3CUQC

Integrated structural and functional model of the human escrt-ii complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
173
Chain Sequence
SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
total genus 46
structure length 173
sequence length 173
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 3cuqC01
1O57A 2O03A 2ZCWA 3I54A 1G3YA 3IC7A 1USSA 1Z7UA 1G4DA 2Q2EA 1FOKA 2ZKZA 1SD7A 1G3TA 4PGHA 1RUOA 5F64A 3R0AA 1BC8C 1KU3A 1GVJA 5K5RA 3QAHA 5J6XA 1B6AA 1J9IA 3MWMA 4IRHA 3GXOA 3GUDA 3HRUA 3Q5FA 1LJ9A 5DUIA 2FQ3A 4FX4A 5H20A 1TW2A 2UXNA 2FBHA 1I5ZA 1YYVA 4EGYA 1D3YA 2JSCA 2MBFA 2CYYA 2MLKA 1SAXA 2ELHA 3KZYA 3PQJA 2QQAA 1XMKA 2QQBA 2VBYA 1AWCA 1W4MA 4UHTA 2LF8A 3WE2A 3KP3A 1ZG5A 1LVAA 3VODA 1V3FA 3BJ6A 4MHGA 1W7PA 2M30A 1YIOA 5LGNA 2V1UA 4HBLA 3HHHA 4B8XA 2COMA 4O3MA 4HX4A 4I09A 1QZZA 4G7HF 2IA2A 1EV7A 2DTRA 4KIBA 3M7GA 4KT5C 4CO8A 4RB3C 3JTGA 5HOOA 1HW2A 2J5OA 2VXZA 2ACJA 4LGWA 2DAOA 3CLOA 1ON1A 2HZTA 3DP7A 1R23A 2XAFA 2V1XA 2O8XA 1T0FA 3NEUA 3K0LA 3KP5A 4CZZA 1J75A 4EMSA 5TRDA 2DW4A 4Y17A 3OV8A 3QU6A 3K1MA 1S3JA 3M9AA 3WTSC 3ISPA 2ZBKA 4MQ9F 3SXYA 3LAPA 5ILUA 4L0ZB 5EEGA 4EM0B 2NAZA 2XAHA 3P7NA 4HDVA 3JSOA 2O3FA 3JTHA 4I0BA 2KRFA 2M45A 5LRRA 3HSRA 5L3EA 2F2EA 4RB2C 1L3LA 4MTDA 3ZMDA 1U5TB 1HSTA 3EQLF 4EV0A 1FNNA 4R1HA 3DF8A 3V7SA 3MFKA 1Z6RA 1U5TA 3ZMUA 4HV6A 4GO1A 2AXLA 1J2XA 3V8JA 4CDGA 5HLIA 1YLFA 4LB6B 2CFXA 2RV8A 4RGUA 3SFZA 5FFXA 3BJAA 1YW9A 3FXQA 1BI2A 2F5EA 3AAFA 1IXCA 4I7HA 2OU2A 2EFPA 1XGOA 2K7LA 4HF0A 2VBZA 2ZO4A 3V7CA 2DI3A 1LNWA 2IPQX 2ZJ2A 3L9FA 2IW5A 1YS7A 1WKMA 5KK1A 3WU0A 4F7ZA 1IRFA 5D5UB 2NS0A 3BP8A 4HX7A 5JI6A 3BZ6A 2A3SA 2ZXJA 4IF4A 3LA2A 1FP2A 5FO5A 2HKXA 3F23A 2RDPA 1XSDA 3BPXA 3TO9A 1WRJA 1B4AA 3ERED 5JHUA 4O6JA 2QBYB 4L5IA 2Q0OA 2UZKA 3KLOA 1F9NA 3ZMZA 3JSPA 2JRTA 3CUOA 1SMYF 4UUVA 3M8EA 2CO5A 1ZN2A 4U88A 2DQLA 4M74A 1R5HA 1YQAA 4A5MA 5BPIA 1TNSA 2FU4A 3V8LA 1KU9A 2K02A 3TO7A 2LKPA 3QRFF 4LG0A 2RKHA 1TNTA 2HEOA 3MZHA 1Z05A 2NNNA 5CYVA 2OQGA 4A12A 4BNCA 3IRRA 2FRHA 2W57A 1JGSA 3GF2A 3ZMVA 3QPHA 4IXAA 5DDGA 3DPLC 3QU3A 3RKXA 4IJAA 4CXFA 4NHJA 1G3SA 4ESJA 1JHHA 1FYKA 2QQ9A 4WXCA 1BM9A 3SHFA 4UVBA 2HYFA 1FLIA 4XLNF 5D6EA 5LGUA 1WI9A 4KUMA 3TGNA 1RIOH 4WWCA 5E18F 1IF1A 4KIFA 3KCCA 2G9WA 1SFXA 2PBIA 3R61A 1KU2A 3WTWC 3EETA 3G73A 1SD6A 2V9VA 4NQWA 4ZYEA 4HDUA 1YFHA 2PQ8A 2WTEA 4BHCA 4P9UA 1K78B 3G3ZA 3ZN0A 4PGGA 1P4WA 1USTA 1QBJA 4QWQA 3JAMZ 3H92A 2V1DA 4KNYA 3C7JA 1FWZA 2XGXA 2PEXA 2ZNZA 1FT9A 3K1PA 3SQNA 4HLYA 3KP2A 5CJ9A 1ZH5A 4M73A 1LB2A 2Z3YA 2RN7A 1T2KA 4HQEA 3LA7A 3F8FA 3KP6A 2QZ8A 3ECOA 2CGPA 1X3UA 3ML6A 4PDKA 2IA0A 5HVQC 1LEBA 2RNJA 4RB0A 2EFWA 3ELKA 1U2WA 3WTUC 2HOEA 4O5VA 3GVAA 4G6DA 5A2QZ 1MDMA 4ZZLA 2EB7A 1YO5C 2HTJA 2AS5F 3LFKA 4GXOA 3R60A 2Z99A 1JHFA 3SZTA 5D4RA 5L3FA 1R1TA 2NNYA 4LLNA 1DP7P 1U6GA 5DCMB 3EDPA 2O61A 5BQTA 2PJPA 3K69A 5ICCA 5IT9K 4A2UA 5ERIA 1OYYA 3LWFA 1G6NA 1HBXG 2IJLA 2HFHA 2GZWA 2W25A 3I59A 2EK5A 4XRFA 2E1NA 4MGRA 1C0WA 4Q4ZF 3VEPA 3W6JB 3HSFA 3ROUA 3DKWA 1MKMA 3O2PE 4FT8A 4RGRA 4UV9A 3REOA 3CTAA 4OMZA 3LA3A 4YFNF 1S7AA 1NHAA 5ILSA 3GO5A 1IXSB 1ULYA 4OINF 3RIRA 4ZZDA 3PFIA 2VBWA 4H0EA 2C6YA 2Y48A 2UWMA 3J81K 2P5VA 4EJUA 4I01A 5JVTA 3FM5A 2FEZA 1AOYA 1QO0D 2Q8KA 5HS7A 2ZMEA 3MCZA 2A6HF 2LSOA 1RZ4A 1KYWA 3IHUA 3RDIA 4KA4A 4I02A 5HS8A 3U2RA 4P5OA 3DXJF 2EV5A 3H3UA 1BIBA 5IT3A 1W7PB 3R4KA 3I58A 1ZRDA 4L9VA 2V6CA 1XGSA 1R1VA 1MJAA 1B9MA 3QPTA 2Z5UA 4ENMA 2FMLA 3BROA 3M1EA 2FMYA 3KFWX 5FLXZ 4K2EA 4A5NA 2OAZA 3IKVA 2HDCA 3WTXC 4Y15A 1YW7A 5LEKA 3RPUA 4IHSA 4KDPA 5FFZA 3GFLA 2DBBA 3KE2A 1YG2A 4Z2YA 2VBXA 2PN6A 1P4AA 2WV0A 4BH9A 4EJTA 1DUXC 2O0YA 2OA4A 4P55A 1R1UA 4EM2A 4RB1A 4S04A 2DPDA 4BXUA 1S6LA 4A0YA 3DFGA 2X0LA 3WGHA 1ZHFA 1E17A 2W24A 3T5XA 1S7OA 2KJCA 2HQRA 1R58A 1IRGA 2G7UA 4WCGA 2L4MA 4R8HA 3WTZA 4QLCU 1BC7C 3GZ5A 1ONVA 1DPUA 1SFEA 3FMRA 1P2FA 2CSOA 1PDNC 3WTVC 2EFQA 2F5DA 1PP8F 3QP5A 1GHCA 2E7WA 1QPMA 4EJOA 4M72A 2VE9A 1U3EM 1W7PD 1KGSA 2D45A 4U7DA 4HF2A 1Q1HA 2QYOA 5HDNA 4OU0A 1WWXA 1H9TA 3LAJA 1LDJA 5HDGA 4JK1X 3COAC 4KIGA 1PP7U 4OIPF 1T98A 1G3WA 1MD0A 5CVRA 1TQPA 5ICEA 1PUEE 3FM3A 4L9TA 1O7LA 5ED4A 1T38A 2GA2A 3F8BA 2BYVE 3I59B 2FSWA 4LK1F 2HYGD 2J5PA 4CGZA 4RS8A 1IN8A 2BEOA 1ZG1A 1FC3A 2R7DA 3O6BB 1XGMA 3CO7C 3Q9SA 4HZFA 1FPQA 3HRTA 2HKOA 2DT5A 3HOTA 2XASA 5DCMA 5D5VB 3WTTC 2E1CA 1O3RA 4IPAA 2QENA 5L3GA 4Q48A 2KIUA 3F3XA 1JXSA 3KP4A 1FYMA 1FYLA 2EFNA 4M6XA 1R22A 5HLGA 1OR7A 1QGPA 4AIHA 3E5UA 5CVIA 1K6OA 4KFCA 2FA5A 2W85A 4N9IA 1KA8A 2OBPA 4LB5A 3T0YA 1J7KA 4TV7A 3IL2A 5F6FA 3GEZA 4YIFA 3M8FA 1ZLJA 2RVCA 5D6FA 3T8TA 5BPDA 3F6OA 2ADUA 3V8KA 3N4MA 4WX9A 2D2WA 4AWXB 1ON2A 5H6QA 2FF4A 4XSXF 2VOOA 4RGXA 1OYWA 4A0XA 4EVIA 1ZARA 4IRGA 1FY7A 4KN7X 2R7FA 1MJBA 4M71A 2PG4A 2VONA 3CO6C 5L3BA 2KIMA 2Y0MA 2DQRA 1MDMB 1TQMA 1KYZA 4G8XA 4S05A 4ZYHA 4ZYGA 4EM1A 5HS9A 1LDKB 3F21A 2QUFA 2M87A 2IP2A 1MJ9A 2XRNA 5ILVA 5D8LB 1Z1DA 4ASNA 4ENNA 2GQQA 1KQ0A 3HRSA 3L7WA 3GFMA 3HOSA 2NRAC 4OIQF 4OIRF 3F8MA 2K86A 1T39A 5TJJA 4EQQA 5LEJA 4HQMA 3BPVA 1FX7A 4OIOF 5BS6A 3D0SA 2H6CA 4LJZF 4CHUA 2A6EF 1OKRA 4LK0F 3SZPA 3IRQA 2IVMA 4EJVA 2JTVA 2CG4A 2L02A 3FX3A 2MH2A 3E5QA 2EA2A 2HR3A 2FXAA 2XKPA 1I1GA 5LHIA 2ZMEC 5FLXK 2XAJA 2M1BA 4UVCA 4MNUA 2L01A 3ABUA 1F1ZA 2H09A 4DNCA 3L09A 3J80K 1ZRCA 5F1RA 4ENJA 4LLLA 1HKSA 1RNLA 5LHHA 4BYYA 3MAJA 2QBYA 1ODDA 1U5TC 3DEUA 5JFRA 1YW8A 4BHBA 4MEYF 1R5GA 1LQ1A 1HW5A 1HQCA 5K5OA 2A07F 2VT2A 3BDDA 3GFJA 5DD8A 2FBIA 5D5WB 4A0ZA 1HKTA 5D5XB 2CW0F 4LG0B 2D1HA 3ZN1A 5CVVA 3E6CC 3JW4A 4HYEA 3I4PA 1HSJA 2JT1A 3DQVC 2LF7A 4IRIA 2O6GE 3K9TA 4RAZA 3I53A 2FNAA 1J5YA 4I0AA 2YPRA 2ZMEB 4YG2F 3E6MA 1MGTA 2H6BA 3MZYA 1FBSA 2KKOA 3KLNA 1W5TA 5E20A 2VC0A 2ETHA 2CWEA 2A69F 2BBYA 5LHGA 1BOAA 3TDUC 3TOAA 3BWGA 5E8IA 4E70A 3DV8A 1K79A 5CVUA 1Z9CA 4ZH4F 1ZG3A 1IN4A 3RI4A 4M6YA 2P8TA 3TO6A 3OOPA 3ZPLA 1DPRA 4RGSA 2H27A 1BIAA 5BOXA 1IUYA 2G7HA 5AIPA 3ZMTA 1S8NA 1TLHB 5K5QA 4A6EA 2EFOA 3TQNA 1XDSA 3LQRA 4GYGA 1U8RA 5E17F 1TBXA 3F6VA 1RUNA 1K7AA 2BE5F 4ESFA 3C1DA 2LDUA 3C3WA 5J8FA 4XBFA 3C18A 4M9SA 2XKOA 4U0YA 3NRVA 1OYIA 3KEQA 1YS6A 2GWRA 5LLQA 3HSEA 4PZJA 2P5LC 1O3TA 4BHPA 5HLHA 2WWYA 3E5XA 1ZGAA 1WSUA 2BGCA 2L4AA 1IN5A 1MZBA 5E1WA 4G9YA 2PI0A 1B59A 2L54A 1ZYRF 2HS5A 4NB5A 1Z6TA 2GXGA 4L18B 3L00A 5DD4A 4AIJA 3LQQA 3U9GA 3FMQA 4ETSA 4HAMA 3TDZC 3DPTA 1D8JA 2STWA 3RKYA 3CUQC 3E6DA 4FX0A 2GXBA 2XHKA 4YFXF 1LEAA 3FXUA 2FE3A 2JPBA 4RAYA 3BJOA 3RPQA 1IW7F 4G94A 3B73A 2B0LA 1Y0UA 3F8CA 4HX8A 1R00A 5DYMA 1FBUA 3WGIA 5K1YA 3WU1B 2STTA 1HXDA 2IA1A 2A68F 2QVOA 1IN6A 4AIKA 5D8KB 3CDHA 4XSZF 1HKQA 1XN7A 1OMIA 3RKWA 1YTYA 4G7OF 1L0OC 2VOPA 2HGCA 5FGMA 3BY6A 3HTSB 1ZRFA 2EV0A 1CF7A 4LFUA 1ZAOA 4UV8A 3FMSA 3WG9A 3E6BA 2TDXA 2F5FA 3GX4X 1B1BA 3RYRA 1JE8A 3K1NA 1D8KA 4HW0A 4PCQA 4JBAA 1TQIA 2RC4A 2XIGA 1DDNA 2MC3A 3VB2A 2DPUA 2Y75A 3KETA 1F5TA 2W84A 1FP1D 3V7RA 2FNPA 3T1BA 3GYHX 2JZYA 3RJPA 2YR2A 1R7JA 3HIFA 2DO7A 2XROA 1SFUA 3GZ6A 1SMTA 1GXQA 4UXNA 5L3CA 2VE8A 4U0VA 3ZQ7A 5CLSA 2M8EA 3B02A 1P6RA 3MEXA 2XVCA 3GWZA 3IWFA 2NYXA 2KJBA 5DEQA 2DK8A 4CICA 2GIVA 3ECHA 4LMYA 2F5CA 5FB2A 2OZ6A 2P6SA 3TOBA 1IZ1A 2LNBA 3FXRA 4ON0A 4L9NA 4GGGA 5LBQA 2ISZA 4BQAA 3J81Z 5A2QK 3I0TA 2K4JA 4G7ZF 3GW2A 2E7XA 4UNOA 2PFBA 3ZP5A 3K2ZA 2GAUA 2CQKA 4FHTA 5JR3A 1TTYA 4DQ2A 2EJRA 2ESNA 2P6TA 4R79A 3F8NA 3E3VA 3I5UA 5E8GA 4IVNA 3KZZA 4U7BA 5H6RA 4BAYA 4KMFA 1KQ9A 2A61A 2VC1A 3EYYA 1BI3A 1IXRC 4A6DA 1W5SA 4HLXA 4WF2A 2FBKA 1J59A 3E97A 5KVRA 1BI0A 2QWWA 2YX4A 4D0PA 5DUKA 3N97A 2KIFA 5DCFA 4AD9A 1IN7A 2ISYA 4HF1A 5IT9Z 5DV5A 3WTYC 4MTEA 1BBYA 1A04A 4EJWA 2H94A 1T6SA 3FZVA 1P92A 1XCBA 2QLZA 2D1VA 4P96A 3D5LA 3GLXA 3ULQB 5J8CA 5L3DA 2MH9A 1WQ2A 3ABTA 4JQFA 1O3QA 3FWEA 3CJNA 2ZNYA 1FSEA 4I2OA 1OPCA 3FF5A 1KQ8A 4M9ZA 3EUHA 1H9GA 2DFIA 1H0MA 3PQKA 4Q47A 1E2XA 2RQPA 1I6XA 4EGZA 2YSRA 4N0BA 1IAWA 2DLLA 2IRFG 2DK5A 2RGVA 4IHTA 3Q9VA 5FD5A 2PMUA 2GA1A 5CVJA 1UHWA 1UCRA 2MA3A 1P4XA 2VN2A 3VOEA 1UFMA 2XAGA 1QZYA 1STZA 4WXDA 4N9HA 1GXPA 6PAXA 4I98B 4OOIA 1BI1A 5AIQA 1B9NA 1SD5A 2YU3A 5LGTA 2WC2A 4MQVA 1XGNA 1CF7B 2YX7A 2P4WA 3VFZA 2PMHA 1F4KA 1XMAA 2K27A 2ESHA 4KN4X 3F72A 1I27A 1ZREA 4UVAA 3L2CA 3P9CA 3LSTA 4CYDA 2OZUA 4ENKA 3KEOA 3R0JA 3W6KB 3I64A 3HHGA 2A5YB 1U78A 5HDKA 1UHMA 5LRSA 4B09A 3WGGA 1CGPA 2OD5A 3R6SA 2HQNA 2DU9A 4YFKF 3RTRA 1KU7A 2XV4S 5ICFA 1I1SA 2VT3A 2X4HA 1VTNC 4YIIA 2IT0A 2EA4A 1FSHA 4GCVA 4KYWA 1TW3A 2XAQA 3HYIA 1UB9A 3O3KA 3CUQA 1QNTA 1RI7A 3IKTA 3V4GA 1Z91A 2HTSA 2M5WA 3EYIA 4GYIA 3S2WA 1ZLKA 4HA8A 2OQRA 2QM3A 2K4BA 3QP6A 1LDDA 2V79A 3RYPA 3WE3A 2MLGA 5AONA 1D5VA 1XB4A 2Z9OA 4OMYA 3F22A 4LLGF 4LD5A 3J80Z 2MD5A 1XSXA 2ZFWA 4Y13A 1ZGJA 3P9KA 1R36A 4L5JA 2EV6A 2UXXA 2P5KA 5BMZA 3MQ0A 1HW1A 4G6QA 5ICGA 4L0YB 4ESBA 4U0WA 4Q5SF 1XDUA 1BJAA 1XSVA 5EEHA 2P7CB 4L9JA 1SD4A 3HTUA 5D4SA 2XUBA 4AVPA 3NQOA 2VODA 1O3SA 1EH6A 3KP7A 3FHZA 3HUGA 2P7VB 5FD6A 1EH7A 3J7AO 2R3SA 3P9IA 3GFIA 1BN5A 1V4RA 1XCVA 3I71A 3U1DA 4XLPF 4WK8F 4WXHA 3BOQA 1XD7A 1FZPB 1S29A 1O7FA 1J0RA 5E1XA 2EWNA 2HWVA 2BV6A 4ZYDA 4M9XA 4KMUX 3H3ZA 3T8RA 3ZMSA 4KICA 3QOPA 2L3DA 4MEXF 4HV5A 2Z33A 1EH8A 1FBQA 2JPCA 3JAMK 4P9FA 2PLYA 1QQIA 3CUQB 3TKYA 5E1ZB 4HOBA 3IWZA 3WODF 3HRMA 1REPC 2FOKA 1K78A
chains in the Genus database with same CATH superfamily
1O57A 2O03A 1ETQA 2ZCWA 3I54A 2O5RA 5LD2C 1G3YA 3OR1C 2VL8A 3IC7A 4E7ZA 1A36A 1HOMA 1USSA 1Z7UA 1JT6A 4V2GA 1G4DA 2Q2EA 1FOKA 2BY1A 2ZKZA 4BACA 1KONA 2DJIA 2M8GX 1EKEA 2XF7A 4PJMA 1SD7A 1U8BA 1G3TA 3Q0VA 2JSPA 2GIZA 1VQ7I 4PGHA 4NDLA 4BBRJ 1MNMC 3OYFA 5C44J 1RUOA 4N4NB 5F64A 2R7WA 2R5ZB 3BR5A 2KL4A 1X4PA 3A0BC 3O8HA 3R0AA 1BC8C 1KU3A 3K4LA 2KZGA 1GVJA 5K5RA 3QAHA 5J6XA 1FJLA 1B6AA 1J9IA 2ZSHB 3MWMA 4C3JJ 4IRHA 3GXOA 3GUDA 3HRUA 3Q5FA 5B5EC 1LJ9A 1WPKA 2E2HJ 4CCLA 5DUIA 2FQ3A 1R4NB 4FX4A 1OR7C 1ORKA 3DEEA 3F9KA 1TWGJ 4Y4RA 5H20A 1TW2A 2UXNA 2OCCH 5J1UA 4MFDA 4M3DA 2FBHA 1I5ZA 1YYVA 2MD0A 4EGYA 1D3YA 2JSCA 2XF5A 2MBFA 2CYYA 2MLKA 2KDOA 1SAXA 2ELHA 2FJ1A 3CC4I 3KZYA 3PQJA 2QQAA 1XMKA 2HQAA 3ZRGA 4X0GA 1S9HA 2LY9A 2QQBA 5EGOA 2VBYA 1RR8C 1AWCA 1W4MA 4DGWB 2EZLA 5FROA 3G4SI 2OC6A 4UHTA 1T0FC 2LF8A 3WE2A 3KP3A 3F0CA 5JLXA 1ZG5A 5M3FJ 1LVAA 2LREA 3J7YJ 3VODA 1V3FA 2Y2ZA 3BJ6A 4MHGA 1W7PA 2M30A 1YIOA 5LGNA 1WJEA 3D1NI 1GUUA 2V1UA 1X3ZB 1U9NA 4HBLA 3HHHA 1IG7A 3CC2I 2JK3A 4B8XA 3LL7A 2EINH 4XMYA 2COMA 4I99C 2R7RA 1JKRC 4O3MA 4HX4A 1R49A 4I09A 1QZZA 2TRTA 4KISA 1VQ6I 4G7HF 2IA2A 3S16J 2LR8A 1EV7A 2DTRA 3JRCA 1FMWA 4KIBA 3M7GA 4KT5C 1JKOC 3TP3A 4CO8A 4DIQA 4Y7NJ 4RB3C 3JTGA 5HOOA 1SAUA 1HW2A 3CCRI 3JRFA 2J5OA 2VXZA 4HSRA 2ACJA 4LGWA 3G6EI 2DAOA 4BE0A 2CV0A 3CLOA 2R5ZA 1ON1A 2HZTA 3DP7A 1R23A 1W36C 2XAFA 4A93J 2V1XA 3DWLE 2O8XA 1T0FA 5B1BH 3NEUA 3HKZN 3K0LA 3PUFA 3QYFA 3KP5A 2CQQA 4ZDLA 4CZZA 4EMSA 1J75A 4BXXJ 1K4SA 2CUEA 5TRDA 2DW4A 4Y17A 1NG6A 2AHQA 3OV8A 3HBLA 5IOZA 1SC7A 3QU6A 3H9GA 1MMGA 2QSFX 3K1MA 1EF4A 1S3JA 3M9AA 3WTSC 3ISPA 2ZBKA 4MQ9F 3SXYA 2VQGA 2CV2A 2X48A 3LAPA 5ILUA 2I5UA 4L0ZB 5EEGA 4EM0B 3H5AA 2NAZA 2XAHA 2CQXA 5GPAA 4UY8I 3CESA 3P7NA 3OL4A 2BVLA 2HOAA 3S15J 3LSHA 4HDVA 1D1AA 2ME6A 2EBIA 2X1CA 3JSOA 2M3AA 2O3FA 4U87A 3JTHA 4XLEA 1YIJI 4I0BA 2KRFA 2WV1A 3HM5A 1E3HA 1MBEA 2DMQA 4AC0A 5M3MJ 2M45A 1DGWY 4DOZA 2LYCA 5LRRA 1P7IA 3HSRA 2F4IA 5L3EA 3H1CA 5FLMJ 2OTJI 4RM2A 2F2EA 4RB2C 1L3LA 2A6TA 3ZMDA 4MTDA 4LITA 3SJMA 2F6CA 1U5TB 1HSTA 1X1PA 3EQLF 4QIWN 3JRDA 4EV0A 3DU6A 1FNNA 3ZGKA 3MMYB 1M1EB 4R1HA 3DF8A 5E79C 1ETOA 5E3NA 2F5VA 2PMZA 2L7MP 3V7SA 1AU7A 3MFKA 2E71A 4EEFG 1Z6RA 4BJ6C 1U5TA 3ZMUA 4HV6A 2IS6A 4GO1A 2AXLA 1J2XA 3V8JA 1TC3C 2X1DA 1GDTA 1ITYA 4CDGA 