3CUQC

Integrated structural and functional model of the human escrt-ii complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
173
Chain Sequence
SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 173
sequence length 173
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 3cuqC01
2GQQA 3QP6A 3JAMK 1LB2A 1XGNA 2R7DA 3TGNA 1OKRA 3CDHA 2FNPA 3MAJA 3P9KA 1PDNC 1G3WA 3V7CA 1HKTA 2EK5A 2BE5F 2ZMEA 3K9TA 1G3SA 4QWQA 2FOKA 1W5SA 2XAFA 4CDGA 2ZJ2A 4IHTA 4A0YA 1J2XA 2OQRA 3WTUC 2DU9A 1IN7A 2W24A 4M9ZA 2WV0A 3I4PA 2A6HF 2J5OA 3ZP5A 4S05A 3T8TA 1YS7A 1LDJA 1U5TB 3M9AA 4LG0A 2EFQA 4ZH4F 3RKWA 5HLIA 1R5GA 5CVJA 5EEHA 2K86A 1IN8A 4PGGA 4XLNF 2VC0A 4O6JA 3FMQA 3E3VA 2AXLA 2HFHA 2QM3A 2KIUA 2OZ6A 1TQMA 3TO6A 1JHHA 4KICA 5FFXA 5D6EA 1J7KA 2WC2A 4U0WA 2PQ8A 1KYWA 3COAC 3Q9SA 3J81K 5DUIA 3C7JA 2W25A 3PFIA 2NYXA 4H0EA 2W57A 1KA8A 3JTHA 2IT0A 4RB0A 1K6OA 2CO5A 2UZKA 3HTUA 4EJWA 2ZCWA 1FWZA 3I5UA 4RS8A 1B6AA 4AVPA 3CO6C 3IWFA 2EFNA 4EJVA 2ESHA 3ERED 5DCFA 2DAOA 2DTRA 4MTDA 2C6YA 2A69F 1D5VA 3BWGA 4OMZA 3KFWX 3WTTC 4BHBA 4U7BA 1ZRFA 3BPXA 1ZN2A 2CGPA 2XAQA 1QZZA 3K1PA 3TOBA 4OIQF 3KP4A 4KDPA 1KQ0A 5FD5A 5J6XA 1H0MA 3FM5A 3D0SA 5CJ9A 2VONA 3CUQA 3FXUA 3LA2A 1DPRA 4XSXF 1J0RA 4L0YB 3EUHA 4RB3C 1J75A 1J5YA 4WCGA 3WTWC 2QENA 2OA4A 4P5OA 2YR2A 5ERIA 2M1BA 3FMSA 4HF2A 2L54A 3KP7A 1P4WA 3DKWA 4MTEA 2NNYA 3GYHX 4BQAA 3BJAA 4XRFA 1T6SA 4G6DA 3K2ZA 1BC8C 1SMYF 1TBXA 2JT1A 4I0AA 2VE8A 1L3LA 1S3JA 3PQKA 5JI6A 2RN7A 3MEXA 1R23A 1K78A 2HQNA 2ZO4A 1FP1D 1YG2A 1FYLA 4IVNA 4AIJA 1IXCA 1RUOA 5ILVA 3JAMZ 2MC3A 4Q47A 1U2WA 3Q5FA 1SD4A 1XGMA 2HTJA 4G9YA 1ZARA 2ADUA 2XHKA 4EJOA 4BAYA 4LLLA 2O03A 4IJAA 4K2EA 3O2PE 1W7PB 3LQQA 2YSRA 2NNNA 2Y75A 1G4DA 2BEOA 1XN7A 5BPDA 1FYKA 2K4BA 5CVVA 3KEOA 2P6SA 2ZFWA 3GZ6A 3R0JA 4F7ZA 4KMUX 3JW4A 5L3BA 4IRGA 3F72A 1GVJA 1T38A 5BOXA 1TNSA 4LK0F 2GAUA 1WI9A 2EJRA 3RJPA 3KLNA 4RGUA 2PLYA 1D8JA 4L0ZB 3FZVA 3E6BA 2Y0MA 2Z5UA 1HW5A 3DFGA 1G6NA 4M9SA 3HIFA 2XROA 5L3CA 1K79A 4AIKA 1O7LA 3E6MA 1LDDA 2QUFA 3P7NA 4JK1X 4U0VA 1QQIA 5D5UB 4HV5A 2VBYA 2G7HA 3V7RA 1BI1A 4N0BA 3T5XA 1KQ8A 4GCVA 2PMUA 3C1DA 2HYGD 5KVRA 5L3DA 3BY6A 3WG9A 2VXZA 2HZTA 4HDUA 4MQ9F 4HOBA 2LSOA 2QYOA 4KYWA 3GO5A 1ZHFA 4L18B 5DDGA 2E1CA 2V1UA 1FYMA 2GXGA 2OBPA 4EM1A 1WSUA 3RI4A 1Z05A 4OOIA 3KE2A 4RGXA 4WK8F 1B4AA 3H3UA 3GEZA 4YFXF 3EETA 2H27A 1X3UA 3VFZA 1P92A 1IW7F 5TJJA 2O6GE 1FC3A 1G3YA 1STZA 1XSDA 3C3WA 3ZMVA 2Y48A 4KA4A 1QZYA 1ZGAA 1FPQA 2A68F 4KN7X 3M7GA 5ILUA 5HS8A 3ZMDA 2HKXA 1J59A 3ZMUA 4L9TA 3C18A 1RNLA 1XMAA 5E18F 4M74A 1W7PA 4QLCU 2LNBA 4UVCA 1UCRA 4O5VA 3TOAA 4HYEA 4CYDA 4EM0B 2BBYA 4KUMA 3I59B 4LB6B 2ZMEC 4L9VA 1FP2A 2ZNYA 1UHWA 3E5UA 1CF7B 2HYFA 3DPLC 2Q8KA 2ZKZA 2ELHA 1D8KA 1P4XA 5DCMA 4RB1A 1C0WA 1S7AA 2GXBA 1HXDA 2YX4A 2F5DA 5AIQA 4A2UA 2RDPA 1BM9A 3ZN0A 1MJ9A 1SD6A 2IRFG 3E97A 3ELKA 3RYPA 2E1NA 5EEGA 5FB2A 5DV5A 4IHSA 3SQNA 4I02A 2ISZA 5ILSA 2XASA 2HTSA 4HQEA 4A5MA 1FX7A 3TDZC 1USTA 4YIIA 4M6YA 1EH7A 4D0PA 5L3GA 2HR3A 3U1DA 2EFWA 4EMSA 2QLZA 5A2QZ 1H9TA 2QQBA 2HOEA 4G6QA 3U2RA 4YG2F 2E7WA 3V8JA 3WU1B 4L5IA 3W6JB 1U78A 2XRNA 3DF8A 1R00A 5JHUA 1P6RA 1V3FA 3G3ZA 2MH2A 2VBXA 1F5TA 4I09A 1NHAA 2EV0A 1ZLJA 2KRFA 5D5XB 2HQRA 4CZZA 5J8CA 4B09A 5E20A 4ENMA 5H6RA 2H6CA 4BH9A 1XSVA 4ESJA 4GYGA 1S6LA 4R79A 2GA1A 2IW5A 1VTNC 4Y15A 4L9NA 4HLXA 1KU3A 5AONA 3RDIA 5D4SA 4EGYA 4M9XA 3M1EA 4UV8A 2EFPA 2QVOA 2VN2A 3D5LA 3ZMSA 3EYYA 3QU3A 1R5HA 1OPCA 3KCCA 2QQ9A 2GA2A 3GW2A 1KU7A 3E5XA 4U88A 1BI2A 2HKOA 2X4HA 5L3FA 4XSZF 2FMYA 1EH8A 2VBZA 1MJAA 1LDKB 5E8IA 1J9IA 5HS9A 2GIVA 1A04A 4HAMA 1QPMA 3HOTA 2CSOA 3CUQC 1QO0D 1SAXA 3IHUA 3I54A 3WGGA 3GVAA 1Z7UA 2JPCA 1MDMA 1HW1A 2OD5A 4WXCA 2DK8A 1FZPB 3NQOA 1R22A 4YIFA 1R58A 1GXPA 5KK1A 5D8LB 1U8RA 1I1GA 1ON1A 1Z9CA 2V9VA 5D5WB 1U5TC 2P8TA 2DO7A 2LF8A 1MKMA 1PP8F 2EA2A 2EV6A 1AWCA 2PJPA 1BOAA 3HUGA 2FSWA 2VC1A 3IL2A 3MFKA 3NEUA 1ULYA 3ML6A 1R1TA 2BGCA 2DQRA 3K1NA 3V7SA 2KIMA 1R1UA 2MLGA 2G9WA 4I98B 1Z6RA 2A3SA 1TQPA 3HRSA 3K0LA 3HSFA 3VB2A 2PN6A 3L2CA 1O7FA 4IXAA 3R4KA 4G8XA 1IXSB 1Z1DA 5TRDA 1LEBA 1Z6TA 3HRUA 4LMYA 2VE9A 1Y0UA 2K7LA 1HKSA 1HBXG 4OIPF 2VT2A 4M6XA 1LNWA 3KP6A 2XGXA 2KKOA 2GWRA 1XB4A 1K7AA 2H6BA 1T39A 5FLXZ 4AIHA 3L9FA 2KJBA 3JSOA 1E2XA 3JSPA 1FSEA 1XDSA 1HQCA 3WTVC 4A12A 4UNOA 1ZRCA 2VBWA 3KP3A 2EV5A 2P4WA 1O57A 3FM3A 4LB5A 1TW3A 5DD4A 1Q1HA 3F8NA 3SZPA 1U5TA 1B59A 4ASNA 6PAXA 3LSTA 1I1SA 2PEXA 4IRIA 4OU0A 4ZYEA 1HSJA 3G73A 2CFXA 3R0AA 2V1DA 5D4RA 4RB2C 1FNNA 3WTSC 1XCBA 3LQRA 2YU3A 1SMTA 2H09A 2TDXA 1ODDA 4IF4A 3PQJA 1YS6A 3VOEA 5A2QK 3IWZA 3O3KA 2DPDA 1RZ4A 4IPAA 4LLGF 1BI3A 2CQKA 5HOOA 4JQFA 3QRFF 3IKVA 1BIBA 5HS7A 2BV6A 2LF7A 3B73A 2COMA 4A0XA 1P4AA 3HYIA 3SHFA 4KMFA 3V8KA 2WWYA 2RV8A 3IKTA 2W84A 1L0OC 4I7HA 1I27A 4CHUA 1YQAA 3HSEA 3L09A 4KIFA 5ICFA 3BDDA 4M72A 3SFZA 1KU2A 4RAZA 1EH6A 4XLPF 4UVAA 1FLIA 1FY7A 4HZFA 3BZ6A 4I0BA 3E6CC 3TO7A 1BBYA 1D3YA 1IN6A 3DXJF 2VOOA 3R61A 3ABTA 3LAPA 2RNJA 3WTYC 1GHCA 3F8MA 3K69A 5LGUA 3RYRA 2R3SA 4TV7A 2LDUA 2ETHA 2L4MA 1QBJA 3BJOA 2XKOA 4ETSA 2A07F 2F5FA 1LVAA 2KJCA 2D1VA 1O3TA 1BC7C 1SFEA 2JSCA 5LHIA 2NS0A 1IN5A 2XAJA 4EQQA 5IT9Z 4KIGA 5CVUA 4WX9A 4KNYA 2Z33A 5BMZA 1XGSA 1XCVA 1O3QA 1OYIA 5K5QA 2P7CB 4ENNA 3GWZA 3P9CA 5D8KB 5BS6A 4R1HA 5E1XA 3ISPA 5LHHA 3TDUC 3DEUA 1O3RA 3H92A 2HGCA 1I6XA 1BN5A 3SZTA 4BYYA 3ZQ7A 2HWVA 1REPC 1I5ZA 3GUDA 4XBFA 1XMKA 5FD6A 1Z91A 3GZ5A 1KU9A 1R7JA 2IVMA 2FU4A 3KEQA 2IP2A 2CW0F 1F9NA 3B02A 4CXFA 2DI3A 4CO8A 2IA0A 4EGZA 2J5PA 1ZLKA 1S8NA 1QGPA 1MGTA 2ZMEB 3BPVA 1W4MA 4OIRF 3P9IA 1MD0A 1OYYA 4FT8A 1DP7P 2A6EF 2CG4A 4AWXB 1ZRDA 1DPUA 2NAZA 5CVIA 1UFMA 4HBLA 3BJ6A 2Z3YA 4U7DA 4S04A 1YYVA 5K1YA 3F8FA 5BQTA 4GYIA 3HOSA 3CJNA 2MLKA 3EQLF 3O6BB 2QZ8A 4LK1F 4RGSA 3DV8A 2M87A 1TTYA 2DBBA 1YTYA 1MJBA 3Q9VA 4GXOA 5ED4A 5FLXK 2D1HA 3F21A 2YX7A 2XVCA 2L02A 3FXQA 3IC7A 2FRHA 4ENKA 4KT5C 3RPQA 5JVTA 3ZN1A 2L3DA 1YFHA 3TKYA 1YW8A 5CLSA 3J7AO 2VT3A 4HX7A 5E1WA 4ZYHA 5H20A 3U9GA 3QPHA 3GFLA 3LA3A 3LA7A 2YPRA 5IT3A 2FF4A 1R36A 3H3ZA 5LRSA 2RKHA 2A5YB 4OIOF 2ISYA 3FF5A 3VODA 5F1RA 4HA8A 1XD7A 2L4AA 3ABUA 5HLHA 1ZGJA 1JXSA 3MWMA 3T1BA 3WGIA 4JBAA 3KETA 4WXHA 1MZBA 2F5EA 4PGHA 2IA2A 4OMYA 2O8XA 3R60A 2XIGA 4B8XA 4NHJA 2ESNA 4KFCA 2STWA 3RIRA 1U6GA 4ENJA 5DUKA 1PUEE 2FEZA 2DK5A 1WWXA 2FXAA 1FBSA 4BNCA 4O3MA 1ON2A 4BHPA 4ZYDA 4UHTA 2XAHA 1SFXA 2LKPA 5HDKA 2OZUA 1IXRC 3CUQB 1AOYA 3HHHA 4BHCA 5LBQA 2P7VB 1ZG5A 3L7WA 2XV4S 3RPUA 3W6KB 1W7PD 2IA1A 2W85A 3GFJA 4A6DA 4FX4A 4N9HA 2Z99A 4G7OF 1FBUA 3KZZA 2M45A 3N4MA 3I59A 3M8EA 2IPQX 1RI7A 3MCZA 1U3EM 3RKYA 4I2OA 5LLQA 1FOKA 1T2KA 4MEXF 3WTZA 1CF7A 1WKMA 5HLGA 1IRGA 2O3FA 2RVCA 5IT9K 3RTRA 5JR3A 3QOPA 2XAGA 1YO5C 4ZZDA 3F6OA 3OOPA 4FHTA 4IRHA 2KIFA 3WU0A 2FQ3A 1K78B 1ZH5A 4Q4ZF 2ZXJA 1CGPA 4UV9A 2PG4A 2P6TA 3CUOA 3ECOA 1DUXC 3ECHA 4RAYA 4Y13A 3REOA 3FXRA 1IUYA 3MQ0A 5H6QA 5LEKA 3ZMZA 4ON0A 1PP7U 4WF2A 2K27A 1IZ1A 3MZYA 2VODA 1S7OA 3E6DA 2DPUA 4OINF 4YFKF 3J80Z 2IJLA 5ICGA 2BYVE 1GXQA 3F8BA 5CYVA 2FNAA 4A6EA 2V79A 2O0YA 2P5LC 1BIAA 5LHGA 2Q2EA 3VEPA 1KYZA 1ZAOA 2JTVA 2QBYB 2UXXA 2CYYA 1KQ9A 3QPTA 2OU2A 5CVRA 4PDKA 2ZBKA 3BOQA 5HDNA 5LGNA 4Z2YA 3T8RA 4HQMA 3HRTA 5D5VB 4NQWA 1IN4A 4LFUA 2X0LA 1TW2A 1YW7A 1UHMA 4EV0A 3EDPA 3FX3A 4HW0A 3WGHA 4BXUA 3HRMA 4LD5A 1S29A 3ZMTA 2MBFA 3S2WA 1P2FA 5FGMA 1LQ1A 3AAFA 4L5JA 3JTGA 4P96A 4RGRA 3MZHA 1R1VA 3ULQB 4U0YA 3DPTA 4P9FA 4P55A 4AD9A 1H9GA 5J8FA 2O61A 4MEYF 1ZREA 1USSA 2K02A 2Z9OA 3GFMA 1SFUA 3NRVA 2RQPA 4KIBA 4WXDA 1ZG1A 1RUNA 1JGSA 3BP8A 5LGTA 4LGWA 2D45A 5E1ZB 3F22A 3EYIA 5F6FA 3K1MA 4I01A 4PZJA 1IRFA 2E7XA 5F64A 2PBIA 3IRQA 2JRTA 3I64A 3QU6A 1W5TA 1RIOH 3FWEA 2M8EA 4G7HF 4N9IA 1TQIA 1DDNA 3IRRA 1OYWA 2QQAA 2STTA 3OV8A 2WTEA 2FBKA 2EWNA 4EJUA 2DW4A 2OAZA 4DNCA 2AS5F 3TQNA 5DEQA 3I0TA 4NB5A 2QWWA 3QP5A 2ZNZA 3CO7C 1O3SA 1ZG3A 2DT5A 2ACJA 1IF1A 2UXNA 1BI0A 1V4RA 5DD8A 1SD7A 3CLOA 1TLHB 5LRRA 4L9JA 4Q5SF 1QNTA 2QBYA 2JPBA 1JHFA 5ICEA 5DCMB 1HKQA 1UB9A 2EA4A 2FBHA 2RC4A 4MHGA 3GF2A 1F1ZA 3GFIA 4GO1A 1LEAA 1WRJA 4MGRA 4EM2A 5HDGA 5E8GA 4YFNF 4MNUA 1EV7A 4HF0A 5AIPA 3LAJA 4HV6A 1YIOA 4CGZA 1WQ2A 3GLXA 3M8FA 5HVQC 4HX8A 4HF1A 4M71A 3FHZA 2XKPA 3WE2A 5K5OA 1E17A 2G7UA 2GZWA 2HEOA 2FMLA 1SD5A 2DFIA 4KN4X 3L00A 4G94A 1OR7A 2PI0A 3ZPLA 3GX4X 3E5QA 4CICA 3V4GA 1YW9A 4FX0A 5K5RA 2EFOA 3QAHA 4ZYGA 4ESBA 4E70A 3TO9A 2NRAC 1B9MA 2VOPA 2HDCA 3J81Z 2M30A 1HW2A 5D6FA 3HSRA 1LJ9A 1T98A 3I53A 3DP7A 4A5NA 3KLOA 3F3XA 5DYMA 4G7ZF 5FFZA 3R6SA 3J80K 4HLYA 3SXYA 1BJAA 3RKXA 4WWCA 3F23A 4P9UA 3HTSB 1B9NA 3DQVC 2UWMA 3BROA 1B1BA 2MH9A 4HX4A 3GXOA 3HHGA 2HS5A 4Y17A 3I58A 3LFKA 3FMRA 3I71A 4GGGA 2K4JA 4LJZF 3F6VA 1F4KA 3ROUA 1T0FA 4MQVA 1XGOA 3KP5A 4M73A 2B0LA 4PCQA 2RGVA 1XDUA 2L01A 4LG0B 3KZYA 1FSHA 1IAWA 3N97A 3F8CA 4ZZLA 4LLNA 1ZYRF 4Q48A 4EJTA 2JZYA 1YLFA 2H94A 2P5KA 3T0YA 2XUBA 1JE8A 5JFRA 5ICCA 3WODF 3WTXC 2PMHA 3WE3A 1MDMB 2F5CA 2MD5A 4DQ2A 4ESFA 1ONVA 2A61A 2Q0OA 4UXNA 1OMIA 2FE3A 2MA3A 3KP2A 1FBQA 5FO5A 2DLLA 2M5WA 2FBIA 2D2WA 2OQGA 2PFBA 5BPIA 2P5VA 1XSXA 3V8LA 2R7FA 4HDVA 2F2EA 4UUVA 1HSTA 1FT9A 4R8HA 4A0ZA 1TNTA 2CWEA 2DQLA 3CTAA 5L3EA 4EVIA 4UVBA 2EB7A 2V1XA 1G3TA 2V6CA 5LEJA 5E17F 1KGSA 2FA5A 3LWFA
chains in the Genus database with same CATH superfamily
1GVDA 2GQQA 1MIJA 4XL9A 4FETA 2IAIA 3QP6A 3JAMK 3MVPA 2ELKA 1YRNB 1LB2A 2DMPA 1XGNA 1ETOA 2R7DA 3FISA 2IGNA 3FHNA 1WJAA 3TGNA 1P7IA 1OCZH 3JRCA 1OKRA 3S3MA 3ZXSA 1X1BA 3CDHA 2FNPA 3MAJA 2PMZN 3P9KA 1PDNC 1VQ9I 1G3WA 2ZXWH 3V7CA 1HKTA 1MMNA 2DJNA 2EK5A 5J1RA 2BE5F 4ZDLA 2ELJA 1JKQC 2ZMEA 1AKHB 2RREA 1MBFA 3K9TA 1G3SA 4QWQA 2FOKA 1W5SA 1TWCJ 2XAFA 1X4PA 4CDGA 2ZSIB 2ZJ2A 4IHTA 4A0YA 1RKTA 1J2XA 2OQRA 3WTUC 2Y31A 1HF0A 3OYJA 2DDBA 3V42A 2DU9A 1K83J 4UY8I 1IN7A 3JRHA 2KFDA 5H2FC 3CF5F 2M4KA 1A36A 2W24A 4M9ZA 2WV0A 3I4PA 2A6HF 2J5OA 3ZP5A 2V6EA 4S05A 3T8TA 1YS7A 2AQEA 1LDJA 1U5TB 1W36C 3M9AA 3FBNB 4A3EJ 4LG0A 2V9KA 2DFHA 2EFQA 2JSPA 4ZH4F 3RKWA 5HLIA 1R5GA 2ZSHB 5CQEA 5CVJA 1VQNI 5EEHA 2K86A 2IBDA 4HNUA 1IN8A 1FOXA 1JUSA 4PGGA 3W6VA 4XLNF 2OC6A 4JX5A 4IHYA 2VC0A 4O6JA 1Z67A 3FMQA 4A3IJ 3E3VA 2AXLA 3ZQGA 2HFHA 3ZQCA 2DMTA 2P81A 2QM3A 2CJJA 2Y30A 1PUFA 2KIUA 3CLQA 3HOVJ 2OZ6A 4XN0A 1TQMA 3RZDJ 3IUOA 1P9QC 3TO6A 1JHHA 4KICA 5BNGA 5FFXA 4FASD 5D6EA 1WVRA 1J7KA 2WC2A 1XMXA 1JI8A 3D1NI 4U0WA 2KRCA 3BR2A 2Q1ZB 4XKCA 2PQ8A 1FEXA 5K7ZA 1KYWA 3COAC 3NARA 2A6TA 3Q9SA 3J81K 5DUIA 3C7JA 2VI6A 4BQQA 2W25A 3PFIA 2NYXA 3A03A 1W0UA 4FTHA 5FLVA 2E36A 2AQFA 4H0EA 2W57A 1KA8A 2GBYA 3LSMA 2H8RA 3JTHA 3FXOA 2IT0A 3KYDB 4RB0A 2K9QA 3CCSI 1K6OA 2CO5A 4E7HA 2UZKA 2QA4I 3HTUA 4EJWA 2ZCWA 1FWZA 3I5UA 4RS8A 1B6AA 1K6YA 4AVPA 2VKEA 3CO6C 3DWLE 3K6GA 2OTJI 3EUKL 3IWFA 2EFNA 1JKOC 4A3JJ 3SZGA 4EJVA 2V1NA 2ESHA 1ZK8A 3OR1C 3ERED 1BR1A 4E7IA 2R7TA 1Z7LA 5DCFA 2DAOA 5DM7F 3FIWA 2DTRA 4MTDA 2C6YA 4IO9F 2JA5J 4RAGA 2E19A 4LITA 2A69F 3G6EI 1D5VA 3BWGA 4OMZA 3KFWX 1IV6A 2P0WA 2O8KA 1UZCA 2X6XA 1OLTA 2Z2SB 3SJMA 3WTTC 4BHBA 5E3LA 4U7BA 1ZRFA 1OISA 3BPXA 1ZN2A 4HSTA 2CGPA 2XAQA 1QZZA 3K1PA 4A3GJ 3TOBA 4OIQF 2M7AA 3KP4A 2ZXIA 2MYSA 2COBA 4KDPA 4G12A 1KQ0A 2E2HJ 1SAUA 2LD5A 4M3DA 5FD5A 5J6XA 1AKHA 4JX6A 2KMUA 3CQZJ 1H0MA 3FM5A 3D0SA 5CJ9A 1YI2I 2XPWA 4IOCF 2VONA 3CUQA 3FXUA 3LA2A 1D5YA 1DPRA 3H5RA 1J0RA 4XSXF 2FOWA 4L0YB 2BOLA 2LH9A 2GLOA 3EUHA 3TEDA 4RB3C 2HVSA 3LSIA 1J75A 1J5YA 4WCGA 3J7AY 4BEHA 3WTWC 2QENA 3BG6A 1R6RA 2OA4A 4P5OA 2W00A 2YR2A 4BGDA 2ZC2A 2CRGA 5TGTA 3PIPF 3DTEA 5ERIA 2NOGA 2M1BA 2CV1A 3FMSA 1Y1WJ 4HF2A 2L54A 3KP7A 2VJ4A 1P4WA 2XF7A 3DKWA 1MBGA 3HC7A 4D5CA 1MMAA 3E0JB 4MTEA 2DMQA 2NNYA 3PO3J 3GYHX 1V55H 4BQAA 