1JGGA

Even-skipped homeodomain complexed to at-rich dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
57
structure length
57
Chain Sequence
RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*AP*AP*TP*TP*GP*AP*AP*TP*T)-3'
publication title Structure of the even-skipped homeodomain complexed to AT-rich DNA: new perspectives on homeodomain specificity.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 19
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jggA00
3F0CA 3MVPA 1GT0C 3W6VA 1ETWA 3BTJA 5FKMA 2R5YB 3NAUA 1SFOJ 3GTOJ 2HQ5A 5IOYA 1ZGWA 3PM1A 4D7MA 4M3GA 5F1JA 5FKKA 4A3GJ 2VUMJ 3A02A 3HGYA 2CQXA 2HYJA 9ANTA 2TCTA 1B72B 2D5VA 1ETYA 3GTPJ 3S1QJ 1ETQA 3RKQA 1A5JA 4FE4A 1ITYA 3HOYJ 2GBYA 3M3YJ 2DA3A 2HXIA 2KDZA 1AHDP 1MH4A 2DJNA 2ECBA 1P7IA 2MG4A 3H3VK 2K40A 3QPSA 3GTJJ 3PO3J 1QVUA 2L7ZA 4B3AA 1F43A 3RZOJ 3M4OJ 3GTGJ 2R7ZJ 1RPWA 2NOGA 1TWAJ 3SDGA 1AKHA 1MSEC 5M3FJ 1MBEA 2LK2A 1CQTA 5E3LA 5F08A 2JA5J 2JA7J 5EF6A 5C4XJ 5J1UA 3BR0A 5IPAA 4X6AJ 1ETKA 2YU9J 3BT9A 2AHQA 1QPIA 4HNVA 1XG1A 4JX4A 4XICA 3S1NJ 3BG9A 3S1MJ 3Q0VA 2ELKA 4G12A 2E2JJ 3G1OA 1I50J 3HDDA 2XPWA 1PUFA 2VPRA 3BR6A 3DCFA 2R5ZA 3BR5A 3FISA 4DZJA 1JKQC 2COBA 2I10A 4BY7J 1HDPA 4DW6A 2HOAA 5JLWA 3BTCA 1RESA 1JT0A 2HI3A 4ABZA 2R93J 3HEFA 3B6CA 4I6ZA 3G1LA 3OSGA 1HCRA 3MN2A 5IYCJ 2JK3A 5C44J 4V2FA 2DMPA 1WI3A 2MW8A 1LE8A 2E1OA 2OPTA 5F0CA 3ZQCA 2K9SA 5DS9A 2WAQN 2ID3A 3FK7A 3L1PA 1MNMC 4JYKA 2ME6A 4A3IJ 1NK2P 1GDTA 1MSFC 5J1RA 4B1RA 3BTLA 1W0TA 5C4JJ 3HOVJ 1BW6A 2XB0X 1ORKA 1X2MA 1P7JA 5GP9A 1WCMJ 1JGGA 4AYBN 1ZK8A 2LLKA 4DYQA 4BXXJ 2M2EA 5EGOA 3LOCA 1TC3C 3ZOBA 5F0HA 3BG5A 3JREA 1FEXA 2LVSA 5K7ZA 5IP7J 4A3MJ 3LSJA 2CJJA 3PO2J 2Y30A 5J1YA 3LSPA 1H8AC 4MLOA 4Y7NJ 1T56A 4D5CA 2RAEA 1RETA 1RKWA 4FTHA 2EZLA 4FCYA 3JRAA 1B8IA 2HOTA 3JRBA 2O9LA 3A03A 2DTZA 1D5YA 1NTCA 1XS9A 2CRGA 3RZDJ 2WB1N 4UUSB 3I4NJ 1TWCJ 1UG2A 3BQYA 1XC5A 1F36A 1IJWC 2X6OA 5FLVA 4LOCA 1TWHJ 1GVDA 3TW7A 4XK4A 3RQIA 2X48A 1H88C 3DEWA 4I76A 2LFBA 3IV5A 3ZQLA 4CYCB 1BJZA 4C3HJ 1H89C 2Y0SN 3JRFA 2H8RA 3HOWJ 1BL0A 2DA5A 1U78A 4BY1J 1R9TJ 2NVTJ 5FLMJ 2DA7A 4M3FA 4MFDA 3HOZJ 4QSHA 2XPUA 3A01A 3CMYA 3D1NI 1MBKA 2W48A 2JJ7A 1POGA 2CU7A 3JRHA 3IH4A 1MBFA 2EZIA 3ZQIA 5M5WJ 1W0UA 1HLVA 3S17J 3QPLA 3O8GA 3S15J 2M8GX 3CCYA 2LKXA 5M5XJ 1EF4A 3I4MJ 2MGQA 1FTZA 1OCTC 1ENHA 5JLXA 1IV6A 1JKPC 2HDDA 3GTQJ 1TWGJ 2VI6A 3CDLA 4MO7A 1WH5A 2EH3A 4D7NA 5F04A 3UKGA 3ZQHA 3BG3A 3JRIA 1I3QJ 1DU6A 5FKLA 1OJLA 2AO9A 4XRSA 2O7OA 4XIDA 4A3FJ 4IHVA 3SFIA 3TP3A 1MBHA 2L7FP 2VKVA 2ECCA 2XSDC 5C3EJ 2P81A 1QVTA 2FX0A 3G1MA 3SJMA 5EDNA 1VNDA 1S7EA 2M34A 3S16J 3JRCA 2JA6J 2EQRA 3BR2A 4S0HB 2CUEA 3S2HJ 1ZTRA 1RR7A 4JX5A 2XGDA 1JUSA 2L9RA 2G0EA 1IUFA 1HOMA 2DMQA 3S2DJ 5IOZA 1FJLA 3HOUJ 1IDYA 2KT0A 1IDZA 3B6AA 4AC0A 1IG7A 1Z0XA 4QIWN 1SANA 3VPRA 3K2AA 3GTLJ 5EG0A 2IBDA 5F27A 1AU7A 2TRTA 1Z77A 5FKOA 2LR8A 1JUPA 1YRNA 3QQAA 1AKHB 3HKZN 1OCPA 2XPVA 3HM5A 3TW6A 3MKLA 2DA2A 2R5YA 4FISA 2NVXJ 2LTPA 5E3MA 1ZR4A 4QTRA 2JA8J 2FJ1A 2LD5A 3HB9A 1TWFJ 2JWTA 1PUFB 1B72A 1MBGA 1VI0A 5GPCA 2WV1A 2XB5A 5BNGA 2R5ZB 1ETOA 4V2GA 2LY9A 4JX6A 4W1UA 2NVQJ 3CQZJ 2GLOA 3NARA 1WH7A 5FJ8J 1JTXA 3S14J 1BA5A 1K83J 1A6IA 1Y1VJ 4L5EA 2Y9YA 3WHBA 5M3MJ 4JP0A 5M5YJ 4A3BJ 1K61A 4AUXA 1NK3P 4M3EA 3Q3SA 4C2MJ 1WPKA 3FKIJ 4DZPA 1LE8B 4MIMA 3ZQFA 2DA1A 3IH3A 2ME0A 3H0GJ 1JKRC 4A3DJ 2YUSA 5EG0B 4M3BA 3HBLA 2DA6A 1Y1WJ 2VKEA 1GV2A 5FKNA 1JTYA 5E3OA 2IAIA 4RDUA 3IH2A 2L7MP 2GM4A 4B4CA 2MSYA 4BBRJ 2Y9ZA 1IC8A 5EGOB 3LSRA 1IGNA 4IHWA 5GPAA 2ID6A 2HOSA 4GFBA 2O8KA 3WHCA 5K7FA 1GV5A 3OSFA 4C3JJ 2FD5A 3Q0UA 2ZB9A 1U9OA 4BKXA 3GTKJ 2IEKA 4XRSG 2K9QA 4RBOA 5IP6A 3O8HA 1B8IB 5EZGA 5IYBJ 3JRDA 2JN6A 1APLC 4MFEA 2CUFA 2L0KA 5E3NA 5HODA 1X2NA 2M9HA 1FIAA 2NS8A 3FIWA 3TP0A 3HGGA 3S1RJ 2QF7A 2HXOA 4A93J 2E19A 3Q0WA 4IEJA 4A3KJ 3BR3A 1ZQ3P 1FTTA 1MH3A 4M6VA 2DN0A 4BBSJ 1MBJA 1JT6A 1HF0A 4NDLA 2FQ4A 1WGXA 4M3DA 1X58A 5J3LA 1ETXA 1OFCX 2CQQA 3GBGA 3LNQA 1Q1VA 4IHYA 3GTMJ 2M0CA 4A3CJ 3A01B 2X9DA 2XGCA 2QCOA 3JR9A 3OOUA 1JJ8C 1ZR2A 3HOXJ 1U8BA 1GUUA 1ETVA 1U9NA 2DA4A 4D5FA 4A3JJ 4EEFG 4A3LJ 2E2HJ 4FE7A 1JUMA 3BTIA 1BW5A 4UUSA 3OIOA 3ZQGA 2B63J 5IP9J 1G2HA 3TEDA 2JMWA 2Y31A 4XRMA 1VF9A 4DYCA 2Y2ZA 2N8GA 3LSGA 4X1EA 2DMUA 2EZKA 4CYCA 2LP0A 1T33A 2OF7A 5EYRA 2NS7A 3K7AJ 1DU0A 4UUTA 5EZHA 5IYDJ 1HDDC 1O4XA 2XGEA 1LFUP 1E3OC 4A3EJ 4DYRA 4Y52J 1RKTA 2NVYJ 2R0QC 2DMTA 2R92J 1JJ6C 1I6HJ 3BR1A 3JRGA 1UHSA 3C2BA 1IRZA 2K9NA 1ZKGA 3BQZA 5DTDA 2E2IJ 2H1KA 2EBIA 2DMNA 1UMQA 4IHXA 4C3IJ 3E7LA 2PMZN 1FIPA 4J19A 1QRYA 5EEAA 5K7HA 1LFBA 4A69C 3FK6A 4W97A 2XRLA 1YRNB 2EZHA 5F0FA 1VFCA 1JKOC 2YS9A
chains in the Genus database with same CATH superfamily
4ZYGA 4CICA 3PSFA 3F0CA 3G4SI 3CLQA 1XCVA 4F7ZA 5J4YA 4IHTA 1GT0C 5EJCA 1W1WE 2F48A 1R7JA 2K86A 1XMKA 5IOYA 1ZGWA 4M3GA 5FKKA 4HDUA 4A3GJ 5DM7F 5E8GA 4A0YA 5ILUA 5K5RA 2P8TA 4AIJA 2VUMJ 2YX4A 4H0EA 5CVVA 3HRMA 5ICEA 2HYJA 3VSKA 4EJUA 2A61A 3GTPJ 3FXUA 2CWEA 5D5XB 2E7WA 1GXQA 3CC2I 1XCBA 2KFDA 2DA3A 1B9NA 2OJED 3P5JA 3WG7H 1AHDP 4HRIA 1MH4A 2MG4A 3H3VK 4XONA 3M8JA 3PO3J 4ZDOA 2L7ZA 2XRNA 3V8LA 4AIHA 2EILH 1F43A 1RUOA 4M73A 2CH0A 4OAYA 2KISA 2CW0F 3M4OJ 4KN4X 2NOGA 2AS5F 3FWEA 2ISZA 4PFOA 2RGVA 4CCKA 3CCVI 4G8XA 5E3LA 5F08A 2TDXA 2JZYA 3VOEA 4XBFA 4AWXB 1XB4A 4ENKA 3OYIA 1PVEA 1QPIA 1XG1A 3F23A 5IT9Z 3BZCA 1U5TC 3JTHA 3ZMVA 5CQGA 2Z16A 4KN7X 2XAUA 1Z6TA 2CFXA 2HWVA 2ZXIA 4FX4A 4G6TB 2BW3A 1R23A 1YX5A 2HPIA 4DOZA 5TJJA 4BDYA 2ZJQF 3BR5A 4DZJA 2CG4A 2V6CA 4BY7J 3R0AA 1LVKA 4UV9A 4XN3A 3U1KA 1WJCA 2DU9A 4BAYA 1JT0A 4A0ZA 3J7YJ 1T08B 3KE2A 2MA3A 4ABZA 2R93J 1RR8C 1TQIA 4I6ZA 2ZXHA 3MN2A 2HDWA 2JK3A 3ABTA 5FFXA 4CYDA 1SD4A 1LE8A 2OPTA 3EUHC 4N4NB 5LEKA 3ZQCA 1NHAA 1A35A 3L1PA 3FBIB 4NB5A 1MNMC 4JYKA 3DKWA 4A3IJ 3OL4A 3CC4I 5L3FA 2IA1A 1E2XA 1LKXA 1Z91A 2E35A 1GLNA 4PZJA 3HRTA 2R7SA 1P7JA 5LFAA 1TT5B 4UY8I 3H1CA 4AYBN 3IP4B 3FXRA 2F5VA 3S32A 1RC9A 1YS6A 3SZTA 4B43A 1LDKB 1QNTA 1YOVB 1R36A 2GA1A 1TLHB 2KJBA 3JREA 4J00A 5K7ZA 2CJJA 2Y30A 3KX2A 1FNNA 4E7JA 1SVOA 5K5OA 2ESNA 4MLOA 5B5EC 2X6YA 2OBPA 2FNAA 4Y7NJ 4B48A 2KMUA 5ED4A 1T56A 5J8FA 5K1YA 3FX3A 4I7HA 3KYCB 1RETA 1RKWA 2BZTA 2X4HA 3K70D 2QQBA 1OYIA 2IS4A 3JRAA 3ABMH 4WXHA 1B8IA 1VQKI 2HOTA 2P7CB 3JRBA 1G59A 1IF1A 3CP2A 3M7GA 1FWZA 4QLCU 2DTZA 3CCUI 5ILVA 4Q48A 4IHSA 4I2OA 1OMIA 2L9SA 4UUSB 1XSDA 2KIFA 4YRVA 5D4SA 3DPUA 3J7AO 4UB6C 5FB2A 2HVQA 1F36A 3DTEA 4L9VA 1A31A 2X6OA 5TRDA 1XN7A 1TWHJ 1GVDA 3TW7A 1I39A 2W82A 1PDNC 2BY2A 4OWRB 2QLZA 4G7OF 2LFBA 2JSCA 4C3HJ 1E17A 3L00A 2P5VA 4RB3C 1V4RA 1YE9A 4XLFA 3LFKA 5LGTA 5BQTA 2L01A 3IKTA 1R5HA 5DCMB 2VE8A 3D5LA 1MKMA 2VKHA 2XKPA 2PQ8A 2A6EF 3CLOA 4YELA 4QSHA 4JOMA 3KLOA 2L54A 2W48A 3K4LA 3VODA 4OMZA 3O2PE 2ICWG 3K0LA 2CU7A 1JGSA 3I3LA 3SEQA 1UHMA 1D8JA 2M8GX 3CCYA 1EF4A 2WAQA 2YPRA 3KZIC 1FTZA 1OCTC 1IV6A 1G3WA 2ZNZA 3DKYA 3I0TA 1TWGJ 4PFPA 4O6JA 1FC3A 2WTEA 4XLNF 2OQGA 2F4IA 2DYRH 4HW0A 2W85A 1SD6A 3OV8A 3K69A 1VQLI 5LRRA 1WJDA 2MD0A 2KQRA 4PUSA 2OAZA 1ZLKA 4IRHA 2VKVA 2G7UA 2ECCA 5C3EJ 1UFMA 2P81A 2V1XA 1ZG5A 4ANJA 2L7KA 3O6BB 3OYLA 2BHYA 3M9AA 1KU7A 2EQRA 1MJBA 1S3JA 1GVJA 4S0HB 4E7IA 3DKXA 3FBNB 1Z05A 1U5TA 4P55A 4RGXA 3T8TA 4WK8F 3ZMDA 2XGDA 1FOKA 1UHWA 1UZCA 4BH9A 4CCOA 2FBHA 1D1CA 5GAHJ 3WGHA 2DW4A 4E7KA 5E17F 2DQLA 5IOZA 1FJLA 1IO2A 4HX4A 4AC0A 1Z0XA 4BQOA 3R6SA 1MMAA 5HOOA 3HHGA 3HTUA 3UNGC 2JVHA 2TRTA 2QENA 2V9VA 1JUPA 1LQ1A 5DDGA 3L2QA 1G3YA 2E71A 3IRQA 1MGTA 3ASNH 3TW6A 1MDMA 2IGMA 2PEXA 3WTXC 4G7HF 1VQOI 5DUKA 3EUHA 3ZCOA 3F21A 1O57A 3IL2A 5LHIA 1BC7C 4NC8A 4CCNA 4CCLA 3F8MA 2L9VA 2ISYA 3PFYA 3QOEA 4MQ9F 3R61A 4OOIA 1DQUA 2BW3B 3ECOA 2M4KA 2XB5A 3TO6A 1YIJI 1YFHA 4CHUA 1Q1HA 3E5XA 4W1UA 4Y33A 2NVQJ 3CQZJ 2AXLA 3FXKA 4OIOF 1J2XA 2MLGA 1ON2A 1PJRA 2MABA 5FJ8J 3S14J 1BA5A 1HSTA 2VIXA 3WHBA 5M3MJ 2CV2A 5ICGA 1ZGAA 1FYKA 2M3AA 5EEHA 1LE8B 2QZ8A 3AG1H 5DCFA 2NXNB 2Z9OA 4RMNA 4KT5C 4EATA 1Z1DA 3FXQA 4A3DJ 1HKQA 1WHUA 2YUSA 2IPQX 3QPTA 5EG0B 4M3BA 1P92A 2GOMA 2V79A 4OINF 5IT3A 1Y1WJ 4L5JA 2CUJA 4NHJA 2KRFA 1JTYA 2ZMEC 4NUBA 3ZN1A 4RDUA 4WCGA 3GFMA 2L7MP 5HLGA 4L18B 4RAGA 4PJNA 2GXGA 3PNYA 3DF8A 4BBRJ 3WE2A 4FQGA 4AIDA 3OYHA 2EIKH 4L9JA 2ID6A 2HOSA 2O8KA 3WHCA 5K7FA 2IJLA 2K85A 1O3SA 2KRHA 3CJNA 3KIOA 3Q0UA 4PCQA 5CPRB 5LD2C 3OYCA 4XRSG 5BOXA 4BQNA 1WJ5A 1YI2I 3ERMA 3O8HA 4WF2A 1B8IB 5EZGA 3S8PA 3T0YA 2JN6A 3MQ0A 3WGGA 2Y75A 3OYEA 2VE9A 1WZ2A 2A5YB 5E1WA 4YIFA 2CUFA 3OYMA 2CQKA 3X2QH 4OIRF 3PSIA 4GGGA 3GXOA 1CF7A 3HSRA 1WSUA 4I01A 1FIAA 1WFXA 2M30A 3TP0A 4E4HA 3S1RJ 1KQ9A 2HR3A 4IEJA 3FMRA 4N0BA 3BR3A 2PJRA 3DV8A 2CW7A 2ELJA 3QP5A 2HVRA 1P4AA 1JT6A 2VQGA 2E1MB 1YX3A 3W2VA 1FBUA 