3BOQA

Crystal structure of marr family transcriptional regulator from silicibacter pomeroyi
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
136
Chain Sequence
KSDRQQNQTRLWLNILRLHGLVFGDLNRQLLDETGLSLAKFDAMAQLARNPDGLSMGKLSGALKVTNGNVSGLVNRLIKDGMVVKAFSAKLTDAGLTTFKQASEAHNRILAELLRAVSDQDMVEASAALRGILESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structure of MarR family transcriptional regulator.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription regulator
total genus 43
structure length 136
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3boqA00
3K1NA 4KDPA 4S04A 2HKXA 3J80Z 3RPQA 4GYIA 3CTAA 4RGRA 4LK1F 2IW5A 2KRFA 2DAOA 1IRFA 2E1CA 3T8RA 3ECHA 2QQ9A 2PG4A 3I58A 4BHCA 1IN8A 2CG4A 1O3QA 1RUNA 1Z05A 3G3ZA 2YSRA 2Q0OA 1U2WA 3TGNA 3F21A 1MDMA 3HRMA 2EFPA 3GZ6A 3CJNA 3SFZA 1R58A 4AD9A 3GZ5A 2EA4A 1ZLKA 4A5NA 2P5KA 3FZVA 5FLXZ 3F72A 1UCRA 4KT5C 1RNLA 1P4XA 5TJJA 5A2QK 4U88A 1R7JA 1W7PB 4ASNA 2EFWA 2MH9A 1ONVA 1HSTA 2R3SA 3GO5A 3BY6A 4R8HA 1D5VA 1QZYA 2E1NA 1H9TA 2XRNA 2JZYA 3T1BA 4LD5A 4ZYHA 3E6DA 5A2QZ 1NHAA 3SQNA 4Y17A 2KJBA 3LAJA 2O0YA 4UVCA 2CSOA 5L3GA 1FSEA 3E6CC 2BEOA 4NB5A 2P7VB 1KGSA 3R4KA 3L09A 1ZGAA 5IT9K 4FX0A 5E8GA 2IT0A 4L0YB 2ESHA 1GXPA 4XBFA 3F6OA 4OU0A 4GO1A 1ON1A 4KN4X 4YG2F 4IRIA 4UNOA 1XGSA 2Q8KA 5F6FA 2H09A 3U9GA 1J7KA 2MA3A 3QU3A 4M71A 4L0ZB 3JSPA 2FRHA 3RYPA 1W7PA 1WKMA 2PLYA 1XGOA 1S7AA 3O3KA 5D5UB 2FSWA 1FWZA 3ZMDA 2W84A 4XLPF 1XN7A 5ILSA 1R23A 2HTJA 3RIRA 4G7HF 4HBLA 3V8LA 3ZN0A 5L3EA 1W7PD 4RB1A 3HRTA 1KQ0A 4PGHA 2P5VA 1T38A 3GEZA 3TQNA 1ZARA 1FY7A 2BGCA 1G3SA 2CWEA 1S7OA 3R0AA 3L7WA 4LJZF 5ICEA 5LGUA 2D1VA 2F5FA 2PN6A 2M87A 3DP7A 1LJ9A 1QQIA 1J2XA 4Q48A 1USTA 3D0SA 1FP1D 4HF0A 1OYYA 1G4DA 2VXZA 2Y75A 1EH6A 3GFLA 6PAXA 3ZMSA 1GHCA 4OOIA 1EV7A 2XAJA 2DLLA 1QPMA 4WCGA 2FU4A 3QRFF 3WTSC 3ZMVA 3RKYA 2ZCWA 1JE8A 2L4AA 1EH8A 1G3YA 3GXOA 4N0BA 3BROA 2YU3A 2A68F 4UV8A 5HDNA 5E17F 2WTEA 1FNNA 3EDPA 2PJPA 2XHKA 4A6EA 4YFNF 5ICGA 2H6BA 3OV8A 2D2WA 3SZTA 4TV7A 3ROUA 3VEPA 1U5TC 3GF2A 2UXXA 3HSRA 4G94A 5LHGA 2AS5F 1BI0A 4KIFA 4O5VA 4DQ2A 2VE9A 2K02A 4HF2A 3KP5A 3I64A 3KLOA 5E1XA 5E1ZB 1BI3A 4NHJA 3PQKA 2V79A 2TDXA 2OQGA 4A5MA 3FWEA 2Z9OA 2XIGA 2HYGD 3H3ZA 4LLGF 3BJAA 1YTYA 4OIRF 3KZZA 4EVIA 2NYXA 5L3FA 4BNCA 2O8XA 1PP7U 4RGSA 1TQMA 3I54A 3MZHA 5HS9A 3K0LA 4I09A 4M72A 5LGTA 2DPUA 4OMZA 5FFXA 1C0WA 3V4GA 4IJAA 3J81K 1FZPB 3ML6A 1YW8A 3E3VA 3R6SA 3E5QA 1WRJA 2OZ6A 4HV5A 1AOYA 1XMKA 1B4AA 4QWQA 1U8RA 1E17A 1SD5A 3GUDA 4XSZF 1XSXA 2EV5A 2FF4A 1ZGJA 2XAHA 1J59A 3I5UA 1UHMA 1S6LA 2DBBA 3ULQB 2NAZA 3MEXA 1P92A 1ZRFA 3RKXA 1Z6TA 2GZWA 2RC4A 1JHHA 5DV5A 2VC1A 1I1GA 1IN7A 3I4PA 5K5OA 4MTDA 1B6AA 5LGNA 4EQQA 4P9FA 4D0PA 3CUQA 1DUXC 3HTUA 5BOXA 2HGCA 2CGPA 3QAHA 2F5CA 1TBXA 2MD5A 1ZLJA 1YLFA 5ERIA 4ENNA 2Z3YA 2EFOA 1G6NA 3BJOA 3W6JB 4M9SA 1R1VA 4JQFA 2CQKA 4IXAA 2H94A 3CO7C 1HKQA 3JTGA 3DF8A 1UFMA 1SD6A 3O2PE 4KIGA 2GXBA 4CGZA 3IKTA 2FEZA 1W5TA 2CO5A 2XKOA 3VB2A 5ICFA 1I6XA 1LDJA 1J0RA 1S29A 1UB9A 4HV6A 3FMRA 2GWRA 3IHUA 5F1RA 2VBZA 3F8CA 2RQPA 1T98A 5HS7A 3R0JA 3RPUA 1WI9A 3T5XA 3W6KB 5JHUA 1SFXA 2B0LA 1F5TA 2FBIA 5CLSA 2WC2A 2UZKA 4HX7A 2A6HF 1T39A 5BPIA 3F8NA 4CICA 3JAMZ 4K2EA 2QQAA 2FMYA 3ZQ7A 4CYDA 1EH7A 3FM5A 1MDMB 3KEOA 1TW2A 5CVRA 2QVOA 4WWCA 2L4MA 4B8XA 3LAPA 4HDVA 3ABTA 4EJVA 4ON0A 1KQ9A 2RN7A 1BC8C 1HW5A 3MAJA 1MJBA 4UXNA 5LLQA 3L9FA 1YYVA 2IA1A 5BPDA 4I02A 1TW3A 4ZZDA 3REOA 2H6CA 1STZA 4KIBA 1XGMA 1HKTA 4WXHA 2JPBA 1XGNA 3C7JA 4R79A 1DPUA 1MD0A 1FC3A 2XAQA 4XLNF 5E1WA 1B59A 4L9JA 4S05A 1FYLA 2VT3A 3FXRA 1K7AA 4ETSA 2O3FA 1YW7A 1R1UA 4PZJA 2VONA 3HSFA 5D8LB 3ZMZA 4KMUX 1FT9A 2Q2EA 2DW4A 4GYGA 2HR3A 1D8KA 2O03A 1QNTA 3IL2A 2V1XA 1T6SA 1ZRDA 3HRUA 2P7CB 2V9VA 1TTYA 5HOOA 4M9XA 3WODF 2PFBA 3V8JA 3CUOA 2M8EA 3WTVC 4LG0B 4LFUA 3CLOA 5H20A 5EEHA 3RJPA 1S8NA 2PMHA 1XDUA 4ENJA 5DCFA 4H0EA 2GIVA 4Q47A 3BWGA 1TQIA 2D45A 5FD6A 1DP7P 5HVQC 1XD7A 3Q5FA 5DCMA 3NQOA 1I27A 4QLCU 4CDGA 4HF1A 1VTNC 3MFKA 4PDKA 1J9IA 4A0ZA 3ZMTA 2QM3A 2XROA 2RVCA 5D4SA 2M5WA 2DTRA 2VBXA 3WGHA 4DNCA 1D3YA 2IJLA 2HS5A 4WX9A 3LQQA 3WE3A 1AWCA 3K1MA 4I2OA 1ZG3A 1Z6RA 4WF2A 3AAFA 4A0XA 2A69F 4ENKA 3DPTA 1G3WA 1LNWA 5BMZA 2EFNA 4Q4ZF 3M8FA 5D4RA 5FB2A 3M7GA 1MKMA 2FBHA 3ISPA 2GXGA 3K9TA 2FXAA 3LA7A 5IT9Z 1LDDA 4HYEA 3TO7A 3N97A 3MCZA 4AVPA 1BC7C 2RDPA 4A0YA 1KYZA 2NNNA 2RKHA 5LHIA 3E5XA 1FLIA 4LG0A 4YIIA 2ETHA 5D6FA 1MGTA 1R5GA 2EK5A 5E8IA 4ESBA 3VODA 4PGGA 4F7ZA 2Y0MA 4L5IA 2G7UA 4OIPF 5AIPA 4G6QA 2DFIA 1V4RA 1X3UA 4EJUA 4I0BA 1U78A 1CGPA 3SHFA 4HOBA 1O7FA 3KP6A 2P6TA 4U0YA 5ICCA 1O3RA 1MZBA 3FMSA 4P96A 5J8CA 4LB5A 2OU2A 3FMQA 2IP2A 4M74A 3T0YA 3T8TA 1IXSB 3ZP5A 1OPCA 2ELHA 3KLNA 3VFZA 1KQ8A 4MEYF 3M1EA 4MQVA 3IRQA 4I0AA 2PEXA 2ZNYA 1J5YA 3P9IA 4I01A 2K4JA 3TKYA 2E7XA 1IF1A 3L00A 3U1DA 2DQRA 1QGPA 2PMUA 1B9MA 1SD4A 5LRSA 3IKVA 4Y15A 5H6QA 5D5WB 4ESJA 3ELKA 2P4WA 4LMYA 4O3MA 3I59B 5L3DA 3PFIA 2HZTA 3Q9SA 4KNYA 4FT8A 5LEJA 1SMYF 4ZYGA 4HLYA 4G7ZF 1SFEA 1ZYRF 3HRSA 3EQLF 3SZPA 1LEAA 3GFIA 2HQRA 4RAZA 5CJ9A 2ADUA 2BE5F 4HDUA 1JHFA 4RB2C 4EJOA 2GA1A 2STWA 3F23A 1RI7A 2VOPA 3JW4A 2LNBA 5J8FA 1YFHA 2RGVA 3QOPA 1RUOA 4HZFA 2ZO4A 5AIQA 5HDKA 2LF7A 3DFGA 3KEQA 4M6XA 3ABUA 5HLIA 2XAGA 3E6BA 2XASA 3CUQB 3BP8A 2G9WA 4EM2A 2A07F 1QZZA 5KK1A 2HFHA 2MH2A 1H9GA 4KA4A 3TDZC 2UXNA 5CVUA 1W4MA 2W85A 1UHWA 3MWMA 3FX3A 3GVAA 2OA4A 3GFMA 3I59A 2OQRA 3CUQC 3JTHA 4I98B 1P6RA 1ZN2A 2EA2A 5LEKA 2OZUA 2M45A 5DDGA 2YX7A 3J81Z 1F4KA 4ZYDA 1OYIA 4BHBA 4M9ZA 3F6VA 3TDUC 3QU6A 1F9NA 2DO7A 1BI1A 2F2EA 5ED4A 2DK8A 2IPQX 3N4MA 1K6OA 1HW2A 5JI6A 4IF4A 2HEOA 3VOEA 5DEQA 2DPDA 4LLLA 4JK1X 4UVBA 4EGZA 2OBPA 4XRFA 1LDKB 1KU9A 3DXJF 1HXDA 2W25A 1BI2A 1YG2A 5L3CA 2KIUA 2ZBKA 1O3SA 4L18B 1O7LA 1ON2A 3DV8A 3WTZA 5LBQA 3U2RA 4CZZA 3LA2A 3H92A 3V8KA 1KYWA 3Q9VA 2O61A 3B73A 2QLZA 4YFKF 3P9CA 3C18A 4OIOF 2A6EF 1REPC 2UWMA 4HX4A 1XSVA 2EFQA 2ZNZA 4M73A 2EV0A 2VBWA 5FFZA 1S3JA 1P2FA 4BXUA 2ZMEA 5CVVA 1SAXA 3BPVA 1WWXA 2A5YB 1LQ1A 1IN5A 1QO0D 2HDCA 2ZFWA 1R5HA 1IN6A 3KFWX 5K5RA 2D1HA 4LB6B 2XAFA 1YO5C 3EUHA 1ZHFA 4P9UA 2Z5UA 3COAC 2R7FA 5BQTA 2FBKA 3TO9A 3ZMUA 4OMYA 3KP4A 3TOBA 5DD8A 4ZYEA 4U0WA 4GCVA 5F64A 4BYYA 3WTWC 4BAYA 2WV0A 4HAMA 1T2KA 2R7DA 2L3DA 1FP2A 2VN2A 2WWYA 3MQ0A 4RB3C 3M8EA 4MHGA 3CDHA 1ODDA 1I1SA 1PP8F 1RIOH 2JTVA 1W5SA 2IA2A 2IRFG 2COMA 5K1YA 5DCMB 2KKOA 1DPRA 5JR3A 1WSUA 2P5LC 3K1PA 1F1ZA 2BYVE 3J80K 1BIBA 3I71A 2LSOA 4R1HA 2VOOA 4M6YA 1HSJA 3DPLC 2NRAC 4Z2YA 4EGYA 4FX4A 1YW9A 1ZAOA 1K79A 4U7BA 3GLXA 4P5OA 2DU9A 4EJWA 4L9TA 4UV9A 3HTSB 3O6BB 2OD5A 2FA5A 3MZYA 4KN7X 4UHTA 1SFUA 4L5JA 1KU7A 2HWVA 1G3TA 1B1BA 2FNPA 2YX4A 3V7RA 1Z91A 2XVCA 2XV4S 1FSHA 1FYKA 5D8KB 1IXRC 4RGUA 4LGWA 3WU0A 3V7CA 1PDNC 4YIFA 1YS6A 1ZG1A 2IA0A 5FLXK 2Z99A 2LF8A 1D8JA 2GQQA 1XDSA 4FHTA 1CF7A 2RNJA 2VE8A 5DUIA 3FXQA 2K27A 5KVRA 2XGXA 4I7HA 5ILUA 3EYIA 2YPRA 3E97A 3NEUA 4WXDA 2BBYA 2KJCA 5E20A 2JSCA 1IW7F 1U6GA 3G73A 5CYVA 1GVJA 4CHUA 1K78A 4G6DA 3RI4A 3HHHA 1IAWA 3BPXA 5DD4A 3S2WA 4UUVA 1LEBA 3I0TA 4P55A 2KIMA 2GAUA 3ECOA 5DYMA 4G9YA 4BHPA 1Z9CA 5L3BA 4AWXB 3LA3A 4KUMA 4ESFA 1YQAA 1FBQA 1ZH5A 4IPAA 2E7WA 2M1BA 1HW1A 1BIAA 2Y48A 4EJTA 2LKPA 3IC7A 1HQCA 1R1TA 3F8FA 3LSTA 3RTRA 1ZRCA 2BV6A 4WK8F 4MNUA 4HX8A 4L9VA 1FPQA 5HLGA 3ZN1A 2HQNA 4A12A 3R61A 3K69A 4EV0A 1BJAA 1SD7A 4GGGA 3TOAA 1MJ9A 3RDIA 3I53A 2F5DA 4OIQF 5DUKA 5FGMA 4YFXF 3WE2A 4MQ9F 4UVAA 2AXLA 2JRTA 3RYRA 3F3XA 1J75A 2FE3A 4NQWA 2EV6A 3DEUA 2J5OA 3GWZA 2PI0A 2ACJA 2IVMA 4KFCA 4ENMA 1TQPA 4RAYA 1E2XA 5AONA 2W57A 3KZYA 3HYIA 2HYFA 4MEXF 2YR2A 1OMIA 3LFKA 1ZREA 4XSXF 1IN4A 2K4BA 2KIFA 1XB4A 1Y0UA 2DQLA 5D6EA 4HQMA 3BJ6A 3KP2A 3BDDA 2CFXA 3QP5A 2JPCA 4HLXA 3E5UA 1HKSA 3WU1B 1O3TA 4HW0A 4G7OF 1B9NA 1YS7A 2DK5A 1R22A 3ERED 3WG9A 5H6RA 1H0MA 3IWFA 2K7LA 4A6DA 5HLHA 4L9NA 1XCVA 1R36A 4N9HA 3HOTA 1FBUA 2L01A 4KMFA 2X0LA 4U7DA 3GYHX 2O6GE 2HOEA 4CXFA 4IHSA 1U5TB 3NRVA 5J6XA 2STTA 3ZPLA 3OOPA 5IT3A 3FXUA 5K5QA 2HKOA 2MBFA 2Z33A 4AIHA 1Q1HA 4IRHA 2X4HA 2ISYA 3WTTC 2FQ3A 1IZ1A 1FBSA 4LLNA 1Z7UA 2MLKA 1SMTA 1L3LA 2JT1A 1MJAA 2XUBA 1IXCA 1O57A 4MTEA 3KP7A 3P7NA 1T0FA 4KYWA 2J5PA 4KICA 1L0OC 4EMSA 1R00A 2PQ8A 2RV8A 4JBAA 4RB0A 2F5EA 3V7SA 4B09A 4ZZLA 1TNSA 1V3FA 1BBYA 2ZJ2A 4WXCA 2ISZA 2FOKA 5LHHA 1P4AA 3FHZA 2K86A 2VT2A 2XKPA 1TLHB 2QBYB 3IWZA 4IVNA 4N9IA 3HIFA 1IRGA 4AIKA 3M9AA 3KE2A 3C3WA 3SXYA 2ESNA 1U5TA 3PQJA 1KU3A 2NS0A 2ZMEB 2FMLA 1WQ2A 3HHGA 1ULYA 4GXOA 2EJRA 2L54A 3F8BA 2HTSA 3C1DA 4BH9A 1HBXG 1I5ZA 3LQRA 3HSEA 2ZKZA 4E70A 2A3SA 2VODA 1IUYA 2QENA 5TRDA 2G7HA 2P8TA 4ZH4F 1JXSA 3JSOA 3R60A 3QPHA 4IHTA 5JFRA 1XSDA 1OR7A 2MC3A 3BOQA 3WGIA 2MLGA 1XCBA 3WTYC 3IRRA 5ILVA 4AIJA 2VBYA 2P6SA 1XMAA 2QQBA 5D5VB 4A2UA 2GA2A 2QBYA 3EETA 1QBJA 2OAZA 4HA8A 5D5XB 2CW0F 3D5LA 5LRRA 2W24A 3BZ6A 1FOKA 2H27A 2A61A 1A04A 1GXQA 3KETA 2EWNA 5FO5A 3FF5A 2EB7A 3B02A 5BS6A 4MGRA 2DI3A 2C6YA 1PUEE 1FX7A 2LDUA 1BN5A 3WGGA 1TNTA 3HUGA 1P4WA 3KCCA 3WTUC 1OYWA 3LWFA 5HDGA 3DKWA 1DDNA 4EM1A 5E18F 1ZG5A 4G8XA 3GFJA 3JAMK 3HOSA 1BOAA 3FM3A 1FYMA 2CYYA 2DT5A 5JVTA 3WTXC 3QP6A 4Q5SF 1Z1DA 5FD5A 1LVAA 4U0VA 4Y13A 3E6MA 3QPTA 4EM0B 2QWWA 2NNYA 2L02A 4CO8A 3F8MA 2M30A 2QUFA 3DQVC 4IRGA 1CF7B 4BQAA 3L2CA 1RZ4A 4HQEA 2PBIA 1USSA 3P9KA 4RGXA 3GX4X 2V1UA 2QYOA 5CVIA 3GW2A 3TO6A 1YIOA 3K2ZA 3EYYA 5EEGA 1KA8A 4RS8A 2FNAA 3CO6C 4O6JA 3J7AO 2QZ8A 1U3EM 3RKWA 1K78B 1KU2A 4LK0F 4OINF 1OKRA 1LB2A 5HS8A 3H3UA 1BM9A 2V6CA 2VC0A 2V1DA 5CVJA 3KP3A 1JGSA 4PCQA 2ZXJA 3F22A
chains in the Genus database with same CATH superfamily
3K1NA 1X4OA 2TCTA 1JTYA 2LKXA 5IOZA 1KZHA 4KDPA 2IEKA 4S04A 2HKXA 4I6ZA 3J80Z 4C9YA 3RPQA 4GYIA 3CTAA 4RGRA 3TL4X 1A5JA 4LK1F 2IW5A 2KRFA 3CMAI 2DAOA 1IRFA 4FE4A 3DPUA 1XTAA 2CQQA 2L7ZA 2E1CA 3T8RA 3ECHA 2HNHA 2QQ9A 2Y69H 2KZGA 2E2JJ 2PG4A 3I58A 4XLAA 1QU3A 4BHCA 1IN8A 1S7EA 1RC9A 4XRMA 1IC8A 4X0GA 1X58A 2CG4A 4XMYA 1Y39A 1O3QA 2KP6A 1RUNA 1Z05A 1ORKA 2OTLI 3G3ZA 1HA8A 1OCPA 2YSRA 3CCRI 2Q0OA 2X6XA 1U2WA 1Y56A 2NOJB 3ZXSA 2HOSA 3TGNA 3F21A 1I50J 1GVDA 1G8XA 4A3MJ 1MDMA 3HRMA 9ANTA 4E6KG 2ME6A 2EFPA 3GZ6A 2B9SA 2LFBA 3CJNA 2Y0SA 5J40A 3SFZA 1R58A 2Q1ZB 4AD9A 3GZ5A 3QYEA 2EA4A 1ZLKA 1GV2A 1QVTA 4A5NA 1IV6A 1WGXA 2P5KA 3DWLE 3FZVA 2M4KA 4BBRJ 2N8GA 5FLXZ 3F72A 1UCRA 4KT5C 1RNLA 2DJNA 1P4XA 5TJJA 4CCLA 4C2TA 2PMZA 3U1KA 5A2QK 4U88A 1R7JA 1W7PB 2BOLA 4ASNA 2EFWA 4IHXA 2MH9A 1ONVA 1HSTA 1I3AA 2OC6A 2R3SA 1SFOJ 2HU9A 1Y8QB 2M3AA 1RKWA 3BY6A 3GO5A 4R8HA 3JRAA 1FJLA 1QZYA 2E1NA 4A3KJ 1D5VA 2H1KA 4IHWA 1H9TA 4D7NA 3S1QJ 2R92J 2XRNA 2JZYA 1UHSA 1RR8C 3T1BA 2M4GA 4LD5A 4ZYHA 3HOYJ 1ZK8A 3CJRB 3SYTA 5IYCJ 3E6DA 3ZQCA 4IQJA 5A2QZ 1NHAA 2XSDC 3SQNA 4XLHA 3KEYA 3FXOA 4Y17A 2KJBA 2VJ5A 2BW3A 3LAJA 5EGOA 4FISA 2O0YA 4UVCA 2CSOA 5L3GA 2EBIA 1FSEA 3E6CC 1DGRM 2BEOA 3O8HA 4NB5A 2KZVA 2P7VB 1KGSA 3R4KA 4MFDA 3L09A 1ZGAA 5IT9K 2GOXB 4XORA 4FX0A 3C2GA 5E8GA 2M0MA 1VQOI 1JJ8C 2IT0A 2ME0A 4L0YB 2V9KA 3V42A 2L2OA 4V2FA 2ELKA 2DYRH 2ESHA 5C3EJ 2CFOA 1GXPA 4XBFA 4AU7A 4BKXA 1MBEA 3BTCA 3F6OA 4OU0A 4GO1A 1ON1A 1JKOC 4KN4X 3VYUB 4YG2F 1GLNA 4J19A 4IRIA 4UNOA 5F08A 1XGSA 2X9DA 1SANA 3JRGA 2K9LA 4AIDA 3QYFA 3F9KA 3H5RA 2B7EA 2Q8KA 3CJQB 5F6FA 3W6VA 3IH3A 2H09A 3U9GA 3L2RA 1J7KA 2MA3A 4QPQA 1R71A 3QU3A 4M71A 4ZC3A 3JSPA 2E5ZA 4L0ZB 1EKEA 4KITB 2FRHA 1HLVA 1QRYA 3RYPA 2LBFB 2VKHA 2HYJA 1W7PA 1WKMA 2PLYA 1X19A 5B3SH 1XGOA 2NOGA 1S7AA 3O3KA 5D5UB 2FSWA 1U8BA 1FWZA 3ZMDA 4EATA 3G4SI 2W84A 3B6CA 4XLPF 1XN7A 1MMSA 5FKMA 2LREA 5ILSA 2O5RA 1R23A 4BE0A 2HTJA 2O9LA 3RIRA 5F0HA 3BTIA 4G7HF 4HBLA 3V8LA 1WJCA 4N4NB 3ZN0A 1OFCX 1TC3C 5L3EA 1W7PD 4RB1A 3HRTA 3DBLB 1KQ0A 4PGHA 3SEZA 2P5VA 