3MKLA

Crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
b'QPNMRTRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQERS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HTH-type transcriptional regulator gadX
publication title Crystal structure of DNA-binding transcriptional dual regulator from Escherichia coli K-12
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 35
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00165 HTH_AraC Bacterial regulatory helix-turn-helix proteins, AraC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mklA00
1AKHB 3BTIA 2DMPA 2K9NA 2AO9A 3TW7A 2EQRA 3HBLA 2FQ4A 3A03A 1HLVA 4X6AJ 5EF6A 2JA8J 2O7OA 3CQZJ 3Q3SA 2LD5A 2E2JJ 3BTCA 4V2FA 1U9OA 2AHQA 3LSPA 2M8GX 1ETOA 4A3JJ 4L5EA 2O8KA 1B72B 3MVPA 1ETKA 1QPIA 1YRNA 2VI6A 2DMQA 2HYJA 4QTRA 3WHBA 4FE7A 1MBHA 1TWGJ 1AU7A 1I6HJ 1HOMA 2DJNA 2JWTA 3FKIJ 3GTPJ 2WV1A 3PO2J 3M4OJ 2DA6A 3BR1A 1NK3P 3GTOJ 1GUUA 1MBKA 2EZHA 3ZQLA 3S16J 3QQAA 1F36A 1WPKA 1GV5A 2I10A 2GBYA 3ZOBA 4FTHA 1MSFC 1X58A 1BA5A 3S1MJ 2E1OA 3FIWA 4EEFG 4C2MJ 1G2HA 3JRGA 1TWFJ 1LFUP 3OIOA 1GVDA 4ABZA 2DA1A 3LSJA 3G1OA 3ZQHA 2HOSA 3BQYA 2L7MP 3JREA 3MKLA 5FLMJ 4M3BA 3CMYA 4Y7NJ 2CQQA 1P7IA 2N8GA 2H1KA 2DN0A 1WH5A 2JJ7A 2E2HJ 1AHDP 3HOZJ 3WHCA 3HOUJ 2XGDA 2CU7A 2ELKA 3O8HA 3OSFA 1VFCA 1RETA 5EDNA 3HOYJ 3PM1A 5K7HA 3S2DJ 4A3DJ 3FISA 4I76A 4I6ZA 4A3MJ 1IV6A 2L9RA 4FISA 1JJ8C 1SANA 3BR6A 3B6AA 1HF0A 1ETYA 1S7EA 2XGCA 4BY7J 4XRSG 4DZJA 3DEWA 3ZQIA 5FKNA 9ANTA 1IUFA 3BR2A 4JYKA 1DU6A 1FTZA 3HOXJ 2JN6A 5F08A 3C2BA 2JK3A 5IYBJ 5DS9A 2X9DA 3S1NJ 1DU0A 1K61A 2ME6A 2JA5J 2COBA 2HOAA 2E2IJ 2JA7J 1BJZA 1D5YA 1BL0A 3VPRA 3JR9A 1H8AC 1W0UA 2HXIA 5EGOA 1IG7A 1FIPA 1MH4A 1A5JA 1RR7A 3JRBA 4DYQA 5FJ8J 1ETWA 1APLC 2TRTA 2K9QA 1Q1VA 1TWHJ 2HI3A 1JUPA 2ECCA 1F43A 2WB1N 3QPSA 5C3EJ 1EF4A 2KT0A 4M6VA 1OFCX 2NVXJ 2MGQA 1P7JA 4MFEA 2R93J 2CQXA 2R7ZJ 3BG9A 5IOZA 2DA3A 2LP0A 3GTQJ 5EGOB 3HOVJ 3LOCA 1UMQA 1WCMJ 1U9NA 3ZQGA 5E3NA 1ENHA 5M3FJ 1HDDC 2ME0A 1UG2A 3BTLA 1Z77A 2NS8A 1LE8A 4X1EA 5FLVA 2ECBA 4G12A 4FCYA 5M5YJ 3HB9A 3K7AJ 1JKPC 2D5VA 4A69C 3SJMA 2TCTA 1MBGA 3LSGA 4D5FA 5EG0A 3I4MJ 2VUMJ 3BG5A 2IEKA 2JA6J 2NVQJ 4RDUA 1QVTA 1JUMA 1RPWA 5M5XJ 3F0CA 4A3IJ 5GPCA 1ZGWA 5DTDA 3K2AA 2OF7A 2L0KA 1ZQ3P 1FTTA 1FIAA 2Y0SN 4S0HB 1ZTRA 2YS9A 3JRAA 1U78A 1WGXA 1LE8B 2H8RA 5IYCJ 1JT6A 5F04A 2CUEA 3A01A 3H3VK 5HODA 3SFIA 5EG0B 1U8BA 3FK7A 5F27A 3MN2A 4CYCA 1JTXA 3Q0VA 3S1RJ 4A3EJ 3HM5A 4M3GA 1JJ6C 3E7LA 4BBRJ 2HQ5A 1SFOJ 3IH4A 1X2NA 4JP0A 1QVUA 3TP0A 3TP3A 5IPAA 1RKTA 3FK6A 1JKQC 2DMNA 2IBDA 5E3MA 4C3JJ 5EYRA 3GTGJ 5J1YA 4UUSA 2G0EA 4V2GA 2GM4A 3A01B 3S14J 4A3GJ 2MG4A 1X2MA 3BTJA 2E19A 4J19A 1Y1WJ 1XG1A 5F0CA 4CYCB 1Y1VJ 3Q0WA 2X48A 3CCYA 5JLXA 2XPUA 4QIWN 5F0HA 3UKGA 1T56A 1CQTA 2DMTA 2EZIA 3JRFA 1LFBA 1TWCJ 4B1RA 4BXXJ 2QCOA 2M34A 2LLKA 1ZR2A 3A02A 2Y2ZA 1ZR4A 2Y9ZA 4UUSB 3NARA 2EZLA 4DW6A 1GV2A 1ETXA 2LK2A 4AYBN 4W1UA 3JRCA 1MNMC 1MH3A 2O9LA 1MSEC 1WH7A 4A3CJ 3QPLA 1IC8A 2NOGA 2CRGA 1IDYA 3S2HJ 2CJJA 3HEFA 1VF9A 4M3DA 1GT0C 2CUFA 4FE4A 5F0FA 3S17J 1A6IA 2R5YA 3OOUA 2DTZA 4LOCA 4MLOA 2L7FP 2NS7A 2DA5A 1FJLA 1POGA 1JGGA 2ID6A 2GLOA 5K7ZA 4XICA 1TC3C 5FKOA 2R0QC 4AC0A 2FX0A 3BQZA 3G1LA 5J3LA 3HDDA 1OCPA 3HOWJ 4GFBA 1IJWC 3GTMJ 4JX4A 3PO3J 1O4XA 2B63J 3W6VA 2NVYJ 5FKLA 5EZHA 2R5ZA 3JRDA 1HDPA 1ORKA 3BG3A 2M2EA 5F1JA 4NDLA 2M9HA 2R5YB 1RKWA 3M3YJ 5M3MJ 3BR0A 2XPVA 1TWAJ 1UHSA 1JTYA 4M3EA 4A3LJ 4XIDA 4D7MA 2XSDC 4DYRA 3IV5A 4IHWA 2RAEA 4B4CA 4BKXA 4XRMA 1NTCA 4M3FA 3TW6A 2HDDA 2XPWA 5FKKA 2MW8A 2Y30A 1ETQA 4IEJA 1IGNA 2R92J 2PMZN 1I50J 2K9SA 1ZKGA 3GTJJ 1H88C 2VKEA 3JRIA 4JX5A 4DYCA 2R5ZB 1T33A 2QF7A 2LKXA 3JRHA 4MIMA 4MO7A 4UUTA 5GP9A 5BNGA 1GDTA 2NVTJ 1Z0XA 2MSYA 2FD5A 1JUSA 2DMUA 3BT9A 3HGGA 4RBOA 2XGEA 4XK4A 3RZDJ 1BW5A 5EEAA 1WI3A 1OCTC 2IAIA 5IYDJ 2XB0X 3LNQA 3GTLJ 1QRYA 1YRNB 5E3OA 4C3IJ 2HOTA 2DA2A 4IHVA 2EBIA 1RESA 2W48A 2YUSA 3ZQFA 3Q0UA 1K83J 3H0GJ 3RZOJ 2KDZA 2XRLA 5C44J 2ID3A 2OPTA 2LY9A 1VNDA 3CDLA 2Y31A 2FJ1A 3S15J 2JMWA 1PUFA 3GTKJ 5M5WJ 2YU9J 3D1NI 2WAQN 5FKMA 5K7FA 5J1RA 1JKRC 3TEDA 2EZKA 3BR5A 2ZB9A 5EZGA 2L7ZA 1OJLA 2K40A 3IH2A 2XB5A 5E3LA 1R9TJ 4MFDA 3RKQA 2LR8A 5J1UA 2HXOA 4B3AA 3RQIA 1I3QJ 4C3HJ 1ZK8A 2VPRA 3SDGA 1MBJA 1FEXA 1XS9A 2VKVA 2P81A 4QSHA 4D7NA 3LSRA 3O8GA 3I4NJ 1PUFB 1ETVA 4A3BJ 4IHXA 1IDZA 5IP9J 3ZQCA 1MBFA 5IP6A 5JLWA 3B6CA 3DCFA 3BR3A 4D5CA 1B8IA 5GPAA 5C4JJ 3L1PA 1W0TA 1AKHA 1JT0A 4Y52J 4A3KJ 4XRSA 4BY1J 1JKOC 4DZPA 4HNVA 4A93J 3OSGA 3HKZN 5C4XJ 2EH3A 1H89C 4JX6A 3G1MA 1MBEA 1IRZA 4AUXA 2DA4A 1E3OC 1XC5A 1NK2P 3GBGA 3IH3A 2LFBA 2M0CA 2DA7A 2X6OA 4IHYA 1B72A 2Y9YA 2LVSA 2LTPA 5IP7J 4A3FJ 1HCRA 3S1QJ 1ITYA 3NAUA 1B8IB 4BBSJ 4W97A 5IOYA 1BW6A 3HGYA 1VI0A
chains in the Genus database with same CATH superfamily
2PJRA 4LK0F 1VQ7I 4ESJA 2P5KA 3IRRA 3OYBA 3TW7A 1K7AA 2EQRA 3ASNH 4PSWA 3A03A 1DP7P 1NG6A 1QA6A 4F52A 4RB3C 5LGNA 4J01A 3OYMA 2O7OA 3CQZJ 3I0TA 4BXUA 5LHGA 2E2JJ 1NHAA 4V2FA 3RIRA 4GXOA 2AHQA 3LSPA 2VBYA 1ZH5A 5LHIA 3DLLF 2A07F 5KAIC 4YFKF 2EV6A 1YRNA 1S7AA 4PFOA 3G2BA 1P4AA 2QM3A 3WTXC 4NNJA 3WHBA 3HSFA 2OBPA 1I6HJ 1HOMA 3FXJA 5ED4A 1KA8A 1X3UA 3GTPJ 2WV1A 1C0WA 2W00A 1XSXA 1R6RA 2HYGD 3BR1A 4KJZA 2P8TA 3GTOJ 3IHUA 3CZ6A 1S9HA 4LG0A 3VYRB 4F55A 2FBHA 3MWMA 4BH9A 3QRFF 3ZMSA 3S3NA 1RI7A 4ASNA 2GBYA 4HOBA 1SFEA 1FYKA 5TRDA 2COMA 3R0AA 5FB2A 1YI2I 3S1MJ 2JTVA 3H5AA 5GAEJ 1LEBA 4C2MJ 4RB2C 2Q0OA 2HGCA 3QYFA 1G2HA 3JRGA 1TWFJ 2ZXJA 3OIOA 3Q5FA 4E6KG 4ABZA 2M1BA 3JREA 1IN4A 2DQLA 3BDDA 4UB6C 5TJJA 2PJPA 4LG0B 1ZRFA 1I39A 3VYUB 5DD8A 3M8JA 2EILH 1P2FA 5D6FA 4EM1A 2R7RA 2H1KA 5FLXK 2JJ7A 2E2HJ 3F6OA 2GXGA 4Q47A 4A12A 1FP2A 5D5WB 2ELKA 4PFPA 3O8HA 4XKVA 1VQLI 1ZG5A 3I5UA 4ZDPA 4WF2A 2K02A 4A6EA 4CUGA 1ZN2A 3M07A 2A69F 1XN7A 5LEKA 3DF8A 4A3MJ 2M30A 2CG4A 1YE9A 4FISA 3BR6A 2F5DA 1HF0A 3DKYA 1ETYA 3RTRA 3SFZA 1ON2A 3WTVC 2XGCA 3IUOA 4XRSG 3GFJA 3KP3A 4LIUA 3ABMH 5FKNA 2F2EA 3C2GA 3LFUA 1IUFA 3KEOA 2LREA 1QHHD 1FTZA 3HOXJ 3CUQA 5DS9A 5IT3A 3FZVA 2EK5A 2G7HA 5D8LB 5LBQA 2ME6A 2COBA 2E2IJ 2F4IA 4EM2A 3FXQA 2EB7A 3K1MA 3JR9A 1B1BA 2MD5A 4XKWA 4KN4X 1WQ2A 3EPZA 1PDNC 3L00A 2E1MC 1W1WE 1Q1VA 1JUPA 1MMDA 5E1WA 4Z2YA 2MD0A 2KP6A 3T0YA 3PL8A 5FD5A 3CUQB 5KNLA 1V54H 3EYYA 1WVRA 3VWBA 3MFKA 4M6VA 1OFCX 1X4OA 2MGQA 2EV0A 2FXAA 1SMYF 2CQXA 2LMDA 1N75A 3MAJA 2XAJA 2R7ZJ 1BOBA 1QHGA 1HC8A 2OCEA 3VFZA 1QNTA 3ASOH 4MGRA 2IS4A 3LOCA 5K1YA 3LAJA 1WJ5A 5M3FJ 1HDDC 4BE2A 3FXOA 1SVMA 2PBIA 1IO2A 2BHYA 2GOXB 3KP2A 1S8NA 2VL8A 2PLYA 4FCYA 3HB9A 2D5VA 3ZQ7A 3PQKA 3LSGA 4D5FA 3I4MJ 3L2RA 5ILSA 2IEKA 2JA6J 2NYXA 4RGUA 3H9GA 4S04A 1R4NB 2KJCA 2W24A 3F0CA 1K79A 2VOPA 1GLNA 3REOA 5GPCA 1ZGWA 2EFWA 3QOPA 1FTTA 2IGKA 4O3MA 2UZKA 2OU2A 2GWRA 4RM3A 2R7WA 1SD7A 2VJIA 3DEUA 4I2OA 1SMTA 3CCMI 3G4SI 5HVQC 1J75A 1WGXA 5LLQA 3F8CA 3ERED 3DPUA 2CUEA 2XAQA 2QBYA 3JSPA 4CH7A 4HQMA 4CA0A 1WZ2A 3TL4X 4QPOA 2D1HA 2DBBA 3MN2A 5CVIA 3ZMUA 4CYCA 4HX8A 4HG2A 3Q0VA 3S1RJ 2KZVA 4A3EJ 1JJ6C 4DNCA 1CF7A 2HQ5A 3DV8A 1D0YA 2CWEA 4JP0A 5A2QK 3T8RA 1SFOJ 2ZXHA 5L3GA 5GADJ 1W36C 1RKTA 1IRGA 3FK6A 2GA1A 4C9YA 2IBDA 2KMUA 2BGCA 2P6SA 5EYRA 5J1YA 2G0EA 4IF4A 2DO7A 5JFRA 5FO5A 2QBYB 3IKTA 4J19A 4Q5SF 1ZYRF 4M6YA 4CYCB 2LYCA 3Q0WA 1ACIA 4D9JA 3M8FA 5BPDA 4DBRA 4Y17A 2XAGA 4QIWN 3UKGA 4L9TA 1CF7B 3OYEA 4G6TB 4RGRA 4L5IA 1LFBA 4AM3A 4L5JA 2XIGA 3TQNA 2QCOA 2OTJI 5ICFA 2E7WA 4HLXA 2QKLB 1K78A 3TGNA 2DYSH 2ESNA 1Y0NA 1Q1HA 3NARA 1ZAOA 2DTRA 2EZLA 2EINH 2ZJ2A 1LUJB 5KCMA 3EQLF 4AYBN 3CC7I 4UUVA 2IPQX 1V3FA 4KT5C 4P9FA 3RJPA 5BS6A 3JRCA 1V4RA 1T6SA 2O9LA 2ZKZA 4CO8A 2HKXA 1YO5C 2NOGA 3KEQA 3CP8A 1UHWA 1G59A 1YS6A 3IKVA 3ROUA 2ADUA 3P7NA 2CUJA 1K78B 2DTZA 4NBQA 1B6AA 3HL2A 4KN7X 2L7FP 4B8XA 2DA5A 1BI2A 2QSGX 2VONA 2GLOA 1HSTA 5K7ZA 3RI4A 2W57A 3KYCB 2WC2A 2R0QC 2MC3A 4AC0A 5J3LA 1WJFA 3HC7A 2V6EA 3I4PA 4N0BA 4GFBA 3FM3A 5GTIC 3OL4A 2V1UA 3GTMJ 2O6GE 2KDOA 3W6VA 4NHJA 2NVYJ 2QENA 5FKLA 3V42A 2X1EA 2KRCA 4K2EA 2VT2A 4BJTA 3C3WA 4BEHA 2VBXA 4YRVA 2XPVA 3JCUC 3HJEA 1TWAJ 4BQAA 2JZYA 4B47A 1JTYA 3K1NA 1XD7A 3IAS2 4D7MA 2WAQA 2VC1A 4IHWA 4ZDLA 1WWXA 2W25A 5GAHJ 4ZTJA 3W2AA 4A0XA 5B1BH 1BIBA 4M3FA 4UV9A 3V8KA 1OYYA 2XPWA 3B02A 1X4PA 1W4MA 4NC6A 5FKKA 1YHQI 4I09A 2R7FA 2R92J 2QSFX 3CLOA 3F22A 1IV8A 3CCLI 4HA8A 4F92B 3TDZC 4BHBA 4PJJA 3OYFA 3JRIA 4JX5A 3L09A 4KIFA 4NQWA 2QF7A 2LKXA 2K7LA 1T08B 2VN2A 4XL9A 4BEHB 4BAYA 3BWGA 4HF0A 2NVTJ 1G3YA 1Z0XA 3WODF 1IN6A 3IL2A 3LFKA 2DMUA 1V5GA 1U2WA 2XGEA 3DBLB 4XK4A 1F9NA 2Y69H 4KICA 1WI3A 2FRHA 2HPMA 5DV5A 3CDIA 5IYDJ 1SD4A 1YLFA 2NVUB 2XB0X 4KA4A 3IP4B 3FXRA 1T38A 1RZ4A 3H9JA 5FGMA 3MKWB 2NXNB 3V7CA 2FOWA 4XN0A 2HOTA 3WG9A 1Z3XA 2W48A 2YUSA 