4XIDA

Antphd with 15bp dna duplex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords Homeotic protein antennapedia
publication title Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 19
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xidA00
1UMQA 1X2NA 2HXIA 3BG9A 1APLC 3B6AA 1H89C 4C3JJ 5E3MA 2XB0X 2CUFA 5C4XJ 2M0CA 2XGCA 3Q0VA 3JRBA 1JT0A 1B8IB 2K9QA 4I76A 1GT0C 1BJZA 2EQRA 2MG4A 5J1YA 3CCYA 1A6IA 4FTHA 2L0KA 3ZQHA 5F04A 1QVTA 1MBEA 3S1QJ 2DA7A 5EYRA 3LNQA 2JA8J 3OSFA 3HOVJ 3O8GA 3QQAA 3BG5A 4M3BA 4C3IJ 2HDDA 4A3BJ 3CQZJ 4X1EA 5FKLA 4M3FA 2L9RA 1BA5A 2H8RA 2R5ZB 1MBKA 1T56A 2HOTA 4XICA 2OF7A 1Y1WJ 2VKVA 4Y7NJ 1JUMA 3JRHA 1WI3A 3S14J 1MNMC 2DMUA 2COBA 2ID6A 3Q3SA 1GV5A 1JT6A 1O4XA 3I4NJ 2QCOA 1S7EA 2LTPA 1ETOA 3BTIA 3HKZN 4LOCA 3FKIJ 1TWFJ 2NVTJ 2IBDA 1TWCJ 4DZPA 3GTJJ 1F43A 1OJLA 2MGQA 3SDGA 3TW6A 4JYKA 4HNVA 4A3FJ 3S1MJ 4JX4A 2XPVA 3CMYA 2EZLA 2JMWA 2WV1A 2E2HJ 4A3CJ 5EG0A 2FQ4A 2TCTA 4IHWA 3A01B 2E2IJ 3LOCA 1GDTA 2ID3A 2B63J 1UHSA 3PM1A 2K40A 5FKMA 5IYBJ 1LE8A 5JLWA 2EBIA 4FE7A 2JN6A 1IC8A 2JJ7A 2DMPA 5EDNA 2VPRA 3JRAA 1WPKA 2E19A 2X9DA 3WHCA 2RAEA 1FJLA 2IEKA 1IGNA 5M3FJ 3BR1A 5IOZA 1WH7A 1XC5A 1IJWC 4MFDA 2OPTA 2D5VA 1PUFB 1TWGJ 4L5EA 4A3JJ 3M4OJ 2PMZN 2DA4A 4A3GJ 2ELKA 4IHXA 3BR2A 4BY1J 2XGEA 2CJJA 4BXXJ 2X48A 1QRYA 2DA2A 4B3AA 1HCRA 4DW6A 1R9TJ 2LD5A 3BTJA 3BR3A 1VNDA 1ENHA 5F0CA 2TRTA 3ZQGA 1A5JA 1K61A 5F0HA 3WHBA 1TWHJ 3GBGA 1F36A 2Y31A 2IAIA 3HOZJ 2YUSA 5BNGA 2NS7A 3JR9A 4S0HB 2M8GX 5C4JJ 4UUSB 2CQXA 2LY9A 1CQTA 4JX6A 1P7JA 1TWAJ 1E3OC 5FKKA 1MSFC 2JWTA 2XSDC 3SJMA 4A3IJ 3GTMJ 1MBHA 4BBRJ 5IPAA 3GTKJ 4W97A 4C3HJ 1I6HJ 5FJ8J 1JGGA 3HGGA 1ETVA 3RZDJ 2R7ZJ 1MH3A 4DYQA 3S1NJ 1HLVA 1ETKA 1T33A 2M9HA 2E2JJ 1JUSA 2XGDA 3FIWA 4M3EA 2NVXJ 4GFBA 4AC0A 3VPRA 5EZGA 4XRSA 1G2HA 1SFOJ 4NDLA 1GV2A 5IOYA 5HODA 3JRCA 2LVSA 1ZR4A 2DTZA 5E3OA 1U9OA 4Y52J 2KDZA 4QSHA 1U8BA 5EGOA 3ZOBA 5E3LA 1LE8B 3DEWA 1D5YA 3W6VA 3O8HA 2LP0A 3TP3A 2HI3A 3JRIA 3FK7A 2JA6J 3HB9A 3BQYA 1AU7A 2CUEA 1YRNA 2VUMJ 2CU7A 3QPSA 2R5YA 4D7MA 5M5WJ 3ZQCA 1OCTC 3MVPA 4FE4A 4A3MJ 2DMQA 2KT0A 1Z77A 1H8AC 1AKHA 1LFUP 3F0CA 4BBSJ 3BT9A 2X6OA 5DS9A 4DZJA 1ETXA 1HDPA 1VFCA 5GPCA 1MBJA 3HGYA 4MFEA 2FD5A 1JKQC 1JUPA 2DA1A 2MSYA 4AYBN 1I50J 3BTLA 1LFBA 1B72A 1DU6A 1I3QJ 1ZKGA 2FX0A 3S15J 5E3NA 4W1UA 9ANTA 3HOWJ 2O9LA 1IRZA 3S16J 1IDZA 4B1RA 2CRGA 1POGA 4DYRA 2JK3A 2H1KA 2JA5J 5FKNA 2HYJA 2HQ5A 3BG3A 4DYCA 1OCPA 3K7AJ 3QPLA 3HBLA 1MBGA 4MIMA 1RKWA 2EZIA 3GTLJ 4A3EJ 3S1RJ 2R92J 5GP9A 3SFIA 3JREA 5F0FA 2NVYJ 4MLOA 1RESA 2NVQJ 3HEFA 4A3LJ 1IG7A 1ZTRA 3B6CA 1X2MA 2Y9ZA 4X6AJ 3A03A 4FISA 2L7FP 5J3LA 1ETYA 4AUXA 1SANA 5M3MJ 3PO2J 3FISA 1OFCX 1P7IA 3D1NI 3E7LA 2Y0SN 2DJNA 2E1OA 1IDYA 4CYCA 4QIWN 5FLVA 1BW5A 1ETWA 1GVDA 1JKPC 1ETQA 4BKXA 4I6ZA 1FIAA 3G1LA 2L7ZA 2W48A 2I10A 5C44J 1AHDP 4D5FA 1NK2P 5EGOB 1VI0A 3LSJA 1MSEC 5JLXA 2EH3A 3JRFA 5EZHA 2FJ1A 3C2BA 4D7NA 3ZQIA 5FLMJ 3GTQJ 5GPAA 1BW6A 3K2AA 3NAUA 2HXOA 5EEAA 2ZB9A 1FTZA 4M6VA 2GM4A 2JA7J 3G1OA 3BQZA 3I4MJ 2CQQA 1MBFA 1WCMJ 2XPWA 4A69C 1W0UA 5IYDJ 3RKQA 4JX5A 5C3EJ 1JJ8C 1JJ6C 1HF0A 1UG2A 4XIDA 1RR7A 5EG0B 3BTCA 2LR8A 3A02A 4XRMA 2LFBA 4A93J 2QF7A 1JTXA 5F27A 1B72B 1ZK8A 4V2FA 3UKGA 4V2GA 4MO7A 3GTGJ 2Y2ZA 1X58A 3BR0A 3BR6A 4BY7J 1VF9A 1NTCA 2DA5A 2DN0A 5J1UA 5J1RA 1FEXA 3ZQFA 2ME0A 3S2DJ 1Z0XA 1XG1A 2DMTA 2EZHA 2P81A 2Y9YA 2LKXA 3TEDA 1DU0A 4FCYA 2DMNA 3Q0WA 3M3YJ 1ZQ3P 4UUSA 3DCFA 2DA6A 3HOXJ 1NK3P 3HOYJ 3HOUJ 5IP7J 2DA3A 1ORKA 3CDLA 3S17J 3OOUA 3LSRA 2K9SA 4B4CA 1W0TA 3S2HJ 1HDDC 2HOAA 1FTTA 1JKOC 2NOGA 3MKLA 3MN2A 1B8IA 3BR5A 1IV6A 5F08A 2Y30A 5IP9J 2O8KA 2WAQN 4CYCB 3IV5A 3PO3J 2AHQA 3RQIA 3G1MA 2VKEA 2GLOA 2XPUA 2XRLA 4ABZA 2K9NA 1EF4A 4IEJA 3HM5A 1XS9A 2EZKA 1MH4A 1BL0A 5EF6A 1RPWA 2XB5A 4EEFG 2R0QC 4J19A 4G12A 1RETA 5DTDA 3H0GJ 2GBYA 5IP6A 1ZR2A 1WGXA 2WB1N 2R5ZA 1H88C 3OIOA 3IH3A 3ZQLA 5FKOA 5K7HA 5K7FA 2LLKA 5M5XJ 1Y1VJ 3HDDA 1U78A 2G0EA 3JRDA 2AO9A 2LK2A 1ZGWA 4IHVA 3TP0A 4XK4A 2ECBA 4C2MJ 4XRSG 1HOMA 5IYCJ 2ECCA 4IHYA 3GTPJ 1IUFA 3TW7A 1U9NA 3Q0UA 1FIPA 3IH2A 2O7OA 4A3KJ 3L1PA 4M3DA 3OSGA 1RKTA 1QPIA 1JTYA 4RDUA 3A01A 2M34A 2MW8A 2YS9A 1WH5A 3GTOJ 1K83J 2N8GA 3IH4A 2VI6A 4QTRA 2ME6A 1TC3C 3RZOJ 1YRNB 3FK6A 3NARA 1GUUA 1ITYA 5F1JA 2R5YB 5K7ZA 4A3DJ 1Q1VA 2L7MP 4D5CA 3JRGA 2NS8A 2M2EA 4RBOA 4JP0A 2R93J 5M5YJ 3H3VK 1QVUA 1JKRC 3LSPA 2YU9J 1PUFA 2HOSA 4UUTA 1AKHB 4M3GA 3LSGA
chains in the Genus database with same CATH superfamily
2R3SA 1X2NA 2HXIA 1K79A 2EV6A 1LUJB 4BEHB 4BDYA 4C3JJ 1U2WA 5E3MA 3AL0B 2M0CA 2XGCA 3EETA 5K1YA 2R7SA 2K9QA 1GT0C 2IA0A 1FLIA 4C9YA 2VXZA 3KP5A 4AWXB 5J1YA 2IVMA 3RDIA 1UHWA 3IHUA 2E7WA 1LDDA 3ZQHA 4BU2A 3TDUC 2HOEA 4AVZA 4Y3OA 5H2FC 1VQ4I 3LNQA 3K2ZA 4Q48A 5L3BA 2VT2A 3JSPA 3WTWC 3ULQB 3I55I 1TW2A 3BG5A 2LKPA 4UUVA 3Q5FA 5CPRB 4M3FA 4RS8A 3CC2I 4I02A 2UWMA 2UV1A 2H8RA 1RUNA 2R5ZB 1G59A 2DYRH 3QP5A 3DLLF 2DU9A 2OF7A 2VKVA 3UR3C 3JRHA 3G71I 1FMVA 5KHDA 3P9KA 4EJWA 3S14J 2XVCA 1YW7A 2H1LA 4ETSA 3IL2A 2COBA 3HIFA 3BP8A 2KZGA 1GV5A 2KIMA 1AA7A 4OOIA 5K5QA 1S7OA 1W5TA 4LOCA 5EEGA 1FSEA 4LD5A 4BXFA 3TO9A 2WADA 1TWFJ 3AG2H 3I59A 1TWCJ 3G2BA 5JFRA 1QZEA 1S8NA 1MMGA 2UUZA 2VLAA 4HNVA 3OS1A 2JRMA 3OIQA 4HV6A 5AIPA 4JX4A 1ZG5A 2VE8A 3OYFA 4A0ZA 2ELHA 2EZLA 2V7FA 3HRSA 4WXDA 4A3CJ 1BI1A 1FSHA 4IHWA 2IS2A 5DYMA 2DDAA 1MMSA 2C6YA 1YS7A 2K40A 4ZC3A 3PNVA 4IOCF 5JLWA 2DMPA 3EUHA 2VPRA 2I5UA 3KLOA 2GXGA 2X9DA 1AWCA 2RAEA 5B1AH 2JPBA 2ZJPF 4F55A 1WH7A 4PCQA 2OPTA 1KU7A 2D5VA 4NC6A 2GAUA 1TWGJ 2RNGA 4KIGA 1PUFB 4U88A 3CJNA 2L7KA 1EH7A 4F7ZA 4GYIA 4BH9A 2FMLA 4A3GJ 1BJAA 5K5OA 3H0DA 2ZFWA 3TGNA 3QYFA 2CJJA 4FETA 2X48A 5ICGA 4MTDA 1W36C 2VOOA 4BXXJ 1V5GA 3LAPA 4A0YA 3OR2C 3H3ZA 1IN4A 4B3AA 2J5PA 4DW6A 3IP4B 1DPRA 4IZZA 3LQRA 1LDJA 3DQVC 4RA2A 2M5WA 2L9VA 4IVNA 1W7PA 3WHBA 4LFUA 5L3EA 3NWTA 3GBGA 2NS0A 3N4MA 4PUSA 4XN3A 5EEHA 2FOWA 3CP2A 1R4MB 1PDNC 3U1KA 4RLFA 4S0HB 4ZH4F 2LY9A 1UZCA 4U0VA 1CQTA 2DTRA 3J81K 2KLOA 1TWAJ 4UV8A 1O3SA 2JWTA 4KUMA 4BDZA 1WJDA 3KLNA 1YQAA 3SJMA 4Y4RA 4CH7A 4E7HA 5IPAA 3GTKJ 3RKWA 4C3HJ 1I6HJ 1FZPB 1IF1A 2DODA 3RZDJ 3DTEA 2MH9A 2R7ZJ 3D5SC 1K78B 3S1NJ 2IT0A 2ZXHA 4XSXF 3OYLA 2PEXA 3VB2A 2W4SA 3H3UA 1KU9A 2D45A 1W4MA 2KDOA 3T5XA 3W2WA 1TNSA 4EQQA 3I56I 1PVEA 1BI0A 1MJAA 2KISA 1SFOJ 3FXUA 1G2HA 3MWMA 3GW2A 2DBBA 1T8IA 1PP8F 2VC0A 1YG2A 4BJ5C 2RNJA 2VQLA 2KDZA 1J75A 2RDPA 3FMRA 5E3LA 5D5VB 2LG4A 1ZHFA 2B7EA 3DFGA 4ASNA 1T39A 4KDPA 2DT6A 3TP3A 3U1DA 4P55A 2PG4A 3BQYA 1OR7C 2CUEA 1MNEA 1H9GA 2CU7A 4D7MA 2WBMA 1I5ZA 1WJFA 3HUGA 2E1CA 4LGWA 1E2XA 3MVPA 3FBIB 1Z77A 4N0BA 2DOAA 2XGXA 2XAGA 4P9UA 4PK4A 4DZJA 3NEUA 1MBJA 3QWLA 4L9NA 4XLFA 4I0AA 2P0WA 3CCJI 1JKQC 2DA1A 4HSTA 4AYBN 5IT3A 2FF4A 1VQLI 3VSKA 1VQ8I 2ISZA 3PFYA 1LFBA 3BG7A 1SVLA 2FX0A 3L00A 4OIQF 9ANTA 4HDUA 1IRZA 3S16J 2CRGA 3LSKA 2XC7A 2V6EA 3G73A 1ZYRF 4RGUA 4DYRA 4EMSA 2VJ5A 3RQ4A 5DM6F 1I1SA 5LHIA 2PJRB 5DDGA 2F5FA 2A07F 4IJAA 2CO5A 5GAGJ 2IS6A 3T8TA 2F5CA 3KP2A 4MIMA 2R7WA 1GHCA 1RKWA 2BZTA 2VJ4A 2X85A 4HA8A 4RAFA 4J01A 1DP7P 1W7PD 4G6QA 1L3LA 2NVQJ 4YRVA 3HEFA 2IA1A 2R4GA 3KFWX 1ZTRA 4MEXF 3FZVA 2IPQX 3FXQA 2L4MA 3C18A 4XBFA 1DUXC 5FFZA 1G3WA 4OMYA 5ILSA 3ZCOA 1MZBA 4M9ZA 4AUXA 4OIPF 2EFOA 3M8JA 3OIPA 1IXRC 2KKOA 2E1OA 4WF2A 3PUFA 2MD5A 5IT9K 5FLVA 2JTVA 3HOSA 4HLYA 2OC6A 2DI3A 2BOLA 5LEJA 1IRGA 1ETQA 1LKXA 2HR3A 4G6TB 1O3RA 1RRJA 3G1LA 3OR1C 2E1MB 4IL6C 5C44J 4F91B 5LGUA 3H9QA 3OS0A 3LWFA 3BC8A 1TQIA 4XKBA 2DW4A 2HKOA 4MEYF 4J00A 1FYMA 1ZLKA 2QLZA 3QU6A 3WODF 3FMSA 3NRVA 2VBWA 2ESNA 4XMYA 3K9TA 5GPAA 5DV5A 3Q9SA 4CDGA 3OYBA 2RGVA 5CVRA 3BG6A 3WGHA 3BWGA 3FXJA 2V1XA 2JUCA 1FTZA 2ZMEB 2GM4A 2L02A 3MAJA 3G1OA 2K4BA 1ZG3A 2CQQA 2OZ6A 1MBFA 1WCMJ 2XPWA 1WVRA 3ESWB 3HJEA 5C3EJ 1JJ8C 2KP6A 1LNWA 4CXFA 2ZFUA 4XLEA 3KYCB 2O5RA 3PQKA 1LEBA 5TISC 4BXUA 2VBZA 5EG0B 3KP4A 2L5QA 3TBIA 2LC2A 4XRMA 3C2HA 1BN5A 1WJ5A 2QF7A 1XD7A 4FQGA 3D5RC 2A6TA 2R7VA 4V2FA 4KFCA 3F8BA 3PNYA 4AIKA 1YHQI 3QPTA 2L9SA 4CCLA 3BR0A 4BY7J 3V8KA 4UY8I 5E17F 4Q47A 5HNFA 2FEZA 4OAZA 2MLKA 3E6DA 1TP4A 5JVGF 4XKWA 2XUBA 4HX7A 2DMTA 2Y9YA 3I5UA 3TEDA 2KHMA 4BQQA 1A35A 3AG1H 3EPZA 4EM2A 3WGIA 3M3YJ 1ZQ3P 1NK3P 2JPCA 3OYMA 3DPLC 3S17J 4FHTA 1MJBA 2STWA 3S2HJ 2HOAA 1FTTA 2V26A 3MKLA 3U9GA 3OYAA 4IOAF 3M8EA 1SD4A 1OCZH 1K78A 3P7NA 1UJ8A 3MZHA 1IV6A 5IP9J 2VXDA 4YIRX 1G4DA 2XPUA 4HZFA 3ZMVA 3DEUA 1YX5A 2XRLA 4E70A 3J7AY 1HW2A 4ANJA 3HM5A 1LVAA 2MC3A 3CDHA 1T0FA 3I0TA 2E35A 2E7XA 2M3AA 2XB5A 1SAXA 1RETA 3WTTC 4C2TA 2OBPA 1X1CA 4IXAA 3H0GJ 4D1QA 1R71A 4N9HA 3I53A 1UAAA 5E8IA 4NC7A 2DOFA 1J09A 3K0LA 5IP6A 4RAGA 1WGXA 1GXPA 1Z3YA 3E6BA 1X3WB 1YW8A 