3BOQA

Crystal structure of marr family transcriptional regulator from silicibacter pomeroyi
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
136
Chain Sequence
b'KSDRQQNQTRLWLNILRLHGLVFGDLNRQLLDETGLSLAKFDAMAQLARNPDGLSMGKLSGALKVTNGNVSGLVNRLIKDGMVVKAFSAKLTDAGLTTFKQASEAHNRILAELLRAVSDQDMVEASAALRGILESM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structure of MarR family transcriptional regulator.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription regulator
total genus 43
structure length 136
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3boqA00
3AAFA 2Y48A 2K7LA 2RGVA 4I0BA 1LDDA 4Q5SF 2M1BA 3S2WA 5FLXK 4UV8A 3VFZA 4M74A 1ON1A 4R79A 4AIKA 2FNAA 4CYDA 4HA8A 5E1XA 4HOBA 4M73A 4MQVA 1R7JA 4O5VA 2W57A 2IJLA 2HQRA 3L09A 2CQKA 3MFKA 3TQNA 2P5KA 2XKPA 1I27A 4MGRA 1XGMA 3KP3A 3F72A 1FP1D 3K1PA 1WI9A 2CW0F 4XSXF 3TGNA 3ZMSA 4L9TA 4LD5A 3EUHA 4GCVA 3GFJA 1F9NA 1K7AA 4Z2YA 4KICA 3QP6A 3DF8A 3N4MA 3VOEA 4KMUX 1Z6TA 3KFWX 1V4RA 3JTGA 2QM3A 3QRFF 1TW3A 4EJVA 4L0ZB 1R00A 3I64A 2NRAC 4CHUA 3M8EA 1QZZA 3GVAA 3SZPA 4P55A 5J8FA 1G3WA 3KETA 3FMRA 4MQ9F 3HRMA 1GHCA 1TW2A 1ZRFA 4JQFA 2A68F 2GQQA 3FXRA 3J80K 2EV5A 3CUQA 5E8GA 5IT9K 4A12A 1RUOA 2G9WA 4FT8A 3WTWC 2H6BA 1D8KA 3GF2A 3HRSA 3GXOA 2ETHA 3W6JB 5D5XB 3C1DA 3F8MA 1Y0UA 1HW2A 2VE8A 2QBYA 2Q0OA 3DXJF 5E18F 1S7OA 3ZPLA 3BJOA 2P5LC 5L3GA 4KA4A 2UXXA 1ONVA 4L9NA 3QPHA 2KJBA 4EM1A 1P6RA 3FF5A 5AIPA 2VE9A 4YG2F 5HS7A 2L54A 5H6QA 1RZ4A 2Z3YA 1YG2A 2PBIA 1YTYA 3EETA 1ZG3A 1P4XA 5E17F 2YPRA 1U5TA 2ZFWA 2JT1A 1ZLJA 3TO7A 4ZYEA 5D5WB 3QU6A 5CJ9A 3SFZA 3F3XA 3IWFA 4U7DA 3ZN0A 1QPMA 1W5TA 4LLLA 3BROA 5EEGA 4KMFA 2LF8A 3H92A 5L3DA 1FSHA 4IJAA 1FYKA 2PMUA 3ZN1A 3JSOA 1R23A 2BBYA 2HYGD 1B9NA 2HTSA 3COAC 1XN7A 4HW0A 4QLCU 3RIRA 1HW5A 2XAHA 2FU4A 5HDGA 3VEPA 2HS5A 3TO6A 1ZHFA 2RN7A 2L4AA 4PCQA 1LB2A 3KE2A 2E7XA 4KNYA 1O7LA 1VTNC 3C18A 3HHHA 4O6JA 1HSTA 4EVIA 2VN2A 1T98A 2DI3A 1QGPA 2PG4A 4BXUA 2EFOA 1R58A 3JAMZ 3CO6C 1PUEE 1OYYA 3RKXA 2HKOA 5LRRA 2ESHA 1TQMA 5TRDA 1KQ9A 2COMA 1PP7U 2EA4A 1D5VA 1OR7A 3GFLA 1O7FA 1CF7B 5CVUA 3T5XA 4GYIA 4YFKF 1BI2A 2YX7A 2FRHA 1R1VA 4U0YA 2GWRA 1PP8F 4ZZDA 2JSCA 4A0XA 1W7PB 1LDJA 4E70A 5D5VB 5E8IA 1U2WA 3F21A 3K1MA 1HQCA 2MBFA 3O6BB 2W84A 3GO5A 2DU9A 4PDKA 6PAXA 1B4AA 2XAQA 2DO7A 2VXZA 3HSEA 3F8NA 2QQAA 3MAJA 4TV7A 4LG0B 5BPIA 3H3ZA 4GGGA 4CGZA 3DV8A 1ZLKA 3HHGA 2LDUA 2VOOA 3E6MA 2A07F 2FF4A 5EEHA 2VBZA 1FSEA 4YFNF 1XCBA 1IXCA 5HOOA 4HQMA 4KYWA 2FBIA 4KIFA 4R1HA 2XVCA 2ZCWA 4S04A 2BYVE 4LLNA 2XAFA 1S6LA 1C0WA 1U5TC 1W4MA 3GUDA 4R8HA 3R60A 3D0SA 4WX9A 1U6GA 2FBKA 3J7AO 3BP8A 2A61A 2X4HA 1KU2A 2F5EA 4IHSA 3WE2A 3IHUA 4P96A 3T8RA 4ON0A 2ZKZA 3M8FA 3REOA 3L9FA 5BOXA 3J81Z 4MEYF 2P4WA 5FLXZ 1BN5A 1R1UA 2W85A 3HUGA 1HXDA 2BV6A 5LBQA 5KVRA 5K5RA 3BJ6A 4OINF 4PZJA 2EFQA 2V6CA 3K0LA 3HTSB 2PMHA 3TKYA 2P7CB 1GVJA 4CXFA 2QLZA 3RYRA 2FSWA 5DUIA 4RGXA 5DV5A 2RVCA 3U1DA 3G73A 2O0YA 4LFUA 3V7RA 3NQOA 2HR3A 3FM5A 2KIMA 4BAYA 1ZG5A 2PJPA 1IRGA 5CYVA 3LQQA 1YO5C 4BHBA 1XGNA 2K4JA 4ZYHA 4A0ZA 1YS7A 1BI0A 2HEOA 1FYMA 3FX3A 1R36A 1FP2A 3F6OA 2DBBA 2D1HA 1T6SA 1J0RA 5E1ZB 4AIHA 3HYIA 3R6SA 3I71A 3J80Z 2QUFA 1ZREA 5IT9Z 1GXPA 1GXQA 1FOKA 3GLXA 1IXRC 2O8XA 2OQGA 1ZARA 2AS5F 4M9SA 2FEZA 3F6VA 1HW1A 4HYEA 3U2RA 3KCCA 5D6FA 3QPTA 2EA2A 5KK1A 2EB7A 4XRFA 3DFGA 2NNYA 4ZZLA 3BPXA 2HGCA 2NAZA 1WSUA 4L18B 4BHCA 3NRVA 1QBJA 1JHHA 1OPCA 3DP7A 1EH8A 1DUXC 4I0AA 3ZMDA 3KP5A 1SAXA 2P8TA 1XMAA 1F5TA 1G6NA 2XKOA 3IRQA 3LAPA 2IW5A 1AOYA 2K27A 2L3DA 2DAOA 3WTSC 3J81K 4B8XA 2WV0A 2OBPA 4XBFA 2GXBA 2IPQX 3KZYA 3GFIA 1HKQA 4P9UA 1SD4A 5ERIA 4K2EA 3ERED 5F64A 2KKOA 4RAYA 5JHUA 2L02A 3ZMUA 5D8KB 1G3SA 4G9YA 2XHKA 3LSTA 5FB2A 1YLFA 2VODA 4OIOF 4Q4ZF 3RI4A 3ABTA 2ADUA 1BOAA 2M5WA 4Y17A 2GIVA 5J8CA 2DQRA 2STTA 4EM0B 2LKPA 4KIGA 4EMSA 3PQJA 2LNBA 1B59A 4U0VA 1Z9CA 1S8NA 2EJRA 2P6SA 3WTVC 3I59B 5ED4A 4OOIA 1DDNA 4UXNA 4G7HF 2X0LA 1ZG1A 1FBUA 2CO5A 2H6CA 2FMLA 4L5JA 5HS9A 2KRFA 2DK8A 1FYLA 1OYWA 1Z1DA 1KQ0A 4I98B 1KGSA 5HS8A 5HLGA 3RJPA 3M1EA 3VODA 3WTZA 2YSRA 4HZFA 1MGTA 2ZMEB 3P9KA 3LFKA 2BE5F 1P4WA 1IN6A 3T1BA 4UVCA 3CJNA 3KP4A 2V1UA 2HZTA 1LVAA 1USTA 1XSXA 1B1BA 5DDGA 4N9IA 3BJAA 5F6FA 4XLNF 4EQQA 3L2CA 1BC7C 3I4PA 3V7SA 2P7VB 2GAUA 2B0LA 5D6EA 5L3EA 1FBQA 3DQVC 3ZMTA 1P92A 4WCGA 4HV5A 2E7WA 4FX4A 1L3LA 3ECOA 1KYWA 4RGUA 4FX0A 4GXOA 1K78B 2F5FA 3O3KA 2F5CA 4LMYA 2PN6A 1KU9A 2ELHA 4WWCA 2Y75A 1KYZA 4MTDA 4EGZA 3E6BA 1O3QA 2ISYA 2FQ3A 3P9IA 3V7CA 2RC4A 4M9ZA 5AONA 3HIFA 3WTUC 2O6GE 5LLQA 3GYHX 1R5GA 1FZPB 1UB9A 2CYYA 2Z9OA 2IA1A 3JSPA 1HSJA 1YYVA 5CVJA 1WQ2A 1FC3A 1B9MA 4MTEA 5FO5A 2J5OA 3Q9SA 3ELKA 2IRFG 4NHJA 5HVQC 4HV6A 1XSDA 4UUVA 2JTVA 4ENKA 5CVVA 1W7PD 5L3CA 2L4MA 3T0YA 3E5QA 3I59A 3F23A 1J2XA 1SFUA 1EH6A 1I6XA 4OIQF 4ESBA 2VBXA 2A69F 1IW7F 3BDDA 1ZH5A 5K5OA 2R3SA 1USSA 2OD5A 1O57A 4MEXF 4YIFA 4OU0A 1KU3A 2JPCA 4DNCA 2EV6A 5LGTA 1S7AA 2EV0A 2Z5UA 3CTAA 4UNOA 2IT0A 3LAJA 2BEOA 1LDKB 4G7OF 5ICEA 5CLSA 4G8XA 3VB2A 4ZH4F 4U0WA 5FD5A 5HDKA 3HTUA 3RTRA 4EJOA 2VC0A 4MHGA 5H6RA 4IRIA 1TQIA 4HDVA 4LGWA 2K4BA 5CVIA 1MKMA 3SXYA 1LEBA 4M71A 3F8BA 3JTHA 4YIIA 3CUQC 5BS6A 3ZMZA 4ZYGA 1JGSA 4BH9A 1QNTA 2DTRA 4LK0F 3FXQA 1EV7A 4UVAA 1K78A 4FHTA 4LB5A 3F8CA 3RDIA 2JPBA 2FBHA 3HRUA 3PQKA 2RQPA 3KLNA 3TOBA 2A3SA 2QENA 2EWNA 4UV9A 2MH9A 1B6AA 4ENMA 4GO1A 2P6TA 5DEQA 1L0OC 1IN7A 4AVPA 1D3YA 4IVNA 1T38A 1REPC 4G7ZF 3WODF 3V4GA 5LRSA 1AWCA 3K69A 4Q47A 2F5DA 3WGIA 2PLYA 1IF1A 1FX7A 2Q2EA 3EYYA 2IVMA 1LJ9A 3IKVA 5ICGA 5ILUA 5ICCA 3C7JA 4NB5A 5F1RA 3KEQA 2Q8KA 1R5HA 2EK5A 2MLKA 3R0AA 2A5YB 2QYOA 1S3JA 1XCVA 2NNNA 5JVTA 3ZP5A 3NEUA 2OAZA 5L3BA 4HF1A 2VBWA 4EJTA 4PGHA 5DUKA 3DKWA 3BWGA 5K5QA 2GA1A 1P2FA 2RNJA 3WGHA 5H20A 1KA8A 4G6DA 1OYIA 4P5OA 3RPUA 5ICFA 3I0TA 2Z99A 2FNPA 4IXAA 2BGCA 2TDXA 2HTJA 1F1ZA 2FMYA 5J6XA 5DCMB 3IL2A 4XSZF 1KU7A 3MZHA 1XB4A 4EM2A 4HX4A 4QWQA 2JZYA 3B73A 2KIFA 2RKHA 3FHZA 4N0BA 3FZVA 1H9TA 3Q5FA 2RV8A 3KEOA 1CF7A 4JBAA 3CDHA 2STWA 3WGGA 2O03A 1Z7UA 3N97A 4OIRF 1JE8A 5D5UB 2VONA 4KN7X 3QAHA 2V9VA 4MNUA 2MD5A 2VT2A 5LGUA 5FD6A 1UHWA 1W7PA 3KP6A 4OIPF 3K9TA 5HLHA 1DP7P 1RUNA 4HLXA 5LHGA 1T39A 4U88A 3RKWA 3R61A 2M45A 1BIAA 2V1XA 5A2QK 2F2EA 3GX4X 2AXLA 2ZJ2A 4EJWA 3M9AA 2FA5A 2V79A 2VT3A 1V3FA 3MWMA 4LLGF 3E5UA 2PEXA 2GA2A 4LG0A 3LA2A 4ZYDA 2CGPA 5DD8A 2W24A 4A2UA 1ZN2A 2XAJA 1E17A 3MCZA 1SMTA 3MEXA 1FT9A 3HSRA 4Y13A 3ISPA 1EH7A 4XLPF 5BPDA 2ESNA 2XASA 2CFXA 1ZRDA 1DPRA 2JRTA 3HOSA 4ESFA 2H27A 1UCRA 2QBYB 5D8LB 4HLYA 1BM9A 1D8JA 1I1GA 1Z91A 4B09A 4RAZA 5ILVA 3LA7A 4WK8F 3FXUA 5L3FA 3KLOA 3E97A 2ZBKA 4OMYA 2FOKA 2DFIA 4N9HA 5K1YA 5FGMA 1RI7A 3W6KB 3DPLC 2HDCA 5LHHA 1FNNA 3CUOA 3TO9A 4IPAA 3E6DA 3SZTA 1U5TB 3IC7A 3K2ZA 4RB3C 1F4KA 4Y15A 2NYXA 1XMKA 3QOPA 5DCMA 3RPQA 3IWZA 3BY6A 1FBSA 3WTXC 3EQLF 5DD4A 1ZGJA 2IA2A 3SQNA 3R0JA 3OOPA 2L01A 4OMZA 3ROUA 3IRRA 2CWEA 1H0MA 1WKMA 4BHPA 4HBLA 5JFRA 4RGRA 2QQBA 1ON2A 2HOEA 3LA3A 3LQRA 1IRFA 5D4SA 1J5YA 2MA3A 1YIOA 1T2KA 2O3FA 4KIBA 2CSOA 3TDUC 3V8JA 4KT5C 2A6HF 2HQNA 3KP7A 2K86A 2ZO4A 1J9IA 3BPVA 1MD0A 5HLIA 4ETSA 2K02A 1ZRCA 1RIOH 1YW7A 4CZZA 3E5XA 1UFMA 5LEJA 3JW4A 3QP5A 1TLHB 4I2OA 5TJJA 1BI1A 4S05A 1HKSA 4WF2A 2LSOA 1K79A 1W5SA 3WTYC 3HOTA 3DPTA 1PDNC 3DEUA 1FY7A 4CICA 1T0FA 3ZMVA 1A04A 4WXHA 3ULQB 1XGSA 2PI0A 1O3RA 2XAGA 3QU3A 2ACJA 2G7UA 1S29A 2Z33A 4IHTA 3SHFA 2D45A 5AIQA 1IN4A 3G3ZA 1KQ8A 3BOQA 1QZYA 1RNLA 5HDNA 2HWVA 4HQEA 1Q1HA 2EFWA 3I54A 4JK1X 3GZ5A 3V8KA 4RS8A 1MJBA 4ENJA 3EYIA 3L00A 3RKYA 1IN5A 4ESJA 4HX8A 4WXDA 1SMYF 1MJAA 5FFZA 3ECHA 2M87A 3MQ0A 2HFHA 2RDPA 2OU2A 5E20A 3WTTC 3Q9VA 2D2WA 4U7BA 1G3TA 3FMQA 4UVBA 4L9VA 3E6CC 3L7WA 2D1VA 2YX4A 2CG4A 1O3TA 4HF2A 2V1DA 2FXAA 1ZYRF 1BIBA 3WU0A 4A6EA 1IUYA 4D0PA 2WWYA 4KDPA 4L9JA 2QVOA 2J5PA 3T8TA 3RYPA 1OMIA 3B02A 1XDSA 4A0YA 1WRJA 2DLLA 1UHMA 1YW9A 2WC2A 3C3WA 1SD5A 4I09A 3O2PE 2C6YA 1DPUA 2MC3A 3FWEA 2EFNA 3GWZA 1U3EM 2ZXJA 3ML6A 2OZ6A 2IA0A 4YFXF 1E2XA 1MZBA 5LEKA 1CGPA 2W25A 2ZMEA 4L5IA 4A5NA 1QO0D 2UXNA 1HKTA 5CVRA 1MJ9A 1J7KA 3P9CA 1IZ1A 2LF7A 5IT3A 4HX7A 2DQLA 2ZNYA 4AWXB 1YS6A 3ABUA 1TNSA 1LNWA 2OA4A 4LK1F 4DQ2A 2GXGA 2XRNA 1JXSA 5JI6A 2XIGA 4HDUA 1XGOA 4M72A 2GZWA 4RB1A 3U9GA 2FE3A 1BC8C 5A2QZ 4O3MA 5DYMA 2ISZA 4G6QA 2YR2A 5D4RA 2XUBA 4M6YA 4GYGA 2UWMA 2H09A 4LB6B 3IKTA 3KZZA 1YFHA 2HYFA 3CLOA 2VOPA 2DPDA 4EJUA 2NS0A 1STZA 2M30A 4UHTA 3TDZC 4L0YB 5ILSA 1G4DA 4G94A 4I02A 3CO7C 3OV8A 1XD7A 1I1SA 3GFMA 1P4AA 1MDMB 3I5UA 1FWZA 1J75A 4AD9A 3LWFA 1YW8A 1K6OA 2QWWA 1R1TA 1IAWA 2PQ8A 3M7GA 1ZGAA 2PFBA 1TQPA 2XGXA 1LEAA 4IRHA 2MLGA 2G7HA 5DCFA 3P7NA 1TTYA 1BI3A 3WG9A 1J59A 5BQTA 2O61A 4HAMA 2DK5A 3E3VA 3H3UA 4IF4A 3F8FA 4A5MA 4A6DA 2QZ8A 1BBYA 4BYYA 1BJAA 1NHAA 3D5LA 4CDGA 4ASNA 2UZKA 2OZUA 1Z05A 1LQ1A 2IP2A 5LHIA 3HRTA 3EDPA 3R4KA 4KUMA 3I53A 3WU1B 1YQAA 2VBYA 5LGNA 5JR3A 1SFXA 3FM3A 1R22A 2QQ9A 2KJCA 4I7HA 2XV4S 1FLIA 1SD6A 3KP2A 1TNTA 2EFPA 2Y0MA 4Q48A 1X3UA 2A6EF 3JAMK 1ZAOA 4KN4X 4LJZF 1O3SA 2E1NA 1WWXA 4CO8A 3BZ6A 4I01A 4EGYA 4M6XA 4KFCA 4BQAA 3I58A 4BNCA 4H0EA 1SD7A 4P9FA 4NQWA 2DW4A 4PGGA 1IXSB 2R7FA 1XSVA 4HF0A 1H9GA 1HBXG 1QQIA 4RGSA 2DT5A 2P5VA 2ZNZA 4ENNA 3HSFA 5FFXA 2E1CA 1G3YA 3ZQ7A 1I5ZA 2WTEA 3CUQB 2KIUA 2OQRA 2H94A 2YU3A 3K1NA 2XROA 3GEZA 4M9XA 1SFEA 1U8RA 2MH2A 1FPQA 3FMSA 1MDMA 3V8LA 3GZ6A 4RB0A 2VC1A 1XDUA 3F22A 1Z6RA 4WXCA 1IN8A 4AIJA 1U78A 4F7ZA 1ULYA 2M8EA 1ODDA 1OKRA 4EV0A 2DPUA 3PFIA 5E1WA 3WE3A 2R7DA 3TOAA 5BMZA 4RB2C 1JHFA 1TBXA 4IRGA 3MZYA 2HKXA 3GW2A
chains in the Genus database with same CATH superfamily
2IGMA 3AAFA 1ETQA 2Y48A 2K7LA 2RGVA 2V26A 4I0BA 2Q1ZB 4XOTA 1LDDA 4LITA 4Q5SF 2M1BA 2KFDA 1X58A 3F0CA 3S2WA 3W3CA 1DQUA 5FLXK 1Y39A 1NG7A 4UV8A 1IV8A 3VFZA 4M74A 2AO9A 1ON1A 2PMZN 3ASNH 4R79A 4NDLA 4AIKA 1D0XA 3I3LA 1Z3YA 1JKQC 2JSPA 2FNAA 5FROA 4CYDA 2DJNA 1JUSA 2OUMA 4BQNA 1MBJA 2WBMA 4HNVA 2HI3A 4HEA2 2FD5A 1WJEA 2JA2A 4HA8A 5E1XA 4HOBA 4M73A 1N25A 4MQVA 1HOMA 4ZTJA 1R7JA 4O5VA 2W57A 2IJLA 2HQRA 3L09A 3KX2A 2CQKA 1CQTA 2CUZA 3EUKL 3BR1A 2R7RA 3CCEI 2E5ZA 4BEHA 1VQ6I 3MFKA 3QYEA 3TQNA 2ELKA 2P5KA 2XKPA 1I27A 4MGRA 1XGMA 3KP3A 4I99C 3F72A 3DKXA 1FP1D 2E60A 1QVTA 3ESWB 3K1PA 2NVXJ 1WI9A 3CCJI 3PO3J 2CW0F 4XLAA 4XSXF 3TGNA 4F92B 3OYMA 3ZMSA 3SZGA 4L9TA 1X4OA 3EUHA 4LD5A 2KZGA 4GCVA 3GFJA 1F9NA 1K7AA 4Z2YA 4JX6A 4KICA 4M3DA 2DA1A 3QP6A 3DF8A 2W7NA 3N4MA 3OYFA 3HB9A 3VOEA 4KMUX 1Z6TA 5DM6F 3DKYA 4V19K 4ZDOA 1M1EB 4LIVA 3KFWX 4A3KJ 5FKOA 1I50J 1PUFA 1V4RA 3JTGA 2QM3A 3QRFF 2DA2A 1IRZA 1TW3A 4EJVA 5F08A 4L0ZB 5EG0B 1R00A 3I64A 3ERMA 3HBLA 3IH3A 2EZLA 2JJ7A 3W2AA 3K4MA 2NRAC 4CHUA 5FRMA 4CA0A 3M8EA 1QZZA 3GVAA 3SZPA 5J4YA 4P55A 5J8FA 2QA4I 1G3WA 3KETA 3D5RC 3FMRA 4MQ9F 1GT0C 4DYQA 3HRMA 3I4MJ 1GHCA 1TW2A 1ZRFA 4JQFA 2LR8A 2XB5A 2A68F 2GQQA 3FXRA 4EATA 1A6IA 3J80K 5M5XJ 2EV5A 2F5VA 3CUQA 5E8GA 5IT9K 4A12A 2HPIA 2E34A 1OISA 1OCCH 1OCOH 3QOEA 1WZ2A 1RUOA 3VSLA 1UJ8A 2G9WA 1RR7A 4FT8A 3ZQFA 2H6BA 1D8KA 3WTWC 4B4CA 3GF2A 4LG3A 3LMMA 3HRSA 3HOVJ 3GXOA 2HXOA 2Y69H 1YJNI 4CCJA 1K4TA 2ETHA 3W6JB 3LSIA 5D5XB 2EQRA 3C1DA 2VB6A 3F8MA 3S8PA 3H3VK 3S93A 2E2HJ 2L5QA 1Y0UA 2LC2A 3CLQA 5FKKA 1HW2A 2VE8A 3G1OA 2Q0OA 3DXJF 1Y1WJ 1JJ8C 2QBYA 5EZHA 5E18F 3GTJJ 2L7ZA 1S7OA 3ZPLA 3BJOA 2VPLA 1X4PA 1RC9A 1RPWA 2VKHA 2P5LC 3BG3A 3K4KA 3I4NJ 5L3GA 3NWSA 1UELB 3BTJA 4KA4A 4CCKA 1IRXA 3CCVI 3MKYB 4AUXA 2EIMH 2UXXA 1GDTA 2LKSA 2AQEA 2G0EA 4HNUA 1ONVA 4L9NA 4BJ6C 1D1BA 3QPHA 3GTOJ 1N77A 1IDYA 5C3EJ 3PL8A 3H0DA 2VJIA 2M4KA 1AKHA 2KJBA 3VYTB 4EM1A 1P6RA 2AXTC 3FF5A 2K85A 5AIPA 5FKNA 4GFBA 1V54H 2VE9A 4YG2F 5HS7A 2L54A 5H6QA 5FJ8J 2OTJI 1RZ4A 2Z3YA 1YG2A 2PBIA 1YTYA 4ZDLA 1OCZH 