4RB1A 1J7KA 3LSHA 3MMYB 4U0VA 1BC7C 1K83J 2V7FA 5C44J 2DT6A 1LEAA 5FFZA 2ID3A 2OPTA 3V8LA 3CDLA 2ZJQF 1QPMA 3S8PA 2FJ1A 2CFOA 2W4SA 4L9NA 5TISC 1Z6RA 5M5WJ 2YU9J 2P0WA 5IT9K 2WAQN 3EDPA 3F9KA 3CMEI 1JKRC 2HDCA 2EZKA 2M87A 1IRFA 2CMPA 2QUFA 2QVOA 3BJ6A 2BVLA 3AKZA 3CF5F 4U87A 1IZ1A 2LY1A 3WGGA 1D8JA 2EA2A 1R9TJ 3GX4X 4MFDA 3RKQA 3C2HA 2HXOA 1I3QJ 4C3HJ 4L0YB 1YW9A 1FBQA 3Q9VA 5L3EA 2V4JC 3MKZA 3GFIA 3O3KA 5HLTA 4KT6A 3I4NJ 2OA4A 4ETSA 1SAUA 3DTEA 1KYWA 1DDNA 1O57A 1JE8A 2TDXA 3CO6C 3ZQCA 1H9TA 2EFNA 5JLWA 3CCQI 3BR3A 4JBAA 1I27A 1R36A 1OCRH 4BUPA 3L1PA 3OS0A 4M9XA 2NAZA 3RCOA 3HZJA 5HDGA 1AKHA 4CCOA 4Y52J 4HBLA 2K9LA 4P96A 2DPDA 1MIJA 1JKOC 4A93J 2DODA 1L0OC 4ANJA 3QU3A 1NH3A 5K5OA 5C4XJ 1H89C 1P4XA 1SEUA 3BCAA 2BE5F 2UXNA 1VZ0A 1NK2P 4Y4RA 4L9JA 2M0CA 2DA7A 1B72A 2LF8A 2EFPA 4HV6A 3LA3A 4XORA 2IT0A 2E71A 1TNTA 3LWFA 1ITYA 4BBSJ 3HGYA 1ZHFA 1VI0A 1AKHB 3BTIA 4RAFA 2K9NA 1D8KA 3H3UA 5JVGF 1D1CA 3OR1C 1O7FA 2K3PA 1V5FA 1FPQA 1UJ8A 3HRTA 1VQMI 1EV7A 4LB6B 2YU3A 2XGXA 4DJAA 4IOCF 2P4WA 2VXDA 3QWLA 1A31A 3PQJA 3LAPA 1O3RA 4MHGA 1ZGJA 1ZG3A 1B72B 1DGWY 2IS2A 2VI6A 2XHKA 4UNOA 4QTRA 1BI1A 3GXOA 2DK5A 4I98B 1MJ9A 2JWTA 4ZDOA 4P9UA 5IT9Z 4XM3A 2KRHA 4PJ0C 3PO2J 1NK3P 2L54A 1YG2A 4GO1A 4ENJA 2XDVA 2YX4A 2NNNA 3ZQLA 2OAZA 1F36A 4KIBA 1GV5A 1F5TA 3KZYA 3ULQB 1WHUA 3S3MA 1TNSA 1MSFC 2O3FA 2YX7A 1BA5A 3HTUA 4GGGA 4ZZLA 3CMAI 3HTSB 2E1OA 4CZCA 1X3ZB 3CCVI 2A68F 2CW8A 3IWZA 1LPQA 4EQQA 5CQEA 1YIJI 4LG3A 4PJMA 3K10A 3VEPA 2EFOA 2LG4A 2DA1A 2OCCH 2DOAA 1BR4A 2R7VA 3LSJA 3ZQHA 2HOSA 2OC6A 3BQYA 5AONA 1W5TA 2FQ3A 2L7MP 1FNNA 5FLMJ 3GO5A 3PNYA 4M3BA 1FX7A 3CMYA 3KZIC 2CQQA 1R5HA 2E1CA 3OYAA 1AHDP 3G73A 2MFZA 3K4LA 3SEQA 3OYCA 1MJAA 4DOZA 4E70A 3CJRB 4OU0A 3OSFA 2A5YB 4YEJA 3HOYJ 3PM1A 5JHUA 5K7HA 3FISA 2BZTA 4CCLA 3SQNA 4GYGA 1JJ8C 1SANA 3B6AA 2ELHA 1Z21A 4E4HA 2Z16A 4ZC3A 3F3XA 3KPHA 1MMGA 2DQRA 2ZXWH 5HLIA 3BJOA 1LFPA 1DPUA 3BR2A 4JYKA 5FD6A 1HW1A 2F4OB 3ML6A 1G6NA 2JN6A 2B0LA 4E7IA 4QLCU 3C2BA 3IWFA 4E7SA 2C6YA 3S1NJ 1DU0A 4CHUA 2XSJC 4FETA 3MD2A 4XSXF 2IS6A 2VASA 3TDUC 2HYFA 3OYJA 2HOAA 2GAUA 1BJZA 3KYLA 3VPRA 1P4WA 3QYEA 5EGOA 1FIPA 5J40A 2P5LC 1MMAA 3HOSA 2MLGA 4DYQA 2K9QA 2DCEA 3FM5A 3K2ZA 4PZJA 2ECCA 1F43A 2BY2A 3E5QA 2DDAA 1YOVB 5C3EJ 2RV8A 3JW4A 4OMYA 3R0JA 4XMYA 3OYLA 4WCGA 3MKYB 3BCBA 2EFQA 3HG9A 4F3QA 3OYIA 1P7JA 4RGXA 4BL0B 1PP7U 4MFEA 1IW7F 2QQBA 4G7OF 3A1YA 1UELB 4XLEA 4XOTA 3KLNA 2HU9A 2VQCA 3BG9A 3KCCA 2LP0A 2X6WA 5JVTA 2M0MA 5EGOB 5B5EC 3M9AA 3ZQQA 1XGSA 4WX9A 1Y39A 1ENHA 2CUZA 1Z7LA 5DD4A 1R7JA 1UG2A 1LNWA 3CJQB 1XX5A 2DLLA 3DQVC 5FLVA 2LSOA 4G12A 5M5YJ 3VSLA 3H5NA 4PJNA 1VQKI 3AG4H 3SJMA 1MBGA 1A6QA 3BG5A 5ERIA 4RDUA 1JUMA 3KE2A 2HEOA 1U3EM 1G3SA 4FASD 2DFFA 2E1NA 1CGPA 4A3IJ 2OTLI 3WTYC 5DTDA 2OF7A 2L0KA 1FIAA 5FROA 2MYSA 2HOEA 4S0HB 3ZMTA 2YS9A 3A0HC 1FP1D 3ERMA 3ISPA 4PK4A 1JT6A 2LNBA 1A04A 3K4KA 4LITA 4WXDA 4CZZA 1D5VA 3CCEI 5HODA 4L9VA 4KFCA 1FWZA 3SYTA 3Q9SA 1TLHB 3U9GA 1JTXA 4A6DA 2R7SA 2DJIA 2E7XA 2HZDA 4ZYAA 3HM5A 2XKOA 2H8WA 4BBRJ 1U5TC 3IH4A 1X2NA 1QVUA 1NG7A 3BLYA 4E7JA 1PUEE 1ZLKA 3K0LA 1PYVA 4XLFA 4XNFA 5IPAA 4L0ZB 5E3MA 2FOKA 3HYIA 5H6RA 3EUKL 4UUSA 4HDVA 3PNVA 2MG4A 3EYIA 1EH7A 3FHZA 1SFUA 1X2MA 5H6QA 3GWZA 5E20A 4X0GA 1Z6TA 1SVOA 1V55H 3GZNB 3QODA 3A4CA 4AIKA 1Y1WJ 2FBIA 3ABUA 3CCYA 5JLXA 1J2XA 2XPUA 2M5WA 2Q2EA 1T56A 2BOLA 2OZ6A 2VJJA 3CF2A 4B3XA 2EZIA 1CQTA 1ZRCA 1N25A 1TWCJ 3PIOF 2KISA 1ZR2A 2XF7A 2KL4A 3KP7A 3A02A 5DUKA 4YG2F 1VQOI 1ZR4A 1XGNA 3TBIA 5HDNA 2Y9ZA 3V7RA 4UUSB 2DYRH 3BP8A 4EV0A 4PJLA 1V5EA 1ETXA 4RLQA 5L3BA 5HS7A 3N4MA 3H36A 5GAGJ 3AFHA 4U88A 2JPCA 1S29A 3I59A 2PMZA 4PCQA 3FMRA 2HDWA 1QZZA 2IA1A 5HNHA 2D2WA 3W6KB 5KVRA 1MSEC 1H0MA 3AL0C 1ON1A 3QPLA 3U2RA 4IVNA 3ABTA 1BI0A 1PP8F 2CJJA 2Q2EB 2CUFA 3PIPF 4ENKA 1REPC 1K6YA 3OOUA 2JPBA 3NQOA 3D5SC 1POGA 2ID6A 3HRMA 5KK1A 1TC3C 4XICA 1EJ9A 1IAWA 2DFIA 5FKOA 2QQAA 2DK8A 1GVJA 1D1BA 3P5JA 3G1LA 2F5FA 3PNTA 1UFMA 4WXCA 3I59B 1FYMA 4WK8F 4HQEA 2M7BA 4A0ZA 3OYDA 3HOWJ 3E5UA 2WAEA 4ZYEA 1IJWC 2CW0F 4JX4A 2Y48A 3C7JA 3WTZA 1O4XA 2B63J 5KAFC 1R1UA 1XMAA 1VQ4I 5ICEA 3I55I 3KLOA 2O0YA 5EZHA 4I02A 1HDPA 2GZWA 2M2EA 1J09A 3W3CA 1FSEA 2M9HA 5DEQA 4HNTA 1SC7A 5M3MJ 3ZMVA 5J4YA 2X0LA 2KKOA 1UHSA 4G7ZF 4M3EA 2XSDC 1GXQA 2AS5F 2H94A 3HIFA 4C2TA 3W2WA 5FLXZ 3M1CA 5HLGA 3H5RA 4LFUA 1I1GA 4RLFA 3QYBA 2E36A 1WJBA 2JT1A 3K70C 5FRMA 1ETQA 5H2FC 4IEJA 1IGNA 3AG1H 2PMZN 2ZSHB 1I50J 2K9SA 1ZKGA 2BYVE 5F64A 3GTJJ 2RN7A 2EIKH 1X3WB 2VKEA 5CVJA 4DYCA 4QWQA 1T33A 3GLLA 4HSTA 4V19K 3FXUA 3JRHA 2LKPA 4AYBA 1LVKA 5CPRB 2HQRA 1GDTA 4OIPF 3BG6A 1OR7A 2R7DA 1RC9A 5IY5H 2E5ZA 4F7ZA 4GCVA 5BMZA 1YIOA 2A05A 1L3LA 4EVIA 3GEZA 1E17A 3ZMZA 3SZPA 4EM0B 5E18F 3NWSA 2W7NA 1KGSA 2ZMEC 5D6EA 4LK1F 4HLYA 4BDYA 2V1DA 3LNQA 3GTLJ 1QRYA 3HSRA 3MCZA 5E3OA 1TQIA 4IJAA 4C3IJ 2HPIA 2QEXI 4KISA 3QP6A 1RESA 4XSZF 3L2VA 4DIQA 3Q0UA 2RVCA 3CESA 2KDZA 2FNPA 3FHNA 3RYPA 2LY9A 1JHFA 3S15J 4UVAA 2H6BA 2VKHA 3T1BA 2VQGA 1T0FA 3SZTA 3D1NI 1FOKA 1KYZA 5FKMA 5K7FA 3A2KA 4E7LA 1YX3A 4HRIA 2EIJH 3BR5A 3K4CA 4U0YA 2L7ZA 3P9IA 2VXZA 4WXHA 4KMUX 4R79A 2D45A 3IH2A 2XB5A 3KEYA 1WKMA 5J1UA 4B3AA 4KUMA 1T98A 1TQPA 5LD2C 3ZGKA 2P6TA 2VPRA 3SDGA 5CVRA 3WGIA 1MKMA 1FLIA 1UB9A 2VKVA 3F8MA 4BHCA 1B59A 4AIHA 4JOMA 3K4MA 1MJBA 2XRNA 4R1HA 1TT0A 3LSKA 2KPMA 2M45A 4HEA2 4A3BJ 2X6XA 1MBFA 5CLSA 1AOYA 2XF6A 3B6CA 4LIVA 4ZJZA 4KITB 1BM9A 3HHGA 3FDYA 3CO7C 2VT3A 1BC8C 1JT0A 4IO9F 3DU5A 3QU6A 4BY1J 4BNCA 3OSGA 3OR2C 3DWLE 2GOMA 2QLZA 4I0BA 2L3DA 3UR3C 3L2WA 4H0EA 1I3AA 5E8IA 2JRTA 3G1MA 3L2CA 1MBEA 1J5YA 4G94A 1E3OC 1E2XA 4HNUA 1EA3A 3K4NA 1PJRA 4IHYA 2PG4A 2Y9YA 4LGWA 2UV1A 5E1XA 2MBFA 3CCJI 2LTPA 3JTHA 2AXLA 3PFIA 4CSWA 4A3FJ 2ZCWA 3BC8A 3DBHB 2XVCA 3NAUA 2IA2A 5CQGA 1ZGAA 4W97A 2M7AA 1U78A 2H8RA 2P5VA 2F5VA 3QAHA 4UHTA 3M3YJ 3GZ5A 5BOXA 3F8FA 5LGUA 4F93B 2KJBA 5A2QZ 5EEHA 2FQ4A 1HLVA 4FX0A 2UUZA 2VB6A 5HLHA 1VQNI 2ACJA 3Q3SA 2LD5A 3BTCA 3ABLH 1FBSA 3ZN1A 4AIDA 2M8GX 1YITI 1ETOA 2LH9A 2MH2A 4A3JJ 4L5EA 4MEYF 2EIMH 1ETKA 2DMQA 2HYJA 4ZYGA 1H9GA 1MBHA 3SEZA 2DJNA 1AA7A 1MD0A 2ELJA 2ETHA 3M4OJ 2DA6A 3CCSI 2BEOA 3HPGA 3F21A 3DP7A 1UCRA 3OY9A 1GUUA 3I3LA 1MBKA 2MC4A 1OCCH 2EZHA 1ZG1A 3HUGB 1MMNA 2I10A 4M71A 1XCBA 3EUHC 3HHHA 3ZOBA 1I6XA 3CJNA 5GTHC 4LLGF 2WBMA 2E60A 3D5RC 3OYHA 4D0PA 5F6FA 2PI0A 2GXBA 4EEFG 2L2OA 3DKXA 2IJLA 4IL6C 1MGTA 2Q1ZB 1LFUP 4YIIA 1GVDA 2ZC2A 4IHSA 1KQ8A 2ZXIA 2ZO4A 3G1OA 1LDDA 3DKWA 3MKLA 4IPAA 3K4JA 1P7IA 1XGOA 2K86A 3NWTA 1JI8A 1Y8QB 1U0JA 3TMOA 2DN0A 4FT8A 3HOZJ 2UXXA 1D0ZA 2LY2A 3WHCA 4ZTFA 3HOUJ 1XDSA 2CU7A 4EJUA 3GLXA 1FOYA 4MEXF 1S6LA 1RETA 3DBRB 1VTNC 2R7OA 3S2DJ 3OL3A 2BV6A 2E1MB 1IV6A 1J59A 2NRAC 4BQQA 2YPRA 5AIPA 4N9HA 4Q48A 5K5RA 2E35A 3V4GA 2M8EA 2KFDA 2Z5UA 1IRXA 2WA0A 3RKWA 2OQGA 2K4JA 1QQIA 2OV7A 4RAYA 4LLLA 4A5MA 9ANTA 1DU6A 3KP6A 3T5XA 3OOPA 4HDUA 3FKJA 4IHTA 1I1SA 2XKPA 1IF1A 2V9PA 3CUOA 1BI3A 2DI3A 2JA5J 1P6RA 2JA7J 2PX9A 5AIQA 5HS9A 1LDKB 1K4TA 2Y0SA 4R8HA 1W0UA 2HXIA 1A5JA 1ZREA 2RDPA 1HKTA 3KP4A 2L02A 5FJ8J 3ZRGA 3GZ6A 1USTA 5L3DA 3F23A 5HNFA 1UAAA 2HI3A 1YJNI 2EV5A 2V9KA 1ERDA 2K3FA 5B3SH 5LHHA 3QPSA 1XGMA 2OD5A 5L3FA 3C1DA 3BZKA 2KT0A 3ESWB 3J80K 3CC2I 2X6YA 3S2WA 3TOAA 1WJEA 2R93J 2VJ5A 4FHTA 1E0EA 2CH0A 1LJ9A 1R71A 3LQRA 2LRDA 3BG7A 4XKBA 1UMQA 1WCMJ 1U9NA 2JUGA 1OCZH 2XROA 2ME0A 3BTLA 1Z77A 1LE8A 5E79C 3E1SA 1W5SA 2ECBA 1R23A 5H20A 1JKPC 3E6BA 1HQCA 4A69C 2TCTA 5EG0A 3DTKA 4BDZA 2DT5A 1KU3A 2MH9A 3K70D 1VQ5I 5LRSA 3CUQC 1R5GA 1B9MA 1TBXA 4C2UA 1R00A 1R22A 1IN5A 1IXCA 3E6DA 3H9QA 3RYRA 4E7HA 1Z3YA 4B43A 2EJRA 4CGZA 4MQVA 4EATA 2NS0A 3CLQA 3QPHA 2Y0SN 3WTSC 1VQPI 4H4KC 3GVAA 4ZH4F 1HA8A 4PGHA 4FX4A 1XPXA 3RKXA 1LE8B 1A35A 5IYCJ 3E6CC 1FY7A 1KQ0A 2K85A 3A01A 3H35A 4RS8A 3L2QA 1ZRDA 4Y33A 1S7OA 3SFIA 2VE8A 2LOOA 2O61A 4IRIA 5EG0B 2HVQA 2VJ4A 1E3HA 3DEEA 4PSXA 1KU2A 2IA0A 3TO7A 2A6TA 1FC3A 3ZR8X 3FF5A 3LMMA 3N05A 4M3GA 4M9SA 1B9NA 2CQ7A 2CS3A 1W36D 2DFEA 3FXMA 1G4DA 2Z1DA 3TP0A 1ZELA 2DU9A 2QWWA 3VOEA 3LL7A 1Z05A 3TP3A 4O6JA 2CV0A 4WWCA 3HOTA 1A36A 4Y3OA 2A61A 1JKQC 2DMNA 2L7KA 2OJED 1SFXA 3WG7H 3GTGJ 4DGWB 3A01B 1EH8A 2JRMA 3BTJA 2FU4A 2FUG2 2JSPA 4OIRF 4CCKA 1TTYA 3K69A 3U1DA 1XG1A 3PJRA 2QQ8A 1M1EB 2K5CA 5FFXA 3OWTA 2KIMA 1N78A 2VBWA 5HOOA 4IQ4A 5F0HA 1FOXA 4XOPA 1OPCA 4LJZF 2ZFWA 2BW3A 4JK1X 4B1RA 4BXXJ 3J80Z 2KRFA 4GRIA 4U0WA 4G7HF 2JUCA 2CW7A 3NEUA 2BY3A 3GF2A 3VSKA 2QZ8A 1XCVA 4DQ2A 1BOAA 2IGNA 1F1ZA 3RSNA 3FBNB 4BU2A 3J7ZI 1LQ1A 2IGOA 2LC2A 2LK2A 3GUDA 4BXFA 2CQNA 4I0AA 3ABKH 4W1UA 4YFNF 3I56I 4IOAF 2BY1A 1MNMC 5B66C 3JAMK 4Q4ZF 1ODDA 4A3CJ 1IDYA 3GCMA 1Y6IA 1SAXA 2X1CA 2B7EA 2BW3B 4FE4A 1USSA 3S17J 1A6IA 