3MKLA

Crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
QPNMRTRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HTH-type transcriptional regulator gadX
publication title Crystal structure of DNA-binding transcriptional dual regulator from Escherichia coli K-12
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 35
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00165 HTH_AraC Bacterial regulatory helix-turn-helix proteins, AraC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mklA00
2FX0A 3BTCA 3S2DJ 3SFIA 1LFUP 3MKLA 1T33A 2MSYA 1ETWA 1B8IA 3QPSA 3S16J 3LSGA 3WHCA 1AU7A 3GTJJ 1FTTA 2XB5A 3HM5A 5E3NA 2DA3A 3SJMA 4QSHA 1MBJA 1CQTA 1WGXA 3FK6A 3W6VA 4DW6A 2WB1N 4M6VA 1P7IA 1LE8A 3HOZJ 2LKXA 3ZQLA 5F04A 2KDZA 1ZR2A 1OFCX 1RR7A 3IV5A 4BY7J 2LP0A 2LTPA 5JLXA 1IJWC 1D5YA 4M3FA 2HI3A 5EGOA 1MNMC 3O8GA 1QVUA 2CRGA 2K9SA 1G2HA 2R5YA 3LOCA 2VI6A 4IHWA 5HODA 3BT9A 3HGGA 1Z0XA 4MFDA 3HOXJ 1E3OC 1JUPA 1XC5A 1FIAA 4BBRJ 4DYRA 4RBOA 4A93J 3BTIA 1VF9A 4BKXA 2R5ZA 1TWAJ 3JRCA 4A3IJ 3GTMJ 3OSFA 4A3BJ 3S17J 2R5ZB 2RAEA 2JA8J 5M5WJ 1VI0A 3JREA 3LSJA 3K7AJ 1WH7A 2XGDA 1ETQA 4XIDA 3BR3A 2DMQA 4C3IJ 5DTDA 2AHQA 3BR5A 3JRAA 2ELKA 3K2AA 2X9DA 3HOYJ 2IAIA 1RPWA 1YRNB 3TP3A 2E2HJ 2XPWA 4UUTA 3IH2A 2QCOA 3FISA 3HEFA 1APLC 2H1KA 4I76A 3LSRA 1BL0A 1ZTRA 1Z77A 3E7LA 3RZDJ 4EEFG 2QF7A 2HOSA 1A5JA 4JP0A 1FTZA 2M0CA 3BTJA 2GLOA 4X1EA 3C2BA 4B3AA 4XRSG 5F1JA 4C2MJ 2OF7A 4X6AJ 4M3GA 2Y0SN 2CJJA 1IGNA 1IG7A 2M34A 3GTQJ 5FKNA 4J19A 5BNGA 4XK4A 1F43A 3BR2A 3A01A 3ZQHA 1MBEA 2LFBA 4BY1J 3HDDA 2DMNA 4AUXA 1IUFA 1QPIA 2IEKA 3S1QJ 2JWTA 5IP6A 1JT6A 5F0CA 3VPRA 1BA5A 3DCFA 1UG2A 1NTCA 4RDUA 5JLWA 4B1RA 5IOZA 1UHSA 5F0FA 2GM4A 3S14J 1MH3A 4V2FA 2DN0A 1IDZA 5M5XJ 2XSDC 4IHYA 2NVTJ 1ZK8A 3RQIA 3PO3J 2MG4A 1POGA 2CQQA 1BW6A 3GTKJ 1I50J 1I6HJ 1ETKA 4W1UA 3JRHA 3TP0A 1W0UA 3S1NJ 2L7FP 1IV6A 1MSEC 3I4MJ 3RZOJ 3HOUJ 1GUUA 2P81A 5F08A 1HLVA 4FISA 3RKQA 2L7MP 1S7EA 1VFCA 1TC3C 2DA7A 2M2EA 3OSGA 1ITYA 2O9LA 1HDPA 3ZQCA 2LK2A 1DU0A 4C3HJ 2I10A 2VKVA 1PUFB 2LLKA 1JT0A 3LNQA 5EEAA 4G12A 3ZQGA 3TW7A 1WPKA 5IYCJ 1IC8A 2XGEA 2XGCA 2G0EA 5J1YA 3BR0A 5C4XJ 3TW6A 3BQZA 5K7ZA 2JK3A 2PMZN 4QIWN 1XG1A 3H3VK 2DTZA 1P7JA 2FQ4A 4UUSA 1X2NA 2JA5J 5FLVA 2HYJA 1ETYA 1IRZA 3ZQFA 4QTRA 3S1MJ 4UUSB 1X58A 3BG3A 3BQYA 4LOCA 1RKTA 1A6IA 2DMUA 3FIWA 3Q0UA 4D5FA 1I3QJ 2CU7A 3SDGA 4D5CA 3S15J 2JA7J 2ME0A 1DU6A 2L9RA 1JJ6C 2FJ1A 3B6CA 4A3KJ 2DA1A 5FJ8J 1H89C 5J1RA 4XRMA 4A3FJ 1ORKA 4DYQA 1YRNA 2H8RA 5FKMA 3LSPA 1U9NA 2E1OA 2WAQN 5EG0B 3HOVJ 1MH4A 2DA2A 2NVXJ 3M3YJ 3CCYA 4D7NA 2R7ZJ 2R92J 1NK3P 3FK7A 2CUFA 2MW8A 2ECBA 3CMYA 5FKLA 4A69C 2B63J 2JN6A 4M3BA 1AKHB 3G1LA 2DA4A 2ID6A 1OJLA 2W48A 1GVDA 2X48A 3CDLA 5J3LA 4Y52J 2DA6A 2EZLA 3S1RJ 1U78A 4AYBN 4NDLA 5FKOA 2L7ZA 3CQZJ 3MVPA 5M3MJ 2MGQA 5DS9A 1JKRC 3GTLJ 1EF4A 1B72A 3L1PA 1NK2P 4DYCA 2XPVA 3JRBA 2O8KA 1BJZA 2EZHA 1ZGWA 3PM1A 1B72B 4I6ZA 3MN2A 2EBIA 1JUMA 5GPAA 1FJLA 1ETOA 3OIOA 3JRGA 4CYCB 3GTOJ 5IP7J 3HB9A 1ETXA 1X2MA 3M4OJ 4L5EA 1JKPC 1GV2A 5M5YJ 3JR9A 1UMQA 3HGYA 4JYKA 5GPCA 4FCYA 1W0TA 2CQXA 3GTGJ 1MBFA 1IDYA 3G1OA 2TCTA 4A3GJ 2LD5A 2CUEA 5K7FA 2VPRA 4MIMA 3FKIJ 2HOAA 2O7OA 1WCMJ 3PO2J 1ETVA 3H0GJ 3B6AA 3ZQIA 3UKGA 2R93J 1TWCJ 3BG9A 4FTHA 4JX6A 1WI3A 4FE7A 1RETA 1AHDP 1HOMA 3D1NI 4A3LJ 2YUSA 2ECCA 2HXIA 2HDDA 4MFEA 2OPTA 1PUFA 2K9NA 4DZPA 2K9QA 3IH4A 1R9TJ 2VKEA 4Y7NJ 2LR8A 3WHBA 2Y9ZA 1OCTC 5K7HA 5E3MA 2DMTA 1GT0C 2Y9YA 3O8HA 1RKWA 2JJ7A 2YS9A 1B8IB 5E3LA 4A3MJ 2TRTA 1H88C 1HCRA 4MO7A 3JRIA 3NAUA 2NVQJ 2FD5A 1MBHA 4XRSA 3BR6A 4XICA 4IHVA 1LE8B 2JA6J 4JX5A 2E19A 4JX4A 1T56A 4IEJA 1TWFJ 5EGOB 9ANTA 2KT0A 1Q1VA 2LVSA 1HDDC 1SANA 2DMPA 2IBDA 3ZOBA 1QVTA 1HF0A 2R5YB 4A3CJ 4DZJA 2ID3A 2X6OA 4AC0A 3QQAA 1FEXA 3GBGA 2DA5A 2HXOA 5EG0A 1VNDA 1JUSA 5E3OA 5IPAA 2D5VA 2L0KA 4BBSJ 5C3EJ 3BG5A 2N8GA 3TEDA 3JRDA 3BR1A 3JRFA 1ZR4A 5IYBJ 3Q3SA 2LY9A 4BXXJ 2DJNA 2XPUA 4B4CA 5EF6A 1Y1VJ 1JJ8C 3GTPJ 4V2GA 1GV5A 1AKHA 3HKZN 5GP9A 4HNVA 4IHXA 2VUMJ 4GFBA 4A3DJ 1MBKA 1XS9A 2Y2ZA 1TWHJ 1F36A 2HQ5A 3IH3A 2EH3A 5IP9J 5FLMJ 1U9OA 1WH5A 1Y1WJ 1JTXA 1TWGJ 1GDTA 1BW5A 3G1MA 1LFBA 3Q0VA 5C4JJ 4W97A 5FKKA 2COBA 1SFOJ 4C3JJ 5EZGA 2EQRA 2NS8A 2ZB9A 3DEWA 1MSFC 2NOGA 4A3JJ 2XRLA 5F27A 1JTYA 1H8AC 3NARA 2GBYA 3Q0WA 1O4XA 4FE4A 2XB0X 2AO9A 3HBLA 2HOTA 1JKOC 4MLOA 3BTLA 1FIPA 1ZQ3P 2ME6A 2R0QC 4CYCA 3A03A 4A3EJ 1K83J 4M3DA 2Y30A 2Y31A 2E2JJ 5M3FJ 2NS7A 4ABZA 3HOWJ 3I4NJ 1U8BA 1ZKGA 3A02A 5F0HA 1RESA 2E2IJ 4D7MA 5J1UA 3S2HJ 1ENHA 3A01B 1QRYA 2M9HA 5IOYA 5EZHA 2EZIA 1OCPA 3F0CA 5EYRA 2WV1A 5IYDJ 2JMWA 4S0HB 2NVYJ 3OOUA 2M8GX 3QPLA 1MBGA 2EZKA 5EDNA 2K40A 5C44J 1K61A 1JKQC 4M3EA 1JGGA 2YU9J
chains in the Genus database with same CATH superfamily
3GVAA 1E17A 4HG2A 1FOWA 4U0VA 4R79A 3FM5A 1T33A 5ICEA 3ASNH 1EV7A 3LSGA 4BDYA 3KCCA 3JCUC 3K4KA 2JT1A 3HM5A 4HAMA 3NWTA 2P7CB 1MBJA 1HW1A 1WGXA 3FBIB 3CCLI 3WTXC 2WB1N 2DJIA 2QYOA 4N4NB 3T8TA 3DP7A 1IRGA 1B6AA 2OCCH 3SYTA 2HGCA 3FKJA 3H9GA 4CXFA 3U2RA 2MFZA 1RR7A 3IV5A 4BY7J 1FMVA 5ILVA 4M3FA 3SQNA 2RQQA 4BUPA 1QVUA 4LLLA 5HLGA 3HHGA 1PYVA 1ZGAA 5DUIA 2Q1ZB 3A0BC 4HLYA 1SFUA 4IHWA 1Z05A 4YIIA 5HODA 3GZNB 3HGGA 1SD4A 1VQ5I 4BJTA 3F3XA 4NHJA 3A1YA 1KYZA 2CV1A 2CYYA 2J5PA 3KP2A 4XONA 1VF9A 3GTMJ 1TWAJ 3A2KA 2PI0A 4J01A 1KYWA 1MMAA 3K4LA 4QPOA 2R5ZB 2JA8J 2WA0A 5M5WJ 4KICA 3JREA 3LA3A 3K7AJ 2GQQA 2NNYA 1ETQA 4EGYA 2DFHA 4BHPA 2STWA 3BR3A 2DMQA 2K3PA 3DBLB 2X85A 3VSKA 1WJFA 3ZQ7A 2ELKA 3K2AA 2X9DA 4CGZA 1TQMA 2HDWA 3GXOA 3F8CA 1R49A 1BIBA 4C2UA 3DKYA 1XTAA 1OLTA 3ZCOA 3TP3A 1R5HA 3GO5A 4AIDA 3IH2A 3B02A 3HEFA 3QPHA 2H1KA 3CP8A 4I76A 1MGTA 1IV8A 2RDPA 1BR4A 3AAFA 3VWBA 1QU3A 3PSFA 3N05A 1FTZA 4F7ZA 1LVAA 2GLOA 4NB5A 4B3AA 3GYHX 4H0EA 3I59B 6PAXA 3T8RA 3K4NA 2XAHA 2DFFA 4ETSA 4BXUA 3GTQJ 5IT9K 3WTSC 3D5LA 3QP5A 1F43A 2O0YA 5LFAA 2Y75A 3QRFF 4D1QA 1MJAA 1OYIA 1FMWA 1T0FC 1IN5A 3ABUA 3HHHA 5AIQA 3HDDA 1VQKI 4M9XA 3QODA 2L54A 3M1CA 2IEKA 1Y56A 5E8IA 2DPDA 1YQAA 4E4HA 3OIPA 2IVMA 4B47A 3BOQA 5F0CA 2Q2EB 3HXLA 3KZZA 4ASNA 3AG4H 3J7ZI 1UHSA 2ZBKA 3HC7A 2E35A 2GM4A 2RNJA 4V2FA 2DN0A 1IDZA 4WF2A 3FMQA 1ZK8A 4L5IA 5CQGA 3PO3J 2Z5UA 2MG4A 1SMTA 4LJZF 4Q47A 4CCNA 2P6SA 4W1UA 1W0UA 1IV6A 3CUQA 4P1WA 4LIUA 3FXKA 1TT5B 1VQ4I 1Z3YA 2K85A 1GUUA 3M7GA 5B1BH 2VKHA 3C3WA 3UR3C 3RQ4A 1CF7A 4RB0A 1IW7F 4I0AA 1S7EA 4YIFA 2EFOA 3BP8A 4OOIA 1VFCA 2M2EA 3I71A 1UG0A 4LGWA 2O9LA 1DU0A 4B3XA 2VC0A 1GLNA 1LUJB 2XF5A 4XN0A 2DOEA 4BGDA 3LNQA 4PJJA 5EEAA 3U1DA 2VJ5A 3HIFA 2GXAA 1N78A 3JSOA 3ECHA 1X1AA 5D8KB 2PMZN 4IRIA 3IWZA 4QIWN 2JZYA 2X6XA 2DTZA 3LSIA 4XNFA 2IRFG 3KFWX 2A69F 3LSMA 1OR7A 2M7AA 2ZC2A 2HYJA 5F1RA 2IJLA 4QTRA 3DU5A 5JHUA 3I9V2 4UUSB 3S1MJ 1AOYA 4LG0B 1X58A 3OS1A 1G4DA 3OS0A 3BQYA 1RKTA 2VPLA 2DMUA 2KQRA 3Q0UA 4KT6A 2M0MA 2DAOA 1Z67A 4CZCA 2CU7A 3H5RA 2LNBA 2L5QA 1SFXA 4PZJA 5DD8A 2R7VA 2FJ1A 3F8FA 2ZXJA 3ABTA 2E1CA 2RC4A 1Z3XA 1JHFA 2H6BA 5FJ8J 2ZKZA 4DGWB 2OZ6A 1ZRDA 5J1RA 1ORKA 3TO7A 1TBXA 1LB2A 3HRUA 5EG0B 4P55A 5JR3A 2DA2A 3M3YJ 4K2EA 4E7LA 4D7NA 5HNHA 4NNJA 2R7ZJ 4G94A 1NK3P 3MMYB 4FX4A 3CMEI 4RLFA 3P9IA 1P2FA 4KISA 5FKLA 3MZYA 4HF0A 3ZGKA 2PJRB 2JN6A 2XAUA 3CLOA 1OISA 1TLHB 3DBRB 3BWGA 3V4GA 1DP7P 4F92B 3HTSB 2QENA 1FP1D 3CDLA 5J3LA 4AD9A 2E1MB 2M1BA 2L2OA 2M4KA 4AYBN 2E7WA 5FKOA 2L7ZA 3S3NA 2V1NA 2ISYA 5DS9A 4UVAA 2ZJRF 4BDZA 3KP7A 1SD6A 2EFNA 3GTLJ 3ZP5A 3SZGA 1NK2P 3JRBA 3RKXA 2MLKA 4B44A 1ZGWA 3PM1A 3OYKA 2AQEA 1B72B 4I6ZA 5E79C 5DDGA 3MN2A 2H6CA 2OUMA 2CS3A 2EBIA 5DEQA 3L2CA 2X6WA 2Z99A 1ETOA 3CCEI 2LBFB 1IN6A 3MKYB 2CUZA 2HZTA 4XLEA 2P4WA 5AONA 2CGPA 3K70C 1YLFA 2AXTC 4L5EA 4PJMA 5M5YJ 1XGSA 3JR9A 3W6JB 1ZLJA 3ECOA 4FCYA 2MABA 3M8JA 1U0JA 1BI1A 4MGRA 3GTGJ 1MBFA 2VBZA 2QQ9A 4KFCA 4RGXA 2TCTA 4G7OF 5IT9Z 2CUEA 2O7OA 5B5EC 1WCMJ 2QSGX 2OQRA 2VBWA 3J7AO 2UXXA 3B6AA 4I98B 3OMYA 1MMDA 3EQLF 1K4TA 4IQJA 2OA4A 2OV7A 3E5UA 1RETA 2L9SA 2W25A 3TGNA 3OY9A 1HA8A 4OU0A 3D1NI 2GA2A 1I1GA 2ZNZA 3G3ZA 5BQTA 2DFIA 4MFEA 2OPTA 1PUFA 2DDAA 2HDDA 1UAAA 2KFDA 3IL2A 1ZAOA 2LR8A 1OCTC 2ESNA 3WGIA 3K10A 3HUGB 1UHWA 5J4YA 1R4NB 3CO6C 5DD4A 1O7LA 2VJIA 3I58A 1FC3A 1D0YA 4U7BA 1U5TC 5D8LB 4MO7A 2ZSIB 4BQAA 1B59A 3OYBA 4PFOA 1VQPI 1ZH5A 1YIOA 2H1LA 5BMZA 4UB8C 1W36D 3PIPF 2JA6J 2P8TA 4XOTA 3WTZA 2Z16A 4CO8A 3KZIC 2FXAA 4OIRF 2W85A 4IEJA 5EGOB 9ANTA 2JVHA 1Q1VA 2I5UA 2KT0A 1FYKA 3TO6A 2OJED 2IBDA 2GXGA 2E36A 5L3CA 4DZJA 3G6EI 1HQCA 1Z7LA 2KRCA 4AIHA 3CCUI 3IUOA 5H20A 3H9QA 3T1BA 2H94A 3S32A 1ZARA 4M6XA 3S2WA 3I3LA 3BG5A 1MKMA 1ZR4A 4ITVA 4A2UA 3Q3SA 1NHAA 2DTRA 4PGGA 1BJAA 1T38A 1YITI 1MNDA 3GUDA 2GWRA 3M1EA 2V1XA 1VZ0A 1F36A 2VQGA 5FLMJ 3RI4A 1Z7UA 4ZH4F 1LDKB 1WH5A 1JTXA 4ON0A 4BJ5C 