3BOQA

Crystal structure of marr family transcriptional regulator from silicibacter pomeroyi
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
136
Chain Sequence
KSDRQQNQTRLWLNILRLHGLVFGDLNRQLLDETGLSLAKFDAMAQLARNPDGLSMGKLSGALKVTNGNVSGLVNRLIKDGMVVKAFSAKLTDAGLTTFKQASEAHNRILAELLRAVSDQDMVEASAALRGILESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structure of MarR family transcriptional regulator.
rcsb
source organism Silicibacter pomeroyi dss-3
total genus 43
structure length 136
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3boqA00
1IAWA 1OMIA 1YG2A 1ZRCA 5L3BA 3WTXC 1R58A 4G7HF 4NQWA 4DNCA 3FXUA 5CYVA 3IL2A 5ICCA 2FRHA 2DI3A 1U5TC 2XAQA 3RYPA 5D5VB 3ML6A 2XRNA 4KMFA 2GWRA 3IHUA 5E17F 5BOXA 3KZYA 3W6KB 5EEHA 1ZG3A 2ZBKA 3VEPA 4IF4A 3ABUA 4Y13A 5K5QA 2EK5A 3PQJA 4EM1A 4KN4X 3E5XA 4L18B 3BZ6A 1ON2A 2EFQA 4RAZA 1WQ2A 3EYIA 1PUEE 4M6YA 1FZPB 4EJTA 1E17A 2HTSA 4Q4ZF 1USSA 4ESBA 2OQRA 4HX8A 2Z5UA 3CUQB 4R79A 2UZKA 1TW2A 2DLLA 2YSRA 3BWGA 1IN6A 1FSEA 2BE5F 4RB2C 3WU1B 1BM9A 2Q2EA 1MJAA 1U78A 5FGMA 5FD6A 1FP1D 1J7KA 2JTVA 2FEZA 3K1NA 5HS9A 3U9GA 5JVTA 4P55A 5FD5A 3F23A 2M5WA 2K27A 1U8RA 1UFMA 2PMUA 1YO5C 4A0ZA 4L5IA 3SQNA 3HYIA 1R1UA 4NHJA 4F7ZA 4I01A 1T98A 4G6DA 3QP5A 4R1HA 2J5PA 2IJLA 3ZMDA 3FZVA 1XSDA 1GXQA 3MZHA 2PMHA 4LLGF 5ICEA 1S3JA 1D3YA 3E6DA 4N9IA 2YPRA 2VT3A 1G3SA 4ETSA 3WTWC 3KP7A 2FBIA 3TOBA 4A5NA 4KA4A 1YW9A 6PAXA 4A6EA 1J2XA 3FX3A 1F1ZA 1G6NA 4G7OF 2D45A 2RDPA 2BEOA 3NEUA 3FF5A 2A69F 4MEYF 1FLIA 1B9NA 4RAYA 1ZLJA 2Z3YA 2XROA 4U0YA 1HW1A 1K6OA 2EFNA 4LFUA 3M8EA 2RN7A 1ON1A 4RGUA 5DD4A 1UCRA 1Z6TA 1OR7A 4IVNA 4PCQA 1IRGA 1XCBA 3FMRA 3FXRA 1IXRC 4KNYA 2HDCA 1EH6A 4LB5A 3HSRA 2L4AA 3L9FA 5BPDA 2STWA 1RNLA 5LHGA 1P2FA 4KN7X 2VBXA 1LDDA 3K69A 4WWCA 3E6BA 3O2PE 1LQ1A 2PN6A 3ROUA 1B1BA 4IRIA 2F5FA 4BNCA 1Z91A 1RUOA 1LNWA 4YFNF 1IXSB 4ZYGA 4ENMA 1ZHFA 2BV6A 2JT1A 1T6SA 1I5ZA 1LEBA 4LK1F 2UXXA 1O3TA 1SFUA 4EM0B 5D6FA 2DFIA 3GFLA 4LMYA 3JW4A 2RKHA 1S29A 3IC7A 2A61A 3IRQA 2W84A 1ZARA 3TO9A 3BY6A 3H3UA 3GEZA 1FP2A 2ZKZA 4U0VA 5L3FA 3FWEA 1U5TB 3VOEA 5FO5A 3BJOA 3WE3A 2XUBA 1V3FA 2QYOA 2VE8A 2P5VA 3F3XA 2OU2A 3EETA 2JPCA 2M8EA 3R61A 4HA8A 3V7CA 1LDJA 2HTJA 1BJAA 2GA1A 3IWFA 4LG0B 2XVCA 1KA8A 4OMYA 2BGCA 2H94A 1MGTA 3JTHA 4DQ2A 2BBYA 4MTEA 4LLLA 2JZYA 3HHGA 3FXQA 4HQEA 4GYGA 3V7SA 4ENNA 1RUNA 2XAJA 1OKRA 1ZRFA 3TQNA 2QQAA 3ERED 1RI7A 2IRFG 4L9JA 1DPUA 4HV6A 3COAC 4KFCA 2ACJA 3K1PA 4Y15A 1R36A 3GF2A 5IT3A 4MGRA 4UVBA 3LFKA 3DKWA 4KICA 2PFBA 3ISPA 1MDMA 3WGHA 2HFHA 3LSTA 2HR3A 1UB9A 1BI2A 1R7JA 2IW5A 2A68F 1FBQA 3SZPA 2CG4A 3EUHA 1YYVA 2CFXA 3RPUA 3W6JB 5AIQA 3N97A 2PLYA 2QM3A 3I71A 5LRSA 1BC8C 3D5LA 3J80Z 1FPQA 5D5UB 3QRFF 2HKOA 1ZG1A 2HGCA 4L9VA 2KJBA 3KLOA 2MLGA 1HKQA 4U88A 4ZYEA 1Z05A 2MH9A 3WU0A 4B09A 2R3SA 4R8HA 2A6HF 2XAHA 2O6GE 4IJAA 4O3MA 1KU9A 2HYFA 1QNTA 2LDUA 4I09A 2G9WA 2RQPA 4ZZDA 3K9TA 3LQQA 3DQVC 4HV5A 1R1TA 1T2KA 3L00A 4L9NA 4HAMA 1KQ0A 4XSXF 2DK5A 4PGGA 2JRTA 3WE2A 3M8FA 1J59A 3HUGA 1XGSA 2ZNYA 3KP6A 2V6CA 2FA5A 4KMUX 1J9IA 3HTSB 5ILVA 4UUVA 3F6OA 3GXOA 1XCVA 1U6GA 4RB3C 1BBYA 3QP6A 4KIGA 2FF4A 4CDGA 4KT5C 2FNPA 2OA4A 2ZMEB 3JAMK 1EH8A 4IPAA 4UVAA 3R0JA 3IWZA 4I2OA 5AONA 3QOPA 2QLZA 1FX7A 4M74A 4KIBA 1CF7A 2HQRA 2Q8KA 1XN7A 2W24A 1IF1A 3LA3A 3HSFA 2V79A 3LA2A 2OAZA 4OIRF 3ZPLA 1PP7U 2CSOA 4OIQF 3HRTA 1P4WA 2W25A 4P9FA 1Z7UA 4HW0A 3VFZA 5D4RA 1IXCA 1RZ4A 2KIUA 2OD5A 2BYVE 3I59B 3J80K 3RKXA 2HZTA 1B9MA 2P7CB 1W7PB 4CZZA 4ZYDA 1H9TA 3KLNA 2RV8A 3P9KA 3IKTA 5LBQA 2R7DA 1JGSA 1T38A 1AOYA 2P8TA 3GX4X 5ICGA 1O7FA 3F8MA 2VC1A 3BDDA 4P9UA 1JHHA 3GVAA 3H92A 2EB7A 4M6XA 3WTUC 1S7AA 4GGGA 2M1BA 1TTYA 2JPBA 4PZJA 3LAPA 3T1BA 2FMYA 5F1RA 4UV9A 5CJ9A 4HDVA 4BH9A 1TNTA 2M87A 2NNYA 4MQVA 1OYIA 2PI0A 5HDGA 1KU7A 3HHHA 3QAHA 1QPMA 5LHHA 4XSZF 2UWMA 2GXGA 3EDPA 5FB2A 4L5JA 2P6TA 2Y0MA 4ON0A 1YIOA 2C6YA 4K2EA 2LF7A 1A04A 5H20A 4L0ZB 1C0WA 3ZMUA 5E20A 4EJOA 3DP7A 1K78B 3AAFA 5D8KB 4EV0A 4HF2A 1ODDA 3WG9A 2D2WA 3V7RA 3O6BB 2DW4A 1Q1HA 4JQFA 2F2EA 2XV4S 3HSEA 4YFKF 4AIJA 3Q9VA 1SD4A 1QZZA 2EFPA 4AVPA 5DCMB 3CO6C 3C18A 1O3QA 5DCFA 1ONVA 3KE2A 3L09A 5FLXZ 3K2ZA 2ISZA 4QWQA 4AWXB 3M1EA 3D0SA 1O3RA 3C3WA 1LVAA 1BN5A 1U3EM 1BIBA 4CYDA 5ED4A 4BHPA 1FC3A 1FY7A 1XD7A 2HYGD 5FFZA 2WC2A 5LGTA 1FT9A 2ZCWA 1Z1DA 2ELHA 2AXLA 2XAGA 1G3WA 1D8JA 2VXZA 1TW3A 3HRMA 2RVCA 4RB0A 2ESNA 5HDNA 3PFIA 4Y17A 2G7UA 4EMSA 5L3CA 1DPRA 1WKMA 4MEXF 4ZYHA 3NRVA 5J6XA 3CJNA 1OYYA 2X0LA 3E97A 1HQCA 2PQ8A 5AIPA 1XGOA 1MD0A 5TJJA 1R00A 2DO7A 2HQNA 3I58A 3TOAA 4KYWA 1HKSA 1IN8A 2VE9A 2HS5A 2UXNA 2IA1A 5HS7A 1WSUA 1J75A 4HX7A 3I4PA 4ENKA 4IHTA 4AIKA 1Z6RA 1LJ9A 1JE8A 1ZH5A 1SD6A 4YIIA 2L01A 4P5OA 2DQLA 4WXHA 3BJ6A 3S2WA 2COMA 4A0YA 5HLIA 3GFMA 5L3EA 3DPLC 3NQOA 3U2RA 2FE3A 4G6QA 3GLXA 3ZMSA 1XB4A 2FMLA 4HLXA 3JSPA 1XDSA 4HBLA 3K0LA 3RIRA 3V4GA 1TBXA 2ZXJA 1OYWA 3GYHX 1T0FA 4ZZLA 3WTSC 1HW2A 4FT8A 1WRJA 4HQMA 4GO1A 3CLOA 3E5QA 4L9TA 4I02A 2YR2A 2DTRA 5D5XB 5E1XA 3IRRA 5FLXK 2GQQA 1FYLA 2GXBA 5H6RA 2CO5A 5KVRA 3CUQA 3DEUA 5JHUA 1K7AA 2HOEA 3IKVA 1ZAOA 4G7ZF 2NS0A 2P7VB 3ZP5A 5DYMA 4CICA 5J8CA 4HLYA 1DDNA 1H0MA 2QENA 4QLCU 5LHIA 3TO7A 1W5SA 2XASA 4BQAA 4M73A 1SFEA 2MH2A 2F5DA 2Y48A 2EFWA 1YW8A 3RI4A 3KEQA 1F5TA 1IN5A 4CHUA 2DQRA 3JAMZ 4WF2A 4YG2F 5D8LB 3KP4A 3I64A 2QBYB 5A2QZ 4IRHA 5D5WB 1SD5A 3T5XA 4MNUA 3SHFA 4HF0A 2J5OA 5BPIA 5E1ZB 2WWYA 3JTGA 4WK8F 4NB5A 4AIHA 3M9AA 3V8LA 5CVJA 5BQTA 3F8NA 2DK8A 2H6BA 2F5CA 1O57A 3HOTA 3LWFA 3E6MA 2ZFWA 3OV8A 2IVMA 5KK1A 5CVUA 3KP3A 1F4KA 2YX7A 3REOA 3E3VA 3LAJA 2P5KA 3CUQC 1YLFA 2DAOA 4ESJA 4Q48A 1KU3A 3WTTC 4OOIA 3MFKA 1ZLKA 3ECHA 3H3ZA 2DT5A 4EGZA 3JSOA 4UV8A 4UVCA 1O3SA 1XDUA 3M7GA 3ZN0A 4GXOA 4ZH4F 3R60A 4FHTA 4I0AA 2ZNZA 2Y75A 2M30A 3FMQA 3Q5FA 4WXCA 3F72A 3GFIA 1MJ9A 2P5LC 3ZMTA 2XHKA 1LB2A 4EM2A 2WV0A 5CVVA 4FX4A 4HF1A 2OQGA 4I0BA 4A12A 2VT2A 3O3KA 1REPC 3F6VA 3KP5A 4GYIA 1YS7A 2Z9OA 1P6RA 1I6XA 2TDXA 3F22A 3B02A 2IP2A 2Z99A 1ZREA 4UXNA 4Q5SF 4XLPF 4Q47A 1I1GA 1UHMA 1YFHA 2O03A 4OIOF 4G9YA 4OIPF 1ZGAA 2IA2A 4LK0F 2K7LA 4CGZA 2O8XA 3HIFA 1B4AA 1YQAA 4A2UA 2NRAC 3ZQ7A 5FFXA 3RDIA 2VONA 3BPVA 4LB6B 1YW7A 2STTA 2CQKA 1U5TA 4OMZA 5A2QK 3I5UA 3V8JA 3Q9SA 3SXYA 2E7WA 3LA7A 2RGVA 2G7HA 2VBWA 4EJUA 1J5YA 3BOQA 3KZZA 1STZA 4GCVA 4WX9A 4RGXA 1TQPA 1SD7A 5DEQA 4LG0A 4XRFA 2B0LA 1D8KA 2L54A 1J0RA 2ESHA 1T39A 4N0BA 2CGPA 2EV0A 2Q0OA 1YTYA 5K1YA 1XGMA 2KIFA 5LEKA 4KUMA 3I0TA 1PP8F 3U1DA 3ZMVA 4S04A 4B8XA 4HX4A 2MLKA 3ECOA 4OU0A 4RS8A 4E70A 4HDUA 1S6LA 4BYYA 2VC0A 5CVRA 2VODA 1GXPA 1G4DA 2ZO4A 1XGNA 1FWZA 2FBHA 4KIFA 2FU4A 1IRFA 5TRDA 1WWXA 3ZN1A 3BPXA 2VOOA 2VN2A 3E6CC 2A5YB 2KRFA 5LGUA 1JXSA 2E1CA 4TV7A 3T8RA 1L3LA 3L7WA 5DUIA 1R23A 2L02A 5L3GA 2JSCA 1ZRDA 1FYMA 5E8IA 5HDKA 1KQ9A 4O6JA 2FXAA 3WTVC 2QQ9A 2HWVA 2EV5A 4HZFA 2IPQX 1D5VA 5ILUA 3TDUC 2MBFA 2QWWA 1Y0UA 4CXFA 2OBPA 2EV6A 5F6FA 3G3ZA 2LNBA 3WODF 2NAZA 1F9NA 2V9VA 1QO0D 3RTRA 4M72A 2NNNA 1MKMA 2FBKA 2WTEA 1V4RA 3GW2A 2QUFA 1PDNC 5HS8A 4EGYA 4HYEA 2L4MA 1KU2A 5E8GA 1SMTA 2VOPA 4IXAA 3RYRA 5HOOA 4EJWA 1XMAA 3B73A 2Z33A 2D1VA 5J8FA 5DD8A 4BXUA 3GO5A 2DPUA 5D4SA 4U0WA 2OZUA 5F64A 3BROA 4D0PA 3RKWA 1WI9A 2FNAA 1FYKA 4S05A 3KETA 1YS6A 1MZBA 3KP2A 5E18F 1QGPA 3GUDA 2KKOA 1MDMB 5HVQC 2PG4A 2CYYA 5BS6A 3CTAA 3QU6A 1R22A 4CO8A 5JR3A 5EEGA 3DFGA 3KEOA 2MA3A 3MAJA 1FSHA 1EV7A 5ERIA 2ZMEA 3MQ0A 4ENJA 1P4AA 3K1MA 3F21A 4I98B 1TNSA 5K5RA 2PJPA 4IHSA 4LJZF 1E2XA 5HLGA 2ISYA 5JI6A 1USTA 2RC4A 5HLHA 1KGSA 3F8FA 1BI0A 2DPDA 1KYZA 1B59A 4LGWA 3T8TA 3TGNA 1MJBA 3DPTA 4EQQA 2A3SA 3DXJF 3BJAA 4U7DA 5DUKA 1Z9CA 2E1NA 5ILSA 3HRSA 3P7NA 3MZYA 2OZ6A 3I59A 1R5HA 4RB1A 1KQ8A 4WCGA 1W7PA 2KJCA 3I53A 1XMKA 2NYXA 3FM5A 3GFJA 2V1DA 3SZTA 1FBUA 2EJRA 2KIMA 2A6EF 4MHGA 1FBSA 4YFXF 2H27A 3TDZC 1K79A 1ZN2A 3P9IA 1EH7A 4IRGA 1W4MA 1QBJA 1HKTA 2XGXA 5LEJA 2M45A 2XKPA 1CGPA 4LLNA 5IT9Z 1IN4A 4MTDA 5ICFA 4LD5A 1IZ1A 1BI1A 2K4BA 4O5VA 1NHAA 4PDKA 2P4WA 1UHWA 2LSOA 4P96A 2XAFA 1I1SA 3VB2A 1S8NA 2EA2A 1RIOH 3J7AO 3P9CA 3GZ5A 2IT0A 4M71A 5LRRA 1R1VA 1L0OC 3ABTA 1CF7B 2YU3A 2MC3A 1G3YA 3FHZA 1ULYA 1DP7P 1W5TA 1K78A 2XKOA 3C1DA 3F8CA 1VTNC 2CWEA 4JK1X 3HRUA 4U7BA 1IW7F 3LQRA 3R6SA 3QU3A 2F5EA 2V1XA 2K02A 3WGIA 4XLNF 2GA2A 4YIFA 5CVIA 1BI3A 3RKYA 3ZMZA 2FSWA 2O3FA 4AD9A 5DCMA 3F8BA 3CO7C 3I54A 4M9XA 4BHBA 1HSJA 1LEAA 3FMSA 1BIAA 2V1UA 5D6EA 1JHFA 2LKPA 3EQLF 1BC7C 2XIGA 5CLSA 2O0YA 2VBZA 4MQ9F 1AWCA 3J81Z 3CDHA 2X4HA 1X3UA 3N4MA 5LLQA 2W85A 4PGHA 1S7OA 2CW0F 1ZGJA 1SMYF 5BMZA 2ZJ2A 1LDKB 2IA0A 5JFRA 1ZG5A 5L3DA 4A0XA 3HOSA 2GZWA 3QPTA 2P6SA 2O61A 2GIVA 5DDGA 3MWMA 1H9GA 4WXDA 4A6DA 5H6QA 4JBAA 2GAUA 2QQBA 5IT9K 3RPQA 1HW5A 3HTUA 2RNJA 4M9ZA 1IUYA 1I27A 4Z2YA 4EVIA 2W57A 2K4JA 5E1WA 1P4XA 1ZYRF 1XSXA 3SFZA 1W7PD 1TQMA 1P92A 3V8KA 3ELKA 4ESFA 4BHCA 2PEXA 3R0AA 4G94A 2H09A 1TLHB 5K5OA 1B6AA 3GZ6A 3QPHA 3WTYC 3T0YA 2EFOA 3VODA 1O7LA 3EYYA 1FNNA 2PBIA 3TO6A 1SAXA 4FX0A 2FOKA 2DBBA 2H6CA 3WGGA 4RGRA 2K86A 3KFWX 2EWNA 3R4KA 1HXDA 4G8XA 4RGSA 3E5UA 3C7JA 4XBFA 1GHCA 1XSVA 3DV8A 3KCCA 3FM3A 2QVOA 1G3TA 2ADUA 1OPCA 4UNOA 3L2CA 4EJVA 5LGNA 2EA4A 3PQKA 4A5MA 2R7FA 1U2WA 3TKYA 4L0YB 2D1HA 4HOBA 3CUOA 4H0EA 1SFXA 4OINF 1IN7A 2FQ3A 3BP8A 2DU9A 4N9HA 3OOPA 2HEOA 2L3DA 1HBXG 4UHTA 1QQIA 2LF8A 1HSTA 1QZYA 1DUXC 3MCZA 3DF8A 2AS5F 1FOKA 3J81K 1GVJA 2QZ8A 4M9SA 2ETHA 3G73A 4KDPA 2E7XA 3MEXA 4I7HA 5DV5A 2VBYA 2HKXA 3GWZA 1BOAA 1KYWA 4BAYA 2QBYA 3RJPA 2YX4A 2MD5A 3WTZA 2A07F 1TQIA 4ASNA 3ULQB 1R5GA
chains in the Genus database with same CATH superfamily
4AC0A 1IAWA 2R7TA 1OMIA 1YG2A 1ZRCA 3ZQLA 2CUEA 5L3BA 3WTXC 1R58A 3OYIA 4G7HF 4NQWA 4DNCA 2DOAA 3FXUA 4B48A 5CYVA 3IL2A 5ICCA 1SEUA 1JKQC 2JWTA 2XB0X 2FRHA 2DXIA 2DI3A 3S3OA 1U5TC 2XAQA 3RYPA 5D5VB 3ML6A 2XRNA 4KMFA 4W97A 2B63J 2GWRA 3IHUA 5CQGA 5E17F 5BOXA 3S2HJ 4IHXA 3KZYA 3W6KB 5EEHA 4CCKA 5GTHC 2M4KA 1ZG3A 2CQ7A 1OCPA 2ZBKA 3VEPA 4IF4A 3I55I 3ABUA 3ABMH 3DKXA 4JP0A 4Y13A 5K5QA 2EPFA 3JRAA 1GLNA 5KHDA 2MC4A 3OS0A 2EK5A 2BY1A 2DFHA 1FIAA 3PQJA 1BR4A 4EM1A 4KN4X 3E5XA 4XKCA 2O9LA 4L18B 3BZ6A 5CQEA 5EEAA 1JJ8C 3S1NJ 1ON2A 2EFQA 4RAZA 1WQ2A 2LH9A 3EYIA 2P81A 1PUEE 4M6YA 3W3CA 2DMNA 2VJ5A 3HXLA 1GT0C 1D1BA 4D9JA 1FZPB 4EJTA 2COBA 1E17A 1LE8B 2HTSA 4Q4ZF 4A3KJ 2XPVA 1USSA 3HDDA 4ESBA 2WB1A 1Y1VJ 2OQRA 3W6VA 4HX8A 2KP6A 2Z5UA 3CUQB 4BEHA 3MVPA 4R79A 2UZKA 4LITA 1K6YA 4A3EJ 1SFKA 2BW3B 1TW2A 3EUKL 1ZKGA 2DLLA 2YSRA 1AHDP 3BWGA 1IN6A 1FSEA 2BE5F 2NS7A 2X48A 4W1UA 4RB2C 3WU1B 1LKXA 5C4XJ 1BM9A 1T95A 4RAFA 2Q2EA 5FKKA 4RM2A 2ICWG 1MJAA 1S9HA 2CRGA 2BY2A 1U78A 5FGMA 3PFYA 3L1PA 3S3NA 2CW7A 3TW6A 5FD6A 1FP1D 4M3FA 3VSLA 1J7KA 4N4OB 3KEYA 2JTVA 3OIOA 2FEZA 4PSXA 1XG1A 3OYHA 3K1NA 1AA7A 5HS9A 2E2JJ 3U9GA 4BXXJ 2K85A 2RREA 5JVTA 2V26A 4UUTA 1IV6A 3ESWB 4P55A 3PL8A 5FD5A 3K4CA 3F23A 2V4JC 3A2KA 2M5WA 3JRHA 2K27A 5JLXA 2R5YA 1U8RA 1UFMA 3ABLH 2PMUA 1YO5C 3IP4B 2X1DA 2QSFX 4A0ZA 5E79C 1BR2A 4L5IA 3SQNA 5GPAA 3K4BA 3JRDA 1YITI 1R71A 3VSKA 4XKVA 3WU2C 3HYIA 1R1UA 4CYCB 4C2TA 4NHJA 4F7ZA 4I01A 1T98A 4G6DA 1ZELA 3QP5A 4BU2A 4R1HA 2J5PA 1R49A 2RQQA 2IJLA 2F5VA 3ZMDA 3FZVA 1XSDA 1GXQA 2LK2A 3MZHA 2PMHA 4LLGF 5ICEA 1S3JA 1BA5A 1D3YA 2XGCA 3E6DA 1CQTA 4JX6A 1N25A 2ID6A 2V9PA 1VFCA 4N9IA 1RETA 2VT3A 2YPRA 4Y3OA 1BL0A 2HNHA 2WAQA 1X19A 5HNHA 1NG7A 4E6KG 4FQGA 2WY8Q 1G3SA 2L9VA 4ETSA 1OISA 3QYEA 3WTWC 3OYGA 3ZRGA 2R5ZA 2VXDA 2DMUA 5J40A 5FROA 1E3HA 4NBQA 1SVOA 3KP7A 2FBIA 3TOBA 4A5NA 2PX9A 2VKDA 4KA4A 1YW9A 6PAXA 1HF0A 4A6EA 1J2XA 1JKPC 2Z2SB 3LSGA 3FX3A 1F1ZA 1G6NA 4G7OF 2D45A 1NK3P 2RDPA 2BEOA 4FCYA 3NEUA 3FF5A 2A69F 3HPHA 4MEYF 1AU7A 2JUCA 4A93J 1WH7A 1FLIA 1B9NA 2CJJA 4RAYA 1R9TJ 