3MKLA

Crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
QPNMRTRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator gadX
publication title Crystal structure of DNA-binding transcriptional dual regulator from Escherichia coli K-12
rcsb
source organism Escherichia coli
total genus 35
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00165 HTH_AraC Bacterial regulatory helix-turn-helix proteins, AraC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mklA00
5F08A 1P7IA 2FJ1A 3HOVJ 2CQQA 3RZDJ 1ETXA 1UMQA 3SFIA 1LFBA 3HEFA 4JYKA 1ZR2A 3BG9A 2VPRA 4MIMA 2DTZA 4BY1J 2XPUA 1MBGA 1ETYA 1G2HA 1LFUP 2QF7A 2DMQA 2XRLA 1LE8A 5FKMA 4DYRA 5F27A 4X6AJ 3JRDA 4A3MJ 2DA7A 4DZPA 3L1PA 2X9DA 4M3BA 2XPVA 4QIWN 2VUMJ 3A01B 3Q3SA 4BXXJ 2P81A 2R7ZJ 3RZOJ 2IBDA 5IYCJ 1F43A 1XS9A 2COBA 2NOGA 3IH4A 4BBRJ 3S17J 3S2DJ 2ID6A 2WB1N 4B1RA 1HDPA 5EZGA 3D1NI 4FE7A 5M3FJ 3BR5A 1HOMA 5C4JJ 2LTPA 3K2AA 1JUMA 3FISA 3BG5A 5K7HA 3MVPA 2M9HA 2EZHA 3A02A 3GBGA 4A3LJ 3TP0A 3WHBA 5C3EJ 1IDZA 1B72A 1MNMC 4CYCB 3S16J 1VF9A 1NTCA 1Y1VJ 1WCMJ 1ENHA 1GVDA 2AO9A 2DA4A 2M34A 1U8BA 2NVXJ 1EF4A 3HOWJ 2E1OA 4I6ZA 5C44J 1OCTC 2MSYA 2KDZA 1MBJA 1AKHA 3GTKJ 3JRCA 1JGGA 3LSPA 3GTGJ 2NVYJ 1QVTA 5EGOA 4A3IJ 2JA5J 2JA8J 2YU9J 1I50J 4FTHA 3M4OJ 4DYQA 3TP3A 2R0QC 2YUSA 3F0CA 3BTIA 1X2NA 5J3LA 2O9LA 3B6AA 3GTMJ 5IYDJ 4M3EA 2XGCA 4A3BJ 4A3CJ 4UUSB 2EQRA 2LLKA 2NVTJ 3TEDA 3HOZJ 2VKVA 4UUTA 3JRGA 5FKKA 2DMPA 2M8GX 3TW7A 4A3KJ 1YRNA 2L7ZA 3RKQA 2CUFA 3GTPJ 5C4XJ 2GLOA 1W0UA 1W0TA 3JRBA 5FLMJ 3BQYA 4QTRA 2FQ4A 3B6CA 3S14J 3I4MJ 4HNVA 1JUSA 1D5YA 5IP7J 1XC5A 4X1EA 2Y0SN 2JA6J 5FKNA 4IHYA 1IC8A 3OSFA 1IUFA 5JLXA 4EEFG 4XIDA 4IHVA 4RBOA 1FJLA 2K9QA 2JN6A 1FTTA 3HBLA 2MG4A 2TCTA 3HGGA 1JKQC 3ZQIA 2CUEA 2X6OA 1U78A 2DA2A 2LP0A 1JT0A 4M3GA 2DA1A 2NS8A 2ZB9A 1IG7A 2HDDA 3NAUA 2LY9A 2DMTA 2HQ5A 2CJJA 4A3FJ 1IV6A 1QPIA 4A3DJ 1H89C 4IHWA 1RESA 1S7EA 3Q0WA 2IAIA 2XGDA 3LSGA 2R5YA 3QPLA 1MSFC 1RKTA 1FTZA 1ETVA 4IEJA 5GPCA 3GTOJ 4C3IJ 3GTLJ 1Q1VA 3TW6A 1MBEA 3CMYA 3WHCA 2DMUA 4CYCA 1WH5A 4MLOA 1NK2P 5EG0B 1WPKA 1WGXA 1NK3P 2W48A 3O8HA 2ECCA 4IHXA 4BKXA 1B8IB 2EH3A 4AYBN 3BG3A 1VNDA 1GDTA 1F36A 4A93J 4D7NA 4XICA 2H1KA 2HI3A 4B4CA 5EDNA 3HDDA 1T56A 3UKGA 1AHDP 1BA5A 5K7ZA 4XRSA 3IV5A 1TC3C 4MFDA 1MH3A 3FIWA 2MW8A 5F04A 1JKPC 1IDYA 4Y52J 1UHSA 3RQIA 3DCFA 4NDLA 1PUFB 2MGQA 1VFCA 2EZLA 4W1UA 3BR2A 1FEXA 1HDDC 1ZTRA 3HM5A 1LE8B 2ELKA 1X58A 3JRAA 5EF6A 3OIOA 3QPSA 2HYJA 3LSJA 4V2GA 3PO3J 5E3OA 2QCOA 1JKRC 1APLC 1RR7A 3G1MA 2GM4A 2JA7J 1GUUA 4DYCA 4JX4A 1I6HJ 1WI3A 1BJZA 1ETWA 2DJNA 3BR3A 3A03A 2XPWA 1DU0A 4JX5A 2K9NA 4Y7NJ 5J1UA 1O4XA 2CQXA 2HOAA 1U9OA 4G12A 5J1RA 2LFBA 5M5WJ 2O7OA 2R5ZB 2IEKA 2H8RA 2EZKA 3BTJA 1JTXA 3ZOBA 5FKLA 2OF7A 4GFBA 2VI6A 2HXOA 4BBSJ 3GTQJ 3BR1A 1UG2A 1B72B 3QQAA 2WV1A 2DA5A 4FCYA 3CQZJ 1ZR4A 3S1NJ 3HKZN 2HOSA 1Z77A 4QSHA 3OSGA 2NVQJ 1K61A 3S1MJ 2LK2A 2LR8A 4M3DA 1MSEC 1AKHB 4D7MA 1GT0C 2FD5A 5E3LA 5EGOB 2XB0X 2Y9YA 5EZHA 3SDGA 1GV2A 1OFCX 1POGA 4AC0A 2DN0A 2L9RA 2YS9A 4M3FA 5K7FA 1Y1WJ 3H3VK 1SANA 5E3NA 2ME6A 2LVSA 4MO7A 5M5YJ 1TWAJ 4ABZA 2DA6A 4D5CA 1XG1A 3HOYJ 1QRYA 4A3EJ 1BW5A 3A01A 3G1OA 1ZKGA 1OCPA 5EYRA 1BW6A 3HOUJ 1A6IA 4XRSG 1YRNB 3ZQCA 1SFOJ 2KT0A 3JRHA 3JR9A 1MH4A 3BQZA 3CCYA 1X2MA 5GP9A 5IP6A 3K7AJ 3DEWA 2PMZN 2HOTA 2JJ7A 2R5ZA 1ETOA 3FK7A 1OJLA 2E2JJ 4C3JJ 1H8AC 1HCRA 4B3AA 5FKOA 5F1JA 2R92J 1R9TJ 4XK4A 2B63J 5JLWA 1FIPA 1RETA 2JMWA 3PO2J 3H0GJ 1PUFA 3LNQA 3G1LA 5BNGA 4J19A 4V2FA 3S15J 4LOCA 3BR6A 4RDUA 2ID3A 5E3MA 3HOXJ 1TWGJ 1ZQ3P 4C2MJ 4A3JJ 3HB9A 3VPRA 2Y2ZA 2O8KA 2K9SA 1MBHA 2XB5A 5FJ8J 1K83J 3ZQLA 3BR0A 2GBYA 2G0EA 3HGYA 4S0HB 3LSRA 1P7JA 3BTLA 3S1RJ 5DS9A 2K40A 4BY7J 1TWFJ 1QVUA 4UUSA 1CQTA 1ITYA 3M3YJ 2WAQN 3O8GA 2OPTA 1MBFA 2ME0A 2Y9ZA 2CRGA 1BL0A 2X48A 3OOUA 1JUPA 4DZJA 1HF0A 1VI0A 3MN2A 3C2BA 2JK3A 2DA3A 5GPAA 1TWCJ 2M0CA 2Y30A 5IYBJ 4A69C 2R5YB 1ZGWA 1DU6A 5J1YA 4XRMA 3SJMA 5M5XJ 2CU7A 2AHQA 3JRIA 4AUXA 3MKLA 5F0HA 2RAEA 1I3QJ 1AU7A 1ETQA 2D5VA 5FLVA 4I76A 2LD5A 2L7MP 4C3HJ 1HLVA 3FKIJ 2R93J 9ANTA 2XGEA 1Z0XA 4MFEA 3ZQGA 1ORKA 3Q0UA 1JKOC 2E2IJ 3NARA 1IJWC 5F0CA 2L7FP 3PM1A 3I4NJ 1ZK8A 5HODA 2E19A 1ETKA 3W6VA 3Q0VA 3BTCA 4DW6A 2XSDC 1A5JA 1JJ8C 5IP9J 1RPWA 5F0FA 1IGNA 3BT9A 3IH2A 2LKXA 3ZQHA 2VKEA 3IH3A 5IOYA 1H88C 4L5EA 1T33A 5IPAA 3S1QJ 4A3GJ 1JJ6C 4W97A 2TRTA 3JREA 4M6VA 1JTYA 4JX6A 2I10A 2DMNA 2L0KA 2N8GA 4FE4A 2HXIA 5EEAA 3GTJJ 2EBIA 1GV5A 1RKWA 1TWHJ 5M3MJ 3LOCA 2ECBA 1IRZA 4JP0A 3S2HJ 2E2HJ 1WH7A 5IOZA 3FK6A 2Y31A 5DTDA 1FIAA 3CDLA 3E7LA 1E3OC 5EG0A 1U9NA 3ZQFA 1JT6A 1MBKA 4FISA 2FX0A 2M2EA 1B8IA 2NS7A 2EZIA 2JWTA 4D5FA 3JRFA
chains in the Genus database with same CATH superfamily
3IKVA 2FJ1A 1X3UA 2XUBA 2CQQA 3GFJA 1ETXA 5F64A 2XRNA 3SFIA 5HOOA 1QBJA 1D0XA 3HEFA 3LFKA 4HG2A 5GTHC 1N25A 4MIMA 3GEZA 4XKCA 3R0JA 4XONA 4M74A 2VJ5A 4Q47A 2R7DA 2QF7A 5D6EA 3MWMA 3BWGA 5KNLA 2XRLA 3ZMTA 3WGIA 2VQHA 3E6DA 1LE8A 3X2QH 3JRDA 2XAQA 2FXAA 4CCOA 2DA7A 5TRDA 2HQNA 1BR4A 1YW8A 2DI3A 1X1PA 1YX3A 3A01B 1G6NA 2CG4A 5FROA 1FYKA 2F5CA 2LH9A 5ILUA 1R5ID 4KJZA 3R60A 5GAHJ 4IQ4A 1R23A 4ON0A 4CCJA 4D0PA 1J7KA 3WTZA 3CCMI 1YITI 3PFYA 3IH4A 4BBRJ 1A31A 5DCMA 1Y8RB 2ID6A 1HDPA 1WJAA 5EZGA 5M3FJ 3OYLA 4TV7A 4ZZLA 3ZCOA 5GTIC 5C4JJ 1SC7A 5CVVA 4GXOA 4HF1A 1ZLKA 2LF8A 1AA7A 1JUMA 3FMRA 3BG5A 2NAZA 4BHPA 3J81Z 2FOWA 4U87A 1SVLA 1SFUA 5E8GA 3WGHA 4HZFA 2EIKH 3FBIB 3RI4A 5JVTA 4A3LJ 2FA5A 2QSFX 3KZYA 2LOOA 2FNAA 1MMSA 3QU3A 2H27A 3HSEA 2W25A 3OOPA 4CYCB 1HKTA 2VXDA 3S16J 3N97A 3BC8A 4LB6B 3ELKA 3IUOA 1I6XA 1Z3YA 2PLYA 1VQ8I 4LG0A 1GVDA 3FDYA 5TJJA 1CGPA 3ZMZA 3E6MA 1F1ZA 2E1OA 2KDZA 4XR6A 5D6FA 1YJWI 1AKHA 1LPQA 3LSPA 5EGOA 3DP7A 1GHCA 4NNJA 4CZZA 4MQ9F 3AG2H 3WTWC 2QQ8A 2K4BA 3ABTA 1FYLA 4C2UA 2V1XA 1ZN2A 3VYTB 2M4KA 3HUGB 3B6AA 2QSHX 3GTMJ 5CQGA 1MGTA 1VQ6I 3OYCA 3F8BA 1FPQA 5K5RA 3PQKA 2FMYA 3HL2A 4A6DA 2V6CA 2IS1A 2P0WA 2KQRA 1X3ZB 4J00A 2CV2A 2VKVA 3PNYA 2VBYA 4UUTA 2M30A 1Z05A 2OZUA 2DMPA 1W5CC 4KISA 3K10A 2OTJI 1YRNA 4IHTA 2UZKA 1B59A 2GLOA 5C4XJ 1W0TA 1OKRA 2L7KA 4F3QA 1MMNA 2Q2EA 3LSIA 4QTRA 5LHIA 3CO7C 3S14J 1OPCA 1R36A 3RPUD 2KRFA 2QQAA 1C0WA 4HNVA 3SFZA 4ZYGA 4UUVA 4E7SA 1ZYRF 3F8NA 2VE9A 2Y0SN 5H6QA 4G8XA 5K5QA 1IC8A 1IUFA 4EEFG 3TO9A 5L3BA 4IHVA 1IO2A 1Y8QB 2LRDA 5FD6A 3KETA 1U5TA 2F4MB 2PJRA 4E6KG 2MG4A 3HGGA 1JKQC 3L2WA 1Z1DA 2XF7A 3OS0A 4L5JA 3T8TA 2FE3A 2I8DA 3O6BB 2BE5F 5K5OA 2A69F 4A12A 2DA1A 2NS8A 5CYVA 5DM6F 3DLLF 4ESFA 1OLTA 2VASA 3F23A 1ZRDA 3HSFA 2JZYA 4XSZF 2CQNA 3KLOA 1X4OA 1QU3A 3E6BA 4EJWA 2Z3YA 3Q0WA 1TLHB 2NS0A 2R7TA 1U6GA 4S05A 4KIBA 3LQRA 3VOEA 1RIOH 1O3SA 1ULYA 4BDYA 1MSFC 3I53A 3ISPA 3DQVC 4Y13A 3H9QA 3IRRA 4RLFA 2QENA 5AIQA 3RKXA 1Q1VA 2ZKZA 3MD2A 2HTJA 3CMYA 2E71A 3K70C 1GXQA 4I7HA 2HTSA 2R7OA 3AL0B 2MC3A 1W5TA 2K5CA 4KN4X 1VNDA 5LGUA 1ZELA 5JFRA 4UVBA 2H1KA 4B4CA 5TISC 4E7JA 5EDNA 3OMYA 2R7SA 1R00A 1N78A 3C2GA 4MNUA 2ZFUA 1WFXA 3DEEA 2NRAC 2KRCA 5K7ZA 3K0LA 4OOIA 1PP8F 4DNCA 2X1EA 4WWCA 4WF2A 4MTEA 2ESNA 3FIWA 5ILSA 4U7DA 1IDYA 1S3JA 1BI2A 2X6WA 2OCCH 3BR2A 2XGXA 1LE8B 1IN4A 2ELKA 4XN3A 4LLLA 5EF6A 3OYFA 2BYVE 4MHGA 1W36D 3ZMVA 3I58A 1YHQI 3LSJA 2Z5UA 2HWVA 1APLC 4P5OA 3FXQA 1WQ2A 2HYFA 4E4HA 4KIFA 4OIPF 4I02A 1WI3A 1BJZA 1ETWA 2DJNA 5KVRA 3E5XA 3P9IA 5DCMB 2QBYA 4Q48A 4OU0A 1VQ7I 2H8WA 5JVGF 5CJ9A 2Z1DA 3LAPA 4LD5A 2Q8KA 1OYIA 4A6EA 4M6XA 3CTAA 3OL3A 5M5WJ 1W5SA 5LRSA 4N9HA 2H8RA 2DDBA 3LWFA 5FKLA 2OF7A 5LGNA 2VI6A 2XAHA 3EUHA 1XGOA 2E36A 3BR1A 5KK1A 2EFPA 1XDSA 2RQPA 1LVKA 3CMMA 2DA5A 2WWYA 1R5GA 2HOSA 1Z77A 1O7LA 3NWSA 1ERDA 4LG0B 3OYEA 1K61A 2GIVA 2ZJRF 1R4NB 1MSEC 5E17F 1AKHB 2HKXA 3M8JA 3D0SA 5E3LA 2A5YB 2K4JA 5EGOB 4BJ5C 3ZN1A 1GV2A 1OFCX 5FLXZ 3CCLI 2RC4A 3LA2A 4RM2A 1KQ9A 4HOBA 5E1WA 3HSRA 3ECOA 4FX4A 4E7LA 3MEXA 5E3NA 4GCVA 4OIOF 2A61A 2VB6A 4RGRA 2H1LA 4D5CA 3RCOA 5ERIA 2ZJ2A 4CXFA 3PIPF 1O3RA 1BW5A 2F5VA 3G1OA 2E5ZA 5EYRA 1FLIA 4HW0A 2GIZA 1YRNB 3H3UA 5HLTA 3SQNA 3CCYA 3C7JA 4EV0A 3K7AJ 2IS4A 4F7ZA 2GXAA 1ETOA 4CICA 2E2JJ 3QAHA 3FXOA 4YIFA 4FASD 4RM3A 3KFWX 1T2KA 4B3AA 4MTDA 5HNHA 2LNBA 4UVAA 1I1SA 2EV6A 4BGDA 3GWZA 4J01A 1YS6A 1XB4A 2R4GA 3LNQA 3I0TA 1U5TB 2VPLA 2PJRB 3HOTA 1FOXA 2F48A 4BXUA 4L9VA 2O03A 1GVJA 2DQLA 4RDUA 2Z2SB 4E70A 3V42A 2XC7A 1OYYA 3NRVA 3DKXA 3ZMUA 3K4LA 1MBHA 3GZNB 2CW8A 3KEYA 3CF5F 3CCQI 3BR0A 3HGYA 1H9GA 4S0HB 1D1BA 2PMUA 2K40A 1CQTA 1QVUA 3RPQA 2LKPA 1OQYA 5CLSA 2HPIA 1W1WE 5IT9Z 2Y9ZA 2OPTA 1DDNA 2DJIA 4PJLA 3W6KB 5GAEJ 2R5ZA 3C2BA 2WY8Q 4XKBA 4Q4ZF 2M0CA 2Y30A 1DU6A 4XRMA 4D9JA 3M8FA 4HNUA 4ANJA 2AHQA 3AKZA 3NQOA 3KIOA 2KLOA 2EV5A 1AU7A 3R0AA 2D5VA 4BH9A 2TDXA 5KAIC 2L7MP 4CUGA 1P4AA 3K1NA 3D5LA 4C3HJ 