1JGGA

Even-skipped homeodomain complexed to at-rich dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
57
structure length
57
Chain Sequence
RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(P*TP*AP*AP*TP*TP*GP*AP*AP*TP*T)-3'
publication title Structure of the even-skipped homeodomain complexed to AT-rich DNA: new perspectives on homeodomain specificity.
pubmed rcsb
source organism Drosophila melanogaster
total genus 19
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jggA00
2ID3A 3JREA 1JT6A 4JP0A 3GTQJ 4IHYA 4A69C 4BBSJ 2DMQA 3BTCA 3IH4A 3BTIA 1WH5A 1FEXA 2HXIA 3BR0A 4AC0A 5F08A 1PUFA 2HI3A 2FQ4A 2FJ1A 3FIWA 3HOXJ 2EH3A 3DCFA 1IDYA 2XGDA 5EYRA 1RESA 4IEJA 2EZIA 5J3LA 3LSGA 2DA2A 1ZGWA 3HOZJ 3M3YJ 3RZOJ 3FISA 4FE7A 2HOTA 1IGNA 2Y2ZA 2E2IJ 1F36A 3S15J 2YUSA 1Z77A 1I50J 3MN2A 2O8KA 5FLVA 1IJWC 2W48A 4BKXA 3FK7A 3JRAA 2O7OA 5IPAA 1OJLA 3W6VA 2DA1A 1RKTA 4QSHA 3NAUA 1XG1A 5J1RA 1W0TA 1ETOA 2ZB9A 4M3DA 4Y7NJ 1Q1VA 3WHCA 4I6ZA 2X6OA 1MSEC 3QQAA 4I76A 3UKGA 4FISA 2XGCA 2ME0A 2NS8A 3S1QJ 2L7ZA 5IP7J 2KDZA 4D5CA 5F04A 2WB1N 2AHQA 1JUPA 4C3IJ 4W1UA 3Q0WA 4DYCA 2IAIA 4A3JJ 2LFBA 3JRGA 2R5YB 5JLXA 2EBIA 1U9OA 3LSJA 1Y1VJ 3G1OA 1A6IA 2TRTA 1FIAA 2E19A 4LOCA 1LFBA 4BY1J 3JRCA 5EGOB 3FKIJ 1RPWA 1TWAJ 3BG5A 2XPUA 5C3EJ 3GTLJ 1TWGJ 2LK2A 3D1NI 1JKRC 1MBFA 5M5WJ 3L1PA 2LR8A 1PUFB 3K7AJ 5M3MJ 1QRYA 5GPAA 1B8IB 1BW5A 3JRDA 3JRFA 2JA5J 4IHVA 2XB5A 1X58A 3I4MJ 5GP9A 4B3AA 3MVPA 1ZKGA 2O9LA 2D5VA 5K7ZA 3RQIA 1QVTA 1HCRA 1MBJA 2XPVA 3RZDJ 1YRNB 2DMUA 1TC3C 3HOYJ 4XICA 5EDNA 2CRGA 3A02A 5FKKA 3OSGA 5BNGA 2FD5A 2WAQN 5DS9A 1MSFC 2EQRA 2Y30A 3RKQA 2Y9ZA 2QF7A 3ZQGA 2R7ZJ 5FJ8J 4A3GJ 1NK2P 1HF0A 4RDUA 3PO3J 2DA7A 4RBOA 1BW6A 2L7MP 5EG0B 2K9SA 4JX6A 1GVDA 4M3EA 4BXXJ 1Z0XA 1BA5A 3BR1A 3IH3A 4L5EA 2R5YA 1HLVA 2PMZN 3JR9A 2YU9J 2DTZA 1BL0A 1Y1WJ 2H1KA 1P7IA 1HOMA 4DZPA 2K9NA 2XRLA 1K83J 4JYKA 5EGOA 1K61A 2OPTA 1WI3A 3O8GA 1MH4A 2R93J 2Y9YA 2HYJA 4XIDA 2VKVA 2VI6A 3WHBA 3IV5A 2K9QA 5C44J 2DMNA 2QCOA 4DYQA 1B8IA 1RETA 3BG9A 5EEAA 2JA7J 1MBEA 2MGQA 4A3BJ 1RKWA 1GUUA 5F0CA 3S1RJ 3ZQLA 1ZK8A 3HGGA 3HM5A 1SFOJ 5EF6A 1DU0A 1WH7A 1H8AC 1RR7A 1VNDA 4C2MJ 2CJJA 3BQZA 1NTCA 1YRNA 4V2GA 3S17J 3GTGJ 2NVQJ 2EZKA 2HOAA 1U78A 3OIOA 1JUMA 2CQQA 1OCPA 4AUXA 2LKXA 2R92J 2XPWA 2FX0A 4XRSA 2KT0A 1ZR2A 3SDGA 3ZQFA 4S0HB 2MSYA 5EG0A 1CQTA 4GFBA 3LOCA 2M34A 1W0UA 2X9DA 5E3OA 2K40A 2RAEA 1QPIA 4HNVA 3GTPJ 1LE8B 2JJ7A 1ZQ3P 1UG2A 2JWTA 5IYDJ 1JJ6C 1GDTA 3Q0UA 3O8HA 2XB0X 3ZQHA 3M4OJ 5FKNA 5F27A 4DZJA 2M0CA 1VI0A 2DN0A 5IOYA 1A5JA 2CUEA 3BTLA 1JJ8C 5K7HA 2GBYA 5FKLA 3GTOJ 4A3DJ 1E3OC 5EZGA 1SANA 4C3HJ 4A3EJ 2G0EA 2L9RA 1APLC 1MBGA 3Q0VA 2N8GA 1ITYA 3GBGA 1TWFJ 4BBRJ 1JT0A 3G1LA 3TP3A 4IHWA 5J1UA 2LVSA 2IEKA 4M3BA 1NK3P 1XC5A 4C3JJ 2B63J 1JKPC 1WGXA 1ZR4A 2JN6A 1IG7A 2GM4A 3S16J 4FE4A 2CUFA 5E3NA 3Q3SA 2Y0SN 4A3CJ 1POGA 3H3VK 1FTZA 5JLWA 2NS7A 5F0HA 1GV2A 1P7JA 3S1NJ 1U8BA 2E1OA 3ZQIA 3ZOBA 4NDLA 4UUSB 1LE8A 1UMQA 1IDZA 4A93J 5F1JA 2LLKA 3GTKJ 3HDDA 2ID6A 1BJZA 2XGEA 1I3QJ 5IP9J 3QPSA 4D5FA 5GPCA 2LP0A 1H89C 2E2HJ 1ETQA 2OF7A 3HEFA 3TP0A 1G2HA 5K7FA 2NVTJ 2JMWA 3BR3A 4MLOA 2CU7A 1LFUP 2NVYJ 3ZQCA 2LD5A 2DMTA 3HBLA 5C4JJ 4MFEA 1B72B 4Y52J 3IH2A 4FCYA 2DMPA 3DEWA 4B1RA 1ZTRA 1JGGA 2LY9A 1ETWA 2X48A 3HGYA 3CCYA 3TW6A 2COBA 1AU7A 3S14J 1JUSA 2MG4A 3LSPA 3BR6A 1T56A 2AO9A 2R5ZB 2DA6A 1IV6A 2L0KA 3LSRA 2NOGA 1QVUA 2JA8J 3A01B 1AKHB 1MBKA 4A3IJ 2VKEA 5IP6A 1FJLA 2P81A 4A3FJ 2VUMJ 4UUTA 4FTHA 2DA5A 1O4XA 3G1MA 1ETYA 2I10A 2DJNA 4DW6A 5IYCJ 1HDDC 1MH3A 3E7LA 2M2EA 4UUSA 5FKOA 5M5XJ 3B6CA 2DA3A 1ETXA 3PM1A 2ME6A 3B6AA 4IHXA 1ETVA 2TCTA 3PO2J 5E3LA 1JTYA 4G12A 4M3GA 4CYCB 3JRIA 4A3KJ 3BT9A 2EZHA 4W97A 1S7EA 2CQXA 2ECCA 5DTDA 3CDLA 2JK3A 1T33A 3TEDA 4A3MJ 1ETKA 3VPRA 1GT0C 3I4NJ 1JKQC 2H8RA 1H88C 3HOVJ 4MIMA 1FTTA 1U9NA 2R0QC 4XK4A 1B72A 3NARA 1XS9A 5IOZA 2M8GX 4DYRA 4BY7J 4B4CA 3BR2A 3OSFA 4AYBN 1JKOC 3S2HJ 5FKMA 3HOUJ 1MBHA 4JX5A 3CQZJ 3S2DJ 2LTPA 1EF4A 3BTJA 1OFCX 2YS9A 4XRSG 1VFCA 4V2FA 2R5ZA 3JRHA 4MFDA 2Y31A 1HDPA 2L7FP 3MKLA 3JRBA 2NVXJ 5M5YJ 3A01A 1AKHA 2E2JJ 1X2MA 1VF9A 1AHDP 3BR5A 5EZHA 4M6VA 4X1EA 1DU6A 4D7MA 2HQ5A 4A3LJ 4JX4A 1F43A 1TWCJ 3GTJJ 1IUFA 1JTXA 5M3FJ 1OCTC 2MW8A 2ECBA 3H0GJ 3K2AA 5IYBJ 2JA6J 3S1MJ 4XRMA 3HB9A 4CYCA 1WCMJ 1ORKA 3QPLA 2HOSA 1R9TJ 1MNMC 1IC8A 3A03A 4M3FA 1WPKA 5FLMJ 1IRZA 3BG3A 3SJMA 4QIWN 1GV5A 3C2BA 4D7NA 1UHSA 2HXOA 4MO7A 3LNQA 3GTMJ 5HODA 2DA4A 4QTRA 2GLOA 2XSDC 1ENHA 2EZLA 1I6HJ 5F0FA 4ABZA 3FK6A 2VPRA 3OOUA 3CMYA 5E3MA 2ELKA 3SFIA 4X6AJ 4J19A 1D5YA 1TWHJ 2IBDA 3HKZN 9ANTA 3TW7A 1X2NA 3F0CA 5J1YA 2M9HA 2WV1A 3HOWJ 5C4XJ 1FIPA 2HDDA 3BQYA 4EEFG
chains in the Genus database with same CATH superfamily
1U2WA 2ID3A 4GYIA 1P4XA 3ZN1A 5DDGA 1W5CC 2L4MA 4IHYA 3IH4A 4ZYAA 4EM0B 1HW2A 3BTIA 1WH5A 4GXOA 3M1CA 2VQCA 5D4SA 4OIQF 2OTLI 2K4JA 1Z21A 2DYRH 2LYCA 4RGRA 2EH3A 3DCFA 4LIUA 3DP7A 4R8HA 2A5YB 2GXAA 2OZ6A 3FMQA 1H9GA 2DA2A 2XAQA 2RKHA 2A07F 3M3YJ 1LVAA 3LFUA 4FE7A 2HOTA 2Y2ZA 2G9WA 1F36A 1XCBA 3CMAI 1I50J 3FDYA 3PFYA 2VOOA 1CF7A 5FLVA 4YELA 5FFZA 2MD5A 1MJ9A 3M8EA 4FHTA 2KLOA 5IPAA 3W6VA 2DA1A 2E1NA 2NS0A 1FY7A 3CUQC 1VQ8I 2PBIA 1Q1VA 4I6ZA 4HNTA 1MSEC 3GFIA 1SVLA 3C1DA 2DK8A 1ACIA 2ME0A 1SFKA 2LC2A 1SFUA 5IP7J 4BJ6C 2KDZA 4KN4X 3K4NA 1D1AA 4XKVA 5FO5A 3JRGA 4UNOA 2EBIA 3FZVA 3RDIA 1Y1VJ 1YW7A 5KAFC 2STTA 2XAJA 1HKQA 2PLYA 5ILUA 5H6QA 3FM3A 1LFBA 2KISA 3KYDB 3G4SI 2V6CA 2M0MA 2VQGA 5M5WJ 4XSXF 2F5VA 1PUFB 1GVJA 1MDMA 3FXOA 2CH0A 3GFJA 1QRYA 3PNVA 4BHPA 5GPAA 1K78B 1E3PA 4CXFA 3CCSI 4DOZA 1HXDA 2JA5J 4IHVA 2XB5A 4C2TA 1BI2A 3ZMDA 2FEZA 4AVZA 1J59A 1WVRA 4B3AA 1ZGJA 1FPQA 1U0JA 3RKYA 1ZKGA 5IY5H 5BOXA 2O9LA 2STWA 3I59B 3CLQA 1B6AA 4FASD 2G7UA 2BY0A 2OCCH 4KT6A 1HCRA 2MD0A 3RZDJ 2VJIA 1W5SA 4XICA 2HDDA 1MJAA 1FYLA 2M30A 3DPUA 2PJRB 3A02A 2R3SA 5FKKA 1LFPA 5BNGA 4RGUA 4AIDA 4P96A 2FD5A 2H8WA 4G7OF 2KP6A 2CQNA 3PFIA 2V1DA 2EQRA 3EUAA 3MZHA 2Y9ZA 3ZQGA 1B59A 2LKPA 1DDNA 1B4AA 1NK2P 2HDWA 1D1BA 2W57A 3OMYA 4RDUA 2LRDA 2KRCA 1YFHA 1EJ9A 2L7MP 2FU4A 3CCEI 2ZMEB 3TBIA 1VQKI 4XOPA 4ENNA 3DWLE 1UAAA 3GF2A 1YX5A 1IRXA 4UVAA 5JI6A 4OIOF 3HTSB 1Z0XA 2KL4A 4ZTFA 5TISC 3UR3C 4L5EA 3DF8A 5D5XB 1YS6A 1HLVA 2E71A 3T1BA 3K0LA 2YU9J 1BL0A 4YG2F 1U6GA 2D45A 2W7NA 3FXMA 3HZJA 2M87A 4B8XA 3CTAA 4DZPA 3HJEA 3PQKA 3G6EI 1ODDA 1O3SA 2K3PA 4JYKA 5CVUA 4A0YA 2BXZA 3OYBA 3O8GA 3I58A 1G59A 2F2EA 4KIFA 3VODA 4MEYF 2VI6A 2K27A 5C44J 3E5QA 1K78A 5CVVA 5TGTA 1XGNA 3BG9A 3DBLB 2JA7J 5FROA 2OD5A 2HTJA 1RKWA 5CYVA 3GX4X 3S1RJ 3ZQLA 1UCRA 3HGGA 2FOWA 3GZNB 2KJBA 1SFOJ 2A6TA 3ISPA 1WH7A 1MZBA 4OIPF 2HVQA 2YPRA 1KONA 4V2GA 4HV6A 1IW7F 3FMRA 3HRUA 2PJRA 4II3A 3CMMA 2L9VA 4XNFA 4KMFA 1GHCA 2W82A 2VOPA 1OCOH 5IT3A 2LKXA 2HPIA 4XRSA 2QUFA 3CCLI 1G3YA 2ZXHA 3PNYA 1WJ5A 3SDGA 2ZMEA 4G6DA 3MD2A 1J5YA 3R61A 1WJFA 5KK1A 3GTPJ 1Y8RB 1LE8B 2JJ7A 3OS1A 4IQ4A 2YX4A 1SAXA 2LF8A 3M4OJ 3BJOA 4DZJA 2M0CA 1VI0A 4S04A 2DN0A 3EQLF 1FMWA 1P6RA 5IOYA 2XGXA 2PMUA 3E97A 4NQWB 4PJJA 1BC8C 3BTLA 3VSKA 3HOSA 5FKLA 4EJTA 1SD4A 3E6DA 3GTOJ 4A3DJ 3CZ6A 1E3OC 3RPUD 2E1MB 4L9NA 2JPBA 3E0JB 4LIVA 3SHFA 1SAUA 2W25A 1T98A 3FMSA 3FF5A 4C3HJ 4Q4ZF 3KP7A 5HLGA 1RRJA 4PFOA 1BJAA 2M7AA 1FBSA 4XORA 3DBHB 4JBAA 2O5RA 3ZPLA 3GBGA 3LA2A 1TWFJ 1B1BA 4BBRJ 2DDBA 3G1LA 4IHWA 2BZTA 1X3UA 1ZLKA 3KETA 4XRFA 4ON0A 2QZ8A 1XC5A 2B63J 4BYYA 4DBRA 4CGZA 3DU5A 2RC4A 2UWMA 2KDOA 5B66C 1ZR4A 1IG7A 4ZYHA 1FZPB 2GM4A 3S16J 4UXNA 2CUFA 3LWFA 3Q3SA 4I7HA 3H36A 4LG0B 2ZCWA 3H5NA 3KYCB 5JLWA 1Y0NA 1Y56A 3LSTA 3KZYA 4YIFA 2J5OA 2DT5A 3S1NJ 4IRIA 5LGTA 3K10A 3OYEA 1Z3YA 4NDLA 4UHTA 3TO7A 4UUSB 1LE8A 3FXQA 1XGMA 3KZIC 4A93J 5F1JA 3J7AY 4RS8A 1J0RA 4C2UA 2ID6A 5D8LB 4OOIA 4AIHA 1I3QJ 2QYOA 5K5RA 3QPSA 1N77A 4H4KC 3RJPA 1FLIA 2Z9OA 1G2HA 3F3XA 2X4HA 4NQWA 1IRGA 1MW7A 2IGNA 3BR3A 5HS8A 4PDKA 4EJWA 4F93B 3COAC 1XSDA 3ZQCA 2LD5A 3E5XA 3HBLA 3H0DA 4XLHA 5C4JJ 4RLQA 3OYNA 1D0YA 2P8TA 1W5TA 2EWNA 3F8CA 4MFEA 3IH2A 1T2KA 2Y75A 3DEEA 3CCRI 2A6EF 5HNHA 1ZTRA 3BC8A 3KPHA 5LFAA 3H3UA 2E34A 2IS1A 2X48A 2FBKA 4ZYGA 3TW6A 1R71A 3WTYC 3W3CA 3CUOA 4WK8F 2QEXI 1PJRA 3BR6A 3EUKL 3LSPA 2E1CA 1W36C 1H0MA 3H35A 2L0KA 1QVUA 2VODA 3BZ6A 4LG0A 3A01B 2RREA 3WU1B 3NQOA 5IP6A 2H6CA 4A3FJ 4FTHA 1VQ7I 1BC7C 2YSRA 2GIVA 2I10A 4XN0A 2WWYA 4UUSA 5M5XJ 2ZNZA 5GAEJ 1PVEA 1XMKA 3WGGA 4U0WA 2ME6A 3B6AA 4YFXF 3AFHA 4CYDA 1KU7A 1X1PA 2EZHA 4EATA 3K1PA 3JSPA 1E17A 2Q0OA 3L2UA 4O6JA 2LF7A 1BIAA 4O3MA 2OC6A 2IXSA 3CDLA 4I2OA 1ZHFA 2FF4A 3K4CA 3H9JA 3ZXSA 3WG7H 1JKQC 2F4MB 2HNHA 4HX8A 1Y39A 2H8RA 1MJBA 1HW1A 4KMUX 4Q48A 4Q47A 3DKWA 3QAHA 3QYFA 1U3EM 3NARA 4JQFA 2Z99A 1R6RA 2DYSH 2M8GX 5DV5A 3W6KB 1ZRDA 4RM2A 