1FIPA

The structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
PLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQALLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords FACTOR FOR INVERSION STIMULATION (FIS)
publication title The structure of Fis mutant Pro61Ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue.
pubmed rcsb
source organism Escherichia coli
total genus 27
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fipA00
5IOYA 2VUMJ 2TRTA 4MLOA 3RZDJ 1A6IA 1U9OA 2R5YA 3UKGA 3IH4A 4A3MJ 3BTCA 1QVTA 2WB1N 3ZQLA 4B4CA 1JTXA 3S2HJ 2LK2A 4C3JJ 2DMQA 2LLKA 5K7HA 4IHXA 1ETXA 1RKWA 2NVYJ 4M3DA 3CCYA 2L7ZA 1U8BA 5F0HA 2YU9J 1POGA 3GTPJ 3WHBA 1GT0C 1JKRC 3C2BA 3GTLJ 4HNVA 2LVSA 2VKVA 2DMPA 1WI3A 2ECBA 4A93J 3DEWA 1LFBA 2O8KA 1ZKGA 4D7MA 2DMUA 2GBYA 2HXOA 3BR5A 3A01B 5EG0B 5IYCJ 1MNMC 1FTZA 1MSEC 3SFIA 1ETOA 5M5YJ 3D1NI 1SFOJ 5IOZA 3BQZA 3OOUA 5C3EJ 2MGQA 2EBIA 2XPUA 3JRGA 1AHDP 5EF6A 2M2EA 2Y30A 3JRHA 1IG7A 1TWGJ 5IPAA 4M6VA 2X48A 2EZKA 1BA5A 3H3VK 5K7ZA 3LSRA 2DA7A 4UUTA 3JRIA 1B8IB 1TWAJ 1HCRA 5FKNA 3TEDA 2EZIA 2FJ1A 4JYKA 4BBSJ 1EF4A 2FD5A 2XSDC 2E2HJ 3PM1A 5FKKA 2NVXJ 3HOUJ 4NDLA 1ITYA 2DA1A 1H8AC 5F0CA 1YRNA 4JX6A 4DZJA 2PMZN 1AKHA 2L0KA 5FKLA 3JREA 2ID6A 1UMQA 2CQQA 2DA4A 2G0EA 3LNQA 1E3OC 4A3KJ 1A5JA 4FE4A 1JJ8C 4JP0A 5C4JJ 2R92J 4X6AJ 9ANTA 1OCPA 3QQAA 1FIPA 2RAEA 5C44J 1FIAA 2LKXA 1U9NA 5M3FJ 1JT6A 4IEJA 2NVQJ 2R0QC 3PO3J 4XRSG 3IH2A 3HOYJ 4CYCB 3DCFA 2R7ZJ 4A3JJ 3S1NJ 4UUSB 5F0FA 3ZQCA 1X58A 3I4NJ 4XK4A 2CUEA 1G2HA 2E19A 1F36A 2XB0X 1XS9A 4LOCA 2P81A 1HF0A 3TP0A 5BNGA 2R5YB 1JKQC 1IGNA 5EEAA 4B1RA 2LY9A 1U78A 2B63J 4A3LJ 4X1EA 3JRFA 2CU7A 4C3IJ 1DU0A 1JUSA 1JKOC 3NARA 2XGCA 1MBKA 2Y31A 3VPRA 1MBHA 2KT0A 3HKZN 2E1OA 2TCTA 2DA6A 3HOVJ 5FKMA 2JWTA 2JJ7A 5EZHA 5FLMJ 3HGGA 4XRMA 3ZOBA 1X2MA 3Q0UA 1I3QJ 1IV6A 1TWHJ 1TWFJ 2DMTA 4I76A 5M5WJ 2AO9A 3FK6A 1HDPA 1GUUA 4G12A 4L5EA 2HQ5A 2ME6A 2HI3A 4V2FA 1FJLA 4AC0A 2H1KA 2LD5A 1WH7A 1JUMA 2DN0A 2K40A 3BR1A 1S7EA 2XB5A 4J19A 1MH3A 2L7FP 2O9LA 1PUFA 1VNDA 5FKOA 2IEKA 1JUPA 2LP0A 2VPRA 3A03A 4RDUA 3RKQA 2M34A 1MBEA 2HXIA 2MW8A 1W0UA 3M3YJ 1ZTRA 1APLC 1OJLA 1LE8A 5M5XJ 3MKLA 1RETA 1JT0A 4A3DJ 1ORKA 3SDGA 3CMYA 3G1LA 3FIWA 2JA7J 3GTGJ 1ENHA 1HDDC 2LFBA 2X9DA 4BBRJ 4EEFG 3OSGA 2Y0SN 1IC8A 1YRNB 1AKHB 4S0HB 1Q1VA 1UG2A 2E2IJ 1SANA 1BJZA 3ZQFA 2D5VA 2EZHA 2YS9A 2OF7A 2DA2A 2KDZA 4D7NA 5E3OA 4A3FJ 2N8GA 4IHWA 2X6OA 4QSHA 1NK3P 4B3AA 3GTQJ 2HOSA 2NOGA 1MH4A 1IJWC 2XGDA 4Y7NJ 2DA3A 1ETWA 5EGOA 3HEFA 1Y1VJ 2DMNA 4A3IJ 3JR9A 2JA6J 3GTKJ 2I10A 3MN2A 2JA8J 4AYBN 3M4OJ 1HOMA 2R93J 4D5FA 2EZLA 5EZGA 3BTIA 5GPCA 4I6ZA 2HOAA 3GTOJ 1HLVA 5DTDA 5JLWA 1ZR2A 4XRSA 3BG9A 4M3BA 1ETVA 1H88C 3S14J 5IYDJ 1R9TJ 4D5CA 1RESA 1AU7A 2H8RA 3RQIA 1QVUA 1I6HJ 3TW6A 2CUFA 2WV1A 5IYBJ 5FLVA 5F08A 4AUXA 2MSYA 3BR0A 3CQZJ 3S1MJ 2JMWA 1T56A 3BT9A 3S15J 1T33A 4A3CJ 2NVTJ 4BY1J 3QPLA 1VI0A 2LTPA 3S2DJ 2K9QA 2XPVA 3HM5A 4BY7J 5JLXA 1P7IA 4FE7A 2E2JJ 2M0CA 3GTMJ 2XRLA 2NS7A 3FK7A 3RZOJ 3BQYA 1WPKA 1I50J 3Q0VA 4Y52J 3O8HA 3Q3SA 1WH5A 1B72A 1NTCA 2EH3A 3NAUA 1PUFB 5M3MJ 4W97A 3OIOA 2NS8A 1JGGA 3FISA 3JRCA 4W1UA 3F0CA 4MO7A 4C3HJ 2MG4A 5FJ8J 4ABZA 2R5ZA 1LE8B 1H89C 2HDDA 3H0GJ 4JX5A 3W6VA 3FKIJ 5F04A 5IP6A 1VF9A 1FEXA 5E3NA 5E3MA 3JRBA 3BTJA 1ZK8A 3JRDA 4FCYA 2OPTA 1Y1WJ 2YUSA 3QPSA 2GLOA 1WCMJ 1MBGA 2CJJA 2K9SA 1JTYA 3WHCA 3HOXJ 2W48A 4BKXA 1OFCX 1QRYA 5J1UA 2LR8A 4DYCA 2VKEA 3ZQIA 1GV5A 4DYRA 1Z77A 2QF7A 5IP7J 3S17J 2JK3A 4XICA 1TWCJ 4DYQA 1MSFC 3BG3A 2WAQN 5EGOB 1P7JA 2ME0A 2O7OA 1OCTC 5IP9J 4GFBA 2QCOA 1BW6A 2ZB9A 1MBJA 5F27A 3BR6A 1RR7A 1IDZA 3G1OA 3G1MA 3HBLA 5K7FA 4FISA 2Y2ZA 1MBFA 1XG1A 1VFCA 3E7LA 5EYRA 1X2NA 2JA5J 4M3FA 5GP9A 3BR3A 3HOWJ 1IDYA 5DS9A 2ELKA 1JJ6C 1QPIA 3IH3A 1DU6A 2DTZA 5EDNA 4RBOA 3LSJA 4QTRA 1BW5A 4MIMA 1GV2A 1RKTA 1ZGWA 4XIDA 3SJMA 4IHVA 3HB9A 4MFEA 3TW7A 4FTHA 2FQ4A 2HYJA 2VI6A 2Y9YA 4V2GA 3I4MJ 3Q0WA 4JX4A 3BTLA 3HDDA 1W0TA 4A69C 1B72B 3L1PA 2XPWA 1NK2P 1XC5A 2IAIA 3CDLA 2CRGA 1CQTA 4IHYA 3S1QJ 1ETYA 2EQRA 3A01A 5C4XJ 2K9NA 3A02A 1O4XA 5EG0A 3OSFA 3IV5A 2R5ZB 1RPWA 3LSPA 2Y9ZA 1K61A 1LFUP 4A3BJ 3JRAA 3S16J 1IUFA 4C2MJ 3S1RJ 3GBGA 3GTJJ 1GDTA 2L7MP 2L9RA 1GVDA 4A3GJ 1K83J 5F1JA 2AHQA 4DZPA 3O8GA 2DA5A 1B8IA 5J1RA 2COBA 4A3EJ 3B6AA 2ECCA 3TP3A 4MFDA 1WGXA 1D5YA 3B6CA 3BG5A 4M3GA 2GM4A 3K7AJ 1Z0XA 3BR2A 5HODA 3ZQGA 1IRZA 4M3EA 2FX0A 1ETKA 1UHSA 2HOTA 1TC3C 2JN6A 3ZQHA 2XGEA 3K2AA 5J1YA 3LOCA 5GPAA 1FTTA 2CQXA 4CYCA 1ETQA 1JKPC 1BL0A 2IBDA 3HGYA 4QIWN 3MVPA 5J3LA 5E3LA 4UUSA 1ZQ3P 2M9HA 3PO2J 1F43A 2DJNA 2ID3A 3HOZJ 2M8GX 4BXXJ 1ZR4A 4DW6A 3LSGA
chains in the Genus database with same CATH superfamily
1MMDA 2DPDA 3RZDJ 1A6IA 1U9OA 2OD5A 1B9NA 2YX7A 3UKGA 3LSIA 3BTCA 4B4CA 4YFNF 2QYOA 2ZSIB 1I1SA 2GOXB 3HPHA 2LK2A 3FXKA 3ZP5A 4H4KC 3KEOA 4A6EA 5HDNA 2LLKA 5K7HA 2Y48A 4IHXA 4HDVA 5HOOA 2OCEA 3GEZA 3F6OA 2RV8A 3ZRGA 4MEYF 3GFIA 2KL4A 2ELJA 2MH2A 2FE3A 3CCYA 2WAFA 4EJWA 1POGA 2CYYA 1GT0C 4CGZA 4XKVA 2BVMA 3IRRA 2DMPA 4NUBA 3A4CA 2EV5A 2I8DA 2JSPA 3DEWA 1LFBA 3VSLA 2O8KA 4D7MA 3FXOA 4U7DA 1T38A 4FQGA 2WAQA 3CMMA 5EG0B 5IYCJ 1MNMC 1O3QA 4FHTA 1R23A 3PNYA 4A5NA 4K2EA 2M8EA 3H3UA 2IT0A 4XLEA 3OMYA 2MGQA 3WGHA 1AHDP 4R79A 2DT7B 4KFCA 2XHKA 4P5OA 1TWGJ 3RKXA 2DOAA 2YU3A 1WJBA 2KRFA 2G7HA 1R5GA 3BLYA 3H3VK 3LSRA 3JRIA 1YFHA 1HKQA 4MGRA 5K5RA 1TWAJ 3BCBA 1B8IB 5CVUA 2LG4A 4PUSA 5FKNA 5HNFA 2EZIA 4BBSJ 3I71A 3MEXA 2K27A 2XSDC 1JI8A 3P9KA 3DU6A 2L2OA 4XSZF 1ITYA 1HXDA 1YS6A 1V5EA 1J2XA 3M8FA 1RR8C 1IRGA 3B02A 4ESJA 2BY2A 1YRNA 2JRMA 5FKLA 5IT9K 3GUDA 1UMQA 2DA4A 2JUGA 4Y13A 3LNQA 4IXAA 1OLTA 4IRHA 1A5JA 4X6AJ 3FWEA 5C4JJ 1Z3YA 3AG2H 2CO5A 1SAUA 1FIAA 4I0BA 2XDVA 2R0QC 1UG0A 3COAC 4I2OA 4CYDA 1BIBA 5KCMA 3IH2A 3DCFA 3OYAA 3S1NJ 2KIFA 3BC8A 4CCNA 4E70A 2PMZA 5F0FA 2W4SA 3ZQCA 4F7ZA 1OMIA 4H0EA 4QLCU 4LFUA 2GXGA 1F36A 3ONQA 3CUOA 3I0TA 2R5YB 1JKQC 4KYWA 2LY9A 1U78A 3FZVA 1G3SA 1XN7A 4C3IJ 1T0FA 4HYEA 1STZA 3NWTA 1JUSA 4NNJA 3T0YA 5TGTA 1JKOC 5TJJA 3J80K 1BR1A 4IQ4A 4PFPA 3VPRA 3HKZN 4XKWA 2E1OA 3HOVJ 1J59A 2BW3B 4KMUX 5FKMA 2DCEA 2JJ7A 1R1VA 2DQRA 3UR3C 3ESWB 2R7QA 2L4AA 2WY8Q 1R4MB 5M5WJ 1XPXA 3CLQA 1MMNA 2D1HA 1QA6A 3J7YJ 1HA8A 2M87A 5A2QZ 2M5WA 1WH7A 3T8RA 1E3HA 2ZMEA 4LIVA 4XORA 3BR1A 2L54A 1PUFA 3JCUC 1OQYA 2IEKA 2XGXA 1RUNA 2DYSH 2VPRA 3A03A 4OAYA 4PK4A 3H5AA 1WI9A 4UVCA 2M34A 2ELHA 2GA2A 3U1KA 4J01A 2BY0A 3ZCOA 3F8CA 4ZDPA 1ZTRA 3M3YJ 3KIOA 3QOEA 5M5XJ 1D0ZA 4A3DJ 3KFWX 4BQNA 3FIWA 4L9NA 5LGUA 2IPQX 1SMTA 5KAIC 1QNTA 4BQQA 1N78A 2HQRA 1HDDC 3BZKA 4LG0A 4IKFA 3CF5F 1PDNC 2G7UA 4XOPA 1TT0A 2NXNB 1ON2A 1Q1VA 4EJOA 2VT3A 2E2IJ 2OJED 4DJAA 3DEEA 2BGCA 1KGSA 3I55I 5AIPA 2EZHA 3H9QA 2V1XA 4O3MA 1TZLA 3SYTA 3G71I 2KDZA 5E3OA 3TOBA 3F8MA 2IGOA 4A3FJ 1XB4A 3CMEI 5HLTA 4QSHA 1NK3P 4HX4A 3QYFA 2HOSA 1W36D 5DCFA 1OPCA 2ZFUA 2LSOA 4BXFA 5EJCA 3SQNA 2KMUA 3DXJF 5KVRA 4D9JA 1ZN2A 2NNNA 1XMKA 4BEHB 1Y1VJ 1BIAA 2GXAA 4OWRB 2JA8J 2HYFA 1DQUA 3FXJA 4ENJA 5EZGA 3TGNA 1ON1A 2F5DA 1QBJA 3S14J 1ZR2A 3MAJA 1H88C 1ETVA 3O6BB 1I27A 4WX9A 3FF5A 1R9TJ 2JZYA 2R7XA 1RESA 1AU7A 2H8RA 1LEAA 3RQIA 4ZZDA 1QVUA 1Y8RB 2QSHX 2E1CA 2Z16A 2W24A 1LVAA 4B09A 3BR0A 3CQZJ 1BOAA 2O0YA 4BS9A 1TBXA 3BT9A 3H35A 3S15J 4A3CJ 2VBYA 4IRGA 4RM3A 2CS3A 4C9YA 1IZ1A 1VI0A 4BY1J 3S2DJ 2K9QA 2KLOA 3HM5A 1IXSB 4BY7J 1Y39A 4FE7A 2DBBA 3PIPF 2GOMA 2HOEA 3VOEA 3GTMJ 1D8JA 3DPLC 3FK7A 5GADJ 3RZOJ 1DPUA 3ZQ7A 2WA0A 1X1CA 2FEZA 3BQYA 2XAJA 1TT5B 3DKWA 2LMDA 3GLXA 3K1MA 3Q0VA 5HS8A 4HZFA 1IV8A 2FF4A 2F4IA 2FNPA 5D6FA 1G59A 1K7AA 5D5VB 2JTVA 2QKMB 3WTYC 3V7CA 4ZTFA 2M4GA 2UXNA 2GIVA 2VOPA 3DLLF 1VZ0A 4ABZA 3BZ6A 1LE8B 2OTLI 1J75A 5H6QA 3H0GJ 5GAHJ 1KU3A 1KYWA 2HWVA 1FEXA 2ESNA 2OQRA 2DFHA 2ZSHB 5E3NA 3H9GA 2CUJA 2F4MB 1ZK8A 3VSKA 2OPTA 2YUSA 5DCMA 2HZDA 2A5YB 1K6OA 2BHYA 3K4LA 5BPIA 1USTA 5J4VA 5D4RA 4IQJA 3K70D 2DK8A 2K9SA 2VE9A 5FRMA 2DFFA 2AQEA 1H9GA 3WHCA 1D8KA 3HOXJ 2W48A 3LWFA 3E3VA 1YIOA 2UUZA 2ZC2A 3K4NA 4U88A 4DBRA 4HQEA 1QRYA 5CKTA 2H94A 4XKCA 3ZQIA 1XSVA 1GV5A 3FMQA 4DYRA 2L7KA 2HEOA 2DOEA 5L3EA 4BDZA 3BDDA 2R7WA 2BEOA 2GZWA 2LKSA 1V4RA 2MLGA 3CJTB 4IO9F 1YJNI 2JSCA 1IXRC 5EGOB 1P7JA 2D1VA 4HSTA 1OCTC 4GFBA 2PEXA 2QCOA 2VQLA 4RGXA 3BZCA 3CTAA 4II2A 3C1DA 4GO1A 1RR7A 3ZN0A 1UHWA 4WK8F 3G1MA 3OIQA 5F64A 3OYGA 2R7FA 3CCVI 5E17F 3EUAA 5F1RA 1N25A 1BOBA 4FISA 1MBFA 2VB6A 1R49A 4CUGA 1TQMA 3E7LA 4XRFA 1S6LA 2VKHA 2JA5J 4XM3A 5GP9A 5D5WB 1F1ZA 2OC6A 3M1EA 5K1YA 3V8LA 3HOWJ 1IDYA 1XGMA 1ZHFA 2ELKA 3HXLA 3PUFA 1DU6A 3BJ6A 2EV6A 2IGNA 2P7CB 4Q5SF 1UAAA 3H1CA 2A6EF 5J6XA 1KQ0A 2V4JC 4S04A 1R1TA 4XIDA 2CSOA 2JPBA 3P7NA 1FNNA 3TW7A 4LLLA 2VI6A 3CCUI 2Y9YA 4CZCA 