3FKIJ 4BJ6C 9ANTA 2CW0F 2BW3A 4MQVA 4DIQA 2VBWA 3OYDA 1BI1A 2KP6A 1NG7A 2OV7A 5DD8A 1ETKA 4CCMA 3L9FA 3GMEA 4F55A 2MLKA 4U0WA 2XSDC 1U2WA 1MMDA 5LHGA 4HDVA 2Y48A 1JJ8C 1PYVA 5IP9J 3GLLA 2P5VA 5F0FA 2RNGA 4KMUX 3ZR8X 3KYCB 1EV7A 4O5VA 2VKEA 1IV8A 2XAJA 2DYRH 2W24A 2HU9A 3CLOA 5E1ZB 3IP4B 1MMAA 1MD0A 4ZDLA 3F8CA 1T08B 1BIBA 4W97A 2TRTA 1G4DA 3HYIA 2DLLA 2KDOA 4YG2F 5D4RA 3MFKA 2E1NA 5DCFA 4EJTA 2OU2A 2MH9A 2I10A 4L0YB 2N8GA 2A3SA 4ZYEA 2QBYB 4CCLA 4D1QA 3LSKA 3RKYA 4EQQA 1VQ4I 4CGZA 4I0BA 4KYWA 3I56I 2KISA 2ECBA 2R7WA 1HKQA 5J6XA 2OC6A 2JQ7A 4PFPA 2DK8A 4K2EA 3ZQFA 1JT6A 1MBKA 2IRFG 1KU3A 3I54A 4ZDPA 1B8IA 3CJTB 3QYEA 1EKEA 3BZCA 1P4XA 4BHBA 2ETHA 2A6TA 4GYGA 3JRFA 3WTVC 3HTSB 4RAZA 3MZHA 1D8JA 2LY2A 5LFAA 4CHUA 1YI2I 2VONA 4WXHA 5D5WB 4M73A 1A6QA 1WJEA 1YTYA 2VPRA 4MGRA 4ZTJA 4ZYDA 2QA4I 1W7PD 2DFFA 1MBGA 4U88A 2E1CA 1ETYA 1G2HA 1LFUP 4EVIA 3T5XA 2DMQA 2QZ8A 4HAMA 4ENJA 1YJNI 4OAYA 3A2KA 4X6AJ 2RKHA 3ZQ7A 2CQKA 4R1HA 3GYHX 3BP8A 1IXSB 3K69A 2E1MC 1HKSA 2VUMJ 2LREA 2HYGD 1G8XA 2DOAA 5D8LB 4BXXJ 4B47A 1QO0D 2ADUA 3N4MA 3M1CA 4ZDOA 2IBDA 4EM2A 4XOTA 2P4WA 1XS9A 2COBA 2JPCA 2NOGA 3FXMA 4IOAF 1WI9A 3S17J 1R5HA 3GFMA 5H20A 4LLNA 1ONVA 4B1RA 4FE7A 1HOMA 3BR5A 3RQ4A 2CGPA 4LK0F 2LTPA 3L09A 3HJEA 4UXNA 2FU4A 3FISA 2DOFA 3AG3H 5K7HA 2G9WA 3CUQC 2EZHA 4AIKA 4UHTA 4G6QA 2LF7A 2CO5A 3P7NA 2L2OA 4KIGA 1WHUA 2X6XA 1Z67A 1Y1VJ 2EIMH 2V6EA 3BPVA 2EJRA 4AWXB 3J81K 2ZNZA 3CDIA 2LBFA 4EJOA 2M34A 2YR2A 1EF4A 1U5TC 3HOWJ 4CCNA 1OCTC 3RJPA 4E7HA 1OCCH 3FXRA 1BIAA 1LEAA 2X6YA 4BJTA 1MJ9A 2OA4A 5B3SH 4A3IJ 1CF7B 1LDKB 4HX8A 5EJCA 1I50J 2PI0A 2NOJB 3M4OJ 3QOPA 4DYQA 3TP3A 2WADA 3D5SC 2YUSA 3KPHA 3HRUA 3CCEI 5IYDJ 4M3EA 4A0ZA 3FZVA 3MMYB 3U21A 4A3CJ 4RB1A 4P55A 2EQRA 5LBQA 2JSPA 2LLKA 1P9QC 3TEDA 4IZZA 1W36C 2BY2A 3ASOH 4KNYA 3ERMA 3N05A 3V8KA 3FMQA 4QLCU 4Y33A 3E0JB 4PJNA 3OY9A 4G7HF 2L7ZA 1O7FA 2CUFA 2KJBA 3UNGC 3RKQA 3HIFA 2QYOA 3PSFA 1D5VA 3AAFA 5J4YA 4NUBA 2CFXA 1H0MA 2GA1A 3K6GA 2BHZA 2BW3B 2Q0OA 3ABUA 3GLXA 2VJIA 3F6VA 3KX2A 1D5YA 5L3FA 5IP7J 4R8HA 2A07F 1XMAA 2GZWA 3V7RA 1BBYA 1QHHD 3B02A 1O3QA 1YE9A 2A6EF 3IAM2 2EILH 4HX7A 3VWBA 2VKDA 3OL4A 2VBZA 3DKYA 4IHYA 2MD5A 3HZJA 4KITB 2P8TA 4ZYHA 1FJLA 2K9QA 4CA0A 3IKTA 2CYYA 4NC6A 3GUDA 1Z7UA 2XHKA 2BVMA 2TCTA 2L5QA 1VZ0A 5LEJA 3T0YA 2DDAA 1Z7LA 2MC4A 2OUMA 2X6OA 4JK1X 5DDGA 2UV1A 4IJAA 2DA2A 2X1CA 2LP0A 3FWEA 1LB2A 1JT0A 2Z99A 2YSRA 1A36A 3G71I 1VQKI 4QPOA 1BR1A 2VOOA 1E17A 1OCRH 1I1GA 5E8IA 4XMYA 4XBFA 3U1DA 2HDDA 1WZ2A 2UXXA 4XORA 4L0ZB 2DMTA 2V9KA 2HQ5A 2CJJA 5IY5H 5E1XA 1QPIA 1H89C 4IHWA 4AIDA 1NHAA 1B9NA 3CLQA 2FBIA 2IAIA 3LSGA 2F4OB 4CZCA 2R5YA 5B1BH 1RKTA 1KA8A 2HQAA 1FTZA 3C1DA 4IEJA 2NXNB 2W4SA 1D0YA 4P96A 5GADJ 3PFIA 4XNFA 1Z6TA 1MBEA 1MZBA 3WHCA 1WH5A 5J8CA 1NK2P 1WPKA 4IHXA 2ECCA 1LDDA 2MA3A 2ZCWA 3EUHC 5LEKA 1B8IB 1QGPA 2R7VA 3A1YA 4XL9A 2ISZA 4AYBN 4PSWA 2PQ8A 4JOMA 1MIJA 1F36A 2AXLA 4A93J 4LMYA 3ZN0A 1T56A 1V5FA 1QA6A 1P92A 3UKGA 1WWXA 1AHDP 3GVAA 3OYIA 3EUAA 4BNCA 1SMYF 2W7NA 4L5IA 1WJDA 4S04A 5F04A 3RPUA 3OYBA 2ZC2A 3RQIA 3QRFF 4NDLA 2EZLA 4NBQA 3HM5A 1OCZH 4PK4A 4BE2A 3JRAA 3QPSA 1UB9A 3V8LA 1SMTA 2CUJA 3I55I 1XD7A 5B66C 3PO3J 3ZXSA 2RVCA 5F6FA 1JKRC 2CH0A 1FYMA 2EV0A 2QWWA 2FUG2 3VFZA 2WAEA 3KZZA 3BLYA 3E5QA 4G7OF 3F6OA 1BI0A 4JX4A 4M71A 1Y39A 1I6HJ 2WBMA 3A03A 1ON2A 3KP5A 3OIQA 1DU0A 2VODA 3FM3A 3F8MA 4RAGA 1TQMA 2CQXA 2P5LC 1O4XA 2PMZA 1EJ9A 1TZLA 2V1DA 3TO6A 1YIOA 2LFBA 5D5XB 3ABMH 1TTYA 3GTQJ 1UG2A 2JVGA 1P2FA 2WV1A 4FCYA 3CQZJ 1ZR4A 2VKHA 4QSHA 1XDUA 3QWLA 1XSXA 3CP8A 3I59A 3CUQA 2LBFB 3J80Z 3JTHA 3K1MA 1SEUA 4H4KC 3KE2A 2PEXA 2UWMA 1ZG5A 4D7MA 5ICEA 4G7ZF 2CS3A 2W84A 5EZHA 3SDGA 5DM7F 1DPUA 2EFWA 3J7ZI 3FKJA 1POGA 3G73A 3R4KA 3E1SA 2GOMA 3DPLC 3QODA 5A2QK 3WU2C 2QLZA 2LVSA 1TWAJ 2H6CA 4OAZA 4HBLA 4FT8A 2DA6A 3HOYJ 1XG1A 2BXYA 1PVEA 3HPGA 5DD4A 3EETA 1ZKGA 3VEPA 1RNLA 1OCPA 3BJ6A 2QEXI 3SHFA 3TOBA 3EPZA 1K6YA 1A6IA 3ZQCA 4F92B 3JRHA 2VL8A 3JR9A 1X2MA 4NQWA 4IRIA 2IVMA 1QQIA 2FMLA 2ZMEA 3HG9A 4M9ZA 4UVCA 1YFHA 3BJAA 2OZ6A 3VSKA 3CC2I 4I09A 3B73A 3M1EA 4KA4A 2L4MA 3VB2A 1V4RA 2DPDA 4KUMA 2CV1A 1TNTA 3SYTA 1FIPA 3LSMA 1RETA 2JMWA 2Z16A 3GX4X 3FHZA 2VOPA 1J9IA 3UR3C 3I64A 4XLEA 2DQRA 2KZGA 5HDGA 3GFIA 1PUFA 1HSJA 3G1LA 5BNGA 1XSVA 4J19A 2MBFA 3S15J 4BYYA 3TDUC 2X0LA 2DT6A 1VQPI 3BR6A 3WGGA 1TWGJ 1EH8A 1ZQ3P 4C2MJ 5J8FA 2EK5A 1P6RA 4HV6A 4PJJA 3VPRA 2Y2ZA 2O8KA 2XAGA 2K9SA 1OMIA 5FJ8J 1K83J 1QNTA 4IRGA 4XN0A 1FBQA 4ESJA 3BOQA 2G0EA 3GF2A 4DQ2A 3Q9VA 3HC7A 3BTLA 2VBXA 4LG3A 1BOBA 3DTKA 2DFIA 3EQLF 4OIQF 3PSIA 2WAQN 3O8GA 3L00A 4MEYF 1XN7A 1R71A 2X48A 2L3DA 3OOUA 1JUPA 3CJQB 2VXZA 3WU0A 5LLQA 1HF0A 4JBAA 3JAMZ 1VI0A 4FETA 4A69C 2JK3A 2DA3A 3CJNA 2R5YB 2VQCA 1RC9A 5J1YA 2W00A 3CESA 2XVCA 3JRIA 3TOAA 2L9NA 1H9TA 4R79A 1I3QJ 4X0GA 2PBIA 4I76A 3V7CA 3J7YJ 4LB5A 3CCVI 3OYKA 1YG2A 1HLVA 2R93J 5F1RA 5CKTA 4C2TA 3ZQGA 1JKOC 2R7QA 3NARA 3FXLA 2K7LA 3ABLH 5F0CA 4OMYA 3S93A 2ZXWH 3MKWB 2OTLI 2M0MA 4IHSA 1XCVA 2E7WA 1WJCA 2YX7A 2ZXHA 3K4MA 4BQNA 1K4SA 2IGKA 2AXTC 1E0EA 1LFPA 4CDGA 3RIRA 3Q0VA 4OMZA 1T0FA 2P6TA 1RPWA 1IAWA 1OR7C 2NNNA 4XSXF 2ZFWA 3BT9A 4BL0B 1BC7C 1XGSA 2EFQA 1MJBA 3TQNA 2X1DA 4PUSA 5IOYA 3FHNA 1XGMA 2A68F 1E3HA 4ZZDA 4N4NB 1K6OA 2OQGA 1T8IA 4KFCA 2KIFA 3ML6A 1YQAA 3T1BA 4YFKF 1IUYA 3H5RA 1O3TA 1JJ6C 4RB0A 4A0XA 2VQLA 3I71A 3DF8A 1MDMA 2L0KA 2M7AA 2Y69H 4ETSA 2HXIA 4EGZA 2FEZA 2BY3A 2EBIA 3DWLE 2E1MB 1D3YA 3TKYA 5LD2C 3C3WA 1RKWA 3HRMA 1IF1A 1R1TA 2LYCA 2JUGA 5K1YA 1ACIA 3WTTC 3KP4A 1UHWA 3GO5A 2MD0A 2Y31A 1U0JA 2WC2A 4GDFA 5DTDA 3CDLA 2JRTA 3CF2A 2DFHA 3WTYC 3L2RA 2F4IA 4FISA 1WKMA 2M2EA 3E97A 1YX5A 3EUKL 2EZIA 3H1CA 2AQFA 1G3TA 4RMNA 2KRHA 2Q2EB 5F08A 1P7IA 3I59B 3CUQB 4KT6A 4HQEA 2FRHA 5FO5A 4O3MA 4IXAA 1WVRA 3RSNA 2WV0A 3WTUC 1LFBA 5HS8A 1ZR2A 2FOKA 3KEOA 4YFNF 3BG9A 5L3GA 2LSOA 1TBXA 2DTZA 3CZ6A 4BY1J 2FBKA 5D8KB 5KCMA 1LDJA 2F5EA 3CCRI 3F8FA 2ZBKA 3P5JA 2IP2A 3VYUB 2PG4A 1FP2A 3KZIC 5F27A 1PJRA 2BOLA 4A3MJ 3R6SA 3BG7A 4PGGA 4YRVA 3L1PA 3RDIA 2OD5A 4M3BA 2XPVA 2LY1A 4IVNA 1KQ8A 4V19K 1Z91A 2R7ZJ 5BS6A 3RZOJ 3QPTA 1TT5B 5IYCJ 3QU6A 2W57A 1F43A 1ZLJA 2OJED 4WCGA 1TQIA 1X1BA 3S2DJ 4CSWA 1SAXA 4NQWB 3D1NI 4UNOA 2QKLB 3EDPA 2ZMEB 4M9SA 1J09A 4I01A 1SVMA 5LRRA 1OYWA 2CUZA 2GOXB 3ZMSA 4IX7A 1HSTA 3S3OA 1VQLI 3PQJA 3OIPA 4RGUA 2M9HA 1E2XA 2OQRA 3TP0A 5BQTA 4RB2C 1L3LA 3REOA 5C3EJ 1B1BA 3RTRA 1IDZA 2Y0SA 1MNEA 1VF9A 1ENHA 3CMEI 3BJOA 2HQRA 2NVXJ 4PGHA 4I6ZA 4IKFA 3W6JB 2MSYA 4EM1A 3VYRB 2ZJQF 3GTKJ 3GTGJ 2NVYJ 2JA5J 2M1BA 3JTGA 3ZP5A 5BPDA 4HF2A 2ZO4A 3DBLB 2R0QC 2F6CA 3F0CA 4QWQA 4XM3A 4HEA2 5CVJA 4I98B 3DU5A 2XGCA 4A5MA 1KU9A 2K9MA 1S72I 3G6EI 4ESBA 1S8NA 3L2QA 3K4CA 2K9LA 2NVTJ 1V3FA 1FBSA 2WY7Q 3K4KA 1W7PA 2E7XA 4XLPF 3OR1C 5FKKA 1JHHA 1KZHA 2M8GX 1RI7A 5DEQA 3TW7A 3JW4A 2HVRA 1QZEA 2HR3A 3FXUA 1W0UA 3HHHA 3JRBA 3LMMA 3M9AA 2JUCA 1OCOH 4IO9F 3CO6C 3L2UA 3B6CA 3LAJA 3U9GA 2P5KA 1UAAA 4HX4A 2OBPA 3V4GA 2RV8A 1JUSA 1JGSA 3H0DA 4XKVA 1Z6RA 1XC5A 4X1EA 1TQPA 4IF4A 3GCMA 5FKNA 1B9MA 2DW4A 5JLXA 1V54H 4C9YA 2B9SA 2V4JC 3WE2A 1KONA 4BE1A 4G9YA 3HBLA 4P1WA 5GAGJ 4A5NA 3DFGA 2A6HF 1HW1A 2F5DA 2XKPA 2HDWA 3ZQIA 2EA2A 2L9SA 3PIOF 1FMWA 2LKSA 5JR3A 1UG0A 2GXGA 4GO1A 4M3GA 1Z9CA 4BAYA 4DBRA 2KJCA 2IA0A 3G3ZA 1OR7A 4A2UA 3OYMA 5KAFC 2ZB9A 1IG7A 1G3YA 5ED4A 3NAUA 3K70D 3CCJI 1MDMB 3QYFA 1MMGA 4A3FJ 1IV6A 2C6YA 2R7RA 1TL8A 3SEZA 4WX9A 4H0EA 4CCKA 5LHHA 2XGDA 2Z9OA 2L4AA 4RAYA 4Q5SF 3QPLA 4UY8I 4BQOA 4HA8A 3KP3A 3DPTA 4EM0B 3TW6A 4CYCA 2DPUA 3MCZA 4AIJA 1NK3P 3F22A 3OR2C 4BKXA 3Q5FA 2EH3A 3KEQA 1PP7U 3BG3A 1GDTA 4IL6C 4DBQA 2NYXA 2H94A 3RYPA 4D7NA 2HFHA 3LSHA 5JI6A 4AU7A 4XICA 4EATA 3HDDA 2IXSA 3WU1B 4HQMA 1BA5A 1WRJA 3IV5A 2IPQX 3K4JA 1MH3A 5HDKA 1AWCA 2RGVA 4Y52J 2GAUA 1UHSA 4N0BA 1ZARA 3DCFA 2STWA 2MGQA 4W1UA 5B5EC 3KYDB 1ZTRA 3DV8A 4NC8A 5L3DA 3V8JA 1FZPB 2B0LA 4RAFA 1P4WA 1FSHA 3JSOA 3MKZA 1B4AA 4V2GA 5E3OA 2QCOA 2JRMA 4XLCA 2FQ3A 2GM4A 1J5YA 4B43A 1DGWY 2O8XA 2VT2A 4DYCA 4ZH4F 1EH7A 2COMA 2ZSIB 1YLFA 2K3PA 3CMAI 5E79C 2GQQA 3QYBA 2NNYA 3H35A 4ZC3A 1G3SA 4JX5A 4NHJA 2K9NA 2D1VA 4Y7NJ 2OAZA 2QKMB 1U9OA 2ZMEC 1X1AA 4G12A 2GWRA 4L9TA 2O7OA 2R5ZB 4OWRB 1X1DA 2EZKA 1JTXA 4IQJA 3W2VA 2KZVA 3GW2A 4BBSJ 2HXOA 2PMHA 2ZJPF 1JE8A 3LSTA 4GRIA 2UXNA 2YU3A 1LNWA 1Y56A 3K4BA 1HW5A 1ZH5A 4LITA 4XLFA 3S1NJ 3HKZN 1Z3XA 2NVQJ 3S1MJ 2JA2A 2LK2A 2YPRA 1IRFA 2HGCA 2HNHA 1W4MA 3QP5A 3WTSC 3VYSB 3C18A 1F5TA 1B6AA 3W3CA 2FD5A 4E7ZA 4HLYA 1FWZA 2HKOA 2XB0X 2Y9YA 1X3WB 2H09A 1TP4A 4BXFA 2HOEA 3BG6A 3TDZC 3DXJF 1S9HA 3J80K 1PDNC 2DT7B 4BQAA 1G59A 2D2WA 2DN0A 1DUXC 4M3FA 2DCEA 3H3VK 1SANA 2OCEA 2ME6A 5M5YJ 4MO7A 1SAUA 4HLXA 4A0YA 