3KP2A

Staphylococcus epidermidis tcar in complex with penicillin g
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
149
structure length
137
Chain Sequence
RRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation/antibiotic
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
total genus 53
structure length 137
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp2A00
4P9FA 4YIIA 2QBYB 1OYWA 2HYFA 4OIQF 4YFXF 1KU2A 3WGHA 5K5QA 4HQEA 2LSOA 3LAPA 4HBLA 1RI7A 4UVAA 4M72A 2FBIA 4KIBA 2HKXA 3HOSA 3WU1B 3T5XA 3FWEA 3IC7A 2KJBA 1TQPA 1ZLJA 3C1DA 4M9ZA 2GIVA 2ETHA 1BJAA 1JGSA 4K2EA 1ZGAA 5E17F 3I4PA 1ZRCA 3G73A 1W7PB 5DUKA 5CYVA 2ISYA 4LLGF 1MDMB 3GFLA 1WRJA 1TW3A 2G9WA 3I58A 1KU3A 2YX7A 4IRIA 5D6FA 1RUNA 2ZFWA 5LBQA 4U0WA 3JTHA 2F5FA 3C18A 4RGUA 1WQ2A 1S29A 3LQQA 2QLZA 4A0XA 2GQQA 2HR3A 2ZNZA 4LG0B 5HS7A 2V9VA 1J5YA 1BI3A 3TQNA 3LA3A 1HKQA 2GZWA 5LHIA 3SZPA 3WG9A 5FLXK 3K1PA 4CGZA 2QQ9A 1GXPA 3LQRA 1IN8A 4CYDA 1KU9A 1KA8A 3GYHX 2P6TA 1ON1A 2E7XA 3WTYC 2NNYA 3DPLC 2WWYA 5BOXA 1XGSA 1H9GA 3M7GA 1FP1D 2X0LA 4S04A 2YX4A 2PI0A 3WTSC 1B9MA 1H9TA 2IRFG 2OZ6A 2DQLA 4XSZF 4LMYA 3ISPA 4G7OF 1YW9A 1XGMA 4KNYA 3GO5A 4ENKA 4PCQA 1W7PA 2EFOA 2BBYA 3TOAA 5D5UB 2IJLA 1GHCA 1ZRDA 2QENA 1I6XA 2E7WA 2JT1A 4AD9A 1KQ8A 1YFHA 1OKRA 4YFNF 2RGVA 5CLSA 1B4AA 1UHWA 2ISZA 2O61A 2QUFA 3DV8A 1F4KA 5ILVA 3WTTC 3V8JA 2CGPA 4R1HA 5EEHA 6PAXA 1IXCA 1FSEA 4XBFA 2K27A 1QQIA 4YFKF 1Z05A 4IVNA 3E6MA 4OU0A 3GEZA 3LSTA 3RKWA 1R1UA 2VBYA 4WXHA 2OZUA 2NAZA 3KE2A 3GWZA 4JBAA 2G7HA 1R23A 1F9NA 4RGRA 4U88A 5FO5A 3Q9SA 2V79A 3MAJA 5K1YA 1R22A 2WV0A 4HX4A 4EQQA 4CZZA 2W85A 3TKYA 1R7JA 2STWA 2P5KA 3QU6A 4LLLA 3GXOA 1O3TA 4OMZA 3JSOA 1J2XA 5CVIA 1KU7A 3WGIA 2QZ8A 2L4MA 3VOEA 4L5IA 2XAGA 2OD5A 2HQRA 3MFKA 3FMQA 1ONVA 1QZYA 3O6BB 3N97A 1OR7A 1FBSA 5HLHA 1XCBA 1IRFA 4TV7A 4RGXA 3O3KA 4PDKA 3HUGA 1FY7A 3I59B 4Q5SF 2Y48A 3GFIA 3HRSA 1IF1A 3WU0A 2BEOA 4LK1F 1C0WA 4I09A 4RGSA 1Z6RA 2P4WA 2VE9A 4HF2A 3CLOA 2H6CA 2Z5UA 1XSVA 1OYYA 2VBWA 5JI6A 3KETA 2FBHA 1UHMA 1XSXA 3ZMTA 3RTRA 3COAC 2Z9OA 5FB2A 5BQTA 1YYVA 1LNWA 5F1RA 4KUMA 4EGYA 3P9IA 3FXUA 3QPHA 3CO6C 2K7LA 4HF0A 4ESJA 5E8IA 3KP4A 4R8HA 1SFUA 5D5WB 2TDXA 2PMHA 2D1VA 5LRRA 1F5TA 5E1XA 3IHUA 2XKPA 4ASNA 2H09A 3D0SA 3L2CA 1R5GA 4ESBA 4M73A 1LDDA 2FSWA 4IRGA 4UXNA 4RB1A 3HTUA 3CUQC 2DI3A 3K1NA 2NNNA 2XAFA 4LK0F 2VE8A 1DUXC 2LDUA 1I5ZA 3E97A 5DD4A 3SZTA 5LGTA 1B6AA 2XRNA 5FGMA 5DEQA 1USTA 5L3DA 1XMKA 2ELHA 1GVJA 1S7OA 3QPTA 2RQPA 4U0VA 4BYYA 1FLIA 2V6CA 2JPCA 3QP6A 3PFIA 3F72A 2VT2A 3WE3A 3I54A 3VEPA 5JR3A 1ZHFA 1R5HA 3F8MA 3QRFF 2MD5A 4OOIA 1HQCA 3R0JA 2QWWA 4OMYA 1KQ9A 4A5NA 2J5OA 1IN5A 3ZN1A 1EV7A 2EB7A 2RVCA 2KIMA 1T98A 5L3CA 5D6EA 2EV5A 2M5WA 4S05A 4EV0A 1G3TA 1D3YA 3H92A 2GAUA 3AAFA 4ENMA 1YG2A 2VXZA 1WKMA 4KN7X 4I0BA 2K4JA 3FM5A 3IL2A 1W4MA 4F7ZA 5HLGA 1TLHB 2F5CA 1YTYA 1ON2A 4Z2YA 3CDHA 3F3XA 4WK8F 4HX8A 4P96A 2EA2A 1YLFA 2FXAA 2OQRA 3TGNA 2DFIA 3WTWC 3HTSB 4QWQA 2P8TA 1D8JA 1U3EM 2DTRA 2HFHA 2VOPA 2OBPA 3U9GA 3BDDA 3ROUA 1IXSB 2D2WA 3S2WA 3WTUC 3F23A 3DPTA 3I64A 2Q2EA 4GCVA 5E1WA 3T8TA 5J6XA 3E6BA 2ZCWA 1BC8C 5LGUA 4UHTA 4KIGA 2CG4A 3BROA 1T2KA 1I1GA 5D4SA 2H6BA 4RAZA 2R7FA 2ZMEA 2FQ3A 2AS5F 1Z6TA 3CUQA 1ZRFA 2HKOA 2DT5A 4HAMA 5JFRA 5BPDA 2FF4A 1ZAOA 2PLYA 5FFXA 2RKHA 3GVAA 5L3GA 3HSFA 1R1VA 3F6OA 5JVTA 1S8NA 2FE3A 5D5XB 4G7ZF 4LGWA 3ZPLA 3N4MA 3VFZA 3FZVA 1ZG5A 3DXJF 5ICEA 2OU2A 1OPCA 1YIOA 4I98B 3RDIA 1XN7A 1Q1HA 1YQAA 2FA5A 2K4BA 3MEXA 4ZYHA 4QLCU 1SMYF 3I0TA 4UVCA 5ILSA 3L09A 3VB2A 2FMYA 3G3ZA 2QQBA 2HZTA 5D4RA 3E3VA 4A12A 4Q47A 5L3BA 2L3DA 1RZ4A 1U6GA 1B9NA 2XV4S 5ICFA 4HV5A 4LFUA 3K2ZA 3SQNA 3CUOA 3SFZA 2ADUA 3LA2A 4EVIA 2PMUA 3R61A 4ZYEA 4I7HA 1FSHA 1J59A 3WTZA 2E1NA 3ZMZA 1LJ9A 1R00A 4EM2A 3MQ0A 5CJ9A 3K0LA 1G3WA 2BV6A 4XLPF 2QQAA 1R58A 4LJZF 3GZ6A 4CICA 2COMA 3REOA 2A68F 5LHHA 1BM9A 1FT9A 5A2QZ 2O6GE 1Y0UA 4ZH4F 3JTGA 4L5JA 3KP3A 3EUHA 3I71A 4AVPA 4MEYF 4O5VA 2Z3YA 4A2UA 5F64A 2QM3A 2UXXA 2EFQA 4HOBA 4IXAA 4MGRA 1ZARA 1Z1DA 4EGZA 3EDPA 1HSTA 3KP6A 4ZYDA 1G6NA 4M9SA 1G3YA 4IRHA 4OINF 2DPDA 4HF1A 4ETSA 3GFMA 5LEKA 3ZMUA 3V8KA 2WC2A 2MH2A 3WE2A 3WTXC 5IT9K 1LEBA 4HZFA 1T39A 2IA1A 4OIRF 2IA0A 1SFXA 1LEAA 1XSDA 2VT3A 2CQKA 1HSJA 3KLOA 5ED4A 3GUDA 3E6CC 5HS9A 4MQVA 1BI1A 5ICCA 4AIHA 5HDKA 5LEJA 2MH9A 4WXCA 3B02A 1CGPA 3W6JB 1J0RA 2OA4A 2XKOA 4BHCA 4HLYA 3BPVA 4GO1A 3E6DA 1I27A 5DUIA 1FYMA 5IT3A 3L9FA 4ZZDA 1U5TC 5AIQA 5CVRA 1AOYA 2GA1A 1J9IA 1D5VA 1FWZA 3ZMDA 4ZZLA 2DU9A 2XROA 2VOOA 1QZZA 1P2FA 3E5QA 4EJTA 1S3JA 2W25A 1UB9A 1XDSA 2EV6A 4FX4A 4AWXB 2IVMA 3T1BA 2XASA 4I2OA 4WX9A 2LKPA 2IA2A 2FU4A 4UVBA 5D8LB 2Q0OA 4IPAA 1USSA 1IXRC 3NQOA 4U7DA 3ECHA 2FRHA 1K6OA 3E5XA 4H0EA 3R4KA 5E18F 4EM1A 2K86A 2D45A 4EJOA 2JPBA 4IHTA 3KZYA 2RC4A 3F8CA 5D5VB 3RPQA 4BHPA 4XSXF 1WSUA 1HKTA 4G8XA 5AIPA 3D5LA 1JXSA 5EEGA 3KCCA 3BOQA 2PFBA 2D1HA 2IW5A 3U2RA 3FMSA 4GXOA 3RYPA 5ILUA 1ZREA 3HYIA 1O7FA 2P7VB 1S6LA 2PN6A 2RV8A 3R0AA 3EETA 2R7DA 4IHSA 5F6FA 3KZZA 2HYGD 3M8FA 1ZLKA 1FC3A 1T38A 1KYZA 4M74A 2ZNYA 1LQ1A 5L3EA 4U0YA 4L0ZB 3RKXA 1XDUA 3TDUC 2L4AA 2K02A 3CTAA 2UWMA 2KIFA 4NHJA 4G9YA 3IRQA 2ZXJA 4UUVA 2VONA 3GFJA 1B1BA 1U5TA 4EJVA 5AONA 4CO8A 4A0YA 2A07F 5IT9Z 1MGTA 1T6SA 5CVUA 2IPQX 2W24A 1HW2A 1BIAA 4Y13A 4RB3C 1YW7A 2EV0A 3LA7A 4MNUA 5HDGA 4CHUA 1IN4A 3BZ6A 3JW4A 5CVJA 4RAYA 1KYWA 1L0OC 2KKOA 3HIFA 4HX7A 2ZMEB 1FBQA 5E1ZB 5HLIA 3CUQB 1Z7UA 2MLKA 3NRVA 3F8NA 2XVCA 2C6YA 3ERED 3IRRA 1BC7C 4BAYA 1EH6A 2A3SA 4P9UA 1CF7B 2XAHA 2DK5A 5KK1A 3CJNA 2XIGA 3J7AO 3ZMSA 2O0YA 3QP5A 5A2QK 1XGOA 1U78A 1TTYA 1HW1A 2CW0F 2YPRA 4A0ZA 4UNOA 1BIBA 3NEUA 3P7NA 1H0MA 3KLNA 2FEZA 4M6YA 2EFPA 3F21A 3LAJA 2CSOA 1IUYA 3RPUA 3Q5FA 4HQMA 3GF2A 3FM3A 1HBXG 4E70A 1MKMA 4M6XA 1REPC 3TO9A 3V7RA 4HLXA 4M71A 1O3QA 1TNSA 3ULQB 3BWGA 3ABTA 1P4AA 3RYRA 4G6DA 2X4HA 2FOKA 3O2PE 4L9JA 3DQVC 2M45A 1IN7A 4Q48A 2HEOA 2HTJA 4I0AA 1EH7A 2NS0A 1BOAA 2HQNA 1MZBA 1V4RA 2GA2A 3TO6A 1QNTA 2LNBA 1CF7A 3HOTA 3ZQ7A 4ZYGA 4EM0B 2OQGA 1KGSA 1RUOA 1OYIA 3C7JA 2EFNA 1ZGJA 3MZHA 3FX3A 1IRGA 1BI0A 1FOKA 2FMLA 1IW7F 1SD7A 4GYGA 1FBUA 3V7CA 5FFZA 3J80K 2ESNA 3C3WA 2ZBKA 4U7BA 2HGCA 1STZA 3FHZA 2XUBA 2KIUA 3SXYA 3BJ6A 4N0BA 5J8CA 1FNNA 1LDJA 2FBKA 2RN7A 1F1ZA 1MJAA 2CWEA 4PGGA 1SD5A 4G6QA 1G4DA 5J8FA 3V7SA 1ODDA 4P5OA 2JSCA 3KP2A 1ULYA 1LVAA 4BNCA 1LB2A 4HDUA 1XB4A 3J81K 4L9VA 1ZG1A 1J75A 1P6RA 3HSEA 4BH9A 2DPUA 3ZP5A 2NRAC 2V1DA 2M87A 4LB6B 1WI9A 4KDPA 4IJAA 3K1MA 2Y75A 1NHAA 2P7CB 1O7LA 3K9TA 3OV8A 4MHGA 2XGXA 1XMAA 4OIPF 2Z33A 1WWXA 3F8FA 4HDVA 3VODA 2AXLA 3I5UA 1ZYRF 1XD7A 1S7AA 2EK5A 2XAJA 2PQ8A 5KVRA 3DP7A 2QBYA 2IP2A 4BXUA 2BYVE 2Q8KA 2QVOA 1TQMA 1MJBA 2DW4A 3L00A 3P9KA 4G94A 1UFMA 4L9TA 5DDGA 5HS8A 3LFKA 1L3LA 1GXQA 3QU3A 3WODF 4KMFA 4L0YB 3HSRA 2M1BA 3IWZA 2HTSA 4JQFA 3WGGA 1UCRA 5BS6A 4A5MA 1SFEA 2J5PA 1YS7A 2LF8A 1FYLA 1SMTA 2DK8A 1YW8A 5HVQC 3V4GA 4NB5A 1XCVA 1Z91A 1V3FA 3TDZC 4JK1X 4BHBA 4KMUX 2VBZA 4IF4A 1EH8A 3HRMA 4ENNA 1MDMA 2L02A 1K7AA 3HRTA 4B09A 2MA3A 4ON0A 2L01A 2EA4A 1P4XA 5H6QA 2VODA 1SAXA 2KRFA 4N9IA 3L7WA 4EJUA 2M8EA 1T0FA 2YU3A 2XAQA 1SD6A 3M9AA 2V1XA 3RIRA 4UV8A 1JHHA 4WXDA 5D8KB 4XRFA 2E1CA 5LGNA 2A5YB 1BN5A 4FHTA 1HW5A 4LG0A 4KFCA 1D8KA 3DEUA 4KYWA 3IKTA 3FMRA 2CO5A 3OOPA 4FT8A 3JAMK 4HW0A 2ZJ2A 4KICA 4MTDA 4WF2A 5JHUA 3Q9VA 4KIFA 1HXDA 3TO7A 4RB2C 1FYKA 2A69F 3EYYA 1PUEE 3R6SA 3QAHA 2ZO4A 1U2WA 1W7PD 1W5SA 2O3FA 1K78B 1RNLA 4I02A 3J80Z 1RIOH 3FXRA 5BPIA 3ZN0A 5FD6A 2ZKZA 4EMSA 5DD8A 3H3UA 2MBFA 1ZH5A 1E17A 3FXQA 2ACJA 4PZJA 1QGPA 1TNTA 4O3MA 1R36A 5DCFA 2GXGA 2STTA 2DO7A 2CFXA 3ECOA 4LLNA 3BJAA 2RNJA 3MCZA 2P6SA 4WCGA 3T8RA 3HHHA 1K79A 3DF8A 2H27A 2IT0A 3J81Z 5DV5A 2W57A 4HYEA 4MTEA 1G3SA 2HOEA 4L9NA 1PP8F 1FX7A 1U5TB 2PEXA 4RB0A 1W5TA 1P4WA 1LDKB 5DCMB 3DKWA 2F2EA 4OIOF 1BBYA 4AIKA 2VC0A 2VBXA 1IAWA 5ICGA 2EJRA 2A6HF 3BPXA 5LHGA 1JE8A 2G7UA 4KA4A 1FPQA 3SHFA 2YSRA 2FNPA 5FLXZ 1ZN2A 2P5LC 2XHKA 2A6EF 3BP8A 5E8GA 4KT5C 4RS8A 2HS5A 4B8XA 2DAOA 2EFWA 4ENJA 1DDNA 2ESHA 1QBJA 5TJJA 1K78A 1DPUA 3BJOA 2PG4A 1SD4A 3KEQA 1BI2A 2Z99A 3ELKA 3IWFA 1VTNC 1U8RA 3H3ZA 1FP2A 2MLGA 2YR2A 3FF5A 1FZPB 3HHGA 5L3FA 2BE5F 4KN4X 1R1TA 3QOPA 4DNCA 5CVVA 4ESFA 3KFWX 3ZMVA 2UZKA 4EJWA 4WWCA 1Z9CA 4Y17A 4D0PA 3RI4A 1O3RA 1DPRA 1YS6A 2RDPA 4UV9A 4MEXF 3WTVC 4AIJA 3IKVA 2QYOA 3EYIA 2NYXA 2A61A 3U1DA 5HOOA 4HV6A 5DCMA 4G7HF 2PBIA 2Y0MA 4PGHA 4R79A 3I59A 2L54A 3GLXA 2V1UA 5LLQA 1A04A 4HA8A 2W84A 3P9CA 1AWCA 2CYYA 4FX0A 5LRSA 3JSPA 3PQJA 3T0YA 4CXFA 2GWRA 2BGCA 5K5RA 2WTEA 1JHFA 3MZYA 1TBXA 3JAMZ 5H20A 3M1EA 3BY6A 2UXNA 5TRDA 4A6DA 2DBBA 2VC1A 4XLNF 1TQIA 4YG2F 3TOBA 3GZ5A 2O8XA 2HWVA 5DYMA 3KP5A 1B59A 3W6KB 2MC3A 3R60A 5BMZA 1PP7U 2VN2A 2H94A 1OMIA 1XGNA 4L18B 4DQ2A 5ERIA 3E5UA 2EWNA 3K69A 2LF7A 3I53A 5FD5A 2JZYA 1KQ0A 1J7KA 1QPMA 2R3SA 1O57A 2HDCA 3ABUA 2F5DA 1MD0A 3B73A 5E20A 1IZ1A 2KJCA 4Q4ZF 4LB5A 3F8BA 4GGGA 3F22A 2FNAA 3HRUA 4M9XA 3GW2A 3KP7A 2B0LA 1IN6A 3EQLF 3RKYA 2PJPA 1ZG3A 4I01A 3KEOA 4Y15A 4N9HA 5HDNA 3DFGA 4NQWA 1E2XA 4CDGA 3PQKA 1MJ9A 3GX4X 4GYIA 4MQ9F 2DLLA 2O03A 3V8LA 1O3SA 3ML6A 2DQRA 3F6VA 1I1SA 1QO0D 1P92A 1DP7P 4O6JA 1HKSA 3MWMA 2JTVA 3RJPA 1TW2A 2JRTA 2GXBA 2P5VA 1X3UA 4LD5A 4P55A 4A6EA 3CO7C 3LWFA 4YIFA 2OAZA 4BQAA 3M8EA 2M30A 2F5EA 1PDNC 5H6RA 1YO5C 5K5OA
chains in the Genus database with same CATH superfamily
4P9FA 4YIIA 1IG7A 2QBYB 1OYWA 3OYHA 2HYFA 2NS8A 3FHNA 4HNUA 2JA8J 4OIQF 4YFXF 1KU2A 3DKXA 3ZRGA 3WGHA 5K5QA 4HQEA 2LSOA 3LAPA 1RETA 2B63J 4HBLA 1YX5A 1MBGA 1RI7A 4UVAA 4XN3A 2LBFB 4M72A 1TT0A 2FBIA 4KIBA 3CMYA 2HKXA 3HOSA 1M1EB 3WU1B 2XC7A 3T5XA 2AO9A 9ANTA 2LD5A 3FWEA 2LOOA 2RNGA 2Y0SN 3IC7A 3IH4A 2KJBA 2DTZA 1TQPA 1ZLJA 3C1DA 3J7AY 2X1EA 4M9ZA 2GIVA 2ETHA 4XLCA 1BJAA 1JGSA 4K2EA 3M3YJ 3S3MA 1ZGAA 3MN2A 3OIOA 2L7FP 2Y2ZA 5E17F 2LC2A 3I4PA 3MKZA 1JTYA 1ZRCA 3G73A 1FOWA 4DW6A 2GOXB 1W7PB 3BG3A 5DUKA 2GBYA 5CYVA 3SYTA 4RDUA 3JR9A 2ISYA 4LLGF 1MDMB 2CV1A 3GTJJ 1P7JA 3GFLA 3S3OA 1SFKA 2VJJA 1WRJA 1TW3A 2G9WA 1WH5A 1KU3A 3I58A 4B3AA 3K2AA 3LNQA 4E6KG 4NNJA 3Q3SA 3A01B 1VF9A 2YX7A 2PMZN 3IP4B 4IRIA 5D6FA 4F3QA 3CDIA 1LUJB 1RUNA 2ZFWA 4JX4A 5LBQA 1BA5A 3CCQI 4U0WA 3JTHA 2KLOA 2F5FA 3H5RA 3C18A 2IEKA 1WQ2A 3NWTA 1S29A 4RGUA 2EINH 1BL0A 3LQQA 1XX5A 2QLZA 4A0XA 2GQQA 3S3NA 1X3ZB 1JT6A 2WV1A 2XGCA 2HR3A 3AG3H 2WB1A 2ZNZA 2W00A 2XPUA 4LG0B 5HS7A 2V9VA 1W0UA 2JA7J 1J5YA 1BI3A 3RCOA 3TQNA 2N8GA 4C3HJ 1AKHB 3LA3A 1HKQA 2GZWA 1A5JA 5LHIA 4IKFA 3VPRA 3SZPA 2LR8A 3WG9A 1F36A 5FLXK 3K1PA 3JRAA 5CKTA 4CGZA 2ME6A 2QQ9A 2OTJI 1GXPA 4IQ4A 2OPTA 2DOFA 2JK3A 3LQRA 1IN8A 5EF6A 4CYDA 1KU9A 1KA8A 3P5JA 3BG7A 3GYHX 2P6TA 1ON1A 3QYFA 2E7XA 1F43A 3WTYC 2WA0A 1HLVA 2NNYA 2LBFA 4E7LA 4FE7A 1LE8B 3DPLC 1IGNA 3HG9A 4BKXA 4QTRA 3FISA 4II2A 3MVPA 3ZQQA 4Y3OA 2WWYA 1MSFC 5BOXA 2PMZA 2BY3A 3PNVA 1XGSA 1H9GA 3M7GA 3FBNB 1FP1D 2X0LA 4M3DA 4S04A 3HOXJ 2HVSA 3S93A 1T95A 2X6XA 5FLMJ 1T56A 2WADA 4E7KA 2YX4A 3FKJA 3H36A 2PI0A 2COBA 5KHDA 3WTSC 2HPIA 1B9MA 1H9TA 2IRFG 2YU9J 2OZ6A 2K9MA 3TW7A 2DQLA 4XSZF 2NS7A 4LMYA 3ISPA 4G7OF 1YW9A 1FEXA 1XGMA 3BR0A 4KNYA 3GO5A 4BE2A 4ENKA 4J19A 2CW7A 4PCQA 2IGOA 1W7PA 3DTEA 1ERDA 2EFOA 5F08A 2E36A 2BBYA 2JVGA 3TOAA 5CQEA 5D5UB 1FTTA 2IJLA 1HCRA 1ZRDA 1GHCA 2QENA 3K6GA 3E7LA 1I6XA 2AQEA 2E7WA 3PUFA 5K7HA 2AHQA 2JT1A 2WY8Q 1D1BA 4AD9A 3S1RJ 1W36C 2L2OA 2DDBA 1KQ8A 3A01A 1YFHA 5EZHA 3CCVI 3ZXSA 1OKRA 4YFNF 2RGVA 3HUGB 5CLSA 1DU6A 1B4AA 1UHWA 2ISZA 2O61A 2QUFA 3DV8A 2DOEA 3OYBA 1F4KA 5EEAA 5ILVA 3HGYA 3WTTC 3DPUA 3VSKA 3V8JA 2CGPA 4R1HA 4BE0A 5EEHA 6PAXA 1IXCA 1FSEA 4RM3A 2Y31A 2HDWA 4XBFA 2K27A 3LSRA 2ZXHA 2HU9A 2PJRB 