1JGGA

Even-skipped homeodomain complexed to at-rich dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
57
structure length
57
Chain Sequence
RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*AP*AP*TP*TP*GP*AP*AP*TP*T)-3'
publication title Structure of the even-skipped homeodomain complexed to AT-rich DNA: new perspectives on homeodomain specificity.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 19
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jggA00
3HOYJ 2JK3A 2XPWA 2DMPA 1ITYA 2HI3A 3BR1A 1RETA 2XGEA 5FKNA 3MN2A 4D5FA 1GV2A 2PMZN 2LKXA 2HXOA 1IG7A 2MG4A 2L7ZA 1GV5A 3BR5A 1MBJA 4A3FJ 2JMWA 1JGGA 2EBIA 2DJNA 3RKQA 1HF0A 2HDDA 3H3VK 4JX5A 2G0EA 1U78A 1VFCA 2Y2ZA 4X6AJ 2CU7A 5GP9A 5M5WJ 3ZQCA 5C4XJ 3GTMJ 5FJ8J 3GTPJ 4C3JJ 2LD5A 4DW6A 4IHVA 3LNQA 5M5XJ 4W97A 1SFOJ 4XIDA 1ETYA 2X9DA 1SANA 2ECBA 1VI0A 2HOTA 1ETXA 1PUFB 1FIAA 4IHYA 4JYKA 3MVPA 1BJZA 5E3MA 4XK4A 5EZHA 3S1QJ 4A3GJ 2NS7A 3M4OJ 3A01B 4D7MA 5E3NA 1X58A 1H8AC 2CQQA 3TW6A 3CCYA 1A5JA 1OCPA 3PM1A 1AKHA 4M3BA 3HB9A 3W6VA 1RPWA 2WAQN 3FIWA 4MLOA 4A69C 3WHBA 3GTLJ 1BW6A 4BY7J 4A3EJ 2GBYA 4FCYA 2L0KA 3S2DJ 3RQIA 4A3CJ 2ELKA 4FISA 2Y30A 1G2HA 2YS9A 2R5ZA 1MBKA 4HNVA 3CQZJ 4MO7A 2LTPA 1W0TA 5M3FJ 5FKOA 2HXIA 3LSPA 2CJJA 3TW7A 5DTDA 5F08A 3QPLA 3BTLA 5EG0B 3GTOJ 2CRGA 5K7ZA 5E3OA 5IYBJ 1RR7A 2CUEA 1FIPA 1GT0C 3FK7A 2MGQA 3HGGA 5F0HA 4Y52J 2E2JJ 3H0GJ 1Q1VA 2XSDC 2R5YB 2DA5A 2OF7A 4FTHA 1F43A 1EF4A 1A6IA 1H89C 4M3EA 5EGOB 1JKOC 1GUUA 2R92J 4XICA 4I6ZA 3DEWA 3CDLA 4A93J 4C3HJ 2MW8A 2X6OA 1TC3C 2Y0SN 1U9OA 1MSEC 3RZOJ 2EH3A 4C2MJ 1PUFA 2DA3A 1IDYA 4XRSA 1IJWC 3IV5A 2ID3A 3G1LA 2E2IJ 4FE7A 1IUFA 3BTCA 2K40A 2XPVA 1JJ6C 2KT0A 2FJ1A 4LOCA 1ETQA 4IEJA 1JT0A 5IOZA 3JRGA 3QQAA 2NS8A 1ZK8A 2H8RA 2VKVA 4JX4A 1IDZA 2LY9A 1Z77A 2Y31A 4A3JJ 2RAEA 2ECCA 2M0CA 1P7IA 1XG1A 2L7MP 4L5EA 2X48A 1S7EA 2N8GA 2XRLA 1ENHA 2HQ5A 1WH5A 4UUSB 3HOZJ 2Y9ZA 4IHXA 5C3EJ 1E3OC 3Q3SA 1OCTC 3ZOBA 1FJLA 2XB5A 1AU7A 4V2FA 4A3LJ 1I6HJ 5EG0A 3BG5A 3SJMA 3DCFA 3NAUA 1ZR4A 1X2NA 2B63J 5F0CA 2H1KA 3S1RJ 3UKGA 4A3BJ 3S17J 4J19A 2XB0X 3M3YJ 2COBA 4BKXA 5C4JJ 2R5YA 4D5CA 1ZQ3P 4Y7NJ 1WI3A 1UG2A 2QCOA 2TRTA 5J1RA 3K7AJ 4AYBN 2K9SA 2O7OA 4QSHA 1DU6A 4M6VA 1IV6A 2JA6J 1BA5A 5K7FA 2GLOA 3K2AA 1YRNB 2JA8J 5F04A 4AUXA 2LVSA 3ZQFA 4QIWN 3GTQJ 2L9RA 1MH3A 2AO9A 4M3FA 1IRZA 4JX6A 1JUMA 2ME0A 2JJ7A 4UUTA 3O8HA 3HM5A 1Z0XA 1GVDA 5JLWA 3JRBA 1U9NA 2DMQA 2R93J 5IPAA 4BY1J 2DA6A 1FEXA 1UHSA 2VUMJ 5F1JA 3FISA 3SFIA 3TP0A 1LFUP 1FTTA 2LLKA 3BR2A 3BQZA 4B3AA 3JRDA 4W1UA 4M3GA 1WGXA 1JKRC 4UUSA 1ZR2A 3I4MJ 1TWHJ 1T56A 4RDUA 3HEFA 2TCTA 1ETVA 1P7JA 4DYQA 3HOUJ 3IH3A 5FKKA 3GTGJ 4DZPA 1X2MA 3BR0A 2NVXJ 5HODA 1ZTRA 2KDZA 2HOAA 4JP0A 2EZIA 5J1UA 3HGYA 1BL0A 1HCRA 1FTZA 3BG3A 2DTZA 5J3LA 2DMNA 3IH2A 1XC5A 4M3DA 4DYCA 4B4CA 2M8GX 5C44J 4A3MJ 3VPRA 2I10A 1B8IB 1IGNA 4CYCB 1WH7A 1TWFJ 2LP0A 1K61A 3HDDA 3PO3J 3BR3A 2DMUA 3ZQLA 5IYCJ 3BG9A 3B6AA 3ZQIA 1B72B 2DA2A 3RZDJ 4AC0A 3Q0UA 3A01A 1YRNA 2ID6A 1APLC 2NOGA 3S14J 4A3DJ 2O8KA 4MIMA 4FE4A 2R0QC 2JN6A 2AHQA 3E7LA 3TP3A 3S15J 3F0CA 3JRFA 1ZKGA 2M2EA 3LSJA 3JR9A 1RESA 4V2GA 1W0UA 1H88C 5GPCA 4D7NA 4BXXJ 3S16J 1UMQA 5FLMJ 3OIOA 3ZQGA 3L1PA 1JKQC 5GPAA 3JRHA 1HDPA 2DN0A 5EZGA 3BR6A 3BTIA 1MBFA 3LSGA 2WV1A 2ZB9A 5JLXA 1I3QJ 2Y9YA 2R7ZJ 3MKLA 3A03A 5EDNA 2LK2A 5M5YJ 2VPRA 5F27A 5FLVA 1RKTA 5IYDJ 1LFBA 1T33A 2FX0A 3PO2J 1JJ8C 3NARA 2NVQJ 1LE8B 1XS9A 2YU9J 2DA4A 4G12A 1BW5A 2EQRA 3CMYA 3IH4A 4EEFG 1JT6A 3B6CA 3TEDA 2EZKA 5FKLA 2JA7J 2IBDA 3LOCA 3Q0WA 4QTRA 5DS9A 5EGOA 2WB1N 2CQXA 1Y1WJ 3S2HJ 1IC8A 1MSFC 1MBHA 4DYRA 4B1RA 4MFEA 2HYJA 4BBRJ 2MSYA 2E1OA 4GFBA 1HLVA 1QVTA 1Y1VJ 4MFDA 4X1EA 3QPSA 1TWCJ 5EEAA 1HOMA 3OOUA 1I50J 1MBGA 3A02A 5IP7J 3BT9A 1B8IA 1JUSA 4CYCA 1K83J 2CUFA 5E3LA 4DZJA 3BQYA 2JWTA 2M34A 3BTJA 2IEKA 1RKWA 1B72A 2NVTJ 2K9QA 2M9HA 1GDTA 2DMTA 3I4NJ 4A3IJ 1JUPA 2XGCA 2LFBA 1ETWA 1CQTA 5EYRA 2JA5J 1U8BA 1TWAJ 3GTJJ 3LSRA 2K9NA 4A3KJ 1WPKA 1POGA 2YUSA 2D5VA 1VNDA 1QRYA 3D1NI 1JTYA 1O4XA 2VKEA 1MNMC 1DU0A 2E19A 1VF9A 2E2HJ 2EZLA 2QF7A 3WHCA 5IP6A 1D5YA 5EF6A 1OJLA 2NVYJ 2XGDA 1QVUA 1OFCX 3GBGA 2XPUA 3G1OA 1WCMJ 3JRIA 1ORKA 2W48A 2DA1A 2LR8A 1JKPC 4C3IJ 5IP9J 3HOXJ 1JTXA 1NK3P 1QPIA 1AHDP 4NDLA 3O8GA 1F36A 5FKMA 3ZQHA 3OSGA 3OSFA 3Q0VA 3SDGA 2IAIA 5BNGA 3JREA 1HDDC 1LE8A 2GM4A 3GTKJ 3FKIJ 3JRAA 3C2BA 4I76A 2OPTA 3G1MA 4IHWA 3JRCA 9ANTA 1ETOA 2FQ4A 1ETKA 5J1YA 4ABZA 2L7FP 5K7HA 2FD5A 1MBEA 3FK6A 2O9LA 1NTCA 2VI6A 5IOYA 4BBSJ 2HOSA 2ME6A 2P81A 1AKHB 1ZGWA 5M3MJ 3HKZN 3S1NJ 4RBOA 1TWGJ 4S0HB 1NK2P 1R9TJ 3HOVJ 4XRSG 2DA7A 4XRMA 2R5ZB 2EZHA 5F0FA 1MH4A 3HBLA 3HOWJ 3S1MJ
chains in the Genus database with same CATH superfamily
1JE8A 5GTHC 2XPWA 3VYTB 2DMPA 2IGNA 2QEXI 3BR1A 4D5FA 3J81K 1V5EA 3DPTA 2LKXA 1K6YA 3AAFA 5HDKA 1JGGA 4A3FJ 2JMWA 3HG9A 3ONQA 3RKQA 1HF0A 4RLQA 2G0EA 1U78A 2VC0A 1ZG3A 1W4MA 1P4WA 5GP9A 4FX0A 1ZGAA 2FRHA 3J7AO 3T8RA 4IHTA 3GTMJ 2WA0A 5J8FA 4C3JJ 2LD5A 4IHVA 4P55A 4UV9A 5L3FA 4XSZF 4XIDA 3JAMZ 2X9DA 2L5QA 2F4MB 4XN0A 2HOTA 2DXIA 1R49A 3FX3A 4LIUA 1ETXA 4AIDA 4IHYA 4JYKA 3MVPA 1BJZA 1DUXC 2K5CA 5E3MA 2BVMA 3P5JA 4A3GJ 2H6BA 4HRIA 1E3HA 3OYAA 3M4OJ 3EDPA 2FOKA 2H8WA 5FRNA 3J7AY 1H8AC 1OCRH 3TW6A 1A5JA 4M3BA 3HB9A 2BEOA 3G2BA 2H94A 4DBRA 3EUHC 4IJAA 4A69C 4LGWA 3GTLJ 1FNNA 4XLEA 2VQCA 1VQ5I 1S6LA 4BY7J 4QLCU 4XLNF 1R22A 3RQIA 2V6EA 1W5SA 2ELKA 3BJAA 4FISA 2GQQA 4U0VA 2R5ZA 2AXLA 2NNNA 1YOVB 2BY0A 2HR3A 1O3RA 1VQKI 1D8KA 1UFMA 3FXMA 3NWTA 4Y15A 4LFUA 2X6XA 2CJJA 4PJ0C 3LSPA 2E5NA 1F4KA 3TW7A 2QZ8A 5EEHA 1A6QA 2R7XA 5F08A 3QPLA 2L4AA 2VBZA 2BXZA 1OYYA 3QU6A 5EG0B 5A2QZ 3HOSA 5E3OA 4EATA 4ZH4F 4G6QA 1RR7A 2BW3B 1YTYA 2DOFA 3J80Z 5F0HA 4AD9A 3HTSB 2VODA 1Q1VA 2DFIA 1O7FA 5D6EA 1TZLA 2KDOA 4CCOA 2V4JC 3KZZA 4BXUA 2CW0F 3P9IA 2PQ8A 1F43A 1E2XA 5B5EC 1EF4A 1WJ5A 2M87A 4V19K 1SEUA 2OTLI 3TGNA 1R00A 1YW9A 1R1VA 5HLTA 1WZ2A 4ENKA 1GUUA 4PSWA 1VQNI 3V42A 1SC7A 1BI1A 1SD6A 3W2VA 4E7IA 3GZ5A 1ZELA 4O5VA 4XMYA 3IRQA 3G3ZA 1TC3C 2Y0SN 4LMYA 2DPDA 4BJ5C 1U9OA 2EH3A 4XNFA 4P96A 4XRSA 4ZTJA 3G1LA 3QYFA 3QODA 2M7AA 2F2EA 3KP6A 4BL0B 3FBNB 2EFNA 2XPVA 2ELJA 2LF8A 4XBFA 2FJ1A 2KP6A 3K10A 3JRGA 2NS8A 1ZK8A 4I99C 2CFXA 1KU2A 4JX4A 3DBHB 3G71I 