3MKLA

Crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
QPNMRTRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of DNA-binding transcriptional dual regulator from Escherichia coli K-12
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator gadX
total genus 35
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00165 HTH_AraC Bacterial regulatory helix-turn-helix proteins, AraC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mklA00
1X2NA 1VNDA 4W97A 1HCRA 4JX5A 2IAIA 4G12A 4RBOA 2G0EA 1ZKGA 5C4JJ 3WHBA 2NVQJ 4A3BJ 1U8BA 4L5EA 1JJ8C 3DEWA 1IUFA 2ELKA 4GFBA 3BR0A 3RKQA 1BW6A 3BR2A 3GTOJ 2IEKA 4DYRA 4Y52J 4J19A 4FCYA 2AO9A 3A01B 5IP6A 5EG0A 1UHSA 1HOMA 3JRIA 4DZJA 1TWHJ 2FX0A 2OPTA 1IDZA 4FTHA 3LOCA 2K40A 2ME6A 1ETKA 1JGGA 1RPWA 2AHQA 4QTRA 4A3MJ 4QSHA 2LVSA 2R5YB 3NARA 1FJLA 2X6OA 3OSFA 1WH5A 1IDYA 2FD5A 4C2MJ 1B8IB 2LR8A 5DTDA 3IV5A 1IV6A 4W1UA 1CQTA 4D7NA 3H0GJ 1JT6A 4XK4A 3G1OA 1NK3P 2LLKA 1IRZA 3JRAA 1ZR4A 3PO2J 9ANTA 1PUFA 2L7FP 3DCFA 2DMUA 1XG1A 3HM5A 5M3MJ 2EZHA 4AYBN 1OCTC 2R0QC 1WI3A 2JJ7A 1IG7A 3JR9A 2QF7A 3LSRA 2VUMJ 3CMYA 1MH4A 3BR5A 5C44J 3O8GA 1WCMJ 3JRHA 2CUFA 1W0TA 3HEFA 3HKZN 1ZQ3P 1JKRC 2L7ZA 2PMZN 4ABZA 4XRMA 5E3OA 2L0KA 4BBSJ 1JJ6C 5C4XJ 4AC0A 5EGOA 3JRBA 4A3GJ 3OOUA 1MBKA 5E3NA 5EG0B 1OCPA 4IEJA 3E7LA 1JKQC 5K7HA 1JUPA 3HGGA 2R7ZJ 1AKHB 2GBYA 1Y1VJ 2XRLA 4MIMA 1GUUA 1MBEA 2JA7J 1DU6A 2Y2ZA 2CUEA 2MW8A 3C2BA 5IP9J 2E2HJ 5IYCJ 1K83J 5K7FA 4M3DA 2TRTA 1GV2A 2XPUA 3OSGA 5FLMJ 3S15J 1H8AC 3HOXJ 5EZHA 3O8HA 4D5CA 3HBLA 1PUFB 2JMWA 3BR3A 4MO7A 1X2MA 3A03A 2M9HA 2L9RA 2XB0X 1WGXA 2Y9YA 1GV5A 1BJZA 3GTPJ 3A01A 1A6IA 4X6AJ 3GTMJ 5GP9A 4IHVA 3G1LA 3SDGA 1JKOC 5F04A 1TWAJ 3I4NJ 5FKKA 2NVYJ 1U78A 3PO3J 1SANA 2R5YA 3HOWJ 2D5VA 2XGEA 3JRGA 1QPIA 3S1QJ 3TW7A 1MSFC 4BKXA 1SFOJ 2JA5J 3HDDA 2Y9ZA 2HOAA 4S0HB 4RDUA 1BA5A 3Q0VA 3S1MJ 3JRDA 1DU0A 1YRNA 2DMTA 2GLOA 2N8GA 4B1RA 3F0CA 5J1YA 4A3FJ 2YUSA 2DA7A 2K9SA 1JT0A 4JX6A 4DYQA 5IOYA 3S1NJ 3TP3A 1HF0A 2O8KA 4BY7J 5C3EJ 1H88C 1MSEC 3S14J 2NVTJ 3G1MA 1Q1VA 1O4XA 1FIPA 2DMNA 1X58A 2ID6A 2ME0A 3CDLA 4XICA 2JK3A 2O9LA 3D1NI 4M3FA 2LKXA 3S2HJ 5M5XJ 1R9TJ 1MBFA 2XPWA 4DW6A 4B4CA 2IBDA 1LE8B 5F1JA 3BTJA 5EEAA 3S17J 2EZKA 3BQZA 1TWCJ 2VKEA 2HOTA 3TEDA 2EBIA 1VI0A 1A5JA 5FKLA 2FJ1A 3QPLA 2XGCA 5JLXA 4MFDA 3RQIA 3HOVJ 5J1UA 2JA6J 1ETOA 3S16J 1B72B 2LP0A 5IYBJ 5EDNA 2HDDA 1VF9A 4A3IJ 2DA3A 3BR1A 4V2FA 3UKGA 1VFCA 3TP0A 1ORKA 4UUSB 1ZTRA 5E3MA 4MLOA 1TC3C 1TWGJ 1FEXA 4DZPA 2L7MP 1ETWA 2R5ZB 5EZGA 3M3YJ 1EF4A 1S7EA 2ID3A 1IJWC 1OFCX 2WV1A 1ZK8A 3GTQJ 3BTLA 2DTZA 1LFBA 1APLC 2HYJA 5J1RA 3W6VA 2YS9A 4B3AA 1H89C 1RKWA 1JUSA 2K9NA 4C3IJ 2E1OA 3Q0UA 4JP0A 3K7AJ 2R93J 2JWTA 2E2IJ 2CQQA 3TW6A 1IC8A 4M6VA 3I4MJ 1XS9A 3H3VK 4CYCB 4UUTA 4FISA 1U9NA 4HNVA 3GTGJ 5K7ZA 2MGQA 2O7OA 5F0FA 1GT0C 1QVUA 5IOZA 1T33A 1YRNB 2XGDA 2GM4A 2TCTA 5M5YJ 2P81A 1AU7A 1BW5A 2HQ5A 2DA4A 5HODA 3WHCA 2JN6A 1IGNA 3IH2A 1ETYA 1QVTA 2EZIA 5J3LA 4A3LJ 1B72A 4IHYA 1ETXA 1ITYA 3FKIJ 3FK6A 2LTPA 2MSYA 1WPKA 1MBGA 5IP7J 4NDLA 3HB9A 5E3LA 1I50J 4A69C 2EQRA 1ZGWA 3K2AA 3RZOJ 3GBGA 2DA1A 4BBRJ 3LSGA 2Y30A 3LSJA 2DN0A 2HOSA 1LE8A 1I6HJ 4AUXA 1QRYA 1MBJA 1G2HA 2OF7A 3ZQGA 4JX4A 1P7IA 3PM1A 2EZLA 2I10A 3B6AA 5M5WJ 1FTTA 1ENHA 3FK7A 2CJJA 2ECCA 3BG3A 4IHXA 2DMQA 3LSPA 2DA6A 3ZQHA 1GVDA 1ETQA 3MKLA 3GTKJ 4A3KJ 4D7MA 4A93J 1UMQA 2NS7A 4CYCA 2WB1N 3L1PA 3SFIA 1JTYA 3FISA 4UUSA 1JUMA 2QCOA 4XIDA 4A3JJ 3A02A 2CRGA 2M8GX 4Y7NJ 1RETA 3JREA 4EEFG 4BY1J 2NS8A 4XRSG 3LNQA 1JKPC 2R5ZA 3BG9A 3JRFA 1Z77A 3ZQFA 4BXXJ 5M3FJ 2NOGA 3BR6A 5F0CA 2DA5A 1MBHA 3BG5A 3GTJJ 1Z0XA 1RR7A 1F36A 4I6ZA 3VPRA 3QQAA 3S2DJ 3M4OJ 3Q3SA 2H1KA 4M3GA 4A3CJ 1P7JA 2H8RA 4JYKA 3B6CA 5JLWA 3GTLJ 3Q0WA 2VKVA 2RAEA 4I76A 2KT0A 1K61A 2XB5A 3QPSA 2R92J 5F08A 2VI6A 1UG2A 5GPCA 3JRCA 1OJLA 2LK2A 2B63J 3HOYJ 2XPVA 1WH7A 3ZQIA 1FTZA 4MFEA 2CQXA 1T56A 3S1RJ 2Y0SN 1D5YA 1LFUP 1AHDP 5F27A 5GPAA 3NAUA 2JA8J 3BTIA 5EYRA 2WAQN 3FIWA 4DYCA 3IH4A 2LD5A 1NK2P 1I3QJ 2FQ4A 5FKOA 2COBA 5FKMA 1POGA 2MG4A 2X48A 4M3BA 2KDZA 3BTCA 2E2JJ 4V2GA 2ECBA 2Y31A 1W0UA 5IYDJ 2M0CA 4IHWA 1MNMC 3ZOBA 4C3JJ 2LFBA 5BNGA 5IPAA 5EF6A 2DA2A 3MN2A 3ZQCA 4A3EJ 3SJMA 3IH3A 3BQYA 1F43A 5FLVA 1NTCA 1RKTA 1ETVA 4M3EA 4FE7A 5FKNA 1TWFJ 4XRSA 2HXOA 1MH3A 1FIAA 5F0HA 2DMPA 1JTXA 4FE4A 3HOZJ 2HXIA 2E19A 1B8IA 1XC5A 2CU7A 2K9QA 3CCYA 2XSDC 5EGOB 1E3OC 3HOUJ 4X1EA 5FJ8J 4LOCA 1ZR2A 1Y1WJ 4D5FA 1HDDC 1RESA 2DJNA 2M2EA 2X9DA 1GDTA 3CQZJ 3OIOA 2ZB9A 2W48A 1BL0A 2LY9A 4C3HJ 2HI3A 5DS9A 3RZDJ 2VPRA 3ZQLA 1AKHA 1U9OA 2YU9J 3BT9A 2EH3A 2M34A 1HLVA 3HGYA 3MVPA 2NVXJ 1HDPA 4A3DJ 4QIWN
chains in the Genus database with same CATH superfamily
2R7DA 1ERDA 4G6TB 1XB4A 3ABUA 2FXAA 1HCRA 2FE3A 2KRCA 3E5QA 4MTEA 3G4SI 3WTUC 2CUZA 3EUHA 4UB8C 2Y69H 1X1CA 4XLPF 4L5EA 3OYEA 3DEWA 3Q9VA 1BR2A 1SFUA 4GFBA 1R5ID 3F8MA 3BR0A 3KEOA 3BR2A 1YE9A 1UHWA 1LPQA 3DU6A 1P9QC 2K7LA 1KQ9A 3QP5A 4FCYA 4ENMA 3J7ZI 2VONA 5EG0A 2WA0A 1JHFA 2FBIA 1HOMA 3PSIA 4DZJA 3M1EA 3KLNA 1TWHJ 1YO5C 1IDZA 3KYDB 2YX4A 5D4RA 4UY8I 1D0XA 4B44A 4QTRA 4QSHA 2R5YB 1FMVA 5GAHJ 1FJLA 1FZPB 3OSFA 2IGNA 1WH5A 1IDYA 4G7OF 4B43A 3S32A 3R6SA 2VJIA 5DTDA 3IV5A 1WWXA 3I59B 4W1UA 2H6BA 2OV7A 3DFGA 3H0GJ 3G1OA 3MQ0A 3EETA 4GYIA 2QQ8A 4PFOA 5EJCA 3IL2A 2FQ3A 3QWLA 4NC8A 2EPFA 2P8TA 2QKLB 5FLXK 2ISZA 1YFHA 3DCFA 2DMUA 3LA7A 1XG1A 3Q9SA 1PUEE 4R8HA 4DBQA 2DQLA 3GFLA 3VWBA 2XF6A 3JSOA 2EFWA 1YG2A 4EGZA 6PAXA 2XRNA 4WXCA 3ESWB 3GZNB 3CMYA 2E36A 3BR5A 1ZARA 1FOYA 4I7HA 2L9SA 4R1HA 2FUG2 4RB2C 2L54A 1W36D 2DU9A 3WGGA 2VBXA 3BWGA 1ZQ3P 1JKRC 2L7ZA 1FBUA 1YJWI 2WC2A 2L0KA 2RGVA 1XMXA 2W82A 2EK5A 3LA3A 3RPQA 4DNCA 3SZPA 4AC0A 1U5TA 3U21A 3K1PA 3JSPA 3K70C 2X85A 1MBKA 3QRFF 4Q5SF 2L3DA 1WJ5A 1YW8A 3E7LA 5F6FA 5H20A 2KIMA 1OYYA 2ZSIB 4L9TA 3ZPLA 2F4IA 2HYGD 1AKHB 1EA3A 2OA4A 3LA2A 2P7CB 1MBEA 2BV6A 5FD6A 5LEJA 2ZBKA 4XR6A 2CH0A 4U0VA 2QQ9A 1N25A 4LLNA 2F2EA 2E2HJ 4LD5A 2W57A 3MEXA 2XUBA 1Z7UA 4EJTA 1VQ8I 2EFPA 2KJCA 1DP3A 1SFKA 1GV2A 3ROUA 5FLMJ 3S15J 1H8AC 3RIRA 2R7UA 2Z99A 4LLLA 3ZMVA 2STWA 1G3SA 2LY1A 4MO7A 1FT9A 4OMZA 2L9RA 3EYIA 2RC4A 3A4CA 5CVUA 3SEQA 1A6IA 2DOFA 4E70A 3ECHA 4IHVA 3G1LA 1Y0NA 3SDGA 1JKOC 3I4NJ 1WHUA 3CMMA 2VBYA 5J6XA 2X0LA 2DW4A 1SANA 2XAHA 4F93B 1Z91A 2JA2A 1EKEA 2GIVA 2ZSHB 3K70D 4CHUA 5DUIA 1SFOJ 1IV8A 4RDUA 4IOAF 4WF2A 2LKPA 3JRDA 1JI8A 4Y15A 2DMTA 2RREA 4Y4RA 3MFKA 2IT0A 1S7AA 3F0CA 3BG6A 3GW2A 1IRGA 4A3FJ 2YUSA 2DA7A 4L5IA 3WG7H 3GUDA 3QOPA 2E1CA 2XDVA 2HU9A 2VJ4A 1TW2A 3BJAA 3ZMSA 4YG2F 1SMTA 2DDAA 3FM3A 1USSA 2AQFA 2RNGA 2X4HA 5TRDA 4UVCA 4ENJA 1MSEC 2KJBA 3C7JA 5KNLA 1DPRA 3G1MA 4EV0A 1Q1VA 2IRFG 1RRJA 5IT9K 3HRTA 3HRUA 4LIVA 2Z33A 3V7CA 4P5OA 2ME0A 4BJ6C 5ILUA 2JK3A 1YI2I 1K6YA 5LRSA 5M5XJ 3KEQA 2IBDA 4CZCA 1JHHA 2A69F 2BY1A 3S17J 1PDNC 1U5TB 4HEA2 3G6EI 3VEPA 2PX9A 2QWWA 3VODA 3TEDA 1VI0A 3ONQA 1A5JA 4B3XA 3CZ6A 2KZGA 3QPLA 4FQGA 3KP5A 2IPQX 1MIJA 4DGWB 3HOVJ 3QAHA 2VT3A 2JA6J 1ETOA 3D5RC 2VXZA 3S16J 2FF4A 3F72A 2A07F 3NWSA 5EDNA 4BDZA 2HDDA 1FPQA 3BP8A 1USTA 1KONA 3QPTA 4AD9A 1K4TA 2OQGA 4J00A 2OTJI 3AG4H 4HDVA 3DBLB 2LKSA 3I55I 2L7MP 2MD0A 3TO6A 3DF8A 3VOEA 1S7EA 2ID3A 3KZZA 3E5UA 3FXKA 4A0ZA 3LSHA 4CH7A 2WV1A 2E1MB 1APLC 3GZ5A 2DYSH 4RAGA 1EJ9A 1ZELA 1FOKA 2K9MA 2WV0A 5J1RA 2WY7Q 2NXNB 1P2FA 1JUSA 2E1OA 2FMYA 3ZGKA 3K7AJ 1RNLA 3PQKA 3B02A 3WTSC 2CQQA 2PEXA 1IC8A 2PI0A 2E5ZA 2K02A 4CYCB 2R7RA 4FISA 2MD5A 1V54H 2MGQA 2MLKA 2O7OA 1A36A 2QSFX 2HFHA 3FXLA 1OR7A 1W4MA 2R4GA 2XGDA 2GM4A 1Z7LA 1ZYRF 3E1SA 2DA4A 2JN6A 1IGNA 4RB1A 1LDJA 2Q2EA 2OCCH 1I1GA 4MNUA 5J3LA 5ILSA 4EQQA 1HBXG 3K4JA 3FKIJ 2JUGA 3FK6A 4X0GA 2LBFA 4A0YA 2MSYA 1WPKA 1KA8A 4UXNA 5IP7J 2BYVE 2OC6A 2PQ8A 1D1BA 2F5EA 1KU7A 4B09A 4PJLA 2DA1A 1OYIA 2QQBA 2K85A 3LSJA 3ZR8X 1UJ8A 3TOBA 4BXUA 3DBRB 1UCRA 3JCUC 2EA4A 4ASNA 2BW3A 2VT2A 1SD7A 3EUHC 5FRMA 2KRHA 4CSWA 4AUXA 1MBJA 4QLCU 5J4YA 3PM1A 2EZLA 1LB2A 1V3FA 3K4NA 1TL8A 4FX0A 2RQQA 2E5NA 5IT9Z 1B59A 4PSWA 4IHXA 2ELJA 2VB6A 2DMQA 5E17F 1SC7A 3ZQHA 1E2XA 3GTKJ 3L2WA 5B1AH 4Q47A 5H6QA 1SD5A 1UMQA 4PZJA 4IJAA 3H36A 4WXDA 2P4WA 2MC3A 4CGZA 2JUCA 4XLHA 4EJUA 4UUSA 3ZQQA 3ZMTA 1YS6A 4XIDA 1VQ9I 4HRIA 5KVRA 3W6KB 4MEXF 4II3A 3E6MA 1VZ0A 1Z3YA 1RETA 1VQPI 4M72A 4XRSG 5H6RA 5GAGJ 3ZQFA 5JVTA 4LJZF 4DJAA 5M3FJ 2NOGA 5DD4A 1WRJA 2DFEA 1MMAA 5LD2C 2DA5A 3DEUA 1Z0XA 5JR3A 3AAFA 2DT7B 4HAMA 5E1WA 2BXYA 1F36A 4Q48A 2OBPA 3T5XA 3S2DJ 3M4OJ 3M8EA 3KYCB 3HUGA 3QYEA 2H1KA 2PJRB 1KGSA 3GFJA 3B6CA 4WK8F 2F5VA 4AIJA 4BQAA 2XSJC 5JVGF 2KL4A 3K9TA 2KT0A 1QZYA 3K1MA 1T0FA 1K61A 3QPSA 2PJPA 4HYEA 4C2TA 3PFYA 1R1VA 5DM7F 1ULYA 3PFIA 4E7SA 2M1BA 2B63J 3HOYJ 4BL0B 1X1AA 3H9QA 1FTZA 2CQXA 