3IP4B 5FKKA 5HLIA 1UELB 2JRMA 1YLFA 4LB6B 3OR2C 1FIPA 1XS9A 2CFXA 1MBHA 2RV8A 3BR6A 4RGUA 3SFZA 5FFXA 3BJAA 1I3QJ 5IOYA 2R4GA 1YW9A 4BJTA 3FXQA 4XM3A 2BY3A 2GBYA 1BI2A 4FTHA 2F5EA 1QU3A 2L9SA 3AG3H 3AAFA 2EZIA 2E60A 3LMMA 3NAUA 1IXCA 4I7HA 3ABMH 4IQ4A 3HUGB 1VFCA 3CF2A 2Y9ZA 1X1BA 2OU2A 2EFPA 1OCZH 2QQ8A 3ZQGA 4P1WA 2H8WA 1XGOA 1IV6A 4X6AJ 4PJNA 1WHUA 4M3EA 3OYAA 1Y0NA 2K7LA 1IV8A 4HF0A 2V9PA 2VBZA 2ZO4A 3V7CA 2DI3A 1LNWA 2WAEA 2IPQX 2WA0A 2ZJ2A 2Y0SA 3H35A 3L9FA 1VI0A 2IW5A 1YS7A 3BZCA 5GAHJ 1WKMA 3K4BA 5KK1A 5E3LA 3WU0A 4B47A 2DYRH 4F7ZA 1VF9A 3HOVJ 5FJ8J 1IRFA 1BR1A 4MO7A 5D5UB 5K7ZA 2LBFB 2NS0A 3BP8A 4QPOA 4HX7A 2R7TA 4A3LJ 1MMAA 2AQFA 5JI6A 3BZ6A 2R7QA 4JX4A 2A3SA 2ZXJA 4UB6C 3I4MJ 4IF4A 3OYHA 4BUPA 3OYKA 3LA2A 2KDZA 3S3MA 1FP2A 3DPUA 1LFPA 5FO5A 1B72A 2HKXA 3OYDA 3F23A 2RDPA 1MBJA 1XSDA 3K6GA 3BPXA 3TO9A 1WRJA 1B4AA 1PUFA 3ESWB 3ERED 5JHUA 3OSGA 4O6JA 2QBYB 1QZEA 3CP8A 4L5IA 2Q0OA 2K3FA 2UZKA 3KLOA 1F9NA 3ZMZA 3VYTB 3GTMJ 3JSPA 2JRTA 3CUOA 3PSFA 4FE4A 2JVHA 2LP0A 2XRLA 1SMYF 4JX5A 4UUVA 2LLKA 3M8EA 1X1CA 3GTQJ 2CO5A 1ZN2A 4U88A 2L9VA 2ID6A 2DXIA 1YJWI 3G71I 2DQLA 4M74A 1R5HA 1QA6A 1YQAA 1QRYA 4A5MA 3A0HC 5FLVA 3Q0WA 5BPIA 1TNSA 2FU4A 2JUGA 3OY9A 3V8LA 1KU9A 3LSJA 2HOTA 2K02A 4M6VA 2WADA 3CJQB 3TO7A 4KJZA 2GM4A 2LKPA 2MSYA 3I4NJ 1OFCX 3QRFF 3FBNB 3OS1A 1HLVA 4LG0A 1B8IB 3MVPA 2RKHA 3GZNB 4OAZA 4XL9A 1TNTA 4YIRX 2HEOA 3MZHA 1Z05A 2NNNA 2YUSA 2HXIA 2DFEA 2JA6J 1BR4A 1Y39A 4D5CA 3FHNA 5CYVA 2OQGA 2XPUA 4A12A 1A31A 3I3LA 2NVXJ 2OF7A 4NUBA 4BNCA 3IRRA 2FRHA 2R5YA 2W57A 1JGSA 3KYCB 1G59A 3GF2A 2IS1A 3ZMVA 4B43A 4B3XA 2F4OB 2IBDA 4UB8C 1MNDA 3QPHA 4D7MA 4IXAA 5DDGA 3DPLC 3QU3A 2HZDA 3LSIA 3RKXA 4IJAA 4Z6YA 4CXFA 1W36D 2XSDC 4D5FA 4NHJA 2E5ZA 1G3SA 1QHHD 5DM7F 1A6QA 4ESJA 1JHHA 1ERDA 3FK7A 1FYKA 2QQ9A 4WXCA 1BM9A 3SHFA 4UVBA 2HYFA 1FLIA 4XLNF 5GTHC 1MH3A 4A3CJ 2UUZA 5D6EA 2BHYA 2JQ7A 5LGUA 1WI9A 4KUMA 4QTRA 3TGNA 2FD5A 1RIOH 2H1KA 4WWCA 1JTYA 5E18F 1IF1A 4KIFA 2E2JJ 2VKDA 3FDYA 4XKWA 3WHCA 2DYSH 3KCCA 3TP0A 2G9WA 1SFXA 2PBIA 3R61A 1KU2A 3DLAA 3WTWC 3EETA 3G73A 2PMZN 1SD6A 2V9VA 4NQWA 4ZYEA 4HDUA 1A35A 1YFHA 1MMSA 2PQ8A 2Q2EB 2WTEA 1V54H 3BG5A 4BHCA 4P9UA 1OCTC 3OIOA 4BDYA 2NOJB 1T08B 2DA2A 1K78B 3G3ZA 4EATA 3IAS2 3ZN0A 4PGGA 1P4WA 1USTA 2M9HA 1QBJA 3S14J 4QWQA 3JAMZ 3H92A 1RPWA 2GOMA 2V1DA 4LOCA 4KNYA 2QSHX 3PNYA 3C7JA 3FXMA 1FWZA 3ZR8X 2XGXA 2PEXA 1TZLA 3CD6I 2PJRA 2KFDA 2ZNZA 2H8RA 1FT9A 2O7OA 1BW5A 3K1PA 1RKTA 3SQNA 4HLYA 1R71A 5E3OA 3KP2A 1XPXA 3OWTA 2JA2A 5CJ9A 1ZH5A 3CZ6A 5KAIC 4M73A 1LB2A 2Z3YA 5GP9A 3FKJA 3BCBA 3KEYA 1PUFB 2RN7A 2DOAA 1T2KA 1Z67A 2VQCA 4HQEA 3OYIA 1XTAA 3LA7A 3F8FA 3KP6A 1YJ9I 2QZ8A 3ECOA 2CGPA 1X3UA 3ML6A 4PDKA 2QA4I 4XICA 2IA0A 4ANJA 2FUG2 5HVQC 1LEBA 2RNJA 4RB0A 2VJIA 2EIMH 3OYNA 2V1NA 2EFWA 3ELKA 1U2WA 3WTUC 2HOEA 2RQQA 3KYDB 2L0KA 4O5VA 1MIJA 1O4XA 3GVAA 2V26A 4G6DA 3ASOH 5A2QZ 1MDMA 2M0CA 4ZZLA 5HNFA 3L2VA 3GTGJ 4HNVA 2EB7A 2FQ4A 2DOFA 3H5NA 3BC8A 1YO5C 2HTJA 2VIXA 3G1OA 4DYQA 2AS5F 2JWTA 3LFKA 4AUXA 1SFOJ 4GXOA 3CMAI 4DZJA 1QHGA 3R60A 2Z99A 1JHFA 2KMUA 3SZTA 5D4RA 5L3FA 1R1TA 2I10A 3DEWA 1MSFC 1WJFA 1TT5B 2NNYA 5JHFA 3TW6A 4LLNA 2VQLA 1DP7P 1U6GA 1ZQ3P 5DCMB 3L2QA 4GRIA 3EDPA 4BJ5C 2O61A 5BQTA 2PJPA 3GTOJ 3K69A 1JJ6C 5ICCA 4RAFA 2DA6A 5IT9K 2VJ4A 4A2UA 3OS2A 3JR9A 5FKMA 5ERIA 2GXAA 1OYYA 3LWFA 1V5EA 2XAUA 2CS3A 3MZ8A 3B6AA 1G6NA 4XLFA 1OLTA 3KX2A 1HBXG 2YS9A 2IJLA 1MBGA 2HFHA 2GZWA 2W25A 3I59A 2EK5A 5F0FA 5E3MA 4XRFA 3FBIB 2E1NA 3QQAA 4MGRA 2L2OA 2LTPA 3BR2A 1G8XA 2M7AA 1C0WA 3QWLA 4Q4ZF 3VEPA 5IYDJ 4C30A 3W6JB 4HPQA 3L2WA 2VUMJ 3HSFA 3ROUA 2IEKA 1MKMA 3DKWA 3CCEI 3O2PE 4FT8A 4RGRA 1WCMJ 4UV9A 3REOA 2MGQA 3CTAA 3AKZA 1G2HA 2EPFA 4OMZA 3LA3A 4YFNF 1FOXA 1S7AA 4HNUA 3S32A 1NHAA 5ILSA 3GO5A 1IXSB 1ULYA 4OINF 3RIRA 2W00A 4A3GJ 4ZZDA 2NOGA 1OCOH 3PFIA 2VBWA 4H0EA 1HDPA 2JMWA 2C6YA 1MW7A 2Y48A 2UWMA 3J81K 2MYSA 5F0HA 2P5VA 4EJUA 4I01A 5JVTA 3FM5A 4Y33A 2FEZA 3SEQA 1AOYA 1QO0D 1VQ8I 4QPQA 2Q8KA 3OYJA 3GBGA 5HS7A 2ZMEA 3MCZA 2A6HF 2YU9J 2NVQJ 2OV7A 2HPIA 2JA5J 2LSOA 1RZ4A 1KYWA 3IHUA 3H0DA 3RDIA 4KA4A 2JN6A 3CMEI 4I02A 3PUBA 5HS8A 3K4CA 3U2RA 4P5OA 4IZZA 3E7LA 3DXJF 3BQYA 5M5YJ 4E7IA 2CV1A 2PJRB 2EV5A 3CCSI 3H3UA 4A3FJ 1BIBA 5IT3A 3WG7H 1W7PB 3I56I 2P81A 3W2AA 3GTKJ 3R4KA 1EA3A 5K7FA 3I58A 1HCRA 1UMQA 4PFPA 4FCYA 4RMNA 1ZRDA 4L9VA 2K5CA 2V6CA 2HVQA 2W4SA 1XGSA 1R1VA 2KP6A 1MJAA 3ZQHA 1B9MA 2RNGA 3QPTA 2Z5UA 3DTKA 2WY7Q 4ENMA 2FMLA 3BROA 1WJBA 3M1EA 2VPLA 2FMYA 4ZDOA 1WGXA 5EGOB 2DMPA 2LH9A 3HOWJ 4II2A 5CPRB 3KFWX 5FLXZ 4K2EA 4A5NA 2OAZA 2XB0X 1APLC 3IKVA 3LSKA 1BJZA 3A01A 2HDCA 4BL0B 3WTXC 4Y15A 1A6IA 3CLQA 1YW7A 5DS9A 5LEKA 2WBMA 2KQRA 1OCRH 3RPUA 4IHSA 4KDPA 3HGYA 5FFZA 3GFLA 2DBBA 2K3PA 3WHBA 2AXTC 4IHXA 5IYBJ 2BZTA 4W1UA 1ZKGA 3KE2A 3BG9A 1YG2A 3LSPA 4Z2YA 2VBXA 2PN6A 1P4AA 2F48A 2WV0A 1YITI 3CCYA 4BH9A 4EJTA 1DUXC 2O0YA 2OA4A 4P55A 1R1UA 4EM2A 2XDVA 4RB1A 4S04A 2DPDA 4BXUA 3S1RJ 1S6LA 3PIOF 4A0YA 4F93B 2R93J 3DFGA 4BQOA 2X0LA 3WGHA 1ZHFA 3DLLF 3HG9A 1ZGWA 1AKHB 1E17A 2W24A 3T5XA 5GAEJ 1YJNI 5FKNA 1S7OA 2Y69H 2KJCA 5FKLA 3CF5F 1TWHJ 2HQRA 4IQJA 3JREA 4HG2A 2HU9A 3DBLB 1R58A 2M4KA 1N78A 1IRGA 2G7UA 1JTXA 2L4MA 4WCGA 4R8HA 3WTZA 3PM1A 4QLCU 1BC7C 2NS8A 3LOCA 3GZ5A 1ONVA 4CCKA 4RLQA 1DPUA 1SFEA 4PJ0C 2DA3A 3JRIA 3FMRA 3BTIA 4BY1J 1P2FA 2WAQN 2H1LA 2CSOA 1PDNC 3WTVC 2EFQA 2F5DA 4IEJA 4JX6A 2HI3A 1PP8F 3QP5A 1GHCA 2E7WA 1QPMA 2K40A 4EJOA 4M72A 2VE9A 1U3EM 4C2TA 1W7PD 1KGSA 2QGUA 3K70C 3CCJI 2D45A 4U7DA 4RM3A 2KISA 3IAM2 3VPRA 4CZCA 4YRVA 3Q3SA 5GPCA 1WFXA 3RQIA 2HOSA 4HF2A 1Q1HA 2QYOA 5HDNA 1ENHA 5GAGJ 4OU0A 1WWXA 2ZB9A 3SEZA 2DMNA 2VXDA 4F92B 1ZR4A 3LAJA 1H9TA 1LDJA 1IUFA 2F4MB 5HDGA 4JK1X 3COAC 4KIGA 1PP7U 4OIPF 3MN2A 1T98A 1G3WA 1MD0A 5CVRA 5EG0A 1TP4A 1VZ0A 4GFBA 4B3AA 1TQPA 5ICEA 1PUEE 1NG7A 1WJ5A 3FM3A 4L9TA 4RAGA 3ERMA 1O7LA 4LIUA 2M2EA 5ED4A 1S7EA 1T38A 2GA2A 3F8BA 2BYVE 3I59B 2FSWA 4LK1F 3HGGA 3LSGA 4PK4A 1K78A 4BEHA 1SVOA 2HYGD 2LC2A 3MKZA 4AYBN 2J5PA 1UG0A 2R0QC 4CGZA 4RS8A 1IN8A 2BEOA 4PSWA 1ZG1A 4E4HA 3HPGA 4B1RA 1FC3A 2R7DA 1Z21A 4ZTJA 1W0UA 3O6BB 4D7NA 1EJ9A 2LKSA 1XGMA 2L9RA 3CO7C 3Q9SA 4HZFA 3TW7A 1FPQA 3HRTA 2HKOA 2Y0SN 2DT5A 2I8DA 3HOTA 2XASA 5DCMA 1T8IA 5D5VB 3WTTC 2E1CA 1O3RA 4L5EA 4IPAA 2QENA 5L3GA 3HZJA 4Q48A 1LE8B 2KIUA 1MH4A 1Y6IA 3F3XA 2MABA 1X2NA 2QSGX 1JXSA 2LRDA 2CFOA 3KP4A 1FYMA 3OYEA 4CCNA 1X2MA 2ZFUA 5IYCJ 4DBRA 1YHQI 1FYLA 1RRJA 1YOVB 2EFNA 4M6XA 1R22A 4BE2A 3M8JA 4XONA 3EPZA 2V6EA 4BGDA 5HLGA 1OR7A 2LG4A 2ZXHA 1K4TA 1QGPA 4AIHA 3E5UA 3DTIA 1GV2A 1I50J 1MBFA 5CVIA 1K6OA 4KFCA 2FA5A 2W85A 1T95A 4N9IA 1ETKA 2HDWA 1KA8A 2OBPA 4D1QA 4LB5A 5J4YA 3T0YA 1J7KA 4TV7A 3W2VA 3IL2A 5F6FA 3GEZA 2BXYA 4YIFA 1IO2A 3M8FA 2DOEA 4IOAF 2WY8Q 1WH5A 1ZLJA 2RVCA 5D6FA 3T8TA 5BPDA 3F6OA 1OCPA 2ADUA 3V8KA 3N4MA 4WX9A 1X1AA 2D2WA 2EIJH 3CDIA 4PFOA 2ZC2A 2HDDA 5J3LA 4AWXB 1RR7A 2EILH 1ON2A 5H6QA 2FF4A 4XSXF 5M5XJ 2VOOA 4RGXA 5JVGF 3DU5A 1OYWA 2LK2A 5CQGA 4A0XA 3FIWA 3AL0C 4EVIA 3W6VA 1ZARA 4DZPA 5IP7J 4IRGA 4ABZA 1Z3XA 1FY7A 5F08A 4KN7X 2R7FA 4B44A 2Y9YA 1MJBA 4C3HJ 2LVSA 1NK2P 3ZXSA 4M71A 2PG4A 5LFAA 2VONA 4CH7A 2LKXA 2XGDA 3NWTA 3CO6C 3H9QA 5L3BA 1FEXA 2KIMA 2WB1A 5J47A 2Y0MA 2DQRA 1MDMB 5C3EJ 1TQMA 1KYZA 4G8XA 4S05A 4IKFA 4ZYHA 5J1YA 4ZYGA 3K4MA 4EM1A 3GMEA 5HS9A 1LDKB 2RREA 1FMVA 3I9V2 1PVEA 4RDUA 3F21A 3BTJA 2QUFA 2M87A 4C9YA 2IP2A 1MJ9A 2X9DA 1P7JA 2XRNA 1VQLI 5ILVA 5D8LB 3BZKA 1Z1DA 1VQNI 2XC7A 2R7OA 5F04A 4ASNA 1RC9A 4ENNA 2GQQA 1KQ0A 3HRSA 3L7WA 3GTPJ 2A05A 3GFMA 3HOSA 4BDZA 2NRAC 1E0EA 2VPRA 4OIQF 1IRZA 4OIRF 3F8MA 3CC7I 2K86A 1T39A 4IHVA 5TJJA 4EQQA 5LEJA 3A02A 3BG6A 4HQMA 3BPVA 1FX7A 4OIOF 1VQ4I 3IH4A 1YRNA 3RCOA 3RSNA 2IGKA 5BS6A 3D0SA 5C4XJ 1R9TJ 4I76A 2H6CA 1D1BA 2VB6A 1H88C 1JKPC 4LJZF 3GTJJ 2ELKA 4CHUA 2A6EF 1OKRA 4LK0F 3SZPA 3A4CA 2OCEA 2X51A 4A3JJ 3AG2H 3JCUC 2K85A 3IRQA 3CDLA 2IVMA 4EJVA 2JTVA 5EJCA 4E7LA 2CG4A 2L02A 4XN0A 3FX3A 9ANTA 2MH2A 1D0YA 3CQZJ 3E5QA 4NQWB 3M1CA 4LIVA 1E3PA 1SVLA 2EA2A 1AKHA 4ZDPA 2HR3A 2FXAA 2XKPA 1I1GA 5LHIA 2ZMEC 2XPVA 5FLXK 2L7ZA 4XRMA 2XAJA 2E5NA 2M1BA 4UVCA 4A3MJ 1GVDA 4MNUA 2L01A 1VQ9I 3TEDA 3ABUA 3SFIA 1F1ZA 2H09A 1DU0A 3FKIJ 1BL0A 1YRNB 2XGEA 3BT9A 4DNCA 3L09A 3J80K 1ZRCA 5F1RA 4ENJA 4LLLA 1V5GA 1W5CC 3BCAA 4XKBA 3L2RA 1TWAJ 1HKSA 1R6RA 4DJAA 1RNLA 3JRGA 5LHHA 2VKVA 1K61A 3PNVA 1WZ2A 3TL4X 4BYYA 3MAJA 3HDDA 5HNHA 3VSKA 2QBYA 3GCMA 1ODDA 1U5TC 3DEUA 2QKMB 3O8GA 2K9SA 5JFRA 1V5FA 1YW8A 2NS7A 4BHBA 4MEYF 5K7HA 1R5GA 4ZC3A 1FTZA 3S2HJ 2OPTA 3QYEA 3IUOA 2ECCA 3CCUI 1LQ1A 1D0ZA 1HW5A 1GLNA 1HQCA 5K5OA 2VT2A 3BDDA 3GFJA 5DD8A 5KNLA 2XSJC 2A07F 4NC7A 5GTIC 1QVTA 2FBIA 4G6TB 5D5WB 2JA7J 4A0ZA 1HKTA 2AO9A 3HOZJ 5D5XB 2WAQA 3OOUA 4IOCF 3RPUD 2CW0F 4LG0B 2KZVA 2D1HA 4FQGA 3ZN1A 2KRHA 2ZSIB 5CVVA 1FTTA 5IPAA 3E6CC 4Y52J 1YI2I 3JW4A 4JYKA 5FRNA 4HYEA 3I4PA 1HSJA 2JT1A 3DQVC 2LF7A 4IRIA 3UNGC 1N25A 1WH7A 3N05A 2O8KA 1HF0A 3G1MA 2O6GE 3ZQLA 3K9TA 2RAEA 4RAZA 3I53A 2FNAA 2UV1A 3ZQFA 4C3IJ 1J5YA 2X6OA 4I0AA 2YPRA 2BXZA 2ZMEB 2R7XA 4YG2F 2G0EA 3E6MA 3DBRB 4A3IJ 1MGTA 1JUPA 2H6BA 3MZYA 1E3OC 3CCQI 1FBSA 2KKOA 3KLNA 2VLAA 3HB9A 1W5TA 5E20A 4XK4A 2VC0A 1R4MB 2ETHA 2CWEA 2A69F 1DP3A 2BBYA 2V9KA 2X6XA 4YEJA 1UAAA 3E0JB 3K4JA 5LHGA 2DN0A 4XOPA 2R7SA 1TWCJ 3OYLA 1BOAA 4V19K 3TDUC 3TOAA 1X3WB 1Z7LA 1DGRM 3BWGA 5E8IA 1VQMI 4M3BA 4E70A 2EH3A 3DV8A 1K79A 3PSIA 1NK3P 4DYRA 2R7UA 5CVUA 1Z9CA 2OTLI 4ZH4F 2MG4A 2HVSA 4NBQA 2ECBA 4KITB 1ZG3A 1XX5A 1IN4A 5IP6A 3RI4A 4M6YA 4QSHA 2FX0A 2DA7A 2P8TA 1SANA 3TO6A 2DT7B 1IGNA 3U1KA 3OOPA 3FXJA 2BHZA 3G1LA 3ZPLA 1A5JA 1JUMA 1DPRA 4CYCA 1VQ5I 3L1PA 4RGSA 3H36A 1MNEA 1YE9A 3K10A 2R92J 3CCLI 2MC4A 1BIAA 1D5YA 2H27A 4JOMA 3FXOA 5BOXA 1IUYA 1Y1VJ 2G7HA 3KZIC 4HSTA 5AIPA 3A1YA 2WB1N 2HQ5A 3S8PA 3ZMTA 3M3YJ 1S8NA 1TLHB 3BG7A 1OCCH 5K5QA 3ABLH 3ZOBA 2XGCA 2EFOA 3TQNA 2CW8A 4A6EA 1XDSA 3LQRA 4GYGA 3C2BA 1U8RA 3M07A 1BA5A 5E17F 4UUSB 1TBXA 1QPIA 3F6VA 4OAYA 3EUKL 2XF6A 1RUNA 5F27A 1K7AA 2BE5F 1GT0C 1RESA 4ESFA 5EDNA 3C1DA 2QEXI 2LDUA 1YX5A 3C3WA 5J8FA 2E1OA 5J4VA 4XBFA 3C18A 3AL0B 4M9SA 2XKOA 4U0YA 3NRVA 1OYIA 3KEQA 1YS6A 3LSMA 2X1EA 2GWRA 3MKWB 5LLQA 2DTZA 4XLAA 2MFZA 3P5JA 2OJED 3HSEA 4PZJA 1SFKA 3LFUA 3H3VK 2P5LC 1O3TA 4BHPA 5HLHA 3HEFA 2WWYA 3E5XA 1ETXA 4XQFA 1ZGAA 1WSUA 5TISC 5KAFC 3K70D 1U9OA 1WI3A 2BGCA 2K9LA 3HXLA 1WVRA 2L4AA 1UG2A 2BY2A 1IN5A 1BOBA 1MZBA 2K9QA 5E1WA 4G9YA 1X19A 2DA4A 2PI0A 3FK6A 2CH0A 4HEA2 1B59A 2CUZA 2L54A 1ZYRF 1N77A 2HS5A 4NB5A 3G2BA 1BW6A 1Z6TA 2GXGA 1LPQA 1K6YA 4L18B 3L00A 5DD4A 4AIJA 2VJJA 3FMQA 3LQQA 3U9GA 4HAMA 3DPTA 1SVMA 3TDZC 4ETSA 1D8JA 2HYJA 2STWA 3CJRB 3VWBA 3RKYA 1FIAA 3CUQC 3E6DA 4FX0A 3ZQQA 2GXBA 2XHKA 3K4KA 4YFXF 1LEAA 3DTEA 2DDAA 2E1MB 3ONQA 1RETA 3FXUA 3V42A 2FE3A 1I3AA 2K9NA 2JPBA 2VKEA 4RAYA 3BJOA 3RPQA 1IW7F 4G94A 3B73A 2CUJA 2B0LA 2CRGA 1LVKA 4BY7J 3QODA 2M7BA 1Y0UA 4UUTA 4V2FA 2ZXIA 1U0JA 2DMTA 1R00A 3F8CA 4HX8A 5DYMA 3CMYA 1VQPI 1B8IA 2W7NA 1FBUA 3WGIA 4MIMA 5K1YA 3WU1B 2STTA 1ACIA 5B3SH 1HXDA 2IA1A 2A68F 2QVOA 1IN6A 4AIKA 5JLWA 5D8KB 3CDHA 1QVUA 3VYSB 3I55I 2DCEA 4XSZF 1HKQA 1XN7A 2ZJQF 1OMIA 3RKWA 4E7KA 1YTYA 4G7OF 3HOYJ 3S17J 4W97A 1JKQC 3SDGA 1L0OC 3JRHA 5FKOA 2VOPA 1I39A 2HGCA 3S1QJ 5FGMA 4HNTA 3BY6A 1VQOI 1CF7A 2EV0A 4IX7A 5F1JA 4LFUA 1ZAOA 4UV8A 4BU2A 2QF7A 4F91B 1ZRFA 2B63J 3FMSA 3WG9A 3E6BA 2TDXA 2F5FA 2Z2SB 2ZXWH 4F3QA 3GX4X 1B1BA 3RYRA 1JE8A 5F0CA 3TBIA 3WU2C 3ZCOA 3K1NA 1D8KA 5BNGA 4XN3A 4FASD 4J19A 4E7JA 4HW0A 1HC8A 4PCQA 3S93A 3HKZA 1PJRA 2X6YA 3U21A 3K2AA 4JBAA 1TQIA 2P0WA 2RC4A 3OYCA 3BQZA 2XIGA 1DDNA 4F52A 1ZK8A 