1QGPA 1R22A 2DAOA 5HVQC 2AQFA 4IHSA 4B4CA 2K02A 3OSFA 4AYBN 4UVCA 3S2HJ 3DLAA 2ETHA 5F6FA 5LRSA 2E1MC 4JX5A 3GLXA 3CQZJ 1WJEA 3S2DJ 4BH9A 2P4WA 1EF4A 1ON2A 3BTJA 1OFCX 2HKXA 4DGWB 1T08B 4F91B 3A0BC 1HDPA 2L7FP 1NHAA 3MMYB 1STZA 2CFXA 3WG9A 3GO5A 3A01A 1MMAA 1VF9A 4BDZA 1AHDP 1TW2A 2ACJA 3JCUC 5EZHA 3WTSC 5D6EA 2PMHA 2HQ5A 3GXOA 3HSFA 1U8RA 1TWCJ 3HSEA 4B47A 4BEHB 4G7HF 1ON1A 1I6XA 2E35A 1JTXA 5F1RA 5M3FJ 3K1NA 3V7RA 1MMDA 3H0GJ 3K2AA 3TOAA 4UV9A 4Y4RA 1YW9A 3HB9A 1WCMJ 2CYYA 4DIQA 2W85A 4KNYA 2PFBA 4CCMA 1ORKA 3C2GA 1R9TJ 5LHGA 1VQ6I 3A03A 1WPKA 3CF5F 3BG3A 4QIWN 1GV5A 3DQVC 1BI0A 4EGYA 5CVIA 1QHHD 3G3ZA 4ZZLA 2GA2A 1T38A 3LNQA 3GTMJ 2DA4A 2MYSA 2XSDC 3GZ6A 2NYXA 5F0FA 4BJ5C 2KZVA 2V1UA 5BMZA 2X1EA 1R4NB 3CMYA 2ELKA 1X3WB 3SFIA 4X6AJ 4ANJA 3R4KA 3Q5FA 2KIQA 2L3DA 3TW7A 2LBFB 3PIPF 2LOOA 2MFZA 3C2HA 2M9HA 1KYWA 3IWFA 1BN5A 5C4XJ 3R6SA 1FIPA 1R58A 3BQYA 2ZJ2A 4AYBA 2F5DA 1K6YA 3JREA 4QLCU 4BXFA 4A69C 1QO0D 2FRHA 4BBSJ 4MEXF 5E8GA 3MAJA 4N9HA 1A31A 2VONA 3SDBA 4KT5C 4M6YA 4AC0A 5F08A 2FQ4A 1TQPA 2UUZA 3W2WA 3HOXJ 3E6CC 3GCMA 3ZMTA 4ESJA 2DLLA 4BEHA 5EYRA 1Z9CA 1F9NA 4XLFA 1PP7U 4HYEA 3FBIB 3L09A 4AM3A 1WWXA 4CDGA 5A2QZ 1ZGWA 2PG4A 2BYVE 2KZGA 2EINH 5FD5A 2KIFA 1IGNA 3ZMUA 2BHZA 1OYIA 2M45A 3HRTA 2NAZA 2IA1A 3MN2A 1RI7A 1TL8A 1I1GA 3L9FA 4BKXA 3JRAA 4MGRA 3IWZA 1N78A 2JA2A 1JE8A 3E5UA 3KE2A 3NAUA 5J1RA 1W0TA 1FWZA 1F4KA 4XONA 3CCMI 4Y7NJ 3WHCA 1I3AA 2MH9A 2W1OA 1KYZA 1V55H 4FISA 2DCEA 2XGCA 2K85A 4NC6A 2R7QA 4I0BA 3RYPA 4F55A 1DP3A 2MLGA 2IA2A 1R1UA 2LBFA 4W1UA 4HG2A 4DYCA 3TMOA 4A3JJ 2LFBA 2R5YB 5JLXA 2BXYA 2QA4I 1U9OA 3LAPA 1D0ZA 3L00A 4HAMA 4Y33A 1R7JA 3ZQQA 1A6IA 1VZ0A 2V7FA 1FIAA 5GAHJ 3D0SA 1YIOA 5EGOB 4M73A 2ELHA 1TWAJ 4HQMA 2DT6A 1JHHA 2VT3A 1XMAA 3OS2A 2VE9A 2LK2A 1JKRC 1XCVA 4ZDOA 2ZJPF 5TJJA 4D0PA 1MBFA 3P9KA 2V79A 2C6YA 2VXZA 3L1PA 3K7AJ 2X1CA 3HPHA 1MMSA 5LEJA 4CA0A 3ECHA 1X58A 3LQQA 5GP9A 2X6YA 2PN6A 1YHQI 2W4SA 1F1ZA 4RB0A 4CZZA 2OTJI 3F8BA 5J4VA 3DKXA 2CWEA 1S29A 2XPVA 2DQRA 3I4PA 1R5HA 3GWZA 5HDGA 1YITI 1TC3C 1S3JA 4M72A 1MMNA 2CRGA 1L3LA 5KNLA 2Q2EA 5E20A 2Q8KA 3ZN0A 4OWRB 3PSIA 5DS9A 3K4KA 2Y30A 4LLGF 1SMTA 3RKQA 4I09A 2VLAA 3SZTA 2RNGA 2IGMA 2Y48A 1O7FA 5FJ8J 4A3GJ 2QLZA 3PO3J 3ZMSA 5ILSA 1OLTA 3IL2A 1MIJA 5EG0B 2NVUB 4YEJA 1GVDA 1YYVA 3VWBA 1IZ1A 4HOBA 4RAZA 3IH3A 2R5YA 2PMZN 3FXLA 4LK1F 3AG4H 4L5JA 3DLLF 1A35A 1WJCA 3VFZA 2R4GA 1FBQA 2K9NA 4BS9A 1S9HA 4ZH4F 2VQHA 5EGOA 2OPTA 1MH4A 2IGKA 3A4CA 1M1EB 4HX4A 2DQLA 2IP2A 1SFXA 3P9CA 3RYRA 4PFPA 2DMNA 1K4TA 2DFFA 1VQLI 4EVIA 4UB8C 2RV8A 1RETA 4QPQA 4E7LA 2MGQA 1T6SA 4JOMA 1YOVB 1GUUA 1UZCA 1SFEA 3PUBA 3DXJF 2F4IA 2JUGA 3HM5A 1IXSB 5EF6A 4LJZF 4HA8A 2RVCA 1WZ2A 5LEKA 2X85A 1QPMA 1A04A 2CJJA 3GTGJ 1QQIA 2V9PA 1LJ9A 1USSA 3IKVA 2NVQJ 2KKOA 2OAZA 3SEQA 4YIIA 4BAYA 1U78A 1IXCA 1Z1DA 1D8JA 1MNEA 1X3ZB 2CQQA 4F92B 3KLOA 4P55A 4AUXA 1OCCH 1RNLA 2FX0A 3LA7A 1X1CA 2IGOA 4E7JA 4OMYA 5TRDA 2RQQA 5LGNA 4ZC3A 1CQTA 5EG0A 4OAYA 5KCMA 3TL4X 3VSLA 4GFBA 3LOCA 5E3OA 4XLEA 3KP5A 3I55I 4PSXA 1Z3XA 2G7HA 5D8KB 1EH8A 3HUGB 4IQJA 1P4AA 1UG2A 3AG3H 3L2WA 4L18B 2IS2A 1TZLA 3H92A 2PMZA 2XRNA 3J80Z 3S3NA 5IT9Z 4ASNA 5FKNA 2CGPA 5F27A 1OKRA 2WY8Q 3QPHA 5H6RA 4OMZA 1JJ8C 4TV7A 2WAFA 1HSJA 3E6MA 5EZGA 1V5FA 2ZXWH 2JZYA 2H27A 4Z6YA 4KICA 3KEQA 4A3EJ 4S05A 5LBQA 3K4LA 2L54A 3I71A 5CKTA 5B1AH 3Q0VA 1X1BA 4QWQA 4K2EA 3U1KA 5ILVA 1RIOH 3HPGA 3OYGA 2JRTA 3IRRA 1FOXA 2H09A 2IEKA 1XGOA 1DQUA 1AWCA 3K2ZA 4L9VA 1DGWY 1XMXA 2GAUA 4ZYEA 3HRMA 4AWXB 1Y6IA 2FE3A 4RAGA 1IN8A 4FE4A 5E3NA 2PQ8A 2Y0SN 4A3CJ 1POGA 3WU0A 2LY1A 3KLNA 2V6EA 3GMEA 3BPVA 4I0AA 4IHTA 1WJBA 3M8JA 2WY7Q 2HGCA 2VJJA 3OR1C 4ESBA 2BBYA 3KP4A 3GZ5A 2BEOA 3F9KA 3ULQB 4DNCA 1HC8A 3HUGA 3HDDA 3I5UA 1ZRFA 3N97A 1W36D 1BJZA 1YLFA 1YW8A 4KA4A 1PDNC 1D0XA 2P7CB 1H9TA 2KMUA 1O7LA 5LRRA 2X6XA 4B09A 2O61A 3QU6A 1H89C 3DV8A 4B48A 3VYSB 2E2HJ 3HEFA 3TP0A 4UY8I 5K7FA 2DFIA 3IRQA 1JXSA 2JMWA 3OYLA 3WTUC 3WTVC 3ABLH 3OYDA 1A36A 3S3OA 1S6LA 1J09A 3KFWX 2J5PA 1KZHA 2CV1A 3BLYA 3MCZA 1JGGA 3NWSA 1KGSA 1IO2A 1LUJB 2DPUA 1ETWA 2EA4A 3CCYA 1W4MA 1F5TA 4QPOA 3OYAA 5KVRA 3S14J 1R4MB 2VJ4A 2HR3A 3PUFA 2OV7A 2R5ZB 1T0FA 3TDZC 1T8IA 1IV6A 3KEOA 4ZTJA 5D4RA 3OYHA 4KFCA 2Y0SA 2V26A 4F7ZA 3O2PE 3OYMA 2F4OB 1OR7A 1OYWA 2DA5A 4A5MA 3I56I 3V8JA 3WTTC 1O4XA 1O3RA 2GXBA 3F21A 1ETYA 3B73A 4AU7A 4DW6A 4G7ZF 1LNWA 1MH3A 5J8FA 5L3DA 5HS9A 2GOMA 4FT8A 1ETXA 3PM1A 4AVPA 5L3CA 1O3TA 3BG6A 1JTYA 1I39A 4M3GA 4CYCB 3BT9A 2DDAA 3LA3A 3Q9VA 1ZN2A 4HDVA 2IT0A 3JAMZ 4IKFA 2ECCA 1OISA 2AXTC 2O8XA 5HS7A 4MQVA 2PEXA 4A3MJ 4BACA 1YTYA 1Z67A 3T8RA 1RC9A 3HOVJ 4MIMA 2Z1DA 1U9NA 4CZCA 3U2RA 2WTEA 1G3TA 5J40A 5IOZA 3VYTB 3F6VA 4ZDLA 1V5EA 2ZSIB 2E36A 1FOWA 3VOEA 2LG4A 2MLKA 4EJUA 3LAJA 2K7LA 3BP8A 2LTPA 2M4GA 3KYLA 1VFCA 1MKMA 5EJCA 2R5ZA 3JRHA 2BVMA 2R7RA 3CP8A 2ZXIA 2CQ7A 3F72A 4IPAA 1X2MA 2P6TA 2E2JJ 3QPTA 2R7SA 4B43A 3L2VA 1BI3A 2GZWA 3BR5A 3E1SA 2JQ7A 1DU6A 1VQNI 1X19A 5AONA 4D7MA 4A3LJ 3I54A 1F43A 2BY2A 5DD8A 3DKYA 2PI0A 3P7NA 3IKTA 3CCJI 4EQQA 2B9SA 2V9KA 3F8NA 2HOEA 2JA6J 2HTSA 3S1MJ 4CYCA 2GOXB 5K5OA 3LFKA 3GUDA 1BR2A 2HOSA 1OR7C 2CO5A 4RGSA 1MNMC 3ABUA 1B9NA 1Y0UA 2JPCA 2VE8A 2VN2A 2ZMEC 4PCQA 3SJMA 3C2BA 3QWLA 4HW0A 2DFEA 4A0ZA 3WU2C 4H0EA 1R5ID 4B3XA 3WTXC 3P9IA 2GLOA 4HF1A 4PJNA 2H94A 2XAHA 2HS5A 3V8LA 1SVOA 4E7SA 3LSMA 1J2XA 3U21A 4BQAA 2LREA 3MQ0A 3RKXA 1SD5A 3FK6A 2VPRA 1Y8QB 5ICFA 2A68F 2CW7A 5GAGJ 1RR8C 1ZG3A 1TBXA 1XDUA 4KN7X 3SXYA 2P7VB 4XMYA 2CMPA 4CCNA 5ED4A 2WV1A 1G3SA 3AG1H 1OCRH 1LKXA 1ERDA 1DGRM 3V8KA 3NWTA 3ZMVA 3GTQJ 2NRAC 2QSHX 1FT9A 3PL8A 1SMYF 1Q1HA 2DMQA 3BTCA 2JSCA 4FX0A 1FEXA 2DOFA 4NC7A 3GW2A 1QZEA 3KCCA 3REOA 1NG6A 3HHGA 2HI3A 2XF5A 3BOQA 4CH7A 4CUGA 5HLHA 4HZFA 1TLHB 3FIWA 1UELB 1IDYA 3CD6I 2XGDA 2XV4S 3U9GA 1RESA 5ICGA 2EZIA 3C3WA 5J3LA 4XN3A 3IUOA 3DTKA 2VXDA 3RZOJ 5JHFA 2EFWA 1LB2A 3IC7A 3S15J 5J47A 2ZBKA 2QWWA 2YUSA 3BJ6A 1WQ2A 4IVNA 2QQ8A 2W48A 4M71A 2K3FA 2CSOA 1BOBA 2EIKH 1CGPA 3OV8A 1RKTA 2EIMH 4QSHA 3RPUA 1R1VA 3FXRA 1IAWA 1ETOA 4YIRX 4M3DA 5FLXZ 2X6OA 2XHKA 3QQAA 4I76A 2JVHA 4GCVA 1ZH5A 3GLLA 2L7ZA 1UHMA 1YJNI 2V9VA 3DEUA 1IRFA 4D5CA 2WB1N 1KU9A 2EA2A 4G9YA 4C3IJ 4AIJA 1QZYA 2M1BA 1N75A 1TQIA 2IS4A 4BGDA 1TT0A 3N4MA 1IXRC 2KFDA 2FBIA 1RZ4A 2DODA 5LLQA 2FA5A 5J6XA 3P5JA 2RNJA 1FP2A 2KIUA 3KZZA 4LOCA 4Y15A 2VC1A 3V4GA 5A2QK 5GTIC 2GQQA 4BY1J 3BG5A 2I8DA 2XPUA 5ERIA 5C3EJ 3OYFA 4HV5A 1X1DA 1VTNC 2CUZA 1HQCA 2LR8A 3S2WA 1ONVA 1EH6A 1ZARA 2JVGA 3I9V2 2K4BA 4CO8A 3CESA 1W7PD 1B8IB 5E1ZB 2DFHA 1BW5A 4U88A 3JRDA 3VB2A 5DCMB 1TNTA 2VBYA 5DEQA 2D5VA 3CP2A 5K7ZA 3RQIA 2OBPA 3I3LA 4C9YA 1MBJA 4EJVA 1YRNB 2QSGX 4WXDA 5EDNA 3OSGA 3CCVI 4CHUA 3EYYA 5CQGA 3IAM2 2IJLA 3KIOA 1EA3A 2ZFWA 5E18F 2QF7A 4D1QA 5H2FC 3MKWB 3WODF 1HF0A 2Z3YA 3G2BA 3BCBA 1QU3A 2FMYA 4RBOA 1BW6A 1YX3A 2ESHA 1TW3A 2NNNA 5HNFA 2BHYA 4D9JA 1P9QC 2EFOA 3OIQA 4NB5A 4BQQA 4E7ZA 5LHHA 4RB1A 1Z6TA 3HRSA 1SEUA 1HW5A 3BR1A 3I53A 2WB1A 3BY6A 5GADJ 5JHUA 2XIGA 4HDUA 4IXAA 3S93A 5DM7F 3IP4B 1N25A 2DTZA 2H1KA 1P7IA 1RUOA 1HOMA 2DXIA 2R7VA 4KJZA 5L3BA 1SD7A 2UZKA 1K61A 2L9NA 1TP4A 4I98B 3SQNA 5JVTA 2VKVA 3EUHA 4ESFA 2L2OA 1X4PA 2V4JC 3WHBA 1GLNA 3IV5A 2K9QA 4DYQA 4G94A 2QGUA 4LLLA 1B8IA 4EGZA 3DPLC 5EEAA 3SFZA 4L5IA 3S3MA 4A3BJ 4UV8A 5DCMA 2ZJQF 1ZYRF 4GDFA 3BWGA 1WFXA 2QKLB 1GXPA 3HXLA 3TOBA 5L3FA 3WE2A 4C2MJ 2CW0F 1NTCA 1YRNA 5E1XA 1AA7A 1L0OC 1P4WA 2KJCA 4RLFA 2EZKA 2HOAA 2HDCA 5CVRA 3G71I 2E5ZA 2QQAA 3K6GA 3JTHA 1JUMA 1I27A 1OCPA 4C30A 3TKYA 3L2RA 3J7AO 2R92J 2XPWA 2Q2EB 4ZZDA 3GFMA 3MWMA 4N0BA 1ZR2A 4S0HB 3K1MA 2RDPA 4B44A 2K40A 2RAEA 3O3KA 1QPIA 4HNVA 1DPUA 2I5UA 3F22A 2FNAA 1MDMB 3K70C 1XN7A 1ZQ3P 3AG2H 2HEOA 3RKWA 2JWTA 5IYDJ 2ESNA 4YRVA 4N9IA 5LD2C 4A5NA 2IRFG 1JJ6C 1GDTA 3Q0UA 3O8HA 1C0WA 3RIRA 1G8XA 1R49A 2YR2A 1O3QA 5EEGA 3C7JA 2RN7A 2OCEA 3H3ZA 4MTDA 2CUEA 2CW8A 1LDKB 2FQ3A 2BV6A 2BW3B 2A05A 4EJOA 1SANA 4OAZA 1VQ5I 2ZSHB 2PX9A 2EFQA 1B9MA 3W2VA 2HWVA 2L9RA 2DTRA 1APLC 4F3QA 1MBGA 3IHUA 2KHMA 2DJIA 1ITYA 2MH2A 3VDXA 3LL7A 3EUHC 3TP3A 2L4AA 4GRIA 5J1UA 2LVSA 1S7OA 3FHZA 4CCJA 4M3BA 2VBWA 1NK3P 4C3JJ 4ZYDA 5HOOA 3FM5A 1JKPC 2Y0MA 2IPQX 2PJPA 2JN6A 4IRGA 2KRFA 4X0GA 4I02A 1OMIA 3PNTA 2A3SA 3IAS2 2HZTA 3ASOH 1FTZA 1G6NA 4NBQA 2R7WA 3J80K 1GV2A 3LMMA 5IT9K 3EETA 5L3EA 3ZQIA 3D5SC 1IDZA 1SD6A 2BY3A 3QP6A 3AAFA 3A0HC 3ASNH 3V42A 4WWCA 1YJWI 2LLKA 2TDXA 1YI2I 1WKMA 4HNUA 4OINF 5D5WB 1J75A 4XKCA 5IP9J 1LQ1A 2Z2SB 3RPQA 4CCOA 4GO1A 4D5FA 3HOTA 2F5FA 2WC2A 4AIKA 3LSIA 3SZPA 2OF7A 3GYHX 1FOYA 2NVTJ 1IN5A 1G4DA 5J8CA 4CCLA 3OIPA 3OL4A 2CU7A 2XUBA 4XR6A 1FX7A 2BW3A 3R0AA 2FSWA 1ZELA 2KQRA 2D1VA 1ZLJA 3KP3A 5E1WA 2XAFA 