3CUQC

Integrated structural and functional model of the human escrt-ii complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
173
Chain Sequence
b'SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting protein SNF8
molecule tags Protein transport
source organism Homo sapiens
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
total genus 46
structure length 173
sequence length 173
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqC02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 3cuqC01
2DW4A 2KJBA 1V4RA 1O3RA 2VN2A 1QNTA 5JR3A 2JPCA 4A5NA 1BIAA 2A69F 5HS8A 3BOQA 3N4MA 1XDSA 1MD0A 4I2OA 2Z3YA 3F8FA 1FZPB 3FMSA 4G7ZF 2P5VA 4Y17A 1W4MA 2DU9A 1MKMA 1W7PB 3FWEA 4ON0A 3LAJA 2OZ6A 3ZMTA 2L02A 1G4DA 2C6YA 1IN6A 3CDHA 5D5VB 3P9CA 4KIBA 3JTGA 4O3MA 4YIFA 3HHGA 1JXSA 4Z2YA 5DEQA 4LK0F 3RJPA 3DF8A 1LQ1A 1WKMA 4L9TA 2BBYA 4UNOA 3PFIA 1T38A 3U1DA 4BYYA 3Q9VA 2MH2A 3H92A 4Q47A 4HX4A 3C18A 3TGNA 4P96A 2G7HA 2VBWA 5EEGA 3IWZA 1L3LA 2ZMEA 3DPTA 3F3XA 4WXCA 3U2RA 5J6XA 4P9FA 2FSWA 1OYWA 3V7CA 3ZN1A 2DLLA 3GXOA 5LHIA 2HTSA 3ERED 4M6YA 3F6VA 3HSRA 1O57A 1QGPA 4HF2A 4YFXF 1I1GA 4NHJA 3T8TA 5H6RA 1XGNA 1USTA 1WSUA 1QZZA 4XLPF 4EM0B 2HZTA 3COAC 4IPAA 1ZH5A 1P92A 1L0OC 5ILVA 3QOPA 5D4RA 2HFHA 3LA7A 3HIFA 1BI3A 1SD4A 2CG4A 2ESHA 3FXRA 2DT5A 4QLCU 4A0XA 4R79A 4EMSA 2V1UA 1FY7A 5DV5A 1HQCA 4HYEA 5LBQA 1F5TA 2BYVE 1F9NA 4L0ZB 3F8NA 3DXJF 2ZFWA 1ONVA 2P7CB 5K5QA 5IT9K 3QP6A 1LDKB 1OYIA 4ENJA 3H3ZA 3CUOA 3KP5A 5L3FA 1D5VA 4OMYA 1FBUA 2VE9A 4RGUA 3V4GA 4LJZF 2CQKA 3KP6A 1O7FA 2LSOA 3ZMDA 5FLXZ 2RGVA 1S3JA 4A2UA 3BPVA 4EM1A 3SXYA 4A0ZA 4A6DA 2HOEA 2UXNA 5E8GA 3MZYA 3I5UA 4D0PA 2ZMEC 2J5PA 3V8JA 2MLGA 3KP7A 2ETHA 1LVAA 1ZYRF 2VE8A 1G3SA 3REOA 2QYOA 2VOOA 4EJTA 1TNSA 2QENA 4BAYA 4L0YB 3HRTA 1Q1HA 1I1SA 4JQFA 4MEYF 1ZRDA 3V7SA 2O3FA 1TQIA 1Z9CA 4OIPF 2DPUA 3EETA 4P55A 3O3KA 3ZQ7A 3GZ6A 2FF4A 2XVCA 4L9VA 3TDUC 1HSJA 3F72A 4N9IA 1ON1A 3R0AA 5AIPA 4OIOF 1HKSA 1VTNC 1MDMB 2XV4S 2HYGD 5E1XA 1F1ZA 4P5OA 3QRFF 1FP1D 1LDDA 1I6XA 2DTRA 1KA8A 4G6DA 2Q0OA 1R1VA 3P9IA 1S7OA 1ZGAA 2DK5A 1PDNC 5HDNA 3MFKA 1P2FA 4G8XA 3T8RA 2NRAC 3GLXA 4BHPA 4RB1A 3FHZA 3QAHA 3WTVC 1K6OA 3FM5A 1XGSA 5HS9A 3VEPA 4CYDA 4ZH4F 1X3UA 3KLNA 2Z5UA 4UV8A 4L5JA 1RZ4A 2PN6A 3P7NA 1FNNA 3ROUA 3DEUA 2E7WA 1CF7B 2Z99A 2H27A 3GX4X 4HOBA 3RI4A 4ZZLA 1ZGJA 4HF1A 4IVNA 1ZRCA 3Q9SA 2OA4A 4KICA 2IRFG 4G9YA 5D4SA 5K5OA 6PAXA 2JZYA 2ACJA 2M45A 3GFLA 1Z7UA 3I53A 3RPQA 1BC7C 5LHGA 5HS7A 3WODF 1ZLJA 1SMTA 2EB7A 1IRFA 3HUGA 1JGSA 2NS0A 3QU3A 3KP2A 1TNTA 1KU2A 2EFQA 3F8CA 3RDIA 2PBIA 3I59A 3L09A 3QU6A 2H6BA 2W25A 4KFCA 2DO7A 3I59B 2MA3A 3KE2A 2QLZA 4LK1F 4BNCA 3IRRA 1MGTA 5DDGA 4XBFA 1W5SA 5JI6A 1YTYA 2PI0A 4IRGA 1KQ8A 5BOXA 1GVJA 2EK5A 3WU0A 4U7DA 3TO9A 5DUKA 4CGZA 2J5OA 1Z1DA 2HS5A 4EM2A 4HZFA 3FMQA 4IRIA 2LF7A 3HRSA 2EJRA 2L54A 1Z91A 3LQRA 2H94A 3WGHA 2VBYA 2UZKA 3KP4A 3BPXA 4EJOA 3BDDA 1IN5A 2HWVA 2MH9A 3O2PE 1U3EM 2FMLA 3AAFA 2QQAA 2EV6A 4UXNA 4S04A 2CGPA 3M1EA 4HDVA 1B1BA 3RTRA 2CFXA 1LJ9A 1W7PA 4E70A 2OQGA 2KIFA 1GXPA 2DBBA 1JHFA 1ZLKA 4EJUA 1MDMA 2PMHA 1USSA 1XD7A 2TDXA 4EGZA 2F5FA 1FYKA 3J81K 5EEHA 4O6JA 2UXXA 1ZAOA 4KYWA 3D5LA 2BEOA 2XAJA 5L3BA 3KLOA 2K02A 2HKXA 5H6QA 1OKRA 3JW4A 4RAZA 3CUQC 4NB5A 3EYIA 4ESFA 4IJAA 4OU0A 2V79A 2YX7A 3E5UA 3E5XA 1J59A 2A07F 3W6JB 2P4WA 1QO0D 1SD5A 2YX4A 3RPUA 3LA2A 1R1TA 5LGUA 3RKWA 2LDUA 1UHWA 5D5UB 1DP7P 2FBIA 2A61A 2OQRA 1R7JA 4I02A 2F5EA 2XGXA 2Z9OA 4UVBA 2MD5A 3WE3A 2Q2EA 4KUMA 5HDGA 3H3UA 3WTWC 1RUOA 1EH7A 1KU3A 2IP2A 1B6AA 4CXFA 1U6GA 1ULYA 3BWGA 3QP5A 3G73A 2STTA 5F64A 1K78B 1J7KA 2E7XA 3TQNA 2WTEA 1S6LA 4M9SA 4MEXF 1BI2A 4ZZDA 4QWQA 1KYZA 5L3EA 5J8CA 1FBSA 2Y75A 3MZHA 3S2WA 2PJPA 4I7HA 4Y13A 4CDGA 4I09A 5ICCA 5HLGA 2VOPA 1SFXA 4I0BA 5K1YA 1XB4A 4RB2C 4R8HA 4LB5A 1OYYA 1IN7A 1EV7A 2P6SA 2COMA 3Q5FA 1R58A 4DNCA 3M7GA 1P6RA 2VC0A 4O5VA 3PQKA 1XGMA 1TW3A 5K5RA 1O3TA 1KQ9A 2OZUA 1D3YA 1FLIA 2MBFA 4MTEA 3IL2A 2O61A 1U5TA 4AD9A 4RB0A 4GYGA 4IHSA 1A04A 2VXZA 3ECOA 4Q5SF 2X0LA 1JE8A 2XAHA 3J80K 3G3ZA 4BHBA 2EFPA 3D0SA 1HW5A 2MC3A 1U8RA 5HOOA 3GW2A 1FBQA 3CO7C 3TKYA 1SD6A 4HLYA 5E8IA 2GQQA 5FGMA 3K2ZA 2UWMA 4ESBA 3GFJA 1U2WA 2IPQX 5ED4A 3MAJA 3E3VA 1S8NA 4M72A 3F6OA 3I0TA 1BBYA 5FFXA 3KEQA 1YW9A 1YS6A 4R1HA 2BE5F 5DCMB 1V3FA 1WQ2A 1HSTA 2LNBA 5L3DA 3GUDA 4IRHA 1B4AA 2BGCA 2PG4A 4Q48A 2CW0F 2B0LA 4FX4A 5D6FA 1T39A 5HVQC 3RYPA 1DUXC 4IF4A 1FT9A 1O3QA 5FB2A 3ISPA 1XGOA 4MTDA 5JFRA 1XCVA 2VBXA 3HHHA 3B02A 1FSEA 2Y48A 4RGRA 4ZYDA 3K1MA 2ZJ2A 3ML6A 1BM9A 1AOYA 2QBYB 2H09A 2PQ8A 2Y0MA 2VC1A 4ESJA 4G7OF 4LB6B 1YW7A 3E97A 3RYRA 4B8XA 3NEUA 1BI0A 4ASNA 4L5IA 4HW0A 1IN4A 2R7DA 1FWZA 4YG2F 1BIBA 3LSTA 2GIVA 2FBHA 2W85A 3E5QA 3P9KA 1WRJA 2AS5F 2PLYA 2XKOA 3DKWA 1P4XA 1R36A 2D1VA 2M1BA 4ENMA 2EFWA 5ILSA 4OIRF 3T5XA 1MJBA 2YSRA 1Z6TA 1W7PD 3ZMSA 1U78A 1QBJA 4KMUX 1SAXA 3IKTA 4PGGA 2VT2A 3O6BB 1XDUA 4U0WA 1DDNA 1BJAA 3F23A 2FOKA 1IXRC 2KKOA 1Z05A 4ETSA 4EJWA 3K9TA 1H0MA 4DQ2A 2P7VB 4HA8A 4PCQA 4B09A 4L9NA 3BY6A 3GYHX 5CLSA 5FD6A 3BJOA 4L9JA 1HXDA 3FX3A 2CO5A 3MCZA 4UVCA 4JK1X 1S7AA 1IN8A 2WC2A 2M30A 2HR3A 2ZXJA 1TTYA 4U88A 4PDKA 4YIIA 1YW8A 1Y0UA 2RDPA 1G3WA 4WK8F 2PFBA 4UVAA 1XSVA 2XKPA 1SD7A 4HAMA 2VT3A 2DK8A 4CICA 2GAUA 2RVCA 4FX0A 1DPRA 3FXQA 5HLIA 2FRHA 1YIOA 3WTUC 4ZYEA 2MLKA 2ZCWA 3J81Z 5BPDA 2CWEA 3FMRA 2P5KA 3M8FA 3JSOA 1KYWA 4MGRA 4MNUA 2ZKZA 1QZYA 1J75A 2A68F 5A2QZ 5LHHA 3F22A 1U5TC 3ZMUA 1CF7A 2KJCA 4MQVA 2FXAA 2QQBA 5LLQA 2CYYA 1UB9A 2VONA 5KVRA 2GA1A 1J0RA 5DD4A 3F21A 4HBLA 1I27A 2OAZA 4I01A 2LKPA 2GA2A 4LFUA 1JHHA 4I98B 4I0AA 2NAZA 1PUEE 4JBAA 1XCBA 1UFMA 3F8MA 1MZBA 3ULQB 2YR2A 2ESNA 4PGHA 4UUVA 3CLOA 3R60A 1RNLA 2W84A 1R23A 2K4BA 4G6QA 4KNYA 4LGWA 3WTTC 2GWRA 5ILUA 3BP8A 1TQPA 3E6DA 2HGCA 2YPRA 1ZHFA 2RC4A 2X4HA 3JSPA 5JHUA 5JVTA 1RIOH 4WCGA 1Z6RA 3MWMA 4OMZA 3TOAA 1IXSB 3C3WA 4ZYGA 4TV7A 4OINF 4GXOA 2FNAA 2EA2A 1LNWA 2ISZA 1WWXA 4Y15A 4U0YA 3TO6A 1I5ZA 5E18F 4XLNF 5ICEA 1XSXA 1WI9A 4IXAA 1ZG3A 3PQJA 3VFZA 1B9MA 5DD8A 3ZMZA 4XSZF 4M73A 5F1RA 5LGNA 4P9UA 4LLLA 2R7FA 5FD5A 2M8EA 4AIJA 1KQ0A 2O03A 3GO5A 1ZREA 3VODA 2IA1A 1R5GA 1TQMA 1P4WA 5TRDA 5L3CA 2JT1A 2ZNZA 3QPTA 2GXBA 2BV6A 3NQOA 3FXUA 5ICGA 4GGGA 3DV8A 4HX8A 3ZPLA 2AXLA 4HDUA 1RUNA 2QUFA 5BPIA 2NNNA 3TOBA 3WG9A 2Q8KA 4BHCA 1H9GA 5CVUA 1F4KA 2RQPA 1T2KA 1FOKA 3B73A 2XROA 2PMUA 3DP7A 2JTVA 4RS8A 3HOTA 3L2CA 4A0YA 5A2QK 1TW2A 4L18B 1G3TA 2KIMA 1UCRA 1TBXA 1TLHB 2FNPA 5FO5A 4Q4ZF 2KIUA 4RB3C 3VOEA 1EH6A 4BXUA 4NQWA 4UV9A 4S05A 1G6NA 5CVIA 5CYVA 3HSFA 2EA4A 3WTZA 3BROA 4RGSA 4UHTA 3CO6C 5D6EA 3LWFA 4GO1A 4U7BA 3EYYA 5BMZA 5E1WA 3HTSB 1DPUA 3LFKA 5DUIA 3FF5A 2PEXA 4HQMA 2QM3A 5CVRA 3R6SA 2IVMA 2F2EA 3ZN0A 4A5MA 3V8KA 1O7LA 3SFZA 2H6CA 3FM3A 2FU4A 3GVAA 3R61A 3W6KB 2O6GE 5FLXK 2L4MA 1HW1A 3FZVA 1B9NA 5BQTA 4XRFA 1XMAA 3K1NA 3OV8A 5CJ9A 2DAOA 2K4JA 4RAYA 1UHMA 1E2XA 5HDKA 5LEJA 2HTJA 2XHKA 5KK1A 2STWA 2WWYA 5IT9Z 5D5XB 4U0VA 2XAFA 5DYMA 1FSHA 1R5HA 1R22A 3HOSA 2RNJA 4KMFA 3K1PA 2ZNYA 4G7HF 1ZG1A 2D45A 4YFKF 5D8KB 1IUYA 2K7LA 2QZ8A 2P6TA 2IW5A 2HEOA 2EV0A 5AIQA 5LRSA 3L9FA 4LD5A 2IA2A 4CO8A 2FE3A 2WV0A 3CUQB 2QBYA 5CVJA 1FP2A 4HQEA 1IW7F 2DQLA 2OBPA 1R1UA 5BS6A 1U5TB 4A12A 1K79A 1R00A 1P4AA 3LAPA 2W24A 2HDCA 3CJNA 1KGSA 5TJJA 3BZ6A 1IRGA 2G9WA 3KP3A 3IHUA 1D8JA 3M9AA 2HQNA 1J9IA 4GCVA 3K0LA 1PP8F 2VODA 3GEZA 3IRQA 3N97A 5LGTA 1AWCA 2V1XA 2K27A 1ZN2A 3OOPA 4M9XA 3R4KA 1K7AA 3TO7A 1QQIA 1CGPA 2EFOA 1ON2A 2XIGA 3WU1B 3SQNA 1YG2A 2NYXA 2A6HF 4ENKA 2HQRA 2DQRA 2YU3A 3EUHA 1XSDA 5F6FA 3E6BA 3IC7A 1K78A 2O0YA 3HRMA 3DPLC 4YFNF 2NNYA 3GFMA 2QQ9A 3BJ6A 3ZMVA 3KZYA 3ECHA 3T0YA 4FHTA 4KT5C 1BOAA 2FA5A 4KIGA 3T1BA 1IZ1A 1FYLA 3HSEA 3I4PA 1EH8A 2G7UA 5AONA 4EQQA 1YS7A 3KFWX 1J5YA 5FFZA 4LG0A 4KN7X 4XSXF 3J80Z 4WF2A 4BH9A 4AIKA 2IJLA 1IXCA 3C7JA 4M6XA 3JTHA 5DCFA 2IT0A 1BC8C 4KA4A 4RGXA 1NHAA 5HLHA 3DFGA 1FC3A 1HKQA 4FT8A 2ISYA 5ERIA 3J7AO 2RN7A 3BJAA 1ZARA 4HX7A 2RKHA 5CVVA 5DCMA 2V6CA 2LF8A 1ZRFA 3WTYC 5ICFA 2E1NA 2FQ3A 3V7RA 2FBKA 4BQAA 2OU2A 3VB2A 3IKVA 3M8EA 1T6SA 1H9TA 4ENNA 4CHUA 1LDJA 1YO5C 3EQLF 3L00A 4WX9A 4KN4X 4HV5A 4MHGA 2IA0A 2L01A 1ODDA 2JSCA 1HW2A 3WGIA 2EWNA 4OIQF 2V9VA 3DQVC 1PP7U 1BI1A 4GYIA 1T0FA 1G3YA 2XRNA 3CTAA 3GFIA 1B59A 4G94A 4KDPA 3RKYA 4PZJA 3EDPA 1MJ9A 1YYVA 2KRFA 2DFIA 2D2WA 1BN5A 1STZA 2V1DA 4EJVA 2F5DA 4EGYA 1FX7A 3I71A 3SHFA 2M87A 1ZG5A 4A6EA 3E6CC 2XUBA 3LQQA 3GWZA 5IT3A 4ZYHA 1MJAA 5E17F 1SFEA 3U9GA 2ELHA 1XMKA 5L3GA 2ZBKA 1FYMA 2OD5A 4F7ZA 3KCCA 4LLGF 2FEZA 2GZWA 2VBZA 3SZPA 1SFUA 1KU9A 1W5TA 3RKXA 2XASA 3KZZA 2HKOA 3I54A 2DI3A 3JAMK 2XAGA 1YLFA 3WTSC 3ZP5A 3RIRA 1IAWA 2ZMEB 2P5LC 4HLXA 3IWFA 2Z33A 2L3DA 3CUQA 4M74A 1S29A 2HYFA 3LA3A 1J2XA 3ABTA 3I64A 5LEKA 2GXGA 4LMYA 3V8LA 3HYIA 4N9HA 3K69A 5J8FA 2ZO4A 1D8KA 3MEXA 3JAMZ 5H20A 2RV8A 3SZTA 3L7WA 1YFHA 3F8BA 1HKTA 3GF2A 2A3SA 3E6MA 1LEBA 3I58A 1GXQA 2A5YB 3KEOA 3WE2A 1RI7A 3NRVA 4EVIA 1QPMA 1GHCA 5E20A 2QWWA 4WWCA 2D1HA 2F5CA 3WTXC 2JRTA 1FPQA 1XN7A 4OOIA 4H0EA 1LEAA 1IF1A 1OPCA 1YQAA 3QPHA 4WXDA 1KU7A 4IHTA 4HF0A 2K86A 1SMYF 2EFNA 2P8TA 2XAQA 5LRRA 4AWXB 3MQ0A 3ELKA 2DPDA 3HTUA 3HRUA 1HBXG 2ADUA 3ABUA 3WGGA 1E17A 4M9ZA 1OR7A 1C0WA 4AIHA 4HV6A 3KETA 4KIFA 4AVPA 1T98A 1OMIA 4K2EA 4LLNA 2W57A 4WXHA 2JPBA 2M5WA 3C1DA 2QVOA 2FMYA 4EV0A 3R0JA 2A6EF 5D8LB 2O8XA 5E1ZB 1REPC 3GZ5A 1O3SA 4M71A 1LB2A 2E1CA 2R3SA 4MQ9F 4CZZA 4N0BA 2CSOA 5D5WB 3TDZC 2L4AA 4LG0B 2EV5A
chains in the Genus database with same CATH superfamily
2YUSA 3BZCA 2DW4A 3WU2C 1LFUP 2KJBA 5J3LA 1V4RA 3W2WA 1O3RA 3SEQA 2CV2A 2VN2A 2QSHX 1QNTA 1E3OC 5LFAA 5JR3A 1A31A 3SYTA 2JPCA 4QTRA 4A5NA 2BHYA 1BIAA 1LQ1A 2A69F 2OC6A 5HS8A 3BOQA 1N25A 5F0CA 1D5YA 1HLVA 4L5EA 3N4MA 4B47A 1XDSA 1XPXA 1MD0A 4MIMA 3IAS2 4I2OA 2Z3YA 3F8FA 4II3A 1Y1VJ 3UNGC 3BR5A 4BJ5C 1FZPB 3FMSA 4G7ZF 4A3BJ 2LH9A 3K4BA 3OIPA 1YIJI 2P5VA 4Y17A 1W4MA 2K9LA 2DU9A 3JRFA 2A05A 1MKMA 1W7PB 3FWEA 3MD2A 4ON0A 3JRDA 3LAJA 3I4MJ 2OZ6A 2M3AA 3DBLB 3ZMTA 1ETXA 2L02A 2RQQA 1G4DA 2BXZA 4PJNA 2W1OA 2C6YA 1IN6A 4BQNA 2VJJA 4LIVA 2Y0SN 3BCBA 2ID3A 3CDHA 4BE0A 5D5VB 3P9CA 4KIBA 1HOMA 1WZ2A 2K9QA 3JTGA 4O3MA 4E7SA 4YIFA 2XC7A 2GBYA 5B66C 1ETOA 2DMPA 3OOUA 4GRIA 3PNYA 3HHGA 2R5YA 1JXSA 2VL8A 2XGCA 2JJ7A 1ETWA 2V7FA 2E1OA 4Z2YA 1T33A 2HQ5A 1A36A 5DEQA 4LK0F 3NARA 3RJPA 3DF8A 3L2VA 3UKGA 1JTYA 2BZTA 3A4CA 5F0FA 1WKMA 3RZDJ 2OPTA 4L9TA 1R9TJ 2BBYA 4UNOA 1P7IA 1RR8C 3AKZA 1MNDA 3PFIA 4V2FA 1T38A 1V5EA 2X85A 3U1DA 4BYYA 3Q9VA 2MH2A 3H92A 1XG1A 4Q47A 3J7YJ 4HX4A 3C18A 4XM3A 3TGNA 3CCSI 1VQ6I 1Z7LA 3C2BA 3CJRB 2G7HA 4P96A 2VBWA 2DJIA 5FLVA 3CF2A 5EEGA 1W1WE 3IWZA 1L3LA 2ZMEA 4ZTFA 2XPVA 2EZLA 3DPTA 1HA8A 2KRHA 3F3XA 1Y6IA 5IP7J 3HEFA 4YIRX 4ZDLA 2AQEA 4WXCA 2M0MA 3OYLA 3U2RA 5J6XA 4P9FA 2FSWA 1OYWA 3V7CA 3ZN1A 2DLLA 3GXOA 5LHIA 2HTSA 3ERED 3HBLA 3HKZA 4M6YA 4KITB 4XKWA 2JSPA 3F6VA 3HSRA 5C3EJ 1O57A 1QGPA 2VPRA 2JWTA 4Y3OA 4HF2A 4YFXF 1I1GA 1U9OA 4XR6A 2LOOA 3OIOA 1DU0A 4NHJA 2DOAA 3T8TA 2DA3A 2CW8A 3BCAA 3K4JA 3DTKA 5H6RA 4IHYA 2LTPA 1XGNA 2K5CA 1AKHA 1USTA 1WSUA 1QZZA 4XLPF 4EM0B 2QCOA 4BGDA 1GT0C 4CCKA 1SAUA 2HZTA 1ERDA 3COAC 4C3JJ 4IPAA 1NG7A 1ZH5A 2VB6A 2FX0A 2DA7A 1JUPA 1A5JA 2I10A 1P92A 1L0OC 1MIJA 3VYSB 5ILVA 4UB8C 3QOPA 2CMPA 5D4RA 4XONA 2HFHA 3LA7A 2BW3B 1GVDA 3HIFA 1BI3A 1SD4A 1U9NA 4PJLA 2CG4A 2ESHA 3FXRA 2DT5A 1JKQC 2OF7A 4AIDA 4QLCU 3IH4A 4A0XA 2BY2A 4R79A 4EEFG 2P0WA 1PVEA 3OIQA 2L9NA 4C2TA 4EMSA 2R7WA 3JR9A 5IP9J 2V1UA 2KDOA 5H2FC 1FY7A 4BL0B 1D0YA 5DV5A 1HQCA 3H9GA 1MNMC 4HYEA 1YE9A 4S0HB 5LBQA 1F5TA 2BYVE 2FOWA 4CUGA 2OCCH 4D9JA 1W0TA 1F9NA 2EILH 2W82A 4L0ZB 1WHUA 1JKOC 1YHQI 1DQUA 3F8NA 