3CUQC

Integrated structural and functional model of the human escrt-ii complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
173
Chain Sequence
b'SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 46
structure length 173
sequence length 173
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 3cuqC01
3JSPA 4HQEA 2Z5UA 4U88A 1MJ9A 1OYYA 2IJLA 1BC7C 1O57A 4Q47A 2G7UA 2BGCA 4WX9A 1HBXG 4ESBA 1FY7A 2ZKZA 4KNYA 1ULYA 3KP5A 1IRFA 4IXAA 2VOOA 4N9IA 4YG2F 5FLXK 1BN5A 3U9GA 2QZ8A 3MZYA 3F6VA 1ZRFA 2RKHA 2DU9A 1FBQA 4KDPA 3LAPA 4ASNA 5TRDA 4FHTA 2GAUA 4UV8A 2V9VA 2K4JA 1U6GA 2LSOA 3J7AO 3V7CA 5TJJA 1CF7A 1FOKA 3KEOA 2FMLA 3CO6C 4I98B 3R0AA 1IN6A 2DTRA 4HF0A 3FM5A 2GA2A 5E1ZB 3L09A 2L3DA 2PEXA 4HA8A 5BPIA 2XKOA 4DQ2A 3K0LA 3O3KA 2FNPA 4BHCA 2OA4A 1I27A 2UXXA 3F8CA 3WG9A 1SAXA 1G4DA 4O3MA 2R3SA 3KP6A 3DXJF 4M71A 2LF8A 3Q9VA 2DO7A 3JAMZ 3K2ZA 2FMYA 1ZGAA 4EMSA 2O03A 5HDNA 3BWGA 4GGGA 5HS7A 2E1CA 1ZAOA 3DFGA 2ZMEA 3ML6A 4KUMA 5H6QA 5FFZA 1R58A 1T39A 4CYDA 5DCMB 1KU9A 1LB2A 1FPQA 2H6CA 1KQ9A 3SQNA 5D6FA 2IW5A 5LGNA 5DUIA 4KN4X 1MJAA 2AXLA 3OV8A 4IPAA 1GXPA 5AIPA 4ZYGA 1XMKA 4FX0A 4WK8F 1H9TA 3BJAA 1R36A 4LB5A 5ICFA 1FLIA 3SHFA 4EV0A 2VT3A 2NNNA 4HYEA 2OD5A 2IPQX 1W4MA 1XDUA 3ZN1A 1FBSA 2FQ3A 3H3UA 2M1BA 3GO5A 3ZMZA 3ISPA 1PP8F 1FZPB 5ILVA 3D0SA 4Q5SF 1LDDA 2QYOA 5F1RA 1D5VA 2EK5A 1W7PA 4LFUA 4L5IA 2H6BA 4PZJA 2P6SA 2COMA 1G3WA 5L3GA 5K5QA 2ZJ2A 3I5UA 3SXYA 1O3SA 4MNUA 1QPMA 1UHMA 5K5OA 4WF2A 3ECOA 1BIBA 5D4SA 2ZXJA 5HLGA 1I1GA 4KN7X 4G6DA 1UHWA 3E5QA 4A5NA 3I0TA 3BPVA 1EH7A 3HYIA 2DLLA 2JZYA 3J81K 2VN2A 5E1WA 2UZKA 4G7ZF 2EV0A 4HOBA 2LDUA 2W57A 3V7RA 1RI7A 1IAWA 4LLLA 2QQBA 3HUGA 1XN7A 2OAZA 3MQ0A 3KLNA 2XRNA 4KIGA 2JPBA 1FWZA 1K6OA 3T0YA 3HIFA 3W6JB 5LEJA 1ZG5A 1J0RA 1MDMB 2A6EF 3E6MA 4AIKA 1HKQA 2ZMEB 2H09A 2V79A 4XSXF 1IZ1A 4EGYA 2G7HA 4NB5A 2FXAA 3JW4A 1FX7A 3NEUA 2K4BA 4HAMA 5CLSA 5ILSA 3GFMA 2Y48A 3I59B 3R4KA 4GYGA 4P5OA 3RKXA 3F8NA 2DPUA 4G7OF 2HTSA 5HOOA 2P5LC 1B1BA 3HTSB 1OPCA 1R1TA 3K1MA 4A6DA 2F5CA 2HZTA 5J6XA 1REPC 1LEBA 1BI1A 3T8RA 3EDPA 5FGMA 5DUKA 3WTWC 1P6RA 1J9IA 1R5HA 3ZPLA 2FBIA 4ENJA 5EEGA 5BQTA 3IWZA 3I4PA 4IVNA 3E3VA 4HX7A 3NQOA 1G6NA 5BS6A 4MTDA 1W7PB 1J5YA 5A2QZ 1A04A 2QQAA 2BBYA 4AIJA 5JVTA 4HLYA 1Z1DA 4UVBA 4FX4A 1KQ8A 4FT8A 2O6GE 3IKTA 5CVRA 2QBYA 2A6HF 1TTYA 3QPHA 2Z3YA 1SD6A 1YO5C 2PG4A 2STWA 3K69A 2MH2A 2CYYA 1WKMA 3ABUA 1J2XA 3E97A 3ZMDA 4L9TA 1EH6A 2M87A 3FF5A 2DT5A 3J80Z 2GIVA 3TQNA 1IW7F 5IT9K 4M6XA 2ZBKA 2Z33A 4JQFA 2K02A 2EA4A 4OIRF 1ZRDA 2VC1A 3RYRA 4KMUX 3F3XA 4HQMA 2LF7A 1T98A 4R1HA 1XSXA 3QU3A 1WQ2A 3SFZA 3QOPA 4PCQA 2KIFA 5HS9A 1S7OA 3J80K 3RI4A 4UNOA 4N0BA 2K86A 1G3TA 4L9JA 3F6OA 1Z9CA 2MD5A 1HSJA 5FB2A 1OR7A 4IHSA 3KCCA 2ZFWA 1NHAA 2HFHA 1I1SA 5LHIA 4UVAA 1XSVA 3DQVC 4YIFA 3D5LA 3JTGA 4G9YA 2GXGA 3TDZC 1PUEE 5D5UB 2KKOA 1S8NA 4I2OA 1F1ZA 4GCVA 5EEHA 3JSOA 2XAQA 1QO0D 1MD0A 3FMSA 3AAFA 3LSTA 3PQKA 2PI0A 2KJCA 4PDKA 3K1PA 3QP5A 5DD8A 1TQPA 2F5EA 3B02A 5D6EA 2MLKA 3CJNA 1TQMA 2VODA 1XMAA 2EJRA 4A0XA 3GX4X 5HDGA 3VEPA 4RB1A 2ZNYA 2PMHA 2EFNA 3CUQA 4HBLA 1U8RA 4S05A 5J8FA 2WTEA 4P96A 2WV0A 1K79A 5LHHA 1KYZA 3U1DA 5E17F 1XCVA 3HRUA 3ROUA 4ESFA 4CICA 2JTVA 2YSRA 3ZN0A 1L0OC 2QBYB 2QQ9A 5FFXA 5FD5A 4EM2A 3BROA 3IL2A 2HR3A 3F23A 2HDCA 4LD5A 5FLXZ 4ETSA 5D5VB 2GZWA 2MBFA 4G7HF 4LLNA 2M5WA 3NRVA 1I6XA 2G9WA 2RC4A 1ON1A 1FSHA 1ZARA 2BYVE 2EFWA 4M9SA 5ED4A 1ON2A 3L2CA 2IA2A 4Q4ZF 4MEXF 1U5TC 2OZUA 3G73A 4UHTA 2JT1A 1YIOA 4L9NA 4HV6A 2L4AA 1FC3A 4AIHA 3WGHA 1XD7A 3ECHA 3O2PE 3GFIA 3B73A 4PGGA 2QVOA 3HOTA 2IA1A 1Z6RA 5CVJA 5J8CA 1F9NA 1LDKB 3LQRA 4DNCA 2EA2A 2FU4A 2PMUA 1BM9A 4GYIA 4I09A 2NS0A 3HHGA 4KYWA 2KJBA 3PQJA 2OZ6A 3TOBA 2RV8A 3P9KA 3GF2A 2DW4A 1S7AA 1YW8A 2F2EA 1BBYA 1SD7A 3QU6A 1R1VA 2W25A 1JE8A 4HLXA 5K5RA 1J75A 1V4RA 1QZYA 3RDIA 1TNTA 4EJOA 4OINF 3WE2A 4HDVA 2HKXA 3CUQB 1D3YA 2J5OA 3RPUA 4R79A 1DPRA 1WI9A 4LK0F 2HQRA 1U78A 4QWQA 2VXZA 2YX7A 1KU7A 2CG4A 5BOXA 1KYWA 3FMQA 4EGZA 5L3BA 1U2WA 4LB6B 3TDUC 2E7WA 4AWXB 1UFMA 1K78A 3RJPA 4Y17A 3HRSA 4KICA 1ZLJA 4EVIA 4ZH4F 4M74A 4BQAA 3P7NA 1VTNC 2OQRA 2EFQA 1SD4A 2XAJA 4HF1A 3EQLF 4AD9A 4MEYF 5CVUA 2FEZA 1ZH5A 2EFPA 4LK1F 1Z05A 4EJWA 3P9IA 2HYGD 3MZHA 1B9MA 2E7XA 1JHFA 5BMZA 2GQQA 2PQ8A 1QQIA 1KU3A 1ODDA 5JHUA 2XROA 2M45A 5H20A 1BOAA 2Y75A 5DEQA 4M9XA 3IRQA 4OIOF 1FP1D 2IP2A 3J81Z 2GXBA 1OYWA 3L9FA 4IRGA 4O5VA 3DPLC 1RUNA 3V8KA 1JXSA 5ERIA 1CF7B 2DI3A 4IRIA 3CDHA 3HRMA 3DP7A 3IWFA 1HKTA 1BC8C 4LJZF 2Y0MA 1TW3A 2HGCA 3T5XA 5JFRA 2QLZA 4IHTA 1HW2A 1S3JA 2ETHA 3RKYA 4JBAA 5ILUA 2VC0A 1O3QA 3LA7A 4ZZDA 1RNLA 4ENKA 1DDNA 1TNSA 4RGRA 3ELKA 3ERED 3WTVC 3KP3A 4QLCU 1YS6A 1BJAA 3KE2A 3I58A 2RDPA 2BEOA 2IA0A 5ICCA 2Q0OA 3DPTA 4K2EA 1L3LA 1FBUA 1OYIA 1KU2A 4RAZA 4KFCA 2TDXA 2JRTA 4CHUA 1J59A 2O8XA 4A2UA 3C7JA 4EJTA 3M8EA 1J7KA 2KRFA 2EV6A 1RZ4A 3GLXA 1PP7U 4EJUA 2VBWA 3WTUC 1IXCA 3CO7C 3E5XA 3HRTA 1HQCA 3COAC 5LHGA 2VT2A 4G94A 2F5DA 4ON0A 1Y0UA 3HSEA 1S6LA 2JPCA 1YLFA 4AVPA 1SMYF 1SD5A 2FF4A 3WU0A 2ZMEC 4ENMA 2P5KA 2P5VA 1ZLKA 4G6QA 1FNNA 1HSTA 4HX4A 3DF8A 3FXUA 2FNAA 3REOA 1CGPA 2DAOA 4HX8A 2XVCA 4M72A 1IN7A 4MQ9F 3HSRA 3ZMSA 5AONA 1R7JA 3CTAA 1PDNC 3RPQA 2ELHA 2MC3A 2BV6A 3H3ZA 4HZFA 3QAHA 4OOIA 4E70A 4L0ZB 4MTEA 3W6KB 2EWNA 4IF4A 3I71A 4CO8A 1HW1A 3H92A 5IT9Z 2P6TA 3T1BA 3E6CC 2L02A 2L4MA 4Q48A 4G8XA 4NQWA 1T2KA 3ABTA 3KP7A 2DBBA 1XGOA 2XAHA 2NYXA 3FXRA 3KEQA 4A5MA 2D1VA 4L9VA 5D8LB 3LFKA 1IUYA 4GO1A 4A0YA 1DPUA 4OIQF 1Q1HA 2W85A 1S29A 4MQVA 3LQQA 1ZRCA 3KETA 2H94A 1U5TA 3ZMVA 1USSA 1SFEA 3LAJA 1BI3A 1O7LA 3KP4A 2XHKA 3CUOA 3MAJA 3HOSA 2HWVA 2ZO4A 5LBQA 2QUFA 1B4AA 4L0YB 3RIRA 3SZTA 2MLGA 3QRFF 2XASA 3V7SA 4ZYDA 3FMRA 1DUXC 1Z7UA 3M1EA 4TV7A 3DEUA 4UXNA 2H27A 3I64A 2F5FA 1XSDA 2VBXA 4U0YA 2XUBA 2NNYA 4HDUA 2O3FA 1LVAA 3CLOA 1YQAA 2IVMA 4HF2A 2EFOA 3R61A 3ZMTA 1LDJA 4UV9A 3TGNA 1YW9A 2OBPA 4I01A 1P4XA 4L5JA 3JTHA 4ESJA 4YIIA 1R22A 5F6FA 2PFBA 1QNTA 4LG0A 5L3FA 4XRFA 2KIUA 1BI2A 4XSZF 1TW2A 2L01A 3WODF 2V1UA 5DYMA 4IRHA 2D1HA 4Y15A 3QPTA 3QP6A 5AIQA 1FP2A 5KVRA 3HTUA 3WU1B 4KA4A 2XAGA 2RN7A 4GXOA 4OMZA 1B9NA 4KIFA 2VONA 3M8FA 1T0FA 2ADUA 3VFZA 2DPDA 1XGMA 3TO6A 3BDDA 1OKRA 3WTYC 3WTZA 1W5TA 2FBKA 5FO5A 1Z6TA 4CXFA 1G3SA 4A6EA 1STZA 3IRRA 2XV4S 4P55A 2ISZA 2HS5A 3TKYA 4A0ZA 4I0BA 5DCMA 5E8IA 1XB4A 3R6SA 2C6YA 5F64A 3WTTC 3HSFA 5HLIA 4WCGA 2O61A 3MWMA 1T6SA 2M30A 4KT5C 3LWFA 2LKPA 3F8FA 2PJPA 3KLOA 5LGTA 1ZREA 3O6BB 2CWEA 1MGTA 3V4GA 5E8GA 1H0MA 3BJOA 1IRGA 3DV8A 3R0JA 3BZ6A 1I5ZA 5HLHA 1R00A 1F4KA 1QBJA 3IKVA 5HVQC 5JI6A 2RNJA 4WWCA 2CW0F 4KMFA 1LQ1A 2V1XA 2ACJA 2HTJA 2V1DA 1YS7A 2W84A 3N97A 3DKWA 2Q8KA 4F7ZA 2ISYA 1OMIA 2OQGA 2XGXA 3L7WA 3GXOA 1ZYRF 3EYYA 4UUVA 2DK8A 3VB2A 2FA5A 2VE9A 4LG0B 1ZN2A 5BPDA 3GWZA 1YG2A 1O3TA 2ESHA 1C0WA 2YR2A 4OMYA 5D4RA 4P9FA 2D45A 4P9UA 5JR3A 5LLQA 2D2WA 2JSCA 1XGNA 3VODA 5FD6A 3TO9A 2K7LA 3BOQA 5KK1A 2NRAC 1R5GA 1R23A 4U0WA 1YFHA 1TQIA 3N4MA 2Q2EA 4LMYA 4KIBA 1E17A 4ZYHA 1IXSB 5CVVA 1B6AA 3CUQC 2CO5A 5ICGA 5L3CA 2DQRA 1MDMA 1W5SA 1XGSA 2ZCWA 4PGHA 3GEZA 2M8EA 3ULQB 1P92A 2STTA 3ZQ7A 2AS5F 3HHHA 3I59A 3JAMK 3FHZA 4OU0A 4BHPA 4ZZLA 4RS8A 3KP2A 4B8XA 3LA3A 4Y13A 2WWYA 3WTSC 3VOEA 3Q9SA 4CGZA 2CQKA 4I02A 3WGGA 2PN6A 2B0LA 2QENA 3RYPA 2R7FA 3V8JA 4MHGA 1R1UA 2UXNA 4M73A 1TBXA 4BNCA 1T38A 1IN4A 5L3EA 2DQLA 3V8LA 2EV5A 1RIOH 2R7DA 4BAYA 2FRHA 4BHBA 3MFKA 2RGVA 1K7AA 4HW0A 4ENNA 5ICEA 3SZPA 2ZNZA 3KZYA 4BYYA 1YTYA 4XLPF 1IF1A 3WGIA 1HKSA 1EH8A 4BXUA 1HXDA 2OU2A 2XKPA 5LRSA 1W7PD 4RGUA 4XBFA 5E18F 3P9CA 4JK1X 3F22A 1FYLA 1P4WA 3K9TA 3GUDA 4RB2C 4EM1A 1KA8A 1LEAA 5D5WB 3F8MA 1FYKA 3G3ZA 1HW5A 3LA2A 4NHJA 1JHHA 1JGSA 3OOPA 1E2XA 2MA3A 2HEOA 1K78B 3BPXA 2GA1A 2FOKA 1EV7A 4I0AA 4ZYEA 5H6RA 2BE5F 3R60A 1BIAA 2J5PA 1IN8A 3F8BA 1H9GA 3L00A 1FT9A 4B09A 1KQ0A 3MEXA 3EETA 4RGSA 3E6BA 2A68F 4I7HA 2RVCA 1IXRC 3M7GA 2P7CB 1ZGJA 2W24A 4WXHA 1MZBA 2IRFG 1XCBA 4UVCA 4Z2YA 5LEKA 3WTXC 2A61A 4N9HA 4RGXA 4EJVA 2HKOA 1Z91A 3IHUA 3U2RA 4YFNF 4R8HA 2HQNA 1ONVA 3EUHA 5LGUA 2CFXA 4YFXF 1YW7A 3C18A 3I54A 3TOAA 2Z99A 4S04A 5DD4A 1LJ9A 1AOYA 2VBZA 4D0PA 2HOEA 1RUOA 4A12A 1LNWA 3ZP5A 5HDKA 4MGRA 2UWMA 1D8JA 3K1NA 2X4HA 1ZHFA 3EYIA 5K1YA 4XLNF 4CDGA 3F72A 5L3DA 5CVIA 2P4WA 1FSEA 3E6DA 2VE8A 2LNBA 2L54A 2V6CA 3BP8A 5DCFA 5CYVA 3RTRA 4L18B 2CSOA 1O3RA 1B59A 1D8KA 2Z9OA 3GZ6A 3S2WA 3TO7A 1SFXA 1G3YA 4RAYA 4OIPF 2VOPA 2A69F 5A2QK 2NAZA 4LLGF 2VBYA 2PLYA 1FYMA 1ZG3A 4BH9A 2FSWA 2YPRA 1IN5A 3GYHX 2A5YB 3FX3A 1WRJA 4LGWA 4RB3C 2KIMA 2E1NA 3PFIA 1AWCA 3FWEA 1ZG1A 2RQPA 3M9AA 4WXDA 1U3EM 3BY6A 2QM3A 2QWWA 2FE3A 4O6JA 2IT0A 3GZ5A 1UB9A 2ESNA 1TLHB 1F5TA 1XDSA 2O0YA 3GFLA 2DFIA 3KZZA 3C3WA 3MCZA 5IT3A 2X0LA 4EQQA 1USTA 2XAFA 2MH9A 1WWXA 3GW2A 5E1XA 1WSUA 1QZZA 3GFJA 1MJBA 4M9ZA 2HYFA 1BI0A 1UCRA 2K27A 6PAXA 3Q5FA 2EB7A 5DDGA 5D5XB 3C1DA 1V3FA 2PBIA 3KFWX 2GWRA 3RKWA 4YFKF 1P2FA 2YX4A 5LRRA 3T8TA 1SMTA 4M6YA 1GHCA 2A3SA 4IJAA 3IC7A 4U7DA 4EM0B 3I53A 5CJ9A 1DP7P 4CZZA 1SFUA 4WXCA 3GVAA 1QGPA 5D8KB 3ZMUA 4H0EA 5HS8A 3F21A 4U7BA 3FXQA 1X3UA 2A07F 4HV5A 1O7FA 5DV5A 3FZVA 1GXQA 2YU3A 2CGPA 1MKMA 2P8TA 2XIGA 4RB0A 3BJ6A 5E20A 3E5UA 2FBHA 2WC2A 1YYVA 3FM3A 4U0VA 2P7VB 1GVJA 1KGSA 1U5TB 1P4AA 2DK5A 3WE3A
chains in the Genus database with same CATH superfamily
3BQYA 4U87A 2BW3B 2E34A 5C3EJ 5EF6A 4B47A 3JSPA 1VQMI 4HQEA 2Z5UA 4U88A 3S93A 2JA6J 1MJ9A 3HOYJ 4AYBA 4PJMA 4II2A 3DBLB 1OYYA 2IJLA 3G71I 2DTZA 1BC7C 1O57A 4Q47A 4PJLA 2G7UA 2BGCA 4WX9A 3X2QH 2ID6A 1HBXG 1WCMJ 3S1QJ 4ESBA 2R7TA 3BCBA 3L2UA 1FY7A 1B72B 2ZKZA 5GTHC 4KNYA 1ULYA 3WHBA 3KP5A 1IRFA 4B43A 4HSTA 4CCMA 4IXAA 1FOWA 4N9IA 4YG2F 5LD2C 1MBGA 2VOOA 5FLXK 3L1PA 1Z3XA 1BN5A 2H8RA 3U9GA 2RAEA 2DFEA 4IQJA 1MSEC 2QZ8A 1EA3A 3MZYA 2QKLB 3CC2I 3F6VA 1E3OC 1ZRFA 2VLAA 2RKHA 2DU9A 2UUZA 4QTRA 1FBQA 3FHNA 1VNDA 2O7OA 4KDPA 3U1KA 5M5WJ 2OV7A 3LAPA 2KPMA 3B6AA 3OSFA 2WADA 2EZHA 4ASNA 5TRDA 4FHTA 2GAUA 1MIJA 4V19K 4UV8A 2V9VA 2K4JA 1U6GA 1K61A 3MKYB 2LSOA 2IEKA 3J7AO 3V7CA 3WG7H 2LREA 4BGDA 1N25A 2ME0A 5TJJA 1CF7A 3ABLH 1SVMA 2P0WA 4A3IJ 1OR7C 1FOKA 4XOPA 3KEOA 1XX5A 2FMLA 5IOZA 3CO6C 1JKOC 5FRNA 1NTCA 1IC8A 2Y0SA 2AQEA 2HVRA 4BUPA 4I98B 3R0AA 1IN6A 2DTRA 4BE0A 2ELJA 4HF0A 3FM5A 2HI3A 3J7YJ 2H8WA 2GA2A 4E7JA 5E1ZB 4CSWA 3DLLF 3L09A 3HGYA 2L3DA 2JJ7A 2EH3A 2PEXA 2ZB9A 4HA8A 1JKPC 5BPIA 2CFOA 2XKOA 3BR1A 4DQ2A 3K0LA 3K10A 1IG7A 1K4SA 5EYRA 3O3KA 2FNPA 3VYUB 2VJ4A 2DODA 4BHCA 2OA4A 1MBKA 1ZR2A 1I27A 2UXXA 1Z0XA 2W7NA 3PNTA 4E7HA 1W1WE 3F8CA 3WG9A 3HGGA 1SAXA 1G4DA 4O3MA 3G1OA 2R3SA 3KP6A 3OIQA 3DXJF 4M71A 2LF8A 1TWAJ 3Q9VA 2DO7A 3JAMZ 5DTDA 3K2ZA 3H3VK 2FMYA 2RNGA 5HLTA 4XNFA 1ZGAA 4EMSA 3BT9A 2O03A 5HDNA 4IO9F 3MKLA 4ZTJA 1WH7A 1D0ZA 3A02A 3BWGA 3LNQA 3KYLA 4GGGA 2QQ8A 5HS7A 3CP8A 2E1CA 4HEA2 1ZAOA 3DFGA 2ZMEA 1WJEA 3ML6A 4KUMA 3FISA 1CQTA 5H6QA 1TWGJ 5FFZA 1FTTA 1R58A 3ABKH 2HNHA 2R0QC 1T39A 4IOAF 4CYDA 5DCMB 4MO7A 1KU9A 1LB2A 2QKMB 1RRJA 1FPQA 2H6CA 4DBQA 1KQ9A 5JVGF 3PM1A 1WJ5A 5D6FA 3SQNA 2IW5A 5LGNA 3CZ6A 3I56I 3AL0B 5DUIA 2GIZA 1MJAA 4KN4X 1BW6A 3L2RA 1A36A 2GLOA 2AXLA 3OV8A 4IPAA 1GXPA 2O8KA 2HU9A 5AIPA 4ZYGA 1U8BA 2BZTA 1XMKA 2KMUA 4FX0A 2R7OA 3D5RC 2BXZA 4WK8F 1RESA 3BJAA 1H9TA 1APLC 1R36A 4LB5A 2ECBA 3BG6A 5ICFA 2OCCH 1FTZA 1FLIA 1Y1VJ 3SHFA 4EV0A 1G59A 2VT3A 2GBYA 2NNNA 3IV5A 3SZGA 4HYEA 2OD5A 3HXLA 2IPQX 2KIQA 5FLVA 4ZDOA 1W4MA 1XDUA 3ZN1A 5GAHJ 1FBSA 4UUTA 4AYBN 2FQ3A 1DGRM 1AHDP 3H3UA 3HM5A 2M1BA 2QF7A 3GO5A 1A6IA 3ZMZA 2EZKA 3ISPA 1QHGA 2AXTC 1PP8F 3KX2A 2E2HJ 1IV6A 1FZPB 5ILVA 3D0SA 4A3DJ 3OY9A 3Q0WA 4Q5SF 1LDDA 2QYOA 5GP9A 5F1RA 2QSHX 1D5VA 3CLQA 4DBRA 2EK5A 