1B72B 4Y52J 1KQ0A 4FCYA 1S5LC 4M74A 4U7DA 2DMPA 2M3AA 3TDUC 3NRVA 1XTAA 1QZZA 1FYKA 1MMGA 1O57A 3JSOA 2OA4A 2P5VA 1FC3A 2R7DA 1WJAA 2DOAA 3FHNA 3FXKA 5HLTA 1IN4A 2COBA 4EM2A 1JUSA 3EDPA 1S72I 1T56A 2AO9A 1XPXA 2UXNA 5E17F 2GXGA 3LSRA 2O6GE 2NOGA 3BROA 2HU9A 4FQGA 4ETSA 2QKMB 1YO5C 1AKHB 2LH9A 4A3IJ 4OIRF 2VKEA 1FJLA 1MNDA 1J7KA 1V4RA 3QOPA 3TQNA 4YFNF 2VUMJ 4N4OB 3F6OA 2DJNA 5IYCJ 3AL0B 3ERED 3E7LA 4ZJZA 5EEHA 1D3YA 1VQMI 2R7FA 3CJTB 4IHXA 1ETVA 3SZGA 3MKZA 4PZJA 1BR1A 4G12A 3JRIA 2VL8A 3EPZA 2UV1A 4A3KJ 5D5UB 4YFKF 3VYUB 2VB6A 3M1EA 1FNNA 3OYIA 4W97A 2IVMA 1S7EA 4BJTA 1MGTA 2CQXA 3T0YA 1V3FA 2JK3A 3KX2A 1T33A 2QM3A 3TEDA 4V19K 1WJDA 4G8XA 1ZREA 4XKBA 3VPRA 4FX4A 1GT0C 3I4NJ 3ABKH 2H1LA 2Y69H 2EV5A 1Z05A 1BBYA 1XDSA 2JTVA 4XSZF 1VQPI 1S8NA 5CLSA 1B72A 4XM3A 5ICEA 2VIXA 4U0VA 4PGHA 2QQBA 4HBLA 2DK5A 4N4NB 4BUPA 1I1SA 3ERMA 4I01A 3BR2A 1JKOC 3X2QH 1EH7A 3HOUJ 2H6BA 1MBHA 1UB9A 4XRSG 4BU2A 4XLNF 3E3VA 2BGCA 2FUG2 1D8KA 4KIGA 4XBFA 4A6DA 3CJRB 3HYIA 4MFDA 2Y31A 3CCUI 2B0LA 1R36A 4L0YB 2NVXJ 1AKHA 1MD0A 1HBXG 4X1EA 1ULYA 3JAMK 1FOKA 3K4MA 5D5VB 1IUFA 4OU0A 4JK1X 1BI1A 2XF7A 2O0YA 2AXLA 1IN6A 2ECBA 5IYBJ 2F48A 3OYCA 1WSUA 3FKJA 3CJQB 5CJ9A 5ICCA 3HL2A 2DPDA 1IC8A 2DW4A 4CICA 4M3FA 5E79C 5FLMJ 4LGWA 4CCKA 4D7NA 2OZUA 5CVJA 2KRHA 2ZC2A 1UHSA 3DTEA 2EIJH 1X4OA 3FX3A 2MABA 2LSOA 5DM6F 2WBMA 2QBYB 2W00A 4Q5SF 3PQJA 1UJ8A 1ENHA 2EZLA 1I6HJ 1Z6RA 4UVBA 3WGHA 4HF0A 3DPTA 4PJ0C 4BQNA 1OYYA 5E3MA 1Z7UA 3OR2C 1D5YA 1TWHJ 1EKEA 3KEYA 2EFNA 3HKZN 9ANTA 2XDVA 4E70A 5KHDA 1JHFA 2XKOA 4G6TB 2CV0A 3ABMH 1X1AA 2LNBA 2LMDA 2M5WA 3BZKA 3F0CA 3T5XA 4A2UA 3JTGA 3WGIA 3HOWJ 5LGUA 4M9ZA 3CO7C 1UHWA 3ZGKA 4GGGA 1JT6A 4JP0A 5E8IA 3L2QA 3EYIA 5JVGF 2VBZA 4M6XA 4HSTA 2HXIA 3BR0A 1PP8F 1PUFA 1LDDA 2EILH 2ADUA 5DUKA 3PJRA 4MTEA 1BIBA 1PYVA 5HDNA 6PAXA 2FJ1A 2WADA 1R5GA 2NNYA 2HPMA 2LKSA 3QYEA 2IW5A 4IEJA 2HZDA 1DPRA 3LSGA 4XKWA 3I59A 3HOZJ 4GYGA 2ELJA 3WTZA 2X6WA 2Z5UA 3FISA 4LB6B 2E7WA 1KQ8A 3H5AA 2E2IJ 4II2A 4R79A 3CC7I 1ZAOA 1Z77A 4HX7A 4EV0A 2O8KA 2CV2A 4ENMA 4LFUA 2CUJA 2XVCA 3FXJA 4IRHA 5DD4A 3H9GA 2Z33A 4LK0F 4IOCF 3F8FA 1IJWC 5FRMA 3AL0C 3FK7A 3Q9SA 4A6EA 4RA2A 5DUIA 2O03A 2O7OA 3RTRA 2W84A 4WCGA 4RMNA 1OJLA 2NOJB 3J7ZI 2UXXA 4MHGA 1XG1A 2BVLA 1UG0A 2R7OA 2ZB9A 5DCFA 2QBYA 3DU6A 4AD9A 4J01A 3UKGA 1LVKA 3ML6A 2VPLA 2HQAA 2NS8A 3HTUA 3S1QJ 2VC0A 2CG4A 3VEPA 1FMVA 5L3GA 3O6BB 3L7WA 4MQ9F 1QHGA 5F04A 1QA6A 2AHQA 1XGSA 3KP6A 1JUPA 4FETA 2ZXJA 3Q0WA 3K69A 1BM9A 2B7EA 2EJRA 2GWRA 1R00A 2IAIA 1K6OA 1Z91A 3HKZA 3UNGC 3LSJA 2QVOA 3G1OA 4HEA2 4F52A 2XAUA 2JSPA 5FD6A 2Q1ZB 1HKSA 2TRTA 2E19A 3QOEA 4J00A 4IOAF 2WA0A 3QU3A 3JRCA 3FKIJ 1RPWA 2HVRA 1JGSA 1QBJA 3GTLJ 2BE5F 1TWGJ 3MZYA 3D1NI 4UUVA 4L9JA 1VQ4I 4BHCA 2DU9A 2M8EA 4LITA 1D1CA 2L9SA 4L9TA 1K4SA 5M3MJ 2A6HF 2E60A 4P9FA 1TQMA 4KUMA 2KIMA 2HQNA 2VBXA 2ZFUA 3JRFA 3I4MJ 3M8FA 3MVPA 1T0FC 5FLXK 4M9XA 3TO6A 2DT7B 2EV0A 1QVTA 3HOYJ 2DMUA 2VASA 1KQ9A 1USTA 4XLAA 3OS0A 2P5KA 1D5VA 2DOEA 4IF4A 2EV6A 1QNTA 1XSXA 1DUXC 4KIBA 2WAQN 5B3SH 4PSWA 1MSFC 1FP1D 3FXUA 3R60A 3LSKA 4IX7A 2R7ZJ 2K5CA 2DA7A 3DBRB 3K4JA 3A2KA 1HSTA 4HQEA 2K9SA 4JX6A 1OQYA 4M3EA 4BXXJ 2A5WA 3E6BA 1BA5A 1R23A 3F8MA 4LG3A 3OYJA 2VT2A 3JR9A 1XD7A 1WRJA 1Y1WJ 1YE9A 2V1NA 1TTYA 2XRLA 3R0JA 1BR4A 1K83J 1T39A 3ZRGA 1ZRCA 4ENJA 1WI3A 4RM3A 5GTHC 2Y9YA 1U5TB 2HYJA 2R93J 4XIDA 2LY2A 2VKDA 4E7IA 3K70D 3TGNA 4WX9A 3ECOA 2QCOA 2ZNYA 3OY9A 1SVMA 3V7SA 4O5VA 3LSHA 2VKHA 1MBEA 5LHIA 2XF6A 4XQFA 5F0CA 2VJ5A 4PGGA 4LMYA 2HFHA 1BOAA 1YIJI 4HLXA 4HPQA 2BY1A 5HLIA 3CMEI 1P92A 1DU0A 3B02A 4PK4A 3GEZA 1RR7A 1VNDA 2XC7A 2IA0A 5BPIA 1H8AC 3CF2A 3BQZA 3S17J 1TT5B 2LDUA 2OQGA 4G6QA 3ZQ7A 3OWTA 3ABTA 4PJLA 3OIOA 3V7CA 1FYMA 4BL0B 5D6FA 4HF2A 3HHHA 2WAQA 1EV7A 3N05A 2KT0A 2F6CA 5DYMA 2QENA 3MKYB 2ZKZA 4WF2A 3U1DA 2WV0A 3ZQFA 2MSYA 3I64A 4A0XA 3OYKA 4BQOA 2M34A 4DQ2A 2NXNB 2X9DA 2MC4A 2P0WA 5J4YA 4A12A 1W0UA 1FBUA 2OU2A 3CC2I 2CFOA 4PUSA 1LEBA 4LLNA 4P9UA 2VQLA 2XB0X 3ZQHA 1VQOI 2ISYA 2M4KA 3D5RC 1K79A 2E7XA 1V54H 4DBQA 2JT1A 4NNJA 4KITB 1A6QA 4RB2C 1A5JA 1U5TA 2L01A 2K9LA 2QSFX 5K7HA 2GBYA 1V5GA 2K86A 4XLPF 4WXCA 5FB2A 3BJAA 3ZMZA 2WAEA 1S7AA 1VQ9I 4IZZA 2G0EA 1KU3A 4HRIA 3BZCA 4KDPA 3GFLA 5BS6A 1OCZH 1YS7A 2E5NA 3CO6C 1XX5A 3RQ4A 2N8GA 1E2XA 1JT0A 3CLOA 3CJNA 4CSWA 1TNSA 2MC3A 3M9AA 2Z16A 4ENKA 4L0ZB 1LPQA 4M9SA 4XLCA 1Z7LA 4U0YA 1IUYA 3PSFA 3OL3A 1K7AA 4P5OA 3K9TA 3ELKA 2R7UA 1WGXA 2D2WA 5JFRA 3K4BA 2L02A 4RAYA 5AIQA 2JRMA 2F5CA 4LD5A 2FBHA 3SEZA 3H3VK 4NUBA 3MZ8A 2NS7A 5F0HA 1AOYA 2X0LA 1P7JA 2KPMA 5FRNA 2DBBA 1U8BA 1WHUA 4BXUA 1ZG5A 2GIZA 2E1OA 2ZO4A 1LDJA 2X1DA 3ZOBA 2HKOA 1WI9A 3W6JB 1UMQA 2MA3A 5CPRB 3J7YJ 3GTKJ 1REPC 1FSHA 2XGEA 1IN7A 3L2CA 1I5ZA 1J9IA 4HLYA 4HSRA 4I99C 1HA8A 5FFXA 5B1BH 5GPCA 2LP0A 2EK5A 1ETQA 3NEUA 4E7HA 4NC8A 1RUNA 2DO7A 1LEAA 3DFGA 3JW4A 2DI3A 3TO9A 2EB7A 3H5RA 4MLOA 2EFPA 4DJAA 1W7PB 1LFUP 2NVYJ 2XAGA 2QQ9A 2DMTA 2O3FA 3AKZA 4E4HA 2CS3A 4IL6C 3W2AA 3SYTA 3MFKA 1IF1A 4KYWA 3RI4A 2CQKA 3DEWA 4MNUA 2X51A 4B1RA 1U5TC 2ZJRF 1G3WA 2M7BA 2HYGD 5B5EC 2LY9A 3HGYA 2IS6A 1UFMA 2P5LC 5H20A 1YJ9I 1IV8A 5AIPA 3HC7A 1AU7A 2MG4A 4U7BA 3WE3A 1NG7A 2DA6A 3J81K 2A69F 1NH3A 2JA8J 2L5QA 4KISA 1MBKA 2XROA 1W1WE 3QP5A 4IJAA 3F23A 3CDIA 2P81A 4UUTA 3G1MA 4Z2YA 1SC7A 4XL9A 1P2FA 4Y3OA 1HDDC 4EMSA 2AQEA 2M2EA 4BE1A 3FBNB 5FKOA 3B6CA 2DA3A 3MEXA 3D5LA 2OQRA 2R7XA 3H1CA 3QODA 3WTWC 3CC4I 2TCTA 1R1TA 2ICWG 5E3LA 3PO2J 1KA8A 2V1XA 3CUQB 2ISZA 1DP7P 3PIOF 1ZGAA 5K5QA 4Y17A 4UB6C 5DTDA 4RAFA 2FMLA 4RGXA 2OUMA 2P6SA 4U87A 1ETKA 3QRFF 5JR3A 2GA1A 1W7PA 4BDYA 1H88C 1JI8A 4LB5A 5F64A 1FTTA 2R0QC 3FWEA 3HIFA 2COMA 4XK4A 1FSEA 3ZP5A 1XS9A 2D1HA 1YG2A 4DYRA 2JUCA 4XOTA 4R1HA 3BG7A 2AS5F 4BY7J 3ONQA 3QYBA 2W24A 4ITVA 3KP2A 2XASA 5FKMA 4BNCA 3CDHA 2F5EA 3LQRA 4WXHA 2FNPA 3M07A 2XSJC 4EM1A 2EPFA 3S8PA 2YS9A 4PJMA 4IO9F 2L7KA 4V2FA 4BE0A 3BDDA 3ZCOA 3MKLA 3JRBA 4NHJA 1ZG1A 3RSNA 5M5YJ 1XB4A 3T8TA 3ZR8X 3CCQI 4M6VA 2BOLA 4JX4A 1HKTA 1T95A 3GTJJ 2RGVA 1E0EA 3HG9A 3G73A 3BCAA 1OCTC 2MW8A 3BPXA 2R7TA 3VYRB 2HVSA 1XSVA 3CUQA 4XRMA 3J81Z 1PUEE 5CQEA 3QPLA 3H9QA 2A61A 2FXAA 2RQPA 2YX7A 1KU2A 3HSRA 5KAIC 3M7GA 3ESWB 3RCOA 1CF7B 2MBFA 4RB3C 2HYFA 1YQAA 1IRZA 1OPCA 5FGMA 3DTIA 3A1YA 2HXOA 1GXQA 4MO7A 4P1WA 5HODA 1E3HA 2YU3A 4QTRA 3C18A 4E6KG 4BE2A 4ABZA 4BHBA 3OOUA 5K1YA 3GVAA 3OOPA 5BQTA 2OJED 4J19A 2HQRA 3ROUA 4ZDPA 2IBDA 4E7KA 3S32A 5HDKA 1X2NA 4Y13A 2K9MA 2XKPA 3I0TA 5J1YA 5BPDA 2FOKA 1ZK8A 4EEFG
chains in the Genus database with same CATH topology
2ID3A 3JREA 1JT6A 4JP0A 3GTQJ 4IHYA 4A69C 4BBSJ 2DMQA 3BTCA 3IH4A 3BTIA 1WH5A 1FEXA 2HXIA 3BR0A 4AC0A 5F08A 1PUFA 2HI3A 2FQ4A 2FJ1A 3FIWA 3HOXJ 2EH3A 3DCFA 1IDYA 2XGDA 5EYRA 1RESA 4IEJA 2EZIA 5J3LA 3LSGA 2DA2A 1ZGWA 3HOZJ 3M3YJ 3RZOJ 3FISA 4FE7A 2HOTA 1IGNA 2Y2ZA 2E2IJ 1F36A 3S15J 2YUSA 1Z77A 1I50J 3MN2A 2O8KA 5FLVA 1IJWC 2W48A 4BKXA 3FK7A 3JRAA 2O7OA 5IPAA 1OJLA 3W6VA 2DA1A 1RKTA 4QSHA 3NAUA 1XG1A 5J1RA 1W0TA 1ETOA 2ZB9A 4M3DA 4Y7NJ 1Q1VA 3WHCA 4I6ZA 2X6OA 1MSEC 3QQAA 4I76A 3UKGA 4FISA 2XGCA 2ME0A 2NS8A 3S1QJ 2L7ZA 5IP7J 2KDZA 4D5CA 5F04A 2WB1N 2AHQA 1JUPA 4C3IJ 4W1UA 3Q0WA 4DYCA 2IAIA 4A3JJ 2LFBA 3JRGA 2R5YB 5JLXA 2EBIA 1U9OA 3LSJA 1Y1VJ 3G1OA 1A6IA 2TRTA 1FIAA 2E19A 4LOCA 1LFBA 4BY1J 3JRCA 5EGOB 3FKIJ 1RPWA 1TWAJ 3BG5A 2XPUA 5C3EJ 3GTLJ 1TWGJ 2LK2A 3D1NI 1JKRC 1MBFA 5M5WJ 3L1PA 2LR8A 1PUFB 3K7AJ 5M3MJ 1QRYA 5GPAA 1B8IB 1BW5A 3JRDA 3JRFA 2JA5J 4IHVA 2XB5A 1X58A 3I4MJ 5GP9A 4B3AA 3MVPA 1ZKGA 2O9LA 2D5VA 5K7ZA 3RQIA 1QVTA 1HCRA 1MBJA 2XPVA 3RZDJ 1YRNB 2DMUA 1TC3C 3HOYJ 4XICA 5EDNA 2CRGA 3A02A 5FKKA 3OSGA 5BNGA 2FD5A 2WAQN 5DS9A 1MSFC 2EQRA 2Y30A 3RKQA 2Y9ZA 2QF7A 3ZQGA 2R7ZJ 5FJ8J 4A3GJ 1NK2P 1HF0A 4RDUA 3PO3J 2DA7A 4RBOA 1BW6A 2L7MP 5EG0B 2K9SA 4JX6A 1GVDA 4M3EA 4BXXJ 1Z0XA 1BA5A 3BR1A 3IH3A 4L5EA 2R5YA 1HLVA 2PMZN 3JR9A 2YU9J 2DTZA 1BL0A 1Y1WJ 2H1KA 1P7IA 1HOMA 4DZPA 2K9NA 2XRLA 1K83J 4JYKA 5EGOA 1K61A 2OPTA 1WI3A 3O8GA 1MH4A 2R93J 2Y9YA 2HYJA 4XIDA 2VKVA 2VI6A 3WHBA 3IV5A 2K9QA 5C44J 2DMNA 2QCOA 4DYQA 1B8IA 1RETA 3BG9A 5EEAA 2JA7J 1MBEA 2MGQA 4A3BJ 1RKWA 1GUUA 5F0CA 3S1RJ 3ZQLA 1ZK8A 3HGGA 3HM5A 1SFOJ 5EF6A 1DU0A 1WH7A 1H8AC 1RR7A 1VNDA 4C2MJ 2CJJA 3BQZA 1NTCA 1YRNA 4V2GA 3S17J 3GTGJ 2NVQJ 2EZKA 2HOAA 1U78A 3OIOA 1JUMA 2CQQA 1OCPA 4AUXA 2LKXA 2R92J 2XPWA 2FX0A 4XRSA 2KT0A 1ZR2A 3SDGA 3ZQFA 4S0HB 2MSYA 5EG0A 1CQTA 4GFBA 3LOCA 2M34A 1W0UA 2X9DA 5E3OA 2K40A 2RAEA 1QPIA 4HNVA 3GTPJ 1LE8B 2JJ7A 1ZQ3P 1UG2A 2JWTA 5IYDJ 1JJ6C 1GDTA 3Q0UA 3O8HA 2XB0X 3ZQHA 3M4OJ 5FKNA 5F27A 4DZJA 2M0CA 1VI0A 2DN0A 5IOYA 1A5JA 2CUEA 3BTLA 1JJ8C 5K7HA 2GBYA 5FKLA 3GTOJ 4A3DJ 1E3OC 5EZGA 1SANA 