3BJAA 4XRFA 1T6SA 2K3FA 4G6DA 4A3BJ 1B72B 4PUSA 3K2ZA 1BC8C 1SMYF 1TBXA 2JT1A 4I0AA 5M5XJ 2M2EA 2R7RA 3S1MJ 1VQ6I 4UB8C 2HDDA 2VE8A 1L3LA 3WHCA 3AKZA 1S3JA 3CZ6A 2DDAA 2VJIA 3ASNH 3G2BA 3PQKA 4PJ0C 5JI6A 2RN7A 3MEXA 2YS9A 1R23A 1K78A 2HQNA 2ZO4A 1FP1D 1YG2A 1FYLA 4Z6YA 1A6IA 4IVNA 4NNJA 4AIJA 2L9SA 1I6HJ 1IXCA 1RUOA 3FK6A 5ILVA 2XPUA 3JAMZ 2MC3A 4Q47A 5GPAA 4BE0A 5EGOA 1U2WA 3Q5FA 1SD4A 1R4NB 1XGMA 2LMDA 3ZQHA 2DFFA 1H8AC 2PJRA 2CQNA 2HTJA 4G9YA 1VQMI 1ZARA 2ADUA 2XHKA 4EJOA 3CMYA 4XIDA 2FX0A 2R93J 2MGQA 4LLLA 4BAYA 4X6AJ 4Y3OA 2JRMA 2O03A 4IJAA 3BTLA 3WG7H 4K2EA 3O2PE 1W7PB 3LQQA 2XB0X 2BXYA 1V54H 2VPRA 2YSRA 3CP8A 2K3PA 3MN2A 2NNNA 4B43A 3K4LA 2Y75A 1IV8A 3AL0C 4D9JA 3C2HA 1VQ4I 1G4DA 2VKHA 3M3YJ 3OS2A 2BEOA 1XN7A 5BPDA 1FYKA 3RQ4A 2K4BA 2WAQA 3LSJA 3LSGA 4M3GA 5CVVA 4U87A 3KEOA 4EATA 2P6SA 2ZFWA 2CUZA 4W97A 3GZ6A 3R0JA 4F7ZA 5EG0B 4KMUX 3BR3A 3JW4A 5E79C 5L3BA 5E3MA 2R5YB 2OTLI 4IRGA 4M3FA 3F72A 1ZKGA 1GVJA 1T38A 5BOXA 1TNSA 2KIQA 4LK0F 2GAUA 1WI9A 3OY9A 5FKOA 3A0BC 2EJRA 3RJPA 2FD5A 1EJ9A 2HDWA 3KLNA 4BS9A 5JHFA 5M5WJ 4RGUA 1WH5A 2VQHA 1YITI 2PLYA 1D8JA 4NDLA 3FZVA 4KJZA 4L0ZB 1T0FC 2BY1A 2Y0MA 3E6BA 2VLAA 2Z5UA 1HW5A 5F0FA 3DFGA 1G6NA 3BZCA 4M9SA 3HIFA 2XROA 3OYFA 1R71A 5L3CA 1K79A 1LE8A 1W36D 3FXJA 1VQOI 2BW3A 2EIKH 4AIKA 2IEKA 1O7LA 2WA0A 4C2UA 1J09A 1LDDA 3E6MA 2R92J 1W0TA 2QUFA 3P7NA 1U9NA 2X48A 4BACA 4UUTA 3GTPJ 4JK1X 4U0VA 4B3XA 2CU7A 1QQIA 4CA0A 4XKWA 1JKRC 4XLAA 1EF4A 1KZHA 5D5UB 4HV5A 2VBYA 2G7HA 3V7RA 1BI1A 4N0BA 3T5XA 1GV2A 1KQ8A 4GCVA 2PMUA 3C1DA 2HYGD 3GTMJ 2EQRA 1MNDA 5KVRA 2EZKA 3BC8A 2WY7Q 4ITVA 1DU0A 5K7HA 3S32A 3DEWA 5L3DA 3BY6A 3JRGA 3WG9A 3AFHA 5IYBJ 1XS9A 2VXZA 2VKDA 2HZTA 4HDUA 3BQYA 4MQ9F 1LVKA 4CUGA 1TZLA 1X58A 4HOBA 2KDZA 2QSFX 2LSOA 2QYOA 4KYWA 3GO5A 1T8IA 1RR8C 2ID6A 1ZHFA 3H9GA 3CF2A 2LREA 4L18B 5DDGA 2E1CA 2HNHA 3Q0VA 2DMUA 2V1UA 1Y56A 4XRSA 1FYMA 2GXGA 2OBPA 2HPIA 4EM1A 1WSUA 3AG1H 4BE1A 3RI4A 5B1BH 1Z05A 4OOIA 3KE2A 4RGXA 3PNYA 4WK8F 4J19A 2LY9A 1B4AA 1F43A 2VB6A 2BHZA 3H3UA 3EUAA 4BJTA 3GEZA 4YFXF 3EETA 2H27A 1X3UA 3VFZA 1P92A 1IW7F 5TJJA 4UB6C 2A5WA 4CCNA 2O6GE 3HM5A 1FC3A 1G3YA 4BJ6C 4BUPA 1STZA 3FDYA 1XSDA 3C3WA 3ZMVA 2Y48A 4KA4A 1QZYA 4D7NA 1ZGAA 1FPQA 2A68F 1IDZA 4KN7X 3S93A 1Z0XA 1WJCA 4QPQA 4F3QA 4A3FJ 4HSRA 3M7GA 4II2A 5ILUA 5HS8A 1S7EA 3L2QA 3ZMDA 2HKXA 2LVSA 1J59A 3HKZA 3BG5A 4L9TA 4C30A 3ZMUA 3P5JA 2MD0A 1AU7A 2E1MB 2Z1DA 4HG2A 1PYVA 2F4IA 3C18A 4N4OB 4KT6A 4AYBA 4D7MA 1RNLA 1XMAA 5E18F 4M74A 4CZCA 2W4SA 2R5ZB 1T33A 3RQIA 3LNQA 1W7PA 4XRSG 1YX5A 3J7YJ 4QLCU 3TP3A 2LNBA 4RAFA 4UVCA 1UCRA 4DZJA 3MKWB 4O5VA 3TOAA 4J00A 4HYEA 1JUMA 1MH3A 1WCMJ 2BBYA 5EJCA 4CYDA 4EM0B 2KPMA 4KUMA 3I59B 2HVRA 1Y8QB 1G8XA 3JRDA 2ZMEC 4LB6B 2XGDA 4XNFA 4L9VA 2KT0A 1FP2A 1EKEA 2ZNYA 1UHWA 3E5UA 3S1RJ 1WGXA 3ZQQA 2KQRA 2XRLA 1CF7B 2HYFA 1R9TJ 3DPLC 2Q8KA 2ZKZA 2ELHA 4RLQA 5CKTA 1D8KA 4XM3A 1P4XA 5DCMA 4RB1A 2E2JJ 1C0WA 1UMQA 4AVZA 1RC9A 1S7AA 2GXBA 1HXDA 2YX4A 2F5DA 4X0GA 5FRNA 2JA2A 5AIQA 4A2UA 3G1MA 2RDPA 3HGYA 4M6VA 1QA6A 2CQXA 1BM9A 3ZN0A 1MJ9A 3MD2A 4ZDPA 2BY3A 2L7KA 1SD6A 3Q3SA 4BBSJ 2IRFG 1K4TA 3E97A 3ELKA 3RYPA 2E1NA 1YJWI 5EEGA 1RKWA 5FB2A 3KPHA 5DV5A 1SFKA 3CP2A 4IHSA 2FJ1A 3SQNA 4I02A 1JTXA 2ISZA 4DYCA 5ILSA 4X1EA 2XASA 3H0GJ 2HTSA 4XN3A 2UV1A 4P1WA 4HQEA 3HXLA 2KISA 3JR9A 4A5MA 1FX7A 4XOPA 3ZR8X 3TDZC 2L0KA 2QGUA 1QRYA 1USTA 4YIIA 1KONA 2B7EA 3BLYA 4ZTJA 4M6YA 1EH7A 2ZXHA 4D0PA 4LIUA 5L3GA 2HR3A 2M9HA 3U1DA 4XMYA 2EFWA 2QKLB 4EMSA 2QLZA 5A2QZ 3BR0A 3JRFA 1H9TA 2QQBA 3VYUB 4PSXA 2OCCH 1MSEC 2HOEA 4G6QA 1BR4A 1WJ5A 3U2RA 2V7FA 3LSHA 1S72I 4IHXA 4B1RA 4XOTA 3M4OJ 2LLKA 4YG2F 2E7WA 4BXXJ 3V8JA 2MW8A 2Q2EB 5GAEJ 3WU1B 1B8IB 4L5IA 3W6JB 1U78A 2K9LA 2XRNA 3DF8A 3QPSA 2TCTA 2DOAA 2CV2A 4XONA 4JYKA 1R00A 1WHUA 5JHUA 1P6RA 1V3FA 2GOXB 2NS8A 4XR6A 3G3ZA 1ITYA 2MH2A 2VBXA 1F5TA 4I09A 1NHAA 1YIJI 2EV0A 4ANJA 1ZLJA 4CYCB 1XPXA 2KRFA 3IH2A 1BW6A 5D5XB 1VZ0A 2HQRA 4GFBA 1A5JA 4CZZA 1X1DA 5J8CA 2XSJC 4B09A 5E20A 2NVTJ 3K4CA 4ENMA 5H6RA 4UUSB 1T95A 2H6CA 3L1PA 4BH9A 4CCLA 4V19K 1IUFA 1XSVA 4ESJA 2JVGA 4GYGA 1S6LA 4R79A 2GA1A 2IW5A 3ZOBA 1VTNC 4Y15A 4IQ4A 2OF7A 3E7LA 3K70C 4L9NA 2CUEA 4HLXA 1KU3A 5AONA 3QYEA 3QWLA 3RDIA 2QF7A 3U21A 5D4SA 3L2RA 4M9XA 5FKMA 4EGYA 3A0HC 3ZGKA 2CUJA 5J1UA 2BHYA 3UR3C 3M1EA 2KZGA 1G59A 4UV8A 3KZIC 2EFPA 1GV5A 3OWTA 2QVOA 2VN2A 3D5LA 3ZMSA 1RPWA 3EYYA 1NK3P 5GTIC 3QU3A 1R5HA 1OPCA 3KCCA 2HYJA 4L5EA 2QQ9A 2F4OB 1BR2A 2GA2A 3GW2A 1KU7A 4GRIA 3E5XA 3K4MA 1SVLA 4U88A 1BI2A 1X1CA 2HKOA 3JRAA 2X4HA 5L3FA 4XSZF 3HG9A 2FMYA 1EH8A 5FKNA 2VBZA 1MJAA 1MBHA 1LDKB 5E8IA 4V2FA 4IOAF 4DYQA 4IKFA 1J9IA 5HS9A 2GIVA 3AG4H 3PO2J 1MMGA 3DU6A 2VIXA 1A04A 4HAMA 3GTJJ 1QPMA 5EZGA 1Q1VA 1DU6A 4XRMA 1TWGJ 3HOTA 2CSOA 3CUQC 1QO0D 2N8GA 1SAXA 3A01B 3C2BA 3IHUA 3I54A 2LOOA 2JQ7A 2L2OA 3EUHC 4S0HB 3WGGA 3GVAA 1Z7UA 2JPCA 3H3VK 1MDMA 1A31A 1VNDA 4IX7A 1TC3C 1HW1A 2OD5A 4WXCA 2DK8A 3LSKA 1QVUA 1FZPB 3DEEA 3NQOA 3MKZA 1R22A 3HJEA 2PX9A 1BA5A 4QSHA 4CSWA 4YIFA 2X9DA 5IOYA 1R58A 2L5QA 3LMMA 5J4VA 5KK1A 1UHSA 3OYGA 1GXPA 5D8LB 1U8RA 2I10A 1I1GA 1ON1A 4YELA 3DCFA 4A93J 1Z9CA 2V9VA 1BW5A 2LTPA 5D5WB 2DA3A 3F0CA 1U5TC 2P8TA 2DO7A 1HC8A 1A6QA 3TP0A 2QCOA 2LF8A 1MKMA 2VPLA 1PP8F 2R4GA 1Z3XA 1T08B 3PUBA 2EA2A 2EV6A 1AWCA 2PJPA 1MNMC 1BOAA 3H0DA 2PMZA 3HUGA 2FSWA 2VC1A 3IL2A 2I8DA 2QEXI 3MFKA 3L2UA 3BCAA 4PJMA 5FLMJ 3NEUA 1ULYA 3ML6A 1R1TA 4AC0A 1UG0A 2BGCA 2DQRA 2DA5A 3JRIA 1OCRH 3K1NA 1HDPA 2DOFA 5JLXA 3V7SA 5B1AH 1X19A 1FIAA 3I4MJ 2KIMA 3CC2I 1R1UA 2MLGA 3ABLH 2G9WA 4I98B 3BTIA 1DQUA 5CPRB 1UG2A 1Z6RA 1YE9A 2XDVA 2VQCA 2A3SA 1TQPA 3HRSA 3K0LA 3HSFA 3VB2A 5B66C 4HNTA 1YRNA 2VJJA 2LFBA 2W48A 4PFPA 1LUJB 2PN6A 3L2CA 1O7FA 1X3WB 4IXAA 3R4KA 3H9QA 4G8XA 4MIMA 4E7JA 3CCVI 2ICWG 1IXSB 1Z1DA 2NVUB 4CCKA 5TRDA 1LEBA 3HZJA 2DCEA 3SEZA 4KISA 1Z6TA 2AHQA 2E2IJ 3VYRB 3HRUA 4LMYA 4CYCA 1R5ID 1WH7A 2VE9A 3UKGA 1Y0UA 1H89C 2K7LA 1HKSA 1HBXG 4OIPF 2VT2A 2OV7A 4UUSA 4M6XA 1LNWA 2L9RA 3KP6A 2JUGA 2F48A 4CH7A 2IS4A 1UJ8A 2XGXA 2KKOA 4OAZA 2GWRA 3BR6A 1XB4A 4FQGA 2DA7A 1TWAJ 5C44J 1K7AA 4IZZA 2H6BA 3I3LA 1LPQA 5FRMA 1T39A 5FKKA 1LFBA 3VWBA 2BY2A 4AIHA 5FLXZ 3L9FA 3HBLA 2KJBA 2YUSA 1E2XA 3JSOA 4B4CA 3JSPA 1FSEA 1XDSA 1HQCA 3WTVC 5KCMA 3SYTA 4A12A 4UNOA 1ZRCA 3S8PA 5FROA 2L7ZA 2VBWA 3KP3A 4RMNA 2EV5A 2P4WA 1BJZA 3TBIA 1O57A 3FM3A 3OL3A 4LB5A 1FJLA 1TW3A 3OL4A 4BXFA 2VJ5A 5DD4A 2H8WA 1Q1HA 3F8NA 3JRBA 4B47A 3SZPA 4ABZA 1U5TA 2HXIA 1B59A 2XGEA 4ASNA 6PAXA 3LSTA 2WAEA 1V5EA 2PEXA 4IRIA 1I1SA 4XORA 5HNHA 3FBIB 3CCJI 3HOWJ 4OU0A 3OYMA 1RETA 4ZYEA 1HSJA 3CCRI 3G73A 2CFXA 2WY8Q 3OYDA 3R0AA 2V1DA 5B3SH 2WB1N 5D4RA 4RB2C 1FNNA 4NBQA 3A01A 3HDDA 3LOCA 3QYBA 4PJLA 3WTSC 4NC7A 1FTTA 3VPRA 1XCBA 4FE7A 3C2GA 3LQRA 3CC4I 2YU3A 3AL0B 2JA7J 2JVHA 1SMTA 2O7OA 2H09A 2TDXA 1ODDA 2MSYA 3KEYA 4IF4A 1RRJA 3PQJA 1YS6A 3VOEA 5A2QK 3KYLA 3S1QJ 2HQAA 3IWZA 3O3KA 2DPDA 1RZ4A 4IPAA 1I3QJ 3VYSB 4LLGF 1BI3A 2CQKA 1ETYA 3DBLB 5HOOA 1EA3A 4KITB 4JQFA 3QRFF 3OYIA 3IKVA 2DA2A 3CD6I 3HOXJ 4NUBA 1O4XA 3IAM2 1BIBA 5HS7A 2LP0A 4A3MJ 2BV6A 2LF7A 3B73A 2COMA 5EZHA 4A0XA 1P4AA 3HYIA 3SHFA 1DP3A 2ZFUA 3IV5A 4KMFA 3V8KA 2WWYA 3MZ8A 5J3LA 2WAFA 2RV8A 4B3AA 1QPIA 5B5EC 3IKTA 2W84A 3ONQA 4HNVA 1L0OC 1I50J 4I7HA 1DGWY 1I27A 4CHUA 1YQAA 2W1OA 2Y0SN 2Y69H 3HSEA 3L09A 4KIFA 5ICFA 3OIOA 4CCOA 2Y9YA 3W2VA 1ACIA 3BDDA 5IYCJ 1NK2P 2E34A 4M72A 3SFZA 1KU2A 2Y9ZA 4RAZA 3KYCB 3K70D 1EH6A 2L9VA 4XLPF 4UVAA 2XC7A 2RNGA 3B6AA 1FLIA 1FY7A 5F27A 2LG4A 1R49A 4HZFA 3BZ6A 4I0BA 3WHBA 3GTLJ 3E6CC 2X51A 3G71I 3I4NJ 3H9JA 3QYFA 3TO7A 1BBYA 1D3YA 1IN6A 3DXJF 1OQYA 2VOOA 3R61A 3ABTA 3LAPA 2RNJA 3QQAA 1S5LC 3WTYC 1GHCA 3F8MA 2L7FP 3K69A 5LGUA 3RYRA 2R3SA 1IRXA 4TV7A 2XGCA 3M8JA 2LDUA 2ETHA 2L4MA 1QBJA 2M8GX 1WJEA 2E5NA 4DBRA 1VQ5I 3PSIA 3BJOA 1WI3A 2XKOA 2B63J 4ETSA 2A07F 2IGKA 1I39A 2F5FA 1LVAA 2KJCA 2CUFA 3LFUA 3S2DJ 2D1VA 4PJNA 3CMAI 3CMEI 1O3TA 2E35A 2JWTA 4OAYA 1SFEA 4EEFG 1BC7C 3K10A 2JSCA 2HXOA 5LHIA 2NS0A 1VQ8I 1IN5A 2XAJA 4EQQA 3S15J 5IT9Z 4KIGA 5CVUA 4WX9A 2V9PA 2DXIA 4KNYA 2Z33A 5BMZA 3VYTB 4MLOA 1XGSA 1TWFJ 1E3OC 4B44A 1XCVA 1O3QA 1OYIA 5CQGA 4A3CJ 1ETXA 5K5QA 3IH4A 1MBJA 2HI3A 5GTHC 2JA6J 3SDBA 2P7CB 4IQJA 4ENNA 1MH4A 3PJRA 3GWZA 3P9CA 4QTRA 1TT0A 3CCEI 3PUFA 2XF6A 5D8KB 5BS6A 4R1HA 5E1XA 3ISPA 5LHHA 3K4NA 4Y4RA 3TDUC 3DEUA 2XF5A 2R7XA 1O3RA 1X1AA 2EILH 4JP0A 3H92A 2F4MB 3QODA 2HGCA 2LBFB 2EZHA 1FIPA 2KLOA 1I6XA 3LSPA 1B72A 1BN5A 3SZTA 4BYYA 3GTGJ 3ZQ7A 4F91B 2HWVA 1REPC 1I5ZA 3GUDA 5KHDA 4XBFA 5M5YJ 1JT0A 1XMKA 3O8GA 1LKXA 2HQ5A 3HOYJ 1SANA 5FD6A 1Z91A 2IXSA 5IOZA 4E7SA 3GZ5A 3RSNA 1KU9A 1R7JA 2IVMA 2I5UA 2FU4A 1ZR4A 3KEQA 5LFAA 1JGGA 5EDNA 2IP2A 2CW0F 1F9NA 2DT6A 3B02A 3DKYA 2DI3A 4CXFA 1QVTA 4CO8A 3GMEA 2IA0A 4EGZA 4OWRB 2J5PA 4YEJA 1ZLKA 1WPKA 3RZOJ 1S8NA 1QGPA 1MGTA 1PJRA 2ID3A 2ZMEB 3A1YA 1HDDC 1BOBA 3BPVA 1W4MA 1TL8A 5KAIC 2K85A 4NC8A 4OIRF 3P9IA 3CJQB 1MD0A 1MW7A 1OYYA 3SFIA 1BL0A 3IH3A 4FT8A 1DP7P 2A6EF 2CG4A 1I3AA 4AWXB 1ZRDA 1FTZA 4XKVA 3ZQIA 5E3OA 3S2HJ 2M4GA 1MNEA 1OJLA 1Y8RB 1DPUA 2R7VA 4E4HA 4XLHA 2DYSH 2NAZA 5CVIA 1UFMA 4HBLA 4ZC3A 3BJ6A 4NC6A 2Z3YA 4HPQA 4U7DA 4S04A 2GXAA 3NAUA 1M1EB 1YYVA 2MC4A 5K1YA 2H1KA 3IP4B 3X2QH 3F8FA 4B48A 2JMWA 2R0QC 4XK4A 5GAGJ 5BQTA 1U9OA 4GYIA 2JUCA 2LRDA 3HOSA 3O8HA 5EG0A 3CJNA 2MLKA 2BVLA 4JX4A 2OCEA 3EQLF 3S1NJ 3O6BB 2QZ8A 2ZJRF 2R5YA 2XPVA 4LK1F 4RGSA 3DV8A 3QOEA 1WJBA 2M87A 1TTYA 2DBBA 1YTYA 1MJBA 3Q9VA 4GXOA 1Z77A 3DTKA 2HOTA 5ED4A 5FLXK 2NVXJ 2D1HA 2IGOA 3F21A 1D1BA 2YX7A 2XVCA 2L02A 3FXQA 3IC7A 2FRHA 3ABKH 3ERMA 4ENKA 4KT5C 3CCYA 3RPQA 5JVTA 3E1SA 3ZN1A 2L3DA 1PUFB 3CC7I 3MKLA 2F6CA 1YFHA 1VQKI 4BY7J 3TKYA 1YW8A 5CLSA 3J7AO 3H35A 2VT3A 4HX7A 5E1WA 4ZYHA 2AXTC 5H20A 3U9GA 4Y33A 3QPHA 2CQ7A 3GFLA 1RR7A 4E7LA 1E0EA 3LA3A 3LA7A 2YPRA 4PK4A 5F04A 2M7BA 5IT3A 3VSKA 3S16J 5KNLA 2FF4A 1R36A 3HOZJ 3H3ZA 5LRSA 5TISC 2JK3A 2RKHA 4FE4A 2A5YB 4E6KG 1JT6A 4BE2A 3BQZA 4LG3A 4OIOF 2ISYA 3FF5A 3VODA 5F1RA 4HA8A 5JLWA 1XD7A 3BTCA 2L4AA 3ABUA 1Z3YA 4W1UA 3K4JA 2ZJQF 3FKJA 5HLHA 3OYBA 2DMNA 1ZGJA 4YIRX 3OYHA 2LKSA 3AG2H 1JXSA 3MWMA 3EPZA 3T1BA 3WGIA 4JBAA 5EEAA 2LYCA 3KETA 1NH3A 1NTCA 4AUXA 2ME6A 1ORKA 3BG3A 1OFCX 4WXHA 1MZBA 2F5EA 3CJTB 3PSFA 1HLVA 3IAS2 4PGHA 4C9YA 3BR5A 2IA2A 2LBFA 4OMYA 2O8XA 3S3NA 1G2HA 3R60A 2XIGA 2VQLA 4HEA2 4I76A 4B8XA 1W5CC 4NHJA 2ESNA 4KFCA 2STWA 2Z16A 3A4CA 3RIRA 1U6GA 4I99C 4NQWB 5FJ8J 1F36A 3ZQLA 4II3A 4ENJA 2ECCA 5IPAA 5DUKA 1PUEE 2FEZA 3RCOA 3HEFA 4HRIA 2GOMA 1D0XA 2DK5A 1LFUP 3OIQA 1WWXA 2FXAA 2DODA 2QSGX 4YRVA 1FBSA 2DT7B 4BNCA 4O3MA 1ON2A 1WZ2A 5GPCA 5JVGF 4BKXA 4BHPA 4ZYDA 4UHTA 2XAHA 1SFXA 2LKPA 3G1OA 4C3IJ 3OYNA 1NG6A 5HDKA 1OCPA 4E7KA 3CUQB 2OZUA 1IXRC 1WJDA 3BZKA 4BU2A 3HHHA 5DS9A 1AOYA 4BHCA 5LBQA 4AIDA 2P7VB 3KIOA 2E60A 2EZLA 1ZG5A 3CESA 2DYRH 4GDFA 2R5ZA 5IP6A 3L7WA 2XV4S 3RPUA 3W6KB 1W7PD 2IA1A 2W85A 2XB5A 3GFJA 2CH0A 3DLLF 2JN6A 4BEHB 5J1YA 4A6DA 3I55I 4FX4A 4N9HA 2L9NA 5DM6F 2Z99A 4G7OF 2EZIA 1FBUA 3KZZA 2M45A 3N4MA 1MBEA 1Y0NA 3H1CA 3I59A 4RDUA 2KP6A 1GDTA 3M8EA 1HA8A 2IPQX 1RI7A 3MCZA 1U3EM 3RKYA 4I2OA 1IDYA 1D0ZA 5LLQA 1FOKA 1T2KA 4MEXF 3WTZA 5HODA 1CF7A 3TW6A 3H5AA 4CCMA 1WKMA 5HLGA 1IRGA 2O3FA 2RVCA 5IT9K 3RTRA 5JR3A 3QOPA 4XLEA 1TT5B 2XAGA 3W2WA 2DA6A 3BCBA 1YO5C 4MFEA 3K2AA 4ZZDA 3F6OA 2LKXA 2LY1A 3OIPA 3OOPA 1UAAA 4FHTA 4IRHA 2KIFA 3WU0A 2FQ3A 2CMPA 1K78B 1APLC 1YJ9I 1ZH5A 2X6OA 2CV0A 4Q4ZF 4V2GA 3PNTA 2EH3A 2ZXJA 4PSWA 1TWHJ 1CGPA 1WFXA 4UV9A 2PG4A 1X3ZB 2P6TA 5IP7J 3CUOA 3ECOA 1VQPI 2G0EA 3ECHA 4RAYA 3ZQFA 5EGOB 1DUXC 4AU7A 2E5ZA 4Y13A 3REOA 3PM1A 