4ZDOA 4YRVA 3DXJF 2ZFWA 4CCLA 2VJ4A 3KYCB 1ONVA 2UV1A 2P7CB 5K5QA 2BY3A 2EZKA 5IT9K 3QP6A 1LDKB 1OYIA 2E36A 3CCQI 2WAEA 4W97A 3JREA 4BACA 4ENJA 5E3LA 3H3ZA 3CUOA 3KP5A 3BR0A 5L3FA 1D5VA 4BDYA 3Q3SA 4OMYA 1FBUA 2VE9A 1Z3YA 4RGUA 3V4GA 3CMEI 3CC7I 2JA6J 1D1CA 1SVLA 4DOZA 3BG9A 3KEYA 4LJZF 2CQKA 3KP6A 1PUFA 5EJCA 2JUGA 4IO9F 5FRNA 1DU6A 2VKDA 1O7FA 4XL9A 2LSOA 2K3FA 2CUFA 3CMYA 2VUMJ 4HRIA 2A6TA 5F04A 3ZMDA 1FEXA 5FLXZ 3A01A 5EZHA 2RGVA 1R4NB 1S3JA 2MYSA 2Z16A 1VQ5I 1UMQA 4A2UA 2P81A 1MBJA 3BPVA 4EM1A 3SXYA 4A0ZA 4A6DA 2HOEA 2UXNA 3HDDA 5E8GA 4MO7A 3MZYA 3DPUA 3I5UA 4D0PA 2ZMEC 2J5PA 2R7UA 3V8JA 1OCZH 5M5WJ 2MLGA 3KP7A 2Y9YA 2ETHA 3QPLA 1LVAA 1ZYRF 2VE8A 1G3SA 3REOA 2QYOA 2VOOA 1IUFA 4EJTA 1TNSA 2Y30A 2QENA 4BAYA 1ZR4A 4L0YB 3PSFA 4HNUA 3HRTA 2L9VA 1Q1HA 3K4KA 3DTEA 2EQRA 3GTJJ 1VQ8I 1I1SA 4JQFA 4MEYF 3ZQIA 2TCTA 1ZRDA 3J7AY 1IDZA 3V7SA 2O3FA 2M7BA 1TQIA 3NWSA 1Z9CA 4JX6A 4IQJA 4OIPF 2R92J 4XMYA 5K7FA 4BJTA 5IYCJ 2XB5A 2DPUA 4E7IA 3EETA 4P55A 1OCRH 2Y69H 3O3KA 3ZQ7A 4XKCA 3GZ6A 3A0HC 3MKWB 2FF4A 2XVCA 4BEHA 5K7ZA 4L9VA 4PJJA 5J4VA 4KJZA 3TDUC 2LC2A 1HSJA 2YU9J 4DW6A 3OMYA 3F72A 2DMQA 1ON1A 4N9IA 2Y9ZA 1VQNI 3R0AA 3CCYA 2WV1A 3BTLA 2FUG2 1X2MA 5AIPA 4OIOF 4XOPA 1HKSA 1VTNC 1MDMB 2XV4S 4XQFA 1JTXA 2HYGD 5E1XA 1F1ZA 4P5OA 3M1CA 3QRFF 2VPLA 1FP1D 1LDDA 4RAFA 1I6XA 2KISA 2DTRA 2CS3A 2MG4A 1KA8A 4G6DA 2Q0OA 1R1VA 2F6CA 1PJRA 3P9IA 1S7OA 3E1SA 4BE1A 5C4XJ 1ZGAA 4BY1J 2DK5A 1PDNC 5HDNA 3FBIB 3MFKA 2HI3A 1ENHA 5DM7F 4FCYA 5E3OA 1P2FA 4G8XA 3T8RA 2NRAC 2WBMA 3GLXA 1SC7A 4BHPA 1LFBA 4RB1A 3FHZA 3S3NA 3LMMA 4A3FJ 3QAHA 4A3EJ 3WTVC 1K6OA 3J7ZI 3FM5A 1XGSA 5HS9A 3VEPA 4CYDA 3MVPA 4ZH4F 1X3UA 3KLNA 1RKWA 2Z5UA 4XN3A 4A3DJ 1OCPA 4UV8A 5CPRB 1QRYA 4L5JA 1RZ4A 2PN6A 2XAUA 1WJCA 3P7NA 1FNNA 2I5UA 3ROUA 1RKTA 1JUMA 2JA2A 3DEUA 2E7WA 1CF7B 2Z99A 1A6IA 1MBFA 3GX4X 2H27A 4HOBA 3OYFA 1EF4A 3RI4A 4ZZLA 4A3GJ 1ZGJA 2XPUA 4RMNA 4DYRA 4HF1A 4IVNA 1ZRCA 3Q9SA 2OA4A 3TL4X 4KICA 1MBGA 2ZC2A 4AUXA 4E7HA 3JRBA 1NH3A 4G9YA 2IRFG 2LY9A 2K9MA 1YJ9I 1B72A 3CCVI 4XLCA 4BXXJ 4AVZA 1YRNB 3K4MA 1HC8A 5D4SA 5K5OA 2JQ7A 6PAXA 2VQHA 2JZYA 2ACJA 3PNVA 2M45A 3GFLA 1I3AA 2EH3A 2BY0A 2WADA 1Z7UA 3I53A 3RPQA 2TRTA 1BC7C 5LHGA 5HS7A 3WODF 2CUZA 4PFPA 1Z67A 1ZLJA 2LKSA 1SMTA 2EB7A 1RESA 1IRFA 3HUGA 1JGSA 2NS0A 3QU3A 3KP2A 1JJ6C 1TNTA 1KU2A 1FOYA 4A69C 2EFQA 3F8CA 5FRMA 2MABA 3RDIA 3TW6A 2PBIA 3I59A 3L09A 3QU6A 2H6BA 1K4TA 1GUUA 2ZXWH 3RKQA 2GOXB 4HSTA 1W0UA 2R7OA 3CF5F 2DYSH 1VNDA 4ZDPA 2NXNB 2W25A 2F4IA 4KFCA 4F3QA 2DO7A 3I59B 2MA3A 1MBHA 2VI6A 3HC7A 4BBRJ 3KE2A 2X6OA 2FD5A 2QLZA 2IGNA 1D1AA 2WB1A 2R7VA 2KQRA 3TBIA 4OWRB 4LK1F 4BNCA 3IRRA 1MGTA 5DDGA 4XBFA 1W5SA 2DMUA 5JI6A 1YTYA 2PI0A 3OR2C 4I99C 4IRGA 1KQ8A 5BOXA 1O4XA 3CQZJ 3SFIA 1GVJA 3CCEI 2EK5A 3WU0A 4B3AA 1WI3A 1TC3C 4U7DA 3TO9A 5DUKA 3AG3H 1FOWA 3G71I 4CGZA 4IX7A 2J5OA 1Z1DA 2HS5A 2M2EA 4EM2A 4HZFA 3B6AA 3FMQA 4IRIA 2LF7A 2XPWA 1BA5A 3QYBA 3BR1A 2EJRA 2W00A 3HRSA 2L54A 3PNTA 1Z91A 5CQGA 2IGMA 4IHWA 3LQRA 2H94A 3WGHA 5B5EC 3ESWB 2VBYA 1WJBA 2UZKA 4J19A 3KP4A 3BPXA 4EJOA 3OYJA 4UUSA 3BDDA 5CQEA 2XF5A 1IN5A 4CA0A 3GTKJ 3S16J 2HWVA 3GTMJ 2MH9A 3CCRI 3O2PE 1U3EM 2FMLA 3AAFA 2QQAA 1VQ9I 3S1MJ 4XRMA 5EG0A 2NVUB 2EV6A 4UXNA 3LSMA 4S04A 2CGPA 4XNFA 3M1EA 4X0GA 4HDVA 1B1BA 3RTRA 2LR8A 2V26A 2M0CA 2CFXA 2ME6A 2WB1N 1LJ9A 1W7PA 4E70A 2OQGA 2KIFA 2WY7Q 3BQZA 4LITA 1GXPA 1FJLA 3FXMA 2CV1A 3OYGA 1SANA 3LFUA 2DBBA 1JHFA 1ZLKA 5M3MJ 2CFOA 1TWGJ 4EJUA 2K9SA 1MDMA 4XICA 1DGWY 2PMHA 2X6XA 1MH3A 1USSA 1YX3A 1XD7A 2TDXA 1IV6A 4EGZA 1BR1A 4UB6C 3IV5A 2F5FA 1FYKA 3J81K 3MZ8A 5EEHA 3SEZA 4MFDA 4O6JA 2XF7A 1H88C 3FK7A 4B43A 2UXXA 1ZAOA 3VYRB 3CMAI 4KYWA 3D5LA 1HF0A 2LMDA 3RZOJ 2BEOA 2XAJA 3SDBA 5L3BA 2VXDA 3KLOA 2K02A 5JHFA 2HKXA 4GFBA 3V42A 3CC4I 2O8KA 5H6QA 1OKRA 3JW4A 4RAZA 3DBHB 3CUQC 4NB5A 3KIOA 3H0DA 3EYIA 4ESFA 4A93J 4IJAA 4OU0A 2V79A 2YX7A 3E5UA 2DDBA 3E5XA 1J59A 4CCNA 5FKNA 3I56I 2A07F 1WFXA 3W6JB 2P4WA 2CQXA 4G12A 2RNGA 1QO0D 4D5FA 1SD5A 3DEWA 2YX4A 3RPUA 3LA2A 1R1TA 3Q0VA 1FMVA 5LGUA 5HODA 3OYHA 3RKWA 2LDUA 1UHWA 5D5UB 3HB9A 1DP7P 1ZGWA 3Q0WA 2FBIA 2A61A 2OQRA 2D5VA 1R7JA 4I02A 4I76A 2F5EA 3KYLA 2XGXA 5IP6A 3ZCOA 2NVTJ 2Z9OA 2DXIA 3PIPF 3OYBA 4UVBA 2JN6A 2MD5A 3WE3A 2ELKA 2Q2EA 1TWFJ 4KUMA 5HDGA 3H3UA 3WTWC 5EDNA 1RUOA 3UR3C 1EH7A 2CQ7A 1KU3A 3VYTB 4PJ0C 4M6VA 2IP2A 4M3BA 1B6AA 4CXFA 1U6GA 2CU7A 2R7TA 1ULYA 3BWGA 3QP5A 3G73A 4B1RA 2LG4A 2OTJI 5F0HA 2STTA 5F64A 1K78B 2PMZN 1J7KA 2DFHA 2E7XA 2HQAA 4DYQA 5BNGA 3M3YJ 3TQNA 5IYBJ 2JA7J 2WTEA 3OS0A 4B44A 1S6LA 4M3DA 2HU9A 4M9SA 5M3FJ 3EUKL 4MEXF 2H8RA 1BI2A 2JVHA 2DN0A 4ZZDA 4QWQA 1CQTA 1KYZA 5L3EA 2E2IJ 5J8CA 3HOXJ 1FBSA 2ZXHA 2Y75A 3MZHA 2WAFA 3TP3A 4V19K 3S2WA 2PJPA 4I7HA 3BT9A 4Y13A 3BLYA 5EYRA 4CDGA 1S9HA 1K83J 2X1EA 4I09A 5ICCA 5HLGA 2KFDA 2VOPA 1SFXA 4I0BA 5K1YA 5GAHJ 1LUJB 3JRAA 1XB4A 4RB2C 2IAIA 4R8HA 4LB5A 2JK3A 1OYYA 3K70D 1IN7A 1JT6A 5GP9A 3GTGJ 2JUCA 4A3KJ 1EV7A 1OR7C 2P6SA 2COMA 4RAGA 3Q5FA 1R58A 1Y0NA 3DU5A 3M7GA 5CKTA 4DNCA 4E7ZA 1K6YA 2H8WA 1P6RA 2VC0A 3H1CA 4O5VA 3PQKA 1XGMA 1TW3A 5K5RA 1O3TA 5F1JA 2L7FP 3HOYJ 1KQ9A 2OZUA 3S1NJ 1D3YA 3FISA 2E2HJ 1FLIA 4FISA 2MBFA 3DTIA 3RPUD 4MTEA 3IL2A 3FK6A 2O61A 2R5ZA 1U5TA 3K10A 4AD9A 1Z0XA 3S17J 3G6EI 4RB0A 4GYGA 4IHSA 4Z6YA 1A04A 1IRZA 1VQOI 3FXJA 2ID6A 4JOMA 2VXZA 3ECOA 4Q5SF 3HPHA 1BL0A 2X0LA 1JE8A 1Z77A 3FHNA 3BZKA 2IGKA 2XAHA 3J80K 3G3ZA 4BHBA 2EFPA 3FXKA 3D0SA 3PJRA 3KX2A 1HW5A 1SVOA 2MC3A 1U8RA 3OYAA 2NOJB 5HOOA 2M4GA 5E3MA 3GW2A 1FBQA 3CO7C 3TKYA 1SD6A 2OCEA 3HOUJ 4HLYA 2M7AA 5E8IA 2GQQA 5FGMA 2RREA 4CH7A 3K2ZA 2UWMA 3EPZA 4ESBA 1LE8A 3GFJA 1U2WA 2IPQX 5ED4A 3MAJA 3E3VA 1S8NA 4M72A 3VYUB 1YRNA 1E0EA 3F6OA 3I0TA 1BBYA 5FFXA 4II2A 1UHSA 3KYDB 3KEQA 2R93J 1YW9A 1LPQA 1YS6A 4R1HA 2BE5F 5DCMB 3PIOF 1MMGA 4XK4A 1FTTA 2LYCA 1FIPA 1V3FA 1WQ2A 1HSTA 2LNBA 5L3DA 3GUDA 5KHDA 2DA5A 3FDYA 1X2NA 4IRHA 2XDVA 1LVKA 3QODA 1B4AA 1VZ0A 2BGCA 2PG4A 2MFZA 2CW0F 4Q48A 2B0LA 4FX4A 3S14J 5D6FA 1T39A 5HVQC 2XB0X 3RYPA 1DUXC 3BR2A 3ERMA 4IF4A 3ZQCA 2NS8A 1FT9A 1O3QA 4RA2A 5FB2A 3ISPA 1XGOA 1VFCA 4MTDA 2R5ZB 5JFRA 1XCVA 2VBXA 3HHHA 4CYCA 3B02A 1FSEA 2Y48A 3FXLA 4RGRA 4ZYDA 3IAM2 3K1MA 2ZJ2A 5GPAA 5HNFA 3ML6A 3BC8A 2NVQJ 4ZYAA 1D0XA 1X3ZB 2DOFA 1BM9A 1B72B 2QA4I 1AOYA 2NOGA 2GIZA 1TP4A 1WJFA 2QBYB 2H09A 3IUOA 2PQ8A 2Y0MA 2VC1A 4ESJA 4PFOA 4G7OF 4LB6B 1YW7A 1R5ID 1ZELA 3E97A 3H9JA 3RYRA 1ZTRA 4B8XA 3NEUA 1BI0A 4ASNA 1OISA 4J01A 4L5IA 2VLAA 2L9RA 1Z3XA 4ZJZA 3G2BA 5J1RA 4M3FA 3S93A 4HW0A 4JX5A 1IN4A 3PFYA 2R7DA 5IOYA 3WG7H 3TW7A 1RC9A 1FWZA 2DTZA 3DKYA 2E71A 3G1LA 4YG2F 4JP0A 3X2QH 1BIBA 3LSTA 1ZQ3P 1IDYA 2FBHA 2GIVA 3K70C 2W85A 3E5QA 4Y52J 3P9KA 1WRJA 2AS5F 2XSJC 2PLYA 2XKOA 3DKWA 3S15J 2M4KA 1P4XA 2X51A 1R36A 4M3EA 3ZOBA 4HNTA 2XGEA 2D1VA 2M1BA 3ONQA 4ENMA 3AG4H 2EFWA 3VDXA 3BTCA 5ILSA 4OIRF 3T5XA 4ANJA 5J4YA 3BG7A 1MJBA 4PUSA 4Y4RA 2YSRA 3SDGA 1Z6TA 2CUJA 5EGOB 1WH7A 1W7PD 3ZMSA 4E7LA 3GTOJ 1U78A 1QBJA 1TWHJ 1BR4A 4KMUX 3MKZA 1SAXA 2OJED 1SEUA 3IKTA 4PGGA 1W5CC 2VT2A 1GDTA 1SFKA 2E2JJ 3O6BB 3HL2A 1XDUA 4U0WA 1JKPC 4C2MJ 1Y56A 2MD0A 3QYEA 1DDNA 1BJAA 1GV2A 3F23A 2FOKA 1IXRC 2KKOA 3OYEA 1Z05A 4ETSA 1QHGA 4EJWA 3K9TA 1H8AC 3DWLE 1DP3A 3HM5A 5M5YJ 1H0MA 5B1BH 3I3LA 4DQ2A 1UG2A 3PL8A 2P7VB 1WVRA 1H89C 4HA8A 1BJZA 4PCQA 5J1UA 4NC8A 4B09A 1S72I 1ITYA 1U8BA 4L9NA 3BY6A 3GYHX 5CLSA 5FD6A 2LP0A 3BJOA 1PUFB 3ZR8X 4L9JA 1HXDA 1V5FA 1LFPA 3H5AA 3FX3A 2VQLA 4BY7J 2CO5A 3MCZA 4UVCA 1F43A 4JK1X 2ZJQF 1S7AA 1IN8A 1UG0A 2WC2A 5GPCA 3P5JA 4DBRA 2KMUA 1VQKI 2M30A 2HXOA 3BQYA 4A3MJ 2HR3A 2ZXJA 1TTYA 3ZQFA 2ZSHB 4U88A 4LOCA 4PDKA 4YIIA 1YW8A 1Y0UA 2RDPA 1G3WA 1S5LC 4P1WA 2QEXI 4B3XA 2HOSA 4WK8F 2LREA 3MMYB 2PFBA 4UVAA 1XSVA 2XKPA 2HNHA 3HOZJ 1SD7A 1NTCA 4A3JJ 1P7JA 5JLXA 3C2GA 2BHZA 4HAMA 2VT3A 1IV8A 2DK8A 4CICA 3WHBA 3OWTA 4BEHB 2GAUA 2HVRA 2RVCA 1J09A 4FX0A 1DPRA 4AU7A 2QQ8A 3FXQA 1MBKA 2H1LA 5HLIA 2FRHA 2LBFB 1YIOA 3TP0A 3OL3A 2QKLB 4ZYEA 3WTUC 1RETA 1X1DA 2MLKA 2ZCWA 3J81Z 3PUBA 5BPDA 1XX5A 1MMDA 3GCMA 2CWEA 2L9SA 2W4SA 3FMRA 3BG3A 2ZJRF 2BW3A 2P5KA 4YELA 3FBNB 3M8FA 3JSOA 1KYWA 2DA2A 2I8DA 2IS1A 3CZ6A 1WJEA 1MBEA 1V54H 4MGRA 2BVMA 4MNUA 2ZKZA 1QZYA 1J75A 3IP4B 2IGOA 4UUTA 2A68F 5A2QZ 1SFOJ 3JRIA 1HDPA 3ZQGA 5LHHA 1WGXA 3CDLA 3F22A 2ICWG 1U5TC 3ZMUA 1CF7A 5GTHC 2KJCA 3E0JB 2F4OB 3ZQHA 4MQVA 2FXAA 2QQBA 5FROA 5LLQA 2IXSA 2CYYA 1UB9A 2VONA 5KVRA 3JRCA 2GA1A 2KPMA 1X58A 1VI0A 3CJTB 1T8IA 2MGQA 1J0RA 4CCMA 3H3VK 5DD4A 3F21A 4HBLA 1I27A 2OAZA 2X6YA 2LKPA 4I01A 2GA2A 4LFUA 1JHHA 2R7RA 4OAZA 2E35A 4I98B 4I0AA 2NAZA 1PUEE 2R7XA 1X4PA 4JBAA 3O8GA 1XCBA 1UFMA 4D7MA 3F8MA 3MKLA 1MZBA 3DEEA 3ULQB 2YR2A 2B9SA 3HPGA 4LG3A 1R71A 3JRHA 2ESNA 4PGHA 1QHHD 4UUVA 3CLOA 1MMAA 3R60A 5B1AH 1RNLA 2W84A 1X1AA 1R23A 2K4BA 4G6QA 3S3OA 4KNYA 2LRDA 3A02A 2X9DA 4LGWA 3GTQJ 3WTTC 4QPOA 2GWRA 3HG9A 3GLLA 5ILUA 3BP8A 1TQPA 3E6DA 3S32A 1AU7A 1APLC 2CV0A 2HGCA 2YPRA 1M1EB 3LSRA 1ZHFA 2RC4A 3O8HA 4DYCA 2X4HA 3JSPA 1QVTA 5JHUA 1Y39A 5JVTA 1RIOH 4WCGA 3A1YA 1Z6RA 3MWMA 4OMZA 3TOAA 1YITI 1S7EA 1IRXA 1IXSB 2E60A 3C3WA 2F48A 2Y31A 4FASD 4ZYGA 4TV7A 3K7AJ 2BXYA 4OINF 1OJLA 4GXOA 4FE7A 2FNAA 4BKXA 3CCLI 1FOXA 1BR2A 3GTPJ 2EA2A 5EF6A 3N05A 1VF9A 4BQOA 1OCCH 1LNWA 3MKYB 4IOCF 2ISZA 1WWXA 4Y15A 4U0YA 4M3GA 3TO6A 2CRGA 1I5ZA 5E18F 4XLNF 5ICEA 1Z21A 3ASOH 4IQ4A 2VKHA 1XSXA 1I39A 2XF6A 9ANTA 1WJDA 2HDDA 2ME0A 2VQGA 2IS4A 3HZJA 2V4JC 1X4OA 1WI9A 3CMMA 3M4OJ 1MW7A 2VASA 2DFEA 3BR3A 4IXAA 2HDWA 1ZG3A 3BG6A 2R0QC 3QPSA 1JI8A 5B3SH 4C3HJ 3GMEA 4B48A 2X48A 3PQJA 2E19A 3VFZA 1B9MA 2GM4A 1PYVA 5DD8A 3ZMZA 4XSZF 4M73A 3TEDA 2VKVA 3CDIA 5F1RA 4HG2A 4P9UA 5LGNA 3OSFA 1XS9A 4LLLA 2R7FA 5FD5A 2M8EA 4AIJA 4C2UA 1KQ0A 2H1KA 3H9QA 4AM3A 2IBDA 2O03A 2PMZA 2DMNA 3HKZN 3GO5A 4D5CA 1ZREA 3ABLH 2IA1A 4NC6A 4XN0A 3F9KA 3VODA 3L1PA 1R5GA 3G4SI 1TQMA 2LD5A 1P4WA 3G1OA 5TRDA 2N8GA 3FXOA 4PSXA 5L3CA 2E5NA 3FKJA 1MMNA 2JT1A 2ZNZA 1JUSA 4N4OB 1A6QA 3K6GA 4KT6A 3DLLF 1EA3A 3QPTA 3OYCA 4PJMA 2GXBA 2BV6A 3LSJA 4RLQA 3NQOA 4IHVA 1ACIA 3FXUA 5ICGA 4GGGA 1UJ8A 3DV8A 1X1BA 2ECCA 2AXLA 4HX8A 3ZPLA 2KHMA 4HDUA 1T08B 2DCEA 1RUNA 2QUFA 5BPIA 2NNNA 3TOBA 3WG9A 3ZGKA 2Q8KA 1P9QC 1H9GA 4BHCA 4RDUA 1OFCX 2L7KA 5CVUA 5FLMJ 1F4KA 3CJQB 2RQPA 2LLKA 1IC8A 1N78A 3CCMI 4MFEA 1T2KA 1FOKA 3OYIA 4W1UA 3OY9A 5K7HA 3B73A 2XROA 4D7NA 3BTIA 2PMUA 3DP7A 3QQAA 4RBOA 2JTVA 2CJJA 4RS8A 3HOTA 3QWLA 1VQ7I 4HNVA 2W7NA 5EG0B 3L2CA 4A0YA 3VSKA 5A2QK 1TW2A 4L18B 1G3TA 1AA7A 2KIMA 1POGA 1UCRA 3VWBA 1TBXA 2M8GX 2QKMB 2WAQN 2GLOA 4JX4A 4XRSG 1TLHB 2B7EA 5DM6F 2FNPA 5FO5A 1ORKA 4Q4ZF 2KIUA 4RB3C 3VOEA 1EH6A 2VJ5A 4BXUA 4BDZA 4NQWA 4UV9A 2X1CA 4S05A 1G6NA 1E3PA 1K4SA 2QGUA 4AC0A 2E1MC 5CVIA 5CYVA 3HSFA 2EA4A 1Q1VA 5J40A 5IY5H 3WTZA 2KL4A 2HPIA 3CLQA 4ZTJA 3BROA 4RGSA 4UHTA 5KAFC 2R5YB 2FQ4A 2CUEA 2LVSA 3CO6C 2Y2ZA 4J00A 5D6EA 2O9LA 2ZJPF 1Y1WJ 3LWFA 4GO1A 4U7BA 1WJAA 4IL6C 1AHDP 3EYYA 5BMZA 5E1WA 1W36D 3HTSB 5FKOA 1DPUA 3LFKA 5DUIA 2CH0A 2DDAA 3ABMH 3FF5A 5FJ8J 3S1RJ 2PEXA 4HQMA 3S8PA 2QM3A 5CVRA 1WPKA 3R6SA 5E3NA 4FE4A 4HEA2 3OL4A 5DS9A 2Z1DA 2IVMA 3HXLA 1OCOH 3RSNA 2F2EA 3OS1A 3ZN0A 1NK2P 2BY1A 4A5MA 1WH5A 3V8KA 3LSGA 3H0GJ 1T0FC 1O7LA 4NNJA 3SFZA 2H6CA 3FM3A 2FU4A 3GVAA 3R61A 3W6KB 1X1CA 3MN2A 2KP6A 4UUSB 4XKVA 4XKBA 2F5VA 2O6GE 5C44J 2EBIA 2CQNA 2JRMA 5FKMA 5FLXK 2L4MA 1HW1A 3FZVA 5HNHA 1B9NA 5BQTA 2O5RA 4XRFA 4CSWA 1XMAA 2AHQA 3K1NA 3CP2A 3OV8A 5CJ9A 1NK3P 3S1QJ 3H35A 1QPIA 2DAOA 2K4JA 4RAYA 2DT7B 2KIQA 1MSEC 5EGOA 1UHMA 1E2XA 5HDKA 4ITVA 2W48A 5LEJA 2HTJA 2XHKA 5KK1A 4C30A 2STWA 4B4CA 2WWYA 4E7JA 4NDLA 5IT9Z 5D5XB 4U0VA 2XAFA 5DYMA 2FJ1A 