2ICWG 3KLNA 3KP6A 4PJNA 4BU2A 3OYDA 1A35A 2PI0A 3BTLA 1A36A 3ABKH 3K1PA 4CCLA 3HDDA 1RIOH 3H5NA 2EINH 1TW3A 1GLNA 3WTZA 4DIQA 3F21A 2QZ8A 1MJBA 2IAIA 3CDLA 3F72A 3F22A 1MIJA 2K9NA 3A02A 1O4XA 2PQ8A 2Z5UA 2FBIA 3DBHB 2BYVE 1XGNA 3CUQC 1S3JA 5LLQA 4A3BJ 4IOCF 1XCVA 1AOYA 5E1XA 3DPTA 4C2MJ 1QO0D 1OR7A 3CD6I 1OKRA 2L7MP 3QPTA 4P9FA 2X6YA 2CQKA 2BY1A 4YEJA 4WXHA 2Q2EA 3OYHA 4U0WA 3ASOH 3CC2I 5J1RA 3M9AA 4M9ZA 4M6YA 3W3CA 4PJJA 1YO5C 2PBIA 4A3EJ 3B6AA 2ECCA 3TP3A 4MQVA 4RGRA 2H09A 2ZCWA 1D5YA 2B0LA 2QGUA 3V42A 2CWEA 4XKBA 1W1WE 2CW0F 3P9CA 2X4HA 3ZQGA 2FSWA 1R5HA 3ABLH 1R5ID 1BR2A 2HOTA 5DD8A 4FX4A 3REOA 1BBYA 2XGEA 3K2AA 3BY6A 1IN5A 2LY1A 4Z6YA 1QZEA 5DEQA 3OYLA 3LOCA 4C2UA 3VDXA 3KEQA 2E35A 2GIZA 2L4MA 4GYGA 4WWCA 2PLYA 1BL0A 2IBDA 3MVPA 2BBYA 2Q8KA 3HL2A 2K3PA 1LFPA 2M4KA 4OINF 4I7HA 3IRQA 3W2WA 3WE3A 3LSGA 2AXTC 4EV0A 1OYIA 4UB6C 2VUMJ 1O57A 4MLOA 3LAPA 1R36A 3OV8A 3IH4A 1WJEA 4AIDA 3ZQLA 2NOJB 2IGMA 2QVOA 1JTXA 1XSDA 5CQEA 3S2HJ 3CJQB 3KETA 5HDGA 1J7KA 2XC7A 2DMQA 4HF0A 4KT5C 3SFZA 3FKJA 3QPHA 3WG9A 2K9LA 4XLAA 3CP8A 2RDPA 4XMYA 3EUHC 2L9SA 4C30A 4YFXF 5F0HA 1KA8A 3GTPJ 3WHBA 3VB2A 2K02A 1BJAA 3C2BA 1E2XA 1ODDA 2ZXIA 3F8FA 4CCMA 2WB1A 3LSMA 3J81Z 2ECBA 1ZH5A 5EEHA 4A93J 4YELA 2GAUA 1Y0UA 4EM2A 4LLNA 1P4XA 5LHGA 1JHFA 2GBYA 2GQQA 2HXOA 1SEUA 4LD5A 1K78A 1IUYA 2CFOA 2CGPA 2M0MA 2ZBKA 4GRIA 3KLOA 1FTZA 1T2KA 4RMNA 4A0ZA 2P5LC 2V6EA 5IOZA 3BQZA 4XQFA 1XSXA 2CQNA 3RYRA 2EBIA 3JRGA 3Q9SA 1CF7A 3J81K 3K10A 2XVCA 3OWTA 3CCMI 5IPAA 3CF2A 2LREA 2X48A 1BA5A 3GMEA 5K7ZA 3HUGB 2DA7A 4UUTA 2HQNA 2KZGA 1NG7A 2QUFA 3JSOA 5K5OA 1HCRA 2O3FA 4UHTA 5IY5H 2FJ1A 3ISPA 2FD5A 3ABTA 2KIMA 3DEUA 4RM2A 5D5UB 4NC8A 5JHFA 1KU9A 5B1AH 3HOUJ 2IJLA 4NDLA 2NRAC 2XKPA 4GXOA 3RJPA 3SZTA 2PMZN 3CZ6A 4PJ0C 3JREA 3LSTA 1QHHD 2ID6A 2CQQA 3LSHA 4MTEA 4A3KJ 5HS9A 1ZG3A 4FE4A 1JJ8C 4JP0A 1BC8C 9ANTA 4XLHA 5ICGA 1U2WA 5C44J 5L3FA 1U9NA 1B1BA 1A04A 1Z7LA 1JT6A 1IRXA 1S7OA 3S3OA 1S9HA 1BI0A 3CUQA 2MD0A 2CW7A 3HOYJ 4CYCB 2R7ZJ 4ZZLA 1G3WA 2FA5A 4E7LA 4UUSB 5LRRA 2HVRA 3D5SC 3K2ZA 2VIXA 3S2WA 2A07F 2GXBA 1R7JA 3R6SA 3ECHA 5HS7A 3OYNA 2P6TA 2V6CA 4IRIA 2W25A 2E19A 3BROA 3I56I 1KYZA 4LOCA 5BNGA 3CO7C 3T5XA 3MCZA 4A3LJ 4BE1A 4X1EA 2M1BA 3I5UA 5BOXA 4ON0A 1DU0A 4CDGA 1PUEE 2XGCA 3ABMH 4BHBA 3TQNA 2O61A 1MBKA 2Y31A 1MBHA 3R0JA 2MC3A 3SZPA 4OIPF 2HVQA 1SFXA 1YE9A 2AQFA 5FD5A 4EGZA 2E36A 3VYSB 1ZG1A 2KRHA 1W5TA 2M30A 3KP3A 5ICFA 2MH9A 4CCOA 1V54H 2XF6A 4DOZA 5H2FC 1I3QJ 3OS0A 5K5QA 4WCGA 4I76A 1G3TA 3K9TA 3DPUA 2WV0A 1U5TB 3FK6A 1HDPA 3KYLA 3T1BA 4QPQA 2HQ5A 2ME6A 4E7JA 3W2VA 4HRIA 2DJIA 3FBNB 4AC0A 5AIQA 2H1KA 2QM3A 2IA0A 4P1WA 2E5NA 3O3KA 1U8RA 1JUMA 1WQ2A 3MQ0A 5ICEA 1S7EA 3ELKA 4GDFA 1O3TA 4LMYA 4J19A 1FT9A 3J7AY 2O9LA 4M72A 3FMRA 3CDIA 5FKOA 4ZTJA 1SFUA 1TTYA 2VN2A 4HV6A 2MW8A 4XSXF 3G3ZA 2XRNA 1P4AA 2TDXA 3DV8A 3RKYA 3MKLA 3BJAA 4RB1A 3HTUA 2RN7A 3CMYA 2MFZA 2L02A 3FXRA 5LFAA 1ZGAA 4QPOA 3GTGJ 1ENHA 5HDKA 3H9JA 5ERIA 4IZZA 1BI1A 3L09A 4PSXA 3OSGA 2HQAA 3WU0A 1AKHB 2ESHA 4HV5A 1UG2A 2DDBA 1D1AA 3I58A 3U9GA 1SANA 1BJZA 3WTSC 2OUMA 3EYYA 4LITA 1XGSA 4MQ9F 3TO9A 1UB9A 1USSA 5H20A 5JI6A 5CLSA 2BV6A 3CJNA 1BC7C 4D7NA 3PQJA 1VQPI 2EFQA 4IX7A 4YFKF 3OIPA 2QKLB 1SMYF 2N8GA 2X6OA 1KZHA 4IHWA 3EDPA 2P0WA 2NOGA 5F6FA 1VQLI 2WBMA 3HSEA 3PL8A 4A2UA 4L18B 5JR3A 2XAGA 1X1BA 2OCCH 4G7OF 3HEFA 3I3LA 5J40A 3OYCA 3GTKJ 2I10A 4AYBN 1X3UA 5CPRB 3F23A 4BUPA 2EZLA 1S72I 3CMAI 1N77A 1U3EM 3FXMA 4XRSA 5IYDJ 3HJEA 3K4MA 3U2RA 1HW1A 1VTNC 4ENMA 3KP5A 3HRUA 1W5SA 2YX4A 2VODA 3C3WA 1I6HJ 3FXLA 2EFWA 2CUFA 2WV1A 5IYBJ 2MSYA 1R22A 1MKMA 1PJRA 1T56A 1GVJA 3SHFA 1W36C 2X85A 4N4NB 2BY3A 3KYDB 2VLAA 1TLHB 3MFKA 5JLXA 2E2JJ 2XAQA 2DPUA 2NS7A 2VJIA 3WE2A 1T98A 1WJCA 2XUBA 4FT8A 3IKTA 2V9KA 4EGYA 1W7PB 1B59A 4BE0A 3O8HA 3AKZA 3G73A 2HR3A 2Z2SB 1B72A 1WZ2A 2QLZA 1RNLA 4R8HA 3NAUA 2VJ4A 2E34A 4JOMA 4CSWA 5M3MJ 3A2KA 2IXSA 5E79C 2KP6A 3FISA 4W1UA 3F0CA 2RNGA 2MA3A 3E5UA 1W5CC 3GZNB 4N4OB 3ZMUA 2R5ZA 1H89C 1JXSA 4BHCA 4JK1X 4PSWA 4KITB 2RNJA 4O5VA 4PJLA 4AIHA 5TRDA 4Y4RA 3DU5A 3CO6C 3AG4H 3DBRB 2EA2A 3TMOA 4Y17A 2GLOA 2DTRA 1XCBA 5LBQA 3DBLB 2FU4A 4D1QA 3PJRA 2IA1A 2DLLA 3PFIA 4QWQA 2E71A 2EIMH 3I64A 1JTYA 1MMGA 3V7RA 2V9VA 3IP4B 1VQ8I 4BKXA 1OFCX 3S3NA 2Z3YA 4A12A 5FFXA 1SC7A 2LR8A 4DYCA 2J5PA 3ECOA 2H6BA 2QF7A 2YPRA 5IP7J 1VQ9I 2VBZA 3S17J 4G7ZF 2V1DA 3K4KA 2QBYA 1TP4A 4DYQA 1MSFC 4NQWA 5A2QK 1G4DA 1Y0NA 2A5WA 3IUOA 1RRJA 2DAOA 1ZLKA 2ZB9A 1WRJA 5L3DA 2KISA 2GA1A 1X3WB 3BR6A 2CV2A 3I53A 1ZRDA 3HBLA 2QENA 3D5RC 5K7FA 3K70C 1FLIA 1VFCA 1BI2A 3K4BA 5EYRA 1X2NA 1I3AA 2M7BA 4M3FA 3WTWC 2JVGA 4BNCA 1G6NA 4ZDLA 4BH9A 3SZGA 4G8XA 3GVAA 5DS9A 4RA2A 1R4NB 3PIOF 3IH3A 2DTZA 5B3SH 1P6RA 4A6DA 5EDNA 4E7IA 4A5MA 3ZMTA 1OCRH 1YS7A 3LSJA 4ENNA 2HDCA 1GV2A 1YW9A 2OAZA 1T08B 5H6RA 3TOAA 5J4YA 3V4GA 3O2PE 3ZMVA 3HB9A 3KCCA 3ZN1A 1R58A 4FTHA 3QU3A 1K4TA 2HYJA 4V19K 1E0EA 4IL6C 3PNTA 3WTUC 3HRSA 1R00A 3EETA 4U7BA 3Q0WA 4FETA 4YG2F 2WADA 2VQHA 3WU1B 2P7VB 1W0TA 3J7AO 4KUMA 3IAS2 4BXUA 2VONA 1VQOI 2XSJC 3FDYA 2V79A 1HKTA 1CQTA 4M6XA 2CRGA 3S1QJ 4B48A 1FYLA 2EQRA 3F6VA 1F9NA 3MD2A 4G9YA 5EG0A 2NVUB 5FLXZ 1YX3A 1FP2A 1FSHA 4AYBA 3NEUA 2KRCA 1ACIA 3LSPA 4C2TA 4RAZA 1SD7A 3I59B 4BJ5C 1IUFA 3F9KA 3QODA 2O8XA 1GDTA 4XR6A 4MNUA 4CA0A 4M73A 2DFEA 1K83J 5F1JA 4L0ZB 5CYVA 5FD6A 4UVBA 1B8IA 3ABUA 1W7PD 5FRNA 4HEA2 1IXCA 1LVKA 5FLXK 1G3YA 3EYIA 5E1WA 2EFPA 3HZJA 3LSKA 3AAFA 1WGXA 1VQ7I 2DYRH 4M3GA 4UNOA 4ASNA 3K7AJ 4N9IA 1VQKI 2K85A 5KHDA 3RIRA 4U87A 5E20A 4NHJA 2ZNZA 3GFJA 2A68F 4L5IA 1TC3C 2JVHA 4Q4ZF 4KIBA 1EH6A 1QPMA 5J1YA 3MKWB 3VWBA 2K3FA 4XBFA 2CQXA 4EM0B 1SVMA 1JKPC 3ERMA 1ONVA 5J3LA 1ZQ3P 1MJAA 3RQ4A 1IN6A 5B5EC 2UZKA 4XN3A 2ID3A 3ML6A 4ITVA 1LJ9A 4BXXJ 3JTGA 2ZKZA 4DW6A 3MMYB 5IOYA 5HNHA 4E4HA 2HNHA 2X6XA 3DP7A 2R5YA 2HPMA 4A3MJ 2EA4A 3IWFA 1QVTA 2QQ8A 2NAZA 2WB1N 5HLIA 3RPUD 4F52A 3D5LA 3TDUC 1IN7A 3X2QH 1TL8A 1MNDA 2Q1ZB 2W57A 1JGSA 1RKWA 3DKYA 4HA8A 1YTYA 5B1BH 1YLFA 2BW3A 1MDMB 2VT2A 5D6EA 2WY7Q 1U8BA 2CH0A 5JVTA 5E1ZB 3GYHX 1JKRC 2BXZA 2VKVA 3K1NA 3HYIA 1WI3A 2ZJPF 3MKZA 1V5FA 3L9FA 1EJ9A 2F5CA 3SDBA 4LB6B 1ZKGA 3S3MA 4Q48A 2DMUA 4KA4A 2HPIA 4F93B 2VOOA 2H8WA 4WF2A 3ZR8X 3A01B 3A1YA 2IP2A 3SXYA 3SFIA 4PZJA 2EILH 3D1NI 1MSEC 2WC2A 3R60A 4DGWB 1EV7A 5C3EJ 2E7XA 2FRHA 2P5VA 2Y30A 1SFKA 3GXOA 4KISA 1IRFA 2Y69H 4M6VA 4ZYDA 4Y15A 2DOFA 3HIFA 4JQFA 2A69F 3I4PA 3N05A 1X4OA 2K5CA 4JYKA 4HF1A 1EF4A 4RAGA 2RC4A 4M71A 3RSNA 1FOYA 2BHZA 4RAFA 3PQKA 3C2HA 3PM1A 2X51A 2H6CA 2NVXJ 4ETSA 5EEGA 5DV5A 2ISZA 1H8AC 2KJBA 4RAYA 1PP7U 4DZJA 5BMZA 4PCQA 3KP7A 4HOBA 2FMYA 1E3OC 3L2QA 1OCCH 1FY7A 2R92J 2YSRA 3QQAA 1FIPA 2LKXA 3LMMA 2PJRB 1M1EB 3C2GA 3PUBA 2FNAA 2LBFA 2BVLA 1ERDA 2DO7A 1SVOA 4UXNA 3QOPA 1MZBA 1FYMA 5J8FA 3E0JB 2LKPA 3I4NJ 3DF8A 2CUEA 2EIJH 4BEHA 1XS9A 4KIFA 3TP0A 4BDYA 3VYTB 4L0YB 3S93A 4LLGF 4HNTA 2B63J 1I6XA 2XF7A 2CU7A 1LPQA 4UV8A 5DM6F 3LFKA 1MMSA 2X1CA 1WWXA 2M7AA 1ZRCA 2RQQA 3R0AA 2X0LA 3QYEA 2W7NA 2W00A 1K79A 1FX7A 2KT0A 3J7ZI 4ENKA 5ILSA 2A6TA 2FBHA 1Q1HA 5EZHA 5FLMJ 4II3A 4UUVA 1FPQA 3HGGA 4XRMA 3ZMDA 4G6TB 1X2MA 4DQ2A 3OYBA 2IS4A 3Q0UA 1TWHJ 5LGNA 4XOTA 3JAMZ 5ED4A 1TWFJ 1V5GA 2DMTA 4KJZA 2C6YA 3WTTC 3TKYA 5FGMA 3C7JA 4L5EA 3FXQA 4V2FA 1J0RA 1ZARA 2IGKA 2QSGX 2LD5A 1BR4A 3LFUA 2DN0A 2XB5A 6PAXA 1NG6A 1MH3A 2L7FP 1YJ9I 5JFRA 1VNDA 5GTIC 1ZAOA 4RDUA 2XKOA 3JAMK 1W0UA 4E6KG 4MHGA 4CCKA 4RB2C 1APLC 2O5RA 1OJLA 1LE8A 2OTJI 3DLAA 1X1PA 1ORKA 3TL4X 3BOQA 1XDSA 2F5FA 1OCOH 3MZYA 3CLOA 1O7LA 1H9TA 2LFBA 4ZYAA 4BBRJ 1X19A 1QZYA 4N9HA 1OYWA 1IC8A 2IW5A 2QA4I 1YRNB 4UV9A 4S0HB 2F5VA 3ZXSA 2FMLA 2KZVA 1E17A 1MMAA 2HTJA 4BJ6C 3F8NA 2IA2A 5CQGA 1P92A 2EIKH 3ZQFA 1O7FA 3HPGA 2YS9A 3OYEA 3CP2A 4O6JA 1U6GA 3KP2A 2OF7A 1J9IA 1SD4A 3M8JA 2LOOA 4XLPF 4ESFA 4HX7A 3QRFF 4FASD 1VQNI 1YX5A 3HSRA 3I9V2 2IRFG 2Y0SA 1IJWC 2XGDA 2VE8A 1ETWA 1WSUA 1EH7A 2V9PA 5AONA 4KT6A 1ZG5A 5EGOA 4BACA 3AG1H 4A3IJ 2JA6J 4PDKA 4D5FA 4KN7X 5GPCA 2L9NA 3GTOJ 1HLVA 2KIQA 2XASA 3QU6A 3RPQA 1G8XA 2WAEA 4G6DA 5CVVA 4D5CA 3M7GA 3NQOA 1ZLJA 3NWSA 2HFHA 1FBQA 4LK1F 2P8TA 4HSRA 5FLVA 5GAGJ 4AUXA 5FFZA 4N0BA 1D0YA 3S1MJ 1FWZA 2JMWA 4MEXF 4TV7A 1P9QC 1TQIA 2G9WA 4AM3A 2VPLA 5LGTA 1ZREA 1V55H 2CG4A 3QPLA 2LTPA 4R1HA 3PSFA 2F6CA 1UELB 4UB8C 2ZXWH 2ZNYA 2XRLA 4LB5A 1I39A 5FO5A 3LQRA 3IWZA 2EFOA 1I1GA 1XX5A 3H5RA 4Y52J 3EPZA 3RYPA 3HC7A 2ACJA 2ZMEB 2W85A 2MC4A 2EFNA 4IPAA 4DNCA 1XTAA 3CCJI 4D0PA 1T0FC 1ZGJA 3L00A 2Z33A 2EH3A 1N75A 2A61A 1PUFB 4W97A 1YW8A 3DWLE 2NS8A 3CCLI 1Z21A 1KQ8A 3JRCA 1ZRFA 2MG4A 4Y33A 2LY2A 1SD6A 3MZ8A 3ERED 3ZMZA 4YIIA 4L9VA 4NB5A 2BOLA 4IVNA 2R7TA 1IAWA 3FKIJ 5F04A 5IP6A 1VF9A 