1RR7A 1W7PA 2L7FP 4D7MA 2VIXA 4LFUA 4L5IA 5F08A 3CCQI 2H6BA 4PZJA 3LL7A 2P6SA 1RKWA 2XB5A 4BDYA 3BZCA 2LVSA 1DU6A 4NC6A 2COMA 1X1PA 1G3WA 5L3GA 5K5QA 4C2TA 2ZJ2A 4RM2A 3W3CA 3I5UA 2CRGA 3SXYA 1O3SA 5B1BH 3CJQB 5KNLA 2QSGX 5GPAA 4MNUA 1QPMA 1UHMA 3I3LA 5K5OA 3FKIJ 3ECOA 1BIBA 4WF2A 5D4SA 4BQNA 4JYKA 3HOVJ 2ZXJA 5HLGA 4F55A 1I1GA 5FKKA 4KN7X 4G6DA 3GZNB 4XRSA 1UHWA 3E5QA 1JJ6C 4A5NA 1UMQA 3I0TA 2EZLA 3BPVA 1O4XA 1EH7A 3HYIA 3PO2J 2DLLA 1MNDA 4AM3A 2JZYA 4RM3A 3J81K 2VN2A 5E1WA 2UZKA 4G7ZF 2BHZA 3K70D 2EV0A 3DLAA 4ZDPA 1D1AA 4HSRA 4ITVA 3S2DJ 4HOBA 2LDUA 2CS3A 2W57A 1RI7A 3V7RA 4F52A 4LLLA 1PUFB 1IAWA 1V5EA 2VQCA 4Z6YA 2E1MB 2Y0SN 1QRYA 4UY8I 1XPXA 2QQBA 3C2BA 2DOAA 2BY2A 3HUGA 1ETOA 1XN7A 1YHQI 3CMEI 2OAZA 3MQ0A 4PSXA 3KLNA 2XRNA 3S3MA 4KIGA 2JPBA 1FWZA 1K6OA 2CUEA 3ZCOA 2JA8J 3OYGA 1IUFA 1OQYA 3BR2A 4HPQA 3HIFA 3T0YA 3W6JB 2E36A 4IQ4A 5LEJA 3OYNA 4E7IA 1ZG5A 2PMZN 1J0RA 1MDMB 2A6EF 2QGUA 3E6MA 4AIKA 1HKQA 2ZMEB 1MNMC 2H09A 2V79A 4XSXF 3KYDB 3HOUJ 1R4NB 1IZ1A 4EGYA 2G7HA 2JSPA 5EJCA 3DPUA 5J1UA 3MKZA 4NB5A 2FXAA 5C4XJ 3JW4A 1FX7A 3NEUA 1X3ZB 1SFKA 2VKEA 2ID3A 4XK4A 2K4BA 4HAMA 5CLSA 4CUGA 5ILSA 3LSRA 3GFMA 2Y48A 3I59B 1I3QJ 3R4KA 3G1LA 3JRGA 1V55H 2HOAA 1X1CA 2M0MA 4GYGA 4P5OA 3RKXA 1VQNI 1ERDA 3DTIA 3F8NA 1WPKA 4XR6A 3P5JA 1GDTA 1HDPA 1OCCH 3DBHB 2DPUA 4G7OF 1YITI 2HTSA 1OCOH 5HOOA 3OR2C 3QWLA 2P5LC 1B1BA 1YJNI 3TL4X 3HTSB 3JRCA 1D1CA 1OPCA 3SFIA 1R1TA 1T56A 5CKTA 3K1MA 4A6DA 2W00A 2F5CA 2HZTA 5J6XA 1REPC 2GXAA 1PJRA 2YS9A 1LEBA 3RKQA 1ZELA 2OCEA 2HXIA 2LKXA 4II3A 4CCKA 1BI1A 3VSKA 2ECCA 1RR8C 3T8RA 1W5CC 3JR9A 3E7LA 3EDPA 5F0CA 4KITB 5FGMA 5DUKA 3WTWC 1P6RA 1J9IA 1R5HA 2BHYA 3ZPLA 2FBIA 2QA4I 1TWFJ 4ENJA 5J4VA 5EEGA 1FJLA 5BQTA 3IWZA 3I4PA 4IVNA 2R7ZJ 3E3VA 4HX7A 2BVMA 1QVUA 3NQOA 1G6NA 5BS6A 5J4YA 1VZ0A 4MTDA 1U9NA 2CQQA 1SVOA 1W7PB 1J5YA 3ZOBA 5A2QZ 1A04A 1PVEA 2QQAA 3BTJA 1Y39A 2BBYA 3BTLA 1FIPA 3GTPJ 2CQXA 4IX7A 4AIJA 5JVTA 4HLYA 2LFBA 4FQGA 3FBNB 2MC4A 1Z1DA 2V1NA 3MMYB 4E7SA 4UVBA 4FX4A 1Y56A 1KQ8A 2D5VA 5K7ZA 3JRHA 5HNFA 4FT8A 2L9RA 2O6GE 3IKTA 4JOMA 3CMMA 1N77A 5CVRA 2QBYA 2A6HF 1TTYA 2LC2A 2Z3YA 3FXOA 3QPHA 1SD6A 4C3HJ 1YO5C 3GTQJ 2PG4A 2STWA 3K69A 2MH2A 5F27A 2DA7A 2CYYA 4V2GA 2E5ZA 1D0XA 1WKMA 3ABUA 3CMYA 2VQLA 1LFPA 1J2XA 3E97A 4Y4RA 3ZMDA 4DYRA 2JK3A 4L9TA 3DTKA 4IZZA 1EH6A 3FXMA 2M87A 1S7EA 1Z7LA 4H4KC 3FF5A 2DT5A 4GFBA 3I4NJ 3J80Z 2GIVA 2R7VA 2HPIA 2V6EA 3TQNA 3HG9A 1IW7F 1N78A 4ZC3A 5IT9K 1WJCA 5C44J 4M6XA 5EEAA 2ZBKA 1WI3A 2Z33A 4XORA 3IH2A 3OS0A 4BY7J 3O8HA 2K02A 4JQFA 2EA4A 4OIRF 3S3OA 1K83J 2W82A 1ZRDA 2VC1A 3RYRA 1MMSA 2KZVA 4KMUX 1UG2A 3VDXA 3F3XA 1ZGWA 4HQMA 2LF7A 3BTIA 4M6VA 1T98A 4R1HA 1XSXA 3QU3A 1WQ2A 3SFZA 2F4IA 3QOPA 4OAYA 4AIDA 2WV1A 5B3SH 1ZK8A 3BR6A 2KIFA 4PCQA 4JX5A 2M0CA 5HS9A 4KISA 4RDUA 1S7OA 3J80K 3RI4A 3Q3SA 4UNOA 4N0BA 4L5EA 1R9TJ 3BLYA 4FE7A 2K86A 3GTGJ 2KLOA 1G3TA 4XQFA 4D1QA 3OYAA 4L9JA 3F6OA 1Z9CA 2EIKH 3HPHA 2MD5A 4FCYA 5J40A 1HSJA 1YIJI 5FB2A 3ZRGA 1OR7A 3C2GA 1UELB 4IHSA 3KCCA 2ZFWA 1NHAA 2HFHA 1LPQA 4F93B 3GMEA 2XGDA 1I1SA 5LHIA 4UVAA 1XSVA 3DQVC 4YIFA 3D5LA 4DJAA 2XDVA 4DW6A 3JTGA 4RAGA 3D5SC 4G9YA 2E35A 2GXGA 3TDZC 1PUEE 1P7IA 1TT5B 3GBGA 5GAEJ 5D5UB 2KKOA 1S8NA 2CUJA 1F1ZA 4I2OA 3RZDJ 4GCVA 4UB8C 3MKWB 1MBFA 5EEHA 3JSOA 3FXLA 1X2MA 3HBLA 2XAQA 3SDGA 2Y69H 3VYRB 3I4MJ 4QPQA 3S3NA 1QO0D 1MD0A 3FMSA 5FKNA 3AAFA 3LSTA 3PQKA 2PI0A 2K9LA 2KJCA 4PDKA 1SVLA 3K1PA 3QP5A 5DD8A 5LFAA 3FK6A 2DA1A 1TQPA 2F5EA 3B02A 5D6EA 3S1NJ 4F91B 2MLKA 1BR1A 3NARA 3CJNA 1TQMA 3OYIA 1LE8B 1PYVA 1AKHA 1XMAA 2VODA 1I50J 2EJRA 4F3QA 3S1MJ 4A0XA 3GX4X 2DOEA 3PUBA 3ZR8X 5HDGA 2CH0A 3VEPA 4RB1A 2ZNYA 2PMHA 4FETA 2X1EA 3LFUA 2EFNA 3CUQA 4PJ0C 4HBLA 1U8RA 4S05A 5J8FA 4RBOA 1GVDA 2WTEA 4P96A 2WV0A 1K79A 2M3AA 2QSFX 4Y3OA 2DDAA 5LHHA 1KYZA 3U1DA 5E17F 1OISA 1DP3A 2COBA 3DTEA 1XCVA 3HRUA 3ROUA 4ESFA 3CCYA 1Y8QB 3OYDA 4CICA 4BXXJ 3K7AJ 2JTVA 2YSRA 3ZN0A 1L0OC 2NVYJ 1LFUP 3HEFA 2WA0A 4HNTA 2QBYB 2IS1A 3JRDA 3TW6A 4CZCA 2QQ9A 1Y1WJ 5FFXA 5EG0B 2R7UA 2CUFA 5FD5A 4EM2A 3BROA 4AC0A 3IL2A 2HR3A 2W48A 3F23A 2HDCA 2HDWA 4LD5A 3H5RA 5FLXZ 3JREA 1Q1VA 3W2WA 4ETSA 5D5VB 2GZWA 4ANJA 2MBFA 3LSKA 4G7HF 2R7QA 2DJIA 1YI2I 4LLNA 2M5WA 5H2FC 4W1UA 3NRVA 3OS2A 1I6XA 2G9WA 2KDZA 2K9MA 4XKBA 2RC4A 4IKFA 4G12A 1ON1A 1FSHA 1ZARA 3DU5A 2BYVE 1GT0C 3ZQLA 1UZCA 2VL8A 2ZSIB 4XIDA 4M3DA 2EFWA 4M9SA 5ED4A 3HZJA 1ON2A 3OYBA 3S8PA 3L2CA 2IA2A 4Q4ZF 4YRVA 3QYFA 4MEXF 1U5TC 2OZUA 3G73A 4UHTA 2JT1A 4NC8A 1YIOA 4L9NA 5J1RA 2IXSA 4PFPA 2DA5A 2PJRA 4PJJA 3FBIB 1ZKGA 4HV6A 2L4AA 1FC3A 4A3KJ 2OF7A 3FK7A 4AIHA 1YJ9I 3WGHA 1VQ6I 4JX6A 3ZGKA 3LSPA 3RZOJ 1XD7A 3ECHA 3O2PE 3BZKA 2Z1DA 3GFIA 3GTKJ 3B73A 4PGGA 1HA8A 1TL8A 2QVOA 3HOTA 4DOZA 4I99C 1HDDC 2IA1A 1NG7A 1Z6RA 2X51A 1GLNA 5CVJA 5J8CA 1F9NA 1LDKB 3LQRA 2DA3A 1W36C 3J7AY 2CU7A 4DNCA 2EA2A 4M3GA 2FU4A 5E3MA 2PMUA 2VI6A 1BM9A 2IS2A 4GYIA 4DGWB 4I09A 2NS0A 3K4CA 2KT0A 3HHGA 4ZYAA 4KYWA 2KJBA 3PQJA 1V54H 2WBMA 2O5RA 2KRCA 4BJ6C 2OZ6A 2BVLA 4D7NA 1TT0A 3TOBA 3ZQQA 3VYTB 2K3PA 2RV8A 2IS6A 1WJBA 2L7ZA 3P9KA 3RSNA 3GF2A 2JA7J 2DW4A 1S7AA 3PIOF 1YW8A 2F2EA 1BBYA 1SD7A 2WAEA 3QU6A 1R1VA 2BY3A 5JHFA 1ETVA 2LBFB 2PMZA 5F0FA 2W25A 1JE8A 1AKHB 4HLXA 1I39A 2LR8A 2XSJC 1MBEA 5K5RA 1J75A 2M7BA 1V4RA 1QZYA 3RDIA 1TNTA 1MMDA 4EJOA 4OINF 3WE2A 4PK4A 4E7ZA 5IYBJ 4HDVA 3K4NA 2HKXA 1B8IA 2DCEA 1T08B 3CUQB 3CCVI 1D3YA 2J5OA 3RPUA 1JUMA 4XN0A 2VQHA 4R79A 4Y7NJ 2ZSHB 3HKZA 5FKOA 1DPRA 1WI9A 4LK0F 2HQRA 1U78A 4QWQA 1X19A 2VXZA 4XRSG 2XGCA 3HOWJ 2H1LA 3NAUA 4I6ZA 2EILH 2YX7A 2WY8Q 3H35A 2WY7Q 1KU7A 2CG4A 5BOXA 1KYWA 2Z16A 3FMQA 3PNYA 4EGZA 2R4GA 3DU6A 4YEJA 5L3BA 5JLWA 3A1YA 3RPUD 5HNHA 2JMWA 4BXFA 1U2WA 3B6CA 2L9VA 4LB6B 4D5CA 3TDUC 2E7WA 4AWXB 1UFMA 1K78A 3RJPA 4Y17A 3E1SA 1LKXA 2ZFUA 1UG0A 4RLQA 2VKDA 4BBSJ 3HRSA 4KICA 4AVZA 3OWTA 1ZLJA 1JJ8C 3JRBA 4CCOA 2GOXB 3OMYA 4XICA 4EVIA 4A3EJ 4ZH4F 4M74A 1T0FC 5DS9A 4BQAA 3P7NA 1TP4A 4XKCA 1VTNC 1JI8A 2OQRA 3W2VA 3HC7A 2EFQA 1OCRH 1SD4A 1WVRA 2XAJA 2XC7A 4HF1A 2FD5A 3EQLF 1A5JA 2ZJRF 1MW7A 1NG6A 1XTAA 4AD9A 4MEYF 5CVUA 2FEZA 4NNJA 1A31A 1ZH5A 1QHHD 2EFPA 2NVXJ 4LG3A 4LK1F 1HF0A 1JT0A 1D1BA 4IHYA 2PJRB 2WAFA 1Z05A 4EJWA 3P9IA 2R5YA 2HYGD 3MZHA 1A6QA 1B9MA 2EIJH 1QVTA 2E7XA 2HVSA 1JHFA 1E0EA 2Y2ZA 5BMZA 2GQQA 2PQ8A 1QQIA 3K4JA 5CPRB 1KU3A 1ODDA 5JHUA 2XROA 2M45A 5H20A 1BOAA 2HPMA 2Y75A 5DEQA 4M9XA 3IRQA 1S72I 4OIOF 1FP1D 4BEHA 1WJDA 2IP2A 3J81Z 5M3MJ 1H89C 2GXBA 3F9KA 1OYWA 3L9FA 2W1OA 4IRGA 4O5VA 4F92B 1MMGA 3DPLC 2XSDC 1RUNA 3V8KA 2B63J 1JXSA 3MVPA 2TCTA 5ERIA 5KAIC 2FUG2 4FTHA 1CF7B 3OYHA 3QODA 2DI3A 2I8DA 3CDHA 4IRIA 3HRMA 2LH9A 3DP7A 3GTMJ 4XL9A 5F0HA 3IWFA 1IRZA 1HKTA 1BC8C 1R49A 4LJZF 2Y0MA 1TW3A 2HGCA 2UV1A 3T5XA 2QLZA 5JFRA 4IHTA 2HQ5A 1HW2A 2R7WA 1S3JA 3O8GA 2ETHA 2M2EA 3RKYA 1RETA 4X0GA 3K2AA 2DA2A 4A3JJ 4JBAA 4PSWA 5ILUA 4HRIA 3BQZA 2R93J 2VC0A 1O3QA 3LA7A 4JX4A 4ZZDA 1G8XA 2HOSA 4A69C 1RNLA 1QU3A 2MGQA 1GV2A 3BR0A 1IJWC 5HODA 2CV2A 4ENKA 1DDNA 1TNSA 4RGRA 4B4CA 4XN3A 3ELKA 1B8IB 1ETKA 3H36A 3ERED 4IHXA 3WTVC 3KP3A 4QLCU 1YS6A 1BJAA 2IGMA 2DMTA 1DQUA 2VASA 3PNVA 3QQAA 4PJNA 3KE2A 1YJWI 3I58A 3ONQA 2JA5J 4XLCA 2RDPA 2BEOA 3EPZA 2IA0A 1Y6IA 5ICCA 1R71A 1NH3A 2Q0OA 4BS9A 3DPTA 4K2EA 2LD5A 1L3LA 1FBUA 2LY9A 1OYIA 3K4MA 1VQOI 4J19A 1KU2A 2XGEA 2BY1A 4RAZA 4KFCA 3GTLJ 2TDXA 2JRTA 4CHUA 4BQQA 1J59A 2LYCA 2O8XA 4A2UA 3C7JA 4BE2A 4EJTA 3J7ZI 4AUXA 2X9DA 3M8EA 4XLFA 1J7KA 2KRFA 2EV6A 1RZ4A 3GLXA 1PP7U 3HKZN 4EJUA 2VBWA 3WTUC 3BR5A 1IXCA 3S14J 3CO7C 3E5XA 3HRTA 5TGTA 5J3LA 1YX3A 1HQCA 3COAC 5LHGA 1X3WB 2JUGA 2VT2A 4G94A 2F5DA 4M3EA 4ON0A 1BW5A 4HNUA 1Y0UA 1RPWA 2OTLI 1MNEA 3HSEA 1S6LA 3OYJA 2R7RA 2JPCA 1IV8A 4ZDLA 1YLFA 4AVPA 1SMYF 4ABZA 2RREA 2Y30A 3CC7I 2XRLA 3K4BA 4GRIA 1SD5A 2FF4A 1MBJA 1VQ5I 3H5AA 2ZMEC 3WU0A 3TP0A 4A93J 4ENMA 2K9SA 2P5KA 2K9NA 2P5VA 5E3OA 4IL6C 1ZLKA 3BR3A 3G4SI 1JUSA 3LMMA 4BE1A 3TBIA 3GLLA 4G6QA 1FNNA 1HSTA 4HX4A 3TW7A 4FASD 4CYCA 1YX5A 3DF8A 1IGNA 3FXUA 3A01A 2FNAA 3FKJA 3REOA 2CJJA 1F43A 2R5YB 1CGPA 1X1AA 2DAOA 2XB0X 4HX8A 1HC8A 3UR3C 2XVCA 4M72A 1IN7A 3SJMA 4MQ9F 3HSRA 2CUZA 3CCLI 3ZMSA 5AONA 1R7JA 2NOGA 3CTAA 4BKXA 1PDNC 3RPQA 4C2MJ 2ELHA 1JKRC 2MC3A 5KCMA 3RCOA 3AKZA 3CF5F 3HB9A 5K7FA 2BV6A 4B48A 2M9HA 3H3ZA 3FXJA 5GADJ 1GUUA 4HZFA 3QAHA 4OOIA 3TMOA 2IGKA 3IAS2 4E70A 4L0ZB 2L2OA 4MTEA 1AA7A 2EWNA 3W6KB 4IF4A 3I71A 4CO8A 3BG7A 2LOOA 2DXIA 1HW1A 2F4OB 3H92A 4MIMA 4KT6A 5IT9Z 2P6TA 2F4MB 3T1BA 3E6CC 5E79C 2L02A 2GOMA 3H9JA 2L4MA 1R5ID 4G8XA 4Q48A 4NQWA 2ZJQF 1T2KA 3ABTA 3OSGA 3KP7A 2DBBA 1K6YA 1XGOA 2DMPA 2XAHA 4E4HA 3HOXJ 3M3YJ 4IHVA 3M4OJ 2NYXA 3FXRA 3KEQA 4A5MA 3FIWA 2D1VA 3ERMA 4L9VA 1YRNA 5D8LB 3LFKA 3A03A 1IUYA 1ZQ3P 4NDLA 4GO1A 4A0YA 1DPUA 4OIQF 1Q1HA 2W85A 1FOXA 2IGNA 1EF4A 2NVUB 1ETWA 1S29A 4MQVA 3JRIA 2LLKA 2JWTA 2KDOA 3LQQA 1ZRCA 1HCRA 3KETA 2H94A 2MG4A 3CCRI 2VUMJ 3OYMA 2CQNA 2L5QA 4M3BA 1U5TA 3ZMVA 3HUGB 5IP6A 2VJJA 1USSA 2V4JC 3QOEA 1WZ2A 1SFEA 3LAJA 1BI3A 1O7LA 3KP4A 3KEYA 3KZIC 5B5EC 2XHKA 3CUOA 3MAJA 3HOSA 4J00A 3AG4H 2HWVA 2PX9A 2OUMA 2ZO4A 4DIQA 5EGOA 1VQ7I 3VPRA 5LBQA 4ZJZA 2VQGA 2QUFA 1B4AA 4L0YB 2LP0A 2X85A 4A3CJ 3K4KA 3RIRA 2FOWA 3SEQA 3SZTA 1F36A 1XG1A 2MLGA 2L9NA 4B44A 5J1YA 3KYCB 2XASA 3QRFF 1H8AC 1K4TA 3V7SA 4ZYDA 3FMRA 5CQEA 1DUXC 1Z7UA 2JVGA 3CCMI 3M1EA 4TV7A 1ITYA 3DEUA 4UXNA 3PUFA 2H27A 1P9QC 2GM4A 2ZXWH 3I64A 2F5FA 2CQ7A 5GPCA 1XSDA 4IHWA 2EINH 5IOYA 2E2IJ 2VBXA 2WB1A 4U0YA 3NWSA 3N05A 2XUBA 4PFOA 2NNYA 3A0BC 4HDUA 2O3FA 1LVAA 1DU0A 2MW8A 4A3BJ 3CLOA 4LIVA 1W36D 2HOTA 1YQAA 3TEDA 2YU9J 2IVMA 5E3LA 4HF2A 1D0YA 1GV5A 2EFOA 2M4KA 2VPRA 3AG2H 3VSLA 3R61A 3ZMTA 2X1CA 1LDJA 1POGA 4UV9A 3TGNA 1YW9A 3FDYA 1X1BA 2OBPA 4BJTA 4I01A 1P4XA 1WGXA 4L5JA 3JTHA 2OJED 4ESJA 2NOJB 4ZTFA 4YIIA 5IPAA 1R22A 3H0DA 3IP4B 2F6CA 5F6FA 3OIPA 3CDLA 1UHSA 2PFBA 4S0HB 1HOMA 2ZJPF 2OTJI 3H9QA 3W6VA 1QNTA 3NWTA 4LG0A 5L3FA 4XRFA 3GTJJ 2KIUA 1BOBA 4XM3A 2JQ7A 2B9SA 2M8GX 1I6HJ 3PJRA 1Z3YA 1BI2A 3LSIA 4XSZF 1U0JA 5IP7J 3EUHC 1FOYA 1TW2A 2L01A 3WODF 2V1UA 2B7EA 5DYMA 3PSFA 4IRHA 2D1HA 4Y15A 3OYKA 2DOFA 2MFZA 3QPTA 1W0TA 3QP6A 3QPLA 1FP2A 5AIQA 3JRAA 5M5XJ 2V9PA 5KVRA 3HTUA 3WU1B 5IYDJ 2KHMA 4KA4A 2XAGA 1VQKI 2RN7A 4GXOA 2AO9A 4OMZA 2E5NA 4BL0B 2E2JJ 2NS8A 1B9NA 4KIFA 4CCJA 2LKSA 3JRFA 4XMYA 2VONA 1ORKA 3M8FA 4KJZA 1T0FA 2ADUA 3VFZA 2KFDA 1VQ8I 2DPDA 1XGMA 2DN0A 3TO6A 3BDDA 4RMNA 1OKRA 4BQOA 3WTZA 3WTYC 1W5TA 3HL2A 2FBKA 5FO5A 3ZQCA 5M3FJ 3WU2C 3CD6I 4JP0A 1Z6TA 4XONA 4CXFA 3C2HA 4XKWA 1G3SA 3HJEA 4A6EA 3RQIA 1STZA 3IRRA 2XV4S 4P55A 2ISZA 4B3AA 2JA2A 2HS5A 2FQ4A 3TKYA 4A0ZA 4I0BA 5DCMA 5E8IA 1RC9A 3G6EI 1XB4A 3M1CA 4P1WA 2YUSA 3R6SA 2C6YA 5F64A 3WTTC 2X6YA 4NC7A 5EGOB 4UUSA 2X6WA 1QA6A 4IOCF 2VKVA 2K9QA 3HSFA 5HLIA 4WCGA 1FMWA 2X6OA 2O61A 3MWMA 4DZJA 1T6SA 2M30A 4KT5C 3LWFA 2E71A 4OWRB 2LKPA 2VPLA 3F8FA 2PJPA 3L2VA 3KLOA 5LGTA 1ZREA 1MH3A 5GAGJ 3O6BB 3BCAA 2CWEA 2KP6A 1JTXA 1MGTA 1TZLA 3V4GA 3ZXSA 1DGWY 5E8GA 1H0MA 3BJOA 2WAQA 4MFDA 1IRGA 4A3GJ 5FKLA 3DV8A 3W2AA 3R0JA 3LSMA 3IUOA 3BZ6A 2LRDA 2A5WA 1I5ZA 3ZQGA 5HLHA 1VQ9I 1R00A 1F4KA 5FKMA 2NVTJ 3H0GJ 4DZPA 1QBJA 3IKVA 5HVQC 1X2NA 1Z67A 2VJ5A 2X6XA 5JI6A 5E3NA 2RNJA 4WWCA 2CW0F 4KMFA 5K7HA 1LQ1A 2ZXIA 2V1XA 2ACJA 2HTJA 2M7AA 2V1DA 1YS7A 2W84A 4IEJA 3N97A 1EJ9A 3DKWA 2Q8KA 4F7ZA 2AQFA 2K3FA 2ISYA 3EUAA 2EQRA 9ANTA 1QPIA 1OMIA 2OQGA 2VXDA 2WB1N 5FLMJ 2XGXA 1NK3P 2HDDA 3L7WA 3GXOA 3CMAI 1ZYRF 1RKTA 3EYYA 5JLXA 4UUVA 4J01A 2DK8A 3VB2A 2XPUA 5IYCJ 2L7KA 1EKEA 3CC4I 1BA5A 2FA5A 2VE9A 4LG0B 1ETYA 1ZN2A 2Z2SB 5BPDA 1ACIA 3HDDA 3VYSB 2LK2A 3V42A 3GWZA 1YG2A 