1T56A 1IXRC 1WQ2A 2DJIA 2Y0MA 4EM1A 5HNHA 3GCMA 1HKSA 2DK5A 2BBYA 2IW5A 2Q2EB 2W25A 2V4JC 3EPZA 1H0MA 5EYRA 4DYCA 3IH4A 5J8FA 2LD5A 1QU3A 3V8JA 2LBFB 2BZTA 4HOBA 2M0MA 2K5CA 5HLGA 3BLYA 1BR1A 2HTSA 3I71A 5FKOA 1OQYA 3HJEA 3DPTA 4O5VA 2JSCA 3H5RA 1T98A 1R22A 2MBFA 4Y13A 4M3BA 2E60A 4RLFA 3SFZA 1ZN2A 2Y31A 1U0JA 2GOXB 4N4OB 2BY3A 3KP6A 3LQQA 3ZOBA 4C3JJ 2LFBA 1ZHFA 1EH6A 2K3PA 5IPAA 5EF6A 3MN2A 2K27A 3ZQCA 4YIRX 1OMIA 3E6BA 2Z1DA 3V7RA 4HX8A 2EIMH 5DV5A 3E6CC 2BGCA 3LFKA 4M3EA 4OU0A 5E8GA 3EYYA 5FKNA 3FMRA 2HQNA 2HXOA 1KYWA 1XTAA 4M9SA 3TBIA 5D8KB 2DMPA 3PUFA 4JBAA 4FE4A 4PJMA 3O6BB 4AM3A 2HXIA 2KHMA 1KYZA 4NNJA 1B8IA 5ICGA 3CCYA 3W3CA 3DQVC 2DOAA 1FY7A 5JFRA 5EGOB 1E3OC 1W1WE 2XGXA 4X1EA 3QP6A 1HDDC 1RESA 3M9AA 3U2RA 2XKOA 3CQZJ 2DT5A 3OIOA 4OAYA 2ELHA 2JVHA 2W48A 1EV7A 1BL0A 5DS9A 2NRAC 3F8BA 2Q1ZB 3JAMZ 1IN7A 2EH3A 3OR1C 3HGYA 1X1PA 1G3YA 3L2RA 4BQQA 5CJ9A 4Z2YA 1QZEA 1B1BA 1FNNA 4W97A 4XKBA 4IQ4A 1LVAA 2IAIA 4LG0A 1LEBA 2VC0A 1G6NA 2X6WA 1X3UA 1ZKGA 3OWTA 5FROA 2NVQJ 5BOXA 4A3BJ 1T95A 1JJ8C 3K6GA 3R61A 3U1KA 1XN7A 1UZCA 2OTLI 3BPXA 2B7EA 3GTOJ 2IEKA 2K86A 1Z9CA 3GXOA 2ZXHA 4HDUA 5K5QA 1LQ1A 4HNTA 2ZMEA 4XKCA 3JRIA 3VYRB 1VQLI 2ZCWA 2FX0A 3EDPA 2K40A 1R49A 2KIFA 3DPLC 1ON2A 3ERMA 1JGGA 2FBKA 2FRHA 2ZFUA 4A3MJ 2RDPA 4G94A 4UNOA 3CO7C 5EEGA 1VQOI 4PUSA 2JPBA 4KMUX 1K7AA 1N77A 1GVJA 2OJED 3FBNB 5CVJA 4C2MJ 1FLIA 3J7AY 3BROA 2LR8A 2HZDA 3GYHX 3G3ZA 1YJNI 1GXPA 1IV6A 2IS6A 3WU1B 4XK4A 2DQRA 2ZC2A 4DOZA 1FYKA 1ZR4A 3PO2J 3WTVC 1IN5A 1PUFA 1FYLA 4U7BA 1XCBA 3HM5A 3SEZA 4IF4A 3L9FA 3FF5A 4AYBN 3CUOA 2NOJB 2DFHA 3DTKA 4GXOA 1R71A 4N0BA 4PJ0C 1W7PA 3B73A 3JR9A 1IG7A 2HVSA 1UHMA 1SVMA 3FM5A 2XAGA 4MTDA 3O8GA 5FLXZ 2E34A 3L2UA 1BIBA 1HXDA 2LNBA 1Y56A 3JRHA 1BI1A 1W0TA 2EWNA 1X3WB 4M73A 3LSKA 4ABZA 2V1NA 1YYVA 4RM3A 1D0ZA 4XRMA 4BBSJ 2XIGA 4KFCA 1V5GA 4EVIA 3WU2C 2CYYA 2COMA 4G8XA 4IRHA 2ICWG 1JGSA 5KAFC 2HKOA 3OOUA 1OCPA 4S04A 3LWFA 2CFOA 5CQGA 4BE0A 2KMUA 4KJZA 2G7UA 4XSXF 1IXCA 5K7HA 4AU7A 3CJNA 2HWVA 3HGGA 3MWMA 1QZZA 4LFUA 1GUUA 4I0AA 1RUOA 1K78B 4EMSA 3CP2A 4IRIA 2MW8A 5IP9J 3ZMUA 2ZMEC 4LG0B 5BPDA 2LDUA 3HTUA 2H27A 1XDUA 3OSGA 2PFBA 3OYIA 2EFQA 3CDIA 5D5UB 3PSFA 3V8LA 1MMNA 1Z67A 5EZHA 3HBLA 2D45A 4M6YA 3BR3A 4PGHA 3OL3A 1X2MA 1XD7A 2M9HA 2Y9YA 1WGXA 3QYBA 1M1EB 4CZZA 3PJRA 3ERED 3IWZA 1G4DA 3MKWB 1TWAJ 3OY9A 3CC4I 2A3SA 5FKKA 4I0BA 3VYUB 2O0YA 2O5RA 1D8KA 2CSOA 2D5VA 2H1LA 3JRGA 3T1BA 1QPIA 3TOAA 3S93A 2MA3A 2A61A 3KP7A 3TW7A 1R1TA 1MSFC 1TP4A 3HDDA 3J7AO 4HV6A 2GAUA 3DKXA 3HHHA 4CO8A 5K1YA 2BVLA 1H9TA 3VB2A 4XLFA 2XAQA 3FDYA 1HW2A 1YRNA 2HKXA 3PNVA 4B1RA 2VJ5A 3HC7A 3QU6A 2GXBA 3BCAA 3QPHA 3PIPF 2QM3A 5AIQA 5HNFA 3HOSA 3H0DA 3EUAA 1QBJA 1VQNI 1G8XA 2AXLA 3S1NJ 3FXJA 3GFIA 1OYWA 1P4AA 4I09A 3J81K 1D8JA 2FNAA 4BY7J 4PDKA 5CVRA 2PMHA 4LGWA 3IAM2 1N78A 1P4XA 2EV6A 3LSTA 3R60A 3RDIA 3ZXSA 3GVAA 1O57A 1BR4A 2JQ7A 3OYLA 3FXUA 3CDLA 3CC2I 2LKXA 1B6AA 4G7HF 2EINH 1R9TJ 2UXNA 4WCGA 3ABTA 4HX4A 1LE8B 2MH9A 2KDOA 5A2QK 3WTZA 2EZKA 4AIDA 2KPMA 1L0OC 2XF5A 2HOTA 2VKEA 3FHNA 1HSTA 2GXGA 1KZHA 3N97A 2I5UA 1S29A 2EBIA 4RMNA 4QWQA 2XGCA 5JLXA 3SHFA 3H5NA 4MFDA 4XKWA 4IQJA 1HW5A 1LUJB 1DPUA 4ZH4F 2YX7A 3VDXA 2XKPA 3RI4A 4A3IJ 1K78A 2DA3A 3BR1A 3KX2A 5KAIC 3UKGA 3TO9A 4KISA 2M87A 3HSEA 4BH9A 3I4PA 4MLOA 2LMDA 1TC3C 1IF1A 4KA4A 5AONA 4JOMA 3E0JB 3MD2A 2QEXI 1D0YA 4IVNA 3MZYA 2CV1A 2W84A 3R0AA 1S8NA 2R5ZB 5EZGA 4H4KC 5LLQA 3DKYA 4E7HA 1R4MB 1ZK8A 4RM2A 3LFUA 2R7TA 1LFBA 3E6DA 3WG9A 1OPCA 2V9KA 2YS9A 4M71A 3TMOA 5EEHA 3Q0UA 1O3TA 4XLAA 1HW1A 1HC8A 1D1CA 2FNPA 3PQJA 4M6VA 4IO9F 1XS9A 3H3ZA 2XHKA 4UUTA 5LHHA 1U9NA 2EFNA 2VE9A 2IS4A 1QVUA 4CCJA 4I01A 3RPUD 2HEOA 1ODDA 1T33A 4YFXF 3GO5A 3ZQ7A 3BY6A 2K3FA 3HHGA 1XGMA 2HQ5A 4A12A 1TNTA 4WXHA 3MMYB 4RLQA 2VKDA 1RR8C 2RN7A 4AIKA 2EZIA 2R7SA 2V1UA 2LTPA 1MBGA 4NDLA 1YQAA 1OLTA 5E3LA 4RGXA 5GADJ 4N9HA 1DP7P 3LSMA 4RGSA 4BE2A 3K2AA 2QBYB 3LSGA 2D2WA 3A1YA 1Z3XA 4JK1X 2Y30A 5K5RA 2EB7A 3G73A 1R5HA 2IVMA 1LE8A 1FYMA 3CUQC 3OIPA 4E7JA 2OF7A 3ZQGA 4JX4A 1P7IA 1Y0UA 2FOWA 1VTNC 1O7FA 2QVOA 2R7QA 1BI3A 5M5WJ 1ENHA 3FK7A 1FP2A 3IC7A 4NUBA 1SFXA 3BG3A 3BJOA 2BXZA 1J7KA 3CJTB 2XASA 4E7KA 4KN4X 2DA6A 3NQOA 4XNFA 3S3OA 4F91B 3MKLA 1VQ4I 3KETA 2F5DA 1MNDA 2HQRA 4E4HA 2QZ8A 1FC3A 5TJJA 1JTYA 2NVUB 1YIOA 3OYGA 4A3JJ 5LGTA 3A02A 1WKMA 2M8GX 1WJDA 4Y7NJ 2ETHA 1QHHD 2KLOA 2A05A 3GZ6A 3JREA 3OYFA 2TDXA 3LNQA 2R5ZA 2DK8A 2HOEA 1TBXA 5LHGA 4Y33A 2PLYA 1MMSA 2NAZA 1Y8RB 2OZUA 3BR6A 3ECOA 2YR2A 5F0CA 1MW7A 4BHCA 2QSHX 3GTJJ 2ZXJA 1ZLKA 1SMYF 4XN0A 1RR7A 2D1HA 1FOXA 2R7OA 3PNYA 4L0YB 3S3MA 2VN2A 1X1BA 2V79A 2P5LC 3QYFA 1ZH5A 5DUKA 2H8RA 1VQKI 4FT8A 4RGRA 3FKJA 4I76A 4OIQF 5ICFA 4XLNF 2PMUA 5HOOA 2R92J 3I9V2 2P0WA 2VI6A 5GPCA 1Y8QB 1S5LC 3E5XA 1N75A 3VSKA 1T39A 5KK1A 2LYCA 2XPVA 5IT3A 4R79A 1WH7A 1LEAA 2UXXA 5BS6A 1RC9A 4P1WA 3F6VA 5GTHC 3BOQA 2Y0SN 3L7WA 1T8IA 3CDHA 4HZFA 3TO7A 4J01A 4PSXA 2JRMA 2VE8A 2I8DA 2CW7A 3BTIA 3HYIA 4F3QA 3JAMK 1NK2P 3H1CA 1QO0D 1SEUA 3I54A 2F4MB 2MC4A 1ZG1A 3ULQB 1POGA 4MQ9F 1A31A 2X48A 3CMAI 1TW3A 2E35A 2KRFA 5CYVA 2ECBA 3E97A 1R58A 1MNMC 5BNGA 2XROA 3K1NA 2DA2A 4GYGA 4YELA 1F9NA 2GXAA 1BN5A 4HBLA 3MZHA 1ZG5A 1RKTA 2Z2SB 4A6EA 3HRSA 3W2AA 2IGMA 1YHQI 5HS9A 2WBMA 1TLHB 1Z1DA 3DTEA 1MH3A 2R7VA 5F0HA 1QPMA 2F5CA 1JTXA 1IN4A 3SQNA 3W6JB 3HOZJ 2UZKA 5ICEA 5HDKA 2W7NA 1XC5A 1PVEA 3KP3A 5BMZA 3I0TA 1SVOA 4HW0A 3F8NA 1ZR2A 1Y1WJ 4BACA 2DJNA 2M2EA 5D5XB 1C0WA 2XC7A 2ZB9A 4KT6A 2A6HF 2G9WA 2LY9A 2UV1A 5LHIA 1T6SA 3ZQLA 1U9OA 1R5GA 3RTRA 2LY2A 2YU9J 4RGUA 2UWMA 2M34A 2NVXJ 1HDPA 4A3DJ 1V4RA 2ZJRF 4QIWN 1W7PB 4M9XA 1VNDA 2DXIA 2LG4A 2HTJA 3P9CA 4CCKA 4G12A 2CFXA 3H35A 4EJOA 3ASOH 1U8BA 5D5WB 2GIZA 4NC7A 1ZRDA 4FETA 1IUFA 3JTGA 1UFMA 2A6EF 2L01A 3SDBA 3SXYA 1BW6A 1J0RA 3IP4B 4S05A 2KQRA 1SFEA 4G9YA 4E7ZA 4BEHB 2Q8KA 3A01B 4NHJA 2QUFA 2DOEA 2WADA 5J4VA 1TQIA 5DYMA 4L0ZB 2VOOA 2EIJH 1RPWA 2AHQA 1X4PA 3S8PA 4ZYAA 2M7AA 1IRXA 2AXTC 4BQOA 3D0SA 1I3AA 1ON1A 1BM9A 4RAZA 3OYAA 2LC2A 4ZTFA 2FD5A 1B8IB 2HVQA 3RKYA 1BIAA 5HVQC 1CQTA 3J80Z 2VASA 1NK3P 4GDFA 3QOEA 1S7OA 5JHUA 3JRAA 2ESHA 4LB6B 3VSLA 3I56I 9ANTA 2EFOA 2R7FA 1X1DA 3AG3H 5M3MJ 1BJAA 3H5AA 1XCVA 5LBQA 4AWXB 1S6LA 2O8XA 1OCTC 2R0QC 2JJ7A 3FXRA 3SYTA 4ZYGA 2EA2A 2E7WA 2VUMJ 2M3AA 3WU0A 1XPXA 1MH4A 1AOYA 1BOAA 5C44J 2IA2A 4KITB 4MHGA 2ZJQF 4AYBA 2V1DA 4ZDPA 3V7SA 2CUFA 3HEFA 3HKZN 3DKWA 3ISPA 2Q0OA 4BE1A 4ETSA 5E3OA 3U9GA 1JJ6C 3AL0C 2DI3A 3RYPA 4RB3C 3R4KA 5ILVA 1R7JA 3KZIC 1NH3A 2F5FA 4B48A 1AWCA 3JRBA 5E3NA 1XDSA 2ZMEB 1XSDA 1V5EA 1MGTA 2PBIA 4XLEA 3T8RA 3J81Z 2WTEA 1JKQC 2MH2A 4A5NA 3OYMA 1XMKA 3E3VA 3M07A 4DIQA 1JUPA 2GBYA 1I39A 2O61A 3I58A 1F1ZA 4MIMA 5JI6A 2JA7J 3AL0B 2V1XA 2Y2ZA 2F4OB 2LF8A 3KPHA 4XN3A 4KDPA 5IYCJ 4ENNA 2AQEA 2X1DA 1K83J 2DFFA 3DTIA 1Z6RA 1IZ1A 4M3DA 3HRMA 1BBYA 3L00A 2XPUA 3EUKL 4UHTA 4UV8A 5DM6F 3OYJA 3HOXJ 1OISA 3PL8A 4BAYA 1MDMA 3WTYC 1PUFB 2ZXWH 5L3EA 5L3BA 1G59A 3A03A 1GV5A 1BJZA 3O2PE 1EH7A 3KZYA 2HZTA 3A01A 3GTPJ 2RVCA 2E7XA 1YTYA 3F6OA 5GP9A 3GTMJ 2PG4A 4AIHA 2NVYJ 4ESBA 5GTIC 4N4NB 1U78A 2VOPA 2R5YA 1ZRFA 2F48A 3HOWJ 3WE2A 2QENA 5A2QZ 5J47A 3S1QJ 3CCUI 3A2KA 3CCQI 1B9NA 2OUMA 4BKXA 4MGRA 2JA5J 2Y9ZA 4S0HB 3F22A 1BA5A 3S1MJ 3BDDA 2FU4A 3CJRB 4Y3OA 2WY8Q 1CF7A 2M5WA 2WB1A 1U3EM 2K9SA 3H3UA 2X1EA 3GFMA 4IHSA 1WJEA 4DYQA 3F8FA 3IWFA 3S2WA 5IOYA 3LAJA 2QA4I 3TP3A 1IXSB 3NEUA 3LSIA 1HF0A 2VBWA 2O8KA 1W5CC 4ZYHA 2ESNA 1W7PD 5D8LB 5C3EJ 2FEZA 1LVKA 1H88C 3K4KA 3OS0A 1O4XA 1XSVA 1FIPA 1X58A 4LB5A 2XV4S 4XORA 3A0BC 3IUOA 4YIIA 4XICA 2DLLA 3D1NI 5D6EA 2BHZA 1J59A 1DDNA 3BCBA 2DYRH 4DW6A 4B4CA 2BW3B 2HS5A 4C30A 1LDKB 4NQWB 2WAFA 3BTJA 3BQZA 5F64A 5HLIA 2B0LA 5DCFA 5B66C 1E3PA 2FJ1A 2FA5A 2HQAA 2ZXIA 2JZYA 1LDDA 1MZBA 5FB2A 1VQ5I 5J1UA 4BS9A 2E1NA 1QGPA 4OAZA 2Y75A 2LP0A 3I64A 4RAFA 5E1XA 5IYBJ 1VF9A 4HF2A 1SD4A 4O6JA 1VFCA 1ORKA 4HX7A 1ZTRA 2M30A 2M7BA 2W24A 3C3WA 5E3MA 4UUSB 3CCJI 1U2WA 2DDBA 3ABMH 3FBIB 3PNTA 3DLLF 2R7WA 2W4SA 3KLOA 4P55A 2HYFA 3BJ6A 2AS5F 4YRVA 2RNJA 1XGSA 1ETWA 5KHDA 4BYYA 3M3YJ 3FXOA 1MDMB 1IJWC 2XAFA 3QU3A 1ZRCA 3VFZA 4BHPA 3GTQJ 2WAEA 3BTLA 4KUMA 2DTZA 2LRDA 2X51A 4WX9A 1WZ2A 2QQAA 2OZ6A 1PP7U 5HS8A 4H0EA 4CXFA 3BC8A 1H89C 3F8CA 2ZO4A 4FASD 1AA7A 3UR3C 2RV8A 3MAJA 4E6KG 4ZDLA 4JP0A 3CC7I 2PJRA 2R93J 2JWTA 3I4MJ 3CCVI 1E17A 1TNSA 4A5MA 3CO6C 1XGOA 4BU2A 3NWTA 3GTGJ 4F55A 3FXMA 3OV8A 5D5VB 1GT0C 1K4SA 5IOZA 1FMWA 3V42A 4CDGA 1KU9A 4E7LA 5H2FC 4CCOA 2KISA 2TCTA 1U6GA 5M5YJ 4GO1A 1ETYA 1XMAA 3K4BA 2VBZA 5CQEA 2UUZA 2CW8A 4A3LJ 4UVAA 4HSTA 1B72A 4IHYA 1VQ6I 2QLZA 1ITYA 3K4CA 3M8FA 3HSRA 3FXQA 1OCZH 3TGNA 4A69C 1I50J 3OL4A 4U7DA 5DDGA 