1JGGA

Even-skipped homeodomain complexed to at-rich dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
57
structure length
57
Chain Sequence
b'RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*AP*AP*TP*TP*GP*AP*AP*TP*T)-3'
publication title Structure of the even-skipped homeodomain complexed to AT-rich DNA: new perspectives on homeodomain specificity.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 19
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jggA00
4X1EA 2Y30A 1RESA 1ENHA 4C3HJ 1BA5A 2CQQA 2G0EA 2ELKA 3FISA 2E2JJ 5M3FJ 2R5YB 3TW7A 1D5YA 3JRFA 1DU0A 1MNMC 4A3MJ 2K40A 3GTMJ 2XRLA 4IEJA 1HLVA 2DA1A 1JGGA 1Q1VA 1IV6A 3CCYA 5E3LA 3W6VA 4A3IJ 1FEXA 2EQRA 3QPLA 2XGDA 1Z0XA 4UUSB 5GPCA 1K61A 3LSRA 1A5JA 3HKZN 1ETXA 3B6CA 2X6OA 1MBGA 1MBKA 4IHXA 1RKWA 1X58A 4A3DJ 2EH3A 2ME6A 1WI3A 2XPUA 2HYJA 3GTOJ 2KT0A 3S1QJ 1S7EA 3JR9A 4M6VA 4MFEA 4DYQA 1Y1WJ 5IPAA 1QVTA 5M5WJ 2DMTA 5FKLA 2JA5J 2HDDA 2JJ7A 2Y9YA 2HXIA 1LFUP 4M3EA 3ZOBA 2HXOA 1YRNA 1BW6A 2M8GX 2GM4A 4FE4A 3A03A 3BR0A 2Y31A 4XRSG 2COBA 3S1RJ 1A6IA 1IC8A 1FTTA 2P81A 1OJLA 1RR7A 1MH4A 1EF4A 2NVQJ 2M9HA 3SJMA 3FK6A 3DCFA 4QTRA 1ZR2A 3Q0VA 5EF6A 1TC3C 2IAIA 3HOUJ 2AHQA 4A69C 5C44J 2R0QC 1JJ6C 2TRTA 1W0UA 3HB9A 4D7NA 3M4OJ 1K83J 3S1MJ 2AO9A 2XGEA 3RQIA 3G1MA 1SANA 2LTPA 4V2FA 1WCMJ 4W97A 5EZGA 3JRGA 1WPKA 3ZQGA 3H3VK 4Y7NJ 3DEWA 4BBRJ 3JRBA 2XPWA 3E7LA 2XPVA 4MLOA 1JKQC 1GVDA 1W0TA 3MKLA 3K7AJ 3K2AA 1APLC 3GTQJ 2FD5A 2CRGA 2JN6A 1JTXA 2ID3A 5EG0B 3BTLA 1T33A 1WH7A 2D5VA 1MBJA 1GT0C 2H8RA 1ZK8A 1Z77A 5M3MJ 4S0HB 2ME0A 4DYRA 2E2IJ 2YS9A 3H0GJ 5J1UA 5M5YJ 5C4XJ 3FIWA 3TP0A 1JJ8C 2R5ZB 1T56A 1FIAA 1QVUA 2DA5A 2EZLA 2L9RA 4BXXJ 3BQZA 2N8GA 5GPAA 1B72A 1MBEA 3ZQHA 1HF0A 3HM5A 3PM1A 4A3EJ 5M5XJ 2W48A 1TWFJ 1JT6A 3G1OA 4A93J 1GUUA 1JUPA 2DTZA 5FKOA 1B8IB 4CYCB 2NOGA 1MSEC 1VI0A 5EDNA 4D5FA 4A3BJ 1HOMA 2NVXJ 1UHSA 1VFCA 2WV1A 2CUEA 4MO7A 3ZQFA 5IP9J 3C2BA 3HGGA 2JA6J 1NK2P 2CU7A 1ZR4A 1IUFA 2M2EA 3S15J 3SFIA 4A3FJ 3O8HA 5IYCJ 1XG1A 2LR8A 1JKRC 2DA3A 3GTLJ 3Q0UA 4MFDA 1JTYA 1X2NA 1IDYA 3VPRA 5JLWA 5J1YA 5EGOA 1IDZA 2M34A 3BR3A 5BNGA 4DW6A 1IG7A 4EEFG 1ITYA 1BJZA 2PMZN 3WHCA 3FKIJ 2JK3A 3GTPJ 1GV2A 5F04A 2LY9A 1JKOC 3O8GA 1AU7A 1JT0A 1Y1VJ 1O4XA 5FKNA 1HCRA 2WB1N 3BR6A 2DA4A 4BY1J 3LSJA 3JRHA 1SFOJ 3D1NI 5C4JJ 3QPSA 3TEDA 1GV5A 2HOSA 1OCPA 3OSGA 3G1LA 5DS9A 3S17J 3BR2A 3A02A 4B1RA 5K7HA 4BY7J 1OFCX 2ID6A 2ECCA 5F0CA 3BG3A 1WGXA 3RZOJ 2H1KA 3IH3A 1JUMA 4M3BA 4QSHA 2WAQN 1XC5A 2Y0SN 2OF7A 2K9NA 2CJJA 3PO3J 1TWAJ 9ANTA 1MSFC 3HEFA 5E3NA 1NTCA 1ZKGA 3A01A 2EZKA 1AHDP 1H8AC 3S1NJ 2Y2ZA 4D5CA 4JX4A 4Y52J 5FJ8J 5E3OA 1UG2A 3JRAA 1OCTC 5HODA 1QRYA 4M3DA 3B6AA 5IOYA 4QIWN 3HOVJ 4X6AJ 1TWGJ 3ZQIA 2LP0A 3OOUA 1U8BA 3BR5A 1XS9A 1PUFA 1UMQA 1YRNB 4BBSJ 1RKTA 4JX5A 5F08A 4XICA 3BTCA 2L7ZA 4RBOA 4FE7A 2DA2A 2R7ZJ 3TW6A 2ECBA 4NDLA 3LOCA 2NVYJ 2OPTA 2MW8A 5EYRA 4XRSA 1TWCJ 3HDDA 1AKHA 1H89C 4IHVA 4MIMA 5EZHA 3NAUA 4B3AA 5C3EJ 4L5EA 1IJWC 1RPWA 2QF7A 4FCYA 4BKXA 1LE8A 4IHWA 2HI3A 2LVSA 5IOZA 4CYCA 1U78A 2JA7J 2VUMJ 2Y9ZA 2XB0X 3GTKJ 3WHBA 2E1OA 3Q0WA 1G2HA 3M3YJ 3UKGA 1ZGWA 5K7ZA 3JRDA 1R9TJ 2XB5A 3ZQCA 3FK7A 1ETOA 1BW5A 2R5YA 4C3IJ 1HDPA 2K9QA 5F1JA 2DA6A 4I76A 3PO2J 3LSPA 3GTJJ 2EZIA 3I4MJ 1IGNA 5F0FA 2CUFA 2X48A 1I6HJ 1B72B 2O8KA 1H88C 2M0CA 5F27A 4UUSA 2JA8J 3HOWJ 5IYBJ 2O7OA 1X2MA 1I3QJ 3BTIA 4I6ZA 3HOZJ 2FQ4A 1LFBA 2DMNA 2L0KA 3HBLA 2K9SA 2RAEA 1QPIA 3I4NJ 4A3CJ 2NS7A 2ZB9A 2NS8A 1P7JA 1TWHJ 5FLMJ 3CMYA 2LLKA 2FX0A 2LFBA 5EEAA 2B63J 1DU6A 1ORKA 1FTZA 1FJLA 3OSFA 4A3KJ 3TP3A 1RETA 1MBFA 1VNDA 1ETYA 3BQYA 3JRCA 3IH4A 2EBIA 3IH2A 2I10A 2QCOA 3BG5A 2HOTA 5EGOB 4JYKA 1NK3P 2GLOA 3JRIA 4RDUA 2YUSA 4DYCA 1ETWA 2MGQA 2DMQA 2L7MP 1E3OC 1GDTA 5FKMA 4FTHA 5FLVA 1U9OA 2LD5A 4HNVA 3S2HJ 2VKVA 2DMPA 3GBGA 2LKXA 4FISA 4W1UA 5DTDA 1HDDC 4D7MA 2L7FP 3JREA 4DZJA 5F0HA 4GFBA 4M3FA 3HGYA 2IEKA 1WH5A 5EG0A 2R92J 1ETKA 2HOAA 3RZDJ 3ZQLA 5GP9A 4M3GA 3S2DJ 3S14J 2LK2A 2TCTA 2CQXA 4JP0A 1ZQ3P 3RKQA 4V2GA 4C3JJ 3L1PA 4IHYA 4DZPA 2R5ZA 4UUTA 3S16J 1CQTA 5E3MA 2NVTJ 1JUSA 3A01B 3MN2A 4AYBN 2X9DA 2MSYA 4AC0A 2MG4A 2DA7A 2DJNA 1JKPC 4JX6A 1MBHA 3CDLA 1F36A 2EZHA 2FJ1A 2R93J 3LSGA 2DMUA 2KDZA 4A3LJ 3BR1A 1POGA 2E2HJ 3GTGJ 1U9NA 1PUFB 2E19A 2VI6A 1P7IA 4AUXA 1BL0A 1B8IA 2XGCA 5K7FA 3OIOA 3CQZJ 4A3GJ 1FIPA 3BG9A 1ETQA 4XK4A 3LNQA 3IV5A 5J1RA 1F43A 5JLXA 4XRMA 5IP6A 2GBYA 1IRZA 2DN0A 4J19A 4LOCA 5FKKA 1MH3A 3F0CA 2JWTA 5IP7J 2YU9J 5IYDJ 3MVPA 1ETVA 1AKHB 1ZTRA 2VPRA 4XIDA 4A3JJ 2O9LA 1I50J 4G12A 3SDGA 2XSDC 2HQ5A 4B4CA 2JMWA 1LE8B 3BT9A 2VKEA 3BTJA 3Q3SA 2IBDA 4C2MJ 4ABZA 5J3LA 1VF9A 3QQAA 3HOXJ 3NARA 3HOYJ
chains in the Genus database with same CATH superfamily
4EJOA 1TQPA 3CP8A 5L3DA 4KMFA 2MD0A 2L54A 2CQQA 3OYFA 4G6DA 2E2JJ 3L2CA 4RS8A 5M3FJ 2NS0A 4F92B 4KUMA 3GF2A 2XRLA 4PJJA 3LSTA 2M7AA 3RIRA 2GA1A 1Q1VA 3I59B 1IV6A 4Q47A 3QYBA 3GEZA 2ZBKA 5L3GA 5HNFA 4N9IA 1Z0XA 5GPCA 1BOAA 1YJNI 4BHCA 1A5JA 1ETXA 2Q1ZB 2X6OA 3B6CA 1I27A 1MBGA 2VASA 4GGGA 2HQRA 2MH2A 4BE2A 1VQ5I 4RB2C 2KPMA 2EH3A 4EM1A 5ICGA 1O3QA 3GTOJ 2Z16A 5D4RA 4MFEA 2V6CA 2FMYA 3SHFA 3GZ5A 5BS6A 4XKCA 2CV1A 2JA5J 3E6DA 2HDDA 2MFZA 2HXIA 1LFUP 1QZEA 3PNTA 3F23A 1YRNA 2ZFWA 3NWTA 1SVOA 4RGSA 4XRSG 1FC3A 2E5ZA 1A6IA 3S1RJ 2QUFA 1MH4A 1YJWI 1ZELA 5L3BA 4GDFA 2XC7A 5CVRA 4HSTA 1TP4A 4M9ZA 3SXYA 3GYHX 1E3PA 5H6QA 2QSFX 2GOXB 1OR7C 2TRTA 3DTIA 1BJAA 1AOYA 4RLQA 4D7NA 3M4OJ 4LJZF 1VQNI 2AO9A 2XGEA 3RQIA 2CW7A 2X1CA 1SANA 1FZPB 2E7XA 4PJMA 4ETSA 3RKXA 2STTA 3O3KA 3M9AA 2F4OB 2XPWA 3E7LA 2XPVA 3CCSI 1FMVA 1RC9A 1GVDA 3FM3A 3HPHA 1WKMA 4UV8A 1APLC 3J80Z 3W2WA 3E5XA 4WXCA 1HQCA 5D5XB 5CVUA 3BTLA 3VYRB 3H9JA 3ZMTA 4C2TA 3CJQB 1K6OA 2EPFA 4XKWA 1LEAA 2H8RA 3U1DA 3DPUA 5M3MJ 3V7RA 5DUKA 4S0HB 2YS9A 3MKWB 2LMDA 1FY7A 3CUQC 3KEOA 5J1UA 1P4XA 3X2QH 3DPTA 4ZYGA 2EZLA 1R5GA 4PGGA 3BQZA 2A6HF 1BIBA 2P5LC 3LA7A 4LLGF 1FSHA 4M71A 5CVJA 1KZHA 1MBEA 3ZQHA 1ZG3A 2KZGA 3MD2A 1HF0A 4LIUA 2E35A 4OAYA 4I7HA 1BI3A 2X1DA 2IA0A 1V5GA 2DOAA 4HX4A 4OIPF 5M5XJ 3M1EA 1TWFJ 3G1OA 4MQVA 1GUUA 3OV8A 3R0AA 4A93J 3WTTC 2ZJRF 1YE9A 1IRXA 4A12A 1NH3A 2QLZA 2NOGA 4H4KC 4ZYAA 2DTRA 5KCMA 1H9GA 3CCJI 4II3A 2DOFA 3ZQFA 4A0XA 2JA6J 4IRGA 4KDPA 3GWZA 4AIDA 1LDJA 4ZDPA 3JAMZ 2A07F 3I71A 3CJNA 2QZ8A 3CMMA 5GTHC 3QPTA 2Q2EB 4AD9A 3O8HA 2DFEA 2P4WA 3LAPA 3PFYA 2EFOA 3GTLJ 4MFDA 4ZYEA 2ISYA 1YYVA 3RTRA 4EEFG 4B3XA 1NG6A 1ITYA 1Z6TA 3PL8A 2K5CA 3FZVA 3FKIJ 2LY9A 3K1NA 1AU7A 1FOXA 1K78B 1X4OA 2EFPA 2VKHA 3CDHA 3I58A 1Y1VJ 2G7HA 2FF4A 5B1AH 3OL3A 1HCRA 2WB1N 3ML6A 3BR6A 2FMLA 1Z05A 2V1XA 3KP4A 2DPDA 4U0WA 2R7TA 2GA2A 2CFXA 5C4JJ 4JQFA 4P1WA 3SFZA 3AFHA 2ETHA 3K9TA 2R7FA 4NQWA 5L3CA 3H9GA 1VQLI 4ESFA 2Z9OA 3G1LA 3A02A 2H09A 2KFDA 3PFIA 5K7HA 2O61A 3PQJA 1O7LA 5F0CA 4B48A 2MYSA 2CMPA 2H1KA 4QSHA 1YQAA 3DEEA 1XC5A 2WAQN 3CZ6A 3J81Z 2FU4A 1LB2A 3FMSA 1D1BA 4KNYA 2CJJA 4HQMA 2K4BA 2BZTA 3H5NA 4KFCA 4G6TB 4HV5A 5TISC 1YIOA 1T95A 3P9KA 2K4JA 1W5SA 4RAGA 1UG2A 2STWA 3ZQQA 1OCTC 2BEOA 1VZ0A 4M3DA 3WTSC 2P0WA 1X3UA 3OOPA 3HRTA 2XRNA 5HS8A 1U8BA 2CW8A 3G2BA 3KP7A 4KMUX 2E60A 2E71A 3FMRA 1EKEA 2VBWA 1HW1A 3CUQB 4CXFA 4LLNA 4D1QA 2JTVA 2DA2A 4XKVA 2HOEA 3TW6A 5DEQA 2DDBA 2IRFG 1VQOI 1XDUA 2YU3A 3LOCA 5FLXZ 5IT9K 2IGKA 4M9SA 5BPDA 2PJRB 1BM9A 2OPTA 3TOAA 2MW8A 4XRSA 5LLQA 5F6FA 1V4RA 2WY7Q 1VQ7I 1K4TA 4IHVA 4ASNA 3O2PE 2J5PA 1U5TA 1IJWC 4GCVA 3A4CA 4BJ6C 2QF7A 4FCYA 1J9IA 2BY1A 1MMAA 4IHWA 1ZLJA 4Q5SF 1FMWA 2HI3A 1EV7A 1YS6A 5IOZA 4CYCA 2LOOA 3ZN1A 4HSRA 5HVQC 1Y8RB 2XAUA 3GTKJ 5JHFA 3QU6A 3S8PA 2NXNB 4P9UA 4KICA 3UKGA 1ZGWA 3JRDA 5FD5A 3S3OA 2E7WA 5GADJ 3C1DA 2ZO4A 4GYIA 2DT7B 2R5YA 2QENA 5F1JA 1QA6A 1UB9A 2DA6A 2VODA 4I76A 3NWSA 3B73A 2FNAA 3H3UA 3LSPA 4XR6A 2QQ8A 2EZIA 3HOTA 1IGNA 5F0FA 1FPQA 4U0YA 3HSFA 4HF2A 4XONA 1H88C 2M0CA 5F27A 4CZCA 4U87A 2DK8A 2HPMA 3OY9A 3H3ZA 2W7NA 5DD8A 2A69F 1O3RA 1LFBA 1W5TA 1O3TA 1SD4A 2P5VA 2KL4A 1B6AA 3FDYA 3GXOA 2IVMA 1L0OC 2NS7A 1D3YA 1Z21A 3RPUD 5DCMB 2DJIA 1ZGAA 3KZZA 4EJWA 5GAHJ 4YRVA 3HUGB 3Q9SA 4DBRA 1FJLA 1S29A 4ZH4F 3JTHA 3E6BA 1W1WE 1VNDA 3DKYA 1ONVA 1SAXA 4HX7A 4CCMA 2EBIA 4XNFA 2M45A 2QCOA 1SFXA 4XN0A 3KE2A 1HKQA 2L2OA 3BJAA 1MJAA 1W7PD 1HBXG 3DEUA 3R61A 3JRIA 2LKSA 4OINF 4PK4A 2LYCA 4PZJA 4IL6C 4F93B 3MKZA 1ETWA 2PJPA 1E3OC 1GDTA 4CCNA 3W3CA 1U9OA 4RB0A 3ZQ7A 4HNVA 1XD7A 2DMPA 1G3TA 3GBGA 1PUEE 1UJ8A 3MKYB 4BU2A 1CF7A 5B5EC 1OYWA 2L9NA 4O3MA 2L4AA 1ULYA 2VJ5A 2QVOA 2VKDA 2XDVA 3OR2C 1SD5A 2CO5A 3RSNA 4GFBA 2KRFA 1I5ZA 4DZJA 1VQKI 1H9TA 3ZCOA 2E1MC 3GFMA 5D8KB 2XROA 1WH5A 2QKLB 4AIKA 1W4MA 3K4JA 4FQGA 2VQCA 1K79A 2VBZA 1OCCH 3S2DJ 3FXOA 1XPXA 1G4DA 4AWXB 4YFKF 3CCQI 3Q9VA 2TCTA 4FASD 3RKQA 