3BR1A 1IC8A 1ZLJA 3BR3A 2Z3YA 2XROA 4U0YA 1FMVA 1HW1A 1K6OA 2EFNA 1N77A 1ITYA 1VQ4I 4LFUA 3M8EA 5EZGA 4U87A 2E2HJ 1MIJA 2RN7A 3RZDJ 1ON1A 1W0TA 1WJFA 2DYRH 2VQGA 4RGUA 5DD4A 4LIUA 1UCRA 1Z6TA 1YJNI 1OR7A 3A01B 1JTXA 4QTRA 4IVNA 1YJ9I 3HJEA 4PCQA 1IRGA 3L2UA 1XCBA 2BY0A 3FMRA 3UNGC 3FXRA 1IXRC 9ANTA 3OSGA 3HB9A 3GTLJ 4KNYA 2F4MB 4XRSA 2HDCA 1EH6A 2VJ4A 4LB5A 3HSRA 2NS8A 2FX0A 2L4AA 4YELA 3L9FA 5BPDA 2STWA 1RNLA 5LHGA 3G1LA 1P2FA 3VPRA 4KN7X 3AKZA 4E7IA 3ZXSA 2VBXA 1LDDA 3K69A 5EGOB 4WWCA 1WCMJ 3E6BA 3O2PE 1WJ5A 3QPLA 3CCJI 1LQ1A 4PJMA 2PN6A 4CCJA 2E2IJ 1V54H 3CD6I 3ROUA 3K70D 1B1BA 4IRIA 2F5FA 4BNCA 4HPQA 2F6CA 1Z91A 4BE1A 2Y2ZA 1RUOA 1LNWA 4YFNF 1IXSB 1V5FA 1ETQA 1H88C 4ZYGA 3OYFA 4ENMA 1ZHFA 2BV6A 4PSWA 2JT1A 1T6SA 1I5ZA 1LEBA 4LK1F 2UXXA 1O3TA 2JA6J 2WAFA 1SFUA 4EM0B 3ZQFA 5D6FA 1TT0A 5M3MJ 3WHCA 2DFIA 2EINH 3GFLA 2ZMEC 2E60A 2F4OB 4LMYA 2JUGA 3FIWA 3JW4A 2RKHA 1S29A 2AO9A 2KZGA 3IC7A 5M5WJ 2A61A 1H8AC 3PO3J 3CCMI 5IOZA 3M1CA 3A0HC 3IRQA 2JN6A 5FRNA 2W84A 1ZARA 5KAFC 3TO9A 3BY6A 3H3UA 3GEZA 1FP2A 2HYJA 4A3MJ 1G59A 4FISA 2VPLA 1UG2A 1J09A 2DA4A 2ZKZA 2NOGA 1JGGA 3HZJA 4U0VA 5L3FA 3FWEA 1D1AA 1U5TB 3VOEA 5FO5A 4NUBA 3BJOA 3WE3A 2DA7A 2XUBA 3S32A 5IPAA 2LVSA 1V3FA 3OYMA 2QYOA 2VE8A 1ZR4A 2P5VA 3F3XA 1XTAA 2OU2A 4I6ZA 3EETA 3AG3H 4PK4A 2JPCA 2M8EA 2HOSA 3R61A 1WJBA 2VB6A 4HA8A 4H4KC 3V7CA 2KLOA 3MMYB 3ZQIA 5EZHA 1LDJA 2HTJA 1BJAA 2GA1A 1XMXA 3IWFA 5IOYA 4E7SA 1WH5A 4LG0B 2XVCA 3BR6A 2BXYA 1KA8A 4OMYA 2BGCA 2H94A 1MGTA 3PNTA 3D1NI 1FJLA 3JTHA 4DQ2A 2BBYA 4MTEA 4LLLA 3I9V2 2JZYA 1VQOI 3HHGA 3FXQA 4HQEA 4GYGA 5KCMA 4ZDPA 3V7SA 1VNDA 4ENNA 5FKLA 4LG3A 1RUNA 2XAJA 1OKRA 4CCOA 1ZRFA 2HQ5A 2Y30A 3TQNA 2QQAA 3ERED 1RI7A 2IRFG 1WPKA 4L9JA 1DPUA 3W2WA 5F0FA 4HV6A 3COAC 4KFCA 2ACJA 3BR2A 3K1PA 2KDZA 4Y15A 1R36A 3ABKH 3GF2A 4XK4A 5GADJ 5IT3A 4MGRA 4UVBA 3LFKA 3DKWA 3H0GJ 2XF5A 4XNFA 4KICA 1V5GA 2ECBA 1YIJI 3OYNA 2PFBA 3ISPA 2MSYA 2A6TA 2IGKA 3CCYA 2LOOA 1NG6A 2LD5A 1QVUA 5M5XJ 1MDMA 3CDLA 2XDVA 3ZOBA 4IX7A 3WGHA 4CZCA 3OYCA 3RQIA 4A3IJ 2HFHA 2W4SA 2WY7Q 2QA4I 3LSTA 2HR3A 4DZPA 1UB9A 1BI2A 1R7JA 2LBFA 2IW5A 2A68F 1FBQA 2ELJA 3OYAA 3SZPA 3MKWB 2E35A 2CG4A 1IRXA 3EUHA 1D1CA 3ASOH 5C3EJ 1YYVA 2CFXA 3BR0A 3RPUA 3W6JB 4B43A 3G2BA 5AIQA 3N97A 1X1PA 2PLYA 4B1RA 4XLFA 2QM3A 3I71A 1UJ8A 5LRSA 1BC8C 3D5LA 3J80Z 3DBRB 4HSRA 4M3BA 1EKEA 3H9QA 2X6WA 3ASNH 1K61A 1FPQA 4LIVA 5D5UB 5GPCA 3QRFF 3CCUI 2HKOA 1ZG1A 3M4OJ 2HGCA 4L9VA 3I4NJ 3HOVJ 2OUMA 2KJBA 3KLOA 2QSHX 2M2EA 2MLGA 2EIKH 1H89C 1HKQA 4U88A 4OAYA 2MD0A 4ZYEA 4A3CJ 5F0HA 1Z05A 2MH9A 1D5YA 2QCOA 3LSRA 3WU0A 4B09A 2R3SA 4R8HA 1WJEA 2A6HF 2XAHA 2O6GE 2IS4A 4IJAA 4O3MA 1KU9A 1RESA 4MO7A 2HYFA 3K7AJ 4XKBA 3JREA 1QNTA 2LDUA 2H8WA 1R4MB 4DYRA 3OYEA 3HBLA 2G9WA 2RQPA 1I50J 4I09A 3GTQJ 4ZZDA 3N05A 3K9TA 2OF7A 3LQQA 1HDPA 2W82A 2LP0A 4FE7A 2YUSA 3DQVC 1JUSA 3TEDA 4HV5A 2A5WA 2DMPA 3BG7A 1R1TA 3E7LA 1T2KA 3L00A 4L9NA 4HAMA 2JQ7A 1KQ0A 5CPRB 3S3MA 1A35A 4XSXF 2DK5A 4PGGA 1JT0A 2JRTA 2D5VA 3H9JA 4Z6YA 2R92J 3WE2A 4ZDLA 3M8FA 1ETWA 3PIPF 4QPQA 3RSNA 1FOWA 3CF2A 1K4SA 3HM5A 1J59A 4HG2A 3HUGA 1XGSA 4B47A 4M3DA 3PO2J 1DP3A 2ZNYA 3KP6A 3EUHC 2EH3A 1VQPI 2V6CA 1YE9A 2FA5A 3QQAA 4KMUX 1J9IA 1Y39A 3HTSB 5ILVA 4UUVA 2W48A 5FKMA 4ZJZA 2M7BA 2JA5J 3F6OA 3GTKJ 3GXOA 1DU0A 1XCVA 1U6GA 3CCQI 1MSEC 2BHYA 2X6XA 4AUXA 4RB3C 2ME6A 1BBYA 1MH4A 1WJCA 3FBIB 3QP6A 4KIGA 5B1AH 2DCEA 2FF4A 2LMDA 4CDGA 4KT5C 1OQYA 2FNPA 2OA4A 2W00A 2ZMEB 4M3EA 5F0CA 3JAMK 1I39A 1N78A 2K5CA 1EH8A 4IPAA 4RA2A 4UVAA 3HOXJ 3R0JA 1P7JA 3H1CA 1ACIA 3IWZA 4CCMA 4Y4RA 4I2OA 3FBNB 5AONA 3PUFA 2A05A 1VQ6I 3QOPA 2QLZA 1FX7A 4XLAA 2DDAA 2XSJC 2CV0A 2KRHA 4M74A 4KIBA 1CF7A 2HQRA 3RCOA 2Q8KA 1XN7A 2L5QA 2W24A 3CP8A 3HSFA 3LA3A 1IF1A 2V79A 3LA2A 1XS9A 1RR7A 2OAZA 1TT5B 3P5JA 3CCVI 4OIRF 4B44A 4ZYAA 3ZPLA 5CKTA 1PP7U 1X1AA 1R6RA 2CSOA 4OIQF 4UB6C 3HRTA 1P4WA 2W25A 5J1RA 4P9FA 1Z7UA 4HW0A 1T08B 2DN0A 3VFZA 5D4RA 1ETXA 3PNVA 1IXCA 2HPMA 1RZ4A 2JK3A 2KIUA 2OD5A 2G0EA 1D0ZA 4X1EA 2BYVE 3I59B 3J80K 2IBDA 3RKXA 2GXAA 2HZTA 3CCSI 1ETVA 1B9MA 3LSMA 2P7CB 2JMWA 5IP6A 1W7PB 4CZZA 1I3AA 4ZYDA 4BGDA 1H9TA 3BLYA 2NOJB 3KLNA 2RV8A 3P9KA 3IKTA 2N8GA 5LBQA 4F93B 2R7DA 3DU5A 1JGSA 1T38A 1AOYA 2P8TA 2HOTA 3GX4X 5ICGA 1O7FA 3F8MA 3HEFA 4XLHA 2Y31A 2IXSA 1B72B 2VC1A 3BDDA 1PVEA 3LSJA 1JHHA 4IEJA 4P9UA 3GVAA 3H92A 5B66C 2EB7A 4S0HB 4M6XA 2HU9A 3WTUC 1S7AA 4GGGA 2M1BA 1TTYA 2JPBA 4YIRX 4XKWA 3OYDA 4DZJA 1FOXA 4PZJA 3LAPA 4PFOA 1HDDC 1PUFB 3H3VK 3T1BA 2E36A 2FMYA 3PSIA 3RPUD 5F1RA 4UV9A 5CJ9A 4HDVA 4BH9A 1XPXA 1TNTA 2M87A 2NNYA 5FLMJ 2K9LA 5HODA 2PJRA 4MQVA 4X6AJ 1OYIA 4A69C 1E3PA 1YRNB 3CCLI 3CMYA 2PI0A 3OR2C 5HDGA 1KU7A 3CC7I 4AM3A 3S16J 3HHHA 5HLTA 2XF6A 5JVGF 1LFPA 2HQAA 3QAHA 4AYBN 5K7ZA 3OY9A 1QPMA 3S8PA 5LHHA 5BNGA 4XSZF 2UWMA 2GXGA 1X2MA 3EDPA 2OCCH 2XAUA 5FB2A 4G6TB 4L5JA 3PNYA 2KISA 1Z3YA 2P6TA 2Y0MA 4ON0A 1YIOA 2C6YA 2YU9J 2BVLA 1MMNA 2IGNA 2LF7A 4K2EA 2K9NA 1A04A 5H20A 3CCEI 5FKOA 3OYLA 4L0ZB 1DU6A 1C0WA 1YX5A 1D0YA 2CV2A 3ZMUA 2MW8A 1WI3A 2L0KA 2LTPA 3DLLF 1SFOJ 5E20A 4EJOA 3DP7A 3RKQA 1QPIA 1K78B 2DMQA 3AAFA 5D8KB 4EV0A 4HF2A 3A4CA 1ODDA 3WG9A 3LMMA 2D2WA 2V1NA 3V7RA 2L7KA 5GAGJ 3K70C 3O6BB 2DW4A 1NTCA 1T8IA 1LUJB 1Q1HA 4JQFA 2F2EA 2EIJH 3ERMA 3JR9A 1LFUP 2XV4S 5J1YA 3IH4A 4IHYA 3SZGA 3HSEA 1XX5A 4YFKF 3BG3A 3QPSA 5DM7F 3TP0A 4AIJA 1POGA 3EPZA 3Q9VA 1SD4A 1QZZA 2R7WA 2EFPA 3GMEA 4AVPA 5DCMB 1OCRH 4BBRJ 1TZLA 3C18A 3CO6C 5DCFA 1O3QA 1ONVA 3KE2A 3JCUC 3L09A 5FLXZ 4D1QA 4HRIA 3K2ZA 1VQNI 2ISZA 1B8IB 1R5ID 4QWQA 4AWXB 2W7NA 1QZEA 3M1EA 3D0SA 1O3RA 3C3WA 1LVAA 1Y0NA 1MNMC 1BN5A 4XICA 1U3EM 1BIBA 2QF7A 4CYDA 2R7SA 3A02A 3SFIA 4BQNA 5ED4A 5E3LA 4BHPA 2ZSIB 1FC3A 1FY7A 1XD7A 2HYGD 2CV1A 3X2QH 4ZTFA 5FFZA 2WC2A 5LGTA 1FT9A 5TISC 4NDLA 2E5NA 4P1WA 2ZCWA 1X3ZB 1Z1DA 2AXLA 2ELHA 1ETYA 2XAGA 5EG0A 2WV1A 1G3WA 3K4MA 4G12A 1W0UA 2K9MA 1VQ5I 4M3GA 1D8JA 2VXZA 1TW3A 3HRMA 2RVCA 3NWTA 3FXLA 4NC7A 4RB0A 2ESNA 5HDNA 1IGNA 1WZ2A 4X0GA 3PFIA 2ZJRF 2CFOA 4Y17A 3JRFA 4GFBA 2BZTA 2G7UA 4EMSA 5L3CA 1A6IA 1TL8A 2OCEA 1DPRA 1WKMA 5DS9A 4OWRB 4MEXF 4ZYHA 3NRVA 5J6XA 3CJNA 1OYYA 2X0LA 5KAIC 1MBFA 3EUAA 4D7NA 2MGQA 3E97A 1HQCA 2PQ8A 2R7ZJ 5AIPA 3M8JA 1XGOA 1MD0A 3BT9A 5TJJA 1R00A 2DO7A 2HQNA 2XGEA 3I58A 4BKXA 3TOAA 1JT6A 3DCFA 3NAUA 4KYWA 3S14J 1HKSA 1IN8A 3OL4A 2VE9A 2HS5A 3I56I 2UXNA 3FDYA 2IA1A 5HS7A 3GCMA 2QGUA 3HGYA 3IH2A 1WSUA 2DYSH 1J75A 1UMQA 4HX7A 3I4PA 4ENKA 4IHTA 4AIKA 1Z6RA 1LJ9A 1JE8A 2JJ7A 1WGXA 1ZH5A 2BXZA 1SD6A 1EF4A 4YIIA 2L01A 5EJCA 2H1LA 5IYBJ 4P5OA 2DQLA 4WXHA 1HA8A 3DTIA 3ZCOA 1W36D 3BJ6A 3BCAA 3S2WA 1RPWA 2COMA 3L2RA 5EYRA 4A0YA 5HLIA 2OC6A 3L2QA 1WJAA 4XORA 4C9YA 3GFMA 2VL8A 2IEKA 3OWTA 2XPWA 5L3EA 3DPLC 3NQOA 4KISA 3U2RA 4A3LJ 2I8DA 4FTHA 2FE3A 4IHWA 4G6QA 3GLXA 1KZHA 3SEQA 3J7ZI 2HVSA 4XRMA 2DA5A 1XB4A 2FMLA 1G8XA 4HLXA 1XDSA 5J1UA 3ZMSA 4HBLA 3JSPA 3K0LA 3RIRA 3V4GA 4BQOA 4CCNA 3LNQA 4ANJA 1EJ9A 1TBXA 2ZXJA 3F0CA 1OYWA 5J47A 4MFEA 4E7JA 3OL3A 2WBMA 3GYHX 3BTLA 5JHFA 1T0FA 4ZZLA 3WTSC 2VKVA 5EF6A 1HW2A 4EATA 2DMTA 2VIXA 4FT8A 1WRJA 1D0XA 4HQMA 2XPUA 4GO1A 5IP9J 5M3FJ 1ETOA 3HGGA 3L2WA 3PM1A 3CLOA 3E5QA 4L9TA 4I02A 4Y52J 2YR2A 2DTRA 5TGTA 1NH3A 1LE8A 5D5XB 5E1XA 5GTIC 3IRRA 5FLXK 2GQQA 4II2A 1FYLA 2GXBA 5H6RA 3TMOA 2CO5A 4UUSB 2RNGA 5KVRA 3JRCA 1Y8QB 3CUQA 3BQZA 3F9KA 3DEUA 1HC8A 5JHUA 1K7AA 3WG7H 5M5YJ 2R0QC 2HOEA 3IKVA 2LG4A 2BW3A 1ZAOA 3E1SA 4G7ZF 1UELB 2NS0A 2P7VB 1OR7C 4V19K 2B9SA 3ZP5A 5DYMA 1BW5A 4CICA 5J8CA 4HLYA 4E7KA 1DDNA 5J4YA 1H0MA 2CUJA 1VQ7I 3S1MJ 2QENA 4QLCU 5LHIA 3TO7A 1W5SA 4ITVA 1UG0A 2XASA 4BQAA 2ZXWH 4M73A 1SFEA 2MH2A 2F5DA 2Y48A 2EFWA 1YW8A 4YEJA 3VYTB 3RI4A 3KEQA 4MFDA 4XOPA 1WFXA 4MIMA 1Y6IA 2HPIA 1AKHB 1F5TA 2EILH 2AHQA 1IN5A 3E0JB 1VQ8I 4CHUA 1HOMA 1SVMA 2DQRA 3JAMZ 4WF2A 4YG2F 1VZ0A 5D8LB 3KP4A 3I64A 4C2MJ 1YHQI 2QBYB 5A2QZ 2GOMA 2X1EA 3OSFA 4IRHA 5D5WB 4M6VA 1SD5A 2EZLA 5B3SH 3T5XA 1X3WB 4MNUA 3SHFA 4HF0A 3PUBA 4CYCA 2JSPA 2J5OA 5BPIA 5E1ZB 2WWYA 3JTGA 4WK8F 3CC2I 4HSTA 5FKNA 3DTKA 2JVHA 2H8RA 3HL2A 2H1KA 4NB5A 3U21A 4AIHA 3M9AA 1DGWY 1YOVB 4NQWB 3V8LA 5CVJA 4IKFA 1MBKA 5BQTA 3IH3A 1WHUA 3QYFA 3DLAA 1SVLA 3CC4I 2DFEA 4UB8C 3F8NA 4J00A 1T0FC 2DK8A 2H6BA 3IV5A 2WA0A 2DOFA 2LRDA 2F5CA 1O57A 4AIDA 3HOTA 2R7VA 1M1EB 4PJ0C 2E1OA 5E3OA 3LWFA 2JA8J 3FKIJ 3E6MA 4UY8I 2ZFWA 3OV8A 2PMZN 2IVMA 2WADA 2CH0A 2Y0SN 5KK1A 1X1BA 5CVUA 1FTTA 3KP3A 4QIWN 1F4KA 2VJIA 2YX7A 2KZVA 3REOA 4C3IJ 3E3VA 2AXTC 4HNUA 5C4JJ 3LAJA 2P5KA 3CUQC 2GIZA 1YLFA 2NVQJ 3SEZA 1ZK8A 3H35A 2DAOA 1VQLI 4ESJA 4Q48A 1KU3A 3KYDB 4OOIA 3WTTC 3MFKA 3GTJJ 2LKXA 1ZLKA 3ECHA 3H3ZA 2DT5A 4EGZA 3JSOA 4UV8A 4UVCA 1O3SA 3G1MA 1XDUA 3M7GA 3ZN0A 4GXOA 2EQRA 4CSWA 4DBQA 4ZH4F 1JI8A 3R60A 4FHTA 4I0AA 4BEHB 4B3XA 1F43A 3O8HA 2ZNZA 1PYVA 5E3NA 5GAEJ 2R7UA 2LC2A 3A01A 2CUZA 2Y75A 2M30A 3FMQA 3Q5FA 4WXCA 3IAM2 3DEEA 2Q2EB 4JX5A 4BS9A 2GBYA 4LOCA 3F72A 3GFIA 1MJ9A 2P5LC 3ZMTA 2XHKA 1LB2A 4EM2A 4C2UA 4F91B 2WV0A 5LFAA 3QODA 2ME0A 5CVVA 4FX4A 4HF1A 1A31A 5EGOA 2LKSA 2K3FA 2OQGA 4I0BA 4FASD 4A12A 2VT2A 3MD2A 3O3KA 3JRIA 1REPC 3F6VA 3KP5A 4GYIA 3CP2A 1FMWA 1NK2P 3H5NA 3J7AY 1YS7A 2Z9OA 5EDNA 2NVUB 4C3HJ 1P6RA 3W2AA 2DT7B 1I6XA 2TDXA 3V42A 4PJLA 3F22A 3B02A 2R5YB 2IP2A 2M4GA 3HOUJ 3CF5F 1MMAA 2Z99A 4UXNA 2ZFUA 1ZREA 4XLPF 4Q5SF 4Q47A 4AYBA 1I1GA 2VQHA 1UHMA 4XLCA 1YFHA 2KPMA 1MBJA 2O03A 4G9YA 2HVRA 4OIOF 4RBOA 4OIPF 1ZGAA 4B4CA 2IA2A 2MG4A 2VASA 1RKTA 4LK0F 2K7LA 1MMDA 3KPHA 3D5RC 2VQCA 4J19A 4CGZA 2I10A 2ZB9A 2O8XA 1A5JA 2K9QA 3HIFA 1B4AA 1YQAA 4A2UA 4RLQA 2NRAC 3ZQ7A 1W1WE 5J4VA 5FFXA 3Q0WA 1K83J 1GUUA 3RDIA 2VONA 3BPVA 3S2DJ 4LB6B 1YW7A 2STTA 2CQKA 1U5TA 2V6EA 1ERDA 2HI3A 2R5ZB 1PJRA 2Z16A 4OMZA 5A2QK 3I5UA 3K6GA 3V8JA 2OV7A 2MFZA 3Q9SA 2OJED 3SXYA 1V55H 2E7WA 2QSGX 3LA7A 2RGVA 3ZQGA 3OYKA 2G7HA 3ZQQA 4A3JJ 2VBWA 1RRJA 3HOWJ 2ZC2A 4EJUA 1J5YA 2EZKA 3ZQHA 4GRIA 2NVYJ 2VQLA 3DBLB 2UUZA 3BOQA 3KZZA 1STZA 4GCVA 4C3JJ 4WX9A 4PJJA 5IYDJ 4RGXA 3SDBA 1TQPA 1SD7A 2HVQA 5DEQA 4LG0A 2X85A 2IGMA 3K4KA 4XRFA 2B0LA 3KX2A 1D8KA 2L54A 2W1OA 1J0RA 2ESHA 2ZXHA 1T39A 1F36A 1U9NA 4N0BA 2CGPA 2EV0A 3AG2H 2Q0OA 2R7RA 2Y9YA 1YTYA 2MYSA 2X51A 2YS9A 4DBRA 3H5RA 3I3LA 5K1YA 2TRTA 2CQXA 1XGMA 2KIFA 1VQ9I 5LEKA 4KUMA 3I0TA 1PP8F 1DGRM 3ONQA 1A6QA 2DJNA 4IO9F 3QWLA 3U1DA 2P0WA 3ZMVA 4S04A 1QVTA 1OJLA 4B8XA 3H0DA 4HX4A 4I76A 2MLKA 4AU7A 3C2HA 2L7MP 2BHZA 3ECOA 4OU0A 4RS8A 1S6LA 4BYYA 4E70A 4YRVA 2XC7A 2L9SA 4HDUA 3W2VA 2VC0A 5CVRA 3OOUA 1JUPA 3VYUB 2VODA 5F27A 1GXPA 1G4DA 1OCZH 2F48A 2ZO4A 1XGNA 1FWZA 3AFHA 3PIOF 2FBHA 4KIFA 4IL6C 1YI2I 3D5SC 3GBGA 2FU4A 1IRFA 5TRDA 1WWXA 2VKEA 3MZ8A 3BPXA 3ZN1A 4E7ZA 2DFFA 2VOOA 2VN2A 3E6CC 1QRYA 2A5YB 2KRFA 3LSKA 3HKZN 4RDUA 5LGUA 1JXSA 2E1CA 1OCCH 2FUG2 4TV7A 3T8RA 1L3LA 3LSHA 1DQUA 1U9OA 3L7WA 5DUIA 1JKOC 2LY9A 5FJ8J 2ZSHB 2HDWA 1R23A 2L02A 5L3GA 3OIPA 2JSCA 2V9KA 1ZRDA 5FRMA 3PSFA 5KNLA 5E8IA 1FYMA 3G4SI 5HDKA 1KQ9A 4O6JA 1T33A 1VF9A 2CQNA 2FXAA 3DBHB 3WTVC 2QQ9A 1TWAJ 2HWVA 2EV5A 4HZFA 4CUGA 2O5RA 4ZC3A 4BJ6C 5C44J 3IUOA 2IPQX 3CLQA 4XN3A 3UKGA 1D5VA 5ILUA 3TDUC 2V7FA 5IYCJ 4E4HA 2MBFA 2QWWA 3A1YA 1Y0UA 3RZOJ 2CUFA 2E19A 4CXFA 2OBPA 2EV6A 3CQZJ 2HXOA 2MABA 5F6FA 3G3ZA 2LNBA 3WODF 1MSFC 2NAZA 1F9NA 2V9VA 3Q0UA 1LFBA 5IY5H 5DTDA 3BTIA 1QO0D 3RTRA 3LOCA 4M72A 2NNNA 1MKMA 2FBKA 2WTEA 1Z3XA 4XONA 1V4RA 3K4NA 3OS1A 1QU3A 1ENHA 3GW2A 2QUFA 2L9NA 1PDNC 5HS8A 4EGYA 2XB5A 3PJRA 1ZGWA 4HYEA 2L4MA 1TC3C 1KU2A 1BOBA 5E8GA 1IJWC 1SMTA 2HZDA 4IOAF 4IXAA 2VOPA 3RYRA 5HOOA 4NNJA 3QOEA 4EJWA 1XMAA 4IHVA 3S17J 3B73A 2Z33A 2D1VA 3DWLE 1I6HJ 5J8FA 5DD8A 5K7FA 2M0CA 1W36C 1N75A 2QKLB 4BXUA 3RQ4A 