3OIOA 3ZQLA 3A2KA 1BBYA 3ZMDA 5M5XJ 3TQNA 3HSEA 1U78A 1KONA 3PFIA 4MTEA 2AO9A 3HHHA 1ZGWA 3E5QA 2QYOA 1MKMA 4C2MJ 3A0BC 5ICEA 3LSIA 1HOMA 1SFKA 4IHYA 3H5AA 2FOKA 1U9NA 2GZWA 4GYGA 4RAZA 2CQKA 2R7QA 3A4CA 1FIPA 3DTIA 2XAJA 4LLNA 1R1UA 4UB8C 1V5FA 1QA6A 1ACIA 1RKTA 3K4MA 5DM7F 3E5UA 2EFQA 4M6XA 2MLGA 3LSHA 4JBAA 3LFKA 2GIVA 1QHGA 2RQQA 2N8GA 1R36A 2CH0A 4IF4A 3O6BB 2EK5A 2VI6A 3RZOJ 1IRFA 3FK6A 2K3FA 3E6CC 4TV7A 3FXOA 2R5YB 4A3DJ 2ACJA 1Q1VA 4GDFA 3EDPA 3E0JB 1BI2A 2WTEA 3KEOA 2EINH 4LB6B 2M2EA 3CCRI 4RBOA 1Y8QB 3H3VK 3LSPA 2JZYA 1YOVB 1H9TA 1G3TA 3HC7A 4QLCU 2BW3B 3LAJA 3BROA 2EIKH 4A0XA 4PFPA 1D0YA 3Q9VA 3SEQA 4KJZA 1FOXA 3JRBA 1JT0A 4BUPA 4DBQA 2BHYA 4HX4A 2H09A 2EQRA 2KPMA 2X6YA 2CQ7A 1IN8A 1R1VA 3DU5A 1E17A 4YFNF 3DF8A 3BCAA 1A6IA 2ZXWH 2BE5F 5DCFA 1N25A 3GWZA 5FFXA 3MKZA 2L0KA 2HEOA 4NB5A 4CGZA 3F6VA 3D0SA 5F04A 1MD0A 1MBEA 2DA7A 2BYVE 4L9TA 2VONA 2HVQA 4KA4A 3HOVJ 1WI9A 5HS7A 2P5LC 4C3IJ 4A3BJ 2OD5A 2V9KA 5FKLA 2L9RA 1SFEA 2B9SA 3L9FA 4AIJA 1R00A 2KJCA 3K4JA 2QQ8A 1ZRCA 1D0ZA 1S72I 1D0XA 2DMUA 3I71A 1P9QC 2ID6A 4X0GA 4E7ZA 2AS5F 5LGTA 1X3ZB 2VIXA 1O4XA 3I4NJ 1FBUA 2QCOA 2LTPA 2HQNA 3BTIA 3NQOA 4V19K 2KRCA 3K1PA 4ZDOA 4B48A 1G6NA 2G7HA 4F3QA 4G7OF 2MC4A 1FC3A 2OUMA 2XSJC 4XR6A 4L0YB 1OJLA 3F8FA 1R5ID 2MGQA 3TW6A 2VQGA 4L18B 3S1MJ 2XPVA 1TQPA 1ULYA 4B44A 3SXYA 3FWEA 3FM3A 4DQ2A 2E2HJ 1B6AA 5EG0A 2D1VA 2A68F 2WY8Q 4EJOA 2YX7A 2ID3A 1I27A 3PM1A 5FKMA 1R1TA 4HQMA 5IYBJ 4DJAA 2FXAA 2R7TA 3K4LA 1IC8A 3BJOA 5EDNA 2PN6A 4IHTA 2QA4I 4M71A 3WHCA 1OPCA 1YE9A 3ROUA 1FJLA 1U5TA 4MHGA 5TRDA 1YTYA 4KN7X 3WTZA 1TL8A 4HPQA 2MYSA 3K4CA 5IOZA 3CMAI 1VTNC 3VWBA 1XC5A 3OY9A 2E60A 2E36A 4PJLA 5F64A 4OIOF 2VJIA 3M7GA 3HYIA 4HF2A 4Y13A 1P4XA 1X1DA 2DA4A 1FYKA 3SFZA 3H9GA 3WTYC 2QQAA 2Q8KA 4YIFA 1YFHA 1Z3XA 1QRYA 2G9WA 2DA2A 2CSOA 2PBIA 2BXYA 1FOYA 1W5SA 2V9PA 4RGXA 1YJ9I 3SZPA 2LMDA 1HKSA 2RREA 5TJJA 1Q1HA 2Q0OA 3P9CA 3ZQGA 2XAUA 2XRNA 3DLAA 1Z21A 2VBXA 4LITA 1TWHJ 1QBJA 2DXIA 4CICA 1F36A 4CCNA 2Y31A 5CVUA 3HOZJ 3K4KA 2O3FA 1Y0UA 1XCVA 2R7XA 3WE2A 3JR9A 3V7SA 1YJNI 2IGNA 3CMMA 3V8LA 2M8GX 3MQ0A 5C4JJ 4UUSB 2CQXA 4BQAA 2R7DA 2RC4A 3K1NA 4G6DA 4NC8A 5D8KB 2VODA 5DCMB 1E3OC 2FMYA 4XKVA 5FKKA 4PJNA 1MSFC 3GCMA 2P6TA 3KZYA 4W97A 2BGCA 2OA4A 4LMYA 2HQAA 3TKYA 2GQQA 2KIUA 2ZBKA 2M9HA 2E2JJ 4R79A 4HEA2 4DOZA 3LA7A 3CCLI 1RI7A 3M07A 3CC7I 1Z7UA 4AC0A 2BY3A 3DKXA 3VSLA 4D0PA 1DGWY 2CFOA 3GMEA 4HX8A 2JVHA 1OCOH 4I2OA 1QO0D 2ISYA 1GV2A 3MCZA 1DDNA 3JRCA 2K7LA 3QPHA 2M7AA 1I1GA 5E3OA 1U9OA 4BL0B 4Y52J 2ZNZA 3FBNB 3KZIC 3ZOBA 3HRMA 3CC4I 1LE8B 3H9JA 1QU3A 1X4OA 3EUHC 1D5YA 2GXBA 2LP0A 3E1SA 5BPIA 4L0ZB 3V42A 5BMZA 1USSA 5ICCA 1HXDA 3QPSA 2R5YA 2QKMB 3CF5F 2Z9OA 1TT0A 3DBHB 4KNYA 3W2VA 4BJ6C 4M9SA 2DMQA 2EV5A 2KT0A 3ZR8X 1XPXA 1KU3A 3J7ZI 2W7NA 2R7OA 4H4KC 1ETXA 5J47A 1T08B 2I8DA 1MMNA 2FD5A 2BVLA 4XONA 1WRJA 1HKQA 3WTVC 2DFEA 4N4OB 2L4AA 3ABUA 4H0EA 1YIJI 4AM3A 1B72A 4ZYAA 1I3QJ 1ZKGA 3GZNB 1BR4A 2FNAA 3RIRA 3WU1B 3HOWJ 1DGRM 1IDZA 2E34A 2WAEA 2NYXA 2A05A 2LKSA 2PMUA 5FB2A 1KU2A 4WX9A 3ZQQA 2IGKA 2V1NA 4NNJA 2HQ5A 4B8XA 1U3EM 4GO1A 4Y17A 3HBLA 1ON2A 5DEQA 1FT9A 2W57A 5LHGA 1CF7B 4C2UA 4LLGF 1BIAA 4BHPA 2JQ7A 3GTLJ 4A3EJ 3V4GA 2R92J 1ZG1A 2HWVA 4GGGA 3ABLH 5CVIA 5F0FA 4E7IA 2R7UA 1RESA 4XLAA 2BV6A 3K70D 3CUQB 4A3LJ 3FF5A 2VQCA 2WV0A 2E1NA 2VBYA 1T98A 2AXTC 2BEOA 2L2OA 2ZO4A 3A03A 1Y39A 2L7FP 4E7JA 3ERED 4KICA 3AG4H 1LJ9A 3I3LA 3P5JA 1RZ4A 5M3MJ 2OCCH 4A12A 2BY1A 3CUOA 4ESJA 3FISA 1R7JA 3PO2J 3KCCA 1F4KA 2M30A 1XX5A 5HLIA 1AOYA 2WB1A 3KPHA 2LYCA 5JHUA 1TZLA 4QIWN 5HVQC 4KT5C 2KIQA 4UVBA 2XROA 3LFUA 3S8PA 1WSUA 1K7AA 1BW5A 3QOPA 4QPOA 4Z6YA 3DTKA 2F5DA 5CYVA 4I6ZA 1FIAA 1V4RA 4IQJA 3CCEI 1R22A 2I10A 4D5FA 1IO2A 1F1ZA 2ETHA 1B4AA 2K02A 5EGOB 1NK2P 2HDCA 2Z16A 2PFBA 1QGPA 1J7KA 2JSPA 4OMZA 2GOXB 3LSJA 2NAZA 3C2BA 4B43A 5FLMJ 4A6DA 2XKPA 1R23A 3GTQJ 2LF7A 3R0JA 4CCKA 3NAUA 1LVKA 2HXOA 1STZA 2HVSA 2JSCA 2ZB9A 2EA4A 2JA7J 1ZELA 3I4MJ 5L3CA 3TL4X 2Y75A 4PJMA 2EIJH 2XHKA 3RKQA 2QKLB 5B1BH 3RYRA 1VQOI 3HXLA 3FXLA 1ZGJA 3H5RA 3FDYA 2QWWA 4FT8A 5H6QA 1HSJA 1X19A 2O6GE 3LMMA 4P5OA 2HGCA 5F27A 4XQFA 4RB2C 3F23A 4MO7A 1UHMA 4HG2A 3GTGJ 4O3MA 2P5VA 2CFXA 2R7FA 3BR6A 1VF9A 2DA5A 2GOMA 2M1BA 5J1UA 4WK8F 2CW7A 1KQ9A 4AIHA 1D1AA 2COMA 1R5HA 1FEXA 3ZQFA 3VYTB 2FA5A 1Z0XA 2L9NA 2XDVA 4G9YA 1OCRH 2DMNA 3OOPA 5JI6A 3Q0WA 4DBRA 4UUSA 3DCFA 4L5JA 3HOYJ 4UB6C 5ERIA 2HPIA 2LBFA 3OYIA 2Y69H 1UB9A 1GXQA 2OCEA 4WCGA 3ZMTA 1ORKA 1D8KA 3KZZA 1WKMA 3CZ6A 3E3VA 4DGWB 1XDUA 4ON0A 3OOUA 4BEHA 3LSRA 4RAYA 1S6LA 3I58A 3MN2A 2KJBA 3BR5A 1NHAA 1IN7A 4EJTA 1UELB 3KX2A 3GFIA 2Y30A 1XGMA 3IV5A 4CYCB 3PO3J 1YX3A 3RCOA 2AHQA 5FLXZ 1ZN2A 3RQIA 3L2VA 2VKEA 4AVPA 5CKTA 4ABZA 2K9NA 4BE0A 2FBKA 2HU9A 3ABKH 3ASOH 4ITVA 1XS9A 2EZKA 4RM3A 1WWXA 3KYLA 1VQ5I 2P4WA 4EEFG 3HKZA 4G12A 1D8JA 5DTDA 1ZAOA 1ZRDA 1SMTA 2ADUA 2P7VB 2Z33A 2HYGD 3R4KA 3ZN1A 2ZKZA 4EGYA 2WB1N 5B5EC 2R5ZA 2QZ8A 2ZXJA 3DBLB 5FKOA 5K7HA 1SD5A 2LLKA 3I64A 2NNYA 4AIDA 4HF0A 2W82A 4Q4ZF 2E5NA 3AKZA 4O6JA 4YEJA 1OR7A 2Q2EB 3IUOA 5F6FA 4XRSG 4Y15A 4C30A 2DFFA 3JAMZ 3H92A 2VL8A 4F52A 1IUFA 4BJTA 3RYPA 1W1WE 3WTUC 4B09A 4ENNA 2Z1DA 1F9NA 2O7OA 3L7WA 2WWYA 1JTYA 2WAFA 5DD4A 5TGTA 4RDUA 2EB7A 3R61A 2HTJA 2DDBA 4S05A 2YS9A 4K2EA 2PMZA 2Y48A 1MMAA 4QTRA 2ME6A 1TC3C 3JTGA 1YRNB 1S5LC 3TMOA 3VEPA 1ITYA 5K7ZA 3IKVA 3JRGA 2H6CA 3KP6A 1CF7A 2NS8A 5LLQA 4JP0A 1USTA 5M5YJ 2QM3A 3LSTA 2NVUB 4LK0F 1B59A 4CYDA 4BHBA 1PUFA 1AKHB 3DPUA 3LSGA 3HTSB 3G4SI 3QP6A 2NOJB 3GFMA 2FBHA 1H0MA 3VYRB 2KRFA 3CUQA 4E7KA 1H89C 1XMXA 2EA2A 2M4KA 1Z7LA 4PSWA 5FD5A 1CGPA 3CF2A 5J40A 2XB0X 2CUFA 5C4XJ 2Z3YA 3RPQA 1B8IB 4I76A 4KN4X 1BJZA 3AAFA 1Y0NA 1XCBA 2Q1ZB 2P6SA 3F3XA 4UNOA 2VC1A 4XOTA 1ODDA 3GFLA 2JT1A 2CUJA 2X4HA 2FU4A 1T0FC 4DIQA 2IW5A 5EYRA 2JA8J 4RLQA 3O8GA 4BS9A 5L3GA 3REOA 2HDDA 1FBSA 4X1EA 3HL2A 3EYYA 3TOAA 2D1HA 3K6GA 1Z91A 2O0YA 2W1OA 1VQ7I 1MBKA 1TNTA 5BS6A 1PYVA 4YFXF 1Y1WJ 1JUMA 2QENA 5BOXA 3N05A 4A5MA 1MNMC 1IN5A 1OISA 2XAQA 4CCOA 3AFHA 5ILVA 1JT6A 2QQBA 2NRAC 2A69F 4UVCA 1S7EA 3FXRA 3HKZN 4ZYHA 4PFOA 3WG9A 5LEKA 3FKIJ 3J7YJ 3KEQA 2NVTJ 2ZCWA 2IBDA 4DZPA 3GTJJ 1MNDA 2LDUA 3SDGA 2V4JC 5FRNA 1T38A 2A61A 3O2PE 1JHHA 2X1EA 2W84A 1A04A 2WV1A 2PQ8A 2CGPA 1YW9A 4IHSA 2YPRA 4L5IA 3A01B 1Z6RA 2XIGA 1XSVA 4P1WA 3ECOA 1FOWA 4XRFA 4EM1A 2MFZA 3CCVI 1UHSA 4M73A 1XGNA 3SZGA 1N77A 3LA3A 3P9IA 4MGRA 2EBIA 2GIZA 2XAFA 3QYEA 4FE7A 2JN6A 1B9MA 4PGHA 1WPKA 1IGNA 2IEKA 2VQHA 4JOMA 2QEXI 1FNNA 2DQRA 3TO6A 1IN6A 1IJWC 2MABA 1W5CC 3R6SA 3RI4A 4YFKF 2LOOA 3FXKA 4BACA 4A3JJ 1TTYA 2PMZN 2XKOA 3OYDA 1BR2A 1HKTA 5B66C 4NQWB 3BR2A 2CS3A 3M8FA 1V55H 4BY1J 2XGEA 4OWRB 2K5CA 1DP3A 3BJAA 1BOBA 2MD0A 4HW0A 1I39A 1NH3A 3GYHX 1R9TJ 2LD5A 3BTJA 3BR3A 3DWLE 1LB2A 1VNDA 1ENHA 5F0CA 4JQFA 3OYHA 5GAHJ 2H8WA 4Z2YA 5GTIC 4HBLA 1K61A 3FMQA 3RPUA 2A5YB 3KP3A 3CDIA 3R0AA 1P4AA 1S7AA 2PJRA 1QQIA 2YUSA 2HZTA 5BNGA 1VQKI 1E0EA 1MIJA 2ESHA 3E6MA 4B47A 4A6EA 3EUAA 3DU6A 4PGGA 5B3SH 3HSRA 3K4BA 2RVCA 2YX4A 4I98B 2FQ3A 1YI2I 1BC7C 2XSDC 4IRHA 4I0BA 1MBHA 2VKDA 4ZZLA 3IC7A 2VPLA 2PLYA 1FP2A 1YLFA 2V9VA 4XLHA 3MMYB 4YELA 1ETVA 3J80Z 5A2QZ 4BE2A 5FD6A 1HLVA 1T33A 2P8TA 3PJRA 1JUSA 2XGDA 3I59B 2F6CA 3C3WA 3E97A 1XMAA 1BOAA 2NVXJ 1GLNA 3ERMA 4GFBA 3HG9A 4R1HA 4LB5A 5F1RA 1TLHB 1P6RA 1J9IA 2VN2A 5J6XA 1YYVA 2YU3A 2E5ZA 5IOYA 5HODA 1S9HA 3B73A 1KYWA 2LVSA 5CVVA 3ZMUA 2DTZA 1ZR4A 3J7AO 4QSHA 1G8XA 3S3NA 3H35A 1TW3A 1K4TA 2ICWG 3W6VA 1Z9CA 2OAZA 2ZSHB 2HI3A 4UHTA 1U5TC 2KQRA 2JA6J 1YRNA 2VUMJ 5D5XB 2QGUA 1FBQA 4EVIA 3WTSC 5M5WJ 1SFUA 2XF7A 3ZQCA 2BBYA 5HNHA 2OU2A 5J8CA 2ZMEA 3X2QH 2QVOA 4FE4A 2FUG2 2H94A 3ASNH 1LDKB 2K9LA 1H8AC 3OYKA 1AKHA 1J2XA 2O61A 2RQPA 4BBSJ 5DS9A 2KRHA 1VZ0A 1HDPA 4XL9A 5GPCA 3HGYA 3PNTA 4MFEA 1JUPA 1IXCA 2MSYA 2H27A 3M1CA 1I50J 3BTLA 4I09A 3GLXA 4ZJZA 3I9V2 4U0WA 5JVTA 1DU6A 2O9LA 1XB4A 2DT5A 2XAHA 4HYEA 4B1RA 3K70C 3MZ8A 4P9FA 3BPVA 2ELJA 2H1KA 4RGRA 3VOEA 4XLPF 2JA5J 5FKNA 2HYJA 2DLLA 3BG3A 1OCPA 1MBGA 1JGSA 2X1CA 4CCJA 2EZIA 3S1RJ 5GP9A 4M6YA 3DPTA 3JREA 3GX4X 2NVYJ 3S93A 4BGDA 4U87A 4MLOA 4KISA 3RPUD 1ZH5A 1IG7A 3B6CA 2VASA 3CESA 2Y9ZA 4OIRF 2K3PA 3CLQA 5J3LA 4G7ZF 4UXNA 1RUOA 2LY1A 1SD7A 4U7DA 5E20A 3ELKA 3MKWB 1OFCX 2UZKA 5EJCA 1WJAA 5KVRA 3MFKA 3D1NI 3E7LA 2QSFX 3AG3H 5D6FA 2DJNA 1IDYA 2XV4S 3ZRGA 3I54A 4HLXA 3JCUC 1VQNI 2CW0F 1ETWA 1GVDA 2Y0MA 2GXAA 2B0LA 2CV0A 4D9JA 2DYSH 2L7ZA 5HS9A 2J5OA 1E3PA 3HSFA 3CP8A 1EA3A 2IA2A 2K86A 1K6OA 3C2GA 1SMYF 2AQFA 3ZN0A 1V5EA 1A31A 5JLXA 3BDDA 4KIBA 4CUGA 3ABMH 4D7NA 3ZQIA 3DXJF 3I4PA 5H20A 1SVMA 5E1ZB 4DNCA 4HNUA 1BW6A 4XORA 4YIIA 3GZ5A 4YG2F 2VOPA 