1BW5A

The nmr solution structure of the homeodomain of the rat insulin gene enhancer protein isl-1, 50 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INSULIN GENE ENHANCER PROTEIN ISL-1
publication title The solution structure of the homeodomain of the rat insulin-gene enhancer protein isl-1. Comparison with other homeodomains.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1bw5A00
2DA5A 3LSJA 1TWHJ 1JKPC 1T56A 2R93J 3BG5A 1MBEA 2L7FP 3A01A 3OIOA 4BY7J 3GTLJ 1I6HJ 2XRLA 2NVYJ 1ENHA 2JK3A 3CQZJ 5EG0A 1K83J 5EGOA 4V2GA 1H8AC 3MN2A 3HGGA 1A5JA 4X1EA 3BR6A 4M6VA 1LFBA 3TW6A 1WI3A 1RESA 1B72A 2JA7J 3E7LA 3OSGA 1F36A 2R92J 1TWGJ 2G0EA 4A3IJ 1DU0A 1K61A 2X6OA 3DCFA 1XC5A 4MIMA 5F04A 2Y9ZA 1APLC 1FIPA 2NS7A 2CJJA 4D5FA 5M5WJ 1MSEC 1HDDC 1WGXA 1NTCA 3S1RJ 3GTQJ 2O7OA 2JWTA 3JRAA 4M3GA 2LKXA 1I50J 2EZHA 4EEFG 2DMTA 1UHSA 3B6AA 2AHQA 1W0TA 2M2EA 1IGNA 5FKLA 2KDZA 3M4OJ 1ZTRA 2M34A 3A02A 4S0HB 1HF0A 3FIWA 2EZLA 1B8IB 2H8RA 2JJ7A 2CU7A 3SDGA 3WHCA 3LNQA 2OPTA 2M9HA 3ZOBA 4RBOA 1H89C 4I6ZA 2HOAA 3ZQGA 5IP6A 5M3FJ 2E2JJ 2ELKA 1IG7A 4BBSJ 2QF7A 3BR5A 1NK3P 4BY1J 3S1NJ 2DA1A 5IPAA 1P7IA 1U8BA 2R5ZB 3MKLA 3BR3A 4BKXA 4D7NA 1AKHB 4B3AA 3PM1A 2Y9YA 3HDDA 1TC3C 4MFEA 1DU6A 3JRGA 4GFBA 3S15J 3LOCA 3LSPA 3TEDA 5M5XJ 1F43A 2WAQN 5EF6A 1JKRC 2O9LA 2LD5A 4JX6A 2AO9A 1MBJA 1IRZA 3O8GA 3GTPJ 1LFUP 3HB9A 4UUTA 4XRSA 1VI0A 4A3LJ 4HNVA 3HOXJ 4DYQA 5FJ8J 1IC8A 2NVTJ 3GTKJ 3MVPA 2HXOA 1ETKA 2K40A 5IOYA 5FLVA 4BXXJ 2EZIA 2VI6A 3CDLA 3I4NJ 1MSFC 2MG4A 1CQTA 1MBKA 3FK7A 2K9QA 3B6CA 5F0CA 1ZR2A 2WV1A 4IHYA 4FE4A 1GVDA 2HI3A 3ZQLA 2GBYA 1JKQC 4LOCA 5FLMJ 1QRYA 1X58A 2CQQA 1U9OA 2GM4A 1U9NA 4DW6A 1BJZA 2DN0A 5E3NA 1JUSA 4V2FA 1GDTA 2IBDA 2NOGA 2TRTA 1FEXA 1MH3A 1H88C 3GTJJ 3HOYJ 5GPAA 2CRGA 3ZQHA 3HKZN 4M3DA 3BR2A 4XK4A 2Y31A 1RPWA 5J3LA 3RZDJ 1IUFA 3HGYA 4QIWN 2IAIA 2L7ZA 2O8KA 1T33A 2HXIA 4JX4A 2DJNA 1AKHA 2PMZN 1IV6A 1PUFA 4A3MJ 4DZPA 1GT0C 3NARA 1BL0A 4MFDA 1LE8B 3HOVJ 1FIAA 5K7ZA 5EZGA 3BG9A 4IHVA 2MSYA 4D5CA 2XGEA 1GV2A 2CQXA 1WCMJ 2CUFA 1YRNB 2E19A 5C4XJ 3BR0A 1JUPA 2K9NA 4Y7NJ 3RKQA 5J1YA 4A3JJ 2NS8A 1JKOC 5EYRA 2HYJA 4UUSB 4RDUA 1AU7A 2Y0SN 1MNMC 2TCTA 4XICA 1ETOA 3SFIA 1UMQA 1ZQ3P 2R5YA 1RR7A 3FKIJ 1AHDP 1IJWC 2HOSA 2ECBA 2EQRA 5J1UA 2K9SA 1R9TJ 2FQ4A 4JP0A 3JRHA 1TWCJ 4NDLA 4DYRA 1TWAJ 1WH5A 4A3DJ 2KT0A 4B1RA 5M3MJ 4X6AJ 2EH3A 1JTXA 5FKKA 4C2MJ 3QPLA 2H1KA 4AYBN 1SANA 3ZQIA 4XIDA 4B4CA 2VUMJ 3BTJA 4DYCA 5K7FA 1OCTC 1ORKA 5F1JA 4C3HJ 2LK2A 1ETVA 3HOUJ 3W6VA 3G1MA 5F08A 1JUMA 2JA8J 2DTZA 3RZOJ 1ETYA 1ZKGA 1X2NA 3S17J 2LTPA 1ETXA 2HDDA 1ZK8A 2JA6J 1HDPA 3TP3A 1JJ6C 2GLOA 3BTIA 5IOZA 4MLOA 1ETWA 2VKEA 3Q0VA 3TP0A 2HQ5A 4DZJA 2LP0A 3G1OA 4G12A 2ME0A 1FJLA 3UKGA 3IH3A 3IV5A 2RAEA 4CYCB 2ID3A 1W0UA 2W48A 1VF9A 5DTDA 3A01B 1JGGA 3O8HA 2QCOA 5EG0B 1OJLA 1GV5A 3JRIA 5EGOB 4L5EA 2XPWA 1BW6A 3D1NI 3HOZJ 9ANTA 2XB5A 2DA2A 3HBLA 1Z0XA 2NVXJ 1IDZA 2YU9J 1B72B 1I3QJ 1B8IA 4IHWA 2DA7A 3H0GJ 2LR8A 3CCYA 4QSHA 5J1RA 1HOMA 2FX0A 5E3LA 1X2MA 1P7JA 2ME6A 1A6IA 3S1MJ 5HODA 4A3BJ 2VKVA 3QPSA 2L9RA 5IP9J 1GUUA 1MBHA 2R5ZA 1MH4A 2R0QC 2Y30A 3NAUA 5FKOA 3VPRA 4A69C 2LLKA 3K7AJ 5JLWA 5F0FA 4W97A 5IYDJ 3M3YJ 5E3MA 1XS9A 2CUEA 4IHXA 3IH2A 3BTLA 4ABZA 2X9DA 3GTGJ 1VNDA 2E1OA 1E3OC 3S16J 2XGCA 1G2HA 4Y52J 3S1QJ 5EDNA 1Y1WJ 1ITYA 1BW5A 5BNGA 2X48A 1JT6A 5IYBJ 2E2IJ 3JRFA 3ZQCA 2JA5J 5IP7J 2XPUA 3Q0UA 3JR9A 3OSFA 2ZB9A 2B63J 2COBA 4IEJA 1UG2A 3HOWJ 2Y2ZA 2M8GX 4QTRA 3ZQFA 3Q0WA 2FD5A 3LSGA 3BG3A 1VFCA 4C3IJ 4W1UA 2IEKA 1FTZA 1Z77A 2FJ1A 3DEWA 2DMQA 1JJ8C 1IDYA 5GP9A 2L0KA 3G1LA 3BQZA 3RQIA 1HCRA 2HOTA 1TWFJ 2XB0X 1U78A 2ECCA 5C3EJ 2XSDC 2YS9A 4A3FJ 5DS9A 4BBRJ 1OCPA 2ID6A 1LE8A 4XRSG 2YUSA 3BTCA 2DMNA 4AUXA 4A3KJ 1XG1A 1HLVA 1OFCX 3PO2J 4A3GJ 3C2BA 4I76A 5EEAA 1YRNA 3L1PA 4FE7A 4JX5A 3BQYA 2I10A 5F27A 3I4MJ 3PO3J 3S2HJ 3JREA 2EZKA 1MBFA 5EZHA 3A03A 2DA6A 1PUFB 4UUSA 1MBGA 3K2AA 5M5YJ 4AC0A 2P81A 1WPKA 2VPRA 3TW7A 3CMYA 1POGA 5GPCA 1D5YA 2DA4A 3GBGA 4M3FA 3JRDA 1ZR4A 2LY9A 4C3JJ 3WHBA 1QVUA 2WB1N 2DA3A 5IYCJ 2LFBA 5C4JJ 3BR1A 3HEFA 3GTOJ 3QQAA 4JYKA 2N8GA 4A3CJ 3BT9A 1Q1VA 1QVTA 1S7EA 1QPIA 2JMWA 2EBIA 4M3BA 4FCYA 1NK2P 5F0HA 3JRCA 4FTHA 2DMUA 4MO7A 2R5YB 3Q3SA 1BA5A 1RETA 2R7ZJ 3GTMJ 3JRBA 2MGQA 2XGDA 1WH7A 1JTYA 3H3VK 2OF7A 4D7MA 4XRMA 5FKNA 1FTTA 3S14J 1O4XA 2L7MP 1ETQA 2M0CA 1ZGWA 3FISA 2XPVA 2NVQJ 1Y1VJ 4J19A 3LSRA 1RKWA 3IH4A 3OOUA 5C44J 5JLXA 3F0CA 2DMPA 2JN6A 2MW8A 4A3EJ 3FK6A 3S2DJ 2LVSA 4M3EA 5FKMA 1RKTA 1SFOJ 1JT0A 2D5VA 1EF4A 3SJMA 5E3OA 4FISA 2E2HJ 4A93J 5K7HA 3HM5A 4CYCA
chains in the Genus database with same CATH superfamily
2HOEA 1SAUA 3OR1C 1IV8A 3BG5A 3A01A 1I6HJ 1IN6A 3QODA 3U21A 4ITVA 3CUQA 5LFAA 2DK8A 2DFIA 4F92B 1K83J 2F4MB 3RPQA 4ZYEA 3K70C 3JSOA 4CCJA 5CYVA 1H8AC 1I1SA 3BR6A 4HW0A 3VFZA 3RTRA 1MMGA 4XNFA 1B9MA 1ZG3A 2BHZA 3K4LA 1B72A 2JA7J 3E7LA 4I01A 1GVJA 1KZHA 3WTVC 2MD0A 2RNJA 1DU0A 5IT3A 1ZH5A 2HDCA 2HYFA 3A4CA 2XUBA 4G9YA 5F04A 1APLC 1D0ZA 1U0JA 2CJJA 1HDDC 3OYIA 1VTNC 1WGXA 5H6QA 1NTCA 5TGTA 2LKXA 3OS2A 1YOVB 2DMTA 3TBIA 4N9IA 3B6AA 4PUSA 1W0TA 2ETHA 3KP2A 2KDZA 2M34A 5AONA 1B8IB 1T6SA 1JGSA 2H8RA 1E17A 4IXAA 2CU7A 3V8KA 3WHCA 2M5WA 2OPTA 3H92A 2L9VA 5TJJA 1Q1HA 4UV9A 2EFPA 1H89C 2Y0SA 3ZQGA 3HL2A 2QF7A 4YIFA 1MJAA 2H27A 2RQQA 2R5ZB 1MJBA 3BR3A 1IW7F 1U6GA 2QQ8A 3L2RA 2PJPA 2CQKA 3TO9A 3RIRA 3PM1A 1U2WA 1MIJA 1DU6A 2IGMA 4EJOA 1Z7LA 2OCCH 4XLPF 2FSWA 2RV8A 3DWLE 1P6RA 1STZA 1IN5A 3LSPA 3TEDA 5M5XJ 1F43A 5EF6A 2EFNA 2LKSA 3J7YJ 1TP4A 2LD5A 1MBJA 4M9XA 2A05A 1X1DA 2E1MC 3O8GA 1LFUP 3J7AY 4UUTA 4EJTA 4XRSA 1VI0A 2LF8A 5D6FA 2W24A 4U0WA 2FRHA 2KRHA 4PJ0C 4M71A 4BAYA 2RN7A 3TDZC 2PI0A 2R7VA 2KPMA 1CQTA 3FK7A 3B6CA 1BR4A 3MKWB 3PL8A 3ASNH 2QUFA 3DV8A 4FE4A 1S9HA 3V7CA 3FHNA 1XB4A 2Z3YA 3ZQLA 5GTHC 1TL8A 1JKQC 4LOCA 3F23A 2O5RA 1YO5C 3RCOA 1N78A 4ZDOA 1MGTA 1BC8C 1U9OA 2GM4A 5HLTA 3EUAA 2IS4A 2DXIA 2XROA 2BVMA 1YTYA 1XD7A 2KHMA 1FEXA 3E5XA 3IC7A 4HEA2 4G94A 2OZUA 3U9GA 4M3DA 2X6YA 1Y39A 2L7KA 3H35A 4BH9A 4MEXF 2HXIA 4JX4A 1AKHA 5HOOA 2PMZN 1IV6A 1TNTA 2QQAA 3MD2A 1BL0A 1UCRA 4IRGA 4XORA 1LE8B 5GAGJ 3A1YA 4O5VA 3S32A 2J5OA 1YFHA 3BG9A 3DKXA 2JUCA 1HKSA 1NHAA 4C9YA 3SZTA 5K5OA 1GV2A 2CUFA 3WU2C 1HKQA 1VQOI 2YPRA 3IKTA 3SFZA 2MBFA 2DW4A 4H4KC 4Y7NJ 1O7LA 5J1YA 4P5OA 3F72A 5L3EA 3M8FA 1TQMA 2GIVA 2K9MA 2PFBA 2HYJA 5HDKA 3OYHA 5HS8A 1WQ2A 4RDUA 1IXSB 1UMQA 3AL0B 5DM6F 4GDFA 1RR7A 1TTYA 4EM1A 3Q9SA 1IJWC 4GYIA 2HOSA 2KIUA 4II2A 3CCRI 5TISC 2GAUA 2FQ4A 4HX7A 1OCZH 2XDVA 3QPHA 2DFFA 2KJBA 2OU2A 4A3DJ 2QBYB 2A68F 1ZYRF 1SVOA 2KT0A 4WXDA 4N4NB 2M87A 1O3RA 1QBJA 4C2MJ 3QU3A 2GZWA 4UHTA 1P4XA 4CH7A 1SANA 3ZQIA 1FSHA 2DDAA 2IS2A 2P8TA 4ENNA 3S93A 1PVEA 4DYCA 5K7FA 1OCTC 2DPUA 2LK2A 1ETVA 2CW0F 3I9V2 3P9IA 3KYDB 1GLNA 1QHHD 1G3SA 3K4KA 2MH9A 5D5WB 3N97A 2VJ5A 1JUMA 1SFUA 1A31A 4BHPA 3FBNB 2L5QA 2DTZA 1SD7A 4ZYAA 3TO7A 2E36A 5HVQC 1FMVA 3GEZA 1SAXA 2HR3A 2HDDA 3SEQA 3L2VA 2E7WA 2FBHA 4K2EA 1RRJA 2AS5F 4CO8A 1FLIA 3TP3A 2K27A 2CG4A 4BEHB 2X1DA 1HC8A 3P9CA 2GXGA 4BE2A 4H0EA 2HQ5A 2IXSA 2LP0A 3S3OA 2QKLB 1W36D 2RQPA 4EGZA 4XMYA 4CZZA 5K5RA 4NNJA 2W48A 1VF9A 5DTDA 3U1DA 3FHZA 3DLLF 1JGGA 2QCOA 4M9SA 2M45A 5EG0B 4E7JA 1OJLA 1GV5A 1X1BA 2BOLA 4RLFA 5EGOB 1FMWA 4MTDA 2BY2A 3F6VA 2D45A 3IWFA 3E97A 2UV1A 4XSZF 3ROUA 4B3XA 5HLGA 1OISA 1DP7P 3GFIA 1T08B 2BBYA 3H36A 2E5ZA 5LBQA 4NC8A 2YU9J 5L3BA 3BCBA 4IHWA 1LVAA 2Y48A 2EV6A 2X6XA 3SEZA 4QSHA 1IRFA 3J80K 1YW8A 2EIMH 4KIBA 4F55A 2FX0A 3V4GA 1F1ZA 2YSRA 2BV6A 2ME6A 4OIQF 3R60A 1PUEE 4LLGF 3S1MJ 1J09A 3BP8A 3JSPA 3BC8A 2L9RA 2VC1A 2HVRA 5LGNA 3HTUA 2VB6A 2XF5A 4AD9A 2EJRA 2HVSA 1GUUA 2XGXA 2HNHA 2WB1A 4HDVA 1WI9A 3VPRA 1AWCA 4I02A 4EJWA 3ZRGA 5CVRA 1F5TA 2KRFA 3DXJF 4UVAA 3I3LA 3FDYA 5JLWA 2H6CA 2OTLI 2QKMB 2JPCA 5IYDJ 2GA2A 3QYFA 3PFYA 1F4KA 4DNCA 3CCMI 4IHXA 1BM9A 1SD6A 4A0YA 2ESHA 4A2UA 4AWXB 2F2EA 1Y0NA 3KYCB 1B6AA 3ABLH 3ABTA 1QNTA 1TQIA 2KIFA 4RAFA 5CLSA 4XOTA 5BNGA 2PX9A 1JT6A 1FT9A 2E2IJ 2DFHA 3OY9A 4XQFA 4PGHA 5FFXA 1Z67A 3W3CA 2DK5A 2D2WA 2W00A 2G7HA 3FXRA 3KLOA 2COBA 4IEJA 1GHCA 1UG2A 3HOWJ 3AG1H 2R3SA 2M8GX 3FXKA 2DYRH 2GQQA 4HV6A 3HRSA 1VFCA 3LSMA 3FX3A 4Z6YA 2UWMA 1FTZA 3KEOA 5DD8A 2OJED 2FJ1A 2GXAA 2P5LC 1V5FA 2ZCWA 1CF7B 1W5CC 2L0KA 3CCLI 2IA2A 2O3FA 2VLAA 2QEXI 4KUMA 4S04A 1A6QA 4Q48A 1IZ1A 2GWRA 2O03A 3MCZA 3WGIA 5DS9A 4BBRJ 4ESFA 1LDJA 3CD6I 2BW3A 1YS6A 3HUGB 4HZFA 4I2OA 4XM3A 2I8DA 2IVMA 2ID6A 2VJJA 3BTCA 2A6TA 1XG1A 3ABMH 4A3KJ 2MC3A 2VQCA 2IGKA 1L0OC 4HPQA 3LSHA 3IAM2 4I76A 1HW2A 3KP6A 1YRNA 3F3XA 1R49A 2ZJ2A 3BQYA 1D5VA 2I10A 3I4MJ 3R0JA 2EIKH 2O0YA 3A03A 3EUHC 1QU3A 1LEBA 3CJQB 3HJEA 1BR1A 2BYVE 1MZBA 3K2AA 