2MC3A 1VNDA 3OL3A 4LG3A 2X6WA 3VB2A 4AM3A 3ZQIA 2JA8J 3ABKH 2DPUA 1XC5A 2Y75A 3KETA 1F5TA 1T56A 2LOOA 2W84A 1FP1D 3V7RA 2FNPA 1Y1WJ 4FE7A 3VYRB 3BTLA 3T1BA 3GYHX 2JZYA 3S1MJ 4CCJA 3RJPA 2DT6A 2YR2A 2HVRA 1R7JA 2JVGA 2XPWA 3HIFA 3M4OJ 1H8AC 4IO9F 2DO7A 2XROA 1SFUA 3GZ6A 1SMTA 4UXNA 5L3CA 2VE8A 3W2WA 2IAIA 2IGNA 4DBQA 4U0VA 3ZQ7A 1IDYA 5CLSA 4UUSA 1LFBA 5B1AH 3H0GJ 2L5QA 3TMOA 2VKHA 2M8EA 4BKXA 3J7AY 3B02A 3OYMA 1P6RA 2DDBA 1IC8A 1ETWA 3MEXA 4XORA 1HDDC 2XVCA 3GWZA 3PL8A 3IWFA 2NYXA 1JI8A 3AG1H 1Z3YA 2KJBA 5DEQA 2DK8A 4AYBA 4CICA 2GIVA 3ECHA 4LMYA 2LFBA 2F5CA 2E2IJ 5FB2A 2OZ6A 2P6SA 3TOBA 3MKYB 1F36A 1IZ1A 2LNBA 5KCMA 4XRSA 3FXRA 2IGMA 4MFEA 4ON0A 4L9NA 4GGGA 5LBQA 5EF6A 5HODA 4BS9A 2ISZA 4D9JA 4BQAA 1X1DA 3J81Z 2M34A 3QOEA 3KIOA 3I0TA 5A2QK 1W0TA 4NC6A 3IH2A 5J1RA 2K4JA 2CUFA 3HJEA 4XLHA 2VQHA 4G7ZF 2JUCA 3FISA 3OIQA 3GW2A 2E7XA 4UNOA 2E36A 2CQ7A 2PFBA 2B9SA 3QPSA 3ZP5A 1ETYA 2W1OA 2LMDA 3K2ZA 2GAUA 3BR3A 5EEAA 2CQKA 4FHTA 3GTLJ 2PX9A 1V55H 5JR3A 1AA7A 5DTDA 3UKGA 4F55A 1X58A 1TTYA 2DFHA 3H5RA 1LFUP 3PO2J 3RZDJ 4DQ2A 5IP9J 1P9QC 1D0XA 2EJRA 1Y56A 3AFHA 2ESNA 2P6TA 4R79A 3ASNH 3HL2A 3F8NA 3E3VA 1SEUA 1OQYA 3H9JA 5HLTA 1ZELA 3I5UA 4RA2A 5E8GA 4IVNA 3KZZA 4U7BA 1ZR2A 3BR1A 5H6RA 4NNJA 4BAYA 4KMFA 1KQ9A 2A61A 2VC1A 2VJ5A 3EYYA 4OWRB 1BI3A 2EQRA 1IXRC 2KIQA 2IGOA 4A6DA 3CP2A 1W5SA 4HLXA 2FOWA 4WF2A 2FBKA 4XKVA 1MMNA 2AQEA 4XRSG 3E97A 1J59A 4JP0A 2EZHA 5KVRA 3RQ4A 3BLYA 4CSWA 2DA5A 1BI0A 2QWWA 2YX4A 2ZJRF 4D0PA 4BEHB 5DUKA 3N97A 1OJLA 1NH3A 2VI6A 2KIFA 1DU6A 5DCFA 4AD9A 1IN7A 2ISYA 4AU7A 1UHSA 2Z1DA 4HF1A 5DV5A 3WTYC 5IT9Z 4A69C 2V4JC 4MTEA 1BBYA 4M3FA 1A04A 1JGGA 3HC7A 4EJWA 3NWSA 2H94A 1T6SA 3FZVA 1JJ8C 1P92A 2WAFA 1XCBA 2QLZA 2E19A 3GLLA 2D1VA 4P96A 3PFYA 2LY1A 1I6HJ 3D5LA 3GLXA 3ULQB 1Y8QB 5J8CA 3QYBA 5L3DA 2MH9A 1S5LC 2COBA 1WQ2A 3ABTA 4JQFA 4ZJZA 1O3QA 5KHDA 3FWEA 2BY0A 2L7FP 2ZNYA 3CJNA 1FSEA 2K9MA 4XOTA 3J7ZI 1OPCA 2BW3A 4I2OA 1K83J 3FF5A 1KQ8A 4M9ZA 2E34A 3K4NA 3EUHA 4C2MJ 1H9GA 1S72I 4PJJA 4G12A 2IS4A 1Z0XA 2DFIA 2JJ7A 3PNTA 1H0MA 3PQKA 3EUAA 3OYGA 2A5WA 3OYBA 4Q47A 1E2XA 2RQPA 2NVUB 1D1CA 3QPLA 1H89C 1I6XA 1Y8RB 2CJJA 1VQKI 4EGZA 3OIPA 2YSRA 3B6CA 2DA1A 4N0BA 1WJDA 3E1SA 2L7KA 1IAWA 1Z77A 4AIDA 2DLLA 2IRFG 2W48A 1FOYA 2DK5A 2RGVA 5H2FC 4IHTA 2R5YB 3Q9VA 2KPMA 5CQEA 5FD5A 4BBSJ 2DJNA 2PMUA 2ID3A 3S3NA 1IDZA 2GA1A 5CVJA 3JRAA 1UHWA 1UCRA 2MA3A 1P4XA 2VN2A 3VOEA 4X1EA 3HOUJ 4AVZA 1UFMA 2XAGA 4A3EJ 4BQNA 3SYTA 2W82A 1QZYA 1STZA 5J40A 1MMDA 3RZOJ 4WXDA 4N9HA 2CQNA 1GXPA 3BG3A 6PAXA 4I98B 3CCVI 4DW6A 2M4GA 4OOIA 3OSFA 5GADJ 1BI1A 3EUHC 5AIQA 3D5RC 1SD5A 1B9NA 4B4CA 2YU3A 5LGTA 2WC2A 3MD2A 3W3CA 2E1MC 3AG4H 4MQVA 2TCTA 2IXSA 1TL8A 1XGNA 1CF7B 2YX7A 3FXLA 2P4WA 1ETVA 3DKXA 3OMYA 3VFZA 2PMHA 3KYLA 1F43A 1F4KA 1X4OA 1XMAA 2K27A 2ESHA 4KN4X 2DMUA 3FXKA 4H4KC 3F72A 1I27A 1W1WE 4UVAA 1ZREA 3L2CA 3A2KA 2BOLA 3P9CA 3BTCA 3LSTA 5CKTA 4ZTFA 4A3KJ 4DYCA 4CYDA 3A01B 2OZUA 2B7EA 1UJ8A 4ITVA 4ENKA 3KEOA 3R0JA 1LKXA 1N75A 3W6KB 2OUMA 2Y30A 3I64A 4E7HA 3HHGA 5B66C 2A5YB 1U78A 5HDKA 1UHMA 3Q0UA 5LRSA 4B09A 3WGGA 1CGPA 5EYRA 2IS2A 2OD5A 2KRCA 3R6SA 4FETA 2HQNA 2DU9A 4J00A 2R7VA 4YFKF 1MBKA 3PO3J 3BR0A 3KPHA 1Q1VA 3RTRA 1KU7A 2XV4S 4J01A 5ICFA 1MSEC 1I1SA 2VT3A 4II3A 4E7SA 4C2UA 4A3DJ 2HNHA 2DODA 4E6KG 2X4HA 3A03A 1VTNC 4PSXA 4Y3OA 4YIIA 4A3BJ 2KLOA 3CCMI 2IT0A 2EA4A 1NTCA 1WJAA 4GDFA 1FSHA 4GCVA 3IH3A 4KYWA 1TW3A 2XAQA 1TWFJ 1UB9A 3HYIA 3O3KA 3CUQA 1QNTA 1RI7A 3IKTA 3V4GA 1Z91A 2HTSA 2M5WA 4RLFA 3EYIA 4GYIA 3S2WA 3HTSB 2ME0A 1ZLKA 3S1NJ 4XLCA 4HA8A 4S0HB 2OQRA 2QM3A 2VASA 1YX3A 1UZCA 2K4BA 3QP6A 1LDDA 2V79A 3RYPA 4YELA 2KHMA 3WE3A 2MLGA 3DKYA 2BW3B 4M3GA 4CA0A 2Z16A 2ICWG 2Y31A 5EZGA 1B72B 4CYCB 5AONA 1D5VA 1XB4A 3S3OA 3PJRA 2CU7A 2Z9OA 4OMYA 2LBFA 3F22A 4LLGF 4LD5A 3J80Z 4I6ZA 1JUSA 2MD5A 1XSXA 2LD5A 2ZFWA 4RBOA 4Y13A 1ZGJA 3P9KA 1KZHA 1R36A 4L5JA 4ZYAA 4CUGA 2EV6A 2LY2A 3ZQCA 2UXXA 2P5KA 3DCFA 5BMZA 1BR2A 2GOXB 3MQ0A 1HW1A 3CJTB 4G6QA 3K7AJ 3X2QH 5ICGA 1OISA 4L0YB 4ESBA 4FISA 4U0WA 1GV5A 1XDUA 5TGTA 1IRXA 1BJAA 2ZJPF 4Q5SF 1XSVA 2V7FA 5EEHA 2P7CB 2CMPA 2Q1ZB 4KT6A 2O9LA 4L9JA 1SD4A 3HTUA 2QCOA 5D4SA 3C2HA 2NVYJ 1DQUA 2XUBA 4AVPA 1LE8A 4PJLA 3NQOA 2VODA 3S2DJ 1O3SA 1PYVA 1EH6A 3VDXA 4NC8A 3KP7A 1HA8A 3FHZA 3HUGA 3JRBA 1CQTA 1ZTRA 2KT0A 3SDBA 4IL6C 2P7VB 4BE1A 5FD6A 1IJWC 1EH7A 4CCOA 2E35A 2R3SA 3P9IA 3GFIA 3J7AO 5FRMA 1POGA 2XB5A 3HPHA 3IV5A 1BN5A 1V4RA 4XIDA 3LNQA 1XCVA 3C2GA 2L9NA 3SZGA 4XKCA 3VYUB 3DBHB 3L2UA 2EIKH 1T33A 3I71A 3HOXJ 1FOWA 3U1DA 4XLPF 1JT0A 3NARA 3LSRA 4IHWA 4WK8F 4WXHA 2R7ZJ 2D5VA 3BOQA 1XMXA 3D5SC 1XD7A 4HRIA 1RKWA 3VSLA 5EG0B 1FZPB 1S29A 1LUJB 1O7FA 2HXOA 1J0RA 5E1XA 1WJCA 2EWNA 4B48A 3RKQA 3PIPF 3MKLA 4N4OB 2HWVA 2BV6A 2X85A 4ZYDA 4M9XA 2BVMA 2GLOA 4PUSA 2MW8A 4KMUX 5IY5H 3H3ZA 5EZHA 3T8RA 4KICA 3ZMSA 3QOPA 2L3DA 4MEXF 3CMMA 4IHYA 4HV5A 1AHDP 2Z33A 1J09A 2ELJA 1EH8A 4XR6A 5DM6F 1FBQA 2CW7A 1R5ID 2HPMA 4XNFA 2QKLB 2JPCA 4MLOA 3JAMK 4P9FA 2PLYA 3UR3C 4BQQA 1XG1A 1TT0A 1QQIA 3CUQB 3TKYA 2EZKA 5E1ZB 5C4JJ 2M0MA 3IWZA 4HOBA 3WODF 4BXFA 2NXNB 2N8GA 3HRMA 1REPC 2DFFA 2NVTJ 4CCMA 3OS0A 5M5WJ 2FOKA 1GXQA
chains in the Genus database with same CATH topology
1O57A 2O03A 2ZCWA 3I54A 1G3YA 3IC7A 1USSA 1Z7UA 1G4DA 2Q2EA 1FOKA 2ZKZA 1SD7A 1G3TA 4PGHA 1RUOA 5F64A 3R0AA 1BC8C 1KU3A 1GVJA 5K5RA 3QAHA 5J6XA 1B6AA 1J9IA 3MWMA 4IRHA 3GXOA 3GUDA 3HRUA 3Q5FA 1LJ9A 5DUIA 2FQ3A 4FX4A 5H20A 1TW2A 2UXNA 2FBHA 1I5ZA 1YYVA 4EGYA 1D3YA 2JSCA 2MBFA 2CYYA 2MLKA 1SAXA 2ELHA 3KZYA 3PQJA 2QQAA 1XMKA 2QQBA 2VBYA 1AWCA 1W4MA 4UHTA 2LF8A 3WE2A 3KP3A 1ZG5A 1LVAA 3VODA 1V3FA 3BJ6A 4MHGA 1W7PA 2M30A 1YIOA 5LGNA 2V1UA 4HBLA 3HHHA 4B8XA 2COMA 4O3MA 4HX4A 4I09A 1QZZA 4G7HF 2IA2A 1EV7A 2DTRA 4KIBA 3M7GA 4KT5C 4CO8A 4RB3C 3JTGA 5HOOA 1HW2A 2J5OA 2VXZA 2ACJA 4LGWA 2DAOA 3CLOA 1ON1A 2HZTA 3DP7A 1R23A 2XAFA 2V1XA 2O8XA 1T0FA 3NEUA 3K0LA 3KP5A 4CZZA 1J75A 4EMSA 5TRDA 2DW4A 4Y17A 3OV8A 3QU6A 3K1MA 1S3JA 3M9AA 3WTSC 3ISPA 2ZBKA 4MQ9F 3SXYA 3LAPA 5ILUA 4L0ZB 5EEGA 4EM0B 2NAZA 2XAHA 3P7NA 4HDVA 3JSOA 2O3FA 3JTHA 4I0BA 2KRFA 2M45A 5LRRA 3HSRA 5L3EA 2F2EA 4RB2C 1L3LA 4MTDA 3ZMDA 1U5TB 1HSTA 3EQLF 4EV0A 1FNNA 4R1HA 3DF8A 3V7SA 3MFKA 1Z6RA 1U5TA 3ZMUA 4HV6A 4GO1A 2AXLA 1J2XA 3V8JA 4CDGA 5HLIA 1YLFA 4LB6B 2CFXA 2RV8A 4RGUA 3SFZA 5FFXA 3BJAA 1YW9A 3FXQA 1BI2A 2F5EA 3AAFA 1IXCA 4I7HA 2OU2A 2EFPA 1XGOA 2K7LA 4HF0A 2VBZA 2ZO4A 3V7CA 2DI3A 1LNWA 2IPQX 2ZJ2A 3L9FA 2IW5A 1YS7A 1WKMA 5KK1A 3WU0A 4F7ZA 1IRFA 5D5UB 2NS0A 3BP8A 4HX7A 5JI6A 3BZ6A 2A3SA 2ZXJA 4IF4A 3LA2A 1FP2A 5FO5A 2HKXA 3F23A 2RDPA 1XSDA 3BPXA 3TO9A 1WRJA 1B4AA 3ERED 5JHUA 4O6JA 2QBYB 4L5IA 2Q0OA 2UZKA 3KLOA 1F9NA 3ZMZA 3JSPA 2JRTA 3CUOA 1SMYF 4UUVA 3M8EA 2CO5A 1ZN2A 4U88A 2DQLA 4M74A 1R5HA 1YQAA 4A5MA 5BPIA 1TNSA 2FU4A 3V8LA 1KU9A 2K02A 3TO7A 2LKPA 3QRFF 4LG0A 2RKHA 1TNTA 2HEOA 3MZHA 1Z05A 2NNNA 5CYVA 2OQGA 4A12A 4BNCA 3IRRA 2FRHA 2W57A 1JGSA 3GF2A 3ZMVA 3QPHA 4IXAA 5DDGA 3DPLC 3QU3A 3RKXA 4IJAA 4CXFA 4NHJA 1G3SA 4ESJA 1JHHA 1FYKA 2QQ9A 4WXCA 1BM9A 3SHFA 4UVBA 2HYFA 1FLIA 4XLNF 5D6EA 5LGUA 1WI9A 4KUMA 3TGNA 1RIOH 4WWCA 5E18F 1IF1A 4KIFA 3KCCA 2G9WA 1SFXA 2PBIA 3R61A 1KU2A 3WTWC 3EETA 3G73A 1SD6A 2V9VA 4NQWA 4ZYEA 4HDUA 1YFHA 2PQ8A 2WTEA 4BHCA 4P9UA 1K78B 3G3ZA 3ZN0A 4PGGA 1P4WA 1USTA 1QBJA 4QWQA 3JAMZ 3H92A 2V1DA 4KNYA 3C7JA 1FWZA 2XGXA 2PEXA 2ZNZA 1FT9A 3K1PA 3SQNA 4HLYA 3KP2A 5CJ9A 1ZH5A 4M73A 1LB2A 2Z3YA 2RN7A 1T2KA 4HQEA 3LA7A 3F8FA 3KP6A 2QZ8A 3ECOA 2CGPA 1X3UA 3ML6A 4PDKA 2IA0A 5HVQC 1LEBA 2RNJA 4RB0A 2EFWA 3ELKA 1U2WA 3WTUC 2HOEA 4O5VA 3GVAA 4G6DA 5A2QZ 1MDMA 4ZZLA 2EB7A 1YO5C 2HTJA 2AS5F 3LFKA 4GXOA 3R60A 2Z99A 1JHFA 3SZTA 5D4RA 5L3FA 1R1TA 2NNYA 4LLNA 1DP7P 1U6GA 5DCMB 3EDPA 2O61A 5BQTA 2PJPA 3K69A 5ICCA 5IT9K 4A2UA 5ERIA 1OYYA 3LWFA 1G6NA 1HBXG 2IJLA 2HFHA 2GZWA 2W25A 3I59A 2EK5A 4XRFA 2E1NA 4MGRA 1C0WA 4Q4ZF 3VEPA 3W6JB 3HSFA 3ROUA 3DKWA 1MKMA 3O2PE 4FT8A 4RGRA 4UV9A 3REOA 3CTAA 4OMZA 3LA3A 4YFNF 1S7AA 1NHAA 5ILSA 3GO5A 1IXSB 1ULYA 4OINF 3RIRA 4ZZDA 3PFIA 2VBWA 4H0EA 2C6YA 2Y48A 2UWMA 3J81K 2P5VA 4EJUA 4I01A 5JVTA 3FM5A 2FEZA 1AOYA 1QO0D 2Q8KA 5HS7A 2ZMEA 3MCZA 2A6HF 2LSOA 1RZ4A 1KYWA 3IHUA 3RDIA 4KA4A 4I02A 5HS8A 3U2RA 4P5OA 3DXJF 2EV5A 3H3UA 1BIBA 5IT3A 1W7PB 3R4KA 3I58A 1ZRDA 4L9VA 2V6CA 1XGSA 1R1VA 1MJAA 1B9MA 3QPTA 2Z5UA 4ENMA 2FMLA 3BROA 3M1EA 2FMYA 3KFWX 5FLXZ 4K2EA 4A5NA 2OAZA 3IKVA 2HDCA 3WTXC 4Y15A 1YW7A 5LEKA 3RPUA 4IHSA 4KDPA 5FFZA 3GFLA 2DBBA 3KE2A 1YG2A 4Z2YA 2VBXA 2PN6A 1P4AA 2WV0A 4BH9A 4EJTA 1DUXC 2O0YA 2OA4A 4P55A 1R1UA 4EM2A 4RB1A 4S04A 2DPDA 4BXUA 1S6LA 4A0YA 3DFGA 2X0LA 3WGHA 1ZHFA 1E17A 2W24A 3T5XA 1S7OA 2KJCA 2HQRA 1R58A 1IRGA 2G7UA 4WCGA 2L4MA 4R8HA 3WTZA 4QLCU 1BC7C 3GZ5A 1ONVA 1DPUA 1SFEA 3FMRA 1P2FA 2CSOA 1PDNC 3WTVC 2EFQA 2F5DA 1PP8F 3QP5A 1GHCA 2E7WA 1QPMA 4EJOA 4M72A 2VE9A 1U3EM 1W7PD 1KGSA 2D45A 4U7DA 4HF2A 1Q1HA 2QYOA 5HDNA 4OU0A 1WWXA 1H9TA 3LAJA 1LDJA 5HDGA 4JK1X 3COAC 4KIGA 1PP7U 4OIPF 1T98A 1G3WA 1MD0A 5CVRA 1TQPA 5ICEA 1PUEE 3FM3A 4L9TA 1O7LA 5ED4A 1T38A 2GA2A 3F8BA 2BYVE 3I59B 2FSWA 4LK1F 2HYGD 2J5PA 4CGZA 4RS8A 1IN8A 2BEOA 1ZG1A 1FC3A 2R7DA 3O6BB 1XGMA 3CO7C 3Q9SA 4HZFA 1FPQA 3HRTA 2HKOA 2DT5A 3HOTA 2XASA 5DCMA 5D5VB 3WTTC 2E1CA 1O3RA 4IPAA 2QENA 5L3GA 4Q48A 2KIUA 3F3XA 1JXSA 3KP4A 1FYMA 1FYLA 2EFNA 4M6XA 1R22A 5HLGA 1OR7A 1QGPA 4AIHA 3E5UA 5CVIA 1K6OA 4KFCA 2FA5A 2W85A 4N9IA 1KA8A 2OBPA 4LB5A 3T0YA 1J7KA 4TV7A 3IL2A 5F6FA 3GEZA 4YIFA 3M8FA 1ZLJA 2RVCA 5D6FA 3T8TA 5BPDA 3F6OA 2ADUA 3V8KA 3N4MA 4WX9A 2D2WA 4AWXB 1ON2A 5H6QA 2FF4A 4XSXF 2VOOA 4RGXA 1OYWA 4A0XA 4EVIA 1ZARA 4IRGA 1FY7A 4KN7X 2R7FA 1MJBA 4M71A 2PG4A 2VONA 3CO6C 5L3BA 2KIMA 2Y0MA 2DQRA 1MDMB 1TQMA 1KYZA 4G8XA 4S05A 4ZYHA 4ZYGA 4EM1A 5HS9A 1LDKB 3F21A 2QUFA 2M87A 2IP2A 1MJ9A 2XRNA 5ILVA 5D8LB 1Z1DA 4ASNA 4ENNA 2GQQA 1KQ0A 3HRSA 3L7WA 3GFMA 3HOSA 2NRAC 4OIQF 4OIRF 3F8MA 2K86A 1T39A 5TJJA 4EQQA 5LEJA 4HQMA 3BPVA 1FX7A 4OIOF 5BS6A 3D0SA 2H6CA 4LJZF 4CHUA 2A6EF 1OKRA 4LK0F 3SZPA 3IRQA 2IVMA 4EJVA 2JTVA 2CG4A 2L02A 3FX3A 2MH2A 3E5QA 2EA2A 2HR3A 2FXAA 2XKPA 1I1GA 5LHIA 2ZMEC 5FLXK 2XAJA 2M1BA 4UVCA 4MNUA 2L01A 3ABUA 1F1ZA 2H09A 4DNCA 3L09A 3J80K 1ZRCA 5F1RA 4ENJA 4LLLA 1HKSA 1RNLA 5LHHA 4BYYA 3MAJA 2QBYA 1ODDA 1U5TC 3DEUA 5JFRA 1YW8A 4BHBA 4MEYF 1R5GA 1LQ1A 1HW5A 1HQCA 5K5OA 2A07F 2VT2A 3BDDA 3GFJA 5DD8A 2FBIA 5D5WB 4A0ZA 1HKTA 5D5XB 2CW0F 4LG0B 2D1HA 3ZN1A 5CVVA 3E6CC 3JW4A 4HYEA 3I4PA 1HSJA 2JT1A 3DQVC 2LF7A 4IRIA 2O6GE 3K9TA 4RAZA 3I53A 2FNAA 1J5YA 4I0AA 2YPRA 2ZMEB 4YG2F 3E6MA 1MGTA 2H6BA 3MZYA 1FBSA 2KKOA 3KLNA 1W5TA 5E20A 2VC0A 2ETHA 2CWEA 2A69F 2BBYA 5LHGA 1BOAA 3TDUC 3TOAA 3BWGA 5E8IA 4E70A 3DV8A 1K79A 5CVUA 1Z9CA 4ZH4F 1ZG3A 1IN4A 3RI4A 4M6YA 2P8TA 3TO6A 3OOPA 3ZPLA 1DPRA 4RGSA 2H27A 1BIAA 5BOXA 1IUYA 2G7HA 5AIPA 3ZMTA 1S8NA 1TLHB 5K5QA 4A6EA 2EFOA 3TQNA 1XDSA 3LQRA 4GYGA 1U8RA 5E17F 1TBXA 3F6VA 1RUNA 1K7AA 2BE5F 4ESFA 3C1DA 2LDUA 3C3WA 5J8FA 4XBFA 3C18A 4M9SA 2XKOA 4U0YA 3NRVA 1OYIA 3KEQA 1YS6A 2GWRA 5LLQA 3HSEA 4PZJA 2P5LC 1O3TA 4BHPA 5HLHA 2WWYA 3E5XA 1ZGAA 1WSUA 2BGCA 2L4AA 1IN5A 1MZBA 5E1WA 4G9YA 2PI0A 1B59A 2L54A 1ZYRF 2HS5A 4NB5A 1Z6TA 2GXGA 4L18B 3L00A 5DD4A 4AIJA 3LQQA 3U9GA 3FMQA 4ETSA 4HAMA 3TDZC 3DPTA 1D8JA 2STWA 3RKYA 3CUQC 3E6DA 4FX0A 2GXBA 2XHKA 4YFXF 1LEAA 3FXUA 2FE3A 2JPBA 4RAYA 3BJOA 3RPQA 1IW7F 4G94A 3B73A 2B0LA 1Y0UA 3F8CA 4HX8A 1R00A 5DYMA 1FBUA 3WGIA 5K1YA 3WU1B 2STTA 1HXDA 2IA1A 2A68F 2QVOA 1IN6A 4AIKA 5D8KB 3CDHA 4XSZF 1HKQA 1XN7A 1OMIA 3RKWA 1YTYA 4G7OF 1L0OC 2VOPA 2HGCA 5FGMA 3BY6A 3HTSB 1ZRFA 2EV0A 1CF7A 4LFUA 1ZAOA 4UV8A 