1FSHA 1R5HA 2DODA 2QSFX 2AQFA 4QPQA 1R22A 2VKEA 3HOSA 2B63J 2O7OA 2NVXJ 1QZEA 2RNJA 3M8JA 4KMFA 3K1PA 1V55H 2ZNYA 4G7HF 1ZG1A 2D45A 1ETYA 4YFKF 5D8KB 1IUYA 2K7LA 1FIAA 2KT0A 4I6ZA 2QZ8A 2P6TA 2IW5A 2Y0SA 2HEOA 3PUFA 4X1EA 1N77A 3CD6I 1E3HA 2EV0A 5AIQA 4E6KG 5LRSA 4C9YA 4HPQA 3L9FA 2LKXA 5TGTA 4LD5A 2IA2A 4CO8A 2FE3A 2WV0A 1QA6A 3CUQB 2QBYA 5CVJA 2HVSA 1FP2A 1UELB 1JT0A 4HQEA 1IW7F 2DQLA 2OBPA 1R1UA 1MH4A 3LOCA 5BS6A 2L7MP 2V6EA 1U5TB 1Y8RB 4A12A 1K79A 1R00A 1P4AA 4Y7NJ 3DKXA 2JA5J 3LAPA 1IO2A 2W24A 1VQPI 2KRCA 2HDCA 4CZCA 3CJNA 1KGSA 5TJJA 3BZ6A 2MW8A 2X1DA 3SZGA 1IRGA 1VQLI 5F27A 3GTLJ 3NAUA 2G9WA 3KP3A 2HVQA 2COBA 3Q0UA 4PK4A 3IHUA 4BS9A 3AL0B 3GBGA 1D8JA 2WY8Q 4OAYA 3M9AA 1T56A 2HQNA 1J9IA 4GCVA 3L2QA 3K0LA 1V5GA 1PP8F 2VODA 3GEZA 3IRQA 3N97A 5LGTA 1I6HJ 1K61A 3RCOA 2ZSIB 2V1NA 3TMOA 1AWCA 2V1XA 2K27A 1ZN2A 3AL0C 3OOPA 3L2WA 4M9XA 2QSGX 3R4KA 3DBRB 1K7AA 5EEAA 1TT0A 3TO7A 1QQIA 2K40A 3F0CA 1CGPA 1ETQA 2EFOA 2F4MB 2E1MB 2V9KA 1ON2A 1U0JA 2VQCA 1WJ5A 2XIGA 3WU1B 1QVUA 3A2KA 3SQNA 5DTDA 1YG2A 2NYXA 2HOTA 2R7SA 1XTAA 2E5ZA 2A6HF 4UY8I 2KDZA 4ABZA 4A3CJ 4ENKA 2HQRA 2DQRA 2YU3A 3EUHA 1XSDA 5F6FA 3LSHA 3E6BA 3IC7A 1K78A 2PX9A 2HPMA 2O0YA 3AG2H 3ZXSA 5GTIC 3HRMA 2ZFUA 3PO3J 3DPLC 3DLAA 1YOVB 3B6CA 4YFNF 1Y8QB 1JKRC 2NNYA 1MNEA 3GFMA 1SVMA 2QQ9A 3OYMA 3BJ6A 1XC5A 2HYJA 3D5SC 3ZMVA 3KZYA 4U87A 3ECHA 4EATA 3T0YA 2DMTA 4FHTA 4KT5C 1BOAA 2FA5A 5JVGF 2Z2SB 4KIGA 3T1BA 2PJRB 2AXTC 3HGGA 1IZ1A 3FKIJ 4JYKA 1FYLA 2NVYJ 3HSEA 4MLOA 3I4PA 1EH8A 3JRGA 2VJIA 3K4LA 2DFFA 2G7UA 5AONA 3U21A 1R6RA 4EQQA 4XIDA 1JGGA 1YS7A 1R4MB 2JMWA 3KFWX 4XLEA 1UAAA 3I4NJ 5GADJ 4F92B 3D5RC 1LE8B 1J5YA 5FFZA 2CW7A 3LSPA 4IEJA 4NUBA 4LG0A 3W3CA 2EZIA 2LY2A 4KN7X 4XSXF 5C4JJ 3J80Z 2LY1A 3BR6A 4AYBA 1KZHA 4WF2A 1UZCA 4BH9A 4AIKA 2IJLA 1IXCA 3AFHA 3C7JA 4M6XA 3WHCA 3JTHA 5DCFA 2IT0A 1N75A 1BC8C 3K4CA 4KA4A 4XORA 4RGXA 5F08A 2OV7A 1NHAA 5HLHA 3DFGA 1FC3A 4D1QA 1BW6A 1HKQA 4FT8A 3VSLA 2ISYA 5ERIA 1OQYA 2G0EA 1YJNI 3J7AO 2RN7A 2A5WA 4IKFA 3BJAA 1ZARA 2AO9A 2Q1ZB 2HOAA 3NWTA 4HX7A 2RKHA 5CVVA 5FKLA 5DCMA 1VQMI 2V6CA 3G1MA 4A3LJ 2EZHA 2LF8A 1ZRFA 4E7KA 3WTYC 1OLTA 4NBQA 4BJ6C 2XGDA 5ICFA 2NS7A 5TISC 2JVGA 4XLAA 2K85A 1I3QJ 2E1NA 2FQ3A 3RQIA 3V7RA 3VPRA 3L2UA 2FBKA 3DCFA 4BQAA 2OU2A 4FETA 3VB2A 2L7ZA 3IKVA 4H4KC 3M8EA 4G6TB 1T6SA 1H9TA 4ENNA 5FKKA 2ECBA 4CHUA 1LDJA 2EIJH 1HCRA 1W36C 5KAIC 2XSDC 1YO5C 2K3PA 3ZRGA 1FMWA 4A3IJ 1B8IA 3K2AA 3EQLF 3L00A 3HOWJ 4WX9A 4KN4X 4HV5A 3LSIA 4MHGA 2IA0A 2L01A 1ODDA 3ASNH 2JSCA 3H5RA 1HW2A 3IH3A 2DA1A 5KNLA 3WGIA 1IG7A 2EWNA 4OIQF 2DA6A 2V9VA 3DQVC 1PP7U 1BI1A 4GYIA 1G59A 4YEJA 2BVLA 1T0FA 3BG5A 3RQ4A 1G3YA 2XRNA 3CTAA 4QIWN 3GFIA 1B59A 1XMXA 4XOTA 5HLTA 4G94A 4KDPA 3RKYA 2L0KA 3EUHC 4PZJA 4XLHA 3QYFA 1TWCJ 3EDPA 4DZJA 1MJ9A 1YYVA 2KRFA 2MSYA 3DU6A 1BOBA 2EINH 5EZGA 1YI2I 2DFIA 2D2WA 2GXAA 3S2DJ 2LK2A 4BBSJ 1BN5A 1STZA 3KZIC 3IH2A 2V1DA 1EKEA 4EJVA 4AYBN 5KCMA 2R7ZJ 2F5DA 4CYCB 1ZK8A 3C2HA 4EGYA 1FX7A 2M34A 2M9HA 3I71A 3KPHA 4RLFA 3JCUC 3SHFA 2M87A 1YJWI 1MMSA 4F55A 1ZG5A 1X1PA 4A6EA 3E6CC 2XUBA 2V9PA 4HSRA 3LQQA 3CC2I 3GWZA 2LFBA 2DT6A 1ETKA 5IT3A 4ZYHA 1MJAA 5E17F 2OTLI 1SFEA 3U9GA 2L2OA 2ELHA 1XMKA 3W2AA 2IEKA 5J1YA 1AKHB 2ELJA 3LL7A 5L3GA 2DOEA 2EIMH 2OD5A 2RAEA 2ZBKA 3ZQLA 1FYMA 1VQ4I 2EPFA 1RRJA 4F7ZA 5J47A 3KCCA 4LLGF 2FEZA 2R7QA 2GZWA 2VBZA 3E7LA 3SZPA 1SFUA 1KU9A 5IOZA 2JA8J 1D1BA 1W5TA 3RKXA 2XASA 1T95A 4QSHA 4N4NB 3EUAA 3KZZA 3PM1A 4DJAA 2WA0A 3ABKH 2HKOA 3I54A 2DI3A 3JAMK 4Y33A 3HUGB 2XAGA 1YLFA 3WTSC 4ZC3A 3ZP5A 1X19A 3HGYA 2HXIA 3RIRA 1IAWA 3OS2A 2ZMEB 2P5LC 4BE2A 3W2VA 2L5QA 4HLXA 3CESA 3GZNB 2YS9A 1G2HA 3IWFA 4BUPA 1R49A 2Z33A 2L3DA 3CCJI 1F36A 3CUQA 4IHXA 2WAQA 4M74A 1S29A 4XLFA 4F93B 1OCTC 2HYFA 3LA3A 1J2XA 2XRLA 3ABTA 1FTZA 3I64A 5LEKA 2IS6A 3LNQA 1RPWA 4KISA 2GXGA 1MSFC 4LMYA 1KONA 3HJEA 2Q2EB 3LSKA 3V8LA 3HYIA 4N9HA 1ETVA 3FIWA 3S2HJ 2MC4A 3PO2J 3K69A 2UUZA 4PSWA 4DIQA 1IGNA 5J8FA 1GV5A 2VIXA 2ZO4A 1QU3A 1D8KA 3MEXA 3JAMZ 5H20A 4XRSA 2ZXIA 2RV8A 2E34A 4V2GA 3SZTA 3L7WA 1YFHA 3F8BA 1HKTA 4FTHA 1JJ8C 3GF2A 2A3SA 3E6MA 1LEBA 4C3IJ 3I58A 1GXQA 2A5YB 3KEOA 3WE2A 1RI7A 3U1KA 3L2RA 3QOEA 3ZQQA 3NRVA 4EVIA 1QPMA 1TL8A 2KZGA 4E4HA 4CCJA 4RM2A 1GHCA 5E20A 2QWWA 3OSGA 2CQQA 2BOLA 3A0BC 1TWAJ 4WWCA 2KZVA 2D1HA 2F5CA 4RM3A 5LD2C 3WTXC 4LIUA 2JRTA 4DGWB 3CP8A 3OR1C 1FPQA 1XN7A 4OOIA 4H0EA 1LEAA 2PJRA 3BTJA 3W6VA 4GDFA 2ZB9A 4CCOA 1EJ9A 5IPAA 3I9V2 1IF1A 1ZR2A 1OPCA 1YQAA 3QPHA 4WXDA 1KU7A 4IHTA 2GOMA 4HF0A 2K86A 1X3WB 1SMYF 1TT5B 1ZKGA 2EFNA 2P8TA 2XAQA 3M07A 1B8IB 3S3MA 3A01B 2QF7A 1NG6A 5LRRA 4AWXB 3MQ0A 4FQGA 2OUMA 3ELKA 2DPDA 1GLNA 3HTUA 2HZDA 3HRUA 3OYKA 1HBXG 3SJMA 1DGRM 2ADUA 3ABUA 3WGGA 1E17A 4M9ZA 1I50J 1OR7A 1C0WA 3I55I 2DYRH 4AIHA 1BW5A 2LBFA 4DBQA 4HV6A 3KETA 4KIFA 2EIKH 4AVPA 1T98A 3HOVJ 1OMIA 3H36A 2K9NA 4K2EA 4LLNA 2W57A 4WXHA 1YX5A 2JPBA 2M5WA 1LKXA 2QVOA 3C1DA 1WCMJ 4NC7A 1G8XA 5IYDJ 3PSIA 1HDDC 2FMYA 4EV0A 2X6WA 2KLOA 5E79C 4X6AJ 1IJWC 1TZLA 1A35A 2DA4A 3OYDA 3H5NA 4BXFA 4IOAF 4NQWB 5JLWA 3AG1H 3R0JA 2A6EF 3A03A 5D8LB 2O8XA 4BQQA 3CCUI 5E1ZB 4DZPA 1REPC 3GZ5A 1D0ZA 1O3SA 5M5XJ 1RR7A 4F91B 4IZZA 3OYNA 5GAEJ 4M71A 4F52A 1LB2A 2E1CA 2R3SA 4MQ9F 3K4NA 4CZZA 5GAGJ 4N0BA 2CSOA 5D5WB 2DJNA 2R4GA 3TDZC 2L4AA 4LG0B 3D1NI 2EV5A 4BU2A 2IS2A
chains in the Genus database with same CATH topology
2DW4A 2KJBA 1V4RA 1O3RA 2VN2A 1QNTA 5JR3A 2JPCA 4A5NA 1BIAA 2A69F 5HS8A 3BOQA 3N4MA 1XDSA 1MD0A 4I2OA 2Z3YA 3F8FA 1FZPB 3FMSA 4G7ZF 2P5VA 4Y17A 1W4MA 2DU9A 1MKMA 1W7PB 3FWEA 4ON0A 3LAJA 2OZ6A 3ZMTA 2L02A 1G4DA 2C6YA 1IN6A 3CDHA 5D5VB 3P9CA 4KIBA 3JTGA 4O3MA 4YIFA 3HHGA 1JXSA 4Z2YA 5DEQA 4LK0F 3RJPA 3DF8A 1LQ1A 1WKMA 4L9TA 2BBYA 4UNOA 3PFIA 1T38A 3U1DA 4BYYA 3Q9VA 2MH2A 3H92A 4Q47A 4HX4A 3C18A 3TGNA 4P96A 2G7HA 2VBWA 5EEGA 3IWZA 1L3LA 2ZMEA 3DPTA 3F3XA 4WXCA 3U2RA 5J6XA 4P9FA 2FSWA 1OYWA 3V7CA 3ZN1A 2DLLA 3GXOA 5LHIA 2HTSA 3ERED 4M6YA 3F6VA 3HSRA 1O57A 1QGPA 4HF2A 4YFXF 1I1GA 4NHJA 3T8TA 5H6RA 1XGNA 1USTA 1WSUA 1QZZA 4XLPF 4EM0B 2HZTA 3COAC 4IPAA 1ZH5A 1P92A 1L0OC 5ILVA 3QOPA 5D4RA 2HFHA 3LA7A 3HIFA 1BI3A 1SD4A 2CG4A 2ESHA 3FXRA 2DT5A 4QLCU 4A0XA 4R79A 4EMSA 2V1UA 1FY7A 5DV5A 1HQCA 4HYEA 5LBQA 1F5TA 2BYVE 1F9NA 4L0ZB 3F8NA 3DXJF 2ZFWA 1ONVA 2P7CB 5K5QA 5IT9K 3QP6A 1LDKB 1OYIA 4ENJA 3H3ZA 3CUOA 3KP5A 5L3FA 1D5VA 4OMYA 1FBUA 2VE9A 4RGUA 3V4GA 4LJZF 2CQKA 3KP6A 1O7FA 2LSOA 3ZMDA 5FLXZ 2RGVA 1S3JA 4A2UA 3BPVA 4EM1A 3SXYA 4A0ZA 4A6DA 2HOEA 2UXNA 5E8GA 3MZYA 3I5UA 4D0PA 2ZMEC 2J5PA 3V8JA 2MLGA 3KP7A 2ETHA 1LVAA 1ZYRF 2VE8A 1G3SA 3REOA 2QYOA 2VOOA 4EJTA 1TNSA 2QENA 4BAYA 4L0YB 3HRTA 1Q1HA 1I1SA 4JQFA 4MEYF 1ZRDA 3V7SA 2O3FA 1TQIA 1Z9CA 4OIPF 2DPUA 3EETA 4P55A 3O3KA 3ZQ7A 3GZ6A 2FF4A 2XVCA 4L9VA 3TDUC 1HSJA 3F72A 4N9IA 1ON1A 3R0AA 5AIPA 4OIOF 1HKSA 1VTNC 1MDMB 2XV4S 2HYGD 5E1XA 1F1ZA 4P5OA 3QRFF 1FP1D 1LDDA 1I6XA 2DTRA 1KA8A 4G6DA 2Q0OA 1R1VA 3P9IA 1S7OA 1ZGAA 2DK5A 1PDNC 5HDNA 3MFKA 1P2FA 4G8XA 3T8RA 2NRAC 3GLXA 4BHPA 4RB1A 3FHZA 3QAHA 3WTVC 1K6OA 3FM5A 1XGSA 5HS9A 3VEPA 4CYDA 4ZH4F 1X3UA 3KLNA 2Z5UA 4UV8A 4L5JA 1RZ4A 2PN6A 3P7NA 1FNNA 3ROUA 3DEUA 2E7WA 1CF7B 2Z99A 2H27A 3GX4X 4HOBA 3RI4A 4ZZLA 1ZGJA 4HF1A 4IVNA 1ZRCA 3Q9SA 2OA4A 4KICA 2IRFG 4G9YA 5D4SA 5K5OA 6PAXA 2JZYA 2ACJA 2M45A 3GFLA 1Z7UA 3I53A 3RPQA 1BC7C 5LHGA 5HS7A 3WODF 1ZLJA 1SMTA 2EB7A 1IRFA 3HUGA 1JGSA 2NS0A 3QU3A 3KP2A 1TNTA 1KU2A 2EFQA 3F8CA 3RDIA 2PBIA 3I59A 3L09A 3QU6A 2H6BA 2W25A 4KFCA 2DO7A 3I59B 2MA3A 3KE2A 2QLZA 4LK1F 4BNCA 3IRRA 1MGTA 5DDGA 4XBFA 1W5SA 5JI6A 1YTYA 2PI0A 4IRGA 1KQ8A 5BOXA 1GVJA 2EK5A 3WU0A 4U7DA 3TO9A 5DUKA 4CGZA 2J5OA 1Z1DA 2HS5A 4EM2A 4HZFA 3FMQA 4IRIA 2LF7A 3HRSA 2EJRA 2L54A 1Z91A 3LQRA 2H94A 3WGHA 2VBYA 2UZKA 3KP4A 3BPXA 4EJOA 3BDDA 1IN5A 2HWVA 2MH9A 3O2PE 1U3EM 2FMLA 3AAFA 2QQAA 2EV6A 4UXNA 4S04A 2CGPA 3M1EA 4HDVA 1B1BA 3RTRA 2CFXA 1LJ9A 1W7PA 4E70A 2OQGA 2KIFA 1GXPA 2DBBA 1JHFA 1ZLKA 4EJUA 1MDMA 2PMHA 1USSA 1XD7A 2TDXA 4EGZA 2F5FA 1FYKA 3J81K 5EEHA 4O6JA 2UXXA 1ZAOA 4KYWA 3D5LA 2BEOA 2XAJA 5L3BA 3KLOA 2K02A 2HKXA 5H6QA 1OKRA 3JW4A 4RAZA 3CUQC 4NB5A 3EYIA 4ESFA 4IJAA 4OU0A 2V79A 2YX7A 3E5UA 3E5XA 1J59A 2A07F 3W6JB 2P4WA 1QO0D 1SD5A 2YX4A 3RPUA 3LA2A 1R1TA 5LGUA 3RKWA 2LDUA 1UHWA 5D5UB 1DP7P 2FBIA 2A61A 2OQRA 1R7JA 4I02A 2F5EA 2XGXA 2Z9OA 4UVBA 2MD5A 3WE3A 2Q2EA 4KUMA 5HDGA 3H3UA 3WTWC 1RUOA 1EH7A 1KU3A 2IP2A 1B6AA 4CXFA 1U6GA 1ULYA 3BWGA 3QP5A 3G73A 2STTA 5F64A 1K78B 1J7KA 2E7XA 3TQNA 2WTEA 1S6LA 4M9SA 4MEXF 1BI2A 4ZZDA 4QWQA 1KYZA 5L3EA 5J8CA 1FBSA 2Y75A 3MZHA 3S2WA 2PJPA 4I7HA 4Y13A 4CDGA 4I09A 5ICCA 5HLGA 2VOPA 1SFXA 4I0BA 5K1YA 1XB4A 4RB2C 4R8HA 4LB5A 1OYYA 1IN7A 1EV7A 2P6SA 2COMA 3Q5FA 1R58A 4DNCA 3M7GA 1P6RA 2VC0A 4O5VA 3PQKA 1XGMA 1TW3A 5K5RA 1O3TA 1KQ9A 2OZUA 1D3YA 1FLIA 2MBFA 4MTEA 3IL2A 2O61A 1U5TA 4AD9A 4RB0A 4GYGA 4IHSA 1A04A 2VXZA 3ECOA 4Q5SF 2X0LA 1JE8A 2XAHA 3J80K 3G3ZA 4BHBA 2EFPA 3D0SA 1HW5A 2MC3A 1U8RA 5HOOA 3GW2A 1FBQA 3CO7C 3TKYA 1SD6A 4HLYA 5E8IA 2GQQA 5FGMA 3K2ZA 2UWMA 4ESBA 3GFJA 1U2WA 2IPQX 5ED4A 3MAJA 3E3VA 1S8NA 4M72A 3F6OA 3I0TA 1BBYA 5FFXA 3KEQA 1YW9A 1YS6A 4R1HA 2BE5F 5DCMB 1V3FA 1WQ2A 1HSTA 2LNBA 5L3DA 3GUDA 4IRHA 1B4AA 2BGCA 2PG4A 4Q48A 2CW0F 2B0LA 4FX4A 5D6FA 1T39A 5HVQC 3RYPA 1DUXC 4IF4A 1FT9A 1O3QA 5FB2A 3ISPA 1XGOA 4MTDA 5JFRA 1XCVA 2VBXA 3HHHA 3B02A 1FSEA 2Y48A 4RGRA 4ZYDA 3K1MA 2ZJ2A 3ML6A 1BM9A 1AOYA 2QBYB 2H09A 2PQ8A 2Y0MA 2VC1A 4ESJA 4G7OF 4LB6B 1YW7A 3E97A 3RYRA 4B8XA 3NEUA 1BI0A 4ASNA 4L5IA 4HW0A 1IN4A 2R7DA 1FWZA 4YG2F 1BIBA 3LSTA 2GIVA 2FBHA 2W85A 3E5QA 3P9KA 1WRJA 2AS5F 2PLYA 2XKOA 3DKWA 1P4XA 1R36A 2D1VA 2M1BA 4ENMA 2EFWA 5ILSA 4OIRF 3T5XA 1MJBA 2YSRA 1Z6TA 1W7PD 3ZMSA 1U78A 1QBJA 4KMUX 1SAXA 3IKTA 4PGGA 2VT2A 3O6BB 1XDUA 4U0WA 1DDNA 1BJAA 3F23A 2FOKA 1IXRC 2KKOA 1Z05A 4ETSA 4EJWA 3K9TA 1H0MA 4DQ2A 2P7VB 4HA8A 4PCQA 4B09A 4L9NA 3BY6A 3GYHX 5CLSA 5FD6A 3BJOA 4L9JA 1HXDA 3FX3A 2CO5A 3MCZA 4UVCA 4JK1X 1S7AA 1IN8A 2WC2A 2M30A 2HR3A 2ZXJA 1TTYA 4U88A 4PDKA 4YIIA 1YW8A 1Y0UA 2RDPA 1G3WA 4WK8F 2PFBA 4UVAA 1XSVA 2XKPA 1SD7A 4HAMA 2VT3A 2DK8A 4CICA 2GAUA 2RVCA 4FX0A 1DPRA 3FXQA 5HLIA 2FRHA 1YIOA 3WTUC 4ZYEA 2MLKA 2ZCWA 3J81Z 5BPDA 2CWEA 3FMRA 2P5KA 3M8FA 3JSOA 1KYWA 4MGRA 4MNUA 2ZKZA 1QZYA 1J75A 2A68F 5A2QZ 5LHHA 3F22A 1U5TC 3ZMUA 1CF7A 2KJCA 4MQVA 2FXAA 2QQBA 5LLQA 2CYYA 1UB9A 2VONA 5KVRA 2GA1A 1J0RA 5DD4A 3F21A 4HBLA 1I27A 2OAZA 4I01A 2LKPA 2GA2A 4LFUA 1JHHA 4I98B 4I0AA 2NAZA 1PUEE 4JBAA 1XCBA 1UFMA 3F8MA 1MZBA 3ULQB 2YR2A 2ESNA 4PGHA 4UUVA 3CLOA 3R60A 1RNLA 2W84A 1R23A 2K4BA 4G6QA 4KNYA 4LGWA 3WTTC 2GWRA 5ILUA 3BP8A 1TQPA 3E6DA 2HGCA 2YPRA 1ZHFA 2RC4A 2X4HA 3JSPA 5JHUA 5JVTA 1RIOH 4WCGA 1Z6RA 3MWMA 4OMZA 3TOAA 1IXSB 3C3WA 4ZYGA 4TV7A 4OINF 4GXOA 2FNAA 2EA2A 1LNWA 2ISZA 1WWXA 4Y15A 4U0YA 3TO6A 1I5ZA 5E18F 4XLNF 5ICEA 1XSXA 1WI9A 4IXAA 1ZG3A 3PQJA 3VFZA 1B9MA 5DD8A 3ZMZA 4XSZF 4M73A 5F1RA 5LGNA 4P9UA 4LLLA 2R7FA 5FD5A 2M8EA 4AIJA 1KQ0A 2O03A 3GO5A 1ZREA 3VODA 2IA1A 1R5GA 1TQMA 1P4WA 5TRDA 5L3CA 2JT1A 2ZNZA 3QPTA 2GXBA 2BV6A 3NQOA 3FXUA 5ICGA 4GGGA 3DV8A 4HX8A 3ZPLA 2AXLA 4HDUA 1RUNA 2QUFA 5BPIA 2NNNA 3TOBA 3WG9A 2Q8KA 4BHCA 1H9GA 5CVUA 1F4KA 2RQPA 1T2KA 1FOKA 3B73A 2XROA 2PMUA 3DP7A 2JTVA 4RS8A 3HOTA 3L2CA 4A0YA 5A2QK 1TW2A 4L18B 1G3TA 2KIMA 1UCRA 1TBXA 1TLHB 2FNPA 5FO5A 4Q4ZF 2KIUA 4RB3C 3VOEA 1EH6A 4BXUA 4NQWA 4UV9A 4S05A 1G6NA 5CVIA 5CYVA 3HSFA 2EA4A 3WTZA 3BROA 4RGSA 4UHTA 3CO6C 5D6EA 3LWFA 4GO1A 4U7BA 3EYYA 5BMZA 5E1WA 3HTSB 1DPUA 3LFKA 5DUIA 3FF5A 2PEXA 4HQMA 2QM3A 5CVRA 3R6SA 2IVMA 2F2EA 3ZN0A 4A5MA 3V8KA 1O7LA 3SFZA 2H6CA 3FM3A 2FU4A 3GVAA 3R61A 3W6KB 2O6GE 5FLXK 2L4MA 