4XIDA

Antphd with 15bp dna duplex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeotic protein antennapedia
publication title Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulator/dna
total genus 19
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xidA00
1LE8A 3BTLA 2EH3A 1X2MA 2K40A 3JR9A 1TWAJ 3BR3A 5FLVA 2ZB9A 1W0TA 4A93J 3CMYA 1RPWA 4A3IJ 1JUMA 2M0CA 4DZJA 3RKQA 4I76A 1WH7A 3PO2J 1RR7A 3OOUA 3FK7A 4C3JJ 1RKWA 2K9SA 4LOCA 2DA2A 3JRHA 3Q0WA 5K7FA 1QPIA 3WHBA 5IP6A 4BBSJ 4V2FA 2WB1N 5DTDA 1IV6A 3Q3SA 3TEDA 4Y52J 1JUPA 1RKTA 1Y1VJ 2CU7A 2QCOA 4MLOA 3G1MA 5IP9J 3HOWJ 5IOZA 3JRCA 3S2DJ 5EG0B 1NK3P 5IP7J 3BR5A 3QPLA 1B72B 3HGGA 4D5FA 3BTCA 4A3KJ 1DU6A 1GUUA 3A01B 1FIAA 1APLC 1MSEC 3HBLA 1B8IB 4Y7NJ 1UHSA 2ELKA 3BTIA 5EGOB 1AU7A 3JREA 1MSFC 2XPVA 4UUSB 1X58A 4C2MJ 3FKIJ 3LOCA 2WAQN 3HGYA 3LSPA 2NVYJ 5EGOA 1YRNA 1WI3A 1K61A 1Z0XA 1U9OA 4M3FA 2R92J 2HDDA 3LNQA 4XIDA 3JRIA 2EZIA 2VPRA 5E3MA 2MG4A 2M2EA 3OSGA 1DU0A 1FTTA 2O9LA 4IEJA 2LK2A 3IV5A 2FX0A 4CYCA 2M8GX 1VI0A 1WH5A 2DMUA 4IHWA 1A6IA 1JGGA 2X9DA 1MBFA 1WPKA 3TP0A 1F36A 2E19A 3FIWA 2KT0A 1HF0A 3HOUJ 5GPCA 5EDNA 2O7OA 2COBA 4GFBA 1S7EA 3G1OA 3IH2A 1ETXA 3F0CA 1X2NA 1FJLA 4M3BA 2IAIA 2L0KA 2MSYA 4X6AJ 1WGXA 3HOZJ 2DA5A 2Y9YA 1P7IA 5FKOA 4W97A 5JLWA 3GTPJ 1MBKA 1XS9A 1VF9A 4IHYA 2R5ZB 2AHQA 2YU9J 4UUTA 3S1NJ 3S17J 5JLXA 3BG3A 4BY7J 1JKOC 4XRSG 3PO3J 1IGNA 1I6HJ 2EBIA 1QRYA 4DYQA 2JA6J 4MFDA 1R9TJ 4D7NA 1BW6A 3LSGA 1LE8B 2LKXA 3BT9A 2E2IJ 1QVUA 1ETYA 3ZQCA 2YS9A 1JJ8C 3JRGA 5K7ZA 1GV5A 2CJJA 4A3GJ 3BG9A 3HDDA 3DEWA 3CQZJ 4I6ZA 1I3QJ 1TWGJ 4S0HB 2DMNA 1FTZA 4M3DA 5F1JA 2VKVA 3I4MJ 4DYCA 3ZQFA 1MH3A 4G12A 2E2JJ 1LFUP 3NARA 4D7MA 2I10A 4BXXJ 1QVTA 1K83J 2DA4A 4A69C 3BG5A 3ZQIA 3HM5A 3SFIA 4EEFG 2XB5A 4W1UA 1TC3C 5M5XJ 1T56A 5F0FA 5F08A 3FK6A 4L5EA 2E1OA 3E7LA 1EF4A 4MO7A 3G1LA 5FKMA 4A3LJ 2DA6A 3DCFA 2TRTA 2LTPA 2ID6A 2XB0X 4QIWN 4IHXA 2G0EA 1U8BA 3O8HA 1VNDA 3LSRA 5E3LA 3GTJJ 3VPRA 2R0QC 3S15J 1D5YA 1HDDC 3W6VA 5F0HA 3PM1A 2PMZN 1YRNB 1P7JA 1ETQA 2W48A 1NTCA 5EF6A 2ME6A 2HOAA 2ECCA 4ABZA 1AKHA 2K9QA 1FEXA 2M9HA 3FISA 3S14J 1CQTA 4CYCB 1I50J 5C44J 1IUFA 3S1MJ 5HODA 4DW6A 1LFBA 1JTXA 3QPSA 3UKGA 1ZR2A 2Y0SN 1IC8A 4FISA 1ZKGA 3C2BA 5C4JJ 1ETOA 3SDGA 2MGQA 3JRBA 2GLOA 1MBJA 2NVXJ 2L9RA 2XGCA 3M3YJ 1MBEA 2R93J 1G2HA 2IBDA 1ORKA 2ID3A 2DTZA 3D1NI 2FQ4A 4A3EJ 1U78A 3Q0UA 2FJ1A 2EZHA 1MH4A 2LLKA 3B6AA 2ME0A 1F43A 1ETKA 1GVDA 5IYCJ 1T33A 5EEAA 5FKLA 3A02A 1MNMC 2R7ZJ 2HXIA 2Y31A 4JX4A 3GBGA 1H89C 4AC0A 3SJMA 1HDPA 2XPUA 2JA7J 3A03A 1ZK8A 3OIOA 1TWCJ 1O4XA 1JTYA 4A3DJ 5DS9A 3LSJA 1Z77A 3BQYA 3ZQHA 4DZPA 2XPWA 4FCYA 1ITYA 4D5CA 2KDZA 4IHVA 1JT0A 1UG2A 2Y2ZA 3BQZA 2JA5J 4FE4A 4M3EA 3BR0A 2QF7A 3Q0VA 3HEFA 2VKEA 2E2HJ 4M6VA 5FLMJ 1PUFA 2DJNA 1ZGWA 1HOMA 3JRDA 1MBGA 1IJWC 2HOTA 4RDUA 2OPTA 4BY1J 1JKRC 2K9NA 1H8AC 5K7HA 5IYBJ 1Q1VA 2LR8A 5C4XJ 3RQIA 3MN2A 3RZDJ 4V2GA 2GM4A 1H88C 4AUXA 1UMQA 3HOXJ 3OSFA 2NOGA 2P81A 1GV2A 1HLVA 2X6OA 2CQXA 1POGA 3BTJA 2JN6A 4QTRA 2HXOA 4A3BJ 1JT6A 5IOYA 3I4NJ 1SANA 1JUSA 3HKZN 4JP0A 2DA3A 4A3MJ 2CRGA 3JRFA 4C3HJ 5M5WJ 2NVQJ 5M5YJ 2EQRA 1A5JA 4A3JJ 4MFEA 4NDLA 1OJLA 2HYJA 2NS7A 2EZLA 3ZQGA 5EZGA 3ZOBA 3K2AA 2FD5A 4A3FJ 3GTLJ 5F04A 3RZOJ 5C3EJ 5EYRA 5J3LA 5J1UA 4FTHA 1BA5A 4M3GA 1OFCX 3NAUA 2N8GA 3GTGJ 1BJZA 5F0CA 2XRLA 1ZR4A 1TWHJ 3GTOJ 9ANTA 4XRSA 1NK2P 1AKHB 3M4OJ 5FKKA 2DN0A 2ECBA 1ZTRA 5J1RA 1E3OC 3TP3A 5IYDJ 1JKQC 2JA8J 3S16J 3TW6A 4BKXA 2H1KA 1ENHA 3JRAA 4J19A 5EG0A 2CUEA 2D5VA 1RETA 2XGEA 4RBOA 1JJ6C 1B72A 2B63J 3BR2A 1ETWA 4B4CA 3HB9A 3A01A 2LVSA 5EZHA 1TWFJ 2JMWA 4XRMA 2IEKA 5J1YA 3CDLA 5BNGA 1B8IA 1IG7A 5E3OA 2DMTA 2TCTA 4BBRJ 5GP9A 1FIPA 2NS8A 5M3FJ 5M3MJ 4UUSA 3BR6A 4JX5A 2YUSA 1MBHA 2LD5A 2CUFA 3GTQJ 3B6CA 2CQQA 2LFBA 3CCYA 2JJ7A 3BR1A 3S1QJ 1GT0C 3GTKJ 1IRZA 2DA7A 4HNVA 1BL0A 2AO9A 2DA1A 2XSDC 3IH3A 4MIMA 4AYBN 5F27A 2RAEA 2JWTA 2NVTJ 4X1EA 3TW7A 4A3CJ 2HI3A 3IH4A 1ETVA 2HQ5A 1GDTA 2LY9A 1Y1WJ 3H3VK 3S2HJ 3QQAA 1ZQ3P 4B3AA 1PUFB 4FE7A 2VI6A 4DYRA 5E3NA 5GPAA 2O8KA 4XICA 2XGDA 1IDYA 3WHCA 3MVPA 5FJ8J 1IDZA 4JYKA 2LP0A 5IPAA 1U9NA 4XK4A 2DMPA 1JKPC 2X48A 2Y9ZA 3GTMJ 1OCTC 1HCRA 2L7ZA 1XG1A 4QSHA 2VUMJ 3O8GA 3K7AJ 1VFCA 2Y30A 1SFOJ 1RESA 2L7FP 2OF7A 5FKNA 1XC5A 3HOYJ 2R5ZA 3S1RJ 2H8RA 2WV1A 2M34A 2R5YB 1AHDP 2JK3A 2L7MP 2MW8A 1W0UA 2HOSA 2GBYA 4B1RA 3ZQLA 3MKLA 2R5YA 1WCMJ 3L1PA 2DMQA 2EZKA 1OCPA 1BW5A 4JX6A 3H0GJ 4C3IJ 3HOVJ
chains in the Genus database with same CATH superfamily
2LBFB 4NQWB 2H1LA 5E1ZB 1FPQA 2E5NA 5E8IA 2K40A 2QSFX 3BR3A 1MMGA 2CSOA 1W0TA 2A68F 2FOWA 2JPBA 3CMYA 1RPWA 4PDKA 2M0CA 1HW5A 1D1AA 4RS8A 2WAEA 1O57A 1U5TB 4IKFA 3OOUA 1EA3A 2XVCA 1RKWA 3SDBA 1YYVA 3Q0WA 4EJUA 3WHBA 3HC7A 4V2FA 1AA7A 2UXXA 2XSJC 3GLLA 3S3OA 2A69F 1JUPA 1Y1VJ 2CU7A 2QCOA 3GWZA 2GXAA 3OYDA 2KKOA 3DEUA 3H5NA 3R61A 5EG0B 2RKHA 3BG7A 3GFMA 5DD8A 1QPMA 2X0LA 1QBJA 4D5FA 1QGPA 2F4IA 3BTCA 4A3KJ 5LHHA 1UB9A 1W7PB 1G3WA 2JA2A 2Y0MA 1BI0A 2P5KA 2PBIA 3H35A 3MKYB 1KGSA 2NS0A 3BCAA 4Y7NJ 4N9IA 2KISA 3TGNA 3EDPA 2QQBA 2BVMA 3GFIA 3LOCA 3HGYA 1RIOH 1EV7A 3SZTA 4AD9A 2HDCA 5BMZA 5EGOA 2GAUA 1K61A 4PSXA 1VQ7I 4O6JA 1LVKA 3FHZA 3PIPF 3DF8A 3JRIA 1YS6A 2VPRA 1DUXC 5E3MA 2DW4A 2M2EA 4EJOA 2D1HA 2FX0A 4CYCA 1N75A 3AKZA 1BJAA 1BN5A 2L54A 4Q5SF 2M8GX 3ZCOA 3PQKA 4I09A 2PJRB 1X4PA 3REOA 3FXUA 1D5VA 3LA2A 1JGGA 4IZZA 2QQAA 2X9DA 3TP0A 2E19A 3MCZA 4CCLA 4BDYA 4G7ZF 2KT0A 1QO0D 1SFKA 2O7OA 2DCEA 5L3CA 2ELHA 2E1MC 3FXQA 4XN3A 3T0YA 1W36C 1S7EA 1S72I 3G73A 2IS2A 3IH2A 5D4SA 3J7AY 3DKXA 1FJLA 1FMVA 2YPRA 3P9CA 5GAHJ 4M73A 3U1DA 2IS6A 4X6AJ 4LK1F 2G9WA 3HOZJ 1V5EA 2Y9YA 4HSRA 5JLWA 1KU9A 4C2TA 4E7KA 4LD5A 2XF6A 4UUTA 3DPLC 2V9KA 4BJ6C 1LDJA 3S1NJ 2NYXA 5JLXA 2J5OA 4BY7J 1MD0A 1SAXA 1FOYA 3B73A 2KZVA 2LY1A 1I27A 5KVRA 1I6HJ 2EBIA 3SEZA 1YLFA 1FC3A 1HC8A 2OV7A 1KA8A 4HOBA 3FZVA 3AL0C 3F6OA 4R79A 2GQQA 1WJDA 5K7ZA 3IRQA 1BOBA 1IN7A 2H6BA 3RKWA 3WTYC 1SVOA 3HDDA 3DEWA 4KT6A 2MD0A 2L3DA 4I6ZA 2NRAC 1TWGJ 4CCJA 1BBYA 4EVIA 2EILH 4WXHA 5DM6F 3TO7A 3TO6A 2XF7A 2GA1A 4HW0A 5IT9Z 4DYCA 1U0JA 4XKCA 3L2QA 5FD5A 3ZQFA 4DBQA 1MW7A 2LREA 3RJPA 1LFUP 1X1CA 4XLCA 5ED4A 3F3XA 4XMYA 3EYYA 4XR6A 4WWCA 4PJ0C 3BG5A 2XAQA 5LRSA 3BG6A 4FT8A 3ESWB 4EEFG 2XB5A 4YFNF 1TC3C 5M5XJ 1T56A 1U6GA 4RGRA 3BJAA 3H3UA 5FLXZ 4B44A 3MFKA 4L5EA 1R71A 4Y15A 1QQIA 5FB2A 2M4KA 4EJTA 1YJNI 1EF4A 1T95A 3PFIA 4KA4A 4BH9A 2DA6A 4IOAF 2MC4A 4ANJA 2XB0X 4QIWN 1E2XA 1S29A 2G0EA 1QU3A 3GZNB 1VNDA 2NAZA 5E3LA 1SD5A 3OIPA 4YIIA 2GWRA 2V1DA 3FM3A 1HDDC 3W6VA 3O3KA 1U8RA 5F0HA 4F3QA 1P7JA 5J4VA 1YO5C 3HSEA 3HTSB 3PSFA 5EF6A 2ME6A 2HNHA 1VQKI 2HOAA 3VWBA 4GRIA 1X4OA 3FISA 1A35A 3OMYA 1CQTA 1D1BA 5C44J 2M8EA 3S1MJ 2VKDA 2M7BA 2MH9A 2X85A 4PJLA 1MMDA 3UKGA 1RUNA 5FFXA 3CCJI 1ZR2A 2RDPA 3DU6A 4AM3A 4RGUA 4FISA 3RKYA 5C4JJ 4RM2A 3SDGA 4A0ZA 2MGQA 1IV8A 2A6EF 3VB2A 3LFUA 2HYGD 3BP8A 2NVXJ 1MBEA 2R93J 4DNCA 4YEJA 3G3ZA 2ID3A 5CQEA 1Z7LA 3WTXC 2FQ4A 2QYOA 2FJ1A 3HZJA 1MH4A 3B6AA 2COMA 3EUHA 3GFJA 2ZFUA 5EEAA 1Z6TA 2OU2A 5FKLA 3AG4H 1H89C 3H1CA 4BACA 1E17A 4J01A 2W1OA 1F1ZA 3WTTC 1O4XA 4BAYA 1XCBA 5TISC 1KQ0A 5FRNA 4A6DA 4P5OA 3ZQHA 4G8XA 1HKQA 2QENA 3AG3H 3LA3A 2EINH 5IY5H 1R1UA 3BQZA 3DBRB 2JA5J 3AG2H 4FE4A 4XLAA 3Q0VA 4HF1A 1VQPI 4HRIA 4G7OF 3IAM2 2L4MA 1PUFA 1HOMA 1MBGA 2HOTA 5J6XA 4IOCF 3HPHA 1JKRC 2QQ9A 1FYMA 1XB4A 1A04A 2W00A 5K7HA 2KDOA 3RI4A 3KP4A 4GYIA 3EPZA 2X4HA 5H2FC 4OWRB 2X6YA 3RZDJ 4Z6YA 2HQNA 2H94A 3C7JA 2GM4A 4AUXA 1UMQA 4PGHA 3IKVA 1B59A 2STTA 4YIRX 3ELKA 2NOGA 2QLZA 1GV2A 2ZSHB 2BY3A 5KK1A 2AS5F 5J47A 2EB7A 2KIMA 1Y0UA 1D8KA 2LKPA 3L2VA 4MFEA 3NQOA 4NDLA 4LB5A 1B6AA 3ZMSA 4G94A 1PUEE 3OL3A 2NS7A 4XKWA 1G59A 1IXRC 2Z16A 1IUYA 1M1EB 4ZDLA 1HW1A 1XN7A 3CJQB 4EV0A 1WI9A 5EZGA 1GLNA 1Q1HA 5LBQA 1XDUA 4RAFA 2W24A 4A3FJ 5F04A 1OISA 3RZOJ 3D5RC 1BR4A 4MEXF 1H9TA 5J3LA 4GXOA 3K4BA 2KIQA 2UV1A 4M3GA 3NAUA 1B1BA 1ZN2A 3SXYA 1TBXA 4PK4A 5F64A 1RI7A 1IN6A 2F5EA 2LRDA 1HQCA 4BQNA 3WTZA 1Z9CA 2IRFG 1NK2P 3WU1B 3M4OJ 2V1NA 3PQJA 3K70D 3TP3A 1KQ9A 2JA8J 4EQQA 3DTIA 1XCVA 1XMXA 1OLTA 2CUEA 4BL0B 1R5HA 4KUMA 5LEJA 1RETA 3HTUA 4RBOA 5CPRB 2YSRA 5J40A 2JTVA 5EZHA 1KU3A 4S04A 4LK0F 2JMWA 3J81K 1SVLA 5J1YA 1B8IA 3BDDA 3PNYA 2LC2A 1TL8A 3MAJA 1W5SA 4LITA 4BYYA 3N05A 1PP7U 4CH7A 2V9VA 1WZ2A 3GTQJ 4PJNA 3LAJA 2PEXA 3G2BA 4BE1A 1F9NA 5K5OA 4ZYGA 3VODA 1MJBA 1ON1A 2JJ7A 2RQPA 1SD4A 2BW3B 4M74A 3DBHB 5B1AH 2XSDC 1WSUA 3DP7A 3J80K 2VLAA 5HDKA 3AAFA 4M9XA 4X1EA 4GYGA 3RKXA 2AQFA 3KP5A 2IGOA 3H9JA 3K1PA 2HI3A 3IH4A 1ETVA 2HQ5A 1KU2A 3I71A 3CP2A 4HX7A 2GA2A 1T2KA 4L9TA 4DYRA 5E3NA 3BJ6A 4HDVA 5L3GA 1WJBA 2O03A 2XGDA 2OD5A 3MVPA 4PSWA 