2VKDA 5JVGF 3CCEI 3GCMA 1QQIA 2JJ7A 1Z05A 4YFKF 5E3LA 3JRFA 1HDPA 3GTLJ 2EZHA 2QKMB 1AKHA 1N77A 4IVNA 2V7FA 3E6MA 4CYCA 4OU0A 3W2AA 3S15J 3GEZA 3LSTA 3RKWA 2L9SA 2M3AA 3AL0B 2V1NA 4A69C 1KONA 1R1UA 3K10A 4YELA 2BXYA 2VBYA 3A2KA 4WXHA 2IGKA 2OJED 2V6EA 2OZUA 1LFUP 2NAZA 1J09A 1R4MB 1W5CC 2PX9A 3GWZA 3KE2A 1VQ6I 2F6CA 2RQQA 4D7NA 4JBAA 2G7HA 5J47A 1R23A 1F9NA 4RGRA 4U88A 4UB6C 2E2IJ 5FO5A 4F93B 3Q9SA 2M0CA 2V79A 1UZCA 3MAJA 2QF7A 3CCUI 3AG1H 3OS0A 4E7JA 1I3QJ 1LE8A 5K1YA 3HOZJ 1R22A 2WV0A 3HKZN 4HX4A 4EQQA 4CZZA 3K4JA 4JX5A 2W85A 2MFZA 3AG2H 5J3LA 3TKYA 3F0CA 3CESA 4RM2A 1R7JA 2KP6A 1VQMI 2STWA 2P5KA 3QU6A 4LLLA 2XF5A 4BY7J 3GXOA 4BDYA 1O3TA 5IYCJ 1ZK8A 2DFHA 1Y6IA 2XB0X 4OMZA 3KX2A 3JSOA 3BTCA 1J2XA 5CVIA 1KU7A 3WGIA 3CCSI 2QZ8A 2L4MA 4GRIA 4NUBA 3VOEA 4CCJA 4L5IA 2ZJPF 2XAGA 2OD5A 2HQRA 2HZDA 4IL6C 3MFKA 1FIAA 2I8DA 3H9JA 4B44A 1NTCA 3PO2J 1SVMA 3FMQA 1ONVA 4BQQA 1QZYA 1H89C 3O6BB 2VPRA 1OR7A 3N97A 1FBSA 4AYBA 5HLHA 2R5ZB 1XCBA 1IRFA 4TV7A 4RGXA 3DU6A 3O3KA 4JOMA 1WJFA 4PDKA 4E7SA 3WG7H 3ZOBA 4A3JJ 1X1BA 3E1SA 1Z3XA 2L7ZA 2JUCA 3HUGA 3S16J 1FY7A 4FISA 2VI6A 1NG7A 3I59B 3W3CA 2BOLA 5IOYA 4Q5SF 2Y48A 1D0XA 4HSRA 3PFYA 3B6AA 3HKZA 3I3LA 3GFIA 3HRSA 1IF1A 3WU0A 2PJRA 1ETYA 1X1PA 2BEOA 3F9KA 4LK1F 1Z77A 3DBHB 1C0WA 4I09A 4RGSA 1Z6RA 1WFXA 2P4WA 2VE9A 4HF2A 3CLOA 1MBHA 3H5AA 2H6CA 2XGDA 1APLC 4I99C 2DMQA 2Z5UA 3TBIA 1XSVA 3FK6A 2CW8A 1OYYA 2VBWA 3IH3A 5JI6A 3KETA 2FBHA 1UHMA 3TMOA 3OYMA 1XSXA 2DMPA 3ZMTA 3RTRA 1ZKGA 4DZPA 1V55H 2A6TA 2W1OA 3COAC 2Z16A 2E1MC 2Z9OA 3K7AJ 2UV1A 4XIDA 5EG0A 1OQYA 2AXTC 5BQTA 5FB2A 1YYVA 2LLKA 1LNWA 5F1RA 3BR2A 3VYTB 3K4LA 4KUMA 4EGYA 3H0GJ 1QZEA 2O7OA 3P9IA 3OWTA 2XSJC 3FXUA 2B7EA 4XN0A 2WAEA 3BCAA 1TC3C 2BZTA 3QPHA 3CO6C 3KEYA 2K7LA 2VASA 4HF0A 4ESJA 5E8IA 3K4MA 3KP4A 4R8HA 1SFUA 2ZJQF 2X51A 1U9NA 5D5WB 2TDXA 2PMHA 2E2HJ 2D1VA 3A4CA 4I76A 2TCTA 1MMSA 5IY5H 1X4OA 5LRRA 1X1DA 2CQNA 2F4IA 3OYCA 1F5TA 5E1XA 2VLAA 3IHUA 2XKPA 4ASNA 2H09A 3D0SA 3OYDA 4IQJA 1U9OA 2ECBA 3L2CA 1R5GA 4ESBA 1MMAA 2M4GA 3AFHA 4M73A 2E1MB 3IAM2 1LDDA 2FSWA 1VFCA 4HRIA 4IRGA 1DGWY 2ZMEC 4UXNA 1G59A 2HOTA 4RB1A 3HTUA 2OCEA 3ZQHA 2KDOA 4XLFA 4RMNA 3CUQC 2DI3A 3K1NA 1SEUA 2KFDA 5K7FA 2NNNA 2XAFA 1LFBA 5C4XJ 3HL2A 4LK0F 2VE8A 2Y30A 4NQWB 4AIDA 1DUXC 1HDDC 2LDUA 3SEZA 1I5ZA 3E97A 3KYCB 3VDXA 1B72B 5DD4A 3SZTA 2CS3A 1NK3P 5LGTA 3OL4A 3G2BA 1B6AA 2KPMA 2V4JC 2XRNA 3PUBA 2ID6A 2IGMA 5FGMA 1RKWA 5DEQA 1USTA 1TT5B 5L3DA 1XMKA 4LIVA 2DXIA 2E35A 2ELHA 1GVJA 1S7OA 2E34A 3QPTA 2DA6A 1HOMA 2RQPA 2Q2EB 4U0VA 4BYYA 2M4KA 1VQLI 1FLIA 2V6CA 2JPCA 3QP6A 4A93J 2LG4A 5IP9J 1YRNA 3PFIA 2DJIA 3F72A 2VT2A 3CJRB 3WE3A 3I54A 3S32A 3FXLA 4KT6A 1G2HA 3ABMH 3VEPA 1QHHD 3CJQB 3TL4X 3CF2A 2IAIA 5JR3A 1ZHFA 4RLFA 4BBRJ 1R5HA 3F8MA 2V9PA 4AC0A 3QRFF 3ERMA 2MD5A 4MLOA 4OOIA 2FJ1A 1QPIA 1HQCA 3ZQLA 1GV2A 2XSDC 3R0JA 2CV0A 2DA3A 2QWWA 3PIOF 4OMYA 1KQ9A 1GLNA 3QODA 4A5NA 2J5OA 1IN5A 3ZN1A 4HNVA 1EV7A 2EB7A 2RVCA 2KIMA 1T98A 5L3CA 3LSJA 3OR1C 5D6EA 2R7UA 3N05A 2EV5A 5IPAA 2M5WA 2FX0A 3V42A 1CQTA 4S05A 1H8AC 1OCZH 4EV0A 1X2NA 1G3TA 1D3YA 3H92A 2QA4I 3PNYA 2GAUA 1ETVA 3AAFA 4ENMA 3IV5A 2JA6J 4MFEA 1YG2A 4CCLA 2VXZA 3I9V2 1WKMA 4KN7X 4I0BA 2K4JA 3FM5A 5E79C 5E3NA 2ZJRF 3IL2A 4XLEA 2DYSH 1W4MA 4LITA 4F7ZA 5HLGA 1TLHB 1OISA 2F5CA 1YTYA 3MD2A 1ON2A 4Z2YA 4CUGA 3CDHA 3F3XA 4WK8F 4HX8A 2EH3A 4P96A 2EA2A 4QSHA 2LVSA 1YLFA 2FXAA 2OQRA 2W7NA 3TGNA 2DFIA 3VYUB 3GTMJ 3WTWC 3HTSB 4QWQA 4CCOA 1MNDA 5F0HA 2P8TA 1D8JA 3H35A 4ZC3A 1U3EM 3CP8A 5HNHA 3JRDA 5F0FA 4CA0A 4BEHA 2DTRA 4M6VA 2HFHA 1A6QA 2VOPA 2OBPA 3U9GA 3BDDA 3GTPJ 4IHXA 2JVHA 4E7IA 3ROUA 5EZGA 1S5LC 1IXSB 2D2WA 3S2WA 4YRVA 3WTUC 3F23A 3DPTA 3I64A 2Q2EA 3HEFA 4GCVA 5E1WA 2LK2A 1BR1A 3T8TA 1R5ID 5J6XA 3E6BA 2ZCWA 4B48A 1BC8C 4BJ5C 5LGUA 4UHTA 4KIGA 2GM4A 2CG4A 3BROA 4B43A 5J4VA 1JI8A 1WVRA 3EUHC 1T2KA 4A3DJ 2VJ5A 1ACIA 3G1OA 1I1GA 3OY9A 5D4SA 1HA8A 2H6BA 4BBSJ 4KITB 4RAZA 2R7FA 1ORKA 2ZMEA 3ZCOA 2FQ3A 3BTLA 3C2BA 1Z6TA 2AS5F 3CUQA 1ZRFA 2HKOA 2DT5A 4HAMA 1JUMA 2NVUB 2BY2A 5JFRA 3OYAA 5BPDA 2FF4A 3PL8A 2L0KA 1ZAOA 3DEWA 3OSFA 3I4MJ 2PLYA 1XTAA 5FFXA 3S8PA 2X1CA 2RKHA 3GVAA 3VYSB 5L3GA 3HSFA 1R1VA 3D5RC 3F6OA 5JVTA 1S8NA 3UKGA 2FE3A 2MGQA 4DBRA 3RZDJ 3BR1A 5D5XB 4G7ZF 4LGWA 5KAFC 3ZPLA 5FLVA 3N4MA 1WHUA 2ECCA 3RPUD 3VFZA 4C3JJ 3Q0VA 3FZVA 1ETKA 1ZG5A 3DXJF 5ICEA 2OU2A 1OPCA 1YIOA 4I98B 2CJJA 3RDIA 1XN7A 4LIUA 1Q1HA 3K70D 1YQAA 2FA5A 2K4BA 4J00A 3MEXA 4ZYHA 4QLCU 1XC5A 2XGEA 3DBRB 1SMYF 4Z6YA 3I0TA 1YOVB 4IZZA 4UVCA 3CJTB 5ILSA 1WPKA 3L09A 1S7EA 4PSWA 4B4CA 3OR2C 2JA2A 1X4PA 3J7ZI 3VB2A 4MFDA 3L2RA 2FMYA 3PM1A 3G3ZA 4NC6A 2QQBA 2HZTA 5D4RA 4CH7A 3OYLA 3E3VA 4A12A 4Q47A 5L3BA 2L3DA 1RZ4A 3BR3A 2ZB9A 1U6GA 1B9NA 2H1LA 3KPHA 3DWLE 3SEQA 3HJEA 5DM6F 2XV4S 3BQZA 5ICFA 2M2EA 4HV5A 4LFUA 4XR6A 3E0JB 5M5XJ 3K2ZA 2LKXA 3VWBA 3SQNA 3CUOA 1LPQA 3SFZA 2ADUA 3LA2A 3OIQA 5B66C 4C2UA 2LFBA 5KCMA 4BXFA 3U1KA 3QOEA 4EVIA 5GPAA 3K4BA 2PMUA 3R61A 3G4SI 4ZYEA 2QEXI 1D1CA 1I39A 2JA5J 1YX3A 5TGTA 1HC8A 3ESWB 1MH3A 5DTDA 2ZXWH 4I7HA 2G0EA 2MYSA 1FSHA 1J59A 3WTZA 5M3MJ 3G1MA 2Y0SA 2E1NA 3ZMZA 1LJ9A 1R00A 4EM2A 4BS9A 1A6IA 1Z3YA 3MQ0A 4CYCB 1QHGA 5CJ9A 2HI3A 1JUPA 3K0LA 2D5VA 1G3WA 3BG6A 2RREA 4LG3A 2BV6A 3FXKA 4XKVA 4XLPF 2VUMJ 1EJ9A 2QQAA 4FASD 2H8RA 4X1EA 4G12A 2R93J 4E7HA 1QRYA 1R58A 4YIRX 2I10A 4LJZF 1JKPC 3GZ6A 1EF4A 4ABZA 1JJ8C 4A3LJ 4CICA 1WJCA 2JRMA 2COMA 1GUUA 1EKEA 3REOA 2A68F 5LHHA 1BM9A 2E1OA 1VQOI 1W0TA 1FT9A 5A2QZ 3GZNB 3RKQA 2O6GE 4A3FJ 2IS1A 1Y0UA 4ZH4F 4BACA 3S14J 4OAZA 3JTGA 4L5JA 3JREA 4OWRB 1R4NB 3KP3A 2VKHA 3EUHA 3OMYA 3I71A 3G6EI 3S17J 4AVPA 4MEYF 1DP3A 3DLAA 4O5VA 2Z3YA 4A2UA 1IC8A 5F64A 2QM3A 2UXXA 2X9DA 4AVZA 2M7AA 1R71A 2K5CA 2EFQA 1U0JA 3CLQA 3MKYB 4HOBA 3K4NA 4M3FA 2BXZA 2JUGA 4IXAA 1QA6A 2MSYA 2DJNA 1JKRC 4MGRA 1QVTA 5EGOB 3HM5A 3DLLF 2IS6A 1ZARA 4Y33A 3S2HJ 1Z1DA 2A05A 2ZSIB 4EGZA 2GIZA 3EDPA 1HSTA 3KP6A 4ZYDA 5B5EC 2FUG2 4DBQA 1R9TJ 1G6NA 4C2MJ 4M9SA 1G3YA 4IRHA 1Z7LA 2WBMA 4OINF 2DPDA 4HF1A 4ETSA 2GLOA 4XK4A 2WAFA 3GFMA 5LEKA 4J01A 3OYKA 1B8IB 1RPWA 3LL7A 2LTPA 3WHBA 4MIMA 2M34A 3ZMUA 3V8KA 5DS9A 5C44J 2LP0A 4UY8I 2QGUA 1A35A 1Y1VJ 2QSHX 2WC2A 2MH2A 3ABKH 3JCUC 3WE2A 4C9YA 3WTXC 5IT9K 3EUAA 1LEBA 2V9KA 5IOZA 3B6CA 5E3MA 1E3PA 4W97A 2L9VA 4KISA 4HZFA 1MSEC 4P1WA 1T39A 2IA1A 4OIRF 2IA0A 1SFXA 3OSGA 1LEAA 1XSDA 5FRNA 4ZYAA 2WAQN 2VT3A 2CQQA 4ZTFA 1BR4A 2CQKA 3DBLB 1HSJA 1WH7A 2HYJA 3KLOA 5ED4A 1OJLA 2OV7A 3GUDA 5K7ZA 3A03A 1HF0A 1MNMC 3U21A 3E6CC 5HS9A 4MQVA 1BI1A 5ICCA 3SJMA 4AIHA 5HDKA 5EG0B 5LEJA 2GOMA 2MH9A 4WXCA 2L9NA 4PK4A 2K9SA 2X48A 2KDZA 3ZQCA 3B02A 4D7MA 1K4SA 1CGPA 3W6JB 1J0RA 2OA4A 3D5SC 5F1JA 2XKOA 4BHCA 4HLYA 1WJBA 4ZTJA 3BPVA 4FTHA 4GO1A 3E6DA 1I27A 5DUIA 1FYMA 5IT3A 3L9FA 1MMGA 2DDAA 4ZZDA 1U5TC 5AIQA 5CVRA 1VQPI 2R4GA 3FXJA 1AOYA 2GA1A 4XONA 1D5VA 1J9IA 1ZELA 2NVTJ 1RR8C 1FWZA 3ZMDA 3CZ6A 1TL8A 4ZZLA 1JGGA 2L7MP 3L2UA 2DU9A 4L5EA 2XROA 2H1KA 2K85A 3CCYA 1ENHA 2VOOA 1QZZA 3W2VA 3CDLA 1P2FA 2OC6A 4M3EA 5EGOA 5GADJ 3E5QA 4RAGA 3H1CA 3OL3A 2HVQA 4EJTA 1GV5A 1S3JA 2W4SA 2W25A 2NVQJ 3CMAI 1UB9A 2L9RA 1N75A 2R0QC 2NVXJ 2CUFA 2Y9YA 1XDSA 2EV6A 4FX4A 4XICA 4E7ZA 4AWXB 1IDYA 2IVMA 3T1BA 1RC9A 4OAYA 5F0CA 2XASA 1IRXA 1B8IA 4I2OA 1BR2A 4WX9A 1RRJA 1H88C 2LKPA 1GVDA 2IA2A 1WJDA 2FU4A 4UVBA 5IYDJ 5D8LB 1T8IA 2Q0OA 4IPAA 1I6HJ 3ZQFA 5KNLA 1USSA 1IXRC 3NQOA 1K4TA 3HOVJ 4U7DA 3ECHA 2FRHA 1K6OA 3E5XA 4H0EA 3R4KA 4IO9F 5E18F 1TP4A 2VL8A 4EM1A 2K86A 2D45A 4EJOA 4EATA 5GPCA 3K4KA 2DN0A 2JPBA 3LSGA 4IHTA 3KZYA 3CD6I 2O8KA 3S1MJ 2RC4A 2X6OA 3F8CA 1YRNB 1VNDA 5D5VB 3RPQA 5EJCA 4BHPA 4D5CA 4XSXF 3M07A 3HOUJ 1WSUA 1HKTA 4G8XA 5AIPA 3D5LA 3Q0WA 1ETWA 5FKMA 1JXSA 2E5NA 2FOWA 1FMVA 4V2FA 3OYGA 2VQLA 1TWFJ 3DEEA 5EEGA 1RESA 2MABA 4DYRA 5DM7F 1GDTA 5GP9A 4BGDA 3KCCA 3BOQA 2PFBA 2D1HA 4F92B 2IW5A 2HOSA 2OUMA 3LOCA 3HBLA 2EZIA 3U2RA 3FMSA 4GXOA 3RYPA 4A3GJ 5ILUA 2I5UA 3HYIA 1ZREA 1O7FA 1FMWA 4XRMA 3K70C 5EYRA 2P7VB 1S6LA 2PN6A 3MZ8A 2RV8A 5CPRB 2Q1ZB 2DA4A 5JLXA 3PSIA 3R0AA 2CUJA 3EETA 3HXLA 2R7DA 2E71A 3IH2A 4IHSA 5F6FA 3KZZA 5GAEJ 5HODA 1EA3A 2HYGD 3M8FA 2M9HA 4PJ0C 1ZLKA 3OYIA 2XDVA 1FC3A 2XF7A 3O8HA 1T38A 3H3VK 1KYZA 4M74A 3ASOH 2ZNYA 1LQ1A 1O4XA 2A5WA 2Y69H 5L3EA 2CMPA 4U0YA 4L0ZB 3RKXA 1XDUA 1G8XA 3TDUC 1XMXA 2L4AA 1IRZA 1NH3A 1MMDA 1FOXA 2K02A 3CTAA 2UWMA 4Y4RA 2KIFA 4NHJA 4G9YA 4BE1A 3IRQA 2UUZA 1U8BA 1X58A 2ZXJA 5J1UA 4F55A 4D9JA 2ZFUA 4UUVA 2VONA 1X19A 3BTJA 1XS9A 3GFJA 2VKEA 1B1BA 4PFOA 4M3GA 1OFCX 4BEHB 1U5TA 5LFAA 4EJVA 5AONA 4CO8A 4A0YA 2A07F 1Z0XA 2R7XA 3OYFA 2DMNA 3CCJI 5IT9Z 2VIXA 1MGTA 1T6SA 4FE4A 5CVUA 2IPQX 4C3IJ 3BT9A 4ANJA 2AQFA 4ZDLA 3CMMA 2W24A 4BUPA 3H5NA 4PUSA 1HW2A 1BIAA 4Y13A 4RB3C 1YW7A 2BY1A 1A31A 2EV0A 3LA7A 4XRSA 2DT6A 4F91B 2R7SA 4MNUA 5HDGA 2MD0A 4CHUA 1IN4A 3BZ6A 3JW4A 5CVJA 5J4YA 1X1AA 4RAYA 1KYWA 1VQ7I 4XKBA 3MKWB 1L0OC 2KRCA 2KKOA 2ME0A 3HIFA 4HX7A 2R7ZJ 5C3EJ 2W82A 2ZMEB 1FBQA 4NDLA 3FDYA 5E1ZB 5HLIA 1MH4A 3HC7A 3KIOA 2F48A 3CUQB 1T33A 1Z7UA 1V5EA 4XRSG 3I4NJ 3JRCA 2MLKA 1P9QC 2XPWA 3BQYA 3F8NA 2XVCA 3NRVA 2KIQA 2C6YA 3ERED 5JHFA 2VQCA 3IRRA 2OCCH 1BC7C 4BAYA 1EH6A 2A3SA 4XLAA 4P9UA 1CF7B 1D5YA 5FKLA 3ZR8X 5TISC 2XAHA 4BQNA 2DK5A 1PYVA 4CCMA 5KK1A 3S2DJ 3CJNA 1W1WE 2XIGA 2KQRA 4PJMA 3WU2C 3J7AO 3MMYB 3W2WA 3ZMSA 2O0YA 3QP5A 3L2WA 5A2QK 2QSFX 3QWLA 2QCOA 4F52A 1DU0A 4M3BA 3M8JA 1XGOA 2DA5A 3A1YA 1U78A 2HVRA 1TTYA 2O5RA 4AU7A 1HW1A 2CW0F 2YPRA 4A0ZA 4UNOA 4RBOA 4AM3A 2ZC2A 3UR3C 2EZKA 2LY9A 1OCCH 4XORA 2DFFA 3DTKA 4S0HB 4JP0A 1FTZA 1BIBA 3NEUA 3P7NA 1H0MA 3KLNA 2FEZA 1Y8QB 1T08B 2KMUA 4M6YA 3C2GA 2EFPA 3BLYA 3F21A 4I6ZA 2L7KA 3LAJA 2CSOA 1IUYA 3RPUA 4NC7A 3Q5FA 4HQMA 3LSPA 3GF2A 1YIJI 1MW7A 3FM3A 1HBXG 3HOYJ 4E70A 4D5FA 3L2QA 3CC4I 1MKMA 4M6XA 2VPLA 1REPC 2F4OB 3TO9A 2KRHA 3V7RA 2NOJB 4HLXA 2HXOA 4M71A 1O3QA 1TNSA 1K6YA 1VZ0A 2YUSA 3ULQB 4B47A 4RLQA 1S72I 3FK7A 1IV8A 3BWGA 3ABTA 1P4AA 3KZIC 4A3CJ 1YITI 3GTQJ 2FQ4A 3RYRA 4G6DA 2R7VA 3TP3A 4H4KC 3CCLI 4UB8C 2X4HA 3L1PA 2FOKA 3CCMI 1Y8RB 3O2PE 4L9JA 3DQVC 2M45A 1IN7A 4Q48A 4X0GA 2HEOA 2HTJA 4I0AA 3J7YJ 3S1QJ 1EH7A 2NS0A 1BOAA 2HQNA 4XM3A 1MZBA 1V4RA 2GA2A 3TO6A 1OCRH 1QNTA 2KT0A 1FJLA 2LNBA 2LREA 2E2JJ 1FIPA 2JWTA 1UAAA 1CF7A 3BG9A 2LRDA 1XG1A 3HOTA 1V5FA 4XL9A 4XLHA 5J1RA 3ZQ7A 4ZYGA 4EM0B 2OQGA 3FKIJ 4U87A 3GTKJ 1FOYA 1KGSA 1RUOA 4PJJA 4DYCA 3G1LA 1VQNI 3VYRB 1OYIA 3C7JA 2XAUA 1TWAJ 2EFNA 4BJTA 1ZGJA 4DGWB 3H9QA 3MZHA 5GTIC 3FX3A 1IRGA 4JX6A 1BI0A 1Z67A 2DODA 1FOKA 2FMLA 1IW7F 1SD7A 4GYGA 2R7RA 4BQOA 1V54H 2Z2SB 3QYEA 4D1QA 3FXOA 2R92J 1FBUA 3V7CA 4RAFA 5FFZA 3J80K 2LKSA 2ESNA 2X1DA 1AU7A 3C3WA 2ZBKA 1T0FC 3D1NI 4NC8A 3LSMA 4U7BA 1R49A 2HGCA 3NARA 1STZA 3FHZA 1PVEA 2R5YA 2XUBA 1QU3A 3GTOJ 2KIUA 3SXYA 2WB1N 4HSTA 1SAUA 1E3HA 3BJ6A 4N0BA 5J8CA 1FNNA 1LDJA 1Q1VA 2FBKA 5H2FC 3BZCA 2RN7A 1F1ZA 2H8WA 1MJAA 2M7BA 1NG6A 1K83J 2CWEA 4PGGA 1SD5A 4G6QA 1G4DA 5J8FA 3V7SA 1ODDA 1YJNI 4A3IJ 3BR6A 3HPHA 4P5OA 2JSCA 3ZQGA 3IUOA 3KP2A 1ULYA 1LVAA 4BNCA 2HDDA 1LB2A 2HQ5A 4HDUA 4A3EJ 1XB4A 1ZTRA 3J81K 4L9VA 3BZKA 2ZSHB 1P6RA 1ZG1A 1J75A 3ZQIA 3HSEA 5FKOA 4BH9A 2DPUA 3ZP5A 1WCMJ 2NRAC 2V1DA 2VXDA 2M87A 4LB6B 1JKOC 2HPMA 3GBGA 1WI9A 4KDPA 5IYBJ 3JRGA 4IJAA 5BNGA 3K1MA 2Y75A 1NHAA 2EILH 2P7CB 1O7LA 3K9TA 3OV8A 4MHGA 2XGXA 1XMAA 4IHWA 4OIPF 3AG4H 1YHQI 1PUFA 2Z33A 1WWXA 1P7IA 2EQRA 3F8FA 4V2GA 4HDVA 3OYNA 4CCKA 1YI2I 4IHVA 3VODA 1OCTC 2GXAA 1SVLA 2AXLA 3I5UA 1BW6A 1XD7A 1ZYRF 2DMTA 2CUZA 4DOZA 1S7AA 2EK5A 2XAJA 2PQ8A 5KVRA 3DP7A 3IAS2 3I55I 2QBYA 2IP2A 4BXUA 1OR7C 1ETXA 4II3A 2BYVE 1N78A 2Q8KA 2QVOA 1TQMA 3TW6A 1MJBA 