3FMSA 3WG9A 3E6BA 2TDXA 2F5FA 3GX4X 1B1BA 3RYRA 1JE8A 3K1NA 1D8KA 4HW0A 4PCQA 4JBAA 1TQIA 2RC4A 2XIGA 1DDNA 2MC3A 3VB2A 2DPUA 2Y75A 3KETA 1F5TA 2W84A 1FP1D 3V7RA 2FNPA 3T1BA 3GYHX 2JZYA 3RJPA 2YR2A 1R7JA 3HIFA 2DO7A 2XROA 1SFUA 3GZ6A 1SMTA 1GXQA 4UXNA 5L3CA 2VE8A 4U0VA 3ZQ7A 5CLSA 2M8EA 3B02A 1P6RA 3MEXA 2XVCA 3GWZA 3IWFA 2NYXA 2KJBA 5DEQA 2DK8A 4CICA 2GIVA 3ECHA 4LMYA 2F5CA 5FB2A 2OZ6A 2P6SA 3TOBA 1IZ1A 2LNBA 3FXRA 4ON0A 4L9NA 4GGGA 5LBQA 2ISZA 4BQAA 3J81Z 5A2QK 3I0TA 2K4JA 4G7ZF 3GW2A 2E7XA 4UNOA 2PFBA 3ZP5A 3K2ZA 2GAUA 2CQKA 4FHTA 5JR3A 1TTYA 4DQ2A 2EJRA 2ESNA 2P6TA 4R79A 3F8NA 3E3VA 3I5UA 5E8GA 4IVNA 3KZZA 4U7BA 5H6RA 4BAYA 4KMFA 1KQ9A 2A61A 2VC1A 3EYYA 1BI3A 1IXRC 4A6DA 1W5SA 4HLXA 4WF2A 2FBKA 1J59A 3E97A 5KVRA 1BI0A 2QWWA 2YX4A 4D0PA 5DUKA 3N97A 2KIFA 5DCFA 4AD9A 1IN7A 2ISYA 4HF1A 5IT9Z 5DV5A 3WTYC 4MTEA 1BBYA 1A04A 4EJWA 2H94A 1T6SA 3FZVA 1P92A 1XCBA 2QLZA 2D1VA 4P96A 3D5LA 3GLXA 3ULQB 5J8CA 5L3DA 2MH9A 1WQ2A 3ABTA 4JQFA 1O3QA 3FWEA 3CJNA 2ZNYA 1FSEA 4I2OA 1OPCA 3FF5A 1KQ8A 4M9ZA 3EUHA 1H9GA 2DFIA 1H0MA 3PQKA 4Q47A 1E2XA 2RQPA 1I6XA 4EGZA 2YSRA 4N0BA 1IAWA 2DLLA 2IRFG 2DK5A 2RGVA 4IHTA 3Q9VA 5FD5A 2PMUA 2GA1A 5CVJA 1UHWA 1UCRA 2MA3A 1P4XA 2VN2A 3VOEA 1UFMA 2XAGA 1QZYA 1STZA 4WXDA 4N9HA 1GXPA 6PAXA 4I98B 4OOIA 1BI1A 5AIQA 1B9NA 1SD5A 2YU3A 5LGTA 2WC2A 4MQVA 1XGNA 1CF7B 2YX7A 2P4WA 3VFZA 2PMHA 1F4KA 1XMAA 2K27A 2ESHA 4KN4X 3F72A 1I27A 1ZREA 4UVAA 3L2CA 3P9CA 3LSTA 4CYDA 2OZUA 4ENKA 3KEOA 3R0JA 3W6KB 3I64A 3HHGA 2A5YB 1U78A 5HDKA 1UHMA 5LRSA 4B09A 3WGGA 1CGPA 2OD5A 3R6SA 2HQNA 2DU9A 4YFKF 3RTRA 1KU7A 2XV4S 5ICFA 1I1SA 2VT3A 2X4HA 1VTNC 4YIIA 2IT0A 2EA4A 1FSHA 4GCVA 4KYWA 1TW3A 2XAQA 3HYIA 1UB9A 3O3KA 3CUQA 1QNTA 1RI7A 3IKTA 3V4GA 1Z91A 2HTSA 2M5WA 3EYIA 4GYIA 3S2WA 1ZLKA 4HA8A 2OQRA 2QM3A 2K4BA 3QP6A 1LDDA 2V79A 3RYPA 3WE3A 2MLGA 5AONA 1D5VA 1XB4A 2Z9OA 4OMYA 3F22A 4LLGF 4LD5A 3J80Z 2MD5A 1XSXA 2ZFWA 4Y13A 1ZGJA 3P9KA 1R36A 4L5JA 2EV6A 2UXXA 2P5KA 5BMZA 3MQ0A 1HW1A 4G6QA 5ICGA 4L0YB 4ESBA 4U0WA 4Q5SF 1XDUA 1BJAA 1XSVA 5EEHA 2P7CB 4L9JA 1SD4A 3HTUA 5D4SA 2XUBA 4AVPA 3NQOA 2VODA 1O3SA 1EH6A 3KP7A 3FHZA 3HUGA 2P7VB 5FD6A 1EH7A 3J7AO 2R3SA 3P9IA 3GFIA 1BN5A 1V4RA 1XCVA 3I71A 3U1DA 4XLPF 4WK8F 4WXHA 3BOQA 1XD7A 1FZPB 1S29A 1O7FA 1J0RA 5E1XA 2EWNA 2HWVA 2BV6A 4ZYDA 4M9XA 4KMUX 3H3ZA 3T8RA 3ZMSA 4KICA 3QOPA 2L3DA 4MEXF 4HV5A 2Z33A 1EH8A 1FBQA 2JPCA 3JAMK 4P9FA 2PLYA 1QQIA 3CUQB 3TKYA 5E1ZB 4HOBA 3IWZA 3WODF 3HRMA 1REPC 2FOKA 1K78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O57 A;  2O03 A;  2ZCW A;  3I54 A;  1G3Y A;  3IC7 A;  1USS A;  1Z7U A;  1G4D A;  2Q2E A;  1FOK A;  2ZKZ A;  1SD7 A;  1G3T A;  4PGH A;  1RUO A;  5F64 A;  3R0A A;  1BC8 C;  1KU3 A;  1GVJ A;  5K5R A;  3QAH A;  5J6X A;  1B6A A;  1J9I A;  3MWM A;  4IRH A;  3GXO A;  3GUD A;  3HRU A;  3Q5F A;  1LJ9 A;  5DUI A;  2FQ3 A;  4FX4 A;  5H20 A;  1TW2 A;  2UXN A;  2FBH A;  1I5Z A;  1YYV A;  4EGY A;  1D3Y A;  2JSC A;  2MBF A;  2CYY A;  2MLK A;  1SAX A;  2ELH A;  3KZY A;  3PQJ A;  2QQA A;  1XMK A;  2QQB A;  2VBY A;  1AWC A;  1W4M A;  4UHT A;  2LF8 A;  3WE2 A;  3KP3 A;  1ZG5 A;  1LVA A;  3VOD A;  1V3F A;  3BJ6 A;  4MHG A;  1W7P A;  2M30 A;  1YIO A;  5LGN A;  2V1U A;  4HBL A;  3HHH A;  4B8X A;  2COM A;  4O3M A;  4HX4 A;  4I09 A;  1QZZ A;  4G7H F;  2IA2 A;  1EV7 A;  2DTR A;  4KIB A;  3M7G A;  4KT5 C;  4CO8 A;  4RB3 C;  3JTG A;  5HOO A;  1HW2 A;  2J5O A;  2VXZ A;  2ACJ A;  4LGW A;  2DAO A;  3CLO A;  1ON1 A;  2HZT A;  3DP7 A;  1R23 A;  2XAF A;  2V1X A;  2O8X A;  1T0F A;  3NEU A;  3K0L A;  3KP5 A;  4CZZ A;  1J75 A;  4EMS A;  5TRD A;  2DW4 A;  4Y17 A;  3OV8 A;  3QU6 A;  3K1M A;  1S3J A;  3M9A A;  3WTS C;  3ISP A;  2ZBK A;  4MQ9 F;  3SXY A;  3LAP A;  5ILU A;  4L0Z B;  5EEG A;  4EM0 B;  2NAZ A;  2XAH A;  3P7N A;  4HDV A;  3JSO A;  2O3F A;  3JTH A;  4I0B A;  2KRF A;  2M45 A;  5LRR A;  3HSR A;  5L3E A;  2F2E A;  4RB2 C;  1L3L A;  4MTD A;  3ZMD A;  1U5T B;  1HST A;  3EQL F;  4EV0 A;  1FNN A;  4R1H A;  3DF8 A;  3V7S A;  3MFK A;  1Z6R A;  1U5T A;  3ZMU A;  4HV6 A;  4GO1 A;  2AXL A;  1J2X A;  3V8J A;  4CDG A;  5HLI A;  1YLF A;  4LB6 B;  2CFX A;  2RV8 A;  4RGU A;  3SFZ A;  5FFX A;  3BJA A;  1YW9 A;  3FXQ A;  1BI2 A;  2F5E A;  3AAF A;  1IXC A;  4I7H A;  2OU2 A;  2EFP A;  1XGO A;  2K7L A;  4HF0 A;  2VBZ A;  2ZO4 A;  3V7C A;  2DI3 A;  1LNW A;  2IPQ X;  2ZJ2 A;  3L9F A;  2IW5 A;  1YS7 A;  1WKM A;  5KK1 A;  3WU0 A;  4F7Z A;  1IRF A;  5D5U B;  2NS0 A;  3BP8 A;  4HX7 A;  5JI6 A;  3BZ6 A;  2A3S A;  2ZXJ A;  4IF4 A;  3LA2 A;  1FP2 A;  5FO5 A;  2HKX A;  3F23 A;  2RDP A;  1XSD A;  3BPX A;  3TO9 A;  1WRJ A;  1B4A A;  3ERE D;  5JHU A;  4O6J A;  2QBY B;  4L5I A;  2Q0O A;  2UZK A;  3KLO A;  1F9N A;  3ZMZ A;  3JSP A;  2JRT A;  3CUO A;  1SMY F;  4UUV A;  3M8E A;  2CO5 A;  1ZN2 A;  4U88 A;  2DQL A;  4M74 A;  1R5H A;  1YQA A;  4A5M A;  5BPI A;  1TNS A;  2FU4 A;  3V8L A;  1KU9 A;  2K02 A;  3TO7 A;  2LKP A;  3QRF F;  4LG0 A;  2RKH A;  1TNT A;  2HEO A;  3MZH A;  1Z05 A;  2NNN A;  5CYV A;  2OQG A;  4A12 A;  4BNC A;  3IRR A;  2FRH A;  2W57 A;  1JGS A;  3GF2 A;  3ZMV A;  3QPH A;  4IXA A;  5DDG A;  3DPL C;  3QU3 A;  3RKX A;  4IJA A;  4CXF A;  4NHJ A;  1G3S A;  4ESJ A;  1JHH A;  1FYK A;  2QQ9 A;  4WXC A;  1BM9 A;  3SHF A;  4UVB A;  2HYF A;  1FLI A;  4XLN F;  5D6E A;  5LGU A;  1WI9 A;  4KUM A;  3TGN A;  1RIO H;  4WWC A;  5E18 F;  1IF1 A;  4KIF A;  3KCC A;  2G9W A;  1SFX A;  2PBI A;  3R61 A;  1KU2 A;  3WTW C;  3EET A;  3G73 A;  1SD6 A;  2V9V A;  4NQW A;  4ZYE A;  4HDU A;  1YFH A;  2PQ8 A;  2WTE A;  4BHC A;  4P9U A;  1K78 B;  3G3Z A;  3ZN0 A;  4PGG A;  1P4W A;  1UST A;  1QBJ A;  4QWQ A;  3JAM Z;  3H92 A;  2V1D A;  4KNY A;  3C7J A;  1FWZ A;  2XGX A;  2PEX A;  2ZNZ A;  1FT9 A;  3K1P A;  3SQN A;  4HLY A;  3KP2 A;  5CJ9 A;  1ZH5 A;  4M73 A;  1LB2 A;  2Z3Y A;  2RN7 A;  1T2K A;  4HQE A;  3LA7 A;  3F8F A;  3KP6 A;  2QZ8 A;  3ECO A;  2CGP A;  1X3U A;  3ML6 A;  4PDK A;  2IA0 A;  5HVQ C;  1LEB A;  2RNJ A;  4RB0 A;  2EFW A;  3ELK A;  1U2W A;  3WTU C;  2HOE A;  4O5V A;  3GVA A;  4G6D A;  5A2Q Z;  1MDM A;  4ZZL A;  2EB7 A;  1YO5 C;  2HTJ A;  2AS5 F;  3LFK A;  4GXO A;  3R60 A;  2Z99 A;  1JHF A;  3SZT A;  5D4R A;  5L3F A;  1R1T A;  2NNY A;  4LLN A;  1DP7 P;  1U6G A;  5DCM B;  3EDP A;  2O61 A;  5BQT A;  2PJP A;  3K69 A;  5ICC A;  5IT9 K;  4A2U A;  5ERI A;  1OYY A;  3LWF A;  1G6N A;  1HBX G;  2IJL A;  2HFH A;  2GZW A;  2W25 A;  3I59 A;  2EK5 A;  4XRF A;  2E1N A;  4MGR A;  1C0W A;  4Q4Z F;  3VEP A;  3W6J B;  3HSF A;  3ROU A;  3DKW A;  1MKM A;  3O2P E;  4FT8 A;  4RGR A;  4UV9 A;  3REO A;  3CTA A;  4OMZ A;  3LA3 A;  4YFN F;  1S7A A;  1NHA A;  5ILS A;  3GO5 A;  1IXS B;  1ULY A;  4OIN F;  3RIR A;  4ZZD A;  3PFI A;  2VBW A;  4H0E A;  2C6Y A;  2Y48 A;  2UWM A;  3J81 K;  2P5V A;  4EJU A;  4I01 A;  5JVT A;  3FM5 A;  2FEZ A;  1AOY A;  1QO0 D;  2Q8K A;  5HS7 A;  2ZME A;  3MCZ A;  2A6H F;  2LSO A;  1RZ4 A;  1KYW A;  3IHU A;  3RDI A;  4KA4 A;  4I02 A;  5HS8 A;  3U2R A;  4P5O A;  3DXJ F;  2EV5 A;  3H3U A;  1BIB A;  5IT3 A;  1W7P B;  3R4K A;  3I58 A;  1ZRD A;  4L9V A;  2V6C A;  1XGS A;  1R1V A;  1MJA A;  1B9M A;  3QPT A;  2Z5U A;  4ENM A;  2FML A;  3BRO A;  3M1E A;  2FMY A;  3KFW X;  5FLX Z;  4K2E A;  4A5N A;  2OAZ A;  3IKV A;  2HDC A;  3WTX C;  4Y15 A;  1YW7 A;  5LEK A;  3RPU A;  4IHS A;  4KDP A;  5FFZ A;  3GFL A;  2DBB A;  3KE2 A;  1YG2 A;  4Z2Y A;  2VBX A;  2PN6 A;  1P4A A;  2WV0 A;  4BH9 A;  4EJT A;  1DUX C;  2O0Y A;  2OA4 A;  4P55 A;  1R1U A;  4EM2 A;  4RB1 A;  4S04 A;  2DPD A;  4BXU A;  1S6L A;  4A0Y A;  3DFG A;  2X0L A;  3WGH A;  1ZHF A;  1E17 A;  2W24 A;  3T5X A;  1S7O A;  2KJC A;  2HQR A;  1R58 A;  1IRG A;  2G7U A;  4WCG A;  2L4M A;  4R8H A;  3WTZ A;  4QLC U;  1BC7 C;  3GZ5 A;  1ONV A;  1DPU A;  1SFE A;  3FMR A;  1P2F A;  2CSO A;  1PDN C;  3WTV C;  2EFQ A;  2F5D A;  1PP8 F;  3QP5 A;  1GHC A;  2E7W A;  1QPM A;  4EJO A;  4M72 A;  2VE9 A;  1U3E M;  1W7P D;  1KGS A;  2D45 A;  4U7D A;  4HF2 A;  1Q1H A;  2QYO A;  5HDN A;  4OU0 A;  1WWX A;  1H9T A;  3LAJ A;  1LDJ A;  5HDG A;  4JK1 X;  3COA C;  4KIG A;  1PP7 U;  4OIP F;  1T98 A;  1G3W A;  1MD0 A;  5CVR A;  1TQP A;  5ICE A;  1PUE E;  3FM3 A;  4L9T A;  1O7L A;  5ED4 A;  1T38 A;  2GA2 A;  3F8B A;  2BYV E;  3I59 B;  2FSW A;  4LK1 F;  2HYG D;  2J5P A;  4CGZ A;  4RS8 A;  1IN8 A;  2BEO A;  1ZG1 A;  1FC3 A;  2R7D A;  3O6B B;  1XGM A;  3CO7 C;  3Q9S A;  4HZF A;  1FPQ A;  3HRT A;  2HKO A;  2DT5 A;  3HOT A;  2XAS A;  5DCM A;  5D5V B;  3WTT C;  2E1C A;  1O3R A;  4IPA A;  2QEN A;  5L3G A;  4Q48 A;  2KIU A;  3F3X A;  1JXS A;  3KP4 A;  1FYM A;  1FYL A;  2EFN A;  4M6X A;  1R22 A;  5HLG A;  1OR7 A;  1QGP A;  4AIH A;  3E5U A;  5CVI A;  1K6O A;  4KFC A;  2FA5 A;  2W85 A;  4N9I A;  1KA8 A;  2OBP A;  4LB5 A;  3T0Y A;  1J7K A;  4TV7 A;  3IL2 A;  5F6F A;  3GEZ A;  4YIF A;  3M8F A;  1ZLJ A;  2RVC A;  5D6F A;  3T8T A;  5BPD A;  3F6O A;  2ADU A;  3V8K A;  3N4M A;  4WX9 A;  2D2W A;  4AWX B;  1ON2 A;  5H6Q A;  2FF4 A;  4XSX F;  2VOO A;  4RGX A;  1OYW A;  4A0X A;  4EVI A;  1ZAR A;  4IRG A;  1FY7 A;  4KN7 X;  2R7F A;  1MJB A;  4M71 A;  2PG4 A;  2VON A;  3CO6 C;  5L3B A;  2KIM A;  2Y0M A;  2DQR A;  1MDM B;  1TQM A;  1KYZ A;  4G8X A;  4S05 A;  4ZYH A;  4ZYG A;  4EM1 A;  5HS9 A;  1LDK B;  3F21 A;  2QUF A;  2M87 A;  2IP2 A;  1MJ9 A;  2XRN A;  5ILV A;  5D8L B;  1Z1D A;  4ASN A;  4ENN A;  2GQQ A;  1KQ0 A;  3HRS A;  3L7W A;  3GFM A;  3HOS A;  2NRA C;  4OIQ F;  4OIR F;  3F8M A;  2K86 A;  1T39 A;  5TJJ A;  4EQQ A;  5LEJ A;  4HQM A;  3BPV A;  1FX7 A;  4OIO F;  5BS6 A;  3D0S A;  2H6C A;  4LJZ F;  4CHU A;  2A6E F;  1OKR A;  4LK0 F;  3SZP A;  3IRQ A;  2IVM A;  4EJV A;  2JTV A;  2CG4 A;  2L02 A;  3FX3 A;  2MH2 A;  3E5Q A;  2EA2 A;  2HR3 A;  2FXA A;  2XKP A;  1I1G A;  5LHI A;  2ZME C;  5FLX K;  2XAJ A;  2M1B A;  4UVC A;  4MNU A;  2L01 A;  3ABU A;  1F1Z A;  2H09 A;  4DNC A;  3L09 A;  3J80 K;  1ZRC A;  5F1R A;  4ENJ A;  4LLL A;  1HKS A;  1RNL A;  5LHH A;  4BYY A;  3MAJ A;  2QBY A;  1ODD A;  1U5T C;  3DEU A;  5JFR A;  1YW8 A;  4BHB A;  4MEY F;  1R5G A;  1LQ1 A;  1HW5 A;  1HQC A;  5K5O A;  2A07 F;  2VT2 A;  3BDD A;  3GFJ A;  5DD8 A;  2FBI A;  5D5W B;  4A0Z A;  1HKT A;  5D5X B;  2CW0 F;  4LG0 B;  2D1H A;  3ZN1 A;  5CVV A;  3E6C C;  3JW4 A;  4HYE A;  3I4P A;  1HSJ A;  2JT1 A;  3DQV C;  2LF7 A;  4IRI A;  2O6G E;  3K9T A;  4RAZ A;  3I53 A;  2FNA A;  1J5Y A;  4I0A A;  2YPR A;  2ZME B;  4YG2 F;  3E6M A;  1MGT A;  2H6B A;  3MZY A;  1FBS A;  2KKO A;  3KLN A;  1W5T A;  5E20 A;  2VC0 A;  2ETH A;  2CWE A;  2A69 F;  2BBY A;  5LHG A;  1BOA A;  3TDU C;  3TOA A;  3BWG A;  5E8I A;  4E70 A;  3DV8 A;  1K79 A;  5CVU A;  1Z9C A;  4ZH4 F;  1ZG3 A;  1IN4 A;  3RI4 A;  4M6Y A;  2P8T A;  3TO6 A;  3OOP A;  3ZPL A;  1DPR A;  4RGS A;  2H27 A;  1BIA A;  5BOX A;  1IUY A;  2G7H A;  5AIP A;  3ZMT A;  1S8N A;  1TLH B;  5K5Q A;  4A6E A;  2EFO A;  3TQN A;  1XDS A;  3LQR A;  4GYG A;  1U8R A;  5E17 F;  1TBX A;  3F6V A;  1RUN A;  1K7A A;  2BE5 F;  4ESF A;  3C1D A;  2LDU A;  3C3W A;  5J8F A;  4XBF A;  3C18 A;  4M9S A;  2XKO A;  4U0Y A;  3NRV A;  1OYI A;  3KEQ A;  1YS6 A;  2GWR A;  5LLQ A;  3HSE A;  4PZJ A;  2P5L C;  1O3T A;  4BHP A;  5HLH A;  2WWY A;  3E5X A;  1ZGA A;  1WSU A;  2BGC A;  2L4A A;  1IN5 A;  1MZB A;  5E1W A;  4G9Y A;  2PI0 A;  1B59 A;  2L54 A;  1ZYR F;  2HS5 A;  4NB5 A;  1Z6T A;  2GXG A;  4L18 B;  3L00 A;  5DD4 A;  4AIJ A;  3LQQ A;  3U9G A;  3FMQ A;  4ETS A;  4HAM A;  3TDZ C;  3DPT A;  1D8J A;  2STW A;  3RKY