3H5AA 3LSIA 3GO5A 2DPUA 2VUMJ 1TWCJ 5D4SA 4U0WA 2K9SA 2HDDA 2OZUA 5GAHJ 4F55A 1XC5A 5F64A 3BROA 3BR5A 4D0PA 4D5FA 2R4GA 1HLVA 3RKWA 1WI9A 2FNAA 1FYKA 2DOEA 3A0BC 4S05A 3KETA 1YS6A 3O8GA 2DA2A 2E1MC 1IDZA 1MZBA 1Z67A 3KIOA 2GLOA 1GVDA 3KP2A 5E18F 2X6YA 1QGPA 3GUDA 2KKOA 1TWHJ 3VDXA 1MDMB 3GZNB 2JRMA 2QEXI 2DDBA 5HVQC 2PG4A 1GV2A 2CYYA 3U1KA 4L5EA 5BS6A 2XGDA 1E3OC 2F4IA 3CTAA 3QU6A 4KT6A 1R22A 3FHNA 4CO8A 4GDFA 5JR3A 3CMAI 5EEGA 1OCOH 3DFGA 3KEOA 4A3DJ 3FXMA 2LBFB 2R7XA 2MA3A 2IS1A 3MAJA 1FSHA 1EV7A 1MNEA 4BJTA 3SYTA 1P7IA 4IZZA 2IS2A 5ERIA 2ZMEA 2DT6A 1ORKA 4IQJA 3MQ0A 3FXOA 1P4AA 4ENJA 3K1MA 3F21A 5FLVA 1S72I 2EBIA 1UHSA 4I98B 1TNSA 3KZIC 5K5RA 2VLAA 3FXJA 4IHSA 2PJPA 4LJZF 1E2XA 4F3QA 5HLGA 2ISYA 2JVGA 4AVZA 3FK7A 4BY1J 2LREA 3LFUA 1ZR2A 1EA3A 3Q0VA 5JI6A 2QQ8A 4EEFG 2LYCA 1USTA 2RC4A 4DW6A 3S1QJ 5HLHA 1KGSA 3F8FA 1BI0A 2TCTA 2DPDA 1KYZA 2WAEA 1B59A 4LGWA 3T8TA 3TGNA 1MJBA 2LY1A 3B6AA 3DPTA 4EQQA 2A3SA 5F1JA 1Y1WJ 2EZIA 3DXJF 1JUMA 2M9HA 3OS2A 3BJAA 4U7DA 1IV8A 1MBHA 5DUKA 1Z9CA 2Q1ZB 2E1NA 1Z77A 5ILSA 2ELKA 1Z7LA 3HRSA 3P7NA 4E7LA 1OLTA 3MZYA 1K4TA 2OZ6A 2M7AA 3BG5A 3C2BA 3I59A 4BL0B 1R5HA 1FIPA 4KJZA 4V2FA 4BE0A 4RB1A 2K3PA 1KQ8A 3CMEI 4WCGA 3GTOJ 1W7PA 4F52A 1Q1VA 1KONA 2KJCA 2NVXJ 3GTMJ 2BVMA 3I53A 1R4NB 4N4NB 3GTPJ 1XMKA 2NYXA 1MBEA 3CJQB 3S93A 3FM5A 3H9GA 1A36A 2PMZA 2FQ4A 4XRSG 1JJ6C 2Y0SA 3GFJA 2V1DA 2WB1N 1MNDA 3HPGA 3J7YJ 1B72A 2ZXIA 3SZTA 1FBUA 5DM6F 3KYLA 2EJRA 3CESA 1ZQ3P 2KDOA 2KIMA 2A6EF 3VWBA 2NXNB 4MHGA 4JX4A 2CQQA 3HOZJ 1FBSA 4B3AA 4YFXF 3TDZC 1K79A 2H27A 1ZN2A 3P9IA 4BQQA 1EH7A 4IRGA 2EZHA 1W4MA 3CCRI 2KQRA 2ID3A 4C30A 3HG9A 3KYCB 1QBJA 1HKTA 3SDGA 1OFCX 2DJIA 2DA6A 2XGXA 4NC6A 5LEJA 2M45A 1YX3A 3BG6A 3HUGB 1PUFA 2XKPA 3BTJA 1LVKA 4BDZA 1Z21A 1CGPA 2KIQA 2AQFA 2FOWA 3MKZA 2UV1A 4LLNA 1Z0XA 5IT9Z 1IN4A 1U0JA 3FK6A 4MTDA 5ICFA 4LD5A 2ZJPF 2Z1DA 1IZ1A 1BI1A 2QKMB 1YRNA 3SJMA 2K4BA 3M3YJ 1SC7A 3I4MJ 4O5VA 1NHAA 4PDKA 2P4WA 3LL7A 2KFDA 1UHWA 3GLLA 2LSOA 4FETA 3TW7A 4CA0A 1QA6A 4P96A 2XAFA 1I1SA 1P9QC 2K40A 3OIQA 3VB2A 2CS3A 4BACA 1S8NA 2EA2A 3G1OA 3OR1C 4DOZA 1RIOH 3J7AO 3P9CA 3CJTB 3GZ5A 4BJ5C 2GM4A 4HEA2 2IT0A 3NARA 1VQMI 3QYBA 4HNVA 4M71A 3JRGA 5LRRA 1R1VA 1L0OC 3S15J 1MH3A 3ABTA 3DEWA 1CF7B 1MBGA 2YU3A 4XLEA 2WAQN 3AL0C 3CMMA 4V2GA 2MC3A 1G3YA 2CW8A 3FHZA 1ULYA 1X1DA 1IUFA 1DP7P 1I3QJ 1W5TA 1X4PA 3BC8A 3FKJA 1K78A 2IAIA 1WJDA 2XKOA 2Y69H 4BDYA 3K2AA 3K4LA 4F92B 2R7OA 3NWSA 4DJAA 3C1DA 3F8CA 2L7ZA 1VTNC 2CWEA 4JK1X 3HRUA 3AG1H 3ZR8X 4U7BA 1IG7A 1IW7F 4XR6A 3LQRA 3R6SA 3QU3A 5B1BH 2F5EA 2JA2A 2V1XA 1S7EA 2K02A 3WGIA 4XLNF 2LFBA 2E34A 2GA2A 3MKYB 4CCLA 5CVIA 4YIFA 1BI3A 3RKYA 3UR3C 3ZMZA 2FSWA 2EIMH 2O3FA 3BTCA 4AD9A 2LY2A 5DCMA 2ECCA 3BQYA 4ZTJA 4PFPA 5F04A 3BZKA 1IO2A 5IP7J 3GTGJ 5GP9A 1V5EA 3F8BA 2CU7A 3CJRB 2L9RA 1B8IA 3CO7C 3I54A 4M9XA 4BHBA 4HNTA 2KT0A 1BW6A 1HSJA 2VKHA 3BG9A 2LR8A 1LEAA 3FMSA 4DIQA 1BIAA 4RAGA 2V1UA 4Y33A 5D6EA 1JTYA 1WVRA 4PJNA 4NC8A 1JHFA 3FISA 1ETKA 4KITB 2E1MB 2KMUA 2LKPA 3EQLF 4OAZA 1BC7C 4JYKA 3OYJA 2XIGA 5CLSA 2O0YA 2VBZA 4I99C 1SAUA 4MQ9F 1AWCA 3J81Z 4DGWB 3CDHA 4A3BJ 4D5CA 2X4HA 3ZQCA 2O7OA 3HOYJ 2VI6A 3AG4H 4A3GJ 1X3UA 3N4MA 2FD5A 5LLQA 4RM3A 2W85A 3A03A 4PGHA 5LD2C 5HNFA 1S7OA 2CW0F 1YJWI 2PJRB 4QSHA 1ZGJA 1GV5A 1Y56A 1SMYF 3VYRB 5BMZA 2ZJ2A 1LDKB 2IA0A 5JFRA 2R7QA 4DYCA 1ZG5A 5E3MA 2CMPA 5L3DA 2L2OA 4A0XA 3HOSA 2GZWA 3QPTA 2KRCA 4Y7NJ 1RKWA 2P6SA 4DYQA 2O61A 2GIVA 4BY7J 5DDGA 4E7HA 3MWMA 1H9GA 4XL9A 2JA7J 4WXDA 2Y9ZA 1MMGA 4A6DA 5H6QA 4JBAA 1FOYA 3LSPA 2B7EA 4RMNA 3C2GA 3L2VA 1Y8RB 2GAUA 2QQBA 2OTLI 3HKZA 3RPQA 5IT9K 2NVTJ 4ZDOA 1HW5A 3HTUA 2RNJA 4M9ZA 1IUYA 2AQEA 1I27A 3DTEA 1JKRC 1X1CA 3WHBA 2XF7A 4Z2YA 4EVIA 2W57A 2K4JA 1E0EA 5F08A 5E1WA 4XM3A 1P4XA 1ZYRF 1XSXA 2M3AA 1RC9A 3SFZA 1W7PD 4II3A 4XN0A 1QHGA 1TQMA 1P92A 2X9DA 3OMYA 3S1RJ 3V8KA 2OPTA 2DA3A 4D7MA 3ELKA 4ESFA 4BHCA 2PEXA 1LPQA 3R0AA 1X58A 4G94A 2DA1A 2H09A 1TLHB 5H2FC 5K5OA 1B6AA 3GZ6A 1UAAA 3QPHA 3WTYC 3MN2A 1SANA 2GOXB 3T0YA 2EFOA 1S5LC 3VODA 3DPUA 1VI0A 1VQKI 1O7LA 3EYYA 1FNNA 2PBIA 3TO6A 1SAXA 2XRLA 3M07A 4FX0A 4BE2A 2FJ1A 1BJZA 1UZCA 2FOKA 2DBBA 2HXIA 2VJJA 2H6CA 3TBIA 3WGGA 4A3FJ 2DODA 1APLC 4RGRA 1U8BA 2M0MA 2BY3A 4FE4A 1GDTA 3G71I 2K86A 3K10A 3KFWX 3TP3A 5B5EC 2EWNA 3R4KA 1HXDA 4G8XA 3HC7A 3OYBA 4RGSA 2I5UA 3E5UA 1MMSA 3C7JA 4XBFA 3BCBA 1GHCA 1BR1A 1XSVA 5JLWA 3DV8A 1W5CC 3Q3SA 3VYSB 3CDIA 3KCCA 3FM3A 2QVOA 3CZ6A 4IOCF 2OTJI 1G3TA 4QPOA 2X6OA 2X1CA 2ADUA 1OPCA 3H36A 2R93J 4UNOA 3L2CA 4JOMA 5EG0B 2E71A 3PQKA 2EA4A 4EJVA 5LGNA 4A5MA 2R7FA 4J01A 2L7FP 3TL4X 2XSDC 1U2WA 4UUSA 2O8KA 2IGOA 1TP4A 1IDYA 4PUSA 3TKYA 1ZTRA 1X4OA 4IQ4A 1FTZA 3B6CA 3K4JA 4L0YB 2D1HA 1IRZA 2BOLA 3BZCA 4HOBA 2VPRA 2E5ZA 2ZJQF 3CUOA 4ABZA 3DU6A 4H0EA 4BBSJ 2DTZA 1SFXA 2M34A 4OINF 1IN7A 4XQFA 4BUPA 2FQ3A 1O4XA 3BP8A 2DU9A 2HOAA 3IAS2 4N9HA 1TWGJ 1G2HA 3OOPA 2HEOA 2IS6A 2L3DA 1HCRA 1HBXG 2KL4A 4UHTA 1QQIA 2LF8A 1FEXA 1RR8C 4MLOA 4XMYA 3MKLA 1HSTA 1QZYA 1OCTC 1DUXC 3MCZA 3DF8A 2AS5F 1FOKA 3J81K 1GVJA 1AKHA 4CH7A 4BXFA 2QZ8A 4M9SA 1TWFJ 2ETHA 3G73A 4KDPA 2LLKA 3ZGKA 2E7XA 3JRBA 3AL0B 3MEXA 4I7HA 2RAEA 5DV5A 2VBYA 2HKXA 3GWZA 1BOAA 1KYWA 4BAYA 2QBYA 3RJPA 4XIDA 2YX4A 4RLFA 2MD5A 3WTZA 3G6EI 2A07F 1X2NA 1QHHD 5J3LA 1T56A 1TQIA 5K7HA 3DKYA 3FXKA 1MW7A 4XOTA 4ASNA 2KHMA 2M8GX 3ULQB 1R5GA
chains in the Genus database with same CATH topology
1IAWA 1OMIA 1YG2A 1ZRCA 5L3BA 3WTXC 1R58A 4G7HF 4NQWA 4DNCA 3FXUA 5CYVA 3IL2A 5ICCA 2FRHA 2DI3A 1U5TC 2XAQA 3RYPA 5D5VB 3ML6A 2XRNA 4KMFA 2GWRA 3IHUA 5E17F 5BOXA 3KZYA 3W6KB 5EEHA 1ZG3A 2ZBKA 3VEPA 4IF4A 3ABUA 4Y13A 5K5QA 2EK5A 3PQJA 4EM1A 4KN4X 3E5XA 4L18B 3BZ6A 1ON2A 2EFQA 4RAZA 1WQ2A 3EYIA 1PUEE 4M6YA 1FZPB 4EJTA 1E17A 2HTSA 4Q4ZF 1USSA 4ESBA 2OQRA 4HX8A 2Z5UA 3CUQB 4R79A 2UZKA 1TW2A 2DLLA 2YSRA 3BWGA 1IN6A 1FSEA 2BE5F 4RB2C 3WU1B 1BM9A 2Q2EA 1MJAA 1U78A 5FGMA 5FD6A 1FP1D 1J7KA 2JTVA 2FEZA 3K1NA 5HS9A 3U9GA 5JVTA 4P55A 5FD5A 3F23A 2M5WA 2K27A 1U8RA 1UFMA 2PMUA 1YO5C 4A0ZA 4L5IA 3SQNA 3HYIA 1R1UA 4NHJA 4F7ZA 4I01A 1T98A 4G6DA 3QP5A 4R1HA 2J5PA 2IJLA 3ZMDA 3FZVA 1XSDA 1GXQA 3MZHA 2PMHA 4LLGF 5ICEA 1S3JA 1D3YA 3E6DA 4N9IA 2YPRA 2VT3A 1G3SA 4ETSA 3WTWC 3KP7A 2FBIA 3TOBA 4A5NA 4KA4A 1YW9A 6PAXA 4A6EA 1J2XA 3FX3A 1F1ZA 1G6NA 4G7OF 2D45A 2RDPA 2BEOA 3NEUA 3FF5A 2A69F 4MEYF 1FLIA 1B9NA 4RAYA 1ZLJA 2Z3YA 2XROA 4U0YA 1HW1A 1K6OA 2EFNA 4LFUA 3M8EA 2RN7A 1ON1A 4RGUA 5DD4A 1UCRA 1Z6TA 1OR7A 4IVNA 4PCQA 1IRGA 1XCBA 3FMRA 3FXRA 1IXRC 4KNYA 2HDCA 1EH6A 4LB5A 3HSRA 2L4AA 3L9FA 5BPDA 2STWA 1RNLA 5LHGA 1P2FA 4KN7X 2VBXA 1LDDA 3K69A 4WWCA 3E6BA 3O2PE 1LQ1A 2PN6A 3ROUA 1B1BA 4IRIA 2F5FA 4BNCA 1Z91A 1RUOA 1LNWA 4YFNF 1IXSB 4ZYGA 4ENMA 1ZHFA 2BV6A 2JT1A 1T6SA 1I5ZA 1LEBA 4LK1F 2UXXA 1O3TA 1SFUA 4EM0B 5D6FA 2DFIA 3GFLA 4LMYA 3JW4A 2RKHA 1S29A 3IC7A 2A61A 3IRQA 2W84A 1ZARA 3TO9A 3BY6A 3H3UA 3GEZA 1FP2A 2ZKZA 4U0VA 5L3FA 3FWEA 1U5TB 3VOEA 5FO5A 3BJOA 3WE3A 2XUBA 1V3FA 2QYOA 2VE8A 2P5VA 3F3XA 2OU2A 3EETA 2JPCA 2M8EA 3R61A 4HA8A 3V7CA 1LDJA 2HTJA 1BJAA 2GA1A 3IWFA 4LG0B 2XVCA 1KA8A 4OMYA 2BGCA 2H94A 1MGTA 3JTHA 4DQ2A 2BBYA 4MTEA 4LLLA 2JZYA 3HHGA 3FXQA 4HQEA 4GYGA 3V7SA 4ENNA 1RUNA 2XAJA 1OKRA 1ZRFA 3TQNA 2QQAA 3ERED 1RI7A 2IRFG 4L9JA 1DPUA 4HV6A 3COAC 4KFCA 2ACJA 3K1PA 4Y15A 1R36A 3GF2A 5IT3A 4MGRA 4UVBA 3LFKA 3DKWA 4KICA 2PFBA 3ISPA 1MDMA 3WGHA 2HFHA 3LSTA 2HR3A 1UB9A 1BI2A 1R7JA 2IW5A 2A68F 1FBQA 3SZPA 2CG4A 3EUHA 1YYVA 2CFXA 3RPUA 3W6JB 5AIQA 3N97A 2PLYA 2QM3A 3I71A 5LRSA 1BC8C 3D5LA 3J80Z 1FPQA 5D5UB 3QRFF 2HKOA 1ZG1A 2HGCA 4L9VA 2KJBA 3KLOA 2MLGA 1HKQA 4U88A 4ZYEA 1Z05A 2MH9A 3WU0A 4B09A 2R3SA 4R8HA 2A6HF 2XAHA 2O6GE 4IJAA 4O3MA 1KU9A 2HYFA 1QNTA 2LDUA 4I09A 2G9WA 2RQPA 4ZZDA 3K9TA 3LQQA 3DQVC 4HV5A 1R1TA 1T2KA 3L00A 4L9NA 4HAMA 1KQ0A 4XSXF 2DK5A 4PGGA 2JRTA 3WE2A 3M8FA 1J59A 3HUGA 1XGSA 2ZNYA 3KP6A 2V6CA 2FA5A 4KMUX 1J9IA 3HTSB 5ILVA 4UUVA 3F6OA 3GXOA 1XCVA 1U6GA 4RB3C 1BBYA 3QP6A 4KIGA 2FF4A 4CDGA 4KT5C 2FNPA 2OA4A 2ZMEB 3JAMK 1EH8A 4IPAA 4UVAA 3R0JA 3IWZA 4I2OA 5AONA 3QOPA 2QLZA 1FX7A 4M74A 4KIBA 1CF7A 2HQRA 2Q8KA 1XN7A 2W24A 1IF1A 3LA3A 3HSFA 2V79A 3LA2A 2OAZA 4OIRF 3ZPLA 1PP7U 2CSOA 4OIQF 3HRTA 1P4WA 2W25A 4P9FA 1Z7UA 4HW0A 3VFZA 5D4RA 1IXCA 1RZ4A 2KIUA 2OD5A 2BYVE 3I59B 3J80K 3RKXA 2HZTA 1B9MA 2P7CB 1W7PB 4CZZA 4ZYDA 1H9TA 3KLNA 2RV8A 3P9KA 3IKTA 5LBQA 2R7DA 1JGSA 1T38A 1AOYA 2P8TA 3GX4X 5ICGA 1O7FA 3F8MA 2VC1A 3BDDA 4P9UA 1JHHA 3GVAA 3H92A 2EB7A 4M6XA 3WTUC 1S7AA 4GGGA 2M1BA 1TTYA 2JPBA 4PZJA 3LAPA 3T1BA 2FMYA 5F1RA 4UV9A 5CJ9A 4HDVA 4BH9A 1TNTA 2M87A 2NNYA 4MQVA 1OYIA 2PI0A 5HDGA 1KU7A 3HHHA 3QAHA 1QPMA 5LHHA 4XSZF 2UWMA 2GXGA 3EDPA 5FB2A 4L5JA 2P6TA 2Y0MA 4ON0A 1YIOA 2C6YA 4K2EA 2LF7A 1A04A 5H20A 4L0ZB 1C0WA 3ZMUA 5E20A 4EJOA 3DP7A 1K78B 3AAFA 5D8KB 4EV0A 4HF2A 1ODDA 3WG9A 2D2WA 3V7RA 3O6BB 2DW4A 1Q1HA 4JQFA 2F2EA 2XV4S 3HSEA 4YFKF 4AIJA 3Q9VA 1SD4A 1QZZA 2EFPA 4AVPA 5DCMB 3CO6C 3C18A 1O3QA 5DCFA 1ONVA 3KE2A 3L09A 5FLXZ 3K2ZA 2ISZA 4QWQA 4AWXB 3M1EA 3D0SA 1O3RA 3C3WA 1LVAA 1BN5A 1U3EM 1BIBA 4CYDA 5ED4A 4BHPA 1FC3A 1FY7A 1XD7A 2HYGD 5FFZA 2WC2A 5LGTA 1FT9A 2ZCWA 1Z1DA 2ELHA 2AXLA 2XAGA 1G3WA 1D8JA 2VXZA 1TW3A 3HRMA 2RVCA 4RB0A 2ESNA 5HDNA 3PFIA 4Y17A 2G7UA 4EMSA 5L3CA 1DPRA 1WKMA 4MEXF 4ZYHA 3NRVA 5J6XA 3CJNA 1OYYA 2X0LA 3E97A 1HQCA 2PQ8A 5AIPA 1XGOA 1MD0A 5TJJA 1R00A 2DO7A 2HQNA 3I58A 3TOAA 4KYWA 1HKSA 1IN8A 2VE9A 2HS5A 2UXNA 2IA1A 5HS7A 1WSUA 1J75A 4HX7A 3I4PA 4ENKA 4IHTA 4AIKA 1Z6RA 1LJ9A 1JE8A 1ZH5A 1SD6A 4YIIA 2L01A 4P5OA 2DQLA 4WXHA 3BJ6A 3S2WA 2COMA 4A0YA 5HLIA 3GFMA 5L3EA 3DPLC 3NQOA 3U2RA 2FE3A 4G6QA 3GLXA 3ZMSA 1XB4A 2FMLA 4HLXA 3JSPA 1XDSA 4HBLA 3K0LA 3RIRA 3V4GA 1TBXA 2ZXJA 1OYWA 3GYHX 1T0FA 4ZZLA 3WTSC 1HW2A 4FT8A 1WRJA 4HQMA 4GO1A 3CLOA 3E5QA 4L9TA 4I02A 2YR2A 2DTRA 5D5XB 5E1XA 3IRRA 5FLXK 2GQQA 1FYLA 2GXBA 5H6RA 2CO5A 5KVRA 3CUQA 3DEUA 5JHUA 1K7AA 2HOEA 3IKVA 1ZAOA 4G7ZF 2NS0A 2P7VB 3ZP5A 5DYMA 4CICA 5J8CA 4HLYA 1DDNA 1H0MA 2QENA 4QLCU 5LHIA 3TO7A 1W5SA 2XASA 4BQAA 4M73A 1SFEA 2MH2A 2F5DA 2Y48A 2EFWA 1YW8A 3RI4A 3KEQA 1F5TA 1IN5A 4CHUA 2DQRA 3JAMZ 4WF2A 4YG2F 5D8LB 3KP4A 3I64A 2QBYB 5A2QZ 4IRHA 5D5WB 1SD5A 3T5XA 4MNUA 3SHFA 4HF0A 2J5OA 5BPIA 5E1ZB 2WWYA 3JTGA 4WK8F 4NB5A 4AIHA 3M9AA 3V8LA 5CVJA 5BQTA 3F8NA 2DK8A 2H6BA 2F5CA 1O57A 3HOTA 3LWFA 3E6MA 2ZFWA 3OV8A 2IVMA 5KK1A 5CVUA 3KP3A 1F4KA 2YX7A 3REOA 3E3VA 3LAJA 2P5KA 3CUQC 1YLFA 2DAOA 4ESJA 4Q48A 1KU3A 3WTTC 4OOIA 3MFKA 1ZLKA 3ECHA 3H3ZA 2DT5A 4EGZA 3JSOA 4UV8A 4UVCA 1O3SA 1XDUA 3M7GA 3ZN0A 4GXOA 4ZH4F 3R60A 4FHTA 4I0AA 2ZNZA 2Y75A 2M30A 3FMQA 3Q5FA 4WXCA 3F72A 3GFIA 1MJ9A 2P5LC 3ZMTA 2XHKA 1LB2A 4EM2A 2WV0A 5CVVA 4FX4A 4HF1A 2OQGA 4I0BA 4A12A 2VT2A 3O3KA 1REPC 3F6VA 3KP5A 4GYIA 1YS7A 2Z9OA 1P6RA 1I6XA 2TDXA 3F22A 3B02A 2IP2A 2Z99A 1ZREA 4UXNA 4Q5SF 4XLPF 4Q47A 1I1GA 1UHMA 1YFHA 2O03A 4OIOF 4G9YA 4OIPF 1ZGAA 2IA2A 4LK0F 2K7LA 4CGZA 2O8XA 3HIFA 1B4AA 1YQAA 4A2UA 2NRAC 3ZQ7A 5FFXA 3RDIA 2VONA 3BPVA 4LB6B 1YW7A 2STTA 2CQKA 1U5TA 4OMZA 5A2QK 3I5UA 3V8JA 3Q9SA 3SXYA 2E7WA 3LA7A 2RGVA 2G7HA 2VBWA 4EJUA 1J5YA 3BOQA 3KZZA 1STZA 4GCVA 4WX9A 4RGXA 1TQPA 1SD7A 5DEQA 4LG0A 4XRFA 2B0LA 1D8KA 2L54A 1J0RA 2ESHA 1T39A 4N0BA 2CGPA 2EV0A 2Q0OA 1YTYA 5K1YA 1XGMA 2KIFA 5LEKA 4KUMA 3I0TA 1PP8F 3U1DA 3ZMVA 4S04A 4B8XA 4HX4A 2MLKA 3ECOA 4OU0A 4RS8A 4E70A 4HDUA 1S6LA 4BYYA 2VC0A 5CVRA 2VODA 1GXPA 1G4DA 2ZO4A 1XGNA 1FWZA 2FBHA 4KIFA 2FU4A 1IRFA 5TRDA 1WWXA 3ZN1A 3BPXA 2VOOA 2VN2A 3E6CC 2A5YB 2KRFA 5LGUA 1JXSA 2E1CA 4TV7A 3T8RA 1L3LA 3L7WA 5DUIA 1R23A 2L02A 5L3GA 2JSCA 1ZRDA 1FYMA 5E8IA 5HDKA 1KQ9A 4O6JA 2FXAA 3WTVC 2QQ9A 2HWVA 2EV5A 4HZFA 