1MMNA 1WZ2A 2DW4A 3L00A 1D0ZA 3P9KA 4G94A 3CQZJ 3DKYA 1UFMA 1MBKA 4L9TA 5DDGA 4BU2A 2F5VA 5HS8A 5KAIC 3LFKA 1L3LA 1GXQA 3QU3A 3WODF 4KMFA 4L0YB 3HSRA 3M4OJ 2M1BA 3IWZA 3OS1A 4BL0B 2K9QA 2HTSA 3FBIB 4JQFA 2EIMH 3WGGA 1UCRA 5BS6A 4A5MA 2ZXIA 1SFEA 4AUXA 2J5PA 1YS7A 2LYCA 2NVYJ 4QPQA 2LF8A 1VQ4I 3SDGA 1FYLA 4W1UA 1NK2P 2RAEA 4B1RA 3VSLA 1GT0C 1SMTA 2DK8A 3HDDA 1YW8A 4RA2A 4QIWN 5HVQC 1BW5A 3LSKA 3V4GA 2DA7A 4NB5A 3K4CA 1XCVA 4CSWA 3TEDA 1Z91A 2HQAA 3AL0C 1V3FA 3TDZC 4JK1X 4A3KJ 4BHBA 4CZCA 4KMUX 4ZJZA 2VBZA 4IF4A 3BG5A 1EH8A 3HRMA 1IO2A 3MKLA 4ENNA 2JSPA 2L02A 1MDMA 1K7AA 3HRTA 4B09A 4BY1J 2MA3A 4ON0A 2L01A 2EA4A 1KZHA 1P4XA 5H6QA 2ID3A 4C30A 2R7OA 2VODA 4IX7A 1WJ5A 1SAXA 2KRFA 1ITYA 4UUSB 2K40A 3ZGKA 4N9IA 2BHZA 3C2HA 3L7WA 1TWHJ 4EJUA 2M8EA 1T0FA 2YU3A 2KHMA 2XAQA 3JRHA 2MG4A 2LMDA 1SD6A 3M9AA 5FKKA 2V1XA 3RIRA 4UV8A 1JHHA 4WXDA 5D8KB 2NOGA 3CCRI 4XRFA 1IUFA 4PJLA 2E1CA 2HNHA 5LGNA 5EDNA 2A5YB 2Z1DA 3GLLA 2R7TA 1BN5A 2BVMA 4FHTA 1HW5A 4LG0A 4KFCA 1D8KA 3DEUA 4KYWA 1WGXA 3IKTA 1POGA 3FMRA 2CO5A 3OOPA 2E5ZA 4FT8A 3NWSA 3JAMK 4AYBN 1N25A 1Y0NA 4HW0A 4PFPA 3OYEA 2ZJ2A 2VQGA 4KICA 3QYBA 3HZJA 1X1CA 4WF2A 4MTDA 5JHUA 1ETOA 3Q9VA 4KIFA 1HXDA 3FIWA 3TO7A 1IDZA 4RB2C 1FYKA 2JN6A 2LY2A 2A69F 3EYYA 1UELB 1PUEE 4NBQA 3R6SA 3QAHA 5J40A 2ZO4A 1U2WA 2JMWA 1W7PD 1W5SA 2O3FA 2KZVA 4DIQA 1K78B 1RNLA 4I02A 3J80Z 1RIOH 3FXRA 1TWCJ 5BPIA 2ELKA 3DTIA 3ZN0A 5FD6A 2ZKZA 4HEA2 4EMSA 5DD8A 5HNFA 3H3UA 2LY1A 2MBFA 3A0HC 3KYLA 2TRTA 1ZH5A 1E17A 5IP6A 3FXQA 2ACJA 3JRBA 1JKQC 4PZJA 1QGPA 3H9GA 1TNTA 4O3MA 1R36A 1SANA 5DCFA 2GXGA 4EEFG 2DO7A 2STTA 4ZDOA 2CFXA 3ECOA 5CQGA 4HNTA 2XPVA 3CC2I 2WAQA 4LLNA 3BJAA 1YJ9I 3HGGA 1DQUA 4LOCA 2RNJA 3MCZA 2P6SA 4WCGA 3LMMA 2KL4A 3T8RA 3AKZA 1UJ8A 4G6TB 1RKTA 3HHHA 3SDBA 2F4MB 1K79A 3DF8A 1WJEA 2VJ4A 3DU5A 2DMUA 3PNTA 2H27A 4PJNA 2IT0A 3J81Z 3X2QH 2XF6A 5DV5A 2W57A 4KJZA 4BXXJ 2FD5A 1JUSA 2X85A 3CC7I 4HYEA 1Y1WJ 4MTEA 1G3SA 1A36A 2HOEA 4XQFA 4UUSA 1UHSA 1BOBA 2MW8A 4L9NA 1D0YA 1PP8F 1FX7A 1U5TB 2CQXA 2PEXA 5F27A 4RB0A 1W5TA 2EIJH 1P4WA 1LDKB 4A3MJ 2DA1A 5DCMB 5FROA 4Y52J 3DKWA 2F2EA 2IGNA 2EZLA 2IS2A 1BJZA 2OF7A 4OIOF 3Q0UA 1AA7A 3O8GA 4XOPA 1BBYA 3ONQA 3BCBA 4AIKA 2VC0A 2VBXA 3M1CA 1IAWA 1R6RA 5ICGA 2EJRA 2NXNB 2A6HF 3BPXA 1UG0A 5LHGA 1JE8A 5GAGJ 2G7UA 1OCOH 4KA4A 1SC7A 4DJAA 1FPQA 3SHFA 3UNGC 2YSRA 2FNPA 1ZR2A 4QPOA 5FLXZ 1ZGWA 1X3WB 1ZN2A 2P5LC 4XOTA 2XHKA 2OTLI 2A6EF 3BP8A 4XKCA 4KT5C 4RS8A 5E8GA 2HS5A 1DGRM 4B8XA 1ZQ3P 1OLTA 2DAOA 2DT7B 1Y39A 2EFWA 4ENJA 3PJRA 2HOAA 4HG2A 5M3FJ 3OS2A 5C4JJ 2ESHA 2L5QA 1DDNA 1TZLA 3RQ4A 1QBJA 3L2VA 5TJJA 2K9LA 1K78A 1DPUA 1WJAA 3BJOA 4XNFA 2PG4A 3GTGJ 1SD4A 3KEQA 1BI2A 2VQHA 1MBEA 2Z99A 3NAUA 3ELKA 5JLWA 4DYQA 3IWFA 3BC8A 1VTNC 1U8RA 3CMEI 1SVOA 3H3ZA 1FP2A 2MLGA 2YR2A 3FF5A 5F04A 1TWGJ 1FZPB 3HHGA 5L3FA 3PO3J 2BE5F 3OIPA 3GMEA 4KN4X 1R1TA 1V5GA 3QOPA 4DNCA 1XPXA 5CVVA 4ESFA 3HOWJ 3KFWX 3ZMVA 2XRLA 2IBDA 2X6WA 2CQ7A 2UZKA 2BHYA 4EJWA 4WWCA 5FJ8J 3I56I 1JJ6C 1Z9CA 4Y17A 4D0PA 3RI4A 5B3SH 1K61A 4IOCF 1O3RA 2K3FA 3PSFA 1UMQA 1DPRA 4E4HA 2DCEA 1QVUA 1YS6A 2JQ7A 1ETQA 2R5ZA 1AHDP 4GDFA 2EBIA 2RDPA 4UV9A 4MEXF 3WTVC 4AIJA 4FETA 3IKVA 2QYOA 3EYIA 2DFEA 2NYXA 2EIKH 1I3AA 2CU7A 2A61A 3U1DA 5HOOA 4HV6A 5DCMA 2PBIA 2Y0MA 4R79A 4PGHA 4G7HF 4IOAF 3W6VA 3I59A 2L54A 3JRIA 3S1NJ 4ZDPA 3GLXA 2V1UA 1W36D 1Z21A 2M0MA 2E19A 5LLQA 1A04A 4HA8A 5GAHJ 2W84A 3P9CA 2O9LA 2DOAA 3ASNH 1AWCA 2CYYA 4FX0A 5LRSA 3JSPA 1MBJA 3PQJA 2YS9A 1X2MA 3SFIA 3T0YA 5GTHC 2BW3B 4CXFA 2GWRA 2IS4A 2BGCA 5K5RA 2WTEA 1JHFA 3MZYA 1TBXA 3JAMZ 1LKXA 3RZOJ 5H20A 2LH9A 2B9SA 3RSNA 2QQ8A 3M1EA 3BY6A 3QPLA 2UXNA 5TRDA 4FCYA 4A6DA 2KISA 5IP7J 2DYRH 3DCFA 5B1BH 4IEJA 3BR5A 3TP0A 4GFBA 4N4NB 2Y9ZA 2DBBA 2VC1A 4XLNF 5LD2C 1TQIA 3G71I 4YG2F 2CH0A 3TOBA 2BY0A 2CUEA 4XMYA 2CFOA 3GZ5A 2O8XA 2HWVA 5DYMA 3EUKL 3A02A 3KP5A 1B59A 3W6KB 2IXSA 2K9NA 2MC3A 3R60A 2VKVA 2VB6A 1D1AA 3LFUA 3OOUA 5BMZA 1PP7U 2VN2A 2H94A 5FRMA 1OMIA 2HXIA 3EPZA 1XGNA 3PIPF 4L18B 2BVLA 4DQ2A 4UUTA 4XKWA 4N4OB 4X6AJ 2CV2A 5ERIA 3E5UA 2EWNA 3K69A 2LF7A 5FKNA 3I53A 5FD5A 4V19K 1YE9A 2JZYA 5HLTA 5E3OA 5M5WJ 2E60A 3RQIA 3LSHA 2P81A 1ZR4A 1KQ0A 4Y7NJ 1J7KA 1QPMA 2R3SA 4MO7A 1O57A 2HDCA 3ABUA 2QSGX 2F5DA 1MD0A 2QKLB 3B73A 2XB5A 3HPGA 5E20A 1IZ1A 3QPSA 4DZJA 2ELJA 2KJCA 1Y56A 1SFOJ 1IJWC 1JTXA 3LSIA 4Q4ZF 4LB5A 3F8BA 4GGGA 3F22A 2R5YB 3OYJA 4BJ6C 2FNAA 2VJIA 3HRUA 4M9XA 1PJRA 1LFPA 2ICWG 3GW2A 2R7QA 3KP7A 2B0LA 1IN6A 3EQLF 3RKYA 2PJPA 3A0BC 2X6YA 1ZG3A 1MBFA 4JYKA 4I01A 2CRGA 4C2TA 1YJWI 3KEOA 4Y15A 4YEJA 4ITVA 4N9HA 5HDNA 3KYDB 1VQ9I 4A3BJ 2EPFA 1MIJA 4PSXA 3DFGA 4NQWA 3WHCA 2WY7Q 3CF5F 1VQKI 1MNEA 1E2XA 3CP2A 3SZGA 4CDGA 1VQ5I 3PQKA 1MJ9A 1IV6A 3BTIA 4B3XA 1B72A 2KZGA 5J1YA 3GX4X 4GYIA 1WI3A 3HB9A 1E0EA 4MQ9F 2DLLA 2O03A 1E3OC 3V8LA 1O3SA 2DA2A 3ML6A 4FQGA 2DQRA 3F6VA 1I1SA 1RR7A 2BW3A 1QO0D 1P92A 2M8GX 4HPQA 5B1AH 1JT0A 2V26A 1DP7P 4O6JA 4BDZA 1HKSA 3MWMA 2JTVA 2R7WA 3RJPA 3FXMA 1TW2A 1S9HA 1VI0A 2MC4A 2W48A 2JRTA 2GXBA 2P5VA 5M5YJ 2K3PA 1PUFB 1LVKA 1X3UA 2P0WA 4LD5A 4P55A 4A6EA 3CO7C 3LWFA 4CCNA 4YIFA 2OAZA 4BQAA 3M8EA 1UG2A 2M30A 1I50J 2F5EA 1PDNC 1OCPA 3ABLH 5H6RA 1YO5C 1VQ8I 3H0DA 5K5OA 4IHYA 3QQAA
chains in the Genus database with same CATH topology
4P9FA 4YIIA 2QBYB 1OYWA 2HYFA 4OIQF 4YFXF 1KU2A 3WGHA 5K5QA 4HQEA 2LSOA 3LAPA 4HBLA 1RI7A 4UVAA 4M72A 2FBIA 4KIBA 2HKXA 3HOSA 3WU1B 3T5XA 3FWEA 3IC7A 2KJBA 1TQPA 1ZLJA 3C1DA 4M9ZA 2GIVA 2ETHA 1BJAA 1JGSA 4K2EA 1ZGAA 5E17F 3I4PA 1ZRCA 3G73A 1W7PB 5DUKA 5CYVA 2ISYA 4LLGF 1MDMB 3GFLA 1WRJA 1TW3A 2G9WA 3I58A 1KU3A 2YX7A 4IRIA 5D6FA 1RUNA 2ZFWA 5LBQA 4U0WA 3JTHA 2F5FA 3C18A 4RGUA 1WQ2A 1S29A 3LQQA 2QLZA 4A0XA 2GQQA 2HR3A 2ZNZA 4LG0B 5HS7A 2V9VA 1J5YA 1BI3A 3TQNA 3LA3A 1HKQA 2GZWA 5LHIA 3SZPA 3WG9A 5FLXK 3K1PA 4CGZA 2QQ9A 1GXPA 3LQRA 1IN8A 4CYDA 1KU9A 1KA8A 3GYHX 2P6TA 1ON1A 2E7XA 3WTYC 2NNYA 3DPLC 2WWYA 5BOXA 1XGSA 1H9GA 3M7GA 1FP1D 2X0LA 4S04A 2YX4A 2PI0A 3WTSC 1B9MA 1H9TA 2IRFG 2OZ6A 2DQLA 4XSZF 4LMYA 3ISPA 4G7OF 1YW9A 1XGMA 4KNYA 3GO5A 4ENKA 4PCQA 1W7PA 2EFOA 2BBYA 3TOAA 5D5UB 2IJLA 1GHCA 1ZRDA 2QENA 1I6XA 2E7WA 2JT1A 4AD9A 1KQ8A 1YFHA 1OKRA 4YFNF 2RGVA 5CLSA 1B4AA 1UHWA 2ISZA 2O61A 2QUFA 3DV8A 1F4KA 5ILVA 3WTTC 3V8JA 2CGPA 4R1HA 5EEHA 6PAXA 1IXCA 1FSEA 4XBFA 2K27A 1QQIA 4YFKF 1Z05A 4IVNA 3E6MA 4OU0A 3GEZA 3LSTA 3RKWA 1R1UA 2VBYA 4WXHA 2OZUA 2NAZA 3KE2A 3GWZA 4JBAA 2G7HA 1R23A 1F9NA 4RGRA 4U88A 5FO5A 3Q9SA 2V79A 3MAJA 5K1YA 1R22A 2WV0A 4HX4A 4EQQA 4CZZA 2W85A 3TKYA 1R7JA 2STWA 2P5KA 3QU6A 4LLLA 3GXOA 1O3TA 4OMZA 3JSOA 1J2XA 5CVIA 1KU7A 3WGIA 2QZ8A 2L4MA 3VOEA 4L5IA 2XAGA 2OD5A 2HQRA 3MFKA 3FMQA 1ONVA 1QZYA 3O6BB 3N97A 1OR7A 1FBSA 5HLHA 1XCBA 1IRFA 4TV7A 4RGXA 3O3KA 4PDKA 3HUGA 1FY7A 3I59B 4Q5SF 2Y48A 3GFIA 3HRSA 1IF1A 3WU0A 2BEOA 4LK1F 1C0WA 4I09A 4RGSA 1Z6RA 2P4WA 2VE9A 4HF2A 3CLOA 2H6CA 2Z5UA 1XSVA 1OYYA 2VBWA 5JI6A 3KETA 2FBHA 1UHMA 1XSXA 3ZMTA 3RTRA 3COAC 2Z9OA 5FB2A 5BQTA 1YYVA 1LNWA 5F1RA 4KUMA 4EGYA 3P9IA 3FXUA 3QPHA 3CO6C 2K7LA 4HF0A 4ESJA 5E8IA 3KP4A 4R8HA 1SFUA 5D5WB 2TDXA 2PMHA 2D1VA 5LRRA 1F5TA 5E1XA 3IHUA 2XKPA 4ASNA 2H09A 3D0SA 3L2CA 1R5GA 4ESBA 4M73A 1LDDA 2FSWA 4IRGA 4UXNA 4RB1A 3HTUA 3CUQC 2DI3A 3K1NA 2NNNA 2XAFA 4LK0F 2VE8A 1DUXC 2LDUA 1I5ZA 3E97A 5DD4A 3SZTA 5LGTA 1B6AA 2XRNA 5FGMA 5DEQA 1USTA 5L3DA 1XMKA 2ELHA 1GVJA 1S7OA 3QPTA 2RQPA 4U0VA 4BYYA 1FLIA 2V6CA 2JPCA 3QP6A 3PFIA 3F72A 2VT2A 3WE3A 3I54A 3VEPA 5JR3A 1ZHFA 1R5HA 3F8MA 3QRFF 2MD5A 4OOIA 1HQCA 3R0JA 2QWWA 4OMYA 1KQ9A 4A5NA 2J5OA 1IN5A 3ZN1A 1EV7A 2EB7A 2RVCA 2KIMA 1T98A 5L3CA 5D6EA 2EV5A 2M5WA 4S05A 4EV0A 1G3TA 1D3YA 3H92A 2GAUA 3AAFA 4ENMA 1YG2A 2VXZA 1WKMA 4KN7X 4I0BA 2K4JA 3FM5A 3IL2A 1W4MA 4F7ZA 5HLGA 1TLHB 2F5CA 1YTYA 1ON2A 4Z2YA 3CDHA 3F3XA 4WK8F 4HX8A 4P96A 2EA2A 1YLFA 2FXAA 2OQRA 3TGNA 2DFIA 3WTWC 3HTSB 4QWQA 2P8TA 1D8JA 1U3EM 2DTRA 2HFHA 2VOPA 2OBPA 3U9GA 3BDDA 3ROUA 1IXSB 2D2WA 3S2WA 3WTUC 3F23A 3DPTA 3I64A 2Q2EA 4GCVA 5E1WA 3T8TA 5J6XA 3E6BA 2ZCWA 1BC8C 5LGUA 4UHTA 4KIGA 2CG4A 3BROA 1T2KA 1I1GA 5D4SA 2H6BA 4RAZA 2R7FA 2ZMEA 2FQ3A 2AS5F 1Z6TA 3CUQA 1ZRFA 2HKOA 2DT5A 4HAMA 5JFRA 5BPDA 2FF4A 1ZAOA 2PLYA 5FFXA 2RKHA 3GVAA 5L3GA 3HSFA 1R1VA 3F6OA 5JVTA 1S8NA 2FE3A 5D5XB 4G7ZF 4LGWA 3ZPLA 3N4MA 3VFZA 3FZVA 1ZG5A 3DXJF 5ICEA 2OU2A 1OPCA 1YIOA 4I98B 3RDIA 1XN7A 1Q1HA 1YQAA 2FA5A 2K4BA 3MEXA 4ZYHA 4QLCU 1SMYF 3I0TA 4UVCA 5ILSA 3L09A 3VB2A 2FMYA 3G3ZA 2QQBA 2HZTA 5D4RA 3E3VA 4A12A 4Q47A 5L3BA 2L3DA 1RZ4A 1U6GA 1B9NA 2XV4S 5ICFA 4HV5A 4LFUA 3K2ZA 3SQNA 3CUOA 3SFZA 2ADUA 3LA2A 4EVIA 2PMUA 3R61A 4ZYEA 4I7HA 1FSHA 1J59A 3WTZA 2E1NA 3ZMZA 1LJ9A 1R00A 4EM2A 3MQ0A 5CJ9A 3K0LA 1G3WA 2BV6A 4XLPF 2QQAA 1R58A 4LJZF 3GZ6A 4CICA 2COMA 3REOA 2A68F 5LHHA 1BM9A 1FT9A 5A2QZ 2O6GE 1Y0UA 4ZH4F 3JTGA 4L5JA 3KP3A 3EUHA 3I71A 4AVPA 4MEYF 4O5VA 2Z3YA 4A2UA 5F64A 2QM3A 2UXXA 2EFQA 4HOBA 4IXAA 4MGRA 1ZARA 1Z1DA 4EGZA 3EDPA 1HSTA 3KP6A 4ZYDA 1G6NA 4M9SA 1G3YA 4IRHA 4OINF 2DPDA 4HF1A 4ETSA 3GFMA 5LEKA 3ZMUA 3V8KA 2WC2A 2MH2A 3WE2A 3WTXC 5IT9K 1LEBA 4HZFA 1T39A 2IA1A 4OIRF 2IA0A 1SFXA 1LEAA 1XSDA 2VT3A 2CQKA 1HSJA 3KLOA 5ED4A 3GUDA 3E6CC 5HS9A 4MQVA 1BI1A 5ICCA 4AIHA 5HDKA 5LEJA 2MH9A 4WXCA 3B02A 1CGPA 3W6JB 1J0RA 2OA4A 2XKOA 4BHCA 4HLYA 3BPVA 4GO1A 3E6DA 1I27A 5DUIA 1FYMA 5IT3A 3L9FA 4ZZDA 1U5TC 5AIQA 5CVRA 1AOYA 2GA1A 1J9IA 1D5VA 1FWZA 3ZMDA 4ZZLA 2DU9A 2XROA 2VOOA 1QZZA 1P2FA 3E5QA 4EJTA 1S3JA 2W25A 1UB9A 1XDSA 2EV6A 4FX4A 4AWXB 2IVMA 3T1BA 2XASA 4I2OA 4WX9A 2LKPA 2IA2A 2FU4A 4UVBA 5D8LB 2Q0OA 4IPAA 1USSA 1IXRC 3NQOA 4U7DA 3ECHA 2FRHA 1K6OA 3E5XA 4H0EA 3R4KA 5E18F 4EM1A 2K86A 2D45A 4EJOA 2JPBA 4IHTA 3KZYA 2RC4A 3F8CA 5D5VB 3RPQA 4BHPA 4XSXF 1WSUA 1HKTA 4G8XA 5AIPA 3D5LA 1JXSA 5EEGA 3KCCA 3BOQA 2PFBA 2D1HA 2IW5A 3U2RA 3FMSA 4GXOA 3RYPA 5ILUA 1ZREA 3HYIA 1O7FA 2P7VB 1S6LA 2PN6A 2RV8A 3R0AA 3EETA 2R7DA 4IHSA 5F6FA 3KZZA 2HYGD 3M8FA 1ZLKA 1FC3A 1T38A 1KYZA 4M74A 2ZNYA 1LQ1A 5L3EA 4U0YA 4L0ZB 3RKXA 1XDUA 3TDUC 2L4AA 2K02A 3CTAA 2UWMA 2KIFA 4NHJA 4G9YA 3IRQA 2ZXJA 4UUVA 2VONA 3GFJA 1B1BA 1U5TA 4EJVA 5AONA 4CO8A 4A0YA 2A07F 5IT9Z 1MGTA 1T6SA 5CVUA 2IPQX 2W24A 1HW2A 1BIAA 4Y13A 4RB3C 1YW7A 2EV0A 3LA7A 4MNUA 5HDGA 4CHUA 1IN4A 3BZ6A 3JW4A 5CVJA 4RAYA 1KYWA 1L0OC 2KKOA 3HIFA 4HX7A 2ZMEB 1FBQA 5E1ZB 5HLIA 3CUQB 1Z7UA 2MLKA 3NRVA 3F8NA 2XVCA 2C6YA 3ERED 3IRRA 1BC7C 4BAYA 1EH6A 2A3SA 4P9UA 1CF7B 2XAHA 2DK5A 5KK1A 3CJNA 2XIGA 3J7AO 3ZMSA 2O0YA 3QP5A 5A2QK 1XGOA 1U78A 1TTYA 1HW1A 2CW0F 2YPRA 4A0ZA 4UNOA 1BIBA 3NEUA 3P7NA 1H0MA 3KLNA 2FEZA 4M6YA 2EFPA 3F21A 3LAJA 2CSOA 1IUYA 3RPUA 3Q5FA 4HQMA 3GF2A 3FM3A 1HBXG 4E70A 1MKMA 4M6XA 1REPC 3TO9A 3V7RA 4HLXA 4M71A 1O3QA 1TNSA 3ULQB 3BWGA 3ABTA 1P4AA 3RYRA 4G6DA 2X4HA 2FOKA 3O2PE 4L9JA 3DQVC 2M45A 1IN7A 4Q48A 2HEOA 2HTJA 4I0AA 1EH7A 2NS0A 1BOAA 2HQNA 1MZBA 1V4RA 2GA2A 3TO6A 1QNTA 2LNBA 1CF7A 3HOTA 3ZQ7A 4ZYGA 4EM0B 2OQGA 1KGSA 1RUOA 1OYIA 3C7JA 2EFNA 1ZGJA 3MZHA 3FX3A 1IRGA 1BI0A 1FOKA 2FMLA 1IW7F 1SD7A 4GYGA 1FBUA 3V7CA 5FFZA 3J80K 2ESNA 3C3WA 2ZBKA 4U7BA 2HGCA 1STZA 3FHZA 2XUBA 2KIUA 3SXYA 3BJ6A 4N0BA 5J8CA 1FNNA 1LDJA 2FBKA 2RN7A 1F1ZA 1MJAA 2CWEA 4PGGA 1SD5A 4G6QA 1G4DA 5J8FA 3V7SA 1ODDA 4P5OA 2JSCA 3KP2A 1ULYA 1LVAA 4BNCA 1LB2A 4HDUA 1XB4A 3J81K 4L9VA 1ZG1A 1J75A 1P6RA 3HSEA 4BH9A 2DPUA 3ZP5A 2NRAC 2V1DA 2M87A 4LB6B 1WI9A 4KDPA 4IJAA 3K1MA 2Y75A 1NHAA 2P7CB 1O7LA 3K9TA 3OV8A 4MHGA 2XGXA 1XMAA 4OIPF 2Z33A 1WWXA 3F8FA 4HDVA 3VODA 2AXLA 3I5UA 1ZYRF 1XD7A 1S7AA 2EK5A 2XAJA 2PQ8A 5KVRA 3DP7A 2QBYA 2IP2A 4BXUA 2BYVE 2Q8KA 2QVOA 1TQMA 1MJBA 2DW4A 3L00A 3P9KA 4G94A 1UFMA 4L9TA 5DDGA 5HS8A 3LFKA 1L3LA 