4NDLA 4WX9A 4MTEA 2K3PA 1WGXA 1RUNA 1A6QA 2KP6A 4G6QA 1FBSA 1XSVA 4AVZA 1OFCX 4O3MA 1D3YA 3GBGA 2GIVA 3HPHA 4WWCA 3SHFA 1Q1VA 2DK8A 4IHYA 3GTMJ 2DOEA 1BI1A 2I5UA 2XGCA 3GZ6A 1JJ8C 3J80Z 2XAFA 4CCJA 4ASNA 1U8BA 3GX4X 2XHKA 2XSJC 1U9NA 4DIQA 4BQAA 3L2WA 1YW9A 2ZSIB 4A3JJ 3AAFA 1YTYA 4S05A 1FYMA 1E0EA 4IOCF 3TO9A 3CCJI 3ZQGA 3ZN0A 2K9LA 2NNYA 4IRIA 1G3TA 3OYGA 5IP9J 2D2WA 1G2HA 1TP4A 3HRUA 4XORA 1WJEA 3BZKA 2N8GA 4X1EA 3FMQA 5FD6A 2EPFA 3HZJA 4Q47A 4XKBA 4G94A 4CYCA 1VQ5I 1T33A 5E8IA 2CUZA 1HDDC 4ZTFA 3ECHA 1R1TA 4OMYA 1VQ9I 2GXBA 3KZZA 2R0QC 4IQ4A 4Z6YA 1FOWA 4KT6A 3WTZA 2GQQA 1ZHFA 3NWTA 2VLAA 3GVAA 1JJ6C 1U5TB 3CF2A 2CV1A 3BR1A 2VJ5A 5B1BH 1EV7A 1W5CC 1Y56A 4C9YA 1IRZA 4DBRA 5DTDA 2EBIA 1B6AA 4XMYA 3OS1A 1SFUA 2ZJRF 2O03A 3K10A 1BR2A 3ABUA 1DPRA 3D5RC 3I64A 4A2UA 2Z99A 4GDFA 3PL8A 5BS6A 1I27A 1FX7A 3HC7A 1VQMI 1SAXA 3DP7A 3KP5A 2DPDA 5F0FA 3J7ZI 1JHFA 2LF7A 1VFCA 4EVIA 3MVPA 1DDNA 2YSRA 5FLXZ 1MDMB 4FHTA 3CD6I 1PP8F 3BJOA 3NAUA 2GWRA 5FFZA 2KLOA 3ROUA 1SFOJ 2HQ5A 3R60A 5BPDA 2QVOA 1RZ4A 4D7MA 4ZDPA 4EMSA 5F1JA 5IY5H 2QSGX 4XLEA 4ENJA 3T5XA 2D1VA 3SEZA 3HGYA 3KEQA 4U88A 4KITB 1X3UA 1KQ8A 2DXIA 2DJIA 1ETQA 4Q5SF 2EV0A 4MGRA 4B8XA 4FE4A 1A5JA 4A12A 4HQEA 2RKHA 4IF4A 3TDZC 1D8KA 3OYBA 2KDZA 3CO6C 5D8LB 2DJNA 3CP8A 3QYFA 1PP7U 1P7IA 3GTJJ 3QPSA 2Q1ZB 4IKFA 2KIUA 4XN0A 4B3AA 2PBIA 4XR6A 1S8NA 1BN5A 4HX7A 4ZYHA 3HTSB 2JSPA 1RPWA 2NVUB 4MEXF 3SDGA 1AKHA 2JT1A 2UV1A 5M3FJ 3GEZA 3MWMA 1MBEA 2LK2A 3OYDA 1DP7P 3EYYA 3BR0A 1ETKA 5HVQC 3ZP5A 2V1UA 4XICA 5DD4A 3S93A 1Y8RB 1KU2A 4HX8A 4G12A 3G1OA 3HG9A 1D1AA 1O3QA 3COAC 1IZ1A 3HDDA 4P5OA 1PUFA 2OV7A 4CXFA 5CLSA 3DBRB 3S2WA 3DCFA 1M1EB 1S6LA 1XGNA 1KZHA 2BHZA 4BXFA 2H94A 1ZGJA 3BZ6A 2COBA 1BIBA 1CGPA 2FMYA 1JXSA 1JHHA 1ZRFA 2DFEA 3CC7I 2HOAA 3BTCA 4KISA 1XDUA 3W6JB 4ZZLA 4BYYA 3HEFA 2EIJH 2DTRA 2PMZA 2VOOA 2MFZA 2V1NA 3IUOA 2YU3A 1ZAOA 3K4MA 1HCRA 5C44J 3H5AA 2DMPA 1WI3A 2XDVA 2NNNA 4BACA 2GAUA 5KK1A 2V9PA 2W1OA 5F0CA 1XTAA 5ICCA 2K9SA 2F5DA 4EGZA 1V5FA 5D5UB 2ME6A 4EJTA 1GDTA 3QWLA 1MSFC 5J1RA 2VT2A 1W0TA 3K4BA 3N4MA 3PJRA 3JSOA 3OMYA 1CF7B 2FUG2 1JGGA 1LDDA 2L4MA 3DTKA 1DGWY 1FSEA 4U7DA 4BXXJ 1TC3C 3ZOBA 2L2OA 2PJRB 5F0HA 1G8XA 3A2KA 5F64A 1FEXA 5IP7J 3EYIA 3LSJA 4F93B 5J1YA 3BP8A 1EH7A 1HXDA 2BEOA 3N05A 5AIQA 2V1DA 2VJIA 2QSHX 4I09A 4D5CA 4FTHA 2V26A 3WTTC 1OCZH 1PYVA 2VJ4A 2G7HA 3SZPA 1GHCA 2DBBA 5A2QZ 3OY9A 1YS7A 3ZMZA 2WA0A 2HQAA 3A03A 4LLLA 3A0BC 1ZARA 5CQEA 1XS9A 2ELHA 2A07F 3RZDJ 1T0FA 2LRDA 2JUGA 1OCOH 1ODDA 3WTVC 1J0RA 4IL6C 3GZ5A 3WODF 1XC5A 4CUGA 3C2HA 5BPIA 1IJWC 2E36A 4RAYA 4LOCA 4OIQF 2X48A 2HQRA 2E7XA 4KICA 3DEWA 3DLLF 3ZQLA 3F8BA 1VTNC 4CYCB 1H89C 3LQQA 1YHQI 2B9SA 1MIJA 3OYAA 4FT8A 1BL0A 2Z5UA 3CJQB 3LSKA 3NQOA 1P2FA 4RB0A 2DA7A 5DEQA 4XNFA 3BWGA 2VBWA 3FHNA 3CCSI 4PSWA 3BPXA 2RREA 2XPUA 2HVSA 5H2FC 4CGZA 1S9HA 3PNVA 3P9KA 4BXUA 3G3ZA 1KU3A 2JJ7A 2P6SA 2DAOA 4XL9A 1TQPA 1Z9CA 1MBFA 2FBKA 2NOJB 2ADUA 5J40A 4FASD 5J47A 3S15J 3H3ZA 1HKSA 2BY3A 1ENHA 2HDDA 2P6TA 5HLIA 3DEEA 4HZFA 2A5WA 3P7NA 3VB2A 1U2WA 5GADJ 2AQEA 3ZQHA 3W3CA 3DFGA 1I3QJ 5CJ9A 5LGUA 5FRMA 5LHHA 3IAM2 3TQNA 4IX7A 5TGTA 2CSOA 3FMSA 3QU6A 4XRSA 5HLTA 4XIDA 4LD5A 4EM2A 3I4PA 4P9FA 2FX0A 1SVLA 3G1MA 4PJ0C 3SJMA 4HV6A 4KMFA 2M34A 3WU2C 1QO0D 2FBIA 3HJEA 3BR2A 3I5UA 1B4AA 2HYFA 1AWCA 3H35A 2WAEA 3KP2A 5GTHC 4YIIA 3G71I 1RR7A 4JX5A 4JQFA 2QGUA 5CVRA 2G0EA 1HOMA 2NRAC 3PUFA 1ON1A 3E0JB 3RPQA 1W7PB 1LNWA 2QM3A 2OTLI 2HTSA 3OYFA 1IDZA 3DTIA 1IG7A 1X1PA 3ELKA 1SANA 1K6YA 3NEUA 3VPRA 1R5GA 4LG0A 3K2AA 2F4MB 3GTLJ 5EG0A 2IBDA 1OR7C 5F27A 1Z77A 2RN7A 2LR8A 4YG2F 3KP6A 1YRNA 3OL3A 2VBXA 3QQAA 3QYEA 3RDIA 2QBYA 1AKHB 5D6EA 4UVAA 3I59A 1AA7A 1OCPA 3LL7A 4XKWA 3UR3C 3RJPA 1QHHD 1IXCA 1E3PA 2OCCH 2DA2A 2R5YA 2MH2A 2VBYA 4FISA 2EINH 2QYOA 1BOAA 2LTPA 2O3FA 3KLNA 4UV8A 4QTRA 3FM3A 1WRJA 2LD5A 1IV8A 3K1PA 4ZYAA 1BOBA 2IGNA 2UXXA 1PUFB 1R58A 1B72A 4HLXA 1QBJA 4XM3A 2STTA 2HGCA 3OWTA 3KFWX 5CKTA 2ZFUA 1ETOA 4PGHA 1Z7LA 4JX6A 4XOPA 4BEHA 1ZH5A 5DYMA 2VQCA 2STWA 3HYIA 3DBHB 1MJAA 2EFNA 1JTXA 3PFIA 2P5LC 1K83J 1R4NB 2Y9YA 1F9NA 2LG4A 1K61A 3LWFA 4AD9A 4RAZA 2DYSH 1NK3P 1I1SA 5D8KB 4C2MJ 3WTWC 1RNLA 3QODA 4R79A 4RLQA 5CVIA 4DQ2A 4EJVA 3OS2A 4XKVA 1YJ9I 3H0GJ 3AL0C 3K2ZA 1JKRC 1QHGA 1IN4A 2EA2A 2JA2A 3I53A 3M8EA 2L02A 1ULYA 1Y0UA 2KKOA 2XF6A 5FKNA 3BROA 1W7PD 1O3TA 1JE8A 4C2TA 4P9UA 2Z1DA 4Z2YA 3S3OA 2BY0A 4PDKA 4NC7A 4ZDLA 3LSRA 1IGNA 1ACIA 2O0YA 2OU2A 4N9HA 3FF5A 2EA4A 1A04A 1GV5A 3OSFA 1LB2A 4M6YA 4A5NA 4KIBA 3GTKJ 2EFPA 3C3WA 1OLTA 4B3XA 1EH8A 3J81Z 3TMOA 4M9SA 4XQFA 5AIPA 3T8RA 2ZJ2A 4M9XA 4PJJA 1QPMA 2L0KA 3KP4A 2EWNA 3HSFA 2R7XA 3VEPA 3HGGA 2QF7A 2E19A 1FTTA 1LEBA 2FOKA 4RM2A 2DPUA 2H8WA 2RC4A 4U87A 1SAUA 3I54A 3AG3H 4UNOA 2GOXB 3MEXA 5HNHA 1O3RA 2HS5A 1WJBA 1QGPA 4MHGA 3LNQA 2JRTA 2LF8A 1FMVA 2M0CA 2JTVA 4I98B 4LB6B 3JR9A 2QCOA 2WB1A 3HOXJ 2VQHA 1GUUA 3QAHA 1H9TA 1KQ0A 4HYEA 1IN5A 2FXAA 2DA4A 4R8HA 4D5FA 3VYRB 3JAMK 2QEXI 1N75A 4EEFG 2E2HJ 1TQMA 4E6KG 5E20A 1JUMA 3BTIA 3MKWB 1Z21A 4TV7A 2B63J 1IXSB 3LSTA 2QQ9A 4CZZA 1F4KA 2EJRA 2Y0SA 5L3CA 1V54H 4AU7A 3PIOF 4WXCA 4XRMA 4LIVA 1VF9A 2DOFA 3CESA 1LDJA 2EZKA 4I0BA 4E70A 2OF7A 4HQMA 4BHCA 5EYRA 4PGGA 2NS7A 1BI0A 3K7AJ 3MAJA 2CQNA 2VL8A 2F6CA 3ABLH 4MNUA 1O4XA 1J7KA 2DT5A 3BDDA 1E3OC 3I55I 3V7RA 1P9QC 1TW3A 4Y52J 2NVYJ 2W84A 3LAJA 1P4WA 4E7LA 2EV5A 3L7WA 5E1ZB 3V7SA 4F92B 1I6HJ 3C7JA 3L2UA 3A4CA 3C2BA 2K9NA 3BQZA 5D5VB 3OS0A 3H9JA 2IRFG 4L9NA 4BL0B 1HKTA 4I02A 2BOLA 4AIKA 3R4KA 1KONA 1OCRH 3H9GA 4XSZF 3L2CA 1R1VA 6PAXA 4RLFA 2AXTC 2GA2A 3Q5FA 1YO5C 4J19A 4LG0B 5EEAA 1QA6A 4A69C 2XRLA 3HOSA 1YRNB 2FU4A 2EZHA 2QBYB 3E6CC 2E5ZA 3K9TA 3DPTA 3ERED 1FLIA 3I59B 2YS9A 1TW2A 1ZRCA 2VASA 5GTIC 3JTGA 1NH3A 4BUPA 3BTJA 1W5TA 2LSOA 2ZXWH 1I5ZA 1YIOA 3ESWB 1HW1A 3FM5A 4M71A 4A0XA 4XKCA 3PM1A 1J75A 1B59A 5FROA 1XD7A 4FX0A 3A02A 3QOPA 3MZ8A 2CQXA 3AG2H 1B72B 2WY7Q 2V7FA 3S1QJ 3F3XA 4ZJZA 1EH6A 2DODA 3RKQA 3TOBA 3M3YJ 1SFXA 2GBYA 2HXIA 2KJCA 2LREA 3DXJF 4LG3A 1UCRA 4Y13A 2W00A 4L9TA 1WVRA 3HKZA 4BEHB 2K40A 2PLYA 4HV5A 5L3BA 2XF7A 1FT9A 1WWXA 3GTGJ 4LFUA 3IC7A 3U2RA 4RGRA 4NBQA 2VC1A 2DOAA 1XX5A 2JA5J 1STZA 3KEOA 2OD5A 4X6AJ 2COMA 1R6RA 1YYVA 2VQLA 3LSMA 5B1AH 3BT9A 2AHQA 2DDAA 4ESBA 4HNVA 4CH7A 4JX4A 5KNLA 4BHBA 2IVMA 4BJ5C 1VQ7I 3GTOJ 3BG9A 3S1NJ 3VYTB 3S1MJ 3Q0VA 2ELKA 1FMWA 1I50J 3HOTA 1MZBA 4HF2A 2XPWA 3SDBA 3RPUD 1ZN2A 5JR3A 3BR6A 5B66C 1HQCA 3LAPA 2LH9A 3RYPA 3ZR8X 2R5ZA 5HLHA 1JKQC 2I10A 1HDPA 3TKYA 3H9QA 2H1LA 5JLWA 1RESA 1YJWI 5HDKA 3WTUC 4E7SA 1KYWA 2DK5A 2DQRA 2HU9A 2HTJA 3B6CA 3MMYB 5D6FA 2RQQA 2JRMA 3OSGA 2QKMB 1TBXA 4HNTA 4V2FA 1YG2A 3B73A 2FRHA 2MW8A 5FO5A 4L0ZB 3REOA 3VSLA 4LB5A 3HRSA 4LK0F 1IXRC 2WAQN 2EV6A 2ID3A 2FE3A 3FK7A 1NK2P 4IRGA 3CTAA 2YR2A 3CJTB 4IZZA 1V3FA 1MMGA 1V5GA 2KZVA 3BTLA 4B1RA 5KAFC 2A69F 5C4JJ 3CCRI 3HOVJ 1T2KA 2XIGA 2NAZA 3ASOH 3K1MA 1IN8A 1N78A 2XB0X 1G3SA 1WJAA 1X2MA 4ZC3A 5GP9A 1SC7A 5IT9K 1USSA 1ZK8A 4DYQA 2BE5F 1SEUA 2M2EA 3MZHA 5EGOA 2O8XA 3CMAI 3BG5A 4ENNA 2V6EA 2G9WA 4YFNF 3PO2J 1LPQA 3IAS2 3TDUC 3D0SA 5JI6A 1OKRA 4KFCA 2KZGA 1H8AC 2HKXA 2UWMA 4HNUA 2ZO4A 3I56I 2VONA 2KPMA 1O7FA 3E6DA 1D0XA 1HW5A 1YW8A 1T98A 3RSNA 3WTSC 3M1EA 1D1BA 1FSHA 1GXPA 5B3SH 4IPAA 4L5IA 4A6EA 1KYZA 2E5NA 2XGXA 3IWFA 3P9IA 5JHUA 2OQRA 1KGSA 4HOBA 3MZYA 3G6EI 3VWBA 2WB1N 3CCMI 1MD0A 2DI3A 2VT3A 1UG2A 3A0HC 3BQYA 2XUBA 3KP3A 1UJ8A 2KIMA 3RQIA 2Q0OA 2W24A 1FOXA 1S7OA 2DCEA 1YW7A 3IV5A 1H88C 3I9V2 4PSXA 4UVCA 3BCAA 4DJAA 1BJZA 2CV0A 2Y0SN 1BI3A 3N97A 2RV8A 2DA5A 5FRNA 2NVTJ 5FLMJ 1W7PA 2ZMEA 2ETHA 2CO5A 3S3MA 1IUYA 3CUQC 3CMYA 3D1NI 1MBKA 3AKZA 2B0LA 4RB1A 3GO5A 1POGA 2IP2A 3JRHA 2BGCA 3HPGA 1FOYA 3HHHA 1K78A 3ZQIA 5M5WJ 1W0UA 3LSIA 1HLVA 3QPLA 3O8GA 3J7AY 1TNSA 2LKXA 1S72I 1J09A 1OCCH 5DD8A 2MGQA 4GO1A 3GTQJ 5JLXA 1JKPC 2X0LA 2VI6A 5ILSA 4MO7A 1WH5A 2XAGA 5GAGJ 2EH3A 2NYXA 2ZJPF 2EB7A 3UKGA 3BG3A 3JRIA 3TL4X 2CS3A 4AYBA 5JFRA 5FKLA 2FNPA 2ZC2A 1OJLA 2O7OA 5E18F 2IT0A 1Z67A 1X1BA 4IHVA 2I8DA 1MBHA 2XSDC 3DPLC 4E7ZA 1QVTA 2PX9A 1K7AA 2R7QA 3CDHA 3AFHA 1S7EA 3F6VA 4BE2A 2Y69H 1YITI 3S2HJ 2J5OA 3L09A 2B7EA 3JW4A 4HLYA 1JUSA 4LITA 1S7AA 2A6HF 2HFHA 2RNJA 3ZRGA 1R5ID 4IQJA 2IGKA 4OIPF 2PJPA 3RCOA 2KT0A 1X19A 3ZGKA 1SD5A 3B6AA 2L3DA 2HDCA 3KEYA 1AU7A 1K79A 5FKOA 2WY8Q 3HKZN 1IN7A 1O7LA 2CMPA 2F5EA 2K5CA 1FP1D 3DU6A 3ONQA 2VBZA 2RNGA 3Q9SA 4BJ6C 3LFUA 3V42A 1T8IA 4UB8C 2P7VB 2NVXJ 1ZR4A 1HW2A 2EFOA 2X6WA 1KU9A 2FJ1A 3V4GA 3O3KA 2D45A 1TWFJ 3CMMA 4Y4RA 3DQVC 2JWTA 4EM1A 4AVPA 5GPCA 3K4CA 4QWQA 2Z33A 2CGPA 5BNGA 1VQ4I 2R5ZB 3SFZA 4V2GA 1SMYF 1R00A 2LY9A 3S3NA 2D1HA 4KIFA 2XAJA 2M8EA 4RM3A 1WH7A 3BY6A 1TZLA 