1FIPA

The structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
PLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQALLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION (FIS)
publication title The structure of Fis mutant Pro61Ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 27
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fipA00
2ZB9A 1Y1WJ 2ECBA 2MSYA 1A5JA 5FLVA 2DA3A 2HI3A 3BTCA 5EGOB 3O8HA 3IH2A 2E2JJ 3TEDA 5GPCA 3IH4A 5F08A 5EG0A 1HCRA 5IYBJ 4IEJA 2Y9ZA 1ZR4A 3L1PA 5HODA 2L7ZA 3QPLA 3JRCA 2LFBA 1WI3A 3JRAA 4IHXA 1UHSA 2WAQN 2GLOA 2B63J 2VKEA 3LSRA 3S1QJ 3OSFA 2TCTA 1IJWC 3BR6A 1UMQA 3GTGJ 5EZHA 3BQYA 1VNDA 4MIMA 4MFDA 1DU0A 1U9NA 2COBA 2JWTA 4A3EJ 4W1UA 1Y1VJ 1ETQA 2XPWA 5E3LA 3GTOJ 4A3CJ 2KT0A 3HOXJ 2M0CA 5IPAA 1GDTA 1JKRC 3ZQCA 1HF0A 2N8GA 1IDYA 4DYRA 4A3JJ 3BTIA 3CDLA 3OIOA 5M5WJ 2QF7A 4C3JJ 3WHBA 2YS9A 5J1YA 2K40A 1BL0A 2NVTJ 2TRTA 5FKOA 2JA8J 2RAEA 1GUUA 2AO9A 4I76A 3IV5A 1TWAJ 3BR5A 1W0TA 3S2HJ 3MVPA 2WB1N 2HOAA 5BNGA 1BJZA 1ETYA 1XG1A 3C2BA 3OOUA 3TP3A 3S2DJ 4A3BJ 3H3VK 1ZTRA 2NVXJ 3HOYJ 4NDLA 1CQTA 2Y30A 3SDGA 1OFCX 4M3DA 1IC8A 1TC3C 4C3IJ 1SANA 3HGYA 1H8AC 2E2IJ 2EQRA 2IAIA 3WHCA 4A3LJ 1MBEA 2DA4A 1ETKA 2ID3A 3BTJA 5J1UA 1H88C 2NVQJ 2DA5A 4XRSA 2XGCA 1R9TJ 1ETOA 1MBHA 2XPVA 2E1OA 1JT6A 2Y0SN 2CUFA 4DZPA 2CUEA 1WH7A 3S1NJ 1FTTA 3MN2A 3A03A 1HLVA 1PUFB 1Z0XA 1IDZA 1JUPA 3GTLJ 1X2MA 2XGEA 2O9LA 1WCMJ 1BA5A 1Z77A 4D5FA 2IBDA 2IEKA 4LOCA 5M3MJ 1SFOJ 5DTDA 3E7LA 3G1MA 3HBLA 5F27A 1POGA 2Y31A 3GBGA 1ZK8A 3O8GA 4M3BA 4FCYA 1H89C 1DU6A 3HB9A 3QPSA 2DJNA 1GV5A 1HOMA 4A3IJ 1BW5A 5E3NA 3A01A 5F0CA 1UG2A 5EZGA 2VKVA 3HOVJ 3BG9A 3JRHA 2L0KA 2NVYJ 1OCPA 4A3MJ 3I4NJ 3RKQA 3B6CA 4Y7NJ 2XB5A 2DMPA 2QCOA 3GTJJ 2VPRA 3M4OJ 1JUMA 4W97A 2KDZA 3HEFA 1VI0A 1TWGJ 1K83J 4A93J 4BXXJ 4AUXA 1QPIA 1OCTC 3FIWA 5EG0B 1IRZA 4G12A 1LFUP 3JRBA 1ETWA 2L7FP 1MH4A 5F0FA 2X6OA 3RZDJ 3FK7A 1JTXA 2G0EA 2M9HA 4B3AA 2FQ4A 1GV2A 2R5ZA 2JN6A 5EYRA 5C4XJ 3BR1A 5M5YJ 1GVDA 2EH3A 1MBFA 2FJ1A 3ZQFA 4A69C 4C2MJ 3HGGA 1ORKA 2LLKA 3JRGA 3HOWJ 4Y52J 5FLMJ 2R5ZB 1AU7A 3ZOBA 1MNMC 1W0UA 5K7HA 5F04A 1YRNA 2K9SA 5FKNA 5M5XJ 2VUMJ 1FJLA 3LNQA 1F36A 2LKXA 1IV6A 4BBRJ 3CQZJ 1MH3A 1AHDP 3HM5A 1TWHJ 3JR9A 1Q1VA 4QSHA 3ZQGA 2WV1A 3BT9A 1BW6A 1IGNA 2XB0X 1RESA 2CQQA 3FISA 3JREA 2MGQA 2E2HJ 3W6VA 2R5YA 4B1RA 3S15J 1NTCA 4XIDA 1JKQC 2DA7A 4M3GA 2HQ5A 1I3QJ 4BY7J 4I6ZA 2O8KA 3F0CA 3S1RJ 2LVSA 2EZHA 3BTLA 1VF9A 5J3LA 2FX0A 1D5YA 2OPTA 4IHYA 1A6IA 3SJMA 2DMQA 4XK4A 4J19A 3TW7A 1RETA 2ME0A 3B6AA 2MG4A 4D7NA 1F43A 1HDPA 2CU7A 3JRIA 5IYCJ 4XRMA 2XSDC 5IYDJ 1XS9A 3I4MJ 2DA6A 4DYCA 2K9QA 1MSEC 2MW8A 5F1JA 2XGDA 3LSPA 3BG3A 4JX6A 2ELKA 2Y9YA 1ZGWA 2DTZA 5JLWA 1HDDC 3BG5A 3NARA 3M3YJ 2ECCA 5FKLA 1B8IA 5M3FJ 3QQAA 3ZQIA 2JK3A 1TWCJ 2H8RA 5C3EJ 1S7EA 4JX5A 2NOGA 3H0GJ 4FTHA 1WGXA 2O7OA 1NK3P 1WPKA 4MFEA 2YU9J 3G1LA 4X1EA 3SFIA 1JJ8C 3OSGA 1VFCA 4FE4A 3A01B 3FKIJ 3Q0WA 1B72A 1G2HA 5K7FA 2ME6A 4FISA 3DCFA 2LY9A 5FJ8J 4DYQA 1MSFC 1MBKA 3MKLA 4A3GJ 3Q3SA 4V2GA 5EGOA 3A02A 4C3HJ 4BKXA 3S16J 2LP0A 1B72B 2CQXA 2JA7J 2EZLA 4DW6A 2L9RA 1JJ6C 3ZQLA 1MBJA 3LSGA 4HNVA 2L7MP 2NS8A 4D5CA 2LD5A 1I6HJ 5EF6A 4UUSA 1FIAA 3JRDA 1JT0A 3GTMJ 4QTRA 4X6AJ 5IP7J 1QVUA 5JLXA 5IOZA 4CYCA 2ID6A 3VPRA 4EEFG 1O4XA 1JUSA 1U8BA 1ZR2A 3D1NI 3HDDA 5C44J 3S17J 4UUSB 2R7ZJ 3K2AA 3TP0A 1GT0C 2GBYA 3S14J 3K7AJ 1QRYA 3CCYA 2R92J 2AHQA 1EF4A 1JKPC 1T33A 5FKMA 2EZIA 5E3OA 4CYCB 2LR8A 2H1KA 3GTQJ 2HYJA 2HXOA 2DA1A 5IOYA 1FTZA 4JX4A 3UKGA 1ENHA 4M3EA 3TW6A 4RDUA 3PM1A 3BQZA 1LE8A 1X2NA 4IHWA 1K61A 3PO3J 2JA5J 1X58A 2DA2A 4S0HB 1P7JA 3BR3A 5FKKA 1YRNB 4B4CA 3RZOJ 1LE8B 2JMWA 1JGGA 4L5EA 1RKTA 1U78A 3RQIA 2Y2ZA 3IH3A 4BBSJ 1RKWA 2OF7A 1FEXA 1AKHA 1IG7A 2YUSA 5DS9A 3G1OA 2FD5A 5C4JJ 3HOZJ 1XC5A 2W48A 2NS7A 3BR2A 1LFBA 1QVTA 2R5YB 3Q0VA 5K7ZA 4M3FA 4XICA 2D5VA 5GP9A 2XPUA 3FK6A 4MLOA 2HOSA 1AKHB 4MO7A 9ANTA 1FIPA 1U9OA 2DMUA 1MBGA 2DMNA 2M34A 3ZQHA 1RR7A 3GTPJ 2M2EA 1ETXA 4GFBA 5J1RA 5EEAA 4M6VA 1P7IA 4V2FA 1JTYA 3HOUJ 4QIWN 3PO2J 1I50J 4RBOA 2DMTA 1T56A 1APLC 1NK2P 3BR0A 1ZKGA 2X9DA 5EDNA 2LK2A 1PUFA 1ZQ3P 2I10A 3HKZN 1OJLA 2CJJA 3DEWA 4JP0A 3GTKJ 2R93J 4DZJA 4AC0A 2P81A 4XRSG 2M8GX 5IP9J 1ETVA 4A3FJ 2CRGA 2E19A 1E3OC 2PMZN 4UUTA 1B8IB 1WH5A 1TWFJ 2X48A 2EZKA 1ITYA 2DN0A 4BY1J 4AYBN 4ABZA 4D7MA 3LOCA 5F0HA 5E3MA 2HOTA 2LTPA 4JYKA 3NAUA 2EBIA 2VI6A 4A3KJ 1IUFA 3S1MJ 3LSJA 4FE7A 2GM4A 2R0QC 1RPWA 2JA6J 2XRLA 5GPAA 1JKOC 3CMYA 5IP6A 2HXIA 2K9NA 4IHVA 3Q0UA 2HDDA 4A3DJ 3JRFA 2JJ7A
chains in the Genus database with same CATH superfamily
2ZB9A 1QBJA 2XHKA 2ECBA 1A5JA 4CCOA 5DDGA 1V5FA 1R7JA 1A04A 2DA3A 2JUGA 4M9ZA 5D6FA 2HPIA 5F08A 1XSDA 1HCRA 4IOAF 3LA7A 3OIQA 3ZR8X 2Y9ZA 5HODA 2GAUA 3CTAA 3HYIA 5HDKA 1AOYA 3C1DA 1P4WA 1WI3A 1EKEA 2GLOA 3PSFA 4EM0B 2B63J 2VKEA 3PJRA 1T6SA 3KP2A 4EJWA 1UMQA 3V4GA 3MEXA 3OS2A 1VNDA 3DEEA 2Z1DA 4XOPA 4BEHB 2P5VA 3VDXA 4XM3A 1U9NA 4IRGA 1VTNC 4UNOA 4W1UA 5L3BA 1ETQA 3K4LA 2I8DA 2MFZA 1LVKA 2IGKA 2M0CA 1K79A 1ON1A 4NUBA 2BHYA 1IDYA 2F4OB 2N8GA 2FBHA 3SFZA 4DYRA 3BPXA 3OIOA 3EPZA 5M5WJ 1FNNA 2ZKZA 1N77A 1U2WA 2FE3A 2K40A 3G4SI 1G4DA 4XKCA 3QOEA 2AXTC 2FSWA 3FMQA 2JA8J 1GUUA 2AO9A 3DU6A 4PGHA 2XUBA 1TWAJ 5E79C 1DPUA 1DQUA 3E5XA 4RAYA 2V9KA 3S2HJ 4UUVA 2WB1N 2WV0A 4BJ5C 1BIBA 2MLKA 1FP1D 3AAFA 1BR1A 2BYVE 4HAMA 1W5CC 1H9GA 3S2DJ 2OV7A 1ZTRA 1I1SA 3ZQ7A 3J7YJ 3CC2I 3SDGA 3IUOA 1S9HA 4HLXA 4M3DA 1MNDA 5E1XA 3MAJA 4LB5A 3HGYA 1H8AC 5GAGJ 3RJPA 3FXMA 3WTTC 5AIPA 2DA4A 1ETKA 3OYLA 2HDCA 3H5RA 3P9KA 2ID3A 3JTHA 3IWFA 1T95A 2DA5A 3E1SA 4HW0A 5E8IA 2HQRA 2VBZA 1XD7A 3QU3A 4PUSA 1DDNA 4BJTA 1ETOA 3CLOA 1EA3A 2XPVA 2LH9A 4RA2A 2F6CA 3KCCA 5HLIA 1EH8A 1FP2A 2Y0SN 3LSMA 2CUFA 1WH7A 1FTTA 3DF8A 4N0BA 1R00A 4AVPA 2JA2A 4E70A 3FWEA 1Z0XA 1Y0UA 2VXDA 1QO0D 1WCMJ 3ZQQA 1WJBA 2Z3YA 3M1CA 1YYVA 2IBDA 4A2UA 3E5QA 5DTDA 5F27A 1SD7A 2XC7A 2ZO4A 1POGA 4G8XA 4IQJA 2V7FA 1MMDA 4FCYA 2J5PA 3IWZA 1DU6A 3QPSA 3OR2C 4UB6C 3ABMH 1K78B 3FM3A 3N05A 4N4OB 1HOMA 3SEZA 1IN5A 2EFPA 2VC0A 1HA8A 3MKYB 3HOVJ 4ENMA 1D8KA 1OCCH 3JSOA 4ENKA 3GEZA 1Q1HA 1Z3XA 3H3ZA 4RGSA 5B3SH 1BBYA 4RM3A 4I02A 2Y0SA 1J2XA 2XB5A 2W25A 4HSTA 2QCOA 1B4AA 1QZYA 3HUGB 2VPRA 3VYSB 2O03A 3OYGA 4M74A 2E34A 3HEFA 1N25A 1TWGJ 3Q9VA 4G6DA 3EUKL 4L0YB 4A93J 4XR6A 5FFZA 3HHGA 3ABTA 1OCTC 2PLYA 3FIWA 3E6CC 1ONVA 4YFNF 1ETWA 2X6OA 2EFQA 1TLHB 1H9TA 1JTXA 2G0EA 2Z99A 2MC4A 4G94A 4B3AA 4LIUA 3BG6A 4ZTJA 4AVZA 2R5ZA 2DXIA 4AWXB 3QU6A 2NOJB 2FBKA 3WTUC 5C4XJ 2FJ1A 3PQJA 3ZQFA 2RGVA 2FOKA 2HWVA 4F52A 3MFKA 3JRGA 5LEKA 4Y52J 2R5ZB 4NQWA 3ZOBA 2EINH 2FNPA 1MNMC 4OMZA 4R1HA 1USTA 4IVNA 2JPBA 1YRNA 2K9SA 3LAPA 3V7CA 2VJ4A 3GFJA 5LGUA 5M5XJ 4IO9F 2VUMJ 2KHMA 2L9SA 1FJLA 1F36A 4XRFA 4BBRJ 3CQZJ 1AWCA 5HNFA 4I0AA 4X0GA 1JHFA 5L3EA 1IAWA 1U6GA 1Q1VA 4QSHA 3CF5F 2QLZA 1SMTA 3BT9A 1R4MB 1Z1DA 4YEJA 4KNYA 2IA1A 1WJAA 3O3KA 2A69F 2KIFA 3TMOA 3JREA 2M30A 2QWWA 2MGQA 4KFCA 3FXJA 3W6VA 1SEUA 2R5YA 1NTCA 1R4NB 2XIGA 3TDUC 4M3GA 2JRTA 2L7KA 1VQ8I 1I3QJ 5TGTA 3X2QH 2O8KA 2BY1A 5E1ZB 2CUJA 4D9JA 5BPDA 4GRIA 4DJAA 1KONA 3KLNA 4CYDA 1U5TC 1KQ0A 1R5ID 1B9MA 1GXQA 3SJMA 2RN7A 4HRIA 2ZFWA 2M4GA 3OWTA 2ME0A 2HTJA 3HSEA 3JTGA 3ZPLA 1KYWA 4HX7A 3TQNA 3FXKA 4XOTA 4M71A 1XS9A 3I4MJ 3OS1A 4IPAA 2OC6A 3EUAA 3BC8A 2UXXA 4PFOA 4LLLA 4KMFA 4XNFA 1IUYA 1HKTA 5L3CA 4E7KA 3DP7A 2DTZA 5JLWA 2GA2A 4ASNA 4CXFA 4DIQA 3EYYA 2AQEA 3GMEA 5LGTA 3WG9A 2HEOA 1ZARA 3COAC 2WBMA 2H8RA 3LFUA 1S7EA 3DTIA 1QZZA 4TV7A 3H0GJ 3PIPF 4FTHA 2R7TA 4CDGA 1XSVA 1IW7F 2EIKH 1WPKA 3NWSA 2HS5A 4MFEA 1OLTA 4F93B 1TNTA 1S5LC 4M6XA 4E7HA 4XLAA 2W1OA 4BU2A 1I3AA 2JPCA 2QQ9A 3LWFA 1YX5A 1G2HA 5K7FA 3VOEA 1PVEA 1IN6A 5DV5A 3ERED 3R0JA 1MJBA 1S8NA 1RZ4A 5FJ8J 4DYQA 1MSFC 1MBKA 3E6BA 3MKLA 4A3GJ 4BQAA 4V2GA 1U5TA 3C2HA 2JA7J 2B0LA 3FXRA 1VQMI 1TQMA 1BOBA 2P7VB 3LSGA 4II3A 1YJ9I 2PG4A 2IS1A 1KU9A 2HZTA 4D5CA 3F9KA 1I6HJ 5EF6A 3PNTA 1U5TB 3SXYA 5JR3A 1SFEA 4QTRA 4X6AJ 4BJ6C 4Q5SF 3U1DA 3I56I 2W57A 5JLXA 4HF1A 1XDSA 5KAFC 4EEFG 3IHUA 1ZR2A 3HDDA 3DEUA 5C44J 1PP7U 5D5UB 4RAZA 2R7ZJ 2PFBA 3K2AA 1GT0C 2GBYA 3OMYA 2NXNB 2OZ6A 2R92J 2RNGA 1MIJA 1EF4A 4A12A 1T33A 2H1KA 2EZIA 4KICA 2IP2A 2KIQA 4JX4A 3ONQA 4B44A 4KN4X 4QPQA 3TW6A 4XQFA 1PUEE 5HVQC 2E1NA 2DFHA 2L01A 3BLYA 2MH9A 1QNTA 1Z6TA 4OIRF 2DA2A 1R36A 3BR3A 4BQNA 5FKKA 3BOQA 4RMNA 1ERDA 2VBYA 2IGMA 3OIPA 4J01A 1D3YA 2ZXJA 5BMZA 3RQIA 4UY8I 1MJAA 3ZN1A 4BBSJ 1RKWA 3KZYA 1AKHA 2D2WA 1UCRA 1X1AA 3F6OA 3G2BA 4D0PA 2W48A 4I09A 5K7ZA 4XICA 4IX7A 4HNUA 4A5NA 2HOSA 2JUCA 3AL0C 1AKHB 2GXBA 5DM7F 2Y69H 2WAQA 2MH2A 4OIQF 4O3MA 2FNAA 3OYCA 1YJWI 4EJUA 3OYMA 3Q5FA 1S6LA 3HSRA 1RR7A 3GTPJ 3LSKA 