1GXQA 3QU3A 3WODF 4KMFA 4L0YB 3HSRA 2M1BA 3IWZA 2HTSA 4JQFA 3WGGA 1UCRA 5BS6A 4A5MA 1SFEA 2J5PA 1YS7A 2LF8A 1FYLA 1SMTA 2DK8A 1YW8A 5HVQC 3V4GA 4NB5A 1XCVA 1Z91A 1V3FA 3TDZC 4JK1X 4BHBA 4KMUX 2VBZA 4IF4A 1EH8A 3HRMA 4ENNA 1MDMA 2L02A 1K7AA 3HRTA 4B09A 2MA3A 4ON0A 2L01A 2EA4A 1P4XA 5H6QA 2VODA 1SAXA 2KRFA 4N9IA 3L7WA 4EJUA 2M8EA 1T0FA 2YU3A 2XAQA 1SD6A 3M9AA 2V1XA 3RIRA 4UV8A 1JHHA 4WXDA 5D8KB 4XRFA 2E1CA 5LGNA 2A5YB 1BN5A 4FHTA 1HW5A 4LG0A 4KFCA 1D8KA 3DEUA 4KYWA 3IKTA 3FMRA 2CO5A 3OOPA 4FT8A 3JAMK 4HW0A 2ZJ2A 4KICA 4MTDA 4WF2A 5JHUA 3Q9VA 4KIFA 1HXDA 3TO7A 4RB2C 1FYKA 2A69F 3EYYA 1PUEE 3R6SA 3QAHA 2ZO4A 1U2WA 1W7PD 1W5SA 2O3FA 1K78B 1RNLA 4I02A 3J80Z 1RIOH 3FXRA 5BPIA 3ZN0A 5FD6A 2ZKZA 4EMSA 5DD8A 3H3UA 2MBFA 1ZH5A 1E17A 3FXQA 2ACJA 4PZJA 1QGPA 1TNTA 4O3MA 1R36A 5DCFA 2GXGA 2STTA 2DO7A 2CFXA 3ECOA 4LLNA 3BJAA 2RNJA 3MCZA 2P6SA 4WCGA 3T8RA 3HHHA 1K79A 3DF8A 2H27A 2IT0A 3J81Z 5DV5A 2W57A 4HYEA 4MTEA 1G3SA 2HOEA 4L9NA 1PP8F 1FX7A 1U5TB 2PEXA 4RB0A 1W5TA 1P4WA 1LDKB 5DCMB 3DKWA 2F2EA 4OIOF 1BBYA 4AIKA 2VC0A 2VBXA 1IAWA 5ICGA 2EJRA 2A6HF 3BPXA 5LHGA 1JE8A 2G7UA 4KA4A 1FPQA 3SHFA 2YSRA 2FNPA 5FLXZ 1ZN2A 2P5LC 2XHKA 2A6EF 3BP8A 5E8GA 4KT5C 4RS8A 2HS5A 4B8XA 2DAOA 2EFWA 4ENJA 1DDNA 2ESHA 1QBJA 5TJJA 1K78A 1DPUA 3BJOA 2PG4A 1SD4A 3KEQA 1BI2A 2Z99A 3ELKA 3IWFA 1VTNC 1U8RA 3H3ZA 1FP2A 2MLGA 2YR2A 3FF5A 1FZPB 3HHGA 5L3FA 2BE5F 4KN4X 1R1TA 3QOPA 4DNCA 5CVVA 4ESFA 3KFWX 3ZMVA 2UZKA 4EJWA 4WWCA 1Z9CA 4Y17A 4D0PA 3RI4A 1O3RA 1DPRA 1YS6A 2RDPA 4UV9A 4MEXF 3WTVC 4AIJA 3IKVA 2QYOA 3EYIA 2NYXA 2A61A 3U1DA 5HOOA 4HV6A 5DCMA 4G7HF 2PBIA 2Y0MA 4PGHA 4R79A 3I59A 2L54A 3GLXA 2V1UA 5LLQA 1A04A 4HA8A 2W84A 3P9CA 1AWCA 2CYYA 4FX0A 5LRSA 3JSPA 3PQJA 3T0YA 4CXFA 2GWRA 2BGCA 5K5RA 2WTEA 1JHFA 3MZYA 1TBXA 3JAMZ 5H20A 3M1EA 3BY6A 2UXNA 5TRDA 4A6DA 2DBBA 2VC1A 4XLNF 1TQIA 4YG2F 3TOBA 3GZ5A 2O8XA 2HWVA 5DYMA 3KP5A 1B59A 3W6KB 2MC3A 3R60A 5BMZA 1PP7U 2VN2A 2H94A 1OMIA 1XGNA 4L18B 4DQ2A 5ERIA 3E5UA 2EWNA 3K69A 2LF7A 3I53A 5FD5A 2JZYA 1KQ0A 1J7KA 1QPMA 2R3SA 1O57A 2HDCA 3ABUA 2F5DA 1MD0A 3B73A 5E20A 1IZ1A 2KJCA 4Q4ZF 4LB5A 3F8BA 4GGGA 3F22A 2FNAA 3HRUA 4M9XA 3GW2A 3KP7A 2B0LA 1IN6A 3EQLF 3RKYA 2PJPA 1ZG3A 4I01A 3KEOA 4Y15A 4N9HA 5HDNA 3DFGA 4NQWA 1E2XA 4CDGA 3PQKA 1MJ9A 3GX4X 4GYIA 4MQ9F 2DLLA 2O03A 3V8LA 1O3SA 3ML6A 2DQRA 3F6VA 1I1SA 1QO0D 1P92A 1DP7P 4O6JA 1HKSA 3MWMA 2JTVA 3RJPA 1TW2A 2JRTA 2GXBA 2P5VA 1X3UA 4LD5A 4P55A 4A6EA 3CO7C 3LWFA 4YIFA 2OAZA 4BQAA 3M8EA 2M30A 2F5EA 1PDNC 5H6RA 1YO5C 5K5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9F A;  4YII A;  2QBY B;  1OYW A;  2HYF A;  4OIQ F;  4YFX F;  1KU2 A;  3WGH A;  5K5Q A;  4HQE A;  2LSO A;  3LAP A;  4HBL A;  1RI7 A;  4UVA A;  4M72 A;  2FBI A;  4KIB A;  2HKX A;  3HOS A;  3WU1 B;  3T5X A;  3FWE A;  3IC7 A;  2KJB A;  1TQP A;  1ZLJ A;  3C1D A;  4M9Z A;  2GIV A;  2ETH A;  1BJA A;  1JGS A;  4K2E A;  1ZGA A;  5E17 F;  3I4P A;  1ZRC A;  3G73 A;  1W7P B;  5DUK A;  5CYV A;  2ISY A;  4LLG F;  1MDM B;  3GFL A;  1WRJ A;  1TW3 A;  2G9W A;  3I58 A;  1KU3 A;  2YX7 A;  4IRI A;  5D6F A;  1RUN A;  2ZFW A;  5LBQ A;  4U0W A;  3JTH A;  2F5F A;  3C18 A;  4RGU A;  1WQ2 A;  1S29 A;  3LQQ A;  2QLZ A;  4A0X A;  2GQQ A;  2HR3 A;  2ZNZ A;  4LG0 B;  5HS7 A;  2V9V A;  1J5Y A;  1BI3 A;  3TQN A;  3LA3 A;  1HKQ A;  2GZW A;  5LHI A;  3SZP A;  3WG9 A;  5FLX K;  3K1P A;  4CGZ A;  2QQ9 A;  1GXP A;  3LQR A;  1IN8 A;  4CYD A;  1KU9 A;  1KA8 A;  3GYH X;  2P6T A;  1ON1 A;  2E7X A;  3WTY C;  2NNY A;  3DPL C;  2WWY A;  5BOX A;  1XGS A;  1H9G A;  3M7G A;  1FP1 D;  2X0L A;  4S04 A;  2YX4 A;  2PI0 A;  3WTS C;  1B9M A;  1H9T A;  2IRF G;  2OZ6 A;  2DQL A;  4XSZ F;  4LMY A;  3ISP A;  4G7O F;  1YW9 A;  1XGM A;  4KNY A;  3GO5 A;  4ENK A;  4PCQ A;  1W7P A;  2EFO A;  2BBY A;  3TOA A;  5D5U B;  2IJL A;  1GHC A;  1ZRD A;  2QEN A;  1I6X A;  2E7W A;  2JT1 A;  4AD9 A;  1KQ8 A;  1YFH A;  1OKR A;  4YFN F;  2RGV A;  5CLS A;  1B4A A;  1UHW A;  2ISZ A;  2O61 A;  2QUF A;  3DV8 A;  1F4K A;  5ILV A;  3WTT C;  3V8J A;  2CGP A;  4R1H A;  5EEH A;  6PAX A;  1IXC A;  1FSE A;  4XBF A;  2K27 A;  1QQI A;  4YFK F;  1Z05 A;  4IVN A;  3E6M A;  4OU0 A;  3GEZ A;  3LST A;  3RKW A;  1R1U A;  2VBY A;  4WXH A;  2OZU A;  2NAZ A;  3KE2 A;  3GWZ A;  4JBA A;  2G7H A;  1R23 A;  1F9N A;  4RGR A;  4U88 A;  5FO5 A;  3Q9S A;  2V79 A;  3MAJ A;  5K1Y A;  1R22 A;  2WV0 A;  4HX4 A;  4EQQ A;  4CZZ A;  2W85 A;  3TKY A;  1R7J A;  2STW A;  2P5K A;  3QU6 A;  4LLL A;  3GXO A;  1O3T A;  4OMZ A;  3JSO A;  1J2X A;  5CVI A;  1KU7 A;  3WGI A;  2QZ8 A;  2L4M A;  3VOE A;  4L5I A;  2XAG A;  2OD5 A;  2HQR A;  3MFK A;  3FMQ A;  1ONV A;  1QZY A;  3O6B B;  3N97 A;  1OR7 A;  1FBS A;  5HLH A;  1XCB A;  1IRF A;  4TV7 A;  4RGX A;  3O3K A;  4PDK A;  3HUG A;  1FY7 A;  3I59 B;  4Q5S F;  2Y48 A;  3GFI A;  3HRS A;  1IF1 A;  3WU0 A;  2BEO A;  4LK1 F;  1C0W A;  4I09 A;  4RGS A;  1Z6R A;  2P4W A;  2VE9 A;  4HF2 A;  3CLO A;  2H6C A;  2Z5U A;  1XSV A;  1OYY A;  2VBW A;  5JI6 A;  3KET A;  2FBH A;  1UHM A;  1XSX A;  3ZMT A;  3RTR A;  3COA C;  2Z9O A;  5FB2 A;  5BQT A;  1YYV A;  1LNW A;  5F1R A;  4KUM A;  4EGY A;  3P9I A;  3FXU A;  3QPH A;  3CO6 C;  2K7L A;  4HF0 A;  4ESJ A;  5E8I A;  3KP4 A;  4R8H A;  1SFU A;  5D5W B;  2TDX A;  2PMH A;  2D1V A;  5LRR A;  1F5T A;  5E1X A;  3IHU A;  2XKP A;  4ASN A;  2H09 A;  3D0S A;  3L2C A;  1R5G A;  4ESB A;  4M73 A;  1LDD A;  2FSW A;  4IRG A;  4UXN A;  4RB1 A;  3HTU A;  3CUQ C;  2DI3 A;  3K1N A;  2NNN A;  2XAF A;  4LK0 F;  2VE8 A;  1DUX C;  2LDU A;  1I5Z A;  3E97 A;  5DD4 A;  3SZT A;  5LGT A;  1B6A A;  2XRN A;  5FGM A;  5DEQ A;  1UST A;  5L3D A;  1XMK A;  2ELH A;  1GVJ A;  1S7O A;  3QPT A;  2RQP A;  4U0V A;  4BYY A;  1FLI A;  2V6C A;  2JPC A;  3QP6 A;  3PFI A;  3F72 A;  2VT2 A;  3WE3 A;  3I54 A;  3VEP A;  5JR3 A;  1ZHF A;  1R5H A;  3F8M A;  3QRF F;  2MD5 A;  4OOI A;  1HQC A;  3R0J A;  2QWW A;  4OMY A;  1KQ9 A;  4A5N A;  2J5O A;  1IN5 A;  3ZN1 A;  1EV7 A;  2EB7 A;  2RVC A;  2KIM A;  1T98 A;  5L3C A;  5D6E A;  2EV5 A;  2M5W A;  4S05 A;  4EV0 A;  1G3T A;  1D3Y A;  3H92 A;  2GAU A;  3AAF A;  4ENM A;  1YG2 A;  2VXZ A;  1WKM A;  4KN7 X;  4I0B A;  2K4J A;  3FM5 A;  3IL2 A;  1W4M A;  4F7Z A;  5HLG A;  1TLH B;  2F5C A;  1YTY A;  1ON2 A;  4Z2Y A;  3CDH A;  3F3X A;  4WK8 F;  4HX8 A;  4P96 A;  2EA2 A;  1YLF A;  2FXA A;  2OQR A;  3TGN A;  2DFI A;  3WTW C;  3HTS B;  4QWQ A;  2P8T A;  1D8J A;  1U3E M;  2DTR A;  2HFH A;  2VOP A;  2OBP A;  3U9G A;  3BDD A;  3ROU A;  1IXS B;  2D2W A;  3S2W A;  3WTU C;  3F23 A;  3DPT A;  3I64 A;  2Q2E A;  4GCV A;  5E1W A;  3T8T A;  5J6X A;  3E6B A;  2ZCW A;  1BC8 C;  5LGU A;  4UHT A;  4KIG A;  2CG4 A;  3BRO A;  1T2K A;  1I1G A;  5D4S A;  2H6B A;  4RAZ A;  2R7F A;  2ZME A;  2FQ3 A;  2AS5 F;  1Z6T A;  3CUQ A;  1ZRF A;  2HKO A;  2DT5 A;  4HAM A;  5JFR A;  5BPD A;  2FF4 A;  1ZAO A;  2PLY A;  5FFX A;  2RKH A;  3GVA A;  5L3G A;  3HSF A;  1R1V A;  3F6O A;  5JVT A;  1S8N A;  2FE3 A;  5D5X B;  4G7Z F;  4LGW A;  3ZPL A;  3N4M A;  3VFZ A;  3FZV A;  1ZG5 A;  3DXJ F;  5ICE A;  2OU2 A;  1OPC A;  1YIO A;  4I98 B;  3RDI A;  1XN7 A;  1Q1H A;  1YQA A;  2FA5 A;  2K4B A;  3MEX A;  4ZYH A;  4QLC U;  1SMY F;  3I0T A;  4UVC A;  5ILS A;  3L09 A;  3VB2 A;  2FMY A;  3G3Z A;  2QQB A;  2HZT A;  5D4R A;  3E3V A;  4A12 A;  4Q47 A;  5L3B A;  2L3D A;  1RZ4 A;  1U6G A;  1B9N A;  2XV4 S;  5ICF A;  4HV5 A;  4LFU A;  3K2Z A;  3SQN A;  3CUO A;  3SFZ A;  2ADU A;  3LA2 A;  4EVI A;  2PMU A;  3R61 A;  4ZYE A;  4I7H A;  1FSH A;  1J59 A;  3WTZ A;  2E1N A;  3ZMZ A;  1LJ9 A;  1R00 A;  4EM2 A;  3MQ0 A;  5CJ9 A;  3K0L A;  1G3W A;  2BV6 A;  4XLP F;  2QQA A;  1R58 A;  4LJZ F;  3GZ6 A;  4CIC A;  2COM A;  3REO A;  2A68 F;  5LHH A;  1BM9 A;  1FT9 A;  5A2Q Z;  2O6G E;  1Y0U A;  4ZH4 F;  3JTG A;  4L5J A;  3KP3 A;  3EUH A;  3I71 A;  4AVP A;  4MEY F;  4O5V A;  2Z3Y A;  4A2U A;  5F64 A;  2QM3 A;  2UXX A;  2EFQ A;  4HOB A;  4IXA A;  4MGR A;  1ZAR A;  1Z1D A;  4EGZ A;  3EDP A;  1HST A;  3KP6 A;  4ZYD A;  1G6N A;  4M9S A;  1G3Y A;  4IRH A;  4OIN F;  2DPD A;  4HF1 A;  4ETS A;  3GFM A;  5LEK A;  3ZMU A;  3V8K A;  2WC2 A;  2MH2 A;  3WE2 A;  3WTX C;  5IT9 K;  1LEB A;  4HZF A;  1T39 A;  2IA1 A;  4OIR F;  2IA0 A;  1SFX A;  1LEA A;  1XSD A;  2VT3 A;  2CQK A;  1HSJ A;  3KLO A;  5ED4 A;  3GUD A;  3E6C C;  5HS9 A;  4MQV A;  1BI1 A;  5ICC A;  4AIH A;  5HDK A;  5LEJ A;  2MH9 A;  4WXC A;  3B02 A;  1CGP A;  3W6J B;  1J0R A;  2OA4 A;  2XKO A;  4BHC A;  4HLY A;  3BPV A;  4GO1 A;  3E6D A;  1I27 A;  5DUI A;  1FYM A;  5IT3 A;  3L9F A;  4ZZD A;  1U5T C;  5AIQ A;  5CVR A;  1AOY A;  2GA1 A;  1J9I A;  1D5V A;  1FWZ A;  3ZMD A;  4ZZL A;  2DU9 A;  2XRO A;  2VOO A;  1QZZ A;  1P2F A;  3E5Q A;  4EJT A;  1S3J A;  2W25 A;  1UB9 A;  1XDS A;  2EV6 A;  4FX4 A;  4AWX B;  2IVM A;  3T1B A;  2XAS A;  4I2O A;  4WX9 A;  2LKP A;  2IA2 A;  2FU4 A;  4UVB A;  5D8L B;  2Q0O A;  4IPA A;  1USS A;  1IXR C;  3NQO A;  4U7D A;  3ECH A;  2FRH A;  1K6O A;  3E5X A;  4H0E A;  3R4K A;  5E18 F;  4EM1 A;  2K86 A;  2D45 A;  4EJO A;  2JPB A;  4IHT A;  3KZY A;  2RC4 A;  3F8C A;  5D5V B;  3RPQ A;  4BHP A;  4XSX F;  1WSU A;  1HKT A;  4G8X A;  5AIP A;  3D5L A;  1JXS A;  5EEG A;  3KCC A;  3BOQ A;  2PFB A;  2D1H A;  2IW5 A;  3U2R A;  3FMS A;  4GXO A;  3RYP A;  5ILU A;  1ZRE A;  3HYI A;  1O7F A;  2P7V B;  1S6L A;  2PN6 A;  2RV8 A;  3R0A A;  3EET A;  2R7D A;  4IHS A;  5F6F A;  3KZZ A;  2HYG D;  3M8F A;  1ZLK A;  1FC3 A;  1T38 A;  1KYZ A;  4M74 A;  2ZNY A;  1LQ1 A;  5L3E A;  4U0Y A;  4L0Z B;  3RKX A;  1XDU A;  3TDU C;  2L4A A;  2K02 A;  3CTA A;  2UWM A;  2KIF A;  4NHJ A;  4G9Y A;  3IRQ A;  2ZXJ A;  4UUV A;  2VON A;  3GFJ A;  1B1B A;  1U5T A;  4EJV A;  5AON A;  4CO8 A;  4A0Y A;  2A07 F;  5IT9 Z;  1MGT A;  1T6S A;  5CVU A;  2IPQ X;  2W24 A;  1HW2 A;  1BIA A;  4Y13 A;  4RB3 C;  1YW7 A;  2EV0 A;  3LA7 A;  4MNU A;  5HDG A;  4CHU A;  1IN4 A;  3BZ6 A;  3JW4 A;  5CVJ A;  4RAY A;  1KYW A;  1L0O C;  2KKO A;  3HIF A;  4HX7 A;  2ZME B;  1FBQ A;  5E1Z B;  5HLI A;  3CUQ B;  1Z7U A;  2MLK A;  3NRV A;  3F8N A;  2XVC A;  2C6Y A;  3ERE D;  3IRR A;  1BC7 C;  4BAY A;  1EH6 A;  2A3S A;  4P9U A;  1CF7 B;  2XAH A;  2DK5 A;  5KK1 A;  3CJN A;  2XIG A;  3J7A O;  3ZMS A;  2O0Y A;  3QP5 A;  5A2Q K;  1XGO A;  1U78 A;  1TTY A;  1HW1 A;  2CW0 F;  2YPR A;  4A0Z A;  4UNO A;  1BIB A;  3NEU A;  3P7N A;  1H0M A;  3KLN A;  2FEZ A;  4M6Y A;  2EFP A;  3F21 A;  3LAJ A;  2CSO A;  1IUY A;  3RPU A;  3Q5F A;  4HQM A;  3GF2 A;  3FM3 A;  1HBX G;  4E70 A;  1MKM A;  4M6X A;  1REP C;  3TO9 A;  3V7R A;  4HLX A;  4M71 A;  1O3Q A;  1TNS A;  3ULQ B;  3BWG A;  3ABT A;  1P4A A;  3RYR A;  4G6D A;  2X4H A;  2FOK A;  3O2P E;  4L9J A;  3DQV C;  2M45 A;  1IN7 A;  4Q48 A;  2HEO A;  2HTJ A;  4I0A A;  1EH7 A;  2NS0 A;  1BOA A;  2HQN A;  1MZB A;  1V4R A;  2GA2 A;  3TO6 A;  1QNT A;  2LNB A;  1CF7 A;  3HOT A;  3ZQ7 A;  4ZYG A;  4EM0 B;  2OQG A;  1KGS A;  1RUO A;  1OYI A;  3C7J A;  2EFN A;  1ZGJ A;  3MZH A;  3FX3 A;  1IRG A;  1BI0 A;  1FOK A;  2FML A;  1IW7 F;  1SD7 A;  4GYG A;  1FBU A;  3V7C A;  5FFZ A;  3J80 K;  2ESN A;  3C3W A;  2ZBK A;  4U7B A;  2HGC A;  1STZ A;  3FHZ A;  2XUB A;  2KIU A;  3SXY A;  3BJ6 A;  4N0B A;  5J8C A;  1FNN A;  1LDJ A;  2FBK A;  2RN7 A;  1F1Z A;  1MJA A;  2CWE A;  4PGG A;  1SD5 A;  4G6Q A;  1G4D A;  5J8F A;  3V7S A;  1ODD A;  4P5O A;  2JSC A;  3KP2 A;  1ULY A;  1LVA A;  4BNC A;  1LB2 A;  4HDU A;  1XB4 A;  3J81 K;  4L9V A;  1ZG1 A;  1J75 A;  1P6R A;  3HSE A;  4BH9 A;  2DPU A;  3ZP5 