1JGGA

Even-skipped homeodomain complexed to at-rich dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
57
structure length
57
Chain Sequence
RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the even-skipped homeodomain complexed to AT-rich DNA: new perspectives on homeodomain specificity.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords 5'-D(P*TP*AP*AP*TP*TP*GP*AP*AP*TP*T)-3'
total genus 19
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jggA00
3LOCA 1RKWA 4RBOA 1LFUP 3HOZJ 2TRTA 4V2FA 4EEFG 3S1MJ 3BQYA 3BTJA 4RDUA 4A3DJ 3FK7A 2P81A 4AUXA 2XGCA 3DEWA 3F0CA 3HEFA 1VFCA 4M3DA 1FTTA 4DYRA 2DA7A 2FD5A 1P7JA 2Y30A 3O8GA 1ITYA 4M6VA 2CRGA 1B72B 3QPSA 3NAUA 1BW5A 2E19A 3JREA 1YRNB 2HDDA 3S1QJ 4BXXJ 4GFBA 3IV5A 2LY9A 4D5FA 2DMQA 2JMWA 3MVPA 1ZK8A 1Y1VJ 3HKZN 4C3IJ 2JA5J 2DMUA 2FJ1A 4A69C 5M5YJ 5FKOA 2R0QC 2ID3A 2DMPA 2EZHA 3ZQIA 1G2HA 2DA4A 3CDLA 3WHCA 2CUEA 1JJ6C 3FISA 1ETXA 5EZGA 2E1OA 3GTLJ 2GBYA 3IH4A 4A3EJ 1OCTC 5C44J 2OPTA 5FKMA 1MBGA 1QVTA 2M8GX 2ECCA 1AKHA 1ZQ3P 1F36A 3CMYA 1ORKA 4MO7A 1U78A 4A3IJ 1X2NA 2YU9J 2IBDA 2X9DA 2EH3A 3BTIA 2YUSA 1HDPA 2FX0A 2HI3A 3BR5A 1Y1WJ 4A3BJ 4M3EA 3UKGA 1HOMA 2HXOA 3PM1A 2L9RA 1LE8A 5DS9A 4FTHA 1ETQA 1IRZA 4X6AJ 1I6HJ 1WI3A 3G1MA 4JX6A 1H89C 1AHDP 3RKQA 3LSJA 3GTQJ 5FJ8J 5IP9J 1A5JA 2LFBA 5J1UA 3IH2A 2ME0A 3BG5A 2GM4A 5IPAA 2R5ZA 3HOYJ 4W1UA 1JUPA 2K9SA 3ZOBA 2E2JJ 3BR2A 2CUFA 1HLVA 2XRLA 1JJ8C 1RPWA 4S0HB 1GUUA 1H8AC 1MSEC 4XRSA 2MSYA 2R5YA 4UUTA 1ZR4A 1XC5A 4AC0A 4IHWA 1QPIA 5FLVA 5EG0B 3PO2J 2AO9A 1F43A 3HGYA 2CQXA 5FLMJ 5C4XJ 3NARA 1A6IA 2EBIA 2H1KA 5F0CA 2XPVA 4A93J 1T56A 4W97A 3S1NJ 5BNGA 2N8GA 4MLOA 1JGGA 4I76A 3A01B 3I4NJ 2K9NA 2M9HA 1IV6A 4A3JJ 2QCOA 1NK3P 4DZJA 1MSFC 3HOVJ 2DN0A 3MN2A 1U9OA 4G12A 1AU7A 1B72A 3SDGA 1ZKGA 2Y2ZA 5GPAA 5EDNA 1ZGWA 2R92J 1ZTRA 1DU0A 1OFCX 3H3VK 3G1OA 1GVDA 4L5EA 1TWGJ 1BJZA 3G1LA 4Y7NJ 4ABZA 3BR6A 3HGGA 3JRAA 4V2GA 2XGDA 4XIDA 1O4XA 4CYCB 3CCYA 2OF7A 5C3EJ 1B8IA 3JRCA 2XGEA 3FKIJ 2HXIA 2XPWA 1TWCJ 1IJWC 1FIAA 5K7FA 5HODA 5E3LA 2DA3A 2XPUA 2LK2A 5IYCJ 1RR7A 2JWTA 3C2BA 4XRSG 5M5WJ 5EZHA 3BT9A 2PMZN 1CQTA 1JKQC 1I3QJ 1AKHB 3W6VA 3BR0A 5J3LA 4HNVA 1VI0A 3HBLA 2VKVA 2X48A 2VI6A 2NS7A 3RZOJ 3HOUJ 2M0CA 5F1JA 4JP0A 4BKXA 1ENHA 4B1RA 1IDYA 1WGXA 5GPCA 3CQZJ 5E3NA 2AHQA 1BW6A 1MBHA 5E3OA 1TWAJ 5E3MA 1K61A 3B6AA 3S15J 4C2MJ 3HDDA 1QRYA 1GV5A 4XRMA 4D7NA 4B4CA 1OCPA 2CJJA 3E7LA 4J19A 2NVYJ 5IOYA 1VNDA 2DTZA 2RAEA 4UUSA 2LD5A 2EZLA 3GTOJ 2R5ZB 1APLC 4JYKA 4FE7A 5EEAA 2HOTA 4Y52J 3HB9A 3GBGA 3BG9A 2CQQA 3SFIA 1JKOC 2Y9ZA 4D5CA 2DJNA 3JRDA 3S17J 2CU7A 5F0HA 1X2MA 5FKNA 1MBKA 1VF9A 1JT6A 1K83J 2ID6A 3TW6A 2R7ZJ 2DA5A 4BBRJ 1UG2A 3BTCA 2KDZA 2G0EA 3O8HA 5M5XJ 4IHVA 2LTPA 3ZQFA 5F0FA 2DA2A 1FJLA 2D5VA 4MIMA 1TC3C 1LFBA 2DA1A 3VPRA 1D5YA 3S14J 1EF4A 2DA6A 2GLOA 4XK4A 1GV2A 2QF7A 1BL0A 5DTDA 3DCFA 2MG4A 5GP9A 3L1PA 3M3YJ 5JLXA 1WCMJ 1PUFB 2DMTA 4JX5A 4DW6A 3JRFA 1P7IA 4JX4A 3TP0A 4XICA 1IC8A 3OOUA 1IG7A 1NK2P 1JKRC 2M34A 4AYBN 1H88C 4BBSJ 1FIPA 1RKTA 1NTCA 3IH3A 2K40A 5EGOB 1WPKA 5F08A 3Q0UA 2JA8J 1MNMC 4CYCA 3FK6A 3LSGA 4QTRA 1B8IB 2HYJA 3JRGA 4IEJA 2WB1N 3HM5A 1LE8B 2VPRA 3S1RJ 2VKEA 4M3FA 4M3BA 3GTMJ 4MFEA 3B6CA 5IP6A 4D7MA 5IYDJ 1TWFJ 2E2IJ 1IDZA 2WAQN 1MBFA 1JKPC 1ETVA 2O9LA 3BR3A 2L7FP 4DZPA 2XSDC 4FISA 4A3FJ 1UMQA 3FIWA 1HCRA 3TP3A 1MH4A 3MKLA 2NVTJ 5IP7J 2O7OA 1BA5A 1Z0XA 2NOGA 5IOZA 3TW7A 2H8RA 2Y31A 2JJ7A 2FQ4A 1Q1VA 5C4JJ 3HOXJ 4DYQA 1JT0A 1ETKA 1HDDC 2HQ5A 2L0KA 1RETA 2LP0A 5EF6A 2W48A 3GTJJ 3HOWJ 4A3KJ 2LVSA 1I50J 3LSPA 1X58A 2HOAA 2LLKA 1SFOJ 1IUFA 3ZQGA 1ETWA 2IEKA 2KT0A 1GDTA 2ECBA 2B63J 5JLWA 3JRBA 4DYCA 5FKLA 4A3CJ 4BY1J 3BR1A 2K9QA 1GT0C 2LKXA 3S2HJ 2IAIA 1U8BA 2COBA 3BTLA 3K2AA 2XB5A 4IHXA 3SJMA 2R93J 3GTKJ 2JN6A 3PO3J 2O8KA 4IHYA 4FE4A 2JK3A 4FCYA 1FEXA 9ANTA 3WHBA 2L7MP 4NDLA 1POGA 2R5YB 1ZR2A 1YRNA 2EZKA 2Y0SN 1W0UA 3H0GJ 1PUFA 5EG0A 3LSRA 1U9NA 3M4OJ 5M3MJ 3QPLA 3JR9A 1WH7A 3LNQA 4X1EA 2ELKA 4I6ZA 2NS8A 1MBEA 1JUMA 4C3JJ 5EGOA 2EQRA 3A01A 5M3FJ 2ZB9A 2ME6A 1HF0A 1XG1A 2YS9A 3K7AJ 2NVXJ 2E2HJ 3OIOA 1T33A 4A3MJ 3JRIA 3ZQLA 3A02A 1R9TJ 4BY7J 1E3OC 3Q0VA 3BQZA 3GTGJ 1MH3A 3Q0WA 2EZIA 1S7EA 4A3LJ 2L7ZA 2TCTA 3QQAA 2XB0X 1SANA 1Z77A 4C3HJ 4QIWN 5FKKA 1JTXA 2X6OA 1WH5A 3ZQHA 3S16J 2MW8A 1RESA 1W0TA 2LR8A 3BG3A 2MGQA 5J1YA 4UUSB 1XS9A 1FTZA 1JUSA 5F27A 1JTYA 1OJLA 4LOCA 5IYBJ 1UHSA 4MFDA 3RZDJ 3JRHA 3OSFA 4B3AA 5J1RA 1QVUA 2DMNA 3Q3SA 5K7HA 1ETOA 3A03A 5EYRA 2Y9YA 2JA7J 1IGNA 2NVQJ 2HOSA 3I4MJ 5F04A 4QSHA 4M3GA 4A3GJ 3RQIA 3D1NI 3GTPJ 1DU6A 1MBJA 2M2EA 3S2DJ 1TWHJ 3OSGA 1ETYA 3ZQCA 3TEDA 2I10A 5K7ZA 2JA6J 2WV1A 2VUMJ
chains in the Genus database with same CATH superfamily
1RKWA 1K78B 2VQHA 3PJRA 3BQYA 3KLNA 2DOFA 3IHUA 3ELKA 3FK7A 2K4JA 4HX7A 1WJDA 2VODA 1MW7A 2K7LA 4YFXF 1QPMA 3T8RA 1G3WA 2EFNA 2XGCA 2O61A 1VTNC 2BHZA 3WTWC 3FMSA 4O6JA 1QZZA 3F8FA 1QZYA 1XGSA 3BJ6A 1P7JA 1TT5B 4M6VA 4IRGA 3NAUA 4RGRA 3RPQA 1K4SA 1BW5A 3IUOA 2DQLA 2QKMB 1YRNB 4AIJA 4C30A 4GFBA 5D5XB 1SVLA 3BWGA 4LIVA 3MVPA 1I3AA 1ZK8A 4XKCA 4XLAA 1Z3XA 4XN0A 3K70D 5GTHC 2LOOA 4C3IJ 2JA5J 2XF6A 4DBRA 2D2WA 2R0QC 2ID3A 3ESWB 1LDDA 1FT9A 4FHTA 3CDLA 4GYGA 3GW2A 3WHCA 2CUEA 4AD9A 1J09A 4ZDLA 2IA0A 3FISA 1BR1A 4KUMA 5L3FA 3P7NA 5LBQA 4L9TA 3KZYA 5LEKA 1T38A 1I39A 2L4AA 1BC7C 5C44J 1OCTC 4EJWA 1QNTA 3M1EA 1U5TB 2R7XA 3DF8A 2ZJRF 2STTA 3OS1A 1ORKA 2QEXI 1BI1A 2P6TA 4A12A 2EH3A 3BTIA 1Y1WJ 4FX0A 4AVZA 4M3EA 3RPUD 3VYRB 3UKGA 1HOMA 4P9FA 4ZYGA 2R7RA 3RJPA 3COAC 4ENKA 3GO5A 2QKLB 5ICEA 1FMWA 3HSEA 1V54H 3HYIA 5D8LB 3CP2A 4E7ZA 1XGOA 3DXJF 4U88A 4LMYA 1I6HJ 1WI3A 3S93A 5ICFA 3RKQA 2PMHA 5FJ8J 4HNTA 4N4NB 3K70C 1RNLA 4NB5A 3ERMA 2LFBA 2RN7A 5E1WA 5J1UA 1YTYA 2D45A 3N4MA 1Z7LA 2R5ZA 2E71A 5GAGJ 1SD4A 1JUPA 3F21A 2CQKA 1W4MA 2PX9A 3DPLC 3HZJA 3TL4X 3CUOA 2JVGA 1YW9A 3QAHA 4OAYA 1USTA 4G7ZF 3K4CA 3K1NA 4UVAA 2MSYA 1X1BA 3OS2A 1I27A 3C7JA 4FQGA 4AC0A 1VQOI 4D9JA 4J00A 3WGIA 1S72I 1XN7A 3PO2J 2KRHA 2PG4A 4RGXA 1KZHA 2CW0F 4P96A 4OAZA 5F0CA 3RPUA 2XPVA 1BN5A 4A93J 3MZ8A 1T56A 5BNGA 2BY2A 4HSRA 2Y69H 1D0XA 1JGGA 2LF7A 3A01B 3C18A 1IV6A 1NK3P 4DZJA 3RI4A 1IRGA 4DQ2A 3HOVJ 4CZZA 3MN2A 4G12A 2KIFA 1SAXA 1LFPA 2Y2ZA 3MMYB 2HKXA 3ZRGA 2RQPA 2Y0MA 1G3TA 1ZTRA 1PDNC 1OFCX 3I56I 5E1XA 1BIBA 1Z6RA 4UV9A 1BJZA 3G1LA 4A0ZA 2DO7A 2BY0A 3LSHA 3BR6A 2GA1A 5ICCA 3EQLF 4G6QA 2L54A 4V2GA 1MMDA 4S04A 2XGDA 5TJJA 4ZZDA 1X1CA 1R23A 3G6EI 2HVQA 1B8IA 3L2VA 3JRCA 2FF4A 2XGEA 1GHCA 3FKIJ 4KIGA 4P1WA 5KVRA 1FIAA 4E7LA 1SEUA 2JPCA 5L3CA 3W2VA 2CV0A 3DKYA 3K0LA 4XRSG 1SFEA 3F23A 4BDYA 2EV5A 1RUOA 1CQTA 4RM3A 2IVMA 3K4BA 1PUEE 3CMEI 2LH9A 4M73A 2VKVA 3E1SA 5BPDA 2P5KA 1NG6A 2R7QA 3D5SC 4KYWA 3H5NA 1UCRA 3CO6C 3OL4A 1IDYA 3TGNA 2JSPA 2OUMA 1BW6A 1MBHA 5E3OA 2MLKA 3EUKL 5E3MA 3B6AA 3S15J 3HDDA 4L0ZB 2BV6A 2LKPA 3W6KB 4XRMA 4HPQA 2CJJA 2NVYJ 3FMRA 5D6FA 1SC7A 3TOAA 1VNDA 2DCEA 2DTZA 2RAEA 2CFOA 3LSTA 3CCUI 1T95A 3RYRA 2R5ZB 4YIFA 4HLXA 5FGMA 1APLC 4JYKA 1VQ6I 1Z9CA 2CQQA 3SFIA 4D5CA 1HXDA 3WTZA 5FKNA 3NEUA 1KONA 3ABKH 1HSTA 1JT6A 2I5UA 2OA4A 1K83J 2ID6A 2DA5A 1UG2A 4YFKF 2F5EA 5M5XJ 4XOTA 1ZLJA 5HLTA 3DTKA 2D5VA 2EIKH 3V7CA 1D8JA 2F4MB 3VPRA 1VQ7I 4Q5SF 1D5YA 3HJEA 3NWSA 1EF4A 2GLOA 4XK4A 4ZDPA 1GV2A 1RIOH 2X1EA 2LY2A 5CVIA 2VPLA 2QF7A 2HYGD 5J6XA 1BL0A 3A1YA 4IKFA 5HS7A 3PNTA 2EFOA 3HKZA 5GP9A 2EWNA 1U0JA 2E34A 1D0YA 3LAPA 4I0AA 1OCZH 4JX4A 1IC8A 1J0RA 1NK2P 3E0JB 5FO5A 2O0YA 4XR6A 2E35A 2QBYA 2M30A 3RYPA 1NTCA 3LA7A 2JSCA 5H6QA 2QLZA 5IT3A 1WPKA 2DFFA 3Q0UA 1CF7B 1K4TA 1MNMC 3LSGA 3OYLA 2FNPA 4Y4RA 5K5QA 2HYJA 2UWMA 3C1DA 3JRGA 3WU0A 1LE8B 1RZ4A 1YOVB 4II2A 4MTDA 2VBYA 4Q48A 4NBQA 2F5DA 3GTMJ 5F1RA 2ZXHA 2LDUA 3SZPA 2WAQA 2PJRA 4CUGA 1KYZA 5IP6A 3WTXC 4LFUA 4FT8A 4IRHA 3GUDA 5TISC 1D5VA 3I58A 2XVCA 1VQKI 1IDZA 3ZN1A 3QYBA 2WAQN 4II3A 3EUHA 4GYIA 1O3RA 5KCMA 4LB6B 1ZAOA 2E36A 2FRHA 2HS5A 1YJWI 4DZPA 4RS8A 1R6RA 2NVUB 4H4KC 5BPIA 2FBHA 3BROA 3A4CA 2BVLA 3FIWA 3IWZA 6PAXA 2IS6A 2DI3A 4HW0A 2OV7A 2FEZA 1A31A 2ISYA 2MC3A 1KU9A 2DU9A 3AFHA 1U3EM 1K7AA 2O7OA 1U5TA 2W25A 3OYAA 1P6RA 4GDFA 3MEXA 5H2FC 2WAFA 3TW7A 4KN4X 2Y31A 3IKTA 3CDHA 3IP4B 3BPVA 3OYBA 1P9QC 2FQ4A 4L18B 4Z6YA 3E5UA 1R5HA 3HL2A 3WTTC 4IO9F 2PJPA 2ZXWH 4BH9A 1QZEA 3I64A 4CCOA 3G4SI 3AL0C 3S32A 3ABTA 1X58A 2LLKA 4EJOA 1SFOJ 2IEKA 3HHHA 2B63J 3V4GA 1SVMA 5AIQA 3JRBA 5DM6F 3U21A 1SVOA 4C9YA 2ZCWA 2KIMA 4NC7A 1EJ9A 1HQCA 2COBA 3EYYA 3BTLA 2ZNYA 4IRIA 2XSJC 3BZ6A 3SJMA 2NRAC 2L5QA 4HOBA 2O8KA 3QOEA 2WA0A 2ELHA 4GXOA 4PJMA 3ZMTA 2L7MP 3WTSC 3OYGA 2MH2A 1J7KA 2W4SA 2X1CA 4HV5A 1KU2A 4Q47A 4PJJA 1POGA 2R5YB 3CC7I 4HLYA 4AU7A 2ELJA 2EZKA 2IS1A 2Z16A 5J8FA 1YJNI 2Y0SN 3K2ZA 