1J7KA 4M9SA 2Y31A 2EINH 2E71A 2WY7Q 3N97A 5FFZA 2XRLA 1S7AA 1IF1A 1IO2A 1ODDA 3V7CA 3ZMZA 5D4RA 2STWA 2MC3A 1TT5B 3GW2A 3RCOA 5E8IA 3CJNA 5C3EJ 1T0FC 2V1UA 1HXDA 3RKXA 3ZOBA 1FJLA 3BWGA 1RC9A 2EFQA 1LVKA 4G7HF 3S3MA 4RM3A 5KAFC 4XOTA 3MQ0A 4HNTA 3DCFA 2R7UA 1LDJA 4OMZA 3SZPA 1O7LA 1HBXG 1PDNC 1ZGJA 2FBHA 3UKGA 3A1YA 4TV7A 4A3BJ 1B4AA 3ML6A 1BI3A 3M3YJ 2DJIA 2E5ZA 1OKRA 4B44A 1ZQ3P 3DFGA 1I1GA 1UG2A 2W00A 2LG4A 2X6YA 2BBYA 2TRTA 3B02A 4K2EA 4BHBA 1G4DA 2QSFX 1IXCA 3K7AJ 3R0JA 4AYBN 3L09A 2FEZA 2A6HF 2K9MA 2K9SA 2IXSA 5B1BH 4QSHA 4F3QA 3EPZA 4HLXA 1VQ8I 1BA5A 3UR3C 3OYEA 2X1CA 1G3YA 1XTAA 1EH7A 3K2AA 1YRNB 4ZTFA 2X4HA 4UB6C 5GAGJ 5F04A 2LBFB 3ZQFA 3GTQJ 2IA2A 2K4JA 3DP7A 3J7YJ 1IRZA 2LNBA 5E1XA 4PZJA 2E35A 4F7ZA 3F8BA 4BNCA 3CUOA 2JPCA 4UUTA 2LSOA 1RRJA 3JRBA 2DMQA 5BPDA 1P92A 5F64A 2FUG2 1QU3A 4BY1J 4MNUA 2DA6A 2H09A 3LSHA 2VUMJ 2ESNA 1L3LA 4HX4A 2KRFA 3CMMA 3TP0A 1ON1A 3WTXC 1FTTA 4I0AA 4CCLA 2NNYA 4XSXF 2IGMA 2GOMA 3Q9VA 2JRTA 2L9SA 2NS0A 1AWCA 1TNSA 4ZZLA 1K4SA 3I4MJ 2MH9A 5D5UB 1DGWY 2EFOA 1TWHJ 2PFBA 5LFAA 1T56A 4EJTA 2A5YB 2ZXJA 1YO5C 2KQRA 4XONA 2RC4A 3S2WA 4Z2YA 1OYWA 2MC4A 3DKXA 4DYQA 2XDVA 3HOUJ 1FP2A 1KYZA 2MH2A 3IH3A 3MZYA 4Q48A 4RM2A 1T8IA 4CA0A 1X2MA 4EQQA 2NVXJ 2V1DA 3DWLE 2WWYA 4HDVA 3W3CA 2EZIA 2V9KA 1LFPA 4HF2A 4JQFA 2DMNA 4UXNA 3PL8A 3E1SA 2VJJA 4DYCA 3K4NA 3VPRA 1TWFJ 4Y13A 1LDDA 1FBUA 3BR3A 1VQ9I 1X1BA 3ZQLA 2X1EA 4KIBA 4ZYHA 3B6AA 3R6SA 1D0ZA 2DA2A 4XLPF 2R4GA 1ZYRF 3J81Z 2EJRA 2OV7A 4ENJA 2W85A 3ERMA 4A3DJ 3M9AA 5ERIA 1P6RA 2H1LA 2VASA 1D8JA 1SVOA 3QOPA 3TP3A 3S15J 2EWNA 1FOWA 4XORA 1N25A 3RYPA 3H35A 3JTGA 3M1CA 3ZQQA 2YPRA 4BAYA 4ZYDA 1RESA 1VQMI 4NC7A 1USTA 5IT9K 3S16J 1UMQA 1YJWI 2HYGD 2MBFA 4ZJZA 4G8XA 4CDGA 5DCFA 4CZZA 3JRHA 3K70D 3G4SI 1HDPA 4IVNA 4KUMA 3LSGA 2KIQA 3BTIA 5JLXA 1I3QJ 3IL2A 1V4RA 4GYIA 3FHNA 1R71A 4G7ZF 5FLVA 1IRGA 5FROA 1T33A 2BV6A 3X2QH 3MMYB 4EM1A 2KZGA 4RB1A 1JJ8C 2Z5UA 5DM7F 1FSEA 1R7JA 3SZGA 1FOXA 3IC7A 2EB7A 4G12A 3CMYA 1P4AA 4EEFG 3H1CA 3ABTA 1BN5A 1FWZA 2X0LA 2PJRA 4IRGA 1F1ZA 3PFYA 1MDMA 2ZSIB 1MBHA 1XMKA 4F55A 3QRFF 4G6TB 2VOPA 4MFEA 4BBRJ 2MSYA 4GFBA 1SVLA 2DFEA 3H5AA 3NWSA 4X1EA 2ZO4A 1MNEA 3OOUA 1I50J 1QZZA 2FA5A 2AQEA 4ZZDA 3LAPA 1QQIA 5TGTA 4EGYA 4EVIA 5JHUA 4DZJA 3BQYA 4E7SA 2W1OA 2JWTA 2M34A 3BTJA 4FHTA 4CZCA 3HC7A 2B7EA 3I55I 1Z3YA 4I98B 1PUEE 2Y69H 2XGCA 3VSLA 2XASA 2LFBA 4RAYA 1U8BA 3JAMK 4IZZA 1JI8A 4ETSA 4A3KJ 4Q5SF 1POGA 2YUSA 2JVGA 5D8KB 2D5VA 4R8HA 2M3AA 4QPOA 5E1ZB 2V6CA 4GDFA 5K1YA 1TQMA 4A5MA 2JVHA 4LB5A 3OS1A 5BMZA 4HV5A 5EF6A 1LDKB 2PMHA 2DU9A 1B6AA 2E36A 1WCMJ 1YJ9I 2NOJB 3T8TA 4IQ4A 3FXUA 1BOBA 3KCCA 4XKVA 2LR8A 3WU1B 2QBYB 4XR6A 2K7LA 1BC7C 3O8GA 3WG7H 1O57A 1EV7A 4CUGA 1PJRA 4LD5A 2PG4A 1YX3A 2KISA 1WI9A 2WADA 1VQ7I 1QPMA 4HX7A 3JREA 3ABLH 4L9JA 1XSVA 3GTKJ 2GXBA 2ZXIA 1YYVA 1D1AA 4ESFA 3C2GA 3KE2A 4I76A 4A6DA 3HSFA 5A2QK 1KQ0A 2EIJH 4CICA 1ETOA 3LL7A 4UV8A 1Y0UA 2CWEA 3J80K 1ETKA 4LK1F 1MNDA 1UELB 2X51A 4M6YA 2DK8A 3MCZA 2XKOA 3EYYA 3FMQA 2VI6A 3L2RA 5BPIA 3DPUA 1YI2I 3LSMA 1UAAA 2OTJI 2F5EA 3GFJA 4CH7A 2HOSA 1ON2A 3OYIA 1AKHB 2Z99A 1YG2A 4HA8A 3P9KA 4HF1A 3RYRA 3WTZA 4S0HB 2GA1A 1R9TJ 3MKYB 4XRMA 3AG4H 3VYSB 3D5LA 3CO6C 2OZ6A 1R4MB 3FKJA 4MEYF 1I5ZA 2VBYA 3TOAA 2XAQA 3TKYA 5HOOA 2R7DA 2PLYA 2KIFA 1X19A 2CO5A 5LGNA 2UWMA 2HI3A 3LA7A 3MN2A 3DQVC 3KEYA 2PMZN 3KP2A 5CVIA 4M74A 3DLAA 2QQ8A 1GV5A 2MABA 2UXNA 3I59A 3M8FA 2ETHA 2P5KA 4JX5A 4WCGA 1MIJA 3L7WA 4KYWA 3HRTA 5BS6A 4XOPA 2H27A 2R7SA 3LAJA 4Y33A 2FOWA 1Z3XA 3ZQCA 3ZXSA 4YIIA 2XAHA 1UB9A 2FBIA 3RI4A 1Z1DA 1USSA 2O5RA 1NH3A 1G3WA 4PK4A 2XF7A 2XAJA 3DLLF 1ETYA 2R7WA 3W6JB 1U5TA 2IS2A 1XMAA 3A4CA 3HHHA 1PUFB 5HS9A 2HEOA 3KYLA 4RMNA 2BY1A 4XK4A 5EZHA 1TQIA 1X4PA 2HDWA 2NS7A 2OZUA 3BPXA 4KIFA 1XPXA 1X1PA 4D7MA 4B48A 3KYCB 3HPHA 3CCYA 4G7OF 1OCPA 3HYIA 1ZARA 2BZTA 1VTNC 1RPWA 5B66C 3W6VA 2WAQN 3DU6A 4OOIA 3ROUA 2CMPA 3H0DA 2PMUA 1ZLJA 2GBYA 4A3EJ 1K7AA 2L0KA 4BQOA 2QM3A 3MKWB 4A3CJ 2M8EA 2WAFA 2VQLA 2Y30A 3WG9A 3K4KA 1MBKA 1VQPI 4I2OA 3CQZJ 5FKOA 3IUOA 1XGOA 1L0OC 4RA2A 1DGRM 3GWZA 3I9V2 3OYKA 2AQFA 2EV5A 4HQMA 4BXFA 3MAJA 3FDYA 4A5NA 3P9CA 3GTOJ 5K7ZA 3CDHA 4QWQA 1TTYA 1V3FA 1RR8C 2L4MA 4A6EA 1GT0C 1UHWA 3HGGA 3JW4A 3U9GA 3E5UA 2E2JJ 4U7BA 3K1NA 1IXRC 3R61A 5D5VB 2WAEA 3I64A 3CD6I 2XSDC 3GXOA 2DCEA 2OCEA 2OF7A 2Q2EB 2DBBA 2GWRA 4IHSA 4E7ZA 2EIMH 2ZKZA 4BE2A 1H89C 4EM0B 2HQNA 2BHZA 3PUBA 1UZCA 3VYRB 4EJOA 3CCMI 1A36A 1WVRA 2ZBKA 1R6RA 5LRRA 2R92J 4XICA 5KVRA 4II2A 4CO8A 4WXDA 4CGZA 4C3HJ 4YFNF 1I27A 5K5RA 2DYSH 5GTIC 4RGXA 4IO9F 2NXNB 4GO1A 1JHHA 4C2MJ 4HNUA 2WBMA 1IDYA 4GGGA 1IJWC 3EUAA 4H0EA 3FXKA 2O61A 1YJNI 3V7SA 2RNJA 3BTCA 5L3EA 1XB4A 1JJ6C 2FF4A 5DD4A 2CUJA 1JT0A 5IOZA 2F5DA 5GADJ 1R36A 4IRHA 2D45A 1XN7A 4A3JJ 2M0CA 4AIKA 5LHGA 1P7IA 1EJ9A 2L7MP 2LMDA 4EJWA 2X48A 4CHUA 2N8GA 5FGMA 4UUSB 2Y9ZA 5HNHA 2QLZA 4JBAA 2CUZA 3OS0A 3ZN0A 2ISYA 1OCTC 3GFMA 4PSXA 2BGCA 3OYBA 1AU7A 3LSTA 2X1DA 2GAUA 4V2FA 3MKZA 1V54H 3BG5A 5D5WB 2P5VA 2LYCA 3NAUA 5AIQA 2W4SA 1MMGA 3RJPA 5F0CA 2B63J 3S1RJ 3BZ6A 1WSUA 4CSWA 4HOBA 1ZG5A 2G9WA 1PVEA 3E3VA 3V4GA 3GCMA 1P4XA 5C4JJ 3CP8A 2R5YA 1SFUA 2VQHA 2W25A 1WI3A 3ECHA 5F1RA 2W57A 4FETA 3U1DA 2A68F 1MJBA 5D6FA 1DQUA 4BUPA 2STTA 3VOEA 4IXAA 3QP5A 5DCMB 3V7RA 5J1RA 1IN8A 2QYOA 4L9TA 1C0WA 2O7OA 3KLNA 4M6VA 2NRAC 2LF7A 5GAEJ 5K7FA 2GLOA 2YX7A 3COAC 2JA8J 4AUXA 4J00A 1OR7A 2ESHA 2VKDA 4ASNA 5LD2C 2A69F 4FASD 4M3FA 1J59A 2XVCA 5ED4A 3PNVA 4RGUA 2ZC2A 2XROA 3HM5A 2XRNA 3H5NA 2IA1A 4CXFA 1BM9A 2IT0A 2OQRA 2UV1A 5IPAA 4ENNA 1UHSA 5F1JA 4A12A 3FISA 1MKMA 4D1QA 3SFIA 4NQWA 5JVTA 1B9MA 2IGKA 4FT8A 2ZMEA 3BQZA 2FE3A 3HUGA 4M3GA 3ASOH 3ULQB 1T39A 4PCQA 4P1WA 2NVUB 2JUGA 3CTAA 2YU3A 1ZR2A 4FX4A 2TCTA 2KPMA 3CCSI 3K9TA 3V8JA 2CV2A 2XAUA 2YSRA 4NNJA 3K6GA 1REPC 3OYNA 3QWLA 1HQCA 1MD0A 4EJVA 5HLHA 1HSJA 1ZTRA 3L2WA 2KDZA 2HOAA 3QYBA 4JP0A 3HSRA 4JOMA 4EGZA 1BL0A 2DTZA 5J3LA 5J40A 1XC5A 4M3DA 4C9YA 2WB1A 3SHFA 1X1AA 1H9TA 3K2ZA 4U87A 3OOPA 4U7DA 5ILVA 1B8IB 1WJFA 1WH7A 1K61A 1OCCH 3PO3J 1DPRA 2DMUA 5IYCJ 2P7VB 3BG9A 2E1NA 2XHKA 3RZDJ 2E34A 3Q0UA 4IPAA 5DUIA 5K5QA 4HF0A 1W5TA 3CESA 4LLLA 3JSOA 2DT6A 3BZKA 2LKSA 4FE4A 2R0QC 2DOEA 3KP3A 2KJBA 3F23A 