2HQAA 1FYMA 3L1PA 4C3JJ 3PJRA 2VQGA 4DZPA 4IHSA 1IXRC 3BJ6A 2HU9A 4G6QA 1YIJI 2P5KA 5AONA 2NVTJ 3H35A 1LEBA 5HS7A 3A01B 1TW2A 4PCQA 4RB1A 2BY3A 2W25A 2MSYA 3EUAA 3FXRA 3NEUA 2JT1A 2P6SA 4KIBA 2K3PA 3W6KB 3OYIA 2DA7A 3EUKL 4LG0B 4Y17A 1E0EA 2JVGA 3BC8A 2ELHA 4JX6A 3CCRI 3TDZC 3CDLA 4RM3A 2EZHA 1HSTA 4M73A 2F4IA 3HJEA 3LSGA 2YPRA 2R7VA 2HKOA 3BR1A 5FGMA 4Z6YA 1U9NA 1PUFB 1OYYA 3C3WA 2R7RA 1BL0A 5CVVA 1B8IA 2XGCA 4B47A 2M1BA 2VIXA 3HL2A 3E97A 1HSJA 3EDPA 4U0VA 2F6CA 2IGOA 1IN7A 4G7HF 3VWBA 2UWMA 3J7ZI 3IV5A 2WADA 1N75A 2XAHA 2DODA 4ITVA 2XGXA 2JQ7A 1D0ZA 3CTAA 2DYSH 3F0CA 2JWTA 3PIOF 2VPRA 3KZYA 3KIOA 4KN7X 4ZC3A 2O9LA 3TGNA 4OU0A 2XSDC 4PJNA 3HG9A 1LE8B 4NC6A 3LMMA 1RRJA 3BTJA 3LQQA 3MZHA 1FNNA 1A04A 1X1PA 3HOXJ 5AIQA 2K7LA 3NARA 3NQOA 4X1EA 2IS6A 1P9QC 1S9HA 4C9YA 3QP5A 1WHUA 3V7CA 5ICFA 2XF6A 4C3HJ 4WWCA 1EA3A 3BDDA 3IRQA 1D5YA 1YO5C 1QHHD 1Z3XA 3JRFA 3G3ZA 3HIFA 4I98B 5D5VB 2KISA 3V8JA 3GTMJ 2VLAA 4IEJA 4K2EA 2DA1A 1HLVA 1FLIA 1KQ0A 4IX7A 5K1YA 5GAEJ 3CCYA 5E3LA 3HTSB 3WGGA 3G4SI 1FEXA 2EQRA 3QPLA 1K61A 1WJCA 2HS5A 3J80K 1BR2A 4PFOA 2PMZA 4NC7A 3DP7A 3VYUB 4IHXA 1R6RA 1FP2A 4ENMA 1X58A 3ASOH 2YR2A 1QNTA 1WI3A 4XLPF 5FFXA 2KT0A 1SMTA 2FRHA 2M7BA 1HXDA 1RI7A 1QVTA 2DT6A 3WE3A 2Y9YA 5LRRA 2A68F 4M3EA 2UZKA 3UR3C 4M74A 2GM4A 1RUOA 1IW7F 3A03A 3BR0A 2ESNA 2FNPA 3TO6A 1YX5A 2GXBA 1LFPA 2DDAA 2Y31A 3JTGA 3RYPA 2BGCA 4ENNA 1IC8A 1FTTA 1OJLA 2KIMA 1EF4A 5ICCA 5HLHA 3MFKA 1YG2A 3DCFA 3ESWB 3OS0A 4ENKA 1LDKB 2A6TA 2X51A 2NAZA 4G94A 4A69C 5C44J 4A6DA 1HW5A 2R0QC 1PP7U 2DLLA 1JJ6C 1MNEA 3LFUA 3S1MJ 2EIKH 4XLEA 3JAMK 3G1MA 5DYMA 3P5JA 2LTPA 4W97A 4N4NB 2XHKA 3TO7A 2LNBA 4Y7NJ 2RQQA 1XGMA 3L00A 1WJEA 4MLOA 3ABTA 3HHHA 4RGRA 3MKLA 3K7AJ 1W0TA 3K2AA 1O3SA 2ZSHB 2TDXA 2FD5A 3R60A 4GXOA 3DTEA 4UNOA 5EJCA 2CRGA 2JN6A 5EG0B 1T6SA 4ZDOA 2D5VA 1MDMB 1GT0C 3K0LA 1N25A 2RGVA 1Z77A 5LD2C 5KNLA 4DYRA 3TMOA 2E2IJ 2OAZA 4O5VA 2JRMA 4GO1A 5M5YJ 3TP0A 4A2UA 1JJ8C 2R5ZB 1T56A 2L9RA 1VTNC 3IL2A 5GPAA 3MZYA 4UY8I 2A3SA 3AG2H 3QAHA 2HDWA 1KQ9A 4CDGA 4YIFA 3HM5A 4HNTA 4EGZA 4MNUA 5ERIA 3UNGC 1ZGJA 3N4MA 2W85A 4A3EJ 1V55H 1EH8A 2W48A 3BCBA 3J81K 1HA8A 1JT6A 2ZNZA 4MHGA 4D0PA 3DXJF 5FKOA 1VI0A 5EDNA 2R3SA 3E6MA 2AS5F 2O3FA 1HOMA 5J4YA 3J7AY 3HGGA 3OYMA 2WAFA 2H6CA 4Y3OA 4XSXF 2VT3A 3GVAA 2V7FA 2O0YA 2K9LA 3TDUC 4BE0A 5IYCJ 1XG1A 1FOWA 3IP4B 5JI6A 4E7LA 3Q0UA 1R4NB 3N97A 1X2NA 3FX3A 5JLWA 1IDZA 1IAWA 2M34A 4DW6A 1IF1A 2DOEA 1GHCA 1BIAA 1RNLA 2PX9A 1GV2A 5F04A 3VYTB 1JKOC 3O8GA 2P7CB 3ZXSA 1IO2A 3OYJA 3DKWA 1ZN2A 2IA1A 1T2KA 2EV5A 4HW0A 2KIFA 4P9FA 1J5YA 1RIOH 4BY1J 5JVTA 3JRHA 3RJPA 1D8JA 2RREA 2HTSA 1XGSA 2QSHX 4ESJA 3QPSA 2JVHA 4NUBA 4PSXA 4XSZF 5FLXK 2IA2A 1GV5A 4G7OF 2EIMH 4IXAA 1BN5A 2ADUA 1IV8A 2GIVA 3AG1H 2W1OA 1LJ9A 3RDIA 2QYOA 2PN6A 3F22A 2Z1DA 2ID6A 3CO7C 4BH9A 1DGWY 2GOMA 2VT2A 3RZOJ 2DAOA 3IH3A 2ZJ2A 1KQ8A 1OCOH 2Y0SN 4EMSA 2V9VA 3HTUA 4KN4X 2OV7A 2NYXA 2OF7A 2K9NA 1XGOA 2VC0A 2VOOA 1LQ1A 1RUNA 2XKPA 3FXQA 4BHPA 3KX2A 1JHFA 1I1GA 5E3NA 1MSFC 5LGNA 1ZH5A 3V4GA 2EZKA 2OQGA 3OYBA 3JCUC 1AHDP 2RV8A 5CPRB 3S1NJ 3WGHA 4OMZA 3V42A 4D5CA 1EJ9A 4Y52J 3H9QA 4N0BA 1MJ9A 5E8GA 5FJ8J 2VN2A 3KYCB 1UG0A 2L5QA 1TWGJ 3LQRA 1T98A 3OOUA 3BR5A 2AXLA 3CF5F 3I55I 2DFHA 1MMGA 3I64A 1F5TA 2IGNA 3D5LA 2A05A 1YRNB 1YTYA 1E17A 5F08A 4XICA 4RBOA 4M9XA 4HZFA 2VJJA 1V5FA 3BPVA 3SEZA 2L3DA 5HS9A 2NRAC 2ECBA 2LREA 2R4GA 4NDLA 3CC2I 4ZTFA 3HRSA 3E5QA 2EILH 4YG2F 3DLLF 1TWCJ 4ZZDA 1AKHA 4NBQA 4CZZA 1KU7A 4CA0A 1H89C 1FOKA 2O03A 1R1VA 1UELB 4R79A 4B3AA 5C3EJ 4XRFA 4L5EA 4UXNA 3M8JA 1G3YA 4AM3A 1RPWA 3I9V2 4FT8A 1R00A 2H1LA 2VJ4A 2QQAA 3ECHA 2CSOA 1HKTA 3F21A 2BY0A 2LVSA 4BL0B 1X4PA 2JA7J 3S32A 3OYAA 2Y9ZA 2MLGA 1MNDA 1YITI 2E1OA 3HYIA 3M3YJ 3HPGA 3QU3A 6PAXA 2RQPA 3ZR8X 5CVIA 4LLLA 3S3NA 5K7ZA 1WWXA 2OZ6A 3AG4H 3CD6I 3CCEI 1WJ5A 1HDPA 1GVJA 2K9QA 3OIPA 3GZNB 1IN6A 2BHZA 4LB5A 1IRGA 2EINH 2HVRA 4WXHA 1X19A 1S3JA 1U0JA 2RVCA 1QQIA 5DV5A 1P6RA 1XMXA 2P8TA 2L4MA 2O8KA 3HOWJ 4UUSA 4JBAA 1WJAA 4XOPA 1I3QJ 3BTIA 5B1BH 4I6ZA 3HOZJ 2ZFUA 3FXKA 2H6BA 2DMNA 2L0KA 4BUPA 3OYHA 5K5RA 5IT3A 3I4NJ 4A3CJ 3H0DA 2NS8A 5H20A 2B9SA 4F52A 2K3FA 4OAZA 1LKXA 1T39A 4IQ4A 2E1CA 1G8XA 2FX0A 1KGSA 4LIVA 1F4KA 2LFBA 3FXUA 2B63J 3WTVC 2J5OA 3ZPLA 3ZMZA 1MGTA 1MBFA 1DQUA 1J59A 3BQYA 1ETYA 2GXGA 4B43A 2ZMEC 3IH4A 1PJRA 2I10A 1BI2A 2QBYA 3I4PA 2FBKA 3F6OA 1ZLKA 1NK3P 1IN4A 5HLIA 1V3FA 5E17F 3F72A 1BOBA 1YW7A 3GLXA 1X1CA 3ISPA 4WX9A 3SEQA 1U8RA 1WSUA 1JXSA 2AQFA 3L9FA 4IOCF 4RDUA 4JK1X 2YUSA 2OU2A 3QODA 1OPCA 2COMA 2DMQA 2L7MP 4BHBA 4IOAF 4FTHA 3ASNH 2LD5A 1S5LC 5DDGA 3S2HJ 4HAMA 1SFKA 1ZG1A 1A31A 2LKXA 4FISA 1S7AA 3CC7I 4F55A 4W1UA 3CUQA 2CWEA 4NQWB 2VC1A 1TQIA 1XMKA 4D7MA 5F0HA 3VSLA 5DM7F 1X1AA 3IKVA 4KT5C 5KK1A 1XMAA 1R71A 2HZDA 4G8XA 2GQQA 2IP2A 3EYYA 2BY2A 2K86A 1ETKA 5CJ9A 3CF2A 4ESBA 1JE8A 3OYEA 1J0RA 3S14J 2LK2A 3I54A 2MLKA 2CQXA 2BW3A 4JP0A 1ZQ3P 2JUCA 2BHYA 3M7GA 5E3MA 3ERMA 1JUSA 2BYVE 1BI1A 3KZIC 3WE2A 5J40A 4AYBN 1PDNC 2QWWA 2M4GA 1MBHA 3GW2A 2PBIA 4E7SA 1VQ4I 2R93J 3F9KA 3ECOA 3LAJA 2H94A 2CW0F 1MZBA 5LGTA 2VJIA 1DP3A 4E7ZA 1XSXA 5KHDA 1FIPA 3BWGA 2LY1A 3BG7A 2XV4S 3E5UA 3KLOA 5JLXA 2DCEA 4XRMA 5IP6A 3L2RA 4E7KA 1SVMA 1IRZA 4J19A 2V26A 3PSIA 5BMZA 5FKKA 2VPLA 3IAS2 4MGRA 4ENJA 5IP7J 3TQNA 1G3WA 3MVPA 5IYDJ 4X0GA 2OBPA 1S8NA 2L01A 1Z3YA 2M5WA 4KIGA 4A3JJ 3G71I 1U5TB 1I50J 4BS9A 3SDGA 4DBQA 3H5RA 3PIPF 2HQ5A 5BPIA 3N05A 3V8LA 3DKXA 5KAIC 4YEJA 3BT9A 5LGUA 3Q3SA 3ABLH 3HSRA 4IRIA 2FE3A 3F8MA 3CMAI 2ZMEB 3HOYJ 2BXZA 3OL4A 4ZZLA 3OYLA 2Y30A 2ZXIA 3HSEA 3OR1C 3A0BC 2FQ3A 3WU0A 1BA5A 2G0EA 3FISA 2R7DA 5IY5H 2JA2A 2R5YB 3G73A 4BE1A 3ULQB 3WG9A 4Q4ZF 5H2FC 5D6FA 3OYKA 2X6XA 2K40A 1A36A 4CHUA 3DU6A 3BG6A 1OKRA 4LB6B 4LFUA 4PJ0C 1VQ9I 1BBYA 4A3IJ 3ZRGA 2UXXA 2RC4A 3V7SA 2XGDA 3HXLA 4B8XA 1LVAA 1UZCA 3LSRA 4RMNA 3HKZN 4F7ZA 1FBSA 1KU9A 2HYFA 3B02A 4BEHA 1IN8A 2JRTA 2XAFA 3D0SA 2R7SA 2RNGA 2XPUA 2HYJA 2KDOA 2F5DA 2WB1A 4Q48A 3FXJA 4DYQA 4G7ZF 1Y1WJ 1SFEA 2KKOA 2XAQA 5IPAA 5M5WJ 2B7EA 2D45A 2KRCA 1TL8A 3BZ6A 3ZOBA 1BW6A 3LSIA 4FE4A 1GXPA 1USTA 3RPUA 4CYDA 2COBA 3OWTA 5FRMA 1U3EM 1RR7A 3U1KA 3SJMA 3IHUA 2WWYA 2A61A 3D5RC 4OWRB 1FOYA 1SD7A 2WAQA 3Q0VA 5EF6A 3HOUJ 4DIQA 2W4SA 5D4SA 4A0ZA 4NC8A 5HDGA 4KT6A 2M87A 4HRIA 1W0UA 4EJVA 2KMUA 1K83J 3C7JA 3KP2A 4Y15A 4EM0B 4H0EA 3OMYA 5ED4A 1W7PA 4KJZA 1T0FC 2BV6A 1ODDA 2W57A 4BJ5C 4V2FA 5EZGA 3JRGA 1WPKA 3ZQGA 1CF7B 2XSJC 4AVPA 1VQ8I 3DEWA 3VDXA 3QYEA 4BAYA 3DFGA 3SZPA 1X3ZB 4YFXF 4E7HA 3PSFA 3TO9A 3CCLI 5J4VA 1WQ2A 2LDUA 4HF1A 3ZMVA 2ID3A 4XLNF 2KHMA 4QLCU 1T33A 1WH7A 2FBIA 1IN5A 1S72I 1BC8C 3DF8A 1IXSB 3WG7H 3BCAA 4R1HA 3ZMUA 5LBQA 2CUZA 3DBRB 2X6WA 2IT0A 3TOBA 1ZRFA 2EK5A 2WY8Q 5C4XJ 4CCKA 1FIAA 2DA5A 4IPAA 3DBHB 1UFMA 2VBXA 1R7JA 1O7FA 3ONQA 4YELA 4WK8F 3HHGA 2N8GA 2DU9A 1B72A 2WAEA 1U2WA 2P6TA 3KP3A 4DNCA 3AKZA 5ILSA 4Y13A 2EA4A 2LF8A 4I01A 5E1XA 1WFXA 1DDNA 5FRNA 1KU2A 3CJRB 1A35A 3R0JA 2K27A 1X1DA 3MMYB 2I5UA 4Z2YA 4HOBA 4PJLA 1JUPA 5K5QA 2EFWA 4XQFA 1Z91A 1B8IB 1H0MA 1MSEC 1I1SA 4HNUA 5JHUA 4A3BJ 4D5FA 2R7OA 3LSMA 4EM2A 1K7AA 2WV1A 4XLHA 5IP9J 4KITB 2A5WA 3FKJA 1NK2P 1IUFA 5DUIA 3M8FA 3S15J 3R4KA 4TV7A 1EH7A 4A3FJ 1JGSA 1O57A 1BI0A 1ZREA 4BJTA 2DA3A 4EJUA 1JTYA 3VPRA 5EGOA 5J1YA 5J47A 5BNGA 5J8FA 4LK0F 3GFLA 4XMYA 2V1UA 1BJZA 5HLTA 1TNSA 2JK3A 2V4JC 3M07A 1LDDA 2ZJQF 1O4XA 2ZKZA 4XLFA 4XBFA 4IO9F 2W82A 1SFOJ 3LWFA 3D1NI 2OTJI 1X3WB 2F2EA 1M1EB 2EFNA 3TEDA 4F91B 2BVMA 2EA2A 4EVIA 2HOSA 4CO8A 5K5OA 1OCPA 2VE8A 3ABMH 4FHTA 2X4HA 3FBIB 3S17J 3BR2A 4B1RA 4KYWA 3A2KA 1TW3A 1HW2A 1OFCX 3BG3A 3WTUC 1JUMA 1B59A 2RNJA 2FXAA 2H27A 3J7AO 1QZZA 2W84A 2V1DA 2R7QA 3K69A 4UHTA 3MCZA 5L3EA 1KONA 1GLNA 4N4OB 1FSEA 4OOIA 3RKWA 2PI0A 3HEFA 3E6CC 3KYLA 4ON0A 3K1PA 1LPQA 1YS7A 2AQEA 5AIPA 1SC7A 4XOTA 2IXSA 1H8AC 3MEXA 1XDSA 5LHGA 5E3OA 3JRAA 1E2XA 4F3QA 4A5MA 5HODA 2AXTC 3B6AA 5IOYA 3T8TA 2Z5UA 4E7JA 3HOVJ 3VYSB 4IVNA 3ZQIA 2LP0A 3VSKA 1G3SA 3AL0B 3GO5A 1XS9A 2HVSA 2DQLA 1RKTA 2DFIA 4HLYA 4I09A 1UHWA 2MABA 5HDKA 3GFIA 1IRFA 4DQ2A 2PMHA 5B3SH 2E5NA 3QP6A 1SAUA 3FXMA 2R7ZJ 5HDNA 2QM3A 2LBFA 1AA7A 4E6KG 2EV0A 2L9SA 1BC7C 4GYGA 2NVYJ 4I0BA 2O6GE 1WZ2A 4U88A 4HX8A 3VFZA 4CCLA 2IS4A 3A0HC 3K1MA 4MIMA 4L5IA 2EFQA 2RN7A 3TL4X 2OC6A 3LSKA 4BKXA 4I2OA 4PFPA 2W24A 1I39A 3CUOA 2CV2A 3HRUA 2FUG2 4CH7A 1S7OA 1J2XA 2H8WA 3BZCA 3WU1B 2XF5A 4LK1F 4UV9A 1G2HA 3Q0WA 4S05A 3MWMA 4HLXA 1NHAA 2Y69H 2EV6A 3OYCA 3ROUA 3BY6A 2V6EA 1ETOA 4C3IJ 1D1AA 4RLFA 5E79C 3FWEA 4CUGA 2V79A 3WTXC 4II2A 3GTJJ 3EUHA 3I59A 2X48A 3CC4I 1I6HJ 4N9HA 3GMEA 2XKOA 1FX7A 5IYBJ 1XTAA 2O7OA 1X2MA 2Z3YA 4M6YA 3KP5A 4CCOA 1KYZA 2FQ4A 4BYYA 2QKMB 3HBLA 