3PUFA 1Z21A 1RRJA 2NVQJ 3EETA 1ZG3A 1P4XA 3OYBA 2FQ4A 2OF7A 2YPRA 5E17F 1U5TA 3HPGA 2ZFWA 2JT1A 1ZLJA 3TO7A 4KT6A 3Q0UA 3KEYA 2QGUA 4ZYEA 1ZK8A 5D5WB 3QU6A 5CJ9A 2JA6J 5LD2C 3SFZA 3F3XA 2CW8A 3E7LA 3IWFA 4QPOA 4U7DA 1N78A 2JUCA 3GBGA 3ZN0A 2R7SA 1YX5A 1QPMA 3C2GA 1W5TA 1V5GA 1WGXA 2LY1A 4LLLA 5HNHA 3AL0B 1MNEA 4C30A 3BROA 5EEGA 4DJAA 3IH2A 4KMFA 2LF8A 2Q2EB 2JMWA 3H92A 5L3DA 1FSHA 1VZ0A 1X1CA 5EF6A 4IJAA 2KMUA 1FYKA 2PMUA 4IHYA 2HDDA 4NBQA 3ZN1A 3JSOA 1R23A 4S0HB 2BBYA 5F04A 2HYGD 1B9NA 4AM3A 2HTSA 2Y2ZA 3COAC 1XN7A 3WG7H 4JOMA 1MMGA 3AG3H 3HOWJ 4HW0A 2D5VA 4MIMA 4QLCU 1T8IA 1WJAA 1MNDA 3RIRA 1HW5A 1VFCA 2R93J 2XAHA 3L2UA 1FMVA 2FU4A 3BR6A 2UV1A 3MN2A 5HDGA 4PSWA 2CUFA 2IXSA 3FBNB 2L9NA 3VEPA 3OMYA 2HS5A 3MVPA 3TO6A 4IHWA 1ZHFA 2RN7A 3HUGB 2BY3A 2X6OA 4J00A 2HVQA 2L4AA 2I8DA 4PCQA 5TGTA 1LB2A 3KE2A 1YRNB 2E7XA 3K4LA 4KNYA 1O7LA 1VTNC 3C18A 3HHHA 2R5ZA 4O6JA 2H1KA 3VYSB 2UUZA 4MFEA 1HSTA 4EVIA 4XM3A 1X1DA 1W36C 5GPCA 2PX9A 3QODA 2VN2A 4XLEA 3L2VA 2DFEA 2IBDA 2VJ4A 2M4GA 3K2AA 1T98A 4FASD 5GTIC 3EUHC 4PUSA 4Y4RA 2R7ZJ 2DI3A 4DZPA 2MGQA 1QGPA 2PG4A 2K5CA 4UB6C 4BXUA 4E4HA 2EFOA 1R58A 3JAMZ 3CO6C 1BL0A 1RKWA 1PUEE 3JCUC 1OYYA 3RKXA 2HKOA 1BR1A 2DDBA 2ESHA 1TQMA 5LRRA 3OYJA 3OYGA 1GLNA 1KQ9A 2COMA 5EZGA 3X2QH 5TRDA 2EA4A 3I9V2 1PP7U 1FEXA 4PJMA 1D5VA 1ETWA 3K70D 1OR7A 3GFLA 1O7FA 1CF7B 1QZEA 3ZCOA 5CVUA 5FKLA 3FK7A 3OS1A 1Y8QB 3T5XA 1FOWA 2CQQA 2E1MB 4GYIA 4YFKF 4B47A 1BI2A 2VASA 2YX7A 2FRHA 1HCRA 1R1VA 4U0YA 4FE7A 2OV7A 1OCTC 2GWRA 1PP8F 3UKGA 4ZZDA 2JSCA 3MKWB 4A0XA 2O9LA 1W7PB 1LDJA 3H9JA 4E70A 2X6XA 3LL7A 4DIQA 5D5VB 1G59A 1B8IA 5E8IA 4DYCA 1U2WA 3F21A 3K1MA 3OOUA 1WI3A 1HQCA 2OC6A 2MBFA 2CV2A 3O6BB 1TL8A 3GZNB 1WJFA 2W84A 3GO5A 3K4BA 1Z7LA 2DU9A 4PDKA 4BXFA 4DZJA 6PAXA 3CCUI 1B4AA 1QHHD 2XAQA 2DO7A 3IV5A 2VXZA 4J19A 1K83J 3HSEA 3F8NA 1UZCA 4HSRA 2QQAA 3MAJA 4TV7A 4LG0B 5BPIA 1NK2P 1WH5A 3H3ZA 4GGGA 4CGZA 2H8RA 3K10A 3DV8A 1ZLKA 3HHGA 2Z16A 2XSJC 1FTZA 2LDUA 4RAFA 2VOOA 3ZOBA 3E6MA 3BCAA 2E2JJ 3JRGA 2A07F 2FF4A 2O5RA 5EEHA 4Y7NJ 5GTHC 2VBZA 3DBHB 4A3MJ 1FSEA 4YFNF 1XCBA 3MMYB 5J4VA 4PJNA 1IXCA 5HOOA 3S1RJ 3IUOA 4HQMA 3G1LA 3GTMJ 2XGCA 4KYWA 1WCMJ 2FBIA 3BR2A 4KIFA 4R1HA 2XVCA 3AG2H 5E3NA 2ZCWA 3OL3A 4S04A 2W48A 2BYVE 1JT6A 4LLNA 3S1QJ 4B3XA 2MSYA 4ITVA 2XAFA 1S6LA 1C0WA 3S1NJ 1U5TC 1W4MA 3GUDA 4R8HA 3IAS2 2QEXI 3S14J 1FTTA 3R60A 1WJCA 3A1YA 4MFDA 3D0SA 4WX9A 1U6GA 2FBKA 2VKVA 1D1AA 4M6VA 2DODA 3BP8A 2A61A 3J7AO 2X4HA 1KU2A 2F5EA 4IHSA 3WE2A 2HU9A 1FMWA 3IHUA 4P96A 3T8RA 4C3HJ 3VWBA 4ON0A 3FHNA 4BY7J 2ZKZA 3M8FA 1JKOC 1QRYA 3REOA 4D5CA 3L9FA 5BOXA 3J81Z 4MEYF 1QU3A 2V7FA 3GTLJ 2ECCA 2P4WA 5FLXZ 2R7UA 2CMPA 1BN5A 1R1UA 2W85A 4IQ4A 3HUGA 2K9QA 3OYLA 1HXDA 2BV6A 5LBQA 5F0CA 3MKZA 1DGRM 5KVRA 2XPUA 4YIRX 5K5RA 4BXXJ 3HOUJ 3BJ6A 3HEFA 4X6AJ 1EA3A 3G1MA 4OINF 4PZJA 3BQYA 3OY9A 4H4KC 2HYJA 3A01A 2EFQA 3BR0A 2V6CA 5F0HA 3K0LA 3HTSB 2PMHA 5J1UA 3TKYA 2P7CB 1GVJA 1HDDC 4CXFA 2QLZA 4XRSA 3RYRA 1FJLA 3IH4A 2FSWA 5DUIA 2DFHA 4RGXA 1XMXA 5DV5A 2RVCA 3U1DA 3G73A 2O0YA 4LFUA 2M2EA 3V7RA 3NQOA 4A3EJ 4B1RA 2DDAA 2HR3A 3FM5A 2KIMA 4BAYA 1ZG5A 5JVGF 1MSEC 2Y30A 2PJPA 3BZCA 1IRGA 3FKIJ 5CYVA 2ZXHA 2LBFB 3W2VA 3LQQA 4CYCB 2ME6A 1YO5C 4C2MJ 1ETXA 4BHBA 2KIQA 4LIUA 1XGNA 4BQQA 2K4JA 3SDGA 4ZYHA 3O8HA 4A0ZA 3CP8A 1YS7A 1BI0A 2EILH 2HEOA 2O8KA 4IHXA 2LLKA 1FYMA 2VQCA 3FX3A 3VDXA 1R36A 4QSHA 1FP2A 3F6OA 2DBBA 4I76A 2CUJA 2D1HA 5J40A 1YITI 2WAQA 4RM3A 1VQOI 2R5YB 3MD2A 1T6SA 1J0RA 1WPKA 3S32A 5E1ZB 3ASOH 3OYNA 3LSKA 4AIHA 1OR7C 1Z77A 3W2WA 2CQXA 3HYIA 1AU7A 3R6SA 3I71A 1MMDA 4D9JA 3J80Z 4XK4A 2QUFA 2BZTA 4XRSG 1ZREA 5IT9Z 1GXPA 3K7AJ 1GXQA 1LVKA 4BACA 4XKCA 1FOKA 3GLXA 4RLFA 1IXRC 2O8XA 2OQGA 1ZARA 3PUBA 2WAQN 4ABZA 5J1RA 5KNLA 4A3JJ 3HJEA 1V55H 4BDZA 2AS5F 4M9SA 2FEZA 3F6VA 1HW1A 4HYEA 3U2RA 3KCCA 3A03A 5D6FA 1MIJA 2XGDA 3QPTA 4RBOA 1TWAJ 2EA2A 5KK1A 2EB7A 4XRFA 3VPRA 3DFGA 2NNYA 1K6YA 4ZZLA 5GAGJ 3BPXA 2HGCA 1ITYA 2VJ5A 2NAZA 1SANA 1WSUA 4L18B 4BHCA 5M5YJ 1X1PA 2RNGA 3NRVA 1QBJA 1JHHA 2VQLA 3HM5A 4KJZA 1K4SA 1OPCA 3JR9A 5CQEA 3DP7A 1A31A 1EH8A 2X1DA 4ANJA 1P9QC 1NK3P 4ZJZA 1DUXC 4I0AA 3ZMDA 2L9RA 3KP5A 2DMNA 4YEJA 2GM4A 3LSRA 1SAXA 1ETYA 3DCFA 2P8TA 1XMAA 1F5TA 5E3LA 4KISA 2XPVA 4HG2A 1G6NA 2XKOA 3IRQA 4PJ0C 3LAPA 2R7VA 1IDZA 2IW5A 3QPLA 3TEDA 1AOYA 4CCOA 2K27A 1EF4A 2L3DA 2DAOA 3WTSC 3J81K 4B8XA 2WV0A 2P81A 2KHMA 3BG6A 1YJWI 2OBPA 3JRHA 2M0CA 2DMQA 4XBFA 4IOAF 2GOMA 4C3IJ 4OWRB 2GXBA 2IPQX 1NTCA 3DU6A 3KZYA 4W1UA 4HRIA 3CMEI 3GFIA 1HKQA 4P9UA 1MBHA 2V1NA 2R7WA 4XL9A 3PIPF 1SD4A 2RAEA 5ERIA 4K2EA 1Q1VA 3ERED 1E0EA 5F64A 1BR2A 1D0YA 2KKOA 4RAGA 1WJBA 1Y56A 4RAYA 5JHUA 2L02A 3HG9A 1HA8A 3HKZA 3ZMUA 5D8KB 1G3SA 3CJTB 4G9YA 3ZQCA 1MBFA 2Y0SA 2XHKA 3LSTA 5FB2A 2EINH 1YLFA 2VODA 2VLAA 4OIOF 4Q4ZF 3RI4A 2X9DA 3CF2A 3TP0A 3ABTA 2I10A 2ADUA 4BY1J 1BOAA 2M5WA 4Y17A 2GIVA 3BTCA 4RA2A 5J8CA 2DQRA 2F4IA 2STTA 2V9KA 2DN0A 4EM0B 2LKPA 3WHBA 3HL2A 4KIGA 3QYBA 2R7QA 1IUFA 2CU7A 4EMSA 2XRLA 2LNBA 2Y0SN 3PQJA 3L2QA 1IV6A 1B59A 4U0VA 1Z9CA 5HNFA 1S8NA 4A3IJ 2EJRA 2P6SA 3WTVC 2BY0A 5B66C 3I59B 3S3OA 5ED4A 1H8AC 2LREA 4OOIA 1DDNA 4UXNA 2ZJPF 1RR8C 3G6EI 4G7HF 3CCMI 3DEEA 2X0LA 1ZG1A 2K3FA 1BW6A 1FBUA 2CO5A 2DA6A 2DOFA 3SYTA 1Z0XA 2H6CA 4RDUA 2FMLA 4PFPA 4L5JA 5HS9A 3F9KA 3CCQI 4UY8I 2KRFA 2DK8A 3D1NI 2KLOA 1FYLA 1OYWA 4AYBA 1Z1DA 3FXOA 1KQ0A 3HXLA 4YELA 4I98B 3FBIB 3FKJA 5B1BH 1KGSA 5HS8A 3BTLA 5HLGA 3RJPA 3OSFA 2LD5A 4N4NB 1SVLA 4XMYA 3CC7I 3M1EA 3VODA 3WTZA 2YSRA 4HZFA 1MGTA 1BA5A 1A6QA 2ZMEB 3P9KA 3LFKA 2BE5F 2HOSA 1PVEA 1P4WA 4IOCF 1IN6A 3T1BA 2GLOA 4UVCA 4MLOA 3CJNA 3KP4A 2V1UA 2JVGA 2WV1A 2CRGA 2HZTA 4AYBN 1LVAA 1USTA 3OS0A 5KHDA 1XSXA 1B1BA 5DDGA 2LOOA 4N9IA 3BJAA 1DP3A 3M1CA 3PJRA 5F6FA 4XLNF 2EPFA 2IGKA 5IP6A 1FOYA 4EQQA 3L2CA 1BC7C 3I4PA 3V7SA 1Y6IA 3GTGJ 2KRHA 1WJ5A 2WY8Q 2P7VB 2EH3A 2GAUA 2B0LA 4BBRJ 5D6EA 5L3EA 1FBQA 1KZHA 3DQVC 3DWLE 5FLMJ 3ZMTA 1P92A 2HQ5A 4WCGA 3G4SI 4HV5A 2E7WA 4FX4A 3N05A 3UNGC 1ERDA 5KAFC 4AC0A 1L3LA 1SAUA 3ECOA 1KYWA 4RGUA 4FX0A 4F55A 4GXOA 1K78B 1VQ9I 2F5FA 2WADA 3O3KA 5JHFA 4BL0B 2F5CA 4LMYA 2K9SA 2KT0A 2NXNB 1QA6A 4A93J 2NVTJ 2PN6A 5C4XJ 1KU9A 2NS7A 3TL4X 2ELHA 1I3QJ 4WWCA 3S2DJ 2Y75A 2Y9ZA 1KYZA 1OCRH 2HOTA 4MTDA 4EGZA 2YUSA 3E6BA 5DM7F 4JX5A 4M3BA 1O3QA 2ISYA 3RPUD 2FQ3A 4CZCA 3K70C 3P9IA 3V7CA 3GCMA 2RC4A 2L0KA 2KISA 4M9ZA 5AONA 2EIJH 3JRCA 3HIFA 3WTUC 2O6GE 5LLQA 3C2HA 3GYHX 1R5GA 1FZPB 1UB9A 2CYYA 4XN0A 1WFXA 2Z9OA 1X2MA 2DXIA 3RQIA 2IA1A 3JSPA 2CV1A 2XB0X 5E79C 1HSJA 1YYVA 1N75A 5CVJA 1WQ2A 1FC3A 2LTPA 2Y31A 2OPTA 3D5SC 1B9MA 4MTEA 4BQOA 5FO5A 2J5OA 2KP6A 3Q9SA 2DMPA 1JI8A 3ELKA 2IRFG 4NHJA 5HVQC 5F0FA 4HV6A 1IG7A 1XSDA 4UUVA 2CQ7A 2ME0A 2NVYJ 2JTVA 1OCPA 4ENKA 2E1OA 4PFOA 1P7IA 5CVVA 1W7PD 2L4MA 5L3CA 2L9SA 3AG4H 5M3FJ 3T0YA 3E5QA 1YHQI 3K4NA 3ZQGA 2R0QC 3I59A 1MBGA 3F23A 3HPHA 1J2XA 1SFUA 1EH6A 1I6XA 4OIQF 4ESBA 2VBXA 1XPXA 2A69F 3LNQA 1BW5A 1IW7F 4RLQA 3BDDA 1ZH5A 4XICA 3S16J 5EG0A 5K5OA 2EZHA 2R3SA 1USSA 3I55I 2OD5A 1O57A 4MEXF 4AIDA 4BKXA 2JUGA 2KZVA 4YIFA 3JREA 5JLXA 1LPQA 4OU0A 2XF6A 2ZC2A 1KU3A 4YRVA 2JPCA 3FXJA 2FOWA 4XQFA 4DNCA 3Q0WA 2EV6A 2P0WA 4E7IA 1A5JA 5LGTA 1MH4A 1S7AA 2E71A 1FOXA 3H9QA 2EV0A 2Z5UA 4D7MA 1SFKA 3UR3C 3CTAA 4UNOA 3DTKA 3PO2J 3OYHA 3IAM2 1FIAA 2GBYA 3FDYA 3JRAA 2IT0A 3LAJA 3M8JA 1ACIA 2BEOA 3JRDA 3G71I 1LDKB 1VI0A 4G7OF 5CLSA 5ICEA 4X0GA 1H89C 4G8XA 3VB2A 4ZH4F 5FLVA 1VQ8I 4U0WA 5FD5A 2DA5A 3I56I 3LSMA 5HDKA 2BVMA 2WAEA 4V2GA 3HTUA 4CUGA 4DW6A 3RTRA 4M3FA 2VC0A 4MHGA 5H6RA 4EJOA 4IRIA 3W6VA 1TQIA 3OYDA 4HDVA 4LGWA 3Q3SA 2K4BA 4LOCA 1ZKGA 5CVIA 1MKMA 2CQNA 3SXYA 4F3QA 1LEBA 4M71A 3F8BA 3JTHA 4YIIA 3S3NA 3CUQC 1PJRA 5BS6A 3ZMZA 4ZYGA 1JGSA 4BH9A 1QNTA 2DTRA 1IC8A 4LK0F 2R7XA 3FXQA 1EV7A 5BNGA 3HGGA 2OCEA 3VYUB 4UVAA 3L2RA 5FRNA 1K78A 3ABKH 3OWTA 4FHTA 4LB5A 3F8CA 4QTRA 1KONA 1X2NA 2BXZA 3RDIA 4PJJA 2JPBA 2FBHA 1TT5B 3HRUA 3PQKA 5J1YA 2RQPA 3KLNA 3TOBA 2A3SA 2CV0A 4BUPA 2HNHA 2QENA 3ONQA 2EWNA 4UV9A 1T33A 2MH9A 1AHDP 1B6AA 3BG9A 4GO1A 5F27A 4ENMA 4B43A 2P6TA 5DEQA 1L0OC 1IN7A 2DT6A 4AVPA 1D3YA 4IVNA 1T38A 2TRTA 4DOZA 3CDIA 1REPC 4G7ZF 2WB1A 3V4GA 3WODF 2DMUA 5LRSA 2E35A 1AWCA 2JRMA 3K69A 3CC4I 4C2TA 4Q47A 2KPMA 2F5DA 3WGIA 2PLYA 2EBIA 2XAUA 1IF1A 1FX7A 2Q2EA 3EYYA 1DU0A 2IVMA 3RCOA 4BDYA 2AHQA 3GTQJ 3H5NA 1LJ9A 3IKVA 5ICGA 2MC4A 5ILUA 3MKLA 3TP3A 2XF5A 5ICCA 3BCBA 1ZGWA 3C7JA 4NB5A 1E3OC 5F1RA 3KEQA 2Q8KA 1ETOA 1R5HA 3G2BA 3CMAI 5IOZA 2EK5A 2GOXB 3CJQB 4DYRA 2MLKA 1V5FA 3R0AA 2A5YB 9ANTA 2QYOA 2LMDA 2MW8A 3CCSI 1S3JA 4ZC3A 1RESA 1XCVA 3EUAA 2W82A 2NNNA 5JVTA 3ZP5A 3NEUA 2OAZA 4E7LA 3A0BC 3ZR8X 2K9NA 1YIJI 1I3AA 4XONA 4DBRA 5L3BA 4HF1A 1R9TJ 2VBWA 4EJTA 3FXLA 4PGHA 5DUKA 3DKWA 1MMAA 3BWGA 5K5QA 2GA1A 1ZTRA 3CF5F 1P2FA 2NOGA 2RNJA 3ZQIA 2RREA 3BG7A 3K4CA 3O8GA 3WGHA 1YRNA 5H20A 1KA8A 2VXDA 4OAZA 4G6DA 2MG4A 3FIWA 4C9YA 1OYIA 4P5OA 3RPUA 5ICFA 3I0TA 4FE4A 2LP0A 2Z99A 4II3A 1ZR4A 2FNPA 4IXAA 3BLYA 3CESA 5B3SH 2BGCA 2TDXA 2HTJA 3FXMA 1F1ZA 2FMYA 3PM1A 5J6XA 5DCMB 3IL2A 4XSZF 3TBIA 1KU7A 4NUBA 3MZHA 1R5ID 2WY7Q 1XB4A 3LSGA 4EM2A 3GLLA 4HX4A 4QWQA 2JZYA 5LFAA 5E3MA 4XNFA 1BR4A 1W0TA 3B73A 3DBLB 2KIFA 1Y1VJ 2RKHA 3FHZA 3ZQLA 2X1EA 3V42A 3S2HJ 4BE1A 4N0BA 3FZVA 3TW7A 1H9TA 3Q5FA 2RV8A 2L9VA 2VKEA 3KEOA 1CF7A 4JBAA 3CDHA 2STWA 2DOAA 3WGGA 2O03A 1Z7UA 2BHYA 4OIRF 3CMYA 3N97A 1JE8A 1V5EA 1YE9A 5D5UB 2VONA 3CDLA 2NOJB 4KN7X 3QAHA 2XPWA 2V9VA 1LE8B 1IGNA 4MNUA 2MD5A 4IO9F 5C4JJ 2VT2A 5LGUA 5FD6A 1UHWA 1W7PA 3HDDA 3KP6A 2K40A 4E7JA 4OIPF 3K9TA 2IGNA 5HLHA 3LSJA 1DP7P 2FUG2 4PK4A 1RUNA 4HLXA 5LHGA 1T39A 2BXYA 2HDWA 4U88A 4XKBA 3RKWA 3R61A 4M3EA 2M45A 1BIAA 2V1XA 5A2QK 3OYEA 2F2EA 3GX4X 1PUFB 2AXLA 2ZJ2A 1MMSA 4EJWA 3K6GA 3M9AA 2FA5A 2V79A 2VT3A 1V3FA 3OL4A 3SEQA 3MWMA 4LLGF 3E5UA 4C3JJ 4DGWB 1ZELA 3PNVA 1D0ZA 4BJTA 4BS9A 3BR5A 3OSGA 2E36A 2PEXA 2GA2A 3ABLH 4LG0A 3LA2A 4ZYDA 2CGPA 5DD8A 2M3AA 2W24A 4A2UA 4IKFA 1ZN2A 2XAJA 2B7EA 2ZB9A 2QCOA 3MCZA 2W1OA 1E17A 1SMTA 3U1KA 4E7ZA 3MEXA 3QYFA 1FT9A 3HSRA 1DGWY 1D1CA 3TMOA 4Y13A 3ISPA 1EH7A 2LKXA 2DTZA 4XLPF 5BPDA 3DBRB 2QSFX 5K7FA 2BY1A 2ESNA 2XASA 1B72B 2O7OA 2CFXA 3SDBA 1ZRDA 1DPRA 1A35A 4BGDA 2JRTA 3HOSA 4XKVA 1VQNI 2F6CA 4ESFA 2V6EA 2H27A 1UCRA 2HVSA 2QBYB 5D8LB 4XLHA 4HLYA 2IEKA 1QPIA 1BM9A 1D8JA 1I1GA 3QQAA 2CH0A 4CCLA 1Z91A 5HLTA 1HF0A 4B09A 4UUSB 2ZJRF 4RAZA 2ID6A 5ILVA 1I6HJ 1QHGA 2OCCH 3LA7A 4FQGA 3AL0C 1E3PA 4WK8F 2QKLB 3FXUA 1UG2A 5L3FA 3KLOA 3E97A 1JTYA 2ZBKA 3DTEA 1AKHB 4FETA 4OMYA 3OR1C 2DYRH 2DFIA 2FOKA 2OTLI 4N9HA 2CFOA 2LRDA 5K1YA 3CCLI 5FGMA 3GTKJ 1RI7A 3W6KB 2Y9YA 3DPLC 1VQLI 1GUUA 2HDCA 1J09A 5LHHA 2R7OA 1FNNA 3CUOA 2X1CA 3TO9A 5DS9A 4IPAA 5JLWA 3E6DA 3P5JA 3SZTA 1U5TB 3IC7A 3K2ZA 4RB3C 4XRMA 1F4KA 1TC3C 1UHSA 3OYIA 2RQQA 4Y15A 2NYXA 3OYCA 4N4OB 5GAEJ 1XMKA 3QOPA 5DCMA 3RPQA 4B48A 3IWZA 3BY6A 1R4NB 3AFHA 2DMTA 1FBSA 4PJLA 3WTXC 3EQLF 5DD4A 1ZGJA 2IA2A 2DA4A 3SQNA 2KQRA 3R0JA 4F52A 3OOPA 2GIZA 2L7KA 2L01A 1PYVA 4OMZA 1VQPI 3ROUA 1TZLA 3IRRA 2CWEA 2HOAA 4ZTFA 1H0MA 1WKMA 4BHPA 4HBLA 5JFRA 4RGRA 3HKZN 1GVDA 4J01A 5B1AH 2ZXIA 3IP4B 2QQBA 1LFPA 1LUJB 1X19A 3VYRB 1ON2A 1AA7A 1BOBA 4E7KA 2HOEA 3LA3A 2LBFA 3LQRA 4CCNA 5GPAA 1U0JA 1R71A 3Q0VA 4CYCA 1IRFA 5D4SA 1J5YA 2MA3A 2LVSA 1YIOA 1O4XA 1RKTA 2DYSH 3HGYA 5C44J 5CQGA 1LE8A 3S3MA 1T2KA 2O3FA 3AKZA 2NS8A 2CSOA 4KIBA 3J7AY 2F48A 1HDPA 3TDUC 1MMNA 4RM2A 3FISA 1OLTA 1S9HA 3V8JA 2BHZA 4KT5C 2A6HF 4IHVA 2HQNA 1NH3A 2X6YA 3KP7A 2K86A 2ZO4A 3GMEA 2R5YA 1J9IA 4XN3A 1TWGJ 2TCTA 3BPVA 1MD0A 5HLIA 4ETSA 2K02A 1ZRCA 1RIOH 1YW7A 4XKWA 4KITB 3BQZA 4CZZA 3E5XA 1UFMA 5LEJA 2OJED 3JW4A 3CCYA 