4C3HJ 4A3EJ 2G0EA 2L9RA 1APLC 1MBGA 3Q0VA 2N8GA 1ITYA 3GBGA 1TWFJ 4BBRJ 1JT0A 3G1LA 3TP3A 4IHWA 5J1UA 2LVSA 2IEKA 4M3BA 1NK3P 1XC5A 4C3JJ 2B63J 1JKPC 1WGXA 1ZR4A 2JN6A 1IG7A 2GM4A 3S16J 4FE4A 2CUFA 5E3NA 3Q3SA 2Y0SN 4A3CJ 1POGA 3H3VK 1FTZA 5JLWA 2NS7A 5F0HA 1GV2A 1P7JA 3S1NJ 1U8BA 2E1OA 3ZQIA 3ZOBA 4NDLA 4UUSB 1LE8A 1UMQA 1IDZA 4A93J 5F1JA 2LLKA 3GTKJ 3HDDA 2ID6A 1BJZA 2XGEA 1I3QJ 5IP9J 3QPSA 4D5FA 5GPCA 2LP0A 1H89C 2E2HJ 1ETQA 2OF7A 3HEFA 3TP0A 1G2HA 5K7FA 2NVTJ 2JMWA 3BR3A 4MLOA 2CU7A 1LFUP 2NVYJ 3ZQCA 2LD5A 2DMTA 3HBLA 5C4JJ 4MFEA 1B72B 4Y52J 3IH2A 4FCYA 2DMPA 3DEWA 4B1RA 1ZTRA 1JGGA 2LY9A 1ETWA 2X48A 3HGYA 3CCYA 3TW6A 2COBA 1AU7A 3S14J 1JUSA 2MG4A 3LSPA 3BR6A 1T56A 2AO9A 2R5ZB 2DA6A 1IV6A 2L0KA 3LSRA 2NOGA 1QVUA 2JA8J 3A01B 1AKHB 1MBKA 4A3IJ 2VKEA 5IP6A 1FJLA 2P81A 4A3FJ 2VUMJ 4UUTA 4FTHA 2DA5A 1O4XA 3G1MA 1ETYA 2I10A 2DJNA 4DW6A 5IYCJ 1HDDC 1MH3A 3E7LA 2M2EA 4UUSA 5FKOA 5M5XJ 3B6CA 2DA3A 1ETXA 3PM1A 2ME6A 3B6AA 4IHXA 1ETVA 2TCTA 3PO2J 5E3LA 1JTYA 4G12A 4M3GA 4CYCB 3JRIA 4A3KJ 3BT9A 2EZHA 4W97A 1S7EA 2CQXA 2ECCA 5DTDA 3CDLA 2JK3A 1T33A 3TEDA 4A3MJ 1ETKA 3VPRA 1GT0C 3I4NJ 1JKQC 2H8RA 1H88C 3HOVJ 4MIMA 1FTTA 1U9NA 2R0QC 4XK4A 1B72A 3NARA 1XS9A 5IOZA 2M8GX 4DYRA 4BY7J 4B4CA 3BR2A 3OSFA 4AYBN 1JKOC 3S2HJ 5FKMA 3HOUJ 1MBHA 4JX5A 3CQZJ 3S2DJ 2LTPA 1EF4A 3BTJA 1OFCX 2YS9A 4XRSG 1VFCA 4V2FA 2R5ZA 3JRHA 4MFDA 2Y31A 1HDPA 2L7FP 3MKLA 3JRBA 2NVXJ 5M5YJ 3A01A 1AKHA 2E2JJ 1X2MA 1VF9A 1AHDP 3BR5A 5EZHA 4M6VA 4X1EA 1DU6A 4D7MA 2HQ5A 4A3LJ 4JX4A 1F43A 1TWCJ 3GTJJ 1IUFA 1JTXA 5M3FJ 1OCTC 2MW8A 2ECBA 3H0GJ 3K2AA 5IYBJ 2JA6J 3S1MJ 4XRMA 3HB9A 4CYCA 1WCMJ 1ORKA 3QPLA 2HOSA 1R9TJ 1MNMC 1IC8A 3A03A 4M3FA 1WPKA 5FLMJ 1IRZA 3BG3A 3SJMA 4QIWN 1GV5A 3C2BA 4D7NA 1UHSA 2HXOA 4MO7A 3LNQA 3GTMJ 5HODA 2DA4A 4QTRA 2GLOA 2XSDC 1ENHA 2EZLA 1I6HJ 5F0FA 4ABZA 3FK6A 2VPRA 3OOUA 3CMYA 5E3MA 2ELKA 3SFIA 4X6AJ 4J19A 1D5YA 1TWHJ 2IBDA 3HKZN 9ANTA 3TW7A 1X2NA 3F0CA 5J1YA 2M9HA 2WV1A 3HOWJ 5C4XJ 1FIPA 2HDDA 3BQYA 4EEFG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ID3 A;  3JRE A;  1JT6 A;  4JP0 A;  3GTQ J;  4IHY A;  4A69 C;  4BBS J;  2DMQ A;  3BTC A;  3IH4 A;  3BTI A;  1WH5 A;  1FEX A;  2HXI A;  3BR0 A;  4AC0 A;  5F08 A;  1PUF A;  2HI3 A;  2FQ4 A;  2FJ1 A;  3FIW A;  3HOX J;  2EH3 A;  3DCF A;  1IDY A;  2XGD A;  5EYR A;  1RES A;  4IEJ A;  2EZI A;  5J3L A;  3LSG A;  2DA2 A;  1ZGW A;  3HOZ J;  3M3Y J;  3RZO J;  3FIS A;  4FE7 A;  2HOT A;  1IGN A;  2Y2Z A;  2E2I J;  1F36 A;  3S15 J;  2YUS A;  1Z77 A;  1I50 J;  3MN2 A;  2O8K A;  5FLV A;  1IJW C;  2W48 A;  4BKX A;  3FK7 A;  3JRA A;  2O7O A;  5IPA A;  1OJL A;  3W6V A;  2DA1 A;  1RKT A;  4QSH A;  3NAU A;  1XG1 A;  5J1R A;  1W0T A;  1ETO A;  2ZB9 A;  4M3D A;  4Y7N J;  1Q1V A;  3WHC A;  4I6Z A;  2X6O A;  1MSE C;  3QQA A;  4I76 A;  3UKG A;  4FIS A;  2XGC A;  2ME0 A;  2NS8 A;  3S1Q J;  2L7Z A;  5IP7 J;  2KDZ A;  4D5C A;  5F04 A;  2WB1 N;  2AHQ A;  1JUP A;  4C3I J;  4W1U A;  3Q0W A;  4DYC A;  2IAI A;  4A3J J;  2LFB A;  3JRG A;  2R5Y B;  5JLX A;  2EBI A;  1U9O A;  3LSJ A;  1Y1V J;  3G1O A;  1A6I A;  2TRT A;  1FIA A;  2E19 A;  4LOC A;  1LFB A;  4BY1 J;  3JRC A;  5EGO B;  3FKI J;  1RPW A;  1TWA J;  3BG5 A;  2XPU A;  5C3E J;  3GTL J;  1TWG J;  2LK2 A;  3D1N I;  1JKR C;  1MBF A;  5M5W J;  3L1P A;  2LR8 A;  1PUF B;  3K7A J;  5M3M J;  1QRY A;  5GPA A;  1B8I B;  1BW5 A;  3JRD A;  3JRF A;  2JA5 J;  4IHV A;  2XB5 A;  1X58 A;  3I4M J;  5GP9 A;  4B3A A;  3MVP A;  1ZKG A;  2O9L A;  2D5V A;  5K7Z A;  3RQI A;  1QVT A;  1HCR A;  1MBJ A;  2XPV A;  3RZD J;  1YRN B;  2DMU A;  1TC3 C;  3HOY J;  4XIC A;  5EDN A;  2CRG A;  3A02 A;  5FKK A;  3OSG A;  5BNG A;  2FD5 A;  2WAQ N;  5DS9 A;  1MSF C;  2EQR A;  2Y30 A;  3RKQ A;  2Y9Z A;  2QF7 A;  3ZQG A;  2R7Z J;  5FJ8 J;  4A3G J;  1NK2 P;  1HF0 A;  4RDU A;  3PO3 J;  2DA7 A;  4RBO A;  1BW6 A;  2L7M P;  5EG0 B;  2K9S A;  4JX6 A;  1GVD A;  4M3E A;  4BXX J;  1Z0X A;  1BA5 A;  3BR1 A;  3IH3 A;  4L5E A;  2R5Y A;  1HLV A;  2PMZ N;  3JR9 A;  2YU9 J;  2DTZ A;  1BL0 A;  1Y1W J;  2H1K A;  1P7I A;  1HOM A;  4DZP A;  2K9N A;  2XRL A;  1K83 J;  4JYK A;  5EGO A;  1K61 A;  2OPT A;  1WI3 A;  3O8G A;  1MH4 A;  2R93 J;  2Y9Y A;  2HYJ A;  4XID A;  2VKV A;  2VI6 A;  3WHB A;  3IV5 A;  2K9Q A;  5C44 J;  2DMN A;  2QCO A;  4DYQ A;  1B8I A;  1RET A;  3BG9 A;  5EEA A;  2JA7 J;  1MBE A;  2MGQ A;  4A3B J;  1RKW A;  1GUU A;  5F0C A;  3S1R J;  3ZQL A;  1ZK8 A;  3HGG A;  3HM5 A;  1SFO J;  5EF6 A;  1DU0 A;  1WH7 A;  1H8A C;  1RR7 A;  1VND A;  4C2M J;  2CJJ A;  3BQZ A;  1NTC A;  1YRN A;  4V2G A;  3S17 J;  3GTG J;  2NVQ J;  2EZK A;  2HOA A;  1U78 A;  3OIO A;  1JUM A;  2CQQ A;  1OCP A;  4AUX A;  2LKX A;  2R92 J;  2XPW A;  2FX0 A;  4XRS A;  2KT0 A;  1ZR2 A;  3SDG A;  3ZQF A;  4S0H B;  2MSY A;  5EG0 A;  1CQT A;  4GFB A;  3LOC A;  2M34 A;  1W0U A;  2X9D A;  5E3O A;  2K40 A;  2RAE A;  1QPI A;  4HNV A;  3GTP J;  1LE8 B;  2JJ7 A;  1ZQ3 P;  1UG2 A;  2JWT A;  5IYD J;  1JJ6 C;  1GDT A;  3Q0U A;  3O8H A;  2XB0 X;  3ZQH A;  3M4O J;  5FKN A;  5F27 A;  4DZJ A;  2M0C A;  1VI0 A;  2DN0 A;  5IOY A;  1A5J A;  2CUE A;  3BTL A;  1JJ8 C;  5K7H A;  2GBY A;  5FKL A;  3GTO J;  4A3D J;  1E3O C;  5EZG A;  1SAN A;  4C3H J;  4A3E J;  2G0E A;  2L9R A;  1APL C;  1MBG A;  3Q0V A;  2N8G A;  1ITY A;  3GBG A;  1TWF J;  4BBR J;  1JT0 A;  3G1L A;  3TP3 A;  4IHW A;  5J1U A;  2LVS A;  2IEK A;  4M3B A;  1NK3 P;  1XC5 A;  4C3J J;  2B63 J;  1JKP C;  1WGX A;  1ZR4 A;  2JN6 A;  1IG7 A;  2GM4 A;  3S16 J;  4FE4 A;  2CUF A;  5E3N A;  3Q3S A;  2Y0S N;  4A3C J;  1POG A;  3H3V K;  1FTZ A;  5JLW A;  2NS7 A;  5F0H A;  1GV2 A;  1P7J A;  3S1N J;  1U8B A;  2E1O A;  3ZQI A;  3ZOB A;  4NDL A;  4UUS B;  1LE8 A;  1UMQ A;  1IDZ A;  4A93 J;  5F1J A;  2LLK A;  3GTK J;  3HDD A;  2ID6 A;  1BJZ A;  2XGE A;  1I3Q J;  5IP9 J;  3QPS A;  4D5F A;  5GPC A;  2LP0 A;  1H89 C;  2E2H J;  1ETQ A;  2OF7 A;  3HEF A;  3TP0 A;  1G2H A;  5K7F A;  2NVT J;  2JMW A;  3BR3 A;  4MLO A;  2CU7 A;  1LFU P;  2NVY J;  3ZQC A;  2LD5 A;  2DMT A;  3HBL A;  5C4J J;  4MFE A;  1B72 B;  4Y52 J;  3IH2 A;  4FCY A;  2DMP A;  3DEW A;  4B1R A;  1ZTR A;  1JGG A;  2LY9 A;  1ETW A;  2X48 A;  3HGY A;  3CCY A;  3TW6 A;  2COB A;  1AU7 A;  3S14 J;  1JUS A;  2MG4 A;  3LSP A;  3BR6 A;  1T56 A;  2AO9 A;  2R5Z B;  2DA6 A;  1IV6 A;  2L0K A;  3LSR A;  2NOG A;  1QVU A;  2JA8 J;  3A01 B;  1AKH B;  1MBK A;  4A3I J;  2VKE A;  5IP6 A;  1FJL A;  2P81 A;  4A3F J;  2VUM J;  4UUT A;  4FTH A;  2DA5 A;  1O4X A;  3G1M A;  1ETY A;  2I10 A;  2DJN A;  4DW6 A;  5IYC J;  1HDD C;  1MH3 A;  3E7L A;  2M2E A;  4UUS A;  5FKO A;  5M5X J;  3B6C A;  2DA3 A;  1ETX A;  3PM1 A;  2ME6 A;  3B6A A;  4IHX A;  1ETV A;  2TCT A;  3PO2 J;  5E3L A;  1JTY A;  4G12 A;  4M3G A;  4CYC B;  3JRI A;  4A3K J;  3BT9 A;  2EZH A;  4W97 A;  1S7E A;  2CQX A;  2ECC A;  5DTD A;  3CDL A;  2JK3 A;  1T33 A;  3TED A;  4A3M J;  1ETK A;  3VPR A;  1GT0 C;  3I4N J;  1JKQ C;  2H8R A;  1H88 C;  3HOV J;  4MIM A;  1FTT A;  1U9N A;  2R0Q C;  4XK4 A;  1B72 A;  3NAR A;  1XS9 A;  5IOZ A;  2M8G X;  4DYR A;  4BY7 J;  4B4C A;  3BR2 A;  3OSF A;  4AYB N;  1JKO C;  3S2H J;  5FKM A;  3HOU J;  1MBH A;  4JX5 A;  3CQZ J;  3S2D J;  2LTP A;  1EF4 A;  3BTJ A;  1OFC X;  2YS9 A;  4XRS G;  1VFC A;  4V2F A;  2R5Z A;  3JRH A;  4MFD A;  2Y31 A;  1HDP A;  2L7F P;  3MKL A;  3JRB A;  2NVX J;  5M5Y J;  3A01 A;  1AKH A;  2E2J J;  1X2M A;  1VF9 A;  1AHD P;  3BR5 A;  5EZH A;  4M6V A;  4X1E A;  1DU6 A;  4D7M A;  2HQ5 A;  4A3L J;  4JX4 A;  1F43 A;  1TWC J;  3GTJ J;  1IUF A;  1JTX A;  5M3F J;  1OCT C;  2MW8 A;  2ECB A;  3H0G J;  3K2A A;  5IYB J;  2JA6 J;  3S1M J;  4XRM A;  3HB9 A;  4CYC A;  1WCM J;  1ORK A;  3QPL A;  2HOS A;  1R9T J;  1MNM C;  1IC8 A;  3A03 A;  4M3F A;  1WPK A;  5FLM J;  1IRZ A;  3BG3 A;  3SJM A;  4QIW N;  1GV5 A;  3C2B A;  4D7N A;  1UHS A;  2HXO A;  4MO7 A;  3LNQ A;  3GTM J;  5HOD A;  2DA4 A;  4QTR A;  2GLO A;  2XSD C;  1ENH A;  2EZL A;  1I6H J;  5F0F A;  4ABZ A;  3FK6 A;  2VPR A;  3OOU A;  3CMY A;  5E3M A;  2ELK A;  3SFI A;  4X6A J;  4J19 A;  1D5Y A;  1TWH J;  2IBD A;  3HKZ N;  9ANT A;  3TW7 A;  1X2N A;  3F0C A;  5J1Y A;  2M9H A;  2WV1 A;  3HOW J;  5C4X J;  1FIP A;  2HDD A;  3BQY A;  4EEF G; 
#chains in the Genus database with same CATH topology
