3CUQC

Integrated structural and functional model of the human escrt-ii complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
173
Chain Sequence
SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
total genus 46
structure length 173
sequence length 173
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 3cuqC01
3WODF 5ICGA 2OQRA 3Q9VA 3E3VA 1IN6A 1BJAA 2ZNYA 1SMTA 1ZHFA 2XAHA 1T2KA 2PG4A 4Q4ZF 3DP7A 4ENJA 4A6DA 1FLIA 1JGSA 5IT9Z 2IA2A 1T6SA 3QAHA 4KUMA 5BMZA 3LA7A 4P96A 2XVCA 2VT3A 2H94A 2IT0A 4XSXF 3L2CA 1I1GA 3FXRA 4KN7X 5J8FA 1FBQA 2B0LA 3HOTA 3CTAA 3WGIA 1DPRA 1U5TA 3IC7A 2ZJ2A 2Y48A 2HYGD 1L0OC 1W5SA 1YW7A 3TOBA 2DK8A 1YW8A 2J5PA 3F22A 4UVBA 3T0YA 3JTGA 1V3FA 2UWMA 3LA2A 2V1UA 1OYIA 1BI3A 2A3SA 3OOPA 4ZYHA 5BS6A 2EV0A 4GYIA 3RIRA 1SD5A 2IP2A 3HRTA 3LQRA 2K4BA 4AD9A 2DW4A 4OIPF 4LG0A 1HXDA 1YIOA 3RPUA 2GZWA 2W85A 4WXCA 1REPC 3E5XA 4AIJA 3HOSA 2P7CB 4NQWA 4LB5A 2RQPA 4OOIA 1TW3A 5F64A 2R7FA 4EM0B 4HQMA 5CJ9A 2RDPA 3R0AA 4L9NA 3V8LA 4Q47A 1WWXA 1YO5C 2YPRA 3O6BB 5D4RA 3KFWX 2HQRA 4R8HA 3NRVA 2XIGA 2WV0A 3JSPA 5IT3A 4WCGA 3VEPA 1D8JA 3F8FA 4XRFA 5ED4A 4MHGA 4WXDA 5CVUA 4G7OF 3DQVC 1LNWA 2JTVA 3F8BA 4A2UA 2DPUA 4BHCA 1Z91A 4UV9A 5D6EA 3GFMA 1LEAA 4M73A 2VE9A 2F5CA 2WC2A 1UB9A 3LAJA 2QENA 4IHSA 4O5VA 5EEHA 4EGZA 1LVAA 2BBYA 1WRJA 2XKPA 1R5GA 1ZGJA 1P92A 2M8EA 5FFZA 1OYYA 2IW5A 3K0LA 2Q2EA 4JK1X 1B59A 5HLIA 4AVPA 2PLYA 4U7DA 1MGTA 4N9IA 5H6RA 5HLGA 4P55A 3G3ZA 2QM3A 2VONA 2EV6A 4A0YA 1TQMA 3JW4A 2R3SA 4HLXA 5HOOA 1WI9A 2Z3YA 3EQLF 2O61A 2PJPA 5FGMA 1F1ZA 2M1BA 1J0RA 3WTTC 1R1VA 1TQIA 2UXNA 2RKHA 3KP4A 3KP3A 2L3DA 1IN8A 4P9FA 3LQQA 3ML6A 1R7JA 1LDDA 1R58A 5LBQA 5HDGA 2PEXA 2V9VA 2ZBKA 3DFGA 5L3DA 3VFZA 3REOA 2MLGA 2OQGA 3BPXA 3PQKA 4CICA 3R6SA 3M1EA 1X3UA 1LJ9A 2CYYA 2GA2A 4CYDA 2K02A 4WF2A 2F5DA 2M5WA 2DT5A 1GXPA 4LLLA 4PDKA 1GXQA 3BOQA 5DUIA 1D8KA 5FD5A 1SFUA 5D5VB 2UXXA 1YYVA 4PGHA 1FYMA 2ZNZA 2STTA 2RNJA 4HV6A 4IPAA 1P4WA 2V1DA 3WGHA 2VOPA 4EMSA 4FT8A 1G4DA 4NHJA 2H6CA 1T38A 2DI3A 3BJ6A 1RI7A 2Y75A 2D2WA 1W4MA 3R60A 4A6EA 3GW2A 4A5NA 1FZPB 3MEXA 1HKSA 4ENMA 1QQIA 3ZP5A 3QPTA 3FM5A 3MAJA 5CLSA 1O7LA 3P9CA 5HDNA 1J75A 1MJ9A 1SD7A 1Q1HA 3QRFF 3DPLC 1TNTA 3KLOA 1LQ1A 3RPQA 4M74A 1I27A 5D5UB 1G3SA 2GIVA 3HTSB 2XUBA 3RDIA 2P8TA 2ELHA 3CO6C 2HYFA 1U2WA 4IJAA 2CFXA 3V7RA 5DCFA 4YIFA 2NNNA 4AWXB 4L9TA 2QBYA 5AIQA 1V4RA 3BPVA 3CJNA 5ICCA 4RB1A 1RUOA 4LFUA 4U0WA 4KIBA 2C6YA 1R23A 1IXCA 4CXFA 4QLCU 1D5VA 2OZUA 2Y0MA 2H27A 3ECHA 4EVIA 4EJTA 4YG2F 2L54A 2HKOA 3CDHA 4L0YB 3CUOA 5BQTA 2MD5A 1R5HA 2O3FA 3V7SA 1OMIA 4H0EA 3L9FA 3TOAA 1ULYA 4Y15A 1F9NA 4K2EA 1S7OA 3ZN1A 2XAGA 2OD5A 4JBAA 4ESJA 4FX0A 5FLXK 1SD4A 5LHIA 4Y17A 3BROA 4L9VA 2FXAA 3ULQB 2EV5A 1KYWA 3QPHA 3BY6A 2KJCA 4IRGA 4HZFA 1FY7A 5IT9K 2ISYA 5FD6A 1MD0A 2HOEA 1P6RA 2IA0A 1R22A 4I0BA 3FZVA 3Q5FA 4MNUA 3Q9SA 2HGCA 4UXNA 1LEBA 4GYGA 4KFCA 2E1NA 1U6GA 2L01A 2CSOA 4TV7A 3JAMZ 5JR3A 2HQNA 2BE5F 2XAQA 5D5WB 1XGOA 3WTWC 5DUKA 2ACJA 4HF2A 5DCMB 3R61A 2FBIA 3RKYA 3M9AA 1XMKA 1JXSA 2NRAC 3RJPA 3V7CA 3FX3A 3ABUA 1XCVA 4O3MA 2PQ8A 2L4AA 1IXSB 5E1ZB 4DNCA 1BI2A 2XV4S 3IRQA 4I02A 3WTXC 2KIFA 1XDSA 4HAMA 3C7JA 4M71A 1KA8A 1RUNA 4FX4A 1E2XA 2DPDA 4O6JA 3TDZC 3WU1B 3HTUA 1S29A 5ILVA 2TDXA 4PZJA 4IRIA 2XHKA 1FSEA 3B02A 4OIQF 5ICEA 1ZYRF 4MTEA 3EUHA 2HR3A 3TO9A 2ADUA 2DFIA 3T1BA 1O3RA 2XAFA 2E1CA 6PAXA 2YX4A 4HX8A 5CVJA 1EH6A 3GXOA 1OR7A 3TQNA 4N0BA 4ZYEA 3D5LA 3KP7A 1LDJA 5FLXZ 2RGVA 3WTVC 1U5TB 2PI0A 1BIAA 3DKWA 3MZYA 3WU0A 4MEXF 5DD4A 4I98B 5E17F 4YFKF 2V6CA 3PFIA 3LWFA 1BOAA 1YTYA 1IRFA 1K78A 1J2XA 1FT9A 2DQLA 2QQBA 4YFNF 5TRDA 3R0JA 3WTUC 3BDDA 2GA1A 5FB2A 3I4PA 4LG0B 1USTA 3J81K 5K1YA 1HKTA 4OINF 5LGUA 5HDKA 3ABTA 1USSA 3FMQA 2Z99A 3U1DA 4IRHA 3CUQB 2P5VA 2V79A 3K9TA 3IKVA 1IN7A 1FBUA 3COAC 4ENNA 2D1HA 1DUXC 3SQNA 2D45A 5H6QA 4BH9A 2ZXJA 4R1HA 3ZQ7A 1MKMA 5L3BA 3K2ZA 3WE3A 3BJAA 2PFBA 2M87A 1HSTA 2ZMEB 2VBYA 3MCZA 5DYMA 3FHZA 4MGRA 2FQ3A 1TNSA 1Z1DA 2KKOA 1W7PA 2O6GE 1GVJA 4EJOA 4HV5A 4LMYA 3PQJA 3KCCA 2OA4A 3I54A 1S8NA 2ZCWA 1FYLA 3FMRA 2FMLA 5KVRA 1B9MA 1BC7C 4ESFA 4P5OA 2GXGA 3GFJA 2FEZA 1KGSA 2VXZA 4U0YA 1ZRDA 1OYWA 1QGPA 2QZ8A 1S6LA 1IN4A 1ODDA 1WSUA 2QQ9A 3P9IA 5LLQA 5DD8A 2Z33A 2CGPA 4RGXA 2FA5A 4M9ZA 1KQ8A 2Q8KA 5L3GA 1T98A 2X0LA 1ZRFA 3S2WA 2BYVE 5JHUA 2XASA 5E8GA 2FSWA 4PGGA 5D5XB 2VT2A 4RGUA 3E5UA 2VODA 1TLHB 2FE3A 1IUYA 4UHTA 3M8FA 1H0MA 1IXRC 1HKQA 2GAUA 1RNLA 3HYIA 1R1TA 1ON2A 1ZG3A 2A61A 3KP2A 4I01A 5D8KB 2EB7A 3U9GA 3FMSA 1J59A 2E7WA 3F6OA 4IXAA 2FBHA 2DTRA 3ELKA 3GFLA 2WTEA 4G9YA 3P7NA 4EJWA 4RS8A 2VBXA 3K1MA 3KZZA 3VODA 3F8MA 2PMHA 3GLXA 4G8XA 5J6XA 1O3SA 2CO5A 1LB2A 3JTHA 1TBXA 1SD6A 1MDMB 1B9NA 1XDUA 4U7BA 2YSRA 5A2QK 1Z7UA 2Q0OA 1UHMA 2D1VA 4I2OA 3F8NA 3GWZA 2A6EF 1P4AA 2HWVA 3E6MA 3G73A 1XGSA 1TQPA 4HOBA 3AAFA 2P6SA 3T8RA 4ZH4F 2O8XA 4GCVA 1HW1A 3KZYA 1HW2A 4ESBA 2CW0F 4F7ZA 3L7WA 5ERIA 5JVTA 3WGGA 2P6TA 2EFOA 4EV0A 5DCMA 2HTSA 2G7UA 1KU7A 2H6BA 1MJBA 1BI0A 5K5QA 2VBWA 3V8KA 3TO6A 3ROUA 3I59B 1K7AA 2M45A 3FWEA 3K69A 5DV5A 5D6FA 3B73A 2ZMEA 1CF7A 5HS8A 3F8CA 5J8CA 3MQ0A 2HTJA 3IHUA 3GVAA 3I71A 4BYYA 3H3UA 3IKTA 1H9TA 2UZKA 5HVQC 3R4KA 3GX4X 1YQAA 3ZMUA 2GXBA 5HS7A 3RYRA 3KLNA 4I09A 5CYVA 1IF1A 3WTZA 5E18F 1KQ0A 3I53A 4M9XA 2JSCA 5DEQA 1B4AA 1A04A 3QU6A 2W24A 1Z9CA 5LRRA 4HW0A 1J5YA 5F6FA 1U5TC 2HFHA 4AIKA 4M6XA 2PN6A 4LLNA 1B6AA 2NYXA 1AOYA 3H92A 2EA4A 4OIRF 2PMUA 2HS5A 2P7VB 2CG4A 1P4XA 5LEKA 3BWGA 3BP8A 4EGYA 4HF0A 4LLGF 5K5RA 5CVRA 1SMYF 3F23A 4RAZA 1PP7U 2FF4A 2A07F 4UV8A 1L3LA 4LD5A 1SAXA 2IA1A 4BXUA 2RV8A 3CUQC 1MZBA 2ZKZA 3ZMSA 2NNYA 1MDMA 4ENKA 2XROA 2GQQA 5L3EA 3I64A 4ZZDA 4UUVA 4HX4A 2W57A 4MQ9F 3I0TA 1KU3A 2NS0A 1WQ2A 3KETA 3RI4A 1DDNA 4L0ZB 3H3ZA 3J80Z 2YR2A 4HF1A 3FXQA 1Z6TA 1PDNC 3E6BA 1XGNA 2IRFG 4G7ZF 4UNOA 4KIFA 3RTRA 4B09A 1DPUA 4UVAA 1IAWA 3GYHX 2JPBA 3BZ6A 2OZ6A 4KN4X 4ZYDA 2W84A 4L5IA 4ZYGA 2VE8A 4HA8A 1EH7A 1R1UA 2DO7A 2H09A 5AIPA 2X4HA 2JRTA 1KYZA 2LKPA 3JSOA 2JPCA 3E6CC 4RAYA 1BIBA 4HDUA 2EWNA 1G3TA 1IW7F 1YS6A 2O0YA 3F21A 1S7AA 3E97A 1PUEE 4HX7A 4CDGA 1Z6RA 1B1BA 1UCRA 4RB3C 1PP8F 3FF5A 3C1DA 5HLHA 1GHCA 1G6NA 1S3JA 1ZN2A 4E70A 3I58A 1W5TA 4XLPF 5E8IA 1O57A 3GFIA 1FNNA 2CQKA 5AONA 3KP5A 1XGMA 2XKOA 3T8TA 5ILSA 2P4WA 1Z05A 2KJBA 3ZPLA 5KK1A 3CLOA 3FM3A 3CUQA 5CVVA 3ISPA 2F5EA 4ON0A 2R7DA 3U2RA 1U8RA 4KDPA 2EFNA 1BN5A 1I6XA 3KEOA 4HQEA 1Y0UA 1XSDA 4A0ZA 2G9WA 4FHTA 2IJLA 2NAZA 2EFPA 2OBPA 3GEZA 4A5MA 3JAMK 1YFHA 4KNYA 4RB0A 3WG9A 3D0SA 4L5JA 3EYYA 3LA3A 4WXHA 3MWMA 2J5OA 5BPIA 4BHBA 4R79A 3HIFA 1ZRCA 1I1SA 3F72A 3RKWA 5ICFA 1MJAA 3FXUA 4BNCA 4ETSA 1BC8C 2FU4A 2A5YB 3IWFA 3IL2A 4I0AA 2KIMA 1H9GA 1KU9A 2ESNA 3WE2A 1XSVA 2ISZA 2W25A 2MH9A 4G6DA 1ZLJA 1HBXG 3I59A 3DPTA 1ZG5A 1R36A 3M7GA 3DF8A 4XBFA 1K79A 2DQRA 1YLFA 2MA3A 2V1XA 3F6VA 2DU9A 1K6OA 4QWQA 2QBYB 1KQ9A 2O03A 4RGSA 2COMA 1HSJA 1O3TA 2M30A 3GO5A 5JFRA 3L00A 3DEUA 2VC1A 1FBSA 1ZGAA 2K86A 5DDGA 1KU2A 4LK1F 3LSTA 2EA2A 4LGWA 2XRNA 2CWEA 1YG2A 2A69F 4OU0A 2DAOA 1SFXA 5E1XA 2P5KA 3ERED 5D8LB 1XCBA 3EDPA 3VB2A 2OAZA 4LB6B 3SXYA 3VOEA 1U3EM 5BOXA 2ZMEC 3K1NA 2EK5A 2HZTA 4M72A 3T5XA 4M9SA 4GGGA 3GZ5A 4PCQA 4LJZF 2RN7A 4BQAA 1FPQA 1W7PD 3E5QA 4B8XA 5LHHA 2LDUA 4UVCA 5CVIA 3KE2A 4KIGA 1XD7A 2E7XA 4G6QA 3V4GA 3L09A 4ZZLA 4HBLA 4CHUA 2MH2A 3ZN0A 4XLNF 3QP6A 1R00A 4WWCA 1ZLKA 1ZG1A 1TTYA 4JQFA 3ZMTA 1F4KA 5A2QZ 2WWYA 2KIUA 4EJUA 3HRSA 1BM9A 2MC3A 4HYEA 5ILUA 5LRSA 3HRMA 4BHPA 1CGPA 2F5FA 4KICA 5FO5A 2P5LC 1IZ1A 3IWZA 2LF8A 5LGNA 1SFEA 4CZZA 3HUGA 4OMYA 1STZA 4OIOF 4KA4A 2QWWA 3SZTA 3J80K 2JT1A 3J81Z 2A6HF 1EH8A 1ZAOA 4LK0F 2L02A 1QPMA 1JE8A 3KP6A 1QO0D 3MFKA 3HRUA 2EJRA 2YU3A 4GO1A 5HS9A 3ECOA 2XAJA 4EM1A 1EV7A 1DP7P 1RZ4A 1O7FA 3RYPA 1J9IA 3O3KA 3LAPA 3HHHA 2EFWA 1FOKA 4WX9A 2ESHA 2JZYA 3OV8A 1ZARA 4DQ2A 2GWRA 2LF7A 4KT5C 1JHHA 5F1RA 4KMUX 2KRFA 4IHTA 1FX7A 2F2EA 2FRHA 2QUFA 3RKXA 1XB4A 4YFXF 5EEGA 1FP2A 1XMAA 2VBZA 4P9UA 2AXLA 2K4JA 4A12A 2FOKA 1QZYA 4MTDA 2RC4A 4RB2C 3C18A 1FWZA 4EQQA 1AWCA 3KEQA 2AS5F 2FBKA 3WTSC 3IRRA 1FP1D 4GXOA 3W6KB 1E17A 5E20A 2IPQX 5BPDA 3SFZA 4OMZA 4A0XA 1QZZA 2K7LA 3O2PE 1QNTA 2HEOA 4BAYA 2OU2A 3EETA 3ZMVA 2QLZA 4XSZF 4G7HF 2LNBA 3ZMDA 1OPCA 4EM2A 3V8JA 3HSEA 1NHAA 3F3XA 1FYKA 4N9HA 4M6YA 3QOPA 1XSXA 2LSOA 4L18B 2BEOA 3EYIA 2DBBA 3GF2A 2A68F 1HW5A 2QYOA 3TKYA 4L9JA 2ZO4A 3C3WA 1WKMA 2FNAA 5L3CA 3HSFA 2MBFA 1O3QA 3N4MA 4Z2YA 4HLYA 3NQOA 3HHGA 5E1WA 2XGXA 1C0WA 2Z9OA 1LDKB 1YS7A 1F5TA 1ONVA 4S05A 2QVOA 3ZMZA 4IF4A 2G7HA 5JI6A 1RIOH 1YW9A 1OKRA 1G3YA 2STWA 1QBJA 2EFQA 3TDUC 3P9KA 1W7PB 3TGNA 4RGRA 4HDVA 3K1PA 4U0VA 3NEUA 5LHGA 2Z5UA 1ZREA 2BV6A 1JHFA 2DK5A 3TO7A 4MEYF 2QQAA 3I5UA 3GZ6A 4MQVA 3M8EA 3SHFA 5D4SA 2VC0A 1T39A 2VOOA 3WTYC 1HQCA 3CO7C 4IVNA 2VN2A 2HKXA 2MLKA 4NB5A 3SZPA 5LGTA 2FMYA 3BJOA 1ZH5A 3DXJF 1IN5A 2DLLA 2BGCA 5LEJA 4Y13A 1I5ZA 1G3WA 3HSRA 4WK8F 4ASNA 4CO8A 3QP5A 3MZHA 2HDCA 1ON1A 4CGZA 4AIHA 4YIIA 1K78B 3W6JB 2ETHA 3QU3A 4I7HA 5K5OA 5TJJA 1BI1A 1J7KA 1UFMA 2FNPA 3GUDA 3E6DA 1U78A 4EJVA 2YX7A 4KYWA 1FC3A 2ZFWA 1XN7A 2IVMA 5L3FA 4D0PA 4G94A 1T0FA 4Q5SF 2K27A 3N97A 4S04A 5H20A 1VTNC 4U88A 2L4MA 1UHWA 1IRGA 1BBYA 2PBIA 2RVCA 1P2FA 3LFKA 1FSHA 5FFXA 1CF7B 4KMFA 3J7AO 3DV8A 4Q48A 1D3YA 1TW2A
chains in the Genus database with same CATH superfamily
3TL4X 3WODF 5ICGA 2OQRA 3Q9VA 3B6AA 1X4PA 3E3VA 1IN6A 1BJAA 2ZNYA 4JOMA 1SMTA 1ZHFA 2XAHA 2LKSA 4RM2A 2PG4A 4XRSG 3ZCOA 1T2KA 2BHYA 1VQ7I 4CUGA 2LMDA 5FKKA 2A6TA 4Q4ZF 2VKHA 3DP7A 4ENJA 4A6DA 2HXOA 3IUOA 2E19A 1FLIA 1GLNA 1JGSA 5IT9Z 4PK4A 5EDNA 2DOAA 4ZDOA 3HOWJ 4BBRJ 2WB1A 2NVQJ 2IA2A 1T6SA 4PJMA 1WI3A 3QAHA 4KUMA 5BMZA 3LA7A 3A01A 4P96A 2XVCA 2VT3A 2R7ZJ 3BTIA 1B72B 2VQGA 4II3A 2H94A 3EPZA 2IT0A 4ZC3A 5FROA 2HVSA 2E35A 4XSXF 3L2CA 2HNHA 1I1GA 5IP6A 1DP3A 2KRHA 2X1DA 3FXRA 4KN7X 4D7NA 5J8FA 3WHCA 3QWLA 1FBQA 2B0LA 3HOTA 1LE8A 2ZSIB 1Z0XA 1ZR4A 2CMPA 3CTAA 3BR0A 2W48A 3WGIA 2DYSH 1DPRA 2IS4A 1V5GA 3AG3H 1U5TA 3IC7A 1WH7A 2QSFX 2ZJ2A 2Y48A 2EIMH 4CH7A 2TRTA 2VJJA 1MBHA 2EZKA 2HYGD 1L0OC 1W5SA 4AC0A 1NK2P 1YW7A 3TOBA 2DK8A 1YW8A 2J5PA 2GBYA 3F22A 4UVBA 4XONA 1MNMC 3T0YA 2DA3A 1FOWA 3JTGA 1V3FA 2UWMA 3LA2A 1BA5A 2V1UA 1OYIA 3OL3A 4FE7A 2WY8Q 1BI3A 2LR8A 2A3SA 2CW7A 5JHFA 3OOPA 4ZYHA 5BS6A 1Y1VJ 2EV0A 4GYIA 3RIRA 1SD5A 2IP2A 4DBQA 3HRTA 4KISA 1TT5B 4JP0A 3LQRA 2IS1A 2K4BA 2CS3A 4IO9F 4AD9A 1GVDA 2DW4A 3HJEA 4OIPF 3S3NA 1A5JA 2IS6A 4LG0A 1XPXA 1HXDA 1UG0A 1YIOA 2GZWA 1X3WB 2W85A 4WXCA 3RPUA 2HPIA 1REPC 2R7SA 3E5XA 1VQNI 4AIJA 5DS9A 2Y9YA 3DTKA 3HOSA 2P7CB 4NQWA 4LB5A 2RQPA 3LSMA 1TW3A 1ETVA 2EIJH 2ZXIA 4OOIA 1R4NB 5FKOA 5IYBJ 1WVRA 1NG6A 5EGOA 5F64A 2R7FA 4EM0B 4HQMA 5CJ9A 3W2AA 2RDPA 1T95A 3R0AA 5F0HA 4L9NA 1VF9A 3V8LA 3DU6A 1X1CA 4Q47A 3CF2A 1H89C 3GLLA 5EF6A 2LFBA 1WWXA 3EUKL 1V5EA 2ELKA 2L9RA 3U1KA 3SYTA 1BR2A 3CCJI 1YO5C 4JX4A 1QVTA 2YPRA 3O6BB 5GADJ 3DKYA 3QYEA 5D4RA 1GT0C 3W2WA 3KFWX 1E3HA 2VQHA 2HQRA 4M3DA 1RC9A 2RAEA 4R8HA 3KPHA 3NRVA 2XIGA 2QSHX 4AVZA 2WV0A 2X6OA 1D5YA 3JSPA 5IT3A 4WCGA 5F27A 3VEPA 1D8JA 3F8FA 1IDYA 4XRFA 2X85A 5ED4A 4MHGA 4WXDA 5IYDJ 3L2WA 5CVUA 4XICA 4G7OF 1HA8A 4M3GA 3DQVC 2M4KA 1LNWA 2JTVA 3F8BA 4A2UA 4CCJA 2DPUA 4BHCA 1Z91A 2OUMA 4BEHA 4UV9A 4IHYA 5D6EA 1DU6A 4PFOA 1Y39A 3GFMA 3A4CA 4C3IJ 2KDZA 2KISA 2X51A 1LEAA 2KIQA 4M73A 1YX3A 2VE9A 2F5CA 2WC2A 1UB9A 3LAJA 2QENA 3SDGA 4D5FA 4IHSA 1EKEA 4O5VA 2X48A 5EEHA 5IP9J 1IV6A 2XC7A 1I3AA 3WHBA 4EGZA 1LVAA 1IDZA 1TWCJ 1WRJA 2BBYA 2XKPA 2Y31A 1R5GA 1ZGJA 1P92A 2M8EA 5FFZA 1OYYA 2IW5A 3K0LA 2Q2EA 4JK1X 1B59A 2BW3A 2LREA 5HLIA 4AVPA 1MNDA 3M1CA 2NVXJ 3C2BA 3S1NJ 2PLYA 4U7DA 3F9KA 1D1CA 