3QP5A 5CPRB 2MFZA 1TLHB 2LG4A 2YS9A 4I2OA 1DU6A 5CKTA 2BOLA 1BI1A 2E1MC 5TJJA 4S05A 2R5ZB 2L7MP 1HKSA 1X3WB 4NC6A 1HC8A 4WF2A 2LSOA 3ZXSA 1K79A 1W5SA 3WTYC 1XC5A 3HOTA 4Z6YA 2X51A 3WU2C 1IJWC 3DPTA 1IO2A 1PDNC 3DEUA 1JKRC 1FY7A 3QPSA 4CICA 1T0FA 5IPAA 2A6TA 3ZMVA 1A04A 1F36A 4WXHA 3ULQB 1XGSA 4D1QA 2IGOA 3U21A 2PI0A 1W5CC 2XAGA 1O3RA 3B6CA 2JA8J 1B72A 3DTIA 2XSDC 3OS2A 2E5NA 3QU3A 2ACJA 2G7UA 1S29A 2Z33A 4IHTA 3SHFA 4NNJA 1ZQ3P 2AQFA 2D45A 2M7BA 5AIQA 3RZOJ 1IN4A 2LH9A 1X1BA 3G3ZA 3LFUA 1KQ8A 2Z2SB 3KIOA 3BOQA 1QZYA 4I6ZA 1RNLA 5HDNA 2HWVA 1MW7A 2N8GA 4W97A 2F4OB 4HPQA 4UUSA 2HQAA 4IZZA 4HQEA 1Q1HA 3J7YJ 2EFWA 1B8IB 4UB8C 1X1AA 3I54A 3OR2C 5F1JA 4JK1X 3GZ5A 3V8KA 4RS8A 2DA3A 1MJBA 4ENJA 2F4MB 2K9MA 3EYIA 1ETVA 1T56A 3L00A 1Z3XA 1OQYA 3RKYA 1IN5A 4F93B 4ESJA 2DJIA 4HX8A 4WXDA 4D5FA 1SMYF 1MJAA 5FFZA 4XIDA 2VPRA 2ELJA 2HVRA 1JGGA 3PNTA 3KYDB 1LKXA 3ECHA 5EEAA 2M87A 3DEWA 3MQ0A 2HFHA 2KDOA 2RDPA 2QQ8A 1LFUP 2OU2A 5E20A 4XORA 4QPQA 3A02A 3DU5A 1JKPC 4AVZA 3OYAA 2M8GX 5J3LA 2YU9J 5IY5H 3WTTC 2EZKA 2VI6A 4BE0A 5EYRA 3Q9VA 2D2WA 3HC7A 2A5WA 3HOXJ 2X85A 1GV5A 2B63J 3C2BA 2H8WA 1GV2A 4JP0A 2K3PA 4U7BA 1G3TA 3PNYA 2LK2A 4V2FA 2JA5J 3OIPA 3FMQA 4UVBA 4L9VA 1NG6A 3E6CC 1VQMI 3L7WA 2K9LA 2D1VA 2YX4A 2CG4A 1O3TA 4B44A 4HF2A 1Y8RB 2ID3A 2V1DA 3H5RA 2MD0A 2FXAA 1ZYRF 3GTPJ 1BIBA 3WU0A 4A6EA 1IUYA 4A3BJ 3CC2I 4D0PA 2WWYA 4KDPA 4L9JA 1I39A 2QVOA 2J5PA 1ORKA 3T8TA 3S1MJ 4CH7A 3FK6A 4EEFG 3RYPA 1OMIA 1S72I 2GXAA 3B02A 3ABMH 1OFCX 1XDSA 1WRJA 2DLLA 4A0YA 1UG0A 1BJZA 1UHMA 1YW9A 2WC2A 3C3WA 2PJRB 3A4CA 1SD5A 4A69C 3JRFA 2L7FP 4I09A 1JTXA 3O2PE 5KCMA 2QSGX 1EJ9A 2C6YA 1DPUA 2MC3A 3FWEA 2EFNA 5E3OA 3GWZA 1U3EM 2VQHA 2ZXJA 3H9GA 3ML6A 2OZ6A 2IA0A 4YFXF 2KDZA 3B6AA 4II2A 1E2XA 1MZBA 1MBEA 5IYCJ 5LEKA 1CGPA 2W25A 2ZFUA 2ZMEA 4L5IA 4A5NA 3A01B 4G12A 1QO0D 2UXNA 2XDVA 2WA0A 4RMNA 1SFOJ 4C2UA 1HKTA 3CJRB 5CVRA 1MJ9A 4A3LJ 1J7KA 2IS2A 3P9CA 2M7AA 1IZ1A 4Y3OA 3ZRGA 2IS6A 3BR3A 2WAFA 1TWHJ 2LF7A 3AG1H 1UAAA 3NAUA 5IT3A 3HOZJ 2JN6A 1VNDA 4HX7A 1TWCJ 3OYKA 2DQLA 2ZNYA 2B9SA 4AWXB 1YS6A 3ABUA 1TNSA 1LNWA 2OA4A 1K61A 1A36A 4LK1F 4DQ2A 4IQJA 5H2FC 4A3GJ 2GXGA 2M0MA 2XRNA 1JXSA 2W4SA 5JI6A 2XIGA 2QSHX 2VJJA 3M3YJ 2H1LA 1YJ9I 4E7SA 4FTHA 3S15J 1Y0NA 3M07A 1EKEA 4HDUA 1X3ZB 3SEZA 1XGOA 1G8XA 4M72A 5GP9A 2GZWA 4RB1A 4NQWB 4DBQA 4FISA 3U9GA 1G2HA 2FE3A 1BC8C 5A2QZ 5HODA 4O3MA 1XX5A 3RZDJ 5K7HA 4HSTA 5IYDJ 5DYMA 1T0FC 2FJ1A 2ISZA 4G6QA 4XR6A 1JT0A 3H35A 2LY9A 4NC7A 2YR2A 5D4RA 2CW7A 2XUBA 4M6YA 1U9OA 4GYGA 3CZ6A 5FKMA 2UWMA 2H09A 4LB6B 1XTAA 3IKTA 1WHUA 2M9HA 3KZZA 4ZYAA 2COBA 1YFHA 1MH3A 3RKQA 2HYFA 3CLOA 2BW3B 4IEJA 4OAYA 3M4OJ 2VOPA 2DPDA 4EJUA 2NS0A 1STZA 2M30A 2Z1DA 2R4GA 4UHTA 2X6WA 3TDZC 2XGEA 4BBSJ 4L0YB 2FX0A 5ILSA 3BZKA 5IOYA 1G4DA 4G94A 4I02A 1VQ5I 3CO7C 3OV8A 2I5UA 2VQGA 1YI2I 1XD7A 1I1SA 3GFMA 3H1CA 1P4AA 3DPUA 2HXIA 3E1SA 3KZIC 2X48A 4JYKA 1MDMB 5EGOB 3I5UA 3BT9A 1FWZA 5J47A 2XC7A 4AD9A 3LWFA 3RQ4A 2WB1N 5GAHJ 1J75A 4A3CJ 5GADJ 1YW8A 1YOVB 1K6OA 2QWWA 1R1TA 2W00A 1IAWA 1W0UA 2CJJA 2LYCA 4BE2A 3CP2A 3QWLA 4XLCA 5DTDA 2PQ8A 1W36D 2VL8A 3M7GA 3KYCB 2ECBA 4Y52J 2MABA 1ENHA 2ZSIB 1TWFJ 1ZGAA 2PFBA 1TQPA 3NARA 4PSXA 2XGXA 1FIPA 4M3GA 1LEAA 1S5LC 4X1EA 3EPZA 2L2OA 4UUTA 2EZIA 3S17J 2DCEA 1POGA 2VUMJ 1TP4A 4IRHA 2MLGA 4B3AA 2G7HA 5DCFA 2CS3A 3P7NA 1TTYA 2DFFA 1JJ6C 1BI3A 1WH7A 3WG9A 1J59A 5BQTA 2O61A 2IS1A 5B5EC 1SEUA 4HAMA 2DK5A 3E3VA 5IP9J 2NVUB 3H3UA 4IF4A 4BU2A 1Z67A 3H0GJ 3F8FA 4A5MA 3E0JB 4A6DA 1ETKA 1E3HA 1BBYA 2QZ8A 3CD6I 1MSFC 4BYYA 1BJAA 1NHAA 3D5LA 2V4JC 4CDGA 4HNTA 2PJRA 4ASNA 1XG1A 2R92J 2M34A 4E6KG 2IS4A 2UZKA 1P7JA 4JX4A 3JRBA 2OZUA 1Z05A 4FCYA 4CCMA 4NC8A 1LQ1A 1D5YA 3A2KA 2KRCA 2IP2A 5LHIA 2KL4A 4QIWN 3BC8A 3HRTA 3EDPA 3R4KA 4KUMA 3I53A 3WU1B 3BG5A 1YQAA 2VBYA 5LGNA 5JR3A 1T08B 1SFXA 5TISC 2VIXA 5M3MJ 1R4MB 1R22A 2HZDA 2QQ9A 2KJCA 3FM3A 4I7HA 5K7ZA 4A3FJ 4P1WA 2XV4S 1FLIA 3PIOF 1VQKI 3PFYA 1SD6A 4CSWA 3KP2A 1TNTA 2EFPA 1R49A 1W1WE 2Y0MA 3PSIA 4Q48A 1X3UA 2A6EF 1APLC 3JAMK 1ZAOA 4BEHB 4KN4X 2BVLA 3MZ8A 4LJZF 1O3SA 3H5AA 2A05A 2E1NA 1WWXA 1VQ7I 2JWTA 2CUEA 4CO8A 3BZ6A 2DA7A 1SVOA 3CQZJ 3WHCA 4A3DJ 4I01A 1SVMA 4EGYA 3SFIA 3A0HC 4M6XA 4KFCA 3NWTA 2LY2A 2EIKH 4XLFA 2ICWG 2HPMA 3DLAA 4BQAA 3DLLF 3I58A 4BNCA 3PSFA 2ZMEC 1TT0A 3OIQA 2DT7B 4H0EA 4IX7A 1T95A 1VF9A 1SD7A 4P9FA 5IYBJ 4NQWA 2DW4A 3KYLA 2QF7A 4PGGA 4XOPA 5KAIC 1IXSB 1WJDA 3SJMA 2R7FA 1F43A 1XSVA 4GRIA 3L2WA 3CMMA 1U8BA 1HLVA 3H36A 2JA7J 4HF0A 2JQ7A 1H9GA 4Y33A 1HBXG 1QQIA 2JK3A 1S7EA 5EJCA 4RGSA 3L1PA 4BJ5C 2E19A 4AU7A 2DT5A 2DOEA 2QKMB 1MNMC 2P5VA 1QVUA 2ZNZA 3TW6A 4ENNA 3HSFA 5FFXA 4U87A 2E1CA 1R6RA 1MBKA 3ZGKA 2R7TA 4G6TB 2BW3A 1G3YA 3ZQ7A 2JVHA 1I5ZA 5IP7J 2WTEA 3CUQB 2E2IJ 2KIUA 1JUMA 2OQRA 2H94A 2YU3A 3K1NA 2XROA 5EDNA 3JRIA 1ZR2A 3GEZA 3BTIA 3ZQHA 2MYSA 4M9XA 1WVRA 2V9PA 1SFEA 2ZXWH 3OIOA 1U8RA 2MH2A 3LOCA 1FPQA 1JUPA 3FMSA 5EGOA 1MDMA 3V8LA 4ZDPA 3GZ6A 3FXKA 4E7HA 4D7NA 4RB0A 2VC1A 1OJLA 2IAIA 4L5EA 4GDFA 1XDUA 3RSNA 3F22A 2LFBA 1U9NA 1RETA 1Z6RA 3KPHA 2VKDA 2ZJQF 4WXCA 1IN8A 4AIJA 1U78A 4F91B 4F7ZA 3HZJA 5M5WJ 1ULYA 2M8EA 1ODDA 3K4JA 1OKRA 1H88C 4EV0A 2DPUA 2BY2A 3PFIA 3HOYJ 5E1WA 2XF7A 3ZQQA 2ZSHB 3WE3A 1XS9A 1LFBA 2R7DA 4IL6C 3LSPA 3TOAA 3J7ZI 2PMZA 4MO7A 5BMZA 3LSHA 3VSKA 4RB2C 3CCRI 1SC7A 1YX3A 1JHFA 1TBXA 4IRGA 1VQ4I 1UMQA 3MZYA 2HKXA 3GW2A
chains in the Genus database with same CATH topology
3AAFA 2Y48A 2K7LA 2RGVA 4I0BA 1LDDA 4Q5SF 2M1BA 3S2WA 5FLXK 4UV8A 3VFZA 4M74A 1ON1A 4R79A 4AIKA 2FNAA 4CYDA 4HA8A 5E1XA 4HOBA 4M73A 4MQVA 1R7JA 4O5VA 2W57A 2IJLA 2HQRA 3L09A 2CQKA 3MFKA 3TQNA 2P5KA 2XKPA 1I27A 4MGRA 1XGMA 3KP3A 3F72A 1FP1D 3K1PA 1WI9A 2CW0F 4XSXF 3TGNA 3ZMSA 4L9TA 4LD5A 3EUHA 4GCVA 3GFJA 1F9NA 1K7AA 4Z2YA 4KICA 3QP6A 3DF8A 3N4MA 3VOEA 4KMUX 1Z6TA 3KFWX 1V4RA 3JTGA 2QM3A 3QRFF 1TW3A 4EJVA 4L0ZB 1R00A 3I64A 2NRAC 4CHUA 3M8EA 1QZZA 3GVAA 3SZPA 4P55A 5J8FA 1G3WA 3KETA 3FMRA 4MQ9F 3HRMA 1GHCA 1TW2A 1ZRFA 4JQFA 2A68F 2GQQA 3FXRA 3J80K 2EV5A 3CUQA 5E8GA 5IT9K 4A12A 1RUOA 2G9WA 4FT8A 3WTWC 2H6BA 1D8KA 3GF2A 3HRSA 3GXOA 2ETHA 3W6JB 5D5XB 3C1DA 3F8MA 1Y0UA 1HW2A 2VE8A 2QBYA 2Q0OA 3DXJF 5E18F 1S7OA 3ZPLA 3BJOA 2P5LC 5L3GA 4KA4A 2UXXA 1ONVA 4L9NA 3QPHA 2KJBA 4EM1A 1P6RA 3FF5A 5AIPA 2VE9A 4YG2F 5HS7A 2L54A 5H6QA 1RZ4A 2Z3YA 1YG2A 2PBIA 1YTYA 3EETA 1ZG3A 1P4XA 5E17F 2YPRA 1U5TA 2ZFWA 2JT1A 1ZLJA 3TO7A 4ZYEA 5D5WB 3QU6A 5CJ9A 3SFZA 3F3XA 3IWFA 4U7DA 3ZN0A 1QPMA 1W5TA 4LLLA 3BROA 5EEGA 4KMFA 2LF8A 3H92A 5L3DA 1FSHA 4IJAA 1FYKA 2PMUA 3ZN1A 3JSOA 1R23A 2BBYA 2HYGD 1B9NA 2HTSA 3COAC 1XN7A 4HW0A 4QLCU 3RIRA 1HW5A 2XAHA 2FU4A 5HDGA 3VEPA 2HS5A 3TO6A 1ZHFA 2RN7A 2L4AA 4PCQA 1LB2A 3KE2A 2E7XA 4KNYA 1O7LA 1VTNC 3C18A 3HHHA 4O6JA 1HSTA 4EVIA 2VN2A 1T98A 2DI3A 1QGPA 2PG4A 4BXUA 2EFOA 1R58A 3JAMZ 3CO6C 1PUEE 1OYYA 3RKXA 2HKOA 5LRRA 2ESHA 1TQMA 5TRDA 1KQ9A 2COMA 1PP7U 2EA4A 1D5VA 1OR7A 3GFLA 1O7FA 1CF7B 5CVUA 3T5XA 4GYIA 4YFKF 1BI2A 2YX7A 2FRHA 1R1VA 4U0YA 2GWRA 1PP8F 4ZZDA 2JSCA 4A0XA 1W7PB 1LDJA 4E70A 5D5VB 5E8IA 1U2WA 3F21A 3K1MA 1HQCA 2MBFA 3O6BB 2W84A 3GO5A 2DU9A 4PDKA 6PAXA 1B4AA 2XAQA 2DO7A 2VXZA 3HSEA 3F8NA 2QQAA 3MAJA 4TV7A 4LG0B 5BPIA 3H3ZA 4GGGA 4CGZA 3DV8A 1ZLKA 3HHGA 2LDUA 2VOOA 3E6MA 2A07F 2FF4A 5EEHA 2VBZA 1FSEA 4YFNF 1XCBA 1IXCA 5HOOA 4HQMA 4KYWA 2FBIA 4KIFA 4R1HA 2XVCA 2ZCWA 4S04A 2BYVE 4LLNA 2XAFA 1S6LA 1C0WA 1U5TC 1W4MA 3GUDA 4R8HA 3R60A 3D0SA 4WX9A 1U6GA 2FBKA 3J7AO 3BP8A 2A61A 2X4HA 1KU2A 2F5EA 4IHSA 3WE2A 3IHUA 4P96A 3T8RA 4ON0A 2ZKZA 3M8FA 3REOA 3L9FA 5BOXA 3J81Z 4MEYF 2P4WA 5FLXZ 1BN5A 1R1UA 2W85A 3HUGA 1HXDA 2BV6A 5LBQA 5KVRA 5K5RA 3BJ6A 4OINF 4PZJA 2EFQA 2V6CA 3K0LA 3HTSB 2PMHA 3TKYA 2P7CB 1GVJA 4CXFA 2QLZA 3RYRA 2FSWA 5DUIA 4RGXA 5DV5A 2RVCA 3U1DA 3G73A 2O0YA 4LFUA 3V7RA 3NQOA 2HR3A 3FM5A 2KIMA 4BAYA 1ZG5A 2PJPA 1IRGA 5CYVA 3LQQA 1YO5C 4BHBA 1XGNA 2K4JA 4ZYHA 4A0ZA 1YS7A 1BI0A 2HEOA 1FYMA 3FX3A 1R36A 1FP2A 3F6OA 2DBBA 2D1HA 1T6SA 1J0RA 5E1ZB 4AIHA 3HYIA 3R6SA 3I71A 3J80Z 2QUFA 1ZREA 5IT9Z 1GXPA 1GXQA 1FOKA 3GLXA 1IXRC 2O8XA 2OQGA 1ZARA 2AS5F 4M9SA 2FEZA 3F6VA 1HW1A 4HYEA 3U2RA 3KCCA 5D6FA 3QPTA 2EA2A 5KK1A 2EB7A 4XRFA 3DFGA 2NNYA 4ZZLA 3BPXA 2HGCA 2NAZA 1WSUA 4L18B 4BHCA 3NRVA 1QBJA 1JHHA 1OPCA 3DP7A 1EH8A 1DUXC 4I0AA 3ZMDA 3KP5A 1SAXA 2P8TA 1XMAA 1F5TA 1G6NA 2XKOA 3IRQA 3LAPA 2IW5A 1AOYA 2K27A 2L3DA 2DAOA 3WTSC 3J81K 4B8XA 2WV0A 2OBPA 4XBFA 2GXBA 2IPQX 3KZYA 3GFIA 1HKQA 4P9UA 1SD4A 5ERIA 4K2EA 3ERED 5F64A 2KKOA 4RAYA 5JHUA 2L02A 3ZMUA 5D8KB 1G3SA 4G9YA 2XHKA 3LSTA 5FB2A 1YLFA 2VODA 4OIOF 4Q4ZF 3RI4A 3ABTA 2ADUA 1BOAA 2M5WA 4Y17A 2GIVA 5J8CA 2DQRA 2STTA 4EM0B 2LKPA 4KIGA 4EMSA 3PQJA 2LNBA 1B59A 4U0VA 1Z9CA 1S8NA 2EJRA 2P6SA 3WTVC 3I59B 5ED4A 4OOIA 1DDNA 4UXNA 4G7HF 2X0LA 1ZG1A 1FBUA 2CO5A 2H6CA 2FMLA 4L5JA 5HS9A 2KRFA 2DK8A 1FYLA 1OYWA 1Z1DA 1KQ0A 4I98B 1KGSA 5HS8A 5HLGA 3RJPA 3M1EA 3VODA 3WTZA 2YSRA 4HZFA 1MGTA 2ZMEB 3P9KA 3LFKA 2BE5F 1P4WA 1IN6A 3T1BA 4UVCA 3CJNA 3KP4A 2V1UA 2HZTA 1LVAA 1USTA 1XSXA 1B1BA 5DDGA 4N9IA 3BJAA 5F6FA 4XLNF 4EQQA 3L2CA 1BC7C 3I4PA 3V7SA 2P7VB 2GAUA 2B0LA 5D6EA 5L3EA 1FBQA 3DQVC 3ZMTA 1P92A 4WCGA 4HV5A 2E7WA 4FX4A 1L3LA 3ECOA 1KYWA 4RGUA 4FX0A 4GXOA 1K78B 2F5FA 3O3KA 2F5CA 4LMYA 2PN6A 1KU9A 2ELHA 4WWCA 2Y75A 1KYZA 4MTDA 4EGZA 3E6BA 1O3QA 2ISYA 2FQ3A 3P9IA 3V7CA 2RC4A 4M9ZA 5AONA 3HIFA 3WTUC 2O6GE 5LLQA 3GYHX 1R5GA 1FZPB 1UB9A 2CYYA 2Z9OA 2IA1A 3JSPA 1HSJA 1YYVA 5CVJA 1WQ2A 1FC3A 1B9MA 4MTEA 5FO5A 2J5OA 3Q9SA 3ELKA 2IRFG 4NHJA 5HVQC 4HV6A 1XSDA 4UUVA 2JTVA 4ENKA 5CVVA 1W7PD 5L3CA 2L4MA 3T0YA 3E5QA 3I59A 3F23A 1J2XA 1SFUA 1EH6A 1I6XA 4OIQF 4ESBA 2VBXA 2A69F 1IW7F 3BDDA 1ZH5A 5K5OA 2R3SA 1USSA 2OD5A 1O57A 4MEXF 4YIFA 4OU0A 1KU3A 2JPCA 4DNCA 2EV6A 5LGTA 1S7AA 2EV0A 2Z5UA 3CTAA 4UNOA 2IT0A 3LAJA 2BEOA 1LDKB 4G7OF 5ICEA 5CLSA 4G8XA 3VB2A 4ZH4F 4U0WA 5FD5A 5HDKA 3HTUA 3RTRA 4EJOA 2VC0A 4MHGA 5H6RA 4IRIA 1TQIA 4HDVA 4LGWA 2K4BA 5CVIA 1MKMA 3SXYA 1LEBA 4M71A 3F8BA 3JTHA 4YIIA 3CUQC 5BS6A 3ZMZA 4ZYGA 1JGSA 4BH9A 1QNTA 2DTRA 4LK0F 3FXQA 1EV7A 4UVAA 1K78A 4FHTA 4LB5A 3F8CA 3RDIA 2JPBA 2FBHA 3HRUA 3PQKA 2RQPA 3KLNA 3TOBA 2A3SA 2QENA 2EWNA 4UV9A 2MH9A 1B6AA 4ENMA 4GO1A 2P6TA 5DEQA 1L0OC 1IN7A 4AVPA 1D3YA 4IVNA 1T38A 1REPC 4G7ZF 3WODF 3V4GA 5LRSA 1AWCA 3K69A 4Q47A 2F5DA 3WGIA 2PLYA 1IF1A 1FX7A 2Q2EA 3EYYA 2IVMA 1LJ9A 3IKVA 5ICGA 5ILUA 5ICCA 3C7JA 4NB5A 5F1RA 3KEQA 2Q8KA 1R5HA 2EK5A 2MLKA 3R0AA 2A5YB 2QYOA 1S3JA 1XCVA 2NNNA 5JVTA 3ZP5A 3NEUA 2OAZA 5L3BA 4HF1A 2VBWA 4EJTA 4PGHA 5DUKA 3DKWA 3BWGA 5K5QA 2GA1A 1P2FA 2RNJA 3WGHA 5H20A 1KA8A 4G6DA 1OYIA 4P5OA 3RPUA 5ICFA 3I0TA 2Z99A 2FNPA 4IXAA 2BGCA 2TDXA 2HTJA 1F1ZA 2FMYA 5J6XA 5DCMB 3IL2A 4XSZF 1KU7A 3MZHA 1XB4A 4EM2A 4HX4A 4QWQA 2JZYA 3B73A 2KIFA 2RKHA 3FHZA 4N0BA 3FZVA 1H9TA 3Q5FA 2RV8A 3KEOA 1CF7A 4JBAA 3CDHA 2STWA 3WGGA 2O03A 1Z7UA 3N97A 4OIRF 1JE8A 5D5UB 2VONA 4KN7X 3QAHA 2V9VA 4MNUA 2MD5A 2VT2A 5LGUA 5FD6A 1UHWA 1W7PA 3KP6A 4OIPF 3K9TA 5HLHA 1DP7P 1RUNA 4HLXA 5LHGA 1T39A 4U88A 3RKWA 3R61A 2M45A 1BIAA 2V1XA 5A2QK 2F2EA 3GX4X 2AXLA 2ZJ2A 4EJWA 3M9AA 2FA5A 2V79A 2VT3A 1V3FA 3MWMA 4LLGF 3E5UA 2PEXA 2GA2A 4LG0A 3LA2A 4ZYDA 2CGPA 5DD8A 2W24A 4A2UA 1ZN2A 2XAJA 1E17A 3MCZA 1SMTA 3MEXA 1FT9A 3HSRA 4Y13A 3ISPA 1EH7A 4XLPF 5BPDA 2ESNA 2XASA 2CFXA 1ZRDA 1DPRA 2JRTA 3HOSA 4ESFA 2H27A 1UCRA 2QBYB 5D8LB 4HLYA 1BM9A 1D8JA 1I1GA 1Z91A 4B09A 4RAZA 5ILVA 3LA7A 4WK8F 3FXUA 5L3FA 3KLOA 3E97A 2ZBKA 4OMYA 2FOKA 2DFIA 4N9HA 5K1YA 5FGMA 1RI7A 3W6KB 3DPLC 2HDCA 5LHHA 1FNNA 3CUOA 3TO9A 4IPAA 3E6DA 3SZTA 1U5TB 3IC7A 3K2ZA 4RB3C 1F4KA 4Y15A 2NYXA 1XMKA 3QOPA 5DCMA 3RPQA 3IWZA 3BY6A 1FBSA 3WTXC 3EQLF 5DD4A 