3M1CA 4CUGA 5E20A 2STTA 3GBGA 2VKHA 2QKMB 4ZC3A 4BBRJ 4IZZA 2R3SA 4KIFA 3OOPA 1H9GA 2P6TA 2X6XA 3K4LA 1ZGJA 2Z9OA 3K0LA 1WJFA 2DN0A 4D1QA 2OD5A 5J40A 4Y17A 1QRYA 2V9PA 4G7ZF 4V19K 3O3KA 2IS2A 2XVCA 2I10A 2CJJA 2RQPA 4LIUA 4BGDA 1O3RA 2RKHA 5TGTA 2IGKA 3LSPA 1GVDA 2BVMA 2O03A 3RKWA 2DT6A 1S3JA 4A93J 2VJJA 3DEEA 1R1UA 3VYSB 3I5UA 3L1PA 4EJWA 2DPUA 4UUVA 3SFIA 4JQFA 4NBQA 3FX3A 4OWRB 1PP8F 4WWCA 1IUYA 3HOTA 2CRGA 2HGCA 2PMZA 4LK1F 2B9SA 1E0EA 2K9LA 2V9VA 4BY1J 4EEFG 5FD5A 2W1OA 2NS8A 1J5YA 1D5VA 3FZVA 1J9IA 1Z77A 3RQ4A 3CMEI 1UAAA 5HDNA 1MBHA 1YJ9I 1LNWA 3OS1A 1XGNA 4A2UA 1G3WA 3CUQA 1KQ0A 4U88A 4IX7A 3I3LA 2HVRA 3OYCA 2BHYA 4I6ZA 1DUXC 3VPRA 3QQAA 3P9IA 1TTYA 4L9VA 4RS8A 2QBYA 2W85A 5LRRA 3I53A 5ICCA 2H6CA 1P7JA 5JLWA 3RKXA 3Q0WA 2VKVA 2VQCA 3CCMI 1W36C 2RAEA 3DBHB 3R0JA 3F23A 3CCLI 4OINF 2XB5A 2VQGA 4HA8A 2QYOA 1OJLA 1SAUA 3V8KA 2VPLA 4LG3A 4CYDA 1J75A 2BE5F 2J5PA 1U5TC 2KIQA 4MFEA 4F92B 3S1RJ 1O3QA 3RCOA 2M4KA 2V7FA 1AHDP 5GPAA 1T38A 3KEYA 2LH9A 1P4WA 1G3TA 1KQ8A 1YS7A 3DLAA 2FQ4A 2COBA 1NG6A 3OYNA 1ONVA 5HLHA 5FKMA 4XSZF 2P6SA 4L9JA 3TKYA 4ZYDA 3MCZA 2KDZA 3BTCA 2E2JJ 4ENKA 1S9HA 2JTVA 2Y48A 4IPAA 1W0UA 4A6DA 4IHWA 1BC8C 4L18B 2VQLA 5DEQA 3COAC 1TQPA 2LREA 3CCSI 3SJMA 2W00A 2DO7A 1SAXA 3IH3A 1F43A 5FLVA 1NTCA 4I2OA 5BPIA 2M4GA 2PN6A 3K2ZA 5L3FA 3WGHA 5JHFA 4AVZA 3ZMDA 2HDCA 3CLQA 3KP2A 3TQNA 1WSUA 1DGWY 4KMFA 4Q4ZF 5HDGA 2BY0A 2CU7A 2XSDC 3ELKA 4HLYA 4XOTA 3HOUJ 2R7XA 1TT5B 3DPUA 4LOCA 2EV0A 4D5FA 1F5TA 2A5WA 2KZVA 2M45A 2X9DA 1GDTA 1WJAA 2EJRA 3KCCA 2HI3A 2ACJA 3RZDJ 2VPRA 2YU3A 3BT9A 3MVPA 2NYXA 2M8EA 3CESA 1X2NA 3PIOF 2CMPA 3CF5F 5DD8A 3LQRA 4JX5A 4B8XA 4ZDOA 3CUQB 4RBOA 2G0EA 1B9MA 5C4JJ 3WHBA 1Z6TA 2ISYA 5IY5H 5E18F 3OIQA 2OCEA 3HUGB 2VC1A 3DP7A 1FP1D 2ELKA 2XAJA 3RKQA 3ZN0A 3ZRGA 4DYRA 4Y52J 2GQQA 1SD6A 4J19A 3D5LA 2AO9A 4KN7X 2O6GE 5IP6A 1NG7A 2IA1A 4BUPA 1UHSA 4DQ2A 2CV2A 4EJVA 2ZNZA 4YFKF 2OPTA 1UB9A 3LOCA 4FTHA 2ME6A 1ETKA 3H9GA 1R6RA 4KT5C 2LVSA 3NARA 3LMMA 3A0HC 3P9KA 5LFAA 2X6OA 3TL4X 3TDZC 1YW7A 2HPMA 4IXAA 4PJJA 4FX4A 3C2HA 2GWRA 2NNNA 1MMDA 2ZJ2A 2FSWA 3ZP5A 3OR2C 2F6CA 3MKYB 2X6YA 1QA6A 1OCOH 3RYRA 3WTWC 2V6CA 1PJRA 4ESFA 4D7NA 5B3SH 1JT6A 1RUNA 3IAS2 3CLOA 2LLKA 1YW9A 1WI9A 2H09A 3AG1H 5DCMA 5HS7A 3ZMZA 1IRZA 1K79A 1YX3A 4BXFA 4RA2A 2L7FP 3J7YJ 3BZKA 2EZHA 1R00A 4BDYA 1WI3A 2QF7A 3LSRA 2CS3A 2H8WA 2CQ7A 4P9UA 3N05A 1MJBA 1MKMA 3H9JA 3AKZA 3ABLH 5D4SA 1WCMJ 4U87A 3DV8A 4PGGA 4EATA 4UV9A 3HPGA 2PMZN 3IHUA 1VQMI 1B4AA 1FX7A 4GGGA 4KIGA 5C4XJ 4HLXA 1K6OA 3N4MA 4ZJZA 3PUBA 4F7ZA 5EGOA 4A3GJ 3IRRA 2EIKH 1IRFA 5EG0B 2G7HA 2O3FA 4IEJA 4K2EA 2BEOA 1XX5A 3OYDA 2YPRA 2R7ZJ 1X19A 1Y1VJ 2XRLA 1A04A 4CA0A 1DU6A 2CUEA 3HSFA 4XQFA 3K4MA 1MJ9A 3VYTB 3C2BA 4GCVA 2Z16A 2EV5A 4OIPF 3X2QH 4IHTA 3I59A 5K7FA 2TRTA 1I5ZA 1W5SA 3GF2A 3CTAA 3EQLF 3OMYA 1ZGAA 2KKOA 3O8HA 3DU5A 4D5CA 4ANJA 1R36A 5L3GA 4C2UA 2OQRA 2A6TA 2JMWA 2P5KA 3L2QA 3CF2A 3F21A 2ZFWA 2XB0X 4BJTA 3WTTC 3WTXC 1YITI 2QSGX 2L9VA 2CQKA 5LGUA 3C1DA 2GA1A 4X6AJ 5F04A 4E7IA 1X3ZB 3C2GA 1STZA 1MJAA 1FOWA 2A5YB 4NB5A 3PO3J 2NS0A 3KYLA 1U8RA 2XGEA 1WJCA 2XF7A 3L09A 1D3YA 1IN6A 3CCEI 1Y6IA 1Q1HA 2HDWA 1HQCA 2LOOA 2A68F 4M9ZA 3WODF 4HG2A 1NHAA 2HOAA 1SVLA 2C6YA 3Q0VA 3ZCOA 2V6EA 4IL6C 3GEZA 1DU0A 2GLOA 2N8GA 5ERIA 1RZ4A 5DCMB 4OOIA 5J1YA 3T8TA 1Z05A 3U1DA 5D6FA 2JT1A 5FO5A 1JT0A 4XMYA 3P5JA 4JX6A 1W5TA 4ITVA 4A0XA 1HKTA 4U0YA 2EILH 3SZGA 3QODA 2L5QA 2VIXA 3DXJF 2JVGA 3S14J 1P92A 4P9FA 1HSJA 5E79C 2NVTJ 3ML6A 1FSEA 4XOPA 3MZ8A 2DMNA 3WE3A 3ASNH 3JW4A 2ID6A 5ED4A 1YLFA 2VL8A 3RSNA 2O9LA 4IOCF 3S2HJ 2HPIA 1O7LA 4M3FA 2V26A 4L9NA 1MBFA 2XPWA 5TISC 2D1VA 2GOMA 5AIPA 1DQUA 2J5OA 5F1JA 5EEAA 2BOLA 3CP8A 4BQNA 1TWCJ 4MEYF 4G6QA 5E8IA 1MNEA 1LJ9A 3AG2H 1TZLA 2L9NA 5FKLA 3D5SC 2LF7A 3FHZA 3BZCA 3RQIA 3OYKA 1Y39A 1VQ7I 2FMLA 2BY2A 2ZNYA 4KIBA 4ESJA 4BNCA 4XBFA 2CV0A 1KU3A 1B72B 1ZLJA 4PK4A 4IRGA 4V2FA 1LKXA 3C18A 4LK0F 3TP0A 1CGPA 1UELB 3FMQA 3GX4X 3ZN1A 2WWYA 3K69A 1TWGJ 5CLSA 3IKTA 1FEXA 1CF7B 4DZPA 4YEJA 1TT0A 1R23A 1KU2A 1EF4A 3V4GA 1HKQA 5L3DA 4HV5A 1OFCX 2L4AA 3BG7A 2XAUA 4LITA 4ZZLA 2HYJA 5E1ZB 1OR7C 2DBBA 2IA0A 2NNYA 2ZKZA 3CCRI 4ZTJA 3W6VA 2IJLA 2Z5UA 4KICA 3W2WA 4B3AA 2IP2A 1RKWA 4RB0A 1DGRM 2KIUA 2K9NA 3OYHA 4C3IJ 1FWZA 3MKZA 1T0FC 4I02A 1ACIA 2E2IJ 3TW6A 4HSRA 1ZG3A 3H3VK 4CICA 2WAQA 4HNVA 5FRNA 5K7ZA 5F0FA 4NQWA 1IO2A 4BJ5C 2Y0SA 3IKVA 5GAEJ 4ON0A 4OIRF 4AVPA 2JRTA 1YRNB 2CUJA 2IGOA 2P81A 1F4KA 1AU7A 1BW5A 3LL7A 5BQTA 5HODA 1V55H 3WHCA 3L2CA 2L4MA 3IH2A 1TQMA 3OS2A 2GZWA 1QVTA 4G6DA 2DODA 2HR3A 1ETXA 3ABKH 3WGIA 3KFWX 1T2KA 3SZTA 3HB9A 3OYBA 2CG4A 2X1CA 3CJQB 4LMYA 2VLAA 4XM3A 1L3LA 2EQRA 4U0WA 3UNGC 1S72I 1ZGWA 4MQVA 4ZYEA 4N9IA 3RZOJ 2FBHA 3GMEA 5FGMA 4BHBA 4XRFA 1MD0A 3F3XA 1JXSA 4IKFA 5B5EC 2HOSA 5B1BH 1XSXA 3G71I 1I6HJ 3HIFA 1G2HA 4L5JA 2MLGA 3L2VA 1J2XA 2FOKA 3RPUA 1BOBA 3B6AA 4YIFA 1FTTA 1HA8A 2ADUA 2OU2A 1A6QA 5J8CA 4QPOA 2ECCA 2H94A 2P5VA 3BPVA 1WFXA 1RIOH 2DTRA 1ETQA 4NC6A 1MMGA 3S3NA 1JE8A 2ZJPF 4XLCA 4A3KJ 4HPQA 4D7MA 1RI7A 3IRQA 4PCQA 2NS7A 4CYCA 2WB1N 4RAYA 1FSHA 2CQNA 3RJPA 1OCRH 3FISA 2CW0F 1QQIA 1JUMA 2KFDA 1ZREA 2HNHA 2QCOA 2QGUA 3KE2A 3H92A 3GLLA 4CCNA 4YFNF 4OMYA 1JKPC 2IS1A 4I99C 2VODA 3BG9A 1EH8A 3JRFA 1GLNA 4BXXJ 4P96A 3P7NA 3HPHA 2MFZA 3BG5A 1BC7C 3BZ6A 1E3HA 4XL9A 2E1MC 2DCEA 2VXDA 3Q3SA 3GWZA 4M3GA 4A3CJ 1IN8A 1LFPA 2MYSA 5K5OA 4JYKA 3HZJA 4CCMA 3FWEA 4D0PA 3GTLJ 5CVIA 5L3CA 1OKRA 4XKVA 2KP6A 3T0YA 5LGNA 5LEKA 2JPCA 4BEHA 5F08A 5CPRB 1UG2A 2IXSA 2P7VB 4Z6YA 3JRCA 1V5FA 2LK2A 2DPDA 2MABA 1FBQA 3JTHA 4XONA 5CKTA 1OCCH 3ZQIA 3KIOA 2K4JA 4LLGF 3HTSB 1O3SA 1ZAOA 1D5YA 1LFUP 4M6XA 4KNYA 5F27A 2GA2A 1WJBA 3NAUA 4HQEA 4ZZDA 2JA8J 5FFZA 2CWEA 3Q5FA 2L02A 4HNUA 1GHCA 1FBSA 2WAQN 1D1AA 3FIWA 4EM0B 1I3QJ 3REOA 1YIJI 4PFPA 1T08B 3M7GA 2MG4A 4HQMA 2L7KA 4QPQA 4FHTA 1BI2A 4CCLA 1IW7F 2YSRA 4D9JA 4V2GA 5IYDJ 2M0CA 1BI0A 1GXQA 1QNTA 1A35A 1I6XA 1I27A 3HKZA 4PJNA 3TDUC 5CVVA 1R4NB 4A3EJ 4I98B 1QHGA 2K4BA 4HF0A 4UVBA 1X4OA 4C9YA 3M8JA 4TV7A 4II2A 3BQYA 3DWLE 3NRVA 1ETVA 2LSOA 2JSPA 4FE7A 4HF1A 1REPC 2CO5A 1TWFJ 4XRSA 3J80K 4M74A 2Z3YA 3KP4A 1FIAA 1PYVA 4EGYA 3HG9A 4EM2A 4F52A 2E19A 3F9KA 4GRIA 3HL2A 2VQHA 2K9QA 1YOVB 4DBRA 1I1SA 3GLXA 3AFHA 4UB6C 1YX5A 3CD6I 3G2BA 5FJ8J 4KYWA 1J09A 1P6RA 3FMSA 3K10A 4C3HJ 5KCMA 2L2OA 3W2VA 4B47A 1AKHA 5HLTA 4O3MA 4OIOF 1UG0A 1HLVA 1Z21A 2E71A 1IAWA 2DFIA 2CGPA 3LAPA 1WVRA 2DAOA 5F1RA 5FFXA 3HXLA 2OAZA
chains in the Genus database with same CATH topology
1X2NA 1VNDA 4W97A 1HCRA 4JX5A 2IAIA 4G12A 4RBOA 2G0EA 1ZKGA 5C4JJ 3WHBA 2NVQJ 4A3BJ 1U8BA 4L5EA 1JJ8C 3DEWA 1IUFA 2ELKA 4GFBA 3BR0A 3RKQA 1BW6A 3BR2A 3GTOJ 2IEKA 4DYRA 4Y52J 4J19A 4FCYA 2AO9A 3A01B 5IP6A 5EG0A 1UHSA 1HOMA 3JRIA 4DZJA 1TWHJ 2FX0A 2OPTA 1IDZA 4FTHA 3LOCA 2K40A 2ME6A 1ETKA 1JGGA 1RPWA 2AHQA 4QTRA 4A3MJ 4QSHA 2LVSA 2R5YB 3NARA 1FJLA 2X6OA 3OSFA 1WH5A 1IDYA 2FD5A 4C2MJ 1B8IB 2LR8A 5DTDA 3IV5A 1IV6A 4W1UA 1CQTA 4D7NA 3H0GJ 1JT6A 4XK4A 3G1OA 1NK3P 2LLKA 1IRZA 3JRAA 1ZR4A 3PO2J 9ANTA 1PUFA 2L7FP 3DCFA 2DMUA 1XG1A 3HM5A 5M3MJ 2EZHA 4AYBN 1OCTC 2R0QC 1WI3A 2JJ7A 1IG7A 3JR9A 2QF7A 3LSRA 2VUMJ 3CMYA 1MH4A 3BR5A 5C44J 3O8GA 1WCMJ 3JRHA 2CUFA 1W0TA 3HEFA 3HKZN 1ZQ3P 1JKRC 2L7ZA 2PMZN 4ABZA 4XRMA 5E3OA 2L0KA 4BBSJ 1JJ6C 5C4XJ 4AC0A 5EGOA 3JRBA 4A3GJ 3OOUA 1MBKA 5E3NA 5EG0B 1OCPA 4IEJA 3E7LA 1JKQC 5K7HA 1JUPA 3HGGA 2R7ZJ 1AKHB 2GBYA 1Y1VJ 2XRLA 4MIMA 1GUUA 1MBEA 2JA7J 1DU6A 2Y2ZA 2CUEA 2MW8A 3C2BA 5IP9J 2E2HJ 5IYCJ 1K83J 5K7FA 4M3DA 2TRTA 1GV2A 2XPUA 3OSGA 5FLMJ 3S15J 1H8AC 3HOXJ 5EZHA 3O8HA 4D5CA 3HBLA 1PUFB 2JMWA 3BR3A 4MO7A 1X2MA 3A03A 2M9HA 2L9RA 2XB0X 1WGXA 2Y9YA 1GV5A 1BJZA 3GTPJ 3A01A 1A6IA 4X6AJ 3GTMJ 5GP9A 4IHVA 3G1LA 3SDGA 1JKOC 5F04A 1TWAJ 3I4NJ 5FKKA 2NVYJ 1U78A 3PO3J 1SANA 2R5YA 3HOWJ 2D5VA 2XGEA 3JRGA 1QPIA 3S1QJ 3TW7A 1MSFC 4BKXA 1SFOJ 2JA5J 3HDDA 2Y9ZA 2HOAA 4S0HB 4RDUA 1BA5A 3Q0VA 3S1MJ 3JRDA 1DU0A 1YRNA 2DMTA 2GLOA 2N8GA 4B1RA 3F0CA 5J1YA 4A3FJ 2YUSA 2DA7A 2K9SA 1JT0A 4JX6A 4DYQA 5IOYA 3S1NJ 3TP3A 1HF0A 2O8KA 4BY7J 5C3EJ 1H88C 1MSEC 3S14J 2NVTJ 3G1MA 1Q1VA 1O4XA 1FIPA 2DMNA 1X58A 2ID6A 2ME0A 3CDLA 4XICA 2JK3A 2O9LA 3D1NI 4M3FA 2LKXA 3S2HJ 5M5XJ 1R9TJ 1MBFA 2XPWA 4DW6A 4B4CA 2IBDA 1LE8B 5F1JA 3BTJA 5EEAA 3S17J 2EZKA 3BQZA 1TWCJ 2VKEA 2HOTA 3TEDA 2EBIA 1VI0A 1A5JA 5FKLA 2FJ1A 3QPLA 2XGCA 5JLXA 4MFDA 3RQIA 3HOVJ 5J1UA 2JA6J 1ETOA 3S16J 1B72B 2LP0A 5IYBJ 5EDNA 2HDDA 1VF9A 4A3IJ 2DA3A 3BR1A 4V2FA 3UKGA 1VFCA 3TP0A 1ORKA 4UUSB 1ZTRA 5E3MA 4MLOA 1TC3C 1TWGJ 1FEXA 4DZPA 2L7MP 1ETWA 2R5ZB 5EZGA 3M3YJ 1EF4A 1S7EA 2ID3A 1IJWC 1OFCX 2WV1A 1ZK8A 3GTQJ 3BTLA 2DTZA 1LFBA 1APLC 2HYJA 5J1RA 