3F0CA 4DBQA 4EV0A 4LLGF 3AG2H 4BXXJ 1FT9A 1KU3A 2CSOA 4CCJA 3ZQGA 1Y39A 5L3BA 1JKQC 1LJ9A 1E0EA 2W24A 1PYVA 2DLLA 2PX9A 1MBFA 1EKEA 2HDCA 2QKMB 4YIRX 2R7ZJ 2ZCWA 4CCKA 2WTEA 3MKLA 3PJRA 5FLXK 5JFRA 3JSPA 4LG0A 1W7PB 4UY8I 1RKTA 2FX0A 4YFKF 3MEXA 3PO2J 2XF5A 4PFOA 3SZTA 1D5VA 4UNOA 1SD7A 2DQLA 2O0YA 2K27A 3NARA 3WODF 1IAWA 3CUQA 1VQLI 2NVQJ 4XM3A 2G7HA 2IP2A 3A0BC 1JT6A 3B6CA 3DV8A 3OWTA 2EZKA 5E17F 3F9KA 2QQ9A 1ZH5A 1DPUA 1LKXA 5EGOA 2CQXA 4RGRA 1QZEA 1MSFC 4KICA 4DYRA 4B1RA 2IJLA 4ZYEA 3PIOF 2JSPA 2RQPA 3HHGA 1WHUA 2P4WA 3CZ6A 1QVTA 1Y1VJ 3GYHX 4CCNA 1FOKA 3DKYA 1TWCJ 3L00A 3W2AA 1WKMA 3A02A 3G73A 5IP7J 3ZCOA 3BT9A 5BQTA 1N77A 4CYCA 2L2OA 4RS8A 2HOEA 4BQAA 2JRMA 4WXCA 3TO9A 1CF7A 1IZ1A 5CJ9A 1WJEA 1B72A 2K9QA 4M71A 5AIPA 1K78A 3OYJA 1BOAA 2EIKH 2Z33A 4HQEA 1ETWA 5L3GA 5EYRA 3E6CC 2Z9OA 1TWAJ 3ASNH 3FXRA 2K9NA 1XX5A 3RSNA 2CGPA 1X3ZB 1VNDA 1YE9A 4NC6A 2HGCA 3D1NI 1SFXA 2VKEA 2F5FA 2VB6A 4GXOA 4KT5C 3H9JA 1WFXA 1LB2A 2QF7A 3WHCA 3H9GA 1D5YA 4U88A 3FMRA 1FX7A 2XGDA 1QVUA 3HRMA 1BBYA 1FP1D 3ABKH 2D2WA 3G1OA 3KEQA 3G6EI 1WRJA 2CFOA 3IWFA 2DQRA 2DA1A 3GUDA 1NK3P 1YLFA 3AG3H 1D3YA 4NDLA 3R4KA 3F8FA 5K5OA 2UUZA 1IV8A 1EH6A 2BE5F 5TJJA 3ZMTA 4E7KA 3K4MA 2L3DA 4BU2A 1LE8A 5CPRB 3TO6A 3C2BA 5HLIA 2E7XA 2OPTA 3FF5A 5H2FC 1T38A 5EEGA 4BQNA 5HS8A 3G1MA 4KDPA 4YFXF 3T1BA 9ANTA 5LGUA 1Z7UA 1GVJA 1YITI 4BEHA 3RTRA 3CCUI 3L2QA 3WTYC 4NBQA 2QENA 2BHYA 4RLFA 4L0ZB 2ICWG 3GO5A 1OQYA 3I3LA 1BIBA 3HRSA 5ICFA 4OMYA 1OYIA 2XAFA 2ME6A 4ON0A 2P81A 5J4YA 1HW2A 3MZHA 4KA4A 4RB3C 4ZDLA 1R1TA 3DTEA 2VQGA 4Z6YA 3O6BB 3RPUD 1NK2P 2HWVA 4AVZA 1ZLKA 1FC3A 4IF4A 2ZFWA 2F48A 2ZJPF 2R5ZB 2BOLA 2R7RA 3HOWJ 3VYUB 3S1MJ 3DTIA 2JK3A 2OD5A 4C30A 3OL3A 3ISPA 3K4CA 3L2CA 2IA0A 2M0MA 3BC8A 3ZMUA 3OY9A 4IX7A 1Z9CA 1RIOH 4H4KC 1RETA 2RN7A 3E0JB 4ANJA 3IWZA 1LPQA 2MYSA 4B8XA 2A6EF 4Y17A 2DFHA 2MD0A 3LMMA 2C6YA 1IG7A 2MG4A 2Y48A 2L7ZA 3WE3A 1X3UA 4LB6B 3VODA 3V8KA 2HYFA 2OC6A 3EETA 3J7ZI 5LRSA 1VFCA 1LEAA 1QHHD 2DK5A 4MEXF 1RUNA 2Z2SB 1T2KA 4F92B 2ZSHB 2HZTA 2L01A 2QSHX 2DAOA 2JUCA 3PQKA 1SFKA 5BOXA 3IKTA 3QYEA 1PP8F 2EA2A 5FJ8J 4U0WA 2Z3YA 3GTPJ 4L9VA 2A6TA 1Q1HA 1MJAA 2EV0A 3FM3A 3E5XA 1OR7C 4W97A 3OYGA 1SFOJ 1SANA 2CH0A 2QQAA 4BS9A 2ECBA 1VI0A 3K69A 3KPHA 1ZRCA 2JQ7A 3CP2A 4XKBA 2AS5F 2V1XA 2VJ5A 1D1BA 4CCMA 3QOEA 4RAGA 4OIPF 5E8GA 4I02A 2Q8KA 3BLYA 2KZVA 2KIMA 2VT3A 3Q5FA 3TOBA 5LEJA 1HKQA 5TRDA 2CQQA 2AXTC 1ZG1A 2QKLB 4KFCA 3IAS2 1Z6RA 1YFHA 5EJCA 4B09A 3L9FA 4I0BA 4FCYA 3RKYA 3ZQ7A 2YS9A 2K86A 1RUOA 1IW7F 3NRVA 3I56I 2Q1ZB 1N78A 3VFZA 2ZXHA 3WGGA 2LTPA 2IPQX 1W0TA 2K85A 2HXIA 2ZJQF 4EMSA 1HKTA 2GA2A 1R5HA 3RQ4A 3BTLA 4HW0A 4BJ6C 4WK8F 3EUHA 4NHJA 2CRGA 5E79C 2M30A 5IYBJ 1SAXA 1I39A 5J8CA 2HZDA 2B9SA 2MGQA 5CQGA 3H0GJ 2P5LC 2ACJA 2P8TA 3IHUA 3OIQA 2CV1A 1UJ8A 3F8MA 4OIRF 4OAYA 4KITB 2DA5A 4YEJA 1A6IA 1P9QC 4M3EA 1U3EM 3HTUA 2JPBA 4M73A 3VDXA 2CW8A 5EGOB 2OJED 5LHHA 1JKOC 1BR4A 4PGHA 5HDGA 1X1DA 2F6CA 2QA4I 2D1VA 3DEWA 3CDLA 1J0RA 3BJOA 1HW1A 2X6OA 1J9IA 1RZ4A 2OU2A 2P7CB 2YR2A 4L0YB 2M4KA 1QBJA 2DA3A 5FLXZ 2KMUA 3QU3A 3SEZA 2ID3A 4OIOF 3FXOA 4FE7A 2HFHA 3CCRI 2K40A 1V5GA 1IRXA 2O3FA 5AONA 2HTJA 3F8CA 3U2RA 2KRCA 2G7UA 3HIFA 4DOZA 1B9NA 4LOCA 1IUYA 4IEJA 3BG6A 5DEQA 2L7KA 3QQAA 2H8RA 2VKVA 4LG3A 2DT5A 1IDZA 1STZA 3SQNA 2LY9A 1KA8A 3OL4A 1XCVA 2BXYA 4ENMA 1A35A 2Y0MA 1SMYF 1YIJI 1FYKA 3D5SC 3ZRGA 1ENHA 3CC2I 2COMA 3BZCA 5DYMA 3LA2A 3QAHA 1E3OC 3Q3SA 3HJEA 4IQJA 2JZYA 2LREA 2XB5A 4XRFA 4RGSA 4D0PA 4I01A 1ERDA 5EG0A 4BE0A 3SJMA 1ZR4A 1ZHFA 2H1KA 2BW3A 2VE8A 3C2HA 2OQGA 4A0YA 4AVPA 5HLGA 2MLGA 4X0GA 1IN6A 1ACIA 3OV8A 2V7FA 4J19A 2XB0X 2L02A 2VN2A 4HV6A 2CG4A 1T0FA 1YS7A 2GZWA 1J09A 4PDKA 3QP6A 1W36C 4RB0A 2DOAA 4B47A 4II3A 3FXQA 4OAZA 1DU6A 3QPTA 5CVVA 1IV6A 4MTDA 3N05A 5LHIA 4DIQA 1WJAA 4KT6A 1AOYA 3CLOA 2LVSA 4KN7X 5JVGF 2HVQA 2L9RA 1VQ6I 2IS4A 2AO9A 1ZRDA 1WJBA 4JX6A 1FPQA 1X1CA 4I09A 3HZJA 2CV0A 5B3SH 5L3CA 2ME0A 1XD7A 2JJ7A 3O8HA 1Z0XA 1GVDA 4LJZF 4CYDA 1U9NA 1MMNA 2P6TA 3LQQA 2R7VA 1CGPA 1S29A 3CMAI 2B0LA 4F91B 1ZRFA 4YELA 4UUVA 1W1WE 2BYVE 3ABUA 3ZN1A 2VJ4A 3GMEA 2J5OA 3OYLA 1NG7A 2LOOA 2LLKA 3BR2A 3KZIC 4S05A 2TDXA 3JRDA 2VXDA 3IAM2 2GIZA 4DGWB 3LWFA 3REOA 1E17A 1IN4A 4KMFA 1ZAOA 1J2XA 2E1CA 3MZ8A 3H3UA 4E7HA 2GIVA 3HEFA 1FMWA 1XGSA 1GHCA 1P7JA 3T0YA 5FB2A 3HOTA 3ZPLA 3PSIA 2VPLA 1QHGA 1I3AA 1X4OA 2LH9A 2O6GE 2PJRB 3BR0A 4HAMA 2JSCA 3KETA 1MDMB 1HC8A 1S3JA 2PEXA 3D5RC 2CQKA 1TL8A 2K3FA 3ZGKA 5KHDA 5C44J 4B4CA 4A3MJ 4BE1A 3RPQA 4F52A 2BY3A 1H0MA 1IGNA 3N4MA 3HDDA 4PJLA 2LRDA 2M4GA 2V9VA 3WTTC 4G9YA 1FYMA 4BHCA 2Z1DA 2DW4A 3BP8A 4AC0A 1U6GA 4E70A 3A01A 1FMVA 2XIGA 1YRNA 2WY8Q 3BCBA 1APLC 3RPUA 2EFPA 2PI0A 3S14J 2LBFA 2HPMA 4GCVA 2RGVA 1UG0A 4B3XA 5E20A 2KRHA 2XGXA 4HPQA 2KKOA 2VIXA 3LSJA 3JR9A 3TMOA 1BI2A 1S8NA 2FNAA 2KIUA 2L9NA 2V26A 3OR1C 4D7NA 1YX5A 5FLMJ 3CC7I 1FYLA 4WX9A 1GXPA 2PJPA 5ILSA 4HBLA 5GPAA 3U1KA 4I7HA 3I5UA 4MQVA 2DN0A 2P6SA 1Z6TA 3BR6A 1KONA 2ZB9A 3P7NA 3FBIB 4PGGA 3PSFA 2MLKA 5EDNA 2LK2A 4MHGA 1XCBA 4EM2A 2ISZA 2VPRA 3LSIA 2QGUA 5F27A 5IYDJ 2QQBA 4RAZA 3ZMVA 1VQ4I 1MMDA 1R58A 2FMYA 1IN7A 1MJ9A 4UVAA 3VB2A 2VBWA 1MW7A 1YQAA 1YHQI 2FXAA 2M45A 2DA4A 2X6WA 3OYFA 2EQRA 1B59A 3TEDA 3CF5F 2JA7J 2IBDA 3LOCA 3V8LA 5DS9A 2WB1N 3S2HJ 2WV0A 1Y1WJ 3ECOA 4O3MA 3E6MA 4A0XA 1R4NB 3DTKA 2HYJA 2E1OA 3S3NA 3WGHA 3HRUA 1MGTA 3CCQI 3K1PA 3KX2A 3QPSA 5EEAA 1HOMA 5IT3A 3TDZC 5FRMA 1JUSA 1K83J 2CUFA 5E3LA 3RDIA 4P5OA 5CVJA 3H36A 2EA4A 3PQJA 1RKWA 5HDNA 1UCRA 5E18F 5CLSA 1SMTA 1EH8A 3H3ZA 4ZC3A 1QNTA 2DMTA 3LFKA 1GDTA 3I4NJ 1K6OA 3KP7A 1XSXA 1CQTA 3CJRB 3M8EA 4L5JA 2JA5J 1SFEA 4N9HA 3HKZA 1QZYA 3DKWA 2A07F 3LSRA 5CKTA 1LVAA 3DEUA 3BG7A 4LITA 1QRYA 2RNGA 1G3SA 1K4TA 1HSTA 1MNMC 3EYIA 1YS6A 4LK0F 2E19A 3CCLI 1VF9A 3E5QA 2E2HJ 2EZLA 1ZREA 4PJNA 4WWCA 4AM3A 2XUBA 2VKHA 5KCMA 3JRIA 2K4BA 2W48A 1ORKA 2R3SA 1M1EB 3WTWC 3ERED 1KU9A 4XKCA 2IRFG 4C3IJ 3I59B 5IP9J 1QPIA 1U0JA 1XGNA 1AHDP 1GXQA 1R23A 3ELKA 4E6KG 5FKMA 2EV6A 2RKHA 3SDBA 3OSGA 3I4PA 3OSFA 1Y56A 1MMSA 3PNTA 4AIHA 1KGSA 2RVCA 3QPHA 4O6JA 3H9QA 5BNGA 2K02A 1VQOI 1HDDC 2DTRA 2JA2A 2GM4A 3E6DA 1DP3A 5JI6A 2L54A 3ZMDA 3F3XA 4HSRA 2XV4S 3KLOA 2CS3A 4ESBA 4N4NB 4IHWA 3JRCA 1SVMA 2XC7A 