1LFPA 1LUJB 3U21A 3BJ6A 4F52A 4O5VA 2R7TA 4G6DA 2MD5A 4JP0A 4IXAA 2KHMA 4ITVA 3ULQB 3H5RA 1B9MA 5HNFA 2R7FA 3CZ6A 3Q3SA 3TBIA 3FKIJ 1U8RA 4GRIA 4MIMA 1ZELA 3SZGA 3VFZA 2DA1A 5HS7A 3IH3A 1J9IA 2LBFA 3EUKL 1FPQA 2ME0A 2ZNYA 1TT0A 1H0MA 2E1MC 3E1SA 3HBLA 2DA6A 1BJAA 4U0YA 2VKEA 1GV2A 3TOAA 1P6RA 4BQQA 5E3OA 2IAIA 1HSJA 4I0AA 2X6XA 3IH2A 3U9GA 1ONVA 2WADA 2GM4A 4EGYA 2MSYA 3MD2A 2Y9ZA 3PQKA 1IC8A 5EGOB 2DDBA 3R0JA 4BDZA 5E79C 3TGNA 3VDXA 4GFBA 3H0DA 1OPCA 2JPCA 5H6QA 4C3JJ 1BIAA 2LNBA 3E97A 3RI4A 1U9OA 1Y8QB 3HIFA 3GLXA 1BC8C 2A68F 3WU0A 1XSXA 4PK4A 4DNCA 2FEZA 3CUQA 3ZMUA 2FQ3A 5IYBJ 1DGRM 2YX7A 3JCUC 2Y48A 2BVLA 3K4JA 4D1QA 1QZEA 3DLAA 3NWSA 1B1BA 1R4MB 2R7WA 2KIQA 5HS9A 5JHFA 5HODA 2M9HA 3FIWA 2BV6A 4IOAF 4A93J 3Q0WA 1ZQ3P 3ZMSA 1MH3A 4M6VA 5JVGF 2K7LA 4BBSJ 1FY7A 4N4OB 1HF0A 1W36C 2M7AA 2W4SA 4M72A 1DP3A 5CVUA 3RPUA 4M3DA 1AOYA 1BM9A 2A3SA 2ZMEB 2CQQA 2M5WA 2OA4A 4OAZA 1H9GA 2ZXJA 2P4WA 2LY2A 4A3CJ 2X9DA 2E60A 4JBAA 3OOUA 4MQVA 1ZR2A 2L5QA 1MJ9A 1SD7A 1FBQA 3BLYA 1WJFA 1YLFA 4HF0A 1U6GA 3IRRA 2OC6A 1XGMA 1BI2A 2A6TA 5BMZA 2V4JC 4RA2A 3CCEI 1K78B 4A3LJ 3GCMA 4II2A 4I99C 2BY1A 3OIOA 4A5MA 1T39A 3HUGA 4EQQA 1J59A 3TEDA 2VB6A 3IHUA 2VKDA 3L2RA 2Y31A 4DYCA 3ZQQA 2IXSA 3LSGA 1X1CA 3CUOA 2BYVE 1TTYA 2HNHA 3AG4H 4NC6A 5LRSA 3CMEI 2KRCA 5EZHA 5IYDJ 2V9KA 2QQAA 4HSRA 1TL8A 1A36A 4A3EJ 5KAIC 2MH9A 1IN6A 2HYGD 1G6NA 2DMTA 2R92J 5CVJA 1IRGA 3P9CA 3PUBA 5FD5A 1UHSA 2L9NA 4F55A 1VQPI 1ZKGA 3LMMA 2H1KA 1MNDA 1FZPB 1MMSA 1LEAA 4HG2A 3RKYA 2DMNA 2E34A 1UMQA 1R71A 2RQPA 3QPHA 2JUCA 2OUMA 3EQLF 4II3A 3J80K 5HDNA 2R4GA 2PMZN 1FIPA 4M9ZA 1QRYA 5K7HA 1LFBA 2QUFA 4Y17A 3FK6A 4MEYF 4C30A 4EJWA 2J5PA 4KJZA 4CO8A 1ZREA 5EEGA 4HEA2 2K4BA 3W6VA 3EETA 2HOEA 2HEOA 1ETWA 5FKMA 2ACJA 2VPLA 5DUIA 2KL4A 2Q2EA 2LOOA 2Y0MA 3IWZA 1P4XA 2QA4I 1DUXC 3LA3A 4BE1A 2P0WA 3QP6A 4GXOA 3PIPF 3GF2A 9ANTA 3K4KA 2TCTA 4BJTA 5K5QA 3F72A 1ETYA 4Q4ZF 2D5VA 2ZBKA 1ITYA 1D0ZA 2KDOA 2W57A 3HOYJ 3KCCA 2AQFA 3BG6A 1F5TA 4OU0A 5CYVA 2ECBA 3U1DA 3T1BA 1QVUA 4U0WA 1YJNI 3RZOJ 2R7ZJ 1XDSA 2CW8A 4XLCA 1TWAJ 1MSEC 1VQ8I 1U3EM 2HQNA 3QYBA 1CQTA 3ZPLA 2JA7J 5EF6A 5C4XJ 5J1UA 5IPAA 3W2WA 2EFQA 2DT6A 2YU9J 4CA0A 4BGDA 2VOPA 1G4DA 4D0PA 2IA2A 2LBFB 1TNTA 2R5YB 4A6DA 2XASA 2IA0A 2W25A 2E2JJ 4PJMA 2R7UA 5LBQA 4GYGA 3B02A 2HZDA 5FLXK 2VPRA 4EM0B 5HS8A 1ZYRF 5KCMA 1XPXA 1RIOH 4LK1F 1J5YA 1X3ZB 2MC3A 3FISA 2IS2A 2O6GE 4Y15A 3C2GA 2O5RA 4DW6A 4ZYDA 3DU5A 4UXNA 2UXNA 1S29A 1X1AA 4BHPA 2GIZA 2HI3A 4HPQA 1WKMA 2X51A 1XMXA 1BR4A 2H6CA 2UZKA 1Z6RA 2XV4S 3G1LA 4XLPF 5IYCJ 2VC0A 2LMDA 2E1OA 3BG7A 3CUQB 1Z7UA 1Y39A 3KETA 1SMTA 5DS9A 5FGMA 2PMHA 2XF5A 1RRJA 3BC8A 1OR7A 3OR2C 4CDGA 1SFEA 3KZYA 5D4RA 2BBYA 1BW6A 1HA8A 2M1BA 5H6RA 1ORKA 2BXYA 3LA2A 2WWYA 1WCMJ 2XAHA 3FXOA 2LLKA 2LYCA 1N25A 1KA8A 3LOCA 2L4AA 1Y0NA 2M87A 4BNCA 2LKSA 2LVSA 3GZNB 2DLLA 2QQ8A 4A3MJ 2MC4A 2JVGA 3A1YA 1D0YA 5HDGA 3F6OA 2EK5A 2LKPA 3LSPA 4B47A 1OYWA 4XSXF 4KNYA 4RB2C 1R49A 3V8KA 2RAEA 3I71A 3K70C 2M7BA 4V19K 2EZLA 1I6XA 4FCYA 1I3AA 5LGNA 2O61A 1C0WA 4G9YA 3GYHX 2CQ7A 1V5EA 3GLLA 2O9LA 3WG9A 1VQ6I 1QQIA 2DFIA 2PN6A 1D5YA 1NTCA 2K9MA 3DEUA 3EPZA 4XRFA 2CRGA 2H6BA 1ERDA 2A05A 3HUGB 3ZMTA 2M0MA 3W6KB 3I4NJ 3L9FA 1PUEE 1TWCJ 2DO7A 2Z3YA 2DFFA 2H09A 5KHDA 4X0GA 2IW5A 5FLVA 2M4GA 4XK4A 3VYUB 1YQAA 3GWZA 4Y3OA 4I76A 2ZFWA 1BR1A 3GUDA 2QKLB 5F6FA 3E3VA 2XROA 1QZZA 3M1CA 3JRFA 2H8RA 3HOWJ 1Z3XA 1U78A 4BY1J 2GZWA 1R9TJ 1MW7A 2PI0A 3MKZA 1W5SA 2VN2A 4M3FA 4MFDA 4ZTJA 2XKOA 2ZSHB 3HOZJ 3FXMA 3A01A 2CFOA 2X1DA 3V8JA 4DBQA 4ZZDA 5F1RA 2E1NA 2K4JA 3NRVA 3IH4A 3IKVA 1SFKA 2EZIA 3BCBA 1WQ2A 3S17J 5LHGA 3LA7A 2FSWA 1Y6IA 4F91B 5M5XJ 1IW7F 3I4MJ 1K4SA 1E3HA 1QZYA 2RDPA 2P5KA 5A2QK 3RKWA 5L3DA 3CDLA 1LJ9A 2DFHA 1QU3A 5J4VA 4D7NA 5F04A 4UVBA 2EFWA 1NG7A 1U0JA 3FXJA 2F5FA 1OQYA 2R7VA 1DU6A 5L3EA 2AO9A 4A3FJ 2M45A 5ICFA 3D5SC 1OISA 5LEJA 3GFIA 3KPHA 3SFIA 1FP2A 2L7FP 2PG4A 3LQRA 3TP3A 1L0OC 4NNJA 1JI8A 5EDNA 1VNDA 4P96A 3JRCA 1USTA 4HF1A 2QSFX 2JA6J 3S16J 1HC8A 4KA4A 2Q2EB 2CUEA 2ESHA 4IJAA 3OOPA 4LLNA 1ZTRA 4HBLA 3H5NA 3L2VA 2R7RA 4ZYEA 2L9RA 3BJAA 3M07A 4GYIA 1IUFA 3GW2A 3CO7C 4NQWA 5DM6F 1IAWA 3H3UA 2PFBA 2DMQA 3ISPA 2VXDA 4L0YB 3S2DJ 3HOUJ 1IDYA 3RYRA 5H20A 3G73A 5J8CA 1ZG3A 2X1EA 4QIWN 3GFLA 4YFXF 3SYTA 2MLKA 3PQJA 1L3LA 1W4MA 3E5QA 4YFKF 3F22A 2XPVA 5GAEJ 2JQ7A 2X1CA 3HM5A 1DPUA 2X85A 3MKLA 4YEJA 4U7BA 4CZCA 2FA5A 3DBLB 1VQNI 2F2EA 3BOQA 3E6BA 3MCZA 4ETSA 3G2BA 5E3MA 4S04A 3LSHA 3CF5F 4U0VA 5AONA 2JA8J 4CSWA 2R3SA 3HB9A 1I1GA 5TISC 2OTJI 4RGSA 2K3FA 4B09A 1EKEA 1XGOA 4LIUA 1MBGA 1VI0A 4DGWB 4UHTA 2WV1A 1IRFA 3TO7A 3OIQA 4LJZF 2NS0A 3QRFF 3E6MA 2GLOA 3NARA 4QPQA 2W7NA 1A6IA 1Y1VJ 1T95A 4L5EA 2XC7A 4EV0A 5M5YJ 4A3BJ 1ZLJA 1T0FC 4F3QA 4AUXA 3HSEA 4M3EA 2R7OA 3ZQ7A 4RS8A 3ZXSA 2C6YA 1EJ9A 1WPKA 3SXYA 4DZPA 3FZVA 2PMUA 5JVTA 3ZQFA 3CDIA 2QWWA 3KYLA 1MNEA 2FOWA 3JSPA 2ZKZA 3QU3A 4N9IA 4LLGF 1N77A 4XOTA 1IRXA 4XLAA 3WGIA 4EJOA 4KIGA 2XVCA 4B44A 2H27A 2VODA 3K6GA 4B4CA 2MBFA 2OZUA 2F4OB 2VXZA 4IHWA 1LVAA 5GPAA 2K27A 4KMUX 1XGSA 1HBXG 2BVMA 4J01A 3RIRA 1F1ZA 3OYNA 2R7DA 3SQNA 3CJRB 2FD5A 4RGUA 2ZB9A 3JAMZ 4BKXA 3ABKH 1NG6A 2HKOA 2IEKA 4LMYA 4PJLA 2K9QA 2WBMA 3VYSB 4RBOA 4M6XA 3GFJA 5IP6A 3RQ4A 4ESJA 2HZTA 1REPC 1VZ0A 3JRDA 3HXLA 2HPMA 4M74A 1APLC 1X4OA 4MFEA 4AM3A 2WV0A 3V7CA 5E1XA 4WXDA 3GMEA 4BE0A 3FDYA 5E3NA 1X2NA 4BS9A 4D9JA 3F8CA 1R22A 1S5LC 1V55H 2NS8A 4IO9F 4FETA 1MMNA 4HAMA 3ML6A 4JK1X 4H4KC 1T38A 3FHZA 3KYDB 2WAFA 2HXOA 4A3KJ 2BXZA 3I58A 2Q8KA 2WC2A 4GCVA 2DN0A 3OIPA 1MBJA 3K1NA 3AL0B 1W36D 2FMLA 4IVNA 5L3GA 2FQ4A 2Z2SB 4K2EA 1R1UA 4P1WA 3MKYB 3WU1B 3Q9VA 3EDPA 3CCQI 2RVCA 1X58A 5J3LA 1ETXA 2UUZA 1MMDA 1K6OA 1X1DA 2OCEA 3H36A 3K4NA 4BU2A 2VJJA 2K02A 3A01B 3OR1C 1ZRDA 4E7HA 1ETVA 3W2AA 2ZCWA 2FF4A 2IGOA 4KUMA 4FE7A 1OYYA 3M8FA 1UG0A 5LLQA 2F5CA 1BW5A 4UUSA 2XAQA 1BBYA 2MYSA 3J81K 3BPVA 5DV5A 3F9KA 2JMWA 4ZH4F 4MTDA 4XLHA 4UUVA 4CCMA 2Y2ZA 2IS6A 1T6SA 2CYYA 3F8NA 2DMUA 4RAFA 2LP0A 5J6XA 3WTYC 4R1HA 2EIMH 3FKJA 2LC2A 1DU0A 4UUTA 1UB9A 4QPOA 2XGEA 3F8FA 1LFUP 5DCMA 3EUAA 3H92A 1WI9A 1SVMA 1UAAA 1UELB 4DYRA 4G7ZF 3OYKA 1RKTA 4C2UA 4KYWA 3KP7A 4ESFA 1D5VA 5ERIA 3PNTA 4HA8A 4HSTA 3E5UA 3C1DA 3JRGA 3RTRA 2E2IJ 3WE3A 4ENMA 4ON0A 2DT7B 4NQWB 1RI7A 1X4PA 1ZG1A 4KDPA 4IHXA 3RKXA 3OYJA 2JPBA 2LY1A 4C3IJ 3DWLE 4HDVA 5KVRA 3HL2A 1X3WB 3E7LA 1FYLA 2GXAA 2OZ6A 2E1CA 3C18A 1EA3A 2IS1A 3MFKA 5D5WB 3FXLA 2LDUA 4LGWA 3CCLI 1XMAA 1Z3YA 4W97A 4YIRX 1K4TA 1JKOC
chains in the Genus database with same CATH topology
3F0CA 3MVPA 1GT0C 3W6VA 1ETWA 3BTJA 5FKMA 2R5YB 3NAUA 1SFOJ 3GTOJ 2HQ5A 5IOYA 1ZGWA 3PM1A 4D7MA 4M3GA 5F1JA 5FKKA 4A3GJ 2VUMJ 3A02A 3HGYA 2CQXA 2HYJA 9ANTA 2TCTA 1B72B 2D5VA 1ETYA 3GTPJ 3S1QJ 1ETQA 3RKQA 1A5JA 4FE4A 1ITYA 3HOYJ 2GBYA 3M3YJ 2DA3A 2HXIA 2KDZA 1AHDP 1MH4A 2DJNA 2ECBA 1P7IA 2MG4A 3H3VK 2K40A 3QPSA 3GTJJ 3PO3J 1QVUA 2L7ZA 4B3AA 1F43A 3RZOJ 3M4OJ 3GTGJ 2R7ZJ 1RPWA 2NOGA 1TWAJ 3SDGA 1AKHA 1MSEC 5M3FJ 1MBEA 2LK2A 1CQTA 5E3LA 5F08A 2JA5J 2JA7J 5EF6A 5C4XJ 5J1UA 3BR0A 5IPAA 4X6AJ 1ETKA 2YU9J 3BT9A 2AHQA 1QPIA 4HNVA 1XG1A 4JX4A 4XICA 3S1NJ 3BG9A 3S1MJ 3Q0VA 2ELKA 4G12A 2E2JJ 3G1OA 1I50J 3HDDA 2XPWA 1PUFA 2VPRA 3BR6A 3DCFA 2R5ZA 3BR5A 3FISA 4DZJA 1JKQC 2COBA 2I10A 4BY7J 1HDPA 4DW6A 2HOAA 5JLWA 3BTCA 1RESA 1JT0A 2HI3A 4ABZA 2R93J 3HEFA 3B6CA 4I6ZA 3G1LA 3OSGA 1HCRA 3MN2A 5IYCJ 2JK3A 5C44J 4V2FA 2DMPA 1WI3A 2MW8A 1LE8A 2E1OA 2OPTA 5F0CA 3ZQCA 2K9SA 5DS9A 2WAQN 2ID3A 3FK7A 3L1PA 1MNMC 4JYKA 2ME6A 4A3IJ 1NK2P 1GDTA 1MSFC 5J1RA 4B1RA 3BTLA 1W0TA 5C4JJ 3HOVJ 1BW6A 2XB0X 1ORKA 1X2MA 1P7JA 5GP9A 1WCMJ 1JGGA 4AYBN 1ZK8A 2LLKA 4DYQA 4BXXJ 2M2EA 5EGOA 3LOCA 1TC3C 3ZOBA 5F0HA 3BG5A 3JREA 1FEXA 2LVSA 5K7ZA 5IP7J 4A3MJ 3LSJA 2CJJA 3PO2J 2Y30A 5J1YA 3LSPA 1H8AC 4MLOA 4Y7NJ 1T56A 4D5CA 2RAEA 1RETA 1RKWA 4FTHA 2EZLA 4FCYA 3JRAA 1B8IA 2HOTA 3JRBA 2O9LA 3A03A 2DTZA 1D5YA 1NTCA 1XS9A 2CRGA 3RZDJ 2WB1N 4UUSB 3I4NJ 1TWCJ 1UG2A 3BQYA 1XC5A 1F36A 1IJWC 2X6OA 5FLVA 4LOCA 1TWHJ 1GVDA 3TW7A 4XK4A 3RQIA 2X48A 1H88C 3DEWA 4I76A 2LFBA 3IV5A 3ZQLA 4CYCB 1BJZA 4C3HJ 1H89C 2Y0SN 3JRFA 2H8RA 3HOWJ 1BL0A 2DA5A 1U78A 4BY1J 1R9TJ 2NVTJ 5FLMJ 2DA7A 4M3FA 4MFDA 3HOZJ 4QSHA 2XPUA 3A01A 3CMYA 3D1NI 1MBKA 2W48A 2JJ7A 1POGA 2CU7A 3JRHA 3IH4A 1MBFA 2EZIA 3ZQIA 5M5WJ 1W0UA 1HLVA 3S17J 3QPLA 3O8GA 3S15J 2M8GX 3CCYA 2LKXA 5M5XJ 1EF4A 3I4MJ 2MGQA 1FTZA 1OCTC 1ENHA 5JLXA 1IV6A 1JKPC 2HDDA 3GTQJ 1TWGJ 2VI6A 3CDLA 4MO7A 1WH5A 2EH3A 4D7NA 5F04A 3UKGA 3ZQHA 3BG3A 3JRIA 1I3QJ 1DU6A 5FKLA 1OJLA 2AO9A 4XRSA 2O7OA 4XIDA 4A3FJ 4IHVA 3SFIA 3TP3A 1MBHA 2L7FP 2VKVA 2ECCA 2XSDC 5C3EJ 2P81A 1QVTA 2FX0A 3G1MA 3SJMA 5EDNA 1VNDA 1S7EA 