2IPQX 1D5VA 5ILUA 3TDUC 2MBFA 2QWWA 1Y0UA 4CXFA 2OBPA 2EV6A 5F6FA 3G3ZA 2LNBA 3WODF 2NAZA 1F9NA 2V9VA 1QO0D 3RTRA 4M72A 2NNNA 1MKMA 2FBKA 2WTEA 1V4RA 3GW2A 2QUFA 1PDNC 5HS8A 4EGYA 4HYEA 2L4MA 1KU2A 5E8GA 1SMTA 2VOPA 4IXAA 3RYRA 5HOOA 4EJWA 1XMAA 3B73A 2Z33A 2D1VA 5J8FA 5DD8A 4BXUA 3GO5A 2DPUA 5D4SA 4U0WA 2OZUA 5F64A 3BROA 4D0PA 3RKWA 1WI9A 2FNAA 1FYKA 4S05A 3KETA 1YS6A 1MZBA 3KP2A 5E18F 1QGPA 3GUDA 2KKOA 1MDMB 5HVQC 2PG4A 2CYYA 5BS6A 3CTAA 3QU6A 1R22A 4CO8A 5JR3A 5EEGA 3DFGA 3KEOA 2MA3A 3MAJA 1FSHA 1EV7A 5ERIA 2ZMEA 3MQ0A 4ENJA 1P4AA 3K1MA 3F21A 4I98B 1TNSA 5K5RA 2PJPA 4IHSA 4LJZF 1E2XA 5HLGA 2ISYA 5JI6A 1USTA 2RC4A 5HLHA 1KGSA 3F8FA 1BI0A 2DPDA 1KYZA 1B59A 4LGWA 3T8TA 3TGNA 1MJBA 3DPTA 4EQQA 2A3SA 3DXJF 3BJAA 4U7DA 5DUKA 1Z9CA 2E1NA 5ILSA 3HRSA 3P7NA 3MZYA 2OZ6A 3I59A 1R5HA 4RB1A 1KQ8A 4WCGA 1W7PA 2KJCA 3I53A 1XMKA 2NYXA 3FM5A 3GFJA 2V1DA 3SZTA 1FBUA 2EJRA 2KIMA 2A6EF 4MHGA 1FBSA 4YFXF 2H27A 3TDZC 1K79A 1ZN2A 3P9IA 1EH7A 4IRGA 1W4MA 1QBJA 1HKTA 2XGXA 5LEJA 2M45A 2XKPA 1CGPA 4LLNA 5IT9Z 1IN4A 4MTDA 5ICFA 4LD5A 1IZ1A 1BI1A 2K4BA 4O5VA 1NHAA 4PDKA 2P4WA 1UHWA 2LSOA 4P96A 2XAFA 1I1SA 3VB2A 1S8NA 2EA2A 1RIOH 3J7AO 3P9CA 3GZ5A 2IT0A 4M71A 5LRRA 1R1VA 1L0OC 3ABTA 1CF7B 2YU3A 2MC3A 1G3YA 3FHZA 1ULYA 1DP7P 1W5TA 1K78A 2XKOA 3C1DA 3F8CA 1VTNC 2CWEA 4JK1X 3HRUA 4U7BA 1IW7F 3LQRA 3R6SA 3QU3A 2F5EA 2V1XA 2K02A 3WGIA 4XLNF 2GA2A 4YIFA 5CVIA 1BI3A 3RKYA 3ZMZA 2FSWA 2O3FA 4AD9A 5DCMA 3F8BA 3CO7C 3I54A 4M9XA 4BHBA 1HSJA 1LEAA 3FMSA 1BIAA 2V1UA 5D6EA 1JHFA 2LKPA 3EQLF 1BC7C 2XIGA 5CLSA 2O0YA 2VBZA 4MQ9F 1AWCA 3J81Z 3CDHA 2X4HA 1X3UA 3N4MA 5LLQA 2W85A 4PGHA 1S7OA 2CW0F 1ZGJA 1SMYF 5BMZA 2ZJ2A 1LDKB 2IA0A 5JFRA 1ZG5A 5L3DA 4A0XA 3HOSA 2GZWA 3QPTA 2P6SA 2O61A 2GIVA 5DDGA 3MWMA 1H9GA 4WXDA 4A6DA 5H6QA 4JBAA 2GAUA 2QQBA 5IT9K 3RPQA 1HW5A 3HTUA 2RNJA 4M9ZA 1IUYA 1I27A 4Z2YA 4EVIA 2W57A 2K4JA 5E1WA 1P4XA 1ZYRF 1XSXA 3SFZA 1W7PD 1TQMA 1P92A 3V8KA 3ELKA 4ESFA 4BHCA 2PEXA 3R0AA 4G94A 2H09A 1TLHB 5K5OA 1B6AA 3GZ6A 3QPHA 3WTYC 3T0YA 2EFOA 3VODA 1O7LA 3EYYA 1FNNA 2PBIA 3TO6A 1SAXA 4FX0A 2FOKA 2DBBA 2H6CA 3WGGA 4RGRA 2K86A 3KFWX 2EWNA 3R4KA 1HXDA 4G8XA 4RGSA 3E5UA 3C7JA 4XBFA 1GHCA 1XSVA 3DV8A 3KCCA 3FM3A 2QVOA 1G3TA 2ADUA 1OPCA 4UNOA 3L2CA 4EJVA 5LGNA 2EA4A 3PQKA 4A5MA 2R7FA 1U2WA 3TKYA 4L0YB 2D1HA 4HOBA 3CUOA 4H0EA 1SFXA 4OINF 1IN7A 2FQ3A 3BP8A 2DU9A 4N9HA 3OOPA 2HEOA 2L3DA 1HBXG 4UHTA 1QQIA 2LF8A 1HSTA 1QZYA 1DUXC 3MCZA 3DF8A 2AS5F 1FOKA 3J81K 1GVJA 2QZ8A 4M9SA 2ETHA 3G73A 4KDPA 2E7XA 3MEXA 4I7HA 5DV5A 2VBYA 2HKXA 3GWZA 1BOAA 1KYWA 4BAYA 2QBYA 3RJPA 2YX4A 2MD5A 3WTZA 2A07F 1TQIA 4ASNA 3ULQB 1R5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IAW A;  1OMI A;  1YG2 A;  1ZRC A;  5L3B A;  3WTX C;  1R58 A;  4G7H F;  4NQW A;  4DNC A;  3FXU A;  5CYV A;  3IL2 A;  5ICC A;  2FRH A;  2DI3 A;  1U5T C;  2XAQ A;  3RYP A;  5D5V B;  3ML6 A;  2XRN A;  4KMF A;  2GWR A;  3IHU A;  5E17 F;  5BOX A;  3KZY A;  3W6K B;  5EEH A;  1ZG3 A;  2ZBK A;  3VEP A;  4IF4 A;  3ABU A;  4Y13 A;  5K5Q A;  2EK5 A;  3PQJ A;  4EM1 A;  4KN4 X;  3E5X A;  4L18 B;  3BZ6 A;  1ON2 A;  2EFQ A;  4RAZ A;  1WQ2 A;  3EYI A;  1PUE E;  4M6Y A;  1FZP B;  4EJT A;  1E17 A;  2HTS A;  4Q4Z F;  1USS A;  4ESB A;  2OQR A;  4HX8 A;  2Z5U A;  3CUQ B;  4R79 A;  2UZK A;  1TW2 A;  2DLL A;  2YSR A;  3BWG A;  1IN6 A;  1FSE A;  2BE5 F;  4RB2 C;  3WU1 B;  1BM9 A;  2Q2E A;  1MJA A;  1U78 A;  5FGM A;  5FD6 A;  1FP1 D;  1J7K A;  2JTV A;  2FEZ A;  3K1N A;  5HS9 A;  3U9G A;  5JVT A;  4P55 A;  5FD5 A;  3F23 A;  2M5W A;  2K27 A;  1U8R A;  1UFM A;  2PMU A;  1YO5 C;  4A0Z A;  4L5I A;  3SQN A;  3HYI A;  1R1U A;  4NHJ A;  4F7Z A;  4I01 A;  1T98 A;  4G6D A;  3QP5 A;  4R1H A;  2J5P A;  2IJL A;  3ZMD A;  3FZV A;  1XSD A;  1GXQ A;  3MZH A;  2PMH A;  4LLG F;  5ICE A;  1S3J A;  1D3Y A;  3E6D A;  4N9I A;  2YPR A;  2VT3 A;  1G3S A;  4ETS A;  3WTW C;  3KP7 A;  2FBI A;  3TOB A;  4A5N A;  4KA4 A;  1YW9 A;  6PAX A;  4A6E A;  1J2X A;  3FX3 A;  1F1Z A;  1G6N A;  4G7O F;  2D45 A;  2RDP A;  2BEO A;  3NEU A;  3FF5 A;  2A69 F;  4MEY F;  1FLI A;  1B9N A;  4RAY A;  1ZLJ A;  2Z3Y A;  2XRO A;  4U0Y A;  1HW1 A;  1K6O A;  2EFN A;  4LFU A;  3M8E A;  2RN7 A;  1ON1 A;  4RGU A;  5DD4 A;  1UCR A;  1Z6T A;  1OR7 A;  4IVN A;  4PCQ A;  1IRG A;  1XCB A;  3FMR A;  3FXR A;  1IXR C;  4KNY A;  2HDC A;  1EH6 A;  4LB5 A;  3HSR A;  2L4A A;  3L9F A;  5BPD A;  2STW A;  1RNL A;  5LHG A;  1P2F A;  4KN7 X;  2VBX A;  1LDD A;  3K69 A;  4WWC A;  3E6B A;  3O2P E;  1LQ1 A;  2PN6 A;  3ROU A;  1B1B A;  4IRI A;  2F5F A;  4BNC A;  1Z91 A;  1RUO A;  1LNW A;  4YFN F;  1IXS B;  4ZYG A;  4ENM A;  1ZHF A;  2BV6 A;  2JT1 A;  1T6S A;  1I5Z A;  1LEB A;  4LK1 F;  2UXX A;  1O3T A;  1SFU A;  4EM0 B;  5D6F A;  2DFI A;  3GFL A;  4LMY A;  3JW4 A;  2RKH A;  1S29 A;  3IC7 A;  2A61 A;  3IRQ A;  2W84 A;  1ZAR A;  3TO9 A;  3BY6 A;  3H3U A;  3GEZ A;  1FP2 A;  2ZKZ A;  4U0V A;  5L3F A;  3FWE A;  1U5T B;  3VOE A;  5FO5 A;  3BJO A;  3WE3 A;  2XUB A;  1V3F A;  2QYO A;  2VE8 A;  2P5V A;  3F3X A;  2OU2 A;  3EET A;  2JPC A;  2M8E A;  3R61 A;  4HA8 A;  3V7C A;  1LDJ A;  2HTJ A;  1BJA A;  2GA1 A;  3IWF A;  4LG0 B;  2XVC A;  1KA8 A;  4OMY A;  2BGC A;  2H94 A;  1MGT A;  3JTH A;  4DQ2 A;  2BBY A;  4MTE A;  4LLL A;  2JZY A;  3HHG A;  3FXQ A;  4HQE A;  4GYG A;  3V7S A;  4ENN A;  1RUN A;  2XAJ A;  1OKR A;  1ZRF A;  3TQN A;  2QQA A;  3ERE D;  1RI7 A;  2IRF G;  4L9J A;  1DPU A;  4HV6 A;  3COA C;  4KFC A;  2ACJ A;  3K1P A;  4Y15 A;  1R36 A;  3GF2 A;  5IT3 A;  4MGR A;  4UVB A;  3LFK A;  3DKW A;  4KIC A;  2PFB A;  3ISP A;  1MDM A;  3WGH A;  2HFH A;  3LST A;  2HR3 A;  1UB9 A;  1BI2 A;  1R7J A;  2IW5 A;  2A68 F;  1FBQ A;  3SZP A;  2CG4 A;  3EUH A;  1YYV A;  2CFX A;  3RPU A;  3W6J B;  5AIQ A;  3N97 A;  2PLY A;  2QM3 A;  3I71 A;  5LRS A;  1BC8 C;  3D5L A;  3J80 Z;  1FPQ A;  5D5U B;  3QRF F;  2HKO A;  1ZG1 A;  2HGC A;  4L9V A;  2KJB A;  3KLO A;  2MLG A;  1HKQ A;  4U88 A;  4ZYE A;  1Z05 A;  2MH9 A;  3WU0 A;  4B09 A;  2R3S A;  4R8H A;  2A6H F;  2XAH A;  2O6G E;  4IJA A;  4O3M A;  1KU9 A;  2HYF A;  1QNT A;  2LDU A;  4I09 A;  2G9W A;  2RQP A;  4ZZD A;  3K9T A;  3LQQ A;  3DQV C;  4HV5 A;  1R1T A;  1T2K A;  3L00 A;  4L9N A;  4HAM A;  1KQ0 A;  4XSX F;  2DK5 A;  4PGG A;  2JRT A;  3WE2 A;  3M8F A;  1J59 A;  3HUG A;  1XGS A;  2ZNY A;  3KP6 A;  2V6C A;  2FA5 A;  4KMU X;  1J9I A;  3HTS B;  5ILV A;  4UUV A;  3F6O A;  3GXO A;  1XCV A;  1U6G A;  4RB3 C;  1BBY A;  3QP6 A;  4KIG A;  2FF4 A;  4CDG A;  4KT5 C;  2FNP A;  2OA4 A;  2ZME B;  3JAM K;  1EH8 A;  4IPA A;  4UVA A;  3R0J A;  3IWZ A;  4I2O A;  5AON A;  3QOP A;  2QLZ A;  1FX7 A;  4M74 A;  4KIB A;  1CF7 A;  2HQR A;  2Q8K A;  1XN7 A;  2W24 A;  1IF1 A;  3LA3 A;  3HSF A;  2V79 A;  3LA2 A;  2OAZ A;  4OIR F;  3ZPL A;  1PP7 U;  2CSO A;  4OIQ F;  3HRT A;  1P4W A;  2W25 A;  4P9F A;  1Z7U A;  4HW0 A;  3VFZ A;  5D4R A;  1IXC A;  1RZ4 A;  2KIU A;  2OD5 A;  2BYV E;  3I59 B;  3J80 K;  3RKX A;  2HZT A;  1B9M A;  2P7C B;  1W7P B;  4CZZ A;  4ZYD A;  1H9T A;  3KLN A;  2RV8 A;  3P9K A;  3IKT A;  5LBQ A;  2R7D A;  1JGS A;  1T38 A;  1AOY A;  2P8T A;  3GX4 X;  5ICG A;  1O7F A;  3F8M A;  2VC1 A;  3BDD A;  4P9U A;  1JHH A;  3GVA A;  3H92 A;  2EB7 A;  4M6X A;  3WTU C;  1S7A A;  4GGG A;  2M1B A;  1TTY A;  2JPB A;  4PZJ A;  3LAP A;  3T1B A;  2FMY A;  5F1R A;  4UV9 A;  5CJ9 A;  4HDV A;  4BH9 A;  1TNT A;  2M87 A;  2NNY A;  4MQV A;  1OYI A;  2PI0 A;  5HDG A;  1KU7 A;  3HHH A;  3QAH A;  1QPM A;  5LHH A;  4XSZ F;  2UWM A;  2GXG A;  3EDP A;  5FB2 A;  4L5J A;  2P6T A;  2Y0M A;  4ON0 A;  1YIO A;  2C6Y A;  4K2E A;  2LF7 A;  1A04 A;  5H20 A;  4L0Z B;  1C0W A;  3ZMU A;  5E20 A;  4EJO A;  3DP7 A;  1K78 B;  3AAF A;  5D8K B;  4EV0 A;  4HF2 A;  1ODD A;  3WG9 A;  2D2W A;  3V7R A;  3O6B B;  2DW4 A;  1Q1H A;  4JQF A;  2F2E A;  2XV4 S;  3HSE A;  4YFK F;  4AIJ A;  3Q9V A;  1SD4 A;  1QZZ A;  2EFP A;  4AVP A;  5DCM B;  3CO6 C;  3C18 A;  1O3Q A;  5DCF A;  1ONV A;  3KE2 A;  3L09 A;  5FLX Z;  3K2Z A;  2ISZ A;  4QWQ A;  4AWX B;  3M1E A;  3D0S A;  1O3R A;  3C3W A;  1LVA A;  1BN5 A;  1U3E M;  1BIB A;  4CYD A;  5ED4 A;  4BHP A;  1FC3 A;  1FY7 A;  1XD7 A;  2HYG D;  5FFZ A;  2WC2 A;  5LGT A;  1FT9 A;  2ZCW A;  1Z1D A;  2ELH A;  2AXL A;  2XAG A;  1G3W A;  1D8J A;  2VXZ A;  1TW3 A;  3HRM A;  2RVC A;  4RB0 A;  2ESN A;  5HDN A;  3PFI A;  4Y17 A;  2G7U A;  4EMS A;  5L3C A;  1DPR A;  1WKM A;  4MEX F;  4ZYH A;  3NRV A;  5J6X A;  3CJN A;  1OYY A;  2X0L A;  3E97 A;  1HQC A;  2PQ8 A;  5AIP A;  1XGO A;  1MD0 A;  5TJJ A;  1R00 A;  2DO7 A;  2HQN A;  3I58 A;  3TOA A;  4KYW A;  1HKS A;  1IN8 A;  2VE9 A;  2HS5 A;  2UXN A;  2IA1 A;  5HS7 A;  1WSU A;  1J75 A;  4HX7 A;  3I4P A;  4ENK A;  4IHT A;  4AIK A;  1Z6R A;  1LJ9 A;  1JE8 A;  1ZH5 A;  1SD6 A;  4YII A;  2L01 A;  4P5O A;  2DQL A;  4WXH A;  3BJ6 A;  3S2W A;  2COM A;  4A0Y A;  5HLI A;  3GFM A;  5L3E A;  3DPL C;  3NQO A;  3U2R A;  2FE3 A;  4G6Q A;  3GLX A;  3ZMS A;  1XB4 A;  2FML A;  4HLX A;  3JSP A;  1XDS A;  4HBL A;  3K0L A;  3RIR A;  3V4G A;  1TBX A;  2ZXJ A;  1OYW A;  3GYH X;  1T0F A;  4ZZL A;  3WTS C;  1HW2 A;  4FT8 A;  1WRJ A;  4HQM A;  4GO1 A;  3CLO A;  3E5Q A;  4L9T A;  4I02 A;  2YR2 A;  2DTR A;  5D5X B;  5E1X A;  3IRR A;  5FLX K;  2GQQ A;  1FYL A;  2GXB A;  5H6R A;  2CO5 A;  5KVR A;  3CUQ A;  3DEU A;  5JHU A;  1K7A A;  2HOE A;  3IKV A;  1ZAO A;  4G7Z F;  2NS0 A;  2P7V B;  3ZP5 A;  5DYM A;  4CIC A;  5J8C A;  4HLY A;  1DDN A;  1H0M A;  2QEN A;  4QLC U;  5LHI A;  3TO7 A;  1W5S A;  2XAS A;  4BQA A;  4M73 A;  1SFE A;  2MH2 A;  2F5D A;  2Y48 A;  2EFW A;  1YW8 A;  3RI4 A;  3KEQ A;  1F5T A;  1IN5 A;  4CHU A;  2DQR A;  3JAM Z;  4WF2 A;  4YG2 F;  5D8L B;  3KP4 A;  3I64 A;  2QBY B;  5A2Q Z;  4IRH A;  5D5W B;  1SD5 A;  3T5X A;  4MNU A;  3SHF A;  4HF0 A;  2J5O A;  5BPI A;  5E1Z B;  2WWY A;  3JTG A;  4WK8 F;  4NB5 A;  4AIH A;  3M9A A;  3V8L A;  5CVJ A;  5BQT A;  3F8N A;  2DK8 A;  2H6B A;  2F5C A;  1O57 A;  3HOT A;  3LWF A;  3E6M A;  2ZFW A;  3OV8 A;  2IVM A;  5KK1 A;  5CVU A;  3KP3 A;  1F4K A;  2YX7 A;  3REO A;  3E3V A;  3LAJ A;  2P5K A;  3CUQ C;  1YLF A;  2DAO A;  4ESJ A;  4Q48 A;  1KU3 A;  3WTT C;  4OOI A;  3MFK A;  1ZLK A;  3ECH A;  3H3Z A;  2DT5 A;  4EGZ A;  3JSO A;  4UV8 A;  4UVC A;  1O3S A;  1XDU A;  3M7G A;  3ZN0 A;  4GXO A;  4ZH4 F;  3R60 A;  4FHT A;  4I0A A;  2ZNZ A;  2Y75 A;  2M30 A;  3FMQ A;  3Q5F A;  4WXC A;  3F72 A;  3GFI A;  1MJ9 A;  2P5L C;  3ZMT A;  2XHK A;  1LB2 A;  4EM2 A;  2WV0 A;  5CVV A;  4FX4 A;  4HF1 A;  2OQG A;  4I0B A;  4A12 A;  2VT2 A;  3O3K A;  1REP C;  3F6V A;  3KP5 A;  4GYI A;  1YS7 A;  2Z9O A;  1P6R A;  1I6X A;  2TDX A;  3F22 A;  3B02 A;  2IP2 A;  2Z99 A;  1ZRE A;  4UXN A;  4Q5S F;  4XLP F;  4Q47 A;  1I1G A;  1UHM A;  1YFH A;  2O03 A;  4OIO F;  4G9Y A;  4OIP F;  1ZGA A;  2IA2 A;  4LK0 F;  2K7L A;  4CGZ A;  2O8X A;  3HIF A;  1B4A A;  1YQA A;  4A2U A;  2NRA C;  3ZQ7 A;  5FFX A;  3RDI A;  2VON A;  3BPV A;  4LB6 B;  1YW7 A;  2STT A;  2CQK A;  1U5T A;  4OMZ A;  5A2Q K;  3I5U A;  3V8J A;  3Q9S A;  3SXY A;  2E7W A;  3LA7 A;  2RGV A;  2G7H A;  2VBW A;  4EJU A;  1J5Y A;  3BOQ A;  3KZZ A;  1STZ A;  4GCV A;  4WX9 A;  4RGX A;  1TQP A;  1SD7 A;  5DEQ A;  4LG0 A;  4XRF A;  2B0L A;  1D8K A;  2L54 A;  1J0R A;  2ESH A;  1T39 A;  4N0B A;  2CGP A;  2EV0 A;  2Q0O A;  1YTY A;  5K1Y A;  1XGM A;  2KIF A;  5LEK A;  4KUM A;  3I0T A;  1PP8 F;  3U1D A;  3ZMV A;  4S04 A;  4B8X A;  4HX4 A;  2MLK A;  3ECO A;  4OU0 A;  4RS8 A;  4E70 A;  4HDU A;  1S6L A;  4BYY A;  2VC0 A;  5CVR A;  