1U5TB 1FZPB 1S9HA 1Y8QB 3CCEI 3WU2C 2L7FP 2IS1A 1WJCA 2FD5A 1MBEA 3FK6A 1G59A 1NTCA 2O9LA 3BCAA 4M9XA 2JT1A 4BBSJ 1R1UA 3K4BA 1NG6A 3TQNA 1TW2A 3DBLB 1ZGWA 5KK1A 4ZDPA 2QUFA 1V5FA 3I58A 3I0TA 4RBOA 1TWGJ 3NQOA 4XRSG 4IL6C 2LKPA 4M72A 4IOCF 2EZHA 5F0FA 1BI0A 3S3OA 3HBLA 2F4IA 1E3PA 5ICGA 4HLYA 3BJ6A 3BY6A 4E4HA 4PFPA 2RDPA 1S7OA 2HTSA 5LBQA 3HOYJ 4RB2C 4AIJA 2KHMA 1ITYA 5DUKA 3CO7C 1MZBA 2XGEA 5FKNA 2R7FA 1GV2A 2HXOA 4HDUA 2FNPA 1ONVA 3BR5A 1MBJA 1EA3A 1NHAA 2QWWA 2EBIA 2DJNA 2QBYA 4QPQA 2HDDA 2RQQA 1TT0A 3H3VK 2GXAA 2Y2ZA 4X6AJ 5HVQC 2CU7A 1U5TC 3CDIA 3HSEA 3MFKA 1XDUA 2K3PA 4D9JA 5M5WJ 5C4XJ 4BHPA 2O03A 4DW6A 2FQ3A 3LNQA 2HKOA 3PFIA 5M5XJ 2HVRA 2GXGA 5FO5A 4A0ZA 3DF8A 1FIAA 4PUSA 1BR1A 2J5PA 3D0SA 3GLLA 4HEA2 4WXHA 3FHZA 3A2KA 1DP7P 1D0XA 3JTHA 1R5ID 3S1QJ 2Y0SA 4OU0A 2A61A 4Q47A 3A01B 4YIFA 2XSJC 5E3NA 1X58A 4XQFA 2OA4A 1UHMA 2H6CA 3PM1A 1AKHA 3TBIA 3CCJI 4LIVA 4IRIA 2IS6A 4XLAA 3FIWA 4MLOA 1I1SA 3WHBA 4IOAF 1BW6A 1KU7A 3S2DJ 3OYDA 1LUJB 1F9NA 3FZVA 5DM6F 3I71A 5CYVA 1G2HA 2I5UA 3KP5A 4HNVA 4MO7A 1D1CA 2M7BA 5M3FJ 2IGOA 2FU4A 4KNYA 3IP4B 3A0HC 2HU9A 5DV5A 1OISA 4ITVA 5DTDA 3PNYA 4PJMA 3GFIA 3UNGC 1BC8C 4N9IA 4LLNA 3HL2A 3L2VA 2I8DA 2K9LA 1T98A 2KFDA 2CUEA 2ZXWH 1FIPA 1LEBA 1TW3A 1TP4A 3FK7A 4Y52J 3WE2A 3FM5A 4L18B 3C7JA 4C2UA 2ZJ2A 3C18A 2R5YB 5LGTA 3CCVI 1FOYA 5LEKA 4XLCA 5H6QA 4FTHA 1W7PD 4KN4X 4XLFA 5D4SA 5DD8A 2KLOA 1SD5A 2OAZA 2Z16A 3NEUA 2F5VA 3WTUC 3VWBA 3H92A 4I6ZA 2DDAA 4HYEA 5LLQA 1Y6IA 4A93J 2OUMA 4AYBA 2MW8A 3EQLF 3K70C 5J6XA 3LSKA 3ZR8X 4EJUA 1WJDA 2E1MB 1RNLA 3LQRA 1MSEC 3RZOJ 1I6XA 2IVMA 1PUFA 4GRIA 4N0BA 3IV5A 1XMXA 2E2IJ 4OIQF 4ZDOA 2DI3A 1KYWA 1IUFA 3DPLC 3AL0B 2Y75A 1BR2A 2KT0A 2VONA 4U0YA 1ETQA 2R7OA 5CQEA 2Q0OA 1WWXA 3M1EA 3CJTB 2FBKA 4NQWB 4KMUX 2VBXA 2GOXB 5ICCA 1XSDA 2ZMEB 1Z77A 1P2FA 2RAEA 2ECCA 3FXJA 1XG1A 2WC2A 3HUGB 3T5XA 4L5EA 1S7EA 1BJAA 3K1MA 2HQ5A 1WH5A 3HOZJ 3FXLA 5FD6A 4BGDA 4IHXA 3SEQA 2BY2A 3ESWB 2ADUA 3LFUA 5H20A 3F21A 3B73A 3ZP5A 5JHFA 3GEZA 4A3LJ 3KP4A 1I6HJ 4OINF 3CF2A 1YW7A 1X2NA 4KIGA 4XLHA 3BOQA 2DT7B 1YIOA 1QO0D 1OCZH 3S17J 1KQ8A 3SFZA 1FY7A 2D1HA 2CQNA 2COBA 2RREA 2EILH 4BKXA 4D5CA 2KL4A 1V55H 2A05A 4Y7NJ 5IY5H 1TBXA 3F6OA 2Q2EA 2E1MC 2HQAA 2QCOA 2UXXA 4ZYGA 4UVCA 5TISC 3R60A 3AKZA 4AWXB 2HVSA 4YG2F 3GZ6A 3AL0C 3IKVA 4ESJA 2JA6J 3W6KB 4BQQA 2R7TA 5FFXA 2V1NA 2VC1A 1K79A 3I53A 1HA8A 4QIWN 2HKXA 3KYDB 1XGMA 4BH9A 1MH3A 3K4LA 3FMSA 5L3DA 3GZNB 2ZMEC 1OPCA 5CVRA 2VOOA 1JUMA 1OCOH 1U2WA 2DYRH 3SXYA 1N75A 2HQRA 5JLWA 3RKWA 1G6NA 1YW8A 2RV8A 4P9UA 2F5CA 5B1AH 3FWEA 2R93J 5CVUA 1FEXA 1BIAA 1T95A 3AFHA 5GAHJ 3LA3A 2QSGX 4OWRB 3HPGA 4UHTA 4WF2A 3SYTA 4R79A 1LFUP 1S72I 3OIPA 2M1BA 2HPIA 2YX4A 4B3AA 2DO7A 5E1WA 4W1UA 1IN5A 2FSWA 5D5XB 4LG0B 3RIRA 5HNFA 1WGXA 1JKRC 4UUSA 1Z7LA 1Z21A 2V9PA 2EPFA 3WTVC 4RDUA 3CUQB 1W5CC 3DBRB 3Q9SA 1G8XA 1ETVA 2O8XA 3OR2C 4P9FA 3MD2A 4HZFA 1A04A 1LNWA 4R1HA 1HKSA 2LC2A 4GYGA 5FKKA 3GTGJ 3O3KA 4DZPA 5HODA 1SAUA 1T6SA 3OYMA 5J1UA 3HGYA 1VZ0A 2DDBA 4S04A 3L2UA 1HCRA 6PAXA 1FTZA 3BG3A 4MTEA 2DPUA 2HNHA 3IH2A 2ZFUA 3M7GA 1DDNA 2M8GX 3CJQB 1X3WB 2I10A 4G6DA 1SD4A 5H6RA 2VXZA 2LP0A 4CYCB 1O3SA 1TLHB 4AU7A 2MFZA 4DJAA 2NYXA 5DCMA 3F22A 3EUKL 1CF7B 3ZQIA 4XL9A 1B72B 1PP7U 3TO7A 1K78B 3JCUC 4HSTA 2ID6A 3HXLA 1QGPA 2NOGA 2ZNZA 4NUBA 1TNTA 2L9VA 1D0YA 3GX4X 2O8KA 4MIMA 3F6VA 4UVBA 4ZYAA 4KISA 2JN6A 2AHQA 3E7LA 4MQ9F 4DNCA 3ABMH 3JRFA 1ZKGA 4L5IA 2M2EA 1J75A 3TDUC 4V2GA 3U21A 1W0UA 2CYYA 1H88C 4N4OB 5F6FA 5GPCA 1A31A 3OMYA 3E97A 4J01A 1TQPA 3GLXA 2W84A 3OIOA 3L1PA 1RI7A 2XAGA 3CUQC 3KFWX 4XKWA 1Y0NA 3M07A 5EZGA 2WV1A 2Y9YA 1OLTA 4E7LA 4FQGA 3A03A 4M6XA 5M5YJ 3K4JA 1LFBA 1WQ2A 3GF2A 2LY1A 3DU5A 3M8JA 2EFWA 1LQ1A 3S8PA 2OCCH 4E7JA 3O2PE 1LE8B 1XS9A 1JGSA 2YU9J 5J4VA 1BW5A 4JK1X 3IH4A 3S93A 1ZN2A 5FKLA 4BJTA 3Q0WA 4QTRA 4M9ZA 2IW5A 4DQ2A 1IC8A 2E7WA 3I54A 4BEHB 1Z91A 1Z67A 2V79A 4UB8C 1F5TA 1H9GA 1S5LC 1HLVA 1IRFA 2FMLA 4MFDA 3CC4I 1MBGA 5KNLA 3MWMA 4NB5A 1B8IA 2PBIA 3KEOA 2ZJRF 1KZHA 1Y8RB 2M5WA 2IEKA 2A3SA 2NVTJ 1IXSB 4B43A 2M9HA 2QVOA 4MGRA 4A3IJ 1JUPA 4RAFA 3WTSC 2JTVA 4Y3OA 5HS7A 3AG1H 3WU0A 4BDYA 1G3TA 2NAZA 3GTJJ 2HS5A 1WPKA 3BPVA 1HW5A 3K0LA 1W36D 1JXSA 4KJZA 1JTYA 1O4XA 3C3WA 1DU0A 2LDUA 2UZKA 3ZMSA 1FBSA 5IP6A 1OJLA 2NVYJ 2P0WA 3VEPA 5KAIC 1OFCX 3GBGA 2XPUA 3IRRA 4HG2A 2VE9A 1OMIA 1Z05A 5DDGA 1JKPC 3HOXJ 1JTXA 2A5WA 2PMZA 2VT2A 2X85A 3W2WA 4F93B 1F36A 3ZQHA 2CQ7A 1W7PA 2KJCA 3F72A 2W7NA 3H5RA 3Q0VA 4BYYA 3C1DA 3SDGA 3KZYA 2E60A 2IAIA 4HX8A 4Y4RA 2W82A 3FKIJ 3JRAA 2ELHA 2MD5A 3BDDA 3S32A 3KIOA 1FBQA 1O3TA 1J5YA 2BVLA 4BACA 3GVAA 1AA7A 2CW7A 5JR3A 1KQ9A 2OBPA 4YRVA 3OYHA 2XKPA 1U8RA 3PIPF 1GLNA 5D8LB 4C2TA 2F4OB 2FQ4A 3TL4X 2XF6A 1T08B 3E6BA 2EK5A 5J1YA 4PJJA 4ABZA 2MA3A 2DODA 3PUFA 3R0AA 4L9NA 5FD5A 4Q4ZF 5K7HA 1JHFA 5IT9Z 1MMAA 1XDSA 4XN3A 4A2UA 4G94A 3DXJF 5IOYA 2LY2A 5J47A 3DEEA 3WGIA 4BDZA 1QA6A 2VJIA 5M3MJ 3BROA 3HKZN 2ZNYA 1O3QA 3S1NJ 4NC8A 2PN6A 2R7QA 3F8NA 2DFFA 3OS2A 3HOVJ 4IKFA 2DA7A 5ICEA 5ILUA 1R5GA 3CLQA 2WAQA 3GFLA 3CMEI 1FSHA 2VL8A 1MH4A 1ULYA 2VLAA 3VSKA 1FLIA 1B1BA 3OYCA
chains in the Genus database with same CATH topology
3HOYJ 2JK3A 2XPWA 2DMPA 1ITYA 2HI3A 3BR1A 1RETA 2XGEA 5FKNA 3MN2A 4D5FA 1GV2A 2PMZN 2LKXA 2HXOA 1IG7A 2MG4A 2L7ZA 1GV5A 3BR5A 1MBJA 4A3FJ 2JMWA 1JGGA 2EBIA 2DJNA 3RKQA 1HF0A 2HDDA 3H3VK 4JX5A 2G0EA 1U78A 1VFCA 2Y2ZA 4X6AJ 2CU7A 5GP9A 5M5WJ 3ZQCA 5C4XJ 3GTMJ 5FJ8J 3GTPJ 4C3JJ 2LD5A 4DW6A 4IHVA 3LNQA 5M5XJ 4W97A 1SFOJ 4XIDA 1ETYA 2X9DA 1SANA 2ECBA 1VI0A 2HOTA 1ETXA 1PUFB 1FIAA 4IHYA 4JYKA 3MVPA 1BJZA 5E3MA 4XK4A 5EZHA 3S1QJ 4A3GJ 2NS7A 3M4OJ 3A01B 4D7MA 5E3NA 1X58A 1H8AC 2CQQA 3TW6A 3CCYA 1A5JA 1OCPA 3PM1A 1AKHA 4M3BA 3HB9A 3W6VA 1RPWA 2WAQN 3FIWA 4MLOA 4A69C 3WHBA 3GTLJ 1BW6A 4BY7J 4A3EJ 2GBYA 4FCYA 2L0KA 3S2DJ 3RQIA 4A3CJ 2ELKA 4FISA 2Y30A 1G2HA 2YS9A 2R5ZA 1MBKA 4HNVA 3CQZJ 4MO7A 2LTPA 1W0TA 5M3FJ 5FKOA 2HXIA 3LSPA 2CJJA 3TW7A 5DTDA 5F08A 3QPLA 3BTLA 5EG0B 3GTOJ 2CRGA 5K7ZA 5E3OA 5IYBJ 1RR7A 2CUEA 1FIPA 1GT0C 3FK7A 2MGQA 3HGGA 5F0HA 4Y52J 2E2JJ 3H0GJ 1Q1VA 2XSDC 2R5YB 2DA5A 2OF7A 4FTHA 1F43A 1EF4A 1A6IA 1H89C 4M3EA 5EGOB 1JKOC 1GUUA 2R92J 4XICA 4I6ZA 3DEWA 3CDLA 4A93J 4C3HJ 2MW8A 2X6OA 