1ZGJA 2IA2A 3SQNA 3R0JA 3OOPA 2L01A 4OMZA 3ROUA 3IRRA 2CWEA 1H0MA 1WKMA 4BHPA 4HBLA 5JFRA 4RGRA 2QQBA 1ON2A 2HOEA 3LA3A 3LQRA 1IRFA 5D4SA 1J5YA 2MA3A 1YIOA 1T2KA 2O3FA 4KIBA 2CSOA 3TDUC 3V8JA 4KT5C 2A6HF 2HQNA 3KP7A 2K86A 2ZO4A 1J9IA 3BPVA 1MD0A 5HLIA 4ETSA 2K02A 1ZRCA 1RIOH 1YW7A 4CZZA 3E5XA 1UFMA 5LEJA 3JW4A 3QP5A 1TLHB 4I2OA 5TJJA 1BI1A 4S05A 1HKSA 4WF2A 2LSOA 1K79A 1W5SA 3WTYC 3HOTA 3DPTA 1PDNC 3DEUA 1FY7A 4CICA 1T0FA 3ZMVA 1A04A 4WXHA 3ULQB 1XGSA 2PI0A 1O3RA 2XAGA 3QU3A 2ACJA 2G7UA 1S29A 2Z33A 4IHTA 3SHFA 2D45A 5AIQA 1IN4A 3G3ZA 1KQ8A 3BOQA 1QZYA 1RNLA 5HDNA 2HWVA 4HQEA 1Q1HA 2EFWA 3I54A 4JK1X 3GZ5A 3V8KA 4RS8A 1MJBA 4ENJA 3EYIA 3L00A 3RKYA 1IN5A 4ESJA 4HX8A 4WXDA 1SMYF 1MJAA 5FFZA 3ECHA 2M87A 3MQ0A 2HFHA 2RDPA 2OU2A 5E20A 3WTTC 3Q9VA 2D2WA 4U7BA 1G3TA 3FMQA 4UVBA 4L9VA 3E6CC 3L7WA 2D1VA 2YX4A 2CG4A 1O3TA 4HF2A 2V1DA 2FXAA 1ZYRF 1BIBA 3WU0A 4A6EA 1IUYA 4D0PA 2WWYA 4KDPA 4L9JA 2QVOA 2J5PA 3T8TA 3RYPA 1OMIA 3B02A 1XDSA 4A0YA 1WRJA 2DLLA 1UHMA 1YW9A 2WC2A 3C3WA 1SD5A 4I09A 3O2PE 2C6YA 1DPUA 2MC3A 3FWEA 2EFNA 3GWZA 1U3EM 2ZXJA 3ML6A 2OZ6A 2IA0A 4YFXF 1E2XA 1MZBA 5LEKA 1CGPA 2W25A 2ZMEA 4L5IA 4A5NA 1QO0D 2UXNA 1HKTA 5CVRA 1MJ9A 1J7KA 3P9CA 1IZ1A 2LF7A 5IT3A 4HX7A 2DQLA 2ZNYA 4AWXB 1YS6A 3ABUA 1TNSA 1LNWA 2OA4A 4LK1F 4DQ2A 2GXGA 2XRNA 1JXSA 5JI6A 2XIGA 4HDUA 1XGOA 4M72A 2GZWA 4RB1A 3U9GA 2FE3A 1BC8C 5A2QZ 4O3MA 5DYMA 2ISZA 4G6QA 2YR2A 5D4RA 2XUBA 4M6YA 4GYGA 2UWMA 2H09A 4LB6B 3IKTA 3KZZA 1YFHA 2HYFA 3CLOA 2VOPA 2DPDA 4EJUA 2NS0A 1STZA 2M30A 4UHTA 3TDZC 4L0YB 5ILSA 1G4DA 4G94A 4I02A 3CO7C 3OV8A 1XD7A 1I1SA 3GFMA 1P4AA 1MDMB 3I5UA 1FWZA 1J75A 4AD9A 3LWFA 1YW8A 1K6OA 2QWWA 1R1TA 1IAWA 2PQ8A 3M7GA 1ZGAA 2PFBA 1TQPA 2XGXA 1LEAA 4IRHA 2MLGA 2G7HA 5DCFA 3P7NA 1TTYA 1BI3A 3WG9A 1J59A 5BQTA 2O61A 4HAMA 2DK5A 3E3VA 3H3UA 4IF4A 3F8FA 4A5MA 4A6DA 2QZ8A 1BBYA 4BYYA 1BJAA 1NHAA 3D5LA 4CDGA 4ASNA 2UZKA 2OZUA 1Z05A 1LQ1A 2IP2A 5LHIA 3HRTA 3EDPA 3R4KA 4KUMA 3I53A 3WU1B 1YQAA 2VBYA 5LGNA 5JR3A 1SFXA 3FM3A 1R22A 2QQ9A 2KJCA 4I7HA 2XV4S 1FLIA 1SD6A 3KP2A 1TNTA 2EFPA 2Y0MA 4Q48A 1X3UA 2A6EF 3JAMK 1ZAOA 4KN4X 4LJZF 1O3SA 2E1NA 1WWXA 4CO8A 3BZ6A 4I01A 4EGYA 4M6XA 4KFCA 4BQAA 3I58A 4BNCA 4H0EA 1SD7A 4P9FA 4NQWA 2DW4A 4PGGA 1IXSB 2R7FA 1XSVA 4HF0A 1H9GA 1HBXG 1QQIA 4RGSA 2DT5A 2P5VA 2ZNZA 4ENNA 3HSFA 5FFXA 2E1CA 1G3YA 3ZQ7A 1I5ZA 2WTEA 3CUQB 2KIUA 2OQRA 2H94A 2YU3A 3K1NA 2XROA 3GEZA 4M9XA 1SFEA 1U8RA 2MH2A 1FPQA 3FMSA 1MDMA 3V8LA 3GZ6A 4RB0A 2VC1A 1XDUA 3F22A 1Z6RA 4WXCA 1IN8A 4AIJA 1U78A 4F7ZA 1ULYA 2M8EA 1ODDA 1OKRA 4EV0A 2DPUA 3PFIA 5E1WA 3WE3A 2R7DA 3TOAA 5BMZA 4RB2C 1JHFA 1TBXA 4IRGA 3MZYA 2HKXA 3GW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAF A;  2Y48 A;  2K7L A;  2RGV A;  4I0B A;  1LDD A;  4Q5S F;  2M1B A;  3S2W A;  5FLX K;  4UV8 A;  3VFZ A;  4M74 A;  1ON1 A;  4R79 A;  4AIK A;  2FNA A;  4CYD A;  4HA8 A;  5E1X A;  4HOB A;  4M73 A;  4MQV A;  1R7J A;  4O5V A;  2W57 A;  2IJL A;  2HQR A;  3L09 A;  2CQK A;  3MFK A;  3TQN A;  2P5K A;  2XKP A;  1I27 A;  4MGR A;  1XGM A;  3KP3 A;  3F72 A;  1FP1 D;  3K1P A;  1WI9 A;  2CW0 F;  4XSX F;  3TGN A;  3ZMS A;  4L9T A;  4LD5 A;  3EUH A;  4GCV A;  3GFJ A;  1F9N A;  1K7A A;  4Z2Y A;  4KIC A;  3QP6 A;  3DF8 A;  3N4M A;  3VOE A;  4KMU X;  1Z6T A;  3KFW X;  1V4R A;  3JTG A;  2QM3 A;  3QRF F;  1TW3 A;  4EJV A;  4L0Z B;  1R00 A;  3I64 A;  2NRA C;  4CHU A;  3M8E A;  1QZZ A;  3GVA A;  3SZP A;  4P55 A;  5J8F A;  1G3W A;  3KET A;  3FMR A;  4MQ9 F;  3HRM A;  1GHC A;  1TW2 A;  1ZRF A;  4JQF A;  2A68 F;  2GQQ A;  3FXR A;  3J80 K;  2EV5 A;  3CUQ A;  5E8G A;  5IT9 K;  4A12 A;  1RUO A;  2G9W A;  4FT8 A;  3WTW C;  2H6B A;  1D8K A;  3GF2 A;  3HRS A;  3GXO A;  2ETH A;  3W6J B;  5D5X B;  3C1D A;  3F8M A;  1Y0U A;  1HW2 A;  2VE8 A;  2QBY A;  2Q0O A;  3DXJ F;  5E18 F;  1S7O A;  3ZPL A;  3BJO A;  2P5L C;  5L3G A;  4KA4 A;  2UXX A;  1ONV A;  4L9N A;  3QPH A;  2KJB A;  4EM1 A;  1P6R A;  3FF5 A;  5AIP A;  2VE9 A;  4YG2 F;  5HS7 A;  2L54 A;  5H6Q A;  1RZ4 A;  2Z3Y A;  1YG2 A;  2PBI A;  1YTY A;  3EET A;  1ZG3 A;  1P4X A;  5E17 F;  2YPR A;  1U5T A;  2ZFW A;  2JT1 A;  1ZLJ A;  3TO7 A;  4ZYE A;  5D5W B;  3QU6 A;  5CJ9 A;  3SFZ A;  3F3X A;  3IWF A;  4U7D A;  3ZN0 A;  1QPM A;  1W5T A;  4LLL A;  3BRO A;  5EEG A;  4KMF A;  2LF8 A;  3H92 A;  5L3D A;  1FSH A;  4IJA A;  1FYK A;  2PMU A;  3ZN1 A;  3JSO A;  1R23 A;  2BBY A;  2HYG D;  1B9N A;  2HTS A;  3COA C;  1XN7 A;  4HW0 A;  4QLC U;  3RIR A;  1HW5 A;  2XAH A;  2FU4 A;  5HDG A;  3VEP A;  2HS5 A;  3TO6 A;  1ZHF A;  2RN7 A;  2L4A A;  4PCQ A;  1LB2 A;  3KE2 A;  2E7X A;  4KNY A;  1O7L A;  1VTN C;  3C18 A;  3HHH A;  4O6J A;  1HST A;  4EVI A;  2VN2 A;  1T98 A;  2DI3 A;  1QGP A;  2PG4 A;  4BXU A;  2EFO A;  1R58 A;  3JAM Z;  3CO6 C;  1PUE E;  1OYY A;  3RKX A;  2HKO A;  5LRR A;  2ESH A;  1TQM A;  5TRD A;  1KQ9 A;  2COM A;  1PP7 U;  2EA4 A;  1D5V A;  1OR7 A;  3GFL A;  1O7F A;  1CF7 B;  5CVU A;  3T5X A;  4GYI A;  4YFK F;  1BI2 A;  2YX7 A;  2FRH A;  1R1V A;  4U0Y A;  2GWR A;  1PP8 F;  4ZZD A;  2JSC A;  4A0X A;  1W7P B;  1LDJ A;  4E70 A;  5D5V B;  5E8I A;  1U2W A;  3F21 A;  3K1M A;  1HQC A;  2MBF A;  3O6B B;  2W84 A;  3GO5 A;  2DU9 A;  4PDK A;  6PAX A;  1B4A A;  2XAQ A;  2DO7 A;  2VXZ A;  3HSE A;  3F8N A;  2QQA A;  3MAJ A;  4TV7 A;  4LG0 B;  5BPI A;  3H3Z A;  4GGG A;  4CGZ A;  3DV8 A;  1ZLK A;  3HHG A;  2LDU A;  2VOO A;  3E6M A;  2A07 F;  2FF4 A;  5EEH A;  2VBZ A;  1FSE A;  4YFN F;  1XCB A;  1IXC A;  5HOO A;  4HQM A;  4KYW A;  2FBI A;  4KIF A;  4R1H A;  2XVC A;  2ZCW A;  4S04 A;  2BYV E;  4LLN A;  2XAF A;  1S6L A;  1C0W A;  1U5T C;  1W4M A;  3GUD A;  4R8H A;  3R60 A;  3D0S A;  4WX9 A;  1U6G A;  2FBK A;  3J7A O;  3BP8 A;  2A61 A;  2X4H A;  1KU2 A;  2F5E A;  4IHS A;  3WE2 A;  3IHU A;  4P96 A;  3T8R A;  4ON0 A;  2ZKZ A;  3M8F A;  3REO A;  3L9F A;  5BOX A;  3J81 Z;  4MEY F;  2P4W A;  5FLX Z;  1BN5 A;  1R1U A;  2W85 A;  3HUG A;  1HXD A;  2BV6 A;  5LBQ A;  5KVR A;  5K5R A;  3BJ6 A;  4OIN F;  4PZJ A;  2EFQ A;  2V6C A;  3K0L A;  3HTS B;  2PMH A;  3TKY A;  2P7C B;  1GVJ A;  4CXF A;  2QLZ A;  3RYR A;  2FSW A;  5DUI A;  4RGX A;  5DV5 A;  2RVC A;  3U1D A;  3G73 A;  2O0Y A;  4LFU A;  3V7R A;  3NQO A;  2HR3 A;  3FM5 A;  2KIM A;  4BAY A;  1ZG5 A;  2PJP A;  1IRG A;  5CYV A;  3LQQ A;  1YO5 C;  4BHB A;  1XGN A;  2K4J A;  4ZYH A;  4A0Z A;  1YS7 A;  1BI0 A;  2HEO A;  1FYM A;  3FX3 A;  1R36 A;  1FP2 A;  3F6O A;  2DBB A;  2D1H A;  1T6S A;  1J0R A;  5E1Z B;  4AIH A;  3HYI A;  3R6S A;  3I71 A;  3J80 Z;  2QUF A;  1ZRE A;  5IT9 Z;  1GXP A;  1GXQ A;  1FOK A;  3GLX A;  1IXR C;  2O8X A;  2OQG A;  1ZAR A;  2AS5 F;  4M9S A;  2FEZ A;  3F6V A;  1HW1 A;  4HYE A;  3U2R A;  3KCC A;  5D6F A;  3QPT A;  2EA2 A;  5KK1 A;  2EB7 A;  4XRF A;  3DFG A;  2NNY A;  4ZZL A;  3BPX A;  2HGC A;  2NAZ A;  1WSU A;  4L18 B;  4BHC A;  3NRV A;  1QBJ A;  1JHH A;  1OPC A;  3DP7 A;  1EH8 A;  1DUX C;  4I0A A;  3ZMD A;  3KP5 A;  1SAX A;  2P8T A;  1XMA A;  1F5T A;  1G6N A;  2XKO A;  3IRQ A;  3LAP A;  2IW5 A;  1AOY A;  2K27 A;  2L3D A;  2DAO A;  3WTS C;  3J81 K;  4B8X A;  2WV0 A;  2OBP A;  4XBF A;  2GXB A;  2IPQ X;  3KZY A;  3GFI A;  1HKQ A;  4P9U A;  1SD4 A;  5ERI A;  4K2E A;  3ERE D;  5F64 A;  2KKO A;  4RAY A;  5JHU A;  2L02 A;  3ZMU A;  5D8K B;  1G3S A;  4G9Y A;  2XHK A;  3LST A;  5FB2 A;  1YLF A;  2VOD A;  4OIO F;  4Q4Z F;  3RI4 A;  3ABT A;  2ADU A;  1BOA A;  2M5W A;  4Y17 A;  2GIV A;  5J8C A;  2DQR A;  2STT A;  4EM0 B;  2LKP A;  4KIG A;  4EMS A;  3PQJ A;  2LNB A;  1B59 A;  4U0V A;  1Z9C A;  1S8N A;  2EJR A;  2P6S A;  3WTV C;  3I59 B;  5ED4 A;  4OOI A;  1DDN A;  4UXN A;  4G7H F;  2X0L A;  1ZG1 A;  1FBU A;  2CO5 A;  2H6C A;  2FML A;  4L5J A;  5HS9 A;  2KRF A;  2DK8 A;  1FYL A;  1OYW A;  1Z1D A;  1KQ0 A;  4I98 B;  1KGS A;  5HS8 A;  5HLG A;  3RJP A;  3M1E A;  3VOD A;  3WTZ A;  2YSR A;  4HZF A;  1MGT A;  2ZME B;  3P9K A;  3LFK A;  2BE5 F;  1P4W A;  1IN6 A;  3T1B A;  4UVC A;  3CJN A;  3KP4 A;  2V1U A;  2HZT A;  1LVA A;  1UST A;  1XSX A;  1B1B A;  5DDG A;  4N9I A;  3BJA A;  5F6F A;  4XLN F;  4EQQ A;  3L2C A;  1BC7 C;  3I4P A;  3V7S A;  2P7V B;  2GAU A;  2B0L A;  5D6E A;  5L3E A;  1FBQ A;  3DQV C;  3ZMT A;  1P92 A;  4WCG A;  4HV5 A;  2E7W A;  4FX4 A;  1L3L A;  3ECO A;  1KYW A;  4RGU A;  4FX0 A;  4GXO A;  1K78 B;  2F5F A;  3O3K A;  2F5C A;  4LMY A;  2PN6 A;  1KU9 A;  2ELH A;  4WWC A;  2Y75 A;  1KYZ A;  4MTD A;  4EGZ A;  3E6B A;  1O3Q A;  2ISY A;  2FQ3 A;  3P9I A;  3V7C A;  2RC4 A;  4M9Z A;  5AON A;  3HIF A;  3WTU C;  2O6G E;  5LLQ A;  3GYH X;  1R5G A;  1FZP B;  1UB9 A;  2CYY A;  2Z9O A;  2IA1 A;  3JSP A;  1HSJ A;  1YYV A;  5CVJ A;  1WQ2 A;  1FC3 A;  1B9M A;  4MTE A;  5FO5 A;  2J5O A;  3Q9S A;  3ELK A;  2IRF G;  4NHJ A;  5HVQ C;  4HV6 A;  1XSD A;  4UUV A;  2JTV A;  4ENK A;  5CVV A;  1W7P D;  5L3C A;  2L4M A;  3T0Y A;  3E5Q A;  3I59 A;  3F23 A;  1J2X A;  1SFU A;  1EH6 A;  1I6X A;  4OIQ F;  4ESB A;  2VBX A;  2A69 F;  1IW7 F;  3BDD A;  1ZH5 A;  5K5O A;  2R3S A;  1USS A;  2OD5 A;  1O57 A;  4MEX F;  4YIF A;  4OU0 A;  1KU3 A;  2JPC A;  4DNC A;  2EV6 A;  5LGT A;  1S7A A;  2EV0 A;  2Z5U A;  3CTA A;  4UNO A;  2IT0 A;  3LAJ A;  2BEO A;  1LDK B;  4G7O F;  5ICE A;  5CLS A;  4G8X A;  3VB2 A;  4ZH4 F;  4U0W A;  5FD5 A;  5HDK A;  3HTU A;  3RTR A;  4EJO A;  2VC0 A;  4MHG A;  5H6R A;  4IRI A;  1TQI A;  4HDV A;  4LGW A;  2K4B A;  5CVI A;  1MKM A;  3SXY A;  1LEB A;  4M71 A;  3F8B A;  3JTH A;  4YII A;  3CUQ C;  5BS6 A;  3ZMZ A;  4ZYG A;  1JGS A;  4BH9 A;  1QNT A;  2DTR A;  4LK0 F;  3FXQ A;  1EV7 A;  4UVA A;  1K78 A;  4FHT A;  4LB5 A;  3F8C A;  3RDI A;  2JPB A;  2FBH A;  3HRU A;  3PQK A;  2RQP A;  3KLN A;  3TOB A;  2A3S A;  2QEN A;  2EWN A;  4UV9 A;  2MH9 A;  1B6A A;  4ENM A;  4GO1 A;  2P6T A;  5DEQ A;  1L0O C;  1IN7 A;  4AVP A;  1D3Y A;  4IVN A;  1T38 A;  1REP C;  4G7Z F;  3WOD F;  3V4G A;  5LRS A;  1AWC A;  3K69 A;  4Q47 A;  2F5D A;  3WGI A;  2PLY A;  1IF1 A;  1FX7 A;  2Q2E A;  3EYY A;  2IVM A;  1LJ9 A;  3IKV A;  5ICG A;  5ILU A;  5ICC A;  3C7J A;  4NB5 A;  5F1R A;  3KEQ A;  2Q8K A;  1R5H A;  2EK5 A;  2MLK A;  3R0A A;  2A5Y B;  2QYO A;  1S3J A;  1XCV A;  2NNN A;  5JVT A;  3ZP5 A;  3NEU A;  2OAZ A;  5L3B A;  4HF1 A;  2VBW A;  4EJT A;  4PGH A;  5DUK A;  3DKW A;  3BWG A;  5K5Q A;  2GA1 A;  1P2F A;  2RNJ A;  3WGH A;  5H20 A;  1KA8 A;  4G6D A;  1OYI A;  4P5O A;  3RPU A;  5ICF A;  3I0T A;  2Z99 A;  2FNP A;  4IXA A;  2BGC A;  2TDX A;  2HTJ A;  1F1Z A;  2FMY A;  5J6X A;  5DCM B;  3IL2 A;  4XSZ F;  1KU7 A;  3MZH A;  1XB4 A;  4EM2 A;  4HX4 A;  4QWQ A;  2JZY A;  3B73 A;  2KIF A;  2RKH A;  3FHZ A;  4N0B A;  3FZV A;  1H9T A;  3Q5F A;  2RV8 A;  3KEO A;  1CF7 A;  4JBA A;  3CDH A;  2STW A;  3WGG A;  2O03 A;  1Z7U A;  3N97 A;  4OIR F;  1JE8 A;  5D5U B;  2VON A;  4KN7 X;  3QAH A;  2V9V A;  4MNU A;  2MD5 A;  2VT2 A;  5LGU A;  5FD6 A;  1UHW A;  1W7P A;  3KP6 A;  4OIP F;  3K9T A;  5HLH A;  1DP7 P;  1RUN A;  4HLX A;  5LHG A;  1T39 A;  4U88 A;  3RKW A;  3R61 A;  2M45 A;  1BIA A;  2V1X A;  5A2Q K;  2F2E A;  3GX4 X;  2AXL A;  2ZJ2 A;  4EJW A;  3M9A A;  2FA5 A;  2V79 A;  2VT3 A;  1V3F A;  3MWM A;  4LLG F;  3E5U A;  2PEX A;  2GA2 A;  4LG0 A;  3LA2 A;  4ZYD A;  2CGP A;  5DD8 A;  2W24 A;  4A2U A;  1ZN2 A;  2XAJ A;  1E17 A;  3MCZ A;  1SMT A;  3MEX A;  1FT9 A;  3HSR A;  4Y13 A;  3ISP A;  1EH7 A;  4XLP F;  5BPD A;  2ESN A;  2XAS A;  2CFX A;  1ZRD A;  1DPR A;  2JRT A;  3HOS A;  4ESF A;  2H27 A;  1UCR A;  2QBY B;  5D8L B;  4HLY A;  1BM9 A;  1D8J A;  1I1G A;  1Z91 A;  4B09 A;  4RAZ A;  