3MKLA

Crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
QPNMRTRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HTH-type transcriptional regulator gadX
publication title Crystal structure of DNA-binding transcriptional dual regulator from Escherichia coli K-12
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 35
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00165 HTH_AraC Bacterial regulatory helix-turn-helix proteins, AraC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mklA00
4S0HB 2R92J 1H89C 1ZGWA 2M2EA 3CMYA 1A5JA 5EZGA 5E3MA 3LSPA 5EEAA 2L7FP 3Q3SA 4UUSA 1BA5A 1ETXA 4G12A 5F27A 1VFCA 3K2AA 2R5ZA 3RQIA 3DEWA 1ETYA 2FQ4A 3W6VA 1B8IB 3Q0VA 2FJ1A 4A3LJ 4XICA 3I4MJ 4DZJA 1D5YA 3BR6A 4I76A 3JRAA 2QF7A 1OJLA 2LK2A 1U9NA 1NK3P 4JX5A 3B6CA 3JRCA 5F08A 2NOGA 3OIOA 1FTTA 3Q0UA 2DMTA 3QPSA 3JRIA 3IH4A 4A3GJ 1GV2A 1JUMA 4JX6A 4X1EA 3HM5A 2AHQA 1MBGA 5FLMJ 3E7LA 3F0CA 3GTQJ 4A69C 3IV5A 2LFBA 1QVTA 1E3OC 3UKGA 1ETOA 2VI6A 4AYBN 3MVPA 4IHXA 4AUXA 1GVDA 4A3JJ 3HEFA 4FE4A 2HOTA 3VPRA 2K40A 1MBEA 1W0UA 2XPUA 1JTYA 1XC5A 1ZTRA 4XK4A 3LSGA 5EG0B 4L5EA 3HBLA 2XB0X 3A01B 2X6OA 3WHBA 2GLOA 3OOUA 4RBOA 2NVXJ 2R7ZJ 3JR9A 3D1NI 3BR1A 1R9TJ 3IH3A 2H1KA 2E1OA 1P7IA 2ID6A 1WCMJ 3FIWA 4UUTA 3HB9A 2M8GX 2DA1A 2DA2A 2M0CA 1PUFB 4A3EJ 1BJZA 5E3NA 1I6HJ 1ENHA 3JRBA 3Q0WA 4M3DA 3G1MA 2XPWA 2ELKA 2N8GA 3GTMJ 5M5WJ 5K7HA 1CQTA 1ETVA 3BTIA 2Y31A 1B8IA 2ME6A 1HCRA 1JJ8C 4D7MA 5IP6A 2P81A 4HNVA 3JRFA 1Q1VA 4C3IJ 1Y1VJ 2XB5A 4D5FA 3SFIA 1APLC 2K9QA 1F43A 2EBIA 1ORKA 5IP7J 4D7NA 3CCYA 1JKOC 5GPCA 3O8HA 3TW7A 1B72B 3HGYA 1MNMC 3S1MJ 3SDGA 1IGNA 2L0KA 2COBA 3LSJA 2D5VA 4CYCB 3ZOBA 5FKMA 1DU0A 2CRGA 3G1OA 4FE7A 5K7FA 2FX0A 5F1JA 2HI3A 1ZR4A 2R93J 2X9DA 3H0GJ 5EG0A 1ETQA 2VUMJ 1GT0C 1FIAA 5J1RA 2JA8J 3A01A 2Y30A 5FLVA 1IDYA 1K83J 1RR7A 3ZQFA 3S14J 2Y9ZA 1U8BA 2LP0A 4BY7J 5F0HA 1VNDA 4IHYA 3GTPJ 2L9RA 1POGA 3FKIJ 3OSFA 3HOZJ 3S1NJ 2E2HJ 3GTKJ 1GUUA 3LSRA 3WHCA 1JTXA 1PUFA 2K9NA 4IHWA 2HOSA 5BNGA 3CDLA 5FKNA 3NARA 4M3EA 1GDTA 1BL0A 2OF7A 2TCTA 2LD5A 2FD5A 5EDNA 3OSGA 3S1RJ 2G0EA 3A03A 1TWHJ 1SFOJ 2MG4A 2LY9A 5EZHA 1MSEC 1QRYA 2E19A 1LFBA 3BR3A 2LTPA 3BT9A 5J3LA 4ABZA 5IOZA 2HYJA 1AKHB 2O7OA 1FEXA 1HOMA 1JUSA 2HOAA 1B72A 3HOUJ 2DA7A 2O9LA 5F04A 2XGEA 3FK7A 3IH2A 3BG3A 1HDPA 2JMWA 4CYCA 2PMZN 4QSHA 1X2MA 3GTJJ 4A3IJ 3BR0A 4FTHA 3PO2J 1WI3A 3BG5A 3RZDJ 1LFUP 3MKLA 3FK6A 1MSFC 2IEKA 2DJNA 1FIPA 5EYRA 2E2JJ 2XPVA 3L1PA 3I4NJ 2JJ7A 2VPRA 1IC8A 3S2HJ 2O8KA 2DMPA 3C2BA 3PM1A 1AU7A 5IPAA 4XRMA 5EGOB 2JN6A 4M3BA 1W0TA 1X2NA 1IRZA 2H8RA 1T33A 3BTJA 2DA5A 3NAUA 5M5XJ 2EQRA 3GTLJ 3ZQHA 2DA3A 4A3DJ 1MBHA 3LOCA 2R0QC 5IOYA 1TWFJ 1TWAJ 2VKEA 2X48A 2R5YB 1MBKA 3JRDA 4I6ZA 4IEJA 5C4JJ 2ECBA 1H8AC 1TC3C 4BBRJ 4DYRA 2YU9J 4X6AJ 2EH3A 1FTZA 4MFEA 4C2MJ 5JLWA 3M4OJ 4QIWN 1SANA 3HOVJ 4BBSJ 2AO9A 3TP3A 4J19A 1UHSA 3QQAA 2DMUA 5J1UA 4A3MJ 1HDDC 4C3HJ 1VI0A 3JRHA 5F0CA 2KT0A 3DCFA 2HXOA 2ZB9A 2VKVA 1AKHA 1RKTA 4Y52J 2CQQA 3HKZN 1ETKA 2ECCA 1JUPA 4W1UA 1DU6A 4FISA 3LNQA 5GPAA 2EZLA 3TW6A 2HQ5A 2NS7A 2CUFA 1RKWA 4V2FA 1GV5A 1WH7A 1MBJA 3GTGJ 1P7JA 3BR5A 4GFBA 2YUSA 1HF0A 5IP9J 4V2GA 2JA6J 2HXIA 2K9SA 3JREA 4XRSG 1JT6A 4D5CA 5EGOA 2KDZA 3HGGA 1OFCX 2CUEA 1JT0A 4JX4A 2B63J 1G2HA 2JA5J 3ZQGA 1RPWA 2DA4A 3BTLA 5IYCJ 2XRLA 1IUFA 1S7EA 2RAEA 3HOXJ 2MGQA 5F0FA 2DA6A 2R5YA 2EZHA 3BQYA 1XS9A 3GTOJ 2W48A 4JYKA 5FKOA 1U78A 1TWCJ 5IYDJ 3O8GA 2IAIA 5C4XJ 4RDUA 5J1YA 2CU7A 4A3KJ 2DMQA 1K61A 1WPKA 1BW5A 5IYBJ 2LKXA 2NVTJ 2XGCA 2XSDC 4JP0A 3RKQA 3FISA 4BKXA 4DYCA 1YRNB 4A3CJ 1MBFA 2QCOA 5C44J 1JGGA 4LOCA 1OCTC 2HDDA 1JKRC 9ANTA 4DW6A 1LE8B 2LR8A 1WH5A 2ID3A 3JRGA 2TRTA 3S15J 1I3QJ 1O4XA 4XRSA 3HOYJ 3MN2A 2JWTA 3TP0A 4BY1J 4B3AA 1BW6A 2L7ZA 1IV6A 3HOWJ 1IDZA 2WB1N 4B1RA 3HDDA 3SJMA 2CQXA 2CJJA 4C3JJ 3S2DJ 2EZKA 1F36A 5E3OA 3S16J 2XGDA 2OPTA 1HLVA 5E3LA 4BXXJ 1Z0XA 2M9HA 3H3VK 1MH3A 3M3YJ 3RZOJ 5M3MJ 2Y0SN 2GBYA 2DTZA 2WAQN 5HODA 4A3BJ 4FCYA 5GP9A 5K7ZA 4Y7NJ 1RETA 1NTCA 4MIMA 3S17J 1IJWC 4DYQA 1QPIA 3BG9A 5FKKA 2LVSA 4QTRA 3A02A 4MFDA 3TEDA 2Y2ZA 2Y9YA 4IHVA 1X58A 2ME0A 1VF9A 3ZQIA 4DZPA 5DS9A 1YRNA 4MLOA 1TWGJ 1RESA 2IBDA 3QPLA 1UMQA 2E2IJ 1LE8A 1T56A 1H88C 4A3FJ 4UUSB 5C3EJ 2YS9A 5FJ8J 3K7AJ 2DMNA 4M3GA 4MO7A 1JKQC 2R5ZB 2JA7J 1U9OA 2LLKA 2I10A 1XG1A 1ETWA 1JKPC 2MW8A 2L7MP 3B6AA 3PO3J 3ZQCA 3S1QJ 3BQZA 1MH4A 3CQZJ 1ZQ3P 1QVUA 1I50J 3ZQLA 4B4CA 2DN0A 2JK3A 2M34A 5FKLA 1OCPA 4AC0A 2GM4A 5M3FJ 1WGXA 3G1LA 4M3FA 5JLXA 1EF4A 1ZK8A 3GBGA 5DTDA 1UG2A 2NVQJ 1ZKGA 2NVYJ 1ITYA 4NDLA 1A6IA 1Y1WJ 1NK2P 2NS8A 4EEFG 1IG7A 1JJ6C 1Z77A 1FJLA 1AHDP 2MSYA 3BR2A 5M5YJ 1ZR2A 3BTCA 4XIDA 2EZIA 4W97A 4A93J 4M6VA 2WV1A 5EF6A
chains in the Genus database with same CATH superfamily
2DTRA 3VDXA 3KE2A 3IC7A 3GMEA 2XROA 5LGTA 3BP8A 3V8LA 3WGIA 5L3DA 2L7FP 3Q3SA 4UUSA 4HDUA 3BDDA 1Z7UA 3FBNB 1VFCA 3K2AA 2R5ZA 3DPUA 3RQIA 4II2A 1YOVB 4CCNA 3N97A 2VPLA 3CO7C 3Q0VA 2XAUA 2HKXA 3ZMDA 2ZMEA 3PIPF 4BXFA 4XICA 2HS5A 4ZYAA 3ERED 3H1CA 1R49A 2BBYA 4HLYA 3AL0C 3OV8A 3EYIA 3CP2A 4D9JA 3B6CA 1QPMA 2EK5A 3JRCA 4XLFA 4IRIA 1BI0A 2FBHA 4PK4A 2DXIA 2BYVE 3S3MA 2W82A 2ZXIA 1YO5C 3F0CA 3OYIA 1U6GA 2DOEA 3IV5A 1QVTA 1E3OC 1HKTA 3LFKA 2QSGX 4WK8F 2QLZA 1V3FA 2A68F 3HEFA 1X1PA 2OV7A 4RS8A 3WGHA 4FE4A 2HOTA 1S3JA 3P9IA 3JAMZ 1XC5A 1F1ZA 4XLNF 4WCGA 2CWEA 2HNHA 3A01B 3WHBA 3KYLA 3PSIA 4NUBA 3OOUA 3ECHA 2NVXJ 2IXSA 2KJCA 2DDAA 1BI3A 1BOBA 3DF8A 1VQOI 1WCMJ 4PGGA 3KCCA 4NC7A 4A3EJ 2KIFA 1I6HJ 5TRDA 3EUAA 1VQ4I 3G1MA 2XPWA 4OMYA 4WWCA 5K7HA 2DT6A 1B8IA 3JAMK 3LA3A 4N0BA 5HLIA 3CMAI 3TMOA 2TDXA 3K4CA 4AIKA 4HNVA 2FUG2 2ZXWH 1X1DA 2PBIA 5LD2C 1IRGA 4A2UA 3R4KA 2K4JA 4ANJA 4P9FA 1F43A 2DYSH 5AIPA 4IPAA 4CHUA 1HBXG 4UB6C 3ABUA 3GUDA 5JVGF 1EV7A 1JKOC 2FA5A 1GVJA 2Z9OA 1DGWY 3A2KA 5HLHA 4BUPA 2XASA 1MNMC 2NNYA 1IN8A 2M7BA 3SDGA 1IXSB 5DM6F 2COBA 2D5VA 5BQTA 1UJ8A 4I98B 4KN7X 1Z3YA 4NC6A 4YEJA 2CRGA 1KU2A 1ZR4A 2KFDA 2R93J 2X9DA 4XKWA 3CCEI 1V55H 3DBHB 5H6QA 1IAWA 2VL8A 3H0GJ 3FMSA 1X1BA 3H9JA 3KP3A 1IDYA 3S14J 1D5VA 2HVRA 1WJAA 2XC7A 1U8BA 3LWFA 1MMDA 4BS9A 2G7UA 2RREA 2YX4A 4BXUA 2A3SA 2L9RA 3BJOA 2HFHA 3FXMA 2LYCA 3S1NJ 4RGUA 1I3AA 4KN4X 4EQQA 2PLYA 4E7JA 3ISPA 3LSRA 3WHCA 3CJQB 3ZR8X 1CF7A 4E6KG 5BNGA 2HOSA 1E2XA 1BIBA 1X1CA 2OTLI 3KX2A 3NARA 4M3EA 1KONA 3KZZA 3ULQB 2X1CA 4BHBA 5D4RA 1WVRA 1Y8RB 4EJTA 3WTYC 3FXJA 2LBFB 3GZ6A 4FT8A 1XB4A 6PAXA 2CQNA 3A03A 3F8NA 1TWHJ 1R36A 4FASD 1XMKA 2DO7A 1Z3XA 2LY9A 3RYPA 2NOJB 1MNEA 4GGGA 1MSEC 4BDYA 5HDGA 5LBQA 4PGHA 2JSPA 4L5IA 5IOZA 3KEOA 3DTKA 3OYKA 2WY8Q 2RDPA 4Y13A 2O7OA 1FEXA 4XM3A 1WJEA 3DP7A 1FBSA 3SZPA 4X0GA 2F4OB 1SAXA 1ZARA 2HZDA 3HOTA 4FTHA 4EV0A 3S8PA 1IN4A 4NBQA 2P7CB 1UZCA 1IXCA 3CUQC 1WI3A 3RZDJ 2E1MC 3SZGA 3C1DA 3MKLA 3WTSC 3FK6A 4BAYA 4RB2C 4O6JA 2E2JJ 4CO8A 2XPVA 3QPHA 1MNDA 2JJ7A 2G9WA 4LITA 2DMPA 3C2BA 4D0PA 4EJUA 1DDNA 3I5UA 1ZHFA 4I0AA 4C2UA 4M3BA 3X2QH 1OR7C 3T0YA 5BPIA 5FRNA 3VSLA 4XBFA 4UV9A 3NAUA 5M5XJ 2L2OA 1R58A 3AG2H 3DTIA 4BE1A 3CD6I 3WTUC 1XMAA 3ABTA 1LEBA 3KEYA 3B73A 3IWZA 5EJCA 2X48A 2R5YB 1MBKA 1FOWA 2LY1A 5D5VB 2ECBA 4RAZA 1H8AC 1TC3C 4G9YA 4R8HA 5GADJ 1FTZA 4S04A 3LQQA 3M4OJ 2WB1A 2Q2EB 4QIWN 2BGCA 1SANA 1Y0UA 4P9UA 3HOVJ 3D5RC 3CJNA 2XV4S 1I1SA 3ML6A 2CSOA 2AO9A 2JTVA 3CCLI 3TP3A 2EFWA 2EV0A 4J19A 2DMUA 2JVGA 1HDDC 4UHTA 5F0CA 2KT0A 3DCFA 4B09A 2VKVA 3E6DA 4AIJA 2MH9A 4BU2A 4Y52J 1YE9A 2R7OA 4HRIA 3L7WA 3HKZN 4Q4ZF 2EFOA 2OD5A 4W1UA 5FROA 2HDCA 4BEHB 3F9KA 3VSKA 2NAZA 4N9IA 4H0EA 1RKWA 3CUQA 1BIAA 4MNUA 1GV5A 4HG2A 5LGNA 1WH7A 3COAC 1P7JA 2FXAA 5KK1A 3CDIA 3IRQA 5IP9J 2DAOA 2XRNA 3F8CA 4R1HA 3SEQA 4IKFA 2VKDA 3K4JA 1HSTA 3T8TA 3E97A 4AWXB 1OR7A 3DBLB 1KU3A 4D5CA 1F4KA 4BL0B 1MMSA 2P0WA 3RTRA 4LLLA 4KDPA 4OAZA 3RIRA 1K6OA 2QZ8A 1UHWA 4PJNA 3HOXJ 2BXYA 4HYEA 1HC8A 4AU7A 2HPMA 1G3WA 2XGXA 3GTOJ 1RC9A 4XOPA 4KYWA 2CV2A 2W48A 2ZC2A 4JYKA 2H6CA 5FKOA 3FWEA 5ICGA 5ILUA 1ODDA 2RVCA 2DCEA 2IAIA 5C4XJ 3WTWC 1CGPA 1MMNA 1S5LC 3IWFA 5IYBJ 3CF5F 2IA1A 1MMGA 2MABA 2XSDC 5K1YA 4GYGA 2D1HA 1VQ6I 3F3XA 1MBFA 3SFZA 3M8FA 2KZVA 4HA8A 2EIJH 1TP4A 1JGSA 5E1ZB 4PFPA 1MKMA 5HS8A 2V1XA 1WH5A 1YIOA 2EILH 2HWVA 2TRTA 2W4SA 3JRGA 2CGPA 4LG0B 2K9LA 3OYEA 3WG7H 5D5UB 3F72A 1V5EA 4NQWB 1FYKA 2XKOA 3QU6A 2FEZA 2OAZA 4RM2A 3TP0A 4BY1J 4B3AA 5B3SH 1IV6A 1IDZA 4B1RA 3EPZA 4RGSA 3OYBA 3HDDA 3SJMA 2CQXA 3CMEI 3QAHA 2VJ4A 1KQ0A 3O3KA 2WAFA 1G3SA 1TLHB 2EZKA 2FNAA 5E3OA 3EYYA 2XGDA 3S16J 1HLVA 3EDPA 5GAEJ 4HSTA 2JRMA 2M9HA 3DKWA 3OL4A 1J59A 2GBYA 3WE2A 2WAQN 5L3GA 2MC3A 3VYRB 1O3TA 4S05A 5L3FA 4HF0A 2EA4A 4U7DA 3FXUA 1ONVA 1S29A 1X3WB 1O7LA 3MD2A 1IJWC 3RCOA 4XRFA 4EJOA 2GA1A 2KIQA 1I39A 3GFJA 3RPUA 3HRUA 5LHIA 