A;  2NRA C;  2V1D A;  2M87 A;  4LB6 B;  1WI9 A;  4KDP A;  4IJA A;  3K1M A;  2Y75 A;  1NHA A;  2P7C B;  1O7L A;  3K9T A;  3OV8 A;  4MHG A;  2XGX A;  1XMA A;  4OIP F;  2Z33 A;  1WWX A;  3F8F A;  4HDV A;  3VOD A;  2AXL A;  3I5U A;  1ZYR F;  1XD7 A;  1S7A A;  2EK5 A;  2XAJ A;  2PQ8 A;  5KVR A;  3DP7 A;  2QBY A;  2IP2 A;  4BXU A;  2BYV E;  2Q8K A;  2QVO A;  1TQM A;  1MJB A;  2DW4 A;  3L00 A;  3P9K A;  4G94 A;  1UFM A;  4L9T A;  5DDG A;  5HS8 A;  3LFK A;  1L3L A;  1GXQ A;  3QU3 A;  3WOD F;  4KMF A;  4L0Y B;  3HSR A;  2M1B A;  3IWZ A;  2HTS A;  4JQF A;  3WGG A;  1UCR A;  5BS6 A;  4A5M A;  1SFE A;  2J5P A;  1YS7 A;  2LF8 A;  1FYL A;  1SMT A;  2DK8 A;  1YW8 A;  5HVQ C;  3V4G A;  4NB5 A;  1XCV A;  1Z91 A;  1V3F A;  3TDZ C;  4JK1 X;  4BHB A;  4KMU X;  2VBZ A;  4IF4 A;  1EH8 A;  3HRM A;  4ENN A;  1MDM A;  2L02 A;  1K7A A;  3HRT A;  4B09 A;  2MA3 A;  4ON0 A;  2L01 A;  2EA4 A;  1P4X A;  5H6Q A;  2VOD A;  1SAX A;  2KRF A;  4N9I A;  3L7W A;  4EJU A;  2M8E A;  1T0F A;  2YU3 A;  2XAQ A;  1SD6 A;  3M9A A;  2V1X A;  3RIR A;  4UV8 A;  1JHH A;  4WXD A;  5D8K B;  4XRF A;  2E1C A;  5LGN A;  2A5Y B;  1BN5 A;  4FHT A;  1HW5 A;  4LG0 A;  4KFC A;  1D8K A;  3DEU A;  4KYW A;  3IKT A;  3FMR A;  2CO5 A;  3OOP A;  4FT8 A;  3JAM K;  4HW0 A;  2ZJ2 A;  4KIC A;  4MTD A;  4WF2 A;  5JHU A;  3Q9V A;  4KIF A;  1HXD A;  3TO7 A;  4RB2 C;  1FYK A;  2A69 F;  3EYY A;  1PUE E;  3R6S A;  3QAH A;  2ZO4 A;  1U2W A;  1W7P D;  1W5S A;  2O3F A;  1K78 B;  1RNL A;  4I02 A;  3J80 Z;  1RIO H;  3FXR A;  5BPI A;  3ZN0 A;  5FD6 A;  2ZKZ A;  4EMS A;  5DD8 A;  3H3U A;  2MBF A;  1ZH5 A;  1E17 A;  3FXQ A;  2ACJ A;  4PZJ A;  1QGP A;  1TNT A;  4O3M A;  1R36 A;  5DCF A;  2GXG A;  2STT A;  2DO7 A;  2CFX A;  3ECO A;  4LLN A;  3BJA A;  2RNJ A;  3MCZ A;  2P6S A;  4WCG A;  3T8R A;  3HHH A;  1K79 A;  3DF8 A;  2H27 A;  2IT0 A;  3J81 Z;  5DV5 A;  2W57 A;  4HYE A;  4MTE A;  1G3S A;  2HOE A;  4L9N A;  1PP8 F;  1FX7 A;  1U5T B;  2PEX A;  4RB0 A;  1W5T A;  1P4W A;  1LDK B;  5DCM B;  3DKW A;  2F2E A;  4OIO F;  1BBY A;  4AIK A;  2VC0 A;  2VBX A;  1IAW A;  5ICG A;  2EJR A;  2A6H F;  3BPX A;  5LHG A;  1JE8 A;  2G7U A;  4KA4 A;  1FPQ A;  3SHF A;  2YSR A;  2FNP A;  5FLX Z;  1ZN2 A;  2P5L C;  2XHK A;  2A6E F;  3BP8 A;  5E8G A;  4KT5 C;  4RS8 A;  2HS5 A;  4B8X A;  2DAO A;  2EFW A;  4ENJ A;  1DDN A;  2ESH A;  1QBJ A;  5TJJ A;  1K78 A;  1DPU A;  3BJO A;  2PG4 A;  1SD4 A;  3KEQ A;  1BI2 A;  2Z99 A;  3ELK A;  3IWF A;  1VTN C;  1U8R A;  3H3Z A;  1FP2 A;  2MLG A;  2YR2 A;  3FF5 A;  1FZP B;  3HHG A;  5L3F A;  2BE5 F;  4KN4 X;  1R1T A;  3QOP A;  4DNC A;  5CVV A;  4ESF A;  3KFW X;  3ZMV A;  2UZK A;  4EJW A;  4WWC A;  1Z9C A;  4Y17 A;  4D0P A;  3RI4 A;  1O3R A;  1DPR A;  1YS6 A;  2RDP A;  4UV9 A;  4MEX F;  3WTV C;  4AIJ A;  3IKV A;  2QYO A;  3EYI A;  2NYX A;  2A61 A;  3U1D A;  5HOO A;  4HV6 A;  5DCM A;  4G7H F;  2PBI A;  2Y0M A;  4PGH A;  4R79 A;  3I59 A;  2L54 A;  3GLX A;  2V1U A;  5LLQ A;  1A04 A;  4HA8 A;  2W84 A;  3P9C A;  1AWC A;  2CYY A;  4FX0 A;  5LRS A;  3JSP A;  3PQJ A;  3T0Y A;  4CXF A;  2GWR A;  2BGC A;  5K5R A;  2WTE A;  1JHF A;  3MZY A;  1TBX A;  3JAM Z;  5H20 A;  3M1E A;  3BY6 A;  2UXN A;  5TRD A;  4A6D A;  2DBB A;  2VC1 A;  4XLN F;  1TQI A;  4YG2 F;  3TOB A;  3GZ5 A;  2O8X A;  2HWV A;  5DYM A;  3KP5 A;  1B59 A;  3W6K B;  2MC3 A;  3R60 A;  5BMZ A;  1PP7 U;  2VN2 A;  2H94 A;  1OMI A;  1XGN A;  4L18 B;  4DQ2 A;  5ERI A;  3E5U A;  2EWN A;  3K69 A;  2LF7 A;  3I53 A;  5FD5 A;  2JZY A;  1KQ0 A;  1J7K A;  1QPM A;  2R3S A;  1O57 A;  2HDC A;  3ABU A;  2F5D A;  1MD0 A;  3B73 A;  5E20 A;  1IZ1 A;  2KJC A;  4Q4Z F;  4LB5 A;  3F8B A;  4GGG A;  3F22 A;  2FNA A;  3HRU A;  4M9X A;  3GW2 A;  3KP7 A;  2B0L A;  1IN6 A;  3EQL F;  3RKY A;  2PJP A;  1ZG3 A;  4I01 A;  3KEO A;  4Y15 A;  4N9H A;  5HDN A;  3DFG A;  4NQW A;  1E2X A;  4CDG A;  3PQK A;  1MJ9 A;  3GX4 X;  4GYI A;  4MQ9 F;  2DLL A;  2O03 A;  3V8L A;  1O3S A;  3ML6 A;  2DQR A;  3F6V A;  1I1S A;  1QO0 D;  1P92 A;  1DP7 P;  4O6J A;  1HKS A;  3MWM A;  2JTV A;  3RJP A;  1TW2 A;  2JRT A;  2GXB A;  2P5V A;  1X3U A;  4LD5 A;  4P55 A;  4A6E A;  3CO7 C;  3LWF A;  4YIF A;  2OAZ A;  4BQA A;  3M8E A;  2M30 A;  2F5E A;  1PDN C;  5H6R A;  1YO5 C;  5K5O A; 
#chains in the Genus database with same CATH topology
 4P9F A;  4YII A;  1IG7 A;  2QBY B;  1OYW A;  3OYH A;  2HYF A;  2NS8 A;  3FHN A;  4HNU A;  2JA8 J;  4OIQ F;  4YFX F;  1KU2 A;  3DKX A;  3ZRG A;  3WGH A;  5K5Q A;  4HQE A;  2LSO A;  3LAP A;  1RET A;  2B63 J;  4HBL A;  1YX5 A;  1MBG A;  1RI7 A;  4UVA A;  4XN3 A;  2LBF B;  4M72 A;  1TT0 A;  2FBI A;  4KIB A;  3CMY A;  2HKX A;  3HOS A;  1M1E B;  3WU1 B;  2XC7 A;  3T5X A;  2AO9 A;  9ANT A;  2LD5 A;  3FWE A;  2LOO A;  2RNG A;  2Y0S N;  3IC7 A;  3IH4 A;  2KJB A;  2DTZ A;  1TQP A;  1ZLJ A;  3C1D A;  3J7A Y;  2X1E A;  4M9Z A;  2GIV A;  2ETH A;  4XLC A;  1BJA A;  1JGS A;  4K2E A;  3M3Y J;  3S3M A;  1ZGA A;  3MN2 A;  3OIO A;  2L7F P;  2Y2Z A;  5E17 F;  2LC2 A;  3I4P A;  3MKZ A;  1JTY A;  1ZRC A;  3G73 A;  1FOW A;  4DW6 A;  2GOX B;  1W7P B;  3BG3 A;  5DUK A;  2GBY A;  5CYV A;  3SYT A;  4RDU A;  3JR9 A;  2ISY A;  4LLG F;  1MDM B;  2CV1 A;  3GTJ J;  1P7J A;  3GFL A;  3S3O A;  1SFK A;  2VJJ A;  1WRJ A;  1TW3 A;  2G9W A;  1WH5 A;  1KU3 A;  3I58 A;  4B3A A;  3K2A A;  3LNQ A;  4E6K G;  4NNJ A;  3Q3S A;  3A01 B;  1VF9 A;  2YX7 A;  2PMZ N;  3IP4 B;  4IRI A;  5D6F A;  4F3Q A;  3CDI A;  1LUJ B;  1RUN A;  2ZFW A;  4JX4 A;  5LBQ A;  1BA5 A;  3CCQ I;  4U0W A;  3JTH A;  2KLO A;  2F5F A;  3H5R A;  3C18 A;  2IEK A;  1WQ2 A;  3NWT A;  1S29 A;  4RGU A;  2EIN H;  1BL0 A;  3LQQ A;  1XX5 A;  2QLZ A;  4A0X A;  2GQQ A;  3S3N A;  1X3Z B;  1JT6 A;  2WV1 A;  2XGC A;  2HR3 A;  3AG3 H;  2WB1 A;  2ZNZ A;  2W00 A;  2XPU A;  4LG0 B;  5HS7 A;  2V9V A;  1W0U A;  2JA7 J;  1J5Y A;  1BI3 A;  3RCO A;  3TQN A;  2N8G A;  4C3H J;  1AKH B;  3LA3 A;  1HKQ A;  2GZW A;  1A5J A;  5LHI A;  4IKF A;  3VPR A;  3SZP A;  2LR8 A;  3WG9 A;  1F36 A;  5FLX K;  3K1P A;  3JRA A;  5CKT A;  4CGZ A;  2ME6 A;  2QQ9 A;  2OTJ I;  1GXP A;  4IQ4 A;  2OPT A;  2DOF A;  2JK3 A;  3LQR A;  1IN8 A;  5EF6 A;  4CYD A;  1KU9 A;  1KA8 A;  3P5J A;  3BG7 A;  3GYH X;  2P6T A;  1ON1 A;  3QYF A;  2E7X A;  1F43 A;  3WTY C;  2WA0 A;  1HLV A;  2NNY A;  2LBF A;  4E7L A;  4FE7 A;  1LE8 B;  3DPL C;  1IGN A;  3HG9 A;  4BKX A;  4QTR A;  3FIS A;  4II2 A;  3MVP A;  3ZQQ A;  4Y3O A;  2WWY A;  1MSF C;  5BOX A;  2PMZ A;  2BY3 A;  3PNV A;  1XGS A;  1H9G A;  3M7G A;  3FBN B;  1FP1 D;  2X0L A;  4M3D A;  4S04 A;  3HOX J;  2HVS A;  3S93 A;  1T95 A;  2X6X A;  5FLM J;  1T56 A;  2WAD A;  4E7K A;  2YX4 A;  3FKJ A;  3H36 A;  2PI0 A;  2COB A;  5KHD A;  3WTS C;  2HPI A;  1B9M A;  1H9T A;  2IRF G;  2YU9 J;  2OZ6 A;  2K9M A;  3TW7 A;  2DQL A;  4XSZ F;  2NS7 A;  4LMY A;  3ISP A;  4G7O F;  1YW9 A;  1FEX A;  1XGM A;  3BR0 A;  4KNY A;  3GO5 A;  4BE2 A;  4ENK A;  4J19 A;  2CW7 A;  4PCQ A;  2IGO A;  1W7P A;  3DTE A;  1ERD A;  2EFO A;  5F08 A;  2E36 A;  2BBY A;  2JVG A;  3TOA A;  5CQE A;  5D5U B;  1FTT A;  2IJL A;  1HCR A;  1ZRD A;  1GHC A;  2QEN A;  3K6G A;  3E7L A;  1I6X A;  2AQE A;  2E7W A;  3PUF A;  5K7H A;  2AHQ A;  2JT1 A;  2WY8 Q;  1D1B A;  4AD9 A;  3S1R J;  1W36 C;  2L2O A;  2DDB A;  1KQ8 A;  3A01 A;  1YFH A;  5EZH A;  3CCV I;  3ZXS A;  1OKR A;  4YFN F;  2RGV A;  3HUG B;  5CLS A;  1DU6 A;  1B4A A;  1UHW A;  2ISZ A;  2O61 A;  2QUF A;  3DV8 A;  2DOE A;  3OYB A;  1F4K A;  5EEA A;  5ILV A;  3HGY A;  3WTT C;  3DPU A;  3VSK A;  3V8J A;  2CGP A;  4R1H A;  4BE0 A;  5EEH A;  6PAX A;  1IXC A;  1FSE A;  4RM3 A;  2Y31 A;  2HDW A;  4XBF A;  2K27 A;  3LSR A;  2ZXH A;  2HU9 A;  2PJR B;  2VKD A;  5JVG F;  3CCE I;  3GCM A;  1QQI A;  2JJ7 A;  1Z05 A;  4YFK F;  5E3L A;  3JRF A;  1HDP A;  3GTL J;  2EZH A;  2QKM B;  1AKH A;  1N77 A;  4IVN A;  2V7F A;  3E6M A;  4CYC A;  4OU0 A;  3W2A A;  3S15 J;  3GEZ A;  3LST A;  3RKW A;  2L9S A;  2M3A A;  3AL0 B;  2V1N A;  4A69 C;  1KON A;  1R1U A;  3K10 A;  4YEL A;  2BXY A;  2VBY A;  3A2K A;  4WXH A;  2IGK A;  2OJE D;  2V6E A;  2OZU A;  1LFU P;  2NAZ A;  1J09 A;  1R4M B;  1W5C C;  2PX9 A;  3GWZ A;  3KE2 A;  1VQ6 I;  2F6C A;  2RQQ A;  4D7N A;  4JBA A;  2G7H A;  5J47 A;  1R23 A;  1F9N A;  4RGR A;  4U88 A;  4UB6 C;  2E2I J;  5FO5 A;  4F93 B;  3Q9S A;  2M0C A;  2V79 A;  1UZC A;  3MAJ A;  2QF7 A;  3CCU I;  3AG1 H;  3OS0 A;  4E7J A;  1I3Q J;  1LE8 A;  5K1Y A;  3HOZ J;  1R22 A;  2WV0 A;  3HKZ N;  4HX4 A;  4EQQ A;  4CZZ A;  3K4J A;  4JX5 A;  2W85 A;  2MFZ A;  3AG2 H;  5J3L A;  3TKY A;  3F0C A;  3CES A;  4RM2 A;  1R7J A;  2KP6 A;  1VQM I;  2STW A;  2P5K A;  3QU6 A;  4LLL A;  2XF5 A;  4BY7 J;  3GXO A;  4BDY A;  1O3T A;  5IYC J;  1ZK8 A;  2DFH A;  1Y6I A;  2XB0 X;  4OMZ A;  3KX2 A;  3JSO A;  3BTC A;  1J2X A;  5CVI A;  1KU7 A;  3WGI A;  3CCS I;  2QZ8 A;  2L4M A;  4GRI A;  4NUB A;  3VOE A;  4CCJ A;  4L5I A;  2ZJP F;  2XAG A;  2OD5 A;  2HQR A;  2HZD A;  4IL6 C;  3MFK A;  1FIA A;  2I8D A;  3H9J A;  4B44 A;  1NTC A;  3PO2 J;  1SVM A;  3FMQ A;  1ONV A;  4BQQ A;  1QZY A;  1H89 C;  3O6B B;  2VPR A;  1OR7 A;  3N97 A;  1FBS A;  4AYB A;  5HLH A;  2R5Z B;  1XCB A;  1IRF A;  4TV7 A;  4RGX A;  3DU6 A;  3O3K A;  4JOM A;  1WJF A;  4PDK A;  4E7S A;  3WG7 H;  3ZOB A;  4A3J J;  1X1B A;  3E1S A;  1Z3X A;  2L7Z A;  2JUC A;  3HUG A;  3S16 J;  1FY7 A;  4FIS A;  2VI6 A;  1NG7 A;  3I59 B;  3W3C A;  2BOL A;  5IOY A;  4Q5S F;  2Y48 A;  1D0X A;  4HSR A;  3PFY A;  3B6A A;  3HKZ A;  3I3L A;  3GFI A;  3HRS A;  1IF1 A;  3WU0 A;  2PJR A;  1ETY A;  1X1P A;  2BEO A;  3F9K A;  4LK1 F;  1Z77 A;  3DBH B;  1C0W A;  4I09 A;  4RGS A;  1Z6R A;  1WFX A;  2P4W A;  2VE9 A;  4HF2 A;  3CLO A;  1MBH A;  3H5A A;  2H6C A;  2XGD A;  1APL C;  4I99 C;  2DMQ A;  2Z5U A;  3TBI A;  1XSV A;  3FK6 A;  2CW8 A;  1OYY A;  2VBW A;  3IH3 A;  5JI6 A;  3KET A;  2FBH A;  1UHM A;  3TMO A;  3OYM A;  1XSX A;  2DMP A;  3ZMT A;  3RTR A;  1ZKG A;  4DZP A;  1V55 H;  2A6T A;  2W1O A;  3COA C;  2Z16 A;  2E1M C;  2Z9O A;  3K7A J;  2UV1 A;  4XID A;  5EG0 A;  1OQY A;  2AXT C;  5BQT A;  5FB2 A;  1YYV A;  2LLK A;  1LNW A;  5F1R A;  3BR2 A;  3VYT B;  3K4L A;  4KUM A;  4EGY A;  3H0G J;  1QZE A;  2O7O A;  3P9I A;  3OWT A;  2XSJ C;  3FXU A;  2B7E A;  4XN0 A;  2WAE A;  3BCA A;  1TC3 C;  2BZT A;  3QPH A;  3CO6 C;  3KEY A;  2K7L A;  2VAS A;  4HF0 A;  4ESJ A;  5E8I A;  3K4M A;  3KP4 A;  4R8H A;  1SFU A;  2ZJQ F;  2X51 A;  1U9N A;  5D5W B;  2TDX A;  2PMH A;  2E2H J;  2D1V A;  3A4C A;  4I76 A;  2TCT A;  1MMS A;  5IY5 H;  1X4O A;  5LRR A;  1X1D A;  2CQN A;  2F4I A;  3OYC A;  1F5T A;  5E1X A;  2VLA A;  3IHU A;  2XKP A;  4ASN A;  2H09 A;  3D0S A;  3OYD A;  4IQJ A;  1U9O A;  2ECB A;  3L2C A;  1R5G A;  4ESB A;  1MMA A;  2M4G A;  3AFH A;  4M73 A;  2E1M B;  3IAM 2;  1LDD A;  2FSW A;  1VFC A;  4HRI A;  4IRG A;  1DGW Y;  2ZME C;  4UXN A;  1G59 A;  2HOT A;  4RB1 A;  3HTU A;  2OCE A;  3ZQH A;  2KDO A;  4XLF A;  4RMN A;  3CUQ C;  2DI3 A;  3K1N A;  1SEU A;  2KFD A;  5K7F A;  2NNN A;  2XAF A;  1LFB A;  5C4X J;  3HL2 A;  4LK0 F;  2VE8 A;  2Y30 A;  4NQW B;  4AID A;  1DUX C;  1HDD C;  2LDU A;  3SEZ A;  1I5Z A;  3E97 A;  3KYC B;  3VDX A;  1B72 B;  5DD4 A;  3SZT A;  2CS3 A;  1NK3 P;  5LGT A;  3OL4 A;  3G2B A;  1B6A A;  2KPM A;  2V4J C;  2XRN A;  3PUB A;  2ID6 A;  2IGM A;  5FGM A;  1RKW A;  5DEQ A;  1UST A;  1TT5 B;  5L3D A;  1XMK A;  4LIV A;  2DXI A;  2E35 A;  2ELH A;  1GVJ A;  1S7O A;  2E34 A;  3QPT A;  2DA6 A;  1HOM A;  2RQP A;  2Q2E B;  