1HLVA 1O3TA 2L0KA 2ESHA 4M3FA 2KISA 1C0WA 4B3XA 4EEFG 2YR2A 3ZQIA 1Y8RB 4OMYA 5D4RA 5GTIC 3CCJI 3M07A 2A6TA 4P9FA 2D45A 4P9UA 3UNGC 5JR3A 5LLQA 2TRTA 3F0CA 4Y52J 3AG3H 1ZR4A 2D2WA 3UKGA 2DDBA 2JSCA 1XGNA 3VODA 2L7MP 5FD6A 3TO9A 2ICWG 1YE9A 2K7LA 2VKHA 3BOQA 3OYCA 5KK1A 1PUFA 2K5CA 3QPSA 1MH4A 3KPHA 5EZGA 1WJFA 3K4LA 2HXOA 2NRAC 1R5GA 1R23A 4U0WA 3H1CA 1YFHA 1TQIA 1S5LC 3ZQHA 3ZQFA 1D5YA 3N4MA 1ETQA 2Q2EA 3JCUC 4LMYA 4KIBA 4RLFA 1E17A 4ZYHA 1IXSB 1R6RA 3ASOH 3S1RJ 3A2KA 5CVVA 1VF9A 1B6AA 3CUQC 2DMQA 4DYCA 2CO5A 5ICGA 5L3CA 5F04A 2DQRA 3OL3A 1MDMA 2X1DA 1W5SA 1XGSA 2ZCWA 2X48A 3DEEA 1MMNA 2IS4A 4PGHA 3GEZA 3H5NA 2M8EA 1SFOJ 1JKQC 4DYQA 3ULQB 1LFBA 1T95A 2HQAA 1G2HA 1P92A 1WJAA 2STTA 3ZQ7A 2L9SA 2AS5F 4UUSB 2FX0A 2DA6A 3HHHA 1W0UA 3I59A 3JAMK 1IRXA 1M1EB 1Z77A 3FHZA 2NVQJ 4OU0A 1N75A 5FJ8J 4BHPA 1OJLA 4ZZLA 4XLEA 4RS8A 1LVKA 4W97A 2E1OA 3KP2A 4B8XA 3S15J 3LA3A 1X4OA 3ABMH 4Y13A 4FE4A 2WWYA 2DMUA 3WTSC 2M4GA 2V7FA 3VOEA 3Q9SA 2W4SA 4CGZA 2CQKA 4I02A 3WGGA 1I3AA 3AL0C 1QZEA 2PN6A 3I55I 2B0LA 2QENA 3RYPA 5DM7F 2R7FA 3ASNH 3V8JA 4MHGA 4G6TB 1R1UA 2LTPA 2BOLA 4I76A 2UXNA 4M73A 5EZHA 2R7SA 1TBXA 2F5VA 4NBQA 2IAIA 2XPWA 5B1AH 3A0HC 2H1KA 4BNCA 2I10A 1T38A 4AU7A 1IN4A 5L3EA 1A35A 2DQLA 2E19A 3V8LA 2DJNA 1X4PA 2DFFA 2EV5A 3OIOA 1NK2P 1VQ4I 3BC8A 1RIOH 2R7DA 4BAYA 1TWHJ 2K40A 2FRHA 4BHBA 1SEUA 2LG4A 3CQZJ 3MFKA 2RGVA 2WAQN 1K7AA 4HW0A 5CQGA 4ENNA 5ICEA 3ESWB 3SZPA 1WH5A 2ZNZA 3KZYA 4BYYA 1YTYA 2HVQA 3S2HJ 2XF6A 3OYEA 4XLPF 2R5ZA 1OLTA 1OCPA 1IF1A 2DMNA 3WGIA 1HKSA 1EH8A 4BXUA 1HXDA 2OU2A 2XKPA 1ETXA 1W7PD 2JVHA 4RGUA 5TISC 3WHCA 5LRSA 1VFCA 4HNVA 3LOCA 4C3JJ 4XBFA 1TC3C 2XAUA 5E18F 3P9CA 1JTYA 4JK1X 2Y9YA 3BG5A 3H9GA 3F22A 1BR2A 1FYLA 1P4WA 1JT6A 3K9TA 3GUDA 4RB2C 3RQ4A 3L2WA 2CMPA 4EM1A 1OFCX 1KA8A 1LEAA 1P7JA 5D5WB 3F8MA 1BR4A 3GTOJ 3EUKL 4OAZA 2JN6A 1FYKA 3G3ZA 1HW5A 4D9JA 3L2QA 2R92J 3CCEI 3MN2A 3LA2A 2V9KA 2EPFA 1JHHA 4NHJA 3S16J 1JGSA 3OOPA 1FEXA 1E2XA 2MA3A 2VB6A 5J47A 2HEOA 2Q1ZB 1K78B 1VQPI 2DT7B 3BPXA 3AFHA 2IGOA 2GA1A 2FOKA 1EV7A 4I0AA 2Q2EB 2DYRH 3I9V2 4ZYEA 1JUPA 1T8IA 5H6RA 2BE5F 2OC6A 1X1DA 1R4MB 4XLHA 1VQLI 1LUJB 2E1MC 3R60A 3OR1C 3SEZA 3CCSI 1BIAA 2J5PA 1IN8A 3F8BA 1YOVB 1H9GA 1OCTC 2I5UA 5BNGA 3L00A 1FT9A 1AU7A 4NUBA 3OYFA 4B09A 5FRMA 1KQ0A 3MEXA 3EETA 4RGSA 3E6BA 2CW8A 2A68F 4I7HA 2RVCA 1X58A 4N4NB 1IXRC 3M7GA 2P7CB 1ZGJA 3CJRB 2W24A 4WXHA 1MZBA 4YIRX 2IRFG 5KAFC 3HPGA 1MMAA 5C4JJ 1XCBA 3OOUA 4BDZA 4UVCA 4Z2YA 5LEKA 3WTXC 2A61A 4N9HA 4BACA 4RGXA 3QYEA 3OS1A 4EJVA 3DCFA 5F1JA 3KIOA 2HKOA 1Z91A 5DM6F 3A4CA 1TWCJ 2EIMH 2F48A 3IHUA 2M34A 2DA4A 3U2RA 1E3PA 4YFNF 4R8HA 2ZC2A 2HQNA 1ONVA 2ME6A 4E6KG 3EUHA 1KONA 3LSHA 5LGUA 2CFXA 4YFXF 1YW7A 3C18A 2JRMA 3PL8A 1JGGA 5EDNA 3I54A 3TOAA 2Z99A 4BY1J 4S04A 5DD4A 3GCMA 1LJ9A 3CESA 1AOYA 2VBZA 2QCOA 4D0PA 4BEHB 3MD2A 1J09A 3Q0VA 2HOEA 1RUOA 1IDZA 4A12A 1LNWA 3G1MA 3ZP5A 1VI0A 5HDKA 4MGRA 5IP9J 1XS9A 2UWMA 1D8JA 3K1NA 3U21A 1Z21A 2X4HA 1ZHFA 2DYSH 2CW7A 1LE8A 3IH4A 4Y33A 4QPOA 3EYIA 1IO2A 5K1YA 4XLNF 4LITA 4CDGA 1UJ8A 4XRMA 3F72A 3CDIA 3CJTB 5L3DA 5CVIA 2P4WA 1FSEA 3E6DA 2O9LA 2KQRA 2NXNB 2VE8A 2LNBA 2L54A 2V6CA 3PO3J 2IBDA 3BP8A 5DCFA 2R5ZB 2CV1A 3PIPF 5CYVA 3RTRA 4L18B 1ENHA 3DKXA 2CSOA 1S9HA 2Y31A 1O3RA 1B59A 1D8KA 1U9OA 2MYSA 2Z9OA 1OCZH 3GZ6A 2VJIA 3S2WA 4C30A 4A3MJ 4BU2A 3TO7A 1SFXA 1H88C 1G3YA 3CF2A 4N4OB 5KHDA 4RAYA 5EG0A 4OIPF 2FJ1A 2VOPA 1KZHA 3FXKA 4C3IJ 2HZDA 4BBRJ 2A69F 4QSHA 5A2QK 5FROA 4C2UA 1SAUA 2NAZA 3Q0UA 1SC7A 3K70C 2BW3A 4LLGF 2EZIA 4GDFA 1Y0NA 4A3LJ 2VBYA 2PLYA 3BG3A 1FYMA 1FMVA 1ZG3A 4BH9A 2FSWA 2YPRA 1IN5A 4PUSA 3GYHX 2A5YB 2LY1A 3FX3A 4MFEA 1WRJA 1XC5A 3M8JA 1ZTRA 4LGWA 2N8GA 3BTCA 4RB3C 2KIMA 2E1NA 3PFIA 1AWCA 3FWEA 2V26A 3IAM2 3SYTA 2XPVA 4C9YA 1ZG1A 1B72A 2LY2A 2RQPA 3M9AA 1BJZA 4WXDA 1U3EM 3AG1H 1WFXA 3CCUI 3BY6A 5B66C 2QM3A 4CCNA 2QWWA 2KRHA 2CV0A 2FE3A 4O6JA 2IT0A 3GZ5A 2RQQA 4RAFA 2Y9ZA 1UB9A 2MD0A 2AHQA 2ESNA 2E60A 1TLHB 1F5TA 2ZXHA 1XDSA 2O0YA 3GFLA 2DFIA 3KZZA 4FISA 3C3WA 3G2BA 4MLOA 2DFHA 3MCZA 2A05A 5IT3A 2X0LA 3DEWA 3S32A 4EQQA 4X1EA 1USTA 2XAFA 2MH9A 1WWXA 2ELKA 3GW2A 5E1XA 2MSYA 1MSFC 1WSUA 1QZZA 2KL4A 4RA2A 4CYCB 3GFJA 3LSJA 4XKVA 3OL4A 1MJBA 3PSIA 3A01B 3TP3A 4M9ZA 2HYFA 2P81A 4XOTA 1UAAA 2BXYA 3SDBA 1BI0A 1UCRA 2K27A 5M5YJ 6PAXA 3DBRB 1V5GA 3Q5FA 3E0JB 2EB7A 3BG9A 3VWBA 2MABA 1T33A 3MZ8A 5DDGA 2K85A 3IH3A 1XMXA 5D5XB 4E7KA 2JUCA 3C1DA 2XF5A 2NS7A 4QIWN 1V3FA 2PBIA 3PFYA 4YELA 2KZGA 3KFWX 2GWRA 2EBIA 3S17J 4EATA 3RKWA 4UB6C 1MBHA 1E3HA 2G0EA 4CCLA 4YFKF 1IDYA 1P2FA 2YX4A 2LBFA 3DKYA 2OPTA 5LRRA 3D1NI 3T8TA 1SMTA 4M6YA 1WHUA 1GHCA 2A3SA 4IJAA 3IC7A 4D5FA 4U7DA 4CA0A 4NQWB 4EM0B 3I53A 5CJ9A 3DWLE 3OYLA 4E7LA 3QYBA 1DP7P 4CZZA 1SFUA 4WXCA 3GVAA 1QGPA 4BJ5C 4CH7A 3HOZJ 5D8KB 3ZMUA 4H0EA 5HS8A 3F21A 3FXQA 4U7BA 1FIAA 4HG2A 1X3UA 2A07F 4HV5A 1O7FA 5DV5A 3LSGA 2QEXI 3K6GA 1YRNB 3FZVA 2YU3A 1GXQA 2HYJA 4XLAA 2CGPA 1MKMA 2XF7A 2P8TA 2XIGA 4V2FA 4RB0A 3BJ6A 5E20A 3E5UA 2FBHA 4A3FJ 2WC2A 1V5FA 2R7XA 4LIUA 5IY5H 1YYVA 4LOCA 3FM3A 4U0VA 2P7VB 4B1RA 1GVJA 2BY0A 3CP2A 1KGSA 1BL0A 1U5TB 1P4AA 4X6AJ 1SANA 2DK5A 2DT6A 3WE3A 2LMDA
chains in the Genus database with same CATH topology
3JSPA 4HQEA 2Z5UA 4U88A 1MJ9A 1OYYA 2IJLA 1BC7C 1O57A 4Q47A 2G7UA 2BGCA 4WX9A 1HBXG 4ESBA 1FY7A 2ZKZA 4KNYA 1ULYA 3KP5A 1IRFA 4IXAA 2VOOA 4N9IA 4YG2F 5FLXK 1BN5A 3U9GA 2QZ8A 3MZYA 3F6VA 1ZRFA 2RKHA 2DU9A 1FBQA 4KDPA 3LAPA 4ASNA 5TRDA 4FHTA 2GAUA 4UV8A 2V9VA 2K4JA 1U6GA 2LSOA 3J7AO 3V7CA 5TJJA 1CF7A 1FOKA 3KEOA 2FMLA 3CO6C 4I98B 3R0AA 1IN6A 2DTRA 4HF0A 3FM5A 2GA2A 5E1ZB 3L09A 2L3DA 2PEXA 4HA8A 5BPIA 2XKOA 4DQ2A 3K0LA 3O3KA 2FNPA 4BHCA 2OA4A 1I27A 2UXXA 3F8CA 3WG9A 1SAXA 1G4DA 4O3MA 2R3SA 3KP6A 3DXJF 4M71A 2LF8A 3Q9VA 2DO7A 3JAMZ 3K2ZA 2FMYA 1ZGAA 4EMSA 2O03A 5HDNA 3BWGA 4GGGA 5HS7A 2E1CA 1ZAOA 3DFGA 2ZMEA 3ML6A 4KUMA 5H6QA 5FFZA 1R58A 1T39A 4CYDA 5DCMB 1KU9A 1LB2A 1FPQA 2H6CA 1KQ9A 3SQNA 5D6FA 2IW5A 5LGNA 5DUIA 4KN4X 1MJAA 2AXLA 3OV8A 4IPAA 1GXPA 5AIPA 4ZYGA 1XMKA 4FX0A 4WK8F 1H9TA 3BJAA 1R36A 4LB5A 5ICFA 1FLIA 3SHFA 4EV0A 2VT3A 2NNNA 4HYEA 2OD5A 2IPQX 1W4MA 1XDUA 3ZN1A 1FBSA 2FQ3A 3H3UA 2M1BA 3GO5A 3ZMZA 3ISPA 1PP8F 1FZPB 5ILVA 3D0SA 4Q5SF 1LDDA 2QYOA 5F1RA 1D5VA 2EK5A 1W7PA 4LFUA 4L5IA 2H6BA 4PZJA 2P6SA 2COMA 1G3WA 5L3GA 5K5QA 2ZJ2A 3I5UA 3SXYA 1O3SA 4MNUA 1QPMA 1UHMA 5K5OA 4WF2A 3ECOA 1BIBA 5D4SA 2ZXJA 5HLGA 1I1GA 4KN7X 4G6DA 1UHWA 3E5QA 4A5NA 3I0TA 3BPVA 1EH7A 3HYIA 2DLLA 2JZYA 3J81K 2VN2A 5E1WA 2UZKA 4G7ZF 2EV0A 4HOBA 2LDUA 2W57A 3V7RA 1RI7A 1IAWA 4LLLA 2QQBA 3HUGA 1XN7A 2OAZA 3MQ0A 3KLNA 2XRNA 4KIGA 2JPBA 1FWZA 1K6OA 3T0YA 3HIFA 3W6JB 5LEJA 1ZG5A 1J0RA 1MDMB 2A6EF 3E6MA 4AIKA 1HKQA 2ZMEB 2H09A 2V79A 4XSXF 1IZ1A 4EGYA 2G7HA 4NB5A 2FXAA 3JW4A 1FX7A 3NEUA 2K4BA 4HAMA 5CLSA 5ILSA 3GFMA 2Y48A 3I59B 3R4KA 4GYGA 4P5OA 3RKXA 3F8NA 2DPUA 4G7OF 2HTSA 5HOOA 2P5LC 1B1BA 3HTSB 1OPCA 1R1TA 3K1MA 4A6DA 2F5CA 2HZTA 5J6XA 1REPC 1LEBA 1BI1A 3T8RA 3EDPA 5FGMA 5DUKA 3WTWC 1P6RA 1J9IA 1R5HA 3ZPLA 2FBIA 4ENJA 5EEGA 5BQTA 3IWZA 3I4PA 4IVNA 3E3VA 4HX7A 3NQOA 1G6NA 5BS6A 4MTDA 1W7PB 1J5YA 5A2QZ 1A04A 2QQAA 2BBYA 4AIJA 5JVTA 4HLYA 1Z1DA 4UVBA 4FX4A 1KQ8A 4FT8A 2O6GE 3IKTA 5CVRA 2QBYA 2A6HF 1TTYA 3QPHA 2Z3YA 1SD6A 1YO5C 2PG4A 2STWA 3K69A 2MH2A 2CYYA 1WKMA 3ABUA 1J2XA 3E97A 3ZMDA 4L9TA 1EH6A 2M87A 3FF5A 2DT5A 3J80Z 2GIVA 3TQNA 1IW7F 5IT9K 4M6XA 2ZBKA 2Z33A 4JQFA 2K02A 2EA4A 4OIRF 1ZRDA 2VC1A 3RYRA 4KMUX 3F3XA 4HQMA 2LF7A 1T98A 4R1HA 1XSXA 3QU3A 1WQ2A 3SFZA 3QOPA 4PCQA 2KIFA 5HS9A 1S7OA 3J80K 3RI4A 4UNOA 4N0BA 2K86A 1G3TA 4L9JA 3F6OA 1Z9CA 2MD5A 1HSJA 5FB2A 1OR7A 4IHSA 3KCCA 2ZFWA 1NHAA 2HFHA 1I1SA 5LHIA 4UVAA 1XSVA 3DQVC 4YIFA 3D5LA 3JTGA 4G9YA 2GXGA 3TDZC 1PUEE 5D5UB 2KKOA 1S8NA 4I2OA 1F1ZA 4GCVA 5EEHA 3JSOA 2XAQA 1QO0D 1MD0A 3FMSA 3AAFA 3LSTA 3PQKA 2PI0A 2KJCA 4PDKA 3K1PA 3QP5A 5DD8A 1TQPA 2F5EA 3B02A 5D6EA 2MLKA 3CJNA 1TQMA 2VODA 1XMAA 2EJRA 4A0XA 3GX4X 5HDGA 3VEPA 4RB1A 2ZNYA 2PMHA 2EFNA 3CUQA 4HBLA 1U8RA 4S05A 5J8FA 2WTEA 4P96A 2WV0A 1K79A 5LHHA 1KYZA 3U1DA 5E17F 1XCVA 3HRUA 3ROUA 4ESFA 4CICA 2JTVA 2YSRA 3ZN0A 1L0OC 2QBYB 2QQ9A 5FFXA 5FD5A 4EM2A 3BROA 3IL2A 2HR3A 3F23A 2HDCA 4LD5A 5FLXZ 4ETSA 5D5VB 2GZWA 2MBFA 4G7HF 4LLNA 2M5WA 3NRVA 1I6XA 2G9WA 2RC4A 1ON1A 1FSHA 1ZARA 2BYVE 2EFWA 4M9SA 5ED4A 1ON2A 3L2CA 2IA2A 4Q4ZF 4MEXF 1U5TC 2OZUA 3G73A 4UHTA 2JT1A 1YIOA 4L9NA 4HV6A 2L4AA 1FC3A 4AIHA 3WGHA 1XD7A 3ECHA 3O2PE 3GFIA 3B73A 4PGGA 2QVOA 3HOTA 2IA1A 1Z6RA 5CVJA 5J8CA 1F9NA 1LDKB 3LQRA 4DNCA 2EA2A 2FU4A 2PMUA 1BM9A 4GYIA 4I09A 2NS0A 3HHGA 4KYWA 2KJBA 3PQJA 2OZ6A 3TOBA 2RV8A 3P9KA 3GF2A 2DW4A 1S7AA 1YW8A 2F2EA 1BBYA 1SD7A 3QU6A 1R1VA 2W25A 1JE8A 4HLXA 5K5RA 1J75A 1V4RA 1QZYA 3RDIA 1TNTA 4EJOA 4OINF 3WE2A 4HDVA 2HKXA 3CUQB 1D3YA 2J5OA 3RPUA 4R79A 1DPRA 1WI9A 4LK0F 2HQRA 1U78A 4QWQA 2VXZA 2YX7A 1KU7A 2CG4A 5BOXA 1KYWA 3FMQA 4EGZA 5L3BA 1U2WA 4LB6B 3TDUC 2E7WA 4AWXB 1UFMA 1K78A 3RJPA 4Y17A 3HRSA 4KICA 1ZLJA 4EVIA 4ZH4F 4M74A 4BQAA 3P7NA 1VTNC 2OQRA 2EFQA 1SD4A 2XAJA 4HF1A 3EQLF 4AD9A 4MEYF 5CVUA 2FEZA 1ZH5A 2EFPA 4LK1F 1Z05A 4EJWA 3P9IA 2HYGD 3MZHA 1B9MA 2E7XA 1JHFA 5BMZA 2GQQA 2PQ8A 1QQIA 1KU3A 1ODDA 5JHUA 2XROA 2M45A 5H20A 1BOAA 2Y75A 5DEQA 4M9XA 3IRQA 4OIOF 1FP1D 2IP2A 3J81Z 2GXBA 1OYWA 3L9FA 4IRGA 4O5VA 3DPLC 1RUNA 3V8KA 1JXSA 5ERIA 1CF7B 2DI3A 4IRIA 3CDHA 3HRMA 3DP7A 3IWFA 1HKTA 1BC8C 4LJZF 2Y0MA 1TW3A 2HGCA 3T5XA 5JFRA 2QLZA 4IHTA 1HW2A 1S3JA 2ETHA 3RKYA 4JBAA 5ILUA 2VC0A 1O3QA 3LA7A 4ZZDA 1RNLA 4ENKA 1DDNA 1TNSA 4RGRA 3ELKA 3ERED 3WTVC 3KP3A 4QLCU 1YS6A 1BJAA 3KE2A 3I58A 2RDPA 2BEOA 2IA0A 5ICCA 2Q0OA 3DPTA 4K2EA 1L3LA 1FBUA 1OYIA 1KU2A 4RAZA 4KFCA 2TDXA 2JRTA 4CHUA 1J59A 2O8XA 4A2UA 3C7JA 4EJTA 3M8EA 1J7KA 2KRFA 2EV6A 1RZ4A 3GLXA 1PP7U 4EJUA 2VBWA 3WTUC 1IXCA 3CO7C 3E5XA 3HRTA 1HQCA 3COAC 5LHGA 2VT2A 4G94A 2F5DA 4ON0A 1Y0UA 3HSEA 1S6LA 2JPCA 1YLFA 4AVPA 1SMYF 1SD5A 2FF4A 3WU0A 2ZMEC 4ENMA 2P5KA 2P5VA 1ZLKA 4G6QA 1FNNA 1HSTA 4HX4A 3DF8A 3FXUA 2FNAA 3REOA 1CGPA 2DAOA 4HX8A 2XVCA 4M72A 1IN7A 4MQ9F 3HSRA 3ZMSA 5AONA 1R7JA 3CTAA 1PDNC 3RPQA 2ELHA 2MC3A 2BV6A 3H3ZA 4HZFA 3QAHA 4OOIA 4E70A 4L0ZB 4MTEA 3W6KB 2EWNA 4IF4A 3I71A 4CO8A 1HW1A 3H92A 5IT9Z 2P6TA 3T1BA 3E6CC 2L02A 2L4MA 4Q48A 4G8XA 4NQWA 1T2KA 3ABTA 3KP7A 2DBBA 1XGOA 2XAHA 2NYXA 3FXRA 3KEQA 4A5MA 2D1VA 4L9VA 5D8LB 3LFKA 1IUYA 4GO1A 4A0YA 1DPUA 4OIQF 1Q1HA 2W85A 1S29A 4MQVA 3LQQA 1ZRCA 3KETA 2H94A 1U5TA 3ZMVA 1USSA 1SFEA 3LAJA 1BI3A 1O7LA 3KP4A 2XHKA 3CUOA 3MAJA 3HOSA 2HWVA 2ZO4A 5LBQA 2QUFA 1B4AA 4L0YB 3RIRA 3SZTA 2MLGA 3QRFF 2XASA 3V7SA 4ZYDA 3FMRA 1DUXC 1Z7UA 3M1EA 4TV7A 3DEUA 4UXNA 2H27A 3I64A 2F5FA 1XSDA 2VBXA 4U0YA 2XUBA 2NNYA 4HDUA 2O3FA 1LVAA 3CLOA 1YQAA 2IVMA 4HF2A 2EFOA 3R61A 3ZMTA 1LDJA 4UV9A 3TGNA 1YW9A 2OBPA 4I01A 1P4XA 4L5JA 3JTHA 4ESJA 4YIIA 1R22A 5F6FA 2PFBA 1QNTA 4LG0A 5L3FA 4XRFA 2KIUA 1BI2A 4XSZF 1TW2A 2L01A 3WODF 2V1UA 5DYMA 4IRHA 2D1HA 4Y15A 3QPTA 3QP6A 5AIQA 1FP2A 5KVRA 3HTUA 3WU1B 4KA4A 2XAGA 2RN7A 4GXOA 4OMZA 1B9NA 4KIFA 2VONA 3M8FA 1T0FA 2ADUA 3VFZA 2DPDA 1XGMA 3TO6A 3BDDA 1OKRA 3WTYC 3WTZA 1W5TA 2FBKA 5FO5A 1Z6TA 4CXFA 1G3SA 4A6EA 1STZA 3IRRA 2XV4S 4P55A 2ISZA 2HS5A 3TKYA 4A0ZA 4I0BA 5DCMA 5E8IA 1XB4A 3R6SA 2C6YA 5F64A 3WTTC 3HSFA 5HLIA 4WCGA 2O61A 3MWMA 1T6SA 2M30A 4KT5C 3LWFA 2LKPA 3F8FA 2PJPA 3KLOA 5LGTA 1ZREA 3O6BB 2CWEA 1MGTA 3V4GA 5E8GA 1H0MA 3BJOA 1IRGA 3DV8A 3R0JA 3BZ6A 1I5ZA 5HLHA 1R00A 1F4KA 1QBJA 3IKVA 5HVQC 5JI6A 2RNJA 4WWCA 2CW0F 4KMFA 1LQ1A 2V1XA 2ACJA 2HTJA 2V1DA 1YS7A 2W84A 3N97A 3DKWA 2Q8KA 4F7ZA 2ISYA 1OMIA 2OQGA 2XGXA 3L7WA 3GXOA 1ZYRF 3EYYA 4UUVA 