1TW3A 1SC7A 4QTRA 3A0BC 3TEDA 2Y2ZA 1FWZA 3KP4A 3VWBA 5H20A 1VF9A 3LA2A 2KJBA 4MLOA 1K78A 1RESA 3BY6A 2ISYA 1UMQA 3QPLA 3RQ4A 3SEZA 1S72I 3DKYA 5CVUA 2E2IJ 3ZQQA 5KHDA 1T56A 2QQ9A 1EH8A 3AFHA 2BHYA 3JCUC 4GRIA 4UUSB 2E5NA 3QYEA 3I56I 2YS9A 4XN0A 3K1PA 4MO7A 2M0MA 2R5ZB 4M73A 4XL9A 5GAGJ 1TNTA 2K86A 4MTDA 3ZP5A 2JUCA 4HV6A 4UVBA 2ZMEB 1W4MA 4ZTJA 3FM5A 4M71A 2FF4A 2F4IA 3WTTC 2ZXJA 4KICA 1PVEA 1QVUA 1ZQ3P 2LH9A 4LK1F 1I50J 4EM1A 5LHHA 2Z1DA 2M34A 5CPRB 4F91B 2OJED 4Z6YA 3LAPA 4M3FA 4CZCA 1EF4A 3HOSA 2VKHA 3FF5A 2NVQJ 2QWWA 2NVYJ 1ITYA 4NDLA 2LSOA 5B5EC 2QQBA 3FKJA 1TQIA 1JJ6C 1VQKI 3BR2A 3GF2A 1EH7A 1SD5A 3M8EA 4XIDA 5J8CA 4DNCA 2EZIA 2V4JC 3L2WA 1T98A 2O61A 1A04A 2Z2SB 3KLNA 4PUSA 2R92J 1H89C 2UUZA 1JE8A 1JI8A 2L7KA 1A5JA 5EZGA 2PN6A 2UWMA 1WQ2A 2CQ7A 2Y75A 1P9QC 1BA5A 1XX5A 1WJFA 5ICCA 1K79A 1EKEA 4AVZA 5F64A 3W6VA 1B8IB 2A6TA 4E7ZA 1IXRC 1SD4A 4A3LJ 5FGMA 1TZLA 1GLNA 1OCOH 3EQLF 4E7SA 3AL0B 1ERDA 3BR6A 4I76A 4ZH4F 4LG3A 1UELB 1RR8C 4GDFA 1Y0NA 3OMYA 3FXRA 3QP5A 4IXAA 2FOWA 1NK3P 2R7VA 2MD5A 2UXXA 3ROUA 3S3OA 4M6YA 2Y48A 3G4SI 1IV8A 1JUMA 2A69F 5ICEA 3HIFA 3HM5A 2AHQA 3ZMVA 1MBGA 5FLMJ 3IL2A 1SFUA 4LLNA 4A69C 4E4HA 1XSXA 3L00A 3RYRA 2F4MB 1ZG5A 4AUXA 3PFYA 5CLSA 3BCBA 2LKSA 4HDVA 4A3JJ 3OYJA 4IZZA 3VPRA 1QGPA 2K40A 4HNUA 3CCRI 1ZTRA 4HQMA 3CESA 2FMYA 2XB0X 3DPTA 5LRSA 4RLFA 3RKWA 2M87A 3CCJI 1IRFA 4WF2A 2FMLA 1WWXA 4UVAA 2GLOA 4BJTA 1XGNA 2QBYA 4PJ0C 2LY2A 5BOXA 1N77A 2QKLB 2RV8A 1XGOA 4WXCA 2STWA 3OYFA 3FIWA 2K4BA 4NC8A 1VQPI 3HB9A 4UXNA 4WXDA 2IGMA 2WV0A 2ZNYA 1KGSA 1CF7B 4OMZA 2LG4A 3H36A 4JOMA 2E36A 3BC8A 4M3DA 1FYMA 2VN2A 4IRGA 2N8GA 1W5CC 2Q1ZB 3GTMJ 1FOYA 1D8KA 3B02A 1CQTA 1ETVA 3HTUA 2ME6A 2VBWA 1JJ8C 2WC2A 2R7WA 1G4DA 3CLQA 3JRFA 1Q1VA 4C3IJ 2KDOA 2H8WA 3SFIA 2E5ZA 1APLC 4BACA 2K9QA 3D5SC 5JFRA 3I9V2 3WTXC 5IP7J 3QYBA 2VIXA 3DWLE 3M1CA 1KZHA 3ESWB 5GPCA 1XSDA 4CGZA 4XOTA 3I64A 1E17A 4AIDA 3DLAA 1XGMA 3HGYA 3O6BB 2RKHA 4NHJA 1R4NB 1IGNA 1YHQI 3ZN0A 3ZOBA 1KA8A 3G1OA 2VC1A 4IRHA 5F1JA 1DP7P 1YX3A 1IO2A 1ULYA 5EG0A 4KIFA 4M74A 2W25A 1FIAA 4LB6B 5J1RA 3SDBA 4CCKA 3HRTA 1RR7A 2L9SA 3ZQFA 3U9GA 1VNDA 2Q0OA 5HDKA 4ZYDA 1K4SA 4AIHA 2VONA 2HPIA 3OSFA 2CH0A 2E2HJ 1EH6A 1BI1A 2DT5A 2EWNA 2XSJC 3HKZA 1JTXA 4U87A 1XD7A 4OU0A 4IHWA 1SAUA 4GXOA 5FKNA 4XSZF 3CCVI 3UNGC 3C18A 1BL0A 5D8KB 2FD5A 3R0JA 2EJRA 3J7AO 4LB5A 1A35A 1SFOJ 1MJAA 4DBRA 1LDDA 5LEKA 3CCQI 3GWZA 4HOBA 2MYSA 1BR2A 5EZHA 3VEPA 2OQRA 2E19A 1P2FA 2KMUA 3BT9A 2M4GA 5J3LA 1G59A 2ZJQF 5BMZA 2B7EA 1HOMA 3LA7A 2HOAA 1B72A 1MD0A 4RGRA 2DA7A 3CJTB 4Q48A 2XGEA 5CVJA 3FK7A 2F5DA 4CYCA 2PMZN 1X2MA 3GTJJ 3F6OA 4LJZF 3CUQB 4B8XA 4P1WA 3K9TA 2M45A 1I6XA 2E1MB 3OYGA 1LDJA 2R3SA 3CP8A 2DJIA 2GIZA 3BG5A 1LFUP 3SQNA 2F5VA 3AKZA 2L9NA 2MLKA 5EYRA 1FSEA 1FIPA 5GTIC 5KNLA 1VQ9I 2M7AA 3I4NJ 2QQAA 2ZCWA 1OCZH 3PM1A 1ZN2A 2V9KA 4L9VA 5IPAA 4XRMA 1W0TA 2JN6A 2H94A 1IRZA 5BS6A 2EINH 1T33A 3BTJA 1ZH5A 2V9VA 3GTLJ 4B43A 4LMYA 2V7FA 2QGUA 2P6SA 2LF7A 1YIJI 1MBHA 2QSFX 3CLOA 1XTAA 4O3MA 4I09A 1S6LA 5J6XA 3PJRA 1LFPA 5D8LB 3BZKA 2L01A 1AOYA 5KVRA 4FX0A 4I6ZA 2LC2A 1R1VA 4BBRJ 5HS7A 4HF2A 3W6JB 2EH3A 4HLXA 3G71I 3DU6A 4X6AJ 5JLWA 4Y17A 2DK5A 3PFIA 3NRVA 2KIUA 3A4CA 3M07A 2KLOA 2ADUA 1T2KA 4E70A 5A2QZ 2BVLA 2E7XA 1UHSA 3OIQA 4A3MJ 3LSMA 4C3HJ 4ENMA 2ZB9A 3LQRA 2ZSHB 1SD6A 4CXFA 2GXAA 1VQNI 2UXNA 4YFNF 2CQQA 2WAQA 3QOEA 3L2QA 3BZCA 1O3QA 1YW9A 1DU6A 4FISA 5GPAA 1Y8QB 3QPTA 3ZMSA 3KZIC 2D2WA 2IRFG 3DFGA 2CUFA 2QM3A 2CYYA 3GFLA 2X0LA 2QUFA 2LF8A 2JQ7A 3DEEA 2ZNZA 1T0FC 2GXBA 2L4MA 4F93B 3BR5A 4GFBA 2YUSA 2AS5F 2OZ6A 2A05A 2W24A 3EUHC 4XLEA 2JZYA 3L09A 3C2HA 1Z05A 2R7DA 3U1KA 4XRSG 3H5RA 2HEOA 1SVOA 5EGOA 4L0ZB 2RNJA 1USTA 2KDZA 1YITI 3HGGA 3ZPLA 3FHZA 3DBRB 3V4GA 5HNFA 4YIRX 1B59A 1SMYF 2X1EA 1JT0A 2B63J 2O5RA 2DA4A 4BGDA 3BTLA 1UHMA 2XAHA 3LSTA 2XRLA 4OIPF 1S7EA 1YS7A 4EM0B 1U2WA 2MGQA 4Y4RA 3C3WA 4GO1A 5E8GA 3SYTA 2F48A 2LMDA 4EMSA 2GOMA 2EZHA 3ABKH 1LVAA 1QO0D 2Z16A 3HYIA 1R6RA 1XDSA 4YELA 1TWCJ 4BJ6C 3OS2A 3KP6A 2HOEA 4EM2A 5J1YA 1DP3A 3HUGA 3J81Z 2CU7A 4IVNA 2LKXA 5FD6A 5KAFC 3ZMUA 4JP0A 3ELKA 3RPQA 3ZCOA 4DYCA 1K6YA 5KAIC 2F5CA 1K78B 4G7ZF 3CC4I 1OCTC 2HDDA 1JKRC 2Y69H 4DW6A 2JSCA 2BXZA 4KT6A 5FFZA 3E6CC 4LK0F 1T0FA 2W1OA 4F92B 4XRSA 4RAGA 4RB1A 3HOYJ 2DFEA 5E1XA 3K4BA 3EUHA 2DFFA 3QRFF 1BW6A 3WE3A 4B47A 3FMQA 1WJDA 4HEA2 2OC6A 2VJIA 2GZWA 1D1AA 4R79A 4C3JJ 3J81K 1ZLKA 2WA0A 2O8XA 1O57A 2O3FA 4HBLA 2QYOA 1BJAA 5E3LA 4BXXJ 1FP2A 2A6HF 3H3VK 1MH3A 5M3MJ 1YG2A 3L2UA 1SEUA 1PYVA 1XPXA 5HODA 1ZREA 4OWRB 4N4NB 2E1NA 3GW2A 3G73A 3OOPA 1EA3A 1YX5A 4DIQA 5JHFA 4Y7NJ 1RETA 4JK1X 3CDHA 2Z5UA 3RSNA 2K9MA 1NTCA 4MIMA 3CZ6A 3MEXA 1QPIA 5L3BA 1G3YA 1YTYA 3K10A 4RA2A 2L5QA 4BNCA 4NNJA 4UB8C 5D4SA 2PEXA 1QA6A 3OL3A 4XQFA 4CSWA 5GAHJ 4IHVA 4M72A 2BHZA 2ME0A 3K70C 1T38A 3ZQIA 4DZPA 3HSFA 1TWGJ 1U5TA 2VQHA 3VB2A 4A0YA 1H0MA 1LUJB 1FX7A 3H3UA 1LE8A 3KP5A 2NRAC 5FB2A 3IKTA 3J7ZI 3F21A 1MDMA 1HW1A 1QU3A 5FFXA 5FJ8J 1BR1A 3LL7A 3K7AJ 4XSXF 2XF5A 3WTVC 3W2AA 2JA7J 3QODA 2ZKZA 4FETA 5TGTA 4B48A 5CYVA 1XG1A 1FYLA 1ETWA 3SHFA 1S9HA 3TO9A 1TTYA 4WX9A 1N25A 1MJBA 4KMFA 1XN7A 3PO3J 2VOOA 2CMPA 1UG0A 5CQGA 1XCVA 1R5GA 2MC4A 3I54A 5D6EA 4A12A 2J5OA 2V1DA 1WZ2A 4ETSA 2HQAA 2JA2A 5F1RA 1FZPB 5FKLA 3K70D 4AC0A 2VE8A 2CV0A 2EFQA 2PG4A 1TT0A 3RJPA 2A5YB 2CG4A 3MFKA 4N9HA 4KUMA 5JLXA 1ZK8A 5IT9Z 1WRJA 2PX9A 4ZDLA 1WJ5A 1Y1WJ 3DU5A 4Y15A 4EEFG 2VLAA 4ESJA 3V42A 1AHDP 2CUZA 4BH9A 1P4XA 5EEGA 2CQKA 4XLPF 5DYMA 1ZR2A 3LAJA 2QEXI 2H09A 2OTJI 2I5UA 2QBYB 5LEJA 4M6VA 2STTA 3DV8A 3OIPA 4S0HB 1ZGWA 4EGYA 1FPQA 1YLFA 2E35A 2M2EA 3I4PA 1RZ4A 5EEAA 3JTHA 5FRMA 1ETXA 3J7AY 2OCEA 5IT9K 2QVOA 1WSUA 5HLTA 1J09A 3PL8A 3DEWA 2RC4A 2DFIA 1HQCA 2FJ1A 5J47A 2DYRH 4DZJA 4AVPA 5HOOA 1V5FA 4FHTA 1D5YA 2DI3A 2L3DA 4IHSA 2PMHA 2ZJ2A 1BN5A 1S7OA 2P7VB 1A6QA 3K1MA 2LK2A 3CTAA 4KT5C 3GZNB 3WTZA 3GLLA 4IF4A 1YFHA 5F08A 2NOGA 3QU3A 2DMTA 2YX7A 1TQPA 1ZG1A 3JRIA 3IH4A 3RPUD 1GV2A 1U0JA 2XDVA 4UV8A 4KA4A 3K69A 4G6DA 4JX6A 4X1EA 1R1TA 4CCOA 1IN7A 1H9TA 2LFBA 1ETOA 2EPFA 2VI6A 2M8EA 3E3VA 4AYBN 1IN5A 3MVPA 3QOPA 5IY5H 1GVDA 4PJJA 1J75A 4IHXA 4Q5SF 1FOXA 1T95A 1Y6IA 1IF1A 3H5AA 4M9SA 3FZVA 3W2WA 1X3ZB 3BCAA 2CFOA 1W0UA 2Z3YA 4XK4A 5EG0B 1OQYA 4L5EA 3HBLA 2PJPA 2WBMA 4IX7A 1E3HA 5DDGA 3OYHA 2X6OA 3TDZC 3M1EA 2VXDA 3TOAA 3CJRB 2V79A 1YS6A 2K85A 4LIUA 3BR1A 4MQ9F 4CH7A 3JR9A 3E6MA 4RAYA 3IH3A 4ENJA 1ZGAA 1OYWA 1J7KA 4JBAA 4A0XA 2M8GX 2DA1A 2IPQX 2DA2A 2M0CA 1SVLA 5J40A 2KZGA 5E3NA 1FMWA 3JRBA 1J0RA 1YW8A 4H4KC 4RGXA 1Z9CA 1T8IA 2PMZA 3VYSB 5M5WJ 3M9AA 2CW7A 2Y31A 1F5TA 1R1UA 4CA0A 3GFIA 3N4MA 4XKVA 4G8XA 1X4OA 4II3A 4LIVA 1Y56A 2DQRA 2P81A 5IP6A 1D1CA 4OOIA 1Y1VJ 4QLCU 4D5FA 4MGRA 1F9NA 5CJ9A 1SVMA 3E6BA 4Y33A 3DTEA 2FOKA 3QYFA 4G7HF 1U3EM 5F6FA 1YW7A 3TW7A 1B72B 4HQEA 2FRHA 5J8FA 3HPGA 3BJ6A 1QBJA 1X1AA 5L3CA 4CYCB 3AAFA 2CW0F 1DU0A 1WHUA 1ZELA 2K7LA 4FE7A 5DD8A 3MZHA 2HI3A 2K02A 2KL4A 3MKZA 1BM9A 2LNBA 4KISA 1GT0C 1RI7A 2EIMH 2OA4A 4FX4A 2F6CA 3K4NA 3SZTA 1PJRA 3H35A 1QNTA 2ZXHA 1GXPA 1IRXA 1STZA 2Y9ZA 4HW0A 1SFXA 3HSRA 4A6EA 1SMTA 1KU9A 4IHYA 3V7SA 3FKIJ 3KYCB 3HOZJ 4A5NA 3TL4X 1X4PA 1BI2A 1PUFA 1YJNI 4IQ4A 2HKOA 1FP1D 3CDLA 1W5SA 1TBXA 1GDTA 3V7CA 2DLLA 3U2RA 1YQAA 1W7PD 4NB5A 2CS3A 2OF7A 3S1RJ 4YIFA 5EDNA 3OSGA 4DGWB 2BY0A 3I59A 2HQNA 1V54H 2XHKA 4QPQA 3PQJA 2MG4A 2KHMA 4UY8I 3M8JA 2OZUA 1W36C 2BY3A 4BHPA 4YIIA 1QRYA 3CUOA 4U0VA 1LFBA 4A5MA 2JPBA 3BR3A 1D3YA 2ELJA 3VOEA 1SFKA 1FT9A 2E71A 3I58A 2IVMA 1W7PA 2Z99A 2O9LA 1BC7C 5F04A 1OYYA 1D1BA 3BG3A 3IH2A 2JMWA 2DPDA 4I2OA 1RNLA 4QSHA 3KLOA 3HRMA 2NNNA 3DEUA 3PO2J 1S7AA 4ITVA 3W6KB 2R7TA 2IS2A 1MSFC 2ZSIB 3G6EI 5ILSA 3S3NA 1HW5A 1DQUA 3L1PA 1USSA 2QA4I 2VPRA 1MW7A 1IC8A 1AU7A 4HNTA 1FMVA 5EGOB 1FSHA 2G7HA 4U0WA 1NG7A 4ZYHA 3VYTB 1W36D 5LFAA 2X6WA 3KIOA 2XF6A 1K7AA 2EQRA 2L4AA 1KQ9A 3ZQHA 4CCLA 4F52A 2MBFA 2VC0A 2DA3A 3FXQA 2DW4A 4A3DJ 5HVQC 5IOYA 2QKMB 5KCMA 3WU2C 1HKQA 2KRFA 2PQ8A 4D1QA 3JRDA 4E7LA 3BG6A 4IEJA 1VZ0A 4DYRA 4OIQF 4PDKA 4PSWA 1KQ8A 4C2MJ 4KNYA 3HHGA 3CO6C 1OLTA 2HR3A 3HJEA 4QPOA 1BC8C 1RRJA 3BPXA 1UFMA 3HUGB 3ABLH 4OAYA 3QQAA 5J1UA 4Q47A 1VI0A 3JW4A 2HXOA 5JVTA 2HYGD 1AKHA 3V8JA 3KP7A 3L9FA 2E34A 1X19A 3H0DA 1ETKA 2ECCA 1JUPA 3J80Z 3P9KA 4ZDPA 2O0YA 2HQ5A 2NS7A 1I5ZA 4V2FA 2IA2A 3GTGJ 2HU9A 5IT3A 2R7SA 1HF0A 4KITB 2X85A 2V6CA 3C2GA 3ECOA 4V2GA 1UCRA 3HHHA 4BQNA 1FY7A 4ESFA 5E20A 1W1WE 2XKPA 1GHCA 1OFCX 3OYAA 3MAJA 5DUIA 3DLLF 1R22A 2KKOA 1G2HA 2X51A 2VBYA 3HG9A 3R60A 3ZQGA 1D0XA 5HLGA 3OS1A 3A1YA 3J80K 2EA2A 3FMRA 1IUFA 2RAEA 1BBYA 4EJVA 3RI4A 3GZ5A 2X6XA 3R61A 5D6FA 5F0FA 5HS9A 3ZGKA 3MZYA 3WG9A 3S32A 3BQYA 4OIOF 2W00A 