1HW1A 3FZVA 1B9NA 5BQTA 4XRFA 1XMAA 3K1NA 3OV8A 5CJ9A 2DAOA 2K4JA 4RAYA 1UHMA 1E2XA 5HDKA 5LEJA 2HTJA 2XHKA 5KK1A 2STWA 2WWYA 5IT9Z 5D5XB 4U0VA 2XAFA 5DYMA 1FSHA 1R5HA 1R22A 3HOSA 2RNJA 4KMFA 3K1PA 2ZNYA 4G7HF 1ZG1A 2D45A 4YFKF 5D8KB 1IUYA 2K7LA 2QZ8A 2P6TA 2IW5A 2HEOA 2EV0A 5AIQA 5LRSA 3L9FA 4LD5A 2IA2A 4CO8A 2FE3A 2WV0A 3CUQB 2QBYA 5CVJA 1FP2A 4HQEA 1IW7F 2DQLA 2OBPA 1R1UA 5BS6A 1U5TB 4A12A 1K79A 1R00A 1P4AA 3LAPA 2W24A 2HDCA 3CJNA 1KGSA 5TJJA 3BZ6A 1IRGA 2G9WA 3KP3A 3IHUA 1D8JA 3M9AA 2HQNA 1J9IA 4GCVA 3K0LA 1PP8F 2VODA 3GEZA 3IRQA 3N97A 5LGTA 1AWCA 2V1XA 2K27A 1ZN2A 3OOPA 4M9XA 3R4KA 1K7AA 3TO7A 1QQIA 1CGPA 2EFOA 1ON2A 2XIGA 3WU1B 3SQNA 1YG2A 2NYXA 2A6HF 4ENKA 2HQRA 2DQRA 2YU3A 3EUHA 1XSDA 5F6FA 3E6BA 3IC7A 1K78A 2O0YA 3HRMA 3DPLC 4YFNF 2NNYA 3GFMA 2QQ9A 3BJ6A 3ZMVA 3KZYA 3ECHA 3T0YA 4FHTA 4KT5C 1BOAA 2FA5A 4KIGA 3T1BA 1IZ1A 1FYLA 3HSEA 3I4PA 1EH8A 2G7UA 5AONA 4EQQA 1YS7A 3KFWX 1J5YA 5FFZA 4LG0A 4KN7X 4XSXF 3J80Z 4WF2A 4BH9A 4AIKA 2IJLA 1IXCA 3C7JA 4M6XA 3JTHA 5DCFA 2IT0A 1BC8C 4KA4A 4RGXA 1NHAA 5HLHA 3DFGA 1FC3A 1HKQA 4FT8A 2ISYA 5ERIA 3J7AO 2RN7A 3BJAA 1ZARA 4HX7A 2RKHA 5CVVA 5DCMA 2V6CA 2LF8A 1ZRFA 3WTYC 5ICFA 2E1NA 2FQ3A 3V7RA 2FBKA 4BQAA 2OU2A 3VB2A 3IKVA 3M8EA 1T6SA 1H9TA 4ENNA 4CHUA 1LDJA 1YO5C 3EQLF 3L00A 4WX9A 4KN4X 4HV5A 4MHGA 2IA0A 2L01A 1ODDA 2JSCA 1HW2A 3WGIA 2EWNA 4OIQF 2V9VA 3DQVC 1PP7U 1BI1A 4GYIA 1T0FA 1G3YA 2XRNA 3CTAA 3GFIA 1B59A 4G94A 4KDPA 3RKYA 4PZJA 3EDPA 1MJ9A 1YYVA 2KRFA 2DFIA 2D2WA 1BN5A 1STZA 2V1DA 4EJVA 2F5DA 4EGYA 1FX7A 3I71A 3SHFA 2M87A 1ZG5A 4A6EA 3E6CC 2XUBA 3LQQA 3GWZA 5IT3A 4ZYHA 1MJAA 5E17F 1SFEA 3U9GA 2ELHA 1XMKA 5L3GA 2ZBKA 1FYMA 2OD5A 4F7ZA 3KCCA 4LLGF 2FEZA 2GZWA 2VBZA 3SZPA 1SFUA 1KU9A 1W5TA 3RKXA 2XASA 3KZZA 2HKOA 3I54A 2DI3A 3JAMK 2XAGA 1YLFA 3WTSC 3ZP5A 3RIRA 1IAWA 2ZMEB 2P5LC 4HLXA 3IWFA 2Z33A 2L3DA 3CUQA 4M74A 1S29A 2HYFA 3LA3A 1J2XA 3ABTA 3I64A 5LEKA 2GXGA 4LMYA 3V8LA 3HYIA 4N9HA 3K69A 5J8FA 2ZO4A 1D8KA 3MEXA 3JAMZ 5H20A 2RV8A 3SZTA 3L7WA 1YFHA 3F8BA 1HKTA 3GF2A 2A3SA 3E6MA 1LEBA 3I58A 1GXQA 2A5YB 3KEOA 3WE2A 1RI7A 3NRVA 4EVIA 1QPMA 1GHCA 5E20A 2QWWA 4WWCA 2D1HA 2F5CA 3WTXC 2JRTA 1FPQA 1XN7A 4OOIA 4H0EA 1LEAA 1IF1A 1OPCA 1YQAA 3QPHA 4WXDA 1KU7A 4IHTA 4HF0A 2K86A 1SMYF 2EFNA 2P8TA 2XAQA 5LRRA 4AWXB 3MQ0A 3ELKA 2DPDA 3HTUA 3HRUA 1HBXG 2ADUA 3ABUA 3WGGA 1E17A 4M9ZA 1OR7A 1C0WA 4AIHA 4HV6A 3KETA 4KIFA 4AVPA 1T98A 1OMIA 4K2EA 4LLNA 2W57A 4WXHA 2JPBA 2M5WA 3C1DA 2QVOA 2FMYA 4EV0A 3R0JA 2A6EF 5D8LB 2O8XA 5E1ZB 1REPC 3GZ5A 1O3SA 4M71A 1LB2A 2E1CA 2R3SA 4MQ9F 4CZZA 4N0BA 2CSOA 5D5WB 3TDZC 2L4AA 4LG0B 2EV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DW4 A;  2KJB A;  1V4R A;  1O3R A;  2VN2 A;  1QNT A;  5JR3 A;  2JPC A;  4A5N A;  1BIA A;  2A69 F;  5HS8 A;  3BOQ A;  3N4M A;  1XDS A;  1MD0 A;  4I2O A;  2Z3Y A;  3F8F A;  1FZP B;  3FMS A;  4G7Z F;  2P5V A;  4Y17 A;  1W4M A;  2DU9 A;  1MKM A;  1W7P B;  3FWE A;  4ON0 A;  3LAJ A;  2OZ6 A;  3ZMT A;  2L02 A;  1G4D A;  2C6Y A;  1IN6 A;  3CDH A;  5D5V B;  3P9C A;  4KIB A;  3JTG A;  4O3M A;  4YIF A;  3HHG A;  1JXS A;  4Z2Y A;  5DEQ A;  4LK0 F;  3RJP A;  3DF8 A;  1LQ1 A;  1WKM A;  4L9T A;  2BBY A;  4UNO A;  3PFI A;  1T38 A;  3U1D A;  4BYY A;  3Q9V A;  2MH2 A;  3H92 A;  4Q47 A;  4HX4 A;  3C18 A;  3TGN A;  4P96 A;  2G7H A;  2VBW A;  5EEG A;  3IWZ A;  1L3L A;  2ZME A;  3DPT A;  3F3X A;  4WXC A;  3U2R A;  5J6X A;  4P9F A;  2FSW A;  1OYW A;  3V7C A;  3ZN1 A;  2DLL A;  3GXO A;  5LHI A;  2HTS A;  3ERE D;  4M6Y A;  3F6V A;  3HSR A;  1O57 A;  1QGP A;  4HF2 A;  4YFX F;  1I1G A;  4NHJ A;  3T8T A;  5H6R A;  1XGN A;  1UST A;  1WSU A;  1QZZ A;  4XLP F;  4EM0 B;  2HZT A;  3COA C;  4IPA A;  1ZH5 A;  1P92 A;  1L0O C;  5ILV A;  3QOP A;  5D4R A;  2HFH A;  3LA7 A;  3HIF A;  1BI3 A;  1SD4 A;  2CG4 A;  2ESH A;  3FXR A;  2DT5 A;  4QLC U;  4A0X A;  4R79 A;  4EMS A;  2V1U A;  1FY7 A;  5DV5 A;  1HQC A;  4HYE A;  5LBQ A;  1F5T A;  2BYV E;  1F9N A;  4L0Z B;  3F8N A;  3DXJ F;  2ZFW A;  1ONV A;  2P7C B;  5K5Q A;  5IT9 K;  3QP6 A;  1LDK B;  1OYI A;  4ENJ A;  3H3Z A;  3CUO A;  3KP5 A;  5L3F A;  1D5V A;  4OMY A;  1FBU A;  2VE9 A;  4RGU A;  3V4G A;  4LJZ F;  2CQK A;  3KP6 A;  1O7F A;  2LSO A;  3ZMD A;  5FLX Z;  2RGV A;  1S3J A;  4A2U A;  3BPV A;  4EM1 A;  3SXY A;  4A0Z A;  4A6D A;  2HOE A;  2UXN A;  5E8G A;  3MZY A;  3I5U A;  4D0P A;  2ZME C;  2J5P A;  3V8J A;  2MLG A;  3KP7 A;  2ETH A;  1LVA A;  1ZYR F;  2VE8 A;  1G3S A;  3REO A;  2QYO A;  2VOO A;  4EJT A;  1TNS A;  2QEN A;  4BAY A;  4L0Y B;  3HRT A;  1Q1H A;  1I1S A;  4JQF A;  4MEY F;  1ZRD A;  3V7S A;  2O3F A;  1TQI A;  1Z9C A;  4OIP F;  2DPU A;  3EET A;  4P55 A;  3O3K A;  3ZQ7 A;  3GZ6 A;  2FF4 A;  2XVC A;  4L9V A;  3TDU C;  1HSJ A;  3F72 A;  4N9I A;  1ON1 A;  3R0A A;  5AIP A;  4OIO F;  1HKS A;  1VTN C;  1MDM B;  2XV4 S;  2HYG D;  5E1X A;  1F1Z A;  4P5O A;  3QRF F;  1FP1 D;  1LDD A;  1I6X A;  2DTR A;  1KA8 A;  4G6D A;  2Q0O A;  1R1V A;  3P9I A;  1S7O A;  1ZGA A;  2DK5 A;  1PDN C;  5HDN A;  3MFK A;  1P2F A;  4G8X A;  3T8R A;  2NRA C;  3GLX A;  4BHP A;  4RB1 A;  3FHZ A;  3QAH A;  3WTV C;  1K6O A;  3FM5 A;  1XGS A;  5HS9 A;  3VEP A;  4CYD A;  4ZH4 F;  1X3U A;  3KLN A;  2Z5U A;  4UV8 A;  4L5J A;  1RZ4 A;  2PN6 A;  3P7N A;  1FNN A;  3ROU A;  3DEU A;  2E7W A;  1CF7 B;  2Z99 A;  2H27 A;  3GX4 X;  4HOB A;  3RI4 A;  4ZZL A;  1ZGJ A;  4HF1 A;  4IVN A;  1ZRC A;  3Q9S A;  2OA4 A;  4KIC A;  2IRF G;  4G9Y A;  5D4S A;  5K5O A;  6PAX A;  2JZY A;  2ACJ A;  2M45 A;  3GFL A;  1Z7U A;  3I53 A;  3RPQ A;  1BC7 C;  5LHG A;  5HS7 A;  3WOD F;  1ZLJ A;  1SMT A;  2EB7 A;  1IRF A;  3HUG A;  1JGS A;  2NS0 A;  3QU3 A;  3KP2 A;  1TNT A;  1KU2 A;  2EFQ A;  3F8C A;  3RDI A;  2PBI A;  3I59 A;  3L09 A;  3QU6 A;  2H6B A;  2W25 A;  4KFC A;  2DO7 A;  3I59 B;  2MA3 A;  3KE2 A;  2QLZ A;  4LK1 F;  4BNC A;  3IRR A;  1MGT A;  5DDG A;  4XBF A;  1W5S A;  5JI6 A;  1YTY A;  2PI0 A;  4IRG A;  1KQ8 A;  5BOX A;  1GVJ A;  2EK5 A;  3WU0 A;  4U7D A;  3TO9 A;  5DUK A;  4CGZ A;  2J5O A;  1Z1D A;  2HS5 A;  4EM2 A;  4HZF A;  3FMQ A;  4IRI A;  2LF7 A;  3HRS A;  2EJR A;  2L54 A;  1Z91 A;  3LQR A;  2H94 A;  3WGH A;  2VBY A;  2UZK A;  3KP4 A;  3BPX A;  4EJO A;  3BDD A;  1IN5 A;  2HWV A;  2MH9 A;  3O2P E;  1U3E M;  2FML A;  3AAF A;  2QQA A;  2EV6 A;  4UXN A;  4S04 A;  2CGP A;  3M1E A;  4HDV A;  1B1B A;  3RTR A;  2CFX A;  1LJ9 A;  1W7P A;  4E70 A;  2OQG A;  2KIF A;  1GXP A;  2DBB A;  1JHF A;  1ZLK A;  4EJU A;  1MDM A;  2PMH A;  1USS A;  1XD7 A;  2TDX A;  4EGZ A;  2F5F A;  1FYK A;  3J81 K;  5EEH A;  4O6J A;  2UXX A;  1ZAO A;  4KYW A;  3D5L A;  2BEO A;  2XAJ A;  5L3B A;  3KLO A;  2K02 A;  2HKX A;  5H6Q A;  1OKR A;  3JW4 A;  4RAZ A;  3CUQ C;  4NB5 A;  3EYI A;  4ESF A;  4IJA A;  4OU0 A;  2V79 A;  2YX7 A;  3E5U A;  3E5X A;  1J59 A;  2A07 F;  3W6J B;  2P4W A;  1QO0 D;  1SD5 A;  2YX4 A;  3RPU A;  3LA2 A;  1R1T A;  5LGU A;  3RKW A;  2LDU A;  1UHW A;  5D5U B;  1DP7 P;  2FBI A;  2A61 A;  2OQR A;  1R7J A;  4I02 A;  2F5E A;  2XGX A;  2Z9O A;  4UVB A;  2MD5 A;  3WE3 A;  2Q2E A;  4KUM A;  5HDG A;  3H3U A;  3WTW C;  1RUO A;  1EH7 A;  1KU3 A;  2IP2 A;  1B6A A;  4CXF A;  1U6G A;  1ULY A;  3BWG A;  3QP5 A;  3G73 A;  2STT A;  5F64 A;  1K78 B;  1J7K A;  2E7X A;  3TQN A;  2WTE A;  1S6L A;  4M9S A;  4MEX F;  1BI2 A;  4ZZD A;  4QWQ A;  1KYZ A;  5L3E A;  5J8C A;  1FBS A;  2Y75 A;  3MZH A;  3S2W A;  2PJP A;  4I7H A;  4Y13 A;  4CDG A;  4I09 A;  5ICC A;  5HLG A;  2VOP A;  1SFX A;  4I0B A;  5K1Y A;  1XB4 A;  4RB2 C;  4R8H A;  4LB5 A;  1OYY A;  1IN7 A;  1EV7 A;  2P6S A;  2COM A;  3Q5F A;  1R58 A;  4DNC A;  3M7G A;  1P6R A;  2VC0 A;  4O5V A;  3PQK A;  1XGM A;  1TW3 A;  5K5R A;  1O3T A;  1KQ9 A;  2OZU A;  1D3Y A;  1FLI A;  2MBF A;  4MTE A;  3IL2 A;  2O61 A;  1U5T A;  4AD9 A;  4RB0 A;  4GYG A;  4IHS A;  1A04 A;  2VXZ A;  3ECO A;  4Q5S F;  2X0L A;  1JE8 A;  2XAH A;  3J80 K;  3G3Z A;  4BHB A;  2EFP A;  3D0S A;  1HW5 A;  2MC3 A;  1U8R A;  5HOO A;  3GW2 A;  1FBQ A;  3CO7 C;  3TKY A;  1SD6 A;  4HLY A;  5E8I A;  2GQQ A;  5FGM A;  3K2Z A;  2UWM A;  4ESB A;  3GFJ A;  1U2W A;  2IPQ X;  5ED4 A;  3MAJ A;  3E3V A;  1S8N A;  4M72 A;  3F6O A;  3I0T A;  1BBY A;  5FFX A;  3KEQ A;  1YW9 A;  1YS6 A;  4R1H A;  2BE5 F;  5DCM B;  1V3F A;  1WQ2 A;  1HST A;  2LNB A;  5L3D A;  3GUD A;  4IRH A;  1B4A A;  2BGC A;  2PG4 A;  4Q48 A;  2CW0 F;  2B0L A;  4FX4 A;  5D6F A;  1T39 A;  5HVQ C;  3RYP A;  1DUX C;  4IF4 A;  1FT9 A;  1O3Q A;  5FB2 A;  3ISP A;  1XGO A;  4MTD A;  5JFR A;  1XCV A;  2VBX A;  3HHH A;  3B02 A;  1FSE A;  2Y48 A;  4RGR A;  4ZYD A;  3K1M A;  2ZJ2 A;  3ML6 A;  1BM9 A;  1AOY A;  2QBY B;  2H09 A;  2PQ8 A;  2Y0M A;  2VC1 A;  4ESJ A;  4G7O F;  4LB6 B;  1YW7 A;  3E97 A;  3RYR A;  4B8X A;  3NEU A;  1BI0 A;  4ASN A;  4L5I A;  4HW0 A;  1IN4 A;  2R7D A;  1FWZ A;  4YG2 F;  1BIB A;  3LST A;  2GIV A;  2FBH A;  2W85 A;  3E5Q A;  3P9K A;  1WRJ A;  2AS5 F;  2PLY A;  2XKO A;  3DKW A;  1P4X A;  1R36 A;  2D1V A;  2M1B A;  4ENM A;  2EFW A;  5ILS A;  4OIR F;  3T5X A;  1MJB A;  2YSR A;  1Z6T A;  1W7P D;  3ZMS A;  1U78 A;  1QBJ A;  4KMU X;  1SAX A;  3IKT A;  4PGG A;  2VT2 A;  3O6B B;  1XDU A;  4U0W A;  1DDN A;  1BJA A;  3F23 A;  2FOK A;  1IXR C;  2KKO A;  1Z05 A;  4ETS A;  4EJW A;  3K9T A;  1H0M A;  4DQ2 A;  2P7V B;  4HA8 A;  4PCQ A;  4B09 A;  4L9N A;  3BY6 A;  3GYH X;  5CLS A;  5FD6 A;  3BJO A;  4L9J A;  1HXD A;  3FX3 A;  2CO5 A;  3MCZ A;  4UVC A;  4JK1 X;  1S7A A;  1IN8 A;  2WC2 A;  2M30 A;  2HR3 A;  2ZXJ A;  1TTY A;  4U88 A;  4PDK A;  4YII A;  1YW8 A;  1Y0U A;  2RDP A;  1G3W A;  4WK8 F;  2PFB A;  4UVA A;  1XSV A;  2XKP A;  1SD7 A;  4HAM A;  2VT3 A;  2DK8 A;  4CIC A;  2GAU A;  2RVC A;  4FX0 A;  1DPR A;  3FXQ A;  5HLI A;  2FRH A;  1YIO A;  3WTU C;  4ZYE A;  2MLK A;  2ZCW A;  3J81 Z;  5BPD A;  2CWE A;  3FMR A;  2P5K A;  3M8F A;  3JSO A;  1KYW A;  4MGR A;  4MNU A;  2ZKZ A;  1QZY A;  1J75 A;  2A68 F;  5A2Q Z;  5LHH A;  3F22 A;  1U5T C;  3ZMU A;  1CF7 A;  2KJC A;  4MQV A;  2FXA A;  2QQB A;  5LLQ A;  2CYY A;  1UB9 A;  2VON A;  5KVR A;  2GA1 A;  1J0R A;  5DD4 A;  3F21 A;  4HBL A;  1I27 A;  2OAZ A;  4I01 A;  2LKP A;  2GA2 A;  4LFU A;  1JHH A;  4I98 B;  4I0A A;  2NAZ A;  1PUE E;  4JBA A;  1XCB A;  1UFM A;  3F8M A;  1MZB A;  3ULQ B;  2YR2 A;  2ESN A;  4PGH A;  4UUV A;  3CLO A;  3R60 A;  1RNL A;  2W84 A;  1R23 A;  2K4B A;  4G6Q A;  4KNY A;  4LGW A;  3WTT C;  2GWR A;  5ILU A;  3BP8 A;  1TQP A;  3E6D A;  2HGC A;  2YPR A;  1ZHF A;  2RC4 A;  2X4H A;  3JSP A;  5JHU A;  5JVT A;  1RIO H;  4WCG A;  1Z6R A;  3MWM A;  4OMZ A;  3TOA A;  1IXS B;  3C3W A;  4ZYG A;  4TV7 A;  4OIN F;  4GXO A;  2FNA A;  2EA2 A;  1LNW A;  2ISZ A;  1WWX A;  4Y15 A;  4U0Y A;  3TO6 A;  1I5Z A;  5E18 F;  4XLN F;  5ICE A;  1XSX A;  1WI9 A;  4IXA A;  1ZG3 A;  3PQJ A;  3VFZ A;  1B9M A;  5DD8 A;  3ZMZ A;  4XSZ F;  4M73 A;  5F1R A;  5LGN A;  4P9U A;  4LLL A;  2R7F A;  5FD5 A;  2M8E A;  4AIJ A;  1KQ0 A;  2O03 A;  3GO5 A;  1ZRE A;  3VOD A;  2IA1 A;  1R5G A;  1TQM A;  1P4W A;  5TRD A;  5L3C A;  2JT1 A;  2ZNZ A;  3QPT A;  2GXB A;  2BV6 A;  3NQO A;  3FXU A;  5ICG A;  4GGG A;  3DV8 A;  4HX8 A;  3ZPL A;  2AXL A;  4HDU A;  1RUN A;  2QUF A;  5BPI A;  2NNN A;  3TOB A;  3WG9 A;  2Q8K A;  4BHC A;  1H9G A;  5CVU A;  1F4K A;  2RQP A;  1T2K A;  1FOK A;  3B73 A;  2XRO A;  2PMU A;  3DP7 A;  2JTV A;  4RS8 A;  3HOT A;  3L2C A;  4A0Y A;  5A2Q K;  1TW2 A;  4L18 B;  1G3T A;  2KIM A;  1UCR A;  1TBX A;  1TLH B;  2FNP A;  5FO5 A;  4Q4Z F;  2KIU A;  4RB3 C;  3VOE A;  1EH6 A;  4BXU A;  4NQW