4HW0A 2R5YA 4N4OB 3IAM2 3BOQA 3ECOA 2H6CA 1TW3A 4LOCA 2DXIA 4MLOA 1G3TA 1FJLA 1JGGA 4ESFA 3RPUA 2FMYA 1G3WA 4NC8A 2V26A 2M4KA 2FX0A 3HDDA 2IXSA 1OCPA 4BS9A 4CCJA 2HTSA 5JI6A 5BPIA 3PO3J 2A3SA 4EGYA 1U6GA 3W2VA 5BQTA 2IW5A 4KYWA 1DP3A 4EJWA 2R5ZA 2ISYA 3JRDA 2FEZA 1SVLA 3BG3A 5F1JA 2R5YB 3PSIA 2IRFG 4YELA 4CYDA 1WJCA 1YYVA 2L9NA 1OKRA 4A3LJ 4XIDA 2CO5A 3IV5A 2RAEA 4OINF 1I5ZA 4B4CA 1WI9A 4XRMA 2VPLA 2HR3A 1R1VA 3W6JB 5F1RA 3UNGC 3TW6A 3A0BC 2HDDA 1EH6A 4KNYA 1VQ6I 3FBIB 2A6EF 1KQ9A 2L4AA 2VQLA 2RNJA 2BXZA 3CC4I 3T8TA 1T2KA 4IQJA 4XLHA 1XMXA 1KZHA 2NOJB 2M3AA 2R5ZB 2BXYA 1OCOH 1SD5A 2Z9OA 4UUTA 4ENNA 2H09A 1MNEA 2PJRB 5D4SA 2DOEA 3U21A 5D8KB 2FA5A 2MSYA 1X1AA 1JUSA 1OMIA 3I53A 2H27A 3BPVA 4F91B 3RPUD 4HV5A 1OISA 3RZDJ 1BW5A 3ZN0A 2I8DA 3HPHA 2RNGA 3LA7A 2IAIA 1ZARA 3HRSA 3U1KA 4BJ5C 2PQ8A 3CTAA 4BGDA 4S05A 3BPXA 1O7LA 2XUBA 2ESHA 1YRNB 1HKSA 4IRGA 2CSOA 3I71A 3HKZA 4P1WA 2DA2A 2EBIA 3CCUI 2PN6A 4RGSA 3JAMZ 3RZOJ 4MTDA 5CVUA 4UVBA 1K6OA 2WADA 1VNDA 2QGUA 3DPTA 2Y31A 1TP4A 2JMWA 1PUFA 1F4KA 1FMWA 4D1QA 3GTKJ 1J9IA 4M73A 2QA4I 2OQRA 2L4MA 1HSJA 2X85A 5J1RA 4B44A 4CCNA 5ILVA 3E6MA 3H92A 2DPUA 4XR6A 2K40A 3J7AO 3KP5A 1TW2A 5E3LA 4HAMA 2LR8A 3WE2A 3RQIA 5LEJA 3VODA 3I9V2 3KYDB 1ZK8A 4XONA 4C30A 3PFYA 1MBJA 1XS9A 1P92A 2P81A 3AG2H 4D7NA 3O8GA 1J0RA 3HXLA 1PUFB 3LSIA 5J4VA 2DW4A 2HVSA 2FSWA 4Y13A 5IP9J 2IP2A 5IP6A 2O8XA 2V9VA 4UXNA 3VYSB 4B09A 3TKYA 2WTEA 2KIQA 3BZ6A 4D5CA 1B8IA 5GPAA 5C4JJ 3J7AY 4G6DA 1W0TA 1FSHA 1LB2A 3COAC 1UZCA 4XRSA 5HS8A 2BY0A 4XBFA 3G3ZA 2RQQA 6PAXA 2E5NA 1O3SA 4MQ9F 3HKZN 4M72A 2EH3A 1XTAA 2RC4A 4EJTA 3O6BB 4PGGA 3D5LA 3WE3A 3ZP5A 4IX7A 2FMLA 2LFBA 2LKSA 3HRUA 3I54A 2Y0MA 4CICA 4HSRA 3CDHA 1FBUA 1Y56A 1S5LC 2LVSA 1YTYA 5IP7J 1HCRA 5D5UB 1N77A 3KFWX 3K1PA 1B8IB 2VBZA 2XAUA 2Y75A 1Z1DA 5IOYA 1BW6A 5DYMA 2IGMA 2DMPA 1OLTA 1GHCA 1ZLJA 1IN7A 2AO9A 3HBLA 4X6AJ 4FQGA 5EF6A 2JA8J 2WY7Q 1R49A 3DFGA 1QGPA 5CJ9A 2KIUA 2G7UA 1U9OA 1KU9A 1FMVA 2E34A 5CYVA 3F6VA 4LD5A 4NB5A 4NC7A 3RPQA 1YJWI 2LDUA 3OYNA 2WWYA 2HNHA 2O8KA 1DPRA 3MVPA 2RGVA 3R60A 3F8NA 4P55A 1QPIA 1YW8A 3S93A 4FE7A 3J7YJ 2XC7A 1TWGJ 1AU7A 5CVVA 1FZPB 4HYEA 5DCMA 2R4GA 4YFXF 1OQYA 2BBYA 3FKIJ 1YX5A 5ICCA 4ZYHA 2W84A 1HBXG 4OAYA 2Q8KA 1GXPA 3OIQA 3DLAA 4ZYDA 4IRHA 1BR2A 1WFXA 4AVPA 3S16J 1WPKA 3QQAA 2L9SA 4E7ZA 4IXAA 1YS7A 1TQMA 2JVGA 4FTHA 1D3YA 3RKYA 1MDMA 1X58A 3G71I 1SFKA 2AQFA 1RUNA 1T95A 4E7KA 3FIWA 1IXRC 1XMKA 2WY8Q 3S32A 2JVHA 3GMEA 1S3JA 3P9CA 2FF4A 5DCMB 3F8BA 2F5EA 5J47A 3V7SA 3IC7A 4EGZA 2L9VA 5LRRA 4CCMA 4B48A 4YIRX 2FNAA 1TL8A 4Y7NJ 1FYLA 2WB1A 2N8GA 2F5CA 4P5OA 4M9ZA 4RAZA 1WH5A 3N97A 4GDFA 3GFMA 4AIJA 1MDMB 2XGDA 1FT9A 3TO6A 3H1CA 3MZ8A 1VFCA 1TT5B 2WAFA 5EDNA 2GA2A 4U7DA 4A3DJ 4I76A 4I6ZA 4XRFA 2KLOA 2L9RA 1O3TA 5ILUA 4A2UA 4BJ6C 3L2UA 2HVRA 3QP5A 3WTTC 1S7EA 3PUBA 4BY7J 2PMUA 3R4KA 4DZJA 3BZCA 3KIOA 2F4MB 1P9QC 3DEWA 3ZQIA 2KHMA 3H0DA 1LDJA 2IVMA 1X19A 2DAOA 1BR1A 2H1LA 2LBFA 4RAGA 4BE0A 5F08A 5IYBJ 2JK3A 2X9DA 1HXDA 2NNYA 3DU6A 1JXSA 1K61A 1BBYA 3WU1B 3MZYA 4HX7A 4CXFA 1D5YA 1BL0A 1Z67A 4U7BA 2W85A 3M1EA 1H8AC 4HX4A 4CDGA 1Z91A 1IG7A 1MH4A 1STZA 1QZYA 2QKMB 1RR7A 3JRBA 3JSOA 4BACA 4BYYA 1ETWA 3FMQA 4N9IA 1APLC 1QU3A 2TRTA 3VYTB 1TWHJ 2M4GA 3K4BA 4M6XA 2WB1N 2LBFB 3RQ4A 1R5ID 2AXTC 1KONA 2F48A 2WV0A 5JHFA 1EF4A 3OMYA 4GYIA 1U5TA 2W82A 2ZFUA 2NVXJ 5EJCA 3X2QH 2VIXA 1D1AA 3CMMA 3LSTA 5IOZA 2DA3A 3GTQJ 1SD6A 3HUGA 2DOFA 3HOVJ 3H3ZA 4UB8C 3WU0A 2VE9A 4II2A 3K6GA 3ZQGA 3FXLA 1EKEA 5E3NA 4BE1A 1X1PA 2O5RA 4AU7A 2YR2A 2MLKA 2NS8A 4KMFA 2V79A 2GQQA 4XN3A 4OIQF 4X1EA 3ZXSA 3CCRI 2YSRA 3K7AJ 3ZPLA 4L18B 3E97A 1T8IA 2OUMA 2VUMJ 1U5TB 2NVQJ 2PFBA 1E3PA 1QVTA 3CP2A 3DPLC 1UHMA 5ICGA 1RPWA 5M5XJ 5EEGA 2LF7A 2DDBA 3SHFA 3V8JA 4BQOA 4HPQA 2R3SA 4OAZA 2KIFA 3K2AA 2HQAA 1ZQ3P 2G9WA 2K9MA 4RM2A 2ZJRF 4A0YA 3SZGA 5E8GA 4XLCA 3L9FA 5L3CA 1ZTRA 2X51A 3QOEA 3VB2A 3JRAA 2UWMA 1UG0A 4BHPA 2JSCA 5F04A 3H3VK 3K9TA 4MNUA 2RREA 4ZZDA 2O03A 3DTIA 2A6HF 5HDKA 3OV8A 2VQHA 3KETA 4RA2A 1U8BA 5E1ZB 3FK7A 5F27A 1MNDA 1X1DA 1B4AA 3FMSA 4PUSA 3PSFA 2HKOA 4EJOA 3F72A 1RUOA 2ZNZA 3MEXA 2BVMA 3BROA 2EWNA 4UV8A 1G8XA 3E7LA 4OWRB 2F6CA 4AD9A 1ONVA 1DQUA 4OOIA 4QPQA 1VQ8I 2GIZA 4C3JJ 1YFHA 4AWXB 4V2GA 4NQWB 2GM4A 4ENMA 3OYGA 3S14J 4A3GJ 1RRJA 1JHHA 2KZGA 3AL0B 2E19A 1YW7A 4XLAA 5F0CA 1HW2A 2JA2A 2XAFA 1Y1VJ 3BY6A 2X48A 2K4BA 1YQAA 4NUBA 3CD6I 1BN5A 3L7WA 1DUXC 2DMTA 3KX2A 3JRFA 2FE3A 1HW5A 1WJAA 2M34A 2LLKA 1RIOH 2Y2ZA 3FXKA 5LFAA 3J81K 1QZEA 2PEXA 3RDIA 2ZJPF 1O3QA 2STTA 3MQ0A 3DXJF 4DW6A 1XSVA 1GV2A 2QSHX 2ZNYA 3FX3A 2EA4A 4XQFA 1BJAA 4UY8I 1MH3A 4MTEA 1WH7A 2Z3YA 1MZBA 4ESBA 1IC8A 2Z99A 4I01A 4BQNA 2CRGA 3S2HJ 2JQ7A 2Z2SB 2V1NA 3HEFA 1VF9A 4LMYA 4M3DA 1GT0C 2CGPA 2R7UA 5F0FA 2HFHA 1Z9CA 4XLPF 4OMZA 2NS7A 1W7PA 2ZMEA 4EJVA 2OZUA 4UVCA 1VQ9I 2K27A 2BHZA 1YJ9I 3BQZA 4LB5A 2CFXA 3LSMA 3EUAA 5TGTA 2R7XA 3SDBA 3OYKA 2B9SA 1WRJA 2HS5A 3AG3H 2D1VA 2J5OA 4Z6YA 1R58A 4EMSA 3E0JB 1WJDA 1FOWA 2L01A 2CQKA 1ORKA 3MZHA 3WU2C 4NDLA 1XSDA 4RB0A 3GYHX 1RKWA 1QBJA 2HWVA 3BR0A 1LKXA 2GXAA 2HQNA 2IS1A 4OIOF 3ZMDA 1W7PB 1LVAA 2ZMEB 3E3VA 4DYRA 1BIAA 4BKXA 3WTWC 2A5WA 3C18A 1NTCA 2R7QA 4HZFA 1Y0UA 2STWA 2MW8A 2Y30A 3I64A 2V6CA 3AAFA 3BJAA 4XKCA 2FBKA 2HTJA 1Y8RB 4ON0A 2L5QA 2XF5A 3E5XA 3FWEA 3R61A 4A5NA 5CKTA 1RR8C 4G8XA 3GFLA 4TV7A 2V1XA 4MIMA 4MO7A 3I58A 1XB4A 4JQFA 5DUIA 4M74A 5GP9A 1D0XA 1S72I 5BNGA 5DM6F 3OS1A 3P9KA 2CYYA 2FD5A 2QQ9A 1XDUA 1OYIA 1W7PD 3BT9A 5J6XA 3HGGA 4RBOA 5LGTA 2HZTA 3D0SA 3JTGA 1IN8A 1JGSA 3LQQA 5EEAA 3ECHA 5DM7F 1OCTC 2AQEA 2CV1A 3J81Z 2RKHA 3PUFA 4O5VA 3WTUC 3IRQA 2CV2A 2VOOA 2MA3A 1R1TA 4IHVA 3ZQFA 1MMSA 5JR3A 3H0GJ 2XRLA 1X1BA 4N4NB 4J00A 4Y15A 2P7VB 2VC0A 1KU7A 5D5VB 2ZBKA 4KIGA 3ELKA 4IZZA 4G9YA 4KDPA 3TEDA 3M7GA 2ZB9A 1DGRM 5EZGA 4IKFA 3HSEA 1OJLA 1Z7UA 2Z33A 3TO9A 3SXYA 2P7CB 1QO0D 2XASA 3ONQA 2W1OA 1R4MB 3ZCOA 1WSUA 3LA2A 5DDGA 4HF1A 1FEXA 4I99C 1PVEA 1W5CC 3WGHA 2PMHA 5E17F 2XV4S 3M8EA 4QSHA 2QYOA 3O2PE 3LSRA 4G6QA 1IXSB 1K4SA 1TZLA 3GW2A 4AVZA 1IUYA 1ETVA 4II3A 3OS2A 4IHXA 3NRVA 4DBQA 3EETA 2GIVA 2MABA 3TOBA 1RNLA 1IDZA 1OR7C 2VODA 5B1AH 3DCFA 5J8FA 3B73A 4HF2A 1MW7A 5KHDA 2ZSIB 2ISZA 1HKQA 3CJTB 4A3KJ 4RMNA 5D4RA 3EUHA 4DZPA 4HNVA 2DT7B 2RQPA 1U8RA 1X1CA 2I5UA 2XAHA 2R7TA 4JX6A 4I7HA 5DCFA 1ULYA 2X4HA 5D5XB 2VKDA 1IRZA 4AUXA 2DA4A 3S3OA 1XC5A 1OYWA 3GBGA 3IH3A 2ICWG 4LLNA 2X1DA 2X6OA 2DFHA 2EPFA 4ITVA 2VLAA 3R6SA 3QPTA 3KZZA 4YIFA 1T39A 2KQRA 5K5QA 5J8CA 3S1QJ 1AWCA 2J5PA 4PDKA 1T0FC 4XLNF 1H88C 5FRNA 3OIPA 3G6EI 3VDXA
chains in the Genus database with same CATH topology
1AKHB 3BTIA 2DMPA 2K9NA 2AO9A 3TW7A 2EQRA 3HBLA 2FQ4A 3A03A 1HLVA 4X6AJ 5EF6A 2JA8J 2O7OA 3CQZJ 3Q3SA 2LD5A 2E2JJ 3BTCA 4V2FA 1U9OA 2AHQA 3LSPA 2M8GX 1ETOA 4A3JJ 4L5EA 2O8KA 1B72B 3MVPA 1ETKA 1QPIA 1YRNA 2VI6A 2DMQA 2HYJA 4QTRA 3WHBA 4FE7A 1MBHA 1TWGJ 1AU7A 1I6HJ 1HOMA 2DJNA 2JWTA 3FKIJ 3GTPJ 2WV1A 3PO2J 3M4OJ 2DA6A 3BR1A 1NK3P 3GTOJ 1GUUA 1MBKA 2EZHA 3ZQLA 3S16J 3QQAA 1F36A 1WPKA 1GV5A 2I10A 2GBYA 3ZOBA 4FTHA 1MSFC 1X58A 1BA5A 3S1MJ 2E1OA 3FIWA 4EEFG 4C2MJ 1G2HA 3JRGA 1TWFJ 1LFUP 3OIOA 1GVDA 4ABZA 2DA1A 3LSJA 3G1OA 3ZQHA 2HOSA 3BQYA 2L7MP 3JREA 3MKLA 5FLMJ 4M3BA 3CMYA 4Y7NJ 2CQQA 1P7IA 2N8GA 2H1KA 2DN0A 1WH5A 2JJ7A 2E2HJ 1AHDP 3HOZJ 3WHCA 3HOUJ 2XGDA 2CU7A 2ELKA 3O8HA 3OSFA 1VFCA 1RETA 5EDNA 3HOYJ 3PM1A 5K7HA 3S2DJ 4A3DJ 3FISA 4I76A 4I6ZA 4A3MJ 1IV6A 2L9RA 4FISA 1JJ8C 1SANA 3BR6A 3B6AA 1HF0A 1ETYA 1S7EA 2XGCA 4BY7J 4XRSG 4DZJA 3DEWA 3ZQIA 5FKNA 9ANTA 1IUFA 3BR2A 4JYKA 1DU6A 1FTZA 3HOXJ 2JN6A 5F08A 3C2BA 2JK3A 5IYBJ 5DS9A 2X9DA 3S1NJ 1DU0A 1K61A 2ME6A 2JA5J 2COBA 2HOAA 2E2IJ 2JA7J 1BJZA 1D5YA 1BL0A 3VPRA 3JR9A 1H8AC 1W0UA 2HXIA 5EGOA 1IG7A 1FIPA 1MH4A 1A5JA 1RR7A 3JRBA 4DYQA 5FJ8J 1ETWA 1APLC 2TRTA 2K9QA 1Q1VA 1TWHJ 2HI3A 1JUPA 2ECCA 1F43A 2WB1N 3QPSA 5C3EJ 1EF4A 2KT0A 4M6VA 1OFCX 2NVXJ 2MGQA 1P7JA 4MFEA 2R93J 2CQXA 2R7ZJ 3BG9A 5IOZA 2DA3A 2LP0A 3GTQJ 5EGOB 3HOVJ 3LOCA 1UMQA 1WCMJ 1U9NA 3ZQGA 5E3NA 1ENHA 5M3FJ 1HDDC 2ME0A 1UG2A 3BTLA 1Z77A 2NS8A 1LE8A 4X1EA 5FLVA 2ECBA 4G12A 4FCYA 5M5YJ 3HB9A 3K7AJ 1JKPC 2D5VA 4A69C 3SJMA 2TCTA 1MBGA 3LSGA 4D5FA 5EG0A 3I4MJ 2VUMJ 3BG5A 2IEKA 2JA6J 2NVQJ 4RDUA 1QVTA 1JUMA 1RPWA 5M5XJ 3F0CA 4A3IJ 5GPCA 1ZGWA 5DTDA 3K2AA 2OF7A 2L0KA 1ZQ3P 1FTTA 1FIAA 2Y0SN 4S0HB 1ZTRA 2YS9A 3JRAA 1U78A 1WGXA 1LE8B 2H8RA 5IYCJ 1JT6A 5F04A 2CUEA 3A01A 3H3VK 5HODA 3SFIA 5EG0B 1U8BA 3FK7A 5F27A 3MN2A 4CYCA 1JTXA 3Q0VA 3S1RJ 4A3EJ 3HM5A 4M3GA 1JJ6C 3E7LA 4BBRJ 2HQ5A 1SFOJ 3IH4A 1X2NA 4JP0A 1QVUA 3TP0A 3TP3A 5IPAA 1RKTA 3FK6A 1JKQC 2DMNA 2IBDA 5E3MA 4C3JJ 5EYRA 3GTGJ 5J1YA 4UUSA 2G0EA 4V2GA 2GM4A 3A01B 3S14J 4A3GJ 