2K9SA 2RAEA 2ZC2A 2OA4A 1QPIA 2VB6A 2OCCH 4L0ZB 2ZB9A 4JOMA 1P7JA 3SYTA 3H36A 4MTEA 1VQ6I 5FLMJ 4EV0A 2LLKA 2OTLI 2ELJA 2F5VA 2CGPA 1MMDA 5EEAA 2JUGA 4IKFA 1Y8QB 1YW8A 1D5VA 1FTZA 3MZ8A 1RETA 1V54H 4J00A 3IUOA 1ON2A 5B66C 5JR3A 2FEZA 2Q8KA 2M30A 1FYKA 3VB2A 3OS1A 1R58A 3WTYC 3S93A 3PNVA 3BG5A 2FSWA 2HWVA 2WA0A 5FD6A 5BOXA 4S04A 3E0JB 1USSA 3ABKH 2A5YB 1XSVA 2K85A 2LY2A 1TLHB 4L9JA 5FKMA 5GTIC 1KA8A 4ZYHA 4CSWA 1D0YA 2CQ7A 4LG3A 2V1NA 5DTDA 1TTYA 1MJBA 1MW7A 2WC2A 3REOA 3WGIA 4WCGA 3JREA 3PUBA 2LRDA 4L18B 3DTKA 3I3LA 4AU7A 3DWLE 2KRHA 2PMUA 2HOAA 4KA4A 3RZDJ 3ZQLA 2L9VA 2D2WA 3VEPA 3LFKA 1ERDA 2L02A 3CCMI 2M0MA 1Y39A 3EQLF 2YX4A 5D5UB 2DXIA 4EJTA 2O5RA 1NG7A 4DOZA 3S16J 4UUTA 2VQHA 1QU3A 1SFUA 4L9NA 1QZYA 1OQYA 2HDCA 3QPHA 2DJNA 3H1CA 2DYRH 2HKXA 5LRSA 2Q0OA 3P9CA 2FJ1A 2R7UA 2QGUA 2XAJA 1RR8C 2E2HJ 3GTGJ 2HPIA 4HBLA 2VI6A 1OCZH 1TT0A 1Z67A 4M6XA 3CLQA 4MEYF 1N78A 3OYNA 3BG9A 1ETQA 4XK4A 4BQOA 2LC2A 4WF2A 3ZP5A 1ZRCA 5H6RA 1ZARA 3BJOA 3PNYA 5J1RA 1F43A 3VODA 2W00A 3ELKA 2GXAA 1OISA 2GBYA 1ZHFA 3DPLC 2B0LA 4QPOA 4LOCA 4U7BA 1XGNA 2Q2EA 4CGZA 1R5HA 4B09A 2Y75A 2VXDA 1SEUA 4U7DA 1AKHB 2QQ9A 5LEKA 1ZG5A 3R6SA 1MD0A 1TNTA 2R7XA 3CMEI 2ZXHA 3EETA 1K78A 2X1EA 3L2VA 4BQAA 4NNJA 2ISZA 5FROA 2ICWG 4RAFA 4A0YA 3TBIA 3I53A 2MD5A 2RKHA 3L7WA 2IW5A 2BBYA 3GCMA 2NNNA 5DM6F 1SVLA 2D1VA 2MBFA 5LHHA 1UAAA 4XORA 1U5TC 1Y56A 1RESA 2DT5A 1ENHA 4MEXF 1C0WA 3LSHA 3JSOA 1JHHA 3D5SC 2ELKA 3KP6A 2QA4I 5HLGA 4HYEA 2PQ8A 3TW7A 1IZ1A 1DU0A 2HEOA 1MNMC 2GAUA 4A3MJ 3T0YA 1OR7A 3CP2A 2M4KA 3SZTA 3K70C 1JGGA 2RDPA 4RGXA 3P7NA 4V19K 3W6VA 1F1ZA 4O6JA 4UUSB 2BXYA 3H5AA 3K4KA 3G6EI 3K4LA 2V9PA 1MBKA 3CO6C 1ZRDA 1P4AA 1RKWA 4A3DJ 1AWCA 1J7KA 1RZ4A 4YFNF 2ME6A 3J7YJ 3S1QJ 1S7EA 2VQLA 3JR9A 2JZYA 4M6VA 4J01A 2IGMA 1DUXC 3DBLB 2DMTA 5FKLA 2EJRA 1TQMA 2JJ7A 3GUDA 2ZJPF 1I3AA 2KLOA 3SZGA 2YSRA 2OZUA 1YW9A 2HTJA 2HXOA 1LUJB 2LH9A 2M8GX 2MA3A 3EPZA 5EEHA 4AIJA 4IHTA 2CYYA 3FF5A 5J8CA 4AVZA 1MIJA 2DO7A 3RI4A 2P81A 1QPMA 1Z9CA 4HA8A 2NVQJ 1BR4A 2M9HA 4ZTJA 1Z7UA 2L7KA 3FK6A 1YX3A 3MAJA 4LGWA 4QTRA 1ZR2A 2Y0SA 1TC3C 2IAIA 2QBYB 3K2ZA 2AHQA 3PQKA 1E3HA 2PJRA 2UUZA 5A2QK 4E4HA 2KIUA 1WJFA 3IKTA 1HC8A 2K02A 2JPCA 2G7UA 3HB9A 3K70D 2KQRA 4BNCA 2MC4A 4HPQA 1U6GA 4C30A 4XL9A 1XCBA 3CJTB 1WCMJ 5F1RA 3KYDB 3LA2A 1W36C 3H3VK 3KFWX 3E1SA 3TKYA 4BBRJ 3FM5A 3JRBA 5LHIA 5E20A 2UV1A 5E8IA 4NHJA 3QRFF 3K6GA 1JKQC 5D6EA 4EATA 2VBYA 3RKYA 1P92A 3RYRA 3GTQJ 5E18F 3HRMA 2ZNYA 4MTDA 1JTXA 2A6EF 1TBXA 4XKBA 4XLAA 4RGUA 1MBJA 1PVEA 1QBJA 3ABUA 3H92A 5D8LB 1ZK8A 5TGTA 2FOWA 3IC7A 2ME0A 2FBHA 3H0GJ 2BW3B 3FHNA 3SDBA 3FIWA 4WXDA 1SD6A 1QVUA 3AG3H 2KIQA 4BXXJ 4RA2A 4QPQA 2CS3A 2XIGA 3FXLA 1R5ID 2WV0A 1DPRA 1SMYF 1R36A 2CG4A 3PM1A 4LD5A 2LG4A 2WTEA 4D9JA 3NRVA 2ZMEA 3CESA 4OIOF 3GX4X 4I0AA 2DTZA 5DCMA 2F5FA 4KIFA 4CYCB 3L2QA 3T5XA 4C2UA 2QQBA 3CCUI 3HUGA 3QYFA 4UUVA 2NVXJ 1UHSA 2ZXWH 3IAM2 2NNYA 1VFCA 2CUEA 2IJLA 4MO7A 2DQRA 3C2BA 1W36D 4ZDLA 1UHMA 3AAFA 1B4AA 2CU7A 1B9MA 1ZR4A 3RPQA 1MKMA 2M2EA 3DLAA 3SFIA 3RQ4A 3RCOA 2M3AA 4QWQA 3KETA 2LR8A 1JKRC 2XVCA 2BE5F 1S6LA 3L2WA 1IDYA 5ILVA 2XF7A 3BR3A 2GIZA 1IG7A 2R7WA 3U2RA 2PMZN 1ON1A 3FBNB 3WHCA 3GTPJ 1QGPA 2KJCA 1JT0A 3DU5A 4P55A 1B9NA 5CKTA 3L2UA 1VQMI 5FKNA 1T38A 2E36A 1OYIA 2DA4A 2HR3A 3K4MA 3GZ6A 4MQ9F 3LSJA 3BROA 3K4CA 1Y0UA 3ZMDA 2CQKA 4XM3A 5D5WB 2FOKA 1LVKA 2G9WA 2PG4A 3W2VA 3OSGA 4XN3A 4BXFA 4YIRX 2DW4A 2JPBA 5DS9A 4HDVA 4BDZA 1QO0D 1OMIA 1OCRH 4BY7J 3DV8A 3U21A 1F9NA 2ECCA 4P96A 4B44A 1WGXA 1I6XA 5CQEA 5LEJA 4M3BA 5TRDA 3IRRA 2HGCA 2WBMA 2QEXI 2Y0MA 3ERED 2FA5A 1G59A 3P9IA 2NVUB 3PO3J 1TWAJ 9ANTA 1TZLA 1ZYRF 3C18A 2ZCWA 2VONA 1NTCA 3WTZA 1ZKGA 5KVRA 4ZJZA 3A01A 4BEHB 1D8KA 2Y2ZA 2HQNA 5HOOA 4JX4A 2GWRA 3I0TA 2MH9A 4FX0A 4LG0A 4FETA 4IZZA 5F64A 4PSWA 2EIJH 4DGWB 1QRYA 4IRHA 1R4MB 4QIWN 3KEQA 4X6AJ 4NB5A 4HF0A 1REPC 2HZTA 4I99C 1A6QA 4BQNA 3K4NA 1V5EA 3OYDA 5CQGA 1PUFA 1UMQA 4BBSJ 2VL8A 4JX5A 2HNHA 3IWZA 3BTCA 2L7ZA 1DP7P 4L0YB 2CQNA 2E1NA 4FE7A 4HG2A 2Y48A 4GRIA 4A6EA 3GFJA 4E7IA 2OUMA 3SQNA 3U9GA 1J75A 1T08B 4BXUA 2CUJA 4Y4RA 4E70A 4YIIA 3I5UA 3BOQA 3AL0C 1Z1DA 2DI3A 4PGHA 4CICA 3F6VA 1D1CA 4RAYA 1WJDA 5EYRA 3KEYA 4DJAA 3S3MA 3HDDA 4LITA 5EEGA 5EZHA 3M1CA 3NAUA 4RM2A 4IJAA 2VXZA 4FX4A 1FT9A 3BZKA 1FBUA 1W7PB 3MQ0A 4AYBA 1LE8A 4UVCA 1WJBA 3PUFA 4IQJA 2OCEA 2DBBA 4BACA 1U78A 1FBQA 2VUMJ 2XB0X 2VOPA 3ZN0A 4UVAA 3WHBA 1L3LA 5L3FA 1MMNA 2XUBA 5BQTA 3OS2A 5ICEA 3LA3A 2KJBA 3OIQA 1QHGA 1N77A 1FP1D 5A2QZ 1R9TJ 1YFHA 5CLSA 2XB5A 3ZQCA 1X1BA 3FK7A 4EGYA 2HFHA 1BW5A 3F3XA 4R8HA 4OMYA 2CV0A 5CYVA 2XAGA 1FYLA 2O8XA 3PO2J 2HYGD 3O6BB 1R22A 3C2HA 3L09A 3W6JB 3I4MJ 3CCVI 2CUFA 2EWNA 3JW4A 1B72B 2JA8J 1EH6A 2XASA 4OIQF 2OQRA 1HKSA 2LKPA 4EQQA 1DGRM 1Y6IA 2CFOA 2IS1A 1WI9A 1BR1A 1DPUA 3F8NA 3K4BA 4RB3C 1T8IA 1TWHJ 5IT9Z 3CMYA 1ACIA 5E1WA 2KP6A 2F5CA 1Z7LA 4HDUA 1XCVA 3IWFA 3T8RA 1ORKA 1DU6A 3VOEA 2UXNA 1R49A 1WRJA 2ZSIB 3FHZA 4A3KJ 3OSFA 2KZVA 4KISA 5TJJA 3TP3A 2M8EA 4ANJA 3Q5FA 3JRCA 1GXQA 2D1HA 2CH0A 2NOJB 3F8BA 4PUSA 3KCCA 5JVGF 1STZA 1T0FA 3BP8A 2ACJA 3IH2A 2VE9A 1W5CC 1P4WA 1R23A 3ZGKA 2E34A 2HOTA 5EGOB 4HV6A 3COAC 4JYKA 4UVBA 1R1TA 1YHQI 4HQEA 2GLOA 5E1ZB 3KLNA 2Z2SB 5DCFA 2IPQX 4IF4A 4L5JA 4L9VA 3HKZA 4G9YA 2E1MB 3CLOA 2F48A 1VQPI 4DYCA 2MGQA 2YX7A 3ZMSA 3EUHC 3T1BA 5FLVA 3F8CA 2VKVA 3LL7A 1K6YA 3WTWC 3A1YA 3C2GA 5FO5A 1KYWA 1XSDA 2PFBA 2OD5A 2Z33A 1HDDC 3E3VA 1K4SA 2QSGX 2X85A 1IXCA 3QOPA 2L7FP 5GAGJ 3FMQA 4M3FA 3HGYA 2GZWA 3I56I 2V9KA 3DQVC 2X6YA 2DFFA 2IEKA 1J09A 5HNHA 5EG0A 3W2AA 1XX5A 2Z99A 2R92J 1MDMA 1Q1HA 1FWZA 5FFZA 3BLYA 2P7VB 1YOVB 1YLFA 4LMYA 4M3GA 4Y33A 5GP9A 4BQQA 1ZAOA 1B1BA 4P5OA 2JSCA 5DD4A 1R1UA 2PEXA 3WODF 5ILUA 1CGPA 4V2GA 4IHYA 2K9MA 2R5ZA 3HOSA 1CQTA 1PP8F 1OLTA 1YI2I 3OYGA 4CCJA 5FB2A 2LSOA 3MN2A 3GLLA 4UB8C 2IS2A 2X9DA 4AC0A 5JFRA 2MG4A 1JKPC 1TT5B 2C6YA 3M8EA 1F36A 3QOEA 1YJ9I 2DMUA 4OIRF 2KDZA 4A3LJ 1POGA 3KPHA 2E19A 1P7IA 3HZJA 4AUXA 5J6XA 4I02A 2ESHA 1JI8A 3QWLA 5K7FA 4XLCA 3OIOA 3CQZJ 5KAFC 1XN7A 1KU3A 4A3GJ 4L9TA 4A5NA 1UCRA 1WVRA 3BPXA 3LNQA 3HC7A 2DPUA 1Z6RA 1G6NA 4UB6C 2LBFB 2DN0A 1D0XA 4BGDA 3F8FA 2DK5A 1MH3A 2EB7A 3K10A 2MC3A 3EYIA 2YU9J 2LF7A 2JSPA 4RAZA 1LNWA 2BOLA 3JSPA 1ETVA 2OJED 1ZTRA 3V8KA 2ZXJA 2F4MB 2F5EA 5LFAA 1MMSA 4XIDA 1PYVA 1IUYA 2PLYA 2BVLA 3CDIA 4G12A 4PDKA 4AIHA 1XB4A 4B4CA 2JMWA 2HVQA 4M72A 2I8DA 2VKEA 3WU2C 4ZYDA 2IBDA 2X0LA 4ABZA 4C2MJ 4HEA2 5J3LA 1VF9A 3S2WA 1P2FA 3QQAA 4BDYA 1Y0NA
chains in the Genus database with same CATH topology
4X1EA 2Y30A 1RESA 1ENHA 4C3HJ 1BA5A 2CQQA 2G0EA 2ELKA 3FISA 2E2JJ 5M3FJ 2R5YB 3TW7A 1D5YA 3JRFA 1DU0A 1MNMC 4A3MJ 2K40A 3GTMJ 2XRLA 4IEJA 1HLVA 2DA1A 1JGGA 1Q1VA 1IV6A 3CCYA 5E3LA 3W6VA 4A3IJ 1FEXA 2EQRA 3QPLA 2XGDA 1Z0XA 4UUSB 5GPCA 1K61A 3LSRA 1A5JA 3HKZN 1ETXA 3B6CA 2X6OA 1MBGA 1MBKA 4IHXA 1RKWA 1X58A 4A3DJ 2EH3A 2ME6A 1WI3A 2XPUA 2HYJA 3GTOJ 2KT0A 3S1QJ 1S7EA 3JR9A 4M6VA 4MFEA 4DYQA 1Y1WJ 5IPAA 1QVTA 5M5WJ 2DMTA 5FKLA 2JA5J 2HDDA 2JJ7A 2Y9YA 2HXIA 1LFUP 4M3EA 3ZOBA 2HXOA 1YRNA 1BW6A 2M8GX 2GM4A 4FE4A 3A03A 3BR0A 2Y31A 4XRSG 2COBA 3S1RJ 1A6IA 1IC8A 1FTTA 2P81A 1OJLA 1RR7A 1MH4A 1EF4A 2NVQJ 2M9HA 3SJMA 3FK6A 3DCFA 4QTRA 1ZR2A 3Q0VA 5EF6A 1TC3C 2IAIA 3HOUJ 2AHQA 4A69C 5C44J 2R0QC 1JJ6C 2TRTA 1W0UA 3HB9A 4D7NA 3M4OJ 1K83J 3S1MJ 2AO9A 2XGEA 3RQIA 3G1MA 1SANA 2LTPA 4V2FA 1WCMJ 4W97A 5EZGA 3JRGA 1WPKA 3ZQGA 3H3VK 4Y7NJ 3DEWA 4BBRJ 3JRBA 2XPWA 3E7LA 2XPVA 4MLOA 1JKQC 1GVDA 1W0TA 3MKLA 3K7AJ 3K2AA 1APLC 3GTQJ 2FD5A 2CRGA 2JN6A 1JTXA 2ID3A 5EG0B 3BTLA 1T33A 1WH7A 2D5VA 1MBJA 1GT0C 2H8RA 1ZK8A 1Z77A 5M3MJ 4S0HB 2ME0A 4DYRA 2E2IJ 2YS9A 3H0GJ 5J1UA 5M5YJ 5C4XJ 3FIWA 3TP0A 1JJ8C 2R5ZB 1T56A 1FIAA 1QVUA 2DA5A 2EZLA 2L9RA 4BXXJ 3BQZA 2N8GA 5GPAA 1B72A 1MBEA 3ZQHA 1HF0A 3HM5A 3PM1A 4A3EJ 5M5XJ 2W48A 1TWFJ 1JT6A 3G1OA 4A93J 1GUUA 1JUPA 2DTZA 5FKOA 1B8IB 4CYCB 2NOGA 1MSEC 1VI0A 5EDNA 4D5FA 4A3BJ 1HOMA 2NVXJ 1UHSA 1VFCA 2WV1A 2CUEA 4MO7A 3ZQFA 5IP9J 3C2BA 3HGGA 2JA6J 1NK2P 2CU7A 1ZR4A 1IUFA 2M2EA 3S15J 3SFIA 4A3FJ 3O8HA 5IYCJ 1XG1A 2LR8A 1JKRC 2DA3A 3GTLJ 3Q0UA 4MFDA 1JTYA 1X2NA 1IDYA 3VPRA 5JLWA 5J1YA 5EGOA 1IDZA 2M34A 3BR3A 5BNGA 4DW6A 1IG7A 4EEFG 1ITYA 1BJZA 2PMZN 3WHCA 3FKIJ 2JK3A 3GTPJ 1GV2A 5F04A 2LY9A 1JKOC 3O8GA 1AU7A 1JT0A 1Y1VJ 1O4XA 5FKNA 1HCRA 2WB1N 3BR6A 2DA4A 4BY1J 3LSJA 3JRHA 1SFOJ 3D1NI 5C4JJ 3QPSA 3TEDA 1GV5A 2HOSA 1OCPA 3OSGA 3G1LA 5DS9A 3S17J 3BR2A 3A02A 4B1RA 5K7HA 4BY7J 1OFCX 2ID6A 2ECCA 5F0CA 3BG3A 1WGXA 3RZOJ 2H1KA 3IH3A 1JUMA 4M3BA 4QSHA 2WAQN 1XC5A 2Y0SN 2OF7A 2K9NA 2CJJA 3PO3J 1TWAJ 9ANTA 1MSFC 3HEFA 5E3NA 1NTCA 1ZKGA 3A01A 2EZKA 1AHDP 1H8AC 3S1NJ 2Y2ZA 4D5CA 4JX4A 