1TC3C 2Y0SN 1U9OA 1MSEC 3RZOJ 2EH3A 4C2MJ 1PUFA 2DA3A 1IDYA 4XRSA 1IJWC 3IV5A 2ID3A 3G1LA 2E2IJ 4FE7A 1IUFA 3BTCA 2K40A 2XPVA 1JJ6C 2KT0A 2FJ1A 4LOCA 1ETQA 4IEJA 1JT0A 5IOZA 3JRGA 3QQAA 2NS8A 1ZK8A 2H8RA 2VKVA 4JX4A 1IDZA 2LY9A 1Z77A 2Y31A 4A3JJ 2RAEA 2ECCA 2M0CA 1P7IA 1XG1A 2L7MP 4L5EA 2X48A 1S7EA 2N8GA 2XRLA 1ENHA 2HQ5A 1WH5A 4UUSB 3HOZJ 2Y9ZA 4IHXA 5C3EJ 1E3OC 3Q3SA 1OCTC 3ZOBA 1FJLA 2XB5A 1AU7A 4V2FA 4A3LJ 1I6HJ 5EG0A 3BG5A 3SJMA 3DCFA 3NAUA 1ZR4A 1X2NA 2B63J 5F0CA 2H1KA 3S1RJ 3UKGA 4A3BJ 3S17J 4J19A 2XB0X 3M3YJ 2COBA 4BKXA 5C4JJ 2R5YA 4D5CA 1ZQ3P 4Y7NJ 1WI3A 1UG2A 2QCOA 2TRTA 5J1RA 3K7AJ 4AYBN 2K9SA 2O7OA 4QSHA 1DU6A 4M6VA 1IV6A 2JA6J 1BA5A 5K7FA 2GLOA 3K2AA 1YRNB 2JA8J 5F04A 4AUXA 2LVSA 3ZQFA 4QIWN 3GTQJ 2L9RA 1MH3A 2AO9A 4M3FA 1IRZA 4JX6A 1JUMA 2ME0A 2JJ7A 4UUTA 3O8HA 3HM5A 1Z0XA 1GVDA 5JLWA 3JRBA 1U9NA 2DMQA 2R93J 5IPAA 4BY1J 2DA6A 1FEXA 1UHSA 2VUMJ 5F1JA 3FISA 3SFIA 3TP0A 1LFUP 1FTTA 2LLKA 3BR2A 3BQZA 4B3AA 3JRDA 4W1UA 4M3GA 1WGXA 1JKRC 4UUSA 1ZR2A 3I4MJ 1TWHJ 1T56A 4RDUA 3HEFA 2TCTA 1ETVA 1P7JA 4DYQA 3HOUJ 3IH3A 5FKKA 3GTGJ 4DZPA 1X2MA 3BR0A 2NVXJ 5HODA 1ZTRA 2KDZA 2HOAA 4JP0A 2EZIA 5J1UA 3HGYA 1BL0A 1HCRA 1FTZA 3BG3A 2DTZA 5J3LA 2DMNA 3IH2A 1XC5A 4M3DA 4DYCA 4B4CA 2M8GX 5C44J 4A3MJ 3VPRA 2I10A 1B8IB 1IGNA 4CYCB 1WH7A 1TWFJ 2LP0A 1K61A 3HDDA 3PO3J 3BR3A 2DMUA 3ZQLA 5IYCJ 3BG9A 3B6AA 3ZQIA 1B72B 2DA2A 3RZDJ 4AC0A 3Q0UA 3A01A 1YRNA 2ID6A 1APLC 2NOGA 3S14J 4A3DJ 2O8KA 4MIMA 4FE4A 2R0QC 2JN6A 2AHQA 3E7LA 3TP3A 3S15J 3F0CA 3JRFA 1ZKGA 2M2EA 3LSJA 3JR9A 1RESA 4V2GA 1W0UA 1H88C 5GPCA 4D7NA 4BXXJ 3S16J 1UMQA 5FLMJ 3OIOA 3ZQGA 3L1PA 1JKQC 5GPAA 3JRHA 1HDPA 2DN0A 5EZGA 3BR6A 3BTIA 1MBFA 3LSGA 2WV1A 2ZB9A 5JLXA 1I3QJ 2Y9YA 2R7ZJ 3MKLA 3A03A 5EDNA 2LK2A 5M5YJ 2VPRA 5F27A 5FLVA 1RKTA 5IYDJ 1LFBA 1T33A 2FX0A 3PO2J 1JJ8C 3NARA 2NVQJ 1LE8B 1XS9A 2YU9J 2DA4A 4G12A 1BW5A 2EQRA 3CMYA 3IH4A 4EEFG 1JT6A 3B6CA 3TEDA 2EZKA 5FKLA 2JA7J 2IBDA 3LOCA 3Q0WA 4QTRA 5DS9A 5EGOA 2WB1N 2CQXA 1Y1WJ 3S2HJ 1IC8A 1MSFC 1MBHA 4DYRA 4B1RA 4MFEA 2HYJA 4BBRJ 2MSYA 2E1OA 4GFBA 1HLVA 1QVTA 1Y1VJ 4MFDA 4X1EA 3QPSA 1TWCJ 5EEAA 1HOMA 3OOUA 1I50J 1MBGA 3A02A 5IP7J 3BT9A 1B8IA 1JUSA 4CYCA 1K83J 2CUFA 5E3LA 4DZJA 3BQYA 2JWTA 2M34A 3BTJA 2IEKA 1RKWA 1B72A 2NVTJ 2K9QA 2M9HA 1GDTA 2DMTA 3I4NJ 4A3IJ 1JUPA 2XGCA 2LFBA 1ETWA 1CQTA 5EYRA 2JA5J 1U8BA 1TWAJ 3GTJJ 3LSRA 2K9NA 4A3KJ 1WPKA 1POGA 2YUSA 2D5VA 1VNDA 1QRYA 3D1NI 1JTYA 1O4XA 2VKEA 1MNMC 1DU0A 2E19A 1VF9A 2E2HJ 2EZLA 2QF7A 3WHCA 5IP6A 1D5YA 5EF6A 1OJLA 2NVYJ 2XGDA 1QVUA 1OFCX 3GBGA 2XPUA 3G1OA 1WCMJ 3JRIA 1ORKA 2W48A 2DA1A 2LR8A 1JKPC 4C3IJ 5IP9J 3HOXJ 1JTXA 1NK3P 1QPIA 1AHDP 4NDLA 3O8GA 1F36A 5FKMA 3ZQHA 3OSGA 3OSFA 3Q0VA 3SDGA 2IAIA 5BNGA 3JREA 1HDDC 1LE8A 2GM4A 3GTKJ 3FKIJ 3JRAA 3C2BA 4I76A 2OPTA 3G1MA 4IHWA 3JRCA 9ANTA 1ETOA 2FQ4A 1ETKA 5J1YA 4ABZA 2L7FP 5K7HA 2FD5A 1MBEA 3FK6A 2O9LA 1NTCA 2VI6A 5IOYA 4BBSJ 2HOSA 2ME6A 2P81A 1AKHB 1ZGWA 5M3MJ 3HKZN 3S1NJ 4RBOA 1TWGJ 4S0HB 1NK2P 1R9TJ 3HOVJ 4XRSG 2DA7A 4XRMA 2R5ZB 2EZHA 5F0FA 1MH4A 3HBLA 3HOWJ 3S1MJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY J;  2JK3 A;  2XPW A;  2DMP A;  1ITY A;  2HI3 A;  3BR1 A;  1RET A;  2XGE A;  5FKN A;  3MN2 A;  4D5F A;  1GV2 A;  2PMZ N;  2LKX A;  2HXO A;  1IG7 A;  2MG4 A;  2L7Z A;  1GV5 A;  3BR5 A;  1MBJ A;  4A3F J;  2JMW A;  1JGG A;  2EBI A;  2DJN A;  3RKQ A;  1HF0 A;  2HDD A;  3H3V K;  4JX5 A;  2G0E A;  1U78 A;  1VFC A;  2Y2Z A;  4X6A J;  2CU7 A;  5GP9 A;  5M5W J;  3ZQC A;  5C4X J;  3GTM J;  5FJ8 J;  3GTP J;  4C3J J;  2LD5 A;  4DW6 A;  4IHV A;  3LNQ A;  5M5X J;  4W97 A;  1SFO J;  4XID A;  1ETY A;  2X9D A;  1SAN A;  2ECB A;  1VI0 A;  2HOT A;  1ETX A;  1PUF B;  1FIA A;  4IHY A;  4JYK A;  3MVP A;  1BJZ A;  5E3M A;  4XK4 A;  5EZH A;  3S1Q J;  4A3G J;  2NS7 A;  3M4O J;  3A01 B;  4D7M A;  5E3N A;  1X58 A;  1H8A C;  2CQQ A;  3TW6 A;  3CCY A;  1A5J A;  1OCP A;  3PM1 A;  1AKH A;  4M3B A;  3HB9 A;  3W6V A;  1RPW A;  2WAQ N;  3FIW A;  4MLO A;  4A69 C;  3WHB A;  3GTL J;  1BW6 A;  4BY7 J;  4A3E J;  2GBY A;  4FCY A;  2L0K A;  3S2D J;  3RQI A;  4A3C J;  2ELK A;  4FIS A;  2Y30 A;  1G2H A;  2YS9 A;  2R5Z A;  1MBK A;  4HNV A;  3CQZ J;  4MO7 A;  2LTP A;  1W0T A;  5M3F J;  5FKO A;  2HXI A;  3LSP A;  2CJJ A;  3TW7 A;  5DTD A;  5F08 A;  3QPL A;  3BTL A;  5EG0 B;  3GTO J;  2CRG A;  5K7Z A;  5E3O A;  5IYB J;  1RR7 A;  2CUE A;  1FIP A;  1GT0 C;  3FK7 A;  2MGQ A;  3HGG A;  5F0H A;  4Y52 J;  2E2J J;  3H0G J;  1Q1V A;  2XSD C;  2R5Y B;  2DA5 A;  2OF7 A;  4FTH A;  1F43 A;  1EF4 A;  1A6I A;  1H89 C;  4M3E A;  5EGO B;  1JKO C;  1GUU A;  2R92 J;  4XIC A;  4I6Z A;  3DEW A;  3CDL A;  4A93 J;  4C3H J;  2MW8 A;  2X6O A;  1TC3 C;  2Y0S N;  1U9O A;  1MSE C;  3RZO J;  2EH3 A;  4C2M J;  1PUF A;  2DA3 A;  1IDY A;  4XRS A;  1IJW C;  3IV5 A;  2ID3 A;  3G1L A;  2E2I J;  4FE7 A;  1IUF A;  3BTC A;  2K40 A;  2XPV A;  1JJ6 C;  2KT0 A;  2FJ1 A;  4LOC A;  1ETQ A;  4IEJ A;  1JT0 A;  5IOZ A;  3JRG A;  3QQA A;  2NS8 A;  1ZK8 A;  2H8R A;  2VKV A;  4JX4 A;  1IDZ A;  2LY9 A;  1Z77 A;  2Y31 A;  4A3J J;  2RAE A;  2ECC A;  2M0C A;  1P7I A;  1XG1 A;  2L7M P;  4L5E A;  2X48 A;  1S7E A;  2N8G A;  2XRL A;  1ENH A;  2HQ5 A;  1WH5 A;  4UUS B;  3HOZ J;  2Y9Z A;  4IHX A;  5C3E J;  1E3O C;  3Q3S A;  1OCT C;  3ZOB A;  1FJL A;  2XB5 A;  1AU7 A;  4V2F A;  4A3L J;  1I6H J;  5EG0 A;  3BG5 A;  3SJM A;  3DCF A;  3NAU A;  1ZR4 A;  1X2N A;  2B63 J;  5F0C A;  2H1K A;  3S1R J;  3UKG A;  4A3B J;  3S17 J;  4J19 A;  2XB0 X;  3M3Y J;  2COB A;  4BKX A;  5C4J J;  2R5Y A;  4D5C A;  1ZQ3 P;  4Y7N J;  1WI3 A;  1UG2 A;  2QCO A;  2TRT A;  5J1R A;  3K7A J;  4AYB N;  2K9S A;  2O7O A;  4QSH A;  1DU6 A;  4M6V A;  1IV6 A;  2JA6 J;  1BA5 A;  5K7F A;  2GLO A;  3K2A A;  1YRN B;  2JA8 J;  5F04 A;  4AUX A;  2LVS A;  3ZQF A;  4QIW N;  3GTQ J;  2L9R A;  1MH3 A;  2AO9 A;  4M3F A;  1IRZ A;  4JX6 A;  1JUM A;  2ME0 A;  2JJ7 A;  4UUT A;  3O8H A;  3HM5 A;  1Z0X A;  1GVD A;  5JLW A;  3JRB A;  1U9N A;  2DMQ A;  2R93 J;  5IPA A;  4BY1 J;  2DA6 A;  1FEX A;  1UHS A;  2VUM J;  5F1J A;  3FIS A;  3SFI A;  3TP0 A;  1LFU P;  1FTT A;  2LLK A;  3BR2 A;  3BQZ A;  4B3A A;  3JRD A;  4W1U A;  4M3G A;  