4F7ZA 3OWTA 2AXLA 3CC2I 5K5RA 1U78A 4ZZDA 5DEQA 2A07F 5IYDJ 3EETA 3IHUA 4M9XA 3E5XA 3WU0A 3ZMZA 3UR3C 2DK8A 3MZ8A 2DMQA 1WPKA 1ZGJA 2NVTJ 2OU2A 2ZO4A 5DCMA 5TISC 3RKQA 3FISA 2WY7Q 4A3CJ 2VJJA 1U5TB 4LOCA 9ANTA 1LE8B 2BV6A 2DDBA 2VJ5A 2VT3A 2O6GE 1ZLJA 4BDZA 1GXQA 1XSVA 4UNOA 2VOPA 2RGVA 1MDMB 3TOBA 2MD0A 3IAM2 1I3QJ 3S15J 3W2VA 1YYVA 1O4XA 3T5XA 4ZDOA 2XUBA 3LFUA 1JHFA 3DQVC 4C9YA 2JWTA 4IO9F 2K3FA 1B6AA 4A6DA 2H27A 4GYIA 3JTGA 5E79C 1QHHD 3G3ZA 3E1SA 2OPTA 2R7FA 2NVUB 3T1BA 4B3XA 1OKRA 3F8FA 4EVIA 2J5PA 1Z91A 2E60A 2Y0SN 4AD9A 2DTZA 4A3BJ 1OYIA 2FBIA 1EJ9A 4FCYA 4F3QA 1QHGA 1ZRFA 2VT2A 1V5GA 5GP9A 2BZTA 2GAUA 2OQGA 2RQPA 3S17J 4DYQA 2PMUA 3BG9A 3BJAA 2HQRA 3CMMA 4E7IA 2R7ZJ 2X1DA 3NEUA 1RUOA 3PUFA 3CCUI 1LQ1A 3F22A 2ZJPF 1T08B 2VQCA 2LVSA 4HX7A 1LKXA 4KIBA 2GXGA 3I71A 3A02A 4MFDA 4RAFA 4HZFA 3S93A 1D8JA 4RMNA 2VBXA 3J7YJ 1IUYA 2KP6A 2A5WA 2CO5A 2W84A 1YRNA 5DS9A 3NWSA 3K2ZA 4KMUX 2IBDA 4DOZA 4IL6C 3KYDB 4I02A 4KIGA 1TL8A 3N05A 2KPMA 2L54A 5DV5A 1H88C 4A3FJ 2DFHA 5E8IA 5C3EJ 4LD5A 2DQLA 4WXHA 4MQVA 4J00A 2DMNA 4AYBA 2XAFA 5E1WA 3VYUB 3OY9A 4MTEA 1U9OA 4IHTA 2R7UA 5B1BH 2BW3A 5GTHC 3C7JA 2H6BA 4C30A 2DOFA 1JKPC 1J5YA 2HVQA 3CCSI 2GOXB 2VODA 2L7MP 2E7WA 3S1QJ 5AONA 1FBQA 1J2XA 1MH4A 3CQZJ 4G6QA 3T8RA 1Z21A 5A2QK 3MWMA 2KQRA 3H3ZA 4B4CA 2ESNA 3GYHX 1LJ9A 1WJBA 2F5FA 2BE5F 4RB3C 1OCPA 1QZZA 1R4MB 3GVAA 1L0OC 2MLGA 1VQ5I 2A6EF 1E0EA 4BE0A 4HSRA 4B44A 1WGXA 3G1LA 3NWTA 1WFXA 3LSIA 1MJ9A 2V1UA 3K4LA 4L9TA 1UG2A 4HX4A 4XN3A 1ZKGA 2IW5A 2IS1A 1FJLA 5M5YJ 4E7KA 3GFMA 4ZJZA 3FXKA 2VBZA 3AG4H 3IRRA 4W97A 4A93J 4XR6A 2Q8KA 5L3EA 5EF6A 4MEXF 1JXSA 4BQOA 2P4WA 4ZZLA 2DOAA 2YR2A 3ZXSA 4CICA 1L3LA 3CMYA 1RIOH 2P5LC 1NG6A 5E3MA 3LSPA 1Z1DA 4U88A 3GXOA 4G12A 1U5TC 1FOKA 5F27A 1TNSA 4J01A 2IS4A 5LLQA 3ASOH 1ETYA 1OMIA 2FQ4A 2L02A 2HTSA 5B66C 5ERIA 2ACJA 4I99C 1PDNC 4LLGF 2M4KA 2XAJA 2RQQA 3I4MJ 1Z6TA 2PJRA 1IZ1A 1UB9A 4CZZA 3LSKA 3TO7A 3QWLA 3JRAA 3MCZA 2QF7A 1HKSA 3P7NA 1OJLA 3K6GA 4XKCA 1ZG3A 2AQEA 3QP6A 1U9NA 1KYZA 5FLXZ 1E3PA 1HSJA 4JX5A 5H6RA 1FTTA 3OIOA 3Q0UA 4XLAA 5FO5A 4EGZA 3QPSA 1Q1HA 3MKWB 3D5LA 4A3GJ 2JT1A 5DM7F 1I1GA 2IS6A 4ZYEA 2EB7A 3E7LA 3GTQJ 4BHCA 3UKGA 5JR3A 2P8TA 3HRSA 3Q5FA 3FXOA 1Z7LA 4PFOA 3RKXA 3RDIA 3HSEA 4V19K 2R4GA 2V6EA 4CYDA 1MBEA 2XPUA 1JTYA 3OYNA 3LSGA 1YJWI 1KU7A 3TQNA 1D0YA 2EFPA 5FLXK 2HGCA 3HPHA 3DPLC 2CV1A 4RBOA 1N75A 2ELHA 3OYCA 3MQ0A 3D1NI 3IP4B 1R9TJ 1WJCA 4YG2F 1NHAA 2EV5A 2H1KA 2E1OA 3BPVA 1P7IA 2ID6A 4UUTA 2UZKA 3O2PE 4EATA 1PUFB 2X4HA 1BJZA 3M7GA 2Z33A 1LB2A 3KZYA 1ENHA 1WKMA 2K5CA 2F2EA 3FHNA 3PNYA 3Q0WA 5CVVA 4BQQA 2ELKA 1YI2I 3CCMI 3NQOA 1Z6RA 3BTIA 3FXLA 1XMXA 1LNWA 3H9GA 2CFXA 1ACIA 1HCRA 3RKYA 4D7MA 3OYMA 1WI9A 1MIJA 3E0JB 3OR2C 3I59B 4PSXA 2XB5A 1T6SA 1QQIA 2K3PA 2ZJRF 2MFZA 2W57A 2FQ3A 4FQGA 4M6XA 3A0HC 4PJMA 1FBUA 4YFKF 2XF7A 2M5WA 4BYYA 2DU9A 5E18F 2LOOA 3VFZA 3EUKL 1M1EB 2EBIA 2OUMA 3V8KA 1ORKA 5HDNA 4D7NA 3CCYA 4L9NA 2ISZA 5DD4A 2KISA 3TBIA 3O8HA 1W7PB 3CF2A 3KETA 4P5OA 1QZEA 3F23A 1P4WA 1AA7A 2DODA 1ZRDA 3S1MJ 5D5WB 1HW2A 2V9PA 3GLXA 2L0KA 3LSJA 1A36A 5FKMA 2F5EA 1PP8F 4U0YA 5K7FA 3PUBA 2FX0A 2ESHA 3H92A 3Q9SA 4IOAF 5D5XB 1Z67A 3L2VA 1PUEE 1OCCH 1TT5B 2XAGA 1SFEA 1X3UA 3K4MA 1PP7U 3TO6A 4L9JA 1FNNA 1ETQA 2VUMJ 3ERMA 2JA8J 4ESBA 4BJ5C 1DPRA 2IJLA 2VQLA 1R71A 5K5QA 3A01A 2EFNA 2Y30A 1K83J 5FLVA 2PFBA 2WWYA 2LP0A 1VQ8I 4BY7J 5F0HA 1SD7A 3I0TA 4G6TB 3GTPJ 2GA2A 1POGA 3F6VA 2L9VA 4Y3OA 3GTKJ 1GUUA 1BOAA 4CCJA 5LHGA 4RM3A 1V4RA 2M30A 2NXNB 3Q9VA 2K9NA 5AIQA 3KFWX 2BVMA 1XCBA 5CKTA 2ZBKA 2W85A 4P55A 2LD5A 2TCTA 3KPHA 1TQMA 2G0EA 4IOCF 1G6NA 2KIMA 1D0ZA 2M1BA 3PQKA 2JPCA 3FBIB 2MH2A 1B9MA 2LDUA 4EJWA 1OISA 1LPQA 3IKVA 4XONA 1VQMI 2AQFA 2LTPA 1JHHA 4ABZA 3JSPA 2HYJA 4XORA 1AKHB 2HZTA 5HNHA 3AG3H 1JUSA 3HOUJ 4L0YB 3DKXA 2LREA 3I55I 2IGNA 4IQJA 2BEOA 1HDPA 2M3AA 1DGRM 4A3IJ 1P6RA 4DQ2A 3BR0A 2C6YA 3ZQ7A 4KFCA 1LDKB 3FX3A 3K4KA 1XDUA 4P96A 1IN6A 2A61A 2IEKA 2DJNA 2QENA 3ONQA 4LFUA 2MA3A 1VQ7I 3S2HJ 5K5OA 2O8KA 4I7HA 4BQAA 1BR4A 2QQ8A 1P4AA 1X2NA 1UAAA 2HTJA 2H8RA 3MKYB 4IJAA 2CW8A 2BY1A 2DA5A 2JRTA 3ZN1A 4YRVA 1FC3A 2DBBA 1K4TA 4ASNA 1G8XA 2RN7A 3BWGA 2R7RA 3LOCA 4M9ZA 2R0QC 4PCQA 2YPRA 1TWFJ 1ZAOA 1TWAJ 2VKEA 4ZTFA 3IAS2 2IT0A 2EV6A 1H9GA 2LBFA 2D45A 2K27A 5C4JJ 4XMYA 1MMAA 2YU9J 4MFEA 3ABMH 3HC7A 5CVRA 4BBSJ 3OS0A 2D1VA 2P6TA 3MMYB 4HF1A 4L5JA 2UV1A 3BZ6A 2OCCH 3E5QA 4GCVA 5DCMB 4HX8A 3JRHA 2CUJA 2GQQA 2DPUA 4XLCA 3F8MA 5CQEA 5H2FC 1RKTA 2Y0SA 2I8DA 3VODA 5LGUA 2HVSA 2E1CA 3LSHA 3LNQA 2V1NA 2ICWG 2EZLA 2B0LA 3TW6A 1Y39A 2IP2A 2FU4A 2VB6A 1ON2A 1R5HA 2NYXA 1O3RA 2H1LA 1MBJA 2RNGA 5ICFA 1S8NA 2NS0A 3TDUC 5B1AH 4CUGA 3KEQA 2JA6J 3FDYA 4O5VA 2HXIA 4CDGA 2KRHA 5DUKA 2K9SA 3JREA 1MGTA 1JT6A 4CCMA 5E17F 2CUEA 3TGNA 4JX4A 2JA5J 1RPWA 4HAMA 2XVCA 5IYCJ 4ENKA 3LMMA 3OYDA 3OR1C 3FM3A 4TV7A 1ON1A 2DA6A 2OBPA 4G94A 4ENNA 4MHGA 2R5YA 1XS9A 3WODF 2VE9A 5ED4A 3U1DA 1OCRH 2R7XA 4HV5A 2QSHX 1W5TA 2X6YA 1ZYRF 2Q2EA 4XKBA 1C0WA 4A0ZA 3O8GA 2KRCA 1NH3A 3PNVA 4I0BA 4RDUA 3BROA 3V7RA 2LRDA 3L2CA 1A31A 4A3KJ 1K61A 1BW5A 3PNTA 5JHUA 2XGCA 1B1BA 4MEYF 1J9IA 4BKXA 2VXZA 1QZYA 1YRNB 5J4VA 2GIVA 2QCOA 1AWCA 5C44J 1JGGA 1I27A 4XLHA 4BEHA 2LR8A 5EEHA 1R23A 3BG7A 2ID3A 1IW7F 3K1NA 3WU1B 1REPC 2YSRA 3JSOA 2XAQA 4RB0A 3OYLA 3MN2A 2BW3B 1VQLI 1B4AA 5J4YA 3HOWJ 2L7ZA 1O7FA 3F8BA 2WB1N 1FLIA 3P5JA 5FD5A 2FE3A 4KJZA 1VTNC 4YFXF 5LRRA 2CJJA 1TW2A 3S2DJ 2ETHA 2JUGA 1F36A 5TJJA 2WADA 4ON0A 2VASA 3GEZA 3GO5A 1Z0XA 1HXDA 3M3YJ 2PI0A 3RZOJ 4XNFA 2WAEA 3H5NA 5JI6A 3D0SA 4AM3A 3H9QA 1ZRCA 1OPCA 4N4OB 1DUXC 2COMA 1U8RA 2AXTC 2LKPA 5K7ZA 3I53A 2BOLA 2V26A 4JQFA 4DJAA 2O03A 3CC7I 2Y0MA 2W7NA 3I3LA 4C2TA 5FKKA 4U7BA 3HXLA 3E5UA 3AG1H 3U21A 1HA8A 1R00A 3K0LA 4PJLA 2Y9YA 4I01A 4ZYGA 1O3SA 1X58A 3TKYA 5CVIA 4UUVA 1LVKA 2P5KA 5ILVA 4BE2A 3REOA 4ZC3A 4UVCA 1P92A 1G3TA 3HZJA 3WGGA 4RLQA 3GX4X 4PZJA 2B9SA 2ZFWA 3G2BA 3HL2A 4LG0A 4M3GA 1JKQC 2FBKA 4Z2YA 2EIKH 4NQWA 4F55A 2LLKA 3GCMA 2GWRA 3P9CA 1RUNA 2I10A 2R7QA 2MW8A 2BY2A 4DBQA 2PJRB 2ZMEC 3B6AA 3ZQCA 4E7HA 3BQZA 3BLYA 4OIRF 4QWQA 1DPUA 2IGOA 3L2RA 3PIOF 3ZQLA 4K2EA 2FNPA 3W3CA 2YU3A 2DN0A 2IGKA 2JK3A 2XIGA 4G7OF 1T39A 2DT7B 3DXJF 1MZBA 1N78A 3IUOA 1B9NA 3ASNH 2GM4A 2HDWA 5M3FJ 2WTEA 1R7JA 1KYWA 3GBGA 3BOQA 1R5ID 3ZRGA 5DTDA 3SXYA 2JVHA 2FSWA 2ZFUA 5BPDA 1A6IA 3HTSB 1NK2P 5DCFA 2NS8A 3PSFA 1IG7A 2P5VA 1LEAA 1Z77A 2MSYA 3ZMTA 3KP2A 1XGSA 3R0AA 3S2WA 1YJ9I 4L18B 3BTCA 4HPQA 2HYFA 2VQGA 4OINF 4LGWA 3R6SA 2IA0A 2WV1A
chains in the Genus database with same CATH topology
4S0HB 2R92J 1H89C 1ZGWA 2M2EA 3CMYA 1A5JA 5EZGA 5E3MA 3LSPA 5EEAA 2L7FP 3Q3SA 4UUSA 1BA5A 1ETXA 4G12A 5F27A 1VFCA 3K2AA 2R5ZA 3RQIA 3DEWA 1ETYA 2FQ4A 3W6VA 1B8IB 3Q0VA 2FJ1A 4A3LJ 4XICA 3I4MJ 4DZJA 1D5YA 3BR6A 4I76A 3JRAA 2QF7A 1OJLA 2LK2A 1U9NA 1NK3P 4JX5A 3B6CA 3JRCA 5F08A 2NOGA 3OIOA 1FTTA 3Q0UA 2DMTA 3QPSA 3JRIA 3IH4A 4A3GJ 1GV2A 1JUMA 4JX6A 4X1EA 3HM5A 2AHQA 1MBGA 5FLMJ 3E7LA 3F0CA 3GTQJ 4A69C 3IV5A 2LFBA 1QVTA 1E3OC 3UKGA 1ETOA 2VI6A 4AYBN 3MVPA 4IHXA 4AUXA 1GVDA 4A3JJ 3HEFA 4FE4A 2HOTA 3VPRA 2K40A 1MBEA 1W0UA 2XPUA 1JTYA 1XC5A 1ZTRA 4XK4A 3LSGA 5EG0B 4L5EA 3HBLA 2XB0X 3A01B 2X6OA 3WHBA 2GLOA 3OOUA 4RBOA 2NVXJ 2R7ZJ 3JR9A 3D1NI 3BR1A 1R9TJ 3IH3A 2H1KA 2E1OA 1P7IA 2ID6A 1WCMJ 3FIWA 4UUTA 3HB9A 2M8GX 2DA1A 2DA2A 2M0CA 1PUFB 4A3EJ 1BJZA 5E3NA 1I6HJ 1ENHA 3JRBA 3Q0WA 4M3DA 3G1MA 2XPWA 2ELKA 2N8GA 3GTMJ 5M5WJ 5K7HA 1CQTA 1ETVA 3BTIA 2Y31A 1B8IA 2ME6A 1HCRA 1JJ8C 4D7MA 5IP6A 2P81A 4HNVA 3JRFA 1Q1VA 4C3IJ 1Y1VJ 2XB5A 4D5FA 3SFIA 1APLC 2K9QA 1F43A 2EBIA 1ORKA 5IP7J 4D7NA 3CCYA 1JKOC 5GPCA 3O8HA 3TW7A 1B72B 3HGYA 1MNMC 3S1MJ 3SDGA 1IGNA 2L0KA 2COBA 3LSJA 2D5VA 4CYCB 3ZOBA 5FKMA 1DU0A 2CRGA 3G1OA 4FE7A 5K7FA 2FX0A 5F1JA 2HI3A 1ZR4A 2R93J 2X9DA 3H0GJ 5EG0A 1ETQA 2VUMJ 1GT0C 1FIAA 5J1RA 2JA8J 3A01A 2Y30A 5FLVA 1IDYA 1K83J 1RR7A 3ZQFA 3S14J 2Y9ZA 1U8BA 2LP0A 4BY7J 5F0HA 1VNDA 4IHYA 3GTPJ 2L9RA 1POGA 3FKIJ 3OSFA 3HOZJ 3S1NJ 2E2HJ 3GTKJ 1GUUA 3LSRA 3WHCA 1JTXA 1PUFA 2K9NA 4IHWA 2HOSA 5BNGA 3CDLA 5FKNA 3NARA 4M3EA 1GDTA 1BL0A 2OF7A 2TCTA 2LD5A 2FD5A 5EDNA 3OSGA 3S1RJ 2G0EA 3A03A 1TWHJ 1SFOJ 2MG4A 2LY9A 5EZHA 1MSEC 1QRYA 2E19A 1LFBA 3BR3A 2LTPA 3BT9A 5J3LA 4ABZA 5IOZA 2HYJA 1AKHB 2O7OA 1FEXA 1HOMA 1JUSA 2HOAA 1B72A 3HOUJ 2DA7A 2O9LA 5F04A 2XGEA 3FK7A 3IH2A 3BG3A 1HDPA 2JMWA 4CYCA 2PMZN 4QSHA 1X2MA 3GTJJ 4A3IJ 3BR0A 4FTHA 3PO2J 1WI3A 3BG5A 3RZDJ 1LFUP 3MKLA 3FK6A 1MSFC 2IEKA 2DJNA 1FIPA 5EYRA 2E2JJ 2XPVA 3L1PA 3I4NJ 2JJ7A 2VPRA 1IC8A 3S2HJ 2O8KA 2DMPA 3C2BA 3PM1A 1AU7A 5IPAA 4XRMA 5EGOB 2JN6A 4M3BA 1W0TA 1X2NA 1IRZA 2H8RA 1T33A 3BTJA 2DA5A 3NAUA 5M5XJ 2EQRA 3GTLJ 3ZQHA 