1T38A 1YITI 3GEZA 1U9NA 4C3IJ 1FMWA 1BW5A 3TQNA 1ZARA 1FY7A 2BGCA 1G3SA 5EZHA 2CWEA 1S7OA 3R0AA 3L7WA 4LJZF 5ICEA 5LGUA 2QA4I 4HSRA 2D1VA 2F5FA 2PN6A 1N25A 2M87A 4AM3A 1S5LC 4XRSG 3UKGA 1TT5B 2XDVA 3DP7A 1LUJB 1LJ9A 1QQIA 2X6OA 1Y6IA 1J2XA 2JVGA 4Q48A 5J1RA 5CQEA 3CMMA 1USTA 3D0SA 5JVGF 1FP1D 4HF0A 2L9VA 4PJJA 2F48A 1OYYA 1G4DA 2VXZA 2Y75A 4JYKA 1EH6A 5KHDA 2Z2SB 3GFLA 4J00A 6PAXA 2Y9ZA 4BU2A 2WAEA 4J01A 3ZMSA 4NBQA 1T0FC 1GHCA 2WAQN 2BXZA 2OCCH 4OOIA 1EV7A 4BDYA 2DFEA 1WJFA 2ECBA 1B8IA 2XAJA 2DLLA 4BACA 5M5YJ 1NK3P 1QPMA 3K6GA 4WCGA 2FU4A 2IS4A 2F4OB 4U87A 3QRFF 3WTSC 3K2AA 1XPXA 3ZMVA 2CUEA 4IL6C 3RKYA 2ZCWA 2EINH 2WB1A 1JE8A 2EH3A 2L4AA 4IZZA 1EH8A 3CMYA 1G3YA 3GXOA 4N0BA 3KX2A 1UZCA 3BROA 2DT7B 2YU3A 1MNDA 3DTKA 2A68F 1X1PA 3ZQQA 4LOCA 4UV8A 5HDNA 2DYSH 5GADJ 5E17F 3SZGA 2WTEA 1FNNA 3EDPA 2PJPA 2XHKA 4A6EA 4YFNF 5ICGA 2H6BA 3OV8A 2JMWA 2D2WA 3SZTA 4CCMA 4TV7A 1TT0A 1VQMI 3ROUA 2DA7A 2KT0A 2WBMA 3VEPA 1D0ZA 4DOZA 3OYNA 3OSFA 1U5TC 3GF2A 2UXXA 4RM2A 3ZR8X 3HSRA 4G94A 5LHGA 1VQ5I 2AS5F 2JUCA 1BI0A 2ZJRF 4KIFA 4O5VA 1R9TJ 4DQ2A 1LFUP 2VE9A 2BY0A 2K02A 4HF2A 3FISA 3KP5A 4BJTA 3I64A 3KLOA 3CCLI 2Z16A 5E1XA 3OIPA 3OYCA 5E1ZB 3I4NJ 1BI3A 4NHJA 3IP4B 3PQKA 3PNTA 2V79A 2TDXA 3WHCA 1D0YA 2OQGA 4A5MA 3ABLH 4V19K 3CCUI 1JTXA 3FWEA 1Z67A 2QKLB 2Z9OA 2XIGA 2HYGD 3H3ZA 3HZJA 4LLGF 1U0JA 1QHGA 3BJAA 2O7OA 1YTYA 4OIRF 3KZZA 4EVIA 2LRDA 1ZQ3P 2BXYA 3HM5A 2IS2A 2NYXA 5L3FA 4BNCA 2O8XA 5C44J 1PP7U 2XC7A 1OR7C 4RGSA 1TQMA 3I54A 4M3BA 4LIVA 3MZHA 5HS9A 2R7WA 3K0LA 4I09A 4M72A 5LGTA 2CQXA 5F0FA 1Z0XA 2DPUA 4OMZA 5FFXA 3CJTB 4GRIA 2L0KA 4I76A 2ZXHA 1C0WA 3V4GA 4IJAA 3Q0UA 3J81K 3W2AA 1FZPB 3BT9A 3ML6A 1YW8A 3AG1H 3E3VA 3R6SA 3E5QA 1ETOA 3L2WA 1WRJA 5LFAA 2ZJQF 2OZ6A 2G0EA 1QPIA 4B1RA 3HOUJ 4HV5A 1AOYA 3BR2A 1XMKA 1MBHA 1B4AA 2XRLA 4XK4A 2MD0A 4QWQA 3AL0B 3BR5A 1N78A 4MO7A 1U8RA 3GTKJ 2M7AA 3HGGA 1E17A 1SD5A 2CRGA 3AG4H 1LE8A 3GUDA 4XSZF 2Y30A 1XSXA 3BR0A 4PFOA 3GTJJ 3K10A 2EV5A 2FF4A 1FOWA 2CMPA 2W4SA 1SFKA 1ZGJA 2WV1A 1QHHD 2X6WA 1QZEA 2XAHA 1E0EA 1J59A 1SEUA 3I5UA 3HEFA 2NVTJ 4PJLA 1UHMA 1S6LA 2DBBA 3ULQB 2NAZA 4G6TB 2FX0A 1YHQI 5F1JA 3MEXA 3PFYA 1P92A 1H88C 3AL0C 5KNLA 1ZRFA 3MZ8A 1FTZA 3IH4A 3VYTB 3RKXA 1Z6TA 2GZWA 2RC4A 3PUFA 1JHHA 1X3WB 3MMYB 5DV5A 4AC0A 2VC1A 1I1GA 2Y9YA 1IN7A 4CCOA 3I9V2 3I4PA 5K5OA 4MTDA 1B6AA 1Z21A 3FK7A 2LD5A 5LGNA 4EQQA 2CW8A 4P9FA 4D0PA 3CUQA 1DUXC 3HTUA 2HOAA 5BOXA 2WAQA 2DMQA 2KMUA 2HGCA 1SVMA 2CGPA 3S3MA 1X1AA 3QAHA 2QGUA 2F5CA 1TBXA 2MD5A 1ZLJA 1YLFA 3CDLA 5ERIA 3FXLA 2Z3YA 4ENNA 3BCBA 2EFOA 1G6NA 3BJOA 3W6JB 1GT0C 4M9SA 3FXKA 1R1VA 4JQFA 2CUJA 2Y0SN 2CQKA 4IXAA 1FTTA 2H94A 3DKYA 3FBNB 3CO7C 1VQLI 1HKQA 4XKVA 3CP8A 1MMGA 3JTGA 3DF8A 1UFMA 1SD6A 3H36A 2EIJH 3O2PE 3CDIA 4MFEA 4KIGA 2GXBA 3ABMH 3QQAA 2PMZN 2X85A 4CGZA 2LR8A 4BE1A 3IKTA 2FEZA 1W5TA 2CO5A 2LVSA 2XKOA 1OCCH 3VB2A 4B43A 4ZTJA 4BS9A 5B66C 5ICFA 1I6XA 1LDJA 1J0RA 1S29A 3G6EI 1UB9A 4HV6A 2LC2A 3FMRA 3CCQI 3M3YJ 2GWRA 3IHUA 5F1RA 2VBZA 4XOTA 2DA4A 3S32A 3F8CA 2RQPA 1ZGWA 1T98A 3H0GJ 2DA1A 3BR1A 5HS7A 2QQ8A 3R0JA 4N4OB 1A6IA 4FASD 4H4KC 4A3CJ 3RPUA 1POGA 2DOAA 1WI9A 3T5XA 3W6KB 5JHUA 1SFXA 2B0LA 1F5TA 2FBIA 2QSFX 3A02A 1IGNA 2X1DA 1WJDA 5CLSA 2DDBA 2XF5A 2JJ7A 3CCYA 1RPWA 2K9QA 3S1NJ 1W5CC 2P0WA 2WC2A 5FROA 2UZKA 2R4GA 3MD2A 3O8GA 4HX7A 4CH7A 1IO2A 2A6HF 1T39A 5BPIA 3F8NA 4CICA 3OSGA 3OR1C 3JAMZ 4DBQA 4K2EA 3K70D 2QQAA 2OPTA 2FMYA 3ZQ7A 2W48A 4CYDA 1EH7A 3FM5A 1MDMB 3KEOA 3H9JA 1TW2A 5EJCA 2DMNA 5CVRA 3N05A 1ZR2A 1QA6A 2QSGX 4A3LJ 4P1WA 1P9QC 3HB9A 2QVOA 1F43A 4UUTA 3FXMA 2PX9A 4WWCA 3CCSI 2L4MA 1MH4A 4B8XA 3LAPA 4HDVA 3ABTA 4AYBA 4EJVA 1JT6A 4ON0A 1OLTA 5JLWA 2RAEA 3OIQA 3OIOA 1KQ9A 3G1LA 2RN7A 2ZSHB 4RAGA 4AVZA 1BC8C 3ZOBA 2WA0A 2KISA 1OJLA 1HW5A 2HDDA 1I3QJ 1N75A 4F3QA 3HOWJ 4HEA2 4A3EJ 1VFCA 3MAJA 2DA6A 1MJBA 4UXNA 3OYEA 3CCEI 1T56A 5LLQA 3KPHA 2IGKA 3L9FA 1YYVA 2IA1A 3SJMA 1MBGA 3FXJA 2XGCA 3HKZA 5BPDA 4I02A 4IEJA 1TW3A 3FBIB 4RLFA 4ZZDA 3REOA 4XM3A 5K7ZA 2MGQA 2H6CA 3BC8A 4XL9A 3I4MJ 1ETVA 1STZA 4KIBA 1X4PA 1XGMA 3OS1A 1HKTA 4WXHA 2JPBA 5J4VA 1XGNA 3C7JA 4R79A 1DPUA 2VASA 2BW3B 3IUOA 1HCRA 1MD0A 2HVQA 5EGOB 1FC3A 1Y0NA 2XAQA 4XLNF 5E1WA 4HSTA 1B59A 4L9JA 4S05A 3BZCA 5M5XJ 1FYLA 4HG2A 2VT3A 1D1CA 1WCMJ 4M6VA 1HDDC 3Q3SA 4BDZA 3PO3J 2TRTA 3PIOF 3FXRA 1K7AA 4ETSA 2ZFUA 2O3FA 1YW7A 5GTHC 1A35A 2DFFA 4E7HA 3BG9A 1R1UA 4PZJA 2R5YA 3HSFA 2VONA 5D8LB 1S9HA 2GM4A 3LSIA 3ZMZA 1VQ7I 4KMUX 3HC7A 1FT9A 4LITA 2Q2EA 1LFPA 1UMQA 4DGWB 1AKHA 2DW4A 2DA2A 3K4MA 4GYGA 2HR3A 2QF7A 3UR3C 3ZQHA 1ZR4A 1D8KA 2CV0A 1UG2A 2DMTA 2O03A 3H1CA 3ONQA 3F0CA 1QNTA 3IL2A 2V1XA 1T6SA 5E3MA 2EQRA 5GAGJ 1ZRDA 1W1WE 2A6TA 3HRUA 2P7CB 2M7BA 2V9VA 1TTYA 1PJRA 4M9XA 4RAFA 3WODF 5HOOA 4YRVA 4B44A 2PFBA 4BL0B 4NC6A 1ETXA 3V8JA 5HNHA 3CUOA 2M8EA 3WTVC 4LG0B 1R6RA 4LFUA 2DOEA 3CLOA 3BQYA 5EEHA 2OV7A 5H20A 2WB1N 1E3HA 4M3FA 2LY1A 3RJPA 4CCJA 1S8NA 2PMHA 1XDUA 4ENJA 3OYHA 1RKTA 5DCFA 4H0EA 2GIVA 2EZLA 3H35A 3BCAA 1P7JA 4Q47A 3BWGA 1TQIA 2D45A 5FD6A 1DP7P 5HVQC 4XRSA 1XD7A 4CYCB 1XG1A 3GMEA 3Q5FA 1W36C 1YX5A 3NQOA 5DCMA 3GTMJ 1I27A 2E71A 2LK2A 4QLCU 5FLMJ 3WU2C 2KL4A 4CDGA 4HF1A 5HNFA 1VTNC 3MFKA 4PDKA 3IV5A 1LPQA 1J9IA 4A0ZA 3ZMTA 2QM3A 2XROA 1B72A 2RVCA 5D4SA 2M5WA 2DTRA 2E1OA 2VBXA 3P5JA 3WGHA 2EZIA 1VZ0A 1H89C 5FKNA 4DNCA 3GCMA 1D3YA 1FIAA 2HS5A 2IJLA 4WX9A 3LQQA 3Q0VA 2NVXJ 3KIOA 3WE3A 1MMNA 3BR6A 4QSHA 1AWCA 3K1MA 4I2OA 1WI3A 1OCRH 3AG3H 1Z6RA 1ZG3A 4WF2A 1NG7A 3AAFA 2DDAA 5F0CA 1HDPA 3A01B 4OAZA 4A0XA 2A69F 2XGDA 3RQIA 2OJED 1ACIA 3PUBA 4ENKA 4BJ5C 1X3ZB 3DPTA 1G3WA 4E7SA 1WJ5A 1LNWA 1GV5A 2XPVA 5BMZA 2EFNA 1HF0A 4Q4ZF 4XOPA 1IDYA 2XF6A 3M8FA 5D4RA 5FB2A 3M7GA 1MKMA 4PFPA 2FBHA 3ISPA 4YELA 4D1QA 5GTIC 1B8IB 3RCOA 2GXGA 2LY2A 3K9TA 2VUMJ 2FXAA 4PUSA 1RR7A 2RREA 3FKJA 2E35A 3LA7A 4XLCA 5IT9Z 1W0UA 1LDDA 4HYEA 3TO7A 3N97A 3MCZA 2HXIA 1H8AC 4AVPA 1BC7C 2RDPA 2HVSA 4A0YA 1KYZA 5IP7J 2COBA 2NNNA 2RKHA 4Y3OA 5LHIA 2IS1A 3E5XA 1FLIA 4BEHA 2XB0X 4LG0A 4YIIA 1W36D 4OAYA 4DJAA 2ETHA 5D6FA 1Z7LA 1MGTA 1R5GA 3GTQJ 2VKVA 1X1CA 2EK5A 3U21A 5E8IA 3WHBA 2DMPA 1YI2I 4ESBA 3VODA 1UELB 4PGGA 3RZOJ 4F7ZA 4BBSJ 2Y0MA 4L5IA 2G7UA 3VYRB 4CYCA 1XX5A 4OIPF 5AIPA 4G6QA 2DJIA 1W0TA 1TP4A 2DFIA 2KLOA 3NAUA 4QPOA 1V4RA 1X3UA 4EJUA 2V6EA 4I0BA 1U78A 2YS9A 1CGPA 3SHFA 3KYDB 2BY1A 1MBJA 1P7IA 3BG3A 3BTJA 4HOBA 3E0JB 1O7FA 3KP6A 3A1YA 4HNTA 4A3GJ 2P6TA 4U0YA 5ICCA 1O3RA 2FQ4A 1Y1WJ 1MZBA 3FMSA 4P96A 4PSXA 3HPHA 5IOYA 5J8CA 4LB5A 2OU2A 3FMQA 1GDTA 2F6CA 2IP2A 4M74A 2VQCA 1F36A 2F5VA 3T0YA 3T8TA 3S1MJ 1IXSB 3ZP5A 1MH3A 1OPCA 5K7FA 3FHNA 2ELHA 2JK3A 3KLNA 4D9JA 3VFZA 1KQ8A 1K61A 2KIQA 2L7MP 3M1EA 4MEYF 4S0HB 5JHFA 4MQVA 3OS2A 2ICWG 3IRQA 1V5FA 4I0AA 3A01A 2PEXA 2ZNYA 1J5YA 3P9IA 4FQGA 4I01A 5GPAA 1OCTC 3TMOA 2K4JA 5CPRB 2L9SA 3TKYA 2ZC2A 3TP3A 2E7XA 2R7OA 1IF1A 3BG5A 3L00A 3K4CA 3U1DA 4NUBA 3G1MA 2DQRA 4W1UA 3JRHA 1QGPA 2PMUA 1YRNB 5IYDJ 2LYCA 4QTRA 1B9MA 2EZHA 3OYAA 1SD4A 5LRSA 1CQTA 3IKVA 4Y15A 5H6QA 5FLVA 5D5WB 4ESJA 2X6YA 2AXTC 1BOBA 3ELKA 2P4WA 4LMYA 3LSPA 4O3MA 3I59B 5L3DA 2VJ4A 5IP9J 1JT0A 3PFIA 4MLOA 2HZTA 4JX5A 1XMXA 3Q9SA 4KNYA 1T08B 4FT8A 5LEJA 2X1EA 4LG3A 4C3JJ 3SEQA 1SMYF 4ZYGA 4HLYA 4G7ZF 1SFEA 1ZYRF 3HRSA 1SC7A 3EQLF 3SZPA 4DYCA 3CC7I 2XB5A 1LEAA 2JN6A 4MIMA 2HQRA 3GFIA 2GLOA 4RAZA 5CJ9A 2ADUA 2BE5F 1LE8B 4HDUA 4F92B 1JHFA 4RB2C 5EDNA 5KAIC 2R7RA 1BJZA 5J1UA 4EJOA 1VQ8I 2GA1A 2STWA 3F23A 1RI7A 2VOPA 3JW4A 2NS7A 3KYLA 2BVLA 4NC8A 1K83J 2LNBA 2LOOA 5J8FA 1YFHA 2DFHA 3GTOJ 2RGVA 3QOPA 2VQHA 2W82A 1PVEA 1RUOA 3LSKA 2R5ZB 2KQRA 4HZFA 2DOFA 2ZO4A 4Y33A 2WY7Q 3DU6A 3GTLJ 5AIQA 5HDKA 2BZTA 1IRZA 3KYCB 2LF7A 3DFGA 3KEQA 2KRCA 4M6XA 1NG6A 3WG7H 3ABUA 5HLIA 2XAGA 2R7XA 3E6BA 3S3OA 2XASA 3CESA 2QEXI 2AQEA 4BGDA 3CUQB 3BP8A 3G71I 1NK2P 2G9WA 4EM2A 2A07F 1QZZA 5KK1A 2E1MB 3HGYA 2XPUA 2HFHA 1ZELA 3J7YJ 5KCMA 2L7FP 2IGOA 3LOCA 2MH2A 3OOUA 1BR1A 3TP0A 1H9GA 4XKBA 4KA4A 2LG4A 1YRNA 3TDZC 4IOCF 2UXNA 2EIKH 2DMUA 5CVUA 1W4MA 4PSWA 2W85A 2DA3A 4AYBN 1UHWA 3MWMA 4DZJA 3FX3A 3GVAA 5DM7F 2OA4A 3GFMA 4DYQA 2RNGA 3I59A 2OQRA 3TW7A 2NVYJ 4W97A 1WHUA 3CUQC 4DW6A 3I3LA 3MN2A 3QYBA 3JTHA 4F91B 3Q0WA 2CQNA 1EF4A 4ZJZA 2E1MC 2I5UA 3GTGJ 4I98B 1P6RA 1ZN2A 2EA2A 5LEKA 3JRBA 4GDFA 2OZUA 2M45A 3GBGA 2L9NA 2OF7A 5DDGA 3HKZN 4CA0A 2YX7A 3HBLA 1R4MB 3J81Z 1UAAA 1F4KA 2DT6A 4ZYDA 1OYIA 3H9QA 3HOXJ 4IX7A 1TZLA 4BHBA 2L9RA 1FOXA 3ZQFA 2YU9J 4HPQA 1A6QA 2KFDA 3F6VA 4M9ZA 2GBYA 5LD2C 3TDUC 2R7QA 3QU6A 1F9NA 1WZ2A 2DO7A 1BI1A 2F2EA 5ED4A 2EZKA 2DK8A 2IPQX 3J7AY 1A31A 1FMVA 4M3EA 3N4MA 1K6OA 1PUFA 1HW2A 4ITVA 5JI6A 4JP0A 3OL4A 4IF4A 2HEOA 3EUAA 2L5QA 5EF6A 2R5ZA 4Y7NJ 3VOEA 5DEQA 2DPDA 1GUUA 1SVOA 4LLLA 4JK1X 5FKKA 4C2MJ 2LP0A 4UVBA 2CJJA 4EGZA 2OBPA 4XRFA 2AO9A 1LDKB 1KU9A 3DXJF 1HXDA 2W25A 1BI2A 1YG2A 5L3CA 2E2IJ 2KIUA 2ZBKA 4I99C 1O3SA 5FRNA 3DEEA 4L18B 1O7LA 1ON2A 3DV8A 3WTZA 3PNVA 5CKTA 2LKSA 3DTEA 3JREA 1QVUA 3M8JA 5LBQA 3U2RA 3MKZA 1IG7A 4CZZA 2HVRA 3K70C 3W2WA 3LA2A 4E7IA 3H92A 3V8KA 4XKWA 1KYWA 3Q9VA 2O61A 2V1NA 4EEFG 3B73A 2QLZA 4YEJA 4F55A 1S72I 2ZB9A 4YFKF 2CV1A 3P9CA 5C4XJ 3C18A 1OCZH 2IBDA 3PJRA 1JI8A 2PJRA 3ASNH 3ABKH 2M8GX 4OIOF 2A6EF 3HJEA 3DTIA 4B3XA 1VQ6I 1REPC 2UWMA 4HX4A 1XSVA 2EFQA 2ZNZA 4E7ZA 4M73A 4A3FJ 2IGNA 2EV0A 3DBRB 5EYRA 1WJBA 2MYSA 1O4XA 4IKFA 4NC7A 3QWLA 1TWHJ 2VBWA 3CCVI 3CD6I 1BW6A 3QODA 1S3JA 5FFZA 4HNVA 1P2FA 3L2QA 4BXUA 2DTZA 3L2UA 4XIDA 1HC8A 4KT6A 2IGMA 2E34A 3LSRA 2ZMEA 2EIMH 5CVVA 1SAXA 3BPVA 1WWXA 2A5YB 5FKLA 1LQ1A 1IN5A 2VLAA 2H8RA 1QO0D 2HDCA 2ZFWA 1R5HA 1IN6A 2VKEA 3KFWX 4FTHA 1A36A 5K5RA 2D1HA 2MSYA 2NXNB 4LB6B 2XAFA 3AG2H 1YO5C 3EUHA 1VQNI 1ENHA 3ZCOA 2JVHA 3JCUC 2M9HA 1ZHFA 3DLAA 2R5YB 2FUG2 3A2KA 3FDYA 3RPUD 2XGEA 4P9UA 2Z5UA 3COAC 2Q2EB 2R7FA 5BQTA 3AFHA 2FBKA 4XN3A 3TO9A 1AKHB 4XLEA 3ZMUA 4OMYA 3I55I 2CUFA 3KP4A 3TOBA 4XICA 2VI6A 1IJWC 3PSFA 3HXLA 5F27A 5DD8A 3VWBA 4ZYEA 1PYVA 5H2FC 4U0WA 4GCVA 5F64A 2KRHA 1IRXA 3D5SC 4E7KA 4BYYA 1JKRC 3WTWC 4BXFA 4BAYA 2WV0A 2JA7J 2VL8A 4HAMA 4DBRA 1T2KA 2R7DA 3H9GA 2L3DA 2D5VA 1N77A 1FP2A 5GAHJ 1RETA 2VN2A 2WWYA 1MIJA 4A3JJ 2IXSA 2MG4A 2HDWA 3MQ0A 4RB3C 1M1EB 2F4MB 3DLLF 3M8EA 3PL8A 1JUSA 4MHGA 3CDHA 1ODDA 1I1SA 1PP8F 5EG0B 4GFBA 3OS0A 1RIOH 4RLQA 5IP6A 2JTVA 1W5SA 2IA2A 2IRFG 1FOYA 2B63J 2DXIA 5K7HA 2COMA 3D5RC 3MKWB 5K1YA 5DCMB 2KKOA 3HOVJ 1LVKA 3A03A 1DPRA 5JR3A 5GPCA 1WSUA 2P5LC 3K1PA 1F1ZA 2BYVE 3DCFA 5J1YA 1BIBA 3I71A 1UG0A 3J80K 3S15J 2X1CA 2LLKA 2LSOA 4JOMA 4R1HA 2VOOA 4UY8I 4ANJA 5IYBJ 4M6YA 3OYFA 1HSJA 1B72B 3ZGKA 3LFUA 3KZIC 2HQ5A 3DPLC 2NRAC 2K9MA 4Z2YA 2YUSA 4EGYA 1D5YA 1LFBA 2XAUA 4FX4A 1YW9A 1ZAOA 1K79A 1OCOH 4U7BA 3GLXA 4P5OA 2F4IA 2HOTA 2DU9A 4EJWA 4II2A 3CZ6A 3ESWB 2WADA 4QIWN 4L9TA 4UV9A 3S1RJ 2IS6A 3A4CA 3HTSB 3O6BB 3PIPF 1TWGJ 2OD5A 4E7LA 1EJ9A 2FA5A 2VKDA 1VQKI 3MZYA 2QSHX 2R7VA 3M07A 4KN7X 4UHTA 1SFUA 4L5JA 1KU7A 3OMYA 2HWVA 4DZPA 1G3TA 1ETKA 1B1BA 2FNPA 3SFIA 2YX4A 2X48A 4BY7J 3V7RA 1Z91A 2XVCA 2XV4S 4CCNA 4HRIA 2LH9A 1FYKA 2NVQJ 5D8KB 4BJ6C 1FSHA 1IXRC 2JWTA 4RGUA 2VJJA 5M3FJ 4LGWA 3B6AA 1E3OC 3IH2A 3WU0A 3V7CA 3D1NI 1PDNC 4YIFA 1YS6A 2CQ7A 1ZG1A 5TGTA 4CSWA 2JRMA 1FIPA 2IA0A 5FLXK 3K4BA 4JX6A 2Z99A 2LF8A 1D8JA 2GQQA 1XDSA 4FHTA 4BEHB 1CF7A 2RNJA 2VE8A 5DUIA 3OYBA 3FXQA 2K27A 4KJZA 1VF9A 2KDOA 2XGXA 5KVRA 4I7HA 3A0BC 5EG0A 3DBHB 4M3DA 2VQGA 3RKQA 3ZQLA 1K4SA 5ILUA 1D1BA 1WH5A 3PNYA 3EYIA 2YPRA 3E97A 3NEUA 1TL8A 4WXDA 2BBYA 2KJCA 3S93A 5E20A 5F04A 2JSCA 4ZYAA 3CP2A 1IW7F 1U6GA 3G73A 4NQWB 5CYVA 1GVJA 4B48A 3G2BA 4CHUA 5B5EC 1MNEA 3BR3A 1K78A 1WVRA 4G6DA 1SVLA 3HHHA 3RI4A 1AA7A 1IAWA 3BPXA 4PJMA 5DD4A 4FETA 3S2WA 1EA3A 