1FIPA

The structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
b'PLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQALLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION (FIS)
publication title The structure of Fis mutant Pro61Ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 27
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fipA00
5FKKA 1ENHA 1EF4A 1W0TA 5IP6A 1GT0C 5EG0A 4A3JJ 3S16J 2ECCA 3ZQCA 1JKQC 2Y2ZA 2LY9A 3CMYA 1FTZA 3FKIJ 4DYRA 2DMNA 2HDDA 1BA5A 3JRBA 1B8IB 4NDLA 2R7ZJ 4G12A 1IGNA 1A6IA 5IYCJ 9ANTA 2E19A 4BBRJ 2JMWA 2JN6A 4RBOA 5IP7J 2XPVA 1BL0A 3DEWA 2CQXA 2L0KA 3TW6A 2VUMJ 1WI3A 1WH7A 1XC5A 3JRIA 3HOYJ 3A01A 3QPSA 3WHBA 4A69C 4XICA 2JA6J 2LKXA 4IHWA 1FEXA 3A02A 3O8GA 3BR0A 5EEAA 2R5ZA 2K9SA 3NAUA 2Y31A 2TCTA 4C3JJ 4C3IJ 1JJ6C 1Y1VJ 1X2MA 2ZB9A 3HM5A 2JK3A 1IV6A 5EF6A 4IHXA 3JREA 2L7ZA 1JUMA 1ETWA 1FIPA 1JGGA 4A3GJ 1HLVA 2HXIA 2DA4A 5F0CA 1JUPA 4W97A 5M5YJ 4GFBA 1JT6A 4MO7A 1RR7A 4IHYA 4BY1J 3BTIA 2VKVA 2DA6A 4FE4A 5FKOA 1HDPA 2E2HJ 2QF7A 2G0EA 2IAIA 5M5WJ 1MBKA 4B1RA 1JT0A 3PO2J 4D5FA 4M6VA 5K7FA 3IV5A 3A01B 2K9QA 1YRNB 1GUUA 5K7ZA 2K40A 3BR3A 2MG4A 2R5ZB 1MBJA 3K2AA 3RZDJ 4FTHA 3K7AJ 3JRHA 3HOZJ 3TP3A 1O4XA 1ETVA 2DN0A 1UMQA 1TWFJ 2NVXJ 2JA8J 1IDZA 3JRFA 2JA7J 1ETKA 2HOAA 3HBLA 5F27A 3BR1A 3TP0A 4AYBN 3GTMJ 1H88C 3GTOJ 3FK6A 2M34A 5C44J 1LFUP 1HF0A 3S1MJ 1RKTA 1JTXA 4IEJA 2D5VA 5GPAA 5JLXA 1VF9A 3LSGA 4D7NA 5E3NA 1JUSA 2R0QC 1ITYA 3F0CA 4A3IJ 1U9NA 2DA2A 2XPWA 4A93J 1FTTA 2LP0A 1UHSA 2IEKA 2XGDA 3HKZN 2WB1N 5E3OA 3BQYA 3L1PA 3SJMA 1RPWA 4A3EJ 2E2IJ 3NARA 1ETQA 3BTLA 1MSFC 4BBSJ 3TEDA 1ZQ3P 4XIDA 2OF7A 3HDDA 5F08A 2JA5J 3S14J 3GTQJ 2EZHA 2HOSA 2COBA 1VFCA 1U78A 2FJ1A 1G2HA 2M2EA 1XS9A 1X2NA 1WH5A 2X48A 4AUXA 4W1UA 5FLVA 3JRCA 4X6AJ 4CYCA 2WAQN 1NK3P 4JX4A 1I3QJ 1BW6A 1ETXA 1Z0XA 5K7HA 3ZQLA 1ETOA 1MBFA 2GBYA 2VPRA 5DTDA 1ZKGA 1F43A 3LSPA 4A3FJ 2I10A 2E2JJ 1F36A 3DCFA 3E7LA 3OIOA 5M3FJ 3LSJA 4XRSG 2CJJA 2ME6A 1QVTA 5HODA 4MFDA 2MSYA 5C4JJ 1GDTA 1P7IA 1T56A 2Y0SN 2EZKA 1PUFA 1JKRC 5IPAA 3MVPA 1LFBA 4IHVA 2L7MP 3JRDA 2AO9A 2TRTA 3RQIA 2LK2A 1OJLA 1SANA 2MGQA 5C3EJ 4A3LJ 1JJ8C 1WCMJ 5FKNA 4FE7A 3BTJA 1MSEC 2XPUA 4I6ZA 3PO3J 3QPLA 1H89C 4CYCB 3HGGA 1ETYA 2Y9ZA 5EG0B 2HYJA 2X6OA 4EEFG 3O8HA 5C4XJ 1ZGWA 1MH4A 1WPKA 3ZQGA 2O9LA 2LR8A 3BG3A 3VPRA 3GTJJ 3BT9A 1SFOJ 2XGCA 5IOZA 2B63J 4JX6A 1OFCX 3GBGA 3JRAA 1A5JA 2CQQA 4MFEA 4BXXJ 2ME0A 4RDUA 3LNQA 4BKXA 1TC3C 5GPCA 2H8RA 1MBGA 3QQAA 3Q3SA 3HOVJ 2NVYJ 2M0CA 3IH4A 2EZIA 2EZLA 5EDNA 2XRLA 4V2FA 2ID3A 3Q0UA 5EYRA 1OCTC 2DJNA 1TWAJ 4Y7NJ 3G1OA 1IDYA 2DTZA 3G1MA 3TW7A 1VI0A 3ZQHA 2E1OA 2MW8A 1BJZA 2ELKA 4HNVA 2EBIA 5J1YA 3RZOJ 2NVTJ 3GTKJ 3LSRA 4DYCA 4JYKA 1NK2P 3ZOBA 1U8BA 5BNGA 1OCPA 1POGA 1QRYA 2IBDA 1FIAA 4X1EA 4QSHA 3H0GJ 1X58A 2P81A 3BG9A 2N8GA 3GTGJ 2VKEA 3FISA 3JRGA 1RESA 2CUFA 2NOGA 2NVQJ 4D5CA 4DZPA 4B4CA 1Y1WJ 2R92J 2HXOA 5J3LA 4A3DJ 2QCOA 5F0FA 2DA7A 3RKQA 2NS7A 4Y52J 2HI3A 3UKGA 3S1RJ 1IUFA 1HOMA 3I4MJ 2GM4A 3BG5A 5EZHA 3CDLA 3C2BA 1U9OA 3M4OJ 3S1QJ 1RKWA 4V2GA 4QIWN 5FLMJ 1TWGJ 3BR2A 3HGYA 1I6HJ 2GLOA 1B72A 2X9DA 5JLWA 1IC8A 1E3OC 1AKHA 2R93J 1ZTRA 2W48A 4LOCA 3WHCA 3Q0VA 5IYBJ 4QTRA 5FKMA 3BR5A 1TWCJ 5IOYA 1ZR4A 3IH3A 1D5YA 4C2MJ 1MBEA 3S1NJ 5F04A 3FK7A 1RETA 5FJ8J 1IJWC 3G1LA 1H8AC 4A3BJ 2ECBA 1ZR2A 2CRGA 2FX0A 1I50J 3CQZJ 2LLKA 4AC0A 5IYDJ 1VNDA 2FD5A 3LOCA 1S7EA 3OSFA 4M3BA 4A3MJ 3BQZA 1MH3A 2WV1A 4I76A 4JP0A 4UUSA 2KDZA 2R5YA 1IRZA 1QPIA 4DZJA 4MIMA 4M3EA 1B72B 3HB9A 4XRSA 1AKHB 3JR9A 2XB5A 4ABZA 1LE8A 4DYQA 3A03A 4BY7J 3BTCA 2DA1A 2O7OA 1AHDP 2AHQA 2LFBA 4C3HJ 4M3FA 2XSDC 2XGEA 2DMUA 3HEFA 5FKLA 1YRNA 3S15J 4FISA 1WGXA 1Q1VA 3OSGA 2YUSA 2DMPA 4A3CJ 4D7MA 2PMZN 3HOWJ 1CQTA 2DA3A 3I4NJ 2XB0X 3B6AA 1HCRA 1Z77A 2H1KA 3H3VK 4B3AA 5J1UA 1GV5A 1PUFB 3W6VA 4UUSB 4MLOA 5DS9A 2R5YB 2JWTA 3SDGA 1GV2A 2ID6A 3FIWA 1QVUA 2OPTA 3S17J 2DA5A 5M3MJ 1W0UA 3S2DJ 1LE8B 2LD5A 2YS9A 2O8KA 3BR6A 3D1NI 1JKOC 2M8GX 2EH3A 3M3YJ 1JKPC 5EGOB 2JJ7A 1NTCA 1APLC 3S2HJ 4M3DA 1DU0A 2LVSA 2RAEA 1R9TJ 2CUEA 3ZQFA 4XRMA 5EZGA 1BW5A 3GTPJ 2DMTA 1MNMC 2YU9J 3OOUA 2K9NA 4XK4A 2Y9YA 3HOUJ 2LTPA 1P7JA 4J19A 4DW6A 2HOTA 5GP9A 3HOXJ 3SFIA 1DU6A 5F0HA 1TWHJ 2CU7A 1MBHA 4S0HB 3MKLA 1ZK8A 4JX5A 5EGOA 2L9RA 1HDDC 1AU7A 2NS8A 2M9HA 4L5EA 3Q0WA 1B8IA 2EQRA 2KT0A 5E3LA 1K83J 5E3MA 3PM1A 1JTYA 2DMQA 4UUTA 5J1RA 1ORKA 1GVDA 1XG1A 1UG2A 2FQ4A 1IG7A 5F1JA 2HQ5A 5M5XJ 3B6CA 2Y30A 1T33A 4M3GA 4FCYA 3IH2A 3CCYA 5IP9J 2VI6A 3ZQIA 1FJLA 2L7FP 3GTLJ 3MN2A 4A3KJ 1K61A
chains in the Genus database with same CATH superfamily
5FKKA 1N78A 5IP6A 2P8TA 4WK8F 1JKQC 1FTZA 1D5VA 2HDDA 3P7NA 2DMNA 1BA5A 4HG2A 3T8TA 1I1SA 1V5GA 2ZMEA 3MZ8A 4BHCA 4G12A 2R7ZJ 1FYLA 4AIKA 4BEHA 3HZJA 1YO5C 1IXCA 4IKFA 4HBLA 2X51A 5IP7J 3DLLF 2XPVA 2R7SA 5FLXK 3TW6A 1LVAA 1VTNC 2VUMJ 3D5SC 1WH7A 2QVOA 1XC5A 3JRIA 2XAGA 3IC7A 2WV0A 2LBFA 3IRQA 4XKVA 4ENMA 3WTZA 3O8GA 3BR0A 2K9SA 2NVUB 1U5TC 1W7PD 3EQLF 2DYRH 3VDXA 4NQWA 1YI2I 2DW4A 2RDPA 3I4PA 3HM5A 2ICWG 2IP2A 1IV6A 2UV1A 2ZJPF 3SQNA 5FRNA 1YOVB 2VQHA 2ZSHB 1UELB 2VC1A 1D8JA 4A3GJ 4BGDA 2HXIA 3GTLJ 1HBXG 3S8PA 1JUPA 4EJWA 2ZMEB 5M5YJ 2OQGA 4BEHB 4F3QA 2VE8A 4IHYA 1Y56A 3WTUC 3MWMA 1BN5A 4FE4A 4C2TA 2DAOA 1Z3YA 2QQ8A 2O61A 2G0EA 2IAIA 3CDIA 4B1RA 3I56I 4ON0A 5K7FA 3QOEA 2QQBA 3FXOA 4KA4A 1KQ9A 2XIGA 3OV8A 1MIJA 4RAYA 3V4GA 1ZRCA 4CCOA 5GADJ 2H6CA 3OYGA 2LBFB 1HW2A 4GO1A 2WWYA 4Z2YA 2MG4A 5J47A 1OCRH 1MBJA 2P7VB 3K2AA 3RZDJ 4GRIA 3K7AJ 4XKBA 3JRHA 1HSTA 3M1EA 4EVIA 4RM3A 4NQWB 3KYCB 5KVRA 3RPQA 3TP3A 2DN0A 3S2WA 1IDZA 3HHHA 1ETKA 1F9NA 3F22A 1MDMA 2A6TA 3GTMJ 4DQ2A 1H88C 1S3JA 1P4WA 3S1MJ 1RKTA 1JTXA 4CCJA 4XKWA 3T8RA 2D1HA 2OV7A 1XGSA 3FF5A 4PUSA 4XLCA 1JUSA 2R0QC 2X1CA 4CH7A 2K9LA 2RQQA 4DBRA 1U9NA 1YX5A 5DUIA 2XAUA 4G7ZF 1FTTA 2EFQA 3G2BA 1UHSA 1SAUA 2WB1N 3BQYA 3L1PA 3ERED 1RPWA 1W36D 3V7CA 2Y48A 2Q2EA 4ZTJA 4KDPA 3SZPA 3MEXA 4N0BA 4NC7A 1MSFC 2MC4A 5ILVA 5J4YA 1IUYA 3LSTA 3S14J 3BOQA 2MBFA 1GLNA 1HW1A 2XVCA 4N9IA 3L7WA 3M8EA 5H2FC 3HSFA 2EZHA 1MDMB 4L0ZB 2COBA 1XCVA 1R1UA 1VFCA 5LHHA 2FJ1A 1XS9A 1SD5A 4EJVA 1K79A 1FWZA 4X6AJ 5FLVA 3JRCA 2A69F 2WAQN 4D1QA 1BW6A 2JVHA 2XGXA 2GAUA 3IWFA 5K7HA 2BY2A 2GBYA 2AXTC 1D1AA 3HRMA 4UXNA 5CQGA 2A5YB 1ZKGA 3CCUI 1R49A 1NHAA 5D8LB 4A3FJ 2PJRA 1F43A 5L3BA 2BY0A 3H9QA 4GGGA 4XMYA 2E2JJ 3DCFA 2XHKA 3KX2A 2VJIA 3E7LA 4WF2A 2ME6A 2FE3A 5HODA 3PIOF 4MFDA 5EEHA 2Q2EB 1BIBA 2KP6A 4XRFA 2OU2A 2STWA 1SD6A 3H3UA 5IT9K 4E7LA 1WJEA 1JKRC 2L02A 4KNYA 3EUHA 4RAZA 2HFHA 3RQIA 2LK2A 3BJAA 2GOXB 2MGQA 3PQKA 4WXHA 4D0PA 3CUQA 3OS1A 3JSPA 1V54H 5E8GA 3S32A 1WQ2A 3E5UA 3FHNA 1A6QA 3BTJA 3RSNA 5FLXZ 1OCZH 1YW9A 4I6ZA 1SMYF 3CMMA 1CGPA 2E7XA 3HL2A 4Q47A 1ETYA 1UCRA 2Y9ZA 3E3VA 3I55I 2DOFA 4F93B 3O8HA 1ZGWA 2X85A 2AQEA 2PJRB 1SFOJ 3BT9A 4HQMA 2ESHA 2M3AA 5IOZA 2VXDA 4JX6A 3F21A 2ZJRF 4EV0A 1ZRDA 3IKTA 4DIQA 2CQNA 2X6XA 2NYXA 4MFEA 4RDUA 3QP6A 3LNQA 3CDHA 4BKXA 2JTVA 2VIXA 3Q3SA 1TL8A 1VQ4I 2YSRA 3HG9A 2M0CA 3OR1C 1FBUA 1LDJA 1S29A 2V6CA 2K7LA 3ZMUA 2VQGA 1OCTC 3GX4X 4MQVA 1TQIA 2DT6A 2LKPA 5KAIC 5HLHA 3L2VA 3CUQB 3L2UA 3CD6I 1EH8A 4K2EA 3U2RA 4ENKA 5ICGA 1X1DA 2CW7A 3QYBA 3HOSA 1X1AA 2MW8A 5B5EC 2HQAA 4QWQA 4HNVA 2DDAA 5J1YA 3K70D 3RZOJ 1SFXA 4JYKA 4QPOA 5DDGA 3ZOBA 4KN7X 1OCPA 1FSHA 1I3AA 2ZMEC 5CLSA 2E71A 3TO9A 4MEYF 3BG9A 3ZMSA 2J5OA 3JRGA 2V4JC 1Y0NA 2FQ3A 4MHGA 3CP8A 2NVQJ 3GF2A 4D5CA 1Y1WJ 1UG0A 2Y0MA 3RYPA 2NNNA 3LWFA 4N9HA 1LKXA 2O8XA 3VSLA 1SVOA 2OZ6A 3ZMTA 3NQOA 3OYAA 3FBIB 4BU2A 1G8XA 1KYZA 5E79C 4UY8I 1S8NA 4PJ0C 1AA7A 4BS9A 1OKRA 4V19K 4D9JA 1XDUA 1IN6A 3H36A 4XLHA 1RKWA 4V2GA 1ZAOA 3HGYA 1D0XA 2GLOA 1B72A 2IS1A 3HPGA 1IC8A 2R93J 2HZTA 2W00A 1Z7UA 3WE3A 4NC6A 3WHCA 1IN8A 3DTIA 1R4MB 5IYBJ 4P1WA 4HV6A 5IOYA 1ZR4A 2ZSIB 3PUFA 5HVQC 2HVRA 1T0FA 1HKTA 2BYVE 2LNBA 3U21A 4C2MJ 2Z33A 1YLFA 1JE8A 4GYGA 1VQLI 1MBEA 2V9PA 1BR2A 3LQQA 1BI3A 5F04A 1RETA 4PJJA 3N97A 3KLOA 1V5FA 1H0MA 2CRGA 4JBAA 3J7YJ 3F23A 1ODDA 3WE2A 2Z3YA 1VNDA 2K02A 3OSFA 1XGOA 1SD7A 3H0DA 4LLLA 4YFKF 3J7AY 4BJ6C 4JP0A 4UUSA 1Y39A 2CO5A 2R5YA 1IRZA 1F5TA 3W2VA 4A0ZA 1B72B 3IAS2 1FNNA 4BQAA 1FOWA 2HNHA 2PMZA 2QKLB 1QZEA 2DA1A 1VQOI 2O7OA 2XSJC 2FNPA 5FB2A 5LGUA 2AHQA 5DEQA 2LFBA 5IT9Z 2COMA 1ZGAA 2PFBA 4BE0A 1BI2A 2XGEA 2DT5A 3JW4A 2VONA 4FISA 4A3CJ 4EGZA 2G7UA 1CQTA 2DA3A 1R36A 4IZZA 5GTIC 2B7EA 3QPHA 4GDFA 4CYDA 4EQQA 3FMRA 3KP3A 2ELJA 1PUFB 4ZYDA 3TO7A 4UUSB 3IKVA 1Z21A 4MLOA 2R5YB 2P5VA 2JWTA 3SDGA 2BV6A 1BOAA 1EH6A 3KEOA 5LEKA 1UAAA 3FIWA 1X1CA 1O3RA 2HPIA 3IWZA 5BPDA 3CO6C 1W0UA 3HSRA 4BJTA 2O8KA 2W57A 3BR6A 4IPAA 1R5HA 2M8GX 1SMTA 2V7FA 2OCEA 3A4CA 1WWXA 3ERMA 2F2EA 3H92A 1XDSA 