3E1SA 3QU3A 3G1MA 2DYRH 4W97A 5FKKA 1SFOJ 4XLAA 2EQRA 2ZB9A 1FPQA 4P9FA 2P5VA 2XRLA 1JTYA 4NC7A 3ZN1A 2GBYA 2A07F 2Y48A 3LA7A 3S3OA 2AO9A 3QOEA 1JKOC 4IPAA 3BTLA 1FIPA 1S5LC 5D6EA 4HSRA 4G7HF 1FBSA 4XSZF 1XCVA 4LLNA 2ME6A 4XN3A 3RPUA 4CYCA 2NYXA 3F21A 3C18A 4U88A 1XMKA 5M3FJ 1KONA 5FRNA 3N4MA 3AL0B 1IAWA 3HOWJ 4FHTA 4MEYF 4BXFA 4IZZA 1ZGJA 3LAPA 2FF4A 1RESA 2EIMH 3CC2I 2HNHA 2COMA 3F8BA 1OCCH 3NQOA 3ELKA 2O6GE 1QRYA 1XMXA 5IOYA 1QBJA 4HBLA 1OCPA 5DYMA 4UV9A 5J8FA 3CCJI 4IO9F 4E7KA 1ZHFA 2WADA 3KEYA 3OOUA 3QPLA 4RGUA 2R7TA 2EZKA 5HLIA 2VT2A 5ILUA 2HPIA 4IHTA 2MC3A 3GX4X 1RUOA 1TW2A 2KIFA 2R7QA 3HOSA 3LSKA 5C44J 2YX7A 1K61A 2XAGA 4F52A 2RVCA 2D2WA 3HKZA 3H3UA 1NH3A 1GXPA 2OBPA 2V4JC 2V1DA 3GFLA 3S2DJ 3I4PA 3WGGA 1BI2A 1Q1HA 5K5QA 3P9CA 3OYAA 1B8IA 1S72I 2RNGA 1LJ9A 2XSJC 4A0ZA 2V1UA 2OD5A 4IL6C 1UZCA 4B43A 4BQOA 1FTTA 2CW8A 2IA2A 1U6GA 4QSHA 1CQTA 3VDXA 1G59A 2XC7A 2FRHA 3L7WA 2R7RA 4M6VA 2X4HA 2OU2A 1P7IA 1LE8A 5E8GA 3ZQLA 3DPUA 1ZR2A 3ZR8X 4CCJA 4N4OB 1CGPA 5JLXA 4FETA 2QKMB 1QHGA 4LG3A 2CRGA 2A3SA 2K9SA 4L9NA 4RLQA 3JTGA 1D5VA 3COAC 1RRJA 3F6OA 5TRDA 1MDMB 1E3OC 2R4GA 1XC5A 2CV2A 3V8KA 4E7SA 3VB2A 3GFJA 4DYRA 3RYRA 4RBOA 2FA5A 5KK1A 2R5ZA 1LFPA 3I56I 4ESBA 1VQ9I 1I6XA 3W2WA 2RAEA 1GHCA 2K86A 1K4SA 3VYRB 4XM3A 1ZG1A 1IO2A 3LSJA 4A6EA 4EM1A 2PFBA 1IN7A 3WU0A 1V55H 3ML6A 3BCAA 2P6TA 3ZMUA 3JRAA 2HWVA 1ON2A 3EUHA 2VODA 1ZELA 1G8XA 3LMMA 1RPWA 2O03A 4HX7A 1YRNB 3JW4A 2E2HJ 2XPWA 5FD6A 1W4MA 2QCOA 1R22A 2F5DA 1SVLA 2MLGA 2VE8A 4CH7A 4CZZA 1YFHA 1R1UA 1YW9A 2XAJA 3KE2A 5GTIC 1P9QC 3LSRA 2HEOA 1Z77A 2QF7A 1R58A 2G9WA 1A5JA 4D0PA 4Y17A 2ACJA 3F23A 1ODDA 4EQQA 3ISPA 4JP0A 5F6FA 5LHGA 2M0CA 5F64A 3C2BA 1PP7U 2P5KA 3BG7A 2EA4A 3IKTA 1K78B 1KU3A 5F1JA 2IS1A 4YRVA 2L9VA 3EDPA 4M3GA 3WTTC 1LVKA 3HJEA 1XN7A 3FX3A 3CDIA 2EPFA 3A01A 2E5ZA 4MHGA 2MD0A 1T98A 1QA6A 2DMNA 2IP2A 2L4AA 4BE0A 3CD6I 4M6YA 2A5WA 4EM0B 3Q5FA 2KL4A 2E1MC 4L9VA 4RA2A 1OYWA 4N0BA 4F55A 4GXOA 2K9MA 3DCFA 1UG2A 2M8EA 4ZYHA 1OYYA 5JLWA 4ENKA 5IOZA 1A31A 4L0YB 3K6GA 3M9AA 4R8HA 3L2UA 3I54A 2VONA 3S14J 5M5XJ 2ZXWH 2XSDC 2HKOA 2NVTJ 2R7FA 4C2TA 1RR8C 1IXSB 1POGA 1UB9A 2CQQA 5GAHJ 3HSFA 3OYHA 1ETKA 3JRHA 2L7FP 1A35A 3LL7A 4HYEA 2M5WA 3I4MJ 4JBAA 4EJOA 3OYIA 3CCMI 5J47A 3QWLA 4DNCA 3HOUJ 2P81A 3J7AY 5F08A 5J8CA 4B48A 3KLOA 4AM3A 1W5TA 4BS9A 1W7PD 4IQ4A 2VKVA 3L00A 3RSNA 2Y69H 4EV0A 2DK8A 2HFHA 2LLKA 1USSA 2HTJA 1WPKA 2Y0SA 5IYCJ 4KDPA 2XGEA 1EJ9A 1Y0NA 5J1YA 1TZLA 1YX3A 2JK3A 3I5UA 2KLOA 1SAXA 2A6EF 4NQWB 1TT0A 3K1PA 2IS2A 3OYLA 1WRJA 2FUG2 2BYVE 3MFKA 2FQ4A 4YG2F 3OYGA 3A4CA 1ZRFA 2FNPA 4UUSA 4ZYEA 2R7OA 3I64A 2VXDA 5HVQC 2DDBA 3ZQFA 4BYYA 1MW7A 4KITB 2FEZA 2R3SA 1ERDA 4LOCA 3U9GA 2VQLA 4CCMA 1D1BA 4D5FA 1DPRA 5HDGA 3GCMA 1WQ2A 2IW5A 3S8PA 2ZMEB 2PJPA 1SAUA 1JJ6C 3B6CA 3FXOA 3OYCA 2P0WA 4CHUA 4UHTA 3TDZC 3OOPA 1IZ1A 1FWZA 2A05A 3LSTA 1H89C 4I2OA 4Y33A 4A3FJ 4DIQA 4KNYA 2PN6A 2H8RA 4EGZA 1U9NA 2E1OA 2FBHA 5D5XB 5CPRB 5DUKA 1MH4A 1A04A 3K0LA 3H92A 3HPGA 3TDUC 2KPMA 3FXUA 4NUBA 2MW8A 2ECBA 4LK0F 2O61A 3IAM2 4WX9A 3FDYA 1X1BA 3RDIA 4ZYAA 3CDHA 2H8WA 1T39A 1P4XA 2IPQX 4M3BA 5IT3A 4BH9A 1Z6RA 1FX7A 2YR2A 5CVJA 3SEQA 3G1LA 4RM2A 2E7XA 1OJLA 1GVDA 2M45A 3BPVA 4L9TA 2DA6A 3C2GA 2EZLA 5EEHA 4GYIA 1WI9A 2K5CA 1U78A 1TP4A 1UFMA 1PDNC 2GAUA 4D9JA 2VASA 2VJ4A 1O3TA 3ABMH 1J59A 2XUBA 4KIGA 5K1YA 2OTLI 5DV5A 1TTYA 1B72A 4IX7A 2WY8Q 3BJ6A 4GCVA 2LBFA 1QHHD 3OR1C 2A5YB 3L2RA 2IA1A 1ULYA 2PG4A 3H1CA 3DKXA 2Q0OA 2X0LA 5LBQA 1WJBA 3VFZA 5HOOA 4PK4A 3VEPA 2LG4A 1K6OA 2VXZA 4BEHB 3AG2H 1REPC 4YELA 5FB2A 1J0RA 1TQPA 4M71A 2EB7A 4F3QA 1WHUA 2CQXA 4S05A 3H5NA 2LOOA 4EJVA 3V8LA 2QM3A 4II3A 5L3GA 5BS6A 5K7FA 3GZ5A 2V79A 4BE2A 2DI3A 3AL0C 1HSJA 1ETVA 3H0GJ 3ZQIA 2KRFA 5HLHA 3UKGA 3N97A 4I99C 3BG9A 2R93J 4JX6A 4XKWA 2NOJB 4U87A 4XLNF 4E6KG 1V5GA 3DU6A 3FZVA 3LFUA 3L2QA 3FXRA 3LQRA 1KQ9A 2YUSA 3BLYA 2ECCA 1IF1A 1TQIA 2K4JA 4DZPA 3ULQB 3DXJF 4Y7NJ 1XPXA 2Y9ZA 2VC1A 5J4VA 3TBIA 1RKWA 2YS9A 1BM9A 4HRIA 3X2QH 5E3LA 1IRXA 4WK8F 3AFHA 2PX9A 3HRMA 1VQ8I 3JRIA 3EUAA 3OYNA 2FOWA 2FD5A 1F1ZA 3MWMA 3WE2A 2OQGA 4A0YA 1LEAA 3IRQA 1VQ6I 3C1DA 3PIOF 1FSEA 2QBYA 1G3YA 4JX5A 4U7DA 3ZMTA 3OYJA 2CQKA 2E19A 2XAFA 3LAJA 4L0ZB 4G6TB 4JX4A 3S93A 3BZKA 2HU9A 1G6NA 4ZTFA 3MEXA 1KU7A 4MEXF 1S29A 2LVSA 4RAZA 1EH7A 1HDDC 2DMPA 2IT0A 3QYFA 1QVTA 3GLXA 1YHQI 3BZ6A 1XDSA 2ID3A 2X6OA 4IKFA 3ABKH 4XOPA 3WTVC 4XLPF 1FEXA 3C2HA 2EINH 2HXOA 5E1WA 4FASD 4Y4RA 2D5VA 1PVEA 5C3EJ 3MZ8A 1V5FA 2N8GA 3TEDA 3JRDA 5BPIA 1YIJI 5LRSA 4XL9A 2DJNA 4PCQA 4LB6B 2XPUA 4B4CA 5EF6A 3ERED 1JJ8C 3GTPJ 1T0FA 4HQMA 4XORA 1AKHA 2JRTA 2R7XA 1MBKA 1FYLA 4E7JA 2EH3A 2ZJ2A 4JQFA 3QAHA 2X6YA 1YS6A 3FWEA 2B0LA 1XSXA 3FHNA 1BW5A 3Q0VA 5C4JJ 3J7YJ 3DQVC 5CVVA 5EZGA 2F4IA 5B66C 2NOGA 4A3JJ 1RIOH 3VYUB 4A5NA 4QWQA 5F27A 1O4XA 3CJQB 1S6LA 2FU4A 3E6DA 2HVSA 3K1MA 1U8RA 3H5AA 5KAFC 1R36A 2BY0A 3DBHB 3F9KA 5D4RA 3VYTB 3A03A 1OKRA 2V6CA 4M3DA 1QQIA 2Y30A 2Y31A 4HDVA 2NS7A 1J75A 2PMHA 2ZXIA 3GF2A 3I4NJ 1ZKGA 1WJ5A 1HXDA 3A02A 2DW4A 5F0HA 2UUZA 2VLAA 2E2IJ 5J1UA 5H6QA 3BC8A 1MJ9A 1NG6A 2L01A 2QUFA 2EZIA 2KIQA 2LKPA 3PUBA 3W2VA 4C9YA 1R5GA 4EVIA 2JMWA 2F5FA 2WAQA 4OWRB 2NVYJ 4O5VA 4XKVA 4MQ9F 1RZ4A 1YG2A 3G4SI 2M30A 1Z6TA 1ON1A 1H9GA 2PBIA 2Z1DA 5JFRA 1KU2A 2X1EA 3EPZA 4M74A 2DK5A 2JRMA 2W24A 1JGGA 3ABLH 4FT8A 1LFUP 3BY6A 3M07A 3I0TA 4YIRX 1ACIA 1GVJA 1U2WA 2EIKH 1X4OA 3GTJJ 2MH2A 2Z33A 2XB5A 3CMAI 2OAZA 2KP6A 1EH6A 3KP4A 5E3NA 1MMNA 3CUQB 4QLCU 1T08B 4BHBA 4DW6A 2JQ7A 1HSTA 2DYSH 4MTEA 4HQEA 1TW3A 5GAEJ 1RC9A 3HOZJ 5L3DA 4XKBA 4Y3OA 2LKXA 1Y8RB 2MH9A 3KP3A 3KEOA 3L9FA 1TNTA 3MD2A 3DTIA 3IWFA 4RGSA 2OTJI 2DT7B 4LLGF 1A36A 1XDUA 2LTPA 1IJWC 2HI3A 1MNMC 5D5VB 3O8GA 2RV8A 1FOYA 2EV0A 3DLAA 2RGVA 2R5YA 3LOCA 3CLQA 4B09A 2G7UA 1SVOA 2VI6A 1R1TA 3KYCB 1Z0XA 4MFDA 3ASOH 3AG1H 1JUPA 1USTA 4Z6YA 1LDDA 1FIAA 1HKSA 2AQFA 4HX4A 4BBRJ 1LPQA 1YX5A 1X3ZB 4A93J 4BKXA 1YO5C 2VOPA 3HZJA 3OSFA 4A3BJ 1K79A 3S17J 3QP6A 4KJZA 3DLLF 3E6BA 4EJWA 1WH7A 3GLLA 4HLXA 2LSOA 4F91B 5FLXK 1S8NA 3PNTA 4C3IJ 2LF7A 3SFZA 1DGWY 5DTDA 1W1WE 3BR5A 4CUGA 1T2KA 3HOYJ 1PUEE 2FNAA 4J00A 4IHSA 4F93B 3JAMK 3JSPA 2L7KA 5LRRA 3H0DA 1BR2A 3CF5F 2A68F 3FISA 2ZMEC 3RPQA 3ZMZA 3SZPA 3BZCA 2BW3A 1HBXG 1ZTRA 1V5EA 3ZMVA 2WB1A 3P7NA 3E7LA 3RZDJ 3QU6A 2D45A 4EEFG 2ESHA 2G7HA 3DF8A 2R7DA 4RS8A 2LY2A 4XMYA 5KAIC 1D3YA 1I27A 1LKXA 2VB6A 1IUYA 1BC7C 3BTJA 1KZHA 4X1EA 4G6QA 5EJCA 3GEZA 4XRSG 4KA4A 3RKWA 1IN8A 5FRMA 3JTHA 3J81K 5FROA 3R61A 2QQBA 2E60A 3BDDA 1DGRM 1IGNA 2WWYA 2M34A 3R0JA 3U21A 5LLQA 5FKNA 4BQNA 4BACA 5BNGA 4XK4A 2ICWG 2W82A 3BR2A 1V4RA 2WC2A 4IJAA 3ZQHA 4WCGA 1MBEA 4CDGA 2DQRA 2PMUA 2X1CA 2HR3A 2KIMA 5FFXA 1J2XA 5HDKA 3IRRA 4AUXA 2JSCA 1IUFA 4MNUA 1QPIA 2QLZA 2MYSA 4HV5A 1FLIA 1QO0D 1D1CA 3K69A 4UB6C 2K7LA 5CVUA 3RJPA 5IP6A 3HRSA 4UY8I 2Y0MA 1U5TA 1AA7A 3VPRA 3DV8A 2CWEA 3ROUA 3F8MA 2EIJH 1NTCA 2F5EA 3NEUA 4RDUA 1R00A 4B1RA 5E17F 5F0FA 1VQLI 2ZJPF 5DCFA 1BIAA 1MH3A 4IHYA 1FNNA 4S04A 1YW7A 1B9MA 3DTKA 5LHHA 3SHFA 1O3QA 1D0XA 3GTKJ 1I50J 3MZHA 2BZTA 3CUOA 4XR6A 3FHZA 1SFKA 3PQJA 2A61A 2KMUA 4GGGA 1MSEC 3O3KA 1F5TA 2QQAA 4RMNA 3TMOA 2W84A 1G3WA 1YYVA 1MZBA 2KZVA 2RREA 3EYYA 4RAGA 4ZDPA 1HLVA 3F72A 2VBYA 4WXCA 3RKQA 2L7MP 2DA7A 4X0GA 2FMYA 3KIOA 3MKZA 1ITYA 1HDPA 4G7ZF 2F2EA 5TJJA 1QZZA 2LK2A 4BQQA 2E34A 1BOAA 3C7JA 1PUFB 4DOZA 2M4GA 1KU9A 2D1VA 5CVRA 3WG7H 1JT0A 2YPRA 4G12A 2CO5A 1E3PA 3BR0A 2VT3A 3BQZA 4XSXF 4P9UA 1XB4A 4E7HA 1SFEA 1WFXA 2KHMA 1QPMA 1X1PA 1JE8A 4OIPF 1FBQA 3PNYA 5CKTA 2BE5F 3QYEA 5ED4A 2O5RA 4UVBA 4L9JA 2KJCA 2JA5J 2ZO4A 2R7WA 1ETYA 2V7FA 1IRZA 2CSOA 2DFEA 3FXLA 3BG3A 5TISC 4AIJA 1A6IA 2ZMEA 4IOAF 2KKOA 1R4MB 3V42A 1I3QJ 2VBXA 1HKQA 3SDGA 4D5CA 3S15J 2JA7J 1SMYF 2ME0A 2DOFA 2L9RA 5GAGJ 2CFXA 2DT5A 4IRHA 3PUFA 2WAFA 3IAS2 4BJ6C 2QA4I 2YSRA 1HW2A 2MD5A 1MJBA 2WBMA 4XRMA 1QNTA 2ZFUA 4DYQA 2GOXB 5FKMA 3LSPA 2WAQN 3HOVJ 2GA1A 2BHYA 3CCYA 4CSWA 2R92J 3ONQA 3HOTA 2UXNA 3FF5A 4LMYA 4HF1A 3ESWB 4PFPA 3W2AA 2M87A 2K27A 4XRFA 4EM2A 1STZA 3T5XA 4A69C 2BOLA 2HKXA 2B63J 2UWMA 3PFYA 5HDNA 5FGMA 3DWLE 2CUJA 1B1BA 2DBBA 1HC8A 1BOBA 2OCEA 2TDXA 3I59A 2W48A 1LNWA 2X48A 1S7AA 4ZZLA 5FLXZ 1BI3A 1T8IA 4Y52J 3HSRA 1X3WB 3FMRA 3S1RJ 5CLSA 1O57A 1IRFA 1W7PB 2BEOA 2BVMA 3MVPA 3TO9A 1X19A 2PMZA 1X4PA 3HYIA 4HDUA 4OAYA 2Z3YA 5J40A 1OQYA 2BY3A 1EA3A 3CMMA 2Z2SB 3L1PA 4DYCA 2XPVA 3JAMZ 2O8KA 4UNOA 1Z91A 3CCSI 3WTUC 4NC6A 4R1HA 2JUCA 4LITA 2Q2EA 4Q4ZF 4JK1X 4KN7X 3CCVI 4M9ZA 4M73A 3OIOA 4KT5C 3JRGA 2VOOA 4CYCB 3GTOJ 5IP7J 2IS6A 3HB9A 2DOAA 1ETXA 1X2MA 2Q8KA 3M4OJ 1J5YA 1GV2A 2V9VA 2RKHA 3HGYA 4PSWA 5GPCA 4HPQA 4PDKA 2K9LA 2UV1A 3F8NA 3QYBA 2DCEA 1IDYA 