2MG4A 1X2MA 3BTJA 2E19A 4J19A 1Y1WJ 1XG1A 5F0CA 4CYCB 1Y1VJ 3Q0WA 2X48A 3CCYA 5JLXA 2XPUA 4QIWN 5F0HA 3UKGA 1T56A 1CQTA 2DMTA 2EZIA 3JRFA 1LFBA 1TWCJ 4B1RA 4BXXJ 2QCOA 2M34A 2LLKA 1ZR2A 3A02A 2Y2ZA 1ZR4A 2Y9ZA 4UUSB 3NARA 2EZLA 4DW6A 1GV2A 1ETXA 2LK2A 4AYBN 4W1UA 3JRCA 1MNMC 1MH3A 2O9LA 1MSEC 1WH7A 4A3CJ 3QPLA 1IC8A 2NOGA 2CRGA 1IDYA 3S2HJ 2CJJA 3HEFA 1VF9A 4M3DA 1GT0C 2CUFA 4FE4A 5F0FA 3S17J 1A6IA 2R5YA 3OOUA 2DTZA 4LOCA 4MLOA 2L7FP 2NS7A 2DA5A 1FJLA 1POGA 1JGGA 2ID6A 2GLOA 5K7ZA 4XICA 1TC3C 5FKOA 2R0QC 4AC0A 2FX0A 3BQZA 3G1LA 5J3LA 3HDDA 1OCPA 3HOWJ 4GFBA 1IJWC 3GTMJ 4JX4A 3PO3J 1O4XA 2B63J 3W6VA 2NVYJ 5FKLA 5EZHA 2R5ZA 3JRDA 1HDPA 1ORKA 3BG3A 2M2EA 5F1JA 4NDLA 2M9HA 2R5YB 1RKWA 3M3YJ 5M3MJ 3BR0A 2XPVA 1TWAJ 1UHSA 1JTYA 4M3EA 4A3LJ 4XIDA 4D7MA 2XSDC 4DYRA 3IV5A 4IHWA 2RAEA 4B4CA 4BKXA 4XRMA 1NTCA 4M3FA 3TW6A 2HDDA 2XPWA 5FKKA 2MW8A 2Y30A 1ETQA 4IEJA 1IGNA 2R92J 2PMZN 1I50J 2K9SA 1ZKGA 3GTJJ 1H88C 2VKEA 3JRIA 4JX5A 4DYCA 2R5ZB 1T33A 2QF7A 2LKXA 3JRHA 4MIMA 4MO7A 4UUTA 5GP9A 5BNGA 1GDTA 2NVTJ 1Z0XA 2MSYA 2FD5A 1JUSA 2DMUA 3BT9A 3HGGA 4RBOA 2XGEA 4XK4A 3RZDJ 1BW5A 5EEAA 1WI3A 1OCTC 2IAIA 5IYDJ 2XB0X 3LNQA 3GTLJ 1QRYA 1YRNB 5E3OA 4C3IJ 2HOTA 2DA2A 4IHVA 2EBIA 1RESA 2W48A 2YUSA 3ZQFA 3Q0UA 1K83J 3H0GJ 3RZOJ 2KDZA 2XRLA 5C44J 2ID3A 2OPTA 2LY9A 1VNDA 3CDLA 2Y31A 2FJ1A 3S15J 2JMWA 1PUFA 3GTKJ 5M5WJ 2YU9J 3D1NI 2WAQN 5FKMA 5K7FA 5J1RA 1JKRC 3TEDA 2EZKA 3BR5A 2ZB9A 5EZGA 2L7ZA 1OJLA 2K40A 3IH2A 2XB5A 5E3LA 1R9TJ 4MFDA 3RKQA 2LR8A 5J1UA 2HXOA 4B3AA 3RQIA 1I3QJ 4C3HJ 1ZK8A 2VPRA 3SDGA 1MBJA 1FEXA 1XS9A 2VKVA 2P81A 4QSHA 4D7NA 3LSRA 3O8GA 3I4NJ 1PUFB 1ETVA 4A3BJ 4IHXA 1IDZA 5IP9J 3ZQCA 1MBFA 5IP6A 5JLWA 3B6CA 3DCFA 3BR3A 4D5CA 1B8IA 5GPAA 5C4JJ 3L1PA 1W0TA 1AKHA 1JT0A 4Y52J 4A3KJ 4XRSA 4BY1J 1JKOC 4DZPA 4HNVA 4A93J 3OSGA 3HKZN 5C4XJ 2EH3A 1H89C 4JX6A 3G1MA 1MBEA 1IRZA 4AUXA 2DA4A 1E3OC 1XC5A 1NK2P 3GBGA 3IH3A 2LFBA 2M0CA 2DA7A 2X6OA 4IHYA 1B72A 2Y9YA 2LVSA 2LTPA 5IP7J 4A3FJ 1HCRA 3S1QJ 1ITYA 3NAUA 1B8IB 4BBSJ 4W97A 5IOYA 1BW6A 3HGYA 1VI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AKH B;  3BTI A;  2DMP A;  2K9N A;  2AO9 A;  3TW7 A;  2EQR A;  3HBL A;  2FQ4 A;  3A03 A;  1HLV A;  4X6A J;  5EF6 A;  2JA8 J;  2O7O A;  3CQZ J;  3Q3S A;  2LD5 A;  2E2J J;  3BTC A;  4V2F A;  1U9O A;  2AHQ A;  3LSP A;  2M8G X;  1ETO A;  4A3J J;  4L5E A;  2O8K A;  1B72 B;  3MVP A;  1ETK A;  1QPI A;  1YRN A;  2VI6 A;  2DMQ A;  2HYJ A;  4QTR A;  3WHB A;  4FE7 A;  1MBH A;  1TWG J;  1AU7 A;  1I6H J;  1HOM A;  2DJN A;  2JWT A;  3FKI J;  3GTP J;  2WV1 A;  3PO2 J;  3M4O J;  2DA6 A;  3BR1 A;  1NK3 P;  3GTO J;  1GUU A;  1MBK A;  2EZH A;  3ZQL A;  3S16 J;  3QQA A;  1F36 A;  1WPK A;  1GV5 A;  2I10 A;  2GBY A;  3ZOB A;  4FTH A;  1MSF C;  1X58 A;  1BA5 A;  3S1M J;  2E1O A;  3FIW A;  4EEF G;  4C2M J;  1G2H A;  3JRG A;  1TWF J;  1LFU P;  3OIO A;  1GVD A;  4ABZ A;  2DA1 A;  3LSJ A;  3G1O A;  3ZQH A;  2HOS A;  3BQY A;  2L7M P;  3JRE A;  3MKL A;  5FLM J;  4M3B A;  3CMY A;  4Y7N J;  2CQQ A;  1P7I A;  2N8G A;  2H1K A;  2DN0 A;  1WH5 A;  2JJ7 A;  2E2H J;  1AHD P;  3HOZ J;  3WHC A;  3HOU J;  2XGD A;  2CU7 A;  2ELK A;  3O8H A;  3OSF A;  1VFC A;  1RET A;  5EDN A;  3HOY J;  3PM1 A;  5K7H A;  3S2D J;  4A3D J;  3FIS A;  4I76 A;  4I6Z A;  4A3M J;  1IV6 A;  2L9R A;  4FIS A;  1JJ8 C;  1SAN A;  3BR6 A;  3B6A A;  1HF0 A;  1ETY A;  1S7E A;  2XGC A;  4BY7 J;  4XRS G;  4DZJ A;  3DEW A;  3ZQI A;  5FKN A;  9ANT A;  1IUF A;  3BR2 A;  4JYK A;  1DU6 A;  1FTZ A;  3HOX J;  2JN6 A;  5F08 A;  3C2B A;  2JK3 A;  5IYB J;  5DS9 A;  2X9D A;  3S1N J;  1DU0 A;  1K61 A;  2ME6 A;  2JA5 J;  2COB A;  2HOA A;  2E2I J;  2JA7 J;  1BJZ A;  1D5Y A;  1BL0 A;  3VPR A;  3JR9 A;  1H8A C;  1W0U A;  2HXI A;  5EGO A;  1IG7 A;  1FIP A;  1MH4 A;  1A5J A;  1RR7 A;  3JRB A;  4DYQ A;  5FJ8 J;  1ETW A;  1APL C;  2TRT A;  2K9Q A;  1Q1V A;  1TWH J;  2HI3 A;  1JUP A;  2ECC A;  1F43 A;  2WB1 N;  3QPS A;  5C3E J;  1EF4 A;  2KT0 A;  4M6V A;  1OFC X;  2NVX J;  2MGQ A;  1P7J A;  4MFE A;  2R93 J;  2CQX A;  2R7Z J;  3BG9 A;  5IOZ A;  2DA3 A;  2LP0 A;  3GTQ J;  5EGO B;  3HOV J;  3LOC A;  1UMQ A;  1WCM J;  1U9N A;  3ZQG A;  5E3N A;  1ENH A;  5M3F J;  1HDD C;  2ME0 A;  1UG2 A;  3BTL A;  1Z77 A;  2NS8 A;  1LE8 A;  4X1E A;  5FLV A;  2ECB A;  4G12 A;  4FCY A;  5M5Y J;  3HB9 A;  3K7A J;  1JKP C;  2D5V A;  4A69 C;  3SJM A;  2TCT A;  1MBG A;  3LSG A;  4D5F A;  5EG0 A;  3I4M J;  2VUM J;  3BG5 A;  2IEK A;  2JA6 J;  2NVQ J;  4RDU A;  1QVT A;  1JUM A;  1RPW A;  5M5X J;  3F0C A;  4A3I J;  5GPC A;  1ZGW A;  5DTD A;  3K2A A;  2OF7 A;  2L0K A;  1ZQ3 P;  1FTT A;  1FIA A;  2Y0S N;  4S0H B;  1ZTR A;  2YS9 A;  3JRA A;  1U78 A;  1WGX A;  1LE8 B;  2H8R A;  5IYC J;  1JT6 A;  5F04 A;  2CUE A;  3A01 A;  3H3V K;  5HOD A;  3SFI A;  5EG0 B;  1U8B A;  3FK7 A;  5F27 A;  3MN2 A;  4CYC A;  1JTX A;  3Q0V A;  3S1R J;  4A3E J;  3HM5 A;  4M3G A;  1JJ6 C;  3E7L A;  4BBR J;  2HQ5 A;  1SFO J;  3IH4 A;  1X2N A;  4JP0 A;  1QVU A;  3TP0 A;  3TP3 A;  5IPA A;  1RKT A;  3FK6 A;  1JKQ C;  2DMN A;  2IBD A;  5E3M A;  4C3J J;  5EYR A;  3GTG J;  5J1Y A;  4UUS A;  2G0E A;  4V2G A;  2GM4 A;  3A01 B;  3S14 J;  4A3G J;  2MG4 A;  1X2M A;  3BTJ A;  2E19 A;  4J19 A;  1Y1W J;  1XG1 A;  5F0C A;  4CYC B;  1Y1V J;  3Q0W A;  2X48 A;  3CCY A;  5JLX A;  2XPU A;  4QIW N;  5F0H A;  3UKG A;  1T56 A;  1CQT A;  2DMT A;  2EZI A;  3JRF A;  1LFB A;  1TWC J;  4B1R A;  4BXX J;  2QCO A;  2M34 A;  2LLK A;  1ZR2 A;  3A02 A;  2Y2Z A;  1ZR4 A;  2Y9Z A;  4UUS B;  3NAR A;  2EZL A;  4DW6 A;  1GV2 A;  1ETX A;  2LK2 A;  4AYB N;  4W1U A;  3JRC A;  1MNM C;  1MH3 A;  2O9L A;  1MSE C;  1WH7 A;  4A3C J;  3QPL A;  1IC8 A;  2NOG A;  2CRG A;  1IDY A;  3S2H J;  2CJJ A;  3HEF A;  1VF9 A;  4M3D A;  1GT0 C;  2CUF A;  4FE4 A;  5F0F A;  3S17 J;  1A6I A;  2R5Y A;  3OOU A;  2DTZ A;  4LOC A;  4MLO A;  2L7F P;  2NS7 A;  2DA5 A;  1FJL A;  1POG A;  1JGG A;  2ID6 A;  2GLO A;  5K7Z A;  4XIC A;  1TC3 C;  5FKO A;  2R0Q C;  4AC0 A;  2FX0 A;  3BQZ A;  3G1L A;  5J3L A;  3HDD A;  1OCP A;  3HOW J;  4GFB A;  1IJW C;  3GTM J;  4JX4 A;  3PO3 J;  1O4X A;  2B63 J;  3W6V A;  2NVY J;  5FKL A;  5EZH A;  2R5Z A;  3JRD A;  1HDP A;  1ORK A;  3BG3 A;  2M2E A;  5F1J A;  4NDL A;  2M9H A;  2R5Y B;  1RKW A;  3M3Y J;  5M3M J;  3BR0 A;  2XPV A;  1TWA J;  1UHS A;  1JTY A;  4M3E A;  4A3L J;  4XID A;  4D7M A;  2XSD C;  4DYR A;  3IV5 A;  4IHW A;  2RAE A;  4B4C A;  4BKX A;  4XRM A;  1NTC A;  4M3F A;  3TW6 A;  2HDD A;  2XPW A;  5FKK A;  2MW8 A;  2Y30 A;  1ETQ A;  4IEJ A;  1IGN A;  2R92 J;  2PMZ N;  1I50 J;  2K9S A;  1ZKG A;  3GTJ J;  1H88 C;  2VKE A;  3JRI A;  4JX5 A;  4DYC A;  2R5Z B;  1T33 A;  2QF7 A;  2LKX A;  3JRH A;  4MIM A;  4MO7 A;  4UUT A;  5GP9 A;  5BNG A;  1GDT A;  2NVT J;  1Z0X A;  2MSY A;  2FD5 A;  1JUS A;  2DMU A;  3BT9 A;  3HGG A;  4RBO A;  2XGE A;  4XK4 A;  3RZD J;  1BW5 A;  5EEA A;  1WI3 A;  1OCT C;  2IAI A;  5IYD J;  2XB0 X;  3LNQ A;  3GTL J;  1QRY A;  1YRN B;  5E3O A;  4C3I J;  2HOT A;  2DA2 A;  4IHV A;  2EBI A;  1RES A;  2W48 A;  2YUS A;  3ZQF A;  3Q0U A;  1K83 J;  3H0G J;  3RZO J;  2KDZ A;  2XRL A;  5C44 J;  2ID3 A;  2OPT A;  2LY9 A;  1VND A;  3CDL A;  2Y31 A;  2FJ1 A;  3S15 J;  2JMW A;  1PUF A;  3GTK J;  5M5W J;  2YU9 J;  3D1N I;  2WAQ N;  5FKM A;  5K7F A;  5J1R A;  1JKR C;  3TED A;  2EZK A;  3BR5 A;  2ZB9 A;  5EZG A;  2L7Z A;  1OJL A;  2K40 A;  3IH2 A;  2XB5 A;  5E3L A;  1R9T J;  4MFD A;  3RKQ A;  2LR8 A;  5J1U A;  2HXO A;  4B3A A;  3RQI A;  1I3Q J;  4C3H J;  1ZK8 A;  2VPR A;  3SDG A;  1MBJ A;  1FEX A;  1XS9 A;  2VKV A;  2P81 A;  4QSH A;  4D7N A;  3LSR A;  3O8G A;  3I4N J;  1PUF B;  1ETV A;  4A3B J;  4IHX A;  1IDZ A;  5IP9 J;  3ZQC A;  1MBF A;  5IP6 A;  5JLW A;  3B6C A;  3DCF A;  3BR3 A;  4D5C A;  1B8I A;  5GPA A;  5C4J J;  3L1P A;  1W0T A;  1AKH A;  1JT0 A;  4Y52 J;  4A3K J;  4XRS A;  4BY1 J;  1JKO C;  4DZP A;  4HNV A;  4A93 J;  3OSG A;  3HKZ N;  5C4X J;  2EH3 A;  1H89 C;  4JX6 A;  3G1M A;  1MBE A;  1IRZ A;  4AUX A;  2DA4 A;  1E3O C;  1XC5 A;  1NK2 P;  3GBG A;  3IH3 A;  2LFB A;  2M0C A;  2DA7 A;  2X6O A;  4IHY A;  1B72 A;  2Y9Y A;  2LVS A;  2LTP A;  5IP7 J;  4A3F J;  1HCR A;  3S1Q J;  1ITY A;  3NAU A;  1B8I B;  4BBS J;  4W97 A;  5IOY A;  1BW6 A;  3HGY A;  1VI0 A; 
#chains in the Genus database with same CATH topology
 2PJR A;  4LK0 F;  1VQ7 I;  4ESJ A;  2P5K A;  3IRR A;  3OYB A;  3TW7 A;  1K7A A;  2EQR A;  3ASN H;  4PSW A;  3A03 A;  1DP7 P;  1NG6 A;  1QA6 A;  4F52 A;  4RB3 C;  5LGN A;  4J01 A;  3OYM A;  2O7O A;  3CQZ J;  3I0T A;  4BXU A;  5LHG A;  2E2J J;  1NHA A;  4V2F A;  3RIR A;  4GXO A;  2AHQ A;  3LSP A;  2VBY A;  1ZH5 A;  5LHI A;  3DLL F;  2A07 F;  5KAI C;  4YFK F;  2EV6 A;  1YRN A;  1S7A A;  4PFO A;  3G2B A;  1P4A A;  2QM3 A;  3WTX C;  4NNJ A;  3WHB A;  3HSF A;  2OBP A;  1I6H J;  1HOM A;  3FXJ A;  5ED4 A;  1KA8 A;  1X3U A;  3GTP J;  2WV1 A;  1C0W A;  2W00 A;  1XSX A;  1R6R A;  2HYG D;  3BR1 A;  4KJZ A;  2P8T A;  3GTO J;  3IHU A;  3CZ6 A;  1S9H A;  4LG0 A;  3VYR B;  4F55 A;  2FBH A;  3MWM A;  4BH9 A;  3QRF F;  3ZMS A;  3S3N A;  1RI7 A;  4ASN A;  2GBY A;  4HOB A;  1SFE A;  1FYK A;  5TRD A;  2COM A;  3R0A A;  5FB2 A;  1YI2 I;  3S1M J;  2JTV A;  3H5A A;  5GAE J;  1LEB A;  4C2M J;  4RB2 C;  2Q0O A;  2HGC A;  3QYF A;  1G2H A;  3JRG A;  1TWF J;  2ZXJ A;  3OIO A;  3Q5F A;  4E6K G;  4ABZ A;  2M1B A;  3JRE A;  1IN4 A;  2DQL A;  3BDD A;  4UB6 C;  5TJJ A;  2PJP A;  4LG0 B;  1ZRF A;  1I39 A;  3VYU B;  5DD8 A;  3M8J A;  2EIL H;  1P2F A;  5D6F A;  4EM1 A;  2R7R A;  2H1K A;  5FLX K;  2JJ7 A;  2E2H J;  3F6O A;  2GXG A;  4Q47 A;  4A12 A;  1FP2 A;  5D5W B;  2ELK A;  4PFP A;  3O8H A;  4XKV A;  1VQL I;  1ZG5 A;  3I5U A;  4ZDP A;  4WF2 A;  2K02 A;  4A6E A;  4CUG A;  1ZN2 A;  3M07 A;  2A69 F;  1XN7 A;  5LEK A;  3DF8 A;  4A3M J;  2M30 A;  2CG4 A;  1YE9 A;  4FIS A;  3BR6 A;  2F5D A;  1HF0 A;  3DKY A;  1ETY A;  3RTR A;  3SFZ A;  1ON2 A;  3WTV C;  2XGC A;  3IUO A;  4XRS G;  3GFJ A;  3KP3 A;  4LIU A;  3ABM H;  5FKN A;  2F2E A;  3C2G A;  3LFU A;  1IUF A;  3KEO A;  2LRE A;  1QHH D;  1FTZ A;  3HOX J;  3CUQ A;  5DS9 A;  5IT3 A;  3FZV A;  2EK5 A;  2G7H A;  5D8L B;  5LBQ A;  2ME6 A;  2COB A;  2E2I J;  2F4I A;  4EM2 A;  3FXQ A;  2EB7 A;  3K1M A;  3JR9 A;  1B1B A;  2MD5 A;  4XKW A;  4KN4 X;  1WQ2 A;  3EPZ A;  1PDN C;  3L00 A;  2E1M C;  1W1W E;  1Q1V A;  1JUP A;  1MMD A;  5E1W A;  4Z2Y A;  2MD0 A;  2KP6 A;  3T0Y A;  3PL8 A;  5FD5 A;  3CUQ B;  5KNL A;  1V54 H;  3EYY A;  1WVR A;  3VWB A;  3MFK A;  4M6V A;  1OFC X;  1X4O A;  2MGQ A;  2EV0 A;  2FXA A;  1SMY F;  2CQX A;  2LMD A;  1N75 A;  3MAJ A;  2XAJ A;  2R7Z J;  1BOB A;  1QHG A;  1HC8 A;  2OCE A;  3VFZ A;  1QNT A;  3ASO H;  4MGR A;  2IS4 A;  3LOC A;  5K1Y A;  3LAJ A;  1WJ5 A;  5M3F J;  1HDD C;  4BE2 A;  3FXO A;  1SVM A;  2PBI A;  1IO2 A;  2BHY A;  2GOX B;  3KP2 A;  1S8N A;  2VL8 A;  2PLY A;  4FCY A;  3HB9 A;  2D5V A;  3ZQ7 A;  3PQK A;  3LSG A;  4D5F A;  3I4M J;  3L2R A;  5ILS A;  2IEK A;  2JA6 J;  2NYX A;  4RGU A;  3H9G A;  4S04 A;  1R4N B;  2KJC A;  2W24 A;  3F0C A;  1K79 A;  2VOP A;  1GLN A;  3REO A;  5GPC A;  1ZGW A;  2EFW A;  3QOP A;  1FTT A;  2IGK A;  4O3M A;  2UZK A;  2OU2 A;  2GWR A;  4RM3 A;  2R7W A;  1SD7 A;  2VJI A;  3DEU A;  4I2O A;  1SMT A;  3CCM I;  3G4S I;  5HVQ C;  1J75 A;  1WGX A;  5LLQ A;  3F8C A;  3ERE D;  3DPU A;  2CUE A;  2XAQ A;  2QBY A;  3JSP A;  4CH7 A;  4HQM A;  4CA0 A;  1WZ2 A;  3TL4 X;  4QPO A;  2D1H A;  2DBB A;  3MN2 A;  5CVI A;  3ZMU A;  4CYC A;  4HX8 A;  4HG2 A;  3Q0V A;  3S1R J;  2KZV A;  4A3E J;  1JJ6 C;  4DNC A;  1CF7 A;  2HQ5 A;  3DV8 A;  1D0Y A;  2CWE A;  4JP0 A;  5A2Q K;  3T8R A;  1SFO J;  2ZXH A;  5L3G A;  5GAD J;  1W36 C;  1RKT A;  1IRG A;  3FK6 A;  2GA1 A;  4C9Y A;  2IBD A;  2KMU A;  2BGC A;  2P6S A;  5EYR A;  5J1Y A;  2G0E A;  4IF4 A;  2DO7 A;  5JFR A;  5FO5 A;  2QBY B;  3IKT A;  4J19 A;  4Q5S F;  1ZYR F;  4M6Y A;  4CYC B;  2LYC A;  3Q0W A;  1ACI A;  4D9J A;  3M8F A;  5BPD A;  4DBR A;  4Y17 A;  2XAG A;  4QIW N;  3UKG A;  4L9T A;  1CF7 B;  3OYE A;  4G6T B;  4RGR A;  4L5I A;  1LFB A;  4AM3 A;  4L5J A;  2XIG A;  3TQN A;  2QCO A;  2OTJ I;  5ICF A;  2E7W A;  4HLX A;  2QKL B;  1K78 A;  3TGN A;  2DYS H;  2ESN A;  1Y0N A;  1Q1H A;  3NAR A;  1ZAO A;  2DTR A;  2EZL A;  2EIN H;  2ZJ2 A;  1LUJ B;  5KCM A;  3EQL F;  4AYB N;  3CC7 I;  4UUV A;  2IPQ X;  1V3F A;  4KT5 C;  4P9F A;  3RJP A;  5BS6 A;  3JRC A;  1V4R A;  1T6S A;  2O9L A;  2ZKZ A;  4CO8 A;  2HKX A;  1YO5 C;  2NOG A;  3KEQ A;  3CP8 A;  1UHW A;  1G59 A;  1YS6 A;  3IKV A;  3ROU A;  2ADU A;  3P7N A;  2CUJ A;  1K78 B;  2DTZ A;  4NBQ A;  1B6A A;  3HL2 A;  4KN7 X;  2L7F P;  4B8X A;  2DA5 A;  1BI2 A;  2QSG X;  2VON A;  2GLO A;  1HST A;  5K7Z A;  3RI4 A;  2W57 A;  3KYC B;  2WC2 A;  2R0Q C;  2MC3 A;  4AC0 A;  5J3L A;  1WJF A;  3HC7 A;  2V6E A;  3I4P A;  4N0B A;  4GFB A;  3FM3 A;  5GTI C;  3OL4 A;  2V1U A;  3GTM J;  2O6G E;  2KDO A;  3W6V A;  4NHJ A;  2NVY J;  2QEN A;  5FKL A;  3V42 A;  2X1E A;  2KRC A;  4K2E A;  2VT2 A;  4BJT A;  3C3W A;  4BEH A;  2VBX A;  4YRV A;  2XPV A;  3JCU C;  3HJE A;  1TWA J;  4BQA A;  2JZY A;  4B47 A;  1JTY A;  3K1N A;  1XD7 A;  3IAS 2;  4D7M A;  2WAQ A;  2VC1 A;  4IHW A;  4ZDL A;  1WWX A;  2W25 A;  5GAH J;  4ZTJ A;  3W2A A;  4A0X A;  5B1B H;  1BIB A;  4M3F A;  4UV9 A;  3V8K A;  1OYY A;  2XPW A;  3B02 A;  1X4P A;  1W4M A;  4NC6 A;  5FKK A;  1YHQ I;  4I09 A;  2R7F A;  2R92 J;  2QSF X;  3CLO A;  3F22 A;  1IV8 A;  3CCL I;  4HA8 A;  4F92 B;  3TDZ C;  4BHB A;  4PJJ A;  3OYF A;  3JRI A;  4JX5 A;  3L09 A;  4KIF A;  4NQW A;  2QF7 A;  2LKX A;  2K7L A;  1T08 B;  2VN2 A;  4XL9 A;  4BEH B;  4BAY A;  3BWG A;  4HF0 A;  2NVT J;  1G3Y A;  1Z0X A;  3WOD F;  1IN6 A;  3IL2 A;  3LFK A;  2DMU A;  1V5G A;  1U2W A;  2XGE A;  3DBL B;  4XK4 A;  1F9N A;  2Y69 H;  4KIC A;  1WI3 A;  2FRH A;  2HPM A;  5DV5 A;  3CDI A;  5IYD J;  1SD4 A;  1YLF A;  2NVU B;  2XB0 X;  4KA4 A;  3IP4 B;  3FXR A;  1T38 A;  1RZ4 A;  3H9J A;  5FGM A;  3MKW B;  2NXN B;  3V7C A;  2FOW A;  4XN0 A;  2HOT A;  3WG9 A;  1Z3X A;  2W48 A;  2YUS A;  4RB1 A;  1J7K A;  3LSH A;  3MMY B;  4U0V A;  1BC7 C;  1K83 J;  2V7F A;  5C44 J;  2DT6 A;  1LEA A;  5FFZ A;  2ID3 A;  2OPT A;  3V8L A;  3CDL A;  2ZJQ F;  1QPM A;  3S8P A;  2FJ1 A;  2CFO A;  2W4S A;  4L9N A;  5TIS C;  1Z6R A;  5M5W J;  2YU9 J;  2P0W A;  5IT9 K;  2WAQ N;  3EDP A;  3F9K A;  3CME I;  1JKR C;  2HDC A;  2EZK A;  2M87 A;  1IRF A;  2CMP A;  2QUF A;  2QVO A;  3BJ6 A;  2BVL A;  3AKZ A;  3CF5 F;  4U87 A;  1IZ1 A;  2LY1 A;  3WGG A;  1D8J A;  2EA2 A;  1R9T J;  3GX4 X;  4MFD A;  3RKQ A;  3C2H A;  2HXO A;  1I3Q J;  4C3H J;  4L0Y B;  1YW9 A;  1FBQ A;  3Q9V A;  5L3E A;  2V4J C;  3MKZ A;  3GFI A;  3O3K A;  5HLT A;  4KT6 A;  3I4N J;  2OA4 A;  4ETS A;  1SAU A;  3DTE A;  1KYW A;  1DDN A;  1O57 A;  1JE8 A;  2TDX A;  3CO6 C;  3ZQC A;  1H9T A;  2EFN A;  5JLW A;  3CCQ I;  3BR3 A;  4JBA A;  1I27 A;  1R36 A;  1OCR H;  4BUP A;  3L1P A;  3OS0 A;  4M9X A;  2NAZ A;  3RCO A;  3HZJ A;  5HDG A;  1AKH A;  4CCO A;  4Y52 J;  4HBL A;  2K9L A;  4P96 A;  2DPD A;  1MIJ A;  1JKO C;  4A93 J;  2DOD A;  1L0O C;  4ANJ A;  3QU3 A;  1NH3 A;  5K5O A;  5C4X J;  1H89 C;  1P4X A;  1SEU A;  3BCA A;  2BE5 F;  2UXN A;  1VZ0 A;  1NK2 P;  4Y4R A;  4L9J A;  2M0C A;  2DA7 A;  1B72 A;  2LF8 A;  2EFP A;  4HV6 A;  3LA3 A;  4XOR A;  2IT0 A;  2E71 A;  1TNT A;  3LWF A;  1ITY A;  4BBS J;  3HGY A;  1ZHF A;  1VI0 A;  1AKH B;  3BTI A;  4RAF A;  2K9N A;  1D8K A;  3H3U A;  5JVG F;  1D1C A;  3OR1 C;  1O7F A;  2K3P A;  1V5F A;  1FPQ A;  1UJ8 A;  3HRT A;  1VQM I;  1EV7 A;  4LB6 B;  2YU3 A;  2XGX A;  4DJA A;  4IOC F;  2P4W A;  2VXD A;  3QWL A;  1A31 A;  3PQJ A;  3LAP A;  1O3R A;  4MHG A;  1ZGJ A;  1ZG3 A;  1B72 B;  1DGW Y;  2IS2 A;  2VI6 A;  2XHK A;  4UNO A;  4QTR A;  1BI1 A;  3GXO A;  2DK5 A;  4I98 B;  1MJ9 A;  2JWT A;  4ZDO A;  4P9U A;  5IT9 Z;  4XM3 A;  2KRH A;  4PJ0 C;  3PO2 J;  1NK3 P;  2L54 A;  1YG2 A;  4GO1 A;  4ENJ A;  2XDV A;  2YX4 A;  2NNN A;  3ZQL A;  2OAZ A;  1F36 A;  4KIB A;  1GV5 A;  1F5T A;  3KZY A;  3ULQ B;  1WHU A;  3S3M A;  1TNS A;  1MSF C;  2O3F A;  2YX7 A;  1BA5 A;  3HTU A;  4GGG A;  4ZZL A;  3CMA I;  3HTS B;  2E1O A;  4CZC A;  1X3Z B;  3CCV I;  2A68 F;  2CW8 A;  3IWZ A;  1LPQ A;  4EQQ A;  5CQE A;  1YIJ I;  4LG3 A;  4PJM A;  3K10 A;  3VEP A;  2EFO A;  2LG4 A;  2DA1 A;  2OCC H;  2DOA A;  1BR4 A;  2R7V A;  3LSJ A;  3ZQH A;  2HOS A;  2OC6 A;  3BQY A;  5AON A;  1W5T A;  2FQ3 A;  2L7M P;  1FNN A;  5FLM J;  3GO5 A;  3PNY A;  4M3B A;  1FX7 A;  3CMY A;  3KZI C;  2CQQ A;  1R5H A;  2E1C A;  3OYA A;  1AHD P;  3G73 A;  2MFZ A;  3K4L A;  3SEQ A;  3OYC A;  1MJA A;  4DOZ A;  4E70 A;  3CJR B;  4OU0 A;  3OSF A;  2A5Y B;  4YEJ A;  3HOY J;  3PM1 A;  5JHU A;  5K7H A;  3FIS A;  2BZT A;  4CCL A;  3SQN A;  4GYG A;  1JJ8 C;  1SAN A;  3B6A A;  2ELH A;  1Z21 A;  4E4H A;  2Z16 A;  4ZC3 A;  3F3X A;  3KPH A;  1MMG A;  2DQR A;  2ZXW H;  5HLI A;  3BJO A;  1LFP A;  1DPU A;  3BR2 A;  4JYK A;  5FD6 A;  1HW1 A;  2F4O B;  3ML6 A;  1G6N A;  2JN6 A;  2B0L A;  4E7I A;  4QLC U;  3C2B A;  3IWF A;  4E7S A;  2C6Y A;  3S1N J;  1DU0 A;  4CHU A;  2XSJ C;  4FET A;  3MD2 A;  4XSX F;  2IS6 A;  2VAS A;  