4KT6A 5M5YJ 4YG2F 2ZNZA 2KLOA 1MNEA 3S2WA 3W6JB 3TW7A 3QU6A 1VQPI 1POGA 4BJTA 2OCEA 5BPDA 5D5UB 3BCAA 1X19A 2DOFA 2QZ8A 1R5ID 3GWZA 3I53A 2UZKA 1K4SA 3M1EA 2DO7A 2OUMA 4IX7A 1MMAA 3QWLA 3OYLA 2KZVA 4A0XA 1QVTA 1S7EA 1QPIA 2M8EA 2EBIA 1RZ4A 1P92A 1XDUA 4I09A 3G3ZA 1E2XA 5CQGA 4QPQA 5JVTA 4L9NA 1B9NA 2DMUA 4RAGA 2R5YB 2ADUA 2FBKA 3KZZA 1JE8A 1RETA 1WJEA 5L3FA 3WTYC 2HKXA 3W6KB 3H3VK 4XRMA 1CGPA 5HDGA 3PIOF 1YG2A 2WAFA 1NG7A 2Z9OA 3FBIB 1ZGWA 4AM3A 1YHQI 4C2TA 1FYKA 1Z91A 3KP4A 3GFMA 1UHWA 1RKWA 2F4IA 3IH4A 2ZJRF 4ZC3A 3ZQ7A 2A07F 3F0CA 4R1HA 1BR2A 2JN6A 3R4KA 2V9VA 1ZRFA 3S2DJ 5FKMA 1TQPA 1RKTA 3CF5F 1JT0A 5FLXK 1EF4A 2WV0A 3P5JA 3F8FA 4FISA 5E3OA 3QYEA 5K7HA 4CYCA 1TWHJ 1MBEA 3ZGKA 2L7FP 3GTLJ 3DPTA 3OIOA 1FC3A 1ENHA 2BHYA 1U5TC 2JK3A 3CQZJ 4R79A 5ICCA 3Q5FA 4V2GA 3MN2A 4X1EA 2HFHA 4UVBA 5A2QK 3LA2A 1R23A 4E7ZA 4M6VA 3DQVC 4F52A 1O3TA 2P5VA 2R92J 3FXMA 1R5GA 2G0EA 2B7EA 2XASA 2MLGA 1K61A 1XC5A 5LHHA 2Y9ZA 3GZ6A 3RYPA 1FIPA 4CICA 2NS7A 5FGMA 3GXOA 3CC2I 4PSWA 3FXUA 4N9HA 3GTQJ 3F21A 2R7TA 2JWTA 3JRAA 1Z21A 2PMHA 4M3GA 1T38A 2ELJA 1I5ZA 5J47A 3ZMUA 4AU7A 3WU1B 5AIQA 1ZTRA 4S0HB 4F7ZA 4EM0B 4P1WA 1K7AA 2JJ7A 3LNQA 1XCBA 2KIQA 2M9HA 1YX3A 4RBOA 3T8RA 1FYLA 3Q9VA 1ZGAA 2HOAA 2E2JJ 1KQ8A 2HQAA 3DPUA 2ZKZA 1IG7A 4IHTA 2Z33A 3E5QA 1WHUA 4FQGA 5IPAA 3WTZA 2DOEA 4Y4RA 3MKLA 2YR2A 4D7NA 5J4YA 4OIPF 3DTIA 3M8JA 5FO5A 1R00A 2Y9YA 1HQCA 3HDDA 1TC3C 5HNFA 5DCFA 3E6DA 3WTUC 2LBFA 2CS3A 3CDIA 4AYBA 4AIJA 4U7DA 3F9KA 1J75A 3VDXA 2DBBA 2WAQN 2C6YA 2FE3A 4UV8A 1JKRC 4BNCA 3TMOA 4JX6A 4LB6B 1ZRCA 1YITI 3HB9A 3D0SA 4YIRX 4D9JA 5KAIC 4DYQA 5FJ8J 3OL3A 1FY7A 1IN8A 3CCQI 3GTKJ 1HW5A 4L9JA 1NG6A 3MVPA 5B1AH 2IS6A 3EUHA 1JHFA 4EGYA 4BXXJ 2EZIA 3I4NJ 3GZ5A 1MSFC 2M4KA 2CFXA 2RVCA 5F0CA 2KISA 4IHYA 3MKZA 4KISA 3IRRA 2QYOA 2JQ7A 2HI3A 2GBYA 1D8KA 1OKRA 3OYEA 1K79A 1U9NA 4IQ4A 2EK5A 3FF5A 4V2FA 2GXBA 4EVIA 2IBDA 2JVGA 3GLLA 2NOGA 3CUOA 3HPHA 2Q1ZB 3GTJJ 4NBQA 3DU5A 2MFZA 3HOYJ 3O6BB 1HKTA 4B8XA 4JK1X 1XTAA 1IUFA 5J8CA 2O8KA 2VBYA 4XONA 3VODA 2D1VA 1XN7A 3N05A 1MNDA 1FIAA 3DTKA 5E8IA 1XGMA 2X0LA 4XLAA 5HLIA 3T0YA 4IHVA 2B0LA 1V5EA 3K4JA 4D5CA 2XGEA 5DCMB 1D3YA 5F6FA 1WCMJ 3FZVA 2ZFUA 4IRIA 3KYLA 2E19A 1RI7A 1QO0D 2NOJB 4RGRA 1JUPA 4A3JJ 4MTEA 4KJZA 2PG4A 1OCOH 1KONA 5DUIA 2CW7A 4HRIA 1VQMI 3SHFA 3TGNA 1XDSA 1ZGJA 4G7HF 3SFIA 4L5IA 4XN0A 3TOBA 4BJ6C 2DU9A 3H0DA 1RIOH 1L3LA 2VXDA 3HC7A 3IRQA 1FPQA 4EQQA 2DDBA 2HGCA 3ZPLA 2NS0A 3K1NA 4KNYA 3JRHA 1PP8F 1U5TA 4AIKA 4NDLA 4F93B 3I56I 5E17F 1TWAJ 1WH5A 1T0FC 2HDWA 1IXRC 3ZN0A 4ASNA 4OAYA 1JTXA 1I27A 2R7FA 5FKKA 2KP6A 3QPLA 4BXUA 4OMZA 5IT9Z 3K6GA 2BVLA 2VKHA 1BIAA 4G6DA 1UELB 3IHUA 2VJ4A 3ZQQA 4C3HJ 2ZFWA 2A3SA 4IQJA 1EV7A 4J00A 3VYTB 3RJPA 2K85A 3I5UA 3RQ4A 2RREA 2NVUB 4U0VA 3I58A 2R7QA 4IO9F 4WXCA 1ZKGA 3LA7A 5LD2C 3S17J 2XHKA 3FXLA 1S72I 2WWYA 1IO2A 4CYDA 2JA6J 2FOKA 3KZYA 4E6KG 2LRDA 2GLOA 5JR3A 1KU2A 3S3MA 4KMUX 4ESJA 3H5NA 1GXQA 1S6LA 3QAHA 1ETWA 2VKEA 3SXYA 5ICEA 2CGPA 2FA5A 4AVZA 3KP7A 4PSXA 2ME0A 3LSIA 3CCUI 2JTVA 4FHTA 4U0YA 1SEUA 4IF4A 3MZHA 4UUVA 3KEYA 4HYEA 3EYIA 1BJAA 2PEXA 2ID3A 2LSOA 1W0UA 3I64A 3A01B 1FSEA 4Q47A 3ECOA 3CUQB 1BN5A 1T39A 2QQ9A 5JI6A 4BACA 2CSOA 2BXYA 1WJFA 2EA4A 4O3MA 4P9UA 4Y15A 2EWNA 3D1NI 1RUOA 9ANTA 4LJZF 1KU3A 5HNHA 4RGSA 1Z0XA 2NVXJ 2QBYA 1IDZA 4LG3A 1FOXA 1B72B 1I3QJ 2CO5A 2K7LA 2M30A 2LR8A 3H0GJ 4BDZA 1HOMA 1XGOA 2VQHA 2X1CA 1X2MA 5LGTA 1KA8A 2HZDA 3RPUA 1P7JA 4XR6A 1LKXA 2BY1A 1Z6RA 3IUOA 3E6CC 3QPSA 1S3JA 3WTWC 4I0BA 1ON1A 4I0AA 4PJLA 4EM2A 1A35A 2WAQA 4XLFA 1T8IA 2R0QC 3SDBA 2Y30A 3NAUA 3U2RA 3WE2A 2K4BA 1UJ8A 5D6EA 1D0YA 2LLKA 4OAZA 2UXNA 2CW8A 1XMXA 4XLCA 1LEAA 5HDNA 4HA8A 4W97A 4G7ZF 4MGRA 1W5TA 1LDKB 1XS9A 1O57A 4ABZA 2X9DA 5CVVA 1VNDA 2I5UA 1ZRDA 3S16J 2XKPA 4B48A 3I55I 2XGCA 3DKYA 3CMMA 4P9FA 1G2HA 2V1DA 1IRGA 1EH6A 1ZG5A 2XF7A 2G9WA 1ITYA 2MD5A 2ELHA 5ED4A 1BW5A 3MMYB 2F5VA 1BOAA 3I71A 3J81Z 3MEXA 2NYXA 2ZO4A 4CXFA 1VQLI 2E1NA 2LY1A 3ZQCA 2JA5J 3WODF 3Q0UA 3JR9A 3COAC 3OSFA 4XKVA 4ZZLA 4BQNA 3RYRA 1WSUA 4A6EA 3E6BA 5LRSA 2KIMA 2VE8A 2B63J 5H20A 2BY0A 1Y8RB 2RKHA 5ILVA 4GXOA 1PP7U 2DPDA 3CC4I 1IUYA 1MMNA 2FD5A 4XOPA 5KVRA 2Z2SB 1P2FA 1BI1A 3D5RC 4C3IJ 4ON0A 5FRMA 3DEWA 5JHFA 4BGDA 1TZLA 1YIJI 1JJ8C 4IL6C 3T8TA 3DLAA 5B1BH 3G1LA 2DQRA 2D1HA 2X4HA 4LB5A 2HOTA 1F9NA 2XB0X 1U78A 1I3AA 4ENJA 4HF0A 1SMYF 5AIPA 2EA2A 1KYZA 1UFMA 2BZTA 2YS9A 1OPCA 2A61A 3HXLA 4V19K 1FBUA 3GFJA 2BGCA 1IN4A 4DGWB 4XRSG 5ERIA 1USTA 2HYGD 5J8FA 1XSXA 3H3ZA 2LH9A 5GADJ 1Z3XA 4ETSA 2L9NA 1T0FA 3L1PA 4TV7A 4FE7A 2DQLA 1EJ9A 2IPQX 4R8HA 5F27A 3PO3J 2V9KA 2EINH 3JREA 2EZKA 5EZHA 2NNYA 3CCVI 3OR2C 1MKMA 1X4OA 5H6RA 4UUSA 1FYMA 2CV1A 3CC7I 4QPOA 1V5GA 1J9IA 2E1CA 1YE9A 4ZDLA 2VPRA 3CMYA 4BE0A 5GPCA 1WKMA 1ZLJA 4M3FA 4HNUA 3KPHA 1G3YA 3JAMZ 3BZ6A 5IYCJ 4NC6A 2ZMEC 5BS6A 2DODA 4LGWA 1MDMA 2GA1A 3HEFA 3IWZA 3GTOJ 3QQAA 4JYKA 4HX4A 4J01A 4M6XA 2OV7A 4RM3A 3TQNA 2IA1A 1X3WB 2IS1A 2JMWA 3ZCOA 4M3BA 3CP8A 1O7FA 3BG7A 3BWGA 4Y17A 1D8JA 1NK2P 4IZZA 1W7PA 4FTHA 4MO7A 3PNTA 3HHHA 1YJ9I 1EKEA 1YLFA 3Q3SA 1KYWA 3GTMJ 4WXHA 4XBFA 3CDHA 3JRBA 2DJIA 2MGQA 2XAQA 2XGDA 3WTSC 6PAXA 1WH7A 2CH0A 1JTYA 3OIQA 4D7MA 1I39A 1HA8A 4JOMA 1X3UA 3WTTC 4BYYA 3S14J 1O4XA 5IY5H 2NVQJ 4AIDA 3TOAA 1Z3YA 2ZNYA 1DPUA 4Y13A 2LC2A 3HOSA 1IAWA 5C44J 2J5PA 3CJTB 3KE2A 3ZMZA 2BXZA 2VT2A 2MW8A 4CCNA 4A3EJ 3EETA 2FOWA 1DDNA 3FK6A 4BXFA 1IRXA 3PNVA 2DTRA 2OQGA 2QVOA 1K78B 1SFOJ 3GZNB 5E1WA 4ZH4F 2IJLA 4A93J 2NAZA 2A6EF 4L5JA 2HVQA 4X6AJ 3DBLB 3E0JB 1VQ4I 4Y3OA 3ZR8X 2DA5A 2VQLA 3VB2A 4BHCA 1BIBA 1T56A 4PJMA 1JKPC 2R93J 3K10A 1VZ0A 4BY7J 2WY8Q 5FD6A 2XRLA 4YEJA 2F5EA 1Z9CA 3V7RA 1OR7A 4HX8A 1B59A 3ABKH 3HGGA 3W2WA 4M72A 1FP1D 2TDXA 3TW6A 1TNSA 1WI3A 1BC7C 4FT8A 4NUBA 1I1GA 4ZTJA 1S8NA 2VBWA 1YX5A 1F36A 2M7BA 1R5HA 1TWGJ 4KYWA 4A3IJ 1WJ5A 2PMZA 3ASOH 4B47A 4ZYDA 1ZREA 1P9QC 4WX9A 3E6MA 3LA3A 4MIMA 5ILSA 1QHGA 3KP5A 1MSEC 5FB2A 2VT3A 3OS1A 2B9SA 1V55H 4HSRA 2EZHA 3RKWA 4EEFG 3K70D 4XLNF 4MEYF 2F5CA 3M1CA 4RA2A 1UHSA 1BI0A 3OYJA 3N4MA 2FF4A 2FXAA 1IGNA 1G3TA 1V54H 3K1MA 5FKLA 1VQ5I 1HF0A 2FQ3A 4RGXA 3FXQA 3GX4X 1O3SA 2ISYA 1ZAOA 3G2BA 5JHUA 4I6ZA 2WBMA 3OYBA 4EMSA 5M3FJ 2E1MB 4BBSJ 1NK3P 1BOBA 2QENA 3FM5A 4L9VA 3C7JA 2CUZA 3ELKA 3W2VA 3FXOA 3CCJI 1YI2I 1U8BA 1FOYA 2XSJC 4BKXA 3QYBA 5KNLA 3CTAA 4B3AA 1TT0A 3X2QH 3OYFA 4MFEA 3HRTA 2W1OA 3JRGA 4FX0A 2MLKA 1YJWI 2PQ8A 5CJ9A 3S15J 4I99C 1KQ9A 3LOCA 3JTGA 2VODA 3DFGA 3HSEA 3FMRA 1ZHFA 1N75A 3E5UA 3NQOA 4ENKA 3EUKL 4BUPA 3I59A 3AAFA 2O9LA 3R0AA 3VYUB 1UG0A 1IRZA 1M1EB 1VQ9I 3GTPJ 2L2OA 4DQ2A 1QZEA 4HNVA 1RR8C 3HOXJ 3CLOA 2QLZA 4NB5A 4DBRA 1IC8A 1WFXA 4YFKF 3W2AA 2NVTJ 1OQYA 1ETKA 2K40A 5IOYA 5FLVA 2DLLA 3BZKA 3CDLA 4U87A 4M6YA 1OYWA 2MG4A 3P7NA 1MBKA 3G73A 4G7OF 1RC9A 1TLHB 2OBPA 4KMFA 2EV5A 1SFEA 2FU4A 2FMYA 2R7OA 3G6EI 2DCEA 4IOCF 5FLMJ 1QRYA 2JZYA 3OS0A 4LLLA 2ZXJA 5TRDA 2ZMEA 1Z7UA 2PMUA 4CGZA 3ZMVA 2DN0A 1JUSA 1GDTA 2V26A 1A04A 2TRTA 2P0WA 4LG0A 2AQEA 2DT7B 2K3PA 4NQWB 5EEHA 1SD5A 2CRGA 1HBXG 3ZQHA 3BR2A 2WA0A 5J3LA 1RPWA 3C18A 2A5YB 3HGYA 3JCUC 4QIWN 2L7ZA 2XRNA 4RB0A 4P96A 3GLXA 3LQQA 4N4OB 2DJNA 1PUFA 4A3MJ 2BW3B 1GT0C 1MW7A 5LLQA 3GMEA 2HQRA 4A12A 2X6WA 3LAJA 1R7JA 1R71A 4LD5A 1HSJA 4OOIA 3D5LA 5K7ZA 2K3FA 4ZYHA 2L02A 4PZJA 3ML6A 5EZGA 4KN4X 1OLTA 2IT0A 2MSYA 5K1YA 2L4MA 2CQXA 4X0GA 1YRNB 1EH8A 3BROA 5C4XJ 2NNNA 2JUGA 1REPC 1C0WA 2K9NA 3RKQA 4NC7A 2NS8A 4DBQA 1T2KA 2MA3A 2FNAA 3L00A 5EYRA 4HOBA 1EA3A 1IN7A 3L2WA 4LLNA 2GOXB 2FEZA 2V79A 2OTJI 1FWZA 2EILH 2Y0SN 1MNMC 2CWEA 5EJCA 4XICA 3MQ0A 2OZ6A 4GYGA 3M9AA 2VE9A 3FKIJ 1P4WA 3OYAA 2EQRA 5J1UA 1EH7A 4O6JA 5KCMA 1D1CA 2E34A 3CZ6A 4HQMA 1S5LC 3EPZA 1FP2A 3DU6A 4XLEA 3KCCA 4B43A 4HLYA 4DYRA 4GCVA 3PQKA 5J4VA 4XKBA 3ULQB 4B1RA 3TL4X 2IRFG 2IGOA 2WTEA 3PIPF 2H1KA 2KJCA 4RAYA 2VUMJ 2JA2A 4LK1F 3GYHX 3LSKA 1ORKA 3ZXSA 4JBAA 2DYSH 2JRMA 4CDGA 1W36C 2EIJH 2L4AA 3DBRB 3W6VA 3AL0C 3G1MA 2PJRB 1LPQA 3I0TA 2X1EA 1VQNI 3HSFA 2JA8J 1SVLA 2KL4A 5DD4A 3RZOJ 1ETYA 5E18F 2DT6A 1ZELA 2Z1DA 2LTPA 1ZK8A 5DCMA 2M4GA 3ECHA 2IW5A 5ICGA 1HDPA 2KKOA 1JJ6C 1R22A 3K1PA 3ZMTA 3BG6A 1KQ0A 4M74A 5J40A 1LVKA 3TO6A 1V4RA 2VASA 4DZJA 3OYCA 3UKGA 2LG4A 2LDUA 3AFHA 4MHGA 2RAEA 3IV5A 4CYCB 2L9SA 3F8CA 4HDUA 1ACIA 3CCSI 2LF7A 1HW1A 4S05A 3O8HA 2IA0A 2LREA 2K86A 2R7UA 2O6GE 2V1UA 4U88A 3WG7H 5F1RA 2HTJA 2VIXA 1H0MA 2XB5A 4G8XA 2XAGA 3RI4A 4IVNA 3SQNA 3TDUC 1B8IA 1SMTA 3CJRB 2DA7A 3GFLA 2V1NA 3CCYA 5J1RA 1E3PA 2QA4I 5KHDA 3NWSA 1A6IA 4PJNA 5EEGA 2EPFA 4IPAA 5HODA 1WZ2A 5J6XA 4A3BJ 1TW3A 1S7OA 2XAJA 3CMAI 1LQ1A 2V1XA 2Q8KA 1MBHA 4LFUA 4PK4A 2R5ZA 1MH4A 3KIOA 4IOAF 3E3VA 4ZYGA 2K02A 1BBYA 