2VOD A;  1GXP A;  1G4D A;  2ZO4 A;  1XGN A;  1FWZ A;  2FBH A;  4KIF A;  2FU4 A;  1IRF A;  5TRD A;  1WWX A;  3ZN1 A;  3BPX A;  2VOO A;  2VN2 A;  3E6C C;  2A5Y B;  2KRF A;  5LGU A;  1JXS A;  2E1C A;  4TV7 A;  3T8R A;  1L3L A;  3L7W A;  5DUI A;  1R23 A;  2L02 A;  5L3G A;  2JSC A;  1ZRD A;  1FYM A;  5E8I A;  5HDK A;  1KQ9 A;  4O6J A;  2FXA A;  3WTV C;  2QQ9 A;  2HWV A;  2EV5 A;  4HZF A;  2IPQ X;  1D5V A;  5ILU A;  3TDU C;  2MBF A;  2QWW A;  1Y0U A;  4CXF A;  2OBP A;  2EV6 A;  5F6F A;  3G3Z A;  2LNB A;  3WOD F;  2NAZ A;  1F9N A;  2V9V A;  1QO0 D;  3RTR A;  4M72 A;  2NNN A;  1MKM A;  2FBK A;  2WTE A;  1V4R A;  3GW2 A;  2QUF A;  1PDN C;  5HS8 A;  4EGY A;  4HYE A;  2L4M A;  1KU2 A;  5E8G A;  1SMT A;  2VOP A;  4IXA A;  3RYR A;  5HOO A;  4EJW A;  1XMA A;  3B73 A;  2Z33 A;  2D1V A;  5J8F A;  5DD8 A;  4BXU A;  3GO5 A;  2DPU A;  5D4S A;  4U0W A;  2OZU A;  5F64 A;  3BRO A;  4D0P A;  3RKW A;  1WI9 A;  2FNA A;  1FYK A;  4S05 A;  3KET A;  1YS6 A;  1MZB A;  3KP2 A;  5E18 F;  1QGP A;  3GUD A;  2KKO A;  1MDM B;  5HVQ C;  2PG4 A;  2CYY A;  5BS6 A;  3CTA A;  3QU6 A;  1R22 A;  4CO8 A;  5JR3 A;  5EEG A;  3DFG A;  3KEO A;  2MA3 A;  3MAJ A;  1FSH A;  1EV7 A;  5ERI A;  2ZME A;  3MQ0 A;  4ENJ A;  1P4A A;  3K1M A;  3F21 A;  4I98 B;  1TNS A;  5K5R A;  2PJP A;  4IHS A;  4LJZ F;  1E2X A;  5HLG A;  2ISY A;  5JI6 A;  1UST A;  2RC4 A;  5HLH A;  1KGS A;  3F8F A;  1BI0 A;  2DPD A;  1KYZ A;  1B59 A;  4LGW A;  3T8T A;  3TGN A;  1MJB A;  3DPT A;  4EQQ A;  2A3S A;  3DXJ F;  3BJA A;  4U7D A;  5DUK A;  1Z9C A;  2E1N A;  5ILS A;  3HRS A;  3P7N A;  3MZY A;  2OZ6 A;  3I59 A;  1R5H A;  4RB1 A;  1KQ8 A;  4WCG A;  1W7P A;  2KJC A;  3I53 A;  1XMK A;  2NYX A;  3FM5 A;  3GFJ A;  2V1D A;  3SZT A;  1FBU A;  2EJR A;  2KIM A;  2A6E F;  4MHG A;  1FBS A;  4YFX F;  2H27 A;  3TDZ C;  1K79 A;  1ZN2 A;  3P9I A;  1EH7 A;  4IRG A;  1W4M A;  1QBJ A;  1HKT A;  2XGX A;  5LEJ A;  2M45 A;  2XKP A;  1CGP A;  4LLN A;  5IT9 Z;  1IN4 A;  4MTD A;  5ICF A;  4LD5 A;  1IZ1 A;  1BI1 A;  2K4B A;  4O5V A;  1NHA A;  4PDK A;  2P4W A;  1UHW A;  2LSO A;  4P96 A;  2XAF A;  1I1S A;  3VB2 A;  1S8N A;  2EA2 A;  1RIO H;  3J7A O;  3P9C A;  3GZ5 A;  2IT0 A;  4M71 A;  5LRR A;  1R1V A;  1L0O C;  3ABT A;  1CF7 B;  2YU3 A;  2MC3 A;  1G3Y A;  3FHZ A;  1ULY A;  1DP7 P;  1W5T A;  1K78 A;  2XKO A;  3C1D A;  3F8C A;  1VTN C;  2CWE A;  4JK1 X;  3HRU A;  4U7B A;  1IW7 F;  3LQR A;  3R6S A;  3QU3 A;  2F5E A;  2V1X A;  2K02 A;  3WGI A;  4XLN F;  2GA2 A;  4YIF A;  5CVI A;  1BI3 A;  3RKY A;  3ZMZ A;  2FSW A;  2O3F A;  4AD9 A;  5DCM A;  3F8B A;  3CO7 C;  3I54 A;  4M9X A;  4BHB A;  1HSJ A;  1LEA A;  3FMS A;  1BIA A;  2V1U A;  5D6E A;  1JHF A;  2LKP A;  3EQL F;  1BC7 C;  2XIG A;  5CLS A;  2O0Y A;  2VBZ A;  4MQ9 F;  1AWC A;  3J81 Z;  3CDH A;  2X4H A;  1X3U A;  3N4M A;  5LLQ A;  2W85 A;  4PGH A;  1S7O A;  2CW0 F;  1ZGJ A;  1SMY F;  5BMZ A;  2ZJ2 A;  1LDK B;  2IA0 A;  5JFR A;  1ZG5 A;  5L3D A;  4A0X A;  3HOS A;  2GZW A;  3QPT A;  2P6S A;  2O61 A;  2GIV A;  5DDG A;  3MWM A;  1H9G A;  4WXD A;  4A6D A;  5H6Q A;  4JBA A;  2GAU A;  2QQB A;  5IT9 K;  3RPQ A;  1HW5 A;  3HTU A;  2RNJ A;  4M9Z A;  1IUY A;  1I27 A;  4Z2Y A;  4EVI A;  2W57 A;  2K4J A;  5E1W A;  1P4X A;  1ZYR F;  1XSX A;  3SFZ A;  1W7P D;  1TQM A;  1P92 A;  3V8K A;  3ELK A;  4ESF A;  4BHC A;  2PEX A;  3R0A A;  4G94 A;  2H09 A;  1TLH B;  5K5O A;  1B6A A;  3GZ6 A;  3QPH A;  3WTY C;  3T0Y A;  2EFO A;  3VOD A;  1O7L A;  3EYY A;  1FNN A;  2PBI A;  3TO6 A;  1SAX A;  4FX0 A;  2FOK A;  2DBB A;  2H6C A;  3WGG A;  4RGR A;  2K86 A;  3KFW X;  2EWN A;  3R4K A;  1HXD A;  4G8X A;  4RGS A;  3E5U A;  3C7J A;  4XBF A;  1GHC A;  1XSV A;  3DV8 A;  3KCC A;  3FM3 A;  2QVO A;  1G3T A;  2ADU A;  1OPC A;  4UNO A;  3L2C A;  4EJV A;  5LGN A;  2EA4 A;  3PQK A;  4A5M A;  2R7F A;  1U2W A;  3TKY A;  4L0Y B;  2D1H A;  4HOB A;  3CUO A;  4H0E A;  1SFX A;  4OIN F;  1IN7 A;  2FQ3 A;  3BP8 A;  2DU9 A;  4N9H A;  3OOP A;  2HEO A;  2L3D A;  1HBX G;  4UHT A;  1QQI A;  2LF8 A;  1HST A;  1QZY A;  1DUX C;  3MCZ A;  3DF8 A;  2AS5 F;  1FOK A;  3J81 K;  1GVJ A;  2QZ8 A;  4M9S A;  2ETH A;  3G73 A;  4KDP A;  2E7X A;  3MEX A;  4I7H A;  5DV5 A;  2VBY A;  2HKX A;  3GWZ A;  1BOA A;  1KYW A;  4BAY A;  2QBY A;  3RJP A;  2YX4 A;  2MD5 A;  3WTZ A;  2A07 F;  1TQI A;  4ASN A;  3ULQ B;  1R5G A; 
#chains in the Genus database with same CATH topology
 4AC0 A;  1IAW A;  2R7T A;  1OMI A;  1YG2 A;  1ZRC A;  3ZQL A;  2CUE A;  5L3B A;  3WTX C;  1R58 A;  3OYI A;  4G7H F;  4NQW A;  4DNC A;  2DOA A;  3FXU A;  4B48 A;  5CYV A;  3IL2 A;  5ICC A;  1SEU A;  1JKQ C;  2JWT A;  2XB0 X;  2FRH A;  2DXI A;  2DI3 A;  3S3O A;  1U5T C;  2XAQ A;  3RYP A;  5D5V B;  3ML6 A;  2XRN A;  4KMF A;  4W97 A;  2B63 J;  2GWR A;  3IHU A;  5CQG A;  5E17 F;  5BOX A;  3S2H J;  4IHX A;  3KZY A;  3W6K B;  5EEH A;  4CCK A;  5GTH C;  2M4K A;  1ZG3 A;  2CQ7 A;  1OCP A;  2ZBK A;  3VEP A;  4IF4 A;  3I55 I;  3ABU A;  3ABM H;  3DKX A;  4JP0 A;  4Y13 A;  5K5Q A;  2EPF A;  3JRA A;  1GLN A;  5KHD A;  2MC4 A;  3OS0 A;  2EK5 A;  2BY1 A;  2DFH A;  1FIA A;  3PQJ A;  1BR4 A;  4EM1 A;  4KN4 X;  3E5X A;  4XKC A;  2O9L A;  4L18 B;  3BZ6 A;  5CQE A;  5EEA A;  1JJ8 C;  3S1N J;  1ON2 A;  2EFQ A;  4RAZ A;  1WQ2 A;  2LH9 A;  3EYI A;  2P81 A;  1PUE E;  4M6Y A;  3W3C A;  2DMN A;  2VJ5 A;  3HXL A;  1GT0 C;  1D1B A;  4D9J A;  1FZP B;  4EJT A;  2COB A;  1E17 A;  1LE8 B;  2HTS A;  4Q4Z F;  4A3K J;  2XPV A;  1USS A;  3HDD A;  4ESB A;  2WB1 A;  1Y1V J;  2OQR A;  3W6V A;  4HX8 A;  2KP6 A;  2Z5U A;  3CUQ B;  4BEH A;  3MVP A;  4R79 A;  2UZK A;  4LIT A;  1K6Y A;  4A3E J;  1SFK A;  2BW3 B;  1TW2 A;  3EUK L;  1ZKG A;  2DLL A;  2YSR A;  1AHD P;  3BWG A;  1IN6 A;  1FSE A;  2BE5 F;  2NS7 A;  2X48 A;  4W1U A;  4RB2 C;  3WU1 B;  1LKX A;  5C4X J;  1BM9 A;  1T95 A;  4RAF A;  2Q2E A;  5FKK A;  4RM2 A;  2ICW G;  1MJA A;  1S9H A;  2CRG A;  2BY2 A;  1U78 A;  5FGM A;  3PFY A;  3L1P A;  3S3N A;  2CW7 A;  3TW6 A;  5FD6 A;  1FP1 D;  4M3F A;  3VSL A;  1J7K A;  4N4O B;  3KEY A;  2JTV A;  3OIO A;  2FEZ A;  4PSX A;  1XG1 A;  3OYH A;  3K1N A;  1AA7 A;  5HS9 A;  2E2J J;  3U9G A;  4BXX J;  2K85 A;  2RRE A;  5JVT A;  2V26 A;  4UUT A;  1IV6 A;  3ESW B;  4P55 A;  3PL8 A;  5FD5 A;  3K4C A;  3F23 A;  2V4J C;  3A2K A;  2M5W A;  3JRH A;  2K27 A;  5JLX A;  2R5Y A;  1U8R A;  1UFM A;  3ABL H;  2PMU A;  1YO5 C;  3IP4 B;  2X1D A;  2QSF X;  4A0Z A;  5E79 C;  1BR2 A;  4L5I A;  3SQN A;  5GPA A;  3K4B A;  3JRD A;  1YIT I;  1R71 A;  3VSK A;  4XKV A;  3WU2 C;  3HYI A;  1R1U A;  4CYC B;  4C2T A;  4NHJ A;  4F7Z A;  4I01 A;  1T98 A;  4G6D A;  1ZEL A;  3QP5 A;  4BU2 A;  4R1H A;  2J5P A;  1R49 A;  2RQQ A;  2IJL A;  2F5V A;  3ZMD A;  3FZV A;  1XSD A;  1GXQ A;  2LK2 A;  3MZH A;  2PMH A;  4LLG F;  5ICE A;  1S3J A;  1BA5 A;  1D3Y A;  2XGC A;  3E6D A;  1CQT A;  4JX6 A;  1N25 A;  2ID6 A;  2V9P A;  1VFC A;  4N9I A;  1RET A;  2VT3 A;  2YPR A;  4Y3O A;  1BL0 A;  2HNH A;  2WAQ A;  1X19 A;  5HNH A;  1NG7 A;  4E6K G;  4FQG A;  2WY8 Q;  1G3S A;  2L9V A;  4ETS A;  1OIS A;  3QYE A;  3WTW C;  3OYG A;  3ZRG A;  2R5Z A;  2VXD A;  2DMU A;  5J40 A;  5FRO A;  1E3H A;  4NBQ A;  1SVO A;  3KP7 A;  2FBI A;  3TOB A;  4A5N A;  2PX9 A;  2VKD A;  4KA4 A;  1YW9 A;  6PAX A;  1HF0 A;  4A6E A;  1J2X A;  1JKP C;  2Z2S B;  3LSG A;  3FX3 A;  1F1Z A;  1G6N A;  4G7O F;  2D45 A;  1NK3 P;  2RDP A;  2BEO A;  4FCY A;  3NEU A;  3FF5 A;  2A69 F;  3HPH A;  4MEY F;  1AU7 A;  2JUC A;  4A93 J;  1WH7 A;  1FLI A;  1B9N A;  2CJJ A;  4RAY A;  1R9T J;  3BR1 A;  1IC8 A;  1ZLJ A;  3BR3 A;  2Z3Y A;  2XRO A;  4U0Y A;  1FMV A;  1HW1 A;  1K6O A;  2EFN A;  1N77 A;  1ITY A;  1VQ4 I;  4LFU A;  3M8E A;  5EZG A;  4U87 A;  2E2H J;  1MIJ A;  2RN7 A;  3RZD J;  1ON1 A;  1W0T A;  1WJF A;  2DYR H;  2VQG A;  4RGU A;  5DD4 A;  4LIU A;  1UCR A;  1Z6T A;  1YJN I;  1OR7 A;  3A01 B;  1JTX A;  4QTR A;  4IVN A;  1YJ9 I;  3HJE A;  4PCQ A;  1IRG A;  3L2U A;  1XCB A;  2BY0 A;  3FMR A;  3UNG C;  3FXR A;  1IXR C;  9ANT A;  3OSG A;  3HB9 A;  3GTL J;  4KNY A;  2F4M B;  4XRS A;  2HDC A;  1EH6 A;  2VJ4 A;  4LB5 A;  3HSR A;  2NS8 A;  2FX0 A;  2L4A A;  4YEL A;  3L9F A;  5BPD A;  2STW A;  1RNL A;  5LHG A;  3G1L A;  1P2F A;  3VPR A;  4KN7 X;  3AKZ A;  4E7I A;  3ZXS A;  2VBX A;  1LDD A;  3K69 A;  5EGO B;  4WWC A;  1WCM J;  3E6B A;  3O2P E;  1WJ5 A;  3QPL A;  3CCJ I;  1LQ1 A;  4PJM A;  2PN6 A;  4CCJ A;  2E2I J;  1V54 H;  3CD6 I;  3ROU A;  3K70 D;  1B1B A;  4IRI A;  2F5F A;  4BNC A;  4HPQ A;  2F6C A;  1Z91 A;  4BE1 A;  2Y2Z A;  1RUO A;  1LNW A;  4YFN F;  1IXS B;  1V5F A;  1ETQ A;  1H88 C;  4ZYG A;  3OYF A;  4ENM A;  1ZHF A;  2BV6 A;  4PSW A;  2JT1 A;  1T6S A;  1I5Z A;  1LEB A;  4LK1 F;  2UXX A;  1O3T A;  2JA6 J;  2WAF A;  1SFU A;  4EM0 B;  3ZQF A;  5D6F A;  1TT0 A;  5M3M J;  3WHC A;  2DFI A;  2EIN H;  3GFL A;  2ZME C;  2E60 A;  2F4O B;  4LMY A;  2JUG A;  3FIW A;  3JW4 A;  2RKH A;  1S29 A;  2AO9 A;  2KZG A;  3IC7 A;  5M5W J;  2A61 A;  1H8A C;  3PO3 J;  3CCM I;  5IOZ A;  3M1C A;  3A0H C;  3IRQ A;  2JN6 A;  5FRN A;  2W84 A;  1ZAR A;  5KAF C;  3TO9 A;  3BY6 A;  3H3U A;  3GEZ A;  1FP2 A;  2HYJ A;  4A3M J;  1G59 A;  4FIS A;  2VPL A;  1UG2 A;  1J09 A;  2DA4 A;  2ZKZ A;  2NOG A;  1JGG A;  3HZJ A;  4U0V A;  5L3F A;  3FWE A;  1D1A A;  1U5T B;  3VOE A;  5FO5 A;  4NUB A;  3BJO A;  3WE3 A;  2DA7 A;  2XUB A;  3S32 A;  5IPA A;  2LVS A;  1V3F A;  3OYM A;  2QYO A;  2VE8 A;  1ZR4 A;  2P5V A;  3F3X A;  1XTA A;  2OU2 A;  4I6Z A;  3EET A;  3AG3 H;  4PK4 A;  2JPC A;  2M8E A;  2HOS A;  3R61 A;  1WJB A;  2VB6 A;  4HA8 A;  4H4K C;  3V7C A;  2KLO A;  3MMY B;  3ZQI A;  5EZH A;  1LDJ A;  2HTJ A;  1BJA A;  2GA1 A;  1XMX A;  3IWF A;  5IOY A;  4E7S A;  1WH5 A;  4LG0 B;  2XVC A;  3BR6 A;  2BXY A;  1KA8 A;  4OMY A;  2BGC A;  2H94 A;  1MGT A;  3PNT A;  3D1N I;  1FJL A;  3JTH A;  4DQ2 A;  2BBY A;  4MTE A;  4LLL A;  3I9V 2;  2JZY A;  1VQO I;  3HHG A;  3FXQ A;  4HQE A;  4GYG A;  5KCM A;  4ZDP A;  3V7S A;  1VND A;  4ENN A;  5FKL A;  4LG3 A;  1RUN A;  2XAJ A;  1OKR A;  4CCO A;  1ZRF A;  2HQ5 A;  2Y30 A;  3TQN A;  2QQA A;  3ERE D;  1RI7 A;  2IRF G;  1WPK A;  4L9J A;  1DPU A;  3W2W A;  5F0F A;  4HV6 A;  3COA C;  4KFC A;  2ACJ A;  3BR2 A;  3K1P A;  2KDZ A;  4Y15 A;  1R36 A;  3ABK H;  3GF2 A;  4XK4 A;  5GAD J;  5IT3 A;  4MGR A;  4UVB A;  3LFK A;  3DKW A;  3H0G J;  2XF5 A;  4XNF A;  4KIC A;  1V5G A;  2ECB A;  1YIJ I;  3OYN A;  2PFB A;  3ISP A;  2MSY A;  2A6T A;  2IGK A;  3CCY A;  2LOO A;  1NG6 A;  2LD5 A;  1QVU A;  5M5X J;  1MDM A;  3CDL A;  2XDV A;  3ZOB A;  4IX7 A;  3WGH A;  4CZC A;  3OYC A;  3RQI A;  4A3I J;  2HFH A;  2W4S A;  2WY7 Q;  2QA4 I;  3LST A;  2HR3 A;  4DZP A;  1UB9 A;  1BI2 A;  1R7J A;  2LBF A;  2IW5 A;  2A68 F;  1FBQ A;  2ELJ A;  3OYA A;  3SZP A;  3MKW B;  2E35 A;  2CG4 A;  1IRX A;  3EUH A;  1D1C A;  3ASO H;  5C3E J;  1YYV A;  2CFX A;  3BR0 A;  3RPU A;  3W6J B;  4B43 A;  3G2B A;  5AIQ A;  3N97 A;  1X1P A;  2PLY A;  4B1R A;  4XLF A;  2QM3 A;  3I71 A;  1UJ8 A;  5LRS A;  1BC8 C;  3D5L A;  3J80 Z;  3DBR B;  4HSR A;  4M3B A;  1EKE A;  3H9Q A;  2X6W A;  3ASN H;  1K61 A;  1FPQ A;  4LIV A;  5D5U B;  5GPC A;  3QRF F;  3CCU I;  2HKO A;  1ZG1 A;  3M4O J;  2HGC A;  4L9V A;  3I4N J;  3HOV J;  2OUM A;  2KJB A;  3KLO A;  2QSH X;  2M2E A;  2MLG A;  2EIK H;  1H89 C;  1HKQ A;  4U88 A;  4OAY A;  2MD0 A;  4ZYE A;  4A3C J;  5F0H A;  1Z05 A;  2MH9 A;  1D5Y A;  2QCO A;  3LSR A;  3WU0 A;  4B09 A;  2R3S A;  4R8H A;  1WJE A;  2A6H F;  2XAH A;  2O6G E;  2IS4 A;  4IJA A;  