2M34A 3S16J 3JRCA 2JA6J 2EQRA 3BR2A 4S0HB 2CUEA 3S2HJ 1ZTRA 1RR7A 4JX5A 2XGDA 1JUSA 2L9RA 2G0EA 1IUFA 1HOMA 2DMQA 3S2DJ 5IOZA 1FJLA 3HOUJ 1IDYA 2KT0A 1IDZA 3B6AA 4AC0A 1IG7A 1Z0XA 4QIWN 1SANA 3VPRA 3K2AA 3GTLJ 5EG0A 2IBDA 5F27A 1AU7A 2TRTA 1Z77A 5FKOA 2LR8A 1JUPA 1YRNA 3QQAA 1AKHB 3HKZN 1OCPA 2XPVA 3HM5A 3TW6A 3MKLA 2DA2A 2R5YA 4FISA 2NVXJ 2LTPA 5E3MA 1ZR4A 4QTRA 2JA8J 2FJ1A 2LD5A 3HB9A 1TWFJ 2JWTA 1PUFB 1B72A 1MBGA 1VI0A 5GPCA 2WV1A 2XB5A 5BNGA 2R5ZB 1ETOA 4V2GA 2LY9A 4JX6A 4W1UA 2NVQJ 3CQZJ 2GLOA 3NARA 1WH7A 5FJ8J 1JTXA 3S14J 1BA5A 1K83J 1A6IA 1Y1VJ 4L5EA 2Y9YA 3WHBA 5M3MJ 4JP0A 5M5YJ 4A3BJ 1K61A 4AUXA 1NK3P 4M3EA 3Q3SA 4C2MJ 1WPKA 3FKIJ 4DZPA 1LE8B 4MIMA 3ZQFA 2DA1A 3IH3A 2ME0A 3H0GJ 1JKRC 4A3DJ 2YUSA 5EG0B 4M3BA 3HBLA 2DA6A 1Y1WJ 2VKEA 1GV2A 5FKNA 1JTYA 5E3OA 2IAIA 4RDUA 3IH2A 2L7MP 2GM4A 4B4CA 2MSYA 4BBRJ 2Y9ZA 1IC8A 5EGOB 3LSRA 1IGNA 4IHWA 5GPAA 2ID6A 2HOSA 4GFBA 2O8KA 3WHCA 5K7FA 1GV5A 3OSFA 4C3JJ 2FD5A 3Q0UA 2ZB9A 1U9OA 4BKXA 3GTKJ 2IEKA 4XRSG 2K9QA 4RBOA 5IP6A 3O8HA 1B8IB 5EZGA 5IYBJ 3JRDA 2JN6A 1APLC 4MFEA 2CUFA 2L0KA 5E3NA 5HODA 1X2NA 2M9HA 1FIAA 2NS8A 3FIWA 3TP0A 3HGGA 3S1RJ 2QF7A 2HXOA 4A93J 2E19A 3Q0WA 4IEJA 4A3KJ 3BR3A 1ZQ3P 1FTTA 1MH3A 4M6VA 2DN0A 4BBSJ 1MBJA 1JT6A 1HF0A 4NDLA 2FQ4A 1WGXA 4M3DA 1X58A 5J3LA 1ETXA 1OFCX 2CQQA 3GBGA 3LNQA 1Q1VA 4IHYA 3GTMJ 2M0CA 4A3CJ 3A01B 2X9DA 2XGCA 2QCOA 3JR9A 3OOUA 1JJ8C 1ZR2A 3HOXJ 1U8BA 1GUUA 1ETVA 1U9NA 2DA4A 4D5FA 4A3JJ 4EEFG 4A3LJ 2E2HJ 4FE7A 1JUMA 3BTIA 1BW5A 4UUSA 3OIOA 3ZQGA 2B63J 5IP9J 1G2HA 3TEDA 2JMWA 2Y31A 4XRMA 1VF9A 4DYCA 2Y2ZA 2N8GA 3LSGA 4X1EA 2DMUA 2EZKA 4CYCA 2LP0A 1T33A 2OF7A 5EYRA 2NS7A 3K7AJ 1DU0A 4UUTA 5EZHA 5IYDJ 1HDDC 1O4XA 2XGEA 1LFUP 1E3OC 4A3EJ 4DYRA 4Y52J 1RKTA 2NVYJ 2R0QC 2DMTA 2R92J 1JJ6C 1I6HJ 3BR1A 3JRGA 1UHSA 3C2BA 1IRZA 2K9NA 1ZKGA 3BQZA 5DTDA 2E2IJ 2H1KA 2EBIA 2DMNA 1UMQA 4IHXA 4C3IJ 3E7LA 2PMZN 1FIPA 4J19A 1QRYA 5EEAA 5K7HA 1LFBA 4A69C 3FK6A 4W97A 2XRLA 1YRNB 2EZHA 5F0FA 1VFCA 1JKOC 2YS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0C A;  3MVP A;  1GT0 C;  3W6V A;  1ETW A;  3BTJ A;  5FKM A;  2R5Y B;  3NAU A;  1SFO J;  3GTO J;  2HQ5 A;  5IOY A;  1ZGW A;  3PM1 A;  4D7M A;  4M3G A;  5F1J A;  5FKK A;  4A3G J;  2VUM J;  3A02 A;  3HGY A;  2CQX A;  2HYJ A;  9ANT A;  2TCT A;  1B72 B;  2D5V A;  1ETY A;  3GTP J;  3S1Q J;  1ETQ A;  3RKQ A;  1A5J A;  4FE4 A;  1ITY A;  3HOY J;  2GBY A;  3M3Y J;  2DA3 A;  2HXI A;  2KDZ A;  1AHD P;  1MH4 A;  2DJN A;  2ECB A;  1P7I A;  2MG4 A;  3H3V K;  2K40 A;  3QPS A;  3GTJ J;  3PO3 J;  1QVU A;  2L7Z A;  4B3A A;  1F43 A;  3RZO J;  3M4O J;  3GTG J;  2R7Z J;  1RPW A;  2NOG A;  1TWA J;  3SDG A;  1AKH A;  1MSE C;  5M3F J;  1MBE A;  2LK2 A;  1CQT A;  5E3L A;  5F08 A;  2JA5 J;  2JA7 J;  5EF6 A;  5C4X J;  5J1U A;  3BR0 A;  5IPA A;  4X6A J;  1ETK A;  2YU9 J;  3BT9 A;  2AHQ A;  1QPI A;  4HNV A;  1XG1 A;  4JX4 A;  4XIC A;  3S1N J;  3BG9 A;  3S1M J;  3Q0V A;  2ELK A;  4G12 A;  2E2J J;  3G1O A;  1I50 J;  3HDD A;  2XPW A;  1PUF A;  2VPR A;  3BR6 A;  3DCF A;  2R5Z A;  3BR5 A;  3FIS A;  4DZJ A;  1JKQ C;  2COB A;  2I10 A;  4BY7 J;  1HDP A;  4DW6 A;  2HOA A;  5JLW A;  3BTC A;  1RES A;  1JT0 A;  2HI3 A;  4ABZ A;  2R93 J;  3HEF A;  3B6C A;  4I6Z A;  3G1L A;  3OSG A;  1HCR A;  3MN2 A;  5IYC J;  2JK3 A;  5C44 J;  4V2F A;  2DMP A;  1WI3 A;  2MW8 A;  1LE8 A;  2E1O A;  2OPT A;  5F0C A;  3ZQC A;  2K9S A;  5DS9 A;  2WAQ N;  2ID3 A;  3FK7 A;  3L1P A;  1MNM C;  4JYK A;  2ME6 A;  4A3I J;  1NK2 P;  1GDT A;  1MSF C;  5J1R A;  4B1R A;  3BTL A;  1W0T A;  5C4J J;  3HOV J;  1BW6 A;  2XB0 X;  1ORK A;  1X2M A;  1P7J A;  5GP9 A;  1WCM J;  1JGG A;  4AYB N;  1ZK8 A;  2LLK A;  4DYQ A;  4BXX J;  2M2E A;  5EGO A;  3LOC A;  1TC3 C;  3ZOB A;  5F0H A;  3BG5 A;  3JRE A;  1FEX A;  2LVS A;  5K7Z A;  5IP7 J;  4A3M J;  3LSJ A;  2CJJ A;  3PO2 J;  2Y30 A;  5J1Y A;  3LSP A;  1H8A C;  4MLO A;  4Y7N J;  1T56 A;  4D5C A;  2RAE A;  1RET A;  1RKW A;  4FTH A;  2EZL A;  4FCY A;  3JRA A;  1B8I A;  2HOT A;  3JRB A;  2O9L A;  3A03 A;  2DTZ A;  1D5Y A;  1NTC A;  1XS9 A;  2CRG A;  3RZD J;  2WB1 N;  4UUS B;  3I4N J;  1TWC J;  1UG2 A;  3BQY A;  1XC5 A;  1F36 A;  1IJW C;  2X6O A;  5FLV A;  4LOC A;  1TWH J;  1GVD A;  3TW7 A;  4XK4 A;  3RQI A;  2X48 A;  1H88 C;  3DEW A;  4I76 A;  2LFB A;  3IV5 A;  3ZQL A;  4CYC B;  1BJZ A;  4C3H J;  1H89 C;  2Y0S N;  3JRF A;  2H8R A;  3HOW J;  1BL0 A;  2DA5 A;  1U78 A;  4BY1 J;  1R9T J;  2NVT J;  5FLM J;  2DA7 A;  4M3F A;  4MFD A;  3HOZ J;  4QSH A;  2XPU A;  3A01 A;  3CMY A;  3D1N I;  1MBK A;  2W48 A;  2JJ7 A;  1POG A;  2CU7 A;  3JRH A;  3IH4 A;  1MBF A;  2EZI A;  3ZQI A;  5M5W J;  1W0U A;  1HLV A;  3S17 J;  3QPL A;  3O8G A;  3S15 J;  2M8G X;  3CCY A;  2LKX A;  5M5X J;  1EF4 A;  3I4M J;  2MGQ A;  1FTZ A;  1OCT C;  1ENH A;  5JLX A;  1IV6 A;  1JKP C;  2HDD A;  3GTQ J;  1TWG J;  2VI6 A;  3CDL A;  4MO7 A;  1WH5 A;  2EH3 A;  4D7N A;  5F04 A;  3UKG A;  3ZQH A;  3BG3 A;  3JRI A;  1I3Q J;  1DU6 A;  5FKL A;  1OJL A;  2AO9 A;  4XRS A;  2O7O A;  4XID A;  4A3F J;  4IHV A;  3SFI A;  3TP3 A;  1MBH A;  2L7F P;  2VKV A;  2ECC A;  2XSD C;  5C3E J;  2P81 A;  1QVT A;  2FX0 A;  3G1M A;  3SJM A;  5EDN A;  1VND A;  1S7E A;  2M34 A;  3S16 J;  3JRC A;  2JA6 J;  2EQR A;  3BR2 A;  4S0H B;  2CUE A;  3S2H J;  1ZTR A;  1RR7 A;  4JX5 A;  2XGD A;  1JUS A;  2L9R A;  2G0E A;  1IUF A;  1HOM A;  2DMQ A;  3S2D J;  5IOZ A;  1FJL A;  3HOU J;  1IDY A;  2KT0 A;  1IDZ A;  3B6A A;  4AC0 A;  1IG7 A;  1Z0X A;  4QIW N;  1SAN A;  3VPR A;  3K2A A;  3GTL J;  5EG0 A;  2IBD A;  5F27 A;  1AU7 A;  2TRT A;  1Z77 A;  5FKO A;  2LR8 A;  1JUP A;  1YRN A;  3QQA A;  1AKH B;  3HKZ N;  1OCP A;  2XPV A;  3HM5 A;  3TW6 A;  3MKL A;  2DA2 A;  2R5Y A;  4FIS A;  2NVX J;  2LTP A;  5E3M A;  1ZR4 A;  4QTR A;  2JA8 J;  2FJ1 A;  2LD5 A;  3HB9 A;  1TWF J;  2JWT A;  1PUF B;  1B72 A;  1MBG A;  1VI0 A;  5GPC A;  2WV1 A;  2XB5 A;  5BNG A;  2R5Z B;  1ETO A;  4V2G A;  2LY9 A;  4JX6 A;  4W1U A;  2NVQ J;  3CQZ J;  2GLO A;  3NAR A;  1WH7 A;  5FJ8 J;  1JTX A;  3S14 J;  1BA5 A;  1K83 J;  1A6I A;  1Y1V J;  4L5E A;  2Y9Y A;  3WHB A;  5M3M J;  4JP0 A;  5M5Y J;  4A3B J;  1K61 A;  4AUX A;  1NK3 P;  4M3E A;  3Q3S A;  4C2M J;  1WPK A;  3FKI J;  4DZP A;  1LE8 B;  4MIM A;  3ZQF A;  2DA1 A;  3IH3 A;  2ME0 A;  3H0G J;  1JKR C;  4A3D J;  2YUS A;  5EG0 B;  4M3B A;  3HBL A;  2DA6 A;  1Y1W J;  2VKE A;  1GV2 A;  5FKN A;  1JTY A;  5E3O A;  2IAI A;  4RDU A;  3IH2 A;  2L7M P;  2GM4 A;  4B4C A;  2MSY A;  4BBR J;  2Y9Z A;  1IC8 A;  5EGO B;  3LSR A;  1IGN A;  4IHW A;  5GPA A;  2ID6 A;  2HOS A;  4GFB A;  2O8K A;  3WHC A;  5K7F A;  1GV5 A;  3OSF A;  4C3J J;  2FD5 A;  3Q0U A;  2ZB9 A;  1U9O A;  4BKX A;  3GTK J;  2IEK A;  4XRS G;  2K9Q A;  4RBO A;  5IP6 A;  3O8H A;  1B8I B;  5EZG A;  5IYB J;  3JRD A;  2JN6 A;  1APL C;  4MFE A;  2CUF A;  2L0K A;  5E3N A;  5HOD A;  1X2N A;  2M9H A;  1FIA A;  2NS8 A;  3FIW A;  3TP0 A;  3HGG A;  3S1R J;  2QF7 A;  2HXO A;  4A93 J;  2E19 A;  3Q0W A;  4IEJ A;  4A3K J;  3BR3 A;  1ZQ3 P;  1FTT A;  1MH3 A;  4M6V A;  2DN0 A;  4BBS J;  1MBJ A;  1JT6 A;  1HF0 A;  4NDL A;  2FQ4 A;  1WGX A;  4M3D A;  1X58 A;  5J3L A;  1ETX A;  1OFC X;  2CQQ A;  3GBG A;  3LNQ A;  1Q1V A;  4IHY A;  3GTM J;  2M0C A;  4A3C J;  3A01 B;  2X9D A;  2XGC A;  2QCO A;  3JR9 A;  3OOU A;  1JJ8 C;  1ZR2 A;  3HOX J;  1U8B A;  1GUU A;  1ETV A;  1U9N A;  2DA4 A;  4D5F A;  4A3J J;  4EEF G;  4A3L J;  2E2H J;  4FE7 A;  1JUM A;  3BTI A;  1BW5 A;  4UUS A;  3OIO A;  3ZQG A;  2B63 J;  5IP9 J;  1G2H A;  3TED A;  2JMW A;  2Y31 A;  4XRM A;  1VF9 A;  4DYC A;  2Y2Z A;  2N8G A;  3LSG A;  4X1E A;  2DMU A;  2EZK A;  4CYC A;  2LP0 A;  1T33 A;  2OF7 A;  5EYR A;  2NS7 A;  3K7A J;  1DU0 A;  4UUT A;  5EZH A;  5IYD J;  1HDD C;  1O4X A;  2XGE A;  1LFU P;  1E3O C;  4A3E J;  4DYR A;  4Y52 J;  1RKT A;  2NVY J;  2R0Q C;  2DMT A;  2R92 J;  1JJ6 C;  1I6H J;  3BR1 A;  3JRG A;  1UHS A;  3C2B A;  1IRZ A;  2K9N A;  1ZKG A;  3BQZ A;  5DTD A;  2E2I J;  2H1K A;  2EBI A;  2DMN A;  1UMQ A;  4IHX A;  4C3I J;  3E7L A;  2PMZ N;  1FIP A;  4J19 A;  1QRY A;  5EEA A;  5K7H A;  1LFB A;  4A69 C;  3FK6 A;  4W97 A;  2XRL A;  1YRN B;  2EZH A;  5F0F A;  1VFC A;  1JKO C;  2YS9 A; 
#chains in the Genus database with same CATH topology