3P5JA 1Y8QB 2LYCA 1X1AA 4CZZA 3JRDA 2VC0A 4FCYA 2EK5A 4BQOA 3HRMA 3MWMA 3K4JA 4LG0B 3QPSA 4A0YA 3AFHA 5HVQC 2CV1A 1OISA 4IHTA 3U21A 5HLGA 2UV1A 2ZO4A 1SFEA 2R7DA 1RZ4A 1J5YA 4I0AA 4MTDA 1DDNA 2ZMEC 3P9IA 1HBXG 3JSPA 1L0OC 5J1UA 1IN4A 2X6WA 1AA7A 3H3ZA 2HKOA 4RS8A 3F3XA 3OR1C 1D1CA 1TQPA 4L9JA 4XICA 1C0WA 3EUHA 3HHHA 2IVMA 4EJUA 3ZPLA 2ME0A 3KYCB 2O7OA 3OOPA 1MBJA 1U5TC 2B7EA 1IDZA 3BJOA 1DUXC 1RUOA 4OIQF 3GCMA 4NBQA 2Y2ZA 2OU2A 1H0MA 3K6GA 1XG1A 3OS1A 5KK1A 4ZYHA 4CXFA 3BR3A 2FBKA 5CVRA 5JHUA 2HDWA 1JJ6C 1YIJI 4BYYA 2RREA 5LHHA 1QPIA 3VYRB 4B8XA 3AL0B 3OYMA 3BP8A 2W82A 2Z9OA 3GF2A 2XV4S 3WODF 1S7AA 2MABA 1LNWA 1XGOA 3SJMA 4IHVA 1FBSA 1KU2A 3M1CA 4HPQA 5L3CA 2HZTA 5IT9Z 2COMA 1P4WA 1YOVB 4HQMA 2ISYA 1UFMA 3B73A 1GXQA 3KEYA 3OYKA 3QWLA 4CO8A 2JA2A 5J8CA 2AS5F 4IHYA 4GGGA 1ETYA 2EB7A 2VQGA 3IC7A 1D1BA 2EPFA 2V1NA 1D0XA 3E6CC 1QGPA 4AVZA 3K0LA 2KPMA 3IV5A 1RPWA 4X0GA 3VYUB 3JRAA 3BG7A 1OCZH 2DT6A 5D8LB 3G2BA 4OIOF 3GBGA 1JE8A 2HU9A 3AL0C 3IL2A 4XLFA 4E7HA 2JUCA 5DCMB 1VQ5I 3BWGA 4IF4A 2DA5A 3HUGA 1FYKA 2UWMA 2XAUA 2QWWA 3J80Z 1B9MA 2VASA 4OMZA 2ZFWA 3GFLA 4F55A 1Z6RA 2EV0A 1TNSA 2K7LA 2KDOA 4MFDA 1WHUA 5LD2C 2FOKA 2R7VA 1BM9A 4KMFA 3L2VA 1MW7A 5ICCA 3BG5A 3DTKA 2GM4A 2E5ZA 3FM5A 3W6KB 3A0HC 2DFIA 2XROA 2GWRA 1Z0XA 4PGGA 3ROUA 3FXUA 1HW5A 1Z7UA 2FQ3A 1GXPA 1WJAA 4HLYA 2R7OA 1UHSA 2KJCA 5BS6A 2W84A 3Q5FA 3FM3A 1OYYA 2YR2A 3DTIA 2OBPA 4B47A 2JN6A 3ZQHA 4EATA 2PMHA 4L5JA 4XL9A 1X4PA 2EWNA 4GYIA 1LUJB 4OOIA 5GPAA 1WVRA 2IS2A 1FTTA 3N4MA 2FXAA 3DKXA 4CYCA 4XONA 1UJ8A 4YIRX 2MD5A 3HGYA 4BL0B 1SVLA 4F91B 2M9HA 4UUSA 1KU7A 2DJNA 3PO2J 1KQ9A 3PSIA 3RKWA 2RKHA 2L01A 1UCRA 2OQGA 2PG4A 2TRTA 3OYIA 2ADUA 2HYGD 4IJAA 3ZQQA 3FHNA 1Z6TA 2R7RA 1FBUA 1TW2A 2OA4A 3CCSI 5E8GA 1KONA 4HW0A 4C3JJ 4CCJA 2H1LA 1ETXA 4L9TA 1Z05A 2XAFA 1HW2A 2LDUA 1DGWY 1T95A 2NVYJ 4M3DA 4ESBA 2L7ZA 3LA3A 3GZ6A 2YU9J 1F5TA 2VC1A 3GTLJ 2H27A 4HNVA 2LVSA 1FOXA 1SAXA 2OZ6A 1EH8A 2IS6A 3NRVA 1EKEA 3GLLA 1U5TA 3IKVA 2V7FA 3BR5A 3E6BA 4F92B 2NYXA 2OZUA 5DM7F 4KDPA 3GW2A 2IS1A 4IHSA 2XIGA 1ETOA 5M5YJ 2KHMA 4G7HF 1AWCA 4HLXA 1SFOJ 1ULYA 3OOUA 5FROA 5ILUA 2XPUA 2MYSA 5L3BA 2PN6A 5EF6A 2M2EA 3JRHA 1IG7A 3FBIB 3GWZA 3OY9A 1FOWA 2EZKA 2Q2EB 2L5QA 5IT3A 3CDHA 1U0JA 2LBFB 3Q9VA 4NC7A 3TEDA 1DP7P 4RB0A 3AG3H 3ULQB 1YYVA 2Y0MA 2HKXA 2E2HJ 3RI4A 3CCRI 2MBFA 5FKKA 1K6YA 4EJTA 2HGCA 2PJPA 2DA1A 3U1DA 5F0CA 3N97A 4JX6A 5LHIA 1AKHA 2O6GE 4P55A 2L0KA 3WG7H 2LH9A 2UXXA 2G0EA 3TO7A 1VQ6I 3H92A 4HAMA 4Y3OA 2D45A 3L2RA 3LAJA 1WJFA 1MD0A 1OCPA 2DQLA 1HSJA 2PFBA 2RAEA 1HKSA 1WJDA 3M8EA 1DPRA 5M3FJ 1GHCA 4IEJA 2NVQJ 4J00A 3PO3J 2DODA 1OR7C 2QQBA 4PGHA 2ZXHA 4XRSG 1REPC 3L2UA 3E1SA 3OL4A 4A3JJ 5D5XB 1S29A 2LC2A 5TISC 2BXYA 3BCAA 5E8IA 2A05A 5J47A 2K4BA 1X58A 4CICA 4XK4A 2LNBA 1G2HA 1BI3A 2XB0X 2Y75A 3OYFA 2P81A 1HF0A 5HLHA 1FZPB 1IGNA 5EEAA 4B1RA 2ZJRF 3JRFA 2Z99A 2K9MA 3QAHA 2M45A 3I54A 3MKYB 5DUIA 2F2EA 3NARA 1UZCA 4YIFA 1IN8A 1HC8A 1SD5A 4RB3C 1O3RA 4RLFA 5DDGA 5BPDA 3HTSB 2TCTA 2DA6A 4XN0A 1FP1D 1R6RA 2JWTA 3OL3A 4KN4X 3H36A 1E3PA 4XNFA 2P5KA 2WTEA 2E60A 3ZOBA 1LDJA 2AXLA 2LF7A 1IV6A 3RTRA 2HTSA 1XMAA 3HOSA 4RGUA 3PNVA 2AO9A 2DW4A 2JT1A 1GUUA 1K78B 4G12A 4KICA 4E7ZA 2HI3A 2I5UA 3BPVA 2X1DA 3HKZA 5DUKA 3LL7A 1W7PA 3E6MA 1FJLA 1P2FA 4P96A 2QQ9A 4NC6A 2BE5F 5CVJA 2K40A 3HG9A 2PMUA 1CF7B 2P4WA 4LK0F 2CUZA 4EVIA 2ZJQF 4OU0A 1JUPA 2LP0A 5DYMA 1CGPA 3GX4X 3RKQA 1LDKB 3QP5A 4EQQA 1MBEA 2HXIA 4KIGA 2QEXI 3CC7I 4EJVA 4OMYA 4UY8I 1I5ZA 1VQ4I 2E1NA 1RETA 3BG6A 1JT0A 3SDGA 1R71A 3G1LA 4HX8A 2JA7J 4BE2A 2VJ5A 4OAZA 2X9DA 4EEFG 1Y56A 1FMWA 1B4AA 2Y0SN 3IHUA 3RDIA 2B9SA 4LG3A 1A31A 2DU9A 2VBWA 2P6SA 2K4JA 1LDDA 1A6QA 1HQCA 1S8NA 1DP3A 1EA3A 2D5VA 2ZXJA 3VODA 2DXIA 2R7SA 3GFMA 1WJ5A 3KZIC 4Q47A 2DA2A 2K86A 4YRVA 4BGDA 4AIJA 4HF2A 4ZC3A 4UVAA 3RPUA 1D3YA 3CUQB 2F5EA 4ZH4F 4U0YA 5D4SA 1T8IA 3E5XA 2F48A 3E5QA 4B3AA 3GTQJ 5LEKA 1MH4A 1XDUA 4Y7NJ 2DA3A 3VEPA 1FOKA 3CJRB 4BJTA 2STWA 4M9XA 4U0VA 3L7WA 1WFXA 2VBXA 2PX9A 3OR2C 1LEBA 5E18F 5LRSA 2DMNA 2W1OA 3JR9A 1HOMA 3MN2A 3M4OJ 2R93J 3BTIA 1Z1DA 4I6ZA 4RLQA 2HOAA 3HOTA 5LEJA 2XAHA 5JVGF 5DTDA 5JLWA 3BG9A 4M3BA 3K4CA 1S5LC 1F4KA 2D2WA 3S32A 2L9VA 2RGVA 2XF5A 3EQLF 2R7UA 2M3AA 3TW6A 4M9SA 5F08A 4B43A 2KFDA 3HRTA 2J5OA 2QSFX 2NNYA 2KKOA 1T33A 2LF8A 1FMVA 2NVTJ 4OIRF 4BHPA 1UHMA 2QQAA 5DD4A 2XPVA 1X3ZB 1LQ1A 3CESA 1P7IA 2M0CA 4DBQA 4IOAF 2DDAA 1B6AA 3V7SA 1ZYRF 3SEZA 4I09A 1WPKA 1I50J 1YHQI 3Q3SA 3DTEA 1PYVA 2Q0OA 3M07A 4E7SA 1WH5A 2RVCA 1QQIA 1NTCA 1YQAA 3OIOA 1JGGA 2R3SA 2KQRA 4G6QA 4MO7A 4C3HJ 4I02A 5FJ8J 1LKXA 5CJ9A 2O03A 2HDDA 3I59A 4ANJA 3V8KA 4JX5A 3W6VA 5E3MA 5KNLA 4AD9A 3JRBA 3BTJA 5GAEJ 3EUKL 2L3DA 4S05A 1Y1WJ 3WGGA 2NS0A 3CCEI 1WCMJ 1V3FA 2FUG2 4HG2A 1IW7F 1MBGA 3S8PA 1HSTA 2CJJA 3ASNH 4ZYEA 1L3LA 1TNTA 3JTHA 1FC3A 3T8TA 4HDUA 1W4MA 2WWYA 1BN5A 4F3QA 4HBLA 4PJMA 3TBIA 1QZZA 2VKEA 3BPXA 1MNEA 2DK5A 1Z77A 1LB2A 2DT5A 3KX2A 4BQAA 3R61A 4B3XA 1DGRM 1T39A 3VFZA 3L2WA 1RI7A 2JK3A 1TWCJ 3TO6A 4WXCA 3BG3A 1Z67A 3ZGKA 1Z91A 2WAQN 1X1DA 3WTXC 3PFYA 1Y6IA 3KE2A 5CVIA 4KNYA 5IP9J 3V8JA 2E1MB 1BW6A 2VXZA 5F27A 2CQ7A 4I99C 4AVPA 3QYBA 4E7KA 3G1OA 4GCVA 1MJ9A 3DQVC 2KIUA 1NH3A 4ZDOA 2Z1DA 2CMPA 4XLCA 3G4SI 2JPCA 3RCOA 5D8KB 3FHZA 3D0SA 4AIKA 2ETHA 2V26A 2VKDA 3L2CA 4LIUA 4RBOA 2RQPA 4QTRA 3MZHA 1YJWI 1BW5A 4A0XA 4MIMA 4HNUA 3WU2C 4ZJZA 3F8BA 2EJRA 1QHGA 1RKTA 3WTVC 2E7WA 3GO5A 1ZGWA 2HVSA 3JW4A 4AU7A 5L3GA 4MFEA 3TDZC 2FQ4A 3LQQA 1MDMA 1QU3A 4V2GA 3I4MJ 3OYJA 4I01A 3ZMSA 3KZYA 4JX4A 3DFGA 2ZJ2A 3FX3A 2CV0A 2E1MC 1IF1A 2VJJA 4PFOA 4A69C 3CCQI 1PVEA 3G6EI 1B72B 2BZTA 3L1PA 4I98B 2XPWA 1NK2P 1XD7A 2FOWA 3A0BC 3LA7A 1XC5A 1YI2I 2CW8A 1T6SA 3A01A 5C4XJ 3W6JB 4P9UA 3OSFA 2R5ZB 2Y9ZA 1K61A 3FMSA 3K69A 1LFUP 2X1EA 2MLKA 1NHAA 3S16J 3S1RJ 3SEQA 2VXDA 1YG2A 1MGTA 3E6DA 4M74A 4XLNF 2DI3A 4FX0A 2L9RA 3GTJJ 1GVDA 4Z2YA 1PP8F 3CC4I 4BAYA 4A3GJ 4LJZF 4AWXB 2AHQA 4DZPA 5B66C 2A6HF 3O8GA 4LGWA 5FB2A 3OS2A 1O3SA 3GZ5A 4EMSA 1YW7A 3QP6A 1VQMI 2COBA 4RGSA 1WKMA 1JHHA 1Z3XA 2OV7A 5KAFC 1IO2A 3LA2A 1R1UA 4ZYGA 5BQTA 4EM1A 2CFXA 3IAM2 3B6CA 1D5VA 1RC9A 1Z9CA 3KZZA 3C18A 4CHUA 2JRTA 2V1UA 3BR2A 5HODA 1FSEA 3R4KA 1IRZA 4G94A 4M3EA 3KP4A 2FX0A 2VL8A 1ETKA 2QBYB 3HSFA 4JBAA 4NQWB 4B44A 2JQ7A 1J09A 2A3SA 3H0DA 3W2AA 1YITI 3E97A 3WGIA 2PJRA 2VQCA 5ILVA 2R4GA 1ZELA 2STTA 5GTHC 1K4SA 2F4OB 1ETQA 3HHGA 3KPHA 4QIWN 2HS5A 3UNGC 5E3LA 1F43A 2LRDA 4WXDA 3HOZJ 4CH7A 2M8GX 1ZR4A 1XMXA
chains in the Genus database with same CATH topology
5IOYA 2VUMJ 2TRTA 4MLOA 3RZDJ 1A6IA 1U9OA 2R5YA 3UKGA 3IH4A 4A3MJ 3BTCA 1QVTA 2WB1N 3ZQLA 4B4CA 1JTXA 3S2HJ 2LK2A 4C3JJ 2DMQA 2LLKA 5K7HA 4IHXA 1ETXA 1RKWA 2NVYJ 4M3DA 3CCYA 2L7ZA 1U8BA 5F0HA 2YU9J 1POGA 3GTPJ 3WHBA 1GT0C 1JKRC 3C2BA 3GTLJ 4HNVA 2LVSA 2VKVA 2DMPA 1WI3A 2ECBA 4A93J 3DEWA 1LFBA 2O8KA 1ZKGA 4D7MA 2DMUA 2GBYA 2HXOA 3BR5A 3A01B 5EG0B 5IYCJ 1MNMC 1FTZA 1MSEC 3SFIA 1ETOA 5M5YJ 3D1NI 1SFOJ 5IOZA 3BQZA 3OOUA 5C3EJ 2MGQA 2EBIA 2XPUA 3JRGA 1AHDP 5EF6A 2M2EA 2Y30A 3JRHA 1IG7A 1TWGJ 5IPAA 4M6VA 2X48A 2EZKA 1BA5A 3H3VK 5K7ZA 3LSRA 2DA7A 4UUTA 3JRIA 1B8IB 1TWAJ 1HCRA 5FKNA 3TEDA 2EZIA 2FJ1A 4JYKA 4BBSJ 1EF4A 2FD5A 2XSDC 2E2HJ 3PM1A 5FKKA 2NVXJ 3HOUJ 4NDLA 1ITYA 2DA1A 1H8AC 5F0CA 1YRNA 4JX6A 4DZJA 2PMZN 1AKHA 2L0KA 5FKLA 3JREA 2ID6A 1UMQA 2CQQA 2DA4A 2G0EA 3LNQA 1E3OC 4A3KJ 1A5JA 4FE4A 1JJ8C 4JP0A 5C4JJ 2R92J 4X6AJ 9ANTA 1OCPA 3QQAA 1FIPA 2RAEA 5C44J 1FIAA 2LKXA 1U9NA 5M3FJ 1JT6A 4IEJA 2NVQJ 2R0QC 3PO3J 4XRSG 3IH2A 3HOYJ 4CYCB 3DCFA 2R7ZJ 4A3JJ 3S1NJ 4UUSB 5F0FA 3ZQCA 1X58A 3I4NJ 4XK4A 2CUEA 1G2HA 2E19A 1F36A 2XB0X 1XS9A 4LOCA 2P81A 1HF0A 3TP0A 5BNGA 2R5YB 1JKQC 1IGNA 5EEAA 4B1RA 2LY9A 1U78A 2B63J 4A3LJ 4X1EA 3JRFA 2CU7A 4C3IJ 1DU0A 1JUSA 1JKOC 3NARA 2XGCA 1MBKA 2Y31A 3VPRA 1MBHA 2KT0A 3HKZN 2E1OA 2TCTA 2DA6A 3HOVJ 5FKMA 2JWTA 2JJ7A 5EZHA 5FLMJ 3HGGA 4XRMA 3ZOBA 1X2MA 3Q0UA 1I3QJ 1IV6A 1TWHJ 1TWFJ 2DMTA 4I76A 5M5WJ 2AO9A 3FK6A 1HDPA 1GUUA 4G12A 4L5EA 2HQ5A 2ME6A 2HI3A 4V2FA 1FJLA 4AC0A 2H1KA 2LD5A 1WH7A 1JUMA 2DN0A 2K40A 3BR1A 1S7EA 2XB5A 4J19A 1MH3A 2L7FP 2O9LA 1PUFA 1VNDA 5FKOA 2IEKA 1JUPA 2LP0A 2VPRA 3A03A 4RDUA 3RKQA 2M34A 1MBEA 2HXIA 2MW8A 1W0UA 3M3YJ 1ZTRA 1APLC 1OJLA 1LE8A 5M5XJ 3MKLA 1RETA 1JT0A 4A3DJ 1ORKA 3SDGA 3CMYA 3G1LA 3FIWA 2JA7J 3GTGJ 1ENHA 1HDDC 2LFBA 2X9DA 4BBRJ 4EEFG 3OSGA 2Y0SN 1IC8A 1YRNB 1AKHB 4S0HB 1Q1VA 1UG2A 2E2IJ 1SANA 1BJZA 3ZQFA 2D5VA 2EZHA 2YS9A 2OF7A 2DA2A 2KDZA 4D7NA 5E3OA 4A3FJ 2N8GA 4IHWA 2X6OA 4QSHA 1NK3P 4B3AA 3GTQJ 2HOSA 2NOGA 1MH4A 1IJWC 2XGDA 4Y7NJ 2DA3A 1ETWA 5EGOA 3HEFA 1Y1VJ 2DMNA 4A3IJ 3JR9A 2JA6J 3GTKJ 2I10A 3MN2A 2JA8J 4AYBN 3M4OJ 1HOMA 2R93J 4D5FA 