1I5ZA 3Q9VA 2LD5A 4ZC3A 2VPRA 4MIMA 3FKIJ 2HOAA 1Z9CA 1I39A 1S7OA 2IGKA 3F6VA 1DQUA 2HQRA 3V7RA 4KMUX 2W7NA 3OYEA 1TWCJ 2PEXA 1W36C 2HZDA 1MD0A 1VQMI 1WI3A 4FE7A 3LWFA 1E3HA 4YFKF 1Y39A 5FD5A 4A3LJ 1ZN2A 2DT6A 1OCOH 1PP8F 2K9NA 3K70D 2HYGD 2K9QA 4RAYA 3WHBA 2ZFWA 5K7HA 2EK5A 1R7JA 2DMTA 3LQQA 1XMAA 1GT0C 2JVGA 3O8HA 2BGCA 1B8IB 2FE3A 2WV0A 3GWZA 4HOBA 4AYBA 4AVZA 2KRHA 1ONVA 1H88C 1WKMA 4KIBA 3CF2A 1D1AA 1YOVB 3GFIA 4BL0B 2STTA 1S3JA 2NVQJ 2ELJA 2BHZA 3H3ZA 1B4AA 1MBHA 1XD7A 3RPUD 4CCKA 4XRSA 3OYDA 1B9NA 4LG0A 3WODF 4IHVA 4OIQF 1LE8B 3ZMSA 1WJAA 2JPCA 4LIVA 2W4SA 2LREA 3E5QA 5HS8A 1TWFJ 4EJUA 2HQAA 3CUQC 3OV8A 4QPQA 1BN5A 3ZOBA 3DFGA 1G3TA 4HW0A 1QGPA 3TQNA 4A3CJ 4AC0A 3M8FA 1UELB 3GMEA 3ZPLA 1X1DA 3IKVA 1XCBA 3GBGA 4I09A 5EG0A 1VNDA 2XASA 1JUSA 2EILH 1K7AA 5E3OA 3I55I 1SC7A 5KVRA 2F4OB 2L0KA 4BBSJ 1TNSA 3BR1A 3AG3H 2FOKA 2ELHA 3PSIA 3KPHA 5IYBJ 3CTAA 1N75A 1XGOA 2BVLA 5E1XA 3CJRB 4HEA2 2PJRA 4HSTA 1Y1VJ 2CW7A 5LGTA 3U1KA 2JSPA 1GV5A 1WJEA 2ZNYA 3HKZN 5GP9A 4BAYA 4ENMA 2VUMJ 4A3DJ 1XS9A 3BROA 2B7EA 1TWHJ 2HQ5A 1QZYA 3V7SA 5IP9J 2XF7A 1OR7C 4CICA 4GO1A 5JI6A 1U9OA 1T95A 2GIZA 2MC4A 1XSDA 1S9HA 4N9IA 4B8XA 1WZ2A 4OAZA 5DCMB 3OYMA 5JHFA 5LGUA 5GADJ 1GDTA 2XF6A 3KP6A 4IXAA 3KETA 4C3JJ 4P96A 2IS4A 5LD2C 4XLCA 1KQ0A 3R0AA 1H8AC 3REOA 1H9TA 2EFQA 1EH8A 2LDUA 2LH9A 2E71A 2DLLA 4I02A 3HBLA 1A6QA 2HOTA 4V19K 1K6YA 2VQCA 1ZQ3P 1R6RA 2LY1A 2LMDA 4BNCA 1K83J 3PJRA 2E2JJ 4ABZA 1I3AA 2QSFX 1SD7A 3OL4A 4WXHA 1IN4A 3SZTA 4IVNA 5L3BA 3J80K 1Z1DA 3H36A 1LDJA 3L09A 2EJRA 3HRTA 4D7MA 3S2HJ 1ENHA 3I53A 3A01B 2HPMA 2M9HA 2W57A 3HG9A 5HNFA 1VTNC 3WGHA 4RM3A 2HS5A 3FXQA 2E1NA 1XSVA 2M8GX 4AVPA 2V6EA 1YJ9I 1Y6IA 5EDNA 3CC7I 3CCQI 3IHUA 4OIOF 1JHHA 2C6YA 3K4BA 4HNUA 3GFMA 2I8DA 2IA0A 4E7IA 3EYIA 4HV6A 5E1ZB 4GYGA 2KJBA 5FFZA 2LYCA 3ZMDA 3L2VA 4M3EA 2YU9J 2FX0A 3BTCA 4PJNA 3O6BB 3SFIA 1R1VA 3MKLA 1OCRH 3HUGA 2MSYA 1ETWA 3FM3A 2JA2A 3QPSA 3S16J 4KUMA 3WHCA 1AU7A 2KZGA 4HZFA 1VQOI 3ZRGA 2XKOA 3PQKA 3KEQA 2DA3A 3SJMA 5TGTA 4CYDA 4UUVA 1V54H 3CP2A 3FK6A 1WJCA 3RKYA 3W6VA 4IF4A 3SEZA 3OYFA 5DM7F 3E97A 2O8XA 3D5RC 5F04A 1YE9A 3R4KA 1P4WA 3D0SA 4E7ZA 1OFCX 5J6XA 5IY5H 2KDZA 4ENJA 2LP0A 2ZXHA 2K02A 1D5YA 2K3FA 5EGOA 2FBIA 4XLFA 1W5SA 2FSWA 3W3CA 2V9PA 1G2HA 3EUKL 3KZYA 4LK1F 1DPUA 3PNVA 3BT9A 1VQNI 2VJJA 2M7BA 3HOXJ 4L18B 1FSHA 4N9HA 3GW2A 4ENNA 3G71I 4GDFA 3EETA 2F5CA 4YFNF 2KIUA 3BTIA 4A6DA 2ZCWA 4A3IJ 3LA2A 5D4SA 3JRCA 3OR2C 2NS0A 1KGSA 3WU2C 3HPHA 3E6MA 4ZZDA 1VI0A 3CCRI 3WTWC 4XLHA 2XGDA 2QGUA 5H2FC 3PFIA 4UVCA 4XIDA 4UXNA 1XGNA 2QZ8A 1XX5A 4LD5A 1BI0A 4I01A 1YI2I 2AHQA 3MAJA 2L02A 1HKTA 4I7HA 2IAIA 4BE1A 3ZQQA 5L3EA 2XIGA 3G73A 3PL8A 5GTHC 1Y0UA 2DQLA 2VL8A 4UUTA 3TL4X 1FOKA 2CG4A 2MBFA 3VODA 1APLC 3FBNB 1BL0A 4E70A 5K5OA 1IXRC 2HOSA 4OINF 1T6SA 3DPTA 1MIJA 1VQ7I 1BBYA 2WAEA 3MQ0A 2P5LC 2HYFA 2IXSA 4C2MJ 3F22A 2OF7A 4OMYA 4RB3C 4X6AJ 2Y0SN 2CJJA 3M8EA 4ZYDA 2UZKA 1IG7A 2LKSA 4J19A 1FY7A 1OMIA 4RGRA 4DBRA 2XKPA 3OS2A 2FBKA 4JOMA 4ZDOA 4DJAA 4DBQA 4ZYGA 2X1DA 2RQPA 1FOXA 3HL2A 2LFBA 3RCOA 4BY1J 4LB5A 1E0EA 1P92A 5ICFA 3BJAA 3P5JA 3S3MA 3CC4I 1UHMA 2VKDA 2IGNA 5AIPA 4AWXB 3G2BA 3S1QJ 2JWTA 3BPXA 3SDBA 3DTEA 1JT6A 1J09A 2XHKA 1E2XA 3VSLA 5JVGF 1BA5A 2GOMA 5LEKA 5CYVA 2NXNB 2NNNA 2FMLA 3DPLC 3BCBA 1L0OC 2JTVA 3E6CC 1IXCA 2K4BA 4O6JA 2ZSHB 2QKLB 3RQIA 3SXYA 2BV6A 1BW6A 3HSEA 3H35A 1I6HJ 2QVOA 3TP0A 2B9SA 3S1NJ 3J80Z 1L3LA 2CQ7A 3WTYC 2DPUA 2QWWA 1WVRA 3A0HC 3BJOA 5CQEA 3RZOJ 5ILSA 2LRDA 1ZG3A 4A0XA 3T0YA 2CQNA 4FISA 4M72A 2HTSA 4KIFA 4WWCA 1TC3C 4EATA 3OSGA 1CF7B 2AS5F 1R5ID 5D5UB 3H9JA 3ZQCA 1O3SA 1ZRCA 4C3HJ 2I10A 2F5VA 1FYMA 4II2A 3RIRA 4A5MA 4IRGA 1JGSA 2OC6A 2WY7Q 5KCMA 3ZQGA 3TW7A 1IC8A 4Q5SF 1RUNA 2XGCA 2G0EA 4TV7A 5C4XJ 3TW6A 5D6FA 5K7ZA 5DM6F 1N25A 2GXBA 1MDMA 1LQ1A 1R71A 1XG1A 3H3VK 1P7JA 3L2WA 2HVQA 1BR1A 3RTRA 1X2NA 3OWTA 5FLVA 2VE9A 1YJNI 4AIKA 1UCRA 3AKZA 2QSHX 1W5CC 4O3MA 2M3AA 1NG7A 3FIWA 2QBYB 2L3DA 4Y13A 2CMPA 1ZG5A 4YFXF 2XV4S 1RNLA 1DU6A 4PJ0C 4HNTA 4A3KJ 1X3UA 3IP4B 5E18F 2DA1A 2XGXA 3WE3A 1TL8A 3W6KB 2EA2A 5KNLA 4U0YA 5ICGA 1YRNA 2HDCA 2JPBA 4BU2A 5A2QK 5E20A 4Y15A 4AU7A 2NVXJ 2BY2A 2EV5A 4MQVA 1FBUA 2XVCA 2HOEA 1QZEA 4HA8A 3FK7A 2CUFA 4ESFA 3CMYA 2QQ8A 4G6DA 1GXQA 2H09A 2XAQA 1D8JA 3LSHA 3FXMA 3K2ZA 1OCZH 3OIQA 1K78A 1AKHB 1JXSA 3CJTB 2DA4A 2ID6A 2WTEA 3Q9SA 2EFWA 3NWSA 3CZ6A 1W7PA 2LC2A 1X1CA 2F6CA 3O2PE 4NDLA 2DXIA 1JI8A 3CQZJ 5M3MJ 2MGQA 2E5NA 4OMZA 2EWNA 3FMSA 1JKRC 4XBFA 1EF4A 2HQNA 1BJZA 2EZHA 1V3FA 5K5RA 1J9IA 1PJRA 1G3SA 3D5SC 5BOXA 1JUMA 3K1NA 5GPAA 1FJLA 1WJDA 4Q48A 1LEBA 3EUHC 4A12A 1D8KA 3GZ6A 5D5WB 2BXZA 1MNEA 5HS9A 5ICCA 5LEJA 4G9YA 1P4AA 4P5OA 1JKPC 1UMQA 1P6RA 4JYKA 3V8JA 1W0TA 1ZLKA 1HW5A 2YU3A 1WWXA 2F48A 3WG9A 4M9SA 1FZPB 1M1EB 2ISZA 3G1OA 4PGHA 1U3EM 2A6TA 4KMFA 4A3GJ 3BG6A 3DEUA 3QOPA 3PO2J 1WSUA 4PUSA 4ZJZA 5HS7A 4FTHA 2L4MA 5KHDA 1AHDP 1R23A 3K9TA 1HOMA 3TOBA 3V7CA 2HXIA 2VN2A 2BY1A 4C30A 1N77A 3IH4A 2IGMA 1R9TJ 2VKEA 2GIVA 2MA3A 5E3MA 2PLYA 2Y9YA 2JJ7A 3MKWB 3IC7A 1BC8C 5H6RA 4NQWA 3TKYA 2BXYA 2ETHA 2TRTA 4A3MJ 1F4KA 3ZXSA 1HCRA 4ANJA 2NRAC 3KLNA 1KQ8A 1MMGA 2FQ3A 2V26A 3CJNA 3NAUA 4ZTJA 1XGMA 1H0MA 3QPTA 3BR6A 4XICA 3K4MA 4MTDA 2NAZA 3KX2A 3KYLA 4KYWA 2O3FA 1Y8QB 4I0BA 1DP3A 5FO5A 2EV6A 1T56A 1SEUA 3DKWA 2QEXI 2GZWA 2AXLA 2IGOA 3LFKA 2XDVA 3DEEA 5LHIA 1SANA 2ZJQF 2P7VB 4YEJA 5BPDA 1HF0A 4XKCA 2R5YB 3KYDB 2JUGA 2ADUA 1SVMA 3QQAA 4CA0A 5JVTA 1DUXC 2DA5A 2OZUA 4PJLA 5IPAA 2HVRA 3VYSB 2LF8A 2KISA 3E5XA 4HF2A 2RN7A 4EMSA 3MCZA 3JRFA 2L9NA 4EJTA 1OPCA 2W00A 2VIXA 2F4MB 2LY9A 4NC8A 4CCLA 4BXXJ 3TOAA 1O7FA 2EFPA 3RYPA 4V2GA 5HLTA 3OL3A 4IHXA 4HNVA 3KP5A 4GFBA 5EEGA 5LGNA 2X51A 2Y2ZA 3HTUA 3IH3A 4XQFA 3R6SA 4ESJA 4FX0A 2R7UA 1O3RA 5DCMA 4L5JA 1MMSA 5ERIA 2W1OA 2DU9A 1Y1WJ 4RAFA 2BBYA 2CH0A 1TWGJ 2A6HF 2DO7A 1EKEA 1LFBA 3ERMA 4DQ2A 1SD5A 2COBA 3B73A 2CV0A 5B1AH 3R60A 2NS8A 3DEWA 4U0WA 1MSFC 1DDNA 2BW3B 3K4JA 2D1HA 3NARA 3Q0WA 2R7SA 4GRIA 4KN4X 4FE4A 2XB0X 3E3VA 5A2QZ 4PSXA 3WU1B 1FP2A 1FT9A 4MLOA 2J5OA 1RI7A 4Z2YA 2XROA 1D0ZA 2XRNA 2CW0F 4HX8A 2R0QC 2DODA 4A3EJ 4IOCF 4RB1A 4BEHA 1YTYA 5B3SH 2NVUB 1I1SA 4CCOA 1U8BA 5L3FA 1ZREA 2H27A 1YS7A 2VQHA 3E0JB 4H4KC 3ZN0A 4FQGA 1YW8A 5CJ9A 1AWCA 4G8XA 3P9KA 3J81Z 2KDOA 4LFUA 5CVIA 3CESA 5EZHA 3FXJA 1KA8A 3F0CA 2YX4A 4UV8A 5EYRA 2Z9OA 2WV1A 5IYDJ 4S0HB 2PQ8A 2V9KA 1MBGA 3VOEA 1UJ8A 4ZDLA 3UNGC 1ZYRF 1J7KA 4BHCA 2K40A 1F9NA 4NBQA 1Z21A 1YJWI 4RB2C 1U5TB 3CO7C 4WXDA 1C0WA 3NRVA 2CFOA 1JKQC 3K4CA
chains in the Genus database with same CATH topology
2FX0A 3BTCA 3S2DJ 3SFIA 1LFUP 3MKLA 1T33A 2MSYA 1ETWA 1B8IA 3QPSA 3S16J 3LSGA 3WHCA 1AU7A 3GTJJ 1FTTA 2XB5A 3HM5A 5E3NA 2DA3A 3SJMA 4QSHA 1MBJA 1CQTA 1WGXA 3FK6A 3W6VA 4DW6A 2WB1N 4M6VA 1P7IA 1LE8A 3HOZJ 2LKXA 3ZQLA 5F04A 2KDZA 1ZR2A 1OFCX 1RR7A 3IV5A 4BY7J 2LP0A 2LTPA 5JLXA 1IJWC 1D5YA 4M3FA 2HI3A 5EGOA 1MNMC 3O8GA 1QVUA 2CRGA 2K9SA 1G2HA 2R5YA 3LOCA 2VI6A 4IHWA 5HODA 3BT9A 3HGGA 1Z0XA 4MFDA 3HOXJ 1E3OC 1JUPA 1XC5A 1FIAA 4BBRJ 4DYRA 4RBOA 4A93J 3BTIA 1VF9A 4BKXA 2R5ZA 1TWAJ 3JRCA 4A3IJ 3GTMJ 3OSFA 4A3BJ 3S17J 2R5ZB 2RAEA 2JA8J 5M5WJ 1VI0A 3JREA 3LSJA 3K7AJ 1WH7A 2XGDA 1ETQA 4XIDA 3BR3A 2DMQA 4C3IJ 5DTDA 2AHQA 3BR5A 3JRAA 2ELKA 3K2AA 2X9DA 3HOYJ 2IAIA 1RPWA 1YRNB 3TP3A 2E2HJ 2XPWA 4UUTA 3IH2A 2QCOA 3FISA 3HEFA 1APLC 2H1KA 4I76A 3LSRA 1BL0A 1ZTRA 1Z77A 3E7LA 3RZDJ 4EEFG 2QF7A 2HOSA 1A5JA 4JP0A 1FTZA 2M0CA 3BTJA 2GLOA 4X1EA 3C2BA 4B3AA 4XRSG 5F1JA 4C2MJ 2OF7A 4X6AJ 4M3GA 2Y0SN 2CJJA 1IGNA 1IG7A 2M34A 3GTQJ 5FKNA 4J19A 5BNGA 4XK4A 1F43A 3BR2A 3A01A 3ZQHA 1MBEA 2LFBA 4BY1J 3HDDA 2DMNA 4AUXA 1IUFA 1QPIA 2IEKA 3S1QJ 2JWTA 5IP6A 1JT6A 5F0CA 3VPRA 1BA5A 3DCFA 1UG2A 1NTCA 4RDUA 5JLWA 4B1RA 5IOZA 1UHSA 5F0FA 2GM4A 3S14J 1MH3A 4V2FA 2DN0A 1IDZA 5M5XJ 2XSDC 4IHYA 2NVTJ 1ZK8A 3RQIA 3PO3J 2MG4A 1POGA 2CQQA 1BW6A 3GTKJ 1I50J 1I6HJ 1ETKA 4W1UA 3JRHA 3TP0A 1W0UA 3S1NJ 2L7FP 1IV6A 1MSEC 3I4MJ 3RZOJ 3HOUJ 1GUUA 2P81A 5F08A 1HLVA 4FISA 3RKQA 2L7MP 1S7EA 1VFCA 1TC3C 2DA7A 2M2EA 3OSGA 1ITYA 2O9LA 1HDPA 3ZQCA 2LK2A 1DU0A 4C3HJ 2I10A 2VKVA 1PUFB 2LLKA 1JT0A 3LNQA 5EEAA 4G12A 3ZQGA 3TW7A 1WPKA 5IYCJ 1IC8A 2XGEA 2XGCA 2G0EA 5J1YA 3BR0A 5C4XJ 3TW6A 3BQZA 5K7ZA 2JK3A 2PMZN 4QIWN 1XG1A 3H3VK 2DTZA 1P7JA 2FQ4A 4UUSA 1X2NA 2JA5J 5FLVA 2HYJA 1ETYA 1IRZA 3ZQFA 4QTRA 3S1MJ 4UUSB 1X58A 3BG3A 3BQYA 4LOCA 1RKTA 1A6IA 2DMUA 3FIWA 3Q0UA 4D5FA 1I3QJ 2CU7A 3SDGA 4D5CA 3S15J 2JA7J 2ME0A 1DU6A 2L9RA 1JJ6C 2FJ1A 3B6CA 4A3KJ 2DA1A 5FJ8J 1H89C 5J1RA 4XRMA 4A3FJ 1ORKA 4DYQA 1YRNA 2H8RA 5FKMA 3LSPA 1U9NA 2E1OA 2WAQN 5EG0B 3HOVJ 1MH4A 2DA2A 2NVXJ 3M3YJ 3CCYA 4D7NA 2R7ZJ 2R92J 1NK3P 3FK7A 2CUFA 2MW8A 2ECBA 