3CMEI 4M3DA 3TQNA 4XBFA 2LVSA 4YELA 4HSRA 3ZQ7A 2QKMB 2E5NA 4XRMA 4E7JA 1BW5A 1SVMA 2DMTA 1MNMC 1MGTA 3OOUA 2W25A 1YIJI 2P5KA 3OL3A 3CF2A 2LTPA 2JZYA 2KFDA 3CCLI 4UHTA 1MMGA 5GP9A 2OZUA 3CESA 3E6MA 3DEUA 2EV0A 4XN0A 3TO6A 1MMSA 4M9ZA 2DI3A 1Z6RA 4JX5A 2H94A 3KE2A 4A2UA 2F5FA 4HLXA 1KU2A 2A6HF 4LB6B 3CO7C 1AU7A 3CZ6A 4U0VA 2DYSH 1LUJB 1I5ZA 4NB5A 1SFUA 3IRRA 5TISC 4HDUA 3D5RC 2M45A 4E70A 2XF6A 2KT0A 2HYGD 5KK1A 5E3LA 1K83J 4Q5SF 3PM1A 3RPUD 4IRIA 3A1YA 1QU3A 2E1NA 2L2OA 1ORKA 3H5RA 2HTJA 3K1PA 5TJJA 2FQ4A 2BY1A 1J75A 2Q1ZB 1MNDA 2HQ5A 1USSA 1X19A 2Y30A 1T33A 5HS7A 4BXFA 4M3GA 2BXYA 1FP2A 1HKSA 1Z05A 4ESBA 5LHGA 2CW8A 3GUDA 3CCYA 5IP9J 1B4AA 1MJBA 3RPUA 1QNTA 1ZN2A 3MKWB 1ZELA 1J59A 4OOIA 4A6DA 3MKZA 2KJBA 4M6YA 4FT8A 4A3KJ 3VYRB 3GXOA 1GT0C 2V1NA 3A2KA 2FNAA 2ECCA 2EB7A 1YFHA 2V1XA 5HDGA 3JRBA 5CYVA 1BC8C 2GA1A 4NDLA 3K9TA 3CLOA 2MD0A 5IYCJ 5FD6A 2E19A 4EM1A 5JI6A 3WGIA 2JMWA 2JN6A 2GA2A 5FO5A 2FA5A 1BL0A 2H8WA 4IX7A 5KCMA 2MH9A 3OYMA 2IT0A 3HOYJ 3A01A 5E8IA 3WHBA 5FFZA 4A69C 4OAZA 4LG0A 1RNLA 4IHWA 1FEXA 4BUPA 2VJJA 2R5ZA 4Y4RA 3KEYA 2WY8Q 2QENA 3WG9A 3BLYA 3NAUA 1BM9A 2Y31A 4KFCA 4LLGF 1D1CA 4C3IJ 4E7SA 1Y1VJ 1FPQA 1NG6A 1SAXA 2JK3A 5EF6A 4OIOF 2OBPA 3K70C 1R6RA 2ZXHA 3CC4I 2L7ZA 1JUMA 2FMLA 1LVKA 2XDVA 3S3OA 3AAFA 4CGZA 2PLYA 2CG4A 2DQLA 4XR6A 4IRGA 2M8EA 4W97A 3FM3A 4GFBA 2M7AA 4MO7A 2VKVA 2DA6A 2ETHA 3FM5A 3DP7A 5FD5A 4PGGA 2QF7A 4PJMA 4RLQA 1SFKA 1MBKA 1FMWA 3PO2J 3VODA 5GAEJ 5GTHC 3A01B 3CJTB 3U9GA 2K9QA 1T0FC 2KDOA 3CJRB 1U0JA 4I98B 1YRNB 3L9FA 3BZ6A 2K40A 4L0YB 4CCKA 1VQKI 4BQNA 2R5ZB 2QBYA 3GCMA 1PYVA 2CMPA 4B44A 4H4KC 3K4LA 3H9JA 3I59A 5F1RA 2VBXA 2WY7Q 1SD4A 2CH0A 3I64A 3O3KA 4EJTA 2X4HA 3DBRB 3K6GA 3ESWB 3N4MA 2JA8J 2JA7J 3DEEA 3Q5FA 5F27A 3SXYA 1EV7A 3TP0A 3T1BA 3GTOJ 1D0ZA 1XGNA 3OS0A 2BW3A 4C2UA 2ZKZA 3ML6A 3U1DA 1IN4A 4LFUA 1ACIA 2WB1A 1WHUA 2WC2A 4IEJA 2KHMA 3PNVA 1J2XA 4KN4X 3WTWC 1TQPA 2YU3A 3RYRA 1ITYA 2M4KA 2RREA 3GZ6A 3F0CA 1YITI 2E60A 3HUGA 5TRDA 3R60A 3GFJA 3M7GA 1T08B 5B3SH 2DJIA 4LIVA 4ZDOA 3IHUA 2UUZA 2IGOA 2E5ZA 3SJMA 2XGDA 3HKZN 3NARA 1RI7A 2JA2A 2KRFA 3TBIA 2Z9OA 5HDKA 4BBSJ 1ZQ3P 5FRMA 4XIDA 3CCJI 4UUVA 3I59B 2OF7A 2WAQA 5F08A 3ZN1A 2IA2A 2LOOA 2WTEA 4I0AA 3PL8A 4CHUA 2FOKA 2P5LC 2HOSA 2ZCWA 1NH3A 2ZXIA 2B0LA 2A61A 4UVCA 4CICA 4E7IA 2ZXWH 2E1MC 4JX4A 4EJUA 5KHDA 3BPVA 1YYVA 2M30A 5E18F 1QA6A 1ZG3A 1O3SA 3GWZA 2GIZA 3AFHA 1W4MA 3ABTA 2ESNA 3T5XA 1MKMA 1S7OA 3HUGB 3K10A 2M5WA 4I02A 2K85A 4LJZF 2EFPA 1S7AA 3F8FA 4U0YA 2PN6A 3KP5A 2L01A 5A2QK 1UZCA 4XRSG 2JPCA 5AONA 2MSYA 2DTRA 3K0LA 2L9SA 3QU3A 4HZFA 1P7IA 4CZCA 2XAHA 1T56A 2M1BA 2Y0SN 2EZKA 1TBXA 1OLTA 4H0EA 2JRTA 4R1HA 1LFBA 2WAEA 4P96A 3JRDA 3P9KA 4CSWA 5BOXA 3WTXC 4A3LJ 3R0JA 3VWBA 1JJ8C 3BJOA 3DU6A 1J09A 1GHCA 3BZKA 4RAFA 1RR8C 4RAGA 4OWRB 2BXZA 3KYDB 3H9GA 1MH4A 1WPKA 2O9LA 2LH9A 1K7AA 1J0RA 3VPRA 2LMDA 2KIUA 2Q8KA 1RIOH 4Q4ZF 2VN2A 2K3FA 3M1CA 4PJNA 5D4RA 1IZ1A 1D1BA 4WWCA 3OYFA 3JRAA 4O5VA 3H3ZA 3F8BA 2ME0A 1W7PA 4BXXJ 1PUEE 1P92A 5GPCA 2HU9A 1ZH5A 2HKOA 1YW7A 1E3PA 4OAYA 2RNJA 1FZPB 2KISA 3IH4A 4EM2A 4BDZA 2AQFA 3HHGA 5EDNA 2EZLA 2XRLA 2R7XA 2ID3A 3Q0UA 2GXBA 1TNSA 2V6EA 4LMYA 2R7VA 3ONQA 2RGVA 4G6TB 4ZH4F 1T39A 3G1OA 2R7FA 5L3FA 3TW7A 4LGWA 4AM3A 1VI0A 4KITB 2QWWA 1XX5A 3BG6A 4YIFA 2VXZA 4A0YA 2CV0A 5H20A 2EBIA 1D3YA 4E6KG 4R79A 1OYWA 5DCMA 4RGSA 3LSRA 5CVJA 4U88A 3TKYA 5BNGA 3H5NA 5K1YA 1N25A 4JK1X 3K4JA 1FIAA 4X1EA 4QSHA 3ASNH 3LL7A 2P81A 4BYYA 2HVQA 1TNTA 1W7PB 2N8GA 1ZG5A 3GTGJ 1VQNI 1RESA 4F91B 2IXSA 3MZHA 4B4CA 1G3TA 2HXOA 2YX4A 5L3GA 1I39A 1S5LC 4HYEA 4UB6C 4RB2C 2QCOA 2DA7A 4BXUA 1X4OA 2NS7A 2HKXA 3RKQA 2MLKA 3F3XA 3RDIA 2GM4A 1A35A 1O57A 2PMUA 1U9OA 2WAFA 5E20A 2FBHA 5DD8A 5GAGJ 1OR7A 3L2RA 4R8HA 5FLMJ 1VQ8I 4QIWN 1TWGJ 3BR2A 2IW5A 2HR3A 5LD2C 1I6HJ 2EA2A 3SHFA 1G3SA 1E3OC 4PSWA 5FGMA 1VQ5I 3Q0VA 1I27A 5DCMB 1OYYA 1TWCJ 2CFXA 2EFOA 1IAWA 3IH3A 3GLXA 2DBBA 2DT7B 5H6RA 3GO5A 3CCEI 1QZZA 1P2FA 3KP6A 3RTRA 3OOPA 3FK7A 4IHTA 3CCQI 1IJWC 3G1LA 4A3BJ 4C9YA 4IQ4A 2A07F 4KIFA 1I50J 4AVPA 4HW0A 4AC0A 3HC7A 5IYDJ 1YIOA 1E2XA 2W1OA 2ISYA 4G6QA 3WTTC 1PP8F 5HDNA 1MH3A 2JUGA 2WV1A 4I76A 2HEOA 3BZCA 2H27A 2DOAA 2KDZA 4QPQA 4XONA 4DZJA 1TW3A 3C1DA 2HGCA 4M3EA 1B1BA 1EKEA 3HB9A 1T2KA 2ZFUA 4G94A 5A2QZ 1FOXA 1G3WA 3DBLB 1P9QC 5LGTA 2A68F 4RA2A 1FSEA 2OA4A 1AHDP 1GXPA 2XSDC 2HQNA 5FKLA 2BGCA 3S15J 1WGXA 3K4MA 3OSGA 3I9V2 4YIIA 2K27A 3SFZA 3HTSB 4Z6YA 4LK1F 2PI0A 3W2WA 2QQAA 3X2QH 5HS8A 2H09A 1KU9A 3B6AA 1HCRA 2P0WA 1Z77A 2IGNA 2H1KA 3RIRA 3H3VK 2KKOA 4HV5A 1WJDA 4AIJA 2KMUA 4BACA 3NWTA 4L9NA 1GV5A 4CA0A 2GZWA 1OISA 3O6BB 3D5LA 3V42A 4BL0B 2XASA 4U7BA 2EV6A 4Y3OA 3K4CA 2A6EF 1GV2A 2V79A 5LHIA 4XN3A 2WA0A 1QVUA 3MD2A 1Y8QB 2DA5A 2KZGA 2LD5A 2ZNZA 3F8CA 3FXQA 4J00A 1SVLA 2VT3A 4CXFA 1JKOC 4LITA 2R7RA 3M3YJ 2L4AA 3DWLE 2JJ7A 3I53A 3DTEA 3S2HJ 5ILSA 3OYDA 4XNFA 2QZ8A 2DODA 3OMYA 2E1CA 5EZGA 2O5RA 2I8DA 3ABMH 3HIFA 2YU9J 4PFOA 2K9NA 4XK4A 5L3DA 4HF2A 3BP8A 5IY5H 4XLEA 1W1WE 2QSGX 3E5XA 2DK5A 4ETSA 5F0HA 1TWHJ 3CTAA 1YTYA 4S0HB 1YQAA 5HLTA 1RZ4A 1ZK8A 1OMIA 5E17F 2L9RA 2KQRA 1TQMA 2Y69H 2NS8A 4M6XA 2M9HA 4Y33A 1OQYA 1B8IA 2EQRA 3ZGKA 4F52A 2P6TA 4GCVA 5E3MA 1IW7F 4NC8A 3K4KA 2K5CA 2DMQA 4I99C 3K2ZA 5J1RA 4Y15A 3AG4H 1UG2A 3VOEA 2OTLI 5K5RA 1FT9A 3PSFA 3VYUB 2UXNA 5ILUA 2MFZA 3ABLH 3MFKA 1LPQA 2QEXI 4YRVA 3CCSI 3FWEA 1TP4A 5B1AH 3K4BA 2EIKH 1WSUA 3LSIA 3FXMA 2KRHA 2PEXA 1R00A 2VI6A 1RUOA 1K6OA 3PJRA 2IVMA 3HRTA 1FJLA 4AD9A 4HLYA 5JR3A 1WFXA 2R7WA 1VQMI 3HXLA 5LLQA 2L7FP 2FBIA 5ICCA 1ENHA 2H1LA 2TDXA 1N75A 5EG0A 1XMXA 4E4HA 4A3JJ 3ZQCA 3S16J 2LY9A 1O3QA 3FXJA 4DYRA 4I09A 4G8XA 2QA4I 5DD4A 2F4OB 1B8IB 3AL0B 3VSKA 4P5OA 4BBRJ 4ANJA 2K4BA 5HS9A 1JI8A 2HTSA 2LKSA 4HX7A 1BIAA 2RV8A 3REOA 2ADUA 2CQXA 4F92B 2BHZA 2K3PA 4XLPF 2DK8A 3CCRI 3M07A 3OS2A 1WI3A 1J5YA 3QPSA 4DOZA 1USTA 2LKXA 2IGMA 3BCBA 3A02A 5CVIA 3MAJA 1Z9CA 4P9UA 1XSVA 3K1MA 3ZQQA 1IN5A 3OYNA 3MKYB 4C3JJ 1ERDA 1JJ6C 3IP4B 3OYKA 1X2MA 1R58A 4II2A 3JREA 4MTEA 4IHXA 3LSMA 1ETWA 1IXSB 2F5DA 4P9FA 1HLVA 4DNCA 2RVCA 3WODF 2F5CA 3WTYC 3C7JA 4HNUA 5F0CA 1MMAA 3CF5F 3IL2A 2F5EA 5E1XA 1RR7A 1FYMA 2CGPA 3BTIA 1X3ZB 2LF8A 2YR2A 3ECOA 2E2HJ 4FHTA 1K4SA 4U7DA 1XSXA 4BE1A 1VQ9I 2VJ4A 1TT5B 3CUOA 4M6VA 4D5FA 5GAHJ 3IV5A 4E7KA 1W36C 2STTA 3L2CA 2YX7A 1GUUA 4B3XA 5K7ZA 2MC3A 2MH2A 1D0YA 2LY2A 4HEA2 4PGHA 5DUKA 1ZGJA 3WGGA 4BQQA 1WZ2A 3PNTA 2EK5A 3LSHA 1IRGA 3HOZJ 1WJBA 1ETVA 1UMQA 1TWFJ 2M0MA 2HDCA 3JRFA 2HOAA 4B43A 3BR1A 4BJ5C 4AYBN 2LG4A 1BR1A 4CCNA 4CUGA 1MW7A 2M34A 3FK6A 2BE5F 3VEPA 1O7FA 1LFUP 3HKZA 3ZN0A 1U2WA 2D5VA 5GPAA 1PP7U 2CV1A 1DPUA 2X6YA 3EUHC 3ZXSA 5E3NA 1YHQI 3CUQC 1R1VA 4CO8A 4A3IJ 5JVGF 2DA2A 2XPWA 4MTDA 1U5TA 3OR2C 5HLGA 2Z99A 2K9MA 2IEKA 4A3EJ 4CCLA 2W7NA 1G6NA 1LQ1A 3ABKH 2E35A 4YIRX 3F6OA 3P9CA 1WJCA 1KQ8A 2OCCH 3TEDA 2BY3A 4KJZA 5BQTA 3HDDA 2K4JA 3V8KA 2VLAA 5IT3A 4Y17A 2V26A 1LNWA 3GZ5A 3RI4A 1ZYRF 1VQ7I 2PG4A 4YEJA 3JSOA 1MMDA 4M72A 2BZTA 2R4GA 1FYKA 3BCAA 2EIJH 2M2EA 4HPQA 3DPTA 2OUMA 5HNHA 3H5AA 1WH5A 2Q0OA 2X48A 5H6QA 4W1UA 1EH7A 4XM3A 4AUXA 2D45A 2L9VA 4CYCA 1LJ9A 1QBJA 5CVRA 2PBIA 5FROA 3QWLA 1BI1A 2AXLA 3IAM2 1MBFA 4FX0A 2Y0SA 4EATA 3SZTA 3LSPA 2I10A 3OIPA 1F36A 4XSXF 4ZYGA 3OIOA 1O7LA 3LSJA 2CJJA 1QVTA 2P6SA 1UJ8A 3DFGA 5C4JJ 2KIFA 4EJOA 1IF1A 5F6FA 2A05A 1QO0D 5LFAA 4XOPA 4RB0A 3FXKA 4LD5A 3B02A 3EYYA 2NS0A 2LRDA 3J7AO 1OJLA 5JHFA 2VKDA 1FOKA 1DDNA 3BROA 3FBNB 1KU3A 1YS7A 5FKNA 3L2QA 1MSEC 2XPUA 2M4GA 3PO3J 3QPLA 1H89C 4CYCB 2GXGA 3HGGA 3P9IA 2GIVA 3VYSB 2HYJA 1V55H 1WJAA 4ZDLA 3ULQB 2O0YA 3TOAA 4EEFG 4HA8A 5C4XJ 3PSIA 3ZQGA 3I58A 2CV2A 5D5VB 2CS3A 2B63J 1OFCX 3AL0C 2IGKA 2P4WA 2X0LA 1BBYA 3GBGA 2MABA 5HLIA 2D2WA 2KPMA 2WBMA 5B66C 1RUNA 4AIHA 3ZRGA 3EUAA 2H8RA 1MBGA 3DV8A 4O6JA 1ZREA 3G73A 3HOVJ 4UV9A 4YFXF 2NVYJ 1YJNI 1T95A 2LDUA 1REPC 4F55A 1IO2A 1IV8A 4LG0B 1XGMA 4IXAA 3SDBA 2F4IA 5EYRA 2F48A 4YFNF 4J01A 3OYIA 1V5EA 1IDYA 2DTZA 1D8KA 2XKOA 3E6DA 2VASA 2XV4S 1BJZA 4PDKA 2E34A 1CF7A 2NVTJ 1H9GA 3TL4X 3GTKJ 1KYWA 4BE2A 3R0AA 2JSPA 6PAXA 1QHGA 1Z1DA 2X6WA 1L0OC 2IBDA 3L00A 1AWCA 2IA0A 2NRAC 1V3FA 1X58A 4LB5A 2L54A 3FISA 3KZIC 2CUFA 2NOGA 5CVVA 4DZPA 2XAJA 2CQKA 2R92J 2CSOA 4HSTA 1I6XA 1TTYA 4XLNF 3T0YA 1ZHFA 3E97A 3WG7H 3R4KA 2VC0A 3QAHA 4X0GA 4Y52J 5J8FA 1DPRA 3UKGA 2QBYB 4N4OB 1IUFA 1HOMA 3BG5A 2W84A 5EZHA 2F5VA 3C2BA 1R5GA 2DLLA 3EPZA 3M4OJ 3S1QJ 2VE9A 2VOOA 4AIDA 5DM6F 1R7JA 2V9VA 1UHMA 2P7CB 2QSHX 2JVGA 1GVJA 2X9DA 2BW3B 1ZTRA 4MNUA 1BC7C 2JRMA 5CPRB 1CF7B 1EA3A 1QHHD 1XPXA 3ECHA 4QTRA 2BHYA 4HDVA 3V7RA 3BR5A 2XROA 1W5SA 1U3EM 1D5YA 1FP1D 3I5UA 1U8RA 1ZG1A 1X1PA 1QPMA 2X1DA 