1ETXA 3DU5A 2KKOA 4KJZA 4GFBA 1OCOH 1TBXA 2DT7B 3CDIA 4HOBA 3HOUJ 2CGPA 4IHTA 4PJJA 3PO2J 2PQ8A 3M8JA 1L0OC 2PN6A 3J80Z 3C7JA 2X4HA 1NK2P 4IKFA 2STTA 3LSTA 2QBYA 2V9VA 1PUFA 1ZQ3P 2I10A 2LDUA 3OYIA 2NYXA 3DKWA 4E7IA 5K5QA 3DTKA 3H1CA 5L3DA 1YTYA 2F5FA 5ICEA 2XAJA 5HS8A 4A3FJ 1G3TA 2CRGA 5E18F 1SMYF 4OAZA 1E3OC 4HV6A 1XDUA 1RI7A 2X48A 1YOVB 4H4KC 2DN0A 3MMYB 4WXDA 3EYIA 4AYBN 5F0HA 1UHWA 3V7SA 2HOTA 4XLCA 2NS0A 2R7QA 3TO6A 3CMMA 4OMYA 3HRMA 3MWMA 5JHUA 3CMAI 3DBLB 3CO6C 2JA6J 5ERIA 3L2WA 2M45A 3L09A 3KPHA 1VQNI 2YX4A 3F6VA 2GOMA 3A4CA 3Q0UA 2HDDA 1XCVA 2CUZA 2YR2A 4FETA 4OU0A 4L18B 3F23A 4MQ9F 1Z67A 1B1BA 4CH7A 2M7BA 2MD5A 3JAMZ 3TEDA 3NEUA 2R7WA 3AL0B 2H6CA 2FUG2 1E3PA 5GTIC 1ZR4A 3DWLE 2EA2A 2VQHA 5LHIA 2LFBA 1FY7A 2FBIA 1FYLA 1VQKI 4WX9A 3JRAA 1UHSA 1KGSA 2F5CA 2BY2A 5J8CA 4CCJA 2VL8A 2TCTA 1B6AA 3BR6A 3GTGJ 3BQYA 1LDKB 2QZ8A 3I59B 4KT5C 4Q47A 2IPQX 2Y0MA 2W82A 2JWTA 5KNLA 2CV2A 2K85A 2XPWA 3ABLH 4ZDPA 4ZDOA 3G71I 3GTOJ 3HOXJ 1HXDA 2Z16A 5BQTA 1GDTA 3ZQCA 4ZDLA 4B09A 4A3JJ 3BTIA 2VBXA 2YS9A 2PX9A 1BL0A 2BV6A 3E0JB 3LA2A 2VC1A 4LB6B 3FBNB 1IN7A 4LGWA 5FKOA 2RAEA 4PK4A 3IV5A 2Y48A 1D1BA 1W0TA 5LEJA 3I4PA 3KEOA 4KA4A 3G73A 2HOAA 3LSIA 4QLCU 2R7RA 1ETYA 3C2BA 1BJAA 2V6CA 2L02A 2DK5A 3HOYJ 1TT0A 4NDLA 1CQTA 4M9SA 2X85A 2DFFA 5D4SA 3LA3A 1IC8A 2PEXA 1OQYA 3OYKA 2X0LA 4F55A 3N4MA 1D1CA 2F2EA 5ICCA 1H88C 2CYYA 2NAZA 4XRSA 3EDPA 3LQRA 1LEBA 2IA2A 2YU3A 1XSXA 2R7OA 2WY8Q 1IRFA 1JT6A 1IF1A 3KP7A 3HG9A 1KQ8A 3FXQA 3O2PE 3JRFA 1RR8C 5DEQA 2VOPA 2CW0F 3QPHA 3MN2A 1VQPI 3W6KB 2XASA 2DFEA 2K3PA 3A03A 1X1DA 2V4JC 1HLVA 3T5XA 1IDZA 3L2RA 3S3MA 4Y15A 2O9LA 3WG7H 5IT9K 3BZKA 3T8TA 2IEKA 4LOCA 1CF7B 1YW8A 3E7LA 3F72A 3P9CA 1Z91A 4ZYDA 5FROA 4I98B 3O8GA 3FXUA 4M3BA 1N75A 2DTRA 1H89C 3L2VA 3HB9A 2CV0A 4PJ0C 3HZJA 3KP6A 4Y3OA 1EH6A 3JCUC 4HPQA 2KISA 2VQLA 3A01A 1W4MA 3IRQA 1QGPA 1P2FA 4S04A 3ZRGA 3BG9A 1P6RA 2Q1ZB 1ZG1A 3KP4A 3OYFA 2DJIA 1X1CA 3I4NJ 1BIAA 2KQRA 4G7ZF 1BN5A 5LBQA 4AIDA 4Y7NJ 3OOPA 1ZH5A 3DXJF 4Q48A 4IL6C 3RI4A 2W85A 2DOAA 5KHDA 1FWZA 2ZFUA 2LKSA 5FD6A 1ZRFA 3F22A 1FZPB 2OA4A 3PFYA 1U3EM 1IRZA 2A6TA 1Z21A 5F0FA 4HX8A 3FK7A 5J4YA 1TTYA 4U0YA 4KDPA 2B7EA 2E35A 1G59A 2FQ4A 5J6XA 1Z6RA 2LF7A 5B1BH 1UG0A 5EYRA 1L3LA 2E7WA 3BR1A 4KIFA 1GVDA 2GA1A 2VBWA 4CO8A 2QA4I 3ZMZA 4BHCA 2QYOA 2ELJA 4BQQA 2B9SA 3AG1H 3HOWJ 5FLMJ 1AU7A 4AIHA 1W0UA 4KMUX 3TDZC 5F04A 4E7ZA 4IXAA 1MW7A 1FOYA 2ZXHA 3WTVC 2M4KA 3FHZA 1T8IA 3F8CA 4YIIA 2H1LA 3HRSA 2IGNA 5CLSA 1AHDP 2WC2A 1FBSA 4IZZA 3OL4A 1R1TA 2QENA 5IY5H 3ZQGA 2H8WA 4E7JA 2WWYA 5F1RA 4PFPA 2GXAA 3CJRB 3ZXSA 2CQQA 1Z3YA 4IJAA 2WAFA 2E2HJ 4LLGF 2DPDA 4ON0A 3ROUA 2DA7A 4QWQA 2HQ5A 3WTZA 4WXCA 4BY7J 5HLTA 3F0CA 2LVSA 2CFXA 2EZHA 5CVVA 4LG0A 3F21A 1S3JA 3CZ6A 3A2KA 3ECOA 4IHYA 3IC7A 2W24A 4XK4A 2JVHA 4AIKA 4II2A 1J7KA 1RETA 2CW7A 2BW3A 2OBPA 4LG0B 2JSPA 3B6AA 2MG4A 3FXOA 2WTEA 4RGUA 1V54H 1B9NA 4Y17A 5EJCA 5L3GA 2RKHA 3EETA 2XSDC 1YIJI 5IYDJ 3K4BA 4PJLA 1P92A 2DA6A 4DYCA 1RC9A 2BW3B 4F92B 2STWA 3B02A 3HPGA 2MW8A 5CQGA 3KYDB 1TZLA 2XGDA 3MKWB 1C0WA 3WTYC 1I1GA 3BG3A 1JE8A 1W5TA 1QQIA 1T2KA 1ZGWA 1WJFA 4BACA 2VJIA 3BG5A 3WU2C 3M3YJ 3T8RA 3SZTA 3K6GA 4F91B 3QQAA 1LEAA 3GZ6A 2KPMA 4ZYGA 1O3QA 5C3EJ 1BI3A 3V8KA 4GGGA 5AIQA 5J40A 3V7RA 1BI2A 1QHHD 2LC2A 2OD5A 1FT9A 5DUIA 1NK3P 1VQ6I 2YPRA 1KA8A 5GAEJ 1J75A 2VKDA 2DODA 2VQCA 3SFIA 3J81K 5B5EC 1ZG5A 2R7SA 1VFCA 1FOWA 5D4RA 3I71A 1DUXC 2ME6A 3I58A 3PNVA 1JI8A 2ESNA 3ZP5A 2LY9A 5ILUA 1K6YA 4EGZA 5EGOA 2EPFA 3HL2A 4BH9A 4N9IA 4IOCF 1SVLA 2L9RA 1JJ6C 3ZQLA 3RTRA 3S8PA 2LYCA 2NS8A 2X6WA 2LD5A 4PJNA 3ULQB 4UUSA 3JRDA 2Q2EA 1JT0A 2XAQA 4MHGA 3CO7C 4RAFA 3K4JA 2JVGA 2BVMA 1J5YA 5JFRA 4E7SA 3VPRA 1Y39A 1G8XA 1O4XA 1U8BA 4UUSB 3MCZA 2Q2EB 2D1VA 1WHUA 3TP0A 3L7WA 3S14J 4ZTFA 3E6DA 2RV8A 5GTHC 3ASNH 2AHQA 1Y8RB 3CCMI 4KT6A 2R7VA 2DA1A 1XB4A 2DU9A 2X1CA 3NWTA 2OTJI 2DT5A 3ERMA 2KFDA 4RDUA 1G3YA 1HSJA 3IAM2 3PM1A 1LFPA 3BQZA 4IHWA 1K61A 1A36A 2EV0A 3PO3J 2F4IA 3R61A 1X58A 3LAJA 3T1BA 1J9IA 4NQWB 3MQ0A 2FXAA 2VN2A 4S0HB 1YRNB 3RZOJ 3V8LA 2H6BA 4B47A 2RQQA 1RKTA 4L5EA 3CJQB 1BC8C 2BGCA 1IG7A 2YUSA 5DS9A 3CCSI 1IXSB 3HOZJ 5E17F 3BR2A 1BI1A 2R5YB 4M3FA 4I99C 5GP9A 2E36A 4NB5A 1G6NA 2HVQA 3GZNB 4XKWA 3K0LA 1U9OA 2DDBA 4B48A 1MBGA 2DMNA 4YELA 5FRNA 1O3SA 1ZLJA 3IKTA 2GIZA 5CYVA 4L5JA 1SAXA 3D5RC 3ZMSA 1R23A 1FPQA 5J1RA 4M6VA 1JTYA 5KAIC 1DGWY 2A5YB 3KZZA 4EATA 1B59A 2P7CB 4RBOA 1APLC 2QQ8A 2NVUB 2P6TA 5J4VA 3K2ZA 5DUKA 1T98A 1OJLA 1TQPA 3HRTA 3K69A 4JP0A 2JQ7A 2DT6A 4EM1A 2R93J 1ACIA 4EGYA 5DD4A 4AC0A 5CVRA 2P81A 4XRSG 2P6SA 4G9YA 5DCMA 1HBXG 4PSWA 4AM3A 4UHTA 4HX4A 2PMZN 2Y75A 4U88A 5DYMA 3TO7A 1ITYA 2EZKA 2FF4A 5CJ9A 4D7MA 2P8TA 3RYPA 4P55A 4R8HA 3VSKA 1R6RA 2BEOA 4G7OF 1U0JA 4JYKA 2VI6A 4A3KJ 4A6DA 1IUFA 1ZHFA 2GM4A 1XPXA 1NG6A 2ACJA 4BUPA 1LQ1A 5GPAA 1LJ9A 2OQGA 2XAFA 2K9NA 5A2QK 4Y33A 4IHVA 3ZCOA 3BG7A 2K5CA 2JJ7A 4QPOA 3ZGKA 2CMPA 2XF6A 3F8FA 4YFXF 3J7AO 5FLVA 2G9WA 3CJNA 1WJDA 3KYLA 1U8RA 3BTCA 1J59A 4DOZA 4HDUA 3IH2A 3PL8A 1FBQA 4F7ZA 2BXZA 2DOFA 1FOXA 1WJ5A 2CO5A 3BPVA 3OYAA 5EG0A 4RLQA 2AS5F 1X3UA 2RC4A 4IEJA 2VODA 2PMZA 1O3RA 3PIOF 2NRAC 2L7ZA 3ELKA 4CGZA 1FBUA 4MQVA 3JRCA 4M9XA 2CSOA 2XAUA 2R3SA 3HOSA 2WAQN 4S05A 1MJ9A 3S1QJ 3OSFA 2Q0OA 3U2RA 3L2UA 1IJWC 3SQNA 5EZHA 1IN4A 2DAOA 4HSRA 4MFDA 5CVJA 4ESBA 4JQFA 1DU0A 4B8XA 3OR1C 4A3EJ 3GUDA 2EFOA 2ELHA 2LSOA 2QSHX 1FMVA 3TOAA 5E3LA 4AD9A 3K70D 4LLNA 3KE2A 2K86A 4UVAA 3FZVA 3R4KA 1JKRC 1HF0A 2GQQA 5HDNA 2HGCA 1XN7A 4IRIA 1O7FA 3CDLA 1LDDA 4HF0A 5D8LB 3S2WA 4C3JJ 3DV8A 3L00A 3VB2A 4I7HA 3ZMTA 1TQIA 1YJNI 4LFUA 5E20A 2TRTA 3C3WA 4EM2A 1IO2A 1FSHA 3RPUA 2P0WA 4GDFA 4HBLA 3BR5A 5K5RA 3WTXC 2DK8A 2WY7Q 3MVPA 2A07F 3BY6A 4L9TA 1YITI 3DBHB 4CCMA 5HLHA 1W7PA 2MLGA 4A3BJ 3HXLA 4RB0A 3TP3A 2IS6A 1TW2A 3V42A 2WAEA 2Y30A 2KJCA 5TJJA 3ZMVA 3DKYA 4C3IJ 2JTVA 1OCRH 2K02A 1SANA 2GXGA 3H36A 4Q4ZF 3WHCA 2PJPA 1W7PB 1IXRC 3KX2A 1E2XA 2VE8A 1MBEA 3AFHA 1GXPA 3W2WA 2NVQJ 3PUBA 5LD2C 2ISZA 2IS2A 4FT8A 2IA0A 2CV1A 2HVRA 2V1XA 2XDVA 4UVBA 4DZPA 3ECHA 1ZGJA 1USSA 4HV5A 3S1NJ 1M1EB 2QGUA 2QQBA 2QBYB 3HJEA 2H09A 1PUFB 3FX3A 1PJRA 1SVMA 4RGRA 2XF5A 3JSPA 1JUPA 2XGEA 1BA5A 1Z77A 4D5FA 5M3MJ 4KISA 2IVMA 1K4TA 4A6EA 2ETHA 3GBGA 4OINF 4E4HA 4R79A 1STZA 5CVUA 4MEXF 1XMXA 2PI0A 1YX3A 4FQGA 2A05A 2DJNA 2NNNA 5KK1A 4CZZA 5IT9Z 2LBFA 4A3IJ 5E3NA 5F0CA 2V6EA 1SD5A 2VKVA 2DO7A 3FM5A 1TT5B 4HG2A 1EV7A 3M7GA 4HNTA 3JRHA 3RYRA 2LBFB 1K4SA 2QQAA 1OCPA 4CUGA 5J8FA 3RPUD 2BY3A 5LRSA 3VSLA 4YIFA 2HR3A 2XKPA 2DMPA 2IJLA 3NRVA 4YRVA 3GTJJ 1X4PA 3H9QA 1JUMA 1W7PD 4FX4A 1YO5C 4W97A 3AG4H 2KDZA 2W4SA 5E8GA 3OYEA 2HOEA 1K83J 3VODA 4M72A 4BXXJ 1WZ2A 2D45A 1TW3A 2PMUA 3GW2A 1FLIA 4Z2YA 4G12A 4ESFA 1KU3A 1LUJB 1MH4A 3GWZA 3U9GA 4XMYA 4HYEA 3DQVC 2FOWA 4YIRX 2M9HA 2GOXB 4BL0B 4DNCA 2DLLA 4IQ4A 2WA0A 2Z33A 3K4NA 3WU1B 4HQMA 3D0SA 2LRDA 3BJOA 2JN6A 4OWRB 3R60A 3H35A 5M5YJ 3S93A 1MBFA 4A69C 4C2MJ 1EJ9A 1PYVA 3HGGA 1WI9A 1ORKA 1QPMA 3CCEI 4G7HF 1G3SA 3EQLF 4XLPF 1UB9A 1DGRM 5FKNA 3OYDA 3LNQA 2LKXA 2RNJA 2XGXA 4BDZA 1TWHJ 3BDDA 3EUHA 2WV1A 3CLQA 4EMSA 3SDBA 1H0MA 2IT0A 3CCUI 3S32A 2XB0X 3F3XA 3SEQA 3TL4X 1R58A 2XKOA 3F8NA 1BC7C 3CCQI 4B43A 1G3WA 2QUFA 1XGSA 2ZMEA 4I01A 2Z9OA 3S15J 4LG3A 4CHUA 4EV0A 4I6ZA 2EWNA 3S1RJ 1HKSA 4BXFA 3BTLA 1VF9A 2FX0A 3CCLI 1RUOA 1LKXA 3F8BA 2QKLB 3R6SA 1D5YA 2OPTA 1WVRA 3CJTB 4NHJA 1A6IA 3S3OA 1YE9A 1K6OA 1J0RA 2DMQA 4EQQA 3QYFA 3TW7A 4RAGA 3VYRB 3W6JB 1MKMA 4D7NA 1YS7A 1S29A 2XRNA 1HDPA 2CU7A 3OYHA 3JRIA 2HYGD 4JK1X 1VQOI 3B73A 1OR7C 4BXUA 2VT3A 1R71A 2EA4A 3FKJA 5D6EA 1VQ7I 3CCJI 2LMDA 3E97A 4XKBA 1Y0NA 2FMLA 2KL4A 2QKMB 2K9QA 1Z7LA 2CG4A 2OQRA 3FDYA 1UHMA 3BWGA 1SVOA 3P9IA 3TKYA 4D1QA 2LKPA 1GVJA 2D1HA 4JX6A 1YFHA 2ELKA 2Y9YA 1W36D 1HDDC 2XROA 3GFLA 3OS0A 2W84A 2ADUA 5DD8A 3IL2A 1B8IA 5M3FJ 4AU7A 2HVSA 2HZDA 5F6FA 3ZQIA 2E1CA 2MC3A 1AA7A 2H94A 2DDAA 4WK8F 1F4KA 3TGNA 4JX5A 2KIMA 2NOGA 1J09A 1VQLI 4RGXA 2L2OA 1WGXA 2FQ3A 3DPTA 2QSFX 2OJED 5H6QA 1MMGA 2ZJPF 4DBRA 3HHHA 1T38A 3OSGA 4FE4A 1YS6A 4I2OA 3A01B 4PJMA 2VB6A 4XONA 1XCBA 2KJBA 3MZ8A 4XKVA 1NG7A 2VJJA 3Q3SA 4G6TB 4C3HJ 2IXSA 4BKXA 3J81Z 3CCRI 3H3UA 1ZRCA 4M73A 3S16J 3KP3A 1IRGA 2CQXA 3FMRA 2EZLA 1SC7A 4XN3A 2CH0A 3WE2A 4JOMA 1MBJA 2ICWG 1OMIA 1MDMA 4HNVA 2L7MP 3RKWA 1X4OA 2EV6A 2X1DA 1KYZA 2M3AA 2OTLI 2EV5A 2G7HA 5ILSA 2LF8A 1FIAA 3HKZA 3GTMJ 1HW2A 3J7AY 2QEXI 5IP7J 1OR7A 3M07A 3A0BC 2H27A 1KZHA 2HYFA 1MDMB 1WRJA 2ID6A 3L9FA 3RCOA 4FASD 1DPRA 3KEQA 1JUSA 3MD2A 5H20A 3D1NI 3H9GA 1IRXA 1UAAA 3S17J 4RB1A 3KFWX 3K7AJ 1IZ1A 2HKXA 2F5EA 3IAS2 4BEHA 2ZSHB 3CCYA 1R49A 3ML6A 2P4WA 1P4AA 4PGGA 4A0ZA 5BOXA 1JKPC 