4Y52J 5FJ8J 5E3OA 1UG2A 3JRAA 1OCTC 5HODA 1QRYA 4M3DA 3B6AA 5IOYA 4QIWN 3HOVJ 4X6AJ 1TWGJ 3ZQIA 2LP0A 3OOUA 1U8BA 3BR5A 1XS9A 1PUFA 1UMQA 1YRNB 4BBSJ 1RKTA 4JX5A 5F08A 4XICA 3BTCA 2L7ZA 4RBOA 4FE7A 2DA2A 2R7ZJ 3TW6A 2ECBA 4NDLA 3LOCA 2NVYJ 2OPTA 2MW8A 5EYRA 4XRSA 1TWCJ 3HDDA 1AKHA 1H89C 4IHVA 4MIMA 5EZHA 3NAUA 4B3AA 5C3EJ 4L5EA 1IJWC 1RPWA 2QF7A 4FCYA 4BKXA 1LE8A 4IHWA 2HI3A 2LVSA 5IOZA 4CYCA 1U78A 2JA7J 2VUMJ 2Y9ZA 2XB0X 3GTKJ 3WHBA 2E1OA 3Q0WA 1G2HA 3M3YJ 3UKGA 1ZGWA 5K7ZA 3JRDA 1R9TJ 2XB5A 3ZQCA 3FK7A 1ETOA 1BW5A 2R5YA 4C3IJ 1HDPA 2K9QA 5F1JA 2DA6A 4I76A 3PO2J 3LSPA 3GTJJ 2EZIA 3I4MJ 1IGNA 5F0FA 2CUFA 2X48A 1I6HJ 1B72B 2O8KA 1H88C 2M0CA 5F27A 4UUSA 2JA8J 3HOWJ 5IYBJ 2O7OA 1X2MA 1I3QJ 3BTIA 4I6ZA 3HOZJ 2FQ4A 1LFBA 2DMNA 2L0KA 3HBLA 2K9SA 2RAEA 1QPIA 3I4NJ 4A3CJ 2NS7A 2ZB9A 2NS8A 1P7JA 1TWHJ 5FLMJ 3CMYA 2LLKA 2FX0A 2LFBA 5EEAA 2B63J 1DU6A 1ORKA 1FTZA 1FJLA 3OSFA 4A3KJ 3TP3A 1RETA 1MBFA 1VNDA 1ETYA 3BQYA 3JRCA 3IH4A 2EBIA 3IH2A 2I10A 2QCOA 3BG5A 2HOTA 5EGOB 4JYKA 1NK3P 2GLOA 3JRIA 4RDUA 2YUSA 4DYCA 1ETWA 2MGQA 2DMQA 2L7MP 1E3OC 1GDTA 5FKMA 4FTHA 5FLVA 1U9OA 2LD5A 4HNVA 3S2HJ 2VKVA 2DMPA 3GBGA 2LKXA 4FISA 4W1UA 5DTDA 1HDDC 4D7MA 2L7FP 3JREA 4DZJA 5F0HA 4GFBA 4M3FA 3HGYA 2IEKA 1WH5A 5EG0A 2R92J 1ETKA 2HOAA 3RZDJ 3ZQLA 5GP9A 4M3GA 3S2DJ 3S14J 2LK2A 2TCTA 2CQXA 4JP0A 1ZQ3P 3RKQA 4V2GA 4C3JJ 3L1PA 4IHYA 4DZPA 2R5ZA 4UUTA 3S16J 1CQTA 5E3MA 2NVTJ 1JUSA 3A01B 3MN2A 4AYBN 2X9DA 2MSYA 4AC0A 2MG4A 2DA7A 2DJNA 1JKPC 4JX6A 1MBHA 3CDLA 1F36A 2EZHA 2FJ1A 2R93J 3LSGA 2DMUA 2KDZA 4A3LJ 3BR1A 1POGA 2E2HJ 3GTGJ 1U9NA 1PUFB 2E19A 2VI6A 1P7IA 4AUXA 1BL0A 1B8IA 2XGCA 5K7FA 3OIOA 3CQZJ 4A3GJ 1FIPA 3BG9A 1ETQA 4XK4A 3LNQA 3IV5A 5J1RA 1F43A 5JLXA 4XRMA 5IP6A 2GBYA 1IRZA 2DN0A 4J19A 4LOCA 5FKKA 1MH3A 3F0CA 2JWTA 5IP7J 2YU9J 5IYDJ 3MVPA 1ETVA 1AKHB 1ZTRA 2VPRA 4XIDA 4A3JJ 2O9LA 1I50J 4G12A 3SDGA 2XSDC 2HQ5A 4B4CA 2JMWA 1LE8B 3BT9A 2VKEA 3BTJA 3Q3SA 2IBDA 4C2MJ 4ABZA 5J3LA 1VF9A 3QQAA 3HOXJ 3NARA 3HOYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X1E A;  2Y30 A;  1RES A;  1ENH A;  4C3H J;  1BA5 A;  2CQQ A;  2G0E A;  2ELK A;  3FIS A;  2E2J J;  5M3F J;  2R5Y B;  3TW7 A;  1D5Y A;  3JRF A;  1DU0 A;  1MNM C;  4A3M J;  2K40 A;  3GTM J;  2XRL A;  4IEJ A;  1HLV A;  2DA1 A;  1JGG A;  1Q1V A;  1IV6 A;  3CCY A;  5E3L A;  3W6V A;  4A3I J;  1FEX A;  2EQR A;  3QPL A;  2XGD A;  1Z0X A;  4UUS B;  5GPC A;  1K61 A;  3LSR A;  1A5J A;  3HKZ N;  1ETX A;  3B6C A;  2X6O A;  1MBG A;  1MBK A;  4IHX A;  1RKW A;  1X58 A;  4A3D J;  2EH3 A;  2ME6 A;  1WI3 A;  2XPU A;  2HYJ A;  3GTO J;  2KT0 A;  3S1Q J;  1S7E A;  3JR9 A;  4M6V A;  4MFE A;  4DYQ A;  1Y1W J;  5IPA A;  1QVT A;  5M5W J;  2DMT A;  5FKL A;  2JA5 J;  2HDD A;  2JJ7 A;  2Y9Y A;  2HXI A;  1LFU P;  4M3E A;  3ZOB A;  2HXO A;  1YRN A;  1BW6 A;  2M8G X;  2GM4 A;  4FE4 A;  3A03 A;  3BR0 A;  2Y31 A;  4XRS G;  2COB A;  3S1R J;  1A6I A;  1IC8 A;  1FTT A;  2P81 A;  1OJL A;  1RR7 A;  1MH4 A;  1EF4 A;  2NVQ J;  2M9H A;  3SJM A;  3FK6 A;  3DCF A;  4QTR A;  1ZR2 A;  3Q0V A;  5EF6 A;  1TC3 C;  2IAI A;  3HOU J;  2AHQ A;  4A69 C;  5C44 J;  2R0Q C;  1JJ6 C;  2TRT A;  1W0U A;  3HB9 A;  4D7N A;  3M4O J;  1K83 J;  3S1M J;  2AO9 A;  2XGE A;  3RQI A;  3G1M A;  1SAN A;  2LTP A;  4V2F A;  1WCM J;  4W97 A;  5EZG A;  3JRG A;  1WPK A;  3ZQG A;  3H3V K;  4Y7N J;  3DEW A;  4BBR J;  3JRB A;  2XPW A;  3E7L A;  2XPV A;  4MLO A;  1JKQ C;  1GVD A;  1W0T A;  3MKL A;  3K7A J;  3K2A A;  1APL C;  3GTQ J;  2FD5 A;  2CRG A;  2JN6 A;  1JTX A;  2ID3 A;  5EG0 B;  3BTL A;  1T33 A;  1WH7 A;  2D5V A;  1MBJ A;  1GT0 C;  2H8R A;  1ZK8 A;  1Z77 A;  5M3M J;  4S0H B;  2ME0 A;  4DYR A;  2E2I J;  2YS9 A;  3H0G J;  5J1U A;  5M5Y J;  5C4X J;  3FIW A;  3TP0 A;  1JJ8 C;  2R5Z B;  1T56 A;  1FIA A;  1QVU A;  2DA5 A;  2EZL A;  2L9R A;  4BXX J;  3BQZ A;  2N8G A;  5GPA A;  1B72 A;  1MBE A;  3ZQH A;  1HF0 A;  3HM5 A;  3PM1 A;  4A3E J;  5M5X J;  2W48 A;  1TWF J;  1JT6 A;  3G1O A;  4A93 J;  1GUU A;  1JUP A;  2DTZ A;  5FKO A;  1B8I B;  4CYC B;  2NOG A;  1MSE C;  1VI0 A;  5EDN A;  4D5F A;  4A3B J;  1HOM A;  2NVX J;  1UHS A;  1VFC A;  2WV1 A;  2CUE A;  4MO7 A;  3ZQF A;  5IP9 J;  3C2B A;  3HGG A;  2JA6 J;  1NK2 P;  2CU7 A;  1ZR4 A;  1IUF A;  2M2E A;  3S15 J;  3SFI A;  4A3F J;  3O8H A;  5IYC J;  1XG1 A;  2LR8 A;  1JKR C;  2DA3 A;  3GTL J;  3Q0U A;  4MFD A;  1JTY A;  1X2N A;  1IDY A;  3VPR A;  5JLW A;  5J1Y A;  5EGO A;  1IDZ A;  2M34 A;  3BR3 A;  5BNG A;  4DW6 A;  1IG7 A;  4EEF G;  1ITY A;  1BJZ A;  2PMZ N;  3WHC A;  3FKI J;  2JK3 A;  3GTP J;  1GV2 A;  5F04 A;  2LY9 A;  1JKO C;  3O8G A;  1AU7 A;  1JT0 A;  1Y1V J;  1O4X A;  5FKN A;  1HCR A;  2WB1 N;  3BR6 A;  2DA4 A;  4BY1 J;  3LSJ A;  3JRH A;  1SFO J;  3D1N I;  5C4J J;  3QPS A;  3TED A;  1GV5 A;  2HOS A;  1OCP A;  3OSG A;  3G1L A;  5DS9 A;  3S17 J;  3BR2 A;  3A02 A;  4B1R A;  5K7H A;  4BY7 J;  1OFC X;  2ID6 A;  2ECC A;  5F0C A;  3BG3 A;  1WGX A;  3RZO J;  2H1K A;  3IH3 A;  1JUM A;  4M3B A;  4QSH A;  2WAQ N;  1XC5 A;  2Y0S N;  2OF7 A;  2K9N A;  2CJJ A;  3PO3 J;  1TWA J;  9ANT A;  1MSF C;  3HEF A;  5E3N A;  1NTC A;  1ZKG A;  3A01 A;  2EZK A;  1AHD P;  1H8A C;  3S1N J;  2Y2Z A;  4D5C A;  4JX4 A;  4Y52 J;  5FJ8 J;  5E3O A;  1UG2 A;  3JRA A;  1OCT C;  5HOD A;  1QRY A;  4M3D A;  3B6A A;  5IOY A;  4QIW N;  3HOV J;  4X6A J;  1TWG J;  3ZQI A;  2LP0 A;  3OOU A;  1U8B A;  3BR5 A;  1XS9 A;  1PUF A;  1UMQ A;  1YRN B;  4BBS J;  1RKT A;  4JX5 A;  5F08 A;  4XIC A;  3BTC A;  2L7Z A;  4RBO A;  4FE7 A;  2DA2 A;  2R7Z J;  3TW6 A;  2ECB A;  4NDL A;  3LOC A;  2NVY J;  2OPT A;  2MW8 A;  5EYR A;  4XRS A;  1TWC J;  3HDD A;  1AKH A;  1H89 C;  4IHV A;  4MIM A;  5EZH A;  3NAU A;  4B3A A;  5C3E J;  4L5E A;  1IJW C;  1RPW A;  2QF7 A;  4FCY A;  4BKX A;  1LE8 A;  4IHW A;  2HI3 A;  2LVS A;  5IOZ A;  4CYC A;  1U78 A;  2JA7 J;  2VUM J;  2Y9Z A;  2XB0 X;  3GTK J;  3WHB A;  2E1O A;  3Q0W A;  1G2H A;  3M3Y J;  3UKG A;  1ZGW A;  5K7Z A;  3JRD A;  1R9T J;  2XB5 A;  3ZQC A;  3FK7 A;  1ETO A;  1BW5 A;  2R5Y A;  4C3I J;  1HDP A;  2K9Q A;  5F1J A;  2DA6 A;  4I76 A;  3PO2 J;  3LSP A;  3GTJ J;  2EZI A;  3I4M J;  1IGN A;  5F0F A;  2CUF A;  2X48 A;  1I6H J;  1B72 B;  2O8K A;  1H88 C;  2M0C A;  5F27 A;  4UUS A;  2JA8 J;  3HOW J;  5IYB J;  2O7O A;  1X2M A;  1I3Q J;  3BTI A;  4I6Z A;  3HOZ J;  2FQ4 A;  1LFB A;  2DMN A;  2L0K A;  3HBL A;  2K9S A;  2RAE A;  1QPI A;  3I4N J;  4A3C J;  2NS7 A;  2ZB9 A;  2NS8 A;  1P7J A;  1TWH J;  5FLM J;  3CMY A;  2LLK A;  2FX0 A;  2LFB A;  5EEA A;  2B63 J;  1DU6 A;  1ORK A;  1FTZ A;  1FJL A;  3OSF A;  4A3K J;  3TP3 A;  1RET A;  1MBF A;  1VND A;  1ETY A;  3BQY A;  3JRC A;  3IH4 A;  2EBI A;  3IH2 A;  2I10 A;  2QCO A;  3BG5 A;  2HOT A;  5EGO B;  4JYK A;  1NK3 P;  2GLO A;  3JRI A;  4RDU A;  2YUS A;  4DYC A;  1ETW A;  2MGQ A;  2DMQ A;  2L7M P;  1E3O C;  1GDT A;  5FKM A;  4FTH A;  5FLV A;  1U9O A;  2LD5 A;  4HNV A;  3S2H J;  2VKV A;  2DMP A;  3GBG A;  2LKX A;  4FIS A;  4W1U A;  5DTD A;  1HDD C;  4D7M A;  2L7F P;  3JRE A;  4DZJ A;  5F0H A;  4GFB A;  4M3F A;  3HGY A;  2IEK A;  1WH5 A;  5EG0 A;  2R92 J;  1ETK A;  2HOA A;  3RZD J;  3ZQL A;  5GP9 A;  4M3G A;  3S2D J;  3S14 J;  2LK2 A;  2TCT A;  2CQX A;  4JP0 A;  1ZQ3 P;  3RKQ A;  4V2G A;  4C3J J;  3L1P A;  4IHY A;  4DZP A;  2R5Z A;  4UUT A;  3S16 J;  1CQT A;  5E3M A;  2NVT J;  1JUS A;  3A01 B;  3MN2 A;  4AYB N;  2X9D A;  2MSY A;  4AC0 A;  2MG4 A;  2DA7 A;  2DJN A;  1JKP C;  4JX6 A;  1MBH A;  3CDL A;  1F36 A;  2EZH A;  2FJ1 A;  2R93 J;  3LSG A;  2DMU A;  2KDZ A;  4A3L J;  3BR1 A;  1POG A;  2E2H J;  3GTG J;  1U9N A;  1PUF B;  2E19 A;  2VI6 A;  1P7I A;  4AUX A;  1BL0 A;  1B8I A;  2XGC A;  5K7F A;  3OIO A;  3CQZ J;  4A3G J;  1FIP A;  3BG9 A;  1ETQ A;  4XK4 A;  3LNQ A;  3IV5 A;  5J1R A;  1F43 A;  5JLX A;  4XRM A;  5IP6 A;  2GBY A;  1IRZ A;  2DN0 A;  4J19 A;  4LOC A;  5FKK A;  1MH3 A;  3F0C A;  2JWT A;  5IP7 J;  2YU9 J;  5IYD J;  3MVP A;  1ETV A;  1AKH B;  1ZTR A;  2VPR A;  4XID A;  4A3J J;  2O9L A;  1I50 J;  4G12 A;  3SDG A;  2XSD C;  2HQ5 A;  4B4C A;  2JMW A;  1LE8 B;  3BT9 A;  2VKE A;  3BTJ A;  3Q3S A;  2IBD A;  4C2M J;  4ABZ A;  5J3L A;  1VF9 A;  3QQA A;  3HOX J;  3NAR A;  3HOY J; 
#chains in the Genus database with same CATH topology