2DA3A 4A3DJ 1MBHA 3LOCA 2R0QC 5IOYA 1TWFJ 1TWAJ 2VKEA 2X48A 2R5YB 1MBKA 3JRDA 4I6ZA 4IEJA 5C4JJ 2ECBA 1H8AC 1TC3C 4BBRJ 4DYRA 2YU9J 4X6AJ 2EH3A 1FTZA 4MFEA 4C2MJ 5JLWA 3M4OJ 4QIWN 1SANA 3HOVJ 4BBSJ 2AO9A 3TP3A 4J19A 1UHSA 3QQAA 2DMUA 5J1UA 4A3MJ 1HDDC 4C3HJ 1VI0A 3JRHA 5F0CA 2KT0A 3DCFA 2HXOA 2ZB9A 2VKVA 1AKHA 1RKTA 4Y52J 2CQQA 3HKZN 1ETKA 2ECCA 1JUPA 4W1UA 1DU6A 4FISA 3LNQA 5GPAA 2EZLA 3TW6A 2HQ5A 2NS7A 2CUFA 1RKWA 4V2FA 1GV5A 1WH7A 1MBJA 3GTGJ 1P7JA 3BR5A 4GFBA 2YUSA 1HF0A 5IP9J 4V2GA 2JA6J 2HXIA 2K9SA 3JREA 4XRSG 1JT6A 4D5CA 5EGOA 2KDZA 3HGGA 1OFCX 2CUEA 1JT0A 4JX4A 2B63J 1G2HA 2JA5J 3ZQGA 1RPWA 2DA4A 3BTLA 5IYCJ 2XRLA 1IUFA 1S7EA 2RAEA 3HOXJ 2MGQA 5F0FA 2DA6A 2R5YA 2EZHA 3BQYA 1XS9A 3GTOJ 2W48A 4JYKA 5FKOA 1U78A 1TWCJ 5IYDJ 3O8GA 2IAIA 5C4XJ 4RDUA 5J1YA 2CU7A 4A3KJ 2DMQA 1K61A 1WPKA 1BW5A 5IYBJ 2LKXA 2NVTJ 2XGCA 2XSDC 4JP0A 3RKQA 3FISA 4BKXA 4DYCA 1YRNB 4A3CJ 1MBFA 2QCOA 5C44J 1JGGA 4LOCA 1OCTC 2HDDA 1JKRC 9ANTA 4DW6A 1LE8B 2LR8A 1WH5A 2ID3A 3JRGA 2TRTA 3S15J 1I3QJ 1O4XA 4XRSA 3HOYJ 3MN2A 2JWTA 3TP0A 4BY1J 4B3AA 1BW6A 2L7ZA 1IV6A 3HOWJ 1IDZA 2WB1N 4B1RA 3HDDA 3SJMA 2CQXA 2CJJA 4C3JJ 3S2DJ 2EZKA 1F36A 5E3OA 3S16J 2XGDA 2OPTA 1HLVA 5E3LA 4BXXJ 1Z0XA 2M9HA 3H3VK 1MH3A 3M3YJ 3RZOJ 5M3MJ 2Y0SN 2GBYA 2DTZA 2WAQN 5HODA 4A3BJ 4FCYA 5GP9A 5K7ZA 4Y7NJ 1RETA 1NTCA 4MIMA 3S17J 1IJWC 4DYQA 1QPIA 3BG9A 5FKKA 2LVSA 4QTRA 3A02A 4MFDA 3TEDA 2Y2ZA 2Y9YA 4IHVA 1X58A 2ME0A 1VF9A 3ZQIA 4DZPA 5DS9A 1YRNA 4MLOA 1TWGJ 1RESA 2IBDA 3QPLA 1UMQA 2E2IJ 1LE8A 1T56A 1H88C 4A3FJ 4UUSB 5C3EJ 2YS9A 5FJ8J 3K7AJ 2DMNA 4M3GA 4MO7A 1JKQC 2R5ZB 2JA7J 1U9OA 2LLKA 2I10A 1XG1A 1ETWA 1JKPC 2MW8A 2L7MP 3B6AA 3PO3J 3ZQCA 3S1QJ 3BQZA 1MH4A 3CQZJ 1ZQ3P 1QVUA 1I50J 3ZQLA 4B4CA 2DN0A 2JK3A 2M34A 5FKLA 1OCPA 4AC0A 2GM4A 5M3FJ 1WGXA 3G1LA 4M3FA 5JLXA 1EF4A 1ZK8A 3GBGA 5DTDA 1UG2A 2NVQJ 1ZKGA 2NVYJ 1ITYA 4NDLA 1A6IA 1Y1WJ 1NK2P 2NS8A 4EEFG 1IG7A 1JJ6C 1Z77A 1FJLA 1AHDP 2MSYA 3BR2A 5M5YJ 1ZR2A 3BTCA 4XIDA 2EZIA 4W97A 4A93J 4M6VA 2WV1A 5EF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S0H B;  2R92 J;  1H89 C;  1ZGW A;  2M2E A;  3CMY A;  1A5J A;  5EZG A;  5E3M A;  3LSP A;  5EEA A;  2L7F P;  3Q3S A;  4UUS A;  1BA5 A;  1ETX A;  4G12 A;  5F27 A;  1VFC A;  3K2A A;  2R5Z A;  3RQI A;  3DEW A;  1ETY A;  2FQ4 A;  3W6V A;  1B8I B;  3Q0V A;  2FJ1 A;  4A3L J;  4XIC A;  3I4M J;  4DZJ A;  1D5Y A;  3BR6 A;  4I76 A;  3JRA A;  2QF7 A;  1OJL A;  2LK2 A;  1U9N A;  1NK3 P;  4JX5 A;  3B6C A;  3JRC A;  5F08 A;  2NOG A;  3OIO A;  1FTT A;  3Q0U A;  2DMT A;  3QPS A;  3JRI A;  3IH4 A;  4A3G J;  1GV2 A;  1JUM A;  4JX6 A;  4X1E A;  3HM5 A;  2AHQ A;  1MBG A;  5FLM J;  3E7L A;  3F0C A;  3GTQ J;  4A69 C;  3IV5 A;  2LFB A;  1QVT A;  1E3O C;  3UKG A;  1ETO A;  2VI6 A;  4AYB N;  3MVP A;  4IHX A;  4AUX A;  1GVD A;  4A3J J;  3HEF A;  4FE4 A;  2HOT A;  3VPR A;  2K40 A;  1MBE A;  1W0U A;  2XPU A;  1JTY A;  1XC5 A;  1ZTR A;  4XK4 A;  3LSG A;  5EG0 B;  4L5E A;  3HBL A;  2XB0 X;  3A01 B;  2X6O A;  3WHB A;  2GLO A;  3OOU A;  4RBO A;  2NVX J;  2R7Z J;  3JR9 A;  3D1N I;  3BR1 A;  1R9T J;  3IH3 A;  2H1K A;  2E1O A;  1P7I A;  2ID6 A;  1WCM J;  3FIW A;  4UUT A;  3HB9 A;  2M8G X;  2DA1 A;  2DA2 A;  2M0C A;  1PUF B;  4A3E J;  1BJZ A;  5E3N A;  1I6H J;  1ENH A;  3JRB A;  3Q0W A;  4M3D A;  3G1M A;  2XPW A;  2ELK A;  2N8G A;  3GTM J;  5M5W J;  5K7H A;  1CQT A;  1ETV A;  3BTI A;  2Y31 A;  1B8I A;  2ME6 A;  1HCR A;  1JJ8 C;  4D7M A;  5IP6 A;  2P81 A;  4HNV A;  3JRF A;  1Q1V A;  4C3I J;  1Y1V J;  2XB5 A;  4D5F A;  3SFI A;  1APL C;  2K9Q A;  1F43 A;  2EBI A;  1ORK A;  5IP7 J;  4D7N A;  3CCY A;  1JKO C;  5GPC A;  3O8H A;  3TW7 A;  1B72 B;  3HGY A;  1MNM C;  3S1M J;  3SDG A;  1IGN A;  2L0K A;  2COB A;  3LSJ A;  2D5V A;  4CYC B;  3ZOB A;  5FKM A;  1DU0 A;  2CRG A;  3G1O A;  4FE7 A;  5K7F A;  2FX0 A;  5F1J A;  2HI3 A;  1ZR4 A;  2R93 J;  2X9D A;  3H0G J;  5EG0 A;  1ETQ A;  2VUM J;  1GT0 C;  1FIA A;  5J1R A;  2JA8 J;  3A01 A;  2Y30 A;  5FLV A;  1IDY A;  1K83 J;  1RR7 A;  3ZQF A;  3S14 J;  2Y9Z A;  1U8B A;  2LP0 A;  4BY7 J;  5F0H A;  1VND A;  4IHY A;  3GTP J;  2L9R A;  1POG A;  3FKI J;  3OSF A;  3HOZ J;  3S1N J;  2E2H J;  3GTK J;  1GUU A;  3LSR A;  3WHC A;  1JTX A;  1PUF A;  2K9N A;  4IHW A;  2HOS A;  5BNG A;  3CDL A;  5FKN A;  3NAR A;  4M3E A;  1GDT A;  1BL0 A;  2OF7 A;  2TCT A;  2LD5 A;  2FD5 A;  5EDN A;  3OSG A;  3S1R J;  2G0E A;  3A03 A;  1TWH J;  1SFO J;  2MG4 A;  2LY9 A;  5EZH A;  1MSE C;  1QRY A;  2E19 A;  1LFB A;  3BR3 A;  2LTP A;  3BT9 A;  5J3L A;  4ABZ A;  5IOZ A;  2HYJ A;  1AKH B;  2O7O A;  1FEX A;  1HOM A;  1JUS A;  2HOA A;  1B72 A;  3HOU J;  2DA7 A;  2O9L A;  5F04 A;  2XGE A;  3FK7 A;  3IH2 A;  3BG3 A;  1HDP A;  2JMW A;  4CYC A;  2PMZ N;  4QSH A;  1X2M A;  3GTJ J;  4A3I J;  3BR0 A;  4FTH A;  3PO2 J;  1WI3 A;  3BG5 A;  3RZD J;  1LFU P;  3MKL A;  3FK6 A;  1MSF C;  2IEK A;  2DJN A;  1FIP A;  5EYR A;  2E2J J;  2XPV A;  3L1P A;  3I4N J;  2JJ7 A;  2VPR A;  1IC8 A;  3S2H J;  2O8K A;  2DMP A;  3C2B A;  3PM1 A;  1AU7 A;  5IPA A;  4XRM A;  5EGO B;  2JN6 A;  4M3B A;  1W0T A;  1X2N A;  1IRZ A;  2H8R A;  1T33 A;  3BTJ A;  2DA5 A;  3NAU A;  5M5X J;  2EQR A;  3GTL J;  3ZQH A;  2DA3 A;  4A3D J;  1MBH A;  3LOC A;  2R0Q C;  5IOY A;  1TWF J;  1TWA J;  2VKE A;  2X48 A;  2R5Y B;  1MBK A;  3JRD A;  4I6Z A;  4IEJ A;  5C4J J;  2ECB A;  1H8A C;  1TC3 C;  4BBR J;  4DYR A;  2YU9 J;  4X6A J;  2EH3 A;  1FTZ A;  4MFE A;  4C2M J;  5JLW A;  3M4O J;  4QIW N;  1SAN A;  3HOV J;  4BBS J;  2AO9 A;  3TP3 A;  4J19 A;  1UHS A;  3QQA A;  2DMU A;  5J1U A;  4A3M J;  1HDD C;  4C3H J;  1VI0 A;  3JRH A;  5F0C A;  2KT0 A;  3DCF A;  2HXO A;  2ZB9 A;  2VKV A;  1AKH A;  1RKT A;  4Y52 J;  2CQQ A;  3HKZ N;  1ETK A;  2ECC A;  1JUP A;  4W1U A;  1DU6 A;  4FIS A;  3LNQ A;  5GPA A;  2EZL A;  3TW6 A;  2HQ5 A;  2NS7 A;  2CUF A;  1RKW A;  4V2F A;  1GV5 A;  1WH7 A;  1MBJ A;  3GTG J;  1P7J A;  3BR5 A;  4GFB A;  2YUS A;  1HF0 A;  5IP9 J;  4V2G A;  2JA6 J;  2HXI A;  2K9S A;  3JRE A;  4XRS G;  1JT6 A;  4D5C A;  5EGO A;  2KDZ A;  3HGG A;  1OFC X;  2CUE A;  1JT0 A;  4JX4 A;  2B63 J;  1G2H A;  2JA5 J;  3ZQG A;  1RPW A;  2DA4 A;  3BTL A;  5IYC J;  2XRL A;  1IUF A;  1S7E A;  2RAE A;  3HOX J;  2MGQ A;  5F0F A;  2DA6 A;  2R5Y A;  2EZH A;  3BQY A;  1XS9 A;  3GTO J;  2W48 A;  4JYK A;  5FKO A;  1U78 A;  1TWC J;  5IYD J;  3O8G A;  2IAI A;  5C4X J;  4RDU A;  5J1Y A;  2CU7 A;  4A3K J;  2DMQ A;  1K61 A;  1WPK A;  1BW5 A;  5IYB J;  2LKX A;  2NVT J;  2XGC A;  2XSD C;  4JP0 A;  3RKQ A;  3FIS A;  4BKX A;  4DYC A;  1YRN B;  4A3C J;  1MBF A;  2QCO A;  5C44 J;  1JGG A;  4LOC A;  1OCT C;  2HDD A;  1JKR C;  9ANT A;  4DW6 A;  1LE8 B;  2LR8 A;  1WH5 A;  2ID3 A;  3JRG A;  2TRT A;  3S15 J;  1I3Q J;  1O4X A;  4XRS A;  3HOY J;  3MN2 A;  2JWT A;  3TP0 A;  4BY1 J;  4B3A A;  1BW6 A;  2L7Z A;  1IV6 A;  3HOW J;  1IDZ A;  2WB1 N;  4B1R A;  3HDD A;  3SJM A;  2CQX A;  2CJJ A;  4C3J J;  3S2D J;  2EZK A;  1F36 A;  5E3O A;  3S16 J;  2XGD A;  2OPT A;  1HLV A;  5E3L A;  4BXX J;  1Z0X A;  2M9H A;  3H3V K;  1MH3 A;  3M3Y J;  3RZO J;  5M3M J;  2Y0S N;  2GBY A;  2DTZ A;  2WAQ N;  5HOD A;  4A3B J;  4FCY A;  5GP9 A;  5K7Z A;  4Y7N J;  1RET A;  1NTC A;  4MIM A;  3S17 J;  1IJW C;  4DYQ A;  1QPI A;  3BG9 A;  5FKK A;  2LVS A;  4QTR A;  3A02 A;  4MFD A;  3TED A;  2Y2Z A;  2Y9Y A;  4IHV A;  1X58 A;  2ME0 A;  1VF9 A;  3ZQI A;  4DZP A;  5DS9 A;  1YRN A;  4MLO A;  1TWG J;  1RES A;  2IBD A;  3QPL A;  1UMQ A;  2E2I J;  1LE8 A;  1T56 A;  1H88 C;  4A3F J;  4UUS B;  5C3E J;  2YS9 A;  5FJ8 J;  3K7A J;  2DMN A;  4M3G A;  4MO7 A;  1JKQ C;  2R5Z B;  2JA7 J;  1U9O A;  2LLK A;  2I10 A;  1XG1 A;  1ETW A;  1JKP C;  2MW8 A;  2L7M P;  3B6A A;  3PO3 J;  3ZQC A;  3S1Q J;  3BQZ A;  1MH4 A;  3CQZ J;  1ZQ3 P;  1QVU A;  1I50 J;  3ZQL A;  4B4C A;  2DN0 A;  2JK3 A;  2M34 A;  5FKL A;  1OCP A;  4AC0 A;  2GM4 A;  5M3F J;  1WGX A;  3G1L A;  4M3F A;  5JLX A;  1EF4 A;  1ZK8 A;  3GBG A;  5DTD A;  1UG2 A;  2NVQ J;  1ZKG A;  2NVY J;  1ITY A;  4NDL A;  1A6I A;  1Y1W J;  1NK2 P;  2NS8 A;  4EEF G;  1IG7 A;  1JJ6 C;  1Z77 A;  1FJL A;  1AHD P;  2MSY A;  3BR2 A;  5M5Y J;  1ZR2 A;  3BTC A;  4XID A;  2EZI A;  4W97 A;  4A93 J;  4M6V A;  2WV1 A;  5EF6 A; 
#chains in the Genus database with same CATH topology