5E3OA 2O6GE 2PMHA 3GTQJ 1BI0A 2HDWA 5ICGA 1OKRA 2HXOA 1D0XA 3BJ6A 4P1WA 3ZMUA 2DYRH 5IOYA 4HDVA 4M3EA 2HPMA 4UB8C 5TISC 2RREA 3DFGA 2LY2A 1LDJA 2K9LA 1LE8A 1X2NA 3K4MA 2JA5J 1FYMA 2EB7A 1P7JA 2X51A 3KZIC 1I6XA 5JVTA 3QOPA 2DYSH 5TRDA 4B4CA 1KU7A 1ULYA 1LE8B 1WJEA 1JGGA 1WFXA 2EFNA 2FEZA 2KRHA 3ISPA 3KEYA 3CD6I 1XX5A 2V1DA 2ZXWH 1P4XA 1ZELA 2AQFA 2OF7A 5BPIA 4V19K 2FD5A 2IGOA 1X3WB 5FO5A 4ZYEA 5FLXK 2DOEA 2HFHA 4WXHA 5FD5A 1OYYA 4XORA 1QVTA 2XSJC 2DFIA 2D5VA 1T08B 3FK6A 1FC3A 2YX7A 3M9AA 4MO7A 1DP3A 1SFXA 2COMA 4LIVA 3WGGA 2V9PA 1RRJA 1I5ZA 1IV8A 2M34A 4BNCA 1WJCA 2TDXA 4MTDA 4KIGA 2M2EA 4LITA 3KETA 4IHSA 3A1YA 3OL3A 4U7BA 4XBFA 2CQ7A 5EEAA 4CCKA 1P7IA 4V2FA 5LFAA 2C6YA 5LRRA 4HA8A 2CW8A 3WODF 4UV9A 3GFMA 1W1WE 1I50J 1MZBA 2DMTA 2KLOA 2XV4S 3BR0A 1ZKGA 2X9DA 2K4JA 3GLLA 1XMAA 1HW5A 1HKQA 1SD6A 3BZ6A 1FSEA 2FRHA 4ENJA 2LOOA 3GXOA 3DEWA 3O6BB 1UJ8A 3AKZA 1OPCA 3VYTB 4CA0A 4ZZLA 2ISYA 3M8FA 2DBBA 2E5ZA 2E19A 1Y8QB 4HZFA 4G6QA 2BE5F 2F5VA 2CWEA 2WB1A 4UUTA 5JVGF 2HKOA 4ZYAA 4MEYF 1K78A 4XLEA 4ABZA 5HNHA 2ZXIA 3LOCA 3W3CA 1EH7A 1OCZH 2YSRA 2VIXA 2M0MA 2M8EA 2UZKA 2L9NA 4J00A 2EBIA 3M1EA 3S1MJ 3LSJA 4FE7A 2P5LC 1MMAA 1RPWA 5CKTA 4PDKA 2A6EF 2M1BA 4L5IA 4MGRA 2OCCH 2BY0A 2HXIA 4Y4RA 2BOLA 2JT1A 3LL7A 4A3DJ 2AXLA 3ZN0A 3DKXA 1Y1WJ 3L2CA 2MSYA 3HUGA 1VQ9I 1QA6A 4WWCA 2HI3A 5EGOB 1MD0A 2VJ5A 3O8HA 2E2JJ 4YFKF 5GPCA 3QAHA 5A2QZ 2QVOA 1I27A 3IH4A 4U0WA 4CZCA 1Z05A 3HC7A 2LNBA 4RLFA 5IYBJ 2RQPA 3I64A 5DCFA 4Y13A 3CC4I 3LSHA 2IW5A 3L1PA 3T0YA 1WSUA 3IKVA 3GZ5A 3E3VA 2M7AA 4KN7X 1A35A 3QPLA 2BVLA 4IHXA 1GHCA 2UV1A 1PP8F 3LSRA 4H0EA 3P5JA 3KIOA 2V79A 2RVCA 3K1MA 1OYIA 3K70C 2E7XA 2Q8KA 2LG4A 4CCLA 4ZH4F 4MIMA 1IXCA 3LQQA 3CP8A 5JI6A 2COBA 2A6HF 1Y1VJ 3QODA 3AG3H 3CC7I 2M5WA 2OAZA 5BS6A 4GYGA 3GLXA 4EJVA 3C2GA 2KT0A 4A3CJ 5LLQA 5K5OA 4A5MA 1BR4A 5IPAA 3ESWB 1LB2A 3MZYA 3OV8A 2KDOA 4CSWA 5B1AH 1Z7UA 2QF7A 4HQEA 1X1PA 3WHBA 3HSFA 5D5WB 1MMSA 5EEHA 5J1YA 2NVTJ 4U7DA 2L5QA 2LREA 4LD5A 5HLGA 4I76A 3V8JA 1QHGA 4FHTA 1YG2A 3BCAA 3DLAA 2O61A 2K4BA 2A68F 3SHFA 2DQLA 1MGTA 4NC8A 2A61A 2GWRA 3KP5A 4GCVA 1KQ9A 4BGDA 5BNGA 4NBQA 1S72I 4N9HA 1REPC 1BJZA 3CP2A 1BOAA 1XG1A 2CS3A 3OOUA 4XLFA 3WGIA 3H3VK 4C30A 2NVXJ 2UUZA 1JGSA 5HOOA 3H9JA 1PDNC 5CQEA 4P5OA 3PSIA 1OFCX 4NNJA 1TC3C 2ZJ2A 1V4RA 4N4NB 1RNLA 3J7ZI 4P9FA 1X19A 2E2IJ 2EQRA 2IAIA 4A3LJ 2XAHA 3TBIA 3BTJA 5J1UA 2O8XA 3TO9A 5B66C 2X6XA 1KU2A 2XGCA 1R9TJ 1MBHA 1XGOA 1R5HA 4BE1A 2E1OA 1FX7A 5D5XB 1T39A 4BHBA 3K4KA 3K1NA 6PAXA 4XLHA 2MYSA 2CUEA 4BE2A 1NH3A 3PUFA 5CPRB 4U0VA 3QYEA 2BZTA 2VPLA 3ABUA 3P7NA 3GX4X 3OYBA 3GTLJ 4UVCA 1X2MA 2A5WA 3I53A 3SYTA 4JBAA 5GADJ 3IP4B 3OYNA 4CICA 2WADA 1SFOJ 3G1MA 3HBLA 2IRFG 5DCMB 2CQKA 2Y31A 2ZNZA 4PCQA 1ZK8A 3F8MA 2E5NA 1R1UA 2OCEA 5KVRA 4DQ2A 3TOBA 1NHAA 5E1WA 2IS4A 2ZNYA 1TL8A 1GV5A 3PNYA 1YQAA 2MBFA 4LJZF 4BAYA 1BW5A 3D5SC 3RQ4A 1HW1A 3A0HC 1UG2A 4L9NA 5EZGA 2I5UA 3PFIA 2L0KA 4ETSA 2GIVA 2NVYJ 1IN8A 4A3MJ 2O5RA 2ZC2A 4FX0A 2R7UA 1UZCA 1FOKA 3RKQA 1WQ2A 2XAGA 3B6CA 2EIMH 3KYCB 1S7AA 3I0TA 2K3FA 4A0YA 2KIUA 5D5VB 3M4OJ 3BROA 1UELB 3CUQC 4NC6A 1P9QC 1FMWA 1VI0A 2NNYA 4EJOA 3AG2H 4BE0A 1SAUA 4AUXA 3QP6A 1QPIA 2KZGA 4ANJA 5L3FA 1RIOH 5EG0B 2PJRA 4O5VA 1LFUP 1ODDA 2L3DA 3FHNA 3JRBA 2L7FP 3S3NA 4DGWB 1R1VA 2V1NA 3RIRA 3RZDJ 4HLYA 1LVAA 3RKXA 5HDGA 5LGNA 2KZVA 1GV2A 3MZHA 2ZSIB 2PJRB 3DLLF 3N97A 3HRUA 4M6YA 2RDPA 3QP5A 3C18A 4KIBA 2EH3A 4ESJA 1F5TA 4RM2A 3KLOA 2KRFA 1XTAA 2FU4A 1ZAOA 2LLKA 4OOIA 3FF5A 3H5AA 2JZYA 5ED4A 3HIFA 3PQKA 1OISA 4XSXF 3WTSC 5K7HA 2G7UA 4MTEA 1ZRDA 1O7LA 4XN0A 1LPQA 2X1EA 2M87A 4C2TA 1ZG3A 4EVIA 4KUMA 4AIJA 1IV6A 1MH3A 3HM5A 2ZJQF 3JR9A 5HS7A 3CESA 1VQ5I 3K10A 1BW6A 3UNGC 3H92A 3OY9A 1IGNA 3DPLC 1RESA 4LK1F 3RPQA 3FISA 4I0BA 2OZUA 2L54A 5CVIA 2E60A 1K7AA 2DPUA 1QZEA 4IRHA 4MNUA 4UXNA 4B1RA 3BCBA 4ZC3A 4XIDA 1JKQC 4C2UA 2K9MA 1D8JA 1WWXA 2JSCA 2L4AA 3GYHX 4HEA2 2O0YA 5FGMA 3GF2A 4XL9A 3CUQA 1ZYRF 5J3LA 4ZYHA 2VLAA 1YLFA 2CQNA 1X3ZB 3GCMA 4L0ZB 2ZBKA 3I5UA 2HU9A 3W2VA 1V3FA 4J19A 2MD0A 1DP7P 4GYIA 1D0YA 5J47A 3CUQB 2PBIA 1F43A 2ESHA 5FB2A 1D0ZA 4B3XA 4BYYA 5H2FC 3I54A 1TP4A 5FRMA 4XLNF 1YHQI 3K4CA 5IYCJ 4XRMA 1JHHA 2CFOA 4E7LA 2LY1A 2X6YA 5AONA 1W36C 1E17A 3CDHA 1SFUA 4LK0F 1F1ZA 2OUMA 2KP6A 4F3QA 1MSEC 1HQCA 4RB2C 2BHZA 1GLNA 2BXYA 2Z5UA 5F1JA 5LHHA 3LSPA 2FA5A 1Y6IA 3UR3C 1I39A 3NARA 2ECCA 5FKLA 2XF7A 3E5UA 4P9UA 2HTSA 2JK3A 1TWCJ 1Z9CA 1OYWA 4BQOA 2ZJRF 3G6EI 3FMSA 3EUHC 5EEGA 5JHFA 1QU3A 2BBYA 3BJAA 2O7OA 3U21A 4C9YA 4XSZF 2YU9J 4RS8A 3G1LA 4X1EA 1JJ8C 2L4MA 2VASA 5DM6F 2K27A 3FKIJ 2ZMEC 3Q0WA 3QPTA 1YIOA 3WE3A 1B72A 5GAHJ 1VQ4I 2MABA 4KYWA 2R7XA 4L9VA 4BHPA 4FISA 4YG2F 2R7DA 3DCFA 5K1YA 2VXZA 5H6RA 1XGNA 1T0FC 5FFXA 4GO1A 3A02A 3I9V2 4O6JA 3GFIA 2LP0A 1B72B 1R22A 4DW6A 3H0DA 4ENNA 2ZCWA 1YW7A 1RUNA 3HTSB 3HOTA 2E1MC 1W5SA 2K7LA 3K1PA 4OIPF 1ZLKA 3REOA 3CMEI 4CCNA 3E6MA 4LMYA 1WKMA 3G3ZA 5D8KB 1QVUA 1YW9A 1CGPA 4HF2A 5IOZA 3QWLA 1UFMA 3I3LA 4CYCA 2QM3A 2VOOA 1FYKA 1ON2A 1TNSA 2FMYA 4P96A 2EIJH 2W7NA 4PSXA 3I55I 3I59A 1QRYA 2JRMA 4AYBA 3FXLA 3CCVI 3FBIB 5FKMA 4DBQA 4CYCB 2LR8A 2XVCA 1R5GA 2HYJA 1FTZA 2HNHA 3UKGA 1ENHA 2A3SA 4BS9A 3WTWC 1SFKA 2DQRA 3W2AA 1A31A 3HTUA 4EJTA 3R0AA 1ZN2A 5ILVA 2L9VA 2VE9A 3RSNA 2HQNA 2DCEA 2F4MB 2EK5A 1Y56A 2F48A 4OAYA 2JMWA 3MKZA 1U78A 3H5NA 2VONA 3BZCA 2Y2ZA 1HSTA 1SD4A 3IH3A 3IRRA 2V1UA 4ZJZA 1A6QA 3RKYA 1FEXA 2EFWA 3G1OA 2OU2A 4WF2A 2V26A 1T0FA 3VWBA 1V55H 5C4JJ 1JXSA 3JW4A 1XC5A 3LFKA 4A0XA 2NS7A 3Q9SA 1HC8A 1LFBA 2P5KA 2VT2A 3Q0VA 1O3TA 2ZMEB 2XPUA 4MLOA 1BM9A 3CF2A 9ANTA 1XMKA 1FIPA 4Z6YA 2DMUA 3QRFF 2UWMA 5FLXZ 2R4GA 3ZMDA 3VEPA 2DI3A 3ZQHA 3J80K 5HS9A 2UXNA 3RDIA 1D5VA 1E0EA 3DPUA 4ZZDA 2O3FA 4KITB 2E1MB 3SZPA 4QIWN 1VZ0A 2E71A 1MMNA 3LMMA 2EJRA 1ZREA 3K9TA 1T56A 3HPHA 3OYJA 5EDNA 3DTEA 1MNEA 2LK2A 1ZGAA 4GXOA 3VFZA 3HKZN 2CJJA 1BR2A 2R7FA 3GTKJ 4IF4A 5IT3A 1E3HA 2KRCA 4DZJA 1X1BA 4U87A 4UV8A 3WU0A 1CF7A 2M8GX 2VKHA 5IP9J 1S7OA 1ETVA 4ITVA 1LNWA 1O57A 1F9NA 1B8IB 1WH5A 5F64A 5LHGA 1TWFJ 2VQGA 5KCMA 4BY1J 4NC7A 2MA3A 2W00A 3DBRB 2HQAA 5E3MA 4OIOF 3SZGA 1N78A 3BP8A 1D1AA 2Z2SB 4L9JA 4E6KG 2LTPA 1V5GA 2F5DA 2KMUA 3NAUA 2QSGX 1XGMA 4WCGA 3D5LA 3VYUB 2R0QC 1V5EA 5ICFA 2DW4A 4RB3C 2XRLA 3U1KA 3NQOA 4PZJA 3L2QA 3JAMK 2GZWA 1JKOC 3GVAA 3CMYA 3CUOA 5IP6A 3ASOH 3GO5A 2J5OA 4K2EA 4BDYA 3M8EA 1YI2I 3ABKH 3QYBA 2EILH 3WGHA
chains in the Genus database with same CATH topology
2ZB9A 1Y1WJ 2ECBA 2MSYA 1A5JA 5FLVA 2DA3A 2HI3A 3BTCA 5EGOB 3O8HA 3IH2A 2E2JJ 3TEDA 5GPCA 3IH4A 5F08A 5EG0A 1HCRA 5IYBJ 4IEJA 2Y9ZA 1ZR4A 3L1PA 5HODA 2L7ZA 3QPLA 3JRCA 2LFBA 1WI3A 3JRAA 4IHXA 1UHSA 2WAQN 2GLOA 2B63J 2VKEA 3LSRA 3S1QJ 3OSFA 2TCTA 1IJWC 3BR6A 1UMQA 3GTGJ 5EZHA 3BQYA 1VNDA 4MIMA 4MFDA 1DU0A 1U9NA 2COBA 2JWTA 4A3EJ 4W1UA 1Y1VJ 1ETQA 2XPWA 5E3LA 3GTOJ 4A3CJ 2KT0A 3HOXJ 2M0CA 5IPAA 1GDTA 1JKRC 3ZQCA 1HF0A 2N8GA 1IDYA 4DYRA 4A3JJ 3BTIA 3CDLA 3OIOA 5M5WJ 2QF7A 4C3JJ 3WHBA 2YS9A 5J1YA 2K40A 1BL0A 2NVTJ 2TRTA 5FKOA 2JA8J 2RAEA 1GUUA 2AO9A 4I76A 3IV5A 1TWAJ 3BR5A 1W0TA 3S2HJ 3MVPA 2WB1N 2HOAA 5BNGA 1BJZA 1ETYA 1XG1A 3C2BA 3OOUA 3TP3A 3S2DJ 4A3BJ 3H3VK 1ZTRA 2NVXJ 3HOYJ 4NDLA 1CQTA 2Y30A 3SDGA 1OFCX 4M3DA 1IC8A 1TC3C 4C3IJ 1SANA 3HGYA 1H8AC 2E2IJ 2EQRA 2IAIA 3WHCA 4A3LJ 1MBEA 2DA4A 1ETKA 2ID3A 3BTJA 5J1UA 1H88C 2NVQJ 2DA5A 4XRSA 2XGCA 1R9TJ 1ETOA 1MBHA 2XPVA 2E1OA 1JT6A 2Y0SN 2CUFA 4DZPA 2CUEA 1WH7A 3S1NJ 1FTTA 3MN2A 3A03A 1HLVA 1PUFB 1Z0XA 1IDZA 1JUPA 3GTLJ 1X2MA 2XGEA 2O9LA 1WCMJ 1BA5A 1Z77A 4D5FA 2IBDA 2IEKA 4LOCA 5M3MJ 1SFOJ 5DTDA 3E7LA 3G1MA 3HBLA 5F27A 1POGA 2Y31A 3GBGA 1ZK8A 3O8GA 4M3BA 4FCYA 1H89C 1DU6A 3HB9A 3QPSA 2DJNA 1GV5A 1HOMA 4A3IJ 1BW5A 5E3NA 3A01A 5F0CA 1UG2A 5EZGA 2VKVA 3HOVJ 3BG9A 3JRHA 2L0KA 2NVYJ 1OCPA 4A3MJ 3I4NJ 3RKQA 3B6CA 4Y7NJ 2XB5A 2DMPA 2QCOA 3GTJJ 2VPRA 3M4OJ 1JUMA 4W97A 2KDZA 3HEFA 1VI0A 1TWGJ 1K83J 4A93J 4BXXJ 4AUXA 1QPIA 1OCTC 3FIWA 5EG0B 1IRZA 4G12A 1LFUP 3JRBA 1ETWA 2L7FP 1MH4A 5F0FA 2X6OA 3RZDJ 3FK7A 1JTXA 2G0EA 2M9HA 4B3AA 2FQ4A 1GV2A 2R5ZA 2JN6A 5EYRA 5C4XJ 3BR1A 5M5YJ 1GVDA 2EH3A 1MBFA 2FJ1A 3ZQFA 4A69C 4C2MJ 3HGGA 1ORKA 2LLKA 3JRGA 3HOWJ 4Y52J 5FLMJ 2R5ZB 1AU7A 3ZOBA 1MNMC 1W0UA 5K7HA 5F04A 1YRNA 2K9SA 5FKNA 5M5XJ 2VUMJ 1FJLA 3LNQA 1F36A 2LKXA 1IV6A 4BBRJ 3CQZJ 1MH3A 1AHDP 3HM5A 1TWHJ 3JR9A 1Q1VA 4QSHA 3ZQGA 2WV1A 3BT9A 1BW6A 1IGNA 2XB0X 1RESA 2CQQA 3FISA 3JREA 2MGQA 2E2HJ 3W6VA 2R5YA 4B1RA 3S15J 1NTCA 4XIDA 1JKQC 2DA7A 4M3GA 2HQ5A 1I3QJ 4BY7J 4I6ZA 2O8KA 3F0CA 3S1RJ 2LVSA 2EZHA 3BTLA 1VF9A 5J3LA 2FX0A 1D5YA 2OPTA 4IHYA 1A6IA 3SJMA 2DMQA 4XK4A 4J19A 3TW7A 1RETA 2ME0A 3B6AA 2MG4A 4D7NA 1F43A 1HDPA 2CU7A 