5TRDA 1WHUA 1U9NA 4XK4A 4JK1X 2X48A 2ZXJA 2VQCA 3DFGA 2HQAA 2LG4A 3PIOF 2DOFA 4QSHA 3O8GA 2RVCA 4BEHB 2Q8KA 2QBYB 4WK8F 2XV4S 2JRMA 3BZCA 3CP8A 1OR7C 3DV8A 3I58A 3PUFA 3HOYJ 2E7XA 1UAAA 3KP2A 3E5UA 3M07A 2R5ZA 2WV1A 1VQ6I 2R5YB 2FRHA 2L7MP 2ZJRF 2DPDA 2E36A 2MLKA 2GBYA 3ZQLA 2I5UA 2XAJA 4KT5C 2VC0A 1P92A 4RAGA 2DMQA 3A0BC 3L1PA 2EZKA 1I39A 4MQ9F 3SFZA 2VBWA 3CUQB 1ZREA 1KYWA 1RRJA 1LNWA 4G6QA 4BE2A 4E7JA 4BJTA 4LG0A 3JR9A 1XD7A 1S3JA 1MZBA 3WGIA 2JVGA 2VN2A 4PFOA 2ZB9A 5DYMA 1L0OC 3V42A 4XQFA 3ABLH 4ZZDA 4D9JA 3RKQA 1DGWY 3ERMA 1FBUA 2CGPA 1WH7A 1J7KA 2E34A 3FK7A 2ZO4A 4XRFA 4C3JJ 4LOCA 2K9SA 2VBYA 4IQ4A 4WF2A 4RB3C 3TO9A 3MKZA 2DA2A 1WJ5A 1RZ4A 5DCFA 5B66C 2DFEA 1UJ8A 2P6TA 1UELB 2Q0OA 2RNJA 3BZKA 4XNFA 5DTDA 4A12A 5J8CA 2V1XA 3C3WA 3Q3SA 4F92B 3TEDA 4Y52J 2O6GE 2K86A 2H09A 3RIRA 2VODA 3VYSB 2E60A 4XSXF 3BZ6A 3S2DJ 4HV6A 2DU9A 5DCMA 5D8LB 4AWXB 5IP7J 5HLIA 1MJ9A 1OR7A 3NEUA 2UUZA 3HGGA 4KIGA 1DU6A 1GUUA 1TZLA 3A01B 1FOWA 1R1VA 1V54H 1DQUA 2P8TA 2EV6A 2KPMA 4RGXA 2R7TA 1UHSA 2ELKA 2A05A 4RB1A 3BTIA 5EGOB 5F1RA 1SFXA 3OYBA 3JREA 1MSFC 1NHAA 1K4TA 2WAQN 4Q48A 2R7FA 3LSPA 1U3EM 4DIQA 4XOTA 1YRNA 3FHNA 4Y33A 2QSHX 3GXOA 3FXKA 3OYNA 2R92J 2HDDA 2KIFA 2XAUA 3S8PA 1LFPA 1O3SA 3OS2A 3OSGA 1FTTA 2JPCA 1WJAA 3BCBA 2L9SA 3G4SI 4CCMA 3CC7I 3WE3A 3P9IA 3OYHA 2OAZA 3LA7A 1Z21A 2EFNA 4UHTA 3EETA 4HZFA 4HG2A 1YW7A 1WPKA 1F36A 4YIFA 5D5XB 3FIWA 3SHFA 2MABA 4XLEA 1HF0A 5GPCA 4CUGA 2EV5A 5EDNA 1ACIA 1VQ5I 3KP7A 4ZTJA 1WJEA 4XORA 4LGWA 3HXLA 3V7SA 3G1OA 4XONA 3SZPA 2HZTA 1TQIA 1K78A 2LDUA 1A31A 2L7KA 3HRUA 2O3FA 3E0JB 3TOBA 4ESBA 2L0KA 4RM3A 5JHFA 3IWZA 3ABTA 1XPXA 2ZFWA 1S6LA 2ESNA 2P7VB 2BHYA 3OS1A 3U1KA 1R49A 4W97A 3K4JA 3H5AA 3GTPJ 1MBKA 3RDIA 1VF9A 1XGOA 4U0WA 3ZQQA 2Z33A 1I6XA 2YU9J 1JKOC 3PO3J 1XSXA 2IXSA 2FOKA 2DT5A 2Z5UA 5D6FA 1J9IA 1SFEA 1R9TJ 5L3FA 4EJWA 1PYVA 4PCQA 3LSGA 1LE8B 1X1PA 3BT9A 2EFQA 3L09A 2W82A 2WV0A 1QVUA 2A5YB 3CMMA 3JRGA 4FX4A 1JJ8C 2HVRA 2B7EA 3CC2I 3GMEA 2CJJA 2OCCH 1EH7A 3BG9A 2OZ6A 1T98A 1QNTA 5H6QA 2M30A 3CQZJ 1Z3YA 3A4CA 2QQ8A 3DLLF 5E17F 2QZ8A 2IJLA 5CLSA 4S0HB 4U0YA 2DMNA 1TT5B 2VKVA 3I4MJ 1MH3A 4OINF 2JSCA 2IA1A 1D0YA 3GVAA 4ZYAA 2IS1A 1X1BA 3FXJA 5ILVA 4GO1A 5GTHC 4BXXJ 1ZLJA 1IN4A 1A6QA 3GLXA 5LLQA 1R22A 2Y75A 2K85A 2BXYA 2BE5F 4W1UA 4KICA 2NOJB 2KMUA 1K6YA 3FK6A 3NRVA 3KEQA 4YRVA 2LH9A 2DLLA 5F6FA 3E7LA 2Z3YA 3N97A 2HR3A 4QLCU 1KQ8A 4MO7A 4A3LJ 4M6YA 3DCFA 2HGCA 5FGMA 2ID6A 3EUKL 1QZYA 4A0XA 3LSRA 3GTJJ 2L9VA 1E3HA 3F8BA 3AL0B 1HKSA 1RUOA 1D5YA 3CLOA 3U21A 3ZQ7A 4AIKA 2CG4A 2V9PA 2ZMEC 1ETQA 2ADUA 2EA4A 5JVTA 2O61A 4XLFA 5JFRA 1OYIA 5ICCA 2VPLA 2DK5A 3WTVC 4Q4ZF 1FP1D 1MNDA 2VASA 2KJBA 2QEXI 2CS3A 1BOAA 3IRRA 1AKHA 2K9QA 2M9HA 3S14J 2RGVA 3CLQA 3W2AA 3KX2A 4DW6A 1LFBA 3B02A 2CUJA 3ZN0A 3H92A 4S05A 1USSA 2GXBA 5KAFC 1P2FA 3KYDB 3RSNA 1IC8A 2X6XA 1EJ9A 1ETOA 3UNGC 4H0EA 3FXRA 2IGMA 2HEOA 2DI3A 3AFHA 2XGCA 4X0GA 2VL8A 3VSLA 3D0SA 4PUSA 3S3NA 2Q2EA 4LLNA 1S5LC 3HUGB 2LLKA 4E7IA 1ETKA 3QYFA 2R7ZJ 2QA4I 4FETA 1MNMC 5CVVA 3L2CA 1OQYA 2WWYA 4AC0A 3HG9A 3KE2A 3BWGA 1HDPA 2XGXA 1VQ9I 4U7DA 3L7WA 1MDMB 3Q9SA 3OIOA 1TWCJ 4PGGA 2VKHA 3P9KA 4A3DJ 1O3TA 4UNOA 3JSOA 4FCYA 3BQYA 1WJFA 2XPWA 4RB0A 3MD2A 3WTSC 2DXIA 1OCCH 2ZMEA 2O5RA 2DQRA 2LF8A 2Y2ZA 3E3VA 2EK5A 4M3EA 3BR0A 2QF7A 5E79C 4I7HA 2VKEA 1HKTA 4IXAA 2E2HJ 3OYEA 5FLMJ 2AXTC 1WJCA 3KFWX 4F55A 3JRDA 1F5TA 1Z6RA 2OPTA 1D8JA 4V19K 3FXMA 4ZYHA 5IYBJ 1Q1VA 2LR8A 2Y48A 2HZDA 2VOOA 2ISYA 4CHUA 3E5XA 1UFMA 1V4RA 4V2GA 2F2EA 2JSPA 5HLHA 3OYFA 3GF2A 4LJZF 5ERIA 1YFHA 4JBAA 5D8KB 3OSFA 4MNUA 1Y0NA 3E6BA 2JUGA 2R3SA 4E4HA 4HDUA 3GFLA 3BTJA 2EJRA 2JN6A 1JT6A 1YJ9I 4BQOA 1ZRDA 1O3QA 4JP0A 2CRGA 4YFKF 4CCKA 1SD6A 3I59A 4ENKA 4C3HJ 5EEGA 4ZZLA 4ZTFA 2NVQJ 4G6TB 2EQRA 1A5JA 1J2XA 3FBIB 3K2ZA 1H0MA 2BYVE 1PJRA 2B0LA 2EZLA 2LBFA 5CVRA 1OMIA 2VQHA 2CW8A 3EUHC 4NQWA 4OMZA 4E7SA 3DWLE 2MFZA 2DDBA 1LDKB 5B1BH 4HX4A 4CA0A 3I56I 1G6NA 1MNEA 1G8XA 5EYRA 4UB6C 4IL6C 2H6CA 2DYSH 4M72A 1U5TA 1BA5A 3OY9A 5HNFA 1T08B 4NBQA 3C2HA 4HX8A 4ZYEA 2DFHA 4WXCA 1K79A 2HYFA 5F0CA 4PJMA 2IT0A 1OCZH 4PJJA 1R1TA 5HLTA 5FKKA 3PNVA 3HOTA 1X1DA 1MKMA 1ZTRA 3R0JA 2DT7B 5LGUA 2MBFA 3KZYA 4KN7X 1NH3A 1JKQC 2PQ8A 2XF5A 1C0WA 1EKEA 1ENHA 2PMHA 2H1KA 2UXNA 2L9NA 5EG0A 3FDYA 2P7CB 2X1CA 5HS8A 3CCEI 4WCGA 4MTEA 3K70C 2EFWA 2QWWA 2B63J 2EWNA 2TDXA 2P5LC 1ETWA 4B4CA 2UZKA 5DUIA 1YTYA 2LVSA 1TWFJ 2VJIA 4GGGA 2TCTA 3J7ZI 1ZRFA 1USTA 1Y6IA 4M9ZA 5GP9A 2HFHA 2XUBA 4BHCA 5M3FJ 3KETA 1K4SA 3O6BB 3BR6A 4QPOA 4E7LA 1IF1A 1ZHFA 2WC2A 3QU6A 3L9FA 1MJAA 3GYHX 1MBHA 3PUBA 3T1BA 4EGYA 2LD5A 2A3SA 2PMUA 2FF4A 3L2WA 1P4XA 2CQQA 2R7RA 4P55A 2LFBA 3QPTA 2GOXB 4A6EA 4HF2A 3TL4X 1IRZA 3SQNA 1O3RA 2VJ4A 2DT6A 2RN7A 2MA3A 4MIMA 4AYBN 4EM1A 2JWTA 3H9GA 1BI1A 3U2RA 4E70A 2M87A 1GHCA 2QKMB 3C18A 1GDTA 2K3FA 2LY9A 3GCMA 2PJRA 1V55H 5D5WB 3S2HJ 2KLOA 1BR1A 4B3AA 2GOMA 4HLXA 1HBXG 2OZUA 3MQ0A 3CCSI 5A2QZ 1IDYA 3WHCA 4E6KG 3QODA 2FXAA 2OQRA 3KP3A 5IPAA 4C9YA 2PX9A 4IHSA 2D1VA 3GTMJ 2XRNA 2WBMA 1HCRA 2VXZA 3IAS2 1K6OA 3CCQI 3GZ5A 4LMYA 1SVMA 2DBBA 5E20A 2BZTA 3K7AJ 2Y30A 4IX7A 1SFOJ 5LFAA 1XMAA 2RNGA 1W7PD 3F6VA 4QPQA 1LUJB 4HA8A 3S1RJ 2Q1ZB 5BPDA 2H8RA 4BJ5C 2PLYA 2MW8A 3W2WA 1W0UA 3WODF 2AXLA 4O3MA 5KAIC 1IZ1A 3RTRA 4NC6A 5HDNA 5H6RA 3VYTB 4DGWB 5HS7A 2BVLA 1MIJA 1OCPA 4A2UA 4KDPA 3H0GJ 1JXSA 3D5SC 3I53A 1OKRA 2CV1A 2EH3A 1X2MA 2Z1DA 2P5VA 5FLVA 1Z05A 4A3IJ 3ROUA 2XROA 4AIHA 1CF7B 4DZJA 5L3DA 1SD7A 1Z1DA 1RR7A 1IRFA 3T8RA 1XGMA 2KRHA 5JI6A 3WG7H 3GW2A 3CCVI 4YG2F 1B9MA 5K7FA 1QPIA 4MHGA 2FUG2 5KNLA 4BDZA 2WB1N 4PFPA 4NUBA 3JAMZ 1IV6A 3WU0A 5LHIA 2CUZA 4MLOA 1WRJA 3HOWJ 4HSTA 4G9YA 1WKMA 3JRCA 1J09A 2ETHA 1J5YA 1KONA 5B5EC 3QPLA 1WWXA 1B72B 3DPUA 1BIAA 1XSDA 1APLC 3ISPA 3HBLA 5CKTA 2OTLI 3KEOA 4F52A 1AU7A 2XPVA 3W3CA 4UVCA 4UUSB 3EYIA 1X58A 4C2MJ 3HL2A 1GVJA 3FKIJ 2NVYJ 2CO5A 1WI3A 1Z0XA 2L02A 1U9OA 3DBLB 3WGGA 3L2UA 1YIJI 4M3FA 1UG0A 2HQRA 3A1YA 2EZIA 3KPHA 1R00A 3BOQA 3MEXA 2ZBKA 4U0VA 1FYLA 1LJ9A 4XLHA 3E97A 2LK2A 3P5JA 2D45A 2KRFA 2BEOA 2BV6A 2RV8A 4P1WA 2WAQA 2HS5A 1VI0A 4G7HF 1ZRCA 1WH5A 2M1BA 2DQLA 2C6YA 1R23A 3FM5A 4F7ZA 4IHWA 1A6IA 3TKYA 3HOSA 3ABMH 3HOUJ 4L9NA 2YU3A 4KNYA 4BQAA 3LSHA 4L0ZB 3MZYA 5JHUA 1AOYA 2R7DA 2COBA 2OA4A 1CGPA 4KN4X 1FBQA 1PVEA 1IN5A 2ZC2A 4UV8A 1ETXA 3OS0A 3F0CA 5HDGA 1X2NA 3HHHA 2UWMA 3Q9VA 4LB6B 1YX5A 4XN0A 3CDIA 4ZH4F 2W4SA 4A5MA 2HKXA 1ZG5A 1LDDA 1WGXA 3WG9A 1XTAA 2CYYA 1G3TA 1JI8A 1IAWA 2FA5A 3V8JA 3CO7C 4GCVA 2L01A 3M9AA 2XASA 3QP6A 4KMFA 3S17J 2OJED 5ICEA 4ENNA 3BG3A 4I02A 3OR2C 4XRSG 4RLQA 4I98B 4N4NB 2BBYA 1T0FC 2IGNA 4UVBA 4DYQA 2JA6J 5K5RA 3KLOA 1N77A 1YOVB 2LKXA 1YW8A 4LG3A 5K1YA 1LEAA 2DJIA 4L18B 1GV5A 5B3SH 1BM9A 3K4LA 1YITI 3IKTA 2XKPA 4L9VA 3OYJA 6PAXA 2I8DA 3EUAA 2ICWG 5HOOA 4XKBA 2PI0A 4AVZA 2LNBA 3R60A 5GADJ 1I3QJ 2BHZA 1XMKA 1FTZA 5AIQA 4M3DA 5F1JA 3MKWB 1IXSB 4B8XA 4XM3A 4BXUA 5HLGA 2E2JJ 3HSFA 2FE3A 3NARA 5BQTA 1I3AA 1QVTA 1I1GA 4A69C 3K1MA 3DLAA 3M1CA 1T38A 2LKSA 2MLGA 3BJOA 3HM5A 4MGRA 2EA2A 3SFIA 2QVOA 2DYRH 2IVMA 5F0FA 2ACJA 2CV2A 2E1OA 1VQ8I 3QOEA 2CQKA 4KFCA 4RAYA 5DM7F 2JQ7A 3L2RA 3DQVC 2BOLA 1UHWA 3FXLA 4IHXA 5FD6A 4CZZA 2K7LA 5ICGA 1U8BA 1OCRH 3O8HA 5LD2C 4R1HA 4LIUA 3VPRA 2Z99A 4C30A 3BPVA 1T0FA 1D0ZA 2X1DA 2XIGA 1FWZA 4A0YA 1SMTA 2EIMH 2PMZN 2KRCA 2W48A 3F21A 2A6HF 4M9SA 4ESJA 1O7FA 4HLYA 1SC7A 1RR8C 2IA0A 4UVAA 1HXDA 3OYMA 1G3YA 1OYYA 2ECCA 4ABZA 4HQMA 1DPRA 1FEXA 1ZAOA 4U87A 4IF4A 4CYCB 1STZA 1IUFA 4HQEA 5HODA 4I01A 1E3PA 2K9LA 3QPSA 3TDZC 4JOMA 5D4RA 2R7UA 1P4WA 1TNTA 2X1EA 4HNUA 3QP5A 1ZKGA 3NWTA 2HPMA 3OYLA 3JRBA 3S32A 2L9RA 3M3YJ 3CF2A 3W6KB 2ZXWH 1G2HA 2IBDA 1ORKA 3OYCA 3I5UA 2ZXHA 3S93A 1U78A 2G7HA 3Q0UA 2V26A 3QAHA 1ODDA 2VBZA 3QWLA 1TNSA 3KYLA 4Y13A 5CVUA 1T33A 2FQ3A 3A02A 3MMYB 3Q5FA 2QKLB 2VC1A 2JA7J 2XPUA 2Y69H 4LLLA 1FP2A 2NNNA 5ILSA 4EATA 3A03A 2GIVA 1WFXA 3R4KA 3TDUC 1JTYA 2DO7A 5DDGA 1RNLA 5D5UB 1ERDA 1W4MA 4ESFA 4HBLA 2FMYA 3QYBA 5IT9K 5FROA 1K7AA 4DZPA 3KLNA 2RQQA 1QHGA 1ITYA 1P4AA 3A0HC 2F6CA 5BS6A 4IRIA 4ASNA 1JT0A 1UG2A 2R7WA 2K02A 2K3PA 4DBRA 3J81Z 3E6MA 2ZJQF 1J59A 4BQQA 1X19A 3RPUD 5FLXK 1ZGWA 1KZHA 1IJWC 4RDUA 1A36A 2OCEA 2WAFA 4L0YB 2VOPA 2CQ7A 2ZNZA 1ONVA 5L3EA 1EH6A 1ZGAA 5C4XJ 3RQIA 4O5VA 1Z3XA 2MD5A 3V7CA 5CJ9A 3ECOA 1D1CA 4OOIA 1J75A 1Y56A 3SEQA 4BEHA 2H8WA 4C2UA 1IXCA 3HOXJ 4YELA 3ZMVA 2P81A 2E1MB 3J80Z 4BXFA 3RQ4A 2CQXA 4EM0B 2K27A 1FSEA 2DODA 5D5VB 1TP4A 4G6DA 5FRMA 4NHJA 1SANA 3HKZN 3PL8A 4IO9F 3LQQA 3D5LA 2DAOA 4K2EA 3F9KA 1ZG3A 3RYPA 5M5YJ 2VQGA 1V3FA 3KYCB 3L00A 4XLPF 3P7NA 4A5NA 4A3JJ 4CGZA 3A2KA 1OJLA 2HYJA 3CUOA 3CUQA 2DK8A 1U2WA 