4S05A 4XKCA 3V8LA 4HAMA 1H8AC 4EMSA 1ZR2A 2LREA 2FX0A 3A0HC 3CQZJ 4G9YA 5E1ZB 1FMVA 4ZYAA 4M9SA 2GWRA 2MYSA 4Y13A 4QLCU 3FHZA 3LOCA 1S7EA 5BMZA 2QUFA 4ZDPA 1MJAA 4LIUA 5D6EA 2HPMA 3SEQA 2FU4A 1MD0A 2DO7A 4CCMA 3GFMA 2G7HA 4MIMA 2FXAA 2VPLA 1VQ6I 3M9AA 3F8MA 4ABZA 1LE8A 3H35A 3LA2A 4DYQA 2GXAA 4BY7J 1R71A 1HSJA 2H6BA 3H1CA 5EEGA 3GFIA 4KYWA 2JQ7A 2DPDA 2KZVA 2IS6A 5ED4A 1Q1VA 3CCMI 1JGSA 5EJCA 3I71A 2YUSA 2HQRA 4NUBA 2DMPA 1KQ0A 5DM7F 4D7MA 4IQJA 2XAFA 3HOWJ 3WU0A 1HQCA 3I4NJ 2KIQA 2BVMA 3LMMA 2JT1A 3DPUA 3FKJA 1O3TA 4ASNA 2R7UA 2VBWA 4B3AA 2Z1DA 4IOCF 3KYLA 3S93A 1C0WA 5LBQA 3W6VA 1XN7A 5D5XB 4YG2F 1OYIA 5DS9A 2V1DA 3KEQA 3HOTA 2HDWA 4DGWB 4DBQA 1OCCH 1X1BA 4TV7A 4L5JA 3FXLA 2M87A 2UXXA 1ON1A 1JXSA 3S17J 2C6YA 3S2DJ 1LE8B 2YS9A 2ZNYA 2DQRA 2IPQX 2R7QA 2EH3A 1DGWY 4BQOA 3J80K 1JKPC 3ASOH 4S04A 3WTSC 4IL6C 3COAC 1STZA 2LYCA 2OTJI 3R61A 3W6KB 1NTCA 1SEUA 3ZMVA 1LB2A 1APLC 1R9TJ 1MMNA 4L9JA 1WJFA 2XF7A 2L7KA 2CUEA 4F7ZA 1S6LA 2OAZA 4WX9A 4HQEA 4OIRF 4KISA 2EIMH 2Y9YA 3LAPA 3HOUJ 3I3LA 2HOTA 2HVSA 4KMUX 3SFIA 3HOXJ 3SYTA 3EDPA 2CU7A 1K6YA 1MBHA 2HZDA 3NWSA 3PUBA 5KNLA 2ZXJA 5EGOA 2X1EA 1XMAA 1J9IA 3K69A 4L5EA 1WKMA 4MGRA 1P4AA 1F4KA 3Q0WA 4O3MA 1FX7A 2VQLA 2KJCA 3IUOA 3OYEA 2LY1A 3N05A 1JTYA 1Z3XA 1Y0UA 1GVDA 1XG1A 2R3SA 5LRRA 5F1JA 1B6AA 3E0JB 4LG3A 2RKHA 5M5XJ 2HOEA 3BDDA 3OYBA 3CJNA 1KU7A 4AWXB 4EGYA 4PZJA 2CWEA 1K78A 1XCBA 3JTGA 3IH2A 3KCCA 3ZQIA 3R6SA 4OMYA 3EYIA 3WGHA 3HYIA 4MEXF 3V8JA 1FC3A 4A5NA 1OCOH 5EGOB 2OQRA 1K61A 5E1WA 1PDNC 3KLNA 1VZ0A 3BG7A 3O2PE 2HS5A 5AIPA 1W0TA 1EF4A 2EV5A 3CMAI 3RQ4A 2Y2ZA 3CMYA 1R5ID 3FKIJ 2R7TA 4DJAA 2W85A 1A31A 3VB2A 1MJ9A 2K86A 1IGNA 9ANTA 1A6IA 3C3WA 3GFLA 3PQJA 2J5PA 2O03A 4RM2A 1XSDA 4G7OF 4RBOA 2FSWA 3DEWA 2L0KA 1IRXA 4FX4A 1R4NB 3L2WA 2OJED 2QSFX 1YJWI 3DQVC 3S3MA 3BC8A 5F64A 4XICA 1A36A 3HTUA 2PX9A 2JA6J 3CJQB 2EFNA 3CP2A 1K78B 3BWGA 3QPTA 2VL8A 5EEAA 1B9NA 2F6CA 1YW8A 2KIMA 2QGUA 5K5OA 2TCTA 5CVUA 2ZFWA 2IRFG 3RJPA 2ZB9A 3KPHA 3QYEA 5D4SA 2G9WA 3KZZA 3AG1H 3JTHA 4HX4A 4PCQA 2VODA 3PFYA 5D8KB 4OMZA 3F9KA 1FIPA 4C30A 1JGGA 2CW0F 4XQFA 2FUG2 1EJ9A 2F4MB 2DA4A 2HYFA 4M71A 1JT6A 3LQRA 5K5QA 4OINF 1MNEA 4BY1J 3V7SA 3SEZA 5FKOA 1HDPA 1YG2A 3OYHA 3NEUA 2L3DA 5M5WJ 1XTAA 1JT0A 3M8FA 4P55A 4E7ZA 4BAYA 4BDYA 1R23A 1WJ5A 3TGNA 2CQ7A 2VOPA 1T38A 4ESJA 2PMHA 4AYBA 2DXIA 4A5MA 3PIPF 3DKYA 1L3LA 4B8XA 3KP4A 3F8NA 2O6GE 3BR3A 1XMKA 3FX3A 2OC6A 4RGRA 1FY7A 3OY9A 4FTHA 3TOBA 1WVRA 1W5TA 2EPFA 2PQ8A 2A5WA 1DUXC 3LAJA 1LDDA 1ZRFA 5ICFA 1AOYA 1FBQA 3SZGA 1O4XA 3GVAA 4M73A 2NVXJ 4OIPF 3E5QA 1Z91A 4G6DA 3HBLA 1B9MA 3J80Z 1E17A 3QP5A 1Y6IA 2V9KA 3HPHA 5JFRA 4NBQA 5C44J 3G3ZA 3ZCOA 1Z6TA 1HF0A 3ELKA 5L3EA 3KP2A 1HXDA 3ZPLA 3MQ0A 5JLXA 1VF9A 3LSGA 4D7NA 4IVNA 4BH9A 2FF4A 4ZC3A 3GYHX 4BNCA 2DFIA 3CCVI 3ZMZA 4A93J 4CZZA 1P6RA 3QYFA 4II3A 1G3YA 2NAZA 2DPUA 2LP0A 5E3OA 1PJRA 4EM0B 2E2IJ 1ETQA 3BTLA 3E6CC 4NHJA 4M9XA 1S9HA 2W82A 2B9SA 2EWNA 3JAMK 4IHSA 4KT5C 4L9VA 4KIGA 5ERIA 2JA5J 3EETA 1F1ZA 3MMYB 3WTVC 3GTQJ 4IO9F 4AVZA 4ZYEA 2W4SA 3CC2I 1U78A 1BJAA 2ZC2A 1G2HA 2XRNA 2EINH 1X2NA 3ABUA 4Q48A 2ISZA 3KIOA 1NK3P 2L5QA 1I3QJ 4ZZDA 1ETXA 3JCUC 1Z0XA 2RQPA 3ZQLA 1T6SA 4XOTA 1ETOA 1YJ9I 2VPRA 5DTDA 2BBYA 4HX8A 3W3CA 1G59A 1XD7A 1YS6A 3BPXA 2CUZA 2FBKA 2WADA 4PK4A 4I01A 5TGTA 1JHFA 2Y75A 4KMFA 4L9TA 4B48A 5M3FJ 3DKXA 3L09A 4RB1A 3OYJA 3TDZC 1GXQA 1GDTA 4ESFA 1XB4A 1T8IA 1E0EA 3KP7A 2ZBKA 2L4MA 3WU2C 3GW2A 3KZYA 1LEBA 1PUFA 3A0BC 5DV5A 1SC7A 5IPAA 3MVPA 4I0BA 3FMSA 4IHVA 2L7MP 4LK0F 4I2OA 2AO9A 5CQEA 2L9NA 2TRTA 4WCGA 5J8CA 3J81K 1SANA 5C3EJ 2VB6A 4IJAA 4A0XA 4PFPA 5BPIA 1WCMJ 5CJ9A 5HNFA 1DP3A 1V4RA 4FE7A 4RS8A 4ZJZA 4XSZF 3AKZA 3LFKA 3FZVA 1X3UA 2XKPA 2I5UA 4A6EA 3VFZA 3E6BA 5EG0B 2MD5A 2X6OA 3C2GA 2RNGA 5D5WB 2Z16A 4NNJA 2LR8A 4L5IA 3BG3A 3PNYA 3QRFF 1OR7C 5DYMA 3GTJJ 3MCZA 2XGCA 4PJLA 1TT0A 1A5JA 2CQQA 1TLHB 2A3SA 2GQQA 2ELHA 1A04A 2XUBA 3S3NA 3ROUA 1LFPA 1TC3C 3LA3A 3U1KA 2O3FA 3QQAA 3OL4A 2NXNB 3PFIA 2Z5UA 2CYYA 4G7HF 1FBSA 2EZIA 3I54A 3AG2H 3DU5A 4V2FA 5B1BH 3Q9VA 1WI9A 1JHHA 2BVLA 4BHPA 4XLAA 2DJNA 5D6FA 3DPLC 1TZLA 1TWAJ 3I0TA 4KIBA 4BHBA 4Y7NJ 2IJLA 5BS6A 2UWMA 3FXRA 4MQ9F 4L18B 4ENNA 2ZJQF 4HOBA 2W24A 3G1MA 2GOMA 3DBHB 2DOEA 3ZQHA 3RCOA 2E1OA 2XAQA 2ELKA 1ZARA 4OIQF 1UFMA 4RLFA 1QGPA 4UV8A 1OPCA 2VJ5A 4DYCA 3DF8A 1NK2P 1U8BA 1POGA 4KUMA 3OYLA 5D5UB 1QRYA 2BOLA 1PVEA 4WXCA 3H0GJ 3QODA 3UR3C 1SFEA 2VKEA 1E3HA 3BJ6A 5J4VA 2DDBA 1ZLJA 4N4NB 2BEOA 3RKWA 5J3LA 2LC2A 1K4TA 2KL4A 4A3DJ 1ON2A 2UZKA 2EILH 2DFHA 5F0FA 5JHUA 2E1MB 4XLFA 2HI3A 4ITVA 4ZZLA 3S1RJ 3I4MJ 3GZNB 3CDLA 4B47A 3AG3H 3GLLA 1LEAA 1ONVA 1I1GA 3CC7I 1Z7LA 5L3CA 1RRJA 2LSOA 2IS4A 5JLWA 1AKHA 1BI0A 2W48A 4LOCA 4FASD 1LDKB 1HC8A 2QM3A 2R7DA 2IA1A 3LA7A 1ULYA 5FKMA 2Z2SB 4IRHA 4XORA 1Z67A 4FQGA 3JAMZ 3F6VA 1G4DA 2DCEA 3Q9SA 2NNYA 3G6EI 3M8JA 2YPRA 1KA8A 4PSXA 1R1TA 1FLIA 3S1NJ 3NRVA 1DP7P 1U5TB 1QQIA 5FJ8J 4HF0A 2ZJ2A 4UNOA 5HOOA 2FRHA 2ECBA 1BOBA 4KT6A 1H9TA 1DGRM 5DCFA 2LLKA 2KLOA 1KZHA 2FD5A 3DTKA 5J40A 3DKWA 4M3BA 4A3MJ 3TMOA 3BY6A 3J7ZI 3BQZA 3GMEA 3RKXA 2PJPA 2JPBA 2VKHA 1QPIA 4OU0A 1M1EB 1R22A 2MLGA 3G4SI 4XRSA 1AKHB 1T98A 2DFEA 2VBZA 4ZYHA 3JR9A 2XB5A 1IRFA 5LGNA 4RGXA 1Y8RB 3A03A 4UB8C 3BTCA 3UNGC 4HRIA 4U87A 2E36A 3HJEA 3HSEA 1FOYA 3HRUA 1B59A 4XL9A 4C3HJ 4M3FA 2DMUA 3DLAA 3HEFA 1YRNA 2CUJA 1YX3A 3J81Z 3OYCA 3QU6A 3FDYA 3ZMDA 2OD5A 2PMZN 2RC4A 3HRSA 4JOMA 2E7WA 2QQ9A 1HKQA 2XB0X 2ZO4A 4GYIA 3QOPA 5J6XA 4RB3C 4LLNA 3C18A 3ZP5A 1TW2A 2R7OA 4KICA 3ISPA 5J1UA 4IOAF 1KGSA 2FEZA 2FMYA 1HA8A 3LSKA 3LFUA 4UVBA 3ZR8X 2DU9A 2ID6A 3VYTB 1IN7A 1HW5A 1KONA 2OPTA 4RGUA 5M3MJ 2CFOA 2VBYA 4FETA 1BR4A 1J7KA 1RC9A 2ACJA 1W5CC 3DXJF 5CKTA 3D1NI 1QZYA 2DFFA 1UHWA 2EA4A 3C2HA 4WXDA 3WU1B 2MA3A 4ENJA 3FXUA 3GEZA 3W2AA 1DU0A 2KRCA 2RAEA 4A12A 1DQUA 5ICEA 3K1NA 4M74A 2NOJB 3ZQFA 3GTPJ 2D1VA 1MZBA 5FFXA 4AU7A 1P7JA 2M7BA 4ZTFA 4J19A 1WRJA 1YE9A 4DW6A 1DU6A 2JSCA 3E1SA 4B09A 2XC7A 2VT2A 1Q1HA 3B73A 2EJRA 4JQFA 5JVTA 3MKLA 2V1UA 1X3WB 1HDDC 3RKYA 3MZYA 4U0WA 1NG7A 5AIQA 2JUCA 2VQCA 4GXOA 4CDGA 3TDUC 3FMQA 2QLZA 2QYOA 3K4NA 4HF1A 1VQPI 4UUTA 3P5JA 4RMNA 5KAFC 3F72A 2EFWA 1IG7A 5LRSA 2XF5A 4HNTA 2IS2A 3OIQA 3OWTA 4E7HA 3CLQA 3B6CA 2HWVA 1U6GA 1P4XA 3D0SA 3W6JB 2AS5F 1ZLKA 1N77A 5LEJA 4I7HA 4FCYA 2RN7A 4UVAA 4IF4A 2LF7A 1UB9A 3G71I 3KFWX 2FOWA 1X4PA 1S72I 1IXRC 3KETA 3EUKL 3MN2A
chains in the Genus database with same CATH topology
5FKKA 1ENHA 1EF4A 1W0TA 5IP6A 1GT0C 5EG0A 4A3JJ 3S16J 2ECCA 3ZQCA 1JKQC 2Y2ZA 2LY9A 3CMYA 1FTZA 3FKIJ 4DYRA 2DMNA 2HDDA 1BA5A 3JRBA 1B8IB 4NDLA 2R7ZJ 4G12A 1IGNA 1A6IA 5IYCJ 9ANTA 2E19A 4BBRJ 2JMWA 2JN6A 4RBOA 5IP7J 2XPVA 1BL0A 3DEWA 2CQXA 2L0KA 3TW6A 2VUMJ 1WI3A 1WH7A 1XC5A 3JRIA 3HOYJ 3A01A 3QPSA 3WHBA 4A69C 4XICA 2JA6J 2LKXA 4IHWA 1FEXA 3A02A 3O8GA 3BR0A 5EEAA 2R5ZA 2K9SA 3NAUA 2Y31A 2TCTA 4C3JJ 4C3IJ 1JJ6C 1Y1VJ 1X2MA 2ZB9A 3HM5A 2JK3A 1IV6A 5EF6A 4IHXA 3JREA 2L7ZA 1JUMA 1ETWA 1FIPA 1JGGA 4A3GJ 1HLVA 2HXIA 2DA4A 5F0CA 1JUPA 4W97A 5M5YJ 4GFBA 1JT6A 4MO7A 1RR7A 4IHYA 4BY1J 3BTIA 2VKVA 2DA6A 4FE4A 5FKOA 1HDPA 2E2HJ 2QF7A 2G0EA 2IAIA 5M5WJ 1MBKA 4B1RA 1JT0A 3PO2J 4D5FA 4M6VA 5K7FA 3IV5A 3A01B 2K9QA 1YRNB 1GUUA 5K7ZA 2K40A 3BR3A 2MG4A 2R5ZB 1MBJA 3K2AA 3RZDJ 4FTHA 3K7AJ 3JRHA 3HOZJ 3TP3A 1O4XA 1ETVA 2DN0A 1UMQA 1TWFJ 2NVXJ 2JA8J 1IDZA 3JRFA 2JA7J 1ETKA 2HOAA 3HBLA 5F27A 3BR1A 3TP0A 4AYBN 3GTMJ 1H88C 3GTOJ 3FK6A 2M34A 5C44J 1LFUP 1HF0A 3S1MJ 1RKTA 1JTXA 4IEJA 2D5VA 5GPAA 5JLXA 1VF9A 3LSGA 4D7NA 5E3NA 1JUSA 2R0QC 1ITYA 3F0CA 4A3IJ 1U9NA 2DA2A 2XPWA 4A93J 1FTTA 2LP0A 1UHSA 2IEKA 2XGDA 3HKZN 2WB1N 5E3OA 3BQYA 3L1PA 3SJMA 1RPWA 4A3EJ 2E2IJ 3NARA 1ETQA 3BTLA 1MSFC 4BBSJ 3TEDA 1ZQ3P 4XIDA 2OF7A 3HDDA 5F08A 2JA5J 3S14J 3GTQJ 2EZHA 2HOSA 2COBA 1VFCA 1U78A 2FJ1A 1G2HA 2M2EA 1XS9A 1X2NA 1WH5A 2X48A 4AUXA 4W1UA 5FLVA 3JRCA 4X6AJ 4CYCA 2WAQN 1NK3P 4JX4A 1I3QJ 1BW6A 1ETXA 1Z0XA 5K7HA 3ZQLA 1ETOA 1MBFA 2GBYA 2VPRA 5DTDA 1ZKGA 1F43A 3LSPA 4A3FJ 2I10A 2E2JJ 1F36A 3DCFA 3E7LA 3OIOA 5M3FJ 3LSJA 4XRSG 2CJJA 2ME6A 1QVTA 5HODA 4MFDA 2MSYA 5C4JJ 1GDTA 1P7IA 1T56A 2Y0SN 2EZKA 1PUFA 1JKRC 5IPAA 3MVPA 1LFBA 4IHVA 2L7MP 3JRDA 2AO9A 2TRTA 3RQIA 2LK2A 1OJLA 1SANA 2MGQA 5C3EJ 4A3LJ 1JJ8C 1WCMJ 5FKNA 4FE7A 3BTJA 1MSEC 2XPUA 4I6ZA 3PO3J 3QPLA 1H89C 4CYCB 3HGGA 1ETYA 2Y9ZA 5EG0B 2HYJA 2X6OA 4EEFG 3O8HA 5C4XJ 1ZGWA 1MH4A 1WPKA 3ZQGA 2O9LA 2LR8A 3BG3A 3VPRA 3GTJJ 3BT9A 1SFOJ 2XGCA 5IOZA 2B63J 4JX6A 1OFCX 3GBGA 3JRAA 1A5JA 2CQQA 4MFEA 4BXXJ 2ME0A 4RDUA 3LNQA 4BKXA 1TC3C 5GPCA 2H8RA 1MBGA 3QQAA 3Q3SA 3HOVJ 2NVYJ 2M0CA 3IH4A 2EZIA 2EZLA 5EDNA 2XRLA 4V2FA 2ID3A 3Q0UA 5EYRA 1OCTC 2DJNA 