3CMYA 5FKLA 4A69C 2B63J 2JN6A 4M3BA 1AKHB 3G1LA 2DA4A 2ID6A 1OJLA 2W48A 1GVDA 2X48A 3CDLA 5J3LA 4Y52J 2DA6A 2EZLA 3S1RJ 1U78A 4AYBN 4NDLA 5FKOA 2L7ZA 3CQZJ 3MVPA 5M3MJ 2MGQA 5DS9A 1JKRC 3GTLJ 1EF4A 1B72A 3L1PA 1NK2P 4DYCA 2XPVA 3JRBA 2O8KA 1BJZA 2EZHA 1ZGWA 3PM1A 1B72B 4I6ZA 3MN2A 2EBIA 1JUMA 5GPAA 1FJLA 1ETOA 3OIOA 3JRGA 4CYCB 3GTOJ 5IP7J 3HB9A 1ETXA 1X2MA 3M4OJ 4L5EA 1JKPC 1GV2A 5M5YJ 3JR9A 1UMQA 3HGYA 4JYKA 5GPCA 4FCYA 1W0TA 2CQXA 3GTGJ 1MBFA 1IDYA 3G1OA 2TCTA 4A3GJ 2LD5A 2CUEA 5K7FA 2VPRA 4MIMA 3FKIJ 2HOAA 2O7OA 1WCMJ 3PO2J 1ETVA 3H0GJ 3B6AA 3ZQIA 3UKGA 2R93J 1TWCJ 3BG9A 4FTHA 4JX6A 1WI3A 4FE7A 1RETA 1AHDP 1HOMA 3D1NI 4A3LJ 2YUSA 2ECCA 2HXIA 2HDDA 4MFEA 2OPTA 1PUFA 2K9NA 4DZPA 2K9QA 3IH4A 1R9TJ 2VKEA 4Y7NJ 2LR8A 3WHBA 2Y9ZA 1OCTC 5K7HA 5E3MA 2DMTA 1GT0C 2Y9YA 3O8HA 1RKWA 2JJ7A 2YS9A 1B8IB 5E3LA 4A3MJ 2TRTA 1H88C 1HCRA 4MO7A 3JRIA 3NAUA 2NVQJ 2FD5A 1MBHA 4XRSA 3BR6A 4XICA 4IHVA 1LE8B 2JA6J 4JX5A 2E19A 4JX4A 1T56A 4IEJA 1TWFJ 5EGOB 9ANTA 2KT0A 1Q1VA 2LVSA 1HDDC 1SANA 2DMPA 2IBDA 3ZOBA 1QVTA 1HF0A 2R5YB 4A3CJ 4DZJA 2ID3A 2X6OA 4AC0A 3QQAA 1FEXA 3GBGA 2DA5A 2HXOA 5EG0A 1VNDA 1JUSA 5E3OA 5IPAA 2D5VA 2L0KA 4BBSJ 5C3EJ 3BG5A 2N8GA 3TEDA 3JRDA 3BR1A 3JRFA 1ZR4A 5IYBJ 3Q3SA 2LY9A 4BXXJ 2DJNA 2XPUA 4B4CA 5EF6A 1Y1VJ 1JJ8C 3GTPJ 4V2GA 1GV5A 1AKHA 3HKZN 5GP9A 4HNVA 4IHXA 2VUMJ 4GFBA 4A3DJ 1MBKA 1XS9A 2Y2ZA 1TWHJ 1F36A 2HQ5A 3IH3A 2EH3A 5IP9J 5FLMJ 1U9OA 1WH5A 1Y1WJ 1JTXA 1TWGJ 1GDTA 1BW5A 3G1MA 1LFBA 3Q0VA 5C4JJ 4W97A 5FKKA 2COBA 1SFOJ 4C3JJ 5EZGA 2EQRA 2NS8A 2ZB9A 3DEWA 1MSFC 2NOGA 4A3JJ 2XRLA 5F27A 1JTYA 1H8AC 3NARA 2GBYA 3Q0WA 1O4XA 4FE4A 2XB0X 2AO9A 3HBLA 2HOTA 1JKOC 4MLOA 3BTLA 1FIPA 1ZQ3P 2ME6A 2R0QC 4CYCA 3A03A 4A3EJ 1K83J 4M3DA 2Y30A 2Y31A 2E2JJ 5M3FJ 2NS7A 4ABZA 3HOWJ 3I4NJ 1U8BA 1ZKGA 3A02A 5F0HA 1RESA 2E2IJ 4D7MA 5J1UA 3S2HJ 1ENHA 3A01B 1QRYA 2M9HA 5IOYA 5EZHA 2EZIA 1OCPA 3F0CA 5EYRA 2WV1A 5IYDJ 2JMWA 4S0HB 2NVYJ 3OOUA 2M8GX 3QPLA 1MBGA 2EZKA 5EDNA 2K40A 5C44J 1K61A 1JKQC 4M3EA 1JGGA 2YU9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FX0 A;  3BTC A;  3S2D J;  3SFI A;  1LFU P;  3MKL A;  1T33 A;  2MSY A;  1ETW A;  1B8I A;  3QPS A;  3S16 J;  3LSG A;  3WHC A;  1AU7 A;  3GTJ J;  1FTT A;  2XB5 A;  3HM5 A;  5E3N A;  2DA3 A;  3SJM A;  4QSH A;  1MBJ A;  1CQT A;  1WGX A;  3FK6 A;  3W6V A;  4DW6 A;  2WB1 N;  4M6V A;  1P7I A;  1LE8 A;  3HOZ J;  2LKX A;  3ZQL A;  5F04 A;  2KDZ A;  1ZR2 A;  1OFC X;  1RR7 A;  3IV5 A;  4BY7 J;  2LP0 A;  2LTP A;  5JLX A;  1IJW C;  1D5Y A;  4M3F A;  2HI3 A;  5EGO A;  1MNM C;  3O8G A;  1QVU A;  2CRG A;  2K9S A;  1G2H A;  2R5Y A;  3LOC A;  2VI6 A;  4IHW A;  5HOD A;  3BT9 A;  3HGG A;  1Z0X A;  4MFD A;  3HOX J;  1E3O C;  1JUP A;  1XC5 A;  1FIA A;  4BBR J;  4DYR A;  4RBO A;  4A93 J;  3BTI A;  1VF9 A;  4BKX A;  2R5Z A;  1TWA J;  3JRC A;  4A3I J;  3GTM J;  3OSF A;  4A3B J;  3S17 J;  2R5Z B;  2RAE A;  2JA8 J;  5M5W J;  1VI0 A;  3JRE A;  3LSJ A;  3K7A J;  1WH7 A;  2XGD A;  1ETQ A;  4XID A;  3BR3 A;  2DMQ A;  4C3I J;  5DTD A;  2AHQ A;  3BR5 A;  3JRA A;  2ELK A;  3K2A A;  2X9D A;  3HOY J;  2IAI A;  1RPW A;  1YRN B;  3TP3 A;  2E2H J;  2XPW A;  4UUT A;  3IH2 A;  2QCO A;  3FIS A;  3HEF A;  1APL C;  2H1K A;  4I76 A;  3LSR A;  1BL0 A;  1ZTR A;  1Z77 A;  3E7L A;  3RZD J;  4EEF G;  2QF7 A;  2HOS A;  1A5J A;  4JP0 A;  1FTZ A;  2M0C A;  3BTJ A;  2GLO A;  4X1E A;  3C2B A;  4B3A A;  4XRS G;  5F1J A;  4C2M J;  2OF7 A;  4X6A J;  4M3G A;  2Y0S N;  2CJJ A;  1IGN A;  1IG7 A;  2M34 A;  3GTQ J;  5FKN A;  4J19 A;  5BNG A;  4XK4 A;  1F43 A;  3BR2 A;  3A01 A;  3ZQH A;  1MBE A;  2LFB A;  4BY1 J;  3HDD A;  2DMN A;  4AUX A;  1IUF A;  1QPI A;  2IEK A;  3S1Q J;  2JWT A;  5IP6 A;  1JT6 A;  5F0C A;  3VPR A;  1BA5 A;  3DCF A;  1UG2 A;  1NTC A;  4RDU A;  5JLW A;  4B1R A;  5IOZ A;  1UHS A;  5F0F A;  2GM4 A;  3S14 J;  1MH3 A;  4V2F A;  2DN0 A;  1IDZ A;  5M5X J;  2XSD C;  4IHY A;  2NVT J;  1ZK8 A;  3RQI A;  3PO3 J;  2MG4 A;  1POG A;  2CQQ A;  1BW6 A;  3GTK J;  1I50 J;  1I6H J;  1ETK A;  4W1U A;  3JRH A;  3TP0 A;  1W0U A;  3S1N J;  2L7F P;  1IV6 A;  1MSE C;  3I4M J;  3RZO J;  3HOU J;  1GUU A;  2P81 A;  5F08 A;  1HLV A;  4FIS A;  3RKQ A;  2L7M P;  1S7E A;  1VFC A;  1TC3 C;  2DA7 A;  2M2E A;  3OSG A;  1ITY A;  2O9L A;  1HDP A;  3ZQC A;  2LK2 A;  1DU0 A;  4C3H J;  2I10 A;  2VKV A;  1PUF B;  2LLK A;  1JT0 A;  3LNQ A;  5EEA A;  4G12 A;  3ZQG A;  3TW7 A;  1WPK A;  5IYC J;  1IC8 A;  2XGE A;  2XGC A;  2G0E A;  5J1Y A;  3BR0 A;  5C4X J;  3TW6 A;  3BQZ A;  5K7Z A;  2JK3 A;  2PMZ N;  4QIW N;  1XG1 A;  3H3V K;  2DTZ A;  1P7J A;  2FQ4 A;  4UUS A;  1X2N A;  2JA5 J;  5FLV A;  2HYJ A;  1ETY A;  1IRZ A;  3ZQF A;  4QTR A;  3S1M J;  4UUS B;  1X58 A;  3BG3 A;  3BQY A;  4LOC A;  1RKT A;  1A6I A;  2DMU A;  3FIW A;  3Q0U A;  4D5F A;  1I3Q J;  2CU7 A;  3SDG A;  4D5C A;  3S15 J;  2JA7 J;  2ME0 A;  1DU6 A;  2L9R A;  1JJ6 C;  2FJ1 A;  3B6C A;  4A3K J;  2DA1 A;  5FJ8 J;  1H89 C;  5J1R A;  4XRM A;  4A3F J;  1ORK A;  4DYQ A;  1YRN A;  2H8R A;  5FKM A;  3LSP A;  1U9N A;  2E1O A;  2WAQ N;  5EG0 B;  3HOV J;  1MH4 A;  2DA2 A;  2NVX J;  3M3Y J;  3CCY A;  4D7N A;  2R7Z J;  2R92 J;  1NK3 P;  3FK7 A;  2CUF A;  2MW8 A;  2ECB A;  3CMY A;  5FKL A;  4A69 C;  2B63 J;  2JN6 A;  4M3B A;  1AKH B;  3G1L A;  2DA4 A;  2ID6 A;  1OJL A;  2W48 A;  1GVD A;  2X48 A;  3CDL A;  5J3L A;  4Y52 J;  2DA6 A;  2EZL A;  3S1R J;  1U78 A;  4AYB N;  4NDL A;  5FKO A;  2L7Z A;  3CQZ J;  3MVP A;  5M3M J;  2MGQ A;  5DS9 A;  1JKR C;  3GTL J;  1EF4 A;  1B72 A;  3L1P A;  1NK2 P;  4DYC A;  2XPV A;  3JRB A;  2O8K A;  1BJZ A;  2EZH A;  1ZGW A;  3PM1 A;  1B72 B;  4I6Z A;  3MN2 A;  2EBI A;  1JUM A;  5GPA A;  1FJL A;  1ETO A;  3OIO A;  3JRG A;  4CYC B;  3GTO J;  5IP7 J;  3HB9 A;  1ETX A;  1X2M A;  3M4O J;  4L5E A;  1JKP C;  1GV2 A;  5M5Y J;  3JR9 A;  1UMQ A;  3HGY A;  4JYK A;  5GPC A;  4FCY A;  1W0T A;  2CQX A;  3GTG J;  1MBF A;  1IDY A;  3G1O A;  2TCT A;  4A3G J;  2LD5 A;  2CUE A;  5K7F A;  2VPR A;  4MIM A;  3FKI J;  2HOA A;  2O7O A;  1WCM J;  3PO2 J;  1ETV A;  3H0G J;  3B6A A;  3ZQI A;  3UKG A;  2R93 J;  1TWC J;  3BG9 A;  4FTH A;  4JX6 A;  1WI3 A;  4FE7 A;  1RET A;  1AHD P;  1HOM A;  3D1N I;  4A3L J;  2YUS A;  2ECC A;  2HXI A;  2HDD A;  4MFE A;  2OPT A;  1PUF A;  2K9N A;  4DZP A;  2K9Q A;  3IH4 A;  1R9T J;  2VKE A;  4Y7N J;  2LR8 A;  3WHB A;  2Y9Z A;  1OCT C;  5K7H A;  5E3M A;  2DMT A;  1GT0 C;  2Y9Y A;  3O8H A;  1RKW A;  2JJ7 A;  2YS9 A;  1B8I B;  5E3L A;  4A3M J;  2TRT A;  1H88 C;  1HCR A;  4MO7 A;  3JRI A;  3NAU A;  2NVQ J;  2FD5 A;  1MBH A;  4XRS A;  3BR6 A;  4XIC A;  4IHV A;  1LE8 B;  2JA6 J;  4JX5 A;  2E19 A;  4JX4 A;  1T56 A;  4IEJ A;  1TWF J;  5EGO B;  9ANT A;  2KT0 A;  1Q1V A;  2LVS A;  1HDD C;  1SAN A;  2DMP A;  2IBD A;  3ZOB A;  1QVT A;  1HF0 A;  2R5Y B;  4A3C J;  4DZJ A;  2ID3 A;  2X6O A;  4AC0 A;  3QQA A;  1FEX A;  3GBG A;  2DA5 A;  2HXO A;  5EG0 A;  1VND A;  1JUS A;  5E3O A;  5IPA A;  2D5V A;  2L0K A;  4BBS J;  5C3E J;  3BG5 A;  2N8G A;  3TED A;  3JRD A;  3BR1 A;  3JRF A;  1ZR4 A;  5IYB J;  3Q3S A;  2LY9 A;  4BXX J;  2DJN A;  2XPU A;  4B4C A;  5EF6 A;  1Y1V J;  1JJ8 C;  3GTP J;  4V2G A;  1GV5 A;  1AKH A;  3HKZ N;  5GP9 A;  4HNV A;  4IHX A;  2VUM J;  4GFB A;  4A3D J;  1MBK A;  1XS9 A;  2Y2Z A;  1TWH J;  1F36 A;  2HQ5 A;  3IH3 A;  2EH3 A;  5IP9 J;  5FLM J;  1U9O A;  1WH5 A;  1Y1W J;  1JTX A;  1TWG J;  1GDT A;  1BW5 A;  3G1M A;  1LFB A;  3Q0V A;  5C4J J;  4W97 A;  5FKK A;  2COB A;  1SFO J;  4C3J J;  5EZG A;  2EQR A;  2NS8 A;  2ZB9 A;  3DEW A;  1MSF C;  2NOG A;  4A3J J;  2XRL A;  5F27 A;  1JTY A;  1H8A C;  3NAR A;  2GBY A;  3Q0W A;  1O4X A;  4FE4 A;  2XB0 X;  2AO9 A;  3HBL A;  2HOT A;  1JKO C;  4MLO A;  3BTL A;  1FIP A;  1ZQ3 P;  2ME6 A;  2R0Q C;  4CYC A;  3A03 A;  4A3E J;  1K83 J;  4M3D A;  2Y30 A;  2Y31 A;  2E2J J;  5M3F J;  2NS7 A;  4ABZ A;  3HOW J;  3I4N J;  1U8B A;  1ZKG A;  3A02 A;  5F0H A;  1RES A;  2E2I J;  4D7M A;  5J1U A;  3S2H J;  1ENH A;  3A01 B;  1QRY A;  2M9H A;  5IOY A;  5EZH A;  2EZI A;  1OCP A;  3F0C A;  5EYR A;  2WV1 A;  5IYD J;  2JMW A;  4S0H B;  2NVY J;  3OOU A;  2M8G X;  3QPL A;  1MBG A;  2EZK A;  5EDN A;  2K40 A;  5C44 J;  1K61 A;  1JKQ C;  4M3E A;  1JGG A;  2YU9 J; 
#chains in the Genus database with same CATH topology