1WGX A;  1JKR C;  4UUS A;  1ZR2 A;  3I4M J;  1TWH J;  1T56 A;  4RDU A;  3HEF A;  2TCT A;  1ETV A;  1P7J A;  4DYQ A;  3HOU J;  3IH3 A;  5FKK A;  3GTG J;  4DZP A;  1X2M A;  3BR0 A;  2NVX J;  5HOD A;  1ZTR A;  2KDZ A;  2HOA A;  4JP0 A;  2EZI A;  5J1U A;  3HGY A;  1BL0 A;  1HCR A;  1FTZ A;  3BG3 A;  2DTZ A;  5J3L A;  2DMN A;  3IH2 A;  1XC5 A;  4M3D A;  4DYC A;  4B4C A;  2M8G X;  5C44 J;  4A3M J;  3VPR A;  2I10 A;  1B8I B;  1IGN A;  4CYC B;  1WH7 A;  1TWF J;  2LP0 A;  1K61 A;  3HDD A;  3PO3 J;  3BR3 A;  2DMU A;  3ZQL A;  5IYC J;  3BG9 A;  3B6A A;  3ZQI A;  1B72 B;  2DA2 A;  3RZD J;  4AC0 A;  3Q0U A;  3A01 A;  1YRN A;  2ID6 A;  1APL C;  2NOG A;  3S14 J;  4A3D J;  2O8K A;  4MIM A;  4FE4 A;  2R0Q C;  2JN6 A;  2AHQ A;  3E7L A;  3TP3 A;  3S15 J;  3F0C A;  3JRF A;  1ZKG A;  2M2E A;  3LSJ A;  3JR9 A;  1RES A;  4V2G A;  1W0U A;  1H88 C;  5GPC A;  4D7N A;  4BXX J;  3S16 J;  1UMQ A;  5FLM J;  3OIO A;  3ZQG A;  3L1P A;  1JKQ C;  5GPA A;  3JRH A;  1HDP A;  2DN0 A;  5EZG A;  3BR6 A;  3BTI A;  1MBF A;  3LSG A;  2WV1 A;  2ZB9 A;  5JLX A;  1I3Q J;  2Y9Y A;  2R7Z J;  3MKL A;  3A03 A;  5EDN A;  2LK2 A;  5M5Y J;  2VPR A;  5F27 A;  5FLV A;  1RKT A;  5IYD J;  1LFB A;  1T33 A;  2FX0 A;  3PO2 J;  1JJ8 C;  3NAR A;  2NVQ J;  1LE8 B;  1XS9 A;  2YU9 J;  2DA4 A;  4G12 A;  1BW5 A;  2EQR A;  3CMY A;  3IH4 A;  4EEF G;  1JT6 A;  3B6C A;  3TED A;  2EZK A;  5FKL A;  2JA7 J;  2IBD A;  3LOC A;  3Q0W A;  4QTR A;  5DS9 A;  5EGO A;  2WB1 N;  2CQX A;  1Y1W J;  3S2H J;  1IC8 A;  1MSF C;  1MBH A;  4DYR A;  4B1R A;  4MFE A;  2HYJ A;  4BBR J;  2MSY A;  2E1O A;  4GFB A;  1HLV A;  1QVT A;  1Y1V J;  4MFD A;  4X1E A;  3QPS A;  1TWC J;  5EEA A;  1HOM A;  3OOU A;  1I50 J;  1MBG A;  3A02 A;  5IP7 J;  3BT9 A;  1B8I A;  1JUS A;  4CYC A;  1K83 J;  2CUF A;  5E3L A;  4DZJ A;  3BQY A;  2JWT A;  2M34 A;  3BTJ A;  2IEK A;  1RKW A;  1B72 A;  2NVT J;  2K9Q A;  2M9H A;  1GDT A;  2DMT A;  3I4N J;  4A3I J;  1JUP A;  2XGC A;  2LFB A;  1ETW A;  1CQT A;  5EYR A;  2JA5 J;  1U8B A;  1TWA J;  3GTJ J;  3LSR A;  2K9N A;  4A3K J;  1WPK A;  1POG A;  2YUS A;  2D5V A;  1VND A;  1QRY A;  3D1N I;  1JTY A;  1O4X A;  2VKE A;  1MNM C;  1DU0 A;  2E19 A;  1VF9 A;  2E2H J;  2EZL A;  2QF7 A;  3WHC A;  5IP6 A;  1D5Y A;  5EF6 A;  1OJL A;  2NVY J;  2XGD A;  1QVU A;  1OFC X;  3GBG A;  2XPU A;  3G1O A;  1WCM J;  3JRI A;  1ORK A;  2W48 A;  2DA1 A;  2LR8 A;  1JKP C;  4C3I J;  5IP9 J;  3HOX J;  1JTX A;  1NK3 P;  1QPI A;  1AHD P;  4NDL A;  3O8G A;  1F36 A;  5FKM A;  3ZQH A;  3OSG A;  3OSF A;  3Q0V A;  3SDG A;  2IAI A;  5BNG A;  3JRE A;  1HDD C;  1LE8 A;  2GM4 A;  3GTK J;  3FKI J;  3JRA A;  3C2B A;  4I76 A;  2OPT A;  3G1M A;  4IHW A;  3JRC A;  9ANT A;  1ETO A;  2FQ4 A;  1ETK A;  5J1Y A;  4ABZ A;  2L7F P;  5K7H A;  2FD5 A;  1MBE A;  3FK6 A;  2O9L A;  1NTC A;  2VI6 A;  5IOY A;  4BBS J;  2HOS A;  2ME6 A;  2P81 A;  1AKH B;  1ZGW A;  5M3M J;  3HKZ N;  3S1N J;  4RBO A;  1TWG J;  4S0H B;  1NK2 P;  1R9T J;  3HOV J;  4XRS G;  2DA7 A;  4XRM A;  2R5Z B;  2EZH A;  5F0F A;  1MH4 A;  3HBL A;  3HOW J;  3S1M J; 
#chains in the Genus database with same CATH topology
 1JE8 A;  5GTH C;  2XPW A;  3VYT B;  2DMP A;  2IGN A;  2QEX I;  3BR1 A;  4D5F A;  3J81 K;  1V5E A;  3DPT A;  2LKX A;  1K6Y A;  3AAF A;  5HDK A;  1JGG A;  4A3F J;  2JMW A;  3HG9 A;  3ONQ A;  3RKQ A;  1HF0 A;  4RLQ A;  2G0E A;  1U78 A;  2VC0 A;  1ZG3 A;  1W4M A;  1P4W A;  5GP9 A;  4FX0 A;  1ZGA A;  2FRH A;  3J7A O;  3T8R A;  4IHT A;  3GTM J;  2WA0 A;  5J8F A;  4C3J J;  2LD5 A;  4IHV A;  4P55 A;  4UV9 A;  5L3F A;  4XSZ F;  4XID A;  3JAM Z;  2X9D A;  2L5Q A;  2F4M B;  4XN0 A;  2HOT A;  2DXI A;  1R49 A;  3FX3 A;  4LIU A;  1ETX A;  4AID A;  4IHY A;  4JYK A;  3MVP A;  1BJZ A;  1DUX C;  2K5C A;  5E3M A;  2BVM A;  3P5J A;  4A3G J;  2H6B A;  4HRI A;  1E3H A;  3OYA A;  3M4O J;  3EDP A;  2FOK A;  2H8W A;  5FRN A;  3J7A Y;  1H8A C;  1OCR H;  3TW6 A;  1A5J A;  4M3B A;  3HB9 A;  2BEO A;  3G2B A;  2H94 A;  4DBR A;  3EUH C;  4IJA A;  4A69 C;  4LGW A;  3GTL J;  1FNN A;  4XLE A;  2VQC A;  1VQ5 I;  1S6L A;  4BY7 J;  4QLC U;  4XLN F;  1R22 A;  3RQI A;  2V6E A;  1W5S A;  2ELK A;  3BJA A;  4FIS A;  2GQQ A;  4U0V A;  2R5Z A;  2AXL A;  2NNN A;  1YOV B;  2BY0 A;  2HR3 A;  1O3R A;  1VQK I;  1D8K A;  1UFM A;  3FXM A;  3NWT A;  4Y15 A;  4LFU A;  2X6X A;  2CJJ A;  4PJ0 C;  3LSP A;  2E5N A;  1F4K A;  3TW7 A;  2QZ8 A;  5EEH A;  1A6Q A;  2R7X A;  5F08 A;  3QPL A;  2L4A A;  2VBZ A;  2BXZ A;  1OYY A;  3QU6 A;  5EG0 B;  5A2Q Z;  3HOS A;  5E3O A;  4EAT A;  4ZH4 F;  4G6Q A;  1RR7 A;  2BW3 B;  1YTY A;  2DOF A;  3J80 Z;  5F0H A;  4AD9 A;  3HTS B;  2VOD A;  1Q1V A;  2DFI A;  1O7F A;  5D6E A;  1TZL A;  2KDO A;  4CCO A;  2V4J C;  3KZZ A;  4BXU A;  2CW0 F;  3P9I A;  2PQ8 A;  1F43 A;  1E2X A;  5B5E C;  1EF4 A;  1WJ5 A;  2M87 A;  4V19 K;  1SEU A;  2OTL I;  3TGN A;  1R00 A;  1YW9 A;  1R1V A;  5HLT A;  1WZ2 A;  4ENK A;  1GUU A;  4PSW A;  1VQN I;  3V42 A;  1SC7 A;  1BI1 A;  1SD6 A;  3W2V A;  4E7I A;  3GZ5 A;  1ZEL A;  4O5V A;  4XMY A;  3IRQ A;  3G3Z A;  1TC3 C;  2Y0S N;  4LMY A;  2DPD A;  4BJ5 C;  1U9O A;  2EH3 A;  4XNF A;  4P96 A;  4XRS A;  4ZTJ A;  3G1L A;  3QYF A;  3QOD A;  2M7A A;  2F2E A;  3KP6 A;  4BL0 B;  3FBN B;  2EFN A;  2XPV A;  2ELJ A;  2LF8 A;  4XBF A;  2FJ1 A;  2KP6 A;  3K10 A;  3JRG A;  2NS8 A;  1ZK8 A;  4I99 C;  2CFX A;  1KU2 A;  4JX4 A;  3DBH B;  3G71 I;  1J7K A;  4M9S A;  2Y31 A;  2EIN H;  2E71 A;  2WY7 Q;  3N97 A;  5FFZ A;  2XRL A;  1S7A A;  1IF1 A;  1IO2 A;  1ODD A;  3V7C A;  3ZMZ A;  5D4R A;  2STW A;  2MC3 A;  1TT5 B;  3GW2 A;  3RCO A;  5E8I A;  3CJN A;  5C3E J;  1T0F C;  2V1U A;  1HXD A;  3RKX A;  3ZOB A;  1FJL A;  3BWG A;  1RC9 A;  2EFQ A;  1LVK A;  4G7H F;  3S3M A;  4RM3 A;  5KAF C;  4XOT A;  3MQ0 A;  4HNT A;  3DCF A;  2R7U A;  1LDJ A;  4OMZ A;  3SZP A;  1O7L A;  1HBX G;  1PDN C;  1ZGJ A;  2FBH A;  3UKG A;  3A1Y A;  4TV7 A;  4A3B J;  1B4A A;  3ML6 A;  1BI3 A;  3M3Y J;  2DJI A;  2E5Z A;  1OKR A;  4B44 A;  1ZQ3 P;  3DFG A;  1I1G A;  1UG2 A;  2W00 A;  2LG4 A;  2X6Y A;  2BBY A;  2TRT A;  3B02 A;  4K2E A;  4BHB A;  1G4D A;  2QSF X;  1IXC A;  3K7A J;  3R0J A;  4AYB