A;  3CUQ C;  3E6D A;  4FX0 A;  2GXB A;  2XHK A;  4YFX F;  1LEA A;  3FXU A;  2FE3 A;  2JPB A;  4RAY A;  3BJO A;  3RPQ A;  1IW7 F;  4G94 A;  3B73 A;  2B0L A;  1Y0U A;  3F8C A;  4HX8 A;  1R00 A;  5DYM A;  1FBU A;  3WGI A;  5K1Y A;  3WU1 B;  2STT A;  1HXD A;  2IA1 A;  2A68 F;  2QVO A;  1IN6 A;  4AIK A;  5D8K B;  3CDH A;  4XSZ F;  1HKQ A;  1XN7 A;  1OMI A;  3RKW A;  1YTY A;  4G7O F;  1L0O C;  2VOP A;  2HGC A;  5FGM A;  3BY6 A;  3HTS B;  1ZRF A;  2EV0 A;  1CF7 A;  4LFU A;  1ZAO A;  4UV8 A;  3FMS A;  3WG9 A;  3E6B A;  2TDX A;  2F5F A;  3GX4 X;  1B1B A;  3RYR A;  1JE8 A;  3K1N A;  1D8K A;  4HW0 A;  4PCQ A;  4JBA A;  1TQI A;  2RC4 A;  2XIG A;  1DDN A;  2MC3 A;  3VB2 A;  2DPU A;  2Y75 A;  3KET A;  1F5T A;  2W84 A;  1FP1 D;  3V7R A;  2FNP A;  3T1B A;  3GYH X;  2JZY A;  3RJP A;  2YR2 A;  1R7J A;  3HIF A;  2DO7 A;  2XRO A;  1SFU A;  3GZ6 A;  1SMT A;  1GXQ A;  4UXN A;  5L3C A;  2VE8 A;  4U0V A;  3ZQ7 A;  5CLS A;  2M8E A;  3B02 A;  1P6R A;  3MEX A;  2XVC A;  3GWZ A;  3IWF A;  2NYX A;  2KJB A;  5DEQ A;  2DK8 A;  4CIC A;  2GIV A;  3ECH A;  4LMY A;  2F5C A;  5FB2 A;  2OZ6 A;  2P6S A;  3TOB A;  1IZ1 A;  2LNB A;  3FXR A;  4ON0 A;  4L9N A;  4GGG A;  5LBQ A;  2ISZ A;  4BQA A;  3J81 Z;  5A2Q K;  3I0T A;  2K4J A;  4G7Z F;  3GW2 A;  2E7X A;  4UNO A;  2PFB A;  3ZP5 A;  3K2Z A;  2GAU A;  2CQK A;  4FHT A;  5JR3 A;  1TTY A;  4DQ2 A;  2EJR A;  2ESN A;  2P6T A;  4R79 A;  3F8N A;  3E3V A;  3I5U A;  5E8G A;  4IVN A;  3KZZ A;  4U7B A;  5H6R A;  4BAY A;  4KMF A;  1KQ9 A;  2A61 A;  2VC1 A;  3EYY A;  1BI3 A;  1IXR C;  4A6D A;  1W5S A;  4HLX A;  4WF2 A;  2FBK A;  1J59 A;  3E97 A;  5KVR A;  1BI0 A;  2QWW A;  2YX4 A;  4D0P A;  5DUK A;  3N97 A;  2KIF A;  5DCF A;  4AD9 A;  1IN7 A;  2ISY A;  4HF1 A;  5IT9 Z;  5DV5 A;  3WTY C;  4MTE A;  1BBY A;  1A04 A;  4EJW A;  2H94 A;  1T6S A;  3FZV A;  1P92 A;  1XCB A;  2QLZ A;  2D1V A;  4P96 A;  3D5L A;  3GLX A;  3ULQ B;  5J8C A;  5L3D A;  2MH9 A;  1WQ2 A;  3ABT A;  4JQF A;  1O3Q A;  3FWE A;  3CJN A;  2ZNY A;  1FSE A;  4I2O A;  1OPC A;  3FF5 A;  1KQ8 A;  4M9Z A;  3EUH A;  1H9G A;  2DFI A;  1H0M A;  3PQK A;  4Q47 A;  1E2X A;  2RQP A;  1I6X A;  4EGZ A;  2YSR A;  4N0B A;  1IAW A;  2DLL A;  2IRF G;  2DK5 A;  2RGV A;  4IHT A;  3Q9V A;  5FD5 A;  2PMU A;  2GA1 A;  5CVJ A;  1UHW A;  1UCR A;  2MA3 A;  1P4X A;  2VN2 A;  3VOE A;  1UFM A;  2XAG A;  1QZY A;  1STZ A;  4WXD A;  4N9H A;  1GXP A;  6PAX A;  4I98 B;  4OOI A;  1BI1 A;  5AIQ A;  1B9N A;  1SD5 A;  2YU3 A;  5LGT A;  2WC2 A;  4MQV A;  1XGN A;  1CF7 B;  2YX7 A;  2P4W A;  3VFZ A;  2PMH A;  1F4K A;  1XMA A;  2K27 A;  2ESH A;  4KN4 X;  3F72 A;  1I27 A;  1ZRE A;  4UVA A;  3L2C A;  3P9C A;  3LST A;  4CYD A;  2OZU A;  4ENK A;  3KEO A;  3R0J A;  3W6K B;  3I64 A;  3HHG A;  2A5Y B;  1U78 A;  5HDK A;  1UHM A;  5LRS A;  4B09 A;  3WGG A;  1CGP A;  2OD5 A;  3R6S A;  2HQN A;  2DU9 A;  4YFK F;  3RTR A;  1KU7 A;  2XV4 S;  5ICF A;  1I1S A;  2VT3 A;  2X4H A;  1VTN C;  4YII A;  2IT0 A;  2EA4 A;  1FSH A;  4GCV A;  4KYW A;  1TW3 A;  2XAQ A;  3HYI A;  1UB9 A;  3O3K A;  3CUQ A;  1QNT A;  1RI7 A;  3IKT A;  3V4G A;  1Z91 A;  2HTS A;  2M5W A;  3EYI A;  4GYI A;  3S2W A;  1ZLK A;  4HA8 A;  2OQR A;  2QM3 A;  2K4B A;  3QP6 A;  1LDD A;  2V79 A;  3RYP A;  3WE3 A;  2MLG A;  5AON A;  1D5V A;  1XB4 A;  2Z9O A;  4OMY A;  3F22 A;  4LLG F;  4LD5 A;  3J80 Z;  2MD5 A;  1XSX A;  2ZFW A;  4Y13 A;  1ZGJ A;  3P9K A;  1R36 A;  4L5J A;  2EV6 A;  2UXX A;  2P5K A;  5BMZ A;  3MQ0 A;  1HW1 A;  4G6Q A;  5ICG A;  4L0Y B;  4ESB A;  4U0W A;  4Q5S F;  1XDU A;  1BJA A;  1XSV A;  5EEH A;  2P7C B;  4L9J A;  1SD4 A;  3HTU A;  5D4S A;  2XUB A;  4AVP A;  3NQO A;  2VOD A;  1O3S A;  1EH6 A;  3KP7 A;  3FHZ A;  3HUG A;  2P7V B;  5FD6 A;  1EH7 A;  3J7A O;  2R3S A;  3P9I A;  3GFI A;  1BN5 A;  1V4R A;  1XCV A;  3I71 A;  3U1D A;  4XLP F;  4WK8 F;  4WXH A;  3BOQ A;  1XD7 A;  1FZP B;  1S29 A;  1O7F A;  1J0R A;  5E1X A;  2EWN A;  2HWV A;  2BV6 A;  4ZYD A;  4M9X A;  4KMU X;  3H3Z A;  3T8R A;  3ZMS A;  4KIC A;  3QOP A;  2L3D A;  4MEX F;  4HV5 A;  2Z33 A;  1EH8 A;  1FBQ A;  2JPC A;  3JAM K;  4P9F A;  2PLY A;  1QQI A;  3CUQ B;  3TKY A;  5E1Z B;  4HOB A;  3IWZ A;  3WOD F;  3HRM A;  1REP C;  2FOK A;  1K78 A; 
#chains in the Genus database with same CATH topology
 1O57 A;  2O03 A;  1ETQ A;  2ZCW A;  3I54 A;  2O5R A;  5LD2 C;  1G3Y A;  3OR1 C;  2VL8 A;  3IC7 A;  4E7Z A;  1A36 A;  1HOM A;  1USS A;  1Z7U A;  1JT6 A;  4V2G A;  1G4D A;  2Q2E A;  1FOK A;  2BY1 A;  2ZKZ A;  4BAC A;  1KON A;  2DJI A;  2M8G X;  1EKE A;  2XF7 A;  4PJM A;  1SD7 A;  1U8B A;  1G3T A;  3Q0V A;  2JSP A;  2GIZ A;  1VQ7 I;  4PGH A;  4NDL A;  4BBR J;  1MNM C;  3OYF A;  5C44 J;  1RUO A;  4N4N B;  5F64 A;  2R7W A;  2R5Z B;  3BR5 A;  2KL4 A;  1X4P A;  3A0B C;  3O8H A;  3R0A A;  1BC8 C;  1KU3 A;  3K4L A;  2KZG A;  1GVJ A;  5K5R A;  3QAH A;  5J6X A;  1FJL A;  1B6A A;  1J9I A;  2ZSH B;  3MWM A;  4C3J J;  4IRH A;  3GXO A;  3GUD A;  3HRU A;  3Q5F A;  5B5E C;  1LJ9 A;  1WPK A;  2E2H J;  4CCL A;  5DUI A;  2FQ3 A;  1R4N B;  4FX4 A;  1OR7 C;  1ORK A;  3DEE A;  3F9K A;  1TWG J;  4Y4R A;  5H20 A;  1TW2 A;  2UXN A;  2OCC H;  5J1U A;  4MFD A;  4M3D A;  2FBH A;  1I5Z A;  1YYV A;  2MD0 A;  4EGY A;  1D3Y A;  2JSC A;  2XF5 A;  2MBF A;  2CYY A;  2MLK A;  2KDO A;  1SAX A;  2ELH A;  2FJ1 A;  3CC4 I;  3KZY A;  3PQJ A;  2QQA A;  1XMK A;  2HQA A;  3ZRG A;  4X0G A;  1S9H A;  2LY9 A;  2QQB A;  5EGO A;  2VBY A;  1RR8 C;  1AWC A;  1W4M A;  4DGW B;  2EZL A;  5FRO A;  3G4S I;  2OC6 A;  4UHT A;  1T0F C;  2LF8 A;  3WE2 A;  3KP3 A;  3F0C A;  5JLX A;  1ZG5 A;  5M3F J;  1LVA A;  2LRE A;  3J7Y J;  3VOD A;  1V3F A;  2Y2Z A;  3BJ6 A;  4MHG A;  1W7P A;  2M30 A;  1YIO A;  5LGN A;  1WJE A;  3D1N I;  1GUU A;  2V1U A;  1X3Z B;  1U9N A;  4HBL A;  3HHH A;  1IG7 A;  3CC2 I;  2JK3 A;  4B8X A;  3LL7 A;  2EIN H;  4XMY A;  2COM A;  4I99 C;  2R7R A;  1JKR C;  4O3M A;  4HX4 A;  1R49 A;  4I09 A;  1QZZ A;  2TRT A;  4KIS A;  1VQ6 I;  4G7H F;  2IA2 A;  3S16 J;  2LR8 A;  1EV7 A;  2DTR A;  3JRC A;  1FMW A;  4KIB A;  3M7G A;  4KT5 C;  1JKO C;  3TP3 A;  4CO8 A;  4DIQ A;  4Y7N J;  4RB3 C;  3JTG A;  5HOO A;  1SAU A;  1HW2 A;  3CCR I;  3JRF A;  2J5O A;  2VXZ A;  4HSR A;  2ACJ A;  4LGW A;  3G6E I;  2DAO A;  4BE0 A;  2CV0 A;  3CLO A;  2R5Z A;  1ON1 A;  2HZT A;  3DP7 A;  1R23 A;  1W36 C;  2XAF A;  4A93 J;  2V1X A;  3DWL E;  2O8X A;  1T0F A;  5B1B H;  3NEU A;  3HKZ N;  3K0L A;  3PUF A;  3QYF A;  3KP5 A;  2CQQ A;  4ZDL A;  4CZZ A;  4EMS A;  1J75 A;  4BXX J;  1K4S A;  2CUE A;  5TRD A;  2DW4 A;  4Y17 A;  1NG6 A;  2AHQ A;  3OV8 A;  3HBL A;  5IOZ A;  1SC7 A;  3QU6 A;  3H9G A;  1MMG A;  2QSF X;  3K1M A;  1EF4 A;  1S3J A;  3M9A A;  3WTS C;  3ISP A;  2ZBK A;  4MQ9 F;  3SXY A;  2VQG A;  2CV2 A;  2X48 A;  3LAP A;  5ILU A;  2I5U A;  4L0Z B;  5EEG A;  4EM0 B;  3H5A A;  2NAZ A;  2XAH A;  2CQX A;  5GPA A;  4UY8 I;  3CES A;  3P7N A;  3OL4 A;  2BVL A;  2HOA A;  3S15 J;  3LSH A;  4HDV A;  1D1A A;  2ME6 A;  2EBI A;  2X1C A;  3JSO A;  2M3A A;  2O3F A;  4U87 A;  3JTH A;  4XLE A;  1YIJ I;  4I0B A;  2KRF A;  2WV1 A;  3HM5 A;  1E3H A;  1MBE A;  2DMQ A;  4AC0 A;  5M3M J;  2M45 A;  1DGW Y;  4DOZ A;  2LYC A;  5LRR A;  1P7I A;  3HSR A;  2F4I A;  5L3E A;  3H1C A;  5FLM J;  2OTJ I;  4RM2 A;  2F2E A;  4RB2 C;  1L3L A;  2A6T A;  3ZMD A;  4MTD A;  4LIT A;  3SJM A;  2F6C A;  1U5T B;  1HST A;  1X1P A;  3EQL F;  4QIW N;  3JRD A;  4EV0 A;  3DU6 A;  1FNN A;  3ZGK A;  3MMY B;  1M1E B;  4R1H A;  3DF8 A;  5E79 C;  1ETO A;  5E3N A;  2F5V A;  2PMZ A;  2L7M P;  3V7S A;  1AU7 A;  3MFK A;  2E71 A;  4EEF G;  1Z6R A;  4BJ6 C;  1U5T A;  3ZMU A;  4HV6 A;  2IS6 A;  4GO1 A;  2AXL A;  1J2X A;  3V8J A;  1TC3 C;  2X1D A;  1GDT A;  1ITY A;  4CDG A;  3IP4 B;  5FKK A;  5HLI A;  1UEL B;  2JRM A;  1YLF A;  4LB6 B;  3OR2 C;  1FIP A;  1XS9 A;  2CFX A;  1MBH A;  2RV8 A;  3BR6 A;  4RGU A;  3SFZ A;  5FFX A;  3BJA A;  1I3Q J;  5IOY A;  2R4G A;  1YW9 A;  4BJT A;  3FXQ A;  4XM3 A;  2BY3 A;  2GBY A;  1BI2 A;  4FTH A;  2F5E A;  1QU3 A;  2L9S A;  3AG3 H;  3AAF A;  2EZI A;  2E60 A;  3LMM A;  3NAU A;  1IXC A;  4I7H A;  3ABM H;  4IQ4 A;  3HUG B;  1VFC A;  3CF2 A;  2Y9Z A;  1X1B A;  2OU2 A;  2EFP A;  1OCZ H;  2QQ8 A;  3ZQG A;  4P1W A;  2H8W A;  1XGO A;  1IV6 A;  4X6A J;  4PJN A;  1WHU A;  4M3E A;  3OYA A;  1Y0N A;  2K7L A;  1IV8 A;  4HF0 A;  2V9P A;  2VBZ A;  2ZO4 A;  3V7C A;  2DI3 A;  1LNW A;  2WAE A;  2IPQ X;  2WA0 A;  2ZJ2 A;  2Y0S A;  3H35 A;  3L9F A;  1VI0 A;  2IW5 A;  1YS7 A;  3BZC A;  5GAH J;  1WKM A;  3K4B A;  5KK1 A;  5E3L A;  3WU0 A;  4B47 A;  2DYR H;  4F7Z A;  1VF9 A;  3HOV J;  5FJ8 J;  1IRF A;  1BR1 A;  4MO7 A;  5D5U B;  5K7Z A;  2LBF B;  2NS0 A;  3BP8 A;  4QPO A;  4HX7 A;  2R7T A;  4A3L J;  1MMA A;  2AQF A;  5JI6 A;  3BZ6 A;  2R7Q A;  4JX4 A;  2A3S A;  2ZXJ A;  4UB6 C;  3I4M J;  4IF4 A;  3OYH A;  4BUP A;  3OYK A;  3LA2 A;  2KDZ A;  3S3M A;  1FP2 A;  3DPU A;  1LFP A;  5FO5 A;  1B72 A;  2HKX A;  3OYD A;  3F23 A;  2RDP A;  1MBJ A;  1XSD A;  3K6G A;  3BPX A;  3TO9 A;  1WRJ A;  1B4A A;  1PUF A;  3ESW B;  3ERE D;  5JHU A;  3OSG A;  4O6J A;  2QBY B;  1QZE A;  3CP8 A;  4L5I A;  2Q0O A;  2K3F A;  2UZK A;  3KLO A;  1F9N A;  3ZMZ A;  3VYT B;  3GTM J;  3JSP A;  2JRT A;  3CUO A;  3PSF A;  4FE4 A;  2JVH A;  2LP0 A;  2XRL A;  1SMY F;  4JX5 A;  4UUV A;  2LLK A;  3M8E A;  1X1C A;  3GTQ J;  2CO5 A;  1ZN2 A;  4U88 A;  2L9V A;  2ID6 A;  2DXI A;  1YJW I;  3G71 I;  2DQL A;  4M74 A;  1R5H A;  1QA6 A;  1YQA A;  1QRY A;  4A5M A;  3A0H C;  5FLV A;  3Q0W A;  5BPI A;  1TNS A;  2FU4 A;  2JUG A;  3OY9 A;  3V8L A;  1KU9 A;  3LSJ A;  2HOT A;  2K02 A;  4M6V A;  2WAD A;  3CJQ B;  3TO7 A;  4KJZ A;  2GM4 A;  2LKP A;  2MSY A;  3I4N J;  1OFC X;  3QRF F;  3FBN B;  3OS1 A;  1HLV A;  4LG0 A;  1B8I B;  3MVP A;  2RKH A;  3GZN B;  4OAZ A;  4XL9 A;  1TNT A;  4YIR X;  2HEO A;  3MZH A;  1Z05 A;  2NNN A;  2YUS A;  2HXI A;  2DFE A;  2JA6 J;  1BR4 A;  1Y39 A;  4D5C A;  3FHN A;  5CYV A;  2OQG A;  2XPU A;  4A12 A;  1A31 A;  3I3L A;  2NVX J;  2OF7 A;  4NUB A;  4BNC A;  3IRR A;  2FRH A;  2R5Y A;  2W57 A;  1JGS A;  3KYC B;  1G59 A;  3GF2 A;  2IS1 A;  3ZMV A;  4B43 A;  4B3X A;  2F4O B;  2IBD A;  4UB8 C;  1MND A;  3QPH A;  4D7M A;  4IXA A;  5DDG A;  3DPL C;  3QU3 A;  2HZD A;  3LSI A;  3RKX A;  4IJA A;  4Z6Y A;  4CXF A;  1W36 D;  2XSD C;  4D5F A;  4NHJ A;  2E5Z A;  1G3S A;  1QHH D;  5DM7 F;  1A6Q A;  4ESJ A;  1JHH A;  1ERD A;  3FK7 A;  1FYK A;  2QQ9 A;  4WXC A;  1BM9 A;  3SHF A;  4UVB A;  2HYF A;  1FLI A;  4XLN F;  5GTH C;  1MH3 A;  4A3C J;  2UUZ A;  5D6E A;  2BHY A;  2JQ7 A;  5LGU A;  1WI9 A;  4KUM A;  4QTR A;  3TGN A;  2FD5 A;  1RIO H;  2H1K A;  4WWC A;  1JTY A;  5E18 F;  1IF1 A;  4KIF A;  2E2J J;  2VKD A;  3FDY A;  4XKW A;  3WHC A;  2DYS H;  3KCC A;  3TP0 A;  2G9W A;  1SFX A;  2PBI A;  3R61 A;  1KU2 A;  3DLA A;  3WTW C;  3EET A;  3G73 A;  2PMZ N;  1SD6 A;  2V9V A;  4NQW A;  4ZYE A;  4HDU A;  1A35 A;  1YFH A;  1MMS A;  2PQ8 A;  2Q2E B;  2WTE A;  1V54 H;  3BG5 A;  4BHC A;  4P9U A;  1OCT C;  3OIO A;  4BDY A;  2NOJ B;  1T08 B;  2DA2 A;  1K78 B;  3G3Z A;  4EAT A;  3IAS 2;  3ZN0 A;  4PGG A;  1P4W A;  1UST A;  2M9H A;  1QBJ A;  3S14 J;  4QWQ A;  3JAM Z;  3H92 A;  1RPW A;  2GOM A;  2V1D A;  4LOC A;  4KNY A;  2QSH X;  3PNY A;  3C7J A;  3FXM A;  1FWZ A;  3ZR8 X;  2XGX A;  2PEX A;  1TZL A;  3CD6 I;  2PJR A;  2KFD A;  2ZNZ A;  2H8R A;  1FT9 A;  2O7O A;  1BW5 A;  3K1P A;  1RKT A;  3SQN A;  4HLY A;  1R71 A;  5E3O A;  3KP2 A;  1XPX