3TDU C;  2HYF A;  3OYJ A;  2HOA A;  2GAU A;  1BJZ A;  3KYL A;  3VPR A;  1P4W A;  3QYE A;  5EGO A;  1FIP A;  5J40 A;  2P5L C;  1MMA A;  3HOS A;  2MLG A;  4DYQ A;  2K9Q A;  2DCE A;  3FM5 A;  3K2Z A;  4PZJ A;  2ECC A;  1F43 A;  2BY2 A;  3E5Q A;  2DDA A;  1YOV B;  5C3E J;  2RV8 A;  3JW4 A;  4OMY A;  3R0J A;  4XMY A;  3OYL A;  4WCG A;  3MKY B;  3BCB A;  2EFQ A;  3HG9 A;  4F3Q A;  3OYI A;  1P7J A;  4RGX A;  4BL0 B;  1PP7 U;  4MFE A;  1IW7 F;  2QQB A;  4G7O F;  3A1Y A;  1UEL B;  4XLE A;  4XOT A;  3KLN A;  2HU9 A;  2VQC A;  3BG9 A;  3KCC A;  2LP0 A;  2X6W A;  5JVT A;  2M0M A;  5EGO B;  5B5E C;  3M9A A;  3ZQQ A;  1XGS A;  4WX9 A;  1Y39 A;  1ENH A;  2CUZ A;  1Z7L A;  5DD4 A;  1R7J A;  1UG2 A;  1LNW A;  3CJQ B;  1XX5 A;  2DLL A;  3DQV C;  5FLV A;  2LSO A;  4G12 A;  5M5Y J;  3VSL A;  3H5N A;  4PJN A;  1VQK I;  3AG4 H;  3SJM A;  1MBG A;  1A6Q A;  3BG5 A;  5ERI A;  4RDU A;  1JUM A;  3KE2 A;  2HEO A;  1U3E M;  1G3S A;  4FAS D;  2DFF A;  2E1N A;  1CGP A;  4A3I J;  2OTL I;  3WTY C;  5DTD A;  2OF7 A;  2L0K A;  1FIA A;  5FRO A;  2MYS A;  2HOE A;  4S0H B;  3ZMT A;  2YS9 A;  3A0H C;  1FP1 D;  3ERM A;  3ISP A;  4PK4 A;  1JT6 A;  2LNB A;  1A04 A;  3K4K A;  4LIT A;  4WXD A;  4CZZ A;  1D5V A;  3CCE I;  5HOD A;  4L9V A;  4KFC A;  1FWZ A;  3SYT A;  3Q9S A;  1TLH B;  3U9G A;  1JTX A;  4A6D A;  2R7S A;  2DJI A;  2E7X A;  2HZD A;  4ZYA A;  3HM5 A;  2XKO A;  2H8W A;  4BBR J;  1U5T C;  3IH4 A;  1X2N A;  1QVU A;  1NG7 A;  3BLY A;  4E7J A;  1PUE E;  1ZLK A;  3K0L A;  1PYV A;  4XLF A;  4XNF A;  5IPA A;  4L0Z B;  5E3M A;  2FOK A;  3HYI A;  5H6R A;  3EUK L;  4UUS A;  4HDV A;  3PNV A;  2MG4 A;  3EYI A;  1EH7 A;  3FHZ A;  1SFU A;  1X2M A;  5H6Q A;  3GWZ A;  5E20 A;  4X0G A;  1Z6T A;  1SVO A;  1V55 H;  3GZN B;  3QOD A;  3A4C A;  4AIK A;  1Y1W J;  2FBI A;  3ABU A;  3CCY A;  5JLX A;  1J2X A;  2XPU A;  2M5W A;  2Q2E A;  1T56 A;  2BOL A;  2OZ6 A;  2VJJ A;  3CF2 A;  4B3X A;  2EZI A;  1CQT A;  1ZRC A;  1N25 A;  1TWC J;  3PIO F;  2KIS A;  1ZR2 A;  2XF7 A;  2KL4 A;  3KP7 A;  3A02 A;  5DUK A;  4YG2 F;  1VQO I;  1ZR4 A;  1XGN A;  3TBI A;  5HDN A;  2Y9Z A;  3V7R A;  4UUS B;  2DYR H;  3BP8 A;  4EV0 A;  4PJL A;  1V5E A;  1ETX A;  4RLQ A;  5L3B A;  5HS7 A;  3N4M A;  3H36 A;  5GAG J;  3AFH A;  4U88 A;  2JPC A;  1S29 A;  3I59 A;  2PMZ A;  4PCQ A;  3FMR A;  2HDW A;  1QZZ A;  2IA1 A;  5HNH A;  2D2W A;  3W6K B;  5KVR A;  1MSE C;  1H0M A;  3AL0 C;  1ON1 A;  3QPL A;  3U2R A;  4IVN A;  3ABT A;  1BI0 A;  1PP8 F;  2CJJ A;  2Q2E B;  2CUF A;  3PIP F;  4ENK A;  1REP C;  1K6Y A;  3OOU A;  2JPB A;  3NQO A;  3D5S C;  1POG A;  2ID6 A;  3HRM A;  5KK1 A;  1TC3 C;  4XIC A;  1EJ9 A;  1IAW A;  2DFI A;  5FKO A;  2QQA A;  2DK8 A;  1GVJ A;  1D1B A;  3P5J A;  3G1L A;  2F5F A;  3PNT A;  1UFM A;  4WXC A;  3I59 B;  1FYM A;  4WK8 F;  4HQE A;  2M7B A;  4A0Z A;  3OYD A;  3HOW J;  3E5U A;  2WAE A;  4ZYE A;  1IJW C;  2CW0 F;  4JX4 A;  2Y48 A;  3C7J A;  3WTZ A;  1O4X A;  2B63 J;  5KAF C;  1R1U A;  1XMA A;  1VQ4 I;  5ICE A;  3I55 I;  3KLO A;  2O0Y A;  5EZH A;  4I02 A;  1HDP A;  2GZW A;  2M2E A;  1J09 A;  3W3C A;  1FSE A;  2M9H A;  5DEQ A;  4HNT A;  1SC7 A;  5M3M J;  3ZMV A;  5J4Y A;  2X0L A;  2KKO A;  1UHS A;  4G7Z F;  4M3E A;  2XSD C;  1GXQ A;  2AS5 F;  2H94 A;  3HIF A;  4C2T A;  3W2W A;  5FLX Z;  3M1C A;  5HLG A;  3H5R A;  4LFU A;  1I1G A;  4RLF A;  3QYB A;  2E36 A;  1WJB A;  2JT1 A;  3K70 C;  5FRM A;  1ETQ A;  5H2F C;  4IEJ A;  1IGN A;  3AG1 H;  2PMZ N;  2ZSH B;  1I50 J;  2K9S A;  1ZKG A;  2BYV E;  5F64 A;  3GTJ J;  2RN7 A;  2EIK H;  1X3W B;  2VKE A;  5CVJ A;  4DYC A;  4QWQ A;  1T33 A;  3GLL A;  4HST A;  4V19 K;  3FXU A;  3JRH A;  2LKP A;  4AYB A;  1LVK A;  5CPR B;  2HQR A;  1GDT A;  4OIP F;  3BG6 A;  1OR7 A;  2R7D A;  1RC9 A;  5IY5 H;  2E5Z A;  4F7Z A;  4GCV A;  5BMZ A;  1YIO A;  2A05 A;  1L3L A;  4EVI A;  3GEZ A;  1E17 A;  3ZMZ A;  3SZP A;  4EM0 B;  5E18 F;  3NWS A;  2W7N A;  1KGS A;  2ZME C;  5D6E A;  4LK1 F;  4HLY A;  4BDY A;  2V1D A;  3LNQ A;  3GTL J;  1QRY A;  3HSR A;  3MCZ A;  5E3O A;  1TQI A;  4IJA A;  4C3I J;  2HPI A;  2QEX I;  4KIS A;  3QP6 A;  1RES A;  4XSZ F;  3L2V A;  4DIQ A;  3Q0U A;  2RVC A;  3CES A;  2KDZ A;  2FNP A;  3FHN A;  3RYP A;  2LY9 A;  1JHF A;  3S15 J;  4UVA A;  2H6B A;  2VKH A;  3T1B A;  2VQG A;  1T0F A;  3SZT A;  3D1N I;  1FOK A;  1KYZ A;  5FKM A;  5K7F A;  3A2K A;  4E7L A;  1YX3 A;  4HRI A;  2EIJ H;  3BR5 A;  3K4C A;  4U0Y A;  2L7Z A;  3P9I A;  2VXZ A;  4WXH A;  4KMU X;  4R79 A;  2D45 A;  3IH2 A;  2XB5 A;  3KEY A;  1WKM A;  5J1U A;  4B3A A;  4KUM A;  1T98 A;  1TQP A;  5LD2 C;  3ZGK A;  2P6T A;  2VPR A;  3SDG A;  5CVR A;  3WGI A;  1MKM A;  1FLI A;  1UB9 A;  2VKV A;  3F8M A;  4BHC A;  1B59 A;  4AIH A;  4JOM A;  3K4M A;  1MJB A;  2XRN A;  4R1H A;  1TT0 A;  3LSK A;  2KPM A;  2M45 A;  4HEA 2;  4A3B J;  2X6X A;  1MBF A;  5CLS A;  1AOY A;  2XF6 A;  3B6C A;  4LIV A;  4ZJZ A;  4KIT B;  1BM9 A;  3HHG A;  3FDY A;  3CO7 C;  2VT3 A;  1BC8 C;  1JT0 A;  4IO9 F;  3DU5 A;  3QU6 A;  4BY1 J;  4BNC A;  3OSG A;  3OR2 C;  3DWL E;  2GOM A;  2QLZ A;  4I0B A;  2L3D A;  3UR3 C;  3L2W A;  4H0E A;  1I3A A;  5E8I A;  2JRT A;  3G1M A;  3L2C A;  1MBE A;  1J5Y A;  4G94 A;  1E3O C;  1E2X A;  4HNU A;  1EA3 A;  3K4N A;  1PJR A;  4IHY A;  2PG4 A;  2Y9Y A;  4LGW A;  2UV1 A;  5E1X A;  2MBF A;  3CCJ I;  2LTP A;  3JTH A;  2AXL A;  3PFI A;  4CSW A;  4A3F J;  2ZCW A;  3BC8 A;  3DBH B;  2XVC A;  3NAU A;  2IA2 A;  5CQG A;  1ZGA A;  4W97 A;  2M7A A;  1U78 A;  2H8R A;  2P5V A;  2F5V A;  3QAH A;  4UHT A;  3M3Y J;  3GZ5 A;  5BOX A;  3F8F A;  5LGU A;  4F93 B;  2KJB A;  5A2Q Z;  5EEH A;  2FQ4 A;  1HLV A;  4FX0 A;  2UUZ A;  2VB6 A;  5HLH A;  1VQN I;  2ACJ A;  3Q3S A;  2LD5 A;  3BTC A;  3ABL H;  1FBS A;  3ZN1 A;  4AID A;  2M8G X;  1YIT I;  1ETO A;  2LH9 A;  2MH2 A;  4A3J J;  4L5E A;  4MEY F;  2EIM H;  1ETK A;  2DMQ A;  2HYJ A;  4ZYG A;  1H9G A;  1MBH A;  3SEZ A;  2DJN A;  1AA7 A;  1MD0 A;  2ELJ A;  2ETH A;  3M4O J;  2DA6 A;  3CCS I;  2BEO A;  3HPG A;  3F21 A;  3DP7 A;  1UCR A;  3OY9 A;  1GUU A;  3I3L A;  1MBK A;  2MC4 A;  1OCC H;  2EZH A;  1ZG1 A;  3HUG B;  1MMN A;  2I10 A;  4M71 A;  1XCB A;  3EUH C;  3HHH A;  3ZOB A;  1I6X A;  3CJN A;  5GTH C;  4LLG F;  2WBM A;  2E60 A;  3D5R C;  3OYH A;  4D0P A;  5F6F A;  2PI0 A;  2GXB A;  4EEF G;  2L2O A;  3DKX A;  2IJL A;  4IL6 C;  1MGT A;  2Q1Z B;  1LFU P;  4YII A;  1GVD A;  2ZC2 A;  4IHS A;  1KQ8 A;  2ZXI A;  2ZO4 A;  3G1O A;  1LDD A;  3DKW A;  3MKL A;  4IPA A;  3K4J A;  1P7I A;  1XGO A;  2K86 A;  3NWT A;  1JI8 A;  1Y8Q B;  1U0J A;  3TMO A;  2DN0 A;  4FT8 A;  3HOZ J;  2UXX A;  1D0Z A;  2LY2 A;  3WHC A;  4ZTF A;  3HOU J;  1XDS A;  2CU7 A;  4EJU A;  3GLX A;  1FOY A;  4MEX F;  1S6L A;  1RET A;  3DBR B;  1VTN C;  2R7O A;  3S2D J;  3OL3 A;  2BV6 A;  2E1M B;  1IV6 A;  1J59 A;  2NRA C;  4BQQ A;  2YPR A;  5AIP A;  4N9H A;  4Q48 A;  5K5R A;  2E35 A;  3V4G A;  2M8E A;  2KFD A;  2Z5U A;  1IRX A;  2WA0 A;  3RKW A;  2OQG A;  2K4J A;  1QQI A;  2OV7 A;  4RAY A;  4LLL A;  4A5M A;  9ANT A;  1DU6 A;  3KP6 A;  3T5X A;  3OOP A;  4HDU A;  3FKJ A;  4IHT A;  1I1S A;  2XKP A;  1IF1 A;  2V9P A;  3CUO A;  1BI3 A;  2DI3 A;  2JA5 J;  1P6R A;  2JA7 J;  2PX9 A;  5AIQ A;  5HS9 A;  1LDK B;  1K4T A;  2Y0S A;  4R8H A;  1W0U A;  2HXI A;  1A5J A;  1ZRE A;  2RDP A;  1HKT A;  3KP4 A;  2L02 A;  5FJ8 J;  3ZRG A;  3GZ6 A;  1UST A;  5L3D A;  3F23 A;  5HNF A;  1UAA A;  2HI3 A;  1YJN I;  2EV5 A;  2V9K A;  1ERD A;  2K3F A;  5B3S H;  5LHH A;  3QPS A;  1XGM A;  2OD5 A;  5L3F A;  3C1D A;  3BZK A;  2KT0 A;  3ESW B;  3J80 K;  3CC2 I;  2X6Y A;  3S2W A;  3TOA A;  1WJE A;  2R93 J;  2VJ5 A;  4FHT A;  1E0E A;  2CH0 A;  1LJ9 A;  1R71 A;  3LQR A;  2LRD A;  3BG7 A;  4XKB A;  1UMQ A;  1WCM J;  1U9N A;  2JUG A;  1OCZ H;  2XRO A;  2ME0 A;  3BTL A;  1Z77 A;  1LE8 A;  5E79 C;  3E1S A;  1W5S A;  2ECB A;  1R23 A;  5H20 A;  1JKP C;  3E6B A;  1HQC A;  4A69 C;  2TCT A;  5EG0 A;  3DTK A;  4BDZ A;  2DT5 A;  1KU3 A;  2MH9 A;  3K70 D;  1VQ5 I;  5LRS A;  3CUQ C;  1R5G A;  1B9M A;  1TBX A;  4C2U A;  1R00 A;  1R22 A;  1IN5 A;  1IXC A;  3E6D A;  3H9Q A;  3RYR A;  4E7H A;  1Z3Y A;  4B43 A;  2EJR A;  4CGZ A;  4MQV A;  4EAT A;  2NS0 A;  3CLQ A;  3QPH A;  2Y0S N;  3WTS C;  1VQP I;  4H4K C;  3GVA A;  4ZH4 F;  1HA8 A;  4PGH A;  4FX4 A;  1XPX A;  3RKX A;  1LE8 B;  1A35 A;  5IYC J;  3E6C C;  1FY7 A;  1KQ0 A;  2K85 A;  3A01 A;  3H35 A;  4RS8 A;  3L2Q A;  1ZRD A;  4Y33 A;  1S7O A;  3SFI A;  2VE8 A;  2LOO A;  2O61 A;  4IRI A;  5EG0 B;  2HVQ A;  2VJ4 A;  1E3H A;  3DEE A;  4PSX A;  1KU2 A;  2IA0 A;  