N;  3L09 A;  2FEZ A;  2A6H F;  2K9M A;  2K9S A;  2IXS A;  5B1B H;  4QSH A;  4F3Q A;  3EPZ A;  4HLX A;  1VQ8 I;  1BA5 A;  3UR3 C;  3OYE A;  2X1C A;  1G3Y A;  1XTA A;  1EH7 A;  3K2A A;  1YRN B;  4ZTF A;  2X4H A;  4UB6 C;  5GAG J;  5F04 A;  2LBF B;  3ZQF A;  3GTQ J;  2IA2 A;  2K4J A;  3DP7 A;  3J7Y J;  1IRZ A;  2LNB A;  5E1X A;  4PZJ A;  2E35 A;  4F7Z A;  3F8B A;  4BNC A;  3CUO A;  2JPC A;  4UUT A;  2LSO A;  1RRJ A;  3JRB A;  2DMQ A;  5BPD A;  1P92 A;  5F64 A;  2FUG 2;  1QU3 A;  4BY1 J;  4MNU A;  2DA6 A;  2H09 A;  3LSH A;  2VUM J;  2ESN A;  1L3L A;  4HX4 A;  2KRF A;  3CMM A;  3TP0 A;  1ON1 A;  3WTX C;  1FTT A;  4I0A A;  4CCL A;  2NNY A;  4XSX F;  2IGM A;  2GOM A;  3Q9V A;  2JRT A;  2L9S A;  2NS0 A;  1AWC A;  1TNS A;  4ZZL A;  1K4S A;  3I4M J;  2MH9 A;  5D5U B;  1DGW Y;  2EFO A;  1TWH J;  2PFB A;  5LFA A;  1T56 A;  4EJT A;  2A5Y B;  2ZXJ A;  1YO5 C;  2KQR A;  4XON A;  2RC4 A;  3S2W A;  4Z2Y A;  1OYW A;  2MC4 A;  3DKX A;  4DYQ A;  2XDV A;  3HOU J;  1FP2 A;  1KYZ A;  2MH2 A;  3IH3 A;  3MZY A;  4Q48 A;  4RM2 A;  1T8I A;  4CA0 A;  1X2M A;  4EQQ A;  2NVX J;  2V1D A;  3DWL E;  2WWY A;  4HDV A;  3W3C A;  2EZI A;  2V9K A;  1LFP A;  4HF2 A;  4JQF A;  2DMN A;  4UXN A;  3PL8 A;  3E1S A;  2VJJ A;  4DYC A;  3K4N A;  3VPR A;  1TWF J;  4Y13 A;  1LDD A;  1FBU A;  3BR3 A;  1VQ9 I;  1X1B A;  3ZQL A;  2X1E A;  4KIB A;  4ZYH A;  3B6A A;  3R6S A;  1D0Z A;  2DA2 A;  4XLP F;  2R4G A;  1ZYR F;  3J81 Z;  2EJR A;  2OV7 A;  4ENJ A;  2W85 A;  3ERM A;  4A3D J;  3M9A A;  5ERI A;  1P6R A;  2H1L A;  2VAS A;  1D8J A;  1SVO A;  3QOP A;  3TP3 A;  3S15 J;  2EWN A;  1FOW A;  4XOR A;  1N25 A;  3RYP A;  3H35 A;  3JTG A;  3M1C A;  3ZQQ A;  2YPR A;  4BAY A;  4ZYD A;  1RES A;  1VQM I;  4NC7 A;  1UST A;  5IT9 K;  3S16 J;  1UMQ A;  1YJW I;  2HYG D;  2MBF A;  4ZJZ A;  4G8X A;  4CDG A;  5DCF A;  4CZZ A;  3JRH A;  3K70 D;  3G4S I;  1HDP A;  4IVN A;  4KUM A;  3LSG A;  2KIQ A;  3BTI A;  5JLX A;  1I3Q J;  3IL2 A;  1V4R A;  4GYI A;  3FHN A;  1R71 A;  4G7Z F;  5FLV A;  1IRG A;  5FRO A;  1T33 A;  2BV6 A;  3X2Q H;  3MMY B;  4EM1 A;  2KZG A;  4RB1 A;  1JJ8 C;  2Z5U A;  5DM7 F;  1FSE A;  1R7J A;  3SZG A;  1FOX A;  3IC7 A;  2EB7 A;  4G12 A;  3CMY A;  1P4A A;  4EEF G;  3H1C A;  3ABT A;  1BN5 A;  1FWZ A;  2X0L A;  2PJR A;  4IRG A;  1F1Z A;  3PFY A;  1MDM A;  2ZSI B;  1MBH A;  1XMK A;  4F55 A;  3QRF F;  4G6T B;  2VOP A;  4MFE A;  4BBR J;  2MSY A;  4GFB A;  1SVL A;  2DFE A;  3H5A A;  3NWS A;  4X1E A;  2ZO4 A;  1MNE A;  3OOU A;  1I50 J;  1QZZ A;  2FA5 A;  2AQE A;  4ZZD A;  3LAP A;  1QQI A;  5TGT A;  4EGY A;  4EVI A;  5JHU A;  4DZJ A;  3BQY A;  4E7S A;  2W1O A;  2JWT A;  2M34 A;  3BTJ A;  4FHT A;  4CZC A;  3HC7 A;  2B7E A;  3I55 I;  1Z3Y A;  4I98 B;  1PUE E;  2Y69 H;  2XGC A;  3VSL A;  2XAS A;  2LFB A;  4RAY A;  1U8B A;  3JAM K;  4IZZ A;  1JI8 A;  4ETS A;  4A3K J;  4Q5S F;  1POG A;  2YUS A;  2JVG A;  5D8K B;  2D5V A;  4R8H A;  2M3A A;  4QPO A;  5E1Z B;  2V6C A;  4GDF A;  5K1Y A;  1TQM A;  4A5M A;  2JVH A;  4LB5 A;  3OS1 A;  5BMZ A;  4HV5 A;  5EF6 A;  1LDK B;  2PMH A;  2DU9 A;  1B6A A;  2E36 A;  1WCM J;  1YJ9 I;  2NOJ B;  3T8T A;  4IQ4 A;  3FXU A;  1BOB A;  3KCC A;  4XKV A;  2LR8 A;  3WU1 B;  2QBY B;  4XR6 A;  2K7L A;  1BC7 C;  3O8G A;  3WG7 H;  1O57 A;  1EV7 A;  4CUG A;  1PJR A;  4LD5 A;  2PG4 A;  1YX3 A;  2KIS A;  1WI9 A;  2WAD A;  1VQ7 I;  1QPM A;  4HX7 A;  3JRE A;  3ABL H;  4L9J A;  1XSV A;  3GTK J;  2GXB A;  2ZXI A;  1YYV A;  1D1A A;  4ESF A;  3C2G A;  3KE2 A;  4I76 A;  4A6D A;  3HSF A;  5A2Q K;  1KQ0 A;  2EIJ H;  4CIC A;  1ETO A;  3LL7 A;  4UV8 A;  1Y0U A;  2CWE A;  3J80 K;  1ETK A;  4LK1 F;  1MND A;  1UEL B;  2X51 A;  4M6Y A;  2DK8 A;  3MCZ A;  2XKO A;  3EYY A;  3FMQ A;  2VI6 A;  3L2R A;  5BPI A;  3DPU A;  1YI2 I;  3LSM A;  1UAA A;  2OTJ I;  2F5E A;  3GFJ A;  4CH7 A;  2HOS A;  1ON2 A;  3OYI A;  1AKH B;  2Z99 A;  1YG2 A;  4HA8 A;  3P9K A;  4HF1 A;  3RYR A;  3WTZ A;  4S0H B;  2GA1 A;  1R9T J;  3MKY B;  4XRM A;  3AG4 H;  3VYS B;  3D5L A;  3CO6 C;  2OZ6 A;  1R4M B;  3FKJ A;  4MEY F;  1I5Z A;  2VBY A;  3TOA A;  2XAQ A;  3TKY A;  5HOO A;  2R7D A;  2PLY A;  2KIF A;  1X19 A;  2CO5 A;  5LGN A;  2UWM A;  2HI3 A;  3LA7 A;  3MN2 A;  3DQV C;  3KEY A;  2PMZ N;  3KP2 A;  5CVI A;  4M74 A;  3DLA A;  2QQ8 A;  1GV5 A;  2MAB A;  2UXN A;  3I59 A;  3M8F A;  2ETH A;  2P5K A;  4JX5 A;  4WCG A;  1MIJ A;  3L7W A;  4KYW A;  3HRT A;  5BS6 A;  4XOP A;  2H27 A;  2R7S A;  3LAJ A;  4Y33 A;  2FOW A;  1Z3X A;  3ZQC A;  3ZXS A;  4YII A;  2XAH A;  1UB9 A;  2FBI A;  3RI4 A;  1Z1D A;  1USS A;  2O5R A;  1NH3 A;  1G3W A;  4PK4 A;  2XF7 A;  2XAJ A;  3DLL F;  1ETY A;  2R7W A;  3W6J B;  1U5T A;  2IS2 A;  1XMA A;  3A4C A;  3HHH A;  1PUF B;  5HS9 A;  2HEO A;  3KYL A;  4RMN A;  2BY1 A;  4XK4 A;  5EZH A;  1TQI A;  1X4P A;  2HDW A;  2NS7 A;  2OZU A;  3BPX A;  4KIF A;  1XPX A;  1X1P A;  4D7M A;  4B48 A;  3KYC B;  3HPH A;  3CCY A;  4G7O F;  1OCP A;  3HYI A;  1ZAR A;  2BZT A;  1VTN C;  1RPW A;  5B66 C;  3W6V A;  2WAQ N;  3DU6 A;  4OOI A;  3ROU A;  2CMP A;  3H0D A;  2PMU A;  1ZLJ A;  2GBY A;  4A3E J;  1K7A A;  2L0K A;  4BQO A;  2QM3 A;  3MKW B;  4A3C J;  2M8E A;  2WAF A;  2VQL A;  2Y30 A;  3WG9 A;  3K4K A;  1MBK A;  1VQP I;  4I2O A;  3CQZ J;  5FKO A;  3IUO A;  1XGO A;  1L0O C;  4RA2 A;  1DGR M;  3GWZ A;  3I9V 2;  3OYK A;  2AQF A;  2EV5 A;  4HQM A;  4BXF A;  3MAJ A;  3FDY A;  4A5N A;  3P9C A;  3GTO J;  5K7Z A;  3CDH A;  4QWQ A;  1TTY A;  1V3F A;  1RR8 C;  2L4M A;  4A6E A;  1GT0 C;  1UHW A;  3HGG A;  3JW4 A;  3U9G A;  3E5U A;  2E2J J;  4U7B A;  3K1N A;  1IXR C;  3R61 A;  5D5V B;  2WAE A;  3I64 A;  3CD6 I;  2XSD C;  3GXO A;  2DCE A;  2OCE A;  2OF7 A;  2Q2E B;  2DBB A;  2GWR A;  4IHS A;  4E7Z A;  2EIM H;  2ZKZ A;  4BE2 A;  1H89 C;  4EM0 B;  2HQN A;  2BHZ A;  3PUB A;  1UZC A;  3VYR B;  4EJO A;  3CCM I;  1A36 A;  1WVR A;  2ZBK A;  1R6R A;  5LRR A;  2R92 J;  4XIC A;  5KVR A;  4II2 A;  4CO8 A;  4WXD A;  4CGZ A;  4C3H J;  4YFN F;  1I27 A;  5K5R A;  2DYS H;  5GTI C;  4RGX A;  4IO9 F;  2NXN B;  4GO1 A;  1JHH A;  4C2M J;  4HNU A;  2WBM A;  1IDY A;  4GGG A;  1IJW C;  3EUA A;  4H0E A;  3FXK A;  2O61 A;  