A;  3OWT A;  2JA2 A;  5CJ9 A;  1ZH5 A;  3CZ6 A;  5KAI C;  4M73 A;  1LB2 A;  2Z3Y A;  5GP9 A;  3FKJ A;  3BCB A;  3KEY A;  1PUF B;  2RN7 A;  2DOA A;  1T2K A;  1Z67 A;  2VQC A;  4HQE A;  3OYI A;  1XTA A;  3LA7 A;  3F8F A;  3KP6 A;  1YJ9 I;  2QZ8 A;  3ECO A;  2CGP A;  1X3U A;  3ML6 A;  4PDK A;  2QA4 I;  4XIC A;  2IA0 A;  4ANJ A;  2FUG 2;  5HVQ C;  1LEB A;  2RNJ A;  4RB0 A;  2VJI A;  2EIM H;  3OYN A;  2V1N A;  2EFW A;  3ELK A;  1U2W A;  3WTU C;  2HOE A;  2RQQ A;  3KYD B;  2L0K A;  4O5V A;  1MIJ A;  1O4X A;  3GVA A;  2V26 A;  4G6D A;  3ASO H;  5A2Q Z;  1MDM A;  2M0C A;  4ZZL A;  5HNF A;  3L2V A;  3GTG J;  4HNV A;  2EB7 A;  2FQ4 A;  2DOF A;  3H5N A;  3BC8 A;  1YO5 C;  2HTJ A;  2VIX A;  3G1O A;  4DYQ A;  2AS5 F;  2JWT A;  3LFK A;  4AUX A;  1SFO J;  4GXO A;  3CMA I;  4DZJ A;  1QHG A;  3R60 A;  2Z99 A;  1JHF A;  2KMU A;  3SZT A;  5D4R A;  5L3F A;  1R1T A;  2I10 A;  3DEW A;  1MSF C;  1WJF A;  1TT5 B;  2NNY A;  5JHF A;  3TW6 A;  4LLN A;  2VQL A;  1DP7 P;  1U6G A;  1ZQ3 P;  5DCM B;  3L2Q A;  4GRI A;  3EDP A;  4BJ5 C;  2O61 A;  5BQT A;  2PJP A;  3GTO J;  3K69 A;  1JJ6 C;  5ICC A;  4RAF A;  2DA6 A;  5IT9 K;  2VJ4 A;  4A2U A;  3OS2 A;  3JR9 A;  5FKM A;  5ERI A;  2GXA A;  1OYY A;  3LWF A;  1V5E A;  2XAU A;  2CS3 A;  3MZ8 A;  3B6A A;  1G6N A;  4XLF A;  1OLT A;  3KX2 A;  1HBX G;  2YS9 A;  2IJL A;  1MBG A;  2HFH A;  2GZW A;  2W25 A;  3I59 A;  2EK5 A;  5F0F A;  5E3M A;  4XRF A;  3FBI B;  2E1N A;  3QQA A;  4MGR A;  2L2O A;  2LTP A;  3BR2 A;  1G8X A;  2M7A A;  1C0W A;  3QWL A;  4Q4Z F;  3VEP A;  5IYD J;  4C30 A;  3W6J B;  4HPQ A;  3L2W A;  2VUM J;  3HSF A;  3ROU A;  2IEK A;  1MKM A;  3DKW A;  3CCE I;  3O2P E;  4FT8 A;  4RGR A;  1WCM J;  4UV9 A;  3REO A;  2MGQ A;  3CTA A;  3AKZ A;  1G2H A;  2EPF A;  4OMZ A;  3LA3 A;  4YFN F;  1FOX A;  1S7A A;  4HNU A;  3S32 A;  1NHA A;  5ILS A;  3GO5 A;  1IXS B;  1ULY A;  4OIN F;  3RIR A;  2W00 A;  4A3G J;  4ZZD A;  2NOG A;  1OCO H;  3PFI A;  2VBW A;  4H0E A;  1HDP A;  2JMW A;  2C6Y A;  1MW7 A;  2Y48 A;  2UWM A;  3J81 K;  2MYS A;  5F0H A;  2P5V A;  4EJU A;  4I01 A;  5JVT A;  3FM5 A;  4Y33 A;  2FEZ A;  3SEQ A;  1AOY A;  1QO0 D;  1VQ8 I;  4QPQ A;  2Q8K A;  3OYJ A;  3GBG A;  5HS7 A;  2ZME A;  3MCZ A;  2A6H F;  2YU9 J;  2NVQ J;  2OV7 A;  2HPI A;  2JA5 J;  2LSO A;  1RZ4 A;  1KYW A;  3IHU A;  3H0D A;  3RDI A;  4KA4 A;  2JN6 A;  3CME I;  4I02 A;  3PUB A;  5HS8 A;  3K4C A;  3U2R A;  4P5O A;  4IZZ A;  3E7L A;  3DXJ F;  3BQY A;  5M5Y J;  4E7I A;  2CV1 A;  2PJR B;  2EV5 A;  3CCS I;  3H3U A;  4A3F J;  1BIB A;  5IT3 A;  3WG7 H;  1W7P B;  3I56 I;  2P81 A;  3W2A A;  3GTK J;  3R4K A;  1EA3 A;  5K7F A;  3I58 A;  1HCR A;  1UMQ A;  4PFP A;  4FCY A;  4RMN A;  1ZRD A;  4L9V A;  2K5C A;  2V6C A;  2HVQ A;  2W4S A;  1XGS A;  1R1V A;  2KP6 A;  1MJA A;  3ZQH A;  1B9M A;  2RNG A;  3QPT A;  2Z5U A;  3DTK A;  2WY7 Q;  4ENM A;  2FML A;  3BRO A;  1WJB A;  3M1E A;  2VPL A;  2FMY A;  4ZDO A;  1WGX A;  5EGO B;  2DMP A;  2LH9 A;  3HOW J;  4II2 A;  5CPR B;  3KFW X;  5FLX Z;  4K2E A;  4A5N A;  2OAZ A;  2XB0 X;  1APL C;  3IKV A;  3LSK A;  1BJZ A;  3A01 A;  2HDC A;  4BL0 B;  3WTX C;  4Y15 A;  1A6I A;  3CLQ A;  1YW7 A;  5DS9 A;  5LEK A;  2WBM A;  2KQR A;  1OCR H;  3RPU A;  4IHS A;  4KDP A;  3HGY A;  5FFZ A;  3GFL A;  2DBB A;  2K3P A;  3WHB A;  2AXT C;  4IHX A;  5IYB J;  2BZT A;  4W1U A;  1ZKG A;  3KE2 A;  3BG9 A;  1YG2 A;  3LSP A;  4Z2Y A;  2VBX A;  2PN6 A;  1P4A A;  2F48 A;  2WV0 A;  1YIT I;  3CCY A;  4BH9 A;  4EJT A;  1DUX C;  2O0Y A;  2OA4 A;  4P55 A;  1R1U A;  4EM2 A;  2XDV A;  4RB1 A;  4S04 A;  2DPD A;  4BXU A;  3S1R J;  1S6L A;  3PIO F;  4A0Y A;  4F93 B;  2R93 J;  3DFG A;  4BQO A;  2X0L A;  3WGH A;  1ZHF A;  3DLL F;  3HG9 A;  1ZGW A;  1AKH B;  1E17 A;  2W24 A;  3T5X A;  5GAE J;  1YJN I;  5FKN A;  1S7O A;  2Y69 H;  2KJC A;  5FKL A;  3CF5 F;  1TWH J;  2HQR A;  4IQJ A;  3JRE A;  4HG2 A;  2HU9 A;  3DBL B;  1R58 A;  2M4K A;  1N78 A;  1IRG A;  2G7U A;  1JTX A;  2L4M A;  4WCG A;  4R8H A;  3WTZ A;  3PM1 A;  4QLC U;  1BC7 C;  2NS8 A;  3LOC A;  3GZ5 A;  1ONV A;  4CCK A;  4RLQ A;  1DPU A;  1SFE A;  4PJ0 C;  2DA3 A;  3JRI A;  3FMR A;  3BTI A;  4BY1 J;  1P2F A;  2WAQ N;  2H1L A;  2CSO A;  1PDN C;  3WTV C;  2EFQ A;  2F5D A;  4IEJ A;  4JX6 A;  2HI3 A;  1PP8 F;  3QP5 A;  1GHC A;  2E7W A;  1QPM A;  2K40 A;  4EJO A;  4M72 A;  2VE9 A;  1U3E M;  4C2T A;  1W7P D;  1KGS A;  2QGU A;  3K70 C;  3CCJ I;  2D45 A;  4U7D A;  4RM3 A;  2KIS A;  3IAM 2;  3VPR A;  4CZC A;  4YRV A;  3Q3S A;  5GPC A;  1WFX A;  3RQI A;  2HOS A;  4HF2 A;  1Q1H A;  2QYO A;  5HDN A;  1ENH A;  5GAG J;  4OU0 A;  1WWX A;  2ZB9 A;  3SEZ A;  2DMN A;  2VXD A;  4F92 B;  1ZR4 A;  3LAJ A;  1H9T A;  1LDJ A;  1IUF A;  2F4M B;  5HDG A;  4JK1 X;  3COA C;  4KIG A;  1PP7 U;  4OIP F;  3MN2 A;  1T98 A;  1G3W A;  1MD0 A;  5CVR A;  5EG0 A;  1TP4 A;  1VZ0 A;  4GFB A;  4B3A A;  1TQP A;  5ICE A;  1PUE E;  1NG7 A;  1WJ5 A;  3FM3 A;  4L9T A;  4RAG A;  3ERM A;  1O7L A;  4LIU A;  2M2E A;  5ED4 A;  1S7E A;  1T38 A;  2GA2 A;  3F8B A;  2BYV E;  3I59 B;  2FSW A;  4LK1 F;  3HGG A;  3LSG A;  4PK4 A;  1K78 A;  4BEH A;  1SVO A;  2HYG D;  2LC2 A;  3MKZ A;  4AYB N;  2J5P A;  1UG0 A;  2R0Q C;  4CGZ A;  4RS8 A;  1IN8 A;  2BEO A;  4PSW A;  1ZG1 A;  4E4H A;  3HPG A;  4B1R A;  1FC3 A;  2R7D A;  1Z21 A;  4ZTJ A;  1W0U A;  3O6B B;  4D7N A;  1EJ9 A;  2LKS A;  1XGM A;  2L9R A;  3CO7 C;  3Q9S A;  4HZF A;  3TW7 A;  1FPQ A;  3HRT A;  2HKO A;  2Y0S N;  2DT5 A;  2I8D A;  3HOT A;  2XAS A;  5DCM A;  1T8I A;  5D5V B;  3WTT C;  2E1C A;  1O3R A;  4L5E A;  4IPA A;  2QEN A;  5L3G A;  3HZJ A;  4Q48 A;  1LE8 B;  2KIU A;  1MH4 A;  1Y6I A;  3F3X A;  2MAB A;  1X2N A;  2QSG X;  1JXS A;  2LRD A;  2CFO A;  3KP4 A;  1FYM A;  3OYE A;  4CCN A;  1X2M A;  2ZFU A;  5IYC J;  4DBR A;  1YHQ I;  1FYL A;  1RRJ A;  1YOV B;  2EFN A;  4M6X A;  1R22 A;  4BE2 A;  3M8J A;  4XON A;  3EPZ A;  2V6E A;  4BGD A;  5HLG A;  1OR7 A;  2LG4 A;  2ZXH A;  1K4T A;  1QGP A;  4AIH A;  3E5U A;  3DTI A;  1GV2 A;  1I50 J;  1MBF A;  5CVI A;  1K6O A;  4KFC A;  2FA5 A;  2W85 A;  1T95 A;  4N9I A;  1ETK A;  2HDW A;  1KA8 A;  2OBP A;  4D1Q A;  4LB5 A;  5J4Y A;  3T0Y A;  1J7K A;  4TV7 A;  3W2V A;  3IL2 A;  5F6F A;  3GEZ A;  2BXY A;  4YIF A;  1IO2 A;  3M8F A;  2DOE A;  4IOA F;  2WY8 Q;  1WH5 A;  1ZLJ A;  2RVC A;  5D6F A;  3T8T A;  5BPD A;  3F6O A;  1OCP A;  2ADU A;  3V8K A;  3N4M A;  4WX9 A;  1X1A A;  2D2W A;  2EIJ H;  3CDI A;  4PFO A;  2ZC2 A;  2HDD A;  5J3L A;  4AWX B;  1RR7 A;  2EIL H;  1ON2 A;  5H6Q A;  2FF4 A;  4XSX F;  5M5X J;  2VOO A;  4RGX A;  5JVG F;  3DU5 A;  1OYW A;  2LK2 A;  5CQG A;  4A0X A;  3FIW A;  3AL0 C;  4EVI A;  3W6V A;  1ZAR A;  4DZP A;  5IP7 J;  4IRG A;  4ABZ A;  1Z3X A;  1FY7 A;  5F08 A;  4KN7 X;  2R7F A;  4B44 A;  2Y9Y A;  1MJB A;  4C3H J;  2LVS A;  1NK2 P;  3ZXS A;  4M71 A;  2PG4 A;  5LFA A;  2VON A;  4CH7 A;  2LKX A;  2XGD A;  3NWT A;  3CO6 C;  3H9Q A;  5L3B A;  1FEX A;  2KIM A;  2WB1 A;  5J47 A;  2Y0M A;  2DQR A;  1MDM B;  5C3E J;  1TQM A;  1KYZ A;  4G8X A;  4S05 A;  4IKF A;  4ZYH A;  5J1Y A;  4ZYG A;  3K4M A;  4EM1 A;  3GME A;  5HS9 A;  1LDK B;  2RRE A;  1FMV A;  3I9V 2;  1PVE A;  4RDU A;  3F21 A;  3BTJ A;  2QUF A;  2M87 A;  4C9Y A;  2IP2 A;  1MJ9 A;  2X9D A;  1P7J A;  2XRN A;  1VQL I;  5ILV A;  5D8L B;  3BZK A;  1Z1D A;  1VQN I;  2XC7 A;  2R7O A;  5F04 A;  4ASN A;  1RC9 A;  4ENN A;  2GQQ A;  1KQ0 A;  3HRS A;  3L7W A;  3GTP J;  2A05 A;  3GFM A;  3HOS A;  4BDZ A;  2NRA C;  1E0E A;  2VPR A;  4OIQ F;  1IRZ A;  4OIR F;  3F8M A;  3CC7 I;  2K86 A;  1T39 A;  4IHV A;  5TJJ A;  4EQQ A;  5LEJ A;  3A02 A;  3BG6 A;  4HQM A;  3BPV A;  1FX7 A;  4OIO F;  1VQ4 I;  3IH4 A;  1YRN A;  3RCO A;  3RSN A;  2IGK A;  5BS6 A;  3D0S A;  5C4X J;  1R9T J;  4I76 A;  2H6C A;  1D1B A;  2VB6 A;  1H88 C;  1JKP C;  4LJZ F;  3GTJ J;  2ELK A;  4CHU A;  2A6E F;  1OKR A;  4LK0 F;  3SZP A;  3A4C A;  2OCE A;  2X51 A;  4A3J J;  3AG2 H;  3JCU C;  2K85 A;  3IRQ A;  3CDL A;  2IVM A;  4EJV A;  2JTV A;  5EJC A;  4E7L A;  2CG4 A;  2L02 A;  4XN0 A;  3FX3 A;  9ANT A;  2MH2 A;  1D0Y A;  3CQZ J;  3E5Q A;  4NQW B;  3M1C A;  4LIV A;  1E3P A;  1SVL A;  2EA2 A;  1AKH A;  4ZDP A;  2HR3 A;  2FXA A;  2XKP A;  1I1G A;  5LHI A;  2ZME C;  2XPV A;  5FLX K;  2L7Z A;  4XRM A;  2XAJ A;  2E5N A;  2M1B A;  4UVC A;  4A3M J;  1GVD A;  4MNU A;  2L01 A;  1VQ9 I;  3TED A;  3ABU A;  3SFI A;  1F1Z A;  2H09 A;  1DU0 A;  3FKI J;  1BL0 A;  1YRN B;  2XGE A;  3BT9 A;  4DNC A;  3L09 A;  3J80 K;  1ZRC A;  5F1R A;  4ENJ A;  4LLL A;  1V5G A;  1W5C C;  3BCA A;  4XKB A;  3L2R A;  1TWA J;  1HKS A;  1R6R A;  4DJA A;  1RNL A;  3JRG A;  5LHH A;  2VKV A;  1K61 A;  3PNV A;  1WZ2 A;  3TL4 X;  4BYY A;  3MAJ A;  3HDD A;  5HNH A;  3VSK A;  2QBY A;  3GCM A;  1ODD A;  1U5T C;  3DEU A;  2QKM B;  3O8G A;  2K9S A;  5JFR A;  1V5F A;  1YW8 A;  2NS7 A;  4BHB A;  4MEY F;  5K7H A;  1R5G A;  4ZC3 A;  1FTZ A;  3S2H J;  2OPT A;  3QYE A;  3IUO A;  2ECC A;  3CCU I;  1LQ1 A;  1D0Z A;  1HW5 A;  1GLN A;  1HQC A;  5K5O A;  2VT2 A;  3BDD A;  3GFJ A;  5DD8 A;  5KNL A;  2XSJ C;  2A07 F;  4NC7 A;  5GTI C;  1QVT A;  2FBI A;  4G6T B;  5D5W B;  2JA7 J;  4A0Z A;  1HKT A;  2AO9 A;  3HOZ J;  5D5X B;  2WAQ A;  3OOU A;  4IOC F;  3RPU D;  2CW0 F;  4LG0 B;  2KZV A;  2D1H A;  4FQG A;  3ZN1 A;  2KRH A;  2ZSI B;  5CVV A;  1FTT A;  5IPA A;  3E6C C;  4Y52 J;  1YI2 I;  3JW4 A;  4JYK A;  5FRN A;  4HYE A;  3I4P A;  1HSJ A;  2JT1 A;  3DQV C;  2LF7 A;  4IRI A;  3UNG C;  1N25 A;  1WH7 A;  3N05 A;  2O8K A;  1HF0 A;  3G1M A;  2O6G E;  3ZQL A;  3K9T A;  2RAE A;  4RAZ A;  3I53 A;  2FNA A;  2UV1 A;  3ZQF A;  4C3I J;  1J5Y A;  2X6O A;  4I0A A;  2YPR A;  2BXZ A;  2ZME B;  2R7X A;  4YG2 F;  2G0E A;  3E6M A;  3DBR B;  4A3I J;  1MGT A;  1JUP A;  2H6B A;  3MZY A;  1E3O C;  3CCQ I;  1FBS A;  2KKO A;  3KLN A;  2VLA A;  3HB9 A;  1W5T A;  5E20 A;  4XK4 A;  2VC0 A;  1R4M B;  2ETH A;  2CWE A;  2A69 F;  1DP3 A;  2BBY A;  2V9K A;  2X6X A;  4YEJ A;  1UAA A;  3E0J B;  3K4J A;  5LHG A;  2DN0 A;  4XOP A;  2R7S A;  1TWC J;  3OYL A;  1BOA A;  4V19 K;  3TDU C;  3TOA A;  1X3W B;  1Z7L A;  1DGR M;  3BWG A;  5E8I A;  1VQM I;  4M3B A;  4E70 A;  2EH3 A;  3DV8 A;  1K79 A;  3PSI A;  1NK3 P;  4DYR A;  2R7U A;  5CVU A;  1Z9C A;  2OTL I;  4ZH4 F;  2MG4 A;  2HVS A;  4NBQ A;  2ECB A;  4KIT B;  1ZG3 A;  1XX5 A;  1IN4 A;  5IP6 A;  3RI4 A;  4M6Y A;  4QSH A;  2FX0 A;  2DA7 A;  2P8T A;  1SAN A;  3TO6 A;  2DT7 B;  1IGN A;  3U1K A;  3OOP A;  3FXJ A;  2BHZ A;  3G1L A;  3ZPL A;  1A5J A;  1JUM A;  1DPR A;  4CYC A;  1VQ5 I;  3L1P A;  4RGS A;  3H36 A;  1MNE A;  1YE9 A;  3K10 A;  2R92 J;  3CCL I;  2MC4 A;  1BIA A;  1D5Y A;  2H27 A;  4JOM A;  3FXO A;  5BOX A;  1IUY A;  1Y1V J;  2G7H A;  3KZI C;  4HST A;  5AIP A;  3A1Y A;  2WB1 N;  2HQ5 A;  3S8P A;  3ZMT A;  3M3Y J;  1S8N A;  1TLH B;  3BG7 A;  1OCC H;  5K5Q A;  3ABL H;  3ZOB A;  2XGC A;  2EFO A;  3TQN A;  2CW8 A;  4A6E A;  1XDS A;  3LQR A;  4GYG A;  3C2B A;  1U8R A;  3M07 A;  1BA5 A;  5E17 F;  4UUS B;  1TBX A;  1QPI A;  3F6V A;  4OAY A;  3EUK L;  2XF6 A;  1RUN A;  5F27 A;  1K7A A;  2BE5 F;  1GT0 C;  1RES A;  4ESF A;  5EDN A;  3C1D A;  2QEX I;  2LDU A;  1YX5 A;  3C3W A;  5J8F A;  2E1O A;  5J4V A;  4XBF A;  3C18 A;  3AL0 B;  4M9S A;  2XKO A;  4U0Y A;  3NRV A;  1OYI A;  3KEQ A;  1YS6 A;  3LSM A;  2X1E A;  2GWR A;  3MKW B;  5LLQ A;  2DTZ A;  4XLA A;  2MFZ A;  3P5J A;  2OJE D;  3HSE A;  4PZJ A;  1SFK A;  3LFU A;  3H3V K;  2P5L C;  1O3T A;  4BHP A;  5HLH A;  3HEF