3F6VA 1XSVA 3LSRA 2HTSA 3FXOA 3QPLA 4EM0B 3GFJA 3LFUA 2W7NA 4RB1A 2LNBA 3JR9A 1D1CA 4E7HA 4X1EA 4I6ZA 2W85A 2Y0SA 2CH0A 2EQRA 2A07F 2AQEA 2HYFA 3E5XA 3QRFF 3H9GA 4V19K 2P5VA 1T33A 4A3MJ 5LLQA 1Y0UA 4YIRX 1R9TJ 4BY7J 3TDZC 1SAUA 3GTGJ 1BI0A 4BL0B 1MH3A 2EZIA 3BC8A 3F3XA 2VONA 4B8XA 4A3LJ 3MCZA 1V5FA 1Z67A 4C3HJ 3KEYA 4QIWN 1DUXC 1JTXA 1WVRA 3LSMA 2ZJPF 3NWTA 3S3MA 1X3UA 1W0TA 3VB2A 4F52A 4S05A 3ECHA 5J1YA 1A36A 5BS6A 3ZQQA 3GCMA 3WODF 2EPFA 3CCRI 3H3ZA 1GVJA 4EVIA 3SHFA 1MNDA 2LC2A 1JTYA 2CMPA 2F5VA 1EH6A 2K85A 2BW3B 4HG2A 4LOCA 1UHSA 4MFDA 5IYBJ 4LLNA 1VQ4I 1VQLI 1WJEA 2IGKA 2V9KA 4EV0A 3BCBA 1TQMA 2MH9A 3OSFA 2XAFA 1LKXA 1S7AA 2DMNA 4A0XA 2GIZA 2WAEA 5FFXA 4OMZA 3A03A 2OU2A 5EYRA 5A2QZ 3HPHA 3OYNA 3ZCOA 2YU3A 2ZBKA 5F04A 4QSHA 5GAEJ 1X3ZB 5LD2C 2XKOA 2M2EA 3CUQC 3S2DJ 3OSGA 2KRFA 3TMOA 2H94A 4NUBA 5FFZA 1FYKA 2I10A 3K4KA 4PJ0C 2M45A 4IVNA 1LFUP 3HOZJ 1O3SA 2TRTA 1W7PD 1TL8A 4U0WA 3BTJA 2AXTC 2MBFA 1WSUA 4I01A 1USSA 1LQ1A 3L2WA 4RAGA 2EFQA 1XMXA 2JRTA 2A6EF 2E5NA 3DEWA 4E4HA 3MKZA 1DQUA 4M3DA 3GEZA 1FTTA 1NH3A 1BR4A 2OCCH 2A6HF 2VJ5A 3N05A 2Y30A 1ITYA 2DAOA 2CRGA 2E19A 3IWFA 4AYBA 1O57A 2VBZA 1MJAA 3H5AA 1ZREA 3S1QJ 3KX2A 4BXXJ 2PLYA 2A61A 3IV5A 3H9JA 1IXCA 2HPIA 2DMQA 5HNFA 1B59A 3K4JA 2MC4A 1Y1VJ 5B66C 3KPHA 5DM7F 1IN4A 1STZA 2OC6A 3VYUB 2FJ1A 4LLGF 4A69C 5M5YJ 1MJ9A 2EB7A 2DMPA 2EZHA 3PUFA 3ZQIA 3RTRA 5LGTA 1IN8A 4IQJA 3KYLA 1FNNA 1ETXA 4LG0B 2R7UA 2E1OA 1YI2I 3L00A 3F72A 2GBYA 4HNUA 2PQ8A 3GVAA 1MKMA 2M5WA 2V6CA 3SEZA 4CO8A 3QPTA 4N0BA 3RIRA 1AKHA 4NHJA 1I5ZA 1ZQ3P 1F36A 4MO7A 2E1CA 2EIJH 3KP5A 4KN7X 3FXJA 2HI3A 2FX0A 3I0TA 2D1VA 3BR5A 4XONA 3ZMVA 4A3BJ 2KISA 4BE1A 1XSXA 4XQFA 2DOEA 2HXOA 3JW4A 1D8KA 1Z21A 4M6XA 4ZYAA 5DS9A 1LE8A 4FTHA 3FXRA 4XKVA 4CSWA 2KP6A 3NRVA 4X6AJ 2E5ZA 3HTUA 4I02A 2P7CB 2CQ7A 1YLFA 2F6CA 1X19A 3G1MA 1AHDP 3MAJA 3R0AA 3VFZA 3GTQJ 4BXFA 1WJFA 1YS7A 2GA2A 3QYEA 3IH2A 1ZELA 2IA1A 1R58A 3ASOH 4BQNA 4ANJA 1YIOA 5D4RA 1Y6IA 3BG5A 3DP7A 2GM4A 4XLPF 4L9VA 2DK8A 2OCEA 4QPQA 4UY8I 5KNLA 1HC8A 2EIMH 2MD0A 2CUFA 2LBFA 2XRLA 4E70A 1RPWA 3M8JA 4S0HB 1GUUA 1H8AC 1MSEC 1P2FA 2R5YA 2BYVE 3RQ4A 1BI2A 4IHWA 4G6DA 5FLVA 1PYVA 4I7HA 1WWXA 3CF2A 5EG0B 2AO9A 1MDMA 3HGYA 3F8MA 3DTIA 2R7WA 1LDJA 1N75A 2ESHA 3FBIB 1Z7UA 3U1KA 4PFPA 4W97A 3S1NJ 5IT9K 1NHAA 3EUHC 4Y15A 3I4NJ 2K9NA 3K4NA 2KDOA 5F6FA 1BOBA 1OYYA 5EEGA 3OYDA 2XC7A 1MGTA 3ZMUA 2K5CA 4CXFA 1B72A 4M74A 3SDGA 4LD5A 1X1DA 1R1UA 4WXHA 2R92J 1OPCA 5BQTA 3H3VK 1GVDA 2IJLA 5FLXK 2DJIA 2OQRA 4BU2A 1YHQI 5CPRB 3J80Z 2FBIA 3JRAA 1VQNI 4Y13A 2BY3A 4YRVA 1T2KA 1TW3A 2ZSHB 1QA6A 1YG2A 2XPWA 4D0PA 3HRTA 5E3LA 3KP7A 2LK2A 1RR7A 3AG1H 2H8WA 3L9FA 2KJCA 4I09A 3BJAA 3BT9A 2V9PA 1D1AA 2M4KA 2H6BA 1AKHB 1IRFA 3W6VA 2GXBA 2VIXA 1OR7A 4Y17A 4HA8A 4N9IA 1VI0A 4OU0A 2VI6A 3J7YJ 3RZOJ 1P4XA 3HOUJ 3KZZA 2MD5A 4BKXA 4B1RA 1KYWA 5GPCA 1MMAA 2CFXA 5E3NA 4BUPA 3EUAA 3ZXSA 1K61A 2VE8A 2EFPA 4C2MJ 1IO2A 3TDUC 2ZMEC 4L5JA 1QRYA 2K4BA 2KKOA 3KEQA 1GV5A 2NYXA 3KP4A 3DFGA 5K1YA 2LYCA 4BHCA 1F5TA 3BJOA 4RMNA 1OMIA 1TTYA 4MEXF 2EZLA 1XCBA 1XGNA 1UB9A 4KJZA 2HOTA 3BG9A 2L9NA 4BJTA 2AQFA 3HOSA 2DJNA 2DT7B 2STWA 1TP4A 2P8TA 3EPZA 2CU7A 3I5UA 5E18F 1MBKA 2FMYA 3DQVC 4N9HA 4I98B 1MZBA 4RAFA 2A5YB 3M8EA 5LHGA 3A0BC 5LGNA 2G0EA 4XORA 4E7SA 5ILVA 1OYWA 3REOA 5F0FA 2DA2A 3BG6A 3HRMA 1IAWA 1TC3C 1LFBA 2DA1A 1W1WE 1GLNA 5E1ZB 3S14J 1R7JA 2FUG2 3BP8A 4ZDOA 3PQKA 3G71I 2BBYA 3IAM2 4PJNA 5DTDA 3HRSA 4ZYEA 3K4MA 1FMVA 3DCFA 2MG4A 2GZWA 2VBXA 5ILUA 4A2UA 1BI3A 3M3YJ 5JLXA 4MEYF 4BYYA 1PUFB 2BY1A 1QBJA 2YR2A 3I3LA 4G7HF 1V4RA 3JAMK 1R36A 2Z3YA 4U87A 3TP0A 4L9JA 2UXNA 1A35A 3KYCB 1T08B 4ESBA 3PFYA 2HDCA 2WY8Q 1FIPA 4ITVA 3IH3A 2K40A 2XRNA 5F08A 4I99C 5FRMA 4RB3C 4CYCA 1EH7A 3H9QA 1MMSA 2HVRA 4BGDA 2JA6J 3VOEA 2VPRA 4UB8C 2R4GA 2V26A 1BM9A 4A0YA 1Z6TA 1SFKA 4E6KG 3GLLA 1ONVA 2RDPA 3EETA 3CO7C 4D7MA 3O6BB 3CMMA 4KFCA 4UXNA 4Y3OA 2F5CA 3E6CC 1ZG1A 2HZDA 1YE9A 2X6XA 1ERDA 1VQ8I 1MBFA 1HW1A 3I71A 3OR2C 1JKPC 1ETVA 3BR3A 2XSDC 3BZCA 4FISA 3E6BA 1WJ5A 1J75A 2XDVA 1UMQA 3RCOA 1IXRC 2VJ4A 3ZPLA 1XD7A 4IJAA 4M71A 2PBIA 3V7RA 3GYHX 1MH4A 2KMUA 4BQAA 3MKLA 4E7IA 2NVTJ 2PI0A 3T5XA 5IP7J 3KP3A 4CCJA 3O2PE 1MMNA 1I6XA 1Z0XA 2VXZA 1ZRDA 2NOGA 3ERED 1O3QA 2DBBA 3QYFA 4O5VA 5CYVA 5C4JJ 3HOXJ 3BZKA 1JT0A 2QVOA 3JTGA 1KGSA 3H0DA 2HNHA 2R7FA 4UB6C 1HDDC 1ZRFA 2W82A 3S2WA 4PFOA 4RGSA 3GTJJ 2EFWA 4A3KJ 3HOWJ 1I50J 1SD5A 1IUFA 1TQPA 2KT0A 2M0MA 4XMYA 3QWLA 1KA8A 3HG9A 2VL8A 3DEEA 3BR1A 2A05A 1LDKB 3B02A 2K9QA 2X85A 3BOQA 3DLAA 2LKXA 1GT0C 1N78A 2WWYA 2IA2A 1U8BA 3VSLA 1OCOH 4XBFA 3CCEI 1ON1A 3BY6A 2R93J 1DP3A 4B09A 2I8DA 1R49A 3DTEA 4KT6A 1LNWA 1WJBA 4R79A 4FCYA 5ILSA 4L0YB 1VQMI 3ZGKA 3IAS2 1FEXA 1MIJA 1S29A 2CYYA 4XM3A 2Z5UA 4WXDA 4NDLA 1ZR2A 3PL8A 2R7SA 4F92B 1ZH5A 2XAUA 2J5OA 4HEA2 1UELB 1LB2A 1FOWA 1PUFA 1SMTA 3M4OJ 1F1ZA 4HRIA 2V7FA 1Z05A 1R5GA 2HOEA 3HHGA 4PSXA 2DXIA 3ABLH 3MZHA 2Q2EB 2M3AA 3K4LA 1YS6A 3LNQA 4CDGA 2FXAA 2ELKA 4KISA 3ZMSA 3BPXA 3A01A 2FQ3A 3ISPA 2ZB9A 1CF7A 4ZTFA 1FWZA 4BNCA 2YS9A 3K7AJ 4EQQA 3ZQLA 1I1GA 2YX4A 3Q0VA 1DGWY 3BQZA 3AAFA 1R4NB 3OIPA 2L7ZA 3SZGA 2TCTA 2CSOA 3QQAA 3HSRA 4U0VA 4XKBA 3RKXA 1KQ0A 1SANA 4IPAA 3L2RA 3CJRB 2NOJB 5CVJA 3S16J 2VJIA 1RESA 4RAZA 3KCCA 2ZJ2A 1XS9A 4UUSB 3OY9A 2DYRH 3JTHA 2HQRA 1FTZA 1BR2A 2DYSH 1OJLA 2IGNA 4P5OA 2P5LC 1YFHA 2EV0A 4B48A 4WCGA 2F2EA 4ZTJA 4FX4A 1ACIA 4KMFA 4EJVA 5HDGA 5KHDA 3OYHA 2NS0A 2V1DA 3ECOA 2CW8A 2R3SA 3Q3SA 1QO0D 3ASNH 3PQJA 5K7HA 3T8TA 5ICGA 1MJBA 5BMZA 2EINH 2G7UA 4G9YA 2LKSA 1XX5A 1YW7A 2YSRA 1VQ9I 5HVQC 1IN5A 3RQIA 4B44A 4LJZF 1TWHJ 1G4DA 4EJTA 2VC0A 5CVUA 5K7ZA 2ACJA 3DU5A 3D5RC 3LOCA 4R1HA 4RB2C 3I54A 3LL7A 4KNYA 4F55A 1OLTA 3S1MJ 1WKMA 4RDUA 4DIQA 2D1HA 2ZFUA 4XLEA 2GQQA 2KIUA 3MKYB 3F9KA 2BGCA 3HEFA 5KAFC 1TNSA 3AL0B 1T98A 2X6WA 1RC9A 2GWRA 1ODDA 2DLLA 1FC3A 1SFUA 2BHYA 2DA7A 3SFZA 3WTUC 3PNVA 3WTVC 4E7KA 1TW2A 2VQLA 1B72B 4FETA 5E79C 3QPSA 4ON0A 4RA2A 3VYSB 2QQBA 2O6GE 2L01A 3M8FA 3JREA 3CC4I 4ESFA 5CJ9A 3OYJA 2HDDA 1J5YA 2CUZA 2Q1ZB 2W57A 3CCQI 1XSDA 4EM2A 2LY9A 5CQGA 2EJRA 4D5FA 3HKZN 3KE2A 3PSFA 2BXZA 2O03A 2X4HA 5EEHA 2UV1A 1EH8A 2A68F 4ESJA 1HW2A 3BCAA 1MNEA 2DA4A 3AG2H 4ENNA 3CTAA 2EA2A 2HZTA 2R7TA 1YQAA 3D0SA 1V55H 2OJED 2XAJA 1HW5A 3L09A 5J8CA 2GOXB 4OIQF 3WGGA 2CQNA 1N77A 3DV8A 5F64A 3KETA 2COMA 1Y8RB 3H5RA 2QQAA 4XLFA 5FKMA 3VODA 2VT2A 4AVPA 3OYFA 1ZGJA 2M8GX 2HU9A 2VKDA 1AWCA 1W7PB 3HC7A 3VEPA 2L9SA 2IBDA 4J01A 2X9DA 2YUSA 5LHIA 5FB2A 3CCJI 2VN2A 3F22A 3M07A 2IT0A 2M7BA 2L9RA 1BBYA 2XF7A 4RAYA 2DFHA 3LQRA 1ETQA 2Y48A 1X1AA 1IRZA 3K6GA 2A6TA 2XUBA 4B3XA 3W2WA 2RV8A 2FU4A 3I59B 2XF5A 1FBQA 1B6AA 4HF2A 3R4KA 1S6LA 3R6SA 3CCSI 2NAZA 4HDUA 2ME0A 1X3WB 4RGUA 3SXYA 5IPAA 2NXNB 1HKSA 3FM3A 2E2JJ 1KU3A 3BR2A 2P4WA 3OMYA 1HLVA 3GZ5A 1JJ8C 5L3GA 1OKRA 1YX3A 1OISA 4ZJZA 2JRMA 4DNCA 4BQQA 2V79A 1QPIA 2EA4A 1FYMA 4KIBA 2K9MA 1F43A 2CQXA 5C4XJ 1E17A 3NARA 1KU7A 1A6IA 2EBIA 2KPMA 4LIUA 3ZR8X 4HV6A 1PP7U 2N8GA 1YIJI 4MLOA 3UNGC 4I76A 4KITB 2M9HA 4AWXB 1R4MB 4YFNF 4ENMA 1J59A 2M4GA 5BOXA 4C2TA 2K3PA 1TZLA 2YX7A 2E7XA 2DN0A 1AU7A 1OR7C 4CICA 1ZKGA 5GPAA 5K5OA 3M9AA 2QQ8A 1DU0A 4K2EA 4CH7A 3G1OA 4L5EA 2ZMEB 4F7ZA 5FRNA 3LWFA 1SMYF 2ZXIA 3CESA 3ROUA 3V42A 3HGGA 1RRJA 2NNNA 4MTEA 1Y8QB 3JSPA 1O4XA 4CYCB 3CDIA 3JCUC 5LRSA 4HX4A 2R7OA 3CCYA 2OF7A 3J7AY 1TWCJ 2RNGA 5GTIC 1KQ9A 3CC2I 3PNYA 3HTSB 3AG3H 2JUCA 2JVHA 4CCNA 1SD7A 5JHFA 4KICA 5IYCJ 3I55I 4IOAF 1QU3A 3WU1B 5M5WJ 5EZHA 1T0FA 2HGCA 3H3UA 4HX8A 4H0EA 2PMZN 2K86A 3FXUA 4UNOA 1FOKA 2UXXA 4KMUX 2KRCA 3BR0A 2WY7Q 5J3LA 2QSFX 4DBQA 5KAIC 2HQAA 1HKQA 4GGGA 3U2RA 1VQPI 2PMZA 4L5IA 1R5ID 2NS7A 1TBXA 1S3JA 3CUQA 3N97A 4BAYA 4R8HA 2M0CA 5F1JA 3OOPA 1S9HA 4DJAA 1BJAA 3GFLA 4IF4A 2F4OB 5H6RA 3BLYA 3JAMZ 2M8EA 3WTYC 1W5SA 3HXLA 1TWAJ 3DEUA 1RUNA 2JUGA 1G3YA 4JOMA 3TO9A 4XNFA 1OCRH 3LA2A 3I59A 4B4CA 2ZKZA 1OCPA 3Q9VA 3FM5A 4CGZA 3E7LA 2R7DA 1HSJA 3J80K 4BHPA 3GFIA 5IOYA 5D5VB 1WZ2A 1VZ0A 1IN6A 5B5EC 2QA4I 1Y56A 2VJJA 4WK8F 1W36C 2RKHA 1R22A 1PP8F 2VB6A 4Y52J 1JHHA 2E1MB 2W84A 1JKOC 1B4AA 4OWRB 2DW4A 2VUMJ 3MWMA 4M6YA 3OYCA 1X2MA 5JR3A 2E7WA 4LK1F 1D3YA 1O7FA 5KK1A 2HVSA 1DPRA 1G3SA 2R7ZJ 1WRJA 1X4OA 4BBRJ 4G7OF 2RREA 1DDNA 2LTPA 1UFMA 3SQNA 3E5QA 2A5WA 3CMAI 2RQQA 2W00A 3KP2A 3KP6A 2DA6A 5GAHJ 4Q4ZF 4ENJA 3OS0A 1LUJB 1RR8C 5LFAA 2MLGA 1JGSA 5LHHA 1ZARA 2QENA 1ON2A 2ETHA 4XSXF 3ZP5A 4JX5A 4YELA 4DW6A 1R00A 1BOAA 3P5JA 1P7IA 4XICA 3JSOA 3OOUA 3C2GA 1IG7A 2M34A 2EK5A 2LSOA 3V7SA 4AYBN 3MKWB 4CCMA 1H88C 1RKTA 1XCVA 2H6CA 2A3SA 2M7AA 2WB1A 3H92A 4A5MA 5HDNA 5AIPA 3DKWA 1QQIA 4G8XA 5EGOB 3CP8A 3K69A 1XDUA 1XTAA 3FK6A 4UV8A 3W3CA 5E20A 1B8IB 