5FKOA 4A69C 4HAMA 2VPLA 4UXNA 3K7AJ 4ZJZA 4G6QA 3M3YJ 1FBQA 2WADA 5HS7A 3IH2A 4LK0F 3MZ8A 3VSKA 3GTGJ 2E1OA 2EFWA 3VYRB 4YFXF 1E0EA 5D8KB 3JW4A 3S1QJ 1Y1WJ 3V8JA 5D4SA 5L3GA 2JRTA 2VN2A 2X48A 1WVRA 2XAUA 5IYBJ 1YJNI 3JRFA 4HV5A 3VOEA 2XF6A 4XRFA 3DBHB 2XPUA 2LBFB 4BHBA 3A0BC 2RDPA 4U7BA 3QOPA 2ESNA 2CYYA 2ZB9A 1X1PA 3ZMDA 3UR3C 4CCOA 3GVAA 2Y69H 2L54A 3LSGA 5E20A 4OWRB 1XSDA 2W57A 2LKPA 2RGVA 4W1UA 4QLCU 4IRHA 2PLYA 2CQ7A 2WY7Q 4CA0A 1Z77A 1D0XA 1IDYA 2YX7A 2VONA 4B09A 5GP9A 4KA4A 2JVHA 1B4AA 4E7IA 2JPBA 1WJBA 2F5FA 2FNPA 3BQZA 4OINF 3RQIA 4BDYA 1HXDA 2K5CA 1FZPB 2XAFA 4EJVA 3F8MA 4KT5C 1TW2A 2K4JA 5LHGA 2ZJQF 4EJUA 4RB3C 1U3EM 3C1DA 5C3EJ 2XSDC 2ZXHA 3T1BA 4CCMA 3CMEI 2V7FA 4E7HA 1OCPA 4ENMA 1P4AA 3BY6A 1LE8A 1JXSA 2YUSA 3K4BA 2DMNA 2BY3A 1WJCA 4LMYA 4AUXA 1FOWA 2ZC2A 1HLVA 1GXPA 3C2BA 5EEAA 3VYSB 5GTIC 5BPIA 4JX5A 4YRVA 3VEPA 1R4NB 2Z5UA 4BQOA 4BU2A 3GW2A 3AKZA 3CJNA 3HYIA 3OYDA 4IHSA 1QA6A 1RNLA 1YW9A 3D5SC 2DA6A 3PFIA 1MBGA 3RDIA 3ERMA 4XN3A 2VOPA 2Q2EB 2V6CA 4RGUA 4AC0A 1LNWA 2P81A 4C2UA 1WPKA 2PN6A 2F5DA 5FFZA 1D5YA 4IKFA 4PGGA 3JRDA 1DP3A 4HNTA 2OAZA 2LY9A 1YW7A 3WHBA 1X3ZB 1QVUA 2WB1N 2LFBA 2QSGX 2STWA 2E60A 2GIZA 4M73A 2VL8A 2N8GA 4A3CJ 3HTSB 3LQRA 3VWBA 2QSFX 1G6NA 2EV0A 3HRMA 3M07A 3H5RA 1LDDA 1KGSA 1PDNC 1H9GA 3O3KA 1W1WE 5HLHA 3R6SA 3L09A 2P6TA 4LIVA 5IT9K 2R7ZJ 1LB2A 3HZJA 4HQEA 3BLYA 5LHIA 1I6XA 4RAZA 2OF7A 4WCGA 2YU3A 1U5TB 2F6CA 2DI3A 5FKNA 1FTTA 2XC7A 1OR7C 3MFKA 2L7MP 2H94A 4GGGA 3FISA 2XPVA 3C2GA 1G59A 1Y1VJ 4J19A 2VC0A 3LSRA 2OD5A 4RMNA 3OOUA 3GO5A 2JT1A 5JLXA 2QGUA 2DMPA 3KP3A 3OYKA 3MZYA 2LNBA 4BEHA 3OMYA 4XLHA 2V4JC 2MC4A 2D5VA 1ODDA 4KDPA 2E2HJ 2E7XA 2DT5A 5DDGA 3LSJA 1DGRM 1WJDA 2L01A 4KIGA 4UB6C 1BI3A 2O8XA 1QQIA 4RLQA 2NVYJ 3QOEA 1SFKA 3NRVA 5ILUA 5EG0A 3RKXA 3DPLC 5EGOA 3MAJA 3PSFA 2HWVA 3HIFA 3KLNA 4FX4A 4NHJA 1A5JA 3WU0A 1UZCA 1IF1A 4UY8I 1LFBA 2R7DA 1VQKI 4G6TB 3LMMA 3BOQA 2AXLA 1J7KA 1RESA 2YX4A 5BOXA 3FXJA 3OSGA 3HHGA 3EYYA 4MNUA 5HS9A 4L0ZB 1R6RA 4KICA 4A0ZA 1PYVA 2X6OA 3DCFA 5E79C 5LRRA 3ZP5A 3DTEA 1YIOA 4DIQA 4D5FA 5M5WJ 4MQ9F 4OMYA 2KZGA 3LWFA 3S1RJ 2O7OA 1UHMA 4RM2A 1I50J 3AG2H 4GO1A 2E35A 1TBXA 3NWTA 5DEQA 2AHQA 1IXCA 3OYGA 2M2EA 4KFCA 4CZCA 4CUGA 3M4OJ 1V3FA 3A02A 3FIWA 2EZLA 3J80Z 5K5QA 3SDGA 3ZOBA 5D4RA 5IP6A 3K69A 2M0MA 4E7KA 2ELKA 4BY1J 3BR5A 3BZCA 3BPVA 3S1NJ 2DA1A 4XKWA 3QP5A 5D8LB 1K78A 1P7IA 4YELA 1ERDA 2VBXA 1VQ6I 3H5AA 4FETA 4I98B 4HSTA 3K9TA 1AKHB 4KITB 1R1UA 4UVCA 5LGUA 3FKJA 4N0BA 3J81K 1QGPA 3WE3A 2HKOA 2R7WA 1XCVA 4GFBA 1Z1DA 3G4SI 2M1BA 5E1ZB 2W84A 5D5XB 5DUKA 1X1CA 3QPTA 1U8RA 1WRJA 1S7AA 3AG3H 3EQLF 2AO9A 4D0PA 1N77A 2A5WA 2Y0MA 3DF8A 5H2FC 3QP6A 3B73A 3SZPA 3V7SA 4A5MA 4A3LJ 3T5XA 3V42A 1CF7A 2P5KA 2PBIA 1QZZA 2HXOA 3G71I 3REOA 2HEOA 4BQQA 2Z99A 2VI6A 3O2PE 1B1BA 2K9QA 3M7GA 3UNGC 1XPXA 1ZR2A 2WV1A 2DFEA 1GVDA 3BDDA 2WC2A 3HUGA 5CVJA 4OIRF 2JSPA 1LUJB 2ZBKA 3ZN1A 3DEEA 1X58A 4JQFA 2CQQA 3H9GA 4A5NA 3RPUD 3L2UA 4DW6A 1H9TA 2KRCA 1BJZA 2HPMA 5E3NA 4WF2A 5LEJA 4PJJA 3B02A 3VSLA 1MH3A 2A69F 3E1SA 1H88C 2Z16A 2VBZA 4QWQA 1QPMA 5BMZA 1T98A 2FBIA 3ABUA 5GPAA 2STTA 3HKZN 4XK4A 3IL2A 3U1KA 2Y31A 3RZDJ 3GF2A 4PCQA 4OIOF 2IAIA 4PDKA 1T33A 1WWXA 2JSCA 4GRIA 1OYYA 4DZPA 3NEUA 2L3DA 3NARA 3P9KA 4MFDA 2H1LA 1T95A 3HOVJ 3GUDA 4I7HA 1FX7A 2V9PA 4HF2A 1Y0UA 3K4CA 4E70A 1R4MB 3PUFA 2F48A 2XKOA 1ZLKA 2H8WA 3ERED 4E4HA 2Q0OA 3L9FA 3JAMK 3BR0A 1HSTA 5FRNA 2A6HF 5D5VB 3F22A 2O61A 1JKOC 2G7UA 3I54A 2LMDA 2AQFA 2W25A 4UUSB 2FMLA 3CO6C 1AU7A 2TCTA 1ETOA 4XKCA 2E71A 3DEUA 3I4PA 2HU9A 4ZDPA 2R5YA 1ZQ3P 3IP4B 3PUBA 1AHDP 4UNOA 4CSWA 2ECBA 2ZJPF 4E7LA 2K9SA 4ANJA 1R9TJ 4II3A 1XMKA 4JP0A 4BS9A 1MDMB 1N25A 1TWCJ 1J59A 3LAPA 4HBLA 3LFKA 1KU7A 2DAOA 1DPRA 3OIPA 2HTSA 5M3MJ 4L0YB 2EH3A 2KFDA 1O3QA 4AYBN 1W7PB 3HG9A 4XIDA 4NQWA 4B4CA 3KX2A 2RC4A 4CCLA 1D1BA 1TT5B 2P7VB 1DUXC 3S8PA 1RUNA 3BTJA 3H9QA 4Y33A 5F1JA 4IJAA 2GOMA 3HOUJ 3ESWB 5JFRA 4XL9A 5CVIA 5F08A 5GAHJ 1K6OA 1WJAA 3J7AO 3WGGA 3FMSA 4PFPA 2H09A 3H9JA 3OOPA 1K6YA 3CF2A 1FNNA 2IP2A 3BPXA 1X2NA 1USSA 2MABA 3K4NA 4WK8F 1ETXA 1FBSA 1LJ9A 3L7WA 2CV2A 2BEOA 3BJAA 3IAS2 1X1AA 4WWCA 2OC6A 2AXTC 3BTIA 1SVMA 5JVGF 5FLXZ 5DYMA 5IOZA 4MLOA 1AA7A 2UUZA 3Q0VA 2MH2A 4DJAA 1PJRA 2KQRA 3TP0A 1FJLA 3G1OA 4G12A 4AVPA 1W4MA 3F8BA 3IH3A 3L2CA 3M8EA 4DOZA 3C3WA 1JI8A 2XVCA 1X4PA 1R1TA 4B44A 3HPGA 2XAHA 3EDPA 2VKDA 2VXZA 3JRIA 3WTXC 4C30A 3L2QA 4L5EA 5A2QZ 3FWEA 1ZN2A 2XPWA 4L18B 1G3WA 1BW6A 2K9LA 3HOZJ 5DM7F 3HSRA 2DA2A 3HBLA 5CQEA 1YS7A 5BQTA 2F4OB 1ULYA 2Y75A 3H1CA 4CCKA 5FROA 1W7PD 2HPIA 3JTHA 1S29A 2KDOA 4F91B 5E3LA 1MJ9A 4EV0A 3IKVA 4MQVA 3HRUA 2VKVA 4BL0B 1XGNA 3A2KA 4LIUA 1MMDA 1XX5A 4OU0A 3ZMSA 5IP9J 3DP7A 4RS8A 1K4TA 2PJRA 5L3DA 2ICWG 3CUQC 4XSXF 1G4DA 2M3AA 2HS5A 4YFNF 2W85A 1XMAA 3CP2A 2CV0A 5GAEJ 5LEKA 5E8GA 2EFOA 5F0FA 2XIGA 1BI2A 2ISZA 3S3NA 2UXXA 5E3MA 2ZSHB 2CUEA 1LFPA 3CLQA 1UAAA 3BTLA 1XSVA 1DQUA 2X51A 1ZG1A 1E3OC 3K4MA 4ZZDA 2QWWA 2ACJA 1UB9A 4Q4ZF 1YQAA 4Y52J 5FD5A 5EDNA 3RKYA 2R7RA 4CHUA 3R61A 4F3QA 1DGWY 3BJ6A 1MMSA 1R58A 3ISPA 5IP7J 3KEQA 1J0RA 2VQGA 3DKWA 3J7ZI 4KIFA 3QRFF 2CMPA 5KAFC 2IGNA 2LYCA 4HF1A 3KFWX 2Y2ZA 4P55A 3HKZA 1Y8QB 3I59B 4QTRA 3ZQFA 1Y6IA 3Q0WA 1Z6TA 4ESBA 3MKYB 3BG3A 2IEKA 3FM3A 1G8XA 1FOKA 5B3SH 2DMQA 5DV5A 3C2HA 3OYNA 1Z05A 2R7SA 1OCCH 2CQNA 4ZTFA 1HCRA 5B66C 2CUJA 1TWFJ 3A0HC 1SD4A 1OMIA 2NRAC 3PJRA 2OQRA 4FASD 2ECCA 4EATA 1KU9A 5ICFA 3WG9A 4A3FJ 3OV8A 2FUG2 1J2XA 2COMA 2MYSA 4LITA 4RB2C 1JHHA 4Z2YA 2BE5F 4M9ZA 2ZMEB 4PFOA 1OFCX 2LOOA 2VOOA 5F64A 3PO2J 4A3GJ 5CKTA 2M7AA 4LG0B 3KETA 3AG4H 4BQAA 1Y56A 3F6OA 1YYVA 3PQJA 3GCMA 3H3UA 4YIIA 2CFOA 3S2HJ 4E7SA 2V6EA 1MBFA 2QQBA 2W82A 3CESA 2EFQA 1PUFB 4UB8C 3HOTA 3K2ZA 1R1VA 3BJOA 3OL4A 3TKYA 2DA4A 1SFXA 4Q5SF 3GBGA 2E5NA 5B5EC 1ZR4A 2QSHX 3HM5A 2W4SA 4C3JJ 4L9TA 1OCRH 4A6DA 2P6SA 3SZGA 2DA3A 2NXNB 5C4JJ 3BR1A 2LY2A 1J5YA 2H6BA 1E3HA 2P4WA 3BT9A 1Q1VA 1W5SA 5L3CA 3SYTA 1QZYA 2W7NA 2P7CB 1R36A 2ZXWH 3CO7C 2EB7A 4FCYA 2OA4A 3PSIA 3LFUA 5F0HA 3KZIC 3JRCA 2ZSIB 3LSTA 4BE1A 2DOAA 3F8NA 4AIHA 4RB1A 1BA5A 2R7XA 1NH3A 1A36A 3RSNA 2XV4S 5KK1A 3PNYA 3MWMA 1VQ8I 2RNGA 1MD0A 1ZARA 3OWTA 5CVUA 1ETQA 2M0CA 3FMQA 1OYIA 1ONVA 3ONQA 3WGHA 2KMUA 2ZXIA 3CCEI 4D1QA 5E1XA 4BJ5C 3K0LA 4HLXA 2VJIA 4HG2A 1VQ7I 3LL7A 1AOYA 1D1AA 3V8LA 2X85A 2HZTA 4KN7X 2LVSA 4M3EA 2HQNA 1SC7A 1XGSA 2QM3A 2R4GA 3SJMA 5CPRB 1ON2A 3OYMA 2Q2EA 2WAEA
chains in the Genus database with same CATH topology
2DA5A 3LSJA 1TWHJ 1JKPC 1T56A 2R93J 3BG5A 1MBEA 2L7FP 3A01A 3OIOA 4BY7J 3GTLJ 1I6HJ 2XRLA 2NVYJ 1ENHA 2JK3A 3CQZJ 5EG0A 1K83J 5EGOA 4V2GA 1H8AC 3MN2A 3HGGA 1A5JA 4X1EA 3BR6A 4M6VA 1LFBA 3TW6A 1WI3A 1RESA 1B72A 2JA7J 3E7LA 3OSGA 1F36A 2R92J 1TWGJ 2G0EA 4A3IJ 1DU0A 1K61A 2X6OA 3DCFA 1XC5A 4MIMA 5F04A 2Y9ZA 1APLC 1FIPA 2NS7A 2CJJA 4D5FA 5M5WJ 1MSEC 1HDDC 1WGXA 1NTCA 3S1RJ 3GTQJ 2O7OA 2JWTA 3JRAA 4M3GA 2LKXA 1I50J 2EZHA 4EEFG 2DMTA 1UHSA 3B6AA 2AHQA 1W0TA 2M2EA 1IGNA 5FKLA 2KDZA 3M4OJ 1ZTRA 2M34A 3A02A 4S0HB 1HF0A 3FIWA 2EZLA 1B8IB 2H8RA 2JJ7A 2CU7A 3SDGA 3WHCA 3LNQA 2OPTA 2M9HA 3ZOBA 4RBOA 1H89C 4I6ZA 2HOAA 3ZQGA 5IP6A 5M3FJ 2E2JJ 2ELKA 1IG7A 4BBSJ 2QF7A 3BR5A 1NK3P 4BY1J 3S1NJ 2DA1A 5IPAA 1P7IA 1U8BA 2R5ZB 3MKLA 3BR3A 4BKXA 4D7NA 1AKHB 4B3AA 3PM1A 2Y9YA 3HDDA 1TC3C 4MFEA 1DU6A 3JRGA 4GFBA 3S15J 3LOCA 3LSPA 3TEDA 5M5XJ 1F43A 2WAQN 5EF6A 1JKRC 2O9LA 2LD5A 4JX6A 2AO9A 1MBJA 1IRZA 3O8GA 3GTPJ 1LFUP 3HB9A 4UUTA 4XRSA 1VI0A 4A3LJ 4HNVA 3HOXJ 4DYQA 5FJ8J 1IC8A 2NVTJ 3GTKJ 3MVPA 2HXOA 1ETKA 2K40A 5IOYA 5FLVA 4BXXJ 2EZIA 2VI6A 3CDLA 3I4NJ 1MSFC 2MG4A 1CQTA 1MBKA 3FK7A 2K9QA 3B6CA 5F0CA 1ZR2A 2WV1A 4IHYA 4FE4A 1GVDA 2HI3A 3ZQLA 2GBYA 1JKQC 4LOCA 5FLMJ 1QRYA 1X58A 2CQQA 1U9OA 2GM4A 1U9NA 4DW6A 1BJZA 2DN0A 5E3NA 1JUSA 4V2FA 1GDTA 2IBDA 2NOGA 2TRTA 1FEXA 1MH3A 1H88C 3GTJJ 3HOYJ 5GPAA 2CRGA 3ZQHA 3HKZN 4M3DA 3BR2A 4XK4A 2Y31A 1RPWA 5J3LA 3RZDJ 1IUFA 3HGYA 4QIWN 2IAIA 2L7ZA 2O8KA 1T33A 2HXIA 4JX4A 2DJNA 1AKHA 2PMZN 1IV6A 1PUFA 4A3MJ 4DZPA 1GT0C 3NARA 1BL0A 4MFDA 1LE8B 3HOVJ 1FIAA 5K7ZA 5EZGA 3BG9A 4IHVA 2MSYA 4D5CA 2XGEA 1GV2A 2CQXA 1WCMJ 2CUFA 1YRNB 2E19A 5C4XJ 3BR0A 1JUPA 2K9NA 4Y7NJ 3RKQA 5J1YA 4A3JJ 2NS8A 1JKOC 5EYRA 2HYJA 4UUSB 4RDUA 1AU7A 2Y0SN 1MNMC 2TCTA 4XICA 1ETOA 3SFIA 1UMQA 1ZQ3P 2R5YA 1RR7A 3FKIJ 1AHDP 1IJWC 2HOSA 2ECBA 2EQRA 5J1UA 2K9SA 1R9TJ 2FQ4A 4JP0A 3JRHA 1TWCJ 4NDLA 4DYRA 1TWAJ 1WH5A 4A3DJ 2KT0A 4B1RA 5M3MJ 4X6AJ 2EH3A 1JTXA 5FKKA 4C2MJ 3QPLA 2H1KA 4AYBN 1SANA 3ZQIA 4XIDA 4B4CA 2VUMJ 3BTJA 4DYCA 5K7FA 1OCTC 1ORKA 5F1JA 4C3HJ 2LK2A 1ETVA 3HOUJ 3W6VA 3G1MA 5F08A 1JUMA 2JA8J 2DTZA 3RZOJ 1ETYA 1ZKGA 1X2NA 3S17J 2LTPA 1ETXA 2HDDA 