A;  2WWY A;  3E5X A;  1ETX A;  4XQF A;  1ZGA A;  1WSU A;  5TIS C;  5KAF C;  3K70 D;  1U9O A;  1WI3 A;  2BGC A;  2K9L A;  3HXL A;  1WVR A;  2L4A A;  1UG2 A;  2BY2 A;  1IN5 A;  1BOB A;  1MZB A;  2K9Q A;  5E1W A;  4G9Y A;  1X19 A;  2DA4 A;  2PI0 A;  3FK6 A;  2CH0 A;  4HEA 2;  1B59 A;  2CUZ A;  2L54 A;  1ZYR F;  1N77 A;  2HS5 A;  4NB5 A;  3G2B A;  1BW6 A;  1Z6T A;  2GXG A;  1LPQ A;  1K6Y A;  4L18 B;  3L00 A;  5DD4 A;  4AIJ A;  2VJJ A;  3FMQ A;  3LQQ A;  3U9G A;  4HAM A;  3DPT A;  1SVM A;  3TDZ C;  4ETS A;  1D8J A;  2HYJ A;  2STW A;  3CJR B;  3VWB A;  3RKY A;  1FIA A;  3CUQ C;  3E6D A;  4FX0 A;  3ZQQ A;  2GXB A;  2XHK A;  3K4K A;  4YFX F;  1LEA A;  3DTE A;  2DDA A;  2E1M B;  3ONQ A;  1RET A;  3FXU A;  3V42 A;  2FE3 A;  1I3A A;  2K9N A;  2JPB A;  2VKE A;  4RAY A;  3BJO A;  3RPQ A;  1IW7 F;  4G94 A;  3B73 A;  2CUJ A;  2B0L A;  2CRG A;  1LVK A;  4BY7 J;  3QOD A;  2M7B A;  1Y0U A;  4UUT A;  4V2F A;  2ZXI A;  1U0J A;  2DMT A;  1R00 A;  3F8C A;  4HX8 A;  5DYM A;  3CMY A;  1VQP I;  1B8I A;  2W7N A;  1FBU A;  3WGI A;  4MIM A;  5K1Y A;  3WU1 B;  2STT A;  1ACI A;  5B3S H;  1HXD A;  2IA1 A;  2A68 F;  2QVO A;  1IN6 A;  4AIK A;  5JLW A;  5D8K B;  3CDH A;  1QVU A;  3VYS B;  3I55 I;  2DCE A;  4XSZ F;  1HKQ A;  1XN7 A;  2ZJQ F;  1OMI A;  3RKW A;  4E7K A;  1YTY A;  4G7O F;  3HOY J;  3S17 J;  4W97 A;  1JKQ C;  3SDG A;  1L0O C;  3JRH A;  5FKO A;  2VOP A;  1I39 A;  2HGC A;  3S1Q J;  5FGM A;  4HNT A;  3BY6 A;  1VQO I;  1CF7 A;  2EV0 A;  4IX7 A;  5F1J A;  4LFU A;  1ZAO A;  4UV8 A;  4BU2 A;  2QF7 A;  4F91 B;  1ZRF A;  2B63 J;  3FMS A;  3WG9 A;  3E6B A;  2TDX A;  2F5F A;  2Z2S B;  2ZXW H;  4F3Q A;  3GX4 X;  1B1B A;  3RYR A;  1JE8 A;  5F0C A;  3TBI A;  3WU2 C;  3ZCO A;  3K1N A;  1D8K A;  5BNG A;  4XN3 A;  4FAS D;  4J19 A;  4E7J A;  4HW0 A;  1HC8 A;  4PCQ A;  3S93 A;  3HKZ A;  1PJR A;  2X6Y A;  3U21 A;  3K2A A;  4JBA A;  1TQI A;  2P0W A;  2RC4 A;  3OYC A;  3BQZ A;  2XIG A;  1DDN A;  4F52 A;  1ZK8 A;  2MC3 A;  1VND A;  3OL3 A;  4LG3 A;  2X6W A;  3VB2 A;  4AM3 A;  3ZQI A;  2JA8 J;  3ABK H;  2DPU A;  1XC5 A;  2Y75 A;  3KET A;  1F5T A;  1T56 A;  2LOO A;  2W84 A;  1FP1 D;  3V7R A;  2FNP A;  1Y1W J;  4FE7 A;  3VYR B;  3BTL A;  3T1B A;  3GYH X;  2JZY A;  3S1M J;  4CCJ A;  3RJP A;  2DT6 A;  2YR2 A;  2HVR A;  1R7J A;  2JVG A;  2XPW A;  3HIF A;  3M4O J;  1H8A C;  4IO9 F;  2DO7 A;  2XRO A;  1SFU A;  3GZ6 A;  1SMT A;  4UXN A;  5L3C A;  2VE8 A;  3W2W A;  2IAI A;  2IGN A;  4DBQ A;  4U0V A;  3ZQ7 A;  1IDY A;  5CLS A;  4UUS A;  1LFB A;  5B1A H;  3H0G J;  2L5Q A;  3TMO A;  2VKH A;  2M8E A;  4BKX A;  3J7A Y;  3B02 A;  3OYM A;  1P6R A;  2DDB A;  1IC8 A;  1ETW A;  3MEX A;  4XOR A;  1HDD C;  2XVC A;  3GWZ A;  3PL8 A;  3IWF A;  2NYX A;  1JI8 A;  3AG1 H;  1Z3Y A;  2KJB A;  5DEQ A;  2DK8 A;  4AYB A;  4CIC A;  2GIV A;  3ECH A;  4LMY A;  2LFB A;  2F5C A;  2E2I J;  5FB2 A;  2OZ6 A;  2P6S A;  3TOB A;  3MKY B;  1F36 A;  1IZ1 A;  2LNB A;  5KCM A;  4XRS A;  3FXR A;  2IGM A;  4MFE A;  4ON0 A;  4L9N A;  4GGG A;  5LBQ A;  5EF6 A;  5HOD A;  4BS9 A;  2ISZ A;  4D9J A;  4BQA A;  1X1D A;  3J81 Z;  2M34 A;  3QOE A;  3KIO A;  3I0T A;  5A2Q K;  1W0T A;  4NC6 A;  3IH2 A;  5J1R A;  2K4J A;  2CUF A;  3HJE A;  4XLH A;  2VQH A;  4G7Z F;  2JUC A;  3FIS A;  3OIQ A;  3GW2 A;  2E7X A;  4UNO A;  2E36 A;  2CQ7 A;  2PFB A;  2B9S A;  3QPS A;  3ZP5 A;  1ETY A;  2W1O A;  2LMD A;  3K2Z A;  2GAU A;  3BR3 A;  5EEA A;  2CQK A;  4FHT A;  3GTL J;  2PX9 A;  1V55 H;  5JR3 A;  1AA7 A;  5DTD A;  3UKG A;  4F55 A;  1X58 A;  1TTY A;  2DFH A;  3H5R A;  1LFU P;  3PO2 J;  3RZD J;  4DQ2 A;  5IP9 J;  1P9Q C;  1D0X A;  2EJR A;  1Y56 A;  3AFH A;  2ESN A;  2P6T A;  4R79 A;  3ASN H;  3HL2 A;  3F8N A;  3E3V A;  1SEU A;  1OQY A;  3H9J A;  5HLT A;  1ZEL A;  3I5U A;  4RA2 A;  5E8G A;  4IVN A;  3KZZ A;  4U7B A;  1ZR2 A;  3BR1 A;  5H6R A;  4NNJ A;  4BAY A;  4KMF A;  1KQ9 A;  2A61 A;  2VC1 A;  2VJ5 A;  3EYY A;  4OWR B;  1BI3 A;  2EQR A;  1IXR C;  2KIQ A;  2IGO A;  4A6D A;  3CP2 A;  1W5S A;  4HLX A;  2FOW A;  4WF2 A;  2FBK A;  4XKV A;  1MMN A;  2AQE A;  4XRS G;  3E97 A;  1J59 A;  4JP0 A;  2EZH A;  5KVR A;  3RQ4 A;  3BLY A;  4CSW A;  2DA5 A;  1BI0 A;  2QWW A;  2YX4 A;  2ZJR F;  4D0P A;  4BEH B;  5DUK A;  3N97 A;  1OJL A;  1NH3 A;  2VI6 A;  2KIF A;  1DU6 A;  5DCF A;  4AD9 A;  1IN7 A;  2ISY A;  4AU7 A;  1UHS A;  2Z1D A;  4HF1 A;  5DV5 A;  3WTY C;  5IT9 Z;  4A69 C;  2V4J C;  4MTE A;  1BBY A;  4M3F A;  1A04 A;  1JGG A;  3HC7 A;  4EJW A;  3NWS A;  2H94 A;  1T6S A;  3FZV A;  1JJ8 C;  1P92 A;  2WAF A;  1XCB A;  2QLZ A;  2E19 A;  3GLL A;  2D1V A;  4P96 A;  3PFY A;  2LY1 A;  1I6H J;  3D5L A;  3GLX A;  3ULQ B;  1Y8Q B;  5J8C A;  3QYB A;  5L3D A;  2MH9 A;  1S5L C;  2COB A;  1WQ2 A;  3ABT A;  4JQF A;  4ZJZ A;  1O3Q A;  5KHD A;  3FWE A;  2BY0 A;  2L7F P;  2ZNY A;  3CJN A;  1FSE A;  2K9M A;  4XOT A;  3J7Z I;  1OPC A;  2BW3 A;  4I2O A;  1K83 J;  3FF5 A;  1KQ8 A;  4M9Z A;  2E34 A;  3K4N A;  3EUH A;  4C2M J;  1H9G A;  1S72 I;  4PJJ A;  4G12 A;  2IS4 A;  1Z0X A;  2DFI A;  2JJ7 A;  3PNT A;  1H0M A;  3PQK A;  3EUA A;  3OYG A;  2A5W A;  3OYB A;  4Q47 A;  1E2X A;  2RQP A;  2NVU B;  1D1C A;  3QPL A;  1H89 C;  1I6X A;  1Y8R B;  2CJJ A;  1VQK I;  4EGZ A;  3OIP A;  2YSR A;  3B6C A;  2DA1 A;  4N0B A;  1WJD A;  3E1S A;  2L7K A;  1IAW A;  1Z77 A;  4AID A;  2DLL A;  2IRF G;  2W48 A;  1FOY A;  2DK5 A;  2RGV A;  5H2F C;  4IHT A;  2R5Y B;  3Q9V A;  2KPM A;  5CQE A;  5FD5 A;  4BBS J;  2DJN A;  2PMU A;  2ID3 A;  3S3N A;  1IDZ A;  2GA1 A;  5CVJ A;  3JRA A;  1UHW A;  1UCR A;  2MA3 A;  1P4X A;  2VN2 A;  3VOE A;  4X1E A;  3HOU J;  4AVZ A;  1UFM A;  2XAG A;  4A3E J;  4BQN A;  3SYT A;  2W82 A;  1QZY A;  1STZ A;  5J40 A;  1MMD A;  3RZO J;  4WXD A;  4N9H A;  2CQN A;  1GXP A;  3BG3 A;  6PAX A;  4I98 B;  3CCV I;  4DW6 A;  2M4G A;  4OOI A;  3OSF A;  5GAD J;  1BI1 A;  3EUH C;  5AIQ A;  3D5R C;  1SD5 A;  1B9N A;  4B4C A;  2YU3 A;  5LGT A;  2WC2 A;  3MD2 A;  3W3C A;  2E1M C;  3AG4 H;  4MQV A;  2TCT A;  2IXS A;  1TL8 A;  1XGN A;  1CF7 B;  2YX7 A;  3FXL A;  2P4W A;  1ETV A;  3DKX A;  3OMY A;  3VFZ A;  2PMH A;  3KYL A;  1F43 A;  1F4K A;  1X4O A;  1XMA A;  2K27 A;  2ESH A;  4KN4 X;  2DMU A;  3FXK A;  4H4K C;  3F72 A;  1I27 A;  1W1W E;  4UVA A;  1ZRE A;  3L2C A;  3A2K A;  2BOL A;  3P9C A;  3BTC A;  3LST A;  5CKT A;  4ZTF A;  4A3K J;  4DYC A;  4CYD A;  3A01 B;  2OZU A;  2B7E A;  1UJ8 A;  4ITV A;  4ENK A;  3KEO A;  3R0J A;  1LKX A;  1N75 A;  3W6K B;  2OUM A;  2Y30 A;  3I64 A;  4E7H A;  3HHG A;  5B66 C;  2A5Y B;  1U78 A;  5HDK A;  1UHM A;  3Q0U A;  5LRS A;  4B09 A;  3WGG A;  1CGP A;  5EYR A;  2IS2 A;  2OD5 A;  2KRC A;  3R6S A;  4FET A;  2HQN A;  2DU9 A;  4J00 A;  2R7V A;  4YFK F;  1MBK A;  3PO3 J;  3BR0 A;  3KPH A;  1Q1V A;  3RTR A;  1KU7 A;  2XV4 S;  4J01 A;  5ICF A;  1MSE C;  1I1S A;  2VT3 A;  4II3 A;  4E7S A;  4C2U A;  4A3D J;  2HNH A;  2DOD A;  4E6K G;  2X4H A;  3A03 A;  1VTN C;  4PSX A;  4Y3O A;  4YII A;  4A3B J;  2KLO A;  3CCM I;  2IT0 A;  2EA4 A;  1NTC A;  1WJA A;  4GDF A;  1FSH A;  4GCV A;  3IH3 A;  4KYW A;  1TW3 A;  2XAQ A;  1TWF J;  1UB9 A;  3HYI A;  3O3K A;  3CUQ A;  1QNT A;  1RI7 A;  3IKT A;  3V4G A;  1Z91 A;  2HTS A;  2M5W A;  4RLF A;  3EYI A;  4GYI A;  3S2W A;  3HTS B;  2ME0 A;  1ZLK A;  3S1N J;  4XLC A;  4HA8 A;  4S0H B;  2OQR A;  2QM3 A;  2VAS A;  1YX3 A;  1UZC A;  2K4B A;  3QP6 A;  1LDD A;  2V79 A;  3RYP A;  4YEL A;  2KHM A;  3WE3 A;  2MLG A;  3DKY A;  2BW3 B;  4M3G A;  4CA0 A;  2Z16 A;  2ICW G;  2Y31 A;  5EZG A;  1B72 B;  4CYC B;  5AON A;  1D5V A;  1XB4 A;  3S3O A;  3PJR A;  2CU7 A;  2Z9O A;  4OMY A;  2LBF A;  3F22 A;  4LLG F;  4LD5 A;  3J80 Z;  4I6Z A;  1JUS A;  2MD5 A;  1XSX A;  2LD5 A;  2ZFW A;  4RBO A;  4Y13 A;  1ZGJ A;  3P9K A;  1KZH A;  1R36 A;  4L5J A;  4ZYA A;  4CUG A;  2EV6 A;  2LY2 A;  3ZQC A;  2UXX A;  2P5K A;  3DCF A;  5BMZ A;  1BR2 A;  2GOX B;  3MQ0 A;  1HW1 A;  3CJT B;  4G6Q A;  3K7A J;  3X2Q H;  5ICG A;  1OIS A;  4L0Y B;  4ESB A;  4FIS A;  4U0W A;  1GV5 A;  1XDU A;  5TGT A;  1IRX A;  1BJA A;  2ZJP F;  4Q5S F;  1XSV A;  2V7F A;  5EEH A;  2P7C B;  2CMP A;  2Q1Z B;  4KT6 A;  2O9L A;  4L9J A;  1SD4 A;  3HTU A;  2QCO A;  5D4S A;  3C2H A;  2NVY J;  1DQU A;  2XUB A;  4AVP A;  1LE8 A;  4PJL A;  3NQO A;  2VOD A;  3S2D J;  1O3S A;  1PYV A;  1EH6 A;  3VDX A;  4NC8 A;  3KP7 A;  1HA8 A;  3FHZ A;  3HUG A;  3JRB A;  1CQT A;  1ZTR A;  2KT0 A;  3SDB A;  4IL6 C;  2P7V B;  4BE1 A;  5FD6 A;  1IJW C;  1EH7 A;  4CCO A;  2E35 A;  2R3S A;  3P9I A;  3GFI A;  3J7A O;  5FRM A;  1POG A;  2XB5 A;  3HPH A;  3IV5 A;  1BN5 A;  1V4R A;  4XID A;  3LNQ A;  1XCV A;  3C2G A;  2L9N A;  3SZG A;  4XKC A;  3VYU B;  3DBH B;  3L2U A;  2EIK H;  1T33 A;  3I71 A;  3HOX J;  1FOW A;  3U1D A;  4XLP F;  1JT0 A;  3NAR A;  3LSR A;  4IHW A;  4WK8 F;  4WXH A;  2R7Z J;  2D5V A;  3BOQ A;  1XMX A;  3D5S C;  1XD7 A;  4HRI A;  1RKW A;  3VSL A;  5EG0 B;  1FZP B;  1S29 A;  1LUJ B;  1O7F A;  2HXO A;  1J0R A;  5E1X A;  1WJC A;  2EWN A;  4B48 A;  3RKQ A;  3PIP F;  3MKL A;  4N4O B;  2HWV A;  2BV6 A;  2X85 A;  4ZYD A;  4M9X A;  2BVM A;  2GLO A;  4PUS A;  2MW8 A;  4KMU X;  5IY5 H;  3H3Z A;  5EZH A;  3T8R A;  4KIC A;  3ZMS A;  3QOP A;  2L3D A;  4MEX F;  3CMM A;  4IHY A;  4HV5 A;  1AHD P;  2Z33 A;  1J09 A;  2ELJ A;  1EH8 A;  4XR6 A;  5DM6 F;  1FBQ A;  2CW7 A;  1R5I D;  2HPM A;  4XNF A;  2QKL B;  2JPC A;  4MLO A;  3JAM K;  4P9F A;  2PLY A;  3UR3 C;  4BQQ A;  1XG1 A;  1TT0 A;  1QQI A;  3CUQ B;  3TKY A;  2EZK A;  5E1Z B;  5C4J J;  2M0M A;  3IWZ A;  4HOB A;  3WOD F;  4BXF A;  2NXN B;  2N8G A;  3HRM A;  1REP C;  2DFF A;  2NVT J;  4CCM A;  3OS0 A;  5M5W J;  2FOK A;  1GXQ A; 
#chains in the Genus database with same CATH homology
 1O57 A;  2O03 A;  2ZCW A;  3I54 A;  1G3Y A;  3IC7 A;  1USS A;  1Z7U A;  1G4D A;  2Q2E A;  1FOK A;  2ZKZ A;  1SD7 A;  1G3T A;  4PGH A;  1RUO A;  5F64 A;  3R0A A;  1BC8 C;  1KU3 A;  1GVJ A;  5K5R A;  3QAH A;  5J6X A;  1B6A A;  1J9I A;  3MWM A;  4IRH A;  3GXO A;  3GUD A;  3HRU A;  3Q5F A;  1LJ9 A;  5DUI A;  2FQ3 A;  4FX4 A;  5H20 A;  1TW2 A;  2UXN A;  2FBH A;  1I5Z A;  1YYV A;  4EGY A;  1D3Y A;  2JSC A;  2MBF A;  2CYY A;  2MLK A;  1SAX A;  2ELH A;  3KZY A;  3PQJ A;  2QQA A;  1XMK A;  2QQB A;  2VBY A;  1AWC A;  1W4M A;  4UHT A;  2LF8 A;  3WE2 A;  3KP3 A;  1ZG5 A;  1LVA A;  3VOD A;  1V3F A;  3BJ6 A;  4MHG A;  1W7P A;  2M30 A;  1YIO A;  5LGN A;  2V1U A;  4HBL A;  3HHH A;  4B8X A;  2COM A;  4O3M A;  4HX4 A;  4I09 A;  1QZZ A;  4G7H F;  2IA2 A;  1EV7 A;  2DTR A;  4KIB A;  3M7G A;  4KT5 C;  4CO8 A;  4RB3 C;  3JTG A;  5HOO A;  1HW2 A;  2J5O A;  2VXZ A;  2ACJ A;  4LGW A;  2DAO A;  3CLO A;  1ON1 A;  2HZT A;  3DP7 A;  1R23 A;  2XAF A;  2V1X A;  2O8X A;  1T0F A;  3NEU A;  3K0L A;  3KP5 A;  4CZZ A;  1J75 A;  4EMS A;  5TRD A;  2DW4 A;  4Y17 A;  3OV8 A;  3QU6 A;  3K1M A;  1S3J A;  3M9A A;  3WTS C;  3ISP A;  2ZBK A;  4MQ9 F;  3SXY A;  3LAP A;  5ILU A;  4L0Z B;  5EEG A;  4EM0 B;  2NAZ A;  2XAH A;  3P7N A;  4HDV A;  3JSO A;  2O3F A;  3JTH A;  4I0B A;  2KRF A;  2M45 A;  5LRR A;  3HSR A;  5L3E A;  2F2E A;  4RB2 C;  1L3L A;  4MTD A;  3ZMD A;  1U5T B;  1HST A;  3EQL F;  4EV0 A;  1FNN A;  4R1H A;  3DF8 A;  3V7S A;  3MFK A;  1Z6R A;  1U5T A;  3ZMU A;  4HV6 A;  4GO1 A;  2AXL A;  1J2X A;  3V8J A;  4CDG A;  5HLI A;  1YLF A;  4LB6 B;  2CFX A;  2RV8 A;  4RGU A;  3SFZ A;  5FFX A;  3BJA A;  1YW9 A;  3FXQ A;  1BI2 A;  2F5E A;  3AAF A;  1IXC A;  4I7H A;  2OU2 A;  2EFP A;  1XGO A;  2K7L