4O3M A;  1KU9 A;  1RES A;  4MO7 A;  2HYF A;  3K7A J;  4XKB A;  3JRE A;  1QNT A;  2LDU A;  2H8W A;  1R4M B;  4DYR A;  3OYE A;  3HBL A;  2G9W A;  2RQP A;  1I50 J;  4I09 A;  3GTQ J;  4ZZD A;  3N05 A;  3K9T A;  2OF7 A;  3LQQ A;  1HDP A;  2W82 A;  2LP0 A;  4FE7 A;  2YUS A;  3DQV C;  1JUS A;  3TED A;  4HV5 A;  2A5W A;  2DMP A;  3BG7 A;  1R1T A;  3E7L A;  1T2K A;  3L00 A;  4L9N A;  4HAM A;  2JQ7 A;  1KQ0 A;  5CPR B;  3S3M A;  1A35 A;  4XSX F;  2DK5 A;  4PGG A;  1JT0 A;  2JRT A;  2D5V A;  3H9J A;  4Z6Y A;  2R92 J;  3WE2 A;  4ZDL A;  3M8F A;  1ETW A;  3PIP F;  4QPQ A;  3RSN A;  1FOW A;  3CF2 A;  1K4S A;  3HM5 A;  1J59 A;  4HG2 A;  3HUG A;  1XGS A;  4B47 A;  4M3D A;  3PO2 J;  1DP3 A;  2ZNY A;  3KP6 A;  3EUH C;  2EH3 A;  1VQP I;  2V6C A;  1YE9 A;  2FA5 A;  3QQA A;  4KMU X;  1J9I A;  1Y39 A;  3HTS B;  5ILV A;  4UUV A;  2W48 A;  5FKM A;  4ZJZ A;  2M7B A;  2JA5 J;  3F6O A;  3GTK J;  3GXO A;  1DU0 A;  1XCV A;  1U6G A;  3CCQ I;  1MSE C;  2BHY A;  2X6X A;  4AUX A;  4RB3 C;  2ME6 A;  1BBY A;  1MH4 A;  1WJC A;  3FBI B;  3QP6 A;  4KIG A;  5B1A H;  2DCE A;  2FF4 A;  2LMD A;  4CDG A;  4KT5 C;  1OQY A;  2FNP A;  2OA4 A;  2W00 A;  2ZME B;  4M3E A;  5F0C A;  3JAM K;  1I39 A;  1N78 A;  2K5C A;  1EH8 A;  4IPA A;  4RA2 A;  4UVA A;  3HOX J;  3R0J A;  1P7J A;  3H1C A;  1ACI A;  3IWZ A;  4CCM A;  4Y4R A;  4I2O A;  3FBN B;  5AON A;  3PUF A;  2A05 A;  1VQ6 I;  3QOP A;  2QLZ A;  1FX7 A;  4XLA A;  2DDA A;  2XSJ C;  2CV0 A;  2KRH A;  4M74 A;  4KIB A;  1CF7 A;  2HQR A;  3RCO A;  2Q8K A;  1XN7 A;  2L5Q A;  2W24 A;  3CP8 A;  3HSF A;  3LA3 A;  1IF1 A;  2V79 A;  3LA2 A;  1XS9 A;  1RR7 A;  2OAZ A;  1TT5 B;  3P5J A;  3CCV I;  4OIR F;  4B44 A;  4ZYA A;  3ZPL A;  5CKT A;  1PP7 U;  1X1A A;  1R6R A;  2CSO A;  4OIQ F;  4UB6 C;  3HRT A;  1P4W A;  2W25 A;  5J1R A;  4P9F A;  1Z7U A;  4HW0 A;  1T08 B;  2DN0 A;  3VFZ A;  5D4R A;  1ETX A;  3PNV A;  1IXC A;  2HPM A;  1RZ4 A;  2JK3 A;  2KIU A;  2OD5 A;  2G0E A;  1D0Z A;  4X1E A;  2BYV E;  3I59 B;  3J80 K;  2IBD A;  3RKX A;  2GXA A;  2HZT A;  3CCS I;  1ETV A;  1B9M A;  3LSM A;  2P7C B;  2JMW A;  5IP6 A;  1W7P B;  4CZZ A;  1I3A A;  4ZYD A;  4BGD A;  1H9T A;  3BLY A;  2NOJ B;  3KLN A;  2RV8 A;  3P9K A;  3IKT A;  2N8G A;  5LBQ A;  4F93 B;  2R7D A;  3DU5 A;  1JGS A;  1T38 A;  1AOY A;  2P8T A;  2HOT A;  3GX4 X;  5ICG A;  1O7F A;  3F8M A;  3HEF A;  4XLH A;  2Y31 A;  2IXS A;  1B72 B;  2VC1 A;  3BDD A;  1PVE A;  3LSJ A;  1JHH A;  4IEJ A;  4P9U A;  3GVA A;  3H92 A;  5B66 C;  2EB7 A;  4S0H B;  4M6X A;  2HU9 A;  3WTU C;  1S7A A;  4GGG A;  2M1B A;  1TTY A;  2JPB A;  4YIR X;  4XKW A;  3OYD A;  4DZJ A;  1FOX A;  4PZJ A;  3LAP A;  4PFO A;  1HDD C;  1PUF B;  3H3V K;  3T1B A;  2E36 A;  2FMY A;  3PSI A;  3RPU D;  5F1R A;  4UV9 A;  5CJ9 A;  4HDV A;  4BH9 A;  1XPX A;  1TNT A;  2M87 A;  2NNY A;  5FLM J;  2K9L A;  5HOD A;  2PJR A;  4MQV A;  4X6A J;  1OYI A;  4A69 C;  1E3P A;  1YRN B;  3CCL I;  3CMY A;  2PI0 A;  3OR2 C;  5HDG A;  1KU7 A;  3CC7 I;  4AM3 A;  3S16 J;  3HHH A;  5HLT A;  2XF6 A;  5JVG F;  1LFP A;  2HQA A;  3QAH A;  4AYB N;  5K7Z A;  3OY9 A;  1QPM A;  3S8P A;  5LHH A;  5BNG A;  4XSZ F;  2UWM A;  2GXG A;  1X2M A;  3EDP A;  2OCC H;  2XAU A;  5FB2 A;  4G6T B;  4L5J A;  3PNY A;  2KIS A;  1Z3Y A;  2P6T A;  2Y0M A;  4ON0 A;  1YIO A;  2C6Y A;  2YU9 J;  2BVL A;  1MMN A;  2IGN A;  2LF7 A;  4K2E A;  2K9N A;  1A04 A;  5H20 A;  3CCE I;  5FKO A;  3OYL A;  4L0Z B;  1DU6 A;  1C0W A;  1YX5 A;  1D0Y A;  2CV2 A;  3ZMU A;  2MW8 A;  1WI3 A;  2L0K A;  2LTP A;  3DLL F;  1SFO J;  5E20 A;  4EJO A;  3DP7 A;  3RKQ A;  1QPI A;  1K78 B;  2DMQ A;  3AAF A;  5D8K B;  4EV0 A;  4HF2 A;  3A4C A;  1ODD A;  3WG9 A;  3LMM A;  2D2W A;  2V1N A;  3V7R A;  2L7K A;  5GAG J;  3K70 C;  3O6B B;  2DW4 A;  1NTC A;  1T8I A;  1LUJ B;  1Q1H A;  4JQF A;  2F2E A;  2EIJ H;  3ERM A;  3JR9 A;  1LFU P;  2XV4 S;  5J1Y A;  3IH4 A;  4IHY A;  3SZG A;  3HSE A;  1XX5 A;  4YFK F;  3BG3 A;  3QPS A;  5DM7 F;  3TP0 A;  4AIJ A;  1POG A;  3EPZ A;  3Q9V A;  1SD4 A;  1QZZ A;  2R7W A;  2EFP A;  3GME A;  4AVP A;  5DCM B;  1OCR H;  4BBR J;  1TZL A;  3C18 A;  3CO6 C;  5DCF A;  1O3Q A;  1ONV A;  3KE2 A;  3JCU C;  3L09 A;  5FLX Z;  4D1Q A;  4HRI A;  3K2Z A;  1VQN I;  2ISZ A;  1B8I B;  1R5I D;  4QWQ A;  4AWX B;  2W7N A;  1QZE A;  3M1E A;  3D0S A;  1O3R A;  3C3W A;  1LVA A;  1Y0N A;  1MNM C;  1BN5 A;  4XIC A;  1U3E M;  1BIB A;  2QF7 A;  4CYD A;  2R7S A;  3A02 A;  3SFI A;  4BQN A;  5ED4 A;  5E3L A;  4BHP A;  2ZSI B;  1FC3 A;  1FY7 A;  1XD7 A;  2HYG D;  2CV1 A;  3X2Q H;  4ZTF A;  5FFZ A;  2WC2 A;  5LGT A;  1FT9 A;  5TIS C;  4NDL A;  2E5N A;  4P1W A;  2ZCW A;  1X3Z B;  1Z1D A;  2AXL A;  2ELH A;  1ETY A;  2XAG A;  5EG0 A;  2WV1 A;  1G3W A;  3K4M A;  4G12 A;  1W0U A;  2K9M A;  1VQ5 I;  4M3G A;  1D8J A;  2VXZ A;  1TW3 A;  3HRM A;  2RVC A;  3NWT A;  3FXL A;  4NC7 A;  4RB0 A;  2ESN A;  5HDN A;  1IGN A;  1WZ2 A;  4X0G A;  3PFI A;  2ZJR F;  2CFO A;  4Y17 A;  3JRF A;  4GFB A;  2BZT A;  2G7U A;  4EMS A;  5L3C A;  1A6I A;  1TL8 A;  2OCE A;  1DPR A;  1WKM A;  5DS9 A;  4OWR B;  4MEX F;  4ZYH A;  3NRV A;  5J6X A;  3CJN A;  1OYY A;  2X0L A;  5KAI C;  1MBF A;  3EUA A;  4D7N A;  2MGQ A;  3E97 A;  1HQC A;  2PQ8 A;  2R7Z J;  5AIP A;  3M8J A;  1XGO A;  1MD0 A;  3BT9 A;  5TJJ A;  1R00 A;  2DO7 A;  2HQN A;  2XGE A;  3I58 A;  4BKX A;  3TOA A;  1JT6 A;  3DCF A;  3NAU A;  4KYW A;  3S14 J;  1HKS A;  1IN8 A;  3OL4 A;  2VE9 A;  2HS5 A;  3I56 I;  2UXN A;  3FDY A;  2IA1 A;  5HS7 A;  3GCM A;  2QGU A;  3HGY A;  3IH2 A;  1WSU A;  2DYS H;  1J75 A;  1UMQ A;  4HX7 A;  3I4P A;  4ENK A;  4IHT A;  4AIK A;  1Z6R A;  1LJ9 A;  1JE8 A;  2JJ7 A;  1WGX A;  1ZH5 A;  2BXZ A;  1SD6 A;  1EF4 A;  4YII A;  2L01 A;  5EJC A;  2H1L A;  5IYB J;  4P5O A;  2DQL A;  4WXH A;  1HA8 A;  3DTI A;  3ZCO A;  1W36 D;  3BJ6 A;  3BCA A;  3S2W A;  1RPW A;  2COM A;  3L2R A;  5EYR A;  4A0Y A;  5HLI A;  2OC6 A;  3L2Q A;  1WJA A;  4XOR A;  4C9Y A;  3GFM A;  2VL8 A;  2IEK A;  3OWT A;  2XPW A;  5L3E A;  3DPL C;  3NQO A;  4KIS A;  3U2R A;  4A3L J;  2I8D A;  4FTH A;  2FE3 A;  4IHW A;  4G6Q A;  3GLX A;  1KZH A;  3SEQ A;  3J7Z I;  2HVS A;  4XRM A;  2DA5 A;  1XB4 A;  2FML A;  1G8X A;  4HLX A;  1XDS A;  5J1U A;  3ZMS A;  4HBL A;  3JSP A;  3K0L A;  3RIR A;  3V4G A;  4BQO A;  4CCN A;  3LNQ A;  4ANJ A;  1EJ9 A;  1TBX A;  2ZXJ A;  3F0C A;  1OYW A;  5J47 A;  4MFE A;  4E7J A;  3OL3 A;  2WBM A;  3GYH X;  3BTL A;  5JHF A;  1T0F A;  4ZZL A;  3WTS C;  2VKV A;  5EF6 A;  1HW2 A;  4EAT A;  2DMT A;  2VIX A;  4FT8 A;  1WRJ A;  1D0X A;  4HQM A;  2XPU A;  4GO1 A;  5IP9 J;  5M3F J;  1ETO A;  3HGG A;  3L2W A;  3PM1 A;  3CLO A;  3E5Q A;  4L9T A;  4I02 A;  4Y52 J;  2YR2 A;  2DTR A;  5TGT A;  1NH3 A;  1LE8 A;  5D5X B;  5E1X A;  5GTI C;  3IRR A;  5FLX K;  2GQQ A;  4II2 A;  1FYL A;  2GXB A;  5H6R A;  3TMO A;  2CO5 A;  4UUS B;  2RNG A;  5KVR A;  3JRC A;  1Y8Q B;  3CUQ A;  3BQZ A;  3F9K A;  3DEU A;  1HC8 A;  5JHU A;  1K7A A;  3WG7 H;  5M5Y J;  2R0Q C;  2HOE A;  3IKV A;  2LG4 A;  2BW3 A;  1ZAO A;  3E1S A;  4G7Z F;  1UEL B;  2NS0 A;  2P7V B;  1OR7 C;  4V19 K;  2B9S A;  3ZP5 A;  5DYM A;  1BW5 A;  4CIC A;  5J8C A;  4HLY A;  4E7K A;  1DDN A;  5J4Y A;  1H0M A;  2CUJ A;  1VQ7 I;  3S1M J;  2QEN A;  4QLC U;  5LHI A;  3TO7 A;  1W5S A;  4ITV A;  1UG0 A;  2XAS A;  4BQA A;  2ZXW H;  4M73 A;  1SFE A;  2MH2 A;  2F5D A;  2Y48 A;  2EFW A;  1YW8 A;  4YEJ A;  3VYT B;  3RI4 A;  3KEQ A;  4MFD A;  4XOP A;  1WFX A;  4MIM A;  1Y6I A;  2HPI A;  1AKH B;  1F5T A;  2EIL H;  2AHQ A;  1IN5 A;  3E0J B;  1VQ8 I;  4CHU A;  1HOM A;  1SVM A;  2DQR A;  3JAM Z;  4WF2 A;  4YG2 F;  1VZ0 A;  5D8L B;  3KP4 A;  3I64 A;  4C2M J;  1YHQ I;  2QBY B;  5A2Q Z;  2GOM A;  2X1E A;  3OSF A;  4IRH A;  5D5W B;  4M6V A;  1SD5 A;  2EZL A;  5B3S H;  3T5X A;  1X3W B;  4MNU A;  3SHF A;  4HF0 A;  3PUB A;  4CYC A;  2JSP A;  2J5O A;  5BPI A;  5E1Z B;  2WWY A;  3JTG A;  4WK8 F;  3CC2 I;  4HST A;  5FKN A;  3DTK A;  2JVH A;  2H8R A;  3HL2 A;  2H1K A;  4NB5 A;  3U21 A;  4AIH A;  3M9A A;  1DGW Y;  1YOV B;  4NQW B;  3V8L A;  5CVJ A;  4IKF A;  1MBK A;  5BQT A;  3IH3 A;  1WHU A;  3QYF A;  3DLA A;  1SVL A;  3CC4 I;  2DFE A;  4UB8 C;  3F8N A;  4J00 A;  1T0F C;  2DK8 A;  2H6B A;  3IV5 A;  2WA0 A;  2DOF A;  2LRD A;  2F5C A;  1O57 A;  4AID A;  3HOT A;  2R7V A;  1M1E B;  4PJ0 C;  2E1O A;  5E3O A;  3LWF A;  2JA8 J;  3FKI J;  3E6M A;  4UY8 I;  2ZFW A;  3OV8 A;  2PMZ N;  2IVM A;  2WAD A;  2CH0 A;  2Y0S N;  5KK1 A;  1X1B A;  5CVU A;  1FTT A;  3KP3 A;  4QIW N;  1F4K A;  2VJI A;  2YX7 A;  2KZV A;  3REO A;  4C3I J;  3E3V A;  2AXT C;  4HNU A;  5C4J J;  3LAJ A;  2P5K A;  3CUQ C;  2GIZ A;  1YLF A;  2NVQ J;  3SEZ A;  1ZK8 A;  3H35 A;  2DAO A;  1VQL I;  4ESJ A;  4Q48 A;  1KU3 A;  3KYD B;  4OOI A;  3WTT C;  3MFK A;  3GTJ J;  2LKX A;  1ZLK A;  3ECH A;  3H3Z A;  2DT5 A;  4EGZ A;  3JSO A;  4UV8 A;  4UVC A;  1O3S A;  3G1M A;  1XDU A;  3M7G A;  3ZN0 A;  4GXO A;  2EQR A;  4CSW A;  4DBQ A;  4ZH4 F;  1JI8 A;  3R60 A;  4FHT A;  4I0A A;  4BEH B;  4B3X A;  1F43 A;  3O8H A;  2ZNZ A;  1PYV A;  5E3N A;  5GAE J;  2R7U A;  2LC2 A;  3A01 A;  2CUZ A;  2Y75 A;  2M30 A;  3FMQ A;  3Q5F A;  4WXC A;  3IAM 2;  3DEE A;  2Q2E B;  4JX5 A;  4BS9 A;  2GBY A;  4LOC A;  3F72 A;  3GFI A;  1MJ9 A;  2P5L C;  3ZMT A;  2XHK A;  1LB2 A;  4EM2 A;  4C2U A;  4F91 B;  2WV0 A;  5LFA A;  3QOD A;  2ME0 A;  5CVV A;  4FX4 A;  4HF1 A;  1A31 A;  5EGO A;  2LKS A;  2K3F A;  2OQG A;  4I0B A;  4FAS D;  4A12 A;  2VT2 A;  3MD2 A;  3O3K A;  3JRI A;  1REP C;  3F6V A;  3KP5 A;  4GYI A;  3CP2 A;  1FMW A;  1NK2 P;  3H5N A;  3J7A Y;  1YS7 A;  2Z9O A;  5EDN A;  2NVU B;  4C3H J;  1P6R A;  3W2A A;  2DT7 B;  1I6X A;  2TDX A;  3V42 A;  4PJL A;  3F22 A;  3B02 A;  2R5Y B;  2IP2 A;  2M4G A;  3HOU J;  3CF5 F;  1MMA A;  2Z99 A;  4UXN A;  2ZFU A;  1ZRE A;  4XLP F;  4Q5S F;  4Q47 A;  4AYB A;  1I1G A;  2VQH A;  1UHM A;  4XLC A;  1YFH A;  2KPM A;  1MBJ A;  2O03 A;  4G9Y A;  2HVR A;  4OIO F;  4RBO A;  4OIP F;  1ZGA A;  4B4C A;  2IA2 A;  2MG4 A;  2VAS A;  1RKT A;  4LK0 F;  2K7L A;  1MMD A;  3KPH A;  3D5R C;  2VQC A;  4J19 A;  4CGZ A;  2I10 A;  2ZB9 A;  2O8X A;  1A5J A;  2K9Q A;  3HIF A;  1B4A A;  1YQA A;  4A2U A;  4RLQ A;  2NRA C;  3ZQ7 A;  1W1W E;  5J4V A;  5FFX A;  3Q0W A;  1K83 J;  1GUU A;  3RDI A;  2VON A;  3BPV A;  3S2D J;  4LB6 B;  1YW7 A;  2STT A;  2CQK A;  1U5T A;  2V6E A;  1ERD A;  2HI3 A;  2R5Z B;  1PJR A;  2Z16 A;  4OMZ A;  5A2Q K;  3I5U A;  3K6G A;  3V8J A;  2OV7 A;  2MFZ A;  3Q9S A;  2OJE D;  3SXY A;  1V55 H;  2E7W A;  2QSG X;  3LA7 A;  2RGV A;  3ZQG A;  3OYK A;  2G7H A;  3ZQQ A;  4A3J J;  2VBW A;  1RRJ A;  3HOW J;  2ZC2 A;  4EJU A;  1J5Y A;  2EZK A;  3ZQH A;  4GRI A;  2NVY J;  2VQL A;  3DBL B;  2UUZ A;  3BOQ A;  3KZZ A;  1STZ A;  4GCV A;  4C3J J;  4WX9 A;  4PJJ A;  5IYD J;  4RGX A;  3SDB A;  1TQP A;  1SD7 A;  2HVQ A;  5DEQ A;  4LG0 A;  2X85 A;  2IGM A;  3K4K A;  4XRF A;  2B0L A;  3KX2 A;  1D8K A;  2L54 A;  2W1O A;  1J0R A;  2ESH A;  2ZXH A;  1T39 A;  1F36 A;  1U9N A;  4N0B A;  2CGP A;  2EV0 A;  3AG2 H;  2Q0O A;  2R7R A;  2Y9Y A;  1YTY A;  2MYS A;  2X51 A;  2YS9 A;  4DBR A;  3H5R A;  3I3L A;  5K1Y A;  2TRT A;  2CQX A;  1XGM A;  2KIF A;  1VQ9 I;  5LEK A;  4KUM A;  3I0T A;  1PP8 F;  1DGR M;  3ONQ A;  1A6Q A;  2DJN A;  4IO9 F;  3QWL A;  3U1D A;  2P0W A;  3ZMV A;  4S04 A;  1QVT A;  1OJL A;  4B8X A;  3H0D A;  4HX4 A;  4I76 A;  2MLK A;  4AU7 A;  3C2H A;  2L7M P;  2BHZ A;  3ECO A;  4OU0 A;  4RS8 A;  1S6L A;  4BYY A;  4E70 A;  4YRV A;  2XC7 A;  