1ZK8A 2JA6J 1HDPA 3TP3A 1JJ6C 2GLOA 3BTIA 5IOZA 4MLOA 1ETWA 2VKEA 3Q0VA 3TP0A 2HQ5A 4DZJA 2LP0A 3G1OA 4G12A 2ME0A 1FJLA 3UKGA 3IH3A 3IV5A 2RAEA 4CYCB 2ID3A 1W0UA 2W48A 1VF9A 5DTDA 3A01B 1JGGA 3O8HA 2QCOA 5EG0B 1OJLA 1GV5A 3JRIA 5EGOB 4L5EA 2XPWA 1BW6A 3D1NI 3HOZJ 9ANTA 2XB5A 2DA2A 3HBLA 1Z0XA 2NVXJ 1IDZA 2YU9J 1B72B 1I3QJ 1B8IA 4IHWA 2DA7A 3H0GJ 2LR8A 3CCYA 4QSHA 5J1RA 1HOMA 2FX0A 5E3LA 1X2MA 1P7JA 2ME6A 1A6IA 3S1MJ 5HODA 4A3BJ 2VKVA 3QPSA 2L9RA 5IP9J 1GUUA 1MBHA 2R5ZA 1MH4A 2R0QC 2Y30A 3NAUA 5FKOA 3VPRA 4A69C 2LLKA 3K7AJ 5JLWA 5F0FA 4W97A 5IYDJ 3M3YJ 5E3MA 1XS9A 2CUEA 4IHXA 3IH2A 3BTLA 4ABZA 2X9DA 3GTGJ 1VNDA 2E1OA 1E3OC 3S16J 2XGCA 1G2HA 4Y52J 3S1QJ 5EDNA 1Y1WJ 1ITYA 1BW5A 5BNGA 2X48A 1JT6A 5IYBJ 2E2IJ 3JRFA 3ZQCA 2JA5J 5IP7J 2XPUA 3Q0UA 3JR9A 3OSFA 2ZB9A 2B63J 2COBA 4IEJA 1UG2A 3HOWJ 2Y2ZA 2M8GX 4QTRA 3ZQFA 3Q0WA 2FD5A 3LSGA 3BG3A 1VFCA 4C3IJ 4W1UA 2IEKA 1FTZA 1Z77A 2FJ1A 3DEWA 2DMQA 1JJ8C 1IDYA 5GP9A 2L0KA 3G1LA 3BQZA 3RQIA 1HCRA 2HOTA 1TWFJ 2XB0X 1U78A 2ECCA 5C3EJ 2XSDC 2YS9A 4A3FJ 5DS9A 4BBRJ 1OCPA 2ID6A 1LE8A 4XRSG 2YUSA 3BTCA 2DMNA 4AUXA 4A3KJ 1XG1A 1HLVA 1OFCX 3PO2J 4A3GJ 3C2BA 4I76A 5EEAA 1YRNA 3L1PA 4FE7A 4JX5A 3BQYA 2I10A 5F27A 3I4MJ 3PO3J 3S2HJ 3JREA 2EZKA 1MBFA 5EZHA 3A03A 2DA6A 1PUFB 4UUSA 1MBGA 3K2AA 5M5YJ 4AC0A 2P81A 1WPKA 2VPRA 3TW7A 3CMYA 1POGA 5GPCA 1D5YA 2DA4A 3GBGA 4M3FA 3JRDA 1ZR4A 2LY9A 4C3JJ 3WHBA 1QVUA 2WB1N 2DA3A 5IYCJ 2LFBA 5C4JJ 3BR1A 3HEFA 3GTOJ 3QQAA 4JYKA 2N8GA 4A3CJ 3BT9A 1Q1VA 1QVTA 1S7EA 1QPIA 2JMWA 2EBIA 4M3BA 4FCYA 1NK2P 5F0HA 3JRCA 4FTHA 2DMUA 4MO7A 2R5YB 3Q3SA 1BA5A 1RETA 2R7ZJ 3GTMJ 3JRBA 2MGQA 2XGDA 1WH7A 1JTYA 3H3VK 2OF7A 4D7MA 4XRMA 5FKNA 1FTTA 3S14J 1O4XA 2L7MP 1ETQA 2M0CA 1ZGWA 3FISA 2XPVA 2NVQJ 1Y1VJ 4J19A 3LSRA 1RKWA 3IH4A 3OOUA 5C44J 5JLXA 3F0CA 2DMPA 2JN6A 2MW8A 4A3EJ 3FK6A 3S2DJ 2LVSA 4M3EA 5FKMA 1RKTA 1SFOJ 1JT0A 2D5VA 1EF4A 3SJMA 5E3OA 4FISA 2E2HJ 4A93J 5K7HA 3HM5A 4CYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA5 A;  3LSJ A;  1TWH J;  1JKP C;  1T56 A;  2R93 J;  3BG5 A;  1MBE A;  2L7F P;  3A01 A;  3OIO A;  4BY7 J;  3GTL J;  1I6H J;  2XRL A;  2NVY J;  1ENH A;  2JK3 A;  3CQZ J;  5EG0 A;  1K83 J;  5EGO A;  4V2G A;  1H8A C;  3MN2 A;  3HGG A;  1A5J A;  4X1E A;  3BR6 A;  4M6V A;  1LFB A;  3TW6 A;  1WI3 A;  1RES A;  1B72 A;  2JA7 J;  3E7L A;  3OSG A;  1F36 A;  2R92 J;  1TWG J;  2G0E A;  4A3I J;  1DU0 A;  1K61 A;  2X6O A;  3DCF A;  1XC5 A;  4MIM A;  5F04 A;  2Y9Z A;  1APL C;  1FIP A;  2NS7 A;  2CJJ A;  4D5F A;  5M5W J;  1MSE C;  1HDD C;  1WGX A;  1NTC A;  3S1R J;  3GTQ J;  2O7O A;  2JWT A;  3JRA A;  4M3G A;  2LKX A;  1I50 J;  2EZH A;  4EEF G;  2DMT A;  1UHS A;  3B6A A;  2AHQ A;  1W0T A;  2M2E A;  1IGN A;  5FKL A;  2KDZ A;  3M4O J;  1ZTR A;  2M34 A;  3A02 A;  4S0H B;  1HF0 A;  3FIW A;  2EZL A;  1B8I B;  2H8R A;  2JJ7 A;  2CU7 A;  3SDG A;  3WHC A;  3LNQ A;  2OPT A;  2M9H A;  3ZOB A;  4RBO A;  1H89 C;  4I6Z A;  2HOA A;  3ZQG A;  5IP6 A;  5M3F J;  2E2J J;  2ELK A;  1IG7 A;  4BBS J;  2QF7 A;  3BR5 A;  1NK3 P;  4BY1 J;  3S1N J;  2DA1 A;  5IPA A;  1P7I A;  1U8B A;  2R5Z B;  3MKL A;  3BR3 A;  4BKX A;  4D7N A;  1AKH B;  4B3A A;  3PM1 A;  2Y9Y A;  3HDD A;  1TC3 C;  4MFE A;  1DU6 A;  3JRG A;  4GFB A;  3S15 J;  3LOC A;  3LSP A;  3TED A;  5M5X J;  1F43 A;  2WAQ N;  5EF6 A;  1JKR C;  2O9L A;  2LD5 A;  4JX6 A;  2AO9 A;  1MBJ A;  1IRZ A;  3O8G A;  3GTP J;  1LFU P;  3HB9 A;  4UUT A;  4XRS A;  1VI0 A;  4A3L J;  4HNV A;  3HOX J;  4DYQ A;  5FJ8 J;  1IC8 A;  2NVT J;  3GTK J;  3MVP A;  2HXO A;  1ETK A;  2K40 A;  5IOY A;  5FLV A;  4BXX J;  2EZI A;  2VI6 A;  3CDL A;  3I4N J;  1MSF C;  2MG4 A;  1CQT A;  1MBK A;  3FK7 A;  2K9Q A;  3B6C A;  5F0C A;  1ZR2 A;  2WV1 A;  4IHY A;  4FE4 A;  1GVD A;  2HI3 A;  3ZQL A;  2GBY A;  1JKQ C;  4LOC A;  5FLM J;  1QRY A;  1X58 A;  2CQQ A;  1U9O A;  2GM4 A;  1U9N A;  4DW6 A;  1BJZ A;  2DN0 A;  5E3N A;  1JUS A;  4V2F A;  1GDT A;  2IBD A;  2NOG A;  2TRT A;  1FEX A;  1MH3 A;  1H88 C;  3GTJ J;  3HOY J;  5GPA A;  2CRG A;  3ZQH A;  3HKZ N;  4M3D A;  3BR2 A;  4XK4 A;  2Y31 A;  1RPW A;  5J3L A;  3RZD J;  1IUF A;  3HGY A;  4QIW N;  2IAI A;  2L7Z A;  2O8K A;  1T33 A;  2HXI A;  4JX4 A;  2DJN A;  1AKH A;  2PMZ N;  1IV6 A;  1PUF A;  4A3M J;  4DZP A;  1GT0 C;  3NAR A;  1BL0 A;  4MFD A;  1LE8 B;  3HOV J;  1FIA A;  5K7Z A;  5EZG A;  3BG9 A;  4IHV A;  2MSY A;  4D5C A;  2XGE A;  1GV2 A;  2CQX A;  1WCM J;  2CUF A;  1YRN B;  2E19 A;  5C4X J;  3BR0 A;  1JUP A;  2K9N A;  4Y7N J;  3RKQ A;  5J1Y A;  4A3J J;  2NS8 A;  1JKO C;  5EYR A;  2HYJ A;  4UUS B;  4RDU A;  1AU7 A;  2Y0S N;  1MNM C;  2TCT A;  4XIC A;  1ETO A;  3SFI A;  1UMQ A;  1ZQ3 P;  2R5Y A;  1RR7 A;  3FKI J;  1AHD P;  1IJW C;  2HOS A;  2ECB A;  2EQR A;  5J1U A;  2K9S A;  1R9T J;  2FQ4 A;  4JP0 A;  3JRH A;  1TWC J;  4NDL A;  4DYR A;  1TWA J;  1WH5 A;  4A3D J;  2KT0 A;  4B1R A;  5M3M J;  4X6A J;  2EH3 A;  1JTX A;  5FKK A;  4C2M J;  3QPL A;  2H1K A;  4AYB N;  1SAN A;  3ZQI A;  4XID A;  4B4C A;  2VUM J;  3BTJ A;  4DYC A;  5K7F A;  1OCT C;  1ORK A;  5F1J A;  4C3H J;  2LK2 A;  1ETV A;  3HOU J;  3W6V A;  3G1M A;  5F08 A;  1JUM A;  2JA8 J;  2DTZ A;  3RZO J;  1ETY A;  1ZKG A;  1X2N A;  3S17 J;  2LTP A;  1ETX A;  2HDD A;  1ZK8 A;  2JA6 J;  1HDP A;  3TP3 A;  1JJ6 C;  2GLO A;  3BTI A;  5IOZ A;  4MLO A;  1ETW A;  2VKE A;  3Q0V A;  3TP0 A;  2HQ5 A;  4DZJ A;  2LP0 A;  3G1O A;  4G12 A;  2ME0 A;  1FJL A;  3UKG A;  3IH3 A;  3IV5 A;  2RAE A;  4CYC B;  2ID3 A;  1W0U A;  2W48 A;  1VF9 A;  5DTD A;  3A01 B;  1JGG A;  3O8H A;  2QCO A;  5EG0 B;  1OJL A;  1GV5 A;  3JRI A;  5EGO B;  4L5E A;  2XPW A;  1BW6 A;  3D1N I;  3HOZ J;  9ANT A;  2XB5 A;  2DA2 A;  3HBL A;  1Z0X A;  2NVX J;  1IDZ A;  2YU9 J;  1B72 B;  1I3Q J;  1B8I A;  4IHW A;  2DA7 A;  3H0G J;  2LR8 A;  3CCY A;  4QSH A;  5J1R A;  1HOM A;  2FX0 A;  5E3L A;  1X2M A;  1P7J A;  2ME6 A;  1A6I A;  3S1M J;  5HOD A;  4A3B J;  2VKV A;  3QPS A;  2L9R A;  5IP9 J;  1GUU A;  1MBH A;  2R5Z A;  1MH4 A;  2R0Q C;  2Y30 A;  3NAU A;  5FKO A;  3VPR A;  4A69 C;  2LLK A;  3K7A J;  5JLW A;  5F0F A;  4W97 A;  5IYD J;  3M3Y J;  5E3M A;  1XS9 A;  2CUE A;  4IHX A;  3IH2 A;  3BTL A;  4ABZ A;  2X9D A;  3GTG J;  1VND A;  2E1O A;  1E3O C;  3S16 J;  2XGC A;  1G2H A;  4Y52 J;  3S1Q J;  5EDN A;  1Y1W J;  1ITY A;  1BW5 A;  5BNG A;  2X48 A;  1JT6 A;  5IYB J;  2E2I J;  3JRF A;  3ZQC A;  2JA5 J;  5IP7 J;  2XPU A;  3Q0U A;  3JR9 A;  3OSF A;  2ZB9 A;  2B63 J;  2COB A;  4IEJ A;  1UG2 A;  3HOW J;  2Y2Z A;  2M8G X;  4QTR A;  3ZQF A;  3Q0W A;  2FD5 A;  3LSG A;  3BG3 A;  1VFC A;  4C3I J;  4W1U A;  2IEK A;  1FTZ A;  1Z77 A;  2FJ1 A;  3DEW A;  2DMQ A;  1JJ8 C;  1IDY A;  5GP9 A;  2L0K A;  3G1L A;  3BQZ A;  3RQI A;  1HCR A;  2HOT A;  1TWF J;  2XB0 X;  1U78 A;  2ECC A;  5C3E J;  2XSD C;  2YS9 A;  4A3F J;  5DS9 A;  4BBR J;  1OCP A;  2ID6 A;  1LE8 A;  4XRS G;  2YUS A;  3BTC A;  2DMN A;  4AUX A;  4A3K J;  1XG1 A;  1HLV A;  1OFC X;  3PO2 J;  4A3G J;  3C2B A;  4I76 A;  5EEA A;  1YRN A;  3L1P A;  4FE7 A;  4JX5 A;  3BQY A;  2I10 A;  5F27 A;  3I4M J;  3PO3 J;  3S2H J;  3JRE A;  2EZK A;  1MBF A;  5EZH A;  3A03 A;  2DA6 A;  1PUF B;  4UUS A;  1MBG A;  3K2A A;  5M5Y J;  4AC0 A;  2P81 A;  1WPK A;  2VPR A;  3TW7 A;  3CMY A;  1POG A;  5GPC A;  1D5Y A;  2DA4 A;  3GBG A;  4M3F A;  3JRD A;  1ZR4 A;  2LY9 A;  4C3J J;  3WHB A;  1QVU A;  2WB1 N;  2DA3 A;  5IYC J;  2LFB A;  5C4J J;  3BR1 A;  3HEF A;  3GTO J;  3QQA A;  4JYK A;  2N8G A;  4A3C J;  3BT9 A;  1Q1V A;  1QVT A;  1S7E A;  1QPI A;  2JMW A;  2EBI A;  4M3B A;  4FCY A;  1NK2 P;  5F0H A;  3JRC A;  4FTH A;  2DMU A;  4MO7 A;  2R5Y B;  3Q3S A;  1BA5 A;  1RET A;  2R7Z J;  3GTM J;  3JRB A;  2MGQ A;  2XGD A;  1WH7 A;  1JTY A;  3H3V K;  2OF7 A;  4D7M A;  4XRM A;  5FKN A;  1FTT A;  3S14 J;  1O4X A;  2L7M P;  1ETQ A;  2M0C A;  1ZGW A;  3FIS A;  2XPV A;  2NVQ J;  1Y1V J;  4J19 A;  3LSR A;  1RKW A;  3IH4 A;  3OOU A;  5C44 J;  5JLX A;  3F0C A;  2DMP A;  2JN6 A;  2MW8 A;  4A3E J;  3FK6 A;  3S2D J;  2LVS A;  4M3E A;  5FKM A;  1RKT A;  1SFO J;  1JT0 A;  2D5V A;  1EF4 A;  3SJM A;  5E3O A;  4FIS A;  2E2H J;  4A93 J;  5K7H A;  3HM5 A;  4CYC A; 
#chains in the Genus database with same CATH topology