4UUVA 5FRMA 1LEBA 3GTPJ 1WH7A 3I0TA 3JRFA 4P55A 2KIMA 4C30A 2GAUA 3ECOA 3HPGA 3IAM2 4G9YA 5DYMA 4BHPA 1Z9CA 4DIQA 5L3BA 1MMDA 3K4JA 4AWXB 4RBOA 4YIRX 3LA3A 4KUMA 4ESFA 3HL2A 1YQAA 1FBQA 3M1CA 1ZH5A 4IPAA 2E7WA 1E3PA 3X2QH 2M1BA 3ERMA 1J09A 1HW1A 1BIAA 2Y48A 4E4HA 4UB8C 1DGWY 4EJTA 2LKPA 1Q1VA 2ID3A 3IC7A 4A3IJ 4V2GA 4C2UA 1HQCA 1R1TA 3LL7A 1IDZA 3F8FA 1I39A 3LSTA 5CQGA 1ITYA 3RTRA 1ZRCA 2BV6A 3LSHA 4WK8F 1WPKA 4MNUA 3EPZA 2DA5A 4XONA 3BG6A 2FOWA 3G1OA 3JRCA 1OISA 1V55H 4HX8A 4HNUA 4L9VA 1FPQA 1X2MA 4LIUA 3ZN1A 2HQNA 4D5FA 5HLGA 3JRIA 3HG9A 3J7ZI 3ASOH 3BZKA 4A12A 4AUXA 3R61A 3K69A 5B1AH 4EV0A 1VQ4I 1BJAA 2K3PA 2KHMA 1G2HA 1JJ6C 1SD7A 4GGGA 4Y52J 3TOAA 2MABA 1JUPA 1MJ9A 1NTCA 2L7KA 2VPRA 2GOMA 3RDIA 3C2HA 3I53A 2F5DA 4OIQF 5DUKA 2QCOA 5FGMA 1WFXA 4YFXF 3WE2A 4Z6YA 2XSJC 4MQ9F 2OUMA 3VYSB 2JA2A 4UVAA 2AXLA 2JRTA 3S2DJ 2NS8A 3RYRA 3F3XA 1X1DA 3K4LA 1J75A 2R7UA 5FJ8J 1ZKGA 2FE3A 2EV6A 4NQWA 4XLFA 3OYMA 3DEUA 1D1AA 3IAS2 2K5CA 4Y4RA 2J5OA 3MKYB 2CV2A 3CMEI 3C2BA 3GWZA 2PI0A 2ACJA 3VSLA 1BR2A 2IVMA 2OCEA 4KFCA 4ENMA 3CQZJ 4II3A 3VPRA 1BA5A 3QPLA 5J3LA 1TQPA 4RAYA 1E2XA 2Y2ZA 5AONA 3FK6A 2W57A 3KZYA 3HYIA 2E60A 2HYFA 4MEXF 4D5CA 3JRDA 2YR2A 5E3OA 2HPMA 1OMIA 3LFKA 1TWAJ 2CW7A 1ZREA 2ZJPF 3OWTA 4XSXF 5FKOA 1IN4A 2K4BA 3GLLA 4OWRB 5B1BH 2KIFA 1XB4A 3E1SA 1Y0UA 2DQLA 5D6EA 2ZSIB 3L1PA 3BTLA 4HQMA 3FKIJ 3BJ6A 3K4NA 2I10A 3KP2A 3OL3A 2LMDA 3BDDA 1ETWA 2VXDA 1R5ID 2CFXA 3TEDA 1MW7A 3QP5A 2JPCA 4HLXA 3S14J 3E5UA 1HKSA 3WU1B 1O3TA 1AHDP 4HW0A 4G7OF 1B9NA 1YS7A 1K4TA 5TISC 4ZTFA 2DK5A 2M34A 3CF2A 1R22A 3ERED 3K4KA 3WG9A 5H6RA 4G12A 1H0MA 3IWFA 2E2HJ 4ZDLA 2ID6A 3AKZA 2JUGA 1R4NB 2K40A 2K7LA 4A6DA 5HLHA 4L9NA 5IY5H 1XCVA 1JUMA 1R36A 4C3HJ 4N9HA 2VIXA 4BQOA 3HOTA 1FBUA 2WY8Q 2L01A 4KMFA 2X0LA 4U7DA 4F93B 3GYHX 2O6GE 2HOEA 4CXFA 3OY9A 4IHSA 1U5TB 2ZXIA 3NRVA 2BHZA 5J6XA 3L2VA 2BVMA 2STTA 1XC5A 5GAEJ 1YOVB 3ZPLA 3DU5A 3OOPA 5IT3A 5EZGA 3CCJI 5JLXA 3FXUA 5K5QA 3UNGC 4RDUA 2HKOA 2A05A 2OTJI 2MBFA 2Z33A 5IPAA 2JA6J 4AIHA 1Q1HA 4IRHA 2X4HA 4XR6A 2LBFA 2ISYA 3WTTC 3W2VA 3BQZA 2FQ3A 1PUFB 1IZ1A 3SDGA 1FBSA 2X51A 4IO9F 2NVUB 4LLNA 4UB6C 4CCKA 1Z7UA 2V9PA 4ZDOA 4XN0A 2E36A 4BXXJ 2MLKA 1Z77A 3QPSA 1KONA 3GZNB 1SMTA 1L3LA 3PO2J 4BQNA 1HOMA 2JT1A 1MJAA 3H5NA 5M3MJ 2XUBA 1IXCA 1O57A 5HODA 2P81A 4MTEA 2IAIA 3KP7A 3P7NA 1T0FA 5KAFC 4KYWA 2J5PA 1V5GA 4KICA 2V4JC 1DP3A 4B3AA 1L0OC 3ZQIA 4UUSB 1X1BA 1MMAA 4CUGA 4EMSA 3S16J 4BQQA 1R00A 2PQ8A 2RV8A 4JBAA 4RB0A 3LNQA 2F5EA 3V7SA 4B09A 3OYLA 4ZZLA 1TNSA 1V3FA 1BBYA 1D0XA 2ECCA 2ZJ2A 5J4YA 4WXCA 2ISZA 1JGGA 4DYRA 2FOKA 1V54H 3VSKA 3OYJA 1JKPC 3RZDJ 3CC2I 1IV8A 5LHHA 2JA8J 2VPLA 1P4AA 3FHZA 2K86A 2VB6A 2VT2A 3VDXA 5EEAA 2XKPA 1TLHB 2QBYB 1ETQA 3PM1A 3FIWA 3TBIA 2HQAA 1BL0A 1ZTRA 3IWZA 4IVNA 4N9IA 1VQPI 2PJRB 3HIFA 1FEXA 2M0CA 1IRGA 4AIKA 4A93J 4IHVA 1Y1VJ 1BR4A 2W7NA 2EPFA 2V7FA 2K3FA 3A0HC 3M9AA 1T95A 3KE2A 4D7MA 3C3WA 3S2HJ 4FE7A 3SXYA 4IHYA 2ESNA 3W3CA 2E5NA 2XPWA 1U5TA 3PQJA 3S3NA 4IOAF 1KU3A 2BHYA 3M4OJ 2NS0A 2DODA 2ZMEB 3LSMA 2FMLA 1WQ2A 3K7AJ 3EUKL 5BNGA 3HHGA 5DTDA 4A3DJ 1ULYA 4GXOA 4RMNA 3H5AA 2EJRA 2AHQA 2L54A 3F8BA 1T33A 3HUGB 2HTSA 3C1DA 5GP9A 4BH9A 1HBXG 1I5ZA 3LQRA 3HSEA 2MC4A 4CZCA 1LKXA 2ZKZA 1MBKA 4E70A 2A3SA 5J47A 2VODA 1IUYA 2QENA 2K85A 2G7HA 5TRDA 3CC4I 1I6HJ 2P8TA 2AQFA 1VNDA 2WAFA 3NWSA 3S17J 1APLC 2VJIA 4ZH4F 1JXSA 3OYKA 2R7ZJ 3JSOA 2ZMEC 3R60A 3QPHA 4IHTA 2RQQA 1VI0A 5JFRA 2I8DA 3ZRGA 1XSDA 1OR7A 2MC3A 3BOQA 2CU7A 3WGIA 4BY1J 2MLGA 2K9NA 4L5EA 4UUSA 1NH3A 1YX3A 1XCBA 3RSNA 3WTYC 4KISA 3IRRA 1VQ9I 5ILVA 1ETYA 4A3BJ 3LMMA 2H1LA 2KPMA 4AIJA 2VBYA 3EUHC 5E3LA 2EILH 2P6SA 5DM6F 1XMAA 2KDZA 1R49A 4X1EA 2QQBA 3DKXA 5D5VB 5DS9A 1YJWI 4A2UA 1G59A 4A69C 2LTPA 2GA2A 2QBYA 1WJEA 1V5EA 3EETA 3NARA 1QBJA 2OAZA 4HA8A 5D5XB 2GIZA 1JKQC 1MSEC 4NDLA 2CW0F 5E3NA 1OQYA 2FD5A 3D5LA 5LRRA 2W24A 2R7TA 3E7LA 2FJ1A 3BZ6A 2M2EA 1FOKA 2H27A 3NWTA 2O8KA 4F52A 2BY3A 2A61A 1A04A 4B4CA 1RRJA 1GXQA 3KETA 2EWNA 3HOZJ 2R0QC 5FO5A 4XKCA 4M3GA 3OYIA 1DQUA 3FF5A 2EB7A 3B02A 2R7SA 5BS6A 1XS9A 4MGRA 2DI3A 4PJ0C 4FCYA 2C6YA 1Y8RB 1FX7A 1PUEE 2LDUA 1YJNI 2Y31A 3BLYA 1BN5A 3WGGA 1TNTA 2CS3A 2VQLA 3HUGA 1P4WA 1U9OA 2CH0A 4ABZA 3KCCA 3H0DA 3WTUC 1OYWA 1TWCJ 2JQ7A 3DEWA 1YJ9I 2HZDA 3LWFA 3DKWA 5HDGA 4E7JA 3LSJA 1DDNA 3BG7A 4EM1A 2MW8A 1YIJI 3H3VK 2Z1DA 3OR2C 2ZXWH 5E18F 3TW6A 4NNJA 2HPIA 1ZG5A 4G8XA 2QKMB 3GFJA 3JAMK 3HOSA 2UUZA 2E19A 3PSIA 1TWFJ 1BOAA 1Z3YA 3FM3A 2JA5J 2XF7A 4BE2A 1FYMA 2CYYA 3LSGA 1RESA 3I56I 2DT5A 4ZDPA 5JVTA 3WTXC 3QP6A 4Q5SF 1Z1DA 5FD5A 1LVAA 2R93J 1DU0A 3MVPA 4U0VA 2V26A 4XQFA 4PJNA 4BUPA 1X2NA 4Y13A 4IQ4A 3E6MA 2GXAA 3QPTA 4EM0B 1DU6A 2QWWA 2NNYA 1ERDA 2L02A 2BY2A 4CO8A 5HLTA 2CUZA 3F8MA 2M30A 3OYDA 2QUFA 4B47A 2DN0A 4RM3A 3DQVC 4IRGA 4RA2A 1UJ8A 2W00A 3S8PA 1WJAA 2LY9A 4PK4A 3SDBA 1CF7B 4BQAA 2HXOA 3L2CA 1RZ4A 4HQEA 3QOEA 3MKLA 2PBIA 2HI3A 1USSA 1MNMC 3P9KA 4RGXA 3GX4X 2V1UA 2QYOA 2K9SA 5CVIA 2A5WA 3GW2A 2UV1A 3TO6A 1YIOA 3K2ZA 2H8WA 1SAUA 3CLQA 4JX4A 3EYYA 5EEGA 1K6YA 1KA8A 2ELJA 3HDDA 5C4JJ 3CF5F 4RS8A 1T8IA 2FNAA 1MSFC 3CO6C 2JSPA 5M5WJ 4XNFA 4O6JA 3J7AO 1IUFA 2DCEA 2QZ8A 1U3EM 3RKWA 1MBFA 2MFZA 1K78B 1KU2A 1Z3XA 4LK0F 4OINF 4X6AJ 1OKRA 3OYGA 3RQ4A 1LB2A 5HS8A 3H3UA 1BM9A 2V6CA 3ZQGA 2VC0A 2V1DA 5CVJA 3KP3A 5E79C 1JGSA 4PCQA 3CCMI 1AU7A 3JR9A 1YE9A 2ZXJA 2W1OA 3F22A
chains in the Genus database with same CATH topology
3K1NA 4KDPA 4S04A 2HKXA 3J80Z 3RPQA 4GYIA 3CTAA 4RGRA 4LK1F 2IW5A 2KRFA 2DAOA 1IRFA 2E1CA 3T8RA 3ECHA 2QQ9A 2PG4A 3I58A 4BHCA 1IN8A 2CG4A 1O3QA 1RUNA 1Z05A 3G3ZA 2YSRA 2Q0OA 1U2WA 3TGNA 3F21A 1MDMA 3HRMA 2EFPA 3GZ6A 3CJNA 3SFZA 1R58A 4AD9A 3GZ5A 2EA4A 1ZLKA 4A5NA 2P5KA 3FZVA 5FLXZ 3F72A 1UCRA 4KT5C 1RNLA 1P4XA 5TJJA 5A2QK 4U88A 1R7JA 1W7PB 4ASNA 2EFWA 2MH9A 1ONVA 1HSTA 2R3SA 3GO5A 3BY6A 4R8HA 1D5VA 1QZYA 2E1NA 1H9TA 2XRNA 2JZYA 3T1BA 4LD5A 4ZYHA 3E6DA 5A2QZ 1NHAA 3SQNA 4Y17A 2KJBA 3LAJA 2O0YA 4UVCA 2CSOA 5L3GA 1FSEA 3E6CC 2BEOA 4NB5A 2P7VB 1KGSA 3R4KA 3L09A 1ZGAA 5IT9K 4FX0A 5E8GA 2IT0A 4L0YB 2ESHA 1GXPA 4XBFA 3F6OA 4OU0A 4GO1A 1ON1A 4KN4X 4YG2F 4IRIA 4UNOA 1XGSA 2Q8KA 5F6FA 2H09A 3U9GA 1J7KA 2MA3A 3QU3A 4M71A 4L0ZB 3JSPA 2FRHA 3RYPA 1W7PA 1WKMA 2PLYA 1XGOA 1S7AA 3O3KA 5D5UB 2FSWA 1FWZA 3ZMDA 2W84A 4XLPF 1XN7A 5ILSA 1R23A 2HTJA 3RIRA 4G7HF 4HBLA 3V8LA 3ZN0A 5L3EA 1W7PD 4RB1A 3HRTA 1KQ0A 4PGHA 2P5VA 1T38A 3GEZA 3TQNA 1ZARA 1FY7A 2BGCA 1G3SA 2CWEA 1S7OA 3R0AA 3L7WA 4LJZF 5ICEA 5LGUA 2D1VA 2F5FA 2PN6A 2M87A 3DP7A 1LJ9A 1QQIA 1J2XA 4Q48A 1USTA 3D0SA 1FP1D 4HF0A 1OYYA 1G4DA 2VXZA 2Y75A 1EH6A 3GFLA 6PAXA 3ZMSA 1GHCA 4OOIA 1EV7A 2XAJA 2DLLA 1QPMA 4WCGA 2FU4A 3QRFF 3WTSC 3ZMVA 3RKYA 2ZCWA 1JE8A 2L4AA 1EH8A 1G3YA 3GXOA 4N0BA 3BROA 2YU3A 2A68F 4UV8A 5HDNA 5E17F 2WTEA 1FNNA 3EDPA 2PJPA 2XHKA 4A6EA 4YFNF 5ICGA 2H6BA 3OV8A 2D2WA 3SZTA 4TV7A 3ROUA 3VEPA 1U5TC 3GF2A 2UXXA 3HSRA 4G94A 5LHGA 2AS5F 1BI0A 4KIFA 4O5VA 4DQ2A 2VE9A 2K02A 4HF2A 3KP5A 3I64A 3KLOA 5E1XA 5E1ZB 1BI3A 4NHJA 3PQKA 2V79A 2TDXA 2OQGA 4A5MA 3FWEA 2Z9OA 2XIGA 2HYGD 3H3ZA 4LLGF 3BJAA 1YTYA 4OIRF 3KZZA 4EVIA 2NYXA 5L3FA 4BNCA 2O8XA 1PP7U 4RGSA 1TQMA 3I54A 3MZHA 5HS9A 3K0LA 4I09A 4M72A 5LGTA 2DPUA 4OMZA 5FFXA 1C0WA 3V4GA 4IJAA 3J81K 1FZPB 3ML6A 1YW8A 3E3VA 3R6SA 3E5QA 1WRJA 2OZ6A 4HV5A 1AOYA 1XMKA 1B4AA 4QWQA 1U8RA 1E17A 1SD5A 3GUDA 4XSZF 1XSXA 2EV5A 2FF4A 1ZGJA 2XAHA 1J59A 3I5UA 1UHMA 1S6LA 2DBBA 3ULQB 2NAZA 3MEXA 1P92A 1ZRFA 3RKXA 1Z6TA 2GZWA 2RC4A 1JHHA 5DV5A 2VC1A 1I1GA 1IN7A 3I4PA 5K5OA 4MTDA 1B6AA 5LGNA 4EQQA 4P9FA 4D0PA 3CUQA 1DUXC 3HTUA 5BOXA 2HGCA 2CGPA 3QAHA 2F5CA 1TBXA 2MD5A 1ZLJA 1YLFA 5ERIA 4ENNA 2Z3YA 2EFOA 1G6NA 3BJOA 3W6JB 4M9SA 1R1VA 4JQFA 2CQKA 4IXAA 2H94A 3CO7C 1HKQA 3JTGA 3DF8A 1UFMA 1SD6A 3O2PE 4KIGA 2GXBA 4CGZA 3IKTA 2FEZA 1W5TA 2CO5A 2XKOA 3VB2A 5ICFA 1I6XA 1LDJA 1J0RA 1S29A 1UB9A 4HV6A 3FMRA 2GWRA 3IHUA 5F1RA 2VBZA 3F8CA 2RQPA 1T98A 5HS7A 3R0JA 3RPUA 1WI9A 3T5XA 3W6KB 5JHUA 1SFXA 2B0LA 1F5TA 2FBIA 5CLSA 2WC2A 2UZKA 4HX7A 2A6HF 1T39A 5BPIA 3F8NA 4CICA 3JAMZ 4K2EA 2QQAA 2FMYA 3ZQ7A 4CYDA 1EH7A 3FM5A 1MDMB 3KEOA 1TW2A 5CVRA 2QVOA 4WWCA 2L4MA 4B8XA 3LAPA 4HDVA 3ABTA 4EJVA 4ON0A 1KQ9A 2RN7A 1BC8C 1HW5A 3MAJA 1MJBA 4UXNA 5LLQA 3L9FA 1YYVA 2IA1A 5BPDA 4I02A 1TW3A 4ZZDA 3REOA 2H6CA 1STZA 4KIBA 1XGMA 1HKTA 4WXHA 2JPBA 1XGNA 3C7JA 4R79A 1DPUA 1MD0A 1FC3A 2XAQA 4XLNF 5E1WA 1B59A 4L9JA 4S05A 1FYLA 2VT3A 3FXRA 1K7AA 4ETSA 2O3FA 1YW7A 1R1UA 4PZJA 2VONA 3HSFA 5D8LB 3ZMZA 4KMUX 1FT9A 2Q2EA 2DW4A 4GYGA 2HR3A 1D8KA 2O03A 1QNTA 3IL2A 2V1XA 1T6SA 1ZRDA 3HRUA 2P7CB 2V9VA 1TTYA 5HOOA 4M9XA 3WODF 2PFBA 3V8JA 3CUOA 2M8EA 3WTVC 4LG0B 4LFUA 3CLOA 5H20A 5EEHA 3RJPA 1S8NA 2PMHA 1XDUA 4ENJA 5DCFA 4H0EA 2GIVA 4Q47A 3BWGA 1TQIA 2D45A 5FD6A 1DP7P 5HVQC 1XD7A 3Q5FA 5DCMA 3NQOA 1I27A 4QLCU 4CDGA 4HF1A 1VTNC 3MFKA 4PDKA 1J9IA 4A0ZA 3ZMTA 2QM3A 2XROA 2RVCA 5D4SA 2M5WA 2DTRA 2VBXA 3WGHA 4DNCA 1D3YA 2IJLA 2HS5A 4WX9A 3LQQA 3WE3A 1AWCA 3K1MA 4I2OA 1ZG3A 1Z6RA 4WF2A 3AAFA 4A0XA 2A69F 4ENKA 3DPTA 1G3WA 1LNWA 5BMZA 2EFNA 4Q4ZF 3M8FA 5D4RA 5FB2A 3M7GA 1MKMA 2FBHA 3ISPA 2GXGA 3K9TA 2FXAA 3LA7A 5IT9Z 1LDDA 4HYEA 3TO7A 3N97A 3MCZA 4AVPA 1BC7C 2RDPA 4A0YA 1KYZA 2NNNA 2RKHA 5LHIA 3E5XA 1FLIA 4LG0A 4YIIA 2ETHA 5D6FA 1MGTA 1R5GA 2EK5A 5E8IA 4ESBA 3VODA 4PGGA 4F7ZA 2Y0MA 4L5IA 2G7UA 4OIPF 5AIPA 4G6QA 2DFIA 1V4RA 1X3UA 4EJUA 4I0BA 1U78A 1CGPA 3SHFA 4HOBA 1O7FA 3KP6A 2P6TA 4U0YA 5ICCA 1O3RA 1MZBA 3FMSA 4P96A 5J8CA 4LB5A 2OU2A 3FMQA 2IP2A 4M74A 3T0YA 3T8TA 1IXSB 3ZP5A 1OPCA 2ELHA 3KLNA 3VFZA 1KQ8A 4MEYF 3M1EA 4MQVA 3IRQA 4I0AA 2PEXA 2ZNYA 1J5YA 3P9IA 4I01A 2K4JA 3TKYA 2E7XA 1IF1A 3L00A 3U1DA 2DQRA 1QGPA 2PMUA 1B9MA 1SD4A 5LRSA 3IKVA 4Y15A 5H6QA 5D5WB 4ESJA 3ELKA 2P4WA 4LMYA 4O3MA 3I59B 5L3DA 3PFIA 2HZTA 3Q9SA 4KNYA 4FT8A 5LEJA 1SMYF 4ZYGA 4HLYA 4G7ZF 1SFEA 1ZYRF 3HRSA 3EQLF 3SZPA 1LEAA 3GFIA 2HQRA 4RAZA 5CJ9A 2ADUA 2BE5F 4HDUA 1JHFA 4RB2C 4EJOA 2GA1A 2STWA 3F23A 1RI7A 2VOPA 3JW4A 2LNBA 5J8FA 1YFHA 2RGVA 3QOPA 1RUOA 4HZFA 2ZO4A 5AIQA 5HDKA 2LF7A 3DFGA 3KEQA 4M6XA 3ABUA 5HLIA 2XAGA 3E6BA 2XASA 3CUQB 3BP8A 2G9WA 4EM2A 2A07F 1QZZA 5KK1A 2HFHA 2MH2A 1H9GA 4KA4A 3TDZC 2UXNA 5CVUA 1W4MA 2W85A 1UHWA 3MWMA 3FX3A 3GVAA 2OA4A 3GFMA 3I59A 2OQRA 3CUQC 3JTHA 4I98B 1P6RA 1ZN2A 2EA2A 5LEKA 2OZUA 2M45A 5DDGA 2YX7A 3J81Z 1F4KA 4ZYDA 1OYIA 4BHBA 4M9ZA 3F6VA 3TDUC 3QU6A 1F9NA 2DO7A 1BI1A 2F2EA 5ED4A 2DK8A 2IPQX 3N4MA 1K6OA 1HW2A 5JI6A 4IF4A 2HEOA 3VOEA 5DEQA 2DPDA 4LLLA 4JK1X 4UVBA 4EGZA 2OBPA 4XRFA 1LDKB 1KU9A 3DXJF 1HXDA 2W25A 1BI2A 1YG2A 5L3CA 2KIUA 2ZBKA 1O3SA 4L18B 1O7LA 1ON2A 3DV8A 3WTZA 5LBQA 3U2RA 4CZZA 3LA2A 3H92A 3V8KA 1KYWA 3Q9VA 2O61A 3B73A 2QLZA 4YFKF 3P9CA 3C18A 4OIOF 2A6EF 1REPC 2UWMA 4HX4A 1XSVA 2EFQA 2ZNZA 4M73A 2EV0A 2VBWA 5FFZA 1S3JA 1P2FA 4BXUA 2ZMEA 5CVVA 1SAXA 3BPVA 1WWXA 2A5YB 1LQ1A 1IN5A 1QO0D 2HDCA 2ZFWA 1R5HA 1IN6A 3KFWX 5K5RA 2D1HA 4LB6B 2XAFA 1YO5C 3EUHA 1ZHFA 4P9UA 2Z5UA 3COAC 2R7FA 5BQTA 2FBKA 3TO9A 3ZMUA 4OMYA 3KP4A 3TOBA 5DD8A 4ZYEA 4U0WA 4GCVA 5F64A 4BYYA 3WTWC 4BAYA 2WV0A 4HAMA 1T2KA 2R7DA 2L3DA 1FP2A 2VN2A 2WWYA 3MQ0A 4RB3C 3M8EA 4MHGA 3CDHA 1ODDA 1I1SA 1PP8F 1RIOH 2JTVA 1W5SA 2IA2A 2IRFG 2COMA 5K1YA 5DCMB 2KKOA 1DPRA 5JR3A 1WSUA 2P5LC 3K1PA 1F1ZA 2BYVE 3J80K 1BIBA 3I71A 2LSOA 4R1HA 2VOOA 4M6YA 1HSJA 3DPLC 2NRAC 4Z2YA 4EGYA 4FX4A 1YW9A 1ZAOA 1K79A 4U7BA 3GLXA 4P5OA 2DU9A 4EJWA 4L9TA 4UV9A 3HTSB 3O6BB 2OD5A 2FA5A 3MZYA 4KN7X 4UHTA 1SFUA 4L5JA 1KU7A 2HWVA 1G3TA 1B1BA 2FNPA 2YX4A 3V7RA 1Z91A 2XVCA 2XV4S 1FSHA 1FYKA 5D8KB 1IXRC 4RGUA 4LGWA 3WU0A 3V7CA 1PDNC 4YIFA 1YS6A 1ZG1A 2IA0A 5FLXK 2Z99A 2LF8A 1D8JA 2GQQA 1XDSA 4FHTA 1CF7A 