1MGTA 4N9IA 5H6RA 4P55A 5HLGA 3HEFA 3G3ZA 3ZQIA 2QM3A 3ERMA 2VONA 2EV6A 4A0YA 1TQMA 3DBRB 3JW4A 3CC4I 2O5RA 5FKNA 3K4NA 4PSXA 5EG0B 3M8JA 1YIJI 1B72A 5KNLA 2R3SA 1X3ZB 1WJDA 4HLXA 5HOOA 1XTAA 1WI9A 1QA6A 2HU9A 2DMPA 2Z3YA 3EQLF 4XKVA 2O61A 3S3OA 1FIAA 2PJPA 2G0EA 5FGMA 4EATA 1SFOJ 3LOCA 4BU2A 3DWLE 1F1ZA 4UUSB 3IH4A 1ETYA 2M1BA 2Y9ZA 1NK3P 4CCNA 2CU7A 1J0RA 3WTTC 1IGNA 1TW2A 1R1VA 3FXLA 1TQIA 2UXNA 2RKHA 3KP4A 1SFKA 3KP3A 2L3DA 3LL7A 4C9YA 1IN8A 4FISA 2LH9A 4BQOA 1ACIA 4P9FA 3HM5A 1VQ4I 1A36A 1G59A 3LQQA 2W1OA 3ML6A 4XLFA 3U21A 3DBHB 2COBA 1Z3YA 2QGUA 1R7JA 2IGMA 2Y30A 1I39A 4XLCA 3C2HA 3MKWB 4BKXA 1LDDA 5B1AH 1AHDP 1R58A 5LBQA 3E7LA 3A2KA 3FXMA 5HDGA 2PEXA 1K83J 2V9VA 2X9DA 2ZBKA 3DFGA 5EG0A 1W0UA 5L3DA 3VFZA 5BNGA 2VLAA 2BVLA 3REOA 3ZRGA 2MLGA 2OQGA 2H8RA 1JJ8C 1WGXA 3BPXA 3HZJA 4Y3OA 4FQGA 3PQKA 4CICA 3R6SA 3M1EA 1X3UA 2ZXHA 4A3JJ 1LJ9A 2CYYA 2GA2A 4CYDA 3TP3A 2R92J 4BDYA 5HODA 2DTZA 2K02A 2F5DA 4WF2A 5H2FC 5CKTA 2M5WA 3H9QA 4A3IJ 2DT5A 4JX6A 1MW7A 1GXPA 2F4MB 4LLLA 3H1CA 1F36A 2OC6A 5IP7J 2M9HA 3AL0C 4PDKA 1GXQA 5KCMA 2CQXA 2KL4A 3G4SI 3BOQA 1A6IA 5DUIA 3GMEA 1D8KA 2VXDA 5FD5A 1SFUA 1Z3XA 2UXXA 5D5VB 4HRIA 1YYVA 4C3JJ 2VKEA 3CCEI 4PGHA 1FYMA 2ZNZA 2STTA 4F52A 4A3LJ 1V54H 4ZYAA 2RNJA 4HV6A 4B48A 5TISC 1UHSA 4IPAA 4E6KG 3BCAA 1P4WA 4A3MJ 1JTYA 2V1DA 3H9GA 3WGHA 2WAFA 1K4SA 2IS2A 3W3CA 2DA5A 2VOPA 4EMSA 1HDDC 2K9SA 4FT8A 1G4DA 4NHJA 2H6CA 2K5CA 1T38A 2DI3A 2NOJB 3ZXSA 3GTKJ 2IAIA 3BJ6A 2DT6A 3ZOBA 1RI7A 2Y75A 2D2WA 1W4MA 3R60A 4A6EA 1R6RA 1AU7A 1QZEA 3GW2A 4A5NA 1FZPB 2JJ7A 3MEXA 3OYEA 1HKSA 4ENMA 2XB5A 1QQIA 3ZP5A 3QPTA 1PYVA 3FM5A 3MAJA 2P0WA 5F0CA 3BC8A 5CLSA 3FKJA 1O7LA 3P9CA 5HDNA 3OYAA 1J75A 1MJ9A 1SD7A 2MD0A 1Q1HA 3CMMA 3QRFF 2LY1A 1Q1VA 3DPLC 1TNTA 3ZQQA 2P81A 3KLOA 3LSGA 3TBIA 1LQ1A 1JUPA 3BTCA 4I99C 3RPQA 4M74A 1I27A 3FISA 5C3EJ 1FTTA 1Y6IA 2DFFA 5D5UB 3HGYA 1G3SA 2GIVA 2M34A 4CA0A 3FHNA 3HTSB 2XUBA 3RDIA 3H0GJ 2P8TA 3OOUA 2ELHA 3OYHA 4LIUA 3CO6C 2VKVA 1MSFC 4D7MA 2NVTJ 2HYFA 1U2WA 1Z77A 1RRJA 2KZVA 2R7VA 3SEQA 4IJAA 2CFXA 3V7RA 1MBKA 5DCFA 5GTHC 2ME0A 3BR1A 4YIFA 4FETA 4IOCF 3BG3A 2NNNA 1UAAA 4AWXB 4L9TA 2QBYA 5AIQA 2CUZA 1V4RA 3BPVA 3CJNA 3CCYA 5ICCA 3HOUJ 4RB1A 1RUOA 2B63J 4LFUA 1BJZA 4U0WA 2LKXA 4KIBA 3HOZJ 2C6YA 5EJCA 2X6YA 1MNEA 4ANJA 1FOXA 3S14J 1R23A 1IXCA 4CXFA 2DMNA 3AFHA 2K3FA 4QLCU 3PO3J 1D5VA 2OZUA 2PX9A 1QHGA 2Y0MA 3CCVI 2H27A 3ECHA 4EVIA 4EJTA 4YG2F 3A0HC 2L54A 1RETA 2HKOA 2LK2A 3CDHA 4L0YB 2KRCA 3CUOA 3DKXA 5BQTA 2MD5A 1R5HA 2JQ7A 2O3FA 3V7SA 1OMIA 4H0EA 2EPFA 3OIQA 1KONA 3L9FA 1Y8RB 3TOAA 1ULYA 4Y15A 2DN0A 1X1AA 1YRNB 1F9NA 4K2EA 1S7OA 2E71A 3ZN1A 2XAGA 1U0JA 2OD5A 4JBAA 4ESJA 4FX0A 4IX7A 5FLXK 1SD4A 4ABZA 5LHIA 4E7SA 2KZGA 1CQTA 2KPMA 3PSIA 3CJQB 3BQZA 4XORA 4Y17A 3HPGA 2JWTA 3BROA 3DU5A 4L9VA 2FXAA 3ULQB 2EV5A 4HSRA 3BG9A 1KYWA 3CZ6A 3MZ8A 2HQ5A 4E7IA 1B8IA 4UY8I 1W5CC 3QPHA 3BY6A 3JRIA 2KJCA 4FCYA 4IRGA 4YELA 2VJIA 5GPCA 4HZFA 1D0YA 2XF6A 2YS9A 1FY7A 5IT9K 2ISYA 1OJLA 2E1OA 5FD6A 1MD0A 1R5ID 2HOEA 3J7ZI 2IGKA 2K85A 1P6RA 4M6VA 2YU9J 2IA0A 1R22A 3HOYJ 4I0BA 3FZVA 3Q5FA 4MNUA 3QPLA 2EZLA 3Q9SA 2HGCA 4NC7A 1SVOA 4UXNA 1LEBA 2QEXI 2FX0A 4GYGA 4KFCA 2E1NA 2WBMA 1U6GA 1XG1A 4MIMA 1T0FC 2L01A 2CSOA 3ZQFA 1YX5A 3OYGA 4TV7A 3JAMZ 3CQZJ 5JR3A 2HQNA 3ZQLA 2BE5F 2XAQA 5D5WB 1MBFA 1XGOA 3WTWC 5DUKA 1YHQI 2ACJA 4HF2A 5DCMB 2PMZA 3R61A 3FDYA 2FBIA 3K4MA 3RKYA 3M9AA 1XMKA 1LFBA 3AG4H 1JXSA 1ZKGA 2NRAC 2DXIA 3RJPA 5J3LA 3V7CA 3FX3A 3ABUA 2EBIA 4BQNA 4E4HA 1XCVA 1PUFA 2PQ8A 2L4AA 4RAGA 4O3MA 1IXSB 5E1ZB 4DNCA 1BI2A 1YJ9I 1X2NA 4F93B 2ZJQF 4V2GA 4XN0A 1EJ9A 4DYRA 2HDDA 1G2HA 1ORKA 4KITB 3HBLA 3AKZA 3HGGA 1LFUP 1N75A 1UZCA 2XV4S 3H35A 3SDBA 3BG6A 3IRQA 5C4XJ 1OISA 3HKZN 4I02A 3WTXC 3VYSB 2R7OA 2D5VA 1M1EB 1VQLI 2KIFA 1AKHA 1X58A 4NQWB 4IQ4A 2CV0A 2ECCA 2RREA 2WA0A 1XDSA 3DPUA 1A35A 5KAFC 4HAMA 3C7JA 4M71A 2DYRH 4Y7NJ 5K7FA 3ASNH 3A03A 1KA8A 1RUNA 1TWAJ 4FX4A 3VYTB 3DLLF 1E2XA 3BQYA 3Q0UA 4IZZA 2DPDA 1MMSA 4O6JA 5EZGA 4Y4RA 2DOEA 2HDWA 2RNGA 3TDZC 4AM3A 1TP4A 4MFDA 2IBDA 4B43A 3WU1B 3HTUA 2IGOA 1S29A 5ILVA 2TDXA 4PZJA 4IRIA 2XHKA 3BR3A 4S0HB 1FSEA 3B02A 4OIQF 2DMQA 2H8WA 1ZYRF 5ICEA 4MTEA 1TWFJ 5JVGF 1W36D 3EUHA 5TGTA 2HR3A 4B3AA 3TO9A 1IV8A 2ADUA 2DFIA 3RSNA 3T1BA 1TWHJ 1O3RA 2XAFA 2E1CA 1BR4A 2ZB9A 1Y8QB 3OMYA 3LSJA 6PAXA 2YX4A 4HX8A 2BW3B 5DM7F 3BCBA 5CVJA 2VKDA 3M07A 4CYCB 1FJLA 1EH6A 3GXOA 2LBFB 2JVHA 1OR7A 3TQNA 4N0BA 4ZYEA 5DM6F 3HB9A 2DA1A 1HDPA 3D5LA 3KP7A 1LDJA 2LRDA 5FLXZ 2O7OA 2RGVA 4OAZA 3OR1C 3WTVC 1S5LC 1U5TB 5J40A 2PI0A 1VQOI 1BIAA 3DKWA 3MZYA 3WU0A 4MEXF 3A02A 2M3AA 2M7BA 5DD4A 3CC7I 4I98B 1MMAA 3K10A 5E17F 4YFKF 2V6CA 3BTJA 4NUBA 2R7WA 2F6CA 3PFIA 5B3SH 3LWFA 2HYJA 1YJNI 1BOAA 2ICWG 1YTYA 1IRFA 3PL8A 1J2XA 1K78A 1FT9A 2DQLA 2QQBA 4YFNF 5TRDA 4W97A 3MKLA 3R0JA 2KLOA 3K4BA 4HG2A 5J4VA 3FK6A 5C4JJ 3WTUC 3BDDA 3CESA 2GA1A 2E36A 3K2AA 3ONQA 1MH4A 3I4PA 5FB2A 2R5ZA 1K61A 4LG0B 5FRMA 1USTA 3J81K 5K1YA 4IOAF 1HKTA 4OINF 5LGUA 1BOBA 2OCCH 4M3BA 5HDKA 3G1LA 1P7JA 1JT6A 3ABTA 1P7IA 1USSA 2MABA 1D0ZA 2R4GA 3FMQA 2Z99A 3U1DA 4BQQA 3PM1A 4IRHA 3I9V2 1ZELA 4A3CJ 3CUQB 2P5VA 4ITVA 2V79A 3OYCA 2CRGA 3K9TA 3HUGB 3IKVA 4J19A 1IN7A 1E3PA 4II2A 3G6EI 2TCTA 4W1UA 1Z67A 3VSKA 1U9OA 1FBUA 2PMZN 3COAC 4ENNA 2D1HA 3RZDJ 1DUXC 4XIDA 3SQNA 1B8IB 2D45A 5H6QA 2QQ8A 4BH9A 2ZXJA 4R1HA 3ZQ7A 1MKMA 5L3BA 3K2ZA 3WE3A 3EUAA 3JCUC 3BJAA 4JX5A 2PFBA 3LSRA 2M87A 1XX5A 1HSTA 2ZMEB 4GDFA 1V55H 3JRFA 1Z21A 3V42A 2QSGX 2R7XA 3VDXA 2VBYA 4XR6A 3PUBA 3MCZA 5DYMA 3FBIB 5IOZA 1IC8A 2V4JC 4BJTA 3FHZA 4MGRA 2FQ3A 4P1WA 1TNSA 1Z1DA 4FE4A 3TW7A 1LVKA 2KKOA 1W7PA 2F4IA 2O6GE 2NS8A 2Z1DA 1GVJA 3CCUI 4BY1J 1NG7A 4HV5A 4EJOA 1OCOH 4LMYA 3PQJA 3KCCA 1F43A 2OA4A 3I54A 1S8NA 2CV2A 2ZCWA 1VQ9I 3I4MJ 4H4KC 1X1BA 1FYLA 1WH5A 2BHZA 4BJ5C 3FMRA 2FMLA 1WPKA 5KVRA 2XAUA 4LIVA 1JKQC 1B9MA 4X6AJ 5M5WJ 3CCSI 1MIJA 1T56A 1BC7C 3HG9A 5F1JA 4ESFA 2JRMA 4GRIA 4P5OA 2GXGA 3GFJA 2UV1A 2EIKH 2BXYA 2FEZA 5HNHA 1KGSA 2VXZA 4U0YA 5E3OA 1RR8C 1ZRDA 4XL9A 4C3HJ 1PUFB 1OYWA 1SVLA 1QGPA 2QZ8A 3L2VA 1S6LA 3DEEA 3OIOA 1N78A 2JA7J 1ETKA 1YRNA 3NWTA 1IN4A 2MG4A 1T08B 1ODDA 4XNFA 1WSUA 3OIPA 3L1PA 2QQ9A 5B5EC 2OTJI 3P9IA 4XQFA 3GTPJ 3HDDA 2HOAA 2FD5A 5DD8A 5LLQA 2Z33A 2CGPA 2DMUA 4RGXA 2FA5A 4M9ZA 4XOPA 1JKPC 2Q8KA 5L3GA 2K9QA 1T98A 1KQ8A 3KIOA 2X0LA 3KEYA 3G2BA 4NC6A 1AKHB 5FRNA 1D1BA 3S2WA 1T33A 1ZRFA 2BYVE 5JHUA 2XASA 2QCOA 5E8GA 2FSWA 3H36A 4PGGA 5D5XB 2VT2A 2XPUA 4RGUA 3E5UA 2VODA 1TLHB 2FE3A 2B9SA 3Q0VA 1IUYA 2VQCA 4UHTA 4CYCA 3E0JB 3M8FA 3BTLA 3CCQI 2ID6A 3PNYA 1H0MA 3OYJA 3BR2A 4ZTJA 1OQYA 1IXRC 1OCZH 3SZGA 1HKQA 2GAUA 5CQEA 2I8DA 1RNLA 3HYIA 1R1TA 4ZDLA 3DCFA 1X19A 2JA6J 4RAFA 1ON2A 3K4KA 2V9KA 1ZG3A 2A61A 3KP2A 4I01A 5D8KB 2EB7A 4F92B 5EEAA 3U9GA 2JA5J 4KT6A 1QVUA 2B7EA 2EZIA 3FMSA 1J59A 2E7WA 3F6OA 3NARA 3Q3SA 4C30A 4IXAA 1POGA 2FBHA 1HCRA 2DTRA 3ELKA 3GFLA 2WTEA 4HNTA 4RBOA 5FLVA 1K6YA 2LLKA 4G9YA 2HQAA 3P7NA 2KT0A 4EJWA 3GTLJ 4RS8A 2VBXA 2JMWA 3GTQJ 2DA2A 3LSIA 3K1MA 3KZZA 3VODA 3F8MA 3L2RA 1SEUA 2PMHA 3GLXA 4G8XA 1RR7A 5J6XA 1Z7LA 1O3SA 3L2UA 2CO5A 1LB2A 3JTHA 3HXLA 1TBXA 2A5WA 1SD6A 3QYFA 1MDMB 3CF5F 1B9NA 5J4YA 5IYCJ 3CCLI 4A69C 3DBLB 2VIXA 3D5SC 1XDUA 4U7BA 2YSRA 5A2QK 2ZXWH 4V19K 1Z7UA 2Q0OA 1WJEA 5JLXA 1UHMA 4MFEA 2D1VA 2E2IJ 3F8NA 3GWZA 2A6EF 4I2OA 1P4AA 2HWVA 4D9JA 3E6MA 3G73A 2AXTC 4BGDA 1XGSA 1VQMI 3CJRB 3GTOJ 1TQPA 4M3EA 4HOBA 3AAFA 2P6SA 3T8RA 4ZH4F 2O8XA 3GBGA 2F48A 4GCVA 1HW1A 3KZYA 3WG7H 1HW2A 3S1MJ 5K7HA 4ESBA 4XKBA 2CW0F 3OYDA 2Y0SN 5FJ8J 3O8GA 4F7ZA 4BXFA 3L7WA 5ERIA 2NS7A 2UUZA 2XGEA 4JYKA 2LD5A 5LD2C 1E0EA 5JVTA 1PVEA 2E5ZA 3WGGA 2P6TA 2EFOA 4EV0A 3MVPA 5DCMA 2E2JJ 2HTSA 2G7UA 1MMNA 1KU7A 3IV5A 3I4NJ 3TP0A 2DFEA 5F04A 3JRCA 2H6BA 2HOTA 3K4CA 4A93J 2CUJA 2K3PA 4BUPA 1MJBA 3SJMA 1BI0A 4BL0B 5K5QA 2VBWA 3V8KA 3TO6A 2L7FP 2NXNB 2AQEA 2ELJA 3I59B 3RPUD 3ROUA 1K7AA 2M45A 3DLAA 2OTLI 3RCOA 3FWEA 1WCMJ 3K69A 4XRMA 1X4OA 5DV5A 5D6FA 3B73A 2ZMEA 1CF7A 5HS8A 1D1AA 3ZGKA 3OS0A 3F8CA 1H8AC 3I56I 3CP2A 3C2GA 5J8CA 3MQ0A 2FQ4A 2HTJA 2E60A 3GVAA 3I71A 3IHUA 4BYYA 3H3UA 3IKTA 3S2DJ 5GTIC 1H9TA 2UZKA 5E79C 3RZOJ 5HVQC 3R4KA 3GX4X 1YQAA 2F5VA 3ZMUA 1ETWA 2GXBA 5HS7A 4IHXA 2Z16A 3AG1H 3RYRA 1UG2A 4B44A 2LOOA 2X1EA 4AU7A 2DFHA 2CQ7A 3KLNA 4I09A 5CYVA 5GAEJ 1IF1A 3WTZA 4QPOA 2LY2A 1R71A 5E18F 2JK3A 1KQ0A 2GIZA 1MBGA 3S17J 2K9MA 3I53A 4BE2A 4M9XA 2JSCA 5DEQA 1B4AA 1OCTC 2BZTA 2M0CA 1A04A 3QU6A 2W24A 4AYBA 1Z9CA 5LRRA 4DBRA 4HW0A 4ZTFA 1J5YA 1MBJA 5F6FA 4Z6YA 2L0KA 1RPWA 1U5TC 1ETOA 2HFHA 1JKOC 4ZDPA 2AO9A 1MH3A 1TWGJ 3LMMA 4XOTA 4AIKA 4M6XA 2PN6A 4LLNA 2Y69H 4AIDA 4AUXA 1B6AA 2KP6A 2NYXA 3WU2C 1AOYA 3GTJJ 3H92A 2EA4A 3BG5A 4OIRF 2PMUA 1HC8A 1TZLA 3HC7A 3FIWA 2HS5A 2XDVA 2P7VB 2CG4A 4E7LA 1P4XA 2O8KA 5LEKA 3BWGA 1ZTRA 3BP8A 4EGYA 2Y0SA 1SANA 3GTMJ 4HF0A 2Y2ZA 4LLGF 5K7ZA 5K5RA 4C2UA 2XGCA 2L2OA 2Z2SB 5CVRA 1SMYF 3F23A 1WJAA 1I6HJ 2W7NA 4RAZA 4B47A 1PP7U 2FF4A 2DT7B 2A07F 2DA7A 4UV8A 1L3LA 4LD5A 1SAXA 2ZJPF 2NVYJ 2IA1A 2CQQA 4BXUA 2RV8A 3CUQC 1S72I 1MZBA 3JRHA 1VFCA 2KHMA 2GLOA 2ZKZA 3ZMSA 2NNYA 3LSHA 4PJLA 1MDMA 3P5JA 1RKTA 3B6CA 5M3FJ 4A3FJ 1GV2A 2WY7Q 4ENKA 3ASOH 2XROA 2GQQA 2WAEA 3NWSA 3H0DA 3ABKH 4BE0A 5L3EA 3I64A 2FOWA 4ZZDA 3PFYA 3QPSA 4UUVA 4HX4A 3QQAA 2HZDA 4BS9A 2WADA 3CJTB 1AA7A 1LE8B 1XMXA 3G1MA 2W57A 2JUCA 4MQ9F 3H3VK 3I0TA 2X6XA 3FKIJ 4BDZA 1KU3A 2NS0A 1WQ2A 3KETA 4IHWA 3RI4A 1DDNA 1S9HA 2XGDA 1GV5A 4L0ZB 3H3ZA 3J80Z 2YR2A 4HF1A 1Y56A 3FXQA 4BY7J 1IJWC 1Z6TA 1SC7A 3MMYB 1PDNC 3E6BA 4XLHA 5F0FA 1XGNA 3S15J 4FASD 2IRFG 4G7ZF 4UNOA 2BXZA 4KIFA 1SVMA 3RTRA 4E7KA 4B09A 1DPUA 1QPIA 4UVAA 3UR3C 1IAWA 3GYHX 2JPBA 2BY0A 3BZ6A 3W2VA 2IXSA 1DGWY 1OFCX 2OZ6A 3FK7A 2VPRA 4KN4X 5FKLA 4ZYDA 2W84A 3PO2J 1LUJB 4L5IA 2DCEA 4DYQA 4ZYGA 2R7UA 3PNVA 4D5CA 2VE8A 4HA8A 1EH7A 1J09A 1R1UA 2DO7A 3S1RJ 2EILH 2L9NA 2CW8A 2H09A 1UJ8A 2HPMA 5AIPA 2ECBA 4J00A 2LBFA 1K4TA 2X4HA 1VNDA 2HVQA 1VQPI 2JRTA 1KYZA 2L7ZA 2LKPA 3JSOA 3I3LA 4HNUA 2JPCA 1A6QA 3E6CC 4RAYA 2KMUA 1BIBA 3TMOA 3OYMA 2N8GA 4HDUA 4OWRB 2LTPA 2EWNA 1G3TA 1IW7F 5EZHA 1YS6A 2O0YA 3F21A 1FIPA 1S7AA 3E97A 1PUEE 1R4MB 1XS9A 1WJBA 1R9TJ 2M4GA 4HX7A 4CDGA 3IAM2 1Z6RA 1B1BA 2XB0X 1UCRA 5F08A 4RB3C 4QSHA 1TT0A 1PP8F 3FF5A 3C1DA 2WAQN 5HLHA 1GHCA 1G6NA 1WFXA 1S3JA 2XSJC 3EUHC 1UMQA 2ID3A 4J01A 1ZN2A 4E70A 2L9SA 2K40A 3RKQA 2V9PA 2R7RA 3I58A 5E3LA 5GP9A 4QTRA 1W5TA 3ABLH 4XLPF 1E3OC 5E8IA 2DJNA 1O57A 4YEJA 1FNNA 3GFIA 2CQKA 4U87A 5AONA 3KP5A 1XGMA 2XKOA 3H5RA 3T8TA 5ILSA 2P4WA 4I6ZA 1Z05A 4IL6C 3S1QJ 4YIRX 2KJBA 2DJIA 4DOZA 2CUFA 3ZPLA 5CQGA 3OS2A 1FMVA 3JRDA 5E3NA 5KK1A 5M3MJ 3OYLA 3CLOA 3FM3A 3CUQA 3KX2A 1HLVA 5CVVA 5JLWA 3ISPA 3JR9A 2F5EA 2NVUB 2QF7A 4ON0A 2R7DA 3M3YJ 2RQQA 3U2RA 4PFPA 1U8RA 4KDPA 2EFNA 1LFPA 1BN5A 1IO2A 1I6XA 5M5XJ 3F0CA 3KEOA 1OCPA 4HQEA 4X1EA 2ZSHB 1NH3A 5GAHJ 1Y0UA 1XSDA 2EQRA 1ETQA 5B1BH 4A0ZA 1EA3A 2G9WA 4FHTA 3JREA 2IJLA 1I3QJ 2NAZA 3IAS2 2EFPA 4QPQA 2H1LA 1JI8A 2OBPA 2W00A 2XF5A 3GEZA 3H9JA 3OWTA 3QYBA 1H88C 3ESWB 4A5MA 3JAMK 1YFHA 3H5AA 1IUFA 1BR1A 1JTXA 4KNYA 4CCOA 3MN2A 4RB0A 3CCMI 3WG9A 2E1MB 3D0SA 1WHUA 3EYYA 4L5JA 3LA3A 5FKMA 1RESA 1WZ2A 4N4NB 2DDAA 1S7EA 4WXHA 3MWMA 2J5OA 2WV1A 2BY3A 3PNTA 5BPIA 5GAGJ 2GOMA 4B1RA 4BHBA 2AQFA 4R79A 4QIWN 3HIFA 1TL8A 2W82A 3GZNB 1ZRCA 1X1PA 1I1SA 1W36C 3F72A 3RKWA 2CH0A 2VI6A 3HKZA 2XPWA 5ICFA 4V2FA 1MJAA 3FXUA 4BNCA 2GM4A 4ETSA 5CPRB 4PSWA 1BC8C 2FU4A 2A5YB 3IWFA 2L7KA 4UUTA 3TW6A 3IL2A 1WJ5A 4I0AA 2KIMA 1H9GA 3IH2A 1KU9A 2JUGA 4CCMA 3OYKA 2ESNA 4E7JA 5GPAA 3WE2A 1XSVA 2ISZA 4XMYA 3S8PA 2W25A 2MH9A 4G6DA 5J47A 