4M72A 4ABZA 1IW7F 1QRYA 1UELB 4A3EJ 3IAS2 1W7PB 2M4GA 1R1UA 3IL2A 2M87A 3FX3A 5H6RA 1XCBA 1VQMI 2MLGA 3HOUJ 4XLHA 4B09A 1SFOJ 2K3FA 2KT0A 3K2ZA 3S3MA 3BQZA 5FGMA 3AFHA 4L9JA 5GP9A 1BJAA 5IP6A 3DEWA 1YS7A 1S7OA 2JT1A 2JJ7A 3ECHA 2HOTA 5FRNA 4DGWB 4LIUA 1K79A 1OJLA 2BVLA 1QZZA 2EA4A 2DO7A 2MFZA 5L3CA 1ZG3A 4ASNA 5J47A 4YFXF 3ZRGA 1JHFA 1USTA 4KICA 2B63J 3CD6I 3SZTA 2IA2A 3ASNH 2O0YA 1VQNI 4QPQA 5JHFA 2F5FA 4ITVA 2O6GE 5FRMA 2LG4A 4HF0A 1T0FC 3CC4I 5ICGA 3H92A 4LOCA 4CYDA 1MW7A 2ID3A 4BDZA 1UJ8A 5CVUA 2BHYA 3RYRA 4GYIA 2RN7A 1RRJA 1X1CA 1YJ9I 2IA1A 4B8XA 3ZQLA 3ZPLA 3ONQA 3ERED 3F72A 2YX4A 3LSRA 3KP6A 3WG9A 1P7JA 1XTAA 3DBHB 3S1RJ 1IZ1A 1S6LA 4BUPA 1J0RA 1TWFJ 4UUSA 1T39A 3ULQB 1ITYA 4YEJA 2JVHA 3M3YJ 1MBFA 2ME0A 3F21A 4HDUA 2CRGA 1BL0A 3WG7H 1IRXA 1SFKA 4DZJA 3MN2A 5CPRB 5IYBJ 2R7UA 1ZGWA 2FBHA 4G94A 5M5XJ 3MKLA 5F0HA 1YW7A 2EB7A 5FLVA 1ETQA 1KQ0A 3BDDA 2LD5A 2M7BA 1IN5A 1FC3A 2F2EA 3TBIA 3JAMK 2I5UA 1Z0XA 4YIIA 1ORKA 3Q0UA 4F52A 2E2IJ 3PNVA 1EA3A 4HRIA 1IJWC 3M07A 3LQQA 3HRSA 3PM1A 2R3SA 3TO7A 1ZK8A 1FT9A 4P9UA 5HVQC 3AG4H 1XPXA 3J7AY 2QSGX 2IGMA 2V9PA 3W6VA 2VIXA 4ZJZA 4II3A 6PAXA 1V5EA 1A5JA 2PN6A 1YO5C 2JTVA 2QM3A 5ILVA 3BY6A 1IGNA 2M5WA 1BR2A 4E7KA 4UV9A 4AVZA 3IH2A 1RUNA 2XF6A 3IH3A 5ICFA 4F93B 3TMOA 3TGNA 1T33A 3H5AA 2DU9A 5LGTA 4A3GJ 1FX7A 1Z21A 3JREA 2BEOA 3OS2A 1JTYA 3WTXC 4HSRA 2CFOA 1BC8C 4FE4A 3KYLA 4B48A 1GLNA 1GV5A 3SXYA 2RDPA 1TWHJ 1XGNA 5FLXK 1Y6IA 1O57A 1QPMA 4G6DA 4G6TB 3WODF 1I3AA 4OIRF 3OYGA 2CMPA 4I99C 4OINF 4RS8A 5D5VB 1WH7A 4AD9A 2WA0A 1FIAA 2RNJA 3E7LA 5D5UB 3S3NA 5EG0A 1U9NA 1IN8A 1KYWA 1VTNC 2MYSA 1TW2A 1TT0A 2NS7A 2QQ9A 2JSCA 2JWTA 4XQFA 3L2VA 4PZJA 1DGRM 4D5FA 2HVQA 5L3EA 4FX0A 2Y0MA 3HOVJ 1SFXA 2DTRA 4Y17A 3RZDJ 1FY7A 1UMQA 2VT3A 2Q1ZB 3E5UA 4LLGF 1RUOA 4UV8A 1J59A 4JYKA 1GXPA 2GA2A 2FNPA 2ZSHB 3ABKH 5HS7A 3A4CA 2ZXIA 4ZTFA 2XPUA 5DV5A 1ZRCA 1I27A 2XIGA 2D1HA 2XSJC 2IT0A 2VN2A 4ZYAA 5FKMA 4DYRA 1UCRA 4XLNF 3OYAA 1D8KA 4PFOA 3J7AO 1BN5A 5AIPA 4DZPA 2LC2A 4XLAA 3OS1A 1MKMA 2X9DA 1T95A 2DXIA 4UB8C 1ZHFA 4QIWN 2FF4A 2QGUA 3Q3SA 4IPAA 2P81A 1K4TA 2V1NA 2MABA 4DOZA 2MH2A 3E3VA 3CJRB 1OISA 3EYYA 2V26A 2O61A 3MAJA 2ELHA 2Y75A 4WXDA 4HV5A 2E60A 2KHMA 2WB1N 4KT5C 2RQQA 3A0HC 1LQ1A 1K7AA 5HDNA 3VODA 3K2AA 2XV4S 3HKZA 1ZG1A 1KU7A 3OYJA 1XSDA 1ZRFA 3F3XA 3MVPA 3CC7I 2HZDA 3A02A 3P9KA 3GBGA 3FF5A 3HXLA 3PUFA 3G2BA 3Q9SA 5CQEA 5J40A 3WHBA 1VQ9I 2HDCA 2G7HA 4BEHA 1B72A 1MNMC 3OYNA 1FBUA 4MEXF 5IT9K 1NTCA 1WCMJ 1SFEA 1HW2A 3L2CA 2ESHA 2AO9A 2DA4A 1U8BA 1ON1A 1L0OC 5C44J 1MBJA 2WTEA 3JRCA 1JGGA 1PUEE 2JA8J 1QVTA 4Y3OA 4EJVA 5JHUA 3I9V2 2YU9J 1LKXA 4CO8A 4FTHA 1HA8A 4II2A 3BTIA 3H9GA 4NC7A 1X2NA 5J3LA 1FNNA 2O9LA 1AOYA 2RREA 2V79A 4IOCF 1NG6A 1S29A 1D0ZA 4PCQA 4A3BJ 2BXZA 4UUSB 3C2HA 3U1KA 2FSWA 4LGWA 2R7XA 1X4PA 4I0AA 1HXDA 5CVRA 3HOZJ 3JRGA 5BOXA 4Z6YA 3BCAA 1ZAOA 2KPMA 1N75A 1M1EB 2DFEA 4A3KJ 3H5NA 3I5UA 3GTPJ 2KFDA 1JXSA 4F91B 1N77A 1X19A 3IWZA 5FB2A 2L02A 2HS5A 3QP6A 5FLMJ 2XROA 1FMVA 3BQYA 2FQ4A 1FOKA 4EGYA 1R1VA 3BZKA 4U0YA 2L01A 3I4MJ 4Z2YA 4AYBA 1T38A 3FBNB 5A2QZ 2HPMA 2E34A 1FOYA 4HPQA 4B3XA 4IRHA 1FSEA 2X51A 1A35A 2JA6J 5EEHA 1FP1D 5ICCA 1LVAA 3GXOA 3OSFA 1VQOI 4XIDA 2HVSA 2UUZA 3DTEA 4RBOA 2JN6A 1FTTA 1KYZA 2CWEA 3IHUA 2EPFA 4YIRX 2Z33A 2L9VA 2ACJA 1MJAA 2ICWG 4P9FA 5H2FC 1ZGAA 1MNDA 3GZ5A 1HQCA 4EJUA 4L9NA 2CQ7A 2CUEA 2VC0A 1G3WA 2XKOA 1U8RA 3I3LA 1U78A 3DBRB 4FQGA 3LA3A 3I4PA 1KGSA 2KKOA 2P7CB 2R7FA 2K27A 2VJ4A 2LY9A 2A5WA 2BV6A 4PSXA 1F9NA 3FXJA 4FHTA 4A3DJ 3OV8A 3JCUC 1A04A 2KL4A 3G4SI 1IXRC 1RESA 3HTUA 1S7EA 3M8EA 1ZREA 4RGXA 3KP7A 3MQ0A 4B44A 2IJLA 1R7JA 4XRFA 1ETVA 2AS5F 5GPCA 3GTOJ 4C3IJ 3GTLJ 4UB6C 4M6YA 2DMUA 3DTIA 4MLOA 3HHGA 5EG0B 3BROA 1SD5A 1WGXA 3CDHA 3CCSI 2W48A 1HC8A 1S5LC 2IW5A 3H9JA 3O8HA 2DBBA 4AVPA 2X4HA 1I39A 4U0VA 2KMUA 2QUFA 3FM5A 2HI3A 1I5ZA 1FOWA 4GGGA 2H6BA 2EINH 2XAFA 4AIHA 1CF7A 3S8PA 2ELJA 2P6SA 4XRSA 1TC3C 1R22A 2EWNA 1V55H 4MFDA 2DT5A 3QOEA 5DYMA 2MW8A 3PNTA 5BPIA 1JKPC 4I2OA 1BI3A 1LJ9A 4Y4RA 4BE0A 1PUFB 1XX5A 2PFBA 1VFCA 4HYEA 1FEXA 1HDDC 1BOAA 1X58A 1YOVB 3DEUA 1T6SA 4BU2A 3OIOA 2AQEA 2HYJA 2P7VB 4CH7A 2W85A 1R49A 3MZ8A 3COAC 1ODDA 3E6CC 3MKYB 3SDBA 4RLQA 3DLAA 1ZGJA 1V5GA 1WJ5A 4YELA 5TGTA 1RR7A 1RZ4A 3G1MA 3ZQQA 2JA7J 2GXBA 1GUUA 2X85A 5EEGA 4EMSA 1K78A 3RKWA 4Y15A 3ZGKA 3R61A 2DYSH 3BR3A 1DP7P 1R6RA 3SZGA 2XPWA 1BM9A 3BPXA 4RGSA 5HLIA 3IRQA 2E5NA 3CUOA 1WJBA 1IXCA 2ZNYA 3AL0C 4RB3C 3H36A 5J1UA 1Y0NA 2HOAA 1USSA 2JPBA 5J1RA 5KHDA 3PJRA 2IEKA 3U2RA 1TNSA 3BTJA 3ZOBA 1D1AA 2L54A 2KIQA 4GFBA 3W2WA 1S7AA 2VC1A 1Q1HA 2IGNA 3O2PE 2J5OA 4BEHB 3KCCA 2STTA 1QHGA 3QQAA 1B72B 4KDPA 4U7BA 1J2XA 2PX9A 2CW7A 3OSGA 3H3ZA 4JQFA 2ZXJA 5FD5A 2LR8A 4M3DA 3LL7A 1IRGA 2B7EA 4BACA 1GT0C 4XOPA 4LIVA 1REPC 2NVUB 5FFZA 2DK5A 3QPHA 3VDXA 3CCUI 2VQGA 3D5RC 1XMXA 3VSLA 4AC0A 2V9VA 3T8RA 2L9RA 2YS9A 3GZ6A 3OYHA 5K7FA 2W82A 3DPUA 4HSTA 1Y1WJ 4LK1F 2WB1A 1SD4A 4PJMA 1WJFA 4O6JA 1DPRA 3A01A 4KMFA 2A05A 2WAQA 1UZCA 4L18B 3JSPA 2XF5A 2KIMA 1IN6A 2QVOA 1BW6A 3KLNA 3ZMDA 2CV0A 1VQ5I 4ENMA 4XRSG 2DAOA 1MH4A 4C30A 2IS6A 2EIJH 3GFLA 2BZTA 2PMZN 1U3EM 2XDVA 3FK7A 3K1PA 4ENKA 2ISYA 5D4SA 4C3JJ 1H8AC 1HCRA 1T98A 1D1CA 5FKOA 5F1JA 2R92J 1R9TJ 4XK4A 1UHMA 5JLWA 4BHCA 4HNTA 5BMZA 3BCBA 1QZYA 3PO2J 3H0GJ 2K85A 2BY1A 5B1AH 5HS9A 4LFUA 3K4NA 3NEUA 4V2FA 5DUIA 3HOXJ 5E3MA 3HPHA 1E3PA 2M45A 4A3JJ 1KU2A 3HB9A 5DUKA 2BBYA 3AG1H 1R58A 1F4KA 2XB5A 2LDUA 3DU6A 2CSOA 2GBYA 3HUGA 3WE3A 4WK8F 2V7FA 1NH3A 2VLAA 1SD7A 2KIUA 2PJPA 3NWTA 2WAFA 3KP2A 4M9XA 3O3KA 5DS9A 4BY7J 2HEOA 1SD6A 2BGCA 1LEBA 2D45A 1YIJI 3LFUA 3L7WA 2G7UA 1HBXG 1YYVA 3ZQHA 5GPAA 2LMDA 4XKWA 1TWCJ 2DOEA 2EFNA 2J5PA 5FFXA 2IS2A 1Y0UA 4DJAA 1EH6A 3SJMA 4NB5A 2XASA 2BY0A 2CU7A 1SVOA 3ESWB 4AUXA 2QQBA 2RAEA 2HZTA 1YW9A 1J75A 2XGEA 3P9CA 4MFEA 2O3FA 2K86A 1RR8C 2M3AA 3F9KA 1UFMA 2L7FP 3HRTA 3I4NJ 3S2WA 4PJ0C 3V7SA 5HODA 2E19A 2K02A 2O5RA 2M8EA 2EFOA 2V1UA 3BTCA 4KN7X 4DW6A 3SEQA 1WSUA 2VJJA 5IT3A 1LUJB 3HOSA 1DP3A 4N4OB 3ROUA 3PL8A 3PUBA 2E35A 5AONA 3EYIA 2LKXA 3IC7A 3A0BC 1H88C 4BQQA 3MZYA 5HNFA 3TL4X 2IGOA 4L5EA 1TW3A 5IPAA 3S1QJ 2DODA 3K9TA 5HLHA 1JI8A 5J4VA 4M6VA 4E7IA 4JX6A 4BS9A 1K78B 2DMNA 3OWTA 4PDKA 3M7GA 4LJZF 5EEAA 3GTJJ 5E18F 3FMSA 3CP2A 5M3MJ 2XAUA 1R4MB 1XMKA 3W2AA 4ENNA 3LOCA 3S32A 3FXKA 5HLGA 3IWFA 2VE8A 1IRZA 4JP0A 3S2HJ 2E2HJ 5E20A 5IOZA 1IN7A 3FK6A 3LA7A 4N9IA 2W1OA 1E3OC 4RA2A 3DKWA 5CVIA 1DQUA 2FX0A 1STZA 4AM3A 4WXCA 3BZ6A 3SZPA
chains in the Genus database with same CATH topology
5F08A 1P7IA 2FJ1A 3HOVJ 2CQQA 3RZDJ 1ETXA 1UMQA 3SFIA 1LFBA 3HEFA 4JYKA 1ZR2A 3BG9A 2VPRA 4MIMA 2DTZA 4BY1J 2XPUA 1MBGA 1ETYA 1G2HA 1LFUP 2QF7A 2DMQA 2XRLA 1LE8A 5FKMA 4DYRA 5F27A 4X6AJ 3JRDA 4A3MJ 2DA7A 4DZPA 3L1PA 2X9DA 4M3BA 2XPVA 4QIWN 2VUMJ 3A01B 3Q3SA 4BXXJ 2P81A 2R7ZJ 3RZOJ 2IBDA 5IYCJ 1F43A 1XS9A 2COBA 2NOGA 3IH4A 4BBRJ 3S17J 3S2DJ 2ID6A 2WB1N 4B1RA 1HDPA 5EZGA 3D1NI 4FE7A 5M3FJ 3BR5A 1HOMA 5C4JJ 2LTPA 3K2AA 1JUMA 3FISA 3BG5A 5K7HA 3MVPA 2M9HA 2EZHA 3A02A 3GBGA 4A3LJ 3TP0A 3WHBA 5C3EJ 1IDZA 1B72A 1MNMC 4CYCB 3S16J 1VF9A 1NTCA 1Y1VJ 1WCMJ 1ENHA 1GVDA 2AO9A 2DA4A 2M34A 1U8BA 2NVXJ 1EF4A 3HOWJ 2E1OA 4I6ZA 5C44J 1OCTC 2MSYA 2KDZA 1MBJA 1AKHA 3GTKJ 3JRCA 1JGGA 3LSPA 3GTGJ 2NVYJ 1QVTA 5EGOA 4A3IJ 2JA5J 2JA8J 2YU9J 1I50J 4FTHA 3M4OJ 4DYQA 3TP3A 2R0QC 2YUSA 3F0CA 3BTIA 1X2NA 5J3LA 2O9LA 3B6AA 3GTMJ 5IYDJ 4M3EA 2XGCA 4A3BJ 4A3CJ 4UUSB 2EQRA 2LLKA 2NVTJ 3TEDA 3HOZJ 2VKVA 4UUTA 3JRGA 5FKKA 2DMPA 2M8GX 3TW7A 4A3KJ 1YRNA 2L7ZA 3RKQA 2CUFA 3GTPJ 5C4XJ 2GLOA 1W0UA 1W0TA 3JRBA 5FLMJ 3BQYA 4QTRA 2FQ4A 3B6CA 3S14J 3I4MJ 4HNVA 1JUSA 1D5YA 5IP7J 1XC5A 4X1EA 2Y0SN 2JA6J 5FKNA 4IHYA 1IC8A 3OSFA 1IUFA 5JLXA 4EEFG 4XIDA 4IHVA 4RBOA 1FJLA 2K9QA 2JN6A 1FTTA 3HBLA 2MG4A 2TCTA 3HGGA 1JKQC 3ZQIA 2CUEA 2X6OA 1U78A 2DA2A 2LP0A 1JT0A 4M3GA 2DA1A 2NS8A 2ZB9A 1IG7A 2HDDA 3NAUA 2LY9A 2DMTA 2HQ5A 2CJJA 4A3FJ 1IV6A 1QPIA 4A3DJ 1H89C 4IHWA 1RESA 1S7EA 3Q0WA 2IAIA 2XGDA 3LSGA 2R5YA 3QPLA 1MSFC 1RKTA 1FTZA 1ETVA 4IEJA 5GPCA 3GTOJ 4C3IJ 3GTLJ 1Q1VA 3TW6A 1MBEA 3CMYA 3WHCA 2DMUA 4CYCA 1WH5A 4MLOA 1NK2P 5EG0B 1WPKA 1WGXA 1NK3P 2W48A 3O8HA 2ECCA 4IHXA 4BKXA 1B8IB 2EH3A 4AYBN 3BG3A 1VNDA 1GDTA 1F36A 4A93J 4D7NA 4XICA 2H1KA 2HI3A 4B4CA 5EDNA 3HDDA 1T56A 3UKGA 1AHDP 1BA5A 5K7ZA 4XRSA 3IV5A 1TC3C 4MFDA 1MH3A 3FIWA 2MW8A 5F04A 1JKPC 1IDYA 4Y52J 1UHSA 3RQIA 3DCFA 4NDLA 1PUFB 2MGQA 1VFCA 2EZLA 4W1UA 3BR2A 1FEXA 1HDDC 1ZTRA 3HM5A 1LE8B 2ELKA 1X58A 3JRAA 5EF6A 3OIOA 3QPSA 2HYJA 3LSJA 4V2GA 3PO3J 5E3OA 2QCOA 1JKRC 1APLC 1RR7A 3G1MA 2GM4A 2JA7J 1GUUA 4DYCA 4JX4A 1I6HJ 1WI3A 1BJZA 1ETWA 2DJNA 3BR3A 3A03A 2XPWA 1DU0A 4JX5A 2K9NA 