2L9S A;  4HDU A;  3W2V A;  2VC0 A;  5CVR A;  3OOU A;  1JUP A;  3VYU B;  2VOD A;  5F27 A;  1GXP A;  1G4D A;  1OCZ H;  2F48 A;  2ZO4 A;  1XGN A;  1FWZ A;  3AFH A;  3PIO F;  2FBH A;  4KIF A;  4IL6 C;  1YI2 I;  3D5S C;  3GBG A;  2FU4 A;  1IRF A;  5TRD A;  1WWX A;  2VKE A;  3MZ8 A;  3BPX A;  3ZN1 A;  4E7Z A;  2DFF A;  2VOO A;  2VN2 A;  3E6C C;  1QRY A;  2A5Y B;  2KRF A;  3LSK A;  3HKZ N;  4RDU A;  5LGU A;  1JXS A;  2E1C A;  1OCC H;  2FUG 2;  4TV7 A;  3T8R A;  1L3L A;  3LSH A;  1DQU A;  1U9O A;  3L7W A;  5DUI A;  1JKO C;  2LY9 A;  5FJ8 J;  2ZSH B;  2HDW A;  1R23 A;  2L02 A;  5L3G A;  3OIP A;  2JSC A;  2V9K A;  1ZRD A;  5FRM A;  3PSF A;  5KNL A;  5E8I A;  1FYM A;  3G4S I;  5HDK A;  1KQ9 A;  4O6J A;  1T33 A;  1VF9 A;  2CQN A;  2FXA A;  3DBH B;  3WTV C;  2QQ9 A;  1TWA J;  2HWV A;  2EV5 A;  4HZF A;  4CUG A;  2O5R A;  4ZC3 A;  4BJ6 C;  5C44 J;  3IUO A;  2IPQ X;  3CLQ A;  4XN3 A;  3UKG A;  1D5V A;  5ILU A;  3TDU C;  2V7F A;  5IYC J;  4E4H A;  2MBF A;  2QWW A;  3A1Y A;  1Y0U A;  3RZO J;  2CUF A;  2E19 A;  4CXF A;  2OBP A;  2EV6 A;  3CQZ J;  2HXO A;  2MAB A;  5F6F A;  3G3Z A;  2LNB A;  3WOD F;  1MSF C;  2NAZ A;  1F9N A;  2V9V A;  3Q0U A;  1LFB A;  5IY5 H;  5DTD A;  3BTI A;  1QO0 D;  3RTR A;  3LOC A;  4M72 A;  2NNN A;  1MKM A;  2FBK A;  2WTE A;  1Z3X A;  4XON A;  1V4R A;  3K4N A;  3OS1 A;  1QU3 A;  1ENH A;  3GW2 A;  2QUF A;  2L9N A;  1PDN C;  5HS8 A;  4EGY A;  2XB5 A;  3PJR A;  1ZGW A;  4HYE A;  2L4M A;  1TC3 C;  1KU2 A;  1BOB A;  5E8G A;  1IJW C;  1SMT A;  2HZD A;  4IOA F;  4IXA A;  2VOP A;  3RYR A;  5HOO A;  4NNJ A;  3QOE A;  4EJW A;  1XMA A;  4IHV A;  3S17 J;  3B73 A;  2Z33 A;  2D1V A;  3DWL E;  1I6H J;  5J8F A;  5DD8 A;  5K7F A;  2M0C A;  1W36 C;  1N75 A;  2QKL B;  4BXU A;  3RQ4 A;  3H5A A;  3LSI A;  3GO5 A;  2DPU A;  2VUM J;  1TWC J;  5D4S A;  4U0W A;  2K9S A;  2HDD A;  2OZU A;  5GAH J;  4F55 A;  1XC5 A;  5F64 A;  3BRO A;  3BR5 A;  4D0P A;  4D5F A;  2R4G A;  1HLV A;  3RKW A;  1WI9 A;  2FNA A;  1FYK A;  2DOE A;  3A0B C;  4S05 A;  3KET A;  1YS6 A;  3O8G A;  2DA2 A;  2E1M C;  1IDZ A;  1MZB A;  1Z67 A;  3KIO A;  2GLO A;  1GVD A;  3KP2 A;  5E18 F;  2X6Y A;  1QGP A;  3GUD A;  2KKO A;  1TWH J;  3VDX A;  1MDM B;  3GZN B;  2JRM A;  2QEX I;  2DDB A;  5HVQ C;  2PG4 A;  1GV2 A;  2CYY A;  3U1K A;  4L5E A;  5BS6 A;  2XGD A;  1E3O C;  2F4I A;  3CTA A;  3QU6 A;  4KT6 A;  1R22 A;  3FHN A;  4CO8 A;  4GDF A;  5JR3 A;  3CMA I;  5EEG A;  1OCO H;  3DFG A;  3KEO A;  4A3D J;  3FXM A;  2LBF B;  2R7X A;  2MA3 A;  2IS1 A;  3MAJ A;  1FSH A;  1EV7 A;  1MNE A;  4BJT A;  3SYT A;  1P7I A;  4IZZ A;  2IS2 A;  5ERI A;  2ZME A;  2DT6 A;  1ORK A;  4IQJ A;  3MQ0 A;  3FXO A;  1P4A A;  4ENJ A;  3K1M A;  3F21 A;  5FLV A;  1S72 I;  2EBI A;  1UHS A;  4I98 B;  1TNS A;  3KZI C;  5K5R A;  2VLA A;  3FXJ A;  4IHS A;  2PJP A;  4LJZ F;  1E2X A;  4F3Q A;  5HLG A;  2ISY A;  2JVG A;  4AVZ A;  3FK7 A;  4BY1 J;  2LRE A;  3LFU A;  1ZR2 A;  1EA3 A;  3Q0V A;  5JI6 A;  2QQ8 A;  4EEF G;  2LYC A;  1UST A;  2RC4 A;  4DW6 A;  3S1Q J;  5HLH A;  1KGS A;  3F8F A;  1BI0 A;  2TCT A;  2DPD A;  1KYZ A;  2WAE A;  1B59 A;  4LGW A;  3T8T A;  3TGN A;  1MJB A;  2LY1 A;  3B6A A;  3DPT A;  4EQQ A;  2A3S A;  5F1J A;  1Y1W J;  2EZI A;  3DXJ F;  1JUM A;  2M9H A;  3OS2 A;  3BJA A;  4U7D A;  1IV8 A;  1MBH A;  5DUK A;  1Z9C A;  2Q1Z B;  2E1N A;  1Z77 A;  5ILS A;  2ELK A;  1Z7L A;  3HRS A;  3P7N A;  4E7L A;  1OLT A;  3MZY A;  1K4T A;  2OZ6 A;  2M7A A;  3BG5 A;  3C2B A;  3I59 A;  4BL0 B;  1R5H A;  1FIP A;  4KJZ A;  4V2F A;  4BE0 A;  4RB1 A;  2K3P A;  1KQ8 A;  3CME I;  4WCG A;  3GTO J;  1W7P A;  4F52 A;  1Q1V A;  1KON A;  2KJC A;  2NVX J;  3GTM J;  2BVM A;  3I53 A;  1R4N B;  4N4N B;  3GTP J;  1XMK A;  2NYX A;  1MBE A;  3CJQ B;  3S93 A;  3FM5 A;  3H9G A;  1A36 A;  2PMZ A;  2FQ4 A;  4XRS G;  1JJ6 C;  2Y0S A;  3GFJ A;  2V1D A;  2WB1 N;  1MND A;  3HPG A;  3J7Y J;  1B72 A;  2ZXI A;  3SZT A;  1FBU A;  5DM6 F;  3KYL A;  2EJR A;  3CES A;  1ZQ3 P;  2KDO A;  2KIM A;  2A6E F;  3VWB A;  2NXN B;  4MHG A;  4JX4 A;  2CQQ A;  3HOZ J;  1FBS A;  4B3A A;  4YFX F;  3TDZ C;  1K79 A;  2H27 A;  1ZN2 A;  3P9I A;  4BQQ A;  1EH7 A;  4IRG A;  2EZH A;  1W4M A;  3CCR I;  2KQR A;  2ID3 A;  4C30 A;  3HG9 A;  3KYC B;  1QBJ A;  1HKT A;  3SDG A;  1OFC X;  2DJI A;  2DA6 A;  2XGX A;  4NC6 A;  5LEJ A;  2M45 A;  1YX3 A;  3BG6 A;  3HUG B;  1PUF A;  2XKP A;  3BTJ A;  1LVK A;  4BDZ A;  1Z21 A;  1CGP A;  2KIQ A;  2AQF A;  2FOW A;  3MKZ A;  2UV1 A;  4LLN A;  1Z0X A;  5IT9 Z;  1IN4 A;  1U0J A;  3FK6 A;  4MTD A;  5ICF A;  4LD5 A;  2ZJP F;  2Z1D A;  1IZ1 A;  1BI1 A;  2QKM B;  1YRN A;  3SJM A;  2K4B A;  3M3Y J;  1SC7 A;  3I4M J;  4O5V A;  1NHA A;  4PDK A;  2P4W A;  3LL7 A;  2KFD A;  1UHW A;  3GLL A;  2LSO A;  4FET A;  3TW7 A;  4CA0 A;  1QA6 A;  4P96 A;  2XAF A;  1I1S A;  1P9Q C;  2K40 A;  3OIQ A;  3VB2 A;  2CS3 A;  4BAC A;  1S8N A;  2EA2 A;  3G1O A;  3OR1 C;  4DOZ A;  1RIO H;  3J7A O;  3P9C A;  3CJT B;  3GZ5 A;  4BJ5 C;  2GM4 A;  4HEA 2;  2IT0 A;  3NAR A;  1VQM I;  3QYB A;  4HNV A;  4M71 A;  3JRG A;  5LRR A;  1R1V A;  1L0O C;  3S15 J;  1MH3 A;  3ABT A;  3DEW A;  1CF7 B;  1MBG A;  2YU3 A;  4XLE A;  2WAQ N;  3AL0 C;  3CMM A;  4V2G A;  2MC3 A;  1G3Y A;  2CW8 A;  3FHZ A;  1ULY A;  1X1D A;  1IUF A;  1DP7 P;  1I3Q J;  1W5T A;  1X4P A;  3BC8 A;  3FKJ A;  1K78 A;  2IAI A;  1WJD A;  2XKO A;  2Y69 H;  4BDY A;  3K2A A;  3K4L A;  4F92 B;  2R7O A;  3NWS A;  4DJA A;  3C1D A;  3F8C A;  2L7Z A;  1VTN C;  2CWE A;  4JK1 X;  3HRU A;  3AG1 H;  3ZR8 X;  4U7B A;  1IG7 A;  1IW7 F;  4XR6 A;  3LQR A;  3R6S A;  3QU3 A;  5B1B H;  2F5E A;  2JA2 A;  2V1X A;  1S7E A;  2K02 A;  3WGI A;  4XLN F;  2LFB A;  2E34 A;  2GA2 A;  3MKY B;  4CCL A;  5CVI A;  4YIF A;  1BI3 A;  3RKY A;  3UR3 C;  3ZMZ A;  2FSW A;  2EIM H;  2O3F A;  3BTC A;  4AD9 A;  2LY2 A;  5DCM A;  2ECC A;  3BQY A;  4ZTJ A;  4PFP A;  5F04 A;  3BZK A;  1IO2 A;  5IP7 J;  3GTG J;  5GP9 A;  1V5E A;  3F8B A;  2CU7 A;  3CJR B;  2L9R A;  1B8I A;  3CO7 C;  3I54 A;  4M9X A;  4BHB A;  4HNT A;  2KT0 A;  1BW6 A;  1HSJ A;  2VKH A;  3BG9 A;  2LR8 A;  1LEA A;  3FMS A;  4DIQ A;  1BIA A;  4RAG A;  2V1U A;  4Y33 A;  5D6E A;  1JTY A;  1WVR A;  4PJN A;  4NC8 A;  1JHF A;  3FIS A;  1ETK A;  4KIT B;  2E1M B;  2KMU A;  2LKP A;  3EQL F;  4OAZ A;  1BC7 C;  4JYK A;  3OYJ A;  2XIG A;  5CLS A;  2O0Y A;  2VBZ A;  4I99 C;  1SAU A;  4MQ9 F;  1AWC A;  3J81 Z;  4DGW B;  3CDH A;  4A3B J;  4D5C A;  2X4H A;  3ZQC A;  2O7O A;  3HOY J;  2VI6 A;  3AG4 H;  4A3G J;  1X3U A;  3N4M A;  2FD5 A;  5LLQ A;  4RM3 A;  2W85 A;  3A03 A;  4PGH A;  5LD2 C;  5HNF A;  1S7O A;  2CW0 F;  1YJW I;  2PJR B;  4QSH A;  1ZGJ A;  1GV5 A;  1Y56 A;  1SMY F;  3VYR B;  5BMZ A;  2ZJ2 A;  1LDK B;  2IA0 A;  5JFR A;  2R7Q A;  4DYC A;  1ZG5 A;  5E3M A;  2CMP A;  5L3D A;  2L2O A;  4A0X A;  3HOS A;  2GZW A;  3QPT A;  2KRC A;  4Y7N J;  1RKW A;  2P6S A;  4DYQ A;  2O61 A;  2GIV A;  4BY7 J;  5DDG A;  4E7H A;  3MWM A;  1H9G A;  4XL9 A;  2JA7 J;  4WXD A;  2Y9Z A;  1MMG A;  4A6D A;  5H6Q A;  4JBA A;  1FOY A;  3LSP A;  2B7E A;  4RMN A;  3C2G A;  3L2V A;  1Y8R B;  2GAU A;  2QQB A;  2OTL I;  3HKZ A;  3RPQ A;  5IT9 K;  2NVT J;  4ZDO A;  1HW5 A;  3HTU A;  2RNJ A;  4M9Z A;  1IUY A;  2AQE A;  1I27 A;  3DTE A;  1JKR C;  1X1C A;  3WHB A;  2XF7 A;  4Z2Y A;  4EVI A;  2W57 A;  2K4J A;  1E0E A;  5F08 A;  5E1W A;  4XM3 A;  1P4X A;  1ZYR F;  1XSX A;  2M3A A;  1RC9 A;  3SFZ A;  1W7P D;  4II3 A;  4XN0 A;  1QHG A;  1TQM A;  1P92 A;  2X9D A;  3OMY A;  3S1R J;  3V8K A;  2OPT A;  2DA3 A;  4D7M A;  3ELK A;  4ESF A;  4BHC A;  2PEX A;  1LPQ A;  3R0A A;  1X58 A;  4G94 A;  2DA1 A;  2H09 A;  1TLH B;  5H2F C;  5K5O A;  1B6A A;  3GZ6 A;  1UAA A;  3QPH A;  3WTY C;  3MN2 A;  1SAN A;  2GOX B;  3T0Y A;  2EFO A;  1S5L C;  3VOD A;  3DPU A;  1VI0 A;  1VQK I;  1O7L A;  3EYY A;  1FNN A;  2PBI A;  3TO6 A;  1SAX A;  2XRL A;  3M07 A;  4FX0 A;  4BE2 A;  2FJ1 A;  1BJZ A;  1UZC A;  2FOK A;  2DBB A;  2HXI A;  2VJJ A;  2H6C A;  3TBI A;  3WGG A;  4A3F J;  2DOD A;  1APL C;  4RGR A;  1U8B A;  2M0M A;  2BY3 A;  4FE4 A;  1GDT A;  3G71 I;  2K86 A;  3K10 A;  3KFW X;  3TP3 A;  5B5E C;  2EWN A;  3R4K A;  1HXD A;  4G8X A;  3HC7 A;  3OYB A;  4RGS A;  2I5U A;  3E5U A;  1MMS A;  3C7J A;  4XBF A;  3BCB A;  1GHC A;  1BR1 A;  1XSV A;  5JLW A;  3DV8 A;  1W5C C;  3Q3S A;  3VYS B;  3CDI A;  3KCC A;  3FM3 A;  2QVO A;  3CZ6 A;  4IOC F;  2OTJ I;  1G3T A;  4QPO A;  2X6O A;  2X1C A;  2ADU A;  1OPC A;  3H36 A;  2R93 J;  4UNO A;  3L2C A;  4JOM A;  5EG0 B;  2E71 A;  3PQK A;  2EA4 A;  4EJV A;  5LGN A;  4A5M A;  2R7F A;  4J01 A;  2L7F P;  3TL4 X;  2XSD C;  1U2W A;  4UUS A;  2O8K A;  2IGO A;  1TP4 A;  1IDY A;  4PUS A;  3TKY A;  1ZTR A;  1X4O A;  4IQ4 A;  1FTZ A;  3B6C A;  3K4J A;  4L0Y B;  2D1H A;  1IRZ A;  2BOL A;  3BZC A;  4HOB A;  2VPR A;  2E5Z A;  2ZJQ F;  3CUO A;  4ABZ A;  3DU6 A;  4H0E A;  4BBS J;  2DTZ A;  1SFX A;  2M34 A;  4OIN F;  1IN7 A;  4XQF A;  4BUP A;  2FQ3 A;  1O4X A;  3BP8 A;  2DU9 A;  2HOA A;  3IAS 2;  4N9H A;  1TWG J;  1G2H A;  3OOP A;  2HEO A;  2IS6 A;  2L3D A;  1HCR A;  1HBX G;  2KL4 A;  4UHT A;  1QQI A;  2LF8 A;  1FEX A;  1RR8 C;  4MLO A;  4XMY A;  3MKL A;  1HST A;  1QZY A;  1OCT C;  1DUX C;  3MCZ A;  3DF8 A;  2AS5 F;  1FOK A;  3J81 K;  1GVJ A;  1AKH A;  4CH7 A;  4BXF A;  2QZ8 A;  4M9S A;  1TWF J;  2ETH A;  3G73 A;  4KDP A;  2LLK A;  3ZGK A;  2E7X A;  3JRB A;  3AL0 B;  3MEX A;  4I7H A;  2RAE A;  5DV5 A;  2VBY A;  2HKX A;  3GWZ A;  1BOA A;  1KYW A;  4BAY A;  2QBY A;  3RJP A;  4XID A;  2YX4 A;  4RLF A;  2MD5 A;  3WTZ A;  3G6E I;  2A07 F;  1X2N A;  1QHH D;  5J3L A;  1T56 A;  1TQI A;  5K7H A;  3DKY A;  3FXK A;  1MW7 A;  4XOT A;  4ASN A;  2KHM A;  2M8G X;  3ULQ B;  1R5G A; 
#chains in the Genus database with same CATH homology