 2DTR A;  3VDX A;  3KE2 A;  3IC7 A;  3GME A;  2XRO A;  5LGT A;  3BP8 A;  3V8L A;  3WGI A;  5L3D A;  2L7F P;  3Q3S A;  4UUS A;  4HDU A;  3BDD A;  1Z7U A;  3FBN B;  1VFC A;  3K2A A;  2R5Z A;  3DPU A;  3RQI A;  4II2 A;  1YOV B;  4CCN A;  3N97 A;  2VPL A;  3CO7 C;  3Q0V A;  2XAU A;  2HKX A;  3ZMD A;  2ZME A;  3PIP F;  4BXF A;  4XIC A;  2HS5 A;  4ZYA A;  3ERE D;  3H1C A;  1R49 A;  2BBY A;  4HLY A;  3AL0 C;  3OV8 A;  3EYI A;  3CP2 A;  4D9J A;  3B6C A;  1QPM A;  2EK5 A;  3JRC A;  4XLF A;  4IRI A;  1BI0 A;  2FBH A;  4PK4 A;  2DXI A;  2BYV E;  3S3M A;  2W82 A;  2ZXI A;  1YO5 C;  3F0C A;  3OYI A;  1U6G A;  2DOE A;  3IV5 A;  1QVT A;  1E3O C;  1HKT A;  3LFK A;  2QSG X;  4WK8 F;  2QLZ A;  1V3F A;  2A68 F;  3HEF A;  1X1P A;  2OV7 A;  4RS8 A;  3WGH A;  4FE4 A;  2HOT A;  1S3J A;  3P9I A;  3JAM Z;  1XC5 A;  1F1Z A;  4XLN F;  4WCG A;  2CWE A;  2HNH A;  3A01 B;  3WHB A;  3KYL A;  3PSI A;  4NUB A;  3OOU A;  3ECH A;  2NVX J;  2IXS A;  2KJC A;  2DDA A;  1BI3 A;  1BOB A;  3DF8 A;  1VQO I;  1WCM J;  4PGG A;  3KCC A;  4NC7 A;  4A3E J;  2KIF A;  1I6H J;  5TRD A;  3EUA A;  1VQ4 I;  3G1M A;  2XPW A;  4OMY A;  4WWC A;  5K7H A;  2DT6 A;  1B8I A;  3JAM K;  3LA3 A;  4N0B A;  5HLI A;  3CMA I;  3TMO A;  2TDX A;  3K4C A;  4AIK A;  4HNV A;  2FUG 2;  2ZXW H;  1X1D A;  2PBI A;  5LD2 C;  1IRG A;  4A2U A;  3R4K A;  2K4J A;  4ANJ A;  4P9F A;  1F43 A;  2DYS H;  5AIP A;  4IPA A;  4CHU A;  1HBX G;  4UB6 C;  3ABU A;  3GUD A;  5JVG F;  1EV7 A;  1JKO C;  2FA5 A;  1GVJ A;  2Z9O A;  1DGW Y;  3A2K A;  5HLH A;  4BUP A;  2XAS A;  1MNM C;  2NNY A;  1IN8 A;  2M7B A;  3SDG A;  1IXS B;  5DM6 F;  2COB A;  2D5V A;  5BQT A;  1UJ8 A;  4I98 B;  4KN7 X;  1Z3Y A;  4NC6 A;  4YEJ A;  2CRG A;  1KU2 A;  1ZR4 A;  2KFD A;  2R93 J;  2X9D A;  4XKW A;  3CCE I;  1V55 H;  3DBH B;  5H6Q A;  1IAW A;  2VL8 A;  3H0G J;  3FMS A;  1X1B A;  3H9J A;  3KP3 A;  1IDY A;  3S14 J;  1D5V A;  2HVR A;  1WJA A;  2XC7 A;  1U8B A;  3LWF A;  1MMD A;  4BS9 A;  2G7U A;  2RRE A;  2YX4 A;  4BXU A;  2A3S A;  2L9R A;  3BJO A;  2HFH A;  3FXM A;  2LYC A;  3S1N J;  4RGU A;  1I3A A;  4KN4 X;  4EQQ A;  2PLY A;  4E7J A;  3ISP A;  3LSR A;  3WHC A;  3CJQ B;  3ZR8 X;  1CF7 A;  4E6K G;  5BNG A;  2HOS A;  1E2X A;  1BIB A;  1X1C A;  2OTL I;  3KX2 A;  3NAR A;  4M3E A;  1KON A;  3KZZ A;  3ULQ B;  2X1C A;  4BHB A;  5D4R A;  1WVR A;  1Y8R B;  4EJT A;  3WTY C;  3FXJ A;  2LBF B;  3GZ6 A;  4FT8 A;  1XB4 A;  6PAX A;  2CQN A;  3A03 A;  3F8N A;  1TWH J;  1R36 A;  4FAS D;  1XMK A;  2DO7 A;  1Z3X A;  2LY9 A;  3RYP A;  2NOJ B;  1MNE A;  4GGG A;  1MSE C;  4BDY A;  5HDG A;  5LBQ A;  4PGH A;  2JSP A;  4L5I A;  5IOZ A;  3KEO A;  3DTK A;  3OYK A;  2WY8 Q;  2RDP A;  4Y13 A;  2O7O A;  1FEX A;  4XM3 A;  1WJE A;  3DP7 A;  1FBS A;  3SZP A;  4X0G A;  2F4O B;  1SAX A;  1ZAR A;  2HZD A;  3HOT A;  4FTH A;  4EV0 A;  3S8P A;  1IN4 A;  4NBQ A;  2P7C B;  1UZC A;  1IXC A;  3CUQ C;  1WI3 A;  3RZD J;  2E1M C;  3SZG A;  3C1D A;  3MKL A;  3WTS C;  3FK6 A;  4BAY A;  4RB2 C;  4O6J A;  2E2J J;  4CO8 A;  2XPV A;  3QPH A;  1MND A;  2JJ7 A;  2G9W A;  4LIT A;  2DMP A;  3C2B A;  4D0P A;  4EJU A;  1DDN A;  3I5U A;  1ZHF A;  4I0A A;  4C2U A;  4M3B A;  3X2Q H;  1OR7 C;  3T0Y A;  5BPI A;  5FRN A;  3VSL A;  4XBF A;  4UV9 A;  3NAU A;  5M5X J;  2L2O A;  1R58 A;  3AG2 H;  3DTI A;  4BE1 A;  3CD6 I;  3WTU C;  1XMA A;  3ABT A;  1LEB A;  3KEY A;  3B73 A;  3IWZ A;  5EJC A;  2X48 A;  2R5Y B;  1MBK A;  1FOW A;  2LY1 A;  5D5V B;  2ECB A;  4RAZ A;  1H8A C;  1TC3 C;  4G9Y A;  4R8H A;  5GAD J;  1FTZ A;  4S04 A;  3LQQ A;  3M4O J;  2WB1 A;  2Q2E B;  4QIW N;  2BGC A;  1SAN A;  1Y0U A;  4P9U A;  3HOV J;  3D5R C;  3CJN A;  2XV4 S;  1I1S A;  3ML6 A;  2CSO A;  2AO9 A;  2JTV A;  3CCL I;  3TP3 A;  2EFW A;  2EV0 A;  4J19 A;  2DMU A;  2JVG A;  1HDD C;  4UHT A;  5F0C A;  2KT0 A;  3DCF A;  4B09 A;  2VKV A;  3E6D A;  4AIJ A;  2MH9 A;  4BU2 A;  4Y52 J;  1YE9 A;  2R7O A;  4HRI A;  3L7W A;  3HKZ N;  4Q4Z F;  2EFO A;  2OD5 A;  4W1U A;  5FRO A;  2HDC A;  4BEH B;  3F9K A;  3VSK A;  2NAZ A;  4N9I A;  4H0E A;  1RKW A;  3CUQ A;  1BIA A;  4MNU A;  1GV5 A;  4HG2 A;  5LGN A;  1WH7 A;  3COA C;  1P7J A;  2FXA A;  5KK1 A;  3CDI A;  3IRQ A;  5IP9 J;  2DAO A;  2XRN A;  3F8C A;  4R1H A;  3SEQ A;  4IKF A;  2VKD A;  3K4J A;  1HST A;  3T8T A;  3E97 A;  4AWX B;  1OR7 A;  3DBL B;  1KU3 A;  4D5C A;  1F4K A;  4BL0 B;  1MMS A;  2P0W A;  3RTR A;  4LLL A;  4KDP A;  4OAZ A;  3RIR A;  1K6O A;  2QZ8 A;  1UHW A;  4PJN A;  3HOX J;  2BXY A;  4HYE A;  1HC8 A;  4AU7 A;  2HPM A;  1G3W A;  2XGX A;  3GTO J;  1RC9 A;  4XOP A;  4KYW A;  2CV2 A;  2W48 A;  2ZC2 A;  4JYK A;  2H6C A;  5FKO A;  3FWE A;  5ICG A;  5ILU A;  1ODD A;  2RVC A;  2DCE A;  2IAI A;  5C4X J;  3WTW C;  1CGP A;  1MMN A;  1S5L C;  3IWF A;  5IYB J;  3CF5 F;  2IA1 A;  1MMG A;  2MAB A;  2XSD C;  5K1Y A;  4GYG A;  2D1H A;  1VQ6 I;  3F3X A;  1MBF A;  3SFZ A;  3M8F A;  2KZV A;  4HA8 A;  2EIJ H;  1TP4 A;  1JGS A;  5E1Z B;  4PFP A;  1MKM A;  5HS8 A;  2V1X A;  1WH5 A;  1YIO A;  2EIL H;  2HWV A;  2TRT A;  2W4S A;  3JRG A;  2CGP A;  4LG0 B;  2K9L A;  3OYE A;  3WG7 H;  5D5U B;  3F72 A;  1V5E A;  4NQW B;  1FYK A;  2XKO A;  3QU6 A;  2FEZ A;  2OAZ A;  4RM2 A;  3TP0 A;  4BY1 J;  4B3A A;  5B3S H;  1IV6 A;  1IDZ A;  4B1R A;  3EPZ A;  4RGS A;  3OYB A;  3HDD A;  3SJM A;  2CQX A;  3CME I;  3QAH A;  2VJ4 A;  1KQ0 A;  3O3K A;  2WAF A;  1G3S A;  1TLH B;  2EZK A;  2FNA A;  5E3O A;  3EYY A;  2XGD A;  3S16 J;  1HLV A;  3EDP A;  5GAE J;  4HST A;  2JRM A;  2M9H A;  3DKW A;  3OL4 A;  1J59 A;  2GBY A;  3WE2 A;  2WAQ N;  5L3G A;  2MC3 A;  3VYR B;  1O3T A;  4S05 A;  5L3F A;  4HF0 A;  2EA4 A;  4U7D A;  3FXU A;  1ONV A;  1S29 A;  1X3W B;  1O7L A;  3MD2 A;  1IJW C;  3RCO A;  4XRF A;  4EJO A;  2GA1 A;  2KIQ A;  1I39 A;  3GFJ A;  3RPU A;  3HRU A;  5LHI A;  1TW3 A;  1SC7 A;  4QTR A;  3A0B C;  3TED A;  2Y2Z A;  1FWZ A;  3KP4 A;  3VWB A;  5H20 A;  1VF9 A;  3LA2 A;  2KJB A;  4MLO A;  1K78 A;  1RES A;  3BY6 A;  2ISY A;  1UMQ A;  3QPL A;  3RQ4 A;  3SEZ A;  1S72 I;  3DKY A;  5CVU A;  2E2I J;  3ZQQ A;  5KHD A;  1T56 A;  2QQ9 A;  1EH8 A;  3AFH A;  2BHY A;  3JCU C;  4GRI A;  4UUS B;  2E5N A;  3QYE A;  3I56 I;  2YS9 A;  4XN0 A;  3K1P A;  4MO7 A;  2M0M A;  2R5Z B;  4M73 A;  4XL9 A;  5GAG J;  1TNT A;  2K86 A;  4MTD A;  3ZP5 A;  2JUC A;  4HV6 A;  4UVB A;  2ZME B;  1W4M A;  4ZTJ A;  3FM5 A;  4M71 A;  2FF4 A;  2F4I A;  3WTT C;  2ZXJ A;  4KIC A;  1PVE A;  1QVU A;  1ZQ3 P;  2LH9 A;  4LK1 F;  1I50 J;  4EM1 A;  5LHH A;  2Z1D A;  2M34 A;  5CPR B;  4F91 B;  2OJE D;  4Z6Y A;  3LAP A;  4M3F A;  4CZC A;  1EF4 A;  3HOS A;  2VKH A;  3FF5 A;  2NVQ J;  2QWW A;  2NVY J;  1ITY A;  4NDL A;  2LSO A;  5B5E C;  2QQB A;  3FKJ A;  1TQI A;  1JJ6 C;  1VQK I;  3BR2 A;  3GF2 A;  1EH7 A;  1SD5 A;  3M8E A;  4XID A;  5J8C A;  4DNC A;  2EZI A;  2V4J C;  3L2W A;  1T98 A;  2O61 A;  1A04 A;  2Z2S B;  3KLN A;  4PUS A;  2R92 J;  1H89 C;  2UUZ A;  1JE8 A;  1JI8 A;  2L7K A;  1A5J A;  5EZG A;  2PN6 A;  2UWM A;  1WQ2 A;  2CQ7 A;  2Y75 A;  1P9Q C;  1BA5 A;  1XX5 A;  1WJF A;  5ICC A;  1K79 A;  1EKE A;  4AVZ A;  5F64 A;  3W6V A;  1B8I B;  2A6T A;  4E7Z A;  1IXR C;  1SD4 A;  4A3L J;  5FGM A;  1TZL A;  1GLN A;  1OCO H;  3EQL F;  4E7S A;  3AL0 B;  1ERD A;  3BR6 A;  4I76 A;  4ZH4 F;  4LG3 A;  1UEL B;  1RR8 C;  4GDF A;  1Y0N A;  3OMY A;  3FXR A;  3QP5 A;  4IXA A;  2FOW A;  1NK3 P;  2R7V A;  2MD5 A;  2UXX A;  3ROU A;  3S3O A;  4M6Y A;  2Y48 A;  3G4S I;  1IV8 A;  1JUM A;  2A69 F;  5ICE A;  3HIF A;  3HM5 A;  2AHQ A;  3ZMV A;  1MBG A;  5FLM J;  3IL2 A;  1SFU A;  4LLN A;  4A69 C;  4E4H A;  1XSX A;  3L00 A;  3RYR A;  2F4M B;  1ZG5 A;  4AUX A;  3PFY A;  5CLS A;  3BCB A;  2LKS A;  4HDV A;  4A3J J;  3OYJ A;  4IZZ A;  3VPR A;  1QGP A;  2K40 A;  4HNU A;  3CCR I;  1ZTR A;  4HQM A;  3CES A;  2FMY A;  2XB0 X;  3DPT A;  5LRS A;  4RLF A;  3RKW A;  2M87 A;  3CCJ I;  1IRF A;  4WF2 A;  2FML A;  1WWX A;  4UVA A;  2GLO A;  4BJT A;  1XGN A;  2QBY A;  4PJ0 C;  2LY2 A;  5BOX A;  1N77 A;  2QKL B;  2RV8 A;  1XGO A;  4WXC A;  2STW A;  3OYF A;  3FIW A;  2K4B A;  4NC8 A;  1VQP I;  3HB9 A;  4UXN A;  4WXD A;  2IGM A;  2WV0 A;  2ZNY A;  1KGS A;  1CF7 B;  4OMZ A;  2LG4 A;  3H36 A;  4JOM A;  2E36 A;  3BC8 A;  4M3D A;  1FYM A;  2VN2 A;  4IRG A;  2N8G A;  1W5C C;  2Q1Z B;  3GTM J;  1FOY A;  1D8K A;  3B02 A;  1CQT A;  1ETV A;  3HTU A;  2ME6 A;  2VBW A;  1JJ8 C;  2WC2 A;  2R7W A;  1G4D A;  3CLQ A;  3JRF A;  1Q1V A;  4C3I J;  2KDO A;  2H8W A;  3SFI A;  2E5Z A;  1APL C;  4BAC A;  2K9Q A;  3D5S C;  5JFR A;  3I9V 2;  3WTX C;  5IP7 J;  3QYB A;  2VIX A;  3DWL E;  3M1C A;  1KZH A;  3ESW B;  5GPC A;  1XSD A;  4CGZ A;  4XOT A;  3I64 A;  1E17 A;  4AID A;  3DLA A;  1XGM A;  3HGY A;  3O6B B;  2RKH A;  4NHJ A;  1R4N B;  1IGN A;  1YHQ I;  3ZN0 A;  3ZOB A;  1KA8 A;  3G1O A;  2VC1 A;  4IRH A;  5F1J A;  1DP7 P;  1YX3 A;  1IO2 A;  1ULY