3NWSA 2OUMA 3ZOBA 1MMSA 5HS9A 2BGCA 3K10A 4ON0A 4UY8I 4Y4RA 2KHMA 3BROA 3BLYA 5C3EJ 4XSZF 2QM3A 5J1UA 3BY6A 3OYIA 2V7FA 2A07F 3GO5A 2N8GA 4DOZA 4LFUA 3GTGJ 2FNAA 3DU5A 3FF5A 2WA0A 3HRTA 4CXFA 4CSWA 1ZR4A 1TWHJ 3GTOJ 2KFDA 4BE0A 1GXQA 3HRMA 3JCUC 2DN0A 4XKVA 2CH0A 3N4MA 2V6EA 3MWMA 3M8FA 5J1RA 4FX0A 5IYDJ 1UCRA 1B4AA 5FFZA 3TW6A 1TLHB 3JRAA 1IN8A 1BI3A 3CZ6A 3HPGA 3H5RA 2D5VA 2XGEA 1JJ6C 1SAUA 5DV5A 3HB9A 3A01A 4UUVA 2O8XA 4XRMA 1YG2A 4UB8C 1FYKA 2XC7A 2E35A 1H9GA 2HDWA 2YR2A 5BNGA 5E3OA 5A2QK 2CMPA 2DMTA 1IG7A 4BBRJ 3K4MA 3M8JA 1VTNC 4CICA 3HJEA 5LHGA 2EFPA 5M3MJ 5TGTA 4JX5A 5AONA 2LF7A 3CF5F 1VQNI 3OOPA 2CUFA 2VE8A 2V79A 3B6CA 2GIZA 4IHTA 4II3A 5BPIA 4D1QA 2FSWA 5KCMA 3VOEA 3S1QJ 2F5CA 4OU0A 3GTKJ 1NG7A 3V7RA 3I64A 2DA7A 3LWFA 3QU3A 3IH3A 5FO5A 2E1NA 5F27A 2RAEA 3AG1H 3FMSA 2NVTJ 2HTJA 2BXZA 2FBIA 5E1XA 3TW7A 1J0RA 3I55I 2RC4A 4I2OA 4KIFA 2IPQX 1VQ4I 3ERED 4OMYA 1G4DA 2W7NA 3VYUB 1PUFB 2R7XA 4FE7A 2VI6A 4HV5A 2O8KA 5GPAA 1O7LA 1U5TC 3SYTA 4XICA 4II2A 4AYBA 1R5ID 5FJ8J 2LP0A 1LKXA 4HEA2 2VQLA 3SZGA 4RLFA 2Y9ZA 1REPC 3ZP5A 1KU7A 4OIRF 1XG1A 1FMWA 3IC7A 4ZYDA 2IS4A 3GZ6A 4P9UA 3E1SA 1X3WB 1RESA 3DKWA 5FKNA 1VQOI 2FEZA 2CW7A 3E6DA 4CO8A 3JAMK 3S2WA 2M34A 2PFBA 1T39A 2JK3A 2LMDA 4EM2A 3JSPA 2CFOA 1AHDP 3CJRB 3DTKA 4AIJA 4B1RA 1ZGJA 2QGUA 3COAC 2A61A 3RCOA 1R36A 2CWEA 2R7OA 1FT9A 1YS7A 2VXDA 3PSIA 4JX6A 1BI2A 1I5ZA 3GX4X 1LE8A 3BTLA 3OWTA 4FHTA 3F8NA 3H3ZA 1X1AA 1TWAJ 1VZ0A 1TW3A 3ECHA 4AU7A 3EQLF 4A93J 2L5QA 1JUMA 5LGTA 1YI2I 2HTSA 3ZMUA 2KJCA 4I76A 3PO2J 3CMEI 3CCUI 3CDHA 4NC7A 1OPCA 3JRHA 1TQPA 2V1UA 2DDAA 4N0BA 2L2OA 4JQFA 5IP6A 4BBSJ 3S3MA 3VEPA 3H9QA 1QZZA 1UHMA 2NXNB 3IP4B 3PFYA 5BOXA 2B9SA 1RKTA 1QHHD 3K9TA 1W1WE 3JTHA 3G1MA 2Z2SB 5IP9J 3C2GA 5IOZA 1NK3P 3LAPA 3BR5A 1SFUA 2DOAA 3F8FA 1E0EA 3ZMDA 1S7OA 1VQLI 2WB1A 1FIAA 1T8IA 1MSEC 4LLGF 1B8IB 1N78A 4Q47A 1TQMA 4KIBA 3CO6C 5H20A 1W7PA 4NNJA 2F4OB 3U9GA 3J7YJ 2BY1A 2DOEA 2M5WA 4WX9A 5EEHA 1LVAA 2EFOA 4EMSA 1Z91A 3M1EA 2ZJ2A 3FWEA 3ASNH 3FMQA 1JE8A 2J5PA 3ZGKA 1BC8C 2X6WA 3CJNA 2H27A 4IJAA 3LSMA 3HSRA 4XIDA 3LNQA 2A6TA 4M71A 2W25A 1XGNA 2MG4A 5KHDA 1DU0A 1V5GA 2O9LA 4P96A 4IEJA 2FNPA 4F93B 1X3ZB 2M3AA 3K0LA 3IV5A 1NG6A 3V8LA 4EGZA 3WTWC 1XDSA 1LB2A 2A5WA 2VJ5A 2IW5A 1V5FA 3RYRA 1FOKA 2VE9A 2DMUA 1D0XA 1W36D 3K6GA 2DFFA 1MBFA 3QPHA 4GDFA 3CJTB 5CVJA 2PJPA 2Y0SA 5EJCA 4ENMA 2P4WA 2VJJA 1N25A 2OTJI 1VQMI 4GFBA 4RMNA 2KIUA 3HUGA 4FQGA 5GAEJ 1R4MB 4KMUX 2M7AA 1HA8A 4ETSA 4WXDA 4C3IJ 4FASD 3CD6I 4Z2YA 2JUCA 4M3BA 3OL4A 1FX7A 3I4PA 4RAZA 2IAIA 2MSYA 2O0YA 4Y3OA 4I0BA 4MTDA 1P7IA 2DA5A 1MDMA 5FKOA 2YX7A 3TBIA 2E1CA 4CCNA 1XS9A 4IHYA 2R5ZB 2AHQA 3LFKA 3WU2C 2ZSIB 1DPUA 5AIPA 2VT3A 3ABUA 3F72A 3FX3A 1JHFA 3LQRA 2XDVA 4CCOA 3W6JB 2STWA 2VIXA 1IGNA 4ITVA 1QRYA 3VSKA 4U7BA 4MFDA 1G3SA 4D7NA 1BW6A 1WVRA 2R4GA 3ZXSA 2E7WA 1YIOA 3E5QA 2E2IJ 1ZARA 1ETYA 3ZQCA 2YS9A 2HWVA 4LG0B 3ZMZA 1WQ2A 2JVHA 3TMOA 4DQ2A 4A3GJ 2LOOA 4AVPA 2X51A 4LIVA 5LRRA 3K4NA 1YW9A 3FKJA 3I0TA 3K1NA 4ZC3A 4L5JA 1IW7F 2QUFA 3CMAI 4HAMA 4BHBA 1YHQI 1P6RA 2VONA 1R5GA 5CVIA 4G12A 2NNYA 2CV0A 2ZNYA 3PNTA 2FBHA 3X2QH 4BS9A 4D7MA 4OAYA 2I10A 1ZELA 1FOXA 1K83J 2DA4A 2R7QA 3ZQIA 3H0DA 4Y17A 3ONQA 5DCMB 4XBFA 2HU9A 4ZDPA 2R7SA 5F08A 3C1DA 3LSIA 2F5FA 5CYVA 1BC7C 3VYRB 4I99C 3G1LA 4KISA 3R6SA 5FKMA 3F8MA 1IO2A 2XHKA 1F4KA 1Z67A 2TRTA 2LTPA 3E6CC 2ISZA 4P9FA 4HNTA 4M6XA 4NB5A 3WTUC 1ZG1A 2R0QC 3S15J 1LQ1A 4HF0A 3V4GA 1R4NB 4E7ZA 3CCLI 3IUOA 3PM1A 5K5QA 1YRNB 2FMLA 1DDNA 3MZ8A 4R8HA 1NTCA 3I9V2 3F23A 3KZZA 1DP7P 3ASOH 2M0MA 3OYAA 2IA2A 1Y8QB 4IVNA 4BHPA 3W2VA 1P9QC 1I50J 5L3BA 2MH2A 2OQGA 4EJVA 5JR3A 2P0WA 2V4JC 2KQRA 1JTXA 1S7AA 3R0AA 2PMZA 2Y0SN 1T6SA 5LEKA 1AWCA 3GEZA 2WTEA 2HVSA 3I3LA 3C2BA 1BR2A 2ZKZA 4AIDA 1MMNA 2GLOA 1MBJA 4NC8A 4BUPA 3H36A 2ESHA 3CTAA 1YJWI 3K4KA 5E1WA 2EPFA 3F8CA 2XAHA 4IPAA 3QYEA 3DTEA 2DTZA 4BGDA 4TV7A 4U88A 3D1NI 4A3EJ 1QZEA 2DPUA 4OIOF 1KYZA 2EZHA 2ME0A 4ZJZA 3FBNB 2ZJPF 1R58A 1GVDA 1FBSA 1OYWA 1F43A 5IYCJ 2XAGA 1K78B 2KP6A 2HXIA 2Y31A 4JX4A 3GBGA 4XL9A 2CW0F 1PDNC 3T5XA 3ZMTA 4UXNA 3SJMA 2AQEA 3RPQA 2HKOA 1ZK8A 3HRSA 4MEYF 1L3LA 2D2WA 3M7GA 3TOAA 2HPIA 3LSJA 5GTIC 5DS9A 1Z77A 3MZHA 3G6EI 1HSTA 5DD4A 4D5CA 2KL4A 3ABKH 2KDZA 4IHVA 1R7JA 3LSKA 4B47A 2M4GA 4HPQA 1W5TA 1S8NA 3DKYA 3HEFA 1Y8RB 3FMRA 4M6VA 2DJNA 3ULQB 3VFZA 2WY8Q 4BY1J 3PJRA 2K9NA 1H8AC 2EIJH 2M45A 4I0AA 3KP6A 3OIQA 3CC4I 3HIFA 5JVGF 3WGHA 4IRHA 2OC6A 3MN2A 1HSJA 3KZIC 3IL2A 1ZLKA 1H88C 2DFIA 1BIBA 4CYDA 3JTGA 3KEYA 4B3XA 1HLVA 3I54A 1XGSA 5IT3A 2LYCA 2X6OA 1POGA 5HNHA 1YE9A 3T8TA 2HXOA 4QTRA 4A3BJ 4YFXF 2HOEA 1W5CC 5DEQA 2F48A 5IOYA 2G7UA 3I4NJ 1JUSA 1OCOH 2CFXA 4E7HA 2DA3A 4A3MJ 1X3UA 3JRFA 2EIKH 2F5DA 4L9JA 1FNNA 5M5WJ 1RC9A 1LEBA 2GXGA 2NVUB 2IGKA 4N4OB 2JT1A 1DGRM 2MYSA 3KIOA 3ZQGA 3K4CA 3LSTA 2BY2A 3K2AA 2FD5A 3LMMA 5GAGJ 3HKZA 3GTLJ 2RREA 5CQGA 1EH8A 4H4KC 2Z9OA 2FU4A 2ELJA 2LSOA 4HYEA 1CF7A 4BNCA 2OBPA 1SMYF 3DXJF 4FTHA 1Z7UA 1IRGA 1TT0A 1OFCX 4D0PA 4IRGA 1ULYA 3O2PE 4XOPA 4BU2A 2F5VA 1BJZA 2BY0A 1ZYRF 2JZYA 1QA6A 4OIPF 2XRLA 9ANTA 4XRSA 2XKOA 4L5IA 3ZR8X 1MGTA 4ENJA 4B09A 4F91B 4PZJA 1AKHB 3TQNA 1YQAA 3QOPA 4OIQF 2K4JA 3RPUA 1UZCA 2ECBA 3G71I 1E3OC 1MMAA 3HYIA 2QSGX 4ZDOA 4KJZA 3S16J 1JGSA 1TTYA 3IHUA 4BKXA 1XSVA 4UV9A 1JHHA 3V8KA 3J7AO 2W84A 2CQNA 3UR3C 4J19A 3QRFF 3VDXA 2E71A 4N9HA 2XAFA 2ZXIA 4QWQA 3GUDA 4B48A 3ZPLA 1B72A 3BR2A 1FY7A 4XLNF 5ILUA 1SEUA 2IEKA 2WADA 3CDLA 2Q2EB 2P6SA 3ZRGA 3OV8A 3IWFA 2YX4A 1DP3A 1FIPA 2NS8A 3LL7A 3M8EA 4UUSA 1TW2A 3KCCA 1FLIA 2W57A 3FXOA 4RA2A 1D3YA 3BPXA 5HVQC 3OYGA 2PN6A 2YUSA 2KZGA 2F4MB 4DJAA 2L4AA 2WY7Q 2E5ZA 3F22A 3OR1C 3CCYA 3BR1A 1GT0C 2DTRA 2V6CA 2VT2A 3CCMI 5TJJA 4CZCA 1HW2A 4HNVA 1BL0A 2AO9A 2DA1A 2K4BA 2ZMEB 3BC8A 3CUQC 5J8FA 2BW3A 2LY2A 4A3CJ 5J4YA 3ZN1A 4RB2C 2MC3A 1LPQA 3H3VK 1Y1WJ 4KYWA 3WE2A 3QQAA 1S9HA 2HVQA 1ZQ3P 2EV0A 2IP2A 1FZPB 3ML6A 5ICFA 2JRTA 5E18F 4KITB 4J00A 1IDZA 4JYKA 2DMPA 1JKPC 3CESA 1FSHA 2K9MA 1ON2A 1GXPA 4B43A 1OCTC 2K5CA 2R7VA 1I1SA 5D6EA 3OYKA 3JW4A 5E8GA 2L7ZA 2W85A 2VUMJ 1B9NA 3CCRI 1VFCA 3DPTA 3HHGA 2L7FP 2OF7A 1R6RA 4RGSA 1XC5A 2ZCWA 2GZWA 3K69A 4IQJA 2QBYA 1XX5A 2VB6A 4CDGA 2FBKA 1IRXA 5LGNA 1PP8F 2HOSA 2PG4A 3MKLA 3I59B 4MQVA 5DUKA 2R5YA 1WCMJ 1Y39A 4OAZA 1ZH5A 1YX3A 1BW5A 2VBXA 3DEEA 3HOVJ
chains in the Genus database with same CATH topology
1LE8A 3BTLA 2EH3A 1X2MA 2K40A 3JR9A 1TWAJ 3BR3A 5FLVA 2ZB9A 1W0TA 4A93J 3CMYA 1RPWA 4A3IJ 1JUMA 2M0CA 4DZJA 3RKQA 4I76A 1WH7A 3PO2J 1RR7A 3OOUA 3FK7A 4C3JJ 1RKWA 2K9SA 4LOCA 2DA2A 3JRHA 3Q0WA 5K7FA 1QPIA 3WHBA 5IP6A 4BBSJ 4V2FA 2WB1N 5DTDA 1IV6A 3Q3SA 3TEDA 4Y52J 1JUPA 1RKTA 1Y1VJ 2CU7A 2QCOA 4MLOA 3G1MA 5IP9J 3HOWJ 5IOZA 3JRCA 3S2DJ 5EG0B 1NK3P 5IP7J 3BR5A 3QPLA 1B72B 3HGGA 4D5FA 3BTCA 4A3KJ 1DU6A 1GUUA 3A01B 1FIAA 1APLC 1MSEC 3HBLA 1B8IB 4Y7NJ 1UHSA 2ELKA 3BTIA 5EGOB 1AU7A 3JREA 1MSFC 2XPVA 4UUSB 1X58A 4C2MJ 3FKIJ 3LOCA 2WAQN 3HGYA 3LSPA 2NVYJ 5EGOA 1YRNA 1WI3A 1K61A 1Z0XA 1U9OA 4M3FA 2R92J 2HDDA 3LNQA 4XIDA 3JRIA 2EZIA 2VPRA 5E3MA 2MG4A 2M2EA 3OSGA 1DU0A 1FTTA 2O9LA 4IEJA 2LK2A 3IV5A 2FX0A 4CYCA 2M8GX 1VI0A 1WH5A 2DMUA 4IHWA 1A6IA 1JGGA 2X9DA 1MBFA 1WPKA 3TP0A 1F36A 2E19A 3FIWA 2KT0A 1HF0A 3HOUJ 5GPCA 5EDNA 2O7OA 2COBA 4GFBA 1S7EA 3G1OA 3IH2A 1ETXA 3F0CA 1X2NA 1FJLA 4M3BA 2IAIA 2L0KA 2MSYA 4X6AJ 1WGXA 3HOZJ 2DA5A 2Y9YA 1P7IA 5FKOA 4W97A 5JLWA 3GTPJ 1MBKA 1XS9A 1VF9A 4IHYA 2R5ZB 2AHQA 2YU9J 4UUTA 3S1NJ 3S17J 5JLXA 3BG3A 4BY7J 1JKOC 4XRSG 3PO3J 1IGNA 1I6HJ 2EBIA 1QRYA 4DYQA 2JA6J 4MFDA 1R9TJ 4D7NA 1BW6A 3LSGA 1LE8B 2LKXA 3BT9A 2E2IJ 1QVUA 1ETYA 3ZQCA 2YS9A 1JJ8C 3JRGA 5K7ZA 1GV5A 2CJJA 4A3GJ 3BG9A 3HDDA 3DEWA 3CQZJ 4I6ZA 1I3QJ 1TWGJ 4S0HB 2DMNA 1FTZA 4M3DA 5F1JA 2VKVA 3I4MJ 4DYCA 3ZQFA 1MH3A 4G12A 2E2JJ 1LFUP 3NARA 4D7MA 2I10A 4BXXJ 1QVTA 1K83J 2DA4A 4A69C 3BG5A 3ZQIA 3HM5A 3SFIA 4EEFG 2XB5A 4W1UA 1TC3C 5M5XJ 1T56A 5F0FA 5F08A 3FK6A 4L5EA 2E1OA 3E7LA 1EF4A 4MO7A 3G1LA 5FKMA 4A3LJ 2DA6A 3DCFA 2TRTA 2LTPA 2ID6A 2XB0X 4QIWN 4IHXA 2G0EA 1U8BA 3O8HA 1VNDA 3LSRA 5E3LA 3GTJJ 3VPRA 2R0QC 3S15J 1D5YA 1HDDC 3W6VA 5F0HA 3PM1A 2PMZN 1YRNB 1P7JA 1ETQA 2W48A 1NTCA 5EF6A 2ME6A 2HOAA 2ECCA 4ABZA 1AKHA 2K9QA 1FEXA 2M9HA 3FISA 3S14J 1CQTA 4CYCB 1I50J 5C44J 1IUFA 3S1MJ 5HODA 4DW6A 1LFBA 1JTXA 3QPSA 3UKGA 1ZR2A 2Y0SN 1IC8A 4FISA 1ZKGA 3C2BA 5C4JJ 1ETOA 3SDGA 2MGQA 3JRBA 2GLOA 1MBJA 2NVXJ 2L9RA 2XGCA 3M3YJ 1MBEA 2R93J 1G2HA 2IBDA 1ORKA 2ID3A 2DTZA 3D1NI 2FQ4A 4A3EJ 1U78A 3Q0UA 2FJ1A 2EZHA 1MH4A 2LLKA 3B6AA 2ME0A 1F43A 1ETKA 1GVDA 5IYCJ 1T33A 5EEAA 5FKLA 3A02A 1MNMC 2R7ZJ 2HXIA 2Y31A 4JX4A 3GBGA 1H89C 4AC0A 3SJMA 1HDPA 2XPUA 