3W6VA 2YS9A 4B3AA 1H89C 1RKWA 1JUSA 2K9NA 4C3IJ 2E1OA 3Q0UA 4JP0A 3K7AJ 2R93J 2JWTA 2E2IJ 2CQQA 3TW6A 1IC8A 4M6VA 3I4MJ 1XS9A 3H3VK 4CYCB 4UUTA 4FISA 1U9NA 4HNVA 3GTGJ 5K7ZA 2MGQA 2O7OA 5F0FA 1GT0C 1QVUA 5IOZA 1T33A 1YRNB 2XGDA 2GM4A 2TCTA 5M5YJ 2P81A 1AU7A 1BW5A 2HQ5A 2DA4A 5HODA 3WHCA 2JN6A 1IGNA 3IH2A 1ETYA 1QVTA 2EZIA 5J3LA 4A3LJ 1B72A 4IHYA 1ETXA 1ITYA 3FKIJ 3FK6A 2LTPA 2MSYA 1WPKA 1MBGA 5IP7J 4NDLA 3HB9A 5E3LA 1I50J 4A69C 2EQRA 1ZGWA 3K2AA 3RZOJ 3GBGA 2DA1A 4BBRJ 3LSGA 2Y30A 3LSJA 2DN0A 2HOSA 1LE8A 1I6HJ 4AUXA 1QRYA 1MBJA 1G2HA 2OF7A 3ZQGA 4JX4A 1P7IA 3PM1A 2EZLA 2I10A 3B6AA 5M5WJ 1FTTA 1ENHA 3FK7A 2CJJA 2ECCA 3BG3A 4IHXA 2DMQA 3LSPA 2DA6A 3ZQHA 1GVDA 1ETQA 3MKLA 3GTKJ 4A3KJ 4D7MA 4A93J 1UMQA 2NS7A 4CYCA 2WB1N 3L1PA 3SFIA 1JTYA 3FISA 4UUSA 1JUMA 2QCOA 4XIDA 4A3JJ 3A02A 2CRGA 2M8GX 4Y7NJ 1RETA 3JREA 4EEFG 4BY1J 2NS8A 4XRSG 3LNQA 1JKPC 2R5ZA 3BG9A 3JRFA 1Z77A 3ZQFA 4BXXJ 5M3FJ 2NOGA 3BR6A 5F0CA 2DA5A 1MBHA 3BG5A 3GTJJ 1Z0XA 1RR7A 1F36A 4I6ZA 3VPRA 3QQAA 3S2DJ 3M4OJ 3Q3SA 2H1KA 4M3GA 4A3CJ 1P7JA 2H8RA 4JYKA 3B6CA 5JLWA 3GTLJ 3Q0WA 2VKVA 2RAEA 4I76A 2KT0A 1K61A 2XB5A 3QPSA 2R92J 5F08A 2VI6A 1UG2A 5GPCA 3JRCA 1OJLA 2LK2A 2B63J 3HOYJ 2XPVA 1WH7A 3ZQIA 1FTZA 4MFEA 2CQXA 1T56A 3S1RJ 2Y0SN 1D5YA 1LFUP 1AHDP 5F27A 5GPAA 3NAUA 2JA8J 3BTIA 5EYRA 2WAQN 3FIWA 4DYCA 3IH4A 2LD5A 1NK2P 1I3QJ 2FQ4A 5FKOA 2COBA 5FKMA 1POGA 2MG4A 2X48A 4M3BA 2KDZA 3BTCA 2E2JJ 4V2GA 2ECBA 2Y31A 1W0UA 5IYDJ 2M0CA 4IHWA 1MNMC 3ZOBA 4C3JJ 2LFBA 5BNGA 5IPAA 5EF6A 2DA2A 3MN2A 3ZQCA 4A3EJ 3SJMA 3IH3A 3BQYA 1F43A 5FLVA 1NTCA 1RKTA 1ETVA 4M3EA 4FE7A 5FKNA 1TWFJ 4XRSA 2HXOA 1MH3A 1FIAA 5F0HA 2DMPA 1JTXA 4FE4A 3HOZJ 2HXIA 2E19A 1B8IA 1XC5A 2CU7A 2K9QA 3CCYA 2XSDC 5EGOB 1E3OC 3HOUJ 4X1EA 5FJ8J 4LOCA 1ZR2A 1Y1WJ 4D5FA 1HDDC 1RESA 2DJNA 2M2EA 2X9DA 1GDTA 3CQZJ 3OIOA 2ZB9A 2W48A 1BL0A 2LY9A 4C3HJ 2HI3A 5DS9A 3RZDJ 2VPRA 3ZQLA 1AKHA 1U9OA 2YU9J 3BT9A 2EH3A 2M34A 1HLVA 3HGYA 3MVPA 2NVXJ 1HDPA 4A3DJ 4QIWN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2N A;  1VND A;  4W97 A;  1HCR A;  4JX5 A;  2IAI A;  4G12 A;  4RBO A;  2G0E A;  1ZKG A;  5C4J J;  3WHB A;  2NVQ J;  4A3B J;  1U8B A;  4L5E A;  1JJ8 C;  3DEW A;  1IUF A;  2ELK A;  4GFB A;  3BR0 A;  3RKQ A;  1BW6 A;  3BR2 A;  3GTO J;  2IEK A;  4DYR A;  4Y52 J;  4J19 A;  4FCY A;  2AO9 A;  3A01 B;  5IP6 A;  5EG0 A;  1UHS A;  1HOM A;  3JRI A;  4DZJ A;  1TWH J;  2FX0 A;  2OPT A;  1IDZ A;  4FTH A;  3LOC A;  2K40 A;  2ME6 A;  1ETK A;  1JGG A;  1RPW A;  2AHQ A;  4QTR A;  4A3M J;  4QSH A;  2LVS A;  2R5Y B;  3NAR A;  1FJL A;  2X6O A;  3OSF A;  1WH5 A;  1IDY A;  2FD5 A;  4C2M J;  1B8I B;  2LR8 A;  5DTD A;  3IV5 A;  1IV6 A;  4W1U A;  1CQT A;  4D7N A;  3H0G J;  1JT6 A;  4XK4 A;  3G1O A;  1NK3 P;  2LLK A;  1IRZ A;  3JRA A;  1ZR4 A;  3PO2 J;  9ANT A;  1PUF A;  2L7F P;  3DCF A;  2DMU A;  1XG1 A;  3HM5 A;  5M3M J;  2EZH A;  4AYB N;  1OCT C;  2R0Q C;  1WI3 A;  2JJ7 A;  1IG7 A;  3JR9 A;  2QF7 A;  3LSR A;  2VUM J;  3CMY A;  1MH4 A;  3BR5 A;  5C44 J;  3O8G A;  1WCM J;  3JRH A;  2CUF A;  1W0T A;  3HEF A;  3HKZ N;  1ZQ3 P;  1JKR C;  2L7Z A;  2PMZ N;  4ABZ A;  4XRM A;  5E3O A;  2L0K A;  4BBS J;  1JJ6 C;  5C4X J;  4AC0 A;  5EGO A;  3JRB A;  4A3G J;  3OOU A;  1MBK A;  5E3N A;  5EG0 B;  1OCP A;  4IEJ A;  3E7L A;  1JKQ C;  5K7H A;  1JUP A;  3HGG A;  2R7Z J;  1AKH B;  2GBY A;  1Y1V J;  2XRL A;  4MIM A;  1GUU A;  1MBE A;  2JA7 J;  1DU6 A;  2Y2Z A;  2CUE A;  2MW8 A;  3C2B A;  5IP9 J;  2E2H J;  5IYC J;  1K83 J;  5K7F A;  4M3D A;  2TRT A;  1GV2 A;  2XPU A;  3OSG A;  5FLM J;  3S15 J;  1H8A C;  3HOX J;  5EZH A;  3O8H A;  4D5C A;  3HBL A;  1PUF B;  2JMW A;  3BR3 A;  4MO7 A;  1X2M A;  3A03 A;  2M9H A;  2L9R A;  2XB0 X;  1WGX A;  2Y9Y A;  1GV5 A;  1BJZ A;  3GTP J;  3A01 A;  1A6I A;  4X6A J;  3GTM J;  5GP9 A;  4IHV A;  3G1L A;  3SDG A;  1JKO C;  5F04 A;  1TWA J;  3I4N J;  5FKK A;  2NVY J;  1U78 A;  3PO3 J;  1SAN A;  2R5Y A;  3HOW J;  2D5V A;  2XGE A;  3JRG A;  1QPI A;  3S1Q J;  3TW7 A;  1MSF C;  4BKX A;  1SFO J;  2JA5 J;  3HDD A;  2Y9Z A;  2HOA A;  4S0H B;  4RDU A;  1BA5 A;  3Q0V A;  3S1M J;  3JRD A;  1DU0 A;  1YRN A;  2DMT A;  2GLO A;  2N8G A;  4B1R A;  3F0C A;  5J1Y A;  4A3F J;  2YUS A;  2DA7 A;  2K9S A;  1JT0 A;  4JX6 A;  4DYQ A;  5IOY A;  3S1N J;  3TP3 A;  1HF0 A;  2O8K A;  4BY7 J;  5C3E J;  1H88 C;  1MSE C;  3S14 J;  2NVT J;  3G1M A;  1Q1V A;  1O4X A;  1FIP A;  2DMN A;  1X58 A;  2ID6 A;  2ME0 A;  3CDL A;  4XIC A;  2JK3 A;  2O9L A;  3D1N I;  4M3F A;  2LKX A;  3S2H J;  5M5X J;  1R9T J;  1MBF A;  2XPW A;  4DW6 A;  4B4C A;  2IBD A;  1LE8 B;  5F1J A;  3BTJ A;  5EEA A;  3S17 J;  2EZK A;  3BQZ A;  1TWC J;  2VKE A;  2HOT A;  3TED A;  2EBI A;  1VI0 A;  1A5J A;  5FKL A;  2FJ1 A;  3QPL A;  2XGC A;  5JLX A;  4MFD A;  3RQI A;  3HOV J;  5J1U A;  2JA6 J;  1ETO A;  3S16 J;  1B72 B;  2LP0 A;  5IYB J;  5EDN A;  2HDD A;  1VF9 A;  4A3I J;  2DA3 A;  3BR1 A;  4V2F A;  3UKG A;  1VFC A;  3TP0 A;  1ORK A;  4UUS B;  1ZTR A;  5E3M A;  4MLO A;  1TC3 C;  1TWG J;  1FEX A;  4DZP A;  2L7M P;  1ETW A;  2R5Z B;  5EZG A;  3M3Y J;  1EF4 A;  1S7E A;  2ID3 A;  1IJW C;  1OFC X;  2WV1 A;  1ZK8 A;  3GTQ J;  3BTL A;  2DTZ A;  1LFB A;  1APL C;  2HYJ A;  5J1R A;  3W6V A;  2YS9 A;  4B3A A;  1H89 C;  1RKW A;  1JUS A;  2K9N A;  4C3I J;  2E1O A;  3Q0U A;  4JP0 A;  3K7A J;  2R93 J;  2JWT A;  2E2I J;  2CQQ A;  3TW6 A;  1IC8 A;  4M6V A;  3I4M J;  1XS9 A;  3H3V K;  4CYC B;  4UUT A;  4FIS A;  1U9N A;  4HNV A;  3GTG J;  5K7Z A;  2MGQ A;  2O7O A;  5F0F A;  1GT0 C;  1QVU A;  5IOZ A;  1T33 A;  1YRN B;  2XGD A;  2GM4 A;  2TCT A;  5M5Y J;  2P81 A;  1AU7 A;  1BW5 A;  2HQ5 A;  2DA4 A;  5HOD A;  3WHC A;  2JN6 A;  1IGN A;  3IH2 A;  1ETY A;  1QVT A;  2EZI A;  5J3L A;  4A3L J;  1B72 A;  4IHY A;  1ETX A;  1ITY A;  3FKI J;  3FK6 A;  2LTP A;  2MSY A;  1WPK A;  1MBG A;  5IP7 J;  4NDL A;  3HB9 A;  5E3L A;  1I50 J;  4A69 C;  2EQR A;  1ZGW A;  3K2A A;  3RZO J;  3GBG A;  2DA1 A;  4BBR J;  3LSG A;  2Y30 A;  3LSJ A;  2DN0 A;  2HOS A;  1LE8 A;  1I6H J;  4AUX A;  1QRY A;  1MBJ A;  1G2H A;  2OF7 A;  3ZQG A;  4JX4 A;  1P7I A;  3PM1 A;  2EZL A;  2I10 A;  3B6A A;  5M5W J;  1FTT A;  1ENH A;  3FK7 A;  2CJJ A;  2ECC A;  3BG3 A;  4IHX A;  2DMQ A;  3LSP A;  2DA6 A;  3ZQH A;  1GVD A;  1ETQ A;  3MKL A;  3GTK J;  4A3K J;  4D7M A;  4A93 J;  1UMQ A;  2NS7 A;  4CYC A;  2WB1 N;  3L1P A;  3SFI A;  1JTY A;  3FIS A;  4UUS A;  1JUM A;  2QCO A;  4XID A;  4A3J J;  3A02 A;  2CRG A;  2M8G X;  4Y7N J;  1RET A;  3JRE A;  4EEF G;  4BY1 J;  2NS8 A;  4XRS G;  3LNQ A;  1JKP C;  2R5Z A;  3BG9 A;  3JRF A;  1Z77 A;  3ZQF A;  4BXX J;  5M3F J;  2NOG A;  3BR6 A;  5F0C A;  2DA5 A;  1MBH A;  3BG5 A;  3GTJ J;  1Z0X A;  1RR7 A;  1F36 A;  4I6Z A;  3VPR A;  3QQA A;  3S2D J;  3M4O J;  3Q3S A;  2H1K A;  4M3G A;  4A3C J;  1P7J A;  2H8R A;  4JYK A;  3B6C A;  5JLW A;  3GTL J;  3Q0W A;  2VKV A;  2RAE A;  4I76 A;  2KT0 A;  1K61 A;  2XB5 A;  3QPS A;  2R92 J;  5F08 A;  2VI6 A;  1UG2 A;  5GPC A;  3JRC A;  1OJL A;  2LK2 A;  2B63 J;  3HOY J;  2XPV A;  1WH7 A;  3ZQI A;  1FTZ A;  4MFE A;  2CQX A;  1T56 A;  3S1R J;  2Y0S N;  1D5Y A;  1LFU P;  1AHD P;  5F27 A;  5GPA A;  3NAU A;  2JA8 J;  3BTI A;  5EYR A;  2WAQ N;  3FIW A;  4DYC A;  3IH4 A;  2LD5 A;  1NK2 P;  1I3Q J;  2FQ4 A;  5FKO A;  2COB A;  5FKM A;  1POG A;  2MG4 A;  2X48 A;  4M3B A;  2KDZ A;  3BTC A;  2E2J J;  4V2G A;  2ECB A;  2Y31 A;  1W0U A;  5IYD J;  2M0C A;  4IHW A;  1MNM C;  3ZOB A;  4C3J J;  2LFB A;  5BNG A;  5IPA A;  5EF6 A;  2DA2 A;  3MN2 A;  3ZQC A;  4A3E J;  3SJM A;  3IH3 A;  3BQY A;  1F43 A;  5FLV A;  1NTC A;  1RKT A;  1ETV A;  4M3E A;  4FE7 A;  5FKN A;  1TWF J;  4XRS A;  2HXO A;  1MH3 A;  1FIA A;  5F0H A;  2DMP A;  1JTX A;  4FE4 A;  3HOZ J;  2HXI A;  2E19 A;  1B8I A;  1XC5 A;  2CU7 A;  2K9Q A;  3CCY A;  2XSD C;  5EGO B;  1E3O C;  3HOU J;  4X1E A;  5FJ8 J;  4LOC A;  1ZR2 A;  1Y1W J;  4D5F A;  1HDD C;  1RES A;  2DJN A;  2M2E A;  2X9D A;  1GDT A;  3CQZ J;  3OIO A;  2ZB9 A;  2W48 A;  1BL0 A;  2LY9 A;  4C3H J;  2HI3 A;  5DS9 A;  3RZD J;  2VPR A;  3ZQL A;  1AKH A;  1U9O A;  2YU9 J;  3BT9 A;  2EH3 A;  2M34 A;  1HLV A;  3HGY A;  3MVP A;  2NVX J;  1HDP A;  4A3D J;  4QIW N; 
#chains in the Genus database with same CATH topology