2E5NA 1ZLJA 3A1YA 4DW6A 3OYNA 1HBXG 3I59A 4PJ0C 3DPTA 3PSFA 1ZG5A 1R36A 3M7GA 1MSEC 3DF8A 4OAYA 4XBFA 1K79A 4DJAA 2DQRA 1YLFA 2MA3A 1JGGA 1GUUA 2V1XA 3MKZA 3F6VA 1BW5A 2ZJRF 2DU9A 1K6OA 4QWQA 2QBYB 3DTEA 4XM3A 1KQ9A 2O03A 4RGSA 4CSWA 1WJFA 2E1MC 5IPAA 2COMA 2KFDA 1HSJA 2QKMB 2VQLA 1O3TA 3K7AJ 3S93A 2M30A 3BT9A 3GO5A 5JFRA 3DEWA 1HF0A 3L00A 3DEUA 1X1DA 2VC1A 3KYCB 3CLQA 1FBSA 1ZGAA 2HXIA 3ZQGA 2K86A 5DDGA 1KU2A 1U9NA 1YE9A 4LK1F 3LSTA 2EA2A 4LGWA 3LNQA 2XRNA 2CWEA 1PJRA 4C2MJ 1N77A 1YG2A 2A69F 4NNJA 1YJWI 1LKXA 4Y52J 4OU0A 2DAOA 1DGRM 1SFXA 4XLEA 5E1XA 2P5KA 3OL4A 5D8LB 3ERED 1UELB 1XCBA 1DU0A 3D1NI 3EDPA 1IRXA 3VB2A 2OAZA 4NC8A 2DA4A 4LB6B 3SXYA 3VOEA 5KHDA 1U3EM 5BOXA 2ZMEC 2W4SA 2L5QA 2EK5A 2HZTA 3K1NA 2L9VA 4M72A 3T5XA 3ZR8X 4M9SA 4GGGA 2VB6A 3GZ5A 4PCQA 3LSKA 3VYRB 4LJZF 2RN7A 3JRGA 5M5YJ 2JA8J 1HOMA 1YITI 4BQAA 3CMYA 1FPQA 1W7PD 4C2TA 3E5QA 3VSLA 4B8XA 5LHHA 2LDUA 3G71I 4UVCA 3G1OA 3H5NA 5CVIA 1X2MA 2DMTA 3KE2A 4KIGA 4LOCA 3OY9A 1XD7A 2E7XA 3PIOF 3A01B 4G6QA 3V4GA 3L09A 4ZZLA 4HBLA 4CHUA 2MH2A 3ZN0A 4XLNF 1YI2I 3QP6A 1R00A 4WWCA 1ZLKA 1ZG1A 2R0QC 1TTYA 4JQFA 3HOVJ 2OJED 1VQ5I 3ZMTA 1F4KA 3FXKA 3FXOA 5A2QZ 4AYBN 2ZFUA 4NDLA 2WWYA 4A3KJ 5B66C 2KIUA 1QRYA 3BZKA 4EJUA 3HRSA 3CMEI 4RLQA 1BM9A 2MC3A 4Y33A 3BR6A 2CV1A 4HYEA 5ILUA 5LRSA 3MD2A 3HRMA 3MKYB 4BHPA 2M0MA 1CGPA 1W1WE 2F5FA 2OPTA 3OS1A 3HOXJ 3X2QH 4RM3A 3N05A 4KICA 4IKFA 4A3DJ 4XK4A 5FO5A 2P5LC 1IZ1A 3S3MA 3IWZA 4DGWB 2CJJA 2L7MP 2LF8A 2JA2A 5LGNA 1SFEA 4CZZA 3HUGA 1W0TA 4OMYA 1STZA 4RDUA 3HPHA 3A0BC 4OIOF 4LITA 1VI0A 2CQNA 4BJ6C 3RQIA 2LY9A 4KA4A 2QWWA 2DA6A 3SZTA 3J80K 4N4OB 2JT1A 4BE1A 3LFUA 3J81Z 2A6HF 5J1YA 1EH8A 1ZAOA 4LK0F 1DQUA 3S16J 2L02A 1QPMA 4F55A 2V6EA 1JE8A 2IEKA 3KP6A 1QO0D 4BEHB 1GDTA 3KZIC 3MFKA 2R93J 3K4LA 2WAQA 5FLMJ 2VPLA 3HRUA 2EJRA 2YU3A 3FXJA 4GO1A 3BG7A 3J7AY 1IRZA 3DTIA 5HS9A 3ECOA 4D1QA 2XAJA 3AL0B 3K6GA 4EM1A 1EV7A 1DP7P 1RZ4A 5IY5H 1O7FA 1YOVB 2MC4A 2R5YA 3RYPA 1J9IA 2VUMJ 3VWBA 3O3KA 3LAPA 2E34A 4BACA 2DDBA 1T8IA 2HI3A 3HHHA 2EFWA 2HVRA 4XKWA 1FOKA 3O8HA 4RMNA 4WX9A 2ESHA 2F4OB 2JZYA 2MFZA 3OV8A 4B3XA 4PJNA 3PJRA 4XRSA 1ZARA 4DZJA 4DQ2A 4F91B 2VL8A 4A3GJ 1Y0NA 2GWRA 2LF7A 2WB1N 2V26A 2DODA 3CMAI 4KT5C 5C44J 2EZHA 3CDLA 4BXXJ 1JHHA 4F3QA 5F1RA 5E3MA 4KMUX 2KRFA 4DIQA 3GTGJ 1G8XA 5HLTA 4IHTA 1FX7A 4L5EA 2FJ1A 4YRVA 2F2EA 1R49A 2FRHA 4HSTA 3OSGA 2EH3A 2GXAA 2QUFA 1QU3A 3RKXA 1XB4A 4YFXF 5EEGA 1FP2A 1XMAA 5KAIC 2VBZA 2PJRB 4DYCA 4P9UA 2AXLA 2K4JA 2KDOA 2X6WA 4A12A 3BZCA 2FOKA 4PJJA 1ZK8A 4KJZA 1QZYA 4MO7A 2DOFA 4MTDA 2RC4A 3RQ4A 3TEDA 2JN6A 4RB2C 3C18A 4B4CA 2LVSA 1FWZA 4UUSA 4EQQA 1AWCA 2Q2EB 3KEQA 2AS5F 2FBKA 4RA2A 3OYBA 2ME6A 2QKLB 3WTSC 1O4XA 3IRRA 2BOLA 3CC2I 2MGQA 2A05A 2JSPA 1FP1D 4GXOA 3W6KB 1E17A 1SAUA 2V1NA 5E20A 4DZPA 3VYUB 1ZR2A 4UB8C 2IPQX 5BPDA 3S32A 3S2HJ 3SFZA 4OMZA 3K70D 4A0XA 1QZZA 2K7LA 3O2PE 3J7YJ 3BLYA 1QNTA 1D0XA 3PIPF 2HEOA 4BAYA 2K9NA 2OU2A 3EETA 2ZC2A 2GOXB 3ZMVA 2QLZA 1ZQ3P 1N25A 2MYSA 4XSZF 4G7HF 2LNBA 3ZMDA 1OPCA 2LC2A 4EM2A 3PUFA 2E2HJ 2M7AA 3V8JA 2OV7A 5J1RA 3HSEA 1NHAA 3F3XA 4FTHA 2BY2A 4A3EJ 3QOEA 2MSYA 1FYKA 4N9HA 4IQJA 4M6YA 3ZQHA 2XRLA 2V7FA 3QOPA 1A31A 1JUSA 1XSXA 2KQRA 3ABMH 2I5UA 2LSOA 3QODA 2BEOA 3EYIA 4L18B 2DBBA 3GF2A 2A68F 1ITYA 1HW5A 2QYOA 4XKCA 3CD6I 2K9LA 3TKYA 4L9JA 2ZO4A 3C3WA 2VJ4A 3KYLA 1WKMA 3I55I 2FNAA 5L3CA 3HSFA 2MBFA 1O3QA 4Z2YA 3N4MA 4HLYA 3NQOA 3HHGA 5E1WA 2CFOA 2XGXA 1C0WA 4IEJA 1WJCA 2Z9OA 1LDKB 1YS7A 5DTDA 1F5TA 4XN3A 1ONVA 3K4JA 5J1UA 4S05A 2QVOA 3SFIA 3IP4B 3Q0WA 2BVMA 4M3FA 3ZMZA 3CDIA 2HOSA 3SEZA 3CCRI 4IF4A 2G7HA 4G12A 5JI6A 2I10A 1RIOH 1ETXA 1YW9A 1FMWA 1OKRA 4CCKA 1MMGA 1G3YA 2M8GX 4A3BJ 3HL2A 2STWA 4ZJZA 1QBJA 3TDUC 3P9KA 1W7PB 3BR5A 2JVGA 3TGNA 4CZCA 4RGRA 4MLOA 4HDVA 2LYCA 3K1PA 4U0VA 3NEUA 1QHHD 1BL0A 5LHGA 1XC5A 1VQ6I 2Z5UA 3NAUA 2BV6A 1ZREA 1JHFA 2DK5A 3OYFA 3TO7A 4MEYF 1U8BA 2QQAA 2X1CA 3I5UA 3GZ6A 4E7HA 2LG4A 1ENHA 4MQVA 5LFAA 2R5YB 3M8EA 3D5RC 4NBQA 2VC0A 3SHFA 5D4SA 1T39A 2VOOA 3WTYC 1HQCA 3CO7C 4IVNA 2R7QA 3OR2C 4I76A 1OR7C 2VN2A 1P9QC 5EGOB 2HKXA 2MLKA 4NB5A 1VQ8I 1OCRH 3E1SA 2AHQA 3SZPA 5LGTA 2FMYA 2QA4I 3UKGA 1EF4A 2OCEA 3BJOA 3IH3A 3DXJF 1ZH5A 1IN5A 2M2EA 4CCLA 2DLLA 2BGCA 3KYDB 5LEJA 1OCCH 2XF7A 4PUSA 2LP0A 4Y13A 1I5ZA 1G3WA 3UNGC 3HSRA 4WK8F 4ASNA 2R5ZB 1BW6A 4CO8A 2CUEA 3QP5A 3MZHA 2HDCA 4X0GA 5EYRA 1ON1A 4CGZA 2R7TA 2MW8A 1JT0A 4AIHA 2PJRA 9ANTA 4YIIA 3ZQCA 3W6JB 1K78B 4BBSJ 2ETHA 3QU3A 1JKRC 2NOGA 4I7HA 4XLAA 5K5OA 4EEFG 2YUSA 4E7ZA 1FEXA 2Q1ZB 4LG3A 1IG7A 5TJJA 1BI1A 1V5FA 1J7KA 3OYIA 1FTZA 1UFMA 2FNPA 3GUDA 3E6DA 1U78A 4EJVA 2IGNA 2YX7A 1Y1WJ 2VJ5A 1FC3A 1JUMA 3OSFA 2ZFWA 3W6VA 4GFBA 1XN7A 2IVMA 5L3FA 4KYWA 4D0PA 3JRAA 4G94A 1VQKI 1MMDA 1T0FA 1RKWA 2K27A 4Q5SF 2XPVA 3N97A 4S04A 5H20A 1LPQA 1VTNC 1TC3C 3M4OJ 4U88A 1FOYA 3VPRA 3AG2H 1NTCA 2XSDC 4G6TB 2VASA 5IOYA 2H1KA 4IHVA 1ERDA 4RLFA 2L4MA 1UHWA 1I50J 1IRGA 1VZ0A 1BBYA 2PBIA 2EINH 2RVCA 4UB6C 1P2FA 4HNVA 3L2QA 3K70C 1APLC 3LFKA 4HPQA 3GCMA 1MBEA 3LSPA 2OF7A 3JRBA 1FSHA 5FFXA 1ZGWA 1CF7B 2O9LA 1OLTA 4KMFA 3J7AO 3FBNB 3CP8A 3DV8A 1JJ6C 4Q48A 2BY1A 4HEA2 5HNFA 1KZHA 1D3YA 2FUG2 2EFQA
chains in the Genus database with same CATH topology
3WODF 5ICGA 2OQRA 3Q9VA 3E3VA 1IN6A 1BJAA 2ZNYA 1SMTA 1ZHFA 2XAHA 1T2KA 2PG4A 4Q4ZF 3DP7A 4ENJA 4A6DA 1FLIA 1JGSA 5IT9Z 2IA2A 1T6SA 3QAHA 4KUMA 5BMZA 3LA7A 4P96A 2XVCA 2VT3A 2H94A 2IT0A 4XSXF 3L2CA 1I1GA 3FXRA 4KN7X 5J8FA 1FBQA 2B0LA 3HOTA 3CTAA 3WGIA 1DPRA 1U5TA 3IC7A 2ZJ2A 2Y48A 2HYGD 1L0OC 1W5SA 1YW7A 3TOBA 2DK8A 1YW8A 2J5PA 3F22A 4UVBA 3T0YA 3JTGA 1V3FA 2UWMA 3LA2A 2V1UA 1OYIA 1BI3A 2A3SA 3OOPA 4ZYHA 5BS6A 2EV0A 4GYIA 3RIRA 1SD5A 2IP2A 3HRTA 3LQRA 2K4BA 4AD9A 2DW4A 4OIPF 4LG0A 1HXDA 1YIOA 3RPUA 2GZWA 2W85A 4WXCA 1REPC 3E5XA 4AIJA 3HOSA 2P7CB 4NQWA 4LB5A 2RQPA 4OOIA 1TW3A 5F64A 2R7FA 4EM0B 4HQMA 5CJ9A 2RDPA 3R0AA 4L9NA 3V8LA 4Q47A 1WWXA 1YO5C 2YPRA 3O6BB 5D4RA 3KFWX 2HQRA 4R8HA 3NRVA 2XIGA 2WV0A 3JSPA 5IT3A 4WCGA 3VEPA 1D8JA 3F8FA 4XRFA 5ED4A 4MHGA 4WXDA 5CVUA 4G7OF 3DQVC 1LNWA 2JTVA 3F8BA 4A2UA 2DPUA 4BHCA 1Z91A 4UV9A 5D6EA 3GFMA 1LEAA 4M73A 2VE9A 2F5CA 2WC2A 1UB9A 3LAJA 2QENA 4IHSA 4O5VA 5EEHA 4EGZA 1LVAA 2BBYA 1WRJA 2XKPA 1R5GA 1ZGJA 1P92A 2M8EA 5FFZA 1OYYA 2IW5A 3K0LA 2Q2EA 4JK1X 1B59A 5HLIA 4AVPA 2PLYA 4U7DA 1MGTA 4N9IA 5H6RA 5HLGA 4P55A 3G3ZA 2QM3A 2VONA 2EV6A 4A0YA 1TQMA 3JW4A 2R3SA 4HLXA 5HOOA 1WI9A 2Z3YA 3EQLF 2O61A 2PJPA 5FGMA 1F1ZA 2M1BA 1J0RA 3WTTC 1R1VA 1TQIA 2UXNA 2RKHA 3KP4A 3KP3A 2L3DA 1IN8A 4P9FA 3LQQA 3ML6A 1R7JA 1LDDA 1R58A 5LBQA 5HDGA 2PEXA 2V9VA 2ZBKA 3DFGA 5L3DA 3VFZA 3REOA 2MLGA 2OQGA 3BPXA 3PQKA 4CICA 3R6SA 3M1EA 1X3UA 1LJ9A 2CYYA 2GA2A 4CYDA 2K02A 4WF2A 2F5DA 2M5WA 2DT5A 1GXPA 4LLLA 4PDKA 1GXQA 3BOQA 5DUIA 1D8KA 5FD5A 1SFUA 5D5VB 2UXXA 1YYVA 4PGHA 1FYMA 2ZNZA 2STTA 2RNJA 4HV6A 4IPAA 1P4WA 2V1DA 3WGHA 2VOPA 4EMSA 4FT8A 1G4DA 4NHJA 2H6CA 1T38A 2DI3A 3BJ6A 1RI7A 2Y75A 2D2WA 1W4MA 3R60A 4A6EA 3GW2A 4A5NA 1FZPB 3MEXA 1HKSA 4ENMA 1QQIA 3ZP5A 3QPTA 3FM5A 3MAJA 5CLSA 1O7LA 3P9CA 5HDNA 1J75A 1MJ9A 1SD7A 1Q1HA 3QRFF 3DPLC 1TNTA 3KLOA 1LQ1A 3RPQA 4M74A 1I27A 5D5UB 1G3SA 2GIVA 3HTSB 2XUBA 3RDIA 2P8TA 2ELHA 3CO6C 2HYFA 1U2WA 4IJAA 2CFXA 3V7RA 5DCFA 4YIFA 2NNNA 4AWXB 4L9TA 2QBYA 5AIQA 1V4RA 3BPVA 3CJNA 5ICCA 4RB1A 1RUOA 4LFUA 4U0WA 4KIBA 2C6YA 1R23A 1IXCA 4CXFA 4QLCU 1D5VA 2OZUA 2Y0MA 2H27A 3ECHA 4EVIA 4EJTA 4YG2F 2L54A 2HKOA 3CDHA 4L0YB 3CUOA 5BQTA 2MD5A 1R5HA 2O3FA 3V7SA 1OMIA 4H0EA 3L9FA 3TOAA 1ULYA 4Y15A 1F9NA 4K2EA 1S7OA 3ZN1A 2XAGA 2OD5A 4JBAA 4ESJA 4FX0A 5FLXK 1SD4A 5LHIA 4Y17A 3BROA 4L9VA 2FXAA 3ULQB 2EV5A 1KYWA 3QPHA 3BY6A 2KJCA 4IRGA 4HZFA 1FY7A 5IT9K 2ISYA 5FD6A 1MD0A 2HOEA 1P6RA 2IA0A 1R22A 4I0BA 3FZVA 3Q5FA 4MNUA 3Q9SA 2HGCA 4UXNA 1LEBA 4GYGA 4KFCA 2E1NA 1U6GA 2L01A 2CSOA 4TV7A 3JAMZ 5JR3A 2HQNA 2BE5F 2XAQA 5D5WB 1XGOA 3WTWC 5DUKA 2ACJA 4HF2A 5DCMB 3R61A 2FBIA 3RKYA 3M9AA 1XMKA 1JXSA 2NRAC 3RJPA 3V7CA 3FX3A 3ABUA 1XCVA 4O3MA 2PQ8A 2L4AA 1IXSB 5E1ZB 4DNCA 1BI2A 2XV4S 3IRQA 4I02A 3WTXC 2KIFA 1XDSA 4HAMA 3C7JA 4M71A 1KA8A 1RUNA 4FX4A 1E2XA 2DPDA 4O6JA 3TDZC 3WU1B 3HTUA 1S29A 5ILVA 2TDXA 4PZJA 4IRIA 2XHKA 1FSEA 3B02A 4OIQF 5ICEA 1ZYRF 4MTEA 3EUHA 2HR3A 3TO9A 2ADUA 2DFIA 3T1BA 1O3RA 2XAFA 2E1CA 6PAXA 2YX4A 4HX8A 5CVJA 1EH6A 3GXOA 1OR7A 3TQNA 4N0BA 4ZYEA 3D5LA 3KP7A 1LDJA 5FLXZ 2RGVA 3WTVC 1U5TB 2PI0A 1BIAA 3DKWA 3MZYA 3WU0A 4MEXF 5DD4A 4I98B 5E17F 4YFKF 2V6CA 3PFIA 3LWFA 1BOAA 1YTYA 1IRFA 1K78A 1J2XA 1FT9A 2DQLA 2QQBA 4YFNF 5TRDA 3R0JA 3WTUC 3BDDA 2GA1A 5FB2A 3I4PA 4LG0B 1USTA 3J81K 5K1YA 1HKTA 4OINF 5LGUA 5HDKA 3ABTA 1USSA 3FMQA 2Z99A 3U1DA 4IRHA 3CUQB 2P5VA 2V79A 3K9TA 3IKVA 1IN7A 1FBUA 3COAC 4ENNA 2D1HA 1DUXC 3SQNA 2D45A 5H6QA 4BH9A 2ZXJA 4R1HA 3ZQ7A 1MKMA 5L3BA 3K2ZA 3WE3A 3BJAA 2PFBA 2M87A 1HSTA 2ZMEB 2VBYA 3MCZA 5DYMA 3FHZA 4MGRA 2FQ3A 1TNSA 1Z1DA 2KKOA 1W7PA 2O6GE 1GVJA 4EJOA 4HV5A 4LMYA 3PQJA 3KCCA 2OA4A 3I54A 1S8NA 2ZCWA 1FYLA 3FMRA 2FMLA 5KVRA 1B9MA 1BC7C 4ESFA 4P5OA 2GXGA 3GFJA 2FEZA 1KGSA 2VXZA 4U0YA 1ZRDA 1OYWA 1QGPA 2QZ8A 1S6LA 1IN4A 1ODDA 1WSUA 2QQ9A 3P9IA 5LLQA 5DD8A 2Z33A 2CGPA 4RGXA 2FA5A 4M9ZA 1KQ8A 2Q8KA 5L3GA 1T98A 2X0LA 1ZRFA 3S2WA 2BYVE 5JHUA 2XASA 5E8GA 2FSWA 4PGGA 5D5XB 2VT2A 4RGUA 3E5UA 2VODA 1TLHB 2FE3A 1IUYA 4UHTA 3M8FA 1H0MA 1IXRC 1HKQA 2GAUA 1RNLA 3HYIA 1R1TA 1ON2A 1ZG3A 2A61A 3KP2A 4I01A 5D8KB 2EB7A 3U9GA 3FMSA 1J59A 2E7WA 3F6OA 4IXAA 2FBHA 2DTRA 3ELKA 3GFLA 2WTEA 4G9YA 3P7NA 4EJWA 4RS8A 2VBXA 3K1MA 3KZZA 3VODA 3F8MA 2PMHA 3GLXA 4G8XA 5J6XA 1O3SA 2CO5A 1LB2A 3JTHA 1TBXA 1SD6A 1MDMB 1B9NA 1XDUA 4U7BA 2YSRA 5A2QK 1Z7UA 2Q0OA 1UHMA 2D1VA 4I2OA 3F8NA 3GWZA 2A6EF 1P4AA 2HWVA 3E6MA 3G73A 1XGSA 1TQPA 4HOBA 3AAFA 2P6SA 3T8RA 4ZH4F 2O8XA 4GCVA 1HW1A 3KZYA 1HW2A 4ESBA 2CW0F 4F7ZA 3L7WA 5ERIA 5JVTA 3WGGA 2P6TA 2EFOA 4EV0A 5DCMA 2HTSA 2G7UA 1KU7A 2H6BA 1MJBA 1BI0A 5K5QA 2VBWA 3V8KA 3TO6A 3ROUA 3I59B 1K7AA 2M45A 3FWEA 3K69A 5DV5A 5D6FA 3B73A 2ZMEA 1CF7A 5HS8A 3F8CA 5J8CA 3MQ0A 2HTJA 3IHUA 3GVAA 3I71A 4BYYA 3H3UA 3IKTA 1H9TA 2UZKA 5HVQC 3R4KA 3GX4X 1YQAA 3ZMUA 2GXBA 5HS7A 3RYRA 3KLNA 4I09A 5CYVA 1IF1A 3WTZA 5E18F 1KQ0A 3I53A 4M9XA 2JSCA 5DEQA 1B4AA 1A04A 3QU6A 2W24A 1Z9CA 5LRRA 4HW0A 1J5YA 5F6FA 1U5TC 2HFHA 4AIKA 4M6XA 2PN6A 4LLNA 1B6AA 2NYXA 1AOYA 3H92A 2EA4A 4OIRF 2PMUA 2HS5A 2P7VB 2CG4A 1P4XA 5LEKA 3BWGA 3BP8A 4EGYA 4HF0A 4LLGF 5K5RA 5CVRA 1SMYF 3F23A 4RAZA 1PP7U 2FF4A 2A07F 4UV8A 1L3LA 4LD5A 1SAXA 2IA1A 4BXUA 2RV8A 3CUQC 1MZBA 2ZKZA 3ZMSA 2NNYA 1MDMA 4ENKA 2XROA 2GQQA 5L3EA 3I64A 4ZZDA 4UUVA 4HX4A 2W57A 4MQ9F 3I0TA 1KU3A 2NS0A 1WQ2A 3KETA 3RI4A 1DDNA 4L0ZB 3H3ZA 3J80Z 2YR2A 4HF1A 3FXQA 1Z6TA 1PDNC 3E6BA 1XGNA 2IRFG 4G7ZF 4UNOA 4KIFA 3RTRA 4B09A 1DPUA 4UVAA 1IAWA 3GYHX 2JPBA 3BZ6A 2OZ6A 4KN4X 4ZYDA 2W84A 4L5IA 4ZYGA 2VE8A 4HA8A 1EH7A 1R1UA 2DO7A 2H09A 5AIPA 2X4HA 2JRTA 1KYZA 2LKPA 3JSOA 2JPCA 3E6CC 4RAYA 1BIBA 4HDUA 2EWNA 1G3TA 1IW7F 1YS6A 2O0YA 3F21A 1S7AA 3E97A 1PUEE 4HX7A 4CDGA 1Z6RA 1B1BA 1UCRA 4RB3C 1PP8F 3FF5A 3C1DA 5HLHA 1GHCA 1G6NA 1S3JA 1ZN2A 4E70A 3I58A 1W5TA 4XLPF 5E8IA 1O57A 3GFIA 1FNNA 2CQKA 5AONA 3KP5A 1XGMA 2XKOA 3T8TA 5ILSA 2P4WA 1Z05A 2KJBA 3ZPLA 5KK1A 3CLOA 3FM3A 3CUQA 5CVVA 3ISPA 2F5EA 4ON0A 2R7DA 3U2RA 1U8RA 4KDPA 2EFNA 1BN5A 1I6XA 3KEOA 4HQEA 1Y0UA 1XSDA 4A0ZA 2G9WA 4FHTA 2IJLA 2NAZA 2EFPA 2OBPA 3GEZA 4A5MA 3JAMK 1YFHA 4KNYA 4RB0A 3WG9A 3D0SA 4L5JA 3EYYA 3LA3A 4WXHA 3MWMA 2J5OA 5BPIA 4BHBA 4R79A 3HIFA 1ZRCA 1I1SA 3F72A 3RKWA 5ICFA 1MJAA 3FXUA 4BNCA 4ETSA 1BC8C 2FU4A 2A5YB 3IWFA 3IL2A 4I0AA 2KIMA 1H9GA 1KU9A 2ESNA 3WE2A 1XSVA 2ISZA 2W25A 2MH9A 4G6DA 1ZLJA 