2JA7J 3A03A 1ZK8A 3OIOA 1TWCJ 1O4XA 1JTYA 4A3DJ 5DS9A 3LSJA 1Z77A 3BQYA 3ZQHA 4DZPA 2XPWA 4FCYA 1ITYA 4D5CA 2KDZA 4IHVA 1JT0A 1UG2A 2Y2ZA 3BQZA 2JA5J 4FE4A 4M3EA 3BR0A 2QF7A 3Q0VA 3HEFA 2VKEA 2E2HJ 4M6VA 5FLMJ 1PUFA 2DJNA 1ZGWA 1HOMA 3JRDA 1MBGA 1IJWC 2HOTA 4RDUA 2OPTA 4BY1J 1JKRC 2K9NA 1H8AC 5K7HA 5IYBJ 1Q1VA 2LR8A 5C4XJ 3RQIA 3MN2A 3RZDJ 4V2GA 2GM4A 1H88C 4AUXA 1UMQA 3HOXJ 3OSFA 2NOGA 2P81A 1GV2A 1HLVA 2X6OA 2CQXA 1POGA 3BTJA 2JN6A 4QTRA 2HXOA 4A3BJ 1JT6A 5IOYA 3I4NJ 1SANA 1JUSA 3HKZN 4JP0A 2DA3A 4A3MJ 2CRGA 3JRFA 4C3HJ 5M5WJ 2NVQJ 5M5YJ 2EQRA 1A5JA 4A3JJ 4MFEA 4NDLA 1OJLA 2HYJA 2NS7A 2EZLA 3ZQGA 5EZGA 3ZOBA 3K2AA 2FD5A 4A3FJ 3GTLJ 5F04A 3RZOJ 5C3EJ 5EYRA 5J3LA 5J1UA 4FTHA 1BA5A 4M3GA 1OFCX 3NAUA 2N8GA 3GTGJ 1BJZA 5F0CA 2XRLA 1ZR4A 1TWHJ 3GTOJ 9ANTA 4XRSA 1NK2P 1AKHB 3M4OJ 5FKKA 2DN0A 2ECBA 1ZTRA 5J1RA 1E3OC 3TP3A 5IYDJ 1JKQC 2JA8J 3S16J 3TW6A 4BKXA 2H1KA 1ENHA 3JRAA 4J19A 5EG0A 2CUEA 2D5VA 1RETA 2XGEA 4RBOA 1JJ6C 1B72A 2B63J 3BR2A 1ETWA 4B4CA 3HB9A 3A01A 2LVSA 5EZHA 1TWFJ 2JMWA 4XRMA 2IEKA 5J1YA 3CDLA 5BNGA 1B8IA 1IG7A 5E3OA 2DMTA 2TCTA 4BBRJ 5GP9A 1FIPA 2NS8A 5M3FJ 5M3MJ 4UUSA 3BR6A 4JX5A 2YUSA 1MBHA 2LD5A 2CUFA 3GTQJ 3B6CA 2CQQA 2LFBA 3CCYA 2JJ7A 3BR1A 3S1QJ 1GT0C 3GTKJ 1IRZA 2DA7A 4HNVA 1BL0A 2AO9A 2DA1A 2XSDC 3IH3A 4MIMA 4AYBN 5F27A 2RAEA 2JWTA 2NVTJ 4X1EA 3TW7A 4A3CJ 2HI3A 3IH4A 1ETVA 2HQ5A 1GDTA 2LY9A 1Y1WJ 3H3VK 3S2HJ 3QQAA 1ZQ3P 4B3AA 1PUFB 4FE7A 2VI6A 4DYRA 5E3NA 5GPAA 2O8KA 4XICA 2XGDA 1IDYA 3WHCA 3MVPA 5FJ8J 1IDZA 4JYKA 2LP0A 5IPAA 1U9NA 4XK4A 2DMPA 1JKPC 2X48A 2Y9ZA 3GTMJ 1OCTC 1HCRA 2L7ZA 1XG1A 4QSHA 2VUMJ 3O8GA 3K7AJ 1VFCA 2Y30A 1SFOJ 1RESA 2L7FP 2OF7A 5FKNA 1XC5A 3HOYJ 2R5ZA 3S1RJ 2H8RA 2WV1A 2M34A 2R5YB 1AHDP 2JK3A 2L7MP 2MW8A 1W0UA 2HOSA 2GBYA 4B1RA 3ZQLA 3MKLA 2R5YA 1WCMJ 3L1PA 2DMQA 2EZKA 1OCPA 1BW5A 4JX6A 3H0GJ 4C3IJ 3HOVJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE8 A;  3BTL A;  2EH3 A;  1X2M A;  2K40 A;  3JR9 A;  1TWA J;  3BR3 A;  5FLV A;  2ZB9 A;  1W0T A;  4A93 J;  3CMY A;  1RPW A;  4A3I J;  1JUM A;  2M0C A;  4DZJ A;  3RKQ A;  4I76 A;  1WH7 A;  3PO2 J;  1RR7 A;  3OOU A;  3FK7 A;  4C3J J;  1RKW A;  2K9S A;  4LOC A;  2DA2 A;  3JRH A;  3Q0W A;  5K7F A;  1QPI A;  3WHB A;  5IP6 A;  4BBS J;  4V2F A;  2WB1 N;  5DTD A;  1IV6 A;  3Q3S A;  3TED A;  4Y52 J;  1JUP A;  1RKT A;  1Y1V J;  2CU7 A;  2QCO A;  4MLO A;  3G1M A;  5IP9 J;  3HOW J;  5IOZ A;  3JRC A;  3S2D J;  5EG0 B;  1NK3 P;  5IP7 J;  3BR5 A;  3QPL A;  1B72 B;  3HGG A;  4D5F A;  3BTC A;  4A3K J;  1DU6 A;  1GUU A;  3A01 B;  1FIA A;  1APL C;  1MSE C;  3HBL A;  1B8I B;  4Y7N J;  1UHS A;  2ELK A;  3BTI A;  5EGO B;  1AU7 A;  3JRE A;  1MSF C;  2XPV A;  4UUS B;  1X58 A;  4C2M J;  3FKI J;  3LOC A;  2WAQ N;  3HGY A;  3LSP A;  2NVY J;  5EGO A;  1YRN A;  1WI3 A;  1K61 A;  1Z0X A;  1U9O A;  4M3F A;  2R92 J;  2HDD A;  3LNQ A;  4XID A;  3JRI A;  2EZI A;  2VPR A;  5E3M A;  2MG4 A;  2M2E A;  3OSG A;  1DU0 A;  1FTT A;  2O9L A;  4IEJ A;  2LK2 A;  3IV5 A;  2FX0 A;  4CYC A;  2M8G X;  1VI0 A;  1WH5 A;  2DMU A;  4IHW A;  1A6I A;  1JGG A;  2X9D A;  1MBF A;  1WPK A;  3TP0 A;  1F36 A;  2E19 A;  3FIW A;  2KT0 A;  1HF0 A;  3HOU J;  5GPC A;  5EDN A;  2O7O A;  2COB A;  4GFB A;  1S7E A;  3G1O A;  3IH2 A;  1ETX A;  3F0C A;  1X2N A;  1FJL A;  4M3B A;  2IAI A;  2L0K A;  2MSY A;  4X6A J;  1WGX A;  3HOZ J;  2DA5 A;  2Y9Y A;  1P7I A;  5FKO A;  4W97 A;  5JLW A;  3GTP J;  1MBK A;  1XS9 A;  1VF9 A;  4IHY A;  2R5Z B;  2AHQ A;  2YU9 J;  4UUT A;  3S1N J;  3S17 J;  5JLX A;  3BG3 A;  4BY7 J;  1JKO C;  4XRS G;  3PO3 J;  1IGN A;  1I6H J;  2EBI A;  1QRY A;  4DYQ A;  2JA6 J;  4MFD A;  1R9T J;  4D7N A;  1BW6 A;  3LSG A;  1LE8 B;  2LKX A;  3BT9 A;  2E2I J;  1QVU A;  1ETY A;  3ZQC A;  2YS9 A;  1JJ8 C;  3JRG A;  5K7Z A;  1GV5 A;  2CJJ A;  4A3G J;  3BG9 A;  3HDD A;  3DEW A;  3CQZ J;  4I6Z A;  1I3Q J;  1TWG J;  4S0H B;  2DMN A;  1FTZ A;  4M3D A;  5F1J A;  2VKV A;  3I4M J;  4DYC A;  3ZQF A;  1MH3 A;  4G12 A;  2E2J J;  1LFU P;  3NAR A;  4D7M A;  2I10 A;  4BXX J;  1QVT A;  1K83 J;  2DA4 A;  4A69 C;  3BG5 A;  3ZQI A;  3HM5 A;  3SFI A;  4EEF G;  2XB5 A;  4W1U A;  1TC3 C;  5M5X J;  1T56 A;  5F0F A;  5F08 A;  3FK6 A;  4L5E A;  2E1O A;  3E7L A;  1EF4 A;  4MO7 A;  3G1L A;  5FKM A;  4A3L J;  2DA6 A;  3DCF A;  2TRT A;  2LTP A;  2ID6 A;  2XB0 X;  4QIW N;  4IHX A;  2G0E A;  1U8B A;  3O8H A;  1VND A;  3LSR A;  5E3L A;  3GTJ J;  3VPR A;  2R0Q C;  3S15 J;  1D5Y A;  1HDD C;  3W6V A;  5F0H A;  3PM1 A;  2PMZ N;  1YRN B;  1P7J A;  1ETQ A;  2W48 A;  1NTC A;  5EF6 A;  2ME6 A;  2HOA A;  2ECC A;  4ABZ A;  1AKH A;  2K9Q A;  1FEX A;  2M9H A;  3FIS A;  3S14 J;  1CQT A;  4CYC B;  1I50 J;  5C44 J;  1IUF A;  3S1M J;  5HOD A;  4DW6 A;  1LFB A;  1JTX A;  3QPS A;  3UKG A;  1ZR2 A;  2Y0S N;  1IC8 A;  4FIS A;  1ZKG A;  3C2B A;  5C4J J;  1ETO A;  3SDG A;  2MGQ A;  3JRB A;  2GLO A;  1MBJ A;  2NVX J;  2L9R A;  2XGC A;  3M3Y J;  1MBE A;  2R93 J;  1G2H A;  2IBD A;  1ORK A;  2ID3 A;  2DTZ A;  3D1N I;  2FQ4 A;  4A3E J;  1U78 A;  3Q0U A;  2FJ1 A;  2EZH A;  1MH4 A;  2LLK A;  3B6A A;  2ME0 A;  1F43 A;  1ETK A;  1GVD A;  5IYC J;  1T33 A;  5EEA A;  5FKL A;  3A02 A;  1MNM C;  2R7Z J;  2HXI A;  2Y31 A;  4JX4 A;  3GBG A;  1H89 C;  4AC0 A;  3SJM A;  1HDP A;  2XPU A;  2JA7 J;  3A03 A;  1ZK8 A;  3OIO A;  1TWC J;  1O4X A;  1JTY A;  4A3D J;  5DS9 A;  3LSJ A;  1Z77 A;  3BQY A;  3ZQH A;  4DZP A;  2XPW A;  4FCY A;  1ITY A;  4D5C A;  2KDZ A;  4IHV A;  1JT0 A;  1UG2 A;  2Y2Z A;  3BQZ A;  2JA5 J;  4FE4 A;  4M3E A;  3BR0 A;  2QF7 A;  3Q0V A;  3HEF A;  2VKE A;  2E2H J;  4M6V A;  5FLM J;  1PUF A;  2DJN A;  1ZGW A;  1HOM A;  3JRD A;  1MBG A;  1IJW C;  2HOT A;  4RDU A;  2OPT A;  4BY1 J;  1JKR C;  2K9N A;  1H8A C;  5K7H A;  5IYB J;  1Q1V A;  2LR8 A;  5C4X J;  3RQI A;  3MN2 A;  3RZD J;  4V2G A;  2GM4 A;  1H88 C;  4AUX A;  1UMQ A;  3HOX J;  3OSF A;  2NOG A;  2P81 A;  1GV2 A;  1HLV A;  2X6O A;  2CQX A;  1POG A;  3BTJ A;  2JN6 A;  4QTR A;  2HXO A;  4A3B J;  1JT6 A;  5IOY A;  3I4N J;  1SAN A;  1JUS A;  3HKZ N;  4JP0 A;  2DA3 A;  4A3M J;  2CRG A;  3JRF A;  4C3H J;  5M5W J;  2NVQ J;  5M5Y J;  2EQR A;  1A5J A;  4A3J J;  4MFE A;  4NDL A;  1OJL A;  2HYJ A;  2NS7 A;  2EZL A;  3ZQG A;  5EZG A;  3ZOB A;  3K2A A;  2FD5 A;  4A3F J;  3GTL J;  5F04 A;  3RZO J;  5C3E J;  5EYR A;  5J3L A;  5J1U A;  4FTH A;  1BA5 A;  4M3G A;  1OFC X;  3NAU A;  2N8G A;  3GTG J;  1BJZ A;  5F0C A;  2XRL A;  1ZR4 A;  1TWH J;  3GTO J;  9ANT A;  4XRS A;  1NK2 P;  1AKH B;  3M4O J;  5FKK A;  2DN0 A;  2ECB A;  1ZTR A;  5J1R A;  1E3O C;  3TP3 A;  5IYD J;  1JKQ C;  2JA8 J;  3S16 J;  3TW6 A;  4BKX A;  2H1K A;  1ENH A;  3JRA A;  4J19 A;  5EG0 A;  2CUE A;  2D5V A;  1RET A;  2XGE A;  4RBO A;  1JJ6 C;  1B72 A;  2B63 J;  3BR2 A;  1ETW A;  4B4C A;  3HB9 A;  3A01 A;  2LVS A;  5EZH A;  1TWF J;  2JMW A;  4XRM A;  2IEK A;  5J1Y A;  3CDL A;  5BNG A;  1B8I A;  1IG7 A;  5E3O A;  2DMT A;  2TCT A;  4BBR J;  5GP9 A;  1FIP A;  2NS8 A;  5M3F J;  5M3M J;  4UUS A;  3BR6 A;  4JX5 A;  2YUS A;  1MBH A;  2LD5 A;  2CUF A;  3GTQ J;  3B6C A;  2CQQ A;  2LFB A;  3CCY A;  2JJ7 A;  3BR1 A;  3S1Q J;  1GT0 C;  3GTK J;  1IRZ A;  2DA7 A;  4HNV A;  1BL0 A;  2AO9 A;  2DA1 A;  2XSD C;  3IH3 A;  4MIM A;  4AYB N;  5F27 A;  2RAE A;  2JWT A;  2NVT J;  4X1E A;  3TW7 A;  4A3C J;  2HI3 A;  3IH4 A;  1ETV A;  2HQ5 A;  1GDT A;  2LY9 A;  1Y1W J;  3H3V K;  3S2H J;  3QQA A;  1ZQ3 P;  4B3A A;  1PUF B;  4FE7 A;  2VI6 A;  4DYR A;  5E3N A;  5GPA A;  2O8K A;  4XIC A;  2XGD A;  1IDY A;  3WHC A;  3MVP A;  5FJ8 J;  1IDZ A;  4JYK A;  2LP0 A;  5IPA A;  1U9N A;  4XK4 A;  2DMP A;  1JKP C;  2X48 A;  2Y9Z A;  3GTM J;  1OCT C;  1HCR A;  2L7Z A;  1XG1 A;  4QSH A;  2VUM J;  3O8G A;  3K7A J;  1VFC A;  2Y30 A;  1SFO J;  1RES A;  2L7F P;  2OF7 A;  5FKN A;  1XC5 A;  3HOY J;  2R5Z A;  3S1R J;  2H8R A;  2WV1 A;  2M34 A;  2R5Y B;  1AHD P;  2JK3 A;  2L7M P;  2MW8 A;  1W0U A;  2HOS A;  2GBY A;  4B1R A;  3ZQL A;  3MKL A;  2R5Y A;  1WCM J;  3L1P A;  2DMQ A;  2EZK A;  1OCP A;  1BW5 A;  4JX6 A;  3H0G J;  4C3I J;  3HOV J; 
#chains in the Genus database with same CATH topology