 2HOE A;  1SAU A;  3OR1 C;  1IV8 A;  3BG5 A;  3A01 A;  1I6H J;  1IN6 A;  3QOD A;  3U21 A;  4ITV A;  3CUQ A;  5LFA A;  2DK8 A;  2DFI A;  4F92 B;  1K83 J;  2F4M B;  3RPQ A;  4ZYE A;  3K70 C;  3JSO A;  4CCJ A;  5CYV A;  1H8A C;  1I1S A;  3BR6 A;  4HW0 A;  3VFZ A;  3RTR A;  1MMG A;  4XNF A;  1B9M A;  1ZG3 A;  2BHZ A;  3K4L A;  1B72 A;  2JA7 J;  3E7L A;  4I01 A;  1GVJ A;  1KZH A;  3WTV C;  2MD0 A;  2RNJ A;  1DU0 A;  5IT3 A;  1ZH5 A;  2HDC A;  2HYF A;  3A4C A;  2XUB A;  4G9Y A;  5F04 A;  1APL C;  1D0Z A;  1U0J A;  2CJJ A;  1HDD C;  3OYI A;  1VTN C;  1WGX A;  5H6Q A;  1NTC A;  5TGT A;  2LKX A;  3OS2 A;  1YOV B;  2DMT A;  3TBI A;  4N9I A;  3B6A A;  4PUS A;  1W0T A;  2ETH A;  3KP2 A;  2KDZ A;  2M34 A;  5AON A;  1B8I B;  1T6S A;  1JGS A;  2H8R A;  1E17 A;  4IXA A;  2CU7 A;  3V8K A;  3WHC A;  2M5W A;  2OPT A;  3H92 A;  2L9V A;  5TJJ A;  1Q1H A;  4UV9 A;  2EFP A;  1H89 C;  2Y0S A;  3ZQG A;  3HL2 A;  2QF7 A;  4YIF A;  1MJA A;  2H27 A;  2RQQ A;  2R5Z B;  1MJB A;  3BR3 A;  1IW7 F;  1U6G A;  2QQ8 A;  3L2R A;  2PJP A;  2CQK A;  3TO9 A;  3RIR A;  3PM1 A;  1U2W A;  1MIJ A;  1DU6 A;  2IGM A;  4EJO A;  1Z7L A;  2OCC H;  4XLP F;  2FSW A;  2RV8 A;  3DWL E;  1P6R A;  1STZ A;  1IN5 A;  3LSP A;  3TED A;  5M5X J;  1F43 A;  5EF6 A;  2EFN A;  2LKS A;  3J7Y J;  1TP4 A;  2LD5 A;  1MBJ A;  4M9X A;  2A05 A;  1X1D A;  2E1M C;  3O8G A;  1LFU P;  3J7A Y;  4UUT A;  4EJT A;  4XRS A;  1VI0 A;  2LF8 A;  5D6F A;  2W24 A;  4U0W A;  2FRH A;  2KRH A;  4PJ0 C;  4M71 A;  4BAY A;  2RN7 A;  3TDZ C;  2PI0 A;  2R7V A;  2KPM A;  1CQT A;  3FK7 A;  3B6C A;  1BR4 A;  3MKW B;  3PL8 A;  3ASN H;  2QUF A;  3DV8 A;  4FE4 A;  1S9H A;  3V7C A;  3FHN A;  1XB4 A;  2Z3Y A;  3ZQL A;  5GTH C;  1TL8 A;  1JKQ C;  4LOC A;  3F23 A;  2O5R A;  1YO5 C;  3RCO A;  1N78 A;  4ZDO A;  1MGT A;  1BC8 C;  1U9O A;  2GM4 A;  5HLT A;  3EUA A;  2IS4 A;  2DXI A;  2XRO A;  2BVM A;  1YTY A;  1XD7 A;  2KHM A;  1FEX A;  3E5X A;  3IC7 A;  4HEA 2;  4G94 A;  2OZU A;  3U9G A;  4M3D A;  2X6Y A;  1Y39 A;  2L7K A;  3H35 A;  4BH9 A;  4MEX F;  2HXI A;  4JX4 A;  1AKH A;  5HOO A;  2PMZ N;  1IV6 A;  1TNT A;  2QQA A;  3MD2 A;  1BL0 A;  1UCR A;  4IRG A;  4XOR A;  1LE8 B;  5GAG J;  3A1Y A;  4O5V A;  3S32 A;  2J5O A;  1YFH A;  3BG9 A;  3DKX A;  2JUC A;  1HKS A;  1NHA A;  4C9Y A;  3SZT A;  5K5O A;  1GV2 A;  2CUF A;  3WU2 C;  1HKQ A;  1VQO I;  2YPR A;  3IKT A;  3SFZ A;  2MBF A;  2DW4 A;  4H4K C;  4Y7N J;  1O7L A;  5J1Y A;  4P5O A;  3F72 A;  5L3E A;  3M8F A;  1TQM A;  2GIV A;  2K9M A;  2PFB A;  2HYJ A;  5HDK A;  3OYH A;  5HS8 A;  1WQ2 A;  4RDU A;  1IXS B;  1UMQ A;  3AL0 B;  5DM6 F;  4GDF A;  1RR7 A;  1TTY A;  4EM1 A;  3Q9S A;  1IJW C;  4GYI A;  2HOS A;  2KIU A;  4II2 A;  3CCR I;  5TIS C;  2GAU A;  2FQ4 A;  4HX7 A;  1OCZ H;  2XDV A;  3QPH A;  2DFF A;  2KJB A;  2OU2 A;  4A3D J;  2QBY B;  2A68 F;  1ZYR F;  1SVO A;  2KT0 A;  4WXD A;  4N4N B;  2M87 A;  1O3R A;  1QBJ A;  4C2M J;  3QU3 A;  2GZW A;  4UHT A;  1P4X A;  4CH7 A;  1SAN A;  3ZQI A;  1FSH A;  2DDA A;  2IS2 A;  2P8T A;  4ENN A;  3S93 A;  1PVE A;  4DYC A;  5K7F A;  1OCT C;  2DPU A;  2LK2 A;  1ETV A;  2CW0 F;  3I9V 2;  3P9I A;  3KYD B;  1GLN A;  1QHH D;  1G3S A;  3K4K A;  2MH9 A;  5D5W B;  3N97 A;  2VJ5 A;  1JUM A;  1SFU A;  1A31 A;  4BHP A;  3FBN B;  2L5Q A;  2DTZ A;  1SD7 A;  4ZYA A;  3TO7 A;  2E36 A;  5HVQ C;  1FMV A;  3GEZ A;  1SAX A;  2HR3 A;  2HDD A;  3SEQ A;  3L2V A;  2E7W A;  2FBH A;  4K2E A;  1RRJ A;  2AS5 F;  4CO8 A;  1FLI A;  3TP3 A;  2K27 A;  2CG4 A;  4BEH B;  2X1D A;  1HC8 A;  3P9C A;  2GXG A;  4BE2 A;  4H0E A;  2HQ5 A;  2IXS A;  2LP0 A;  3S3O A;  2QKL B;  1W36 D;  2RQP A;  4EGZ A;  4XMY A;  4CZZ A;  5K5R A;  4NNJ A;  2W48 A;  1VF9 A;  5DTD A;  3U1D A;  3FHZ A;  3DLL F;  1JGG A;  2QCO A;  4M9S A;  2M45 A;  5EG0 B;  4E7J A;  1OJL A;  1GV5 A;  1X1B A;  2BOL A;  4RLF A;  5EGO B;  1FMW A;  4MTD A;  2BY2 A;  3F6V A;  2D45 A;  3IWF A;  3E97 A;  2UV1 A;  4XSZ F;  3ROU A;  4B3X A;  5HLG A;  1OIS A;  1DP7 P;  3GFI A;  1T08 B;  2BBY A;  3H36 A;  2E5Z A;  5LBQ A;  4NC8 A;  2YU9 J;  5L3B A;  3BCB A;  4IHW A;  1LVA A;  2Y48 A;  2EV6 A;  2X6X A;  3SEZ A;  4QSH A;  1IRF A;  3J80 K;  1YW8 A;  2EIM H;  4KIB A;  4F55 A;  2FX0 A;  3V4G A;  1F1Z A;  2YSR A;  2BV6 A;  2ME6 A;  4OIQ F;  3R60 A;  1PUE E;  4LLG F;  3S1M J;  1J09 A;  3BP8 A;  3JSP A;  3BC8 A;  2L9R A;  2VC1 A;  2HVR A;  5LGN A;  3HTU A;  2VB6 A;  2XF5 A;  4AD9 A;  2EJR A;  2HVS A;  1GUU A;  2XGX A;  2HNH A;  2WB1 A;  4HDV A;  1WI9 A;  3VPR A;  1AWC A;  4I02 A;  4EJW A;  3ZRG A;  5CVR A;  1F5T A;  2KRF A;  3DXJ F;  4UVA A;  3I3L A;  3FDY A;  5JLW A;  2H6C A;  2OTL I;  2QKM B;  2JPC A;  5IYD J;  2GA2 A;  3QYF A;  3PFY A;  1F4K A;  4DNC A;  3CCM I;  4IHX A;  1BM9 A;  1SD6 A;  4A0Y A;  2ESH A;  4A2U A;  4AWX B;  2F2E A;  1Y0N A;  3KYC B;  1B6A A;  3ABL H;  3ABT A;  1QNT A;  1TQI A;  2KIF A;  4RAF A;  5CLS A;  4XOT A;  5BNG A;  2PX9 A;  1JT6 A;  1FT9 A;  2E2I J;  2DFH A;  3OY9 A;  4XQF A;  4PGH A;  5FFX A;  1Z67 A;  3W3C A;  2DK5 A;  2D2W A;  2W00 A;  2G7H A;  3FXR A;  3KLO A;  2COB A;  4IEJ A;  1GHC A;  1UG2 A;  3HOW J;  3AG1 H;  2R3S A;  2M8G X;  3FXK A;  2DYR H;  2GQQ A;  4HV6 A;  3HRS A;  1VFC A;  3LSM A;  3FX3 A;  4Z6Y A;  2UWM A;  1FTZ A;  3KEO A;  5DD8 A;  2OJE D;  2FJ1 A;  2GXA A;  2P5L C;  1V5F A;  2ZCW A;  1CF7 B;  1W5C C;  2L0K A;  3CCL I;  2IA2 A;  2O3F A;  2VLA A;  2QEX I;  4KUM A;  4S04 A;  1A6Q A;  4Q48 A;  1IZ1 A;  2GWR A;  2O03 A;  3MCZ A;  3WGI A;  5DS9 A;  4BBR J;  4ESF A;  1LDJ A;  3CD6 I;  2BW3 A;  1YS6 A;  3HUG B;  4HZF A;  4I2O A;  4XM3 A;  2I8D A;  2IVM A;  2ID6 A;  2VJJ A;  3BTC A;  2A6T A;  1XG1 A;  3ABM H;  4A3K J;  2MC3 A;  2VQC A;  2IGK A;  1L0O C;  4HPQ A;  3LSH A;  3IAM 2;  4I76 A;  1HW2 A;  3KP6 A;  1YRN A;  3F3X A;  1R49 A;  2ZJ2 A;  3BQY A;  1D5V A;  2I10 A;  3I4M J;  3R0J A;  2EIK H;  2O0Y A;  3A03 A;  3EUH C;  1QU3 A;  1LEB A;  3CJQ B;  3HJE A;  1BR1 A;  2BYV E;  1MZB A;  3K2A A;  4KT6 A;  5M5Y J;  4YG2 F;  2ZNZ A;  2KLO A;  1MNE A;  3S2W A;  3W6J B;  3TW7 A;  3QU6 A;  1VQP I;  1POG A;  4BJT A;  2OCE A;  5BPD A;  5D5U B;  3BCA A;  1X19 A;  2DOF A;  2QZ8 A;  1R5I D;  3GWZ A;  3I53 A;  2UZK A;  1K4S A;  3M1E A;  2DO7 A;  2OUM A;  4IX7 A;  1MMA A;  3QWL A;  3OYL A;  2KZV A;  4A0X A;  1QVT A;  1S7E A;  1QPI A;  2M8E A;  2EBI A;  1RZ4 A;  1P92 A;  1XDU A;  4I09 A;  3G3Z A;  1E2X A;  5CQG A;  4QPQ A;  5JVT A;  4L9N A;  1B9N A;  2DMU A;  4RAG A;  2R5Y B;  2ADU A;  2FBK A;  3KZZ A;  1JE8 A;  1RET A;  1WJE A;  5L3F A;  3WTY C;  2HKX A;  3W6K B;  3H3V K;  4XRM A;  1CGP A;  5HDG A;  3PIO F;  1YG2 A;  2WAF A;  1NG7 A;  2Z9O A;  3FBI B;  1ZGW A;  4AM3 A;  1YHQ I;  4C2T A;  1FYK A;  1Z91 A;  3KP4 A;  3GFM A;  1UHW A;  1RKW A;  2F4I A;  3IH4 A;  2ZJR F;  4ZC3 A;  3ZQ7 A;  2A07 F;  3F0C A;  4R1H A;  1BR2 A;  2JN6 A;  3R4K A;  2V9V A;  1ZRF A;  3S2D J;  5FKM A;  1TQP A;  1RKT A;  3CF5 F;  1JT0 A;  5FLX K;  1EF4 A;  2WV0 A;  3P5J A;  3F8F A;  4FIS A;  5E3O A;  3QYE A;  5K7H A;  4CYC A;  1TWH J;  1MBE A;  3ZGK A;  2L7F P;  3GTL J;  3DPT A;  3OIO A;  1FC3 A;  1ENH A;  2BHY A;  1U5T C;  2JK3 A;  3CQZ J;  4R79 A;  5ICC A;  3Q5F A;  4V2G A;  3MN2 A;  4X1E A;  2HFH A;  4UVB A;  5A2Q K;  3LA2 A;  1R23 A;  4E7Z A;  4M6V A;  3DQV C;  4F52 A;  1O3T A;  2P5V A;  2R92 J;  3FXM A;  1R5G A;  2G0E A;  2B7E A;  2XAS A;  2MLG A;  1K61 A;  1XC5 A;  5LHH A;  2Y9Z A;  3GZ6 A;  3RYP A;  1FIP A;  4CIC A;  2NS7 A;  5FGM A;  3GXO A;  3CC2 I;  4PSW A;  3FXU A;  4N9H A;  3GTQ J;  3F21 A;  2R7T A;  2JWT A;  3JRA A;  1Z21 A;  2PMH A;  4M3G A;  1T38 A;  2ELJ A;  1I5Z A;  5J47 A;  3ZMU A;  4AU7 A;  3WU1 B;  5AIQ A;  1ZTR A;  4S0H B;  4F7Z A;  4EM0 B;  4P1W A;  1K7A A;  2JJ7 A;  3LNQ A;  1XCB A;  2KIQ A;  2M9H A;  1YX3 A;  4RBO A;  3T8R A;  1FYL A;  3Q9V A;  1ZGA A;  2HOA A;  2E2J J;  1KQ8 A;  2HQA A;  3DPU A;  2ZKZ A;  1IG7 A;  4IHT A;  2Z33 A;  3E5Q A;  1WHU A;  4FQG A;  5IPA A;  3WTZ A;  2DOE A;  4Y4R A;  3MKL A;  2YR2 A;  4D7N A;  5J4Y A;  4OIP F;  3DTI A;  3M8J A;  5FO5 A;  1R00 A;  2Y9Y A;  1HQC A;  3HDD A;  1TC3 C;  5HNF A;  5DCF A;  3E6D A;  3WTU C;  2LBF A;  2CS3 A;  3CDI A;  4AYB A;  4AIJ A;  4U7D A;  3F9K A;  1J75 A;  3VDX A;  2DBB A;  2WAQ N;  2C6Y A;  2FE3 A;  4UV8 A;  1JKR C;  4BNC A;  3TMO A;  4JX6 A;  4LB6 B;  1ZRC A;  1YIT I;  3HB9 A;  3D0S A;  4YIR X;  4D9J A;  5KAI C;  4DYQ A;  5FJ8 J;  3OL3 A;  1FY7 A;  1IN8 A;  3CCQ I;  3GTK J;  1HW5 A;  4L9J A;  1NG6 A;  3MVP A;  5B1A H;  2IS6 A;  3EUH A;  1JHF A;  4EGY A;  4BXX J;  2EZI A;  3I4N J;  3GZ5 A;  1MSF C;  2M4K A;  2CFX A;  2RVC A;  5F0C A;  2KIS A;  4IHY A;  3MKZ A;  4KIS A;  3IRR A;  2QYO A;  2JQ7 A;  2HI3 A;  2GBY A;  1D8K A;  1OKR A;  3OYE A;  1K79 A;  1U9N A;  4IQ4 A;  2EK5 A;  3FF5 A;  4V2F A;  2GXB A;  4EVI A;  2IBD A;  2JVG A;  3GLL A;  2NOG A;  3CUO A;  3HPH A;  2Q1Z B;  3GTJ J;  4NBQ A;  3DU5 A;  2MFZ A;  3HOY J;  3O6B B;  1HKT A;  4B8X A;  4JK1 X;  1XTA A;  1IUF A;  5J8C A;  2O8K A;  2VBY A;  4XON A;  3VOD A;  2D1V A;  1XN7 A;  3N05 A;  1MND A;  1FIA A;  3DTK A;  5E8I A;  1XGM A;  2X0L A;  4XLA A;  5HLI A;  3T0Y A;  4IHV A;  2B0L A;  1V5E A;  3K4J A;  4D5C A;  2XGE A;  5DCM B;  1D3Y A;  5F6F A;  1WCM J;  3FZV A;  2ZFU A;  4IRI A;  3KYL A;  2E19 A;  1RI7 A;  1QO0 D;  2NOJ B;  4RGR A;  1JUP A;  4A3J J;  4MTE A;  4KJZ A;  2PG4 A;  1OCO H;  1KON A;  5DUI A;  2CW7 A;  4HRI A;  1VQM I;  3SHF A;  3TGN A;  1XDS A;  1ZGJ A;  4G7H F;  3SFI A;  4L5I A;  4XN0 A;  3TOB A;  4BJ6 C;  2DU9 A;  3H0D A;  1RIO H;  1L3L A;  2VXD A;  3HC7 A;  3IRQ A;  1FPQ A;  4EQQ A;  2DDB A;  2HGC A;  3ZPL A;  2NS0 A;  3K1N A;  4KNY A;  3JRH A;  1PP8 F;  1U5T A;  4AIK A;  4NDL A;  4F93 B;  3I56 I;  5E17 F;  1TWA J;  1WH5 A;  1T0F C;  2HDW A;  1IXR C;  3ZN0 A;  4ASN A;  4OAY A;  1JTX A;  1I27 A;  2R7F A;  5FKK A;  2KP6 A;  3QPL A;  4BXU A;  4OMZ A;  5IT9 Z;  3K6G A;  2BVL A;  2VKH A;  1BIA A;  4G6D A;  1UEL B;  3IHU A;  2VJ4 A;  3ZQQ A;  4C3H J;  2ZFW A;  2A3S A;  4IQJ A;  1EV7 A;  4J00 A;  3VYT B;  3RJP A;  2K85 A;  3I5U A;  3RQ4 A;  2RRE A;  2NVU B;  4U0V A;  3I58 A;  2R7Q A;  4IO9 F;  4WXC A;  1ZKG A;  3LA7 A;  5LD2 C;  3S17 J;  2XHK A;  3FXL A;  1S72 I;  2WWY A;  1IO2 A;  4CYD A;  2JA6 J;  2FOK A;  3KZY A;  4E6K G;  2LRD A;  2GLO A;  5JR3 A;  1KU2 A;  3S3M A;  4KMU X;  4ESJ A;  3H5N A;  1GXQ A;  1S6L A;  3QAH A;  1ETW A;  2VKE A;  3SXY A;  5ICE A;  2CGP A;  2FA5 A;  4AVZ A;  3KP7 A;  4PSX A;  2ME0 A;  3LSI A;  3CCU I;  2JTV A;  4FHT A;  4U0Y A;  1SEU A;  4IF4 A;  3MZH A;  4UUV A;  3KEY A;  4HYE A;  3EYI A;  1BJA A;  2PEX A;  2ID3 A;  2LSO A;  1W0U A;  3I64 A;  3A01 B;  1FSE A;  4Q47 A;  3ECO A;  3CUQ B;  1BN5 A;  1T39 A;  2QQ9 A;  5JI6 A;  4BAC A;  2CSO A;  2BXY A;  1WJF A;  2EA4 A;  4O3M A;  4P9U A;  4Y15 A;  2EWN A;  3D1N I;  1RUO A;  9ANT A;  4LJZ F;  1KU3 A;  5HNH A;  4RGS A;  1Z0X A;  2NVX J;  2QBY A;  1IDZ A;  4LG3 A;  1FOX A;  1B72 B;  1I3Q J;  2CO5 A;  2K7L A;  2M30 A;  2LR8 A;  3H0G J;  4BDZ A;  1HOM A;  1XGO A;  2VQH A;  2X1C A;  1X2M A;  5LGT A;  1KA8 A;  2HZD A;  3RPU A;  1P7J A;  4XR6 A;  1LKX A;  2BY1 A;  1Z6R A;  3IUO A;  3E6C C;  3QPS A;  1S3J A;  3WTW C;  4I0B A;  1ON1 A;  4I0A A;  4PJL A;  4EM2 A;  1A35 A;  2WAQ A;  4XLF A;  1T8I A;  2R0Q C;  3SDB A;  2Y30 A;  3NAU A;  3U2R A;  3WE2 A;  2K4B A;  1UJ8 A;  5D6E A;  1D0Y A;  2LLK A;  4OAZ A;  2UXN A;  2CW8 A;  1XMX A;  4XLC A;  1LEA A;  5HDN A;  4HA8 A;  4W97 A;  4G7Z F;  4MGR A;  1W5T A;  1LDK B;  1XS9 A;  1O57 A;  4ABZ A;  2X9D A;  5CVV A;  1VND A;  2I5U A;  1ZRD A;  3S16 J;  2XKP A;  4B48 A;  3I55 I;  2XGC A;  3DKY A;  3CMM A;  4P9F A;  1G2H A;  2V1D A;  1IRG A;  1EH6 A;  1ZG5 A;  2XF7 A;  2G9W A;  1ITY A;  2MD5 A;  2ELH A;  5ED4 A;  1BW5 A;  3MMY B;  2F5V A;  1BOA A;  3I71 A;  3J81 Z;  3MEX A;  2NYX A;  2ZO4 A;  4CXF A;  1VQL I;  2E1N A;  2LY1 A;  3ZQC A;  2JA5 J;  3WOD F;  3Q0U A;  3JR9 A;  3COA C;  3OSF A;  4XKV A;  4ZZL A;  4BQN A;  3RYR A;  1WSU A;  4A6E A;  3E6B A;  5LRS A;  2KIM A;  2VE8 A;  2B63 J;  5H20 A;  2BY0 A;  1Y8R B;  2RKH A;  5ILV A;  4GXO A;  1PP7 U;  2DPD A;  3CC4 I;  1IUY A;  1MMN A;  2FD5 A;  4XOP A;  5KVR A;  2Z2S B;  1P2F A;  1BI1 A;  3D5R C;  4C3I J;  4ON0 A;  5FRM A;  3DEW A;  5JHF A;  4BGD A;  1TZL A;  1YIJ I;  1JJ8 C;  4IL6 C;  3T8T A;  3DLA A;  5B1B H;  3G1L A;  2DQR A;  2D1H A;  2X4H A;  4LB5 A;  2HOT A;  1F9N A;  2XB0 X;  1U78 A;  1I3A A;  4ENJ A;  4HF0 A;  1SMY F;  5AIP A;  2EA2 A;  1KYZ A;  1UFM A;  2BZT A;  2YS9 A;  1OPC A;  2A61 A;  3HXL A;  4V19 K;  1FBU A;  3GFJ A;  2BGC A;  1IN4 A;  4DGW B;  4XRS G;  5ERI A;  1UST A;  2HYG D;  5J8F A;  1XSX A;  3H3Z A;  2LH9 A;  5GAD J;  1Z3X A;  4ETS A;  2L9N A;  1T0F A;  3L1P A;  4TV7 A;  4FE7 A;  2DQL A;  1EJ9 A;  2IPQ X;  4R8H A;  5F27 A;  3PO3 J;  2V9K A;  2EIN H;  3JRE A;  2EZK A;  5EZH A;  2NNY A;  3CCV I;  3OR2 C;  1MKM A;  1X4O A;  5H6R A;  4UUS A;  1FYM A;  2CV1 A;  3CC7 I;  4QPO A;  1V5G A;  1J9I A;  2E1C A;  1YE9 A;  4ZDL A;  2VPR A;  3CMY A;  4BE0 A;  5GPC A;  1WKM A;  1ZLJ A;  4M3F A;  4HNU A;  3KPH A;  1G3Y A;  3JAM Z;  3BZ6 A;  5IYC J;  4NC6 A;  2ZME C;  5BS6 A;  2DOD A;  4LGW A;  1MDM A;  2GA1 A;  3HEF A;  3IWZ A;  3GTO J;  3QQA A;  4JYK A;  4HX4 A;  4J01 A;  4M6X A;  2OV7 A;  4RM3 A;  3TQN A;  2IA1 A;  1X3W B;  2IS1 A;  2JMW A;  3ZCO A;  4M3B A;  3CP8 A;  1O7F A;  3BG7 A;  3BWG A;  4Y17 A;  1D8J A;  1NK2 P;  4IZZ A;  1W7P A;  4FTH A;  4MO7 A;  3PNT A;  3HHH A;  1YJ9 I;  1EKE A;  1YLF A;  3Q3S A;  1KYW A;  3GTM J;  4WXH A;  4XBF A;  3CDH A;  3JRB A;  2DJI A;  2MGQ A;  2XAQ A;  2XGD A;  3WTS C;  6PAX A;  1WH7 A;  2CH0 A;  1JTY A;  3OIQ A;  4D7M A;  1I39 A;  1HA8 A;  4JOM A;  1X3U A;  3WTT C;  4BYY A;  3S14 J;  1O4X A;  5IY5 H;  2NVQ J;  4AID A;  3TOA A;  1Z3Y A;  2ZNY A;  1DPU A;  4Y13 A;  2LC2 A;  3HOS A;  1IAW A;  5C44 J;  2J5P A;  3CJT B;  3KE2 A;  3ZMZ A;  2BXZ A;  2VT2 A;  2MW8 A;  4CCN A;  4A3E J;  3EET A;  2FOW A;  1DDN A;  3FK6 A;  4BXF A;  1IRX A;  3PNV A;  2DTR A;  2OQG A;  2QVO A;  1K78 B;  1SFO J;  3GZN B;  5E1W A;  4ZH4 F;  2IJL A;  4A93 J;  2NAZ A;  2A6E F;  4L5J A;  2HVQ A;  4X6A J;  3DBL B;  3E0J B;  1VQ4 I;  4Y3O A;  3ZR8 X;  2DA5 A;  2VQL A;  3VB2 A;  4BHC A;  1BIB A;  1T56 A;  4PJM A;  1JKP C;  2R93 J;  3K10 A;  1VZ0 A;  4BY7 J;  2WY8 Q;  5FD6 A;  2XRL A;  4YEJ A;  2F5E A;  1Z9C A;  3V7R A;  1OR7 A;  4HX8 A;  1B59 A;  3ABK H;  3HGG A;  3W2W A;  4M72 A;  1FP1 D;  2TDX A;  3TW6 A;  1TNS A;  1WI3 A;  1BC7 C;  4FT8 A;  4NUB A;  1I1G A;  4ZTJ A;  1S8N A;  2VBW A;  1YX5 A;  1F36 A;  2M7B A;  1R5H A;  1TWG J;  4KYW A;  4A3I J;  1WJ5 A;  2PMZ A;  3ASO H;  4B47 A;  4ZYD A;  1ZRE A;  1P9Q C;  4WX9 A;  3E6M A;  3LA3 A;  4MIM A;  5ILS A;  1QHG A;  3KP5 A;  1MSE C;  5FB2 A;  2VT3 A;  3OS1 A;  2B9S A;  1V55 H;  4HSR A;  2EZH A;  3RKW A;  4EEF G;  3K70 D;  4XLN F;  4MEY F;  2F5C A;  3M1C A;  4RA2 A;  1UHS A;  1BI0 A;  3OYJ A;  3N4M A;  2FF4 A;  2FXA A;  1IGN A;  1G3T A;  1V54 H;  3K1M A;  5FKL A;  1VQ5 I;  1HF0 A;  2FQ3 A;  4RGX A;  3FXQ A;  3GX4 X;  1O3S A;  2ISY A;  1ZAO A;  3G2B A;  5JHU A;  4I6Z A;  2WBM A;  3OYB A;  4EMS A;  5M3F J;  2E1M B;  4BBS J;  1NK3 P;  1BOB A;  2QEN A;  3FM5 A;  4L9V A;  3C7J A;  2CUZ A;  3ELK A;  3W2V A;  3FXO A;  3CCJ I;  1YI2 I;  1U8B A;  1FOY A;  2XSJ C;  4BKX A;  3QYB A;  5KNL A;  3CTA A;  4B3A A;  1TT0 A;  3X2Q H;  3OYF A;  4MFE A;  3HRT A;  2W1O A;  3JRG A;  4FX0 A;  2MLK A;  1YJW I;  2PQ8 A;  5CJ9 A;  3S15 J;  4I99 C;  1KQ9 A;  3LOC A;  3JTG A;  2VOD A;  3DFG A;  3HSE A;  3FMR A;  1ZHF A;  1N75 A;  3E5U A;  3NQO A;  4ENK A;  3EUK L;  4BUP A;  3I59 A;  3AAF A;  2O9L A;  3R0A A;  3VYU B;  1UG0 A;  1IRZ A;  1M1E B;  1VQ9 I;  3GTP J;  2L2O A;  4DQ2 A;  1QZE A;  4HNV A;  1RR8 C;  3HOX J;  3CLO A;  2QLZ A;  4NB5 A;  4DBR A;  1IC8 A;  1WFX A;  4YFK F;  3W2A A;  2NVT J;  1OQY A;  1ETK A;  2K40 A;  5IOY A;  5FLV A;  2DLL A;  3BZK A;  3CDL A;  4U87 A;  4M6Y A;  1OYW A;  2MG4 A;  3P7N A;  1MBK A;  3G73 A;  4G7O F;  1RC9 A;  1TLH B;  2OBP A;  4KMF A;  2EV5 A;  1SFE A;  2FU4 A;  2FMY A;  2R7O A;  3G6E I;  2DCE A;  4IOC F;  5FLM J;  1QRY A;  2JZY A;  3OS0 A;  4LLL A;  2ZXJ A;  5TRD A;  2ZME A;  1Z7U A;  2PMU A;  4CGZ A;  3ZMV A;  2DN0 A;  1JUS A;  1GDT A;  2V26 A;  1A04 A;  2TRT A;  2P0W A;  4LG0 A;  2AQE A;  2DT7 B;  2K3P A;  4NQW B;  5EEH A;  1SD5 A;  2CRG A;  1HBX G;  3ZQH A;  3BR2 A;  2WA0 A;  5J3L A;  1RPW A;  3C18 A;  2A5Y B;  3HGY A;  3JCU C;  4QIW N;  2L7Z A;  2XRN A;  4RB0 A;  4P96 A;  3GLX A;  3LQQ A;  4N4O B;  2DJN A;  1PUF A;  4A3M J;  2BW3 B;  1GT0 C;  1MW7 A;  5LLQ A;  3GME A;  2HQR A;  4A12 A;  2X6W A;  3LAJ A;  1R7J A;  1R71 A;  4LD5 A;  1HSJ A;  4OOI A;  3D5L A;  5K7Z A;  2K3F A;  4ZYH A;  2L02 A;  4PZJ A;  3ML6 A;  5EZG A;  4KN4 X;  1OLT A;  2IT0 A;  2MSY A;  5K1Y A;  2L4M A;  2CQX A;  4X0G A;  1YRN B;  1EH8 A;  3BRO A;  5C4X J;  2NNN A;  2JUG A;  1REP C;  1C0W A;  2K9N A;  3RKQ A;  4NC7 A;  2NS8 A;  4DBQ A;  1T2K A;  2MA3 A;  2FNA A;  3L00 A;  5EYR A;  4HOB A;  1EA3 A;  1IN7 A;  3L2W A;  4LLN A;  2GOX B;  2FEZ A;  2V79 A;  2OTJ I;  1FWZ A;  2EIL H;  2Y0S N;  1MNM C;  2CWE A;  5EJC A;  4XIC A;  3MQ0 A;  2OZ6 A;  4GYG A;  3M9A A;  2VE9 A;  3FKI J;  1P4W A;  3OYA A;  2EQR A;  5J1U A;  1EH7 A;  4O6J A;  5KCM A;  1D1C A;  2E34 A;  3CZ6 A;  4HQM A;  1S5L C;  3EPZ A;  1FP2 A;  3DU6 A;  4XLE A;  3KCC A;  4B43 A;  4HLY A;  4DYR A;  4GCV A;  3PQK A;  5J4V A;  4XKB A;  