1HBXG 3I59A 3DPTA 1ZG5A 1R36A 3M7GA 3DF8A 4XBFA 1K79A 2DQRA 1YLFA 2MA3A 2V1XA 3F6VA 2DU9A 1K6OA 4QWQA 2QBYB 1KQ9A 2O03A 4RGSA 2COMA 1HSJA 1O3TA 2M30A 3GO5A 5JFRA 3L00A 3DEUA 2VC1A 1FBSA 1ZGAA 2K86A 5DDGA 1KU2A 4LK1F 3LSTA 2EA2A 4LGWA 2XRNA 2CWEA 1YG2A 2A69F 4OU0A 2DAOA 1SFXA 5E1XA 2P5KA 3ERED 5D8LB 1XCBA 3EDPA 3VB2A 2OAZA 4LB6B 3SXYA 3VOEA 1U3EM 5BOXA 2ZMEC 3K1NA 2EK5A 2HZTA 4M72A 3T5XA 4M9SA 4GGGA 3GZ5A 4PCQA 4LJZF 2RN7A 4BQAA 1FPQA 1W7PD 3E5QA 4B8XA 5LHHA 2LDUA 4UVCA 5CVIA 3KE2A 4KIGA 1XD7A 2E7XA 4G6QA 3V4GA 3L09A 4ZZLA 4HBLA 4CHUA 2MH2A 3ZN0A 4XLNF 3QP6A 1R00A 4WWCA 1ZLKA 1ZG1A 1TTYA 4JQFA 3ZMTA 1F4KA 5A2QZ 2WWYA 2KIUA 4EJUA 3HRSA 1BM9A 2MC3A 4HYEA 5ILUA 5LRSA 3HRMA 4BHPA 1CGPA 2F5FA 4KICA 5FO5A 2P5LC 1IZ1A 3IWZA 2LF8A 5LGNA 1SFEA 4CZZA 3HUGA 4OMYA 1STZA 4OIOF 4KA4A 2QWWA 3SZTA 3J80K 2JT1A 3J81Z 2A6HF 1EH8A 1ZAOA 4LK0F 2L02A 1QPMA 1JE8A 3KP6A 1QO0D 3MFKA 3HRUA 2EJRA 2YU3A 4GO1A 5HS9A 3ECOA 2XAJA 4EM1A 1EV7A 1DP7P 1RZ4A 1O7FA 3RYPA 1J9IA 3O3KA 3LAPA 3HHHA 2EFWA 1FOKA 4WX9A 2ESHA 2JZYA 3OV8A 1ZARA 4DQ2A 2GWRA 2LF7A 4KT5C 1JHHA 5F1RA 4KMUX 2KRFA 4IHTA 1FX7A 2F2EA 2FRHA 2QUFA 3RKXA 1XB4A 4YFXF 5EEGA 1FP2A 1XMAA 2VBZA 4P9UA 2AXLA 2K4JA 4A12A 2FOKA 1QZYA 4MTDA 2RC4A 4RB2C 3C18A 1FWZA 4EQQA 1AWCA 3KEQA 2AS5F 2FBKA 3WTSC 3IRRA 1FP1D 4GXOA 3W6KB 1E17A 5E20A 2IPQX 5BPDA 3SFZA 4OMZA 4A0XA 1QZZA 2K7LA 3O2PE 1QNTA 2HEOA 4BAYA 2OU2A 3EETA 3ZMVA 2QLZA 4XSZF 4G7HF 2LNBA 3ZMDA 1OPCA 4EM2A 3V8JA 3HSEA 1NHAA 3F3XA 1FYKA 4N9HA 4M6YA 3QOPA 1XSXA 2LSOA 4L18B 2BEOA 3EYIA 2DBBA 3GF2A 2A68F 1HW5A 2QYOA 3TKYA 4L9JA 2ZO4A 3C3WA 1WKMA 2FNAA 5L3CA 3HSFA 2MBFA 1O3QA 3N4MA 4Z2YA 4HLYA 3NQOA 3HHGA 5E1WA 2XGXA 1C0WA 2Z9OA 1LDKB 1YS7A 1F5TA 1ONVA 4S05A 2QVOA 3ZMZA 4IF4A 2G7HA 5JI6A 1RIOH 1YW9A 1OKRA 1G3YA 2STWA 1QBJA 2EFQA 3TDUC 3P9KA 1W7PB 3TGNA 4RGRA 4HDVA 3K1PA 4U0VA 3NEUA 5LHGA 2Z5UA 1ZREA 2BV6A 1JHFA 2DK5A 3TO7A 4MEYF 2QQAA 3I5UA 3GZ6A 4MQVA 3M8EA 3SHFA 5D4SA 2VC0A 1T39A 2VOOA 3WTYC 1HQCA 3CO7C 4IVNA 2VN2A 2HKXA 2MLKA 4NB5A 3SZPA 5LGTA 2FMYA 3BJOA 1ZH5A 3DXJF 1IN5A 2DLLA 2BGCA 5LEJA 4Y13A 1I5ZA 1G3WA 3HSRA 4WK8F 4ASNA 4CO8A 3QP5A 3MZHA 2HDCA 1ON1A 4CGZA 4AIHA 4YIIA 1K78B 3W6JB 2ETHA 3QU3A 4I7HA 5K5OA 5TJJA 1BI1A 1J7KA 1UFMA 2FNPA 3GUDA 3E6DA 1U78A 4EJVA 2YX7A 4KYWA 1FC3A 2ZFWA 1XN7A 2IVMA 5L3FA 4D0PA 4G94A 1T0FA 4Q5SF 2K27A 3N97A 4S04A 5H20A 1VTNC 4U88A 2L4MA 1UHWA 1IRGA 1BBYA 2PBIA 2RVCA 1P2FA 3LFKA 1FSHA 5FFXA 1CF7B 4KMFA 3J7AO 3DV8A 4Q48A 1D3YA 1TW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOD F;  5ICG A;  2OQR A;  3Q9V A;  3E3V A;  1IN6 A;  1BJA A;  2ZNY A;  1SMT A;  1ZHF A;  2XAH A;  1T2K A;  2PG4 A;  4Q4Z F;  3DP7 A;  4ENJ A;  4A6D A;  1FLI A;  1JGS A;  5IT9 Z;  2IA2 A;  1T6S A;  3QAH A;  4KUM A;  5BMZ A;  3LA7 A;  4P96 A;  2XVC A;  2VT3 A;  2H94 A;  2IT0 A;  4XSX F;  3L2C A;  1I1G A;  3FXR A;  4KN7 X;  5J8F A;  1FBQ A;  2B0L A;  3HOT A;  3CTA A;  3WGI A;  1DPR A;  1U5T A;  3IC7 A;  2ZJ2 A;  2Y48 A;  2HYG D;  1L0O C;  1W5S A;  1YW7 A;  3TOB A;  2DK8 A;  1YW8 A;  2J5P A;  3F22 A;  4UVB A;  3T0Y A;  3JTG A;  1V3F A;  2UWM A;  3LA2 A;  2V1U A;  1OYI A;  1BI3 A;  2A3S A;  3OOP A;  4ZYH A;  5BS6 A;  2EV0 A;  4GYI A;  3RIR A;  1SD5 A;  2IP2 A;  3HRT A;  3LQR A;  2K4B A;  4AD9 A;  2DW4 A;  4OIP F;  4LG0 A;  1HXD A;  1YIO A;  3RPU A;  2GZW A;  2W85 A;  4WXC A;  1REP C;  3E5X A;  4AIJ A;  3HOS A;  2P7C B;  4NQW A;  4LB5 A;  2RQP A;  4OOI A;  1TW3 A;  5F64 A;  2R7F A;  4EM0 B;  4HQM A;  5CJ9 A;  2RDP A;  3R0A A;  4L9N A;  3V8L A;  4Q47 A;  1WWX A;  1YO5 C;  2YPR A;  3O6B B;  5D4R A;  3KFW X;  2HQR A;  4R8H A;  3NRV A;  2XIG A;  2WV0 A;  3JSP A;  5IT3 A;  4WCG A;  3VEP A;  1D8J A;  3F8F A;  4XRF A;  5ED4 A;  4MHG A;  4WXD A;  5CVU A;  4G7O F;  3DQV C;  1LNW A;  2JTV A;  3F8B A;  4A2U A;  2DPU A;  4BHC A;  1Z91 A;  4UV9 A;  5D6E A;  3GFM A;  1LEA A;  4M73 A;  2VE9 A;  2F5C A;  2WC2 A;  1UB9 A;  3LAJ A;  2QEN A;  4IHS A;  4O5V A;  5EEH A;  4EGZ A;  1LVA A;  2BBY A;  1WRJ A;  2XKP A;  1R5G A;  1ZGJ A;  1P92 A;  2M8E A;  5FFZ A;  1OYY A;  2IW5 A;  3K0L A;  2Q2E A;  4JK1 X;  1B59 A;  5HLI A;  4AVP A;  2PLY A;  4U7D A;  1MGT A;  4N9I A;  5H6R A;  5HLG A;  4P55 A;  3G3Z A;  2QM3 A;  2VON A;  2EV6 A;  4A0Y A;  1TQM A;  3JW4 A;  2R3S A;  4HLX A;  5HOO A;  1WI9 A;  2Z3Y A;  3EQL F;  2O61 A;  2PJP A;  5FGM A;  1F1Z A;  2M1B A;  1J0R A;  3WTT C;  1R1V A;  1TQI A;  2UXN A;  2RKH A;  3KP4 A;  3KP3 A;  2L3D A;  1IN8 A;  4P9F A;  3LQQ A;  3ML6 A;  1R7J A;  1LDD A;  1R58 A;  5LBQ A;  5HDG A;  2PEX A;  2V9V A;  2ZBK A;  3DFG A;  5L3D A;  3VFZ A;  3REO A;  2MLG A;  2OQG A;  3BPX A;  3PQK A;  4CIC A;  3R6S A;  3M1E A;  1X3U A;  1LJ9 A;  2CYY A;  2GA2 A;  4CYD A;  2K02 A;  4WF2 A;  2F5D A;  2M5W A;  2DT5 A;  1GXP A;  4LLL A;  4PDK A;  1GXQ A;  3BOQ A;  5DUI A;  1D8K A;  5FD5 A;  1SFU A;  5D5V B;  2UXX A;  1YYV A;  4PGH A;  1FYM A;  2ZNZ A;  2STT A;  2RNJ A;  4HV6 A;  4IPA A;  1P4W A;  2V1D A;  3WGH A;  2VOP A;  4EMS A;  4FT8 A;  1G4D A;  4NHJ A;  2H6C A;  1T38 A;  2DI3 A;  3BJ6 A;  1RI7 A;  2Y75 A;  2D2W A;  1W4M A;  3R60 A;  4A6E A;  3GW2 A;  4A5N A;  1FZP B;  3MEX A;  1HKS A;  4ENM A;  1QQI A;  3ZP5 A;  3QPT A;  3FM5 A;  3MAJ A;  5CLS A;  1O7L A;  3P9C A;  5HDN A;  1J75 A;  1MJ9 A;  1SD7 A;  1Q1H A;  3QRF F;  3DPL C;  1TNT A;  3KLO A;  1LQ1 A;  3RPQ A;  4M74 A;  1I27 A;  5D5U B;  1G3S A;  2GIV A;  3HTS B;  2XUB A;  3RDI A;  2P8T A;  2ELH A;  3CO6 C;  2HYF A;  1U2W A;  4IJA A;  2CFX A;  3V7R A;  5DCF A;  4YIF A;  2NNN A;  4AWX B;  4L9T A;  2QBY A;  5AIQ A;  1V4R A;  3BPV A;  3CJN A;  5ICC A;  4RB1 A;  1RUO A;  4LFU A;  4U0W A;  4KIB A;  2C6Y A;  1R23 A;  1IXC A;  4CXF A;  4QLC U;  1D5V A;  2OZU A;  2Y0M A;  2H27 A;  3ECH A;  4EVI A;  4EJT A;  4YG2 F;  2L54 A;  2HKO A;  3CDH A;  4L0Y B;  3CUO A;  5BQT A;  2MD5 A;  1R5H A;  2O3F A;  3V7S A;  1OMI A;  4H0E A;  3L9F A;  3TOA A;  1ULY A;  4Y15 A;  1F9N A;  4K2E A;  1S7O A;  3ZN1 A;  2XAG A;  2OD5 A;  4JBA A;  4ESJ A;  4FX0 A;  5FLX K;  1SD4 A;  5LHI A;  4Y17 A;  3BRO A;  4L9V A;  2FXA A;  3ULQ B;  2EV5 A;  1KYW A;  3QPH A;  3BY6 A;  2KJC A;  4IRG A;  4HZF A;  1FY7 A;  5IT9 K;  2ISY A;  5FD6 A;  1MD0 A;  2HOE A;  1P6R A;  2IA0 A;  1R22 A;  4I0B A;  3FZV A;  3Q5F A;  4MNU A;  3Q9S A;  2HGC A;  4UXN A;  1LEB A;  4GYG A;  4KFC A;  2E1N A;  1U6G A;  2L01 A;  2CSO A;  4TV7 A;  3JAM Z;  5JR3 A;  2HQN A;  2BE5 F;  2XAQ A;  5D5W B;  1XGO A;  3WTW C;  5DUK A;  2ACJ A;  4HF2 A;  5DCM B;  3R61 A;  2FBI A;  3RKY A;  3M9A A;  1XMK A;  1JXS A;  2NRA C;  3RJP A;  3V7C A;  3FX3 A;  3ABU A;  1XCV A;  4O3M A;  2PQ8 A;  2L4A A;  1IXS B;  5E1Z B;  4DNC A;  1BI2 A;  2XV4 S;  3IRQ A;  4I02 A;  3WTX C;  2KIF A;  1XDS A;  4HAM A;  3C7J A;  4M71 A;  1KA8 A;  1RUN A;  4FX4 A;  1E2X A;  2DPD A;  4O6J A;  3TDZ C;  3WU1 B;  3HTU A;  1S29 A;  5ILV A;  2TDX A;  4PZJ A;  4IRI A;  2XHK A;  1FSE A;  3B02 A;  4OIQ F;  5ICE A;  1ZYR F;  4MTE A;  3EUH A;  2HR3 A;  3TO9 A;  2ADU A;  2DFI A;  3T1B A;  1O3R A;  2XAF A;  2E1C A;  6PAX A;  2YX4 A;  4HX8 A;  5CVJ A;  1EH6 A;  3GXO A;  1OR7 A;  3TQN A;  4N0B A;  4ZYE A;  3D5L A;  3KP7 A;  1LDJ A;  5FLX Z;  2RGV A;  3WTV C;  1U5T B;  2PI0 A;  1BIA A;  3DKW A;  3MZY A;  3WU0 A;  4MEX F;  5DD4 A;  4I98 B;  5E17 F;  4YFK F;  2V6C A;  3PFI A;  3LWF A;  1BOA A;  1YTY A;  1IRF A;  1K78 A;  1J2X A;  1FT9 A;  2DQL A;  2QQB A;  4YFN F;  5TRD A;  3R0J A;  3WTU C;  3BDD A;  2GA1 A;  5FB2 A;  3I4P A;  4LG0 B;  1UST A;  3J81 K;  5K1Y A;  1HKT A;  4OIN F;  5LGU A;  5HDK A;  3ABT A;  1USS A;  3FMQ A;  2Z99 A;  3U1D A;  4IRH A;  3CUQ B;  2P5V A;  2V79 A;  3K9T A;  3IKV A;  1IN7 A;  1FBU A;  3COA C;  4ENN A;  2D1H A;  1DUX C;  3SQN A;  2D45 A;  5H6Q A;  4BH9 A;  2ZXJ A;  4R1H A;  3ZQ7 A;  1MKM A;  5L3B A;  3K2Z A;  3WE3 A;  3BJA A;  2PFB A;  2M87 A;  1HST A;  2ZME B;  2VBY A;  3MCZ A;  5DYM A;  3FHZ A;  4MGR A;  2FQ3 A;  1TNS A;  1Z1D A;  2KKO A;  1W7P A;  2O6G E;  1GVJ A;  4EJO A;  4HV5 A;  4LMY A;  3PQJ A;  3KCC A;  2OA4 A;  3I54 A;  1S8N A;  2ZCW A;  1FYL A;  3FMR A;  2FML A;  5KVR A;  1B9M A;  1BC7 C;  4ESF A;  4P5O A;  2GXG A;  3GFJ A;  2FEZ A;  1KGS A;  2VXZ A;  4U0Y A;  1ZRD A;  1OYW A;  1QGP A;  2QZ8 A;  1S6L A;  1IN4 A;  1ODD A;  1WSU A;  2QQ9 A;  3P9I A;  5LLQ A;  5DD8 A;  2Z33 A;  2CGP A;  4RGX A;  2FA5 A;  4M9Z A;  1KQ8 A;  2Q8K A;  5L3G A;  1T98 A;  2X0L A;  1ZRF A;  3S2W A;  2BYV E;  5JHU A;  2XAS A;  5E8G A;  2FSW A;  4PGG A;  5D5X B;  2VT2 A;  4RGU A;  3E5U A;  2VOD A;  1TLH B;  2FE3 A;  1IUY A;  4UHT A;  3M8F A;  1H0M A;  1IXR C;  1HKQ A;  2GAU A;  1RNL A;  3HYI A;  1R1T A;  1ON2 A;  1ZG3 A;  2A61 A;  3KP2 A;  4I01 A;  5D8K B;  2EB7 A;  3U9G A;  3FMS A;  1J59 A;  2E7W A;  3F6O A;  4IXA A;  2FBH A;  2DTR A;  3ELK A;  3GFL A;  2WTE A;  4G9Y A;  3P7N A;  4EJW A;  4RS8 A;  2VBX A;  3K1M A;  3KZZ A;  3VOD A;  3F8M A;  2PMH A;  3GLX A;  4G8X A;  5J6X A;  1O3S A;  2CO5 A;  1LB2 A;  3JTH A;  1TBX A;  1SD6 A;  1MDM B;  1B9N A;  1XDU A;  4U7B A;  2YSR A;  5A2Q K;  1Z7U A;  2Q0O A;  1UHM A;  2D1V A;  4I2O A;  3F8N A;  3GWZ A;  2A6E F;  1P4A A;  2HWV A;  3E6M A;  3G73 A;  1XGS A;  1TQP A;  4HOB A;  3AAF A;  2P6S A;  3T8R A;  4ZH4 F;  2O8X A;  4GCV A;  1HW1 A;  3KZY A;  1HW2 A;  4ESB A;  2CW0 F;  4F7Z A;  3L7W A;  5ERI A;  5JVT A;  3WGG A;  2P6T A;  2EFO A;  4EV0 A;  5DCM A;  2HTS A;  2G7U A;  1KU7 A;  2H6B A;  1MJB A;  1BI0 A;  5K5Q A;  2VBW A;  3V8K A;  3TO6 A;  3ROU A;  3I59 B;  1K7A A;  2M45 A;  3FWE A;  3K69 A;  5DV5 A;  5D6F A;  3B73 A;  2ZME A;  1CF7 A;  5HS8 A;  3F8C A;  5J8C A;  3MQ0 A;  2HTJ A;  3IHU A;  3GVA A;  3I71 A;  4BYY A;  3H3U A;  3IKT A;  1H9T A;  2UZK A;  5HVQ C;  3R4K A;  3GX4 X;  1YQA A;  3ZMU A;  2GXB A;  5HS7 A;  3RYR A;  3KLN A;  4I09 A;  5CYV A;  1IF1 A;  3WTZ A;  5E18 F;  1KQ0 A;  3I53 A;  4M9X A;  2JSC A;  5DEQ A;  1B4A A;  1A04 A;  3QU6 A;  2W24 A;  1Z9C A;  5LRR A;  4HW0 A;  1J5Y A;  5F6F A;  1U5T C;  2HFH A;  4AIK A;  4M6X A;  2PN6 A;  4LLN A;  1B6A A;  2NYX A;  1AOY A;  3H92 A;  2EA4 A;  4OIR F;  2PMU A;  2HS5 A;  2P7V B;  2CG4 A;  1P4X A;  5LEK A;  3BWG A;  3BP8 A;  4EGY A;  4HF0 A;  4LLG F;  5K5R A;  5CVR A;  1SMY F;  3F23 A;  4RAZ A;  1PP7 U;  2FF4 A;  2A07 F;  4UV8 A;  1L3L A;  4LD5 A;  1SAX A;  2IA1 A;  4BXU A;  2RV8 A;  3CUQ C;  1MZB A;  2ZKZ A;  3ZMS A;  2NNY A;  1MDM A;  4ENK A;  2XRO A;  2GQQ A;  5L3E A;  3I64 A;  4ZZD A;  4UUV A;  4HX4 A;  2W57 A;  4MQ9 F;  3I0T A;  1KU3 A;  2NS0 A;  1WQ2 A;  3KET A;  3RI4 A;  1DDN A;  4L0Z B;  3H3Z A;  3J80 Z;  2YR2 A;  4HF1 A;  3FXQ A;  1Z6T A;  1PDN C;  3E6B A;  1XGN A;  2IRF G;  4G7Z F;  4UNO A;  4KIF A;  3RTR A;  4B09 A;  1DPU A;  4UVA A;  1IAW A;  3GYH X;  2JPB A;  3BZ6 A;  2OZ6 A;  4KN4 X;  4ZYD A;  2W84 A;  4L5I A;  4ZYG A;  2VE8 A;  4HA8 A;  1EH7 A;  1R1U A;  2DO7 A;  2H09 A;  5AIP A;  2X4H A;  2JRT A;  1KYZ A;  2LKP A;  3JSO A;  2JPC A;  3E6C C;  4RAY A;  1BIB A;  4HDU A;  2EWN A;  1G3T A;  1IW7 F;  1YS6 A;  2O0Y A;  3F21 A;  1S7A A;  3E97 A;  1PUE E;  4HX7 A;  4CDG A;  1Z6R A;  1B1B A;  1UCR A;  4RB3 C;  1PP8 F;  3FF5 A;  3C1D A;  5HLH A;  1GHC A;  1G6N A;  1S3J A;  1ZN2 A;  4E70 A;  3I58 A;  1W5T A;  4XLP F;  5E8I A;  1O57 A;  3GFI A;  1FNN A;  2CQK A;  5AON A;  3KP5 A;  1XGM A;  2XKO A;  3T8T A;  5ILS A;  2P4W A;  1Z05 A;  2KJB A;  3ZPL A;  5KK1 A;  3CLO A;  3FM3 A;  3CUQ A;  5CVV A;  3ISP A;  2F5E A;  4ON0 A;  2R7D A;  3U2R A;  1U8R A;  4KDP A;  2EFN A;  1BN5 A;  1I6X A;  3KEO