2DK8A 3VB2A 2FA5A 2VE9A 4LG0B 1ZN2A 5BPDA 3GWZA 1YG2A 1O3TA 2ESHA 1C0WA 2YR2A 4OMYA 5D4RA 4P9FA 2D45A 4P9UA 5JR3A 5LLQA 2D2WA 2JSCA 1XGNA 3VODA 5FD6A 3TO9A 2K7LA 3BOQA 5KK1A 2NRAC 1R5GA 1R23A 4U0WA 1YFHA 1TQIA 3N4MA 2Q2EA 4LMYA 4KIBA 1E17A 4ZYHA 1IXSB 5CVVA 1B6AA 3CUQC 2CO5A 5ICGA 5L3CA 2DQRA 1MDMA 1W5SA 1XGSA 2ZCWA 4PGHA 3GEZA 2M8EA 3ULQB 1P92A 2STTA 3ZQ7A 2AS5F 3HHHA 3I59A 3JAMK 3FHZA 4OU0A 4BHPA 4ZZLA 4RS8A 3KP2A 4B8XA 3LA3A 4Y13A 2WWYA 3WTSC 3VOEA 3Q9SA 4CGZA 2CQKA 4I02A 3WGGA 2PN6A 2B0LA 2QENA 3RYPA 2R7FA 3V8JA 4MHGA 1R1UA 2UXNA 4M73A 1TBXA 4BNCA 1T38A 1IN4A 5L3EA 2DQLA 3V8LA 2EV5A 1RIOH 2R7DA 4BAYA 2FRHA 4BHBA 3MFKA 2RGVA 1K7AA 4HW0A 4ENNA 5ICEA 3SZPA 2ZNZA 3KZYA 4BYYA 1YTYA 4XLPF 1IF1A 3WGIA 1HKSA 1EH8A 4BXUA 1HXDA 2OU2A 2XKPA 5LRSA 1W7PD 4RGUA 4XBFA 5E18F 3P9CA 4JK1X 3F22A 1FYLA 1P4WA 3K9TA 3GUDA 4RB2C 4EM1A 1KA8A 1LEAA 5D5WB 3F8MA 1FYKA 3G3ZA 1HW5A 3LA2A 4NHJA 1JHHA 1JGSA 3OOPA 1E2XA 2MA3A 2HEOA 1K78B 3BPXA 2GA1A 2FOKA 1EV7A 4I0AA 4ZYEA 5H6RA 2BE5F 3R60A 1BIAA 2J5PA 1IN8A 3F8BA 1H9GA 3L00A 1FT9A 4B09A 1KQ0A 3MEXA 3EETA 4RGSA 3E6BA 2A68F 4I7HA 2RVCA 1IXRC 3M7GA 2P7CB 1ZGJA 2W24A 4WXHA 1MZBA 2IRFG 1XCBA 4UVCA 4Z2YA 5LEKA 3WTXC 2A61A 4N9HA 4RGXA 4EJVA 2HKOA 1Z91A 3IHUA 3U2RA 4YFNF 4R8HA 2HQNA 1ONVA 3EUHA 5LGUA 2CFXA 4YFXF 1YW7A 3C18A 3I54A 3TOAA 2Z99A 4S04A 5DD4A 1LJ9A 1AOYA 2VBZA 4D0PA 2HOEA 1RUOA 4A12A 1LNWA 3ZP5A 5HDKA 4MGRA 2UWMA 1D8JA 3K1NA 2X4HA 1ZHFA 3EYIA 5K1YA 4XLNF 4CDGA 3F72A 5L3DA 5CVIA 2P4WA 1FSEA 3E6DA 2VE8A 2LNBA 2L54A 2V6CA 3BP8A 5DCFA 5CYVA 3RTRA 4L18B 2CSOA 1O3RA 1B59A 1D8KA 2Z9OA 3GZ6A 3S2WA 3TO7A 1SFXA 1G3YA 4RAYA 4OIPF 2VOPA 2A69F 5A2QK 2NAZA 4LLGF 2VBYA 2PLYA 1FYMA 1ZG3A 4BH9A 2FSWA 2YPRA 1IN5A 3GYHX 2A5YB 3FX3A 1WRJA 4LGWA 4RB3C 2KIMA 2E1NA 3PFIA 1AWCA 3FWEA 1ZG1A 2RQPA 3M9AA 4WXDA 1U3EM 3BY6A 2QM3A 2QWWA 2FE3A 4O6JA 2IT0A 3GZ5A 1UB9A 2ESNA 1TLHB 1F5TA 1XDSA 2O0YA 3GFLA 2DFIA 3KZZA 3C3WA 3MCZA 5IT3A 2X0LA 4EQQA 1USTA 2XAFA 2MH9A 1WWXA 3GW2A 5E1XA 1WSUA 1QZZA 3GFJA 1MJBA 4M9ZA 2HYFA 1BI0A 1UCRA 2K27A 6PAXA 3Q5FA 2EB7A 5DDGA 5D5XB 3C1DA 1V3FA 2PBIA 3KFWX 2GWRA 3RKWA 4YFKF 1P2FA 2YX4A 5LRRA 3T8TA 1SMTA 4M6YA 1GHCA 2A3SA 4IJAA 3IC7A 4U7DA 4EM0B 3I53A 5CJ9A 1DP7P 4CZZA 1SFUA 4WXCA 3GVAA 1QGPA 5D8KB 3ZMUA 4H0EA 5HS8A 3F21A 4U7BA 3FXQA 1X3UA 2A07F 4HV5A 1O7FA 5DV5A 3FZVA 1GXQA 2YU3A 2CGPA 1MKMA 2P8TA 2XIGA 4RB0A 3BJ6A 5E20A 3E5UA 2FBHA 2WC2A 1YYVA 3FM3A 4U0VA 2P7VB 1GVJA 1KGSA 1U5TB 1P4AA 2DK5A 3WE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSP A;  4HQE A;  2Z5U A;  4U88 A;  1MJ9 A;  1OYY A;  2IJL A;  1BC7 C;  1O57 A;  4Q47 A;  2G7U A;  2BGC A;  4WX9 A;  1HBX G;  4ESB A;  1FY7 A;  2ZKZ A;  4KNY A;  1ULY A;  3KP5 A;  1IRF A;  4IXA A;  2VOO A;  4N9I A;  4YG2 F;  5FLX K;  1BN5 A;  3U9G A;  2QZ8 A;  3MZY A;  3F6V A;  1ZRF A;  2RKH A;  2DU9 A;  1FBQ A;  4KDP A;  3LAP A;  4ASN A;  5TRD A;  4FHT A;  2GAU A;  4UV8 A;  2V9V A;  2K4J A;  1U6G A;  2LSO A;  3J7A O;  3V7C A;  5TJJ A;  1CF7 A;  1FOK A;  3KEO A;  2FML A;  3CO6 C;  4I98 B;  3R0A A;  1IN6 A;  2DTR A;  4HF0 A;  3FM5 A;  2GA2 A;  5E1Z B;  3L09 A;  2L3D A;  2PEX A;  4HA8 A;  5BPI A;  2XKO A;  4DQ2 A;  3K0L A;  3O3K A;  2FNP A;  4BHC A;  2OA4 A;  1I27 A;  2UXX A;  3F8C A;  3WG9 A;  1SAX A;  1G4D A;  4O3M A;  2R3S A;  3KP6 A;  3DXJ F;  4M71 A;  2LF8 A;  3Q9V A;  2DO7 A;  3JAM Z;  3K2Z A;  2FMY A;  1ZGA A;  4EMS A;  2O03 A;  5HDN A;  3BWG A;  4GGG A;  5HS7 A;  2E1C A;  1ZAO A;  3DFG A;  2ZME A;  3ML6 A;  4KUM A;  5H6Q A;  5FFZ A;  1R58 A;  1T39 A;  4CYD A;  5DCM B;  1KU9 A;  1LB2 A;  1FPQ A;  2H6C A;  1KQ9 A;  3SQN A;  5D6F A;  2IW5 A;  5LGN A;  5DUI A;  4KN4 X;  1MJA A;  2AXL A;  3OV8 A;  4IPA A;  1GXP A;  5AIP A;  4ZYG A;  1XMK A;  4FX0 A;  4WK8 F;  1H9T A;  3BJA A;  1R36 A;  4LB5 A;  5ICF A;  1FLI A;  3SHF A;  4EV0 A;  2VT3 A;  2NNN A;  4HYE A;  2OD5 A;  2IPQ X;  1W4M A;  1XDU A;  3ZN1 A;  1FBS A;  2FQ3 A;  3H3U A;  2M1B A;  3GO5 A;  3ZMZ A;  3ISP A;  1PP8 F;  1FZP B;  5ILV A;  3D0S A;  4Q5S F;  1LDD A;  2QYO A;  5F1R A;  1D5V A;  2EK5 A;  1W7P A;  4LFU A;  4L5I A;  2H6B A;  4PZJ A;  2P6S A;  2COM A;  1G3W A;  5L3G A;  5K5Q A;  2ZJ2 A;  3I5U A;  3SXY A;  1O3S A;  4MNU A;  1QPM A;  1UHM A;  5K5O A;  4WF2 A;  3ECO A;  1BIB A;  5D4S A;  2ZXJ A;  5HLG A;  1I1G A;  4KN7 X;  4G6D A;  1UHW A;  3E5Q A;  4A5N A;  3I0T A;  3BPV A;  1EH7 A;  3HYI A;  2DLL A;  2JZY A;  3J81 K;  2VN2 A;  5E1W A;  2UZK A;  4G7Z F;  2EV0 A;  4HOB A;  2LDU A;  2W57 A;  3V7R A;  1RI7 A;  1IAW A;  4LLL A;  2QQB A;  3HUG A;  1XN7 A;  2OAZ A;  3MQ0 A;  3KLN A;  2XRN A;  4KIG A;  2JPB A;  1FWZ A;  1K6O A;  3T0Y A;  3HIF A;  3W6J B;  5LEJ A;  1ZG5 A;  1J0R A;  1MDM B;  2A6E F;  3E6M A;  4AIK A;  1HKQ A;  2ZME B;  2H09 A;  2V79 A;  4XSX F;  1IZ1 A;  4EGY A;  2G7H A;  4NB5 A;  2FXA A;  3JW4 A;  1FX7 A;  3NEU A;  2K4B A;  4HAM A;  5CLS A;  5ILS A;  3GFM A;  2Y48 A;  3I59 B;  3R4K A;  4GYG A;  4P5O A;  3RKX A;  3F8N A;  2DPU A;  4G7O F;  2HTS A;  5HOO A;  2P5L C;  1B1B A;  3HTS B;  1OPC A;  1R1T A;  3K1M A;  4A6D A;  2F5C A;  2HZT A;  5J6X A;  1REP C;  1LEB A;  1BI1 A;  3T8R A;  3EDP A;  5FGM A;  5DUK A;  3WTW C;  1P6R A;  1J9I A;  1R5H A;  3ZPL A;  2FBI A;  4ENJ A;  5EEG A;  5BQT A;  3IWZ A;  3I4P A;  4IVN A;  3E3V A;  4HX7 A;  3NQO A;  1G6N A;  5BS6 A;  4MTD A;  1W7P B;  1J5Y A;  5A2Q Z;  1A04 A;  2QQA A;  2BBY A;  4AIJ A;  5JVT A;  4HLY A;  1Z1D A;  4UVB A;  4FX4 A;  1KQ8 A;  4FT8 A;  2O6G E;  3IKT A;  5CVR A;  2QBY A;  2A6H F;  1TTY A;  3QPH A;  2Z3Y A;  1SD6 A;  1YO5 C;  2PG4 A;  2STW A;  3K69 A;  2MH2 A;  2CYY A;  1WKM A;  3ABU A;  1J2X A;  3E97 A;  3ZMD A;  4L9T A;  1EH6 A;  2M87 A;  3FF5 A;  2DT5 A;  3J80 Z;  2GIV A;  3TQN A;  1IW7 F;  5IT9 K;  4M6X A;  2ZBK A;  2Z33 A;  4JQF A;  2K02 A;  2EA4 A;  4OIR F;  1ZRD A;  2VC1 A;  3RYR A;  4KMU X;  3F3X A;  4HQM A;  2LF7 A;  1T98 A;  4R1H A;  1XSX A;  3QU3 A;  1WQ2 A;  3SFZ A;  3QOP A;  4PCQ A;  2KIF A;  5HS9 A;  1S7O A;  3J80 K;  3RI4 A;  4UNO A;  4N0B A;  2K86 A;  1G3T A;  4L9J A;  3F6O A;  1Z9C A;  2MD5 A;  1HSJ A;  5FB2 A;  1OR7 A;  4IHS A;  3KCC A;  2ZFW A;  1NHA A;  2HFH A;  1I1S A;  5LHI A;  4UVA A;  1XSV A;  3DQV C;  4YIF A;  3D5L A;  3JTG A;  4G9Y A;  2GXG A;  3TDZ C;  1PUE E;  5D5U B;  2KKO A;  1S8N A;  4I2O A;  1F1Z A;  4GCV A;  5EEH A;  3JSO A;  2XAQ A;  1QO0 D;  1MD0 A;  3FMS A;  3AAF A;  3LST A;  3PQK A;  2PI0 A;  2KJC A;  4PDK A;  3K1P A;  3QP5 A;  5DD8 A;  1TQP A;  2F5E A;  3B02 A;  5D6E A;  2MLK A;  3CJN A;  1TQM A;  2VOD A;  1XMA A;  2EJR A;  4A0X A;  3GX4 X;  5HDG A;  3VEP A;  4RB1 A;  2ZNY A;  2PMH A;  2EFN A;  3CUQ A;  4HBL A;  1U8R A;  4S05 A;  5J8F A;  2WTE A;  4P96 A;  2WV0 A;  1K79 A;  5LHH A;  1KYZ A;  3U1D A;  5E17 F;  1XCV A;  3HRU A;  3ROU A;  4ESF A;  4CIC A;  2JTV A;  2YSR A;  3ZN0 A;  1L0O C;  2QBY B;  2QQ9 A;  5FFX A;  5FD5 A;  4EM2 A;  3BRO A;  3IL2 A;  2HR3 A;  3F23 A;  2HDC A;  4LD5 A;  5FLX Z;  4ETS A;  5D5V B;  2GZW A;  2MBF A;  4G7H F;  4LLN A;  2M5W A;  3NRV A;  1I6X A;  2G9W A;  2RC4 A;  1ON1 A;  1FSH A;  1ZAR A;  2BYV E;  2EFW A;  4M9S A;  5ED4 A;  1ON2 A;  3L2C A;  2IA2 A;  4Q4Z F;  4MEX F;  1U5T C;  2OZU A;  3G73 A;  4UHT A;  2JT1 A;  1YIO A;  4L9N A;  4HV6 A;  2L4A A;  1FC3 A;  4AIH A;  3WGH A;  1XD7 A;  3ECH A;  3O2P E;  3GFI A;  3B73 A;  4PGG A;  2QVO A;  3HOT A;  2IA1 A;  1Z6R A;  5CVJ A;  5J8C A;  1F9N A;  1LDK B;  3LQR A;  4DNC A;  2EA2 A;  2FU4 A;  2PMU A;  1BM9 A;  4GYI A;  4I09 A;  2NS0 A;  3HHG A;  4KYW A;  2KJB A;  3PQJ A;  2OZ6 A;  3TOB A;  2RV8 A;  3P9K A;  3GF2 A;  2DW4 A;  1S7A A;  1YW8 A;  2F2E A;  1BBY A;  1SD7 A;  3QU6 A;  1R1V A;  2W25 A;  1JE8 A;  4HLX A;  5K5R A;  1J75 A;  1V4R A;  1QZY A;  3RDI A;  1TNT A;  4EJO A;  4OIN F;  3WE2 A;  4HDV A;  2HKX A;  3CUQ B;  1D3Y A;  2J5O A;  3RPU A;  4R79 A;  1DPR A;  1WI9 A;  4LK0 F;  2HQR A;  1U78 A;  4QWQ A;  2VXZ A;  2YX7 A;  1KU7 A;  2CG4 A;  5BOX A;  1KYW A;  3FMQ A;  4EGZ A;  5L3B A;  1U2W A;  4LB6 B;  3TDU C;  2E7W A;  4AWX B;  1UFM A;  1K78 A;  3RJP A;  4Y17 A;  3HRS A;  4KIC A;  1ZLJ A;  4EVI A;  4ZH4 F;  4M74 A;  4BQA A;  3P7N A;  1VTN C;  2OQR A;  2EFQ A;  1SD4 A;  2XAJ A;  4HF1 A;  3EQL F;  4AD9 A;  4MEY F;  5CVU A;  2FEZ A;  1ZH5 A;  2EFP A;  4LK1 F;  1Z05 A;  4EJW A;  3P9I A;  2HYG D;  3MZH A;  1B9M A;  2E7X A;  1JHF A;  5BMZ A;  2GQQ A;  2PQ8 A;  1QQI A;  1KU3 A;  1ODD A;  5JHU A;  2XRO A;  2M45 A;  5H20 A;  1BOA A;  2Y75 A;  5DEQ A;  4M9X A;  3IRQ A;  4OIO F;  1FP1 D;  2IP2 A;  3J81 Z;  2GXB A;  1OYW A;  3L9F A;  4IRG A;  4O5V A;  3DPL C;  1RUN A;  3V8K A;  1JXS A;  5ERI A;  1CF7 B;  2DI3 A;  4IRI A;  3CDH A;  3HRM A;  3DP7 A;  3IWF A;  1HKT A;  1BC8 C;  4LJZ F;  2Y0M A;  1TW3 A;  2HGC A;  3T5X A;  5JFR A;  2QLZ A;  4IHT A;  1HW2 A;  1S3J A;  2ETH A;  3RKY A;  4JBA A;  5ILU A;  2VC0 A;  1O3Q A;  3LA7 A;  4ZZD A;  1RNL A;  4ENK A;  1DDN A;  1TNS A;  4RGR A;  3ELK A;  3ERE D;  3WTV C;  3KP3 A;  4QLC U;  1YS6 A;  1BJA A;  3KE2 A;  3I58 A;  2RDP A;  2BEO A;  2IA0 A;  5ICC A;  2Q0O A;  3DPT A;  4K2E A;  1L3L A;  1FBU A;  1OYI A;  1KU2 A;  4RAZ A;  4KFC A;  2TDX A;  2JRT A;  4CHU A;  1J59 A;  2O8X A;  4A2U A;  3C7J A;  4EJT A;  3M8E A;  1J7K A;  2KRF A;  2EV6 A;  1RZ4 A;  3GLX A;  1PP7 U;  4EJU A;  2VBW A;  3WTU C;  1IXC A;  3CO7 C;  3E5X A;  3HRT A;  1HQC A;  3COA C;  5LHG A;  2VT2 A;  4G94 A;  2F5D A;  4ON0 A;  1Y0U A;  3HSE A;  1S6L A;  2JPC A;  1YLF A;  4AVP A;  1SMY F;  1SD5 A;  2FF4 A;  3WU0 A;  2ZME C;  4ENM A;  2P5K A;  2P5V A;  1ZLK A;  4G6Q A;  1FNN A;  1HST A;  4HX4 A;  3DF8 A;  3FXU A;  2FNA A;  3REO A;  1CGP A;  2DAO A;  4HX8 A;  2XVC A;  4M72 A;  1IN7 A;  4MQ9 F;  3HSR A;  3ZMS A;  5AON A;  1R7J A;  3CTA A;  1PDN C;  3RPQ A;  2ELH A;  2MC3 A;  2BV6 A;  3H3Z A;  4HZF A;  3QAH A;  4OOI A;  4E70 A;  4L0Z B;  4MTE A;  3W6K B;  2EWN A;  4IF4 A;  3I71 A;  4CO8 A;  1HW1 A;  3H92 A;  5IT9 Z;  2P6T A;  3T1B A;  3E6C C;  2L02 A;  2L4M A;  4Q48 A;  4G8X A;  4NQW A;  1T2K A;  3ABT A;  3KP7 A;  2DBB A;  1XGO A;  2XAH A;  2NYX A;  3FXR A;  3KEQ A;  4A5M A;  2D1V A;  4L9V A;  5D8L B;  3LFK A;  1IUY A;  4GO1 A;  4A0Y A;  1DPU A;  4OIQ F;  1Q1H A;  2W85 A;  1S29 A;  4MQV A;  3LQQ A;  1ZRC A;  3KET A;  2H94 A;  1U5T A;  3ZMV A;  1USS A;  1SFE A;  3LAJ A;  1BI3 A;  1O7L A;  3KP4 A;  2XHK A;  3CUO A;  3MAJ A;  3HOS A;  2HWV A;  2ZO4 A;  5LBQ A;  2QUF A;  1B4A A;  4L0Y B;  3RIR A;  3SZT A;  2MLG A;  3QRF F;  2XAS A;  3V7S A;  4ZYD A;  3FMR A;  1DUX C;  1Z7U A;  3M1E A;  4TV7 A;  3DEU A;  4UXN A;  2H27 A;  3I64 A;  2F5F A;  1XSD A;  2VBX A;  4U0Y A;  2XUB A;  2NNY A;  4HDU A;  2O3F A;  1LVA A;  3CLO A;  1YQA A;  2IVM A;  4HF2 A;  2EFO A;  3R61 A;  3ZMT A;  1LDJ A;  4UV9 A;  3TGN A;  1YW9 A;  2OBP A;  4I01 A;  1P4X A;  4L5J A;  3JTH A;  4ESJ A;  4YII A;  1R22 A;  5F6F A;  2PFB A;  1QNT A;  4LG0 A;  5L3F A;  4XRF A;  2KIU A;  1BI2 A;  4XSZ F;  1TW2 A;  2L01 A;  3WOD F;  2V1U A;  5DYM A;  4IRH A;  2D1H A;  4Y15 A;  3QPT A;  3QP6 A;  5AIQ A;  1FP2 A;  5KVR A;  3HTU A;  3WU1 B;  4KA4 A;  2XAG A;  2RN7 A;  4GXO A;  4OMZ A;  1B9N A;  4KIF A;  2VON A;  3M8F A;  1T0F A;  2ADU A;  3VFZ A;  2DPD A;  1XGM A;  3TO6 A;  3BDD A;  1OKR A;  3WTY C;  3WTZ A;  1W5T A;  2FBK A;  5FO5 A;  1Z6T A;  4CXF A;  1G3S A;  4A6E A;  1STZ A;  3IRR A;  2XV4 S;  4P55 A;  2ISZ A;  2HS5 A;  3TKY A;  4A0Z A;  4I0B A;  5DCM A;  5E8I A;  1XB4 A;  3R6S A;  2C6Y A;  5F64 A;  3WTT C;  3HSF A;  5HLI A;  4WCG A;  