;  2UV1 A;  2WAQ N;  3I55 I;  1U9N A;  2HVR A;  1FOK A;  4BHB A;  2XSD C;  3PO2 J;  3BR2 A;  2JSP A;  3R61 A;  1YIO A;  2ICW G;  3RDI A;  3JRI A;  5DTD A;  2V1U A;  4IHV A;  2YU3 A;  3I4P A;  3LSI A;  4MTE A;  3T8R A;  1IRX A;  3AL0 B;  1MIJ A;  2JPB A;  1S72 I;  2DCE A;  3EUA A;  4M71 A;  2CW7 A;  3H5R A;  3GZN B;  2ZBK A;  5DCM B;  3TO7 A;  1K78 A;  3ZQG A;  1QNT A;  3BCB A;  1Y1V J;  4NNJ A;  2PG4 A;  1HST A;  1D8J A;  1R00 A;  4IHS A;  1J5Y A;  2DJN A;  3E6B A;  2KIM A;  1XD7 A;  2L9V A;  1FJL A;  5E1Z B;  4CUG A; 
#chains in the Genus database with same CATH homology
 1P4X A;  2DPU A;  3GFL A;  4ZYG A;  1T98 A;  2XRO A;  5BOX A;  1D5V A;  3K1M A;  2EWN A;  4CIC A;  2R7D A;  1PP8 F;  2A68 F;  2ACJ A;  1B9M A;  5D4S A;  4KIB A;  1BI3 A;  5HDN A;  3ERE D;  2H94 A;  4EM0 B;  3C1D A;  3FXU A;  1G3S A;  3JTH A;  5HLI A;  2FBK A;  5FB2 A;  1LJ9 A;  2P5K A;  2FQ3 A;  4QWQ A;  3QOP A;  4EJT A;  3C18 A;  4L9J A;  2FSW A;  1WI9 A;  5J6X A;  4EJO A;  1Z7U A;  3BPX A;  3M8F A;  2HGC A;  2QUF A;  1J2X A;  5J8F A;  5LRS A;  1T0F A;  4HF1 A;  4O5V A;  3HOT A;  3V8L A;  1TW2 A;  1XSV A;  4IPA A;  2EV5 A;  1HSJ A;  3OOP A;  4O3M A;  2QEN A;  4L5I A;  3GW2 A;  3HRM A;  4FHT A;  3ECO A;  3RPU A;  2K4J A;  3ABT A;  1BIB A;  4Y15 A;  1QGP A;  1UHM A;  4KUM A;  4EVI A;  4IRH A;  4OU0 A;  5HLH A;  4S04 A;  3M1E A;  3K9T A;  4IJA A;  1O3T A;  5E1X A;  3IHU A;  3KP3 A;  4HQM A;  1PP7 U;  5ILV A;  5L3G A;  3RKX A;  3W6J B;  3IRR A;  3O6B B;  3F8N A;  4A12 A;  4G94 A;  5L3F A;  2QM3 A;  3H92 A;  3KP6 A;  2RDP A;  1W5T A;  5JVT A;  1ZGA A;  2ZJ2 A;  2HDC A;  1RUO A;  2NRA C;  3DF8 A;  2DQR A;  5DDG A;  2UZK A;  1SD4 A;  1TW3 A;  1KU9 A;  3I59 A;  4L0Y B;  1FYK A;  2Z99 A;  1CF7 A;  3RI4 A;  1AWC A;  2WTE A;  1F1Z A;  4YFX F;  4K2E A;  4GYG A;  1R23 A;  2P5V A;  1MKM A;  5DUI A;  5J8C A;  5ILS A;  5TRD A;  2Y75 A;  2QBY A;  1BJA A;  2O6G E;  3K2Z A;  4OOI A;  1ZRF A;  1B59 A;  2UWM A;  2EFQ A;  1JE8 A;  1BI0 A;  4ZZL A;  4MNU A;  2GZW A;  2R7F A;  4HLX A;  1IXC A;  3FM3 A;  4L9N A;  5K5R A;  4A2U A;  5KVR A;  2H27 A;  4EMS A;  2HOE A;  1TQP A;  3ULQ B;  2RC4 A;  2MBF A;  4HQE A;  5DYM A;  3KLN A;  3DPL C;  4LLN A;  4GYI A;  4I98 B;  1T39 A;  3HRT A;  4L0Z B;  3VEP A;  3CDH A;  3TGN A;  2PQ8 