 4EJO A;  1TQP A;  3CP8 A;  5L3D A;  4KMF A;  2MD0 A;  2L54 A;  2CQQ A;  3OYF A;  4G6D A;  2E2J J;  3L2C A;  4RS8 A;  5M3F J;  2NS0 A;  4F92 B;  4KUM A;  3GF2 A;  2XRL A;  4PJJ A;  3LST A;  2M7A A;  3RIR A;  2GA1 A;  1Q1V A;  3I59 B;  1IV6 A;  4Q47 A;  3QYB A;  3GEZ A;  2ZBK A;  5L3G A;  5HNF A;  4N9I A;  1Z0X A;  5GPC A;  1BOA A;  1YJN I;  4BHC A;  1A5J A;  1ETX A;  2Q1Z B;  2X6O A;  3B6C A;  1I27 A;  1MBG A;  2VAS A;  4GGG A;  2HQR A;  2MH2 A;  4BE2 A;  1VQ5 I;  4RB2 C;  2KPM A;  2EH3 A;  4EM1 A;  5ICG A;  1O3Q A;  3GTO J;  2Z16 A;  5D4R A;  4MFE A;  2V6C A;  2FMY A;  3SHF A;  3GZ5 A;  5BS6 A;  4XKC A;  2CV1 A;  2JA5 J;  3E6D A;  2HDD A;  2MFZ A;  2HXI A;  1LFU P;  1QZE A;  3PNT A;  3F23 A;  1YRN A;  2ZFW A;  3NWT A;  1SVO A;  4RGS A;  4XRS G;  1FC3 A;  2E5Z A;  1A6I A;  3S1R J;  2QUF A;  1MH4 A;  1YJW I;  1ZEL A;  5L3B A;  4GDF A;  2XC7 A;  5CVR A;  4HST A;  1TP4 A;  4M9Z A;  3SXY A;  3GYH X;  1E3P A;  5H6Q A;  2QSF X;  2GOX B;  1OR7 C;  2TRT A;  3DTI A;  1BJA A;  1AOY A;  4RLQ A;  4D7N A;  3M4O J;  4LJZ F;  1VQN I;  2AO9 A;  2XGE A;  3RQI A;  2CW7 A;  2X1C A;  1SAN A;  1FZP B;  2E7X A;  4PJM A;  4ETS A;  3RKX A;  2STT A;  3O3K A;  3M9A A;  2F4O B;  2XPW A;  3E7L A;  2XPV A;  3CCS I;  1FMV A;  1RC9 A;  1GVD A;  3FM3 A;  3HPH A;  1WKM A;  4UV8 A;  1APL C;  3J80 Z;  3W2W A;  3E5X A;  4WXC A;  1HQC A;  5D5X B;  5CVU A;  3BTL A;  3VYR B;  3H9J A;  3ZMT A;  4C2T A;  3CJQ B;  1K6O A;  2EPF A;  4XKW A;  1LEA A;  2H8R A;  3U1D A;  3DPU A;  5M3M J;  3V7R A;  5DUK A;  4S0H B;  2YS9 A;  3MKW B;  2LMD A;  1FY7 A;  3CUQ C;  3KEO A;  5J1U A;  1P4X A;  3X2Q H;  3DPT A;  4ZYG A;  2EZL A;  1R5G A;  4PGG A;  3BQZ A;  2A6H F;  1BIB A;  2P5L C;  3LA7 A;  4LLG F;  1FSH A;  4M71 A;  5CVJ A;  1KZH A;  1MBE A;  3ZQH A;  1ZG3 A;  2KZG A;  3MD2 A;  1HF0 A;  4LIU A;  2E35 A;  4OAY A;  4I7H A;  1BI3 A;  2X1D A;  2IA0 A;  1V5G A;  2DOA A;  4HX4 A;  4OIP F;  5M5X J;  3M1E A;  1TWF J;  3G1O A;  4MQV A;  1GUU A;  3OV8 A;  3R0A A;  4A93 J;  3WTT C;  2ZJR F;  1YE9 A;  1IRX A;  4A12 A;  1NH3 A;  2QLZ A;  2NOG A;  4H4K C;  4ZYA A;  2DTR A;  5KCM A;  1H9G A;  3CCJ I;  4II3 A;  2DOF A;  3ZQF A;  4A0X A;  2JA6 J;  4IRG A;  4KDP A;  3GWZ A;  4AID A;  1LDJ A;  4ZDP A;  3JAM Z;  2A07 F;  3I71 A;  3CJN A;  2QZ8 A;  3CMM A;  5GTH C;  3QPT A;  2Q2E B;  4AD9 A;  3O8H A;  2DFE A;  2P4W A;  3LAP A;  3PFY A;  2EFO A;  3GTL J;  4MFD A;  4ZYE A;  2ISY A;  1YYV A;  3RTR A;  4EEF G;  4B3X A;  1NG6 A;  1ITY A;  1Z6T A;  3PL8 A;  2K5C A;  3FZV A;  3FKI J;  2LY9 A;  3K1N A;  1AU7 A;  1FOX A;  1K78 B;  1X4O A;  2EFP A;  2VKH A;  3CDH A;  3I58 A;  1Y1V J;  2G7H A;  2FF4 A;  5B1A H;  3OL3 A;  1HCR A;  2WB1 N;  3ML6 A;  3BR6 A;  2FML A;  1Z05 A;  2V1X A;  3KP4 A;  2DPD A;  4U0W A;  2R7T A;  2GA2 A;  2CFX A;  5C4J J;  4JQF A;  4P1W A;  3SFZ A;  3AFH A;  2ETH A;  3K9T A;  2R7F A;  4NQW A;  5L3C A;  3H9G A;  1VQL I;  4ESF A;  2Z9O A;  3G1L A;  3A02 A;  2H09 A;  2KFD A;  3PFI A;  5K7H A;  2O61 A;  3PQJ A;  1O7L A;  5F0C A;  4B48 A;  2MYS A;  2CMP A;  2H1K A;  4QSH A;  1YQA A;  3DEE A;  1XC5 A;  2WAQ N;  3CZ6 A;  3J81 Z;  2FU4 A;  1LB2 A;  3FMS A;  1D1B A;  4KNY A;  2CJJ A;  4HQM A;  2K4B A;  2BZT A;  3H5N A;  4KFC A;  4G6T B;  4HV5 A;  5TIS C;  1YIO A;  1T95 A;  3P9K A;  2K4J A;  1W5S A;  4RAG A;  1UG2 A;  2STW A;  3ZQQ A;  1OCT C;  2BEO A;  1VZ0 A;  4M3D A;  3WTS C;  2P0W A;  1X3U A;  3OOP A;  3HRT A;  2XRN A;  5HS8 A;  1U8B A;  2CW8 A;  3G2B A;  3KP7 A;  4KMU X;  2E60 A;  2E71 A;  3FMR A;  1EKE A;  2VBW A;  1HW1 A;  3CUQ B;  4CXF A;  4LLN A;  4D1Q A;  2JTV A;  2DA2 A;  4XKV A;  2HOE A;  3TW6 A;  5DEQ A;  2DDB A;  2IRF G;  1VQO I;  1XDU A;  2YU3 A;  3LOC A;  5FLX Z;  5IT9 K;  2IGK A;  4M9S A;  5BPD A;  2PJR B;  1BM9 A;  2OPT A;  3TOA A;  2MW8 A;  4XRS A;  5LLQ A;  5F6F A;  1V4R A;  2WY7 Q;  1VQ7 I;  1K4T A;  4IHV A;  4ASN A;  3O2P E;  2J5P A;  1U5T A;  1IJW C;  4GCV A;  3A4C A;  4BJ6 C;  2QF7 A;  4FCY A;  1J9I A;  2BY1 A;  1MMA A;  4IHW A;  1ZLJ A;  4Q5S F;  1FMW A;  2HI3 A;  1EV7 A;  1YS6 A;  5IOZ A;  4CYC A;  2LOO A;  3ZN1 A;  4HSR A;  5HVQ C;  1Y8R B;  2XAU A;  3GTK J;  5JHF A;  3QU6 A;  3S8P A;  2NXN B;  4P9U A;  4KIC A;  3UKG A;  1ZGW A;  3JRD A;  5FD5 A;  3S3O A;  2E7W A;  5GAD J;  3C1D A;  2ZO4 A;  4GYI A;  2DT7 B;  2R5Y A;  2QEN A;  5F1J A;  1QA6 A;  1UB9 A;  2DA6 A;  2VOD A;  4I76 A;  3NWS A;  3B73 A;  2FNA A;  3H3U A;  3LSP A;  4XR6 A;  2QQ8 A;  2EZI A;  3HOT A;  1IGN A;  5F0F A;  1FPQ A;  4U0Y A;  3HSF A;  4HF2 A;  4XON A;  1H88 C;  2M0C A;  5F27 A;  4CZC A;  4U87 A;  2DK8 A;  2HPM A;  3OY9 A;  3H3Z A;  2W7N A;  5DD8 A;  2A69 F;  1O3R A;  1LFB A;  1W5T A;  1O3T A;  1SD4 A;  2P5V A;  2KL4 A;  1B6A A;  3FDY A;  3GXO A;  2IVM A;  1L0O C;  2NS7 A;  1D3Y A;  1Z21 A;  3RPU D;  5DCM B;  2DJI A;  1ZGA A;  3KZZ A;  4EJW A;  5GAH J;  4YRV A;  3HUG B;  3Q9S A;  4DBR A;  1FJL A;  1S29 A;  4ZH4 F;  3JTH A;  3E6B A;  1W1W E;  1VND A;  3DKY A;  1ONV A;  1SAX A;  4HX7 A;  4CCM A;  2EBI A;  4XNF A;  2M45 A;  2QCO A;  1SFX A;  4XN0 A;  3KE2 A;  1HKQ A;  2L2O A;  3BJA A;  1MJA A;  1W7P D;  1HBX G;  3DEU A;  3R61 A;  3JRI A;  2LKS A;  4OIN F;  4PK4 A;  2LYC A;  4PZJ A;  4IL6 C;  4F93 B;  3MKZ A;  1ETW A;  2PJP A;  1E3O C;  1GDT A;  4CCN A;  3W3C A;  1U9O A;  4RB0 A;  3ZQ7 A;  4HNV A;  1XD7 A;  2DMP A;  1G3T A;  3GBG A;  1PUE E;  1UJ8 A;  3MKY B;  4BU2 A;  1CF7 A;  5B5E C;  1OYW A;  2L9N A;  4O3M A;  2L4A A;  1ULY A;  2VJ5 A;  2QVO A;  2VKD A;  2XDV A;  3OR2 C;  1SD5 A;  2CO5 A;  3RSN A;  4GFB A;  2KRF A;  1I5Z A;  4DZJ A;  1VQK I;  1H9T A;  3ZCO A;  2E1M C;  3GFM A;  5D8K B;  2XRO A;  1WH5 A;  2QKL B;  4AIK A;  1W4M A;  3K4J A;  4FQG A;  2VQC A;  1K79 A;  2VBZ A;  1OCC H;  3S2D J;  3FXO A;  1XPX A;  1G4D A;  4AWX B;  4YFK F;  3CCQ I;  3Q9V A;  2TCT A;  4FAS D;  3RKQ A;  2HQA A;  1FYM A;  3L1P A;  4C3J J;  3PJR A;  2VQG A;  4DZP A;  4IHS A;  1IXR C;  3BJ6 A;  2HU9 A;  4G6Q A;  1YIJ I;  2P5K A;  5AON A;  2NVT J;  3H35 A;  1LEB A;  5HS7 A;  3A01 B;  1TW2 A;  4PCQ A;  4RB1 A;  2BY3 A;  2W25 A;  2MSY A;  3EUA A;  3FXR A;  3NEU A;  2JT1 A;  2P6S A;  4KIB A;  2K3P A;  3W6K B;  3OYI A;  2DA7 A;  3EUK L;  4LG0 B;  4Y17 A;  1E0E A;  2JVG A;  3BC8 A;  2ELH A;  4JX6 A;  3CCR I;  3TDZ C;  3CDL A;  4RM3 A;  2EZH A;  1HST A;  4M73 A;  2F4I A;  3HJE A;  3LSG A;  2YPR A;  2R7V A;  2HKO A;  3BR1 A;  5FGM A;  4Z6Y A;  1U9N A;  1PUF B;  1OYY A;  3C3W A;  2R7R A;  1BL0 A;  5CVV A;  1B8I A;  2XGC A;  4B47 A;  2M1B A;  2VIX A;  3HL2 A;  3E97 A;  1HSJ A;  3EDP A;  4U0V A;  2F6C A;  2IGO A;  1IN7 A;  4G7H F;  3VWB A;  2UWM A;  3J7Z I;  3IV5 A;  2WAD A;  1N75 A;  2XAH A;  2DOD A;  4ITV A;  2XGX A;  2JQ7 A;  1D0Z A;  3CTA A;  2DYS H;  3F0C A;  2JWT A;  3PIO F;  2VPR A;  3KZY A;  3KIO A;  4KN7 X;  4ZC3 A;  2O9L A;  3TGN A;  4OU0 A;  2XSD C;  4PJN A;  3HG9 A;  1LE8 B;  4NC6 A;  3LMM A;  1RRJ A;  3BTJ A;  3LQQ A;  3MZH A;  1FNN A;  1A04 A;  1X1P A;  3HOX J;  5AIQ A;  2K7L A;  3NAR A;  3NQO A;  4X1E A;  2IS6 A;  1P9Q C;  1S9H A;  4C9Y A;  3QP5 A;  1WHU A;  3V7C A;  5ICF A;  2XF6 A;  4C3H J;  4WWC A;  1EA3 A;  3BDD A;  3IRQ A;  1D5Y A;  1YO5 C;  1QHH D;  1Z3X A;  3JRF A;  3G3Z A;  3HIF A;  4I98 B;  5D5V B;  2KIS A;  3V8J A;  3GTM J;  2VLA A;  4IEJ A;  4K2E A;  2DA1 A;  1HLV A;  1FLI A;  1KQ0 A;  4IX7 A;  5K1Y A;  5GAE J;  3CCY A;  5E3L A;  3HTS B;  3WGG A;  3G4S I;  1FEX A;  2EQR A;  3QPL A;  1K61 A;  1WJC A;  2HS5 A;  3J80 K;  1BR2 A;  4PFO A;  2PMZ A;  4NC7 A;  3DP7 A;  3VYU B;  4IHX A;  1R6R A;  1FP2 A;  4ENM A;  1X58 A;  3ASO H;  2YR2 A;  1QNT A;  1WI3 A;  4XLP F;  5FFX A;  2KT0 A;  1SMT A;  2FRH A;  2M7B A;  1HXD A;  1RI7 A;  1QVT A;  2DT6 A;  3WE3 A;  2Y9Y A;  5LRR A;  2A68 F;  4M3E A;  2UZK A;  3UR3 C;  4M74 A;  2GM4 A;  1RUO A;  1IW7 F;  3A03 A;  3BR0 A;  2ESN A;  2FNP A;  3TO6 A;  1YX5 A;  2GXB A;  1LFP A;  2DDA A;  2Y31 A;  3JTG A;  3RYP A;  2BGC A;  4ENN A;  1IC8 A;  1FTT A;  1OJL A;  2KIM A;  1EF4 A;  5ICC A;  5HLH A;  3MFK A;  1YG2 A;  3DCF A;  3ESW B;  3OS0 A;  4ENK A;  1LDK B;  2A6T A;  2X51 A;  2NAZ A;  4G94 A;  4A69 C;  5C44 J;  4A6D A;  1HW5 A;  2R0Q C;  1PP7 U;  2DLL A;  1JJ6 C;  1MNE A;  3LFU A;  3S1M J;  2EIK H;  4XLE A;  3JAM K;  3G1M A;  5DYM A;  3P5J A;  2LTP A;  4W97 A;  4N4N B;  2XHK A;  3TO7 A;  2LNB A;  4Y7N J;  2RQQ A;  1XGM A;  3L00 A;  1WJE A;  4MLO A;  3ABT A;  3HHH A;  4RGR A;  3MKL A;  3K7A J;  1W0T A;  3K2A A;  1O3S A;  2ZSH B;  2TDX A;  2FD5 A;  3R60 A;  4GXO A;  3DTE A;  4UNO A;  5EJC A;  2CRG A;  2JN6 A;  5EG0 B;  1T6S A;  4ZDO A;  2D5V A;  1MDM B;  1GT0 C;  3K0L A;  1N25 A;  2RGV A;  1Z77 A;  5LD2 C;  5KNL A;  4DYR A;  3TMO A;  2E2I J;  2OAZ A;  4O5V A;  2JRM A;  4GO1 A;  5M5Y J;  3TP0 A;  4A2U A;  1JJ8 C;  2R5Z B;  1T56 A;  2L9R A;  1VTN C;  3IL2 A;  5GPA A;  3MZY A;  4UY8 I;  2A3S A;  3AG2 