 2R7D A;  1ERD A;  4G6T B;  1XB4 A;  3ABU A;  2FXA A;  1HCR A;  2FE3 A;  2KRC A;  3E5Q A;  4MTE A;  3G4S I;  3WTU C;  2CUZ A;  3EUH A;  4UB8 C;  2Y69 H;  1X1C A;  4XLP F;  4L5E A;  3OYE A;  3DEW A;  3Q9V A;  1BR2 A;  1SFU A;  4GFB A;  1R5I D;  3F8M A;  3BR0 A;  3KEO A;  3BR2 A;  1YE9 A;  1UHW A;  1LPQ A;  3DU6 A;  1P9Q C;  2K7L A;  1KQ9 A;  3QP5 A;  4FCY A;  4ENM A;  3J7Z I;  2VON A;  5EG0 A;  2WA0 A;  1JHF A;  2FBI A;  1HOM A;  3PSI A;  4DZJ A;  3M1E A;  3KLN A;  1TWH J;  1YO5 C;  1IDZ A;  3KYD B;  2YX4 A;  5D4R A;  4UY8 I;  1D0X A;  4B44 A;  4QTR A;  4QSH A;  2R5Y B;  1FMV A;  5GAH J;  1FJL A;  1FZP B;  3OSF A;  2IGN A;  1WH5 A;  1IDY A;  4G7O F;  4B43 A;  3S32 A;  3R6S A;  2VJI A;  5DTD A;  3IV5 A;  1WWX A;  3I59 B;  4W1U A;  2H6B A;  2OV7 A;  3DFG A;  3H0G J;  3G1O A;  3MQ0 A;  3EET A;  4GYI A;  2QQ8 A;  4PFO A;  5EJC A;  3IL2 A;  2FQ3 A;  3QWL A;  4NC8 A;  2EPF A;  2P8T A;  2QKL B;  5FLX K;  2ISZ A;  1YFH A;  3DCF A;  2DMU A;  3LA7 A;  1XG1 A;  3Q9S A;  1PUE E;  4R8H A;  4DBQ A;  2DQL A;  3GFL A;  3VWB A;  2XF6 A;  3JSO A;  2EFW A;  1YG2 A;  4EGZ A;  6PAX A;  2XRN A;  4WXC A;  3ESW B;  3GZN B;  3CMY A;  2E36 A;  3BR5 A;  1ZAR A;  1FOY A;  4I7H A;  2L9S A;  4R1H A;  2FUG 2;  4RB2 C;  2L54 A;  1W36 D;  2DU9 A;  3WGG A;  2VBX A;  3BWG A;  1ZQ3 P;  1JKR C;  2L7Z A;  1FBU A;  1YJW I;  2WC2 A;  2L0K A;  2RGV A;  1XMX A;  2W82 A;  2EK5 A;  3LA3 A;  3RPQ A;  4DNC A;  3SZP A;  4AC0 A;  1U5T A;  3U21 A;  3K1P A;  3JSP A;  3K70 C;  2X85 A;  1MBK A;  3QRF F;  4Q5S F;  2L3D A;  1WJ5 A;  1YW8 A;  3E7L A;  5F6F A;  5H20 A;  2KIM A;  1OYY A;  2ZSI B;  4L9T A;  3ZPL A;  2F4I A;  2HYG D;  1AKH B;  1EA3 A;  2OA4 A;  3LA2 A;  2P7C B;  1MBE A;  2BV6 A;  5FD6 A;  5LEJ A;  2ZBK A;  4XR6 A;  2CH0 A;  4U0V A;  2QQ9 A;  1N25 A;  4LLN A;  2F2E A;  2E2H J;  4LD5 A;  2W57 A;  3MEX A;  2XUB A;  1Z7U A;  4EJT A;  1VQ8 I;  2EFP A;  2KJC A;  1DP3 A;  1SFK A;  1GV2 A;  3ROU A;  5FLM J;  3S15 J;  1H8A C;  3RIR A;  2R7U A;  2Z99 A;  4LLL A;  3ZMV A;  2STW A;  1G3S A;  2LY1 A;  4MO7 A;  1FT9 A;  4OMZ A;  2L9R A;  3EYI A;  2RC4 A;  3A4C A;  5CVU A;  3SEQ A;  1A6I A;  2DOF A;  4E70 A;  3ECH A;  4IHV A;  3G1L A;  1Y0N A;  3SDG A;  1JKO C;  3I4N J;  1WHU A;  3CMM A;  2VBY A;  5J6X A;  2X0L A;  2DW4 A;  1SAN A;  2XAH A;  4F93 B;  1Z91 A;  2JA2 A;  1EKE A;  2GIV A;  2ZSH B;  3K70 D;  4CHU A;  5DUI A;  1SFO J;  1IV8 A;  4RDU A;  4IOA F;  4WF2 A;  2LKP A;  3JRD A;  1JI8 A;  4Y15 A;  2DMT A;  2RRE A;  4Y4R A;  3MFK A;  2IT0 A;  1S7A A;  3F0C A;  3BG6 A;  3GW2 A;  1IRG A;  4A3F J;  2YUS A;  2DA7 A;  4L5I A;  3WG7 H;  3GUD A;  3QOP A;  2E1C A;  2XDV A;  2HU9 A;  2VJ4 A;  1TW2 A;  3BJA A;  3ZMS A;  4YG2 F;  1SMT A;  2DDA A;  3FM3 A;  1USS A;  2AQF A;  2RNG A;  2X4H A;  5TRD A;  4UVC A;  4ENJ A;  1MSE C;  2KJB A;  3C7J A;  5KNL A;  1DPR A;  3G1M A;  4EV0 A;  1Q1V A;  2IRF G;  1RRJ A;  5IT9 K;  3HRT A;  3HRU A;  4LIV A;  2Z33 A;  3V7C A;  4P5O A;  2ME0 A;  4BJ6 C;  5ILU A;  2JK3 A;  1YI2 I;  1K6Y A;  5LRS A;  5M5X J;  3KEQ A;  2IBD A;  4CZC A;  1JHH A;  2A69 F;  2BY1 A;  3S17 J;  1PDN C;  1U5T B;  4HEA 2;  3G6E I;  3VEP A;  2PX9 A;  2QWW A;  3VOD A;  3TED A;  1VI0 A;  3ONQ A;  1A5J A;  4B3X A;  3CZ6 A;  2KZG A;  3QPL A;  4FQG A;  3KP5 A;  2IPQ X;  1MIJ A;  4DGW B;  3HOV J;  3QAH A;  2VT3 A;  2JA6 J;  1ETO A;  3D5R C;  2VXZ A;  3S16 J;  2FF4 A;  3F72 A;  2A07 F;  3NWS A;  5EDN A;  4BDZ A;  2HDD A;  1FPQ A;  3BP8 A;  1UST A;  1KON A;  3QPT A;  4AD9 A;  1K4T A;  2OQG A;  4J00 A;  2OTJ I;  3AG4 H;  4HDV A;  3DBL B;  2LKS A;  3I55 I;  2L7M P;  2MD0 A;  3TO6 A;  3DF8 A;  3VOE A;  1S7E A;  2ID3 A;  3KZZ A;  3E5U A;  3FXK A;  4A0Z A;  3LSH A;  4CH7 A;  2WV1 A;  2E1M B;  1APL C;  3GZ5 A;  2DYS H;  4RAG A;  1EJ9 A;  1ZEL A;  1FOK A;  2K9M A;  2WV0 A;  5J1R A;  2WY7 Q;  2NXN B;  1P2F A;  1JUS A;  2E1O A;  2FMY A;  3ZGK A;  3K7A J;  1RNL A;  3PQK A;  3B02 A;  3WTS C;  2CQQ A;  2PEX A;  1IC8 A;  2PI0 A;  2E5Z A;  2K02 A;  4CYC B;  2R7R A;  4FIS A;  2MD5 A;  1V54 H;  2MGQ A;  2MLK A;  2O7O A;  1A36 A;  2QSF X;  2HFH A;  3FXL A;  1OR7 A;  1W4M A;  2R4G A;  2XGD A;  2GM4 A;  1Z7L A;  1ZYR F;  3E1S A;  2DA4 A;  2JN6 A;  1IGN A;  4RB1 A;  1LDJ A;  2Q2E A;  2OCC H;  1I1G A;  4MNU A;  5J3L A;  5ILS A;  4EQQ A;  1HBX G;  3K4J A;  3FKI J;  2JUG A;  3FK6 A;  4X0G A;  2LBF A;  4A0Y A;  2MSY A;  1WPK A;  1KA8 A;  4UXN A;  5IP7 J;  2BYV E;  2OC6 A;  2PQ8 A;  1D1B A;  2F5E A;  1KU7 A;  4B09 A;  4PJL A;  2DA1 A;  1OYI A;  2QQB A;  2K85 A;  3LSJ A;  3ZR8 X;  1UJ8 A;  3TOB A;  4BXU A;  3DBR B;  1UCR A;  3JCU C;  2EA4 A;  4ASN A;  2BW3 A;  2VT2 A;  1SD7 A;  3EUH C;  5FRM A;  2KRH A;  4CSW A;  4AUX A;  1MBJ A;  4QLC U;  5J4Y A;  3PM1 A;  2EZL A;  1LB2 A;  1V3F A;  3K4N A;  1TL8 A;  4FX0 A;  2RQQ A;  2E5N A;  5IT9 Z;  1B59 A;  4PSW A;  4IHX A;  2ELJ A;  2VB6 A;  2DMQ A;  5E17 F;  1SC7 A;  3ZQH A;  1E2X A;  3GTK J;  3L2W A;  5B1A H;  4Q47 A;  5H6Q A;  1SD5 A;  1UMQ A;  4PZJ A;  4IJA A;  3H36 A;  4WXD A;  2P4W A;  2MC3 A;  4CGZ A;  2JUC A;  4XLH A;  4EJU A;  4UUS A;  3ZQQ A;  3ZMT A;  1YS6 A;  4XID A;  1VQ9 I;  4HRI A;  5KVR A;  3W6K B;  4MEX F;  4II3 A;  3E6M A;  1VZ0 A;  1Z3Y A;  1RET A;  1VQP I;  4M72 A;  4XRS G;  5H6R A;  5GAG J;  3ZQF A;  5JVT A;  4LJZ F;  4DJA A;  5M3F J;  2NOG A;  5DD4 A;  1WRJ A;  2DFE A;  1MMA A;  5LD2 C;  2DA5 A;  3DEU A;  1Z0X A;  5JR3 A;  3AAF A;  2DT7 B;  4HAM A;  5E1W A;  2BXY A;  1F36 A;  4Q48 A;  2OBP A;  3T5X A;  3S2D J;  3M4O J;  3M8E A;  3KYC B;  3HUG A;  3QYE A;  2H1K A;  2PJR B;  1KGS A;  3GFJ A;  3B6C A;  4WK8 F;  2F5V A;  4AIJ A;  4BQA A;  2XSJ C;  5JVG F;  2KL4 A;  3K9T A;  2KT0 A;  1QZY A;  3K1M A;  1T0F A;  1K61 A;  3QPS A;  2PJP A;  4HYE A;  4C2T A;  3PFY A;  1R1V A;  5DM7 F;  1ULY A;  3PFI A;  4E7S A;  2M1B A;  2B63 J;  3HOY J;  4BL0 B;  1X1A A;  3H9Q A;  1FTZ A;  2CQX A;  1T56 A;  1IXR C;  1WQ2 A;  2DJI A;  2Y0M A;  4EM1 A;  5HNH A;  3GCM A;  1HKS A;  2DK5 A;  2BBY A;  2IW5 A;  2Q2E B;  2W25 A;  2V4J C;  3EPZ A;  1H0M A;  5EYR A;  4DYC A;  3IH4 A;  5J8F A;  2LD5 A;  1QU3 A;  3V8J A;  2LBF B;  2BZT A;  4HOB A;  2M0M A;  2K5C A;  5HLG A;  3BLY A;  1BR1 A;  2HTS A;  3I71 A;  5FKO A;  1OQY A;  3HJE A;  3DPT A;  4O5V A;  2JSC A;  3H5R A;  1T98 A;  1R22 A;  2MBF A;  4Y13 A;  4M3B A;  2E60 A;  4RLF A;  3SFZ A;  1ZN2 A;  2Y31 A;  1U0J A;  2GOX B;  4N4O B;  2BY3 A;  3KP6 A;  3LQQ A;  3ZOB A;  4C3J J;  2LFB A;  1ZHF A;  1EH6 A;  2K3P A;  5IPA A;  5EF6 A;  3MN2 A;  2K27 A;  3ZQC A;  4YIR X;  1OMI A;  3E6B A;  2Z1D A;  3V7R A;  4HX8 A;  2EIM H;  5DV5 A;  3E6C C;  2BGC A;  3LFK A;  4M3E A;  4OU0 A;  5E8G A;  3EYY A;  5FKN A;  3FMR A;  2HQN A;  2HXO A;  1KYW A;  1XTA A;  4M9S A;  3TBI A;  5D8K B;  2DMP A;  3PUF A;  4JBA A;  4FE4 A;  4PJM A;  3O6B B;  4AM3 A;  2HXI A;  2KHM A;  1KYZ A;  4NNJ A;  1B8I A;  5ICG A;  3CCY A;  3W3C A;  3DQV C;  2DOA A;  1FY7 A;  5JFR A;  5EGO B;  1E3O C;  1W1W E;  2XGX A;  4X1E A;  3QP6 A;  1HDD C;  1RES A;  3M9A A;  3U2R A;  2XKO A;  3CQZ J;  2DT5 A;  3OIO A;  4OAY A;  2ELH A;  2JVH A;  2W48 A;  1EV7 A;  1BL0 A;  5DS9 A;  2NRA C;  3F8B A;  2Q1Z B;  3JAM Z;  1IN7 A;  2EH3 A;  3OR1 C;  3HGY A;  1X1P A;  1G3Y A;  3L2R A;  4BQQ A;  5CJ9 A;  4Z2Y A;  1QZE A;  1B1B A;  1FNN A;  4W97 A;  4XKB A;  4IQ4 A;  1LVA A;  2IAI A;  4LG0 A;  1LEB A;  2VC0 A;  1G6N A;  2X6W A;  1X3U A;  1ZKG A;  3OWT A;  5FRO A;  2NVQ J;  5BOX A;  4A3B J;  1T95 A;  1JJ8 C;  3K6G A;  3R61 A;  3U1K A;  1XN7 A;  1UZC A;  2OTL I;  3BPX A;  2B7E A;  3GTO J;  2IEK A;  2K86 A;  1Z9C A;  3GXO A;  2ZXH A;  4HDU A;  5K5Q A;  1LQ1 A;  4HNT A;  2ZME A;  4XKC A;  3JRI A;  3VYR B;  1VQL I;  2ZCW A;  2FX0 A;  3EDP A;  2K40 A;  1R49 A;  2KIF A;  3DPL C;  1ON2 A;  3ERM A;  1JGG A;  2FBK A;  2FRH A;  2ZFU A;  4A3M J;  2RDP A;  4G94 A;  4UNO A;  3CO7 C;  5EEG A;  1VQO I;  4PUS A;  2JPB A;  4KMU X;  1K7A A;  1N77 A;  1GVJ A;  2OJE D;  3FBN B;  5CVJ A;  4C2M J;  1FLI A;  3J7A Y;  3BRO A;  2LR8 A;  2HZD A;  3GYH X;  3G3Z A;  1YJN I;  1GXP A;  1IV6 A;  2IS6 A;  3WU1 B;  4XK4 A;  2DQR A;  2ZC2 A;  4DOZ A;  1FYK A;  1ZR4 A;  3PO2 J;  3WTV C;  1IN5 A;  1PUF A;  1FYL A;  4U7B A;  1XCB A;  3HM5 A;  3SEZ A;  4IF4 A;  3L9F A;  3FF5 A;  4AYB N;  3CUO A;  2NOJ B;  2DFH A;  3DTK A;  4GXO A;  1R71 A;  4N0B A;  4PJ0 C;  1W7P A;  3B73 A;  3JR9 A;  1IG7 A;  2HVS A;  1UHM A;  1SVM A;  3FM5 A;  2XAG A;  4MTD A;  3O8G A;  5FLX Z;  2E34 A;  3L2U A;  1BIB A;  1HXD A;  2LNB A;  1Y56 A;  3JRH A;  1BI1 A;  1W0T A;  2EWN A;  1X3W B;  4M73 A;  3LSK A;  4ABZ A;  2V1N A;  1YYV A;  4RM3 A;  1D0Z A;  4XRM A;  4BBS J;  2XIG A;  4KFC A;  1V5G A;  4EVI A;  3WU2 C;  2CYY A;  2COM A;  4G8X A;  4IRH A;  2ICW G;  1JGS A;  5KAF C;  2HKO A;  3OOU A;  1OCP A;  4S04 A;  3LWF A;  2CFO A;  5CQG A;  4BE0 A;  2KMU A;  4KJZ A;  2G7U A;  4XSX F;  1IXC A;  5K7H A;  