2LY2A 3FXRA 3MMYB 2IS1A 1IUYA 3MQ0A 5H6QA 5LEKA 3ZMZA 4QPOA 2PJRB 4ON0A 5GADJ 1PP7U 3DLAA 4WF2A 5M3MJ 4F92B 2QQ8A 4JOMA 2JA8J 2H1LA 1WJFA 1Y1VJ 2NXNB 3DTIA 2K27A 1IZ1A 4IL6C 1GT0C 3MZYA 2VODA 1S7OA 1XC5A 3W2AA 5IP9J 3CCUI 2WADA 3E6DA 2DPUA 2QSHX 2LK2A 1ZELA 4OINF 4DZPA 4YFKF 3J80Z 2IJLA 5ICGA 2BYVE 1GXQA 3CMMA 1X2NA 1HCRA 3F8BA 1TP4A 2TRTA 5CYVA 1GUUA 4FCYA 4ZTFA 3HOUJ 2FNAA 4A6EA 2ZB9A 2V79A 4XLFA 2O0YA 4BL0B 2W82A 2P5LC 1RESA 1BIAA 3FXMA 5LHGA 2Q2EA 3VEPA 1KYZA 3A02A 1ZAOA 3TL4X 2JTVA 1B8IA 2QBYB 2UXXA 2CYYA 1KQ9A 3QPTA 2OU2A 5CVRA 2O5RA 1ZGWA 4PDKA 3OYAA 2ZBKA 3BOQA 3A2KA 2WV1A 5HDNA 3ZRGA 4DYRA 5LGNA 5EYRA 3L2VA 2DA1A 1N25A 3HPHA 4G6TB 4Z2YA 3T8RA 4HQMA 3HRTA 5J40A 4NQWA 5D5VB 2M0CA 3D5SC 4H4KC 4RM2A 2GIZA 4Y7NJ 1N77A 1MMSA 1IN4A 2R7OA 4LFUA 4RA2A 4FISA 2E1OA 2X0LA 1TW2A 1YW7A 1UHMA 2ME0A 2VQGA 4EV0A 3M07A 4E7ZA 5HLTA 3EDPA 3FX3A 3W3CA 1LE8B 4HW0A 3WGHA 4BXUA 3HRMA 4LD5A 3TW7A 2BW3B 1K4SA 1S29A 3ZMTA 2MBFA 2WAQN 3S2WA 1P2FA 5FGMA 3OYEA 3HB9A 1LQ1A 1JKPC 3AAFA 5J47A 4L5JA 1ZR2A 4C3HJ 3JTGA 4P96A 3NWSA 2E71A 4LOCA 4M3EA 4RGRA 1YX3A 4BBRJ 3MZHA 1OCCH 1R1VA 3ASOH 3OYLA 3HPGA 3LSRA 3WU2C 3ULQB 1IG7A 4U0YA 3DPTA 1ERDA 2X6WA 1FOYA 1T56A 4P9FA 2MABA 3DBHB 4P55A 4AD9A 4DJAA 4F52A 1AA7A 4XQFA 1H9GA 3RPUD 5J8FA 1VFCA 2O61A 1FMWA 1PVEA 2OJED 4MEYF 2K9MA 5C3EJ 1ZREA 1ENHA 1USSA 1E3HA 2EBIA 2K02A 2Z9OA 1NG7A 3GFMA 3NRVA 4C2MJ 2BY0A 2RQPA 1SFUA 2LR8A 4KIBA 4WXDA 2X1EA 1IGNA 5KAFC 2CW8A 1ZG1A 3F9KA 1MSFC 1RUNA 1JGSA 3BP8A 2K9SA 5LGTA 5HNFA 2VUMJ 4LGWA 3BR1A 1X1PA 1OCOH 2D45A 2YU9J 2CW7A 3BG7A 4J01A 1SVOA 2XAUA 4D5FA 5E1ZB 5C4XJ 1QU3A 3F22A 3EYIA 5F6FA 2EINH 3K1MA 4I01A 1FOWA 2DFEA 4PZJA 1IRFA 2E7XA 1ETVA 2DA4A 5F64A 2AO9A 2DN0A 2PBIA 3CJRB 3SEQA 3GBGA 3OYKA 3IRQA 1A35A 1OR7C 3D5RC 2JRTA 3I64A 3QU6A 1W5TA 3JREA 1RIOH 1X2MA 3VDXA 4LIVA 3H5NA 1QHGA 2R7QA 3FWEA 2KZVA 2M8EA 2R7WA 1ETWA 4G7HF 1IRZA 4N4NB 4N9IA 1TQIA 1DDNA 3M1CA 3IRRA 3DU5A 1OYWA 2QQAA 2STTA 4DOZA 3OV8A 2WTEA 2VKVA 2R7SA 2FBKA 1YHQI 1SEUA 2EWNA 4DBQA 4EJUA 2DW4A 2OAZA 4A3LJ 4DNCA 2AS5F 2ZJPF 2NVQJ 3TQNA 3SDGA 3OSFA 3CCQI 5DEQA 3I0TA 4PFOA 4NB5A 2QWWA 3JCUC 3QP5A 1JJ6C 1UELB 2ZNZA 3CO7C 3J7ZI 1AHDP 2RAEA 1YOVB 1O3SA 2OUMA 1ZG3A 2DT5A 2ACJA 1CQTA 3I9V2 3CCMI 1IF1A 4A69C 2UXNA 3GCMA 1BI0A 1V4RA 2MFZA 3PIOF 5DD8A 3OS1A 1SD7A 3CLOA 1XG1A 1TLHB 5LRRA 3DKXA 2EPFA 2DTZA 3AG3H 1V5FA 2Y2ZA 4L9JA 2DJIA 5FKLA 4Q5SF 1QNTA 2QBYA 2JPBA 1JHFA 3S17J 5ICEA 5DCMB 3HKZN 1HKQA 1UB9A 2B9SA 2EA4A 2FBHA 2RC4A 4MHGA 1SFOJ 3GF2A 2KRHA 4RM3A 1F1ZA 4BDYA 4AYBN 1Y6IA 5J4YA 3GFIA 5K7FA 4GO1A 3CDIA 1LEAA 1WRJA 4MGRA 4EM2A 3GLLA 5HDGA 5E8GA 4YFNF 4MNUA 1EV7A 4HF0A 5AIPA 3LAJA 4HV6A 3OMYA 1YIOA 2V4JC 4CGZA 4RLFA 3ZCOA 1R4MB 1WQ2A 4Y52J 4I6ZA 3GLXA 3M8FA 1JUPA 4HX8A 5HVQC 4HF1A 3BTJA 3OYCA 4M71A 1E3PA 3FHZA 2XKPA 3GZNB 9ANTA 3WE2A 5K5OA 3OR2C 1E17A 2G7UA 1JTYA 2EIMH 2WB1A 3G1LA 2GZWA 4XKBA 2HEOA 3TMOA 3FXLA 2FMLA 1SD5A 2CQQA 2DFIA 2O9LA 4KN4X 3L00A 4G94A 1OR7A 1FMVA 2D5VA 2PI0A 2HOAA 2FUG2 2M34A 3N05A 1U0JA 1QZEA 3ZPLA 2KL4A 3GX4X 3Q0WA 3OS0A 3E5QA 4CICA 5F0CA 3V4GA 3FKIJ 1YW9A 4ZJZA 4FX0A 1VQ7I 2DOEA 5K5RA 4QIWN 2EFOA 3QAHA 4ZYGA 5GAHJ 4ESBA 4E70A 2NS7A 4XLCA 5EF6A 3ESWB 3CDLA 3TO9A 2NRAC 1B9MA 2VOPA 2HDCA 3J81Z 2X6YA 2X1CA 2M30A 3K4KA 1HW2A 4DW6A 1Z21A 3L2WA 1ETKA 5D6FA 3HSRA 1LJ9A 3GTOJ 1T98A 3I53A 4BQNA 3ABMH 3DP7A 1YJNI 3K4BA 4A5NA 5F0HA 2R7ZJ 3KLOA 3F3XA 1QHHD 3NWTA 5DYMA 4G7ZF 5FFZA 2M3AA 1W1WE 3R6SA 3K7AJ 2Y0SA 1DGRM 3J80K 4HLYA 3VSLA 4D1QA 3SXYA 1BJAA 3RKXA 4WWCA 3F23A 4P9UA 2NVYJ 1OCTC 2FQ4A 3HTSB 2HU9A 2KHMA 4IHVA 1B9NA 1ETQA 3CCLI 1D1AA 3DQVC 4IHWA 5GP9A 4XICA 2UWMA 3BROA 2K9NA 4AM3A 1D0YA 1B1BA 2MH9A 4HX4A 1IO2A 3U1KA 3OSGA 1GLNA 5IY5H 3GXOA 3OOUA 3HHGA 2R7UA 4BQOA 2HS5A 2F5VA 2VL8A 3DBRB 4Y17A 3I58A 1XTAA 2L7MP 3FMRA 3I71A 3LFKA 4GGGA 1P7JA 4CCJA 2K4JA 2HPMA 2BZTA 4LJZF 3F6VA 1F4KA 3FXKA 3ROUA 5C4JJ 1T0FA 4MQVA 5F1JA 1U8BA 1XGOA 3KP5A 2HVQA 4F55A 4M73A 4DGWB 1LFPA 2B0LA 1IC8A 4BJ5C 4BY1J 1S9HA 4PCQA 2RGVA 1XDUA 3MKYB 2L01A 3HL2A 3G4SI 4LG0B 1HOMA 2A05A 1JJ8C 3KZYA 3GTQJ 1FSHA 2VASA 1IAWA 3KX2A 3N97A 4C2TA 3F8CA 2W7NA 4ZZLA 4LLNA 1MBKA 1VF9A 1ZYRF 4Q48A 4EJTA 2JZYA 2XSDC 2BVMA 2UUZA 3S3OA 1IJWC 1YLFA 2H94A 2P5KA 5F08A 3UNGC 3T0YA 2ECBA 4MO7A 3H36A 2XUBA 2IS2A 2OPTA 2E1MC 1N75A 2V26A 5JFRA 4A3KJ 1K61A 5ICCA 1JE8A 4MFDA 3WODF 3S14J 4DIQA 5IYDJ 1D1CA 3BG9A 3WTXC 2PMHA 4C3JJ 3WE3A 1MMDA 5E3NA 2EIJH 3DPUA 2F5CA 1MDMB 2MD5A 2GM4A 1H88C 4DQ2A 3BT9A 5M3FJ 4ESFA 2WBMA 1ONVA 2QKMB 2K40A 2HOSA 2CFOA 2X1DA 4IEJA 2M0MA 4ZYAA 1ZQ3P 1ZTRA 1SVMA 2A61A 2CS3A 2JJ7A 2Q0OA 3FK7A 4UXNA 2LC2A 2MG4A 5LD2C 1OMIA 1POGA 4RBOA 4A3DJ 2FE3A 3HGGA 2MA3A 3KP2A 4M3BA 1FBQA 3LL7A 5FO5A 4ZDOA 1Y39A 1VQLI 4F93B 2DLLA 2M5WA 2FBIA 2D2WA 3PFYA 2IGMA 2OQGA 1V5GA 2PFBA 5BPIA 2K5CA 2P5VA 2RQQA 1XSXA 3V8LA 3B6CA 2R7FA 4HDVA 4BDZA 2BXZA 2F2EA 4UUVA 1HSTA 2KDOA 1FT9A 1XX5A 4R8HA 2NOJB 5DTDA 3HUGB 3PNVA 1N78A 4A0ZA 1TNTA 2CWEA 2X85A 1X4OA 2DQLA 3Q0UA 1VI0A 3CTAA 3PL8A 4EVIA 5L3EA 2VXDA 2EB7A 4UVBA 2V1XA 3QPLA 2HZDA 1G3TA 2V6CA 2IS6A 5LEJA 3GTKJ 5E17F 1KGSA 2FA5A 4PJJA 1SC7A 3I56I 3LWFA 3RKQA
chains in the Genus database with same CATH topology
2GQQA 3QP6A 3JAMK 1LB2A 1XGNA 2R7DA 3TGNA 1OKRA 3CDHA 2FNPA 3MAJA 3P9KA 1PDNC 1G3WA 3V7CA 1HKTA 2EK5A 2BE5F 2ZMEA 3K9TA 1G3SA 4QWQA 2FOKA 1W5SA 2XAFA 4CDGA 2ZJ2A 4IHTA 4A0YA 1J2XA 2OQRA 3WTUC 2DU9A 1IN7A 2W24A 4M9ZA 2WV0A 3I4PA 2A6HF 2J5OA 3ZP5A 4S05A 3T8TA 1YS7A 1LDJA 1U5TB 3M9AA 4LG0A 2EFQA 4ZH4F 3RKWA 5HLIA 1R5GA 5CVJA 5EEHA 2K86A 1IN8A 4PGGA 4XLNF 2VC0A 4O6JA 3FMQA 3E3VA 2AXLA 2HFHA 2QM3A 2KIUA 2OZ6A 1TQMA 3TO6A 1JHHA 4KICA 5FFXA 5D6EA 1J7KA 2WC2A 4U0WA 2PQ8A 1KYWA 3COAC 3Q9SA 3J81K 5DUIA 3C7JA 2W25A 3PFIA 2NYXA 4H0EA 2W57A 1KA8A 3JTHA 2IT0A 4RB0A 1K6OA 2CO5A 2UZKA 3HTUA 4EJWA 2ZCWA 1FWZA 3I5UA 4RS8A 1B6AA 4AVPA 3CO6C 3IWFA 2EFNA 4EJVA 2ESHA 3ERED 5DCFA 2DAOA 2DTRA 4MTDA 2C6YA 2A69F 1D5VA 3BWGA 4OMZA 3KFWX 3WTTC 4BHBA 4U7BA 1ZRFA 3BPXA 1ZN2A 2CGPA 2XAQA 1QZZA 3K1PA 3TOBA 4OIQF 3KP4A 4KDPA 1KQ0A 5FD5A 5J6XA 1H0MA 3FM5A 3D0SA 5CJ9A 2VONA 3CUQA 3FXUA 3LA2A 1DPRA 4XSXF 1J0RA 4L0YB 3EUHA 4RB3C 1J75A 1J5YA 4WCGA 3WTWC 2QENA 2OA4A 4P5OA 2YR2A 5ERIA 2M1BA 3FMSA 4HF2A 2L54A 3KP7A 1P4WA 3DKWA 4MTEA 2NNYA 3GYHX 4BQAA 3BJAA 4XRFA 1T6SA 4G6DA 3K2ZA 1BC8C 1SMYF 1TBXA 2JT1A 4I0AA 2VE8A 1L3LA 1S3JA 3PQKA 5JI6A 2RN7A 3MEXA 1R23A 1K78A 2HQNA 2ZO4A 1FP1D 1YG2A 1FYLA 4IVNA 4AIJA 1IXCA 1RUOA 5ILVA 3JAMZ 2MC3A 4Q47A 1U2WA 3Q5FA 1SD4A 1XGMA 2HTJA 4G9YA 1ZARA 2ADUA 2XHKA 4EJOA 4BAYA 4LLLA 2O03A 4IJAA 4K2EA 3O2PE 1W7PB 3LQQA 2YSRA 2NNNA 2Y75A 1G4DA 2BEOA 1XN7A 5BPDA 1FYKA 2K4BA 5CVVA 3KEOA 2P6SA 2ZFWA 3GZ6A 3R0JA 4F7ZA 4KMUX 3JW4A 5L3BA 4IRGA 3F72A 1GVJA 1T38A 5BOXA 1TNSA 4LK0F 2GAUA 1WI9A 2EJRA 3RJPA 3KLNA 4RGUA 2PLYA 1D8JA 4L0ZB 3FZVA 3E6BA 2Y0MA 2Z5UA 1HW5A 3DFGA 1G6NA 4M9SA 3HIFA 2XROA 5L3CA 1K79A 4AIKA 1O7LA 3E6MA 1LDDA 2QUFA 3P7NA 4JK1X 4U0VA 1QQIA 5D5UB 4HV5A 2VBYA 2G7HA 3V7RA 1BI1A 4N0BA 3T5XA 1KQ8A 4GCVA 2PMUA 3C1DA 2HYGD 5KVRA 5L3DA 3BY6A 3WG9A 2VXZA 2HZTA 4HDUA 4MQ9F 4HOBA 2LSOA 2QYOA 4KYWA 3GO5A 1ZHFA 4L18B 5DDGA 2E1CA 2V1UA 1FYMA 2GXGA 2OBPA 4EM1A 1WSUA 3RI4A 1Z05A 4OOIA 3KE2A 4RGXA 4WK8F 1B4AA 3H3UA 3GEZA 4YFXF 3EETA 2H27A 1X3UA 3VFZA 1P92A 1IW7F 5TJJA 2O6GE 1FC3A 1G3YA 1STZA 1XSDA 3C3WA 3ZMVA 2Y48A 4KA4A 1QZYA 1ZGAA 1FPQA 2A68F 4KN7X 3M7GA 5ILUA 5HS8A 3ZMDA 2HKXA 1J59A 3ZMUA 4L9TA 3C18A 1RNLA 1XMAA 5E18F 4M74A 1W7PA 4QLCU 2LNBA 4UVCA 1UCRA 4O5VA 3TOAA 4HYEA 4CYDA 4EM0B 2BBYA 4KUMA 3I59B 4LB6B 2ZMEC 4L9VA 1FP2A 2ZNYA 1UHWA 3E5UA 1CF7B 2HYFA 3DPLC 2Q8KA 2ZKZA 2ELHA 1D8KA 1P4XA 5DCMA 4RB1A 1C0WA 1S7AA 2GXBA 1HXDA 2YX4A 2F5DA 5AIQA 4A2UA 2RDPA 1BM9A 3ZN0A 1MJ9A 1SD6A 2IRFG 3E97A 3ELKA 3RYPA 2E1NA 5EEGA 5FB2A 5DV5A 4IHSA 3SQNA 4I02A 2ISZA 5ILSA 2XASA 2HTSA 4HQEA 4A5MA 1FX7A 3TDZC 1USTA 4YIIA 4M6YA 1EH7A 4D0PA 5L3GA 2HR3A 3U1DA 2EFWA 4EMSA 2QLZA 5A2QZ 1H9TA 2QQBA 2HOEA 4G6QA 3U2RA 4YG2F 2E7WA 3V8JA 3WU1B 4L5IA 3W6JB 1U78A 2XRNA 3DF8A 1R00A 5JHUA 1P6RA 1V3FA 3G3ZA 2MH2A 2VBXA 1F5TA 4I09A 1NHAA 2EV0A 1ZLJA 2KRFA 5D5XB 2HQRA 4CZZA 5J8CA 4B09A 5E20A 4ENMA 5H6RA 2H6CA 4BH9A 1XSVA 4ESJA 4GYGA 1S6LA 4R79A 2GA1A 2IW5A 1VTNC 4Y15A 4L9NA 4HLXA 1KU3A 5AONA 3RDIA 5D4SA 4EGYA 4M9XA 3M1EA 4UV8A 2EFPA 2QVOA 2VN2A 3D5LA 3ZMSA 3EYYA 3QU3A 1R5HA 1OPCA 3KCCA 2QQ9A 2GA2A 3GW2A 1KU7A 3E5XA 4U88A 1BI2A 2HKOA 2X4HA 5L3FA 4XSZF 2FMYA 1EH8A 2VBZA 1MJAA 1LDKB 5E8IA 1J9IA 5HS9A 2GIVA 1A04A 4HAMA 1QPMA 3HOTA 2CSOA 3CUQC 1QO0D 1SAXA 3IHUA 3I54A 3WGGA 3GVAA 1Z7UA 2JPCA 1MDMA 1HW1A 2OD5A 4WXCA 2DK8A 1FZPB 3NQOA 1R22A 4YIFA 1R58A 1GXPA 5KK1A 5D8LB 1U8RA 1I1GA 1ON1A 1Z9CA 2V9VA 5D5WB 1U5TC 2P8TA 2DO7A 2LF8A 1MKMA 1PP8F 2EA2A 2EV6A 1AWCA 2PJPA 1BOAA 3HUGA 2FSWA 2VC1A 3IL2A 3MFKA 3NEUA 1ULYA 3ML6A 1R1TA 2BGCA 2DQRA 3K1NA 3V7SA 2KIMA 1R1UA 2MLGA 2G9WA 4I98B 1Z6RA 2A3SA 1TQPA 3HRSA 3K0LA 3HSFA 3VB2A 2PN6A 3L2CA 1O7FA 4IXAA 3R4KA 4G8XA 1IXSB 1Z1DA 5TRDA 1LEBA 1Z6TA 3HRUA 4LMYA 2VE9A 1Y0UA 2K7LA 1HKSA 1HBXG 4OIPF 2VT2A 4M6XA 1LNWA 3KP6A 2XGXA 2KKOA 2GWRA 1XB4A 1K7AA 2H6BA 1T39A 5FLXZ 4AIHA 3L9FA 2KJBA 3JSOA 1E2XA 3JSPA 1FSEA 1XDSA 1HQCA 3WTVC 4A12A 4UNOA 1ZRCA 2VBWA 3KP3A 2EV5A 2P4WA 1O57A 3FM3A 4LB5A 1TW3A 5DD4A 1Q1HA 3F8NA 3SZPA 1U5TA 1B59A 4ASNA 6PAXA 3LSTA 1I1SA 2PEXA 4IRIA 4OU0A 4ZYEA 1HSJA 3G73A 2CFXA 3R0AA 2V1DA 5D4RA 4RB2C 1FNNA 3WTSC 1XCBA 3LQRA 2YU3A 1SMTA 2H09A 2TDXA 1ODDA 4IF4A 3PQJA 1YS6A 3VOEA 5A2QK 3IWZA 3O3KA 2DPDA 1RZ4A 4IPAA 4LLGF 1BI3A 2CQKA 5HOOA 4JQFA 3QRFF 3IKVA 1BIBA 5HS7A 2BV6A 2LF7A 3B73A 2COMA 4A0XA 1P4AA 3HYIA 3SHFA 4KMFA 3V8KA 2WWYA 2RV8A 3IKTA 2W84A 1L0OC 4I7HA 1I27A 4CHUA 1YQAA 3HSEA 3L09A 4KIFA 5ICFA 3BDDA 4M72A 3SFZA 1KU2A 4RAZA 1EH6A 4XLPF 4UVAA 1FLIA 1FY7A 4HZFA 3BZ6A 4I0BA 3E6CC 3TO7A 1BBYA 1D3YA 1IN6A 3DXJF 2VOOA 3R61A 3ABTA 3LAPA 2RNJA 3WTYC 1GHCA 3F8MA 3K69A 5LGUA 3RYRA 2R3SA 4TV7A 2LDUA 2ETHA 2L4MA 1QBJA 3BJOA 2XKOA 4ETSA 2A07F 2F5FA 1LVAA 2KJCA 2D1VA 1O3TA 1BC7C 1SFEA 2JSCA 5LHIA 2NS0A 1IN5A 2XAJA 4EQQA 5IT9Z 4KIGA 5CVUA 4WX9A 4KNYA 2Z33A 5BMZA 1XGSA 1XCVA 1O3QA 1OYIA 5K5QA 2P7CB 4ENNA 3GWZA 3P9CA 5D8KB 5BS6A 4R1HA 5E1XA 3ISPA 5LHHA 3TDUC 3DEUA 1O3RA 3H92A 2HGCA 1I6XA 1BN5A 3SZTA 4BYYA 3ZQ7A 2HWVA 1REPC 1I5ZA 3GUDA 4XBFA 1XMKA 5FD6A 1Z91A 3GZ5A 1KU9A 1R7JA 2IVMA 2FU4A 3KEQA 2IP2A 2CW0F 1F9NA 3B02A 4CXFA 2DI3A 4CO8A 2IA0A 4EGZA 2J5PA 1ZLKA 1S8NA 1QGPA 1MGTA 2ZMEB 3BPVA 1W4MA 4OIRF 3P9IA 1MD0A 1OYYA 4FT8A 1DP7P 2A6EF 2CG4A 4AWXB 1ZRDA 1DPUA 2NAZA 5CVIA 1UFMA 4HBLA 3BJ6A 2Z3YA 4U7DA 4S04A 1YYVA 5K1YA 3F8FA 5BQTA 4GYIA 3HOSA 3CJNA 2MLKA 3EQLF 3O6BB 2QZ8A 4LK1F 4RGSA 3DV8A 2M87A 1TTYA 2DBBA 1YTYA 1MJBA 3Q9VA 4GXOA 5ED4A 5FLXK 2D1HA 3F21A 2YX7A 2XVCA 2L02A 3FXQA 3IC7A 2FRHA 4ENKA 4KT5C 3RPQA 5JVTA 3ZN1A 2L3DA 1YFHA 3TKYA 1YW8A 5CLSA 3J7AO 2VT3A 4HX7A 5E1WA 4ZYHA 5H20A 3U9GA 3QPHA 3GFLA 3LA3A 3LA7A 2YPRA 5IT3A 2FF4A 1R36A 3H3ZA 5LRSA 2RKHA 2A5YB 4OIOF 2ISYA 3FF5A 3VODA 5F1RA 4HA8A 1XD7A 2L4AA 3ABUA 5HLHA 1ZGJA 1JXSA 3MWMA 3T1BA 3WGIA 4JBAA 3KETA 4WXHA 1MZBA 2F5EA 4PGHA 2IA2A 4OMYA 2O8XA 3R60A 2XIGA 4B8XA 4NHJA 2ESNA 4KFCA 2STWA 3RIRA 1U6GA 4ENJA 5DUKA 1PUEE 2FEZA 2DK5A 1WWXA 2FXAA 1FBSA 4BNCA 4O3MA 1ON2A 4BHPA 4ZYDA 4UHTA 2XAHA 1SFXA 2LKPA 5HDKA 2OZUA 1IXRC 3CUQB 1AOYA 3HHHA 4BHCA 5LBQA 2P7VB 1ZG5A 3L7WA 2XV4S 3RPUA 3W6KB 1W7PD 2IA1A 2W85A 3GFJA 4A6DA 4FX4A 4N9HA 2Z99A 4G7OF 1FBUA 3KZZA 2M45A 3N4MA 3I59A 3M8EA 2IPQX 1RI7A 3MCZA 1U3EM 3RKYA 4I2OA 5LLQA 1FOKA 1T2KA 4MEXF 3WTZA 1CF7A 1WKMA 5HLGA 1IRGA 2O3FA 2RVCA 5IT9K 3RTRA 5JR3A 3QOPA 2XAGA 1YO5C 4ZZDA 