A;  5EG0 A;  4KIF A;  4M74 A;  2W25 A;  1FIA A;  4LB6 B;  5J1R A;  3SDB A;  4CCK A;  3HRT A;  1RR7 A;  2L9S A;  3ZQF A;  3U9G A;  1VND A;  2Q0O A;  5HDK A;  4ZYD A;  1K4S A;  4AIH A;  2VON A;  2HPI A;  3OSF A;  2CH0 A;  2E2H J;  1EH6 A;  1BI1 A;  2DT5 A;  2EWN A;  2XSJ C;  3HKZ A;  1JTX A;  4U87 A;  1XD7 A;  4OU0 A;  4IHW A;  1SAU A;  4GXO A;  5FKN A;  4XSZ F;  3CCV I;  3UNG C;  3C18 A;  1BL0 A;  5D8K B;  2FD5 A;  3R0J A;  2EJR A;  3J7A O;  4LB5 A;  1A35 A;  1SFO J;  1MJA A;  4DBR A;  1LDD A;  5LEK A;  3CCQ I;  3GWZ A;  4HOB A;  2MYS A;  1BR2 A;  5EZH A;  3VEP A;  2OQR A;  2E19 A;  1P2F A;  2KMU A;  3BT9 A;  2M4G A;  5J3L A;  1G59 A;  2ZJQ F;  5BMZ A;  2B7E A;  1HOM A;  3LA7 A;  2HOA A;  1B72 A;  1MD0 A;  4RGR A;  2DA7 A;  3CJT B;  4Q48 A;  2XGE A;  5CVJ A;  3FK7 A;  2F5D A;  4CYC A;  2PMZ N;  1X2M A;  3GTJ J;  3F6O A;  4LJZ F;  3CUQ B;  4B8X A;  4P1W A;  3K9T A;  2M45 A;  1I6X A;  2E1M B;  3OYG A;  1LDJ A;  2R3S A;  3CP8 A;  2DJI A;  2GIZ A;  3BG5 A;  1LFU P;  3SQN A;  2F5V A;  3AKZ A;  2L9N A;  2MLK A;  5EYR A;  1FSE A;  1FIP A;  5GTI C;  5KNL A;  1VQ9 I;  2M7A A;  3I4N J;  2QQA A;  2ZCW A;  1OCZ H;  3PM1 A;  1ZN2 A;  2V9K A;  4L9V A;  5IPA A;  4XRM A;  1W0T A;  2JN6 A;  2H94 A;  1IRZ A;  5BS6 A;  2EIN H;  1T33 A;  3BTJ A;  1ZH5 A;  2V9V A;  3GTL J;  4B43 A;  4LMY A;  2V7F A;  2QGU A;  2P6S A;  2LF7 A;  1YIJ I;  1MBH A;  2QSF X;  3CLO A;  1XTA A;  4O3M A;  4I09 A;  1S6L A;  5J6X A;  3PJR A;  1LFP A;  5D8L B;  3BZK A;  2L01 A;  1AOY A;  5KVR A;  4FX0 A;  4I6Z A;  2LC2 A;  1R1V A;  4BBR J;  5HS7 A;  4HF2 A;  3W6J B;  2EH3 A;  4HLX A;  3G71 I;  3DU6 A;  4X6A J;  5JLW A;  4Y17 A;  2DK5 A;  3PFI A;  3NRV A;  2KIU A;  3A4C A;  3M07 A;  2KLO A;  2ADU A;  1T2K A;  4E70 A;  5A2Q Z;  2BVL A;  2E7X A;  1UHS A;  3OIQ A;  4A3M J;  3LSM A;  4C3H J;  4ENM A;  2ZB9 A;  3LQR A;  2ZSH B;  1SD6 A;  4CXF A;  2GXA A;  1VQN I;  2UXN A;  4YFN F;  2CQQ A;  2WAQ A;  3QOE A;  3L2Q A;  3BZC A;  1O3Q A;  1YW9 A;  1DU6 A;  4FIS A;  5GPA A;  1Y8Q B;  3QPT A;  3ZMS A;  3KZI C;  2D2W A;  2IRF G;  3DFG A;  2CUF A;  2QM3 A;  2CYY A;  3GFL A;  2X0L A;  2QUF A;  2LF8 A;  2JQ7 A;  3DEE A;  2ZNZ A;  1T0F C;  2GXB A;  2L4M A;  4F93 B;  3BR5 A;  4GFB A;  2YUS A;  2AS5 F;  2OZ6 A;  2A05 A;  2W24 A;  3EUH C;  4XLE A;  2JZY A;  3L09 A;  3C2H A;  1Z05 A;  2R7D A;  3U1K A;  4XRS G;  3H5R A;  2HEO A;  1SVO A;  5EGO A;  4L0Z B;  2RNJ A;  1UST A;  2KDZ A;  1YIT I;  3HGG A;  3ZPL A;  3FHZ A;  3DBR B;  3V4G A;  5HNF A;  4YIR X;  1B59 A;  1SMY F;  2X1E A;  1JT0 A;  2B63 J;  2O5R A;  2DA4 A;  4BGD A;  3BTL A;  1UHM A;  2XAH A;  3LST A;  2XRL A;  4OIP F;  1S7E A;  1YS7 A;  4EM0 B;  1U2W A;  2MGQ A;  4Y4R A;  3C3W A;  4GO1 A;  5E8G A;  3SYT A;  2F48 A;  2LMD A;  4EMS A;  2GOM A;  2EZH A;  3ABK H;  1LVA A;  1QO0 D;  2Z16 A;  3HYI A;  1R6R A;  1XDS A;  4YEL A;  1TWC J;  4BJ6 C;  3OS2 A;  3KP6 A;  2HOE A;  4EM2 A;  5J1Y A;  1DP3 A;  3HUG A;  3J81 Z;  2CU7 A;  4IVN A;  2LKX A;  5FD6 A;  5KAF C;  3ZMU A;  4JP0 A;  3ELK A;  3RPQ A;  3ZCO A;  4DYC A;  1K6Y A;  5KAI C;  2F5C A;  1K78 B;  4G7Z F;  3CC4 I;  1OCT C;  2HDD A;  1JKR C;  2Y69 H;  4DW6 A;  2JSC A;  2BXZ A;  4KT6 A;  5FFZ A;  3E6C C;  4LK0 F;  1T0F A;  2W1O A;  4F92 B;  4XRS A;  4RAG A;  4RB1 A;  3HOY J;  2DFE A;  5E1X A;  3K4B A;  3EUH A;  2DFF A;  3QRF F;  1BW6 A;  3WE3 A;  4B47 A;  3FMQ A;  1WJD A;  4HEA 2;  2OC6 A;  2VJI A;  2GZW A;  1D1A A;  4R79 A;  4C3J J;  3J81 K;  1ZLK A;  2WA0 A;  2O8X A;  1O57 A;  2O3F A;  4HBL A;  2QYO A;  1BJA A;  5E3L A;  4BXX J;  1FP2 A;  2A6H F;  3H3V K;  1MH3 A;  5M3M J;  1YG2 A;  3L2U A;  1SEU A;  1PYV A;  1XPX A;  5HOD A;  1ZRE A;  4OWR B;  4N4N B;  2E1N A;  3GW2 A;  3G73 A;  3OOP A;  1EA3 A;  1YX5 A;  4DIQ A;  5JHF A;  4Y7N J;  1RET A;  4JK1 X;  3CDH A;  2Z5U A;  3RSN A;  2K9M A;  1NTC A;  4MIM A;  3CZ6 A;  3MEX A;  1QPI A;  5L3B A;  1G3Y A;  1YTY A;  3K10 A;  4RA2 A;  2L5Q A;  4BNC A;  4NNJ A;  4UB8 C;  5D4S A;  2PEX A;  1QA6 A;  3OL3 A;  4XQF A;  4CSW A;  5GAH J;  4IHV A;  4M72 A;  2BHZ A;  2ME0 A;  3K70 C;  1T38 A;  3ZQI A;  4DZP A;  3HSF A;  1TWG J;  1U5T A;  2VQH A;  3VB2 A;  4A0Y A;  1H0M A;  1LUJ B;  1FX7 A;  3H3U A;  1LE8 A;  3KP5 A;  2NRA C;  5FB2 A;  3IKT A;  3J7Z I;  3F21 A;  1MDM A;  1HW1 A;  1QU3 A;  5FFX A;  5FJ8 J;  1BR1 A;  3LL7 A;  3K7A J;  4XSX F;  2XF5 A;  3WTV C;  3W2A A;  2JA7 J;  3QOD A;  2ZKZ A;  4FET A;  5TGT A;  4B48 A;  5CYV A;  1XG1 A;  1FYL A;  1ETW A;  3SHF A;  1S9H A;  3TO9 A;  1TTY A;  4WX9 A;  1N25 A;  1MJB A;  4KMF A;  1XN7 A;  3PO3 J;  2VOO A;  2CMP A;  1UG0 A;  5CQG A;  1XCV A;  1R5G A;  2MC4 A;  3I54 A;  5D6E A;  4A12 A;  2J5O A;  2V1D A;  1WZ2 A;  4ETS A;  2HQA A;  2JA2 A;  5F1R A;  1FZP B;  5FKL A;  3K70 D;  4AC0 A;  2VE8 A;  2CV0 A;  2EFQ A;  2PG4 A;  1TT0 A;  3RJP A;  2A5Y B;  2CG4 A;  3MFK A;  4N9H A;  4KUM A;  5JLX A;  1ZK8 A;  5IT9 Z;  1WRJ A;  2PX9 A;  4ZDL A;  1WJ5 A;  1Y1W J;  3DU5 A;  4Y15 A;  4EEF G;  2VLA A;  4ESJ A;  3V42 A;  1AHD P;  2CUZ A;  4BH9 A;  1P4X A;  5EEG A;  2CQK A;  4XLP F;  5DYM A;  1ZR2 A;  3LAJ A;  2QEX I;  2H09 A;  2OTJ I;  2I5U A;  2QBY B;  5LEJ A;  4M6V A;  2STT A;  3DV8 A;  3OIP A;  4S0H B;  1ZGW A;  4EGY A;  1FPQ A;  1YLF A;  2E35 A;  2M2E A;  3I4P A;  1RZ4 A;  5EEA A;  3JTH A;  5FRM A;  1ETX A;  3J7A Y;  2OCE A;  5IT9 K;  2QVO A;  1WSU A;  5HLT A;  1J09 A;  3PL8 A;  3DEW A;  2RC4 A;  2DFI A;  1HQC A;  2FJ1 A;  5J47 A;  2DYR H;  4DZJ A;  4AVP A;  5HOO A;  1V5F A;  4FHT A;  1D5Y A;  2DI3 A;  2L3D A;  4IHS A;  2PMH A;  2ZJ2 A;  1BN5 A;  1S7O A;  2P7V B;  1A6Q A;  3K1M A;  2LK2 A;  3CTA A;  4KT5 C;  3GZN B;  3WTZ A;  3GLL A;  4IF4 A;  1YFH A;  5F08 A;  2NOG A;  3QU3 A;  2DMT A;  2YX7 A;  1TQP A;  1ZG1 A;  3JRI A;  3IH4 A;  3RPU D;  1GV2 A;  1U0J A;  2XDV A;  4UV8 A;  4KA4 A;  3K69 A;  4G6D A;  4JX6 A;  4X1E A;  1R1T A;  4CCO A;  1IN7 A;  1H9T A;  2LFB A;  1ETO A;  2EPF A;  2VI6 A;  2M8E A;  3E3V A;  4AYB N;  1IN5 A;  3MVP A;  3QOP A;  5IY5 H;  1GVD A;  4PJJ A;  1J75 A;  4IHX A;  4Q5S F;  1FOX A;  1T95 A;  1Y6I A;  1IF1 A;  3H5A A;  4M9S A;  3FZV A;  3W2W A;  1X3Z B;  3BCA A;  2CFO A;  1W0U A;  2Z3Y A;  4XK4 A;  5EG0 B;  1OQY A;  4L5E A;  3HBL A;  2PJP A;  2WBM A;  4IX7 A;  1E3H A;  5DDG A;  3OYH A;  2X6O A;  3TDZ C;  3M1E A;  2VXD A;  3TOA A;  3CJR B;  2V79 A;  1YS6 A;  2K85 A;  4LIU A;  3BR1 A;  4MQ9 F;  4CH7 A;  3JR9 A;  3E6M A;  4RAY A;  3IH3 A;  4ENJ A;  1ZGA A;  1OYW A;  1J7K A;  4JBA A;  4A0X A;  2M8G X;  2DA1 A;  2IPQ X;  2DA2 A;  2M0C A;  1SVL A;  5J40 A;  2KZG A;  5E3N A;  1FMW A;  3JRB A;  1J0R A;  1YW8 A;  4H4K C;  4RGX A;  1Z9C A;  1T8I A;  2PMZ A;  3VYS B;  5M5W J;  3M9A A;  2CW7 A;  2Y31 A;  1F5T A;  1R1U A;  4CA0 A;  3GFI A;  3N4M A;  4XKV A;  4G8X A;  1X4O A;  4II3 A;  4LIV A;  1Y56 A;  2DQR A;  2P81 A;  5IP6 A;  1D1C A;  4OOI A;  1Y1V J;  4QLC U;  4D5F A;  4MGR A;  1F9N A;  5CJ9 A;  1SVM A;  3E6B A;  4Y33 A;  3DTE A;  2FOK A;  3QYF A;  4G7H F;  1U3E M;  5F6F A;  1YW7 A;  3TW7 A;  1B72 B;  4HQE A;  2FRH A;  5J8F A;  3HPG A;  3BJ6 A;  1QBJ A;  1X1A A;  5L3C A;  4CYC B;  3AAF A;  2CW0 F;  1DU0 A;  1WHU A;  1ZEL A;  2K7L A;  4FE7 A;  5DD8 A;  3MZH A;  2HI3 A;  2K02 A;  2KL4 A;  3MKZ A;  1BM9 A;  2LNB A;  4KIS A;  1GT0 C;  1RI7 A;  2EIM H;  2OA4 A;  4FX4 A;  2F6C A;  3K4N A;  3SZT A;  1PJR A;  3H35 A;  1QNT A;  2ZXH A;  1GXP A;  1IRX A;  1STZ A;  2Y9Z A;  4HW0 A;  1SFX A;  3HSR A;  4A6E A;  1SMT A;  1KU9 A;  4IHY A;  3V7S A;  3FKI J;  3KYC B;  3HOZ J;  4A5N A;  3TL4 X;  1X4P A;  1BI2 A;  1PUF A;  1YJN I;  4IQ4 A;  2HKO A;  1FP1 D;  3CDL A;  1W5S A;  1TBX A;  1GDT A;  3V7C A;  2DLL A;  3U2R A;  1YQA A;  1W7P D;  4NB5 A;  2CS3 A;  2OF7 A;  3S1R J;  4YIF A;  5EDN A;  3OSG A;  4DGW B;  2BY0 A;  3I59 A;  2HQN A;  1V54 H;  2XHK A;  4QPQ A;  3PQJ A;  2MG4 A;  2KHM A;  4UY8 I;  3M8J A;  2OZU A;  1W36 C;  2BY3 A;  4BHP A;  4YII A;  1QRY A;  3CUO A;  4U0V A;  1LFB A;  4A5M A;  2JPB A;  3BR3 A;  1D3Y A;  2ELJ A;  3VOE A;  1SFK A;  1FT9 A;  2E71 A;  3I58 A;  2IVM A;  1W7P A;  2Z99 A;  2O9L A;  1BC7 C;  5F04 A;  1OYY A;  1D1B A;  3BG3 A;  3IH2 A;  2JMW A;  2DPD A;  4I2O A;  1RNL A;  4QSH A;  3KLO A;  3HRM A;  2NNN A;  3DEU A;  3PO2 J;  1S7A A;  4ITV A;  3W6K B;  2R7T A;  2IS2 A;  1MSF C;  2ZSI B;  3G6E I;  5ILS A;  3S3N A;  1HW5 A;  1DQU A;  3L1P A;  1USS A;  2QA4 I;  2VPR A;  1MW7 A;  1IC8 A;  1AU7 A;  4HNT A;  1FMV A;  5EGO B;  1FSH A;  2G7H A;  4U0W A;  1NG7 A;  4ZYH A;  3VYT B;  1W36 D;  5LFA A;  2X6W A;  3KIO A;  2XF6 A;  1K7A A;  2EQR A;  2L4A A;  1KQ9 A;  3ZQH A;  4CCL A;  4F52 A;  2MBF A;  2VC0 A;  2DA3 A;  3FXQ A;  2DW4 A;  4A3D J;  5HVQ C;  5IOY A;  2QKM B;  5KCM A;  3WU2 C;  1HKQ A;  2KRF A;  2PQ8 A;  4D1Q A;  3JRD A;  4E7L A;  3BG6 A;  4IEJ A;  1VZ0 A;  4DYR A;  4OIQ F;  4PDK A;  4PSW A;  1KQ8 A;  4C2M J;  4KNY A;  3HHG A;  3CO6 C;  1OLT A;  2HR3 A;  3HJE A;  4QPO A;  1BC8 C;  1RRJ A;  3BPX A;  1UFM A;  3HUG B;  3ABL H;  4OAY A;  3QQA A;  5J1U A;  4Q47 A;  1VI0 A;  3JW4 A;  2HXO A;  5JVT A;  2HYG D;  1AKH A;  3V8J A;  3KP7 A;  3L9F A;  2E34 A;  1X19 A;  3H0D A;  1ETK A;  2ECC A;  1JUP A;  3J80 Z;  3P9K A;  4ZDP A;  2O0Y A;  2HQ5 A;  2NS7 A;  1I5Z A;  4V2F A;  2IA2 A;  3GTG J;  2HU9 A;  5IT3 A;  2R7S A;  1HF0 A;  4KIT B;  2X85 A;  2V6C A;  3C2G A;  3ECO A;  4V2G A;  1UCR A;  3HHH A;  4BQN A;  1FY7 A;  4ESF A;  5E20 A;  1W1W E;  2XKP A;  1GHC A;  1OFC X;  3OYA A;  3MAJ A;  5DUI A;  3DLL F;  1R22 A;  2KKO A;  1G2H A;  2X51 A;  2VBY A;  3HG9 A;  3R60 A;  3ZQG A;  1D0X A;  5HLG A;  3OS1 A;  3A1Y A;  3J80 K;  2EA2 A;  3FMR A;  1IUF A;  2RAE A;  1BBY A;  4EJV A;  3RI4 A;  3GZ5 A;  2X6X A;  3R61 A;  5D6F A;  5F0F A;  5HS9 A;  3ZGK A;  3MZY A;  3WG9 A;  3S32 A;  3BQY A;  4OIO F;  2W00 A;  4F7Z A;  3OWT A;  2AXL A;  3CC2 I;  5K5R A;  1U78 A;  4ZZD A;  5DEQ A;  2A07 F;  5IYD J;  3EET A;  3IHU A;  4M9X A;  3E5X A;  3WU0 A;  3ZMZ A;  3UR3 C;  2DK8 A;  3MZ8 A;  2DMQ A;  1WPK A;  1ZGJ A;  2NVT J;  2OU2 A;  2ZO4 A;  5DCM A;  5TIS C;  3RKQ A;  3FIS A;  2WY7 Q;  4A3C J;  2VJJ A;  1U5T B;  4LOC A;  9ANT A;  1LE8 B;  2BV6 A;  2DDB A;  2VJ5 A;  2VT3 A;  2O6G E;  1ZLJ A;  4BDZ A;  1GXQ A;  1XSV A;  4UNO A;  2VOP A;  2RGV A;  1MDM B;  3TOB A;  2MD0 A;  3IAM 2;  1I3Q J;  3S15 J;  3W2V A;  1YYV A;  1O4X A;  3T5X A;  4ZDO A;  2XUB A;  3LFU A;  1JHF A;  3DQV C;  4C9Y A;  2JWT A;  4IO9 F;  2K3F A;  1B6A A;  4A6D A;  2H27 A;  4GYI A;  3JTG A;  5E79 C;  1QHH D;  3G3Z A;  3E1S A;  2OPT A;  2R7F A;  2NVU B;  3T1B A;  4B3X A;  1OKR A;  3F8F A;  4EVI A;  2J5P A;  1Z91 A;  2E60 A;  2Y0S N;  4AD9 A;  2DTZ A;  4A3B J;  1OYI A;  2FBI A;  1EJ9 A;  4FCY A;  4F3Q A;  1QHG A;  1ZRF A;  2VT2 A;  1V5G A;  5GP9 A;  2BZT A;  2GAU A;  2OQG A;  2RQP A;  3S17 J;  4DYQ A;  2PMU A;  3BG9 A;  3BJA A;  2HQR A;  3CMM A;  4E7I A;  2R7Z J;  2X1D A;  3NEU A;  1RUO A;  3PUF A;  3CCU I;  1LQ1 A;  3F22 A;  2ZJP F;  1T08 B;  2VQC A;  2LVS A;  4HX7 A;  1LKX A;  4KIB A;  2GXG A;  3I71 A;  3A02 A;  4MFD A;  4RAF A;  4HZF A;  3S93 A;  1D8J A;  4RMN A;  2VBX A;  3J7Y J;  1IUY A;  2KP6 A;  2A5W A;  2CO5 A;  2W84 A;  1YRN A;  5DS9 A;  3NWS A;  3K2Z A;  4KMU X;  2IBD A;  4DOZ A;  4IL6 C;  3KYD B;  4I02 A;  4KIG A;  1TL8 A;  3N05 A;  2KPM A;  2L54 A;  5DV5 A;  1H88 C;  4A3F J;  2DFH A;  5E8I A;  5C3E J;  4LD5 A;  2DQL A;  4WXH A;  4MQV A;  4J00 A;  2DMN A;  4AYB A;  2XAF A;  5E1W A;  3VYU B;  3OY9 A;  4MTE A;  1U9O A;  4IHT A;  2R7U A;  5B1B H;  2BW3 A;  5GTH C;  3C7J A;  2H6B A;  4C30 A;  2DOF A;  1JKP C;  1J5Y A;  2HVQ A;  3CCS I;  2GOX B;  2VOD A;  2L7M P;  2E7W A;  3S1Q J;  5AON A;  1FBQ A;  1J2X A;  1MH4 A;  3CQZ J;  4G6Q A;  3T8R A;  1Z21 A;  5A2Q K;  3MWM A;  2KQR A;  3H3Z A;  4B4C A;  2ESN A;  3GYH X;  1LJ9 A;  1WJB A;  2F5F A;  2BE5 F;  4RB3 C;  1OCP A;  1QZZ A;  1R4M B;  3GVA A;  1L0O C;  2MLG A;  1VQ5 I;  2A6E F;  1E0E A;  4BE0 A;  4HSR A;  4B44 A;  1WGX A;  3G1L A;  3NWT A;  1WFX A;  3LSI A;  1MJ9 A;  2V1U A;  3K4L A;  4L9T A;  1UG2 A;  4HX4 A;  4XN3 A;  1ZKG A;  2IW5 A;  2IS1 A;  1FJL A;  5M5Y J;  4E7K A;  3GFM A;  4ZJZ A;  3FXK A;  2VBZ A;  3AG4 H;  3IRR A;  4W97 A;  4A93 J;  4XR6 A;  2Q8K A;  5L3E A;  5EF6 A;  4MEX F;  1JXS A;  4BQO A;  2P4W A;  4ZZL A;  2DOA A;  2YR2 A;  3ZXS A;  4CIC A;  1L3L A;  3CMY A;  1RIO H;  2P5L C;  1NG6 A;  5E3M A;  3LSP A;  1Z1D A;  4U88 A;  3GXO A;  4G12 A;  1U5T C;  1FOK A;  5F27 A;  1TNS A;  4J01 A;  2IS4 A;  5LLQ A;  3ASO H;  1ETY A;  1OMI A;  2FQ4 A;  2L02 A;  2HTS A;  5B66 C;  5ERI A;  2ACJ A;  4I99 C;  1PDN C;  4LLG F;  2M4K A;  2XAJ A;  2RQQ A;  3I4M J;  1Z6T A;  2PJR A;  1IZ1 A;  1UB9 A;  4CZZ A;  3LSK A;  3TO7 A;  3QWL A;  3JRA A;  3MCZ A;  2QF7 A;  1HKS A;  3P7N A;  1OJL A;  3K6G A;  4XKC A;  1ZG3 A;  2AQE A;  3QP6 A;  1U9N A;  1KYZ A;  5FLX Z;  1E3P A;  1HSJ A;  4JX5 A;  5H6R A;  1FTT A;  3OIO A;  3Q0U A;  4XLA A;  5FO5 A;  4EGZ A;  3QPS A;  1Q1H A;  3MKW B;  3D5L A;  4A3G J;  2JT1 A;  5DM7 F;  1I1G A;  2IS6 A;  4ZYE A;  2EB7 A;  3E7L A;  3GTQ J;  4BHC A;  3UKG A;  5JR3 A;  2P8T A;  3HRS A;  3Q5F A;  3FXO A;  1Z7L A;  4PFO A;  3RKX A;  3RDI A;  3HSE A;  4V19 K;  2R4G A;  2V6E A;  4CYD A;  1MBE A;  2XPU A;  1JTY A;  3OYN A;  3LSG A;  1YJW I;  1KU7 A;  3TQN A;  1D0Y A;  2EFP A;  5FLX K;  2HGC A;  3HPH A;  3DPL C;  2CV1 A;  4RBO A;  1N75 A;  2ELH A;  3OYC A;  3MQ0 A;  3D1N I;  3IP4 B;  1R9T J;  1WJC A;  4YG2 F;  1NHA A;  2EV5 A;  2H1K A;  2E1O A;  3BPV A;  1P7I A;  2ID6 A;  4UUT A;  2UZK A;  3O2P E;  4EAT A;  1PUF B;  2X4H A;  1BJZ A;  3M7G A;  2Z33 A;  1LB2 A;  3KZY A;  1ENH A;  1WKM A;  2K5C A;  2F2E A;  3FHN A;  3PNY A;  3Q0W A;  5CVV A;  4BQQ A;  2ELK A;  1YI2 I;  3CCM I;  3NQO A;  1Z6R A;  3BTI A;  3FXL A;  1XMX A;  1LNW A;  3H9G A;  2CFX A;  1ACI A;  1HCR A;  3RKY A;  4D7M A;  3OYM A;  1WI9 A;  1MIJ A;  3E0J B;  3OR2 C;  3I59 B;  4PSX A;  2XB5 A;  1T6S A;  1QQI A;  2K3P A;  2ZJR F;  2MFZ A;  2W57 A;  2FQ3 A;  4FQG A;  4M6X A;  3A0H C;  4PJM A;  1FBU A;  4YFK F;  2XF7 A;  2M5W A;  4BYY A;  2DU9 A;  5E18 F;  2LOO A;  3VFZ A;  3EUK L;  1M1E B;  2EBI A;  2OUM A;  3V8K A;  1ORK A;  5HDN A;  4D7N A;  3CCY A;  4L9N A;  2ISZ A;  5DD4 A;  2KIS A;  3TBI A;  3O8H A;  1W7P B;  3CF2 A;  3KET A;  4P5O A;  1QZE A;  3F23 A;  1P4W A;  1AA7 A;  2DOD A;  1ZRD A;  3S1M J;  5D5W B;  1HW2 A;  2V9P A;  3GLX A;  2L0K A;  3LSJ A;  1A36 A;  5FKM A;  2F5E A;  1PP8 F;  4U0Y A;  5K7F A;  3PUB A;  2FX0 A;  2ESH A;  3H92 A;  3Q9S A;  4IOA F;  5D5X B;  1Z67 A;  3L2V A;  1PUE E;  1OCC H;  1TT5 B;  2XAG A;  1SFE A;  1X3U A;  3K4M A;  1PP7 U;  3TO6 A;  4L9J A;  1FNN A;  1ETQ A;  2VUM J;  3ERM A;  2JA8 J;  4ESB A;  4BJ5 C;  1DPR A;  2IJL A;  2VQL A;  1R71 A;  5K5Q A;  3A01 A;  2EFN A;  2Y30 A;  1K83 J;  5FLV A;  2PFB A;  2WWY A;  2LP0 A;  1VQ8 I;  4BY7 J;  5F0H A;  1SD7 A;  3I0T A;  4G6T B;  3GTP J;  2GA2 A;  1POG A;  3F6V A;  2L9V A;  4Y3O A;  3GTK J;  1GUU A;  1BOA A;  4CCJ A;  5LHG A;  4RM3 A;  1V4R A;  2M30 A;  2NXN B;  3Q9V A;  2K9N A;  5AIQ A;  3KFW X;  2BVM A;  1XCB A;  5CKT A;  2ZBK A;  2W85 A;  4P55 A;  2LD5 A;  2TCT A;  3KPH A;  1TQM A;  2G0E A;  4IOC F;  1G6N A;  2KIM A;  1D0Z A;  2M1B A;  3PQK A;  2JPC A;  3FBI B;  2MH2 A;  1B9M A;  2LDU A;  4EJW A;  1OIS A;  1LPQ A;  3IKV A;  4XON A;  1VQM I;  2AQF A;  2LTP A;  1JHH A;  4ABZ A;  3JSP A;  2HYJ A;  4XOR A;  1AKH B;  2HZT A;  5HNH A;  3AG3 H;  1JUS A;  3HOU J;  4L0Y B;  3DKX A;  2LRE A;  3I55 I;  2IGN A;  4IQJ A;  2BEO A;  1HDP A;  2M3A A;  1DGR M;  4A3I J;  1P6R A;  4DQ2 A;  3BR0 A;  2C6Y A;  3ZQ7 A;  4KFC A;  1LDK B;  3FX3 A;  3K4K A;  1XDU A;  4P96 A;  1IN6 A;  2A61 A;  2IEK A;  2DJN A;  2QEN A;  3ONQ A;  4LFU A;  2MA3 A;  1VQ7 I;  3S2H J;  5K5O A;  2O8K A;  4I7H A;  4BQA A;  1BR4 A;  2QQ8 A;  1P4A A;  1X2N A;  1UAA A;  2HTJ A;  2H8R A;  3MKY B;  4IJA A;  2CW8 A;  2BY1 A;  2DA5 A;  2JRT A;  3ZN1 A;  4YRV A;  1FC3 A;  2DBB A;  1K4T A;  4ASN A;  1G8X A;  2RN7 A;  3BWG A;  2R7R A;  3LOC A;  4M9Z A;  2R0Q C;  4PCQ A;  2YPR A;  1TWF J;  1ZAO A;  1TWA J;  2VKE A;  4ZTF A;  3IAS 2;  2IT0 A;  2EV6 A;  1H9G A;  2LBF A;  2D45 A;  2K27 A;  5C4J J;  4XMY A;  1MMA A;  2YU9 J;  4MFE A;  3ABM H;  3HC7 A;  5CVR A;  4BBS J;  3OS0 A;  2D1V A;  2P6T A;  3MMY B;  4HF1 A;  4L5J A;  2UV1 A;  3BZ6 A;  2OCC H;  3E5Q A;  4GCV A;  5DCM B;  4HX8 A;  3JRH A;  2CUJ A;  2GQQ A;  2DPU A;  4XLC A;  3F8M A;  5CQE A;  5H2F C;  1RKT A;  2Y0S A;  2I8D A;  3VOD A;  5LGU A;  2HVS A;  2E1C A;  3LSH A;  3LNQ A;  2V1N A;  2ICW G;  2EZL A;  2B0L A;  3TW6 A;  1Y39 A;  2IP2 A;  2FU4 A;  2VB6 A;  1ON2 A;  1R5H A;  2NYX A;  1O3R A;  2H1L A;  1MBJ A;  2RNG A;  5ICF A;  1S8N A;  2NS0 A;  3TDU C;  5B1A H;  4CUG A;  3KEQ A;  2JA6 J;  3FDY A;  4O5V A;  2HXI A;  4CDG A;  2KRH A;  5DUK A;  2K9S A;  3JRE A;  1MGT A;  1JT6 A;  4CCM A;  5E17 F;  2CUE A;  3TGN A;  4JX4 A;  2JA5 J;  1RPW A;  4HAM A;  2XVC A;  5IYC J;  4ENK A;  3LMM A;  3OYD A;  3OR1 C;  3FM3 A;  4TV7 A;  1ON1 A;  2DA6 A;  2OBP A;  4G94 A;  4ENN A;  4MHG A;  2R5Y A;  1XS9 A;  3WOD F;  2VE9 A;  5ED4 A;  3U1D A;  1OCR H;  2R7X A;  