4U0V A;  4BYY A;  2M4K A;  1VQL I;  1FLI A;  2V6C A;  2JPC A;  3QP6 A;  4A93 J;  2LG4 A;  5IP9 J;  1YRN A;  3PFI A;  2DJI A;  3F72 A;  2VT2 A;  3CJR B;  3WE3 A;  3I54 A;  3S32 A;  3FXL A;  4KT6 A;  1G2H A;  3ABM H;  3VEP A;  1QHH D;  3CJQ B;  3TL4 X;  3CF2 A;  2IAI A;  5JR3 A;  1ZHF A;  4RLF A;  4BBR J;  1R5H A;  3F8M A;  2V9P A;  4AC0 A;  3QRF F;  3ERM A;  2MD5 A;  4MLO A;  4OOI A;  2FJ1 A;  1QPI A;  1HQC A;  3ZQL A;  1GV2 A;  2XSD C;  3R0J A;  2CV0 A;  2DA3 A;  2QWW A;  3PIO F;  4OMY A;  1KQ9 A;  1GLN A;  3QOD A;  4A5N A;  2J5O A;  1IN5 A;  3ZN1 A;  4HNV A;  1EV7 A;  2EB7 A;  2RVC A;  2KIM A;  1T98 A;  5L3C A;  3LSJ A;  3OR1 C;  5D6E A;  2R7U A;  3N05 A;  2EV5 A;  5IPA A;  2M5W A;  2FX0 A;  3V42 A;  1CQT A;  4S05 A;  1H8A C;  1OCZ H;  4EV0 A;  1X2N A;  1G3T A;  1D3Y A;  3H92 A;  2QA4 I;  3PNY A;  2GAU A;  1ETV A;  3AAF A;  4ENM A;  3IV5 A;  2JA6 J;  4MFE A;  1YG2 A;  4CCL A;  2VXZ A;  3I9V 2;  1WKM A;  4KN7 X;  4I0B A;  2K4J A;  3FM5 A;  5E79 C;  5E3N A;  2ZJR F;  3IL2 A;  4XLE A;  2DYS H;  1W4M A;  4LIT A;  4F7Z A;  5HLG A;  1TLH B;  1OIS A;  2F5C A;  1YTY A;  3MD2 A;  1ON2 A;  4Z2Y A;  4CUG A;  3CDH A;  3F3X A;  4WK8 F;  4HX8 A;  2EH3 A;  4P96 A;  2EA2 A;  4QSH A;  2LVS A;  1YLF A;  2FXA A;  2OQR A;  2W7N A;  3TGN A;  2DFI A;  3VYU B;  3GTM J;  3WTW C;  3HTS B;  4QWQ A;  4CCO A;  1MND A;  5F0H A;  2P8T A;  1D8J A;  3H35 A;  4ZC3 A;  1U3E M;  3CP8 A;  5HNH A;  3JRD A;  5F0F A;  4CA0 A;  4BEH A;  2DTR A;  4M6V A;  2HFH A;  1A6Q A;  2VOP A;  2OBP A;  3U9G A;  3BDD A;  3GTP J;  4IHX A;  2JVH A;  4E7I A;  3ROU A;  5EZG A;  1S5L C;  1IXS B;  2D2W A;  3S2W A;  4YRV A;  3WTU C;  3F23 A;  3DPT A;  3I64 A;  2Q2E A;  3HEF A;  4GCV A;  5E1W A;  2LK2 A;  1BR1 A;  3T8T A;  1R5I D;  5J6X A;  3E6B A;  2ZCW A;  4B48 A;  1BC8 C;  4BJ5 C;  5LGU A;  4UHT A;  4KIG A;  2GM4 A;  2CG4 A;  3BRO A;  4B43 A;  5J4V A;  1JI8 A;  1WVR A;  3EUH C;  1T2K A;  4A3D J;  2VJ5 A;  1ACI A;  3G1O A;  1I1G A;  3OY9 A;  5D4S A;  1HA8 A;  2H6B A;  4BBS J;  4KIT B;  4RAZ A;  2R7F A;  1ORK A;  2ZME A;  3ZCO A;  2FQ3 A;  3BTL A;  3C2B A;  1Z6T A;  2AS5 F;  3CUQ A;  1ZRF A;  2HKO A;  2DT5 A;  4HAM A;  1JUM A;  2NVU B;  2BY2 A;  5JFR A;  3OYA A;  5BPD A;  2FF4 A;  3PL8 A;  2L0K A;  1ZAO A;  3DEW A;  3OSF A;  3I4M J;  2PLY A;  1XTA A;  5FFX A;  3S8P A;  2X1C A;  2RKH A;  3GVA A;  3VYS B;  5L3G A;  3HSF A;  1R1V A;  3D5R C;  3F6O A;  5JVT A;  1S8N A;  3UKG A;  2FE3 A;  2MGQ A;  4DBR A;  3RZD J;  3BR1 A;  5D5X B;  4G7Z F;  4LGW A;  5KAF C;  3ZPL A;  5FLV A;  3N4M A;  1WHU A;  2ECC A;  3RPU D;  3VFZ A;  4C3J J;  3Q0V A;  3FZV A;  1ETK A;  1ZG5 A;  3DXJ F;  5ICE A;  2OU2 A;  1OPC A;  1YIO A;  4I98 B;  2CJJ A;  3RDI A;  1XN7 A;  4LIU A;  1Q1H A;  3K70 D;  1YQA A;  2FA5 A;  2K4B A;  4J00 A;  3MEX A;  4ZYH A;  4QLC U;  1XC5 A;  2XGE A;  3DBR B;  1SMY F;  4Z6Y A;  3I0T A;  1YOV B;  4IZZ A;  4UVC A;  3CJT B;  5ILS A;  1WPK A;  3L09 A;  1S7E A;  4PSW A;  4B4C A;  3OR2 C;  2JA2 A;  1X4P A;  3J7Z I;  3VB2 A;  4MFD A;  3L2R A;  2FMY A;  3PM1 A;  3G3Z A;  4NC6 A;  2QQB A;  2HZT A;  5D4R A;  4CH7 A;  3OYL A;  3E3V A;  4A12 A;  4Q47 A;  5L3B A;  2L3D A;  1RZ4 A;  3BR3 A;  2ZB9 A;  1U6G A;  1B9N A;  2H1L A;  3KPH A;  3DWL E;  3SEQ A;  3HJE A;  5DM6 F;  2XV4 S;  3BQZ A;  5ICF A;  2M2E A;  4HV5 A;  4LFU A;  4XR6 A;  3E0J B;  5M5X J;  3K2Z A;  2LKX A;  3VWB A;  3SQN A;  3CUO A;  1LPQ A;  3SFZ A;  2ADU A;  3LA2 A;  3OIQ A;  5B66 C;  4C2U A;  2LFB A;  5KCM A;  4BXF A;  3U1K A;  3QOE A;  4EVI A;  5GPA A;  3K4B A;  2PMU A;  3R61 A;  3G4S I;  4ZYE A;  2QEX I;  1D1C A;  1I39 A;  2JA5 J;  1YX3 A;  5TGT A;  1HC8 A;  3ESW B;  1MH3 A;  5DTD A;  2ZXW H;  4I7H A;  2G0E A;  2MYS A;  1FSH A;  1J59 A;  3WTZ A;  5M3M J;  3G1M A;  2Y0S A;  2E1N A;  3ZMZ A;  1LJ9 A;  1R00 A;  4EM2 A;  4BS9 A;  1A6I A;  1Z3Y A;  3MQ0 A;  4CYC B;  1QHG A;  5CJ9 A;  2HI3 A;  1JUP A;  3K0L A;  2D5V A;  1G3W A;  3BG6 A;  2RRE A;  4LG3 A;  2BV6 A;  3FXK A;  4XKV A;  4XLP F;  2VUM J;  1EJ9 A;  2QQA A;  4FAS D;  2H8R A;  4X1E A;  4G12 A;  2R93 J;  4E7H A;  1QRY A;  1R58 A;  4YIR X;  2I10 A;  4LJZ F;  1JKP C;  3GZ6 A;  1EF4 A;  4ABZ A;  1JJ8 C;  4A3L J;  4CIC A;  1WJC A;  2JRM A;  2COM A;  1GUU A;  1EKE A;  3REO A;  2A68 F;  5LHH A;  1BM9 A;  2E1O A;  1VQO I;  1W0T A;  1FT9 A;  5A2Q Z;  3GZN B;  3RKQ A;  2O6G E;  4A3F J;  2IS1 A;  1Y0U A;  4ZH4 F;  4BAC A;  3S14 J;  4OAZ A;  3JTG A;  4L5J A;  3JRE A;  4OWR B;  1R4N B;  3KP3 A;  2VKH A;  3EUH A;  3OMY A;  3I71 A;  3G6E I;  3S17 J;  4AVP A;  4MEY F;  1DP3 A;  3DLA A;  4O5V A;  2Z3Y A;  4A2U A;  1IC8 A;  5F64 A;  2QM3 A;  2UXX A;  2X9D A;  4AVZ A;  2M7A A;  1R71 A;  2K5C A;  2EFQ A;  1U0J A;  3CLQ A;  3MKY B;  4HOB A;  3K4N A;  4M3F A;  2BXZ A;  2JUG A;  4IXA A;  1QA6 A;  2MSY A;  2DJN A;  1JKR C;  4MGR A;  1QVT A;  5EGO B;  3HM5 A;  3DLL F;  2IS6 A;  1ZAR A;  4Y33 A;  3S2H J;  1Z1D A;  2A05 A;  2ZSI B;  4EGZ A;  2GIZ A;  3EDP A;  1HST A;  3KP6 A;  4ZYD A;  5B5E C;  2FUG 2;  4DBQ A;  1R9T J;  1G6N A;  4C2M J;  4M9S A;  1G3Y A;  4IRH A;  1Z7L A;  2WBM A;  4OIN F;  2DPD A;  4HF1 A;  4ETS A;  2GLO A;  4XK4 A;  2WAF A;  3GFM A;  5LEK A;  4J01 A;  3OYK A;  1B8I B;  1RPW A;  3LL7 A;  2LTP A;  3WHB A;  4MIM A;  2M34 A;  3ZMU A;  3V8K A;  5DS9 A;  5C44 J;  2LP0 A;  4UY8 I;  2QGU A;  1A35 A;  1Y1V J;  2QSH X;  2WC2 A;  2MH2 A;  3ABK H;  3JCU C;  3WE2 A;  4C9Y A;  3WTX C;  5IT9 K;  3EUA A;  1LEB A;  2V9K A;  5IOZ A;  3B6C A;  5E3M A;  1E3P A;  4W97 A;  2L9V A;  4KIS A;  4HZF A;  1MSE C;  4P1W A;  1T39 A;  2IA1 A;  4OIR F;  2IA0 A;  1SFX A;  3OSG A;  1LEA A;  1XSD A;  5FRN A;  4ZYA A;  2WAQ N;  2VT3 A;  2CQQ A;  4ZTF A;  1BR4 A;  2CQK A;  3DBL B;  1HSJ A;  1WH7 A;  2HYJ A;  3KLO A;  5ED4 A;  1OJL A;  2OV7 A;  3GUD A;  5K7Z A;  3A03 A;  1HF0 A;  1MNM C;  3U21 A;  3E6C C;  5HS9 A;  4MQV A;  1BI1 A;  5ICC A;  3SJM A;  4AIH A;  5HDK A;  5EG0 B;  5LEJ A;  2GOM A;  2MH9 A;  4WXC A;  2L9N A;  4PK4 A;  2K9S A;  2X48 A;  2KDZ A;  3ZQC A;  3B02 A;  4D7M A;  1K4S A;  1CGP A;  3W6J B;  1J0R A;  2OA4 A;  3D5S C;  5F1J A;  2XKO A;  4BHC A;  4HLY A;  1WJB A;  4ZTJ A;  3BPV A;  4FTH A;  4GO1 A;  3E6D A;  1I27 A;  5DUI A;  1FYM A;  5IT3 A;  3L9F A;  1MMG A;  2DDA A;  4ZZD A;  1U5T C;  5AIQ A;  5CVR A;  1VQP I;  2R4G A;  3FXJ A;  1AOY A;  2GA1 A;  4XON A;  1D5V A;  1J9I A;  1ZEL A;  2NVT J;  1RR8 C;  1FWZ A;  3ZMD A;  3CZ6 A;  1TL8 A;  4ZZL A;  1JGG A;  2L7M P;  3L2U A;  2DU9 A;  4L5E A;  2XRO A;  2H1K A;  2K85 A;  3CCY A;  1ENH A;  2VOO A;  1QZZ A;  3W2V A;  3CDL A;  1P2F A;  2OC6 A;  4M3E A;  5EGO A;  5GAD J;  3E5Q A;  4RAG A;  3H1C A;  3OL3 A;  2HVQ A;  4EJT A;  1GV5 A;  1S3J A;  2W4S A;  2W25 A;  2NVQ J;  3CMA I;  1UB9 A;  2L9R A;  1N75 A;  2R0Q C;  2NVX J;  2CUF A;  2Y9Y A;  1XDS A;  2EV6 A;  4FX4 A;  4XIC A;  4E7Z A;  4AWX B;  1IDY A;  2IVM A;  3T1B A;  1RC9 A;  4OAY A;  5F0C A;  2XAS A;  1IRX A;  1B8I A;  4I2O A;  1BR2 A;  4WX9 A;  1RRJ A;  1H88 C;  2LKP A;  1GVD A;  2IA2 A;  1WJD A;  2FU4 A;  4UVB A;  5IYD J;  5D8L B;  1T8I A;  2Q0O A;  4IPA A;  1I6H J;  3ZQF A;  5KNL A;  1USS A;  1IXR C;  3NQO A;  1K4T A;  3HOV J;  4U7D A;  3ECH A;  2FRH A;  1K6O A;  3E5X A;  4H0E A;  3R4K A;  4IO9 F;  5E18 F;  1TP4 A;  2VL8 A;  4EM1 A;  2K86 A;  2D45 A;  4EJO A;  4EAT A;  5GPC A;  3K4K A;  2DN0 A;  2JPB A;  3LSG A;  4IHT A;  3KZY A;  3CD6 I;  2O8K A;  3S1M J;  2RC4 A;  2X6O A;  3F8C A;  1YRN B;  1VND A;  5D5V B;  3RPQ A;  5EJC A;  4BHP A;  4D5C A;  4XSX F;  3M07 A;  3HOU J;  1WSU A;  1HKT A;  4G8X A;  5AIP A;  3D5L A;  3Q0W A;  1ETW A;  5FKM A;  1JXS A;  2E5N A;  2FOW A;  1FMV A;  4V2F A;  3OYG A;  2VQL A;  1TWF J;  3DEE A;  5EEG A;  1RES A;  2MAB A;  4DYR A;  5DM7 F;  1GDT A;  5GP9 A;  4BGD A;  3KCC A;  3BOQ A;  2PFB A;  2D1H A;  4F92 B;  2IW5 A;  2HOS A;  2OUM A;  3LOC A;  3HBL A;  2EZI A;  3U2R A;  3FMS A;  4GXO A;  3RYP A;  4A3G J;  5ILU A;  2I5U A;  3HYI A;  1ZRE A;  1O7F A;  1FMW A;  4XRM A;  3K70 C;  5EYR A;  2P7V B;  1S6L A;  2PN6 A;  3MZ8 A;  2RV8 A;  5CPR B;  2Q1Z B;  2DA4 A;  5JLX A;  3PSI A;  3R0A A;  2CUJ A;  3EET A;  3HXL A;  2R7D A;  2E71 A;  3IH2 A;  4IHS A;  5F6F A;  3KZZ A;  5GAE J;  5HOD A;  1EA3 A;  2HYG D;  3M8F A;  2M9H A;  4PJ0 C;  1ZLK A;  3OYI A;  2XDV A;  1FC3 A;  2XF7 A;  3O8H A;  1T38 A;  3H3V K;  1KYZ A;  4M74 A;  3ASO H;  2ZNY A;  1LQ1 A;  1O4X A;  2A5W A;  2Y69 H;  5L3E A;  2CMP A;  4U0Y A;  4L0Z B;  3RKX A;  1XDU A;  1G8X A;  3TDU C;  1XMX A;  2L4A A;  1IRZ A;  1NH3 A;  1MMD A;  1FOX A;  2K02 A;  3CTA A;  2UWM A;  4Y4R A;  2KIF A;  4NHJ A;  4G9Y A;  4BE1 A;  3IRQ A;  2UUZ A;  1U8B A;  1X58 A;  2ZXJ A;  5J1U A;  4F55 A;  4D9J A;  2ZFU A;  4UUV A;  2VON A;  1X19 A;  3BTJ A;  1XS9 A;  3GFJ A;  2VKE A;  1B1B A;  4PFO A;  4M3G A;  1OFC X;  4BEH B;  1U5T A;  5LFA A;  4EJV A;  5AON A;  4CO8 A;  4A0Y A;  2A07 F;  1Z0X A;  2R7X A;  3OYF A;  2DMN A;  3CCJ I;  5IT9 Z;  2VIX A;  1MGT A;  1T6S A;  4FE4 A;  5CVU A;  2IPQ X;  4C3I J;  3BT9 A;  4ANJ A;  2AQF A;  4ZDL A;  3CMM A;  2W24 A;  4BUP A;  3H5N A;  4PUS A;  1HW2 A;  1BIA A;  4Y13 A;  4RB3 C;  1YW7 A;  2BY1 A;  1A31 A;  2EV0 A;  3LA7 A;  4XRS A;  2DT6 A;  4F91 B;  2R7S A;  4MNU A;  5HDG A;  2MD0 A;  4CHU A;  1IN4 A;  3BZ6 A;  3JW4 A;  5CVJ A;  5J4Y A;  1X1A A;  4RAY A;  1KYW A;  1VQ7 I;  4XKB A;  3MKW B;  1L0O C;  2KRC A;  2KKO A;  2ME0 A;  3HIF A;  4HX7 A;  2R7Z J;  5C3E J;  2W82 A;  2ZME B;  1FBQ A;  4NDL A;  3FDY A;  5E1Z B;  5HLI A;  1MH4 A;  3HC7 A;  3KIO A;  2F48 A;  3CUQ B;  1T33 A;  1Z7U A;  1V5E A;  4XRS G;  3I4N J;  3JRC A;  2MLK A;  1P9Q C;  2XPW A;  3BQY A;  3F8N A;  2XVC A;  3NRV A;  2KIQ A;  2C6Y A;  3ERE D;  5JHF A;  2VQC A;  3IRR A;  2OCC H;  1BC7 C;  4BAY A;  1EH6 A;  2A3S A;  4XLA A;  4P9U A;  1CF7 B;  1D5Y A;  5FKL A;  3ZR8 X;  5TIS C;  2XAH A;  4BQN A;  2DK5 A;  1PYV A;  4CCM A;  5KK1 A;  3S2D J;  3CJN A;  1W1W E;  2XIG A;  2KQR A;  4PJM A;  3WU2 C;  3J7A O;  3MMY B;  3W2W A;  3ZMS A;  2O0Y A;  3QP5 A;  3L2W A;  5A2Q K;  2QSF X;  3QWL A;  2QCO A;  4F52 A;  1DU0 A;  4M3B A;  3M8J A;  1XGO A;  2DA5 A;  3A1Y A;  1U78 A;  2HVR A;  1TTY A;  2O5R A;  4AU7 A;  1HW1 A;  2CW0 F;  2YPR A;  4A0Z A;  4UNO A;  4RBO A;  4AM3 A;  2ZC2 A;  3UR3 C;  2EZK A;  2LY9 A;  1OCC H;  4XOR A;  2DFF A;  3DTK A;  4S0H B;  4JP0 A;  1FTZ A;  1BIB A;  3NEU A;  3P7N A;  1H0M A;  3KLN A;  2FEZ A;  1Y8Q B;  1T08 B;  2KMU A;  4M6Y A;  3C2G A;  2EFP A;  3BLY A;  3F21 A;  4I6Z A;  2L7K A;  3LAJ A;  2CSO A;  1IUY A;  3RPU A;  4NC7 A;  3Q5F A;  4HQM A;  3LSP A;  3GF2 A;  1YIJ I;  1MW7 A;  3FM3 A;  1HBX G;  3HOY J;  4E70 A;  4D5F A;  3L2Q A;  3CC4 I;  1MKM A;  4M6X A;  2VPL A;  1REP C;  2F4O B;  3TO9 A;  2KRH A;  3V7R A;  2NOJ B;  4HLX A;  2HXO A;  4M71 A;  1O3Q A;  1TNS A;  1K6Y A;  1VZ0 A;  2YUS A;  3ULQ B;  4B47 A;  4RLQ A;  1S72 I;  3FK7 A;  1IV8 A;  3BWG A;  3ABT A;  1P4A A;  3KZI C;  4A3C J;  1YIT I;  3GTQ J;  2FQ4 A;  3RYR A;  4G6D A;  2R7V A;  3TP3 A;  4H4K C;  3CCL I;  4UB8 C;  2X4H A;  3L1P A;  2FOK A;  3CCM I;  1Y8R B;  3O2P E;  4L9J A;  3DQV C;  2M45 A;  1IN7 A;  4Q48 A;  4X0G A;  2HEO A;  2HTJ A;  4I0A A;  3J7Y J;  3S1Q J;  1EH7 A;  2NS0 A;  1BOA A;  2HQN A;  4XM3 A;  1MZB A;  1V4R A;  2GA2 A;  3TO6 A;  1OCR H;  1QNT A;  2KT0 A;  1FJL A;  2LNB A;  2LRE A;  2E2J J;  1FIP A;  2JWT A;  1UAA A;  1CF7 A;  3BG9 A;  2LRD A;  1XG1 A;  3HOT A;  1V5F A;  4XL9 A;  4XLH A;  5J1R A;  3ZQ7 A;  4ZYG A;  4EM0 