3V8KA 2VC1A 4BHBA 4IEJA 2WB1N 2XASA 3HM5A 4NNJA 3S1RJ 4OMYA 2ZSIB 4M3FA 4M3BA 3FXKA 1AA7A 5J4YA 2EILH 4RLQA 2NNYA 3G3ZA 3HOTA 3P9CA 4XN3A 2O8XA 1TWFJ 5DDGA 2VXDA 2IS4A 2E2IJ 2MFZA 2UZKA 1ZRCA 3E97A 4KA4A 1ULYA 2O9LA 3K10A 3W6JB 2CW7A 1U2WA 2WV0A 3HUGB 1H0MA 1YYVA 4XSZF 4LLLA 1YITI 2W24A 3L2QA 1M1EB 3P9IA 5A2QK 1UHWA 3TP3A 4KT5C 4NQWA 1K6OA 3I4PA 1BA5A 1FSHA 3F8BA 4XRFA 3FX3A 3FZVA 4DGWB 5IOZA 5DUKA 5J4VA 5JFRA 1TT0A 2XGXA 4DYQA 4LG3A 4X0GA 2XHKA 4U7BA 2KIQA 4CA0A 4YIIA 2DTRA 3RSNA 3ABMH 2L0KA 1RETA 5EF6A 1XMKA 1P4AA 2VLAA 5JVGF 1SFXA 2LVSA 1E3PA 4ZYDA 3LSPA 2HOAA 3ZQGA 1ETWA 2Z2SB 3GF2A 2ECBA 4B47A 1GDTA 1PJRA 5JLWA 2HR3A 3OYKA 3CCLI 4A5NA 3R0JA 2IRFG 5HDKA 5D5UB 1GXPA 1GXQA 2XB5A 4KDPA 4IHXA 2XAHA 2E60A 1VQ5I 3ABUA 3TQNA 4AIDA 4F91B 2JN6A 3PO3J 4IHYA 3GX4X 4FE4A 2JK3A 4UUVA 1FP2A 5JI6A 3TO6A 3ULQB 3WHBA 3DPUA 2V1UA 1FSEA 3LMMA 2DODA 3V8LA 1WQ2A 3FHNA 1YRNA 3CJTB 3H0GJ 3DU6A 3GZNB 5EG0A 1IN7A 4U7DA 3KZIC 5M3MJ 2AXLA 2FBKA 3S3OA 1UZCA 4CCLA 4A6DA 4XLHA 1WH7A 1Q1HA 3QP5A 1OCCH 2PEXA 4PDKA 3GLXA 4EATA 1MBEA 3X2QH 2CV2A 1JUMA 1X1PA 3I53A 5CQEA 5EGOA 3IL2A 1XG1A 4GRIA 3KEOA 2ZC2A 2OD5A 3GXOA 4M9ZA 3JRIA 1E2XA 3C3WA 2XAGA 4XL9A 3IC7A 4C2UA 2LRDA 1MMGA 3Q0WA 3J7ZI 1S7EA 3GWZA 3ZMZA 4BE2A 2CS3A 5K5RA 5LGUA 3EYIA 4RM2A 1Z77A 2LMDA 4Z2YA 3DLLF 2RC4A 3O3KA 2GOMA 1QHHD 2X6OA 1AOYA 2CGPA 4M9XA 2AS5F 2LR8A 1LEBA 2IGOA 2RGVA 1LEAA 3L2CA 3CD6I 3R60A 1JUSA 2DT5A 3TBIA 2FSWA 1T6SA 2IP2A 1TNTA 3FXLA 1ZG5A 2B9SA 5DEQA 3FF5A 3RZDJ 2IS2A 4HF1A 2GAUA 3U1DA 1EV7A 2WC2A 4NC8A 1BIAA 2DOAA 2F5FA 3DWLE 2FE3A 4WX9A 1FOYA 1W36D 1OYIA 1PVEA 2JA7J 4BJ5C 2HOSA 2EV6A 3CUQB 1R1TA 3I4MJ 4HDVA 4CYDA 4A3GJ 3GMEA 2P0WA 1DU6A 1MBJA 2OZUA 3ZQCA 1FZPB 2ESNA 4MHGA 4U0YA 3HIFA 2WV1A 2DDAA 5HS9A 4IOCF 4RBOA 1IUYA 2X0LA 2ZNZA 4V2FA 4EEFG 1G8XA 1MDMB 4A3DJ 1IF1A 1Y0NA 1T0FC 4OINF 1X4PA 2P81A 3WGHA 4AUXA 5FROA 4PZJA 5DD8A 3F0CA 1REPC 3D5LA 2M1BA 1SD6A 1VFCA 2LREA 4IZZA 1W5TA 5CLSA 1NG7A 5CVVA 4DYRA 1IZ1A 1TLHB 2FD5A 1IV8A 2L02A 5AONA 3O8GA 1D0ZA 3KYDB 3ZQ7A 2VE9A 2HWVA 3E6MA 1LVAA 3E6DA 4WXCA 1F4KA 2JMWA 4ZH4F 5JVTA 2HQNA 3HSFA 4O3MA 3TKYA 5D8KB 3S3NA 2DMUA 1FOXA 5FKOA 2DPDA 1ZYRF 2BXYA 2JT1A 1G2HA 2IGMA 2CO5A 2F4IA 3A0HC 2XV4S 1JJ6C 1DP7P 2L4MA 1A04A 5EZGA 3FBNB 5J47A 4M9SA 2DQRA 4EM1A 3GTLJ 1YJ9I 2HPMA 3IH4A 2QSHX 5H20A 2LY1A 4A3EJ 2BOLA 3LA3A 1H9GA 2OPTA 1Z3YA 3OIQA 5LRRA 5L3BA 3MZYA 1MBGA 1QVTA 2ECCA 3CMYA 1U78A 3FXQA 4A3IJ 1X2NA 2YU9J 1Z1DA 1HDPA 2OBPA 3VYTB 4I0BA 3HPGA 3SZTA 4PCQA 2CUJA 3QPHA 4AIKA 3QU6A 2QM3A 3PM1A 2KZVA 4ZC3A 1JXSA 3NQOA 4A6EA 4AM3A 1WJCA 3PSIA 3CZ6A 2KZGA 3DBRB 4P9UA 5JHUA 1KQ8A 4BJ6C 4P55A 1JE8A 1YX5A 2IW5A 2RNJA 2BVMA 2L3DA 3J7AO 4JX6A 2M87A 4M72A 1H89C 1FLIA 3LSJA 4HF0A 5IP9J 4CHUA 5DYMA 4I2OA 1A5JA 2Z1DA 2UUZA 4MGRA 2YPRA 2IXSA 2JPBA 2R7VA 2O3FA 3KLOA 1EKEA 2WBMA 1LJ9A 2VT3A 5B1BH 3HOYJ 3FXMA 3GFMA 3K1PA 3HUGA 4W1UA 2K9SA 3PUBA 3ZOBA 1I1SA 4N4OB 3CCMI 4XLNF 4XRSA 1K79A 2F48A 3CJNA 4ZZLA 3J81Z 4XKWA 4UUTA 1ZR4A 1XC5A 1WHUA 2KQRA 2HDWA 5E8GA 1K78A 1CGPA 2L7KA 4YG2F 5L3EA 5FLMJ 2C6YA 2OTJI 4QLCU 3OWTA 3B73A 2H1KA 1WJAA 3ML6A 3CF5F 1FP1D 3WG7H 2X6YA 1DPUA 2QUFA 1V3FA 4A3JJ 2QCOA 1MSFC 2Z99A 4RB0A 2O5RA 1FBSA 4HBLA 4OOIA 1U9OA 2DDBA 5IY5H 4D1QA 1T39A 3LSKA 5EDNA 1ZGWA 2L2OA 4NC6A 1FYLA 1WFXA 4WF2A 1J9IA 5CKTA 1TWGJ 3HRUA 1K6YA 2X51A 2VASA 2ZXJA 4Y7NJ 4ABZA 1HKTA 4PSWA 4YEJA 2FOKA 1U6GA 1IRXA 5DCMB 2VOOA 3UR3C 1D1BA 4XIDA 5HLGA 1C0WA 5C3EJ 5DD4A 3J81K 4F3QA 2Y75A 4F93B 2K27A 3KFWX 1YO5C 2HXIA 1IJWC 5K7FA 2KJBA 2BW3A 5HODA 1FPQA 2HKOA 2DA3A 2XPUA 4QWQA 1DGRM 2JWTA 3C2BA 2PJRB 5L3DA 4LB5A 2ZJQF 2OZ6A 2V9VA 1JKQC 1I3QJ 3C2HA 2Q2EA 1T8IA 2GXGA 2TDXA 3QOPA 3QU3A 1UG0A 3OL3A 4HNVA 2QYOA 4BEHB 3HBLA 3RDIA 3ZMDA 2VOPA 2X48A 3MFKA 2JTVA 3TOBA 4BDZA 1HA8A 3K1MA 4BQOA 1XPXA 2ZFWA 4JP0A 1ENHA 3PIPF 3U9GA 2PMUA 1WGXA 2QSGX 3CQZJ 2AHQA 2G7HA 2Q8KA 3A2KA 2B7EA 4EGZA 4ZYHA 4GO1A 3BDDA 4NQWB 2H1LA 3SYTA 3H1CA 3W2AA 3QP6A 4D7NA 4J19A 3RKYA 2CWEA 4EMSA 3IKVA 3OV8A 4RLFA 1J2XA 3OYIA 2QQ9A 4UUSA 2LD5A 1ZLKA 3GTOJ 2HEOA 2BZTA 5HLHA 4LGWA 3LQQA 4FE7A 4BS9A 5EEAA 3PIOF 3HB9A 1R1VA 3GBGA 2LF8A 2DPUA 5D4SA 4E7JA 3QODA 3EDPA 2DFEA 4JK1X 2Y9ZA 3JRDA 2ZO4A 1P4WA 3S17J 1B9MA 5F0HA 2JZYA 2GXAA 1VF9A 2OAZA 4JQFA 3Q5FA 4IX7A 1ZGAA 4HZFA 2PN6A 3TW6A 4EJUA 2XAQA 4EGYA 3BTCA 2KDZA 5E8IA 1U8RA 2XROA 3O8HA 3M7GA 4IHVA 2V4JC 3ZQFA 3LFKA 2V1NA 4Y33A 4B43A 1FJLA 4MIMA 2FMLA 1G6NA 4IL6C 2A69F 3SEQA 3FKJA 2K3FA 3E3VA 4ETSA 4LITA 4GCVA 2LG4A 5B3SH 3WE3A 1S7OA 3FWEA 5D6EA 3L1PA 4XLCA 1WCMJ 2P7VB 2DMTA 1XDSA 2VKHA 3V8JA 4WWCA 3JRFA 5IT9Z 4IQ4A 1S8NA 3WG9A 1W5CC 4XOPA 3T1BA 1O3TA 1JKRC 4BBSJ 3IRQA 2FNAA 3I9V2 2DT6A 4HQMA 2H09A 3L7WA 5DCMA 2CG4A 2JA8J 3Q9SA 2WTEA 4QTRA 4PK4A 5E17F 1V5EA 1L0OC 1UHMA 1A6QA 4AIHA 1R71A 1IW7F 2FOWA 5HLIA 2WADA 2KHMA 5HNHA 2VKEA 2V6EA 5FLXZ 3IRRA 2K9LA 1S5LC 1U5TC 3M1CA 4TV7A 2OTLI 4MFEA 2VBWA 1XMAA 3B6CA 4L9NA 1RI7A 4OIOF 4HSTA 5IYDJ 5FD5A 3VDXA 4CZCA 2HTJA 3AG4H 5ED4A 1XB4A 2Q0OA 1V5GA 1ZN2A 2L7FP 4G94A 1TQIA 3OYMA 2XIGA 4LG0A 2LBFB 4A3FJ 2MABA 1HCRA 1FY7A 2X1DA 4OIPF 2DFIA 5FD6A 2W1OA 4MNUA 1HBXG 3DBHB 2KL4A 5DUIA 5CVRA 2RVCA 2H8RA 5EJCA 2Z33A 2JJ7A 2VQCA 3OYEA 1Q1VA 2E1MC 3LSIA 5J40A 4HYEA 2GIVA 4KIFA 3P9KA 3K9TA 1N25A 1ETKA 3CJQB 4LK0F 3DKXA 1JHFA 2HQ5A 3CLOA 2LP0A 2W48A 3F8NA 3R61A 4BXUA 3MQ0A 2H27A 1EA3A 1P92A 5FKLA 4DYCA 4A3CJ 4BY1J 1E0EA 2QGUA 3S2HJ 1FBUA 2IAIA 1JI8A 2B0LA 2G9WA 4CCKA 5B1AH 3K2AA 1B9NA 2HFHA 1LVKA 4MQ9F 2L9VA 4DOZA 2V1XA 3GTKJ 3H35A 5HS8A 2ADUA 2E1NA 9ANTA 4PGGA 1O7LA 3FMQA 4UVBA 3F6OA 1OQYA 2KLOA 2BE5F 4IHSA 1Z91A 1W0UA 3GZ6A 3H36A 1U9NA 3ZN0A 5TGTA 1L3LA 1ZG3A 2JQ7A 5HOOA 1XGMA 2QBYB 3WE2A 2NS8A 4BEHA 1UJ8A 2ICWG 1LPQA 4C3JJ 3L2UA 5M3FJ 1F9NA 2ME6A 1HF0A 2NVXJ 2E2HJ 2DK5A 4PGHA 3OIOA 3ONQA 4G6TB 2OQGA 3FDYA 2K02A 3A02A 1E3OC 5DCFA 2BEOA 3DBLB 3VSKA 3MD2A 5LEJA 3AKZA 5GADJ 3VWBA 3LAJA 2VQGA 2XB0X 4IXAA 2ZMEA 5FKKA 1Y39A 4UVCA 1W7PA 4HAMA 3S8PA 2ISZA 1YW8A 2PFBA 2QWWA 5DV5A 1WH5A 3ZQHA 2MW8A 4PUSA 3FHZA 2QZ8A 3OR1C 4PJLA 3BG3A 2MGQA 1ZHFA 4FASD 4BE0A 1QGPA 1B1BA 3DPTA 5F27A 4UHTA 5ERIA 2Z9OA 1QHGA 4JBAA 3WU2C 2XKPA 1E3HA 3KIOA 2CV1A 3G2BA 1IXSB 3SDBA 2MYSA 1BC8C 3TO7A 5TRDA 3JRHA 2IPQX 3BG7A 3CLQA 4B3AA 5J1RA 1QVUA 4IHTA 4MQVA 1ETOA 4HQEA 5D5WB 3F8CA 2Y9YA 1IGNA 1MD0A 2NVQJ 1WI9A 3PFIA 3CCVI 4OIRF 4M3GA 1H9TA 1FX7A 3D1NI 2KFDA 3GTPJ 2P6SA 3G73A 4ASNA 1ETYA 2J5PA 3RKWA 4BACA 1UAAA 2MA3A 3TEDA 1G59A 3T0YA 2JA2A 2FA5A 4QPOA
chains in the Genus database with same CATH topology
3LOCA 1RKWA 4RBOA 1LFUP 3HOZJ 2TRTA 4V2FA 4EEFG 3S1MJ 3BQYA 3BTJA 4RDUA 4A3DJ 3FK7A 2P81A 4AUXA 2XGCA 3DEWA 3F0CA 3HEFA 1VFCA 4M3DA 1FTTA 4DYRA 2DA7A 2FD5A 1P7JA 2Y30A 3O8GA 1ITYA 4M6VA 2CRGA 1B72B 3QPSA 3NAUA 1BW5A 2E19A 3JREA 1YRNB 2HDDA 3S1QJ 4BXXJ 4GFBA 3IV5A 2LY9A 4D5FA 2DMQA 2JMWA 3MVPA 1ZK8A 1Y1VJ 3HKZN 4C3IJ 2JA5J 2DMUA 2FJ1A 4A69C 5M5YJ 5FKOA 2R0QC 2ID3A 2DMPA 2EZHA 3ZQIA 1G2HA 2DA4A 3CDLA 3WHCA 2CUEA 1JJ6C 3FISA 1ETXA 5EZGA 2E1OA 3GTLJ 2GBYA 3IH4A 4A3EJ 1OCTC 5C44J 2OPTA 5FKMA 1MBGA 1QVTA 2M8GX 2ECCA 1AKHA 1ZQ3P 1F36A 3CMYA 1ORKA 4MO7A 1U78A 4A3IJ 1X2NA 2YU9J 2IBDA 2X9DA 2EH3A 3BTIA 2YUSA 1HDPA 2FX0A 2HI3A 3BR5A 1Y1WJ 4A3BJ 4M3EA 3UKGA 1HOMA 2HXOA 3PM1A 2L9RA 1LE8A 5DS9A 4FTHA 1ETQA 1IRZA 4X6AJ 1I6HJ 1WI3A 3G1MA 4JX6A 1H89C 1AHDP 3RKQA 3LSJA 3GTQJ 5FJ8J 5IP9J 1A5JA 2LFBA 5J1UA 3IH2A 2ME0A 3BG5A 2GM4A 5IPAA 2R5ZA 3HOYJ 4W1UA 1JUPA 2K9SA 3ZOBA 2E2JJ 3BR2A 2CUFA 1HLVA 2XRLA 1JJ8C 1RPWA 4S0HB 1GUUA 1H8AC 1MSEC 4XRSA 2MSYA 2R5YA 4UUTA 1ZR4A 1XC5A 4AC0A 4IHWA 1QPIA 5FLVA 5EG0B 3PO2J 2AO9A 1F43A 3HGYA 2CQXA 5FLMJ 5C4XJ 3NARA 1A6IA 2EBIA 2H1KA 5F0CA 2XPVA 4A93J 1T56A 4W97A 3S1NJ 5BNGA 2N8GA 4MLOA 1JGGA 4I76A 3A01B 3I4NJ 2K9NA 2M9HA 1IV6A 4A3JJ 2QCOA 1NK3P 4DZJA 1MSFC 3HOVJ 2DN0A 3MN2A 1U9OA 4G12A 1AU7A 1B72A 3SDGA 1ZKGA 2Y2ZA 5GPAA 5EDNA 1ZGWA 2R92J 1ZTRA 1DU0A 1OFCX 3H3VK 3G1OA 1GVDA 4L5EA 1TWGJ 1BJZA 3G1LA 4Y7NJ 4ABZA 3BR6A 3HGGA 3JRAA 4V2GA 2XGDA 4XIDA 1O4XA 4CYCB 3CCYA 2OF7A 5C3EJ 1B8IA 3JRCA 2XGEA 3FKIJ 2HXIA 2XPWA 1TWCJ 1IJWC 1FIAA 5K7FA 5HODA 5E3LA 2DA3A 2XPUA 2LK2A 5IYCJ 1RR7A 2JWTA 3C2BA 4XRSG 5M5WJ 5EZHA 3BT9A 2PMZN 1CQTA 1JKQC 1I3QJ 1AKHB 3W6VA 3BR0A 5J3LA 4HNVA 1VI0A 3HBLA 2VKVA 2X48A 2VI6A 2NS7A 3RZOJ 3HOUJ 2M0CA 5F1JA 4JP0A 4BKXA 1ENHA 4B1RA 1IDYA 1WGXA 5GPCA 3CQZJ 5E3NA 2AHQA 1BW6A 1MBHA 5E3OA 1TWAJ 5E3MA 1K61A 3B6AA 3S15J 4C2MJ 3HDDA 1QRYA 1GV5A 4XRMA 4D7NA 4B4CA 1OCPA 2CJJA 3E7LA 4J19A 2NVYJ 5IOYA 1VNDA 2DTZA 2RAEA 4UUSA 2LD5A 2EZLA 3GTOJ 2R5ZB 1APLC 4JYKA 4FE7A 5EEAA 2HOTA 4Y52J 3HB9A 3GBGA 3BG9A 2CQQA 3SFIA 1JKOC 2Y9ZA 4D5CA 2DJNA 3JRDA 3S17J 2CU7A 5F0HA 1X2MA 