3JRIA 5IYCJ 4XRMA 2XSDC 5IYDJ 1XS9A 3I4MJ 2DA6A 4DYCA 2K9QA 1MSEC 2MW8A 5F1JA 2XGDA 3LSPA 3BG3A 4JX6A 2ELKA 2Y9YA 1ZGWA 2DTZA 5JLWA 1HDDC 3BG5A 3NARA 3M3YJ 2ECCA 5FKLA 1B8IA 5M3FJ 3QQAA 3ZQIA 2JK3A 1TWCJ 2H8RA 5C3EJ 1S7EA 4JX5A 2NOGA 3H0GJ 4FTHA 1WGXA 2O7OA 1NK3P 1WPKA 4MFEA 2YU9J 3G1LA 4X1EA 3SFIA 1JJ8C 3OSGA 1VFCA 4FE4A 3A01B 3FKIJ 3Q0WA 1B72A 1G2HA 5K7FA 2ME6A 4FISA 3DCFA 2LY9A 5FJ8J 4DYQA 1MSFC 1MBKA 3MKLA 4A3GJ 3Q3SA 4V2GA 5EGOA 3A02A 4C3HJ 4BKXA 3S16J 2LP0A 1B72B 2CQXA 2JA7J 2EZLA 4DW6A 2L9RA 1JJ6C 3ZQLA 1MBJA 3LSGA 4HNVA 2L7MP 2NS8A 4D5CA 2LD5A 1I6HJ 5EF6A 4UUSA 1FIAA 3JRDA 1JT0A 3GTMJ 4QTRA 4X6AJ 5IP7J 1QVUA 5JLXA 5IOZA 4CYCA 2ID6A 3VPRA 4EEFG 1O4XA 1JUSA 1U8BA 1ZR2A 3D1NI 3HDDA 5C44J 3S17J 4UUSB 2R7ZJ 3K2AA 3TP0A 1GT0C 2GBYA 3S14J 3K7AJ 1QRYA 3CCYA 2R92J 2AHQA 1EF4A 1JKPC 1T33A 5FKMA 2EZIA 5E3OA 4CYCB 2LR8A 2H1KA 3GTQJ 2HYJA 2HXOA 2DA1A 5IOYA 1FTZA 4JX4A 3UKGA 1ENHA 4M3EA 3TW6A 4RDUA 3PM1A 3BQZA 1LE8A 1X2NA 4IHWA 1K61A 3PO3J 2JA5J 1X58A 2DA2A 4S0HB 1P7JA 3BR3A 5FKKA 1YRNB 4B4CA 3RZOJ 1LE8B 2JMWA 1JGGA 4L5EA 1RKTA 1U78A 3RQIA 2Y2ZA 3IH3A 4BBSJ 1RKWA 2OF7A 1FEXA 1AKHA 1IG7A 2YUSA 5DS9A 3G1OA 2FD5A 5C4JJ 3HOZJ 1XC5A 2W48A 2NS7A 3BR2A 1LFBA 1QVTA 2R5YB 3Q0VA 5K7ZA 4M3FA 4XICA 2D5VA 5GP9A 2XPUA 3FK6A 4MLOA 2HOSA 1AKHB 4MO7A 9ANTA 1FIPA 1U9OA 2DMUA 1MBGA 2DMNA 2M34A 3ZQHA 1RR7A 3GTPJ 2M2EA 1ETXA 4GFBA 5J1RA 5EEAA 4M6VA 1P7IA 4V2FA 1JTYA 3HOUJ 4QIWN 3PO2J 1I50J 4RBOA 2DMTA 1T56A 1APLC 1NK2P 3BR0A 1ZKGA 2X9DA 5EDNA 2LK2A 1PUFA 1ZQ3P 2I10A 3HKZN 1OJLA 2CJJA 3DEWA 4JP0A 3GTKJ 2R93J 4DZJA 4AC0A 2P81A 4XRSG 2M8GX 5IP9J 1ETVA 4A3FJ 2CRGA 2E19A 1E3OC 2PMZN 4UUTA 1B8IB 1WH5A 1TWFJ 2X48A 2EZKA 1ITYA 2DN0A 4BY1J 4AYBN 4ABZA 4D7MA 3LOCA 5F0HA 5E3MA 2HOTA 2LTPA 4JYKA 3NAUA 2EBIA 2VI6A 4A3KJ 1IUFA 3S1MJ 3LSJA 4FE7A 2GM4A 2R0QC 1RPWA 2JA6J 2XRLA 5GPAA 1JKOC 3CMYA 5IP6A 2HXIA 2K9NA 4IHVA 3Q0UA 2HDDA 4A3DJ 3JRFA 2JJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZB9 A;  1Y1W J;  2ECB A;  2MSY A;  1A5J A;  5FLV A;  2DA3 A;  2HI3 A;  3BTC A;  5EGO B;  3O8H A;  3IH2 A;  2E2J J;  3TED A;  5GPC A;  3IH4 A;  5F08 A;  5EG0 A;  1HCR A;  5IYB J;  4IEJ A;  2Y9Z A;  1ZR4 A;  3L1P A;  5HOD A;  2L7Z A;  3QPL A;  3JRC A;  2LFB A;  1WI3 A;  3JRA A;  4IHX A;  1UHS A;  2WAQ N;  2GLO A;  2B63 J;  2VKE A;  3LSR A;  3S1Q J;  3OSF A;  2TCT A;  1IJW C;  3BR6 A;  1UMQ A;  3GTG J;  5EZH A;  3BQY A;  1VND A;  4MIM A;  4MFD A;  1DU0 A;  1U9N A;  2COB A;  2JWT A;  4A3E J;  4W1U A;  1Y1V J;  1ETQ A;  2XPW A;  5E3L A;  3GTO J;  4A3C J;  2KT0 A;  3HOX J;  2M0C A;  5IPA A;  1GDT A;  1JKR C;  3ZQC A;  1HF0 A;  2N8G A;  1IDY A;  4DYR A;  4A3J J;  3BTI A;  3CDL A;  3OIO A;  5M5W J;  2QF7 A;  4C3J J;  3WHB A;  2YS9 A;  5J1Y A;  2K40 A;  1BL0 A;  2NVT J;  2TRT A;  5FKO A;  2JA8 J;  2RAE A;  1GUU A;  2AO9 A;  4I76 A;  3IV5 A;  1TWA J;  3BR5 A;  1W0T A;  3S2H J;  3MVP A;  2WB1 N;  2HOA A;  5BNG A;  1BJZ A;  1ETY A;  1XG1 A;  3C2B A;  3OOU A;  3TP3 A;  3S2D J;  4A3B J;  3H3V K;  1ZTR A;  2NVX J;  3HOY J;  4NDL A;  1CQT A;  2Y30 A;  3SDG A;  1OFC X;  4M3D A;  1IC8 A;  1TC3 C;  4C3I J;  1SAN A;  3HGY A;  1H8A C;  2E2I J;  2EQR A;  2IAI A;  3WHC A;  4A3L J;  1MBE A;  2DA4 A;  1ETK A;  2ID3 A;  3BTJ A;  5J1U A;  1H88 C;  2NVQ J;  2DA5 A;  4XRS A;  2XGC A;  1R9T J;  1ETO A;  1MBH A;  2XPV A;  2E1O A;  1JT6 A;  2Y0S N;  2CUF A;  4DZP A;  2CUE A;  1WH7 A;  3S1N J;  1FTT A;  3MN2 A;  3A03 A;  1HLV A;  1PUF B;  1Z0X A;  1IDZ A;  1JUP A;  3GTL J;  1X2M A;  2XGE A;  2O9L A;  1WCM J;  1BA5 A;  1Z77 A;  4D5F A;  2IBD A;  2IEK A;  4LOC A;  5M3M J;  1SFO J;  5DTD A;  3E7L A;  3G1M A;  3HBL A;  5F27 A;  1POG A;  2Y31 A;  3GBG A;  1ZK8 A;  3O8G A;  4M3B A;  4FCY A;  1H89 C;  1DU6 A;  3HB9 A;  3QPS A;  2DJN A;  1GV5 A;  1HOM A;  4A3I J;  1BW5 A;  5E3N A;  3A01 A;  5F0C A;  1UG2 A;  5EZG A;  2VKV A;  3HOV J;  3BG9 A;  3JRH A;  2L0K A;  2NVY J;  1OCP A;  4A3M J;  3I4N J;  3RKQ A;  3B6C A;  4Y7N J;  2XB5 A;  2DMP A;  2QCO A;  3GTJ J;  2VPR A;  3M4O J;  1JUM A;  4W97 A;  2KDZ A;  3HEF A;  1VI0 A;  1TWG J;  1K83 J;  4A93 J;  4BXX J;  4AUX A;  1QPI A;  1OCT C;  3FIW A;  5EG0 B;  1IRZ A;  4G12 A;  1LFU P;  3JRB A;  1ETW A;  2L7F P;  1MH4 A;  5F0F A;  2X6O A;  3RZD J;  3FK7 A;  1JTX A;  2G0E A;  2M9H A;  4B3A A;  2FQ4 A;  1GV2 A;  2R5Z A;  2JN6 A;  5EYR A;  5C4X J;  3BR1 A;  5M5Y J;  1GVD A;  2EH3 A;  1MBF A;  2FJ1 A;  3ZQF A;  4A69 C;  4C2M J;  3HGG A;  1ORK A;  2LLK A;  3JRG A;  3HOW J;  4Y52 J;  5FLM J;  2R5Z B;  1AU7 A;  3ZOB A;  1MNM C;  1W0U A;  5K7H A;  5F04 A;  1YRN A;  2K9S A;  5FKN A;  5M5X J;  2VUM J;  1FJL A;  3LNQ A;  1F36 A;  2LKX A;  1IV6 A;  4BBR J;  3CQZ J;  1MH3 A;  1AHD P;  3HM5 A;  1TWH J;  3JR9 A;  1Q1V A;  4QSH A;  3ZQG A;  2WV1 A;  3BT9 A;  1BW6 A;  1IGN A;  2XB0 X;  1RES A;  2CQQ A;  3FIS A;  3JRE A;  2MGQ A;  2E2H J;  3W6V A;  2R5Y A;  4B1R A;  3S15 J;  1NTC A;  4XID A;  1JKQ C;  2DA7 A;  4M3G A;  2HQ5 A;  1I3Q J;  4BY7 J;  4I6Z A;  2O8K A;  3F0C A;  3S1R J;  2LVS A;  2EZH A;  3BTL A;  1VF9 A;  5J3L A;  2FX0 A;  1D5Y A;  2OPT A;  4IHY A;  1A6I A;  3SJM A;  2DMQ A;  4XK4 A;  4J19 A;  3TW7 A;  1RET A;  2ME0 A;  3B6A A;  2MG4 A;  4D7N A;  1F43 A;  1HDP A;  2CU7 A;  3JRI A;  5IYC J;  4XRM A;  2XSD C;  5IYD J;  1XS9 A;  3I4M J;  2DA6 A;  4DYC A;  2K9Q A;  1MSE C;  2MW8 A;  5F1J A;  2XGD A;  3LSP A;  3BG3 A;  4JX6 A;  2ELK A;  2Y9Y A;  1ZGW A;  2DTZ A;  5JLW A;  1HDD C;  3BG5 A;  3NAR A;  3M3Y J;  2ECC A;  5FKL A;  1B8I A;  5M3F J;  3QQA A;  3ZQI A;  2JK3 A;  1TWC J;  2H8R A;  5C3E J;  1S7E A;  4JX5 A;  2NOG A;  3H0G J;  4FTH A;  1WGX A;  2O7O A;  1NK3 P;  1WPK A;  4MFE A;  2YU9 J;  3G1L A;  4X1E A;  3SFI A;  1JJ8 C;  3OSG A;  1VFC A;  4FE4 A;  3A01 B;  3FKI J;  3Q0W A;  1B72 A;  1G2H A;  5K7F A;  2ME6 A;  4FIS A;  3DCF A;  2LY9 A;  5FJ8 J;  4DYQ A;  1MSF C;  1MBK A;  3MKL A;  4A3G J;  3Q3S A;  4V2G A;  5EGO A;  3A02 A;  4C3H J;  4BKX A;  3S16 J;  2LP0 A;  1B72 B;  2CQX A;  2JA7 J;  2EZL A;  4DW6 A;  2L9R A;  1JJ6 C;  3ZQL A;  1MBJ A;  3LSG A;  4HNV A;  2L7M P;  2NS8 A;  4D5C A;  2LD5 A;  1I6H J;  5EF6 A;  4UUS A;  1FIA A;  3JRD A;  1JT0 A;  3GTM J;  4QTR A;  4X6A J;  5IP7 J;  1QVU A;  5JLX A;  5IOZ A;  4CYC A;  2ID6 A;  3VPR A;  4EEF G;  1O4X A;  1JUS A;  1U8B A;  1ZR2 A;  3D1N I;  3HDD A;  5C44 J;  3S17 J;  4UUS B;  2R7Z J;  3K2A A;  3TP0 A;  1GT0 C;  2GBY A;  3S14 J;  3K7A J;  1QRY A;  3CCY A;  2R92 J;  2AHQ A;  1EF4 A;  1JKP C;  1T33 A;  5FKM A;  2EZI A;  5E3O A;  4CYC B;  2LR8 A;  2H1K A;  3GTQ J;  2HYJ A;  2HXO A;  2DA1 A;  5IOY A;  1FTZ A;  4JX4 A;  3UKG A;  1ENH A;  4M3E A;  3TW6 A;  4RDU A;  3PM1 A;  3BQZ A;  1LE8 A;  1X2N A;  4IHW A;  1K61 A;  3PO3 J;  2JA5 J;  1X58 A;  2DA2 A;  4S0H B;  1P7J A;  3BR3 A;  5FKK A;  1YRN B;  4B4C A;  3RZO J;  1LE8 B;  2JMW A;  1JGG A;  4L5E A;  1RKT A;  1U78 A;  3RQI A;  2Y2Z A;  3IH3 A;  4BBS J;  1RKW A;  2OF7 A;  1FEX A;  1AKH A;  1IG7 A;  2YUS A;  5DS9 A;  3G1O A;  2FD5 A;  5C4J J;  3HOZ J;  1XC5 A;  2W48 A;  2NS7 A;  3BR2 A;  1LFB A;  1QVT A;  2R5Y B;  3Q0V A;  5K7Z A;  4M3F A;  4XIC A;  2D5V A;  5GP9 A;  2XPU A;  3FK6 A;  4MLO A;  2HOS A;  1AKH B;  4MO7 A;  9ANT A;  1FIP A;  1U9O A;  2DMU A;  1MBG A;  2DMN A;  2M34 A;  3ZQH A;  1RR7 A;  3GTP J;  2M2E A;  1ETX A;  4GFB A;  5J1R A;  5EEA A;  4M6V A;  1P7I A;  4V2F A;  1JTY A;  3HOU J;  4QIW N;  3PO2 J;  1I50 J;  4RBO A;  2DMT A;  1T56 A;  1APL C;  1NK2 P;  3BR0 A;  1ZKG A;  2X9D A;  5EDN A;  2LK2 A;  1PUF A;  1ZQ3 P;  2I10 A;  3HKZ N;  1OJL A;  2CJJ A;  3DEW A;  4JP0 A;  3GTK J;  2R93 J;  4DZJ A;  4AC0 A;  2P81 A;  4XRS G;  2M8G X;  5IP9 J;  1ETV A;  4A3F J;  2CRG A;  2E19 A;  1E3O C;  2PMZ N;  4UUT A;  1B8I B;  1WH5 A;  1TWF J;  2X48 A;  2EZK A;  1ITY A;  2DN0 A;  4BY1 J;  4AYB N;  4ABZ A;  4D7M A;  3LOC A;  5F0H A;  5E3M A;  2HOT A;  2LTP A;  4JYK A;  3NAU A;  2EBI A;  2VI6 A;  4A3K J;  1IUF A;  3S1M J;  3LSJ A;  4FE7 A;  2GM4 A;  2R0Q C;  1RPW A;  2JA6 J;  2XRL A;  5GPA A;  1JKO C;  3CMY A;  5IP6 A;  2HXI A;  2K9N A;  4IHV A;  3Q0U A;  2HDD A;  4A3D J;  3JRF A;  2JJ7 A; 
#chains in the Genus database with same CATH topology