4Y7NJ 5J1UA 1O4XA 2CQXA 2HOAA 1U9OA 4G12A 5J1RA 2LFBA 5M5WJ 2O7OA 2R5ZB 2IEKA 2H8RA 2EZKA 3BTJA 1JTXA 3ZOBA 5FKLA 2OF7A 4GFBA 2VI6A 2HXOA 4BBSJ 3GTQJ 3BR1A 1UG2A 1B72B 3QQAA 2WV1A 2DA5A 4FCYA 3CQZJ 1ZR4A 3S1NJ 3HKZN 2HOSA 1Z77A 4QSHA 3OSGA 2NVQJ 1K61A 3S1MJ 2LK2A 2LR8A 4M3DA 1MSEC 1AKHB 4D7MA 1GT0C 2FD5A 5E3LA 5EGOB 2XB0X 2Y9YA 5EZHA 3SDGA 1GV2A 1OFCX 1POGA 4AC0A 2DN0A 2L9RA 2YS9A 4M3FA 5K7FA 1Y1WJ 3H3VK 1SANA 5E3NA 2ME6A 2LVSA 4MO7A 5M5YJ 1TWAJ 4ABZA 2DA6A 4D5CA 1XG1A 3HOYJ 1QRYA 4A3EJ 1BW5A 3A01A 3G1OA 1ZKGA 1OCPA 5EYRA 1BW6A 3HOUJ 1A6IA 4XRSG 1YRNB 3ZQCA 1SFOJ 2KT0A 3JRHA 3JR9A 1MH4A 3BQZA 3CCYA 1X2MA 5GP9A 5IP6A 3K7AJ 3DEWA 2PMZN 2HOTA 2JJ7A 2R5ZA 1ETOA 3FK7A 1OJLA 2E2JJ 4C3JJ 1H8AC 1HCRA 4B3AA 5FKOA 5F1JA 2R92J 1R9TJ 4XK4A 2B63J 5JLWA 1FIPA 1RETA 2JMWA 3PO2J 3H0GJ 1PUFA 3LNQA 3G1LA 5BNGA 4J19A 4V2FA 3S15J 4LOCA 3BR6A 4RDUA 2ID3A 5E3MA 3HOXJ 1TWGJ 1ZQ3P 4C2MJ 4A3JJ 3HB9A 3VPRA 2Y2ZA 2O8KA 2K9SA 1MBHA 2XB5A 5FJ8J 1K83J 3ZQLA 3BR0A 2GBYA 2G0EA 3HGYA 4S0HB 3LSRA 1P7JA 3BTLA 3S1RJ 5DS9A 2K40A 4BY7J 1TWFJ 1QVUA 4UUSA 1CQTA 1ITYA 3M3YJ 2WAQN 3O8GA 2OPTA 1MBFA 2ME0A 2Y9ZA 2CRGA 1BL0A 2X48A 3OOUA 1JUPA 4DZJA 1HF0A 1VI0A 3MN2A 3C2BA 2JK3A 2DA3A 5GPAA 1TWCJ 2M0CA 2Y30A 5IYBJ 4A69C 2R5YB 1ZGWA 1DU6A 5J1YA 4XRMA 3SJMA 5M5XJ 2CU7A 2AHQA 3JRIA 4AUXA 3MKLA 5F0HA 2RAEA 1I3QJ 1AU7A 1ETQA 2D5VA 5FLVA 4I76A 2LD5A 2L7MP 4C3HJ 1HLVA 3FKIJ 2R93J 9ANTA 2XGEA 1Z0XA 4MFEA 3ZQGA 1ORKA 3Q0UA 1JKOC 2E2IJ 3NARA 1IJWC 5F0CA 2L7FP 3PM1A 3I4NJ 1ZK8A 5HODA 2E19A 1ETKA 3W6VA 3Q0VA 3BTCA 4DW6A 2XSDC 1A5JA 1JJ8C 5IP9J 1RPWA 5F0FA 1IGNA 3BT9A 3IH2A 2LKXA 3ZQHA 2VKEA 3IH3A 5IOYA 1H88C 4L5EA 1T33A 5IPAA 3S1QJ 4A3GJ 1JJ6C 4W97A 2TRTA 3JREA 4M6VA 1JTYA 4JX6A 2I10A 2DMNA 2L0KA 2N8GA 4FE4A 2HXIA 5EEAA 3GTJJ 2EBIA 1GV5A 1RKWA 1TWHJ 5M3MJ 3LOCA 2ECBA 1IRZA 4JP0A 3S2HJ 2E2HJ 1WH7A 5IOZA 3FK6A 2Y31A 5DTDA 1FIAA 3CDLA 3E7LA 1E3OC 5EG0A 1U9NA 3ZQFA 1JT6A 1MBKA 4FISA 2FX0A 2M2EA 1B8IA 2NS7A 2EZIA 2JWTA 4D5FA 3JRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F08 A;  1P7I A;  2FJ1 A;  3HOV J;  2CQQ A;  3RZD J;  1ETX A;  1UMQ A;  3SFI A;  1LFB A;  3HEF A;  4JYK A;  1ZR2 A;  3BG9 A;  2VPR A;  4MIM A;  2DTZ A;  4BY1 J;  2XPU A;  1MBG A;  1ETY A;  1G2H A;  1LFU P;  2QF7 A;  2DMQ A;  2XRL A;  1LE8 A;  5FKM A;  4DYR A;  5F27 A;  4X6A J;  3JRD A;  4A3M J;  2DA7 A;  4DZP A;  3L1P A;  2X9D A;  4M3B A;  2XPV A;  4QIW N;  2VUM J;  3A01 B;  3Q3S A;  4BXX J;  2P81 A;  2R7Z J;  3RZO J;  2IBD A;  5IYC J;  1F43 A;  1XS9 A;  2COB A;  2NOG A;  3IH4 A;  4BBR J;  3S17 J;  3S2D J;  2ID6 A;  2WB1 N;  4B1R A;  1HDP A;  5EZG A;  3D1N I;  4FE7 A;  5M3F J;  3BR5 A;  1HOM A;  5C4J J;  2LTP A;  3K2A A;  1JUM A;  3FIS A;  3BG5 A;  5K7H A;  3MVP A;  2M9H A;  2EZH A;  3A02 A;  3GBG A;  4A3L J;  3TP0 A;  3WHB A;  5C3E J;  1IDZ A;  1B72 A;  1MNM C;  4CYC B;  3S16 J;  1VF9 A;  1NTC A;  1Y1V J;  1WCM J;  1ENH A;  1GVD A;  2AO9 A;  2DA4 A;  2M34 A;  1U8B A;  2NVX J;  1EF4 A;  3HOW J;  2E1O A;  4I6Z A;  5C44 J;  1OCT C;  2MSY A;  2KDZ A;  1MBJ A;  1AKH A;  3GTK J;  3JRC A;  1JGG A;  3LSP A;  3GTG J;  2NVY J;  1QVT A;  5EGO A;  4A3I J;  2JA5 J;  2JA8 J;  2YU9 J;  1I50 J;  4FTH A;  3M4O J;  4DYQ A;  3TP3 A;  2R0Q C;  2YUS A;  3F0C A;  3BTI A;  1X2N A;  5J3L A;  2O9L A;  3B6A A;  3GTM J;  5IYD J;  4M3E A;  2XGC A;  4A3B J;  4A3C J;  4UUS B;  2EQR A;  2LLK A;  2NVT J;  3TED A;  3HOZ J;  2VKV A;  4UUT A;  3JRG A;  5FKK A;  2DMP A;  2M8G X;  3TW7 A;  4A3K J;  1YRN A;  2L7Z A;  3RKQ A;  2CUF A;  3GTP J;  5C4X J;  2GLO A;  1W0U A;  1W0T A;  3JRB A;  5FLM J;  3BQY A;  4QTR A;  2FQ4 A;  3B6C A;  3S14 J;  3I4M J;  4HNV A;  1JUS A;  1D5Y A;  5IP7 J;  1XC5 A;  4X1E A;  2Y0S N;  2JA6 J;  5FKN A;  4IHY A;  1IC8 A;  3OSF A;  1IUF A;  5JLX A;  4EEF G;  4XID A;  4IHV A;  4RBO A;  1FJL A;  2K9Q A;  2JN6 A;  1FTT A;  3HBL A;  2MG4 A;  2TCT A;  3HGG A;  1JKQ C;  3ZQI A;  2CUE A;  2X6O A;  1U78 A;  2DA2 A;  2LP0 A;  1JT0 A;  4M3G A;  2DA1 A;  2NS8 A;  2ZB9 A;  1IG7 A;  2HDD A;  3NAU A;  2LY9 A;  2DMT A;  2HQ5 A;  2CJJ A;  4A3F J;  1IV6 A;  1QPI A;  4A3D J;  1H89 C;  4IHW A;  1RES A;  1S7E A;  3Q0W A;  2IAI A;  2XGD A;  3LSG A;  2R5Y A;  3QPL A;  1MSF C;  1RKT A;  1FTZ A;  1ETV A;  4IEJ A;  5GPC A;  3GTO J;  4C3I J;  3GTL J;  1Q1V A;  3TW6 A;  1MBE A;  3CMY A;  3WHC A;  2DMU A;  4CYC A;  1WH5 A;  4MLO A;  1NK2 P;  5EG0 B;  1WPK A;  1WGX A;  1NK3 P;  2W48 A;  3O8H A;  2ECC A;  4IHX A;  4BKX A;  1B8I B;  2EH3 A;  4AYB N;  3BG3 A;  1VND A;  1GDT A;  1F36 A;  4A93 J;  4D7N A;  4XIC A;  2H1K A;  2HI3 A;  4B4C A;  5EDN A;  3HDD A;  1T56 A;  3UKG A;  1AHD P;  1BA5 A;  5K7Z A;  4XRS A;  3IV5 A;  1TC3 C;  4MFD A;  1MH3 A;  3FIW A;  2MW8 A;  5F04 A;  1JKP C;  1IDY A;  4Y52 J;  1UHS A;  3RQI A;  3DCF A;  4NDL A;  1PUF B;  2MGQ A;  1VFC A;  2EZL A;  4W1U A;  3BR2 A;  1FEX A;  1HDD C;  1ZTR A;  3HM5 A;  1LE8 B;  2ELK A;  1X58 A;  3JRA A;  5EF6 A;  3OIO A;  3QPS A;  2HYJ A;  3LSJ A;  4V2G A;  3PO3 J;  5E3O A;  2QCO A;  1JKR C;  1APL C;  1RR7 A;  3G1M A;  2GM4 A;  2JA7 J;  1GUU A;  4DYC A;  4JX4 A;  1I6H J;  1WI3 A;  1BJZ A;  1ETW A;  2DJN A;  3BR3 A;  3A03 A;  2XPW A;  1DU0 A;  4JX5 A;  2K9N A;  4Y7N J;  5J1U A;  1O4X A;  2CQX A;  2HOA A;  1U9O A;  4G12 A;  5J1R A;  2LFB A;  5M5W J;  2O7O A;  2R5Z B;  2IEK A;  2H8R A;  2EZK A;  3BTJ A;  1JTX A;  3ZOB A;  5FKL A;  2OF7 A;  4GFB A;  2VI6 A;  2HXO A;  4BBS J;  3GTQ J;  3BR1 A;  1UG2 A;  1B72 B;  3QQA A;  2WV1 A;  2DA5 A;  4FCY A;  3CQZ J;  1ZR4 A;  3S1N J;  3HKZ N;  2HOS A;  1Z77 A;  4QSH A;  3OSG A;  2NVQ J;  1K61 A;  3S1M J;  2LK2 A;  2LR8 A;  4M3D A;  1MSE C;  1AKH B;  4D7M A;  1GT0 C;  2FD5 A;  5E3L A;  5EGO B;  2XB0 X;  2Y9Y A;  5EZH A;  3SDG A;  1GV2 A;  1OFC X;  1POG A;  4AC0 A;  2DN0 A;  2L9R A;  2YS9 A;  4M3F A;  5K7F A;  1Y1W J;  3H3V K;  1SAN A;  5E3N A;  2ME6 A;  2LVS A;  4MO7 A;  5M5Y J;  1TWA J;  4ABZ A;  2DA6 A;  4D5C A;  1XG1 A;  3HOY J;  1QRY A;  4A3E J;  1BW5 A;  3A01 A;  3G1O A;  1ZKG A;  1OCP A;  5EYR A;  1BW6 A;  3HOU J;  1A6I A;  4XRS G;  1YRN B;  3ZQC A;  1SFO J;  2KT0 A;  3JRH A;  3JR9 A;  1MH4 A;  3BQZ A;  3CCY A;  1X2M A;  5GP9 A;  5IP6 A;  3K7A J;  3DEW A;  2PMZ N;  2HOT A;  2JJ7 A;  2R5Z A;  1ETO A;  3FK7 A;  1OJL A;  2E2J J;  4C3J J;  1H8A C;  1HCR A;  4B3A A;  5FKO A;  5F1J A;  2R92 J;  1R9T J;  4XK4 A;  2B63 J;  5JLW A;  1FIP A;  1RET A;  2JMW A;  3PO2 J;  3H0G J;  1PUF A;  3LNQ A;  3G1L A;  5BNG A;  4J19 A;  4V2F A;  3S15 J;  4LOC A;  3BR6 A;  4RDU A;  2ID3 A;  5E3M A;  3HOX J;  1TWG J;  1ZQ3 P;  4C2M J;  4A3J J;  3HB9 A;  3VPR A;  2Y2Z A;  2O8K A;  2K9S A;  1MBH A;  2XB5 A;  5FJ8 J;  1K83 J;  3ZQL A;  3BR0 A;  2GBY A;  2G0E A;  3HGY A;  4S0H B;  3LSR A;  1P7J A;  3BTL A;  3S1R J;  5DS9 A;  2K40 A;  4BY7 J;  1TWF J;  1QVU A;  4UUS A;  1CQT A;  1ITY A;  3M3Y J;  2WAQ N;  3O8G A;  2OPT A;  1MBF A;  2ME0 A;  2Y9Z A;  2CRG A;  1BL0 A;  2X48 A;  3OOU A;  1JUP A;  4DZJ A;  1HF0 A;  1VI0 A;  3MN2 A;  3C2B A;  2JK3 A;  2DA3 A;  5GPA A;  1TWC J;  2M0C A;  2Y30 A;  5IYB J;  4A69 C;  2R5Y B;  1ZGW A;  1DU6 A;  5J1Y A;  4XRM A;  3SJM A;  5M5X J;  2CU7 A;  2AHQ A;  3JRI A;  4AUX A;  3MKL A;  5F0H A;  2RAE A;  1I3Q J;  1AU7 A;  1ETQ A;  2D5V A;  5FLV A;  4I76 A;  2LD5 A;  2L7M P;  4C3H J;  1HLV A;  3FKI J;  2R93 J;  9ANT A;  2XGE A;  1Z0X A;  4MFE A;  3ZQG A;  1ORK A;  3Q0U A;  1JKO C;  2E2I J;  3NAR A;  1IJW C;  5F0C A;  2L7F P;  3PM1 A;  3I4N J;  1ZK8 A;  5HOD A;  2E19 A;  1ETK A;  3W6V A;  3Q0V A;  3BTC A;  4DW6 A;  2XSD C;  1A5J A;  1JJ8 C;  5IP9 J;  1RPW A;  5F0F A;  1IGN A;  3BT9 A;  3IH2 A;  2LKX A;  3ZQH A;  2VKE A;  3IH3 A;  5IOY A;  1H88 C;  4L5E A;  1T33 A;  5IPA A;  3S1Q J;  4A3G J;  1JJ6 C;  4W97 A;  2TRT A;  3JRE A;  4M6V A;  1JTY A;  4JX6 A;  2I10 A;  2DMN A;  2L0K A;  2N8G A;  4FE4 A;  2HXI A;  5EEA A;  3GTJ J;  2EBI A;  1GV5 A;  1RKW A;  1TWH J;  5M3M J;  3LOC A;  2ECB A;  1IRZ A;  4JP0 A;  3S2H J;  2E2H J;  1WH7 A;  5IOZ A;  3FK6 A;  2Y31 A;  5DTD A;  1FIA A;  3CDL A;  3E7L A;  1E3O C;  5EG0 A;  1U9N A;  3ZQF A;  1JT6 A;  1MBK A;  4FIS A;  2FX0 A;  2M2E A;  1B8I A;  2NS7 A;  2EZI A;  2JWT A;  4D5F A;  3JRF A; 
#chains in the Genus database with same CATH topology