2EZLA 5EZGA 3BTIA 5GPCA 4I6ZA 2HOAA 3GTOJ 1HLVA 5DTDA 5JLWA 1ZR2A 4XRSA 3BG9A 4M3BA 1ETVA 1H88C 3S14J 5IYDJ 1R9TJ 4D5CA 1RESA 1AU7A 2H8RA 3RQIA 1QVUA 1I6HJ 3TW6A 2CUFA 2WV1A 5IYBJ 5FLVA 5F08A 4AUXA 2MSYA 3BR0A 3CQZJ 3S1MJ 2JMWA 1T56A 3BT9A 3S15J 1T33A 4A3CJ 2NVTJ 4BY1J 3QPLA 1VI0A 2LTPA 3S2DJ 2K9QA 2XPVA 3HM5A 4BY7J 5JLXA 1P7IA 4FE7A 2E2JJ 2M0CA 3GTMJ 2XRLA 2NS7A 3FK7A 3RZOJ 3BQYA 1WPKA 1I50J 3Q0VA 4Y52J 3O8HA 3Q3SA 1WH5A 1B72A 1NTCA 2EH3A 3NAUA 1PUFB 5M3MJ 4W97A 3OIOA 2NS8A 1JGGA 3FISA 3JRCA 4W1UA 3F0CA 4MO7A 4C3HJ 2MG4A 5FJ8J 4ABZA 2R5ZA 1LE8B 1H89C 2HDDA 3H0GJ 4JX5A 3W6VA 3FKIJ 5F04A 5IP6A 1VF9A 1FEXA 5E3NA 5E3MA 3JRBA 3BTJA 1ZK8A 3JRDA 4FCYA 2OPTA 1Y1WJ 2YUSA 3QPSA 2GLOA 1WCMJ 1MBGA 2CJJA 2K9SA 1JTYA 3WHCA 3HOXJ 2W48A 4BKXA 1OFCX 1QRYA 5J1UA 2LR8A 4DYCA 2VKEA 3ZQIA 1GV5A 4DYRA 1Z77A 2QF7A 5IP7J 3S17J 2JK3A 4XICA 1TWCJ 4DYQA 1MSFC 3BG3A 2WAQN 5EGOB 1P7JA 2ME0A 2O7OA 1OCTC 5IP9J 4GFBA 2QCOA 1BW6A 2ZB9A 1MBJA 5F27A 3BR6A 1RR7A 1IDZA 3G1OA 3G1MA 3HBLA 5K7FA 4FISA 2Y2ZA 1MBFA 1XG1A 1VFCA 3E7LA 5EYRA 1X2NA 2JA5J 4M3FA 5GP9A 3BR3A 3HOWJ 1IDYA 5DS9A 2ELKA 1JJ6C 1QPIA 3IH3A 1DU6A 2DTZA 5EDNA 4RBOA 3LSJA 4QTRA 1BW5A 4MIMA 1GV2A 1RKTA 1ZGWA 4XIDA 3SJMA 4IHVA 3HB9A 4MFEA 3TW7A 4FTHA 2FQ4A 2HYJA 2VI6A 2Y9YA 4V2GA 3I4MJ 3Q0WA 4JX4A 3BTLA 3HDDA 1W0TA 4A69C 1B72B 3L1PA 2XPWA 1NK2P 1XC5A 2IAIA 3CDLA 2CRGA 1CQTA 4IHYA 3S1QJ 1ETYA 2EQRA 3A01A 5C4XJ 2K9NA 3A02A 1O4XA 5EG0A 3OSFA 3IV5A 2R5ZB 1RPWA 3LSPA 2Y9ZA 1K61A 1LFUP 4A3BJ 3JRAA 3S16J 1IUFA 4C2MJ 3S1RJ 3GBGA 3GTJJ 1GDTA 2L7MP 2L9RA 1GVDA 4A3GJ 1K83J 5F1JA 2AHQA 4DZPA 3O8GA 2DA5A 1B8IA 5J1RA 2COBA 4A3EJ 3B6AA 2ECCA 3TP3A 4MFDA 1WGXA 1D5YA 3B6CA 3BG5A 4M3GA 2GM4A 3K7AJ 1Z0XA 3BR2A 5HODA 3ZQGA 1IRZA 4M3EA 2FX0A 1ETKA 1UHSA 2HOTA 1TC3C 2JN6A 3ZQHA 2XGEA 3K2AA 5J1YA 3LOCA 5GPAA 1FTTA 2CQXA 4CYCA 1ETQA 1JKPC 1BL0A 2IBDA 3HGYA 4QIWN 3MVPA 5J3LA 5E3LA 4UUSA 1ZQ3P 2M9HA 3PO2J 1F43A 2DJNA 2ID3A 3HOZJ 2M8GX 4BXXJ 1ZR4A 4DW6A 3LSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOY A;  2VUM J;  2TRT A;  4MLO A;  3RZD J;  1A6I A;  1U9O A;  2R5Y A;  3UKG A;  3IH4 A;  4A3M J;  3BTC A;  1QVT A;  2WB1 N;  3ZQL A;  4B4C A;  1JTX A;  3S2H J;  2LK2 A;  4C3J J;  2DMQ A;  2LLK A;  5K7H A;  4IHX A;  1ETX A;  1RKW A;  2NVY J;  4M3D A;  3CCY A;  2L7Z A;  1U8B A;  5F0H A;  2YU9 J;  1POG A;  3GTP J;  3WHB A;  1GT0 C;  1JKR C;  3C2B A;  3GTL J;  4HNV A;  2LVS A;  2VKV A;  2DMP A;  1WI3 A;  2ECB A;  4A93 J;  3DEW A;  1LFB A;  2O8K A;  1ZKG A;  4D7M A;  2DMU A;  2GBY A;  2HXO A;  3BR5 A;  3A01 B;  5EG0 B;  5IYC J;  1MNM C;  1FTZ A;  1MSE C;  3SFI A;  1ETO A;  5M5Y J;  3D1N I;  1SFO J;  5IOZ A;  3BQZ A;  3OOU A;  5C3E J;  2MGQ A;  2EBI A;  2XPU A;  3JRG A;  1AHD P;  5EF6 A;  2M2E A;  2Y30 A;  3JRH A;  1IG7 A;  1TWG J;  5IPA A;  4M6V A;  2X48 A;  2EZK A;  1BA5 A;  3H3V K;  5K7Z A;  3LSR A;  2DA7 A;  4UUT A;  3JRI A;  1B8I B;  1TWA J;  1HCR A;  5FKN A;  3TED A;  2EZI A;  2FJ1 A;  4JYK A;  4BBS J;  1EF4 A;  2FD5 A;  2XSD C;  2E2H J;  3PM1 A;  5FKK A;  2NVX J;  3HOU J;  4NDL A;  1ITY A;  2DA1 A;  1H8A C;  5F0C A;  1YRN A;  4JX6 A;  4DZJ A;  2PMZ N;  1AKH A;  2L0K A;  5FKL A;  3JRE A;  2ID6 A;  1UMQ A;  2CQQ A;  2DA4 A;  2G0E A;  3LNQ A;  1E3O C;  4A3K J;  1A5J A;  4FE4 A;  1JJ8 C;  4JP0 A;  5C4J J;  2R92 J;  4X6A J;  9ANT A;  1OCP A;  3QQA A;  1FIP A;  2RAE A;  5C44 J;  1FIA A;  2LKX A;  1U9N A;  5M3F J;  1JT6 A;  4IEJ A;  2NVQ J;  2R0Q C;  3PO3 J;  4XRS G;  3IH2 A;  3HOY J;  4CYC B;  3DCF A;  2R7Z J;  4A3J J;  3S1N J;  4UUS B;  5F0F A;  3ZQC A;  1X58 A;  3I4N J;  4XK4 A;  2CUE A;  1G2H A;  2E19 A;  1F36 A;  2XB0 X;  1XS9 A;  4LOC A;  2P81 A;  1HF0 A;  3TP0 A;  5BNG A;  2R5Y B;  1JKQ C;  1IGN A;  5EEA A;  4B1R A;  2LY9 A;  1U78 A;  2B63 J;  4A3L J;  4X1E A;  3JRF A;  2CU7 A;  4C3I J;  1DU0 A;  1JUS A;  1JKO C;  3NAR A;  2XGC A;  1MBK A;  2Y31 A;  3VPR A;  1MBH A;  2KT0 A;  3HKZ N;  2E1O A;  2TCT A;  2DA6 A;  3HOV J;  5FKM A;  2JWT A;  2JJ7 A;  5EZH A;  5FLM J;  3HGG A;  4XRM A;  3ZOB A;  1X2M A;  3Q0U A;  1I3Q J;  1IV6 A;  1TWH J;  1TWF J;  2DMT A;  4I76 A;  5M5W J;  2AO9 A;  3FK6 A;  1HDP A;  1GUU A;  4G12 A;  4L5E A;  2HQ5 A;  2ME6 A;  2HI3 A;  4V2F A;  1FJL A;  4AC0 A;  2H1K A;  2LD5 A;  1WH7 A;  1JUM A;  2DN0 A;  2K40 A;  3BR1 A;  1S7E A;  2XB5 A;  4J19 A;  1MH3 A;  2L7F P;  2O9L A;  1PUF A;  1VND A;  5FKO A;  2IEK A;  1JUP A;  2LP0 A;  2VPR A;  3A03 A;  4RDU A;  3RKQ A;  2M34 A;  1MBE A;  2HXI A;  2MW8 A;  1W0U A;  3M3Y J;  1ZTR A;  1APL C;  1OJL A;  1LE8 A;  5M5X J;  3MKL A;  1RET A;  1JT0 A;  4A3D J;  1ORK A;  3SDG A;  3CMY A;  3G1L A;  3FIW A;  2JA7 J;  3GTG J;  1ENH A;  1HDD C;  2LFB A;  2X9D A;  4BBR J;  4EEF G;  3OSG A;  2Y0S N;  1IC8 A;  1YRN B;  1AKH B;  4S0H B;  1Q1V A;  1UG2 A;  2E2I J;  1SAN A;  1BJZ A;  3ZQF A;  2D5V A;  2EZH A;  2YS9 A;  2OF7 A;  2DA2 A;  2KDZ A;  4D7N A;  5E3O A;  4A3F J;  2N8G A;  4IHW A;  2X6O A;  4QSH A;  1NK3 P;  4B3A A;  3GTQ J;  2HOS A;  2NOG A;  1MH4 A;  1IJW C;  2XGD A;  4Y7N J;  2DA3 A;  1ETW A;  5EGO A;  3HEF A;  1Y1V J;  2DMN A;  4A3I J;  3JR9 A;  2JA6 J;  3GTK J;  2I10 A;  3MN2 A;  2JA8 J;  4AYB N;  3M4O J;  1HOM A;  2R93 J;  4D5F A;  2EZL A;  5EZG A;  3BTI A;  5GPC A;  4I6Z A;  2HOA A;  3GTO J;  1HLV A;  5DTD A;  5JLW A;  1ZR2 A;  4XRS A;  3BG9 A;  4M3B A;  1ETV A;  1H88 C;  3S14 J;  5IYD J;  1R9T J;  4D5C A;  1RES A;  1AU7 A;  2H8R A;  3RQI A;  1QVU A;  1I6H J;  3TW6 A;  2CUF A;  2WV1 A;  5IYB J;  5FLV A;  5F08 A;  4AUX A;  2MSY A;  3BR0 A;  3CQZ J;  3S1M J;  2JMW A;  1T56 A;  3BT9 A;  3S15 J;  1T33 A;  4A3C J;  2NVT J;  4BY1 J;  3QPL A;  1VI0 A;  2LTP A;  3S2D J;  2K9Q A;  2XPV A;  3HM5 A;  4BY7 J;  5JLX A;  1P7I A;  4FE7 A;  2E2J J;  2M0C A;  3GTM J;  2XRL A;  2NS7 A;  3FK7 A;  3RZO J;  3BQY A;  1WPK A;  1I50 J;  3Q0V A;  4Y52 J;  3O8H A;  3Q3S A;  1WH5 A;  1B72 A;  1NTC A;  2EH3 A;  3NAU A;  1PUF B;  5M3M J;  4W97 A;  3OIO A;  2NS8 A;  1JGG A;  3FIS A;  3JRC A;  4W1U A;  3F0C A;  4MO7 A;  4C3H J;  2MG4 A;  5FJ8 J;  4ABZ A;  2R5Z A;  1LE8 B;  1H89 C;  2HDD A;  3H0G J;  4JX5 A;  3W6V A;  3FKI J;  5F04 A;  5IP6 A;  1VF9 A;  1FEX A;  5E3N A;  5E3M A;  3JRB A;  3BTJ A;  1ZK8 A;  3JRD A;  4FCY A;  2OPT A;  1Y1W J;  2YUS A;  3QPS A;  2GLO A;  1WCM J;  1MBG A;  2CJJ A;  2K9S A;  1JTY A;  3WHC A;  3HOX J;  2W48 A;  4BKX A;  1OFC X;  1QRY A;  5J1U A;  2LR8 A;  4DYC A;  2VKE A;  3ZQI A;  1GV5 A;  4DYR A;  1Z77 A;  2QF7 A;  5IP7 J;  3S17 J;  2JK3 A;  4XIC A;  1TWC J;  4DYQ A;  1MSF C;  3BG3 A;  2WAQ N;  5EGO B;  1P7J A;  2ME0 A;  2O7O A;  1OCT C;  5IP9 J;  4GFB A;  2QCO A;  1BW6 A;  2ZB9 A;  1MBJ A;  5F27 A;  3BR6 A;  1RR7 A;  1IDZ A;  3G1O A;  3G1M A;  3HBL A;  5K7F A;  4FIS A;  2Y2Z A;  1MBF A;  1XG1 A;  1VFC A;  3E7L A;  5EYR A;  1X2N A;  2JA5 J;  4M3F A;  5GP9 A;  3BR3 A;  3HOW J;  1IDY A;  5DS9 A;  2ELK A;  1JJ6 C;  1QPI A;  3IH3 A;  1DU6 A;  2DTZ A;  5EDN A;  4RBO A;  3LSJ A;  4QTR A;  1BW5 A;  4MIM A;  1GV2 A;  1RKT A;  1ZGW A;  4XID A;  3SJM A;  4IHV A;  3HB9 A;  4MFE A;  3TW7 A;  4FTH A;  2FQ4 A;  2HYJ A;  2VI6 A;  2Y9Y A;  4V2G A;  3I4M J;  3Q0W A;  4JX4 A;  3BTL A;  3HDD A;  1W0T A;  4A69 C;  1B72 B;  3L1P A;  2XPW A;  1NK2 P;  1XC5 A;  2IAI A;  3CDL A;  2CRG A;  1CQT A;  4IHY A;  3S1Q J;  1ETY A;  2EQR A;  3A01 A;  5C4X J;  2K9N A;  3A02 A;  1O4X A;  5EG0 A;  3OSF A;  3IV5 A;  2R5Z B;  1RPW A;  3LSP A;  2Y9Z A;  1K61 A;  1LFU P;  4A3B J;  3JRA A;  3S16 J;  1IUF A;  4C2M J;  3S1R J;  3GBG A;  3GTJ J;  1GDT A;  2L7M P;  2L9R A;  1GVD A;  4A3G J;  1K83 J;  5F1J A;  2AHQ A;  4DZP A;  3O8G A;  2DA5 A;  1B8I A;  5J1R A;  2COB A;  4A3E J;  3B6A A;  2ECC A;  3TP3 A;  4MFD A;  1WGX A;  1D5Y A;  3B6C A;  3BG5 A;  4M3G A;  2GM4 A;  3K7A J;  1Z0X A;  3BR2 A;  5HOD A;  3ZQG A;  1IRZ A;  4M3E A;  2FX0 A;  1ETK A;  1UHS A;  2HOT A;  1TC3 C;  2JN6 A;  3ZQH A;  2XGE A;  3K2A A;  5J1Y A;  3LOC A;  5GPA A;  1FTT A;  2CQX A;  4CYC A;  1ETQ A;  1JKP C;  1BL0 A;  2IBD A;  3HGY A;  4QIW N;  3MVP A;  5J3L A;  5E3L A;  4UUS A;  1ZQ3 P;  2M9H A;  3PO2 J;  1F43 A;  2DJN A;  2ID3 A;  3HOZ J;  2M8G X;  4BXX J;  1ZR4 A;  4DW6 A;  3LSG A; 
#chains in the Genus database with same CATH topology