 2ZB9 A;  1QBJ A;  2XHK A;  2ECB A;  1A5J A;  4CCO A;  5DDG A;  1V5F A;  1R7J A;  1A04 A;  2DA3 A;  2JUG A;  4M9Z A;  5D6F A;  2HPI A;  5F08 A;  1XSD A;  1HCR A;  4IOA F;  3LA7 A;  3OIQ A;  3ZR8 X;  2Y9Z A;  5HOD A;  2GAU A;  3CTA A;  3HYI A;  5HDK A;  1AOY A;  3C1D A;  1P4W A;  1WI3 A;  1EKE A;  2GLO A;  3PSF A;  4EM0 B;  2B63 J;  2VKE A;  3PJR A;  1T6S A;  3KP2 A;  4EJW A;  1UMQ A;  3V4G A;  3MEX A;  3OS2 A;  1VND A;  3DEE A;  2Z1D A;  4XOP A;  4BEH B;  2P5V A;  3VDX A;  4XM3 A;  1U9N A;  4IRG A;  1VTN C;  4UNO A;  4W1U A;  5L3B A;  1ETQ A;  3K4L A;  2I8D A;  2MFZ A;  1LVK A;  2IGK A;  2M0C A;  1K79 A;  1ON1 A;  4NUB A;  2BHY A;  1IDY A;  2F4O B;  2N8G A;  2FBH A;  3SFZ A;  4DYR A;  3BPX A;  3OIO A;  3EPZ A;  5M5W J;  1FNN A;  2ZKZ A;  1N77 A;  1U2W A;  2FE3 A;  2K40 A;  3G4S I;  1G4D A;  4XKC A;  3QOE A;  2AXT C;  2FSW A;  3FMQ A;  2JA8 J;  1GUU A;  2AO9 A;  3DU6 A;  4PGH A;  2XUB A;  1TWA J;  5E79 C;  1DPU A;  1DQU A;  3E5X A;  4RAY A;  2V9K A;  3S2H J;  4UUV A;  2WB1 N;  2WV0 A;  4BJ5 C;  1BIB A;  2MLK A;  1FP1 D;  3AAF A;  1BR1 A;  2BYV E;  4HAM A;  1W5C C;  1H9G A;  3S2D J;  2OV7 A;  1ZTR A;  1I1S A;  3ZQ7 A;  3J7Y J;  3CC2 I;  3SDG A;  3IUO A;  1S9H A;  4HLX A;  4M3D A;  1MND A;  5E1X A;  3MAJ A;  4LB5 A;  3HGY A;  1H8A C;  5GAG J;  3RJP A;  3FXM A;  3WTT C;  5AIP A;  2DA4 A;  1ETK A;  3OYL A;  2HDC A;  3H5R A;  3P9K A;  2ID3 A;  3JTH A;  3IWF A;  1T95 A;  2DA5 A;  3E1S A;  4HW0 A;  5E8I A;  2HQR A;  2VBZ A;  1XD7 A;  3QU3 A;  4PUS A;  1DDN A;  4BJT A;  1ETO A;  3CLO A;  1EA3 A;  2XPV A;  2LH9 A;  4RA2 A;  2F6C A;  3KCC A;  5HLI A;  1EH8 A;  1FP2 A;  2Y0S N;  3LSM A;  2CUF A;  1WH7 A;  1FTT A;  3DF8 A;  4N0B A;  1R00 A;  4AVP A;  2JA2 A;  4E70 A;  3FWE A;  1Z0X A;  1Y0U A;  2VXD A;  1QO0 D;  1WCM J;  3ZQQ A;  1WJB A;  2Z3Y A;  3M1C A;  1YYV A;  2IBD A;  4A2U A;  3E5Q A;  5DTD A;  5F27 A;  1SD7 A;  2XC7 A;  2ZO4 A;  1POG A;  4G8X A;  4IQJ A;  2V7F A;  1MMD A;  4FCY A;  2J5P A;  3IWZ A;  1DU6 A;  3QPS A;  3OR2 C;  4UB6 C;  3ABM H;  1K78 B;  3FM3 A;  3N05 A;  4N4O B;  1HOM A;  3SEZ A;  1IN5 A;  2EFP A;  2VC0 A;  1HA8 A;  3MKY B;  3HOV J;  4ENM A;  1D8K A;  1OCC H;  3JSO A;  4ENK A;  3GEZ A;  1Q1H A;  1Z3X A;  3H3Z A;  4RGS A;  5B3S H;  1BBY A;  4RM3 A;  4I02 A;  2Y0S A;  1J2X A;  2XB5 A;  2W25 A;  4HST A;  2QCO A;  1B4A A;  1QZY A;  3HUG B;  2VPR A;  3VYS B;  2O03 A;  3OYG A;  4M74 A;  2E34 A;  3HEF A;  1N25 A;  1TWG J;  3Q9V A;  4G6D A;  3EUK L;  4L0Y B;  4A93 J;  4XR6 A;  5FFZ A;  3HHG A;  3ABT A;  1OCT C;  2PLY A;  3FIW A;  3E6C C;  1ONV A;  4YFN F;  1ETW A;  2X6O A;  2EFQ A;  1TLH B;  1H9T A;  1JTX A;  2G0E A;  2Z99 A;  2MC4 A;  4G94 A;  4B3A A;  4LIU A;  3BG6 A;  4ZTJ A;  4AVZ A;  2R5Z A;  2DXI A;  4AWX B;  3QU6 A;  2NOJ B;  2FBK A;  3WTU C;  5C4X J;  2FJ1 A;  3PQJ A;  3ZQF A;  2RGV A;  2FOK A;  2HWV A;  4F52 A;  3MFK A;  3JRG A;  5LEK A;  4Y52 J;  2R5Z B;  4NQW A;  3ZOB A;  2EIN H;  2FNP A;  1MNM C;  4OMZ A;  4R1H A;  1UST A;  4IVN A;  2JPB A;  1YRN A;  2K9S A;  3LAP A;  3V7C A;  2VJ4 A;  3GFJ A;  5LGU A;  5M5X J;  4IO9 F;  2VUM J;  2KHM A;  2L9S A;  1FJL A;  1F36 A;  4XRF A;  4BBR J;  3CQZ J;  1AWC A;  5HNF A;  4I0A A;  4X0G A;  1JHF A;  5L3E A;  1IAW A;  1U6G A;  1Q1V A;  4QSH A;  3CF5 F;  2QLZ A;  1SMT A;  3BT9 A;  1R4M B;  1Z1D A;  4YEJ A;  4KNY A;  2IA1 A;  1WJA A;  3O3K A;  2A69 F;  2KIF A;  3TMO A;  3JRE A;  2M30 A;  2QWW A;  2MGQ A;  4KFC A;  3FXJ A;  3W6V A;  1SEU A;  2R5Y A;  1NTC A;  1R4N B;  2XIG A;  3TDU C;  4M3G A;  2JRT A;  2L7K A;  1VQ8 I;  1I3Q J;  5TGT A;  3X2Q H;  2O8K A;  2BY1 A;  5E1Z B;  2CUJ A;  4D9J A;  5BPD A;  4GRI A;  4DJA A;  1KON A;  3KLN A;  4CYD A;  1U5T C;  1KQ0 A;  1R5I D;  1B9M A;  1GXQ A;  3SJM A;  2RN7 A;  4HRI A;  2ZFW A;  2M4G A;  3OWT A;  2ME0 A;  2HTJ A;  3HSE A;  3JTG A;  3ZPL A;  1KYW A;  4HX7 A;  3TQN A;  3FXK A;  4XOT A;  4M71 A;  1XS9 A;  3I4M J;  3OS1 A;  4IPA A;  2OC6 A;  3EUA A;  3BC8 A;  2UXX A;  4PFO A;  4LLL A;  4KMF A;  4XNF A;  1IUY A;  1HKT A;  5L3C A;  4E7K A;  3DP7 A;  2DTZ A;  5JLW A;  2GA2 A;  4ASN A;  4CXF A;  4DIQ A;  3EYY A;  2AQE A;  3GME A;  5LGT A;  3WG9 A;  2HEO A;  1ZAR A;  3COA C;  2WBM A;  2H8R A;  3LFU A;  1S7E A;  3DTI A;  1QZZ A;  4TV7 A;  3H0G J;  3PIP F;  4FTH A;  2R7T A;  4CDG A;  1XSV A;  1IW7 F;  2EIK H;  1WPK A;  3NWS A;  2HS5 A;  4MFE A;  1OLT A;  4F93 B;  1TNT A;  1S5L C;  4M6X A;  4E7H A;  4XLA A;  2W1O A;  4BU2 A;  1I3A A;  2JPC A;  2QQ9 A;  3LWF A;  1YX5 A;  1G2H A;  5K7F A;  3VOE A;  1PVE A;  1IN6 A;  5DV5 A;  3ERE D;  3R0J A;  1MJB A;  1S8N A;  1RZ4 A;  5FJ8 J;  4DYQ A;  1MSF C;  1MBK A;  3E6B A;  3MKL A;  4A3G J;  4BQA A;  4V2G A;  1U5T A;  3C2H A;  2JA7 J;  2B0L A;  3FXR A;  1VQM I;  1TQM A;  1BOB A;  2P7V B;  3LSG A;  4II3 A;  1YJ9 I;  2PG4 A;  2IS1 A;  1KU9 A;  2HZT A;  4D5C A;  3F9K A;  1I6H J;  5EF6 A;  3PNT A;  1U5T B;  3SXY A;  5JR3 A;  1SFE A;  4QTR A;  4X6A J;  4BJ6 C;  4Q5S F;  3U1D A;  3I56 I;  2W57 A;  5JLX A;  4HF1 A;  1XDS A;  5KAF C;  4EEF G;  3IHU A;  1ZR2 A;  3HDD A;  3DEU A;  5C44 J;  1PP7 U;  5D5U B;  4RAZ A;  2R7Z J;  2PFB A;  3K2A A;  1GT0 C;  2GBY A;  3OMY A;  2NXN B;  2OZ6 A;  2R92 J;  2RNG A;  1MIJ A;  1EF4 A;  4A12 A;  1T33 A;  2H1K A;  2EZI A;  4KIC A;  2IP2 A;  2KIQ A;  4JX4 A;  3ONQ A;  4B44 A;  4KN4 X;  4QPQ A;  3TW6 A;  4XQF A;  1PUE E;  5HVQ C;  2E1N A;  2DFH A;  2L01 A;  3BLY A;  2MH9 A;  1QNT A;  1Z6T A;  4OIR F;  2DA2 A;  1R36 A;  3BR3 A;  4BQN A;  5FKK A;  3BOQ A;  4RMN A;  1ERD A;  2VBY A;  2IGM A;  3OIP A;  4J01 A;  1D3Y A;  2ZXJ A;  5BMZ A;  3RQI A;  4UY8 I;  1MJA A;  3ZN1 A;  4BBS J;  1RKW A;  3KZY A;  1AKH A;  2D2W A;  1UCR A;  1X1A A;  3F6O A;  3G2B A;  4D0P A;  2W48 A;  4I09 A;  5K7Z A;  4XIC A;  4IX7 A;  4HNU A;  4A5N A;  2HOS A;  2JUC A;  3AL0 C;  1AKH B;  2GXB A;  5DM7 F;  2Y69 H;  2WAQ A;  2MH2 A;  4OIQ F;  4O3M A;  2FNA A;  3OYC A;  1YJW I;  4EJU A;  3OYM A;  3Q5F A;  1S6L A;  3HSR A;  1RR7 A;  3GTP J;  3LSK A;  1ETX A;  3DU5 A;  2KKO A;  4KJZ A;  4GFB A;  1OCO H;  1TBX A;  2DT7 B;  3CDI A;  4HOB A;  3HOU J;  2CGP A;  4IHT A;  4PJJ A;  3PO2 J;  2PQ8 A;  3M8J A;  1L0O C;  2PN6 A;  3J80 Z;  3C7J A;  2X4H A;  1NK2 P;  4IKF A;  2STT A;  3LST A;  2QBY A;  2V9V A;  1PUF A;  1ZQ3 P;  2I10 A;  2LDU A;  3OYI A;  2NYX A;  3DKW A;  4E7I A;  5K5Q A;  3DTK A;  3H1C A;  5L3D A;  1YTY A;  2F5F A;  5ICE A;  2XAJ A;  5HS8 A;  4A3F J;  1G3T A;  2CRG A;  5E18 F;  1SMY F;  4OAZ A;  1E3O C;  4HV6 A;  1XDU A;  1RI7 A;  2X48 A;  1YOV B;  4H4K C;  2DN0 A;  3MMY B;  4WXD A;  3EYI A;  4AYB N;  5F0H A;  1UHW A;  3V7S A;  2HOT A;  4XLC A;  2NS0 A;  2R7Q A;  3TO6 A;  3CMM A;  4OMY A;  3HRM A;  3MWM A;  5JHU A;  3CMA I;  3DBL B;  3CO6 C;  2JA6 J;  5ERI A;  3L2W A;  2M45 A;  3L09 A;  3KPH A;  1VQN I;  2YX4 A;  3F6V A;  2GOM A;  3A4C A;  3Q0U A;  2HDD A;  1XCV A;  2CUZ A;  2YR2 A;  4FET A;  4OU0 A;  4L18 B;  3F23 A;  4MQ9 F;  1Z67 A;  1B1B A;  4CH7 A;  2M7B A;  2MD5 A;  3JAM Z;  3TED A;  3NEU A;  2R7W A;  3AL0 B;  2H6C A;  2FUG 2;  1E3P A;  5GTI C;  1ZR4 A;  3DWL E;  2EA2 A;  2VQH A;  5LHI A;  2LFB A;  1FY7 A;  2FBI A;  1FYL A;  1VQK I;  4WX9 A;  3JRA A;  1UHS A;  1KGS A;  2F5C A;  2BY2 A;  5J8C A;  4CCJ A;  2VL8 A;  2TCT A;  1B6A A;  3BR6 A;  3GTG J;  3BQY A;  1LDK B;  2QZ8 A;  3I59 B;  4KT5 C;  4Q47 A;  2IPQ X;  2Y0M A;  2W82 A;  2JWT A;  5KNL A;  2CV2 A;  2K85 A;  2XPW A;  3ABL H;  4ZDP A;  4ZDO A;  3G71 I;  3GTO J;  3HOX J;  1HXD A;  2Z16 A;  5BQT A;  1GDT A;  3ZQC A;  4ZDL A;  4B09 A;  4A3J J;  3BTI A;  2VBX A;  2YS9 A;  2PX9 A;  1BL0 A;  2BV6 A;  3E0J B;  3LA2 A;  2VC1 A;  4LB6 B;  3FBN B;  1IN7 A;  4LGW A;  5FKO A;  2RAE A;  4PK4 A;  3IV5 A;  2Y48 A;  1D1B A;  1W0T A;  5LEJ A;  3I4P A;  3KEO A;  4KA4 A;  3G73 A;  2HOA A;  3LSI A;  4QLC U;  2R7R A;  1ETY A;  3C2B A;  1BJA A;  2V6C A;  2L02 A;  2DK5 A;  3HOY J;  1TT0 A;  4NDL A;  1CQT A;  4M9S A;  2X85 A;  2DFF A;  5D4S A;  3LA3 A;  1IC8 A;  2PEX A;  1OQY A;  3OYK A;  2X0L A;  4F55 A;  3N4M A;  1D1C A;  2F2E A;  5ICC A;  1H88 C;  2CYY A;  2NAZ A;  4XRS A;  3EDP A;  3LQR A;  1LEB A;  2IA2 A;  2YU3 A;  1XSX A;  2R7O A;  2WY8 Q;  1IRF A;  1JT6 A;  1IF1 A;  3KP7 A;  3HG9 A;  1KQ8 A;  3FXQ A;  3O2P E;  3JRF A;  1RR8 C;  5DEQ A;  2VOP A;  2CW0 F;  3QPH A;  3MN2 A;  1VQP I;  3W6K B;  2XAS A;  2DFE A;  2K3P A;  3A03 A;  1X1D A;  2V4J C;  1HLV A;  3T5X A;  1IDZ A;  3L2R A;  3S3M A;  4Y15 A;  2O9L A;  3WG7 H;  5IT9 K;  3BZK A;  3T8T A;  2IEK A;  4LOC A;  1CF7 B;  1YW8 A;  3E7L A;  3F72 A;  3P9C A;  1Z91 A;  4ZYD A;  5FRO A;  4I98 B;  3O8G A;  3FXU A;  4M3B A;  1N75 A;  2DTR A;  1H89 C;  3L2V A;  3HB9 A;  2CV0 A;  4PJ0 C;  3HZJ A;  3KP6 A;  4Y3O A;  1EH6 A;  3JCU C;  4HPQ A;  2KIS A;  2VQL A;  3A01 A;  1W4M A;  3IRQ A;  1QGP A;  1P2F A;  4S04 A;  3ZRG A;  3BG9 A;  1P6R A;  2Q1Z B;  1ZG1 A;  3KP4 A;  3OYF A;  2DJI A;  1X1C