5ILV A;  3LA7 A;  4WK8 F;  3FXU A;  5L3F A;  3KLO A;  3E97 A;  2ZBK A;  4OMY A;  2FOK A;  2DFI A;  4N9H A;  5K1Y A;  5FGM A;  1RI7 A;  3W6K B;  3DPL C;  2HDC A;  5LHH A;  1FNN A;  3CUO A;  3TO9 A;  4IPA A;  3E6D A;  3SZT A;  1U5T B;  3IC7 A;  3K2Z A;  4RB3 C;  1F4K A;  4Y15 A;  2NYX A;  1XMK A;  3QOP A;  5DCM A;  3RPQ A;  3IWZ A;  3BY6 A;  1FBS A;  3WTX C;  3EQL F;  5DD4 A;  1ZGJ A;  2IA2 A;  3SQN A;  3R0J A;  3OOP A;  2L01 A;  4OMZ A;  3ROU A;  3IRR A;  2CWE A;  1H0M A;  1WKM A;  4BHP A;  4HBL A;  5JFR A;  4RGR A;  2QQB A;  1ON2 A;  2HOE A;  3LA3 A;  3LQR A;  1IRF A;  5D4S A;  1J5Y A;  2MA3 A;  1YIO A;  1T2K A;  2O3F A;  4KIB A;  2CSO A;  3TDU C;  3V8J A;  4KT5 C;  2A6H F;  2HQN A;  3KP7 A;  2K86 A;  2ZO4 A;  1J9I A;  3BPV A;  1MD0 A;  5HLI A;  4ETS A;  2K02 A;  1ZRC A;  1RIO H;  1YW7 A;  4CZZ A;  3E5X A;  1UFM A;  5LEJ A;  3JW4 A;  3QP5 A;  1TLH B;  4I2O A;  5TJJ A;  1BI1 A;  4S05 A;  1HKS A;  4WF2 A;  2LSO A;  1K79 A;  1W5S A;  3WTY C;  3HOT A;  3DPT A;  1PDN C;  3DEU A;  1FY7 A;  4CIC A;  1T0F A;  3ZMV A;  1A04 A;  4WXH A;  3ULQ B;  1XGS A;  2PI0 A;  1O3R A;  2XAG A;  3QU3 A;  2ACJ A;  2G7U A;  1S29 A;  2Z33 A;  4IHT A;  3SHF A;  2D45 A;  5AIQ A;  1IN4 A;  3G3Z A;  1KQ8 A;  3BOQ A;  1QZY A;  1RNL A;  5HDN A;  2HWV A;  4HQE A;  1Q1H A;  2EFW A;  3I54 A;  4JK1 X;  3GZ5 A;  3V8K A;  4RS8 A;  1MJB A;  4ENJ A;  3EYI A;  3L00 A;  3RKY A;  1IN5 A;  4ESJ A;  4HX8 A;  4WXD A;  1SMY F;  1MJA A;  5FFZ A;  3ECH A;  2M87 A;  3MQ0 A;  2HFH A;  2RDP A;  2OU2 A;  5E20 A;  3WTT C;  3Q9V A;  2D2W A;  4U7B A;  1G3T A;  3FMQ A;  4UVB A;  4L9V A;  3E6C C;  3L7W A;  2D1V A;  2YX4 A;  2CG4 A;  1O3T A;  4HF2 A;  2V1D A;  2FXA A;  1ZYR F;  1BIB A;  3WU0 A;  4A6E A;  1IUY A;  4D0P A;  2WWY A;  4KDP A;  4L9J A;  2QVO A;  2J5P A;  3T8T A;  3RYP A;  1OMI A;  3B02 A;  1XDS A;  4A0Y A;  1WRJ A;  2DLL A;  1UHM A;  1YW9 A;  2WC2 A;  3C3W A;  1SD5 A;  4I09 A;  3O2P E;  2C6Y A;  1DPU A;  2MC3 A;  3FWE A;  2EFN A;  3GWZ A;  1U3E M;  2ZXJ A;  3ML6 A;  2OZ6 A;  2IA0 A;  4YFX F;  1E2X A;  1MZB A;  5LEK A;  1CGP A;  2W25 A;  2ZME A;  4L5I A;  4A5N A;  1QO0 D;  2UXN A;  1HKT A;  5CVR A;  1MJ9 A;  1J7K A;  3P9C A;  1IZ1 A;  2LF7 A;  5IT3 A;  4HX7 A;  2DQL A;  2ZNY A;  4AWX B;  1YS6 A;  3ABU A;  1TNS A;  1LNW A;  2OA4 A;  4LK1 F;  4DQ2 A;  2GXG A;  2XRN A;  1JXS A;  5JI6 A;  2XIG A;  4HDU A;  1XGO A;  4M72 A;  2GZW A;  4RB1 A;  3U9G A;  2FE3 A;  1BC8 C;  5A2Q Z;  4O3M A;  5DYM A;  2ISZ A;  4G6Q A;  2YR2 A;  5D4R A;  2XUB A;  4M6Y A;  4GYG A;  2UWM A;  2H09 A;  4LB6 B;  3IKT A;  3KZZ A;  1YFH A;  2HYF A;  3CLO A;  2VOP A;  2DPD A;  4EJU A;  2NS0 A;  1STZ A;  2M30 A;  4UHT A;  3TDZ C;  4L0Y B;  5ILS A;  1G4D A;  4G94 A;  4I02 A;  3CO7 C;  3OV8 A;  1XD7 A;  1I1S A;  3GFM A;  1P4A A;  1MDM B;  3I5U A;  1FWZ A;  1J75 A;  4AD9 A;  3LWF A;  1YW8 A;  1K6O A;  2QWW A;  1R1T A;  1IAW A;  2PQ8 A;  3M7G A;  1ZGA A;  2PFB A;  1TQP A;  2XGX A;  1LEA A;  4IRH A;  2MLG A;  2G7H A;  5DCF A;  3P7N A;  1TTY A;  1BI3 A;  3WG9 A;  1J59 A;  5BQT A;  2O61 A;  4HAM A;  2DK5 A;  3E3V A;  3H3U A;  4IF4 A;  3F8F A;  4A5M A;  4A6D A;  2QZ8 A;  1BBY A;  4BYY A;  1BJA A;  1NHA A;  3D5L A;  4CDG A;  4ASN A;  2UZK A;  2OZU A;  1Z05 A;  1LQ1 A;  2IP2 A;  5LHI A;  3HRT A;  3EDP A;  3R4K A;  4KUM A;  3I53 A;  3WU1 B;  1YQA A;  2VBY A;  5LGN A;  5JR3 A;  1SFX A;  3FM3 A;  1R22 A;  2QQ9 A;  2KJC A;  4I7H A;  2XV4 S;  1FLI A;  1SD6 A;  3KP2 A;  1TNT A;  2EFP A;  2Y0M A;  4Q48 A;  1X3U A;  2A6E F;  3JAM K;  1ZAO A;  4KN4 X;  4LJZ F;  1O3S A;  2E1N A;  1WWX A;  4CO8 A;  3BZ6 A;  4I01 A;  4EGY A;  4M6X A;  4KFC A;  4BQA A;  3I58 A;  4BNC A;  4H0E A;  1SD7 A;  4P9F A;  4NQW A;  2DW4 A;  4PGG A;  1IXS B;  2R7F A;  1XSV A;  4HF0 A;  1H9G A;  1HBX G;  1QQI A;  4RGS A;  2DT5 A;  2P5V A;  2ZNZ A;  4ENN A;  3HSF A;  5FFX A;  2E1C A;  1G3Y A;  3ZQ7 A;  1I5Z A;  2WTE A;  3CUQ B;  2KIU A;  2OQR A;  2H94 A;  2YU3 A;  3K1N A;  2XRO A;  3GEZ A;  4M9X A;  1SFE A;  1U8R A;  2MH2 A;  1FPQ A;  3FMS A;  1MDM A;  3V8L A;  3GZ6 A;  4RB0 A;  2VC1 A;  1XDU A;  3F22 A;  1Z6R A;  4WXC A;  1IN8 A;  4AIJ A;  1U78 A;  4F7Z A;  1ULY A;  2M8E A;  1ODD A;  1OKR A;  4EV0 A;  2DPU A;  3PFI A;  5E1W A;  3WE3 A;  2R7D A;  3TOA A;  5BMZ A;  4RB2 C;  1JHF A;  1TBX A;  4IRG A;  3MZY A;  2HKX A;  3GW2 A; 
#chains in the Genus database with same CATH topology
 2IGM A;  3AAF A;  1ETQ A;  2Y48 A;  2K7L A;  2RGV A;  2V26 A;  4I0B A;  2Q1Z B;  4XOT A;  1LDD A;  4LIT A;  4Q5S F;  2M1B A;  2KFD A;  1X58 A;  3F0C A;  3S2W A;  3W3C A;  1DQU A;  5FLX K;  1Y39 A;  1NG7 A;  4UV8 A;  1IV8 A;  3VFZ A;  4M74 A;  2AO9 A;  1ON1 A;  2PMZ N;  3ASN H;  4R79 A;  4NDL A;  4AIK A;  1D0X A;  3I3L A;  1Z3Y A;  1JKQ C;  2JSP A;  2FNA A;  5FRO A;  4CYD A;  2DJN A;  1JUS A;  2OUM A;  4BQN A;  1MBJ A;  2WBM A;  4HNV A;  2HI3 A;  4HEA 2;  2FD5 A;  1WJE A;  2JA2 A;  4HA8 A;  5E1X A;  4HOB A;  4M73 A;  1N25 A;  4MQV A;  1HOM A;  4ZTJ A;  1R7J A;  4O5V A;  2W57 A;  2IJL A;  2HQR A;  3L09 A;  3KX2 A;  2CQK A;  1CQT A;  2CUZ A;  3EUK L;  3BR1 A;  2R7R A;  3CCE I;  2E5Z A;  4BEH A;  1VQ6 I;  3MFK A;  3QYE A;  3TQN A;  2ELK A;  2P5K A;  2XKP A;  1I27 A;  4MGR A;  1XGM A;  3KP3 A;  4I99 C;  3F72 A;  3DKX A;  1FP1 D;  2E60 A;  1QVT A;  3ESW B;  3K1P A;  2NVX J;  1WI9 A;  3CCJ I;  3PO3 J;  2CW0 F;  4XLA A;  4XSX F;  3TGN A;  4F92 B;  3OYM A;  3ZMS A;  3SZG A;  4L9T A;  1X4O A;  3EUH A;  4LD5 A;  2KZG A;  4GCV A;  3GFJ A;  1F9N A;  1K7A A;  4Z2Y A;  4JX6 A;  4KIC A;  4M3D A;  2DA1 A;  3QP6 A;  3DF8 A;  2W7N A;  3N4M A;  3OYF A;  3HB9 A;  3VOE A;  4KMU X;  1Z6T A;  5DM6 F;  3DKY A;  4V19 K;  4ZDO A;  1M1E B;  4LIV A;  3KFW X;  4A3K J;  5FKO A;  1I50 J;  1PUF A;  1V4R A;  3JTG A;  2QM3 A;  3QRF F;  2DA2 A;  1IRZ A;  1TW3 A;  4EJV A;  5F08 A;  4L0Z B;  5EG0 B;  1R00 A;  3I64 A;  3ERM A;  3HBL A;  3IH3 A;  2EZL A;  2JJ7 A;  3W2A A;  3K4M A;  2NRA C;  4CHU A;  5FRM A;  4CA0 A;  3M8E A;  1QZZ A;  3GVA A;  3SZP A;  5J4Y A;  4P55 A;  5J8F A;  2QA4 I;  1G3W A;  3KET A;  3D5R C;  3FMR A;  4MQ9 F;  1GT0 C;  4DYQ A;  3HRM A;  3I4M J;  1GHC A;  1TW2 A;  1ZRF A;  4JQF A;  2LR8 A;  2XB5 A;  2A68 F;  2GQQ A;  3FXR A;  4EAT A;  1A6I A;  3J80 K;  5M5X J;  2EV5 A;  2F5V A;  3CUQ A;  5E8G A;  5IT9 K;  4A12 A;  2HPI A;  2E34 A;  1OIS A;  1OCC H;  1OCO H;  3QOE A;  1WZ2 A;  1RUO A;  3VSL A;  1UJ8 A;  2G9W A;  1RR7 A;  4FT8 A;  3ZQF A;  2H6B A;  1D8K A;  3WTW C;  4B4C A;  3GF2 A;  4LG3 A;  3LMM A;  3HRS A;  3HOV J;  3GXO A;  2HXO A;  2Y69 H;  1YJN I;  4CCJ A;  1K4T A;  2ETH A;  3W6J B;  3LSI A;  5D5X B;  2EQR A;  3C1D A;  2VB6 A;  3F8M A;  3S8P A;  3H3V K;  3S93 A;  2E2H J;  2L5Q A;  1Y0U A;  2LC2 A;  3CLQ A;  5FKK A;  1HW2 A;  2VE8 A;  3G1O A;  2Q0O A;  3DXJ F;  1Y1W J;  1JJ8 C;  2QBY A;  5EZH A;  5E18 F;  3GTJ J;  2L7Z A;  1S7O A;  3ZPL A;  3BJO A;  2VPL A;  1X4P A;  1RC9 A;  1RPW A;  2VKH A;  2P5L C;  3BG3 A;  3K4K A;  3I4N J;  5L3G A;  3NWS A;  1UEL B;  3BTJ A;  4KA4 A;  4CCK A;  1IRX A;  3CCV I;  3MKY B;  4AUX A;  2EIM H;  2UXX A;  1GDT A;  2LKS A;  2AQE A;  2G0E A;  4HNU A;  1ONV A;  4L9N A;  4BJ6 C;  1D1B A;  3QPH A;  3GTO J;  1N77 A;  1IDY A;  5C3E J;  3PL8 A;  3H0D A;  2VJI A;  2M4K A;  1AKH A;  2KJB A;  3VYT B;  4EM1 A;  1P6R A;  2AXT C;  3FF5 A;  2K85 A;  5AIP A;  5FKN A;  4GFB A;  1V54 H;  2VE9 A;  4YG2 F;  5HS7 A;  2L54 A;  5H6Q A;  5FJ8 J;  2OTJ I;  1RZ4 A;  2Z3Y A;  1YG2 A;  2PBI A;  1YTY A;  4ZDL A;  1OCZ H;  3PUF A;  1Z21 A;  1RRJ A;  2NVQ J;  3EET A;  1ZG3 A;  1P4X A;  3OYB A;  2FQ4 A;  2OF7 A;  2YPR A;  5E17 F;  1U5T A;  3HPG A;  2ZFW A;  2JT1 A;  1ZLJ A;  3TO7 A;  4KT6 A;  3Q0U A;  3KEY A;  2QGU A;  4ZYE A;  1ZK8 A;  5D5W B;  3QU6 A;  5CJ9 A;  2JA6 J;  5LD2 C;  3SFZ A;  3F3X A;  2CW8 A;  3E7L A;  3IWF A;  4QPO A;  4U7D A;  1N78 A;  2JUC A;  3GBG A;  3ZN0 A;  2R7S A;  1YX5 A;  1QPM A;  3C2G A;  1W5T A;  1V5G A;  1WGX A;  2LY1 A;  4LLL A;  5HNH A;  3AL0 B;  1MNE A;  4C30 A;  3BRO A;  5EEG A;  4DJA A;  3IH2 A;  4KMF A;  2LF8 A;  2Q2E B;  2JMW A;  3H92 A;  5L3D A;  1FSH A;  1VZ0 A;  1X1C A;  5EF6 A;  4IJA A;  2KMU A;  1FYK A;  2PMU A;  4IHY A;  2HDD A;  4NBQ A;  3ZN1 A;  3JSO A;  1R23 A;  4S0H B;  2BBY A;  5F04 A;  2HYG D;  1B9N A;  4AM3 A;  2HTS A;  2Y2Z A;  3COA C;  1XN7 A;  3WG7 H;  4JOM A;  1MMG A;  3AG3 H;  3HOW J;  4HW0 A;  2D5V A;  4MIM A;  4QLC U;  1T8I A;  1WJA A;  1MND A;  3RIR A;  1HW5 A;  1VFC A;  2R93 J;  2XAH A;  3L2U A;  1FMV A;  2FU4 A;  3BR6 A;  2UV1 A;  3MN2 A;  5HDG A;  4PSW A;  2CUF A;  2IXS A;  3FBN B;  2L9N A;  3VEP A;  3OMY A;  2HS5 A;  3MVP A;  3TO6 A;  4IHW A;  1ZHF A;  2RN7 A;  3HUG B;  2BY3 A;  2X6O A;  4J00 A;  2HVQ A;  2L4A A;  2I8D A;  4PCQ A;  5TGT A;  1LB2 A;  3KE2 A;  1YRN B;  2E7X A;  3K4L A;  4KNY A;  1O7L A;  1VTN C;  3C18 A;  3HHH A;  2R5Z A;  4O6J A;  2H1K A;  3VYS B;  2UUZ A;  4MFE A;  1HST A;  4EVI A;  4XM3 A;  1X1D A;  1W36 C;  5GPC A;  2PX9 A;  3QOD A;  2VN2 A;  4XLE A;  3L2V A;  2DFE A;  2IBD A;  2VJ4 A;  2M4G A;  3K2A A;  1T98 A;  4FAS D;  5GTI C;  3EUH C;  4PUS A;  4Y4R A;  2R7Z J;  2DI3 A;  4DZP A;  2MGQ A;  1QGP A;  2PG4 A;  2K5C A;  4UB6 C;  4BXU A;  4E4H A;  2EFO A;  1R58 A;  3JAM Z;  3CO6 C;  1BL0 A;  1RKW A;  1PUE E;  3JCU C;  1OYY A;  3RKX A;  2HKO A;  1BR1 A;  2DDB A;  2ESH A;  1TQM A;  5LRR A;  3OYJ A;  3OYG A;  1GLN A;  1KQ9 A;  2COM A;  5EZG A;  3X2Q H;  5TRD A;  2EA4 A;  3I9V 2;  1PP7 U;  1FEX A;  4PJM A;  1D5V A;  1ETW A;  3K70 D;  1OR7 A;  3GFL A;  1O7F A;  1CF7 B;  1QZE A;  3ZCO A;  5CVU A;  5FKL A;  3FK7 A;  3OS1 A;  1Y8Q B;  3T5X A;  1FOW A;  2CQQ A;  2E1M B;  4GYI A;  4YFK F;  4B47 A;  1BI2 A;  2VAS A;  2YX7 A;  2FRH A;  1HCR A;  1R1V A;  4U0Y A;  4FE7 A;  2OV7 A;  1OCT C;  2GWR A;  1PP8 F;  3UKG A;  4ZZD A;  2JSC A;  3MKW B;  4A0X A;  2O9L A;  1W7P B;  1LDJ A;  3H9J A;  4E70 A;  2X6X A;  3LL7 A;  4DIQ A;  5D5V B;  1G59 A;  1B8I A;  5E8I A;  4DYC A;  1U2W A;  3F21 A;  3K1M A;  3OOU A;  1WI3 A;  1HQC A;  2OC6 A;  2MBF A;  2CV2 A;  3O6B B;  1TL8 A;  3GZN B;  1WJF A;  2W84 A;  3GO5 A;  3K4B A;  1Z7L A;  2DU9 A;  4PDK A;  4BXF A;  4DZJ A;  6PAX A;  3CCU I;  1B4A A;  1QHH D;  2XAQ A;  2DO7 A;  3IV5 A;  2VXZ A;  4J19 A;  1K83 J;  3HSE A;  3F8N A;  1UZC A;  4HSR A;  2QQA A;  3MAJ A;  4TV7 A;  4LG0 B;  5BPI A;  1NK2 P;  1WH5 A;  3H3Z A;  4GGG A;  4CGZ A;  2H8R A;  3K10 A;  3DV8 A;  1ZLK A;  3HHG A;  2Z16 A;  2XSJ C;  1FTZ A;  2LDU A;  4RAF A;  2VOO A;  3ZOB A;  3E6M A;  3BCA A;  2E2J J;  3JRG A;  2A07 F;  2FF4 A;  2O5R A;  5EEH A;  4Y7N J;  5GTH C;  2VBZ A;  3DBH B;  4A3M J;  1FSE A;  4YFN F;  1XCB A;  3MMY B;  5J4V A;  4PJN A;  1IXC A;  5HOO A;  3S1R J;  3IUO A;  4HQM A;  3G1L A;  3GTM J;  2XGC A;  4KYW A;  1WCM J;  2FBI A;  3BR2 A;  4KIF A;  4R1H A;  2XVC A;  3AG2 H;  5E3N A;  2ZCW A;  3OL3 A;  4S04 A;  2W48 A;  2BYV E;  1JT6 A;  4LLN A;  3S1Q J;  4B3X A;  2MSY A;  4ITV A;  2XAF A;  1S6L A;  1C0W A;  3S1N J;  1U5T C;  1W4M A;  3GUD A;  4R8H A;  3IAS 2;  2QEX I;  3S14 J;  1FTT A;  3R60 A;  1WJC A;  3A1Y A;  4MFD A;  3D0S A;  4WX9 A;  1U6G A;  2FBK A;  2VKV A;  1D1A A;  4M6V A;  2DOD A;  3BP8 A;  2A61 A;  3J7A O;  2X4H A;  1KU2 A;  2F5E A;  4IHS A;  3WE2 A;  2HU9 A;  1FMW A;  3IHU A;  4P96 A;  3T8R A;  4C3H J;  3VWB A;  4ON0 A;  3FHN A;  4BY7 J;  2ZKZ A;  3M8F A;  1JKO C;  1QRY A;  3REO A;  4D5C A;  3L9F A;  5BOX A;  3J81 Z;  4MEY F;  1QU3 A;  2V7F A;  3GTL J;  2ECC A;  2P4W A;  5FLX Z;  2R7U A;  