3F6OA 3OOPA 4FHTA 4IRHA 2KIFA 3WU0A 2FQ3A 1K78B 1ZH5A 4Q4ZF 2ZXJA 1CGPA 4UV9A 2PG4A 2P6TA 3CUOA 3ECOA 1DUXC 3ECHA 4RAYA 4Y13A 3REOA 3FXRA 1IUYA 3MQ0A 5H6QA 5LEKA 3ZMZA 4ON0A 1PP7U 4WF2A 2K27A 1IZ1A 3MZYA 2VODA 1S7OA 3E6DA 2DPUA 4OINF 4YFKF 3J80Z 2IJLA 5ICGA 2BYVE 1GXQA 3F8BA 5CYVA 2FNAA 4A6EA 2V79A 2O0YA 2P5LC 1BIAA 5LHGA 2Q2EA 3VEPA 1KYZA 1ZAOA 2JTVA 2QBYB 2UXXA 2CYYA 1KQ9A 3QPTA 2OU2A 5CVRA 4PDKA 2ZBKA 3BOQA 5HDNA 5LGNA 4Z2YA 3T8RA 4HQMA 3HRTA 5D5VB 4NQWA 1IN4A 4LFUA 2X0LA 1TW2A 1YW7A 1UHMA 4EV0A 3EDPA 3FX3A 4HW0A 3WGHA 4BXUA 3HRMA 4LD5A 1S29A 3ZMTA 2MBFA 3S2WA 1P2FA 5FGMA 1LQ1A 3AAFA 4L5JA 3JTGA 4P96A 4RGRA 3MZHA 1R1VA 3ULQB 4U0YA 3DPTA 4P9FA 4P55A 4AD9A 1H9GA 5J8FA 2O61A 4MEYF 1ZREA 1USSA 2K02A 2Z9OA 3GFMA 1SFUA 3NRVA 2RQPA 4KIBA 4WXDA 1ZG1A 1RUNA 1JGSA 3BP8A 5LGTA 4LGWA 2D45A 5E1ZB 3F22A 3EYIA 5F6FA 3K1MA 4I01A 4PZJA 1IRFA 2E7XA 5F64A 2PBIA 3IRQA 2JRTA 3I64A 3QU6A 1W5TA 1RIOH 3FWEA 2M8EA 4G7HF 4N9IA 1TQIA 1DDNA 3IRRA 1OYWA 2QQAA 2STTA 3OV8A 2WTEA 2FBKA 2EWNA 4EJUA 2DW4A 2OAZA 4DNCA 2AS5F 3TQNA 5DEQA 3I0TA 4NB5A 2QWWA 3QP5A 2ZNZA 3CO7C 1O3SA 1ZG3A 2DT5A 2ACJA 1IF1A 2UXNA 1BI0A 1V4RA 5DD8A 1SD7A 3CLOA 1TLHB 5LRRA 4L9JA 4Q5SF 1QNTA 2QBYA 2JPBA 1JHFA 5ICEA 5DCMB 1HKQA 1UB9A 2EA4A 2FBHA 2RC4A 4MHGA 3GF2A 1F1ZA 3GFIA 4GO1A 1LEAA 1WRJA 4MGRA 4EM2A 5HDGA 5E8GA 4YFNF 4MNUA 1EV7A 4HF0A 5AIPA 3LAJA 4HV6A 1YIOA 4CGZA 1WQ2A 3GLXA 3M8FA 5HVQC 4HX8A 4HF1A 4M71A 3FHZA 2XKPA 3WE2A 5K5OA 1E17A 2G7UA 2GZWA 2HEOA 2FMLA 1SD5A 2DFIA 4KN4X 3L00A 4G94A 1OR7A 2PI0A 3ZPLA 3GX4X 3E5QA 4CICA 3V4GA 1YW9A 4FX0A 5K5RA 2EFOA 3QAHA 4ZYGA 4ESBA 4E70A 3TO9A 2NRAC 1B9MA 2VOPA 2HDCA 3J81Z 2M30A 1HW2A 5D6FA 3HSRA 1LJ9A 1T98A 3I53A 3DP7A 4A5NA 3KLOA 3F3XA 5DYMA 4G7ZF 5FFZA 3R6SA 3J80K 4HLYA 3SXYA 1BJAA 3RKXA 4WWCA 3F23A 4P9UA 3HTSB 1B9NA 3DQVC 2UWMA 3BROA 1B1BA 2MH9A 4HX4A 3GXOA 3HHGA 2HS5A 4Y17A 3I58A 3LFKA 3FMRA 3I71A 4GGGA 2K4JA 4LJZF 3F6VA 1F4KA 3ROUA 1T0FA 4MQVA 1XGOA 3KP5A 4M73A 2B0LA 4PCQA 2RGVA 1XDUA 2L01A 4LG0B 3KZYA 1FSHA 1IAWA 3N97A 3F8CA 4ZZLA 4LLNA 1ZYRF 4Q48A 4EJTA 2JZYA 1YLFA 2H94A 2P5KA 3T0YA 2XUBA 1JE8A 5JFRA 5ICCA 3WODF 3WTXC 2PMHA 3WE3A 1MDMB 2F5CA 2MD5A 4DQ2A 4ESFA 1ONVA 2A61A 2Q0OA 4UXNA 1OMIA 2FE3A 2MA3A 3KP2A 1FBQA 5FO5A 2DLLA 2M5WA 2FBIA 2D2WA 2OQGA 2PFBA 5BPIA 2P5VA 1XSXA 3V8LA 2R7FA 4HDVA 2F2EA 4UUVA 1HSTA 1FT9A 4R8HA 4A0ZA 1TNTA 2CWEA 2DQLA 3CTAA 5L3EA 4EVIA 4UVBA 2EB7A 2V1XA 1G3TA 2V6CA 5LEJA 5E17F 1KGSA 2FA5A 3LWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQQ A;  3QP6 A;  3JAM K;  1LB2 A;  1XGN A;  2R7D A;  3TGN A;  1OKR A;  3CDH A;  2FNP A;  3MAJ A;  3P9K A;  1PDN C;  1G3W A;  3V7C A;  1HKT A;  2EK5 A;  2BE5 F;  2ZME A;  3K9T A;  1G3S A;  4QWQ A;  2FOK A;  1W5S A;  2XAF A;  4CDG A;  2ZJ2 A;  4IHT A;  4A0Y A;  1J2X A;  2OQR A;  3WTU C;  2DU9 A;  1IN7 A;  2W24 A;  4M9Z A;  2WV0 A;  3I4P A;  2A6H F;  2J5O A;  3ZP5 A;  4S05 A;  3T8T A;  1YS7 A;  1LDJ A;  1U5T B;  3M9A A;  4LG0 A;  2EFQ A;  4ZH4 F;  3RKW A;  5HLI A;  1R5G A;  5CVJ A;  5EEH A;  2K86 A;  1IN8 A;  4PGG A;  4XLN F;  2VC0 A;  4O6J A;  3FMQ A;  3E3V A;  2AXL A;  2HFH A;  2QM3 A;  2KIU A;  2OZ6 A;  1TQM A;  3TO6 A;  1JHH A;  4KIC A;  5FFX A;  5D6E A;  1J7K A;  2WC2 A;  4U0W A;  2PQ8 A;  1KYW A;  3COA C;  3Q9S A;  3J81 K;  5DUI A;  3C7J A;  2W25 A;  3PFI A;  2NYX A;  4H0E A;  2W57 A;  1KA8 A;  3JTH A;  2IT0 A;  4RB0 A;  1K6O A;  2CO5 A;  2UZK A;  3HTU A;  4EJW A;  2ZCW A;  1FWZ A;  3I5U A;  4RS8 A;  1B6A A;  4AVP A;  3CO6 C;  3IWF A;  2EFN A;  4EJV A;  2ESH A;  3ERE D;  5DCF A;  2DAO A;  2DTR A;  4MTD A;  2C6Y A;  2A69 F;  1D5V A;  3BWG A;  4OMZ A;  3KFW X;  3WTT C;  4BHB A;  4U7B A;  1ZRF A;  3BPX A;  1ZN2 A;  2CGP A;  2XAQ A;  1QZZ A;  3K1P A;  3TOB A;  4OIQ F;  3KP4 A;  4KDP A;  1KQ0 A;  5FD5 A;  5J6X A;  1H0M A;  3FM5 A;  3D0S A;  5CJ9 A;  2VON A;  3CUQ A;  3FXU A;  3LA2 A;  1DPR A;  4XSX F;  1J0R A;  4L0Y B;  3EUH A;  4RB3 C;  1J75 A;  1J5Y A;  4WCG A;  3WTW C;  2QEN A;  2OA4 A;  4P5O A;  2YR2 A;  5ERI A;  2M1B A;  3FMS A;  4HF2 A;  2L54 A;  3KP7 A;  1P4W A;  3DKW A;  4MTE A;  2NNY A;  3GYH X;  4BQA A;  3BJA A;  4XRF A;  1T6S A;  4G6D A;  3K2Z A;  1BC8 C;  1SMY F;  1TBX A;  2JT1 A;  4I0A A;  2VE8 A;  1L3L A;  1S3J A;  3PQK A;  5JI6 A;  2RN7 A;  3MEX A;  1R23 A;  1K78 A;  2HQN A;  2ZO4 A;  1FP1 D;  1YG2 A;  1FYL A;  4IVN A;  4AIJ A;  1IXC A;  1RUO A;  5ILV A;  3JAM Z;  2MC3 A;  4Q47 A;  1U2W A;  3Q5F A;  1SD4 A;  1XGM A;  2HTJ A;  4G9Y A;  1ZAR A;  2ADU A;  2XHK A;  4EJO A;  4BAY A;  4LLL A;  2O03 A;  4IJA A;  4K2E A;  3O2P E;  1W7P B;  3LQQ A;  2YSR A;  2NNN A;  2Y75 A;  1G4D A;  2BEO A;  1XN7 A;  5BPD A;  1FYK A;  2K4B A;  5CVV A;  3KEO A;  2P6S A;  2ZFW A;  3GZ6 A;  3R0J A;  4F7Z A;  4KMU X;  3JW4 A;  5L3B A;  4IRG A;  3F72 A;  1GVJ A;  1T38 A;  5BOX A;  1TNS A;  4LK0 F;  2GAU A;  1WI9 A;  2EJR A;  3RJP A;  3KLN A;  4RGU A;  2PLY A;  1D8J A;  4L0Z B;  3FZV A;  3E6B A;  2Y0M A;  2Z5U A;  1HW5 A;  3DFG A;  1G6N A;  4M9S A;  3HIF A;  2XRO A;  5L3C A;  1K79 A;  4AIK A;  1O7L A;  3E6M A;  1LDD A;  2QUF A;  3P7N A;  4JK1 X;  4U0V A;  1QQI A;  5D5U B;  4HV5 A;  2VBY A;  2G7H A;  3V7R A;  1BI1 A;  4N0B A;  3T5X A;  1KQ8 A;  4GCV A;  2PMU A;  3C1D A;  2HYG D;  5KVR A;  5L3D A;  3BY6 A;  3WG9 A;  2VXZ A;  2HZT A;  4HDU A;  4MQ9 F;  4HOB A;  2LSO A;  2QYO A;  4KYW A;  3GO5 A;  1ZHF A;  4L18 B;  5DDG A;  2E1C A;  2V1U A;  1FYM A;  2GXG A;  2OBP A;  4EM1 A;  1WSU A;  3RI4 A;  1Z05 A;  4OOI A;  3KE2 A;  4RGX A;  4WK8 F;  1B4A A;  3H3U A;  3GEZ A;  4YFX F;  3EET A;  2H27 A;  1X3U A;  3VFZ A;  1P92 A;  1IW7 F;  5TJJ A;  2O6G E;  1FC3 A;  1G3Y A;  1STZ A;  1XSD A;  3C3W A;  3ZMV A;  2Y48 A;  4KA4 A;  1QZY A;  1ZGA A;  1FPQ A;  2A68 F;  4KN7 X;  3M7G A;  5ILU A;  5HS8 A;  3ZMD A;  2HKX A;  1J59 A;  3ZMU A;  4L9T A;  3C18 A;  1RNL A;  1XMA A;  5E18 F;  4M74 A;  1W7P A;  4QLC U;  2LNB A;  4UVC A;  1UCR A;  4O5V A;  3TOA A;  4HYE A;  4CYD A;  4EM0 B;  2BBY A;  4KUM A;  3I59 B;  4LB6 B;  2ZME C;  4L9V A;  1FP2 A;  2ZNY A;  1UHW A;  3E5U A;  1CF7 B;  2HYF A;  3DPL C;  2Q8K A;  2ZKZ A;  2ELH A;  1D8K A;  1P4X A;  5DCM A;  4RB1 A;  1C0W A;  1S7A A;  2GXB A;  1HXD A;  2YX4 A;  2F5D A;  5AIQ A;  4A2U A;  2RDP A;  1BM9 A;  3ZN0 A;  1MJ9 A;  1SD6 A;  2IRF G;  3E97 A;  3ELK A;  3RYP A;  2E1N A;  5EEG A;  5FB2 A;  5DV5 A;  4IHS A;  3SQN A;  4I02 A;  2ISZ A;  5ILS A;  2XAS A;  2HTS A;  4HQE A;  4A5M A;  1FX7 A;  3TDZ C;  1UST A;  4YII A;  4M6Y A;  1EH7 A;  4D0P A;  5L3G A;  2HR3 A;  3U1D A;  2EFW A;  4EMS A;  2QLZ A;  5A2Q Z;  1H9T A;  2QQB A;  2HOE A;  4G6Q A;  3U2R A;  4YG2 F;  2E7W A;  3V8J A;  3WU1 B;  4L5I A;  3W6J B;  1U78 A;  2XRN A;  3DF8 A;  1R00 A;  5JHU A;  1P6R A;  1V3F A;  3G3Z A;  2MH2 A;  2VBX A;  1F5T A;  4I09 A;  1NHA A;  2EV0 A;  1ZLJ A;  2KRF A;  5D5X B;  2HQR A;  4CZZ A;  5J8C A;  4B09 A;  5E20 A;  4ENM A;  5H6R A;  2H6C A;  4BH9 A;  1XSV A;  4ESJ A;  4GYG A;  1S6L A;  4R79 A;  2GA1 A;  2IW5 A;  1VTN C;  4Y15 A;  4L9N A;  4HLX A;  1KU3 A;  5AON A;  3RDI A;  5D4S A;  4EGY A;  4M9X A;  3M1E A;  4UV8 A;  2EFP A;  2QVO A;  2VN2 A;  3D5L A;  3ZMS A;  3EYY A;  3QU3 A;  1R5H A;  1OPC A;  3KCC A;  2QQ9 A;  2GA2 A;  3GW2 A;  1KU7 A;  3E5X A;  4U88 A;  1BI2 A;  2HKO A;  2X4H A;  5L3F A;  4XSZ F;  2FMY A;  1EH8 A;  2VBZ A;  1MJA A;  1LDK B;  5E8I A;  1J9I A;  5HS9 A;  2GIV A;  1A04 A;  4HAM A;  1QPM A;  3HOT A;  2CSO A;  3CUQ C;  1QO0 D;  1SAX A;  3IHU A;  3I54 A;  3WGG A;  3GVA A;  1Z7U A;  2JPC A;  1MDM A;  1HW1 A;  2OD5 A;  4WXC A;  2DK8 A;  1FZP B;  3NQO A;  1R22 A;  4YIF A;  1R58 A;  1GXP A;  5KK1 A;  5D8L B;  1U8R A;  1I1G A;  1ON1 A;  1Z9C A;  2V9V A;  5D5W B;  1U5T C;  2P8T A;  2DO7 A;  2LF8 A;  1MKM A;  1PP8 F;  2EA2 A;  2EV6 A;  1AWC A;  2PJP A;  1BOA A;  3HUG A;  2FSW A;  2VC1 A;  3IL2 A;  3MFK A;  3NEU A;  1ULY A;  3ML6 A;  1R1T A;  2BGC A;  2DQR A;  3K1N A;  3V7S A;  2KIM A;  1R1U A;  2MLG A;  2G9W A;  4I98 B;  1Z6R A;  2A3S A;  1TQP A;  3HRS A;  3K0L A;  3HSF A;  3VB2 A;  2PN6 A;  3L2C A;  1O7F A;  4IXA A;  3R4K A;  4G8X A;  1IXS B;  1Z1D A;  5TRD A;  1LEB A;  1Z6T A;  3HRU A;  4LMY A;  2VE9 A;  1Y0U A;  2K7L A;  1HKS A;  1HBX G;  4OIP F;  2VT2 A;  4M6X A;  1LNW A;  3KP6 A;  2XGX A;  2KKO A;  2GWR A;  1XB4 A;  1K7A A;  2H6B A;  1T39 A;  5FLX Z;  4AIH A;  3L9F A;  2KJB A;  3JSO A;  1E2X A;  3JSP A;  1FSE A;  1XDS A;  1HQC A;  3WTV C;  4A12 A;  4UNO A;  1ZRC A;  2VBW A;  3KP3 A;  2EV5 A;  2P4W A;  1O57 A;  3FM3 A;  4LB5 A;  1TW3 A;  5DD4 A;  1Q1H A;  3F8N A;  3SZP A;  1U5T A;  1B59 A;  4ASN A;  6PAX A;  3LST A;  1I1S A;  2PEX A;  4IRI A;  4OU0 A;  4ZYE A;  1HSJ A;  3G73 A;  2CFX A;  3R0A A;  2V1D A;  5D4R A;  4RB2 C;  1FNN A;  3WTS C;  1XCB A;  3LQR A;  2YU3 A;  1SMT A;  2H09 A;  2TDX A;  1ODD A;  4IF4 A;  3PQJ A;  1YS6 A;  3VOE A;  5A2Q K;  3IWZ A;  3O3K A;  2DPD A;  1RZ4 A;  4IPA A;  4LLG F;  1BI3 A;  2CQK A;  5HOO A;  4JQF A;  3QRF F;  3IKV A;  1BIB A;  5HS7 A;  2BV6 A;  2LF7 A;  3B73 A;  2COM A;  4A0X A;  1P4A A;  3HYI A;  3SHF A;  4KMF A;  3V8K A;  2WWY A;  2RV8 A;  3IKT A;  2W84 A;  1L0O C;  4I7H A;  1I27 A;  4CHU A;  1YQA A;  3HSE A;  3L09 A;  4KIF A;  5ICF A;  3BDD A;  4M72 A;  3SFZ A;  1KU2 A;  4RAZ A;  1EH6 A;  4XLP F;  4UVA A;  1FLI A;  1FY7 A;  4HZF A;  3BZ6 A;  4I0B A;  3E6C C;  3TO7 A;  1BBY A;  1D3Y A;  1IN6 A;  3DXJ F;  2VOO A;  3R61 A;  3ABT A;  3LAP A;  2RNJ A;  3WTY C;  1GHC A;  3F8M A;  3K69 A;  5LGU A;  3RYR A;  2R3S A;  4TV7 A;  2LDU A;  2ETH A;  2L4M A;  1QBJ A;  3BJO A;  2XKO A;  4ETS A;  2A07 F;  2F5F A;  1LVA A;  2KJC A;  2D1V A;  1O3T A;  1BC7 C;  1SFE A;  2JSC A;  5LHI A;  2NS0 A;  1IN5 A;  2XAJ A;  4EQQ A;  5IT9 Z;  4KIG A;  5CVU A;  4WX9 A;  4KNY A;  2Z33 A;  5BMZ A;  1XGS A;  1XCV A;  1O3Q A;  1OYI A;  5K5Q A;  2P7C B;  4ENN A;  3GWZ A;  3P9C A;  5D8K B;  5BS6 A;  4R1H A;  5E1X A;  3ISP A;  5LHH A;  3TDU C;  3DEU A;  1O3R A;  3H92 A;  2HGC A;  1I6X A;  1BN5 A;  3SZT A;  4BYY A;  3ZQ7 A;  2HWV A;  1REP C;  1I5Z A;  3GUD A;  4XBF A;  1XMK A;  5FD6 A;  1Z91 A;  3GZ5 A;  1KU9 A;  1R7J A;  2IVM A;  2FU4 A;  3KEQ A;  2IP2 A;  2CW0 F;  1F9N A;  3B02 A;  4CXF A;  2DI3 A;  4CO8 A;  2IA0 A;  4EGZ A;  2J5P A;  1ZLK A;  1S8N A;  1QGP A;  1MGT A;  2ZME B;  3BPV A;  1W4M A;  4OIR F;  3P9I A;  1MD0 A;  1OYY A;  4FT8 A;  1DP7 P;  2A6E F;  2CG4 A;  4AWX B;  1ZRD A;  1DPU A;  2NAZ A;  5CVI A;  1UFM A;  4HBL A;  3BJ6 A;  2Z3Y A;  4U7D A;  4S04 A;  1YYV A;  5K1Y A;  3F8F A;  5BQT A;  4GYI A;  3HOS A;  3CJN A;  2MLK A;  3EQL F;  3O6B B;  2QZ8 A;  4LK1 F;  4RGS A;  3DV8 A;  2M87 A;  1TTY A;  2DBB A;  1YTY A;  1MJB A;  3Q9V A;  4GXO A;  5ED4 A;  5FLX K;  2D1H A;  3F21 A;  2YX7 A;  2XVC A;  2L02 A;  3FXQ A;  3IC7 A;  2FRH A;  4ENK A;  4KT5 C;  3RPQ A;  5JVT A;  3ZN1 A;  2L3D A;  1YFH A;  3TKY A;  1YW8 A;  5CLS A;  3J7A O;  2VT3 A;  4HX7 A;  5E1W A;  4ZYH A;  5H20 A;  3U9G A;  3QPH A;  3GFL A;  3LA3 A;  3LA7 A;  2YPR A;  5IT3 A;  2FF4 A;  1R36 A;  3H3Z A;  5LRS A;  2RKH A;  2A5Y B;  4OIO F;  2ISY A;  3FF5 A;  3VOD A;  5F1R A;  4HA8 A;  1XD7 A;  2L4A A;  3ABU A;  5HLH A;  1ZGJ A;  1JXS A;  3MWM A;  3T1B A;  3WGI A;  4JBA A;  3KET A;  4WXH A;  1MZB A;  2F5E A;  4PGH A;  2IA2 A;  4OMY A;  2O8X A;  3R60 A;  2XIG A;  4B8X A;  4NHJ A;  2ESN A;  4KFC A;  2STW A;  3RIR A;  1U6G A;  4ENJ A;  5DUK A;  1PUE E;  2FEZ A;  2DK5 A;  1WWX A;  2FXA A;  1FBS A;  4BNC A;  4O3M A;  1ON2 A;  4BHP A;  4ZYD A;  4UHT A;  