1TWAJ 4Y7NJ 3G1OA 1IDYA 2DTZA 3G1MA 3TW7A 1VI0A 3ZQHA 2E1OA 2MW8A 1BJZA 2ELKA 4HNVA 2EBIA 5J1YA 3RZOJ 2NVTJ 3GTKJ 3LSRA 4DYCA 4JYKA 1NK2P 3ZOBA 1U8BA 5BNGA 1OCPA 1POGA 1QRYA 2IBDA 1FIAA 4X1EA 4QSHA 3H0GJ 1X58A 2P81A 3BG9A 2N8GA 3GTGJ 2VKEA 3FISA 3JRGA 1RESA 2CUFA 2NOGA 2NVQJ 4D5CA 4DZPA 4B4CA 1Y1WJ 2R92J 2HXOA 5J3LA 4A3DJ 2QCOA 5F0FA 2DA7A 3RKQA 2NS7A 4Y52J 2HI3A 3UKGA 3S1RJ 1IUFA 1HOMA 3I4MJ 2GM4A 3BG5A 5EZHA 3CDLA 3C2BA 1U9OA 3M4OJ 3S1QJ 1RKWA 4V2GA 4QIWN 5FLMJ 1TWGJ 3BR2A 3HGYA 1I6HJ 2GLOA 1B72A 2X9DA 5JLWA 1IC8A 1E3OC 1AKHA 2R93J 1ZTRA 2W48A 4LOCA 3WHCA 3Q0VA 5IYBJ 4QTRA 5FKMA 3BR5A 1TWCJ 5IOYA 1ZR4A 3IH3A 1D5YA 4C2MJ 1MBEA 3S1NJ 5F04A 3FK7A 1RETA 5FJ8J 1IJWC 3G1LA 1H8AC 4A3BJ 2ECBA 1ZR2A 2CRGA 2FX0A 1I50J 3CQZJ 2LLKA 4AC0A 5IYDJ 1VNDA 2FD5A 3LOCA 1S7EA 3OSFA 4M3BA 4A3MJ 3BQZA 1MH3A 2WV1A 4I76A 4JP0A 4UUSA 2KDZA 2R5YA 1IRZA 1QPIA 4DZJA 4MIMA 4M3EA 1B72B 3HB9A 4XRSA 1AKHB 3JR9A 2XB5A 4ABZA 1LE8A 4DYQA 3A03A 4BY7J 3BTCA 2DA1A 2O7OA 1AHDP 2AHQA 2LFBA 4C3HJ 4M3FA 2XSDC 2XGEA 2DMUA 3HEFA 5FKLA 1YRNA 3S15J 4FISA 1WGXA 1Q1VA 3OSGA 2YUSA 2DMPA 4A3CJ 4D7MA 2PMZN 3HOWJ 1CQTA 2DA3A 3I4NJ 2XB0X 3B6AA 1HCRA 1Z77A 2H1KA 3H3VK 4B3AA 5J1UA 1GV5A 1PUFB 3W6VA 4UUSB 4MLOA 5DS9A 2R5YB 2JWTA 3SDGA 1GV2A 2ID6A 3FIWA 1QVUA 2OPTA 3S17J 2DA5A 5M3MJ 1W0UA 3S2DJ 1LE8B 2LD5A 2YS9A 2O8KA 3BR6A 3D1NI 1JKOC 2M8GX 2EH3A 3M3YJ 1JKPC 5EGOB 2JJ7A 1NTCA 1APLC 3S2HJ 4M3DA 1DU0A 2LVSA 2RAEA 1R9TJ 2CUEA 3ZQFA 4XRMA 5EZGA 1BW5A 3GTPJ 2DMTA 1MNMC 2YU9J 3OOUA 2K9NA 4XK4A 2Y9YA 3HOUJ 2LTPA 1P7JA 4J19A 4DW6A 2HOTA 5GP9A 3HOXJ 3SFIA 1DU6A 5F0HA 1TWHJ 2CU7A 1MBHA 4S0HB 3MKLA 1ZK8A 4JX5A 5EGOA 2L9RA 1HDDC 1AU7A 2NS8A 2M9HA 4L5EA 3Q0WA 1B8IA 2EQRA 2KT0A 5E3LA 1K83J 5E3MA 3PM1A 1JTYA 2DMQA 4UUTA 5J1RA 1ORKA 1GVDA 1XG1A 1UG2A 2FQ4A 1IG7A 5F1JA 2HQ5A 5M5XJ 3B6CA 2Y30A 1T33A 4M3GA 4FCYA 3IH2A 3CCYA 5IP9J 2VI6A 3ZQIA 1FJLA 2L7FP 3GTLJ 3MN2A 4A3KJ 1K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKK A;  1ENH A;  1EF4 A;  1W0T A;  5IP6 A;  1GT0 C;  5EG0 A;  4A3J J;  3S16 J;  2ECC A;  3ZQC A;  1JKQ C;  2Y2Z A;  2LY9 A;  3CMY A;  1FTZ A;  3FKI J;  4DYR A;  2DMN A;  2HDD A;  1BA5 A;  3JRB A;  1B8I B;  4NDL A;  2R7Z J;  4G12 A;  1IGN A;  1A6I A;  5IYC J;  9ANT A;  2E19 A;  4BBR J;  2JMW A;  2JN6 A;  4RBO A;  5IP7 J;  2XPV A;  1BL0 A;  3DEW A;  2CQX A;  2L0K A;  3TW6 A;  2VUM J;  1WI3 A;  1WH7 A;  1XC5 A;  3JRI A;  3HOY J;  3A01 A;  3QPS A;  3WHB A;  4A69 C;  4XIC A;  2JA6 J;  2LKX A;  4IHW A;  1FEX A;  3A02 A;  3O8G A;  3BR0 A;  5EEA A;  2R5Z A;  2K9S A;  3NAU A;  2Y31 A;  2TCT A;  4C3J J;  4C3I J;  1JJ6 C;  1Y1V J;  1X2M A;  2ZB9 A;  3HM5 A;  2JK3 A;  1IV6 A;  5EF6 A;  4IHX A;  3JRE A;  2L7Z A;  1JUM A;  1ETW A;  1FIP A;  1JGG A;  4A3G J;  1HLV A;  2HXI A;  2DA4 A;  5F0C A;  1JUP A;  4W97 A;  5M5Y J;  4GFB A;  1JT6 A;  4MO7 A;  1RR7 A;  4IHY A;  4BY1 J;  3BTI A;  2VKV A;  2DA6 A;  4FE4 A;  5FKO A;  1HDP A;  2E2H J;  2QF7 A;  2G0E A;  2IAI A;  5M5W J;  1MBK A;  4B1R A;  1JT0 A;  3PO2 J;  4D5F A;  4M6V A;  5K7F A;  3IV5 A;  3A01 B;  2K9Q A;  1YRN B;  1GUU A;  5K7Z A;  2K40 A;  3BR3 A;  2MG4 A;  2R5Z B;  1MBJ A;  3K2A A;  3RZD J;  4FTH A;  3K7A J;  3JRH A;  3HOZ J;  3TP3 A;  1O4X A;  1ETV A;  2DN0 A;  1UMQ A;  1TWF J;  2NVX J;  2JA8 J;  1IDZ A;  3JRF A;  2JA7 J;  1ETK A;  2HOA A;  3HBL A;  5F27 A;  3BR1 A;  3TP0 A;  4AYB N;  3GTM J;  1H88 C;  3GTO J;  3FK6 A;  2M34 A;  5C44 J;  1LFU P;  1HF0 A;  3S1M J;  1RKT A;  1JTX A;  4IEJ A;  2D5V A;  5GPA A;  5JLX A;  1VF9 A;  3LSG A;  4D7N A;  5E3N A;  1JUS A;  2R0Q C;  1ITY A;  3F0C A;  4A3I J;  1U9N A;  2DA2 A;  2XPW A;  4A93 J;  1FTT A;  2LP0 A;  1UHS A;  2IEK A;  2XGD A;  3HKZ N;  2WB1 N;  5E3O A;  3BQY A;  3L1P A;  3SJM A;  1RPW A;  4A3E J;  2E2I J;  3NAR A;  1ETQ A;  3BTL A;  1MSF C;  4BBS J;  3TED A;  1ZQ3 P;  4XID A;  2OF7 A;  3HDD A;  5F08 A;  2JA5 J;  3S14 J;  3GTQ J;  2EZH A;  2HOS A;  2COB A;  1VFC A;  1U78 A;  2FJ1 A;  1G2H A;  2M2E A;  1XS9 A;  1X2N A;  1WH5 A;  2X48 A;  4AUX A;  4W1U A;  5FLV A;  3JRC A;  4X6A J;  4CYC A;  2WAQ N;  1NK3 P;  4JX4 A;  1I3Q J;  1BW6 A;  1ETX A;  1Z0X A;  5K7H A;  3ZQL A;  1ETO A;  1MBF A;  2GBY A;  2VPR A;  5DTD A;  1ZKG A;  1F43 A;  3LSP A;  4A3F J;  2I10 A;  2E2J J;  1F36 A;  3DCF A;  3E7L A;  3OIO A;  5M3F J;  3LSJ A;  4XRS G;  2CJJ A;  2ME6 A;  1QVT A;  5HOD A;  4MFD A;  2MSY A;  5C4J J;  1GDT A;  1P7I A;  1T56 A;  2Y0S N;  2EZK A;  1PUF A;  1JKR C;  5IPA A;  3MVP A;  1LFB A;  4IHV A;  2L7M P;  3JRD A;  2AO9 A;  2TRT A;  3RQI A;  2LK2 A;  1OJL A;  1SAN A;  2MGQ A;  5C3E J;  4A3L J;  1JJ8 C;  1WCM J;  5FKN A;  4FE7 A;  3BTJ A;  1MSE C;  2XPU A;  4I6Z A;  3PO3 J;  3QPL A;  1H89 C;  4CYC B;  3HGG A;  1ETY A;  2Y9Z A;  5EG0 B;  2HYJ A;  2X6O A;  4EEF G;  3O8H A;  5C4X J;  1ZGW A;  1MH4 A;  1WPK A;  3ZQG A;  2O9L A;  2LR8 A;  3BG3 A;  3VPR A;  3GTJ J;  3BT9 A;  1SFO J;  2XGC A;  5IOZ A;  2B63 J;  4JX6 A;  1OFC X;  3GBG A;  3JRA A;  1A5J A;  2CQQ A;  4MFE A;  4BXX J;  2ME0 A;  4RDU A;  3LNQ A;  4BKX A;  1TC3 C;  5GPC A;  2H8R A;  1MBG A;  3QQA A;  3Q3S A;  3HOV J;  2NVY J;  2M0C A;  3IH4 A;  2EZI A;  2EZL A;  5EDN A;  2XRL A;  4V2F A;  2ID3 A;  3Q0U A;  5EYR A;  1OCT C;  2DJN A;  1TWA J;  4Y7N J;  3G1O A;  1IDY A;  2DTZ A;  3G1M A;  3TW7 A;  1VI0 A;  3ZQH A;  2E1O A;  2MW8 A;  1BJZ A;  2ELK A;  4HNV A;  2EBI A;  5J1Y A;  3RZO J;  2NVT J;  3GTK J;  3LSR A;  4DYC A;  4JYK A;  1NK2 P;  3ZOB A;  1U8B A;  5BNG A;  1OCP A;  1POG A;  1QRY A;  2IBD A;  1FIA A;  4X1E A;  4QSH A;  3H0G J;  1X58 A;  2P81 A;  3BG9 A;  2N8G A;  3GTG J;  2VKE A;  3FIS A;  3JRG A;  1RES A;  2CUF A;  2NOG A;  2NVQ J;  4D5C A;  4DZP A;  4B4C A;  1Y1W J;  2R92 J;  2HXO A;  5J3L A;  4A3D J;  2QCO A;  5F0F A;  2DA7 A;  3RKQ A;  2NS7 A;  4Y52 J;  2HI3 A;  3UKG A;  3S1R J;  1IUF A;  1HOM A;  3I4M J;  2GM4 A;  3BG5 A;  5EZH A;  3CDL A;  3C2B A;  1U9O A;  3M4O J;  3S1Q J;  1RKW A;  4V2G A;  4QIW N;  5FLM J;  1TWG J;  3BR2 A;  3HGY A;  1I6H J;  2GLO A;  1B72 A;  2X9D A;  5JLW A;  1IC8 A;  1E3O C;  1AKH A;  2R93 J;  1ZTR A;  2W48 A;  4LOC A;  3WHC A;  3Q0V A;  5IYB J;  4QTR A;  5FKM A;  3BR5 A;  1TWC J;  5IOY A;  1ZR4 A;  3IH3 A;  1D5Y A;  4C2M J;  1MBE A;  3S1N J;  5F04 A;  3FK7 A;  1RET A;  5FJ8 J;  1IJW C;  3G1L A;  1H8A C;  4A3B J;  2ECB A;  1ZR2 A;  2CRG A;  2FX0 A;  1I50 J;  3CQZ J;  2LLK A;  4AC0 A;  5IYD J;  1VND A;  2FD5 A;  3LOC A;  1S7E A;  3OSF A;  4M3B A;  4A3M J;  3BQZ A;  1MH3 A;  2WV1 A;  4I76 A;  4JP0 A;  4UUS A;  2KDZ A;  2R5Y A;  1IRZ A;  1QPI A;  4DZJ A;  4MIM A;  4M3E A;  1B72 B;  3HB9 A;  4XRS A;  1AKH B;  3JR9 A;  2XB5 A;  4ABZ A;  1LE8 A;  4DYQ A;  3A03 A;  4BY7 J;  3BTC A;  2DA1 A;  2O7O A;  1AHD P;  2AHQ A;  2LFB A;  4C3H J;  4M3F A;  2XSD C;  2XGE A;  2DMU A;  3HEF A;  5FKL A;  1YRN A;  3S15 J;  4FIS A;  1WGX A;  1Q1V A;  3OSG A;  2YUS A;  2DMP A;  4A3C J;  4D7M A;  2PMZ N;  3HOW J;  1CQT A;  2DA3 A;  3I4N J;  2XB0 X;  3B6A A;  1HCR A;  1Z77 A;  2H1K A;  3H3V K;  4B3A A;  5J1U A;  1GV5 A;  1PUF B;  3W6V A;  4UUS B;  4MLO A;  5DS9 A;  2R5Y B;  2JWT A;  3SDG A;  1GV2 A;  2ID6 A;  3FIW A;  1QVU A;  2OPT A;  3S17 J;  2DA5 A;  5M3M J;  1W0U A;  3S2D J;  1LE8 B;  2LD5 A;  2YS9 A;  2O8K A;  3BR6 A;  3D1N I;  1JKO C;  2M8G X;  2EH3 A;  3M3Y J;  1JKP C;  5EGO B;  2JJ7 A;  1NTC A;  1APL C;  3S2H J;  4M3D A;  1DU0 A;  2LVS A;  2RAE A;  1R9T J;  2CUE A;  3ZQF A;  4XRM A;  5EZG A;  1BW5 A;  3GTP J;  2DMT A;  1MNM C;  2YU9 J;  3OOU A;  2K9N A;  4XK4 A;  2Y9Y A;  3HOU J;  2LTP A;  1P7J A;  4J19 A;  4DW6 A;  2HOT A;  5GP9 A;  3HOX J;  3SFI A;  1DU6 A;  5F0H A;  1TWH J;  2CU7 A;  1MBH A;  4S0H B;  3MKL A;  1ZK8 A;  4JX5 A;  5EGO A;  2L9R A;  1HDD C;  1AU7 A;  2NS8 A;  2M9H A;  4L5E A;  3Q0W A;  1B8I A;  2EQR A;  2KT0 A;  5E3L A;  1K83 J;  5E3M A;  3PM1 A;  1JTY A;  2DMQ A;  4UUT A;  5J1R A;  1ORK A;  1GVD A;  1XG1 A;  1UG2 A;  2FQ4 A;  1IG7 A;  5F1J A;  2HQ5 A;  5M5X J;  3B6C A;  2Y30 A;  1T33 A;  4M3G A;  4FCY A;  3IH2 A;  3CCY A;  5IP9 J;  2VI6 A;  3ZQI A;  1FJL A;  2L7F P;  3GTL J;  3MN2 A;  4A3K J;  1K61 A; 
#chains in the Genus database with same CATH topology