 2LBF B;  4NQW B;  2H1L A;  5E1Z B;  1FPQ A;  2E5N A;  5E8I A;  2K40 A;  2QSF X;  3BR3 A;  1MMG A;  2CSO A;  1W0T A;  2A68 F;  2FOW A;  2JPB A;  3CMY A;  1RPW A;  4PDK A;  2M0C A;  1HW5 A;  1D1A A;  4RS8 A;  2WAE A;  1O57 A;  1U5T B;  4IKF A;  3OOU A;  1EA3 A;  2XVC A;  1RKW A;  3SDB A;  1YYV A;  3Q0W A;  4EJU A;  3WHB A;  3HC7 A;  4V2F A;  1AA7 A;  2UXX A;  2XSJ C;  3GLL A;  3S3O A;  2A69 F;  1JUP A;  1Y1V J;  2CU7 A;  2QCO A;  3GWZ A;  2GXA A;  3OYD A;  2KKO A;  3DEU A;  3H5N A;  3R61 A;  5EG0 B;  2RKH A;  3BG7 A;  3GFM A;  5DD8 A;  1QPM A;  2X0L A;  1QBJ A;  4D5F A;  1QGP A;  2F4I A;  3BTC A;  4A3K J;  5LHH A;  1UB9 A;  1W7P B;  1G3W A;  2JA2 A;  2Y0M A;  1BI0 A;  2P5K A;  2PBI A;  3H35 A;  3MKY B;  1KGS A;  2NS0 A;  3BCA A;  4Y7N J;  4N9I A;  2KIS A;  3TGN A;  3EDP A;  2QQB A;  2BVM A;  3GFI A;  3LOC A;  3HGY A;  1RIO H;  1EV7 A;  3SZT A;  4AD9 A;  2HDC A;  5BMZ A;  5EGO A;  2GAU A;  1K61 A;  4PSX A;  1VQ7 I;  4O6J A;  1LVK A;  3FHZ A;  3PIP F;  3DF8 A;  3JRI A;  1YS6 A;  2VPR A;  1DUX C;  5E3M A;  2DW4 A;  2M2E A;  4EJO A;  2D1H A;  2FX0 A;  4CYC A;  1N75 A;  3AKZ A;  1BJA A;  1BN5 A;  2L54 A;  4Q5S F;  2M8G X;  3ZCO A;  3PQK A;  4I09 A;  2PJR B;  1X4P A;  3REO A;  3FXU A;  1D5V A;  3LA2 A;  1JGG A;  4IZZ A;  2QQA A;  2X9D A;  3TP0 A;  2E19 A;  3MCZ A;  4CCL A;  4BDY A;  4G7Z F;  2KT0 A;  1QO0 D;  1SFK A;  2O7O A;  2DCE A;  5L3C A;  2ELH A;  2E1M C;  3FXQ A;  4XN3 A;  3T0Y A;  1W36 C;  1S7E A;  1S72 I;  3G73 A;  2IS2 A;  3IH2 A;  5D4S A;  3J7A Y;  3DKX A;  1FJL A;  1FMV A;  2YPR A;  3P9C A;  5GAH J;  4M73 A;  3U1D A;  2IS6 A;  4X6A J;  4LK1 F;  2G9W A;  3HOZ J;  1V5E A;  2Y9Y A;  4HSR A;  5JLW A;  1KU9 A;  4C2T A;  4E7K A;  4LD5 A;  2XF6 A;  4UUT A;  3DPL C;  2V9K A;  4BJ6 C;  1LDJ A;  3S1N J;  2NYX A;  5JLX A;  2J5O A;  4BY7 J;  1MD0 A;  1SAX A;  1FOY A;  3B73 A;  2KZV A;  2LY1 A;  1I27 A;  5KVR A;  1I6H J;  2EBI A;  3SEZ A;  1YLF A;  1FC3 A;  1HC8 A;  2OV7 A;  1KA8 A;  4HOB A;  3FZV A;  3AL0 C;  3F6O A;  4R79 A;  2GQQ A;  1WJD A;  5K7Z A;  3IRQ A;  1BOB A;  1IN7 A;  2H6B A;  3RKW A;  3WTY C;  1SVO A;  3HDD A;  3DEW A;  4KT6 A;  2MD0 A;  2L3D A;  4I6Z A;  2NRA C;  1TWG J;  4CCJ A;  1BBY A;  4EVI A;  2EIL H;  4WXH A;  5DM6 F;  3TO7 A;  3TO6 A;  2XF7 A;  2GA1 A;  4HW0 A;  5IT9 Z;  4DYC A;  1U0J A;  4XKC A;  3L2Q A;  5FD5 A;  3ZQF A;  4DBQ A;  1MW7 A;  2LRE A;  3RJP A;  1LFU P;  1X1C A;  4XLC A;  5ED4 A;  3F3X A;  4XMY A;  3EYY A;  4XR6 A;  4WWC A;  4PJ0 C;  3BG5 A;  2XAQ A;  5LRS A;  3BG6 A;  4FT8 A;  3ESW B;  4EEF G;  2XB5 A;  4YFN F;  1TC3 C;  5M5X J;  1T56 A;  1U6G A;  4RGR A;  3BJA A;  3H3U A;  5FLX Z;  4B44 A;  3MFK A;  4L5E A;  1R71 A;  4Y15 A;  1QQI A;  5FB2 A;  2M4K A;  4EJT A;  1YJN I;  1EF4 A;  1T95 A;  3PFI A;  4KA4 A;  4BH9 A;  2DA6 A;  4IOA F;  2MC4 A;  4ANJ A;  2XB0 X;  4QIW N;  1E2X A;  1S29 A;  2G0E A;  1QU3 A;  3GZN B;  1VND A;  2NAZ A;  5E3L A;  1SD5 A;  3OIP A;  4YII A;  2GWR A;  2V1D A;  3FM3 A;  1HDD C;  3W6V A;  3O3K A;  1U8R A;  5F0H A;  4F3Q A;  1P7J A;  5J4V A;  1YO5 C;  3HSE A;  3HTS B;  3PSF A;  5EF6 A;  2ME6 A;  2HNH A;  1VQK I;  2HOA A;  3VWB A;  4GRI A;  1X4O A;  3FIS A;  1A35 A;  3OMY A;  1CQT A;  1D1B A;  5C44 J;  2M8E A;  3S1M J;  2VKD A;  2M7B A;  2MH9 A;  2X85 A;  4PJL A;  1MMD A;  3UKG A;  1RUN A;  5FFX A;  3CCJ I;  1ZR2 A;  2RDP A;  3DU6 A;  4AM3 A;  4RGU A;  4FIS A;  3RKY A;  5C4J J;  4RM2 A;  3SDG A;  4A0Z A;  2MGQ A;  1IV8 A;  2A6E F;  3VB2 A;  3LFU A;  2HYG D;  3BP8 A;  2NVX J;  1MBE A;  2R93 J;  4DNC A;  4YEJ A;  3G3Z A;  2ID3 A;  5CQE A;  1Z7L A;  3WTX C;  2FQ4 A;  2QYO A;  2FJ1 A;  3HZJ A;  1MH4 A;  3B6A A;  2COM A;  3EUH A;  3GFJ A;  2ZFU A;  5EEA A;  1Z6T A;  2OU2 A;  5FKL A;  3AG4 H;  1H89 C;  3H1C A;  4BAC A;  1E17 A;  4J01 A;  2W1O A;  1F1Z A;  3WTT C;  1O4X A;  4BAY A;  1XCB A;  5TIS C;  1KQ0 A;  5FRN A;  4A6D A;  4P5O A;  3ZQH A;  4G8X A;  1HKQ A;  2QEN A;  3AG3 H;  3LA3 A;  2EIN H;  5IY5 H;  1R1U A;  3BQZ A;  3DBR B;  2JA5 J;  3AG2 H;  4FE4 A;  4XLA A;  3Q0V A;  4HF1 A;  1VQP I;  4HRI A;  4G7O F;  3IAM 2;  2L4M A;  1PUF A;  1HOM A;  1MBG A;  2HOT A;  5J6X A;  4IOC F;  3HPH A;  1JKR C;  2QQ9 A;  1FYM A;  1XB4 A;  1A04 A;  2W00 A;  5K7H A;  2KDO A;  3RI4 A;  3KP4 A;  4GYI A;  3EPZ A;  2X4H A;  5H2F C;  4OWR B;  2X6Y A;  3RZD J;  4Z6Y A;  2HQN A;  2H94 A;  3C7J A;  2GM4 A;  4AUX A;  1UMQ A;  4PGH A;  3IKV A;  1B59 A;  2STT A;  4YIR X;  3ELK A;  2NOG A;  2QLZ A;  1GV2 A;  2ZSH B;  2BY3 A;  5KK1 A;  2AS5 F;  5J47 A;  2EB7 A;  2KIM A;  1Y0U A;  1D8K A;  2LKP A;  3L2V A;  4MFE A;  3NQO A;  4NDL A;  4LB5 A;  1B6A A;  3ZMS A;  4G94 A;  1PUE E;  3OL3 A;  2NS7 A;  4XKW A;  1G59 A;  1IXR C;  2Z16 A;  1IUY A;  1M1E B;  4ZDL A;  1HW1 A;  1XN7 A;  3CJQ B;  4EV0 A;  1WI9 A;  5EZG A;  1GLN A;  1Q1H A;  5LBQ A;  1XDU A;  4RAF A;  2W24 A;  4A3F J;  5F04 A;  1OIS A;  3RZO J;  3D5R C;  1BR4 A;  4MEX F;  1H9T A;  5J3L A;  4GXO A;  3K4B A;  2KIQ A;  2UV1 A;  4M3G A;  3NAU A;  1B1B A;  1ZN2 A;  3SXY A;  1TBX A;  4PK4 A;  5F64 A;  1RI7 A;  1IN6 A;  2F5E A;  2LRD A;  1HQC A;  4BQN A;  3WTZ A;  1Z9C A;  2IRF G;  1NK2 P;  3WU1 B;  3M4O J;  2V1N A;  3PQJ A;  3K70 D;  3TP3 A;  1KQ9 A;  2JA8 J;  4EQQ A;  3DTI A;  1XCV A;  1XMX A;  1OLT A;  2CUE A;  4BL0 B;  1R5H A;  4KUM A;  5LEJ A;  1RET A;  3HTU A;  4RBO A;  5CPR B;  2YSR A;  5J40 A;  2JTV A;  5EZH A;  1KU3 A;  4S04 A;  4LK0 F;  2JMW A;  3J81 K;  1SVL A;  5J1Y A;  1B8I A;  3BDD A;  3PNY A;  2LC2 A;  1TL8 A;  3MAJ A;  1W5S A;  4LIT A;  4BYY A;  3N05 A;  1PP7 U;  4CH7 A;  2V9V A;  1WZ2 A;  3GTQ J;  4PJN A;  3LAJ A;  2PEX A;  3G2B A;  4BE1 A;  1F9N A;  5K5O A;  4ZYG A;  3VOD A;  1MJB A;  1ON1 A;  2JJ7 A;  2RQP A;  1SD4 A;  2BW3 B;  4M74 A;  3DBH B;  5B1A H;  2XSD C;  1WSU A;  3DP7 A;  3J80 K;  2VLA A;  5HDK A;  3AAF A;  4M9X A;  4X1E A;  4GYG A;  3RKX A;  2AQF A;  3KP5 A;  2IGO A;  3H9J A;  3K1P A;  2HI3 A;  3IH4 A;  1ETV A;  2HQ5 A;  1KU2 A;  3I71 A;  3CP2 A;  4HX7 A;  2GA2 A;  1T2K A;  4L9T A;  4DYR A;  5E3N A;  3BJ6 A;  4HDV A;  5L3G A;  1WJB A;  2O03 A;  2XGD A;  2OD5 A;  3MVP A;  4PSW A;  5TRD A;  1WHU A;  1U9N A;  4XK4 A;  4JK1 X;  2X48 A;  2ZXJ A;  2VQC A;  3DFG A;  2HQA A;  2LG4 A;  3PIO F;  2DOF A;  4QSH A;  3O8G A;  2RVC A;  4BEH B;  2Q8K A;  2QBY B;  4WK8 F;  2XV4 S;  2JRM A;  3BZC A;  3CP8 A;  1OR7 C;  3DV8 A;  3I58 A;  3PUF A;  3HOY J;  2E7X A;  1UAA A;  3KP2 A;  3E5U A;  3M07 A;  2R5Z A;  2WV1 A;  1VQ6 I;  2R5Y B;  2FRH A;  2L7M P;  2ZJR F;  2DPD A;  2E36 A;  2MLK A;  2GBY A;  3ZQL A;  2I5U A;  2XAJ A;  4KT5 C;  2VC0 A;  1P92 A;  4RAG A;  2DMQ A;  3A0B C;  3L1P A;  2EZK A;  1I39 A;  4MQ9 F;  3SFZ A;  2VBW A;  3CUQ B;  1ZRE A;  1KYW A;  1RRJ A;  1LNW A;  4G6Q A;  4BE2 A;  4E7J A;  4BJT A;  4LG0 A;  3JR9 A;  1XD7 A;  1S3J A;  1MZB A;  3WGI A;  2JVG A;  2VN2 A;  4PFO A;  2ZB9 A;  5DYM A;  1L0O C;  3V42 A;  4XQF A;  3ABL H;  4ZZD A;  4D9J A;  3RKQ A;  1DGW Y;  3ERM A;  1FBU A;  2CGP A;  1WH7 A;  1J7K A;  2E34 A;  3FK7 A;  2ZO4 A;  4XRF A;  4C3J J;  4LOC A;  2K9S A;  2VBY A;  4IQ4 A;  4WF2 A;  4RB3 C;  3TO9 A;  3MKZ A;  2DA2 A;  1WJ5 A;  1RZ4 A;  5DCF A;  5B66 C;  2DFE A;  1UJ8 A;  2P6T A;  1UEL B;  2Q0O A;  2RNJ A;  3BZK A;  4XNF A;  5DTD A;  4A12 A;  5J8C A;  2V1X A;  3C3W A;  3Q3S A;  4F92 B;  3TED A;  4Y52 J;  2O6G E;  2K86 A;  2H09 A;  3RIR A;  2VOD A;  3VYS B;  2E60 A;  4XSX F;  3BZ6 A;  3S2D J;  4HV6 A;  2DU9 A;  5DCM A;  5D8L B;  4AWX B;  5IP7 J;  5HLI A;  1MJ9 A;  1OR7 A;  3NEU A;  2UUZ A;  3HGG A;  4KIG A;  1DU6 A;  1GUU A;  1TZL A;  3A01 B;  1FOW A;  1R1V A;  1V54 H;  1DQU A;  2P8T A;  2EV6 A;  2KPM A;  4RGX A;  2R7T A;  1UHS A;  2ELK A;  2A05 A;  4RB1 A;  3BTI A;  5EGO B;  5F1R A;  1SFX A;  3OYB A;  3JRE A;  1MSF C;  1NHA A;  1K4T A;  2WAQ N;  4Q48 A;  2R7F A;  3LSP A;  1U3E M;  4DIQ A;  4XOT A;  1YRN A;  3FHN A;  4Y33 A;  2QSH X;  3GXO A;  3FXK A;  3OYN A;  2R92 J;  2HDD A;  2KIF A;  2XAU A;  3S8P A;  1LFP A;  1O3S A;  3OS2 A;  3OSG A;  1FTT A;  2JPC A;  1WJA A;  3BCB A;  2L9S A;  3G4S I;  4CCM A;  3CC7 I;  3WE3 A;  3P9I A;  3OYH A;  2OAZ A;  3LA7 A;  1Z21 A;  2EFN A;  4UHT A;  3EET A;  4HZF A;  4HG2 A;  1YW7 A;  1WPK A;  1F36 A;  4YIF A;  5D5X B;  3FIW A;  3SHF A;  2MAB A;  4XLE A;  1HF0 A;  5GPC A;  4CUG A;  2EV5 A;  5EDN A;  1ACI A;  1VQ5 I;  3KP7 A;  4ZTJ A;  1WJE A;  4XOR A;  4LGW A;  3HXL A;  3V7S A;  3G1O A;  4XON A;  3SZP A;  2HZT A;  1TQI A;  1K78 A;  2LDU A;  1A31 A;  2L7K A;  3HRU A;  2O3F A;  3E0J B;  3TOB A;  4ESB A;  2L0K A;  4RM3 A;  5JHF A;  3IWZ A;  3ABT A;  1XPX A;  2ZFW A;  1S6L A;  2ESN A;  2P7V B;  2BHY A;  3OS1 A;  3U1K A;  1R49 A;  4W97 A;  3K4J A;  3H5A A;  3GTP J;  1MBK A;  3RDI A;  1VF9 A;  1XGO A;  4U0W A;  3ZQQ A;  2Z33 A;  1I6X A;  2YU9 J;  1JKO C;  3PO3 J;  1XSX A;  2IXS A;  2FOK A;  2DT5 A;  2Z5U A;  5D6F A;  1J9I A;  1SFE A;  1R9T J;  5L3F A;  4EJW A;  1PYV A;  4PCQ A;  3LSG A;  1LE8 