3ULQ B;  4B1R A;  3TL4 X;  2IRF G;  2IGO A;  2WTE A;  3PIP F;  2H1K A;  2KJC A;  4RAY A;  2VUM J;  2JA2 A;  4LK1 F;  3GYH X;  3LSK A;  1ORK A;  3ZXS A;  4JBA A;  2DYS H;  2JRM A;  4CDG A;  1W36 C;  2EIJ H;  2L4A A;  3DBR B;  3W6V A;  3AL0 C;  3G1M A;  2PJR B;  1LPQ A;  3I0T A;  2X1E A;  1VQN I;  3HSF A;  2JA8 J;  1SVL A;  2KL4 A;  5DD4 A;  3RZO J;  1ETY A;  5E18 F;  2DT6 A;  1ZEL A;  2Z1D A;  2LTP A;  1ZK8 A;  5DCM A;  2M4G A;  3ECH A;  2IW5 A;  5ICG A;  1HDP A;  2KKO A;  1JJ6 C;  1R22 A;  3K1P A;  3ZMT A;  3BG6 A;  1KQ0 A;  4M74 A;  5J40 A;  1LVK A;  3TO6 A;  1V4R A;  2VAS A;  4DZJ A;  3OYC A;  3UKG A;  2LG4 A;  2LDU A;  3AFH A;  4MHG A;  2RAE A;  3IV5 A;  4CYC B;  2L9S A;  3F8C A;  4HDU A;  1ACI A;  3CCS I;  2LF7 A;  1HW1 A;  4S05 A;  3O8H A;  2IA0 A;  2LRE A;  2K86 A;  2R7U A;  2O6G E;  2V1U A;  4U88 A;  3WG7 H;  5F1R A;  2HTJ A;  2VIX A;  1H0M A;  2XB5 A;  4G8X A;  2XAG A;  3RI4 A;  4IVN A;  3SQN A;  3TDU C;  1B8I A;  1SMT A;  3CJR B;  2DA7 A;  3GFL A;  2V1N A;  3CCY A;  5J1R A;  1E3P A;  2QA4 I;  5KHD A;  3NWS A;  1A6I A;  4PJN A;  5EEG A;  2EPF A;  4IPA A;  5HOD A;  1WZ2 A;  5J6X A;  4A3B J;  1TW3 A;  1S7O A;  2XAJ A;  3CMA I;  1LQ1 A;  2V1X A;  2Q8K A;  1MBH A;  4LFU A;  4PK4 A;  2R5Z A;  1MH4 A;  3KIO A;  4IOA F;  3E3V A;  4ZYG A;  2K02 A;  1BBY A;  5FKO A;  4A69 C;  4HAM A;  2VPL A;  4UXN A;  3K7A J;  4ZJZ A;  4G6Q A;  3M3Y J;  1FBQ A;  2WAD A;  5HS7 A;  3IH2 A;  4LK0 F;  3MZ8 A;  3VSK A;  3GTG J;  2E1O A;  2EFW A;  3VYR B;  4YFX F;  1E0E A;  5D8K B;  3JW4 A;  3S1Q J;  1Y1W J;  3V8J A;  5D4S A;  5L3G A;  2JRT A;  2VN2 A;  2X48 A;  1WVR A;  2XAU A;  5IYB J;  1YJN I;  3JRF A;  4HV5 A;  3VOE A;  2XF6 A;  4XRF A;  3DBH B;  2XPU A;  2LBF B;  4BHB A;  3A0B C;  2RDP A;  4U7B A;  3QOP A;  2ESN A;  2CYY A;  2ZB9 A;  1X1P A;  3ZMD A;  3UR3 C;  4CCO A;  3GVA A;  2Y69 H;  2L54 A;  3LSG A;  5E20 A;  4OWR B;  1XSD A;  2W57 A;  2LKP A;  2RGV A;  4W1U A;  4QLC U;  4IRH A;  2PLY A;  2CQ7 A;  2WY7 Q;  4CA0 A;  1Z77 A;  1D0X A;  1IDY A;  2YX7 A;  2VON A;  4B09 A;  5GP9 A;  4KA4 A;  2JVH A;  1B4A A;  4E7I A;  2JPB A;  1WJB A;  2F5F A;  2FNP A;  3BQZ A;  4OIN F;  3RQI A;  4BDY A;  1HXD A;  2K5C A;  1FZP B;  2XAF A;  4EJV A;  3F8M A;  4KT5 C;  1TW2 A;  2K4J A;  5LHG A;  2ZJQ F;  4EJU A;  4RB3 C;  1U3E M;  3C1D A;  5C3E J;  2XSD C;  2ZXH A;  3T1B A;  4CCM A;  3CME I;  2V7F A;  4E7H A;  1OCP A;  4ENM A;  1P4A A;  3BY6 A;  1LE8 A;  1JXS A;  2YUS A;  3K4B A;  2DMN A;  2BY3 A;  1WJC A;  4LMY A;  4AUX A;  1FOW A;  2ZC2 A;  1HLV A;  1GXP A;  3C2B A;  5EEA A;  3VYS B;  5GTI C;  5BPI A;  4JX5 A;  4YRV A;  3VEP A;  1R4N B;  2Z5U A;  4BQO A;  4BU2 A;  3GW2 A;  3AKZ A;  3CJN A;  3HYI A;  3OYD A;  4IHS A;  1QA6 A;  1RNL A;  1YW9 A;  3D5S C;  2DA6 A;  3PFI A;  1MBG A;  3RDI A;  3ERM A;  4XN3 A;  2VOP A;  2Q2E B;  2V6C A;  4RGU A;  4AC0 A;  1LNW A;  2P81 A;  4C2U A;  1WPK A;  2PN6 A;  2F5D A;  5FFZ A;  1D5Y A;  4IKF A;  4PGG A;  3JRD A;  1DP3 A;  4HNT A;  2OAZ A;  2LY9 A;  1YW7 A;  3WHB A;  1X3Z B;  1QVU A;  2WB1 N;  2LFB A;  2QSG X;  2STW A;  2E60 A;  2GIZ A;  4M73 A;  2VL8 A;  2N8G A;  4A3C J;  3HTS B;  3LQR A;  3VWB A;  2QSF X;  1G6N A;  2EV0 A;  3HRM A;  3M07 A;  3H5R A;  1LDD A;  1KGS A;  1PDN C;  1H9G A;  3O3K A;  1W1W E;  5HLH A;  3R6S A;  3L09 A;  2P6T A;  4LIV A;  5IT9 K;  2R7Z J;  1LB2 A;  3HZJ A;  4HQE A;  3BLY A;  5LHI A;  1I6X A;  4RAZ A;  2OF7 A;  4WCG A;  2YU3 A;  1U5T B;  2F6C A;  2DI3 A;  5FKN A;  1FTT A;  2XC7 A;  1OR7 C;  3MFK A;  2L7M P;  2H94 A;  4GGG A;  3FIS A;  2XPV A;  3C2G A;  1G59 A;  1Y1V J;  4J19 A;  2VC0 A;  3LSR A;  2OD5 A;  4RMN A;  3OOU A;  3GO5 A;  2JT1 A;  5JLX A;  2QGU A;  2DMP A;  3KP3 A;  3OYK A;  3MZY A;  2LNB A;  4BEH A;  3OMY A;  4XLH A;  2V4J C;  2MC4 A;  2D5V A;  1ODD A;  4KDP A;  2E2H J;  2E7X A;  2DT5 A;  5DDG A;  3LSJ A;  1DGR M;  1WJD A;  2L01 A;  4KIG A;  4UB6 C;  1BI3 A;  2O8X A;  1QQI A;  4RLQ A;  2NVY J;  3QOE A;  1SFK A;  3NRV A;  5ILU A;  5EG0 A;  3RKX A;  3DPL C;  5EGO A;  3MAJ A;  3PSF A;  2HWV A;  3HIF A;  3KLN A;  4FX4 A;  4NHJ A;  1A5J A;  3WU0 A;  1UZC A;  1IF1 A;  4UY8 I;  1LFB A;  2R7D A;  1VQK I;  4G6T B;  3LMM A;  3BOQ A;  2AXL A;  1J7K A;  1RES A;  2YX4 A;  5BOX A;  3FXJ A;  3OSG A;  3HHG A;  3EYY A;  4MNU A;  5HS9 A;  4L0Z B;  1R6R A;  4KIC A;  4A0Z A;  1PYV A;  2X6O A;  3DCF A;  5E79 C;  5LRR A;  3ZP5 A;  3DTE A;  1YIO A;  4DIQ A;  4D5F A;  5M5W J;  4MQ9 F;  4OMY A;  2KZG A;  3LWF A;  3S1R J;  2O7O A;  1UHM A;  4RM2 A;  1I50 J;  3AG2 H;  4GO1 A;  2E35 A;  1TBX A;  3NWT A;  5DEQ A;  2AHQ A;  1IXC A;  3OYG A;  2M2E A;  4KFC A;  4CZC A;  4CUG A;  3M4O J;  1V3F A;  3A02 A;  3FIW A;  2EZL A;  3J80 Z;  5K5Q A;  3SDG A;  3ZOB A;  5D4R A;  5IP6 A;  3K69 A;  2M0M A;  4E7K A;  2ELK A;  4BY1 J;  3BR5 A;  3BZC A;  3BPV A;  3S1N J;  2DA1 A;  4XKW A;  3QP5 A;  5D8L B;  1K78 A;  1P7I A;  4YEL A;  1ERD A;  2VBX A;  1VQ6 I;  3H5A A;  4FET A;  4I98 B;  4HST A;  3K9T A;  1AKH B;  4KIT B;  1R1U A;  4UVC A;  5LGU A;  3FKJ A;  4N0B A;  3J81 K;  1QGP A;  3WE3 A;  2HKO A;  2R7W A;  1XCV A;  4GFB A;  1Z1D A;  3G4S I;  2M1B A;  5E1Z B;  2W84 A;  5D5X B;  5DUK A;  1X1C A;  3QPT A;  1U8R A;  1WRJ A;  1S7A A;  3AG3 H;  3EQL F;  2AO9 A;  4D0P A;  1N77 A;  2A5W A;  2Y0M A;  3DF8 A;  5H2F C;  3QP6 A;  3B73 A;  3SZP A;  3V7S A;  4A5M A;  4A3L J;  3T5X A;  3V42 A;  1CF7 A;  2P5K A;  2PBI A;  1QZZ A;  2HXO A;  3G71 I;  3REO A;  2HEO A;  4BQQ A;  2Z99 A;  2VI6 A;  3O2P E;  1B1B A;  2K9Q A;  3M7G A;  3UNG C;  1XPX A;  1ZR2 A;  2WV1 A;  2DFE A;  1GVD A;  3BDD A;  2WC2 A;  3HUG A;  5CVJ A;  4OIR F;  2JSP A;  1LUJ B;  2ZBK A;  3ZN1 A;  3DEE A;  1X58 A;  4JQF A;  2CQQ A;  3H9G A;  4A5N A;  3RPU D;  3L2U A;  4DW6 A;  1H9T A;  2KRC A;  1BJZ A;  2HPM A;  5E3N A;  4WF2 A;  5LEJ A;  4PJJ A;  3B02 A;  3VSL A;  1MH3 A;  2A69 F;  3E1S A;  1H88 C;  2Z16 A;  2VBZ A;  4QWQ A;  1QPM A;  5BMZ A;  1T98 A;  2FBI A;  3ABU A;  5GPA A;  2STT A;  3HKZ N;  4XK4 A;  3IL2 A;  3U1K A;  2Y31 A;  3RZD J;  3GF2 A;  4PCQ A;  4OIO F;  2IAI A;  4PDK A;  1T33 A;  1WWX A;  2JSC A;  4GRI A;  1OYY A;  4DZP A;  3NEU A;  2L3D A;  3NAR A;  3P9K A;  4MFD A;  2H1L A;  1T95 A;  3HOV J;  3GUD A;  4I7H A;  1FX7 A;  2V9P A;  4HF2 A;  1Y0U A;  3K4C A;  4E70 A;  1R4M B;  3PUF A;  2F48 A;  2XKO A;  1ZLK A;  2H8W A;  3ERE D;  4E4H A;  2Q0O A;  3L9F A;  3JAM K;  3BR0 A;  1HST A;  5FRN A;  2A6H F;  5D5V B;  3F22 A;  2O61 A;  1JKO C;  2G7U A;  3I54 A;  2LMD A;  2AQF A;  2W25 A;  4UUS B;  2FML A;  3CO6 C;  1AU7 A;  2TCT A;  1ETO A;  4XKC A;  2E71 A;  3DEU A;  3I4P A;  2HU9 A;  4ZDP A;  2R5Y A;  1ZQ3 P;  3IP4 B;  3PUB A;  1AHD P;  4UNO A;  4CSW A;  2ECB A;  2ZJP F;  4E7L A;  2K9S A;  4ANJ A;  1R9T J;  4II3 A;  1XMK A;  4JP0 A;  4BS9 A;  1MDM B;  1N25 A;  1TWC J;  1J59 A;  3LAP A;  4HBL A;  3LFK A;  1KU7 A;  2DAO A;  1DPR A;  3OIP A;  2HTS A;  5M3M J;  4L0Y B;  2EH3 A;  2KFD A;  1O3Q A;  4AYB N;  1W7P B;  3HG9 A;  4XID A;  4NQW A;  4B4C A;  3KX2 A;  2RC4 A;  4CCL A;  1D1B A;  1TT5 B;  2P7V B;  1DUX C;  3S8P A;  1RUN A;  3BTJ A;  3H9Q A;  4Y33 A;  5F1J A;  4IJA A;  2GOM A;  3HOU J;  3ESW B;  5JFR A;  4XL9 A;  5CVI A;  5F08 A;  5GAH J;  1K6O A;  1WJA A;  3J7A O;  3WGG A;  3FMS A;  4PFP A;  2H09 A;  3H9J A;  3OOP A;  1K6Y A;  3CF2 A;  1FNN A;  2IP2 A;  3BPX A;  1X2N A;  1USS A;  2MAB A;  3K4N A;  4WK8 F;  1ETX A;  1FBS A;  1LJ9 A;  3L7W A;  2CV2 A;  2BEO A;  3BJA A;  3IAS 2;  1X1A A;  4WWC A;  2OC6 A;  2AXT C;  3BTI A;  1SVM A;  5JVG F;  5FLX Z;  5DYM A;  5IOZ A;  4MLO A;  1AA7 A;  2UUZ A;  3Q0V A;  2MH2 A;  4DJA A;  1PJR A;  2KQR A;  3TP0 A;  1FJL A;  3G1O A;  4G12 A;  4AVP A;  1W4M A;  3F8B A;  3IH3 A;  3L2C A;  3M8E A;  4DOZ A;  3C3W A;  1JI8 A;  2XVC A;  1X4P A;  1R1T A;  4B44 A;  3HPG A;  2XAH A;  3EDP A;  2VKD A;  2VXZ A;  3JRI A;  3WTX C;  4C30 A;  3L2Q A;  4L5E A;  5A2Q Z;  3FWE A;  1ZN2 A;  2XPW A;  4L18 B;  1G3W A;  1BW6 A;  2K9L A;  3HOZ J;  5DM7 F;  3HSR A;  2DA2 A;  3HBL A;  5CQE A;  1YS7 A;  5BQT A;  2F4O B;  1ULY A;  2Y75 A;  3H1C A;  4CCK A;  5FRO A;  1W7P D;  2HPI A;  3JTH A;  1S29 A;  2KDO A;  4F91 B;  5E3L A;  1MJ9 A;  4EV0 A;  3IKV A;  4MQV A;  3HRU A;  2VKV A;  4BL0 B;  1XGN A;  3A2K A;  4LIU A;  1MMD A;  1XX5 A;  4OU0 A;  3ZMS A;  5IP9 J;  3DP7 A;  4RS8 A;  1K4T A;  2PJR A;  5L3D A;  2ICW G;  3CUQ C;  4XSX F;  1G4D A;  2M3A A;  2HS5 A;  4YFN F;  2W85 A;  1XMA A;  3CP2 A;  2CV0 A;  5GAE J;  5LEK A;  5E8G A;  2EFO A;  5F0F A;  2XIG A;  1BI2 A;  2ISZ A;  3S3N A;  