2RNJA 2VE8A 5DUIA 3FXQA 2K27A 5KVRA 2XGXA 4I7HA 5ILUA 3EYIA 2YPRA 3E97A 3NEUA 4WXDA 2BBYA 2KJCA 5E20A 2JSCA 1IW7F 1U6GA 3G73A 5CYVA 1GVJA 4CHUA 1K78A 4G6DA 3RI4A 3HHHA 1IAWA 3BPXA 5DD4A 3S2WA 4UUVA 1LEBA 3I0TA 4P55A 2KIMA 2GAUA 3ECOA 5DYMA 4G9YA 4BHPA 1Z9CA 5L3BA 4AWXB 3LA3A 4KUMA 4ESFA 1YQAA 1FBQA 1ZH5A 4IPAA 2E7WA 2M1BA 1HW1A 1BIAA 2Y48A 4EJTA 2LKPA 3IC7A 1HQCA 1R1TA 3F8FA 3LSTA 3RTRA 1ZRCA 2BV6A 4WK8F 4MNUA 4HX8A 4L9VA 1FPQA 5HLGA 3ZN1A 2HQNA 4A12A 3R61A 3K69A 4EV0A 1BJAA 1SD7A 4GGGA 3TOAA 1MJ9A 3RDIA 3I53A 2F5DA 4OIQF 5DUKA 5FGMA 4YFXF 3WE2A 4MQ9F 4UVAA 2AXLA 2JRTA 3RYRA 3F3XA 1J75A 2FE3A 4NQWA 2EV6A 3DEUA 2J5OA 3GWZA 2PI0A 2ACJA 2IVMA 4KFCA 4ENMA 1TQPA 4RAYA 1E2XA 5AONA 2W57A 3KZYA 3HYIA 2HYFA 4MEXF 2YR2A 1OMIA 3LFKA 1ZREA 4XSXF 1IN4A 2K4BA 2KIFA 1XB4A 1Y0UA 2DQLA 5D6EA 4HQMA 3BJ6A 3KP2A 3BDDA 2CFXA 3QP5A 2JPCA 4HLXA 3E5UA 1HKSA 3WU1B 1O3TA 4HW0A 4G7OF 1B9NA 1YS7A 2DK5A 1R22A 3ERED 3WG9A 5H6RA 1H0MA 3IWFA 2K7LA 4A6DA 5HLHA 4L9NA 1XCVA 1R36A 4N9HA 3HOTA 1FBUA 2L01A 4KMFA 2X0LA 4U7DA 3GYHX 2O6GE 2HOEA 4CXFA 4IHSA 1U5TB 3NRVA 5J6XA 2STTA 3ZPLA 3OOPA 5IT3A 3FXUA 5K5QA 2HKOA 2MBFA 2Z33A 4AIHA 1Q1HA 4IRHA 2X4HA 2ISYA 3WTTC 2FQ3A 1IZ1A 1FBSA 4LLNA 1Z7UA 2MLKA 1SMTA 1L3LA 2JT1A 1MJAA 2XUBA 1IXCA 1O57A 4MTEA 3KP7A 3P7NA 1T0FA 4KYWA 2J5PA 4KICA 1L0OC 4EMSA 1R00A 2PQ8A 2RV8A 4JBAA 4RB0A 2F5EA 3V7SA 4B09A 4ZZLA 1TNSA 1V3FA 1BBYA 2ZJ2A 4WXCA 2ISZA 2FOKA 5LHHA 1P4AA 3FHZA 2K86A 2VT2A 2XKPA 1TLHB 2QBYB 3IWZA 4IVNA 4N9IA 3HIFA 1IRGA 4AIKA 3M9AA 3KE2A 3C3WA 3SXYA 2ESNA 1U5TA 3PQJA 1KU3A 2NS0A 2ZMEB 2FMLA 1WQ2A 3HHGA 1ULYA 4GXOA 2EJRA 2L54A 3F8BA 2HTSA 3C1DA 4BH9A 1HBXG 1I5ZA 3LQRA 3HSEA 2ZKZA 4E70A 2A3SA 2VODA 1IUYA 2QENA 5TRDA 2G7HA 2P8TA 4ZH4F 1JXSA 3JSOA 3R60A 3QPHA 4IHTA 5JFRA 1XSDA 1OR7A 2MC3A 3BOQA 3WGIA 2MLGA 1XCBA 3WTYC 3IRRA 5ILVA 4AIJA 2VBYA 2P6SA 1XMAA 2QQBA 5D5VB 4A2UA 2GA2A 2QBYA 3EETA 1QBJA 2OAZA 4HA8A 5D5XB 2CW0F 3D5LA 5LRRA 2W24A 3BZ6A 1FOKA 2H27A 2A61A 1A04A 1GXQA 3KETA 2EWNA 5FO5A 3FF5A 2EB7A 3B02A 5BS6A 4MGRA 2DI3A 2C6YA 1PUEE 1FX7A 2LDUA 1BN5A 3WGGA 1TNTA 3HUGA 1P4WA 3KCCA 3WTUC 1OYWA 3LWFA 5HDGA 3DKWA 1DDNA 4EM1A 5E18F 1ZG5A 4G8XA 3GFJA 3JAMK 3HOSA 1BOAA 3FM3A 1FYMA 2CYYA 2DT5A 5JVTA 3WTXC 3QP6A 4Q5SF 1Z1DA 5FD5A 1LVAA 4U0VA 4Y13A 3E6MA 3QPTA 4EM0B 2QWWA 2NNYA 2L02A 4CO8A 3F8MA 2M30A 2QUFA 3DQVC 4IRGA 1CF7B 4BQAA 3L2CA 1RZ4A 4HQEA 2PBIA 1USSA 3P9KA 4RGXA 3GX4X 2V1UA 2QYOA 5CVIA 3GW2A 3TO6A 1YIOA 3K2ZA 3EYYA 5EEGA 1KA8A 4RS8A 2FNAA 3CO6C 4O6JA 3J7AO 2QZ8A 1U3EM 3RKWA 1K78B 1KU2A 4LK0F 4OINF 1OKRA 1LB2A 5HS8A 3H3UA 1BM9A 2V6CA 2VC0A 2V1DA 5CVJA 3KP3A 1JGSA 4PCQA 2ZXJA 3F22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1N A;  4KDP A;  4S04 A;  2HKX A;  3J80 Z;  3RPQ A;  4GYI A;  3CTA A;  4RGR A;  4LK1 F;  2IW5 A;  2KRF A;  2DAO A;  1IRF A;  2E1C A;  3T8R A;  3ECH A;  2QQ9 A;  2PG4 A;  3I58 A;  4BHC A;  1IN8 A;  2CG4 A;  1O3Q A;  1RUN A;  1Z05 A;  3G3Z A;  2YSR A;  2Q0O A;  1U2W A;  3TGN A;  3F21 A;  1MDM A;  3HRM A;  2EFP A;  3GZ6 A;  3CJN A;  3SFZ A;  1R58 A;  4AD9 A;  3GZ5 A;  2EA4 A;  1ZLK A;  4A5N A;  2P5K A;  3FZV A;  5FLX Z;  3F72 A;  1UCR A;  4KT5 C;  1RNL A;  1P4X A;  5TJJ A;  5A2Q K;  4U88 A;  1R7J A;  1W7P B;  4ASN A;  2EFW A;  2MH9 A;  1ONV A;  1HST A;  2R3S A;  3GO5 A;  3BY6 A;  4R8H A;  1D5V A;  1QZY A;  2E1N A;  1H9T A;  2XRN A;  2JZY A;  3T1B A;  4LD5 A;  4ZYH A;  3E6D A;  5A2Q Z;  1NHA A;  3SQN A;  4Y17 A;  2KJB A;  3LAJ A;  2O0Y A;  4UVC A;  2CSO A;  5L3G A;  1FSE A;  3E6C C;  2BEO A;  4NB5 A;  2P7V B;  1KGS A;  3R4K A;  3L09 A;  1ZGA A;  5IT9 K;  4FX0 A;  5E8G A;  2IT0 A;  4L0Y B;  2ESH A;  1GXP A;  4XBF A;  3F6O A;  4OU0 A;  4GO1 A;  1ON1 A;  4KN4 X;  4YG2 F;  4IRI A;  4UNO A;  1XGS A;  2Q8K A;  5F6F A;  2H09 A;  3U9G A;  1J7K A;  2MA3 A;  3QU3 A;  4M71 A;  4L0Z B;  3JSP A;  2FRH A;  3RYP A;  1W7P A;  1WKM A;  2PLY A;  1XGO A;  1S7A A;  3O3K A;  5D5U B;  2FSW A;  1FWZ A;  3ZMD A;  2W84 A;  4XLP F;  1XN7 A;  5ILS A;  1R23 A;  2HTJ A;  3RIR A;  4G7H F;  4HBL A;  3V8L A;  3ZN0 A;  5L3E A;  1W7P D;  4RB1 A;  3HRT A;  1KQ0 A;  4PGH A;  2P5V A;  1T38 A;  3GEZ A;  3TQN A;  1ZAR A;  1FY7 A;  2BGC A;  1G3S A;  2CWE A;  1S7O A;  3R0A A;  3L7W A;  4LJZ F;  5ICE A;  5LGU A;  2D1V A;  2F5F A;  2PN6 A;  2M87 A;  3DP7 A;  1LJ9 A;  1QQI A;  1J2X A;  4Q48 A;  1UST A;  3D0S A;  1FP1 D;  4HF0 A;  1OYY A;  1G4D A;  2VXZ A;  2Y75 A;  1EH6 A;  3GFL A;  6PAX A;  3ZMS A;  1GHC A;  4OOI A;  1EV7 A;  2XAJ A;  2DLL A;  1QPM A;  4WCG A;  2FU4 A;  3QRF F;  3WTS C;  3ZMV A;  3RKY A;  2ZCW A;  1JE8 A;  2L4A A;  1EH8 A;  1G3Y A;  3GXO A;  4N0B A;  3BRO A;  2YU3 A;  2A68 F;  4UV8 A;  5HDN A;  5E17 F;  2WTE A;  1FNN A;  3EDP A;  2PJP A;  2XHK A;  4A6E A;  4YFN F;  5ICG A;  2H6B A;  3OV8 A;  2D2W A;  3SZT A;  4TV7 A;  3ROU A;  3VEP A;  1U5T C;  3GF2 A;  2UXX A;  3HSR A;  4G94 A;  5LHG A;  2AS5 F;  1BI0 A;  4KIF A;  4O5V A;  4DQ2 A;  2VE9 A;  2K02 A;  4HF2 A;  3KP5 A;  3I64 A;  3KLO A;  5E1X A;  5E1Z B;  1BI3 A;  4NHJ A;  3PQK A;  2V79 A;  2TDX A;  2OQG A;  4A5M A;  3FWE A;  2Z9O A;  2XIG A;  2HYG D;  3H3Z A;  4LLG F;  3BJA A;  1YTY A;  4OIR F;  3KZZ A;  4EVI A;  2NYX A;  5L3F A;  4BNC A;  2O8X A;  1PP7 U;  4RGS A;  1TQM A;  3I54 A;  3MZH A;  5HS9 A;  3K0L A;  4I09 A;  4M72 A;  5LGT A;  2DPU A;  4OMZ A;  5FFX A;  1C0W A;  3V4G A;  4IJA A;  3J81 K;  1FZP B;  3ML6 A;  1YW8 A;  3E3V A;  3R6S A;  3E5Q A;  1WRJ A;  2OZ6 A;  4HV5 A;  1AOY A;  1XMK A;  1B4A A;  4QWQ A;  1U8R A;  1E17 A;  1SD5 A;  3GUD A;  4XSZ F;  1XSX A;  2EV5 A;  2FF4 A;  1ZGJ A;  2XAH A;  1J59 A;  3I5U A;  1UHM A;  1S6L A;  2DBB A;  3ULQ B;  2NAZ A;  3MEX A;  1P92 A;  1ZRF A;  3RKX A;  1Z6T A;  2GZW A;  2RC4 A;  1JHH A;  5DV5 A;  2VC1 A;  1I1G A;  1IN7 A;  3I4P A;  5K5O A;  4MTD A;  1B6A A;  5LGN A;  4EQQ A;  4P9F A;  4D0P A;  3CUQ A;  1DUX C;  3HTU A;  5BOX A;  2HGC A;  2CGP A;  3QAH A;  2F5C A;  1TBX A;  2MD5 A;  1ZLJ A;  1YLF A;  5ERI A;  4ENN A;  2Z3Y A;  2EFO A;  1G6N A;  3BJO A;  3W6J B;  4M9S A;  1R1V A;  4JQF A;  2CQK A;  4IXA A;  2H94 A;  3CO7 C;  1HKQ A;  3JTG A;  3DF8 A;  1UFM A;  1SD6 A;  3O2P E;  4KIG A;  2GXB A;  4CGZ A;  3IKT A;  2FEZ A;  1W5T A;  2CO5 A;  2XKO A;  3VB2 A;  5ICF A;  1I6X A;  1LDJ A;  1J0R A;  1S29 A;  1UB9 A;  4HV6 A;  3FMR A;  2GWR A;  3IHU A;  5F1R A;  2VBZ A;  3F8C A;  2RQP A;  1T98 A;  5HS7 A;  3R0J A;  3RPU A;  1WI9 A;  3T5X A;  3W6K B;  5JHU A;  1SFX A;  2B0L A;  1F5T A;  2FBI A;  5CLS A;  2WC2 A;  2UZK A;  4HX7 A;  2A6H F;  1T39 A;  5BPI A;  3F8N A;  4CIC A;  3JAM Z;  4K2E A;  2QQA A;  2FMY A;  3ZQ7 A;  4CYD A;  1EH7 A;  3FM5 A;  1MDM B;  3KEO A;  1TW2 A;  5CVR A;  2QVO A;  4WWC A;  2L4M A;  4B8X A;  3LAP A;  4HDV A;  3ABT A;  4EJV A;  4ON0 A;  1KQ9 A;  2RN7 A;  1BC8 C;  1HW5 A;  3MAJ A;  1MJB A;  4UXN A;  5LLQ A;  3L9F A;  1YYV A;  2IA1 A;  5BPD A;  4I02 A;  1TW3 A;  4ZZD A;  3REO A;  2H6C A;  1STZ A;  4KIB A;  1XGM A;  1HKT A;  4WXH A;  2JPB A;  1XGN A;  3C7J A;  4R79 A;  1DPU A;  1MD0 A;  1FC3 A;  2XAQ A;  4XLN F;  5E1W A;  1B59 A;  4L9J A;  4S05 A;  1FYL A;  2VT3 A;  3FXR A;  1K7A A;  4ETS A;  2O3F A;  1YW7 A;  1R1U A;  4PZJ A;  2VON A;  3HSF A;  5D8L B;  3ZMZ A;  4KMU X;  1FT9 A;  2Q2E A;  2DW4 A;  4GYG A;  2HR3 A;  1D8K A;  2O03 A;  1QNT A;  3IL2 A;  2V1X A;  1T6S A;  1ZRD A;  3HRU A;  2P7C B;  2V9V A;  1TTY A;  5HOO A;  4M9X A;  3WOD F;  2PFB A;  3V8J A;  3CUO A;  2M8E A;  3WTV C;  4LG0 B;  4LFU A;  3CLO A;  5H20 A;  5EEH A;  3RJP A;  1S8N A;  2PMH A;  1XDU A;  4ENJ A;  5DCF A;  4H0E A;  2GIV A;  4Q47 A;  3BWG A;  1TQI A;  2D45 A;  5FD6 A;  1DP7 P;  5HVQ C;  1XD7 A;  3Q5F A;  5DCM A;  3NQO A;  1I27 A;  4QLC U;  4CDG A;  4HF1 A;  1VTN C;  3MFK A;  4PDK A;  1J9I A;  4A0Z A;  3ZMT A;  2QM3 A;  2XRO A;  2RVC A;  5D4S A;  2M5W A;  2DTR A;  2VBX A;  3WGH A;  4DNC A;  1D3Y A;  2IJL A;  2HS5 A;  4WX9 A;  3LQQ A;  3WE3 A;  1AWC A;  3K1M A;  4I2O A;  1ZG3 A;  1Z6R A;  4WF2 A;  3AAF A;  4A0X A;  2A69 F;  4ENK A;  3DPT A;  1G3W A;  1LNW A;  5BMZ A;  2EFN A;  4Q4Z F;  3M8F A;  5D4R A;  5FB2 A;  3M7G A;  1MKM A;  2FBH A;  3ISP A;  2GXG A;  3K9T A;  2FXA A;  3LA7 A;  5IT9 Z;  1LDD A;  4HYE A;  3TO7 A;  3N97 A;  3MCZ A;  4AVP A;  1BC7 C;  2RDP A;  4A0Y A;  1KYZ A;  2NNN A;  2RKH A;  5LHI A;  3E5X A;  1FLI A;  4LG0 A;  4YII A;  2ETH A;  5D6F A;  1MGT A;  1R5G A;  2EK5 A;  5E8I A;  4ESB A;  3VOD A;  4PGG A;  4F7Z A;  2Y0M A;  4L5I A;  2G7U A;  4OIP F;  5AIP A;  4G6Q A;  2DFI A;  1V4R A;  1X3U A;  4EJU A;  4I0B A;  1U78 A;  1CGP A;  3SHF A;  4HOB A;  1O7F A;  3KP6 A;  2P6T A;  4U0Y A;  5ICC A;  1O3R A;  1MZB A;  3FMS A;  4P96 A;  5J8C A;  4LB5 A;  2OU2 A;  3FMQ A;  2IP2 A;  4M74 A;  3T0Y A;  3T8T A;  1IXS B;  3ZP5 A;  1OPC A;  2ELH A;  3KLN A;  3VFZ A;  1KQ8 A;  4MEY F;  3M1E A;  4MQV A;  3IRQ A;  4I0A A;  2PEX A;  2ZNY A;  1J5Y A;  3P9I A;  4I01 A;  2K4J A;  3TKY A;  2E7X A;  1IF1 A;  3L00 A;  3U1D A;  2DQR A;  1QGP A;  2PMU A;  1B9M A;  1SD4 A;  5LRS A;  3IKV A;  4Y15 A;  5H6Q A;  5D5W B;  4ESJ A;  3ELK A;  2P4W A;  4LMY A;  4O3M A;  3I59 B;  5L3D A;  3PFI A;  2HZT A;  3Q9S A;  4KNY A;  4FT8 A;  5LEJ A;  1SMY F;  4ZYG A;  4HLY A;  4G7Z F;  1SFE A;  1ZYR F;  3HRS A;  3EQL F;  3SZP A;  1LEA A;  3GFI A;  2HQR A;  4RAZ A;  5CJ9 A;  2ADU A;  2BE5 F;  4HDU A;  1JHF A;  4RB2 C;  4EJO A;  2GA1 A;  2STW A;  3F23 A;  1RI7 A;  2VOP A;  3JW4 A;  2LNB A;  5J8F A;  1YFH A;  2RGV A;  3QOP A;  1RUO A;  4HZF A;  2ZO4 A;  5AIQ A;  5HDK A;  2LF7 A;  3DFG A;  3KEQ A;  4M6X A;  3ABU A;  5HLI A;  2XAG A;  3E6B A;  2XAS A;  3CUQ B;  3BP8 A;  2G9W A;  4EM2 A;  2A07 F;  1QZZ A;  5KK1 A;  2HFH A;  2MH2 A;  1H9G A;  4KA4 A;  3TDZ C;  2UXN A;  5CVU A;  1W4M A;  2W85 A;  1UHW A;  3MWM A;  3FX3 A;  3GVA A;  2OA4 A;  3GFM A;  3I59 A;  2OQR A;  3CUQ C;  3JTH A;  4I98 B;  1P6R A;  1ZN2 A;  2EA2 A;  5LEK A;  2OZU A;  2M45 A;  5DDG A;  2YX7 A;  3J81 Z;  1F4K A;  4ZYD A;  1OYI A;  4BHB A;  4M9Z A;  3F6V A;  3TDU C;  3QU6 A;  1F9N A;  2DO7 A;  1BI1 A;  2F2E A;  5ED4 A;  2DK8 A;  2IPQ X;  3N4M A;  1K6O A;  1HW2 A;  5JI6 A;  4IF4 A;  2HEO A;  3VOE A;  5DEQ A;  2DPD A;  4LLL A;  4JK1 X;  4UVB A;  4EGZ A;  2OBP A;  4XRF A;  1LDK B;  1KU9 A;  3DXJ F;  1HXD A;  2W25 A;  1BI2 A;  1YG2 A;  5L3C A;  2KIU A;  2ZBK A;  1O3S A;  4L18 B;  1O7L A;  1ON2 A;  3DV8 A;  3WTZ A;  5LBQ A;  3U2R A;  4CZZ A;  3LA2 A;  3H92 A;  3V8K A;  1KYW A;  3Q9V A;  2O61 A;  3B73 A;  2QLZ A;  4YFK F;  3P9C A;  3C18 A;  4OIO F;  2A6E F;  1REP C;  2UWM A;  4HX4 A;  1XSV A;  2EFQ A;  2ZNZ A;  4M73 A;  2EV0 A;  2VBW A;  5FFZ A;  1S3J A;  1P2F A;  4BXU A;  2ZME A;  5CVV A;  1SAX A;  3BPV A;  1WWX A;  2A5Y B;  1LQ1 A;  1IN5 A;  1QO0 D;  2HDC A;  2ZFW A;  1R5H A;  1IN6 A;  3KFW X;  5K5R A;  2D1H A;  4LB6 B;  2XAF A;  1YO5 C;  3EUH A;  1ZHF A;  4P9U A;  2Z5U A;  3COA C;  2R7F A;  5BQT A;  2FBK A;  3TO9 A;  3ZMU A;  4OMY A;  3KP4 A;  3TOB A;  5DD8 A;  4ZYE A;  4U0W A;  4GCV A;  5F64 A;  4BYY A;  3WTW C;  4BAY A;  2WV0 A;  4HAM A;  1T2K A;  2R7D A;  2L3D A;  1FP2 A;  2VN2 A;  2WWY A;  3MQ0 A;  4RB3 C;  3M8E A;  4MHG A;  3CDH A;  1ODD A;  1I1S A;  1PP8 F;  1RIO H;  2JTV A;  1W5S A;  2IA2 A;  2IRF G;  2COM A;  5K1Y A;  5DCM B;  2KKO A;  1DPR A;  5JR3 A;  1WSU A;  2P5L C;  3K1P A;  1F1Z A;  2BYV E;  3J80 K;  1BIB A;  3I71 A;  2LSO A;  4R1H A;  2VOO A;  4M6Y A;  1HSJ A;  3DPL C;  2NRA C;  4Z2Y A;  4EGY A;  4FX4 A;  1YW9 A;  1ZAO A;  1K79 A;  4U7B A;  3GLX A;  4P5O A;  2DU9 A;  4EJW A;  