3CCSI 4UV9A 1IXSB 2V1UA 2HDWA 2W25A 3HPGA 1FY7A 3HUGB 4EJVA 4M9XA 1VQMI 4ZZDA 3BQZA 2Z99A 2BY0A 2YR2A 4G94A 5LFAA 1W0UA 1YS6A 2XASA 5IYDJ 1WJEA 2GWRA 4RMNA 1BM9A 1HF0A 1BI3A 6PAXA 1QNTA 2DFHA 1LPQA 1Y6IA 3KP7A 2ZNYA 4NQWA 4EATA 3BTCA 4OAYA 2LR8A 3A02A 2UXXA 4KIFA 4ZDPA 1BR1A 2FRHA 4A93J 2M8EA 4EGZA 3PQJA 3SYTA 1JTXA 2VB6A 3F72A 1DPUA 5GTHC 5D4SA 4IQ4A 4V2GA 3OYCA 4GRIA 2KZVA 4E7LA 1JE8A 5E8GA 2FBIA 1WHUA 2PMHA 3FKJA 3SHFA 4CZZA 1X58A 5GAEJ 1NTCA 1O7LA 2L54A 1MDMB 1WZ2A 1N78A 1J5YA 2MA3A 4HNTA 3S2DJ 5H6RA 1YITI 3L09A 1DU0A 1ON1A 2EZHA 2P81A 4ZYDA 2LKXA 5L3DA 2F5VA 4WXCA 2DPDA 2EFNA 2A3SA 2L3DA 3JSOA 4ENJA 4Q5SF 1YIOA 3HOUJ 1FX7A 2BW3A 2F48A 5DUIA 2EFPA 4CA0A 2DA3A 2M7BA 1ZLJA 1ZREA 2MBFA 3WTXC 2QSGX 3L2QA 3BLYA 4B4CA 1FOKA 1HDDC 4II3A 4RGSA 4CO8A 4XOPA 2HQRA 1XTAA 5CJ9A 1G3SA 1SD6A 2XF6A 1XN7A 5F08A 3COAC 2O8KA 3WU2C 4I01A 2QSHX 2GLOA 2DK5A 3LA2A 4GXOA 5JR3A 2Z5UA 3S32A 2DPUA 1EF4A 4IEJA 3SDBA 4FX4A 1OYWA 5D5UB 3C1DA 1BL0A 1IUYA 5EF6A 1RPWA 3CO6C 2E71A 2R0QC 5KAIC 3OYNA 4J19A 4KITB 3CTAA 3KETA 1VQ6I 3ECHA 1KZHA 2GBYA 1K6YA 4N4NB 5FRMA 4RB1A 3ZMZA 2CV1A 1JI8A 2X0LA 2QUFA 5K7FA 5LGNA 3T8RA 3IKTA 1Y1VJ 4L9VA 2OQRA 3GLLA 4PJJA 1RNLA 3SQNA 2LK2A 4AYBA 3QODA 2X1DA 3TP0A 3BZ6A 4IHVA 1R5GA 1OQYA 2BHZA 4XK4A 2ECBA 4ZYEA 1REPC 2LRDA 3FHNA 4ZTFA 2ECCA 3RJPA 3GTPJ 4LG0B 1SVOA 2MH2A 3TW7A 4B3XA 3RKYA 3Q0UA 4LIVA 3W6KB 3LSMA 5CVJA 4XLCA 4I7HA 3IH2A 1X3UA 1SC7A 4BE1A 3L1PA 3OYGA 3CJQB 1RC9A 3GFJA 1S29A 2M34A 3BOQA 2YSRA 3CJRB 3OL4A 1WH5A 3GTOJ 1TQMA 4MNUA 3GEZA 4CHUA 1UCRA 3JW4A 5FLXK 1C0WA 1F5TA 2CMPA 3NARA 2W00A 5K5RA 3A0HC 3MEXA 1P2FA 4U7BA 4EJUA 5LD2C 3W3CA 5D5WB 1QHHD 1WJBA 4F92B 1QVUA 1VQPI 1SEUA 2YU9J 1D3YA 2W85A 4ENMA 4UUTA 5AONA 1R6RA 3M1EA 4M3GA 1EKEA 4LG3A 1UMQA 2DAOA 3BJ6A 3BG9A 1WFXA 1APLC 3B6AA 2IXSA 3ZMSA 3AL0C 2XF5A 1EV7A 3KYDB 2M45A 3ABTA 1Z1DA 3Q0VA 1KQ8A 1T2KA 4HOBA 4XSZF 1D5VA 2D2WA 2MG4A 4LIUA 3V7CA 3V8JA 4IO9F 3IRQA 3CCYA 3T0YA 1X4PA 3BZCA 4FTHA 4NHJA 3JAMK 2DOEA 3EYIA 3VYUB 2F4IA 4HSRA 2CWEA 1QVTA 2DQLA 5HLGA 3S1QJ 4QWQA 1Z05A 3H36A 3OSFA 3HTUA 1RIOH 3QQAA 2OTJI 4M3BA 3CQZJ 1IZ1A 2EWNA 3CCQI 2Z2SB 1NG6A 1BA5A 4F93B 2QQ9A 1T56A 2HOTA 4XICA 2VT3A 4Y7NJ 2ZJQF 1FWZA 5DCMA 1QZYA 2BXZA 3WU0A 1WI3A 5GADJ 1GVJA 4RM2A 2AXLA 5FO5A 3FXMA 5HLTA 1R58A 3Q3SA 5DUKA 4KT6A 3TO7A 3WE3A 2EJRA 2WA0A 1ETOA 4MQVA 3IWZA 3FHZA 3NWSA 1MGTA 4U0YA 2GA1A 2ZSIB 3IRRA 2M87A 1F43A 2M4GA 3HHGA 1WJCA 4PDKA 4PZJA 3EQLF 4JYKA 4A3FJ 1LFPA 1XSXA 5D6EA 4R8HA 3CMYA 1L0OC 2JMWA 1U6GA 2HNHA 2K85A 4HDVA 1ERDA 3IWFA 3ZGKA 2FQ4A 2ZXIA 1P92A 2TCTA 1BC8C 2E2IJ 3CMEI 3LOCA 1GDTA 2OQGA 4AU7A 3J81Z 3F21A 2B63J 3UNGC 1ZARA 1LEAA 4Y33A 3RTRA 1LE8A 4XNFA 2A5WA 2JJ7A 1Z67A 4UVAA 3JRAA 4AD9A 2E19A 2JUGA 4E4HA 1MDMA 5M3FJ 1R4NB 1NG7A 3BR1A 3CCUI 3DEEA 2DO7A 3QRFF 2DJIA 4MFDA 1G3YA 3U2RA 1OLTA 3S3MA 5KCMA 4L5EA 4XN0A 3M4OJ 3KIOA 1HW1A 2LF8A 3CUQC 3PSIA 2ELKA 1RR8C 4BNCA 2K9MA 4IHXA 3K10A 3F22A 3CD6I 2F4MB 3BY6A 3GO5A 3L2CA 1HCRA 1B9NA 4ESBA 2BY2A 2X51A 3CO7C 3OV8A 2OTLI 4O5VA 2TRTA 1A5JA 1I6XA 1N75A 5F0HA 3F8NA 3LL7A 4XKCA 3F9KA 1J0RA 2UXNA 2IAIA 2PX9A 2HPMA 2NS7A 2KIFA 1W36D 1HA8A 2A6HF 1XGSA 5HLHA 5L3FA 2TDXA 1JXSA 5D4RA 2Y0SA 3H1CA 1X1AA 4JX6A 3C7JA 1P7JA 3G3ZA 3ISPA 3WG7H 3F8MA 5CQEA 1TT5B 2CG4A 1FP1D 4A3IJ 3GTMJ 2LY2A 1X1PA 4BBRJ 2QBYB 1Y8RB 1MW7A 1UFMA 2CW8A 2V79A 5J4VA 5HDNA 5FJ8J 1JGGA 4HF1A 2IGMA 3HGGA 1Z6TA 1MH3A 3HZJA 4DYQA 3DKYA 3PIOF 4X6AJ 1ETKA 2DFIA 4M72A 5FROA 1I3AA 4I99C 3FIWA 3KEYA 2LREA 4M3EA 3VPRA 5EZGA 4LG0A 4XRSA 2HTSA 5LRRA 1D1BA 3JTHA 4NDLA 2JA2A 2CQNA 4ZDLA 4LLLA 4QPQA 5E1XA 2KMUA 2OV7A 2F5EA 5FGMA 3H5NA 3K1MA 2LH9A 1O57A 1T6SA 1U0JA 4ZYGA 5JHFA 4M74A 1U8BA 5EGOA 1YO5C 4ENKA 5HOOA 3TDZC 3ZXSA 4EV0A 2KL4A 1IV8A 3K4NA 3DEWA 2STTA 1A6QA 3O8HA 3BZKA 5D8LB 2IS4A 3W2AA 1Y56A 3JRIA 3FK7A 3V7RA 5BQTA 3HB9A 1U5TB 1AU7A 2LSOA 5BPDA 4GCVA 3OS2A 1PJRA 5LBQA 4G7HF 1OCTC 4RB3C 1K4SA 3QOEA 3MKYB 4A3MJ 4ZTJA 1UG0A 3RKXA 4E7SA 3QAHA 5IT9Z 4A2UA 2EIMH 3VFZA 4HAMA 1LFUP 3F0CA 2WY7Q 2X6XA 1DQUA 4L9JA 3BT9A 2X6OA 1QPMA 4PJ0C 2FE3A 2VE9A 2P7CB 1VFCA 3M9AA 4CCMA 1U8RA 3OWTA 3VODA 3J80K 2RN7A 5A2QK 2BVMA 4IKFA 3S15J 5E3NA 4W1UA 3MZYA 1FMWA 1HW5A 1POGA 3PL8A 2JK3A 4PSXA 3OYEA 2NXNB 2O03A 3ONQA 1TBXA 2DCEA 4DYCA 4P96A 3K7AJ 3QPLA 2IGOA 2OJED 3SFIA 3K69A 4IPAA 2WAQA 4FX0A 4WWCA 3LQQA 2P5KA 1PP7U 2WC2A 3HRUA 3FX3A 1X2MA 2GA2A 2RV8A 5CQGA 5ICFA 1YJWI 2IS1A 4FISA 3OYJA 2F4OB 2ZJ2A 1ETYA 2HS5A 2CUZA 5HS8A 1EJ9A 1SANA 4G8XA 2V6CA 3HOTA 1S3JA 1KGSA 1P7IA 4LK1F 1J59A 2Y0SN 3ZPLA 3SEZA 3L2UA 3VYSB 4CYCA 2LNBA 2EILH 4XLNF 1OYIA 2O8XA 1JKPC 3OMYA 4N9IA 4BKXA 2HYFA 2E1MC 3GUDA 2W48A 1AHDP 3FM5A 3DV8A 1KA8A 1VI0A 4E6KG 1V54H 3GVAA 4BQNA 1MSEC 2EH3A 3JRFA 5EZHA 2FJ1A 2FSWA 4BQOA 1EH8A 2PJPA 4II2A 4OINF 3RSNA 1PUEE 3K2AA 1SAUA 5E18F 5HDKA 1ZGAA 5EEAA 2HVRA 1BIBA 1XGOA 1M1EB 2ZMEC 4M6VA 4A5NA 2Q2EA 3PUBA 4IRGA 3TOBA 4A69C 1OCCH 4JX5A 4JK1X 5LRSA 3BPXA 4HV5A 4CZCA 3CCMI 3L2RA 3SZTA 1JJ6C 2K27A 4MQ9F 1OKRA 1UG2A 2DT7B 2F2EA 3N97A 4XIDA 2PI0A 1RR7A 3D5LA 1T95A 2LFBA 4OU0A 1B72B 1VQ9I 2KFDA 1ZK8A 3VDXA 3UKGA 1ONVA 4BAYA 2HFHA 4LJZF 3KE2A 4HQEA 5LHHA 2Y2ZA 4HRIA 3IAM2 5E79C 1V3FA 1FYLA 4XM3A 2DN0A 5J1RA 1OMIA 3GF2A 2V1DA 3PSFA 2ME0A 2JVGA 1XG1A 3IAS2 1SFXA 1D1CA 4FASD 4FCYA 1LQ1A 1EH6A 1B1BA 2DA6A 1MJ9A 3HPHA 5CLSA 3HOXJ 3ML6A 5IP7J 3O3KA 3E5XA 4NBQA 2K4JA 3HRTA 3F6OA 3S3OA 3CDLA 3R60A 1P4WA 3T1BA 3W6JB 2L01A 1FPQA 2CYYA 2K9SA 1W0TA 2EPFA 2QBYA 3PIPF 5IY5H 1JKOC 2AQEA 2NOGA 1B8IA 2ZJRF 5KAFC 1XSDA 2DK8A 2OZUA 1HQCA 2IRFG 1HSTA 1W7PB 2WAQN 2IJLA 3CJTB 3G1MA 2HKXA 3EUKL 4CSWA 3MD2A 4WXHA 2W24A 2M0MA 1O3QA 4KMUX 1HBXG 2H6BA 1MH4A 2RKHA 4NUBA 1R49A 5AIQA 1XDSA 4RB0A 1ZRFA 3ZQ7A 2EFWA 1X1BA 1ZR2A 1WQ2A 3GXOA 3WGGA 1H88C 3IH3A 4IRIA 4BHCA 4ESFA 3CLOA 2IP2A 1MMDA 2NNNA 3HDDA 2G0EA 3JRDA 2CV2A 3QU3A 3A1YA 1JHFA 3DBRB 1OYYA 5ED4A 2G7UA 3BCBA 5IYCJ 3L2WA 1E3HA 2ZC2A 1O7FA 3S2WA 1KYZA 4EM0B 2JRTA 1XMKA 2EV0A 3B02A 5J4YA 5E1WA 3QYBA 1IW7F 5DD8A 4A3KJ 3DKWA 4M3DA 3OSGA 3F8CA 4KYWA 1QPIA 5J8FA 3U21A 1HC8A 3A01A 1IAWA 2MW8A 3G6EI 2R7RA 5KK1A 1K83J 3IH4A 2HZDA 1A36A 4IX7A 2X6WA 1GUUA 3DP7A 2A6EF 1KQ0A 5F1JA 4KMFA 4D5CA 2L7MP 2VJJA 2VKHA 2R93J 3GZ6A 5ILUA 4S04A 1IRXA 1QZZA 3ZP5A 5HDGA 1JKRC 4BYYA 5KNLA 3OL3A 2FNPA 2HOSA 2LBFB 1O3TA
chains in the Genus database with same CATH topology
1UMQA 1X2NA 2HXIA 3BG9A 1APLC 3B6AA 1H89C 4C3JJ 5E3MA 2XB0X 2CUFA 5C4XJ 2M0CA 2XGCA 3Q0VA 3JRBA 1JT0A 1B8IB 2K9QA 4I76A 1GT0C 1BJZA 2EQRA 2MG4A 5J1YA 3CCYA 1A6IA 4FTHA 2L0KA 3ZQHA 5F04A 1QVTA 1MBEA 3S1QJ 2DA7A 5EYRA 3LNQA 2JA8J 3OSFA 3HOVJ 3O8GA 3QQAA 3BG5A 4M3BA 4C3IJ 2HDDA 4A3BJ 3CQZJ 4X1EA 5FKLA 4M3FA 2L9RA 1BA5A 2H8RA 2R5ZB 1MBKA 1T56A 2HOTA 4XICA 2OF7A 1Y1WJ 2VKVA 4Y7NJ 1JUMA 3JRHA 1WI3A 3S14J 1MNMC 2DMUA 2COBA 2ID6A 3Q3SA 1GV5A 1JT6A 1O4XA 3I4NJ 2QCOA 1S7EA 2LTPA 1ETOA 3BTIA 3HKZN 4LOCA 3FKIJ 1TWFJ 2NVTJ 2IBDA 1TWCJ 4DZPA 3GTJJ 1F43A 1OJLA 2MGQA 3SDGA 3TW6A 4JYKA 4HNVA 4A3FJ 3S1MJ 4JX4A 2XPVA 3CMYA 2EZLA 2JMWA 2WV1A 2E2HJ 4A3CJ 5EG0A 2FQ4A 2TCTA 4IHWA 3A01B 2E2IJ 3LOCA 1GDTA 2ID3A 2B63J 1UHSA 3PM1A 2K40A 5FKMA 5IYBJ 1LE8A 5JLWA 2EBIA 4FE7A 2JN6A 1IC8A 2JJ7A 2DMPA 5EDNA 2VPRA 3JRAA 1WPKA 2E19A 2X9DA 3WHCA 2RAEA 1FJLA 2IEKA 1IGNA 5M3FJ 3BR1A 5IOZA 1WH7A 1XC5A 1IJWC 4MFDA 2OPTA 2D5VA 1PUFB 1TWGJ 4L5EA 4A3JJ 3M4OJ 2PMZN 2DA4A 4A3GJ 2ELKA 4IHXA 3BR2A 4BY1J 2XGEA 2CJJA 4BXXJ 2X48A 1QRYA 2DA2A 4B3AA 1HCRA 4DW6A 1R9TJ 2LD5A 3BTJA 3BR3A 1VNDA 1ENHA 5F0CA 2TRTA 3ZQGA 1A5JA 1K61A 5F0HA 3WHBA 1TWHJ 3GBGA 1F36A 2Y31A 2IAIA 3HOZJ 2YUSA 5BNGA 2NS7A 3JR9A 4S0HB 2M8GX 5C4JJ 4UUSB 2CQXA 2LY9A 1CQTA 4JX6A 1P7JA 1TWAJ 1E3OC 5FKKA 1MSFC 2JWTA 2XSDC 3SJMA 4A3IJ 3GTMJ 1MBHA 4BBRJ 5IPAA 3GTKJ 4W97A 4C3HJ 1I6HJ 5FJ8J 1JGGA 3HGGA 1ETVA 3RZDJ 2R7ZJ 1MH3A 4DYQA 3S1NJ 1HLVA 1ETKA 1T33A 2M9HA 2E2JJ 1JUSA 2XGDA 3FIWA 4M3EA 2NVXJ 4GFBA 4AC0A 3VPRA 5EZGA 4XRSA 1G2HA 1SFOJ 4NDLA 1GV2A 5IOYA 5HODA 3JRCA 2LVSA 1ZR4A 2DTZA 5E3OA 1U9OA 4Y52J 2KDZA 4QSHA 1U8BA 5EGOA 3ZOBA 5E3LA 1LE8B 3DEWA 1D5YA 3W6VA 3O8HA 2LP0A 3TP3A 2HI3A 3JRIA 3FK7A 2JA6J 3HB9A 3BQYA 1AU7A 2CUEA 1YRNA 2VUMJ 2CU7A 3QPSA 2R5YA 4D7MA 5M5WJ 3ZQCA 1OCTC 3MVPA 4FE4A 4A3MJ 2DMQA 2KT0A 1Z77A 1H8AC 1AKHA 1LFUP 3F0CA 4BBSJ 3BT9A 2X6OA 5DS9A 4DZJA 1ETXA 1HDPA 1VFCA 5GPCA 1MBJA 3HGYA 4MFEA 2FD5A 1JKQC 1JUPA 2DA1A 2MSYA 4AYBN 1I50J 3BTLA 1LFBA 1B72A 1DU6A 1I3QJ 1ZKGA 2FX0A 3S15J 5E3NA 4W1UA 9ANTA 3HOWJ 2O9LA 1IRZA 3S16J 1IDZA 4B1RA 2CRGA 1POGA 4DYRA 2JK3A 2H1KA 2JA5J 5FKNA 2HYJA 2HQ5A 3BG3A 4DYCA 1OCPA 3K7AJ 3QPLA 3HBLA 1MBGA 4MIMA 1RKWA 2EZIA 3GTLJ 4A3EJ 3S1RJ 2R92J 5GP9A 3SFIA 3JREA 