A;  4UV9 A;  4S05 A;  1G6N A;  5CVI A;  5CYV A;  3HSF A;  2EA4 A;  3WTZ A;  3BRO A;  4RGS A;  4UHT A;  3CO6 C;  5D6E A;  3LWF A;  4GO1 A;  4U7B A;  3EYY A;  5BMZ A;  5E1W A;  3HTS B;  1DPU A;  3LFK A;  5DUI A;  3FF5 A;  2PEX A;  4HQM A;  2QM3 A;  5CVR A;  3R6S A;  2IVM A;  2F2E A;  3ZN0 A;  4A5M A;  3V8K A;  1O7L A;  3SFZ A;  2H6C A;  3FM3 A;  2FU4 A;  3GVA A;  3R61 A;  3W6K B;  2O6G E;  5FLX K;  2L4M A;  1HW1 A;  3FZV A;  1B9N A;  5BQT A;  4XRF A;  1XMA A;  3K1N A;  3OV8 A;  5CJ9 A;  2DAO A;  2K4J A;  4RAY A;  1UHM A;  1E2X A;  5HDK A;  5LEJ A;  2HTJ A;  2XHK A;  5KK1 A;  2STW A;  2WWY A;  5IT9 Z;  5D5X B;  4U0V A;  2XAF A;  5DYM A;  1FSH A;  1R5H A;  1R22 A;  3HOS A;  2RNJ A;  4KMF A;  3K1P A;  2ZNY A;  4G7H F;  1ZG1 A;  2D45 A;  4YFK F;  5D8K B;  1IUY A;  2K7L A;  2QZ8 A;  2P6T A;  2IW5 A;  2HEO A;  2EV0 A;  5AIQ A;  5LRS A;  3L9F A;  4LD5 A;  2IA2 A;  4CO8 A;  2FE3 A;  2WV0 A;  3CUQ B;  2QBY A;  5CVJ A;  1FP2 A;  4HQE A;  1IW7 F;  2DQL A;  2OBP A;  1R1U A;  5BS6 A;  1U5T B;  4A12 A;  1K79 A;  1R00 A;  1P4A A;  3LAP A;  2W24 A;  2HDC A;  3CJN A;  1KGS A;  5TJJ A;  3BZ6 A;  1IRG A;  2G9W A;  3KP3 A;  3IHU A;  1D8J A;  3M9A A;  2HQN A;  1J9I A;  4GCV A;  3K0L A;  1PP8 F;  2VOD A;  3GEZ A;  3IRQ A;  3N97 A;  5LGT A;  1AWC A;  2V1X A;  2K27 A;  1ZN2 A;  3OOP A;  4M9X A;  3R4K A;  1K7A A;  3TO7 A;  1QQI A;  1CGP A;  2EFO A;  1ON2 A;  2XIG A;  3WU1 B;  3SQN A;  1YG2 A;  2NYX A;  2A6H F;  4ENK A;  2HQR A;  2DQR A;  2YU3 A;  3EUH A;  1XSD A;  5F6F A;  3E6B A;  3IC7 A;  1K78 A;  2O0Y A;  3HRM A;  3DPL C;  4YFN F;  2NNY A;  3GFM A;  2QQ9 A;  3BJ6 A;  3ZMV A;  3KZY A;  3ECH A;  3T0Y A;  4FHT A;  4KT5 C;  1BOA A;  2FA5 A;  4KIG A;  3T1B A;  1IZ1 A;  1FYL A;  3HSE A;  3I4P A;  1EH8 A;  2G7U A;  5AON A;  4EQQ A;  1YS7 A;  3KFW X;  1J5Y A;  5FFZ A;  4LG0 A;  4KN7 X;  4XSX F;  3J80 Z;  4WF2 A;  4BH9 A;  4AIK A;  2IJL A;  1IXC A;  3C7J A;  4M6X A;  3JTH A;  5DCF A;  2IT0 A;  1BC8 C;  4KA4 A;  4RGX A;  1NHA A;  5HLH A;  3DFG A;  1FC3 A;  1HKQ A;  4FT8 A;  2ISY A;  5ERI A;  3J7A O;  2RN7 A;  3BJA A;  1ZAR A;  4HX7 A;  2RKH A;  5CVV A;  5DCM A;  2V6C A;  2LF8 A;  1ZRF A;  3WTY C;  5ICF A;  2E1N A;  2FQ3 A;  3V7R A;  2FBK A;  4BQA A;  2OU2 A;  3VB2 A;  3IKV A;  3M8E A;  1T6S A;  1H9T A;  4ENN A;  4CHU A;  1LDJ A;  1YO5 C;  3EQL F;  3L00 A;  4WX9 A;  4KN4 X;  4HV5 A;  4MHG A;  2IA0 A;  2L01 A;  1ODD A;  2JSC A;  1HW2 A;  3WGI A;  2EWN A;  4OIQ F;  2V9V A;  3DQV C;  1PP7 U;  1BI1 A;  4GYI A;  1T0F A;  1G3Y A;  2XRN A;  3CTA A;  3GFI A;  1B59 A;  4G94 A;  4KDP A;  3RKY A;  4PZJ A;  3EDP A;  1MJ9 A;  1YYV A;  2KRF A;  2DFI A;  2D2W A;  1BN5 A;  1STZ A;  2V1D A;  4EJV A;  2F5D A;  4EGY A;  1FX7 A;  3I71 A;  3SHF A;  2M87 A;  1ZG5 A;  4A6E A;  3E6C C;  2XUB A;  3LQQ A;  3GWZ A;  5IT3 A;  4ZYH A;  1MJA A;  5E17 F;  1SFE A;  3U9G A;  2ELH A;  1XMK A;  5L3G A;  2ZBK A;  1FYM A;  2OD5 A;  4F7Z A;  3KCC A;  4LLG F;  2FEZ A;  2GZW A;  2VBZ A;  3SZP A;  1SFU A;  1KU9 A;  1W5T A;  3RKX A;  2XAS A;  3KZZ A;  2HKO A;  3I54 A;  2DI3 A;  3JAM K;  2XAG A;  1YLF A;  3WTS C;  3ZP5 A;  3RIR A;  1IAW A;  2ZME B;  2P5L C;  4HLX A;  3IWF A;  2Z33 A;  2L3D A;  3CUQ A;  4M74 A;  1S29 A;  2HYF A;  3LA3 A;  1J2X A;  3ABT A;  3I64 A;  5LEK A;  2GXG A;  4LMY A;  3V8L A;  3HYI A;  4N9H A;  3K69 A;  5J8F A;  2ZO4 A;  1D8K A;  3MEX A;  3JAM Z;  5H20 A;  2RV8 A;  3SZT A;  3L7W A;  1YFH A;  3F8B A;  1HKT A;  3GF2 A;  2A3S A;  3E6M A;  1LEB A;  3I58 A;  1GXQ A;  2A5Y B;  3KEO A;  3WE2 A;  1RI7 A;  3NRV A;  4EVI A;  1QPM A;  1GHC A;  5E20 A;  2QWW A;  4WWC A;  2D1H A;  2F5C A;  3WTX C;  2JRT A;  1FPQ A;  1XN7 A;  4OOI A;  4H0E A;  1LEA A;  1IF1 A;  1OPC A;  1YQA A;  3QPH A;  4WXD A;  1KU7 A;  4IHT A;  4HF0 A;  2K86 A;  1SMY F;  2EFN A;  2P8T A;  2XAQ A;  5LRR A;  4AWX B;  3MQ0 A;  3ELK A;  2DPD A;  3HTU A;  3HRU A;  1HBX G;  2ADU A;  3ABU A;  3WGG A;  1E17 A;  4M9Z A;  1OR7 A;  1C0W A;  4AIH A;  4HV6 A;  3KET A;  4KIF A;  4AVP A;  1T98 A;  1OMI A;  4K2E A;  4LLN A;  2W57 A;  4WXH A;  2JPB A;  2M5W A;  3C1D A;  2QVO A;  2FMY A;  4EV0 A;  3R0J A;  2A6E F;  5D8L B;  2O8X A;  5E1Z B;  1REP C;  3GZ5 A;  1O3S A;  4M71 A;  1LB2 A;  2E1C A;  2R3S A;  4MQ9 F;  4CZZ A;  4N0B A;  2CSO A;  5D5W B;  3TDZ C;  2L4A A;  4LG0 B;  2EV5 A; 
#chains in the Genus database with same CATH topology
 2YUS A;  3BZC A;  2DW4 A;  3WU2 C;  1LFU P;  2KJB A;  5J3L A;  1V4R A;  3W2W A;  1O3R A;  3SEQ A;  2CV2 A;  2VN2 A;  2QSH X;  1QNT A;  1E3O C;  5LFA A;  5JR3 A;  1A31 A;  3SYT A;  2JPC A;  4QTR A;  4A5N A;  2BHY A;  1BIA A;  1LQ1 A;  2A69 F;  2OC6 A;  5HS8 A;  3BOQ A;  1N25 A;  5F0C A;  1D5Y A;  1HLV A;  4L5E A;  3N4M A;  4B47 A;  1XDS A;  1XPX A;  1MD0 A;  4MIM A;  3IAS 2;  4I2O A;  2Z3Y A;  3F8F A;  4II3 A;  1Y1V J;  3UNG C;  3BR5 A;  4BJ5 C;  1FZP B;  3FMS A;  4G7Z F;  4A3B J;  2LH9 A;  3K4B A;  3OIP A;  1YIJ I;  2P5V A;  4Y17 A;  1W4M A;  2K9L A;  2DU9 A;  3JRF A;  2A05 A;  1MKM A;  1W7P B;  3FWE A;  3MD2 A;  4ON0 A;  3JRD A;  3LAJ A;  3I4M J;  2OZ6 A;  2M3A A;  3DBL B;  3ZMT A;  1ETX A;  2L02 A;  2RQQ A;  1G4D A;  2BXZ A;  4PJN A;  2W1O A;  2C6Y A;  1IN6 A;  4BQN A;  2VJJ A;  4LIV A;  2Y0S N;  3BCB A;  2ID3 A;  3CDH A;  4BE0 A;  5D5V B;  3P9C A;  4KIB A;  1HOM A;  1WZ2 A;  2K9Q A;  3JTG A;  4O3M A;  4E7S A;  4YIF A;  2XC7 A;  2GBY A;  5B66 C;  1ETO A;  2DMP A;  3OOU A;  4GRI A;  3PNY A;  3HHG A;  2R5Y A;  1JXS A;  2VL8 A;  2XGC A;  2JJ7 A;  1ETW A;  2V7F A;  2E1O A;  4Z2Y A;  1T33 A;  2HQ5 A;  1A36 A;  5DEQ A;  4LK0 F;  3NAR A;  3RJP A;  3DF8 A;  3L2V A;  3UKG A;  1JTY A;  2BZT A;  3A4C A;  5F0F A;  1WKM A;  3RZD J;  2OPT A;  4L9T A;  1R9T J;  2BBY A;  4UNO A;  1P7I A;  1RR8 C;  3AKZ A;  1MND A;  3PFI A;  4V2F A;  1T38 A;  1V5E A;  2X85 A;  3U1D A;  4BYY A;  3Q9V A;  2MH2 A;  3H92 A;  1XG1 A;  4Q47 A;  3J7Y J;  4HX4 A;  3C18 A;  4XM3 A;  3TGN A;  3CCS I;  1VQ6 I;  1Z7L A;  3C2B A;  3CJR B;  2G7H A;  4P96 A;  2VBW A;  2DJI A;  5FLV A;  3CF2 A;  5EEG A;  1W1W E;  3IWZ A;  1L3L A;  2ZME A;  4ZTF A;  2XPV A;  2EZL A;  3DPT A;  1HA8 A;  2KRH A;  3F3X A;  1Y6I A;  5IP7 J;  3HEF A;  4YIR X;  4ZDL A;  2AQE A;  4WXC A;  2M0M A;  3OYL A;  3U2R A;  5J6X A;  4P9F A;  2FSW A;  1OYW A;  3V7C A;  3ZN1 A;  2DLL A;  3GXO A;  5LHI A;  2HTS A;  3ERE D;  3HBL A;  3HKZ A;  4M6Y A;  4KIT B;  4XKW A;  2JSP A;  3F6V A;  3HSR A;  5C3E J;  1O57 A;  1QGP A;  2VPR A;  2JWT A;  4Y3O A;  4HF2 A;  4YFX F;  1I1G A;  1U9O A;  4XR6 A;  2LOO A;  3OIO A;  1DU0 A;  4NHJ A;  2DOA A;  3T8T A;  2DA3 A;  2CW8 A;  3BCA A;  3K4J A;  3DTK A;  5H6R A;  4IHY A;  2LTP A;  1XGN A;  2K5C A;  1AKH A;  1UST A;  1WSU A;  1QZZ A;  4XLP F;  4EM0 B;  2QCO A;  4BGD A;  1GT0 C;  4CCK A;  1SAU A;  2HZT A;  1ERD A;  3COA C;  4C3J J;  4IPA A;  1NG7 A;  1ZH5 A;  2VB6 A;  2FX0 A;  2DA7 A;  1JUP A;  1A5J A;  2I10 A;  1P92 A;  1L0O C;  1MIJ A;  3VYS B;  5ILV A;  4UB8 C;  3QOP A;  2CMP A;  5D4R A;  4XON A;  2HFH A;  3LA7 A;  2BW3 B;  1GVD A;  3HIF A;  1BI3 A;  1SD4 A;  1U9N A;  4PJL A;  2CG4 A;  2ESH A;  3FXR A;  2DT5 A;  1JKQ C;  2OF7 A;  4AID A;  4QLC U;  3IH4 A;  4A0X A;  2BY2 A;  4R79 A;  4EEF G;  2P0W A;  1PVE A;  3OIQ A;  2L9N A;  4C2T A;  4EMS A;  2R7W A;  3JR9 A;  5IP9 J;  2V1U A;  2KDO A;  5H2F C;  1FY7 A;  4BL0 B;  1D0Y A;  5DV5 A;  1HQC A;  3H9G A;  1MNM C;  4HYE A;  1YE9 A;  4S0H B;  5LBQ A;  1F5T A;  2BYV E;  2FOW A;  4CUG A;  2OCC H;  4D9J A;  1W0T A;  1F9N A;  2EIL H;  2W82 A;  4L0Z B;  1WHU A;  1JKO C;  1YHQ I;  1DQU A;  3F8N A;  4ZDO A;  4YRV A;  3DXJ F;  2ZFW A;  4CCL A;  2VJ4 A;  3KYC B;  1ONV A;  2UV1 A;  2P7C B;  5K5Q A;  2BY3 A;  2EZK A;  5IT9 K;  3QP6 A;  1LDK B;  1OYI A;  2E36 A;  3CCQ I;  2WAE A;  4W97 A;  3JRE A;  4BAC A;  4ENJ A;  5E3L A;  3H3Z A;  3CUO A;  3KP5 A;  3BR0 A;  5L3F A;  1D5V A;  4BDY A;  3Q3S A;  4OMY A;  1FBU A;  2VE9 A;  1Z3Y A;  4RGU A;  3V4G A;  3CME I;  3CC7 I;  2JA6 J;  1D1C A;  1SVL A;  4DOZ A;  3BG9 A;  3KEY A;  4LJZ F;  2CQK A;  3KP6 A;  1PUF A;  5EJC A;  2JUG A;  4IO9 F;  5FRN A;  1DU6 A;  2VKD A;  1O7F A;  4XL9 A;  2LSO A;  2K3F A;  2CUF A;  3CMY A;  2VUM J;  4HRI A;  2A6T A;  5F04 A;  3ZMD A;  1FEX A;  5FLX Z;  3A01 A;  5EZH A;  2RGV A;  1R4N B;  1S3J A;  2MYS A;  2Z16 A;  1VQ5 I;  1UMQ A;  4A2U A;  2P81 A;  1MBJ A;  3BPV A;  4EM1 A;  3SXY A;  4A0Z A;  4A6D A;  2HOE A;  2UXN A;  3HDD A;  5E8G A;  4MO7 A;  3MZY A;  3DPU A;  3I5U A;  4D0P A;  2ZME C;  2J5P A;  2R7U A;  3V8J A;  1OCZ H;  5M5W J;  2MLG A;  3KP7 A;  2Y9Y A;  2ETH A;  3QPL A;  1LVA A;  1ZYR F;  2VE8 A;  1G3S A;  3REO A;  2QYO A;  2VOO A;  1IUF A;  4EJT A;  1TNS A;  2Y30 A;  2QEN A;  4BAY A;  1ZR4 A;  4L0Y B;  3PSF A;  4HNU A;  3HRT A;  2L9V A;  1Q1H A;  3K4K A;  3DTE A;  2EQR A;  3GTJ J;  1VQ8 I;  1I1S A;  4JQF A;  4MEY F;  3ZQI A;  2TCT A;  1ZRD A;  3J7A Y;  1IDZ A;  3V7S A;  2O3F A;  2M7B A;  1TQI A;  3NWS A;  1Z9C A;  4JX6 A;  4IQJ A;  4OIP F;  2R92 J;  4XMY A;  5K7F A;  4BJT A;  5IYC J;  2XB5 A;  2DPU A;  4E7I A;  3EET A;  4P55 A;  1OCR H;  2Y69 H;  3O3K A;  3ZQ7 A;  4XKC A;  3GZ6 A;  3A0H C;  3MKW B;  2FF4 A;  2XVC A;  4BEH A;  5K7Z A;  4L9V A;  4PJJ A;  5J4V A;  4KJZ A;  3TDU C;  2LC2 A;  1HSJ A;  2YU9 J;  4DW6 A;  3OMY A;  3F72 A;  2DMQ A;  1ON1 A;  4N9I A;  2Y9Z A;  1VQN I;  3R0A A;  3CCY A;  2WV1 A;  3BTL A;  2FUG 2;  1X2M A;  5AIP A;  4OIO F;  4XOP A;  1HKS A;  1VTN C;  1MDM B;  2XV4 S;  4XQF A;  1JTX A;  2HYG D;  5E1X A;  1F1Z A;  4P5O A;  3M1C A;  3QRF F;  2VPL A;  1FP1 D;  1LDD A;  4RAF A;  1I6X A;  2KIS A;  2DTR A;  2CS3 A;  2MG4 A;  1KA8 A;  4G6D A;  2Q0O A;  1R1V A;  2F6C A;  1PJR A;  3P9I A;  1S7O A;  3E1S A;  4BE1 A;  5C4X J;  1ZGA A;  4BY1 J;  2DK5 A;  1PDN C;  5HDN A;  3FBI B;  3MFK A;  2HI3 A;  1ENH A;  5DM7 F;  4FCY A;  5E3O A;  1P2F A;  4G8X A;  3T8R A;  2NRA C;  2WBM A;  3GLX A;  1SC7 A;  4BHP A;  1LFB A;  4RB1 A;  3FHZ A;  3S3N A;  3LMM A;  4A3F J;  3QAH A;  4A3E J;  3WTV C;  1K6O A;  3J7Z I;  3FM5 A;  1XGS A;  5HS9 A;  3VEP A;  4CYD A;  3MVP A;  4ZH4 F;  1X3U A;  3KLN A;  1RKW A;  2Z5U A;  4XN3 A;  4A3D J;  1OCP A;  4UV8 A;  5CPR B;  1QRY A;  4L5J A;  1RZ4 A;  2PN6 A;  2XAU A;  1WJC A;  3P7N A;  1FNN A;  2I5U A;  3ROU A;  1RKT A;  1JUM A;  2JA2 A;  3DEU A;  2E7W A;  1CF7 B;  2Z99 A;  1A6I A;  1MBF A;  3GX4 X;  2H27 A;  4HOB A;  3OYF A;  1EF4 A;  3RI4 A;  4ZZL A;  4A3G J;  1ZGJ A;  2XPU A;  4RMN A;  4DYR A;  4HF1 A;  4IVN A;  1ZRC A;  3Q9S A;  2OA4 A;  3TL4 X;  4KIC A;  1MBG A;  2ZC2 A;  4AUX A;  4E7H A;  3JRB A;  1NH3 A;  4G9Y A;  2IRF G;  2LY9 A;  2K9M A;  1YJ9 I;  1B72 A;  3CCV I;  4XLC A;  4BXX J;  4AVZ A;  1YRN B;  3K4M A;  1HC8 A;  5D4S A;  5K5O A;  2JQ7 A;  6PAX A;  2VQH A;  2JZY A;  2ACJ A;  3PNV A;  2M45 A;  3GFL A;  1I3A A;  2EH3 A;  2BY0 A;  2WAD A;  1Z7U A;  3I53 A;  3RPQ A;  2TRT A;  1BC7 C;  5LHG A;  5HS7 A;  3WOD F;  2CUZ A;  4PFP A;  1Z67 A;  1ZLJ A;  2LKS A;  1SMT A;  2EB7 A;  1RES A;  1IRF A;  3HUG A;  1JGS A;  2NS0 A;  3QU3 A;  3KP2 A;  1JJ6 C;  1TNT A;  1KU2 A;  1FOY A;  4A69 C;  2EFQ A;  3F8C A;  5FRM A;  2MAB A;  3RDI A;  3TW6 A;  2PBI A;  3I59 A;  3L09 A;  3QU6 A;  2H6B A;  1K4T A;  1GUU A;  2ZXW H;  3RKQ A;  2GOX B;  4HST A;  1W0U A;  2R7O A;  3CF5 F;  2DYS H;  1VND A;  4ZDP A;  2NXN B;  2W25 A;  2F4I A;  4KFC A;  4F3Q A;  2DO7 A;  3I59 B;  2MA3 A;  1MBH A;  2VI6 A;  3HC7 A;  4BBR J;  3KE2 A;  2X6O A;  2FD5 A;  2QLZ A;  2IGN A;  1D1A A;  2WB1 A;  2R7V A;  2KQR A;  3TBI