 1U2W A;  2ID3 A;  4GYI A;  1P4X A;  3ZN1 A;  5DDG A;  1W5C C;  2L4M A;  4IHY A;  3IH4 A;  4ZYA A;  4EM0 B;  1HW2 A;  3BTI A;  1WH5 A;  4GXO A;  3M1C A;  2VQC A;  5D4S A;  4OIQ F;  2OTL I;  2K4J A;  1Z21 A;  2DYR H;  2LYC A;  4RGR A;  2EH3 A;  3DCF A;  4LIU A;  3DP7 A;  4R8H A;  2A5Y B;  2GXA A;  2OZ6 A;  3FMQ A;  1H9G A;  2DA2 A;  2XAQ A;  2RKH A;  2A07 F;  3M3Y J;  1LVA A;  3LFU A;  4FE7 A;  2HOT A;  2Y2Z A;  2G9W A;  1F36 A;  1XCB A;  3CMA I;  1I50 J;  3FDY A;  3PFY A;  2VOO A;  1CF7 A;  5FLV A;  4YEL A;  5FFZ A;  2MD5 A;  1MJ9 A;  3M8E A;  4FHT A;  2KLO A;  5IPA A;  3W6V A;  2DA1 A;  2E1N A;  2NS0 A;  1FY7 A;  3CUQ C;  1VQ8 I;  2PBI A;  1Q1V A;  4I6Z A;  4HNT A;  1MSE C;  3GFI A;  1SVL A;  3C1D A;  2DK8 A;  1ACI A;  2ME0 A;  1SFK A;  2LC2 A;  1SFU A;  5IP7 J;  4BJ6 C;  2KDZ A;  4KN4 X;  3K4N A;  1D1A A;  4XKV A;  5FO5 A;  3JRG A;  4UNO A;  2EBI A;  3FZV A;  3RDI A;  1Y1V J;  1YW7 A;  5KAF C;  2STT A;  2XAJ A;  1HKQ A;  2PLY A;  5ILU A;  5H6Q A;  3FM3 A;  1LFB A;  2KIS A;  3KYD B;  3G4S I;  2V6C A;  2M0M A;  2VQG A;  5M5W J;  4XSX F;  2F5V A;  1PUF B;  1GVJ A;  1MDM A;  3FXO A;  2CH0 A;  3GFJ A;  1QRY A;  3PNV A;  4BHP A;  5GPA A;  1K78 B;  1E3P A;  4CXF A;  3CCS I;  4DOZ A;  1HXD A;  2JA5 J;  4IHV A;  2XB5 A;  4C2T A;  1BI2 A;  3ZMD A;  2FEZ A;  4AVZ A;  1J59 A;  1WVR A;  4B3A A;  1ZGJ A;  1FPQ A;  1U0J A;  3RKY A;  1ZKG A;  5IY5 H;  5BOX A;  2O9L A;  2STW A;  3I59 B;  3CLQ A;  1B6A A;  4FAS D;  2G7U A;  2BY0 A;  2OCC H;  4KT6 A;  1HCR A;  2MD0 A;  3RZD J;  2VJI A;  1W5S A;  4XIC A;  2HDD A;  1MJA A;  1FYL A;  2M30 A;  3DPU A;  2PJR B;  3A02 A;  2R3S A;  5FKK A;  1LFP A;  5BNG A;  4RGU A;  4AID A;  4P96 A;  2FD5 A;  2H8W A;  4G7O F;  2KP6 A;  2CQN A;  3PFI A;  2V1D A;  2EQR A;  3EUA A;  3MZH A;  2Y9Z A;  3ZQG A;  1B59 A;  2LKP A;  1DDN A;  1B4A A;  1NK2 P;  2HDW A;  1D1B A;  2W57 A;  3OMY A;  4RDU A;  2LRD A;  2KRC A;  1YFH A;  1EJ9 A;  2L7M P;  2FU4 A;  3CCE I;  2ZME B;  3TBI A;  1VQK I;  4XOP A;  4ENN A;  3DWL E;  1UAA A;  3GF2 A;  1YX5 A;  1IRX A;  4UVA A;  5JI6 A;  4OIO F;  3HTS B;  1Z0X A;  2KL4 A;  4ZTF A;  5TIS C;  3UR3 C;  4L5E A;  3DF8 A;  5D5X B;  1YS6 A;  1HLV A;  2E71 A;  3T1B A;  3K0L A;  2YU9 J;  1BL0 A;  4YG2 F;  1U6G A;  2D45 A;  2W7N A;  3FXM A;  3HZJ A;  2M87 A;  4B8X A;  3CTA A;  4DZP A;  3HJE A;  3PQK A;  3G6E I;  1ODD A;  1O3S A;  2K3P A;  4JYK A;  5CVU A;  4A0Y A;  2BXZ A;  3OYB A;  3O8G A;  3I58 A;  1G59 A;  2F2E A;  4KIF A;  3VOD A;  4MEY F;  2VI6 A;  2K27 A;  5C44 J;  3E5Q A;  1K78 A;  5CVV A;  5TGT A;  1XGN A;  3BG9 A;  3DBL B;  2JA7 J;  5FRO A;  2OD5 A;  2HTJ A;  1RKW A;  5CYV A;  3GX4 X;  3S1R J;  3ZQL A;  1UCR A;  3HGG A;  2FOW A;  3GZN B;  2KJB A;  1SFO J;  2A6T A;  3ISP A;  1WH7 A;  1MZB A;  4OIP F;  2HVQ A;  2YPR A;  1KON A;  4V2G A;  4HV6 A;  1IW7 F;  3FMR A;  3HRU A;  2PJR A;  4II3 A;  3CMM A;  2L9V A;  4XNF A;  4KMF A;  1GHC A;  2W82 A;  2VOP A;  1OCO H;  5IT3 A;  2LKX A;  2HPI A;  4XRS A;  2QUF A;  3CCL I;  1G3Y A;  2ZXH A;  3PNY A;  1WJ5 A;  3SDG A;  2ZME A;  4G6D A;  3MD2 A;  1J5Y A;  3R61 A;  1WJF A;  5KK1 A;  3GTP J;  1Y8R B;  1LE8 B;  2JJ7 A;  3OS1 A;  4IQ4 A;  2YX4 A;  1SAX A;  2LF8 A;  3M4O J;  3BJO A;  4DZJ A;  2M0C A;  1VI0 A;  4S04 A;  2DN0 A;  3EQL F;  1FMW A;  1P6R A;  5IOY A;  2XGX A;  2PMU A;  3E97 A;  4NQW B;  4PJJ A;  1BC8 C;  3BTL A;  3VSK A;  3HOS A;  5FKL A;  4EJT A;  1SD4 A;  3E6D A;  3GTO J;  4A3D J;  3CZ6 A;  1E3O C;  3RPU D;  2E1M B;  4L9N A;  2JPB A;  3E0J B;  4LIV A;  3SHF A;  1SAU A;  2W25 A;  1T98 A;  3FMS A;  3FF5 A;  4C3H J;  4Q4Z F;  3KP7 A;  5HLG A;  1RRJ A;  4PFO A;  1BJA A;  2M7A A;  1FBS A;  4XOR A;  3DBH B;  4JBA A;  2O5R A;  3ZPL A;  3GBG A;  3LA2 A;  1TWF J;  1B1B A;  4BBR J;  2DDB A;  3G1L A;  4IHW A;  2BZT A;  1X3U A;  1ZLK A;  3KET A;  4XRF A;  4ON0 A;  2QZ8 A;  1XC5 A;  2B63 J;  4BYY A;  4DBR A;  4CGZ A;  3DU5 A;  2RC4 A;  2UWM A;  2KDO A;  5B66 C;  1ZR4 A;  1IG7 A;  4ZYH A;  1FZP B;  2GM4 A;  3S16 J;  4UXN A;  2CUF A;  3LWF A;  3Q3S A;  4I7H A;  3H36 A;  4LG0 B;  2ZCW A;  3H5N A;  3KYC B;  5JLW A;  1Y0N A;  1Y56 A;  3LST A;  3KZY A;  4YIF A;  2J5O A;  2DT5 A;  3S1N J;  4IRI A;  5LGT A;  3K10 A;  3OYE A;  1Z3Y A;  4NDL A;  4UHT A;  3TO7 A;  4UUS B;  1LE8 A;  3FXQ A;  1XGM A;  3KZI C;  4A93 J;  5F1J A;  3J7A Y;  4RS8 A;  1J0R A;  4C2U A;  2ID6 A;  5D8L B;  4OOI A;  4AIH A;  1I3Q J;  2QYO A;  5K5R A;  3QPS A;  1N77 A;  4H4K C;  3RJP A;  1FLI A;  2Z9O A;  1G2H A;  3F3X A;  2X4H A;  4NQW A;  1IRG A;  1MW7 A;  2IGN A;  3BR3 A;  5HS8 A;  4PDK A;  4EJW A;  4F93 B;  3COA C;  1XSD A;  3ZQC A;  2LD5 A;  3E5X A;  3HBL A;  3H0D A;  4XLH A;  5C4J J;  4RLQ A;  3OYN A;  1D0Y A;  2P8T A;  1W5T A;  2EWN A;  3F8C A;  4MFE A;  3IH2 A;  1T2K A;  2Y75 A;  3DEE A;  3CCR I;  2A6E F;  5HNH A;  1ZTR A;  3BC8 A;  3KPH A;  5LFA A;  3H3U A;  2E34 A;  2IS1 A;  2X48 A;  2FBK A;  4ZYG A;  3TW6 A;  1R71 A;  3WTY C;  3W3C A;  3CUO A;  4WK8 F;  2QEX I;  1PJR A;  3BR6 A;  3EUK L;  3LSP A;  2E1C A;  1W36 C;  1H0M A;  3H35 A;  2L0K A;  1QVU A;  2VOD A;  3BZ6 A;  4LG0 A;  3A01 B;  2RRE A;  3WU1 B;  3NQO A;  5IP6 A;  2H6C A;  4A3F J;  4FTH A;  1VQ7 I;  1BC7 C;  2YSR A;  2GIV A;  2I10 A;  4XN0 A;  2WWY A;  4UUS A;  5M5X J;  2ZNZ A;  5GAE J;  1PVE A;  1XMK A;  3WGG A;  4U0W A;  2ME6 A;  3B6A A;  4YFX F;  3AFH A;  4CYD A;  1KU7 A;  1X1P A;  2EZH A;  4EAT A;  3K1P A;  3JSP A;  1E17 A;  2Q0O A;  3L2U A;  4O6J A;  2LF7 A;  1BIA A;  4O3M A;  2OC6 A;  2IXS A;  3CDL A;  4I2O A;  1ZHF A;  2FF4 A;  3K4C A;  3H9J A;  3ZXS A;  3WG7 H;  1JKQ C;  2F4M B;  2HNH A;  4HX8 A;  1Y39 A;  2H8R A;  1MJB A;  1HW1 A;  4KMU X;  4Q48 A;  4Q47 A;  3DKW A;  3QAH A;  3QYF A;  1U3E M;  3NAR A;  4JQF A;  2Z99 A;  1R6R A;  2DYS H;  2M8G X;  5DV5 A;  3W6K B;  1ZRD A;  4RM2 A;  1QGP A;  1R22 A;  2DAO A;  5HVQ C;  2AQF A;  4IHS A;  4B4C A;  2K02 A;  3OSF A;  4AYB N;  4UVC A;  3S2H J;  3DLA A;  2ETH A;  5F6F A;  5LRS A;  2E1M C;  4JX5 A;  3GLX A;  3CQZ J;  1WJE A;  3S2D J;  4BH9 A;  2P4W A;  1EF4 A;  1ON2 A;  3BTJ A;  1OFC X;  2HKX A;  4DGW B;  1T08 B;  4F91 B;  3A0B C;  1HDP A;  2L7F P;  1NHA A;  3MMY B;  1STZ A;  2CFX A;  3WG9 A;  3GO5 A;  3A01 A;  1MMA A;  1VF9 A;  4BDZ A;  1AHD P;  1TW2 A;  2ACJ A;  3JCU C;  5EZH A;  3WTS C;  5D6E A;  2PMH A;  2HQ5 A;  3GXO A;  3HSF A;  1U8R A;  1TWC J;  3HSE A;  4B47 A;  4BEH B;  4G7H F;  1ON1 A;  1I6X A;  2E35 A;  1JTX A;  5F1R A;  5M3F J;  3K1N A;  3V7R A;  1MMD A;  3H0G J;  3K2A A;  3TOA A;  4UV9 A;  4Y4R A;  1YW9 A;  3HB9 A;  1WCM J;  2CYY A;  4DIQ A;  2W85 A;  4KNY A;  2PFB A;  4CCM A;  1ORK A;  3C2G A;  1R9T J;  5LHG A;  1VQ6 I;  3A03 A;  1WPK A;  3CF5 F;  3BG3 A;  4QIW N;  1GV5 A;  3DQV C;  1BI0 A;  4EGY A;  5CVI A;  1QHH D;  3G3Z A;  4ZZL A;  2GA2 A;  1T38 A;  3LNQ A;  3GTM J;  2DA4 A;  2MYS A;  2XSD C;  3GZ6 A;  2NYX A;  5F0F A;  4BJ5 C;  2KZV A;  2V1U A;  5BMZ A;  2X1E A;  1R4N B;  3CMY A;  2ELK A;  1X3W B;  3SFI A;  4X6A J;  4ANJ A;  3R4K A;  3Q5F A;  2KIQ A;  2L3D A;  3TW7 A;  2LBF B;  3PIP F;  2LOO A;  2MFZ A;  3C2H A;  2M9H A;  1KYW A;  3IWF A;  1BN5 A;  5C4X J;  3R6S A;  1FIP A;  1R58 A;  3BQY A;  2ZJ2 A;  4AYB A;  2F5D A;  1K6Y A;  3JRE A;  4QLC U;  4BXF A;  4A69 C;  1QO0 D;  2FRH A;  4BBS J;  4MEX F;  5E8G A;  3MAJ A;  4N9H A;  1A31 A;  2VON A;  3SDB A;  4KT5 C;  4M6Y A;  4AC0 A;  5F08 A;  2FQ4 A;  1TQP A;  2UUZ A;  3W2W A;  3HOX J;  3E6C C;  3GCM A;  3ZMT A;  4ESJ A;  2DLL A;  4BEH A;  5EYR A;  1Z9C A;  1F9N A;  4XLF A;  1PP7 U;  4HYE A;  3FBI B;  3L09 A;  4AM3 A;  1WWX A;  4CDG A;  5A2Q Z;  1ZGW A;  2PG4 A;  2BYV E;  2KZG A;  2EIN H;  5FD5 A;  2KIF A;  1IGN A;  3ZMU A;  2BHZ A;  1OYI A;  2M45 A;  3HRT A;  2NAZ A;  2IA1 A;  3MN2 A;  1RI7 A;  1TL8 A;  1I1G A;  3L9F A;  4BKX A;  3JRA A;  4MGR A;  3IWZ A;  1N78 A;  2JA2 A;  1JE8 A;  3E5U A;  3KE2 A;  3NAU A;  5J1R A;  1W0T A;  1FWZ A;  1F4K A;  4XON A;  3CCM I;  4Y7N J;  3WHC A;  1I3A A;  2MH9 A;  2W1O A;  1KYZ A;  1V55 H;  4FIS A;  2DCE A;  2XGC A;  2K85 A;  4NC6 A;  2R7Q A;  4I0B A;  3RYP A;  4F55 A;  1DP3 A;  2MLG A;  2IA2 A;  1R1U A;  2LBF A;  4W1U A;  4HG2 A;  4DYC A;  3TMO A;  4A3J J;  2LFB A;  2R5Y B;  5JLX A;  2BXY A;  2QA4 I;  1U9O A;  3LAP A;  1D0Z A;  3L00 A;  4HAM A;  4Y33 A;  1R7J A;  3ZQQ A;  1A6I A;  1VZ0 A;  2V7F A;  1FIA A;  5GAH J;  3D0S A;  1YIO A;  5EGO B;  4M73 A;  2ELH A;  1TWA J;  4HQM A;  2DT6 A;  1JHH A;  2VT3 A;  1XMA A;  3OS2 A;  2VE9 A;  2LK2 A;  1JKR C;  1XCV A;  4ZDO A;  2ZJP F;  5TJJ A;  4D0P A;  1MBF A;  3P9K A;  2V79 A;  2C6Y A;  2VXZ A;  3L1P A;  3K7A J;  2X1C A;  3HPH A;  1MMS A;  5LEJ A;  4CA0 A;  3ECH A;  1X58 A;  3LQQ A;  5GP9 A;  2X6Y A;  2PN6 A;  1YHQ I;  2W4S A;  1F1Z A;  4RB0 A;  4CZZ A;  2OTJ I;  3F8B A;  5J4V A;  3DKX A;  2CWE A;  1S29 A;  2XPV A;  2DQR A;  3I4P A;  1R5H A;  