 3GVA A;  1E17 A;  4HG2 A;  1FOW A;  4U0V A;  4R79 A;  3FM5 A;  1T33 A;  5ICE A;  3ASN H;  1EV7 A;  3LSG A;  4BDY A;  3KCC A;  3JCU C;  3K4K A;  2JT1 A;  3HM5 A;  4HAM A;  3NWT A;  2P7C B;  1MBJ A;  1HW1 A;  1WGX A;  3FBI B;  3CCL I;  3WTX C;  2WB1 N;  2DJI A;  2QYO A;  4N4N B;  3T8T A;  3DP7 A;  1IRG A;  1B6A A;  2OCC H;  3SYT A;  2HGC A;  3FKJ A;  3H9G A;  4CXF A;  3U2R A;  2MFZ A;  1RR7 A;  3IV5 A;  4BY7 J;  1FMV A;  5ILV A;  4M3F A;  3SQN A;  2RQQ A;  4BUP A;  1QVU A;  4LLL A;  5HLG A;  3HHG A;  1PYV A;  1ZGA A;  5DUI A;  2Q1Z B;  3A0B C;  4HLY A;  1SFU A;  4IHW A;  1Z05 A;  4YII A;  5HOD A;  3GZN B;  3HGG A;  1SD4 A;  1VQ5 I;  4BJT A;  3F3X A;  4NHJ A;  3A1Y A;  1KYZ A;  2CV1 A;  2CYY A;  2J5P A;  3KP2 A;  4XON A;  1VF9 A;  3GTM J;  1TWA J;  3A2K A;  2PI0 A;  4J01 A;  1KYW A;  1MMA A;  3K4L A;  4QPO A;  2R5Z B;  2JA8 J;  2WA0 A;  5M5W J;  4KIC A;  3JRE A;  3LA3 A;  3K7A J;  2GQQ A;  2NNY A;  1ETQ A;  4EGY A;  2DFH A;  4BHP A;  2STW A;  3BR3 A;  2DMQ A;  2K3P A;  3DBL B;  2X85 A;  3VSK A;  1WJF A;  3ZQ7 A;  2ELK A;  3K2A A;  2X9D A;  4CGZ A;  1TQM A;  2HDW A;  3GXO A;  3F8C A;  1R49 A;  1BIB A;  4C2U A;  3DKY A;  1XTA A;  1OLT A;  3ZCO A;  3TP3 A;  1R5H A;  3GO5 A;  4AID A;  3IH2 A;  3B02 A;  3HEF A;  3QPH A;  2H1K A;  3CP8 A;  4I76 A;  1MGT A;  1IV8 A;  2RDP A;  1BR4 A;  3AAF A;  3VWB A;  1QU3 A;  3PSF A;  3N05 A;  1FTZ A;  4F7Z A;  1LVA A;  2GLO A;  4NB5 A;  4B3A A;  3GYH X;  4H0E A;  3I59 B;  6PAX A;  3T8R A;  3K4N A;  2XAH A;  2DFF A;  4ETS A;  4BXU A;  3GTQ J;  5IT9 K;  3WTS C;  3D5L A;  3QP5 A;  1F43 A;  2O0Y A;  5LFA A;  2Y75 A;  3QRF F;  4D1Q A;  1MJA A;  1OYI A;  1FMW A;  1T0F C;  1IN5 A;  3ABU A;  3HHH A;  5AIQ A;  3HDD A;  1VQK I;  4M9X A;  3QOD A;  2L54 A;  3M1C A;  2IEK A;  1Y56 A;  5E8I A;  2DPD A;  1YQA A;  4E4H A;  3OIP A;  2IVM A;  4B47 A;  3BOQ A;  5F0C A;  2Q2E B;  3HXL A;  3KZZ A;  4ASN A;  3AG4 H;  3J7Z I;  1UHS A;  2ZBK A;  3HC7 A;  2E35 A;  2GM4 A;  2RNJ A;  4V2F A;  2DN0 A;  1IDZ A;  4WF2 A;  3FMQ A;  1ZK8 A;  4L5I A;  5CQG A;  3PO3 J;  2Z5U A;  2MG4 A;  1SMT A;  4LJZ F;  4Q47 A;  4CCN A;  2P6S A;  4W1U A;  1W0U A;  1IV6 A;  3CUQ A;  4P1W A;  4LIU A;  3FXK A;  1TT5 B;  1VQ4 I;  1Z3Y A;  2K85 A;  1GUU A;  3M7G A;  5B1B H;  2VKH A;  3C3W A;  3UR3 C;  3RQ4 A;  1CF7 A;  4RB0 A;  1IW7 F;  4I0A A;  1S7E A;  4YIF A;  2EFO A;  3BP8 A;  4OOI A;  1VFC A;  2M2E A;  3I71 A;  1UG0 A;  4LGW A;  2O9L A;  1DU0 A;  4B3X A;  2VC0 A;  1GLN A;  1LUJ B;  2XF5 A;  4XN0 A;  2DOE A;  4BGD A;  3LNQ A;  4PJJ A;  5EEA A;  3U1D A;  2VJ5 A;  3HIF A;  2GXA A;  1N78 A;  3JSO A;  3ECH A;  1X1A A;  5D8K B;  2PMZ N;  4IRI A;  3IWZ A;  4QIW N;  2JZY A;  2X6X A;  2DTZ A;  3LSI A;  4XNF A;  2IRF G;  3KFW X;  2A69 F;  3LSM A;  1OR7 A;  2M7A A;  2ZC2 A;  2HYJ A;  5F1R A;  2IJL A;  4QTR A;  3DU5 A;  5JHU A;  3I9V 2;  4UUS B;  3S1M J;  1AOY A;  4LG0 B;  1X58 A;  3OS1 A;  1G4D A;  3OS0 A;  3BQY A;  1RKT A;  2VPL A;  2DMU A;  2KQR A;  3Q0U A;  4KT6 A;  2M0M A;  2DAO A;  1Z67 A;  4CZC A;  2CU7 A;  3H5R A;  2LNB A;  2L5Q A;  1SFX A;  4PZJ A;  5DD8 A;  2R7V A;  2FJ1 A;  3F8F A;  2ZXJ A;  3ABT A;  2E1C A;  2RC4 A;  1Z3X A;  1JHF A;  2H6B A;  5FJ8 J;  2ZKZ A;  4DGW B;  2OZ6 A;  1ZRD A;  5J1R A;  1ORK A;  3TO7 A;  1TBX A;  1LB2 A;  3HRU A;  5EG0 B;  4P55 A;  5JR3 A;  2DA2 A;  3M3Y J;  4K2E A;  4E7L A;  4D7N A;  5HNH A;  4NNJ A;  2R7Z J;  4G94 A;  1NK3 P;  3MMY B;  4FX4 A;  3CME I;  4RLF A;  3P9I A;  1P2F A;  4KIS A;  5FKL A;  3MZY A;  4HF0 A;  3ZGK A;  2PJR B;  2JN6 A;  2XAU A;  3CLO A;  1OIS A;  1TLH B;  3DBR B;  3BWG A;  3V4G A;  1DP7 P;  4F92 B;  3HTS B;  2QEN A;  1FP1 D;  3CDL A;  5J3L A;  4AD9 A;  2E1M B;  2M1B A;  2L2O A;  2M4K A;  4AYB N;  2E7W A;  5FKO A;  2L7Z A;  3S3N A;  2V1N A;  2ISY A;  5DS9 A;  4UVA A;  2ZJR F;  4BDZ A;  3KP7 A;  1SD6 A;  2EFN A;  3GTL J;  3ZP5 A;  3SZG A;  1NK2 P;  3JRB A;  3RKX A;  2MLK A;  4B44 A;  1ZGW A;  3PM1 A;  3OYK A;  2AQE A;  1B72 B;  4I6Z A;  5E79 C;  5DDG A;  3MN2 A;  2H6C A;  2OUM A;  2CS3 A;  2EBI A;  5DEQ A;  3L2C A;  2X6W A;  2Z99 A;  1ETO A;  3CCE I;  2LBF B;  1IN6 A;  3MKY B;  2CUZ A;  2HZT A;  4XLE A;  2P4W A;  5AON A;  2CGP A;  3K70 C;  1YLF A;  2AXT C;  4L5E A;  4PJM A;  5M5Y J;  1XGS A;  3JR9 A;  3W6J B;  1ZLJ A;  3ECO A;  4FCY A;  2MAB A;  3M8J A;  1U0J A;  1BI1 A;  4MGR A;  3GTG J;  1MBF A;  2VBZ A;  2QQ9 A;  4KFC A;  4RGX A;  2TCT A;  4G7O F;  5IT9 Z;  2CUE A;  2O7O A;  5B5E C;  1WCM J;  2QSG X;  2OQR A;  2VBW A;  3J7A O;  2UXX A;  3B6A A;  4I98 B;  3OMY A;  1MMD A;  3EQL F;  1K4T A;  4IQJ A;  2OA4 A;  2OV7 A;  3E5U A;  1RET A;  2L9S A;  2W25 A;  3TGN A;  3OY9 A;  1HA8 A;  4OU0 A;  3D1N I;  2GA2 A;  1I1G A;  2ZNZ A;  3G3Z A;  5BQT A;  2DFI A;  4MFE A;  2OPT A;  1PUF A;  2DDA A;  2HDD A;  1UAA A;  2KFD A;  3IL2 A;  1ZAO A;  2LR8 A;  1OCT C;  2ESN A;  3WGI A;  3K10 A;  3HUG B;  1UHW A;  5J4Y A;  1R4N B;  3CO6 C;  5DD4 A;  1O7L A;  2VJI A;  3I58 A;  1FC3 A;  1D0Y A;  4U7B A;  1U5T C;  5D8L B;  4MO7 A;  2ZSI B;  4BQA A;  1B59 A;  3OYB A;  4PFO A;  1VQP I;  1ZH5 A;  1YIO A;  2H1L A;  5BMZ A;  4UB8 C;  1W36 D;  3PIP F;  2JA6 J;  2P8T A;  4XOT A;  3WTZ A;  2Z16 A;  4CO8 A;  3KZI C;  2FXA A;  4OIR F;  2W85 A;  4IEJ A;  5EGO B;  9ANT A;  2JVH A;  1Q1V A;  2I5U A;  2KT0 A;  1FYK A;  3TO6 A;  2OJE D;  2IBD A;  2GXG A;  2E36 A;  5L3C A;  4DZJ A;  3G6E I;  1HQC A;  1Z7L A;  2KRC A;  4AIH A;  3CCU I;  3IUO A;  5H20 A;  3H9Q A;  3T1B A;  2H94 A;  3S32 A;  1ZAR A;  4M6X A;  3S2W A;  3I3L A;  3BG5 A;  1MKM A;  1ZR4 A;  4ITV A;  4A2U A;  3Q3S A;  1NHA A;  2DTR A;  4PGG A;  1BJA A;  1T38 A;  1YIT I;  1MND A;  3GUD A;  2GWR A;  3M1E A;  2V1X A;  1VZ0 A;  1F36 A;  2VQG A;  5FLM J;  3RI4 A;  1Z7U A;  4ZH4 F;  1LDK B;  1WH5 A;  1JTX A;  4ON0 A;  4BJ5 C;  3E1S A;  3QU3 A;  3G1M A;  2DYR H;  4W97 A;  5FKK A;  1SFO J;  4XLA A;  2EQR A;  2ZB9 A;  1FPQ A;  4P9F A;  2P5V A;  2XRL A;  1JTY A;  4NC7 A;  3ZN1 A;  2GBY A;  2A07 F;  2Y48 A;  3LA7 A;  3S3O A;  2AO9 A;  3QOE A;  1JKO C;  4IPA A;  3BTL A;  1FIP A;  1S5L C;  5D6E A;  4HSR A;  4G7H F;  1FBS A;  4XSZ F;  1XCV A;  4LLN A;  2ME6 A;  4XN3 A;  3RPU A;  4CYC A;  2NYX A;  3F21 A;  3C18 A;  4U88 A;  1XMK A;  5M3F J;  1KON A;  5FRN A;  3N4M A;  3AL0 B;  1IAW A;  3HOW J;  4FHT A;  4MEY F;  4BXF A;  4IZZ A;  1ZGJ A;  3LAP A;  2FF4 A;  1RES A;  2EIM H;  3CC2 I;  2HNH A;  2COM A;  3F8B A;  1OCC H;  3NQO A;  3ELK A;  2O6G E;  1QRY A;  1XMX A;  5IOY A;  1QBJ A;  4HBL A;  1OCP A;  5DYM A;  4UV9 A;  5J8F A;  3CCJ I;  4IO9 F;  4E7K A;  1ZHF A;  2WAD A;  3KEY A;  3OOU A;  3QPL A;  4RGU A;  2R7T A;  2EZK A;  5HLI A;  2VT2 A;  5ILU A;  2HPI A;  4IHT A;  2MC3 A;  3GX4 X;  1RUO A;  1TW2 A;  2KIF A;  2R7Q A;  3HOS A;  3LSK A;  5C44 J;  2YX7 A;  1K61 A;  2XAG A;  4F52 A;  2RVC A;  2D2W A;  3HKZ A;  3H3U A;  1NH3 A;  1GXP A;  2OBP A;  2V4J C;  2V1D A;  3GFL A;  3S2D J;  3I4P A;  3WGG A;  1BI2 A;  1Q1H A;  5K5Q A;  3P9C A;  3OYA A;  1B8I A;  1S72 I;  2RNG A;  1LJ9 A;  2XSJ C;  4A0Z A;  2V1U A;  2OD5 A;  4IL6 C;  1UZC A;  4B43 A;  4BQO A;  1FTT A;  2CW8 A;  2IA2 A;  1U6G A;  4QSH A;  1CQT A;  3VDX A;  1G59 A;  2XC7 A;  2FRH A;  3L7W A;  2R7R A;  4M6V A;  2X4H A;  2OU2 A;  1P7I A;  1LE8 A;  5E8G A;  3ZQL A;  3DPU A;  1ZR2 A;  3ZR8 X;  4CCJ A;  4N4O B;  1CGP A;  5JLX A;  4FET A;  2QKM B;  1QHG A;  4LG3 A;  2CRG A;  2A3S A;  2K9S A;  4L9N A;  4RLQ A;  3JTG A;  1D5V A;  3COA C;  1RRJ A;  3F6O A;  5TRD A;  1MDM B;  1E3O C;  2R4G A;  1XC5 A;  2CV2 A;  3V8K A;  4E7S A;  3VB2 A;  3GFJ A;  4DYR A;  3RYR A;  4RBO A;  2FA5 A;  5KK1 A;  2R5Z A;  1LFP A;  3I56 I;  4ESB A;  1VQ9 I;  1I6X A;  3W2W A;  2RAE A;  1GHC A;  2K86 A;  1K4S A;  3VYR B;  4XM3 A;  1ZG1 A;  1IO2 A;  3LSJ A;  4A6E A;  4EM1 A;  2PFB A;  1IN7 A;  3WU0 A;  1V55 H;  3ML6 A;  3BCA A;  2P6T A;  3ZMU A;  3JRA A;  2HWV A;  1ON2 A;  3EUH A;  2VOD A;  1ZEL A;  1G8X A;  3LMM A;  1RPW A;  2O03 A;  4HX7 A;  1YRN B;  3JW4 A;  2E2H J;  2XPW A;  5FD6 A;  1W4M A;  2QCO A;  1R22 A;  2F5D A;  1SVL A;  2MLG A;  2VE8 A;  4CH7 A;  4CZZ A;  1YFH A;  1R1U A;  1YW9 A;  2XAJ A;  3KE2 A;  5GTI C;  1P9Q C;  3LSR A;  2HEO A;  1Z77 A;  2QF7 A;  1R58 A;  2G9W A;  1A5J A;  4D0P A;  4Y17 A;  2ACJ A;  3F23 A;  1ODD A;  4EQQ A;  3ISP A;  4JP0 A;  5F6F A;  5LHG A;  2M0C A;  5F64 A;  3C2B A;  1PP7 U;  2P5K A;  3BG7 A;  2EA4 A;  3IKT A;  1K78 B;  1KU3 A;  5F1J A;  2IS1 A;  4YRV A;  2L9V A;  3EDP A;  4M3G A;  3WTT C;  1LVK A;  3HJE A;  1XN7 A;  3FX3 A;  3CDI A;  2EPF A;  3A01 A;  2E5Z A;  4MHG A;  2MD0 A;  1T98 A;  1QA6 A;  2DMN A;  2IP2 A;  2L4A A;  4BE0 A;  3CD6 I;  4M6Y A;  2A5W A;  4EM0 B;  3Q5F A;  2KL4 A;  2E1M C;  4L9V A;  4RA2 A;  1OYW A;  4N0B A;  4F55 A;  4GXO A;  2K9M A;  3DCF A;  1UG2 A;  2M8E A;  4ZYH A;  1OYY A;  5JLW A;  4ENK A;  5IOZ A;  1A31 A;  4L0Y