 1MMD A;  2DPD A;  3RZD J;  1A6I A;  1U9O A;  2OD5 A;  1B9N A;  2YX7 A;  3UKG A;  3LSI A;  3BTC A;  4B4C A;  4YFN F;  2QYO A;  2ZSI B;  1I1S A;  2GOX B;  3HPH A;  2LK2 A;  3FXK A;  3ZP5 A;  4H4K C;  3KEO A;  4A6E A;  5HDN A;  2LLK A;  5K7H A;  2Y48 A;  4IHX A;  4HDV A;  5HOO A;  2OCE A;  3GEZ A;  3F6O A;  2RV8 A;  3ZRG A;  4MEY F;  3GFI A;  2KL4 A;  2ELJ A;  2MH2 A;  2FE3 A;  3CCY A;  2WAF A;  4EJW A;  1POG A;  2CYY A;  1GT0 C;  4CGZ A;  4XKV A;  2BVM A;  3IRR A;  2DMP A;  4NUB A;  3A4C A;  2EV5 A;  2I8D A;  2JSP A;  3DEW A;  1LFB A;  3VSL A;  2O8K A;  4D7M A;  3FXO A;  4U7D A;  1T38 A;  4FQG A;  2WAQ A;  3CMM A;  5EG0 B;  5IYC J;  1MNM C;  1O3Q A;  4FHT A;  1R23 A;  3PNY A;  4A5N A;  4K2E A;  2M8E A;  3H3U A;  2IT0 A;  4XLE A;  3OMY A;  2MGQ A;  3WGH A;  1AHD P;  4R79 A;  2DT7 B;  4KFC A;  2XHK A;  4P5O A;  1TWG J;  3RKX A;  2DOA A;  2YU3 A;  1WJB A;  2KRF A;  2G7H A;  1R5G A;  3BLY A;  3H3V K;  3LSR A;  3JRI A;  1YFH A;  1HKQ A;  4MGR A;  5K5R A;  1TWA J;  3BCB A;  1B8I B;  5CVU A;  2LG4 A;  4PUS A;  5FKN A;  5HNF A;  2EZI A;  4BBS J;  3I71 A;  3MEX A;  2K27 A;  2XSD C;  1JI8 A;  3P9K A;  3DU6 A;  2L2O A;  4XSZ F;  1ITY A;  1HXD A;  1YS6 A;  1V5E A;  1J2X A;  3M8F A;  1RR8 C;  1IRG A;  3B02 A;  4ESJ A;  2BY2 A;  1YRN A;  2JRM A;  5FKL A;  5IT9 K;  3GUD A;  1UMQ A;  2DA4 A;  2JUG A;  4Y13 A;  3LNQ A;  4IXA A;  1OLT A;  4IRH A;  1A5J A;  4X6A J;  3FWE A;  5C4J J;  1Z3Y A;  3AG2 H;  2CO5 A;  1SAU A;  1FIA A;  4I0B A;  2XDV A;  2R0Q C;  1UG0 A;  3COA C;  4I2O A;  4CYD A;  1BIB A;  5KCM A;  3IH2 A;  3DCF A;  3OYA A;  3S1N J;  2KIF A;  3BC8 A;  4CCN A;  4E70 A;  2PMZ A;  5F0F A;  2W4S A;  3ZQC A;  4F7Z A;  1OMI A;  4H0E A;  4QLC U;  4LFU A;  2GXG A;  1F36 A;  3ONQ A;  3CUO A;  3I0T A;  2R5Y B;  1JKQ C;  4KYW A;  2LY9 A;  1U78 A;  3FZV A;  1G3S A;  1XN7 A;  4C3I J;  1T0F A;  4HYE A;  1STZ A;  3NWT A;  1JUS A;  4NNJ A;  3T0Y A;  5TGT A;  1JKO C;  5TJJ A;  3J80 K;  1BR1 A;  4IQ4 A;  4PFP A;  3VPR A;  3HKZ N;  4XKW A;  2E1O A;  3HOV J;  1J59 A;  2BW3 B;  4KMU X;  5FKM A;  2DCE A;  2JJ7 A;  1R1V A;  2DQR A;  3UR3 C;  3ESW B;  2R7Q A;  2L4A A;  2WY8 Q;  1R4M B;  5M5W J;  1XPX A;  3CLQ A;  1MMN A;  2D1H A;  1QA6 A;  3J7Y J;  1HA8 A;  2M87 A;  5A2Q Z;  2M5W A;  1WH7 A;  3T8R A;  1E3H A;  2ZME A;  4LIV A;  4XOR A;  3BR1 A;  2L54 A;  1PUF A;  3JCU C;  1OQY A;  2IEK A;  2XGX A;  1RUN A;  2DYS H;  2VPR A;  3A03 A;  4OAY A;  4PK4 A;  3H5A A;  1WI9 A;  4UVC A;  2M34 A;  2ELH A;  2GA2 A;  3U1K A;  4J01 A;  2BY0 A;  3ZCO A;  3F8C A;  4ZDP A;  1ZTR A;  3M3Y J;  3KIO A;  3QOE A;  5M5X J;  1D0Z A;  4A3D J;  3KFW X;  4BQN A;  3FIW A;  4L9N A;  5LGU A;  2IPQ X;  1SMT A;  5KAI C;  1QNT A;  4BQQ A;  1N78 A;  2HQR A;  1HDD C;  3BZK A;  4LG0 A;  4IKF A;  3CF5 F;  1PDN C;  2G7U A;  4XOP A;  1TT0 A;  2NXN B;  1ON2 A;  1Q1V A;  4EJO A;  2VT3 A;  2E2I J;  2OJE D;  4DJA A;  3DEE A;  2BGC A;  1KGS A;  3I55 I;  5AIP A;  2EZH A;  3H9Q A;  2V1X A;  4O3M A;  1TZL A;  3SYT A;  3G71 I;  2KDZ A;  5E3O A;  3TOB A;  3F8M A;  2IGO A;  4A3F J;  1XB4 A;  3CME I;  5HLT A;  4QSH A;  1NK3 P;  4HX4 A;  3QYF A;  2HOS A;  1W36 D;  5DCF A;  1OPC A;  2ZFU A;  2LSO A;  4BXF A;  5EJC A;  3SQN A;  2KMU A;  3DXJ F;  5KVR A;  4D9J A;  1ZN2 A;  2NNN A;  1XMK A;  4BEH B;  1Y1V J;  1BIA A;  2GXA A;  4OWR B;  2JA8 J;  2HYF A;  1DQU A;  3FXJ A;  4ENJ A;  5EZG A;  3TGN A;  1ON1 A;  2F5D A;  1QBJ A;  3S14 J;  1ZR2 A;  3MAJ A;  1H88 C;  1ETV A;  3O6B B;  1I27 A;  4WX9 A;  3FF5 A;  1R9T J;  2JZY A;  2R7X A;  1RES A;  1AU7 A;  2H8R A;  1LEA A;  3RQI A;  4ZZD A;  1QVU A;  1Y8R B;  2QSH X;  2E1C A;  2Z16 A;  2W24 A;  1LVA A;  4B09 A;  3BR0 A;  3CQZ J;  1BOA A;  2O0Y A;  4BS9 A;  1TBX A;  3BT9 A;  3H35 A;  3S15 J;  4A3C J;  2VBY A;  4IRG A;  4RM3 A;  2CS3 A;  4C9Y A;  1IZ1 A;  1VI0 A;  4BY1 J;  3S2D J;  2K9Q A;  2KLO A;  3HM5 A;  1IXS B;  4BY7 J;  1Y39 A;  4FE7 A;  2DBB A;  3PIP F;  2GOM A;  2HOE A;  3VOE A;  3GTM J;  1D8J A;  3DPL C;  3FK7 A;  5GAD J;  3RZO J;  1DPU A;  3ZQ7 A;  2WA0 A;  1X1C A;  2FEZ A;  3BQY A;  2XAJ A;  1TT5 B;  3DKW A;  2LMD A;  3GLX A;  3K1M A;  3Q0V A;  5HS8 A;  4HZF A;  1IV8 A;  2FF4 A;  2F4I A;  2FNP A;  5D6F A;  1G59 A;  1K7A A;  5D5V B;  2JTV A;  2QKM B;  3WTY C;  3V7C A;  4ZTF A;  2M4G A;  2UXN A;  2GIV A;  2VOP A;  3DLL F;  1VZ0 A;  4ABZ A;  3BZ6 A;  1LE8 B;  2OTL I;  1J75 A;  5H6Q A;  3H0G J;  5GAH J;  1KU3 A;  1KYW A;  2HWV A;  1FEX A;  2ESN A;  2OQR A;  2DFH A;  2ZSH B;  5E3N A;  3H9G A;  2CUJ A;  2F4M B;  1ZK8 A;  3VSK A;  2OPT A;  2YUS A;  5DCM A;  2HZD A;  2A5Y B;  1K6O A;  2BHY A;  3K4L A;  5BPI A;  1UST A;  5J4V A;  5D4R A;  4IQJ A;  3K70 D;  2DK8 A;  2K9S A;  2VE9 A;  5FRM A;  2DFF A;  2AQE A;  1H9G A;  3WHC A;  1D8K A;  3HOX J;  2W48 A;  3LWF A;  3E3V A;  1YIO A;  2UUZ A;  2ZC2 A;  3K4N A;  4U88 A;  4DBR A;  4HQE A;  1QRY A;  5CKT A;  2H94 A;  4XKC A;  3ZQI A;  1XSV A;  1GV5 A;  3FMQ A;  4DYR A;  2L7K A;  2HEO A;  2DOE A;  5L3E A;  4BDZ A;  3BDD A;  2R7W A;  2BEO A;  2GZW A;  2LKS A;  1V4R A;  2MLG A;  3CJT B;  4IO9 F;  1YJN I;  2JSC A;  1IXR C;  5EGO B;  1P7J A;  2D1V A;  4HST A;  1OCT C;  4GFB A;  2PEX A;  2QCO A;  2VQL A;  4RGX A;  3BZC A;  3CTA A;  4II2 A;  3C1D A;  4GO1 A;  1RR7 A;  3ZN0 A;  1UHW A;  4WK8 F;  3G1M A;  3OIQ A;  5F64 A;  3OYG A;  2R7F A;  3CCV I;  5E17 F;  3EUA A;  5F1R A;  1N25 A;  1BOB A;  4FIS A;  1MBF A;  2VB6 A;  1R49 A;  4CUG A;  1TQM A;  3E7L A;  4XRF A;  1S6L A;  2VKH A;  2JA5 J;  4XM3 A;  5GP9 A;  5D5W B;  1F1Z A;  2OC6 A;  3M1E A;  5K1Y A;  3V8L A;  3HOW J;  1IDY A;  1XGM A;  1ZHF A;  2ELK A;  3HXL A;  3PUF A;  1DU6 A;  3BJ6 A;  2EV6 A;  2IGN A;  2P7C B;  4Q5S F;  1UAA A;  3H1C A;  2A6E F;  5J6X A;  1KQ0 A;  2V4J C;  4S04 A;  1R1T A;  4XID A;  2CSO A;  2JPB A;  3P7N A;  1FNN A;  3TW7 A;  4LLL A;  2VI6 A;  3CCU I;  2Y9Y A;  4CZC A;  2ICW G;  3KLN A;  3KP6 A;  4PJN A;  4BU2 A;  3OYD A;  1A35 A;  2PI0 A;  3BTL A;  1A36 A;  3ABK H;  3K1P A;  4CCL A;  3HDD A;  1RIO H;  3H5N A;  2EIN H;  1TW3 A;  1GLN A;  3WTZ A;  4DIQ A;  3F21 A;  2QZ8 A;  1MJB A;  2IAI A;  3CDL A;  3F72 A;  3F22 A;  1MIJ A;  2K9N A;  3A02 A;  1O4X A;  2PQ8 A;  2Z5U A;  2FBI A;  3DBH B;  2BYV E;  1XGN A;  3CUQ C;  1S3J A;  5LLQ A;  4A3B J;  4IOC F;  1XCV A;  1AOY A;  5E1X A;  3DPT A;  4C2M J;  1QO0 D;  1OR7 A;  3CD6 I;  1OKR A;  2L7M P;  3QPT A;  4P9F A;  2X6Y A;  2CQK A;  2BY1 A;  4YEJ A;  4WXH A;  2Q2E A;  3OYH A;  4U0W A;  3ASO H;  3CC2 I;  5J1R A;  3M9A A;  4M9Z A;  4M6Y A;  3W3C A;  4PJJ A;  1YO5 C;  2PBI A;  4A3E J;  3B6A A;  2ECC A;  3TP3 A;  4MQV A;  4RGR A;  2H09 A;  2ZCW A;  1D5Y A;  2B0L A;  2QGU A;  3V42 A;  2CWE A;  4XKB A;  1W1W E;  2CW0 F;  3P9C A;  2X4H A;  3ZQG A;  2FSW A;  1R5H A;  3ABL H;  1R5I D;  1BR2 A;  2HOT A;  5DD8 A;  4FX4 A;  3REO A;  1BBY A;  2XGE A;  3K2A A;  3BY6 A;  1IN5 A;  2LY1 A;  4Z6Y A;  1QZE A;  5DEQ A;  3OYL A;  3LOC A;  4C2U A;  3VDX A;  3KEQ A;  2E35 A;  2GIZ A;  2L4M A;  4GYG A;  4WWC A;  2PLY A;  1BL0 A;  2IBD A;  3MVP A;  2BBY A;  2Q8K A;  3HL2 A;  2K3P A;  1LFP A;  2M4K A;  4OIN F;  4I7H A;  3IRQ A;  3W2W A;  3WE3 A;  3LSG A;  2AXT C;  4EV0 A;  1OYI A;  4UB6 C;  2VUM J;  1O57 A;  4MLO A;  3LAP A;  1R36 A;  3OV8 A;  3IH4 A;  1WJE A;  4AID A;  3ZQL A;  2NOJ B;  2IGM A;  2QVO A;  1JTX A;  1XSD A;  5CQE A;  3S2H J;  3CJQ B;  3KET A;  5HDG A;  1J7K A;  2XC7 A;  2DMQ A;  4HF0 A;  4KT5 C;  3SFZ A;  3FKJ A;  3QPH A;  3WG9 A;  2K9L A;  4XLA A;  3CP8 A;  2RDP A;  4XMY A;  3EUH C;  2L9S A;  4C30 A;  4YFX F;  5F0H A;  1KA8 A;  3GTP J;  3WHB A;  3VB2 A;  2K02 A;  1BJA A;  3C2B A;  1E2X A;  1ODD A;  2ZXI A;  3F8F A;  4CCM A;  2WB1 A;  3LSM A;  3J81 Z;  2ECB A;  1ZH5 A;  5EEH A;  4A93 J;  4YEL A;  2GAU A;  1Y0U A;  4EM2 A;  4LLN A;  1P4X A;  5LHG A;  1JHF A;  2GBY A;  2GQQ A;  2HXO A;  1SEU A;  4LD5 A;  1K78 A;  1IUY A;  2CFO A;  2CGP A;  2M0M A;  2ZBK A;  4GRI A;  3KLO A;  1FTZ A;  1T2K A;  4RMN A;  4A0Z A;  2P5L C;  2V6E A;  5IOZ A;  3BQZ A;  4XQF A;  1XSX A;  2CQN A;  3RYR A;  2EBI A;  3JRG A;  3Q9S A;  1CF7 A;  3J81 K;  3K10 A;  2XVC A;  3OWT A;  3CCM I;  5IPA A;  3CF2 A;  2LRE A;  2X48 A;  1BA5 A;  3GME A;  5K7Z A;  3HUG B;  2DA7 A;  4UUT A;  2HQN A;  2KZG A;  1NG7 A;  2QUF A;  3JSO A;  5K5O A;  1HCR A;  2O3F A;  4UHT A;  5IY5 H;  2FJ1 A;  3ISP A;  2FD5 A;  3ABT A;  2KIM A;  3DEU A;  4RM2 A;  5D5U B;  4NC8 A;  5JHF A;  1KU9 A;  5B1A H;  3HOU J;  2IJL A;  4NDL A;  2NRA C;  2XKP A;  4GXO A;  3RJP A;  3SZT A;  2PMZ N;  3CZ6 A;  4PJ0 C;  3JRE A;  3LST A;  1QHH D;  2ID6 A;  2CQQ A;  3LSH A;  4MTE A;  4A3K J;  5HS9 A;  1ZG3 A;  4FE4 A;  1JJ8 C;  4JP0 A;  1BC8 C;  9ANT A;  4XLH A;  5ICG A;  1U2W A;  5C44 J;  5L3F A;  1U9N A;  1B1B A;  1A04 A;  1Z7L A;  1JT6 A;  1IRX A;  1S7O A;  3S3O A;  1S9H A;  1BI0 A;  3CUQ A;  2MD0 A;  2CW7 A;  3HOY J;  4CYC B;  2R7Z