4AU7 A;  3CJN A;  2HWV A;  3HGG A;  3MWM A;  1QZZ A;  4LFU A;  1GUU A;  4I0A A;  1RUO A;  1K78 B;  4EMS A;  3CP2 A;  4IRI A;  2MW8 A;  5IP9 J;  3ZMU A;  2ZME C;  4LG0 B;  5BPD A;  2LDU A;  3HTU A;  2H27 A;  1XDU A;  3OSG A;  2PFB A;  3OYI A;  2EFQ A;  3CDI A;  5D5U B;  3PSF A;  3V8L A;  1MMN A;  1Z67 A;  5EZH A;  3HBL A;  2D45 A;  4M6Y A;  3BR3 A;  4PGH A;  3OL3 A;  1X2M A;  1XD7 A;  2M9H A;  2Y9Y A;  1WGX A;  3QYB A;  1M1E B;  4CZZ A;  3PJR A;  3ERE D;  3IWZ A;  1G4D A;  3MKW B;  1TWA J;  3OY9 A;  3CC4 I;  2A3S A;  5FKK A;  4I0B A;  3VYU B;  2O0Y A;  2O5R A;  1D8K A;  2CSO A;  2D5V A;  2H1L A;  3JRG A;  3T1B A;  1QPI A;  3TOA A;  3S93 A;  2MA3 A;  2A61 A;  3KP7 A;  3TW7 A;  1R1T A;  1MSF C;  1TP4 A;  3HDD A;  3J7A O;  4HV6 A;  2GAU A;  3DKX A;  3HHH A;  4CO8 A;  5K1Y A;  2BVL A;  1H9T A;  3VB2 A;  4XLF A;  2XAQ A;  3FDY A;  1HW2 A;  1YRN A;  2HKX A;  3PNV A;  4B1R A;  2VJ5 A;  3HC7 A;  3QU6 A;  2GXB A;  3BCA A;  3QPH A;  3PIP F;  2QM3 A;  5AIQ A;  5HNF A;  3HOS A;  3H0D A;  3EUA A;  1QBJ A;  1VQN I;  1G8X A;  2AXL A;  3S1N J;  3FXJ A;  3GFI A;  1OYW A;  1P4A A;  4I09 A;  3J81 K;  1D8J A;  2FNA A;  4BY7 J;  4PDK A;  5CVR A;  2PMH A;  4LGW A;  3IAM 2;  1N78 A;  1P4X A;  2EV6 A;  3LST A;  3R60 A;  3RDI A;  3ZXS A;  3GVA A;  1O57 A;  1BR4 A;  2JQ7 A;  3OYL A;  3FXU A;  3CDL A;  3CC2 I;  2LKX A;  1B6A A;  4G7H F;  2EIN H;  1R9T J;  2UXN A;  4WCG A;  3ABT A;  4HX4 A;  1LE8 B;  2MH9 A;  2KDO A;  5A2Q K;  3WTZ A;  2EZK A;  4AID A;  2KPM A;  1L0O C;  2XF5 A;  2HOT A;  2VKE A;  3FHN A;  1HST A;  2GXG A;  1KZH A;  3N97 A;  2I5U A;  1S29 A;  2EBI A;  4RMN A;  4QWQ A;  2XGC A;  5JLX A;  3SHF A;  3H5N A;  4MFD A;  4XKW A;  4IQJ A;  1HW5 A;  1LUJ B;  1DPU A;  4ZH4 F;  2YX7 A;  3VDX A;  2XKP A;  3RI4 A;  4A3I J;  1K78 A;  2DA3 A;  3BR1 A;  3KX2 A;  5KAI C;  3UKG A;  3TO9 A;  4KIS A;  2M87 A;  3HSE A;  4BH9 A;  3I4P A;  4MLO A;  2LMD A;  1TC3 C;  1IF1 A;  4KA4 A;  5AON A;  4JOM A;  3E0J B;  3MD2 A;  2QEX I;  1D0Y A;  4IVN A;  3MZY A;  2CV1 A;  2W84 A;  3R0A A;  1S8N A;  2R5Z B;  5EZG A;  4H4K C;  5LLQ A;  3DKY A;  4E7H A;  1R4M B;  1ZK8 A;  4RM2 A;  3LFU A;  2R7T A;  1LFB A;  3E6D A;  3WG9 A;  1OPC A;  2V9K A;  2YS9 A;  4M71 A;  3TMO A;  5EEH A;  3Q0U A;  1O3T A;  4XLA A;  1HW1 A;  1HC8 A;  1D1C A;  2FNP A;  3PQJ A;  4M6V A;  4IO9 F;  1XS9 A;  3H3Z A;  2XHK A;  4UUT A;  5LHH A;  1U9N A;  2EFN A;  2VE9 A;  2IS4 A;  1QVU A;  4CCJ A;  4I01 A;  3RPU D;  2HEO A;  1ODD A;  1T33 A;  4YFX F;  3GO5 A;  3ZQ7 A;  3BY6 A;  2K3F A;  3HHG A;  1XGM A;  2HQ5 A;  4A12 A;  1TNT A;  4WXH A;  3MMY B;  4RLQ A;  2VKD A;  1RR8 C;  2RN7 A;  4AIK A;  2EZI A;  2R7S A;  2V1U A;  2LTP A;  1MBG A;  4NDL A;  1YQA A;  1OLT A;  5E3L A;  4RGX A;  5GAD J;  4N9H A;  1DP7 P;  3LSM A;  4RGS A;  4BE2 A;  3K2A A;  2QBY B;  3LSG A;  2D2W A;  3A1Y A;  1Z3X A;  4JK1 X;  2Y30 A;  5K5R A;  2EB7 A;  3G73 A;  1R5H A;  2IVM A;  1LE8 A;  1FYM A;  3CUQ C;  3OIP A;  4E7J A;  2OF7 A;  3ZQG A;  4JX4 A;  1P7I A;  1Y0U A;  2FOW A;  1VTN C;  1O7F A;  2QVO A;  2R7Q A;  1BI3 A;  5M5W J;  1ENH A;  3FK7 A;  1FP2 A;  3IC7 A;  4NUB A;  1SFX A;  3BG3 A;  3BJO A;  2BXZ A;  1J7K A;  3CJT B;  2XAS A;  4E7K A;  4KN4 X;  2DA6 A;  3NQO A;  4XNF A;  3S3O A;  4F91 B;  3MKL A;  1VQ4 I;  3KET A;  2F5D A;  1MND A;  2HQR A;  4E4H A;  2QZ8 A;  1FC3 A;  5TJJ A;  1JTY A;  2NVU B;  1YIO A;  3OYG A;  4A3J J;  5LGT A;  3A02 A;  1WKM A;  2M8G X;  1WJD A;  4Y7N J;  2ETH A;  1QHH D;  2KLO A;  2A05 A;  3GZ6 A;  3JRE A;  3OYF A;  2TDX A;  3LNQ A;  2R5Z A;  2DK8 A;  2HOE A;  1TBX A;  5LHG A;  4Y33 A;  2PLY A;  1MMS A;  2NAZ A;  1Y8R B;  2OZU A;  3BR6 A;  3ECO A;  2YR2 A;  5F0C A;  1MW7 A;  4BHC A;  2QSH X;  3GTJ J;  2ZXJ A;  1ZLK A;  1SMY F;  4XN0 A;  1RR7 A;  2D1H A;  1FOX A;  2R7O A;  3PNY A;  4L0Y B;  3S3M A;  2VN2 A;  1X1B A;  2V79 A;  2P5L C;  3QYF A;  1ZH5 A;  5DUK A;  2H8R A;  1VQK I;  4FT8 A;  4RGR A;  3FKJ A;  4I76 A;  4OIQ F;  5ICF A;  4XLN F;  2PMU A;  5HOO A;  2R92 J;  3I9V 2;  2P0W A;  2VI6 A;  5GPC A;  1Y8Q B;  1S5L C;  3E5X A;  1N75 A;  3VSK A;  1T39 A;  5KK1 A;  2LYC A;  2XPV A;  5IT3 A;  4R79 A;  1WH7 A;  1LEA A;  2UXX A;  5BS6 A;  1RC9 A;  4P1W A;  3F6V A;  5GTH C;  3BOQ A;  2Y0S N;  3L7W A;  1T8I A;  3CDH A;  4HZF A;  3TO7 A;  4J01 A;  4PSX A;  2JRM A;  2VE8 A;  2I8D A;  2CW7 A;  3BTI A;  3HYI A;  4F3Q A;  3JAM K;  1NK2 P;  3H1C A;  1QO0 D;  1SEU A;  3I54 A;  2F4M B;  2MC4 A;  1ZG1 A;  3ULQ B;  1POG A;  4MQ9 F;  1A31 A;  2X48 A;  3CMA I;  1TW3 A;  2E35 A;  2KRF A;  5CYV A;  2ECB A;  3E97 A;  1R58 A;  1MNM C;  5BNG A;  2XRO A;  3K1N A;  2DA2 A;  4GYG A;  4YEL A;  1F9N A;  2GXA A;  1BN5 A;  4HBL A;  3MZH A;  1ZG5 A;  1RKT A;  2Z2S B;  4A6E A;  3HRS A;  3W2A A;  2IGM A;  1YHQ I;  5HS9 A;  2WBM A;  1TLH B;  1Z1D A;  3DTE A;  1MH3 A;  2R7V A;  5F0H A;  1QPM A;  2F5C A;  1JTX A;  1IN4 A;  3SQN A;  3W6J B;  3HOZ J;  2UZK A;  5ICE A;  5HDK A;  2W7N A;  1XC5 A;  1PVE A;  3KP3 A;  5BMZ A;  3I0T A;  1SVO A;  4HW0 A;  3F8N A;  1ZR2 A;  1Y1W J;  4BAC A;  2DJN A;  2M2E A;  5D5X B;  1C0W A;  2XC7 A;  2ZB9 A;  4KT6 A;  2A6H F;  2G9W A;  2LY9 A;  2UV1 A;  5LHI A;  1T6S A;  3ZQL A;  1U9O A;  1R5G A;  3RTR A;  2LY2 A;  2YU9 J;  4RGU A;  2UWM A;  2M34 A;  2NVX J;  1HDP A;  4A3D J;  1V4R A;  2ZJR F;  4QIW N;  1W7P B;  4M9X A;  1VND A;  2DXI A;  2LG4 A;  2HTJ A;  3P9C A;  4CCK A;  4G12 A;  2CFX A;  3H35 A;  4EJO A;  3ASO H;  1U8B A;  5D5W B;  2GIZ A;  4NC7 A;  1ZRD A;  4FET A;  1IUF A;  3JTG A;  1UFM A;  2A6E F;  2L01 A;  3SDB A;  3SXY A;  1BW6 A;  1J0R A;  3IP4 B;  4S05 A;  2KQR A;  1SFE A;  4G9Y A;  4E7Z A;  4BEH B;  2Q8K A;  3A01 B;  4NHJ A;  2QUF A;  2DOE A;  2WAD A;  5J4V A;  1TQI A;  5DYM A;  4L0Z B;  2VOO A;  2EIJ H;  1RPW A;  2AHQ A;  1X4P A;  3S8P A;  4ZYA A;  2M7A A;  1IRX A;  2AXT C;  4BQO A;  3D0S A;  1I3A A;  1ON1 A;  1BM9 A;  4RAZ A;  3OYA A;  2LC2 A;  4ZTF A;  2FD5 A;  1B8I B;  2HVQ A;  3RKY A;  1BIA A;  5HVQ C;  1CQT A;  3J80 Z;  2VAS A;  1NK3 P;  4GDF A;  3QOE A;  1S7O A;  5JHU A;  3JRA A;  2ESH A;  4LB6 B;  3VSL A;  3I56 I;  9ANT A;  2EFO A;  2R7F A;  1X1D A;  3AG3 H;  5M3M J;  1BJA A;  3H5A A;  1XCV A;  5LBQ A;  4AWX B;  1S6L A;  2O8X A;  1OCT C;  2R0Q C;  2JJ7 A;  3FXR A;  3SYT A;  4ZYG A;  2EA2 A;  2E7W A;  2VUM J;  2M3A A;  3WU0 A;  1XPX A;  1MH4 A;  1AOY A;  1BOA A;  5C44 J;  2IA2 A;  4KIT B;  4MHG A;  2ZJQ F;  4AYB A;  2V1D A;  4ZDP A;  3V7S A;  2CUF A;  3HEF A;  3HKZ N;  3DKW A;  3ISP A;  2Q0O A;  4BE1 A;  4ETS A;  5E3O A;  3U9G A;  1JJ6 C;  3AL0 C;  2DI3 A;  3RYP A;  4RB3 C;  3R4K A;  5ILV A;  1R7J A;  3KZI C;  1NH3 A;  2F5F A;  4B48 A;  1AWC A;  3JRB A;  5E3N A;  1XDS A;  2ZME B;  1XSD A;  1V5E A;  1MGT A;  2PBI A;  4XLE A;  3T8R A;  3J81 Z;  2WTE A;  1JKQ C;  2MH2 A;  4A5N A;  3OYM A;  1XMK A;  3E3V A;  3M07 A;  4DIQ A;  1JUP A;  2GBY A;  1I39 A;  2O61 A;  3I58 A;  1F1Z A;  4MIM A;  5JI6 A;  2JA7 J;  3AL0 B;  2V1X A;  2Y2Z A;  2F4O B;  2LF8 A;  3KPH A;  4XN3 A;  4KDP A;  5IYC J;  4ENN A;  2AQE A;  2X1D A;  1K83 J;  2DFF A;  3DTI A;  1Z6R A;  1IZ1 A;  4M3D A;  3HRM A;  1BBY A;  3L00 A;  2XPU A;  3EUK L;  4UHT A;  4UV8 A;  5DM6 F;  3OYJ A;  3HOX J;  1OIS A;  3PL8 A;  4BAY A;  1MDM A;  3WTY C;  1PUF B;  2ZXW H;  5L3E A;  5L3B A;  1G59 A;  3A03 A;  1GV5 A;  1BJZ A;  3O2P E;  1EH7 A;  3KZY A;  2HZT A;  3A01 A;  3GTP J;  2RVC A;  2E7X A;  1YTY A;  3F6O A;  5GP9 A;  3GTM J;  2PG4 A;  4AIH A;  2NVY J;  4ESB A;  5GTI C;  4N4N B;  1U78 A;  2VOP A;  2R5Y A;  1ZRF A;  2F48 A;  3HOW J;  3WE2 A;  2QEN A;  5A2Q Z;  5J47 A;  3S1Q J;  3CCU I;  3A2K A;  3CCQ I;  1B9N A;  2OUM A;  4BKX A;  4MGR A;  2JA5 J;  2Y9Z A;  4S0H B;  3F22 A;  1BA5 A;  3S1M J;  3BDD A;  2FU4 A;  3CJR B;  4Y3O A;  2WY8 Q;  1CF7 A;  2M5W A;  2WB1 A;  1U3E M;  2K9S A;  3H3U A;  2X1E A;  3GFM A;  4IHS A;  1WJE A;  4DYQ A;  3F8F A;  3IWF A;  3S2W A;  5IOY A;  3LAJ A;  2QA4 I;  3TP3 A;  1IXS B;  3NEU A;  3LSI A;  1HF0 A;  2VBW A;  2O8K A;  1W5C C;  4ZYH A;  2ESN A;  1W7P D;  5D8L B;  5C3E J;  2FEZ A;  1LVK A;  1H88 C;  3K4K A;  3OS0 A;  1O4X A;  1XSV A;  1FIP A;  1X58 A;  4LB5 A;  2XV4 S;  4XOR A;  3A0B C;  3IUO A;  4YII A;  4XIC A;  2DLL A;  3D1N I;  5D6E A;  2BHZ A;  1J59 A;  1DDN A;  3BCB A;  2DYR H;  4DW6 A;  4B4C A;  2BW3 B;  2HS5 A;  4C30 A;  1LDK B;  4NQW B;  2WAF A;  3BTJ A;  3BQZ A;  5F64 A;  5HLI A;  2B0L A;  5DCF A;  5B66 C;  1E3P A;  2FJ1 A;  2FA5 A;  2HQA A;  2ZXI A;  2JZY A;  1LDD A;  1MZB A;  5FB2 A;  1VQ5 I;  5J1U A;  4BS9 A;  2E1N A;  1QGP