2XAH A;  1SFX A;  2LKP A;  5HDK A;  2OZU A;  1IXR C;  3CUQ B;  1AOY A;  3HHH A;  4BHC A;  5LBQ A;  2P7V B;  1ZG5 A;  3L7W A;  2XV4 S;  3RPU A;  3W6K B;  1W7P D;  2IA1 A;  2W85 A;  3GFJ A;  4A6D A;  4FX4 A;  4N9H A;  2Z99 A;  4G7O F;  1FBU A;  3KZZ A;  2M45 A;  3N4M A;  3I59 A;  3M8E A;  2IPQ X;  1RI7 A;  3MCZ A;  1U3E M;  3RKY A;  4I2O A;  5LLQ A;  1FOK A;  1T2K A;  4MEX F;  3WTZ A;  1CF7 A;  1WKM A;  5HLG A;  1IRG A;  2O3F A;  2RVC A;  5IT9 K;  3RTR A;  5JR3 A;  3QOP A;  2XAG A;  1YO5 C;  4ZZD A;  3F6O A;  3OOP A;  4FHT A;  4IRH A;  2KIF A;  3WU0 A;  2FQ3 A;  1K78 B;  1ZH5 A;  4Q4Z F;  2ZXJ A;  1CGP A;  4UV9 A;  2PG4 A;  2P6T A;  3CUO A;  3ECO A;  1DUX C;  3ECH A;  4RAY A;  4Y13 A;  3REO A;  3FXR A;  1IUY A;  3MQ0 A;  5H6Q A;  5LEK A;  3ZMZ A;  4ON0 A;  1PP7 U;  4WF2 A;  2K27 A;  1IZ1 A;  3MZY A;  2VOD A;  1S7O A;  3E6D A;  2DPU A;  4OIN F;  4YFK F;  3J80 Z;  2IJL A;  5ICG A;  2BYV E;  1GXQ A;  3F8B A;  5CYV A;  2FNA A;  4A6E A;  2V79 A;  2O0Y A;  2P5L C;  1BIA A;  5LHG A;  2Q2E A;  3VEP A;  1KYZ A;  1ZAO A;  2JTV A;  2QBY B;  2UXX A;  2CYY A;  1KQ9 A;  3QPT A;  2OU2 A;  5CVR A;  4PDK A;  2ZBK A;  3BOQ A;  5HDN A;  5LGN A;  4Z2Y A;  3T8R A;  4HQM A;  3HRT A;  5D5V B;  4NQW A;  1IN4 A;  4LFU A;  2X0L A;  1TW2 A;  1YW7 A;  1UHM A;  4EV0 A;  3EDP A;  3FX3 A;  4HW0 A;  3WGH A;  4BXU A;  3HRM A;  4LD5 A;  1S29 A;  3ZMT A;  2MBF A;  3S2W A;  1P2F A;  5FGM A;  1LQ1 A;  3AAF A;  4L5J A;  3JTG A;  4P96 A;  4RGR A;  3MZH A;  1R1V A;  3ULQ B;  4U0Y A;  3DPT A;  4P9F A;  4P55 A;  4AD9 A;  1H9G A;  5J8F A;  2O61 A;  4MEY F;  1ZRE A;  1USS A;  2K02 A;  2Z9O A;  3GFM A;  1SFU A;  3NRV A;  2RQP A;  4KIB A;  4WXD A;  1ZG1 A;  1RUN A;  1JGS A;  3BP8 A;  5LGT A;  4LGW A;  2D45 A;  5E1Z B;  3F22 A;  3EYI A;  5F6F A;  3K1M A;  4I01 A;  4PZJ A;  1IRF A;  2E7X A;  5F64 A;  2PBI A;  3IRQ A;  2JRT A;  3I64 A;  3QU6 A;  1W5T A;  1RIO H;  3FWE A;  2M8E A;  4G7H F;  4N9I A;  1TQI A;  1DDN A;  3IRR A;  1OYW A;  2QQA A;  2STT A;  3OV8 A;  2WTE A;  2FBK A;  2EWN A;  4EJU A;  2DW4 A;  2OAZ A;  4DNC A;  2AS5 F;  3TQN A;  5DEQ A;  3I0T A;  4NB5 A;  2QWW A;  3QP5 A;  2ZNZ A;  3CO7 C;  1O3S A;  1ZG3 A;  2DT5 A;  2ACJ A;  1IF1 A;  2UXN A;  1BI0 A;  1V4R A;  5DD8 A;  1SD7 A;  3CLO A;  1TLH B;  5LRR A;  4L9J A;  4Q5S F;  1QNT A;  2QBY A;  2JPB A;  1JHF A;  5ICE A;  5DCM B;  1HKQ A;  1UB9 A;  2EA4 A;  2FBH A;  2RC4 A;  4MHG A;  3GF2 A;  1F1Z A;  3GFI A;  4GO1 A;  1LEA A;  1WRJ A;  4MGR A;  4EM2 A;  5HDG A;  5E8G A;  4YFN F;  4MNU A;  1EV7 A;  4HF0 A;  5AIP A;  3LAJ A;  4HV6 A;  1YIO A;  4CGZ A;  1WQ2 A;  3GLX A;  3M8F A;  5HVQ C;  4HX8 A;  4HF1 A;  4M71 A;  3FHZ A;  2XKP A;  3WE2 A;  5K5O A;  1E17 A;  2G7U A;  2GZW A;  2HEO A;  2FML A;  1SD5 A;  2DFI A;  4KN4 X;  3L00 A;  4G94 A;  1OR7 A;  2PI0 A;  3ZPL A;  3GX4 X;  3E5Q A;  4CIC A;  3V4G A;  1YW9 A;  4FX0 A;  5K5R A;  2EFO A;  3QAH A;  4ZYG A;  4ESB A;  4E70 A;  3TO9 A;  2NRA C;  1B9M A;  2VOP A;  2HDC A;  3J81 Z;  2M30 A;  1HW2 A;  5D6F A;  3HSR A;  1LJ9 A;  1T98 A;  3I53 A;  3DP7 A;  4A5N A;  3KLO A;  3F3X A;  5DYM A;  4G7Z F;  5FFZ A;  3R6S A;  3J80 K;  4HLY A;  3SXY A;  1BJA A;  3RKX A;  4WWC A;  3F23 A;  4P9U A;  3HTS B;  1B9N A;  3DQV C;  2UWM A;  3BRO A;  1B1B A;  2MH9 A;  4HX4 A;  3GXO A;  3HHG A;  2HS5 A;  4Y17 A;  3I58 A;  3LFK A;  3FMR A;  3I71 A;  4GGG A;  2K4J A;  4LJZ F;  3F6V A;  1F4K A;  3ROU A;  1T0F A;  4MQV A;  1XGO A;  3KP5 A;  4M73 A;  2B0L A;  4PCQ A;  2RGV A;  1XDU A;  2L01 A;  4LG0 B;  3KZY A;  1FSH A;  1IAW A;  3N97 A;  3F8C A;  4ZZL A;  4LLN A;  1ZYR F;  4Q48 A;  4EJT A;  2JZY A;  1YLF A;  2H94 A;  2P5K A;  3T0Y A;  2XUB A;  1JE8 A;  5JFR A;  5ICC A;  3WOD F;  3WTX C;  2PMH A;  3WE3 A;  1MDM B;  2F5C A;  2MD5 A;  4DQ2 A;  4ESF A;  1ONV A;  2A61 A;  2Q0O A;  4UXN A;  1OMI A;  2FE3 A;  2MA3 A;  3KP2 A;  1FBQ A;  5FO5 A;  2DLL A;  2M5W A;  2FBI A;  2D2W A;  2OQG A;  2PFB A;  5BPI A;  2P5V A;  1XSX A;  3V8L A;  2R7F A;  4HDV A;  2F2E A;  4UUV A;  1HST A;  1FT9 A;  4R8H A;  4A0Z A;  1TNT A;  2CWE A;  2DQL A;  3CTA A;  5L3E A;  4EVI A;  4UVB A;  2EB7 A;  2V1X A;  1G3T A;  2V6C A;  5LEJ A;  5E17 F;  1KGS A;  2FA5 A;  3LWF A; 
#chains in the Genus database with same CATH topology
 1GVD A;  2GQQ A;  1MIJ A;  4XL9 A;  4FET A;  2IAI A;  3QP6 A;  3JAM K;  3MVP A;  2ELK A;  1YRN B;  1LB2 A;  2DMP A;  1XGN A;  1ETO A;  2R7D A;  3FIS A;  2IGN A;  3FHN A;  1WJA A;  3TGN A;  1P7I A;  1OCZ H;  3JRC A;  1OKR A;  3S3M A;  3ZXS A;  1X1B A;  3CDH A;  2FNP A;  3MAJ A;  2PMZ N;  3P9K A;  1PDN C;  1VQ9 I;  1G3W A;  2ZXW H;  3V7C A;  1HKT A;  1MMN A;  2DJN A;  2EK5 A;  5J1R A;  2BE5 F;  4ZDL A;  2ELJ A;  1JKQ C;  2ZME A;  1AKH B;  2RRE A;  1MBF A;  3K9T A;  1G3S A;  4QWQ A;  2FOK A;  1W5S A;  1TWC J;  2XAF A;  1X4P A;  4CDG A;  2ZSI B;  2ZJ2 A;  4IHT A;  4A0Y A;  1RKT A;  1J2X A;  2OQR A;  3WTU C;  2Y31 A;  1HF0 A;  3OYJ A;  2DDB A;  3V42 A;  2DU9 A;  1K83 J;  4UY8 I;  1IN7 A;  3JRH A;  2KFD A;  5H2F C;  3CF5 F;  2M4K A;  1A36 A;  2W24 A;  4M9Z A;  2WV0 A;  3I4P A;  2A6H F;  2J5O A;  3ZP5 A;  2V6E A;  4S05 A;  3T8T A;  1YS7 A;  2AQE A;  1LDJ A;  1U5T B;  1W36 C;  3M9A A;  3FBN B;  4A3E J;  4LG0 A;  2V9K A;  2DFH A;  2EFQ A;  2JSP A;  4ZH4 F;  3RKW A;  5HLI A;  1R5G A;  2ZSH B;  5CQE A;  5CVJ A;  1VQN I;  5EEH A;  2K86 A;  2IBD A;  4HNU A;  1IN8 A;  1FOX A;  1JUS A;  4PGG A;  3W6V A;  4XLN F;  2OC6 A;  4JX5 A;  4IHY A;  2VC0 A;  4O6J A;  1Z67 A;  3FMQ A;  4A3I J;  3E3V A;  2AXL A;  3ZQG A;  2HFH A;  3ZQC A;  2DMT A;  2P81 A;  2QM3 A;  2CJJ A;  2Y30 A;  1PUF A;  2KIU A;  3CLQ A;  3HOV J;  2OZ6 A;  4XN0 A;  1TQM A;  3RZD J;  3IUO A;  1P9Q C;  3TO6 A;  1JHH A;  4KIC A;  5BNG A;  5FFX A;  4FAS D;  5D6E A;  1WVR A;  1J7K A;  2WC2 A;  1XMX A;  1JI8 A;  3D1N I;  4U0W A;  2KRC A;  3BR2 A;  2Q1Z B;  4XKC A;  2PQ8 A;  1FEX A;  5K7Z A;  1KYW A;  3COA C;  3NAR A;  2A6T A;  3Q9S A;  3J81 K;  5DUI A;  3C7J A;  2VI6 A;  4BQQ A;  2W25 A;  3PFI A;  2NYX A;  3A03 A;  1W0U A;  4FTH A;  5FLV A;  2E36 A;  2AQF A;  4H0E A;  2W57 A;  1KA8 A;  2GBY A;  3LSM A;  2H8R A;  3JTH A;  3FXO A;  2IT0 A;  3KYD B;  4RB0 A;  2K9Q A;  3CCS I;  1K6O A;  2CO5 A;  4E7H A;  2UZK A;  2QA4 I;  3HTU A;  4EJW A;  2ZCW A;  1FWZ A;  3I5U A;  4RS8 A;  1B6A A;  1K6Y A;  4AVP A;  2VKE A;  3CO6 C;  3DWL E;  3K6G A;  2OTJ I;  3EUK L;  3IWF A;  2EFN A;  1JKO C;  4A3J J;  3SZG A;  4EJV A;  2V1N A;  2ESH A;  1ZK8 A;  3OR1 C;  3ERE D;  1BR1 A;  4E7I A;  2R7T A;  1Z7L A;  5DCF A;  2DAO A;  5DM7 F;  3FIW A;  2DTR A;  4MTD A;  2C6Y A;  4IO9 F;  2JA5 J;  4RAG A;  2E19 A;  4LIT A;  2A69 F;  3G6E I;  1D5V A;  3BWG A;  4OMZ A;  3KFW X;  1IV6 A;  2P0W A;  2O8K A;  1UZC A;  2X6X A;  1OLT A;  2Z2S B;  3SJM A;  3WTT C;  4BHB A;  5E3L A;  4U7B A;  1ZRF A;  1OIS A;  3BPX A;  1ZN2 A;  4HST A;  2CGP A;  2XAQ A;  1QZZ A;  3K1P A;  4A3G J;  3TOB A;  4OIQ F;  2M7A A;  3KP4 A;  2ZXI A;  2MYS A;  2COB A;  4KDP A;  4G12 A;  1KQ0 A;  2E2H J;  1SAU A;  2LD5 A;  4M3D A;  5FD5 A;  5J6X A;  1AKH A;  4JX6 A;  2KMU A;  3CQZ J;  1H0M A;  3FM5 A;  3D0S A;  5CJ9 A;  1YI2 I;  2XPW A;  4IOC F;  2VON A;  3CUQ A;  3FXU A;  3LA2 A;  1D5Y A;  1DPR A;  3H5R A;  1J0R A;  4XSX F;  2FOW A;  4L0Y B;  2BOL A;  2LH9 A;  2GLO A;  3EUH A;  3TED A;  4RB3 C;  2HVS A;  3LSI A;  1J75 A;  1J5Y A;  4WCG A;  3J7A Y;  4BEH A;  3WTW C;  2QEN A;  3BG6 A;  1R6R A;  2OA4 A;  4P5O A;  2W00 A;  2YR2 A;  4BGD A;  2ZC2 A;  2CRG A;  5TGT A;  3PIP F;  3DTE A;  5ERI A;  2NOG A;  2M1B A;  2CV1 A;  3FMS A;  1Y1W J;  4HF2 A;  2L54 A;  3KP7 A;  2VJ4 A;  1P4W A;  2XF7 A;  3DKW A;  1MBG A;  3HC7 A;  4D5C A;  1MMA A;  3E0J B;  4MTE A;  2DMQ A;  2NNY A;  3PO3 J;  3GYH X;  1V55 H;  4BQA A;  3BJA A;  4XRF A;  1T6S A;  2K3F A;  4G6D A;  4A3B J;  1B72 B;  4PUS A;  3K2Z A;  1BC8 C;  1SMY F;  1TBX A;  2JT1 A;  4I0A A;  5M5X J;  2M2E A;  2R7R A;  3S1M J;  1VQ6 I;  4UB8 C;  2HDD A;  2VE8 A;  1L3L A;  3WHC A;  3AKZ A;  1S3J A;  3CZ6 A;  2DDA A;  2VJI A;  3ASN H;  3G2B A;  3PQK A;  4PJ0 C;  5JI6 A;  2RN7 A;  3MEX A;  2YS9 A;  1R23 A;  1K78 A;  2HQN A;  2ZO4 A;  1FP1 D;  1YG2 A;  1FYL A;  4Z6Y A;  1A6I A;  4IVN A;  4NNJ A;  4AIJ A;  2L9S A;  1I6H J;  1IXC A;  1RUO A;  3FK6 A;  5ILV A;  2XPU A;  3JAM Z;  2MC3 A;  4Q47 A;  5GPA A;  4BE0 A;  5EGO A;  1U2W A;  3Q5F A;  1SD4 A;  1R4N B;  1XGM A;  2LMD A;  3ZQH A;  2DFF A;  1H8A C;  2PJR A;  2CQN A;  2HTJ A;  4G9Y A;  1VQM I;  1ZAR A;  2ADU A;  2XHK A;  4EJO A;  3CMY A;  4XID A;  2FX0 A;  2R93 J;  2MGQ A;  4LLL A;  4BAY A;  4X6A J;  4Y3O A;  2JRM A;  2O03 A;  4IJA A;  3BTL A;  3WG7 H;  4K2E A;  3O2P E;  1W7P B;  3LQQ A;  2XB0 X;  2BXY A;  1V54 H;  2VPR A;  2YSR A;  3CP8 A;  2K3P A;  3MN2 A;  2NNN A;  4B43 A;  3K4L A;  2Y75 A;  1IV8 A;  3AL0 C;  4D9J A;  3C2H A;  1VQ4 I;  1G4D A;  2VKH A;  3M3Y J;  3OS2 A;  2BEO A;  1XN7 A;  5BPD A;  1FYK A;  3RQ4 A;  2K4B A;  2WAQ A;  3LSJ A;  3LSG A;  4M3G A;  5CVV A;  4U87 A;  3KEO A;  4EAT A;  2P6S A;  2ZFW A;  2CUZ A;  4W97 A;  3GZ6 A;  3R0J A;  4F7Z A;  5EG0 B;  4KMU X;  3BR3 A;  3JW4 A;  5E79 C;  5L3B A;  5E3M A;  2R5Y B;  2OTL I;  4IRG A;  4M3F A;  3F72 A;  1ZKG A;  1GVJ A;  1T38 A;  5BOX A;  1TNS A;  2KIQ A;  4LK0 F;  2GAU A;  1WI9 A;  3OY9 A;  5FKO A;  3A0B C;  2EJR A;  3RJP A;  2FD5 A;  1EJ9 A;  2HDW A;  3KLN A;  4BS9 A;  5JHF A;  5M5W J;  4RGU A;  1WH5 A;  2VQH A;  1YIT I;  2PLY A;  1D8J A;  4NDL A;  3FZV A;  4KJZ A;  4L0Z B;  1T0F C;  2BY1 A;  2Y0M A;  3E6B A;  2VLA A;  2Z5U A;  1HW5 A;  5F0F A;  3DFG A;  1G6N A;  3BZC A;  4M9S A;  3HIF A;  2XRO A;  3OYF A;  1R71 A;  5L3C A;  1K79 A;  1LE8 A;  1W36 D;  3FXJ A;  1VQO I;  2BW3 A;  2EIK H;  4AIK A;  2IEK A;  1O7L A;  2WA0 A;  4C2U A;  1J09 A;  1LDD A;  3E6M A;  2R92 J;  1W0T A;  2QUF A;  3P7N A;  1U9N A;  2X48 A;  4BAC A;  4UUT A;  3GTP J;  4JK1 X;  4U0V A;  4B3X A;  2CU7 A;  1QQI A;  4CA0 A;  4XKW A;  1JKR C;  4XLA A;  1EF4 A;  1KZH A;  5D5U B;  4HV5 A;  2VBY A;  2G7H A;  3V7R A;  1BI1 A;  4N0B A;  3T5X A;  1GV2 A;  1KQ8 A;  4GCV A;  2PMU A;  3C1D A;  2HYG D;  3GTM J;  2EQR A;  1MND A;  5KVR A;  2EZK A;  3BC8 A;  2WY7 Q;  4ITV A;  1DU0 A;  5K7H A;  3S32 A;  3DEW A;  5L3D A;  3BY6 A;  3JRG A;  3WG9 A;  3AFH A;  5IYB J;  1XS9 A;  2VXZ A;  2VKD A;  2HZT A;  4HDU A;  3BQY A;  4MQ9 F;  1LVK A;  4CUG A;  1TZL A;  1X58 A;  4HOB A;  2KDZ A;  2QSF X;  2LSO A;  2QYO A;  4KYW A;  3GO5 A;  1T8I A;  1RR8 C;  2ID6 A;  1ZHF A;  3H9G A;  3CF2 A;  2LRE A;  4L18 B;  5DDG A;  2E1C A;  2HNH A;  3Q0V A;  2DMU A;  2V1U A;  1Y56 A;  4XRS A;  1FYM A;  2GXG A;  2OBP A;  2HPI A;  4EM1 A;  1WSU A;  3AG1 H;  4BE1 A;  3RI4 A;  5B1B H;  1Z05 A;  4OOI A;  3KE2 A;  4RGX A;  3PNY A;  4WK8 F;  4J19 A;  2LY9 A;  1B4A A;  1F43 A;  2VB6 A;  2BHZ A;  3H3U A;  3EUA A;  4BJT A;  3GEZ A;  4YFX F;  3EET A;  2H27 A;  1X3U A;  3VFZ A;  1P92 A;  1IW7 F;  5TJJ A;  4UB6 C;  2A5W A;  4CCN A;  2O6G E;  3HM5 A;  1FC3 A;  1G3Y A;  4BJ6 C;  4BUP A;  1STZ A;  3FDY A;  1XSD A;  3C3W A;  3ZMV A;  2Y48 A;  4KA4 A;  1QZY A;  4D7N A;  1ZGA A;  1FPQ A;  2A68 F;  1IDZ A;  4KN7 X;  3S93 A;  1Z0X A;  1WJC A;  4QPQ A;  4F3Q A;  4A3F J;  4HSR A;  3M7G A;  4II2 A;  5ILU A;  5HS8 A;  1S7E A;  3L2Q A;  3ZMD A;  2HKX A;  2LVS A;  1J59 A;  3HKZ A;  3BG5 A;  4L9T A;  4C30 A;  3ZMU A;  3P5J A;  2MD0 A;  1AU7 A;  2E1M B;  2Z1D A;  4HG2 A;  1PYV A;  2F4I A;  3C18 A;  4N4O B;  4KT6 A;  4AYB A;  4D7M A;  1RNL A;  1XMA