5FKNA 1MBKA 1VF9A 1JT6A 1K83J 2ID6A 3TW6A 2R7ZJ 2DA5A 4BBRJ 1UG2A 3BTCA 2KDZA 2G0EA 3O8HA 5M5XJ 4IHVA 2LTPA 3ZQFA 5F0FA 2DA2A 1FJLA 2D5VA 4MIMA 1TC3C 1LFBA 2DA1A 3VPRA 1D5YA 3S14J 1EF4A 2DA6A 2GLOA 4XK4A 1GV2A 2QF7A 1BL0A 5DTDA 3DCFA 2MG4A 5GP9A 3L1PA 3M3YJ 5JLXA 1WCMJ 1PUFB 2DMTA 4JX5A 4DW6A 3JRFA 1P7IA 4JX4A 3TP0A 4XICA 1IC8A 3OOUA 1IG7A 1NK2P 1JKRC 2M34A 4AYBN 1H88C 4BBSJ 1FIPA 1RKTA 1NTCA 3IH3A 2K40A 5EGOB 1WPKA 5F08A 3Q0UA 2JA8J 1MNMC 4CYCA 3FK6A 3LSGA 4QTRA 1B8IB 2HYJA 3JRGA 4IEJA 2WB1N 3HM5A 1LE8B 2VPRA 3S1RJ 2VKEA 4M3FA 4M3BA 3GTMJ 4MFEA 3B6CA 5IP6A 4D7MA 5IYDJ 1TWFJ 2E2IJ 1IDZA 2WAQN 1MBFA 1JKPC 1ETVA 2O9LA 3BR3A 2L7FP 4DZPA 2XSDC 4FISA 4A3FJ 1UMQA 3FIWA 1HCRA 3TP3A 1MH4A 3MKLA 2NVTJ 5IP7J 2O7OA 1BA5A 1Z0XA 2NOGA 5IOZA 3TW7A 2H8RA 2Y31A 2JJ7A 2FQ4A 1Q1VA 5C4JJ 3HOXJ 4DYQA 1JT0A 1ETKA 1HDDC 2HQ5A 2L0KA 1RETA 2LP0A 5EF6A 2W48A 3GTJJ 3HOWJ 4A3KJ 2LVSA 1I50J 3LSPA 1X58A 2HOAA 2LLKA 1SFOJ 1IUFA 3ZQGA 1ETWA 2IEKA 2KT0A 1GDTA 2ECBA 2B63J 5JLWA 3JRBA 4DYCA 5FKLA 4A3CJ 4BY1J 3BR1A 2K9QA 1GT0C 2LKXA 3S2HJ 2IAIA 1U8BA 2COBA 3BTLA 3K2AA 2XB5A 4IHXA 3SJMA 2R93J 3GTKJ 2JN6A 3PO3J 2O8KA 4IHYA 4FE4A 2JK3A 4FCYA 1FEXA 9ANTA 3WHBA 2L7MP 4NDLA 1POGA 2R5YB 1ZR2A 1YRNA 2EZKA 2Y0SN 1W0UA 3H0GJ 1PUFA 5EG0A 3LSRA 1U9NA 3M4OJ 5M3MJ 3QPLA 3JR9A 1WH7A 3LNQA 4X1EA 2ELKA 4I6ZA 2NS8A 1MBEA 1JUMA 4C3JJ 5EGOA 2EQRA 3A01A 5M3FJ 2ZB9A 2ME6A 1HF0A 1XG1A 2YS9A 3K7AJ 2NVXJ 2E2HJ 3OIOA 1T33A 4A3MJ 3JRIA 3ZQLA 3A02A 1R9TJ 4BY7J 1E3OC 3Q0VA 3BQZA 3GTGJ 1MH3A 3Q0WA 2EZIA 1S7EA 4A3LJ 2L7ZA 2TCTA 3QQAA 2XB0X 1SANA 1Z77A 4C3HJ 4QIWN 5FKKA 1JTXA 2X6OA 1WH5A 3ZQHA 3S16J 2MW8A 1RESA 1W0TA 2LR8A 3BG3A 2MGQA 5J1YA 4UUSB 1XS9A 1FTZA 1JUSA 5F27A 1JTYA 1OJLA 4LOCA 5IYBJ 1UHSA 4MFDA 3RZDJ 3JRHA 3OSFA 4B3AA 5J1RA 1QVUA 2DMNA 3Q3SA 5K7HA 1ETOA 3A03A 5EYRA 2Y9YA 2JA7J 1IGNA 2NVQJ 2HOSA 3I4MJ 5F04A 4QSHA 4M3GA 4A3GJ 3RQIA 3D1NI 3GTPJ 1DU6A 1MBJA 2M2EA 3S2DJ 1TWHJ 3OSGA 1ETYA 3ZQCA 3TEDA 2I10A 5K7ZA 2JA6J 2WV1A 2VUMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LOC A;  1RKW A;  4RBO A;  1LFU P;  3HOZ J;  2TRT A;  4V2F A;  4EEF G;  3S1M J;  3BQY A;  3BTJ A;  4RDU A;  4A3D J;  3FK7 A;  2P81 A;  4AUX A;  2XGC A;  3DEW A;  3F0C A;  3HEF A;  1VFC A;  4M3D A;  1FTT A;  4DYR A;  2DA7 A;  2FD5 A;  1P7J A;  2Y30 A;  3O8G A;  1ITY A;  4M6V A;  2CRG A;  1B72 B;  3QPS A;  3NAU A;  1BW5 A;  2E19 A;  3JRE A;  1YRN B;  2HDD A;  3S1Q J;  4BXX J;  4GFB A;  3IV5 A;  2LY9 A;  4D5F A;  2DMQ A;  2JMW A;  3MVP A;  1ZK8 A;  1Y1V J;  3HKZ N;  4C3I J;  2JA5 J;  2DMU A;  2FJ1 A;  4A69 C;  5M5Y J;  5FKO A;  2R0Q C;  2ID3 A;  2DMP A;  2EZH A;  3ZQI A;  1G2H A;  2DA4 A;  3CDL A;  3WHC A;  2CUE A;  1JJ6 C;  3FIS A;  1ETX A;  5EZG A;  2E1O A;  3GTL J;  2GBY A;  3IH4 A;  4A3E J;  1OCT C;  5C44 J;  2OPT A;  5FKM A;  1MBG A;  1QVT A;  2M8G X;  2ECC A;  1AKH A;  1ZQ3 P;  1F36 A;  3CMY A;  1ORK A;  4MO7 A;  1U78 A;  4A3I J;  1X2N A;  2YU9 J;  2IBD A;  2X9D A;  2EH3 A;  3BTI A;  2YUS A;  1HDP A;  2FX0 A;  2HI3 A;  3BR5 A;  1Y1W J;  4A3B J;  4M3E A;  3UKG A;  1HOM A;  2HXO A;  3PM1 A;  2L9R A;  1LE8 A;  5DS9 A;  4FTH A;  1ETQ A;  1IRZ A;  4X6A J;  1I6H J;  1WI3 A;  3G1M A;  4JX6 A;  1H89 C;  1AHD P;  3RKQ A;  3LSJ A;  3GTQ J;  5FJ8 J;  5IP9 J;  1A5J A;  2LFB A;  5J1U A;  3IH2 A;  2ME0 A;  3BG5 A;  2GM4 A;  5IPA A;  2R5Z A;  3HOY J;  4W1U A;  1JUP A;  2K9S A;  3ZOB A;  2E2J J;  3BR2 A;  2CUF A;  1HLV A;  2XRL A;  1JJ8 C;  1RPW A;  4S0H B;  1GUU A;  1H8A C;  1MSE C;  4XRS A;  2MSY A;  2R5Y A;  4UUT A;  1ZR4 A;  1XC5 A;  4AC0 A;  4IHW A;  1QPI A;  5FLV A;  5EG0 B;  3PO2 J;  2AO9 A;  1F43 A;  3HGY A;  2CQX A;  5FLM J;  5C4X J;  3NAR A;  1A6I A;  2EBI A;  2H1K A;  5F0C A;  2XPV A;  4A93 J;  1T56 A;  4W97 A;  3S1N J;  5BNG A;  2N8G A;  4MLO A;  1JGG A;  4I76 A;  3A01 B;  3I4N J;  2K9N A;  2M9H A;  1IV6 A;  4A3J J;  2QCO A;  1NK3 P;  4DZJ A;  1MSF C;  3HOV J;  2DN0 A;  3MN2 A;  1U9O A;  4G12 A;  1AU7 A;  1B72 A;  3SDG A;  1ZKG A;  2Y2Z A;  5GPA A;  5EDN A;  1ZGW A;  2R92 J;  1ZTR A;  1DU0 A;  1OFC X;  3H3V K;  3G1O A;  1GVD A;  4L5E A;  1TWG J;  1BJZ A;  3G1L A;  4Y7N J;  4ABZ A;  3BR6 A;  3HGG A;  3JRA A;  4V2G A;  2XGD A;  4XID A;  1O4X A;  4CYC B;  3CCY A;  2OF7 A;  5C3E J;  1B8I A;  3JRC A;  2XGE A;  3FKI J;  2HXI A;  2XPW A;  1TWC J;  1IJW C;  1FIA A;  5K7F A;  5HOD A;  5E3L A;  2DA3 A;  2XPU A;  2LK2 A;  5IYC J;  1RR7 A;  2JWT A;  3C2B A;  4XRS G;  5M5W J;  5EZH A;  3BT9 A;  2PMZ N;  1CQT A;  1JKQ C;  1I3Q J;  1AKH B;  3W6V A;  3BR0 A;  5J3L A;  4HNV A;  1VI0 A;  3HBL A;  2VKV A;  2X48 A;  2VI6 A;  2NS7 A;  3RZO J;  3HOU J;  2M0C A;  5F1J A;  4JP0 A;  4BKX A;  1ENH A;  4B1R A;  1IDY A;  1WGX A;  5GPC A;  3CQZ J;  5E3N A;  2AHQ A;  1BW6 A;  1MBH A;  5E3O A;  1TWA J;  5E3M A;  1K61 A;  3B6A A;  3S15 J;  4C2M J;  3HDD A;  1QRY A;  1GV5 A;  4XRM A;  4D7N A;  4B4C A;  1OCP A;  2CJJ A;  3E7L A;  4J19 A;  2NVY J;  5IOY A;  1VND A;  2DTZ A;  2RAE A;  4UUS A;  2LD5 A;  2EZL A;  3GTO J;  2R5Z B;  1APL C;  4JYK A;  4FE7 A;  5EEA A;  2HOT A;  4Y52 J;  3HB9 A;  3GBG A;  3BG9 A;  2CQQ A;  3SFI A;  1JKO C;  2Y9Z A;  4D5C A;  2DJN A;  3JRD A;  3S17 J;  2CU7 A;  5F0H A;  1X2M A;  5FKN A;  1MBK A;  1VF9 A;  1JT6 A;  1K83 J;  2ID6 A;  3TW6 A;  2R7Z J;  2DA5 A;  4BBR J;  1UG2 A;  3BTC A;  2KDZ A;  2G0E A;  3O8H A;  5M5X J;  4IHV A;  2LTP A;  3ZQF A;  5F0F A;  2DA2 A;  1FJL A;  2D5V A;  4MIM A;  1TC3 C;  1LFB A;  2DA1 A;  3VPR A;  1D5Y A;  3S14 J;  1EF4 A;  2DA6 A;  2GLO A;  4XK4 A;  1GV2 A;  2QF7 A;  1BL0 A;  5DTD A;  3DCF A;  2MG4 A;  5GP9 A;  3L1P A;  3M3Y J;  5JLX A;  1WCM J;  1PUF B;  2DMT A;  4JX5 A;  4DW6 A;  3JRF A;  1P7I A;  4JX4 A;  3TP0 A;  4XIC A;  1IC8 A;  3OOU A;  1IG7 A;  1NK2 P;  1JKR C;  2M34 A;  4AYB N;  1H88 C;  4BBS J;  1FIP A;  1RKT A;  1NTC A;  3IH3 A;  2K40 A;  5EGO B;  1WPK A;  5F08 A;  3Q0U A;  2JA8 J;  1MNM C;  4CYC A;  3FK6 A;  3LSG A;  4QTR A;  1B8I B;  2HYJ A;  3JRG A;  4IEJ A;  2WB1 N;  3HM5 A;  1LE8 B;  2VPR A;  3S1R J;  2VKE A;  4M3F A;  4M3B A;  3GTM J;  4MFE A;  3B6C A;  5IP6 A;  4D7M A;  5IYD J;  1TWF J;  2E2I J;  1IDZ A;  2WAQ N;  1MBF A;  1JKP C;  1ETV A;  2O9L A;  3BR3 A;  2L7F P;  4DZP A;  2XSD C;  4FIS A;  4A3F J;  1UMQ A;  3FIW A;  1HCR A;  3TP3 A;  1MH4 A;  3MKL A;  2NVT J;  5IP7 J;  2O7O A;  1BA5 A;  1Z0X A;  2NOG A;  5IOZ A;  3TW7 A;  2H8R A;  2Y31 A;  2JJ7 A;  2FQ4 A;  1Q1V A;  5C4J J;  3HOX J;  4DYQ A;  1JT0 A;  1ETK A;  1HDD C;  2HQ5 A;  2L0K A;  1RET A;  2LP0 A;  5EF6 A;  2W48 A;  3GTJ J;  3HOW J;  4A3K J;  2LVS A;  1I50 J;  3LSP A;  1X58 A;  2HOA A;  2LLK A;  1SFO J;  1IUF A;  3ZQG A;  1ETW A;  2IEK A;  2KT0 A;  1GDT A;  2ECB A;  2B63 J;  5JLW A;  3JRB A;  4DYC A;  5FKL A;  4A3C J;  4BY1 J;  3BR1 A;  2K9Q A;  1GT0 C;  2LKX A;  3S2H J;  2IAI A;  1U8B A;  2COB A;  3BTL A;  3K2A A;  2XB5 A;  4IHX A;  3SJM A;  2R93 J;  3GTK J;  2JN6 A;  3PO3 J;  2O8K A;  4IHY A;  4FE4 A;  2JK3 A;  4FCY A;  1FEX A;  9ANT A;  3WHB A;  2L7M P;  4NDL A;  1POG A;  2R5Y B;  1ZR2 A;  1YRN A;  2EZK A;  2Y0S N;  1W0U A;  3H0G J;  1PUF A;  5EG0 A;  3LSR A;  1U9N A;  3M4O J;  5M3M J;  3QPL A;  3JR9 A;  1WH7 A;  3LNQ A;  4X1E A;  2ELK A;  4I6Z A;  2NS8 A;  1MBE A;  1JUM A;  4C3J J;  5EGO A;  2EQR A;  3A01 A;  5M3F J;  2ZB9 A;  2ME6 A;  1HF0 A;  1XG1 A;  2YS9 A;  3K7A J;  2NVX J;  2E2H J;  3OIO A;  1T33 A;  4A3M J;  3JRI A;  3ZQL A;  3A02 A;  1R9T J;  4BY7 J;  1E3O C;  3Q0V A;  3BQZ A;  3GTG J;  1MH3 A;  3Q0W A;  2EZI A;  1S7E A;  4A3L J;  2L7Z A;  2TCT A;  3QQA A;  2XB0 X;  1SAN A;  1Z77 A;  4C3H J;  4QIW N;  5FKK A;  1JTX A;  2X6O A;  1WH5 A;  3ZQH A;  3S16 J;  2MW8 A;  1RES A;  1W0T A;  2LR8 A;  3BG3 A;  2MGQ A;  5J1Y A;  4UUS B;  1XS9 A;  1FTZ A;  1JUS A;  5F27 A;  1JTY A;  1OJL A;  4LOC A;  5IYB J;  1UHS A;  4MFD A;  3RZD J;  3JRH A;  3OSF A;  4B3A A;  5J1R A;  1QVU A;  2DMN A;  3Q3S A;  5K7H A;  1ETO A;  3A03 A;  5EYR A;  2Y9Y A;  2JA7 J;  1IGN A;  2NVQ J;  2HOS A;  3I4M J;  5F04 A;  4QSH A;  4M3G A;  4A3G J;  3RQI A;  3D1N I;  3GTP J;  1DU6 A;  1MBJ A;  2M2E A;  3S2D J;  1TWH J;  3OSG A;  1ETY A;  3ZQC A;  3TED A;  2I10 A;  5K7Z A;  2JA6 J;  2WV1 A;  2VUM J; 
#chains in the Genus database with same CATH topology