2CMP A;  1BN5 A;  1R1U A;  2W85 A;  4IQ4 A;  3HUG A;  2K9Q A;  3OYL A;  1HXD A;  2BV6 A;  5LBQ A;  5F0C A;  3MKZ A;  1DGR M;  5KVR A;  2XPU A;  4YIR X;  5K5R A;  4BXX J;  3HOU J;  3BJ6 A;  3HEF A;  4X6A J;  1EA3 A;  3G1M A;  4OIN F;  4PZJ A;  3BQY A;  3OY9 A;  4H4K C;  2HYJ A;  3A01 A;  2EFQ A;  3BR0 A;  2V6C A;  5F0H A;  3K0L A;  3HTS B;  2PMH A;  5J1U A;  3TKY A;  2P7C B;  1GVJ A;  1HDD C;  4CXF A;  2QLZ A;  4XRS A;  3RYR A;  1FJL A;  3IH4 A;  2FSW A;  5DUI A;  2DFH A;  4RGX A;  1XMX A;  5DV5 A;  2RVC A;  3U1D A;  3G73 A;  2O0Y A;  4LFU A;  2M2E A;  3V7R A;  3NQO A;  4A3E J;  4B1R A;  2DDA A;  2HR3 A;  3FM5 A;  2KIM A;  4BAY A;  1ZG5 A;  5JVG F;  1MSE C;  2Y30 A;  2PJP A;  3BZC A;  1IRG A;  3FKI J;  5CYV A;  2ZXH A;  2LBF B;  3W2V A;  3LQQ A;  4CYC B;  2ME6 A;  1YO5 C;  4C2M J;  1ETX A;  4BHB A;  2KIQ A;  4LIU A;  1XGN A;  4BQQ A;  2K4J A;  3SDG A;  4ZYH A;  3O8H A;  4A0Z A;  3CP8 A;  1YS7 A;  1BI0 A;  2EIL H;  2HEO A;  2O8K A;  4IHX A;  2LLK A;  1FYM A;  2VQC A;  3FX3 A;  3VDX A;  1R36 A;  4QSH A;  1FP2 A;  3F6O A;  2DBB A;  4I76 A;  2CUJ A;  2D1H A;  5J40 A;  1YIT I;  2WAQ A;  4RM3 A;  1VQO I;  2R5Y B;  3MD2 A;  1T6S A;  1J0R A;  1WPK A;  3S32 A;  5E1Z B;  3ASO H;  3OYN A;  3LSK A;  4AIH A;  1OR7 C;  1Z77 A;  3W2W A;  2CQX A;  3HYI A;  1AU7 A;  3R6S A;  3I71 A;  1MMD A;  4D9J A;  3J80 Z;  4XK4 A;  2QUF A;  2BZT A;  4XRS G;  1ZRE A;  5IT9 Z;  1GXP A;  3K7A J;  1GXQ A;  1LVK A;  4BAC A;  4XKC A;  1FOK A;  3GLX A;  4RLF A;  1IXR C;  2O8X A;  2OQG A;  1ZAR A;  3PUB A;  2WAQ N;  4ABZ A;  5J1R A;  5KNL A;  4A3J J;  3HJE A;  1V55 H;  4BDZ A;  2AS5 F;  4M9S A;  2FEZ A;  3F6V A;  1HW1 A;  4HYE A;  3U2R A;  3KCC A;  3A03 A;  5D6F A;  1MIJ A;  2XGD A;  3QPT A;  4RBO A;  1TWA J;  2EA2 A;  5KK1 A;  2EB7 A;  4XRF A;  3VPR A;  3DFG A;  2NNY A;  1K6Y A;  4ZZL A;  5GAG J;  3BPX A;  2HGC A;  1ITY A;  2VJ5 A;  2NAZ A;  1SAN A;  1WSU A;  4L18 B;  4BHC A;  5M5Y J;  1X1P A;  2RNG A;  3NRV A;  1QBJ A;  1JHH A;  2VQL A;  3HM5 A;  4KJZ A;  1K4S A;  1OPC A;  3JR9 A;  5CQE A;  3DP7 A;  1A31 A;  1EH8 A;  2X1D A;  4ANJ A;  1P9Q C;  1NK3 P;  4ZJZ A;  1DUX C;  4I0A A;  3ZMD A;  2L9R A;  3KP5 A;  2DMN A;  4YEJ A;  2GM4 A;  3LSR A;  1SAX A;  1ETY A;  3DCF A;  2P8T A;  1XMA A;  1F5T A;  5E3L A;  4KIS A;  2XPV A;  4HG2 A;  1G6N A;  2XKO A;  3IRQ A;  4PJ0 C;  3LAP A;  2R7V A;  1IDZ A;  2IW5 A;  3QPL A;  3TED A;  1AOY A;  4CCO A;  2K27 A;  1EF4 A;  2L3D A;  2DAO A;  3WTS C;  3J81 K;  4B8X A;  2WV0 A;  2P81 A;  2KHM A;  3BG6 A;  1YJW I;  2OBP A;  3JRH A;  2M0C A;  2DMQ A;  4XBF A;  4IOA F;  2GOM A;  4C3I J;  4OWR B;  2GXB A;  2IPQ X;  1NTC A;  3DU6 A;  3KZY A;  4W1U A;  4HRI A;  3CME I;  3GFI A;  1HKQ A;  4P9U A;  1MBH A;  2V1N A;  2R7W A;  4XL9 A;  3PIP F;  1SD4 A;  2RAE A;  5ERI A;  4K2E A;  1Q1V A;  3ERE D;  1E0E A;  5F64 A;  1BR2 A;  1D0Y A;  2KKO A;  4RAG A;  1WJB A;  1Y56 A;  4RAY A;  5JHU A;  2L02 A;  3HG9 A;  1HA8 A;  3HKZ A;  3ZMU A;  5D8K B;  1G3S A;  3CJT B;  4G9Y A;  3ZQC A;  1MBF A;  2Y0S A;  2XHK A;  3LST A;  5FB2 A;  2EIN H;  1YLF A;  2VOD A;  2VLA A;  4OIO F;  4Q4Z F;  3RI4 A;  2X9D A;  3CF2 A;  3TP0 A;  3ABT A;  2I10 A;  2ADU A;  4BY1 J;  1BOA A;  2M5W A;  4Y17 A;  2GIV A;  3BTC A;  4RA2 A;  5J8C A;  2DQR A;  2F4I A;  2STT A;  2V9K A;  2DN0 A;  4EM0 B;  2LKP A;  3WHB A;  3HL2 A;  4KIG A;  3QYB A;  2R7Q A;  1IUF A;  2CU7 A;  4EMS A;  2XRL A;  2LNB A;  2Y0S N;  3PQJ A;  3L2Q A;  1IV6 A;  1B59 A;  4U0V A;  1Z9C A;  5HNF A;  1S8N A;  4A3I J;  2EJR A;  2P6S A;  3WTV C;  2BY0 A;  5B66 C;  3I59 B;  3S3O A;  5ED4 A;  1H8A C;  2LRE A;  4OOI A;  1DDN A;  4UXN A;  2ZJP F;  1RR8 C;  3G6E I;  4G7H F;  3CCM I;  3DEE A;  2X0L A;  1ZG1 A;  2K3F A;  1BW6 A;  1FBU A;  2CO5 A;  2DA6 A;  2DOF A;  3SYT A;  1Z0X A;  2H6C A;  4RDU A;  2FML A;  4PFP A;  4L5J A;  5HS9 A;  3F9K A;  3CCQ I;  4UY8 I;  2KRF A;  2DK8 A;  3D1N I;  2KLO A;  1FYL A;  1OYW A;  4AYB A;  1Z1D A;  3FXO A;  1KQ0 A;  3HXL A;  4YEL A;  4I98 B;  3FBI B;  3FKJ A;  5B1B H;  1KGS A;  5HS8 A;  3BTL A;  5HLG A;  3RJP A;  3OSF A;  2LD5 A;  4N4N B;  1SVL A;  4XMY A;  3CC7 I;  3M1E A;  3VOD A;  3WTZ A;  2YSR A;  4HZF A;  1MGT A;  1BA5 A;  1A6Q A;  2ZME B;  3P9K A;  3LFK A;  2BE5 F;  2HOS A;  1PVE A;  1P4W A;  4IOC F;  1IN6 A;  3T1B A;  2GLO A;  4UVC A;  4MLO A;  3CJN A;  3KP4 A;  2V1U A;  2JVG A;  2WV1 A;  2CRG A;  2HZT A;  4AYB N;  1LVA A;  1UST A;  3OS0 A;  5KHD A;  1XSX A;  1B1B A;  5DDG A;  2LOO A;  4N9I A;  3BJA A;  1DP3 A;  3M1C A;  3PJR A;  5F6F A;  4XLN F;  2EPF A;  2IGK A;  5IP6 A;  1FOY A;  4EQQ A;  3L2C A;  1BC7 C;  3I4P A;  3V7S A;  1Y6I A;  3GTG J;  2KRH A;  1WJ5 A;  2WY8 Q;  2P7V B;  2EH3 A;  2GAU A;  2B0L A;  4BBR J;  5D6E A;  5L3E A;  1FBQ A;  1KZH A;  3DQV C;  3DWL E;  5FLM J;  3ZMT A;  1P92 A;  2HQ5 A;  4WCG A;  3G4S I;  4HV5 A;  2E7W A;  4FX4 A;  3N05 A;  3UNG C;  1ERD A;  5KAF C;  4AC0 A;  1L3L A;  1SAU A;  3ECO A;  1KYW A;  4RGU A;  4FX0 A;  4F55 A;  4GXO A;  1K78 B;  1VQ9 I;  2F5F A;  2WAD A;  3O3K A;  5JHF A;  4BL0 B;  2F5C A;  4LMY A;  2K9S A;  2KT0 A;  2NXN B;  1QA6 A;  4A93 J;  2NVT J;  2PN6 A;  5C4X J;  1KU9 A;  2NS7 A;  3TL4 X;  2ELH A;  1I3Q J;  4WWC A;  3S2D J;  2Y75 A;  2Y9Z A;  1KYZ A;  1OCR H;  2HOT A;  4MTD A;  4EGZ A;  2YUS A;  3E6B A;  5DM7 F;  4JX5 A;  4M3B A;  1O3Q A;  2ISY A;  3RPU D;  2FQ3 A;  4CZC A;  3K70 C;  3P9I A;  3V7C A;  3GCM A;  2RC4 A;  2L0K A;  2KIS A;  4M9Z A;  5AON A;  2EIJ H;  3JRC A;  3HIF A;  3WTU C;  2O6G E;  5LLQ A;  3C2H A;  3GYH X;  1R5G A;  1FZP B;  1UB9 A;  2CYY A;  4XN0 A;  1WFX A;  2Z9O A;  1X2M A;  2DXI A;  3RQI A;  2IA1 A;  3JSP A;  2CV1 A;  2XB0 X;  5E79 C;  1HSJ A;  1YYV A;  1N75 A;  5CVJ A;  1WQ2 A;  1FC3 A;  2LTP A;  2Y31 A;  2OPT A;  3D5S C;  1B9M A;  4MTE A;  4BQO A;  5FO5 A;  2J5O A;  2KP6 A;  3Q9S A;  2DMP A;  1JI8 A;  3ELK A;  2IRF G;  4NHJ A;  5HVQ C;  5F0F A;  4HV6 A;  1IG7 A;  1XSD A;  4UUV A;  2CQ7 A;  2ME0 A;  2NVY J;  2JTV A;  1OCP A;  4ENK A;  2E1O A;  4PFO A;  1P7I A;  5CVV A;  1W7P D;  2L4M A;  5L3C A;  2L9S A;  3AG4 H;  5M3F J;  3T0Y A;  3E5Q A;  1YHQ I;  3K4N A;  3ZQG A;  2R0Q C;  3I59 A;  1MBG A;  3F23 A;  3HPH A;  1J2X A;  1SFU A;  1EH6 A;  1I6X A;  4OIQ F;  4ESB A;  2VBX A;  1XPX A;  2A69 F;  3LNQ A;  1BW5 A;  1IW7 F;  4RLQ A;  3BDD A;  1ZH5 A;  4XIC A;  3S16 J;  5EG0 A;  5K5O A;  2EZH A;  2R3S A;  1USS A;  3I55 I;  2OD5 A;  1O57 A;  4MEX F;  4AID A;  4BKX A;  2JUG A;  2KZV A;  4YIF A;  3JRE A;  5JLX A;  1LPQ A;  4OU0 A;  2XF6 A;  2ZC2 A;  1KU3 A;  4YRV A;  2JPC A;  3FXJ A;  2FOW A;  4XQF A;  4DNC A;  3Q0W A;  2EV6 A;  2P0W A;  4E7I A;  1A5J A;  5LGT A;  1MH4 A;  1S7A A;  2E71 A;  1FOX A;  3H9Q A;  2EV0 A;  2Z5U A;  4D7M A;  1SFK A;  3UR3 C;  3CTA A;  4UNO A;  3DTK A;  3PO2 J;  3OYH A;  3IAM 2;  1FIA A;  2GBY A;  3FDY A;  3JRA A;  2IT0 A;  3LAJ A;  3M8J A;  1ACI A;  2BEO A;  3JRD A;  3G71 I;  1LDK B;  1VI0 A;  4G7O F;  5CLS A;  5ICE A;  4X0G A;  1H89 C;  4G8X A;  3VB2 A;  4ZH4 F;  5FLV A;  1VQ8 I;  4U0W A;  5FD5 A;  2DA5 A;  3I56 I;  3LSM A;  5HDK A;  2BVM A;  2WAE A;  4V2G A;  3HTU A;  4CUG A;  4DW6 A;  3RTR A;  4M3F A;  2VC0 A;  4MHG A;  5H6R A;  4EJO A;  4IRI A;  3W6V A;  1TQI A;  3OYD A;  4HDV A;  4LGW A;  3Q3S A;  2K4B A;  4LOC A;  1ZKG A;  5CVI A;  1MKM A;  2CQN A;  3SXY A;  4F3Q A;  1LEB A;  4M71 A;  3F8B A;  3JTH A;  4YII A;  3S3N A;  3CUQ C;  1PJR A;  5BS6 A;  3ZMZ A;  4ZYG A;  1JGS A;  4BH9 A;  1QNT A;  2DTR A;  1IC8 A;  4LK0 F;  2R7X A;  3FXQ A;  1EV7 A;  5BNG A;  3HGG A;  2OCE A;  3VYU B;  4UVA A;  3L2R A;  5FRN A;  1K78 A;  3ABK H;  3OWT A;  4FHT A;  4LB5 A;  3F8C A;  4QTR A;  1KON A;  1X2N A;  2BXZ A;  3RDI A;  4PJJ A;  2JPB A;  2FBH A;  1TT5 B;  3HRU A;  3PQK A;  5J1Y A;  2RQP A;  3KLN A;  3TOB A;  2A3S A;  2CV0 A;  4BUP A;  2HNH A;  2QEN A;  3ONQ A;  2EWN A;  4UV9 A;  1T33 A;  2MH9 A;  1AHD P;  1B6A A;  3BG9 A;  4GO1 A;  5F27 A;  4ENM A;  4B43 A;  2P6T A;  5DEQ A;  1L0O C;  1IN7 A;  2DT6 A;  4AVP A;  1D3Y A;  4IVN A;  1T38 A;  2TRT A;  4DOZ A;  3CDI A;  1REP C;  4G7Z F;  2WB1 A;  3V4G A;  3WOD F;  2DMU A;  5LRS A;  2E35 A;  1AWC A;  2JRM A;  3K69 A;  3CC4 I;  4C2T A;  4Q47 A;  2KPM A;  2F5D A;  3WGI A;  2PLY A;  2EBI A;  2XAU A;  1IF1 A;  1FX7 A;  2Q2E A;  3EYY A;  1DU0 A;  2IVM A;  3RCO A;  4BDY A;  2AHQ A;  3GTQ J;  3H5N A;  1LJ9 A;  3IKV A;  5ICG A;  2MC4 A;  5ILU A;  3MKL A;  3TP3 A;  2XF5 A;  5ICC A;  3BCB A;  1ZGW A;  3C7J A;  4NB5 A;  1E3O C;  5F1R A;  3KEQ A;  2Q8K A;  1ETO A;  1R5H A;  3G2B A;  3CMA I;  5IOZ A;  2EK5 A;  2GOX B;  3CJQ B;  4DYR A;  2MLK A;  1V5F A;  3R0A A;  2A5Y B;  9ANT A;  2QYO A;  2LMD A;  2MW8 A;  3CCS I;  1S3J A;  4ZC3 A;  1RES A;  1XCV A;  3EUA A;  2W82 A;  2NNN A;  5JVT A;  3ZP5 A;  3NEU A;  2OAZ A;  4E7L A;  3A0B C;  3ZR8 X;  2K9N A;  1YIJ I;  1I3A A;  4XON A;  4DBR A;  5L3B A;  4HF1 A;  1R9T J;  2VBW A;  4EJT A;  3FXL A;  4PGH A;  5DUK A;  3DKW A;  1MMA A;  3BWG A;  5K5Q A;  2GA1 A;  1ZTR A;  3CF5 F;  1P2F A;  2NOG A;  2RNJ A;  3ZQI A;  2RRE A;  3BG7 A;  3K4C A;  3O8G A;  3WGH A;  1YRN A;  5H20 A;  1KA8 A;  2VXD A;  4OAZ A;  4G6D A;  2MG4 A;  3FIW A;  4C9Y A;  1OYI A;  4P5O A;  3RPU A;  5ICF A;  3I0T A;  4FE4 A;  2LP0 A;  2Z99 A;  4II3 A;  1ZR4 A;  2FNP A;  4IXA A;  3BLY A;  3CES A;  5B3S H;  2BGC A;  2TDX A;  2HTJ A;  3FXM A;  1F1Z A;  2FMY A;  3PM1 A;  5J6X A;  5DCM B;  3IL2 A;  4XSZ F;  3TBI A;  1KU7 A;  4NUB A;  3MZH A;  1R5I D;  2WY7 Q;  1XB4 A;  3LSG A;  4EM2 A;  3GLL A;  4HX4 A;  4QWQ A;  2JZY A;  5LFA A;  5E3M A;  4XNF A;  1BR4 A;  1W0T A;  3B73 A;  3DBL B;  2KIF A;  1Y1V J;  2RKH A;  3FHZ A;  3ZQL A;  2X1E A;  3V42 A;  3S2H J;  4BE1 A;  4N0B A;  3FZV A;  3TW7 A;  1H9T A;  3Q5F A;  2RV8 A;  2L9V A;  2VKE A;  3KEO A;  1CF7 A;  4JBA A;  3CDH A;  2STW A;  2DOA A;  3WGG A;  2O03 A;  1Z7U A;  2BHY A;  4OIR F;  3CMY A;  3N97 A;  1JE8 A;  1V5E A;  1YE9 A;  5D5U B;  2VON A;  3CDL A;  2NOJ B;  4KN7 X;  3QAH A;  2XPW A;  2V9V A;  1LE8 B;  1IGN A;  4MNU A;  2MD5 A;  4IO9 F;  5C4J J;  2VT2 A;  5LGU A;  5FD6 A;  1UHW A;  1W7P A;  3HDD A;  3KP6 A;  2K40 A;  4E7J A;  4OIP F;  3K9T A;  2IGN A;  5HLH A;  3LSJ A;  1DP7 P;  2FUG 2;  4PK4 A;  1RUN A;  4HLX A;  5LHG A;  1T39 A;  2BXY A;  2HDW A;  4U88 A;  4XKB A;  3RKW A;  3R61 A;  4M3E A;  2M45 A;  1BIA A;  2V1X A;  5A2Q K;  3OYE A;  2F2E A;  3GX4 X;  1PUF B;  2AXL A;  2ZJ2 A;  1MMS A;  4EJW A;  3K6G A;  3M9A A;  2FA5 A;  2V79 A;  2VT3 A;  1V3F A;  3OL4 A;  3SEQ A;  3MWM A;  4LLG F;  3E5U A;  4C3J J;  4DGW B;  1ZEL A;  3PNV A;  1D0Z A;  4BJT A;  4BS9 A;  3BR5 A;  3OSG A;  2E36 A;  2PEX A;  2GA2 A;  3ABL H;  4LG0 A;  3LA2 A;  4ZYD A;  2CGP A;  5DD8 A;  2M3A A;  2W24 A;  4A2U A;  4IKF A;  1ZN2 A;  2XAJ A;  2B7E A;  2ZB9 A;  2QCO A;  3MCZ A;  2W1O A;  1E17 A;  1SMT A;  3U1K A;  4E7Z A;  3MEX A;  3QYF A;  1FT9 A;  3HSR A;  1DGW Y;  1D1C A;  3TMO A;  4Y13 A;  3ISP A;  1EH7 A;  2LKX A;  2DTZ A;  4XLP F;  5BPD A;  3DBR B;  2QSF X;  5K7F A;  2BY1 A;  2ESN A;  2XAS A;  1B72 B;  2O7O A;  2CFX A;  3SDB A;  1ZRD A;  1DPR A;  1A35 A;  4BGD A;  2JRT A;  3HOS A;  4XKV A;  1VQN I;  2F6C A;  4ESF A;  2V6E A;  2H27 A;  1UCR A;  2HVS A;  2QBY B;  5D8L B;  4XLH A;  4HLY A;  2IEK A;  1QPI A;  1BM9 A;  1D8J A;  1I1G A;  3QQA A;  2CH0 A;  4CCL A;  1Z91 A;  5HLT A;  1HF0 A;  4B09 A;  4UUS B;  2ZJR F;  4RAZ A;  2ID6 A;  5ILV A;  1I6H J;  1QHG A;  2OCC H;  3LA7 A;  4FQG A;  3AL0 C;  1E3P A;  4WK8 F;  2QKL B;  3FXU A;  