A;  5E18 F;  4M74 A;  4CZC A;  2W4S A;  2R5Z B;  1T33 A;  3RQI A;  3LNQ A;  1W7P A;  4XRS G;  1YX5 A;  3J7Y J;  4QLC U;  3TP3 A;  2LNB A;  4RAF A;  4UVC A;  1UCR A;  4DZJ A;  3MKW B;  4O5V A;  3TOA A;  4J00 A;  4HYE A;  1JUM A;  1MH3 A;  1WCM J;  2BBY A;  5EJC A;  4CYD A;  4EM0 B;  2KPM A;  4KUM A;  3I59 B;  2HVR A;  1Y8Q B;  1G8X A;  3JRD A;  2ZME C;  4LB6 B;  2XGD A;  4XNF A;  4L9V A;  2KT0 A;  1FP2 A;  1EKE A;  2ZNY A;  1UHW A;  3E5U A;  3S1R J;  1WGX A;  3ZQQ A;  2KQR A;  2XRL A;  1CF7 B;  2HYF A;  1R9T J;  3DPL C;  2Q8K A;  2ZKZ A;  2ELH A;  4RLQ A;  5CKT A;  1D8K A;  4XM3 A;  1P4X A;  5DCM A;  4RB1 A;  2E2J J;  1C0W A;  1UMQ A;  4AVZ A;  1RC9 A;  1S7A A;  2GXB A;  1HXD A;  2YX4 A;  2F5D A;  4X0G A;  5FRN A;  2JA2 A;  5AIQ A;  4A2U A;  3G1M A;  2RDP A;  3HGY A;  4M6V A;  1QA6 A;  2CQX A;  1BM9 A;  3ZN0 A;  1MJ9 A;  3MD2 A;  4ZDP A;  2BY3 A;  2L7K A;  1SD6 A;  3Q3S A;  4BBS J;  2IRF G;  1K4T A;  3E97 A;  3ELK A;  3RYP A;  2E1N A;  1YJW I;  5EEG A;  1RKW A;  5FB2 A;  3KPH A;  5DV5 A;  1SFK A;  3CP2 A;  4IHS A;  2FJ1 A;  3SQN A;  4I02 A;  1JTX A;  2ISZ A;  4DYC A;  5ILS A;  4X1E A;  2XAS A;  3H0G J;  2HTS A;  4XN3 A;  2UV1 A;  4P1W A;  4HQE A;  3HXL A;  2KIS A;  3JR9 A;  4A5M A;  1FX7 A;  4XOP A;  3ZR8 X;  3TDZ C;  2L0K A;  2QGU A;  1QRY A;  1UST A;  4YII A;  1KON A;  2B7E A;  3BLY A;  4ZTJ A;  4M6Y A;  1EH7 A;  2ZXH A;  4D0P A;  4LIU A;  5L3G A;  2HR3 A;  2M9H A;  3U1D A;  4XMY A;  2EFW A;  2QKL B;  4EMS A;  2QLZ A;  5A2Q Z;  3BR0 A;  3JRF A;  1H9T A;  2QQB A;  3VYU B;  4PSX A;  2OCC H;  1MSE C;  2HOE A;  4G6Q A;  1BR4 A;  1WJ5 A;  3U2R A;  2V7F A;  3LSH A;  1S72 I;  4IHX A;  4B1R A;  4XOT A;  3M4O J;  2LLK A;  4YG2 F;  2E7W A;  4BXX J;  3V8J A;  2MW8 A;  2Q2E B;  5GAE J;  3WU1 B;  1B8I B;  4L5I A;  3W6J B;  1U78 A;  2K9L A;  2XRN A;  3DF8 A;  3QPS A;  2TCT A;  2DOA A;  2CV2 A;  4XON A;  4JYK A;  1R00 A;  1WHU A;  5JHU A;  1P6R A;  1V3F A;  2GOX B;  2NS8 A;  4XR6 A;  3G3Z A;  1ITY A;  2MH2 A;  2VBX A;  1F5T A;  4I09 A;  1NHA A;  1YIJ I;  2EV0 A;  4ANJ A;  1ZLJ A;  4CYC B;  1XPX A;  2KRF A;  3IH2 A;  1BW6 A;  5D5X B;  1VZ0 A;  2HQR A;  4GFB A;  1A5J A;  4CZZ A;  1X1D A;  5J8C A;  2XSJ C;  4B09 A;  5E20 A;  2NVT J;  3K4C A;  4ENM A;  5H6R A;  4UUS B;  1T95 A;  2H6C A;  3L1P A;  4BH9 A;  4CCL A;  4V19 K;  1IUF A;  1XSV A;  4ESJ A;  2JVG A;  4GYG A;  1S6L A;  4R79 A;  2GA1 A;  2IW5 A;  3ZOB A;  1VTN C;  4Y15 A;  4IQ4 A;  2OF7 A;  3E7L A;  3K70 C;  4L9N A;  2CUE A;  4HLX A;  1KU3 A;  5AON A;  3QYE A;  3QWL A;  3RDI A;  2QF7 A;  3U21 A;  5D4S A;  3L2R A;  4M9X A;  5FKM A;  4EGY A;  3A0H C;  3ZGK A;  2CUJ A;  5J1U A;  2BHY A;  3UR3 C;  3M1E A;  2KZG A;  1G59 A;  4UV8 A;  3KZI C;  2EFP A;  1GV5 A;  3OWT A;  2QVO A;  2VN2 A;  3D5L A;  3ZMS A;  1RPW A;  3EYY A;  1NK3 P;  5GTI C;  3QU3 A;  1R5H A;  1OPC A;  3KCC A;  2HYJ A;  4L5E A;  2QQ9 A;  2F4O B;  1BR2 A;  2GA2 A;  3GW2 A;  1KU7 A;  4GRI A;  3E5X A;  3K4M A;  1SVL A;  4U88 A;  1BI2 A;  1X1C A;  2HKO A;  3JRA A;  2X4H A;  5L3F A;  4XSZ F;  3HG9 A;  2FMY A;  1EH8 A;  5FKN A;  2VBZ A;  1MJA A;  1MBH A;  1LDK B;  5E8I A;  4V2F A;  4IOA F;  4DYQ A;  4IKF A;  1J9I A;  5HS9 A;  2GIV A;  3AG4 H;  3PO2 J;  1MMG A;  3DU6 A;  2VIX A;  1A04 A;  4HAM A;  3GTJ J;  1QPM A;  5EZG A;  1Q1V A;  1DU6 A;  4XRM A;  1TWG J;  3HOT A;  2CSO A;  3CUQ C;  1QO0 D;  2N8G A;  1SAX A;  3A01 B;  3C2B A;  3IHU A;  3I54 A;  2LOO A;  2JQ7 A;  2L2O A;  3EUH C;  4S0H B;  3WGG A;  3GVA A;  1Z7U A;  2JPC A;  3H3V K;  1MDM A;  1A31 A;  1VND A;  4IX7 A;  1TC3 C;  1HW1 A;  2OD5 A;  4WXC A;  2DK8 A;  3LSK A;  1QVU A;  1FZP B;  3DEE A;  3NQO A;  3MKZ A;  1R22 A;  3HJE A;  2PX9 A;  1BA5 A;  4QSH A;  4CSW A;  4YIF A;  2X9D A;  5IOY A;  1R58 A;  2L5Q A;  3LMM A;  5J4V A;  5KK1 A;  1UHS A;  3OYG A;  1GXP A;  5D8L B;  1U8R A;  2I10 A;  1I1G A;  1ON1 A;  4YEL A;  3DCF A;  4A93 J;  1Z9C A;  2V9V A;  1BW5 A;  2LTP A;  5D5W B;  2DA3 A;  3F0C A;  1U5T C;  2P8T A;  2DO7 A;  1HC8 A;  1A6Q A;  3TP0 A;  2QCO A;  2LF8 A;  1MKM A;  2VPL A;  1PP8 F;  2R4G A;  1Z3X A;  1T08 B;  3PUB A;  2EA2 A;  2EV6 A;  1AWC A;  2PJP A;  1MNM C;  1BOA A;  3H0D A;  2PMZ A;  3HUG A;  2FSW A;  2VC1 A;  3IL2 A;  2I8D A;  2QEX I;  3MFK A;  3L2U A;  3BCA A;  4PJM A;  5FLM J;  3NEU A;  1ULY A;  3ML6 A;  1R1T A;  4AC0 A;  1UG0 A;  2BGC A;  2DQR A;  2DA5 A;  3JRI A;  1OCR H;  3K1N A;  1HDP A;  2DOF A;  5JLX A;  3V7S A;  5B1A H;  1X19 A;  1FIA A;  3I4M J;  2KIM A;  3CC2 I;  1R1U A;  2MLG A;  3ABL H;  2G9W A;  4I98 B;  3BTI A;  1DQU A;  5CPR B;  1UG2 A;  1Z6R A;  1YE9 A;  2XDV A;  2VQC A;  2A3S A;  1TQP A;  3HRS A;  3K0L A;  3HSF A;  3VB2 A;  5B66 C;  4HNT A;  1YRN A;  2VJJ A;  2LFB A;  2W48 A;  4PFP A;  1LUJ B;  2PN6 A;  3L2C A;  1O7F A;  1X3W B;  4IXA A;  3R4K A;  3H9Q A;  4G8X A;  4MIM A;  4E7J A;  3CCV I;  2ICW G;  1IXS B;  1Z1D A;  2NVU B;  4CCK A;  5TRD A;  1LEB A;  3HZJ A;  2DCE A;  3SEZ A;  4KIS A;  1Z6T A;  2AHQ A;  2E2I J;  3VYR B;  3HRU A;  4LMY A;  4CYC A;  1R5I D;  1WH7 A;  2VE9 A;  3UKG A;  1Y0U A;  1H89 C;  2K7L A;  1HKS A;  1HBX G;  4OIP F;  2VT2 A;  2OV7 A;  4UUS A;  4M6X A;  1LNW A;  2L9R A;  3KP6 A;  2JUG A;  2F48 A;  4CH7 A;  2IS4 A;  1UJ8 A;  2XGX A;  2KKO A;  4OAZ A;  2GWR A;  3BR6 A;  1XB4 A;  4FQG A;  2DA7 A;  1TWA J;  5C44 J;  1K7A A;  4IZZ A;  2H6B A;  3I3L A;  1LPQ A;  5FRM A;  1T39 A;  5FKK A;  1LFB A;  3VWB A;  2BY2 A;  4AIH A;  5FLX Z;  3L9F A;  3HBL A;  2KJB A;  2YUS A;  1E2X A;  3JSO A;  4B4C A;  3JSP A;  1FSE A;  1XDS A;  1HQC A;  3WTV C;  5KCM A;  3SYT A;  4A12 A;  4UNO A;  1ZRC A;  3S8P A;  5FRO A;  2L7Z A;  2VBW A;  3KP3 A;  4RMN A;  2EV5 A;  2P4W A;  1BJZ A;  3TBI A;  1O57 A;  3FM3 A;  3OL3 A;  4LB5 A;  1FJL A;  1TW3 A;  3OL4 A;  4BXF A;  2VJ5 A;  5DD4 A;  2H8W A;  1Q1H A;  3F8N A;  3JRB A;  4B47 A;  3SZP A;  4ABZ A;  1U5T A;  2HXI A;  1B59 A;  2XGE A;  4ASN A;  6PAX A;  3LST A;  2WAE A;  1V5E A;  2PEX A;  4IRI A;  1I1S A;  4XOR A;  5HNH A;  3FBI B;  3CCJ I;  3HOW J;  4OU0 A;  3OYM A;  1RET A;  4ZYE A;  1HSJ A;  3CCR I;  3G73 A;  2CFX A;  2WY8 Q;  3OYD A;  3R0A A;  2V1D A;  5B3S H;  2WB1 N;  5D4R A;  4RB2 C;  1FNN A;  4NBQ A;  3A01 A;  3HDD A;  3LOC A;  3QYB A;  4PJL A;  3WTS C;  4NC7 A;  1FTT A;  3VPR A;  1XCB A;  4FE7 A;  3C2G A;  3LQR A;  3CC4 I;  2YU3 A;  3AL0 B;  2JA7 J;  2JVH A;  1SMT A;  2O7O A;  2H09 A;  2TDX A;  1ODD A;  2MSY A;  3KEY A;  4IF4 A;  1RRJ A;  3PQJ A;  1YS6 A;  3VOE A;  5A2Q K;  3KYL A;  3S1Q J;  2HQA A;  3IWZ A;  3O3K A;  2DPD A;  1RZ4 A;  4IPA A;  1I3Q J;  3VYS B;  4LLG F;  1BI3 A;  2CQK A;  1ETY A;  3DBL B;  5HOO A;  1EA3 A;  4KIT B;  4JQF A;  3QRF F;  3OYI A;  3IKV A;  2DA2 A;  3CD6 I;  3HOX J;  4NUB A;  1O4X A;  3IAM 2;  1BIB A;  5HS7 A;  2LP0 A;  4A3M J;  2BV6 A;  2LF7 A;  3B73 A;  2COM A;  5EZH A;  4A0X A;  1P4A A;  3HYI A;  3SHF A;  1DP3 A;  2ZFU A;  3IV5 A;  4KMF A;  3V8K A;  2WWY A;  3MZ8 A;  5J3L A;  2WAF A;  2RV8 A;  4B3A A;  1QPI A;  5B5E C;  3IKT A;  2W84 A;  3ONQ A;  4HNV A;  1L0O C;  1I50 J;  4I7H A;  1DGW Y;  1I27 A;  4CHU A;  1YQA A;  2W1O A;  2Y0S N;  2Y69 H;  3HSE A;  3L09 A;  4KIF A;  5ICF A;  3OIO A;  4CCO A;  2Y9Y A;  3W2V A;  1ACI A;  3BDD A;  5IYC J;  1NK2 P;  2E34 A;  4M72 A;  3SFZ A;  1KU2 A;  2Y9Z A;  4RAZ A;  3KYC B;  3K70 D;  1EH6 A;  2L9V A;  4XLP F;  4UVA A;  2XC7 A;  2RNG A;  3B6A A;  1FLI A;  1FY7 A;  5F27 A;  2LG4 A;  1R49 A;  4HZF A;  3BZ6 A;  4I0B A;  3WHB A;  3GTL J;  3E6C C;  2X51 A;  3G71 I;  3I4N J;  3H9J A;  3QYF A;  3TO7 A;  1BBY A;  1D3Y A;  1IN6 A;  3DXJ F;  1OQY A;  2VOO A;  3R61 A;  3ABT A;  3LAP A;  2RNJ A;  3QQA A;  1S5L C;  3WTY C;  1GHC A;  3F8M A;  2L7F P;  3K69 A;  5LGU A;  3RYR A;  2R3S A;  1IRX A;  4TV7 A;  2XGC A;  3M8J A;  2LDU A;  2ETH A;  2L4M A;  1QBJ A;  2M8G X;  1WJE A;  2E5N A;  4DBR A;  1VQ5 I;  3PSI A;  3BJO A;  1WI3 A;  2XKO A;  2B63 J;  4ETS A;  2A07 F;  2IGK A;  1I39 A;  2F5F A;  1LVA A;  2KJC A;  2CUF A;  3LFU A;  3S2D J;  2D1V A;  4PJN A;  3CMA I;  3CME I;  1O3T A;  2E35 A;  2JWT A;  4OAY A;  1SFE A;  4EEF G;  1BC7 C;  3K10 A;  2JSC A;  2HXO A;  5LHI A;  2NS0 A;  1VQ8 I;  1IN5 A;  2XAJ A;  4EQQ A;  3S15 J;  5IT9 Z;  4KIG A;  5CVU A;  4WX9 A;  2V9P A;  2DXI A;  4KNY A;  2Z33 A;  5BMZ A;  3VYT B;  4MLO A;  1XGS A;  1TWF J;  1E3O C;  4B44 A;  1XCV A;  1O3Q A;  1OYI A;  5CQG A;  4A3C J;  1ETX A;  5K5Q A;  3IH4 A;  1MBJ A;  2HI3 A;  5GTH C;  2JA6 J;  3SDB A;  2P7C B;  4IQJ A;  4ENN A;  1MH4 A;  3PJR A;  3GWZ A;  3P9C A;  4QTR A;  1TT0 A;  3CCE I;  3PUF A;  2XF6 A;  5D8K B;  5BS6 A;  4R1H A;  5E1X A;  3ISP A;  5LHH A;  3K4N A;  4Y4R A;  3TDU C;  3DEU A;  2XF5 A;  2R7X A;  1O3R A;  1X1A A;  2EIL H;  4JP0 A;  3H92 A;  2F4M B;  3QOD A;  2HGC A;  2LBF B;  2EZH A;  1FIP A;  2KLO A;  1I6X A;  3LSP A;  1B72 A;  1BN5 A;  3SZT A;  4BYY A;  3GTG J;  3ZQ7 A;  4F91 B;  2HWV A;  1REP C;  1I5Z A;  3GUD A;  5KHD A;  4XBF A;  5M5Y J;  1JT0 A;  1XMK A;  3O8G A;  1LKX A;  2HQ5 A;  3HOY J;  1SAN A;  5FD6 A;  1Z91 A;  2IXS A;  5IOZ A;  4E7S A;  3GZ5 A;  3RSN A;  1KU9 A;  1R7J A;  2IVM A;  2I5U A;  2FU4 A;  1ZR4 A;  3KEQ A;  5LFA A;  1JGG A;  5EDN A;  2IP2 A;  2CW0 F;  1F9N A;  2DT6 A;  3B02 A;  3DKY A;  2DI3 A;  4CXF A;  1QVT A;  4CO8 A;  3GME A;  2IA0 A;  4EGZ A;  4OWR B;  2J5P A;  4YEJ A;  1ZLK A;  1WPK A;  3RZO J;  1S8N A;  1QGP A;  1MGT A;  1PJR A;  2ID3 A;  2ZME B;  3A1Y A;  1HDD C;  1BOB A;  3BPV A;  1W4M A;  1TL8 A;  5KAI C;  2K85 A;  4NC8 A;  4OIR F;  3P9I A;  3CJQ B;  1MD0 A;  1MW7 A;  1OYY A;  3SFI A;  1BL0 A;  3IH3 A;  4FT8 A;  1DP7 P;  2A6E F;  2CG4 A;  1I3A A;  4AWX B;  1ZRD A;  1FTZ A;  4XKV A;  3ZQI A;  5E3O A;  3S2H J;  2M4G A;  1MNE A;  1OJL A;  1Y8R B;  1DPU A;  2R7V A;  4E4H A;  4XLH A;  2DYS H;  2NAZ A;  5CVI A;  1UFM A;  4HBL A;  4ZC3 A;  3BJ6 A;  4NC6 A;  2Z3Y A;  4HPQ A;  4U7D A;  4S04 A;  2GXA A;  3NAU A;  1M1E B;  1YYV A;  2MC4 A;  5K1Y A;  2H1K A;  3IP4 B;  3X2Q H;  3F8F A;  4B48 A;  2JMW A;  2R0Q C;  4XK4 A;  5GAG J;  5BQT A;  1U9O A;  4GYI A;  2JUC A;  2LRD A;  3HOS A;  3O8H A;  5EG0 A;  3CJN A;  2MLK A;  2BVL A;  4JX4 A;  2OCE A;  3EQL F;  3S1N J;  3O6B B;  2QZ8 A;  2ZJR F;  2R5Y A;  2XPV A;  4LK1 F;  4RGS A;  3DV8 A;  3QOE A;  1WJB A;  2M87 A;  1TTY A;  2DBB A;  1YTY A;  1MJB A;  3Q9V A;  4GXO A;  1Z77 A;  3DTK A;  2HOT A;  5ED4 A;  5FLX K;  2NVX J;  2D1H A;  2IGO A;  3F21 A;  1D1B A;  2YX7 A;  2XVC A;  2L02 A;  3FXQ A;  3IC7 A;  2FRH A;  3ABK H;  3ERM A;  4ENK A;  4KT5 C;  3CCY A;  3RPQ A;  5JVT A;  3E1S A;  3ZN1 A;  2L3D A;  1PUF B;  3CC7 I;  3MKL A;  2F6C A;  1YFH A;  1VQK I;  4BY7 J;  3TKY A;  1YW8 A;  5CLS A;  3J7A O;  3H35 A;  2VT3 A;  4HX7 A;  5E1W A;  4ZYH A;  2AXT C;  5H20 A;  3U9G A;  4Y33 A;  3QPH A;  2CQ7 A;  3GFL A;  1RR7 A;  4E7L A;  1E0E A;  3LA3 A;  3LA7 A;  2YPR A;  4PK4 A;  5F04 A;  2M7B A;  5IT3 A;  3VSK A;  3S16 J;  5KNL A;  2FF4 A;  1R36 A;  3HOZ J;  3H3Z A;  5LRS A;  5TIS C;  2JK3 A;  2RKH A;  4FE4 A;  2A5Y B;  4E6K G;  1JT6 A;  4BE2 A;  3BQZ A;  4LG3 A;  4OIO F;  2ISY A;  3FF5 A;  3VOD A;  5F1R A;  4HA8 A;  5JLW A;  1XD7 A;  3BTC A;  2L4A A;  3ABU A;  1Z3Y A;  4W1U A;  3K4J A;  2ZJQ F;  3FKJ A;  5HLH A;  3OYB A;  2DMN A;  1ZGJ A;  4YIR X;  3OYH A;  2LKS A;  3AG2 H;  1JXS A;  3MWM A;  3EPZ A;  3T1B A;  3WGI A;  4JBA A;  5EEA A;  2LYC A;  3KET A;  1NH3 A;  1NTC A;  4AUX A;  2ME6 A;  1ORK A;  3BG3 A;  1OFC X;  4WXH A;  1MZB A;  2F5E A;  3CJT B;  3PSF