3GWZ A;  5HDG A;  1YIT I;  1TC3 C;  1S3J A;  4M72 A;  1MMN A;  2CRG A;  1L3L A;  5KNL A;  2Q2E A;  5E20 A;  2Q8K A;  3ZN0 A;  4OWR B;  3PSI A;  5DS9 A;  3K4K A;  2Y30 A;  4LLG F;  1SMT A;  3RKQ A;  4I09 A;  2VLA A;  3SZT A;  2RNG A;  2IGM A;  2Y48 A;  1O7F A;  5FJ8 J;  4A3G J;  2QLZ A;  3PO3 J;  3ZMS A;  5ILS A;  1OLT A;  3IL2 A;  1MIJ A;  5EG0 B;  2NVU B;  4YEJ A;  1GVD A;  1YYV A;  3VWB A;  1IZ1 A;  4HOB A;  4RAZ A;  3IH3 A;  2R5Y A;  2PMZ N;  3FXL A;  4LK1 F;  3AG4 H;  4L5J A;  3DLL F;  1A35 A;  1WJC A;  3VFZ A;  2R4G A;  1FBQ A;  2K9N A;  4BS9 A;  1S9H A;  4ZH4 F;  2VQH A;  5EGO A;  2OPT A;  1MH4 A;  2IGK A;  3A4C A;  1M1E B;  4HX4 A;  2DQL A;  2IP2 A;  1SFX A;  3P9C A;  3RYR A;  4PFP A;  2DMN A;  1K4T A;  2DFF A;  1VQL I;  4EVI A;  4UB8 C;  2RV8 A;  1RET A;  4QPQ A;  4E7L A;  2MGQ A;  1T6S A;  4JOM A;  1YOV B;  1GUU A;  1UZC A;  1SFE A;  3PUB A;  3DXJ F;  2F4I A;  2JUG A;  3HM5 A;  1IXS B;  5EF6 A;  4LJZ F;  4HA8 A;  2RVC A;  1WZ2 A;  5LEK A;  2X85 A;  1QPM A;  1A04 A;  2CJJ A;  3GTG J;  1QQI A;  2V9P A;  1LJ9 A;  1USS A;  3IKV A;  2NVQ J;  2KKO A;  2OAZ A;  3SEQ A;  4YII A;  4BAY A;  1U78 A;  1IXC A;  1Z1D A;  1D8J A;  1MNE A;  1X3Z B;  2CQQ A;  4F92 B;  3KLO A;  4P55 A;  4AUX A;  1OCC H;  1RNL A;  2FX0 A;  3LA7 A;  1X1C A;  2IGO A;  4E7J A;  4OMY A;  5TRD A;  2RQQ A;  5LGN A;  4ZC3 A;  1CQT A;  5EG0 A;  4OAY A;  5KCM A;  3TL4 X;  3VSL A;  4GFB A;  3LOC A;  5E3O A;  4XLE A;  3KP5 A;  3I55 I;  4PSX A;  1Z3X A;  2G7H A;  5D8K B;  1EH8 A;  3HUG B;  4IQJ A;  1P4A A;  1UG2 A;  3AG3 H;  3L2W A;  4L18 B;  2IS2 A;  1TZL A;  3H92 A;  2PMZ A;  2XRN A;  3J80 Z;  3S3N A;  5IT9 Z;  4ASN A;  5FKN A;  2CGP A;  5F27 A;  1OKR A;  2WY8 Q;  3QPH A;  5H6R A;  4OMZ A;  1JJ8 C;  4TV7 A;  2WAF A;  1HSJ A;  3E6M A;  5EZG A;  1V5F A;  2ZXW H;  2JZY A;  2H27 A;  4Z6Y A;  4KIC A;  3KEQ A;  4A3E J;  4S05 A;  5LBQ A;  3K4L A;  2L54 A;  3I71 A;  5CKT A;  5B1A H;  3Q0V A;  1X1B A;  4QWQ A;  4K2E A;  3U1K A;  5ILV A;  1RIO H;  3HPG A;  3OYG A;  2JRT A;  3IRR A;  1FOX A;  2H09 A;  2IEK A;  1XGO A;  1DQU A;  1AWC A;  3K2Z A;  4L9V A;  1DGW Y;  1XMX A;  2GAU A;  4ZYE A;  3HRM A;  4AWX B;  1Y6I A;  2FE3 A;  4RAG A;  1IN8 A;  4FE4 A;  5E3N A;  2PQ8 A;  2Y0S N;  4A3C J;  1POG A;  3WU0 A;  2LY1 A;  3KLN A;  2V6E A;  3GME A;  3BPV A;  4I0A A;  4IHT A;  1WJB A;  3M8J A;  2WY7 Q;  2HGC A;  2VJJ A;  3OR1 C;  4ESB A;  2BBY A;  3KP4 A;  3GZ5 A;  2BEO A;  3F9K A;  3ULQ B;  4DNC A;  1HC8 A;  3HUG A;  3HDD A;  3I5U A;  1ZRF A;  3N97 A;  1W36 D;  1BJZ A;  1YLF A;  1YW8 A;  4KA4 A;  1PDN C;  1D0X A;  2P7C B;  1H9T A;  2KMU A;  1O7L A;  5LRR A;  2X6X A;  4B09 A;  2O61 A;  3QU6 A;  1H89 C;  3DV8 A;  4B48 A;  3VYS B;  2E2H J;  3HEF A;  3TP0 A;  4UY8 I;  5K7F A;  2DFI A;  3IRQ A;  1JXS A;  2JMW A;  3OYL A;  3WTU C;  3WTV C;  3ABL H;  3OYD A;  1A36 A;  3S3O A;  1S6L A;  1J09 A;  3KFW X;  2J5P A;  1KZH A;  2CV1 A;  3BLY A;  3MCZ A;  1JGG A;  3NWS A;  1KGS A;  1IO2 A;  1LUJ B;  2DPU A;  1ETW A;  2EA4 A;  3CCY A;  1W4M A;  1F5T A;  4QPO A;  3OYA A;  5KVR A;  3S14 J;  1R4M B;  2VJ4 A;  2HR3 A;  3PUF A;  2OV7 A;  2R5Z B;  1T0F A;  3TDZ C;  1T8I A;  1IV6 A;  3KEO A;  4ZTJ A;  5D4R A;  3OYH A;  4KFC A;  2Y0S A;  2V26 A;  4F7Z A;  3O2P E;  3OYM A;  2F4O B;  1OR7 A;  1OYW A;  2DA5 A;  4A5M A;  3I56 I;  3V8J A;  3WTT C;  1O4X A;  1O3R A;  2GXB A;  3F21 A;  1ETY A;  3B73 A;  4AU7 A;  4DW6 A;  4G7Z F;  1LNW A;  1MH3 A;  5J8F A;  5L3D A;  5HS9 A;  2GOM A;  4FT8 A;  1ETX A;  3PM1 A;  4AVP A;  5L3C A;  1O3T A;  3BG6 A;  1JTY A;  1I39 A;  4M3G A;  4CYC B;  3BT9 A;  2DDA A;  3LA3 A;  3Q9V A;  1ZN2 A;  4HDV A;  2IT0 A;  3JAM Z;  4IKF A;  2ECC A;  1OIS A;  2AXT C;  2O8X A;  5HS7 A;  4MQV A;  2PEX A;  4A3M J;  4BAC A;  1YTY A;  1Z67 A;  3T8R A;  1RC9 A;  3HOV J;  4MIM A;  2Z1D A;  1U9N A;  4CZC A;  3U2R A;  2WTE A;  1G3T A;  5J40 A;  5IOZ A;  3VYT B;  3F6V A;  4ZDL A;  1V5E A;  2ZSI B;  2E36 A;  1FOW A;  3VOE A;  2LG4 A;  2MLK A;  4EJU A;  3LAJ A;  2K7L A;  3BP8 A;  2LTP A;  2M4G A;  3KYL A;  1VFC A;  1MKM A;  5EJC A;  2R5Z A;  3JRH A;  2BVM A;  2R7R A;  3CP8 A;  2ZXI A;  2CQ7 A;  3F72 A;  4IPA A;  1X2M A;  2P6T A;  2E2J J;  3QPT A;  2R7S A;  4B43 A;  3L2V A;  1BI3 A;  2GZW A;  3BR5 A;  3E1S A;  2JQ7 A;  1DU6 A;  1VQN I;  1X19 A;  5AON A;  4D7M A;  4A3L J;  3I54 A;  1F43 A;  2BY2 A;  5DD8 A;  3DKY A;  2PI0 A;  3P7N A;  3IKT A;  3CCJ I;  4EQQ A;  2B9S A;  2V9K A;  3F8N A;  2HOE A;  2JA6 J;  2HTS A;  3S1M J;  4CYC A;  2GOX B;  5K5O A;  3LFK A;  3GUD A;  1BR2 A;  2HOS A;  1OR7 C;  2CO5 A;  4RGS A;  1MNM C;  3ABU A;  1B9N A;  1Y0U A;  2JPC A;  2VE8 A;  2VN2 A;  2ZME C;  4PCQ A;  3SJM A;  3C2B A;  3QWL A;  4HW0 A;  2DFE A;  4A0Z A;  3WU2 C;  4H0E A;  1R5I D;  4B3X A;  3WTX C;  3P9I A;  2GLO A;  4HF1 A;  4PJN A;  2H94 A;  2XAH A;  2HS5 A;  3V8L A;  1SVO A;  4E7S A;  3LSM A;  1J2X A;  3U21 A;  4BQA A;  2LRE A;  3MQ0 A;  3RKX A;  1SD5 A;  3FK6 A;  2VPR A;  1Y8Q B;  5ICF A;  2A68 F;  2CW7 A;  5GAG J;  1RR8 C;  1ZG3 A;  1TBX A;  1XDU A;  4KN7 X;  3SXY A;  2P7V B;  4XMY A;  2CMP A;  4CCN A;  5ED4 A;  2WV1 A;  1G3S A;  3AG1 H;  1OCR H;  1LKX A;  1ERD A;  1DGR M;  3V8K A;  3NWT A;  3ZMV A;  3GTQ J;  2NRA C;  2QSH X;  1FT9 A;  3PL8 A;  1SMY F;  1Q1H A;  2DMQ A;  3BTC A;  2JSC A;  4FX0 A;  1FEX A;  2DOF A;  4NC7 A;  3GW2 A;  1QZE A;  3KCC A;  3REO A;  1NG6 A;  3HHG A;  2HI3 A;  2XF5 A;  3BOQ A;  4CH7 A;  4CUG A;  5HLH A;  4HZF A;  1TLH B;  3FIW A;  1UEL B;  1IDY A;  3CD6 I;  2XGD A;  2XV4 S;  3U9G A;  1RES A;  5ICG A;  2EZI A;  3C3W A;  5J3L A;  4XN3 A;  3IUO A;  3DTK A;  2VXD A;  3RZO J;  5JHF A;  2EFW A;  1LB2 A;  3IC7 A;  3S15 J;  5J47 A;  2ZBK A;  2QWW A;  2YUS A;  3BJ6 A;  1WQ2 A;  4IVN A;  2QQ8 A;  2W48 A;  4M71 A;  2K3F A;  2CSO A;  1BOB A;  2EIK H;  1CGP A;  3OV8 A;  1RKT A;  2EIM H;  4QSH A;  3RPU A;  1R1V A;  3FXR A;  1IAW A;  1ETO A;  4YIR X;  4M3D A;  5FLX Z;  2X6O A;  2XHK A;  3QQA A;  4I76 A;  2JVH A;  4GCV A;  1ZH5 A;  3GLL A;  2L7Z A;  1UHM A;  1YJN I;  2V9V A;  3DEU A;  1IRF A;  4D5C A;  2WB1 N;  1KU9 A;  2EA2 A;  4G9Y A;  4C3I J;  4AIJ A;  1QZY A;  2M1B A;  1N75 A;  1TQI A;  2IS4 A;  4BGD A;  1TT0 A;  3N4M A;  1IXR C;  2KFD A;  2FBI A;  1RZ4 A;  2DOD A;  5LLQ A;  2FA5 A;  5J6X A;  3P5J A;  2RNJ A;  1FP2 A;  2KIU A;  3KZZ A;  4LOC A;  4Y15 A;  2VC1 A;  3V4G A;  5A2Q K;  5GTI C;  2GQQ A;  4BY1 J;  3BG5 A;  2I8D A;  2XPU A;  5ERI A;  5C3E J;  3OYF A;  4HV5 A;  1X1D A;  1VTN C;  2CUZ A;  1HQC A;  2LR8 A;  3S2W A;  1ONV A;  1EH6 A;  1ZAR A;  2JVG A;  3I9V 2;  2K4B A;  4CO8 A;  3CES A;  1W7P D;  1B8I B;  5E1Z B;  2DFH A;  1BW5 A;  4U88 A;  3JRD A;  3VB2 A;  5DCM B;  1TNT A;  2VBY A;  5DEQ A;  2D5V A;  3CP2 A;  5K7Z A;  3RQI A;  2OBP A;  3I3L A;  4C9Y A;  1MBJ A;  4EJV A;  1YRN B;  2QSG X;  4WXD A;  5EDN A;  3OSG A;  3CCV I;  4CHU A;  3EYY A;  5CQG A;  3IAM 2;  2IJL A;  3KIO A;  1EA3 A;  2ZFW A;  5E18 F;  2QF7 A;  4D1Q A;  5H2F C;  3MKW B;  3WOD F;  1HF0 A;  2Z3Y A;  3G2B A;  3BCB A;  1QU3 A;  2FMY A;  4RBO A;  1BW6 A;  1YX3 A;  2ESH A;  1TW3 A;  2NNN A;  5HNF A;  2BHY A;  4D9J A;  1P9Q C;  2EFO A;  3OIQ A;  4NB5 A;  4BQQ A;  4E7Z A;  5LHH A;  4RB1 A;  1Z6T A;  3HRS A;  1SEU A;  1HW5 A;  3BR1 A;  3I53 A;  2WB1 A;  3BY6 A;  5GAD J;  5JHU A;  2XIG A;  4HDU A;  4IXA A;  3S93 A;  5DM7 F;  3IP4 B;  1N25 A;  2DTZ A;  2H1K A;  1P7I A;  1RUO A;  1HOM A;  2DXI A;  2R7V A;  4KJZ A;  5L3B A;  1SD7 A;  2UZK A;  1K61 A;  2L9N A;  1TP4 A;  4I98 B;  3SQN A;  5JVT A;  2VKV A;  3EUH A;  4ESF A;  2L2O A;  1X4P A;  2V4J C;  3WHB A;  1GLN A;  3IV5 A;  2K9Q A;  4DYQ A;  4G94 A;  2QGU A;  4LLL A;  1B8I A;  4EGZ A;  3DPL C;  5EEA A;  3SFZ A;  4L5I A;  3S3M A;  4A3B J;  4UV8 A;  5DCM A;  2ZJQ F;  1ZYR F;  4GDF A;  3BWG A;  1WFX A;  2QKL B;  1GXP A;  3HXL A;  3TOB A;  5L3F A;  3WE2 A;  4C2M J;  2CW0 F;  1NTC A;  1YRN A;  5E1X A;  1AA7 A;  1L0O C;  1P4W A;  2KJC A;  4RLF A;  2EZK A;  2HOA A;  2HDC A;  5CVR A;  3G71 I;  2E5Z A;  2QQA A;  3K6G A;  3JTH A;  1JUM A;  1I27 A;  1OCP A;  4C30 A;  3TKY A;  3L2R A;  3J7A O;  2R92 J;  2XPW A;  2Q2E B;  4ZZD A;  3GFM A;  3MWM A;  4N0B A;  1ZR2 A;  4S0H B;  3K1M A;  2RDP A;  4B44 A;  2K40 A;  2RAE A;  3O3K A;  1QPI A;  4HNV A;  1DPU A;  2I5U A;  3F22 A;  2FNA A;  1MDM B;  3K70 C;  1XN7 A;  1ZQ3 P;  3AG2 H;  2HEO A;  3RKW A;  2JWT A;  5IYD J;  2ESN A;  4YRV A;  4N9I A;  5LD2 C;  4A5N A;  2IRF G;  1JJ6 C;  1GDT A;  3Q0U A;  3O8H A;  1C0W A;  3RIR A;  1G8X A;  1R49 A;  2YR2 A;  1O3Q A;  5EEG A;  3C7J