A;  3WU0 A;  4IVN A;  2CO5 A;  2BV6 A;  4WCG A;  2HYF A;  5D6E A;  1FWZ A;  1H9G A;  4LK1 F;  1UFM A;  4UNO A;  4HYE A;  1BBY A;  1IUY A;  3TO9 A;  1OYY A;  2ZO4 A;  5EEG A;  2LNB A;  3GFM A;  2W57 A;  3LFK A;  2FOK A;  3WTY C;  1FZP B;  1YLF A;  1SAX A;  4R79 A;  1IXR C;  1TBX A;  1MJ9 A;  1L3L A;  4KMU X;  1OYI A;  2CSO A;  1T6S A;  4N9I A;  2V1D A;  2L02 A;  3F72 A;  4HAM A;  1RZ4 A;  2ELH A;  1KQ8 A;  4U7D A;  2DT5 A;  5AIP A;  3JW4 A;  1F5T A;  1SFU A;  1S29 A;  1MJA A;  4CDG A;  1LDD A;  5LEJ A;  2OA4 A;  5ICG A;  2FBI A;  1ODD A;  3LWF A;  1HKT A;  1P2F A;  1FX7 A;  3P9K A;  1ZAO A;  1USS A;  5FLX Z;  1XDS A;  1YQA A;  1CF7 B;  2E1C A;  4I09 A;  5FLX K;  2KKO A;  3F8B A;  1JXS A;  2CQK A;  2Z5U A;  4UV9 A;  3BPV A;  2EV6 A;  5L3E A;  4O6J A;  2E7X A;  4FX0 A;  1FP2 A;  5CLS A;  2QBY B;  1LDJ A;  3LQR A;  3VOD A;  4UXN A;  3KET A;  2P5L C;  3T5X A;  2VBY A;  5LGN A;  5HOO A;  1U5T C;  4U88 A;  1XDU A;  3JAM K;  2D2W A;  3GLX A;  1IAW A;  2FA5 A;  5DEQ A;  1Q1H A;  1ULY A;  2XAQ A;  4MQV A;  2G9W A;  4Z2Y A;  3WOD F;  3T0Y A;  2RGV A;  4P5O A;  4M9S A;  2M5W A;  2DBB A;  4A0Z A;  1OKR A;  1U6G A;  1GXQ A;  1E17 A;  3R0J A;  2D1H A;  2ZXJ A;  1J59 A;  3F3X A;  1SMY F;  4ESJ A;  3QU6 A;  4KT5 C;  4P96 A;  1YS7 A;  3WGH A;  2LSO A;  1XGO A;  3MZH A;  4L9V A;  4I02 A;  1WSU A;  1STZ A;  3J80 Z;  1Z6T A;  2V9V A;  2J5P A;  2O61 A;  2DAO A;  1MJB A;  2Z33 A;  4KNY A;  3BJA A;  4BHC A;  4HLY A;  3BJO A;  5ICF A;  4RB3 C;  2OAZ A;  4L18 B;  5FGM A;  1ONV A;  3M7G A;  4AD9 A;  3VFZ A;  2FXA A;  2YSR A;  3WTX C;  3WTZ A;  2BBY A;  3ECH A;  4EJW A;  1LNW A;  1ZRD A;  3HRU A;  4R1H A;  2H6B A;  4KA4 A;  1Z91 A;  3EYY A;  2YR2 A;  2K7L A;  3HRS A;  4Q5S F;  5CJ9 A;  3GF2 A;  3HOS A;  3P9I A;  4PGH A;  5HLG A;  3SHF A;  2K27 A;  4P9U A;  3W6K B;  1BC8 C;  4KIG A;  1KA8 A;  1F9N A;  3RKY A;  2RN7 A;  5H20 A;  4CHU A;  2WWY A;  3IC7 A;  5DD4 A;  3E6D A;  3FHZ A;  4AIJ A;  1G3Y A;  1AOY A;  3QAH A;  1I5Z A;  1I6X A;  3E97 A;  4HV6 A;  5K1Y A;  4JK1 X;  3M8E A;  3JTG A;  3BZ6 A;  3HHG A;  5E20 A;  1X3U A;  1SMT A;  2BGC A;  3BY6 A;  2V79 A;  3TDZ C;  2MD5 A;  4BQA A;  1JHH A;  1SD6 A;  3HIF A;  1H0M A;  3GFJ A;  2KRF A;  3ZP5 A;  1UST A;  1T2K A;  3R6S A;  1BM9 A;  2IA1 A;  2L54 