 3IKV A;  2FJ1 A;  1X3U A;  2XUB A;  2CQQ A;  3GFJ A;  1ETX A;  5F64 A;  2XRN A;  3SFI A;  5HOO A;  1QBJ A;  1D0X A;  3HEF A;  3LFK A;  4HG2 A;  5GTH C;  1N25 A;  4MIM A;  3GEZ A;  4XKC A;  3R0J A;  4XON A;  4M74 A;  2VJ5 A;  4Q47 A;  2R7D A;  2QF7 A;  5D6E A;  3MWM A;  3BWG A;  5KNL A;  2XRL A;  3ZMT A;  3WGI A;  2VQH A;  3E6D A;  1LE8 A;  3X2Q H;  3JRD A;  2XAQ A;  2FXA A;  4CCO A;  2DA7 A;  5TRD A;  2HQN A;  1BR4 A;  1YW8 A;  2DI3 A;  1X1P A;  1YX3 A;  3A01 B;  1G6N A;  2CG4 A;  5FRO A;  1FYK A;  2F5C A;  2LH9 A;  5ILU A;  1R5I D;  4KJZ A;  3R60 A;  5GAH J;  4IQ4 A;  1R23 A;  4ON0 A;  4CCJ A;  4D0P A;  1J7K A;  3WTZ A;  3CCM I;  1YIT I;  3PFY A;  3IH4 A;  4BBR J;  1A31 A;  5DCM A;  1Y8R B;  2ID6 A;  1HDP A;  1WJA A;  5EZG A;  5M3F J;  3OYL A;  4TV7 A;  4ZZL A;  3ZCO A;  5GTI C;  5C4J J;  1SC7 A;  5CVV A;  4GXO A;  4HF1 A;  1ZLK A;  2LF8 A;  1AA7 A;  1JUM A;  3FMR A;  3BG5 A;  2NAZ A;  4BHP A;  3J81 Z;  2FOW A;  4U87 A;  1SVL A;  1SFU A;  5E8G A;  3WGH A;  4HZF A;  2EIK H;  3FBI B;  3RI4 A;  5JVT A;  4A3L J;  2FA5 A;  2QSF X;  3KZY A;  2LOO A;  2FNA A;  1MMS A;  3QU3 A;  2H27 A;  3HSE A;  2W25 A;  3OOP A;  4CYC B;  1HKT A;  2VXD A;  3S16 J;  3N97 A;  3BC8 A;  4LB6 B;  3ELK A;  3IUO A;  1I6X A;  1Z3Y A;  2PLY A;  1VQ8 I;  4LG0 A;  1GVD A;  3FDY A;  5TJJ A;  1CGP A;  3ZMZ A;  3E6M A;  1F1Z A;  2E1O A;  2KDZ A;  4XR6 A;  5D6F A;  1YJW I;  1AKH A;  1LPQ A;  3LSP A;  5EGO A;  3DP7 A;  1GHC A;  4NNJ A;  4CZZ A;  4MQ9 F;  3AG2 H;  3WTW C;  2QQ8 A;  2K4B A;  3ABT A;  1FYL A;  4C2U A;  2V1X A;  1ZN2 A;  3VYT B;  2M4K A;  3HUG B;  3B6A A;  2QSH X;  3GTM J;  5CQG A;  1MGT A;  1VQ6 I;  3OYC A;  3F8B A;  1FPQ A;  5K5R A;  3PQK A;  2FMY A;  3HL2 A;  4A6D A;  2V6C A;  2IS1 A;  2P0W A;  2KQR A;  1X3Z B;  4J00 A;  2CV2 A;  2VKV A;  3PNY A;  2VBY A;  4UUT A;  2M30 A;  1Z05 A;  2OZU A;  2DMP A;  1W5C C;  4KIS A;  3K10 A;  2OTJ I;  1YRN A;  4IHT A;  2UZK A;  1B59 A;  2GLO A;  5C4X J;  1W0T A;  1OKR A;  2L7K A;  4F3Q A;  1MMN A;  2Q2E A;  3LSI A;  4QTR A;  5LHI A;  3CO7 C;  3S14 J;  1OPC A;  1R36 A;  3RPU D;  2KRF A;  2QQA A;  1C0W A;  4HNV A;  3SFZ A;  4ZYG A;  4UUV A;  4E7S A;  1ZYR F;  3F8N A;  2VE9 A;  2Y0S N;  5H6Q A;  4G8X A;  5K5Q A;  1IC8 A;  1IUF A;  4EEF G;  3TO9 A;  5L3B A;  4IHV A;  1IO2 A;  1Y8Q B;  2LRD A;  5FD6 A;  3KET A;  1U5T A;  2F4M B;  2PJR A;  4E6K G;  2MG4 A;  3HGG A;  1JKQ C;  3L2W A;  1Z1D A;  2XF7 A;  3OS0 A;  4L5J A;  3T8T A;  2FE3 A;  2I8D A;  3O6B B;  2BE5 F;  5K5O A;  2A69 F;  4A12 A;  2DA1 A;  2NS8 A;  5CYV A;  5DM6 F;  3DLL F;  4ESF A;  1OLT A;  2VAS A;  3F23 A;  1ZRD A;  3HSF A;  2JZY A;  4XSZ F;  2CQN A;  3KLO A;  1X4O A;  1QU3 A;  3E6B A;  4EJW A;  2Z3Y A;  3Q0W A;  1TLH B;  2NS0 A;  2R7T A;  1U6G A;  4S05 A;  4KIB A;  3LQR A;  3VOE A;  1RIO H;  1O3S A;  1ULY A;  4BDY A;  1MSF C;  3I53 A;  3ISP A;  3DQV C;  4Y13 A;  3H9Q A;  3IRR A;  4RLF A;  2QEN A;  5AIQ A;  3RKX A;  1Q1V A;  2ZKZ A;  3MD2 A;  2HTJ A;  3CMY A;  2E71 A;  3K70 C;  1GXQ A;  4I7H A;  2HTS A;  2R7O A;  3AL0 B;  2MC3 A;  1W5T A;  2K5C A;  4KN4 X;  1VND A;  5LGU A;  1ZEL A;  5JFR A;  4UVB A;  2H1K A;  4B4C A;  5TIS C;  4E7J A;  5EDN A;  3OMY A;  2R7S A;  1R00 A;  1N78 A;  3C2G A;  4MNU A;  2ZFU A;  1WFX A;  3DEE A;  2NRA C;  2KRC A;  5K7Z A;  3K0L A;  4OOI A;  1PP8 F;  4DNC A;  2X1E A;  4WWC A;  4WF2 A;  4MTE A;  2ESN A;  3FIW A;  5ILS A;  4U7D A;  1IDY A;  1S3J A;  1BI2 A;  2X6W A;  2OCC H;  3BR2 A;  2XGX A;  1LE8 B;  1IN4 A;  2ELK A;  4XN3 A;  4LLL A;  5EF6 A;  3OYF A;  2BYV E;  4MHG A;  1W36 D;  3ZMV A;  3I58 A;  1YHQ I;  3LSJ A;  2Z5U A;  2HWV A;  1APL C;  4P5O A;  3FXQ A;  1WQ2 A;  2HYF A;  4E4H A;  4KIF A;  4OIP F;  4I02 A;  1WI3 A;  1BJZ A;  1ETW A;  2DJN A;  5KVR A;  3E5X A;  3P9I A;  5DCM B;  2QBY A;  4Q48 A;  4OU0 A;  1VQ7 I;  2H8W A;  5JVG F;  5CJ9 A;  2Z1D A;  3LAP A;  4LD5 A;  2Q8K A;  1OYI A;  4A6E A;  4M6X A;  3CTA A;  3OL3 A;  5M5W J;  1W5S A;  5LRS A;  4N9H A;  2H8R A;  2DDB A;  3LWF A;  5FKL A;  2OF7 A;  5LGN A;  2VI6 A;  2XAH A;  3EUH A;  1XGO A;  2E36 A;  3BR1 A;  5KK1 A;  2EFP A;  1XDS A;  2RQP A;  1LVK A;  3CMM A;  2DA5 A;  2WWY A;  1R5G A;  2HOS A;  1Z77 A;  1O7L A;  3NWS A;  1ERD A;  4LG0 B;  3OYE A;  1K61 A;  2GIV A;  2ZJR F;  1R4N B;  1MSE C;  5E17 F;  1AKH B;  2HKX A;  3M8J A;  3D0S A;  5E3L A;  2A5Y B;  2K4J A;  5EGO B;  4BJ5 C;  3ZN1 A;  1GV2 A;  1OFC X;  5FLX Z;  3CCL I;  2RC4 A;  3LA2 A;  4RM2 A;  1KQ9 A;  4HOB A;  5E1W A;  3HSR A;  3ECO A;  4FX4 A;  4E7L A;  3MEX A;  5E3N A;  4GCV A;  4OIO F;  2A61 A;  2VB6 A;  4RGR A;  2H1L A;  4D5C A;  3RCO A;  5ERI A;  2ZJ2 A;  4CXF A;  3PIP F;  1O3R A;  1BW5 A;  2F5V A;  3G1O A;  2E5Z A;  5EYR A;  1FLI A;  4HW0 A;  2GIZ A;  1YRN B;  3H3U A;  5HLT A;  3SQN A;  3CCY A;  3C7J A;  4EV0 A;  3K7A J;  2IS4 A;  4F7Z A;  2GXA A;  1ETO A;  4CIC A;  2E2J J;  3QAH A;  3FXO A;  4YIF A;  4FAS D;  4RM3 A;  3KFW X;  1T2K A;  4B3A A;  4MTD A;  5HNH A;  2LNB A;  4UVA A;  1I1S A;  2EV6 A;  4BGD A;  3GWZ A;  4J01 A;  1YS6 A;  1XB4 A;  2R4G A;  3LNQ A;  3I0T A;  1U5T B;  2VPL A;  2PJR B;  3HOT A;  1FOX A;  2F48 A;  4BXU A;  4L9V A;  2O03 A;  1GVJ A;  2DQL A;  4RDU A;  2Z2S B;  4E70 A;  3V42 A;  2XC7 A;  1OYY A;  3NRV A;  3DKX A;  3ZMU A;  3K4L A;  1MBH A;  3GZN B;  2CW8 A;  3KEY A;  3CF5 F;  3CCQ I;  3BR0 A;  3HGY A;  1H9G A;  4S0H B;  1D1B A;  2PMU A;  2K40 A;  1CQT A;  1QVU A;  3RPQ A;  2LKP A;  1OQY A;  5CLS A;  2HPI A;  1W1W E;  5IT9 Z;  2Y9Z A;  2OPT A;  1DDN A;  2DJI A;  4PJL A;  3W6K B;  5GAE J;  2R5Z A;  3C2B A;  2WY8 Q;  4XKB A;  4Q4Z F;  2M0C A;  2Y30 A;  1DU6 A;  4XRM A;  4D9J A;  3M8F A;  4HNU A;  4ANJ A;  2AHQ A;  3AKZ A;  3NQO A;  3KIO A;  2KLO A;  2EV5 A;  1AU7 A;  3R0A A;  2D5V A;  4BH9 A;  2TDX A;  5KAI C;  2L7M P;  4CUG A;  1P4A A;  3K1N A;  3D5L A;  4C3H J;  3FKI J;  4BJ6 C;  9ANT A;  2CW0 F;  2BW3 A;  4MQV A;  4DIQ A;  2VBW A;  3OYD A;  1BI1 A;  2KP6 A;  1NG7 A;  2OV7 A;  5DD8 A;  1ETK A;  4CCM A;  3L9F A;  3GME A;  4F55 A;  2MLK A;  4U0W A;  2XSD C;  1U2W A;  1MMD A;  5LHG A;  4HDV A;  2Y48 A;  1JJ8 C;  1PYV A;  5IP9 J;  3GLL A;  2P5V A;  5F0F A;  2RNG A;  4KMU X;  3ZR8 X;  3KYC B;  1EV7 A;  4O5V A;  2VKE A;  1IV8 A;  2XAJ A;  2DYR H;  2W24 A;  2HU9 A;  3CLO A;  5E1Z B;  3IP4 B;  1MMA A;  1MD0 A;  4ZDL A;  3F8C A;  1T08 B;  1BIB A;  4W97 A;  2TRT A;  1G4D A;  3HYI A;  2DLL A;  2KDO A;  4YG2 F;  5D4R A;  3MFK A;  2E1N A;  5DCF A;  4EJT A;  2OU2 A;  2MH9 A;  2I10 A;  4L0Y B;  2N8G A;  2A3S A;  4ZYE A;  2QBY B;  4CCL A;  4D1Q A;  3LSK A;  3RKY A;  4EQQ A;  1VQ4 I;  4CGZ A;  4I0B A;  4KYW A;  3I56 I;  2KIS A;  2ECB A;  2R7W A;  1HKQ A;  5J6X A;  2OC6 A;  2JQ7 A;  4PFP A;  2DK8 A;  4K2E A;  3ZQF A;  1JT6 A;  1MBK A;  2IRF G;  1KU3 A;  3I54 A;  4ZDP A;  1B8I A;  3CJT B;  3QYE A;  1EKE A;  3BZC A;  1P4X A;  4BHB A;  2ETH A;  2A6T A;  4GYG A;  3JRF A;  3WTV C;  3HTS B;  4RAZ A;  3MZH A;  1D8J A;  2LY2 A;  5LFA A;  4CHU A;  1YI2 I;  2VON A;  4WXH A;  5D5W B;  4M73 A;  1A6Q A;  1WJE A;  1YTY A;  2VPR A;  4MGR A;  4ZTJ A;  4ZYD A;  2QA4 I;  1W7P D;  2DFF A;  1MBG A;  4U88 A;  2E1C A;  1ETY A;  1G2H A;  1LFU P;  4EVI A;  3T5X A;  2DMQ A;  2QZ8 A;  4HAM A;  4ENJ A;  1YJN I;  4OAY A;  3A2K A;  4X6A J;  2RKH A;  3ZQ7 A;  2CQK A;  4R1H A;  3GYH X;  3BP8 A;  1IXS B;  3K69 A;  2E1M C;  1HKS A;  2VUM J;  2LRE A;  2HYG D;  1G8X A;  2DOA A;  5D8L B;  4BXX J;  4B47 A;  1QO0 D;  2ADU A;  3N4M A;  3M1C A;  4ZDO A;  2IBD A;  4EM2 A;  4XOT A;  2P4W A;  1XS9 A;  2COB A;  2JPC A;  2NOG A;  3FXM A;  4IOA F;  1WI9 A;  3S17 J;  1R5H A;  3GFM A;  5H20 A;  4LLN A;  1ONV A;  4B1R A;  4FE7 A;  1HOM A;  3BR5 A;  3RQ4 A;  2CGP A;  4LK0 F;  2LTP A;  3L09 A;  3HJE A;  4UXN A;  2FU4 A;  3FIS A;  2DOF A;  3AG3 H;  5K7H A;  2G9W A;  3CUQ C;  2EZH A;  4AIK A;  4UHT A;  4G6Q A;  2LF7 A;  2CO5 A;  3P7N A;  2L2O A;  4KIG A;  1WHU A;  2X6X A;  1Z67 A;  1Y1V J;  2EIM H;  2V6E A;  3BPV A;  2EJR A;  4AWX B;  3J81 K;  2ZNZ A;  3CDI A;  2LBF A;  4EJO A;  2M34 A;  2YR2 A;  1EF4 A;  1U5T C;  3HOW J;  4CCN A;  1OCT C;  3RJP A;  4E7H A;  1OCC H;  3FXR A;  1BIA A;  1LEA A;  2X6Y A;  4BJT A;  1MJ9 A;  2OA4 A;  5B3S H;  4A3I J;  1CF7 B;  1LDK B;  4HX8 A;  5EJC A;  1I50 J;  2PI0 A;  2NOJ B;  3M4O J;  3QOP A;  4DYQ A;  3TP3 A;  2WAD A;  3D5S C;  2YUS A;  3KPH A;  3HRU A;  3CCE I;  5IYD J;  4M3E A;  4A0Z A;  3FZV A;  3MMY B;  3U21 A;  4A3C J;  4RB1 A;  4P55 A;  2EQR A;  5LBQ A;  2JSP A;  2LLK A;  1P9Q C;  3TED A;  4IZZ A;  1W36 C;  2BY2 A;  3ASO H;  4KNY A;  3ERM A;  3N05 A;  3V8K A;  3FMQ A;  4QLC U;  4Y33 A;  3E0J B;  4PJN A;  3OY9 A;  4G7H F;  2L7Z A;  1O7F A;  2CUF A;  2KJB A;  3UNG C;  3RKQ A;  3HIF A;  2QYO A;  3PSF A;  1D5V A;  3AAF A;  5J4Y A;  4NUB A;  2CFX A;  1H0M A;  2GA1 A;  3K6G A;  2BHZ A;  2BW3 B;  2Q0O A;  3ABU A;  3GLX A;  2VJI