 1RKW A;  1K78 B;  2VQH A;  3PJR A;  3BQY A;  3KLN A;  2DOF A;  3IHU A;  3ELK A;  3FK7 A;  2K4J A;  4HX7 A;  1WJD A;  2VOD A;  1MW7 A;  2K7L A;  4YFX F;  1QPM A;  3T8R A;  1G3W A;  2EFN A;  2XGC A;  2O61 A;  1VTN C;  2BHZ A;  3WTW C;  3FMS A;  4O6J A;  1QZZ A;  3F8F A;  1QZY A;  1XGS A;  3BJ6 A;  1P7J A;  1TT5 B;  4M6V A;  4IRG A;  3NAU A;  4RGR A;  3RPQ A;  1K4S A;  1BW5 A;  3IUO A;  2DQL A;  2QKM B;  1YRN B;  4AIJ A;  4C30 A;  4GFB A;  5D5X B;  1SVL A;  3BWG A;  4LIV A;  3MVP A;  1I3A A;  1ZK8 A;  4XKC A;  4XLA A;  1Z3X A;  4XN0 A;  3K70 D;  5GTH C;  2LOO A;  4C3I J;  2JA5 J;  2XF6 A;  4DBR A;  2D2W A;  2R0Q C;  2ID3 A;  3ESW B;  1LDD A;  1FT9 A;  4FHT A;  3CDL A;  4GYG A;  3GW2 A;  3WHC A;  2CUE A;  4AD9 A;  1J09 A;  4ZDL A;  2IA0 A;  3FIS A;  1BR1 A;  4KUM A;  5L3F A;  3P7N A;  5LBQ A;  4L9T A;  3KZY A;  5LEK A;  1T38 A;  1I39 A;  2L4A A;  1BC7 C;  5C44 J;  1OCT C;  4EJW A;  1QNT A;  3M1E A;  1U5T B;  2R7X A;  3DF8 A;  2ZJR F;  2STT A;  3OS1 A;  1ORK A;  2QEX I;  1BI1 A;  2P6T A;  4A12 A;  2EH3 A;  3BTI A;  1Y1W J;  4FX0 A;  4AVZ A;  4M3E A;  3RPU D;  3VYR B;  3UKG A;  1HOM A;  4P9F A;  4ZYG A;  2R7R A;  3RJP A;  3COA C;  4ENK A;  3GO5 A;  2QKL B;  5ICE A;  1FMW A;  3HSE A;  1V54 H;  3HYI A;  5D8L B;  3CP2 A;  4E7Z A;  1XGO A;  3DXJ F;  4U88 A;  4LMY A;  1I6H J;  1WI3 A;  3S93 A;  5ICF A;  3RKQ A;  2PMH A;  5FJ8 J;  4HNT A;  4N4N B;  3K70 C;  1RNL A;  4NB5 A;  3ERM A;  2LFB A;  2RN7 A;  5E1W A;  5J1U A;  1YTY A;  2D45 A;  3N4M A;  1Z7L A;  2R5Z A;  2E71 A;  5GAG J;  1SD4 A;  1JUP A;  3F21 A;  2CQK A;  1W4M A;  2PX9 A;  3DPL C;  3HZJ A;  3TL4 X;  3CUO A;  2JVG A;  1YW9 A;  3QAH A;  4OAY A;  1UST A;  4G7Z F;  3K4C A;  3K1N A;  4UVA A;  2MSY A;  1X1B A;  3OS2 A;  1I27 A;  3C7J A;  4FQG A;  4AC0 A;  1VQO I;  4D9J A;  4J00 A;  3WGI A;  1S72 I;  1XN7 A;  3PO2 J;  2KRH A;  2PG4 A;  4RGX A;  1KZH A;  2CW0 F;  4P96 A;  4OAZ A;  5F0C A;  3RPU A;  2XPV A;  1BN5 A;  4A93 J;  3MZ8 A;  1T56 A;  5BNG A;  2BY2 A;  4HSR A;  2Y69 H;  1D0X A;  1JGG A;  2LF7 A;  3A01 B;  3C18 A;  1IV6 A;  1NK3 P;  4DZJ A;  3RI4 A;  1IRG A;  4DQ2 A;  3HOV J;  4CZZ A;  3MN2 A;  4G12 A;  2KIF A;  1SAX A;  1LFP A;  2Y2Z A;  3MMY B;  2HKX A;  3ZRG A;  2RQP A;  2Y0M A;  1G3T A;  1ZTR A;  1PDN C;  1OFC X;  3I56 I;  5E1X A;  1BIB A;  1Z6R A;  4UV9 A;  1BJZ A;  3G1L A;  4A0Z A;  2DO7 A;  2BY0 A;  3LSH A;  3BR6 A;  2GA1 A;  5ICC A;  3EQL F;  4G6Q A;  2L54 A;  4V2G A;  1MMD A;  4S04 A;  2XGD A;  5TJJ A;  4ZZD A;  1X1C A;  1R23 A;  3G6E I;  2HVQ A;  1B8I A;  3L2V A;  3JRC A;  2FF4 A;  2XGE A;  1GHC A;  3FKI J;  4KIG A;  4P1W A;  5KVR A;  1FIA A;  4E7L A;  1SEU A;  2JPC A;  5L3C A;  3W2V A;  2CV0 A;  3DKY A;  3K0L A;  4XRS G;  1SFE A;  3F23 A;  4BDY A;  2EV5 A;  1RUO A;  1CQT A;  4RM3 A;  2IVM A;  3K4B A;  1PUE E;  3CME I;  2LH9 A;  4M73 A;  2VKV A;  3E1S A;  5BPD A;  2P5K A;  1NG6 A;  2R7Q A;  3D5S C;  4KYW A;  3H5N A;  1UCR A;  3CO6 C;  3OL4 A;  1IDY A;  3TGN A;  2JSP A;  2OUM A;  1BW6 A;  1MBH A;  5E3O A;  2MLK A;  3EUK L;  5E3M A;  3B6A A;  3S15 J;  3HDD A;  4L0Z B;  2BV6 A;  2LKP A;  3W6K B;  4XRM A;  4HPQ A;  2CJJ A;  2NVY J;  3FMR A;  5D6F A;  1SC7 A;  3TOA A;  1VND A;  2DCE A;  2DTZ A;  2RAE A;  2CFO A;  3LST A;  3CCU I;  1T95 A;  3RYR A;  2R5Z B;  4YIF A;  4HLX A;  5FGM A;  1APL C;  4JYK A;  1VQ6 I;  1Z9C A;  2CQQ A;  3SFI A;  4D5C A;  1HXD A;  3WTZ A;  5FKN A;  3NEU A;  1KON A;  3ABK H;  1HST A;  1JT6 A;  2I5U A;  2OA4 A;  1K83 J;  2ID6 A;  2DA5 A;  1UG2 A;  4YFK F;  2F5E A;  5M5X J;  4XOT A;  1ZLJ A;  5HLT A;  3DTK A;  2D5V A;  2EIK H;  3V7C A;  1D8J A;  2F4M B;  3VPR A;  1VQ7 I;  4Q5S F;  1D5Y A;  3HJE A;  3NWS A;  1EF4 A;  2GLO A;  4XK4 A;  4ZDP A;  1GV2 A;  1RIO H;  2X1E A;  2LY2 A;  5CVI A;  2VPL A;  2QF7 A;  2HYG D;  5J6X A;  1BL0 A;  3A1Y A;  4IKF A;  5HS7 A;  3PNT A;  2EFO A;  3HKZ A;  5GP9 A;  2EWN A;  1U0J A;  2E34 A;  1D0Y A;  3LAP A;  4I0A A;  1OCZ H;  4JX4 A;  1IC8 A;  1J0R A;  1NK2 P;  3E0J B;  5FO5 A;  2O0Y A;  4XR6 A;  2E35 A;  2QBY A;  2M30 A;  3RYP A;  1NTC A;  3LA7 A;  2JSC A;  5H6Q A;  2QLZ A;  5IT3 A;  1WPK A;  2DFF A;  3Q0U A;  1CF7 B;  1K4T A;  1MNM C;  3LSG A;  3OYL A;  2FNP A;  4Y4R A;  5K5Q A;  2HYJ A;  2UWM A;  3C1D A;  3JRG A;  3WU0 A;  1LE8 B;  1RZ4 A;  1YOV B;  4II2 A;  4MTD A;  2VBY A;  4Q48 A;  4NBQ A;  2F5D A;  3GTM J;  5F1R A;  2ZXH A;  2LDU A;  3SZP A;  2WAQ A;  2PJR A;  4CUG A;  1KYZ A;  5IP6 A;  3WTX C;  4LFU A;  4FT8 A;  4IRH A;  3GUD A;  5TIS C;  1D5V A;  3I58 A;  2XVC A;  1VQK I;  1IDZ A;  3ZN1 A;  3QYB A;  2WAQ N;  4II3 A;  3EUH A;  4GYI A;  1O3R A;  5KCM A;  4LB6 B;  1ZAO A;  2E36 A;  2FRH A;  2HS5 A;  1YJW I;  4DZP A;  4RS8 A;  1R6R A;  2NVU B;  4H4K C;  5BPI A;  2FBH A;  3BRO A;  3A4C A;  2BVL A;  3FIW A;  3IWZ A;  6PAX A;  2IS6 A;  2DI3 A;  4HW0 A;  2OV7 A;  2FEZ A;  1A31 A;  2ISY A;  2MC3 A;  1KU9 A;  2DU9 A;  3AFH A;  1U3E M;  1K7A A;  2O7O A;  1U5T A;  2W25 A;  3OYA A;  1P6R A;  4GDF A;  3MEX A;  5H2F C;  2WAF A;  3TW7 A;  4KN4 X;  2Y31 A;  3IKT A;  3CDH A;  3IP4 B;  3BPV A;  3OYB A;  1P9Q C;  2FQ4 A;  4L18 B;  4Z6Y A;  3E5U A;  1R5H A;  3HL2 A;  3WTT C;  4IO9 F;  2PJP A;  2ZXW H;  4BH9 A;  1QZE A;  3I64 A;  4CCO A;  3G4S I;  3AL0 C;  3S32 A;  3ABT A;  1X58 A;  2LLK A;  4EJO A;  1SFO J;  2IEK A;  3HHH A;  2B63 J;  3V4G A;  1SVM A;  5AIQ A;  3JRB A;  5DM6 F;  3U21 A;  1SVO A;  4C9Y A;  2ZCW A;  2KIM A;  4NC7 A;  1EJ9 A;  1HQC A;  2COB A;  3EYY A;  3BTL A;  2ZNY A;  4IRI A;  2XSJ C;  3BZ6 A;  3SJM A;  2NRA C;  2L5Q A;  4HOB A;  2O8K A;  3QOE A;  2WA0 A;  2ELH A;  4GXO A;  4PJM A;  3ZMT A;  2L7M P;  3WTS C;  3OYG A;  2MH2 A;  1J7K A;  2W4S A;  2X1C A;  4HV5 A;  1KU2 A;  4Q47 A;  4PJJ A;  1POG A;  2R5Y B;  3CC7 I;  4HLY A;  4AU7 A;  2ELJ A;  2EZK A;  2IS1 A;  2Z16 A;  5J8F A;  1YJN I;  2Y0S N;  3K2Z A;  3F6V A;  1XSV A;  3LSR A;  2HTS A;  3FXO A;  3QPL A;  4EM0 B;  3GFJ A;  3LFU A;  2W7N A;  4RB1 A;  2LNB A;  3JR9 A;  1D1C A;  4E7H A;  4X1E A;  4I6Z A;  2W85 A;  2Y0S A;  2CH0 A;  2EQR A;  2A07 F;  2AQE A;  2HYF A;  3E5X A;  3QRF F;  3H9G A;  4V19 K;  2P5V A;  1T33 A;  4A3M J;  5LLQ A;  1Y0U A;  4YIR X;  1R9T J;  4BY7 J;  3TDZ C;  1SAU A;  3GTG J;  1BI0 A;  4BL0 B;  1MH3 A;  2EZI A;  3BC8 A;  3F3X A;  2VON A;  4B8X A;  4A3L J;  3MCZ A;  1V5F A;  1Z67 A;  4C3H J;  3KEY A;  4QIW N;  1DUX C;  1JTX A;  1WVR A;  3LSM A;  2ZJP F;  3NWT A;  3S3M A;  1X3U A;  1W0T A;  3VB2 A;  4F52 A;  4S05 A;  3ECH A;  5J1Y A;  1A36 A;  5BS6 A;  3ZQQ A;  3GCM A;  3WOD F;  2EPF A;  3CCR I;  3H3Z A;  1GVJ A;  4EVI A;  3SHF A;  1MND A;  2LC2 A;  1JTY A;  2CMP A;  2F5V A;  1EH6 A;  2K85 A;  2BW3 B;  4HG2 A;  4LOC A;  1UHS A;  4MFD A;  5IYB J;  4LLN A;  1VQ4 I;  1VQL I;  1WJE A;  2IGK A;  2V9K A;  4EV0 A;  3BCB A;  1TQM A;  2MH9 A;  3OSF A;  2XAF A;  1LKX A;  1S7A A;  2DMN A;  4A0X A;  2GIZ A;  2WAE A;  5FFX A;  4OMZ A;  3A03 A;  2OU2 A;  5EYR A;  5A2Q Z;  3HPH A;  3OYN A;  3ZCO A;  2YU3 A;  2ZBK A;  5F04 A;  4QSH A;  5GAE J;  1X3Z B;  5LD2 C;  2XKO A;  2M2E A;  3CUQ C;  3S2D J;  3OSG A;  2KRF A;  3TMO A;  2H94 A;  4NUB A;  5FFZ A;  1FYK A;  2I10 A;  3K4K A;  4PJ0 C;  2M45 A;  4IVN A;  1LFU P;  3HOZ J;  1O3S A;  2TRT A;  1W7P D;  1TL8 A;  4U0W A;  3BTJ A;  2AXT C;  2MBF A;  1WSU A;  4I01 A;  1USS A;  1LQ1 A;  3L2W A;  4RAG A;  2EFQ A;  1XMX A;  2JRT A;  2A6E F;  2E5N A;  3DEW A;  4E4H A;  3MKZ A;  1DQU A;  4M3D A;  3GEZ A;  1FTT A;  1NH3 A;  1BR4 A;  2OCC H;  2A6H F;  2VJ5 A;  3N05 A;  2Y30 A;  1ITY A;  2DAO A;  2CRG A;  2E19 A;  3IWF A;  4AYB A;  1O57 A;  2VBZ A;  1MJA A;  3H5A A;  1ZRE A;  3S1Q J;  3KX2 A;  4BXX J;  2PLY A;  2A61 A;  3IV5 A;  3H9J A;  1IXC A;  2HPI A;  2DMQ A;  5HNF A;  1B59 A;  3K4J A;  2MC4 A;  1Y1V J;  5B66 C;  3KPH A;  5DM7 F;  1IN4 A;  1STZ A;  2OC6 A;  3VYU B;  2FJ1 A;  4LLG F;  4A69 C;  5M5Y J;  1MJ9 A;  2EB7 A;  2DMP A;  2EZH A;  3PUF A;  3ZQI A;  3RTR A;  5LGT A;  1IN8 A;  4IQJ A;  3KYL A;  1FNN A;  1ETX A;  4LG0 B;  2R7U A;  2E1O A;  1YI2 I;  3L00 A;  3F72 A;  2GBY A;  4HNU A;  2PQ8 A;  3GVA A;  1MKM A;  2M5W A;  2V6C A;  3SEZ A;  4CO8 A;  3QPT A;  4N0B A;  3RIR A;  1AKH A;  4NHJ A;  1I5Z A;  1ZQ3 P;  1F36 A;  4MO7 A;  2E1C A;  2EIJ H;  3KP5 A;  4KN7 X;  3FXJ A;  2HI3 A;  2FX0 A;  3I0T A;  2D1V A;  3BR5 A;  4XON A;  3ZMV A;  4A3B J;  2KIS A;  4BE1 A;  1XSX A;  4XQF A;  2DOE A;  2HXO A;  3JW4 A;  1D8K A;  1Z21 A;  4M6X A;  4ZYA A;  5DS9 A;  1LE8 A;  4FTH A;  3FXR A;  4XKV A;  4CSW A;  2KP6 A;  3NRV A;  4X6A J;  2E5Z A;  3HTU A;  4I02 A;  2P7C B;  2CQ7 A;  1YLF A;  2F6C A;  1X19 A;  3G1M A;  1AHD P;  3MAJ A;  3R0A A;  3VFZ A;  3GTQ J;  4BXF A;  1WJF A;  1YS7 A;  2GA2 A;  3QYE A;  3IH2 A;  1ZEL A;  2IA1 A;  1R58 A;  3ASO H;  4BQN A;  4ANJ A;  1YIO A;  5D4R A;  1Y6I A;  3BG5 A;  3DP7 A;  2GM4 A;  4XLP F;  4L9V A;  2DK8 A;  2OCE A;  