 5FKK A;  1N78 A;  5IP6 A;  2P8T A;  4WK8 F;  1JKQ C;  1FTZ A;  1D5V A;  2HDD A;  3P7N A;  2DMN A;  1BA5 A;  4HG2 A;  3T8T A;  1I1S A;  1V5G A;  2ZME A;  3MZ8 A;  4BHC A;  4G12 A;  2R7Z J;  1FYL A;  4AIK A;  4BEH A;  3HZJ A;  1YO5 C;  1IXC A;  4IKF A;  4HBL A;  2X51 A;  5IP7 J;  3DLL F;  2XPV A;  2R7S A;  5FLX K;  3TW6 A;  1LVA A;  1VTN C;  2VUM J;  3D5S C;  1WH7 A;  2QVO A;  1XC5 A;  3JRI A;  2XAG A;  3IC7 A;  2WV0 A;  2LBF A;  3IRQ A;  4XKV A;  4ENM A;  3WTZ A;  3O8G A;  3BR0 A;  2K9S A;  2NVU B;  1U5T C;  1W7P D;  3EQL F;  2DYR H;  3VDX A;  4NQW A;  1YI2 I;  2DW4 A;  2RDP A;  3I4P A;  3HM5 A;  2ICW G;  2IP2 A;  1IV6 A;  2UV1 A;  2ZJP F;  3SQN A;  5FRN A;  1YOV B;  2VQH A;  2ZSH B;  1UEL B;  2VC1 A;  1D8J A;  4A3G J;  4BGD A;  2HXI A;  3GTL J;  1HBX G;  3S8P A;  1JUP A;  4EJW A;  2ZME B;  5M5Y J;  2OQG A;  4BEH B;  4F3Q A;  2VE8 A;  4IHY A;  1Y56 A;  3WTU C;  3MWM A;  1BN5 A;  4FE4 A;  4C2T A;  2DAO A;  1Z3Y A;  2QQ8 A;  2O61 A;  2G0E A;  2IAI A;  3CDI A;  4B1R A;  3I56 I;  4ON0 A;  5K7F A;  3QOE A;  2QQB A;  3FXO A;  4KA4 A;  1KQ9 A;  2XIG A;  3OV8 A;  1MIJ A;  4RAY A;  3V4G A;  1ZRC A;  4CCO A;  5GAD J;  2H6C A;  3OYG A;  2LBF B;  1HW2 A;  4GO1 A;  2WWY A;  4Z2Y A;  2MG4 A;  5J47 A;  1OCR H;  1MBJ A;  2P7V B;  3K2A A;  3RZD J;  4GRI A;  3K7A J;  4XKB A;  3JRH A;  1HST A;  3M1E A;  4EVI A;  4RM3 A;  4NQW B;  3KYC B;  5KVR A;  3RPQ A;  3TP3 A;  2DN0 A;  3S2W A;  1IDZ A;  3HHH A;  1ETK A;  1F9N A;  3F22 A;  1MDM A;  2A6T A;  3GTM J;  4DQ2 A;  1H88 C;  1S3J A;  1P4W A;  3S1M J;  1RKT A;  1JTX A;  4CCJ A;  4XKW A;  3T8R A;  2D1H A;  2OV7 A;  1XGS A;  3FF5 A;  4PUS A;  4XLC A;  1JUS A;  2R0Q C;  2X1C A;  4CH7 A;  2K9L A;  2RQQ A;  4DBR A;  1U9N A;  1YX5 A;  5DUI A;  2XAU A;  4G7Z F;  1FTT A;  2EFQ A;  3G2B A;  1UHS A;  1SAU A;  2WB1 N;  3BQY A;  3L1P A;  3ERE D;  1RPW A;  1W36 D;  3V7C A;  2Y48 A;  2Q2E A;  4ZTJ A;  4KDP A;  3SZP A;  3MEX A;  4N0B A;  4NC7 A;  1MSF C;  2MC4 A;  5ILV A;  5J4Y A;  1IUY A;  3LST A;  3S14 J;  3BOQ A;  2MBF A;  1GLN A;  1HW1 A;  2XVC A;  4N9I A;  3L7W A;  3M8E A;  5H2F C;  3HSF A;  2EZH A;  1MDM B;  4L0Z B;  2COB A;  1XCV A;  1R1U A;  1VFC A;  5LHH A;  2FJ1 A;  1XS9 A;  1SD5 A;  4EJV A;  1K79 A;  1FWZ A;  4X6A J;  5FLV A;  3JRC A;  2A69 F;  2WAQ N;  4D1Q A;  1BW6 A;  2JVH A;  2XGX A;  2GAU A;  3IWF A;  5K7H A;  2BY2 A;  2GBY A;  2AXT C;  1D1A A;  3HRM A;  4UXN A;  5CQG A;  2A5Y B;  1ZKG A;  3CCU I;  1R49 A;  1NHA A;  5D8L B;  4A3F J;  2PJR A;  1F43 A;  5L3B A;  2BY0 A;  3H9Q A;  4GGG A;  4XMY A;  2E2J J;  3DCF A;  2XHK A;  3KX2 A;  2VJI A;  3E7L A;  4WF2 A;  2ME6 A;  2FE3 A;  5HOD A;  3PIO F;  4MFD A;  5EEH A;  2Q2E B;  1BIB A;  2KP6 A;  4XRF A;  2OU2 A;  2STW A;  1SD6 A;  3H3U A;  5IT9 K;  4E7L A;  1WJE A;  1JKR C;  2L02 A;  4KNY A;  3EUH A;  4RAZ A;  2HFH A;  3RQI A;  2LK2 A;  3BJA A;  2GOX B;  2MGQ A;  3PQK A;  4WXH A;  4D0P A;  3CUQ A;  3OS1 A;  3JSP A;  1V54 H;  5E8G A;  3S32 A;  1WQ2 A;  3E5U A;  3FHN A;  1A6Q A;  3BTJ A;  3RSN A;  5FLX Z;  1OCZ H;  1YW9 A;  4I6Z A;  1SMY F;  3CMM A;  1CGP A;  2E7X A;  3HL2 A;  4Q47 A;  1ETY A;  1UCR A;  2Y9Z A;  3E3V A;  3I55 I;  2DOF A;  4F93 B;  3O8H A;  1ZGW A;  2X85 A;  2AQE A;  2PJR B;  1SFO J;  3BT9 A;  4HQM A;  2ESH A;  2M3A A;  5IOZ A;  2VXD A;  4JX6 A;  3F21 A;  2ZJR F;  4EV0 A;  1ZRD A;  3IKT A;  4DIQ A;  2CQN A;  2X6X A;  2NYX A;  4MFE A;  4RDU A;  3QP6 A;  3LNQ A;  3CDH A;  4BKX A;  2JTV A;  2VIX A;  3Q3S A;  1TL8 A;  1VQ4 I;  2YSR A;  3HG9 A;  2M0C A;  3OR1 C;  1FBU A;  1LDJ A;  1S29 A;  2V6C A;  2K7L A;  3ZMU A;  2VQG A;  1OCT C;  3GX4 X;  4MQV A;  1TQI A;  2DT6 A;  2LKP A;  5KAI C;  5HLH A;  3L2V A;  3CUQ B;  3L2U A;  3CD6 I;  1EH8 A;  4K2E A;  3U2R A;  4ENK A;  5ICG A;  1X1D A;  2CW7 A;  3QYB A;  3HOS A;  1X1A A;  2MW8 A;  5B5E C;  2HQA A;  4QWQ A;  4HNV A;  2DDA A;  5J1Y A;  3K70 D;  3RZO J;  1SFX A;  4JYK A;  4QPO A;  5DDG A;  3ZOB A;  4KN7 X;  1OCP A;  1FSH A;  1I3A A;  2ZME C;  5CLS A;  2E71 A;  3TO9 A;  4MEY F;  3BG9 A;  3ZMS A;  2J5O A;  3JRG A;  2V4J C;  1Y0N A;  2FQ3 A;  4MHG A;  3CP8 A;  2NVQ J;  3GF2 A;  4D5C A;  1Y1W J;  1UG0 A;  2Y0M A;  3RYP A;  2NNN A;  3LWF A;  4N9H A;  1LKX A;  2O8X A;  3VSL A;  1SVO A;  2OZ6 A;  3ZMT A;  3NQO A;  3OYA A;  3FBI B;  4BU2 A;  1G8X A;  1KYZ A;  5E79 C;  4UY8 I;  1S8N A;  4PJ0 C;  1AA7 A;  4BS9 A;  1OKR A;  4V19 K;  4D9J A;  1XDU A;  1IN6 A;  3H36 A;  4XLH A;  1RKW A;  4V2G A;  1ZAO A;  3HGY A;  1D0X A;  2GLO A;  1B72 A;  2IS1 A;  3HPG A;  1IC8 A;  2R93 J;  2HZT A;  2W00 A;  1Z7U A;  3WE3 A;  4NC6 A;  3WHC A;  1IN8 A;  3DTI A;  1R4M B;  5IYB J;  4P1W A;  4HV6 A;  5IOY A;  1ZR4 A;  2ZSI B;  3PUF A;  5HVQ C;  2HVR A;  1T0F A;  1HKT A;  2BYV E;  2LNB A;  3U21 A;  4C2M J;  2Z33 A;  1YLF A;  1JE8 A;  4GYG A;  1VQL I;  1MBE A;  2V9P A;  1BR2 A;  3LQQ A;  1BI3 A;  5F04 A;  1RET A;  4PJJ A;  3N97 A;  3KLO A;  1V5F A;  1H0M A;  2CRG A;  4JBA A;  3J7Y J;  3F23 A;  1ODD A;  3WE2 A;  2Z3Y A;  1VND A;  2K02 A;  3OSF A;  1XGO A;  1SD7 A;  3H0D A;  4LLL A;  4YFK F;  3J7A Y;  4BJ6 C;  4JP0 A;  4UUS A;  1Y39 A;  2CO5 A;  2R5Y A;  1IRZ A;  1F5T A;  3W2V A;  4A0Z A;  1B72 B;  3IAS 2;  1FNN A;  4BQA A;  1FOW A;  2HNH A;  2PMZ A;  2QKL B;  1QZE A;  2DA1 A;  1VQO I;  2O7O A;  2XSJ C;  2FNP A;  5FB2 A;  5LGU A;  2AHQ A;  5DEQ A;  2LFB A;  5IT9 Z;  2COM A;  1ZGA A;  2PFB A;  4BE0 A;  1BI2 A;  2XGE A;  2DT5 A;  3JW4 A;  2VON A;  4FIS A;  4A3C J;  4EGZ A;  2G7U A;  1CQT A;  2DA3 A;  1R36 A;  4IZZ A;  5GTI C;  2B7E A;  3QPH A;  4GDF A;  4CYD A;  4EQQ A;  3FMR A;  3KP3 A;  2ELJ A;  1PUF B;  4ZYD A;  3TO7 A;  4UUS B;  3IKV A;  1Z21 A;  4MLO A;  2R5Y B;  2P5V A;  2JWT A;  3SDG A;  2BV6 A;  1BOA A;  1EH6 A;  3KEO A;  5LEK A;  1UAA A;  3FIW A;  1X1C A;  1O3R A;  2HPI A;  3IWZ A;  5BPD A;  3CO6 C;  1W0U A;  3HSR A;  4BJT A;  2O8K A;  2W57 A;  3BR6 A;  4IPA A;  1R5H A;  2M8G X;  1SMT A;  2V7F A;  2OCE A;  3A4C A;  1WWX A;  3ERM A;  2F2E A;  3H92 A;  1XDS A;  3CME I;  4M3D A;  3TQN A;  4XBF A;  2LVS A;  4YEL A;  4HSR A;  3ZQ7 A;  2QKM B;  2E5N A;  4XRM A;  4E7J A;  1BW5 A;  1SVM A;  2DMT A;  1MNM C;  1MGT A;  3OOU A;  2W25 A;  1YIJ I;  2P5K A;  3OL3 A;  3CF2 A;  2LTP A;  2JZY A;  2KFD A;  3CCL I;  4UHT A;  1MMG A;  5GP9 A;  2OZU A;  3CES A;  3E6M A;  3DEU A;  2EV0 A;  4XN0 A;  3TO6 A;  1MMS A;  4M9Z A;  2DI3 A;  1Z6R A;  4JX5 A;  2H94 A;  3KE2 A;  4A2U A;  2F5F A;  4HLX A;  1KU2 A;  2A6H F;  4LB6 B;  3CO7 C;  1AU7 A;  3CZ6 A;  4U0V A;  2DYS H;  1LUJ B;  1I5Z A;  4NB5 A;  1SFU A;  3IRR A;  5TIS C;  4HDU A;  3D5R C;  2M45 A;  4E70 A;  2XF6 A;  2KT0 A;  2HYG D;  5KK1 A;  5E3L A;  1K83 J;  4Q5S F;  3PM1 A;  3RPU D;  4IRI A;  3A1Y A;  1QU3 A;  2E1N A;  2L2O A;  1ORK A;  3H5R A;  2HTJ A;  3K1P A;  5TJJ A;  2FQ4 A;  2BY1 A;  1J75 A;  2Q1Z B;  1MND A;  2HQ5 A;  1USS A;  1X19 A;  2Y30 A;  1T33 A;  5HS7 A;  4BXF A;  4M3G A;  2BXY A;  1FP2 A;  1HKS A;  1Z05 A;  4ESB A;  5LHG A;  2CW8 A;  3GUD A;  3CCY A;  5IP9 J;  1B4A A;  1MJB A;  3RPU A;  1QNT A;  1ZN2 A;  3MKW B;  1ZEL A;  1J59 A;  4OOI A;  4A6D A;  3MKZ A;  2KJB A;  4M6Y A;  4FT8 A;  4A3K J;  3VYR B;  3GXO A;  1GT0 C;  2V1N A;  3A2K A;  2FNA A;  2ECC A;  2EB7 A;  1YFH A;  2V1X A;  5HDG A;  3JRB A;  5CYV A;  1BC8 C;  2GA1 A;  4NDL A;  3K9T A;  3CLO A;  2MD0 A;  5IYC J;  5FD6 A;  2E19 A;  4EM1 A;  5JI6 A;  3WGI A;  2JMW A;  2JN6 A;  2GA2 A;  5FO5 A;  2FA5 A;  1BL0 A;  2H8W A;  4IX7 A;  5KCM A;  2MH9 A;  3OYM A;  2IT0 A;  3HOY J;  3A01 A;  5E8I A;  3WHB A;  5FFZ A;  4A69 C;  4OAZ A;  4LG0 A;  1RNL A;  4IHW A;  1FEX A;  4BUP A;  2VJJ A;  2R5Z A;  4Y4R A;  3KEY A;  2WY8 Q;  2QEN A;  3WG9 A;  3BLY A;  3NAU A;  1BM9 A;  2Y31 A;  4KFC A;  4LLG F;  1D1C A;  4C3I J;  4E7S A;  1Y1V J;  1FPQ A;  1NG6 A;  1SAX A;  2JK3 A;  5EF6 A;  4OIO F;  2OBP A;  3K70 C;  1R6R A;  2ZXH A;  3CC4 I;  2L7Z A;  1JUM A;  2FML A;  1LVK A;  2XDV A;  3S3O A;  3AAF A;  4CGZ A;  2PLY A;  2CG4 A;  2DQL A;  4XR6 A;  4IRG A;  2M8E A;  4W97 A;  3FM3 A;  4GFB A;  2M7A A;  4MO7 A;  2VKV A;  2DA6 A;  2ETH A;  3FM5 A;  3DP7 A;  5FD5 A;  4PGG A;  2QF7 A;  4PJM A;  4RLQ A;  1SFK A;  1MBK A;  1FMW A;  3PO2 J;  3VOD A;  5GAE J;  5GTH C;  3A01 B;  3CJT B;  3U9G A;  2K9Q A;  1T0F C;  2KDO A;  3CJR B;  1U0J A;  4I98 B;  1YRN B;  3L9F A;  3BZ6 A;  2K40 A;  4L0Y B;  4CCK A;  1VQK I;  4BQN A;  2R5Z B;  2QBY A;  3GCM A;  1PYV A;  2CMP A;  4B44 A;  4H4K C;  3K4L A;  3H9J A;  3I59 A;  5F1R A;  2VBX A;  2WY7 Q;  1SD4 A;  2CH0 A;  3I64 A;  3O3K A;  4EJT A;  2X4H A;  3DBR B;  3K6G A;  3ESW B;  3N4M A;  2JA8 J;  2JA7 J;  3DEE A;  3Q5F A;  5F27 A;  3SXY A;  1EV7 A;  3TP0 A;  3T1B A;  3GTO J;  1D0Z A;  1XGN A;  3OS0 A;  2BW3 A;  4C2U A;  2ZKZ A;  3ML6 A;  3U1D A;  1IN4 A;  4LFU A;  1ACI A;  2WB1 A;  1WHU A;  2WC2 A;  4IEJ A;  2KHM A;  3PNV A;  1J2X A;  4KN4 X;  3WTW C;  1TQP A;  2YU3 A;  3RYR A;  1ITY