A;  3F6V A;  3KX2 A;  1D5Y A;  5L3F A;  5IP7 J;  4R8H A;  2A07 F;  1XMA A;  2GZW A;  3V7R A;  1BBY A;  1QHH D;  3B02 A;  1O3Q A;  1YE9 A;  2A6E F;  3IAM 2;  2EIL H;  4HX7 A;  3VWB A;  2VKD A;  3OL4 A;  2VBZ A;  3DKY A;  4IHY A;  2MD5 A;  3HZJ A;  4KIT B;  2P8T A;  4ZYH A;  1FJL A;  2K9Q A;  4CA0 A;  3IKT A;  2CYY A;  4NC6 A;  3GUD A;  1Z7U A;  2XHK A;  2BVM A;  2TCT A;  2L5Q A;  1VZ0 A;  5LEJ A;  3T0Y A;  2DDA A;  1Z7L A;  2MC4 A;  2OUM A;  2X6O A;  4JK1 X;  5DDG A;  2UV1 A;  4IJA A;  2DA2 A;  2X1C A;  2LP0 A;  3FWE A;  1LB2 A;  1JT0 A;  2Z99 A;  2YSR A;  1A36 A;  3G71 I;  1VQK I;  4QPO A;  1BR1 A;  2VOO A;  1E17 A;  1OCR H;  1I1G A;  5E8I A;  4XMY A;  4XBF A;  3U1D A;  2HDD A;  1WZ2 A;  2UXX A;  4XOR A;  4L0Z B;  2DMT A;  2V9K A;  2HQ5 A;  2CJJ A;  5IY5 H;  5E1X A;  1QPI A;  1H89 C;  4IHW A;  4AID A;  1NHA A;  1B9N A;  3CLQ A;  2FBI A;  2IAI A;  3LSG A;  2F4O B;  4CZC A;  2R5Y A;  5B1B H;  1RKT A;  1KA8 A;  2HQA A;  1FTZ A;  3C1D A;  4IEJ A;  2NXN B;  2W4S A;  1D0Y A;  4P96 A;  5GAD J;  3PFI A;  4XNF A;  1Z6T A;  1MBE A;  1MZB A;  3WHC A;  1WH5 A;  5J8C A;  1NK2 P;  1WPK A;  4IHX A;  2ECC A;  1LDD A;  2MA3 A;  2ZCW A;  3EUH C;  5LEK A;  1B8I B;  1QGP A;  2R7V A;  3A1Y A;  4XL9 A;  2ISZ A;  4AYB N;  4PSW A;  2PQ8 A;  4JOM A;  1MIJ A;  1F36 A;  2AXL A;  4A93 J;  4LMY A;  3ZN0 A;  1T56 A;  1V5F A;  1QA6 A;  1P92 A;  3UKG A;  1WWX A;  1AHD P;  3GVA A;  3OYI A;  3EUA A;  4BNC A;  1SMY F;  2W7N A;  4L5I A;  1WJD A;  4S04 A;  5F04 A;  3RPU A;  3OYB A;  2ZC2 A;  3RQI A;  3QRF F;  4NDL A;  2EZL A;  4NBQ A;  3HM5 A;  1OCZ H;  4PK4 A;  4BE2 A;  3JRA A;  3QPS A;  1UB9 A;  3V8L A;  1SMT A;  2CUJ A;  3I55 I;  1XD7 A;  5B66 C;  3PO3 J;  3ZXS A;  2RVC A;  5F6F A;  1JKR C;  2CH0 A;  1FYM A;  2EV0 A;  2QWW A;  2FUG 2;  3VFZ A;  2WAE A;  3KZZ A;  3BLY A;  3E5Q A;  4G7O F;  3F6O A;  1BI0 A;  4JX4 A;  4M71 A;  1Y39 A;  1I6H J;  2WBM A;  3A03 A;  1ON2 A;  3KP5 A;  3OIQ A;  1DU0 A;  2VOD A;  3FM3 A;  3F8M A;  4RAG A;  1TQM A;  2CQX A;  2P5L C;  1O4X A;  2PMZ A;  1EJ9 A;  1TZL A;  2V1D A;  3TO6 A;  1YIO A;  2LFB A;  5D5X B;  3ABM H;  1TTY A;  3GTQ J;  1UG2 A;  2JVG A;  1P2F A;  2WV1 A;  4FCY A;  3CQZ J;  1ZR4 A;  2VKH A;  4QSH A;  1XDU A;  3QWL A;  1XSX A;  3CP8 A;  3I59 A;  3CUQ A;  2LBF B;  3J80 Z;  3JTH A;  3K1M A;  1SEU A;  4H4K C;  3KE2 A;  2PEX A;  2UWM A;  1ZG5 A;  4D7M A;  5ICE A;  4G7Z F;  2CS3 A;  2W84 A;  5EZH A;  3SDG A;  5DM7 F;  1DPU A;  2EFW A;  3J7Z I;  3FKJ A;  1POG A;  3G73 A;  3R4K A;  3E1S A;  2GOM A;  3DPL C;  3QOD A;  5A2Q K;  3WU2 C;  2QLZ A;  2LVS A;  1TWA J;  2H6C A;  4OAZ A;  4HBL A;  4FT8 A;  2DA6 A;  3HOY J;  1XG1 A;  2BXY A;  1PVE A;  3HPG A;  5DD4 A;  3EET A;  1ZKG A;  3VEP A;  1RNL A;  1OCP A;  3BJ6 A;  2QEX I;  3SHF A;  3TOB A;  3EPZ A;  1K6Y A;  1A6I A;  3ZQC A;  4F92 B;  3JRH A;  2VL8 A;  3JR9 A;  1X2M A;  4NQW A;  4IRI A;  2IVM A;  1QQI A;  2FML A;  2ZME A;  3HG9 A;  4M9Z A;  4UVC A;  1YFH A;  3BJA A;  2OZ6 A;  3VSK A;  3CC2 I;  4I09 A;  3B73 A;  3M1E A;  4KA4 A;  2L4M A;  3VB2 A;  1V4R A;  2DPD A;  4KUM A;  2CV1 A;  1TNT A;  3SYT A;  1FIP A;  3LSM A;  1RET A;  2JMW A;  2Z16 A;  3GX4 X;  3FHZ A;  2VOP A;  1J9I A;  3UR3 C;  3I64 A;  4XLE A;  2DQR A;  2KZG A;  5HDG A;  3GFI A;  1PUF A;  1HSJ A;  3G1L A;  5BNG A;  1XSV A;  4J19 A;  2MBF A;  3S15 J;  4BYY A;  3TDU C;  2X0L A;  2DT6 A;  1VQP I;  3BR6 A;  3WGG A;  1TWG J;  1EH8 A;  1ZQ3 P;  4C2M J;  5J8F A;  2EK5 A;  1P6R A;  4HV6 A;  4PJJ A;  3VPR A;  2Y2Z A;  2O8K A;  2XAG A;  2K9S A;  1OMI A;  5FJ8 J;  1K83 J;  1QNT A;  4IRG A;  4XN0 A;  1FBQ A;  4ESJ A;  3BOQ A;  2G0E A;  3GF2 A;  4DQ2 A;  3Q9V A;  3HC7 A;  3BTL A;  2VBX A;  4LG3 A;  1BOB A;  3DTK A;  2DFI A;  3EQL F;  4OIQ F;  3PSI A;  2WAQ N;  3O8G A;  3L00 A;  4MEY F;  1XN7 A;  1R71 A;  2X48 A;  2L3D A;  3OOU A;  1JUP A;  3CJQ B;  2VXZ A;  3WU0 A;  5LLQ A;  1HF0 A;  4JBA A;  3JAM Z;  1VI0 A;  4FET A;  4A69 C;  2JK3 A;  2DA3 A;  3CJN A;  2R5Y B;  2VQC A;  1RC9 A;  5J1Y A;  2W00 A;  3CES A;  2XVC A;  3JRI A;  3TOA A;  2L9N A;  1H9T A;  4R79 A;  1I3Q J;  4X0G A;  2PBI A;  4I76 A;  3V7C A;  3J7Y J;  4LB5 A;  3CCV I;  3OYK A;  1YG2 A;  1HLV A;  2R93 J;  5F1R A;  5CKT A;  4C2T A;  3ZQG A;  1JKO C;  2R7Q A;  3NAR A;  3FXL A;  2K7L A;  3ABL H;  5F0C A;  4OMY A;  3S93 A;  2ZXW H;  3MKW B;  2OTL I;  2M0M A;  4IHS A;  1XCV A;  2E7W A;  1WJC A;  2YX7 A;  2ZXH A;  3K4M A;  4BQN A;  1K4S A;  2IGK A;  2AXT C;  1E0E A;  1LFP A;  4CDG A;  3RIR A;  3Q0V A;  4OMZ A;  1T0F A;  2P6T A;  1RPW A;  1IAW A;  1OR7 C;  2NNN A;  4XSX F;  2ZFW A;  3BT9 A;  4BL0 B;  1BC7 C;  1XGS A;  2EFQ A;  1MJB A;  3TQN A;  2X1D A;  4PUS A;  5IOY A;  3FHN A;  1XGM A;  2A68 F;  1E3H A;  4ZZD A;  4N4N B;  1K6O A;  2OQG A;  1T8I A;  4KFC A;  2KIF A;  3ML6 A;  1YQA A;  3T1B A;  4YFK F;  1IUY A;  3H5R A;  1O3T A;  1JJ6 C;  4RB0 A;  4A0X A;  2VQL A;  3I71 A;  3DF8 A;  1MDM A;  2L0K A;  2M7A A;  2Y69 H;  4ETS A;  2HXI A;  4EGZ A;  2FEZ A;  2BY3 A;  2EBI A;  3DWL E;  2E1M B;  1D3Y A;  3TKY A;  5LD2 C;  3C3W A;  1RKW A;  3HRM A;  1IF1 A;  1R1T A;  2LYC A;  2JUG A;  5K1Y A;  1ACI A;  3WTT C;  3KP4 A;  1UHW A;  3GO5 A;  2MD0 A;  2Y31 A;  1U0J A;  2WC2 A;  4GDF A;  5DTD A;  3CDL A;  2JRT A;  3CF2 A;  2DFH A;  3WTY C;  3L2R A;  2F4I A;  4FIS A;  1WKM A;  2M2E A;  3E97 A;  1YX5 A;  3EUK L;  2EZI A;  3H1C A;  2AQF A;  1G3T A;  4RMN A;  2KRH A;  2Q2E B;  5F08 A;  1P7I A;  3I59 B;  3CUQ B;  4KT6 A;  4HQE A;  2FRH A;  5FO5 A;  4O3M A;  4IXA A;  1WVR A;  3RSN A;  2WV0 A;  3WTU C;  1LFB A;  5HS8 A;  1ZR2 A;  2FOK A;  3KEO A;  4YFN F;  3BG9 A;  5L3G A;  2LSO A;  1TBX A;  2DTZ A;  3CZ6 A;  4BY1 J;  2FBK A;  5D8K B;  5KCM A;  1LDJ A;  2F5E A;  3CCR I;  3F8F A;  2ZBK A;  3P5J A;  2IP2 A;  3VYU B;  2PG4 A;  1FP2 A;  3KZI C;  5F27 A;  1PJR A;  2BOL A;  4A3M J;  3R6S A;  3BG7 A;  4PGG A;  4YRV A;  3L1P A;  3RDI A;  2OD5 A;  4M3B A;  2XPV A;  2LY1 A;  4IVN A;  1KQ8 A;  4V19 K;  1Z91 A;  2R7Z J;  5BS6 A;  3RZO J;  3QPT A;  1TT5 B;  5IYC J;  3QU6 A;  2W57 A;  1F43 A;  1ZLJ A;  2OJE D;  4WCG A;  1TQI A;  1X1B A;  3S2D J;  4CSW A;  1SAX A;  4NQW B;  3D1N I;  4UNO A;  2QKL B;  3EDP A;  2ZME B;  4M9S A;  1J09 A;  4I01 A;  1SVM A;  5LRR A;  1OYW A;  2CUZ A;  2GOX B;  3ZMS A;  4IX7 A;  1HST A;  3S3O A;  1VQL I;  3PQJ A;  3OIP A;  4RGU A;  2M9H A;  1E2X A;  2OQR A;  3TP0 A;  5BQT A;  4RB2 C;  1L3L A;  3REO A;  5C3E J;  1B1B A;  3RTR A;  1IDZ A;  2Y0S A;  1MNE A;  1VF9 A;  1ENH A;  3CME I;  3BJO A;  2HQR A;  2NVX J;  4PGH A;  4I6Z A;  4IKF A;  3W6J B;  2MSY A;  4EM1 A;  3VYR B;  2ZJQ F;  3GTK J;  3GTG J;  2NVY J;  2JA5 J;  2M1B A;  3JTG A;  3ZP5 A;  5BPD A;  4HF2 A;  2ZO4 A;  3DBL B;  2R0Q C;  2F6C A;  3F0C A;  4QWQ A;  4XM3 A;  4HEA 2;  5CVJ A;  4I98 B;  3DU5 A;  2XGC A;  4A5M A;  1KU9 A;  2K9M A;  1S72 I;  3G6E I;  4ESB A;  1S8N A;  3L2Q A;  3K4C A;  2K9L A;  2NVT J;  1V3F A;  1FBS A;  2WY7 Q;  3K4K A;  1W7P A;  2E7X A;  4XLP F;  3OR1 C;  5FKK A;  1JHH A;  1KZH A;  2M8G X;  1RI7 A;  5DEQ A;  3TW7 A;  3JW4 A;  2HVR A;  1QZE A;  2HR3 A;  3FXU A;  1W0U A;  3HHH A;  3JRB A;  3LMM A;  3M9A A;  2JUC A;  1OCO H;  4IO9 F;  3CO6 C;  3L2U A;  3B6C A;  3LAJ A;  3U9G A;  2P5K A;  1UAA A;  4HX4 A;  2OBP A;  3V4G A;  2RV8 A;  1JUS A;  1JGS A;  3H0D A;  4XKV A;  1Z6R A;  1XC5 A;  4X1E A;  1TQP A;  4IF4 A;  3GCM A;  5FKN A;  1B9M A;  2DW4 A;  5JLX A;  1V54 H;  4C9Y A;  2B9S A;  2V4J C;  3WE2 A;  1KON A;  4BE1 A;  4G9Y A;  3HBL A;  4P1W A;  5GAG J;  4A5N A;  3DFG A;  2A6H F;  1HW1 A;  2F5D A;  2XKP A;  2HDW A;  3ZQI A;  2EA2 A;  2L9S A;  3PIO F;  1FMW A;  2LKS A;  5JR3 A;  1UG0 A;  2GXG A;  4GO1 A;  4M3G A;  1Z9C A;  4BAY A;  4DBR A;  2KJC A;  2IA0 A;  3G3Z A;  1OR7 A;  4A2U A;  3OYM A;  5KAF C;  2ZB9 A;  1IG7 A;  1G3Y A;  5ED4 A;  3NAU A;  3K70 D;  3CCJ I;  1MDM B;  3QYF A;  1MMG A;  4A3F J;  1IV6 A;  2C6Y A;  2R7R A;  1TL8 A;  3SEZ A;  4WX9 A;  4H0E A;  4CCK A;  5LHH A;  2XGD A;  2Z9O A;  2L4A A;  4RAY A;  4Q5S F;  3QPL A;  4UY8 I;  4BQO A;  4HA8 A;  3KP3 A;  3DPT A;  4EM0 B;  3TW6 A;  4CYC A;  2DPU A;  3MCZ A;  4AIJ A;  1NK3 P;  3F22 A;  3OR2 C;  4BKX A;  3Q5F A;  2EH3 A;  3KEQ A;  1PP7 U;  3BG3 A;  1GDT A;  4IL6 C;  4DBQ A;  2NYX A;  2H94 A;  3RYP A;  4D7N A;  2HFH A;  3LSH A;  5JI6 A;  4AU7 A;  4XIC A;  4EAT A;  3HDD A;  2IXS A;  3WU1 B;  4HQM A;  1BA5 A;  1WRJ A;  3IV5 A;  2IPQ X;  3K4J A;  1MH3 A;  5HDK A;  1AWC A;  2RGV A;  4Y52 J;  2GAU A;  1UHS A;  4N0B A;  1ZAR A;  3DCF A;  2STW A;  2MGQ A;  4W1U A;  5B5E