2O61 A;  3MWM A;  1T6S A;  2M30 A;  4KT5 C;  3LWF A;  2LKP A;  3F8F A;  2PJP A;  3KLO A;  5LGT A;  1ZRE A;  3O6B B;  2CWE A;  1MGT A;  3V4G A;  5E8G A;  1H0M A;  3BJO A;  1IRG A;  3DV8 A;  3R0J A;  3BZ6 A;  1I5Z A;  5HLH A;  1R00 A;  1F4K A;  1QBJ A;  3IKV A;  5HVQ C;  5JI6 A;  2RNJ A;  4WWC A;  2CW0 F;  4KMF A;  1LQ1 A;  2V1X A;  2ACJ A;  2HTJ A;  2V1D A;  1YS7 A;  2W84 A;  3N97 A;  3DKW A;  2Q8K A;  4F7Z A;  2ISY A;  1OMI A;  2OQG A;  2XGX A;  3L7W A;  3GXO A;  1ZYR F;  3EYY A;  4UUV A;  2DK8 A;  3VB2 A;  2FA5 A;  2VE9 A;  4LG0 B;  1ZN2 A;  5BPD A;  3GWZ A;  1YG2 A;  1O3T A;  2ESH A;  1C0W A;  2YR2 A;  4OMY A;  5D4R A;  4P9F A;  2D45 A;  4P9U A;  5JR3 A;  5LLQ A;  2D2W A;  2JSC A;  1XGN A;  3VOD A;  5FD6 A;  3TO9 A;  2K7L A;  3BOQ A;  5KK1 A;  2NRA C;  1R5G A;  1R23 A;  4U0W A;  1YFH A;  1TQI A;  3N4M A;  2Q2E A;  4LMY A;  4KIB A;  1E17 A;  4ZYH A;  1IXS B;  5CVV A;  1B6A A;  3CUQ C;  2CO5 A;  5ICG A;  5L3C A;  2DQR A;  1MDM A;  1W5S A;  1XGS A;  2ZCW A;  4PGH A;  3GEZ A;  2M8E A;  3ULQ B;  1P92 A;  2STT A;  3ZQ7 A;  2AS5 F;  3HHH A;  3I59 A;  3JAM K;  3FHZ A;  4OU0 A;  4BHP A;  4ZZL A;  4RS8 A;  3KP2 A;  4B8X A;  3LA3 A;  4Y13 A;  2WWY A;  3WTS C;  3VOE A;  3Q9S A;  4CGZ A;  2CQK A;  4I02 A;  3WGG A;  2PN6 A;  2B0L A;  2QEN A;  3RYP A;  2R7F A;  3V8J A;  4MHG A;  1R1U A;  2UXN A;  4M73 A;  1TBX A;  4BNC A;  1T38 A;  1IN4 A;  5L3E A;  2DQL A;  3V8L A;  2EV5 A;  1RIO H;  2R7D A;  4BAY A;  2FRH A;  4BHB A;  3MFK A;  2RGV A;  1K7A A;  4HW0 A;  4ENN A;  5ICE A;  3SZP A;  2ZNZ A;  3KZY A;  4BYY A;  1YTY A;  4XLP F;  1IF1 A;  3WGI A;  1HKS A;  1EH8 A;  4BXU A;  1HXD A;  2OU2 A;  2XKP A;  5LRS A;  1W7P D;  4RGU A;  4XBF A;  5E18 F;  3P9C A;  4JK1 X;  3F22 A;  1FYL A;  1P4W A;  3K9T A;  3GUD A;  4RB2 C;  4EM1 A;  1KA8 A;  1LEA A;  5D5W B;  3F8M A;  1FYK A;  3G3Z A;  1HW5 A;  3LA2 A;  4NHJ A;  1JHH A;  1JGS A;  3OOP A;  1E2X A;  2MA3 A;  2HEO A;  1K78 B;  3BPX A;  2GA1 A;  2FOK A;  1EV7 A;  4I0A A;  4ZYE A;  5H6R A;  2BE5 F;  3R60 A;  1BIA A;  2J5P A;  1IN8 A;  3F8B A;  1H9G A;  3L00 A;  1FT9 A;  4B09 A;  1KQ0 A;  3MEX A;  3EET A;  4RGS A;  3E6B A;  2A68 F;  4I7H A;  2RVC A;  1IXR C;  3M7G A;  2P7C B;  1ZGJ A;  2W24 A;  4WXH A;  1MZB A;  2IRF G;  1XCB A;  4UVC A;  4Z2Y A;  5LEK A;  3WTX C;  2A61 A;  4N9H A;  4RGX A;  4EJV A;  2HKO A;  1Z91 A;  3IHU A;  3U2R A;  4YFN F;  4R8H A;  2HQN A;  1ONV A;  3EUH A;  5LGU A;  2CFX A;  4YFX F;  1YW7 A;  3C18 A;  3I54 A;  3TOA A;  2Z99 A;  4S04 A;  5DD4 A;  1LJ9 A;  1AOY A;  2VBZ A;  4D0P A;  2HOE A;  1RUO A;  4A12 A;  1LNW A;  3ZP5 A;  5HDK A;  4MGR A;  2UWM A;  1D8J A;  3K1N A;  2X4H A;  1ZHF A;  3EYI A;  5K1Y A;  4XLN F;  4CDG A;  3F72 A;  5L3D A;  5CVI A;  2P4W A;  1FSE A;  3E6D A;  2VE8 A;  2LNB A;  2L54 A;  2V6C A;  3BP8 A;  5DCF A;  5CYV A;  3RTR A;  4L18 B;  2CSO A;  1O3R A;  1B59 A;  1D8K A;  2Z9O A;  3GZ6 A;  3S2W A;  3TO7 A;  1SFX A;  1G3Y A;  4RAY A;  4OIP F;  2VOP A;  2A69 F;  5A2Q K;  2NAZ A;  4LLG F;  2VBY A;  2PLY A;  1FYM A;  1ZG3 A;  4BH9 A;  2FSW A;  2YPR A;  1IN5 A;  3GYH X;  2A5Y B;  3FX3 A;  1WRJ A;  4LGW A;  4RB3 C;  2KIM A;  2E1N A;  3PFI A;  1AWC A;  3FWE A;  1ZG1 A;  2RQP A;  3M9A A;  4WXD A;  1U3E M;  3BY6 A;  2QM3 A;  2QWW A;  2FE3 A;  4O6J A;  2IT0 A;  3GZ5 A;  1UB9 A;  2ESN A;  1TLH B;  1F5T A;  1XDS A;  2O0Y A;  3GFL A;  2DFI A;  3KZZ A;  3C3W A;  3MCZ A;  5IT3 A;  2X0L A;  4EQQ A;  1UST A;  2XAF A;  2MH9 A;  1WWX A;  3GW2 A;  5E1X A;  1WSU A;  1QZZ A;  3GFJ A;  1MJB A;  4M9Z A;  2HYF A;  1BI0 A;  1UCR A;  2K27 A;  6PAX A;  3Q5F A;  2EB7 A;  5DDG A;  5D5X B;  3C1D A;  1V3F A;  2PBI A;  3KFW X;  2GWR A;  3RKW A;  4YFK F;  1P2F A;  2YX4 A;  5LRR A;  3T8T A;  1SMT A;  4M6Y A;  1GHC A;  2A3S A;  4IJA A;  3IC7 A;  4U7D A;  4EM0 B;  3I53 A;  5CJ9 A;  1DP7 P;  4CZZ A;  1SFU A;  4WXC A;  3GVA A;  1QGP A;  5D8K B;  3ZMU A;  4H0E A;  5HS8 A;  3F21 A;  4U7B A;  3FXQ A;  1X3U A;  2A07 F;  4HV5 A;  1O7F A;  5DV5 A;  3FZV A;  1GXQ A;  2YU3 A;  2CGP A;  1MKM A;  2P8T A;  2XIG A;  4RB0 A;  3BJ6 A;  5E20 A;  3E5U A;  2FBH A;  2WC2 A;  1YYV A;  3FM3 A;  4U0V A;  2P7V B;  1GVJ A;  1KGS A;  1U5T B;  1P4A A;  2DK5 A;  3WE3 A; 
#chains in the Genus database with same CATH topology
 3BQY A;  4U87 A;  2BW3 B;  2E34 A;  5C3E J;  5EF6 A;  4B47 A;  3JSP A;  1VQM I;  4HQE A;  2Z5U A;  4U88 A;  3S93 A;  2JA6 J;  1MJ9 A;  3HOY J;  4AYB A;  4PJM A;  4II2 A;  3DBL B;  1OYY A;  2IJL A;  3G71 I;  2DTZ A;  1BC7 C;  1O57 A;  4Q47 A;  4PJL A;  2G7U A;  2BGC A;  4WX9 A;  3X2Q H;  2ID6 A;  1HBX G;  1WCM J;  3S1Q J;  4ESB A;  2R7T A;  3BCB A;  3L2U A;  1FY7 A;  1B72 B;  2ZKZ A;  5GTH C;  4KNY A;  1ULY A;  3WHB A;  3KP5 A;  1IRF A;  4B43 A;  4HST A;  4CCM A;  4IXA A;  1FOW A;  4N9I A;  4YG2 F;  5LD2 C;  1MBG A;  2VOO A;  5FLX K;  3L1P A;  1Z3X A;  1BN5 A;  2H8R A;  3U9G A;  2RAE A;  2DFE A;  4IQJ A;  1MSE C;  2QZ8 A;  1EA3 A;  3MZY A;  2QKL B;  3CC2 I;  3F6V A;  1E3O C;  1ZRF A;  2VLA A;  2RKH A;  2DU9 A;  2UUZ A;  4QTR A;  1FBQ A;  3FHN A;  1VND A;  2O7O A;  4KDP A;  3U1K A;  5M5W J;  2OV7 A;  3LAP A;  2KPM A;  3B6A A;  3OSF A;  2WAD A;  2EZH A;  4ASN A;  5TRD A;  4FHT A;  2GAU A;  1MIJ A;  4V19 K;  4UV8 A;  2V9V A;  2K4J A;  1U6G A;  1K61 A;  3MKY B;  2LSO A;  2IEK A;  3J7A O;  3V7C A;  3WG7 H;  2LRE A;  4BGD A;  1N25 A;  2ME0 A;  5TJJ A;  1CF7 A;  3ABL H;  1SVM A;  2P0W A;  4A3I J;  1OR7 C;  1FOK A;  4XOP A;  3KEO A;  1XX5 A;  2FML A;  5IOZ A;  3CO6 C;  1JKO C;  5FRN A;  1NTC A;  1IC8 A;  2Y0S A;  2AQE A;  2HVR A;  4BUP A;  4I98 B;  3R0A A;  1IN6 A;  2DTR A;  4BE0 A;  2ELJ A;  4HF0 A;  3FM5 A;  2HI3 A;  3J7Y J;  2H8W A;  2GA2 A;  4E7J A;  5E1Z B;  4CSW A;  3DLL F;  3L09 A;  3HGY A;  2L3D A;  2JJ7 A;  2EH3 A;  2PEX A;  2ZB9 A;  4HA8 A;  1JKP C;  5BPI A;  2CFO A;  2XKO A;  3BR1 A;  4DQ2 A;  3K0L A;  3K10 A;  1IG7 A;  1K4S A;  5EYR A;  3O3K A;  2FNP A;  3VYU B;  2VJ4 A;  2DOD A;  4BHC A;  2OA4 A;  1MBK A;  1ZR2 A;  1I27 A;  2UXX A;  1Z0X A;  2W7N A;  3PNT A;  4E7H A;  1W1W E;  3F8C A;  3WG9 A;  3HGG A;  1SAX A;  1G4D A;  4O3M A;  3G1O A;  2R3S A;  3KP6 A;  3OIQ A;  3DXJ F;  4M71 A;  2LF8 A;  1TWA J;  3Q9V A;  2DO7 A;  3JAM Z;  5DTD A;  3K2Z A;  3H3V K;  2FMY A;  2RNG A;  5HLT A;  4XNF A;  1ZGA A;  4EMS A;  3BT9 A;  2O03 A;  5HDN A;  4IO9 F;  3MKL A;  4ZTJ A;  1WH7 A;  1D0Z A;  3A02 A;  3BWG A;  3LNQ A;  3KYL A;  4GGG A;  2QQ8 A;  5HS7 A;  3CP8 A;  2E1C A;  4HEA 2;  1ZAO A;  3DFG A;  2ZME A;  1WJE A;  3ML6 A;  4KUM A;  3FIS A;  1CQT A;  5H6Q A;  1TWG J;  5FFZ A;  1FTT A;  1R58 A;  3ABK H;  2HNH A;  2R0Q C;  1T39 A;  4IOA F;  4CYD A;  5DCM B;  4MO7 A;  1KU9 A;  1LB2 A;  2QKM B;  1RRJ A;  1FPQ A;  2H6C A;  4DBQ A;  1KQ9 A;  5JVG F;  3PM1 A;  1WJ5 A;  5D6F A;  3SQN A;  2IW5 A;  5LGN A;  3CZ6 A;  3I56 I;  3AL0 B;  5DUI A;  2GIZ A;  1MJA A;  4KN4 X;  1BW6 A;  3L2R A;  1A36 A;  2GLO A;  2AXL A;  3OV8 A;  4IPA A;  1GXP A;  2O8K A;  2HU9 A;  5AIP A;  4ZYG A;  1U8B A;  2BZT A;  1XMK A;  2KMU A;  4FX0 A;  2R7O A;  3D5R C;  2BXZ A;  4WK8 F;  1RES A;  3BJA A;  1H9T A;  1APL C;  1R36 A;  4LB5 A;  2ECB A;  3BG6 A;  5ICF A;  2OCC H;  1FTZ A;  1FLI A;  1Y1V J;  3SHF A;  4EV0 A;  1G59 A;  2VT3 A;  2GBY A;  2NNN A;  3IV5 A;  3SZG A;  4HYE A;  2OD5 A;  3HXL A;  2IPQ X;  2KIQ A;  5FLV A;  4ZDO A;  1W4M A;  1XDU A;  3ZN1 A;  5GAH J;  1FBS A;  4UUT A;  4AYB N;  2FQ3 A;  1DGR M;  1AHD P;  3H3U A;  3HM5 A;  2M1B A;  2QF7 A;  3GO5 A;  1A6I A;  3ZMZ A;  2EZK A;  3ISP A;  1QHG A;  2AXT C;  1PP8 F;  3KX2 A;  2E2H J;  1IV6 A;  1FZP B;  5ILV A;  3D0S A;  4A3D J;  3OY9 A;  3Q0W A;  4Q5S F;  1LDD A;  2QYO A;  5GP9 A;  5F1R A;  2QSH X;  1D5V A;  3CLQ A;  4DBR A;  2EK5 A;  1RR7 A;  1W7P A;  2L7F P;  4D7M A;  2VIX A;  4LFU A;  4L5I A;  5F08 A;  3CCQ I;  2H6B A;  4PZJ A;  3LL7 A;  2P6S A;  1RKW A;  2XB5 A;  4BDY A;  3BZC A;  2LVS A;  1DU6 A;  4NC6 A;  2COM A;  1X1P A;  1G3W A;  5L3G A;  5K5Q A;  4C2T A;  2ZJ2 A;  4RM2 A;  3W3C A;  3I5U A;  2CRG A;  3SXY A;  1O3S A;  5B1B H;  3CJQ B;  5KNL A;  2QSG X;  5GPA A;  4MNU A;  1QPM A;  1UHM A;  3I3L A;  5K5O A;  3FKI J;  3ECO A;  1BIB A;  4WF2 A;  5D4S A;  4BQN A;  4JYK A;  3HOV J;  2ZXJ A;  5HLG A;  4F55 A;  1I1G A;  5FKK A;  4KN7 X;  4G6D A;  3GZN B;  4XRS A;  1UHW A;  3E5Q A;  1JJ6 C;  4A5N A;  1UMQ A;  3I0T A;  2EZL A;  3BPV A;  1O4X A;  1EH7 A;  3HYI A;  3PO2 J;  2DLL A;  1MND A;  4AM3 A;  2JZY A;  4RM3 A;  3J81 K;  2VN2 A;  5E1W A;  2UZK A;  4G7Z F;  2BHZ A;  3K70 D;  2EV0 A;  3DLA A;  4ZDP A;  1D1A A;  4HSR A;  4ITV A;  3S2D J;  4HOB A;  2LDU A;  2CS3 A;  2W57 A;  1RI7 A;  3V7R A;  4F52 A;  4LLL A;  1PUF B;  1IAW A;  1V5E A;  2VQC A;  4Z6Y A;  2E1M B;  2Y0S N;  1QRY A;  4UY8 I;  1XPX A;  2QQB A;  3C2B A;  2DOA A;  2BY2 A;  3HUG A;  1ETO A;  1XN7 A;  1YHQ I;  3CME I;  2OAZ A;  3MQ0 A;  4PSX A;  3KLN A;  2XRN A;  3S3M A;  4KIG A;  2JPB A;  1FWZ A;  1K6O A;  2CUE A;  3ZCO A;  2JA8 J;  3OYG A;  1IUF A;  1OQY A;  3BR2 A;  4HPQ A;  3HIF A;  3T0Y A;  3W6J B;  2E36 A;  4IQ4 A;  5LEJ A;  3OYN A;  4E7I A;  1ZG5 A;  2PMZ N;  1J0R A;  1MDM B;  2A6E F;  2QGU A;  3E6M A;  4AIK A;  1HKQ A;  2ZME B;  1MNM C;  2H09 A;  2V79 A;  4XSX F;  3KYD B;  3HOU J;  1R4N B;  1IZ1 A;  4EGY A;  2G7H A;  2JSP A;  5EJC A;  3DPU A;  5J1U A;  3MKZ A;  4NB5 A;  2FXA A;  5C4X J;  3JW4 A;  1FX7 A;  3NEU A;  1X3Z B;  1SFK A;  2VKE A;  2ID3 A;  4XK4 A;  2K4B A;  4HAM A;  5CLS A;  4CUG A;  5ILS A;  3LSR A;  3GFM A;  2Y48 A;  3I59 B;  1I3Q J;  3R4K A;  3G1L A;  3JRG A;  1V55 H;  2HOA A;  1X1C A;  2M0M A;  4GYG A;  4P5O A;  3RKX A;  1VQN I;  1ERD A;  3DTI A;  3F8N A;  1WPK A;  4XR6 A;  3P5J A;  1GDT A;  1HDP A;  1OCC H;  3DBH B;  2DPU A;  4G7O F;  1YIT I;  2HTS A;  1OCO H;  5HOO A;  3OR2 C;  3QWL A;  2P5L C;  1B1B A;  1YJN I;  3TL4 X;  3HTS B;  3JRC A;  1D1C A;  1OPC A;  3SFI A;  1R1T A;  1T56 A;  5CKT A;  3K1M A;  4A6D A;  2W00 A;  2F5C A;  2HZT A;  5J6X A;  1REP C;  2GXA A;  1PJR A;  2YS9 A;  1LEB A;  3RKQ A;  1ZEL A;  2OCE A;  2HXI A;  2LKX A;  4II3 A;  4CCK A;  1BI1 A;  3VSK A;  2ECC A;  1RR8 C;  3T8R A;  1W5C C;  3JR9 A;  3E7L A;  3EDP A;  5F0C A;  4KIT B;  5FGM A;  5DUK A;  3WTW C;  1P6R A;  1J9I A;  1R5H A;  2BHY A;  3ZPL A;  2FBI A;  2QA4 I;  1TWF J;  4ENJ A;  5J4V A;  5EEG A;  1FJL A;  5BQT A;  3IWZ A;  3I4P A;  4IVN A;  2R7Z J;  3E3V A;  4HX7 A;  2BVM A;  1QVU A;  3NQO A;  1G6N A;  5BS6 A;  5J4Y A;  1VZ0 A;  4MTD A;  1U9N A;  2CQQ A;  1SVO A;  1W7P B;  1J5Y A;  3ZOB A;  5A2Q Z;  1A04 A;  1PVE A;  2QQA A;  3BTJ A;  1Y39 A;  2BBY A;  3BTL A;  1FIP A;  3GTP J;  2CQX A;  4IX7 A;  4AIJ A;  5JVT A;  4HLY A;  2LFB A;  4FQG A;  3FBN B;  2MC4 A;  1Z1D A;  2V1N A;  3MMY B;  4E7S A;  4UVB A;  4FX4 A;  1Y56 A;  1KQ8 A;  2D5V A;  5K7Z A;  3JRH A;  5HNF A;  4FT8 A;  2L9R A;  2O6G E;  3IKT A;  4JOM A;  3CMM A;  1N77 A;  5CVR A;  2QBY A;  2A6H F;  1TTY A;  2LC2 A;  2Z3Y A;  3FXO A;  3QPH A;  1SD6 A;  4C3H J;  1YO5 C;  3GTQ J;  2PG4 A;  2STW A;  3K69 A;  2MH2 A;  5F27 A;  2DA7 A;  2CYY A;  4V2G A;  2E5Z A;  1D0X A;  1WKM A;  3ABU A;  3CMY A;  2VQL A;  1LFP A;  1J2X A;  3E97 A;  4Y4R A;  3ZMD A;  4DYR A;  2JK3 A;  4L9T A;  3DTK A;  4IZZ A;  1EH6 A;  3FXM A;  2M87 A;  1S7E A;  1Z7L A;  4H4K C;  3FF5 A;  2DT5 A;  4GFB A;  3I4N J;  3J80 Z;  2GIV A;  2R7V A;  2HPI A;  2V6E A;  3TQN A;  3HG9 A;  1IW7 F;  1N78 A;  4ZC3 A;  5IT9 K;  1WJC A;  5C44 J;  4M6X A;  5EEA A;  2ZBK A;  1WI3 A;  