A;  3I4N J;  1BIA A;  2KQR A;  4G7Z F;  1BN5 A;  5LBQ A;  4AID A;  4Y7N J;  3OOP A;  1ZH5 A;  3DXJ F;  4Q48 A;  4IL6 C;  3RI4 A;  2W85 A;  2DOA A;  5KHD A;  1FWZ A;  2ZFU A;  2LKS A;  5FD6 A;  1ZRF A;  3F22 A;  1FZP B;  2OA4 A;  3PFY A;  1U3E M;  1IRZ A;  2A6T A;  1Z21 A;  5F0F A;  4HX8 A;  3FK7 A;  5J4Y A;  1TTY A;  4U0Y A;  4KDP A;  2B7E A;  2E35 A;  1G59 A;  2FQ4 A;  5J6X A;  1Z6R A;  2LF7 A;  5B1B H;  1UG0 A;  5EYR A;  1L3L A;  2E7W A;  3BR1 A;  4KIF A;  1GVD A;  2GA1 A;  2VBW A;  4CO8 A;  2QA4 I;  3ZMZ A;  4BHC A;  2QYO A;  2ELJ A;  4BQQ A;  2B9S A;  3AG1 H;  3HOW J;  5FLM J;  1AU7 A;  4AIH A;  1W0U A;  4KMU X;  3TDZ C;  5F04 A;  4E7Z A;  4IXA A;  1MW7 A;  1FOY A;  2ZXH A;  3WTV C;  2M4K A;  3FHZ A;  1T8I A;  3F8C A;  4YII A;  2H1L A;  3HRS A;  2IGN A;  5CLS A;  1AHD P;  2WC2 A;  1FBS A;  4IZZ A;  3OL4 A;  1R1T A;  2QEN A;  5IY5 H;  3ZQG A;  2H8W A;  4E7J A;  2WWY A;  5F1R A;  4PFP A;  2GXA A;  3CJR B;  3ZXS A;  2CQQ A;  1Z3Y A;  4IJA A;  2WAF A;  2E2H J;  4LLG F;  2DPD A;  4ON0 A;  3ROU A;  2DA7 A;  4QWQ A;  2HQ5 A;  3WTZ A;  4WXC A;  4BY7 J;  5HLT A;  3F0C A;  2LVS A;  2CFX A;  2EZH A;  5CVV A;  4LG0 A;  3F21 A;  1S3J A;  3CZ6 A;  3A2K A;  3ECO A;  4IHY A;  3IC7 A;  2W24 A;  4XK4 A;  2JVH A;  4AIK A;  4II2 A;  1J7K A;  1RET A;  2CW7 A;  2BW3 A;  2OBP A;  4LG0 B;  2JSP A;  3B6A A;  2MG4 A;  3FXO A;  2WTE A;  4RGU A;  1V54 H;  1B9N A;  4Y17 A;  5EJC A;  5L3G A;  2RKH A;  3EET A;  2XSD C;  1YIJ I;  5IYD J;  3K4B A;  4PJL A;  1P92 A;  2DA6 A;  4DYC A;  1RC9 A;  2BW3 B;  4F92 B;  2STW A;  3B02 A;  3HPG A;  2MW8 A;  5CQG A;  3KYD B;  1TZL A;  2XGD A;  3MKW B;  1C0W A;  3WTY C;  1I1G A;  3BG3 A;  1JE8 A;  1W5T A;  1QQI A;  1T2K A;  1ZGW A;  1WJF A;  4BAC A;  2VJI A;  3BG5 A;  3WU2 C;  3M3Y J;  3T8R A;  3SZT A;  3K6G A;  4F91 B;  3QQA A;  1LEA A;  3GZ6 A;  2KPM A;  4ZYG A;  1O3Q A;  5C3E J;  1BI3 A;  3V8K A;  4GGG A;  5AIQ A;  5J40 A;  3V7R A;  1BI2 A;  1QHH D;  2LC2 A;  2OD5 A;  1FT9 A;  5DUI A;  1NK3 P;  1VQ6 I;  2YPR A;  1KA8 A;  5GAE J;  1J75 A;  2VKD A;  2DOD A;  2VQC A;  3SFI A;  3J81 K;  5B5E C;  1ZG5 A;  2R7S A;  1VFC A;  1FOW A;  5D4R A;  3I71 A;  1DUX C;  2ME6 A;  3I58 A;  3PNV A;  1JI8 A;  2ESN A;  3ZP5 A;  2LY9 A;  5ILU A;  1K6Y A;  4EGZ A;  5EGO A;  2EPF A;  3HL2 A;  4BH9 A;  4N9I A;  4IOC F;  1SVL A;  2L9R A;  1JJ6 C;  3ZQL A;  3RTR A;  3S8P A;  2LYC A;  2NS8 A;  2X6W A;  2LD5 A;  4PJN A;  3ULQ B;  4UUS A;  3JRD A;  2Q2E A;  1JT0 A;  2XAQ A;  4MHG A;  3CO7 C;  4RAF A;  3K4J A;  2JVG A;  2BVM A;  1J5Y A;  5JFR A;  4E7S A;  3VPR A;  1Y39 A;  1G8X A;  1O4X A;  1U8B A;  4UUS B;  3MCZ A;  2Q2E B;  2D1V A;  1WHU A;  3TP0 A;  3L7W A;  3S14 J;  4ZTF A;  3E6D A;  2RV8 A;  5GTH C;  3ASN H;  2AHQ A;  1Y8R B;  3CCM I;  4KT6 A;  2R7V A;  2DA1 A;  1XB4 A;  2DU9 A;  2X1C A;  3NWT A;  2OTJ I;  2DT5 A;  3ERM A;  2KFD A;  4RDU A;  1G3Y A;  1HSJ A;  3IAM 2;  3PM1 A;  1LFP A;  3BQZ A;  4IHW A;  1K61 A;  1A36 A;  2EV0 A;  3PO3 J;  2F4I A;  3R61 A;  1X58 A;  3LAJ A;  3T1B A;  1J9I A;  4NQW B;  3MQ0 A;  2FXA A;  2VN2 A;  4S0H B;  1YRN B;  3RZO J;  3V8L A;  2H6B A;  4B47 A;  2RQQ A;  1RKT A;  4L5E A;  3CJQ B;  1BC8 C;  2BGC A;  1IG7 A;  2YUS A;  5DS9 A;  3CCS I;  1IXS B;  3HOZ J;  5E17 F;  3BR2 A;  1BI1 A;  2R5Y B;  4M3F A;  4I99 C;  5GP9 A;  2E36 A;  4NB5 A;  1G6N A;  2HVQ A;  3GZN B;  4XKW A;  3K0L A;  1U9O A;  2DDB A;  4B48 A;  1MBG A;  2DMN A;  4YEL A;  5FRN A;  1O3S A;  1ZLJ A;  3IKT A;  2GIZ A;  5CYV A;  4L5J A;  1SAX A;  3D5R C;  3ZMS A;  1R23 A;  1FPQ A;  5J1R A;  4M6V A;  1JTY A;  5KAI C;  1DGW Y;  2A5Y B;  3KZZ A;  4EAT A;  1B59 A;  2P7C B;  4RBO A;  1APL C;  2QQ8 A;  2NVU B;  2P6T A;  5J4V A;  3K2Z A;  5DUK A;  1T98 A;  1OJL A;  1TQP A;  3HRT A;  3K69 A;  4JP0 A;  2JQ7 A;  2DT6 A;  4EM1 A;  2R93 J;  1ACI A;  4EGY A;  5DD4 A;  4AC0 A;  5CVR A;  2P81 A;  4XRS G;  2P6S A;  4G9Y A;  5DCM A;  1HBX G;  4PSW A;  4AM3 A;  4UHT A;  4HX4 A;  2PMZ N;  2Y75 A;  4U88 A;  5DYM A;  3TO7 A;  1ITY A;  2EZK A;  2FF4 A;  5CJ9 A;  4D7M A;  2P8T A;  3RYP A;  4P55 A;  4R8H A;  3VSK A;  1R6R A;  2BEO A;  4G7O F;  1U0J A;  4JYK A;  2VI6 A;  4A3K J;  4A6D A;  1IUF A;  1ZHF A;  2GM4 A;  1XPX A;  1NG6 A;  2ACJ A;  4BUP A;  1LQ1 A;  5GPA A;  1LJ9 A;  2OQG A;  2XAF A;  2K9N A;  5A2Q K;  4Y33 A;  4IHV A;  3ZCO A;  3BG7 A;  2K5C A;  2JJ7 A;  4QPO A;  3ZGK A;  2CMP A;  2XF6 A;  3F8F A;  4YFX F;  3J7A O;  5FLV A;  2G9W A;  3CJN A;  1WJD A;  3KYL A;  1U8R A;  3BTC A;  1J59 A;  4DOZ A;  4HDU A;  3IH2 A;  3PL8 A;  1FBQ A;  4F7Z A;  2BXZ A;  2DOF A;  1FOX A;  1WJ5 A;  2CO5 A;  3BPV A;  3OYA A;  5EG0 A;  4RLQ A;  2AS5 F;  1X3U A;  2RC4 A;  4IEJ A;  2VOD A;  2PMZ A;  1O3R A;  3PIO F;  2NRA C;  2L7Z A;  3ELK A;  4CGZ A;  1FBU A;  4MQV A;  3JRC A;  4M9X A;  2CSO A;  2XAU A;  2R3S A;  3HOS A;  2WAQ N;  4S05 A;  1MJ9 A;  3S1Q J;  3OSF A;  2Q0O A;  3U2R A;  3L2U A;  1IJW C;  3SQN A;  5EZH A;  1IN4 A;  2DAO A;  4HSR A;  4MFD A;  5CVJ A;  4ESB A;  4JQF A;  1DU0 A;  4B8X A;  3OR1 C;  4A3E J;  3GUD A;  2EFO A;  2ELH A;  2LSO A;  2QSH X;  1FMV A;  3TOA A;  5E3L A;  4AD9 A;  3K70 D;  4LLN A;  3KE2 A;  2K86 A;  4UVA A;  3FZV A;  3R4K A;  1JKR C;  1HF0 A;  2GQQ A;  5HDN A;  2HGC A;  1XN7 A;  4IRI A;  1O7F A;  3CDL A;  1LDD A;  4HF0 A;  5D8L B;  3S2W A;  4C3J J;  3DV8 A;  3L00 A;  3VB2 A;  4I7H A;  3ZMT A;  1TQI A;  1YJN I;  4LFU A;  5E20 A;  2TRT A;  3C3W A;  4EM2 A;  1IO2 A;  1FSH A;  3RPU A;  2P0W A;  4GDF A;  4HBL A;  3BR5 A;  5K5R A;  3WTX C;  2DK8 A;  2WY7 Q;  3MVP A;  2A07 F;  3BY6 A;  4L9T A;  1YIT I;  3DBH B;  4CCM A;  5HLH A;  1W7P A;  2MLG A;  4A3B J;  3HXL A;  4RB0 A;  3TP3 A;  2IS6 A;  1TW2 A;  3V42 A;  2WAE A;  2Y30 A;  2KJC A;  5TJJ A;  3ZMV A;  3DKY A;  4C3I J;  2JTV A;  1OCR H;  2K02 A;  1SAN A;  2GXG A;  3H36 A;  4Q4Z F;  3WHC A;  2PJP A;  1W7P B;  1IXR C;  3KX2 A;  1E2X A;  2VE8 A;  1MBE A;  3AFH A;  1GXP A;  3W2W A;  2NVQ J;  3PUB A;  5LD2 C;  2ISZ A;  2IS2 A;  4FT8 A;  2IA0 A;  2CV1 A;  2HVR A;  2V1X A;  2XDV A;  4UVB A;  4DZP A;  3ECH A;  1ZGJ A;  1USS A;  4HV5 A;  3S1N J;  1M1E B;  2QGU A;  2QQB A;  2QBY B;  3HJE A;  2H09 A;  1PUF B;  3FX3 A;  1PJR A;  1SVM A;  4RGR A;  2XF5 A;  3JSP A;  1JUP A;  2XGE A;  1BA5 A;  1Z77 A;  4D5F A;  5M3M J;  4KIS A;  2IVM A;  1K4T A;  4A6E A;  2ETH A;  3GBG A;  4OIN F;  4E4H A;  4R79 A;  1STZ A;  5CVU A;  4MEX F;  1XMX A;  2PI0 A;  1YX3 A;  4FQG A;  2A05 A;  2DJN A;  2NNN A;  5KK1 A;  4CZZ A;  5IT9 Z;  2LBF A;  4A3I J;  5E3N A;  5F0C A;  2V6E A;  1SD5 A;  2VKV A;  2DO7 A;  3FM5 A;  1TT5 B;  4HG2 A;  1EV7 A;  3M7G A;  4HNT A;  3JRH A;  3RYR A;  2LBF B;  1K4S A;  2QQA A;  1OCP A;  4CUG A;  5J8F A;  3RPU D;  2BY3 A;  5LRS A;  3VSL A;  4YIF A;  2HR3 A;  2XKP A;  2DMP A;  2IJL A;  3NRV A;  4YRV A;  3GTJ J;  1X4P A;  3H9Q A;  1JUM A;  1W7P D;  4FX4 A;  1YO5 C;  4W97 A;  3AG4 H;  2KDZ A;  2W4S A;  5E8G A;  3OYE A;  2HOE A;  1K83 J;  3VOD A;  4M72 A;  4BXX J;  1WZ2 A;  2D45 A;  1TW3 A;  2PMU A;  3GW2 A;  1FLI A;  4Z2Y A;  4G12 A;  4ESF A;  1KU3 A;  1LUJ B;  1MH4 A;  3GWZ A;  3U9G A;  4XMY A;  4HYE A;  3DQV C;  2FOW A;  4YIR X;  2M9H A;  2GOX B;  4BL0 B;  4DNC A;  2DLL A;  4IQ4 A;  2WA0 A;  2Z33 A;  3K4N A;  3WU1 B;  4HQM A;  3D0S A;  2LRD A;  3BJO A;  2JN6 A;  4OWR B;  3R60 A;  3H35 A;  5M5Y J;  3S93 A;  1MBF A;  4A69 C;  4C2M J;  1EJ9 A;  1PYV A;  3HGG A;  1WI9 A;  1ORK A;  1QPM A;  3CCE I;  4G7H F;  1G3S A;  3EQL F;  4XLP F;  1UB9 A;  1DGR M;  5FKN A;  3OYD A;  3LNQ A;  2LKX A;  2RNJ A;  2XGX A;  4BDZ A;  1TWH J;  3BDD A;  3EUH A;  2WV1 A;  3CLQ A;  4EMS A;  3SDB A;  1H0M A;  2IT0 A;  3CCU I;  3S32 A;  2XB0 X;  3F3X A;  3SEQ A;  3TL4 X;  1R58 A;  2XKO A;  3F8N A;  1BC7 C;  3CCQ I;  4B43 A;  1G3W A;  2QUF A;  1XGS A;  2ZME A;  4I01 A;  2Z9O A;  3S15 J;  4LG3 A;  4CHU A;  4EV0 A;  4I6Z A;  2EWN A;  3S1R J;  1HKS A;  4BXF A;  3BTL A;  1VF9 A;  2FX0 A;  3CCL I;  1RUO A;  1LKX A;  3F8B A;  2QKL B;  3R6S A;  1D5Y A;  2OPT A;  1WVR A;  3CJT B;  4NHJ A;  1A6I A;  3S3O A;  1YE9 A;  1K6O A;  1J0R A;  2DMQ A;  4EQQ A;  3QYF A;  3TW7 A;  4RAG A;  3VYR B;  3W6J B;  1MKM A;  4D7N A;  1YS7 A;  1S29 A;  2XRN A;  1HDP A;  2CU7 A;  3OYH A;  3JRI A;  2HYG D;  4JK1 X;  1VQO I;  3B73 A;  1OR7 C;  4BXU A;  2VT3 A;  1R71 A;  2EA4 A;  3FKJ A;  5D6E A;  1VQ7 I;  3CCJ I;  2LMD A;  3E97 A;  4XKB A;  1Y0N A;  2FML A;  2KL4 A;  2QKM B;  2K9Q A;  1Z7L A;  2CG4 A;  2OQR A;  3FDY A;  1UHM A;  3BWG A;  1SVO A;  3P9I A;  3TKY A;  4D1Q A;  2LKP A;  1GVJ A;  