4L9T A;  4UV9 A;  3HTS B;  3O6B B;  2OD5 A;  2FA5 A;  3MZY A;  4KN7 X;  4UHT A;  1SFU A;  4L5J A;  1KU7 A;  2HWV A;  1G3T A;  1B1B A;  2FNP A;  2YX4 A;  3V7R A;  1Z91 A;  2XVC A;  2XV4 S;  1FSH A;  1FYK A;  5D8K B;  1IXR C;  4RGU A;  4LGW A;  3WU0 A;  3V7C A;  1PDN C;  4YIF A;  1YS6 A;  1ZG1 A;  2IA0 A;  5FLX K;  2Z99 A;  2LF8 A;  1D8J A;  2GQQ A;  1XDS A;  4FHT A;  1CF7 A;  2RNJ A;  2VE8 A;  5DUI A;  3FXQ A;  2K27 A;  5KVR A;  2XGX A;  4I7H A;  5ILU A;  3EYI A;  2YPR A;  3E97 A;  3NEU A;  4WXD A;  2BBY A;  2KJC A;  5E20 A;  2JSC A;  1IW7 F;  1U6G A;  3G73 A;  5CYV A;  1GVJ A;  4CHU A;  1K78 A;  4G6D A;  3RI4 A;  3HHH A;  1IAW A;  3BPX A;  5DD4 A;  3S2W A;  4UUV A;  1LEB A;  3I0T A;  4P55 A;  2KIM A;  2GAU A;  3ECO A;  5DYM A;  4G9Y A;  4BHP A;  1Z9C A;  5L3B A;  4AWX B;  3LA3 A;  4KUM A;  4ESF A;  1YQA A;  1FBQ A;  1ZH5 A;  4IPA A;  2E7W A;  2M1B A;  1HW1 A;  1BIA A;  2Y48 A;  4EJT A;  2LKP A;  3IC7 A;  1HQC A;  1R1T A;  3F8F A;  3LST A;  3RTR A;  1ZRC A;  2BV6 A;  4WK8 F;  4MNU A;  4HX8 A;  4L9V A;  1FPQ A;  5HLG A;  3ZN1 A;  2HQN A;  4A12 A;  3R61 A;  3K69 A;  4EV0 A;  1BJA A;  1SD7 A;  4GGG A;  3TOA A;  1MJ9 A;  3RDI A;  3I53 A;  2F5D A;  4OIQ F;  5DUK A;  5FGM A;  4YFX F;  3WE2 A;  4MQ9 F;  4UVA A;  2AXL A;  2JRT A;  3RYR A;  3F3X A;  1J75 A;  2FE3 A;  4NQW A;  2EV6 A;  3DEU A;  2J5O A;  3GWZ A;  2PI0 A;  2ACJ A;  2IVM A;  4KFC A;  4ENM A;  1TQP A;  4RAY A;  1E2X A;  5AON A;  2W57 A;  3KZY A;  3HYI A;  2HYF A;  4MEX F;  2YR2 A;  1OMI A;  3LFK A;  1ZRE A;  4XSX F;  1IN4 A;  2K4B A;  2KIF A;  1XB4 A;  1Y0U A;  2DQL A;  5D6E A;  4HQM A;  3BJ6 A;  3KP2 A;  3BDD A;  2CFX A;  3QP5 A;  2JPC A;  4HLX A;  3E5U A;  1HKS A;  3WU1 B;  1O3T A;  4HW0 A;  4G7O F;  1B9N A;  1YS7 A;  2DK5 A;  1R22 A;  3ERE D;  3WG9 A;  5H6R A;  1H0M A;  3IWF A;  2K7L A;  4A6D A;  5HLH A;  4L9N A;  1XCV A;  1R36 A;  4N9H A;  3HOT A;  1FBU A;  2L01 A;  4KMF A;  2X0L A;  4U7D A;  3GYH X;  2O6G E;  2HOE A;  4CXF A;  4IHS A;  1U5T B;  3NRV A;  5J6X A;  2STT A;  3ZPL A;  3OOP A;  5IT3 A;  3FXU A;  5K5Q A;  2HKO A;  2MBF A;  2Z33 A;  4AIH A;  1Q1H A;  4IRH A;  2X4H A;  2ISY A;  3WTT C;  2FQ3 A;  1IZ1 A;  1FBS A;  4LLN A;  1Z7U A;  2MLK A;  1SMT A;  1L3L A;  2JT1 A;  1MJA A;  2XUB A;  1IXC A;  1O57 A;  4MTE A;  3KP7 A;  3P7N A;  1T0F A;  4KYW A;  2J5P A;  4KIC A;  1L0O C;  4EMS A;  1R00 A;  2PQ8 A;  2RV8 A;  4JBA A;  4RB0 A;  2F5E A;  3V7S A;  4B09 A;  4ZZL A;  1TNS A;  1V3F A;  1BBY A;  2ZJ2 A;  4WXC A;  2ISZ A;  2FOK A;  5LHH A;  1P4A A;  3FHZ A;  2K86 A;  2VT2 A;  2XKP A;  1TLH B;  2QBY B;  3IWZ A;  4IVN A;  4N9I A;  3HIF A;  1IRG A;  4AIK A;  3M9A A;  3KE2 A;  3C3W A;  3SXY A;  2ESN A;  1U5T A;  3PQJ A;  1KU3 A;  2NS0 A;  2ZME B;  2FML A;  1WQ2 A;  3HHG A;  1ULY A;  4GXO A;  2EJR A;  2L54 A;  3F8B A;  2HTS A;  3C1D A;  4BH9 A;  1HBX G;  1I5Z A;  3LQR A;  3HSE A;  2ZKZ A;  4E70 A;  2A3S A;  2VOD A;  1IUY A;  2QEN A;  5TRD A;  2G7H A;  2P8T A;  4ZH4 F;  1JXS A;  3JSO A;  3R60 A;  3QPH A;  4IHT A;  5JFR A;  1XSD A;  1OR7 A;  2MC3 A;  3BOQ A;  3WGI A;  2MLG A;  1XCB A;  3WTY C;  3IRR A;  5ILV A;  4AIJ A;  2VBY A;  2P6S A;  1XMA A;  2QQB A;  5D5V B;  4A2U A;  2GA2 A;  2QBY A;  3EET A;  1QBJ A;  2OAZ A;  4HA8 A;  5D5X B;  2CW0 F;  3D5L A;  5LRR A;  2W24 A;  3BZ6 A;  1FOK A;  2H27 A;  2A61 A;  1A04 A;  1GXQ A;  3KET A;  2EWN A;  5FO5 A;  3FF5 A;  2EB7 A;  3B02 A;  5BS6 A;  4MGR A;  2DI3 A;  2C6Y A;  1PUE E;  1FX7 A;  2LDU A;  1BN5 A;  3WGG A;  1TNT A;  3HUG A;  1P4W A;  3KCC A;  3WTU C;  1OYW A;  3LWF A;  5HDG A;  3DKW A;  1DDN A;  4EM1 A;  5E18 F;  1ZG5 A;  4G8X A;  3GFJ A;  3JAM K;  3HOS A;  1BOA A;  3FM3 A;  1FYM A;  2CYY A;  2DT5 A;  5JVT A;  3WTX C;  3QP6 A;  4Q5S F;  1Z1D A;  5FD5 A;  1LVA A;  4U0V A;  4Y13 A;  3E6M A;  3QPT A;  4EM0 B;  2QWW A;  2NNY A;  2L02 A;  4CO8 A;  3F8M A;  2M30 A;  2QUF A;  3DQV C;  4IRG A;  1CF7 B;  4BQA A;  3L2C A;  1RZ4 A;  4HQE A;  2PBI A;  1USS A;  3P9K A;  4RGX A;  3GX4 X;  2V1U A;  2QYO A;  5CVI A;  3GW2 A;  3TO6 A;  1YIO A;  3K2Z A;  3EYY A;  5EEG A;  1KA8 A;  4RS8 A;  2FNA A;  3CO6 C;  4O6J A;  3J7A O;  2QZ8 A;  1U3E M;  3RKW A;  1K78 B;  1KU2 A;  4LK0 F;  4OIN F;  1OKR A;  1LB2 A;  5HS8 A;  3H3U A;  1BM9 A;  2V6C A;  2VC0 A;  2V1D A;  5CVJ A;  3KP3 A;  1JGS A;  4PCQ A;  2ZXJ A;  3F22 A; 
#chains in the Genus database with same CATH topology
 3K1N A;  1X4O A;  2TCT A;  1JTY A;  2LKX A;  5IOZ A;  1KZH A;  4KDP A;  2IEK A;  4S04 A;  2HKX A;  4I6Z A;  3J80 Z;  4C9Y A;  3RPQ A;  4GYI A;  3CTA A;  4RGR A;  3TL4 X;  1A5J A;  4LK1 F;  2IW5 A;  2KRF A;  3CMA I;  2DAO A;  1IRF A;  4FE4 A;  3DPU A;  1XTA A;  2CQQ A;  2L7Z A;  2E1C A;  3T8R A;  3ECH A;  2HNH A;  2QQ9 A;  2Y69 H;  2KZG A;  2E2J J;  2PG4 A;  3I58 A;  4XLA A;  1QU3 A;  4BHC A;  1IN8 A;  1S7E A;  1RC9 A;  4XRM A;  1IC8 A;  4X0G A;  1X58 A;  2CG4 A;  4XMY A;  1Y39 A;  1O3Q A;  2KP6 A;  1RUN A;  1Z05 A;  1ORK A;  2OTL I;  3G3Z A;  1HA8 A;  1OCP A;  2YSR A;  3CCR I;  2Q0O A;  2X6X A;  1U2W A;  1Y56 A;  2NOJ B;  3ZXS A;  2HOS A;  3TGN A;  3F21 A;  1I50 J;  1GVD A;  1G8X A;  4A3M J;  1MDM A;  3HRM A;  9ANT A;  4E6K G;  2ME6 A;  2EFP A;  3GZ6 A;  2B9S A;  2LFB A;  3CJN A;  2Y0S A;  5J40 A;  3SFZ A;  1R58 A;  2Q1Z B;  4AD9 A;  3GZ5 A;  3QYE A;  2EA4 A;  1ZLK A;  1GV2 A;  1QVT A;  4A5N A;  1IV6 A;  1WGX A;  2P5K A;  3DWL E;  3FZV A;  2M4K A;  4BBR J;  2N8G A;  5FLX Z;  3F72 A;  1UCR A;  4KT5 C;  1RNL A;  2DJN A;  1P4X A;  5TJJ A;  4CCL A;  4C2T A;  2PMZ A;  3U1K A;  5A2Q K;  4U88 A;  1R7J A;  1W7P B;  2BOL A;  4ASN A;  2EFW A;  4IHX A;  2MH9 A;  1ONV A;  1HST A;  1I3A A;  2OC6 A;  2R3S A;  1SFO J;  2HU9 A;  1Y8Q B;  2M3A A;  1RKW A;  3BY6 A;  3GO5 A;  4R8H A;  3JRA A;  1FJL A;  1QZY A;  2E1N A;  4A3K J;  1D5V A;  2H1K A;  4IHW A;  1H9T A;  4D7N A;  3S1Q J;  2R92 J;  2XRN A;  2JZY A;  1UHS A;  1RR8 C;  3T1B A;  2M4G A;  4LD5 A;  4ZYH A;  3HOY J;  1ZK8 A;  3CJR B;  3SYT A;  5IYC J;  3E6D A;  3ZQC A;  4IQJ A;  5A2Q Z;  1NHA A;  2XSD C;  3SQN A;  4XLH A;  3KEY A;  3FXO A;  4Y17 A;  2KJB A;  2VJ5 A;  2BW3 A;  3LAJ A;  5EGO A;  4FIS A;  2O0Y A;  4UVC A;  2CSO A;  5L3G A;  2EBI A;  1FSE A;  3E6C C;  1DGR M;  2BEO A;  3O8H A;  4NB5 A;  2KZV A;  2P7V B;  1KGS A;  3R4K A;  4MFD A;  3L09 A;  1ZGA A;  5IT9 K;  2GOX B;  4XOR A;  4FX0 A;  3C2G A;  5E8G A;  2M0M A;  1VQO I;  1JJ8 C;  2IT0 A;  2ME0 A;  4L0Y B;  2V9K A;  3V42 A;  2L2O A;  4V2F A;  2ELK A;  2DYR H;  2ESH A;  5C3E J;  2CFO A;  1GXP A;  4XBF A;  4AU7 A;  4BKX A;  1MBE A;  3BTC A;  3F6O A;  4OU0 A;  4GO1 A;  1ON1 A;  1JKO C;  4KN4 X;  3VYU B;  4YG2 F;  1GLN A;  4J19 A;  4IRI A;  4UNO A;  5F08 A;  1XGS A;  2X9D A;  1SAN A;  3JRG A;  2K9L A;  4AID A;  3QYF A;  3F9K A;  3H5R A;  2B7E A;  2Q8K A;  3CJQ B;  5F6F A;  3W6V A;  3IH3 A;  2H09 A;  3U9G A;  3L2R A;  1J7K A;  2MA3 A;  4QPQ A;  1R71 A;  3QU3 A;  4M71 A;  4ZC3 A;  3JSP A;  2E5Z A;  4L0Z B;  1EKE A;  4KIT B;  2FRH A;  1HLV A;  1QRY A;  3RYP A;  2LBF B;  2VKH A;  2HYJ A;  1W7P A;  1WKM A;  2PLY A;  1X19 A;  5B3S H;  1XGO A;  2NOG A;  1S7A A;  3O3K A;  5D5U B;  2FSW A;  1U8B A;  1FWZ A;  3ZMD A;  4EAT A;  3G4S I;  2W84 A;  3B6C A;  4XLP F;  1XN7 A;  1MMS A;  5FKM A;  2LRE A;  5ILS A;  2O5R A;  1R23 A;  4BE0 A;  2HTJ A;  2O9L A;  3RIR A;  5F0H A;  3BTI A;  4G7H F;  4HBL A;  3V8L A;  1WJC A;  4N4N B;  3ZN0 A;  1OFC X;  1TC3 C;  5L3E A;  1W7P D;  4RB1 A;  3HRT A;  3DBL B;  1KQ0 A;  4PGH A;  3SEZ A;  2P5V A;  1T38 A;  1YIT I;  3GEZ A;  1U9N A;  4C3I J;  1FMW A;  1BW5 A;  3TQN A;  1ZAR A;  1FY7 A;  2BGC A;  1G3S A;  5EZH A;  2CWE A;  1S7O A;  3R0A A;  3L7W A;  4LJZ F;  5ICE A;  5LGU A;  2QA4 I;  4HSR A;  2D1V A;  2F5F A;  2PN6 A;  1N25 A;  2M87 A;  4AM3 A;  1S5L C;  4XRS G;  3UKG A;  1TT5 B;  2XDV A;  3DP7 A;  1LUJ B;  1LJ9 A;  1QQI A;  2X6O A;  1Y6I A;  1J2X A;  2JVG A;  4Q48 A;  5J1R A;  5CQE A;  3CMM A;  1UST A;  3D0S A;  5JVG F;  1FP1 D;  4HF0 A;  2L9V A;  4PJJ A;  2F48 A;  1OYY A;  1G4D A;  2VXZ A;  2Y75 A;  4JYK A;  1EH6 A;  5KHD A;  2Z2S B;  3GFL A;  4J00 A;  6PAX A;  2Y9Z A;  4BU2 A;  2WAE A;  4J01 A;  3ZMS A;  4NBQ A;  1T0F C;  1GHC A;  2WAQ N;  2BXZ A;  2OCC H;  4OOI A;  1EV7 A;  4BDY A;  2DFE A;  1WJF A;  2ECB A;  1B8I A;  2XAJ A;  2DLL A;  4BAC A;  5M5Y J;  1NK3 P;  1QPM A;  3K6G A;  4WCG A;  2FU4 A;  2IS4 A;  2F4O B;  4U87 A;  3QRF F;  3WTS C;  3K2A A;  1XPX A;  3ZMV A;  2CUE A;  4IL6 C;  3RKY A;  2ZCW A;  2EIN H;  2WB1 A;  1JE8 A;  2EH3 A;  2L4A A;  4IZZ A;  1EH8 A;  3CMY A;  1G3Y A;  3GXO A;  4N0B A;  3KX2 A;  1UZC A;  3BRO A;  2DT7 B;  2YU3 A;  1MND A;  3DTK A;  2A68 F;  1X1P A;  3ZQQ A;  4LOC A;  4UV8 A;  5HDN A;  2DYS H;  5GAD J;  5E17 F;  3SZG A;  2WTE A;  1FNN A;  3EDP A;  2PJP A;  2XHK A;  4A6E A;  4YFN F;  5ICG A;  2H6B A;  3OV8 A;  2JMW A;  2D2W A;  3SZT A;  4CCM A;  4TV7 A;  1TT0 A;  1VQM I;  3ROU A;  2DA7 A;  2KT0 A;  2WBM A;  3VEP A;  1D0Z A;  4DOZ A;  3OYN A;  3OSF A;  1U5T C;  3GF2 A;  2UXX A;  4RM2 A;  3ZR8 X;  3HSR A;  4G94 A;  5LHG A;  1VQ5 I;  2AS5 F;  2JUC A;  1BI0 A;  2ZJR F;  4KIF A;  4O5V A;  1R9T J;  4DQ2 A;  1LFU P;  2VE9 A;  2BY0 A;  2K02 A;  4HF2 A;  3FIS A;  3KP5 A;  4BJT A;  3I64 A;  3KLO A;  3CCL I;  2Z16 A;  5E1X A;  3OIP A;  3OYC A;  5E1Z B;  3I4N J;  1BI3 A;  4NHJ A;  3IP4 B;  3PQK A;  3PNT A;  2V79 A;  2TDX A;  3WHC A;  1D0Y A;  2OQG A;  4A5M A;  3ABL H;  4V19 K;  3CCU I;  1JTX A;  3FWE A;  1Z67 A;  2QKL B;  2Z9O A;  2XIG A;  2HYG D;  3H3Z A;  3HZJ A;  4LLG F;  1U0J A;  1QHG A;  3BJA A;  2O7O A;  1YTY A;  4OIR F;  3KZZ A;  4EVI A;  2LRD A;  1ZQ3 P;  2BXY A;  3HM5 A;  2IS2 A;  2NYX A;  5L3F A;  4BNC A;  2O8X A;  5C44 J;  1PP7 U;  2XC7 A;  1OR7 C;  4RGS A;  1TQM A;  3I54 A;  4M3B A;  4LIV A;  3MZH A;  5HS9 A;  2R7W A;  3K0L A;  4I09 A;  4M72 A;  5LGT A;  2CQX A;  5F0F A;  1Z0X A;  2DPU A;  4OMZ A;  5FFX A;  3CJT B;  4GRI A;  2L0K A;  4I76 A;  2ZXH A;  1C0W A;  3V4G A;  4IJA A;  3Q0U A;  3J81 K;  3W2A A;  1FZP B;  3BT9 A;  3ML6 A;  1YW8 A;  3AG1 H;  3E3V A;  3R6S A;  3E5Q A;  1ETO A;  3L2W A;  1WRJ A;  5LFA A;  2ZJQ F;  2OZ6 A;  2G0E A;  1QPI A;  4B1R A;  3HOU J;  4HV5 A;  1AOY A;  3BR2 A;  1XMK A;  1MBH A;  1B4A A;  2XRL A;  4XK4 A;  2MD0 A;  4QWQ A;  3AL0 B;  3BR5 A;  1N78 A;  4MO7 A;  1U8R A;  3GTK J;  2M7A A;  3HGG A;  1E17 A;  1SD5 A;  2CRG A;  3AG4 H;  1LE8 A;  3GUD A;  4XSZ F;  2Y30 A;  1XSX A;  3BR0 A;  4PFO A;  3GTJ J;  3K10 A;  2EV5 A;  2FF4 A;  1FOW A;  2CMP A;  2W4S A;  1SFK A;  1ZGJ A;  2WV1 A;  1QHH D;  2X6W A;  1QZE A;  2XAH A;  1E0E A;  1J59 A;  1SEU A;  3I5U A;  3HEF A;  2NVT J;  4PJL A;  1UHM A;  1S6L A;  2DBB A;  3ULQ B;  2NAZ A;  4G6T B;  2FX0 A;  1YHQ I;  5F1J A;  3MEX A;  3PFY A;  1P92 A;  1H88 C;  3AL0 C;  5KNL A;  1ZRF A;  3MZ8 A;  1FTZ A;  3IH4 A;  3VYT B;  3RKX A;  1Z6T A;  2GZW A;  2RC4 A;  3PUF A;  1JHH A;  1X3W B;  3MMY B;  5DV5 A;  4AC0 A;  2VC1 A;  1I1G A;  2Y9Y A;  1IN7 A;  4CCO A;  3I9V 2;  3I4P A;  5K5O A;  4MTD A;  1B6A A;  1Z21 A;  3FK7 A;  2LD5 A;  5LGN A;  4EQQ A;  2CW8 A;  4P9F A;  4D0P A;  3CUQ A;  1DUX C;  3HTU A;  2HOA A;  5BOX A;  2WAQ A;  2DMQ A;  2KMU A;  2HGC A;  1SVM A;  2CGP A;  3S3M A;  1X1A A;  3QAH A;  2QGU A;  2F5C A;  1TBX A;  2MD5 A;  1ZLJ A;  1YLF A;  3CDL A;  5ERI A;  3FXL A;  2Z3Y A;  4ENN A;  3BCB A;  2EFO A;  1G6N A;  3BJO A;  3W6J B;  1GT0 C;  4M9S A;  3FXK A;  1R1V A;  4JQF A;  2CUJ A;  2Y0S N;  2CQK A;  4IXA A;  1FTT A;  2H94 A;  3DKY A;  3FBN B;  