A;  4HQE A;  1Y0U A;  1XSD A;  4A0Z A;  2G9W A;  4FHT A;  2IJL A;  2NAZ A;  2EFP A;  2OBP A;  3GEZ A;  4A5M A;  3JAM K;  1YFH A;  4KNY A;  4RB0 A;  3WG9 A;  3D0S A;  4L5J A;  3EYY A;  3LA3 A;  4WXH A;  3MWM A;  2J5O A;  5BPI A;  4BHB A;  4R79 A;  3HIF A;  1ZRC A;  1I1S A;  3F72 A;  3RKW A;  5ICF A;  1MJA A;  3FXU A;  4BNC A;  4ETS A;  1BC8 C;  2FU4 A;  2A5Y B;  3IWF A;  3IL2 A;  4I0A A;  2KIM A;  1H9G A;  1KU9 A;  2ESN A;  3WE2 A;  1XSV A;  2ISZ A;  2W25 A;  2MH9 A;  4G6D A;  1ZLJ A;  1HBX G;  3I59 A;  3DPT A;  1ZG5 A;  1R36 A;  3M7G A;  3DF8 A;  4XBF A;  1K79 A;  2DQR A;  1YLF A;  2MA3 A;  2V1X A;  3F6V A;  2DU9 A;  1K6O A;  4QWQ A;  2QBY B;  1KQ9 A;  2O03 A;  4RGS A;  2COM A;  1HSJ A;  1O3T A;  2M30 A;  3GO5 A;  5JFR A;  3L00 A;  3DEU A;  2VC1 A;  1FBS A;  1ZGA A;  2K86 A;  5DDG A;  1KU2 A;  4LK1 F;  3LST A;  2EA2 A;  4LGW A;  2XRN A;  2CWE A;  1YG2 A;  2A69 F;  4OU0 A;  2DAO A;  1SFX A;  5E1X A;  2P5K A;  3ERE D;  5D8L B;  1XCB A;  3EDP A;  3VB2 A;  2OAZ A;  4LB6 B;  3SXY A;  3VOE A;  1U3E M;  5BOX A;  2ZME C;  3K1N A;  2EK5 A;  2HZT A;  4M72 A;  3T5X A;  4M9S A;  4GGG A;  3GZ5 A;  4PCQ A;  4LJZ F;  2RN7 A;  4BQA A;  1FPQ A;  1W7P D;  3E5Q A;  4B8X A;  5LHH A;  2LDU A;  4UVC A;  5CVI A;  3KE2 A;  4KIG A;  1XD7 A;  2E7X A;  4G6Q A;  3V4G A;  3L09 A;  4ZZL A;  4HBL A;  4CHU A;  2MH2 A;  3ZN0 A;  4XLN F;  3QP6 A;  1R00 A;  4WWC A;  1ZLK A;  1ZG1 A;  1TTY A;  4JQF A;  3ZMT A;  1F4K A;  5A2Q Z;  2WWY A;  2KIU A;  4EJU A;  3HRS A;  1BM9 A;  2MC3 A;  4HYE A;  5ILU A;  5LRS A;  3HRM A;  4BHP A;  1CGP A;  2F5F A;  4KIC A;  5FO5 A;  2P5L C;  1IZ1 A;  3IWZ A;  2LF8 A;  5LGN A;  1SFE A;  4CZZ A;  3HUG A;  4OMY A;  1STZ A;  4OIO F;  4KA4 A;  2QWW A;  3SZT A;  3J80 K;  2JT1 A;  3J81 Z;  2A6H F;  1EH8 A;  1ZAO A;  4LK0 F;  2L02 A;  1QPM A;  1JE8 A;  3KP6 A;  1QO0 D;  3MFK A;  3HRU A;  2EJR A;  2YU3 A;  4GO1 A;  5HS9 A;  3ECO A;  2XAJ A;  4EM1 A;  1EV7 A;  1DP7 P;  1RZ4 A;  1O7F A;  3RYP A;  1J9I A;  3O3K A;  3LAP A;  3HHH A;  2EFW A;  1FOK A;  4WX9 A;  2ESH A;  2JZY A;  3OV8 A;  1ZAR A;  4DQ2 A;  2GWR A;  2LF7 A;  4KT5 C;  1JHH A;  5F1R A;  4KMU X;  2KRF A;  4IHT A;  1FX7 A;  2F2E A;  2FRH A;  2QUF A;  3RKX A;  1XB4 A;  4YFX F;  5EEG A;  1FP2 A;  1XMA A;  2VBZ A;  4P9U A;  2AXL A;  2K4J A;  4A12 A;  2FOK A;  1QZY A;  4MTD A;  2RC4 A;  4RB2 C;  3C18 A;  1FWZ A;  4EQQ A;  1AWC A;  3KEQ A;  2AS5 F;  2FBK A;  3WTS C;  3IRR A;  1FP1 D;  4GXO A;  3W6K B;  1E17 A;  5E20 A;  2IPQ X;  5BPD A;  3SFZ A;  4OMZ A;  4A0X A;  1QZZ A;  2K7L A;  3O2P E;  1QNT A;  2HEO A;  4BAY A;  2OU2 A;  3EET A;  3ZMV A;  2QLZ A;  4XSZ F;  4G7H F;  2LNB A;  3ZMD A;  1OPC A;  4EM2 A;  3V8J A;  3HSE A;  1NHA A;  3F3X A;  1FYK A;  4N9H A;  4M6Y A;  3QOP A;  1XSX A;  2LSO A;  4L18 B;  2BEO A;  3EYI A;  2DBB A;  3GF2 A;  2A68 F;  1HW5 A;  2QYO A;  3TKY A;  4L9J A;  2ZO4 A;  3C3W A;  1WKM A;  2FNA A;  5L3C A;  3HSF A;  2MBF A;  1O3Q A;  3N4M A;  4Z2Y A;  4HLY A;  3NQO A;  3HHG A;  5E1W A;  2XGX A;  1C0W A;  2Z9O A;  1LDK B;  1YS7 A;  1F5T A;  1ONV A;  4S05 A;  2QVO A;  3ZMZ A;  4IF4 A;  2G7H A;  5JI6 A;  1RIO H;  1YW9 A;  1OKR A;  1G3Y A;  2STW A;  1QBJ A;  2EFQ A;  3TDU C;  3P9K A;  1W7P B;  3TGN A;  4RGR A;  4HDV A;  3K1P A;  4U0V A;  3NEU A;  5LHG A;  2Z5U A;  1ZRE A;  2BV6 A;  1JHF A;  2DK5 A;  3TO7 A;  4MEY F;  2QQA A;  3I5U A;  3GZ6 A;  4MQV A;  3M8E A;  3SHF A;  5D4S A;  2VC0 A;  1T39 A;  2VOO A;  3WTY C;  1HQC A;  3CO7 C;  4IVN A;  2VN2 A;  2HKX A;  2MLK A;  4NB5 A;  3SZP A;  5LGT A;  2FMY A;  3BJO A;  1ZH5 A;  3DXJ F;  1IN5 A;  2DLL A;  2BGC A;  5LEJ A;  4Y13 A;  1I5Z A;  1G3W A;  3HSR A;  4WK8 F;  4ASN A;  4CO8 A;  3QP5 A;  3MZH A;  2HDC A;  1ON1 A;  4CGZ A;  4AIH A;  4YII A;  1K78 B;  3W6J B;  2ETH A;  3QU3 A;  4I7H A;  5K5O A;  5TJJ A;  1BI1 A;  1J7K A;  1UFM A;  2FNP A;  3GUD A;  3E6D A;  1U78 A;  4EJV A;  2YX7 A;  4KYW A;  1FC3 A;  2ZFW A;  1XN7 A;  2IVM A;  5L3F A;  4D0P A;  4G94 A;  1T0F A;  4Q5S F;  2K27 A;  3N97 A;  4S04 A;  5H20 A;  1VTN C;  4U88 A;  2L4M A;  1UHW A;  1IRG A;  1BBY A;  2PBI A;  2RVC A;  1P2F A;  3LFK A;  1FSH A;  5FFX A;  1CF7 B;  4KMF A;  3J7A O;  3DV8 A;  4Q48 A;  1D3Y A;  1TW2 A; 
#chains in the Genus database with same CATH topology
 3TL4 X;  3WOD F;  5ICG A;  2OQR A;  3Q9V A;  3B6A A;  1X4P A;  3E3V A;  1IN6 A;  1BJA A;  2ZNY A;  4JOM A;  1SMT A;  1ZHF A;  2XAH A;  2LKS A;  4RM2 A;  2PG4 A;  4XRS G;  3ZCO A;  1T2K A;  2BHY A;  1VQ7 I;  4CUG A;  2LMD A;  5FKK A;  2A6T A;  4Q4Z F;  2VKH A;  3DP7 A;  4ENJ A;  4A6D A;  2HXO A;  3IUO A;  2E19 A;  1FLI A;  1GLN A;  1JGS A;  5IT9 Z;  4PK4 A;  5EDN A;  2DOA A;  4ZDO A;  3HOW J;  4BBR J;  2WB1 A;  2NVQ J;  2IA2 A;  1T6S A;  4PJM A;  1WI3 A;  3QAH A;  4KUM A;  5BMZ A;  3LA7 A;  3A01 A;  4P96 A;  2XVC A;  2VT3 A;  2R7Z J;  3BTI A;  1B72 B;  2VQG A;  4II3 A;  2H94 A;  3EPZ A;  2IT0 A;  4ZC3 A;  5FRO A;  2HVS A;  2E35 A;  4XSX F;  3L2C A;  2HNH A;  1I1G A;  5IP6 A;  1DP3 A;  2KRH A;  2X1D A;  3FXR A;  4KN7 X;  4D7N A;  5J8F A;  3WHC A;  3QWL A;  1FBQ A;  2B0L A;  3HOT A;  1LE8 A;  2ZSI B;  1Z0X A;  1ZR4 A;  2CMP A;  3CTA A;  3BR0 A;  2W48 A;  3WGI A;  2DYS H;  1DPR A;  2IS4 A;  1V5G A;  3AG3 H;  1U5T A;  3IC7 A;  1WH7 A;  2QSF X;  2ZJ2 A;  2Y48 A;  2EIM H;  4CH7 A;  2TRT A;  2VJJ A;  1MBH A;  2EZK A;  2HYG D;  1L0O C;  1W5S A;  4AC0 A;  1NK2 P;  1YW7 A;  3TOB A;  2DK8 A;  1YW8 A;  2J5P A;  2GBY A;  3F22 A;  4UVB A;  4XON A;  1MNM C;  3T0Y A;  2DA3 A;  1FOW A;  3JTG A;  1V3F A;  2UWM A;  3LA2 A;  1BA5 A;  2V1U A;  1OYI A;  3OL3 A;  4FE7 A;  2WY8 Q;  1BI3 A;  2LR8 A;  2A3S A;  2CW7 A;  5JHF A;  3OOP A;  4ZYH A;  5BS6 A;  1Y1V J;  2EV0 A;  4GYI A;  3RIR A;  1SD5 A;  2IP2 A;  4DBQ A;  3HRT A;  4KIS A;  1TT5 B;  4JP0 A;  3LQR A;  2IS1 A;  2K4B A;  2CS3 A;  4IO9 F;  4AD9 A;  1GVD A;  2DW4 A;  3HJE A;  4OIP F;  3S3N A;  1A5J A;  2IS6 A;  4LG0 A;  1XPX A;  1HXD A;  1UG0 A;  1YIO A;  2GZW A;  1X3W B;  2W85 A;  4WXC A;  3RPU A;  2HPI A;  1REP C;  2R7S A;  3E5X A;  1VQN I;  4AIJ A;  5DS9 A;  2Y9Y A;  3DTK A;  3HOS A;  2P7C B;  4NQW A;  4LB5 A;  2RQP A;  3LSM A;  1TW3 A;  1ETV A;  2EIJ H;  2ZXI A;  4OOI A;  1R4N B;  5FKO A;  5IYB J;  1WVR A;  1NG6 A;  5EGO A;  5F64 A;  2R7F A;  4EM0 B;  4HQM A;  5CJ9 A;  3W2A A;  2RDP A;  1T95 A;  3R0A A;  5F0H A;  4L9N A;  1VF9 A;  3V8L A;  3DU6 A;  1X1C A;  4Q47 A;  3CF2 A;  1H89 C;  3GLL A;  5EF6 A;  2LFB A;  1WWX A;  3EUK L;  1V5E A;  2ELK A;  2L9R A;  3U1K A;  3SYT A;  1BR2 A;  3CCJ I;  1YO5 C;  4JX4 A;  1QVT A;  2YPR A;  3O6B B;  5GAD J;  3DKY A;  3QYE A;  5D4R A;  1GT0 C;  3W2W A;  3KFW X;  1E3H A;  2VQH A;  2HQR A;  4M3D A;  1RC9 A;  2RAE A;  4R8H A;  3KPH A;  3NRV A;  2XIG A;  2QSH X;  4AVZ A;  2WV0 A;  2X6O A;  1D5Y A;  3JSP A;  5IT3 A;  4WCG A;  5F27 A;  3VEP A;  1D8J A;  3F8F A;  1IDY A;  4XRF A;  2X85 A;  5ED4 A;  4MHG A;  4WXD A;  5IYD J;  3L2W A;  5CVU A;  4XIC A;  4G7O F;  1HA8 A;  4M3G A;  3DQV C;  2M4K A;  1LNW A;  2JTV A;  3F8B A;  4A2U A;  4CCJ A;  2DPU A;  4BHC A;  1Z91 A;  2OUM A;  4BEH A;  4UV9 A;  4IHY A;  5D6E A;  1DU6 A;  4PFO A;  1Y39 A;  3GFM A;  3A4C A;  4C3I J;  2KDZ A;  2KIS A;  2X51 A;  1LEA A;  2KIQ A;  4M73 A;  1YX3 A;  2VE9 A;  2F5C A;  2WC2 A;  1UB9 A;  3LAJ A;  2QEN A;  3SDG A;  4D5F A;  4IHS A;  1EKE A;  4O5V A;  2X48 A;  5EEH A;  5IP9 J;  1IV6 A;  2XC7 A;  1I3A A;  3WHB A;  4EGZ A;  1LVA A;  1IDZ A;  1TWC J;  1WRJ A;  2BBY A;  2XKP A;  2Y31 A;  1R5G A;  1ZGJ A;  1P92 A;  2M8E A;  5FFZ A;  1OYY A;  2IW5 A;  3K0L A;  2Q2E A;  4JK1 X;  1B59 A;  2BW3 A;  2LRE A;  5HLI A;  4AVP A;  1MND A;  3M1C A;  2NVX J;  3C2B A;  3S1N J;  2PLY A;  4U7D A;  3F9K A;  1D1C A;  1MGT A;  4N9I A;  5H6R A;  4P55 A;  5HLG A;  3HEF A;  3G3Z A;  3ZQI A;  2QM3 A;  3ERM A;  2VON A;  2EV6 A;  4A0Y A;  1TQM A;  3DBR B;  3JW4 A;  3CC4 I;  2O5R A;  5FKN A;  3K4N A;  4PSX A;  5EG0 B;  3M8J A;  1YIJ I;  1B72 A;  5KNL A;  2R3S A;  1X3Z B;  1WJD A;  4HLX A;  5HOO A;  1XTA A;  1WI9 A;  1QA6 A;  2HU9 A;  2DMP A;  2Z3Y A;  3EQL F;  4XKV A;  2O61 A;  3S3O A;  1FIA A;  2PJP A;  2G0E A;  5FGM A;  4EAT A;  1SFO J;  3LOC A;  4BU2 A;  3DWL E;  1F1Z A;  4UUS B;  3IH4 A;  1ETY A;  2M1B A;  2Y9Z A;  1NK3 P;  4CCN A;  2CU7 A;  1J0R A;  3WTT C;  1IGN A;  1TW2 A;  1R1V A;  3FXL A;  1TQI A;  2UXN A;  2RKH A;  3KP4 A;  1SFK A;  3KP3 A;  2L3D A;  3LL7 A;  4C9Y A;  1IN8 A;  4FIS A;  2LH9 A;  4BQO A;  1ACI A;  4P9F A;  3HM5 A;  1VQ4 I;  1A36 A;  1G59 A;  3LQQ A;  2W1O A;  3ML6 A;  4XLF A;  3U21 A;  3DBH B;  2COB A;  1Z3Y A;  2QGU A;  1R7J A;  2IGM A;  2Y30 A;  1I39 A;  4XLC A;  3C2H A;  3MKW B;  4BKX A;  1LDD A;  5B1A H;  1AHD P;  1R58 A;  5LBQ A;  3E7L A;  3A2K A;  3FXM A;  5HDG A;  2PEX A;  1K83 J;  2V9V A;  2X9D A;  2ZBK A;  3DFG A;  5EG0 A;  1W0U A;  5L3D A;  3VFZ A;  5BNG A;  2VLA A;  2BVL A;  3REO A;  3ZRG A;  2MLG A;  2OQG A;  2H8R A;  1JJ8 C;  1WGX A;  3BPX A;  3HZJ A;  4Y3O A;  4FQG A;  3PQK A;  4CIC A;  3R6S A;  3M1E A;  1X3U A;  2ZXH A;  4A3J J;  1LJ9 A;  2CYY A;  2GA2 A;  4CYD A;  3TP3 A;  2R92 J;  4BDY A;  5HOD A;  2DTZ A;  2K02 A;  2F5D A;  4WF2 A;  5H2F C;  5CKT A;  2M5W A;  3H9Q A;  4A3I J;  2DT5 A;  4JX6 A;  1MW7 A;  1GXP A;  2F4M B;  4LLL A;  3H1C A;  1F36 A;  2OC6 A;  5IP7 J;  2M9H A;  3AL0 C;  4PDK A;  1GXQ A;  5KCM A;  2CQX A;  2KL4 A;  3G4S I;  3BOQ A;  1A6I A;  5DUI A;  3GME A;  1D8K A;  2VXD A;  5FD5 A;  1SFU A;  1Z3X A;  2UXX A;  5D5V B;  4HRI A;  1YYV A;  4C3J J;  2VKE A;  3CCE I;  4PGH A;  1FYM A;  2ZNZ A;  2STT A;  4F52 A;  4A3L J;  1V54 H;  4ZYA A;  2RNJ A;  4HV6 A;  4B48 A;  5TIS C;  1UHS A;  4IPA A;  4E6K G;  3BCA A;  1P4W A;  4A3M J;  1JTY A;  2V1D A;  3H9G A;  3WGH A;  2WAF A;  1K4S A;  2IS2 A;  3W3C A;  2DA5 A;  2VOP A;  4EMS A;  1HDD C;  2K9S A;  4FT8 A;  1G4D A;  4NHJ A;  2H6C A;  2K5C A;  1T38 A;  2DI3 A;  2NOJ B;  3ZXS A;  3GTK J;  2IAI A;  3BJ6 A;  2DT6 A;  3ZOB A;  1RI7 A;  2Y75 A;  2D2W A;  1W4M A;  3R60 A;  4A6E A;  1R6R A;  1AU7 A;  1QZE A;  3GW2 A;  4A5N A;  1FZP B;  2JJ7 A;  3MEX A;  3OYE A;  1HKS A;  4ENM A;  2XB5 A;  1QQI A;  3ZP5 A;  3QPT A;  1PYV A;  3FM5 A;  3MAJ A;  2P0W A;  5F0C A;  3BC8 A;  5CLS A;  3FKJ A;  1O7L A;  3P9C A;  5HDN A;  3OYA A;  1J75 A;  1MJ9 A;  1SD7 A;  2MD0 A;  1Q1H A;  3CMM A;  3QRF F;  2LY1 A;  1Q1V A;  3DPL C;  1TNT A;  3ZQQ A;  2P81 A;  3KLO A;  3LSG A;  3TBI A;  1LQ1 A;  1JUP A;  3BTC A;  4I99 C;  3RPQ A;  4M74 A;  1I27 A;  3FIS A;  5C3E J;  1FTT A;  1Y6I A;  2DFF A;  5D5U B;  3HGY A;  1G3S A;  2GIV A;  2M34 A;  4CA0 A;  3FHN A;  3HTS B;  2XUB A;  3RDI A;  3H0G J;  2P8T A;  3OOU A;  2ELH A;  3OYH A;  4LIU A;  3CO6 C;  2VKV A;  1MSF C;  4D7M A;  2NVT J;  2HYF A;  1U2W A;  1Z77 A;  1RRJ A;  2KZV A;  2R7V A;  3SEQ A;  4IJA A;  2CFX A;  3V7R A;  1MBK A;  5DCF A;  5GTH C;  2ME0 A;  3BR1 A;  4YIF A;  4FET A;  4IOC F;  3BG3 A;  2NNN A;  1UAA A;  4AWX B;  4L9T A;  2QBY A;  5AIQ A;  2CUZ A;  1V4R A;  3BPV A;  3CJN A;  3CCY A;  5ICC A;  3HOU J;  4RB1 A;  1RUO A;  2B63 J;  4LFU A;  1BJZ A;  4U0W A;  2LKX A;  4KIB A;  3HOZ J;  2C6Y A;  5EJC A;  2X6Y A;  1MNE A;  4ANJ A;  1FOX A;  3S14 J;  1R23 A;  1IXC A;  4CXF A;  2DMN A;  3AFH A;  2K3F A;  4QLC U;  3PO3 J;  1D5V A;  2OZU A;  2PX9 A;  1QHG A;  2Y0M A;  3CCV I;  2H27 A;  3ECH A;  4EVI A;  4EJT A;  4YG2 F;  3A0H C;  2L54 A;  1RET A;  2HKO A;  2LK2 A;  3CDH A;  4L0Y B;  2KRC A;  3CUO A;  3DKX A;  5BQT A;  2MD5 A;  1R5H