2D1H A;  4JX6 A;  1YFH A;  2ELK A;  2Y9Y A;  1W36 D;  1HDD C;  2XRO A;  3GFL A;  3OS0 A;  2W84 A;  2ADU A;  5DD8 A;  3IL2 A;  1B8I A;  5M3F J;  4AU7 A;  2HVS A;  2HZD A;  5F6F A;  3ZQI A;  2E1C A;  2MC3 A;  1AA7 A;  2H94 A;  2DDA A;  4WK8 F;  1F4K A;  3TGN A;  4JX5 A;  2KIM A;  2NOG A;  1J09 A;  1VQL I;  4RGX A;  2L2O A;  1WGX A;  2FQ3 A;  3DPT A;  2QSF X;  2OJE D;  5H6Q A;  1MMG A;  2ZJP F;  4DBR A;  3HHH A;  1T38 A;  3OSG A;  4FE4 A;  1YS6 A;  4I2O A;  3A01 B;  4PJM A;  2VB6 A;  4XON A;  1XCB A;  2KJB A;  3MZ8 A;  4XKV A;  1NG7 A;  2VJJ A;  3Q3S A;  4G6T B;  4C3H J;  2IXS A;  4BKX A;  3J81 Z;  3CCR I;  3H3U A;  1ZRC A;  4M73 A;  3S16 J;  3KP3 A;  1IRG A;  2CQX A;  3FMR A;  2EZL A;  1SC7 A;  4XN3 A;  2CH0 A;  3WE2 A;  4JOM A;  1MBJ A;  2ICW G;  1OMI A;  1MDM A;  4HNV A;  2L7M P;  3RKW A;  1X4O A;  2EV6 A;  2X1D A;  1KYZ A;  2M3A A;  2OTL I;  2EV5 A;  2G7H A;  5ILS A;  2LF8 A;  1FIA A;  3HKZ A;  3GTM J;  1HW2 A;  3J7A Y;  2QEX I;  5IP7 J;  1OR7 A;  3M07 A;  3A0B C;  2H27 A;  1KZH A;  2HYF A;  1MDM B;  1WRJ A;  2ID6 A;  3L9F A;  3RCO A;  4FAS D;  1DPR A;  3KEQ A;  1JUS A;  3MD2 A;  5H20 A;  3D1N I;  3H9G A;  1IRX A;  1UAA A;  3S17 J;  4RB1 A;  3KFW X;  3K7A J;  1IZ1 A;  2HKX A;  2F5E A;  3IAS 2;  4BEH A;  2ZSH B;  3CCY A;  1R49 A;  3ML6 A;  2P4W A;  1P4A A;  4PGG A;  4A0Z A;  5BOX A;  1JKP C;  5E3O A;  2O6G E;  2PMH A;  3GTQ J;  1BI0 A;  2HDW A;  5ICG A;  1OKR A;  2HXO A;  1D0X A;  3BJ6 A;  4P1W A;  3ZMU A;  2DYR H;  5IOY A;  4HDV A;  4M3E A;  2HPM A;  4UB8 C;  5TIS C;  2RRE A;  3DFG A;  2LY2 A;  1LDJ A;  2K9L A;  1LE8 A;  1X2N A;  3K4M A;  2JA5 J;  1FYM A;  2EB7 A;  1P7J A;  2X51 A;  3KZI C;  1I6X A;  5JVT A;  3QOP A;  2DYS H;  5TRD A;  4B4C A;  1KU7 A;  1ULY A;  1LE8 B;  1WJE A;  1JGG A;  1WFX A;  2EFN A;  2FEZ A;  2KRH A;  3ISP A;  3KEY A;  3CD6 I;  1XX5 A;  2V1D A;  2ZXW H;  1P4X A;  1ZEL A;  2AQF A;  2OF7 A;  5BPI A;  4V19 K;  2FD5 A;  2IGO A;  1X3W B;  5FO5 A;  4ZYE A;  5FLX K;  2DOE A;  2HFH A;  4WXH A;  5FD5 A;  1OYY A;  4XOR A;  1QVT A;  2XSJ C;  2DFI A;  2D5V A;  1T08 B;  3FK6 A;  1FC3 A;  2YX7 A;  3M9A A;  4MO7 A;  1DP3 A;  1SFX A;  2COM A;  4LIV A;  3WGG A;  2V9P A;  1RRJ A;  1I5Z A;  1IV8 A;  2M34 A;  4BNC A;  1WJC A;  2TDX A;  4MTD A;  4KIG A;  2M2E A;  4LIT A;  3KET A;  4IHS A;  3A1Y A;  3OL3 A;  4U7B A;  4XBF A;  2CQ7 A;  5EEA A;  4CCK A;  1P7I A;  4V2F A;  5LFA A;  2C6Y A;  5LRR A;  4HA8 A;  2CW8 A;  3WOD F;  4UV9 A;  3GFM A;  1W1W E;  1I50 J;  1MZB A;  2DMT A;  2KLO A;  2XV4 S;  3BR0 A;  1ZKG A;  2X9D A;  2K4J A;  3GLL A;  1XMA A;  1HW5 A;  1HKQ A;  1SD6 A;  3BZ6 A;  1FSE A;  2FRH A;  4ENJ A;  2LOO A;  3GXO A;  3DEW A;  3O6B B;  1UJ8 A;  3AKZ A;  1OPC A;  3VYT B;  4CA0 A;  4ZZL A;  2ISY A;  3M8F A;  2DBB A;  2E5Z A;  2E19 A;  1Y8Q B;  4HZF A;  4G6Q A;  2BE5 F;  2F5V A;  2CWE A;  2WB1 A;  4UUT A;  5JVG F;  2HKO A;  4ZYA A;  4MEY F;  1K78 A;  4XLE A;  4ABZ A;  5HNH A;  2ZXI A;  3LOC A;  3W3C A;  1EH7 A;  1OCZ H;  2YSR A;  2VIX A;  2M0M A;  2M8E A;  2UZK A;  2L9N A;  4J00 A;  2EBI A;  3M1E A;  3S1M J;  3LSJ A;  4FE7 A;  2P5L C;  1MMA A;  1RPW A;  5CKT A;  4PDK A;  2A6E F;  2M1B A;  4L5I A;  4MGR A;  2OCC H;  2BY0 A;  2HXI A;  4Y4R A;  2BOL A;  2JT1 A;  3LL7 A;  4A3D J;  2AXL A;  3ZN0 A;  3DKX A;  1Y1W J;  3L2C A;  2MSY A;  3HUG A;  1VQ9 I;  1QA6 A;  4WWC A;  2HI3 A;  5EGO B;  1MD0 A;  2VJ5 A;  3O8H A;  2E2J J;  4YFK F;  5GPC A;  3QAH A;  5A2Q Z;  2QVO A;  1I27 A;  3IH4 A;  4U0W A;  4CZC A;  1Z05 A;  3HC7 A;  2LNB A;  4RLF A;  5IYB J;  2RQP A;  3I64 A;  5DCF A;  4Y13 A;  3CC4 I;  3LSH A;  2IW5 A;  3L1P A;  3T0Y A;  1WSU A;  3IKV A;  3GZ5 A;  3E3V A;  2M7A A;  4KN7 X;  1A35 A;  3QPL A;  2BVL A;  4IHX A;  1GHC A;  2UV1 A;  1PP8 F;  3LSR A;  4H0E A;  3P5J A;  3KIO A;  2V79 A;  2RVC A;  3K1M A;  1OYI A;  3K70 C;  2E7X A;  2Q8K A;  2LG4 A;  4CCL A;  4ZH4 F;  4MIM A;  1IXC A;  3LQQ A;  3CP8 A;  5JI6 A;  2COB A;  2A6H F;  1Y1V J;  3QOD A;  3AG3 H;  3CC7 I;  2M5W A;  2OAZ A;  5BS6 A;  4GYG A;  3GLX A;  4EJV A;  3C2G A;  2KT0 A;  4A3C J;  5LLQ A;  5K5O A;  4A5M A;  1BR4 A;  5IPA A;  3ESW B;  1LB2 A;  3MZY A;  3OV8 A;  2KDO A;  4CSW A;  5B1A H;  1Z7U A;  2QF7 A;  4HQE A;  1X1P A;  3WHB A;  3HSF A;  5D5W B;  1MMS A;  5EEH A;  5J1Y A;  2NVT J;  4U7D A;  2L5Q A;  2LRE A;  4LD5 A;  5HLG A;  4I76 A;  3V8J A;  1QHG A;  4FHT A;  1YG2 A;  3BCA A;  3DLA A;  2O61 A;  2K4B A;  2A68 F;  3SHF A;  2DQL A;  1MGT A;  4NC8 A;  2A61 A;  2GWR A;  3KP5 A;  4GCV A;  1KQ9 A;  4BGD A;  5BNG A;  4NBQ A;  1S72 I;  4N9H A;  1REP C;  1BJZ A;  3CP2 A;  1BOA A;  1XG1 A;  2CS3 A;  3OOU A;  4XLF A;  3WGI A;  3H3V K;  4C30 A;  2NVX J;  2UUZ A;  1JGS A;  5HOO A;  3H9J A;  1PDN C;  5CQE A;  4P5O A;  3PSI A;  1OFC X;  4NNJ A;  1TC3 C;  2ZJ2 A;  1V4R A;  4N4N B;  1RNL A;  3J7Z I;  4P9F A;  1X19 A;  2E2I J;  2EQR A;  2IAI A;  4A3L J;  2XAH A;  3TBI A;  3BTJ A;  5J1U A;  2O8X A;  3TO9 A;  5B66 C;  2X6X A;  1KU2 A;  2XGC A;  1R9T J;  1MBH A;  1XGO A;  1R5H A;  4BE1 A;  2E1O A;  1FX7 A;  5D5X B;  1T39 A;  4BHB A;  3K4K A;  3K1N A;  6PAX A;  4XLH A;  2MYS A;  2CUE A;  4BE2 A;  1NH3 A;  3PUF A;  5CPR B;  4U0V A;  3QYE A;  2BZT A;  2VPL A;  3ABU A;  3P7N A;  3GX4 X;  3OYB A;  3GTL J;  4UVC A;  1X2M A;  2A5W A;  3I53 A;  3SYT A;  4JBA A;  5GAD J;  3IP4 B;  3OYN A;  4CIC A;  2WAD A;  1SFO J;  3G1M A;  3HBL A;  2IRF G;  5DCM B;  2CQK A;  2Y31 A;  2ZNZ A;  4PCQ A;  1ZK8 A;  3F8M A;  2E5N A;  1R1U A;  2OCE A;  5KVR A;  4DQ2 A;  3TOB A;  1NHA A;  5E1W A;  2IS4 A;  2ZNY A;  1TL8 A;  1GV5 A;  3PNY A;  1YQA A;  2MBF A;  4LJZ F;  4BAY A;  1BW5 A;  3D5S C;  3RQ4 A;  1HW1 A;  3A0H C;  1UG2 A;  4L9N A;  5EZG A;  2I5U A;  3PFI A;  2L0K A;  4ETS A;  2GIV A;  2NVY J;  1IN8 A;  4A3M J;  2O5R A;  2ZC2 A;  4FX0 A;  2R7U A;  1UZC A;  1FOK A;  3RKQ A;  1WQ2 A;  2XAG A;  3B6C A;  2EIM H;  3KYC B;  1S7A A;  3I0T A;  2K3F A;  4A0Y A;  2KIU A;  5D5V B;  3M4O J;  3BRO A;  1UEL B;  3CUQ C;  4NC6 A;  1P9Q C;  1FMW A;  1VI0 A;  2NNY A;  4EJO A;  3AG2 H;  4BE0 A;  1SAU A;  4AUX A;  3QP6 A;  1QPI A;  2KZG A;  4ANJ A;  5L3F A;  1RIO H;  5EG0 B;  2PJR A;  4O5V A;  1LFU P;  1ODD A;  2L3D A;  3FHN A;  3JRB A;  2L7F P;  3S3N A;  4DGW B;  1R1V A;  2V1N A;  3RIR A;  3RZD J;  4HLY A;  1LVA A;  3RKX A;  5HDG A;  5LGN A;  2KZV A;  1GV2 A;  3MZH A;  2ZSI B;  2PJR B;  3DLL F;  3N97 A;  3HRU A;  4M6Y A;  2RDP A;  3QP5 A;  3C18 A;  4KIB A;  2EH3 A;  4ESJ A;  1F5T A;  4RM2 A;  3KLO A;  2KRF A;  1XTA A;  2FU4 A;  1ZAO A;  2LLK A;  4OOI A;  3FF5 A;  3H5A A;  2JZY A;  5ED4 A;  3HIF A;  3PQK A;  1OIS A;  4XSX F;  3WTS C;  5K7H A;  2G7U A;  4MTE A;  1ZRD A;  1O7L A;  4XN0 A;  1LPQ A;  2X1E A;  2M87 A;  4C2T A;  1ZG3 A;  4EVI A;  4KUM A;  4AIJ A;  1IV6 A;  1MH3 A;  3HM5 A;  2ZJQ F;  3JR9 A;  5HS7 A;  3CES A;  1VQ5 I;  3K10 A;  1BW6 A;  3UNG C;  3H92 A;  3OY9 A;  1IGN A;  3DPL C;  1RES A;  4LK1 F;  3RPQ A;  3FIS A;  4I0B A;  2OZU A;  2L54 A;  5CVI A;  2E60 A;  1K7A A;  2DPU A;  1QZE A;  4IRH A;  4MNU A;  4UXN A;  4B1R A;  3BCB A;  4ZC3 A;  4XID A;  1JKQ C;  4C2U A;  2K9M A;  1D8J A;  1WWX A;  2JSC A;  2L4A A;  3GYH X;  4HEA 2;  2O0Y A;  5FGM A;  3GF2 A;  4XL9 A;  3CUQ A;  1ZYR F;  5J3L A;  4ZYH A;  2VLA A;  1YLF A;  2CQN A;  1X3Z B;  3GCM A;  4L0Z B;  2ZBK A;  3I5U A;  2HU9 A;  3W2V A;  1V3F A;  4J19 A;  2MD0 A;  1DP7 P;  4GYI A;  1D0Y A;  5J47 A;  3CUQ B;  2PBI A;  1F43 A;  2ESH A;  5FB2 A;  1D0Z A;  4B3X A;  4BYY A;  5H2F C;  3I54 A;  1TP4 A;  5FRM A;  4XLN F;  1YHQ I;  3K4C A;  5IYC J;  4XRM A;  1JHH A;  2CFO A;  4E7L A;  2LY1 A;  2X6Y A;  5AON A;  1W36 C;  1E17 A;  3CDH A;  1SFU A;  4LK0 F;  1F1Z A;  2OUM A;  2KP6 A;  4F3Q A;  1MSE C;  1HQC A;  4RB2 C;  2BHZ A;  1GLN A;  2BXY A;  2Z5U A;  5F1J A;  5LHH A;  3LSP A;  2FA5 A;  1Y6I A;  3UR3 C;  1I39 A;  3NAR A;  2ECC A;  5FKL A;  2XF7 A;  3E5U A;  4P9U A;  2HTS A;  2JK3 A;  1TWC J;  1Z9C A;  1OYW A;  4BQO A;  2ZJR F;  3G6E I;  3FMS A;  3EUH C;  5EEG A;  5JHF A;  1QU3 A;  2BBY A;  3BJA A;  2O7O A;  3U21 A;  4C9Y A;  4XSZ F;  2YU9 J;  4RS8 A;  3G1L A;  4X1E A;  1JJ8 C;  2L4M A;  2VAS A;  5DM6 F;  2K27 A;  3FKI J;  2ZME C;  3Q0W A;  3QPT A;  1YIO A;  3WE3 A;  1B72 A;  5GAH J;  1VQ4 I;  2MAB A;  4KYW A;  2R7X A;  4L9V A;  4BHP A;  4FIS A;  4YG2 F;  2R7D A;  3DCF A;  5K1Y A;  2VXZ A;  5H6R A;  1XGN A;  1T0F C;  5FFX A;  4GO1 A;  3A02 A;  3I9V 2;  4O6J A;  3GFI A;  2LP0 A;  1B72 B;  1R22 A;  4DW6 A;  3H0D A;  4ENN A;  2ZCW A;  1YW7 A;  1RUN A;  3HTS B;  3HOT A;  