J;  4ZZL A;  1G3W A;  2FA5 A;  4E7L A;  4UUS B;  5LRR A;  2HVR A;  3D5S C;  3K2Z A;  2VIX A;  3S2W A;  2A07 F;  2GXB A;  1R7J A;  3R6S A;  3ECH A;  5HS7 A;  3OYN A;  2P6T A;  2V6C A;  4IRI A;  2W25 A;  2E19 A;  3BRO A;  3I56 I;  1KYZ A;  4LOC A;  5BNG A;  3CO7 C;  3T5X A;  3MCZ A;  4A3L J;  4BE1 A;  4X1E A;  2M1B A;  3I5U A;  5BOX A;  4ON0 A;  1DU0 A;  4CDG A;  1PUE E;  2XGC A;  3ABM H;  4BHB A;  3TQN A;  2O61 A;  1MBK A;  2Y31 A;  1MBH A;  3R0J A;  2MC3 A;  3SZP A;  4OIP F;  2HVQ A;  1SFX A;  1YE9 A;  2AQF A;  5FD5 A;  4EGZ A;  2E36 A;  3VYS B;  1ZG1 A;  2KRH A;  1W5T A;  2M30 A;  3KP3 A;  5ICF A;  2MH9 A;  4CCO A;  1V54 H;  2XF6 A;  4DOZ A;  5H2F C;  1I3Q J;  3OS0 A;  5K5Q A;  4WCG A;  4I76 A;  1G3T A;  3K9T A;  3DPU A;  2WV0 A;  1U5T B;  3FK6 A;  1HDP A;  3KYL A;  3T1B A;  4QPQ A;  2HQ5 A;  2ME6 A;  4E7J A;  3W2V A;  4HRI A;  2DJI A;  3FBN B;  4AC0 A;  5AIQ A;  2H1K A;  2QM3 A;  2IA0 A;  4P1W A;  2E5N A;  3O3K A;  1U8R A;  1JUM A;  1WQ2 A;  3MQ0 A;  5ICE A;  1S7E A;  3ELK A;  4GDF A;  1O3T A;  4LMY A;  4J19 A;  1FT9 A;  3J7A Y;  2O9L A;  4M72 A;  3FMR A;  3CDI A;  5FKO A;  4ZTJ A;  1SFU A;  1TTY A;  2VN2 A;  4HV6 A;  2MW8 A;  4XSX F;  3G3Z A;  2XRN A;  1P4A A;  2TDX A;  3DV8 A;  3RKY A;  3MKL A;  3BJA A;  4RB1 A;  3HTU A;  2RN7 A;  3CMY A;  2MFZ A;  2L02 A;  3FXR A;  5LFA A;  1ZGA A;  4QPO A;  3GTG J;  1ENH A;  5HDK A;  3H9J A;  5ERI A;  4IZZ A;  1BI1 A;  3L09 A;  4PSX A;  3OSG A;  2HQA A;  3WU0 A;  1AKH B;  2ESH A;  4HV5 A;  1UG2 A;  2DDB A;  1D1A A;  3I58 A;  3U9G A;  1SAN A;  1BJZ A;  3WTS C;  2OUM A;  3EYY A;  4LIT A;  1XGS A;  4MQ9 F;  3TO9 A;  1UB9 A;  1USS A;  5H20 A;  5JI6 A;  5CLS A;  2BV6 A;  3CJN A;  1BC7 C;  4D7N A;  3PQJ A;  1VQP I;  2EFQ A;  4IX7 A;  4YFK F;  3OIP A;  2QKL B;  1SMY F;  2N8G A;  2X6O A;  1KZH A;  4IHW A;  3EDP A;  2P0W A;  2NOG A;  5F6F A;  1VQL I;  2WBM A;  3HSE A;  3PL8 A;  4A2U A;  4L18 B;  5JR3 A;  2XAG A;  1X1B A;  2OCC H;  4G7O F;  3HEF A;  3I3L A;  5J40 A;  3OYC A;  3GTK J;  2I10 A;  4AYB N;  1X3U A;  5CPR B;  3F23 A;  4BUP A;  2EZL A;  1S72 I;  3CMA I;  1N77 A;  1U3E M;  3FXM A;  4XRS A;  5IYD J;  3HJE A;  3K4M A;  3U2R A;  1HW1 A;  1VTN C;  4ENM A;  3KP5 A;  3HRU A;  1W5S A;  2YX4 A;  2VOD A;  3C3W A;  1I6H J;  3FXL A;  2EFW A;  2CUF A;  2WV1 A;  5IYB J;  2MSY A;  1R22 A;  1MKM A;  1PJR A;  1T56 A;  1GVJ A;  3SHF A;  1W36 C;  2X85 A;  4N4N B;  2BY3 A;  3KYD B;  2VLA A;  1TLH B;  3MFK A;  5JLX A;  2E2J J;  2XAQ A;  2DPU A;  2NS7 A;  2VJI A;  3WE2 A;  1T98 A;  1WJC A;  2XUB A;  4FT8 A;  3IKT A;  2V9K A;  4EGY A;  1W7P B;  1B59 A;  4BE0 A;  3O8H A;  3AKZ A;  3G73 A;  2HR3 A;  2Z2S B;  1B72 A;  1WZ2 A;  2QLZ A;  1RNL A;  4R8H A;  3NAU A;  2VJ4 A;  2E34 A;  4JOM A;  4CSW A;  5M3M J;  3A2K A;  2IXS A;  5E79 C;  2KP6 A;  3FIS A;  4W1U A;  3F0C A;  2RNG A;  2MA3 A;  3E5U A;  1W5C C;  3GZN B;  4N4O B;  3ZMU A;  2R5Z A;  1H89 C;  1JXS A;  4BHC A;  4JK1 X;  4PSW A;  4KIT B;  2RNJ A;  4O5V A;  4PJL A;  4AIH A;  5TRD A;  4Y4R A;  3DU5 A;  3CO6 C;  3AG4 H;  3DBR B;  2EA2 A;  3TMO A;  4Y17 A;  2GLO A;  2DTR A;  1XCB A;  5LBQ A;  3DBL B;  2FU4 A;  4D1Q A;  3PJR A;  2IA1 A;  2DLL A;  3PFI A;  4QWQ A;  2E71 A;  2EIM H;  3I64 A;  1JTY A;  1MMG A;  3V7R A;  2V9V A;  3IP4 B;  1VQ8 I;  4BKX A;  1OFC X;  3S3N A;  2Z3Y A;  4A12 A;  5FFX A;  1SC7 A;  2LR8 A;  4DYC A;  2J5P A;  3ECO A;  2H6B A;  2QF7 A;  2YPR A;  5IP7 J;  1VQ9 I;  2VBZ A;  3S17 J;  4G7Z F;  2V1D A;  3K4K A;  2QBY A;  1TP4 A;  4DYQ A;  1MSF C;  4NQW A;  5A2Q K;  1G4D A;  1Y0N A;  2A5W A;  3IUO A;  1RRJ A;  2DAO A;  1ZLK A;  2ZB9 A;  1WRJ A;  5L3D A;  2KIS A;  2GA1 A;  1X3W B;  3BR6 A;  2CV2 A;  3I53 A;  1ZRD A;  3HBL A;  2QEN A;  3D5R C;  5K7F A;  3K70 C;  1FLI A;  1VFC A;  1BI2 A;  3K4B A;  5EYR A;  1X2N A;  1I3A A;  2M7B A;  4M3F A;  3WTW C;  2JVG A;  4BNC A;  1G6N A;  4ZDL A;  4BH9 A;  3SZG A;  4G8X A;  3GVA A;  5DS9 A;  4RA2 A;  1R4N B;  3PIO F;  3IH3 A;  2DTZ A;  5B3S H;  1P6R A;  4A6D A;  5EDN A;  4E7I A;  4A5M A;  3ZMT A;  1OCR H;  1YS7 A;  3LSJ A;  4ENN A;  2HDC A;  1GV2 A;  1YW9 A;  2OAZ A;  1T08 B;  5H6R A;  3TOA A;  5J4Y A;  3V4G A;  3O2P E;  3ZMV A;  3HB9 A;  3KCC A;  3ZN1 A;  1R58 A;  4FTH A;  3QU3 A;  1K4T A;  2HYJ A;  4V19 K;  1E0E A;  4IL6 C;  3PNT A;  3WTU C;  3HRS A;  1R00 A;  3EET A;  4U7B A;  3Q0W A;  4FET A;  4YG2 F;  2WAD A;  2VQH A;  3WU1 B;  2P7V B;  1W0T A;  3J7A O;  4KUM A;  3IAS 2;  4BXU A;  2VON A;  1VQO I;  2XSJ C;  3FDY A;  2V79 A;  1HKT A;  1CQT A;  4M6X A;  2CRG A;  3S1Q J;  4B48 A;  1FYL A;  2EQR A;  3F6V A;  1F9N A;  3MD2 A;  4G9Y A;  5EG0 A;  2NVU B;  5FLX Z;  1YX3 A;  1FP2 A;  1FSH A;  4AYB A;  3NEU A;  2KRC A;  1ACI A;  3LSP A;  4C2T A;  4RAZ A;  1SD7 A;  3I59 B;  4BJ5 C;  1IUF A;  3F9K A;  3QOD A;  2O8X A;  1GDT A;  4XR6 A;  4MNU A;  4CA0 A;  4M73 A;  2DFE A;  1K83 J;  5F1J A;  4L0Z B;  5CYV A;  5FD6 A;  4UVB A;  1B8I A;  3ABU A;  1W7P D;  5FRN A;  4HEA 2;  1IXC A;  1LVK A;  5FLX K;  1G3Y A;  3EYI A;  5E1W A;  2EFP A;  3HZJ A;  3LSK A;  3AAF A;  1WGX A;  1VQ7 I;  2DYR H;  4M3G A;  4UNO A;  4ASN A;  3K7A J;  4N9I A;  1VQK I;  2K85 A;  5KHD A;  3RIR A;  4U87 A;  5E20 A;  4NHJ A;  2ZNZ A;  3GFJ A;  2A68 F;  4L5I A;  1TC3 C;  2JVH A;  4Q4Z F;  4KIB A;  1EH6 A;  1QPM A;  5J1Y A;  3MKW B;  3VWB A;  2K3F A;  4XBF A;  2CQX A;  4EM0 B;  1SVM A;  1JKP C;  3ERM A;  1ONV A;  5J3L A;  1ZQ3 P;  1MJA A;  3RQ4 A;  1IN6 A;  5B5E C;  2UZK A;  4XN3 A;  2ID3 A;  3ML6 A;  4ITV A;  1LJ9 A;  4BXX J;  3JTG A;  2ZKZ A;  4DW6 A;  3MMY B;  5IOY A;  5HNH A;  4E4H A;  2HNH A;  2X6X A;  3DP7 A;  2R5Y A;  2HPM A;  4A3M J;  2EA4 A;  3IWF A;  1QVT A;  2QQ8 A;  2NAZ A;  2WB1 N;  5HLI A;  3RPU D;  4F52 A;  3D5L A;  3TDU C;  1IN7 A;  3X2Q H;  1TL8 A;  1MND A;  2Q1Z B;  2W57 A;  1JGS A;  1RKW A;  3DKY A;  4HA8 A;  1YTY A;  5B1B H;  1YLF A;  2BW3 A;  1MDM B;  2VT2 A;  5D6E A;  2WY7 Q;  1U8B A;  2CH0 A;  5JVT A;  5E1Z B;  3GYH X;  1JKR C;  2BXZ A;  2VKV A;  3K1N A;  3HYI A;  1WI3 A;  2ZJP F;  3MKZ A;  1V5F A;  3L9F A;  1EJ9 A;  2F5C A;  3SDB A;  4LB6 B;  1ZKG A;  3S3M A;  4Q48 A;  2DMU A;  4KA4 A;  2HPI A;  4F93 B;  2VOO A;  2H8W A;  4WF2 A;  3ZR8 X;  3A01 B;  3A1Y A;  2IP2 A;  3SXY A;  3SFI A;  4PZJ A;  2EIL H;  3D1N I;  1MSE C;  2WC2 A;  3R60 A;  4DGW B;  1EV7 A;  5C3E J;  2E7X A;  2FRH A;  2P5V A;  2Y30 A;  1SFK A;  3GXO A;  4KIS A;  1IRF A;  2Y69 H;  4M6V A;  4ZYD A;  4Y15 A;  2DOF A;  3HIF A;  4JQF A;  2A69 F;  3I4P A;  3N05 A;  1X4O A;  2K5C A;  4JYK A;  4HF1 A;  1EF4 A;  4RAG A;  2RC4 A;  4M71 A;  3RSN A;  1FOY A;  2BHZ A;  4RAF A;  3PQK A;  3C2H A;  3PM1 A;  2X51 A;  2H6C A;  2NVX J;  4ETS A;  5EEG A;  5DV5 A;  2ISZ A;  1H8A C;  2KJB A;  4RAY A;  1PP7 U;  4DZJ A;  5BMZ A;  4PCQ A;  3KP7 A;  4HOB A;  2FMY A;  1E3O C;  3L2Q A;  1OCC H;  1FY7 A;  2R92 J;  2YSR A;  3QQA A;  1FIP A;  2LKX A;  3LMM A;  2PJR B;  1M1E B;  3C2G A;  3PUB A;  2FNA A;  2LBF A;  2BVL A;  1ERD A;  2DO7 A;  1SVO A;  4UXN A;  3QOP A;  1MZB A;  1FYM A;  5J8F A;  3E0J B;  2LKP A;  3I4N J;  3DF8 A;  2CUE A;  2EIJ H;  4BEH A;  1XS9 A;  4KIF A;  3TP0 A;  4BDY A;  3VYT B;  4L0Y B;  3S93 A;  4LLG F;  4HNT A;  2B63 J;  1I6X A;  2XF7 A;  2CU7 A;  1LPQ A;  4UV8 A;  5DM6 F;  3LFK A;  1MMS A;  2X1C A;  1WWX A;  2M7A A;  1ZRC A;  2RQQ A;  3R0A A;  2X0L A;  3QYE A;  2W7N A;  2W00 A;  1K79 A;  1FX7 A;  2KT0 A;  3J7Z I;  4ENK A;  5ILS A;  2A6T A;  2FBH A;  1Q1H A;  5EZH A;  5FLM J;  4II3 A;  4UUV A;  1FPQ A;  3HGG A;  4XRM A;  3ZMD A;  4G6T B;  1X2M A;  4DQ2 A;  3OYB A;  2IS4 A;  3Q0U A;  1TWH J;  5LGN A;  4XOT A;  3JAM Z;  5ED4 A;  1TWF J;  1V5G A;  2DMT A;  4KJZ A;  2C6Y A;  3WTT C;  3TKY A;  5FGM A;  3C7J A;  4L5E A;  3FXQ A;  4V2F A;  1J0R A;  1ZAR A;  2IGK A;  2QSG X;  2LD5 A;  1BR4 A;  3LFU A;  2DN0 A;  2XB5 A;  6PAX A;  1NG6 A;  1MH3 A;  2L7F P;  1YJ9 I;  5JFR A;  1VND A;  5GTI C;  1ZAO A;  4RDU A;  2XKO A;  3JAM K;  1W0U A;  4E6K G;  4MHG A;  4CCK A;  4RB2 C;  1APL C;  2O5R A;  1OJL A;  1LE8 A;  2OTJ I;  3DLA A;  1X1P A;  1ORK A;  3TL4 X;  3BOQ A;  1XDS A;  2F5F A;  1OCO H;  3MZY A;  3CLO A;  1O7L A;  1H9T A;  2LFB A;  4ZYA A;  4BBR J;  1X19 A;  1QZY A;  4N9H A;  1OYW A;  1IC8 A;  2IW5 A;  2QA4 I;  1YRN B;  4UV9 A;  4S0H B;  2F5V A;  3ZXS A;  2FML A;  2KZV A;  1E17 A;  1MMA A;  2HTJ A;  4BJ6 C;  3F8N A;  2IA2 A;  5CQG A;  1P92 A;  2EIK H;  3ZQF A;  1O7F A;  3HPG A;  2YS9 A;  3OYE A;  3CP2 A;  4O6J A;  1U6G A;  3KP2 A;  2OF7 A;  1J9I A;  1SD4 A;  3M8J A;  2LOO A;  4XLP F;  4ESF A;  4HX7 