A;  2RN7 A;  2OCE A;  3H3Z A;  4MTD A;  2CUE A;  2CW8 A;  1LDK B;  2FQ3 A;  2BV6 A;  2BW3 B;  2A05 A;  4EJO A;  1SAN A;  4OAZ A;  1VQ5 I;  2ZSH B;  2PX9 A;  2EFQ A;  1B9M A;  3W2V A;  2HWV A;  2L9R A;  2DTR A;  1APL C;  4F3Q A;  1MBG A;  3IHU A;  2KHM A;  2DJI A;  1ITY A;  2MH2 A;  3VDX A;  3LL7 A;  3EUH C;  3TP3 A;  2L4A A;  4GRI A;  5J1U A;  2LVS A;  1S7O A;  3FHZ A;  4CCJ A;  4M3B A;  2VBW A;  1NK3 P;  4C3J J;  4ZYD A;  5HOO A;  3FM5 A;  1JKP C;  2Y0M A;  2IPQ X;  2PJP A;  2JN6 A;  4IRG A;  2KRF A;  4X0G A;  4I02 A;  1OMI A;  3PNT A;  2A3S A;  3IAS 2;  2HZT A;  3ASO H;  1FTZ A;  1G6N A;  4NBQ A;  2R7W A;  3J80 K;  1GV2 A;  3LMM A;  5IT9 K;  3EET A;  5L3E A;  3ZQI A;  3D5S C;  1IDZ A;  1SD6 A;  2BY3 A;  3QP6 A;  3AAF A;  3A0H C;  3ASN H;  3V42 A;  4WWC A;  1YJW I;  2LLK A;  2TDX A;  1YI2 I;  1WKM A;  4HNU A;  4OIN F;  5D5W B;  1J75 A;  4XKC A;  5IP9 J;  1LQ1 A;  2Z2S B;  3RPQ A;  4CCO A;  4GO1 A;  4D5F A;  3HOT A;  2F5F A;  2WC2 A;  4AIK A;  3LSI A;  3SZP A;  2OF7 A;  3GYH X;  1FOY A;  2NVT J;  1IN5 A;  1G4D A;  5J8C A;  4CCL A;  3OIP A;  3OL4 A;  2CU7 A;  2XUB A;  4XR6 A;  1FX7 A;  2BW3 A;  3R0A A;  2FSW A;  1ZEL A;  2KQR A;  2D1V A;  1ZLJ A;  3KP3 A;  5E1W A;  2XAF A;  1B72 B;  4Y52 J;  1KQ0 A;  4FCY A;  1S5L C;  4M74 A;  4U7D A;  2DMP A;  2M3A A;  3TDU C;  3NRV A;  1XTA A;  1QZZ A;  1FYK A;  1MMG A;  1O57 A;  3JSO A;  2OA4 A;  2P5V A;  1FC3 A;  2R7D A;  1WJA A;  2DOA A;  3FHN A;  3FXK A;  5HLT A;  1IN4 A;  2COB A;  4EM2 A;  1JUS A;  3EDP A;  1S72 I;  1T56 A;  2AO9 A;  1XPX A;  2UXN A;  5E17 F;  2GXG A;  3LSR A;  2O6G E;  2NOG A;  3BRO A;  2HU9 A;  4FQG A;  4ETS A;  2QKM B;  1YO5 C;  1AKH B;  2LH9 A;  4A3I J;  4OIR F;  2VKE A;  1FJL A;  1MND A;  1J7K A;  1V4R A;  3QOP A;  3TQN A;  4YFN F;  2VUM J;  4N4O B;  3F6O A;  2DJN A;  5IYC J;  3AL0 B;  3ERE D;  3E7L A;  4ZJZ A;  5EEH A;  1D3Y A;  1VQM I;  2R7F A;  3CJT B;  4IHX A;  1ETV A;  3SZG A;  3MKZ A;  4PZJ A;  1BR1 A;  4G12 A;  3JRI A;  2VL8 A;  3EPZ A;  2UV1 A;  4A3K J;  5D5U B;  4YFK F;  3VYU B;  2VB6 A;  3M1E A;  1FNN A;  3OYI A;  4W97 A;  2IVM A;  1S7E A;  4BJT A;  1MGT A;  2CQX A;  3T0Y A;  1V3F A;  2JK3 A;  3KX2 A;  1T33 A;  2QM3 A;  3TED A;  4V19 K;  1WJD A;  4G8X A;  1ZRE A;  4XKB A;  3VPR A;  4FX4 A;  1GT0 C;  3I4N J;  3ABK H;  2H1L A;  2Y69 H;  2EV5 A;  1Z05 A;  1BBY A;  1XDS A;  2JTV A;  4XSZ F;  1VQP I;  1S8N A;  5CLS A;  1B72 A;  4XM3 A;  5ICE A;  2VIX A;  4U0V A;  4PGH A;  2QQB A;  4HBL A;  2DK5 A;  4N4N B;  4BUP A;  1I1S A;  3ERM A;  4I01 A;  3BR2 A;  1JKO C;  3X2Q H;  1EH7 A;  3HOU J;  2H6B A;  1MBH A;  1UB9 A;  4XRS G;  4BU2 A;  4XLN F;  3E3V A;  2BGC A;  2FUG 2;  1D8K A;  4KIG A;  4XBF A;  4A6D A;  3CJR B;  3HYI A;  4MFD A;  2Y31 A;  3CCU I;  2B0L A;  1R36 A;  4L0Y B;  2NVX J;  1AKH A;  1MD0 A;  1HBX G;  4X1E A;  1ULY A;  3JAM K;  1FOK A;  3K4M A;  5D5V B;  1IUF A;  4OU0 A;  4JK1 X;  1BI1 A;  2XF7 A;  2O0Y A;  2AXL A;  1IN6 A;  2ECB A;  5IYB J;  2F48 A;  3OYC A;  1WSU A;  3FKJ A;  3CJQ B;  5CJ9 A;  5ICC A;  3HL2 A;  2DPD A;  1IC8 A;  2DW4 A;  4CIC A;  4M3F A;  5E79 C;  5FLM J;  4LGW A;  4CCK A;  4D7N A;  2OZU A;  5CVJ A;  2KRH A;  2ZC2 A;  1UHS A;  3DTE A;  2EIJ H;  1X4O A;  3FX3 A;  2MAB A;  2LSO A;  5DM6 F;  2WBM A;  2QBY B;  2W00 A;  4Q5S F;  3PQJ A;  1UJ8 A;  1ENH A;  2EZL A;  1I6H J;  1Z6R A;  4UVB A;  3WGH A;  4HF0 A;  3DPT A;  4PJ0 C;  4BQN A;  1OYY A;  5E3M A;  1Z7U A;  3OR2 C;  1D5Y A;  1TWH J;  1EKE A;  3KEY A;  2EFN A;  3HKZ N;  9ANT A;  2XDV A;  4E70 A;  5KHD A;  1JHF A;  2XKO A;  4G6T B;  2CV0 A;  3ABM H;  1X1A A;  2LNB A;  2LMD A;  2M5W A;  3BZK A;  3F0C A;  3T5X A;  4A2U A;  3JTG A;  3WGI A;  3HOW J;  5LGU A;  4M9Z A;  3CO7 C;  1UHW A;  3ZGK A;  4GGG A;  1JT6 A;  4JP0 A;  5E8I A;  3L2Q A;  3EYI A;  5JVG F;  2VBZ A;  4M6X A;  4HST A;  2HXI A;  3BR0 A;  1PP8 F;  1PUF A;  1LDD A;  2EIL H;  2ADU A;  5DUK A;  3PJR A;  4MTE A;  1BIB A;  1PYV A;  5HDN A;  6PAX A;  2FJ1 A;  2WAD A;  1R5G A;  2NNY A;  2HPM A;  2LKS A;  3QYE A;  2IW5 A;  4IEJ A;  2HZD A;  1DPR A;  3LSG A;  4XKW A;  3I59 A;  3HOZ J;  4GYG A;  2ELJ A;  3WTZ A;  2X6W A;  2Z5U A;  3FIS A;  4LB6 B;  2E7W A;  1KQ8 A;  3H5A A;  2E2I J;  4II2 A;  4R79 A;  3CC7 I;  1ZAO A;  1Z77 A;  4HX7 A;  4EV0 A;  2O8K A;  2CV2 A;  4ENM A;  4LFU A;  2CUJ A;  2XVC A;  3FXJ A;  4IRH A;  5DD4 A;  3H9G A;  2Z33 A;  4LK0 F;  4IOC F;  3F8F A;  1IJW C;  5FRM A;  3AL0 C;  3FK7 A;  3Q9S A;  4A6E A;  4RA2 A;  5DUI A;  2O03 A;  2O7O A;  3RTR A;  2W84 A;  4WCG A;  4RMN A;  1OJL A;  2NOJ B;  3J7Z I;  2UXX A;  4MHG A;  1XG1 A;  2BVL A;  1UG0 A;  2R7O A;  2ZB9 A;  5DCF A;  2QBY A;  3DU6 A;  4AD9 A;  4J01 A;  3UKG A;  1LVK A;  3ML6 A;  2VPL A;  2HQA A;  2NS8 A;  3HTU A;  3S1Q J;  2VC0 A;  2CG4 A;  3VEP A;  1FMV A;  5L3G A;  3O6B B;  3L7W A;  4MQ9 F;  1QHG A;  5F04 A;  1QA6 A;  2AHQ A;  1XGS A;  3KP6 A;  1JUP A;  4FET A;  2ZXJ A;  3Q0W A;  3K69 A;  1BM9 A;  2B7E A;  2EJR A;  2GWR A;  1R00 A;  2IAI A;  1K6O A;  1Z91 A;  3HKZ A;  3UNG C;  3LSJ A;  2QVO A;  3G1O A;  4HEA 2;  4F52 A;  2XAU A;  2JSP A;  5FD6 A;  2Q1Z B;  1HKS A;  2TRT A;  2E19 A;  3QOE A;  4J00 A;  4IOA F;  2WA0 A;  3QU3 A;  3JRC A;  3FKI J;  1RPW A;  2HVR A;  1JGS A;  1QBJ A;  3GTL J;  2BE5 F;  1TWG J;  3MZY A;  3D1N I;  4UUV A;  4L9J A;  1VQ4 I;  4BHC A;  2DU9 A;  2M8E A;  4LIT A;  1D1C A;  2L9S A;  4L9T A;  1K4S A;  5M3M J;  2A6H F;  2E60 A;  4P9F A;  1TQM A;  4KUM A;  2KIM A;  2HQN A;  2VBX A;  2ZFU A;  3JRF A;  3I4M J;  3M8F A;  3MVP A;  1T0F C;  5FLX K;  4M9X A;  3TO6 A;  2DT7 B;  2EV0 A;  1QVT A;  3HOY J;  2DMU A;  2VAS A;  1KQ9 A;  1UST A;  4XLA A;  3OS0 A;  2P5K A;  1D5V A;  2DOE A;  4IF4 A;  2EV6 A;  1QNT A;  1XSX A;  1DUX C;  4KIB A;  2WAQ N;  5B3S H;  4PSW A;  1MSF C;  1FP1 D;  3FXU A;  3R60 A;  3LSK A;  4IX7 A;  2R7Z J;  2K5C A;  2DA7 A;  3DBR B;  3K4J A;  3A2K A;  1HST A;  4HQE A;  2K9S A;  4JX6 A;  1OQY A;  4M3E A;  4BXX J;  2A5W A;  3E6B A;  1BA5 A;  1R23 A;  3F8M A;  4LG3 A;  3OYJ A;  2VT2 A;  3JR9 A;  1XD7 A;  1WRJ A;  1Y1W J;  1YE9 A;  2V1N A;  1TTY A;  2XRL A;  3R0J A;  1BR4 A;  1K83 J;  1T39 A;  3ZRG A;  1ZRC A;  4ENJ A;  1WI3 A;  4RM3 A;  5GTH C;  2Y9Y A;  1U5T B;  2HYJ A;  2R93 J;  4XID A;  2LY2 A;  2VKD A;  4E7I A;  3K70 D;  3TGN A;  4WX9 A;  3ECO A;  2QCO A;  2ZNY A;  3OY9 A;  1SVM A;  3V7S A;  4O5V A;  3LSH A;  2VKH A;  1MBE A;  5LHI A;  2XF6 A;  4XQF A;  5F0C A;  2VJ5 A;  4PGG A;  4LMY A;  2HFH A;  1BOA A;  1YIJ I;  4HLX A;  4HPQ A;  2BY1 A;  5HLI A;  3CME I;  1P92 A;  1DU0 A;  3B02 A;  4PK4 A;  3GEZ A;  1RR7 A;  1VND A;  2XC7 A;  2IA0 A;  5BPI A;  1H8A C;  3CF2 A;  3BQZ A;  3S17 J;  1TT5 B;  2LDU A;  2OQG A;  4G6Q A;  3ZQ7 A;  3OWT A;  3ABT A;  4PJL A;  3OIO A;  3V7C A;  1FYM A;  4BL0 B;  5D6F A;  4HF2 A;  3HHH A;  2WAQ A;  1EV7 A;  3N05 A;  2KT0 A;  2F6C A;  5DYM A;  2QEN A;  3MKY B;  2ZKZ A;  4WF2 A;  3U1D A;  2WV0 A;  3ZQF A;  2MSY A;  3I64 A;  4A0X A;  3OYK A;  4BQO A;  2M34 A;  4DQ2 A;  2NXN B;  2X9D A;  2MC4 A;  2P0W A;  5J4Y A;  4A12 A;  1W0U A;  1FBU A;  2OU2 A;  3CC2 I;  2CFO A;  4PUS A;  1LEB A;  4LLN A;  4P9U A;  2VQL A;  2XB0 X;  3ZQH A;  1VQO I;  2ISY A;  2M4K A;  3D5R C;  1K79 A;  2E7X A;  1V54 H;  4DBQ A;  2JT1 A;  4NNJ A;  4KIT B;  1A6Q A;  4RB2 C;  1A5J A;  1U5T A;  2L01 A;  2K9L A;  2QSF X;  5K7H A;  2GBY A;  1V5G A;  2K86 A;  4XLP F;  4WXC A;  5FB2 A;  3BJA A;  3ZMZ A;  2WAE A;  1S7A A;  1VQ9 I;  4IZZ A;  2G0E A;  1KU3 A;  4HRI A;  3BZC A;  4KDP A;  3GFL A;  5BS6 A;  1OCZ H;  1YS7 A;  2E5N A;  3CO6 C;  1XX5 A;  3RQ4 A;  2N8G A;  1E2X A;  1JT0 A;  3CLO A;  3CJN A;  4CSW A;  1TNS A;  2MC3 A;  3M9A A;  2Z16 A;  4ENK A;  4L0Z B;  1LPQ A;  4M9S A;  4XLC A;  1Z7L A;  4U0Y A;  1IUY A;  3PSF A;  3OL3 A;  1K7A A;  4P5O A;  3K9T A;  3ELK A;  2R7U A;  1WGX A;  2D2W A;  5JFR A;  3K4B A;  2L02 A;  4RAY A;  5AIQ A;  2JRM A;  2F5C A;  4LD5 A;  2FBH A;  3SEZ A;  3H3V K;  4NUB A;  3MZ8 A;  2NS7 A;  5F0H A;  1AOY A;  2X0L A;  1P7J A;  2KPM A;  5FRN A;  2DBB A;  1U8B A;  1WHU A;  4BXU A;  1ZG5 A;  2GIZ A;  2E1O A;  2ZO4 A;  1LDJ A;  2X1D A;  3ZOB A;  2HKO A;  1WI9 A;  3W6J B;  1UMQ A;  2MA3 A;  5CPR B;  3J7Y J;  3GTK J;  1REP C;  1FSH A;  2XGE A;  1IN7 A;  3L2C A;  1I5Z A;  1J9I A;  4HLY A;  4HSR A;  4I99 C;  1HA8 A;  5FFX A;  5B1B H;  5GPC A;  2LP0 A;  2EK5 A;  1ETQ A;  3NEU A;  4E7H A;  4NC8 A;  1RUN A;  2DO7 A;  1LEA A;  3DFG A;  3JW4 A;  2DI3 A;  3TO9 A;  2EB7 A;  3H5R A;  4MLO A;  2EFP A;  4DJA A;  1W7P B;  1LFU P;  2NVY J;  2XAG A;  2QQ9 