C;  3KYD B;  1ZTR A;  3DV8 A;  4NC8 A;  5L3D A;  3V8J A;  1FZP B;  2B0L A;  4RAF A;  1P4W A;  1FSH A;  3JSO A;  3MKZ A;  1B4A A;  4V2G A;  5E3O A;  2QCO A;  2JRM A;  4XLC A;  2FQ3 A;  2GM4 A;  1J5Y A;  4B43 A;  1DGW Y;  2O8X A;  2VT2 A;  4DYC A;  4ZH4 F;  1EH7 A;  2COM A;  2ZSI B;  1YLF A;  2K3P A;  3CMA I;  5E79 C;  2GQQ A;  3QYB A;  2NNY A;  3H35 A;  4ZC3 A;  1G3S A;  4JX5 A;  4NHJ A;  2K9N A;  2D1V A;  4Y7N J;  2OAZ A;  2QKM B;  1U9O A;  2ZME C;  1X1A A;  4G12 A;  2GWR A;  4L9T A;  2O7O A;  2R5Z B;  4OWR B;  1X1D A;  2EZK A;  1JTX A;  4IQJ A;  3W2V A;  2KZV A;  3GW2 A;  4BBS J;  2HXO A;  2PMH A;  2ZJP F;  1JE8 A;  3LST A;  4GRI A;  2UXN A;  2YU3 A;  1LNW A;  1Y56 A;  3K4B A;  1HW5 A;  1ZH5 A;  4LIT A;  4XLF A;  3S1N J;  3HKZ N;  1Z3X A;  2NVQ J;  3S1M J;  2JA2 A;  2LK2 A;  2YPR A;  1IRF A;  2HGC A;  2HNH A;  1W4M A;  3QP5 A;  3WTS C;  3VYS B;  3C18 A;  1F5T A;  1B6A A;  3W3C A;  2FD5 A;  4E7Z A;  4HLY A;  1FWZ A;  2HKO A;  2XB0 X;  2Y9Y A;  1X3W B;  2H09 A;  1TP4 A;  4BXF A;  2HOE A;  3BG6 A;  3TDZ C;  3DXJ F;  1S9H A;  3J80 K;  1PDN C;  2DT7 B;  4BQA A;  1G59 A;  2D2W A;  2DN0 A;  1DUX C;  4M3F A;  2DCE A;  3H3V K;  1SAN A;  2OCE A;  2ME6 A;  5M5Y J;  4MO7 A;  1SAU A;  4HLX A;  4A0Y A;  4M72 A;  4ABZ A;  1IW7 F;  1QRY A;  1UEL B;  4A3E J;  3IAS 2;  1W7P B;  2M4G A;  1R1U A;  3IL2 A;  2M87 A;  3FX3 A;  5H6R A;  1XCB A;  1VQM I;  2MLG A;  3HOU J;  4XLH A;  4B09 A;  1SFO J;  2K3F A;  2KT0 A;  3K2Z A;  3S3M A;  3BQZ A;  5FGM A;  3AFH A;  4L9J A;  5GP9 A;  1BJA A;  5IP6 A;  3DEW A;  1YS7 A;  1S7O A;  2JT1 A;  2JJ7 A;  3ECH A;  2HOT A;  5FRN A;  4DGW B;  4LIU A;  1K79 A;  1OJL A;  2BVL A;  1QZZ A;  2EA4 A;  2DO7 A;  2MFZ A;  5L3C A;  1ZG3 A;  4ASN A;  5J47 A;  4YFX F;  3ZRG A;  1JHF A;  1UST A;  4KIC A;  2B63 J;  3CD6 I;  3SZT A;  2IA2 A;  3ASN H;  2O0Y A;  1VQN I;  4QPQ A;  5JHF A;  2F5F A;  4ITV A;  2O6G E;  5FRM A;  2LG4 A;  4HF0 A;  1T0F C;  3CC4 I;  5ICG A;  3H92 A;  4LOC A;  4CYD A;  1MW7 A;  2ID3 A;  4BDZ A;  1UJ8 A;  5CVU A;  2BHY A;  3RYR A;  4GYI A;  2RN7 A;  1RRJ A;  1X1C A;  1YJ9 I;  2IA1 A;  4B8X A;  3ZQL A;  3ZPL A;  3ONQ A;  3ERE D;  3F72 A;  2YX4 A;  3LSR A;  3KP6 A;  3WG9 A;  1P7J A;  1XTA A;  3DBH B;  3S1R J;  1IZ1 A;  1S6L A;  4BUP A;  1J0R A;  1TWF J;  4UUS A;  1T39 A;  3ULQ B;  1ITY A;  4YEJ A;  2JVH A;  3M3Y J;  1MBF A;  2ME0 A;  3F21 A;  4HDU A;  2CRG A;  1BL0 A;  3WG7 H;  1IRX A;  1SFK A;  4DZJ A;  3MN2 A;  5CPR B;  5IYB J;  2R7U A;  1ZGW A;  2FBH A;  4G94 A;  5M5X J;  3MKL A;  5F0H A;  1YW7 A;  2EB7 A;  5FLV A;  1ETQ A;  1KQ0 A;  3BDD A;  2LD5 A;  2M7B A;  1IN5 A;  1FC3 A;  2F2E A;  3TBI A;  3JAM K;  2I5U A;  1Z0X A;  4YII A;  1ORK A;  3Q0U A;  4F52 A;  2E2I J;  3PNV A;  1EA3 A;  4HRI A;  1IJW C;  3M07 A;  3LQQ A;  3HRS A;  3PM1 A;  2R3S A;  3TO7 A;  1ZK8 A;  1FT9 A;  4P9U A;  5HVQ C;  3AG4 H;  1XPX A;  3J7A Y;  2QSG X;  2IGM A;  2V9P A;  3W6V A;  2VIX A;  4ZJZ A;  4II3 A;  6PAX A;  1V5E A;  1A5J A;  2PN6 A;  1YO5 C;  2JTV A;  2QM3 A;  5ILV A;  3BY6 A;  1IGN A;  2M5W A;  1BR2 A;  4E7K A;  4UV9 A;  4AVZ A;  3IH2 A;  1RUN A;  2XF6 A;  3IH3 A;  5ICF A;  4F93 B;  3TMO A;  3TGN A;  1T33 A;  3H5A A;  2DU9 A;  5LGT A;  4A3G J;  1FX7 A;  1Z21 A;  3JRE A;  2BEO A;  3OS2 A;  1JTY A;  3WTX C;  4HSR A;  2CFO A;  1BC8 C;  4FE4 A;  3KYL A;  4B48 A;  1GLN A;  1GV5 A;  3SXY A;  2RDP A;  1TWH J;  1XGN A;  5FLX K;  1Y6I A;  1O57 A;  1QPM A;  4G6D A;  4G6T B;  3WOD F;  1I3A A;  4OIR F;  3OYG A;  2CMP A;  4I99 C;  4OIN F;  4RS8 A;  5D5V B;  1WH7 A;  4AD9 A;  2WA0 A;  1FIA A;  2RNJ A;  3E7L A;  5D5U B;  3S3N A;  5EG0 A;  1U9N A;  1IN8 A;  1KYW A;  1VTN C;  2MYS A;  1TW2 A;  1TT0 A;  2NS7 A;  2QQ9 A;  2JSC A;  2JWT A;  4XQF A;  3L2V A;  4PZJ A;  1DGR M;  4D5F A;  2HVQ A;  5L3E A;  4FX0 A;  2Y0M A;  3HOV J;  1SFX A;  2DTR A;  4Y17 A;  3RZD J;  1FY7 A;  1UMQ A;  2VT3 A;  2Q1Z B;  3E5U A;  4LLG F;  1RUO A;  4UV8 A;  1J59 A;  4JYK A;  1GXP A;  2GA2 A;  2FNP A;  2ZSH B;  3ABK H;  5HS7 A;  3A4C A;  2ZXI A;  4ZTF A;  2XPU A;  5DV5 A;  1ZRC A;  1I27 A;  2XIG A;  2D1H A;  2XSJ C;  2IT0 A;  2VN2 A;  4ZYA A;  5FKM A;  4DYR A;  1UCR A;  4XLN F;  3OYA A;  1D8K A;  4PFO A;  3J7A O;  1BN5 A;  5AIP A;  4DZP A;  2LC2 A;  4XLA A;  3OS1 A;  1MKM A;  2X9D A;  1T95 A;  2DXI A;  4UB8 C;  1ZHF A;  4QIW N;  2FF4 A;  2QGU A;  3Q3S A;  4IPA A;  2P81 A;  1K4T A;  2V1N A;  2MAB A;  4DOZ A;  2MH2 A;  3E3V A;  3CJR B;  1OIS A;  3EYY A;  2V26 A;  2O61 A;  3MAJ A;  2ELH A;  2Y75 A;  4WXD A;  4HV5 A;  2E60 A;  2KHM A;  2WB1 N;  4KT5 C;  2RQQ A;  3A0H C;  1LQ1 A;  1K7A A;  5HDN A;  3VOD A;  3K2A A;  2XV4 S;  3HKZ A;  1ZG1 A;  1KU7 A;  3OYJ A;  1XSD A;  1ZRF A;  3F3X A;  3MVP A;  3CC7 I;  2HZD A;  3A02 A;  3P9K A;  3GBG A;  3FF5 A;  3HXL A;  3PUF A;  3G2B A;  3Q9S A;  5CQE A;  5J40 A;  3WHB A;  1VQ9 I;  2HDC A;  2G7H A;  4BEH A;  1B72 A;  1MNM C;  3OYN A;  1FBU A;  4MEX F;  5IT9 K;  1NTC A;  1WCM J;  1SFE A;  1HW2 A;  3L2C A;  2ESH A;  2AO9 A;  2DA4 A;  1U8B A;  1ON1 A;  1L0O C;  5C44 J;  1MBJ A;  2WTE A;  3JRC A;  1JGG A;  1PUE E;  2JA8 J;  1QVT A;  4Y3O A;  4EJV A;  5JHU A;  3I9V 2;  2YU9 J;  1LKX A;  4CO8 A;  4FTH A;  1HA8 A;  4II2 A;  3BTI A;  3H9G A;  4NC7 A;  1X2N A;  5J3L A;  1FNN A;  2O9L A;  1AOY A;  2RRE A;  2V79 A;  4IOC F;  1NG6 A;  1S29 A;  1D0Z A;  4PCQ A;  4A3B J;  2BXZ A;  4UUS B;  3C2H A;  3U1K A;  2FSW A;  4LGW A;  2R7X A;  1X4P A;  4I0A A;  1HXD A;  5CVR A;  3HOZ J;  3JRG A;  5BOX A;  4Z6Y A;  3BCA A;  1ZAO A;  2KPM A;  1N75 A;  1M1E B;  2DFE A;  4A3K J;  3H5N A;  3I5U A;  3GTP J;  2KFD A;  1JXS A;  4F91 B;  1N77 A;  1X19 A;  3IWZ A;  5FB2 A;  2L02 A;  2HS5 A;  3QP6 A;  5FLM J;  2XRO A;  1FMV A;  3BQY A;  2FQ4 A;  1FOK A;  4EGY A;  1R1V A;  3BZK A;  4U0Y A;  2L01 A;  3I4M J;  4Z2Y A;  4AYB A;  1T38 A;  3FBN B;  5A2Q Z;  2HPM A;  2E34 A;  1FOY A;  4HPQ A;  4B3X A;  4IRH A;  1FSE A;  2X51 A;  1A35 A;  2JA6 J;  5EEH A;  1FP1 D;  5ICC A;  1LVA A;  3GXO A;  3OSF A;  1VQO I;  4XID A;  2HVS A;  2UUZ A;  3DTE A;  4RBO A;  2JN6 A;  1FTT A;  1KYZ A;  2CWE A;  3IHU A;  2EPF A;  4YIR X;  2Z33 A;  2L9V A;  2ACJ A;  1MJA A;  2ICW G;  4P9F A;  5H2F C;  1ZGA A;  1MND A;  3GZ5 A;  1HQC A;  4EJU A;  4L9N A;  2CQ7 A;  2CUE A;  2VC0 A;  1G3W A;  2XKO A;  1U8R A;  3I3L A;  1U78 A;  3DBR B;  4FQG A;  3LA3 A;  3I4P A;  1KGS A;  2KKO A;  2P7C B;  2R7F A;  2K27 A;  2VJ4 A;  2LY9 A;  2A5W A;  2BV6 A;  4PSX A;  1F9N A;  3FXJ A;  4FHT A;  4A3D J;  3OV8 A;  3JCU C;  1A04 A;  2KL4 A;  3G4S I;  1IXR C;  1RES A;  3HTU A;  1S7E A;  3M8E A;  1ZRE A;  4RGX A;  3KP7 A;  3MQ0 A;  4B44 A;  2IJL A;  1R7J A;  4XRF A;  1ETV A;  2AS5 F;  5GPC A;  3GTO J;  4C3I J;  3GTL J;  4UB6 C;  4M6Y A;  2DMU A;  3DTI A;  4MLO A;  3HHG A;  5EG0 B;  3BRO A;  1SD5 A;  1WGX A;  3CDH A;  3CCS I;  2W48 A;  1HC8 A;  1S5L C;  2IW5 A;  3H9J A;  3O8H A;  2DBB A;  4AVP A;  2X4H A;  1I39 A;  4U0V A;  2KMU A;  2QUF A;  3FM5 A;  2HI3 A;  1I5Z A;  1FOW A;  4GGG A;  2H6B A;  2EIN H;  2XAF A;  4AIH A;  1CF7 A;  3S8P A;  2ELJ A;  2P6S A;  4XRS A;  1TC3 C;  1R22 A;  2EWN A;  1V55 H;  4MFD A;  2DT5 A;  3QOE A;  5DYM A;  2MW8 A;  3PNT A;  5BPI A;  1JKP C;  4I2O A;  1BI3 A;  1LJ9 A;  4Y4R A;  4BE0 A;  1PUF B;  1XX5 A;  2PFB A;  1VFC A;  4HYE A;  1FEX A;  1HDD C;  1BOA A;  1X58 A;  1YOV B;  3DEU A;  1T6S A;  4BU2 A;  3OIO A;  2AQE A;  2HYJ A;  2P7V B;  4CH7 A;  2W85 A;  1R49 A;  3MZ8 A;  3COA C;  1ODD A;  3E6C C;  3MKY B;  3SDB A;  4RLQ A;  3DLA A;  1ZGJ A;  1V5G A;  1WJ5 A;  4YEL A;  5TGT A;  1RR7 A;  1RZ4 A;  3G1M A;  3ZQQ A;  2JA7 J;  2GXB A;  1GUU A;  2X85 A;  5EEG A;  4EMS A;  1K78 A;  3RKW A;  4Y15 A;  3ZGK A;  3R61 A;  2DYS H;  3BR3 A;  1DP7 P;  1R6R A;  3SZG A;  2XPW A;  1BM9 A;  3BPX A;  4RGS A;  5HLI A;  3IRQ A;  2E5N A;  3CUO A;  1WJB A;  1IXC A;  2ZNY A;  3AL0 C;  4RB3 C;  3H36 A;  5J1U A;  1Y0N A;  2HOA A;  1USS A;  2JPB A;  5J1R A;  5KHD A;  3PJR A;  2IEK A;  3U2R A;  1TNS A;  3BTJ A;  3ZOB A;  1D1A A;  2L54 A;  2KIQ A;  4GFB A;  3W2W A;  1S7A A;  2VC1 A;  1Q1H A;  2IGN A;  3O2P E;  2J5O A;  4BEH B;  3KCC A;  2STT A;  1QHG A;  3QQA A;  1B72 B;  4KDP A;  4U7B A;  1J2X A;  2PX9 A;  2CW7 A;  3OSG A;  3H3Z A;  4JQF A;  2ZXJ A;  5FD5 A;  2LR8 A;  4M3D A;  3LL7 A;  1IRG A;  2B7E A;  4BAC A;  1GT0 C;  4XOP A;  4LIV A;  1REP C;  2NVU B;  5FFZ A;  2DK5 A;  3QPH A;  3VDX A;  3CCU I;  2VQG A;  3D5R C;  1XMX A;  3VSL A;  4AC0 A;  2V9V A;  3T8R A;  2L9R A;  2YS9 A;  3GZ6 A;  3OYH A;  5K7F A;  2W82 A;  3DPU A;  4HST A;  1Y1W