 4ZYG A;  4CIC A;  3PSF A;  3F0C A;  3G4S I;  3CLQ A;  1XCV A;  4F7Z A;  5J4Y A;  4IHT A;  1GT0 C;  5EJC A;  1W1W E;  2F48 A;  1R7J A;  2K86 A;  1XMK A;  5IOY A;  1ZGW A;  4M3G A;  5FKK A;  4HDU A;  4A3G J;  5DM7 F;  5E8G A;  4A0Y A;  5ILU A;  5K5R A;  2P8T A;  4AIJ A;  2VUM J;  2YX4 A;  4H0E A;  5CVV A;  3HRM A;  5ICE A;  2HYJ A;  3VSK A;  4EJU A;  2A61 A;  3GTP J;  3FXU A;  2CWE A;  5D5X B;  2E7W A;  1GXQ A;  3CC2 I;  1XCB A;  2KFD A;  2DA3 A;  1B9N A;  2OJE D;  3P5J A;  3WG7 H;  1AHD P;  4HRI A;  1MH4 A;  2MG4 A;  3H3V K;  4XON A;  3M8J A;  3PO3 J;  4ZDO A;  2L7Z A;  2XRN A;  3V8L A;  4AIH A;  2EIL H;  1F43 A;  1RUO A;  4M73 A;  2CH0 A;  4OAY A;  2KIS A;  2CW0 F;  3M4O J;  4KN4 X;  2NOG A;  2AS5 F;  3FWE A;  2ISZ A;  4PFO A;  2RGV A;  4CCK A;  3CCV I;  4G8X A;  5E3L A;  5F08 A;  2TDX A;  2JZY A;  3VOE A;  4XBF A;  4AWX B;  1XB4 A;  4ENK A;  3OYI A;  1PVE A;  1QPI A;  1XG1 A;  3F23 A;  5IT9 Z;  3BZC A;  1U5T C;  3JTH A;  3ZMV A;  5CQG A;  2Z16 A;  4KN7 X;  2XAU A;  1Z6T A;  2CFX A;  2HWV A;  2ZXI A;  4FX4 A;  4G6T B;  2BW3 A;  1R23 A;  1YX5 A;  2HPI A;  4DOZ A;  5TJJ A;  4BDY A;  2ZJQ F;  3BR5 A;  4DZJ A;  2CG4 A;  2V6C A;  4BY7 J;  3R0A A;  1LVK A;  4UV9 A;  4XN3 A;  3U1K A;  1WJC A;  2DU9 A;  4BAY A;  1JT0 A;  4A0Z A;  3J7Y J;  1T08 B;  3KE2 A;  2MA3 A;  4ABZ A;  2R93 J;  1RR8 C;  1TQI A;  4I6Z A;  2ZXH A;  3MN2 A;  2HDW A;  2JK3 A;  3ABT A;  5FFX A;  4CYD A;  1SD4 A;  1LE8 A;  2OPT A;  3EUH C;  4N4N B;  5LEK A;  3ZQC A;  1NHA A;  1A35 A;  3L1P A;  3FBI B;  4NB5 A;  1MNM C;  4JYK A;  3DKW A;  4A3I J;  3OL4 A;  3CC4 I;  5L3F A;  2IA1 A;  1E2X A;  1LKX A;  1Z91 A;  2E35 A;  1GLN A;  4PZJ A;  3HRT A;  2R7S A;  1P7J A;  5LFA A;  1TT5 B;  4UY8 I;  3H1C A;  4AYB N;  3IP4 B;  3FXR A;  2F5V A;  3S32 A;  1RC9 A;  1YS6 A;  3SZT A;  4B43 A;  1LDK B;  1QNT A;  1YOV B;  1R36 A;  2GA1 A;  1TLH B;  2KJB A;  3JRE A;  4J00 A;  5K7Z A;  2CJJ A;  2Y30 A;  3KX2 A;  1FNN A;  4E7J A;  1SVO A;  5K5O A;  2ESN A;  4MLO A;  5B5E C;  2X6Y A;  2OBP A;  2FNA A;  4Y7N J;  4B48 A;  2KMU A;  5ED4 A;  1T56 A;  5J8F A;  5K1Y A;  3FX3 A;  4I7H A;  3KYC B;  1RET A;  1RKW A;  2BZT A;  2X4H A;  3K70 D;  2QQB A;  1OYI A;  2IS4 A;  3JRA A;  3ABM H;  4WXH A;  1B8I A;  1VQK I;  2HOT A;  2P7C B;  3JRB A;  1G59 A;  1IF1 A;  3CP2 A;  3M7G A;  1FWZ A;  4QLC U;  2DTZ A;  3CCU I;  5ILV A;  4Q48 A;  4IHS A;  4I2O A;  1OMI A;  2L9S A;  4UUS B;  1XSD A;  2KIF A;  4YRV A;  5D4S A;  3DPU A;  3J7A O;  4UB6 C;  5FB2 A;  2HVQ A;  1F36 A;  3DTE A;  4L9V A;  1A31 A;  2X6O A;  5TRD A;  1XN7 A;  1TWH J;  1GVD A;  3TW7 A;  1I39 A;  2W82 A;  1PDN C;  2BY2 A;  4OWR B;  2QLZ A;  4G7O F;  2LFB A;  2JSC A;  4C3H J;  1E17 A;  3L00 A;  2P5V A;  4RB3 C;  1V4R A;  1YE9 A;  4XLF A;  3LFK A;  5LGT A;  5BQT A;  2L01 A;  3IKT A;  1R5H A;  5DCM B;  2VE8 A;  3D5L A;  1MKM A;  2VKH A;  2XKP A;  2PQ8 A;  2A6E F;  3CLO A;  4YEL A;  4QSH A;  4JOM A;  3KLO A;  2L54 A;  2W48 A;  3K4L A;  3VOD A;  4OMZ A;  3O2P E;  2ICW G;  3K0L A;  2CU7 A;  1JGS A;  3I3L A;  3SEQ A;  1UHM A;  1D8J A;  2M8G X;  3CCY A;  1EF4 A;  2WAQ A;  2YPR A;  3KZI C;  1FTZ A;  1OCT C;  1IV6 A;  1G3W A;  2ZNZ A;  3DKY A;  3I0T A;  1TWG J;  4PFP A;  4O6J A;  1FC3 A;  2WTE A;  4XLN F;  2OQG A;  2F4I A;  2DYR H;  4HW0 A;  2W85 A;  1SD6 A;  3OV8 A;  3K69 A;  1VQL I;  5LRR A;  1WJD A;  2MD0 A;  2KQR A;  4PUS A;  2OAZ A;  1ZLK A;  4IRH A;  2VKV A;  2G7U A;  2ECC A;  5C3E J;  1UFM A;  2P81 A;  2V1X A;  1ZG5 A;  4ANJ A;  2L7K A;  3O6B B;  3OYL A;  2BHY A;  3M9A A;  1KU7 A;  2EQR A;  1MJB A;  1S3J A;  1GVJ A;  4S0H B;  4E7I A;  3DKX A;  3FBN B;  1Z05 A;  1U5T A;  4P55 A;  4RGX A;  3T8T A;  4WK8 F;  3ZMD A;  2XGD A;  1FOK A;  1UHW A;  1UZC A;  4BH9 A;  4CCO A;  2FBH A;  1D1C A;  5GAH J;  3WGH A;  2DW4 A;  4E7K A;  5E17 F;  2DQL A;  5IOZ A;  1FJL A;  1IO2 A;  4HX4 A;  4AC0 A;  1Z0X A;  4BQO A;  3R6S A;  1MMA A;  5HOO A;  3HHG A;  3HTU A;  3UNG C;  2JVH A;  2TRT A;  2QEN A;  2V9V A;  1JUP A;  1LQ1 A;  5DDG A;  3L2Q A;  1G3Y A;  2E71 A;  3IRQ A;  1MGT A;  3ASN H;  3TW6 A;  1MDM A;  2IGM A;  2PEX A;  3WTX C;  4G7H F;  1VQO I;  5DUK A;  3EUH A;  3ZCO A;  3F21 A;  1O57 A;  3IL2 A;  5LHI A;  1BC7 C;  4NC8 A;  4CCN A;  4CCL A;  3F8M A;  2L9V A;  2ISY A;  3PFY A;  3QOE A;  4MQ9 F;  3R61 A;  4OOI A;  1DQU A;  2BW3 B;  3ECO A;  2M4K A;  2XB5 A;  3TO6 A;  1YIJ I;  1YFH A;  4CHU A;  1Q1H A;  3E5X A;  4W1U A;  4Y33 A;  2NVQ J;  3CQZ J;  2AXL A;  3FXK A;  4OIO F;  1J2X A;  2MLG A;  1ON2 A;  1PJR A;  2MAB A;  5FJ8 J;  3S14 J;  1BA5 A;  1HST A;  2VIX A;  3WHB A;  5M3M J;  2CV2 A;  5ICG A;  1ZGA A;  1FYK A;  2M3A A;  5EEH A;  1LE8 B;  2QZ8 A;  3AG1 H;  5DCF A;  2NXN B;  2Z9O A;  4RMN A;  4KT5 C;  4EAT A;  1Z1D A;  3FXQ A;  4A3D J;  1HKQ A;  1WHU A;  2YUS A;  2IPQ X;  3QPT A;  5EG0 B;  4M3B A;  1P92 A;  2GOM A;  2V79 A;  4OIN F;  5IT3 A;  1Y1W J;  4L5J A;  2CUJ A;  4NHJ A;  2KRF A;  1JTY A;  2ZME C;  4NUB A;  3ZN1 A;  4RDU A;  4WCG A;  3GFM A;  2L7M P;  5HLG A;  4L18 B;  4RAG A;  4PJN A;  2GXG A;  3PNY A;  3DF8 A;  4BBR J;  3WE2 A;  4FQG A;  4AID A;  3OYH A;  2EIK H;  4L9J A;  2ID6 A;  2HOS A;  2O8K A;  3WHC A;  5K7F A;  2IJL A;  2K85 A;  1O3S A;  2KRH A;  3CJN A;  3KIO A;  3Q0U A;  4PCQ A;  5CPR B;  5LD2 C;  3OYC A;  4XRS G;  5BOX A;  4BQN A;  1WJ5 A;  1YI2 I;  3ERM A;  3O8H A;  4WF2 A;  1B8I B;  5EZG A;  3S8P A;  3T0Y A;  2JN6 A;  3MQ0 A;  3WGG A;  2Y75 A;  3OYE A;  2VE9 A;  1WZ2 A;  2A5Y B;  5E1W A;  4YIF A;  2CUF A;  3OYM A;  2CQK A;  3X2Q H;  4OIR F;  3PSI A;  4GGG A;  3GXO A;  1CF7 A;  3HSR A;  1WSU A;  4I01 A;  1FIA A;  1WFX A;  2M30 A;  3TP0 A;  4E4H A;  3S1R J;  1KQ9 A;  2HR3 A;  4IEJ A;  3FMR A;  4N0B A;  3BR3 A;  2PJR A;  3DV8 A;  2CW7 A;  2ELJ A;  3QP5 A;  2HVR A;  1P4A A;  1JT6 A;  2VQG A;  2E1M B;  1YX3 A;  3W2V A;  1FBU A;  4NDL A;  4WX9 A;  4MTE A;  2K3P A;  1WGX A;  1RUN A;  1A6Q A;  2KP6 A;  4G6Q A;  1FBS A;  1XSV A;  4AVZ A;  1OFC X;  4O3M A;  1D3Y A;  3GBG A;  2GIV A;  3HPH A;  4WWC A;  3SHF A;  1Q1V A;  2DK8 A;  4IHY A;  3GTM J;  2DOE A;  1BI1 A;  2I5U A;  2XGC A;  3GZ6 A;  1JJ8 C;  3J80 Z;  2XAF A;  4CCJ A;  4ASN A;  1U8B A;  3GX4 X;  2XHK A;  2XSJ C;  1U9N A;  4DIQ A;  4BQA A;  3L2W A;  1YW9 A;  2ZSI B;  4A3J J;  3AAF A;  1YTY A;  4S05 A;  1FYM A;  1E0E A;  4IOC F;  3TO9 A;  3CCJ I;  3ZQG A;  3ZN0 A;  2K9L A;  2NNY A;  4IRI A;  1G3T A;  3OYG A;  5IP9 J;  2D2W A;  1G2H A;  1TP4 A;  3HRU A;  4XOR A;  1WJE A;  3BZK A;  2N8G A;  4X1E A;  3FMQ A;  5FD6 A;  2EPF A;  3HZJ A;  4Q47 A;  4XKB A;  4G94 A;  4CYC A;  1VQ5 I;  1T33 A;  5E8I A;  2CUZ A;  1HDD C;  4ZTF A;  3ECH A;  1R1T A;  4OMY A;  1VQ9 I;  2GXB A;  3KZZ A;  2R0Q C;  4IQ4 A;  4Z6Y A;  1FOW A;  4KT6 A;  3WTZ A;  2GQQ A;  1ZHF A;  3NWT A;  2VLA A;  3GVA A;  1JJ6 C;  1U5T B;  3CF2 A;  2CV1 A;  3BR1 A;  2VJ5 A;  5B1B H;  1EV7 A;  1W5C C;  1Y56 A;  4C9Y A;  1IRZ A;  4DBR A;  5DTD A;  2EBI A;  1B6A A;  4XMY A;  3OS1 A;  1SFU A;  2ZJR F;  2O03 A;  3K10 A;  1BR2 A;  3ABU A;  1DPR A;  3D5R C;  3I64 A;  4A2U A;  2Z99 A;  4GDF A;  3PL8 A;  5BS6 A;  1I27 A;  1FX7 A;  3HC7 A;  1VQM I;  1SAX A;  3DP7 A;  3KP5 A;  2DPD A;  5F0F A;  3J7Z I;  1JHF A;  2LF7 A;  1VFC A;  4EVI A;  3MVP A;  1DDN A;  2YSR A;  5FLX Z;  1MDM B;  4FHT A;  3CD6 I;  1PP8 F;  3BJO A;  3NAU A;  2GWR A;  5FFZ A;  2KLO A;  3ROU A;  1SFO J;  2HQ5 A;  3R60 A;  5BPD A;  2QVO A;  1RZ4 A;  4D7M A;  4ZDP A;  4EMS A;  5F1J A;  5IY5 H;  2QSG X;  4XLE A;  4ENJ A;  3T5X A;  2D1V A;  3SEZ A;  3HGY A;  3KEQ A;  4U88 A;  4KIT B;  1X3U A;  1KQ8 A;  2DXI A;  2DJI A;  1ETQ A;  4Q5S F;  2EV0 A;  4MGR A;  4B8X A;  4FE4 A;  1A5J A;  4A12 A;  4HQE A;  2RKH A;  4IF4 A;  3TDZ C;  1D8K A;  3OYB A;  2KDZ A;  3CO6 C;  5D8L B;  2DJN A;  3CP8 A;  3QYF A;  1PP7 U;  1P7I A;  3GTJ J;  3QPS A;  2Q1Z B;  4IKF A;  2KIU A;  4XN0 A;  4B3A A;  2PBI A;  4XR6 A;  1S8N A;  1BN5 A;  4HX7 A;  4ZYH A;  3HTS B;  2JSP A;  1RPW A;  2NVU B;  4MEX F;  3SDG A;  1AKH A;  2JT1 A;  2UV1 A;  5M3F J;  3GEZ A;  3MWM A;  1MBE A;  2LK2 A;  3OYD A;  1DP7 P;  3EYY A;  3BR0 A;  1ETK A;  5HVQ C;  3ZP5 A;  2V1U A;  4XIC A;  5DD4 A;  3S93 A;  1Y8R B;  1KU2 A;  4HX8 A;  4G12 A;  3G1O A;  3HG9 A;  1D1A A;  1O3Q A;  3COA C;  1IZ1 A;  3HDD A;  4P5O A;  1PUF A;  2OV7 A;  4CXF A;  5CLS A;  3DBR B;  3S2W A;  3DCF A;  1M1E B;  1S6L A;  1XGN A;  1KZH A;  2BHZ A;  4BXF A;  2H94 A;  1ZGJ A;  3BZ6 A;  2COB A;  1BIB A;  1CGP A;  2FMY A;  1JXS A;  1JHH A;  1ZRF A;  2DFE A;  3CC7 I;  2HOA A;  3BTC A;  4KIS A;  1XDU A;  3W6J B;  4ZZL A;  4BYY A;  3HEF A;  2EIJ H;  2DTR A;  2PMZ A;  2VOO A;  2MFZ A;  2V1N A;  3IUO A;  2YU3 A;  1ZAO A;  3K4M A;  1HCR A;  5C44 J;  3H5A A;  2DMP A;  1WI3 A;  2XDV A;  2NNN A;  4BAC A;  2GAU A;  5KK1 A;  2V9P A;  2W1O A;  5F0C A;  1XTA A;  5ICC A;  2K9S A;  2F5D A;  4EGZ A;  1V5F A;  5D5U