A;  4OWR B;  4LK1 F;  4BNC A;  3IRR A;  1MGT A;  5DDG A;  4XBF A;  1W5S A;  2DMU A;  5JI6 A;  1YTY A;  2PI0 A;  3OR2 C;  4I99 C;  4IRG A;  1KQ8 A;  5BOX A;  1O4X A;  3CQZ J;  3SFI A;  1GVJ A;  3CCE I;  2EK5 A;  3WU0 A;  4B3A A;  1WI3 A;  1TC3 C;  4U7D A;  3TO9 A;  5DUK A;  3AG3 H;  1FOW A;  3G71 I;  4CGZ A;  4IX7 A;  2J5O A;  1Z1D A;  2HS5 A;  2M2E A;  4EM2 A;  4HZF A;  3B6A A;  3FMQ A;  4IRI A;  2LF7 A;  2XPW A;  1BA5 A;  3QYB A;  3BR1 A;  2EJR A;  2W00 A;  3HRS A;  2L54 A;  3PNT A;  1Z91 A;  5CQG A;  2IGM A;  4IHW A;  3LQR A;  2H94 A;  3WGH A;  5B5E C;  3ESW B;  2VBY A;  1WJB A;  2UZK A;  4J19 A;  3KP4 A;  3BPX A;  4EJO A;  3OYJ A;  4UUS A;  3BDD A;  5CQE A;  2XF5 A;  1IN5 A;  4CA0 A;  3GTK J;  3S16 J;  2HWV A;  3GTM J;  2MH9 A;  3CCR I;  3O2P E;  1U3E M;  2FML A;  3AAF A;  2QQA A;  1VQ9 I;  3S1M J;  4XRM A;  5EG0 A;  2NVU B;  2EV6 A;  4UXN A;  3LSM A;  4S04 A;  2CGP A;  4XNF A;  3M1E A;  4X0G A;  4HDV A;  1B1B A;  3RTR A;  2LR8 A;  2V26 A;  2M0C A;  2CFX A;  2ME6 A;  2WB1 N;  1LJ9 A;  1W7P A;  4E70 A;  2OQG A;  2KIF A;  2WY7 Q;  3BQZ A;  4LIT A;  1GXP A;  1FJL A;  3FXM A;  2CV1 A;  3OYG A;  1SAN A;  3LFU A;  2DBB A;  1JHF A;  1ZLK A;  5M3M J;  2CFO A;  1TWG J;  4EJU A;  2K9S A;  1MDM A;  4XIC A;  1DGW Y;  2PMH A;  2X6X A;  1MH3 A;  1USS A;  1YX3 A;  1XD7 A;  2TDX A;  1IV6 A;  4EGZ A;  1BR1 A;  4UB6 C;  3IV5 A;  2F5F A;  1FYK A;  3J81 K;  3MZ8 A;  5EEH A;  3SEZ A;  4MFD A;  4O6J A;  2XF7 A;  1H88 C;  3FK7 A;  4B43 A;  2UXX A;  1ZAO A;  3VYR B;  3CMA I;  4KYW A;  3D5L A;  1HF0 A;  2LMD A;  3RZO J;  2BEO A;  2XAJ A;  3SDB A;  5L3B A;  2VXD A;  3KLO A;  2K02 A;  5JHF A;  2HKX A;  4GFB A;  3V42 A;  3CC4 I;  2O8K A;  5H6Q A;  1OKR A;  3JW4 A;  4RAZ A;  3DBH B;  3CUQ C;  4NB5 A;  3KIO A;  3H0D A;  3EYI A;  4ESF A;  4A93 J;  4IJA A;  4OU0 A;  2V79 A;  2YX7 A;  3E5U A;  2DDB A;  3E5X A;  1J59 A;  4CCN A;  5FKN A;  3I56 I;  2A07 F;  1WFX A;  3W6J B;  2P4W A;  2CQX A;  4G12 A;  2RNG A;  1QO0 D;  4D5F A;  1SD5 A;  3DEW A;  2YX4 A;  3RPU A;  3LA2 A;  1R1T A;  3Q0V A;  1FMV A;  5LGU A;  5HOD A;  3OYH A;  3RKW A;  2LDU A;  1UHW A;  5D5U B;  3HB9 A;  1DP7 P;  1ZGW A;  3Q0W A;  2FBI A;  2A61 A;  2OQR A;  2D5V A;  1R7J A;  4I02 A;  4I76 A;  2F5E A;  3KYL A;  2XGX A;  5IP6 A;  3ZCO A;  2NVT J;  2Z9O A;  2DXI A;  3PIP F;  3OYB A;  4UVB A;  2JN6 A;  2MD5 A;  3WE3 A;  2ELK A;  2Q2E A;  1TWF J;  4KUM A;  5HDG A;  3H3U A;  3WTW C;  5EDN A;  1RUO A;  3UR3 C;  1EH7 A;  2CQ7 A;  1KU3 A;  3VYT B;  4PJ0 C;  4M6V A;  2IP2 A;  4M3B A;  1B6A A;  4CXF A;  1U6G A;  2CU7 A;  2R7T A;  1ULY A;  3BWG A;  3QP5 A;  3G73 A;  4B1R A;  2LG4 A;  2OTJ I;  5F0H A;  2STT A;  5F64 A;  1K78 B;  2PMZ N;  1J7K A;  2DFH A;  2E7X A;  2HQA A;  4DYQ A;  5BNG A;  3M3Y J;  3TQN A;  5IYB J;  2JA7 J;  2WTE A;  3OS0 A;  4B44 A;  1S6L A;  4M3D A;  2HU9 A;  4M9S A;  5M3F J;  3EUK L;  4MEX F;  2H8R A;  1BI2 A;  2JVH A;  2DN0 A;  4ZZD A;  4QWQ A;  1CQT A;  1KYZ A;  5L3E A;  2E2I J;  5J8C A;  3HOX J;  1FBS A;  2ZXH A;  2Y75 A;  3MZH A;  2WAF A;  3TP3 A;  4V19 K;  3S2W A;  2PJP A;  4I7H A;  3BT9 A;  4Y13 A;  3BLY A;  5EYR A;  4CDG A;  1S9H A;  1K83 J;  2X1E A;  4I09 A;  5ICC A;  5HLG A;  2KFD A;  2VOP A;  1SFX A;  4I0B A;  5K1Y A;  5GAH J;  1LUJ B;  3JRA A;  1XB4 A;  4RB2 C;  2IAI A;  4R8H A;  4LB5 A;  2JK3 A;  1OYY A;  3K70 D;  1IN7 A;  1JT6 A;  5GP9 A;  3GTG J;  2JUC A;  4A3K J;  1EV7 A;  1OR7 C;  2P6S A;  2COM A;  4RAG A;  3Q5F A;  1R58 A;  1Y0N A;  3DU5 A;  3M7G A;  5CKT A;  4DNC A;  4E7Z A;  1K6Y A;  2H8W A;  1P6R A;  2VC0 A;  3H1C A;  4O5V A;  3PQK A;  1XGM A;  1TW3 A;  5K5R A;  1O3T A;  5F1J A;  2L7F P;  3HOY J;  1KQ9 A;  2OZU A;  3S1N J;  1D3Y A;  3FIS A;  2E2H J;  1FLI A;  4FIS A;  2MBF A;  3DTI A;  3RPU D;  4MTE A;  3IL2 A;  3FK6 A;  2O61 A;  2R5Z A;  1U5T A;  3K10 A;  4AD9 A;  1Z0X A;  3S17 J;  3G6E I;  4RB0 A;  4GYG A;  4IHS A;  4Z6Y A;  1A04 A;  1IRZ A;  1VQO I;  3FXJ A;  2ID6 A;  4JOM A;  2VXZ A;  3ECO A;  4Q5S F;  3HPH A;  1BL0 A;  2X0L A;  1JE8 A;  1Z77 A;  3FHN A;  3BZK A;  2IGK A;  2XAH A;  3J80 K;  3G3Z A;  4BHB A;  2EFP A;  3FXK A;  3D0S A;  3PJR A;  3KX2 A;  1HW5 A;  1SVO A;  2MC3 A;  1U8R A;  3OYA A;  2NOJ B;  5HOO A;  2M4G A;  5E3M A;  3GW2 A;  1FBQ A;  3CO7 C;  3TKY A;  1SD6 A;  2OCE A;  3HOU J;  4HLY A;  2M7A A;  5E8I A;  2GQQ A;  5FGM A;  2RRE A;  4CH7 A;  3K2Z A;  2UWM A;  3EPZ A;  4ESB A;  1LE8 A;  3GFJ A;  1U2W A;  2IPQ X;  5ED4 A;  3MAJ A;  3E3V A;  1S8N A;  4M72 A;  3VYU B;  1YRN A;  1E0E A;  3F6O A;  3I0T A;  1BBY A;  5FFX A;  4II2 A;  1UHS A;  3KYD B;  3KEQ A;  2R93 J;  1YW9 A;  1LPQ A;  1YS6 A;  4R1H A;  2BE5 F;  5DCM B;  3PIO F;  1MMG A;  4XK4 A;  1FTT A;  2LYC A;  1FIP A;  1V3F A;  1WQ2 A;  1HST A;  2LNB A;  5L3D A;  3GUD A;  5KHD A;  2DA5 A;  3FDY A;  1X2N A;  4IRH A;  2XDV A;  1LVK A;  3QOD A;  1B4A A;  1VZ0 A;  2BGC A;  2PG4 A;  2MFZ A;  2CW0 F;  4Q48 A;  2B0L A;  4FX4 A;  3S14 J;  5D6F A;  1T39 A;  5HVQ C;  2XB0 X;  3RYP A;  1DUX C;  3BR2 A;  3ERM A;  4IF4 A;  3ZQC A;  2NS8 A;  1FT9 A;  1O3Q A;  4RA2 A;  5FB2 A;  3ISP A;  1XGO A;  1VFC A;  4MTD A;  2R5Z B;  5JFR A;  1XCV A;  2VBX A;  3HHH A;  4CYC A;  3B02 A;  1FSE A;  2Y48 A;  3FXL A;  4RGR A;  4ZYD A;  3IAM 2;  3K1M A;  2ZJ2 A;  5GPA A;  5HNF A;  3ML6 A;  3BC8 A;  2NVQ J;  4ZYA A;  1D0X A;  1X3Z B;  2DOF A;  1BM9 A;  1B72 B;  2QA4 I;  1AOY A;  2NOG A;  2GIZ A;  1TP4 A;  1WJF A;  2QBY B;  2H09 A;  3IUO A;  2PQ8 A;  2Y0M A;  2VC1 A;  4ESJ A;  4PFO A;  4G7O F;  4LB6 B;  1YW7 A;  1R5I D;  1ZEL A;  3E97 A;  3H9J A;  3RYR A;  1ZTR A;  4B8X A;  3NEU A;  1BI0 A;  4ASN A;  1OIS A;  4J01 A;  4L5I A;  2VLA A;  2L9R A;  1Z3X A;  4ZJZ A;  3G2B A;  5J1R A;  4M3F A;  3S93 A;  4HW0 A;  4JX5 A;  1IN4 A;  3PFY A;  2R7D A;  5IOY A;  3WG7 H;  3TW7 A;  1RC9 A;  1FWZ A;  2DTZ A;  3DKY A;  2E71 A;  3G1L A;  4YG2 F;  4JP0 A;  3X2Q H;  1BIB A;  3LST A;  1ZQ3 P;  1IDY A;  2FBH A;  2GIV A;  3K70 C;  2W85 A;  3E5Q A;  4Y52 J;  3P9K A;  1WRJ A;  2AS5 F;  2XSJ C;  2PLY A;  2XKO A;  3DKW A;  3S15 J;  2M4K A;  1P4X A;  2X51 A;  1R36 A;  4M3E A;  3ZOB A;  4HNT A;  2XGE A;  2D1V A;  2M1B A;  3ONQ A;  4ENM A;  3AG4 H;  2EFW A;  3VDX A;  3BTC A;  5ILS A;  4OIR F;  3T5X A;  4ANJ A;  5J4Y A;  3BG7 A;  1MJB A;  4PUS A;  4Y4R A;  2YSR A;  3SDG A;  1Z6T A;  2CUJ A;  5EGO B;  1WH7 A;  1W7P D;  3ZMS A;  4E7L A;  3GTO J;  1U78 A;  1QBJ A;  1TWH J;  1BR4 A;  4KMU X;  3MKZ A;  1SAX A;  2OJE D;  1SEU A;  3IKT A;  4PGG A;  1W5C C;  2VT2 A;  1GDT A;  1SFK A;  2E2J J;  3O6B B;  3HL2 A;  1XDU A;  4U0W A;  1JKP C;  4C2M J;  1Y56 A;  2MD0 A;  3QYE A;  1DDN A;  1BJA A;  1GV2 A;  3F23 A;  2FOK A;  1IXR C;  2KKO A;  3OYE A;  1Z05 A;  4ETS A;  1QHG A;  4EJW A;  3K9T A;  1H8A C;  3DWL E;  1DP3 A;  3HM5 A;  5M5Y J;  1H0M A;  5B1B H;  3I3L A;  4DQ2 A;  1UG2 A;  3PL8 A;  2P7V B;  1WVR A;  1H89 C;  4HA8 A;  1BJZ A;  4PCQ A;  5J1U A;  4NC8 A;  4B09 A;  1S72 I;  1ITY A;  1U8B A;  4L9N A;  3BY6 A;  3GYH X;  5CLS A;  5FD6 A;  2LP0 A;  3BJO A;  1PUF B;  3ZR8 X;  4L9J A;  1HXD A;  1V5F A;  1LFP A;  3H5A A;  3FX3 A;  2VQL A;  4BY7 J;  2CO5 A;  3MCZ A;  4UVC A;  1F43 A;  4JK1 X;  2ZJQ F;  1S7A A;  1IN8 A;  1UG0 A;  2WC2 A;  5GPC A;  3P5J A;  4DBR A;  2KMU A;  1VQK I;  2M30 A;  2HXO A;  3BQY A;  4A3M J;  2HR3 A;  2ZXJ A;  1TTY A;  3ZQF A;  2ZSH B;  4U88 A;  4LOC A;  4PDK A;  4YII A;  1YW8 A;  1Y0U A;  2RDP A;  1G3W A;  1S5L C;  4P1W A;  2QEX I;  4B3X A;  2HOS A;  4WK8 F;  2LRE A;  3MMY B;  2PFB A;  4UVA A;  1XSV A;  2XKP A;  2HNH A;  3HOZ J;  1SD7 A;  1NTC A;  4A3J J;  1P7J A;  5JLX A;  3C2G A;  2BHZ A;  4HAM A;  2VT3 A;  1IV8 A;  2DK8 A;  4CIC A;  3WHB A;  3OWT A;  4BEH B;  2GAU A;  2HVR A;  2RVC A;  1J09 A;  4FX0 A;  1DPR A;  4AU7 A;  2QQ8 A;  3FXQ A;  1MBK A;  2H1L A;  5HLI A;  2FRH A;  2LBF B;  1YIO A;  3TP0 A;  3OL3 A;  2QKL B;  4ZYE A;  3WTU C;  1RET A;  1X1D A;  2MLK A;  2ZCW A;  3J81 Z;  3PUB A;  5BPD A;  1XX5 A;  1MMD A;  3GCM A;  2CWE A;  2L9S A;  2W4S A;  3FMR A;  3BG3 A;  2ZJR F;  2BW3 A;  2P5K A;  4YEL A;  3FBN B;  3M8F A;  3JSO A;  1KYW A;  2DA2 A;  2I8D A;  2IS1 A;  3CZ6 A;  1WJE A;  1MBE A;  1V54 H;  4MGR A;  2BVM A;  4MNU A;  2ZKZ A;  1QZY A;  1J75 A;  3IP4 B;  2IGO A;  4UUT A;  2A68 F;  5A2Q Z;  1SFO J;  3JRI A;  1HDP A;  3ZQG A;  5LHH A;  1WGX A;  3CDL A;  3F22 A;  2ICW G;  1U5T C;  3ZMU A;  1CF7 A;  5GTH C;  2KJC A;  3E0J B;  2F4O B;  3ZQH A;  4MQV A;  2FXA A;  2QQB A;  5FRO A;  5LLQ A;  2IXS A;  2CYY A;  1UB9 A;  2VON A;  5KVR A;  3JRC A;  2GA1 A;  2KPM A;  1X58 A;  1VI0 A;  3CJT B;  1T8I A;  2MGQ A;  1J0R A;  4CCM A;  3H3V K;  5DD4 A;  3F21 A;  4HBL A;  1I27 A;  2OAZ A;  2X6Y A;  2LKP A;  4I01 A;  2GA2 A;  4LFU A;  1JHH A;  2R7R A;  4OAZ A;  2E35 A;  4I98 B;  4I0A A;  2NAZ A;  1PUE E;  2R7X A;  1X4P A;  4JBA A;  3O8G A;  1XCB A;  1UFM A;  4D7M A;  3F8M A;  3MKL A;  1MZB A;  3DEE A;  3ULQ B;  2YR2 A;  2B9S A;  3HPG A;  4LG3 A;  1R71 A;  3JRH A;  2ESN A;  4PGH A;  1QHH D;  4UUV A;  3CLO A;  1MMA A;  3R60 A;  5B1A H;  1RNL A;  2W84 A;  1X1A A;  1R23 A;  2K4B A;  4G6Q A;  3S3O A;  4KNY A;  2LRD A;  3A02 A;  2X9D A;  4LGW A;  3GTQ J;  3WTT C;  4QPO A;  2GWR A;  3HG9 A;  3GLL A;  5ILU A;  3BP8 A;  1TQP A;  3E6D A;  3S32 A;  1AU7 A;  1APL C;  2CV0 A;  2HGC A;  2YPR A;  1M1E B;  3LSR A;  1ZHF A;  2RC4 A;  3O8H A;  4DYC A;  2X4H A;  3JSP A;  1QVT A;  5JHU A;  1Y39 A;  5JVT A;  1RIO H;  4WCG A;  3A1Y A;  1Z6R A;  3MWM A;  4OMZ A;  3TOA A;  1YIT I;  1S7E A;  1IRX A;  1IXS B;  2E60 A;  3C3W A;  2F48 A;  2Y31 A;  4FAS D;  4ZYG A;  4TV7 A;  3K7A J;  2BXY A;  4OIN F;  1OJL A;  4GXO A;  4FE7 A;  2FNA A;  4BKX A;  3CCL I;  1FOX A;  1BR2 A;  3GTP J;  2EA2 A;  5EF6 A;  3N05 A;  1VF9 A;  4BQO A;  1OCC H;  1LNW A;  3MKY B;  4IOC F;  2ISZ A;  1WWX A;  4Y15 A;  4U0Y A;  4M3G A;  3TO6 A;  2CRG A;  1I5Z A;  5E18 F;  4XLN F;  5ICE A;  1Z21 A;  3ASO H;  4IQ4 A;  2VKH A;  1XSX A;  1I39 A;  2XF6 A;  9ANT A;  1WJD A;  2HDD A;  2ME0 A;  2VQG A;  2IS4 A;  3HZJ A;  2V4J C;  1X4O A;  1WI9 A;  3CMM A;  3M4O J;  1MW7 A;  2VAS A;  2DFE A;  3BR3 A;  4IXA A;  2HDW A;  1ZG3 A;  3BG6 A;  2R0Q C;  3QPS A;  1JI8 A;  5B3S H;  4C3H J;  3GME A;  4B48 A;  2X48 A;  3PQJ A;  2E19 A;  3VFZ A;  1B9M A;  2GM4 A;  1PYV A;  5DD8 A;  3ZMZ A;  4XSZ F;  4M73 A;  3TED A;  2VKV A;  3CDI A;  5F1R A;  4HG2 A;  4P9U A;  5LGN A;  3OSF A;  1XS9 A;  4LLL A;  2R7F A;  5FD5 A;  2M8E A;  4AIJ A;  4C2U A;  1KQ0 A;  2H1K A;  3H9Q A;  4AM3 A;  2IBD A;  2O03 A;  2PMZ A;  2DMN A;  3HKZ N;  3GO5 A;  4D5C A;  1ZRE A;  3ABL H;  2IA1 A;  4NC6 A;  4XN0 A;  3F9K A;  3VOD A;  3L1P A;  1R5G A;  3G4S I;  1TQM A;  2LD5 A;  1P4W A;  3G1O A;  5TRD A;  2N8G A;  3FXO A;  4PSX A;  5L3C A;  2E5N A;  3FKJ A;  1MMN A;  2JT1 A;  2ZNZ A;  1JUS A;  4N4O B;  1A6Q A;  3K6G A;  4KT6 A;  3DLL F;  1EA3 A;  3QPT A;  3OYC A;  4PJM A;  2GXB A;  2BV6 A;  3LSJ A;  4RLQ A;  3NQO A;  4IHV A;  1ACI A;  3FXU A;  5ICG A;  4GGG A;  1UJ8 A;  3DV8 A;  1X1B A;  2ECC A;  2AXL A;  4HX8 A;  3ZPL A;  2KHM A;  4HDU A;  1T08 B;  2DCE A;  1RUN A;  2QUF A;  5BPI A;  2NNN A;  3TOB A;  3WG9 A;  3ZGK A;  2Q8K A;  1P9Q C;  1H9G A;  4BHC A;  4RDU A;  1OFC X;  2L7K A;  5CVU A;  5FLM J;  1F4K A;  3CJQ B;  2RQP A;  2LLK A;  1IC8 A;  1N78 A;  3CCM I;  4MFE A;  1T2K A;  1FOK A;  3OYI A;  4W1U A;  3OY9 A;  5K7H A;  3B73 A;  2XRO A;  4D7N A;  3BTI A;  2PMU A;  3DP7 A;  3QQA A;  4RBO A;  2JTV A;  2CJJ A;  4RS8 A;  3HOT A;  3QWL A;  