A;  2M4K A;  2RRE A;  3GZ6 A;  3F0C A;  1YIT I;  2E60 A;  3HUG A;  5TRD A;  3R60 A;  3GFJ A;  3M7G A;  1T08 B;  5B3S H;  2DJI A;  4LIV A;  4ZDO A;  3IHU A;  2UUZ A;  2IGO A;  2E5Z A;  3SJM A;  2XGD A;  3HKZ N;  3NAR A;  1RI7 A;  2JA2 A;  2KRF A;  3TBI A;  2Z9O A;  5HDK A;  4BBS J;  1ZQ3 P;  5FRM A;  4XID A;  3CCJ I;  4UUV A;  3I59 B;  2OF7 A;  2WAQ A;  5F08 A;  3ZN1 A;  2IA2 A;  2LOO A;  2WTE A;  4I0A A;  3PL8 A;  4CHU A;  2FOK A;  2P5L C;  2HOS A;  2ZCW A;  1NH3 A;  2ZXI A;  2B0L A;  2A61 A;  4UVC A;  4CIC A;  4E7I A;  2ZXW H;  2E1M C;  4JX4 A;  4EJU A;  5KHD A;  3BPV A;  1YYV A;  2M30 A;  5E18 F;  1QA6 A;  1ZG3 A;  1O3S A;  3GWZ A;  2GIZ A;  3AFH A;  1W4M A;  3ABT A;  2ESN A;  3T5X A;  1MKM A;  1S7O A;  3HUG B;  3K10 A;  2M5W A;  4I02 A;  2K85 A;  4LJZ F;  2EFP A;  1S7A A;  3F8F A;  4U0Y A;  2PN6 A;  3KP5 A;  2L01 A;  5A2Q K;  1UZC A;  4XRS G;  2JPC A;  5AON A;  2MSY A;  2DTR A;  3K0L A;  2L9S A;  3QU3 A;  4HZF A;  1P7I A;  4CZC A;  2XAH A;  1T56 A;  2M1B A;  2Y0S N;  2EZK A;  1TBX A;  1OLT A;  4H0E A;  2JRT A;  4R1H A;  1LFB A;  2WAE A;  4P96 A;  3JRD A;  3P9K A;  4CSW A;  5BOX A;  3WTX C;  4A3L J;  3R0J A;  3VWB A;  1JJ8 C;  3BJO A;  3DU6 A;  1J09 A;  1GHC A;  3BZK A;  4RAF A;  1RR8 C;  4RAG A;  4OWR B;  2BXZ A;  3KYD B;  3H9G A;  1MH4 A;  1WPK A;  2O9L A;  2LH9 A;  1K7A A;  1J0R A;  3VPR A;  2LMD A;  2KIU A;  2Q8K A;  1RIO H;  4Q4Z F;  2VN2 A;  2K3F A;  3M1C A;  4PJN A;  5D4R A;  1IZ1 A;  1D1B A;  4WWC A;  3OYF A;  3JRA A;  4O5V A;  3H3Z A;  3F8B A;  2ME0 A;  1W7P A;  4BXX J;  1PUE E;  1P92 A;  5GPC A;  2HU9 A;  1ZH5 A;  2HKO A;  1YW7 A;  1E3P A;  4OAY A;  2RNJ A;  1FZP B;  2KIS A;  3IH4 A;  4EM2 A;  4BDZ A;  2AQF A;  3HHG A;  5EDN A;  2EZL A;  2XRL A;  2R7X A;  2ID3 A;  3Q0U A;  2GXB A;  1TNS A;  2V6E A;  4LMY A;  2R7V A;  3ONQ A;  2RGV A;  4G6T B;  4ZH4 F;  1T39 A;  3G1O A;  2R7F A;  5L3F A;  3TW7 A;  4LGW A;  4AM3 A;  1VI0 A;  4KIT B;  2QWW A;  1XX5 A;  3BG6 A;  4YIF A;  2VXZ A;  4A0Y A;  2CV0 A;  5H20 A;  2EBI A;  1D3Y A;  4E6K G;  4R79 A;  1OYW A;  5DCM A;  4RGS A;  3LSR A;  5CVJ A;  4U88 A;  3TKY A;  5BNG A;  3H5N A;  5K1Y A;  1N25 A;  4JK1 X;  3K4J A;  1FIA A;  4X1E A;  4QSH A;  3ASN H;  3LL7 A;  2P81 A;  4BYY A;  2HVQ A;  1TNT A;  1W7P B;  2N8G A;  1ZG5 A;  3GTG J;  1VQN I;  1RES A;  4F91 B;  2IXS A;  3MZH A;  4B4C A;  1G3T A;  2HXO A;  2YX4 A;  5L3G A;  1I39 A;  1S5L C;  4HYE A;  4UB6 C;  4RB2 C;  2QCO A;  2DA7 A;  4BXU A;  1X4O A;  2NS7 A;  2HKX A;  3RKQ A;  2MLK A;  3F3X A;  3RDI A;  2GM4 A;  1A35 A;  1O57 A;  2PMU A;  1U9O A;  2WAF A;  5E20 A;  2FBH A;  5DD8 A;  5GAG J;  1OR7 A;  3L2R A;  4R8H A;  5FLM J;  1VQ8 I;  4QIW N;  1TWG J;  3BR2 A;  2IW5 A;  2HR3 A;  5LD2 C;  1I6H J;  2EA2 A;  3SHF A;  1G3S A;  1E3O C;  4PSW A;  5FGM A;  1VQ5 I;  3Q0V A;  1I27 A;  5DCM B;  1OYY A;  1TWC J;  2CFX A;  2EFO A;  1IAW A;  3IH3 A;  3GLX A;  2DBB A;  2DT7 B;  5H6R A;  3GO5 A;  3CCE I;  1QZZ A;  1P2F A;  3KP6 A;  3RTR A;  3OOP A;  3FK7 A;  4IHT A;  3CCQ I;  1IJW C;  3G1L A;  4A3B J;  4C9Y A;  4IQ4 A;  2A07 F;  4KIF A;  1I50 J;  4AVP A;  4HW0 A;  4AC0 A;  3HC7 A;  5IYD J;  1YIO A;  1E2X A;  2W1O A;  2ISY A;  4G6Q A;  3WTT C;  1PP8 F;  5HDN A;  1MH3 A;  2JUG A;  2WV1 A;  4I76 A;  2HEO A;  3BZC A;  2H27 A;  2DOA A;  2KDZ A;  4QPQ A;  4XON A;  4DZJ A;  1TW3 A;  3C1D A;  2HGC A;  4M3E A;  1B1B A;  1EKE A;  3HB9 A;  1T2K A;  2ZFU A;  4G94 A;  5A2Q Z;  1FOX A;  1G3W A;  3DBL B;  1P9Q C;  5LGT A;  2A68 F;  4RA2 A;  1FSE A;  2OA4 A;  1AHD P;  1GXP A;  2XSD C;  2HQN A;  5FKL A;  2BGC A;  3S15 J;  1WGX A;  3K4M A;  3OSG A;  3I9V 2;  4YII A;  2K27 A;  3SFZ A;  3HTS B;  4Z6Y A;  4LK1 F;  2PI0 A;  3W2W A;  2QQA A;  3X2Q H;  5HS8 A;  2H09 A;  1KU9 A;  3B6A A;  1HCR A;  2P0W A;  1Z77 A;  2IGN A;  2H1K A;  3RIR A;  3H3V K;  2KKO A;  4HV5 A;  1WJD A;  4AIJ A;  2KMU A;  4BAC A;  3NWT A;  4L9N A;  1GV5 A;  4CA0 A;  2GZW A;  1OIS A;  3O6B B;  3D5L A;  3V42 A;  4BL0 B;  2XAS A;  4U7B A;  2EV6 A;  4Y3O A;  3K4C A;  2A6E F;  1GV2 A;  2V79 A;  5LHI A;  4XN3 A;  2WA0 A;  1QVU A;  3MD2 A;  1Y8Q B;  2DA5 A;  2KZG A;  2LD5 A;  2ZNZ A;  3F8C A;  3FXQ A;  4J00 A;  1SVL A;  2VT3 A;  4CXF A;  1JKO C;  4LIT A;  2R7R A;  3M3Y J;  2L4A A;  3DWL E;  2JJ7 A;  3I53 A;  3DTE A;  3S2H J;  5ILS A;  3OYD A;  4XNF A;  2QZ8 A;  2DOD A;  3OMY A;  2E1C A;  5EZG A;  2O5R A;  2I8D A;  3ABM H;  3HIF A;  2YU9 J;  4PFO A;  2K9N A;  4XK4 A;  5L3D A;  4HF2 A;  3BP8 A;  5IY5 H;  4XLE A;  1W1W E;  2QSG X;  3E5X A;  2DK5 A;  4ETS A;  5F0H A;  1TWH J;  3CTA A;  1YTY A;  4S0H B;  1YQA A;  5HLT A;  1RZ4 A;  1ZK8 A;  1OMI A;  5E17 F;  2L9R A;  2KQR A;  1TQM A;  2Y69 H;  2NS8 A;  4M6X A;  2M9H A;  4Y33 A;  1OQY A;  1B8I A;  2EQR A;  3ZGK A;  4F52 A;  2P6T A;  4GCV A;  5E3M A;  1IW7 F;  4NC8 A;  3K4K A;  2K5C A;  2DMQ A;  4I99 C;  3K2Z A;  5J1R A;  4Y15 A;  3AG4 H;  1UG2 A;  3VOE A;  2OTL I;  5K5R A;  1FT9 A;  3PSF A;  3VYU B;  2UXN A;  5ILU A;  2MFZ A;  3ABL H;  3MFK A;  1LPQ A;  2QEX I;  4YRV A;  3CCS I;  3FWE A;  1TP4 A;  5B1A H;  3K4B A;  2EIK H;  1WSU A;  3LSI A;  3FXM A;  2KRH A;  2PEX A;  1R00 A;  2VI6 A;  1RUO A;  1K6O A;  3PJR A;  2IVM A;  3HRT A;  1FJL A;  4AD9 A;  4HLY A;  5JR3 A;  1WFX A;  2R7W A;  1VQM I;  3HXL A;  5LLQ A;  2L7F P;  2FBI A;  5ICC A;  1ENH A;  2H1L A;  2TDX A;  1N75 A;  5EG0 A;  1XMX A;  4E4H A;  4A3J J;  3ZQC A;  3S16 J;  2LY9 A;  1O3Q A;  3FXJ A;  4DYR A;  4I09 A;  4G8X A;  2QA4 I;  5DD4 A;  2F4O B;  1B8I B;  3AL0 B;  3VSK A;  4P5O A;  4BBR J;  4ANJ A;  2K4B A;  5HS9 A;  1JI8 A;  2HTS A;  2LKS A;  4HX7 A;  1BIA A;  2RV8 A;  3REO A;  2ADU A;  2CQX A;  4F92 B;  2BHZ A;  2K3P A;  4XLP F;  2DK8 A;  3CCR I;  3M07 A;  3OS2 A;  1WI3 A;  1J5Y A;  3QPS A;  4DOZ A;  1UST A;  2LKX A;  2IGM A;  3BCB A;  3A02 A;  5CVI A;  3MAJ A;  1Z9C A;  4P9U A;  1XSV A;  3K1M A;  3ZQQ A;  1IN5 A;  3OYN A;  3MKY B;  4C3J J;  1ERD A;  1JJ6 C;  3IP4 B;  3OYK A;  1X2M A;  1R58 A;  4II2 A;  3JRE A;  4MTE A;  4IHX A;  3LSM A;  1ETW A;  1IXS B;  2F5D A;  4P9F A;  1HLV A;  4DNC A;  2RVC A;  3WOD F;  2F5C A;  3WTY C;  3C7J A;  4HNU A;  5F0C A;  1MMA A;  3CF5 F;  3IL2 A;  2F5E A;  5E1X A;  1RR7 A;  1FYM A;  2CGP A;  3BTI A;  1X3Z B;  2LF8 A;  2YR2 A;  3ECO A;  2E2H J;  4FHT A;  1K4S A;  4U7D A;  1XSX A;  4BE1 A;  1VQ9 I;  2VJ4 A;  1TT5 B;  3CUO A;  4M6V A;  4D5F A;  5GAH J;  3IV5 A;  4E7K A;  1W36 C;  2STT A;  3L2C A;  2YX7 A;  1GUU A;  4B3X A;  5K7Z A;  2MC3 A;  2MH2 A;  1D0Y A;  2LY2 A;  4HEA 2;  4PGH A;  5DUK A;  1ZGJ A;  3WGG A;  4BQQ A;  1WZ2 A;  3PNT A;  2EK5 A;  3LSH A;  1IRG A;  3HOZ J;  1WJB A;  1ETV A;  1UMQ A;  1TWF J;  2M0M A;  2HDC A;  3JRF A;  2HOA A;  4B43 A;  3BR1 A;  4BJ5 C;  4AYB N;  2LG4 A;  1BR1 A;  4CCN A;  4CUG A;  1MW7 A;  2M34 A;  3FK6 A;  2BE5 F;  3VEP A;  1O7F A;  1LFU P;  3HKZ A;  3ZN0 A;  1U2W A;  2D5V A;  5GPA A;  1PP7 U;  2CV1 A;  1DPU A;  2X6Y A;  3EUH C;  3ZXS A;  5E3N A;  1YHQ I;  3CUQ C;  1R1V A;  4CO8 A;  4A3I J;  5JVG F;  2DA2 A;  2XPW A;  4MTD A;  1U5T A;  3OR2 C;  5HLG A;  2Z99 A;  2K9M A;  2IEK A;  4A3E J;  4CCL A;  2W7N A;  1G6N A;  1LQ1 A;  3ABK H;  2E35 A;  4YIR X;  3F6O A;  3P9C A;  1WJC A;  1KQ8 A;  2OCC H;  3TED A;  2BY3 A;  4KJZ A;  5BQT A;  3HDD A;  2K4J A;  3V8K A;  2VLA A;  5IT3 A;  4Y17 A;  2V26 A;  1LNW A;  3GZ5 A;  3RI4 A;  1ZYR F;  1VQ7 I;  2PG4 A;  4YEJ A;  3JSO A;  1MMD A;  4M72 A;  2BZT A;  2R4G A;  1FYK A;  3BCA A;  2EIJ H;  2M2E A;  4HPQ A;  3DPT A;  2OUM A;  5HNH A;  3H5A A;  1WH5 A;  2Q0O A;  2X48 A;  5H6Q A;  4W1U A;  1EH7 A;  4XM3 A;  4AUX A;  2D45 A;  2L9V A;  4CYC A;  1LJ9 A;  1QBJ A;  5CVR A;  2PBI A;  5FRO A;  3QWL A;  1BI1 A;  2AXL A;  3IAM 2;  1MBF A;  4FX0 A;  2Y0S A;  4EAT A;  3SZT A;  3LSP A;  2I10 A;  3OIP A;  1F36 A;  4XSX F;  4ZYG A;  3OIO A;  1O7L A;  3LSJ A;  2CJJ A;  1QVT A;  2P6S A;  1UJ8 A;  3DFG A;  5C4J J;  2KIF A;  4EJO A;  1IF1 A;  5F6F A;  2A05 A;  1QO0 D;  5LFA A;  4XOP A;  4RB0 A;  3FXK A;  4LD5 A;  3B02 A;  3EYY A;  2NS0 A;  2LRD A;  3J7A O;  1OJL A;  5JHF A;  2VKD A;  1FOK A;  1DDN A;  3BRO A;  3FBN B;  1KU3 A;  1YS7 A;  5FKN A;  3L2Q A;  1MSE C;  2XPU A;  2M4G A;  3PO3 J;  3QPL A;  1H89 C;  4CYC B;  2GXG A;  3HGG A;  3P9I A;  2GIV A;  3VYS B;  2HYJ A;  1V55 H;  1WJA A;  4ZDL A;  3ULQ B;  2O0Y A;  3TOA A;  4EEF G;  4HA8 A;  5C4X J;  3PSI A;  3ZQG A;  3I58 A;  2CV2 A;  5D5V B;  2CS3 A;  2B63 J;  1OFC X;  3AL0 C;  2IGK A;  2P4W A;  2X0L A;  1BBY A;  3GBG A;  2MAB A;  5HLI A;  2D2W A;  2KPM A;  2WBM A;  