3CO7 C;  1VQL I;  1HKQ A;  4XKV A;  3CP8 A;  1MMG A;  3JTG A;  3DF8 A;  1UFM A;  1SD6 A;  3H36 A;  2EIJ H;  3O2P E;  3CDI A;  4MFE A;  4KIG A;  2GXB A;  3ABM H;  3QQA A;  2PMZ N;  2X85 A;  4CGZ A;  2LR8 A;  4BE1 A;  3IKT A;  2FEZ A;  1W5T A;  2CO5 A;  2LVS A;  2XKO A;  1OCC H;  3VB2 A;  4B43 A;  4ZTJ A;  4BS9 A;  5B66 C;  5ICF A;  1I6X A;  1LDJ A;  1J0R A;  1S29 A;  3G6E I;  1UB9 A;  4HV6 A;  2LC2 A;  3FMR A;  3CCQ I;  3M3Y J;  2GWR A;  3IHU A;  5F1R A;  2VBZ A;  4XOT A;  2DA4 A;  3S32 A;  3F8C A;  2RQP A;  1ZGW A;  1T98 A;  3H0G J;  2DA1 A;  3BR1 A;  5HS7 A;  2QQ8 A;  3R0J A;  4N4O B;  1A6I A;  4FAS D;  4H4K C;  4A3C J;  3RPU A;  1POG A;  2DOA A;  1WI9 A;  3T5X A;  3W6K B;  5JHU A;  1SFX A;  2B0L A;  1F5T A;  2FBI A;  2QSF X;  3A02 A;  1IGN A;  2X1D A;  1WJD A;  5CLS A;  2DDB A;  2XF5 A;  2JJ7 A;  3CCY A;  1RPW A;  2K9Q A;  3S1N J;  1W5C C;  2P0W A;  2WC2 A;  5FRO A;  2UZK A;  2R4G A;  3MD2 A;  3O8G A;  4HX7 A;  4CH7 A;  1IO2 A;  2A6H F;  1T39 A;  5BPI A;  3F8N A;  4CIC A;  3OSG A;  3OR1 C;  3JAM Z;  4DBQ A;  4K2E A;  3K70 D;  2QQA A;  2OPT A;  2FMY A;  3ZQ7 A;  2W48 A;  4CYD A;  1EH7 A;  3FM5 A;  1MDM B;  3KEO A;  3H9J A;  1TW2 A;  5EJC A;  2DMN A;  5CVR A;  3N05 A;  1ZR2 A;  1QA6 A;  2QSG X;  4A3L J;  4P1W A;  1P9Q C;  3HB9 A;  2QVO A;  1F43 A;  4UUT A;  3FXM A;  2PX9 A;  4WWC A;  3CCS I;  2L4M A;  1MH4 A;  4B8X A;  3LAP A;  4HDV A;  3ABT A;  4AYB A;  4EJV A;  1JT6 A;  4ON0 A;  1OLT A;  5JLW A;  2RAE A;  3OIQ A;  3OIO A;  1KQ9 A;  3G1L A;  2RN7 A;  2ZSH B;  4RAG A;  4AVZ A;  1BC8 C;  3ZOB A;  2WA0 A;  2KIS A;  1OJL A;  1HW5 A;  2HDD A;  1I3Q J;  1N75 A;  4F3Q A;  3HOW J;  4HEA 2;  4A3E J;  1VFC A;  3MAJ A;  2DA6 A;  1MJB A;  4UXN A;  3OYE A;  3CCE I;  1T56 A;  5LLQ A;  3KPH A;  2IGK A;  3L9F A;  1YYV A;  2IA1 A;  3SJM A;  1MBG A;  3FXJ A;  2XGC A;  3HKZ A;  5BPD A;  4I02 A;  4IEJ A;  1TW3 A;  3FBI B;  4RLF A;  4ZZD A;  3REO A;  4XM3 A;  5K7Z A;  2MGQ A;  2H6C A;  3BC8 A;  4XL9 A;  3I4M J;  1ETV A;  1STZ A;  4KIB A;  1X4P A;  1XGM A;  3OS1 A;  1HKT A;  4WXH A;  2JPB A;  5J4V A;  1XGN A;  3C7J A;  4R79 A;  1DPU A;  2VAS A;  2BW3 B;  3IUO A;  1HCR A;  1MD0 A;  2HVQ A;  5EGO B;  1FC3 A;  1Y0N A;  2XAQ A;  4XLN F;  5E1W A;  4HST A;  1B59 A;  4L9J A;  4S05 A;  3BZC A;  5M5X J;  1FYL A;  4HG2 A;  2VT3 A;  1D1C A;  1WCM J;  4M6V A;  1HDD C;  3Q3S A;  4BDZ A;  3PO3 J;  2TRT A;  3PIO F;  3FXR A;  1K7A A;  4ETS A;  2ZFU A;  2O3F A;  1YW7 A;  5GTH C;  1A35 A;  2DFF A;  4E7H A;  3BG9 A;  1R1U A;  4PZJ A;  2R5Y A;  3HSF A;  2VON A;  5D8L B;  1S9H A;  2GM4 A;  3LSI A;  3ZMZ A;  1VQ7 I;  4KMU X;  3HC7 A;  1FT9 A;  4LIT A;  2Q2E A;  1LFP A;  1UMQ A;  4DGW B;  1AKH A;  2DW4 A;  2DA2 A;  3K4M A;  4GYG A;  2HR3 A;  2QF7 A;  3UR3 C;  3ZQH A;  1ZR4 A;  1D8K A;  2CV0 A;  1UG2 A;  2DMT A;  2O03 A;  3H1C A;  3ONQ A;  3F0C A;  1QNT A;  3IL2 A;  2V1X A;  1T6S A;  5E3M A;  2EQR A;  5GAG J;  1ZRD A;  1W1W E;  2A6T A;  3HRU A;  2P7C B;  2M7B A;  2V9V A;  1TTY A;  1PJR A;  4M9X A;  4RAF A;  3WOD F;  5HOO A;  4YRV A;  4B44 A;  2PFB A;  4BL0 B;  4NC6 A;  1ETX A;  3V8J A;  5HNH A;  3CUO A;  2M8E A;  3WTV C;  4LG0 B;  1R6R A;  4LFU A;  2DOE A;  3CLO A;  3BQY A;  5EEH A;  2OV7 A;  5H20 A;  2WB1 N;  1E3H A;  4M3F A;  2LY1 A;  3RJP A;  4CCJ A;  1S8N A;  2PMH A;  1XDU A;  4ENJ A;  3OYH A;  1RKT A;  5DCF A;  4H0E A;  2GIV A;  2EZL A;  3H35 A;  3BCA A;  1P7J A;  4Q47 A;  3BWG A;  1TQI A;  2D45 A;  5FD6 A;  1DP7 P;  5HVQ C;  4XRS A;  1XD7 A;  4CYC B;  1XG1 A;  3GME A;  3Q5F A;  1W36 C;  1YX5 A;  3NQO A;  5DCM A;  3GTM J;  1I27 A;  2E71 A;  2LK2 A;  4QLC U;  5FLM J;  3WU2 C;  2KL4 A;  4CDG A;  4HF1 A;  5HNF A;  1VTN C;  3MFK A;  4PDK A;  3IV5 A;  1LPQ A;  1J9I A;  4A0Z A;  3ZMT A;  2QM3 A;  2XRO A;  1B72 A;  2RVC A;  5D4S A;  2M5W A;  2DTR A;  2E1O A;  2VBX A;  3P5J A;  3WGH A;  2EZI A;  1VZ0 A;  1H89 C;  5FKN A;  4DNC A;  3GCM A;  1D3Y A;  1FIA A;  2HS5 A;  2IJL A;  4WX9 A;  3LQQ A;  3Q0V A;  2NVX J;  3KIO A;  3WE3 A;  1MMN A;  3BR6 A;  4QSH A;  1AWC A;  3K1M A;  4I2O A;  1WI3 A;  1OCR H;  3AG3 H;  1Z6R A;  1ZG3 A;  4WF2 A;  1NG7 A;  3AAF A;  2DDA A;  5F0C A;  1HDP A;  3A01 B;  4OAZ A;  4A0X A;  2A69 F;  2XGD A;  3RQI A;  2OJE D;  1ACI A;  3PUB A;  4ENK A;  4BJ5 C;  1X3Z B;  3DPT A;  1G3W A;  4E7S A;  1WJ5 A;  1LNW A;  1GV5 A;  2XPV A;  5BMZ A;  2EFN A;  1HF0 A;  4Q4Z F;  4XOP A;  1IDY A;  2XF6 A;  3M8F A;  5D4R A;  5FB2 A;  3M7G A;  1MKM A;  4PFP A;  2FBH A;  3ISP A;  4YEL A;  4D1Q A;  5GTI C;  1B8I B;  3RCO A;  2GXG A;  2LY2 A;  3K9T A;  2VUM J;  2FXA A;  4PUS A;  1RR7 A;  2RRE A;  3FKJ A;  2E35 A;  3LA7 A;  4XLC A;  5IT9 Z;  1W0U A;  1LDD A;  4HYE A;  3TO7 A;  3N97 A;  3MCZ A;  2HXI A;  1H8A C;  4AVP A;  1BC7 C;  2RDP A;  2HVS A;  4A0Y A;  1KYZ A;  5IP7 J;  2COB A;  2NNN A;  2RKH A;  4Y3O A;  5LHI A;  2IS1 A;  3E5X A;  1FLI A;  4BEH A;  2XB0 X;  4LG0 A;  4YII A;  1W36 D;  4OAY A;  4DJA A;  2ETH A;  5D6F A;  1Z7L A;  1MGT A;  1R5G A;  3GTQ J;  2VKV A;  1X1C A;  2EK5 A;  3U21 A;  5E8I A;  3WHB A;  2DMP A;  1YI2 I;  4ESB A;  3VOD A;  1UEL B;  4PGG A;  3RZO J;  4F7Z A;  4BBS J;  2Y0M A;  4L5I A;  2G7U A;  3VYR B;  4CYC A;  1XX5 A;  4OIP F;  5AIP A;  4G6Q A;  2DJI A;  1W0T A;  1TP4 A;  2DFI A;  2KLO A;  3NAU A;  4QPO A;  1V4R A;  1X3U A;  4EJU A;  2V6E A;  4I0B A;  1U78 A;  2YS9 A;  1CGP A;  3SHF A;  3KYD B;  2BY1 A;  1MBJ A;  1P7I A;  3BG3 A;  3BTJ A;  4HOB A;  3E0J B;  1O7F A;  3KP6 A;  3A1Y A;  4HNT A;  4A3G J;  2P6T A;  4U0Y A;  5ICC A;  1O3R A;  2FQ4 A;  1Y1W J;  1MZB A;  3FMS A;  4P96 A;  4PSX A;  3HPH A;  5IOY A;  5J8C A;  4LB5 A;  2OU2 A;  3FMQ A;  1GDT A;  2F6C A;  2IP2 A;  4M74 A;  2VQC A;  1F36 A;  2F5V A;  3T0Y A;  3T8T A;  3S1M J;  1IXS B;  3ZP5 A;  1MH3 A;  1OPC A;  5K7F A;  3FHN A;  2ELH A;  2JK3 A;  3KLN A;  4D9J A;  3VFZ A;  1KQ8 A;  1K61 A;  2KIQ A;  2L7M P;  3M1E A;  4MEY F;  4S0H B;  5JHF A;  4MQV A;  3OS2 A;  2ICW G;  3IRQ A;  1V5F A;  4I0A A;  3A01 A;  2PEX A;  2ZNY A;  1J5Y A;  3P9I A;  4FQG A;  4I01 A;  5GPA A;  1OCT C;  3TMO A;  2K4J A;  5CPR B;  2L9S A;  3TKY A;  2ZC2 A;  3TP3 A;  2E7X A;  2R7O A;  1IF1 A;  3BG5 A;  3L00 A;  3K4C A;  3U1D A;  4NUB A;  3G1M A;  2DQR A;  4W1U A;  3JRH A;  1QGP A;  2PMU A;  1YRN B;  5IYD J;  2LYC A;  4QTR A;  1B9M A;  2EZH A;  3OYA A;  1SD4 A;  5LRS A;  1CQT A;  3IKV A;  4Y15 A;  5H6Q A;  5FLV A;  5D5W B;  4ESJ A;  2X6Y A;  2AXT C;  1BOB A;  3ELK A;  2P4W A;  4LMY A;  3LSP A;  4O3M A;  3I59 B;  5L3D A;  2VJ4 A;  5IP9 J;  1JT0 A;  3PFI A;  4MLO A;  2HZT A;  4JX5 A;  1XMX A;  3Q9S A;  4KNY A;  1T08 B;  4FT8 A;  5LEJ A;  2X1E A;  4LG3 A;  4C3J J;  3SEQ A;  1SMY F;  4ZYG A;  4HLY A;  4G7Z F;  1SFE A;  1ZYR F;  3HRS A;  1SC7 A;  3EQL F;  3SZP A;  4DYC A;  3CC7 I;  2XB5 A;  1LEA A;  2JN6 A;  4MIM A;  2HQR A;  3GFI A;  2GLO A;  4RAZ A;  5CJ9 A;  2ADU A;  2BE5 F;  1LE8 B;  4HDU A;  4F92 B;  1JHF A;  4RB2 C;  5EDN A;  5KAI C;  2R7R A;  1BJZ A;  5J1U A;  4EJO A;  1VQ8 I;  2GA1 A;  2STW A;  3F23 A;  1RI7 A;  2VOP A;  3JW4 A;  2NS7 A;  3KYL A;  2BVL A;  4NC8 A;  1K83 J;  2LNB A;  2LOO A;  5J8F A;  1YFH A;  2DFH A;  3GTO J;  2RGV A;  3QOP A;  2VQH A;  2W82 A;  1PVE A;  1RUO A;  3LSK A;  2R5Z B;  2KQR A;  4HZF A;  2DOF A;  2ZO4 A;  4Y33 A;  2WY7 Q;  3DU6 A;  3GTL J;  5AIQ A;  5HDK A;  2BZT A;  1IRZ A;  3KYC B;  2LF7 A;  3DFG A;  3KEQ A;  2KRC A;  4M6X A;  1NG6 A;  3WG7 H;  3ABU A;  5HLI A;  2XAG A;  2R7X A;  3E6B A;  3S3O A;  2XAS A;  3CES A;  2QEX I;  2AQE A;  4BGD A;  3CUQ B;  3BP8 A;  3G71 I;  1NK2 P;  2G9W A;  4EM2 A;  2A07 F;  1QZZ A;  5KK1 A;  2E1M B;  3HGY A;  2XPU A;  2HFH A;  1ZEL A;  3J7Y J;  5KCM A;  2L7F P;  2IGO A;  3LOC A;  2MH2 A;  3OOU A;  1BR1 A;  3TP0 A;  1H9G A;  4XKB A;  4KA4 A;  2LG4 A;  1YRN A;  3TDZ C;  4IOC F;  2UXN A;  2EIK H;  2DMU A;  5CVU A;  1W4M A;  4PSW A;  2W85 A;  2DA3 A;  4AYB N;  1UHW A;  3MWM A;  4DZJ A;  3FX3 A;  3GVA A;  5DM7 F;  2OA4 A;  3GFM A;  4DYQ A;  2RNG A;  3I59 A;  2OQR A;  3TW7 A;  2NVY J;  4W97 A;  1WHU A;  3CUQ C;  4DW6 A;  3I3L A;  3MN2 A;  3QYB A;  3JTH A;  4F91 B;  3Q0W A;  2CQN A;  1EF4 A;  4ZJZ A;  2E1M C;  2I5U A;  3GTG J;  4I98 B;  1P6R A;  1ZN2 A;  2EA2 A;  5LEK A;  3JRB A;  4GDF A;  2OZU A;  2M45 A;  3GBG A;  2L9N A;  2OF7 A;  5DDG A;  3HKZ N;  4CA0 A;  2YX7 A;  3HBL A;  1R4M B;  3J81 Z;  1UAA A;  1F4K A;  2DT6 A;  4ZYD A;  1OYI A;  3H9Q A;  3HOX J;  4IX7 A;  1TZL A;  4BHB A;  2L9R A;  1FOX A;  3ZQF A;  2YU9 J;  4HPQ A;  1A6Q A;  2KFD A;  3F6V A;  4M9Z A;  2GBY A;  5LD2 C;  3TDU C;  2R7Q A;  3QU6 A;  1F9N A;  1WZ2 A;  2DO7 A;  1BI1 A;  2F2E A;  5ED4 A;  2EZK A;  2DK8 A;  2IPQ X;  3J7A Y;  1A31 A;  1FMV A;  4M3E A;  3N4M A;  1K6O A;  1PUF A;  1HW2 A;  4ITV A;  5JI6 A;  4JP0 A;  3OL4 A;  4IF4 A;  2HEO A;  3EUA A;  2L5Q A;  5EF6 A;  2R5Z A;  4Y7N J;  3VOE A;  5DEQ A;  2DPD A;  1GUU A;  1SVO A;  4LLL A;  4JK1 X;  5FKK A;  4C2M J;  2LP0 A;  4UVB A;  2CJJ A;  4EGZ A;  2OBP A;  4XRF A;  2AO9 A;  1LDK B;  1KU9 A;  3DXJ F;  1HXD A;  2W25 A;  1BI2 A;  1YG2 A;  5L3C A;  2E2I J;  2KIU A;  2ZBK A;  4I99 C;  1O3S A;  5FRN A;  3DEE A;  4L18 B;  1O7L A;  1ON2 A;  3DV8 A;  3WTZ A;  3PNV A;  5CKT A;  2LKS A;  3DTE A;  3JRE A;  1QVU A;  3M8J A;  5LBQ A;  3U2R A;  3MKZ A;  1IG7 A;  4CZZ A;  2HVR A;  3K70 C;  3W2W A;  3LA2 A;  4E7I A;  3H92 A;  3V8K A;  4XKW A;  1KYW A;  3Q9V A;  2O61 A;  2V1N A;  4EEF G;  3B73 A;  2QLZ A;  4YEJ A;  4F55 A;  1S72 I;  2ZB9 A;  4YFK F;  2CV1 A;  3P9C A;  5C4X J;  3C18 A;  1OCZ H;  2IBD A;  3PJR A;  1JI8 A;  2PJR A;  3ASN H;  3ABK H;  2M8G X;  4OIO F;  2A6E F;  3HJE A;  3DTI A;  4B3X A;  1VQ6 I;  1REP C;  2UWM A;  4HX4 A;  1XSV A;  2EFQ A;  2ZNZ A;  4E7Z A;  4M73 A;  4A3F J;  2IGN A;  2EV0 A;  3DBR B;  5EYR A;  1WJB A;  2MYS A;  1O4X A;  4IKF A;  4NC7 A;  3QWL A;  1TWH J;  2VBW A;  3CCV I;  3CD6 I;  1BW6 A;  3QOD A;  1S3J A;  5FFZ A;  4HNV A;  1P2F A;  3L2Q A;  4BXU A;  2DTZ A;  3L2U A;  4XID A;  1HC8 A;  4KT6 A;  2IGM A;  2E34 A;  3LSR A;  2ZME A;  2EIM H;  5CVV A;  1SAX A;  3BPV A;  1WWX A;  2A5Y B;  5FKL A;  1LQ1 A;  1IN5 A;  2VLA A;  2H8R A;  1QO0 D;  2HDC A;  2ZFW A;  1R5H A;  1IN6 A;  2VKE A;  3KFW X;  4FTH A;  1A36 A;  5K5R A;  2D1H A;  2MSY A;  2NXN B;  4LB6 B;  2XAF A;  3AG2 H;  1YO5 C;  3EUH A;  1VQN I;  1ENH A;  3ZCO A;  2JVH A;  3JCU C;  2M9H A;  1ZHF A;  3DLA A;  2R5Y B;  2FUG 2;  3A2K A;  3FDY A;  3RPU D;  2XGE A;  4P9U A;  2Z5U A;  3COA C;  2Q2E B;  2R7F A;  5BQT A;  3AFH A;  2FBK A;  4XN3 A;  3TO9 A;  1AKH B;  4XLE A;  3ZMU A;  4OMY A;  3I55 I;  2CUF A;  3KP4 A;  3TOB A;  4XIC A;  2VI6 A;  1IJW C;  3PSF A;  3HXL A;  5F27 A;  5DD8 A;  3VWB A;  4ZYE A;  1PYV A;  5H2F C;  4U0W A;  4GCV A;  5F64 A;  2KRH A;  1IRX A;  3D5S C;  4E7K A;  4BYY A;  1JKR C;  3WTW C;  4BXF A;  4BAY A;  2WV0 A;  2JA7 J;  2VL8 A;  4HAM A;  4DBR A;  1T2K A;  2R7D A;  3H9G A;  2L3D A;  2D5V A;  1N77 A;  1FP2 A;  5GAH J;  1RET A;  2VN2 A;  2WWY A;  1MIJ A;  4A3J J;  2IXS A;  2MG4 A;  2HDW A;  3MQ0 A;  4RB3 C;  1M1E B;  2F4M B;  3DLL F;  3M8E A;  3PL8 A;  1JUS A;  4MHG A;  3CDH A;  1ODD A;  1I1S A;  1PP8 F;  5EG0 B;  4GFB A;  3OS0 A;  1RIO H;  4RLQ A;  5IP6 A;  2JTV A;  1W5S A;  2IA2 A;  2IRF G;  1FOY A;  2B63 J;  2DXI A;  5K7H A;  2COM A;  3D5R C;  3MKW B;  5K1Y A;  5DCM B;  2KKO A;  3HOV J;  1LVK A;  3A03 A;  1DPR A;  5JR3 A;  5GPC A;  1WSU A;  2P5L C;  3K1P A;  1F1Z A;  2BYV E;  3DCF A;  5J1Y A;  1BIB A;  3I71 A;  1UG0 A;  3J80 K;  3S15 