2Z33 A;  4XOR A;  3IH2 A;  3OS0 A;  4BY7 J;  3O8H A;  2K02 A;  4JQF A;  2EA4 A;  4OIR F;  3S3O A;  1K83 J;  2W82 A;  1ZRD A;  2VC1 A;  3RYR A;  1MMS A;  2KZV A;  4KMU X;  1UG2 A;  3VDX A;  3F3X A;  1ZGW A;  4HQM A;  2LF7 A;  3BTI A;  4M6V A;  1T98 A;  4R1H A;  1XSX A;  3QU3 A;  1WQ2 A;  3SFZ A;  2F4I A;  3QOP A;  4OAY A;  4AID A;  2WV1 A;  5B3S H;  1ZK8 A;  3BR6 A;  2KIF A;  4PCQ A;  4JX5 A;  2M0C A;  5HS9 A;  4KIS A;  4RDU A;  1S7O A;  3J80 K;  3RI4 A;  3Q3S A;  4UNO A;  4N0B A;  4L5E A;  1R9T J;  3BLY A;  4FE7 A;  2K86 A;  3GTG J;  2KLO A;  1G3T A;  4XQF A;  4D1Q A;  3OYA A;  4L9J A;  3F6O A;  1Z9C A;  2EIK H;  3HPH A;  2MD5 A;  4FCY A;  5J40 A;  1HSJ A;  1YIJ I;  5FB2 A;  3ZRG A;  1OR7 A;  3C2G A;  1UEL B;  4IHS A;  3KCC A;  2ZFW A;  1NHA A;  2HFH A;  1LPQ A;  4F93 B;  3GME A;  2XGD A;  1I1S A;  5LHI A;  4UVA A;  1XSV A;  3DQV C;  4YIF A;  3D5L A;  4DJA A;  2XDV A;  4DW6 A;  3JTG A;  4RAG A;  3D5S C;  4G9Y A;  2E35 A;  2GXG A;  3TDZ C;  1PUE E;  1P7I A;  1TT5 B;  3GBG A;  5GAE J;  5D5U B;  2KKO A;  1S8N A;  2CUJ A;  1F1Z A;  4I2O A;  3RZD J;  4GCV A;  4UB8 C;  3MKW B;  1MBF A;  5EEH A;  3JSO A;  3FXL A;  1X2M A;  3HBL A;  2XAQ A;  3SDG A;  2Y69 H;  3VYR B;  3I4M J;  4QPQ A;  3S3N A;  1QO0 D;  1MD0 A;  3FMS A;  5FKN A;  3AAF A;  3LST A;  3PQK A;  2PI0 A;  2K9L A;  2KJC A;  4PDK A;  1SVL A;  3K1P A;  3QP5 A;  5DD8 A;  5LFA A;  3FK6 A;  2DA1 A;  1TQP A;  2F5E A;  3B02 A;  5D6E A;  3S1N J;  4F91 B;  2MLK A;  1BR1 A;  3NAR A;  3CJN A;  1TQM A;  3OYI A;  1LE8 B;  1PYV A;  1AKH A;  1XMA A;  2VOD A;  1I50 J;  2EJR A;  4F3Q A;  3S1M J;  4A0X A;  3GX4 X;  2DOE A;  3PUB A;  3ZR8 X;  5HDG A;  2CH0 A;  3VEP A;  4RB1 A;  2ZNY A;  2PMH A;  4FET A;  2X1E A;  3LFU A;  2EFN A;  3CUQ A;  4PJ0 C;  4HBL A;  1U8R A;  4S05 A;  5J8F A;  4RBO A;  1GVD A;  2WTE A;  4P96 A;  2WV0 A;  1K79 A;  2M3A A;  2QSF X;  4Y3O A;  2DDA A;  5LHH A;  1KYZ A;  3U1D A;  5E17 F;  1OIS A;  1DP3 A;  2COB A;  3DTE A;  1XCV A;  3HRU A;  3ROU A;  4ESF A;  3CCY A;  1Y8Q B;  3OYD A;  4CIC A;  4BXX J;  3K7A J;  2JTV A;  2YSR A;  3ZN0 A;  1L0O C;  2NVY J;  1LFU P;  3HEF A;  2WA0 A;  4HNT A;  2QBY B;  2IS1 A;  3JRD A;  3TW6 A;  4CZC A;  2QQ9 A;  1Y1W J;  5FFX A;  5EG0 B;  2R7U A;  2CUF A;  5FD5 A;  4EM2 A;  3BRO A;  4AC0 A;  3IL2 A;  2HR3 A;  2W48 A;  3F23 A;  2HDC A;  2HDW A;  4LD5 A;  3H5R A;  5FLX Z;  3JRE A;  1Q1V A;  3W2W A;  4ETS A;  5D5V B;  2GZW A;  4ANJ A;  2MBF A;  3LSK A;  4G7H F;  2R7Q A;  2DJI A;  1YI2 I;  4LLN A;  2M5W A;  5H2F C;  4W1U A;  3NRV A;  3OS2 A;  1I6X A;  2G9W A;  2KDZ A;  2K9M A;  4XKB A;  2RC4 A;  4IKF A;  4G12 A;  1ON1 A;  1FSH A;  1ZAR A;  3DU5 A;  2BYV E;  1GT0 C;  3ZQL A;  1UZC A;  2VL8 A;  2ZSI B;  4XID A;  4M3D A;  2EFW A;  4M9S A;  5ED4 A;  3HZJ A;  1ON2 A;  3OYB A;  3S8P A;  3L2C A;  2IA2 A;  4Q4Z F;  4YRV A;  3QYF A;  4MEX F;  1U5T C;  2OZU A;  3G73 A;  4UHT A;  2JT1 A;  4NC8 A;  1YIO A;  4L9N A;  5J1R A;  2IXS A;  4PFP A;  2DA5 A;  2PJR A;  4PJJ A;  3FBI B;  1ZKG A;  4HV6 A;  2L4A A;  1FC3 A;  4A3K J;  2OF7 A;  3FK7 A;  4AIH A;  1YJ9 I;  3WGH A;  1VQ6 I;  4JX6 A;  3ZGK A;  3LSP A;  3RZO J;  1XD7 A;  3ECH A;  3O2P E;  3BZK A;  2Z1D A;  3GFI A;  3GTK J;  3B73 A;  4PGG A;  1HA8 A;  1TL8 A;  2QVO A;  3HOT A;  4DOZ A;  4I99 C;  1HDD C;  2IA1 A;  1NG7 A;  1Z6R A;  2X51 A;  1GLN A;  5CVJ A;  5J8C A;  1F9N A;  1LDK B;  3LQR A;  2DA3 A;  1W36 C;  3J7A Y;  2CU7 A;  4DNC A;  2EA2 A;  4M3G A;  2FU4 A;  5E3M A;  2PMU A;  2VI6 A;  1BM9 A;  2IS2 A;  4GYI A;  4DGW B;  4I09 A;  2NS0 A;  3K4C A;  2KT0 A;  3HHG A;  4ZYA A;  4KYW A;  2KJB A;  3PQJ A;  1V54 H;  2WBM A;  2O5R A;  2KRC A;  4BJ6 C;  2OZ6 A;  2BVL A;  4D7N A;  1TT0 A;  3TOB A;  3ZQQ A;  3VYT B;  2K3P A;  2RV8 A;  2IS6 A;  1WJB A;  2L7Z A;  3P9K A;  3RSN A;  3GF2 A;  2JA7 J;  2DW4 A;  1S7A A;  3PIO F;  1YW8 A;  2F2E A;  1BBY A;  1SD7 A;  2WAE A;  3QU6 A;  1R1V A;  2BY3 A;  5JHF A;  1ETV A;  2LBF B;  2PMZ A;  5F0F A;  2W25 A;  1JE8 A;  1AKH B;  4HLX A;  1I39 A;  2LR8 A;  2XSJ C;  1MBE A;  5K5R A;  1J75 A;  2M7B A;  1V4R A;  1QZY A;  3RDI A;  1TNT A;  1MMD A;  4EJO A;  4OIN F;  3WE2 A;  4PK4 A;  4E7Z A;  5IYB J;  4HDV A;  3K4N A;  2HKX A;  1B8I A;  2DCE A;  1T08 B;  3CUQ B;  3CCV I;  1D3Y A;  2J5O A;  3RPU A;  1JUM A;  4XN0 A;  2VQH A;  4R79 A;  4Y7N J;  2ZSH B;  3HKZ A;  5FKO A;  1DPR A;  1WI9 A;  4LK0 F;  2HQR A;  1U78 A;  4QWQ A;  1X19 A;  2VXZ A;  4XRS G;  2XGC A;  3HOW J;  2H1L A;  3NAU A;  4I6Z A;  2EIL H;  2YX7 A;  2WY8 Q;  3H35 A;  2WY7 Q;  1KU7 A;  2CG4 A;  5BOX A;  1KYW A;  2Z16 A;  3FMQ A;  3PNY A;  4EGZ A;  2R4G A;  3DU6 A;  4YEJ A;  5L3B A;  5JLW A;  3A1Y A;  3RPU D;  5HNH A;  2JMW A;  4BXF A;  1U2W A;  3B6C A;  2L9V A;  4LB6 B;  4D5C A;  3TDU C;  2E7W A;  4AWX B;  1UFM A;  1K78 A;  3RJP A;  4Y17 A;  3E1S A;  1LKX A;  2ZFU A;  1UG0 A;  4RLQ A;  2VKD A;  4BBS J;  3HRS A;  4KIC A;  4AVZ A;  3OWT A;  1ZLJ A;  1JJ8 C;  3JRB A;  4CCO A;  2GOX B;  3OMY A;  4XIC A;  4EVI A;  4A3E J;  4ZH4 F;  4M74 A;  1T0F C;  5DS9 A;  4BQA A;  3P7N A;  1TP4 A;  4XKC A;  1VTN C;  1JI8 A;  2OQR A;  3W2V A;  3HC7 A;  2EFQ A;  1OCR H;  1SD4 A;  1WVR A;  2XAJ A;  2XC7 A;  4HF1 A;  2FD5 A;  3EQL F;  1A5J A;  2ZJR F;  1MW7 A;  1NG6 A;  1XTA A;  4AD9 A;  4MEY F;  5CVU A;  2FEZ A;  4NNJ A;  1A31 A;  1ZH5 A;  1QHH D;  2EFP A;  2NVX J;  4LG3 A;  4LK1 F;  1HF0 A;  1JT0 A;  1D1B A;  4IHY A;  2PJR B;  2WAF A;  1Z05 A;  4EJW A;  3P9I A;  2R5Y A;  2HYG D;  3MZH A;  1A6Q A;  1B9M A;  2EIJ H;  1QVT A;  2E7X A;  2HVS A;  1JHF A;  1E0E A;  2Y2Z A;  5BMZ A;  2GQQ A;  2PQ8 A;  1QQI A;  3K4J A;  5CPR B;  1KU3 A;  1ODD A;  5JHU A;  2XRO A;  2M45 A;  5H20 A;  1BOA A;  2HPM A;  2Y75 A;  5DEQ A;  4M9X A;  3IRQ A;  1S72 I;  4OIO F;  1FP1 D;  4BEH A;  1WJD A;  2IP2 A;  3J81 Z;  5M3M J;  1H89 C;  2GXB A;  3F9K A;  1OYW A;  3L9F A;  2W1O A;  4IRG A;  4O5V A;  4F92 B;  1MMG A;  3DPL C;  2XSD C;  1RUN A;  3V8K A;  2B63 J;  1JXS A;  3MVP A;  2TCT A;  5ERI A;  5KAI C;  2FUG 2;  4FTH A;  1CF7 B;  3OYH A;  3QOD A;  2DI3 A;  2I8D A;  3CDH A;  4IRI A;  3HRM A;  2LH9 A;  3DP7 A;  3GTM J;  4XL9 A;  5F0H A;  3IWF A;  1IRZ A;  1HKT A;  1BC8 C;  1R49 A;  4LJZ F;  2Y0M A;  1TW3 A;  2HGC A;  2UV1 A;  3T5X A;  2QLZ A;  5JFR A;  4IHT A;  2HQ5 A;  1HW2 A;  2R7W A;  1S3J A;  3O8G A;  2ETH A;  2M2E A;  3RKY A;  1RET A;  4X0G A;  3K2A A;  2DA2 A;  4A3J J;  4JBA A;  4PSW A;  5ILU A;  4HRI A;  3BQZ A;  2R93 J;  2VC0 A;  1O3Q A;  3LA7 A;  4JX4 A;  4ZZD A;  1G8X A;  2HOS A;  4A69 C;  1RNL A;  1QU3 A;  2MGQ A;  1GV2 A;  3BR0 A;  1IJW C;  5HOD A;  2CV2 A;  4ENK A;  1DDN A;  1TNS A;  4RGR A;  4B4C A;  4XN3 A;  3ELK A;  1B8I B;  1ETK A;  3H36 A;  3ERE D;  4IHX A;  3WTV C;  3KP3 A;  4QLC U;  1YS6 A;  1BJA A;  2IGM A;  2DMT A;  1DQU A;  2VAS A;  3PNV A;  3QQA A;  4PJN A;  3KE2 A;  1YJW I;  3I58 A;  3ONQ A;  2JA5 J;  4XLC A;  2RDP A;  2BEO A;  3EPZ A;  2IA0 A;  1Y6I A;  5ICC A;  1R71 A;  1NH3 A;  2Q0O A;  4BS9 A;  3DPT A;  4K2E A;  2LD5 A;  1L3L A;  1FBU A;  2LY9 A;  1OYI A;  3K4M A;  1VQO I;  4J19 A;  1KU2 A;  2XGE A;  2BY1 A;  4RAZ A;  4KFC A;  3GTL J;  2TDX A;  2JRT A;  4CHU A;  4BQQ A;  1J59 A;  2LYC A;  2O8X A;  4A2U A;  3C7J A;  4BE2 A;  4EJT A;  3J7Z I;  4AUX A;  2X9D A;  3M8E A;  4XLF A;  1J7K A;  2KRF A;  2EV6 A;  1RZ4 A;  3GLX A;  1PP7 U;  3HKZ N;  4EJU A;  2VBW A;  3WTU C;  3BR5 A;  1IXC A;  3S14 J;  3CO7 C;  3E5X A;  3HRT A;  5TGT A;  5J3L A;  1YX3 A;  1HQC A;  3COA C;  5LHG A;  1X3W B;  2JUG A;  2VT2 A;  4G94 A;  2F5D A;  4M3E A;  4ON0 A;  1BW5 A;  4HNU A;  1Y0U A;  1RPW A;  2OTL I;  1MNE A;  3HSE A;  1S6L A;  3OYJ A;  2R7R A;  2JPC A;  1IV8 A;  4ZDL A;  1YLF A;  4AVP A;  1SMY F;  4ABZ A;  2RRE A;  2Y30 A;  3CC7 I;  2XRL A;  3K4B A;  4GRI A;  1SD5 A;  2FF4 A;  1MBJ A;  1VQ5 I;  3H5A A;  2ZME C;  3WU0 A;  3TP0 A;  4A93 J;  4ENM A;  2K9S A;  2P5K A;  2K9N A;  2P5V A;  5E3O A;  4IL6 C;  1ZLK A;  3BR3 A;  3G4S I;  1JUS A;  3LMM A;  4BE1 A;  3TBI A;  3GLL A;  4G6Q A;  1FNN A;  1HST A;  4HX4 A;  3TW7 A;  4FAS D;  4CYC A;  1YX5 A;  3DF8 A;  1IGN A;  3FXU A;  3A01 A;  2FNA A;  3FKJ A;  3REO A;  2CJJ A;  1F43 A;  2R5Y B;  1CGP A;  1X1A A;  2DAO A;  2XB0 X;  4HX8 A;  1HC8 A;  3UR3 C;  2XVC A;  4M72 A;  1IN7 A;  3SJM A;  4MQ9 F;  3HSR A;  2CUZ A;  3CCL I;  3ZMS A;  5AON A;  1R7J A;  2NOG A;  3CTA A;  4BKX A;  1PDN C;  3RPQ A;  4C2M J;  2ELH A;  1JKR C;  2MC3 A;  5KCM A;  3RCO A;  3AKZ A;  3CF5 F;  3HB9 A;  5K7F A;  2BV6 A;  4B48 A;  2M9H A;  3H3Z A;  3FXJ A;  5GAD J;  1GUU A;  4HZF A;  3QAH A;  4OOI A;  3TMO A;  2IGK A;  3IAS 2;  4E70 A;  4L0Z B;  2L2O A;  4MTE A;  1AA7 A;  2EWN A;  3W6K B;  4IF4 A;  3I71 A;  4CO8 A;  3BG7 A;  2LOO A;  2DXI A;  1HW1 A;  2F4O B;  3H92 A;  4MIM A;  4KT6 A;  5IT9 Z;  2P6T A;  2F4M B;  3T1B A;  3E6C C;  5E79 C;  2L02 A;  2GOM A;  3H9J A;  2L4M A;  1R5I D;  4G8X A;  4Q48 A;  4NQW A;  2ZJQ F;  1T2K A;  3ABT A;  3OSG A;  3KP7 A;  2DBB A;  1K6Y A;  1XGO A;  2DMP A;  2XAH A;  4E4H A;  3HOX J;  3M3Y J;  4IHV A;  3M4O J;  2NYX A;  3FXR A;  3KEQ A;  4A5M A;  3FIW A;  2D1V A;  3ERM A;  4L9V A;  1YRN A;  5D8L B;  3LFK A;  3A03 A;  1IUY A;  1ZQ3 P;  4NDL A;  4GO1 A;  4A0Y A;  1DPU A;  4OIQ F;  1Q1H A;  2W85 A;  1FOX A;  2IGN A;  1EF4 A;  2NVU B;  1ETW A;  1S29 A;  4MQV A;  3JRI A;  2LLK A;  2JWT A;  2KDO A;  3LQQ A;  1ZRC A;  1HCR A;  3KET A;  2H94 A;  2MG4 A;  3CCR I;  2VUM J;  3OYM A;  2CQN A;  2L5Q A;  4M3B A;  1U5T A;  3ZMV A;  3HUG B;  5IP6 A;  2VJJ A;  1USS A;  2V4J C;  3QOE A;  1WZ2 A;  1SFE A;  3LAJ A;  1BI3 A;  1O7L A;  3KP4 A;  3KEY A;  3KZI C;  5B5E C;  2XHK A;  3CUO A;  3MAJ A;  3HOS A;  4J00 A;  3AG4 H;  2HWV A;  2PX9 A;  2OUM A;  2ZO4 A;  4DIQ A;  5EGO A;  1VQ7 I;  3VPR A;  5LBQ A;  4ZJZ A;  2VQG A;  2QUF A;  1B4A A;  4L0Y B;  2LP0 A;  2X85 A;  4A3C J;  3K4K A;  3RIR A;  2FOW A;  3SEQ A;  3SZT A;  1F36 A;  1XG1 A;  2MLG A;  2L9N A;  4B44 A;  5J1Y A;  3KYC B;  2XAS A;  3QRF F;  1H8A C;  1K4T A;  3V7S A;  4ZYD A;  3FMR A;  5CQE A;  1DUX C;  1Z7U A;  2JVG A;  3CCM I;  3M1E A;  4TV7 A;  1ITY A;  3DEU A;  4UXN A;  3PUF A;  2H27 A;  1P9Q C;  2GM4 A;  2ZXW H;  3I64 A;  2F5F A;  2CQ7 A;  5GPC A;  1XSD A;  4IHW A;  2EIN H;  5IOY A;  2E2I J;  2VBX A;  2WB1 A;  4U0Y A;  3NWS A;  3N05 A;  2XUB A;  4PFO A;  2NNY A;  3A0B C;  4HDU A;  2O3F A;  1LVA A;  1DU0 A;  2MW8 A;  4A3B J;  3CLO A;  4LIV A;  1W36 D;  2HOT A;  1YQA A;  3TED A;  2YU9 J;  2IVM A;  5E3L A;  4HF2 A;  1D0Y A;  1GV5 A;  2EFO A;  2M4K A;  2VPR A;  3AG2 H;  3VSL A;  3R61 A;  3ZMT A;  2X1C A;  1LDJ A;  1POG A;  4UV9 A;  3TGN A;  1YW9 A;  3FDY A;  1X1B A;  2OBP A;  4BJT A;  4I01 A;  1P4X A;  1WGX A;  4L5J A;  3JTH A;  2OJE D;  4ESJ A;  2NOJ B;  4ZTF A;  4YII A;  5IPA A;  1R22 A;  3H0D A;  3IP4 B;  2F6C A;  5F6F A;  3OIP A;  3CDL A;  1UHS A;  2PFB A;  4S0H B;  1HOM A;  2ZJP F;  2OTJ I;  3H9Q A;  3W6V A;  1QNT A;  3NWT A;  4LG0 A;  5L3F A;  4XRF A;  3GTJ J;  2KIU A;  1BOB A;  4XM3 A;  2JQ7 A;  2B9S A;  2M8G X;  1I6H J;  3PJR A;  1Z3Y A;  1BI2 A;  3LSI A;  4XSZ F;  1U0J A;  5IP7 J;  3EUH C;  1FOY A;  1TW2 A;  2L01 A;  3WOD F;  2V1U A;  2B7E A;  5DYM A;  3PSF A;  4IRH A;  2D1H A;  4Y15 A;  3OYK A;  2DOF A;  2MFZ A;  3QPT A;  1W0T A;  3QP6 A;  3QPL A;  1FP2 A;  5AIQ A;  3JRA A;  5M5X J;  2V9P A;  5KVR A;  3HTU A;  3WU1 B;  5IYD J;  2KHM A;  4KA4 A;  2XAG A;  1VQK I;  2RN7 A;  4GXO A;  2AO9 A;  4OMZ A;  2E5N A;  4BL0 B;  2E2J