4HV5 A;  2QSH X;  1W5T A;  2X6Y A;  1ZYR F;  2Q2E A;  4XKB A;  1C0W A;  4A0Z A;  3O8G A;  2KRC A;  1NH3 A;  3PNV A;  4I0B A;  4RDU A;  3BRO A;  3V7R A;  2LRD A;  3L2C A;  1A31 A;  4A3K J;  1K61 A;  1BW5 A;  3PNT A;  5JHU A;  2XGC A;  1B1B A;  4MEY F;  1J9I A;  4BKX A;  2VXZ A;  1QZY A;  1YRN B;  5J4V A;  2GIV A;  2QCO A;  1AWC A;  5C44 J;  1JGG A;  1I27 A;  4XLH A;  4BEH A;  2LR8 A;  5EEH A;  1R23 A;  3BG7 A;  2ID3 A;  1IW7 F;  3K1N A;  3WU1 B;  1REP C;  2YSR A;  3JSO A;  2XAQ A;  4RB0 A;  3OYL A;  3MN2 A;  2BW3 B;  1VQL I;  1B4A A;  5J4Y A;  3HOW J;  2L7Z A;  1O7F A;  3F8B A;  2WB1 N;  1FLI A;  3P5J A;  5FD5 A;  2FE3 A;  4KJZ A;  1VTN C;  4YFX F;  5LRR A;  2CJJ A;  1TW2 A;  3S2D J;  2ETH A;  2JUG A;  1F36 A;  5TJJ A;  2WAD A;  4ON0 A;  2VAS A;  3GEZ A;  3GO5 A;  1Z0X A;  1HXD A;  3M3Y J;  2PI0 A;  3RZO J;  4XNF A;  2WAE A;  3H5N A;  5JI6 A;  3D0S A;  4AM3 A;  3H9Q A;  1ZRC A;  1OPC A;  4N4O B;  1DUX C;  2COM A;  1U8R A;  2AXT C;  2LKP A;  5K7Z A;  3I53 A;  2BOL A;  2V26 A;  4JQF A;  4DJA A;  2O03 A;  3CC7 I;  2Y0M A;  2W7N A;  3I3L A;  4C2T A;  5FKK A;  4U7B A;  3HXL A;  3E5U A;  3AG1 H;  3U21 A;  1HA8 A;  1R00 A;  3K0L A;  4PJL A;  2Y9Y A;  4I01 A;  4ZYG A;  1O3S A;  1X58 A;  3TKY A;  5CVI A;  4UUV A;  1LVK A;  2P5K A;  5ILV A;  4BE2 A;  3REO A;  4ZC3 A;  4UVC A;  1P92 A;  1G3T A;  3HZJ A;  3WGG A;  4RLQ A;  3GX4 X;  4PZJ A;  2B9S A;  2ZFW A;  3G2B A;  3HL2 A;  4LG0 A;  4M3G A;  1JKQ C;  2FBK A;  4Z2Y A;  2EIK H;  4NQW A;  4F55 A;  2LLK A;  3GCM A;  2GWR A;  3P9C A;  1RUN A;  2I10 A;  2R7Q A;  2MW8 A;  2BY2 A;  4DBQ A;  2PJR B;  2ZME C;  3B6A A;  3ZQC A;  4E7H A;  3BQZ A;  3BLY A;  4OIR F;  4QWQ A;  1DPU A;  2IGO A;  3L2R A;  3PIO F;  3ZQL A;  4K2E A;  2FNP A;  3W3C A;  2YU3 A;  2DN0 A;  2IGK A;  2JK3 A;  2XIG A;  4G7O F;  1T39 A;  2DT7 B;  3DXJ F;  1MZB A;  1N78 A;  3IUO A;  1B9N A;  3ASN H;  2GM4 A;  2HDW A;  5M3F J;  2WTE A;  1R7J A;  1KYW A;  3GBG A;  3BOQ A;  1R5I D;  3ZRG A;  5DTD A;  3SXY A;  2JVH A;  2FSW A;  2ZFU A;  5BPD A;  1A6I A;  3HTS B;  1NK2 P;  5DCF A;  2NS8 A;  3PSF A;  1IG7 A;  2P5V A;  1LEA A;  1Z77 A;  2MSY A;  3ZMT A;  3KP2 A;  1XGS A;  3R0A A;  3S2W A;  1YJ9 I;  4L18 B;  3BTC A;  4HPQ A;  2HYF A;  2VQG A;  4OIN F;  4LGW A;  3R6S A;  2IA0 A;  2WV1 A; 
#chains in the Genus database with same CATH homology
 4S0H B;  2R92 J;  1H89 C;  1ZGW A;  2M2E A;  3CMY A;  1A5J A;  5EZG A;  5E3M A;  3LSP A;  5EEA A;  2L7F P;  3Q3S A;  4UUS A;  1BA5 A;  1ETX A;  4G12 A;  5F27 A;  1VFC A;  3K2A A;  2R5Z A;  3RQI A;  3DEW A;  1ETY A;  2FQ4 A;  3W6V A;  1B8I B;  3Q0V A;  2FJ1 A;  4A3L J;  4XIC A;  3I4M J;  4DZJ A;  1D5Y A;  3BR6 A;  4I76 A;  3JRA A;  2QF7 A;  1OJL A;  2LK2 A;  1U9N A;  1NK3 P;  4JX5 A;  3B6C A;  3JRC A;  5F08 A;  2NOG A;  3OIO A;  1FTT A;  3Q0U A;  2DMT A;  3QPS A;  3JRI A;  3IH4 A;  4A3G J;  1GV2 A;  1JUM A;  4JX6 A;  4X1E A;  3HM5 A;  2AHQ A;  1MBG A;  5FLM J;  3E7L A;  3F0C A;  3GTQ J;  4A69 C;  3IV5 A;  2LFB A;  1QVT A;  1E3O C;  3UKG A;  1ETO A;  2VI6 A;  4AYB N;  3MVP A;  4IHX A;  4AUX A;  1GVD A;  4A3J J;  3HEF A;  4FE4 A;  2HOT A;  3VPR A;  2K40 A;  1MBE A;  1W0U A;  2XPU A;  1JTY A;  1XC5 A;  1ZTR A;  4XK4 A;  3LSG A;  5EG0 B;  4L5E A;  3HBL A;  2XB0 X;  3A01 B;  2X6O A;  3WHB A;  2GLO A;  3OOU A;  4RBO A;  2NVX J;  2R7Z J;  3JR9 A;  3D1N I;  3BR1 A;  1R9T J;  3IH3 A;  2H1K A;  2E1O A;  1P7I A;  2ID6 A;  1WCM J;  3FIW A;  4UUT A;  3HB9 A;  2M8G X;  2DA1 A;  2DA2 A;  2M0C A;  1PUF B;  4A3E J;  1BJZ A;  5E3N A;  1I6H J;  1ENH A;  3JRB A;  3Q0W A;  4M3D A;  3G1M A;  2XPW A;  2ELK A;  2N8G A;  3GTM J;  5M5W J;  5K7H A;  1CQT A;  1ETV A;  3BTI A;  2Y31 A;  1B8I A;  2ME6 A;  1HCR A;  1JJ8 C;  4D7M A;  5IP6 A;  2P81 A;  4HNV A;  3JRF A;  1Q1V A;  4C3I J;  1Y1V J;  2XB5 A;  4D5F A;  3SFI A;  1APL C;  2K9Q A;  1F43 A;  2EBI A;  1ORK A;  5IP7 J;  4D7N A;  3CCY A;  1JKO C;  5GPC A;  3O8H A;  3TW7 A;  1B72 B;  3HGY A;  1MNM C;  3S1M J;  3SDG A;  1IGN A;  2L0K A;  2COB A;  3LSJ A;  2D5V A;  4CYC B;  3ZOB A;  5FKM A;  1DU0 A;  2CRG A;  3G1O A;  4FE7 A;  5K7F A;  2FX0 A;  5F1J A;  2HI3 A;  1ZR4 A;  2R93 J;  2X9D A;  3H0G J;  5EG0 A;  1ETQ A;  2VUM J;  1GT0 C;  1FIA A;  5J1R A;  2JA8 J;  3A01 A;  2Y30 A;  5FLV A;  1IDY A;  1K83 J;  1RR7 A;  3ZQF A;  3S14 J;  2Y9Z A;  1U8B A;  2LP0 A;  4BY7 J;  5F0H A;  1VND A;  4IHY A;  3GTP J;  2L9R A;  1POG A;  3FKI J;  3OSF A;  3HOZ J;  3S1N J;  2E2H J;  3GTK J;  1GUU A;  3LSR A;  3WHC A;  1JTX A;  1PUF A;  2K9N A;  4IHW A;  2HOS A;  5BNG A;  3CDL A;  5FKN A;  3NAR A;  4M3E A;  1GDT A;  1BL0 A;  2OF7 A;  2TCT A;  2LD5 A;  2FD5 A;  5EDN A;  3OSG A;  3S1R J;  2G0E A;  3A03 A;  1TWH J;  1SFO J;  2MG4 A;  2LY9 A;  5EZH A;  1MSE C;  1QRY A;  2E19 A;  1LFB A;  3BR3 A;  2LTP A;  3BT9 A;  5J3L A;  4ABZ A;  5IOZ A;  2HYJ A;  1AKH B;  2O7O A;  1FEX A;  1HOM A;  1JUS A;  2HOA A;  1B72 A;  3HOU J;  2DA7 A;  2O9L A;  5F04 A;  2XGE A;  3FK7 A;  3IH2 A;  3BG3 A;  1HDP A;  2JMW A;  4CYC A;  2PMZ N;  4QSH A;  1X2M A;  3GTJ J;  4A3I J;  3BR0 A;  4FTH A;  3PO2 J;  1WI3 A;  3BG5 A;  3RZD J;  1LFU P;  3MKL A;  3FK6 A;  1MSF C;  2IEK A;  2DJN A;  1FIP A;  5EYR A;  2E2J J;  2XPV A;  3L1P A;  3I4N J;  2JJ7 A;  2VPR A;  1IC8 A;  3S2H J;  2O8K A;  2DMP A;  3C2B A;  3PM1 A;  1AU7 A;  5IPA A;  4XRM A;  5EGO B;  2JN6 A;  4M3B A;  1W0T A;  1X2N A;  1IRZ A;  2H8R A;  1T33 A;  3BTJ A;  2DA5 A;  3NAU A;  5M5X J;  2EQR A;  3GTL J;  3ZQH A;  2DA3 A;  4A3D J;  1MBH A;  3LOC A;  2R0Q C;  5IOY A;  1TWF J;  1TWA J;  2VKE A;  2X48 A;  2R5Y B;  1MBK A;  3JRD A;  4I6Z A;  4IEJ A;  5C4J J;  2ECB A;  1H8A C;  1TC3 C;  4BBR J;  4DYR A;  2YU9 J;  4X6A J;  2EH3 A;  1FTZ A;  4MFE A;  4C2M J;  5JLW A;  3M4O J;  4QIW N;  1SAN A;  3HOV J;  4BBS J;  2AO9 A;  3TP3 A;  4J19 A;  1UHS A;  3QQA A;  2DMU A;  5J1U A;  4A3M J;  1HDD C;  4C3H J;  1VI0 A;  3JRH A;  5F0C A;  2KT0 A;  3DCF A;  2HXO A;  2ZB9 A;  2VKV A;  1AKH A;  1RKT A;  4Y52 J;  2CQQ A;  3HKZ N;  1ETK A;  2ECC A;  1JUP A;  4W1U A;  1DU6 A;  4FIS A;  3LNQ A;  5GPA A;  2EZL A;  3TW6 A;  2HQ5 A;  2NS7 A;  2CUF A;  1RKW A;  4V2F A;  1GV5 A;  1WH7 A;  1MBJ A;  3GTG J;  1P7J A;  3BR5 A;  4GFB A;  2YUS A;  1HF0 A;  5IP9 J;  4V2G A;  2JA6 J;  2HXI A;  2K9S A;  3JRE A;  4XRS G;  1JT6 A;  4D5C A;  5EGO A;  2KDZ A;  3HGG A;  1OFC X;  2CUE A;  1JT0 A;  4JX4 A;  2B63 J;  1G2H A;  2JA5 J;  3ZQG A;  1RPW A;  2DA4 A;  3BTL A;  5IYC J;  2XRL A;  1IUF A;  1S7E A;  2RAE A;  3HOX J;  2MGQ A;  5F0F A;  2DA6 A;  2R5Y A;  2EZH A;  3BQY A;  1XS9 A;  3GTO J;  2W48 A;  4JYK A;  5FKO A;  1U78 A;  1TWC J;  5IYD J;  3O8G A;  2IAI A;  5C4X J;  4RDU A;  5J1Y A;  2CU7 A;  4A3K J;  2DMQ A;  1K61 A;  1WPK A;  1BW5 A;  5IYB J;  2LKX A;  2NVT J;  2XGC A;  2XSD C;  4JP0 A;  3RKQ A;  3FIS A;  4BKX A;  4DYC A;  1YRN B;  4A3C J;  1MBF A;  2QCO A;  5C44 J;  1JGG A;  4LOC A;  1OCT C;  2HDD A;  1JKR C;  9ANT A;  4DW6 A;  1LE8 B;  2LR8 A;  1WH5 A;  2ID3 A;  3JRG A;  2TRT A;  3S15 J;  1I3Q J;  1O4X A;  4XRS A;  3HOY J;  3MN2 A;  2JWT A;  3TP0 A;  4BY1 J;  4B3A A;  1BW6 A;  2L7Z A;  1IV6 A;  3HOW J;  1IDZ A;  2WB1 N;  4B1R A;  3HDD A;  3SJM A;  2CQX A;  2CJJ A;  4C3J J;  3S2D J;  2EZK A;  1F36 A;  5E3O A;  3S16 J;  2XGD A;  2OPT A;  1HLV A;  5E3L A;  4BXX J;  1Z0X A;  2M9H A;  3H3V K;  1MH3 A;  3M3Y J;  3RZO J;  5M3M J;  2Y0S N;  2GBY A;  2DTZ A;  2WAQ N;  5HOD A;  4A3B J;  4FCY A;  5GP9 A;  5K7Z A;  4Y7N J;  1RET A;  1NTC A;  4MIM A;  3S17 J;  1IJW C;  4DYQ A;  1QPI A;  3BG9 A;  5FKK A;  2LVS A;  4QTR A;  3A02 A;  4MFD A;  3TED A;  2Y2Z A;  2Y9Y A;  4IHV A;  1X58 A;  2ME0 A;  1VF9 A;  3ZQI A;  4DZP A;  5DS9 A;  1YRN A;  4MLO A;  1TWG J;  1RES A;  2IBD A;  3QPL A;  1UMQ A;  2E2I J;  1LE8 A;  1T56 A;  1H88 C;  4A3F J;  4UUS B;  5C3E J;  2YS9 A;  5FJ8 J;  3K7A J;  2DMN A;  4M3G A;  4MO7 A;  1JKQ C;  2R5Z B;  2JA7 J;  1U9O A;  2LLK A;  2I10 A;  1XG1 A;  1ETW A;  1JKP C;  2MW8 A;  2L7M P;  3B6A A;  3PO3 J;  3ZQC A;  3S1Q J;  3BQZ A;  1MH4 A;  3CQZ J;  1ZQ3 P;  1QVU A;  1I50 J;  3ZQL A;  4B4C A;  2DN0 A;  2JK3 A;  2M34 A;  5FKL A;  1OCP A;  4AC0 A;  2GM4 A;  5M3F J;  1WGX A;  3G1L A;  4M3F A;  5JLX A;  1EF4 A;  1ZK8 A;  3GBG A;  5DTD A;  1UG2 A;  2NVQ J;  1ZKG A;  2NVY J;  1ITY A;  4NDL A;  1A6I A;  1Y1W J;  1NK2 P;  2NS8 A;  4EEF G;  1IG7 A;  1JJ6 C;  1Z77 A;  1FJL A;  1AHD P;  2MSY A;  3BR2 A;  5M5Y J;  1ZR2 A;  3BTC A;  4XID A;  2EZI A;  4W97 A;  4A93 J;  4M6V A;  2WV1 A;  5EF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...