A;  4D0P A;  2YX4 A;  5ERI A;  3ZN1 A;  2VON A;  1FSE A;  4WF2 A;  2VOD A;  2DU9 A;  2P8T A;  1KQ9 A;  4UVB A;  3PQJ A;  2OQR A;  3SXY A;  2LDU A;  1TTY A;  3FX3 A;  1ZGJ A;  5AON A;  2ISZ A;  3V4G A;  2J5O A;  1B1B A;  2A5Y B;  1EV7 A;  3HTS B;  3L7W A;  1WRJ A;  2XHK A;  2H09 A;  2VBX A;  3E5Q A;  5F64 A;  2BEO A;  2OU2 A;  2A3S A;  3OV8 A;  3WTT C;  1TQI A;  4NB5 A;  5CVI A;  5BPI A;  4P9F A;  5HS9 A;  1IN6 A;  2MC3 A;  3V8J A;  1U3E M;  1IW7 F;  4G7Z F;  5FFZ A;  2A6H F;  1OR7 A;  4JBA A;  2JT1 A;  2DI3 A;  1D8K A;  2F5F A;  3I64 A;  1KQ0 A;  2AXL A;  3GUD A;  3C3W A;  1VTN C;  1DP7 P;  4M74 A;  5D8L B;  5LLQ A;  5D6F A;  3FXR A;  1TQM A;  2NNY A;  2GXB A;  5LGT A;  5E18 F;  4WK8 F;  1ZLJ A;  3LAJ A;  3KCC A;  2GIV A;  3LA2 A;  3HSR A;  5LRR A;  4WXH A;  4LB6 B;  3RJP A;  2LF8 A;  4EGZ A;  2XKP A;  1U2W A;  1Z9C A;  4G6Q A;  1YO5 C;  1ZG5 A;  2P6S A;  4M72 A;  4ZH4 F;  3N4M A;  4ENN A;  5L3B A;  5TJJ A;  5L3D A;  4AWX B;  1GVJ A;  4Y13 A;  3ELK A;  4HA8 A;  3I5U A;  1HKS A;  3J80 K;  4G7O F;  3FWE A;  1U5T A;  2IP2 A;  1MZB A;  2D1V A;  3D0S A;  3KP2 A;  1O3R A;  5JI6 A;  1HKQ A;  2EFP A;  1IN5 A;  3F23 A;  3IL2 A;  3H3Z A;  2Z3Y A;  2W24 A;  5CYV A;  1R1T A;  2EFN A;  1XN7 A;  3KE2 A;  2FNA A;  4WWC A;  3QRF F;  1XCB A;  5LHG A;  1Z6R A;  4YIF A;  4LMY A;  4WXC A;  2OBP A;  1FPQ A;  5D5V B;  3KP5 A;  1B4A A;  3G73 A;  4KMF A;  2XAJ A;  3BRO A;  2ZME B;  2NNN A;  1Y0U A;  1E2X A;  3T8T A;  2M87 A;  3HTU A;  1KU2 A;  2FNP A;  4NHJ A;  3WTW C;  3EET A;  5CVJ A;  4EM2 A;  3HUG A;  3TDU C;  2CFX A;  1EH8 A;  2KJC A;  2XAS A;  2KIF A;  1IRF A;  2V6C A;  1XSX A;  5DUK A;  4XLP F;  4LD5 A;  2O03 A;  4CYD A;  4WXD A;  2GWR A;  2NYX A;  5HS7 A;  4KIF A;  4OIQ F;  2BE5 F;  4ZYE A;  2F5E A;  3SQN A;  2PBI A;  3QP6 A;  3RYR A;  3CJN A;  3GWZ A;  4XBF A;  4AVP A;  4RB0 A;  2EFW A;  1O57 A;  2W85 A;  4XRF A;  2L4A A;  1IXS B;  2MH2 A;  3I71 A;  4L5J A;  1ZLK A;  1MD0 A;  3U1D A;  2DK5 A;  3BP8 A;  1SD5 A;  4IXA A;  4U0V A;  3ZN0 A;  1WWX A;  1RI7 A;  2XUB A;  3E3V A;  2B0L A;  3V7R A;  4BHP A;  2FMY A;  3T1B A;  5LGU A;  1R22 A;  3KP4 A;  5DV5 A;  4XLN F;  4B09 A;  4EJU A;  4E70 A;  2VT3 A;  4GXO A;  3I53 A;  2F5C A;  4YII A;  2YPR A;  2NAZ A;  2DO7 A;  2K02 A;  2ETH A;  4UVA