A;  4OAZ A;  2Y75 A;  2LP0 A;  3I64 A;  4RAF A;  5E1X A;  5IYB J;  1VF9 A;  4HF2 A;  1SD4 A;  4O6J A;  1VFC A;  1ORK A;  4HX7 A;  1ZTR A;  2M30 A;  2M7B A;  2W24 A;  3C3W A;  5E3M A;  4UUS B;  3CCJ I;  1U2W A;  2DDB A;  3ABM H;  3FBI B;  3PNT A;  3DLL F;  2R7W A;  2W4S A;  3KLO A;  4P55 A;  2HYF A;  3BJ6 A;  2AS5 F;  4YRV A;  2RNJ A;  1XGS A;  1ETW A;  5KHD A;  4BYY A;  3M3Y J;  3FXO A;  1MDM B;  1IJW C;  2XAF A;  3QU3 A;  1ZRC A;  3VFZ A;  4BHP A;  3GTQ J;  2WAE A;  3BTL A;  4KUM A;  2DTZ A;  2LRD A;  2X51 A;  4WX9 A;  1WZ2 A;  2QQA A;  2OZ6 A;  1PP7 U;  5HS8 A;  4H0E A;  4CXF A;  3BC8 A;  1H89 C;  3F8C A;  2ZO4 A;  4FAS D;  1AA7 A;  3UR3 C;  2RV8 A;  3MAJ A;  4E6K G;  4ZDL A;  4JP0 A;  3CC7 I;  2PJR A;  2R93 J;  2JWT A;  3I4M J;  3CCV I;  1E17 A;  1TNS A;  4A5M A;  3CO6 C;  1XGO A;  4BU2 A;  3NWT A;  3GTG J;  4F55 A;  3FXM A;  3OV8 A;  5D5V B;  1GT0 C;  1K4S A;  5IOZ A;  1FMW A;  3V42 A;  4CDG A;  1KU9 A;  4E7L A;  5H2F C;  4CCO A;  2KIS A;  2TCT A;  1U6G A;  5M5Y J;  4GO1 A;  1ETY A;  1XMA A;  3K4B A;  2VBZ A;  5CQE A;  2UUZ A;  2CW8 A;  4A3L J;  4UVA A;  4HST A;  1B72 A;  4IHY A;  1VQ6 I;  2QLZ A;  1ITY A;  3K4C A;  3M8F A;  3HSR A;  3FXQ A;  1OCZ H;  3TGN A;  4A69 C;  1I50 J;  3OL4 A;  4U7D A;  5DDG A;  3M1C A;  4CUG A;  5E20 A;  2STT A;  3GBG A;  2VKH A;  2QKM B;  4ZC3 A;  4BBR J;  4IZZ A;  2R3S A;  4KIF A;  3OOP A;  1H9G A;  2P6T A;  2X6X A;  3K4L A;  1ZGJ A;  2Z9O A;  3K0L A;  1WJF A;  2DN0 A;  4D1Q A;  2OD5 A;  5J40 A;  4Y17 A;  1QRY A;  2V9P A;  4G7Z F;  4V19 K;  3O3K A;  2IS2 A;  2XVC A;  2I10 A;  2CJJ A;  2RQP A;  4LIU A;  4BGD A;  1O3R A;  2RKH A;  5TGT A;  2IGK A;  3LSP A;  1GVD A;  2BVM A;  2O03 A;  3RKW A;  2DT6 A;  1S3J A;  4A93 J;  2VJJ A;  3DEE A;  1R1U A;  3VYS B;  3I5U A;  3L1P A;  4EJW A;  2DPU A;  4UUV A;  3SFI A;  4JQF A;  4NBQ A;  3FX3 A;  4OWR B;  1PP8 F;  4WWC A;  1IUY A;  3HOT A;  2CRG A;  2HGC A;  2PMZ A;  4LK1 F;  2B9S A;  1E0E A;  2K9L A;  2V9V A;  4BY1 J;  4EEF G;  5FD5 A;  2W1O A;  2NS8 A;  1J5Y A;  1D5V A;  3FZV A;  1J9I A;  1Z77 A;  3RQ4 A;  3CME I;  1UAA A;  5HDN A;  1MBH A;  1YJ9 I;  1LNW A;  3OS1 A;  1XGN A;  4A2U A;  1G3W A;  3CUQ A;  1KQ0 A;  4U88 A;  4IX7 A;  3I3L A;  2HVR A;  3OYC A;  2BHY A;  4I6Z A;  1DUX C;  3VPR A;  3QQA A;  3P9I A;  1TTY A;  4L9V A;  4RS8 A;  2QBY A;  2W85 A;  5LRR A;  3I53 A;  5ICC A;  2H6C A;  1P7J A;  5JLW A;  3RKX A;  3Q0W A;  2VKV A;  2VQC A;  3CCM I;  1W36 C;  2RAE A;  3DBH B;  3R0J A;  3F23 A;  3CCL I;  4OIN F;  2XB5 A;  2VQG A;  4HA8 A;  2QYO A;  1OJL A;  1SAU A;  3V8K A;  2VPL A;  4LG3 A;  4CYD A;  1J75 A;  2BE5 F;  2J5P A;  1U5T C;  2KIQ A;  4MFE A;  4F92 B;  3S1R J;  1O3Q A;  3RCO A;  2M4K A;  2V7F A;  1AHD P;  5GPA A;  1T38 A;  3KEY A;  2LH9 A;  1P4W A;  1G3T A;  1KQ8 A;  1YS7 A;  3DLA A;  2FQ4 A;  2COB A;  1NG6 A;  3OYN A;  1ONV A;  5HLH A;  5FKM A;  4XSZ F;  2P6S A;  4L9J A;  3TKY A;  4ZYD A;  3MCZ A;  2KDZ A;  3BTC A;  2E2J J;  4ENK A;  1S9H A;  2JTV A;  2Y48 A;  4IPA A;  1W0U A;  4A6D A;  4IHW A;  1BC8 C;  4L18 B;  2VQL A;  5DEQ A;  3COA C;  1TQP A;  2LRE A;  3CCS I;  3SJM A;  2W00 A;  2DO7 A;  1SAX A;  3IH3 A;  1F43 A;  5FLV A;  1NTC A;  4I2O A;  5BPI A;  2M4G A;  2PN6 A;  3K2Z A;  5L3F A;  3WGH A;  5JHF A;  4AVZ A;  3ZMD A;  2HDC A;  3CLQ A;  3KP2 A;  3TQN A;  1WSU A;  1DGW Y;  4KMF A;  4Q4Z F;  5HDG A;  2BY0 A;  2CU7 A;  2XSD C;  3ELK A;  4HLY A;  4XOT A;  3HOU J;  2R7X A;  1TT5 B;  3DPU A;  4LOC A;  2EV0 A;  4D5F A;  1F5T A;  2A5W A;  2KZV A;  2M45 A;  2X9D A;  1GDT A;  1WJA A;  2EJR A;  3KCC A;  2HI3 A;  2ACJ A;  3RZD J;  2VPR A;  2YU3 A;  3BT9 A;  3MVP A;  2NYX A;  2M8E A;  3CES A;  1X2N A;  3PIO F;  2CMP A;  3CF5 F;  5DD8 A;  3LQR A;  4JX5 A;  4B8X A;  4ZDO A;  3CUQ B;  4RBO A;  2G0E A;  1B9M A;  5C4J J;  3WHB A;  1Z6T A;  2ISY A;  5IY5 H;  5E18 F;  3OIQ A;  2OCE A;  3HUG B;  2VC1 A;  3DP7 A;  1FP1 D;  2ELK A;  2XAJ A;  3RKQ A;  3ZN0 A;  3ZRG A;  4DYR A;  4Y52 J;  2GQQ A;  1SD6 A;  4J19 A;  3D5L A;  2AO9 A;  4KN7 X;  2O6G E;  5IP6 A;  1NG7 A;  2IA1 A;  4BUP A;  1UHS A;  4DQ2 A;  2CV2 A;  4EJV A;  2ZNZ A;  4YFK F;  2OPT A;  1UB9 A;  3LOC A;  4FTH A;  2ME6 A;  1ETK A;  3H9G A;  1R6R A;  4KT5 C;  2LVS A;  3NAR A;  3LMM A;  3A0H C;  3P9K A;  5LFA A;  2X6O A;  3TL4 X;  3TDZ C;  1YW7 A;  2HPM A;  4IXA A;  4PJJ A;  4FX4 A;  3C2H A;  2GWR A;  2NNN A;  1MMD A;  2ZJ2 A;  2FSW A;  3ZP5 A;  3OR2 C;  2F6C A;  3MKY B;  2X6Y A;  1QA6 A;  1OCO H;  3RYR A;  3WTW C;  2V6C A;  1PJR A;  4ESF A;  4D7N A;  5B3S H;  1JT6 A;  1RUN A;  3IAS 2;  3CLO A;  2LLK A;  1YW9 A;  1WI9 A;  2H09 A;  3AG1 H;  5DCM A;  5HS7 A;  3ZMZ A;  1IRZ A;  1K79 A;  1YX3 A;  4BXF A;  4RA2 A;  2L7F P;  3J7Y J;  3BZK A;  2EZH A;  1R00 A;  4BDY A;  1WI3 A;  2QF7 A;  3LSR A;  2CS3 A;  2H8W A;  2CQ7 A;  4P9U A;  3N05 A;  1MJB A;  1MKM A;  3H9J A;  3AKZ A;  3ABL H;  5D4S A;  1WCM J;  4U87 A;  3DV8 A;  4PGG A;  4EAT A;  4UV9 A;  3HPG A;  2PMZ N;  3IHU A;  1VQM I;  1B4A A;  1FX7 A;  4GGG A;  4KIG A;  5C4X J;  4HLX A;  1K6O A;  3N4M A;  4ZJZ A;  3PUB A;  4F7Z A;  5EGO A;  4A3G J;  3IRR A;  2EIK H;  1IRF A;  5EG0 B;  2G7H A;  2O3F A;  4IEJ A;  4K2E A;  2BEO A;  1XX5 A;  3OYD A;  2YPR A;  2R7Z J;  1X19 A;  1Y1V J;  2XRL A;  1A04 A;  4CA0 A;  1DU6 A;  2CUE A;  3HSF A;  4XQF A;  3K4M A;  1MJ9 A;  3VYT B;  3C2B A;  4GCV A;  2Z16 A;  2EV5 A;  4OIP F;  3X2Q H;  4IHT A;  3I59 A;  5K7F A;  2TRT A;  1I5Z A;  1W5S A;  3GF2 A;  3CTA A;  3EQL F;  3OMY A;  1ZGA A;  2KKO A;  3O8H A;  3DU5 A;  4D5C A;  4ANJ A;  1R36 A;  5L3G A;  4C2U A;  2OQR A;  2A6T A;  2JMW A;  2P5K A;  3L2Q A;  3CF2 A;  3F21 A;  2ZFW A;  2XB0 X;  4BJT A;  3WTT C;  3WTX C;  1YIT I;  2QSG X;  2L9V A;  2CQK A;  5LGU A;  3C1D A;  2GA1 A;  4X6A J;  5F04 A;  4E7I A;  1X3Z B;  3C2G A;  1STZ A;  1MJA A;  1FOW A;  2A5Y B;  4NB5 A;  3PO3 J;  2NS0 A;  3KYL A;  1U8R A;  2XGE A;  1WJC A;  2XF7 A;  3L09 A;  1D3Y A;  1IN6 A;  3CCE I;  1Y6I A;  1Q1H A;  2HDW A;  1HQC A;  2LOO A;  2A68 F;  4M9Z A;  3WOD F;  4HG2 A;  1NHA A;  2HOA A;  1SVL A;  2C6Y A;  3Q0V A;  3ZCO A;  2V6E A;  4IL6 C;  3GEZ A;  1DU0 A;  2GLO A;  2N8G A;  5ERI A;  1RZ4 A;  5DCM B;  4OOI A;  5J1Y A;  3T8T A;  1Z05 A;  3U1D A;  5D6F A;  2JT1 A;  5FO5 A;  1JT0 A;  4XMY A;  3P5J A;  4JX6 A;  1W5T A;  4ITV A;  4A0X A;  1HKT A;  4U0Y A;  2EIL H;  3SZG A;  3QOD A;  2L5Q A;  2VIX A;  3DXJ F;  2JVG A;  3S14 J;  1P92 A;  4P9F A;  1HSJ A;  5E79 C;  2NVT J;  3ML6 A;  1FSE A;  4XOP A;  3MZ8 A;  2DMN A;  3WE3 A;  3ASN H;  3JW4 A;  2ID6 A;  5ED4 A;  1YLF A;  2VL8 A;  3RSN A;  2O9L A;  4IOC F;  3S2H J;  2HPI A;  1O7L A;  4M3F A;  2V26 A;  4L9N A;  1MBF A;  2XPW A;  5TIS C;  2D1V A;  2GOM A;  5AIP A;  1DQU A;  2J5O A;  5F1J A;  5EEA A;  2BOL A;  3CP8 A;  4BQN A;  1TWC J;  4MEY F;  4G6Q A;  5E8I A;  1MNE A;  1LJ9 A;  3AG2 H;  1TZL A;  2L9N A;  5FKL A;  3D5S C;  2LF7 A;  3FHZ A;  3BZC A;  3RQI A;  3OYK A;  1Y39 A;  1VQ7 I;  2FML A;  2BY2 A;  2ZNY A;  4KIB A;  4ESJ A;  4BNC A;  4XBF A;  2CV0 A;  1KU3 A;  1B72 B;  1ZLJ A;  4PK4 A;  4IRG A;  4V2F A;  1LKX A;  3C18 A;  4LK0 F;  3TP0 A;  1CGP A;  1UEL B;  3FMQ A;  3GX4 X;  3ZN1 A;  2WWY A;  3K69 A;  1TWG J;  5CLS A;  3IKT A;  1FEX A;  1CF7 B;  4DZP A;  4YEJ A;  1TT0 A;  1R23 A;  1KU2 A;  1EF4 A;  3V4G A;  1HKQ A;  5L3D A;  4HV5 A;  1OFC X;  2L4A A;  3BG7 A;  2XAU A;  4LIT A;  4ZZL A;  2HYJ A;  5E1Z B;  1OR7 C;  2DBB A;  2IA0 A;  2NNY A;  2ZKZ A;  3CCR I;  4ZTJ A;  3W6V A;  2IJL A;  2Z5U A;  4KIC A;  3W2W A;  4B3A A;  2IP2 A;  1RKW A;  4RB0 A;  1DGR M;  2KIU A;  2K9N A;  3OYH A;  4C3I J;  1FWZ A;  3MKZ A;  1T0F C;  4I02 A;  1ACI A;  2E2I J;  3TW6 A;  4HSR A;  1ZG3 A;  3H3V K;  4CIC A;  2WAQ A;  4HNV A;  5FRN A;  5K7Z A;  5F0F A;  4NQW A;  1IO2 A;  4BJ5 C;  2Y0S A;  3IKV A;  5GAE J;  4ON0 A;  4OIR F;  4AVP A;  2JRT A;  1YRN B;  2CUJ A;  2IGO A;  2P81 A;  1F4K A;  1AU7 A;  1BW5 A;  3LL7 A;  5BQT A;  5HOD A;  1V55 H;  3WHC A;  3L2C A;  2L4M A;  3IH2 A;  1TQM A;  3OS2 A;  2GZW A;  1QVT A;  4G6D A;  2DOD A;  2HR3 A;  1ETX A;  3ABK H;  3WGI A;  3KFW X;  1T2K A;  3SZT A;  3HB9 A;  3OYB A;  2CG4 A;  2X1C A;  3CJQ B;  4LMY A;  2VLA A;  4XM3 A;  1L3L A;  2EQR A;  4U0W A;  3UNG C;  1S72 I;  1ZGW A;  4MQV A;  4ZYE A;  4N9I A;  3RZO J;  2FBH A;  3GME A;  5FGM A;  4BHB A;  4XRF A;  1MD0 A;  3F3X A;  1JXS A;  4IKF A;  5B5E C;  2HOS A;  5B1B H;  1XSX A;  3G71 I;  1I6H J;  3HIF A;  1G2H A;  4L5J A;  2MLG A;  3L2V A;  1J2X A;  2FOK A;  3RPU A;  1BOB A;  3B6A A;  4YIF A;  1FTT A;  1HA8 A;  