A;  3QRF F;  4FAS D;  1VQN I;  1YX5 A;  3HSR A;  3I9V 2;  2IRF G;  2Y0S A;  1IJW C;  2XGD A;  2VE8 A;  1ETW A;  1WSU A;  1EH7 A;  2V9P A;  5AON A;  4KT6 A;  1ZG5 A;  5EGO A;  4BAC A;  3AG1 H;  4A3I J;  2JA6 J;  4PDK A;  4D5F A;  4KN7 X;  5GPC A;  2L9N A;  3GTO J;  1HLV A;  2KIQ A;  2XAS A;  3QU6 A;  3RPQ A;  1G8X A;  2WAE A;  4G6D A;  5CVV A;  4D5C A;  3M7G A;  3NQO A;  1ZLJ A;  3NWS A;  2HFH A;  1FBQ A;  4LK1 F;  2P8T A;  4HSR A;  5FLV A;  5GAG J;  4AUX A;  5FFZ A;  4N0B A;  1D0Y A;  3S1M J;  1FWZ A;  2JMW A;  4MEX F;  4TV7 A;  1P9Q C;  1TQI A;  2G9W A;  4AM3 A;  2VPL A;  5LGT A;  1ZRE A;  1V55 H;  2CG4 A;  3QPL A;  2LTP A;  4R1H A;  3PSF A;  2F6C A;  1UEL B;  4UB8 C;  2ZXW H;  2ZNY A;  2XRL A;  4LB5 A;  1I39 A;  5FO5 A;  3LQR A;  3IWZ A;  2EFO A;  1I1G A;  1XX5 A;  3H5R A;  4Y52 J;  3EPZ A;  3RYP A;  3HC7 A;  2ACJ A;  2ZME B;  2W85 A;  2MC4 A;  2EFN A;  4IPA A;  4DNC A;  1XTA A;  3CCJ I;  4D0P A;  1T0F C;  1ZGJ A;  3L00 A;  2Z33 A;  2EH3 A;  1N75 A;  2A61 A;  1PUF B;  4W97 A;  1YW8 A;  3DWL E;  2NS8 A;  3CCL I;  1Z21 A;  1KQ8 A;  3JRC A;  1ZRF A;  2MG4 A;  4Y33 A;  2LY2 A;  1SD6 A;  3MZ8 A;  3ERE D;  3ZMZ A;  4YII A;  4L9V A;  4NB5 A;  2BOL A;  4IVN A;  2R7T A;  1IAW A;  3FKI J;  5F04 A;  5IP6 A;  1VF9 A;  3P5J A;  1Y8Q B;  2LYC A;  1X1A A;  4CZZ A;  3JRD A;  2VC0 A;  4FCY A;  2EK5 A;  4BQO A;  3HRM A;  3MWM A;  3K4J A;  4LG0 B;  3QPS A;  4A0Y A;  3AFH A;  5HVQ C;  2CV1 A;  1OIS A;  4IHT A;  3U21 A;  5HLG A;  2UV1 A;  2ZO4 A;  1SFE A;  2R7D A;  1RZ4 A;  1J5Y A;  4I0A A;  4MTD A;  1DDN A;  2ZME C;  3P9I A;  1HBX G;  3JSP A;  1L0O C;  5J1U A;  1IN4 A;  2X6W A;  1AA7 A;  3H3Z A;  2HKO A;  4RS8 A;  3F3X A;  3OR1 C;  1D1C A;  1TQP A;  4L9J A;  4XIC A;  1C0W A;  3EUH A;  3HHH A;  2IVM A;  4EJU A;  3ZPL A;  2ME0 A;  3KYC B;  2O7O A;  3OOP A;  1MBJ A;  1U5T C;  2B7E A;  1IDZ A;  3BJO A;  1DUX C;  1RUO A;  4OIQ F;  3GCM A;  4NBQ A;  2Y2Z A;  2OU2 A;  1H0M A;  3K6G A;  1XG1 A;  3OS1 A;  5KK1 A;  4ZYH A;  4CXF A;  3BR3 A;  2FBK A;  5CVR A;  5JHU A;  2HDW A;  1JJ6 C;  1YIJ I;  4BYY A;  2RRE A;  5LHH A;  1QPI A;  3VYR B;  4B8X A;  3AL0 B;  3OYM A;  3BP8 A;  2W82 A;  2Z9O A;  3GF2 A;  2XV4 S;  3WOD F;  1S7A A;  2MAB A;  1LNW A;  1XGO A;  3SJM A;  4IHV A;  1FBS A;  1KU2 A;  3M1C A;  4HPQ A;  5L3C A;  2HZT A;  5IT9 Z;  2COM A;  1P4W A;  1YOV B;  4HQM A;  2ISY A;  1UFM A;  3B73 A;  1GXQ A;  3KEY A;  3OYK A;  3QWL A;  4CO8 A;  2JA2 A;  5J8C A;  2AS5 F;  4IHY A;  4GGG A;  1ETY A;  2EB7 A;  2VQG A;  3IC7 A;  1D1B A;  2EPF A;  2V1N A;  1D0X A;  3E6C C;  1QGP A;  4AVZ A;  3K0L A;  2KPM A;  3IV5 A;  1RPW A;  4X0G A;  3VYU B;  3JRA A;  3BG7 A;  1OCZ H;  2DT6 A;  5D8L B;  3G2B A;  4OIO F;  3GBG A;  1JE8 A;  2HU9 A;  3AL0 C;  3IL2 A;  4XLF A;  4E7H A;  2JUC A;  5DCM B;  1VQ5 I;  3BWG A;  4IF4 A;  2DA5 A;  3HUG A;  1FYK A;  2UWM A;  2XAU A;  2QWW A;  3J80 Z;  1B9M A;  2VAS A;  4OMZ A;  2ZFW A;  3GFL A;  4F55 A;  1Z6R A;  2EV0 A;  1TNS A;  2K7L A;  2KDO A;  4MFD A;  1WHU A;  5LD2 C;  2FOK A;  2R7V A;  1BM9 A;  4KMF A;  3L2V A;  1MW7 A;  5ICC A;  3BG5 A;  3DTK A;  2GM4 A;  2E5Z A;  3FM5 A;  3W6K B;  3A0H C;  2DFI A;  2XRO A;  2GWR A;  1Z0X A;  4PGG A;  3ROU A;  3FXU A;  1HW5 A;  1Z7U A;  2FQ3 A;  1GXP A;  1WJA A;  4HLY A;  2R7O A;  1UHS A;  2KJC A;  5BS6 A;  2W84 A;  3Q5F A;  3FM3 A;  1OYY A;  2YR2 A;  3DTI A;  2OBP A;  4B47 A;  2JN6 A;  3ZQH A;  4EAT A;  2PMH A;  4L5J A;  4XL9 A;  1X4P A;  2EWN A;  4GYI A;  1LUJ B;  4OOI A;  5GPA A;  1WVR A;  2IS2 A;  1FTT A;  3N4M A;  2FXA A;  3DKX A;  4CYC A;  4XON A;  1UJ8 A;  4YIR X;  2MD5 A;  3HGY A;  4BL0 B;  1SVL A;  4F91 B;  2M9H A;  4UUS A;  1KU7 A;  2DJN A;  3PO2 J;  1KQ9 A;  3PSI A;  3RKW A;  2RKH A;  2L01 A;  1UCR A;  2OQG A;  2PG4 A;  2TRT A;  3OYI A;  2ADU A;  2HYG D;  4IJA A;  3ZQQ A;  3FHN A;  1Z6T A;  2R7R A;  1FBU A;  1TW2 A;  2OA4 A;  3CCS I;  5E8G A;  1KON A;  4HW0 A;  4C3J J;  4CCJ A;  2H1L A;  1ETX A;  4L9T A;  1Z05 A;  2XAF A;  1HW2 A;  2LDU A;  1DGW Y;  1T95 A;  2NVY J;  4M3D A;  4ESB A;  2L7Z A;  3LA3 A;  3GZ6 A;  2YU9 J;  1F5T A;  2VC1 A;  3GTL J;  2H27 A;  4HNV A;  2LVS A;  1FOX A;  1SAX A;  2OZ6 A;  1EH8 A;  2IS6 A;  3NRV A;  1EKE A;  3GLL A;  1U5T A;  3IKV A;  2V7F A;  3BR5 A;  3E6B A;  4F92 B;  2NYX A;  2OZU A;  5DM7 F;  4KDP A;  3GW2 A;  2IS1 A;  4IHS A;  2XIG A;  1ETO A;  5M5Y J;  2KHM A;  4G7H F;  1AWC A;  4HLX A;  1SFO J;  1ULY A;  3OOU A;  5FRO A;  5ILU A;  2XPU A;  2MYS A;  5L3B A;  2PN6 A;  5EF6 A;  2M2E A;  3JRH A;  1IG7 A;  3FBI B;  3GWZ A;  3OY9 A;  1FOW A;  2EZK A;  2Q2E B;  2L5Q A;  5IT3 A;  3CDH A;  1U0J A;  2LBF B;  3Q9V A;  4NC7 A;  3TED A;  1DP7 P;  4RB0 A;  3AG3 H;  3ULQ B;  1YYV A;  2Y0M A;  2HKX A;  2E2H J;  3RI4 A;  3CCR I;  2MBF A;  5FKK A;  1K6Y A;  4EJT A;  2HGC A;  2PJP A;  2DA1 A;  3U1D A;  5F0C A;  3N97 A;  4JX6 A;  5LHI A;  1AKH A;  2O6G E;  4P55 A;  2L0K A;  3WG7 H;  2LH9 A;  2UXX A;  2G0E A;  3TO7 A;  1VQ6 I;  3H92 A;  4HAM A;  4Y3O A;  2D45 A;  3L2R A;  3LAJ A;  1WJF A;  1MD0 A;  1OCP A;  2DQL A;  1HSJ A;  2PFB A;  2RAE A;  1HKS A;  1WJD A;  3M8E A;  1DPR A;  5M3F J;  1GHC A;  4IEJ A;  2NVQ J;  4J00 A;  3PO3 J;  2DOD A;  1OR7 C;  2QQB A;  4PGH A;  2ZXH A;  4XRS G;  1REP C;  3L2U A;  3E1S A;  3OL4 A;  4A3J J;  5D5X B;  1S29 A;  2LC2 A;  5TIS C;  2BXY A;  3BCA A;  5E8I A;  2A05 A;  5J47 A;  2K4B A;  1X58 A;  4CIC A;  4XK4 A;  2LNB A;  1G2H A;  1BI3 A;  2XB0 X;  2Y75 A;  3OYF A;  2P81 A;  1HF0 A;  5HLH A;  1FZP B;  1IGN A;  5EEA A;  4B1R A;  2ZJR F;  3JRF A;  2Z99 A;  2K9M A;  3QAH A;  2M45 A;  3I54 A;  3MKY B;  5DUI A;  2F2E A;  3NAR A;  1UZC A;  4YIF A;  1IN8 A;  1HC8 A;  1SD5 A;  4RB3 C;  1O3R A;  4RLF A;  5DDG A;  5BPD A;  3HTS B;  2TCT A;  2DA6 A;  4XN0 A;  1FP1 D;  1R6R A;  2JWT A;  3OL3 A;  4KN4 X;  3H36 A;  1E3P A;  4XNF A;  2P5K A;  2WTE A;  2E60 A;  3ZOB A;  1LDJ A;  2AXL A;  2LF7 A;  1IV6 A;  3RTR A;  2HTS A;  1XMA A;  3HOS A;  4RGU A;  3PNV A;  2AO9 A;  2DW4 A;  2JT1 A;  1GUU A;  1K78 B;  4G12 A;  4KIC A;  4E7Z A;  2HI3 A;  2I5U A;  3BPV A;  2X1D A;  3HKZ A;  5DUK A;  3LL7 A;  1W7P A;  3E6M A;  1FJL A;  1P2F A;  4P96 A;  2QQ9 A;  4NC6 A;  2BE5 F;  5CVJ A;  2K40 A;  3HG9 A;  2PMU A;  1CF7 B;  2P4W A;  4LK0 F;  2CUZ A;  4EVI A;  2ZJQ F;  4OU0 A;  1JUP A;  2LP0 A;  5DYM A;  1CGP A;  3GX4 X;  3RKQ A;  1LDK B;  3QP5 A;  4EQQ A;  1MBE A;  2HXI A;  4KIG A;  2QEX I;  3CC7 I;  4EJV A;  4OMY A;  4UY8 I;  1I5Z A;  1VQ4 I;  2E1N A;  1RET A;  3BG6 A;  1JT0 A;  3SDG A;  1R71 A;  3G1L A;  4HX8 A;  2JA7 J;  4BE2 A;  2VJ5 A;  4OAZ A;  2X9D A;  4EEF G;  1Y56 A;  1FMW A;  1B4A A;  2Y0S N;  3IHU A;  3RDI A;  2B9S A;  4LG3 A;  1A31 A;  2DU9 A;  2VBW A;  2P6S A;  2K4J A;  1LDD A;  1A6Q A;  1HQC A;  1S8N A;  1DP3 A;  1EA3 A;  2D5V A;  2ZXJ A;  3VOD A;  2DXI A;  2R7S A;  3GFM A;  1WJ5 A;  3KZI C;  4Q47 A;  2DA2 A;  2K86 A;  4YRV A;  4BGD A;  4AIJ A;  4HF2 A;  4ZC3 A;  4UVA A;  3RPU A;  1D3Y A;  3CUQ B;  2F5E A;  4ZH4 F;  4U0Y A;  5D4S A;  1T8I A;  3E5X A;  2F48 A;  3E5Q A;  4B3A A;  3GTQ J;  5LEK A;  1MH4 A;  1XDU A;  4Y7N J;  2DA3 A;  3VEP A;  1FOK A;  3CJR B;  4BJT A;  2STW A;  4M9X A;  4U0V A;  3L7W A;  1WFX A;  2VBX A;  2PX9 A;  3OR2 C;  1LEB A;  5E18 F;  5LRS A;  2DMN A;  2W1O A;  3JR9 A;  1HOM A;  3MN2 A;  3M4O J;  2R93 J;  3BTI A;  1Z1D A;  4I6Z A;  4RLQ A;  2HOA A;  3HOT A;  5LEJ A;  2XAH A;  5JVG F;  5DTD A;  5JLW A;  3BG9 A;  4M3B A;  3K4C A;  1S5L C;  1F4K A;  2D2W A;  3S32 A;  2L9V A;  2RGV A;  2XF5 A;  3EQL F;  2R7U A;  2M3A A;  3TW6 A;  4M9S A;  5F08 A;  4B43 A;  2KFD A;  3HRT A;  2J5O A;  2QSF X;  2NNY A;  2KKO A;  1T33 A;  2LF8 A;  1FMV A;  2NVT J;  4OIR F;  4BHP A;  1UHM A;  2QQA A;  5DD4 A;  2XPV A;  1X3Z B;  1LQ1 A;  3CES A;  1P7I A;  2M0C A;  4DBQ A;  4IOA F;  2DDA A;  1B6A A;  3V7S A;  1ZYR F;  3SEZ A;  4I09 A;  1WPK A;  1I50 J;  1YHQ I;  3Q3S A;  3DTE A;  1PYV A;  2Q0O A;  3M07 A;  4E7S A;  1WH5 A;  2RVC A;  1QQI A;  1NTC A;  1YQA A;  3OIO A;  1JGG A;  2R3S A;  2KQR A;  4G6Q A;  4MO7 A;  4C3H J;  4I02 A;  5FJ8 J;  1LKX A;  5CJ9 A;  2O03 A;  2HDD A;  3I59 A;  4ANJ A;  3V8K A;  4JX5 A;  3W6V A;  5E3M A;  5KNL A;  4AD9 A;  3JRB A;  3BTJ A;  5GAE J;  3EUK L;  2L3D A;  4S05 A;  1Y1W J;  3WGG A;  2NS0 A;  3CCE I;  1WCM J;  1V3F A;  2FUG 2;  4HG2 A;  1IW7 F;  1MBG A;  3S8P A;  1HST A;  2CJJ A;  3ASN H;  4ZYE A;  1L3L A;  1TNT A;  3JTH A;  1FC3 A;  3T8T A;  4HDU A;  1W4M A;  2WWY A;  1BN5 A;  4F3Q A;  4HBL A;  4PJM A;  3TBI A;  1QZZ A;  2VKE A;  3BPX A;  1MNE A;  