B;  3K6G A;  3M9A A;  4R8H A;  3L2U A;  3I54 A;  2VON A;  3S14 J;  5M5X J;  2ZXW H;  2XSD C;  2HKO A;  2NVT J;  2R7F A;  4C2T A;  1RR8 C;  1IXS B;  1POG A;  1UB9 A;  2CQQ A;  5GAH J;  3HSF A;  3OYH A;  1ETK A;  3JRH A;  2L7F P;  1A35 A;  3LL7 A;  4HYE A;  2M5W A;  3I4M J;  4JBA A;  4EJO A;  3OYI A;  3CCM I;  5J47 A;  3QWL A;  4DNC A;  3HOU J;  2P81 A;  3J7A Y;  5F08 A;  5J8C A;  4B48 A;  3KLO A;  4AM3 A;  1W5T A;  4BS9 A;  1W7P D;  4IQ4 A;  2VKV A;  3L00 A;  3RSN A;  2Y69 H;  4EV0 A;  2DK8 A;  2HFH A;  2LLK A;  1USS A;  2HTJ A;  1WPK A;  2Y0S A;  5IYC J;  4KDP A;  2XGE A;  1EJ9 A;  1Y0N A;  5J1Y A;  1TZL A;  1YX3 A;  2JK3 A;  3I5U A;  2KLO A;  1SAX A;  2A6E F;  4NQW B;  1TT0 A;  3K1P A;  2IS2 A;  3OYL A;  1WRJ A;  2FUG 2;  2BYV E;  3MFK A;  2FQ4 A;  4YG2 F;  3OYG A;  3A4C A;  1ZRF A;  2FNP A;  4UUS A;  4ZYE A;  2R7O A;  3I64 A;  2VXD A;  5HVQ C;  2DDB A;  3ZQF A;  4BYY A;  1MW7 A;  4KIT B;  2FEZ A;  2R3S A;  1ERD A;  4LOC A;  3U9G A;  2VQL A;  4CCM A;  1D1B A;  4D5F A;  1DPR A;  5HDG A;  3GCM A;  1WQ2 A;  2IW5 A;  3S8P A;  2ZME B;  2PJP A;  1SAU A;  1JJ6 C;  3B6C A;  3FXO A;  3OYC A;  2P0W A;  4CHU A;  4UHT A;  3TDZ C;  3OOP A;  1IZ1 A;  1FWZ A;  2A05 A;  3LST A;  1H89 C;  4I2O A;  4Y33 A;  4A3F J;  4DIQ A;  4KNY A;  2PN6 A;  2H8R A;  4EGZ A;  1U9N A;  2E1O A;  2FBH A;  5D5X B;  5CPR B;  5DUK A;  1MH4 A;  1A04 A;  3K0L A;  3H92 A;  3HPG A;  3TDU C;  2KPM A;  3FXU A;  4NUB A;  2MW8 A;  2ECB A;  4LK0 F;  2O61 A;  3IAM 2;  4WX9 A;  3FDY A;  1X1B A;  3RDI A;  4ZYA A;  3CDH A;  2H8W A;  1T39 A;  1P4X A;  2IPQ X;  4M3B A;  5IT3 A;  4BH9 A;  1Z6R A;  1FX7 A;  2YR2 A;  5CVJ A;  3SEQ A;  3G1L A;  4RM2 A;  2E7X A;  1OJL A;  1GVD A;  2M45 A;  3BPV A;  4L9T A;  2DA6 A;  3C2G A;  2EZL A;  5EEH A;  4GYI A;  1WI9 A;  2K5C A;  1U78 A;  1TP4 A;  1UFM A;  1PDN C;  2GAU A;  4D9J A;  2VAS A;  2VJ4 A;  1O3T A;  3ABM H;  1J59 A;  2XUB A;  4KIG A;  5K1Y A;  2OTL I;  5DV5 A;  1TTY A;  1B72 A;  4IX7 A;  2WY8 Q;  3BJ6 A;  4GCV A;  2LBF A;  1QHH D;  3OR1 C;  2A5Y B;  3L2R A;  2IA1 A;  1ULY A;  2PG4 A;  3H1C A;  3DKX A;  2Q0O A;  2X0L A;  5LBQ A;  1WJB A;  3VFZ A;  5HOO A;  4PK4 A;  3VEP A;  2LG4 A;  1K6O A;  2VXZ A;  4BEH B;  3AG2 H;  1REP C;  4YEL A;  5FB2 A;  1J0R A;  1TQP A;  4M71 A;  2EB7 A;  4F3Q A;  1WHU A;  2CQX A;  4S05 A;  3H5N A;  2LOO A;  4EJV A;  3V8L A;  2QM3 A;  4II3 A;  5L3G A;  5BS6 A;  5K7F A;  3GZ5 A;  2V79 A;  4BE2 A;  2DI3 A;  3AL0 C;  1HSJ A;  1ETV A;  3H0G J;  3ZQI A;  2KRF A;  5HLH A;  3UKG A;  3N97 A;  4I99 C;  3BG9 A;  2R93 J;  4JX6 A;  4XKW A;  2NOJ B;  4U87 A;  4XLN F;  4E6K G;  1V5G A;  3DU6 A;  3FZV A;  3LFU A;  3L2Q A;  3FXR A;  3LQR A;  1KQ9 A;  2YUS A;  3BLY A;  2ECC A;  1IF1 A;  1TQI A;  2K4J A;  4DZP A;  3ULQ B;  3DXJ F;  4Y7N J;  1XPX A;  2Y9Z A;  2VC1 A;  5J4V A;  3TBI A;  1RKW A;  2YS9 A;  1BM9 A;  4HRI A;  3X2Q H;  5E3L A;  1IRX A;  4WK8 F;  3AFH A;  2PX9 A;  3HRM A;  1VQ8 I;  3JRI A;  3EUA A;  3OYN A;  2FOW A;  2FD5 A;  1F1Z A;  3MWM A;  3WE2 A;  2OQG A;  4A0Y A;  1LEA A;  3IRQ A;  1VQ6 I;  3C1D A;  3PIO F;  1FSE A;  2QBY A;  1G3Y A;  4JX5 A;  4U7D A;  3ZMT A;  3OYJ A;  2CQK A;  2E19 A;  2XAF A;  3LAJ A;  4L0Z B;  4G6T B;  4JX4 A;  3S93 A;  3BZK A;  2HU9 A;  1G6N A;  4ZTF A;  3MEX A;  1KU7 A;  4MEX F;  1S29 A;  2LVS A;  4RAZ A;  1EH7 A;  1HDD C;  2DMP A;  2IT0 A;  3QYF A;  1QVT A;  3GLX A;  1YHQ I;  3BZ6 A;  1XDS A;  2ID3 A;  2X6O A;  4IKF A;  3ABK H;  4XOP A;  3WTV C;  4XLP F;  1FEX A;  3C2H A;  2EIN H;  2HXO A;  5E1W A;  4FAS D;  4Y4R A;  2D5V A;  1PVE A;  5C3E J;  3MZ8 A;  1V5F A;  2N8G A;  3TED A;  3JRD A;  5BPI A;  1YIJ I;  5LRS A;  4XL9 A;  2DJN A;  4PCQ A;  4LB6 B;  2XPU A;  4B4C A;  5EF6 A;  3ERE D;  1JJ8 C;  3GTP J;  1T0F A;  4HQM A;  4XOR A;  1AKH A;  2JRT A;  2R7X A;  1MBK A;  1FYL A;  4E7J A;  2EH3 A;  2ZJ2 A;  4JQF A;  3QAH A;  2X6Y A;  1YS6 A;  3FWE A;  2B0L A;  1XSX A;  3FHN A;  1BW5 A;  3Q0V A;  5C4J J;  3J7Y J;  3DQV C;  5CVV A;  5EZG A;  2F4I A;  5B66 C;  2NOG A;  4A3J J;  1RIO H;  3VYU B;  4A5N A;  4QWQ A;  5F27 A;  1O4X A;  3CJQ B;  1S6L A;  2FU4 A;  3E6D A;  2HVS A;  3K1M A;  1U8R A;  3H5A A;  5KAF C;  1R36 A;  2BY0 A;  3DBH B;  3F9K A;  5D4R A;  3VYT B;  3A03 A;  1OKR A;  2V6C A;  4M3D A;  1QQI A;  2Y30 A;  2Y31 A;  4HDV A;  2NS7 A;  1J75 A;  2PMH A;  2ZXI A;  3GF2 A;  3I4N J;  1ZKG A;  1WJ5 A;  1HXD A;  3A02 A;  2DW4 A;  5F0H A;  2UUZ A;  2VLA A;  2E2I J;  5J1U A;  5H6Q A;  3BC8 A;  1MJ9 A;  1NG6 A;  2L01 A;  2QUF A;  2EZI A;  2KIQ A;  2LKP A;  3PUB A;  3W2V A;  4C9Y A;  1R5G A;  4EVI A;  2JMW A;  2F5F A;  2WAQ A;  4OWR B;  2NVY J;  4O5V A;  4XKV A;  4MQ9 F;  1RZ4 A;  1YG2 A;  3G4S I;  2M30 A;  1Z6T A;  1ON1 A;  1H9G A;  2PBI A;  2Z1D A;  5JFR A;  1KU2 A;  2X1E A;  3EPZ A;  4M74 A;  2DK5 A;  2JRM A;  2W24 A;  1JGG A;  3ABL H;  4FT8 A;  1LFU P;  3BY6 A;  3M07 A;  3I0T A;  4YIR X;  1ACI A;  1GVJ A;  1U2W A;  2EIK H;  1X4O A;  3GTJ J;  2MH2 A;  2Z33 A;  2XB5 A;  3CMA I;  2OAZ A;  2KP6 A;  1EH6 A;  3KP4 A;  5E3N A;  1MMN A;  3CUQ B;  4QLC U;  1T08 B;  4BHB A;  4DW6 A;  2JQ7 A;  1HST A;  2DYS H;  4MTE A;  4HQE A;  1TW3 A;  5GAE J;  1RC9 A;  3HOZ J;  5L3D A;  4XKB A;  4Y3O A;  2LKX A;  1Y8R B;  2MH9 A;  3KP3 A;  3KEO A;  3L9F A;  1TNT A;  3MD2 A;  3DTI A;  3IWF A;  4RGS A;  2OTJ I;  2DT7 B;  4LLG F;  1A36 A;  1XDU A;  2LTP A;  1IJW C;  2HI3 A;  1MNM C;  5D5V B;  3O8G A;  2RV8 A;  1FOY A;  2EV0 A;  3DLA A;  2RGV A;  2R5Y A;  3LOC A;  3CLQ A;  4B09 A;  2G7U A;  1SVO A;  2VI6 A;  1R1T A;  3KYC B;  1Z0X A;  4MFD A;  3ASO H;  3AG1 H;  1JUP A;  1UST A;  4Z6Y A;  1LDD A;  1FIA A;  1HKS A;  2AQF A;  4HX4 A;  4BBR J;  1LPQ A;  1YX5 A;  1X3Z B;  4A93 J;  4BKX A;  1YO5 C;  2VOP A;  3HZJ A;  3OSF A;  4A3B J;  1K79 A;  3S17 J;  3QP6 A;  4KJZ A;  3DLL F;  3E6B A;  4EJW A;  1WH7 A;  3GLL A;  4HLX A;  2LSO A;  4F91 B;  5FLX K;  1S8N A;  3PNT A;  4C3I J;  2LF7 A;  3SFZ A;  1DGW Y;  5DTD A;  1W1W E;  3BR5 A;  4CUG A;  1T2K A;  3HOY J;  1PUE E;  2FNA A;  4J00 A;  4IHS A;  4F93 B;  3JAM K;  3JSP A;  2L7K A;  5LRR A;  3H0D A;  1BR2 A;  3CF5 F;  2A68 F;  3FIS A;  2ZME C;  3RPQ A;  3ZMZ A;  3SZP A;  3BZC A;  2BW3 A;  1HBX G;  1ZTR A;  1V5E A;  3ZMV A;  2WB1 A;  3P7N A;  3E7L A;  3RZD J;  3QU6 A;  2D45 A;  4EEF G;  2ESH A;  2G7H A;  3DF8 A;  2R7D A;  4RS8 A;  2LY2 A;  4XMY A;  5KAI C;  1D3Y A;  1I27 A;  1LKX A;  2VB6 A;  1IUY A;  1BC7 C;  3BTJ A;  1KZH A;  4X1E A;  4G6Q A;  5EJC A;  3GEZ A;  4XRS G;  4KA4 A;  3RKW A;  1IN8 A;  5FRM A;  3JTH A;  3J81 K;  5FRO A;  3R61 A;  2QQB A;  2E60 A;  3BDD A;  1DGR M;  1IGN A;  2WWY A;  2M34 A;  3R0J A;  3U21 A;  5LLQ A;  5FKN A;  4BQN A;  4BAC A;  5BNG A;  4XK4 A;  2ICW G;  2W82 A;  3BR2 A;  1V4R A;  2WC2 A;  4IJA A;  3ZQH A;  4WCG A;  1MBE A;  4CDG A;  2DQR A;  2PMU A;  2X1C A;  2HR3 A;  2KIM A;  5FFX A;  1J2X A;  5HDK A;  3IRR A;  4AUX A;  2JSC A;  1IUF A;  4MNU A;  1QPI A;  2QLZ A;  2MYS A;  4HV5 A;  1FLI A;  1QO0 D;  1D1C A;  3K69 A;  4UB6 C;  2K7L A;  5CVU A;  3RJP A;  5IP6 A;  3HRS A;  4UY8 I;  2Y0M A;  1U5T A;  1AA7 A;  3VPR A;  3DV8 A;  2CWE A;  3ROU A;  3F8M A;  2EIJ H;  1NTC A;  2F5E A;  3NEU A;  4RDU A;  1R00 A;  4B1R A;  5E17 F;  5F0F A;  1VQL I;  2ZJP F;  5DCF A;  1BIA A;  1MH3 A;  4IHY A;  1FNN A;  4S04 A;  1YW7 A;  1B9M A;  3DTK A;  5LHH A;  3SHF A;  1O3Q A;  1D0X A;  3GTK J;  1I50 J;  3MZH A;  2BZT A;  3CUO A;  4XR6 A;  3FHZ A;  1SFK A;  3PQJ A;  2A61 A;  2KMU A;  4GGG A;  1MSE C;  3O3K A;  1F5T A;  2QQA A;  4RMN A;  3TMO A;  2W84 A;  1G3W A;  1YYV A;  1MZB A;  2KZV A;  2RRE A;  3EYY A;  4RAG A;  4ZDP A;  1HLV A;  3F72 A;  2VBY A;  4WXC A;  3RKQ A;  2L7M P;  2DA7 A;  4X0G A;  2FMY A;  3KIO A;  3MKZ A;  1ITY A;  1HDP A;  4G7Z F;  2F2E A;  5TJJ A;  1QZZ A;  2LK2 A;  4BQQ A;  2E34 A;  1BOA A;  3C7J A;  1PUF B;  4DOZ A;  2M4G A;  1KU9 A;  2D1V A;  5CVR A;  3WG7 H;  1JT0 A;  2YPR A;  4G12 A;  2CO5 A;  1E3P A;  3BR0 A;  2VT3 A;  3BQZ A;  4XSX F;  4P9U A;  1XB4 A;  4E7H A;  1SFE A;  1WFX A;  2KHM A;  1QPM A;  1X1P A;  1JE8 A;  4OIP F;  1FBQ A;  3PNY A;  5CKT A;  2BE5 F;  3QYE A;  5ED4 A;  2O5R A;  4UVB A;  4L9J A;  2KJC A;  2JA5 J;  2ZO4 A;  2R7W A;  1ETY A;  2V7F A;  1IRZ A;  2CSO A;  2DFE A;  3FXL A;  3BG3 A;  5TIS C;  4AIJ A;  1A6I A;  2ZME A;  4IOA F;  2KKO A;  1R4M B;  3V42 A;  1I3Q J;  2VBX A;  1HKQ A;  3SDG A;  4D5C A;  3S15 J;  2JA7 J;  1SMY F;  2ME0 A;  2DOF A;  2L9R A;  5GAG J;  2CFX A;  2DT5 A;  4IRH A;  3PUF A;  2WAF A;  3IAS 2;  4BJ6 C;  2QA4 I;  2YSR A;  1HW2 A;  2MD5 A;  