A;  2E1N A;  1OYW A;  3KLO A;  3K0L A;  3LQQ A;  4IRG A;  1S6L A;  2IPQ X;  2V1X A;  4A0X A;  5D5X B;  1S7O A;  2JRT A;  1V4R A;  2UXX A;  5CVU A;  2FF4 A;  2PFB A;  1FP1 D;  5ED4 A;  2EA4 A;  1FC3 A;  2H6C A;  1O3S A;  1D3Y A;  3L9F A;  5E1W A;  1BN5 A;  1YTY A;  3KP7 A;  3IKT A;  1A04 A;  1TNS A;  2QQ9 A;  3F6V A;  2DQL A;  2GA1 A;  4M9X A;  3L00 A;  2DPD A;  2XKO A;  4PGG A;  2VT2 A;  2PJP A;  2ZNY A;  2OD5 A;  3FF5 A;  4IRI A;  1YW7 A;  2A69 F;  2NS0 A;  4BYY A;  4HF2 A;  4P55 A;  4WX9 A;  2PMH A;  2HR3 A;  3S2W A;  2PI0 A;  2L4M A;  2QWW A;  3GVA A;  3GO5 A;  1QZY A;  2O0Y A;  3F6O A;  1IZ1 A;  5E17 F;  5IT9 Z;  4ASN A;  4ETS A;  1H9T A;  4RGU A;  3JSO A;  2GAU A;  3CO7 C;  1UB9 A;  1ZHF A;  2P4W A;  4I01 A;  2FEZ A;  5H6Q A;  3F8C A;  2VBW A;  3HSF A;  3MQ0 A;  3Q9V A;  3DKW A;  2QQB A;  1QBJ A;  4M6X A;  1DPU A;  3CUO A;  3I54 A;  5HVQ C;  1ZYR F;  4HF0 A;  4LK0 F;  4HBL A;  3I0T A;  3N97 A;  4UV8 A;  3I59 B;  1MGT A;  1JHF A;  2W25 A;  3KEO A;  4OMZ A;  5LEK A;  5FD5 A;  3COA C;  3ZMV A;  4DQ2 A;  3Q9S A;  2MLG A;  1OPC A;  5HDG A;  3E6C C;  4HV5 A;  2PLY A;  1ZG1 A;  4A5N A;  3O3K A;  2PEX A;  1FBQ A;  2VC0 A;  2O8X A;  4ENK A;  2HKO A;  1UCR A;  1UHW A;  1QPM A;  2M30 A;  4KDP A;  2DTR A;  2A6E F;  3EDP A;  3GEZ A;  4M73 A;  1HQC A;  3ZMZ A;  4HW0 A;  5ICE A;  2M45 A;  1P4A A;  2EB7 A;  1F4K A;  4FT8 A;  3NQO A;  4JQF A;  3WTS C;  4YG2 F;  2G7U A;  4LLL A;  2PMU A;  1XGM A;  2X0L A;  4HOB A;  3CO6 C;  3GXO A;  3V7C A;  2ZNZ A;  5IT3 A;  2GQQ A;  2MH9 A;  1YW8 A;  4TV7 A;  1IN4 A;  4A0Y A;  1RUN A;  2ZFW A;  1R58 A;  2E7W A;  2DLL A;  2QVO A;  1XMK A;  3WGI A;  1R7J A;  1R1U A;  3MAJ A;  3J7A O;  4ZZD A;  1SFE A;  3V7S A;  4L9T A;  4RGX A;  4BXU A;  3I58 A;  3QP5 A;  1BOA A;  1ZRE A;  3KZY A;  1ON2 A;  4U0Y A;  1TNT A;  4QLC U;  5IT9 K;  3F8M A;  3KZZ A;  1HW5 A;  4KN7 X;  1XCV A;  4F7Z A;  4I2O A;  4CZZ A;  2JZY A;  4UVC A;  2HQN A;  3SFZ A;  1U8R A;  1JGS A;  2K86 A;  5CVV A;  4AIH A;  3TO6 A;  2XGX A;  1PUE E;  5D5U B;  1G3W A;  5FO5 A;  3JAM Z;  1B6A A;  2OQG A;  1FBU A;  1XGS A;  2TDX A;  3FM5 A;  1G3T A;  3AAF A;  2RNJ A;  3HHH A;  4GCV A;  1QO0 D;  4MTD A;  2IA0 A;  4Q48 A;  5HS8 A;  2CG4 A;  4G8X A;  4BH9 A;  4ZYH A;  2R3S A;  3F21 A;  1I27 A;  4M6Y