J;  2X1C A;  2LLK A;  2LSO A;  4JOM A;  4R1H A;  2VOO A;  4UY8 I;  4ANJ A;  5IYB J;  4M6Y A;  3OYF A;  1HSJ A;  1B72 B;  3ZGK A;  3LFU A;  3KZI C;  2HQ5 A;  3DPL C;  2NRA C;  2K9M A;  4Z2Y A;  2YUS A;  4EGY A;  1D5Y A;  1LFB A;  2XAU A;  4FX4 A;  1YW9 A;  1ZAO A;  1K79 A;  1OCO H;  4U7B A;  3GLX A;  4P5O A;  2F4I A;  2HOT A;  2DU9 A;  4EJW A;  4II2 A;  3CZ6 A;  3ESW B;  2WAD A;  4QIW N;  4L9T A;  4UV9 A;  3S1R J;  2IS6 A;  3A4C A;  3HTS B;  3O6B B;  3PIP F;  1TWG J;  2OD5 A;  4E7L A;  1EJ9 A;  2FA5 A;  2VKD A;  1VQK I;  3MZY A;  2QSH X;  2R7V A;  3M07 A;  4KN7 X;  4UHT A;  1SFU A;  4L5J A;  1KU7 A;  3OMY A;  2HWV A;  4DZP A;  1G3T A;  1ETK A;  1B1B A;  2FNP A;  3SFI A;  2YX4 A;  2X48 A;  4BY7 J;  3V7R A;  1Z91 A;  2XVC A;  2XV4 S;  4CCN A;  4HRI A;  2LH9 A;  1FYK A;  2NVQ J;  5D8K B;  4BJ6 C;  1FSH A;  1IXR C;  2JWT A;  4RGU A;  2VJJ A;  5M3F J;  4LGW A;  3B6A A;  1E3O C;  3IH2 A;  3WU0 A;  3V7C A;  3D1N I;  1PDN C;  4YIF A;  1YS6 A;  2CQ7 A;  1ZG1 A;  5TGT A;  4CSW A;  2JRM A;  1FIP A;  2IA0 A;  5FLX K;  3K4B A;  4JX6 A;  2Z99 A;  2LF8 A;  1D8J A;  2GQQ A;  1XDS A;  4FHT A;  4BEH B;  1CF7 A;  2RNJ A;  2VE8 A;  5DUI A;  3OYB A;  3FXQ A;  2K27 A;  4KJZ A;  1VF9 A;  2KDO A;  2XGX A;  5KVR A;  4I7H A;  3A0B C;  5EG0 A;  3DBH B;  4M3D A;  2VQG A;  3RKQ A;  3ZQL A;  1K4S A;  5ILU A;  1D1B A;  1WH5 A;  3PNY A;  3EYI A;  2YPR A;  3E97 A;  3NEU A;  1TL8 A;  4WXD A;  2BBY A;  2KJC A;  3S93 A;  5E20 A;  5F04 A;  2JSC A;  4ZYA A;  3CP2 A;  1IW7 F;  1U6G A;  3G73 A;  4NQW B;  5CYV A;  1GVJ A;  4B48 A;  3G2B A;  4CHU A;  5B5E C;  1MNE A;  3BR3 A;  1K78 A;  1WVR A;  4G6D A;  1SVL A;  3HHH A;  3RI4 A;  1AA7 A;  1IAW A;  3BPX A;  4PJM A;  5DD4 A;  4FET A;  3S2W A;  1EA3 A;  4UUV A;  5FRM A;  1LEB A;  3GTP J;  1WH7 A;  3I0T A;  3JRF A;  4P55 A;  2KIM A;  4C30 A;  2GAU A;  3ECO A;  3HPG A;  3IAM 2;  4G9Y A;  5DYM A;  4BHP A;  1Z9C A;  4DIQ A;  5L3B A;  1MMD A;  3K4J A;  4AWX B;  4RBO A;  4YIR X;  3LA3 A;  4KUM A;  4ESF A;  3HL2 A;  1YQA A;  1FBQ A;  3M1C A;  1ZH5 A;  4IPA A;  2E7W A;  1E3P A;  3X2Q H;  2M1B A;  3ERM A;  1J09 A;  1HW1 A;  1BIA A;  2Y48 A;  4E4H A;  4UB8 C;  1DGW Y;  4EJT A;  2LKP A;  1Q1V A;  2ID3 A;  3IC7 A;  4A3I J;  4V2G A;  4C2U A;  1HQC A;  1R1T A;  3LL7 A;  1IDZ A;  3F8F A;  1I39 A;  3LST A;  5CQG A;  1ITY A;  3RTR A;  1ZRC A;  2BV6 A;  3LSH A;  4WK8 F;  1WPK A;  4MNU A;  3EPZ A;  2DA5 A;  4XON A;  3BG6 A;  2FOW A;  3G1O A;  3JRC A;  1OIS A;  1V55 H;  4HX8 A;  4HNU A;  4L9V A;  1FPQ A;  1X2M A;  4LIU A;  3ZN1 A;  2HQN A;  4D5F A;  5HLG A;  3JRI A;  3HG9 A;  3J7Z I;  3ASO H;  3BZK A;  4A12 A;  4AUX A;  3R61 A;  3K69 A;  5B1A H;  4EV0 A;  1VQ4 I;  1BJA A;  2K3P A;  2KHM A;  1G2H A;  1JJ6 C;  1SD7 A;  4GGG A;  4Y52 J;  3TOA A;  2MAB A;  1JUP A;  1MJ9 A;  1NTC A;  2L7K A;  2VPR A;  2GOM A;  3RDI A;  3C2H A;  3I53 A;  2F5D A;  4OIQ F;  5DUK A;  2QCO A;  5FGM A;  1WFX A;  4YFX F;  3WE2 A;  4Z6Y A;  2XSJ C;  4MQ9 F;  2OUM A;  3VYS B;  2JA2 A;  4UVA A;  2AXL A;  2JRT A;  3S2D J;  2NS8 A;  3RYR A;  3F3X A;  1X1D A;  3K4L A;  1J75 A;  2R7U A;  5FJ8 J;  1ZKG A;  2FE3 A;  2EV6 A;  4NQW A;  4XLF A;  3OYM A;  3DEU A;  1D1A A;  3IAS 2;  2K5C A;  4Y4R A;  2J5O A;  3MKY B;  2CV2 A;  3CME I;  3C2B A;  3GWZ A;  2PI0 A;  2ACJ A;  3VSL A;  1BR2 A;  2IVM A;  2OCE A;  4KFC A;  4ENM A;  3CQZ J;  4II3 A;  3VPR A;  1BA5 A;  3QPL A;  5J3L A;  1TQP A;  4RAY A;  1E2X A;  2Y2Z A;  5AON A;  3FK6 A;  2W57 A;  3KZY A;  3HYI A;  2E60 A;  2HYF A;  4MEX F;  4D5C A;  3JRD A;  2YR2 A;  5E3O A;  2HPM A;  1OMI A;  3LFK A;  1TWA J;  2CW7 A;  1ZRE A;  2ZJP F;  3OWT A;  4XSX F;  5FKO A;  1IN4 A;  2K4B A;  3GLL A;  4OWR B;  5B1B H;  2KIF A;  1XB4 A;  3E1S A;  1Y0U A;  2DQL A;  5D6E A;  2ZSI B;  3L1P A;  3BTL A;  4HQM A;  3FKI J;  3BJ6 A;  3K4N A;  2I10 A;  3KP2 A;  3OL3 A;  2LMD A;  3BDD A;  1ETW A;  2VXD A;  1R5I D;  2CFX A;  3TED A;  1MW7 A;  3QP5 A;  2JPC A;  4HLX A;  3S14 J;  3E5U A;  1HKS A;  3WU1 B;  1O3T A;  1AHD P;  4HW0 A;  4G7O F;  1B9N A;  1YS7 A;  1K4T A;  5TIS C;  4ZTF A;  2DK5 A;  2M34 A;  3CF2 A;  1R22 A;  3ERE D;  3K4K A;  3WG9 A;  5H6R A;  4G12 A;  1H0M A;  3IWF A;  2E2H J;  4ZDL A;  2ID6 A;  3AKZ A;  2JUG A;  1R4N B;  2K40 A;  2K7L A;  4A6D A;  5HLH A;  4L9N A;  5IY5 H;  1XCV A;  1JUM A;  1R36 A;  4C3H J;  4N9H A;  2VIX A;  4BQO A;  3HOT A;  1FBU A;  2WY8 Q;  2L01 A;  4KMF A;  2X0L A;  4U7D A;  4F93 B;  3GYH X;  2O6G E;  2HOE A;  4CXF A;  3OY9 A;  4IHS A;  1U5T B;  2ZXI A;  3NRV A;  2BHZ A;  5J6X A;  3L2V A;  2BVM A;  2STT A;  1XC5 A;  5GAE J;  1YOV B;  3ZPL A;  3DU5 A;  3OOP A;  5IT3 A;  5EZG A;  3CCJ I;  5JLX A;  3FXU A;  5K5Q A;  3UNG C;  4RDU A;  2HKO A;  2A05 A;  2OTJ I;  2MBF A;  2Z33 A;  5IPA A;  2JA6 J;  4AIH A;  1Q1H A;  4IRH A;  2X4H A;  4XR6 A;  2LBF A;  2ISY A;  3WTT C;  3W2V A;  3BQZ A;  2FQ3 A;  1PUF B;  1IZ1 A;  3SDG A;  1FBS A;  2X51 A;  4IO9 F;  2NVU B;  4LLN A;  4UB6 C;  4CCK A;  1Z7U A;  2V9P A;  4ZDO A;  4XN0 A;  2E36 A;  4BXX J;  2MLK A;  1Z77 A;  3QPS A;  1KON A;  3GZN B;  1SMT A;  1L3L A;  3PO2 J;  4BQN A;  1HOM A;  2JT1 A;  1MJA A;  3H5N A;  5M3M J;  2XUB A;  1IXC A;  1O57 A;  5HOD A;  2P81 A;  4MTE A;  2IAI A;  3KP7 A;  3P7N A;  1T0F A;  5KAF C;  4KYW A;  2J5P A;  1V5G A;  4KIC A;  2V4J C;  1DP3 A;  4B3A A;  1L0O C;  3ZQI A;  4UUS B;  1X1B A;  1MMA A;  4CUG A;  4EMS A;  3S16 J;  4BQQ A;  1R00 A;  2PQ8 A;  2RV8 A;  4JBA A;  4RB0 A;  3LNQ A;  2F5E A;  3V7S A;  4B09 A;  3OYL A;  4ZZL A;  1TNS A;  1V3F A;  1BBY A;  1D0X A;  2ECC A;  2ZJ2 A;  5J4Y A;  4WXC A;  2ISZ A;  1JGG A;  4DYR A;  2FOK A;  1V54 H;  3VSK A;  3OYJ A;  1JKP C;  3RZD J;  3CC2 I;  1IV8 A;  5LHH A;  2JA8 J;  2VPL A;  1P4A A;  3FHZ A;  2K86 A;  2VB6 A;  2VT2 A;  3VDX A;  5EEA A;  2XKP A;  1TLH B;  2QBY B;  1ETQ A;  3PM1 A;  3FIW A;  3TBI A;  2HQA A;  1BL0 A;  1ZTR A;  3IWZ A;  4IVN A;  4N9I A;  1VQP I;  2PJR B;  3HIF A;  1FEX A;  2M0C A;  1IRG A;  4AIK A;  4A93 J;  4IHV A;  1Y1V J;  1BR4 A;  2W7N A;  2EPF A;  2V7F A;  2K3F A;  3A0H C;  3M9A A;  1T95 A;  3KE2 A;  4D7M A;  3C3W A;  3S2H J;  4FE7 A;  3SXY A;  4IHY A;  2ESN A;  3W3C A;  2E5N A;  2XPW A;  1U5T A;  3PQJ A;  3S3N A;  4IOA F;  1KU3 A;  2BHY A;  3M4O J;  2NS0 A;  2DOD A;  2ZME B;  3LSM A;  2FML A;  1WQ2 A;  3K7A J;  3EUK L;  5BNG A;  3HHG A;  5DTD A;  4A3D J;  1ULY A;  4GXO A;  4RMN A;  3H5A A;  2EJR A;  2AHQ A;  2L54 A;  3F8B A;  1T33 A;  3HUG B;  2HTS A;  3C1D A;  5GP9 A;  4BH9 A;  1HBX G;  1I5Z A;  3LQR A;  3HSE A;  2MC4 A;  4CZC A;  1LKX A;  2ZKZ A;  1MBK A;  4E70 A;  2A3S A;  5J47 A;  2VOD A;  1IUY A;  2QEN A;  2K85 A;  2G7H A;  5TRD A;  3CC4 I;  1I6H J;  2P8T A;  2AQF A;  1VND A;  2WAF A;  3NWS A;  3S17 J;  1APL C;  2VJI A;  4ZH4 F;  1JXS A;  3OYK A;  2R7Z J;  3JSO A;  2ZME C;  3R60 A;  3QPH A;  4IHT A;  2RQQ A;  1VI0 A;  5JFR A;  2I8D A;  3ZRG A;  1XSD A;  1OR7 A;  2MC3 A;  3BOQ A;  2CU7 A;  3WGI A;  4BY1 J;  2MLG A;  2K9N A;  4L5E A;  4UUS A;  1NH3 A;  1YX3 A;  1XCB A;  3RSN A;  3WTY C;  4KIS A;  3IRR A;  1VQ9 I;  5ILV A;  1ETY A;  4A3B J;  3LMM A;  2H1L A;  2KPM A;  4AIJ A;  2VBY A;  3EUH C;  5E3L A;  2EIL H;  2P6S A;  5DM6 F;  1XMA A;  2KDZ A;  1R49 A;  4X1E A;  2QQB A;  3DKX A;  5D5V B;  5DS9 A;  1YJW I;  4A2U A;  1G59 A;  4A69 C;  2LTP A;  2GA2 A;  2QBY A;  1WJE A;  1V5E A;  3EET A;  3NAR A;  1QBJ A;  2OAZ A;  4HA8 A;  5D5X B;  2GIZ A;  1JKQ C;  1MSE C;  4NDL A;  2CW0 F;  5E3N A;  1OQY A;  2FD5 A;  3D5L A;  5LRR A;  2W24 A;  2R7T A;  3E7L A;  2FJ1 A;  3BZ6 A;  2M2E A;  1FOK A;  2H27 A;  3NWT A;  2O8K A;  4F52 A;  2BY3 A;  2A61 A;  1A04 A;  4B4C A;  1RRJ A;  1GXQ A;  3KET A;  2EWN A;  3HOZ J;  2R0Q C;  5FO5 A;  4XKC A;  4M3G A;  3OYI A;  1DQU A;  3FF5 A;  2EB7 A;  3B02 A;  2R7S A;  5BS6 A;  1XS9 A;  4MGR A;  2DI3 A;  4PJ0 C;  4FCY A;  2C6Y A;  1Y8R B;  1FX7 A;  1PUE E;  2LDU A;  1YJN I;  2Y31 A;  3BLY A;  1BN5 A;  3WGG A;  1TNT A;  2CS3 A;  2VQL A;  3HUG A;  1P4W A;  1U9O A;  2CH0 A;  4ABZ A;  3KCC A;  3H0D A;  3WTU C;  1OYW A;  1TWC J;  2JQ7 A;  3DEW A;  1YJ9 I;  2HZD A;  3LWF A;  3DKW A;  5HDG A;  4E7J A;  3LSJ A;  1DDN A;  3BG7 A;  4EM1 A;  2MW8 A;  1YIJ I;  3H3V K;  2Z1D A;  3OR2 C;  2ZXW H;  5E18 F;  3TW6 A;  4NNJ A;  2HPI A;  1ZG5 A;  4G8X A;  2QKM B;  3GFJ A;  3JAM K;  3HOS A;  2UUZ A;  2E19 A;  3PSI A;  1TWF J;  1BOA A;  1Z3Y A;  3FM3 A;  2JA5 J;  2XF7 A;  4BE2 A;  1FYM A;  2CYY A;  3LSG A;  1RES A;  3I56 I;  2DT5 A;  4ZDP A;  5JVT A;  3WTX C;  3QP6 A;  4Q5S F;  1Z1D A;  5FD5 A;  1LVA A;  2R93 J;  1DU0 A;  3MVP A;  4U0V A;  2V26 A;  4XQF A;  4PJN A;  4BUP A;  1X2N A;  4Y13 A;  4IQ4 A;  3E6M A;  2GXA A;  3QPT A;  4EM0 B;  1DU6 A;  2QWW A;  2NNY A;  1ERD A;  2L02 A;  2BY2 A;  4CO8 A;  5HLT A;  2CUZ A;  3F8M A;  2M30 A;  3OYD A;  2QUF A;  4B47 A;  2DN0 A;  4RM3 A;  3DQV C;  4IRG A;  4RA2 A;  1UJ8 A;  2W00 A;  3S8P A;  1WJA A;  2LY9 A;  4PK4 A;  3SDB A;  1CF7 B;  4BQA A;  2HXO A;  3L2C A;  1RZ4 A;  4HQE A;  3QOE A;  3MKL A;  2PBI A;  2HI3 A;  1USS A;  1MNM C;  3P9K A;  4RGX A;  3GX4 X;  2V1U A;  2QYO A;  2K9S A;  5CVI A;  2A5W A;  3GW2 A;  2UV1 A;  3TO6 A;  1YIO A;  3K2Z A;  2H8W A;  1SAU A;  3CLQ A;  4JX4 A;  3EYY A;  5EEG A;  1K6Y A;  1KA8 A;  2ELJ A;  3HDD A;  5C4J J;  3CF5 F;  4RS8 A;  1T8I A;  2FNA A;  1MSF C;  3CO6 C;  2JSP A;  5M5W J;  4XNF A;  4O6J A;  3J7A O;  1IUF A;  2DCE A;  2QZ8 A;  1U3E M;  3RKW A;  1MBF A;  2MFZ A;  1K78 B;  1KU2 A;  1Z3X A;  4LK0 F;  4OIN F;  4X6A J;  1OKR A;  3OYG A;  3RQ4 A;  1LB2 A;  5HS8 A;  3H3U A;  1BM9 A;  2V6C A;  3ZQG A;  2VC0 A;  2V1D A;  5CVJ A;  3KP3 A;  5E79 C;  1JGS A;  4PCQ A;  3CCM I;  1AU7 A;  3JR9 A;  1YE9 A;  2ZXJ A;  2W1O A;  3F22 A; 
#chains in the Genus database with same CATH homology