4QPQ A;  4UY8 I;  5KNL A;  1HC8 A;  2EIM H;  2MD0 A;  2CUF A;  2LBF A;  2XRL A;  4E70 A;  1RPW A;  3M8J A;  4S0H B;  1GUU A;  1H8A C;  1MSE C;  1P2F A;  2R5Y A;  2BYV E;  3RQ4 A;  1BI2 A;  4IHW A;  4G6D A;  5FLV A;  1PYV A;  4I7H A;  1WWX A;  3CF2 A;  5EG0 B;  2AO9 A;  1MDM A;  3HGY A;  3F8M A;  3DTI A;  2R7W A;  1LDJ A;  1N75 A;  2ESH A;  3FBI B;  1Z7U A;  3U1K A;  4PFP A;  4W97 A;  3S1N J;  5IT9 K;  1NHA A;  3EUH C;  4Y15 A;  3I4N J;  2K9N A;  3K4N A;  2KDO A;  5F6F A;  1BOB A;  1OYY A;  5EEG A;  3OYD A;  2XC7 A;  1MGT A;  3ZMU A;  2K5C A;  4CXF A;  1B72 A;  4M74 A;  3SDG A;  4LD5 A;  1X1D A;  1R1U A;  4WXH A;  2R92 J;  1OPC A;  5BQT A;  3H3V K;  1GVD A;  2IJL A;  5FLX K;  2DJI A;  2OQR A;  4BU2 A;  1YHQ I;  5CPR B;  3J80 Z;  2FBI A;  3JRA A;  1VQN I;  4Y13 A;  2BY3 A;  4YRV A;  1T2K A;  1TW3 A;  2ZSH B;  1QA6 A;  1YG2 A;  2XPW A;  4D0P A;  3HRT A;  5E3L A;  3KP7 A;  2LK2 A;  1RR7 A;  3AG1 H;  2H8W A;  3L9F A;  2KJC A;  4I09 A;  3BJA A;  3BT9 A;  2V9P A;  1D1A A;  2M4K A;  2H6B A;  1AKH B;  1IRF A;  3W6V A;  2GXB A;  2VIX A;  1OR7 A;  4Y17 A;  4HA8 A;  4N9I A;  1VI0 A;  4OU0 A;  2VI6 A;  3J7Y J;  3RZO J;  1P4X A;  3HOU J;  3KZZ A;  2MD5 A;  4BKX A;  4B1R A;  1KYW A;  5GPC A;  1MMA A;  2CFX A;  5E3N A;  4BUP A;  3EUA A;  3ZXS A;  1K61 A;  2VE8 A;  2EFP A;  4C2M J;  1IO2 A;  3TDU C;  2ZME C;  4L5J A;  1QRY A;  2K4B A;  2KKO A;  3KEQ A;  1GV5 A;  2NYX A;  3KP4 A;  3DFG A;  5K1Y A;  2LYC A;  4BHC A;  1F5T A;  3BJO A;  4RMN A;  1OMI A;  1TTY A;  4MEX F;  2EZL A;  1XCB A;  1XGN A;  1UB9 A;  4KJZ A;  2HOT A;  3BG9 A;  2L9N A;  4BJT A;  2AQF A;  3HOS A;  2DJN A;  2DT7 B;  2STW A;  1TP4 A;  2P8T A;  3EPZ A;  2CU7 A;  3I5U A;  5E18 F;  1MBK A;  2FMY A;  3DQV C;  4N9H A;  4I98 B;  1MZB A;  4RAF A;  2A5Y B;  3M8E A;  5LHG A;  3A0B C;  5LGN A;  2G0E A;  4XOR A;  4E7S A;  5ILV A;  1OYW A;  3REO A;  5F0F A;  2DA2 A;  3BG6 A;  3HRM A;  1IAW A;  1TC3 C;  1LFB A;  2DA1 A;  1W1W E;  1GLN A;  5E1Z B;  3S14 J;  1R7J A;  2FUG 2;  3BP8 A;  4ZDO A;  3PQK A;  3G71 I;  2BBY A;  3IAM 2;  4PJN A;  5DTD A;  3HRS A;  4ZYE A;  3K4M A;  1FMV A;  3DCF A;  2MG4 A;  2GZW A;  2VBX A;  5ILU A;  4A2U A;  1BI3 A;  3M3Y J;  5JLX A;  4MEY F;  4BYY A;  1PUF B;  2BY1 A;  1QBJ A;  2YR2 A;  3I3L A;  4G7H F;  1V4R A;  3JAM K;  1R36 A;  2Z3Y A;  4U87 A;  3TP0 A;  4L9J A;  2UXN A;  1A35 A;  3KYC B;  1T08 B;  4ESB A;  3PFY A;  2HDC A;  2WY8 Q;  1FIP A;  4ITV A;  3IH3 A;  2K40 A;  2XRN A;  5F08 A;  4I99 C;  5FRM A;  4RB3 C;  4CYC A;  1EH7 A;  3H9Q A;  1MMS A;  2HVR A;  4BGD A;  2JA6 J;  3VOE A;  2VPR A;  4UB8 C;  2R4G A;  2V26 A;  1BM9 A;  4A0Y A;  1Z6T A;  1SFK A;  4E6K G;  3GLL A;  1ONV A;  2RDP A;  3EET A;  3CO7 C;  4D7M A;  3O6B B;  3CMM A;  4KFC A;  4UXN A;  4Y3O A;  2F5C A;  3E6C C;  1ZG1 A;  2HZD A;  1YE9 A;  2X6X A;  1ERD A;  1VQ8 I;  1MBF A;  1HW1 A;  3I71 A;  3OR2 C;  1JKP C;  1ETV A;  3BR3 A;  2XSD C;  3BZC A;  4FIS A;  3E6B A;  1WJ5 A;  1J75 A;  2XDV A;  1UMQ A;  3RCO A;  1IXR C;  2VJ4 A;  3ZPL A;  1XD7 A;  4IJA A;  4M71 A;  2PBI A;  3V7R A;  3GYH X;  1MH4 A;  2KMU A;  4BQA A;  3MKL A;  4E7I A;  2NVT J;  2PI0 A;  3T5X A;  5IP7 J;  3KP3 A;  4CCJ A;  3O2P E;  1MMN A;  1I6X A;  1Z0X A;  2VXZ A;  1ZRD A;  2NOG A;  3ERE D;  1O3Q A;  2DBB A;  3QYF A;  4O5V A;  5CYV A;  5C4J J;  3HOX J;  3BZK A;  1JT0 A;  2QVO A;  3JTG A;  1KGS A;  3H0D A;  2HNH A;  2R7F A;  4UB6 C;  1HDD C;  1ZRF A;  2W82 A;  3S2W A;  4PFO A;  4RGS A;  3GTJ J;  2EFW A;  4A3K J;  3HOW J;  1I50 J;  1SD5 A;  1IUF A;  1TQP A;  2KT0 A;  2M0M A;  4XMY A;  3QWL A;  1KA8 A;  3HG9 A;  2VL8 A;  3DEE A;  3BR1 A;  2A05 A;  1LDK B;  3B02 A;  2K9Q A;  2X85 A;  3BOQ A;  3DLA A;  2LKX A;  1GT0 C;  1N78 A;  2WWY A;  2IA2 A;  1U8B A;  3VSL A;  1OCO H;  4XBF A;  3CCE I;  1ON1 A;  3BY6 A;  2R93 J;  1DP3 A;  4B09 A;  2I8D A;  1R49 A;  3DTE A;  4KT6 A;  1LNW A;  1WJB A;  4R79 A;  4FCY A;  5ILS A;  4L0Y B;  1VQM I;  3ZGK A;  3IAS 2;  1FEX A;  1MIJ A;  1S29 A;  2CYY A;  4XM3 A;  2Z5U A;  4WXD A;  4NDL A;  1ZR2 A;  3PL8 A;  2R7S A;  4F92 B;  1ZH5 A;  2XAU A;  2J5O A;  4HEA 2;  1UEL B;  1LB2 A;  1FOW A;  1PUF A;  1SMT A;  3M4O J;  1F1Z A;  4HRI A;  2V7F A;  1Z05 A;  1R5G A;  2HOE A;  3HHG A;  4PSX A;  2DXI A;  3ABL H;  3MZH A;  2Q2E B;  2M3A A;  3K4L A;  1YS6 A;  3LNQ A;  4CDG A;  2FXA A;  2ELK A;  4KIS A;  3ZMS A;  3BPX A;  3A01 A;  2FQ3 A;  3ISP A;  2ZB9 A;  1CF7 A;  4ZTF A;  1FWZ A;  4BNC A;  2YS9 A;  3K7A J;  4EQQ A;  3ZQL A;  1I1G A;  2YX4 A;  3Q0V A;  1DGW Y;  3BQZ A;  3AAF A;  1R4N B;  3OIP A;  2L7Z A;  3SZG A;  2TCT A;  2CSO A;  3QQA A;  3HSR A;  4U0V A;  4XKB A;  3RKX A;  1KQ0 A;  1SAN A;  4IPA A;  3L2R A;  3CJR B;  2NOJ B;  5CVJ A;  3S16 J;  2VJI A;  1RES A;  4RAZ A;  3KCC A;  2ZJ2 A;  1XS9 A;  4UUS B;  3OY9 A;  2DYR H;  3JTH A;  2HQR A;  1FTZ A;  1BR2 A;  2DYS H;  1OJL A;  2IGN A;  4P5O A;  2P5L C;  1YFH A;  2EV0 A;  4B48 A;  4WCG A;  2F2E A;  4ZTJ A;  4FX4 A;  1ACI A;  4KMF A;  4EJV A;  5HDG A;  5KHD A;  3OYH A;  2NS0 A;  2V1D A;  3ECO A;  2CW8 A;  2R3S A;  3Q3S A;  1QO0 D;  3ASN H;  3PQJ A;  5K7H A;  3T8T A;  5ICG A;  1MJB A;  5BMZ A;  2EIN H;  2G7U A;  4G9Y A;  2LKS A;  1XX5 A;  1YW7 A;  2YSR A;  1VQ9 I;  5HVQ C;  1IN5 A;  3RQI A;  4B44 A;  4LJZ F;  1TWH J;  1G4D A;  4EJT A;  2VC0 A;  5CVU A;  5K7Z A;  2ACJ A;  3DU5 A;  3D5R C;  3LOC A;  4R1H A;  4RB2 C;  3I54 A;  3LL7 A;  4KNY A;  4F55 A;  1OLT A;  3S1M J;  1WKM A;  4RDU A;  4DIQ A;  2D1H A;  2ZFU A;  4XLE A;  2GQQ A;  2KIU A;  3MKY B;  3F9K A;  2BGC A;  3HEF A;  5KAF C;  1TNS A;  3AL0 B;  1T98 A;  2X6W A;  1RC9 A;  2GWR A;  1ODD A;  2DLL A;  1FC3 A;  1SFU A;  2BHY A;  2DA7 A;  3SFZ A;  3WTU C;  3PNV A;  3WTV C;  4E7K A;  1TW2 A;  2VQL A;  1B72 B;  4FET A;  5E79 C;  3QPS A;  4ON0 A;  4RA2 A;  3VYS B;  2QQB A;  2O6G E;  2L01 A;  3M8F A;  3JRE A;  3CC4 I;  4ESF A;  5CJ9 A;  3OYJ A;  2HDD A;  1J5Y A;  2CUZ A;  2Q1Z B;  2W57 A;  3CCQ I;  1XSD A;  4EM2 A;  2LY9 A;  5CQG A;  2EJR A;  4D5F A;  3HKZ N;  3KE2 A;  3PSF A;  2BXZ A;  2O03 A;  2X4H A;  5EEH A;  2UV1 A;  1EH8 A;  2A68 F;  4ESJ A;  1HW2 A;  3BCA A;  1MNE A;  2DA4 A;  3AG2 H;  4ENN A;  3CTA A;  2EA2 A;  2HZT A;  2R7T A;  1YQA A;  3D0S A;  1V55 H;  2OJE D;  2XAJ A;  1HW5 A;  3L09 A;  5J8C A;  2GOX B;  4OIQ F;  3WGG A;  2CQN A;  1N77 A;  3DV8 A;  5F64 A;  3KET A;  2COM A;  1Y8R B;  3H5R A;  2QQA A;  4XLF A;  5FKM A;  3VOD A;  2VT2 A;  4AVP A;  3OYF A;  1ZGJ A;  2M8G X;  2HU9 A;  2VKD A;  1AWC A;  1W7P B;  3HC7 A;  3VEP A;  2L9S A;  2IBD A;  4J01 A;  2X9D A;  2YUS A;  5LHI A;  5FB2 A;  3CCJ I;  2VN2 A;  3F22 A;  3M07 A;  2IT0 A;  2M7B A;  2L9R A;  1BBY A;  2XF7 A;  4RAY A;  2DFH A;  3LQR A;  1ETQ A;  2Y48 A;  1X1A A;  1IRZ A;  3K6G A;  2A6T A;  2XUB A;  4B3X A;  3W2W A;  2RV8 A;  2FU4 A;  3I59 B;  2XF5 A;  1FBQ A;  1B6A A;  4HF2 A;  3R4K A;  1S6L A;  3R6S A;  3CCS I;  2NAZ A;  4HDU A;  2ME0 A;  1X3W B;  4RGU A;  3SXY A;  5IPA A;  2NXN B;  1HKS A;  3FM3 A;  2E2J J;  1KU3 A;  3BR2 A;  2P4W A;  3OMY A;  1HLV A;  3GZ5 A;  1JJ8 C;  5L3G A;  1OKR A;  1YX3 A;  1OIS A;  4ZJZ A;  2JRM A;  4DNC A;  4BQQ A;  2V79 A;  1QPI A;  2EA4 A;  1FYM A;  4KIB A;  2K9M A;  1F43 A;  2CQX A;  5C4X J;  1E17 A;  3NAR A;  1KU7 A;  1A6I A;  2EBI A;  2KPM A;  4LIU A;  3ZR8 X;  4HV6 A;  1PP7 U;  2N8G A;  1YIJ I;  4MLO A;  3UNG C;  4I76 A;  4KIT B;  2M9H A;  4AWX B;  1R4M B;  4YFN F;  4ENM A;  1J59 A;  2M4G A;  5BOX A;  4C2T A;  2K3P A;  1TZL A;  2YX7 A;  2E7X A;  2DN0 A;  1AU7 A;  1OR7 C;  4CIC A;  1ZKG A;  5GPA A;  5K5O A;  3M9A A;  2QQ8 A;  1DU0 A;  4K2E A;  4CH7 A;  3G1O A;  4L5E A;  2ZME B;  4F7Z A;  5FRN A;  3LWF A;  1SMY F;  2ZXI A;  3CES A;  3ROU A;  3V42 A;  3HGG A;  1RRJ A;  2NNN A;  4MTE A;  1Y8Q B;  3JSP A;  1O4X A;  4CYC B;  3CDI A;  3JCU C;  5LRS A;  4HX4 A;  2R7O A;  3CCY A;  2OF7 A;  3J7A Y;  1TWC J;  2RNG A;  5GTI C;  1KQ9 A;  3CC2 I;  3PNY A;  3HTS B;  3AG3 H;  2JUC A;  2JVH A;  4CCN A;  1SD7 A;  5JHF A;  4KIC A;  5IYC J;  3I55 I;  4IOA F;  1QU3 A;  3WU1 B;  5M5W J;  5EZH A;  1T0F A;  2HGC A;  3H3U A;  4HX8 A;  4H0E A;  2PMZ N;  2K86 A;  3FXU A;  4UNO A;  1FOK A;  2UXX A;  4KMU X;  2KRC A;  3BR0 A;  2WY7 Q;  5J3L A;  2QSF X;  4DBQ A;  5KAI C;  2HQA A;  1HKQ A;  4GGG A;  3U2R A;  1VQP I;  2PMZ A;  4L5I A;  1R5I D;  2NS7 A;  1TBX A;  1S3J A;  3CUQ A;  3N97 A;  4BAY A;  4R8H A;  2M0C A;  5F1J A;  3OOP A;  1S9H A;  4DJA A;  1BJA A;  3GFL A;  4IF4 A;  2F4O B;  5H6R A;  3BLY A;  3JAM Z;  2M8E A;  3WTY C;  1W5S A;  3HXL A;  1TWA J;  3DEU A;  