2ADU A;  2OU2 A;  1A6Q A;  5J8C A;  4QPO A;  2ECC A;  2H94 A;  2P5V A;  3BPV A;  1WFX A;  1RIO H;  2DTR A;  1ETQ A;  4NC6 A;  1MMG A;  3S3N A;  1JE8 A;  2ZJP F;  4XLC A;  4A3K J;  4HPQ A;  4D7M A;  1RI7 A;  3IRQ A;  4PCQ A;  2NS7 A;  4CYC A;  2WB1 N;  4RAY A;  1FSH A;  2CQN A;  3RJP A;  1OCR H;  3FIS A;  2CW0 F;  1QQI A;  1JUM A;  2KFD A;  1ZRE A;  2HNH A;  2QCO A;  2QGU A;  3KE2 A;  3H92 A;  3GLL A;  4CCN A;  4YFN F;  4OMY A;  1JKP C;  2IS1 A;  4I99 C;  2VOD A;  3BG9 A;  1EH8 A;  3JRF A;  1GLN A;  4BXX J;  4P96 A;  3P7N A;  3HPH A;  2MFZ A;  3BG5 A;  1BC7 C;  3BZ6 A;  1E3H A;  4XL9 A;  2E1M C;  2DCE A;  2VXD A;  3Q3S A;  3GWZ A;  4M3G A;  4A3C J;  1IN8 A;  1LFP A;  2MYS A;  5K5O A;  4JYK A;  3HZJ A;  4CCM A;  3FWE A;  4D0P A;  3GTL J;  5CVI A;  5L3C A;  1OKR A;  4XKV A;  2KP6 A;  3T0Y A;  5LGN A;  5LEK A;  2JPC A;  4BEH A;  5F08 A;  5CPR B;  1UG2 A;  2IXS A;  2P7V B;  4Z6Y A;  3JRC A;  1V5F A;  2LK2 A;  2DPD A;  2MAB A;  1FBQ A;  3JTH A;  4XON A;  5CKT A;  1OCC H;  3ZQI A;  3KIO A;  2K4J A;  4LLG F;  3HTS B;  1O3S A;  1ZAO A;  1D5Y A;  1LFU P;  4M6X A;  4KNY A;  5F27 A;  2GA2 A;  1WJB A;  3NAU A;  4HQE A;  4ZZD A;  2JA8 J;  5FFZ A;  2CWE A;  3Q5F A;  2L02 A;  4HNU A;  1GHC A;  1FBS A;  2WAQ N;  1D1A A;  3FIW A;  4EM0 B;  1I3Q J;  3REO A;  1YIJ I;  4PFP A;  1T08 B;  3M7G A;  2MG4 A;  4HQM A;  2L7K A;  4QPQ A;  4FHT A;  1BI2 A;  4CCL A;  1IW7 F;  2YSR A;  4D9J A;  4V2G A;  5IYD J;  2M0C A;  1BI0 A;  1GXQ A;  1QNT A;  1A35 A;  1I6X A;  1I27 A;  3HKZ A;  4PJN A;  3TDU C;  5CVV A;  1R4N B;  4A3E J;  4I98 B;  1QHG A;  2K4B A;  4HF0 A;  4UVB A;  1X4O A;  4C9Y A;  3M8J A;  4TV7 A;  4II2 A;  3BQY A;  3DWL E;  3NRV A;  1ETV A;  2LSO A;  2JSP A;  4FE7 A;  4HF1 A;  1REP C;  2CO5 A;  1TWF J;  4XRS A;  3J80 K;  4M74 A;  2Z3Y A;  3KP4 A;  1FIA A;  1PYV A;  4EGY A;  3HG9 A;  4EM2 A;  4F52 A;  2E19 A;  3F9K A;  4GRI A;  3HL2 A;  2VQH A;  2K9Q A;  1YOV B;  4DBR A;  1I1S A;  3GLX A;  3AFH A;  4UB6 C;  1YX5 A;  3CD6 I;  3G2B A;  5FJ8 J;  4KYW A;  1J09 A;  1P6R A;  3FMS A;  3K10 A;  4C3H J;  5KCM A;  2L2O A;  3W2V A;  4B47 A;  1AKH A;  5HLT A;  4O3M A;  4OIO F;  1UG0 A;  1HLV A;  1Z21 A;  2E71 A;  1IAW A;  2DFI A;  2CGP A;  3LAP A;  1WVR A;  2DAO A;  5F1R A;  5FFX A;  3HXL A;  2OAZ A; 
#chains in the Genus database with same CATH homology
 1X2N A;  1VND A;  4W97 A;  1HCR A;  4JX5 A;  2IAI A;  4G12 A;  4RBO A;  2G0E A;  1ZKG A;  5C4J J;  3WHB A;  2NVQ J;  4A3B J;  1U8B A;  4L5E A;  1JJ8 C;  3DEW A;  1IUF A;  2ELK A;  4GFB A;  3BR0 A;  3RKQ A;  1BW6 A;  3BR2 A;  3GTO J;  2IEK A;  4DYR A;  4Y52 J;  4J19 A;  4FCY A;  2AO9 A;  3A01 B;  5IP6 A;  5EG0 A;  1UHS A;  1HOM A;  3JRI A;  4DZJ A;  1TWH J;  2FX0 A;  2OPT A;  1IDZ A;  4FTH A;  3LOC A;  2K40 A;  2ME6 A;  1ETK A;  1JGG A;  1RPW A;  2AHQ A;  4QTR A;  4A3M J;  4QSH A;  2LVS A;  2R5Y B;  3NAR A;  1FJL A;  2X6O A;  3OSF A;  1WH5 A;  1IDY A;  2FD5 A;  4C2M J;  1B8I B;  2LR8 A;  5DTD A;  3IV5 A;  1IV6 A;  4W1U A;  1CQT A;  4D7N A;  3H0G J;  1JT6 A;  4XK4 A;  3G1O A;  1NK3 P;  2LLK A;  1IRZ A;  3JRA A;  1ZR4 A;  3PO2 J;  9ANT A;  1PUF A;  2L7F P;  3DCF A;  2DMU A;  1XG1 A;  3HM5 A;  5M3M J;  2EZH A;  4AYB N;  1OCT C;  2R0Q C;  1WI3 A;  2JJ7 A;  1IG7 A;  3JR9 A;  2QF7 A;  3LSR A;  2VUM J;  3CMY A;  1MH4 A;  3BR5 A;  5C44 J;  3O8G A;  1WCM J;  3JRH A;  2CUF A;  1W0T A;  3HEF A;  3HKZ N;  1ZQ3 P;  1JKR C;  2L7Z A;  2PMZ N;  4ABZ A;  4XRM A;  5E3O A;  2L0K A;  4BBS J;  1JJ6 C;  5C4X J;  4AC0 A;  5EGO A;  3JRB A;  4A3G J;  3OOU A;  1MBK A;  5E3N A;  5EG0 B;  1OCP A;  4IEJ A;  3E7L A;  1JKQ C;  5K7H A;  1JUP A;  3HGG A;  2R7Z J;  1AKH B;  2GBY A;  1Y1V J;  2XRL A;  4MIM A;  1GUU A;  1MBE A;  2JA7 J;  1DU6 A;  2Y2Z A;  2CUE A;  2MW8 A;  3C2B A;  5IP9 J;  2E2H J;  5IYC J;  1K83 J;  5K7F A;  4M3D A;  2TRT A;  1GV2 A;  2XPU A;  3OSG A;  5FLM J;  3S15 J;  1H8A C;  3HOX J;  5EZH A;  3O8H A;  4D5C A;  3HBL A;  1PUF B;  2JMW A;  3BR3 A;  4MO7 A;  1X2M A;  3A03 A;  2M9H A;  2L9R A;  2XB0 X;  1WGX A;  2Y9Y A;  1GV5 A;  1BJZ A;  3GTP J;  3A01 A;  1A6I A;  4X6A J;  3GTM J;  5GP9 A;  4IHV A;  3G1L A;  3SDG A;  1JKO C;  5F04 A;  1TWA J;  3I4N J;  5FKK A;  2NVY J;  1U78 A;  3PO3 J;  1SAN A;  2R5Y A;  3HOW J;  2D5V A;  2XGE A;  3JRG A;  1QPI A;  3S1Q J;  3TW7 A;  1MSF C;  4BKX A;  1SFO J;  2JA5 J;  3HDD A;  2Y9Z A;  2HOA A;  4S0H B;  4RDU A;  1BA5 A;  3Q0V A;  3S1M J;  3JRD A;  1DU0 A;  1YRN A;  2DMT A;  2GLO A;  2N8G A;  4B1R A;  3F0C A;  5J1Y A;  4A3F J;  2YUS A;  2DA7 A;  2K9S A;  1JT0 A;  4JX6 A;  4DYQ A;  5IOY A;  3S1N J;  3TP3 A;  1HF0 A;  2O8K A;  4BY7 J;  5C3E J;  1H88 C;  1MSE C;  3S14 J;  2NVT J;  3G1M A;  1Q1V A;  1O4X A;  1FIP A;  2DMN A;  1X58 A;  2ID6 A;  2ME0 A;  3CDL A;  4XIC A;  2JK3 A;  2O9L A;  3D1N I;  4M3F A;  2LKX A;  3S2H J;  5M5X J;  1R9T J;  1MBF A;  2XPW A;  4DW6 A;  4B4C A;  2IBD A;  1LE8 B;  5F1J A;  3BTJ A;  5EEA A;  3S17 J;  2EZK A;  3BQZ A;  1TWC J;  2VKE A;  2HOT A;  3TED A;  2EBI A;  1VI0 A;  1A5J A;  5FKL A;  2FJ1 A;  3QPL A;  2XGC A;  5JLX A;  4MFD A;  3RQI A;  3HOV J;  5J1U A;  2JA6 J;  1ETO A;  3S16 J;  1B72 B;  2LP0 A;  5IYB J;  5EDN A;  2HDD A;  1VF9 A;  4A3I J;  2DA3 A;  3BR1 A;  4V2F A;  3UKG A;  1VFC A;  3TP0 A;  1ORK A;  4UUS B;  1ZTR A;  5E3M A;  4MLO A;  1TC3 C;  1TWG J;  1FEX A;  4DZP A;  2L7M P;  1ETW A;  2R5Z B;  5EZG A;  3M3Y J;  1EF4 A;  1S7E A;  2ID3 A;  1IJW C;  1OFC X;  2WV1 A;  1ZK8 A;  3GTQ J;  3BTL A;  2DTZ A;  1LFB A;  1APL C;  2HYJ A;  5J1R A;  3W6V A;  2YS9 A;  4B3A A;  1H89 C;  1RKW A;  1JUS A;  2K9N A;  4C3I J;  2E1O A;  3Q0U A;  4JP0 A;  3K7A J;  2R93 J;  2JWT A;  2E2I J;  2CQQ A;  3TW6 A;  1IC8 A;  4M6V A;  3I4M J;  1XS9 A;  3H3V K;  4CYC B;  4UUT A;  4FIS A;  1U9N A;  4HNV A;  3GTG J;  5K7Z A;  2MGQ A;  2O7O A;  5F0F A;  1GT0 C;  1QVU A;  5IOZ A;  1T33 A;  1YRN B;  2XGD A;  2GM4 A;  2TCT A;  5M5Y J;  2P81 A;  1AU7 A;  1BW5 A;  2HQ5 A;  2DA4 A;  5HOD A;  3WHC A;  2JN6 A;  1IGN A;  3IH2 A;  1ETY A;  1QVT A;  2EZI A;  5J3L A;  4A3L J;  1B72 A;  4IHY A;  1ETX A;  1ITY A;  3FKI J;  3FK6 A;  2LTP A;  2MSY A;  1WPK A;  1MBG A;  5IP7 J;  4NDL A;  3HB9 A;  5E3L A;  1I50 J;  4A69 C;  2EQR A;  1ZGW A;  3K2A A;  3RZO J;  3GBG A;  2DA1 A;  4BBR J;  3LSG A;  2Y30 A;  3LSJ A;  2DN0 A;  2HOS A;  1LE8 A;  1I6H J;  4AUX A;  1QRY A;  1MBJ A;  1G2H A;  2OF7 A;  3ZQG A;  4JX4 A;  1P7I A;  3PM1 A;  2EZL A;  2I10 A;  3B6A A;  5M5W J;  1FTT A;  1ENH A;  3FK7 A;  2CJJ A;  2ECC A;  3BG3 A;  4IHX A;  2DMQ A;  3LSP A;  2DA6 A;  3ZQH A;  1GVD A;  1ETQ A;  3MKL A;  3GTK J;  4A3K J;  4D7M A;  4A93 J;  1UMQ A;  2NS7 A;  4CYC A;  2WB1 N;  3L1P A;  3SFI A;  1JTY A;  3FIS A;  4UUS A;  1JUM A;  2QCO A;  4XID A;  4A3J J;  3A02 A;  2CRG A;  2M8G X;  4Y7N J;  1RET A;  3JRE A;  4EEF G;  4BY1 J;  2NS8 A;  4XRS G;  3LNQ A;  1JKP C;  2R5Z A;  3BG9 A;  3JRF A;  1Z77 A;  3ZQF A;  4BXX J;  5M3F J;  2NOG A;  3BR6 A;  5F0C A;  2DA5 A;  1MBH A;  3BG5 A;  3GTJ J;  1Z0X A;  1RR7 A;  1F36 A;  4I6Z A;  3VPR A;  3QQA A;  3S2D J;  3M4O J;  3Q3S A;  2H1K A;  4M3G A;  4A3C J;  1P7J A;  2H8R A;  4JYK A;  3B6C A;  5JLW A;  3GTL J;  3Q0W A;  2VKV A;  2RAE A;  4I76 A;  2KT0 A;  1K61 A;  2XB5 A;  3QPS A;  2R92 J;  5F08 A;  2VI6 A;  1UG2 A;  5GPC A;  3JRC A;  1OJL A;  2LK2 A;  2B63 J;  3HOY J;  2XPV A;  1WH7 A;  3ZQI A;  1FTZ A;  4MFE A;  2CQX A;  1T56 A;  3S1R J;  2Y0S N;  1D5Y A;  1LFU P;  1AHD P;  5F27 A;  5GPA A;  3NAU A;  2JA8 J;  3BTI A;  5EYR A;  2WAQ N;  3FIW A;  4DYC A;  3IH4 A;  2LD5 A;  1NK2 P;  1I3Q J;  2FQ4 A;  5FKO A;  2COB A;  5FKM A;  1POG A;  2MG4 A;  2X48 A;  4M3B A;  2KDZ A;  3BTC A;  2E2J J;  4V2G A;  2ECB A;  2Y31 A;  1W0U A;  5IYD J;  2M0C A;  4IHW A;  1MNM C;  3ZOB A;  4C3J J;  2LFB A;  5BNG A;  5IPA A;  5EF6 A;  2DA2 A;  3MN2 A;  3ZQC A;  4A3E J;  3SJM A;  3IH3 A;  3BQY A;  1F43 A;  5FLV A;  1NTC A;  1RKT A;  1ETV A;  4M3E A;  4FE7 A;  5FKN A;  1TWF J;  4XRS A;  2HXO A;  1MH3 A;  1FIA A;  5F0H A;  2DMP A;  1JTX A;  4FE4 A;  3HOZ J;  2HXI A;  2E19 A;  1B8I A;  1XC5 A;  2CU7 A;  2K9Q A;  3CCY A;  2XSD C;  5EGO B;  1E3O C;  3HOU J;  4X1E A;  5FJ8 J;  4LOC A;  1ZR2 A;  1Y1W J;  4D5F A;  1HDD C;  1RES A;  2DJN A;  2M2E A;  2X9D A;  1GDT A;  3CQZ J;  3OIO A;  2ZB9 A;  2W48 A;  1BL0 A;  2LY9 A;  4C3H J;  2HI3 A;  5DS9 A;  3RZD J;  2VPR A;  3ZQL A;  1AKH A;  1U9O A;  2YU9 J;  3BT9 A;  2EH3 A;  2M34 A;  1HLV A;  3HGY A;  3MVP A;  2NVX J;  1HDP A;  4A3D J;  4QIW N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...