B;  2ME6 A;  4EJT A;  1GDT A;  3QWL A;  1MSF C;  5J1R A;  2VT2 A;  1W0T A;  3K4B A;  3N4M A;  3PJR A;  3JSO A;  3OMY A;  1CF7 B;  2FUG 2;  1JGG A;  1LDD A;  2L4M A;  3DTK A;  1DGW Y;  1FSE A;  4U7D A;  4BXX J;  1TC3 C;  3ZOB A;  2L2O A;  2PJR B;  5F0H A;  1G8X A;  3A2K A;  5F64 A;  1FEX A;  5IP7 J;  3EYI A;  3LSJ A;  4F93 B;  5J1Y A;  3BP8 A;  1EH7 A;  1HXD A;  2BEO A;  3N05 A;  5AIQ A;  2V1D A;  2VJI A;  2QSH X;  4I09 A;  4D5C A;  4FTH A;  2V26 A;  3WTT C;  1OCZ H;  1PYV A;  2VJ4 A;  2G7H A;  3SZP A;  1GHC A;  2DBB A;  5A2Q Z;  3OY9 A;  1YS7 A;  3ZMZ A;  2WA0 A;  2HQA A;  3A03 A;  4LLL A;  3A0B C;  1ZAR A;  5CQE A;  1XS9 A;  2ELH A;  2A07 F;  3RZD J;  1T0F A;  2LRD A;  2JUG A;  1OCO H;  1ODD A;  3WTV C;  1J0R A;  4IL6 C;  3GZ5 A;  3WOD F;  1XC5 A;  4CUG A;  3C2H A;  5BPI A;  1IJW C;  2E36 A;  4RAY A;  4LOC A;  4OIQ F;  2X48 A;  2HQR A;  2E7X A;  4KIC A;  3DEW A;  3DLL F;  3ZQL A;  3F8B A;  1VTN C;  4CYC B;  1H89 C;  3LQQ A;  1YHQ I;  2B9S A;  1MIJ A;  3OYA A;  4FT8 A;  1BL0 A;  2Z5U A;  3CJQ B;  3LSK A;  3NQO A;  1P2F A;  4RB0 A;  2DA7 A;  5DEQ A;  4XNF A;  3BWG A;  2VBW A;  3FHN A;  3CCS I;  4PSW A;  3BPX A;  2RRE A;  2XPU A;  2HVS A;  5H2F C;  4CGZ A;  1S9H A;  3PNV A;  3P9K A;  4BXU A;  3G3Z A;  1KU3 A;  2JJ7 A;  2P6S A;  2DAO A;  4XL9 A;  1TQP A;  1Z9C A;  1MBF A;  2FBK A;  2NOJ B;  2ADU A;  5J40 A;  4FAS D;  5J47 A;  3S15 J;  3H3Z A;  1HKS A;  2BY3 A;  1ENH A;  2HDD A;  2P6T A;  5HLI A;  3DEE A;  4HZF A;  2A5W A;  3P7N A;  3VB2 A;  1U2W A;  5GAD J;  2AQE A;  3ZQH A;  3W3C A;  3DFG A;  1I3Q J;  5CJ9 A;  5LGU A;  5FRM A;  5LHH A;  3IAM 2;  3TQN A;  4IX7 A;  5TGT A;  2CSO A;  3FMS A;  3QU6 A;  4XRS A;  5HLT A;  4XID A;  4LD5 A;  4EM2 A;  3I4P A;  4P9F A;  2FX0 A;  1SVL A;  3G1M A;  4PJ0 C;  3SJM A;  4HV6 A;  4KMF A;  2M34 A;  3WU2 C;  1QO0 D;  2FBI A;  3HJE A;  3BR2 A;  3I5U A;  1B4A A;  2HYF A;  1AWC A;  3H35 A;  2WAE A;  3KP2 A;  5GTH C;  4YII A;  3G71 I;  1RR7 A;  4JX5 A;  4JQF A;  2QGU A;  5CVR A;  2G0E A;  1HOM A;  2NRA C;  3PUF A;  1ON1 A;  3E0J B;  3RPQ A;  1W7P B;  1LNW A;  2QM3 A;  2OTL I;  2HTS A;  3OYF A;  1IDZ A;  3DTI A;  1IG7 A;  1X1P A;  3ELK A;  1SAN A;  1K6Y A;  3NEU A;  3VPR A;  1R5G A;  4LG0 A;  3K2A A;  2F4M B;  3GTL J;  5EG0 A;  2IBD A;  1OR7 C;  5F27 A;  1Z77 A;  2RN7 A;  2LR8 A;  4YG2 F;  3KP6 A;  1YRN A;  3OL3 A;  2VBX A;  3QQA A;  3QYE A;  3RDI A;  2QBY A;  1AKH B;  5D6E A;  4UVA A;  3I59 A;  1AA7 A;  1OCP A;  3LL7 A;  4XKW A;  3UR3 C;  3RJP A;  1QHH D;  1IXC A;  1E3P A;  2OCC H;  2DA2 A;  2R5Y A;  2MH2 A;  2VBY A;  4FIS A;  2EIN H;  2QYO A;  1BOA A;  2LTP A;  2O3F A;  3KLN A;  4UV8 A;  4QTR A;  3FM3 A;  1WRJ A;  2LD5 A;  1IV8 A;  3K1P A;  4ZYA A;  1BOB A;  2IGN A;  2UXX A;  1PUF B;  1R58 A;  1B72 A;  4HLX A;  1QBJ A;  4XM3 A;  2STT A;  2HGC A;  3OWT A;  3KFW X;  5CKT A;  2ZFU A;  1ETO A;  4PGH A;  1Z7L A;  4JX6 A;  4XOP A;  4BEH A;  1ZH5 A;  5DYM A;  2VQC A;  2STW A;  3HYI A;  3DBH B;  1MJA A;  2EFN A;  1JTX A;  3PFI A;  2P5L C;  1K83 J;  1R4N B;  2Y9Y A;  1F9N A;  2LG4 A;  1K61 A;  3LWF A;  4AD9 A;  4RAZ A;  2DYS H;  1NK3 P;  1I1S A;  5D8K B;  4C2M J;  3WTW C;  1RNL A;  3QOD A;  4R79 A;  4RLQ A;  5CVI A;  4DQ2 A;  4EJV A;  3OS2 A;  4XKV A;  1YJ9 I;  3H0G J;  3AL0 C;  3K2Z A;  1JKR C;  1QHG A;  1IN4 A;  2EA2 A;  2JA2 A;  3I53 A;  3M8E A;  2L02 A;  1ULY A;  1Y0U A;  2KKO A;  2XF6 A;  5FKN A;  3BRO A;  1W7P D;  1O3T A;  1JE8 A;  4C2T A;  4P9U A;  2Z1D A;  4Z2Y A;  3S3O A;  2BY0 A;  4PDK A;  4NC7 A;  4ZDL A;  3LSR A;  1IGN A;  1ACI A;  2O0Y A;  2OU2 A;  4N9H A;  3FF5 A;  2EA4 A;  1A04 A;  1GV5 A;  3OSF A;  1LB2 A;  4M6Y A;  4A5N A;  4KIB A;  3GTK J;  2EFP A;  3C3W A;  1OLT A;  4B3X A;  1EH8 A;  3J81 Z;  3TMO A;  4M9S A;  4XQF A;  5AIP A;  3T8R A;  2ZJ2 A;  4M9X A;  4PJJ A;  1QPM A;  2L0K A;  3KP4 A;  2EWN A;  3HSF A;  2R7X A;  3VEP A;  3HGG A;  2QF7 A;  2E19 A;  1FTT A;  1LEB A;  2FOK A;  4RM2 A;  2DPU A;  2H8W A;  2RC4 A;  4U87 A;  1SAU A;  3I54 A;  3AG3 H;  4UNO A;  2GOX B;  3MEX A;  5HNH A;  1O3R A;  2HS5 A;  1WJB A;  1QGP A;  4MHG A;  3LNQ A;  2JRT A;  2LF8 A;  1FMV A;  2M0C A;  2JTV A;  4I98 B;  4LB6 B;  3JR9 A;  2QCO A;  2WB1 A;  3HOX J;  2VQH A;  1GUU A;  3QAH A;  1H9T A;  1KQ0 A;  4HYE A;  1IN5 A;  2FXA A;  2DA4 A;  4R8H A;  4D5F A;  3VYR B;  3JAM K;  2QEX I;  1N75 A;  4EEF G;  2E2H J;  1TQM A;  4E6K G;  5E20 A;  1JUM A;  3BTI A;  3MKW B;  1Z21 A;  4TV7 A;  2B63 J;  1IXS B;  3LST A;  2QQ9 A;  4CZZ A;  1F4K A;  2EJR A;  2Y0S A;  5L3C A;  1V54 H;  4AU7 A;  3PIO F;  4WXC A;  4XRM A;  4LIV A;  1VF9 A;  2DOF A;  3CES A;  1LDJ A;  2EZK A;  4I0B A;  4E70 A;  2OF7 A;  4HQM A;  4BHC A;  5EYR A;  4PGG A;  2NS7 A;  1BI0 A;  3K7A J;  3MAJ A;  2CQN A;  2VL8 A;  2F6C A;  3ABL H;  4MNU A;  1O4X A;  1J7K A;  2DT5 A;  3BDD A;  1E3O C;  3I55 I;  3V7R A;  1P9Q C;  1TW3 A;  4Y52 J;  2NVY J;  2W84 A;  3LAJ A;  1P4W A;  4E7L A;  2EV5 A;  3L7W A;  5E1Z B;  3V7S A;  4F92 B;  1I6H J;  3C7J A;  3L2U A;  3A4C A;  3C2B A;  2K9N A;  3BQZ A;  5D5V B;  3OS0 A;  3H9J A;  2IRF G;  4L9N A;  4BL0 B;  1HKT A;  4I02 A;  2BOL A;  4AIK A;  3R4K A;  1KON A;  1OCR H;  3H9G A;  4XSZ F;  3L2C A;  1R1V A;  6PAX A;  4RLF A;  2AXT C;  2GA2 A;  3Q5F A;  1YO5 C;  4J19 A;  4LG0 B;  5EEA A;  1QA6 A;  4A69 C;  2XRL A;  3HOS A;  1YRN B;  2FU4 A;  2EZH A;  2QBY B;  3E6C C;  2E5Z A;  3K9T A;  3DPT A;  3ERE D;  1FLI A;  3I59 B;  2YS9 A;  1TW2 A;  1ZRC A;  2VAS A;  5GTI C;  3JTG A;  1NH3 A;  4BUP A;  3BTJ A;  1W5T A;  2LSO A;  2ZXW H;  1I5Z A;  1YIO A;  3ESW B;  1HW1 A;  3FM5 A;  4M71 A;  4A0X A;  4XKC A;  3PM1 A;  1J75 A;  1B59 A;  5FRO A;  1XD7 A;  4FX0 A;  3A02 A;  3QOP A;  3MZ8 A;  2CQX A;  3AG2 H;  1B72 B;  2WY7 Q;  2V7F A;  3S1Q J;  3F3X A;  4ZJZ A;  1EH6 A;  2DOD A;  3RKQ A;  3TOB A;  3M3Y J;  1SFX A;  2GBY A;  2HXI A;  2KJC A;  2LRE A;  3DXJ F;  4LG3 A;  1UCR A;  4Y13 A;  2W00 A;  4L9T A;  1WVR A;  3HKZ A;  4BEH B;  2K40 A;  2PLY A;  4HV5 A;  5L3B A;  2XF7 A;  1FT9 A;  1WWX A;  3GTG J;  4LFU A;  3IC7 A;  3U2R A;  4RGR A;  4NBQ A;  2VC1 A;  2DOA A;  1XX5 A;  2JA5 J;  1STZ A;  3KEO A;  2OD5 A;  4X6A J;  2COM A;  1R6R A;  1YYV A;  2VQL A;  3LSM A;  5B1A H;  3BT9 A;  2AHQ A;  2DDA A;  4ESB A;  4HNV A;  4CH7 A;  4JX4 A;  5KNL A;  4BHB A;  2IVM A;  4BJ5 C;  1VQ7 I;  3GTO J;  3BG9 A;  3S1N J;  3VYT B;  3S1M J;  3Q0V A;  2ELK A;  1FMW A;  1I50 J;  3HOT A;  1MZB A;  4HF2 A;  2XPW A;  3SDB A;  3RPU D;  1ZN2 A;  5JR3 A;  3BR6 A;  5B66 C;  1HQC A;  3LAP A;  2LH9 A;  3RYP A;  3ZR8 X;  2R5Z A;  5HLH A;  1JKQ C;  2I10 A;  1HDP A;  3TKY A;  3H9Q A;  2H1L A;  5JLW A;  1RES A;  1YJW I;  5HDK A;  3WTU C;  4E7S A;  1KYW A;  2DK5 A;  2DQR A;  2HU9 A;  2HTJ A;  3B6C A;  3MMY B;  5D6F A;  2RQQ A;  2JRM A;  3OSG A;  2QKM B;  1TBX A;  4HNT A;  4V2F A;  1YG2 A;  3B73 A;  2FRH A;  2MW8 A;  5FO5 A;  4L0Z B;  3REO A;  3VSL A;  4LB5 A;  3HRS A;  4LK0 F;  1IXR C;  2WAQ N;  2EV6 A;  2ID3 A;  2FE3 A;  3FK7 A;  1NK2 P;  4IRG A;  3CTA A;  2YR2 A;  3CJT B;  4IZZ A;  1V3F A;  1MMG A;  1V5G A;  2KZV A;  3BTL A;  4B1R A;  5KAF C;  2A69 F;  5C4J J;  3CCR I;  3HOV J;  1T2K A;  2XIG A;  2NAZ A;  3ASO H;  3K1M A;  1IN8 A;  1N78 A;  2XB0 X;  1G3S A;  1WJA A;  1X2M A;  4ZC3 A;  5GP9 A;  1SC7 A;  5IT9 K;  1USS A;  1ZK8 A;  4DYQ A;  2BE5 F;  1SEU A;  2M2E A;  3MZH A;  5EGO A;  2O8X A;  3CMA I;  3BG5 A;  4ENN A;  2V6E A;  2G9W A;  4YFN F;  3PO2 J;  1LPQ A;  3IAS 2;  3TDU C;  3D0S A;  5JI6 A;  1OKR A;  4KFC A;  2KZG A;  1H8A C;  2HKX A;  2UWM A;  4HNU A;  2ZO4 A;  3I56 I;  2VON A;  2KPM A;  1O7F A;  3E6D A;  1D0X A;  1HW5 A;  1YW8 A;  1T98 A;  3RSN A;  3WTS C;  3M1E A;  1D1B A;  1FSH A;  1GXP A;  5B3S H;  4IPA A;  4L5I A;  4A6E A;  1KYZ A;  2E5N A;  2XGX A;  3IWF A;  3P9I A;  5JHU A;  2OQR A;  1KGS A;  4HOB A;  3MZY A;  3G6E I;  3VWB A;  2WB1 N;  3CCM I;  1MD0 A;  2DI3 A;  2VT3 A;  1UG2 A;  3A0H C;  3BQY A;  2XUB A;  3KP3 A;  1UJ8 A;  2KIM A;  3RQI A;  2Q0O A;  2W24 A;  1FOX A;  1S7O A;  2DCE A;  1YW7 A;  3IV5 A;  1H88 C;  3I9V 2;  4PSX A;  4UVC A;  3BCA A;  4DJA A;  1BJZ A;  2CV0 A;  2Y0S N;  1BI3 A;  3N97 A;  2RV8 A;  2DA5 A;  5FRN A;  2NVT J;  5FLM J;  1W7P A;  2ZME A;  2ETH A;  2CO5 A;  3S3M A;  1IUY A;  3CUQ C;  3CMY A;  3D1N I;  1MBK A;  3AKZ A;  2B0L A;  4RB1 A;  3GO5 A;  1POG A;  2IP2 A;  3JRH A;  2BGC A;  3HPG A;  1FOY A;  3HHH A;  1K78 A;  3ZQI A;  5M5W J;  1W0U A;  3LSI A;  1HLV A;  3QPL A;  3O8G A;  3J7A Y;  1TNS A;  2LKX A;  1S72 I;  1J09 A;  1OCC H;  5DD8 A;  2MGQ A;  4GO1 A;  3GTQ J;  5JLX A;  1JKP C;  2X0L A;  2VI6 A;  5ILS A;  4MO7 A;  1WH5 A;  2XAG A;  5GAG J;  2EH3 A;  2NYX A;  2ZJP F;  2EB7 A;  3UKG A;  3BG3 A;  3JRI A;  3TL4 X;  2CS3 A;  4AYB A;  5JFR A;  5FKL A;  2FNP A;  2ZC2 A;  1OJL A;  2O7O A;  5E18 F;  2IT0 A;  1Z67 A;  1X1B A;  4IHV A;  2I8D A;  1MBH A;  2XSD C;  3DPL C;  4E7Z A;  1QVT A;  2PX9 A;  1K7A A;  2R7Q A;  3CDH A;  3AFH A;  1S7E A;  3F6V A;  4BE2 A;  2Y69 H;  1YIT I;  3S2H J;  2J5O A;  3L09 A;  2B7E A;  3JW4 A;  4HLY A;  1JUS A;  4LIT A;  1S7A A;  2A6H F;  2HFH A;  2RNJ A;  3ZRG A;  1R5I D;  4IQJ A;  2IGK A;  4OIP F;  2PJP A;  3RCO A;  2KT0 A;  1X19 A;  3ZGK A;  1SD5 A;  3B6A A;  2L3D A;  2HDC A;  3KEY A;  1AU7 A;  1K79 A;  5FKO A;  2WY8 Q;  3HKZ N;  1IN7 A;  1O7L A;  2CMP A;  2F5E A;  2K5C A;  1FP1 D;  3DU6 A;  3ONQ A;  2VBZ A;  2RNG A;  3Q9S A;  4BJ6 C;  3LFU A;  3V42 A;  1T8I A;  4UB8 C;  2P7V B;  2NVX J;  1ZR4 A;  1HW2 A;  2EFO A;  2X6W A;  1KU9 A;  2FJ1 A;  3V4G A;  3O3K A;  2D45 A;  1TWF J;  3CMM A;  4Y4R A;  3DQV C;  2JWT A;  4EM1 A;  4AVP A;  5GPC A;  3K4C A;  4QWQ A;  2Z33 A;  2CGP A;  5BNG A;  1VQ4 I;  2R5Z B;  3SFZ A;  4V2G A;  1SMY F;  1R00 A;  2LY9 A;  3S3N A;  2D1H A;  4KIF A;  2XAJ A;  2M8E A;  4RM3 A;  1WH7 A;  3BY6 A;  1TZL A;  1LFP A;  1LUJ B;  3U21 A;  3BJ6 A;  4F52 A;  4O5V A;  2R7T A;  4G6D A;  2MD5 A;  4JP0 A;  4IXA A;  2KHM A;  4ITV A;  3ULQ B;  3H5R A;  1B9M A;  5HNF A;  2R7F A;  3CZ6 A;  3Q3S A;  3TBI A;  3FKI J;  1U8R A;  4GRI A;  4MIM A;  1ZEL A;  3SZG A;  3VFZ A;  2DA1 A;  5HS7 A;  3IH3 A;  1J9I A;  2LBF A;  3EUK L;  1FPQ A;  2ME0 A;  2ZNY A;  1TT0 A;  1H0M A;  2E1M C;  3E1S A;  3HBL A;  2DA6 A;  1BJA A;  4U0Y A;  2VKE A;  1GV2 A;  3TOA A;  1P6R A;  4BQQ A;  5E3O A;  2IAI A;  1HSJ A;  4I0A A;  2X6X A;  3IH2 A;  3U9G A;  1ONV A;  2WAD A;  2GM4 A;  4EGY A;  2MSY A;  3MD2 A;  2Y9Z A;  3PQK A;  1IC8 A;  5EGO B;  2DDB A;  3R0J A;  4BDZ A;  5E79 C;  3TGN A;  3VDX A;  4GFB A;  3H0D A;  1OPC A;  2JPC A;  5H6Q A;  4C3J J;  1BIA A;  2LNB A;  3E97 A;  3RI4 A;  1U9O A;  1Y8Q B;  3HIF A;  3GLX A;  1BC8 C;  2A68 F;  3WU0 A;  1XSX A;  4PK4 A;  4DNC A;  2FEZ A;  3CUQ A;  3ZMU A;  2FQ3 A;  5IYB J;  1DGR M;  2YX7 A;  3JCU C;  2Y48 A;  2BVL A;  3K4J A;  4D1Q A;  1QZE A;  3DLA A;  3NWS A;  1B1B A;  1R4M B;  2R7W A;  2KIQ A;  5HS9 A;  5JHF A;  5HOD A;  2M9H A;  3FIW A;  2BV6 A;  4IOA F;  4A93 J;  3Q0W A;  1ZQ3 P;  3ZMS A;  1MH3 A;  4M6V A;  5JVG F;  2K7L A;  4BBS J;  1FY7 A;  4N4O B;  1HF0 A;  1W36 C;  2M7A A;  2W4S A;  4M72 A;  1DP3 A;  5CVU A;  3RPU A;  4M3D A;  1AOY A;  1BM9 A;  2A3S A;  2ZME B;  2CQQ A;  2M5W A;  2OA4 A;  4OAZ A;  1H9G A;  2ZXJ A;  2P4W A;  2LY2 A;  4A3C J;  2X9D A;  2E60 A;  4JBA A;  3OOU A;  4MQV A;  1ZR2 A;  2L5Q A;  1MJ9 A;  1SD7 A;  1FBQ A;  3BLY A;  1WJF A;  1YLF A;  4HF0 A;  1U6G A;  3IRR A;  2OC6 A;  1XGM A;  1BI2 A;  2A6T A;  5BMZ A;  2V4J C;  4RA2 A;  3CCE I;  1K78 B;  4A3L J;  3GCM A;  4II2 A;  4I99 C;  2BY1 A;  3OIO A;  4A5M A;  1T39 A;  3HUG A;  4EQQ A;  1J59 A;  3TED A;  2VB6 A;  3IHU A;  2VKD A;  3L2R A;  2Y31 A;  4DYC A;  3ZQQ A;  2IXS A;  3LSG A;  1X1C A;  3CUO A;  2BYV E;  1TTY A;  2HNH A;  3AG4 H;  4NC6 A;  5LRS A;  3CME I;  2KRC A;  5EZH A;  5IYD J;  2V9K A;  2QQA A;  4HSR A;  1TL8 A;  1A36 A;  4A3E J;  5KAI C;  2MH9 A;  1IN6 A;  2HYG D;  1G6N A;  2DMT A;  2R92 J;  5CVJ A;  1IRG A;  3P9C A;  3PUB A;  5FD5 A;  1UHS A;  2L9N A;  4F55 A;  1VQP I;  1ZKG A;  3LMM A;  2H1K A;  1MND A;  1FZP B;  1MMS A;  1LEA A;  4HG2 A;  3RKY A;  2DMN A;  2E34 A;  1UMQ A;  1R71 A;  2RQP A;  3QPH A;  2JUC A;  2OUM A;  3EQL F;  4II3 A;  3J80 K;  5HDN A;  2R4G A;  2PMZ N;  1FIP A;  4M9Z A;  1QRY A;  5K7H A;  1LFB A;  2QUF A;  4Y17 A;  3FK6 A;  4MEY F;  4C30 A;  4EJW A;  2J5P A;  4KJZ A;  4CO8 A;  1ZRE A;  5EEG A;  4HEA 2;  2K4B A;  3W6V A;  3EET A;  2HOE A;  2HEO A;  1ETW A;  5FKM A;  2ACJ A;  2VPL A;  5DUI A;  2KL4 A;  2Q2E A;  2LOO A;  2Y0M A;  3IWZ A;  1P4X A;  2QA4 I;  1DUX C;  3LA3 A;  4BE1 A;  2P0W A;  3QP6 A;  4GXO A;  3PIP F;  3GF2 A;  9ANT A;  3K4K A;  2TCT A;  4BJT A;  5K5Q A;  3F72 A;  1ETY A;  4Q4Z F;  2D5V A;  2ZBK A;  1ITY A;  1D0Z A;  2KDO A;  2W57 A;  3HOY J;  3KCC A;  2AQF A;  3BG6 A;  1F5T A;  4OU0 A;  5CYV A;  2ECB A;  3U1D A;  3T1B A;  1QVU A;  4U0W A;  1YJN I;  3RZO J;  2R7Z J;  1XDS A;  2CW8 A;  4XLC A;  1TWA J;  1MSE C;  1VQ8 I;  1U3E M;  2HQN A;  3QYB A;  1CQT A;  3ZPL A;  2JA7 J;  5EF6 A;  5C4X J;  5J1U A;  5IPA A;  3W2W A;  2EFQ A;  2DT6 A;  2YU9 J;  4CA0 A;  4BGD A;  2VOP A;  1G4D A;  4D0P A;  2IA2 A;  2LBF B;  1TNT A;  2R5Y B;  4A6D A;  2XAS A;  2IA0 A;  2W25 A;  2E2J J;  4PJM A;  2R7U A;  5LBQ A;  4GYG A;  3B02 A;  2HZD A;  5FLX K;  2VPR A;  4EM0 B;  5HS8 A;  1ZYR F;  5KCM A;  1XPX A;  1RIO H;  4LK1 F;  1J5Y A;  1X3Z B;  2MC3 A;  3FIS A;  2IS2 A;  2O6G E;  4Y15 A;  3C2G A;  2O5R A;  4DW6 A;  4ZYD A;  3DU5 A;  4UXN A;  2UXN A;  1S29 A;  1X1A A;  4BHP A;  2GIZ A;  2HI3 A;  4HPQ A;  1WKM A;  2X51 A;  1XMX A;  1BR4 A;  2H6C A;  2UZK A;  1Z6R A;  2XV4 S;  3G1L A;  4XLP F;  5IYC J;  2VC0 A;  2LMD A;  2E1O A;  3BG7 A;  3CUQ B;  1Z7U A;  1Y39 A;  3KET A;  1SMT A;  5DS9 A;  5FGM A;  2PMH A;  2XF5 A;  1RRJ A;  3BC8 A;  1OR7 A;  3OR2 C;  4CDG A;  1SFE A;  3KZY A;  5D4R A;  2BBY A;  1BW6 A;  1HA8 A;  2M1B A;  5H6R A;  1ORK A;  2BXY A;  3LA2 A;  2WWY A;  1WCM J;  2XAH A;  3FXO A;  2LLK A;  2LYC A;  1N25 A;  1KA8 A;  3LOC A;  2L4A A;  1Y0N A;  2M87 A;  4BNC A;  2LKS A;  2LVS A;  3GZN B;  2DLL A;  2QQ8 A;  4A3M J;  2MC4 A;  2JVG A;  3A1Y A;  1D0Y A;  5HDG A;  3F6O A;  2EK5 A;  2LKP A;  3LSP A;  4B47 A;  1OYW A;  4XSX F;  4KNY A;  4RB2 C;  1R49 A;  3V8K A;  2RAE A;  3I71 A;  3K70 C;  2M7B A;  4V19 K;  2EZL A;  1I6X A;  4FCY A;  1I3A A;  5LGN A;  2O61 A;  1C0W A;  4G9Y A;  3GYH X;  2CQ7 A;  1V5E A;  3GLL A;  2O9L A;  3WG9 A;  1VQ6 I;  1QQI A;  2DFI A;  2PN6 A;  1D5Y A;  1NTC A;  2K9M A;  3DEU A;  3EPZ A;  4XRF A;  2CRG A;  2H6B A;  1ERD A;  2A05 A;  3HUG B;  3ZMT A;  2M0M A;  3W6K B;  3I4N J;  3L9F A;  1PUE E;  1TWC J;  2DO7 A;  2Z3Y A;  2DFF A;  2H09 A;  5KHD A;  4X0G A;  2IW5 A;  5FLV A;  2M4G A;  4XK4 A;  3VYU B;  1YQA A;  3GWZ A;  4Y3O A;  4I76 A;  2ZFW A;  1BR1 A;  3GUD A;  2QKL B;  5F6F A;  3E3V A;  2XRO A;  1QZZ A;  3M1C A;  3JRF A;  2H8R A;  3HOW J;  1Z3X A;  1U78 A;  4BY1 J;  2GZW A;  1R9T J;  1MW7 A;  2PI0 A;  3MKZ A;  1W5S A;  2VN2 A;  4M3F A;  4MFD A;  4ZTJ A;  2XKO A;  2ZSH B;  3HOZ J;  3FXM A;  3A01 A;  2CFO A;  2X1D A;  3V8J A;  4DBQ A;  4ZZD A;  5F1R A;  2E1N A;  2K4J A;  3NRV A;  3IH4 A;  3IKV A;  1SFK A;  2EZI A;  3BCB A;  1WQ2 A;  3S17 J;  5LHG A;  3LA7 A;  2FSW A;  1Y6I A;  4F91 B;  5M5X J;  1IW7 F;  3I4M J;  1K4S A;  1E3H A;  1QZY A;  2RDP A;  2P5K A;  5A2Q K;  3RKW A;  5L3D A;  3CDL A;  1LJ9 A;  2DFH A;  1QU3 A;  5J4V A;  4D7N A;  5F04 A;  4UVB A;  2EFW A;  1NG7 A;  1U0J A;  3FXJ A;  2F5F A;  1OQY A;  2R7V A;  1DU6 A;  5L3E A;  2AO9 A;  4A3F J;  2M45 A;  5ICF A;  3D5S C;  1OIS A;  5LEJ A;  3GFI A;  3KPH A;  3SFI A;  1FP2 A;  2L7F P;  2PG4 A;  3LQR A;  3TP3 A;  1L0O C;  4NNJ A;  1JI8 A;  5EDN A;  1VND A;  4P96 A;  3JRC A;  1UST A;  4HF1 A;  2QSF X;  2JA6 J;  3S16 J;  1HC8 A;  4KA4 A;  2Q2E B;  2CUE A;  2ESH A;  4IJA A;  3OOP A;  4LLN A;  1ZTR A;  4HBL A;  3H5N A;  3L2V A;  2R7R A;  4ZYE A;  2L9R A;  3BJA A;  3M07 A;  4GYI A;  1IUF A;  3GW2 A;  3CO7 C;  4NQW A;  5DM6 F;  1IAW A;  3H3U A;  2PFB A;  2DMQ A;  3ISP A;  2VXD A;  4L0Y B;  3S2D J;  3HOU J;  1IDY A;  3RYR A;  5H20 A;  3G73 A;  5J8C A;  1ZG3 A;  2X1E A;  4QIW N;  3GFL A;  4YFX F;  3SYT A;  2MLK A;  3PQJ A;  1L3L A;  1W4M A;  3E5Q A;  4YFK F;  3F22 A;  2XPV A;  5GAE J;  2JQ7 A;  2X1C A;  3HM5 A;  1DPU A;  2X85 A;  3MKL A;  4YEJ A;  4U7B A;  4CZC A;  2FA5 A;  3DBL B;  1VQN I;  2F2E A;  3BOQ A;  3E6B A;  3MCZ A;  4ETS A;  3G2B A;  5E3M A;  4S04 A;  3LSH A;  3CF5 F;  4U0V A;  5AON A;  2JA8 J;  4CSW A;  2R3S A;  3HB9 A;  1I1G A;  5TIS C;  2OTJ I;  4RGS A;  2K3F A;  4B09 A;  1EKE A;  1XGO A;  4LIU A;  1MBG A;  1VI0 A;  4DGW B;  4UHT A;  2WV1 A;  1IRF A;  3TO7 A;  3OIQ A;  4LJZ F;  2NS0 A;  3QRF F;  3E6M A;  2GLO A;  3NAR A;  4QPQ A;  2W7N A;  1A6I A;  1Y1V J;  1T95 A;  4L5E A;  2XC7 A;  4EV0 A;  5M5Y J;  4A3B J;  1ZLJ A;  1T0F C;  4F3Q A;  4AUX A;  3HSE A;  4M3E A;  2R7O A;  3ZQ7 A;  4RS8 A;  3ZXS A;  2C6Y A;  1EJ9 A;  1WPK A;  3SXY A;  4DZP A;  3FZV A;  2PMU A;  5JVT A;  3ZQF A;  3CDI A;  2QWW A;  3KYL A;  1MNE A;  2FOW A;  3JSP A;  2ZKZ A;  3QU3 A;  4N9I A;  4LLG F;  1N77 A;  4XOT