H;  3QAH A;  2HDW A;  1KQ9 A;  4CDG A;  4YIF A;  3HM5 A;  4HNT A;  4EGZ A;  4MNU A;  5ERI A;  3UNG C;  1ZGJ A;  3N4M A;  2W85 A;  4A3E J;  1V55 H;  1EH8 A;  2W48 A;  3BCB A;  3J81 K;  1HA8 A;  1JT6 A;  2ZNZ A;  4MHG A;  4D0P A;  3DXJ F;  5FKO A;  1VI0 A;  5EDN A;  2R3S A;  3E6M A;  2AS5 F;  2O3F A;  1HOM A;  5J4Y A;  3J7A Y;  3HGG A;  3OYM A;  2WAF A;  2H6C A;  4Y3O A;  4XSX F;  2VT3 A;  3GVA A;  2V7F A;  2O0Y A;  2K9L A;  3TDU C;  4BE0 A;  5IYC J;  1XG1 A;  1FOW A;  3IP4 B;  5JI6 A;  4E7L A;  3Q0U A;  1R4N B;  3N97 A;  1X2N A;  3FX3 A;  5JLW A;  1IDZ A;  1IAW A;  2M34 A;  4DW6 A;  1IF1 A;  2DOE A;  1GHC A;  1BIA A;  1RNL A;  2PX9 A;  1GV2 A;  5F04 A;  3VYT B;  1JKO C;  3O8G A;  2P7C B;  3ZXS A;  1IO2 A;  3OYJ A;  3DKW A;  1ZN2 A;  2IA1 A;  1T2K A;  2EV5 A;  4HW0 A;  2KIF A;  4P9F A;  1J5Y A;  1RIO H;  4BY1 J;  5JVT A;  3JRH A;  3RJP A;  1D8J A;  2RRE A;  2HTS A;  1XGS A;  2QSH X;  4ESJ A;  3QPS A;  2JVH A;  4NUB A;  4PSX A;  4XSZ F;  5FLX K;  2IA2 A;  1GV5 A;  4G7O F;  2EIM H;  4IXA A;  1BN5 A;  2ADU A;  1IV8 A;  2GIV A;  3AG1 H;  2W1O A;  1LJ9 A;  3RDI A;  2QYO A;  2PN6 A;  3F22 A;  2Z1D A;  2ID6 A;  3CO7 C;  4BH9 A;  1DGW Y;  2GOM A;  2VT2 A;  3RZO J;  2DAO A;  3IH3 A;  2ZJ2 A;  1KQ8 A;  1OCO H;  2Y0S N;  4EMS A;  2V9V A;  3HTU A;  4KN4 X;  2OV7 A;  2NYX A;  2OF7 A;  2K9N A;  1XGO A;  2VC0 A;  2VOO A;  1LQ1 A;  1RUN A;  2XKP A;  3FXQ A;  4BHP A;  3KX2 A;  1JHF A;  1I1G A;  5E3N A;  1MSF C;  5LGN A;  1ZH5 A;  3V4G A;  2EZK A;  2OQG A;  3OYB A;  3JCU C;  1AHD P;  2RV8 A;  5CPR B;  3S1N J;  3WGH A;  4OMZ A;  3V42 A;  4D5C A;  1EJ9 A;  4Y52 J;  3H9Q A;  4N0B A;  1MJ9 A;  5E8G A;  5FJ8 J;  2VN2 A;  3KYC B;  1UG0 A;  2L5Q A;  1TWG J;  3LQR A;  1T98 A;  3OOU A;  3BR5 A;  2AXL A;  3CF5 F;  3I55 I;  2DFH A;  1MMG A;  3I64 A;  1F5T A;  2IGN A;  3D5L A;  2A05 A;  1YRN B;  1YTY A;  1E17 A;  5F08 A;  4XIC A;  4RBO A;  4M9X A;  4HZF A;  2VJJ A;  1V5F A;  3BPV A;  3SEZ A;  2L3D A;  5HS9 A;  2NRA C;  2ECB A;  2LRE A;  2R4G A;  4NDL A;  3CC2 I;  4ZTF A;  3HRS A;  3E5Q A;  2EIL H;  4YG2 F;  3DLL F;  1TWC J;  4ZZD A;  1AKH A;  4NBQ A;  4CZZ A;  1KU7 A;  4CA0 A;  1H89 C;  1FOK A;  2O03 A;  1R1V A;  1UEL B;  4R79 A;  4B3A A;  5C3E J;  4XRF A;  4L5E A;  4UXN A;  3M8J A;  1G3Y A;  4AM3 A;  1RPW A;  3I9V 2;  4FT8 A;  1R00 A;  2H1L A;  2VJ4 A;  2QQA A;  3ECH A;  2CSO A;  1HKT A;  3F21 A;  2BY0 A;  2LVS A;  4BL0 B;  1X4P A;  2JA7 J;  3S32 A;  3OYA A;  2Y9Z A;  2MLG A;  1MND A;  1YIT I;  2E1O A;  3HYI A;  3M3Y J;  3HPG A;  3QU3 A;  6PAX A;  2RQP A;  3ZR8 X;  5CVI A;  4LLL A;  3S3N A;  5K7Z A;  1WWX A;  2OZ6 A;  3AG4 H;  3CD6 I;  3CCE I;  1WJ5 A;  1HDP A;  1GVJ A;  2K9Q A;  3OIP A;  3GZN B;  1IN6 A;  2BHZ A;  4LB5 A;  1IRG A;  2EIN H;  2HVR A;  4WXH A;  1X19 A;  1S3J A;  1U0J A;  2RVC A;  1QQI A;  5DV5 A;  1P6R A;  1XMX A;  2P8T A;  2L4M A;  2O8K A;  3HOW J;  4UUS A;  4JBA A;  1WJA A;  4XOP A;  1I3Q J;  3BTI A;  5B1B H;  4I6Z A;  3HOZ J;  2ZFU A;  3FXK A;  2H6B A;  2DMN A;  2L0K A;  4BUP A;  3OYH A;  5K5R A;  5IT3 A;  3I4N J;  4A3C J;  3H0D A;  2NS8 A;  5H20 A;  2B9S A;  4F52 A;  2K3F A;  4OAZ A;  1LKX A;  1T39 A;  4IQ4 A;  2E1C A;  1G8X A;  2FX0 A;  1KGS A;  4LIV A;  1F4K A;  2LFB A;  3FXU A;  2B63 J;  3WTV C;  2J5O A;  3ZPL A;  3ZMZ A;  1MGT A;  1MBF A;  1DQU A;  1J59 A;  3BQY A;  1ETY A;  2GXG A;  4B43 A;  2ZME C;  3IH4 A;  1PJR A;  2I10 A;  1BI2 A;  2QBY A;  3I4P A;  2FBK A;  3F6O A;  1ZLK A;  1NK3 P;  1IN4 A;  5HLI A;  1V3F A;  5E17 F;  3F72 A;  1BOB A;  1YW7 A;  3GLX A;  1X1C A;  3ISP A;  4WX9 A;  3SEQ A;  1U8R A;  1WSU A;  1JXS A;  2AQF A;  3L9F A;  4IOC F;  4RDU A;  4JK1 X;  2YUS A;  2OU2 A;  3QOD A;  1OPC A;  2COM A;  2DMQ A;  2L7M P;  4BHB A;  4IOA F;  4FTH A;  3ASN H;  2LD5 A;  1S5L C;  5DDG A;  3S2H J;  4HAM A;  1SFK A;  1ZG1 A;  1A31 A;  2LKX A;  4FIS A;  1S7A A;  3CC7 I;  4F55 A;  4W1U A;  3CUQ A;  2CWE A;  4NQW B;  2VC1 A;  1TQI A;  1XMK A;  4D7M A;  5F0H A;  3VSL A;  5DM7 F;  1X1A A;  3IKV A;  4KT5 C;  5KK1 A;  1XMA A;  1R71 A;  2HZD A;  4G8X A;  2GQQ A;  2IP2 A;  3EYY A;  2BY2 A;  2K86 A;  1ETK A;  5CJ9 A;  3CF2 A;  4ESB A;  1JE8 A;  3OYE A;  1J0R A;  3S14 J;  2LK2 A;  3I54 A;  2MLK A;  2CQX A;  2BW3 A;  4JP0 A;  1ZQ3 P;  2JUC A;  2BHY A;  3M7G A;  5E3M A;  3ERM A;  1JUS A;  2BYV E;  1BI1 A;  3KZI C;  3WE2 A;  5J40 A;  4AYB N;  1PDN C;  2QWW A;  2M4G A;  1MBH A;  3GW2 A;  2PBI A;  4E7S A;  1VQ4 I;  2R93 J;  3F9K A;  3ECO A;  3LAJ A;  2H94 A;  2CW0 F;  1MZB A;  5LGT A;  2VJI A;  1DP3 A;  4E7Z A;  1XSX A;  5KHD A;  1FIP A;  3BWG A;  2LY1 A;  3BG7 A;  2XV4 S;  3E5U A;  3KLO A;  5JLX A;  2DCE A;  4XRM A;  5IP6 A;  3L2R A;  4E7K A;  1SVM A;  1IRZ A;  4J19 A;  2V26 A;  3PSI A;  5BMZ A;  5FKK A;  2VPL A;  3IAS 2;  4MGR A;  4ENJ A;  5IP7 J;  3TQN A;  1G3W A;  3MVP A;  5IYD J;  4X0G A;  2OBP A;  1S8N A;  2L01 A;  1Z3Y A;  2M5W A;  4KIG A;  4A3J J;  3G71 I;  1U5T B;  1I50 J;  4BS9 A;  3SDG A;  4DBQ A;  3H5R A;  3PIP F;  2HQ5 A;  5BPI A;  3N05 A;  3V8L A;  3DKX A;  5KAI C;  4YEJ A;  3BT9 A;  5LGU A;  3Q3S A;  3ABL H;  3HSR A;  4IRI A;  2FE3 A;  3F8M A;  3CMA I;  2ZME B;  3HOY J;  2BXZ A;  3OL4 A;  4ZZL A;  3OYL A;  2Y30 A;  2ZXI A;  3HSE A;  3OR1 C;  3A0B C;  2FQ3 A;  3WU0 A;  1BA5 A;  2G0E A;  3FIS A;  2R7D A;  5IY5 H;  2JA2 A;  2R5Y B;  3G73 A;  4BE1 A;  3ULQ B;  3WG9 A;  4Q4Z F;  5H2F C;  5D6F A;  3OYK A;  2X6X A;  2K40 A;  1A36 A;  4CHU A;  3DU6 A;  3BG6 A;  1OKR A;  4LB6 B;  4LFU A;  4PJ0 C;  1VQ9 I;  1BBY A;  4A3I J;  3ZRG A;  2UXX A;  2RC4 A;  3V7S A;  2XGD A;  3HXL A;  4B8X A;  1LVA A;  1UZC A;  3LSR A;  4RMN A;  3HKZ N;  4F7Z A;  1FBS A;  1KU9 A;  2HYF A;  3B02 A;  4BEH A;  1IN8 A;  2JRT A;  2XAF A;  3D0S A;  2R7S A;  2RNG A;  2XPU A;  2HYJ A;  2KDO A;  2F5D A;  2WB1 A;  4Q48 A;  3FXJ A;  4DYQ A;  4G7Z F;  1Y1W J;  1SFE A;  2KKO A;  2XAQ A;  5IPA A;  5M5W J;  2B7E A;  2D45 A;  2KRC A;  1TL8 A;  3BZ6 A;  3ZOB A;  1BW6 A;  3LSI A;  4FE4 A;  1GXP A;  1UST A;  3RPU A;  4CYD A;  2COB A;  3OWT A;  5FRM A;  1U3E M;  1RR7 A;  3U1K A;  3SJM A;  3IHU A;  2WWY A;  2A61 A;  3D5R C;  4OWR B;  1FOY A;  1SD7 A;  2WAQ A;  3Q0V A;  5EF6 A;  3HOU J;  4DIQ A;  2W4S A;  5D4S A;  4A0Z A;  4NC8 A;  5HDG A;  4KT6 A;  2M87 A;  4HRI A;  1W0U A;  4EJV A;  2KMU A;  1K83 J;  3C7J A;  3KP2 A;  4Y15 A;  4EM0 B;  4H0E A;  3OMY A;  5ED4 A;  1W7P A;  4KJZ A;  1T0F C;  2BV6 A;  1ODD A;  2W57 A;  4BJ5 C;  4V2F A;  5EZG A;  3JRG A;  1WPK A;  3ZQG A;  1CF7 B;  2XSJ C;  4AVP A;  1VQ8 I;  3DEW A;  3VDX A;  3QYE A;  4BAY A;  3DFG A;  3SZP A;  1X3Z B;  4YFX F;  4E7H A;  3PSF A;  3TO9 A;  3CCL I;  5J4V A;  1WQ2 A;  2LDU A;  4HF1 A;  3ZMV A;  2ID3 A;  4XLN F;  2KHM A;  4QLC U;  1T33 A;  1WH7 A;  2FBI A;  1IN5 A;  1S72 I;  1BC8 C;  3DF8 A;  1IXS B;  3WG7 H;  3BCA A;  4R1H A;  3ZMU A;  5LBQ A;  2CUZ A;  3DBR B;  2X6W A;  2IT0 A;  3TOB A;  1ZRF A;  2EK5 A;  2WY8 Q;  5C4X J;  4CCK A;  1FIA A;  2DA5 A;  4IPA A;  3DBH B;  1UFM A;  2VBX A;  1R7J A;  1O7F A;  3ONQ A;  4YEL A;  4WK8 F;  3HHG A;  2N8G A;  2DU9 A;  1B72 A;  2WAE A;  1U2W A;  2P6T A;  3KP3 A;  4DNC A;  3AKZ A;  5ILS A;  4Y13 A;  2EA4 A;  2LF8 A;  4I01 A;  5E1X A;  1WFX A;  1DDN A;  5FRN A;  1KU2 A;  3CJR B;  1A35 A;  3R0J A;  2K27 A;  1X1D A;  3MMY B;  2I5U A;  4Z2Y A;  4HOB A;  4PJL A;  1JUP A;  5K5Q A;  2EFW A;  4XQF A;  1Z91 A;  1B8I B;  1H0M A;  1MSE C;  1I1S A;  4HNU A;  5JHU A;  4A3B J;  4D5F A;  2R7O A;  3LSM A;  4EM2 A;  1K7A A;  2WV1 A;  4XLH A;  5IP9 J;  4KIT B;  2A5W A;  3FKJ A;  1NK2 P;  1IUF A;  5DUI A;  3M8F A;  3S15 J;  3R4K A;  4TV7 A;  1EH7 A;  4A3F J;  1JGS A;  1O57 A;  1BI0 A;  1ZRE A;  4BJT A;  2DA3 A;  4EJU A;  1JTY A;  3VPR A;  5EGO A;  5J1Y A;  5J47 A;  5BNG A;  5J8F A;  4LK0 F;  3GFL A;  4XMY A;  2V1U A;  1BJZ A;  5HLT A;  1TNS A;  2JK3 A;  2V4J C;  3M07 A;  1LDD A;  2ZJQ F;  1O4X A;  2ZKZ A;  4XLF A;  4XBF A;  4IO9 F;  2W82 A;  1SFO J;  3LWF A;  3D1N I;  2OTJ I;  1X3W B;  2F2E A;  1M1E B;  2EFN A;  3TED A;  4F91 B;  2BVM A;  2EA2 A;  4EVI A;  2HOS A;  4CO8 A;  5K5O A;  1OCP A;  2VE8 A;  3ABM H;  4FHT A;  2X4H A;  3FBI B;  3S17 J;  3BR2 A;  4B1R A;  4KYW A;  3A2K A;  1TW3 A;  1HW2 A;  1OFC X;  3BG3 A;  3WTU C;  1JUM A;  1B59 A;  2RNJ A;  2FXA A;  2H27 A;  3J7A O;  1QZZ A;  2W84 A;  2V1D A;  2R7Q A;  3K69 A;  4UHT A;  3MCZ A;  5L3E A;  1KON A;  1GLN A;  4N4O B;  1FSE A;  4OOI A;  3RKW A;  2PI0 A;  3HEF A;  3E6C C;  3KYL A;  4ON0 A;  3K1P A;  1LPQ A;  1YS7 A;  2AQE A;  5AIP A;  1SC7 A;  4XOT A;  2IXS A;  1H8A