A;  1S8N A;  4U7B A;  3RIR A;  2KIU A;  3FZV A;  3E5X A;  4EJV A;  3M9A A;  3KEQ A;  2Y0M A;  1G6N A;  3PFI A;  1W7P D;  4RAY A;  2CGP A;  4UHT A;  2X4H A;  4LGW A;  1G4D A;  1IRG A;  5JHU A;  3O2P E;  1K79 A;  3DXJ F;  2O3F A;  3GFI A;  3E6M A;  5EEH A;  1I1G A;  4A6D A;  4ON0 A;  3U9G A;  4A5M A;  2STW A;  3WTV C;  4Q4Z F;  4PCQ A;  2EJR A;  3J81 Z;  2Y48 A;  1R5H A;  3J81 K;  4N9H A;  2IVM A;  2XAG A;  4HDU A;  1FNN A;  3IRQ A;  2W84 A;  1O7L A;  1ZRC A;  3RYP A;  3F22 A;  3B73 A;  5HDK A;  1R36 A;  1LEB A;  1K78 B;  2HWV A;  2RQP A;  2VOP A;  1QQI A;  4OIN F;  2VE8 A;  3R4K A;  5JFR A;  5F6F A;  4S05 A;  2VOO A;  6PAX A;  2A07 F;  1T38 A;  4I7H A;  5L3C A;  4LG0 B;  3E5U A;  3BJ6 A;  1OMI A;  4LB5 A;  2XAF A;  1J7K A;  4OMY A;  3LA3 A;  3CUQ A;  2L01 A;  3GYH X;  3GX4 X;  1YW9 A;  1CGP A;  3GZ6 A;  2BYV E;  3ROU A;  2CW0 F;  3ZPL A;  4GO1 A;  1KU3 A;  3EQL F;  2Q0O A;  1REP C;  4RB1 A;  3WU1 B;  1QZZ A;  1XGN A;  2AS5 F;  5DD8 A;  4OIP F;  3BDD A;  2G7H A;  2RV8 A;  1ZAR A;  3R0A A;  3ZMU A;  3DEU A;  3ZMD A;  3F8F A;  3LA7 A;  1DPR A;  1IN7 A;  3FMR A;  1HXD A;  3ZMS A;  2VBZ A;  4DNC A;  2K4B A;  4LJZ F;  4KYW A;  1BC7 C;  2FU4 A;  4H0E A;  1L0O C;  4MQ9 F;  1V3F A;  2RVC A;  2STT A;  3WE3 A;  4YFK F;  1XB4 A;  1LDK B;  2OZ6 A;  4RGS A;  2EFO A;  4Q47 A;  1C0W A;  2XVC A;  3PQK A;  3ABU A;  2IRF G;  3RTR A;  3WTU C;  2HYG D;  2GXG A;  2LF7 A;  5A2Q K;  1K6O A;  1KGS A;  2ZME C;  4IF4 A;  3MFK A;  3ZQ7 A;  4HDV A;  2VC1 A;  1BIA A;  2ESN A;  4CGZ A;  2ZKZ A;  3HYI A;  5D5W B;  3IKV A;  3BWG A;  4A6E A;  3MWM A;  3TOB A;  2Z9O A;  2LKP A;  4HX7 A;  2HS5 A;  4XSX F;  1U78 A;  2VXZ A;  4OIO F;  4KIC A;  4XSZ F;  3FMQ A;  3ISP A;  3DV8 A;  3SZP A;  1LB2 A;  2WV0 A;  1W5S A;  1FLI A;  2EK5 A;  4G7H F;  1YFH A;  2XAH A;  2ZCW A;  1KYW A;  2ESH A;  4MHG A;  4LG0 A;  5E8I A;  2VE9 A;  1SFX A;  5D4R A;  2ISY A;  5K5O A;  1HBX G;  2QLZ A;  3QPT A;  3GZ5 A;  5BQT A;  1DUX C;  1MDM A;  4EGY A;  1BI1 A;  5FFX A;  1KYZ A;  3WG9 A;  3WE2 A;  2KJB A;  4PZJ A;  3K1N A;  4MEX F;  2HFH A;  1EH6 A;  4HX8 A;  4N0B A;  1W7P B;  2M1B A;  1GXP A;  1I1S A;  3CLO A;  4AIK A;  3L09 A;  2CWE A;  5LHH A;  4B8X A;  1EH7 A;  2HTJ A;  2FRH A;  2JPC A;  2DK8 A;  3D5L A;  5F1R A;  4OIR F;  3B02 