J;  4LK1 F;  2WB1 A;  1SD4 A;  4PJM A;  1WJF A;  4O6J A;  1DPR A;  3A01 A;  4KMF A;  2A05 A;  2WAQ A;  1UZC A;  4L18 B;  3JSP A;  2XF5 A;  2KIM A;  1IN6 A;  2QVO A;  1BW6 A;  3KLN A;  3ZMD A;  2CV0 A;  1VQ5 I;  4ENM A;  4XRS G;  2DAO A;  1MH4 A;  4C30 A;  2IS6 A;  2EIJ H;  3GFL A;  2BZT A;  2PMZ N;  1U3E M;  2XDV A;  3FK7 A;  3K1P A;  4ENK A;  2ISY A;  5D4S A;  4C3J J;  1H8A C;  1HCR A;  1T98 A;  1D1C A;  5FKO A;  5F1J A;  2R92 J;  1R9T J;  4XK4 A;  1UHM A;  5JLW A;  4BHC A;  4HNT A;  5BMZ A;  3BCB A;  1QZY A;  3PO2 J;  3H0G J;  2K85 A;  2BY1 A;  5B1A H;  5HS9 A;  4LFU A;  3K4N A;  3NEU A;  4V2F A;  5DUI A;  3HOX J;  5E3M A;  3HPH A;  1E3P A;  2M45 A;  4A3J J;  1KU2 A;  3HB9 A;  5DUK A;  2BBY A;  3AG1 H;  1R58 A;  1F4K A;  2XB5 A;  2LDU A;  3DU6 A;  2CSO A;  2GBY A;  3HUG A;  3WE3 A;  4WK8 F;  2V7F A;  1NH3 A;  2VLA A;  1SD7 A;  2KIU A;  2PJP A;  3NWT A;  2WAF A;  3KP2 A;  4M9X A;  3O3K A;  5DS9 A;  4BY7 J;  2HEO A;  1SD6 A;  2BGC A;  1LEB A;  2D45 A;  1YIJ I;  3LFU A;  3L7W A;  2G7U A;  1HBX G;  1YYV A;  3ZQH A;  5GPA A;  2LMD A;  4XKW A;  1TWC J;  2DOE A;  2EFN A;  2J5P A;  5FFX A;  2IS2 A;  1Y0U A;  4DJA A;  1EH6 A;  3SJM A;  4NB5 A;  2XAS A;  2BY0 A;  2CU7 A;  1SVO A;  3ESW B;  4AUX A;  2QQB A;  2RAE A;  2HZT A;  1YW9 A;  1J75 A;  2XGE A;  3P9C A;  4MFE A;  2O3F A;  2K86 A;  1RR8 C;  2M3A A;  3F9K A;  1UFM A;  2L7F P;  3HRT A;  3I4N J;  3S2W A;  4PJ0 C;  3V7S A;  5HOD A;  2E19 A;  2K02 A;  2O5R A;  2M8E A;  2EFO A;  2V1U A;  3BTC A;  4KN7 X;  4DW6 A;  3SEQ A;  1WSU A;  2VJJ A;  5IT3 A;  1LUJ B;  3HOS A;  1DP3 A;  4N4O B;  3ROU A;  3PL8 A;  3PUB A;  2E35 A;  5AON A;  3EYI A;  2LKX A;  3IC7 A;  3A0B C;  1H88 C;  4BQQ A;  3MZY A;  5HNF A;  3TL4 X;  2IGO A;  4L5E A;  1TW3 A;  5IPA A;  3S1Q J;  2DOD A;  3K9T A;  5HLH A;  1JI8 A;  5J4V A;  4M6V A;  4E7I A;  4JX6 A;  4BS9 A;  1K78 B;  2DMN A;  3OWT A;  4PDK A;  3M7G A;  4LJZ F;  5EEA A;  3GTJ J;  5E18 F;  3FMS A;  3CP2 A;  5M3M J;  2XAU A;  1R4M B;  1XMK A;  3W2A A;  4ENN A;  3LOC A;  3S32 A;  3FXK A;  5HLG A;  3IWF A;  2VE8 A;  1IRZ A;  4JP0 A;  3S2H J;  2E2H J;  5E20 A;  5IOZ A;  1IN7 A;  3FK6 A;  3LA7 A;  4N9I A;  2W1O A;  1E3O C;  4RA2 A;  3DKW A;  5CVI A;  1DQU A;  2FX0 A;  1STZ A;  4AM3 A;  4WXC A;  3BZ6 A;  3SZP A; 
#chains in the Genus database with same CATH homology
 5F08 A;  1P7I A;  2FJ1 A;  3HOV J;  2CQQ A;  3RZD J;  1ETX A;  1UMQ A;  3SFI A;  1LFB A;  3HEF A;  4JYK A;  1ZR2 A;  3BG9 A;  2VPR A;  4MIM A;  2DTZ A;  4BY1 J;  2XPU A;  1MBG A;  1ETY A;  1G2H A;  1LFU P;  2QF7 A;  2DMQ A;  2XRL A;  1LE8 A;  5FKM A;  4DYR A;  5F27 A;  4X6A J;  3JRD A;  4A3M J;  2DA7 A;  4DZP A;  3L1P A;  2X9D A;  4M3B A;  2XPV A;  4QIW N;  2VUM J;  3A01 B;  3Q3S A;  4BXX J;  2P81 A;  2R7Z J;  3RZO J;  2IBD A;  5IYC J;  1F43 A;  1XS9 A;  2COB A;  2NOG A;  3IH4 A;  4BBR J;  3S17 J;  3S2D J;  2ID6 A;  2WB1 N;  4B1R A;  1HDP A;  5EZG A;  3D1N I;  4FE7 A;  5M3F J;  3BR5 A;  1HOM A;  5C4J J;  2LTP A;  3K2A A;  1JUM A;  3FIS A;  3BG5 A;  5K7H A;  3MVP A;  2M9H A;  2EZH A;  3A02 A;  3GBG A;  4A3L J;  3TP0 A;  3WHB A;  5C3E J;  1IDZ A;  1B72 A;  1MNM C;  4CYC B;  3S16 J;  1VF9 A;  1NTC A;  1Y1V J;  1WCM J;  1ENH A;  1GVD A;  2AO9 A;  2DA4 A;  2M34 A;  1U8B A;  2NVX J;  1EF4 A;  3HOW J;  2E1O A;  4I6Z A;  5C44 J;  1OCT C;  2MSY A;  2KDZ A;  1MBJ A;  1AKH A;  3GTK J;  3JRC A;  1JGG A;  3LSP A;  3GTG J;  2NVY J;  1QVT A;  5EGO A;  4A3I J;  2JA5 J;  2JA8 J;  2YU9 J;  1I50 J;  4FTH A;  3M4O J;  4DYQ A;  3TP3 A;  2R0Q C;  2YUS A;  3F0C A;  3BTI A;  1X2N A;  5J3L A;  2O9L A;  3B6A A;  3GTM J;  5IYD J;  4M3E A;  2XGC A;  4A3B J;  4A3C J;  4UUS B;  2EQR A;  2LLK A;  2NVT J;  3TED A;  3HOZ J;  2VKV A;  4UUT A;  3JRG A;  5FKK A;  2DMP A;  2M8G X;  3TW7 A;  4A3K J;  1YRN A;  2L7Z A;  3RKQ A;  2CUF A;  3GTP J;  5C4X J;  2GLO A;  1W0U A;  1W0T A;  3JRB A;  5FLM J;  3BQY A;  4QTR A;  2FQ4 A;  3B6C A;  3S14 J;  3I4M J;  4HNV A;  1JUS A;  1D5Y A;  5IP7 J;  1XC5 A;  4X1E A;  2Y0S N;  2JA6 J;  5FKN A;  4IHY A;  1IC8 A;  3OSF A;  1IUF A;  5JLX A;  4EEF G;  4XID A;  4IHV A;  4RBO A;  1FJL A;  2K9Q A;  2JN6 A;  1FTT A;  3HBL A;  2MG4 A;  2TCT A;  3HGG A;  1JKQ C;  3ZQI A;  2CUE A;  2X6O A;  1U78 A;  2DA2 A;  2LP0 A;  1JT0 A;  4M3G A;  2DA1 A;  2NS8 A;  2ZB9 A;  1IG7 A;  2HDD A;  3NAU A;  2LY9 A;  2DMT A;  2HQ5 A;  2CJJ A;  4A3F J;  1IV6 A;  1QPI A;  4A3D J;  1H89 C;  4IHW A;  1RES A;  1S7E A;  3Q0W A;  2IAI A;  2XGD A;  3LSG A;  2R5Y A;  3QPL A;  1MSF C;  1RKT A;  1FTZ A;  1ETV A;  4IEJ A;  5GPC A;  3GTO J;  4C3I J;  3GTL J;  1Q1V A;  3TW6 A;  1MBE A;  3CMY A;  3WHC A;  2DMU A;  4CYC A;  1WH5 A;  4MLO A;  1NK2 P;  5EG0 B;  1WPK A;  1WGX A;  1NK3 P;  2W48 A;  3O8H A;  2ECC A;  4IHX A;  4BKX A;  1B8I B;  2EH3 A;  4AYB N;  3BG3 A;  1VND A;  1GDT A;  1F36 A;  4A93 J;  4D7N A;  4XIC A;  2H1K A;  2HI3 A;  4B4C A;  5EDN A;  3HDD A;  1T56 A;  3UKG A;  1AHD P;  1BA5 A;  5K7Z A;  4XRS A;  3IV5 A;  1TC3 C;  4MFD A;  1MH3 A;  3FIW A;  2MW8 A;  5F04 A;  1JKP C;  1IDY A;  4Y52 J;  1UHS A;  3RQI A;  3DCF A;  4NDL A;  1PUF B;  2MGQ A;  1VFC A;  2EZL A;  4W1U A;  3BR2 A;  1FEX A;  1HDD C;  1ZTR A;  3HM5 A;  1LE8 B;  2ELK A;  1X58 A;  3JRA A;  5EF6 A;  3OIO A;  3QPS A;  2HYJ A;  3LSJ A;  4V2G A;  3PO3 J;  5E3O A;  2QCO A;  1JKR C;  1APL C;  1RR7 A;  3G1M A;  2GM4 A;  2JA7 J;  1GUU A;  4DYC A;  4JX4 A;  1I6H J;  1WI3 A;  1BJZ A;  1ETW A;  2DJN A;  3BR3 A;  3A03 A;  2XPW A;  1DU0 A;  4JX5 A;  2K9N A;  4Y7N J;  5J1U A;  1O4X A;  2CQX A;  2HOA A;  1U9O A;  4G12 A;  5J1R A;  2LFB A;  5M5W J;  2O7O A;  2R5Z B;  2IEK A;  2H8R A;  2EZK A;  3BTJ A;  1JTX A;  3ZOB A;  5FKL A;  2OF7 A;  4GFB A;  2VI6 A;  2HXO A;  4BBS J;  3GTQ J;  3BR1 A;  1UG2 A;  1B72 B;  3QQA A;  2WV1 A;  2DA5 A;  4FCY A;  3CQZ J;  1ZR4 A;  3S1N J;  3HKZ N;  2HOS A;  1Z77 A;  4QSH A;  3OSG A;  2NVQ J;  1K61 A;  3S1M J;  2LK2 A;  2LR8 A;  4M3D A;  1MSE C;  1AKH B;  4D7M A;  1GT0 C;  2FD5 A;  5E3L A;  5EGO B;  2XB0 X;  2Y9Y A;  5EZH A;  3SDG A;  1GV2 A;  1OFC X;  1POG A;  4AC0 A;  2DN0 A;  2L9R A;  2YS9 A;  4M3F A;  5K7F A;  1Y1W J;  3H3V K;  1SAN A;  5E3N A;  2ME6 A;  2LVS A;  4MO7 A;  5M5Y J;  1TWA J;  4ABZ A;  2DA6 A;  4D5C A;  1XG1 A;  3HOY J;  1QRY A;  4A3E J;  1BW5 A;  3A01 A;  3G1O A;  1ZKG A;  1OCP A;  5EYR A;  1BW6 A;  3HOU J;  1A6I A;  4XRS G;  1YRN B;  3ZQC A;  1SFO J;  2KT0 A;  3JRH A;  3JR9 A;  1MH4 A;  3BQZ A;  3CCY A;  1X2M A;  5GP9 A;  5IP6 A;  3K7A J;  3DEW A;  2PMZ N;  2HOT A;  2JJ7 A;  2R5Z A;  1ETO A;  3FK7 A;  1OJL A;  2E2J J;  4C3J J;  1H8A C;  1HCR A;  4B3A A;  5FKO A;  5F1J A;  2R92 J;  1R9T J;  4XK4 A;  2B63 J;  5JLW A;  1FIP A;  1RET A;  2JMW A;  3PO2 J;  3H0G J;  1PUF A;  3LNQ A;  3G1L A;  5BNG A;  4J19 A;  4V2F A;  3S15 J;  4LOC A;  3BR6 A;  4RDU A;  2ID3 A;  5E3M A;  3HOX J;  1TWG J;  1ZQ3 P;  4C2M J;  4A3J J;  3HB9 A;  3VPR A;  2Y2Z A;  2O8K A;  2K9S A;  1MBH A;  2XB5 A;  5FJ8 J;  1K83 J;  3ZQL A;  3BR0 A;  2GBY A;  2G0E A;  3HGY A;  4S0H B;  3LSR A;  1P7J A;  3BTL A;  3S1R J;  5DS9 A;  2K40 A;  4BY7 J;  1TWF J;  1QVU A;  4UUS A;  1CQT A;  1ITY A;  3M3Y J;  2WAQ N;  3O8G A;  2OPT A;  1MBF A;  2ME0 A;  2Y9Z A;  2CRG A;  1BL0 A;  2X48 A;  3OOU A;  1JUP A;  4DZJ A;  1HF0 A;  1VI0 A;  3MN2 A;  3C2B A;  2JK3 A;  2DA3 A;  5GPA A;  1TWC J;  2M0C A;  2Y30 A;  5IYB J;  4A69 C;  2R5Y B;  1ZGW A;  1DU6 A;  5J1Y A;  4XRM A;  3SJM A;  5M5X J;  2CU7 A;  2AHQ A;  3JRI A;  4AUX A;  3MKL A;  5F0H A;  2RAE A;  1I3Q J;  1AU7 A;  1ETQ A;  2D5V A;  5FLV A;  4I76 A;  2LD5 A;  2L7M P;  4C3H J;  1HLV A;  3FKI J;  2R93 J;  9ANT A;  2XGE A;  1Z0X A;  4MFE A;  3ZQG A;  1ORK A;  3Q0U A;  1JKO C;  2E2I J;  3NAR A;  1IJW C;  5F0C A;  2L7F P;  3PM1 A;  3I4N J;  1ZK8 A;  5HOD A;  2E19 A;  1ETK A;  3W6V A;  3Q0V A;  3BTC A;  4DW6 A;  2XSD C;  1A5J A;  1JJ8 C;  5IP9 J;  1RPW A;  5F0F A;  1IGN A;  3BT9 A;  3IH2 A;  2LKX A;  3ZQH A;  2VKE A;  3IH3 A;  5IOY A;  1H88 C;  4L5E A;  1T33 A;  5IPA A;  3S1Q J;  4A3G J;  1JJ6 C;  4W97 A;  2TRT A;  3JRE A;  4M6V A;  1JTY A;  4JX6 A;  2I10 A;  2DMN A;  2L0K A;  2N8G A;  4FE4 A;  2HXI A;  5EEA A;  3GTJ J;  2EBI A;  1GV5 A;  1RKW A;  1TWH J;  5M3M J;  3LOC A;  2ECB A;  1IRZ A;  4JP0 A;  3S2H J;  2E2H J;  1WH7 A;  5IOZ A;  3FK6 A;  2Y31 A;  5DTD A;  1FIA A;  3CDL A;  3E7L A;  1E3O C;  5EG0 A;  1U9N A;  3ZQF A;  1JT6 A;  1MBK A;  4FIS A;  2FX0 A;  2M2E A;  1B8I A;  2NS7 A;  2EZI A;  2JWT A;  4D5F A;  3JRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...