J;  2NS8 A;  1B9N A;  4KIF A;  4CCJ A;  2LKS A;  3JRF A;  4XMY A;  2VON A;  1ORK A;  3M8F A;  4KJZ A;  1T0F A;  2ADU A;  3VFZ A;  2KFD A;  1VQ8 I;  2DPD A;  1XGM A;  2DN0 A;  3TO6 A;  3BDD A;  4RMN A;  1OKR A;  4BQO A;  3WTZ A;  3WTY C;  1W5T A;  3HL2 A;  2FBK A;  5FO5 A;  3ZQC A;  5M3F J;  3WU2 C;  3CD6 I;  4JP0 A;  1Z6T A;  4XON A;  4CXF A;  3C2H A;  4XKW A;  1G3S A;  3HJE A;  4A6E A;  3RQI A;  1STZ A;  3IRR A;  2XV4 S;  4P55 A;  2ISZ A;  4B3A A;  2JA2 A;  2HS5 A;  2FQ4 A;  3TKY A;  4A0Z A;  4I0B A;  5DCM A;  5E8I A;  1RC9 A;  3G6E I;  1XB4 A;  3M1C A;  4P1W A;  2YUS A;  3R6S A;  2C6Y A;  5F64 A;  3WTT C;  2X6Y A;  4NC7 A;  5EGO B;  4UUS A;  2X6W A;  1QA6 A;  4IOC F;  2VKV A;  2K9Q A;  3HSF A;  5HLI A;  4WCG A;  1FMW A;  2X6O A;  2O61 A;  3MWM A;  4DZJ A;  1T6S A;  2M30 A;  4KT5 C;  3LWF A;  2E71 A;  4OWR B;  2LKP A;  2VPL A;  3F8F A;  2PJP A;  3L2V A;  3KLO A;  5LGT A;  1ZRE A;  1MH3 A;  5GAG J;  3O6B B;  3BCA A;  2CWE A;  2KP6 A;  1JTX A;  1MGT A;  1TZL A;  3V4G A;  3ZXS A;  1DGW Y;  5E8G A;  1H0M A;  3BJO A;  2WAQ A;  4MFD A;  1IRG A;  4A3G J;  5FKL A;  3DV8 A;  3W2A A;  3R0J A;  3LSM A;  3IUO A;  3BZ6 A;  2LRD A;  2A5W A;  1I5Z A;  3ZQG A;  5HLH A;  1VQ9 I;  1R00 A;  1F4K A;  5FKM A;  2NVT J;  3H0G J;  4DZP A;  1QBJ A;  3IKV A;  5HVQ C;  1X2N A;  1Z67 A;  2VJ5 A;  2X6X A;  5JI6 A;  5E3N A;  2RNJ A;  4WWC A;  2CW0 F;  4KMF A;  5K7H A;  1LQ1 A;  2ZXI A;  2V1X A;  2ACJ A;  2HTJ A;  2M7A A;  2V1D A;  1YS7 A;  2W84 A;  4IEJ A;  3N97 A;  1EJ9 A;  3DKW A;  2Q8K A;  4F7Z A;  2AQF A;  2K3F A;  2ISY A;  3EUA A;  2EQR A;  9ANT A;  1QPI A;  1OMI A;  2OQG A;  2VXD A;  2WB1 N;  5FLM J;  2XGX A;  1NK3 P;  2HDD A;  3L7W A;  3GXO A;  3CMA I;  1ZYR F;  1RKT A;  3EYY A;  5JLX A;  4UUV A;  4J01 A;  2DK8 A;  3VB2 A;  2XPU A;  5IYC J;  2L7K A;  1EKE A;  3CC4 I;  1BA5 A;  2FA5 A;  2VE9 A;  4LG0 B;  1ETY A;  1ZN2 A;  2Z2S B;  5BPD A;  1ACI A;  3HDD A;  3VYS B;  2LK2 A;  3V42 A;  3GWZ A;  1YG2 A;  1HLV A;  1O3T A;  2L0K A;  2ESH A;  4M3F A;  2KIS A;  1C0W A;  4B3X A;  4EEF G;  2YR2 A;  3ZQI A;  1Y8R B;  4OMY A;  5D4R A;  5GTI C;  3CCJ I;  3M07 A;  2A6T A;  4P9F A;  2D45 A;  4P9U A;  3UNG C;  5JR3 A;  5LLQ A;  2TRT A;  3F0C A;  4Y52 J;  3AG3 H;  1ZR4 A;  2D2W A;  3UKG A;  2DDB A;  2JSC A;  1XGN A;  3VOD A;  2L7M P;  5FD6 A;  3TO9 A;  2ICW G;  1YE9 A;  2K7L A;  2VKH A;  3BOQ A;  3OYC A;  5KK1 A;  1PUF A;  2K5C A;  3QPS A;  1MH4 A;  3KPH A;  5EZG A;  1WJF A;  3K4L A;  2HXO A;  2NRA C;  1R5G A;  1R23 A;  4U0W A;  3H1C A;  1YFH A;  1TQI A;  1S5L C;  3ZQH A;  3ZQF A;  1D5Y A;  3N4M A;  1ETQ A;  2Q2E A;  3JCU C;  4LMY A;  4KIB A;  4RLF A;  1E17 A;  4ZYH A;  1IXS B;  1R6R A;  3ASO H;  3S1R J;  3A2K A;  5CVV A;  1VF9 A;  1B6A A;  3CUQ C;  2DMQ A;  4DYC A;  2CO5 A;  5ICG A;  5L3C A;  5F04 A;  2DQR A;  3OL3 A;  1MDM A;  2X1D A;  1W5S A;  1XGS A;  2ZCW A;  2X48 A;  3DEE A;  1MMN A;  2IS4 A;  4PGH A;  3GEZ A;  3H5N A;  2M8E A;  1SFO J;  1JKQ C;  4DYQ A;  3ULQ B;  1LFB A;  1T95 A;  2HQA A;  1G2H A;  1P92 A;  1WJA A;  2STT A;  3ZQ7 A;  2L9S A;  2AS5 F;  4UUS B;  2FX0 A;  2DA6 A;  3HHH A;  1W0U A;  3I59 A;  3JAM K;  1IRX A;  1M1E B;  1Z77 A;  3FHZ A;  2NVQ J;  4OU0 A;  1N75 A;  5FJ8 J;  4BHP A;  1OJL A;  4ZZL A;  4XLE A;  4RS8 A;  1LVK A;  4W97 A;  2E1O A;  3KP2 A;  4B8X A;  3S15 J;  3LA3 A;  1X4O A;  3ABM H;  4Y13 A;  4FE4 A;  2WWY A;  2DMU A;  3WTS C;  2M4G A;  2V7F A;  3VOE A;  3Q9S A;  2W4S A;  4CGZ A;  2CQK A;  4I02 A;  3WGG A;  1I3A A;  3AL0 C;  1QZE A;  2PN6 A;  3I55 I;  2B0L A;  2QEN A;  3RYP A;  5DM7 F;  2R7F A;  3ASN H;  3V8J A;  4MHG A;  4G6T B;  1R1U A;  2LTP A;  2BOL A;  4I76 A;  2UXN A;  4M73 A;  5EZH A;  2R7S A;  1TBX A;  2F5V A;  4NBQ A;  2IAI A;  2XPW A;  5B1A H;  3A0H C;  2H1K A;  4BNC A;  2I10 A;  1T38 A;  4AU7 A;  1IN4 A;  5L3E A;  1A35 A;  2DQL A;  2E19 A;  3V8L A;  2DJN A;  1X4P A;  2DFF A;  2EV5 A;  3OIO A;  1NK2 P;  1VQ4 I;  3BC8 A;  1RIO H;  2R7D A;  4BAY A;  1TWH J;  2K40 A;  2FRH A;  4BHB A;  1SEU A;  2LG4 A;  3CQZ J;  3MFK A;  2RGV A;  2WAQ N;  1K7A A;  4HW0 A;  5CQG A;  4ENN A;  5ICE A;  3ESW B;  3SZP A;  1WH5 A;  2ZNZ A;  3KZY A;  4BYY A;  1YTY A;  2HVQ A;  3S2H J;  2XF6 A;  3OYE A;  4XLP F;  2R5Z A;  1OLT A;  1OCP A;  1IF1 A;  2DMN A;  3WGI A;  1HKS A;  1EH8 A;  4BXU A;  1HXD A;  2OU2 A;  2XKP A;  1ETX A;  1W7P D;  2JVH A;  4RGU A;  5TIS C;  3WHC A;  5LRS A;  1VFC A;  4HNV A;  3LOC A;  4C3J J;  4XBF A;  1TC3 C;  2XAU A;  5E18 F;  3P9C A;  1JTY A;  4JK1 X;  2Y9Y A;  3BG5 A;  3H9G A;  3F22 A;  1BR2 A;  1FYL A;  1P4W A;  1JT6 A;  3K9T A;  3GUD A;  4RB2 C;  3RQ4 A;  3L2W A;  2CMP A;  4EM1 A;  1OFC X;  1KA8 A;  1LEA A;  1P7J A;  5D5W B;  3F8M A;  1BR4 A;  3GTO J;  3EUK L;  4OAZ A;  2JN6 A;  1FYK A;  3G3Z A;  1HW5 A;  4D9J A;  3L2Q A;  2R92 J;  3CCE I;  3MN2 A;  3LA2 A;  2V9K A;  2EPF A;  1JHH A;  4NHJ A;  3S16 J;  1JGS A;  3OOP A;  1FEX A;  1E2X A;  2MA3 A;  2VB6 A;  5J47 A;  2HEO A;  2Q1Z B;  1K78 B;  1VQP I;  2DT7 B;  3BPX A;  3AFH A;  2IGO A;  2GA1 A;  2FOK A;  1EV7 A;  4I0A A;  2Q2E B;  2DYR H;  3I9V 2;  4ZYE A;  1JUP A;  1T8I A;  5H6R A;  2BE5 F;  2OC6 A;  1X1D A;  1R4M B;  4XLH A;  1VQL I;  1LUJ B;  2E1M C;  3R60 A;  3OR1 C;  3SEZ A;  3CCS I;  1BIA A;  2J5P A;  1IN8 A;  3F8B A;  1YOV B;  1H9G A;  1OCT C;  2I5U A;  5BNG A;  3L00 A;  1FT9 A;  1AU7 A;  4NUB A;  3OYF A;  4B09 A;  5FRM A;  1KQ0 A;  3MEX A;  3EET A;  4RGS A;  3E6B A;  2CW8 A;  2A68 F;  4I7H A;  2RVC A;  1X58 A;  4N4N B;  1IXR C;  3M7G A;  2P7C B;  1ZGJ A;  3CJR B;  2W24 A;  4WXH A;  1MZB A;  4YIR X;  2IRF G;  5KAF C;  3HPG A;  1MMA A;  5C4J J;  1XCB A;  3OOU A;  4BDZ A;  4UVC A;  4Z2Y A;  5LEK A;  3WTX C;  2A61 A;  4N9H A;  4BAC A;  4RGX A;  3QYE A;  3OS1 A;  4EJV A;  3DCF A;  5F1J A;  3KIO A;  2HKO A;  1Z91 A;  5DM6 F;  3A4C A;  1TWC J;  2EIM H;  2F48 A;  3IHU A;  2M34 A;  2DA4 A;  3U2R A;  1E3P A;  4YFN F;  4R8H A;  2ZC2 A;  2HQN A;  1ONV A;  2ME6 A;  4E6K G;  3EUH A;  1KON A;  3LSH A;  5LGU A;  2CFX A;  4YFX F;  1YW7 A;  3C18 A;  2JRM A;  3PL8 A;  1JGG A;  5EDN A;  3I54 A;  3TOA A;  2Z99 A;  4BY1 J;  4S04 A;  5DD4 A;  3GCM A;  1LJ9 A;  3CES A;  1AOY A;  2VBZ A;  2QCO A;  4D0P A;  4BEH B;  3MD2 A;  1J09 A;  3Q0V A;  2HOE A;  1RUO A;  1IDZ A;  4A12 A;  1LNW A;  3G1M A;  3ZP5 A;  1VI0 A;  5HDK A;  4MGR A;  5IP9 J;  1XS9 A;  2UWM A;  1D8J A;  3K1N A;  3U21 A;  1Z21 A;  2X4H A;  1ZHF A;  2DYS H;  2CW7 A;  1LE8 A;  3IH4 A;  4Y33 A;  4QPO A;  3EYI A;  1IO2 A;  5K1Y A;  4XLN F;  4LIT A;  4CDG A;  1UJ8 A;  4XRM A;  3F72 A;  3CDI A;  3CJT B;  5L3D A;  5CVI A;  2P4W A;  1FSE A;  3E6D A;  2O9L A;  2KQR A;  2NXN B;  2VE8 A;  2LNB A;  2L54 A;  2V6C A;  3PO3 J;  2IBD A;  3BP8 A;  5DCF A;  2R5Z B;  2CV1 A;  3PIP F;  5CYV A;  3RTR A;  4L18 B;  1ENH A;  3DKX A;  2CSO A;  1S9H A;  2Y31 A;  1O3R A;  1B59 A;  1D8K A;  1U9O A;  2MYS A;  2Z9O A;  1OCZ H;  3GZ6 A;  2VJI A;  3S2W A;  4C30 A;  4A3M J;  4BU2 A;  3TO7 A;  1SFX A;  1H88 C;  1G3Y A;  3CF2 A;  4N4O B;  5KHD A;  4RAY A;  5EG0 A;  4OIP F;  2FJ1 A;  2VOP A;  1KZH A;  3FXK A;  4C3I J;  2HZD A;  4BBR J;  2A69 F;  4QSH A;  5A2Q K;  5FRO A;  4C2U A;  1SAU A;  2NAZ A;  3Q0U A;  1SC7 A;  3K70 C;  2BW3 A;  4LLG F;  2EZI A;  4GDF A;  1Y0N A;  4A3L J;  2VBY A;  2PLY A;  3BG3 A;  1FYM A;  1FMV A;  1ZG3 A;  4BH9 A;  2FSW A;  2YPR A;  1IN5 A;  4PUS A;  3GYH X;  2A5Y B;  2LY1 A;  3FX3 A;  4MFE A;  1WRJ A;  1XC5 A;  3M8J A;  1ZTR A;  4LGW A;  2N8G A;  3BTC A;  4RB3 C;  2KIM A;  2E1N A;  3PFI A;  1AWC A;  3FWE A;  2V26 A;  3IAM 2;  3SYT A;  2XPV A;  4C9Y A;  1ZG1 A;  1B72 A;  2LY2 A;  2RQP A;  3M9A A;  1BJZ A;  4WXD A;  1U3E M;  3AG1 H;  1WFX A;  3CCU I;  3BY6 A;  5B66 C;  2QM3 A;  4CCN A;  2QWW A;  2KRH A;  2CV0 A;  2FE3 A;  4O6J A;  2IT0 A;  3GZ5 A;  2RQQ A;  4RAF A;  2Y9Z A;  1UB9 A;  2MD0 A;  2AHQ A;  2ESN A;  2E60 A;  1TLH B;  1F5T A;  2ZXH A;  1XDS A;  2O0Y A;  3GFL A;  2DFI A;  3KZZ A;  4FIS A;  3C3W A;  3G2B A;  4MLO A;  2DFH A;  3MCZ A;  2A05 A;  5IT3 A;  2X0L A;  3DEW A;  3S32 A;  4EQQ A;  4X1E A;  1UST A;  2XAF A;  2MH9 A;  1WWX A;  2ELK A;  3GW2 A;  5E1X A;  2MSY A;  1MSF C;  1WSU A;  1QZZ A;  2KL4 A;  4RA2 A;  4CYC B;  3GFJ A;  3LSJ A;  4XKV A;  3OL4 A;  1MJB A;  3PSI A;  3A01 B;  3TP3 A;  4M9Z A;  2HYF A;  2P81 A;  4XOT A;  1UAA A;  2BXY A;  3SDB A;  1BI0 A;  1UCR A;  2K27 A;  5M5Y J;  6PAX A;  3DBR B;  1V5G A;  3Q5F A;  3E0J B;  2EB7 A;  3BG9 A;  3VWB A;  2MAB A;  1T33 A;  3MZ8 A;  5DDG A;  2K85 A;  3IH3 A;  1XMX A;  5D5X B;  4E7K A;  2JUC A;  3C1D A;  2XF5 A;  2NS7 A;  4QIW N;  1V3F A;  2PBI A;  3PFY A;  4YEL A;  2KZG A;  3KFW X;  2GWR A;  2EBI A;  3S17 J;  4EAT A;  3RKW A;  4UB6 C;  1MBH A;  1E3H A;  2G0E A;  4CCL A;  4YFK F;  1IDY A;  1P2F A;  2YX4 A;  2LBF A;  3DKY A;  2OPT A;  5LRR A;  3D1N I;  3T8T A;  1SMT A;  4M6Y A;  1WHU A;  1GHC A;  2A3S A;  4IJA A;  3IC7 A;  4D5F A;  4U7D A;  4CA0 A;  4NQW B;  4EM0 B;  3I53 A;  5CJ9 A;  3DWL E;  3OYL A;  4E7L A;  3QYB A;  1DP7 P;  4CZZ A;  1SFU A;  4WXC A;  3GVA A;  1QGP A;  4BJ5 C;  4CH7 A;  3HOZ J;  5D8K B;  3ZMU A;  4H0E A;  5HS8 A;  3F21 A;  3FXQ A;  4U7B A;  1FIA A;  4HG2 A;  1X3U A;  2A07 F;  4HV5 A;  1O7F A;  5DV5 A;  3LSG A;  2QEX I;  3K6G A;  1YRN B;  3FZV A;  2YU3 A;  1GXQ A;  2HYJ A;  4XLA A;  2CGP A;  1MKM A;  2XF7 A;  2P8T A;  2XIG A;  4V2F A;  4RB0 A;  3BJ6 A;  5E20 A;  3E5U A;  2FBH A;  4A3F J;  2WC2 A;  1V5F A;  2R7X A;  4LIU A;  5IY5 H;  1YYV A;  4LOC A;  3FM3 A;  4U0V A;  2P7V B;  4B1R A;  1GVJ A;  2BY0 A;  3CP2 A;  1KGS A;  1BL0 A;  1U5T B;  1P4A A;  4X6A J;  1SAN A;  2DK5 A;  2DT6 A;  3WE3 A;  2LMD A; 
#chains in the Genus database with same CATH homology
 3JSP A;  4HQE A;  2Z5U A;  4U88 A;  1MJ9 A;  1OYY A;  2IJL A;  1BC7 C;  1O57 A;  4Q47 A;  2G7U A;  2BGC A;  4WX9 A;  1HBX G;  4ESB A;  1FY7 A;  2ZKZ A;  4KNY A;  1ULY A;  3KP5 A;  1IRF A;  4IXA A;  2VOO A;  4N9I A;  4YG2 F;  5FLX K;  1BN5 A;  3U9G A;  2QZ8 A;  3MZY A;  3F6V A;  1ZRF A;  2RKH A;  2DU9 A;  1FBQ A;  4KDP A;  3LAP A;  4ASN A;  5TRD A;  4FHT A;  2GAU A;  4UV8 A;  2V9V A;  2K4J A;  1U6G A;  2LSO A;  3J7A O;  3V7C A;  5TJJ A;  1CF7 A;  1FOK A;  3KEO A;  2FML A;  3CO6 C;  4I98 B;  3R0A A;  1IN6 A;  2DTR A;  4HF0 A;  3FM5 A;  2GA2 A;  5E1Z B;  3L09 A;  2L3D A;  2PEX A;  4HA8 A;  5BPI A;  2XKO A;  4DQ2 A;  3K0L A;  3O3K A;  2FNP A;  4BHC A;  2OA4 A;  1I27 A;  2UXX A;  3F8C A;  3WG9 A;  1SAX A;  1G4D A;  4O3M A;  2R3S A;  3KP6 A;  3DXJ F;  4M71 A;  2LF8 A;  3Q9V A;  2DO7 A;  3JAM Z;  3K2Z A;  2FMY A;  1ZGA A;  4EMS A;  2O03 A;  5HDN A;  3BWG A;  4GGG A;  5HS7 A;  2E1C A;  1ZAO A;  3DFG A;  2ZME A;  3ML6 A;  4KUM A;  5H6Q A;  5FFZ A;  1R58 A;  1T39 A;  4CYD A;  5DCM B;  1KU9 A;  1LB2 A;  1FPQ A;  2H6C A;  1KQ9 A;  3SQN A;  5D6F A;  2IW5 A;  5LGN A;  5DUI A;  4KN4 X;  1MJA A;  2AXL A;  3OV8 A;  4IPA A;  1GXP A;  5AIP A;  4ZYG A;  1XMK A;  4FX0 A;  4WK8 F;  1H9T A;  3BJA A;  1R36 A;  4LB5 A;  5ICF A;  1FLI A;  3SHF A;  4EV0 A;  2VT3 A;  2NNN A;  4HYE A;  2OD5 A;  2IPQ X;  1W4M A;  1XDU A;  3ZN1 A;  1FBS A;  2FQ3 A;  3H3U A;  2M1B A;  3GO5 A;  3ZMZ A;  3ISP A;  1PP8 F;  1FZP B;  5ILV A;  3D0S A;  4Q5S F;  1LDD A;  2QYO A;  5F1R A;  1D5V A;  2EK5 A;  1W7P A;  4LFU A;  4L5I A;  2H6B A;  4PZJ A;  2P6S A;  2COM A;  1G3W A;  5L3G A;  5K5Q A;  2ZJ2 A;  3I5U A;  3SXY A;  1O3S A;  4MNU A;  1QPM A;  1UHM A;  5K5O A;  4WF2 A;  3ECO A;  1BIB A;  5D4S A;  2ZXJ A;  5HLG A;  1I1G A;  4KN7 X;  4G6D A;  1UHW A;  3E5Q A;  4A5N A;  3I0T A;  3BPV A;  1EH7 A;  3HYI A;  2DLL A;  2JZY A;  3J81 K;  2VN2 A;  5E1W A;  2UZK A;  4G7Z F;  2EV0 A;  4HOB A;  2LDU A;  2W57 A;  3V7R A;  1RI7 A;  1IAW A;  4LLL A;  2QQB A;  3HUG A;  1XN7 A;  2OAZ A;  3MQ0 A;  3KLN A;  2XRN A;  4KIG A;  2JPB A;  1FWZ A;  1K6O A;  3T0Y A;  3HIF A;  3W6J B;  5LEJ A;  1ZG5 A;  1J0R A;  1MDM B;  2A6E F;  3E6M A;  4AIK A;  1HKQ A;  2ZME B;  2H09 A;  2V79 A;  4XSX F;  1IZ1 A;  4EGY A;  2G7H A;  4NB5 A;  2FXA A;  3JW4 A;  1FX7 A;  3NEU A;  2K4B A;  4HAM A;  5CLS A;  5ILS A;  3GFM A;  2Y48 A;  3I59 B;  3R4K A;  4GYG A;  4P5O A;  3RKX A;  3F8N A;  2DPU A;  4G7O F;  2HTS A;  5HOO A;  2P5L C;  1B1B A;  3HTS B;  1OPC A;  1R1T A;  3K1M A;  4A6D A;  2F5C A;  2HZT A;  5J6X A;  1REP C;  1LEB A;  1BI1 A;  3T8R A;  3EDP A;  5FGM A;  5DUK A;  3WTW C;  1P6R A;  1J9I A;  1R5H A;  3ZPL A;  2FBI A;  4ENJ A;  5EEG A;  5BQT A;  3IWZ A;  3I4P A;  4IVN A;  3E3V A;  4HX7 A;  3NQO A;  1G6N A;  5BS6 A;  4MTD A;  1W7P B;  1J5Y A;  5A2Q Z;  1A04 A;  2QQA A;  2BBY A;  4AIJ A;  5JVT A;  4HLY A;  1Z1D A;  4UVB A;  4FX4 A;  1KQ8 A;  4FT8 A;  2O6G E;  3IKT A;  5CVR A;  2QBY A;  2A6H F;  1TTY A;  3QPH A;  2Z3Y A;  1SD6 A;  1YO5 C;  2PG4 A;  2STW A;  3K69 A;  2MH2 A;  2CYY A;  1WKM A;  3ABU A;  1J2X A;  3E97 A;  3ZMD A;  4L9T A;  1EH6 A;  2M87 A;  3FF5 A;  2DT5 A;  3J80 Z;  2GIV A;  3TQN A;  1IW7 F;  5IT9 K;  4M6X A;  2ZBK A;  2Z33 A;  4JQF A;  2K02 A;  2EA4 A;  4OIR F;  1ZRD A;  2VC1 A;  3RYR A;  4KMU X;  3F3X A;  4HQM A;  2LF7 A;  1T98 A;  4R1H A;  1XSX A;  3QU3 A;  1WQ2 A;  3SFZ A;  3QOP A;  4PCQ A;  2KIF A;  5HS9 A;  1S7O A;  3J80 K;  3RI4 A;  4UNO A;  4N0B A;  2K86 A;  1G3T A;  4L9J A;  3F6O A;  1Z9C A;  2MD5 A;  1HSJ A;  5FB2 A;  1OR7 A;  4IHS A;  3KCC A;  2ZFW A;  1NHA A;  2HFH A;  1I1S A;  5LHI A;  4UVA A;  1XSV A;  3DQV C;  4YIF A;  3D5L A;  3JTG A;  4G9Y A;  2GXG A;  3TDZ C;  1PUE E;  5D5U B;  2KKO A;  1S8N A;  4I2O A;  1F1Z A;  4GCV A;  5EEH A;  3JSO A;  2XAQ A;  1QO0 D;  1MD0 A;  3FMS A;  3AAF A;  3LST A;  3PQK A;  2PI0 A;  2KJC A;  4PDK A;  3K1P A;  3QP5 A;  5DD8 A;  1TQP A;  2F5E A;  3B02 A;  5D6E A;  2MLK A;  3CJN A;  1TQM A;  2VOD A;  1XMA A;  2EJR A;  4A0X A;  3GX4 X;  5HDG A;  3VEP A;  4RB1 A;  2ZNY A;  2PMH A;  2EFN A;  3CUQ A;  4HBL A;  1U8R A;  4S05 A;  5J8F A;  2WTE A;  4P96 A;  2WV0 A;  1K79 A;  5LHH A;  1KYZ A;  3U1D A;  5E17 F;  1XCV A;  3HRU A;  3ROU A;  4ESF A;  4CIC A;  2JTV A;  2YSR A;  3ZN0 A;  1L0O C;  2QBY B;  2QQ9 A;  5FFX A;  5FD5 A;  4EM2 A;  3BRO A;  3IL2 A;  2HR3 A;  3F23 A;  2HDC A;  4LD5 A;  5FLX Z;  4ETS A;  5D5V B;  2GZW A;  2MBF A;  4G7H F;  4LLN A;  2M5W A;  3NRV A;  1I6X A;  2G9W A;  2RC4 A;  1ON1 A;  1FSH A;  1ZAR A;  2BYV E;  2EFW A;  4M9S A;  5ED4 A;  1ON2 A;  3L2C A;  2IA2 A;  4Q4Z F;  4MEX F;  1U5T C;  2OZU A;  3G73 A;  4UHT A;  2JT1 A;  1YIO A;  4L9N A;  4HV6 A;  2L4A A;  1FC3 A;  4AIH A;  3WGH A;  1XD7 A;  3ECH A;  3O2P E;  3GFI A;  3B73 A;  4PGG A;  2QVO A;  3HOT A;  2IA1 A;  1Z6R A;  5CVJ A;  5J8C A;  1F9N A;  1LDK B;  3LQR A;  4DNC A;  2EA2 A;  2FU4 A;  2PMU A;  1BM9 A;  4GYI A;  4I09 A;  2NS0 A;  3HHG A;  4KYW A;  2KJB A;  3PQJ A;  2OZ6 A;  3TOB A;  2RV8 A;  3P9K A;  3GF2 A;  2DW4 A;  1S7A A;  1YW8 A;  2F2E A;  1BBY A;  1SD7 A;  3QU6 A;  1R1V A;  2W25 A;  1JE8 A;  4HLX A;  5K5R A;  1J75 A;  1V4R A;  1QZY A;  3RDI A;  1TNT A;  4EJO A;  4OIN F;  3WE2 A;  4HDV A;  2HKX A;  3CUQ B;  1D3Y A;  2J5O A;  3RPU A;  4R79 A;  1DPR A;  1WI9 A;  4LK0 F;  2HQR A;  1U78 A;  4QWQ A;  2VXZ A;  2YX7 A;  1KU7 A;  2CG4 A;  5BOX A;  1KYW A;  3FMQ A;  4EGZ A;  5L3B A;  1U2W A;  4LB6 B;  3TDU C;  2E7W A;  4AWX B;  1UFM A;  1K78 A;  3RJP A;  4Y17 A;  3HRS A;  4KIC A;  1ZLJ A;  4EVI A;  4ZH4 F;  4M74 A;  4BQA A;  3P7N A;  1VTN C;  2OQR A;  2EFQ A;  1SD4 A;  2XAJ A;  4HF1 A;  3EQL F;  4AD9 A;  4MEY F;  5CVU A;  2FEZ A;  1ZH5 A;  2EFP A;  4LK1 F;  1Z05 A;  4EJW A;  3P9I A;  2HYG D;  3MZH A;  1B9M A;  2E7X A;  1JHF A;  5BMZ A;  2GQQ A;  2PQ8 A;  1QQI A;  1KU3 A;  1ODD A;  5JHU A;  2XRO A;  2M45 A;  5H20 A;  1BOA A;  2Y75 A;  5DEQ A;  4M9X A;  3IRQ A;  4OIO F;  1FP1 D;  2IP2 A;  3J81 Z;  2GXB A;  1OYW A;  3L9F A;  4IRG A;  4O5V A;  3DPL C;  1RUN A;  3V8K A;  1JXS A;  5ERI A;  1CF7 B;  2DI3 A;  4IRI A;  3CDH A;  3HRM A;  3DP7 A;  3IWF A;  1HKT A;  1BC8 C;  4LJZ F;  2Y0M A;  1TW3 A;  2HGC A;  3T5X A;  5JFR A;  2QLZ A;  4IHT A;  1HW2 A;  1S3J A;  2ETH A;  3RKY A;  4JBA A;  5ILU A;  2VC0 A;  1O3Q A;  3LA7 A;  4ZZD A;  1RNL A;  4ENK A;  1DDN A;  1TNS A;  4RGR A;  3ELK A;  3ERE D;  3WTV C;  3KP3 A;  4QLC U;  1YS6 A;  1BJA A;  3KE2 A;  3I58 A;  2RDP A;  2BEO A;  2IA0 A;  5ICC A;  2Q0O A;  3DPT A;  4K2E A;  1L3L A;  1FBU A;  1OYI A;  1KU2 A;  4RAZ A;  4KFC A;  2TDX A;  2JRT A;  4CHU A;  1J59 A;  2O8X A;  4A2U A;  3C7J A;  4EJT A;  3M8E A;  1J7K A;  2KRF A;  2EV6 A;  1RZ4 A;  3GLX A;  1PP7 U;  4EJU A;  2VBW A;  3WTU C;  1IXC A;  3CO7 C;  3E5X A;  3HRT A;  1HQC A;  3COA C;  5LHG A;  2VT2 A;  4G94 A;  2F5D A;  4ON0 A;  1Y0U A;  3HSE A;  1S6L A;  2JPC A;  1YLF A;  4AVP A;  1SMY F;  1SD5 A;  2FF4 A;  3WU0 A;  2ZME C;  4ENM A;  2P5K A;  2P5V A;  1ZLK A;  4G6Q A;  1FNN A;  1HST A;  4HX4 A;  3DF8 A;  3FXU A;  2FNA A;  3REO A;  1CGP A;  2DAO A;  4HX8 A;  2XVC A;  4M72 A;  1IN7 A;  4MQ9 F;  3HSR A;  3ZMS A;  5AON A;  1R7J A;  3CTA A;  1PDN C;  3RPQ A;  2ELH A;  2MC3 A;  2BV6 A;  3H3Z A;  4HZF A;  3QAH A;  4OOI A;  4E70 A;  4L0Z B;  4MTE A;  3W6K B;  2EWN A;  4IF4 A;  3I71 A;  4CO8 A;  1HW1 A;  3H92 A;  5IT9 Z;  2P6T A;  3T1B A;  3E6C C;  2L02 A;  2L4M A;  4Q48 A;  4G8X A;  4NQW A;  1T2K A;  3ABT A;  3KP7 A;  2DBB A;  1XGO A;  2XAH A;  2NYX A;  3FXR A;  3KEQ A;  4A5M A;  2D1V A;  4L9V A;  5D8L B;  3LFK A;  1IUY A;  4GO1 A;  4A0Y A;  1DPU A;  4OIQ F;  1Q1H A;  2W85 A;  1S29 A;  4MQV A;  3LQQ A;  1ZRC A;  3KET A;  2H94 A;  1U5T A;  3ZMV A;  1USS A;  1SFE A;  3LAJ A;  1BI3 A;  1O7L A;  3KP4 A;  2XHK A;  3CUO A;  3MAJ A;  3HOS A;  2HWV A;  2ZO4 A;  5LBQ A;  2QUF A;  1B4A A;  4L0Y B;  3RIR A;  3SZT A;  2MLG A;  3QRF F;  2XAS A;  3V7S A;  4ZYD A;  3FMR A;  1DUX C;  1Z7U A;  3M1E A;  4TV7 A;  3DEU A;  4UXN A;  2H27 A;  3I64 A;  2F5F A;  1XSD A;  2VBX A;  4U0Y A;  2XUB A;  2NNY A;  4HDU A;  2O3F A;  1LVA A;  3CLO A;  1YQA A;  2IVM A;  4HF2 A;  2EFO A;  3R61 A;  3ZMT A;  1LDJ A;  4UV9 A;  3TGN A;  1YW9 A;  2OBP A;  4I01 A;  1P4X A;  4L5J A;  3JTH A;  4ESJ A;  4YII A;  1R22 A;  5F6F A;  2PFB A;  1QNT A;  4LG0 A;  5L3F A;  4XRF A;  2KIU A;  1BI2 A;  4XSZ F;  1TW2 A;  2L01 A;  3WOD F;  2V1U A;  5DYM A;  4IRH A;  2D1H A;  4Y15 A;  3QPT A;  3QP6 A;  5AIQ A;  1FP2 A;  5KVR A;  3HTU A;  3WU1 B;  4KA4 A;  2XAG A;  2RN7 A;  4GXO A;  4OMZ A;  1B9N A;  4KIF A;  2VON A;  3M8F A;  1T0F A;  2ADU A;  3VFZ A;  2DPD A;  1XGM A;  3TO6 A;  3BDD A;  1OKR A;  3WTY C;  3WTZ A;  1W5T A;  2FBK A;  5FO5 A;  1Z6T A;  4CXF A;  1G3S A;  4A6E A;  1STZ A;  3IRR A;  2XV4 S;  4P55 A;  2ISZ A;  2HS5 A;  3TKY A;  4A0Z A;  4I0B A;  5DCM A;  5E8I A;  1XB4 A;  3R6S A;  2C6Y A;  5F64 A;  3WTT C;  3HSF A;  5HLI A;  4WCG A;  2O61 A;  3MWM A;  1T6S A;  2M30 A;  4KT5 C;  3LWF A;  2LKP A;  3F8F A;  2PJP A;  3KLO A;  5LGT A;  1ZRE A;  3O6B B;  2CWE A;  1MGT A;  3V4G A;  5E8G A;  1H0M A;  3BJO A;  1IRG A;  3DV8 A;  3R0J A;  3BZ6 A;  1I5Z A;  5HLH A;  1R00 A;  1F4K A;  1QBJ A;  3IKV A;  5HVQ C;  5JI6 A;  2RNJ A;  4WWC A;  2CW0 F;  4KMF A;  1LQ1 A;  2V1X A;  2ACJ A;  2HTJ A;  2V1D A;  1YS7 A;  2W84 A;  3N97 A;  3DKW A;  2Q8K A;  4F7Z A;  2ISY A;  1OMI A;  2OQG A;  2XGX A;  3L7W A;  3GXO A;  1ZYR F;  3EYY A;  4UUV A;  2DK8 A;  3VB2 A;  2FA5 A;  2VE9 A;  4LG0 B;  1ZN2 A;  5BPD A;  3GWZ A;  1YG2 A;  1O3T A;  2ESH A;  1C0W A;  2YR2 A;  4OMY A;  5D4R A;  4P9F A;  2D45 A;  4P9U A;  5JR3 A;  5LLQ A;  2D2W A;  2JSC A;  1XGN A;  3VOD A;  5FD6 A;  3TO9 A;  2K7L A;  3BOQ A;  5KK1 A;  2NRA C;  1R5G A;  1R23 A;  4U0W A;  1YFH A;  1TQI A;  3N4M A;  2Q2E A;  4LMY A;  4KIB A;  1E17 A;  4ZYH A;  1IXS B;  5CVV A;  1B6A A;  3CUQ C;  2CO5 A;  5ICG A;  5L3C A;  2DQR A;  1MDM A;  1W5S A;  1XGS A;  2ZCW A;  4PGH A;  3GEZ A;  2M8E A;  3ULQ B;  1P92 A;  2STT A;  3ZQ7 A;  2AS5 F;  3HHH A;  3I59 A;  3JAM K;  3FHZ A;  4OU0 A;  4BHP A;  4ZZL A;  4RS8 A;  3KP2 A;  4B8X A;  3LA3 A;  4Y13 A;  2WWY A;  3WTS C;  3VOE A;  3Q9S A;  4CGZ A;  2CQK A;  4I02 A;  3WGG A;  2PN6 A;  2B0L A;  2QEN A;  3RYP A;  2R7F A;  3V8J A;  4MHG A;  1R1U A;  2UXN A;  4M73 A;  1TBX A;  4BNC A;  1T38 A;  1IN4 A;  5L3E A;  2DQL A;  3V8L A;  2EV5 A;  1RIO H;  2R7D A;  4BAY A;  2FRH A;  4BHB A;  3MFK A;  2RGV A;  1K7A A;  4HW0 A;  4ENN A;  5ICE A;  3SZP A;  2ZNZ A;  3KZY A;  4BYY A;  1YTY A;  4XLP F;  1IF1 A;  3WGI A;  1HKS A;  1EH8 A;  4BXU A;  1HXD A;  2OU2 A;  2XKP A;  5LRS A;  1W7P D;  4RGU A;  4XBF A;  5E18 F;  3P9C A;  4JK1 X;  3F22 A;  1FYL A;  1P4W A;  3K9T A;  3GUD A;  4RB2 C;  4EM1 A;  1KA8 A;  1LEA A;  5D5W B;  3F8M A;  1FYK A;  3G3Z A;  1HW5 A;  3LA2 A;  4NHJ A;  1JHH A;  1JGS A;  3OOP A;  1E2X A;  2MA3 A;  2HEO A;  1K78 B;  3BPX A;  2GA1 A;  2FOK A;  1EV7 A;  4I0A A;  4ZYE A;  5H6R A;  2BE5 F;  3R60 A;  1BIA A;  2J5P A;  1IN8 A;  3F8B A;  1H9G A;  3L00 A;  1FT9 A;  4B09 A;  1KQ0 A;  3MEX A;  3EET A;  4RGS A;  3E6B A;  2A68 F;  4I7H A;  2RVC A;  1IXR C;  3M7G A;  2P7C B;  1ZGJ A;  2W24 A;  4WXH A;  1MZB A;  2IRF G;  1XCB A;  4UVC A;  4Z2Y A;  5LEK A;  3WTX C;  2A61 A;  4N9H A;  4RGX A;  4EJV A;  2HKO A;  1Z91 A;  3IHU A;  3U2R A;  4YFN F;  4R8H A;  2HQN A;  1ONV A;  3EUH A;  5LGU A;  2CFX A;  4YFX F;  1YW7 A;  3C18 A;  3I54 A;  3TOA A;  2Z99 A;  4S04 A;  5DD4 A;  1LJ9 A;  1AOY A;  2VBZ A;  4D0P A;  2HOE A;  1RUO A;  4A12 A;  1LNW A;  3ZP5 A;  5HDK A;  4MGR A;  2UWM A;  1D8J A;  3K1N A;  2X4H A;  1ZHF A;  3EYI A;  5K1Y A;  4XLN F;  4CDG A;  3F72 A;  5L3D A;  5CVI A;  2P4W A;  1FSE A;  3E6D A;  2VE8 A;  2LNB A;  2L54 A;  2V6C A;  3BP8 A;  5DCF A;  5CYV A;  3RTR A;  4L18 B;  2CSO A;  1O3R A;  1B59 A;  1D8K A;  2Z9O A;  3GZ6 A;  3S2W A;  3TO7 A;  1SFX A;  1G3Y A;  4RAY A;  4OIP F;  2VOP A;  2A69 F;  5A2Q K;  2NAZ A;  4LLG F;  2VBY A;  2PLY A;  1FYM A;  1ZG3 A;  4BH9 A;  2FSW A;  2YPR A;  1IN5 A;  3GYH X;  2A5Y B;  3FX3 A;  1WRJ A;  4LGW A;  4RB3 C;  2KIM A;  2E1N A;  3PFI A;  1AWC A;  3FWE A;  1ZG1 A;  2RQP A;  3M9A A;  4WXD A;  1U3E M;  3BY6 A;  2QM3 A;  2QWW A;  2FE3 A;  4O6J A;  2IT0 A;  3GZ5 A;  1UB9 A;  2ESN A;  1TLH B;  1F5T A;  1XDS A;  2O0Y A;  3GFL A;  2DFI A;  3KZZ A;  3C3W A;  3MCZ A;  5IT3 A;  2X0L A;  4EQQ A;  1UST A;  2XAF A;  2MH9 A;  1WWX A;  3GW2 A;  5E1X A;  1WSU A;  1QZZ A;  3GFJ A;  1MJB A;  4M9Z A;  2HYF A;  1BI0 A;  1UCR A;  2K27 A;  6PAX A;  3Q5F A;  2EB7 A;  5DDG A;  5D5X B;  3C1D A;  1V3F A;  2PBI A;  3KFW X;  2GWR A;  3RKW A;  4YFK F;  1P2F A;  2YX4 A;  5LRR A;  3T8T A;  1SMT A;  4M6Y A;  1GHC A;  2A3S A;  4IJA A;  3IC7 A;  4U7D A;  4EM0 B;  3I53 A;  5CJ9 A;  1DP7 P;  4CZZ A;  1SFU A;  4WXC A;  3GVA A;  1QGP A;  5D8K B;  3ZMU A;  4H0E A;  5HS8 A;  3F21 A;  4U7B A;  3FXQ A;  1X3U A;  2A07 F;  4HV5 A;  1O7F A;  5DV5 A;  3FZV A;  1GXQ A;  2YU3 A;  2CGP A;  1MKM A;  2P8T A;  2XIG A;  4RB0 A;  3BJ6 A;  5E20 A;  3E5U A;  2FBH A;  2WC2 A;  1YYV A;  3FM3 A;  4U0V A;  2P7V B;  1GVJ A;  1KGS A;  1U5T B;  1P4A A;  2DK5 A;  3WE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...