3TO7 A;  2A6T A;  1FC3 A;  3ZR8 X;  3FF5 A;  3LMM A;  3N05 A;  4M3G A;  4M9S A;  1B9N A;  2CQ7 A;  2CS3 A;  1W36 D;  2DFE A;  3FXM A;  1G4D A;  2Z1D A;  3TP0 A;  1ZEL A;  2DU9 A;  2QWW A;  3VOE A;  3LL7 A;  1Z05 A;  3TP3 A;  4O6J A;  2CV0 A;  4WWC A;  3HOT A;  1A36 A;  4Y3O A;  2A61 A;  1JKQ C;  2DMN A;  2L7K A;  2OJE D;  1SFX A;  3WG7 H;  3GTG J;  4DGW B;  3A01 B;  1EH8 A;  2JRM A;  3BTJ A;  2FU4 A;  2FUG 2;  2JSP A;  4OIR F;  4CCK A;  1TTY A;  3K69 A;  3U1D A;  1XG1 A;  3PJR A;  2QQ8 A;  1M1E B;  2K5C A;  5FFX A;  3OWT A;  2KIM A;  1N78 A;  2VBW A;  5HOO A;  4IQ4 A;  5F0H A;  1FOX A;  4XOP A;  1OPC A;  4LJZ F;  2ZFW A;  2BW3 A;  4JK1 X;  4B1R A;  4BXX J;  3J80 Z;  2KRF A;  4GRI A;  4U0W A;  4G7H F;  2JUC A;  2CW7 A;  3NEU A;  2BY3 A;  3GF2 A;  3VSK A;  2QZ8 A;  1XCV A;  4DQ2 A;  1BOA A;  2IGN A;  1F1Z A;  3RSN A;  3FBN B;  4BU2 A;  3J7Z I;  1LQ1 A;  2IGO A;  2LC2 A;  2LK2 A;  3GUD A;  4BXF A;  2CQN A;  4I0A A;  3ABK H;  4W1U A;  4YFN F;  3I56 I;  4IOA F;  2BY1 A;  1MNM C;  5B66 C;  3JAM K;  4Q4Z F;  1ODD A;  4A3C J;  1IDY A;  3GCM A;  1Y6I A;  1SAX A;  2X1C A;  2B7E A;  2BW3 B;  4FE4 A;  1USS A;  3S17 J;  1A6I A;  4HW0 A;  2R5Y A;  4N4O B;  3IAM 2;  3BOQ A;  3ECO A;  2H6C A;  1TW3 A;  4LOC A;  2DXI A;  4MLO A;  1G3T A;  1FJL A;  1JGG A;  4ESF A;  3RPU A;  2FMY A;  1G3W A;  4NC8 A;  2V26 A;  2M4K A;  2FX0 A;  3HDD A;  2IXS A;  1OCP A;  4BS9 A;  4CCJ A;  2HTS A;  5JI6 A;  5BPI A;  3PO3 J;  2A3S A;  4EGY A;  1U6G A;  3W2V A;  5BQT A;  2IW5 A;  4KYW A;  1DP3 A;  4EJW A;  2R5Z A;  2ISY A;  3JRD A;  2FEZ A;  1SVL A;  3BG3 A;  5F1J A;  2R5Y B;  3PSI A;  2IRF G;  4YEL A;  4CYD A;  1WJC A;  1YYV A;  2L9N A;  1OKR A;  4A3L J;  4XID A;  2CO5 A;  3IV5 A;  2RAE A;  4OIN F;  1I5Z A;  4B4C A;  1WI9 A;  4XRM A;  2VPL A;  2HR3 A;  1R1V A;  3W6J B;  5F1R A;  3UNG C;  3TW6 A;  3A0B C;  2HDD A;  1EH6 A;  4KNY A;  1VQ6 I;  3FBI B;  2A6E F;  1KQ9 A;  2L4A A;  2VQL A;  2RNJ A;  2BXZ A;  3CC4 I;  3T8T A;  1T2K A;  4IQJ A;  4XLH A;  1XMX A;  1KZH A;  2NOJ B;  2M3A A;  2R5Z B;  2BXY A;  1OCO H;  1SD5 A;  2Z9O A;  4UUT A;  4ENN A;  2H09 A;  1MNE A;  2PJR B;  5D4S A;  2DOE A;  3U21 A;  5D8K B;  2FA5 A;  2MSY A;  1X1A A;  1JUS A;  1OMI A;  3I53 A;  2H27 A;  3BPV A;  4F91 B;  3RPU D;  4HV5 A;  1OIS A;  3RZD J;  1BW5 A;  3ZN0 A;  2I8D A;  3HPH A;  2RNG A;  3LA7 A;  2IAI A;  1ZAR A;  3HRS A;  3U1K A;  4BJ5 C;  2PQ8 A;  3CTA A;  4BGD A;  4S05 A;  3BPX A;  1O7L A;  2XUB A;  2ESH A;  1YRN B;  1HKS A;  4IRG A;  2CSO A;  3I71 A;  3HKZ A;  4P1W A;  2DA2 A;  2EBI A;  3CCU I;  2PN6 A;  4RGS A;  3JAM Z;  3RZO J;  4MTD A;  5CVU A;  4UVB A;  1K6O A;  2WAD A;  1VND A;  2QGU A;  3DPT A;  2Y31 A;  1TP4 A;  2JMW A;  1PUF A;  1F4K A;  1FMW A;  4D1Q A;  3GTK J;  1J9I A;  4M73 A;  2QA4 I;  2OQR A;  2L4M A;  1HSJ A;  2X85 A;  5J1R A;  4B44 A;  4CCN A;  5ILV A;  3E6M A;  3H92 A;  2DPU A;  4XR6 A;  2K40 A;  3J7A O;  3KP5 A;  1TW2 A;  5E3L A;  4HAM A;  2LR8 A;  3WE2 A;  3RQI A;  5LEJ A;  3VOD A;  3I9V 2;  3KYD B;  1ZK8 A;  4XON A;  4C30 A;  3PFY A;  1MBJ A;  1XS9 A;  1P92 A;  2P81 A;  3AG2 H;  4D7N A;  3O8G A;  1J0R A;  3HXL A;  1PUF B;  3LSI A;  5J4V A;  2DW4 A;  2HVS A;  2FSW A;  4Y13 A;  5IP9 J;  2IP2 A;  5IP6 A;  2O8X A;  2V9V A;  4UXN A;  3VYS B;  4B09 A;  3TKY A;  2WTE A;  2KIQ A;  3BZ6 A;  4D5C A;  1B8I A;  5GPA A;  5C4J J;  3J7A Y;  4G6D A;  1W0T A;  1FSH A;  1LB2 A;  3COA C;  1UZC A;  4XRS A;  5HS8 A;  2BY0 A;  4XBF A;  3G3Z A;  2RQQ A;  6PAX A;  2E5N A;  1O3S A;  4MQ9 F;  3HKZ N;  4M72 A;  2EH3 A;  1XTA A;  2RC4 A;  4EJT A;  3O6B B;  4PGG A;  3D5L A;  3WE3 A;  3ZP5 A;  4IX7 A;  2FML A;  2LFB A;  2LKS A;  3HRU A;  3I54 A;  2Y0M A;  4CIC A;  4HSR A;  3CDH A;  1FBU A;  1Y56 A;  1S5L C;  2LVS A;  1YTY A;  5IP7 J;  1HCR A;  5D5U B;  1N77 A;  3KFW X;  3K1P A;  1B8I B;  2VBZ A;  2XAU A;  2Y75 A;  1Z1D A;  5IOY A;  1BW6 A;  5DYM A;  2IGM A;  2DMP A;  1OLT A;  1GHC A;  1ZLJ A;  1IN7 A;  2AO9 A;  3HBL A;  4X6A J;  4FQG A;  5EF6 A;  2JA8 J;  2WY7 Q;  1R49 A;  3DFG A;  1QGP A;  5CJ9 A;  2KIU A;  2G7U A;  1U9O A;  1KU9 A;  1FMV A;  2E34 A;  5CYV A;  3F6V A;  4LD5 A;  4NB5 A;  4NC7 A;  3RPQ A;  1YJW I;  2LDU A;  3OYN A;  2WWY A;  2HNH A;  2O8K A;  1DPR A;  3MVP A;  2RGV A;  3R60 A;  3F8N A;  4P55 A;  1QPI A;  1YW8 A;  3S93 A;  4FE7 A;  3J7Y J;  2XC7 A;  1TWG J;  1AU7 A;  5CVV A;  1FZP B;  4HYE A;  5DCM A;  2R4G A;  4YFX F;  1OQY A;  2BBY A;  3FKI J;  1YX5 A;  5ICC A;  4ZYH A;  2W84 A;  1HBX G;  4OAY A;  2Q8K A;  1GXP A;  3OIQ A;  3DLA A;  4ZYD A;  4IRH A;  1BR2 A;  1WFX A;  4AVP A;  3S16 J;  1WPK A;  3QQA A;  2L9S A;  4E7Z A;  4IXA A;  1YS7 A;  1TQM A;  2JVG A;  4FTH A;  1D3Y A;  3RKY A;  1MDM A;  1X58 A;  3G71 I;  1SFK A;  2AQF A;  1RUN A;  1T95 A;  4E7K A;  3FIW A;  1IXR C;  1XMK A;  2WY8 Q;  3S32 A;  2JVH A;  3GME A;  1S3J A;  3P9C A;  2FF4 A;  5DCM B;  3F8B A;  2F5E A;  5J47 A;  3V7S A;  3IC7 A;  4EGZ A;  2L9V A;  5LRR A;  4CCM A;  4B48 A;  4YIR X;  2FNA A;  1TL8 A;  4Y7N J;  1FYL A;  2WB1 A;  2N8G A;  2F5C A;  4P5O A;  4M9Z A;  4RAZ A;  1WH5 A;  3N97 A;  4GDF A;  3GFM A;  4AIJ A;  1MDM B;  2XGD A;  1FT9 A;  3TO6 A;  3H1C A;  3MZ8 A;  1VFC A;  1TT5 B;  2WAF A;  5EDN A;  2GA2 A;  4U7D A;  4A3D J;  4I76 A;  4I6Z A;  4XRF A;  2KLO A;  2L9R A;  1O3T A;  5ILU A;  4A2U A;  4BJ6 C;  3L2U A;  2HVR A;  3QP5 A;  3WTT C;  1S7E A;  3PUB A;  4BY7 J;  2PMU A;  3R4K A;  4DZJ A;  3BZC A;  3KIO A;  2F4M B;  1P9Q C;  3DEW A;  3ZQI A;  2KHM A;  3H0D A;  1LDJ A;  2IVM A;  1X19 A;  2DAO A;  1BR1 A;  2H1L A;  2LBF A;  4RAG A;  4BE0 A;  5F08 A;  5IYB J;  2JK3 A;  2X9D A;  1HXD A;  2NNY A;  3DU6 A;  1JXS A;  1K61 A;  1BBY A;  3WU1 B;  3MZY A;  4HX7 A;  4CXF A;  1D5Y A;  1BL0 A;  1Z67 A;  4U7B A;  2W85 A;  3M1E A;  1H8A C;  4HX4 A;  4CDG A;  1Z91 A;  1IG7 A;  1MH4 A;  1STZ A;  1QZY A;  2QKM B;  1RR7 A;  3JRB A;  3JSO A;  4BAC A;  4BYY A;  1ETW A;  3FMQ A;  4N9I A;  1APL C;  1QU3 A;  2TRT A;  3VYT B;  1TWH J;  2M4G A;  3K4B A;  4M6X A;  2WB1 N;  2LBF B;  3RQ4 A;  1R5I D;  2AXT C;  1KON A;  2F48 A;  2WV0 A;  5JHF A;  1EF4 A;  3OMY A;  4GYI A;  1U5T A;  2W82 A;  2ZFU A;  2NVX J;  5EJC A;  3X2Q H;  2VIX A;  1D1A A;  3CMM A;  3LST A;  5IOZ A;  2DA3 A;  3GTQ J;  1SD6 A;  3HUG A;  2DOF A;  3HOV J;  3H3Z A;  4UB8 C;  3WU0 A;  2VE9 A;  4II2 A;  3K6G A;  3ZQG A;  3FXL A;  1EKE A;  5E3N A;  4BE1 A;  1X1P A;  2O5R A;  4AU7 A;  2YR2 A;  2MLK A;  2NS8 A;  4KMF A;  2V79 A;  2GQQ A;  4XN3 A;  4OIQ F;  4X1E A;  3ZXS A;  3CCR I;  2YSR A;  3K7A J;  3ZPL A;  4L18 B;  3E97 A;  1T8I A;  2OUM A;  2VUM J;  1U5T B;  2NVQ J;  2PFB A;  1E3P A;  1QVT A;  3CP2 A;  3DPL C;  1UHM A;  5ICG A;  1RPW A;  5M5X J;  5EEG A;  2LF7 A;  2DDB A;  3SHF A;  3V8J A;  4BQO A;  4HPQ A;  2R3S A;  4OAZ A;  2KIF A;  3K2A A;  2HQA A;  1ZQ3 P;  2G9W A;  2K9M A;  4RM2 A;  2ZJR F;  4A0Y A;  3SZG A;  5E8G A;  4XLC A;  3L9F A;  5L3C A;  1ZTR A;  2X51 A;  3QOE A;  3VB2 A;  3JRA A;  2UWM A;  1UG0 A;  4BHP A;  2JSC A;  5F04 A;  3H3V K;  3K9T A;  4MNU A;  2RRE A;  4ZZD A;  2O03 A;  3DTI A;  2A6H F;  5HDK A;  3OV8 A;  2VQH A;  3KET A;  4RA2 A;  1U8B A;  5E1Z B;  3FK7 A;  5F27 A;  1MND A;  1X1D A;  1B4A A;  3FMS A;  4PUS A;  3PSF A;  2HKO A;  4EJO A;  3F72 A;  1RUO A;  2ZNZ A;  3MEX A;  2BVM A;  3BRO A;  2EWN A;  4UV8 A;  1G8X A;  3E7L A;  4OWR B;  2F6C A;  4AD9 A;  1ONV A;  1DQU A;  4OOI A;  4QPQ A;  1VQ8 I;  2GIZ A;  4C3J J;  1YFH A;  4AWX B;  4V2G A;  4NQW B;  2GM4 A;  4ENM A;  3OYG A;  3S14 J;  4A3G J;  1RRJ A;  1JHH A;  2KZG A;  3AL0 B;  2E19 A;  1YW7 A;  4XLA A;  5F0C A;  1HW2 A;  2JA2 A;  2XAF A;  1Y1V J;  3BY6 A;  2X48 A;  2K4B A;  1YQA A;  4NUB A;  3CD6 I;  1BN5 A;  3L7W A;  1DUX C;  2DMT A;  3KX2 A;  3JRF A;  2FE3 A;  1HW5 A;  1WJA A;  2M34 A;  2LLK A;  1RIO H;  2Y2Z A;  3FXK A;  5LFA A;  3J81 K;  1QZE A;  2PEX A;  3RDI A;  2ZJP F;  1O3Q A;  2STT A;  3MQ0 A;  3DXJ F;  4DW6 A;  1XSV A;  1GV2 A;  2QSH X;  2ZNY A;  3FX3 A;  2EA4 A;  4XQF A;  1BJA A;  4UY8 I;  1MH3 A;  4MTE A;  1WH7 A;  2Z3Y A;  1MZB A;  4ESB A;  1IC8 A;  2Z99 A;  4I01 A;  4BQN A;  2CRG A;  3S2H J;  2JQ7 A;  2Z2S B;  2V1N A;  3HEF A;  1VF9 A;  4LMY A;  4M3D A;  1GT0 C;  2CGP A;  2R7U A;  5F0F A;  2HFH A;  1Z9C A;  4XLP F;  4OMZ A;  2NS7 A;  1W7P A;  2ZME A;  4EJV A;  2OZU A;  4UVC A;  1VQ9 I;  2K27 A;  2BHZ A;  1YJ9 I;  3BQZ A;  4LB5 A;  2CFX A;  3LSM A;  3EUA A;  5TGT A;  2R7X A;  3SDB A;  3OYK A;  2B9S A;  1WRJ A;  2HS5 A;  3AG3 H;  2D1V A;  2J5O A;  4Z6Y A;  1R58 A;  4EMS A;  3E0J B;  1WJD A;  1FOW A;  2L01 