1UG2 A;  5L3F A;  3KLO A;  3E97 A;  1JTY A;  2ZBK A;  3DTE A;  1AKH B;  4FET A;  4OMY A;  3OR1 C;  2DYR H;  2DFI A;  2FOK A;  2OTL I;  4N9H A;  2CFO A;  2LRD A;  5K1Y A;  3CCL I;  5FGM A;  3GTK J;  1RI7 A;  3W6K B;  2Y9Y A;  3DPL C;  1VQL I;  1GUU A;  2HDC A;  1J09 A;  5LHH A;  2R7O A;  1FNN A;  3CUO A;  2X1C A;  3TO9 A;  5DS9 A;  4IPA A;  5JLW A;  3E6D A;  3P5J A;  3SZT A;  1U5T B;  3IC7 A;  3K2Z A;  4RB3 C;  4XRM A;  1F4K A;  1TC3 C;  1UHS A;  3OYI A;  2RQQ A;  4Y15 A;  2NYX A;  3OYC A;  4N4O B;  5GAE J;  1XMK A;  3QOP A;  5DCM A;  3RPQ A;  4B48 A;  3IWZ A;  3BY6 A;  1R4N B;  3AFH A;  2DMT A;  1FBS A;  4PJL A;  3WTX C;  3EQL F;  5DD4 A;  1ZGJ A;  2IA2 A;  2DA4 A;  3SQN A;  2KQR A;  3R0J A;  4F52 A;  3OOP A;  2GIZ A;  2L7K A;  2L01 A;  1PYV A;  4OMZ A;  1VQP I;  3ROU A;  1TZL A;  3IRR A;  2CWE A;  2HOA A;  4ZTF A;  1H0M A;  1WKM A;  4BHP A;  4HBL A;  5JFR A;  4RGR A;  3HKZ N;  1GVD A;  4J01 A;  5B1A H;  2ZXI A;  3IP4 B;  2QQB A;  1LFP A;  1LUJ B;  1X19 A;  3VYR B;  1ON2 A;  1AA7 A;  1BOB A;  4E7K A;  2HOE A;  3LA3 A;  2LBF A;  3LQR A;  4CCN A;  5GPA A;  1U0J A;  1R71 A;  3Q0V A;  4CYC A;  1IRF A;  5D4S A;  1J5Y A;  2MA3 A;  2LVS A;  1YIO A;  1O4X A;  1RKT A;  2DYS H;  3HGY A;  5C44 J;  5CQG A;  1LE8 A;  3S3M A;  1T2K A;  2O3F A;  3AKZ A;  2NS8 A;  2CSO A;  4KIB A;  3J7A Y;  2F48 A;  1HDP A;  3TDU C;  1MMN A;  4RM2 A;  3FIS A;  1OLT A;  1S9H A;  3V8J A;  2BHZ A;  4KT5 C;  2A6H F;  4IHV A;  2HQN A;  1NH3 A;  2X6Y A;  3KP7 A;  2K86 A;  2ZO4 A;  3GME A;  2R5Y A;  1J9I A;  4XN3 A;  1TWG J;  2TCT A;  3BPV A;  1MD0 A;  5HLI A;  4ETS A;  2K02 A;  1ZRC A;  1RIO H;  1YW7 A;  4XKW A;  4KIT B;  3BQZ A;  4CZZ A;  3E5X A;  1UFM A;  5LEJ A;  2OJE D;  3JW4 A;  3CCY A;  3QP5 A;  5CPR B;  2MFZ A;  1TLH B;  2LG4 A;  2YS9 A;  4I2O A;  1DU6 A;  5CKT A;  2BOL A;  1BI1 A;  2E1M C;  5TJJ A;  4S05 A;  2R5Z B;  2L7M P;  1HKS A;  1X3W B;  4NC6 A;  1HC8 A;  4WF2 A;  2LSO A;  3ZXS A;  1K79 A;  1W5S A;  3WTY C;  1XC5 A;  3HOT A;  4Z6Y A;  2X51 A;  3WU2 C;  1IJW C;  3DPT A;  1IO2 A;  1PDN C;  3DEU A;  1JKR C;  1FY7 A;  3QPS A;  4CIC A;  1T0F A;  5IPA A;  2A6T A;  3ZMV A;  1A04 A;  1F36 A;  4WXH A;  3ULQ B;  1XGS A;  4D1Q A;  2IGO A;  3U21 A;  2PI0 A;  1W5C C;  2XAG A;  1O3R A;  3B6C A;  2JA8 J;  1B72 A;  3DTI A;  2XSD C;  3OS2 A;  2E5N A;  3QU3 A;  2ACJ A;  2G7U A;  1S29 A;  2Z33 A;  4IHT A;  3SHF A;  4NNJ A;  1ZQ3 P;  2AQF A;  2D45 A;  2M7B A;  5AIQ A;  3RZO J;  1IN4 A;  2LH9 A;  1X1B A;  3G3Z A;  3LFU A;  1KQ8 A;  2Z2S B;  3KIO A;  3BOQ A;  1QZY A;  4I6Z A;  1RNL A;  5HDN A;  2HWV A;  1MW7 A;  2N8G A;  4W97 A;  2F4O B;  4HPQ A;  4UUS A;  2HQA A;  4IZZ A;  4HQE A;  1Q1H A;  3J7Y J;  2EFW A;  1B8I B;  4UB8 C;  1X1A A;  3I54 A;  3OR2 C;  5F1J A;  4JK1 X;  3GZ5 A;  3V8K A;  4RS8 A;  2DA3 A;  1MJB A;  4ENJ A;  2F4M B;  2K9M A;  3EYI A;  1ETV A;  1T56 A;  3L00 A;  1Z3X A;  1OQY A;  3RKY A;  1IN5 A;  4F93 B;  4ESJ A;  2DJI A;  4HX8 A;  4WXD A;  4D5F A;  1SMY F;  1MJA A;  5FFZ A;  4XID A;  2VPR A;  2ELJ A;  2HVR A;  1JGG A;  3PNT A;  3KYD B;  1LKX A;  3ECH A;  5EEA A;  2M87 A;  3DEW A;  3MQ0 A;  2HFH A;  2KDO A;  2RDP A;  2QQ8 A;  1LFU P;  2OU2 A;  5E20 A;  4XOR A;  4QPQ A;  3A02 A;  3DU5 A;  1JKP C;  4AVZ A;  3OYA A;  2M8G X;  5J3L A;  2YU9 J;  5IY5 H;  3WTT C;  2EZK A;  2VI6 A;  4BE0 A;  5EYR A;  3Q9V A;  2D2W A;  3HC7 A;  2A5W A;  3HOX J;  2X85 A;  1GV5 A;  2B63 J;  3C2B A;  2H8W A;  1GV2 A;  4JP0 A;  2K3P A;  4U7B A;  1G3T A;  3PNY A;  2LK2 A;  4V2F A;  2JA5 J;  3OIP A;  3FMQ A;  4UVB A;  4L9V A;  1NG6 A;  3E6C C;  1VQM I;  3L7W A;  2K9L A;  2D1V A;  2YX4 A;  2CG4 A;  1O3T A;  4B44 A;  4HF2 A;  1Y8R B;  2ID3 A;  2V1D A;  3H5R A;  2MD0 A;  2FXA A;  1ZYR F;  3GTP J;  1BIB A;  3WU0 A;  4A6E A;  1IUY A;  4A3B J;  3CC2 I;  4D0P A;  2WWY A;  4KDP A;  4L9J A;  1I39 A;  2QVO A;  2J5P A;  1ORK A;  3T8T A;  3S1M J;  4CH7 A;  3FK6 A;  4EEF G;  3RYP A;  1OMI A;  1S72 I;  2GXA A;  3B02 A;  3ABM H;  1OFC X;  1XDS A;  1WRJ A;  2DLL A;  4A0Y A;  1UG0 A;  1BJZ A;  1UHM A;  1YW9 A;  2WC2 A;  3C3W A;  2PJR B;  3A4C A;  1SD5 A;  4A69 C;  3JRF A;  2L7F P;  4I09 A;  1JTX A;  3O2P E;  5KCM A;  2QSG X;  1EJ9 A;  2C6Y A;  1DPU A;  2MC3 A;  3FWE A;  2EFN A;  5E3O A;  3GWZ A;  1U3E M;  2VQH A;  2ZXJ A;  3H9G A;  3ML6 A;  2OZ6 A;  2IA0 A;  4YFX F;  2KDZ A;  3B6A A;  4II2 A;  1E2X A;  1MZB A;  1MBE A;  5IYC J;  5LEK A;  1CGP A;  2W25 A;  2ZFU A;  2ZME A;  4L5I A;  4A5N A;  3A01 B;  4G12 A;  1QO0 D;  2UXN A;  2XDV A;  2WA0 A;  4RMN A;  1SFO J;  4C2U A;  1HKT A;  3CJR B;  5CVR A;  1MJ9 A;  4A3L J;  1J7K A;  2IS2 A;  3P9C A;  2M7A A;  1IZ1 A;  4Y3O A;  3ZRG A;  2IS6 A;  3BR3 A;  2WAF A;  1TWH J;  2LF7 A;  3AG1 H;  1UAA A;  3NAU A;  5IT3 A;  3HOZ J;  2JN6 A;  1VND A;  4HX7 A;  1TWC J;  3OYK A;  2DQL A;  2ZNY A;  2B9S A;  4AWX B;  1YS6 A;  3ABU A;  1TNS A;  1LNW A;  2OA4 A;  1K61 A;  1A36 A;  4LK1 F;  4DQ2 A;  4IQJ A;  5H2F C;  4A3G J;  2GXG A;  2M0M A;  2XRN A;  1JXS A;  2W4S A;  5JI6 A;  2XIG A;  2QSH X;  2VJJ A;  3M3Y J;  2H1L A;  1YJ9 I;  4E7S A;  4FTH A;  3S15 J;  1Y0N A;  3M07 A;  1EKE A;  4HDU A;  1X3Z B;  3SEZ A;  1XGO A;  1G8X A;  4M72 A;  5GP9 A;  2GZW A;  4RB1 A;  4NQW B;  4DBQ A;  4FIS A;  3U9G A;  1G2H A;  2FE3 A;  1BC8 C;  5A2Q Z;  5HOD A;  4O3M A;  1XX5 A;  3RZD J;  5K7H A;  4HST A;  5IYD J;  5DYM A;  1T0F C;  2FJ1 A;  2ISZ A;  4G6Q A;  4XR6 A;  1JT0 A;  3H35 A;  2LY9 A;  4NC7 A;  2YR2 A;  5D4R A;  2CW7 A;  2XUB A;  4M6Y A;  1U9O A;  4GYG A;  3CZ6 A;  5FKM A;  2UWM A;  2H09 A;  4LB6 B;  1XTA A;  3IKT A;  1WHU A;  2M9H A;  3KZZ A;  4ZYA A;  2COB A;  1YFH A;  1MH3 A;  3RKQ A;  2HYF A;  3CLO A;  2BW3 B;  4IEJ A;  4OAY A;  3M4O J;  2VOP A;  2DPD A;  4EJU A;  2NS0 A;  1STZ A;  2M30 A;  2Z1D A;  2R4G A;  4UHT A;  2X6W A;  3TDZ C;  2XGE A;  4BBS J;  4L0Y B;  2FX0 A;  5ILS A;  3BZK A;  5IOY A;  1G4D A;  4G94 A;  4I02 A;  1VQ5 I;  3CO7 C;  3OV8 A;  2I5U A;  2VQG A;  1YI2 I;  1XD7 A;  1I1S A;  3GFM A;  3H1C A;  1P4A A;  3DPU A;  2HXI A;  3E1S A;  3KZI C;  2X48 A;  4JYK A;  1MDM B;  5EGO B;  3I5U A;  3BT9 A;  1FWZ A;  5J47 A;  2XC7 A;  4AD9 A;  3LWF A;  3RQ4 A;  2WB1 N;  5GAH J;  1J75 A;  4A3C J;  5GAD J;  1YW8 A;  1YOV B;  1K6O A;  2QWW A;  1R1T A;  2W00 A;  1IAW A;  1W0U A;  2CJJ A;  2LYC A;  4BE2 A;  3CP2 A;  3QWL A;  4XLC A;  5DTD A;  2PQ8 A;  1W36 D;  2VL8 A;  3M7G A;  3KYC B;  2ECB A;  4Y52 J;  2MAB A;  1ENH A;  2ZSI B;  1TWF J;  1ZGA A;  2PFB A;  1TQP A;  3NAR A;  4PSX A;  2XGX A;  1FIP A;  4M3G A;  1LEA A;  1S5L C;  4X1E A;  3EPZ A;  2L2O A;  4UUT A;  2EZI A;  3S17 J;  2DCE A;  1POG A;  2VUM J;  1TP4 A;  4IRH A;  2MLG A;  4B3A A;  2G7H A;  5DCF A;  2CS3 A;  3P7N A;  1TTY A;  2DFF A;  1JJ6 C;  1BI3 A;  1WH7 A;  3WG9 A;  1J59 A;  5BQT A;  2O61 A;  2IS1 A;  5B5E C;  1SEU A;  4HAM A;  2DK5 A;  3E3V A;  5IP9 J;  2NVU B;  3H3U A;  4IF4 A;  4BU2 A;  1Z67 A;  3H0G J;  3F8F A;  4A5M A;  3E0J B;  4A6D A;  1ETK A;  1E3H A;  1BBY A;  2QZ8 A;  3CD6 I;  1MSF C;  4BYY A;  1BJA A;  1NHA A;  3D5L A;  2V4J C;  4CDG A;  4HNT A;  2PJR A;  4ASN A;  1XG1 A;  2R92 J;  2M34 A;  4E6K G;  2IS4 A;  2UZK A;  1P7J A;  4JX4 A;  3JRB A;  2OZU A;  1Z05 A;  4FCY A;  4CCM A;  4NC8 A;  1LQ1 A;  1D5Y A;  3A2K A;  2KRC A;  2IP2 A;  5LHI A;  2KL4 A;  4QIW N;  3BC8 A;  3HRT A;  3EDP A;  3R4K A;  4KUM A;  3I53 A;  3WU1 B;  3BG5 A;  1YQA A;  2VBY A;  5LGN A;  5JR3 A;  1T08 B;  1SFX A;  5TIS C;  2VIX A;  5M3M J;  1R4M B;  1R22 A;  2HZD A;  2QQ9 A;  2KJC A;  3FM3 A;  4I7H A;  5K7Z A;  4A3F J;  4P1W A;  2XV4 S;  1FLI A;  3PIO F;  1VQK I;  3PFY A;  1SD6 A;  4CSW A;  3KP2 A;  1TNT A;  2EFP A;  1R49 A;  1W1W E;  2Y0M A;  3PSI A;  4Q48 A;  1X3U A;  2A6E F;  1APL C;  3JAM K;  1ZAO A;  4BEH B;  4KN4 X;  2BVL A;  3MZ8 A;  4LJZ F;  1O3S A;  3H5A A;  2A05 A;  2E1N A;  1WWX A;  1VQ7 I;  2JWT A;  2CUE A;  4CO8 A;  3BZ6 A;  2DA7 A;  1SVO A;  3CQZ J;  3WHC A;  4A3D J;  4I01 A;  1SVM A;  4EGY A;  3SFI A;  3A0H C;  4M6X A;  4KFC A;  3NWT A;  2LY2 A;  2EIK H;  4XLF A;  2ICW G;  2HPM A;  3DLA A;  4BQA A;  3DLL F;  3I58 A;  4BNC A;  3PSF A;  2ZME C;  1TT0 A;  3OIQ A;  2DT7 B;  4H0E A;  4IX7 A;  1T95 A;  1VF9 A;  1SD7 A;  4P9F A;  5IYB J;  4NQW A;  2DW4 A;  3KYL A;  2QF7 A;  4PGG A;  4XOP A;  5KAI C;  1IXS B;  1WJD A;  3SJM A;  2R7F A;  1F43 A;  1XSV A;  4GRI A;  3L2W A;  3CMM A;  1U8B A;  1HLV A;  3H36 A;  2JA7 J;  4HF0 A;  2JQ7 A;  1H9G A;  4Y33 A;  1HBX G;  1QQI A;  2JK3 A;  1S7E A;  5EJC A;  4RGS A;  3L1P A;  4BJ5 C;  2E19 A;  4AU7 A;  2DT5 A;  2DOE A;  2QKM B;  1MNM C;  2P5V A;  1QVU A;  2ZNZ A;  3TW6 A;  4ENN A;  3HSF A;  5FFX A;  4U87 A;  2E1C A;  1R6R A;  1MBK A;  3ZGK A;  2R7T A;  4G6T B;  2BW3 A;  1G3Y A;  3ZQ7 A;  2JVH A;  1I5Z A;  5IP7 J;  2WTE A;  3CUQ B;  2E2I J;  2KIU A;  1JUM A;  2OQR A;  2H94 A;  2YU3 A;  3K1N A;  2XRO A;  5EDN A;  3JRI A;  1ZR2 A;  3GEZ A;  3BTI A;  3ZQH A;  2MYS A;  4M9X A;  1WVR A;  2V9P A;  1SFE A;  2ZXW H;  3OIO A;  1U8R A;  2MH2 A;  3LOC A;  1FPQ A;  1JUP A;  3FMS A;  5EGO A;  1MDM A;  3V8L A;  4ZDP A;  3GZ6 A;  3FXK A;  4E7H A;  4D7N A;  4RB0 A;  2VC1 A;  1OJL A;  2IAI A;  4L5E A;  4GDF A;  1XDU A;  3RSN A;  3F22 A;  2LFB A;  1U9N A;  1RET A;  1Z6R A;  3KPH A;  2VKD A;  2ZJQ F;  4WXC A;  1IN8 A;  4AIJ A;  1U78 A;  4F91 B;  4F7Z A;  3HZJ A;  5M5W J;  1ULY A;  2M8E A;  1ODD A;  3K4J A;  1OKR A;  1H88 C;  4EV0 A;  2DPU A;  2BY2 A;  3PFI A;  3HOY J;  5E1W A;  2XF7 A;  3ZQQ A;  2ZSH B;  3WE3 A;  1XS9 A;  1LFB A;  2R7D A;  4IL6 C;  3LSP A;  3TOA A;  3J7Z I;  2PMZ A;  4MO7 A;  5BMZ A;  3LSH A;  3VSK A;  4RB2 C;  3CCR I;  1SC7 A;  1YX3 A;  1JHF A;  1TBX A;  4IRG A;  1VQ4 I;  1UMQ A;  3MZY A;  2HKX A;  3GW2 A; 
#chains in the Genus database with same CATH homology