1VQ7 I;  4HNV A;  2W7N A;  5EG0 B;  3L2C A;  4A0Y A;  3VSK A;  5A2Q K;  1TW2 A;  4L18 B;  1G3T A;  1AA7 A;  2KIM A;  1POG A;  1UCR A;  3VWB A;  1TBX A;  2M8G X;  2QKM B;  2WAQ N;  2GLO A;  4JX4 A;  4XRS G;  1TLH B;  2B7E A;  5DM6 F;  2FNP A;  5FO5 A;  1ORK A;  4Q4Z F;  2KIU A;  4RB3 C;  3VOE A;  1EH6 A;  2VJ5 A;  4BXU A;  4BDZ A;  4NQW A;  4UV9 A;  2X1C A;  4S05 A;  1G6N A;  1E3P A;  1K4S A;  2QGU A;  4AC0 A;  2E1M C;  5CVI A;  5CYV A;  3HSF A;  2EA4 A;  1Q1V A;  5J40 A;  5IY5 H;  3WTZ A;  2KL4 A;  2HPI A;  3CLQ A;  4ZTJ A;  3BRO A;  4RGS A;  4UHT A;  5KAF C;  2R5Y B;  2FQ4 A;  2CUE A;  2LVS A;  3CO6 C;  2Y2Z A;  4J00 A;  5D6E A;  2O9L A;  2ZJP F;  1Y1W J;  3LWF A;  4GO1 A;  4U7B A;  1WJA A;  4IL6 C;  1AHD P;  3EYY A;  5BMZ A;  5E1W A;  1W36 D;  3HTS B;  5FKO A;  1DPU A;  3LFK A;  5DUI A;  2CH0 A;  2DDA A;  3ABM H;  3FF5 A;  5FJ8 J;  3S1R J;  2PEX A;  4HQM A;  3S8P A;  2QM3 A;  5CVR A;  1WPK A;  3R6S A;  5E3N A;  4FE4 A;  4HEA 2;  3OL4 A;  5DS9 A;  2Z1D A;  2IVM A;  3HXL A;  1OCO H;  3RSN A;  2F2E A;  3OS1 A;  3ZN0 A;  1NK2 P;  2BY1 A;  4A5M A;  1WH5 A;  3V8K A;  3LSG A;  3H0G J;  1T0F C;  1O7L A;  4NNJ A;  3SFZ A;  2H6C A;  3FM3 A;  2FU4 A;  3GVA A;  3R61 A;  3W6K B;  1X1C A;  3MN2 A;  2KP6 A;  4UUS B;  4XKV A;  4XKB A;  2F5V A;  2O6G E;  5C44 J;  2EBI A;  2CQN A;  2JRM A;  5FKM A;  5FLX K;  2L4M A;  1HW1 A;  3FZV A;  5HNH A;  1B9N A;  5BQT A;  2O5R A;  4XRF A;  4CSW A;  1XMA A;  2AHQ A;  3K1N A;  3CP2 A;  3OV8 A;  5CJ9 A;  1NK3 P;  3S1Q J;  3H35 A;  1QPI A;  2DAO A;  2K4J A;  4RAY A;  2DT7 B;  2KIQ A;  1MSE C;  5EGO A;  1UHM A;  1E2X A;  5HDK A;  4ITV A;  2W48 A;  5LEJ A;  2HTJ A;  2XHK A;  5KK1 A;  4C30 A;  2STW A;  4B4C A;  2WWY A;  4E7J A;  4NDL A;  5IT9 Z;  5D5X B;  4U0V A;  2XAF A;  5DYM A;  2FJ1 A;  1FSH A;  1R5H A;  2DOD A;  2QSF X;  2AQF A;  4QPQ A;  1R22 A;  2VKE A;  3HOS A;  2B63 J;  2O7O A;  2NVX J;  1QZE A;  2RNJ A;  3M8J A;  4KMF A;  3K1P A;  1V55 H;  2ZNY A;  4G7H F;  1ZG1 A;  2D45 A;  1ETY A;  4YFK F;  5D8K B;  1IUY A;  2K7L A;  1FIA A;  2KT0 A;  4I6Z A;  2QZ8 A;  2P6T A;  2IW5 A;  2Y0S A;  2HEO A;  3PUF A;  4X1E A;  1N77 A;  3CD6 I;  1E3H A;  2EV0 A;  5AIQ A;  4E6K G;  5LRS A;  4C9Y A;  4HPQ A;  3L9F A;  2LKX A;  5TGT A;  4LD5 A;  2IA2 A;  4CO8 A;  2FE3 A;  2WV0 A;  1QA6 A;  3CUQ B;  2QBY A;  5CVJ A;  2HVS A;  1FP2 A;  1UEL B;  1JT0 A;  4HQE A;  1IW7 F;  2DQL A;  2OBP A;  1R1U A;  1MH4 A;  3LOC A;  5BS6 A;  2L7M P;  2V6E A;  1U5T B;  1Y8R B;  4A12 A;  1K79 A;  1R00 A;  1P4A A;  4Y7N J;  3DKX A;  2JA5 J;  3LAP A;  1IO2 A;  2W24 A;  1VQP I;  2KRC A;  2HDC A;  4CZC A;  3CJN A;  1KGS A;  5TJJ A;  3BZ6 A;  2MW8 A;  2X1D A;  3SZG A;  1IRG A;  1VQL I;  5F27 A;  3GTL J;  3NAU A;  2G9W A;  3KP3 A;  2HVQ A;  2COB A;  3Q0U A;  4PK4 A;  3IHU A;  4BS9 A;  3AL0 B;  3GBG A;  1D8J A;  2WY8 Q;  4OAY A;  3M9A A;  1T56 A;  2HQN A;  1J9I A;  4GCV A;  3L2Q A;  3K0L A;  1V5G A;  1PP8 F;  2VOD A;  3GEZ A;  3IRQ A;  3N97 A;  5LGT A;  1I6H J;  1K61 A;  3RCO A;  2ZSI B;  2V1N A;  3TMO A;  1AWC A;  2V1X A;  2K27 A;  1ZN2 A;  3AL0 C;  3OOP A;  3L2W A;  4M9X A;  2QSG X;  3R4K A;  3DBR B;  1K7A A;  5EEA A;  1TT0 A;  3TO7 A;  1QQI A;  2K40 A;  3F0C A;  1CGP A;  1ETQ A;  2EFO A;  2F4M B;  2E1M B;  2V9K A;  1ON2 A;  1U0J A;  2VQC A;  1WJ5 A;  2XIG A;  3WU1 B;  1QVU A;  3A2K A;  3SQN A;  5DTD A;  1YG2 A;  2NYX A;  2HOT A;  2R7S A;  1XTA A;  2E5Z A;  2A6H F;  4UY8 I;  2KDZ A;  4ABZ A;  4A3C J;  4ENK A;  2HQR A;  2DQR A;  2YU3 A;  3EUH A;  1XSD A;  5F6F A;  3LSH A;  3E6B A;  3IC7 A;  1K78 A;  2PX9 A;  2HPM A;  2O0Y A;  3AG2 H;  3ZXS A;  5GTI C;  3HRM A;  2ZFU A;  3PO3 J;  3DPL C;  3DLA A;  1YOV B;  3B6C A;  4YFN F;  1Y8Q B;  1JKR C;  2NNY A;  1MNE A;  3GFM A;  1SVM A;  2QQ9 A;  3OYM A;  3BJ6 A;  1XC5 A;  2HYJ A;  3D5S C;  3ZMV A;  3KZY A;  4U87 A;  3ECH A;  4EAT A;  3T0Y A;  2DMT A;  4FHT A;  4KT5 C;  1BOA A;  2FA5 A;  5JVG F;  2Z2S B;  4KIG A;  3T1B A;  2PJR B;  2AXT C;  3HGG A;  1IZ1 A;  3FKI J;  4JYK A;  1FYL A;  2NVY J;  3HSE A;  4MLO A;  3I4P A;  1EH8 A;  3JRG A;  2VJI A;  3K4L A;  2DFF A;  2G7U A;  5AON A;  3U21 A;  1R6R A;  4EQQ A;  4XID A;  1JGG A;  1YS7 A;  1R4M B;  2JMW A;  3KFW X;  4XLE A;  1UAA A;  3I4N J;  5GAD J;  4F92 B;  3D5R C;  1LE8 B;  1J5Y A;  5FFZ A;  2CW7 A;  3LSP A;  4IEJ A;  4NUB A;  4LG0 A;  3W3C A;  2EZI A;  2LY2 A;  4KN7 X;  4XSX F;  5C4J J;  3J80 Z;  2LY1 A;  3BR6 A;  4AYB A;  1KZH A;  4WF2 A;  1UZC A;  4BH9 A;  4AIK A;  2IJL A;  1IXC A;  3AFH A;  3C7J A;  4M6X A;  3WHC A;  3JTH A;  5DCF A;  2IT0 A;  1N75 A;  1BC8 C;  3K4C A;  4KA4 A;  4XOR A;  4RGX A;  5F08 A;  2OV7 A;  1NHA A;  5HLH A;  3DFG A;  1FC3 A;  4D1Q A;  1BW6 A;  1HKQ A;  4FT8 A;  3VSL A;  2ISY A;  5ERI A;  1OQY A;  2G0E A;  1YJN I;  3J7A O;  2RN7 A;  2A5W A;  4IKF A;  3BJA A;  1ZAR A;  2AO9 A;  2Q1Z B;  2HOA A;  3NWT A;  4HX7 A;  2RKH A;  5CVV A;  5FKL A;  5DCM A;  1VQM I;  2V6C A;  3G1M A;  4A3L J;  2EZH A;  2LF8 A;  1ZRF A;  4E7K A;  3WTY C;  1OLT A;  4NBQ A;  4BJ6 C;  2XGD A;  5ICF A;  2NS7 A;  5TIS C;  2JVG A;  4XLA A;  2K85 A;  1I3Q J;  2E1N A;  2FQ3 A;  3RQI A;  3V7R A;  3VPR A;  3L2U A;  2FBK A;  3DCF A;  4BQA A;  2OU2 A;  4FET A;  3VB2 A;  2L7Z A;  3IKV A;  4H4K C;  3M8E A;  4G6T B;  1T6S A;  1H9T A;  4ENN A;  5FKK A;  2ECB A;  4CHU A;  1LDJ A;  2EIJ H;  1HCR A;  1W36 C;  5KAI C;  2XSD C;  1YO5 C;  2K3P A;  3ZRG A;  1FMW A;  4A3I J;  1B8I A;  3K2A A;  3EQL F;  3L00 A;  3HOW J;  4WX9 A;  4KN4 X;  4HV5 A;  3LSI A;  4MHG A;  2IA0 A;  2L01 A;  1ODD A;  3ASN H;  2JSC A;  3H5R A;  1HW2 A;  3IH3 A;  2DA1 A;  5KNL A;  3WGI A;  1IG7 A;  2EWN A;  4OIQ F;  2DA6 A;  2V9V A;  3DQV C;  1PP7 U;  1BI1 A;  4GYI A;  1G59 A;  4YEJ A;  2BVL A;  1T0F A;  3BG5 A;  3RQ4 A;  1G3Y A;  2XRN A;  3CTA A;  4QIW N;  3GFI A;  1B59 A;  1XMX A;  4XOT A;  5HLT A;  4G94 A;  4KDP A;  3RKY A;  2L0K A;  3EUH C;  4PZJ A;  4XLH A;  3QYF A;  1TWC J;  3EDP A;  4DZJ A;  1MJ9 A;  1YYV A;  2KRF A;  2MSY A;  3DU6 A;  1BOB A;  2EIN H;  5EZG A;  1YI2 I;  2DFI A;  2D2W A;  2GXA A;  3S2D J;  2LK2 A;  4BBS J;  1BN5 A;  1STZ A;  3KZI C;  3IH2 A;  2V1D A;  1EKE A;  4EJV A;  4AYB N;  5KCM A;  2R7Z J;  2F5D A;  4CYC B;  1ZK8 A;  3C2H A;  4EGY A;  1FX7 A;  2M34 A;  2M9H A;  3I71 A;  3KPH A;  4RLF A;  3JCU C;  3SHF A;  2M87 A;  1YJW I;  1MMS A;  4F55 A;  1ZG5 A;  1X1P A;  4A6E A;  3E6C C;  2XUB A;  2V9P A;  4HSR A;  3LQQ A;  3CC2 I;  3GWZ A;  2LFB A;  2DT6 A;  1ETK A;  5IT3 A;  4ZYH A;  1MJA A;  5E17 F;  2OTL I;  1SFE A;  3U9G A;  2L2O A;  2ELH A;  1XMK A;  3W2A A;  2IEK A;  5J1Y A;  1AKH B;  2ELJ A;  3LL7 A;  5L3G A;  2DOE A;  2EIM H;  2OD5 A;  2RAE A;  2ZBK A;  3ZQL A;  1FYM A;  1VQ4 I;  2EPF A;  1RRJ A;  4F7Z A;  5J47 A;  3KCC A;  4LLG F;  2FEZ A;  2R7Q A;  2GZW A;  2VBZ A;  3E7L A;  3SZP A;  1SFU A;  1KU9 A;  5IOZ A;  2JA8 J;  1D1B A;  1W5T A;  3RKX A;  2XAS A;  1T95 A;  4QSH A;  4N4N B;  3EUA A;  3KZZ A;  3PM1 A;  4DJA A;  2WA0 A;  3ABK H;  2HKO A;  3I54 A;  2DI3 A;  3JAM K;  4Y33 A;  3HUG B;  2XAG A;  1YLF A;  3WTS C;  4ZC3 A;  3ZP5 A;  1X19 A;  3HGY A;  2HXI A;  3RIR A;  1IAW A;  3OS2 A;  2ZME B;  2P5L C;  4BE2 A;  3W2V A;  2L5Q A;  4HLX A;  3CES A;  3GZN B;  2YS9 A;  1G2H A;  3IWF A;  4BUP A;  1R49 A;  2Z33 A;  2L3D A;  3CCJ I;  1F36 A;  3CUQ A;  4IHX A;  2WAQ A;  4M74 A;  1S29 A;  4XLF A;  4F93 B;  1OCT C;  2HYF A;  3LA3 A;  1J2X A;  2XRL A;  3ABT A;  1FTZ A;  3I64 A;  5LEK A;  2IS6 A;  3LNQ A;  1RPW A;  4KIS A;  2GXG A;  1MSF C;  4LMY A;  1KON A;  3HJE A;  2Q2E B;  3LSK A;  3V8L A;  3HYI A;  4N9H A;  1ETV A;  3FIW A;  3S2H J;  2MC4 A;  3PO2 J;  3K69 A;  2UUZ A;  4PSW A;  4DIQ A;  1IGN A;  5J8F A;  1GV5 A;  2VIX A;  2ZO4 A;  1QU3 A;  1D8K A;  3MEX A;  3JAM Z;  5H20 A;  4XRS A;  2ZXI A;  2RV8 A;  2E34 A;  4V2G A;  3SZT A;  3L7W A;  1YFH A;  3F8B A;  1HKT A;  4FTH A;  1JJ8 C;  3GF2 A;  2A3S A;  3E6M A;  1LEB A;  4C3I J;  3I58 A;  1GXQ A;  2A5Y B;  3KEO A;  3WE2 A;  1RI7 A;  3U1K A;  3L2R A;  3QOE A;  3ZQQ A;  3NRV A;  4EVI A;  1QPM A;  1TL8 A;  2KZG A;  4E4H A;  4CCJ A;  4RM2 A;  1GHC A;  5E20 A;  2QWW A;  3OSG A;  2CQQ A;  2BOL A;  3A0B C;  1TWA J;  4WWC A;  2KZV A;  2D1H A;  2F5C A;  4RM3 A;  5LD2 C;  3WTX C;  4LIU A;  2JRT A;  4DGW B;  3CP8 A;  3OR1 C;  1FPQ A;  1XN7 A;  4OOI A;  4H0E A;  1LEA A;  2PJR A;  3BTJ A;  3W6V A;  4GDF A;  2ZB9 A;  4CCO A;  1EJ9 A;  5IPA A;  3I9V 2;  1IF1 A;  1ZR2 A;  1OPC A;  1YQA A;  3QPH A;  4WXD A;  1KU7 A;  4IHT A;  2GOM A;  4HF0 A;  2K86 A;  1X3W B;  1SMY F;  1TT5 B;  1ZKG A;  2EFN A;  2P8T A;  2XAQ A;  3M07 A;  1B8I B;  3S3M A;  3A01 B;  2QF7 A;  1NG6 A;  5LRR A;  4AWX B;  3MQ0 A;  4FQG A;  2OUM A;  3ELK A;  2DPD A;  1GLN A;  3HTU A;  2HZD A;  3HRU A;  3OYK A;  1HBX G;  3SJM A;  1DGR M;  2ADU A;  3ABU A;  3WGG A;  1E17 A;  4M9Z A;  1I50 J;  1OR7 A;  1C0W A;  3I55 I;  2DYR H;  4AIH A;  1BW5 A;  2LBF A;  4DBQ A;  4HV6 A;  3KET A;  4KIF A;  2EIK H;  4AVP A;  1T98 A;  3HOV J;  1OMI A;  3H36 A;  2K9N A;  4K2E A;  4LLN A;  2W57 A;  4WXH A;  1YX5 A;  2JPB A;  2M5W A;  1LKX A;  2QVO A;  3C1D A;  1WCM J;  4NC7 A;  1G8X A;  5IYD J;  3PSI A;  1HDD C;  2FMY A;  4EV0 A;  2X6W A;  2KLO A;  5E79 C;  4X6A J;  1IJW C;  1TZL A;  1A35 A;  2DA4 A;  3OYD A;  3H5N A;  4BXF A;  4IOA F;  4NQW B;  5JLW A;  3AG1 H;  3R0J A;  2A6E F;  3A03 A;  5D8L B;  2O8X A;  4BQQ A;  3CCU I;  5E1Z B;  4DZP A;  1REP C;  3GZ5 A;  1D0Z A;  1O3S A;  5M5X J;  1RR7 A;  4F91 B;  4IZZ A;  3OYN A;  5GAE J;  4M71 A;  4F52 A;  1LB2 A;  2E1C A;  2R3S A;  4MQ9 F;  3K4N A;  4CZZ A;  5GAG J;  4N0B A;  2CSO A;  5D5W B;  2DJN A;  2R4G A;  3TDZ C;  2L4A A;  4LG0 B;  3D1N I;  2EV5 A;  4BU2 A;  2IS2 A; 
#chains in the Genus database with same CATH homology
 2DW4 A;  2KJB A;  1V4R A;  1O3R A;  2VN2 A;  1QNT A;  5JR3 A;  2JPC A;  4A5N A;  1BIA A;  2A69 F;  5HS8 A;  3BOQ A;  3N4M A;  1XDS A;  1MD0 A;  4I2O A;  2Z3Y A;  3F8F A;  1FZP B;  3FMS A;  4G7Z F;  2P5V A;  4Y17 A;  1W4M A;  2DU9 A;  1MKM A;  1W7P B;  3FWE A;  4ON0 A;  3LAJ A;  2OZ6 A;  3ZMT A;  2L02 A;  1G4D A;  2C6Y A;  1IN6 A;  3CDH A;  5D5V B;  3P9C A;  4KIB A;  3JTG A;  4O3M A;  4YIF A;  3HHG A;  1JXS A;  4Z2Y A;  5DEQ A;  4LK0 F;  3RJP A;  3DF8 A;  1LQ1 A;  1WKM A;  4L9T A;  2BBY A;  4UNO A;  3PFI A;  1T38 A;  3U1D A;  4BYY A;  3Q9V A;  2MH2 A;  3H92 A;  4Q47 A;  4HX4 A;  3C18 A;  3TGN A;  4P96 A;  2G7H A;  2VBW A;  5EEG A;  3IWZ A;  1L3L A;  2ZME A;  3DPT A;  3F3X A;  4WXC A;  3U2R A;  5J6X A;  4P9F A;  2FSW A;  1OYW A;  3V7C A;  3ZN1 A;  2DLL A;  3GXO A;  5LHI A;  2HTS A;  3ERE D;  4M6Y A;  3F6V A;  3HSR A;  1O57 A;  1QGP A;  4HF2 A;  4YFX F;  1I1G A;  4NHJ A;  3T8T A;  5H6R A;  1XGN A;  1UST A;  1WSU A;  1QZZ A;  4XLP F;  4EM0 B;  2HZT A;  3COA C;  4IPA A;  1ZH5 A;  1P92 A;  1L0O C;  5ILV A;  3QOP A;  5D4R A;  2HFH A;  3LA7 A;  3HIF A;  1BI3 A;  1SD4 A;  2CG4 A;  2ESH A;  3FXR A;  2DT5 A;  4QLC U;  4A0X A;  4R79 A;  4EMS A;  2V1U A;  1FY7 A;  5DV5 A;  1HQC A;  4HYE A;  5LBQ A;  1F5T A;  2BYV E;  1F9N A;  4L0Z B;  3F8N A;  3DXJ F;  2ZFW A;  1ONV A;  2P7C B;  5K5Q A;  5IT9 K;  3QP6 A;  1LDK B;  1OYI A;  4ENJ A;  3H3Z A;  3CUO A;  3KP5 A;  5L3F A;  1D5V A;  4OMY A;  1FBU A;  2VE9 A;  4RGU A;  3V4G A;  4LJZ F;  2CQK A;  3KP6 A;  1O7F A;  2LSO A;  3ZMD A;  5FLX Z;  2RGV A;  1S3J A;  4A2U A;  3BPV A;  4EM1 A;  3SXY A;  4A0Z A;  4A6D A;  2HOE A;  2UXN A;  5E8G A;  3MZY A;  3I5U A;  4D0P A;  2ZME C;  2J5P A;  3V8J A;  2MLG A;  