B;  2OQG A;  3FKI J;  4U87 A;  3GTK J;  1FOY A;  1KGS A;  1RUO A;  4PJJ A;  4DYC A;  3G1L A;  1VQN I;  3VYR B;  1OYI A;  3C7J A;  2XAU A;  1TWA J;  2EFN A;  4BJT A;  1ZGJ A;  4DGW B;  3H9Q A;  3MZH A;  5GTI C;  3FX3 A;  1IRG A;  4JX6 A;  1BI0 A;  1Z67 A;  2DOD A;  1FOK A;  2FML A;  1IW7 F;  1SD7 A;  4GYG A;  2R7R A;  4BQO A;  1V54 H;  2Z2S B;  3QYE A;  4D1Q A;  3FXO A;  2R92 J;  1FBU A;  3V7C A;  4RAF A;  5FFZ A;  3J80 K;  2LKS A;  2ESN A;  2X1D A;  1AU7 A;  3C3W A;  2ZBK A;  1T0F C;  3D1N I;  4NC8 A;  3LSM A;  4U7B A;  1R49 A;  2HGC A;  3NAR A;  1STZ A;  3FHZ A;  1PVE A;  2R5Y A;  2XUB A;  1QU3 A;  3GTO J;  2KIU A;  3SXY A;  2WB1 N;  4HST A;  1SAU A;  1E3H A;  3BJ6 A;  4N0B A;  5J8C A;  1FNN A;  1LDJ A;  1Q1V A;  2FBK A;  5H2F C;  3BZC A;  2RN7 A;  1F1Z A;  2H8W A;  1MJA A;  2M7B A;  1NG6 A;  1K83 J;  2CWE A;  4PGG A;  1SD5 A;  4G6Q A;  1G4D A;  5J8F A;  3V7S A;  1ODD A;  1YJN I;  4A3I J;  3BR6 A;  3HPH A;  4P5O A;  2JSC A;  3ZQG A;  3IUO A;  3KP2 A;  1ULY A;  1LVA A;  4BNC A;  2HDD A;  1LB2 A;  2HQ5 A;  4HDU A;  4A3E J;  1XB4 A;  1ZTR A;  3J81 K;  4L9V A;  3BZK A;  2ZSH B;  1P6R A;  1ZG1 A;  1J75 A;  3ZQI A;  3HSE A;  5FKO A;  4BH9 A;  2DPU A;  3ZP5 A;  1WCM J;  2NRA C;  2V1D A;  2VXD A;  2M87 A;  4LB6 B;  1JKO C;  2HPM A;  3GBG A;  1WI9 A;  4KDP A;  5IYB J;  3JRG A;  4IJA A;  5BNG A;  3K1M A;  2Y75 A;  1NHA A;  2EIL H;  2P7C B;  1O7L A;  3K9T A;  3OV8 A;  4MHG A;  2XGX A;  1XMA A;  4IHW A;  4OIP F;  3AG4 H;  1YHQ I;  1PUF A;  2Z33 A;  1WWX A;  1P7I A;  2EQR A;  3F8F A;  4V2G A;  4HDV A;  3OYN A;  4CCK A;  1YI2 I;  4IHV A;  3VOD A;  1OCT C;  2GXA A;  1SVL A;  2AXL A;  3I5U A;  1BW6 A;  1XD7 A;  1ZYR F;  2DMT A;  2CUZ A;  4DOZ A;  1S7A A;  2EK5 A;  2XAJ A;  2PQ8 A;  5KVR A;  3DP7 A;  3IAS 2;  3I55 I;  2QBY A;  2IP2 A;  4BXU A;  1OR7 C;  1ETX A;  4II3 A;  2BYV E;  1N78 A;  2Q8K A;  2QVO A;  1TQM A;  3TW6 A;  1MJB A;  1MMN A;  1WZ2 A;  2DW4 A;  3L00 A;  1D0Z A;  3P9K A;  4G94 A;  3CQZ J;  3DKY A;  1UFM A;  1MBK A;  4L9T A;  5DDG A;  4BU2 A;  2F5V A;  5HS8 A;  5KAI C;  3LFK A;  1L3L A;  1GXQ A;  3QU3 A;  3WOD F;  4KMF A;  4L0Y B;  3HSR A;  3M4O J;  2M1B A;  3IWZ A;  3OS1 A;  4BL0 B;  2K9Q A;  2HTS A;  3FBI B;  4JQF A;  2EIM H;  3WGG A;  1UCR A;  5BS6 A;  4A5M A;  2ZXI A;  1SFE A;  4AUX A;  2J5P A;  1YS7 A;  2LYC A;  2NVY J;  4QPQ A;  2LF8 A;  1VQ4 I;  3SDG A;  1FYL A;  4W1U A;  1NK2 P;  2RAE A;  4B1R A;  3VSL A;  1GT0 C;  1SMT A;  2DK8 A;  3HDD A;  1YW8 A;  4RA2 A;  4QIW N;  5HVQ C;  1BW5 A;  3LSK A;  3V4G A;  2DA7 A;  4NB5 A;  3K4C A;  1XCV A;  4CSW A;  3TED A;  1Z91 A;  2HQA A;  3AL0 C;  1V3F A;  3TDZ C;  4JK1 X;  4A3K J;  4BHB A;  4CZC A;  4KMU X;  4ZJZ A;  2VBZ A;  4IF4 A;  3BG5 A;  1EH8 A;  3HRM A;  1IO2 A;  3MKL A;  4ENN A;  2JSP A;  2L02 A;  1MDM A;  1K7A A;  3HRT A;  4B09 A;  4BY1 J;  2MA3 A;  4ON0 A;  2L01 A;  2EA4 A;  1KZH A;  1P4X A;  5H6Q A;  2ID3 A;  4C30 A;  2R7O A;  2VOD A;  4IX7 A;  1WJ5 A;  1SAX A;  2KRF A;  1ITY A;  4UUS B;  2K40 A;  3ZGK A;  4N9I A;  2BHZ A;  3C2H A;  3L7W A;  1TWH J;  4EJU A;  2M8E A;  1T0F A;  2YU3 A;  2KHM A;  2XAQ A;  3JRH A;  2MG4 A;  2LMD A;  1SD6 A;  3M9A A;  5FKK A;  2V1X A;  3RIR A;  4UV8 A;  1JHH A;  4WXD A;  5D8K B;  2NOG A;  3CCR I;  4XRF A;  1IUF A;  4PJL A;  2E1C A;  2HNH A;  5LGN A;  5EDN A;  2A5Y B;  2Z1D A;  3GLL A;  2R7T A;  1BN5 A;  2BVM A;  4FHT A;  1HW5 A;  4LG0 A;  4KFC A;  1D8K A;  3DEU A;  4KYW A;  1WGX A;  3IKT A;  1POG A;  3FMR A;  2CO5 A;  3OOP A;  2E5Z A;  4FT8 A;  3NWS A;  3JAM K;  4AYB N;  1N25 A;  1Y0N A;  4HW0 A;  4PFP A;  3OYE A;  2ZJ2 A;  2VQG A;  4KIC A;  3QYB A;  3HZJ A;  1X1C A;  4WF2 A;  4MTD A;  5JHU A;  1ETO A;  3Q9V A;  4KIF A;  1HXD A;  3FIW A;  3TO7 A;  1IDZ A;  4RB2 C;  1FYK A;  2JN6 A;  2LY2 A;  2A69 F;  3EYY A;  1UEL B;  1PUE E;  4NBQ A;  3R6S A;  3QAH A;  5J40 A;  2ZO4 A;  1U2W A;  2JMW A;  1W7P D;  1W5S A;  2O3F A;  2KZV A;  4DIQ A;  1K78 B;  1RNL A;  4I02 A;  3J80 Z;  1RIO H;  3FXR A;  1TWC J;  5BPI A;  2ELK A;  3DTI A;  3ZN0 A;  5FD6 A;  2ZKZ A;  4HEA 2;  4EMS A;  5DD8 A;  5HNF A;  3H3U A;  2LY1 A;  2MBF A;  3A0H C;  3KYL A;  2TRT A;  1ZH5 A;  1E17 A;  5IP6 A;  3FXQ A;  2ACJ A;  3JRB A;  1JKQ C;  4PZJ A;  1QGP A;  3H9G A;  1TNT A;  4O3M A;  1R36 A;  1SAN A;  5DCF A;  2GXG A;  4EEF G;  2DO7 A;  2STT A;  4ZDO A;  2CFX A;  3ECO A;  5CQG A;  4HNT A;  2XPV A;  3CC2 I;  2WAQ A;  4LLN A;  3BJA A;  1YJ9 I;  3HGG A;  1DQU A;  4LOC A;  2RNJ A;  3MCZ A;  2P6S A;  4WCG A;  3LMM A;  2KL4 A;  3T8R A;  3AKZ A;  1UJ8 A;  4G6T B;  1RKT A;  3HHH A;  3SDB A;  2F4M B;  1K79 A;  3DF8 A;  1WJE A;  2VJ4 A;  3DU5 A;  2DMU A;  3PNT A;  2H27 A;  4PJN A;  2IT0 A;  3J81 Z;  3X2Q H;  2XF6 A;  5DV5 A;  2W57 A;  4KJZ A;  4BXX J;  2FD5 A;  1JUS A;  2X85 A;  3CC7 I;  4HYE A;  1Y1W J;  4MTE A;  1G3S A;  1A36 A;  2HOE A;  4XQF A;  4UUS A;  1UHS A;  1BOB A;  2MW8 A;  4L9N A;  1D0Y A;  1PP8 F;  1FX7 A;  1U5T B;  2CQX A;  2PEX A;  5F27 A;  4RB0 A;  1W5T A;  2EIJ H;  1P4W A;  1LDK B;  4A3M J;  2DA1 A;  5DCM B;  5FRO A;  4Y52 J;  3DKW A;  2F2E A;  2IGN A;  2EZL A;  2IS2 A;  1BJZ A;  2OF7 A;  4OIO F;  3Q0U A;  1AA7 A;  3O8G A;  4XOP A;  1BBY A;  3ONQ A;  3BCB A;  4AIK A;  2VC0 A;  2VBX A;  3M1C A;  1IAW A;  1R6R A;  5ICG A;  2EJR A;  2NXN B;  2A6H F;  3BPX A;  1UG0 A;  5LHG A;  1JE8 A;  5GAG J;  2G7U A;  1OCO H;  4KA4 A;  1SC7 A;  4DJA A;  1FPQ A;  3SHF A;  3UNG C;  2YSR A;  2FNP A;  1ZR2 A;  4QPO A;  5FLX Z;  1ZGW A;  1X3W B;  1ZN2 A;  2P5L C;  4XOT A;  2XHK A;  2OTL I;  2A6E F;  3BP8 A;  4XKC A;  4KT5 C;  4RS8 A;  5E8G A;  2HS5 A;  1DGR M;  4B8X A;  1ZQ3 P;  1OLT A;  2DAO A;  2DT7 B;  1Y39 A;  2EFW A;  4ENJ A;  3PJR A;  2HOA A;  4HG2 A;  5M3F J;  3OS2 A;  5C4J J;  2ESH A;  2L5Q A;  1DDN A;  1TZL A;  3RQ4 A;  1QBJ A;  3L2V A;  5TJJ A;  2K9L A;  1K78 A;  1DPU A;  1WJA A;  3BJO A;  4XNF A;  2PG4 A;  3GTG J;  1SD4 A;  3KEQ A;  1BI2 A;  2VQH A;  1MBE A;  2Z99 A;  3NAU A;  3ELK A;  5JLW A;  4DYQ A;  3IWF A;  3BC8 A;  1VTN C;  1U8R A;  3CME I;  1SVO A;  3H3Z A;  1FP2 A;  2MLG A;  2YR2 A;  3FF5 A;  5F04 A;  1TWG J;  1FZP B;  3HHG A;  5L3F A;  3PO3 J;  2BE5 F;  3OIP A;  3GME A;  4KN4 X;  1R1T A;  1V5G A;  3QOP A;  4DNC A;  1XPX A;  5CVV A;  4ESF A;  3HOW J;  3KFW X;  3ZMV A;  2XRL A;  2IBD A;  2X6W A;  2CQ7 A;  2UZK A;  2BHY A;  4EJW A;  4WWC A;  5FJ8 J;  3I56 I;  1JJ6 C;  1Z9C A;  4Y17 A;  4D0P A;  3RI4 A;  5B3S H;  1K61 A;  4IOC F;  1O3R A;  2K3F A;  3PSF A;  1UMQ A;  1DPR A;  4E4H A;  2DCE A;  1QVU A;  1YS6 A;  2JQ7 A;  1ETQ A;  2R5Z A;  1AHD P;  4GDF A;  2EBI A;  2RDP A;  4UV9 A;  4MEX F;  3WTV C;  4AIJ A;  4FET A;  3IKV A;  2QYO A;  3EYI A;  2DFE A;  2NYX A;  2EIK H;  1I3A A;  2CU7 A;  2A61 A;  3U1D A;  5HOO A;  4HV6 A;  5DCM A;  2PBI A;  2Y0M A;  4R79 A;  4PGH A;  4G7H F;  4IOA F;  3W6V A;  3I59 A;  2L54 A;  3JRI A;  3S1N J;  4ZDP A;  3GLX A;  2V1U A;  1W36 D;  1Z21 A;  2M0M A;  2E19 A;  5LLQ A;  1A04 A;  4HA8 A;  5GAH J;  2W84 A;  3P9C A;  2O9L A;  2DOA A;  3ASN H;  1AWC A;  2CYY A;  4FX0 A;  5LRS A;  3JSP A;  1MBJ A;  3PQJ A;  2YS9 A;  1X2M A;  3SFI A;  3T0Y A;  5GTH C;  2BW3 B;  4CXF A;  2GWR A;  2IS4 A;  2BGC A;  5K5R A;  2WTE A;  1JHF A;  3MZY A;  1TBX A;  3JAM Z;  1LKX A;  3RZO J;  5H20 A;  2LH9 A;  2B9S A;  3RSN A;  2QQ8 A;  3M1E A;  3BY6 A;  3QPL A;  2UXN A;  5TRD A;  4FCY A;  4A6D A;  2KIS A;  5IP7 J;  2DYR H;  3DCF A;  5B1B H;  4IEJ A;  3BR5 A;  3TP0 A;  4GFB A;  4N4N B;  2Y9Z A;  2DBB A;  2VC1 A;  4XLN F;  5LD2 C;  1TQI A;  3G71 I;  4YG2 F;  2CH0 A;  3TOB A;  2BY0 A;  2CUE A;  4XMY A;  2CFO A;  3GZ5 A;  2O8X A;  2HWV A;  5DYM A;  3EUK L;  3A02 A;  3KP5 A;  1B59 A;  3W6K B;  2IXS A;  2K9N A;  2MC3 A;  3R60 A;  2VKV A;  2VB6 A;  1D1A A;  3LFU A;  3OOU A;  5BMZ A;  1PP7 U;  2VN2 A;  2H94 A;  5FRM A;  1OMI A;  2HXI A;  3EPZ A;  1XGN A;  3PIP F;  4L18 B;  2BVL A;  4DQ2 A;  4UUT A;  4XKW A;  4N4O B;  4X6A J;  2CV2 A;  5ERI A;  3E5U A;  2EWN A;  3K69 A;  2LF7 A;  5FKN A;  3I53 A;  5FD5 A;  4V19 K;  1YE9 A;  2JZY A;  5HLT A;  5E3O A;  5M5W J;  2E60 A;  3RQI A;  3LSH A;  2P81 A;  1ZR4 A;  1KQ0 A;  4Y7N J;  1J7K A;  1QPM A;  2R3S A;  4MO7 A;  1O57 A;  2HDC A;  3ABU A;  2QSG X;  2F5D A;  1MD0 A;  2QKL B;  3B73 A;  2XB5 A;  3HPG A;  5E20 A;  1IZ1 A;  3QPS A;  4DZJ A;  2ELJ A;  2KJC A;  1Y56 A;  1SFO J;  1IJW C;  1JTX A;  3LSI A;  4Q4Z F;  4LB5 A;  3F8B A;  4GGG A;  3F22 A;  2R5Y B;  3OYJ A;  4BJ6 C;  2FNA A;  2VJI A;  3HRU A;  4M9X A;  1PJR A;  1LFP A;  2ICW G;  3GW2 A;  2R7Q A;  3KP7 A;  2B0L A;  1IN6 A;  3EQL F;  3RKY A;  2PJP A;  3A0B C;  2X6Y A;  1ZG3 A;  1MBF A;  4JYK A;  4I01 A;  2CRG A;  4C2T A;  1YJW I;  3KEO A;  4Y15 A;  4YEJ A;  4ITV A;  4N9H A;  5HDN A;  3KYD B;  1VQ9 I;  4A3B J;  2EPF A;  1MIJ A;  4PSX A;  3DFG A;  4NQW A;  3WHC A;  2WY7 Q;  3CF5 F;  1VQK I;  1MNE A;  1E2X A;  3CP2 A;  3SZG A;  4CDG A;  1VQ5 I;  3PQK A;  1MJ9 A;  1IV6 A;  3BTI A;  4B3X A;  1B72 A;  2KZG A;  5J1Y A;  3GX4 X;  4GYI A;  1WI3 A;  3HB9 A;  1E0E A;  4MQ9 F;  2DLL A;  2O03 A;  1E3O C;  3V8L A;  1O3S A;  2DA2 A;  3ML6 A;  4FQG A;  2DQR A;  3F6V A;  1I1S A;  1RR7 A;  2BW3 A;  1QO0 D;  1P92 A;  2M8G X;  4HPQ A;  5B1A H;  1JT0 A;  2V26 A;  1DP7 P;  4O6J A;  4BDZ A;  1HKS A;  3MWM A;  2JTV A;  2R7W A;  3RJP A;  3FXM A;  1TW2 A;  1S9H A;  1VI0 A;  2MC4 A;  2W48 A;  2JRT A;  2GXB A;  2P5V A;  5M5Y J;  2K3P A;  1PUF B;  1LVK A;  1X3U A;  2P0W A;  4LD5 A;  4P55 A;  4A6E A;  3CO7 C;  3LWF A;  4CCN A;  4YIF A;  2OAZ A;  4BQA A;  3M8E A;  1UG2 A;  2M30 A;  1I50 J;  2F5E A;  1PDN C;  1OCP A;  3ABL H;  5H6R A;  1YO5 C;  1VQ8 I;  3H0D A;  5K5O A;  4IHY A;  3QQA A; 
#chains in the Genus database with same CATH homology
 4P9F A;  4YII A;  2QBY B;  1OYW A;  2HYF A;  4OIQ F;  4YFX F;  1KU2 A;  3WGH A;  5K5Q A;  4HQE A;  2LSO A;  3LAP A;  4HBL A;  1RI7 A;  4UVA A;  4M72 A;  2FBI A;  4KIB A;  2HKX A;  3HOS A;  3WU1 B;  3T5X A;  3FWE A;  3IC7 A;  2KJB A;  1TQP A;  1ZLJ A;  3C1D A;  4M9Z A;  2GIV A;  2ETH A;  1BJA A;  1JGS A;  4K2E A;  1ZGA A;  5E17 F;  3I4P A;  1ZRC A;  3G73 A;  1W7P B;  5DUK A;  5CYV A;  2ISY A;  4LLG F;  1MDM B;  3GFL A;  1WRJ A;  1TW3 A;  2G9W A;  3I58 A;  1KU3 A;  2YX7 A;  4IRI A;  5D6F A;  1RUN A;  2ZFW A;  5LBQ A;  4U0W A;  3JTH A;  2F5F A;  3C18 A;  4RGU A;  1WQ2 A;  1S29 A;  3LQQ A;  2QLZ A;  4A0X A;  2GQQ A;  2HR3 A;  2ZNZ A;  4LG0 B;  5HS7 A;  2V9V A;  1J5Y A;  1BI3 A;  3TQN A;  3LA3 A;  1HKQ A;  2GZW A;  5LHI A;  3SZP A;  3WG9 A;  5FLX K;  3K1P A;  4CGZ A;  2QQ9 A;  1GXP A;  3LQR A;  1IN8 A;  4CYD A;  1KU9 A;  1KA8 A;  3GYH X;  2P6T A;  1ON1 A;  2E7X A;  3WTY C;  2NNY A;  3DPL C;  2WWY A;  5BOX A;  1XGS A;  1H9G A;  3M7G A;  1FP1 D;  2X0L A;  4S04 A;  2YX4 A;  2PI0 A;  3WTS C;  1B9M A;  1H9T A;  2IRF G;  2OZ6 A;  2DQL A;  4XSZ F;  4LMY A;  3ISP A;  4G7O F;  1YW9 A;  1XGM A;  4KNY A;  3GO5 A;  4ENK A;  4PCQ A;  1W7P A;  2EFO A;  2BBY A;  3TOA A;  5D5U B;  2IJL A;  1GHC A;  1ZRD A;  2QEN A;  1I6X A;  2E7W A;  2JT1 A;  4AD9 A;  1KQ8 A;  1YFH A;  1OKR A;  4YFN F;  2RGV A;  5CLS A;  1B4A A;  1UHW A;  2ISZ A;  2O61 A;  2QUF A;  3DV8 A;  1F4K A;  5ILV A;  3WTT C;  3V8J A;  2CGP A;  4R1H A;  5EEH A;  6PAX A;  1IXC A;  1FSE A;  4XBF A;  2K27 A;  1QQI A;  4YFK F;  1Z05 A;  4IVN A;  3E6M A;  4OU0 A;  3GEZ A;  3LST A;  3RKW A;  1R1U A;  2VBY A;  4WXH A;  2OZU A;  2NAZ A;  3KE2 A;  3GWZ A;  4JBA A;  2G7H A;  1R23 A;  1F9N A;  4RGR A;  4U88 A;  