5F0FA 2NVYJ 4MLOA 1RESA 2NVQJ 3HEFA 4A3LJ 1IG7A 1ZTRA 3B6CA 1X2MA 2Y9ZA 4X6AJ 3A03A 4FISA 2L7FP 5J3LA 1ETYA 4AUXA 1SANA 5M3MJ 3PO2J 3FISA 1OFCX 1P7IA 3D1NI 3E7LA 2Y0SN 2DJNA 2E1OA 1IDYA 4CYCA 4QIWN 5FLVA 1BW5A 1ETWA 1GVDA 1JKPC 1ETQA 4BKXA 4I6ZA 1FIAA 3G1LA 2L7ZA 2W48A 2I10A 5C44J 1AHDP 4D5FA 1NK2P 5EGOB 1VI0A 3LSJA 1MSEC 5JLXA 2EH3A 3JRFA 5EZHA 2FJ1A 3C2BA 4D7NA 3ZQIA 5FLMJ 3GTQJ 5GPAA 1BW6A 3K2AA 3NAUA 2HXOA 5EEAA 2ZB9A 1FTZA 4M6VA 2GM4A 2JA7J 3G1OA 3BQZA 3I4MJ 2CQQA 1MBFA 1WCMJ 2XPWA 4A69C 1W0UA 5IYDJ 3RKQA 4JX5A 5C3EJ 1JJ8C 1JJ6C 1HF0A 1UG2A 4XIDA 1RR7A 5EG0B 3BTCA 2LR8A 3A02A 4XRMA 2LFBA 4A93J 2QF7A 1JTXA 5F27A 1B72B 1ZK8A 4V2FA 3UKGA 4V2GA 4MO7A 3GTGJ 2Y2ZA 1X58A 3BR0A 3BR6A 4BY7J 1VF9A 1NTCA 2DA5A 2DN0A 5J1UA 5J1RA 1FEXA 3ZQFA 2ME0A 3S2DJ 1Z0XA 1XG1A 2DMTA 2EZHA 2P81A 2Y9YA 2LKXA 3TEDA 1DU0A 4FCYA 2DMNA 3Q0WA 3M3YJ 1ZQ3P 4UUSA 3DCFA 2DA6A 3HOXJ 1NK3P 3HOYJ 3HOUJ 5IP7J 2DA3A 1ORKA 3CDLA 3S17J 3OOUA 3LSRA 2K9SA 4B4CA 1W0TA 3S2HJ 1HDDC 2HOAA 1FTTA 1JKOC 2NOGA 3MKLA 3MN2A 1B8IA 3BR5A 1IV6A 5F08A 2Y30A 5IP9J 2O8KA 2WAQN 4CYCB 3IV5A 3PO3J 2AHQA 3RQIA 3G1MA 2VKEA 2GLOA 2XPUA 2XRLA 4ABZA 2K9NA 1EF4A 4IEJA 3HM5A 1XS9A 2EZKA 1MH4A 1BL0A 5EF6A 1RPWA 2XB5A 4EEFG 2R0QC 4J19A 4G12A 1RETA 5DTDA 3H0GJ 2GBYA 5IP6A 1ZR2A 1WGXA 2WB1N 2R5ZA 1H88C 3OIOA 3IH3A 3ZQLA 5FKOA 5K7HA 5K7FA 2LLKA 5M5XJ 1Y1VJ 3HDDA 1U78A 2G0EA 3JRDA 2AO9A 2LK2A 1ZGWA 4IHVA 3TP0A 4XK4A 2ECBA 4C2MJ 4XRSG 1HOMA 5IYCJ 2ECCA 4IHYA 3GTPJ 1IUFA 3TW7A 1U9NA 3Q0UA 1FIPA 3IH2A 2O7OA 4A3KJ 3L1PA 4M3DA 3OSGA 1RKTA 1QPIA 1JTYA 4RDUA 3A01A 2M34A 2MW8A 2YS9A 1WH5A 3GTOJ 1K83J 2N8GA 3IH4A 2VI6A 4QTRA 2ME6A 1TC3C 3RZOJ 1YRNB 3FK6A 3NARA 1GUUA 1ITYA 5F1JA 2R5YB 5K7ZA 4A3DJ 1Q1VA 2L7MP 4D5CA 3JRGA 2NS8A 2M2EA 4RBOA 4JP0A 2R93J 5M5YJ 3H3VK 1QVUA 1JKRC 3LSPA 2YU9J 1PUFA 2HOSA 4UUTA 1AKHB 4M3GA 3LSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMQ A;  1X2N A;  2HXI A;  3BG9 A;  1APL C;  3B6A A;  1H89 C;  4C3J J;  5E3M A;  2XB0 X;  2CUF A;  5C4X J;  2M0C A;  2XGC A;  3Q0V A;  3JRB A;  1JT0 A;  1B8I B;  2K9Q A;  4I76 A;  1GT0 C;  1BJZ A;  2EQR A;  2MG4 A;  5J1Y A;  3CCY A;  1A6I A;  4FTH A;  2L0K A;  3ZQH A;  5F04 A;  1QVT A;  1MBE A;  3S1Q J;  2DA7 A;  5EYR A;  3LNQ A;  2JA8 J;  3OSF A;  3HOV J;  3O8G A;  3QQA A;  3BG5 A;  4M3B A;  4C3I J;  2HDD A;  4A3B J;  3CQZ J;  4X1E A;  5FKL A;  4M3F A;  2L9R A;  1BA5 A;  2H8R A;  2R5Z B;  1MBK A;  1T56 A;  2HOT A;  4XIC A;  2OF7 A;  1Y1W J;  2VKV A;  4Y7N J;  1JUM A;  3JRH A;  1WI3 A;  3S14 J;  1MNM C;  2DMU A;  2COB A;  2ID6 A;  3Q3S A;  1GV5 A;  1JT6 A;  1O4X A;  3I4N J;  2QCO A;  1S7E A;  2LTP A;  1ETO A;  3BTI A;  3HKZ N;  4LOC A;  3FKI J;  1TWF J;  2NVT J;  2IBD A;  1TWC J;  4DZP A;  3GTJ J;  1F43 A;  1OJL A;  2MGQ A;  3SDG A;  3TW6 A;  4JYK A;  4HNV A;  4A3F J;  3S1M J;  4JX4 A;  2XPV A;  3CMY A;  2EZL A;  2JMW A;  2WV1 A;  2E2H J;  4A3C J;  5EG0 A;  2FQ4 A;  2TCT A;  4IHW A;  3A01 B;  2E2I J;  3LOC A;  1GDT A;  2ID3 A;  2B63 J;  1UHS A;  3PM1 A;  2K40 A;  5FKM A;  5IYB J;  1LE8 A;  5JLW A;  2EBI A;  4FE7 A;  2JN6 A;  1IC8 A;  2JJ7 A;  2DMP A;  5EDN A;  2VPR A;  3JRA A;  1WPK A;  2E19 A;  2X9D A;  3WHC A;  2RAE A;  1FJL A;  2IEK A;  1IGN A;  5M3F J;  3BR1 A;  5IOZ A;  1WH7 A;  1XC5 A;  1IJW C;  4MFD A;  2OPT A;  2D5V A;  1PUF B;  1TWG J;  4L5E A;  4A3J J;  3M4O J;  2PMZ N;  2DA4 A;  4A3G J;  2ELK A;  4IHX A;  3BR2 A;  4BY1 J;  2XGE A;  2CJJ A;  4BXX J;  2X48 A;  1QRY A;  2DA2 A;  4B3A A;  1HCR A;  4DW6 A;  1R9T J;  2LD5 A;  3BTJ A;  3BR3 A;  1VND A;  1ENH A;  5F0C A;  2TRT A;  3ZQG A;  1A5J A;  1K61 A;  5F0H A;  3WHB A;  1TWH J;  3GBG A;  1F36 A;  2Y31 A;  2IAI A;  3HOZ J;  2YUS A;  5BNG A;  2NS7 A;  3JR9 A;  4S0H B;  2M8G X;  5C4J J;  4UUS B;  2CQX A;  2LY9 A;  1CQT A;  4JX6 A;  1P7J A;  1TWA J;  1E3O C;  5FKK A;  1MSF C;  2JWT A;  2XSD C;  3SJM A;  4A3I J;  3GTM J;  1MBH A;  4BBR J;  5IPA A;  3GTK J;  4W97 A;  4C3H J;  1I6H J;  5FJ8 J;  1JGG A;  3HGG A;  1ETV A;  3RZD J;  2R7Z J;  1MH3 A;  4DYQ A;  3S1N J;  1HLV A;  1ETK A;  1T33 A;  2M9H A;  2E2J J;  1JUS A;  2XGD A;  3FIW A;  4M3E A;  2NVX J;  4GFB A;  4AC0 A;  3VPR A;  5EZG A;  4XRS A;  1G2H A;  1SFO J;  4NDL A;  1GV2 A;  5IOY A;  5HOD A;  3JRC A;  2LVS A;  1ZR4 A;  2DTZ A;  5E3O A;  1U9O A;  4Y52 J;  2KDZ A;  4QSH A;  1U8B A;  5EGO A;  3ZOB A;  5E3L A;  1LE8 B;  3DEW A;  1D5Y A;  3W6V A;  3O8H A;  2LP0 A;  3TP3 A;  2HI3 A;  3JRI A;  3FK7 A;  2JA6 J;  3HB9 A;  3BQY A;  1AU7 A;  2CUE A;  1YRN A;  2VUM J;  2CU7 A;  3QPS A;  2R5Y A;  4D7M A;  5M5W J;  3ZQC A;  1OCT C;  3MVP A;  4FE4 A;  4A3M J;  2DMQ A;  2KT0 A;  1Z77 A;  1H8A C;  1AKH A;  1LFU P;  3F0C A;  4BBS J;  3BT9 A;  2X6O A;  5DS9 A;  4DZJ A;  1ETX A;  1HDP A;  1VFC A;  5GPC A;  1MBJ A;  3HGY A;  4MFE A;  2FD5 A;  1JKQ C;  1JUP A;  2DA1 A;  2MSY A;  4AYB N;  1I50 J;  3BTL A;  1LFB A;  1B72 A;  1DU6 A;  1I3Q J;  1ZKG A;  2FX0 A;  3S15 J;  5E3N A;  4W1U A;  9ANT A;  3HOW J;  2O9L A;  1IRZ A;  3S16 J;  1IDZ A;  4B1R A;  2CRG A;  1POG A;  4DYR A;  2JK3 A;  2H1K A;  2JA5 J;  5FKN A;  2HYJ A;  2HQ5 A;  3BG3 A;  4DYC A;  1OCP A;  3K7A J;  3QPL A;  3HBL A;  1MBG A;  4MIM A;  1RKW A;  2EZI A;  3GTL J;  4A3E J;  3S1R J;  2R92 J;  5GP9 A;  3SFI A;  3JRE A;  5F0F A;  2NVY J;  4MLO A;  1RES A;  2NVQ J;  3HEF A;  4A3L J;  1IG7 A;  1ZTR A;  3B6C A;  1X2M A;  2Y9Z A;  4X6A J;  3A03 A;  4FIS A;  2L7F P;  5J3L A;  1ETY A;  4AUX A;  1SAN A;  5M3M J;  3PO2 J;  3FIS A;  1OFC X;  1P7I A;  3D1N I;  3E7L A;  2Y0S N;  2DJN A;  2E1O A;  1IDY A;  4CYC A;  4QIW N;  5FLV A;  1BW5 A;  1ETW A;  1GVD A;  1JKP C;  1ETQ A;  4BKX A;  4I6Z A;  1FIA A;  3G1L A;  2L7Z A;  2W48 A;  2I10 A;  5C44 J;  1AHD P;  4D5F A;  1NK2 P;  5EGO B;  1VI0 A;  3LSJ A;  1MSE C;  5JLX A;  2EH3 A;  3JRF A;  5EZH A;  2FJ1 A;  3C2B A;  4D7N A;  3ZQI A;  5FLM J;  3GTQ J;  5GPA A;  1BW6 A;  3K2A A;  3NAU A;  2HXO A;  5EEA A;  2ZB9 A;  1FTZ A;  4M6V A;  2GM4 A;  2JA7 J;  3G1O A;  3BQZ A;  3I4M J;  2CQQ A;  1MBF A;  1WCM J;  2XPW A;  4A69 C;  1W0U A;  5IYD J;  3RKQ A;  4JX5 A;  5C3E J;  1JJ8 C;  1JJ6 C;  1HF0 A;  1UG2 A;  4XID A;  1RR7 A;  5EG0 B;  3BTC A;  2LR8 A;  3A02 A;  4XRM A;  2LFB A;  4A93 J;  2QF7 A;  1JTX A;  5F27 A;  1B72 B;  1ZK8 A;  4V2F A;  3UKG A;  4V2G A;  4MO7 A;  3GTG J;  2Y2Z A;  1X58 A;  3BR0 A;  3BR6 A;  4BY7 J;  1VF9 A;  1NTC A;  2DA5 A;  2DN0 A;  5J1U A;  5J1R A;  1FEX A;  3ZQF A;  2ME0 A;  3S2D J;  1Z0X A;  1XG1 A;  2DMT A;  2EZH A;  2P81 A;  2Y9Y A;  2LKX A;  3TED A;  1DU0 A;  4FCY A;  2DMN A;  3Q0W A;  3M3Y J;  1ZQ3 P;  4UUS A;  3DCF A;  2DA6 A;  3HOX J;  1NK3 P;  3HOY J;  3HOU J;  5IP7 J;  2DA3 A;  1ORK A;  3CDL A;  3S17 J;  3OOU A;  3LSR A;  2K9S A;  4B4C A;  1W0T A;  3S2H J;  1HDD C;  2HOA A;  1FTT A;  1JKO C;  2NOG A;  3MKL A;  3MN2 A;  1B8I A;  3BR5 A;  1IV6 A;  5F08 A;  2Y30 A;  5IP9 J;  2O8K A;  2WAQ N;  4CYC B;  3IV5 A;  3PO3 J;  2AHQ A;  3RQI A;  3G1M A;  2VKE A;  2GLO A;  2XPU A;  2XRL A;  4ABZ A;  2K9N A;  1EF4 A;  4IEJ A;  3HM5 A;  1XS9 A;  2EZK A;  1MH4 A;  1BL0 A;  5EF6 A;  1RPW A;  2XB5 A;  4EEF G;  2R0Q C;  4J19 A;  4G12 A;  1RET A;  5DTD A;  3H0G J;  2GBY A;  5IP6 A;  1ZR2 A;  1WGX A;  2WB1 N;  2R5Z A;  1H88 C;  3OIO A;  3IH3 A;  3ZQL A;  5FKO A;  5K7H A;  5K7F A;  2LLK A;  5M5X J;  1Y1V J;  3HDD A;  1U78 A;  2G0E A;  3JRD A;  2AO9 A;  2LK2 A;  1ZGW A;  4IHV A;  3TP0 A;  4XK4 A;  2ECB A;  4C2M J;  4XRS G;  1HOM A;  5IYC J;  2ECC A;  4IHY A;  3GTP J;  1IUF A;  3TW7 A;  1U9N A;  3Q0U A;  1FIP A;  3IH2 A;  2O7O A;  4A3K J;  3L1P A;  4M3D A;  3OSG A;  1RKT A;  1QPI A;  1JTY A;  4RDU A;  3A01 A;  2M34 A;  2MW8 A;  2YS9 A;  1WH5 A;  3GTO J;  1K83 J;  2N8G A;  3IH4 A;  2VI6 A;  4QTR A;  2ME6 A;  1TC3 C;  3RZO J;  1YRN B;  3FK6 A;  3NAR A;  1GUU A;  1ITY A;  5F1J A;  2R5Y B;  5K7Z A;  4A3D J;  1Q1V A;  2L7M P;  4D5C A;  3JRG A;  2NS8 A;  2M2E A;  4RBO A;  4JP0 A;  2R93 J;  5M5Y J;  3H3V K;  1QVU A;  1JKR C;  3LSP A;  2YU9 J;  1PUF A;  2HOS A;  4UUT A;  1AKH B;  4M3G A;  3LSG A; 
#chains in the Genus database with same CATH topology