C;  3MEX A;  1XDS A;  5LHG A;  5E3O A;  3JRA A;  1E2X A;  4F3Q A;  4A5M A;  5HOD A;  2AXT C;  3B6A A;  5IOY A;  3T8T A;  2Z5U A;  4E7J A;  3HOV J;  3VYS B;  4IVN A;  3ZQI A;  2LP0 A;  3VSK A;  1G3S A;  3AL0 B;  3GO5 A;  1XS9 A;  2HVS A;  2DQL A;  1RKT A;  2DFI A;  4HLY A;  4I09 A;  1UHW A;  2MAB A;  5HDK A;  3GFI A;  1IRF A;  4DQ2 A;  2PMH A;  5B3S H;  2E5N A;  3QP6 A;  1SAU A;  3FXM A;  2R7Z J;  5HDN A;  2QM3 A;  2LBF A;  1AA7 A;  4E6K G;  2EV0 A;  2L9S A;  1BC7 C;  4GYG A;  2NVY J;  4I0B A;  2O6G E;  1WZ2 A;  4U88 A;  4HX8 A;  3VFZ A;  4CCL A;  2IS4 A;  3A0H C;  3K1M A;  4MIM A;  4L5I A;  2EFQ A;  2RN7 A;  3TL4 X;  2OC6 A;  3LSK A;  4BKX A;  4I2O A;  4PFP A;  2W24 A;  1I39 A;  3CUO A;  2CV2 A;  3HRU A;  2FUG 2;  4CH7 A;  1S7O A;  1J2X A;  2H8W A;  3BZC A;  3WU1 B;  2XF5 A;  4LK1 F;  4UV9 A;  1G2H A;  3Q0W A;  4S05 A;  3MWM A;  4HLX A;  1NHA A;  2Y69 H;  2EV6 A;  3OYC A;  3ROU A;  3BY6 A;  2V6E A;  1ETO A;  4C3I J;  1D1A A;  4RLF A;  5E79 C;  3FWE A;  4CUG A;  2V79 A;  3WTX C;  4II2 A;  3GTJ J;  3EUH A;  3I59 A;  2X48 A;  3CC4 I;  1I6H J;  4N9H A;  3GME A;  2XKO A;  1FX7 A;  5IYB J;  1XTA A;  2O7O A;  1X2M A;  2Z3Y A;  4M6Y A;  3KP5 A;  4CCO A;  1KYZ A;  2FQ4 A;  4BYY A;  2QKM B;  3HBL A;  2K9S A;  2RAE A;  2ZC2 A;  2OA4 A;  1QPI A;  2VB6 A;  2OCC H;  4L0Z B;  2ZB9 A;  4JOM A;  1P7J A;  3SYT A;  3H36 A;  4MTE A;  1VQ6 I;  5FLM J;  4EV0 A;  2LLK A;  2OTL I;  2ELJ A;  2F5V A;  2CGP A;  1MMD A;  5EEA A;  2JUG A;  4IKF A;  1Y8Q B;  1YW8 A;  1D5V A;  1FTZ A;  3MZ8 A;  1RET A;  1V54 H;  4J00 A;  3IUO A;  1ON2 A;  5B66 C;  5JR3 A;  2FEZ A;  2Q8K A;  2M30 A;  1FYK A;  3VB2 A;  3OS1 A;  1R58 A;  3WTY C;  3S93 A;  3PNV A;  3BG5 A;  2FSW A;  2HWV A;  2WA0 A;  5FD6 A;  5BOX A;  4S04 A;  3E0J B;  1USS A;  3ABK H;  2A5Y B;  1XSV A;  2K85 A;  2LY2 A;  1TLH B;  4L9J A;  5FKM A;  5GTI C;  1KA8 A;  4ZYH A;  4CSW A;  1D0Y A;  2CQ7 A;  4LG3 A;  2V1N A;  5DTD A;  1TTY A;  1MJB A;  1MW7 A;  2WC2 A;  3REO A;  3WGI A;  4WCG A;  3JRE A;  3PUB A;  2LRD A;  4L18 B;  3DTK A;  3I3L A;  4AU7 A;  3DWL E;  2KRH A;  2PMU A;  2HOA A;  4KA4 A;  3RZD J;  3ZQL A;  2L9V A;  2D2W A;  3VEP A;  3LFK A;  1ERD A;  2L02 A;  3CCM I;  2M0M A;  1Y39 A;  3EQL F;  2YX4 A;  5D5U B;  2DXI A;  4EJT A;  2O5R A;  1NG7 A;  4DOZ A;  3S16 J;  4UUT A;  2VQH A;  1QU3 A;  1SFU A;  4L9N A;  1QZY A;  1OQY A;  2HDC A;  3QPH A;  2DJN A;  3H1C A;  2DYR H;  2HKX A;  5LRS A;  2Q0O A;  3P9C A;  2FJ1 A;  2R7U A;  2QGU A;  2XAJ A;  1RR8 C;  2E2H J;  3GTG J;  2HPI A;  4HBL A;  2VI6 A;  1OCZ H;  1TT0 A;  1Z67 A;  4M6X A;  3CLQ A;  4MEY F;  1N78 A;  3OYN A;  3BG9 A;  1ETQ A;  4XK4 A;  4BQO A;  2LC2 A;  4WF2 A;  3ZP5 A;  1ZRC A;  5H6R A;  1ZAR A;  3BJO A;  3PNY A;  5J1R A;  1F43 A;  3VOD A;  2W00 A;  3ELK A;  2GXA A;  1OIS A;  2GBY A;  1ZHF A;  3DPL C;  2B0L A;  4QPO A;  4LOC A;  4U7B A;  1XGN A;  2Q2E A;  4CGZ A;  1R5H A;  4B09 A;  2Y75 A;  2VXD A;  1SEU A;  4U7D A;  1AKH B;  2QQ9 A;  5LEK A;  1ZG5 A;  3R6S A;  1MD0 A;  1TNT A;  2R7X A;  3CME I;  2ZXH A;  3EET A;  1K78 A;  2X1E A;  3L2V A;  4BQA A;  4NNJ A;  2ISZ A;  5FRO A;  2ICW G;  4RAF A;  4A0Y A;  3TBI A;  3I53 A;  2MD5 A;  2RKH A;  3L7W A;  2IW5 A;  2BBY A;  3GCM A;  2NNN A;  5DM6 F;  1SVL A;  2D1V A;  2MBF A;  5LHH A;  1UAA A;  4XOR A;  1U5T C;  1Y56 A;  1RES A;  2DT5 A;  1ENH A;  4MEX F;  1C0W A;  3LSH A;  3JSO A;  1JHH A;  3D5S C;  2ELK A;  3KP6 A;  2QA4 I;  5HLG A;  4HYE A;  2PQ8 A;  3TW7 A;  1IZ1 A;  1DU0 A;  2HEO A;  1MNM C;  2GAU A;  4A3M J;  3T0Y A;  1OR7 A;  3CP2 A;  2M4K A;  3SZT A;  3K70 C;  1JGG A;  2RDP A;  4RGX A;  3P7N A;  4V19 K;  3W6V A;  1F1Z A;  4O6J A;  4UUS B;  2BXY A;  3H5A A;  3K4K A;  3G6E I;  3K4L A;  2V9P A;  1MBK A;  3CO6 C;  1ZRD A;  1P4A A;  1RKW A;  4A3D J;  1AWC A;  1J7K A;  1RZ4 A;  4YFN F;  2ME6 A;  3J7Y J;  3S1Q J;  1S7E A;  2VQL A;  3JR9 A;  2JZY A;  4M6V A;  4J01 A;  2IGM A;  1DUX C;  3DBL B;  2DMT A;  5FKL A;  2EJR A;  1TQM A;  2JJ7 A;  3GUD A;  2ZJP F;  1I3A A;  2KLO A;  3SZG A;  2YSR A;  2OZU A;  1YW9 A;  2HTJ A;  2HXO A;  1LUJ B;  2LH9 A;  2M8G X;  2MA3 A;  3EPZ A;  5EEH A;  4AIJ A;  4IHT A;  2CYY A;  3FF5 A;  5J8C A;  4AVZ A;  1MIJ A;  2DO7 A;  3RI4 A;  2P81 A;  1QPM A;  1Z9C A;  4HA8 A;  2NVQ J;  1BR4 A;  2M9H A;  4ZTJ A;  1Z7U A;  2L7K A;  3FK6 A;  1YX3 A;  3MAJ A;  4LGW A;  4QTR A;  1ZR2 A;  2Y0S A;  1TC3 C;  2IAI A;  2QBY B;  3K2Z A;  2AHQ A;  3PQK A;  1E3H A;  2PJR A;  2UUZ A;  5A2Q K;  4E4H A;  2KIU A;  1WJF A;  3IKT A;  1HC8 A;  2K02 A;  2JPC A;  2G7U A;  3HB9 A;  3K70 D;  2KQR A;  4BNC A;  2MC4 A;  4HPQ A;  1U6G A;  4C30 A;  4XL9 A;  1XCB A;  3CJT B;  1WCM J;  5F1R A;  3KYD B;  3LA2 A;  1W36 C;  3H3V K;  3KFW X;  3E1S A;  3TKY A;  4BBR J;  3FM5 A;  3JRB A;  5LHI A;  5E20 A;  2UV1 A;  5E8I A;  4NHJ A;  3QRF F;  3K6G A;  1JKQ C;  5D6E A;  4EAT A;  2VBY A;  3RKY A;  1P92 A;  3RYR A;  3GTQ J;  5E18 F;  3HRM A;  2ZNY A;  4MTD A;  1JTX A;  2A6E F;  1TBX A;  4XKB A;  4XLA A;  4RGU A;  1MBJ A;  1PVE A;  1QBJ A;  3ABU A;  3H92 A;  5D8L B;  1ZK8 A;  5TGT A;  2FOW A;  3IC7 A;  2ME0 A;  2FBH A;  3H0G J;  2BW3 B;  3FHN A;  3SDB A;  3FIW A;  4WXD A;  1SD6 A;  1QVU A;  3AG3 H;  2KIQ A;  4BXX J;  4RA2 A;  4QPQ A;  2CS3 A;  2XIG A;  3FXL A;  1R5I D;  2WV0 A;  1DPR A;  1SMY F;  1R36 A;  2CG4 A;  3PM1 A;  4LD5 A;  2LG4 A;  2WTE A;  4D9J A;  3NRV A;  2ZME A;  3CES A;  4OIO F;  3GX4 X;  4I0A A;  2DTZ A;  5DCM A;  2F5F A;  4KIF A;  4CYC B;  3L2Q A;  3T5X A;  4C2U A;  2QQB A;  3CCU I;  3HUG A;  3QYF A;  4UUV A;  2NVX J;  1UHS A;  2ZXW H;  3IAM 2;  2NNY A;  1VFC A;  2CUE A;  2IJL A;  4MO7 A;  2DQR A;  3C2B A;  1W36 D;  4ZDL A;  1UHM A;  3AAF A;  1B4A A;  2CU7 A;  1B9M A;  1ZR4 A;  3RPQ A;  1MKM A;  2M2E A;  3DLA A;  3SFI A;  3RQ4 A;  3RCO A;  2M3A A;  4QWQ A;  3KET A;  2LR8 A;  1JKR C;  2XVC A;  2BE5 F;  1S6L A;  3L2W A;  1IDY A;  5ILV A;  2XF7 A;  3BR3 A;  2GIZ A;  1IG7 A;  2R7W A;  3U2R A;  2PMZ N;  1ON1 A;  3FBN B;  3WHC A;  3GTP J;  1QGP A;  2KJC A;  1JT0 A;  3DU5 A;  4P55 A;  1B9N A;  5CKT A;  3L2U A;  1VQM I;  5FKN A;  1T38 A;  2E36 A;  1OYI A;  2DA4 A;  2HR3 A;  3K4M A;  3GZ6 A;  4MQ9 F;  3LSJ A;  3BRO A;  3K4C A;  1Y0U A;  3ZMD A;  2CQK A;  4XM3 A;  5D5W B;  2FOK A;  1LVK A;  2G9W A;  2PG4 A;  3W2V A;  3OSG A;  4XN3 A;  4BXF A;  4YIR X;  2DW4 A;  2JPB A;  5DS9 A;  4HDV A;  4BDZ A;  1QO0 D;  1OMI A;  1OCR H;  4BY7 J;  3DV8 A;  3U21 A;  1F9N A;  2ECC A;  4P96 A;  4B44 A;  1WGX A;  1I6X A;  5CQE A;  5LEJ A;  4M3B A;  5TRD A;  3IRR A;  2HGC A;  2WBM A;  2QEX I;  2Y0M A;  3ERE D;  2FA5 A;  1G59 A;  3P9I A;  2NVU B;  3PO3 J;  1TWA J;  9ANT A;  1TZL A;  1ZYR F;  3C18 A;  2ZCW A;  2VON A;  1NTC A;  3WTZ A;  1ZKG A;  5KVR A;  4ZJZ A;  3A01 A;  4BEH B;  1D8K A;  2Y2Z A;  2HQN A;  5HOO A;  4JX4 A;  2GWR A;  3I0T A;  2MH9 A;  4FX0 A;  4LG0 A;  4FET A;  4IZZ A;  5F64 A;  4PSW A;  2EIJ H;  4DGW B;  1QRY A;  4IRH A;  1R4M B;  4QIW N;  3KEQ A;  4X6A J;  4NB5 A;  4HF0 A;  1REP C;  2HZT A;  4I99 C;  1A6Q A;  4BQN A;  3K4N A;  1V5E A;  3OYD A;  5CQG A;  1PUF A;  1UMQ A;  4BBS J;  2VL8 A;  4JX5 A;  2HNH A;  3IWZ A;  3BTC A;  2L7Z A;  1DP7 P;  4L0Y B;  2CQN A;  2E1N A;  4FE7 A;  4HG2 A;  2Y48 A;  4GRI A;  4A6E A;  3GFJ A;  4E7I A;  2OUM A;  3SQN A;  3U9G A;  1J75 A;  1T08 B;  4BXU A;  2CUJ A;  4Y4R A;  4E70 A;  4YII A;  3I5U A;  3BOQ A;  3AL0 C;  1Z1D A;  2DI3 A;  4PGH A;  4CIC A;  3F6V A;  1D1C A;  4RAY A;  1WJD A;  5EYR A;  3KEY A;  4DJA A;  3S3M A;  3HDD A;  4LIT A;  5EEG A;  5EZH A;  3M1C A;  3NAU A;  4RM2 A;  4IJA A;  2VXZ A;  4FX4 A;  1FT9 A;  3BZK A;  1FBU A;  1W7P B;  3MQ0 A;  4AYB A;  1LE8 A;  4UVC A;  1WJB A;  3PUF A;  4IQJ A;  2OCE A;  2DBB A;  4BAC A;  1U78 A;  1FBQ A;  2VUM J;  2XB0 X;  2VOP A;  3ZN0 A;  4UVA A;  3WHB A;  1L3L A;  5L3F A;  1MMN A;  2XUB A;  5BQT A;  3OS2 A;  5ICE A;  3LA3 A;  2KJB A;  3OIQ A;  1QHG A;  1N77 A;  1FP1 D;  5A2Q Z;  1R9T J;  1YFH A;  5CLS A;  2XB5 A;  3ZQC A;  1X1B A;  3FK7 A;  4EGY A;  2HFH A;  1BW5 A;  3F3X A;  4R8H A;  4OMY A;  2CV0 A;  5CYV A;  2XAG A;  1FYL A;  2O8X A;  3PO2 J;  2HYG D;  3O6B B;  1R22 A;  3C2H A;  3L09 A;  3W6J B;  3I4M J;  3CCV I;  2CUF A;  2EWN A;  3JW4 A;  1B72 B;  2JA8 J;  1EH6 A;  2XAS A;  4OIQ F;  2OQR A;  1HKS A;  2LKP A;  4EQQ A;  1DGR M;  1Y6I A;  2CFO A;  2IS1 A;  1WI9 A;  1BR1 A;  1DPU A;  3F8N A;  3K4B A;  4RB3 C;  1T8I A;  1TWH J;  5IT9 Z;  3CMY A;  1ACI A;  5E1W A;  2KP6 A;  2F5C A;  1Z7L A;  4HDU A;  1XCV A;  3IWF A;  3T8R A;  1ORK A;  1DU6 A;  3VOE A;  2UXN