A;  1HLV A;  3IAS 2;  4PGH A;  4C9Y A;  3BR5 A;  2IA2 A;  2LBF A;  4OMY A;  2O8X A;  3S3N A;  1G2H A;  3R60 A;  2XIG A;  2VQL A;  4HEA 2;  4I76 A;  4B8X A;  1W5C C;  4NHJ A;  2ESN A;  4KFC A;  2STW A;  2Z16 A;  3A4C A;  3RIR A;  1U6G A;  4I99 C;  4NQW B;  5FJ8 J;  1F36 A;  3ZQL A;  4II3 A;  4ENJ A;  2ECC A;  5IPA A;  5DUK A;  1PUE E;  2FEZ A;  3RCO A;  3HEF A;  4HRI A;  2GOM A;  1D0X A;  2DK5 A;  1LFU P;  3OIQ A;  1WWX A;  2FXA A;  2DOD A;  2QSG X;  4YRV A;  1FBS A;  2DT7 B;  4BNC A;  4O3M A;  1ON2 A;  1WZ2 A;  5GPC A;  5JVG F;  4BKX A;  4BHP A;  4ZYD A;  4UHT A;  2XAH A;  1SFX A;  2LKP A;  3G1O A;  4C3I J;  3OYN A;  1NG6 A;  5HDK A;  1OCP A;  4E7K A;  3CUQ B;  2OZU A;  1IXR C;  1WJD A;  3BZK A;  4BU2 A;  3HHH A;  5DS9 A;  1AOY A;  4BHC A;  5LBQ A;  4AID A;  2P7V B;  3KIO A;  2E60 A;  2EZL A;  1ZG5 A;  3CES A;  2DYR H;  4GDF A;  2R5Z A;  5IP6 A;  3L7W A;  2XV4 S;  3RPU A;  3W6K B;  1W7P D;  2IA1 A;  2W85 A;  2XB5 A;  3GFJ A;  2CH0 A;  3DLL F;  2JN6 A;  4BEH B;  5J1Y A;  4A6D A;  3I55 I;  4FX4 A;  4N9H A;  2L9N A;  5DM6 F;  2Z99 A;  4G7O F;  2EZI A;  1FBU A;  3KZZ A;  2M45 A;  3N4M A;  1MBE A;  1Y0N A;  3H1C A;  3I59 A;  4RDU A;  2KP6 A;  1GDT A;  3M8E A;  1HA8 A;  2IPQ X;  1RI7 A;  3MCZ A;  1U3E M;  3RKY A;  4I2O A;  1IDY A;  1D0Z A;  5LLQ A;  1FOK A;  1T2K A;  4MEX F;  3WTZ A;  5HOD A;  1CF7 A;  3TW6 A;  3H5A A;  4CCM A;  1WKM A;  5HLG A;  1IRG A;  2O3F A;  2RVC A;  5IT9 K;  3RTR A;  5JR3 A;  3QOP A;  4XLE A;  1TT5 B;  2XAG A;  3W2W A;  2DA6 A;  3BCB A;  1YO5 C;  4MFE A;  3K2A A;  4ZZD A;  3F6O A;  2LKX A;  2LY1 A;  3OIP A;  3OOP A;  1UAA A;  4FHT A;  4IRH A;  2KIF A;  3WU0 A;  2FQ3 A;  2CMP A;  1K78 B;  1APL C;  1YJ9 I;  1ZH5 A;  2X6O A;  2CV0 A;  4Q4Z F;  4V2G A;  3PNT A;  2EH3 A;  2ZXJ A;  4PSW A;  1TWH J;  1CGP A;  1WFX A;  4UV9 A;  2PG4 A;  1X3Z B;  2P6T A;  5IP7 J;  3CUO A;  3ECO A;  1VQP I;  2G0E A;  3ECH A;  4RAY A;  3ZQF A;  5EGO B;  1DUX C;  4AU7 A;  2E5Z A;  4Y13 A;  3REO A;  3PM1 A;  2LY2 A;  3FXR A;  3MMY B;  2IS1 A;  1IUY A;  3MQ0 A;  5H6Q A;  5LEK A;  3ZMZ A;  4QPO A;  2PJR B;  4ON0 A;  5GAD J;  1PP7 U;  3DLA A;  4WF2 A;  5M3M J;  4F92 B;  2QQ8 A;  4JOM A;  2JA8 J;  2H1L A;  1WJF A;  1Y1V J;  2NXN B;  3DTI A;  2K27 A;  1IZ1 A;  4IL6 C;  1GT0 C;  3MZY A;  2VOD A;  1S7O A;  1XC5 A;  3W2A A;  5IP9 J;  3CCU I;  2WAD A;  3E6D A;  2DPU A;  2QSH X;  2LK2 A;  1ZEL A;  4OIN F;  4DZP A;  4YFK F;  3J80 Z;  2IJL A;  5ICG A;  2BYV E;  1GXQ A;  3CMM A;  1X2N A;  1HCR A;  3F8B A;  1TP4 A;  2TRT A;  5CYV A;  1GUU A;  4FCY A;  4ZTF A;  3HOU J;  2FNA A;  4A6E A;  2ZB9 A;  2V79 A;  4XLF A;  2O0Y A;  4BL0 B;  2W82 A;  2P5L C;  1RES A;  1BIA A;  3FXM A;  5LHG A;  2Q2E A;  3VEP A;  1KYZ A;  3A02 A;  1ZAO A;  3TL4 X;  2JTV A;  1B8I A;  2QBY B;  2UXX A;  2CYY A;  1KQ9 A;  3QPT A;  2OU2 A;  5CVR A;  2O5R A;  1ZGW A;  4PDK A;  3OYA A;  2ZBK A;  3BOQ A;  3A2K A;  2WV1 A;  5HDN A;  3ZRG A;  4DYR A;  5LGN A;  5EYR A;  3L2V A;  2DA1 A;  1N25 A;  3HPH A;  4G6T B;  4Z2Y A;  3T8R A;  4HQM A;  3HRT A;  5J40 A;  4NQW A;  5D5V B;  2M0C A;  3D5S C;  4H4K C;  4RM2 A;  2GIZ A;  4Y7N J;  1N77 A;  1MMS A;  1IN4 A;  2R7O A;  4LFU A;  4RA2 A;  4FIS A;  2E1O A;  2X0L A;  1TW2 A;  1YW7 A;  1UHM A;  2ME0 A;  2VQG A;  4EV0 A;  3M07 A;  4E7Z A;  5HLT A;  3EDP A;  3FX3 A;  3W3C A;  1LE8 B;  4HW0 A;  3WGH A;  4BXU A;  3HRM A;  4LD5 A;  3TW7 A;  2BW3 B;  1K4S A;  1S29 A;  3ZMT A;  2MBF A;  2WAQ N;  3S2W A;  1P2F A;  5FGM A;  3OYE A;  3HB9 A;  1LQ1 A;  1JKP C;  3AAF A;  5J47 A;  4L5J A;  1ZR2 A;  4C3H J;  3JTG A;  4P96 A;  3NWS A;  2E71 A;  4LOC A;  4M3E A;  4RGR A;  1YX3 A;  4BBR J;  3MZH A;  1OCC H;  1R1V A;  3ASO H;  3OYL A;  3HPG A;  3LSR A;  3WU2 C;  3ULQ B;  1IG7 A;  4U0Y A;  3DPT A;  1ERD A;  2X6W A;  1FOY A;  1T56 A;  4P9F A;  2MAB A;  3DBH B;  4P55 A;  4AD9 A;  4DJA A;  4F52 A;  1AA7 A;  4XQF A;  1H9G A;  3RPU D;  5J8F A;  1VFC A;  2O61 A;  1FMW A;  1PVE A;  2OJE D;  4MEY F;  2K9M A;  5C3E J;  1ZRE A;  1ENH A;  1USS A;  1E3H A;  2EBI A;  2K02 A;  2Z9O A;  1NG7 A;  3GFM A;  3NRV A;  4C2M J;  2BY0 A;  2RQP A;  1SFU A;  2LR8 A;  4KIB A;  4WXD A;  2X1E A;  1IGN A;  5KAF C;  2CW8 A;  1ZG1 A;  3F9K A;  1MSF C;  1RUN A;  1JGS A;  3BP8 A;  2K9S A;  5LGT A;  5HNF A;  2VUM J;  4LGW A;  3BR1 A;  1X1P A;  1OCO H;  2D45 A;  2YU9 J;  2CW7 A;  3BG7 A;  4J01 A;  1SVO A;  2XAU A;  4D5F A;  5E1Z B;  5C4X J;  1QU3 A;  3F22 A;  3EYI A;  5F6F A;  2EIN H;  3K1M A;  4I01 A;  1FOW A;  2DFE A;  4PZJ A;  1IRF A;  2E7X A;  1ETV A;  2DA4 A;  5F64 A;  2AO9 A;  2DN0 A;  2PBI A;  3CJR B;  3SEQ A;  3GBG A;  3OYK A;  3IRQ A;  1A35 A;  1OR7 C;  3D5R C;  2JRT A;  3I64 A;  3QU6 A;  1W5T A;  3JRE A;  1RIO H;  1X2M A;  3VDX A;  4LIV A;  3H5N A;  1QHG A;  2R7Q A;  3FWE A;  2KZV A;  2M8E A;  2R7W A;  1ETW A;  4G7H F;  1IRZ A;  4N4N B;  4N9I A;  1TQI A;  1DDN A;  3M1C A;  3IRR A;  3DU5 A;  1OYW A;  2QQA A;  2STT A;  4DOZ A;  3OV8 A;  2WTE A;  2VKV A;  2R7S A;  2FBK A;  1YHQ I;  1SEU A;  2EWN A;  4DBQ A;  4EJU A;  2DW4 A;  2OAZ A;  4A3L J;  4DNC A;  2AS5 F;  2ZJP F;  2NVQ J;  3TQN A;  3SDG A;  3OSF A;  3CCQ I;  5DEQ A;  3I0T A;  4PFO A;  4NB5 A;  2QWW A;  3JCU C;  3QP5 A;  1JJ6 C;  1UEL B;  2ZNZ A;  3CO7 C;  3J7Z I;  1AHD P;  2RAE A;  1YOV B;  1O3S A;  2OUM A;  1ZG3 A;  2DT5 A;  2ACJ A;  1CQT A;  3I9V 2;  3CCM I;  1IF1 A;  4A69 C;  2UXN A;  3GCM A;  1BI0 A;  1V4R A;  2MFZ A;  3PIO F;  5DD8 A;  3OS1 A;  1SD7 A;  3CLO A;  1XG1 A;  1TLH B;  5LRR A;  3DKX A;  2EPF A;  2DTZ A;  3AG3 H;  1V5F A;  2Y2Z A;  4L9J A;  2DJI A;  5FKL A;  4Q5S F;  1QNT A;  2QBY A;  2JPB A;  1JHF A;  3S17 J;  5ICE A;  5DCM B;  3HKZ N;  1HKQ A;  1UB9 A;  2B9S A;  2EA4 A;  2FBH A;  2RC4 A;  4MHG A;  1SFO J;  3GF2 A;  2KRH A;  4RM3 A;  1F1Z A;  4BDY A;  4AYB N;  1Y6I A;  5J4Y A;  3GFI A;  5K7F A;  4GO1 A;  3CDI A;  1LEA A;  1WRJ A;  4MGR A;  4EM2 A;  3GLL A;  5HDG A;  5E8G A;  4YFN F;  4MNU A;  1EV7 A;  4HF0 A;  5AIP A;  3LAJ A;  4HV6 A;  3OMY A;  1YIO A;  2V4J C;  4CGZ A;  4RLF A;  3ZCO A;  1R4M B;  1WQ2 A;  4Y52 J;  4I6Z A;  3GLX A;  3M8F A;  1JUP A;  4HX8 A;  5HVQ C;  4HF1 A;  3BTJ A;  3OYC A;  4M71 A;  1E3P A;  3FHZ A;  2XKP A;  3GZN B;  9ANT A;  3WE2 A;  5K5O A;  3OR2 C;  1E17 A;  2G7U A;  1JTY A;  2EIM H;  2WB1 A;  3G1L A;  2GZW A;  4XKB A;  2HEO A;  3TMO A;  3FXL A;  2FML A;  1SD5 A;  2CQQ A;  2DFI A;  2O9L A;  4KN4 X;  3L00 A;  4G94 A;  1OR7 A;  1FMV A;  2D5V A;  2PI0 A;  2HOA A;  2FUG 2;  2M34 A;  3N05 A;  1U0J A;  1QZE A;  3ZPL A;  2KL4 A;  3GX4 X;  3Q0W A;  3OS0 A;  3E5Q A;  4CIC A;  5F0C A;  3V4G A;  3FKI J;  1YW9 A;  4ZJZ A;  4FX0 A;  1VQ7 I;  2DOE A;  5K5R A;  4QIW N;  2EFO A;  3QAH A;  4ZYG A;  5GAH J;  4ESB A;  4E70 A;  2NS7 A;  4XLC A;  5EF6 A;  3ESW B;  3CDL A;  3TO9 A;  2NRA C;  1B9M A;  2VOP A;  2HDC A;  3J81 Z;  2X6Y A;  2X1C A;  2M30 A;  3K4K A;  1HW2 A;  4DW6 A;  1Z21 A;  3L2W A;  1ETK A;  5D6F A;  3HSR A;  1LJ9 A;  3GTO J;  1T98 A;  3I53 A;  4BQN A;  3ABM H;  3DP7 A;  1YJN I;  3K4B A;  4A5N A;  5F0H A;  2R7Z J;  3KLO A;  3F3X A;  1QHH D;  3NWT A;  5DYM A;  4G7Z F;  5FFZ A;  2M3A A;  1W1W E;  3R6S A;  3K7A J;  2Y0S A;  1DGR M;  3J80 K;  4HLY A;  3VSL A;  4D1Q A;  3SXY A;  1BJA A;  3RKX A;  4WWC A;  3F23 A;  4P9U A;  2NVY J;  1OCT C;  2FQ4 A;  3HTS B;  2HU9 A;  2KHM A;  4IHV A;  1B9N A;  1ETQ A;  3CCL I;  1D1A A;  3DQV C;  4IHW A;  5GP9 A;  4XIC A;  2UWM A;  3BRO A;  2K9N A;  4AM3 A;  1D0Y A;  1B1B A;  2MH9 A;  4HX4 A;  1IO2 A;  3U1K A;  3OSG A;  1GLN A;  5IY5 H;  3GXO A;  3OOU A;  3HHG A;  2R7U A;  4BQO A;  2HS5 A;  2F5V A;  2VL8 A;  3DBR B;  4Y17 A;  3I58 A;  1XTA A;  2L7M P;  3FMR A;  3I71 A;  3LFK A;  4GGG A;  1P7J A;  4CCJ A;  2K4J A;  2HPM A;  2BZT A;  4LJZ F;  3F6V A;  1F4K A;  3FXK A;  3ROU A;  5C4J J;  1T0F A;  4MQV A;  5F1J A;  1U8B A;  1XGO A;  3KP5 A;  2HVQ A;  4F55 A;  4M73 A;  4DGW B;  1LFP A;  2B0L A;  1IC8 A;  4BJ5 C;  4BY1 J;  1S9H A;  4PCQ A;  2RGV A;  1XDU A;  3MKY B;  2L01 A;  3HL2 A;  3G4S I;  4LG0 B;  1HOM A;  2A05 A;  1JJ8 C;  3KZY A;  3GTQ J;  1FSH A;  2VAS A;  1IAW A;  3KX2 A;  3N97 A;  4C2T A;  3F8C A;  2W7N A;  4ZZL A;  4LLN A;  1MBK A;  1VF9 A;  1ZYR F;  4Q48 A;  4EJT A;  2JZY A;  2XSD C;  2BVM A;  2UUZ A;  3S3O A;  1IJW C;  1YLF A;  2H94 A;  2P5K A;  5F08 A;  3UNG C;  3T0Y A;  2ECB A;  4MO7 A;  3H36 A;  2XUB A;  2IS2 A;  2OPT A;  2E1M C;  1N75 A;  2V26 A;  5JFR A;  4A3K J;  1K61 A;  5ICC A;  1JE8 A;  4MFD A;  3WOD F;  3S14 J;  4DIQ A;  5IYD J;  1D1C A;  3BG9 A;  3WTX C;  2PMH A;  4C3J J;  3WE3 A;  1MMD A;  5E3N A;  2EIJ H;  3DPU A;  2F5C A;  1MDM B;  2MD5 A;  2GM4 A;  1H88 C;  4DQ2 A;  3BT9 A;  5M3F J;  4ESF A;  2WBM A;  1ONV A;  2QKM B;  2K40 A;  2HOS A;  2CFO A;  2X1D A;  4IEJ A;  2M0M A;  4ZYA A;  1ZQ3 P;  1ZTR A;  1SVM A;  2A61 A;  2CS3 A;  2JJ7 A;  2Q0O A;  3FK7 A;  4UXN A;  2LC2 A;  2MG4 A;  5LD2 C;  1OMI A;  1POG A;  4RBO A;  4A3D J;  2FE3 A;  3HGG A;  2MA3 A;  3KP2 A;  4M3B A;  1FBQ A;  3LL7 A;  5FO5 A;  4ZDO A;  1Y39 A;  1VQL I;  4F93 B;  2DLL A;  2M5W A;  2FBI A;  2D2W A;  3PFY A;  2IGM A;  2OQG A;  1V5G A;  2PFB A;  5BPI A;  2K5C A;  2P5V A;  2RQQ A;  1XSX A;  3V8L A;  3B6C A;  2R7F A;  4HDV A;  4BDZ A;  2BXZ A;  2F2E A;  4UUV A;  1HST A;  2KDO A;  1FT9 A;  1XX5 A;  4R8H A;  2NOJ B;  5DTD A;  3HUG B;  3PNV A;  1N78 A;  4A0Z A;  1TNT A;  2CWE A;  2X85 A;  1X4O A;  2DQL A;  3Q0U A;  1VI0 A;  3CTA A;  3PL8 A;  4EVI A;  5L3E A;  2VXD A;  2EB7 A;  4UVB A;  2V1X A;  3QPL A;  2HZD A;  1G3T A;  2V6C A;  2IS6 A;  5LEJ A;  3GTK J;  5E17 F;  1KGS A;  2FA5 A;  4PJJ A;  1SC7 A;  3I56 I;  3LWF A;  3RKQ A; 
#chains in the Genus database with same CATH homology
 2GQQ A;  3QP6 A;  3JAM K;  1LB2 A;  1XGN A;  2R7D A;  3TGN A;  1OKR A;  3CDH A;  2FNP A;  3MAJ A;  3P9K A;  1PDN C;  1G3W A;  3V7C A;  1HKT A;  2EK5 A;  2BE5 F;  2ZME A;  3K9T A;  1G3S A;  4QWQ A;  2FOK A;  1W5S A;  2XAF A;  4CDG A;  2ZJ2 A;  4IHT A;  4A0Y A;  1J2X A;  2OQR A;  3WTU C;  2DU9 A;  1IN7 A;  2W24 A;  4M9Z A;  2WV0 A;  3I4P A;  2A6H F;  2J5O A;  3ZP5 A;  4S05 A;  3T8T A;  1YS7 A;  1LDJ A;  1U5T B;  3M9A A;  4LG0 A;  2EFQ A;  4ZH4 F;  3RKW A;  5HLI A;  1R5G A;  5CVJ A;  5EEH A;  2K86 A;  1IN8 A;  4PGG A;  4XLN F;  2VC0 A;  4O6J A;  3FMQ A;  3E3V A;  2AXL A;  2HFH A;  2QM3 A;  2KIU A;  2OZ6 A;  1TQM A;  3TO6 A;  1JHH A;  4KIC A;  5FFX A;  5D6E A;  1J7K A;  2WC2 A;  4U0W A;  2PQ8 A;  1KYW A;  3COA C;  3Q9S A;  3J81 K;  5DUI A;  3C7J A;  2W25 A;  3PFI A;  2NYX A;  4H0E A;  2W57 A;  1KA8 A;  3JTH A;  2IT0 A;  4RB0 A;  1K6O A;  2CO5 A;  2UZK A;  3HTU A;  4EJW A;  2ZCW A;  1FWZ A;  3I5U A;  4RS8 A;  1B6A A;  4AVP A;  3CO6 C;  3IWF A;  2EFN A;  4EJV A;  2ESH A;  3ERE D;  5DCF A;  2DAO A;  2DTR A;  4MTD A;  2C6Y A;  2A69 F;  1D5V A;  3BWG A;  4OMZ A;  3KFW X;  3WTT C;  4BHB A;  4U7B A;  1ZRF A;  3BPX A;  1ZN2 A;  2CGP A;  2XAQ A;  1QZZ A;  3K1P A;  3TOB A;  4OIQ F;  3KP4 A;  4KDP A;  1KQ0 A;  5FD5 A;  5J6X A;  1H0M A;  3FM5 A;  3D0S A;  5CJ9 A;  2VON A;  3CUQ A;  3FXU A;  3LA2 A;  1DPR A;  4XSX F;  1J0R A;  4L0Y B;  3EUH A;  4RB3 C;  1J75 A;  1J5Y A;  4WCG A;  3WTW C;  2QEN A;  2OA4 A;  4P5O A;  2YR2 A;  5ERI A;  2M1B A;  3FMS A;  4HF2 A;  2L54 A;  3KP7 A;  1P4W A;  3DKW A;  4MTE A;  2NNY A;  3GYH X;  4BQA A;  3BJA A;  4XRF A;  1T6S A;  4G6D A;  3K2Z A;  1BC8 C;  1SMY F;  1TBX A;  2JT1 A;  4I0A A;  2VE8 A;  1L3L A;  1S3J A;  3PQK A;  5JI6 A;  2RN7 A;  