A;  2JQ7 A;  2O3F A;  3V7S A;  1OMI A;  4H0E A;  2EPF A;  3OIQ A;  1KON A;  3L9F A;  1Y8R B;  3TOA A;  1ULY A;  4Y15 A;  2DN0 A;  1X1A A;  1YRN B;  1F9N A;  4K2E A;  1S7O A;  2E71 A;  3ZN1 A;  2XAG A;  1U0J A;  2OD5 A;  4JBA A;  4ESJ A;  4FX0 A;  4IX7 A;  5FLX K;  1SD4 A;  4ABZ A;  5LHI A;  4E7S A;  2KZG A;  1CQT A;  2KPM A;  3PSI A;  3CJQ B;  3BQZ A;  4XOR A;  4Y17 A;  3HPG A;  2JWT A;  3BRO A;  3DU5 A;  4L9V A;  2FXA A;  3ULQ B;  2EV5 A;  4HSR A;  3BG9 A;  1KYW A;  3CZ6 A;  3MZ8 A;  2HQ5 A;  4E7I A;  1B8I A;  4UY8 I;  1W5C C;  3QPH A;  3BY6 A;  3JRI A;  2KJC A;  4FCY A;  4IRG A;  4YEL A;  2VJI A;  5GPC A;  4HZF A;  1D0Y A;  2XF6 A;  2YS9 A;  1FY7 A;  5IT9 K;  2ISY A;  1OJL A;  2E1O A;  5FD6 A;  1MD0 A;  1R5I D;  2HOE A;  3J7Z I;  2IGK A;  2K85 A;  1P6R A;  4M6V A;  2YU9 J;  2IA0 A;  1R22 A;  3HOY J;  4I0B A;  3FZV A;  3Q5F A;  4MNU A;  3QPL A;  2EZL A;  3Q9S A;  2HGC A;  4NC7 A;  1SVO A;  4UXN A;  1LEB A;  2QEX I;  2FX0 A;  4GYG A;  4KFC A;  2E1N A;  2WBM A;  1U6G A;  1XG1 A;  4MIM A;  1T0F C;  2L01 A;  2CSO A;  3ZQF A;  1YX5 A;  3OYG A;  4TV7 A;  3JAM Z;  3CQZ J;  5JR3 A;  2HQN A;  3ZQL A;  2BE5 F;  2XAQ A;  5D5W B;  1MBF A;  1XGO A;  3WTW C;  5DUK A;  1YHQ I;  2ACJ A;  4HF2 A;  5DCM B;  2PMZ A;  3R61 A;  3FDY A;  2FBI A;  3K4M A;  3RKY A;  3M9A A;  1XMK A;  1LFB A;  3AG4 H;  1JXS A;  1ZKG A;  2NRA C;  2DXI A;  3RJP A;  5J3L A;  3V7C A;  3FX3 A;  3ABU A;  2EBI A;  4BQN A;  4E4H A;  1XCV A;  1PUF A;  2PQ8 A;  2L4A A;  4RAG A;  4O3M A;  1IXS B;  5E1Z B;  4DNC A;  1BI2 A;  1YJ9 I;  1X2N A;  4F93 B;  2ZJQ F;  4V2G A;  4XN0 A;  1EJ9 A;  4DYR A;  2HDD A;  1G2H A;  1ORK A;  4KIT B;  3HBL A;  3AKZ A;  3HGG A;  1LFU P;  1N75 A;  1UZC A;  2XV4 S;  3H35 A;  3SDB A;  3BG6 A;  3IRQ A;  5C4X J;  1OIS A;  3HKZ N;  4I02 A;  3WTX C;  3VYS B;  2R7O A;  2D5V A;  1M1E B;  1VQL I;  2KIF A;  1AKH A;  1X58 A;  4NQW B;  4IQ4 A;  2CV0 A;  2ECC A;  2RRE A;  2WA0 A;  1XDS A;  3DPU A;  1A35 A;  5KAF C;  4HAM A;  3C7J A;  4M71 A;  2DYR H;  4Y7N J;  5K7F A;  3ASN H;  3A03 A;  1KA8 A;  1RUN A;  1TWA J;  4FX4 A;  3VYT B;  3DLL F;  1E2X A;  3BQY A;  3Q0U A;  4IZZ A;  2DPD A;  1MMS A;  4O6J A;  5EZG A;  4Y4R A;  2DOE A;  2HDW A;  2RNG A;  3TDZ C;  4AM3 A;  1TP4 A;  4MFD A;  2IBD A;  4B43 A;  3WU1 B;  3HTU A;  2IGO A;  1S29 A;  5ILV A;  2TDX A;  4PZJ A;  4IRI A;  2XHK A;  3BR3 A;  4S0H B;  1FSE A;  3B02 A;  4OIQ F;  2DMQ A;  2H8W A;  1ZYR F;  5ICE A;  4MTE A;  1TWF J;  5JVG F;  1W36 D;  3EUH A;  5TGT A;  2HR3 A;  4B3A A;  3TO9 A;  1IV8 A;  2ADU A;  2DFI A;  3RSN A;  3T1B A;  1TWH J;  1O3R A;  2XAF A;  2E1C A;  1BR4 A;  2ZB9 A;  1Y8Q B;  3OMY A;  3LSJ A;  6PAX A;  2YX4 A;  4HX8 A;  2BW3 B;  5DM7 F;  3BCB A;  5CVJ A;  2VKD A;  3M07 A;  4CYC B;  1FJL A;  1EH6 A;  3GXO A;  2LBF B;  2JVH A;  1OR7 A;  3TQN A;  4N0B A;  4ZYE A;  5DM6 F;  3HB9 A;  2DA1 A;  1HDP A;  3D5L A;  3KP7 A;  1LDJ A;  2LRD A;  5FLX Z;  2O7O A;  2RGV A;  4OAZ A;  3OR1 C;  3WTV C;  1S5L C;  1U5T B;  5J40 A;  2PI0 A;  1VQO I;  1BIA A;  3DKW A;  3MZY A;  3WU0 A;  4MEX F;  3A02 A;  2M3A A;  2M7B A;  5DD4 A;  3CC7 I;  4I98 B;  1MMA A;  3K10 A;  5E17 F;  4YFK F;  2V6C A;  3BTJ A;  4NUB A;  2R7W A;  2F6C A;  3PFI A;  5B3S H;  3LWF A;  2HYJ A;  1YJN I;  1BOA A;  2ICW G;  1YTY A;  1IRF A;  3PL8 A;  1J2X A;  1K78 A;  1FT9 A;  2DQL A;  2QQB A;  4YFN F;  5TRD A;  4W97 A;  3MKL A;  3R0J A;  2KLO A;  3K4B A;  4HG2 A;  5J4V A;  3FK6 A;  5C4J J;  3WTU C;  3BDD A;  3CES A;  2GA1 A;  2E36 A;  3K2A A;  3ONQ A;  1MH4 A;  3I4P A;  5FB2 A;  2R5Z A;  1K61 A;  4LG0 B;  5FRM A;  1UST A;  3J81 K;  5K1Y A;  4IOA F;  1HKT A;  4OIN F;  5LGU A;  1BOB A;  2OCC H;  4M3B A;  5HDK A;  3G1L A;  1P7J A;  1JT6 A;  3ABT A;  1P7I A;  1USS A;  2MAB A;  1D0Z A;  2R4G A;  3FMQ A;  2Z99 A;  3U1D A;  4BQQ A;  3PM1 A;  4IRH A;  3I9V 2;  1ZEL A;  4A3C J;  3CUQ B;  2P5V A;  4ITV A;  2V79 A;  3OYC A;  2CRG A;  3K9T A;  3HUG B;  3IKV A;  4J19 A;  1IN7 A;  1E3P A;  4II2 A;  3G6E I;  2TCT A;  4W1U A;  1Z67 A;  3VSK A;  1U9O A;  1FBU A;  2PMZ N;  3COA C;  4ENN A;  2D1H A;  3RZD J;  1DUX C;  4XID A;  3SQN A;  1B8I B;  2D45 A;  5H6Q A;  2QQ8 A;  4BH9 A;  2ZXJ A;  4R1H A;  3ZQ7 A;  1MKM A;  5L3B A;  3K2Z A;  3WE3 A;  3EUA A;  3JCU C;  3BJA A;  4JX5 A;  2PFB A;  3LSR A;  2M87 A;  1XX5 A;  1HST A;  2ZME B;  4GDF A;  1V55 H;  3JRF A;  1Z21 A;  3V42 A;  2QSG X;  2R7X A;  3VDX A;  2VBY A;  4XR6 A;  3PUB A;  3MCZ A;  5DYM A;  3FBI B;  5IOZ A;  1IC8 A;  2V4J C;  4BJT A;  3FHZ A;  4MGR A;  2FQ3 A;  4P1W A;  1TNS A;  1Z1D A;  4FE4 A;  3TW7 A;  1LVK A;  2KKO A;  1W7P A;  2F4I A;  2O6G E;  2NS8 A;  2Z1D A;  1GVJ A;  3CCU I;  4BY1 J;  1NG7 A;  4HV5 A;  4EJO A;  1OCO H;  4LMY A;  3PQJ A;  3KCC A;  1F43 A;  2OA4 A;  3I54 A;  1S8N A;  2CV2 A;  2ZCW A;  1VQ9 I;  3I4M J;  4H4K C;  1X1B A;  1FYL A;  1WH5 A;  2BHZ A;  4BJ5 C;  3FMR A;  2FML A;  1WPK A;  5KVR A;  2XAU A;  4LIV A;  1JKQ C;  1B9M A;  4X6A J;  5M5W J;  3CCS I;  1MIJ A;  1T56 A;  1BC7 C;  3HG9 A;  5F1J A;  4ESF A;  2JRM A;  4GRI A;  4P5O A;  2GXG A;  3GFJ A;  2UV1 A;  2EIK H;  2BXY A;  2FEZ A;  5HNH A;  1KGS A;  2VXZ A;  4U0Y A;  5E3O A;  1RR8 C;  1ZRD A;  4XL9 A;  4C3H J;  1PUF B;  1OYW A;  1SVL A;  1QGP A;  2QZ8 A;  3L2V A;  1S6L A;  3DEE A;  3OIO A;  1N78 A;  2JA7 J;  1ETK A;  1YRN A;  3NWT A;  1IN4 A;  2MG4 A;  1T08 B;  1ODD A;  4XNF A;  1WSU A;  3OIP A;  3L1P A;  2QQ9 A;  5B5E C;  2OTJ I;  3P9I A;  4XQF A;  3GTP J;  3HDD A;  2HOA A;  2FD5 A;  5DD8 A;  5LLQ A;  2Z33 A;  2CGP A;  2DMU A;  4RGX A;  2FA5 A;  4M9Z A;  4XOP A;  1JKP C;  2Q8K A;  5L3G A;  2K9Q A;  1T98 A;  1KQ8 A;  3KIO A;  2X0L A;  3KEY A;  3G2B A;  4NC6 A;  1AKH B;  5FRN A;  1D1B A;  3S2W A;  1T33 A;  1ZRF A;  2BYV E;  5JHU A;  2XAS A;  2QCO A;  5E8G A;  2FSW A;  3H36 A;  4PGG A;  5D5X B;  2VT2 A;  2XPU A;  4RGU A;  3E5U A;  2VOD A;  1TLH B;  2FE3 A;  2B9S A;  3Q0V A;  1IUY A;  2VQC A;  4UHT A;  4CYC A;  3E0J B;  3M8F A;  3BTL A;  3CCQ I;  2ID6 A;  3PNY A;  1H0M A;  3OYJ A;  3BR2 A;  4ZTJ A;  1OQY A;  1IXR C;  1OCZ H;  3SZG A;  1HKQ A;  2GAU A;  5CQE A;  2I8D A;  1RNL A;  3HYI A;  1R1T A;  4ZDL A;  3DCF A;  1X19 A;  2JA6 J;  4RAF A;  1ON2 A;  3K4K A;  2V9K A;  1ZG3 A;  2A61 A;  3KP2 A;  4I01 A;  5D8K B;  2EB7 A;  4F92 B;  5EEA A;  3U9G A;  2JA5 J;  4KT6 A;  1QVU A;  2B7E A;  2EZI A;  3FMS A;  1J59 A;  2E7W A;  3F6O A;  3NAR A;  3Q3S A;  4C30 A;  4IXA A;  1POG A;  2FBH A;  1HCR A;  2DTR A;  3ELK A;  3GFL A;  2WTE A;  4HNT A;  4RBO A;  5FLV A;  1K6Y A;  2LLK A;  4G9Y A;  2HQA A;  3P7N A;  2KT0 A;  4EJW A;  3GTL J;  4RS8 A;  2VBX A;  2JMW A;  3GTQ J;  2DA2 A;  3LSI A;  3K1M A;  3KZZ A;  3VOD A;  3F8M A;  3L2R A;  1SEU A;  2PMH A;  3GLX A;  4G8X A;  1RR7 A;  5J6X A;  1Z7L A;  1O3S A;  3L2U A;  2CO5 A;  1LB2 A;  3JTH A;  3HXL A;  1TBX A;  2A5W A;  1SD6 A;  3QYF A;  1MDM B;  3CF5 F;  1B9N A;  5J4Y A;  5IYC J;  3CCL I;  4A69 C;  3DBL B;  2VIX A;  3D5S C;  1XDU A;  4U7B A;  2YSR A;  5A2Q K;  2ZXW H;  4V19 K;  1Z7U A;  2Q0O A;  1WJE A;  5JLX A;  1UHM A;  4MFE A;  2D1V A;  2E2I J;  3F8N A;  3GWZ A;  2A6E F;  4I2O A;  1P4A A;  2HWV A;  4D9J A;  3E6M A;  3G73 A;  2AXT C;  4BGD A;  1XGS A;  1VQM I;  3CJR B;  3GTO J;  1TQP A;  4M3E A;  4HOB A;  3AAF A;  2P6S A;  3T8R A;  4ZH4 F;  2O8X A;  3GBG A;  2F48 A;  4GCV A;  1HW1 A;  3KZY A;  3WG7 H;  1HW2 A;  3S1M J;  5K7H A;  4ESB A;  4XKB A;  2CW0 F;  3OYD A;  2Y0S N;  5FJ8 J;  3O8G A;  4F7Z A;  4BXF A;  3L7W A;  5ERI A;  2NS7 A;  2UUZ A;  2XGE A;  4JYK A;  2LD5 A;  5LD2 C;  1E0E A;  5JVT A;  1PVE A;  2E5Z A;  3WGG A;  2P6T A;  2EFO A;  4EV0 A;  3MVP A;  5DCM A;  2E2J J;  2HTS A;  2G7U A;  1MMN A;  1KU7 A;  3IV5 A;  3I4N J;  3TP0 A;  2DFE A;  5F04 A;  3JRC A;  2H6B A;  2HOT A;  3K4C A;  4A93 J;  2CUJ A;  2K3P A;  4BUP A;  1MJB A;  3SJM A;  1BI0 A;  4BL0 B;  5K5Q A;  2VBW A;  3V8K A;  3TO6 A;  2L7F P;  2NXN B;  2AQE A;  2ELJ A;  3I59 B;  3RPU D;  3ROU A;  1K7A A;  2M45 A;  3DLA A;  2OTL I;  3RCO A;  3FWE A;  1WCM J;  3K69 A;  4XRM A;  1X4O A;  5DV5 A;  5D6F A;  3B73 A;  2ZME A;  1CF7 A;  5HS8 A;  1D1A A;  3ZGK A;  3OS0 A;  3F8C A;  1H8A C;  3I56 I;  3CP2 A;  3C2G A;  5J8C A;  3MQ0 A;  2FQ4 A;  2HTJ A;  2E60 A;  3GVA A;  3I71 A;  3IHU A;  4BYY A;  3H3U A;  3IKT A;  3S2D J;  5GTI C;  1H9T A;  2UZK A;  5E79 C;  3RZO J;  5HVQ C;  3R4K A;  3GX4 X;  1YQA A;  2F5V A;  3ZMU A;  1ETW A;  2GXB A;  5HS7 A;  4IHX A;  2Z16 A;  3AG1 H;  3RYR A;  1UG2 A;  4B44 A;  2LOO A;  2X1E A;  4AU7 A;  2DFH A;  2CQ7 A;  3KLN A;  4I09 A;  5CYV A;  5GAE J;  1IF1 A;  3WTZ A;  4QPO A;  2LY2 A;  1R71 A;  5E18 F;  2JK3 A;  1KQ0 A;  2GIZ A;  1MBG A;  3S17 J;  2K9M A;  3I53 A;  4BE2 A;  4M9X A;  2JSC A;  5DEQ A;  1B4A A;  1OCT C;  2BZT A;  2M0C A;  1A04 A;  3QU6 A;  2W24 A;  4AYB A;  1Z9C A;  5LRR A;  4DBR A;  4HW0 A;  4ZTF A;  1J5Y A;  1MBJ A;  5F6F A;  4Z6Y A;  2L0K A;  1RPW A;  1U5T C;  1ETO A;  2HFH A;  1JKO C;  4ZDP A;  2AO9 A;  1MH3 A;  1TWG J;  3LMM A;  4XOT A;  4AIK A;  4M6X A;  2PN6 A;  4LLN A;  2Y69 H;  4AID A;  4AUX A;  1B6A A;  2KP6 A;  2NYX A;  3WU2 C;  1AOY A;  3GTJ J;  3H92 A;  2EA4 A;  3BG5 A;  4OIR F;  2PMU A;  1HC8 A;  1TZL A;  3HC7 A;  3FIW A;  2HS5 A;  2XDV A;  2P7V B;  2CG4 A;  4E7L A;  1P4X A;  2O8K A;  5LEK A;  3BWG A;  1ZTR A;  3BP8 A;  4EGY A;  2Y0S A;  1SAN A;  3GTM J;  4HF0 A;  2Y2Z A;  4LLG F;  5K7Z A;  5K5R A;  4C2U A;  2XGC A;  2L2O A;  2Z2S B;  5CVR A;  1SMY F;  3F23 A;  1WJA A;  1I6H J;  2W7N A;  4RAZ A;  4B47 A;  1PP7 U;  2FF4 A;  2DT7 B;  2A07 F;  2DA7 A;  4UV8 A;  1L3L A;  4LD5 A;  1SAX A;  2ZJP F;  2NVY J;  2IA1 A;  2CQQ A;  4BXU A;  2RV8 A;  3CUQ C;  1S72 I;  1MZB A;  3JRH A;  1VFC A;  2KHM A;  2GLO A;  2ZKZ A;  3ZMS A;  2NNY A;  3LSH A;  4PJL A;  1MDM A;  3P5J A;  1RKT A;  3B6C A;  5M3F J;  4A3F J;  1GV2 A;  2WY7 Q;  4ENK A;  3ASO H;  2XRO A;  2GQQ A;  2WAE A;  3NWS A;  3H0D A;  3ABK H;  4BE0 A;  5L3E A;  3I64 A;  2FOW A;  4ZZD A;  3PFY A;  3QPS A;  4UUV A;  4HX4 A;  3QQA A;  2HZD A;  4BS9 A;  2WAD A;  3CJT B;  1AA7 A;  1LE8 B;  1XMX A;  3G1M A;  2W57 A;  2JUC A;  4MQ9 F;  3H3V K;  3I0T A;  2X6X A;  3FKI J;  4BDZ A;  1KU3 A;  2NS0 A;  1WQ2 A;  3KET A;  4IHW A;  3RI4 A;  1DDN A;  1S9H A;  2XGD A;  1GV5 A;  4L0Z B;  3H3Z A;  3J80 Z;  2YR2 A;  4HF1 A;  1Y56 A;  3FXQ A;  4BY7 J;  1IJW C;  1Z6T A;  1SC7 A;  3MMY B;  1PDN C;  3E6B A;  4XLH A;  5F0F A;  1XGN A;  3S15 J;  4FAS D;  2IRF G;  4G7Z F;  4UNO A;  2BXZ A;  4KIF A;  1SVM A;  3RTR A;  4E7K A;  4B09 A;  1DPU A;  1QPI A;  4UVA A;  3UR3 C;  1IAW A;  3GYH X;  2JPB A;  2BY0 A;  3BZ6 A;  3W2V A;  2IXS A;  1DGW Y;  1OFC X;  2OZ6 A;  3FK7 A;  2VPR A;  4KN4 X;  5FKL A;  4ZYD A;  2W84 A;  3PO2 J;  1LUJ B;  4L5I A;  2DCE A;  4DYQ A;  4ZYG A;  2R7U A;  3PNV A;  4D5C A;  2VE8 A;  4HA8 A;  1EH7 A;  1J09 A;  1R1U A;  2DO7 A;  3S1R J;  2EIL H;  2L9N A;  2CW8 A;  2H09 A;  1UJ8 A;  2HPM A;  5AIP A;  2ECB A;  4J00 A;  2LBF A;  1K4T A;  2X4H A;  1VND A;  2HVQ A;  1VQP I;  2JRT A;  1KYZ A;  2L7Z A;  2LKP A;  3JSO A;  3I3L A;  4HNU A;  2JPC A;  1A6Q A;  3E6C C;  4RAY A;  2KMU A;  1BIB A;  3TMO A;  3OYM A;  2N8G A;  4HDU A;  4OWR B;  2LTP A;  2EWN A;  1G3T A;  1IW7 F;  5EZH A;  1YS6 A;  2O0Y A;  3F21 A;  1FIP A;  1S7A A;  3E97 A;  1PUE E;  1R4M B;  1XS9 A;  1WJB A;  1R9T J;  2M4G A;  4HX7 A;  4CDG A;  3IAM 2;  1Z6R A;  1B1B A;  2XB0 X;  1UCR A;  5F08 A;  4RB3 C;  4QSH A;  1TT0 A;  1PP8 F;  3FF5 A;  3C1D A;  2WAQ N;  5HLH A;  1GHC A;  1G6N A;  1WFX A;  1S3J A;  2XSJ C;  3EUH C;  1UMQ A;  2ID3 A;  4J01 A;  1ZN2 A;  4E70 A;  2L9S A;  2K40 A;  3RKQ A;  2V9P A;  2R7R A;  3I58 A;  5E3L A;  5GP9 A;  4QTR A;  1W5T A;  3ABL H;  4XLP F;  1E3O C;  5E8I A;  2DJN A;  1O57 A;  4YEJ A;  1FNN A;  3GFI A;  2CQK A;  4U87 A;  5AON A;  3KP5 A;  1XGM A;  2XKO A;  3H5R A;  3T8T A;  5ILS A;  2P4W A;  4I6Z A;  1Z05 A;  4IL6 C;  3S1Q J;  4YIR X;  2KJB A;  2DJI A;  4DOZ A;  2CUF A;  3ZPL A;  5CQG A;  3OS2 A;  1FMV A;  3JRD A;  5E3N A;  5KK1 A;  5M3M J;  3OYL A;  3CLO A;  3FM3 A;  3CUQ A;  3KX2 A;  1HLV A;  5CVV A;  5JLW A;  3ISP A;  3JR9 A;  2F5E A;  2NVU B;  2QF7 A;  4ON0 A;  2R7D A;  3M3Y J;  2RQQ A;  3U2R A;  4PFP A;  1U8R A;  4KDP A;  2EFN A;  1LFP A;  1BN5 A;  1IO2 A;  1I6X A;  5M5X J;  3F0C A;  3KEO A;  1OCP A;  4HQE A;  4X1E A;  2ZSH B;  1NH3 A;  5GAH J;  1Y0U A;  1XSD A;  2EQR A;  1ETQ A;  5B1B H;  4A0Z A;  1EA3 A;  2G9W A;  4FHT A;  3JRE A;  2IJL A;  1I3Q J;  2NAZ A;  3IAS 2;  2EFP A;  4QPQ A;  2H1L A;  1JI8 A;  2OBP A;  2W00 A;  2XF5 A;  3GEZ A;  3H9J A;  3OWT A;  3QYB A;  1H88 C;  3ESW B;  4A5M A;  3JAM K;  1YFH A;  3H5A A;  1IUF A;  1BR1 A;  1JTX A;  4KNY A;  4CCO A;  3MN2 A;  4RB0 A;  3CCM I;  3WG9 A;  2E1M B;  3D0S A;  1WHU A;  3EYY A;  4L5J A;  3LA3 A;  5FKM A;  1RES A;  1WZ2 A;  4N4N B;  2DDA A;  1S7E A;  4WXH A;  3MWM A;  2J5O A;  2WV1 A;  2BY3 A;  3PNT A;  5BPI A;  5GAG J;  2GOM A;  4B1R A;  4BHB A;  2AQF A;  4R79 A;  4QIW N;  3HIF A;  1TL8 A;  2W82 A;  3GZN B;  1ZRC A;  1X1P A;  1I1S A;  1W36 C;  3F72 A;  3RKW A;  2CH0 A;  2VI6 A;  3HKZ A;  2XPW A;  5ICF A;  4V2F A;  1MJA A;  3FXU A;  4BNC A;  2GM4 A;  4ETS A;  5CPR B;  4PSW A;  1BC8 C;  2FU4 A;  2A5Y B;  3IWF A;  2L7K A;  4UUT A;  3TW6 A;  3IL2 A;  1WJ5 A;  4I0A A;  2KIM A;  1H9G A;  3IH2 A;  1KU9 A;  2JUG A;  4CCM A;  3OYK A;  2ESN A;  4E7J A;  5GPA A;  3WE2 A;  1XSV A;  2ISZ A;  4XMY A;  3S8P A;  2W25 A;  2MH9 A;  4G6D A;  5J47 A;  2E5N A;  1ZLJ A;  3A1Y A;  4DW6 A;  3OYN A;  1HBX G;  3I59 A;  4PJ0 C;  3DPT A;  3PSF A;  1ZG5 A;  1R36 A;  3M7G A;  1MSE C;  3DF8 A;  4OAY A;  4XBF A;  1K79 A;  4DJA A;  2DQR A;  1YLF A;  2MA3 A;  1JGG A;  1GUU A;  2V1X A;  3MKZ A;  3F6V A;  1BW5 A;  2ZJR F;  2DU9 A;  1K6O A;  4QWQ A;  2QBY B;  3DTE A;  4XM3 A;  1KQ9 A;  2O03 A;  4RGS A;  4CSW A;  1WJF A;  2E1M C;  5IPA A;  2COM A;  2KFD A;  1HSJ A;  2QKM B;  2VQL A;  1O3T A;  3K7A J;  3S93 A;  2M30 A;  3BT9 A;  3GO5 A;  5JFR A;  3DEW A;  1HF0 A;  3L00 A;  3DEU A;  1X1D A;  2VC1 A;  3KYC B;  3CLQ A;  1FBS A;  1ZGA A;  2HXI A;  3ZQG A;  2K86 A;  5DDG A;  1KU2 A;  1U9N A;  1YE9 A;  4LK1 F;  3LST A;  2EA2 A;  4LGW A;  3LNQ A;  2XRN A;  2CWE A;  1PJR A;  4C2M J;  1N77 A;  1YG2 A;  2A69 F;  4NNJ A;  1YJW I;  1LKX A;  4Y52 J;  4OU0 A;  2DAO A;  1DGR M;  1SFX A;  4XLE A;  5E1X A;  2P5K A;  3OL4 A;  5D8L B;  3ERE D;  1UEL B;  1XCB A;  1DU0 A;  3D1N I;  3EDP A;  1IRX A;  3VB2 A;  2OAZ A;  4NC8 A;  2DA4 A;  4LB6 B;  3SXY A;  3VOE A;  5KHD A;  1U3E M;  5BOX A;  2ZME C;  2W4S A;  2L5Q A;  2EK5 A;  2HZT A;  3K1N A;  2L9V A;  4M72 A;  3T5X A;  3ZR8 X;  4M9S A;  4GGG A;  2VB6 A;  3GZ5 A;  4PCQ A;  3LSK A;  3VYR B;  4LJZ F;  2RN7 A;  3JRG A;  5M5Y J;  2JA8 J;  1HOM A;  1YIT I;  4BQA A;  3CMY A;  1FPQ A;  1W7P D;  4C2T A;  3E5Q A;  3VSL A;  4B8X A;  5LHH A;  2LDU A;  3G71 I;  4UVC A;  3G1O A;  3H5N A;  5CVI A;  1X2M A;  2DMT A;  3KE2 A;  4KIG A;  4LOC A;  3OY9 A;  1XD7 A;  2E7X A;  3PIO F;  3A01 B;  4G6Q A;  3V4G A;  3L09 A;  4ZZL A;  4HBL A;  4CHU A;  2MH2 A;  3ZN0 A;  4XLN F;  1YI2 I;  3QP6 A;  1R00 A;  4WWC A;  1ZLK A;  1ZG1 A;  2R0Q C;  1TTY A;  4JQF A;  3HOV J;  2OJE D;  1VQ5 I;  3ZMT A;  1F4K A;  3FXK A;  3FXO A;  5A2Q Z;  4AYB N;  2ZFU A;  4NDL A;  2WWY A;  4A3K J;  5B66 C;  2KIU A;  1QRY A;  3BZK A;  4EJU A;  3HRS A;  3CME I;  4RLQ A;  1BM9 A;  2MC3 A;  4Y33 A;  3BR6 A;  2CV1 A;  4HYE A;  5ILU A;  5LRS A;  3MD2 A;  3HRM A;  3MKY B;  4BHP A;  2M0M A;  1CGP A;  1W1W E;  2F5F A;  2OPT A;  3OS1 A;  3HOX J;  3X2Q H;  4RM3 A;  3N05 A;  4KIC A;  4IKF A;  4A3D J;  4XK4 A;  5FO5 A;  2P5L C;  1IZ1 A;  3S3M A;  3IWZ A;  4DGW B;  2CJJ A;  2L7M P;  2LF8 A;  2JA2 A;  5LGN A;  1SFE A;  4CZZ A;  3HUG A;  1W0T A;  4OMY A;  1STZ A;  4RDU A;  3HPH A;  3A0B C;  4OIO F;  4LIT A;  1VI0 A;  2CQN A;  4BJ6 C;  3RQI A;  2LY9 A;  4KA4 A;  2QWW A;  2DA6 A;  3SZT A;  3J80 K;  4N4O B;  2JT1 A;  4BE1 A;  3LFU A;  3J81 Z;  2A6H F;  5J1Y A;  1EH8 A;  1ZAO A;  4LK0 F;  1DQU A;  3S16 J;  2L02 A;  1QPM A;  4F55 A;  2V6E A;  1JE8 A;  2IEK A;  3KP6 A;  1QO0 D;  4BEH B;  1GDT A;  3KZI C;  3MFK A;  2R93 J;  3K4L A;  2WAQ A;  5FLM J;  2VPL A;  3HRU A;  2EJR A;  2YU3 A;  3FXJ A;  4GO1 A;  3BG7 A;  3J7A Y;  1IRZ A;  3DTI A;  5HS9 A;  3ECO A;  4D1Q A;  2XAJ A;  3AL0 B;  3K6G A;  4EM1 A;  1EV7 A;  1DP7 P;  1RZ4 A;  5IY5 H;  1O7F A;  1YOV B;  2MC4 A;  2R5Y A;  3RYP A;  1J9I A;  2VUM J;  3VWB A;  3O3K A;  3LAP A;  2E34 A;  4BAC A;  2DDB A;  1T8I A;  2HI3 A;  3HHH A;  2EFW A;  2HVR A;  4XKW A;  1FOK A;  3O8H A;  4RMN A;  4WX9 A;  2ESH A;  2F4O B;  2JZY A;  2MFZ A;  3OV8 A;  4B3X A;  4PJN A;  3PJR A;  4XRS A;  1ZAR A;  4DZJ A;  4DQ2 A;  4F91 B;  2VL8 A;  4A3G J;  1Y0N A;  2GWR A;  2LF7 A;  2WB1 N;  2V26 A;  2DOD A;  3CMA I;  4KT5 C;  5C44 J;  2EZH A;  3CDL A;  4BXX J;  1JHH A;  4F3Q A;  5F1R A;  5E3M A;  4KMU X;  2KRF A;  4DIQ A;  3GTG J;  1G8X A;  5HLT A;  4IHT A;  1FX7 A;  4L5E A;  2FJ1 A;  4YRV A;  2F2E A;  1R49 A;  2FRH A;  4HST A;  3OSG A;  2EH3 A;  2GXA A;  2QUF A;  1QU3 A;  3RKX A;  1XB4 A;  4YFX F;  5EEG A;  1FP2 A;  1XMA A;  5KAI C;  2VBZ A;  2PJR B;  4DYC A;  4P9U A;  2AXL A;  2K4J A;  2KDO A;  2X6W A;  4A12 A;  3BZC A;  2FOK A;  4PJJ A;  1ZK8 A;  4KJZ A;  1QZY A;  4MO7 A;  2DOF A;  4MTD A;  2RC4 A;  3RQ4 A;  3TED A;  2JN6 A;  4RB2 C;  3C18 A;  4B4C A;  2LVS A;  1FWZ A;  4UUS A;  4EQQ A;  1AWC A;  2Q2E B;  3KEQ A;  2AS5 F;  2FBK A;  4RA2 A;  3OYB A;  2ME6 A;  2QKL B;  3WTS C;  1O4X A;  3IRR A;  2BOL A;  3CC2 I;  2MGQ A;  2A05 A;  2JSP A;  1FP1 D;  4GXO A;  3W6K B;  1E17 A;  1SAU A;  2V1N A;  5E20 A;  4DZP A;  3VYU B;  1ZR2 A;  4UB8 C;  2IPQ X;  5BPD A;  3S32 A;  3S2H J;  3SFZ A;  4OMZ A;  3K70 D;  4A0X A;  1QZZ A;  2K7L A;  3O2P E;  3J7Y J;  3BLY A;  1QNT A;  1D0X A;  3PIP F;  2HEO A;  4BAY A;  2K9N A;  2OU2 A;  3EET A;  2ZC2 A;  2GOX B;  3ZMV A;  2QLZ A;  1ZQ3 P;  1N25 A;  2MYS A;  4XSZ F;  4G7H F;  2LNB A;  3ZMD A;  1OPC A;  2LC2 A;  4EM2 A;  3PUF A;  2E2H J;  2M7A A;  3V8J A;  2OV7 A;  5J1R A;  3HSE A;  1NHA A;  3F3X A;  4FTH A;  2BY2 A;  4A3E J;  3QOE A;  2MSY A;  1FYK A;  4N9H A;  4IQJ A;  4M6Y A;  3ZQH A;  2XRL A;  2V7F A;  3QOP A;  1A31 A;  1JUS A;  1XSX A;  2KQR A;  3ABM H;  2I5U A;  2LSO A;  3QOD A;  2BEO A;  3EYI A;  4L18 B;  2DBB A;  3GF2 A;  2A68 F;  1ITY A;  1HW5 A;  2QYO A;  4XKC A;  3CD6 I;  2K9L A;  3TKY A;  4L9J A;  2ZO4 A;  3C3W A;  2VJ4 A;  3KYL A;  1WKM A;  3I55 I;  2FNA A;  5L3C A;  3HSF A;  2MBF A;  1O3Q A;  4Z2Y A;  3N4M A;  4HLY A;  3NQO A;  3HHG A;  5E1W A;  2CFO A;  2XGX A;  1C0W A;  4IEJ A;  1WJC A;  2Z9O A;  1LDK B;  1YS7 A;  5DTD A;  1F5T A;  4XN3 A;  1ONV A;  3K4J A;  5J1U A;  4S05 A;  2QVO A;  3SFI A;  3IP4 B;  3Q0W A;  2BVM A;  4M3F A;  3ZMZ A;  3CDI A;  2HOS A;  3SEZ A;  3CCR I;  4IF4 A;  2G7H A;  4G12 A;  5JI6 A;  2I10 A;  1RIO H;  1ETX A;  1YW9 A;  1FMW A;  1OKR A;  4CCK A;  1MMG A;  1G3Y A;  2M8G X;  4A3B J;  3HL2 A;  2STW A;  4ZJZ A;  1QBJ A;  3TDU C;  3P9K A;  1W7P B;  3BR5 A;  2JVG A;  3TGN A;  4CZC A;  4RGR A;  4MLO A;  4HDV A;  2LYC A;  3K1P A;  4U0V A;  3NEU A;  1QHH D;  1BL0 A;  5LHG A;  1XC5 A;  1VQ6 I;  2Z5U A;  3NAU A;  2BV6 A;  1ZRE A;  1JHF A;  2DK5 A;  3OYF A;  3TO7 A;  4MEY F;  1U8B A;  2QQA A;  2X1C A;  3I5U A;  3GZ6 A;  4E7H A;  2LG4 A;  1ENH A;  4MQV A;  5LFA A;  2R5Y B;  3M8E A;  3D5R C;  4NBQ A;  2VC0 A;  3SHF A;  5D4S A;  1T39 A;  2VOO A;  3WTY C;  1HQC A;  3CO7 C;  4IVN A;  2R7Q A;  3OR2 C;  4I76 A;  1OR7 C;  2VN2 A;  1P9Q C;  5EGO B;  2HKX A;  2MLK A;  4NB5 A;  1VQ8 I;  1OCR H;  3E1S A;  2AHQ A;  3SZP A;  5LGT A;  2FMY A;  2QA4 I;  3UKG A;  1EF4 A;  2OCE A;  3BJO A;  3IH3 A;  3DXJ F;  1ZH5 A;  1IN5 A;  2M2E A;  4CCL A;  2DLL A;  2BGC A;  3KYD B;  5LEJ A;  1OCC H;  2XF7 A;  4PUS A;  2LP0 A;  4Y13 A;  1I5Z A;  1G3W A;  3UNG C;  3HSR A;  4WK8 F;  4ASN A;  2R5Z B;  1BW6 A;  4CO8 A;  2CUE A;  3QP5 A;  3MZH A;  2HDC A;  4X0G A;  5EYR A;  1ON1 A;  4CGZ A;  2R7T A;  2MW8 A;  1JT0 A;  4AIH A;  2PJR A;  9ANT A;  4YII A;  3ZQC A;  3W6J B;  1K78 B;  4BBS J;  2ETH A;  3QU3 A;  1JKR C;  2NOG A;  4I7H A;  4XLA A;  5K5O A;  4EEF G;  2YUS A;  4E7Z A;  1FEX A;  2Q1Z B;  4LG3 A;  1IG7 A;  5TJJ A;  1BI1 A;  1V5F A;  1J7K A;  3OYI A;  1FTZ A;  1UFM A;  2FNP A;  3GUD A;  3E6D A;  1U78 A;  4EJV A;  2IGN A;  2YX7 A;  1Y1W J;  2VJ5 A;  1FC3 A;  1JUM A;  3OSF A;  2ZFW A;  3W6V A;  4GFB A;  1XN7 A;  2IVM A;  5L3F A;  4KYW A;  4D0P A;  3JRA A;  4G94 A;  1VQK I;  1MMD A;  1T0F A;  1RKW A;  2K27 A;  4Q5S F;  2XPV A;  3N97 A;  4S04 A;  5H20 A;  1LPQ A;  1VTN C;  1TC3 C;  3M4O J;  4U88 A;  1FOY A;  3VPR A;  3AG2 H;  1NTC A;  2XSD C;  4G6T B;  2VAS A;  5IOY A;  2H1K A;  4IHV A;  1ERD A;  4RLF A;  2L4M A;  1UHW A;  1I50 J;  1IRG A;  1VZ0 A;  1BBY A;  2PBI A;  2EIN H;  2RVC A;  4UB6 C;  1P2F A;  4HNV A;  3L2Q A;  3K70 C;  1APL C;  3LFK A;  4HPQ A;  3GCM A;  1MBE A;  3LSP A;  2OF7 A;  3JRB A;  1FSH A;  5FFX A;  1ZGW A;  1CF7 B;  2O9L A;  1OLT A;  4KMF A;  3J7A O;  3FBN B;  3CP8 A;  3DV8 A;  1JJ6 C;  4Q48 A;  2BY1 A;  4HEA 2;  5HNF A;  1KZH A;  1D3Y A;  2FUG 2;  2EFQ A; 
#chains in the Genus database with same CATH homology
 3WOD F;  5ICG A;  2OQR A;  3Q9V A;  3E3V A;  1IN6 A;  1BJA A;  2ZNY A;  1SMT A;  1ZHF A;  2XAH A;  1T2K A;  2PG4 A;  4Q4Z F;  3DP7 A;  4ENJ A;  4A6D A;  1FLI A;  1JGS A;  5IT9 Z;  2IA2 A;  1T6S A;  3QAH A;  4KUM A;  5BMZ A;  3LA7 A;  4P96 A;  2XVC A;  2VT3 A;  2H94 A;  2IT0 A;  4XSX F;  3L2C A;  1I1G A;  3FXR A;  4KN7 X;  5J8F A;  1FBQ A;  2B0L A;  3HOT A;  3CTA A;  3WGI A;  1DPR A;  1U5T A;  3IC7 A;  2ZJ2 A;  2Y48 A;  2HYG D;  1L0O C;  1W5S A;  1YW7 A;  3TOB A;  2DK8 A;  1YW8 A;  2J5P A;  3F22 A;  4UVB A;  3T0Y A;  3JTG A;  1V3F A;  2UWM A;  3LA2 A;  2V1U A;  1OYI A;  1BI3 A;  2A3S A;  3OOP A;  4ZYH A;  5BS6 A;  2EV0 A;  4GYI A;  3RIR A;  1SD5 A;  2IP2 A;  3HRT A;  3LQR A;  2K4B A;  4AD9 A;  2DW4 A;  4OIP F;  4LG0 A;  1HXD A;  1YIO A;  3RPU A;  2GZW A;  2W85 A;  4WXC A;  1REP C;  3E5X A;  4AIJ A;  3HOS A;  2P7C B;  4NQW A;  4LB5 A;  2RQP A;  4OOI A;  1TW3 A;  5F64 A;  2R7F A;  4EM0 B;  4HQM A;  5CJ9 A;  2RDP A;  3R0A A;  4L9N A;  3V8L A;  4Q47 A;  1WWX A;  1YO5 C;  2YPR A;  3O6B B;  5D4R A;  3KFW X;  2HQR A;  4R8H A;  3NRV A;  2XIG A;  2WV0 A;  3JSP A;  5IT3 A;  4WCG A;  3VEP A;  1D8J A;  3F8F A;  4XRF A;  5ED4 A;  4MHG A;  4WXD A;  5CVU A;  4G7O F;  3DQV C;  1LNW A;  2JTV A;  3F8B A;  4A2U A;  2DPU A;  4BHC A;  1Z91 A;  4UV9 A;  5D6E A;  3GFM A;  1LEA A;  4M73 A;  2VE9 A;  2F5C A;  2WC2 A;  1UB9 A;  3LAJ A;  2QEN A;  4IHS A;  4O5V A;  5EEH A;  4EGZ A;  1LVA A;  2BBY A;  1WRJ A;  2XKP A;  1R5G A;  1ZGJ A;  1P92 A;  2M8E A;  5FFZ A;  1OYY A;  2IW5 A;  3K0L A;  2Q2E A;  4JK1 X;  1B59 A;  5HLI A;  4AVP A;  2PLY A;  4U7D A;  1MGT A;  4N9I A;  5H6R A;  5HLG A;  4P55 A;  3G3Z A;  2QM3 A;  2VON A;  2EV6 A;  4A0Y A;  1TQM A;  3JW4 A;  2R3S A;  4HLX A;  5HOO