A;  1R49 A;  1WRJ A;  2ZSI B;  3FHZ A;  4A3K J;  3OSF A;  2KZV A;  4KIS A;  5TJJ A;  3TP3 A;  2M8E A;  4ANJ A;  3Q5F A;  3JRC A;  1GXQ A;  2D1H A;  2CH0 A;  2NOJ B;  3F8B A;  4PUS A;  3KCC A;  5JVG F;  1STZ A;  1T0F A;  3BP8 A;  2ACJ A;  3IH2 A;  2VE9 A;  1W5C C;  1P4W A;  1R23 A;  3ZGK A;  2E34 A;  2HOT A;  5EGO B;  4HV6 A;  3COA C;  4JYK A;  4UVB A;  1R1T A;  1YHQ I;  4HQE A;  2GLO A;  5E1Z B;  3KLN A;  2Z2S B;  5DCF A;  2IPQ X;  4IF4 A;  4L5J A;  4L9V A;  3HKZ A;  4G9Y A;  2E1M B;  3CLO A;  2F48 A;  1VQP I;  4DYC A;  2MGQ A;  2YX7 A;  3ZMS A;  3EUH C;  3T1B A;  5FLV A;  3F8C A;  2VKV A;  3LL7 A;  1K6Y A;  3WTW C;  3A1Y A;  3C2G A;  5FO5 A;  1KYW A;  1XSD A;  2PFB A;  2OD5 A;  2Z33 A;  1HDD C;  3E3V A;  1K4S A;  2QSG X;  2X85 A;  1IXC A;  3QOP A;  2L7F P;  5GAG J;  3FMQ A;  4M3F A;  3HGY A;  2GZW A;  3I56 I;  2V9K A;  3DQV C;  2X6Y A;  2DFF A;  2IEK A;  1J09 A;  5HNH A;  5EG0 A;  3W2A A;  1XX5 A;  2Z99 A;  2R92 J;  1MDM A;  1Q1H A;  1FWZ A;  5FFZ A;  3BLY A;  2P7V B;  1YOV B;  1YLF A;  4LMY A;  4M3G A;  4Y33 A;  5GP9 A;  4BQQ A;  1ZAO A;  1B1B A;  4P5O A;  2JSC A;  5DD4 A;  1R1U A;  2PEX A;  3WOD F;  5ILU A;  1CGP A;  4V2G A;  4IHY A;  2K9M A;  2R5Z A;  3HOS A;  1CQT A;  1PP8 F;  1OLT A;  1YI2 I;  3OYG A;  4CCJ A;  5FB2 A;  2LSO A;  3MN2 A;  3GLL A;  4UB8 C;  2IS2 A;  2X9D A;  4AC0 A;  5JFR A;  2MG4 A;  1JKP C;  1TT5 B;  2C6Y A;  3M8E A;  1F36 A;  3QOE A;  1YJ9 I;  2DMU A;  4OIR F;  2KDZ A;  4A3L J;  1POG A;  3KPH A;  2E19 A;  1P7I A;  3HZJ A;  4AUX A;  5J6X A;  4I02 A;  2ESH A;  1JI8 A;  3QWL A;  5K7F A;  4XLC A;  3OIO A;  3CQZ J;  5KAF C;  1XN7 A;  1KU3 A;  4A3G J;  4L9T A;  4A5N A;  1UCR A;  1WVR A;  3BPX A;  3LNQ A;  3HC7 A;  2DPU A;  1Z6R A;  1G6N A;  4UB6 C;  2LBF B;  2DN0 A;  1D0X A;  4BGD A;  3F8F A;  2DK5 A;  1MH3 A;  2EB7 A;  3K10 A;  2MC3 A;  3EYI A;  2YU9 J;  2LF7 A;  2JSP A;  4RAZ A;  1LNW A;  2BOL A;  3JSP A;  1ETV A;  2OJE D;  1ZTR A;  3V8K A;  2ZXJ A;  2F4M B;  2F5E A;  5LFA A;  1MMS A;  4XID A;  1PYV A;  1IUY A;  2PLY A;  2BVL A;  3CDI A;  4G12 A;  4PDK A;  4AIH A;  1XB4 A;  4B4C A;  2JMW A;  2HVQ A;  4M72 A;  2I8D A;  2VKE A;  3WU2 C;  4ZYD A;  2IBD A;  2X0L A;  4ABZ A;  4C2M J;  4HEA 2;  5J3L A;  1VF9 A;  3S2W A;  1P2F A;  3QQA A;  4BDY A;  1Y0N A; 
#chains in the Genus database with same CATH homology
 4X1E A;  2Y30 A;  1RES A;  1ENH A;  4C3H J;  1BA5 A;  2CQQ A;  2G0E A;  2ELK A;  3FIS A;  2E2J J;  5M3F J;  2R5Y B;  3TW7 A;  1D5Y A;  3JRF A;  1DU0 A;  1MNM C;  4A3M J;  2K40 A;  3GTM J;  2XRL A;  4IEJ A;  1HLV A;  2DA1 A;  1JGG A;  1Q1V A;  1IV6 A;  3CCY A;  5E3L A;  3W6V A;  4A3I J;  1FEX A;  2EQR A;  3QPL A;  2XGD A;  1Z0X A;  4UUS B;  5GPC A;  1K61 A;  3LSR A;  1A5J A;  3HKZ N;  1ETX A;  3B6C A;  2X6O A;  1MBG A;  1MBK A;  4IHX A;  1RKW A;  1X58 A;  4A3D J;  2EH3 A;  2ME6 A;  1WI3 A;  2XPU A;  2HYJ A;  3GTO J;  2KT0 A;  3S1Q J;  1S7E A;  3JR9 A;  4M6V A;  4MFE A;  4DYQ A;  1Y1W J;  5IPA A;  1QVT A;  5M5W J;  2DMT A;  5FKL A;  2JA5 J;  2HDD A;  2JJ7 A;  2Y9Y A;  2HXI A;  1LFU P;  4M3E A;  3ZOB A;  2HXO A;  1YRN A;  1BW6 A;  2M8G X;  2GM4 A;  4FE4 A;  3A03 A;  3BR0 A;  2Y31 A;  4XRS G;  2COB A;  3S1R J;  1A6I A;  1IC8 A;  1FTT A;  2P81 A;  1OJL A;  1RR7 A;  1MH4 A;  1EF4 A;  2NVQ J;  2M9H A;  3SJM A;  3FK6 A;  3DCF A;  4QTR A;  1ZR2 A;  3Q0V A;  5EF6 A;  1TC3 C;  2IAI A;  3HOU J;  2AHQ A;  4A69 C;  5C44 J;  2R0Q C;  1JJ6 C;  2TRT A;  1W0U A;  3HB9 A;  4D7N A;  3M4O J;  1K83 J;  3S1M J;  2AO9 A;  2XGE A;  3RQI A;  3G1M A;  1SAN A;  2LTP A;  4V2F A;  1WCM J;  4W97 A;  5EZG A;  3JRG A;  1WPK A;  3ZQG A;  3H3V K;  4Y7N J;  3DEW A;  4BBR J;  3JRB A;  2XPW A;  3E7L A;  2XPV A;  4MLO A;  1JKQ C;  1GVD A;  1W0T A;  3MKL A;  3K7A J;  3K2A A;  1APL C;  3GTQ J;  2FD5 A;  2CRG A;  2JN6 A;  1JTX A;  2ID3 A;  5EG0 B;  3BTL A;  1T33 A;  1WH7 A;  2D5V A;  1MBJ A;  1GT0 C;  2H8R A;  1ZK8 A;  1Z77 A;  5M3M J;  4S0H B;  2ME0 A;  4DYR A;  2E2I J;  2YS9 A;  3H0G J;  5J1U A;  5M5Y J;  5C4X J;  3FIW A;  3TP0 A;  1JJ8 C;  2R5Z B;  1T56 A;  1FIA A;  1QVU A;  2DA5 A;  2EZL A;  2L9R A;  4BXX J;  3BQZ A;  2N8G A;  5GPA A;  1B72 A;  1MBE A;  3ZQH A;  1HF0 A;  3HM5 A;  3PM1 A;  4A3E J;  5M5X J;  2W48 A;  1TWF J;  1JT6 A;  3G1O A;  4A93 J;  1GUU A;  1JUP A;  2DTZ A;  5FKO A;  1B8I B;  4CYC B;  2NOG A;  1MSE C;  1VI0 A;  5EDN A;  4D5F A;  4A3B J;  1HOM A;  2NVX J;  1UHS A;  1VFC A;  2WV1 A;  2CUE A;  4MO7 A;  3ZQF A;  5IP9 J;  3C2B A;  3HGG A;  2JA6 J;  1NK2 P;  2CU7 A;  1ZR4 A;  1IUF A;  2M2E A;  3S15 J;  3SFI A;  4A3F J;  3O8H A;  5IYC J;  1XG1 A;  2LR8 A;  1JKR C;  2DA3 A;  3GTL J;  3Q0U A;  4MFD A;  1JTY A;  1X2N A;  1IDY A;  3VPR A;  5JLW A;  5J1Y A;  5EGO A;  1IDZ A;  2M34 A;  3BR3 A;  5BNG A;  4DW6 A;  1IG7 A;  4EEF G;  1ITY A;  1BJZ A;  2PMZ N;  3WHC A;  3FKI J;  2JK3 A;  3GTP J;  1GV2 A;  5F04 A;  2LY9 A;  1JKO C;  3O8G A;  1AU7 A;  1JT0 A;  1Y1V J;  1O4X A;  5FKN A;  1HCR A;  2WB1 N;  3BR6 A;  2DA4 A;  4BY1 J;  3LSJ A;  3JRH A;  1SFO J;  3D1N I;  5C4J J;  3QPS A;  3TED A;  1GV5 A;  2HOS A;  1OCP A;  3OSG A;  3G1L A;  5DS9 A;  3S17 J;  3BR2 A;  3A02 A;  4B1R A;  5K7H A;  4BY7 J;  1OFC X;  2ID6 A;  2ECC A;  5F0C A;  3BG3 A;  1WGX A;  3RZO J;  2H1K A;  3IH3 A;  1JUM A;  4M3B A;  4QSH A;  2WAQ N;  1XC5 A;  2Y0S N;  2OF7 A;  2K9N A;  2CJJ A;  3PO3 J;  1TWA J;  9ANT A;  1MSF C;  3HEF A;  5E3N A;  1NTC A;  1ZKG A;  3A01 A;  2EZK A;  1AHD P;  1H8A C;  3S1N J;  2Y2Z A;  4D5C A;  4JX4 A;  4Y52 J;  5FJ8 J;  5E3O A;  1UG2 A;  3JRA A;  1OCT C;  5HOD A;  1QRY A;  4M3D A;  3B6A A;  5IOY A;  4QIW N;  3HOV J;  4X6A J;  1TWG J;  3ZQI A;  2LP0 A;  3OOU A;  1U8B A;  3BR5 A;  1XS9 A;  1PUF A;  1UMQ A;  1YRN B;  4BBS J;  1RKT A;  4JX5 A;  5F08 A;  4XIC A;  3BTC A;  2L7Z A;  4RBO A;  4FE7 A;  2DA2 A;  2R7Z J;  3TW6 A;  2ECB A;  4NDL A;  3LOC A;  2NVY J;  2OPT A;  2MW8 A;  5EYR A;  4XRS A;  1TWC J;  3HDD A;  1AKH A;  1H89 C;  4IHV A;  4MIM A;  5EZH A;  3NAU A;  4B3A A;  5C3E J;  4L5E A;  1IJW C;  1RPW A;  2QF7 A;  4FCY A;  4BKX A;  1LE8 A;  4IHW A;  2HI3 A;  2LVS A;  5IOZ A;  4CYC A;  1U78 A;  2JA7 J;  2VUM J;  2Y9Z A;  2XB0 X;  3GTK J;  3WHB A;  2E1O A;  3Q0W A;  1G2H A;  3M3Y J;  3UKG A;  1ZGW A;  5K7Z A;  3JRD A;  1R9T J;  2XB5 A;  3ZQC A;  3FK7 A;  1ETO A;  1BW5 A;  2R5Y A;  4C3I J;  1HDP A;  2K9Q A;  5F1J A;  2DA6 A;  4I76 A;  3PO2 J;  3LSP A;  3GTJ J;  2EZI A;  3I4M J;  1IGN A;  5F0F A;  2CUF A;  2X48 A;  1I6H J;  1B72 B;  2O8K A;  1H88 C;  2M0C A;  5F27 A;  4UUS A;  2JA8 J;  3HOW J;  5IYB J;  2O7O A;  1X2M A;  1I3Q J;  3BTI A;  4I6Z A;  3HOZ J;  2FQ4 A;  1LFB A;  2DMN A;  2L0K A;  3HBL A;  2K9S A;  2RAE A;  1QPI A;  3I4N J;  4A3C J;  2NS7 A;  2ZB9 A;  2NS8 A;  1P7J A;  1TWH J;  5FLM J;  3CMY A;  2LLK A;  2FX0 A;  2LFB A;  5EEA A;  2B63 J;  1DU6 A;  1ORK A;  1FTZ A;  1FJL A;  3OSF A;  4A3K J;  3TP3 A;  1RET A;  1MBF A;  1VND A;  1ETY A;  3BQY A;  3JRC A;  3IH4 A;  2EBI A;  3IH2 A;  2I10 A;  2QCO A;  3BG5 A;  2HOT A;  5EGO B;  4JYK A;  1NK3 P;  2GLO A;  3JRI A;  4RDU A;  2YUS A;  4DYC A;  1ETW A;  2MGQ A;  2DMQ A;  2L7M P;  1E3O C;  1GDT A;  5FKM A;  4FTH A;  5FLV A;  1U9O A;  2LD5 A;  4HNV A;  3S2H J;  2VKV A;  2DMP A;  3GBG A;  2LKX A;  4FIS A;  4W1U A;  5DTD A;  1HDD C;  4D7M A;  2L7F P;  3JRE A;  4DZJ A;  5F0H A;  4GFB A;  4M3F A;  3HGY A;  2IEK A;  1WH5 A;  5EG0 A;  2R92 J;  1ETK A;  2HOA A;  3RZD J;  3ZQL A;  5GP9 A;  4M3G A;  3S2D J;  3S14 J;  2LK2 A;  2TCT A;  2CQX A;  4JP0 A;  1ZQ3 P;  3RKQ A;  4V2G A;  4C3J J;  3L1P A;  4IHY A;  4DZP A;  2R5Z A;  4UUT A;  3S16 J;  1CQT A;  5E3M A;  2NVT J;  1JUS A;  3A01 B;  3MN2 A;  4AYB N;  2X9D A;  2MSY A;  4AC0 A;  2MG4 A;  2DA7 A;  2DJN A;  1JKP C;  4JX6 A;  1MBH A;  3CDL A;  1F36 A;  2EZH A;  2FJ1 A;  2R93 J;  3LSG A;  2DMU A;  2KDZ A;  4A3L J;  3BR1 A;  1POG A;  2E2H J;  3GTG J;  1U9N A;  1PUF B;  2E19 A;  2VI6 A;  1P7I A;  4AUX A;  1BL0 A;  1B8I A;  2XGC A;  5K7F A;  3OIO A;  3CQZ J;  4A3G J;  1FIP A;  3BG9 A;  1ETQ A;  4XK4 A;  3LNQ A;  3IV5 A;  5J1R A;  1F43 A;  5JLX A;  4XRM A;  5IP6 A;  2GBY A;  1IRZ A;  2DN0 A;  4J19 A;  4LOC A;  5FKK A;  1MH3 A;  3F0C A;  2JWT A;  5IP7 J;  2YU9 J;  5IYD J;  3MVP A;  1ETV A;  1AKH B;  1ZTR A;  2VPR A;  4XID A;  4A3J J;  2O9L A;  1I50 J;  4G12 A;  3SDG A;  2XSD C;  2HQ5 A;  4B4C A;  2JMW A;  1LE8 B;  3BT9 A;  2VKE A;  3BTJ A;  3Q3S A;  2IBD A;  4C2M J;  4ABZ A;  5J3L A;  1VF9 A;  3QQA A;  3HOX J;  3NAR A;  3HOY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...