 2R3S A;  1X2N A;  2HXI A;  1K79 A;  2EV6 A;  1LUJ B;  4BEH B;  4BDY A;  4C3J J;  1U2W A;  5E3M A;  3AL0 B;  2M0C A;  2XGC A;  3EET A;  5K1Y A;  2R7S A;  2K9Q A;  1GT0 C;  2IA0 A;  1FLI A;  4C9Y A;  2VXZ A;  3KP5 A;  4AWX B;  5J1Y A;  2IVM A;  3RDI A;  1UHW A;  3IHU A;  2E7W A;  1LDD A;  3ZQH A;  4BU2 A;  3TDU C;  2HOE A;  4AVZ A;  4Y3O A;  5H2F C;  1VQ4 I;  3LNQ A;  3K2Z A;  4Q48 A;  5L3B A;  2VT2 A;  3JSP A;  3WTW C;  3ULQ B;  3I55 I;  1TW2 A;  3BG5 A;  2LKP A;  4UUV A;  3Q5F A;  5CPR B;  4M3F A;  4RS8 A;  3CC2 I;  4I02 A;  2UWM A;  2UV1 A;  2H8R A;  1RUN A;  2R5Z B;  1G59 A;  2DYR H;  3QP5 A;  3DLL F;  2DU9 A;  2OF7 A;  2VKV A;  3UR3 C;  3JRH A;  3G71 I;  1FMV A;  5KHD A;  3P9K A;  4EJW A;  3S14 J;  2XVC A;  1YW7 A;  2H1L A;  4ETS A;  3IL2 A;  2COB A;  3HIF A;  3BP8 A;  2KZG A;  1GV5 A;  2KIM A;  1AA7 A;  4OOI A;  5K5Q A;  1S7O A;  1W5T A;  4LOC A;  5EEG A;  1FSE A;  4LD5 A;  4BXF A;  3TO9 A;  2WAD A;  1TWF J;  3AG2 H;  3I59 A;  1TWC J;  3G2B A;  5JFR A;  1QZE A;  1S8N A;  1MMG A;  2UUZ A;  2VLA A;  4HNV A;  3OS1 A;  2JRM A;  3OIQ A;  4HV6 A;  5AIP A;  4JX4 A;  1ZG5 A;  2VE8 A;  3OYF A;  4A0Z A;  2ELH A;  2EZL A;  2V7F A;  3HRS A;  4WXD A;  4A3C J;  1BI1 A;  1FSH A;  4IHW A;  2IS2 A;  5DYM A;  2DDA A;  1MMS A;  2C6Y A;  1YS7 A;  2K40 A;  4ZC3 A;  3PNV A;  4IOC F;  5JLW A;  2DMP A;  3EUH A;  2VPR A;  2I5U A;  3KLO A;  2GXG A;  2X9D A;  1AWC A;  2RAE A;  5B1A H;  2JPB A;  2ZJP F;  4F55 A;  1WH7 A;  4PCQ A;  2OPT A;  1KU7 A;  2D5V A;  4NC6 A;  2GAU A;  1TWG J;  2RNG A;  4KIG A;  1PUF B;  4U88 A;  3CJN A;  2L7K A;  1EH7 A;  4F7Z A;  4GYI A;  4BH9 A;  2FML A;  4A3G J;  1BJA A;  5K5O A;  3H0D A;  2ZFW A;  3TGN A;  3QYF A;  2CJJ A;  4FET A;  2X48 A;  5ICG A;  4MTD A;  1W36 C;  2VOO A;  4BXX J;  1V5G A;  3LAP A;  4A0Y A;  3OR2 C;  3H3Z A;  1IN4 A;  4B3A A;  2J5P A;  4DW6 A;  3IP4 B;  1DPR A;  4IZZ A;  3LQR A;  1LDJ A;  3DQV C;  4RA2 A;  2M5W A;  2L9V A;  4IVN A;  1W7P A;  3WHB A;  4LFU A;  5L3E A;  3NWT A;  3GBG A;  2NS0 A;  3N4M A;  4PUS A;  4XN3 A;  5EEH A;  2FOW A;  3CP2 A;  1R4M B;  1PDN C;  3U1K A;  4RLF A;  4S0H B;  4ZH4 F;  2LY9 A;  1UZC A;  4U0V A;  1CQT A;  2DTR A;  3J81 K;  2KLO A;  1TWA J;  4UV8 A;  1O3S A;  2JWT A;  4KUM A;  4BDZ A;  1WJD A;  3KLN A;  1YQA A;  3SJM A;  4Y4R A;  4CH7 A;  4E7H A;  5IPA A;  3GTK J;  3RKW A;  4C3H J;  1I6H J;  1FZP B;  1IF1 A;  2DOD A;  3RZD J;  3DTE A;  2MH9 A;  2R7Z J;  3D5S C;  1K78 B;  3S1N J;  2IT0 A;  2ZXH A;  4XSX F;  3OYL A;  2PEX A;  3VB2 A;  2W4S A;  3H3U A;  1KU9 A;  2D45 A;  1W4M A;  2KDO A;  3T5X A;  3W2W A;  1TNS A;  4EQQ A;  3I56 I;  1PVE A;  1BI0 A;  1MJA A;  2KIS A;  1SFO J;  3FXU A;  1G2H A;  3MWM A;  3GW2 A;  2DBB A;  1T8I A;  1PP8 F;  2VC0 A;  1YG2 A;  4BJ5 C;  2RNJ A;  2VQL A;  2KDZ A;  1J75 A;  2RDP A;  3FMR A;  5E3L A;  5D5V B;  2LG4 A;  1ZHF A;  2B7E A;  3DFG A;  4ASN A;  1T39 A;  4KDP A;  2DT6 A;  3TP3 A;  3U1D A;  4P55 A;  2PG4 A;  3BQY A;  1OR7 C;  2CUE A;  1MNE A;  1H9G A;  2CU7 A;  4D7M A;  2WBM A;  1I5Z A;  1WJF A;  3HUG A;  2E1C A;  4LGW A;  1E2X A;  3MVP A;  3FBI B;  1Z77 A;  4N0B A;  2DOA A;  2XGX A;  2XAG A;  4P9U A;  4PK4 A;  4DZJ A;  3NEU A;  1MBJ A;  3QWL A;  4L9N A;  4XLF A;  4I0A A;  2P0W A;  3CCJ I;  1JKQ C;  2DA1 A;  4HST A;  4AYB N;  5IT3 A;  2FF4 A;  1VQL I;  3VSK A;  1VQ8 I;  2ISZ A;  3PFY A;  1LFB A;  3BG7 A;  1SVL A;  2FX0 A;  3L00 A;  4OIQ F;  9ANT A;  4HDU A;  1IRZ A;  3S16 J;  2CRG A;  3LSK A;  2XC7 A;  2V6E A;  3G73 A;  1ZYR F;  4RGU A;  4DYR A;  4EMS A;  2VJ5 A;  3RQ4 A;  5DM6 F;  1I1S A;  5LHI A;  2PJR B;  5DDG A;  2F5F A;  2A07 F;  4IJA A;  2CO5 A;  5GAG J;  2IS6 A;  3T8T A;  2F5C A;  3KP2 A;  4MIM A;  2R7W A;  1GHC A;  1RKW A;  2BZT A;  2VJ4 A;  2X85 A;  4HA8 A;  4RAF A;  4J01 A;  1DP7 P;  1W7P D;  4G6Q A;  1L3L A;  2NVQ J;  4YRV A;  3HEF A;  2IA1 A;  2R4G A;  3KFW X;  1ZTR A;  4MEX F;  3FZV A;  2IPQ X;  3FXQ A;  2L4M A;  3C18 A;  4XBF A;  1DUX C;  5FFZ A;  1G3W A;  4OMY A;  5ILS A;  3ZCO A;  1MZB A;  4M9Z A;  4AUX A;  4OIP F;  2EFO A;  3M8J A;  3OIP A;  1IXR C;  2KKO A;  2E1O A;  4WF2 A;  3PUF A;  2MD5 A;  5IT9 K;  5FLV A;  2JTV A;  3HOS A;  4HLY A;  2OC6 A;  2DI3 A;  2BOL A;  5LEJ A;  1IRG A;  1ETQ A;  1LKX A;  2HR3 A;  4G6T B;  1O3R A;  1RRJ A;  3G1L A;  3OR1 C;  2E1M B;  4IL6 C;  5C44 J;  4F91 B;  5LGU A;  3H9Q A;  3OS0 A;  3LWF A;  3BC8 A;  1TQI A;  4XKB A;  2DW4 A;  2HKO A;  4MEY F;  4J00 A;  1FYM A;  1ZLK A;  2QLZ A;  3QU6 A;  3WOD F;  3FMS A;  3NRV A;  2VBW A;  2ESN A;  4XMY A;  3K9T A;  5GPA A;  5DV5 A;  3Q9S A;  4CDG A;  3OYB A;  2RGV A;  5CVR A;  3BG6 A;  3WGH A;  3BWG A;  3FXJ A;  2V1X A;  2JUC A;  1FTZ A;  2ZME B;  2GM4 A;  2L02 A;  3MAJ A;  3G1O A;  2K4B A;  1ZG3 A;  2CQQ A;  2OZ6 A;  1MBF A;  1WCM J;  2XPW A;  1WVR A;  3ESW B;  3HJE A;  5C3E J;  1JJ8 C;  2KP6 A;  1LNW A;  4CXF A;  2ZFU A;  4XLE A;  3KYC B;  2O5R A;  3PQK A;  1LEB A;  5TIS C;  4BXU A;  2VBZ A;  5EG0 B;  3KP4 A;  2L5Q A;  3TBI A;  2LC2 A;  4XRM A;  3C2H A;  1BN5 A;  1WJ5 A;  2QF7 A;  1XD7 A;  4FQG A;  3D5R C;  2A6T A;  2R7V A;  4V2F A;  4KFC A;  3F8B A;  3PNY A;  4AIK A;  1YHQ I;  3QPT A;  2L9S A;  4CCL A;  3BR0 A;  4BY7 J;  3V8K A;  4UY8 I;  5E17 F;  4Q47 A;  5HNF A;  2FEZ A;  4OAZ A;  2MLK A;  3E6D A;  1TP4 A;  5JVG F;  4XKW A;  2XUB A;  4HX7 A;  2DMT A;  2Y9Y A;  3I5U A;  3TED A;  2KHM A;  4BQQ A;  1A35 A;  3AG1 H;  3EPZ A;  4EM2 A;  3WGI A;  3M3Y J;  1ZQ3 P;  1NK3 P;  2JPC A;  3OYM A;  3DPL C;  3S17 J;  4FHT A;  1MJB A;  2STW A;  3S2H J;  2HOA A;  1FTT A;  2V26 A;  3MKL A;  3U9G A;  3OYA A;  4IOA F;  3M8E A;  1SD4 A;  1OCZ H;  1K78 A;  3P7N A;  1UJ8 A;  3MZH A;  1IV6 A;  5IP9 J;  2VXD A;  4YIR X;  1G4D A;  2XPU A;  4HZF A;  3ZMV A;  3DEU A;  1YX5 A;  2XRL A;  4E70 A;  3J7A Y;  1HW2 A;  4ANJ A;  3HM5 A;  1LVA A;  2MC3 A;  3CDH A;  1T0F A;  3I0T A;  2E35 A;  2E7X A;  2M3A A;  2XB5 A;  1SAX A;  1RET A;  3WTT C;  4C2T A;  2OBP A;  1X1C A;  4IXA A;  3H0G J;  4D1Q A;  1R71 A;  4N9H A;  3I53 A;  1UAA A;  5E8I A;  4NC7 A;  2DOF A;  1J09 A;  3K0L A;  5IP6 A;  4RAG A;  1WGX A;  1GXP A;  1Z3Y A;  3E6B A;  1X3W B;  1YW8 A;  3OIO A;  3ZQL A;  3A2K A;  1BBY A;  3ZMD A;  5M5X J;  3TQN A;  3HSE A;  1U78 A;  1KON A;  3PFI A;  4MTE A;  2AO9 A;  3HHH A;  1ZGW A;  3E5Q A;  2QYO A;  1MKM A;  4C2M J;  3A0B C;  5ICE A;  3LSI A;  1HOM A;  1SFK A;  4IHY A;  3H5A A;  2FOK A;  1U9N A;  2GZW A;  4GYG A;  4RAZ A;  2CQK A;  2R7Q A;  3A4C A;  1FIP A;  3DTI A;  2XAJ A;  4LLN A;  1R1U A;  4UB8 C;  1V5F A;  1QA6 A;  1ACI A;  1RKT A;  3K4M A;  5DM7 F;  3E5U A;  2EFQ A;  4M6X A;  2MLG A;  3LSH A;  4JBA A;  3LFK A;  2GIV A;  1QHG A;  2RQQ A;  2N8G A;  1R36 A;  2CH0 A;  4IF4 A;  3O6B B;  2EK5 A;  2VI6 A;  3RZO J;  1IRF A;  3FK6 A;  2K3F A;  3E6C C;  4TV7 A;  3FXO A;  2R5Y B;  4A3D J;  2ACJ A;  1Q1V A;  4GDF A;  3EDP A;  3E0J B;  1BI2 A;  2WTE A;  3KEO A;  2EIN H;  4LB6 B;  2M2E A;  3CCR I;  4RBO A;  1Y8Q B;  3H3V K;  3LSP A;  2JZY A;  1YOV B;  1H9T A;  1G3T A;  3HC7 A;  4QLC U;  2BW3 B;  3LAJ A;  3BRO A;  2EIK H;  4A0X A;  4PFP A;  1D0Y A;  3Q9V A;  3SEQ A;  4KJZ A;  1FOX A;  3JRB A;  1JT0 A;  4BUP A;  4DBQ A;  2BHY A;  4HX4 A;  2H09 A;  2EQR A;  2KPM A;  2X6Y A;  2CQ7 A;  1IN8 A;  1R1V A;  3DU5 A;  1E17 A;  4YFN F;  3DF8 A;  3BCA A;  1A6I A;  2ZXW H;  2BE5 F;  5DCF A;  1N25 A;  3GWZ A;  5FFX A;  3MKZ A;  2L0K A;  2HEO A;  4NB5 A;  4CGZ A;  3F6V A;  3D0S A;  5F04 A;  1MD0 A;  1MBE A;  2DA7 A;  2BYV E;  4L9T A;  2VON A;  2HVQ A;  4KA4 A;  3HOV J;  1WI9 A;  5HS7 A;  2P5L C;  4C3I J;  4A3B J;  2OD5 A;  2V9K A;  5FKL A;  2L9R A;  1SFE A;  2B9S A;  3L9F A;  4AIJ A;  1R00 A;  2KJC A;  3K4J A;  2QQ8 A;  1ZRC A;  1D0Z A;  1S72 I;  1D0X A;  2DMU A;  3I71 A;  1P9Q C;  2ID6 A;  4X0G A;  4E7Z A;  2AS5 F;  5LGT A;  1X3Z B;  2VIX A;  1O4X A;  3I4N J;  1FBU A;  2QCO A;  2LTP A;  2HQN A;  3BTI A;  3NQO A;  4V19 K;  2KRC A;  3K1P A;  4ZDO A;  4B48 A;  1G6N A;  2G7H A;  4F3Q A;  4G7O F;  2MC4 A;  1FC3 A;  2OUM A;  2XSJ C;  4XR6 A;  4L0Y B;  1OJL A;  3F8F A;  1R5I D;  2MGQ A;  3TW6 A;  2VQG A;  4L18 B;  3S1M J;  2XPV A;  1TQP A;  1ULY A;  4B44 A;  3SXY A;  3FWE A;  3FM3 A;  4DQ2 A;  2E2H J;  1B6A A;  5EG0 A;  2D1V A;  2A68 F;  2WY8 Q;  4EJO A;  2YX7 A;  2ID3 A;  1I27 A;  3PM1 A;  5FKM A;  1R1T A;  4HQM A;  5IYB J;  4DJA A;  2FXA A;  2R7T A;  3K4L A;  1IC8 A;  3BJO A;  5EDN A;  2PN6 A;  4IHT A;  2QA4 I;  4M71 A;  3WHC A;  1OPC A;  1YE9 A;  3ROU A;  1FJL A;  1U5T A;  4MHG A;  5TRD A;  1YTY A;  4KN7 X;  3WTZ A;  1TL8 A;  4HPQ A;  2MYS A;  3K4C A;  5IOZ A;  3CMA I;  1VTN C;  3VWB A;  1XC5 A;  3OY9 A;  2E60 A;  2E36 A;  4PJL A;  5F64 A;  4OIO F;  2VJI A;  3M7G A;  3HYI A;  4HF2 A;  4Y13 A;  1P4X A;  1X1D A;  2DA4 A;  1FYK A;  3SFZ A;  3H9G A;  3WTY C;  2QQA A;  2Q8K A;  4YIF A;  1YFH A;  1Z3X A;  1QRY A;  2G9W A;  2DA2 A;  2CSO A;  2PBI A;  2BXY A;  1FOY A;  1W5S A;  2V9P A;  4RGX A;  1YJ9 I;  3SZP A;  