2UXX A;  5E3M A;  2ZSH B;  2CUE A;  1LFP A;  3CLQ A;  1UAA A;  3BTL A;  1XSV A;  1DQU A;  2X51 A;  1ZG1 A;  1E3O C;  3K4M A;  4ZZD A;  2QWW A;  2ACJ A;  1UB9 A;  4Q4Z F;  1YQA A;  4Y52 J;  5FD5 A;  5EDN A;  3RKY A;  2R7R A;  4CHU A;  3R61 A;  4F3Q A;  1DGW Y;  3BJ6 A;  1MMS A;  1R58 A;  3ISP A;  5IP7 J;  3KEQ A;  1J0R A;  2VQG A;  3DKW A;  3J7Z I;  4KIF A;  3QRF F;  2CMP A;  5KAF C;  2IGN A;  2LYC A;  4HF1 A;  3KFW X;  2Y2Z A;  4P55 A;  3HKZ A;  1Y8Q B;  3I59 B;  4QTR A;  3ZQF A;  1Y6I A;  3Q0W A;  1Z6T A;  4ESB A;  3MKY B;  3BG3 A;  2IEK A;  3FM3 A;  1G8X A;  1FOK A;  5B3S H;  2DMQ A;  5DV5 A;  3C2H A;  3OYN A;  1Z05 A;  2R7S A;  1OCC H;  2CQN A;  4ZTF A;  1HCR A;  5B66 C;  2CUJ A;  1TWF J;  3A0H C;  1SD4 A;  1OMI A;  2NRA C;  3PJR A;  2OQR A;  4FAS D;  2ECC A;  4EAT A;  1KU9 A;  5ICF A;  3WG9 A;  4A3F J;  3OV8 A;  2FUG 2;  1J2X A;  2COM A;  2MYS A;  4LIT A;  4RB2 C;  1JHH A;  4Z2Y A;  2BE5 F;  4M9Z A;  2ZME B;  4PFO A;  1OFC X;  2LOO A;  2VOO A;  5F64 A;  3PO2 J;  4A3G J;  5CKT A;  2M7A A;  4LG0 B;  3KET A;  3AG4 H;  4BQA A;  1Y56 A;  3F6O A;  1YYV A;  3PQJ A;  3GCM A;  3H3U A;  4YII A;  2CFO A;  3S2H J;  4E7S A;  2V6E A;  1MBF A;  2QQB A;  2W82 A;  3CES A;  2EFQ A;  1PUF B;  4UB8 C;  3HOT A;  3K2Z A;  1R1V A;  3BJO A;  3OL4 A;  3TKY A;  2DA4 A;  1SFX A;  4Q5S F;  3GBG A;  2E5N A;  5B5E C;  1ZR4 A;  2QSH X;  3HM5 A;  2W4S A;  4C3J J;  4L9T A;  1OCR H;  4A6D A;  2P6S A;  3SZG A;  2DA3 A;  2NXN B;  5C4J J;  3BR1 A;  2LY2 A;  1J5Y A;  2H6B A;  1E3H A;  2P4W A;  3BT9 A;  1Q1V A;  1W5S A;  5L3C A;  3SYT A;  1QZY A;  2W7N A;  2P7C B;  1R36 A;  2ZXW H;  3CO7 C;  2EB7 A;  4FCY A;  2OA4 A;  3PSI A;  3LFU A;  5F0H A;  3KZI C;  3JRC A;  2ZSI B;  3LST A;  4BE1 A;  2DOA A;  3F8N A;  4AIH A;  4RB1 A;  1BA5 A;  2R7X A;  1NH3 A;  1A36 A;  3RSN A;  2XV4 S;  5KK1 A;  3PNY A;  3MWM A;  1VQ8 I;  2RNG A;  1MD0 A;  1ZAR A;  3OWT A;  5CVU A;  1ETQ A;  2M0C A;  3FMQ A;  1OYI A;  1ONV A;  3ONQ A;  3WGH A;  2KMU A;  2ZXI A;  3CCE I;  4D1Q A;  5E1X A;  4BJ5 C;  3K0L A;  4HLX A;  2VJI A;  4HG2 A;  1VQ7 I;  3LL7 A;  1AOY A;  1D1A A;  3V8L A;  2X85 A;  2HZT A;  4KN7 X;  2LVS A;  4M3E A;  2HQN A;  1SC7 A;  1XGS A;  2QM3 A;  2R4G A;  3SJM A;  5CPR B;  1ON2 A;  3OYM A;  2Q2E A;  2WAE A; 
#chains in the Genus database with same CATH homology
 2DA5 A;  3LSJ A;  1TWH J;  1JKP C;  1T56 A;  2R93 J;  3BG5 A;  1MBE A;  2L7F P;  3A01 A;  3OIO A;  4BY7 J;  3GTL J;  1I6H J;  2XRL A;  2NVY J;  1ENH A;  2JK3 A;  3CQZ J;  5EG0 A;  1K83 J;  5EGO A;  4V2G A;  1H8A C;  3MN2 A;  3HGG A;  1A5J A;  4X1E A;  3BR6 A;  4M6V A;  1LFB A;  3TW6 A;  1WI3 A;  1RES A;  1B72 A;  2JA7 J;  3E7L A;  3OSG A;  1F36 A;  2R92 J;  1TWG J;  2G0E A;  4A3I J;  1DU0 A;  1K61 A;  2X6O A;  3DCF A;  1XC5 A;  4MIM A;  5F04 A;  2Y9Z A;  1APL C;  1FIP A;  2NS7 A;  2CJJ A;  4D5F A;  5M5W J;  1MSE C;  1HDD C;  1WGX A;  1NTC A;  3S1R J;  3GTQ J;  2O7O A;  2JWT A;  3JRA A;  4M3G A;  2LKX A;  1I50 J;  2EZH A;  4EEF G;  2DMT A;  1UHS A;  3B6A A;  2AHQ A;  1W0T A;  2M2E A;  1IGN A;  5FKL A;  2KDZ A;  3M4O J;  1ZTR A;  2M34 A;  3A02 A;  4S0H B;  1HF0 A;  3FIW A;  2EZL A;  1B8I B;  2H8R A;  2JJ7 A;  2CU7 A;  3SDG A;  3WHC A;  3LNQ A;  2OPT A;  2M9H A;  3ZOB A;  4RBO A;  1H89 C;  4I6Z A;  2HOA A;  3ZQG A;  5IP6 A;  5M3F J;  2E2J J;  2ELK A;  1IG7 A;  4BBS J;  2QF7 A;  3BR5 A;  1NK3 P;  4BY1 J;  3S1N J;  2DA1 A;  5IPA A;  1P7I A;  1U8B A;  2R5Z B;  3MKL A;  3BR3 A;  4BKX A;  4D7N A;  1AKH B;  4B3A A;  3PM1 A;  2Y9Y A;  3HDD A;  1TC3 C;  4MFE A;  1DU6 A;  3JRG A;  4GFB A;  3S15 J;  3LOC A;  3LSP A;  3TED A;  5M5X J;  1F43 A;  2WAQ N;  5EF6 A;  1JKR C;  2O9L A;  2LD5 A;  4JX6 A;  2AO9 A;  1MBJ A;  1IRZ A;  3O8G A;  3GTP J;  1LFU P;  3HB9 A;  4UUT A;  4XRS A;  1VI0 A;  4A3L J;  4HNV A;  3HOX J;  4DYQ A;  5FJ8 J;  1IC8 A;  2NVT J;  3GTK J;  3MVP A;  2HXO A;  1ETK A;  2K40 A;  5IOY A;  5FLV A;  4BXX J;  2EZI A;  2VI6 A;  3CDL A;  3I4N J;  1MSF C;  2MG4 A;  1CQT A;  1MBK A;  3FK7 A;  2K9Q A;  3B6C A;  5F0C A;  1ZR2 A;  2WV1 A;  4IHY A;  4FE4 A;  1GVD A;  2HI3 A;  3ZQL A;  2GBY A;  1JKQ C;  4LOC A;  5FLM J;  1QRY A;  1X58 A;  2CQQ A;  1U9O A;  2GM4 A;  1U9N A;  4DW6 A;  1BJZ A;  2DN0 A;  5E3N A;  1JUS A;  4V2F A;  1GDT A;  2IBD A;  2NOG A;  2TRT A;  1FEX A;  1MH3 A;  1H88 C;  3GTJ J;  3HOY J;  5GPA A;  2CRG A;  3ZQH A;  3HKZ N;  4M3D A;  3BR2 A;  4XK4 A;  2Y31 A;  1RPW A;  5J3L A;  3RZD J;  1IUF A;  3HGY A;  4QIW N;  2IAI A;  2L7Z A;  2O8K A;  1T33 A;  2HXI A;  4JX4 A;  2DJN A;  1AKH A;  2PMZ N;  1IV6 A;  1PUF A;  4A3M J;  4DZP A;  1GT0 C;  3NAR A;  1BL0 A;  4MFD A;  1LE8 B;  3HOV J;  1FIA A;  5K7Z A;  5EZG A;  3BG9 A;  4IHV A;  2MSY A;  4D5C A;  2XGE A;  1GV2 A;  2CQX A;  1WCM J;  2CUF A;  1YRN B;  2E19 A;  5C4X J;  3BR0 A;  1JUP A;  2K9N A;  4Y7N J;  3RKQ A;  5J1Y A;  4A3J J;  2NS8 A;  1JKO C;  5EYR A;  2HYJ A;  4UUS B;  4RDU A;  1AU7 A;  2Y0S N;  1MNM C;  2TCT A;  4XIC A;  1ETO A;  3SFI A;  1UMQ A;  1ZQ3 P;  2R5Y A;  1RR7 A;  3FKI J;  1AHD P;  1IJW C;  2HOS A;  2ECB A;  2EQR A;  5J1U A;  2K9S A;  1R9T J;  2FQ4 A;  4JP0 A;  3JRH A;  1TWC J;  4NDL A;  4DYR A;  1TWA J;  1WH5 A;  4A3D J;  2KT0 A;  4B1R A;  5M3M J;  4X6A J;  2EH3 A;  1JTX A;  5FKK A;  4C2M J;  3QPL A;  2H1K A;  4AYB N;  1SAN A;  3ZQI A;  4XID A;  4B4C A;  2VUM J;  3BTJ A;  4DYC A;  5K7F A;  1OCT C;  1ORK A;  5F1J A;  4C3H J;  2LK2 A;  1ETV A;  3HOU J;  3W6V A;  3G1M A;  5F08 A;  1JUM A;  2JA8 J;  2DTZ A;  3RZO J;  1ETY A;  1ZKG A;  1X2N A;  3S17 J;  2LTP A;  1ETX A;  2HDD A;  1ZK8 A;  2JA6 J;  1HDP A;  3TP3 A;  1JJ6 C;  2GLO A;  3BTI A;  5IOZ A;  4MLO A;  1ETW A;  2VKE A;  3Q0V A;  3TP0 A;  2HQ5 A;  4DZJ A;  2LP0 A;  3G1O A;  4G12 A;  2ME0 A;  1FJL A;  3UKG A;  3IH3 A;  3IV5 A;  2RAE A;  4CYC B;  2ID3 A;  1W0U A;  2W48 A;  1VF9 A;  5DTD A;  3A01 B;  1JGG A;  3O8H A;  2QCO A;  5EG0 B;  1OJL A;  1GV5 A;  3JRI A;  5EGO B;  4L5E A;  2XPW A;  1BW6 A;  3D1N I;  3HOZ J;  9ANT A;  2XB5 A;  2DA2 A;  3HBL A;  1Z0X A;  2NVX J;  1IDZ A;  2YU9 J;  1B72 B;  1I3Q J;  1B8I A;  4IHW A;  2DA7 A;  3H0G J;  2LR8 A;  3CCY A;  4QSH A;  5J1R A;  1HOM A;  2FX0 A;  5E3L A;  1X2M A;  1P7J A;  2ME6 A;  1A6I A;  3S1M J;  5HOD A;  4A3B J;  2VKV A;  3QPS A;  2L9R A;  5IP9 J;  1GUU A;  1MBH A;  2R5Z A;  1MH4 A;  2R0Q C;  2Y30 A;  3NAU A;  5FKO A;  3VPR A;  4A69 C;  2LLK A;  3K7A J;  5JLW A;  5F0F A;  4W97 A;  5IYD J;  3M3Y J;  5E3M A;  1XS9 A;  2CUE A;  4IHX A;  3IH2 A;  3BTL A;  4ABZ A;  2X9D A;  3GTG J;  1VND A;  2E1O A;  1E3O C;  3S16 J;  2XGC A;  1G2H A;  4Y52 J;  3S1Q J;  5EDN A;  1Y1W J;  1ITY A;  1BW5 A;  5BNG A;  2X48 A;  1JT6 A;  5IYB J;  2E2I J;  3JRF A;  3ZQC A;  2JA5 J;  5IP7 J;  2XPU A;  3Q0U A;  3JR9 A;  3OSF A;  2ZB9 A;  2B63 J;  2COB A;  4IEJ A;  1UG2 A;  3HOW J;  2Y2Z A;  2M8G X;  4QTR A;  3ZQF A;  3Q0W A;  2FD5 A;  3LSG A;  3BG3 A;  1VFC A;  4C3I J;  4W1U A;  2IEK A;  1FTZ A;  1Z77 A;  2FJ1 A;  3DEW A;  2DMQ A;  1JJ8 C;  1IDY A;  5GP9 A;  2L0K A;  3G1L A;  3BQZ A;  3RQI A;  1HCR A;  2HOT A;  1TWF J;  2XB0 X;  1U78 A;  2ECC A;  5C3E J;  2XSD C;  2YS9 A;  4A3F J;  5DS9 A;  4BBR J;  1OCP A;  2ID6 A;  1LE8 A;  4XRS G;  2YUS A;  3BTC A;  2DMN A;  4AUX A;  4A3K J;  1XG1 A;  1HLV A;  1OFC X;  3PO2 J;  4A3G J;  3C2B A;  4I76 A;  5EEA A;  1YRN A;  3L1P A;  4FE7 A;  4JX5 A;  3BQY A;  2I10 A;  5F27 A;  3I4M J;  3PO3 J;  3S2H J;  3JRE A;  2EZK A;  1MBF A;  5EZH A;  3A03 A;  2DA6 A;  1PUF B;  4UUS A;  1MBG A;  3K2A A;  5M5Y J;  4AC0 A;  2P81 A;  1WPK A;  2VPR A;  3TW7 A;  3CMY A;  1POG A;  5GPC A;  1D5Y A;  2DA4 A;  3GBG A;  4M3F A;  3JRD A;  1ZR4 A;  2LY9 A;  4C3J J;  3WHB A;  1QVU A;  2WB1 N;  2DA3 A;  5IYC J;  2LFB A;  5C4J J;  3BR1 A;  3HEF A;  3GTO J;  3QQA A;  4JYK A;  2N8G A;  4A3C J;  3BT9 A;  1Q1V A;  1QVT A;  1S7E A;  1QPI A;  2JMW A;  2EBI A;  4M3B A;  4FCY A;  1NK2 P;  5F0H A;  3JRC A;  4FTH A;  2DMU A;  4MO7 A;  2R5Y B;  3Q3S A;  1BA5 A;  1RET A;  2R7Z J;  3GTM J;  3JRB A;  2MGQ A;  2XGD A;  1WH7 A;  1JTY A;  3H3V K;  2OF7 A;  4D7M A;  4XRM A;  5FKN A;  1FTT A;  3S14 J;  1O4X A;  2L7M P;  1ETQ A;  2M0C A;  1ZGW A;  3FIS A;  2XPV A;  2NVQ J;  1Y1V J;  4J19 A;  3LSR A;  1RKW A;  3IH4 A;  3OOU A;  5C44 J;  5JLX A;  3F0C A;  2DMP A;  2JN6 A;  2MW8 A;  4A3E J;  3FK6 A;  3S2D J;  2LVS A;  4M3E A;  5FKM A;  1RKT A;  1SFO J;  1JT0 A;  2D5V A;  1EF4 A;  3SJM A;  5E3O A;  4FIS A;  2E2H J;  4A93 J;  5K7H A;  3HM5 A;  4CYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...