5FO5 A;  3Q9S A;  2V79 A;  3MAJ A;  5K1Y A;  1R22 A;  2WV0 A;  4HX4 A;  4EQQ A;  4CZZ A;  2W85 A;  3TKY A;  1R7J A;  2STW A;  2P5K A;  3QU6 A;  4LLL A;  3GXO A;  1O3T A;  4OMZ A;  3JSO A;  1J2X A;  5CVI A;  1KU7 A;  3WGI A;  2QZ8 A;  2L4M A;  3VOE A;  4L5I A;  2XAG A;  2OD5 A;  2HQR A;  3MFK A;  3FMQ A;  1ONV A;  1QZY A;  3O6B B;  3N97 A;  1OR7 A;  1FBS A;  5HLH A;  1XCB A;  1IRF A;  4TV7 A;  4RGX A;  3O3K A;  4PDK A;  3HUG A;  1FY7 A;  3I59 B;  4Q5S F;  2Y48 A;  3GFI A;  3HRS A;  1IF1 A;  3WU0 A;  2BEO A;  4LK1 F;  1C0W A;  4I09 A;  4RGS A;  1Z6R A;  2P4W A;  2VE9 A;  4HF2 A;  3CLO A;  2H6C A;  2Z5U A;  1XSV A;  1OYY A;  2VBW A;  5JI6 A;  3KET A;  2FBH A;  1UHM A;  1XSX A;  3ZMT A;  3RTR A;  3COA C;  2Z9O A;  5FB2 A;  5BQT A;  1YYV A;  1LNW A;  5F1R A;  4KUM A;  4EGY A;  3P9I A;  3FXU A;  3QPH A;  3CO6 C;  2K7L A;  4HF0 A;  4ESJ A;  5E8I A;  3KP4 A;  4R8H A;  1SFU A;  5D5W B;  2TDX A;  2PMH A;  2D1V A;  5LRR A;  1F5T A;  5E1X A;  3IHU A;  2XKP A;  4ASN A;  2H09 A;  3D0S A;  3L2C A;  1R5G A;  4ESB A;  4M73 A;  1LDD A;  2FSW A;  4IRG A;  4UXN A;  4RB1 A;  3HTU A;  3CUQ C;  2DI3 A;  3K1N A;  2NNN A;  2XAF A;  4LK0 F;  2VE8 A;  1DUX C;  2LDU A;  1I5Z A;  3E97 A;  5DD4 A;  3SZT A;  5LGT A;  1B6A A;  2XRN A;  5FGM A;  5DEQ A;  1UST A;  5L3D A;  1XMK A;  2ELH A;  1GVJ A;  1S7O A;  3QPT A;  2RQP A;  4U0V A;  4BYY A;  1FLI A;  2V6C A;  2JPC A;  3QP6 A;  3PFI A;  3F72 A;  2VT2 A;  3WE3 A;  3I54 A;  3VEP A;  5JR3 A;  1ZHF A;  1R5H A;  3F8M A;  3QRF F;  2MD5 A;  4OOI A;  1HQC A;  3R0J A;  2QWW A;  4OMY A;  1KQ9 A;  4A5N A;  2J5O A;  1IN5 A;  3ZN1 A;  1EV7 A;  2EB7 A;  2RVC A;  2KIM A;  1T98 A;  5L3C A;  5D6E A;  2EV5 A;  2M5W A;  4S05 A;  4EV0 A;  1G3T A;  1D3Y A;  3H92 A;  2GAU A;  3AAF A;  4ENM A;  1YG2 A;  2VXZ A;  1WKM A;  4KN7 X;  4I0B A;  2K4J A;  3FM5 A;  3IL2 A;  1W4M A;  4F7Z A;  5HLG A;  1TLH B;  2F5C A;  1YTY A;  1ON2 A;  4Z2Y A;  3CDH A;  3F3X A;  4WK8 F;  4HX8 A;  4P96 A;  2EA2 A;  1YLF A;  2FXA A;  2OQR A;  3TGN A;  2DFI A;  3WTW C;  3HTS B;  4QWQ A;  2P8T A;  1D8J A;  1U3E M;  2DTR A;  2HFH A;  2VOP A;  2OBP A;  3U9G A;  3BDD A;  3ROU A;  1IXS B;  2D2W A;  3S2W A;  3WTU C;  3F23 A;  3DPT A;  3I64 A;  2Q2E A;  4GCV A;  5E1W A;  3T8T A;  5J6X A;  3E6B A;  2ZCW A;  1BC8 C;  5LGU A;  4UHT A;  4KIG A;  2CG4 A;  3BRO A;  1T2K A;  1I1G A;  5D4S A;  2H6B A;  4RAZ A;  2R7F A;  2ZME A;  2FQ3 A;  2AS5 F;  1Z6T A;  3CUQ A;  1ZRF A;  2HKO A;  2DT5 A;  4HAM A;  5JFR A;  5BPD A;  2FF4 A;  1ZAO A;  2PLY A;  5FFX A;  2RKH A;  3GVA A;  5L3G A;  3HSF A;  1R1V A;  3F6O A;  5JVT A;  1S8N A;  2FE3 A;  5D5X B;  4G7Z F;  4LGW A;  3ZPL A;  3N4M A;  3VFZ A;  3FZV A;  1ZG5 A;  3DXJ F;  5ICE A;  2OU2 A;  1OPC A;  1YIO A;  4I98 B;  3RDI A;  1XN7 A;  1Q1H A;  1YQA A;  2FA5 A;  2K4B A;  3MEX A;  4ZYH A;  4QLC U;  1SMY F;  3I0T A;  4UVC A;  5ILS A;  3L09 A;  3VB2 A;  2FMY A;  3G3Z A;  2QQB A;  2HZT A;  5D4R A;  3E3V A;  4A12 A;  4Q47 A;  5L3B A;  2L3D A;  1RZ4 A;  1U6G A;  1B9N A;  2XV4 S;  5ICF A;  4HV5 A;  4LFU A;  3K2Z A;  3SQN A;  3CUO A;  3SFZ A;  2ADU A;  3LA2 A;  4EVI A;  2PMU A;  3R61 A;  4ZYE A;  4I7H A;  1FSH A;  1J59 A;  3WTZ A;  2E1N A;  3ZMZ A;  1LJ9 A;  1R00 A;  4EM2 A;  3MQ0 A;  5CJ9 A;  3K0L A;  1G3W A;  2BV6 A;  4XLP F;  2QQA A;  1R58 A;  4LJZ F;  3GZ6 A;  4CIC A;  2COM A;  3REO A;  2A68 F;  5LHH A;  1BM9 A;  1FT9 A;  5A2Q Z;  2O6G E;  1Y0U A;  4ZH4 F;  3JTG A;  4L5J A;  3KP3 A;  3EUH A;  3I71 A;  4AVP A;  4MEY F;  4O5V A;  2Z3Y A;  4A2U A;  5F64 A;  2QM3 A;  2UXX A;  2EFQ A;  4HOB A;  4IXA A;  4MGR A;  1ZAR A;  1Z1D A;  4EGZ A;  3EDP A;  1HST A;  3KP6 A;  4ZYD A;  1G6N A;  4M9S A;  1G3Y A;  4IRH A;  4OIN F;  2DPD A;  4HF1 A;  4ETS A;  3GFM A;  5LEK A;  3ZMU A;  3V8K A;  2WC2 A;  2MH2 A;  3WE2 A;  3WTX C;  5IT9 K;  1LEB A;  4HZF A;  1T39 A;  2IA1 A;  4OIR F;  2IA0 A;  1SFX A;  1LEA A;  1XSD A;  2VT3 A;  2CQK A;  1HSJ A;  3KLO A;  5ED4 A;  3GUD A;  3E6C C;  5HS9 A;  4MQV A;  1BI1 A;  5ICC A;  4AIH A;  5HDK A;  5LEJ A;  2MH9 A;  4WXC A;  3B02 A;  1CGP A;  3W6J B;  1J0R A;  2OA4 A;  2XKO A;  4BHC A;  4HLY A;  3BPV A;  4GO1 A;  3E6D A;  1I27 A;  5DUI A;  1FYM A;  5IT3 A;  3L9F A;  4ZZD A;  1U5T C;  5AIQ A;  5CVR A;  1AOY A;  2GA1 A;  1J9I A;  1D5V A;  1FWZ A;  3ZMD A;  4ZZL A;  2DU9 A;  2XRO A;  2VOO A;  1QZZ A;  1P2F A;  3E5Q A;  4EJT A;  1S3J A;  2W25 A;  1UB9 A;  1XDS A;  2EV6 A;  4FX4 A;  4AWX B;  2IVM A;  3T1B A;  2XAS A;  4I2O A;  4WX9 A;  2LKP A;  2IA2 A;  2FU4 A;  4UVB A;  5D8L B;  2Q0O A;  4IPA A;  1USS A;  1IXR C;  3NQO A;  4U7D A;  3ECH A;  2FRH A;  1K6O A;  3E5X A;  4H0E A;  3R4K A;  5E18 F;  4EM1 A;  2K86 A;  2D45 A;  4EJO A;  2JPB A;  4IHT A;  3KZY A;  2RC4 A;  3F8C A;  5D5V B;  3RPQ A;  4BHP A;  4XSX F;  1WSU A;  1HKT A;  4G8X A;  5AIP A;  3D5L A;  1JXS A;  5EEG A;  3KCC A;  3BOQ A;  2PFB A;  2D1H A;  2IW5 A;  3U2R A;  3FMS A;  4GXO A;  3RYP A;  5ILU A;  1ZRE A;  3HYI A;  1O7F A;  2P7V B;  1S6L A;  2PN6 A;  2RV8 A;  3R0A A;  3EET A;  2R7D A;  4IHS A;  5F6F A;  3KZZ A;  2HYG D;  3M8F A;  1ZLK A;  1FC3 A;  1T38 A;  1KYZ A;  4M74 A;  2ZNY A;  1LQ1 A;  5L3E A;  4U0Y A;  4L0Z B;  3RKX A;  1XDU A;  3TDU C;  2L4A A;  2K02 A;  3CTA A;  2UWM A;  2KIF A;  4NHJ A;  4G9Y A;  3IRQ A;  2ZXJ A;  4UUV A;  2VON A;  3GFJ A;  1B1B A;  1U5T A;  4EJV A;  5AON A;  4CO8 A;  4A0Y A;  2A07 F;  5IT9 Z;  1MGT A;  1T6S A;  5CVU A;  2IPQ X;  2W24 A;  1HW2 A;  1BIA A;  4Y13 A;  4RB3 C;  1YW7 A;  2EV0 A;  3LA7 A;  4MNU A;  5HDG A;  4CHU A;  1IN4 A;  3BZ6 A;  3JW4 A;  5CVJ A;  4RAY A;  1KYW A;  1L0O C;  2KKO A;  3HIF A;  4HX7 A;  2ZME B;  1FBQ A;  5E1Z B;  5HLI A;  3CUQ B;  1Z7U A;  2MLK A;  3NRV A;  3F8N A;  2XVC A;  2C6Y A;  3ERE D;  3IRR A;  1BC7 C;  4BAY A;  1EH6 A;  2A3S A;  4P9U A;  1CF7 B;  2XAH A;  2DK5 A;  5KK1 A;  3CJN A;  2XIG A;  3J7A O;  3ZMS A;  2O0Y A;  3QP5 A;  5A2Q K;  1XGO A;  1U78 A;  1TTY A;  1HW1 A;  2CW0 F;  2YPR A;  4A0Z A;  4UNO A;  1BIB A;  3NEU A;  3P7N A;  1H0M A;  3KLN A;  2FEZ A;  4M6Y A;  2EFP A;  3F21 A;  3LAJ A;  2CSO A;  1IUY A;  3RPU A;  3Q5F A;  4HQM A;  3GF2 A;  3FM3 A;  1HBX G;  4E70 A;  1MKM A;  4M6X A;  1REP C;  3TO9 A;  3V7R A;  4HLX A;  4M71 A;  1O3Q A;  1TNS A;  3ULQ B;  3BWG A;  3ABT A;  1P4A A;  3RYR A;  4G6D A;  2X4H A;  2FOK A;  3O2P E;  4L9J A;  3DQV C;  2M45 A;  1IN7 A;  4Q48 A;  2HEO A;  2HTJ A;  4I0A A;  1EH7 A;  2NS0 A;  1BOA A;  2HQN A;  1MZB A;  1V4R A;  2GA2 A;  3TO6 A;  1QNT A;  2LNB A;  1CF7 A;  3HOT A;  3ZQ7 A;  4ZYG A;  4EM0 B;  2OQG A;  1KGS A;  1RUO A;  1OYI A;  3C7J A;  2EFN A;  1ZGJ A;  3MZH A;  3FX3 A;  1IRG A;  1BI0 A;  1FOK A;  2FML A;  1IW7 F;  1SD7 A;  4GYG A;  1FBU A;  3V7C A;  5FFZ A;  3J80 K;  2ESN A;  3C3W A;  2ZBK A;  4U7B A;  2HGC A;  1STZ A;  3FHZ A;  2XUB A;  2KIU A;  3SXY A;  3BJ6 A;  4N0B A;  5J8C A;  1FNN A;  1LDJ A;  2FBK A;  2RN7 A;  1F1Z A;  1MJA A;  2CWE A;  4PGG A;  1SD5 A;  4G6Q A;  1G4D A;  5J8F A;  3V7S A;  1ODD A;  4P5O A;  2JSC A;  3KP2 A;  1ULY A;  1LVA A;  4BNC A;  1LB2 A;  4HDU A;  1XB4 A;  3J81 K;  4L9V A;  1ZG1 A;  1J75 A;  1P6R A;  3HSE A;  4BH9 A;  2DPU A;  3ZP5 A;  2NRA C;  2V1D A;  2M87 A;  4LB6 B;  1WI9 A;  4KDP A;  4IJA A;  3K1M A;  2Y75 A;  1NHA A;  2P7C B;  1O7L A;  3K9T A;  3OV8 A;  4MHG A;  2XGX A;  1XMA A;  4OIP F;  2Z33 A;  1WWX A;  3F8F A;  4HDV A;  3VOD A;  2AXL A;  3I5U A;  1ZYR F;  1XD7 A;  1S7A A;  2EK5 A;  2XAJ A;  2PQ8 A;  5KVR A;  3DP7 A;  2QBY A;  2IP2 A;  4BXU A;  2BYV E;  2Q8K A;  2QVO A;  1TQM A;  1MJB A;  2DW4 A;  3L00 A;  3P9K A;  4G94 A;  1UFM A;  4L9T A;  5DDG A;  5HS8 A;  3LFK A;  1L3L A;  1GXQ A;  3QU3 A;  3WOD F;  4KMF A;  4L0Y B;  3HSR A;  2M1B A;  3IWZ A;  2HTS A;  4JQF A;  3WGG A;  1UCR A;  5BS6 A;  4A5M A;  1SFE A;  2J5P A;  1YS7 A;  2LF8 A;  1FYL A;  1SMT A;  2DK8 A;  1YW8 A;  5HVQ C;  3V4G A;  4NB5 A;  1XCV A;  1Z91 A;  1V3F A;  3TDZ C;  4JK1 X;  4BHB A;  4KMU X;  2VBZ A;  4IF4 A;  1EH8 A;  3HRM A;  4ENN A;  1MDM A;  2L02 A;  1K7A A;  3HRT A;  4B09 A;  2MA3 A;  4ON0 A;  2L01 A;  2EA4 A;  1P4X A;  5H6Q A;  2VOD A;  1SAX A;  2KRF A;  4N9I A;  3L7W A;  4EJU A;  2M8E A;  1T0F A;  2YU3 A;  2XAQ A;  1SD6 A;  3M9A A;  2V1X A;  3RIR A;  4UV8 A;  1JHH A;  4WXD A;  5D8K B;  4XRF A;  2E1C A;  5LGN A;  2A5Y B;  1BN5 A;  4FHT A;  1HW5 A;  4LG0 A;  4KFC A;  1D8K A;  3DEU A;  4KYW A;  3IKT A;  3FMR A;  2CO5 A;  3OOP A;  4FT8 A;  3JAM K;  4HW0 A;  2ZJ2 A;  4KIC A;  4MTD A;  4WF2 A;  5JHU A;  3Q9V A;  4KIF A;  1HXD A;  3TO7 A;  4RB2 C;  1FYK A;  2A69 F;  3EYY A;  1PUE E;  3R6S A;  3QAH A;  2ZO4 A;  1U2W A;  1W7P D;  1W5S A;  2O3F A;  1K78 B;  1RNL A;  4I02 A;  3J80 Z;  1RIO H;  3FXR A;  5BPI A;  3ZN0 A;  5FD6 A;  2ZKZ A;  4EMS A;  5DD8 A;  3H3U A;  2MBF A;  1ZH5 A;  1E17 A;  3FXQ A;  2ACJ A;  4PZJ A;  1QGP A;  1TNT A;  4O3M A;  1R36 A;  5DCF A;  2GXG A;  2STT A;  2DO7 A;  2CFX A;  3ECO A;  4LLN A;  3BJA A;  2RNJ A;  3MCZ A;  2P6S A;  4WCG A;  3T8R A;  3HHH A;  1K79 A;  3DF8 A;  2H27 A;  2IT0 A;  3J81 Z;  5DV5 A;  2W57 A;  4HYE A;  4MTE A;  1G3S A;  2HOE A;  4L9N A;  1PP8 F;  1FX7 A;  1U5T B;  2PEX A;  4RB0 A;  1W5T A;  1P4W A;  1LDK B;  5DCM B;  3DKW A;  2F2E A;  4OIO F;  1BBY A;  4AIK A;  2VC0 A;  2VBX A;  1IAW A;  5ICG A;  2EJR A;  2A6H F;  3BPX A;  5LHG A;  1JE8 A;  2G7U A;  4KA4 A;  1FPQ A;  3SHF A;  2YSR A;  2FNP A;  5FLX Z;  1ZN2 A;  2P5L C;  2XHK A;  2A6E F;  3BP8 A;  5E8G A;  4KT5 C;  4RS8 A;  2HS5 A;  4B8X A;  2DAO A;  2EFW A;  4ENJ A;  1DDN A;  2ESH A;  1QBJ A;  5TJJ A;  1K78 A;  1DPU A;  3BJO A;  2PG4 A;  1SD4 A;  3KEQ A;  1BI2 A;  2Z99 A;  3ELK A;  3IWF A;  1VTN C;  1U8R A;  3H3Z A;  1FP2 A;  2MLG A;  2YR2 A;  3FF5 A;  1FZP B;  3HHG A;  5L3F A;  2BE5 F;  4KN4 X;  1R1T A;  3QOP A;  4DNC A;  5CVV A;  4ESF A;  3KFW X;  3ZMV A;  2UZK A;  4EJW A;  4WWC A;  1Z9C A;  4Y17 A;  4D0P A;  3RI4 A;  1O3R A;  1DPR A;  1YS6 A;  2RDP A;  4UV9 A;  4MEX F;  3WTV C;  4AIJ A;  3IKV A;  2QYO A;  3EYI A;  2NYX A;  2A61 A;  3U1D A;  5HOO A;  4HV6 A;  5DCM A;  4G7H F;  2PBI A;  2Y0M A;  4PGH A;  4R79 A;  3I59 A;  2L54 A;  3GLX A;  2V1U A;  5LLQ A;  1A04 A;  4HA8 A;  2W84 A;  3P9C A;  1AWC A;  2CYY A;  4FX0 A;  5LRS A;  3JSP A;  3PQJ A;  3T0Y A;  4CXF A;  2GWR A;  2BGC A;  5K5R A;  2WTE A;  1JHF A;  3MZY A;  1TBX A;  3JAM Z;  5H20 A;  3M1E A;  3BY6 A;  2UXN A;  5TRD A;  4A6D A;  2DBB A;  2VC1 A;  4XLN F;  1TQI A;  4YG2 F;  3TOB A;  3GZ5 A;  2O8X A;  2HWV A;  5DYM A;  3KP5 A;  1B59 A;  3W6K B;  2MC3 A;  3R60 A;  5BMZ A;  1PP7 U;  2VN2 A;  2H94 A;  1OMI A;  1XGN A;  4L18 B;  4DQ2 A;  5ERI A;  3E5U A;  2EWN A;  3K69 A;  2LF7 A;  3I53 A;  5FD5 A;  2JZY A;  1KQ0 A;  1J7K A;  1QPM A;  2R3S A;  1O57 A;  2HDC A;  3ABU A;  2F5D A;  1MD0 A;  3B73 A;  5E20 A;  1IZ1 A;  2KJC A;  4Q4Z F;  4LB5 A;  3F8B A;  4GGG A;  3F22 A;  2FNA A;  3HRU A;  4M9X A;  3GW2 A;  3KP7 A;  2B0L A;  1IN6 A;  3EQL F;  3RKY A;  2PJP A;  1ZG3 A;  4I01 A;  3KEO A;  4Y15 A;  4N9H A;  5HDN A;  3DFG A;  4NQW A;  1E2X A;  4CDG A;  3PQK A;  1MJ9 A;  3GX4 X;  4GYI A;  4MQ9 F;  2DLL A;  2O03 A;  3V8L A;  1O3S A;  3ML6 A;  2DQR A;  3F6V A;  1I1S A;  1QO0 D;  1P92 A;  1DP7 P;  4O6J A;  1HKS A;  3MWM A;  2JTV A;  3RJP A;  1TW2 A;  2JRT A;  2GXB A;  2P5V A;  1X3U A;  4LD5 A;  4P55 A;  4A6E A;  3CO7 C;  3LWF A;  4YIF A;  2OAZ A;  4BQA A;  3M8E A;  2M30 A;  2F5E A;  1PDN C;  5H6R A;  1YO5 C;  5K5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...