 3AAF A;  2Y48 A;  2K7L A;  2RGV A;  4I0B A;  1LDD A;  4Q5S F;  2M1B A;  3S2W A;  5FLX K;  4UV8 A;  3VFZ A;  4M74 A;  1ON1 A;  4R79 A;  4AIK A;  2FNA A;  4CYD A;  4HA8 A;  5E1X A;  4HOB A;  4M73 A;  4MQV A;  1R7J A;  4O5V A;  2W57 A;  2IJL A;  2HQR A;  3L09 A;  2CQK A;  3MFK A;  3TQN A;  2P5K A;  2XKP A;  1I27 A;  4MGR A;  1XGM A;  3KP3 A;  3F72 A;  1FP1 D;  3K1P A;  1WI9 A;  2CW0 F;  4XSX F;  3TGN A;  3ZMS A;  4L9T A;  4LD5 A;  3EUH A;  4GCV A;  3GFJ A;  1F9N A;  1K7A A;  4Z2Y A;  4KIC A;  3QP6 A;  3DF8 A;  3N4M A;  3VOE A;  4KMU X;  1Z6T A;  3KFW X;  1V4R A;  3JTG A;  2QM3 A;  3QRF F;  1TW3 A;  4EJV A;  4L0Z B;  1R00 A;  3I64 A;  2NRA C;  4CHU A;  3M8E A;  1QZZ A;  3GVA A;  3SZP A;  4P55 A;  5J8F A;  1G3W A;  3KET A;  3FMR A;  4MQ9 F;  3HRM A;  1GHC A;  1TW2 A;  1ZRF A;  4JQF A;  2A68 F;  2GQQ A;  3FXR A;  3J80 K;  2EV5 A;  3CUQ A;  5E8G A;  5IT9 K;  4A12 A;  1RUO A;  2G9W A;  4FT8 A;  3WTW C;  2H6B A;  1D8K A;  3GF2 A;  3HRS A;  3GXO A;  2ETH A;  3W6J B;  5D5X B;  3C1D A;  3F8M A;  1Y0U A;  1HW2 A;  2VE8 A;  2QBY A;  2Q0O A;  3DXJ F;  5E18 F;  1S7O A;  3ZPL A;  3BJO A;  2P5L C;  5L3G A;  4KA4 A;  2UXX A;  1ONV A;  4L9N A;  3QPH A;  2KJB A;  4EM1 A;  1P6R A;  3FF5 A;  5AIP A;  2VE9 A;  4YG2 F;  5HS7 A;  2L54 A;  5H6Q A;  1RZ4 A;  2Z3Y A;  1YG2 A;  2PBI A;  1YTY A;  3EET A;  1ZG3 A;  1P4X A;  5E17 F;  2YPR A;  1U5T A;  2ZFW A;  2JT1 A;  1ZLJ A;  3TO7 A;  4ZYE A;  5D5W B;  3QU6 A;  5CJ9 A;  3SFZ A;  3F3X A;  3IWF A;  4U7D A;  3ZN0 A;  1QPM A;  1W5T A;  4LLL A;  3BRO A;  5EEG A;  4KMF A;  2LF8 A;  3H92 A;  5L3D A;  1FSH A;  4IJA A;  1FYK A;  2PMU A;  3ZN1 A;  3JSO A;  1R23 A;  2BBY A;  2HYG D;  1B9N A;  2HTS A;  3COA C;  1XN7 A;  4HW0 A;  4QLC U;  3RIR A;  1HW5 A;  2XAH A;  2FU4 A;  5HDG A;  3VEP A;  2HS5 A;  3TO6 A;  1ZHF A;  2RN7 A;  2L4A A;  4PCQ A;  1LB2 A;  3KE2 A;  2E7X A;  4KNY A;  1O7L A;  1VTN C;  3C18 A;  3HHH A;  4O6J A;  1HST A;  4EVI A;  2VN2 A;  1T98 A;  2DI3 A;  1QGP A;  2PG4 A;  4BXU A;  2EFO A;  1R58 A;  3JAM Z;  3CO6 C;  1PUE E;  1OYY A;  3RKX A;  2HKO A;  5LRR A;  2ESH A;  1TQM A;  5TRD A;  1KQ9 A;  2COM A;  1PP7 U;  2EA4 A;  1D5V A;  1OR7 A;  3GFL A;  1O7F A;  1CF7 B;  5CVU A;  3T5X A;  4GYI A;  4YFK F;  1BI2 A;  2YX7 A;  2FRH A;  1R1V A;  4U0Y A;  2GWR A;  1PP8 F;  4ZZD A;  2JSC A;  4A0X A;  1W7P B;  1LDJ A;  4E70 A;  5D5V B;  5E8I A;  1U2W A;  3F21 A;  3K1M A;  1HQC A;  2MBF A;  3O6B B;  2W84 A;  3GO5 A;  2DU9 A;  4PDK A;  6PAX A;  1B4A A;  2XAQ A;  2DO7 A;  2VXZ A;  3HSE A;  3F8N A;  2QQA A;  3MAJ A;  4TV7 A;  4LG0 B;  5BPI A;  3H3Z A;  4GGG A;  4CGZ A;  3DV8 A;  1ZLK A;  3HHG A;  2LDU A;  2VOO A;  3E6M A;  2A07 F;  2FF4 A;  5EEH A;  2VBZ A;  1FSE A;  4YFN F;  1XCB A;  1IXC A;  5HOO A;  4HQM A;  4KYW A;  2FBI A;  4KIF A;  4R1H A;  2XVC A;  2ZCW A;  4S04 A;  2BYV E;  4LLN A;  2XAF A;  1S6L A;  1C0W A;  1U5T C;  1W4M A;  3GUD A;  4R8H A;  3R60 A;  3D0S A;  4WX9 A;  1U6G A;  2FBK A;  3J7A O;  3BP8 A;  2A61 A;  2X4H A;  1KU2 A;  2F5E A;  4IHS A;  3WE2 A;  3IHU A;  4P96 A;  3T8R A;  4ON0 A;  2ZKZ A;  3M8F A;  3REO A;  3L9F A;  5BOX A;  3J81 Z;  4MEY F;  2P4W A;  5FLX Z;  1BN5 A;  1R1U A;  2W85 A;  3HUG A;  1HXD A;  2BV6 A;  5LBQ A;  5KVR A;  5K5R A;  3BJ6 A;  4OIN F;  4PZJ A;  2EFQ A;  2V6C A;  3K0L A;  3HTS B;  2PMH A;  3TKY A;  2P7C B;  1GVJ A;  4CXF A;  2QLZ A;  3RYR A;  2FSW A;  5DUI A;  4RGX A;  5DV5 A;  2RVC A;  3U1D A;  3G73 A;  2O0Y A;  4LFU A;  3V7R A;  3NQO A;  2HR3 A;  3FM5 A;  2KIM A;  4BAY A;  1ZG5 A;  2PJP A;  1IRG A;  5CYV A;  3LQQ A;  1YO5 C;  4BHB A;  1XGN A;  2K4J A;  4ZYH A;  4A0Z A;  1YS7 A;  1BI0 A;  2HEO A;  1FYM A;  3FX3 A;  1R36 A;  1FP2 A;  3F6O A;  2DBB A;  2D1H A;  1T6S A;  1J0R A;  5E1Z B;  4AIH A;  3HYI A;  3R6S A;  3I71 A;  3J80 Z;  2QUF A;  1ZRE A;  5IT9 Z;  1GXP A;  1GXQ A;  1FOK A;  3GLX A;  1IXR C;  2O8X A;  2OQG A;  1ZAR A;  2AS5 F;  4M9S A;  2FEZ A;  3F6V A;  1HW1 A;  4HYE A;  3U2R A;  3KCC A;  5D6F A;  3QPT A;  2EA2 A;  5KK1 A;  2EB7 A;  4XRF A;  3DFG A;  2NNY A;  4ZZL A;  3BPX A;  2HGC A;  2NAZ A;  1WSU A;  4L18 B;  4BHC A;  3NRV A;  1QBJ A;  1JHH A;  1OPC A;  3DP7 A;  1EH8 A;  1DUX C;  4I0A A;  3ZMD A;  3KP5 A;  1SAX A;  2P8T A;  1XMA A;  1F5T A;  1G6N A;  2XKO A;  3IRQ A;  3LAP A;  2IW5 A;  1AOY A;  2K27 A;  2L3D A;  2DAO A;  3WTS C;  3J81 K;  4B8X A;  2WV0 A;  2OBP A;  4XBF A;  2GXB A;  2IPQ X;  3KZY A;  3GFI A;  1HKQ A;  4P9U A;  1SD4 A;  5ERI A;  4K2E A;  3ERE D;  5F64 A;  2KKO A;  4RAY A;  5JHU A;  2L02 A;  3ZMU A;  5D8K B;  1G3S A;  4G9Y A;  2XHK A;  3LST A;  5FB2 A;  1YLF A;  2VOD A;  4OIO F;  4Q4Z F;  3RI4 A;  3ABT A;  2ADU A;  1BOA A;  2M5W A;  4Y17 A;  2GIV A;  5J8C A;  2DQR A;  2STT A;  4EM0 B;  2LKP A;  4KIG A;  4EMS A;  3PQJ A;  2LNB A;  1B59 A;  4U0V A;  1Z9C A;  1S8N A;  2EJR A;  2P6S A;  3WTV C;  3I59 B;  5ED4 A;  4OOI A;  1DDN A;  4UXN A;  4G7H F;  2X0L A;  1ZG1 A;  1FBU A;  2CO5 A;  2H6C A;  2FML A;  4L5J A;  5HS9 A;  2KRF A;  2DK8 A;  1FYL A;  1OYW A;  1Z1D A;  1KQ0 A;  4I98 B;  1KGS A;  5HS8 A;  5HLG A;  3RJP A;  3M1E A;  3VOD A;  3WTZ A;  2YSR A;  4HZF A;  1MGT A;  2ZME B;  3P9K A;  3LFK A;  2BE5 F;  1P4W A;  1IN6 A;  3T1B A;  4UVC A;  3CJN A;  3KP4 A;  2V1U A;  2HZT A;  1LVA A;  1UST A;  1XSX A;  1B1B A;  5DDG A;  4N9I A;  3BJA A;  5F6F A;  4XLN F;  4EQQ A;  3L2C A;  1BC7 C;  3I4P A;  3V7S A;  2P7V B;  2GAU A;  2B0L A;  5D6E A;  5L3E A;  1FBQ A;  3DQV C;  3ZMT A;  1P92 A;  4WCG A;  4HV5 A;  2E7W A;  4FX4 A;  1L3L A;  3ECO A;  1KYW A;  4RGU A;  4FX0 A;  4GXO A;  1K78 B;  2F5F A;  3O3K A;  2F5C A;  4LMY A;  2PN6 A;  1KU9 A;  2ELH A;  4WWC A;  2Y75 A;  1KYZ A;  4MTD A;  4EGZ A;  3E6B A;  1O3Q A;  2ISY A;  2FQ3 A;  3P9I A;  3V7C A;  2RC4 A;  4M9Z A;  5AON A;  3HIF A;  3WTU C;  2O6G E;  5LLQ A;  3GYH X;  1R5G A;  1FZP B;  1UB9 A;  2CYY A;  2Z9O A;  2IA1 A;  3JSP A;  1HSJ A;  1YYV A;  5CVJ A;  1WQ2 A;  1FC3 A;  1B9M A;  4MTE A;  5FO5 A;  2J5O A;  3Q9S A;  3ELK A;  2IRF G;  4NHJ A;  5HVQ C;  4HV6 A;  1XSD A;  4UUV A;  2JTV A;  4ENK A;  5CVV A;  1W7P D;  5L3C A;  2L4M A;  3T0Y A;  3E5Q A;  3I59 A;  3F23 A;  1J2X A;  1SFU A;  1EH6 A;  1I6X A;  4OIQ F;  4ESB A;  2VBX A;  2A69 F;  1IW7 F;  3BDD A;  1ZH5 A;  5K5O A;  2R3S A;  1USS A;  2OD5 A;  1O57 A;  4MEX F;  4YIF A;  4OU0 A;  1KU3 A;  2JPC A;  4DNC A;  2EV6 A;  5LGT A;  1S7A A;  2EV0 A;  2Z5U A;  3CTA A;  4UNO A;  2IT0 A;  3LAJ A;  2BEO A;  1LDK B;  4G7O F;  5ICE A;  5CLS A;  4G8X A;  3VB2 A;  4ZH4 F;  4U0W A;  5FD5 A;  5HDK A;  3HTU A;  3RTR A;  4EJO A;  2VC0 A;  4MHG A;  5H6R A;  4IRI A;  1TQI A;  4HDV A;  4LGW A;  2K4B A;  5CVI A;  1MKM A;  3SXY A;  1LEB A;  4M71 A;  3F8B A;  3JTH A;  4YII A;  3CUQ C;  5BS6 A;  3ZMZ A;  4ZYG A;  1JGS A;  4BH9 A;  1QNT A;  2DTR A;  4LK0 F;  3FXQ A;  1EV7 A;  4UVA A;  1K78 A;  4FHT A;  4LB5 A;  3F8C A;  3RDI A;  2JPB A;  2FBH A;  3HRU A;  3PQK A;  2RQP A;  3KLN A;  3TOB A;  2A3S A;  2QEN A;  2EWN A;  4UV9 A;  2MH9 A;  1B6A A;  4ENM A;  4GO1 A;  2P6T A;  5DEQ A;  1L0O C;  1IN7 A;  4AVP A;  1D3Y A;  4IVN A;  1T38 A;  1REP C;  4G7Z F;  3WOD F;  3V4G A;  5LRS A;  1AWC A;  3K69 A;  4Q47 A;  2F5D A;  3WGI A;  2PLY A;  1IF1 A;  1FX7 A;  2Q2E A;  3EYY A;  2IVM A;  1LJ9 A;  3IKV A;  5ICG A;  5ILU A;  5ICC A;  3C7J A;  4NB5 A;  5F1R A;  3KEQ A;  2Q8K A;  1R5H A;  2EK5 A;  2MLK A;  3R0A A;  2A5Y B;  2QYO A;  1S3J A;  1XCV A;  2NNN A;  5JVT A;  3ZP5 A;  3NEU A;  2OAZ A;  5L3B A;  4HF1 A;  2VBW A;  4EJT A;  4PGH A;  5DUK A;  3DKW A;  3BWG A;  5K5Q A;  2GA1 A;  1P2F A;  2RNJ A;  3WGH A;  5H20 A;  1KA8 A;  4G6D A;  1OYI A;  4P5O A;  3RPU A;  5ICF A;  3I0T A;  2Z99 A;  2FNP A;  4IXA A;  2BGC A;  2TDX A;  2HTJ A;  1F1Z A;  2FMY A;  5J6X A;  5DCM B;  3IL2 A;  4XSZ F;  1KU7 A;  3MZH A;  1XB4 A;  4EM2 A;  4HX4 A;  4QWQ A;  2JZY A;  3B73 A;  2KIF A;  2RKH A;  3FHZ A;  4N0B A;  3FZV A;  1H9T A;  3Q5F A;  2RV8 A;  3KEO A;  1CF7 A;  4JBA A;  3CDH A;  2STW A;  3WGG A;  2O03 A;  1Z7U A;  3N97 A;  4OIR F;  1JE8 A;  5D5U B;  2VON A;  4KN7 X;  3QAH A;  2V9V A;  4MNU A;  2MD5 A;  2VT2 A;  5LGU A;  5FD6 A;  1UHW A;  1W7P A;  3KP6 A;  4OIP F;  3K9T A;  5HLH A;  1DP7 P;  1RUN A;  4HLX A;  5LHG A;  1T39 A;  4U88 A;  3RKW A;  3R61 A;  2M45 A;  1BIA A;  2V1X A;  5A2Q K;  2F2E A;  3GX4 X;  2AXL A;  2ZJ2 A;  4EJW A;  3M9A A;  2FA5 A;  2V79 A;  2VT3 A;  1V3F A;  3MWM A;  4LLG F;  3E5U A;  2PEX A;  2GA2 A;  4LG0 A;  3LA2 A;  4ZYD A;  2CGP A;  5DD8 A;  2W24 A;  4A2U A;  1ZN2 A;  2XAJ A;  1E17 A;  3MCZ A;  1SMT A;  3MEX A;  1FT9 A;  3HSR A;  4Y13 A;  3ISP A;  1EH7 A;  4XLP F;  5BPD A;  2ESN A;  2XAS A;  2CFX A;  1ZRD A;  1DPR A;  2JRT A;  3HOS A;  4ESF A;  2H27 A;  1UCR A;  2QBY B;  5D8L B;  4HLY A;  1BM9 A;  1D8J A;  1I1G A;  1Z91 A;  4B09 A;  4RAZ A;  5ILV A;  3LA7 A;  4WK8 F;  3FXU A;  5L3F A;  3KLO A;  3E97 A;  2ZBK A;  4OMY A;  2FOK A;  2DFI A;  4N9H A;  5K1Y A;  5FGM A;  1RI7 A;  3W6K B;  3DPL C;  2HDC A;  5LHH A;  1FNN A;  3CUO A;  3TO9 A;  4IPA A;  3E6D A;  3SZT A;  1U5T B;  3IC7 A;  3K2Z A;  4RB3 C;  1F4K A;  4Y15 A;  2NYX A;  1XMK A;  3QOP A;  5DCM A;  3RPQ A;  3IWZ A;  3BY6 A;  1FBS A;  3WTX C;  3EQL F;  5DD4 A;  1ZGJ A;  2IA2 A;  3SQN A;  3R0J A;  3OOP A;  2L01 A;  4OMZ A;  3ROU A;  3IRR A;  2CWE A;  1H0M A;  1WKM A;  4BHP A;  4HBL A;  5JFR A;  4RGR A;  2QQB A;  1ON2 A;  2HOE A;  3LA3 A;  3LQR A;  1IRF A;  5D4S A;  1J5Y A;  2MA3 A;  1YIO A;  1T2K A;  2O3F A;  4KIB A;  2CSO A;  3TDU C;  3V8J A;  4KT5 C;  2A6H F;  2HQN A;  3KP7 A;  2K86 A;  2ZO4 A;  1J9I A;  3BPV A;  1MD0 A;  5HLI A;  4ETS A;  2K02 A;  1ZRC A;  1RIO H;  1YW7 A;  4CZZ A;  3E5X A;  1UFM A;  5LEJ A;  3JW4 A;  3QP5 A;  1TLH B;  4I2O A;  5TJJ A;  1BI1 A;  4S05 A;  1HKS A;  4WF2 A;  2LSO A;  1K79 A;  1W5S A;  3WTY C;  3HOT A;  3DPT A;  1PDN C;  3DEU A;  1FY7 A;  4CIC A;  1T0F A;  3ZMV A;  1A04 A;  4WXH A;  3ULQ B;  1XGS A;  2PI0 A;  1O3R A;  2XAG A;  3QU3 A;  2ACJ A;  2G7U A;  1S29 A;  2Z33 A;  4IHT A;  3SHF A;  2D45 A;  5AIQ A;  1IN4 A;  3G3Z A;  1KQ8 A;  3BOQ A;  1QZY A;  1RNL A;  5HDN A;  2HWV A;  4HQE A;  1Q1H A;  2EFW A;  3I54 A;  4JK1 X;  3GZ5 A;  3V8K A;  4RS8 A;  1MJB A;  4ENJ A;  3EYI A;  3L00 A;  3RKY A;  1IN5 A;  4ESJ A;  4HX8 A;  4WXD A;  1SMY F;  1MJA A;  5FFZ A;  3ECH A;  2M87 A;  3MQ0 A;  2HFH A;  2RDP A;  2OU2 A;  5E20 A;  3WTT C;  3Q9V A;  2D2W A;  4U7B A;  1G3T A;  3FMQ A;  4UVB A;  4L9V A;  3E6C C;  3L7W A;  2D1V A;  2YX4 A;  2CG4 A;  1O3T A;  4HF2 A;  2V1D A;  2FXA A;  1ZYR F;  1BIB A;  3WU0 A;  4A6E A;  1IUY A;  4D0P A;  2WWY A;  4KDP A;  4L9J A;  2QVO A;  2J5P A;  3T8T A;  3RYP A;  1OMI A;  3B02 A;  1XDS A;  4A0Y A;  1WRJ A;  2DLL A;  1UHM A;  1YW9 A;  2WC2 A;  3C3W A;  1SD5 A;  4I09 A;  3O2P E;  2C6Y A;  1DPU A;  2MC3 A;  3FWE A;  2EFN A;  3GWZ A;  1U3E M;  2ZXJ A;  3ML6 A;  2OZ6 A;  2IA0 A;  4YFX F;  1E2X A;  1MZB A;  5LEK A;  1CGP A;  2W25 A;  2ZME A;  4L5I A;  4A5N A;  1QO0 D;  2UXN A;  1HKT A;  5CVR A;  1MJ9 A;  1J7K A;  3P9C A;  1IZ1 A;  2LF7 A;  5IT3 A;  4HX7 A;  2DQL A;  2ZNY A;  4AWX B;  1YS6 A;  3ABU A;  1TNS A;  1LNW A;  2OA4 A;  4LK1 F;  4DQ2 A;  2GXG A;  2XRN A;  1JXS A;  5JI6 A;  2XIG A;  4HDU A;  1XGO A;  4M72 A;  2GZW A;  4RB1 A;  3U9G A;  2FE3 A;  1BC8 C;  5A2Q Z;  4O3M A;  5DYM A;  2ISZ A;  4G6Q A;  2YR2 A;  5D4R A;  2XUB A;  4M6Y A;  4GYG A;  2UWM A;  2H09 A;  4LB6 B;  3IKT A;  3KZZ A;  1YFH A;  2HYF A;  3CLO A;  2VOP A;  2DPD A;  4EJU A;  2NS0 A;  1STZ A;  2M30 A;  4UHT A;  3TDZ C;  4L0Y B;  5ILS A;  1G4D A;  4G94 A;  4I02 A;  3CO7 C;  3OV8 A;  1XD7 A;  1I1S A;  3GFM A;  1P4A A;  1MDM B;  3I5U A;  1FWZ A;  1J75 A;  4AD9 A;  3LWF A;  1YW8 A;  1K6O A;  2QWW A;  1R1T A;  1IAW A;  2PQ8 A;  3M7G A;  1ZGA A;  2PFB A;  1TQP A;  2XGX A;  1LEA A;  4IRH A;  2MLG A;  2G7H A;  5DCF A;  3P7N A;  1TTY A;  1BI3 A;  3WG9 A;  1J59 A;  5BQT A;  2O61 A;  4HAM A;  2DK5 A;  3E3V A;  3H3U A;  4IF4 A;  3F8F A;  4A5M A;  4A6D A;  2QZ8 A;  1BBY A;  4BYY A;  1BJA A;  1NHA A;  3D5L A;  4CDG A;  4ASN A;  2UZK A;  2OZU A;  1Z05 A;  1LQ1 A;  2IP2 A;  5LHI A;  3HRT A;  3EDP A;  3R4K A;  4KUM A;  3I53 A;  3WU1 B;  1YQA A;  2VBY A;  5LGN A;  5JR3 A;  1SFX A;  3FM3 A;  1R22 A;  2QQ9 A;  2KJC A;  4I7H A;  2XV4 S;  1FLI A;  1SD6 A;  3KP2 A;  1TNT A;  2EFP A;  2Y0M A;  4Q48 A;  1X3U A;  2A6E F;  3JAM K;  1ZAO A;  4KN4 X;  4LJZ F;  1O3S A;  2E1N A;  1WWX A;  4CO8 A;  3BZ6 A;  4I01 A;  4EGY A;  4M6X A;  4KFC A;  4BQA A;  3I58 A;  4BNC A;  4H0E A;  1SD7 A;  4P9F A;  4NQW A;  2DW4 A;  4PGG A;  1IXS B;  2R7F A;  1XSV A;  4HF0 A;  1H9G A;  1HBX G;  1QQI A;  4RGS A;  2DT5 A;  2P5V A;  2ZNZ A;  4ENN A;  3HSF A;  5FFX A;  2E1C A;  1G3Y A;  3ZQ7 A;  1I5Z A;  2WTE A;  3CUQ B;  2KIU A;  2OQR A;  2H94 A;  2YU3 A;  3K1N A;  2XRO A;  3GEZ A;  4M9X A;  1SFE A;  1U8R A;  2MH2 A;  1FPQ A;  3FMS A;  1MDM A;  3V8L A;  3GZ6 A;  4RB0 A;  2VC1 A;  1XDU A;  3F22 A;  1Z6R A;  4WXC A;  1IN8 A;  4AIJ A;  1U78 A;  4F7Z A;  1ULY A;  2M8E A;  1ODD A;  1OKR A;  4EV0 A;  2DPU A;  3PFI A;  5E1W A;  3WE3 A;  2R7D A;  3TOA A;  5BMZ A;  4RB2 C;  1JHF A;  1TBX A;  4IRG A;  3MZY A;  2HKX A;  3GW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...