A;  3MZY A;  5BMZ A;  4U0W A;  4PDK A;  4EQQ A;  3REO A;  2QYO A;  3QPH A;  1P6R A;  3FMS A;  4ENJ A;  2JSC A;  1FT9 A;  1J75 A;  3LAP A;  3TQN A;  1LQ1 A;  3TOA A;  2VN2 A;  4G9Y A;  3DFG A;  2HKX A;  2EV0 A;  1ON1 A;  3H3U A;  3U2R A;  1IF1 A;  1R1V A;  1HW1 A;  3LST A;  1O7F A;  5D8K B;  2XIG A;  2FBH A;  1WQ2 A;  5BPD A;  2HQR A;  2JTV A;  2F2E A;  1YS6 A;  2CYY A;  1XSD A;  1S3J A;  3JSP A;  3DPT A;  3MEX A;  5BS6 A;  4ESB A;  1LEA A;  1P92 A;  2A61 A;  2ADU A;  1P4W A;  4M9Z A;  1Z1D A;  4BAY A;  1K7A A;  4RGR A;  4LFU A;  5DCF A;  4NQW A;  2DW4 A;  1HW2 A;  2IA2 A;  3CUQ C;  2MLK A;  4CO8 A;  4RAZ A;  4MEY F;  3K1P A;  2M8E A;  3NRV A;  3K69 A;  2GA2 A;  1Z05 A;  2OZU A;  3CUQ B;  3KFW X;  4EM1 A;  1WKM A;  3DQV C;  1R5G A;  2HZT A;  5JR3 A;  3ZMT A;  1RIO H;  1YYV A;  1FSH A;  2D45 A;  1BI2 A;  3FXQ A;  4CXF A;  1DDN A;  2FE3 A;  5KK1 A;  2DFI A;  4UUV A;  2XRN A;  5LHI A;  2YX7 A;  2XV4 S;  5DCM A;  1B9N A;  3NEU A;  3WGG A;  3EUH A;  2Q8K A;  2RKH A;  1IN8 A;  2C6Y A;  2P6T A;  1FYL A;  2HEO A;  3SZT A;  5E8G A;  2EA2 A;  4KN4 X;  1RNL A;  3Q5F A;  1O3Q A;  4ESF A;  2HTS A;  5FD6 A;  4G6D A;  5ILU A;  2Q2E A;  4BNC A;  2P7C B;  5A2Q Z;  3HSE A;  5LBQ A;  1FBS A;  4HX4 A;  1YG2 A;  1U5T B;  4RB2 C;  2COM A;  4R8H A;  1FYM A;  3RPQ A;  2F5D A;  3P9C A;  1S7A A;  3C7J A;  2IJL A;  3P7N A;  4IHT A;  2P7V B;  4ENM A;  3RKW A;  4MGR A;  3TKY A;  1J9I A;  3R60 A;  3MCZ A;  4LLG F;  5AIQ A;  4FX4 A;  1W4M A;  4EV0 A;  1KU7 A;  3ML6 A;  2QZ8 A;  2L3D A;  2IW5 A;  3IWZ A;  3BOQ A;  2PN6 A;  3G3Z A;  1ZH5 A;  3DP7 A;  1TLH B;  3L2C A;  2ZME A;  5ICC A;  3VB2 A;  2QQA A;  1XMA A;  1ZG3 A;  1NHA A;  1ZN2 A;  2MA3 A;  1LVA A;  2UXN A;  4Y17 A;  2IT0 A;  5CVR A;  3QU3 A;  4RS8 A;  4ZYD A;  1GHC A;  3VOE A;  4I0A A;  1MDM B;  3IWF A;  2FML A;  5H6R A;  4YFN F;  2WC2 A;  3CTA A;  4HZF A;  3EYI A;  3V8K A;  1FY7 A;  1J0R A;  1W7P A;  1SD7 A;  4GGG A;  5K5Q A;  4KFC A;  4I0B A;  1PDN C;  1FOK A;  4BHB A;  3R61 A;  2V1U A;  1YIO A;  3RDI A;  2YU3 A;  3I4P A;  4MTE A;  3T8R A;  2JPB A;  1K78 A;  4M71 A;  5DCM B;  3TO7 A;  2ZBK A;  1QNT A;  2PG4 A;  1HST A;  1D8J A;  1R00 A;  4IHS A;  1J5Y A;  3E6B A;  2KIM A;  1XD7 A;  5E1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...