1RUN A;  2JUG A;  1G3Y A;  4JOM A;  3TO9 A;  4XNF A;  1OCR H;  3LA2 A;  3I59 A;  4B4C A;  2ZKZ A;  1OCP A;  3Q9V A;  3FM5 A;  4CGZ A;  3E7L A;  2R7D A;  1HSJ A;  3J80 K;  4BHP A;  3GFI A;  5IOY A;  5D5V B;  1WZ2 A;  1VZ0 A;  1IN6 A;  5B5E C;  2QA4 I;  1Y56 A;  2VJJ A;  4WK8 F;  1W36 C;  2RKH A;  1R22 A;  1PP8 F;  2VB6 A;  4Y52 J;  1JHH A;  2E1M B;  2W84 A;  1JKO C;  1B4A A;  4OWR B;  2DW4 A;  2VUM J;  3MWM A;  4M6Y A;  3OYC A;  1X2M A;  5JR3 A;  2E7W A;  4LK1 F;  1D3Y A;  1O7F A;  5KK1 A;  2HVS A;  1DPR A;  1G3S A;  2R7Z J;  1WRJ A;  1X4O A;  4BBR J;  4G7O F;  2RRE A;  1DDN A;  2LTP A;  1UFM A;  3SQN A;  3E5Q A;  2A5W A;  3CMA I;  2RQQ A;  2W00 A;  3KP2 A;  3KP6 A;  2DA6 A;  5GAH J;  4Q4Z F;  4ENJ A;  3OS0 A;  1LUJ B;  1RR8 C;  5LFA A;  2MLG A;  1JGS A;  5LHH A;  1ZAR A;  2QEN A;  1ON2 A;  2ETH A;  4XSX F;  3ZP5 A;  4JX5 A;  4YEL A;  4DW6 A;  1R00 A;  1BOA A;  3P5J A;  1P7I A;  4XIC A;  3JSO A;  3OOU A;  3C2G A;  1IG7 A;  2M34 A;  2EK5 A;  2LSO A;  3V7S A;  4AYB N;  3MKW B;  4CCM A;  1H88 C;  1RKT A;  1XCV A;  2H6C A;  2A3S A;  2M7A A;  2WB1 A;  3H92 A;  4A5M A;  5HDN A;  5AIP A;  3DKW A;  1QQI A;  4G8X A;  5EGO B;  3CP8 A;  3K69 A;  1XDU A;  1XTA A;  3FK6 A;  4UV8 A;  3W3C A;  5E20 A;  1B8I B;  3V8K A;  2VC1 A;  4BHB A;  4IEJ A;  2WB1 N;  2XAS A;  3HM5 A;  4NNJ A;  3S1R J;  4OMY A;  2ZSI B;  4M3F A;  4M3B A;  3FXK A;  1AA7 A;  5J4Y A;  2EIL H;  4RLQ A;  2NNY A;  3G3Z A;  3HOT A;  3P9C A;  4XN3 A;  2O8X A;  1TWF J;  5DDG A;  2VXD A;  2IS4 A;  2E2I J;  2MFZ A;  2UZK A;  1ZRC A;  3E97 A;  4KA4 A;  1ULY A;  2O9L A;  3K10 A;  3W6J B;  2CW7 A;  1U2W A;  2WV0 A;  3HUG B;  1H0M A;  1YYV A;  4XSZ F;  4LLL A;  1YIT I;  2W24 A;  3L2Q A;  1M1E B;  3P9I A;  5A2Q K;  1UHW A;  3TP3 A;  4KT5 C;  4NQW A;  1K6O A;  3I4P A;  1BA5 A;  1FSH A;  3F8B A;  4XRF A;  3FX3 A;  3FZV A;  4DGW B;  5IOZ A;  5DUK A;  5J4V A;  5JFR A;  1TT0 A;  2XGX A;  4DYQ A;  4LG3 A;  4X0G A;  2XHK A;  4U7B A;  2KIQ A;  4CA0 A;  4YII A;  2DTR A;  3RSN A;  3ABM H;  2L0K A;  1RET A;  5EF6 A;  1XMK A;  1P4A A;  2VLA A;  5JVG F;  1SFX A;  2LVS A;  1E3P A;  4ZYD A;  3LSP A;  2HOA A;  3ZQG A;  1ETW A;  2Z2S B;  3GF2 A;  2ECB A;  4B47 A;  1GDT A;  1PJR A;  5JLW A;  2HR3 A;  3OYK A;  3CCL I;  4A5N A;  3R0J A;  2IRF G;  5HDK A;  5D5U B;  1GXP A;  1GXQ A;  2XB5 A;  4KDP A;  4IHX A;  2XAH A;  2E60 A;  1VQ5 I;  3ABU A;  3TQN A;  4AID A;  4F91 B;  2JN6 A;  3PO3 J;  4IHY A;  3GX4 X;  4FE4 A;  2JK3 A;  4UUV A;  1FP2 A;  5JI6 A;  3TO6 A;  3ULQ B;  3WHB A;  3DPU A;  2V1U A;  1FSE A;  3LMM A;  2DOD A;  3V8L A;  1WQ2 A;  3FHN A;  1YRN A;  3CJT B;  3H0G J;  3DU6 A;  3GZN B;  5EG0 A;  1IN7 A;  4U7D A;  3KZI C;  5M3M J;  2AXL A;  2FBK A;  3S3O A;  1UZC A;  4CCL A;  4A6D A;  4XLH A;  1WH7 A;  1Q1H A;  3QP5 A;  1OCC H;  2PEX A;  4PDK A;  3GLX A;  4EAT A;  1MBE A;  3X2Q H;  2CV2 A;  1JUM A;  1X1P A;  3I53 A;  5CQE A;  5EGO A;  3IL2 A;  1XG1 A;  4GRI A;  3KEO A;  2ZC2 A;  2OD5 A;  3GXO A;  4M9Z A;  3JRI A;  1E2X A;  3C3W A;  2XAG A;  4XL9 A;  3IC7 A;  4C2U A;  2LRD A;  1MMG A;  3Q0W A;  3J7Z I;  1S7E A;  3GWZ A;  3ZMZ A;  4BE2 A;  2CS3 A;  5K5R A;  5LGU A;  3EYI A;  4RM2 A;  1Z77 A;  2LMD A;  4Z2Y A;  3DLL F;  2RC4 A;  3O3K A;  2GOM A;  1QHH D;  2X6O A;  1AOY A;  2CGP A;  4M9X A;  2AS5 F;  2LR8 A;  1LEB A;  2IGO A;  2RGV A;  1LEA A;  3L2C A;  3CD6 I;  3R60 A;  1JUS A;  2DT5 A;  3TBI A;  2FSW A;  1T6S A;  2IP2 A;  1TNT A;  3FXL A;  1ZG5 A;  2B9S A;  5DEQ A;  3FF5 A;  3RZD J;  2IS2 A;  4HF1 A;  2GAU A;  3U1D A;  1EV7 A;  2WC2 A;  4NC8 A;  1BIA A;  2DOA A;  2F5F A;  3DWL E;  2FE3 A;  4WX9 A;  1FOY A;  1W36 D;  1OYI A;  1PVE A;  2JA7 J;  4BJ5 C;  2HOS A;  2EV6 A;  3CUQ B;  1R1T A;  3I4M J;  4HDV A;  4CYD A;  4A3G J;  3GME A;  2P0W A;  1DU6 A;  1MBJ A;  2OZU A;  3ZQC A;  1FZP B;  2ESN A;  4MHG A;  4U0Y A;  3HIF A;  2WV1 A;  2DDA A;  5HS9 A;  4IOC F;  4RBO A;  1IUY A;  2X0L A;  2ZNZ A;  4V2F A;  4EEF G;  1G8X A;  1MDM B;  4A3D J;  1IF1 A;  1Y0N A;  1T0F C;  4OIN F;  1X4P A;  2P81 A;  3WGH A;  4AUX A;  5FRO A;  4PZJ A;  5DD8 A;  3F0C A;  1REP C;  3D5L A;  2M1B A;  1SD6 A;  1VFC A;  2LRE A;  4IZZ A;  1W5T A;  5CLS A;  1NG7 A;  5CVV A;  4DYR A;  1IZ1 A;  1TLH B;  2FD5 A;  1IV8 A;  2L02 A;  5AON A;  3O8G A;  1D0Z A;  3KYD B;  3ZQ7 A;  2VE9 A;  2HWV A;  3E6M A;  1LVA A;  3E6D A;  4WXC A;  1F4K A;  2JMW A;  4ZH4 F;  5JVT A;  2HQN A;  3HSF A;  4O3M A;  3TKY A;  5D8K B;  3S3N A;  2DMU A;  1FOX A;  5FKO A;  2DPD A;  1ZYR F;  2BXY A;  2JT1 A;  1G2H A;  2IGM A;  2CO5 A;  2F4I A;  3A0H C;  2XV4 S;  1JJ6 C;  1DP7 P;  2L4M A;  1A04 A;  5EZG A;  3FBN B;  5J47 A;  4M9S A;  2DQR A;  4EM1 A;  3GTL J;  1YJ9 I;  2HPM A;  3IH4 A;  2QSH X;  5H20 A;  2LY1 A;  4A3E J;  2BOL A;  3LA3 A;  1H9G A;  2OPT A;  1Z3Y A;  3OIQ A;  5LRR A;  5L3B A;  3MZY A;  1MBG A;  1QVT A;  2ECC A;  3CMY A;  1U78 A;  3FXQ A;  4A3I J;  1X2N A;  2YU9 J;  1Z1D A;  1HDP A;  2OBP A;  3VYT B;  4I0B A;  3HPG A;  3SZT A;  4PCQ A;  2CUJ A;  3QPH A;  4AIK A;  3QU6 A;  2QM3 A;  3PM1 A;  2KZV A;  4ZC3 A;  1JXS A;  3NQO A;  4A6E A;  4AM3 A;  1WJC A;  3PSI A;  3CZ6 A;  2KZG A;  3DBR B;  4P9U A;  5JHU A;  1KQ8 A;  4BJ6 C;  4P55 A;  1JE8 A;  1YX5 A;  2IW5 A;  2RNJ A;  2BVM A;  2L3D A;  3J7A O;  4JX6 A;  2M87 A;  4M72 A;  1H89 C;  1FLI A;  3LSJ A;  4HF0 A;  5IP9 J;  4CHU A;  5DYM A;  4I2O A;  1A5J A;  2Z1D A;  2UUZ A;  4MGR A;  2YPR A;  2IXS A;  2JPB A;  2R7V A;  2O3F A;  3KLO A;  1EKE A;  2WBM A;  1LJ9 A;  2VT3 A;  5B1B H;  3HOY J;  3FXM A;  3GFM A;  3K1P A;  3HUG A;  4W1U A;  2K9S A;  3PUB A;  3ZOB A;  1I1S A;  4N4O B;  3CCM I;  4XLN F;  4XRS A;  1K79 A;  2F48 A;  3CJN A;  4ZZL A;  3J81 Z;  4XKW A;  4UUT A;  1ZR4 A;  1XC5 A;  1WHU A;  2KQR A;  2HDW A;  5E8G A;  1K78 A;  1CGP A;  2L7K A;  4YG2 F;  5L3E A;  5FLM J;  2C6Y A;  2OTJ I;  4QLC U;  3OWT A;  3B73 A;  2H1K A;  1WJA A;  3ML6 A;  3CF5 F;  1FP1 D;  3WG7 H;  2X6Y A;  1DPU A;  2QUF A;  1V3F A;  4A3J J;  2QCO A;  1MSF C;  2Z99 A;  4RB0 A;  2O5R A;  1FBS A;  4HBL A;  4OOI A;  1U9O A;  2DDB A;  5IY5 H;  4D1Q A;  1T39 A;  3LSK A;  5EDN A;  1ZGW A;  2L2O A;  4NC6 A;  1FYL A;  1WFX A;  4WF2 A;  1J9I A;  5CKT A;  1TWG J;  3HRU A;  1K6Y A;  2X51 A;  2VAS A;  2ZXJ A;  4Y7N J;  4ABZ A;  1HKT A;  4PSW A;  4YEJ A;  2FOK A;  1U6G A;  1IRX A;  5DCM B;  2VOO A;  3UR3 C;  1D1B A;  4XID A;  5HLG A;  1C0W A;  5C3E J;  5DD4 A;  3J81 K;  4F3Q A;  2Y75 A;  4F93 B;  2K27 A;  3KFW X;  1YO5 C;  2HXI A;  1IJW C;  5K7F A;  2KJB A;  2BW3 A;  5HOD A;  1FPQ A;  2HKO A;  2DA3 A;  2XPU A;  4QWQ A;  1DGR M;  2JWT A;  3C2B A;  2PJR B;  5L3D A;  4LB5 A;  2ZJQ F;  2OZ6 A;  2V9V A;  1JKQ C;  1I3Q J;  3C2H A;  2Q2E A;  1T8I A;  2GXG A;  2TDX A;  3QOP A;  3QU3 A;  1UG0 A;  3OL3 A;  4HNV A;  2QYO A;  4BEH B;  3HBL A;  3RDI A;  3ZMD A;  2VOP A;  2X48 A;  3MFK A;  2JTV A;  3TOB A;  4BDZ A;  1HA8 A;  3K1M A;  4BQO A;  1XPX A;  2ZFW A;  4JP0 A;  1ENH A;  3PIP F;  3U9G A;  2PMU A;  1WGX A;  2QSG X;  3CQZ J;  2AHQ A;  2G7H A;  2Q8K A;  3A2K A;  2B7E A;  4EGZ A;  4ZYH A;  4GO1 A;  3BDD A;  4NQW B;  2H1L A;  3SYT A;  3H1C A;  3W2A A;  3QP6 A;  4D7N A;  4J19 A;  3RKY A;  2CWE A;  4EMS A;  3IKV A;  3OV8 A;  4RLF A;  1J2X A;  3OYI A;  2QQ9 A;  4UUS A;  2LD5 A;  1ZLK A;  3GTO J;  2HEO A;  2BZT A;  5HLH A;  4LGW A;  3LQQ A;  4FE7 A;  4BS9 A;  5EEA A;  3PIO F;  3HB9 A;  1R1V A;  3GBG A;  2LF8 A;  2DPU A;  5D4S A;  4E7J A;  3QOD A;  3EDP A;  2DFE A;  4JK1 X;  2Y9Z A;  3JRD A;  2ZO4 A;  1P4W A;  3S17 J;  1B9M A;  5F0H A;  2JZY A;  2GXA A;  1VF9 A;  2OAZ A;  4JQF A;  3Q5F A;  4IX7 A;  1ZGA A;  4HZF A;  2PN6 A;  3TW6 A;  4EJU A;  2XAQ A;  4EGY A;  3BTC A;  2KDZ A;  5E8I A;  1U8R A;  2XRO A;  3O8H A;  3M7G A;  4IHV A;  2V4J C;  3ZQF A;  3LFK A;  2V1N A;  4Y33 A;  4B43 A;  1FJL A;  4MIM A;  2FML A;  1G6N A;  4IL6 C;  2A69 F;  3SEQ A;  3FKJ A;  2K3F A;  3E3V A;  4ETS A;  4LIT A;  4GCV A;  2LG4 A;  5B3S H;  3WE3 A;  1S7O A;  3FWE A;  5D6E A;  3L1P A;  4XLC A;  1WCM J;  2P7V B;  2DMT A;  1XDS A;  2VKH A;  3V8J A;  4WWC A;  3JRF A;  5IT9 Z;  4IQ4 A;  1S8N A;  3WG9 A;  1W5C C;  4XOP A;  3T1B A;  1O3T A;  1JKR C;  4BBS J;  3IRQ A;  2FNA A;  3I9V 2;  2DT6 A;  4HQM A;  2H09 A;  3L7W A;  5DCM A;  2CG4 A;  2JA8 J;  3Q9S A;  2WTE A;  4QTR A;  4PK4 A;  5E17 F;  1V5E A;  1L0O C;  1UHM A;  1A6Q A;  4AIH A;  1R71 A;  1IW7 F;  2FOW A;  5HLI A;  2WAD A;  2KHM A;  5HNH A;  2VKE A;  2V6E A;  5FLX Z;  3IRR A;  2K9L A;  1S5L C;  1U5T C;  3M1C A;  4TV7 A;  2OTL I;  4MFE A;  2VBW A;  1XMA A;  3B6C A;  