2DK5 A;  1Z77 A;  1LB2 A;  2DT5 A;  3KX2 A;  4BQA A;  3R61 A;  4B3X A;  1DGR M;  1T39 A;  3VFZ A;  3L2W A;  1RI7 A;  2JK3 A;  1TWC J;  3TO6 A;  4WXC A;  3BG3 A;  1Z67 A;  3ZGK A;  1Z91 A;  2WAQ N;  1X1D A;  3WTX C;  3PFY A;  1Y6I A;  3KE2 A;  5CVI A;  4KNY A;  5IP9 J;  3V8J A;  2E1M B;  1BW6 A;  2VXZ A;  5F27 A;  2CQ7 A;  4I99 C;  4AVP A;  3QYB A;  4E7K A;  3G1O A;  4GCV A;  1MJ9 A;  3DQV C;  2KIU A;  1NH3 A;  4ZDO A;  2Z1D A;  2CMP A;  4XLC A;  3G4S I;  2JPC A;  3RCO A;  5D8K B;  3FHZ A;  3D0S A;  4AIK A;  2ETH A;  2V26 A;  2VKD A;  3L2C A;  4LIU A;  4RBO A;  2RQP A;  4QTR A;  3MZH A;  1YJW I;  1BW5 A;  4A0X A;  4MIM A;  4HNU A;  3WU2 C;  4ZJZ A;  3F8B A;  2EJR A;  1QHG A;  1RKT A;  3WTV C;  2E7W A;  3GO5 A;  1ZGW A;  2HVS A;  3JW4 A;  4AU7 A;  5L3G A;  4MFE A;  3TDZ C;  2FQ4 A;  3LQQ A;  1MDM A;  1QU3 A;  4V2G A;  3I4M J;  3OYJ A;  4I01 A;  3ZMS A;  3KZY A;  4JX4 A;  3DFG A;  2ZJ2 A;  3FX3 A;  2CV0 A;  2E1M C;  1IF1 A;  2VJJ A;  4PFO A;  4A69 C;  3CCQ I;  1PVE A;  3G6E I;  1B72 B;  2BZT A;  3L1P A;  4I98 B;  2XPW A;  1NK2 P;  1XD7 A;  2FOW A;  3A0B C;  3LA7 A;  1XC5 A;  1YI2 I;  2CW8 A;  1T6S A;  3A01 A;  5C4X J;  3W6J B;  4P9U A;  3OSF A;  2R5Z B;  2Y9Z A;  1K61 A;  3FMS A;  3K69 A;  1LFU P;  2X1E A;  2MLK A;  1NHA A;  3S16 J;  3S1R J;  3SEQ A;  2VXD A;  1YG2 A;  1MGT A;  3E6D A;  4M74 A;  4XLN F;  2DI3 A;  4FX0 A;  2L9R A;  3GTJ J;  1GVD A;  4Z2Y A;  1PP8 F;  3CC4 I;  4BAY A;  4A3G J;  4LJZ F;  4AWX B;  2AHQ A;  4DZP A;  5B66 C;  2A6H F;  3O8G A;  4LGW A;  5FB2 A;  3OS2 A;  1O3S A;  3GZ5 A;  4EMS A;  1YW7 A;  3QP6 A;  1VQM I;  2COB A;  4RGS A;  1WKM A;  1JHH A;  1Z3X A;  2OV7 A;  5KAF C;  1IO2 A;  3LA2 A;  1R1U A;  4ZYG A;  5BQT A;  4EM1 A;  2CFX A;  3IAM 2;  3B6C A;  1D5V A;  1RC9 A;  1Z9C A;  3KZZ A;  3C18 A;  4CHU A;  2JRT A;  2V1U A;  3BR2 A;  5HOD A;  1FSE A;  3R4K A;  1IRZ A;  4G94 A;  4M3E A;  3KP4 A;  2FX0 A;  2VL8 A;  1ETK A;  2QBY B;  3HSF A;  4JBA A;  4NQW B;  4B44 A;  2JQ7 A;  1J09 A;  2A3S A;  3H0D A;  3W2A A;  1YIT I;  3E97 A;  3WGI A;  2PJR A;  2VQC A;  5ILV A;  2R4G A;  1ZEL A;  2STT A;  5GTH C;  1K4S A;  2F4O B;  1ETQ A;  3HHG A;  3KPH A;  4QIW N;  2HS5 A;  3UNG C;  5E3L A;  1F43 A;  2LRD A;  4WXD A;  3HOZ J;  4CH7 A;  2M8G X;  1ZR4 A;  1XMX A; 
#chains in the Genus database with same CATH homology
 5IOY A;  2VUM J;  2TRT A;  4MLO A;  3RZD J;  1A6I A;  1U9O A;  2R5Y A;  3UKG A;  3IH4 A;  4A3M J;  3BTC A;  1QVT A;  2WB1 N;  3ZQL A;  4B4C A;  1JTX A;  3S2H J;  2LK2 A;  4C3J J;  2DMQ A;  2LLK A;  5K7H A;  4IHX A;  1ETX A;  1RKW A;  2NVY J;  4M3D A;  3CCY A;  2L7Z A;  1U8B A;  5F0H A;  2YU9 J;  1POG A;  3GTP J;  3WHB A;  1GT0 C;  1JKR C;  3C2B A;  3GTL J;  4HNV A;  2LVS A;  2VKV A;  2DMP A;  1WI3 A;  2ECB A;  4A93 J;  3DEW A;  1LFB A;  2O8K A;  1ZKG A;  4D7M A;  2DMU A;  2GBY A;  2HXO A;  3BR5 A;  3A01 B;  5EG0 B;  5IYC J;  1MNM C;  1FTZ A;  1MSE C;  3SFI A;  1ETO A;  5M5Y J;  3D1N I;  1SFO J;  5IOZ A;  3BQZ A;  3OOU A;  5C3E J;  2MGQ A;  2EBI A;  2XPU A;  3JRG A;  1AHD P;  5EF6 A;  2M2E A;  2Y30 A;  3JRH A;  1IG7 A;  1TWG J;  5IPA A;  4M6V A;  2X48 A;  2EZK A;  1BA5 A;  3H3V K;  5K7Z A;  3LSR A;  2DA7 A;  4UUT A;  3JRI A;  1B8I B;  1TWA J;  1HCR A;  5FKN A;  3TED A;  2EZI A;  2FJ1 A;  4JYK A;  4BBS J;  1EF4 A;  2FD5 A;  2XSD C;  2E2H J;  3PM1 A;  5FKK A;  2NVX J;  3HOU J;  4NDL A;  1ITY A;  2DA1 A;  1H8A C;  5F0C A;  1YRN A;  4JX6 A;  4DZJ A;  2PMZ N;  1AKH A;  2L0K A;  5FKL A;  3JRE A;  2ID6 A;  1UMQ A;  2CQQ A;  2DA4 A;  2G0E A;  3LNQ A;  1E3O C;  4A3K J;  1A5J A;  4FE4 A;  1JJ8 C;  4JP0 A;  5C4J J;  2R92 J;  4X6A J;  9ANT A;  1OCP A;  3QQA A;  1FIP A;  2RAE A;  5C44 J;  1FIA A;  2LKX A;  1U9N A;  5M3F J;  1JT6 A;  4IEJ A;  2NVQ J;  2R0Q C;  3PO3 J;  4XRS G;  3IH2 A;  3HOY J;  4CYC B;  3DCF A;  2R7Z J;  4A3J J;  3S1N J;  4UUS B;  5F0F A;  3ZQC A;  1X58 A;  3I4N J;  4XK4 A;  2CUE A;  1G2H A;  2E19 A;  1F36 A;  2XB0 X;  1XS9 A;  4LOC A;  2P81 A;  1HF0 A;  3TP0 A;  5BNG A;  2R5Y B;  1JKQ C;  1IGN A;  5EEA A;  4B1R A;  2LY9 A;  1U78 A;  2B63 J;  4A3L J;  4X1E A;  3JRF A;  2CU7 A;  4C3I J;  1DU0 A;  1JUS A;  1JKO C;  3NAR A;  2XGC A;  1MBK A;  2Y31 A;  3VPR A;  1MBH A;  2KT0 A;  3HKZ N;  2E1O A;  2TCT A;  2DA6 A;  3HOV J;  5FKM A;  2JWT A;  2JJ7 A;  5EZH A;  5FLM J;  3HGG A;  4XRM A;  3ZOB A;  1X2M A;  3Q0U A;  1I3Q J;  1IV6 A;  1TWH J;  1TWF J;  2DMT A;  4I76 A;  5M5W J;  2AO9 A;  3FK6 A;  1HDP A;  1GUU A;  4G12 A;  4L5E A;  2HQ5 A;  2ME6 A;  2HI3 A;  4V2F A;  1FJL A;  4AC0 A;  2H1K A;  2LD5 A;  1WH7 A;  1JUM A;  2DN0 A;  2K40 A;  3BR1 A;  1S7E A;  2XB5 A;  4J19 A;  1MH3 A;  2L7F P;  2O9L A;  1PUF A;  1VND A;  5FKO A;  2IEK A;  1JUP A;  2LP0 A;  2VPR A;  3A03 A;  4RDU A;  3RKQ A;  2M34 A;  1MBE A;  2HXI A;  2MW8 A;  1W0U A;  3M3Y J;  1ZTR A;  1APL C;  1OJL A;  1LE8 A;  5M5X J;  3MKL A;  1RET A;  1JT0 A;  4A3D J;  1ORK A;  3SDG A;  3CMY A;  3G1L A;  3FIW A;  2JA7 J;  3GTG J;  1ENH A;  1HDD C;  2LFB A;  2X9D A;  4BBR J;  4EEF G;  3OSG A;  2Y0S N;  1IC8 A;  1YRN B;  1AKH B;  4S0H B;  1Q1V A;  1UG2 A;  2E2I J;  1SAN A;  1BJZ A;  3ZQF A;  2D5V A;  2EZH A;  2YS9 A;  2OF7 A;  2DA2 A;  2KDZ A;  4D7N A;  5E3O A;  4A3F J;  2N8G A;  4IHW A;  2X6O A;  4QSH A;  1NK3 P;  4B3A A;  3GTQ J;  2HOS A;  2NOG A;  1MH4 A;  1IJW C;  2XGD A;  4Y7N J;  2DA3 A;  1ETW A;  5EGO A;  3HEF A;  1Y1V J;  2DMN A;  4A3I J;  3JR9 A;  2JA6 J;  3GTK J;  2I10 A;  3MN2 A;  2JA8 J;  4AYB N;  3M4O J;  1HOM A;  2R93 J;  4D5F A;  2EZL A;  5EZG A;  3BTI A;  5GPC A;  4I6Z A;  2HOA A;  3GTO J;  1HLV A;  5DTD A;  5JLW A;  1ZR2 A;  4XRS A;  3BG9 A;  4M3B A;  1ETV A;  1H88 C;  3S14 J;  5IYD J;  1R9T J;  4D5C A;  1RES A;  1AU7 A;  2H8R A;  3RQI A;  1QVU A;  1I6H J;  3TW6 A;  2CUF A;  2WV1 A;  5IYB J;  5FLV A;  5F08 A;  4AUX A;  2MSY A;  3BR0 A;  3CQZ J;  3S1M J;  2JMW A;  1T56 A;  3BT9 A;  3S15 J;  1T33 A;  4A3C J;  2NVT J;  4BY1 J;  3QPL A;  1VI0 A;  2LTP A;  3S2D J;  2K9Q A;  2XPV A;  3HM5 A;  4BY7 J;  5JLX A;  1P7I A;  4FE7 A;  2E2J J;  2M0C A;  3GTM J;  2XRL A;  2NS7 A;  3FK7 A;  3RZO J;  3BQY A;  1WPK A;  1I50 J;  3Q0V A;  4Y52 J;  3O8H A;  3Q3S A;  1WH5 A;  1B72 A;  1NTC A;  2EH3 A;  3NAU A;  1PUF B;  5M3M J;  4W97 A;  3OIO A;  2NS8 A;  1JGG A;  3FIS A;  3JRC A;  4W1U A;  3F0C A;  4MO7 A;  4C3H J;  2MG4 A;  5FJ8 J;  4ABZ A;  2R5Z A;  1LE8 B;  1H89 C;  2HDD A;  3H0G J;  4JX5 A;  3W6V A;  3FKI J;  5F04 A;  5IP6 A;  1VF9 A;  1FEX A;  5E3N A;  5E3M A;  3JRB A;  3BTJ A;  1ZK8 A;  3JRD A;  4FCY A;  2OPT A;  1Y1W J;  2YUS A;  3QPS A;  2GLO A;  1WCM J;  1MBG A;  2CJJ A;  2K9S A;  1JTY A;  3WHC A;  3HOX J;  2W48 A;  4BKX A;  1OFC X;  1QRY A;  5J1U A;  2LR8 A;  4DYC A;  2VKE A;  3ZQI A;  1GV5 A;  4DYR A;  1Z77 A;  2QF7 A;  5IP7 J;  3S17 J;  2JK3 A;  4XIC A;  1TWC J;  4DYQ A;  1MSF C;  3BG3 A;  2WAQ N;  5EGO B;  1P7J A;  2ME0 A;  2O7O A;  1OCT C;  5IP9 J;  4GFB A;  2QCO A;  1BW6 A;  2ZB9 A;  1MBJ A;  5F27 A;  3BR6 A;  1RR7 A;  1IDZ A;  3G1O A;  3G1M A;  3HBL A;  5K7F A;  4FIS A;  2Y2Z A;  1MBF A;  1XG1 A;  1VFC A;  3E7L A;  5EYR A;  1X2N A;  2JA5 J;  4M3F A;  5GP9 A;  3BR3 A;  3HOW J;  1IDY A;  5DS9 A;  2ELK A;  1JJ6 C;  1QPI A;  3IH3 A;  1DU6 A;  2DTZ A;  5EDN A;  4RBO A;  3LSJ A;  4QTR A;  1BW5 A;  4MIM A;  1GV2 A;  1RKT A;  1ZGW A;  4XID A;  3SJM A;  4IHV A;  3HB9 A;  4MFE A;  3TW7 A;  4FTH A;  2FQ4 A;  2HYJ A;  2VI6 A;  2Y9Y A;  4V2G A;  3I4M J;  3Q0W A;  4JX4 A;  3BTL A;  3HDD A;  1W0T A;  4A69 C;  1B72 B;  3L1P A;  2XPW A;  1NK2 P;  1XC5 A;  2IAI A;  3CDL A;  2CRG A;  1CQT A;  4IHY A;  3S1Q J;  1ETY A;  2EQR A;  3A01 A;  5C4X J;  2K9N A;  3A02 A;  1O4X A;  5EG0 A;  3OSF A;  3IV5 A;  2R5Z B;  1RPW A;  3LSP A;  2Y9Z A;  1K61 A;  1LFU P;  4A3B J;  3JRA A;  3S16 J;  1IUF A;  4C2M J;  3S1R J;  3GBG A;  3GTJ J;  1GDT A;  2L7M P;  2L9R A;  1GVD A;  4A3G J;  1K83 J;  5F1J A;  2AHQ A;  4DZP A;  3O8G A;  2DA5 A;  1B8I A;  5J1R A;  2COB A;  4A3E J;  3B6A A;  2ECC A;  3TP3 A;  4MFD A;  1WGX A;  1D5Y A;  3B6C A;  3BG5 A;  4M3G A;  2GM4 A;  3K7A J;  1Z0X A;  3BR2 A;  5HOD A;  3ZQG A;  1IRZ A;  4M3E A;  2FX0 A;  1ETK A;  1UHS A;  2HOT A;  1TC3 C;  2JN6 A;  3ZQH A;  2XGE A;  3K2A A;  5J1Y A;  3LOC A;  5GPA A;  1FTT A;  2CQX A;  4CYC A;  1ETQ A;  1JKP C;  1BL0 A;  2IBD A;  3HGY A;  4QIW N;  3MVP A;  5J3L A;  5E3L A;  4UUS A;  1ZQ3 P;  2M9H A;  3PO2 J;  1F43 A;  2DJN A;  2ID3 A;  3HOZ J;  2M8G X;  4BXX J;  1ZR4 A;  4DW6 A;  3LSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...