A;  1IRX A;  4XLA A;  3WGI A;  4EJO A;  4KIG A;  2XVC A;  4B44 A;  2H27 A;  2VOD A;  3K6G A;  4B4C A;  2MBF A;  2OZU A;  2F4O B;  2VXZ A;  4IHW A;  1LVA A;  5GPA A;  2K27 A;  4KMU X;  1XGS A;  1HBX G;  2BVM A;  4J01 A;  3RIR A;  1F1Z A;  3OYN A;  2R7D A;  3SQN A;  3CJR B;  2FD5 A;  4RGU A;  2ZB9 A;  3JAM Z;  4BKX A;  3ABK H;  1NG6 A;  2HKO A;  2IEK A;  4LMY A;  4PJL A;  2K9Q A;  2WBM A;  3VYS B;  4RBO A;  4M6X A;  3GFJ A;  5IP6 A;  3RQ4 A;  4ESJ A;  2HZT A;  1REP C;  1VZ0 A;  3JRD A;  3HXL A;  2HPM A;  4M74 A;  1APL C;  1X4O A;  4MFE A;  4AM3 A;  2WV0 A;  3V7C A;  5E1X A;  4WXD A;  3GME A;  4BE0 A;  3FDY A;  5E3N A;  1X2N A;  4BS9 A;  4D9J A;  3F8C A;  1R22 A;  1S5L C;  1V55 H;  2NS8 A;  4IO9 F;  4FET A;  1MMN A;  4HAM A;  3ML6 A;  4JK1 X;  4H4K C;  1T38 A;  3FHZ A;  3KYD B;  2WAF A;  2HXO A;  4A3K J;  2BXZ A;  3I58 A;  2Q8K A;  2WC2 A;  4GCV A;  2DN0 A;  3OIP A;  1MBJ A;  3K1N A;  3AL0 B;  1W36 D;  2FML A;  4IVN A;  5L3G A;  2FQ4 A;  2Z2S B;  4K2E A;  1R1U A;  4P1W A;  3MKY B;  3WU1 B;  3Q9V A;  3EDP A;  3CCQ I;  2RVC A;  1X58 A;  5J3L A;  1ETX A;  2UUZ A;  1MMD A;  1K6O A;  1X1D A;  2OCE A;  3H36 A;  3K4N A;  4BU2 A;  2VJJ A;  2K02 A;  3A01 B;  3OR1 C;  1ZRD A;  4E7H A;  1ETV A;  3W2A A;  2ZCW A;  2FF4 A;  2IGO A;  4KUM A;  4FE7 A;  1OYY A;  3M8F A;  1UG0 A;  5LLQ A;  2F5C A;  1BW5 A;  4UUS A;  2XAQ A;  1BBY A;  2MYS A;  3J81 K;  3BPV A;  5DV5 A;  3F9K A;  2JMW A;  4ZH4 F;  4MTD A;  4XLH A;  4UUV A;  4CCM A;  2Y2Z A;  2IS6 A;  1T6S A;  2CYY A;  3F8N A;  2DMU A;  4RAF A;  2LP0 A;  5J6X A;  3WTY C;  4R1H A;  2EIM H;  3FKJ A;  2LC2 A;  1DU0 A;  4UUT A;  1UB9 A;  4QPO A;  2XGE A;  3F8F A;  1LFU P;  5DCM A;  3EUA A;  3H92 A;  1WI9 A;  1SVM A;  1UAA A;  1UEL B;  4DYR A;  4G7Z F;  3OYK A;  1RKT A;  4C2U A;  4KYW A;  3KP7 A;  4ESF A;  1D5V A;  5ERI A;  3PNT A;  4HA8 A;  4HST A;  3E5U A;  3C1D A;  3JRG A;  3RTR A;  2E2I J;  3WE3 A;  4ENM A;  4ON0 A;  2DT7 B;  4NQW B;  1RI7 A;  1X4P A;  1ZG1 A;  4KDP A;  4IHX A;  3RKX A;  3OYJ A;  2JPB A;  2LY1 A;  4C3I J;  3DWL E;  4HDV A;  5KVR A;  3HL2 A;  1X3W B;  3E7L A;  1FYL A;  2GXA A;  2OZ6 A;  2E1C A;  3C18 A;  1EA3 A;  2IS1 A;  3MFK A;  5D5W B;  3FXL A;  2LDU A;  4LGW A;  3CCL I;  1XMA A;  1Z3Y A;  4W97 A;  4YIR X;  1K4T A;  1JKO C; 
#chains in the Genus database with same CATH homology
 3F0C A;  3MVP A;  1GT0 C;  3W6V A;  1ETW A;  3BTJ A;  5FKM A;  2R5Y B;  3NAU A;  1SFO J;  3GTO J;  2HQ5 A;  5IOY A;  1ZGW A;  3PM1 A;  4D7M A;  4M3G A;  5F1J A;  5FKK A;  4A3G J;  2VUM J;  3A02 A;  3HGY A;  2CQX A;  2HYJ A;  9ANT A;  2TCT A;  1B72 B;  2D5V A;  1ETY A;  3GTP J;  3S1Q J;  1ETQ A;  3RKQ A;  1A5J A;  4FE4 A;  1ITY A;  3HOY J;  2GBY A;  3M3Y J;  2DA3 A;  2HXI A;  2KDZ A;  1AHD P;  1MH4 A;  2DJN A;  2ECB A;  1P7I A;  2MG4 A;  3H3V K;  2K40 A;  3QPS A;  3GTJ J;  3PO3 J;  1QVU A;  2L7Z A;  4B3A A;  1F43 A;  3RZO J;  3M4O J;  3GTG J;  2R7Z J;  1RPW A;  2NOG A;  1TWA J;  3SDG A;  1AKH A;  1MSE C;  5M3F J;  1MBE A;  2LK2 A;  1CQT A;  5E3L A;  5F08 A;  2JA5 J;  2JA7 J;  5EF6 A;  5C4X J;  5J1U A;  3BR0 A;  5IPA A;  4X6A J;  1ETK A;  2YU9 J;  3BT9 A;  2AHQ A;  1QPI A;  4HNV A;  1XG1 A;  4JX4 A;  4XIC A;  3S1N J;  3BG9 A;  3S1M J;  3Q0V A;  2ELK A;  4G12 A;  2E2J J;  3G1O A;  1I50 J;  3HDD A;  2XPW A;  1PUF A;  2VPR A;  3BR6 A;  3DCF A;  2R5Z A;  3BR5 A;  3FIS A;  4DZJ A;  1JKQ C;  2COB A;  2I10 A;  4BY7 J;  1HDP A;  4DW6 A;  2HOA A;  5JLW A;  3BTC A;  1RES A;  1JT0 A;  2HI3 A;  4ABZ A;  2R93 J;  3HEF A;  3B6C A;  4I6Z A;  3G1L A;  3OSG A;  1HCR A;  3MN2 A;  5IYC J;  2JK3 A;  5C44 J;  4V2F A;  2DMP A;  1WI3 A;  2MW8 A;  1LE8 A;  2E1O A;  2OPT A;  5F0C A;  3ZQC A;  2K9S A;  5DS9 A;  2WAQ N;  2ID3 A;  3FK7 A;  3L1P A;  1MNM C;  4JYK A;  2ME6 A;  4A3I J;  1NK2 P;  1GDT A;  1MSF C;  5J1R A;  4B1R A;  3BTL A;  1W0T A;  5C4J J;  3HOV J;  1BW6 A;  2XB0 X;  1ORK A;  1X2M A;  1P7J A;  5GP9 A;  1WCM J;  1JGG A;  4AYB N;  1ZK8 A;  2LLK A;  4DYQ A;  4BXX J;  2M2E A;  5EGO A;  3LOC A;  1TC3 C;  3ZOB A;  5F0H A;  3BG5 A;  3JRE A;  1FEX A;  2LVS A;  5K7Z A;  5IP7 J;  4A3M J;  3LSJ A;  2CJJ A;  3PO2 J;  2Y30 A;  5J1Y A;  3LSP A;  1H8A C;  4MLO A;  4Y7N J;  1T56 A;  4D5C A;  2RAE A;  1RET A;  1RKW A;  4FTH A;  2EZL A;  4FCY A;  3JRA A;  1B8I A;  2HOT A;  3JRB A;  2O9L A;  3A03 A;  2DTZ A;  1D5Y A;  1NTC A;  1XS9 A;  2CRG A;  3RZD J;  2WB1 N;  4UUS B;  3I4N J;  1TWC J;  1UG2 A;  3BQY A;  1XC5 A;  1F36 A;  1IJW C;  2X6O A;  5FLV A;  4LOC A;  1TWH J;  1GVD A;  3TW7 A;  4XK4 A;  3RQI A;  2X48 A;  1H88 C;  3DEW A;  4I76 A;  2LFB A;  3IV5 A;  3ZQL A;  4CYC B;  1BJZ A;  4C3H J;  1H89 C;  2Y0S N;  3JRF A;  2H8R A;  3HOW J;  1BL0 A;  2DA5 A;  1U78 A;  4BY1 J;  1R9T J;  2NVT J;  5FLM J;  2DA7 A;  4M3F A;  4MFD A;  3HOZ J;  4QSH A;  2XPU A;  3A01 A;  3CMY A;  3D1N I;  1MBK A;  2W48 A;  2JJ7 A;  1POG A;  2CU7 A;  3JRH A;  3IH4 A;  1MBF A;  2EZI A;  3ZQI A;  5M5W J;  1W0U A;  1HLV A;  3S17 J;  3QPL A;  3O8G A;  3S15 J;  2M8G X;  3CCY A;  2LKX A;  5M5X J;  1EF4 A;  3I4M J;  2MGQ A;  1FTZ A;  1OCT C;  1ENH A;  5JLX A;  1IV6 A;  1JKP C;  2HDD A;  3GTQ J;  1TWG J;  2VI6 A;  3CDL A;  4MO7 A;  1WH5 A;  2EH3 A;  4D7N A;  5F04 A;  3UKG A;  3ZQH A;  3BG3 A;  3JRI A;  1I3Q J;  1DU6 A;  5FKL A;  1OJL A;  2AO9 A;  4XRS A;  2O7O A;  4XID A;  4A3F J;  4IHV A;  3SFI A;  3TP3 A;  1MBH A;  2L7F P;  2VKV A;  2ECC A;  2XSD C;  5C3E J;  2P81 A;  1QVT A;  2FX0 A;  3G1M A;  3SJM A;  5EDN A;  1VND A;  1S7E A;  2M34 A;  3S16 J;  3JRC A;  2JA6 J;  2EQR A;  3BR2 A;  4S0H B;  2CUE A;  3S2H J;  1ZTR A;  1RR7 A;  4JX5 A;  2XGD A;  1JUS A;  2L9R A;  2G0E A;  1IUF A;  1HOM A;  2DMQ A;  3S2D J;  5IOZ A;  1FJL A;  3HOU J;  1IDY A;  2KT0 A;  1IDZ A;  3B6A A;  4AC0 A;  1IG7 A;  1Z0X A;  4QIW N;  1SAN A;  3VPR A;  3K2A A;  3GTL J;  5EG0 A;  2IBD A;  5F27 A;  1AU7 A;  2TRT A;  1Z77 A;  5FKO A;  2LR8 A;  1JUP A;  1YRN A;  3QQA A;  1AKH B;  3HKZ N;  1OCP A;  2XPV A;  3HM5 A;  3TW6 A;  3MKL A;  2DA2 A;  2R5Y A;  4FIS A;  2NVX J;  2LTP A;  5E3M A;  1ZR4 A;  4QTR A;  2JA8 J;  2FJ1 A;  2LD5 A;  3HB9 A;  1TWF J;  2JWT A;  1PUF B;  1B72 A;  1MBG A;  1VI0 A;  5GPC A;  2WV1 A;  2XB5 A;  5BNG A;  2R5Z B;  1ETO A;  4V2G A;  2LY9 A;  4JX6 A;  4W1U A;  2NVQ J;  3CQZ J;  2GLO A;  3NAR A;  1WH7 A;  5FJ8 J;  1JTX A;  3S14 J;  1BA5 A;  1K83 J;  1A6I A;  1Y1V J;  4L5E A;  2Y9Y A;  3WHB A;  5M3M J;  4JP0 A;  5M5Y J;  4A3B J;  1K61 A;  4AUX A;  1NK3 P;  4M3E A;  3Q3S A;  4C2M J;  1WPK A;  3FKI J;  4DZP A;  1LE8 B;  4MIM A;  3ZQF A;  2DA1 A;  3IH3 A;  2ME0 A;  3H0G J;  1JKR C;  4A3D J;  2YUS A;  5EG0 B;  4M3B A;  3HBL A;  2DA6 A;  1Y1W J;  2VKE A;  1GV2 A;  5FKN A;  1JTY A;  5E3O A;  2IAI A;  4RDU A;  3IH2 A;  2L7M P;  2GM4 A;  4B4C A;  2MSY A;  4BBR J;  2Y9Z A;  1IC8 A;  5EGO B;  3LSR A;  1IGN A;  4IHW A;  5GPA A;  2ID6 A;  2HOS A;  4GFB A;  2O8K A;  3WHC A;  5K7F A;  1GV5 A;  3OSF A;  4C3J J;  2FD5 A;  3Q0U A;  2ZB9 A;  1U9O A;  4BKX A;  3GTK J;  2IEK A;  4XRS G;  2K9Q A;  4RBO A;  5IP6 A;  3O8H A;  1B8I B;  5EZG A;  5IYB J;  3JRD A;  2JN6 A;  1APL C;  4MFE A;  2CUF A;  2L0K A;  5E3N A;  5HOD A;  1X2N A;  2M9H A;  1FIA A;  2NS8 A;  3FIW A;  3TP0 A;  3HGG A;  3S1R J;  2QF7 A;  2HXO A;  4A93 J;  2E19 A;  3Q0W A;  4IEJ A;  4A3K J;  3BR3 A;  1ZQ3 P;  1FTT A;  1MH3 A;  4M6V A;  2DN0 A;  4BBS J;  1MBJ A;  1JT6 A;  1HF0 A;  4NDL A;  2FQ4 A;  1WGX A;  4M3D A;  1X58 A;  5J3L A;  1ETX A;  1OFC X;  2CQQ A;  3GBG A;  3LNQ A;  1Q1V A;  4IHY A;  3GTM J;  2M0C A;  4A3C J;  3A01 B;  2X9D A;  2XGC A;  2QCO A;  3JR9 A;  3OOU A;  1JJ8 C;  1ZR2 A;  3HOX J;  1U8B A;  1GUU A;  1ETV A;  1U9N A;  2DA4 A;  4D5F A;  4A3J J;  4EEF G;  4A3L J;  2E2H J;  4FE7 A;  1JUM A;  3BTI A;  1BW5 A;  4UUS A;  3OIO A;  3ZQG A;  2B63 J;  5IP9 J;  1G2H A;  3TED A;  2JMW A;  2Y31 A;  4XRM A;  1VF9 A;  4DYC A;  2Y2Z A;  2N8G A;  3LSG A;  4X1E A;  2DMU A;  2EZK A;  4CYC A;  2LP0 A;  1T33 A;  2OF7 A;  5EYR A;  2NS7 A;  3K7A J;  1DU0 A;  4UUT A;  5EZH A;  5IYD J;  1HDD C;  1O4X A;  2XGE A;  1LFU P;  1E3O C;  4A3E J;  4DYR A;  4Y52 J;  1RKT A;  2NVY J;  2R0Q C;  2DMT A;  2R92 J;  1JJ6 C;  1I6H J;  3BR1 A;  3JRG A;  1UHS A;  3C2B A;  1IRZ A;  2K9N A;  1ZKG A;  3BQZ A;  5DTD A;  2E2I J;  2H1K A;  2EBI A;  2DMN A;  1UMQ A;  4IHX A;  4C3I J;  3E7L A;  2PMZ N;  1FIP A;  4J19 A;  1QRY A;  5EEA A;  5K7H A;  1LFB A;  4A69 C;  3FK6 A;  4W97 A;  2XRL A;  1YRN B;  2EZH A;  5F0F A;  1VFC A;  1JKO C;  2YS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...