A;  1WI9 A;  2Z3Y A;  3EQL F;  2O61 A;  2PJP A;  5FGM A;  1F1Z A;  2M1B A;  1J0R A;  3WTT C;  1R1V A;  1TQI A;  2UXN A;  2RKH A;  3KP4 A;  3KP3 A;  2L3D A;  1IN8 A;  4P9F A;  3LQQ A;  3ML6 A;  1R7J A;  1LDD A;  1R58 A;  5LBQ A;  5HDG A;  2PEX A;  2V9V A;  2ZBK A;  3DFG A;  5L3D A;  3VFZ A;  3REO A;  2MLG A;  2OQG A;  3BPX A;  3PQK A;  4CIC A;  3R6S A;  3M1E A;  1X3U A;  1LJ9 A;  2CYY A;  2GA2 A;  4CYD A;  2K02 A;  4WF2 A;  2F5D A;  2M5W A;  2DT5 A;  1GXP A;  4LLL A;  4PDK A;  1GXQ A;  3BOQ A;  5DUI A;  1D8K A;  5FD5 A;  1SFU A;  5D5V B;  2UXX A;  1YYV A;  4PGH A;  1FYM A;  2ZNZ A;  2STT A;  2RNJ A;  4HV6 A;  4IPA A;  1P4W A;  2V1D A;  3WGH A;  2VOP A;  4EMS A;  4FT8 A;  1G4D A;  4NHJ A;  2H6C A;  1T38 A;  2DI3 A;  3BJ6 A;  1RI7 A;  2Y75 A;  2D2W A;  1W4M A;  3R60 A;  4A6E A;  3GW2 A;  4A5N A;  1FZP B;  3MEX A;  1HKS A;  4ENM A;  1QQI A;  3ZP5 A;  3QPT A;  3FM5 A;  3MAJ A;  5CLS A;  1O7L A;  3P9C A;  5HDN A;  1J75 A;  1MJ9 A;  1SD7 A;  1Q1H A;  3QRF F;  3DPL C;  1TNT A;  3KLO A;  1LQ1 A;  3RPQ A;  4M74 A;  1I27 A;  5D5U B;  1G3S A;  2GIV A;  3HTS B;  2XUB A;  3RDI A;  2P8T A;  2ELH A;  3CO6 C;  2HYF A;  1U2W A;  4IJA A;  2CFX A;  3V7R A;  5DCF A;  4YIF A;  2NNN A;  4AWX B;  4L9T A;  2QBY A;  5AIQ A;  1V4R A;  3BPV A;  3CJN A;  5ICC A;  4RB1 A;  1RUO A;  4LFU A;  4U0W A;  4KIB A;  2C6Y A;  1R23 A;  1IXC A;  4CXF A;  4QLC U;  1D5V A;  2OZU A;  2Y0M A;  2H27 A;  3ECH A;  4EVI A;  4EJT A;  4YG2 F;  2L54 A;  2HKO A;  3CDH A;  4L0Y B;  3CUO A;  5BQT A;  2MD5 A;  1R5H A;  2O3F A;  3V7S A;  1OMI A;  4H0E A;  3L9F A;  3TOA A;  1ULY A;  4Y15 A;  1F9N A;  4K2E A;  1S7O A;  3ZN1 A;  2XAG A;  2OD5 A;  4JBA A;  4ESJ A;  4FX0 A;  5FLX K;  1SD4 A;  5LHI A;  4Y17 A;  3BRO A;  4L9V A;  2FXA A;  3ULQ B;  2EV5 A;  1KYW A;  3QPH A;  3BY6 A;  2KJC A;  4IRG A;  4HZF A;  1FY7 A;  5IT9 K;  2ISY A;  5FD6 A;  1MD0 A;  2HOE A;  1P6R A;  2IA0 A;  1R22 A;  4I0B A;  3FZV A;  3Q5F A;  4MNU A;  3Q9S A;  2HGC A;  4UXN A;  1LEB A;  4GYG A;  4KFC A;  2E1N A;  1U6G A;  2L01 A;  2CSO A;  4TV7 A;  3JAM Z;  5JR3 A;  2HQN A;  2BE5 F;  2XAQ A;  5D5W B;  1XGO A;  3WTW C;  5DUK A;  2ACJ A;  4HF2 A;  5DCM B;  3R61 A;  2FBI A;  3RKY A;  3M9A A;  1XMK A;  1JXS A;  2NRA C;  3RJP A;  3V7C A;  3FX3 A;  3ABU A;  1XCV A;  4O3M A;  2PQ8 A;  2L4A A;  1IXS B;  5E1Z B;  4DNC A;  1BI2 A;  2XV4 S;  3IRQ A;  4I02 A;  3WTX C;  2KIF A;  1XDS A;  4HAM A;  3C7J A;  4M71 A;  1KA8 A;  1RUN A;  4FX4 A;  1E2X A;  2DPD A;  4O6J A;  3TDZ C;  3WU1 B;  3HTU A;  1S29 A;  5ILV A;  2TDX A;  4PZJ A;  4IRI A;  2XHK A;  1FSE A;  3B02 A;  4OIQ F;  5ICE A;  1ZYR F;  4MTE A;  3EUH A;  2HR3 A;  3TO9 A;  2ADU A;  2DFI A;  3T1B A;  1O3R A;  2XAF A;  2E1C A;  6PAX A;  2YX4 A;  4HX8 A;  5CVJ A;  1EH6 A;  3GXO A;  1OR7 A;  3TQN A;  4N0B A;  4ZYE A;  3D5L A;  3KP7 A;  1LDJ A;  5FLX Z;  2RGV A;  3WTV C;  1U5T B;  2PI0 A;  1BIA A;  3DKW A;  3MZY A;  3WU0 A;  4MEX F;  5DD4 A;  4I98 B;  5E17 F;  4YFK F;  2V6C A;  3PFI A;  3LWF A;  1BOA A;  1YTY A;  1IRF A;  1K78 A;  1J2X A;  1FT9 A;  2DQL A;  2QQB A;  4YFN F;  5TRD A;  3R0J A;  3WTU C;  3BDD A;  2GA1 A;  5FB2 A;  3I4P A;  4LG0 B;  1UST A;  3J81 K;  5K1Y A;  1HKT A;  4OIN F;  5LGU A;  5HDK A;  3ABT A;  1USS A;  3FMQ A;  2Z99 A;  3U1D A;  4IRH A;  3CUQ B;  2P5V A;  2V79 A;  3K9T A;  3IKV A;  1IN7 A;  1FBU A;  3COA C;  4ENN A;  2D1H A;  1DUX C;  3SQN A;  2D45 A;  5H6Q A;  4BH9 A;  2ZXJ A;  4R1H A;  3ZQ7 A;  1MKM A;  5L3B A;  3K2Z A;  3WE3 A;  3BJA A;  2PFB A;  2M87 A;  1HST A;  2ZME B;  2VBY A;  3MCZ A;  5DYM A;  3FHZ A;  4MGR A;  2FQ3 A;  1TNS A;  1Z1D A;  2KKO A;  1W7P A;  2O6G E;  1GVJ A;  4EJO A;  4HV5 A;  4LMY A;  3PQJ A;  3KCC A;  2OA4 A;  3I54 A;  1S8N A;  2ZCW A;  1FYL A;  3FMR A;  2FML A;  5KVR A;  1B9M A;  1BC7 C;  4ESF A;  4P5O A;  2GXG A;  3GFJ A;  2FEZ A;  1KGS A;  2VXZ A;  4U0Y A;  1ZRD A;  1OYW A;  1QGP A;  2QZ8 A;  1S6L A;  1IN4 A;  1ODD A;  1WSU A;  2QQ9 A;  3P9I A;  5LLQ A;  5DD8 A;  2Z33 A;  2CGP A;  4RGX A;  2FA5 A;  4M9Z A;  1KQ8 A;  2Q8K A;  5L3G A;  1T98 A;  2X0L A;  1ZRF A;  3S2W A;  2BYV E;  5JHU A;  2XAS A;  5E8G A;  2FSW A;  4PGG A;  5D5X B;  2VT2 A;  4RGU A;  3E5U A;  2VOD A;  1TLH B;  2FE3 A;  1IUY A;  4UHT A;  3M8F A;  1H0M A;  1IXR C;  1HKQ A;  2GAU A;  1RNL A;  3HYI A;  1R1T A;  1ON2 A;  1ZG3 A;  2A61 A;  3KP2 A;  4I01 A;  5D8K B;  2EB7 A;  3U9G A;  3FMS A;  1J59 A;  2E7W A;  3F6O A;  4IXA A;  2FBH A;  2DTR A;  3ELK A;  3GFL A;  2WTE A;  4G9Y A;  3P7N A;  4EJW A;  4RS8 A;  2VBX A;  3K1M A;  3KZZ A;  3VOD A;  3F8M A;  2PMH A;  3GLX A;  4G8X A;  5J6X A;  1O3S A;  2CO5 A;  1LB2 A;  3JTH A;  1TBX A;  1SD6 A;  1MDM B;  1B9N A;  1XDU A;  4U7B A;  2YSR A;  5A2Q K;  1Z7U A;  2Q0O A;  1UHM A;  2D1V A;  4I2O A;  3F8N A;  3GWZ A;  2A6E F;  1P4A A;  2HWV A;  3E6M A;  3G73 A;  1XGS A;  1TQP A;  4HOB A;  3AAF A;  2P6S A;  3T8R A;  4ZH4 F;  2O8X A;  4GCV A;  1HW1 A;  3KZY A;  1HW2 A;  4ESB A;  2CW0 F;  4F7Z A;  3L7W A;  5ERI A;  5JVT A;  3WGG A;  2P6T A;  2EFO A;  4EV0 A;  5DCM A;  2HTS A;  2G7U A;  1KU7 A;  2H6B A;  1MJB A;  1BI0 A;  5K5Q A;  2VBW A;  3V8K A;  3TO6 A;  3ROU A;  3I59 B;  1K7A A;  2M45 A;  3FWE A;  3K69 A;  5DV5 A;  5D6F A;  3B73 A;  2ZME A;  1CF7 A;  5HS8 A;  3F8C A;  5J8C A;  3MQ0 A;  2HTJ A;  3IHU A;  3GVA A;  3I71 A;  4BYY A;  3H3U A;  3IKT A;  1H9T A;  2UZK A;  5HVQ C;  3R4K A;  3GX4 X;  1YQA A;  3ZMU A;  2GXB A;  5HS7 A;  3RYR A;  3KLN A;  4I09 A;  5CYV A;  1IF1 A;  3WTZ A;  5E18 F;  1KQ0 A;  3I53 A;  4M9X A;  2JSC A;  5DEQ A;  1B4A A;  1A04 A;  3QU6 A;  2W24 A;  1Z9C A;  5LRR A;  4HW0 A;  1J5Y A;  5F6F A;  1U5T C;  2HFH A;  4AIK A;  4M6X A;  2PN6 A;  4LLN A;  1B6A A;  2NYX A;  1AOY A;  3H92 A;  2EA4 A;  4OIR F;  2PMU A;  2HS5 A;  2P7V B;  2CG4 A;  1P4X A;  5LEK A;  3BWG A;  3BP8 A;  4EGY A;  4HF0 A;  4LLG F;  5K5R A;  5CVR A;  1SMY F;  3F23 A;  4RAZ A;  1PP7 U;  2FF4 A;  2A07 F;  4UV8 A;  1L3L A;  4LD5 A;  1SAX A;  2IA1 A;  4BXU A;  2RV8 A;  3CUQ C;  1MZB A;  2ZKZ A;  3ZMS A;  2NNY A;  1MDM A;  4ENK A;  2XRO A;  2GQQ A;  5L3E A;  3I64 A;  4ZZD A;  4UUV A;  4HX4 A;  2W57 A;  4MQ9 F;  3I0T A;  1KU3 A;  2NS0 A;  1WQ2 A;  3KET A;  3RI4 A;  1DDN A;  4L0Z B;  3H3Z A;  3J80 Z;  2YR2 A;  4HF1 A;  3FXQ A;  1Z6T A;  1PDN C;  3E6B A;  1XGN A;  2IRF G;  4G7Z F;  4UNO A;  4KIF A;  3RTR A;  4B09 A;  1DPU A;  4UVA A;  1IAW A;  3GYH X;  2JPB A;  3BZ6 A;  2OZ6 A;  4KN4 X;  4ZYD A;  2W84 A;  4L5I A;  4ZYG A;  2VE8 A;  4HA8 A;  1EH7 A;  1R1U A;  2DO7 A;  2H09 A;  5AIP A;  2X4H A;  2JRT A;  1KYZ A;  2LKP A;  3JSO A;  2JPC A;  3E6C C;  4RAY A;  1BIB A;  4HDU A;  2EWN A;  1G3T A;  1IW7 F;  1YS6 A;  2O0Y A;  3F21 A;  1S7A A;  3E97 A;  1PUE E;  4HX7 A;  4CDG A;  1Z6R A;  1B1B A;  1UCR A;  4RB3 C;  1PP8 F;  3FF5 A;  3C1D A;  5HLH A;  1GHC A;  1G6N A;  1S3J A;  1ZN2 A;  4E70 A;  3I58 A;  1W5T A;  4XLP F;  5E8I A;  1O57 A;  3GFI A;  1FNN A;  2CQK A;  5AON A;  3KP5 A;  1XGM A;  2XKO A;  3T8T A;  5ILS A;  2P4W A;  1Z05 A;  2KJB A;  3ZPL A;  5KK1 A;  3CLO A;  3FM3 A;  3CUQ A;  5CVV A;  3ISP A;  2F5E A;  4ON0 A;  2R7D A;  3U2R A;  1U8R A;  4KDP A;  2EFN A;  1BN5 A;  1I6X A;  3KEO A;  4HQE A;  1Y0U A;  1XSD A;  4A0Z A;  2G9W A;  4FHT A;  2IJL A;  2NAZ A;  2EFP A;  2OBP A;  3GEZ A;  4A5M A;  3JAM K;  1YFH A;  4KNY A;  4RB0 A;  3WG9 A;  3D0S A;  4L5J A;  3EYY A;  3LA3 A;  4WXH A;  3MWM A;  2J5O A;  5BPI A;  4BHB A;  4R79 A;  3HIF A;  1ZRC A;  1I1S A;  3F72 A;  3RKW A;  5ICF A;  1MJA A;  3FXU A;  4BNC A;  4ETS A;  1BC8 C;  2FU4 A;  2A5Y B;  3IWF A;  3IL2 A;  4I0A A;  2KIM A;  1H9G A;  1KU9 A;  2ESN A;  3WE2 A;  1XSV A;  2ISZ A;  2W25 A;  2MH9 A;  4G6D A;  1ZLJ A;  1HBX G;  3I59 A;  3DPT A;  1ZG5 A;  1R36 A;  3M7G A;  3DF8 A;  4XBF A;  1K79 A;  2DQR A;  1YLF A;  2MA3 A;  2V1X A;  3F6V A;  2DU9 A;  1K6O A;  4QWQ A;  2QBY B;  1KQ9 A;  2O03 A;  4RGS A;  2COM A;  1HSJ A;  1O3T A;  2M30 A;  3GO5 A;  5JFR A;  3L00 A;  3DEU A;  2VC1 A;  1FBS A;  1ZGA A;  2K86 A;  5DDG A;  1KU2 A;  4LK1 F;  3LST A;  2EA2 A;  4LGW A;  2XRN A;  2CWE A;  1YG2 A;  2A69 F;  4OU0 A;  2DAO A;  1SFX A;  5E1X A;  2P5K A;  3ERE D;  5D8L B;  1XCB A;  3EDP A;  3VB2 A;  2OAZ A;  4LB6 B;  3SXY A;  3VOE A;  1U3E M;  5BOX A;  2ZME C;  3K1N A;  2EK5 A;  2HZT A;  4M72 A;  3T5X A;  4M9S A;  4GGG A;  3GZ5 A;  4PCQ A;  4LJZ F;  2RN7 A;  4BQA A;  1FPQ A;  1W7P D;  3E5Q A;  4B8X A;  5LHH A;  2LDU A;  4UVC A;  5CVI A;  3KE2 A;  4KIG A;  1XD7 A;  2E7X A;  4G6Q A;  3V4G A;  3L09 A;  4ZZL A;  4HBL A;  4CHU A;  2MH2 A;  3ZN0 A;  4XLN F;  3QP6 A;  1R00 A;  4WWC A;  1ZLK A;  1ZG1 A;  1TTY A;  4JQF A;  3ZMT A;  1F4K A;  5A2Q Z;  2WWY A;  2KIU A;  4EJU A;  3HRS A;  1BM9 A;  2MC3 A;  4HYE A;  5ILU A;  5LRS A;  3HRM A;  4BHP A;  1CGP A;  2F5F A;  4KIC A;  5FO5 A;  2P5L C;  1IZ1 A;  3IWZ A;  2LF8 A;  5LGN A;  1SFE A;  4CZZ A;  3HUG A;  4OMY A;  1STZ A;  4OIO F;  4KA4 A;  2QWW A;  3SZT A;  3J80 K;  2JT1 A;  3J81 Z;  2A6H F;  1EH8 A;  1ZAO A;  4LK0 F;  2L02 A;  1QPM A;  1JE8 A;  3KP6 A;  1QO0 D;  3MFK A;  3HRU A;  2EJR A;  2YU3 A;  4GO1 A;  5HS9 A;  3ECO A;  2XAJ A;  4EM1 A;  1EV7 A;  1DP7 P;  1RZ4 A;  1O7F A;  3RYP A;  1J9I A;  3O3K A;  3LAP A;  3HHH A;  2EFW A;  1FOK A;  4WX9 A;  2ESH A;  2JZY A;  3OV8 A;  1ZAR A;  4DQ2 A;  2GWR A;  2LF7 A;  4KT5 C;  1JHH A;  5F1R A;  4KMU X;  2KRF A;  4IHT A;  1FX7 A;  2F2E A;  2FRH A;  2QUF A;  3RKX A;  1XB4 A;  4YFX F;  5EEG A;  1FP2 A;  1XMA A;  2VBZ A;  4P9U A;  2AXL A;  2K4J A;  4A12 A;  2FOK A;  1QZY A;  4MTD A;  2RC4 A;  4RB2 C;  3C18 A;  1FWZ A;  4EQQ A;  1AWC A;  3KEQ A;  2AS5 F;  2FBK A;  3WTS C;  3IRR A;  1FP1 D;  4GXO A;  3W6K B;  1E17 A;  5E20 A;  2IPQ X;  5BPD A;  3SFZ A;  4OMZ A;  4A0X A;  1QZZ A;  2K7L A;  3O2P E;  1QNT A;  2HEO A;  4BAY A;  2OU2 A;  3EET A;  3ZMV A;  2QLZ A;  4XSZ F;  4G7H F;  2LNB A;  3ZMD A;  1OPC A;  4EM2 A;  3V8J A;  3HSE A;  1NHA A;  3F3X A;  1FYK A;  4N9H A;  4M6Y A;  3QOP A;  1XSX A;  2LSO A;  4L18 B;  2BEO A;  3EYI A;  2DBB A;  3GF2 A;  2A68 F;  1HW5 A;  2QYO A;  3TKY A;  4L9J A;  2ZO4 A;  3C3W A;  1WKM A;  2FNA A;  5L3C A;  3HSF A;  2MBF A;  1O3Q A;  3N4M A;  4Z2Y A;  4HLY A;  3NQO A;  3HHG A;  5E1W A;  2XGX A;  1C0W A;  2Z9O A;  1LDK B;  1YS7 A;  1F5T A;  1ONV A;  4S05 A;  2QVO A;  3ZMZ A;  4IF4 A;  2G7H A;  5JI6 A;  1RIO H;  1YW9 A;  1OKR A;  1G3Y A;  2STW A;  1QBJ A;  2EFQ A;  3TDU C;  3P9K A;  1W7P B;  3TGN A;  4RGR A;  4HDV A;  3K1P A;  4U0V A;  3NEU A;  5LHG A;  2Z5U A;  1ZRE A;  2BV6 A;  1JHF A;  2DK5 A;  3TO7 A;  4MEY F;  2QQA A;  3I5U A;  3GZ6 A;  4MQV A;  3M8E A;  3SHF A;  5D4S A;  2VC0 A;  1T39 A;  2VOO A;  3WTY C;  1HQC A;  3CO7 C;  4IVN A;  2VN2 A;  2HKX A;  2MLK A;  4NB5 A;  3SZP A;  5LGT A;  2FMY A;  3BJO A;  1ZH5 A;  3DXJ F;  1IN5 A;  2DLL A;  2BGC A;  5LEJ A;  4Y13 A;  1I5Z A;  1G3W A;  3HSR A;  4WK8 F;  4ASN A;  4CO8 A;  3QP5 A;  3MZH A;  2HDC A;  1ON1 A;  4CGZ A;  4AIH A;  4YII A;  1K78 B;  3W6J B;  2ETH A;  3QU3 A;  4I7H A;  5K5O A;  5TJJ A;  1BI1 A;  1J7K A;  1UFM A;  2FNP A;  3GUD A;  3E6D A;  1U78 A;  4EJV A;  2YX7 A;  4KYW A;  1FC3 A;  2ZFW A;  1XN7 A;  2IVM A;  5L3F A;  4D0P A;  4G94 A;  1T0F A;  4Q5S F;  2K27 A;  3N97 A;  4S04 A;  5H20 A;  1VTN C;  4U88 A;  2L4M A;  1UHW A;  1IRG A;  1BBY A;  2PBI A;  2RVC A;  1P2F A;  3LFK A;  1FSH A;  5FFX A;  1CF7 B;  4KMF A;  3J7A O;  3DV8 A;  4Q48 A;  1D3Y A;  1TW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...