2LMD A;  1HKS A;  2RRE A;  5TJJ A;  1Q1H A;  2Q0O A;  3P9C A;  3ZQG A;  2XAU A;  2XRN A;  3DLA A;  1Z21 A;  2VBX A;  4LIT A;  1TWH J;  1QBJ A;  2DXI A;  4CIC A;  1F36 A;  4CCN A;  2Y31 A;  5CVU A;  3HOZ J;  3K4K A;  2O3F A;  1Y0U A;  1XCV A;  2R7X A;  3WE2 A;  3JR9 A;  3V7S A;  1YJN I;  2IGN A;  3CMM A;  3V8L A;  2M8G X;  3MQ0 A;  5C4J J;  4UUS B;  2CQX A;  4BQA A;  2R7D A;  2RC4 A;  3K1N A;  4G6D A;  4NC8 A;  5D8K B;  2VOD A;  5DCM B;  1E3O C;  2FMY A;  4XKV A;  5FKK A;  4PJN A;  1MSF C;  3GCM A;  2P6T A;  3KZY A;  4W97 A;  2BGC A;  2OA4 A;  4LMY A;  2HQA A;  3TKY A;  2GQQ A;  2KIU A;  2ZBK A;  2M9H A;  2E2J J;  4R79 A;  4HEA 2;  4DOZ A;  3LA7 A;  3CCL I;  1RI7 A;  3M07 A;  3CC7 I;  1Z7U A;  4AC0 A;  2BY3 A;  3DKX A;  3VSL A;  4D0P A;  1DGW Y;  2CFO A;  3GME A;  4HX8 A;  2JVH A;  1OCO H;  4I2O A;  1QO0 D;  2ISY A;  1GV2 A;  3MCZ A;  1DDN A;  3JRC A;  2K7L A;  3QPH A;  2M7A A;  1I1G A;  5E3O A;  1U9O A;  4BL0 B;  4Y52 J;  2ZNZ A;  3FBN B;  3KZI C;  3ZOB A;  3HRM A;  3CC4 I;  1LE8 B;  3H9J A;  1QU3 A;  1X4O A;  3EUH C;  1D5Y A;  2GXB A;  2LP0 A;  3E1S A;  5BPI A;  4L0Z B;  3V42 A;  5BMZ A;  1USS A;  5ICC A;  1HXD A;  3QPS A;  2R5Y A;  2QKM B;  3CF5 F;  2Z9O A;  1TT0 A;  3DBH B;  4KNY A;  3W2V A;  4BJ6 C;  4M9S A;  2DMQ A;  2EV5 A;  2KT0 A;  3ZR8 X;  1XPX A;  1KU3 A;  3J7Z I;  2W7N A;  2R7O A;  4H4K C;  1ETX A;  5J47 A;  1T08 B;  2I8D A;  1MMN A;  2FD5 A;  2BVL A;  4XON A;  1WRJ A;  1HKQ A;  3WTV C;  2DFE A;  4N4O B;  2L4A A;  3ABU A;  4H0E A;  1YIJ I;  4AM3 A;  1B72 A;  4ZYA A;  1I3Q J;  1ZKG A;  3GZN B;  1BR4 A;  2FNA A;  3RIR A;  3WU1 B;  3HOW J;  1DGR M;  1IDZ A;  2E34 A;  2WAE A;  2NYX A;  2A05 A;  2LKS A;  2PMU A;  5FB2 A;  1KU2 A;  4WX9 A;  3ZQQ A;  2IGK A;  2V1N A;  4NNJ A;  2HQ5 A;  4B8X A;  1U3E M;  4GO1 A;  4Y17 A;  3HBL A;  1ON2 A;  5DEQ A;  1FT9 A;  2W57 A;  5LHG A;  1CF7 B;  4C2U A;  4LLG F;  1BIA A;  4BHP A;  2JQ7 A;  3GTL J;  4A3E J;  3V4G A;  2R92 J;  1ZG1 A;  2HWV A;  4GGG A;  3ABL H;  5CVI A;  5F0F A;  4E7I A;  2R7U A;  1RES A;  4XLA A;  2BV6 A;  3K70 D;  3CUQ B;  4A3L J;  3FF5 A;  2VQC A;  2WV0 A;  2E1N A;  2VBY A;  1T98 A;  2AXT C;  2BEO A;  2L2O A;  2ZO4 A;  3A03 A;  1Y39 A;  2L7F P;  4E7J A;  3ERE D;  4KIC A;  3AG4 H;  1LJ9 A;  3I3L A;  3P5J A;  1RZ4 A;  5M3M J;  2OCC H;  4A12 A;  2BY1 A;  3CUO A;  4ESJ A;  3FIS A;  1R7J A;  3PO2 J;  3KCC A;  1F4K A;  2M30 A;  1XX5 A;  5HLI A;  1AOY A;  2WB1 A;  3KPH A;  2LYC A;  5JHU A;  1TZL A;  4QIW N;  5HVQ C;  4KT5 C;  2KIQ A;  4UVB A;  2XRO A;  3LFU A;  3S8P A;  1WSU A;  1K7A A;  1BW5 A;  3QOP A;  4QPO A;  4Z6Y A;  3DTK A;  2F5D A;  5CYV A;  4I6Z A;  1FIA A;  1V4R A;  4IQJ A;  3CCE I;  1R22 A;  2I10 A;  4D5F A;  1IO2 A;  1F1Z A;  2ETH A;  1B4A A;  2K02 A;  5EGO B;  1NK2 P;  2HDC A;  2Z16 A;  2PFB A;  1QGP A;  1J7K A;  2JSP A;  4OMZ A;  2GOX B;  3LSJ A;  2NAZ A;  3C2B A;  4B43 A;  5FLM J;  4A6D A;  2XKP A;  1R23 A;  3GTQ J;  2LF7 A;  3R0J A;  4CCK A;  3NAU A;  1LVK A;  2HXO A;  1STZ A;  2HVS A;  2JSC A;  2ZB9 A;  2EA4 A;  2JA7 J;  1ZEL A;  3I4M J;  5L3C A;  3TL4 X;  2Y75 A;  4PJM A;  2EIJ H;  2XHK A;  3RKQ A;  2QKL B;  5B1B H;  3RYR A;  1VQO I;  3HXL A;  3FXL A;  1ZGJ A;  3H5R A;  3FDY A;  2QWW A;  4FT8 A;  5H6Q A;  1HSJ A;  1X19 A;  2O6G E;  3LMM A;  4P5O A;  2HGC A;  5F27 A;  4XQF A;  4RB2 C;  3F23 A;  4MO7 A;  1UHM A;  4HG2 A;  3GTG J;  4O3M A;  2P5V A;  2CFX A;  2R7F A;  3BR6 A;  1VF9 A;  2DA5 A;  2GOM A;  2M1B A;  5J1U A;  4WK8 F;  2CW7 A;  1KQ9 A;  4AIH A;  1D1A A;  2COM A;  1R5H A;  1FEX A;  3ZQF A;  3VYT B;  2FA5 A;  1Z0X A;  2L9N A;  2XDV A;  4G9Y A;  1OCR H;  2DMN A;  3OOP A;  5JI6 A;  3Q0W A;  4DBR A;  4UUS A;  3DCF A;  4L5J A;  3HOY J;  4UB6 C;  5ERI A;  2HPI A;  2LBF A;  3OYI A;  2Y69 H;  1UB9 A;  1GXQ A;  2OCE A;  4WCG A;  3ZMT A;  1ORK A;  1D8K A;  3KZZ A;  1WKM A;  3CZ6 A;  3E3V A;  4DGW B;  1XDU A;  4ON0 A;  3OOU A;  4BEH A;  3LSR A;  4RAY A;  1S6L A;  3I58 A;  3MN2 A;  2KJB A;  3BR5 A;  1NHA A;  1IN7 A;  4EJT A;  1UEL B;  3KX2 A;  3GFI A;  2Y30 A;  1XGM A;  3IV5 A;  4CYC B;  3PO3 J;  1YX3 A;  3RCO A;  2AHQ A;  5FLX Z;  1ZN2 A;  3RQI A;  3L2V A;  2VKE A;  4AVP A;  5CKT A;  4ABZ A;  2K9N A;  4BE0 A;  2FBK A;  2HU9 A;  3ABK H;  3ASO H;  4ITV A;  1XS9 A;  2EZK A;  4RM3 A;  1WWX A;  3KYL A;  1VQ5 I;  2P4W A;  4EEF G;  3HKZ A;  4G12 A;  1D8J A;  5DTD A;  1ZAO A;  1ZRD A;  1SMT A;  2ADU A;  2P7V B;  2Z33 A;  2HYG D;  3R4K A;  3ZN1 A;  2ZKZ A;  4EGY A;  2WB1 N;  5B5E C;  2R5Z A;  2QZ8 A;  2ZXJ A;  3DBL B;  5FKO A;  5K7H A;  1SD5 A;  2LLK A;  3I64 A;  2NNY A;  4AID A;  4HF0 A;  2W82 A;  4Q4Z F;  2E5N A;  3AKZ A;  4O6J A;  4YEJ A;  1OR7 A;  2Q2E B;  3IUO A;  5F6F A;  4XRS G;  4Y15 A;  4C30 A;  2DFF A;  3JAM Z;  3H92 A;  2VL8 A;  4F52 A;  1IUF A;  4BJT A;  3RYP A;  1W1W E;  3WTU C;  4B09 A;  4ENN A;  2Z1D A;  1F9N A;  2O7O A;  3L7W A;  2WWY A;  1JTY A;  2WAF A;  5DD4 A;  5TGT A;  4RDU A;  2EB7 A;  3R61 A;  2HTJ A;  2DDB A;  4S05 A;  2YS9 A;  4K2E A;  2PMZ A;  2Y48 A;  1MMA A;  4QTR A;  2ME6 A;  1TC3 C;  3JTG A;  1YRN B;  1S5L C;  3TMO A;  3VEP A;  1ITY A;  5K7Z A;  3IKV A;  3JRG A;  2H6C A;  3KP6 A;  1CF7 A;  2NS8 A;  5LLQ A;  4JP0 A;  1UST A;  5M5Y J;  2QM3 A;  3LST A;  2NVU B;  4LK0 F;  1B59 A;  4CYD A;  4BHB A;  1PUF A;  1AKH B;  3DPU A;  3LSG A;  3HTS B;  3G4S I;  3QP6 A;  2NOJ B;  3GFM A;  2FBH A;  1H0M A;  3VYR B;  2KRF A;  3CUQ A;  4E7K A;  1H89 C;  1XMX A;  2EA2 A;  2M4K A;  1Z7L A;  4PSW A;  5FD5 A;  1CGP A;  3CF2 A;  5J40 A;  2XB0 X;  2CUF A;  5C4X J;  2Z3Y A;  3RPQ A;  1B8I B;  4I76 A;  4KN4 X;  1BJZ A;  3AAF A;  1Y0N A;  1XCB A;  2Q1Z B;  2P6S A;  3F3X A;  4UNO A;  2VC1 A;  4XOT A;  1ODD A;  3GFL A;  2JT1 A;  2CUJ A;  2X4H A;  2FU4 A;  1T0F C;  4DIQ A;  2IW5 A;  5EYR A;  2JA8 J;  4RLQ A;  3O8G A;  4BS9 A;  5L3G A;  3REO A;  2HDD A;  1FBS A;  4X1E A;  3HL2 A;  3EYY A;  3TOA A;  2D1H A;  3K6G A;  1Z91 A;  2O0Y A;  2W1O A;  1VQ7 I;  1MBK A;  1TNT A;  5BS6 A;  1PYV A;  4YFX F;  1Y1W J;  1JUM A;  2QEN A;  5BOX A;  3N05 A;  4A5M A;  1MNM C;  1IN5 A;  1OIS A;  2XAQ A;  4CCO A;  3AFH A;  5ILV A;  1JT6 A;  2QQB A;  2NRA C;  2A69 F;  4UVC A;  1S7E A;  3FXR A;  3HKZ N;  4ZYH A;  4PFO A;  3WG9 A;  5LEK A;  3FKI J;  3J7Y J;  3KEQ A;  2NVT J;  2ZCW A;  2IBD A;  4DZP A;  3GTJ J;  1MND A;  2LDU A;  3SDG A;  2V4J C;  5FRN A;  1T38 A;  2A61 A;  3O2P E;  1JHH A;  2X1E A;  2W84 A;  1A04 A;  2WV1 A;  2PQ8 A;  2CGP A;  1YW9 A;  4IHS A;  2YPR A;  4L5I A;  3A01 B;  1Z6R A;  2XIG A;  1XSV A;  4P1W A;  3ECO A;  1FOW A;  4XRF A;  4EM1 A;  2MFZ A;  3CCV I;  1UHS A;  4M73 A;  1XGN A;  3SZG A;  1N77 A;  3LA3 A;  3P9I A;  4MGR A;  2EBI A;  2GIZ A;  2XAF A;  3QYE A;  4FE7 A;  2JN6 A;  1B9M A;  4PGH A;  1WPK A;  1IGN A;  2IEK A;  2VQH A;  4JOM A;  2QEX I;  1FNN A;  2DQR A;  3TO6 A;  1IN6 A;  1IJW C;  2MAB A;  1W5C C;  3R6S A;  3RI4 A;  4YFK F;  2LOO A;  3FXK A;  4BAC A;  4A3J J;  1TTY A;  2PMZ N;  2XKO A;  3OYD A;  1BR2 A;  1HKT A;  5B66 C;  4NQW B;  3BR2 A;  2CS3 A;  3M8F A;  1V55 H;  4BY1 J;  2XGE A;  4OWR B;  2K5C A;  1DP3 A;  3BJA A;  1BOB A;  2MD0 A;  4HW0 A;  1I39 A;  1NH3 A;  3GYH X;  1R9T J;  2LD5 A;  3BTJ A;  3BR3 A;  3DWL E;  1LB2 A;  1VND A;  1ENH A;  5F0C A;  4JQF A;  3OYH A;  5GAH J;  2H8W A;  4Z2Y A;  5GTI C;  4HBL A;  1K61 A;  3FMQ A;  3RPU A;  2A5Y B;  3KP3 A;  3CDI A;  3R0A A;  1P4A A;  1S7A A;  2PJR A;  1QQI A;  2YUS A;  2HZT A;  5BNG A;  1VQK I;  1E0E A;  1MIJ A;  2ESH A;  3E6M A;  4B47 A;  4A6E A;  3EUA A;  3DU6 A;  4PGG A;  5B3S H;  3HSR A;  3K4B A;  2RVC A;  2YX4 A;  4I98 B;  2FQ3 A;  1YI2 I;  1BC7 C;  2XSD C;  4IRH A;  4I0B A;  1MBH A;  2VKD A;  4ZZL A;  3IC7 A;  2VPL A;  2PLY A;  1FP2 A;  1YLF A;  2V9V A;  4XLH A;  3MMY B;  4YEL A;  1ETV A;  3J80 Z;  5A2Q Z;  4BE2 A;  5FD6 A;  1HLV A;  1T33 A;  2P8T A;  3PJR A;  1JUS A;  2XGD A;  3I59 B;  2F6C A;  3C3W A;  3E97 A;  1XMA A;  1BOA A;  2NVX J;  1GLN A;  3ERM A;  4GFB A;  3HG9 A;  4R1H A;  4LB5 A;  5F1R A;  1TLH B;  1P6R A;  1J9I A;  2VN2 A;  5J6X A;  1YYV A;  2YU3 A;  2E5Z A;  5IOY A;  5HOD A;  1S9H A;  3B73 A;  1KYW A;  2LVS A;  5CVV A;  3ZMU A;  2DTZ A;  1ZR4 A;  3J7A O;  4QSH A;  1G8X A;  3S3N A;  3H35 A;  1TW3 A;  1K4T A;  2ICW G;  3W6V A;  1Z9C A;  2OAZ A;  2ZSH B;  2HI3 A;  4UHT A;  1U5T C;  2KQR A;  2JA6 J;  1YRN A;  2VUM J;  5D5X B;  2QGU A;  1FBQ A;  4EVI A;  3WTS C;  5M5W J;  1SFU A;  2XF7 A;  3ZQC A;  2BBY A;  5HNH A;  2OU2 A;  5J8C A;  2ZME A;  3X2Q H;  2QVO A;  4FE4 A;  2FUG 2;  