5B66 C;  1RUN A;  4AIH A;  3ZRG A;  3EUA A;  2H8R A;  1MBG A;  3DV8 A;  4O6J A;  1ZRE A;  3G73 A;  3HOV J;  4UV9 A;  4YFX F;  2NVY J;  1YJN I;  1T95 A;  2LDU A;  1REP C;  4F55 A;  1IO2 A;  1IV8 A;  4LG0 B;  1XGM A;  4IXA A;  3SDB A;  2F4I A;  5EYR A;  2F48 A;  4YFN F;  4J01 A;  3OYI A;  1V5E A;  1IDY A;  2DTZ A;  1D8K A;  2XKO A;  3E6D A;  2VAS A;  2XV4 S;  1BJZ A;  4PDK A;  2E34 A;  1CF7 A;  2NVT J;  1H9G A;  3TL4 X;  3GTK J;  1KYW A;  4BE2 A;  3R0A A;  2JSP A;  6PAX A;  1QHG A;  1Z1D A;  2X6W A;  1L0O C;  2IBD A;  3L00 A;  1AWC A;  2IA0 A;  2NRA C;  1V3F A;  1X58 A;  4LB5 A;  2L54 A;  3FIS A;  3KZI C;  2CUF A;  2NOG A;  5CVV A;  4DZP A;  2XAJ A;  2CQK A;  2R92 J;  2CSO A;  4HST A;  1I6X A;  1TTY A;  4XLN F;  3T0Y A;  1ZHF A;  3E97 A;  3WG7 H;  3R4K A;  2VC0 A;  3QAH A;  4X0G A;  4Y52 J;  5J8F A;  1DPR A;  3UKG A;  2QBY B;  4N4O B;  1IUF A;  1HOM A;  3BG5 A;  2W84 A;  5EZH A;  2F5V A;  3C2B A;  1R5G A;  2DLL A;  3EPZ A;  3M4O J;  3S1Q J;  2VE9 A;  2VOO A;  4AID A;  5DM6 F;  1R7J A;  2V9V A;  1UHM A;  2P7C B;  2QSH X;  2JVG A;  1GVJ A;  2X9D A;  2BW3 B;  1ZTR A;  4MNU A;  1BC7 C;  2JRM A;  5CPR B;  1CF7 B;  1EA3 A;  1QHH D;  1XPX A;  3ECH A;  4QTR A;  2BHY A;  4HDV A;  3V7R A;  3BR5 A;  2XRO A;  1W5S A;  1U3E M;  1D5Y A;  1FP1 D;  3I5U A;  1U8R A;  1ZG1 A;  1X1P A;  1QPM A;  2X1D A;  4S05 A;  4XKC A;  3V8L A;  4HAM A;  1H8A C;  4EMS A;  1ZR2 A;  2LRE A;  2FX0 A;  3A0H C;  3CQZ J;  4G9Y A;  5E1Z B;  1FMV A;  4ZYA A;  4M9S A;  2GWR A;  2MYS A;  4Y13 A;  4QLC U;  3FHZ A;  3LOC A;  1S7E A;  5BMZ A;  2QUF A;  4ZDP A;  1MJA A;  4LIU A;  5D6E A;  2HPM A;  3SEQ A;  2FU4 A;  1MD0 A;  2DO7 A;  4CCM A;  3GFM A;  2G7H A;  4MIM A;  2FXA A;  2VPL A;  1VQ6 I;  3M9A A;  3F8M A;  4ABZ A;  1LE8 A;  3H35 A;  3LA2 A;  4DYQ A;  2GXA A;  4BY7 J;  1R71 A;  1HSJ A;  2H6B A;  3H1C A;  5EEG A;  3GFI A;  4KYW A;  2JQ7 A;  2DPD A;  2KZV A;  2IS6 A;  5ED4 A;  1Q1V A;  3CCM I;  1JGS A;  5EJC A;  3I71 A;  2YUS A;  2HQR A;  4NUB A;  2DMP A;  1KQ0 A;  5DM7 F;  4D7M A;  4IQJ A;  2XAF A;  3HOW J;  3WU0 A;  1HQC A;  3I4N J;  2KIQ A;  2BVM A;  3LMM A;  2JT1 A;  3DPU A;  3FKJ A;  1O3T A;  4ASN A;  2R7U A;  2VBW A;  4B3A A;  2Z1D A;  4IOC F;  3KYL A;  3S93 A;  1C0W A;  5LBQ A;  3W6V A;  1XN7 A;  5D5X B;  4YG2 F;  1OYI A;  5DS9 A;  2V1D A;  3KEQ A;  3HOT A;  2HDW A;  4DGW B;  4DBQ A;  1OCC H;  1X1B A;  4TV7 A;  4L5J A;  3FXL A;  2M87 A;  2UXX A;  1ON1 A;  1JXS A;  3S17 J;  2C6Y A;  3S2D J;  1LE8 B;  2YS9 A;  2ZNY A;  2DQR A;  2IPQ X;  2R7Q A;  2EH3 A;  1DGW Y;  4BQO A;  3J80 K;  1JKP C;  3ASO H;  4S04 A;  3WTS C;  4IL6 C;  3COA C;  1STZ A;  2LYC A;  2OTJ I;  3R61 A;  3W6K B;  1NTC A;  1SEU A;  3ZMV A;  1LB2 A;  1APL C;  1R9T J;  1MMN A;  4L9J A;  1WJF A;  2XF7 A;  2L7K A;  2CUE A;  4F7Z A;  1S6L A;  2OAZ A;  4WX9 A;  4HQE A;  4OIR F;  4KIS A;  2EIM H;  2Y9Y A;  3LAP A;  3HOU J;  3I3L A;  2HOT A;  2HVS A;  4KMU X;  3SFI A;  3HOX J;  3SYT A;  3EDP A;  2CU7 A;  1K6Y A;  1MBH A;  2HZD A;  3NWS A;  3PUB A;  5KNL A;  2ZXJ A;  5EGO A;  2X1E A;  1XMA A;  1J9I A;  3K69 A;  4L5E A;  1WKM A;  4MGR A;  1P4A A;  1F4K A;  3Q0W A;  4O3M A;  1FX7 A;  2VQL A;  2KJC A;  3IUO A;  3OYE A;  2LY1 A;  3N05 A;  1JTY A;  1Z3X A;  1Y0U A;  1GVD A;  1XG1 A;  2R3S A;  5LRR A;  5F1J A;  1B6A A;  3E0J B;  4LG3 A;  2RKH A;  5M5X J;  2HOE A;  3BDD A;  3OYB A;  3CJN A;  1KU7 A;  4AWX B;  4EGY A;  4PZJ A;  2CWE A;  1K78 A;  1XCB A;  3JTG A;  3IH2 A;  3KCC A;  3ZQI A;  3R6S A;  4OMY A;  3EYI A;  3WGH A;  3HYI A;  4MEX F;  3V8J A;  1FC3 A;  4A5N A;  1OCO H;  5EGO B;  2OQR A;  1K61 A;  5E1W A;  1PDN C;  3KLN A;  1VZ0 A;  3BG7 A;  3O2P E;  2HS5 A;  5AIP A;  1W0T A;  1EF4 A;  2EV5 A;  3CMA I;  3RQ4 A;  2Y2Z A;  3CMY A;  1R5I D;  3FKI J;  2R7T A;  4DJA A;  2W85 A;  1A31 A;  3VB2 A;  1MJ9 A;  2K86 A;  1IGN A;  9ANT A;  1A6I A;  3C3W A;  3GFL A;  3PQJ A;  2J5P A;  2O03 A;  4RM2 A;  1XSD A;  4G7O F;  4RBO A;  2FSW A;  3DEW A;  2L0K A;  1IRX A;  4FX4 A;  1R4N B;  3L2W A;  2OJE D;  2QSF X;  1YJW I;  3DQV C;  3S3M A;  3BC8 A;  5F64 A;  4XIC A;  1A36 A;  3HTU A;  2PX9 A;  2JA6 J;  3CJQ B;  2EFN A;  3CP2 A;  1K78 B;  3BWG A;  3QPT A;  2VL8 A;  5EEA A;  1B9N A;  2F6C A;  1YW8 A;  2KIM A;  2QGU A;  5K5O A;  2TCT A;  5CVU A;  2ZFW A;  2IRF G;  3RJP A;  2ZB9 A;  3KPH A;  3QYE A;  5D4S A;  2G9W A;  3KZZ A;  3AG1 H;  3JTH A;  4HX4 A;  4PCQ A;  2VOD A;  3PFY A;  5D8K B;  4OMZ A;  3F9K A;  1FIP A;  4C30 A;  1JGG A;  2CW0 F;  4XQF A;  2FUG 2;  1EJ9 A;  2F4M B;  2DA4 A;  2HYF A;  4M71 A;  1JT6 A;  3LQR A;  5K5Q A;  4OIN F;  1MNE A;  4BY1 J;  3V7S A;  3SEZ A;  5FKO A;  1HDP A;  1YG2 A;  3OYH A;  3NEU A;  2L3D A;  5M5W J;  1XTA A;  1JT0 A;  3M8F A;  4P55 A;  4E7Z A;  4BAY A;  4BDY A;  1R23 A;  1WJ5 A;  3TGN A;  2CQ7 A;  2VOP A;  1T38 A;  4ESJ A;  2PMH A;  4AYB A;  2DXI A;  4A5M A;  3PIP F;  3DKY A;  1L3L A;  4B8X A;  3KP4 A;  3F8N A;  2O6G E;  3BR3 A;  1XMK A;  3FX3 A;  2OC6 A;  4RGR A;  1FY7 A;  3OY9 A;  4FTH A;  3TOB A;  1WVR A;  1W5T A;  2EPF A;  2PQ8 A;  2A5W A;  1DUX C;  3LAJ A;  1LDD A;  1ZRF A;  5ICF A;  1AOY A;  1FBQ A;  3SZG A;  1O4X A;  3GVA A;  4M73 A;  2NVX J;  4OIP F;  3E5Q A;  1Z91 A;  4G6D A;  3HBL A;  1B9M A;  3J80 Z;  1E17 A;  3QP5 A;  1Y6I A;  2V9K A;  3HPH A;  5JFR A;  4NBQ A;  5C44 J;  3G3Z A;  3ZCO A;  1Z6T A;  1HF0 A;  3ELK A;  5L3E A;  3KP2 A;  1HXD A;  3ZPL A;  3MQ0 A;  5JLX A;  1VF9 A;  3LSG A;  4D7N A;  4IVN A;  4BH9 A;  2FF4 A;  4ZC3 A;  3GYH X;  4BNC A;  2DFI A;  3CCV I;  3ZMZ A;  4A93 J;  4CZZ A;  1P6R A;  3QYF A;  4II3 A;  1G3Y A;  2NAZ A;  2DPU A;  2LP0 A;  5E3O A;  1PJR A;  4EM0 B;  2E2I J;  1ETQ A;  3BTL A;  3E6C C;  4NHJ A;  4M9X A;  1S9H A;  2W82 A;  2B9S A;  2EWN A;  3JAM K;  4IHS A;  4KT5 C;  4L9V A;  4KIG A;  5ERI A;  2JA5 J;  3EET A;  1F1Z A;  3MMY B;  3WTV C;  3GTQ J;  4IO9 F;  4AVZ A;  4ZYE A;  2W4S A;  3CC2 I;  1U78 A;  1BJA A;  2ZC2 A;  1G2H A;  2XRN A;  2EIN H;  1X2N A;  3ABU A;  4Q48 A;  2ISZ A;  3KIO A;  1NK3 P;  2L5Q A;  1I3Q J;  4ZZD A;  1ETX A;  3JCU C;  1Z0X A;  2RQP A;  3ZQL A;  1T6S A;  4XOT A;  1ETO A;  1YJ9 I;  2VPR A;  5DTD A;  2BBY A;  4HX8 A;  3W3C A;  1G59 A;  1XD7 A;  1YS6 A;  3BPX A;  2CUZ A;  2FBK A;  2WAD A;  4PK4 A;  4I01 A;  5TGT A;  1JHF A;  2Y75 A;  4KMF A;  4L9T A;  4B48 A;  5M3F J;  3DKX A;  3L09 A;  4RB1 A;  3OYJ A;  3TDZ C;  1GXQ A;  1GDT A;  4ESF A;  1XB4 A;  1T8I A;  1E0E A;  3KP7 A;  2ZBK A;  2L4M A;  3WU2 C;  3GW2 A;  3KZY A;  1LEB A;  1PUF A;  3A0B C;  5DV5 A;  1SC7 A;  5IPA A;  3MVP A;  4I0B A;  3FMS A;  4IHV A;  2L7M P;  4LK0 F;  4I2O A;  2AO9 A;  5CQE A;  2L9N A;  2TRT A;  4WCG A;  5J8C A;  3J81 K;  1SAN A;  5C3E J;  2VB6 A;  4IJA A;  4A0X A;  4PFP A;  5BPI A;  1WCM J;  5CJ9 A;  5HNF A;  1DP3 A;  1V4R A;  4FE7 A;  4RS8 A;  4ZJZ A;  4XSZ F;  3AKZ A;  3LFK A;  3FZV A;  1X3U A;  2XKP A;  2I5U A;  4A6E A;  3VFZ A;  3E6B A;  5EG0 B;  2MD5 A;  2X6O A;  3C2G A;  2RNG A;  5D5W B;  2Z16 A;  4NNJ A;  2LR8 A;  4L5I A;  3BG3 A;  3PNY A;  3QRF F;  1OR7 C;  5DYM A;  3GTJ J;  3MCZ A;  2XGC A;  4PJL A;  1TT0 A;  1A5J A;  2CQQ A;  1TLH B;  2A3S A;  2GQQ A;  2ELH A;  1A04 A;  2XUB A;  3S3N A;  3ROU A;  1LFP A;  1TC3 C;  3LA3 A;  3U1K A;  2O3F A;  3QQA A;  3OL4 A;  2NXN B;  3PFI A;  2Z5U A;  2CYY A;  4G7H F;  1FBS A;  2EZI A;  3I54 A;  3AG2 H;  3DU5 A;  4V2F A;  5B1B H;  3Q9V A;  1WI9 A;  1JHH A;  2BVL A;  4BHP A;  4XLA A;  2DJN A;  5D6F A;  3DPL C;  1TZL A;  1TWA J;  3I0T A;  4KIB A;  4BHB A;  4Y7N J;  2IJL A;  5BS6 A;  2UWM A;  3FXR A;  4MQ9 F;  4L18 B;  4ENN A;  2ZJQ F;  4HOB A;  2W24 A;  3G1M A;  2GOM A;  3DBH B;  2DOE A;  3ZQH A;  3RCO A;  2E1O A;  2XAQ A;  2ELK A;  1ZAR A;  4OIQ F;  1UFM A;  4RLF A;  1QGP A;  4UV8 A;  1OPC A;  2VJ5 A;  4DYC A;  3DF8 A;  1NK2 P;  1U8B A;  1POG A;  4KUM A;  3OYL A;  5D5U B;  1QRY A;  2BOL A;  1PVE A;  4WXC A;  3H0G J;  3QOD A;  3UR3 C;  1SFE A;  2VKE A;  1E3H A;  3BJ6 A;  5J4V A;  2DDB A;  1ZLJ A;  4N4N B;  2BEO A;  3RKW A;  5J3L A;  2LC2 A;  1K4T A;  2KL4 A;  4A3D J;  1ON2 A;  2UZK A;  2EIL H;  2DFH A;  5F0F A;  5JHU A;  2E1M B;  4XLF A;  2HI3 A;  4ITV A;  4ZZL A;  3S1R J;  3I4M J;  3GZN B;  3CDL A;  4B47 A;  3AG3 H;  3GLL A;  1LEA A;  1ONV A;  1I1G A;  3CC7 I;  1Z7L A;  5L3C A;  1RRJ A;  2LSO A;  2IS4 A;  5JLW A;  1AKH A;  1BI0 A;  2W48 A;  4LOC A;  4FAS D;  1LDK B;  1HC8 A;  2QM3 A;  2R7D A;  2IA1 A;  3LA7 A;  1ULY A;  5FKM A;  2Z2S B;  4IRH A;  4XOR A;  1Z67 A;  4FQG A;  3JAM Z;  3F6V A;  1G4D A;  2DCE A;  3Q9S A;  