A;  4HF0 A;  2VBZ A;  2ZO4 A;  3V7C A;  2DI3 A;  1LNW A;  2IPQ X;  2ZJ2 A;  3L9F A;  2IW5 A;  1YS7 A;  1WKM A;  5KK1 A;  3WU0 A;  4F7Z A;  1IRF A;  5D5U B;  2NS0 A;  3BP8 A;  4HX7 A;  5JI6 A;  3BZ6 A;  2A3S A;  2ZXJ A;  4IF4 A;  3LA2 A;  1FP2 A;  5FO5 A;  2HKX A;  3F23 A;  2RDP A;  1XSD A;  3BPX A;  3TO9 A;  1WRJ A;  1B4A A;  3ERE D;  5JHU A;  4O6J A;  2QBY B;  4L5I A;  2Q0O A;  2UZK A;  3KLO A;  1F9N A;  3ZMZ A;  3JSP A;  2JRT A;  3CUO A;  1SMY F;  4UUV A;  3M8E A;  2CO5 A;  1ZN2 A;  4U88 A;  2DQL A;  4M74 A;  1R5H A;  1YQA A;  4A5M A;  5BPI A;  1TNS A;  2FU4 A;  3V8L A;  1KU9 A;  2K02 A;  3TO7 A;  2LKP A;  3QRF F;  4LG0 A;  2RKH A;  1TNT A;  2HEO A;  3MZH A;  1Z05 A;  2NNN A;  5CYV A;  2OQG A;  4A12 A;  4BNC A;  3IRR A;  2FRH A;  2W57 A;  1JGS A;  3GF2 A;  3ZMV A;  3QPH A;  4IXA A;  5DDG A;  3DPL C;  3QU3 A;  3RKX A;  4IJA A;  4CXF A;  4NHJ A;  1G3S A;  4ESJ A;  1JHH A;  1FYK A;  2QQ9 A;  4WXC A;  1BM9 A;  3SHF A;  4UVB A;  2HYF A;  1FLI A;  4XLN F;  5D6E A;  5LGU A;  1WI9 A;  4KUM A;  3TGN A;  1RIO H;  4WWC A;  5E18 F;  1IF1 A;  4KIF A;  3KCC A;  2G9W A;  1SFX A;  2PBI A;  3R61 A;  1KU2 A;  3WTW C;  3EET A;  3G73 A;  1SD6 A;  2V9V A;  4NQW A;  4ZYE A;  4HDU A;  1YFH A;  2PQ8 A;  2WTE A;  4BHC A;  4P9U A;  1K78 B;  3G3Z A;  3ZN0 A;  4PGG A;  1P4W A;  1UST A;  1QBJ A;  4QWQ A;  3JAM Z;  3H92 A;  2V1D A;  4KNY A;  3C7J A;  1FWZ A;  2XGX A;  2PEX A;  2ZNZ A;  1FT9 A;  3K1P A;  3SQN A;  4HLY A;  3KP2 A;  5CJ9 A;  1ZH5 A;  4M73 A;  1LB2 A;  2Z3Y A;  2RN7 A;  1T2K A;  4HQE A;  3LA7 A;  3F8F A;  3KP6 A;  2QZ8 A;  3ECO A;  2CGP A;  1X3U A;  3ML6 A;  4PDK A;  2IA0 A;  5HVQ C;  1LEB A;  2RNJ A;  4RB0 A;  2EFW A;  3ELK A;  1U2W A;  3WTU C;  2HOE A;  4O5V A;  3GVA A;  4G6D A;  5A2Q Z;  1MDM A;  4ZZL A;  2EB7 A;  1YO5 C;  2HTJ A;  2AS5 F;  3LFK A;  4GXO A;  3R60 A;  2Z99 A;  1JHF A;  3SZT A;  5D4R A;  5L3F A;  1R1T A;  2NNY A;  4LLN A;  1DP7 P;  1U6G A;  5DCM B;  3EDP A;  2O61 A;  5BQT A;  2PJP A;  3K69 A;  5ICC A;  5IT9 K;  4A2U A;  5ERI A;  1OYY A;  3LWF A;  1G6N A;  1HBX G;  2IJL A;  2HFH A;  2GZW A;  2W25 A;  3I59 A;  2EK5 A;  4XRF A;  2E1N A;  4MGR A;  1C0W A;  4Q4Z F;  3VEP A;  3W6J B;  3HSF A;  3ROU A;  3DKW A;  1MKM A;  3O2P E;  4FT8 A;  4RGR A;  4UV9 A;  3REO A;  3CTA A;  4OMZ A;  3LA3 A;  4YFN F;  1S7A A;  1NHA A;  5ILS A;  3GO5 A;  1IXS B;  1ULY A;  4OIN F;  3RIR A;  4ZZD A;  3PFI A;  2VBW A;  4H0E A;  2C6Y A;  2Y48 A;  2UWM A;  3J81 K;  2P5V A;  4EJU A;  4I01 A;  5JVT A;  3FM5 A;  2FEZ A;  1AOY A;  1QO0 D;  2Q8K A;  5HS7 A;  2ZME A;  3MCZ A;  2A6H F;  2LSO A;  1RZ4 A;  1KYW A;  3IHU A;  3RDI A;  4KA4 A;  4I02 A;  5HS8 A;  3U2R A;  4P5O A;  3DXJ F;  2EV5 A;  3H3U A;  1BIB A;  5IT3 A;  1W7P B;  3R4K A;  3I58 A;  1ZRD A;  4L9V A;  2V6C A;  1XGS A;  1R1V A;  1MJA A;  1B9M A;  3QPT A;  2Z5U A;  4ENM A;  2FML A;  3BRO A;  3M1E A;  2FMY A;  3KFW X;  5FLX Z;  4K2E A;  4A5N A;  2OAZ A;  3IKV A;  2HDC A;  3WTX C;  4Y15 A;  1YW7 A;  5LEK A;  3RPU A;  4IHS A;  4KDP A;  5FFZ A;  3GFL A;  2DBB A;  3KE2 A;  1YG2 A;  4Z2Y A;  2VBX A;  2PN6 A;  1P4A A;  2WV0 A;  4BH9 A;  4EJT A;  1DUX C;  2O0Y A;  2OA4 A;  4P55 A;  1R1U A;  4EM2 A;  4RB1 A;  4S04 A;  2DPD A;  4BXU A;  1S6L A;  4A0Y A;  3DFG A;  2X0L A;  3WGH A;  1ZHF A;  1E17 A;  2W24 A;  3T5X A;  1S7O A;  2KJC A;  2HQR A;  1R58 A;  1IRG A;  2G7U A;  4WCG A;  2L4M A;  4R8H A;  3WTZ A;  4QLC U;  1BC7 C;  3GZ5 A;  1ONV A;  1DPU A;  1SFE A;  3FMR A;  1P2F A;  2CSO A;  1PDN C;  3WTV C;  2EFQ A;  2F5D A;  1PP8 F;  3QP5 A;  1GHC A;  2E7W A;  1QPM A;  4EJO A;  4M72 A;  2VE9 A;  1U3E M;  1W7P D;  1KGS A;  2D45 A;  4U7D A;  4HF2 A;  1Q1H A;  2QYO A;  5HDN A;  4OU0 A;  1WWX A;  1H9T A;  3LAJ A;  1LDJ A;  5HDG A;  4JK1 X;  3COA C;  4KIG A;  1PP7 U;  4OIP F;  1T98 A;  1G3W A;  1MD0 A;  5CVR A;  1TQP A;  5ICE A;  1PUE E;  3FM3 A;  4L9T A;  1O7L A;  5ED4 A;  1T38 A;  2GA2 A;  3F8B A;  2BYV E;  3I59 B;  2FSW A;  4LK1 F;  2HYG D;  2J5P A;  4CGZ A;  4RS8 A;  1IN8 A;  2BEO A;  1ZG1 A;  1FC3 A;  2R7D A;  3O6B B;  1XGM A;  3CO7 C;  3Q9S A;  4HZF A;  1FPQ A;  3HRT A;  2HKO A;  2DT5 A;  3HOT A;  2XAS A;  5DCM A;  5D5V B;  3WTT C;  2E1C A;  1O3R A;  4IPA A;  2QEN A;  5L3G A;  4Q48 A;  2KIU A;  3F3X A;  1JXS A;  3KP4 A;  1FYM A;  1FYL A;  2EFN A;  4M6X A;  1R22 A;  5HLG A;  1OR7 A;  1QGP A;  4AIH A;  3E5U A;  5CVI A;  1K6O A;  4KFC A;  2FA5 A;  2W85 A;  4N9I A;  1KA8 A;  2OBP A;  4LB5 A;  3T0Y A;  1J7K A;  4TV7 A;  3IL2 A;  5F6F A;  3GEZ A;  4YIF A;  3M8F A;  1ZLJ A;  2RVC A;  5D6F A;  3T8T A;  5BPD A;  3F6O A;  2ADU A;  3V8K A;  3N4M A;  4WX9 A;  2D2W A;  4AWX B;  1ON2 A;  5H6Q A;  2FF4 A;  4XSX F;  2VOO A;  4RGX A;  1OYW A;  4A0X A;  4EVI A;  1ZAR A;  4IRG A;  1FY7 A;  4KN7 X;  2R7F A;  1MJB A;  4M71 A;  2PG4 A;  2VON A;  3CO6 C;  5L3B A;  2KIM A;  2Y0M A;  2DQR A;  1MDM B;  1TQM A;  1KYZ A;  4G8X A;  4S05 A;  4ZYH A;  4ZYG A;  4EM1 A;  5HS9 A;  1LDK B;  3F21 A;  2QUF A;  2M87 A;  2IP2 A;  1MJ9 A;  2XRN A;  5ILV A;  5D8L B;  1Z1D A;  4ASN A;  4ENN A;  2GQQ A;  1KQ0 A;  3HRS A;  3L7W A;  3GFM A;  3HOS A;  2NRA C;  4OIQ F;  4OIR F;  3F8M A;  2K86 A;  1T39 A;  5TJJ A;  4EQQ A;  5LEJ A;  4HQM A;  3BPV A;  1FX7 A;  4OIO F;  5BS6 A;  3D0S A;  2H6C A;  4LJZ F;  4CHU A;  2A6E F;  1OKR A;  4LK0 F;  3SZP A;  3IRQ A;  2IVM A;  4EJV A;  2JTV A;  2CG4 A;  2L02 A;  3FX3 A;  2MH2 A;  3E5Q A;  2EA2 A;  2HR3 A;  2FXA A;  2XKP A;  1I1G A;  5LHI A;  2ZME C;  5FLX K;  2XAJ A;  2M1B A;  4UVC A;  4MNU A;  2L01 A;  3ABU A;  1F1Z A;  2H09 A;  4DNC A;  3L09 A;  3J80 K;  1ZRC A;  5F1R A;  4ENJ A;  4LLL A;  1HKS A;  1RNL A;  5LHH A;  4BYY A;  3MAJ A;  2QBY A;  1ODD A;  1U5T C;  3DEU A;  5JFR A;  1YW8 A;  4BHB A;  4MEY F;  1R5G A;  1LQ1 A;  1HW5 A;  1HQC A;  5K5O A;  2A07 F;  2VT2 A;  3BDD A;  3GFJ A;  5DD8 A;  2FBI A;  5D5W B;  4A0Z A;  1HKT A;  5D5X B;  2CW0 F;  4LG0 B;  2D1H A;  3ZN1 A;  5CVV A;  3E6C C;  3JW4 A;  4HYE A;  3I4P A;  1HSJ A;  2JT1 A;  3DQV C;  2LF7 A;  4IRI A;  2O6G E;  3K9T A;  4RAZ A;  3I53 A;  2FNA A;  1J5Y A;  4I0A A;  2YPR A;  2ZME B;  4YG2 F;  3E6M A;  1MGT A;  2H6B A;  3MZY A;  1FBS A;  2KKO A;  3KLN A;  1W5T A;  5E20 A;  2VC0 A;  2ETH A;  2CWE A;  2A69 F;  2BBY A;  5LHG A;  1BOA A;  3TDU C;  3TOA A;  3BWG A;  5E8I A;  4E70 A;  3DV8 A;  1K79 A;  5CVU A;  1Z9C A;  4ZH4 F;  1ZG3 A;  1IN4 A;  3RI4 A;  4M6Y A;  2P8T A;  3TO6 A;  3OOP A;  3ZPL A;  1DPR A;  4RGS A;  2H27 A;  1BIA A;  5BOX A;  1IUY A;  2G7H A;  5AIP A;  3ZMT A;  1S8N A;  1TLH B;  5K5Q A;  4A6E A;  2EFO A;  3TQN A;  1XDS A;  3LQR A;  4GYG A;  1U8R A;  5E17 F;  1TBX A;  3F6V A;  1RUN A;  1K7A A;  2BE5 F;  4ESF A;  3C1D A;  2LDU A;  3C3W A;  5J8F A;  4XBF A;  3C18 A;  4M9S A;  2XKO A;  4U0Y A;  3NRV A;  1OYI A;  3KEQ A;  1YS6 A;  2GWR A;  5LLQ A;  3HSE A;  4PZJ A;  2P5L C;  1O3T A;  4BHP A;  5HLH A;  2WWY A;  3E5X A;  1ZGA A;  1WSU A;  2BGC A;  2L4A A;  1IN5 A;  1MZB A;  5E1W A;  4G9Y A;  2PI0 A;  1B59 A;  2L54 A;  1ZYR F;  2HS5 A;  4NB5 A;  1Z6T A;  2GXG A;  4L18 B;  3L00 A;  5DD4 A;  4AIJ A;  3LQQ A;  3U9G A;  3FMQ A;  4ETS A;  4HAM A;  3TDZ C;  3DPT A;  1D8J A;  2STW A;  3RKY A;  3CUQ C;  3E6D A;  4FX0 A;  2GXB A;  2XHK A;  4YFX F;  1LEA A;  3FXU A;  2FE3 A;  2JPB A;  4RAY A;  3BJO A;  3RPQ A;  1IW7 F;  4G94 A;  3B73 A;  2B0L A;  1Y0U A;  3F8C A;  4HX8 A;  1R00 A;  5DYM A;  1FBU A;  3WGI A;  5K1Y A;  3WU1 B;  2STT A;  1HXD A;  2IA1 A;  2A68 F;  2QVO A;  1IN6 A;  4AIK A;  5D8K B;  3CDH A;  4XSZ F;  1HKQ A;  1XN7 A;  1OMI A;  3RKW A;  1YTY A;  4G7O F;  1L0O C;  2VOP A;  2HGC A;  5FGM A;  3BY6 A;  3HTS B;  1ZRF A;  2EV0 A;  1CF7 A;  4LFU A;  1ZAO A;  4UV8 A;  3FMS A;  3WG9 A;  3E6B A;  2TDX A;  2F5F A;  3GX4 X;  1B1B A;  3RYR A;  1JE8 A;  3K1N A;  1D8K A;  4HW0 A;  4PCQ A;  4JBA A;  1TQI A;  2RC4 A;  2XIG A;  1DDN A;  2MC3 A;  3VB2 A;  2DPU A;  2Y75 A;  3KET A;  1F5T A;  2W84 A;  1FP1 D;  3V7R A;  2FNP A;  3T1B A;  3GYH X;  2JZY A;  3RJP A;  2YR2 A;  1R7J A;  3HIF A;  2DO7 A;  2XRO A;  1SFU A;  3GZ6 A;  1SMT A;  1GXQ A;  4UXN A;  5L3C A;  2VE8 A;  4U0V A;  3ZQ7 A;  5CLS A;  2M8E A;  3B02 A;  1P6R A;  3MEX A;  2XVC A;  3GWZ A;  3IWF A;  2NYX A;  2KJB A;  5DEQ A;  2DK8 A;  4CIC A;  2GIV A;  3ECH A;  4LMY A;  2F5C A;  5FB2 A;  2OZ6 A;  2P6S A;  3TOB A;  1IZ1 A;  2LNB A;  3FXR A;  4ON0 A;  4L9N A;  4GGG A;  5LBQ A;  2ISZ A;  4BQA A;  3J81 Z;  5A2Q K;  3I0T A;  2K4J A;  4G7Z F;  3GW2 A;  2E7X A;  4UNO A;  2PFB A;  3ZP5 A;  3K2Z A;  2GAU A;  2CQK A;  4FHT A;  5JR3 A;  1TTY A;  4DQ2 A;  2EJR A;  2ESN A;  2P6T A;  4R79 A;  3F8N A;  3E3V A;  3I5U A;  5E8G A;  4IVN A;  3KZZ A;  4U7B A;  5H6R A;  4BAY A;  4KMF A;  1KQ9 A;  2A61 A;  2VC1 A;  3EYY A;  1BI3 A;  1IXR C;  4A6D A;  1W5S A;  4HLX A;  4WF2 A;  2FBK A;  1J59 A;  3E97 A;  5KVR A;  1BI0 A;  2QWW A;  2YX4 A;  4D0P A;  5DUK A;  3N97 A;  2KIF A;  5DCF A;  4AD9 A;  1IN7 A;  2ISY A;  4HF1 A;  5IT9 Z;  5DV5 A;  3WTY C;  4MTE A;  1BBY A;  1A04 A;  4EJW A;  2H94 A;  1T6S A;  3FZV A;  1P92 A;  1XCB A;  2QLZ A;  2D1V A;  4P96 A;  3D5L A;  3GLX A;  3ULQ B;  5J8C A;  5L3D A;  2MH9 A;  1WQ2 A;  3ABT A;  4JQF A;  1O3Q A;  3FWE A;  3CJN A;  2ZNY A;  1FSE A;  4I2O A;  1OPC A;  3FF5 A;  1KQ8 A;  4M9Z A;  3EUH A;  1H9G A;  2DFI A;  1H0M A;  3PQK A;  4Q47 A;  1E2X A;  2RQP A;  1I6X A;  4EGZ A;  2YSR A;  4N0B A;  1IAW A;  2DLL A;  2IRF G;  2DK5 A;  2RGV A;  4IHT A;  3Q9V A;  5FD5 A;  2PMU A;  2GA1 A;  5CVJ A;  1UHW A;  1UCR A;  2MA3 A;  1P4X A;  2VN2 A;  3VOE A;  1UFM A;  2XAG A;  1QZY A;  1STZ A;  4WXD A;  4N9H A;  1GXP A;  6PAX A;  4I98 B;  4OOI A;  1BI1 A;  5AIQ A;  1B9N A;  1SD5 A;  2YU3 A;  5LGT A;  2WC2 A;  4MQV A;  1XGN A;  1CF7 B;  2YX7 A;  2P4W A;  3VFZ A;  2PMH A;  1F4K A;  1XMA A;  2K27 A;  2ESH A;  4KN4 X;  3F72 A;  1I27 A;  1ZRE A;  4UVA A;  3L2C A;  3P9C A;  3LST A;  4CYD A;  2OZU A;  4ENK A;  3KEO A;  3R0J A;  3W6K B;  3I64 A;  3HHG A;  2A5Y B;  1U78 A;  5HDK A;  1UHM A;  5LRS A;  4B09 A;  3WGG A;  1CGP A;  2OD5 A;  3R6S A;  2HQN A;  2DU9 A;  4YFK F;  3RTR A;  1KU7 A;  2XV4 S;  5ICF A;  1I1S A;  2VT3 A;  2X4H A;  1VTN C;  4YII A;  2IT0 A;  2EA4 A;  1FSH A;  4GCV A;  4KYW A;  1TW3 A;  2XAQ A;  3HYI A;  1UB9 A;  3O3K A;  3CUQ A;  1QNT A;  1RI7 A;  3IKT A;  3V4G A;  1Z91 A;  2HTS A;  2M5W A;  3EYI A;  4GYI A;  3S2W A;  1ZLK A;  4HA8 A;  2OQR A;  2QM3 A;  2K4B A;  3QP6 A;  1LDD A;  2V79 A;  3RYP A;  3WE3 A;  2MLG A;  5AON A;  1D5V A;  1XB4 A;  2Z9O A;  4OMY A;  3F22 A;  4LLG F;  4LD5 A;  3J80 Z;  2MD5 A;  1XSX A;  2ZFW A;  4Y13 A;  1ZGJ A;  3P9K A;  1R36 A;  4L5J A;  2EV6 A;  2UXX A;  2P5K A;  5BMZ A;  3MQ0 A;  1HW1 A;  4G6Q A;  5ICG A;  4L0Y B;  4ESB A;  4U0W A;  4Q5S F;  1XDU A;  1BJA A;  1XSV A;  5EEH A;  2P7C B;  4L9J A;  1SD4 A;  3HTU A;  5D4S A;  2XUB A;  4AVP A;  3NQO A;  2VOD A;  1O3S A;  1EH6 A;  3KP7 A;  3FHZ A;  3HUG A;  2P7V B;  5FD6 A;  1EH7 A;  3J7A O;  2R3S A;  3P9I A;  3GFI A;  1BN5 A;  1V4R A;  1XCV A;  3I71 A;  3U1D A;  4XLP F;  4WK8 F;  4WXH A;  3BOQ A;  1XD7 A;  1FZP B;  1S29 A;  1O7F A;  1J0R A;  5E1X A;  2EWN A;  2HWV A;  2BV6 A;  4ZYD A;  4M9X A;  4KMU X;  3H3Z A;  3T8R A;  3ZMS A;  4KIC A;  3QOP A;  2L3D A;  4MEX F;  4HV5 A;  2Z33 A;  1EH8 A;  1FBQ A;  2JPC A;  3JAM K;  4P9F A;  2PLY A;  1QQI A;  3CUQ B;  3TKY A;  5E1Z B;  4HOB A;  3IWZ A;  3WOD F;  3HRM A;  1REP C;  2FOK A;  1K78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...