A;  2DMT A;  2O3F A;  3AKZ A;  4E4H A;  2CS3 A;  4IL6 C;  3W2A A;  3SYT A;  3MFK A;  1IF1 A;  4KYW A;  3RI4 A;  2CQK A;  3DEW A;  4MNU A;  2X51 A;  4B1R A;  1U5T C;  2ZJR F;  1G3W A;  2M7B A;  2HYG D;  5B5E C;  2LY9 A;  3HGY A;  2IS6 A;  1UFM A;  2P5L C;  5H20 A;  1YJ9 I;  1IV8 A;  5AIP A;  3HC7 A;  1AU7 A;  2MG4 A;  4U7B A;  3WE3 A;  1NG7 A;  2DA6 A;  3J81 K;  2A69 F;  1NH3 A;  2JA8 J;  2L5Q A;  4KIS A;  1MBK A;  2XRO A;  1W1W E;  3QP5 A;  4IJA A;  3F23 A;  3CDI A;  2P81 A;  4UUT A;  3G1M A;  4Z2Y A;  1SC7 A;  4XL9 A;  1P2F A;  4Y3O A;  1HDD C;  4EMS A;  2AQE A;  2M2E A;  4BE1 A;  3FBN B;  5FKO A;  3B6C A;  2DA3 A;  3MEX A;  3D5L A;  2OQR A;  2R7X A;  3H1C A;  3QOD A;  3WTW C;  3CC4 I;  2TCT A;  1R1T A;  2ICW G;  5E3L A;  3PO2 J;  1KA8 A;  2V1X A;  3CUQ B;  2ISZ A;  1DP7 P;  3PIO F;  1ZGA A;  5K5Q A;  4Y17 A;  4UB6 C;  5DTD A;  4RAF A;  2FML A;  4RGX A;  2OUM A;  2P6S A;  4U87 A;  1ETK A;  3QRF F;  5JR3 A;  2GA1 A;  1W7P A;  4BDY A;  1H88 C;  1JI8 A;  4LB5 A;  5F64 A;  1FTT A;  2R0Q C;  3FWE A;  3HIF A;  2COM A;  4XK4 A;  1FSE A;  3ZP5 A;  1XS9 A;  2D1H A;  1YG2 A;  4DYR A;  2JUC A;  4XOT A;  4R1H A;  3BG7 A;  2AS5 F;  4BY7 J;  3ONQ A;  3QYB A;  2W24 A;  4ITV A;  3KP2 A;  2XAS A;  5FKM A;  4BNC A;  3CDH A;  2F5E A;  3LQR A;  4WXH A;  2FNP A;  3M07 A;  2XSJ C;  4EM1 A;  2EPF A;  3S8P A;  2YS9 A;  4PJM A;  4IO9 F;  2L7K A;  4V2F A;  4BE0 A;  3BDD A;  3ZCO A;  3MKL A;  3JRB A;  4NHJ A;  1ZG1 A;  3RSN A;  5M5Y J;  1XB4 A;  3T8T A;  3ZR8 X;  3CCQ I;  4M6V A;  2BOL A;  4JX4 A;  1HKT A;  1T95 A;  3GTJ J;  2RGV A;  1E0E A;  3HG9 A;  3G73 A;  3BCA A;  1OCT C;  2MW8 A;  3BPX A;  2R7T A;  3VYR B;  2HVS A;  1XSV A;  3CUQ A;  4XRM A;  3J81 Z;  1PUE E;  5CQE A;  3QPL A;  3H9Q A;  2A61 A;  2FXA A;  2RQP A;  2YX7 A;  1KU2 A;  3HSR A;  5KAI C;  3M7G A;  3ESW B;  3RCO A;  1CF7 B;  2MBF A;  4RB3 C;  2HYF A;  1YQA A;  1IRZ A;  1OPC A;  5FGM A;  3DTI A;  3A1Y A;  2HXO A;  1GXQ A;  4MO7 A;  4P1W A;  5HOD A;  1E3H A;  2YU3 A;  4QTR A;  3C18 A;  4E6K G;  4BE2 A;  4ABZ A;  4BHB A;  3OOU A;  5K1Y A;  3GVA A;  3OOP A;  5BQT A;  2OJE D;  4J19 A;  2HQR A;  3ROU A;  4ZDP A;  2IBD A;  4E7K A;  3S32 A;  5HDK A;  1X2N A;  4Y13 A;  2K9M A;  2XKP A;  3I0T A;  5J1Y A;  5BPD A;  2FOK A;  1ZK8 A;  4EEF G; 
#chains in the Genus database with same CATH homology
 2ID3 A;  3JRE A;  1JT6 A;  4JP0 A;  3GTQ J;  4IHY A;  4A69 C;  4BBS J;  2DMQ A;  3BTC A;  3IH4 A;  3BTI A;  1WH5 A;  1FEX A;  2HXI A;  3BR0 A;  4AC0 A;  5F08 A;  1PUF A;  2HI3 A;  2FQ4 A;  2FJ1 A;  3FIW A;  3HOX J;  2EH3 A;  3DCF A;  1IDY A;  2XGD A;  5EYR A;  1RES A;  4IEJ A;  2EZI A;  5J3L A;  3LSG A;  2DA2 A;  1ZGW A;  3HOZ J;  3M3Y J;  3RZO J;  3FIS A;  4FE7 A;  2HOT A;  1IGN A;  2Y2Z A;  2E2I J;  1F36 A;  3S15 J;  2YUS A;  1Z77 A;  1I50 J;  3MN2 A;  2O8K A;  5FLV A;  1IJW C;  2W48 A;  4BKX A;  3FK7 A;  3JRA A;  2O7O A;  5IPA A;  1OJL A;  3W6V A;  2DA1 A;  1RKT A;  4QSH A;  3NAU A;  1XG1 A;  5J1R A;  1W0T A;  1ETO A;  2ZB9 A;  4M3D A;  4Y7N J;  1Q1V A;  3WHC A;  4I6Z A;  2X6O A;  1MSE C;  3QQA A;  4I76 A;  3UKG A;  4FIS A;  2XGC A;  2ME0 A;  2NS8 A;  3S1Q J;  2L7Z A;  5IP7 J;  2KDZ A;  4D5C A;  5F04 A;  2WB1 N;  2AHQ A;  1JUP A;  4C3I J;  4W1U A;  3Q0W A;  4DYC A;  2IAI A;  4A3J J;  2LFB A;  3JRG A;  2R5Y B;  5JLX A;  2EBI A;  1U9O A;  3LSJ A;  1Y1V J;  3G1O A;  1A6I A;  2TRT A;  1FIA A;  2E19 A;  4LOC A;  1LFB A;  4BY1 J;  3JRC A;  5EGO B;  3FKI J;  1RPW A;  1TWA J;  3BG5 A;  2XPU A;  5C3E J;  3GTL J;  1TWG J;  2LK2 A;  3D1N I;  1JKR C;  1MBF A;  5M5W J;  3L1P A;  2LR8 A;  1PUF B;  3K7A J;  5M3M J;  1QRY A;  5GPA A;  1B8I B;  1BW5 A;  3JRD A;  3JRF A;  2JA5 J;  4IHV A;  2XB5 A;  1X58 A;  3I4M J;  5GP9 A;  4B3A A;  3MVP A;  1ZKG A;  2O9L A;  2D5V A;  5K7Z A;  3RQI A;  1QVT A;  1HCR A;  1MBJ A;  2XPV A;  3RZD J;  1YRN B;  2DMU A;  1TC3 C;  3HOY J;  4XIC A;  5EDN A;  2CRG A;  3A02 A;  5FKK A;  3OSG A;  5BNG A;  2FD5 A;  2WAQ N;  5DS9 A;  1MSF C;  2EQR A;  2Y30 A;  3RKQ A;  2Y9Z A;  2QF7 A;  3ZQG A;  2R7Z J;  5FJ8 J;  4A3G J;  1NK2 P;  1HF0 A;  4RDU A;  3PO3 J;  2DA7 A;  4RBO A;  1BW6 A;  2L7M P;  5EG0 B;  2K9S A;  4JX6 A;  1GVD A;  4M3E A;  4BXX J;  1Z0X A;  1BA5 A;  3BR1 A;  3IH3 A;  4L5E A;  2R5Y A;  1HLV A;  2PMZ N;  3JR9 A;  2YU9 J;  2DTZ A;  1BL0 A;  1Y1W J;  2H1K A;  1P7I A;  1HOM A;  4DZP A;  2K9N A;  2XRL A;  1K83 J;  4JYK A;  5EGO A;  1K61 A;  2OPT A;  1WI3 A;  3O8G A;  1MH4 A;  2R93 J;  2Y9Y A;  2HYJ A;  4XID A;  2VKV A;  2VI6 A;  3WHB A;  3IV5 A;  2K9Q A;  5C44 J;  2DMN A;  2QCO A;  4DYQ A;  1B8I A;  1RET A;  3BG9 A;  5EEA A;  2JA7 J;  1MBE A;  2MGQ A;  4A3B J;  1RKW A;  1GUU A;  5F0C A;  3S1R J;  3ZQL A;  1ZK8 A;  3HGG A;  3HM5 A;  1SFO J;  5EF6 A;  1DU0 A;  1WH7 A;  1H8A C;  1RR7 A;  1VND A;  4C2M J;  2CJJ A;  3BQZ A;  1NTC A;  1YRN A;  4V2G A;  3S17 J;  3GTG J;  2NVQ J;  2EZK A;  2HOA A;  1U78 A;  3OIO A;  1JUM A;  2CQQ A;  1OCP A;  4AUX A;  2LKX A;  2R92 J;  2XPW A;  2FX0 A;  4XRS A;  2KT0 A;  1ZR2 A;  3SDG A;  3ZQF A;  4S0H B;  2MSY A;  5EG0 A;  1CQT A;  4GFB A;  3LOC A;  2M34 A;  1W0U A;  2X9D A;  5E3O A;  2K40 A;  2RAE A;  1QPI A;  4HNV A;  3GTP J;  1LE8 B;  2JJ7 A;  1ZQ3 P;  1UG2 A;  2JWT A;  5IYD J;  1JJ6 C;  1GDT A;  3Q0U A;  3O8H A;  2XB0 X;  3ZQH A;  3M4O J;  5FKN A;  5F27 A;  4DZJ A;  2M0C A;  1VI0 A;  2DN0 A;  5IOY A;  1A5J A;  2CUE A;  3BTL A;  1JJ8 C;  5K7H A;  2GBY A;  5FKL A;  3GTO J;  4A3D J;  1E3O C;  5EZG A;  1SAN A;  4C3H J;  4A3E J;  2G0E A;  2L9R A;  1APL C;  1MBG A;  3Q0V A;  2N8G A;  1ITY A;  3GBG A;  1TWF J;  4BBR J;  1JT0 A;  3G1L A;  3TP3 A;  4IHW A;  5J1U A;  2LVS A;  2IEK A;  4M3B A;  1NK3 P;  1XC5 A;  4C3J J;  2B63 J;  1JKP C;  1WGX A;  1ZR4 A;  2JN6 A;  1IG7 A;  2GM4 A;  3S16 J;  4FE4 A;  2CUF A;  5E3N A;  3Q3S A;  2Y0S N;  4A3C J;  1POG A;  3H3V K;  1FTZ A;  5JLW A;  2NS7 A;  5F0H A;  1GV2 A;  1P7J A;  3S1N J;  1U8B A;  2E1O A;  3ZQI A;  3ZOB A;  4NDL A;  4UUS B;  1LE8 A;  1UMQ A;  1IDZ A;  4A93 J;  5F1J A;  2LLK A;  3GTK J;  3HDD A;  2ID6 A;  1BJZ A;  2XGE A;  1I3Q J;  5IP9 J;  3QPS A;  4D5F A;  5GPC A;  2LP0 A;  1H89 C;  2E2H J;  1ETQ A;  2OF7 A;  3HEF A;  3TP0 A;  1G2H A;  5K7F A;  2NVT J;  2JMW A;  3BR3 A;  4MLO A;  2CU7 A;  1LFU P;  2NVY J;  3ZQC A;  2LD5 A;  2DMT A;  3HBL A;  5C4J J;  4MFE A;  1B72 B;  4Y52 J;  3IH2 A;  4FCY A;  2DMP A;  3DEW A;  4B1R A;  1ZTR A;  1JGG A;  2LY9 A;  1ETW A;  2X48 A;  3HGY A;  3CCY A;  3TW6 A;  2COB A;  1AU7 A;  3S14 J;  1JUS A;  2MG4 A;  3LSP A;  3BR6 A;  1T56 A;  2AO9 A;  2R5Z B;  2DA6 A;  1IV6 A;  2L0K A;  3LSR A;  2NOG A;  1QVU A;  2JA8 J;  3A01 B;  1AKH B;  1MBK A;  4A3I J;  2VKE A;  5IP6 A;  1FJL A;  2P81 A;  4A3F J;  2VUM J;  4UUT A;  4FTH A;  2DA5 A;  1O4X A;  3G1M A;  1ETY A;  2I10 A;  2DJN A;  4DW6 A;  5IYC J;  1HDD C;  1MH3 A;  3E7L A;  2M2E A;  4UUS A;  5FKO A;  5M5X J;  3B6C A;  2DA3 A;  1ETX A;  3PM1 A;  2ME6 A;  3B6A A;  4IHX A;  1ETV A;  2TCT A;  3PO2 J;  5E3L A;  1JTY A;  4G12 A;  4M3G A;  4CYC B;  3JRI A;  4A3K J;  3BT9 A;  2EZH A;  4W97 A;  1S7E A;  2CQX A;  2ECC A;  5DTD A;  3CDL A;  2JK3 A;  1T33 A;  3TED A;  4A3M J;  1ETK A;  3VPR A;  1GT0 C;  3I4N J;  1JKQ C;  2H8R A;  1H88 C;  3HOV J;  4MIM A;  1FTT A;  1U9N A;  2R0Q C;  4XK4 A;  1B72 A;  3NAR A;  1XS9 A;  5IOZ A;  2M8G X;  4DYR A;  4BY7 J;  4B4C A;  3BR2 A;  3OSF A;  4AYB N;  1JKO C;  3S2H J;  5FKM A;  3HOU J;  1MBH A;  4JX5 A;  3CQZ J;  3S2D J;  2LTP A;  1EF4 A;  3BTJ A;  1OFC X;  2YS9 A;  4XRS G;  1VFC A;  4V2F A;  2R5Z A;  3JRH A;  4MFD A;  2Y31 A;  1HDP A;  2L7F P;  3MKL A;  3JRB A;  2NVX J;  5M5Y J;  3A01 A;  1AKH A;  2E2J J;  1X2M A;  1VF9 A;  1AHD P;  3BR5 A;  5EZH A;  4M6V A;  4X1E A;  1DU6 A;  4D7M A;  2HQ5 A;  4A3L J;  4JX4 A;  1F43 A;  1TWC J;  3GTJ J;  1IUF A;  1JTX A;  5M3F J;  1OCT C;  2MW8 A;  2ECB A;  3H0G J;  3K2A A;  5IYB J;  2JA6 J;  3S1M J;  4XRM A;  3HB9 A;  4CYC A;  1WCM J;  1ORK A;  3QPL A;  2HOS A;  1R9T J;  1MNM C;  1IC8 A;  3A03 A;  4M3F A;  1WPK A;  5FLM J;  1IRZ A;  3BG3 A;  3SJM A;  4QIW N;  1GV5 A;  3C2B A;  4D7N A;  1UHS A;  2HXO A;  4MO7 A;  3LNQ A;  3GTM J;  5HOD A;  2DA4 A;  4QTR A;  2GLO A;  2XSD C;  1ENH A;  2EZL A;  1I6H J;  5F0F A;  4ABZ A;  3FK6 A;  2VPR A;  3OOU A;  3CMY A;  5E3M A;  2ELK A;  3SFI A;  4X6A J;  4J19 A;  1D5Y A;  1TWH J;  2IBD A;  3HKZ N;  9ANT A;  3TW7 A;  1X2N A;  3F0C A;  5J1Y A;  2M9H A;  2WV1 A;  3HOW J;  5C4X J;  1FIP A;  2HDD A;  3BQY A;  4EEF G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...