3KP7 A;  2ETH A;  1LVA A;  1ZYR F;  2VE8 A;  1G3S A;  3REO A;  2QYO A;  2VOO A;  4EJT A;  1TNS A;  2QEN A;  4BAY A;  4L0Y B;  3HRT A;  1Q1H A;  1I1S A;  4JQF A;  4MEY F;  1ZRD A;  3V7S A;  2O3F A;  1TQI A;  1Z9C A;  4OIP F;  2DPU A;  3EET A;  4P55 A;  3O3K A;  3ZQ7 A;  3GZ6 A;  2FF4 A;  2XVC A;  4L9V A;  3TDU C;  1HSJ A;  3F72 A;  4N9I A;  1ON1 A;  3R0A A;  5AIP A;  4OIO F;  1HKS A;  1VTN C;  1MDM B;  2XV4 S;  2HYG D;  5E1X A;  1F1Z A;  4P5O A;  3QRF F;  1FP1 D;  1LDD A;  1I6X A;  2DTR A;  1KA8 A;  4G6D A;  2Q0O A;  1R1V A;  3P9I A;  1S7O A;  1ZGA A;  2DK5 A;  1PDN C;  5HDN A;  3MFK A;  1P2F A;  4G8X A;  3T8R A;  2NRA C;  3GLX A;  4BHP A;  4RB1 A;  3FHZ A;  3QAH A;  3WTV C;  1K6O A;  3FM5 A;  1XGS A;  5HS9 A;  3VEP A;  4CYD A;  4ZH4 F;  1X3U A;  3KLN A;  2Z5U A;  4UV8 A;  4L5J A;  1RZ4 A;  2PN6 A;  3P7N A;  1FNN A;  3ROU A;  3DEU A;  2E7W A;  1CF7 B;  2Z99 A;  2H27 A;  3GX4 X;  4HOB A;  3RI4 A;  4ZZL A;  1ZGJ A;  4HF1 A;  4IVN A;  1ZRC A;  3Q9S A;  2OA4 A;  4KIC A;  2IRF G;  4G9Y A;  5D4S A;  5K5O A;  6PAX A;  2JZY A;  2ACJ A;  2M45 A;  3GFL A;  1Z7U A;  3I53 A;  3RPQ A;  1BC7 C;  5LHG A;  5HS7 A;  3WOD F;  1ZLJ A;  1SMT A;  2EB7 A;  1IRF A;  3HUG A;  1JGS A;  2NS0 A;  3QU3 A;  3KP2 A;  1TNT A;  1KU2 A;  2EFQ A;  3F8C A;  3RDI A;  2PBI A;  3I59 A;  3L09 A;  3QU6 A;  2H6B A;  2W25 A;  4KFC A;  2DO7 A;  3I59 B;  2MA3 A;  3KE2 A;  2QLZ A;  4LK1 F;  4BNC A;  3IRR A;  1MGT A;  5DDG A;  4XBF A;  1W5S A;  5JI6 A;  1YTY A;  2PI0 A;  4IRG A;  1KQ8 A;  5BOX A;  1GVJ A;  2EK5 A;  3WU0 A;  4U7D A;  3TO9 A;  5DUK A;  4CGZ A;  2J5O A;  1Z1D A;  2HS5 A;  4EM2 A;  4HZF A;  3FMQ A;  4IRI A;  2LF7 A;  3HRS A;  2EJR A;  2L54 A;  1Z91 A;  3LQR A;  2H94 A;  3WGH A;  2VBY A;  2UZK A;  3KP4 A;  3BPX A;  4EJO A;  3BDD A;  1IN5 A;  2HWV A;  2MH9 A;  3O2P E;  1U3E M;  2FML A;  3AAF A;  2QQA A;  2EV6 A;  4UXN A;  4S04 A;  2CGP A;  3M1E A;  4HDV A;  1B1B A;  3RTR A;  2CFX A;  1LJ9 A;  1W7P A;  4E70 A;  2OQG A;  2KIF A;  1GXP A;  2DBB A;  1JHF A;  1ZLK A;  4EJU A;  1MDM A;  2PMH A;  1USS A;  1XD7 A;  2TDX A;  4EGZ A;  2F5F A;  1FYK A;  3J81 K;  5EEH A;  4O6J A;  2UXX A;  1ZAO A;  4KYW A;  3D5L A;  2BEO A;  2XAJ A;  5L3B A;  3KLO A;  2K02 A;  2HKX A;  5H6Q A;  1OKR A;  3JW4 A;  4RAZ A;  3CUQ C;  4NB5 A;  3EYI A;  4ESF A;  4IJA A;  4OU0 A;  2V79 A;  2YX7 A;  3E5U A;  3E5X A;  1J59 A;  2A07 F;  3W6J B;  2P4W A;  1QO0 D;  1SD5 A;  2YX4 A;  3RPU A;  3LA2 A;  1R1T A;  5LGU A;  3RKW A;  2LDU A;  1UHW A;  5D5U B;  1DP7 P;  2FBI A;  2A61 A;  2OQR A;  1R7J A;  4I02 A;  2F5E A;  2XGX A;  2Z9O A;  4UVB A;  2MD5 A;  3WE3 A;  2Q2E A;  4KUM A;  5HDG A;  3H3U A;  3WTW C;  1RUO A;  1EH7 A;  1KU3 A;  2IP2 A;  1B6A A;  4CXF A;  1U6G A;  1ULY A;  3BWG A;  3QP5 A;  3G73 A;  2STT A;  5F64 A;  1K78 B;  1J7K A;  2E7X A;  3TQN A;  2WTE A;  1S6L A;  4M9S A;  4MEX F;  1BI2 A;  4ZZD A;  4QWQ A;  1KYZ A;  5L3E A;  5J8C A;  1FBS A;  2Y75 A;  3MZH A;  3S2W A;  2PJP A;  4I7H A;  4Y13 A;  4CDG A;  4I09 A;  5ICC A;  5HLG A;  2VOP A;  1SFX A;  4I0B A;  5K1Y A;  1XB4 A;  4RB2 C;  4R8H A;  4LB5 A;  1OYY A;  1IN7 A;  1EV7 A;  2P6S A;  2COM A;  3Q5F A;  1R58 A;  4DNC A;  3M7G A;  1P6R A;  2VC0 A;  4O5V A;  3PQK A;  1XGM A;  1TW3 A;  5K5R A;  1O3T A;  1KQ9 A;  2OZU A;  1D3Y A;  1FLI A;  2MBF A;  4MTE A;  3IL2 A;  2O61 A;  1U5T A;  4AD9 A;  4RB0 A;  4GYG A;  4IHS A;  1A04 A;  2VXZ A;  3ECO A;  4Q5S F;  2X0L A;  1JE8 A;  2XAH A;  3J80 K;  3G3Z A;  4BHB A;  2EFP A;  3D0S A;  1HW5 A;  2MC3 A;  1U8R A;  5HOO A;  3GW2 A;  1FBQ A;  3CO7 C;  3TKY A;  1SD6 A;  4HLY A;  5E8I A;  2GQQ A;  5FGM A;  3K2Z A;  2UWM A;  4ESB A;  3GFJ A;  1U2W A;  2IPQ X;  5ED4 A;  3MAJ A;  3E3V A;  1S8N A;  4M72 A;  3F6O A;  3I0T A;  1BBY A;  5FFX A;  3KEQ A;  1YW9 A;  1YS6 A;  4R1H A;  2BE5 F;  5DCM B;  1V3F A;  1WQ2 A;  1HST A;  2LNB A;  5L3D A;  3GUD A;  4IRH A;  1B4A A;  2BGC A;  2PG4 A;  4Q48 A;  2CW0 F;  2B0L A;  4FX4 A;  5D6F A;  1T39 A;  5HVQ C;  3RYP A;  1DUX C;  4IF4 A;  1FT9 A;  1O3Q A;  5FB2 A;  3ISP A;  1XGO A;  4MTD A;  5JFR A;  1XCV A;  2VBX A;  3HHH A;  3B02 A;  1FSE A;  2Y48 A;  4RGR A;  4ZYD A;  3K1M A;  2ZJ2 A;  3ML6 A;  1BM9 A;  1AOY A;  2QBY B;  2H09 A;  2PQ8 A;  2Y0M A;  2VC1 A;  4ESJ A;  4G7O F;  4LB6 B;  1YW7 A;  3E97 A;  3RYR A;  4B8X A;  3NEU A;  1BI0 A;  4ASN A;  4L5I A;  4HW0 A;  1IN4 A;  2R7D A;  1FWZ A;  4YG2 F;  1BIB A;  3LST A;  2GIV A;  2FBH A;  2W85 A;  3E5Q A;  3P9K A;  1WRJ A;  2AS5 F;  2PLY A;  2XKO A;  3DKW A;  1P4X A;  1R36 A;  2D1V A;  2M1B A;  4ENM A;  2EFW A;  5ILS A;  4OIR F;  3T5X A;  1MJB A;  2YSR A;  1Z6T A;  1W7P D;  3ZMS A;  1U78 A;  1QBJ A;  4KMU X;  1SAX A;  3IKT A;  4PGG A;  2VT2 A;  3O6B B;  1XDU A;  4U0W A;  1DDN A;  1BJA A;  3F23 A;  2FOK A;  1IXR C;  2KKO A;  1Z05 A;  4ETS A;  4EJW A;  3K9T A;  1H0M A;  4DQ2 A;  2P7V B;  4HA8 A;  4PCQ A;  4B09 A;  4L9N A;  3BY6 A;  3GYH X;  5CLS A;  5FD6 A;  3BJO A;  4L9J A;  1HXD A;  3FX3 A;  2CO5 A;  3MCZ A;  4UVC A;  4JK1 X;  1S7A A;  1IN8 A;  2WC2 A;  2M30 A;  2HR3 A;  2ZXJ A;  1TTY A;  4U88 A;  4PDK A;  4YII A;  1YW8 A;  1Y0U A;  2RDP A;  1G3W A;  4WK8 F;  2PFB A;  4UVA A;  1XSV A;  2XKP A;  1SD7 A;  4HAM A;  2VT3 A;  2DK8 A;  4CIC A;  2GAU A;  2RVC A;  4FX0 A;  1DPR A;  3FXQ A;  5HLI A;  2FRH A;  1YIO A;  3WTU C;  4ZYE A;  2MLK A;  2ZCW A;  3J81 Z;  5BPD A;  2CWE A;  3FMR A;  2P5K A;  3M8F A;  3JSO A;  1KYW A;  4MGR A;  4MNU A;  2ZKZ A;  1QZY A;  1J75 A;  2A68 F;  5A2Q Z;  5LHH A;  3F22 A;  1U5T C;  3ZMU A;  1CF7 A;  2KJC A;  4MQV A;  2FXA A;  2QQB A;  5LLQ A;  2CYY A;  1UB9 A;  2VON A;  5KVR A;  2GA1 A;  1J0R A;  5DD4 A;  3F21 A;  4HBL A;  1I27 A;  2OAZ A;  4I01 A;  2LKP A;  2GA2 A;  4LFU A;  1JHH A;  4I98 B;  4I0A A;  2NAZ A;  1PUE E;  4JBA A;  1XCB A;  1UFM A;  3F8M A;  1MZB A;  3ULQ B;  2YR2 A;  2ESN A;  4PGH A;  4UUV A;  3CLO A;  3R60 A;  1RNL A;  2W84 A;  1R23 A;  2K4B A;  4G6Q A;  4KNY A;  4LGW A;  3WTT C;  2GWR A;  5ILU A;  3BP8 A;  1TQP A;  3E6D A;  2HGC A;  2YPR A;  1ZHF A;  2RC4 A;  2X4H A;  3JSP A;  5JHU A;  5JVT A;  1RIO H;  4WCG A;  1Z6R A;  3MWM A;  4OMZ A;  3TOA A;  1IXS B;  3C3W A;  4ZYG A;  4TV7 A;  4OIN F;  4GXO A;  2FNA A;  2EA2 A;  1LNW A;  2ISZ A;  1WWX A;  4Y15 A;  4U0Y A;  3TO6 A;  1I5Z A;  5E18 F;  4XLN F;  5ICE A;  1XSX A;  1WI9 A;  4IXA A;  1ZG3 A;  3PQJ A;  3VFZ A;  1B9M A;  5DD8 A;  3ZMZ A;  4XSZ F;  4M73 A;  5F1R A;  5LGN A;  4P9U A;  4LLL A;  2R7F A;  5FD5 A;  2M8E A;  4AIJ A;  1KQ0 A;  2O03 A;  3GO5 A;  1ZRE A;  3VOD A;  2IA1 A;  1R5G A;  1TQM A;  1P4W A;  5TRD A;  5L3C A;  2JT1 A;  2ZNZ A;  3QPT A;  2GXB A;  2BV6 A;  3NQO A;  3FXU A;  5ICG A;  4GGG A;  3DV8 A;  4HX8 A;  3ZPL A;  2AXL A;  4HDU A;  1RUN A;  2QUF A;  5BPI A;  2NNN A;  3TOB A;  3WG9 A;  2Q8K A;  4BHC A;  1H9G A;  5CVU A;  1F4K A;  2RQP A;  1T2K A;  1FOK A;  3B73 A;  2XRO A;  2PMU A;  3DP7 A;  2JTV A;  4RS8 A;  3HOT A;  3L2C A;  4A0Y A;  5A2Q K;  1TW2 A;  4L18 B;  1G3T A;  2KIM A;  1UCR A;  1TBX A;  1TLH B;  2FNP A;  5FO5 A;  4Q4Z F;  2KIU A;  4RB3 C;  3VOE A;  1EH6 A;  4BXU A;  4NQW A;  4UV9 A;  4S05 A;  1G6N A;  5CVI A;  5CYV A;  3HSF A;  2EA4 A;  3WTZ A;  3BRO A;  4RGS A;  4UHT A;  3CO6 C;  5D6E A;  3LWF A;  4GO1 A;  4U7B A;  3EYY A;  5BMZ A;  5E1W A;  3HTS B;  1DPU A;  3LFK A;  5DUI A;  3FF5 A;  2PEX A;  4HQM A;  2QM3 A;  5CVR A;  3R6S A;  2IVM A;  2F2E A;  3ZN0 A;  4A5M A;  3V8K A;  1O7L A;  3SFZ A;  2H6C A;  3FM3 A;  2FU4 A;  3GVA A;  3R61 A;  3W6K B;  2O6G E;  5FLX K;  2L4M A;  1HW1 A;  3FZV A;  1B9N A;  5BQT A;  4XRF A;  1XMA A;  3K1N A;  3OV8 A;  5CJ9 A;  2DAO A;  2K4J A;  4RAY A;  1UHM A;  1E2X A;  5HDK A;  5LEJ A;  2HTJ A;  2XHK A;  5KK1 A;  2STW A;  2WWY A;  5IT9 Z;  5D5X B;  4U0V A;  2XAF A;  5DYM A;  1FSH A;  1R5H A;  1R22 A;  3HOS A;  2RNJ A;  4KMF A;  3K1P A;  2ZNY A;  4G7H F;  1ZG1 A;  2D45 A;  4YFK F;  5D8K B;  1IUY A;  2K7L A;  2QZ8 A;  2P6T A;  2IW5 A;  2HEO A;  2EV0 A;  5AIQ A;  5LRS A;  3L9F A;  4LD5 A;  2IA2 A;  4CO8 A;  2FE3 A;  2WV0 A;  3CUQ B;  2QBY A;  5CVJ A;  1FP2 A;  4HQE A;  1IW7 F;  2DQL A;  2OBP A;  1R1U A;  5BS6 A;  1U5T B;  4A12 A;  1K79 A;  1R00 A;  1P4A A;  3LAP A;  2W24 A;  2HDC A;  3CJN A;  1KGS A;  5TJJ A;  3BZ6 A;  1IRG A;  2G9W A;  3KP3 A;  3IHU A;  1D8J A;  3M9A A;  2HQN A;  1J9I A;  4GCV A;  3K0L A;  1PP8 F;  2VOD A;  3GEZ A;  3IRQ A;  3N97 A;  5LGT A;  1AWC A;  2V1X A;  2K27 A;  1ZN2 A;  3OOP A;  4M9X A;  3R4K A;  1K7A A;  3TO7 A;  1QQI A;  1CGP A;  2EFO A;  1ON2 A;  2XIG A;  3WU1 B;  3SQN A;  1YG2 A;  2NYX A;  2A6H F;  4ENK A;  2HQR A;  2DQR A;  2YU3 A;  3EUH A;  1XSD A;  5F6F A;  3E6B A;  3IC7 A;  1K78 A;  2O0Y A;  3HRM A;  3DPL C;  4YFN F;  2NNY A;  3GFM A;  2QQ9 A;  3BJ6 A;  3ZMV A;  3KZY A;  3ECH A;  3T0Y A;  4FHT A;  4KT5 C;  1BOA A;  2FA5 A;  4KIG A;  3T1B A;  1IZ1 A;  1FYL A;  3HSE A;  3I4P A;  1EH8 A;  2G7U A;  5AON A;  4EQQ A;  1YS7 A;  3KFW X;  1J5Y A;  5FFZ A;  4LG0 A;  4KN7 X;  4XSX F;  3J80 Z;  4WF2 A;  4BH9 A;  4AIK A;  2IJL A;  1IXC A;  3C7J A;  4M6X A;  3JTH A;  5DCF A;  2IT0 A;  1BC8 C;  4KA4 A;  4RGX A;  1NHA A;  5HLH A;  3DFG A;  1FC3 A;  1HKQ A;  4FT8 A;  2ISY A;  5ERI A;  3J7A O;  2RN7 A;  3BJA A;  1ZAR A;  4HX7 A;  2RKH A;  5CVV A;  5DCM A;  2V6C A;  2LF8 A;  1ZRF A;  3WTY C;  5ICF A;  2E1N A;  2FQ3 A;  3V7R A;  2FBK A;  4BQA A;  2OU2 A;  3VB2 A;  3IKV A;  3M8E A;  1T6S A;  1H9T A;  4ENN A;  4CHU A;  1LDJ A;  1YO5 C;  3EQL F;  3L00 A;  4WX9 A;  4KN4 X;  4HV5 A;  4MHG A;  2IA0 A;  2L01 A;  1ODD A;  2JSC A;  1HW2 A;  3WGI A;  2EWN A;  4OIQ F;  2V9V A;  3DQV C;  1PP7 U;  1BI1 A;  4GYI A;  1T0F A;  1G3Y A;  2XRN A;  3CTA A;  3GFI A;  1B59 A;  4G94 A;  4KDP A;  3RKY A;  4PZJ A;  3EDP A;  1MJ9 A;  1YYV A;  2KRF A;  2DFI A;  2D2W A;  1BN5 A;  1STZ A;  2V1D A;  4EJV A;  2F5D A;  4EGY A;  1FX7 A;  3I71 A;  3SHF A;  2M87 A;  1ZG5 A;  4A6E A;  3E6C C;  2XUB A;  3LQQ A;  3GWZ A;  5IT3 A;  4ZYH A;  1MJA A;  5E17 F;  1SFE A;  3U9G A;  2ELH A;  1XMK A;  5L3G A;  2ZBK A;  1FYM A;  2OD5 A;  4F7Z A;  3KCC A;  4LLG F;  2FEZ A;  2GZW A;  2VBZ A;  3SZP A;  1SFU A;  1KU9 A;  1W5T A;  3RKX A;  2XAS A;  3KZZ A;  2HKO A;  3I54 A;  2DI3 A;  3JAM K;  2XAG A;  1YLF A;  3WTS C;  3ZP5 A;  3RIR A;  1IAW A;  2ZME B;  2P5L C;  4HLX A;  3IWF A;  2Z33 A;  2L3D A;  3CUQ A;  4M74 A;  1S29 A;  2HYF A;  3LA3 A;  1J2X A;  3ABT A;  3I64 A;  5LEK A;  2GXG A;  4LMY A;  3V8L A;  3HYI A;  4N9H A;  3K69 A;  5J8F A;  2ZO4 A;  1D8K A;  3MEX A;  3JAM Z;  5H20 A;  2RV8 A;  3SZT A;  3L7W A;  1YFH A;  3F8B A;  1HKT A;  3GF2 A;  2A3S A;  3E6M A;  1LEB A;  3I58 A;  1GXQ A;  2A5Y B;  3KEO A;  3WE2 A;  1RI7 A;  3NRV A;  4EVI A;  1QPM A;  1GHC A;  5E20 A;  2QWW A;  4WWC A;  2D1H A;  2F5C A;  3WTX C;  2JRT A;  1FPQ A;  1XN7 A;  4OOI A;  4H0E A;  1LEA A;  1IF1 A;  1OPC A;  1YQA A;  3QPH A;  4WXD A;  1KU7 A;  4IHT A;  4HF0 A;  2K86 A;  1SMY F;  2EFN A;  2P8T A;  2XAQ A;  5LRR A;  4AWX B;  3MQ0 A;  3ELK A;  2DPD A;  3HTU A;  3HRU A;  1HBX G;  2ADU A;  3ABU A;  3WGG A;  1E17 A;  4M9Z A;  1OR7 A;  1C0W A;  4AIH A;  4HV6 A;  3KET A;  4KIF A;  4AVP A;  1T98 A;  1OMI A;  4K2E A;  4LLN A;  2W57 A;  4WXH A;  2JPB A;  2M5W A;  3C1D A;  2QVO A;  2FMY A;  4EV0 A;  3R0J A;  2A6E F;  5D8L B;  2O8X A;  5E1Z B;  1REP C;  3GZ5 A;  1O3S A;  4M71 A;  1LB2 A;  2E1C A;  2R3S A;  4MQ9 F;  4CZZ A;  4N0B A;  2CSO A;  5D5W B;  3TDZ C;  2L4A A;  4LG0 B;  2EV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...