B;  1X1P A;  3BT9 A;  2EFQ A;  3L09 A;  2W82 A;  2WV0 A;  1QVU A;  2A5Y B;  3CMM A;  3JRG A;  4FX4 A;  1JJ8 C;  2HVR A;  2B7E A;  3CC2 I;  3GME A;  2CJJ A;  2OCC H;  1EH7 A;  3BG9 A;  2OZ6 A;  1T98 A;  1QNT A;  5H6Q A;  2M30 A;  3CQZ J;  1Z3Y A;  3A4C A;  2QQ8 A;  3DLL F;  5E17 F;  2QZ8 A;  2IJL A;  5CLS A;  4S0H B;  4U0Y A;  2DMN A;  1TT5 B;  2VKV A;  3I4M J;  1MH3 A;  4OIN F;  2JSC A;  2IA1 A;  1D0Y A;  3GVA A;  4ZYA A;  2IS1 A;  1X1B A;  3FXJ A;  5ILV A;  4GO1 A;  5GTH C;  4BXX J;  1ZLJ A;  1IN4 A;  1A6Q A;  3GLX A;  5LLQ A;  1R22 A;  2Y75 A;  2K85 A;  2BXY A;  2BE5 F;  4W1U A;  4KIC A;  2NOJ B;  2KMU A;  1K6Y A;  3FK6 A;  3NRV A;  3KEQ A;  4YRV A;  2LH9 A;  2DLL A;  5F6F A;  3E7L A;  2Z3Y A;  3N97 A;  2HR3 A;  4QLC U;  1KQ8 A;  4MO7 A;  4A3L J;  4M6Y A;  3DCF A;  2HGC A;  5FGM A;  2ID6 A;  3EUK L;  1QZY A;  4A0X A;  3LSR A;  3GTJ J;  2L9V A;  1E3H A;  3F8B A;  3AL0 B;  1HKS A;  1RUO A;  1D5Y A;  3CLO A;  3U21 A;  3ZQ7 A;  4AIK A;  2CG4 A;  2V9P A;  2ZME C;  1ETQ A;  2ADU A;  2EA4 A;  5JVT A;  2O61 A;  4XLF A;  5JFR A;  1OYI A;  5ICC A;  2VPL A;  2DK5 A;  3WTV C;  4Q4Z F;  1FP1 D;  1MND A;  2VAS A;  2KJB A;  2QEX I;  2CS3 A;  1BOA A;  3IRR A;  1AKH A;  2K9Q A;  2M9H A;  3S14 J;  2RGV A;  3CLQ A;  3W2A A;  3KX2 A;  4DW6 A;  1LFB A;  3B02 A;  2CUJ A;  3ZN0 A;  3H92 A;  4S05 A;  1USS A;  2GXB A;  5KAF C;  1P2F A;  3KYD B;  3RSN A;  1IC8 A;  2X6X A;  1EJ9 A;  1ETO A;  3UNG C;  4H0E A;  3FXR A;  2IGM A;  2HEO A;  2DI3 A;  3AFH A;  2XGC A;  4X0G A;  2VL8 A;  3VSL A;  3D0S A;  4PUS A;  3S3N A;  2Q2E A;  4LLN A;  1S5L C;  3HUG B;  2LLK A;  4E7I A;  1ETK A;  3QYF A;  2R7Z J;  2QA4 I;  4FET A;  1MNM C;  5CVV A;  3L2C A;  1OQY A;  2WWY A;  4AC0 A;  3HG9 A;  3KE2 A;  3BWG A;  1HDP A;  2XGX A;  1VQ9 I;  4U7D A;  3L7W A;  1MDM B;  3Q9S A;  3OIO A;  1TWC J;  4PGG A;  2VKH A;  3P9K A;  4A3D J;  1O3T A;  4UNO A;  3JSO A;  4FCY A;  3BQY A;  1WJF A;  2XPW A;  4RB0 A;  3MD2 A;  3WTS C;  2DXI A;  1OCC H;  2ZME A;  2O5R A;  2DQR A;  2LF8 A;  2Y2Z A;  3E3V A;  2EK5 A;  4M3E A;  3BR0 A;  2QF7 A;  5E79 C;  4I7H A;  2VKE A;  1HKT A;  4IXA A;  2E2H J;  3OYE A;  5FLM J;  2AXT C;  1WJC A;  3KFW X;  4F55 A;  3JRD A;  1F5T A;  1Z6R A;  2OPT A;  1D8J A;  4V19 K;  3FXM A;  4ZYH A;  5IYB J;  1Q1V A;  2LR8 A;  2Y48 A;  2HZD A;  2VOO A;  2ISY A;  4CHU A;  3E5X A;  1UFM A;  1V4R A;  4V2G A;  2F2E A;  2JSP A;  5HLH A;  3OYF A;  3GF2 A;  4LJZ F;  5ERI A;  1YFH A;  4JBA A;  5D8K B;  3OSF A;  4MNU A;  1Y0N A;  3E6B A;  2JUG A;  2R3S A;  4E4H A;  4HDU A;  3GFL A;  3BTJ A;  2EJR A;  2JN6 A;  1JT6 A;  1YJ9 I;  4BQO A;  1ZRD A;  1O3Q A;  4JP0 A;  2CRG A;  4YFK F;  4CCK A;  1SD6 A;  3I59 A;  4ENK A;  4C3H J;  5EEG A;  4ZZL A;  4ZTF A;  2NVQ J;  4G6T B;  2EQR A;  1A5J A;  1J2X A;  3FBI B;  3K2Z A;  1H0M A;  2BYV E;  1PJR A;  2B0L A;  2EZL A;  2LBF A;  5CVR A;  1OMI A;  2VQH A;  2CW8 A;  3EUH C;  4NQW A;  4OMZ A;  4E7S A;  3DWL E;  2MFZ A;  2DDB A;  1LDK B;  5B1B H;  4HX4 A;  4CA0 A;  3I56 I;  1G6N A;  1MNE A;  1G8X A;  5EYR A;  4UB6 C;  4IL6 C;  2H6C A;  2DYS H;  4M72 A;  1U5T A;  1BA5 A;  3OY9 A;  5HNF A;  1T08 B;  4NBQ A;  3C2H A;  4HX8 A;  4ZYE A;  2DFH A;  4WXC A;  1K79 A;  2HYF A;  5F0C A;  4PJM A;  2IT0 A;  1OCZ H;  4PJJ A;  1R1T A;  5HLT A;  5FKK A;  3PNV A;  3HOT A;  1X1D A;  1MKM A;  1ZTR A;  3R0J A;  2DT7 B;  5LGU A;  2MBF A;  3KZY A;  4KN7 X;  1NH3 A;  1JKQ C;  2PQ8 A;  2XF5 A;  1C0W A;  1EKE A;  1ENH A;  2PMH A;  2H1K A;  2UXN A;  2L9N A;  5EG0 A;  3FDY A;  2P7C B;  2X1C A;  5HS8 A;  3CCE I;  4WCG A;  4MTE A;  3K70 C;  2EFW A;  2QWW A;  2B63 J;  2EWN A;  2TDX A;  2P5L C;  1ETW A;  4B4C A;  2UZK A;  5DUI A;  1YTY A;  2LVS A;  1TWF J;  2VJI A;  4GGG A;  2TCT A;  3J7Z I;  1ZRF A;  1UST A;  1Y6I A;  4M9Z A;  5GP9 A;  2HFH A;  2XUB A;  4BHC A;  5M3F J;  3KET A;  1K4S A;  3O6B B;  3BR6 A;  4QPO A;  4E7L A;  1IF1 A;  1ZHF A;  2WC2 A;  3QU6 A;  3L9F A;  1MJA A;  3GYH X;  1MBH A;  3PUB A;  3T1B A;  4EGY A;  2LD5 A;  2A3S A;  2PMU A;  2FF4 A;  3L2W A;  1P4X A;  2CQQ A;  2R7R A;  4P55 A;  2LFB A;  3QPT A;  2GOX B;  4A6E A;  4HF2 A;  3TL4 X;  1IRZ A;  3SQN A;  1O3R A;  2VJ4 A;  2DT6 A;  2RN7 A;  2MA3 A;  4MIM A;  4AYB N;  4EM1 A;  2JWT A;  3H9G A;  1BI1 A;  3U2R A;  4E70 A;  2M87 A;  1GHC A;  2QKM B;  3C18 A;  1GDT A;  2K3F A;  2LY9 A;  3GCM A;  2PJR A;  1V55 H;  5D5W B;  3S2H J;  2KLO A;  1BR1 A;  4B3A A;  2GOM A;  4HLX A;  1HBX G;  2OZU A;  3MQ0 A;  3CCS I;  5A2Q Z;  1IDY A;  3WHC A;  4E6K G;  3QOD A;  2FXA A;  2OQR A;  3KP3 A;  5IPA A;  4C9Y A;  2PX9 A;  4IHS A;  2D1V A;  3GTM J;  2XRN A;  2WBM A;  1HCR A;  2VXZ A;  3IAS 2;  1K6O A;  3CCQ I;  3GZ5 A;  4LMY A;  1SVM A;  2DBB A;  5E20 A;  2BZT A;  3K7A J;  2Y30 A;  4IX7 A;  1SFO J;  5LFA A;  1XMA A;  2RNG A;  1W7P D;  3F6V A;  4QPQ A;  1LUJ B;  4HA8 A;  3S1R J;  2Q1Z B;  5BPD A;  2H8R A;  4BJ5 C;  2PLY A;  2MW8 A;  3W2W A;  1W0U A;  3WOD F;  2AXL A;  4O3M A;  5KAI C;  1IZ1 A;  3RTR A;  4NC6 A;  5HDN A;  5H6R A;  3VYT B;  4DGW B;  5HS7 A;  2BVL A;  1MIJ A;  1OCP A;  4A2U A;  4KDP A;  3H0G J;  1JXS A;  3D5S C;  3I53 A;  1OKR A;  2CV1 A;  2EH3 A;  1X2M A;  2Z1D A;  2P5V A;  5FLV A;  1Z05 A;  4A3I J;  3ROU A;  2XRO A;  4AIH A;  1CF7 B;  4DZJ A;  5L3D A;  1SD7 A;  1Z1D A;  1RR7 A;  1IRF A;  3T8R A;  1XGM A;  2KRH A;  5JI6 A;  3WG7 H;  3GW2 A;  3CCV I;  4YG2 F;  1B9M A;  5K7F A;  1QPI A;  4MHG A;  2FUG 2;  5KNL A;  4BDZ A;  2WB1 N;  4PFP A;  4NUB A;  3JAM Z;  1IV6 A;  3WU0 A;  5LHI A;  2CUZ A;  4MLO A;  1WRJ A;  3HOW J;  4HST A;  4G9Y A;  1WKM A;  3JRC A;  1J09 A;  2ETH A;  1J5Y A;  1KON A;  5B5E C;  3QPL A;  1WWX A;  1B72 B;  3DPU A;  1BIA A;  1XSD A;  1APL C;  3ISP A;  3HBL A;  5CKT A;  2OTL I;  3KEO A;  4F52 A;  1AU7 A;  2XPV A;  3W3C A;  4UVC A;  4UUS B;  3EYI A;  1X58 A;  4C2M J;  3HL2 A;  1GVJ A;  3FKI J;  2NVY J;  2CO5 A;  1WI3 A;  1Z0X A;  2L02 A;  1U9O A;  3DBL B;  3WGG A;  3L2U A;  1YIJ I;  4M3F A;  1UG0 A;  2HQR A;  3A1Y A;  2EZI A;  3KPH A;  1R00 A;  3BOQ A;  3MEX A;  2ZBK A;  4U0V A;  1FYL A;  1LJ9 A;  4XLH A;  3E97 A;  2LK2 A;  3P5J A;  2D45 A;  2KRF A;  2BEO A;  2BV6 A;  2RV8 A;  4P1W A;  2WAQ A;  2HS5 A;  1VI0 A;  4G7H F;  1ZRC A;  1WH5 A;  2M1B A;  2DQL A;  2C6Y A;  1R23 A;  3FM5 A;  4F7Z A;  4IHW A;  1A6I A;  3TKY A;  3HOS A;  3ABM H;  3HOU J;  4L9N A;  2YU3 A;  4KNY A;  4BQA A;  3LSH A;  4L0Z B;  3MZY A;  5JHU A;  1AOY A;  2R7D A;  2COB A;  2OA4 A;  1CGP A;  4KN4 X;  1FBQ A;  1PVE A;  1IN5 A;  2ZC2 A;  4UV8 A;  1ETX A;  3OS0 A;  3F0C A;  5HDG A;  1X2N A;  3HHH A;  2UWM A;  3Q9V A;  4LB6 B;  1YX5 A;  4XN0 A;  3CDI A;  4ZH4 F;  2W4S A;  4A5M A;  2HKX A;  1ZG5 A;  1LDD A;  1WGX A;  3WG9 A;  1XTA A;  2CYY A;  1G3T A;  1JI8 A;  1IAW A;  2FA5 A;  3V8J A;  3CO7 C;  4GCV A;  2L01 A;  3M9A A;  2XAS A;  3QP6 A;  4KMF A;  3S17 J;  2OJE D;  5ICE A;  4ENN A;  3BG3 A;  4I02 A;  3OR2 C;  4XRS G;  4RLQ A;  4I98 B;  4N4N B;  2BBY A;  1T0F C;  2IGN A;  4UVB A;  4DYQ A;  2JA6 J;  5K5R A;  3KLO A;  1N77 A;  1YOV B;  2LKX A;  1YW8 A;  4LG3 A;  5K1Y A;  1LEA A;  2DJI A;  4L18 B;  1GV5 A;  5B3S H;  1BM9 A;  3K4L A;  1YIT I;  3IKT A;  2XKP A;  4L9V A;  3OYJ A;  6PAX A;  2I8D A;  3EUA A;  2ICW G;  5HOO A;  4XKB A;  2PI0 A;  4AVZ A;  2LNB A;  3R60 A;  5GAD J;  1I3Q J;  2BHZ A;  1XMK A;  1FTZ A;  5AIQ A;  4M3D A;  5F1J A;  3MKW B;  1IXS B;  4B8X A;  4XM3 A;  4BXU A;  5HLG A;  2E2J J;  3HSF A;  2FE3 A;  3NAR A;  5BQT A;  1I3A A;  1QVT A;  1I1G A;  4A69 C;  3K1M A;  3DLA A;  3M1C A;  1T38 A;  2LKS A;  2MLG A;  3BJO A;  3HM5 A;  4MGR A;  2EA2 A;  3SFI A;  2QVO A;  2DYR H;  2IVM A;  5F0F A;  2ACJ A;  2CV2 A;  2E1O A;  1VQ8 I;  3QOE A;  2CQK A;  4KFC A;  4RAY A;  5DM7 F;  2JQ7 A;  3L2R A;  3DQV C;  2BOL A;  1UHW A;  3FXL A;  4IHX A;  5FD6 A;  4CZZ A;  2K7L A;  5ICG A;  1U8B A;  1OCR H;  3O8H A;  5LD2 C;  4R1H A;  4LIU A;  3VPR A;  2Z99 A;  4C30 A;  3BPV A;  1T0F A;  1D0Z A;  2X1D A;  2XIG A;  1FWZ A;  4A0Y A;  1SMT A;  2EIM H;  2PMZ N;  2KRC A;  2W48 A;  3F21 A;  2A6H F;  4M9S A;  4ESJ A;  1O7F A;  4HLY A;  1SC7 A;  1RR8 C;  2IA0 A;  4UVA A;  1HXD A;  3OYM A;  1G3Y A;  1OYY A;  2ECC A;  4ABZ A;  4HQM A;  1DPR A;  1FEX A;  1ZAO A;  4U87 A;  4IF4 A;  4CYC B;  1STZ A;  1IUF A;  4HQE A;  5HOD A;  4I01 A;  1E3P A;  2K9L A;  3QPS A;  3TDZ C;  4JOM A;  5D4R A;  2R7U A;  1P4W A;  1TNT A;  2X1E A;  4HNU A;  3QP5 A;  1ZKG A;  3NWT A;  2HPM A;  3OYL A;  3JRB A;  3S32 A;  2L9R A;  3M3Y J;  3CF2 A;  3W6K B;  2ZXW H;  1G2H A;  2IBD