2H94 A;  3ASN H;  1LDK B;  2K9L A;  1H8A C;  3OYK A;  1AKH A;  1J2X A;  2O61 A;  2RQP A;  4BBS J;  5DS9 A;  2KRH A;  1VZ0 A;  1HDP A;  4XL9 A;  5GPC A;  3HGY A;  3PNT A;  4MFE A;  1JUP A;  1IXC A;  2MSY A;  2H27 A;  3M1C A;  1I50 J;  3BTL A;  4I09 A;  3GLX A;  4ZJZ A;  3I9V 2;  4U0W A;  5JVT A;  1DU6 A;  2O9L A;  1XB4 A;  2DT5 A;  2XAH A;  4HYE A;  4B1R A;  3K70 C;  3MZ8 A;  4P9F A;  3BPV A;  2ELJ A;  2H1K A;  4RGR A;  3VOE A;  4XLP F;  2JA5 J;  5FKN A;  2HYJ A;  2DLL A;  3BG3 A;  1OCP A;  1MBG A;  1JGS A;  2X1C A;  4CCJ A;  2EZI A;  3S1R J;  5GP9 A;  4M6Y A;  3DPT A;  3JRE A;  3GX4 X;  2NVY J;  3S93 A;  4BGD A;  4U87 A;  4MLO A;  4KIS A;  3RPU D;  1ZH5 A;  1IG7 A;  3B6C A;  2VAS A;  3CES A;  2Y9Z A;  4OIR F;  2K3P A;  3CLQ A;  5J3L A;  4G7Z F;  4UXN A;  1RUO A;  2LY1 A;  1SD7 A;  4U7D A;  5E20 A;  3ELK A;  3MKW B;  1OFC X;  2UZK A;  5EJC A;  1WJA A;  5KVR A;  3MFK A;  3D1N I;  3E7L A;  2QSF X;  3AG3 H;  5D6F A;  2DJN A;  1IDY A;  2XV4 S;  3ZRG A;  3I54 A;  4HLX A;  3JCU C;  1VQN I;  2CW0 F;  1ETW A;  1GVD A;  2Y0M A;  2GXA A;  2B0L A;  2CV0 A;  4D9J A;  2DYS H;  2L7Z A;  5HS9 A;  2J5O A;  1E3P A;  3HSF A;  3CP8 A;  1EA3 A;  2IA2 A;  2K86 A;  1K6O A;  3C2G A;  1SMY F;  2AQF A;  3ZN0 A;  1V5E A;  1A31 A;  5JLX A;  3BDD A;  4KIB A;  4CUG A;  3ABM H;  4D7N A;  3ZQI A;  3DXJ F;  3I4P A;  5H20 A;  1SVM A;  5E1Z B;  4DNC A;  4HNU A;  1BW6 A;  4XOR A;  4YII A;  3GZ5 A;  4YG2 F;  2VOP A;  3CCS I;  4UV9 A;  1IXS B;  2V1U A;  2HDW A;  2W25 A;  3HPG A;  1FY7 A;  3HUG B;  4EJV A;  4M9X A;  1VQM I;  4ZZD A;  3BQZ A;  2Z99 A;  2BY0 A;  2YR2 A;  4G94 A;  5LFA A;  1W0U A;  1YS6 A;  2XAS A;  5IYD J;  1WJE A;  2GWR A;  4RMN A;  1BM9 A;  1HF0 A;  1BI3 A;  6PAX A;  1QNT A;  2DFH A;  1LPQ A;  1Y6I A;  3KP7 A;  2ZNY A;  4NQW A;  4EAT A;  3BTC A;  4OAY A;  2LR8 A;  3A02 A;  2UXX A;  4KIF A;  4ZDP A;  1BR1 A;  2FRH A;  4A93 J;  2M8E A;  4EGZ A;  3PQJ A;  3SYT A;  1JTX A;  2VB6 A;  3F72 A;  1DPU A;  5GTH C;  5D4S A;  4IQ4 A;  4V2G A;  3OYC A;  4GRI A;  2KZV A;  4E7L A;  1JE8 A;  5E8G A;  2FBI A;  1WHU A;  2PMH A;  3FKJ A;  3SHF A;  4CZZ A;  1X58 A;  5GAE J;  1NTC A;  1O7L A;  2L54 A;  1MDM B;  1WZ2 A;  1N78 A;  1J5Y A;  2MA3 A;  4HNT A;  3S2D J;  5H6R A;  1YIT I;  3L09 A;  1DU0 A;  1ON1 A;  2EZH A;  2P81 A;  4ZYD A;  2LKX A;  5L3D A;  2F5V A;  4WXC A;  2DPD A;  2EFN A;  2A3S A;  2L3D A;  3JSO A;  4ENJ A;  4Q5S F;  1YIO A;  3HOU J;  1FX7 A;  2BW3 A;  2F48 A;  5DUI A;  2EFP A;  4CA0 A;  2DA3 A;  2M7B A;  1ZLJ A;  1ZRE A;  2MBF A;  3WTX C;  2QSG X;  3L2Q A;  3BLY A;  4B4C A;  1FOK A;  1HDD C;  4II3 A;  4RGS A;  4CO8 A;  4XOP A;  2HQR A;  1XTA A;  5CJ9 A;  1G3S A;  1SD6 A;  2XF6 A;  1XN7 A;  5F08 A;  3COA C;  2O8K A;  3WU2 C;  4I01 A;  2QSH X;  2GLO A;  2DK5 A;  3LA2 A;  4GXO A;  5JR3 A;  2Z5U A;  3S32 A;  2DPU A;  1EF4 A;  4IEJ A;  3SDB A;  4FX4 A;  1OYW A;  5D5U B;  3C1D A;  1BL0 A;  1IUY A;  5EF6 A;  1RPW A;  3CO6 C;  2E71 A;  2R0Q C;  5KAI C;  3OYN A;  4J19 A;  4KIT B;  3CTA A;  3KET A;  1VQ6 I;  3ECH A;  1KZH A;  2GBY A;  1K6Y A;  4N4N B;  5FRM A;  4RB1 A;  3ZMZ A;  2CV1 A;  1JI8 A;  2X0L A;  2QUF A;  5K7F A;  5LGN A;  3T8R A;  3IKT A;  1Y1V J;  4L9V A;  2OQR A;  3GLL A;  4PJJ A;  1RNL A;  3SQN A;  2LK2 A;  4AYB A;  3QOD A;  2X1D A;  3TP0 A;  3BZ6 A;  4IHV A;  1R5G A;  1OQY A;  2BHZ A;  4XK4 A;  2ECB A;  4ZYE A;  1REP C;  2LRD A;  3FHN A;  4ZTF A;  2ECC A;  3RJP A;  3GTP J;  4LG0 B;  1SVO A;  2MH2 A;  3TW7 A;  4B3X A;  3RKY A;  3Q0U A;  4LIV A;  3W6K B;  3LSM A;  5CVJ A;  4XLC A;  4I7H A;  3IH2 A;  1X3U A;  1SC7 A;  4BE1 A;  3L1P A;  3OYG A;  3CJQ B;  1RC9 A;  3GFJ A;  1S29 A;  2M34 A;  3BOQ A;  2YSR A;  3CJR B;  3OL4 A;  1WH5 A;  3GTO J;  1TQM A;  4MNU A;  3GEZ A;  4CHU A;  1UCR A;  3JW4 A;  5FLX K;  1C0W A;  1F5T A;  2CMP A;  3NAR A;  2W00 A;  5K5R A;  3A0H C;  3MEX A;  1P2F A;  4U7B A;  4EJU A;  5LD2 C;  3W3C A;  5D5W B;  1QHH D;  1WJB A;  4F92 B;  1QVU A;  1VQP I;  1SEU A;  2YU9 J;  1D3Y A;  2W85 A;  4ENM A;  4UUT A;  5AON A;  1R6R A;  3M1E A;  4M3G A;  1EKE A;  4LG3 A;  1UMQ A;  2DAO A;  3BJ6 A;  3BG9 A;  1WFX A;  1APL C;  3B6A A;  2IXS A;  3ZMS A;  3AL0 C;  2XF5 A;  1EV7 A;  3KYD B;  2M45 A;  3ABT A;  1Z1D A;  3Q0V A;  1KQ8 A;  1T2K A;  4HOB A;  4XSZ F;  1D5V A;  2D2W A;  2MG4 A;  4LIU A;  3V7C A;  3V8J A;  4IO9 F;  3IRQ A;  3CCY A;  3T0Y A;  1X4P A;  3BZC A;  4FTH A;  4NHJ A;  3JAM K;  2DOE A;  3EYI A;  3VYU B;  2F4I A;  4HSR A;  2CWE A;  1QVT A;  2DQL A;  5HLG A;  3S1Q J;  4QWQ A;  1Z05 A;  3H36 A;  3OSF A;  3HTU A;  1RIO H;  3QQA A;  2OTJ I;  4M3B A;  3CQZ J;  1IZ1 A;  2EWN A;  3CCQ I;  2Z2S B;  1NG6 A;  1BA5 A;  4F93 B;  2QQ9 A;  1T56 A;  2HOT A;  4XIC A;  2VT3 A;  4Y7N J;  2ZJQ F;  1FWZ A;  5DCM A;  1QZY A;  2BXZ A;  3WU0 A;  1WI3 A;  5GAD J;  1GVJ A;  4RM2 A;  2AXL A;  5FO5 A;  3FXM A;  5HLT A;  1R58 A;  3Q3S A;  5DUK A;  4KT6 A;  3TO7 A;  3WE3 A;  2EJR A;  2WA0 A;  1ETO A;  4MQV A;  3IWZ A;  3FHZ A;  3NWS A;  1MGT A;  4U0Y A;  2GA1 A;  2ZSI B;  3IRR A;  2M87 A;  1F43 A;  2M4G A;  3HHG A;  1WJC A;  4PDK A;  4PZJ A;  3EQL F;  4JYK A;  4A3F J;  1LFP A;  1XSX A;  5D6E A;  4R8H A;  3CMY A;  1L0O C;  2JMW A;  1U6G A;  2HNH A;  2K85 A;  4HDV A;  1ERD A;  3IWF A;  3ZGK A;  2FQ4 A;  2ZXI A;  1P92 A;  2TCT A;  1BC8 C;  2E2I J;  3CME I;  3LOC A;  1GDT A;  2OQG A;  4AU7 A;  3J81 Z;  3F21 A;  2B63 J;  3UNG C;  1ZAR A;  1LEA A;  4Y33 A;  3RTR A;  1LE8 A;  4XNF A;  2A5W A;  2JJ7 A;  1Z67 A;  4UVA A;  3JRA A;  4AD9 A;  2E19 A;  2JUG A;  4E4H A;  1MDM A;  5M3F J;  1R4N B;  1NG7 A;  3BR1 A;  3CCU I;  3DEE A;  2DO7 A;  3QRF F;  2DJI A;  4MFD A;  1G3Y A;  3U2R A;  1OLT A;  3S3M A;  5KCM A;  4L5E A;  4XN0 A;  3M4O J;  3KIO A;  1HW1 A;  2LF8 A;  3CUQ C;  3PSI A;  2ELK A;  1RR8 C;  4BNC A;  2K9M A;  4IHX A;  3K10 A;  3F22 A;  3CD6 I;  2F4M B;  3BY6 A;  3GO5 A;  3L2C A;  1HCR A;  1B9N A;  4ESB A;  2BY2 A;  2X51 A;  3CO7 C;  3OV8 A;  2OTL I;  4O5V A;  2TRT A;  1A5J A;  1I6X A;  1N75 A;  5F0H A;  3F8N A;  3LL7 A;  4XKC A;  3F9K A;  1J0R A;  2UXN A;  2IAI A;  2PX9 A;  2HPM A;  2NS7 A;  2KIF A;  1W36 D;  1HA8 A;  2A6H F;  1XGS A;  5HLH A;  5L3F A;  2TDX A;  1JXS A;  5D4R A;  2Y0S A;  3H1C A;  1X1A A;  4JX6 A;  3C7J A;  1P7J A;  3G3Z A;  3ISP A;  3WG7 H;  3F8M A;  5CQE A;  1TT5 B;  2CG4 A;  1FP1 D;  4A3I J;  3GTM J;  2LY2 A;  1X1P A;  4BBR J;  2QBY B;  1Y8R B;  1MW7 A;  1UFM A;  2CW8 A;  2V79 A;  5J4V A;  5HDN A;  5FJ8 J;  1JGG A;  4HF1 A;  2IGM A;  3HGG A;  1Z6T A;  1MH3 A;  3HZJ A;  4DYQ A;  3DKY A;  3PIO F;  4X6A J;  1ETK A;  2DFI A;  4M72 A;  5FRO A;  1I3A A;  4I99 C;  3FIW A;  3KEY A;  2LRE A;  4M3E A;  3VPR A;  5EZG A;  4LG0 A;  4XRS A;  2HTS A;  5LRR A;  1D1B A;  3JTH A;  4NDL A;  2JA2 A;  2CQN A;  4ZDL A;  4LLL A;  4QPQ A;  5E1X A;  2KMU A;  2OV7 A;  2F5E A;  5FGM A;  3H5N A;  3K1M A;  2LH9 A;  1O57 A;  1T6S A;  1U0J A;  4ZYG A;  5JHF A;  4M74 A;  1U8B A;  5EGO A;  1YO5 C;  4ENK A;  5HOO A;  3TDZ C;  3ZXS A;  4EV0 A;  2KL4 A;  1IV8 A;  3K4N A;  3DEW A;  2STT A;  1A6Q A;  3O8H A;  3BZK A;  5D8L B;  2IS4 A;  3W2A A;  1Y56 A;  3JRI A;  3FK7 A;  3V7R A;  5BQT A;  3HB9 A;  1U5T B;  1AU7 A;  2LSO A;  5BPD A;  4GCV A;  3OS2 A;  1PJR A;  5LBQ A;  4G7H F;  1OCT C;  4RB3 C;  1K4S A;  3QOE A;  3MKY B;  4A3M J;  4ZTJ A;  1UG0 A;  3RKX A;  4E7S A;  3QAH A;  5IT9 Z;  4A2U A;  2EIM H;  3VFZ A;  4HAM A;  1LFU P;  3F0C A;  2WY7 Q;  2X6X A;  1DQU A;  4L9J A;  3BT9 A;  2X6O A;  1QPM A;  4PJ0 C;  2FE3 A;  2VE9 A;  2P7C B;  1VFC A;  3M9A A;  4CCM A;  1U8R A;  3OWT A;  3VOD A;  3J80 K;  2RN7 A;  5A2Q K;  2BVM A;  4IKF A;  3S15 J;  5E3N A;  4W1U A;  3MZY A;  1FMW A;  1HW5 A;  1POG A;  3PL8 A;  2JK3 A;  4PSX A;  3OYE A;  2NXN B;  2O03 A;  3ONQ A;  1TBX A;  2DCE A;  4DYC A;  4P96 A;  3K7A J;  3QPL A;  2IGO A;  2OJE D;  3SFI A;  3K69 A;  4IPA A;  2WAQ A;  4FX0 A;  4WWC A;  3LQQ A;  2P5K A;  1PP7 U;  2WC2 A;  3HRU A;  3FX3 A;  1X2M A;  2GA2 A;  2RV8 A;  5CQG A;  5ICF A;  1YJW I;  2IS1 A;  4FIS A;  3OYJ A;  2F4O B;  2ZJ2 A;  1ETY A;  2HS5 A;  2CUZ A;  5HS8 A;  1EJ9 A;  1SAN A;  4G8X A;  2V6C A;  3HOT A;  1S3J A;  1KGS A;  1P7I A;  4LK1 F;  1J59 A;  2Y0S N;  3ZPL A;  3SEZ A;  3L2U A;  3VYS B;  4CYC A;  2LNB A;  2EIL H;  4XLN F;  1OYI A;  2O8X A;  1JKP C;  3OMY A;  4N9I A;  4BKX A;  2HYF A;  2E1M C;  3GUD A;  2W48 A;  1AHD P;  3FM5 A;  3DV8 A;  1KA8 A;  1VI0 A;  4E6K G;  1V54 H;  3GVA A;  4BQN A;  1MSE C;  2EH3 A;  3JRF A;  5EZH A;  2FJ1 A;  2FSW A;  4BQO A;  1EH8 