2NNY A;  3G6E I;  3M8J A;  2YPR A;  1KA8 A;  4PSX A;  1R1T A;  1FLI A;  3S1N J;  3NRV A;  1DP7 P;  1U5T B;  1QQI A;  5FJ8 J;  4HF0 A;  2ZJ2 A;  4UNO A;  5HOO A;  2FRH A;  2ECB A;  1BOB A;  4KT6 A;  1H9T A;  1DGR M;  5DCF A;  2LLK A;  2KLO A;  1KZH A;  2FD5 A;  3DTK A;  5J40 A;  3DKW A;  4M3B A;  4A3M J;  3TMO A;  3BY6 A;  3J7Z I;  3BQZ A;  3GME A;  3RKX A;  2PJP A;  2JPB A;  2VKH A;  1QPI A;  4OU0 A;  1M1E B;  1R22 A;  2MLG A;  3G4S I;  4XRS A;  1AKH B;  1T98 A;  2DFE A;  2VBZ A;  4ZYH A;  3JR9 A;  2XB5 A;  1IRF A;  5LGN A;  4RGX A;  1Y8R B;  3A03 A;  4UB8 C;  3BTC A;  3UNG C;  4HRI A;  4U87 A;  2E36 A;  3HJE A;  3HSE A;  1FOY A;  3HRU A;  1B59 A;  4XL9 A;  4C3H J;  4M3F A;  2DMU A;  3DLA A;  3HEF A;  1YRN A;  2CUJ A;  1YX3 A;  3J81 Z;  3OYC A;  3QU6 A;  3FDY A;  3ZMD A;  2OD5 A;  2PMZ N;  2RC4 A;  3HRS A;  4JOM A;  2E7W A;  2QQ9 A;  1HKQ A;  2XB0 X;  2ZO4 A;  4GYI A;  3QOP A;  5J6X A;  4RB3 C;  4LLN A;  3C18 A;  3ZP5 A;  1TW2 A;  2R7O A;  4KIC A;  3ISP A;  5J1U A;  4IOA F;  1KGS A;  2FEZ A;  2FMY A;  1HA8 A;  3LSK A;  3LFU A;  4UVB A;  3ZR8 X;  2DU9 A;  2ID6 A;  3VYT B;  1IN7 A;  1HW5 A;  1KON A;  2OPT A;  4RGU A;  5M3M J;  2CFO A;  2VBY A;  4FET A;  1BR4 A;  1J7K A;  1RC9 A;  2ACJ A;  1W5C C;  3DXJ F;  5CKT A;  3D1N I;  1QZY A;  2DFF A;  1UHW A;  2EA4 A;  3C2H A;  4WXD A;  3WU1 B;  2MA3 A;  4ENJ A;  3FXU A;  3GEZ A;  3W2A A;  1DU0 A;  2KRC A;  2RAE A;  4A12 A;  1DQU A;  5ICE A;  3K1N A;  4M74 A;  2NOJ B;  3ZQF A;  3GTP J;  2D1V A;  1MZB A;  5FFX A;  4AU7 A;  1P7J A;  2M7B A;  4ZTF A;  4J19 A;  1WRJ A;  1YE9 A;  4DW6 A;  1DU6 A;  2JSC A;  3E1S A;  4B09 A;  2XC7 A;  2VT2 A;  1Q1H A;  3B73 A;  2EJR A;  4JQF A;  5JVT A;  3MKL A;  2V1U A;  1X3W B;  1HDD C;  3RKY A;  3MZY A;  4U0W A;  1NG7 A;  5AIQ A;  2JUC A;  2VQC A;  4GXO A;  4CDG A;  3TDU C;  3FMQ A;  2QLZ A;  2QYO A;  3K4N A;  4HF1 A;  1VQP I;  4UUT A;  3P5J A;  4RMN A;  5KAF C;  3F72 A;  2EFW A;  1IG7 A;  5LRS A;  2XF5 A;  4HNT A;  2IS2 A;  3OIQ A;  3OWT A;  4E7H A;  3CLQ A;  3B6C A;  2HWV A;  1U6G A;  1P4X A;  3D0S A;  3W6J B;  2AS5 F;  1ZLK A;  1N77 A;  5LEJ A;  4I7H A;  4FCY A;  2RN7 A;  4UVA A;  4IF4 A;  2LF7 A;  1UB9 A;  3G71 I;  3KFW X;  2FOW A;  1X4P A;  1S72 I;  1IXR C;  3KET A;  3EUK L;  3MN2 A; 
#chains in the Genus database with same CATH homology
 5FKK A;  1ENH A;  1EF4 A;  1W0T A;  5IP6 A;  1GT0 C;  5EG0 A;  4A3J J;  3S16 J;  2ECC A;  3ZQC A;  1JKQ C;  2Y2Z A;  2LY9 A;  3CMY A;  1FTZ A;  3FKI J;  4DYR A;  2DMN A;  2HDD A;  1BA5 A;  3JRB A;  1B8I B;  4NDL A;  2R7Z J;  4G12 A;  1IGN A;  1A6I A;  5IYC J;  9ANT A;  2E19 A;  4BBR J;  2JMW A;  2JN6 A;  4RBO A;  5IP7 J;  2XPV A;  1BL0 A;  3DEW A;  2CQX A;  2L0K A;  3TW6 A;  2VUM J;  1WI3 A;  1WH7 A;  1XC5 A;  3JRI A;  3HOY J;  3A01 A;  3QPS A;  3WHB A;  4A69 C;  4XIC A;  2JA6 J;  2LKX A;  4IHW A;  1FEX A;  3A02 A;  3O8G A;  3BR0 A;  5EEA A;  2R5Z A;  2K9S A;  3NAU A;  2Y31 A;  2TCT A;  4C3J J;  4C3I J;  1JJ6 C;  1Y1V J;  1X2M A;  2ZB9 A;  3HM5 A;  2JK3 A;  1IV6 A;  5EF6 A;  4IHX A;  3JRE A;  2L7Z A;  1JUM A;  1ETW A;  1FIP A;  1JGG A;  4A3G J;  1HLV A;  2HXI A;  2DA4 A;  5F0C A;  1JUP A;  4W97 A;  5M5Y J;  4GFB A;  1JT6 A;  4MO7 A;  1RR7 A;  4IHY A;  4BY1 J;  3BTI A;  2VKV A;  2DA6 A;  4FE4 A;  5FKO A;  1HDP A;  2E2H J;  2QF7 A;  2G0E A;  2IAI A;  5M5W J;  1MBK A;  4B1R A;  1JT0 A;  3PO2 J;  4D5F A;  4M6V A;  5K7F A;  3IV5 A;  3A01 B;  2K9Q A;  1YRN B;  1GUU A;  5K7Z A;  2K40 A;  3BR3 A;  2MG4 A;  2R5Z B;  1MBJ A;  3K2A A;  3RZD J;  4FTH A;  3K7A J;  3JRH A;  3HOZ J;  3TP3 A;  1O4X A;  1ETV A;  2DN0 A;  1UMQ A;  1TWF J;  2NVX J;  2JA8 J;  1IDZ A;  3JRF A;  2JA7 J;  1ETK A;  2HOA A;  3HBL A;  5F27 A;  3BR1 A;  3TP0 A;  4AYB N;  3GTM J;  1H88 C;  3GTO J;  3FK6 A;  2M34 A;  5C44 J;  1LFU P;  1HF0 A;  3S1M J;  1RKT A;  1JTX A;  4IEJ A;  2D5V A;  5GPA A;  5JLX A;  1VF9 A;  3LSG A;  4D7N A;  5E3N A;  1JUS A;  2R0Q C;  1ITY A;  3F0C A;  4A3I J;  1U9N A;  2DA2 A;  2XPW A;  4A93 J;  1FTT A;  2LP0 A;  1UHS A;  2IEK A;  2XGD A;  3HKZ N;  2WB1 N;  5E3O A;  3BQY A;  3L1P A;  3SJM A;  1RPW A;  4A3E J;  2E2I J;  3NAR A;  1ETQ A;  3BTL A;  1MSF C;  4BBS J;  3TED A;  1ZQ3 P;  4XID A;  2OF7 A;  3HDD A;  5F08 A;  2JA5 J;  3S14 J;  3GTQ J;  2EZH A;  2HOS A;  2COB A;  1VFC A;  1U78 A;  2FJ1 A;  1G2H A;  2M2E A;  1XS9 A;  1X2N A;  1WH5 A;  2X48 A;  4AUX A;  4W1U A;  5FLV A;  3JRC A;  4X6A J;  4CYC A;  2WAQ N;  1NK3 P;  4JX4 A;  1I3Q J;  1BW6 A;  1ETX A;  1Z0X A;  5K7H A;  3ZQL A;  1ETO A;  1MBF A;  2GBY A;  2VPR A;  5DTD A;  1ZKG A;  1F43 A;  3LSP A;  4A3F J;  2I10 A;  2E2J J;  1F36 A;  3DCF A;  3E7L A;  3OIO A;  5M3F J;  3LSJ A;  4XRS G;  2CJJ A;  2ME6 A;  1QVT A;  5HOD A;  4MFD A;  2MSY A;  5C4J J;  1GDT A;  1P7I A;  1T56 A;  2Y0S N;  2EZK A;  1PUF A;  1JKR C;  5IPA A;  3MVP A;  1LFB A;  4IHV A;  2L7M P;  3JRD A;  2AO9 A;  2TRT A;  3RQI A;  2LK2 A;  1OJL A;  1SAN A;  2MGQ A;  5C3E J;  4A3L J;  1JJ8 C;  1WCM J;  5FKN A;  4FE7 A;  3BTJ A;  1MSE C;  2XPU A;  4I6Z A;  3PO3 J;  3QPL A;  1H89 C;  4CYC B;  3HGG A;  1ETY A;  2Y9Z A;  5EG0 B;  2HYJ A;  2X6O A;  4EEF G;  3O8H A;  5C4X J;  1ZGW A;  1MH4 A;  1WPK A;  3ZQG A;  2O9L A;  2LR8 A;  3BG3 A;  3VPR A;  3GTJ J;  3BT9 A;  1SFO J;  2XGC A;  5IOZ A;  2B63 J;  4JX6 A;  1OFC X;  3GBG A;  3JRA A;  1A5J A;  2CQQ A;  4MFE A;  4BXX J;  2ME0 A;  4RDU A;  3LNQ A;  4BKX A;  1TC3 C;  5GPC A;  2H8R A;  1MBG A;  3QQA A;  3Q3S A;  3HOV J;  2NVY J;  2M0C A;  3IH4 A;  2EZI A;  2EZL A;  5EDN A;  2XRL A;  4V2F A;  2ID3 A;  3Q0U A;  5EYR A;  1OCT C;  2DJN A;  1TWA J;  4Y7N J;  3G1O A;  1IDY A;  2DTZ A;  3G1M A;  3TW7 A;  1VI0 A;  3ZQH A;  2E1O A;  2MW8 A;  1BJZ A;  2ELK A;  4HNV A;  2EBI A;  5J1Y A;  3RZO J;  2NVT J;  3GTK J;  3LSR A;  4DYC A;  4JYK A;  1NK2 P;  3ZOB A;  1U8B A;  5BNG A;  1OCP A;  1POG A;  1QRY A;  2IBD A;  1FIA A;  4X1E A;  4QSH A;  3H0G J;  1X58 A;  2P81 A;  3BG9 A;  2N8G A;  3GTG J;  2VKE A;  3FIS A;  3JRG A;  1RES A;  2CUF A;  2NOG A;  2NVQ J;  4D5C A;  4DZP A;  4B4C A;  1Y1W J;  2R92 J;  2HXO A;  5J3L A;  4A3D J;  2QCO A;  5F0F A;  2DA7 A;  3RKQ A;  2NS7 A;  4Y52 J;  2HI3 A;  3UKG A;  3S1R J;  1IUF A;  1HOM A;  3I4M J;  2GM4 A;  3BG5 A;  5EZH A;  3CDL A;  3C2B A;  1U9O A;  3M4O J;  3S1Q J;  1RKW A;  4V2G A;  4QIW N;  5FLM J;  1TWG J;  3BR2 A;  3HGY A;  1I6H J;  2GLO A;  1B72 A;  2X9D A;  5JLW A;  1IC8 A;  1E3O C;  1AKH A;  2R93 J;  1ZTR A;  2W48 A;  4LOC A;  3WHC A;  3Q0V A;  5IYB J;  4QTR A;  5FKM A;  3BR5 A;  1TWC J;  5IOY A;  1ZR4 A;  3IH3 A;  1D5Y A;  4C2M J;  1MBE A;  3S1N J;  5F04 A;  3FK7 A;  1RET A;  5FJ8 J;  1IJW C;  3G1L A;  1H8A C;  4A3B J;  2ECB A;  1ZR2 A;  2CRG A;  2FX0 A;  1I50 J;  3CQZ J;  2LLK A;  4AC0 A;  5IYD J;  1VND A;  2FD5 A;  3LOC A;  1S7E A;  3OSF A;  4M3B A;  4A3M J;  3BQZ A;  1MH3 A;  2WV1 A;  4I76 A;  4JP0 A;  4UUS A;  2KDZ A;  2R5Y A;  1IRZ A;  1QPI A;  4DZJ A;  4MIM A;  4M3E A;  1B72 B;  3HB9 A;  4XRS A;  1AKH B;  3JR9 A;  2XB5 A;  4ABZ A;  1LE8 A;  4DYQ A;  3A03 A;  4BY7 J;  3BTC A;  2DA1 A;  2O7O A;  1AHD P;  2AHQ A;  2LFB A;  4C3H J;  4M3F A;  2XSD C;  2XGE A;  2DMU A;  3HEF A;  5FKL A;  1YRN A;  3S15 J;  4FIS A;  1WGX A;  1Q1V A;  3OSG A;  2YUS A;  2DMP A;  4A3C J;  4D7M A;  2PMZ N;  3HOW J;  1CQT A;  2DA3 A;  3I4N J;  2XB0 X;  3B6A A;  1HCR A;  1Z77 A;  2H1K A;  3H3V K;  4B3A A;  5J1U A;  1GV5 A;  1PUF B;  3W6V A;  4UUS B;  4MLO A;  5DS9 A;  2R5Y B;  2JWT A;  3SDG A;  1GV2 A;  2ID6 A;  3FIW A;  1QVU A;  2OPT A;  3S17 J;  2DA5 A;  5M3M J;  1W0U A;  3S2D J;  1LE8 B;  2LD5 A;  2YS9 A;  2O8K A;  3BR6 A;  3D1N I;  1JKO C;  2M8G X;  2EH3 A;  3M3Y J;  1JKP C;  5EGO B;  2JJ7 A;  1NTC A;  1APL C;  3S2H J;  4M3D A;  1DU0 A;  2LVS A;  2RAE A;  1R9T J;  2CUE A;  3ZQF A;  4XRM A;  5EZG A;  1BW5 A;  3GTP J;  2DMT A;  1MNM C;  2YU9 J;  3OOU A;  2K9N A;  4XK4 A;  2Y9Y A;  3HOU J;  2LTP A;  1P7J A;  4J19 A;  4DW6 A;  2HOT A;  5GP9 A;  3HOX J;  3SFI A;  1DU6 A;  5F0H A;  1TWH J;  2CU7 A;  1MBH A;  4S0H B;  3MKL A;  1ZK8 A;  4JX5 A;  5EGO A;  2L9R A;  1HDD C;  1AU7 A;  2NS8 A;  2M9H A;  4L5E A;  3Q0W A;  1B8I A;  2EQR A;  2KT0 A;  5E3L A;  1K83 J;  5E3M A;  3PM1 A;  1JTY A;  2DMQ A;  4UUT A;  5J1R A;  1ORK A;  1GVD A;  1XG1 A;  1UG2 A;  2FQ4 A;  1IG7 A;  5F1J A;  2HQ5 A;  5M5X J;  3B6C A;  2Y30 A;  1T33 A;  4M3G A;  4FCY A;  3IH2 A;  3CCY A;  5IP9 J;  2VI6 A;  3ZQI A;  1FJL A;  2L7F P;  3GTL J;  3MN2 A;  4A3K J;  1K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...