A;  1ORK A;  3OYC A;  3I5U A;  2ZXH A;  3S93 A;  1U78 A;  2G7H A;  3Q0U A;  2V26 A;  3QAH A;  1ODD A;  2VBZ A;  3QWL A;  1TNS A;  3KYL A;  4Y13 A;  5CVU A;  1T33 A;  2FQ3 A;  3A02 A;  3MMY B;  3Q5F A;  2QKL B;  2VC1 A;  2JA7 J;  2XPU A;  2Y69 H;  4LLL A;  1FP2 A;  2NNN A;  5ILS A;  4EAT A;  3A03 A;  2GIV A;  1WFX A;  3R4K A;  3TDU C;  1JTY A;  2DO7 A;  5DDG A;  1RNL A;  5D5U B;  1ERD A;  1W4M A;  4ESF A;  4HBL A;  2FMY A;  3QYB A;  5IT9 K;  5FRO A;  1K7A A;  4DZP A;  3KLN A;  2RQQ A;  1QHG A;  1ITY A;  1P4A A;  3A0H C;  2F6C A;  5BS6 A;  4IRI A;  4ASN A;  1JT0 A;  1UG2 A;  2R7W A;  2K02 A;  2K3P A;  4DBR A;  3J81 Z;  3E6M A;  2ZJQ F;  1J59 A;  4BQQ A;  1X19 A;  3RPU D;  5FLX K;  1ZGW A;  1KZH A;  1IJW C;  4RDU A;  1A36 A;  2OCE A;  2WAF A;  4L0Y B;  2VOP A;  2CQ7 A;  2ZNZ A;  1ONV A;  5L3E A;  1EH6 A;  1ZGA A;  5C4X J;  3RQI A;  4O5V A;  1Z3X A;  2MD5 A;  3V7C A;  5CJ9 A;  3ECO A;  1D1C A;  4OOI A;  1J75 A;  1Y56 A;  3SEQ A;  4BEH A;  2H8W A;  4C2U A;  1IXC A;  3HOX J;  4YEL A;  3ZMV A;  2P81 A;  2E1M B;  3J80 Z;  4BXF A;  3RQ4 A;  2CQX A;  4EM0 B;  2K27 A;  1FSE A;  2DOD A;  5D5V B;  1TP4 A;  4G6D A;  5FRM A;  4NHJ A;  1SAN A;  3HKZ N;  3PL8 A;  4IO9 F;  3LQQ A;  3D5L A;  2DAO A;  4K2E A;  3F9K A;  1ZG3 A;  3RYP A;  5M5Y J;  2VQG A;  1V3F A;  3KYC B;  3L00 A;  4XLP F;  3P7N A;  4A5N A;  4A3J J;  4CGZ A;  3A2K A;  1OJL A;  2HYJ A;  3CUO A;  3CUQ A;  2DK8 A;  1U2W A;  3NWS A;  2OUM A;  3ZOB A;  1MMS A;  5HS9 A;  2BGC A;  3K10 A;  4ON0 A;  4UY8 I;  4Y4R A;  2KHM A;  3BRO A;  3BLY A;  5C3E J;  4XSZ F;  2QM3 A;  5J1U A;  3BY6 A;  3OYI A;  2V7F A;  2A07 F;  3GO5 A;  2N8G A;  4DOZ A;  4LFU A;  3GTG J;  2FNA A;  3DU5 A;  3FF5 A;  2WA0 A;  3HRT A;  4CXF A;  4CSW A;  1ZR4 A;  1TWH J;  3GTO J;  2KFD A;  4BE0 A;  1GXQ A;  3HRM A;  3JCU C;  2DN0 A;  4XKV A;  2CH0 A;  3N4M A;  2V6E A;  3MWM A;  3M8F A;  5J1R A;  4FX0 A;  5IYD J;  1UCR A;  1B4A A;  5FFZ A;  3TW6 A;  1TLH B;  3JRA A;  1IN8 A;  1BI3 A;  3CZ6 A;  3HPG A;  3H5R A;  2D5V A;  2XGE A;  1JJ6 C;  1SAU A;  5DV5 A;  3HB9 A;  3A01 A;  4UUV A;  2O8X A;  4XRM A;  1YG2 A;  4UB8 C;  1FYK A;  2XC7 A;  2E35 A;  1H9G A;  2HDW A;  2YR2 A;  5BNG A;  5E3O A;  5A2Q K;  2CMP A;  2DMT A;  1IG7 A;  4BBR J;  3K4M A;  3M8J A;  1VTN C;  4CIC A;  3HJE A;  5LHG A;  2EFP A;  5M3M J;  5TGT A;  4JX5 A;  5AON A;  2LF7 A;  3CF5 F;  1VQN I;  3OOP A;  2CUF A;  2VE8 A;  2V79 A;  3B6C A;  2GIZ A;  4IHT A;  4II3 A;  5BPI A;  4D1Q A;  2FSW A;  5KCM A;  3VOE A;  3S1Q J;  2F5C A;  4OU0 A;  3GTK J;  1NG7 A;  3V7R A;  3I64 A;  2DA7 A;  3LWF A;  3QU3 A;  3IH3 A;  5FO5 A;  2E1N A;  5F27 A;  2RAE A;  3AG1 H;  3FMS A;  2NVT J;  2HTJ A;  2BXZ A;  2FBI A;  5E1X A;  3TW7 A;  1J0R A;  3I55 I;  2RC4 A;  4I2O A;  4KIF A;  2IPQ X;  1VQ4 I;  3ERE D;  4OMY A;  1G4D A;  2W7N A;  3VYU B;  1PUF B;  2R7X A;  4FE7 A;  2VI6 A;  4HV5 A;  2O8K A;  5GPA A;  1O7L A;  1U5T C;  3SYT A;  4XIC A;  4II2 A;  4AYB A;  1R5I D;  5FJ8 J;  2LP0 A;  1LKX A;  4HEA 2;  2VQL A;  3SZG A;  4RLF A;  2Y9Z A;  1REP C;  3ZP5 A;  1KU7 A;  4OIR F;  1XG1 A;  1FMW A;  3IC7 A;  4ZYD A;  2IS4 A;  3GZ6 A;  4P9U A;  3E1S A;  1X3W B;  1RES A;  3DKW A;  5FKN A;  1VQO I;  2FEZ A;  2CW7 A;  3E6D A;  4CO8 A;  3JAM K;  3S2W A;  2M34 A;  2PFB A;  1T39 A;  2JK3 A;  2LMD A;  4EM2 A;  3JSP A;  2CFO A;  1AHD P;  3CJR B;  3DTK A;  4AIJ A;  4B1R A;  1ZGJ A;  2QGU A;  3COA C;  2A61 A;  3RCO A;  1R36 A;  2CWE A;  2R7O A;  1FT9 A;  1YS7 A;  2VXD A;  3PSI A;  4JX6 A;  1BI2 A;  1I5Z A;  3GX4 X;  1LE8 A;  3BTL A;  3OWT A;  4FHT A;  3F8N A;  3H3Z A;  1X1A A;  1TWA J;  1VZ0 A;  1TW3 A;  3ECH A;  4AU7 A;  3EQL F;  4A93 J;  2L5Q A;  1JUM A;  5LGT A;  1YI2 I;  2HTS A;  3ZMU A;  2KJC A;  4I76 A;  3PO2 J;  3CME I;  3CCU I;  3CDH A;  4NC7 A;  1OPC A;  3JRH A;  1TQP A;  2V1U A;  2DDA A;  4N0B A;  2L2O A;  4JQF A;  5IP6 A;  4BBS J;  3S3M A;  3VEP A;  3H9Q A;  1QZZ A;  1UHM A;  2NXN B;  3IP4 B;  3PFY A;  5BOX A;  2B9S A;  1RKT A;  1QHH D;  3K9T A;  1W1W E;  3JTH A;  3G1M A;  2Z2S B;  5IP9 J;  3C2G A;  5IOZ A;  1NK3 P;  3LAP A;  3BR5 A;  1SFU A;  2DOA A;  3F8F A;  1E0E A;  3ZMD A;  1S7O A;  1VQL I;  2WB1 A;  1FIA A;  1T8I A;  1MSE C;  4LLG F;  1B8I B;  1N78 A;  4Q47 A;  1TQM A;  4KIB A;  3CO6 C;  5H20 A;  1W7P A;  4NNJ A;  2F4O B;  3U9G A;  3J7Y J;  2BY1 A;  2DOE A;  2M5W A;  4WX9 A;  5EEH A;  1LVA A;  2EFO A;  4EMS A;  1Z91 A;  3M1E A;  2ZJ2 A;  3FWE A;  3ASN H;  3FMQ A;  1JE8 A;  2J5P A;  3ZGK A;  1BC8 C;  2X6W A;  3CJN A;  2H27 A;  4IJA A;  3LSM A;  3HSR A;  4XID A;  3LNQ A;  2A6T A;  4M71 A;  2W25 A;  1XGN A;  2MG4 A;  5KHD A;  1DU0 A;  1V5G A;  2O9L A;  4P96 A;  4IEJ A;  2FNP A;  4F93 B;  1X3Z B;  2M3A A;  3K0L A;  3IV5 A;  1NG6 A;  3V8L A;  4EGZ A;  3WTW C;  1XDS A;  1LB2 A;  2A5W A;  2VJ5 A;  2IW5 A;  1V5F A;  3RYR A;  1FOK A;  2VE9 A;  2DMU A;  1D0X A;  1W36 D;  3K6G A;  2DFF A;  1MBF A;  3QPH A;  4GDF A;  3CJT B;  5CVJ A;  2PJP A;  2Y0S A;  5EJC A;  4ENM A;  2P4W A;  2VJJ A;  1N25 A;  2OTJ I;  1VQM I;  4GFB A;  4RMN A;  2KIU A;  3HUG A;  4FQG A;  5GAE J;  1R4M B;  4KMU X;  2M7A A;  1HA8 A;  4ETS A;  4WXD A;  4C3I J;  4FAS D;  3CD6 I;  4Z2Y A;  2JUC A;  4M3B A;  3OL4 A;  1FX7 A;  3I4P A;  4RAZ A;  2IAI A;  2MSY A;  2O0Y A;  4Y3O A;  4I0B A;  4MTD A;  1P7I A;  2DA5 A;  1MDM A;  5FKO A;  2YX7 A;  3TBI A;  2E1C A;  4CCN A;  1XS9 A;  4IHY A;  2R5Z B;  2AHQ A;  3LFK A;  3WU2 C;  2ZSI B;  1DPU A;  5AIP A;  2VT3 A;  3ABU A;  3F72 A;  3FX3 A;  1JHF A;  3LQR A;  2XDV A;  4CCO A;  3W6J B;  2STW A;  2VIX A;  1IGN A;  4ITV A;  1QRY A;  3VSK A;  4U7B A;  4MFD A;  1G3S A;  4D7N A;  1BW6 A;  1WVR A;  2R4G A;  3ZXS A;  2E7W A;  1YIO A;  3E5Q A;  2E2I J;  1ZAR A;  1ETY A;  3ZQC A;  2YS9 A;  2HWV A;  4LG0 B;  3ZMZ A;  1WQ2 A;  2JVH A;  3TMO A;  4DQ2 A;  4A3G J;  2LOO A;  4AVP A;  2X51 A;  4LIV A;  5LRR A;  3K4N A;  1YW9 A;  3FKJ A;  3I0T A;  3K1N A;  4ZC3 A;  4L5J A;  1IW7 F;  2QUF A;  3CMA I;  4HAM A;  4BHB A;  1YHQ I;  1P6R A;  2VON A;  1R5G A;  5CVI A;  4G12 A;  2NNY A;  2CV0 A;  2ZNY A;  3PNT A;  2FBH A;  3X2Q H;  4BS9 A;  4D7M A;  4OAY A;  2I10 A;  1ZEL A;  1FOX A;  1K83 J;  2DA4 A;  2R7Q A;  3ZQI A;  3H0D A;  4Y17 A;  3ONQ A;  5DCM B;  4XBF A;  2HU9 A;  4ZDP A;  2R7S A;  5F08 A;  3C1D A;  3LSI A;  2F5F A;  5CYV A;  1BC7 C;  3VYR B;  4I99 C;  3G1L A;  4KIS A;  3R6S A;  5FKM A;  3F8M A;  1IO2 A;  2XHK A;  1F4K A;  1Z67 A;  2TRT A;  2LTP A;  3E6C C;  2ISZ A;  4P9F A;  4HNT A;  4M6X A;  4NB5 A;  3WTU C;  1ZG1 A;  2R0Q C;  3S15 J;  1LQ1 A;  4HF0 A;  3V4G A;  1R4N B;  4E7Z A;  3CCL I;  3IUO A;  3PM1 A;  5K5Q A;  1YRN B;  2FML A;  1DDN A;  3MZ8 A;  4R8H A;  1NTC A;  3I9V 2;  3F23 A;  3KZZ A;  1DP7 P;  3ASO H;  2M0M A;  3OYA A;  2IA2 A;  1Y8Q B;  4IVN A;  4BHP A;  3W2V A;  1P9Q C;  1I50 J;  5L3B A;  2MH2 A;  2OQG A;  4EJV A;  5JR3 A;  2P0W A;  2V4J C;  2KQR A;  1JTX A;  1S7A A;  3R0A A;  2PMZ A;  2Y0S N;  1T6S A;  5LEK A;  1AWC A;  3GEZ A;  2WTE A;  2HVS A;  3I3L A;  3C2B A;  1BR2 A;  2ZKZ A;  4AID A;  1MMN A;  2GLO A;  1MBJ A;  4NC8 A;  4BUP A;  3H36 A;  2ESH A;  3CTA A;  1YJW I;  3K4K A;  5E1W A;  2EPF A;  3F8C A;  2XAH A;  4IPA A;  3QYE A;  3DTE A;  2DTZ A;  4BGD A;  4TV7 A;  4U88 A;  3D1N I;  4A3E J;  1QZE A;  2DPU A;  4OIO F;  1KYZ A;  2EZH A;  2ME0 A;  4ZJZ A;  3FBN B;  2ZJP F;  1R58 A;  1GVD A;  1FBS A;  1OYW A;  1F43 A;  5IYC J;  2XAG A;  1K78 B;  2KP6 A;  2HXI A;  2Y31 A;  4JX4 A;  3GBG A;  4XL9 A;  2CW0 F;  1PDN C;  3T5X A;  3ZMT A;  4UXN A;  3SJM A;  2AQE A;  3RPQ A;  2HKO A;  1ZK8 A;  3HRS A;  4MEY F;  1L3L A;  2D2W A;  3M7G A;  3TOA A;  2HPI A;  3LSJ A;  5GTI C;  5DS9 A;  1Z77 A;  3MZH A;  3G6E I;  1HST A;  5DD4 A;  4D5C A;  2KL4 A;  3ABK H;  2KDZ A;  4IHV A;  1R7J A;  3LSK A;  4B47 A;  2M4G A;  4HPQ A;  1W5T A;  1S8N A;  3DKY A;  3HEF A;  1Y8R B;  3FMR A;  4M6V A;  2DJN A;  3ULQ B;  3VFZ A;  2WY8 Q;  4BY1 J;  3PJR A;  2K9N A;  1H8A C;  2EIJ H;  2M45 A;  4I0A A;  3KP6 A;  3OIQ A;  3CC4 I;  3HIF A;  5JVG F;  3WGH A;  4IRH A;  2OC6 A;  3MN2 A;  1HSJ A;  3KZI C;  3IL2 A;  1ZLK A;  1H88 C;  2DFI A;  1BIB A;  4CYD A;  3JTG A;  3KEY A;  4B3X A;  1HLV A;  3I54 A;  1XGS A;  5IT3 A;  2LYC A;  2X6O A;  1POG A;  5HNH A;  1YE9 A;  3T8T A;  2HXO A;  4QTR A;  4A3B J;  4YFX F;  2HOE A;  1W5C C;  5DEQ A;  2F48 A;  5IOY A;  2G7U A;  3I4N J;  1JUS A;  1OCO H;  2CFX A;  4E7H A;  2DA3 A;  4A3M J;  1X3U A;  3JRF A;  2EIK H;  2F5D A;  4L9J A;  1FNN A;  5M5W J;  1RC9 A;  1LEB A;  2GXG A;  2NVU B;  2IGK A;  