1MJB A;  2WBM A;  4XRM A;  1QNT A;  2ZFU A;  4DYQ A;  2GOX B;  5FKM A;  3LSP A;  2WAQ N;  3HOV J;  2GA1 A;  2BHY A;  3CCY A;  4CSW A;  2R92 J;  3ONQ A;  3HOT A;  2UXN A;  3FF5 A;  4LMY A;  4HF1 A;  3ESW B;  4PFP A;  3W2A A;  2M87 A;  2K27 A;  4XRF A;  4EM2 A;  1STZ A;  3T5X A;  4A69 C;  2BOL A;  2HKX A;  2B63 J;  2UWM A;  3PFY A;  5HDN A;  5FGM A;  3DWL E;  2CUJ A;  1B1B A;  2DBB A;  1HC8 A;  1BOB A;  2OCE A;  2TDX A;  3I59 A;  2W48 A;  1LNW A;  2X48 A;  1S7A A;  4ZZL A;  5FLX Z;  1BI3 A;  1T8I A;  4Y52 J;  3HSR A;  1X3W B;  3FMR A;  3S1R J;  5CLS A;  1O57 A;  1IRF A;  1W7P B;  2BEO A;  2BVM A;  3MVP A;  3TO9 A;  1X19 A;  2PMZ A;  1X4P A;  3HYI A;  4HDU A;  4OAY A;  2Z3Y A;  5J40 A;  1OQY A;  2BY3 A;  1EA3 A;  3CMM A;  2Z2S B;  3L1P A;  4DYC A;  2XPV A;  3JAM Z;  2O8K A;  4UNO A;  1Z91 A;  3CCS I;  3WTU C;  4NC6 A;  4R1H A;  2JUC A;  4LIT A;  2Q2E A;  4Q4Z F;  4JK1 X;  4KN7 X;  3CCV I;  4M9Z A;  4M73 A;  3OIO A;  4KT5 C;  3JRG A;  2VOO A;  4CYC B;  3GTO J;  5IP7 J;  2IS6 A;  3HB9 A;  2DOA A;  1ETX A;  1X2M A;  2Q8K A;  3M4O J;  1J5Y A;  1GV2 A;  2V9V A;  2RKH A;  3HGY A;  4PSW A;  5GPC A;  4HPQ A;  4PDK A;  2K9L A;  2UV1 A;  3F8N A;  3QYB A;  2DCE A;  1IDY A;  1I5Z A;  3Q9V A;  2LD5 A;  4ZC3 A;  2VPR A;  4MIM A;  3FKI J;  2HOA A;  1Z9C A;  1I39 A;  1S7O A;  2IGK A;  3F6V A;  1DQU A;  2HQR A;  3V7R A;  4KMU X;  2W7N A;  3OYE A;  1TWC J;  2PEX A;  1W36 C;  2HZD A;  1MD0 A;  1VQM I;  1WI3 A;  4FE7 A;  3LWF A;  1E3H A;  4YFK F;  1Y39 A;  5FD5 A;  4A3L J;  1ZN2 A;  2DT6 A;  1OCO H;  1PP8 F;  2K9N A;  3K70 D;  2HYG D;  2K9Q A;  4RAY A;  3WHB A;  2ZFW A;  5K7H A;  2EK5 A;  1R7J A;  2DMT A;  3LQQ A;  1XMA A;  1GT0 C;  2JVG A;  3O8H A;  2BGC A;  1B8I B;  2FE3 A;  2WV0 A;  3GWZ A;  4HOB A;  4AYB A;  4AVZ A;  2KRH A;  1ONV A;  1H88 C;  1WKM A;  4KIB A;  3CF2 A;  1D1A A;  1YOV B;  3GFI A;  4BL0 B;  2STT A;  1S3J A;  2NVQ J;  2ELJ A;  2BHZ A;  3H3Z A;  1B4A A;  1MBH A;  1XD7 A;  3RPU D;  4CCK A;  4XRS A;  3OYD A;  1B9N A;  4LG0 A;  3WOD F;  4IHV A;  4OIQ F;  1LE8 B;  3ZMS A;  1WJA A;  2JPC A;  4LIV A;  2W4S A;  2LRE A;  3E5Q A;  5HS8 A;  1TWF J;  4EJU A;  2HQA A;  3CUQ C;  3OV8 A;  4QPQ A;  1BN5 A;  3ZOB A;  3DFG A;  1G3T A;  4HW0 A;  1QGP A;  3TQN A;  4A3C J;  4AC0 A;  3M8F A;  1UEL B;  3GME A;  3ZPL A;  1X1D A;  3IKV A;  1XCB A;  3GBG A;  4I09 A;  5EG0 A;  1VND A;  2XAS A;  1JUS A;  2EIL H;  1K7A A;  5E3O A;  3I55 I;  1SC7 A;  5KVR A;  2F4O B;  2L0K A;  4BBS J;  1TNS A;  3BR1 A;  3AG3 H;  2FOK A;  2ELH A;  3PSI A;  3KPH A;  5IYB J;  3CTA A;  1N75 A;  1XGO A;  2BVL A;  5E1X A;  3CJR B;  4HEA 2;  2PJR A;  4HST A;  1Y1V J;  2CW7 A;  5LGT A;  3U1K A;  2JSP A;  1GV5 A;  1WJE A;  2ZNY A;  3HKZ N;  5GP9 A;  4BAY A;  4ENM A;  2VUM J;  4A3D J;  1XS9 A;  3BRO A;  2B7E A;  1TWH J;  2HQ5 A;  1QZY A;  3V7S A;  5IP9 J;  2XF7 A;  1OR7 C;  4CIC A;  4GO1 A;  5JI6 A;  1U9O A;  1T95 A;  2GIZ A;  2MC4 A;  1XSD A;  1S9H A;  4N9I A;  4B8X A;  1WZ2 A;  4OAZ A;  5DCM B;  3OYM A;  5JHF A;  5LGU A;  5GAD J;  1GDT A;  2XF6 A;  3KP6 A;  4IXA A;  3KET A;  4C3J J;  4P96 A;  2IS4 A;  5LD2 C;  4XLC A;  1KQ0 A;  3R0A A;  1H8A C;  3REO A;  1H9T A;  2EFQ A;  1EH8 A;  2LDU A;  2LH9 A;  2E71 A;  2DLL A;  4I02 A;  3HBL A;  1A6Q A;  2HOT A;  4V19 K;  1K6Y A;  2VQC A;  1ZQ3 P;  1R6R A;  2LY1 A;  2LMD A;  4BNC A;  1K83 J;  3PJR A;  2E2J J;  4ABZ A;  1I3A A;  2QSF X;  1SD7 A;  3OL4 A;  4WXH A;  1IN4 A;  3SZT A;  4IVN A;  5L3B A;  3J80 K;  1Z1D A;  3H36 A;  1LDJ A;  3L09 A;  2EJR A;  3HRT A;  4D7M A;  3S2H J;  1ENH A;  3I53 A;  3A01 B;  2HPM A;  2M9H A;  2W57 A;  3HG9 A;  5HNF A;  1VTN C;  3WGH A;  4RM3 A;  2HS5 A;  3FXQ A;  2E1N A;  1XSV A;  2M8G X;  4AVP A;  2V6E A;  1YJ9 I;  1Y6I A;  5EDN A;  3CC7 I;  3CCQ I;  3IHU A;  4OIO F;  1JHH A;  2C6Y A;  3K4B A;  4HNU A;  3GFM A;  2I8D A;  2IA0 A;  4E7I A;  3EYI A;  4HV6 A;  5E1Z B;  4GYG A;  2KJB A;  5FFZ A;  2LYC A;  3ZMD A;  3L2V A;  4M3E A;  2YU9 J;  2FX0 A;  3BTC A;  4PJN A;  3O6B B;  3SFI A;  1R1V A;  3MKL A;  1OCR H;  3HUG A;  2MSY A;  1ETW A;  3FM3 A;  2JA2 A;  3QPS A;  3S16 J;  4KUM A;  3WHC A;  1AU7 A;  2KZG A;  4HZF A;  1VQO I;  3ZRG A;  2XKO A;  3PQK A;  3KEQ A;  2DA3 A;  3SJM A;  5TGT A;  4CYD A;  4UUV A;  1V54 H;  3CP2 A;  3FK6 A;  1WJC A;  3RKY A;  3W6V A;  4IF4 A;  3SEZ A;  3OYF A;  5DM7 F;  3E97 A;  2O8X A;  3D5R C;  5F04 A;  1YE9 A;  3R4K A;  1P4W A;  3D0S A;  4E7Z A;  1OFC X;  5J6X A;  5IY5 H;  2KDZ A;  4ENJ A;  2LP0 A;  2ZXH A;  2K02 A;  1D5Y A;  2K3F A;  5EGO A;  2FBI A;  4XLF A;  1W5S A;  2FSW A;  3W3C A;  2V9P A;  1G2H A;  3EUK L;  3KZY A;  4LK1 F;  1DPU A;  3PNV A;  3BT9 A;  1VQN I;  2VJJ A;  2M7B A;  3HOX J;  4L18 B;  1FSH A;  4N9H A;  3GW2 A;  4ENN A;  3G71 I;  4GDF A;  3EET A;  2F5C A;  4YFN F;  2KIU A;  3BTI A;  4A6D A;  2ZCW A;  4A3I J;  3LA2 A;  5D4S A;  3JRC A;  3OR2 C;  2NS0 A;  1KGS A;  3WU2 C;  3HPH A;  3E6M A;  4ZZD A;  1VI0 A;  3CCR I;  3WTW C;  4XLH A;  2XGD A;  2QGU A;  5H2F C;  3PFI A;  4UVC A;  4XID A;  4UXN A;  1XGN A;  2QZ8 A;  1XX5 A;  4LD5 A;  1BI0 A;  4I01 A;  1YI2 I;  2AHQ A;  3MAJ A;  2L02 A;  1HKT A;  4I7H A;  2IAI A;  4BE1 A;  3ZQQ A;  5L3E A;  2XIG A;  3G73 A;  3PL8 A;  5GTH C;  1Y0U A;  2DQL A;  2VL8 A;  4UUT A;  3TL4 X;  1FOK A;  2CG4 A;  2MBF A;  3VOD A;  1APL C;  3FBN B;  1BL0 A;  4E70 A;  5K5O A;  1IXR C;  2HOS A;  4OIN F;  1T6S A;  3DPT A;  1MIJ A;  1VQ7 I;  1BBY A;  2WAE A;  3MQ0 A;  2P5L C;  2HYF A;  2IXS A;  4C2M J;  3F22 A;  2OF7 A;  4OMY A;  4RB3 C;  4X6A J;  2Y0S N;  2CJJ A;  3M8E A;  4ZYD A;  2UZK A;  1IG7 A;  2LKS A;  4J19 A;  1FY7 A;  1OMI A;  4RGR A;  4DBR A;  2XKP A;  3OS2 A;  2FBK A;  4JOM A;  4ZDO A;  4DJA A;  4DBQ A;  4ZYG A;  2X1D A;  2RQP A;  1FOX A;  3HL2 A;  2LFB A;  3RCO A;  4BY1 J;  4LB5 A;  1E0E A;  1P92 A;  5ICF A;  3BJA A;  3P5J A;  3S3M A;  3CC4 I;  1UHM A;  2VKD A;  2IGN A;  5AIP A;  4AWX B;  3G2B A;  3S1Q J;  2JWT A;  3BPX A;  3SDB A;  3DTE A;  1JT6 A;  1J09 A;  2XHK A;  1E2X A;  3VSL A;  5JVG F;  1BA5 A;  2GOM A;  5LEK A;  5CYV A;  2NXN B;  2NNN A;  2FML A;  3DPL C;  3BCB A;  1L0O C;  2JTV A;  3E6C C;  1IXC A;  2K4B A;  4O6J A;  2ZSH B;  2QKL B;  3RQI A;  3SXY A;  2BV6 A;  1BW6 A;  3HSE A;  3H35 A;  1I6H J;  2QVO A;  3TP0 A;  2B9S A;  3S1N J;  3J80 Z;  1L3L A;  2CQ7 A;  3WTY C;  2DPU A;  2QWW A;  1WVR A;  3A0H C;  3BJO A;  5CQE A;  3RZO J;  5ILS A;  2LRD A;  1ZG3 A;  4A0X A;  3T0Y A;  2CQN A;  4FIS A;  4M72 A;  2HTS A;  4KIF A;  4WWC A;  1TC3 C;  4EAT A;  3OSG A;  1CF7 B;  2AS5 F;  1R5I D;  5D5U B;  3H9J A;  3ZQC A;  1O3S A;  1ZRC A;  4C3H J;  2I10 A;  2F5V A;  1FYM A;  4II2 A;  3RIR A;  4A5M A;  4IRG A;  1JGS A;  2OC6 A;  2WY7 Q;  5KCM A;  3ZQG A;  3TW7 A;  1IC8 A;  4Q5S F;  1RUN A;  2XGC A;  2G0E A;  4TV7 A;  5C4X J;  3TW6 A;  5D6F A;  5K7Z A;  5DM6 F;  1N25 A;  2GXB A;  1MDM A;  1LQ1 A;  1R71 A;  1XG1 A;  3H3V K;  1P7J A;  3L2W A;  2HVQ A;  1BR1 A;  3RTR A;  1X2N A;  3OWT A;  5FLV A;  2VE9 A;  1YJN I;  4AIK A;  1UCR A;  3AKZ A;  2QSH X;  1W5C C;  4O3M A;  2M3A A;  1NG7 A;  3FIW A;  2QBY B;  2L3D A;  4Y13 A;  2CMP A;  1ZG5 A;  4YFX F;  2XV4 S;  1RNL A;  1DU6 A;  4PJ0 C;  4HNT A;  4A3K J;  1X3U A;  3IP4 B;  5E18 F;  2DA1 A;  2XGX A;  3WE3 A;  1TL8 A;  3W6K B;  2EA2 A;  5KNL A;  4U0Y A;  5ICG A;  1YRN A;  2HDC A;  2JPB A;  4BU2 A;  5A2Q K;  5E20 A;  4Y15 A;  4AU7 A;  2NVX J;  2BY2 A;  2EV5 A;  4MQV A;  1FBU A;  2XVC A;  2HOE A;  1QZE A;  4HA8 A;  3FK7 A;  2CUF A;  4ESF A;  3CMY A;  2QQ8 A;  4G6D A;  1GXQ A;  2H09 A;  2XAQ A;  1D8J A;  3LSH A;  3FXM A;  3K2Z A;  1OCZ H;  3OIQ A;  1K78 A;  1AKH B;  1JXS A;  3CJT B;  2DA4 A;  2ID6 A;  2WTE A;  3Q9S A;  2EFW A;  3NWS A;  3CZ6 A;  1W7P A;  2LC2 A;  1X1C A;  2F6C A;  3O2P E;  4NDL A;  2DXI A;  1JI8 A;  3CQZ J;  5M3M J;  2MGQ A;  2E5N A;  4OMZ A;  2EWN A;  3FMS A;  1JKR C;  4XBF A;  1EF4 A;  2HQN A;  1BJZ A;  2EZH A;  1V3F A;  5K5R A;  1J9I A;  1PJR A;  1G3S A;  3D5S C;  5BOX A;  1JUM A;  3K1N A;  5GPA A;  1FJL A;  1WJD A;  4Q48 A;  1LEB A;  3EUH C;  4A12 A;  1D8K A;  3GZ6 A;  5D5W B;  2BXZ A;  1MNE A;  5HS9 A;  5ICC A;  5LEJ A;  4G9Y A;  1P4A A;  4P5O A;  1JKP C;  1UMQ A;  1P6R A;  4JYK A;  3V8J A;  1W0T A;  1ZLK A;  1HW5 A;  2YU3 A;  1WWX A;  2F48 A;  3WG9 A;  4M9S A;  1FZP B;  1M1E B;  2ISZ A;  3G1O A;  4PGH A;  1U3E M;  2A6T A;  4KMF A;  4A3G J;  3BG6 A;  3DEU A;  3QOP A;  3PO2 J;  1WSU A;  4PUS A;  4ZJZ A;  5HS7 A;  4FTH A;  2L4M A;  5KHD A;  1AHD P;  1R23 A;  3K9T A;  1HOM A;  3TOB A;  3V7C A;  2HXI A;  2VN2 A;  2BY1 