4L9N A;  1RI7 A;  4OIO F;  4HST A;  5IYD J;  5FD5 A;  3VDX A;  4CZC A;  2HTJ A;  3AG4 H;  5ED4 A;  1XB4 A;  2Q0O A;  1V5G A;  1ZN2 A;  2L7F P;  4G94 A;  1TQI A;  3OYM A;  2XIG A;  4LG0 A;  2LBF B;  4A3F J;  2MAB A;  1HCR A;  1FY7 A;  2X1D A;  4OIP F;  2DFI A;  5FD6 A;  2W1O A;  4MNU A;  1HBX G;  3DBH B;  2KL4 A;  5DUI A;  5CVR A;  2RVC A;  2H8R A;  5EJC A;  2Z33 A;  2JJ7 A;  2VQC A;  3OYE A;  1Q1V A;  2E1M C;  3LSI A;  5J40 A;  4HYE A;  2GIV A;  4KIF A;  3P9K A;  3K9T A;  1N25 A;  1ETK A;  3CJQ B;  4LK0 F;  3DKX A;  1JHF A;  2HQ5 A;  3CLO A;  2LP0 A;  2W48 A;  3F8N A;  3R61 A;  4BXU A;  3MQ0 A;  2H27 A;  1EA3 A;  1P92 A;  5FKL A;  4DYC A;  4A3C J;  4BY1 J;  1E0E A;  2QGU A;  3S2H J;  1FBU A;  2IAI A;  1JI8 A;  2B0L A;  2G9W A;  4CCK A;  5B1A H;  3K2A A;  1B9N A;  2HFH A;  1LVK A;  4MQ9 F;  2L9V A;  4DOZ A;  2V1X A;  3GTK J;  3H35 A;  5HS8 A;  2ADU A;  2E1N A;  9ANT A;  4PGG A;  1O7L A;  3FMQ A;  4UVB A;  3F6O A;  1OQY A;  2KLO A;  2BE5 F;  4IHS A;  1Z91 A;  1W0U A;  3GZ6 A;  3H36 A;  1U9N A;  3ZN0 A;  5TGT A;  1L3L A;  1ZG3 A;  2JQ7 A;  5HOO A;  1XGM A;  2QBY B;  3WE2 A;  2NS8 A;  4BEH A;  1UJ8 A;  2ICW G;  1LPQ A;  4C3J J;  3L2U A;  5M3F J;  1F9N A;  2ME6 A;  1HF0 A;  2NVX J;  2E2H J;  2DK5 A;  4PGH A;  3OIO A;  3ONQ A;  4G6T B;  2OQG A;  3FDY A;  2K02 A;  3A02 A;  1E3O C;  5DCF A;  2BEO A;  3DBL B;  3VSK A;  3MD2 A;  5LEJ A;  3AKZ A;  5GAD J;  3VWB A;  3LAJ A;  2VQG A;  2XB0 X;  4IXA A;  2ZME A;  5FKK A;  1Y39 A;  4UVC A;  1W7P A;  4HAM A;  3S8P A;  2ISZ A;  1YW8 A;  2PFB A;  2QWW A;  5DV5 A;  1WH5 A;  3ZQH A;  2MW8 A;  4PUS A;  3FHZ A;  2QZ8 A;  3OR1 C;  4PJL A;  3BG3 A;  2MGQ A;  1ZHF A;  4FAS D;  4BE0 A;  1QGP A;  1B1B A;  3DPT A;  5F27 A;  4UHT A;  5ERI A;  2Z9O A;  1QHG A;  4JBA A;  3WU2 C;  2XKP A;  1E3H A;  3KIO A;  2CV1 A;  3G2B A;  1IXS B;  3SDB A;  2MYS A;  1BC8 C;  3TO7 A;  5TRD A;  3JRH A;  2IPQ X;  3BG7 A;  3CLQ A;  4B3A A;  5J1R A;  1QVU A;  4IHT A;  4MQV A;  1ETO A;  4HQE A;  5D5W B;  3F8C A;  2Y9Y A;  1IGN A;  1MD0 A;  2NVQ J;  1WI9 A;  3PFI A;  3CCV I;  4OIR F;  4M3G A;  1H9T A;  1FX7 A;  3D1N I;  2KFD A;  3GTP J;  2P6S A;  3G73 A;  4ASN A;  1ETY A;  2J5P A;  3RKW A;  4BAC A;  1UAA A;  2MA3 A;  3TED A;  1G59 A;  3T0Y A;  2JA2 A;  2FA5 A;  4QPO A; 
#chains in the Genus database with same CATH homology
 3LOC A;  1RKW A;  4RBO A;  1LFU P;  3HOZ J;  2TRT A;  4V2F A;  4EEF G;  3S1M J;  3BQY A;  3BTJ A;  4RDU A;  4A3D J;  3FK7 A;  2P81 A;  4AUX A;  2XGC A;  3DEW A;  3F0C A;  3HEF A;  1VFC A;  4M3D A;  1FTT A;  4DYR A;  2DA7 A;  2FD5 A;  1P7J A;  2Y30 A;  3O8G A;  1ITY A;  4M6V A;  2CRG A;  1B72 B;  3QPS A;  3NAU A;  1BW5 A;  2E19 A;  3JRE A;  1YRN B;  2HDD A;  3S1Q J;  4BXX J;  4GFB A;  3IV5 A;  2LY9 A;  4D5F A;  2DMQ A;  2JMW A;  3MVP A;  1ZK8 A;  1Y1V J;  3HKZ N;  4C3I J;  2JA5 J;  2DMU A;  2FJ1 A;  4A69 C;  5M5Y J;  5FKO A;  2R0Q C;  2ID3 A;  2DMP A;  2EZH A;  3ZQI A;  1G2H A;  2DA4 A;  3CDL A;  3WHC A;  2CUE A;  1JJ6 C;  3FIS A;  1ETX A;  5EZG A;  2E1O A;  3GTL J;  2GBY A;  3IH4 A;  4A3E J;  1OCT C;  5C44 J;  2OPT A;  5FKM A;  1MBG A;  1QVT A;  2M8G X;  2ECC A;  1AKH A;  1ZQ3 P;  1F36 A;  3CMY A;  1ORK A;  4MO7 A;  1U78 A;  4A3I J;  1X2N A;  2YU9 J;  2IBD A;  2X9D A;  2EH3 A;  3BTI A;  2YUS A;  1HDP A;  2FX0 A;  2HI3 A;  3BR5 A;  1Y1W J;  4A3B J;  4M3E A;  3UKG A;  1HOM A;  2HXO A;  3PM1 A;  2L9R A;  1LE8 A;  5DS9 A;  4FTH A;  1ETQ A;  1IRZ A;  4X6A J;  1I6H J;  1WI3 A;  3G1M A;  4JX6 A;  1H89 C;  1AHD P;  3RKQ A;  3LSJ A;  3GTQ J;  5FJ8 J;  5IP9 J;  1A5J A;  2LFB A;  5J1U A;  3IH2 A;  2ME0 A;  3BG5 A;  2GM4 A;  5IPA A;  2R5Z A;  3HOY J;  4W1U A;  1JUP A;  2K9S A;  3ZOB A;  2E2J J;  3BR2 A;  2CUF A;  1HLV A;  2XRL A;  1JJ8 C;  1RPW A;  4S0H B;  1GUU A;  1H8A C;  1MSE C;  4XRS A;  2MSY A;  2R5Y A;  4UUT A;  1ZR4 A;  1XC5 A;  4AC0 A;  4IHW A;  1QPI A;  5FLV A;  5EG0 B;  3PO2 J;  2AO9 A;  1F43 A;  3HGY A;  2CQX A;  5FLM J;  5C4X J;  3NAR A;  1A6I A;  2EBI A;  2H1K A;  5F0C A;  2XPV A;  4A93 J;  1T56 A;  4W97 A;  3S1N J;  5BNG A;  2N8G A;  4MLO A;  1JGG A;  4I76 A;  3A01 B;  3I4N J;  2K9N A;  2M9H A;  1IV6 A;  4A3J J;  2QCO A;  1NK3 P;  4DZJ A;  1MSF C;  3HOV J;  2DN0 A;  3MN2 A;  1U9O A;  4G12 A;  1AU7 A;  1B72 A;  3SDG A;  1ZKG A;  2Y2Z A;  5GPA A;  5EDN A;  1ZGW A;  2R92 J;  1ZTR A;  1DU0 A;  1OFC X;  3H3V K;  3G1O A;  1GVD A;  4L5E A;  1TWG J;  1BJZ A;  3G1L A;  4Y7N J;  4ABZ A;  3BR6 A;  3HGG A;  3JRA A;  4V2G A;  2XGD A;  4XID A;  1O4X A;  4CYC B;  3CCY A;  2OF7 A;  5C3E J;  1B8I A;  3JRC A;  2XGE A;  3FKI J;  2HXI A;  2XPW A;  1TWC J;  1IJW C;  1FIA A;  5K7F A;  5HOD A;  5E3L A;  2DA3 A;  2XPU A;  2LK2 A;  5IYC J;  1RR7 A;  2JWT A;  3C2B A;  4XRS G;  5M5W J;  5EZH A;  3BT9 A;  2PMZ N;  1CQT A;  1JKQ C;  1I3Q J;  1AKH B;  3W6V A;  3BR0 A;  5J3L A;  4HNV A;  1VI0 A;  3HBL A;  2VKV A;  2X48 A;  2VI6 A;  2NS7 A;  3RZO J;  3HOU J;  2M0C A;  5F1J A;  4JP0 A;  4BKX A;  1ENH A;  4B1R A;  1IDY A;  1WGX A;  5GPC A;  3CQZ J;  5E3N A;  2AHQ A;  1BW6 A;  1MBH A;  5E3O A;  1TWA J;  5E3M A;  1K61 A;  3B6A A;  3S15 J;  4C2M J;  3HDD A;  1QRY A;  1GV5 A;  4XRM A;  4D7N A;  4B4C A;  1OCP A;  2CJJ A;  3E7L A;  4J19 A;  2NVY J;  5IOY A;  1VND A;  2DTZ A;  2RAE A;  4UUS A;  2LD5 A;  2EZL A;  3GTO J;  2R5Z B;  1APL C;  4JYK A;  4FE7 A;  5EEA A;  2HOT A;  4Y52 J;  3HB9 A;  3GBG A;  3BG9 A;  2CQQ A;  3SFI A;  1JKO C;  2Y9Z A;  4D5C A;  2DJN A;  3JRD A;  3S17 J;  2CU7 A;  5F0H A;  1X2M A;  5FKN A;  1MBK A;  1VF9 A;  1JT6 A;  1K83 J;  2ID6 A;  3TW6 A;  2R7Z J;  2DA5 A;  4BBR J;  1UG2 A;  3BTC A;  2KDZ A;  2G0E A;  3O8H A;  5M5X J;  4IHV A;  2LTP A;  3ZQF A;  5F0F A;  2DA2 A;  1FJL A;  2D5V A;  4MIM A;  1TC3 C;  1LFB A;  2DA1 A;  3VPR A;  1D5Y A;  3S14 J;  1EF4 A;  2DA6 A;  2GLO A;  4XK4 A;  1GV2 A;  2QF7 A;  1BL0 A;  5DTD A;  3DCF A;  2MG4 A;  5GP9 A;  3L1P A;  3M3Y J;  5JLX A;  1WCM J;  1PUF B;  2DMT A;  4JX5 A;  4DW6 A;  3JRF A;  1P7I A;  4JX4 A;  3TP0 A;  4XIC A;  1IC8 A;  3OOU A;  1IG7 A;  1NK2 P;  1JKR C;  2M34 A;  4AYB N;  1H88 C;  4BBS J;  1FIP A;  1RKT A;  1NTC A;  3IH3 A;  2K40 A;  5EGO B;  1WPK A;  5F08 A;  3Q0U A;  2JA8 J;  1MNM C;  4CYC A;  3FK6 A;  3LSG A;  4QTR A;  1B8I B;  2HYJ A;  3JRG A;  4IEJ A;  2WB1 N;  3HM5 A;  1LE8 B;  2VPR A;  3S1R J;  2VKE A;  4M3F A;  4M3B A;  3GTM J;  4MFE A;  3B6C A;  5IP6 A;  4D7M A;  5IYD J;  1TWF J;  2E2I J;  1IDZ A;  2WAQ N;  1MBF A;  1JKP C;  1ETV A;  2O9L A;  3BR3 A;  2L7F P;  4DZP A;  2XSD C;  4FIS A;  4A3F J;  1UMQ A;  3FIW A;  1HCR A;  3TP3 A;  1MH4 A;  3MKL A;  2NVT J;  5IP7 J;  2O7O A;  1BA5 A;  1Z0X A;  2NOG A;  5IOZ A;  3TW7 A;  2H8R A;  2Y31 A;  2JJ7 A;  2FQ4 A;  1Q1V A;  5C4J J;  3HOX J;  4DYQ A;  1JT0 A;  1ETK A;  1HDD C;  2HQ5 A;  2L0K A;  1RET A;  2LP0 A;  5EF6 A;  2W48 A;  3GTJ J;  3HOW J;  4A3K J;  2LVS A;  1I50 J;  3LSP A;  1X58 A;  2HOA A;  2LLK A;  1SFO J;  1IUF A;  3ZQG A;  1ETW A;  2IEK A;  2KT0 A;  1GDT A;  2ECB A;  2B63 J;  5JLW A;  3JRB A;  4DYC A;  5FKL A;  4A3C J;  4BY1 J;  3BR1 A;  2K9Q A;  1GT0 C;  2LKX A;  3S2H J;  2IAI A;  1U8B A;  2COB A;  3BTL A;  3K2A A;  2XB5 A;  4IHX A;  3SJM A;  2R93 J;  3GTK J;  2JN6 A;  3PO3 J;  2O8K A;  4IHY A;  4FE4 A;  2JK3 A;  4FCY A;  1FEX A;  9ANT A;  3WHB A;  2L7M P;  4NDL A;  1POG A;  2R5Y B;  1ZR2 A;  1YRN A;  2EZK A;  2Y0S N;  1W0U A;  3H0G J;  1PUF A;  5EG0 A;  3LSR A;  1U9N A;  3M4O J;  5M3M J;  3QPL A;  3JR9 A;  1WH7 A;  3LNQ A;  4X1E A;  2ELK A;  4I6Z A;  2NS8 A;  1MBE A;  1JUM A;  4C3J J;  5EGO A;  2EQR A;  3A01 A;  5M3F J;  2ZB9 A;  2ME6 A;  1HF0 A;  1XG1 A;  2YS9 A;  3K7A J;  2NVX J;  2E2H J;  3OIO A;  1T33 A;  4A3M J;  3JRI A;  3ZQL A;  3A02 A;  1R9T J;  4BY7 J;  1E3O C;  3Q0V A;  3BQZ A;  3GTG J;  1MH3 A;  3Q0W A;  2EZI A;  1S7E A;  4A3L J;  2L7Z A;  2TCT A;  3QQA A;  2XB0 X;  1SAN A;  1Z77 A;  4C3H J;  4QIW N;  5FKK A;  1JTX A;  2X6O A;  1WH5 A;  3ZQH A;  3S16 J;  2MW8 A;  1RES A;  1W0T A;  2LR8 A;  3BG3 A;  2MGQ A;  5J1Y A;  4UUS B;  1XS9 A;  1FTZ A;  1JUS A;  5F27 A;  1JTY A;  1OJL A;  4LOC A;  5IYB J;  1UHS A;  4MFD A;  3RZD J;  3JRH A;  3OSF A;  4B3A A;  5J1R A;  1QVU A;  2DMN A;  3Q3S A;  5K7H A;  1ETO A;  3A03 A;  5EYR A;  2Y9Y A;  2JA7 J;  1IGN A;  2NVQ J;  2HOS A;  3I4M J;  5F04 A;  4QSH A;  4M3G A;  4A3G J;  3RQI A;  3D1N I;  3GTP J;  1DU6 A;  1MBJ A;  2M2E A;  3S2D J;  1TWH J;  3OSG A;  1ETY A;  3ZQC A;  3TED A;  2I10 A;  5K7Z A;  2JA6 J;  2WV1 A;  2VUM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...