3MEX A;  1R23 A;  1K78 A;  2HQN A;  2ZO4 A;  1FP1 D;  1YG2 A;  1FYL A;  4IVN A;  4AIJ A;  1IXC A;  1RUO A;  5ILV A;  3JAM Z;  2MC3 A;  4Q47 A;  1U2W A;  3Q5F A;  1SD4 A;  1XGM A;  2HTJ A;  4G9Y A;  1ZAR A;  2ADU A;  2XHK A;  4EJO A;  4BAY A;  4LLL A;  2O03 A;  4IJA A;  4K2E A;  3O2P E;  1W7P B;  3LQQ A;  2YSR A;  2NNN A;  2Y75 A;  1G4D A;  2BEO A;  1XN7 A;  5BPD A;  1FYK A;  2K4B A;  5CVV A;  3KEO A;  2P6S A;  2ZFW A;  3GZ6 A;  3R0J A;  4F7Z A;  4KMU X;  3JW4 A;  5L3B A;  4IRG A;  3F72 A;  1GVJ A;  1T38 A;  5BOX A;  1TNS A;  4LK0 F;  2GAU A;  1WI9 A;  2EJR A;  3RJP A;  3KLN A;  4RGU A;  2PLY A;  1D8J A;  4L0Z B;  3FZV A;  3E6B A;  2Y0M A;  2Z5U A;  1HW5 A;  3DFG A;  1G6N A;  4M9S A;  3HIF A;  2XRO A;  5L3C A;  1K79 A;  4AIK A;  1O7L A;  3E6M A;  1LDD A;  2QUF A;  3P7N A;  4JK1 X;  4U0V A;  1QQI A;  5D5U B;  4HV5 A;  2VBY A;  2G7H A;  3V7R A;  1BI1 A;  4N0B A;  3T5X A;  1KQ8 A;  4GCV A;  2PMU A;  3C1D A;  2HYG D;  5KVR A;  5L3D A;  3BY6 A;  3WG9 A;  2VXZ A;  2HZT A;  4HDU A;  4MQ9 F;  4HOB A;  2LSO A;  2QYO A;  4KYW A;  3GO5 A;  1ZHF A;  4L18 B;  5DDG A;  2E1C A;  2V1U A;  1FYM A;  2GXG A;  2OBP A;  4EM1 A;  1WSU A;  3RI4 A;  1Z05 A;  4OOI A;  3KE2 A;  4RGX A;  4WK8 F;  1B4A A;  3H3U A;  3GEZ A;  4YFX F;  3EET A;  2H27 A;  1X3U A;  3VFZ A;  1P92 A;  1IW7 F;  5TJJ A;  2O6G E;  1FC3 A;  1G3Y A;  1STZ A;  1XSD A;  3C3W A;  3ZMV A;  2Y48 A;  4KA4 A;  1QZY A;  1ZGA A;  1FPQ A;  2A68 F;  4KN7 X;  3M7G A;  5ILU A;  5HS8 A;  3ZMD A;  2HKX A;  1J59 A;  3ZMU A;  4L9T A;  3C18 A;  1RNL A;  1XMA A;  5E18 F;  4M74 A;  1W7P A;  4QLC U;  2LNB A;  4UVC A;  1UCR A;  4O5V A;  3TOA A;  4HYE A;  4CYD A;  4EM0 B;  2BBY A;  4KUM A;  3I59 B;  4LB6 B;  2ZME C;  4L9V A;  1FP2 A;  2ZNY A;  1UHW A;  3E5U A;  1CF7 B;  2HYF A;  3DPL C;  2Q8K A;  2ZKZ A;  2ELH A;  1D8K A;  1P4X A;  5DCM A;  4RB1 A;  1C0W A;  1S7A A;  2GXB A;  1HXD A;  2YX4 A;  2F5D A;  5AIQ A;  4A2U A;  2RDP A;  1BM9 A;  3ZN0 A;  1MJ9 A;  1SD6 A;  2IRF G;  3E97 A;  3ELK A;  3RYP A;  2E1N A;  5EEG A;  5FB2 A;  5DV5 A;  4IHS A;  3SQN A;  4I02 A;  2ISZ A;  5ILS A;  2XAS A;  2HTS A;  4HQE A;  4A5M A;  1FX7 A;  3TDZ C;  1UST A;  4YII A;  4M6Y A;  1EH7 A;  4D0P A;  5L3G A;  2HR3 A;  3U1D A;  2EFW A;  4EMS A;  2QLZ A;  5A2Q Z;  1H9T A;  2QQB A;  2HOE A;  4G6Q A;  3U2R A;  4YG2 F;  2E7W A;  3V8J A;  3WU1 B;  4L5I A;  3W6J B;  1U78 A;  2XRN A;  3DF8 A;  1R00 A;  5JHU A;  1P6R A;  1V3F A;  3G3Z A;  2MH2 A;  2VBX A;  1F5T A;  4I09 A;  1NHA A;  2EV0 A;  1ZLJ A;  2KRF A;  5D5X B;  2HQR A;  4CZZ A;  5J8C A;  4B09 A;  5E20 A;  4ENM A;  5H6R A;  2H6C A;  4BH9 A;  1XSV A;  4ESJ A;  4GYG A;  1S6L A;  4R79 A;  2GA1 A;  2IW5 A;  1VTN C;  4Y15 A;  4L9N A;  4HLX A;  1KU3 A;  5AON A;  3RDI A;  5D4S A;  4EGY A;  4M9X A;  3M1E A;  4UV8 A;  2EFP A;  2QVO A;  2VN2 A;  3D5L A;  3ZMS A;  3EYY A;  3QU3 A;  1R5H A;  1OPC A;  3KCC A;  2QQ9 A;  2GA2 A;  3GW2 A;  1KU7 A;  3E5X A;  4U88 A;  1BI2 A;  2HKO A;  2X4H A;  5L3F A;  4XSZ F;  2FMY A;  1EH8 A;  2VBZ A;  1MJA A;  1LDK B;  5E8I A;  1J9I A;  5HS9 A;  2GIV A;  1A04 A;  4HAM A;  1QPM A;  3HOT A;  2CSO A;  3CUQ C;  1QO0 D;  1SAX A;  3IHU A;  3I54 A;  3WGG A;  3GVA A;  1Z7U A;  2JPC A;  1MDM A;  1HW1 A;  2OD5 A;  4WXC A;  2DK8 A;  1FZP B;  3NQO A;  1R22 A;  4YIF A;  1R58 A;  1GXP A;  5KK1 A;  5D8L B;  1U8R A;  1I1G A;  1ON1 A;  1Z9C A;  2V9V A;  5D5W B;  1U5T C;  2P8T A;  2DO7 A;  2LF8 A;  1MKM A;  1PP8 F;  2EA2 A;  2EV6 A;  1AWC A;  2PJP A;  1BOA A;  3HUG A;  2FSW A;  2VC1 A;  3IL2 A;  3MFK A;  3NEU A;  1ULY A;  3ML6 A;  1R1T A;  2BGC A;  2DQR A;  3K1N A;  3V7S A;  2KIM A;  1R1U A;  2MLG A;  2G9W A;  4I98 B;  1Z6R A;  2A3S A;  1TQP A;  3HRS A;  3K0L A;  3HSF A;  3VB2 A;  2PN6 A;  3L2C A;  1O7F A;  4IXA A;  3R4K A;  4G8X A;  1IXS B;  1Z1D A;  5TRD A;  1LEB A;  1Z6T A;  3HRU A;  4LMY A;  2VE9 A;  1Y0U A;  2K7L A;  1HKS A;  1HBX G;  4OIP F;  2VT2 A;  4M6X A;  1LNW A;  3KP6 A;  2XGX A;  2KKO A;  2GWR A;  1XB4 A;  1K7A A;  2H6B A;  1T39 A;  5FLX Z;  4AIH A;  3L9F A;  2KJB A;  3JSO A;  1E2X A;  3JSP A;  1FSE A;  1XDS A;  1HQC A;  3WTV C;  4A12 A;  4UNO A;  1ZRC A;  2VBW A;  3KP3 A;  2EV5 A;  2P4W A;  1O57 A;  3FM3 A;  4LB5 A;  1TW3 A;  5DD4 A;  1Q1H A;  3F8N A;  3SZP A;  1U5T A;  1B59 A;  4ASN A;  6PAX A;  3LST A;  1I1S A;  2PEX A;  4IRI A;  4OU0 A;  4ZYE A;  1HSJ A;  3G73 A;  2CFX A;  3R0A A;  2V1D A;  5D4R A;  4RB2 C;  1FNN A;  3WTS C;  1XCB A;  3LQR A;  2YU3 A;  1SMT A;  2H09 A;  2TDX A;  1ODD A;  4IF4 A;  3PQJ A;  1YS6 A;  3VOE A;  5A2Q K;  3IWZ A;  3O3K A;  2DPD A;  1RZ4 A;  4IPA A;  4LLG F;  1BI3 A;  2CQK A;  5HOO A;  4JQF A;  3QRF F;  3IKV A;  1BIB A;  5HS7 A;  2BV6 A;  2LF7 A;  3B73 A;  2COM A;  4A0X A;  1P4A A;  3HYI A;  3SHF A;  4KMF A;  3V8K A;  2WWY A;  2RV8 A;  3IKT A;  2W84 A;  1L0O C;  4I7H A;  1I27 A;  4CHU A;  1YQA A;  3HSE A;  3L09 A;  4KIF A;  5ICF A;  3BDD A;  4M72 A;  3SFZ A;  1KU2 A;  4RAZ A;  1EH6 A;  4XLP F;  4UVA A;  1FLI A;  1FY7 A;  4HZF A;  3BZ6 A;  4I0B A;  3E6C C;  3TO7 A;  1BBY A;  1D3Y A;  1IN6 A;  3DXJ F;  2VOO A;  3R61 A;  3ABT A;  3LAP A;  2RNJ A;  3WTY C;  1GHC A;  3F8M A;  3K69 A;  5LGU A;  3RYR A;  2R3S A;  4TV7 A;  2LDU A;  2ETH A;  2L4M A;  1QBJ A;  3BJO A;  2XKO A;  4ETS A;  2A07 F;  2F5F A;  1LVA A;  2KJC A;  2D1V A;  1O3T A;  1BC7 C;  1SFE A;  2JSC A;  5LHI A;  2NS0 A;  1IN5 A;  2XAJ A;  4EQQ A;  5IT9 Z;  4KIG A;  5CVU A;  4WX9 A;  4KNY A;  2Z33 A;  5BMZ A;  1XGS A;  1XCV A;  1O3Q A;  1OYI A;  5K5Q A;  2P7C B;  4ENN A;  3GWZ A;  3P9C A;  5D8K B;  5BS6 A;  4R1H A;  5E1X A;  3ISP A;  5LHH A;  3TDU C;  3DEU A;  1O3R A;  3H92 A;  2HGC A;  1I6X A;  1BN5 A;  3SZT A;  4BYY A;  3ZQ7 A;  2HWV A;  1REP C;  1I5Z A;  3GUD A;  4XBF A;  1XMK A;  5FD6 A;  1Z91 A;  3GZ5 A;  1KU9 A;  1R7J A;  2IVM A;  2FU4 A;  3KEQ A;  2IP2 A;  2CW0 F;  1F9N A;  3B02 A;  4CXF A;  2DI3 A;  4CO8 A;  2IA0 A;  4EGZ A;  2J5P A;  1ZLK A;  1S8N A;  1QGP A;  1MGT A;  2ZME B;  3BPV A;  1W4M A;  4OIR F;  3P9I A;  1MD0 A;  1OYY A;  4FT8 A;  1DP7 P;  2A6E F;  2CG4 A;  4AWX B;  1ZRD A;  1DPU A;  2NAZ A;  5CVI A;  1UFM A;  4HBL A;  3BJ6 A;  2Z3Y A;  4U7D A;  4S04 A;  1YYV A;  5K1Y A;  3F8F A;  5BQT A;  4GYI A;  3HOS A;  3CJN A;  2MLK A;  3EQL F;  3O6B B;  2QZ8 A;  4LK1 F;  4RGS A;  3DV8 A;  2M87 A;  1TTY A;  2DBB A;  1YTY A;  1MJB A;  3Q9V A;  4GXO A;  5ED4 A;  5FLX K;  2D1H A;  3F21 A;  2YX7 A;  2XVC A;  2L02 A;  3FXQ A;  3IC7 A;  2FRH A;  4ENK A;  4KT5 C;  3RPQ A;  5JVT A;  3ZN1 A;  2L3D A;  1YFH A;  3TKY A;  1YW8 A;  5CLS A;  3J7A O;  2VT3 A;  4HX7 A;  5E1W A;  4ZYH A;  5H20 A;  3U9G A;  3QPH A;  3GFL A;  3LA3 A;  3LA7 A;  2YPR A;  5IT3 A;  2FF4 A;  1R36 A;  3H3Z A;  5LRS A;  2RKH A;  2A5Y B;  4OIO F;  2ISY A;  3FF5 A;  3VOD A;  5F1R A;  4HA8 A;  1XD7 A;  2L4A A;  3ABU A;  5HLH A;  1ZGJ A;  1JXS A;  3MWM A;  3T1B A;  3WGI A;  4JBA A;  3KET A;  4WXH A;  1MZB A;  2F5E A;  4PGH A;  2IA2 A;  4OMY A;  2O8X A;  3R60 A;  2XIG A;  4B8X A;  4NHJ A;  2ESN A;  4KFC A;  2STW A;  3RIR A;  1U6G A;  4ENJ A;  5DUK A;  1PUE E;  2FEZ A;  2DK5 A;  1WWX A;  2FXA A;  1FBS A;  4BNC A;  4O3M A;  1ON2 A;  4BHP A;  4ZYD A;  4UHT A;  2XAH A;  1SFX A;  2LKP A;  5HDK A;  2OZU A;  1IXR C;  3CUQ B;  1AOY A;  3HHH A;  4BHC A;  5LBQ A;  2P7V B;  1ZG5 A;  3L7W A;  2XV4 S;  3RPU A;  3W6K B;  1W7P D;  2IA1 A;  2W85 A;  3GFJ A;  4A6D A;  4FX4 A;  4N9H A;  2Z99 A;  4G7O F;  1FBU A;  3KZZ A;  2M45 A;  3N4M A;  3I59 A;  3M8E A;  2IPQ X;  1RI7 A;  3MCZ A;  1U3E M;  3RKY A;  4I2O A;  5LLQ A;  1FOK A;  1T2K A;  4MEX F;  3WTZ A;  1CF7 A;  1WKM A;  5HLG A;  1IRG A;  2O3F A;  2RVC A;  5IT9 K;  3RTR A;  5JR3 A;  3QOP A;  2XAG A;  1YO5 C;  4ZZD A;  3F6O A;  3OOP A;  4FHT A;  4IRH A;  2KIF A;  3WU0 A;  2FQ3 A;  1K78 B;  1ZH5 A;  4Q4Z F;  2ZXJ A;  1CGP A;  4UV9 A;  2PG4 A;  2P6T A;  3CUO A;  3ECO A;  1DUX C;  3ECH A;  4RAY A;  4Y13 A;  3REO A;  3FXR A;  1IUY A;  3MQ0 A;  5H6Q A;  5LEK A;  3ZMZ A;  4ON0 A;  1PP7 U;  4WF2 A;  2K27 A;  1IZ1 A;  3MZY A;  2VOD A;  1S7O A;  3E6D A;  2DPU A;  4OIN F;  4YFK F;  3J80 Z;  2IJL A;  5ICG A;  2BYV E;  1GXQ A;  3F8B A;  5CYV A;  2FNA A;  4A6E A;  2V79 A;  2O0Y A;  2P5L C;  1BIA A;  5LHG A;  2Q2E A;  3VEP A;  1KYZ A;  1ZAO A;  2JTV A;  2QBY B;  2UXX A;  2CYY A;  1KQ9 A;  3QPT A;  2OU2 A;  5CVR A;  4PDK A;  2ZBK A;  3BOQ A;  5HDN A;  5LGN A;  4Z2Y A;  3T8R A;  4HQM A;  3HRT A;  5D5V B;  4NQW A;  1IN4 A;  4LFU A;  2X0L A;  1TW2 A;  1YW7 A;  1UHM A;  4EV0 A;  3EDP A;  3FX3 A;  4HW0 A;  3WGH A;  4BXU A;  3HRM A;  4LD5 A;  1S29 A;  3ZMT A;  2MBF A;  3S2W A;  1P2F A;  5FGM A;  1LQ1 A;  3AAF A;  4L5J A;  3JTG A;  4P96 A;  4RGR A;  3MZH A;  1R1V A;  3ULQ B;  4U0Y A;  3DPT A;  4P9F A;  4P55 A;  4AD9 A;  1H9G A;  5J8F A;  2O61 A;  4MEY F;  1ZRE A;  1USS A;  2K02 A;  2Z9O A;  3GFM A;  1SFU A;  3NRV A;  2RQP A;  4KIB A;  4WXD A;  1ZG1 A;  1RUN A;  1JGS A;  3BP8 A;  5LGT A;  4LGW A;  2D45 A;  5E1Z B;  3F22 A;  3EYI A;  5F6F A;  3K1M A;  4I01 A;  4PZJ A;  1IRF A;  2E7X A;  5F64 A;  2PBI A;  3IRQ A;  2JRT A;  3I64 A;  3QU6 A;  1W5T A;  1RIO H;  3FWE A;  2M8E A;  4G7H F;  4N9I A;  1TQI A;  1DDN A;  3IRR A;  1OYW A;  2QQA A;  2STT A;  3OV8 A;  2WTE A;  2FBK A;  2EWN A;  4EJU A;  2DW4 A;  2OAZ A;  4DNC A;  2AS5 F;  3TQN A;  5DEQ A;  3I0T A;  4NB5 A;  2QWW A;  3QP5 A;  2ZNZ A;  3CO7 C;  1O3S A;  1ZG3 A;  2DT5 A;  2ACJ A;  1IF1 A;  2UXN A;  1BI0 A;  1V4R A;  5DD8 A;  1SD7 A;  3CLO A;  1TLH B;  5LRR A;  4L9J A;  4Q5S F;  1QNT A;  2QBY A;  2JPB A;  1JHF A;  5ICE A;  5DCM B;  1HKQ A;  1UB9 A;  2EA4 A;  2FBH A;  2RC4 A;  4MHG A;  3GF2 A;  1F1Z A;  3GFI A;  4GO1 A;  1LEA A;  1WRJ A;  4MGR A;  4EM2 A;  5HDG A;  5E8G A;  4YFN F;  4MNU A;  1EV7 A;  4HF0 A;  5AIP A;  3LAJ A;  4HV6 A;  1YIO A;  4CGZ A;  1WQ2 A;  3GLX A;  3M8F A;  5HVQ C;  4HX8 A;  4HF1 A;  4M71 A;  3FHZ A;  2XKP A;  3WE2 A;  5K5O A;  1E17 A;  2G7U A;  2GZW A;  2HEO A;  2FML A;  1SD5 A;  2DFI A;  4KN4 X;  3L00 A;  4G94 A;  1OR7 A;  2PI0 A;  3ZPL A;  3GX4 X;  3E5Q A;  4CIC A;  3V4G A;  1YW9 A;  4FX0 A;  5K5R A;  2EFO A;  3QAH A;  4ZYG A;  4ESB A;  4E70 A;  3TO9 A;  2NRA C;  1B9M A;  2VOP A;  2HDC A;  3J81 Z;  2M30 A;  1HW2 A;  5D6F A;  3HSR A;  1LJ9 A;  1T98 A;  3I53 A;  3DP7 A;  4A5N A;  3KLO A;  3F3X A;  5DYM A;  4G7Z F;  5FFZ A;  3R6S A;  3J80 K;  4HLY A;  3SXY A;  1BJA A;  3RKX A;  4WWC A;  3F23 A;  4P9U A;  3HTS B;  1B9N A;  3DQV C;  2UWM A;  3BRO A;  1B1B A;  2MH9 A;  4HX4 A;  3GXO A;  3HHG A;  2HS5 A;  4Y17 A;  3I58 A;  3LFK A;  3FMR A;  3I71 A;  4GGG A;  2K4J A;  4LJZ F;  3F6V A;  1F4K A;  3ROU A;  1T0F A;  4MQV A;  1XGO A;  3KP5 A;  4M73 A;  2B0L A;  4PCQ A;  2RGV A;  1XDU A;  2L01 A;  4LG0 B;  3KZY A;  1FSH A;  1IAW A;  3N97 A;  3F8C A;  4ZZL A;  4LLN A;  1ZYR F;  4Q48 A;  4EJT A;  2JZY A;  1YLF A;  2H94 A;  2P5K A;  3T0Y A;  2XUB A;  1JE8 A;  5JFR A;  5ICC A;  3WOD F;  3WTX C;  2PMH A;  3WE3 A;  1MDM B;  2F5C A;  2MD5 A;  4DQ2 A;  4ESF A;  1ONV A;  2A61 A;  2Q0O A;  4UXN A;  1OMI A;  2FE3 A;  2MA3 A;  3KP2 A;  1FBQ A;  5FO5 A;  2DLL A;  2M5W A;  2FBI A;  2D2W A;  2OQG A;  2PFB A;  5BPI A;  2P5V A;  1XSX A;  3V8L A;  2R7F A;  4HDV A;  2F2E A;  4UUV A;  1HST A;  1FT9 A;  4R8H A;  4A0Z A;  1TNT A;  2CWE A;  2DQL A;  3CTA A;  5L3E A;  4EVI A;  4UVB A;  2EB7 A;  2V1X A;  1G3T A;  2V6C A;  5LEJ A;  5E17 F;  1KGS A;  2FA5 A;  3LWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...