A;  4C30 A;  1N77 A;  3IH4 A;  2IGM A;  1R9T J;  2VKE A;  2GIV A;  2MA3 A;  5E3M A;  2PLY A;  2Y9Y A;  2JJ7 A;  3MKW B;  3IC7 A;  1BC8 C;  5H6R A;  4NQW A;  3TKY A;  2BXY A;  2ETH A;  2TRT A;  4A3M J;  1F4K A;  3ZXS A;  1HCR A;  4ANJ A;  2NRA C;  3KLN A;  1KQ8 A;  1MMG A;  2FQ3 A;  2V26 A;  3CJN A;  3NAU A;  4ZTJ A;  1XGM A;  1H0M A;  3QPT A;  3BR6 A;  4XIC A;  3K4M A;  4MTD A;  2NAZ A;  3KX2 A;  3KYL A;  4KYW A;  2O3F A;  1Y8Q B;  4I0B A;  1DP3 A;  5FO5 A;  2EV6 A;  1T56 A;  1SEU A;  3DKW A;  2QEX I;  2GZW A;  2AXL A;  2IGO A;  3LFK A;  2XDV A;  3DEE A;  5LHI A;  1SAN A;  2ZJQ F;  2P7V B;  4YEJ A;  5BPD A;  1HF0 A;  4XKC A;  2R5Y B;  3KYD B;  2JUG A;  2ADU A;  1SVM A;  3QQA A;  4CA0 A;  5JVT A;  1DUX C;  2DA5 A;  2OZU A;  4PJL A;  5IPA A;  2HVR A;  3VYS B;  2LF8 A;  2KIS A;  3E5X A;  4HF2 A;  2RN7 A;  4EMS A;  3MCZ A;  3JRF A;  2L9N A;  4EJT A;  1OPC A;  2W00 A;  2VIX A;  2F4M B;  2LY9 A;  4NC8 A;  4CCL A;  4BXX J;  3TOA A;  1O7F A;  2EFP A;  3RYP A;  4V2G A;  5HLT A;  3OL3 A;  4IHX A;  4HNV A;  3KP5 A;  4GFB A;  5EEG A;  5LGN A;  2X51 A;  2Y2Z A;  3HTU A;  3IH3 A;  4XQF A;  3R6S A;  4ESJ A;  4FX0 A;  2R7U A;  1O3R A;  5DCM A;  4L5J A;  1MMS A;  5ERI A;  2W1O A;  2DU9 A;  1Y1W J;  4RAF A;  2BBY A;  2CH0 A;  1TWG J;  2A6H F;  2DO7 A;  1EKE A;  1LFB A;  3ERM A;  4DQ2 A;  1SD5 A;  2COB A;  3B73 A;  2CV0 A;  5B1A H;  3R60 A;  2NS8 A;  3DEW A;  4U0W A;  1MSF C;  1DDN A;  2BW3 B;  3K4J A;  2D1H A;  3NAR A;  3Q0W A;  2R7S A;  4GRI A;  4KN4 X;  4FE4 A;  2XB0 X;  3E3V A;  5A2Q Z;  4PSX A;  3WU1 B;  1FP2 A;  1FT9 A;  4MLO A;  2J5O A;  1RI7 A;  4Z2Y A;  2XRO A;  1D0Z A;  2XRN A;  2CW0 F;  4HX8 A;  2R0Q C;  2DOD A;  4A3E J;  4IOC F;  4RB1 A;  4BEH A;  1YTY A;  5B3S H;  2NVU B;  1I1S A;  4CCO A;  1U8B A;  5L3F A;  1ZRE A;  2H27 A;  1YS7 A;  2VQH A;  3E0J B;  4H4K C;  3ZN0 A;  4FQG A;  1YW8 A;  5CJ9 A;  1AWC A;  4G8X A;  3P9K A;  3J81 Z;  2KDO A;  4LFU A;  5CVI A;  3CES A;  5EZH A;  3FXJ A;  1KA8 A;  3F0C A;  2YX4 A;  4UV8 A;  5EYR A;  2Z9O A;  2WV1 A;  5IYD J;  4S0H B;  2PQ8 A;  2V9K A;  1MBG A;  3VOE A;  1UJ8 A;  4ZDL A;  3UNG C;  1ZYR F;  1J7K A;  4BHC A;  2K40 A;  1F9N A;  4NBQ A;  1Z21 A;  1YJW I;  4RB2 C;  1U5T B;  3CO7 C;  4WXD A;  1C0W A;  3NRV A;  2CFO A;  1JKQ C;  3K4C A; 
#chains in the Genus database with same CATH homology
 2FX0 A;  3BTC A;  3S2D J;  3SFI A;  1LFU P;  3MKL A;  1T33 A;  2MSY A;  1ETW A;  1B8I A;  3QPS A;  3S16 J;  3LSG A;  3WHC A;  1AU7 A;  3GTJ J;  1FTT A;  2XB5 A;  3HM5 A;  5E3N A;  2DA3 A;  3SJM A;  4QSH A;  1MBJ A;  1CQT A;  1WGX A;  3FK6 A;  3W6V A;  4DW6 A;  2WB1 N;  4M6V A;  1P7I A;  1LE8 A;  3HOZ J;  2LKX A;  3ZQL A;  5F04 A;  2KDZ A;  1ZR2 A;  1OFC X;  1RR7 A;  3IV5 A;  4BY7 J;  2LP0 A;  2LTP A;  5JLX A;  1IJW C;  1D5Y A;  4M3F A;  2HI3 A;  5EGO A;  1MNM C;  3O8G A;  1QVU A;  2CRG A;  2K9S A;  1G2H A;  2R5Y A;  3LOC A;  2VI6 A;  4IHW A;  5HOD A;  3BT9 A;  3HGG A;  1Z0X A;  4MFD A;  3HOX J;  1E3O C;  1JUP A;  1XC5 A;  1FIA A;  4BBR J;  4DYR A;  4RBO A;  4A93 J;  3BTI A;  1VF9 A;  4BKX A;  2R5Z A;  1TWA J;  3JRC A;  4A3I J;  3GTM J;  3OSF A;  4A3B J;  3S17 J;  2R5Z B;  2RAE A;  2JA8 J;  5M5W J;  1VI0 A;  3JRE A;  3LSJ A;  3K7A J;  1WH7 A;  2XGD A;  1ETQ A;  4XID A;  3BR3 A;  2DMQ A;  4C3I J;  5DTD A;  2AHQ A;  3BR5 A;  3JRA A;  2ELK A;  3K2A A;  2X9D A;  3HOY J;  2IAI A;  1RPW A;  1YRN B;  3TP3 A;  2E2H J;  2XPW A;  4UUT A;  3IH2 A;  2QCO A;  3FIS A;  3HEF A;  1APL C;  2H1K A;  4I76 A;  3LSR A;  1BL0 A;  1ZTR A;  1Z77 A;  3E7L A;  3RZD J;  4EEF G;  2QF7 A;  2HOS A;  1A5J A;  4JP0 A;  1FTZ A;  2M0C A;  3BTJ A;  2GLO A;  4X1E A;  3C2B A;  4B3A A;  4XRS G;  5F1J A;  4C2M J;  2OF7 A;  4X6A J;  4M3G A;  2Y0S N;  2CJJ A;  1IGN A;  1IG7 A;  2M34 A;  3GTQ J;  5FKN A;  4J19 A;  5BNG A;  4XK4 A;  1F43 A;  3BR2 A;  3A01 A;  3ZQH A;  1MBE A;  2LFB A;  4BY1 J;  3HDD A;  2DMN A;  4AUX A;  1IUF A;  1QPI A;  2IEK A;  3S1Q J;  2JWT A;  5IP6 A;  1JT6 A;  5F0C A;  3VPR A;  1BA5 A;  3DCF A;  1UG2 A;  1NTC A;  4RDU A;  5JLW A;  4B1R A;  5IOZ A;  1UHS A;  5F0F A;  2GM4 A;  3S14 J;  1MH3 A;  4V2F A;  2DN0 A;  1IDZ A;  5M5X J;  2XSD C;  4IHY A;  2NVT J;  1ZK8 A;  3RQI A;  3PO3 J;  2MG4 A;  1POG A;  2CQQ A;  1BW6 A;  3GTK J;  1I50 J;  1I6H J;  1ETK A;  4W1U A;  3JRH A;  3TP0 A;  1W0U A;  3S1N J;  2L7F P;  1IV6 A;  1MSE C;  3I4M J;  3RZO J;  3HOU J;  1GUU A;  2P81 A;  5F08 A;  1HLV A;  4FIS A;  3RKQ A;  2L7M P;  1S7E A;  1VFC A;  1TC3 C;  2DA7 A;  2M2E A;  3OSG A;  1ITY A;  2O9L A;  1HDP A;  3ZQC A;  2LK2 A;  1DU0 A;  4C3H J;  2I10 A;  2VKV A;  1PUF B;  2LLK A;  1JT0 A;  3LNQ A;  5EEA A;  4G12 A;  3ZQG A;  3TW7 A;  1WPK A;  5IYC J;  1IC8 A;  2XGE A;  2XGC A;  2G0E A;  5J1Y A;  3BR0 A;  5C4X J;  3TW6 A;  3BQZ A;  5K7Z A;  2JK3 A;  2PMZ N;  4QIW N;  1XG1 A;  3H3V K;  2DTZ A;  1P7J A;  2FQ4 A;  4UUS A;  1X2N A;  2JA5 J;  5FLV A;  2HYJ A;  1ETY A;  1IRZ A;  3ZQF A;  4QTR A;  3S1M J;  4UUS B;  1X58 A;  3BG3 A;  3BQY A;  4LOC A;  1RKT A;  1A6I A;  2DMU A;  3FIW A;  3Q0U A;  4D5F A;  1I3Q J;  2CU7 A;  3SDG A;  4D5C A;  3S15 J;  2JA7 J;  2ME0 A;  1DU6 A;  2L9R A;  1JJ6 C;  2FJ1 A;  3B6C A;  4A3K J;  2DA1 A;  5FJ8 J;  1H89 C;  5J1R A;  4XRM A;  4A3F J;  1ORK A;  4DYQ A;  1YRN A;  2H8R A;  5FKM A;  3LSP A;  1U9N A;  2E1O A;  2WAQ N;  5EG0 B;  3HOV J;  1MH4 A;  2DA2 A;  2NVX J;  3M3Y J;  3CCY A;  4D7N A;  2R7Z J;  2R92 J;  1NK3 P;  3FK7 A;  2CUF A;  2MW8 A;  2ECB A;  3CMY A;  5FKL A;  4A69 C;  2B63 J;  2JN6 A;  4M3B A;  1AKH B;  3G1L A;  2DA4 A;  2ID6 A;  1OJL A;  2W48 A;  1GVD A;  2X48 A;  3CDL A;  5J3L A;  4Y52 J;  2DA6 A;  2EZL A;  3S1R J;  1U78 A;  4AYB N;  4NDL A;  5FKO A;  2L7Z A;  3CQZ J;  3MVP A;  5M3M J;  2MGQ A;  5DS9 A;  1JKR C;  3GTL J;  1EF4 A;  1B72 A;  3L1P A;  1NK2 P;  4DYC A;  2XPV A;  3JRB A;  2O8K A;  1BJZ A;  2EZH A;  1ZGW A;  3PM1 A;  1B72 B;  4I6Z A;  3MN2 A;  2EBI A;  1JUM A;  5GPA A;  1FJL A;  1ETO A;  3OIO A;  3JRG A;  4CYC B;  3GTO J;  5IP7 J;  3HB9 A;  1ETX A;  1X2M A;  3M4O J;  4L5E A;  1JKP C;  1GV2 A;  5M5Y J;  3JR9 A;  1UMQ A;  3HGY A;  4JYK A;  5GPC A;  4FCY A;  1W0T A;  2CQX A;  3GTG J;  1MBF A;  1IDY A;  3G1O A;  2TCT A;  4A3G J;  2LD5 A;  2CUE A;  5K7F A;  2VPR A;  4MIM A;  3FKI J;  2HOA A;  2O7O A;  1WCM J;  3PO2 J;  1ETV A;  3H0G J;  3B6A A;  3ZQI A;  3UKG A;  2R93 J;  1TWC J;  3BG9 A;  4FTH A;  4JX6 A;  1WI3 A;  4FE7 A;  1RET A;  1AHD P;  1HOM A;  3D1N I;  4A3L J;  2YUS A;  2ECC A;  2HXI A;  2HDD A;  4MFE A;  2OPT A;  1PUF A;  2K9N A;  4DZP A;  2K9Q A;  3IH4 A;  1R9T J;  2VKE A;  4Y7N J;  2LR8 A;  3WHB A;  2Y9Z A;  1OCT C;  5K7H A;  5E3M A;  2DMT A;  1GT0 C;  2Y9Y A;  3O8H A;  1RKW A;  2JJ7 A;  2YS9 A;  1B8I B;  5E3L A;  4A3M J;  2TRT A;  1H88 C;  1HCR A;  4MO7 A;  3JRI A;  3NAU A;  2NVQ J;  2FD5 A;  1MBH A;  4XRS A;  3BR6 A;  4XIC A;  4IHV A;  1LE8 B;  2JA6 J;  4JX5 A;  2E19 A;  4JX4 A;  1T56 A;  4IEJ A;  1TWF J;  5EGO B;  9ANT A;  2KT0 A;  1Q1V A;  2LVS A;  1HDD C;  1SAN A;  2DMP A;  2IBD A;  3ZOB A;  1QVT A;  1HF0 A;  2R5Y B;  4A3C J;  4DZJ A;  2ID3 A;  2X6O A;  4AC0 A;  3QQA A;  1FEX A;  3GBG A;  2DA5 A;  2HXO A;  5EG0 A;  1VND A;  1JUS A;  5E3O A;  5IPA A;  2D5V A;  2L0K A;  4BBS J;  5C3E J;  3BG5 A;  2N8G A;  3TED A;  3JRD A;  3BR1 A;  3JRF A;  1ZR4 A;  5IYB J;  3Q3S A;  2LY9 A;  4BXX J;  2DJN A;  2XPU A;  4B4C A;  5EF6 A;  1Y1V J;  1JJ8 C;  3GTP J;  4V2G A;  1GV5 A;  1AKH A;  3HKZ N;  5GP9 A;  4HNV A;  4IHX A;  2VUM J;  4GFB A;  4A3D J;  1MBK A;  1XS9 A;  2Y2Z A;  1TWH J;  1F36 A;  2HQ5 A;  3IH3 A;  2EH3 A;  5IP9 J;  5FLM J;  1U9O A;  1WH5 A;  1Y1W J;  1JTX A;  1TWG J;  1GDT A;  1BW5 A;  3G1M A;  1LFB A;  3Q0V A;  5C4J J;  4W97 A;  5FKK A;  2COB A;  1SFO J;  4C3J J;  5EZG A;  2EQR A;  2NS8 A;  2ZB9 A;  3DEW A;  1MSF C;  2NOG A;  4A3J J;  2XRL A;  5F27 A;  1JTY A;  1H8A C;  3NAR A;  2GBY A;  3Q0W A;  1O4X A;  4FE4 A;  2XB0 X;  2AO9 A;  3HBL A;  2HOT A;  1JKO C;  4MLO A;  3BTL A;  1FIP A;  1ZQ3 P;  2ME6 A;  2R0Q C;  4CYC A;  3A03 A;  4A3E J;  1K83 J;  4M3D A;  2Y30 A;  2Y31 A;  2E2J J;  5M3F J;  2NS7 A;  4ABZ A;  3HOW J;  3I4N J;  1U8B A;  1ZKG A;  3A02 A;  5F0H A;  1RES A;  2E2I J;  4D7M A;  5J1U A;  3S2H J;  1ENH A;  3A01 B;  1QRY A;  2M9H A;  5IOY A;  5EZH A;  2EZI A;  1OCP A;  3F0C A;  5EYR A;  2WV1 A;  5IYD J;  2JMW A;  4S0H B;  2NVY J;  3OOU A;  2M8G X;  3QPL A;  1MBG A;  2EZK A;  5EDN A;  2K40 A;  5C44 J;  1K61 A;  1JKQ C;  4M3E A;  1JGG A;  2YU9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...