 1IAW A;  1OMI A;  1YG2 A;  1ZRC A;  5L3B A;  3WTX C;  1R58 A;  4G7H F;  4NQW A;  4DNC A;  3FXU A;  5CYV A;  3IL2 A;  5ICC A;  2FRH A;  2DI3 A;  1U5T C;  2XAQ A;  3RYP A;  5D5V B;  3ML6 A;  2XRN A;  4KMF A;  2GWR A;  3IHU A;  5E17 F;  5BOX A;  3KZY A;  3W6K B;  5EEH A;  1ZG3 A;  2ZBK A;  3VEP A;  4IF4 A;  3ABU A;  4Y13 A;  5K5Q A;  2EK5 A;  3PQJ A;  4EM1 A;  4KN4 X;  3E5X A;  4L18 B;  3BZ6 A;  1ON2 A;  2EFQ A;  4RAZ A;  1WQ2 A;  3EYI A;  1PUE E;  4M6Y A;  1FZP B;  4EJT A;  1E17 A;  2HTS A;  4Q4Z F;  1USS A;  4ESB A;  2OQR A;  4HX8 A;  2Z5U A;  3CUQ B;  4R79 A;  2UZK A;  1TW2 A;  2DLL A;  2YSR A;  3BWG A;  1IN6 A;  1FSE A;  2BE5 F;  4RB2 C;  3WU1 B;  1BM9 A;  2Q2E A;  1MJA A;  1U78 A;  5FGM A;  5FD6 A;  1FP1 D;  1J7K A;  2JTV A;  2FEZ A;  3K1N A;  5HS9 A;  3U9G A;  5JVT A;  4P55 A;  5FD5 A;  3F23 A;  2M5W A;  2K27 A;  1U8R A;  1UFM A;  2PMU A;  1YO5 C;  4A0Z A;  4L5I A;  3SQN A;  3HYI A;  1R1U A;  4NHJ A;  4F7Z A;  4I01 A;  1T98 A;  4G6D A;  3QP5 A;  4R1H A;  2J5P A;  2IJL A;  3ZMD A;  3FZV A;  1XSD A;  1GXQ A;  3MZH A;  2PMH A;  4LLG F;  5ICE A;  1S3J A;  1D3Y A;  3E6D A;  4N9I A;  2YPR A;  2VT3 A;  1G3S A;  4ETS A;  3WTW C;  3KP7 A;  2FBI A;  3TOB A;  4A5N A;  4KA4 A;  1YW9 A;  6PAX A;  4A6E A;  1J2X A;  3FX3 A;  1F1Z A;  1G6N A;  4G7O F;  2D45 A;  2RDP A;  2BEO A;  3NEU A;  3FF5 A;  2A69 F;  4MEY F;  1FLI A;  1B9N A;  4RAY A;  1ZLJ A;  2Z3Y A;  2XRO A;  4U0Y A;  1HW1 A;  1K6O A;  2EFN A;  4LFU A;  3M8E A;  2RN7 A;  1ON1 A;  4RGU A;  5DD4 A;  1UCR A;  1Z6T A;  1OR7 A;  4IVN A;  4PCQ A;  1IRG A;  1XCB A;  3FMR A;  3FXR A;  1IXR C;  4KNY A;  2HDC A;  1EH6 A;  4LB5 A;  3HSR A;  2L4A A;  3L9F A;  5BPD A;  2STW A;  1RNL A;  5LHG A;  1P2F A;  4KN7 X;  2VBX A;  1LDD A;  3K69 A;  4WWC A;  3E6B A;  3O2P E;  1LQ1 A;  2PN6 A;  3ROU A;  1B1B A;  4IRI A;  2F5F A;  4BNC A;  1Z91 A;  1RUO A;  1LNW A;  4YFN F;  1IXS B;  4ZYG A;  4ENM A;  1ZHF A;  2BV6 A;  2JT1 A;  1T6S A;  1I5Z A;  1LEB A;  4LK1 F;  2UXX A;  1O3T A;  1SFU A;  4EM0 B;  5D6F A;  2DFI A;  3GFL A;  4LMY A;  3JW4 A;  2RKH A;  1S29 A;  3IC7 A;  2A61 A;  3IRQ A;  2W84 A;  1ZAR A;  3TO9 A;  3BY6 A;  3H3U A;  3GEZ A;  1FP2 A;  2ZKZ A;  4U0V A;  5L3F A;  3FWE A;  1U5T B;  3VOE A;  5FO5 A;  3BJO A;  3WE3 A;  2XUB A;  1V3F A;  2QYO A;  2VE8 A;  2P5V A;  3F3X A;  2OU2 A;  3EET A;  2JPC A;  2M8E A;  3R61 A;  4HA8 A;  3V7C A;  1LDJ A;  2HTJ A;  1BJA A;  2GA1 A;  3IWF A;  4LG0 B;  2XVC A;  1KA8 A;  4OMY A;  2BGC A;  2H94 A;  1MGT A;  3JTH A;  4DQ2 A;  2BBY A;  4MTE A;  4LLL A;  2JZY A;  3HHG A;  3FXQ A;  4HQE A;  4GYG A;  3V7S A;  4ENN A;  1RUN A;  2XAJ A;  1OKR A;  1ZRF A;  3TQN A;  2QQA A;  3ERE D;  1RI7 A;  2IRF G;  4L9J A;  1DPU A;  4HV6 A;  3COA C;  4KFC A;  2ACJ A;  3K1P A;  4Y15 A;  1R36 A;  3GF2 A;  5IT3 A;  4MGR A;  4UVB A;  3LFK A;  3DKW A;  4KIC A;  2PFB A;  3ISP A;  1MDM A;  3WGH A;  2HFH A;  3LST A;  2HR3 A;  1UB9 A;  1BI2 A;  1R7J A;  2IW5 A;  2A68 F;  1FBQ A;  3SZP A;  2CG4 A;  3EUH A;  1YYV A;  2CFX A;  3RPU A;  3W6J B;  5AIQ A;  3N97 A;  2PLY A;  2QM3 A;  3I71 A;  5LRS A;  1BC8 C;  3D5L A;  3J80 Z;  1FPQ A;  5D5U B;  3QRF F;  2HKO A;  1ZG1 A;  2HGC A;  4L9V A;  2KJB A;  3KLO A;  2MLG A;  1HKQ A;  4U88 A;  4ZYE A;  1Z05 A;  2MH9 A;  3WU0 A;  4B09 A;  2R3S A;  4R8H A;  2A6H F;  2XAH A;  2O6G E;  4IJA A;  4O3M A;  1KU9 A;  2HYF A;  1QNT A;  2LDU A;  4I09 A;  2G9W A;  2RQP A;  4ZZD A;  3K9T A;  3LQQ A;  3DQV C;  4HV5 A;  1R1T A;  1T2K A;  3L00 A;  4L9N A;  4HAM A;  1KQ0 A;  4XSX F;  2DK5 A;  4PGG A;  2JRT A;  3WE2 A;  3M8F A;  1J59 A;  3HUG A;  1XGS A;  2ZNY A;  3KP6 A;  2V6C A;  2FA5 A;  4KMU X;  1J9I A;  3HTS B;  5ILV A;  4UUV A;  3F6O A;  3GXO A;  1XCV A;  1U6G A;  4RB3 C;  1BBY A;  3QP6 A;  4KIG A;  2FF4 A;  4CDG A;  4KT5 C;  2FNP A;  2OA4 A;  2ZME B;  3JAM K;  1EH8 A;  4IPA A;  4UVA A;  3R0J A;  3IWZ A;  4I2O A;  5AON A;  3QOP A;  2QLZ A;  1FX7 A;  4M74 A;  4KIB A;  1CF7 A;  2HQR A;  2Q8K A;  1XN7 A;  2W24 A;  1IF1 A;  3LA3 A;  3HSF A;  2V79 A;  3LA2 A;  2OAZ A;  4OIR F;  3ZPL A;  1PP7 U;  2CSO A;  4OIQ F;  3HRT A;  1P4W A;  2W25 A;  4P9F A;  1Z7U A;  4HW0 A;  3VFZ A;  5D4R A;  1IXC A;  1RZ4 A;  2KIU A;  2OD5 A;  2BYV E;  3I59 B;  3J80 K;  3RKX A;  2HZT A;  1B9M A;  2P7C B;  1W7P B;  4CZZ A;  4ZYD A;  1H9T A;  3KLN A;  2RV8 A;  3P9K A;  3IKT A;  5LBQ A;  2R7D A;  1JGS A;  1T38 A;  1AOY A;  2P8T A;  3GX4 X;  5ICG A;  1O7F A;  3F8M A;  2VC1 A;  3BDD A;  4P9U A;  1JHH A;  3GVA A;  3H92 A;  2EB7 A;  4M6X A;  3WTU C;  1S7A A;  4GGG A;  2M1B A;  1TTY A;  2JPB A;  4PZJ A;  3LAP A;  3T1B A;  2FMY A;  5F1R A;  4UV9 A;  5CJ9 A;  4HDV A;  4BH9 A;  1TNT A;  2M87 A;  2NNY A;  4MQV A;  1OYI A;  2PI0 A;  5HDG A;  1KU7 A;  3HHH A;  3QAH A;  1QPM A;  5LHH A;  4XSZ F;  2UWM A;  2GXG A;  3EDP A;  5FB2 A;  4L5J A;  2P6T A;  2Y0M A;  4ON0 A;  1YIO A;  2C6Y A;  4K2E A;  2LF7 A;  1A04 A;  5H20 A;  4L0Z B;  1C0W A;  3ZMU A;  5E20 A;  4EJO A;  3DP7 A;  1K78 B;  3AAF A;  5D8K B;  4EV0 A;  4HF2 A;  1ODD A;  3WG9 A;  2D2W A;  3V7R A;  3O6B B;  2DW4 A;  1Q1H A;  4JQF A;  2F2E A;  2XV4 S;  3HSE A;  4YFK F;  4AIJ A;  3Q9V A;  1SD4 A;  1QZZ A;  2EFP A;  4AVP A;  5DCM B;  3CO6 C;  3C18 A;  1O3Q A;  5DCF A;  1ONV A;  3KE2 A;  3L09 A;  5FLX Z;  3K2Z A;  2ISZ A;  4QWQ A;  4AWX B;  3M1E A;  3D0S A;  1O3R A;  3C3W A;  1LVA A;  1BN5 A;  1U3E M;  1BIB A;  4CYD A;  5ED4 A;  4BHP A;  1FC3 A;  1FY7 A;  1XD7 A;  2HYG D;  5FFZ A;  2WC2 A;  5LGT A;  1FT9 A;  2ZCW A;  1Z1D A;  2ELH A;  2AXL A;  2XAG A;  1G3W A;  1D8J A;  2VXZ A;  1TW3 A;  3HRM A;  2RVC A;  4RB0 A;  2ESN A;  5HDN A;  3PFI A;  4Y17 A;  2G7U A;  4EMS A;  5L3C A;  1DPR A;  1WKM A;  4MEX F;  4ZYH A;  3NRV A;  5J6X A;  3CJN A;  1OYY A;  2X0L A;  3E97 A;  1HQC A;  2PQ8 A;  5AIP A;  1XGO A;  1MD0 A;  5TJJ A;  1R00 A;  2DO7 A;  2HQN A;  3I58 A;  3TOA A;  4KYW A;  1HKS A;  1IN8 A;  2VE9 A;  2HS5 A;  2UXN A;  2IA1 A;  5HS7 A;  1WSU A;  1J75 A;  4HX7 A;  3I4P A;  4ENK A;  4IHT A;  4AIK A;  1Z6R A;  1LJ9 A;  1JE8 A;  1ZH5 A;  1SD6 A;  4YII A;  2L01 A;  4P5O A;  2DQL A;  4WXH A;  3BJ6 A;  3S2W A;  2COM A;  4A0Y A;  5HLI A;  3GFM A;  5L3E A;  3DPL C;  3NQO A;  3U2R A;  2FE3 A;  4G6Q A;  3GLX A;  3ZMS A;  1XB4 A;  2FML A;  4HLX A;  3JSP A;  1XDS A;  4HBL A;  3K0L A;  3RIR A;  3V4G A;  1TBX A;  2ZXJ A;  1OYW A;  3GYH X;  1T0F A;  4ZZL A;  3WTS C;  1HW2 A;  4FT8 A;  1WRJ A;  4HQM A;  4GO1 A;  3CLO A;  3E5Q A;  4L9T A;  4I02 A;  2YR2 A;  2DTR A;  5D5X B;  5E1X A;  3IRR A;  5FLX K;  2GQQ A;  1FYL A;  2GXB A;  5H6R A;  2CO5 A;  5KVR A;  3CUQ A;  3DEU A;  5JHU A;  1K7A A;  2HOE A;  3IKV A;  1ZAO A;  4G7Z F;  2NS0 A;  2P7V B;  3ZP5 A;  5DYM A;  4CIC A;  5J8C A;  4HLY A;  1DDN A;  1H0M A;  2QEN A;  4QLC U;  5LHI A;  3TO7 A;  1W5S A;  2XAS A;  4BQA A;  4M73 A;  1SFE A;  2MH2 A;  2F5D A;  2Y48 A;  2EFW A;  1YW8 A;  3RI4 A;  3KEQ A;  1F5T A;  1IN5 A;  4CHU A;  2DQR A;  3JAM Z;  4WF2 A;  4YG2 F;  5D8L B;  3KP4 A;  3I64 A;  2QBY B;  5A2Q Z;  4IRH A;  5D5W B;  1SD5 A;  3T5X A;  4MNU A;  3SHF A;  4HF0 A;  2J5O A;  5BPI A;  5E1Z B;  2WWY A;  3JTG A;  4WK8 F;  4NB5 A;  4AIH A;  3M9A A;  3V8L A;  5CVJ A;  5BQT A;  3F8N A;  2DK8 A;  2H6B A;  2F5C A;  1O57 A;  3HOT A;  3LWF A;  3E6M A;  2ZFW A;  3OV8 A;  2IVM A;  5KK1 A;  5CVU A;  3KP3 A;  1F4K A;  2YX7 A;  3REO A;  3E3V A;  3LAJ A;  2P5K A;  3CUQ C;  1YLF A;  2DAO A;  4ESJ A;  4Q48 A;  1KU3 A;  3WTT C;  4OOI A;  3MFK A;  1ZLK A;  3ECH A;  3H3Z A;  2DT5 A;  4EGZ A;  3JSO A;  4UV8 A;  4UVC A;  1O3S A;  1XDU A;  3M7G A;  3ZN0 A;  4GXO A;  4ZH4 F;  3R60 A;  4FHT A;  4I0A A;  2ZNZ A;  2Y75 A;  2M30 A;  3FMQ A;  3Q5F A;  4WXC A;  3F72 A;  3GFI A;  1MJ9 A;  2P5L C;  3ZMT A;  2XHK A;  1LB2 A;  4EM2 A;  2WV0 A;  5CVV A;  4FX4 A;  4HF1 A;  2OQG A;  4I0B A;  4A12 A;  2VT2 A;  3O3K A;  1REP C;  3F6V A;  3KP5 A;  4GYI A;  1YS7 A;  2Z9O A;  1P6R A;  1I6X A;  2TDX A;  3F22 A;  3B02 A;  2IP2 A;  2Z99 A;  1ZRE A;  4UXN A;  4Q5S F;  4XLP F;  4Q47 A;  1I1G A;  1UHM A;  1YFH A;  2O03 A;  4OIO F;  4G9Y A;  4OIP F;  1ZGA A;  2IA2 A;  4LK0 F;  2K7L A;  4CGZ A;  2O8X A;  3HIF A;  1B4A A;  1YQA A;  4A2U A;  2NRA C;  3ZQ7 A;  5FFX A;  3RDI A;  2VON A;  3BPV A;  4LB6 B;  1YW7 A;  2STT A;  2CQK A;  1U5T A;  4OMZ A;  5A2Q K;  3I5U A;  3V8J A;  3Q9S A;  3SXY A;  2E7W A;  3LA7 A;  2RGV A;  2G7H A;  2VBW A;  4EJU A;  1J5Y A;  3BOQ A;  3KZZ A;  1STZ A;  4GCV A;  4WX9 A;  4RGX A;  1TQP A;  1SD7 A;  5DEQ A;  4LG0 A;  4XRF A;  2B0L A;  1D8K A;  2L54 A;  1J0R A;  2ESH A;  1T39 A;  4N0B A;  2CGP A;  2EV0 A;  2Q0O A;  1YTY A;  5K1Y A;  1XGM A;  2KIF A;  5LEK A;  4KUM A;  3I0T A;  1PP8 F;  3U1D A;  3ZMV A;  4S04 A;  4B8X A;  4HX4 A;  2MLK A;  3ECO A;  4OU0 A;  4RS8 A;  4E70 A;  4HDU A;  1S6L A;  4BYY A;  2VC0 A;  5CVR A;  2VOD A;  1GXP A;  1G4D A;  2ZO4 A;  1XGN A;  1FWZ A;  2FBH A;  4KIF A;  2FU4 A;  1IRF A;  5TRD A;  1WWX A;  3ZN1 A;  3BPX A;  2VOO A;  2VN2 A;  3E6C C;  2A5Y B;  2KRF A;  5LGU A;  1JXS A;  2E1C A;  4TV7 A;  3T8R A;  1L3L A;  3L7W A;  5DUI A;  1R23 A;  2L02 A;  5L3G A;  2JSC A;  1ZRD A;  1FYM A;  5E8I A;  5HDK A;  1KQ9 A;  4O6J A;  2FXA A;  3WTV C;  2QQ9 A;  2HWV A;  2EV5 A;  4HZF A;  2IPQ X;  1D5V A;  5ILU A;  3TDU C;  2MBF A;  2QWW A;  1Y0U A;  4CXF A;  2OBP A;  2EV6 A;  5F6F A;  3G3Z A;  2LNB A;  3WOD F;  2NAZ A;  1F9N A;  2V9V A;  1QO0 D;  3RTR A;  4M72 A;  2NNN A;  1MKM A;  2FBK A;  2WTE A;  1V4R A;  3GW2 A;  2QUF A;  1PDN C;  5HS8 A;  4EGY A;  4HYE A;  2L4M A;  1KU2 A;  5E8G A;  1SMT A;  2VOP A;  4IXA A;  3RYR A;  5HOO A;  4EJW A;  1XMA A;  3B73 A;  2Z33 A;  2D1V A;  5J8F A;  5DD8 A;  4BXU A;  3GO5 A;  2DPU A;  5D4S A;  4U0W A;  2OZU A;  5F64 A;  3BRO A;  4D0P A;  3RKW A;  1WI9 A;  2FNA A;  1FYK A;  4S05 A;  3KET A;  1YS6 A;  1MZB A;  3KP2 A;  5E18 F;  1QGP A;  3GUD A;  2KKO A;  1MDM B;  5HVQ C;  2PG4 A;  2CYY A;  5BS6 A;  3CTA A;  3QU6 A;  1R22 A;  4CO8 A;  5JR3 A;  5EEG A;  3DFG A;  3KEO A;  2MA3 A;  3MAJ A;  1FSH A;  1EV7 A;  5ERI A;  2ZME A;  3MQ0 A;  4ENJ A;  1P4A A;  3K1M A;  3F21 A;  4I98 B;  1TNS A;  5K5R A;  2PJP A;  4IHS A;  4LJZ F;  1E2X A;  5HLG A;  2ISY A;  5JI6 A;  1UST A;  2RC4 A;  5HLH A;  1KGS A;  3F8F A;  1BI0 A;  2DPD A;  1KYZ A;  1B59 A;  4LGW A;  3T8T A;  3TGN A;  1MJB A;  3DPT A;  4EQQ A;  2A3S A;  3DXJ F;  3BJA A;  4U7D A;  5DUK A;  1Z9C A;  2E1N A;  5ILS A;  3HRS A;  3P7N A;  3MZY A;  2OZ6 A;  3I59 A;  1R5H A;  4RB1 A;  1KQ8 A;  4WCG A;  1W7P A;  2KJC A;  3I53 A;  1XMK A;  2NYX A;  3FM5 A;  3GFJ A;  2V1D A;  3SZT A;  1FBU A;  2EJR A;  2KIM A;  2A6E F;  4MHG A;  1FBS A;  4YFX F;  2H27 A;  3TDZ C;  1K79 A;  1ZN2 A;  3P9I A;  1EH7 A;  4IRG A;  1W4M A;  1QBJ A;  1HKT A;  2XGX A;  5LEJ A;  2M45 A;  2XKP A;  1CGP A;  4LLN A;  5IT9 Z;  1IN4 A;  4MTD A;  5ICF A;  4LD5 A;  1IZ1 A;  1BI1 A;  2K4B A;  4O5V A;  1NHA A;  4PDK A;  2P4W A;  1UHW A;  2LSO A;  4P96 A;  2XAF A;  1I1S A;  3VB2 A;  1S8N A;  2EA2 A;  1RIO H;  3J7A O;  3P9C A;  3GZ5 A;  2IT0 A;  4M71 A;  5LRR A;  1R1V A;  1L0O C;  3ABT A;  1CF7 B;  2YU3 A;  2MC3 A;  1G3Y A;  3FHZ A;  1ULY A;  1DP7 P;  1W5T A;  1K78 A;  2XKO A;  3C1D A;  3F8C A;  1VTN C;  2CWE A;  4JK1 X;  3HRU A;  4U7B A;  1IW7 F;  3LQR A;  3R6S A;  3QU3 A;  2F5E A;  2V1X A;  2K02 A;  3WGI A;  4XLN F;  2GA2 A;  4YIF A;  5CVI A;  1BI3 A;  3RKY A;  3ZMZ A;  2FSW A;  2O3F A;  4AD9 A;  5DCM A;  3F8B A;  3CO7 C;  3I54 A;  4M9X A;  4BHB A;  1HSJ A;  1LEA A;  3FMS A;  1BIA A;  2V1U A;  5D6E A;  1JHF A;  2LKP A;  3EQL F;  1BC7 C;  2XIG A;  5CLS A;  2O0Y A;  2VBZ A;  4MQ9 F;  1AWC A;  3J81 Z;  3CDH A;  2X4H A;  1X3U A;  3N4M A;  5LLQ A;  2W85 A;  4PGH A;  1S7O A;  2CW0 F;  1ZGJ A;  1SMY F;  5BMZ A;  2ZJ2 A;  1LDK B;  2IA0 A;  5JFR A;  1ZG5 A;  5L3D A;  4A0X A;  3HOS A;  2GZW A;  3QPT A;  2P6S A;  2O61 A;  2GIV A;  5DDG A;  3MWM A;  1H9G A;  4WXD A;  4A6D A;  5H6Q A;  4JBA A;  2GAU A;  2QQB A;  5IT9 K;  3RPQ A;  1HW5 A;  3HTU A;  2RNJ A;  4M9Z A;  1IUY A;  1I27 A;  4Z2Y A;  4EVI A;  2W57 A;  2K4J A;  5E1W A;  1P4X A;  1ZYR F;  1XSX A;  3SFZ A;  1W7P D;  1TQM A;  1P92 A;  3V8K A;  3ELK A;  4ESF A;  4BHC A;  2PEX A;  3R0A A;  4G94 A;  2H09 A;  1TLH B;  5K5O A;  1B6A A;  3GZ6 A;  3QPH A;  3WTY C;  3T0Y A;  2EFO A;  3VOD A;  1O7L A;  3EYY A;  1FNN A;  2PBI A;  3TO6 A;  1SAX A;  4FX0 A;  2FOK A;  2DBB A;  2H6C A;  3WGG A;  4RGR A;  2K86 A;  3KFW X;  2EWN A;  3R4K A;  1HXD A;  4G8X A;  4RGS A;  3E5U A;  3C7J A;  4XBF A;  1GHC A;  1XSV A;  3DV8 A;  3KCC A;  3FM3 A;  2QVO A;  1G3T A;  2ADU A;  1OPC A;  4UNO A;  3L2C A;  4EJV A;  5LGN A;  2EA4 A;  3PQK A;  4A5M A;  2R7F A;  1U2W A;  3TKY A;  4L0Y B;  2D1H A;  4HOB A;  3CUO A;  4H0E A;  1SFX A;  4OIN F;  1IN7 A;  2FQ3 A;  3BP8 A;  2DU9 A;  4N9H A;  3OOP A;  2HEO A;  2L3D A;  1HBX G;  4UHT A;  1QQI A;  2LF8 A;  1HST A;  1QZY A;  1DUX C;  3MCZ A;  3DF8 A;  2AS5 F;  1FOK A;  3J81 K;  1GVJ A;  2QZ8 A;  4M9S A;  2ETH A;  3G73 A;  4KDP A;  2E7X A;  3MEX A;  4I7H A;  5DV5 A;  2VBY A;  2HKX A;  3GWZ A;  1BOA A;  1KYW A;  4BAY A;  2QBY A;  3RJP A;  2YX4 A;  2MD5 A;  3WTZ A;  2A07 F;  1TQI A;  4ASN A;  3ULQ B;  1R5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...