A;  2CQK A;  1ORK A;  3MZH A;  3WU2 C;  4NDL A;  1XSD A;  4RB0 A;  3GYH X;  1RKW A;  1QBJ A;  2HWV A;  3BR0 A;  1LKX A;  2GXA A;  2HQN A;  2IS1 A;  4OIO F;  3ZMD A;  1W7P B;  1LVA A;  2ZME B;  3E3V A;  4DYR A;  1BIA A;  4BKX A;  3WTW C;  2A5W A;  3C18 A;  1NTC A;  2R7Q A;  4HZF A;  1Y0U A;  2STW A;  2MW8 A;  2Y30 A;  3I64 A;  2V6C A;  3AAF A;  3BJA A;  4XKC A;  2FBK A;  2HTJ A;  1Y8R B;  4ON0 A;  2L5Q A;  2XF5 A;  3E5X A;  3FWE A;  3R61 A;  4A5N A;  5CKT A;  1RR8 C;  4G8X A;  3GFL A;  4TV7 A;  2V1X A;  4MIM A;  4MO7 A;  3I58 A;  1XB4 A;  4JQF A;  5DUI A;  4M74 A;  5GP9 A;  1D0X A;  1S72 I;  5BNG A;  5DM6 F;  3OS1 A;  3P9K A;  2CYY A;  2FD5 A;  2QQ9 A;  1XDU A;  1OYI A;  1W7P D;  3BT9 A;  5J6X A;  3HGG A;  4RBO A;  5LGT A;  2HZT A;  3D0S A;  3JTG A;  1IN8 A;  1JGS A;  3LQQ A;  5EEA A;  3ECH A;  5DM7 F;  1OCT C;  2AQE A;  2CV1 A;  3J81 Z;  2RKH A;  3PUF A;  4O5V A;  3WTU C;  3IRQ A;  2CV2 A;  2VOO A;  2MA3 A;  1R1T A;  4IHV A;  3ZQF A;  1MMS A;  5JR3 A;  3H0G J;  2XRL A;  1X1B A;  4N4N B;  4J00 A;  4Y15 A;  2P7V B;  2VC0 A;  1KU7 A;  5D5V B;  2ZBK A;  4KIG A;  3ELK A;  4IZZ A;  4G9Y A;  4KDP A;  3TED A;  3M7G A;  2ZB9 A;  1DGR M;  5EZG A;  4IKF A;  3HSE A;  1OJL A;  1Z7U A;  2Z33 A;  3TO9 A;  3SXY A;  2P7C B;  1QO0 D;  2XAS A;  3ONQ A;  2W1O A;  1R4M B;  3ZCO A;  1WSU A;  3LA2 A;  5DDG A;  4HF1 A;  1FEX A;  4I99 C;  1PVE A;  1W5C C;  3WGH A;  2PMH A;  5E17 F;  2XV4 S;  3M8E A;  4QSH A;  2QYO A;  3O2P E;  3LSR A;  4G6Q A;  1IXS B;  1K4S A;  1TZL A;  3GW2 A;  4AVZ A;  1IUY A;  1ETV A;  4II3 A;  3OS2 A;  4IHX A;  3NRV A;  4DBQ A;  3EET A;  2GIV A;  2MAB A;  3TOB A;  1RNL A;  1IDZ A;  1OR7 C;  2VOD A;  5B1A H;  3DCF A;  5J8F A;  3B73 A;  4HF2 A;  1MW7 A;  5KHD A;  2ZSI B;  2ISZ A;  1HKQ A;  3CJT B;  4A3K J;  4RMN A;  5D4R A;  3EUH A;  4DZP A;  4HNV A;  2DT7 B;  2RQP A;  1U8R A;  1X1C A;  2I5U A;  2XAH A;  2R7T A;  4JX6 A;  4I7H A;  5DCF A;  1ULY A;  2X4H A;  5D5X B;  2VKD A;  1IRZ A;  4AUX A;  2DA4 A;  3S3O A;  1XC5 A;  1OYW A;  3GBG A;  3IH3 A;  2ICW G;  4LLN A;  2X1D A;  2X6O A;  2DFH A;  2EPF A;  4ITV A;  2VLA A;  3R6S A;  3QPT A;  3KZZ A;  4YIF A;  1T39 A;  2KQR A;  5K5Q A;  5J8C A;  3S1Q J;  1AWC A;  2J5P A;  4PDK A;  1T0F C;  4XLN F;  1H88 C;  5FRN A;  3OIP A;  3G6E I;  3VDX A; 
#chains in the Genus database with same CATH homology
 1AKH B;  3BTI A;  2DMP A;  2K9N A;  2AO9 A;  3TW7 A;  2EQR A;  3HBL A;  2FQ4 A;  3A03 A;  1HLV A;  4X6A J;  5EF6 A;  2JA8 J;  2O7O A;  3CQZ J;  3Q3S A;  2LD5 A;  2E2J J;  3BTC A;  4V2F A;  1U9O A;  2AHQ A;  3LSP A;  2M8G X;  1ETO A;  4A3J J;  4L5E A;  2O8K A;  1B72 B;  3MVP A;  1ETK A;  1QPI A;  1YRN A;  2VI6 A;  2DMQ A;  2HYJ A;  4QTR A;  3WHB A;  4FE7 A;  1MBH A;  1TWG J;  1AU7 A;  1I6H J;  1HOM A;  2DJN A;  2JWT A;  3FKI J;  3GTP J;  2WV1 A;  3PO2 J;  3M4O J;  2DA6 A;  3BR1 A;  1NK3 P;  3GTO J;  1GUU A;  1MBK A;  2EZH A;  3ZQL A;  3S16 J;  3QQA A;  1F36 A;  1WPK A;  1GV5 A;  2I10 A;  2GBY A;  3ZOB A;  4FTH A;  1MSF C;  1X58 A;  1BA5 A;  3S1M J;  2E1O A;  3FIW A;  4EEF G;  4C2M J;  1G2H A;  3JRG A;  1TWF J;  1LFU P;  3OIO A;  1GVD A;  4ABZ A;  2DA1 A;  3LSJ A;  3G1O A;  3ZQH A;  2HOS A;  3BQY A;  2L7M P;  3JRE A;  3MKL A;  5FLM J;  4M3B A;  3CMY A;  4Y7N J;  2CQQ A;  1P7I A;  2N8G A;  2H1K A;  2DN0 A;  1WH5 A;  2JJ7 A;  2E2H J;  1AHD P;  3HOZ J;  3WHC A;  3HOU J;  2XGD A;  2CU7 A;  2ELK A;  3O8H A;  3OSF A;  1VFC A;  1RET A;  5EDN A;  3HOY J;  3PM1 A;  5K7H A;  3S2D J;  4A3D J;  3FIS A;  4I76 A;  4I6Z A;  4A3M J;  1IV6 A;  2L9R A;  4FIS A;  1JJ8 C;  1SAN A;  3BR6 A;  3B6A A;  1HF0 A;  1ETY A;  1S7E A;  2XGC A;  4BY7 J;  4XRS G;  4DZJ A;  3DEW A;  3ZQI A;  5FKN A;  9ANT A;  1IUF A;  3BR2 A;  4JYK A;  1DU6 A;  1FTZ A;  3HOX J;  2JN6 A;  5F08 A;  3C2B A;  2JK3 A;  5IYB J;  5DS9 A;  2X9D A;  3S1N J;  1DU0 A;  1K61 A;  2ME6 A;  2JA5 J;  2COB A;  2HOA A;  2E2I J;  2JA7 J;  1BJZ A;  1D5Y A;  1BL0 A;  3VPR A;  3JR9 A;  1H8A C;  1W0U A;  2HXI A;  5EGO A;  1IG7 A;  1FIP A;  1MH4 A;  1A5J A;  1RR7 A;  3JRB A;  4DYQ A;  5FJ8 J;  1ETW A;  1APL C;  2TRT A;  2K9Q A;  1Q1V A;  1TWH J;  2HI3 A;  1JUP A;  2ECC A;  1F43 A;  2WB1 N;  3QPS A;  5C3E J;  1EF4 A;  2KT0 A;  4M6V A;  1OFC X;  2NVX J;  2MGQ A;  1P7J A;  4MFE A;  2R93 J;  2CQX A;  2R7Z J;  3BG9 A;  5IOZ A;  2DA3 A;  2LP0 A;  3GTQ J;  5EGO B;  3HOV J;  3LOC A;  1UMQ A;  1WCM J;  1U9N A;  3ZQG A;  5E3N A;  1ENH A;  5M3F J;  1HDD C;  2ME0 A;  1UG2 A;  3BTL A;  1Z77 A;  2NS8 A;  1LE8 A;  4X1E A;  5FLV A;  2ECB A;  4G12 A;  4FCY A;  5M5Y J;  3HB9 A;  3K7A J;  1JKP C;  2D5V A;  4A69 C;  3SJM A;  2TCT A;  1MBG A;  3LSG A;  4D5F A;  5EG0 A;  3I4M J;  2VUM J;  3BG5 A;  2IEK A;  2JA6 J;  2NVQ J;  4RDU A;  1QVT A;  1JUM A;  1RPW A;  5M5X J;  3F0C A;  4A3I J;  5GPC A;  1ZGW A;  5DTD A;  3K2A A;  2OF7 A;  2L0K A;  1ZQ3 P;  1FTT A;  1FIA A;  2Y0S N;  4S0H B;  1ZTR A;  2YS9 A;  3JRA A;  1U78 A;  1WGX A;  1LE8 B;  2H8R A;  5IYC J;  1JT6 A;  5F04 A;  2CUE A;  3A01 A;  3H3V K;  5HOD A;  3SFI A;  5EG0 B;  1U8B A;  3FK7 A;  5F27 A;  3MN2 A;  4CYC A;  1JTX A;  3Q0V A;  3S1R J;  4A3E J;  3HM5 A;  4M3G A;  1JJ6 C;  3E7L A;  4BBR J;  2HQ5 A;  1SFO J;  3IH4 A;  1X2N A;  4JP0 A;  1QVU A;  3TP0 A;  3TP3 A;  5IPA A;  1RKT A;  3FK6 A;  1JKQ C;  2DMN A;  2IBD A;  5E3M A;  4C3J J;  5EYR A;  3GTG J;  5J1Y A;  4UUS A;  2G0E A;  4V2G A;  2GM4 A;  3A01 B;  3S14 J;  4A3G J;  2MG4 A;  1X2M A;  3BTJ A;  2E19 A;  4J19 A;  1Y1W J;  1XG1 A;  5F0C A;  4CYC B;  1Y1V J;  3Q0W A;  2X48 A;  3CCY A;  5JLX A;  2XPU A;  4QIW N;  5F0H A;  3UKG A;  1T56 A;  1CQT A;  2DMT A;  2EZI A;  3JRF A;  1LFB A;  1TWC J;  4B1R A;  4BXX J;  2QCO A;  2M34 A;  2LLK A;  1ZR2 A;  3A02 A;  2Y2Z A;  1ZR4 A;  2Y9Z A;  4UUS B;  3NAR A;  2EZL A;  4DW6 A;  1GV2 A;  1ETX A;  2LK2 A;  4AYB N;  4W1U A;  3JRC A;  1MNM C;  1MH3 A;  2O9L A;  1MSE C;  1WH7 A;  4A3C J;  3QPL A;  1IC8 A;  2NOG A;  2CRG A;  1IDY A;  3S2H J;  2CJJ A;  3HEF A;  1VF9 A;  4M3D A;  1GT0 C;  2CUF A;  4FE4 A;  5F0F A;  3S17 J;  1A6I A;  2R5Y A;  3OOU A;  2DTZ A;  4LOC A;  4MLO A;  2L7F P;  2NS7 A;  2DA5 A;  1FJL A;  1POG A;  1JGG A;  2ID6 A;  2GLO A;  5K7Z A;  4XIC A;  1TC3 C;  5FKO A;  2R0Q C;  4AC0 A;  2FX0 A;  3BQZ A;  3G1L A;  5J3L A;  3HDD A;  1OCP A;  3HOW J;  4GFB A;  1IJW C;  3GTM J;  4JX4 A;  3PO3 J;  1O4X A;  2B63 J;  3W6V A;  2NVY J;  5FKL A;  5EZH A;  2R5Z A;  3JRD A;  1HDP A;  1ORK A;  3BG3 A;  2M2E A;  5F1J A;  4NDL A;  2M9H A;  2R5Y B;  1RKW A;  3M3Y J;  5M3M J;  3BR0 A;  2XPV A;  1TWA J;  1UHS A;  1JTY A;  4M3E A;  4A3L J;  4XID A;  4D7M A;  2XSD C;  4DYR A;  3IV5 A;  4IHW A;  2RAE A;  4B4C A;  4BKX A;  4XRM A;  1NTC A;  4M3F A;  3TW6 A;  2HDD A;  2XPW A;  5FKK A;  2MW8 A;  2Y30 A;  1ETQ A;  4IEJ A;  1IGN A;  2R92 J;  2PMZ N;  1I50 J;  2K9S A;  1ZKG A;  3GTJ J;  1H88 C;  2VKE A;  3JRI A;  4JX5 A;  4DYC A;  2R5Z B;  1T33 A;  2QF7 A;  2LKX A;  3JRH A;  4MIM A;  4MO7 A;  4UUT A;  5GP9 A;  5BNG A;  1GDT A;  2NVT J;  1Z0X A;  2MSY A;  2FD5 A;  1JUS A;  2DMU A;  3BT9 A;  3HGG A;  4RBO A;  2XGE A;  4XK4 A;  3RZD J;  1BW5 A;  5EEA A;  1WI3 A;  1OCT C;  2IAI A;  5IYD J;  2XB0 X;  3LNQ A;  3GTL J;  1QRY A;  1YRN B;  5E3O A;  4C3I J;  2HOT A;  2DA2 A;  4IHV A;  2EBI A;  1RES A;  2W48 A;  2YUS A;  3ZQF A;  3Q0U A;  1K83 J;  3H0G J;  3RZO J;  2KDZ A;  2XRL A;  5C44 J;  2ID3 A;  2OPT A;  2LY9 A;  1VND A;  3CDL A;  2Y31 A;  2FJ1 A;  3S15 J;  2JMW A;  1PUF A;  3GTK J;  5M5W J;  2YU9 J;  3D1N I;  2WAQ N;  5FKM A;  5K7F A;  5J1R A;  1JKR C;  3TED A;  2EZK A;  3BR5 A;  2ZB9 A;  5EZG A;  2L7Z A;  1OJL A;  2K40 A;  3IH2 A;  2XB5 A;  5E3L A;  1R9T J;  4MFD A;  3RKQ A;  2LR8 A;  5J1U A;  2HXO A;  4B3A A;  3RQI A;  1I3Q J;  4C3H J;  1ZK8 A;  2VPR A;  3SDG A;  1MBJ A;  1FEX A;  1XS9 A;  2VKV A;  2P81 A;  4QSH A;  4D7N A;  3LSR A;  3O8G A;  3I4N J;  1PUF B;  1ETV A;  4A3B J;  4IHX A;  1IDZ A;  5IP9 J;  3ZQC A;  1MBF A;  5IP6 A;  5JLW A;  3B6C A;  3DCF A;  3BR3 A;  4D5C A;  1B8I A;  5GPA A;  5C4J J;  3L1P A;  1W0T A;  1AKH A;  1JT0 A;  4Y52 J;  4A3K J;  4XRS A;  4BY1 J;  1JKO C;  4DZP A;  4HNV A;  4A93 J;  3OSG A;  3HKZ N;  5C4X J;  2EH3 A;  1H89 C;  4JX6 A;  3G1M A;  1MBE A;  1IRZ A;  4AUX A;  2DA4 A;  1E3O C;  1XC5 A;  1NK2 P;  3GBG A;  3IH3 A;  2LFB A;  2M0C A;  2DA7 A;  2X6O A;  4IHY A;  1B72 A;  2Y9Y A;  2LVS A;  2LTP A;  5IP7 J;  4A3F J;  1HCR A;  3S1Q J;  1ITY A;  3NAU A;  1B8I B;  4BBS J;  4W97 A;  5IOY A;  1BW6 A;  3HGY A;  1VI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...