 3K1N A;  4KDP A;  4S04 A;  2HKX A;  3J80 Z;  3RPQ A;  4GYI A;  3CTA A;  4RGR A;  4LK1 F;  2IW5 A;  2KRF A;  2DAO A;  1IRF A;  2E1C A;  3T8R A;  3ECH A;  2QQ9 A;  2PG4 A;  3I58 A;  4BHC A;  1IN8 A;  2CG4 A;  1O3Q A;  1RUN A;  1Z05 A;  3G3Z A;  2YSR A;  2Q0O A;  1U2W A;  3TGN A;  3F21 A;  1MDM A;  3HRM A;  2EFP A;  3GZ6 A;  3CJN A;  3SFZ A;  1R58 A;  4AD9 A;  3GZ5 A;  2EA4 A;  1ZLK A;  4A5N A;  2P5K A;  3FZV A;  5FLX Z;  3F72 A;  1UCR A;  4KT5 C;  1RNL A;  1P4X A;  5TJJ A;  5A2Q K;  4U88 A;  1R7J A;  1W7P B;  4ASN A;  2EFW A;  2MH9 A;  1ONV A;  1HST A;  2R3S A;  3GO5 A;  3BY6 A;  4R8H A;  1D5V A;  1QZY A;  2E1N A;  1H9T A;  2XRN A;  2JZY A;  3T1B A;  4LD5 A;  4ZYH A;  3E6D A;  5A2Q Z;  1NHA A;  3SQN A;  4Y17 A;  2KJB A;  3LAJ A;  2O0Y A;  4UVC A;  2CSO A;  5L3G A;  1FSE A;  3E6C C;  2BEO A;  4NB5 A;  2P7V B;  1KGS A;  3R4K A;  3L09 A;  1ZGA A;  5IT9 K;  4FX0 A;  5E8G A;  2IT0 A;  4L0Y B;  2ESH A;  1GXP A;  4XBF A;  3F6O A;  4OU0 A;  4GO1 A;  1ON1 A;  4KN4 X;  4YG2 F;  4IRI A;  4UNO A;  1XGS A;  2Q8K A;  5F6F A;  2H09 A;  3U9G A;  1J7K A;  2MA3 A;  3QU3 A;  4M71 A;  4L0Z B;  3JSP A;  2FRH A;  3RYP A;  1W7P A;  1WKM A;  2PLY A;  1XGO A;  1S7A A;  3O3K A;  5D5U B;  2FSW A;  1FWZ A;  3ZMD A;  2W84 A;  4XLP F;  1XN7 A;  5ILS A;  1R23 A;  2HTJ A;  3RIR A;  4G7H F;  4HBL A;  3V8L A;  3ZN0 A;  5L3E A;  1W7P D;  4RB1 A;  3HRT A;  1KQ0 A;  4PGH A;  2P5V A;  1T38 A;  3GEZ A;  3TQN A;  1ZAR A;  1FY7 A;  2BGC A;  1G3S A;  2CWE A;  1S7O A;  3R0A A;  3L7W A;  4LJZ F;  5ICE A;  5LGU A;  2D1V A;  2F5F A;  2PN6 A;  2M87 A;  3DP7 A;  1LJ9 A;  1QQI A;  1J2X A;  4Q48 A;  1UST A;  3D0S A;  1FP1 D;  4HF0 A;  1OYY A;  1G4D A;  2VXZ A;  2Y75 A;  1EH6 A;  3GFL A;  6PAX A;  3ZMS A;  1GHC A;  4OOI A;  1EV7 A;  2XAJ A;  2DLL A;  1QPM A;  4WCG A;  2FU4 A;  3QRF F;  3WTS C;  3ZMV A;  3RKY A;  2ZCW A;  1JE8 A;  2L4A A;  1EH8 A;  1G3Y A;  3GXO A;  4N0B A;  3BRO A;  2YU3 A;  2A68 F;  4UV8 A;  5HDN A;  5E17 F;  2WTE A;  1FNN A;  3EDP A;  2PJP A;  2XHK A;  4A6E A;  4YFN F;  5ICG A;  2H6B A;  3OV8 A;  2D2W A;  3SZT A;  4TV7 A;  3ROU A;  3VEP A;  1U5T C;  3GF2 A;  2UXX A;  3HSR A;  4G94 A;  5LHG A;  2AS5 F;  1BI0 A;  4KIF A;  4O5V A;  4DQ2 A;  2VE9 A;  2K02 A;  4HF2 A;  3KP5 A;  3I64 A;  3KLO A;  5E1X A;  5E1Z B;  1BI3 A;  4NHJ A;  3PQK A;  2V79 A;  2TDX A;  2OQG A;  4A5M A;  3FWE A;  2Z9O A;  2XIG A;  2HYG D;  3H3Z A;  4LLG F;  3BJA A;  1YTY A;  4OIR F;  3KZZ A;  4EVI A;  2NYX A;  5L3F A;  4BNC A;  2O8X A;  1PP7 U;  4RGS A;  1TQM A;  3I54 A;  3MZH A;  5HS9 A;  3K0L A;  4I09 A;  4M72 A;  5LGT A;  2DPU A;  4OMZ A;  5FFX A;  1C0W A;  3V4G A;  4IJA A;  3J81 K;  1FZP B;  3ML6 A;  1YW8 A;  3E3V A;  3R6S A;  3E5Q A;  1WRJ A;  2OZ6 A;  4HV5 A;  1AOY A;  1XMK A;  1B4A A;  4QWQ A;  1U8R A;  1E17 A;  1SD5 A;  3GUD A;  4XSZ F;  1XSX A;  2EV5 A;  2FF4 A;  1ZGJ A;  2XAH A;  1J59 A;  3I5U A;  1UHM A;  1S6L A;  2DBB A;  3ULQ B;  2NAZ A;  3MEX A;  1P92 A;  1ZRF A;  3RKX A;  1Z6T A;  2GZW A;  2RC4 A;  1JHH A;  5DV5 A;  2VC1 A;  1I1G A;  1IN7 A;  3I4P A;  5K5O A;  4MTD A;  1B6A A;  5LGN A;  4EQQ A;  4P9F A;  4D0P A;  3CUQ A;  1DUX C;  3HTU A;  5BOX A;  2HGC A;  2CGP A;  3QAH A;  2F5C A;  1TBX A;  2MD5 A;  1ZLJ A;  1YLF A;  5ERI A;  4ENN A;  2Z3Y A;  2EFO A;  1G6N A;  3BJO A;  3W6J B;  4M9S A;  1R1V A;  4JQF A;  2CQK A;  4IXA A;  2H94 A;  3CO7 C;  1HKQ A;  3JTG A;  3DF8 A;  1UFM A;  1SD6 A;  3O2P E;  4KIG A;  2GXB A;  4CGZ A;  3IKT A;  2FEZ A;  1W5T A;  2CO5 A;  2XKO A;  3VB2 A;  5ICF A;  1I6X A;  1LDJ A;  1J0R A;  1S29 A;  1UB9 A;  4HV6 A;  3FMR A;  2GWR A;  3IHU A;  5F1R A;  2VBZ A;  3F8C A;  2RQP A;  1T98 A;  5HS7 A;  3R0J A;  3RPU A;  1WI9 A;  3T5X A;  3W6K B;  5JHU A;  1SFX A;  2B0L A;  1F5T A;  2FBI A;  5CLS A;  2WC2 A;  2UZK A;  4HX7 A;  2A6H F;  1T39 A;  5BPI A;  3F8N A;  4CIC A;  3JAM Z;  4K2E A;  2QQA A;  2FMY A;  3ZQ7 A;  4CYD A;  1EH7 A;  3FM5 A;  1MDM B;  3KEO A;  1TW2 A;  5CVR A;  2QVO A;  4WWC A;  2L4M A;  4B8X A;  3LAP A;  4HDV A;  3ABT A;  4EJV A;  4ON0 A;  1KQ9 A;  2RN7 A;  1BC8 C;  1HW5 A;  3MAJ A;  1MJB A;  4UXN A;  5LLQ A;  3L9F A;  1YYV A;  2IA1 A;  5BPD A;  4I02 A;  1TW3 A;  4ZZD A;  3REO A;  2H6C A;  1STZ A;  4KIB A;  1XGM A;  1HKT A;  4WXH A;  2JPB A;  1XGN A;  3C7J A;  4R79 A;  1DPU A;  1MD0 A;  1FC3 A;  2XAQ A;  4XLN F;  5E1W A;  1B59 A;  4L9J A;  4S05 A;  1FYL A;  2VT3 A;  3FXR A;  1K7A A;  4ETS A;  2O3F A;  1YW7 A;  1R1U A;  4PZJ A;  2VON A;  3HSF A;  5D8L B;  3ZMZ A;  4KMU X;  1FT9 A;  2Q2E A;  2DW4 A;  4GYG A;  2HR3 A;  1D8K A;  2O03 A;  1QNT A;  3IL2 A;  2V1X A;  1T6S A;  1ZRD A;  3HRU A;  2P7C B;  2V9V A;  1TTY A;  5HOO A;  4M9X A;  3WOD F;  2PFB A;  3V8J A;  3CUO A;  2M8E A;  3WTV C;  4LG0 B;  4LFU A;  3CLO A;  5H20 A;  5EEH A;  3RJP A;  1S8N A;  2PMH A;  1XDU A;  4ENJ A;  5DCF A;  4H0E A;  2GIV A;  4Q47 A;  3BWG A;  1TQI A;  2D45 A;  5FD6 A;  1DP7 P;  5HVQ C;  1XD7 A;  3Q5F A;  5DCM A;  3NQO A;  1I27 A;  4QLC U;  4CDG A;  4HF1 A;  1VTN C;  3MFK A;  4PDK A;  1J9I A;  4A0Z A;  3ZMT A;  2QM3 A;  2XRO A;  2RVC A;  5D4S A;  2M5W A;  2DTR A;  2VBX A;  3WGH A;  4DNC A;  1D3Y A;  2IJL A;  2HS5 A;  4WX9 A;  3LQQ A;  3WE3 A;  1AWC A;  3K1M A;  4I2O A;  1ZG3 A;  1Z6R A;  4WF2 A;  3AAF A;  4A0X A;  2A69 F;  4ENK A;  3DPT A;  1G3W A;  1LNW A;  5BMZ A;  2EFN A;  4Q4Z F;  3M8F A;  5D4R A;  5FB2 A;  3M7G A;  1MKM A;  2FBH A;  3ISP A;  2GXG A;  3K9T A;  2FXA A;  3LA7 A;  5IT9 Z;  1LDD A;  4HYE A;  3TO7 A;  3N97 A;  3MCZ A;  4AVP A;  1BC7 C;  2RDP A;  4A0Y A;  1KYZ A;  2NNN A;  2RKH A;  5LHI A;  3E5X A;  1FLI A;  4LG0 A;  4YII A;  2ETH A;  5D6F A;  1MGT A;  1R5G A;  2EK5 A;  5E8I A;  4ESB A;  3VOD A;  4PGG A;  4F7Z A;  2Y0M A;  4L5I A;  2G7U A;  4OIP F;  5AIP A;  4G6Q A;  2DFI A;  1V4R A;  1X3U A;  4EJU A;  4I0B A;  1U78 A;  1CGP A;  3SHF A;  4HOB A;  1O7F A;  3KP6 A;  2P6T A;  4U0Y A;  5ICC A;  1O3R A;  1MZB A;  3FMS A;  4P96 A;  5J8C A;  4LB5 A;  2OU2 A;  3FMQ A;  2IP2 A;  4M74 A;  3T0Y A;  3T8T A;  1IXS B;  3ZP5 A;  1OPC A;  2ELH A;  3KLN A;  3VFZ A;  1KQ8 A;  4MEY F;  3M1E A;  4MQV A;  3IRQ A;  4I0A A;  2PEX A;  2ZNY A;  1J5Y A;  3P9I A;  4I01 A;  2K4J A;  3TKY A;  2E7X A;  1IF1 A;  3L00 A;  3U1D A;  2DQR A;  1QGP A;  2PMU A;  1B9M A;  1SD4 A;  5LRS A;  3IKV A;  4Y15 A;  5H6Q A;  5D5W B;  4ESJ A;  3ELK A;  2P4W A;  4LMY A;  4O3M A;  3I59 B;  5L3D A;  3PFI A;  2HZT A;  3Q9S A;  4KNY A;  4FT8 A;  5LEJ A;  1SMY F;  4ZYG A;  4HLY A;  4G7Z F;  1SFE A;  1ZYR F;  3HRS A;  3EQL F;  3SZP A;  1LEA A;  3GFI A;  2HQR A;  4RAZ A;  5CJ9 A;  2ADU A;  2BE5 F;  4HDU A;  1JHF A;  4RB2 C;  4EJO A;  2GA1 A;  2STW A;  3F23 A;  1RI7 A;  2VOP A;  3JW4 A;  2LNB A;  5J8F A;  1YFH A;  2RGV A;  3QOP A;  1RUO A;  4HZF A;  2ZO4 A;  5AIQ A;  5HDK A;  2LF7 A;  3DFG A;  3KEQ A;  4M6X A;  3ABU A;  5HLI A;  2XAG A;  3E6B A;  2XAS A;  3CUQ B;  3BP8 A;  2G9W A;  4EM2 A;  2A07 F;  1QZZ A;  5KK1 A;  2HFH A;  2MH2 A;  1H9G A;  4KA4 A;  3TDZ C;  2UXN A;  5CVU A;  1W4M A;  2W85 A;  1UHW A;  3MWM A;  3FX3 A;  3GVA A;  2OA4 A;  3GFM A;  3I59 A;  2OQR A;  3CUQ C;  3JTH A;  4I98 B;  1P6R A;  1ZN2 A;  2EA2 A;  5LEK A;  2OZU A;  2M45 A;  5DDG A;  2YX7 A;  3J81 Z;  1F4K A;  4ZYD A;  1OYI A;  4BHB A;  4M9Z A;  3F6V A;  3TDU C;  3QU6 A;  1F9N A;  2DO7 A;  1BI1 A;  2F2E A;  5ED4 A;  2DK8 A;  2IPQ X;  3N4M A;  1K6O A;  1HW2 A;  5JI6 A;  4IF4 A;  2HEO A;  3VOE A;  5DEQ A;  2DPD A;  4LLL A;  4JK1 X;  4UVB A;  4EGZ A;  2OBP A;  4XRF A;  1LDK B;  1KU9 A;  3DXJ F;  1HXD A;  2W25 A;  1BI2 A;  1YG2 A;  5L3C A;  2KIU A;  2ZBK A;  1O3S A;  4L18 B;  1O7L A;  1ON2 A;  3DV8 A;  3WTZ A;  5LBQ A;  3U2R A;  4CZZ A;  3LA2 A;  3H92 A;  3V8K A;  1KYW A;  3Q9V A;  2O61 A;  3B73 A;  2QLZ A;  4YFK F;  3P9C A;  3C18 A;  4OIO F;  2A6E F;  1REP C;  2UWM A;  4HX4 A;  1XSV A;  2EFQ A;  2ZNZ A;  4M73 A;  2EV0 A;  2VBW A;  5FFZ A;  1S3J A;  1P2F A;  4BXU A;  2ZME A;  5CVV A;  1SAX A;  3BPV A;  1WWX A;  2A5Y B;  1LQ1 A;  1IN5 A;  1QO0 D;  2HDC A;  2ZFW A;  1R5H A;  1IN6 A;  3KFW X;  5K5R A;  2D1H A;  4LB6 B;  2XAF A;  1YO5 C;  3EUH A;  1ZHF A;  4P9U A;  2Z5U A;  3COA C;  2R7F A;  5BQT A;  2FBK A;  3TO9 A;  3ZMU A;  4OMY A;  3KP4 A;  3TOB A;  5DD8 A;  4ZYE A;  4U0W A;  4GCV A;  5F64 A;  4BYY A;  3WTW C;  4BAY A;  2WV0 A;  4HAM A;  1T2K A;  2R7D A;  2L3D A;  1FP2 A;  2VN2 A;  2WWY A;  3MQ0 A;  4RB3 C;  3M8E A;  4MHG A;  3CDH A;  1ODD A;  1I1S A;  1PP8 F;  1RIO H;  2JTV A;  1W5S A;  2IA2 A;  2IRF G;  2COM A;  5K1Y A;  5DCM B;  2KKO A;  1DPR A;  5JR3 A;  1WSU A;  2P5L C;  3K1P A;  1F1Z A;  2BYV E;  3J80 K;  1BIB A;  3I71 A;  2LSO A;  4R1H A;  2VOO A;  4M6Y A;  1HSJ A;  3DPL C;  2NRA C;  4Z2Y A;  4EGY A;  4FX4 A;  1YW9 A;  1ZAO A;  1K79 A;  4U7B A;  3GLX A;  4P5O A;  2DU9 A;  4EJW A;  4L9T A;  4UV9 A;  3HTS B;  3O6B B;  2OD5 A;  2FA5 A;  3MZY A;  4KN7 X;  4UHT A;  1SFU A;  4L5J A;  1KU7 A;  2HWV A;  1G3T A;  1B1B A;  2FNP A;  2YX4 A;  3V7R A;  1Z91 A;  2XVC A;  2XV4 S;  1FSH A;  1FYK A;  5D8K B;  1IXR C;  4RGU A;  4LGW A;  3WU0 A;  3V7C A;  1PDN C;  4YIF A;  1YS6 A;  1ZG1 A;  2IA0 A;  5FLX K;  2Z99 A;  2LF8 A;  1D8J A;  2GQQ A;  1XDS A;  4FHT A;  1CF7 A;  2RNJ A;  2VE8 A;  5DUI A;  3FXQ A;  2K27 A;  5KVR A;  2XGX A;  4I7H A;  5ILU A;  3EYI A;  2YPR A;  3E97 A;  3NEU A;  4WXD A;  2BBY A;  2KJC A;  5E20 A;  2JSC A;  1IW7 F;  1U6G A;  3G73 A;  5CYV A;  1GVJ A;  4CHU A;  1K78 A;  4G6D A;  3RI4 A;  3HHH A;  1IAW A;  3BPX A;  5DD4 A;  3S2W A;  4UUV A;  1LEB A;  3I0T A;  4P55 A;  2KIM A;  2GAU A;  3ECO A;  5DYM A;  4G9Y A;  4BHP A;  1Z9C A;  5L3B A;  4AWX B;  3LA3 A;  4KUM A;  4ESF A;  1YQA A;  1FBQ A;  1ZH5 A;  4IPA A;  2E7W A;  2M1B A;  1HW1 A;  1BIA A;  2Y48 A;  4EJT A;  2LKP A;  3IC7 A;  1HQC A;  1R1T A;  3F8F A;  3LST A;  3RTR A;  1ZRC A;  2BV6 A;  4WK8 F;  4MNU A;  4HX8 A;  4L9V A;  1FPQ A;  5HLG A;  3ZN1 A;  2HQN A;  4A12 A;  3R61 A;  3K69 A;  4EV0 A;  1BJA A;  1SD7 A;  4GGG A;  3TOA A;  1MJ9 A;  3RDI A;  3I53 A;  2F5D A;  4OIQ F;  5DUK A;  5FGM A;  4YFX F;  3WE2 A;  4MQ9 F;  4UVA A;  2AXL A;  2JRT A;  3RYR A;  3F3X A;  1J75 A;  2FE3 A;  4NQW A;  2EV6 A;  3DEU A;  2J5O A;  3GWZ A;  2PI0 A;  2ACJ A;  2IVM A;  4KFC A;  4ENM A;  1TQP A;  4RAY A;  1E2X A;  5AON A;  2W57 A;  3KZY A;  3HYI A;  2HYF A;  4MEX F;  2YR2 A;  1OMI A;  3LFK A;  1ZRE A;  4XSX F;  1IN4 A;  2K4B A;  2KIF A;  1XB4 A;  1Y0U A;  2DQL A;  5D6E A;  4HQM A;  3BJ6 A;  3KP2 A;  3BDD A;  2CFX A;  3QP5 A;  2JPC A;  4HLX A;  3E5U A;  1HKS A;  3WU1 B;  1O3T A;  4HW0 A;  4G7O F;  1B9N A;  1YS7 A;  2DK5 A;  1R22 A;  3ERE D;  3WG9 A;  5H6R A;  1H0M A;  3IWF A;  2K7L A;  4A6D A;  5HLH A;  4L9N A;  1XCV A;  1R36 A;  4N9H A;  3HOT A;  1FBU A;  2L01 A;  4KMF A;  2X0L A;  4U7D A;  3GYH X;  2O6G E;  2HOE A;  4CXF A;  4IHS A;  1U5T B;  3NRV A;  5J6X A;  2STT A;  3ZPL A;  3OOP A;  5IT3 A;  3FXU A;  5K5Q A;  2HKO A;  2MBF A;  2Z33 A;  4AIH A;  1Q1H A;  4IRH A;  2X4H A;  2ISY A;  3WTT C;  2FQ3 A;  1IZ1 A;  1FBS A;  4LLN A;  1Z7U A;  2MLK A;  1SMT A;  1L3L A;  2JT1 A;  1MJA A;  2XUB A;  1IXC A;  1O57 A;  4MTE A;  3KP7 A;  3P7N A;  1T0F A;  4KYW A;  2J5P A;  4KIC A;  1L0O C;  4EMS A;  1R00 A;  2PQ8 A;  2RV8 A;  4JBA A;  4RB0 A;  2F5E A;  3V7S A;  4B09 A;  4ZZL A;  1TNS A;  1V3F A;  1BBY A;  2ZJ2 A;  4WXC A;  2ISZ A;  2FOK A;  5LHH A;  1P4A A;  3FHZ A;  2K86 A;  2VT2 A;  2XKP A;  1TLH B;  2QBY B;  3IWZ A;  4IVN A;  4N9I A;  3HIF A;  1IRG A;  4AIK A;  3M9A A;  3KE2 A;  3C3W A;  3SXY A;  2ESN A;  1U5T A;  3PQJ A;  1KU3 A;  2NS0 A;  2ZME B;  2FML A;  1WQ2 A;  3HHG A;  1ULY A;  4GXO A;  2EJR A;  2L54 A;  3F8B A;  2HTS A;  3C1D A;  4BH9 A;  1HBX G;  1I5Z A;  3LQR A;  3HSE A;  2ZKZ A;  4E70 A;  2A3S A;  2VOD A;  1IUY A;  2QEN A;  5TRD A;  2G7H A;  2P8T A;  4ZH4 F;  1JXS A;  3JSO A;  3R60 A;  3QPH A;  4IHT A;  5JFR A;  1XSD A;  1OR7 A;  2MC3 A;  3BOQ A;  3WGI A;  2MLG A;  1XCB A;  3WTY C;  3IRR A;  5ILV A;  4AIJ A;  2VBY A;  2P6S A;  1XMA A;  2QQB A;  5D5V B;  4A2U A;  2GA2 A;  2QBY A;  3EET A;  1QBJ A;  2OAZ A;  4HA8 A;  5D5X B;  2CW0 F;  3D5L A;  5LRR A;  2W24 A;  3BZ6 A;  1FOK A;  2H27 A;  2A61 A;  1A04 A;  1GXQ A;  3KET A;  2EWN A;  5FO5 A;  3FF5 A;  2EB7 A;  3B02 A;  5BS6 A;  4MGR A;  2DI3 A;  2C6Y A;  1PUE E;  1FX7 A;  2LDU A;  1BN5 A;  3WGG A;  1TNT A;  3HUG A;  1P4W A;  3KCC A;  3WTU C;  1OYW A;  3LWF A;  5HDG A;  3DKW A;  1DDN A;  4EM1 A;  5E18 F;  1ZG5 A;  4G8X A;  3GFJ A;  3JAM K;  3HOS A;  1BOA A;  3FM3 A;  1FYM A;  2CYY A;  2DT5 A;  5JVT A;  3WTX C;  3QP6 A;  4Q5S F;  1Z1D A;  5FD5 A;  1LVA A;  4U0V A;  4Y13 A;  3E6M A;  3QPT A;  4EM0 B;  2QWW A;  2NNY A;  2L02 A;  4CO8 A;  3F8M A;  2M30 A;  2QUF A;  3DQV C;  4IRG A;  1CF7 B;  4BQA A;  3L2C A;  1RZ4 A;  4HQE A;  2PBI A;  1USS A;  3P9K A;  4RGX A;  3GX4 X;  2V1U A;  2QYO A;  5CVI A;  3GW2 A;  3TO6 A;  1YIO A;  3K2Z A;  3EYY A;  5EEG A;  1KA8 A;  4RS8 A;  2FNA A;  3CO6 C;  4O6J A;  3J7A O;  2QZ8 A;  1U3E M;  3RKW A;  1K78 B;  1KU2 A;  4LK0 F;  4OIN F;  1OKR A;  1LB2 A;  5HS8 A;  3H3U A;  1BM9 A;  2V6C A;  2VC0 A;  2V1D A;  5CVJ A;  3KP3 A;  1JGS A;  4PCQ A;  2ZXJ A;  3F22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...