2E1M C;  1W5S A;  2K7L A;  3K1P A;  4OIP F;  1ZLK A;  3REO A;  3CME I;  4CCN A;  3E6M A;  4LMY A;  1WKM A;  3G3Z A;  5D8K B;  1QVU A;  1YW9 A;  1CGP A;  4HF2 A;  5IOZ A;  3QWL A;  1UFM A;  3I3L A;  4CYC A;  2QM3 A;  2VOO A;  1FYK A;  1ON2 A;  1TNS A;  2FMY A;  4P96 A;  2EIJ H;  2W7N A;  4PSX A;  3I55 I;  3I59 A;  1QRY A;  2JRM A;  4AYB A;  3FXL A;  3CCV I;  3FBI B;  5FKM A;  4DBQ A;  4CYC B;  2LR8 A;  2XVC A;  1R5G A;  2HYJ A;  1FTZ A;  2HNH A;  3UKG A;  1ENH A;  2A3S A;  4BS9 A;  3WTW C;  1SFK A;  2DQR A;  3W2A A;  1A31 A;  3HTU A;  4EJT A;  3R0A A;  1ZN2 A;  5ILV A;  2L9V A;  2VE9 A;  3RSN A;  2HQN A;  2DCE A;  2F4M B;  2EK5 A;  1Y56 A;  2F48 A;  4OAY A;  2JMW A;  3MKZ A;  1U78 A;  3H5N A;  2VON A;  3BZC A;  2Y2Z A;  1HST A;  1SD4 A;  3IH3 A;  3IRR A;  2V1U A;  4ZJZ A;  1A6Q A;  3RKY A;  1FEX A;  2EFW A;  3G1O A;  2OU2 A;  4WF2 A;  2V26 A;  1T0F A;  3VWB A;  1V55 H;  5C4J J;  1JXS A;  3JW4 A;  1XC5 A;  3LFK A;  4A0X A;  2NS7 A;  3Q9S A;  1HC8 A;  1LFB A;  2P5K A;  2VT2 A;  3Q0V A;  1O3T A;  2ZME B;  2XPU A;  4MLO A;  1BM9 A;  3CF2 A;  9ANT A;  1XMK A;  1FIP A;  4Z6Y A;  2DMU A;  3QRF F;  2UWM A;  5FLX Z;  2R4G A;  3ZMD A;  3VEP A;  2DI3 A;  3ZQH A;  3J80 K;  5HS9 A;  2UXN A;  3RDI A;  1D5V A;  1E0E A;  3DPU A;  4ZZD A;  2O3F A;  4KIT B;  2E1M B;  3SZP A;  4QIW N;  1VZ0 A;  2E71 A;  1MMN A;  3LMM A;  2EJR A;  1ZRE A;  3K9T A;  1T56 A;  3HPH A;  3OYJ A;  5EDN A;  3DTE A;  1MNE A;  2LK2 A;  1ZGA A;  4GXO A;  3VFZ A;  3HKZ N;  2CJJ A;  1BR2 A;  2R7F A;  3GTK J;  4IF4 A;  5IT3 A;  1E3H A;  2KRC A;  4DZJ A;  1X1B A;  4U87 A;  4UV8 A;  3WU0 A;  1CF7 A;  2M8G X;  2VKH A;  5IP9 J;  1S7O A;  1ETV A;  4ITV A;  1LNW A;  1O57 A;  1F9N A;  1B8I B;  1WH5 A;  5F64 A;  5LHG A;  1TWF J;  2VQG A;  5KCM A;  4BY1 J;  4NC7 A;  2MA3 A;  2W00 A;  3DBR B;  2HQA A;  5E3M A;  4OIO F;  3SZG A;  1N78 A;  3BP8 A;  1D1A A;  2Z2S B;  4L9J A;  4E6K G;  2LTP A;  1V5G A;  2F5D A;  2KMU A;  3NAU A;  2QSG X;  1XGM A;  4WCG A;  3D5L A;  3VYU B;  2R0Q C;  1V5E A;  5ICF A;  2DW4 A;  4RB3 C;  2XRL A;  3U1K A;  3NQO A;  4PZJ A;  3L2Q A;  3JAM K;  2GZW A;  1JKO C;  3GVA A;  3CMY A;  3CUO A;  5IP6 A;  3ASO H;  3GO5 A;  2J5O A;  4K2E A;  4BDY A;  3M8E A;  1YI2 I;  3ABK H;  3QYB A;  2EIL H;  3WGH A; 
#chains in the Genus database with same CATH homology
 2ZB9 A;  1Y1W J;  2ECB A;  2MSY A;  1A5J A;  5FLV A;  2DA3 A;  2HI3 A;  3BTC A;  5EGO B;  3O8H A;  3IH2 A;  2E2J J;  3TED A;  5GPC A;  3IH4 A;  5F08 A;  5EG0 A;  1HCR A;  5IYB J;  4IEJ A;  2Y9Z A;  1ZR4 A;  3L1P A;  5HOD A;  2L7Z A;  3QPL A;  3JRC A;  2LFB A;  1WI3 A;  3JRA A;  4IHX A;  1UHS A;  2WAQ N;  2GLO A;  2B63 J;  2VKE A;  3LSR A;  3S1Q J;  3OSF A;  2TCT A;  1IJW C;  3BR6 A;  1UMQ A;  3GTG J;  5EZH A;  3BQY A;  1VND A;  4MIM A;  4MFD A;  1DU0 A;  1U9N A;  2COB A;  2JWT A;  4A3E J;  4W1U A;  1Y1V J;  1ETQ A;  2XPW A;  5E3L A;  3GTO J;  4A3C J;  2KT0 A;  3HOX J;  2M0C A;  5IPA A;  1GDT A;  1JKR C;  3ZQC A;  1HF0 A;  2N8G A;  1IDY A;  4DYR A;  4A3J J;  3BTI A;  3CDL A;  3OIO A;  5M5W J;  2QF7 A;  4C3J J;  3WHB A;  2YS9 A;  5J1Y A;  2K40 A;  1BL0 A;  2NVT J;  2TRT A;  5FKO A;  2JA8 J;  2RAE A;  1GUU A;  2AO9 A;  4I76 A;  3IV5 A;  1TWA J;  3BR5 A;  1W0T A;  3S2H J;  3MVP A;  2WB1 N;  2HOA A;  5BNG A;  1BJZ A;  1ETY A;  1XG1 A;  3C2B A;  3OOU A;  3TP3 A;  3S2D J;  4A3B J;  3H3V K;  1ZTR A;  2NVX J;  3HOY J;  4NDL A;  1CQT A;  2Y30 A;  3SDG A;  1OFC X;  4M3D A;  1IC8 A;  1TC3 C;  4C3I J;  1SAN A;  3HGY A;  1H8A C;  2E2I J;  2EQR A;  2IAI A;  3WHC A;  4A3L J;  1MBE A;  2DA4 A;  1ETK A;  2ID3 A;  3BTJ A;  5J1U A;  1H88 C;  2NVQ J;  2DA5 A;  4XRS A;  2XGC A;  1R9T J;  1ETO A;  1MBH A;  2XPV A;  2E1O A;  1JT6 A;  2Y0S N;  2CUF A;  4DZP A;  2CUE A;  1WH7 A;  3S1N J;  1FTT A;  3MN2 A;  3A03 A;  1HLV A;  1PUF B;  1Z0X A;  1IDZ A;  1JUP A;  3GTL J;  1X2M A;  2XGE A;  2O9L A;  1WCM J;  1BA5 A;  1Z77 A;  4D5F A;  2IBD A;  2IEK A;  4LOC A;  5M3M J;  1SFO J;  5DTD A;  3E7L A;  3G1M A;  3HBL A;  5F27 A;  1POG A;  2Y31 A;  3GBG A;  1ZK8 A;  3O8G A;  4M3B A;  4FCY A;  1H89 C;  1DU6 A;  3HB9 A;  3QPS A;  2DJN A;  1GV5 A;  1HOM A;  4A3I J;  1BW5 A;  5E3N A;  3A01 A;  5F0C A;  1UG2 A;  5EZG A;  2VKV A;  3HOV J;  3BG9 A;  3JRH A;  2L0K A;  2NVY J;  1OCP A;  4A3M J;  3I4N J;  3RKQ A;  3B6C A;  4Y7N J;  2XB5 A;  2DMP A;  2QCO A;  3GTJ J;  2VPR A;  3M4O J;  1JUM A;  4W97 A;  2KDZ A;  3HEF A;  1VI0 A;  1TWG J;  1K83 J;  4A93 J;  4BXX J;  4AUX A;  1QPI A;  1OCT C;  3FIW A;  5EG0 B;  1IRZ A;  4G12 A;  1LFU P;  3JRB A;  1ETW A;  2L7F P;  1MH4 A;  5F0F A;  2X6O A;  3RZD J;  3FK7 A;  1JTX A;  2G0E A;  2M9H A;  4B3A A;  2FQ4 A;  1GV2 A;  2R5Z A;  2JN6 A;  5EYR A;  5C4X J;  3BR1 A;  5M5Y J;  1GVD A;  2EH3 A;  1MBF A;  2FJ1 A;  3ZQF A;  4A69 C;  4C2M J;  3HGG A;  1ORK A;  2LLK A;  3JRG A;  3HOW J;  4Y52 J;  5FLM J;  2R5Z B;  1AU7 A;  3ZOB A;  1MNM C;  1W0U A;  5K7H A;  5F04 A;  1YRN A;  2K9S A;  5FKN A;  5M5X J;  2VUM J;  1FJL A;  3LNQ A;  1F36 A;  2LKX A;  1IV6 A;  4BBR J;  3CQZ J;  1MH3 A;  1AHD P;  3HM5 A;  1TWH J;  3JR9 A;  1Q1V A;  4QSH A;  3ZQG A;  2WV1 A;  3BT9 A;  1BW6 A;  1IGN A;  2XB0 X;  1RES A;  2CQQ A;  3FIS A;  3JRE A;  2MGQ A;  2E2H J;  3W6V A;  2R5Y A;  4B1R A;  3S15 J;  1NTC A;  4XID A;  1JKQ C;  2DA7 A;  4M3G A;  2HQ5 A;  1I3Q J;  4BY7 J;  4I6Z A;  2O8K A;  3F0C A;  3S1R J;  2LVS A;  2EZH A;  3BTL A;  1VF9 A;  5J3L A;  2FX0 A;  1D5Y A;  2OPT A;  4IHY A;  1A6I A;  3SJM A;  2DMQ A;  4XK4 A;  4J19 A;  3TW7 A;  1RET A;  2ME0 A;  3B6A A;  2MG4 A;  4D7N A;  1F43 A;  1HDP A;  2CU7 A;  3JRI A;  5IYC J;  4XRM A;  2XSD C;  5IYD J;  1XS9 A;  3I4M J;  2DA6 A;  4DYC A;  2K9Q A;  1MSE C;  2MW8 A;  5F1J A;  2XGD A;  3LSP A;  3BG3 A;  4JX6 A;  2ELK A;  2Y9Y A;  1ZGW A;  2DTZ A;  5JLW A;  1HDD C;  3BG5 A;  3NAR A;  3M3Y J;  2ECC A;  5FKL A;  1B8I A;  5M3F J;  3QQA A;  3ZQI A;  2JK3 A;  1TWC J;  2H8R A;  5C3E J;  1S7E A;  4JX5 A;  2NOG A;  3H0G J;  4FTH A;  1WGX A;  2O7O A;  1NK3 P;  1WPK A;  4MFE A;  2YU9 J;  3G1L A;  4X1E A;  3SFI A;  1JJ8 C;  3OSG A;  1VFC A;  4FE4 A;  3A01 B;  3FKI J;  3Q0W A;  1B72 A;  1G2H A;  5K7F A;  2ME6 A;  4FIS A;  3DCF A;  2LY9 A;  5FJ8 J;  4DYQ A;  1MSF C;  1MBK A;  3MKL A;  4A3G J;  3Q3S A;  4V2G A;  5EGO A;  3A02 A;  4C3H J;  4BKX A;  3S16 J;  2LP0 A;  1B72 B;  2CQX A;  2JA7 J;  2EZL A;  4DW6 A;  2L9R A;  1JJ6 C;  3ZQL A;  1MBJ A;  3LSG A;  4HNV A;  2L7M P;  2NS8 A;  4D5C A;  2LD5 A;  1I6H J;  5EF6 A;  4UUS A;  1FIA A;  3JRD A;  1JT0 A;  3GTM J;  4QTR A;  4X6A J;  5IP7 J;  1QVU A;  5JLX A;  5IOZ A;  4CYC A;  2ID6 A;  3VPR A;  4EEF G;  1O4X A;  1JUS A;  1U8B A;  1ZR2 A;  3D1N I;  3HDD A;  5C44 J;  3S17 J;  4UUS B;  2R7Z J;  3K2A A;  3TP0 A;  1GT0 C;  2GBY A;  3S14 J;  3K7A J;  1QRY A;  3CCY A;  2R92 J;  2AHQ A;  1EF4 A;  1JKP C;  1T33 A;  5FKM A;  2EZI A;  5E3O A;  4CYC B;  2LR8 A;  2H1K A;  3GTQ J;  2HYJ A;  2HXO A;  2DA1 A;  5IOY A;  1FTZ A;  4JX4 A;  3UKG A;  1ENH A;  4M3E A;  3TW6 A;  4RDU A;  3PM1 A;  3BQZ A;  1LE8 A;  1X2N A;  4IHW A;  1K61 A;  3PO3 J;  2JA5 J;  1X58 A;  2DA2 A;  4S0H B;  1P7J A;  3BR3 A;  5FKK A;  1YRN B;  4B4C A;  3RZO J;  1LE8 B;  2JMW A;  1JGG A;  4L5E A;  1RKT A;  1U78 A;  3RQI A;  2Y2Z A;  3IH3 A;  4BBS J;  1RKW A;  2OF7 A;  1FEX A;  1AKH A;  1IG7 A;  2YUS A;  5DS9 A;  3G1O A;  2FD5 A;  5C4J J;  3HOZ J;  1XC5 A;  2W48 A;  2NS7 A;  3BR2 A;  1LFB A;  1QVT A;  2R5Y B;  3Q0V A;  5K7Z A;  4M3F A;  4XIC A;  2D5V A;  5GP9 A;  2XPU A;  3FK6 A;  4MLO A;  2HOS A;  1AKH B;  4MO7 A;  9ANT A;  1FIP A;  1U9O A;  2DMU A;  1MBG A;  2DMN A;  2M34 A;  3ZQH A;  1RR7 A;  3GTP J;  2M2E A;  1ETX A;  4GFB A;  5J1R A;  5EEA A;  4M6V A;  1P7I A;  4V2F A;  1JTY A;  3HOU J;  4QIW N;  3PO2 J;  1I50 J;  4RBO A;  2DMT A;  1T56 A;  1APL C;  1NK2 P;  3BR0 A;  1ZKG A;  2X9D A;  5EDN A;  2LK2 A;  1PUF A;  1ZQ3 P;  2I10 A;  3HKZ N;  1OJL A;  2CJJ A;  3DEW A;  4JP0 A;  3GTK J;  2R93 J;  4DZJ A;  4AC0 A;  2P81 A;  4XRS G;  2M8G X;  5IP9 J;  1ETV A;  4A3F J;  2CRG A;  2E19 A;  1E3O C;  2PMZ N;  4UUT A;  1B8I B;  1WH5 A;  1TWF J;  2X48 A;  2EZK A;  1ITY A;  2DN0 A;  4BY1 J;  4AYB N;  4ABZ A;  4D7M A;  3LOC A;  5F0H A;  5E3M A;  2HOT A;  2LTP A;  4JYK A;  3NAU A;  2EBI A;  2VI6 A;  4A3K J;  1IUF A;  3S1M J;  3LSJ A;  4FE7 A;  2GM4 A;  2R0Q C;  1RPW A;  2JA6 J;  2XRL A;  5GPA A;  1JKO C;  3CMY A;  5IP6 A;  2HXI A;  2K9N A;  4IHV A;  3Q0U A;  2HDD A;  4A3D J;  3JRF A;  2JJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...