4N4O B;  2JT1 A;  1DGR M;  2MYS A;  3KIO A;  3ZQG A;  3K4C A;  3LST A;  2BY2 A;  3K2A A;  2FD5 A;  3LMM A;  5GAG J;  3HKZ A;  3GTL J;  2RRE A;  5CQG A;  1EH8 A;  4H4K C;  2Z9O A;  2FU4 A;  2ELJ A;  2LSO A;  4HYE A;  1CF7 A;  4BNC A;  2OBP A;  1SMY F;  3DXJ F;  4FTH A;  1Z7U A;  1IRG A;  1TT0 A;  1OFC X;  4D0P A;  4IRG A;  1ULY A;  3O2P E;  4XOP A;  4BU2 A;  2F5V A;  1BJZ A;  2BY0 A;  1ZYR F;  2JZY A;  1QA6 A;  4OIP F;  2XRL A;  9ANT A;  4XRS A;  2XKO A;  4L5I A;  3ZR8 X;  1MGT A;  4ENJ A;  4B09 A;  4F91 B;  4PZJ A;  1AKH B;  3TQN A;  1YQA A;  3QOP A;  4OIQ F;  2K4J A;  3RPU A;  1UZC A;  2ECB A;  3G71 I;  1E3O C;  1MMA A;  3HYI A;  2QSG X;  4ZDO A;  4KJZ A;  3S16 J;  1JGS A;  1TTY A;  3IHU A;  4BKX A;  1XSV A;  4UV9 A;  1JHH A;  3V8K A;  3J7A O;  2W84 A;  2CQN A;  3UR3 C;  4J19 A;  3QRF F;  3VDX A;  2E71 A;  4N9H A;  2XAF A;  2ZXI A;  4QWQ A;  3GUD A;  4B48 A;  3ZPL A;  1B72 A;  3BR2 A;  1FY7 A;  4XLN F;  5ILU A;  1SEU A;  2IEK A;  2WAD A;  3CDL A;  2Q2E B;  2P6S A;  3ZRG A;  3OV8 A;  3IWF A;  2YX4 A;  1DP3 A;  1FIP A;  2NS8 A;  3LL7 A;  3M8E A;  4UUS A;  1TW2 A;  3KCC A;  1FLI A;  2W57 A;  3FXO A;  4RA2 A;  1D3Y A;  3BPX A;  5HVQ C;  3OYG A;  2PN6 A;  2YUS A;  2KZG A;  2F4M B;  4DJA A;  2L4A A;  2WY7 Q;  2E5Z A;  3F22 A;  3OR1 C;  3CCY A;  3BR1 A;  1GT0 C;  2DTR A;  2V6C A;  2VT2 A;  3CCM I;  5TJJ A;  4CZC A;  1HW2 A;  4HNV A;  1BL0 A;  2AO9 A;  2DA1 A;  2K4B A;  2ZME B;  3BC8 A;  3CUQ C;  5J8F A;  2BW3 A;  2LY2 A;  4A3C J;  5J4Y A;  3ZN1 A;  4RB2 C;  2MC3 A;  1LPQ A;  3H3V K;  1Y1W J;  4KYW A;  3WE2 A;  3QQA A;  1S9H A;  2HVQ A;  1ZQ3 P;  2EV0 A;  2IP2 A;  1FZP B;  3ML6 A;  5ICF A;  2JRT A;  5E18 F;  4KIT B;  4J00 A;  1IDZ A;  4JYK A;  2DMP A;  1JKP C;  3CES A;  1FSH A;  2K9M A;  1ON2 A;  1GXP A;  4B43 A;  1OCT C;  2K5C A;  2R7V A;  1I1S A;  5D6E A;  3OYK A;  3JW4 A;  5E8G A;  2L7Z A;  2W85 A;  2VUM J;  1B9N A;  3CCR I;  1VFC A;  3DPT A;  3HHG A;  2L7F P;  2OF7 A;  1R6R A;  4RGS A;  1XC5 A;  2ZCW A;  2GZW A;  3K69 A;  4IQJ A;  2QBY A;  1XX5 A;  2VB6 A;  4CDG A;  2FBK A;  1IRX A;  5LGN A;  1PP8 F;  2HOS A;  2PG4 A;  3MKL A;  3I59 B;  4MQV A;  5DUK A;  2R5Y A;  1WCM J;  1Y39 A;  4OAZ A;  1ZH5 A;  1YX3 A;  1BW5 A;  2VBX A;  3DEE A;  3HOV J; 
#chains in the Genus database with same CATH homology
 1LE8 A;  3BTL A;  2EH3 A;  1X2M A;  2K40 A;  3JR9 A;  1TWA J;  3BR3 A;  5FLV A;  2ZB9 A;  1W0T A;  4A93 J;  3CMY A;  1RPW A;  4A3I J;  1JUM A;  2M0C A;  4DZJ A;  3RKQ A;  4I76 A;  1WH7 A;  3PO2 J;  1RR7 A;  3OOU A;  3FK7 A;  4C3J J;  1RKW A;  2K9S A;  4LOC A;  2DA2 A;  3JRH A;  3Q0W A;  5K7F A;  1QPI A;  3WHB A;  5IP6 A;  4BBS J;  4V2F A;  2WB1 N;  5DTD A;  1IV6 A;  3Q3S A;  3TED A;  4Y52 J;  1JUP A;  1RKT A;  1Y1V J;  2CU7 A;  2QCO A;  4MLO A;  3G1M A;  5IP9 J;  3HOW J;  5IOZ A;  3JRC A;  3S2D J;  5EG0 B;  1NK3 P;  5IP7 J;  3BR5 A;  3QPL A;  1B72 B;  3HGG A;  4D5F A;  3BTC A;  4A3K J;  1DU6 A;  1GUU A;  3A01 B;  1FIA A;  1APL C;  1MSE C;  3HBL A;  1B8I B;  4Y7N J;  1UHS A;  2ELK A;  3BTI A;  5EGO B;  1AU7 A;  3JRE A;  1MSF C;  2XPV A;  4UUS B;  1X58 A;  4C2M J;  3FKI J;  3LOC A;  2WAQ N;  3HGY A;  3LSP A;  2NVY J;  5EGO A;  1YRN A;  1WI3 A;  1K61 A;  1Z0X A;  1U9O A;  4M3F A;  2R92 J;  2HDD A;  3LNQ A;  4XID A;  3JRI A;  2EZI A;  2VPR A;  5E3M A;  2MG4 A;  2M2E A;  3OSG A;  1DU0 A;  1FTT A;  2O9L A;  4IEJ A;  2LK2 A;  3IV5 A;  2FX0 A;  4CYC A;  2M8G X;  1VI0 A;  1WH5 A;  2DMU A;  4IHW A;  1A6I A;  1JGG A;  2X9D A;  1MBF A;  1WPK A;  3TP0 A;  1F36 A;  2E19 A;  3FIW A;  2KT0 A;  1HF0 A;  3HOU J;  5GPC A;  5EDN A;  2O7O A;  2COB A;  4GFB A;  1S7E A;  3G1O A;  3IH2 A;  1ETX A;  3F0C A;  1X2N A;  1FJL A;  4M3B A;  2IAI A;  2L0K A;  2MSY A;  4X6A J;  1WGX A;  3HOZ J;  2DA5 A;  2Y9Y A;  1P7I A;  5FKO A;  4W97 A;  5JLW A;  3GTP J;  1MBK A;  1XS9 A;  1VF9 A;  4IHY A;  2R5Z B;  2AHQ A;  2YU9 J;  4UUT A;  3S1N J;  3S17 J;  5JLX A;  3BG3 A;  4BY7 J;  1JKO C;  4XRS G;  3PO3 J;  1IGN A;  1I6H J;  2EBI A;  1QRY A;  4DYQ A;  2JA6 J;  4MFD A;  1R9T J;  4D7N A;  1BW6 A;  3LSG A;  1LE8 B;  2LKX A;  3BT9 A;  2E2I J;  1QVU A;  1ETY A;  3ZQC A;  2YS9 A;  1JJ8 C;  3JRG A;  5K7Z A;  1GV5 A;  2CJJ A;  4A3G J;  3BG9 A;  3HDD A;  3DEW A;  3CQZ J;  4I6Z A;  1I3Q J;  1TWG J;  4S0H B;  2DMN A;  1FTZ A;  4M3D A;  5F1J A;  2VKV A;  3I4M J;  4DYC A;  3ZQF A;  1MH3 A;  4G12 A;  2E2J J;  1LFU P;  3NAR A;  4D7M A;  2I10 A;  4BXX J;  1QVT A;  1K83 J;  2DA4 A;  4A69 C;  3BG5 A;  3ZQI A;  3HM5 A;  3SFI A;  4EEF G;  2XB5 A;  4W1U A;  1TC3 C;  5M5X J;  1T56 A;  5F0F A;  5F08 A;  3FK6 A;  4L5E A;  2E1O A;  3E7L A;  1EF4 A;  4MO7 A;  3G1L A;  5FKM A;  4A3L J;  2DA6 A;  3DCF A;  2TRT A;  2LTP A;  2ID6 A;  2XB0 X;  4QIW N;  4IHX A;  2G0E A;  1U8B A;  3O8H A;  1VND A;  3LSR A;  5E3L A;  3GTJ J;  3VPR A;  2R0Q C;  3S15 J;  1D5Y A;  1HDD C;  3W6V A;  5F0H A;  3PM1 A;  2PMZ N;  1YRN B;  1P7J A;  1ETQ A;  2W48 A;  1NTC A;  5EF6 A;  2ME6 A;  2HOA A;  2ECC A;  4ABZ A;  1AKH A;  2K9Q A;  1FEX A;  2M9H A;  3FIS A;  3S14 J;  1CQT A;  4CYC B;  1I50 J;  5C44 J;  1IUF A;  3S1M J;  5HOD A;  4DW6 A;  1LFB A;  1JTX A;  3QPS A;  3UKG A;  1ZR2 A;  2Y0S N;  1IC8 A;  4FIS A;  1ZKG A;  3C2B A;  5C4J J;  1ETO A;  3SDG A;  2MGQ A;  3JRB A;  2GLO A;  1MBJ A;  2NVX J;  2L9R A;  2XGC A;  3M3Y J;  1MBE A;  2R93 J;  1G2H A;  2IBD A;  1ORK A;  2ID3 A;  2DTZ A;  3D1N I;  2FQ4 A;  4A3E J;  1U78 A;  3Q0U A;  2FJ1 A;  2EZH A;  1MH4 A;  2LLK A;  3B6A A;  2ME0 A;  1F43 A;  1ETK A;  1GVD A;  5IYC J;  1T33 A;  5EEA A;  5FKL A;  3A02 A;  1MNM C;  2R7Z J;  2HXI A;  2Y31 A;  4JX4 A;  3GBG A;  1H89 C;  4AC0 A;  3SJM A;  1HDP A;  2XPU A;  2JA7 J;  3A03 A;  1ZK8 A;  3OIO A;  1TWC J;  1O4X A;  1JTY A;  4A3D J;  5DS9 A;  3LSJ A;  1Z77 A;  3BQY A;  3ZQH A;  4DZP A;  2XPW A;  4FCY A;  1ITY A;  4D5C A;  2KDZ A;  4IHV A;  1JT0 A;  1UG2 A;  2Y2Z A;  3BQZ A;  2JA5 J;  4FE4 A;  4M3E A;  3BR0 A;  2QF7 A;  3Q0V A;  3HEF A;  2VKE A;  2E2H J;  4M6V A;  5FLM J;  1PUF A;  2DJN A;  1ZGW A;  1HOM A;  3JRD A;  1MBG A;  1IJW C;  2HOT A;  4RDU A;  2OPT A;  4BY1 J;  1JKR C;  2K9N A;  1H8A C;  5K7H A;  5IYB J;  1Q1V A;  2LR8 A;  5C4X J;  3RQI A;  3MN2 A;  3RZD J;  4V2G A;  2GM4 A;  1H88 C;  4AUX A;  1UMQ A;  3HOX J;  3OSF A;  2NOG A;  2P81 A;  1GV2 A;  1HLV A;  2X6O A;  2CQX A;  1POG A;  3BTJ A;  2JN6 A;  4QTR A;  2HXO A;  4A3B J;  1JT6 A;  5IOY A;  3I4N J;  1SAN A;  1JUS A;  3HKZ N;  4JP0 A;  2DA3 A;  4A3M J;  2CRG A;  3JRF A;  4C3H J;  5M5W J;  2NVQ J;  5M5Y J;  2EQR A;  1A5J A;  4A3J J;  4MFE A;  4NDL A;  1OJL A;  2HYJ A;  2NS7 A;  2EZL A;  3ZQG A;  5EZG A;  3ZOB A;  3K2A A;  2FD5 A;  4A3F J;  3GTL J;  5F04 A;  3RZO J;  5C3E J;  5EYR A;  5J3L A;  5J1U A;  4FTH A;  1BA5 A;  4M3G A;  1OFC X;  3NAU A;  2N8G A;  3GTG J;  1BJZ A;  5F0C A;  2XRL A;  1ZR4 A;  1TWH J;  3GTO J;  9ANT A;  4XRS A;  1NK2 P;  1AKH B;  3M4O J;  5FKK A;  2DN0 A;  2ECB A;  1ZTR A;  5J1R A;  1E3O C;  3TP3 A;  5IYD J;  1JKQ C;  2JA8 J;  3S16 J;  3TW6 A;  4BKX A;  2H1K A;  1ENH A;  3JRA A;  4J19 A;  5EG0 A;  2CUE A;  2D5V A;  1RET A;  2XGE A;  4RBO A;  1JJ6 C;  1B72 A;  2B63 J;  3BR2 A;  1ETW A;  4B4C A;  3HB9 A;  3A01 A;  2LVS A;  5EZH A;  1TWF J;  2JMW A;  4XRM A;  2IEK A;  5J1Y A;  3CDL A;  5BNG A;  1B8I A;  1IG7 A;  5E3O A;  2DMT A;  2TCT A;  4BBR J;  5GP9 A;  1FIP A;  2NS8 A;  5M3F J;  5M3M J;  4UUS A;  3BR6 A;  4JX5 A;  2YUS A;  1MBH A;  2LD5 A;  2CUF A;  3GTQ J;  3B6C A;  2CQQ A;  2LFB A;  3CCY A;  2JJ7 A;  3BR1 A;  3S1Q J;  1GT0 C;  3GTK J;  1IRZ A;  2DA7 A;  4HNV A;  1BL0 A;  2AO9 A;  2DA1 A;  2XSD C;  3IH3 A;  4MIM A;  4AYB N;  5F27 A;  2RAE A;  2JWT A;  2NVT J;  4X1E A;  3TW7 A;  4A3C J;  2HI3 A;  3IH4 A;  1ETV A;  2HQ5 A;  1GDT A;  2LY9 A;  1Y1W J;  3H3V K;  3S2H J;  3QQA A;  1ZQ3 P;  4B3A A;  1PUF B;  4FE7 A;  2VI6 A;  4DYR A;  5E3N A;  5GPA A;  2O8K A;  4XIC A;  2XGD A;  1IDY A;  3WHC A;  3MVP A;  5FJ8 J;  1IDZ A;  4JYK A;  2LP0 A;  5IPA A;  1U9N A;  4XK4 A;  2DMP A;  1JKP C;  2X48 A;  2Y9Z A;  3GTM J;  1OCT C;  1HCR A;  2L7Z A;  1XG1 A;  4QSH A;  2VUM J;  3O8G A;  3K7A J;  1VFC A;  2Y30 A;  1SFO J;  1RES A;  2L7F P;  2OF7 A;  5FKN A;  1XC5 A;  3HOY J;  2R5Z A;  3S1R J;  2H8R A;  2WV1 A;  2M34 A;  2R5Y B;  1AHD P;  2JK3 A;  2L7M P;  2MW8 A;  1W0U A;  2HOS A;  2GBY A;  4B1R A;  3ZQL A;  3MKL A;  2R5Y A;  1WCM J;  3L1P A;  2DMQ A;  2EZK A;  1OCP A;  1BW5 A;  4JX6 A;  3H0G J;  4C3I J;  3HOV J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...