A;  2PJP A;  4II2 A;  4OIN F;  3RSN A;  1PUE E;  3K2A A;  1SAU A;  5E18 F;  5HDK A;  1ZGA A;  5EEA A;  2HVR A;  1BIB A;  1XGO A;  1M1E B;  2ZME C;  4M6V A;  4A5N A;  2Q2E A;  3PUB A;  4IRG A;  3TOB A;  4A69 C;  1OCC H;  4JX5 A;  4JK1 X;  5LRS A;  3BPX A;  4HV5 A;  4CZC A;  3CCM I;  3L2R A;  3SZT A;  1JJ6 C;  2K27 A;  4MQ9 F;  1OKR A;  1UG2 A;  2DT7 B;  2F2E A;  3N97 A;  4XID A;  2PI0 A;  1RR7 A;  3D5L A;  1T95 A;  2LFB A;  4OU0 A;  1B72 B;  1VQ9 I;  2KFD A;  1ZK8 A;  3VDX A;  3UKG A;  1ONV A;  4BAY A;  2HFH A;  4LJZ F;  3KE2 A;  4HQE A;  5LHH A;  2Y2Z A;  4HRI A;  3IAM 2;  5E79 C;  1V3F A;  1FYL A;  4XM3 A;  2DN0 A;  5J1R A;  1OMI A;  3GF2 A;  2V1D A;  3PSF A;  2ME0 A;  2JVG A;  1XG1 A;  3IAS 2;  1SFX A;  1D1C A;  4FAS D;  4FCY A;  1LQ1 A;  1EH6 A;  1B1B A;  2DA6 A;  1MJ9 A;  3HPH A;  5CLS A;  3HOX J;  3ML6 A;  5IP7 J;  3O3K A;  3E5X A;  4NBQ A;  2K4J A;  3HRT A;  3F6O A;  3S3O A;  3CDL A;  3R60 A;  1P4W A;  3T1B A;  3W6J B;  2L01 A;  1FPQ A;  2CYY A;  2K9S A;  1W0T A;  2EPF A;  2QBY A;  3PIP F;  5IY5 H;  1JKO C;  2AQE A;  2NOG A;  1B8I A;  2ZJR F;  5KAF C;  1XSD A;  2DK8 A;  2OZU A;  1HQC A;  2IRF G;  1HST A;  1W7P B;  2WAQ N;  2IJL A;  3CJT B;  3G1M A;  2HKX A;  3EUK L;  4CSW A;  3MD2 A;  4WXH A;  2W24 A;  2M0M A;  1O3Q A;  4KMU X;  1HBX G;  2H6B A;  1MH4 A;  2RKH A;  4NUB A;  1R49 A;  5AIQ A;  1XDS A;  4RB0 A;  1ZRF A;  3ZQ7 A;  2EFW A;  1X1B A;  1ZR2 A;  1WQ2 A;  3GXO A;  3WGG A;  1H88 C;  3IH3 A;  4IRI A;  4BHC A;  4ESF A;  3CLO A;  2IP2 A;  1MMD A;  2NNN A;  3HDD A;  2G0E A;  3JRD A;  2CV2 A;  3QU3 A;  3A1Y A;  1JHF A;  3DBR B;  1OYY A;  5ED4 A;  2G7U A;  3BCB A;  5IYC J;  3L2W A;  1E3H A;  2ZC2 A;  1O7F A;  3S2W A;  1KYZ A;  4EM0 B;  2JRT A;  1XMK A;  2EV0 A;  3B02 A;  5J4Y A;  5E1W A;  3QYB A;  1IW7 F;  5DD8 A;  4A3K J;  3DKW A;  4M3D A;  3OSG A;  3F8C A;  4KYW A;  1QPI A;  5J8F A;  3U21 A;  1HC8 A;  3A01 A;  1IAW A;  2MW8 A;  3G6E I;  2R7R A;  5KK1 A;  1K83 J;  3IH4 A;  2HZD A;  1A36 A;  4IX7 A;  2X6W A;  1GUU A;  3DP7 A;  2A6E F;  1KQ0 A;  5F1J A;  4KMF A;  4D5C A;  2L7M P;  2VJJ A;  2VKH A;  2R93 J;  3GZ6 A;  5ILU A;  4S04 A;  1IRX A;  1QZZ A;  3ZP5 A;  5HDG A;  1JKR C;  4BYY A;  5KNL A;  3OL3 A;  2FNP A;  2HOS A;  2LBF B;  1O3T A; 
#chains in the Genus database with same CATH homology
 1UMQ A;  1X2N A;  2HXI A;  3BG9 A;  1APL C;  3B6A A;  1H89 C;  4C3J J;  5E3M A;  2XB0 X;  2CUF A;  5C4X J;  2M0C A;  2XGC A;  3Q0V A;  3JRB A;  1JT0 A;  1B8I B;  2K9Q A;  4I76 A;  1GT0 C;  1BJZ A;  2EQR A;  2MG4 A;  5J1Y A;  3CCY A;  1A6I A;  4FTH A;  2L0K A;  3ZQH A;  5F04 A;  1QVT A;  1MBE A;  3S1Q J;  2DA7 A;  5EYR A;  3LNQ A;  2JA8 J;  3OSF A;  3HOV J;  3O8G A;  3QQA A;  3BG5 A;  4M3B A;  4C3I J;  2HDD A;  4A3B J;  3CQZ J;  4X1E A;  5FKL A;  4M3F A;  2L9R A;  1BA5 A;  2H8R A;  2R5Z B;  1MBK A;  1T56 A;  2HOT A;  4XIC A;  2OF7 A;  1Y1W J;  2VKV A;  4Y7N J;  1JUM A;  3JRH A;  1WI3 A;  3S14 J;  1MNM C;  2DMU A;  2COB A;  2ID6 A;  3Q3S A;  1GV5 A;  1JT6 A;  1O4X A;  3I4N J;  2QCO A;  1S7E A;  2LTP A;  1ETO A;  3BTI A;  3HKZ N;  4LOC A;  3FKI J;  1TWF J;  2NVT J;  2IBD A;  1TWC J;  4DZP A;  3GTJ J;  1F43 A;  1OJL A;  2MGQ A;  3SDG A;  3TW6 A;  4JYK A;  4HNV A;  4A3F J;  3S1M J;  4JX4 A;  2XPV A;  3CMY A;  2EZL A;  2JMW A;  2WV1 A;  2E2H J;  4A3C J;  5EG0 A;  2FQ4 A;  2TCT A;  4IHW A;  3A01 B;  2E2I J;  3LOC A;  1GDT A;  2ID3 A;  2B63 J;  1UHS A;  3PM1 A;  2K40 A;  5FKM A;  5IYB J;  1LE8 A;  5JLW A;  2EBI A;  4FE7 A;  2JN6 A;  1IC8 A;  2JJ7 A;  2DMP A;  5EDN A;  2VPR A;  3JRA A;  1WPK A;  2E19 A;  2X9D A;  3WHC A;  2RAE A;  1FJL A;  2IEK A;  1IGN A;  5M3F J;  3BR1 A;  5IOZ A;  1WH7 A;  1XC5 A;  1IJW C;  4MFD A;  2OPT A;  2D5V A;  1PUF B;  1TWG J;  4L5E A;  4A3J J;  3M4O J;  2PMZ N;  2DA4 A;  4A3G J;  2ELK A;  4IHX A;  3BR2 A;  4BY1 J;  2XGE A;  2CJJ A;  4BXX J;  2X48 A;  1QRY A;  2DA2 A;  4B3A A;  1HCR A;  4DW6 A;  1R9T J;  2LD5 A;  3BTJ A;  3BR3 A;  1VND A;  1ENH A;  5F0C A;  2TRT A;  3ZQG A;  1A5J A;  1K61 A;  5F0H A;  3WHB A;  1TWH J;  3GBG A;  1F36 A;  2Y31 A;  2IAI A;  3HOZ J;  2YUS A;  5BNG A;  2NS7 A;  3JR9 A;  4S0H B;  2M8G X;  5C4J J;  4UUS B;  2CQX A;  2LY9 A;  1CQT A;  4JX6 A;  1P7J A;  1TWA J;  1E3O C;  5FKK A;  1MSF C;  2JWT A;  2XSD C;  3SJM A;  4A3I J;  3GTM J;  1MBH A;  4BBR J;  5IPA A;  3GTK J;  4W97 A;  4C3H J;  1I6H J;  5FJ8 J;  1JGG A;  3HGG A;  1ETV A;  3RZD J;  2R7Z J;  1MH3 A;  4DYQ A;  3S1N J;  1HLV A;  1ETK A;  1T33 A;  2M9H A;  2E2J J;  1JUS A;  2XGD A;  3FIW A;  4M3E A;  2NVX J;  4GFB A;  4AC0 A;  3VPR A;  5EZG A;  4XRS A;  1G2H A;  1SFO J;  4NDL A;  1GV2 A;  5IOY A;  5HOD A;  3JRC A;  2LVS A;  1ZR4 A;  2DTZ A;  5E3O A;  1U9O A;  4Y52 J;  2KDZ A;  4QSH A;  1U8B A;  5EGO A;  3ZOB A;  5E3L A;  1LE8 B;  3DEW A;  1D5Y A;  3W6V A;  3O8H A;  2LP0 A;  3TP3 A;  2HI3 A;  3JRI A;  3FK7 A;  2JA6 J;  3HB9 A;  3BQY A;  1AU7 A;  2CUE A;  1YRN A;  2VUM J;  2CU7 A;  3QPS A;  2R5Y A;  4D7M A;  5M5W J;  3ZQC A;  1OCT C;  3MVP A;  4FE4 A;  4A3M J;  2DMQ A;  2KT0 A;  1Z77 A;  1H8A C;  1AKH A;  1LFU P;  3F0C A;  4BBS J;  3BT9 A;  2X6O A;  5DS9 A;  4DZJ A;  1ETX A;  1HDP A;  1VFC A;  5GPC A;  1MBJ A;  3HGY A;  4MFE A;  2FD5 A;  1JKQ C;  1JUP A;  2DA1 A;  2MSY A;  4AYB N;  1I50 J;  3BTL A;  1LFB A;  1B72 A;  1DU6 A;  1I3Q J;  1ZKG A;  2FX0 A;  3S15 J;  5E3N A;  4W1U A;  9ANT A;  3HOW J;  2O9L A;  1IRZ A;  3S16 J;  1IDZ A;  4B1R A;  2CRG A;  1POG A;  4DYR A;  2JK3 A;  2H1K A;  2JA5 J;  5FKN A;  2HYJ A;  2HQ5 A;  3BG3 A;  4DYC A;  1OCP A;  3K7A J;  3QPL A;  3HBL A;  1MBG A;  4MIM A;  1RKW A;  2EZI A;  3GTL J;  4A3E J;  3S1R J;  2R92 J;  5GP9 A;  3SFI A;  3JRE A;  5F0F A;  2NVY J;  4MLO A;  1RES A;  2NVQ J;  3HEF A;  4A3L J;  1IG7 A;  1ZTR A;  3B6C A;  1X2M A;  2Y9Z A;  4X6A J;  3A03 A;  4FIS A;  2L7F P;  5J3L A;  1ETY A;  4AUX A;  1SAN A;  5M3M J;  3PO2 J;  3FIS A;  1OFC X;  1P7I A;  3D1N I;  3E7L A;  2Y0S N;  2DJN A;  2E1O A;  1IDY A;  4CYC A;  4QIW N;  5FLV A;  1BW5 A;  1ETW A;  1GVD A;  1JKP C;  1ETQ A;  4BKX A;  4I6Z A;  1FIA A;  3G1L A;  2L7Z A;  2W48 A;  2I10 A;  5C44 J;  1AHD P;  4D5F A;  1NK2 P;  5EGO B;  1VI0 A;  3LSJ A;  1MSE C;  5JLX A;  2EH3 A;  3JRF A;  5EZH A;  2FJ1 A;  3C2B A;  4D7N A;  3ZQI A;  5FLM J;  3GTQ J;  5GPA A;  1BW6 A;  3K2A A;  3NAU A;  2HXO A;  5EEA A;  2ZB9 A;  1FTZ A;  4M6V A;  2GM4 A;  2JA7 J;  3G1O A;  3BQZ A;  3I4M J;  2CQQ A;  1MBF A;  1WCM J;  2XPW A;  4A69 C;  1W0U A;  5IYD J;  3RKQ A;  4JX5 A;  5C3E J;  1JJ8 C;  1JJ6 C;  1HF0 A;  1UG2 A;  4XID A;  1RR7 A;  5EG0 B;  3BTC A;  2LR8 A;  3A02 A;  4XRM A;  2LFB A;  4A93 J;  2QF7 A;  1JTX A;  5F27 A;  1B72 B;  1ZK8 A;  4V2F A;  3UKG A;  4V2G A;  4MO7 A;  3GTG J;  2Y2Z A;  1X58 A;  3BR0 A;  3BR6 A;  4BY7 J;  1VF9 A;  1NTC A;  2DA5 A;  2DN0 A;  5J1U A;  5J1R A;  1FEX A;  3ZQF A;  2ME0 A;  3S2D J;  1Z0X A;  1XG1 A;  2DMT A;  2EZH A;  2P81 A;  2Y9Y A;  2LKX A;  3TED A;  1DU0 A;  4FCY A;  2DMN A;  3Q0W A;  3M3Y J;  1ZQ3 P;  4UUS A;  3DCF A;  2DA6 A;  3HOX J;  1NK3 P;  3HOY J;  3HOU J;  5IP7 J;  2DA3 A;  1ORK A;  3CDL A;  3S17 J;  3OOU A;  3LSR A;  2K9S A;  4B4C A;  1W0T A;  3S2H J;  1HDD C;  2HOA A;  1FTT A;  1JKO C;  2NOG A;  3MKL A;  3MN2 A;  1B8I A;  3BR5 A;  1IV6 A;  5F08 A;  2Y30 A;  5IP9 J;  2O8K A;  2WAQ N;  4CYC B;  3IV5 A;  3PO3 J;  2AHQ A;  3RQI A;  3G1M A;  2VKE A;  2GLO A;  2XPU A;  2XRL A;  4ABZ A;  2K9N A;  1EF4 A;  4IEJ A;  3HM5 A;  1XS9 A;  2EZK A;  1MH4 A;  1BL0 A;  5EF6 A;  1RPW A;  2XB5 A;  4EEF G;  2R0Q C;  4J19 A;  4G12 A;  1RET A;  5DTD A;  3H0G J;  2GBY A;  5IP6 A;  1ZR2 A;  1WGX A;  2WB1 N;  2R5Z A;  1H88 C;  3OIO A;  3IH3 A;  3ZQL A;  5FKO A;  5K7H A;  5K7F A;  2LLK A;  5M5X J;  1Y1V J;  3HDD A;  1U78 A;  2G0E A;  3JRD A;  2AO9 A;  2LK2 A;  1ZGW A;  4IHV A;  3TP0 A;  4XK4 A;  2ECB A;  4C2M J;  4XRS G;  1HOM A;  5IYC J;  2ECC A;  4IHY A;  3GTP J;  1IUF A;  3TW7 A;  1U9N A;  3Q0U A;  1FIP A;  3IH2 A;  2O7O A;  4A3K J;  3L1P A;  4M3D A;  3OSG A;  1RKT A;  1QPI A;  1JTY A;  4RDU A;  3A01 A;  2M34 A;  2MW8 A;  2YS9 A;  1WH5 A;  3GTO J;  1K83 J;  2N8G A;  3IH4 A;  2VI6 A;  4QTR A;  2ME6 A;  1TC3 C;  3RZO J;  1YRN B;  3FK6 A;  3NAR A;  1GUU A;  1ITY A;  5F1J A;  2R5Y B;  5K7Z A;  4A3D J;  1Q1V A;  2L7M P;  4D5C A;  3JRG A;  2NS8 A;  2M2E A;  4RBO A;  4JP0 A;  2R93 J;  5M5Y J;  3H3V K;  1QVU A;  1JKR C;  3LSP A;  2YU9 J;  1PUF A;  2HOS A;  4UUT A;  1AKH B;  4M3G A;  3LSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...