1YJN I;  3V7S A;  2RNJ A;  3BTC A;  5L3E A;  1XB4 A;  1JJ6 C;  2FF4 A;  5DD4 A;  2CUJ A;  1JT0 A;  5IOZ A;  2F5D A;  5GAD J;  1R36 A;  4IRH A;  2D45 A;  1XN7 A;  4A3J J;  2M0C A;  4AIK A;  5LHG A;  1P7I A;  1EJ9 A;  2L7M P;  2LMD A;  4EJW A;  2X48 A;  4CHU A;  2N8G A;  5FGM A;  4UUS B;  2Y9Z A;  5HNH A;  2QLZ A;  4JBA A;  2CUZ A;  3OS0 A;  3ZN0 A;  2ISY A;  1OCT C;  3GFM A;  4PSX A;  2BGC A;  3OYB A;  1AU7 A;  3LST A;  2X1D A;  2GAU A;  4V2F A;  3MKZ A;  1V54 H;  3BG5 A;  5D5W B;  2P5V A;  2LYC A;  3NAU A;  5AIQ A;  2W4S A;  1MMG A;  3RJP A;  5F0C A;  2B63 J;  3S1R J;  3BZ6 A;  1WSU A;  4CSW A;  4HOB A;  1ZG5 A;  2G9W A;  1PVE A;  3E3V A;  3V4G A;  3GCM A;  1P4X A;  5C4J J;  3CP8 A;  2R5Y A;  1SFU A;  2VQH A;  2W25 A;  1WI3 A;  3ECH A;  5F1R A;  2W57 A;  4FET A;  3U1D A;  2A68 F;  1MJB A;  5D6F A;  1DQU A;  4BUP A;  2STT A;  3VOE A;  4IXA A;  3QP5 A;  5DCM B;  3V7R A;  5J1R A;  1IN8 A;  2QYO A;  4L9T A;  1C0W A;  2O7O A;  3KLN A;  4M6V A;  2NRA C;  2LF7 A;  5GAE J;  5K7F A;  2GLO A;  2YX7 A;  3COA C;  2JA8 J;  4AUX A;  4J00 A;  1OR7 A;  2ESH A;  2VKD A;  4ASN A;  5LD2 C;  2A69 F;  4FAS D;  4M3F A;  1J59 A;  2XVC A;  5ED4 A;  3PNV A;  4RGU A;  2ZC2 A;  2XRO A;  3HM5 A;  2XRN A;  3H5N A;  2IA1 A;  4CXF A;  1BM9 A;  2IT0 A;  2OQR A;  2UV1 A;  5IPA A;  4ENN A;  1UHS A;  5F1J A;  4A12 A;  3FIS A;  1MKM A;  4D1Q A;  3SFI A;  4NQW A;  5JVT A;  1B9M A;  2IGK A;  4FT8 A;  2ZME A;  3BQZ A;  2FE3 A;  3HUG A;  4M3G A;  3ASO H;  3ULQ B;  1T39 A;  4PCQ A;  4P1W A;  2NVU B;  2JUG A;  3CTA A;  2YU3 A;  1ZR2 A;  4FX4 A;  2TCT A;  2KPM A;  3CCS I;  3K9T A;  3V8J A;  2CV2 A;  2XAU A;  2YSR A;  4NNJ A;  3K6G A;  1REP C;  3OYN A;  3QWL A;  1HQC A;  1MD0 A;  4EJV A;  5HLH A;  1HSJ A;  1ZTR A;  3L2W A;  2KDZ A;  2HOA A;  3QYB A;  4JP0 A;  3HSR A;  4JOM A;  4EGZ A;  1BL0 A;  2DTZ A;  5J3L A;  5J40 A;  1XC5 A;  4M3D A;  4C9Y A;  2WB1 A;  3SHF A;  1X1A A;  1H9T A;  3K2Z A;  4U87 A;  3OOP A;  4U7D A;  5ILV A;  1B8I B;  1WJF A;  1WH7 A;  1K61 A;  1OCC H;  3PO3 J;  1DPR A;  2DMU A;  5IYC J;  2P7V B;  3BG9 A;  2E1N A;  2XHK A;  3RZD J;  2E34 A;  3Q0U A;  4IPA A;  5DUI A;  5K5Q A;  4HF0 A;  1W5T A;  3CES A;  4LLL A;  3JSO A;  2DT6 A;  3BZK A;  2LKS A;  4FE4 A;  2R0Q C;  2DOE A;  3KP3 A;  2KJB A;  3F23 A;  3F0C A;  4DBQ A;  4EV0 A;  4LLG F;  3AG2 H;  4BXX J;  1FT9 A;  1KU3 A;  2CSO A;  4CCJ A;  3ZQG A;  1Y39 A;  5L3B A;  1JKQ C;  1LJ9 A;  1E0E A;  2W24 A;  1PYV A;  2DLL A;  2PX9 A;  1MBF A;  1EKE A;  2HDC A;  2QKM B;  4YIR X;  2R7Z J;  2ZCW A;  4CCK A;  2WTE A;  3MKL A;  3PJR A;  5FLX K;  5JFR A;  3JSP A;  4LG0 A;  1W7P B;  4UY8 I;  1RKT A;  2FX0 A;  4YFK F;  3MEX A;  3PO2 J;  2XF5 A;  4PFO A;  3SZT A;  1D5V A;  4UNO A;  1SD7 A;  2DQL A;  2O0Y A;  2K27 A;  3NAR A;  3WOD F;  1IAW A;  3CUQ A;  1VQL I;  2NVQ J;  4XM3 A;  2G7H A;  2IP2 A;  3A0B C;  1JT6 A;  3B6C A;  3DV8 A;  3OWT A;  2EZK A;  5E17 F;  3F9K A;  2QQ9 A;  1ZH5 A;  1DPU A;  1LKX A;  5EGO A;  2CQX A;  4RGR A;  1QZE A;  1MSF C;  4KIC A;  4DYR A;  4B1R A;  2IJL A;  4ZYE A;  3PIO F;  2JSP A;  2RQP A;  3HHG A;  1WHU A;  2P4W A;  3CZ6 A;  1QVT A;  1Y1V J;  3GYH X;  4CCN A;  1FOK A;  3DKY A;  1TWC J;  3L00 A;  3W2A A;  1WKM A;  3A02 A;  3G73 A;  5IP7 J;  3ZCO A;  3BT9 A;  5BQT A;  1N77 A;  4CYC A;  2L2O A;  4RS8 A;  2HOE A;  4BQA A;  2JRM A;  4WXC A;  3TO9 A;  1CF7 A;  1IZ1 A;  5CJ9 A;  1WJE A;  1B72 A;  2K9Q A;  4M71 A;  5AIP A;  1K78 A;  3OYJ A;  1BOA A;  2EIK H;  2Z33 A;  4HQE A;  1ETW A;  5L3G A;  5EYR A;  3E6C C;  2Z9O A;  1TWA J;  3ASN H;  3FXR A;  2K9N A;  1XX5 A;  3RSN A;  2CGP A;  1X3Z B;  1VND A;  1YE9 A;  4NC6 A;  2HGC A;  3D1N I;  1SFX A;  2VKE A;  2F5F A;  2VB6 A;  4GXO A;  4KT5 C;  3H9J A;  1WFX A;  1LB2 A;  2QF7 A;  3WHC A;  3H9G A;  1D5Y A;  4U88 A;  3FMR A;  1FX7 A;  2XGD A;  1QVU A;  3HRM A;  1BBY A;  1FP1 D;  3ABK H;  2D2W A;  3G1O A;  3KEQ A;  3G6E I;  1WRJ A;  2CFO A;  3IWF A;  2DQR A;  2DA1 A;  3GUD A;  1NK3 P;  1YLF A;  3AG3 H;  1D3Y A;  4NDL A;  3R4K A;  3F8F A;  5K5O A;  2UUZ A;  1IV8 A;  1EH6 A;  2BE5 F;  5TJJ A;  3ZMT A;  4E7K A;  3K4M A;  2L3D A;  4BU2 A;  1LE8 A;  5CPR B;  3TO6 A;  3C2B A;  5HLI A;  2E7X A;  2OPT A;  3FF5 A;  5H2F C;  1T38 A;  5EEG A;  4BQN A;  5HS8 A;  3G1M A;  4KDP A;  4YFX F;  3T1B A;  9ANT A;  5LGU A;  1Z7U A;  1GVJ A;  1YIT I;  4BEH A;  3RTR A;  3CCU I;  3L2Q A;  3WTY C;  4NBQ A;  2QEN A;  2BHY A;  4RLF A;  4L0Z B;  2ICW G;  3GO5 A;  1OQY A;  3I3L A;  1BIB A;  3HRS A;  5ICF A;  4OMY A;  1OYI A;  2XAF A;  2ME6 A;  4ON0 A;  2P81 A;  5J4Y A;  1HW2 A;  3MZH A;  4KA4 A;  4RB3 C;  4ZDL A;  1R1T A;  3DTE A;  2VQG A;  4Z6Y A;  3O6B B;  3RPU D;  1NK2 P;  2HWV A;  4AVZ A;  1ZLK A;  1FC3 A;  4IF4 A;  2ZFW A;  2F48 A;  2ZJP F;  2R5Z B;  2BOL A;  2R7R A;  3HOW J;  3VYU B;  3S1M J;  3DTI A;  2JK3 A;  2OD5 A;  4C30 A;  3OL3 A;  3ISP A;  3K4C A;  3L2C A;  2IA0 A;  2M0M A;  3BC8 A;  3ZMU A;  3OY9 A;  4IX7 A;  1Z9C A;  1RIO H;  4H4K C;  1RET A;  2RN7 A;  3E0J B;  4ANJ A;  3IWZ A;  1LPQ A;  2MYS A;  4B8X A;  2A6E F;  4Y17 A;  2DFH A;  2MD0 A;  3LMM A;  2C6Y A;  1IG7 A;  2MG4 A;  2Y48 A;  2L7Z A;  3WE3 A;  1X3U A;  4LB6 B;  3VOD A;  3V8K A;  2HYF A;  2OC6 A;  3EET A;  3J7Z I;  5LRS A;  1VFC A;  1LEA A;  1QHH D;  2DK5 A;  4MEX F;  1RUN A;  2Z2S B;  1T2K A;  4F92 B;  2ZSH B;  2HZT A;  2L01 A;  2QSH X;  2DAO A;  2JUC A;  3PQK A;  1SFK A;  5BOX A;  3IKT A;  3QYE A;  1PP8 F;  2EA2 A;  5FJ8 J;  4U0W A;  2Z3Y A;  3GTP J;  4L9V A;  2A6T A;  1Q1H A;  1MJA A;  2EV0 A;  3FM3 A;  3E5X A;  1OR7 C;  4W97 A;  3OYG A;  1SFO J;  1SAN A;  2CH0 A;  2QQA A;  4BS9 A;  2ECB A;  1VI0 A;  3K69 A;  3KPH A;  1ZRC A;  2JQ7 A;  3CP2 A;  4XKB A;  2AS5 F;  2V1X A;  2VJ5 A;  1D1B A;  4CCM A;  3QOE A;  4RAG A;  4OIP F;  5E8G A;  4I02 A;  2Q8K A;  3BLY A;  2KZV A;  2KIM A;  2VT3 A;  3Q5F A;  3TOB A;  5LEJ A;  1HKQ A;  5TRD A;  2CQQ A;  2AXT C;  1ZG1 A;  2QKL B;  4KFC A;  3IAS 2;  1Z6R A;  1YFH A;  5EJC A;  4B09 A;  3L9F A;  4I0B A;  4FCY A;  3RKY A;  3ZQ7 A;  2YS9 A;  2K86 A;  1RUO A;  1IW7 F;  3NRV A;  3I56 I;  2Q1Z B;  1N78 A;  3VFZ A;  2ZXH A;  3WGG A;  2LTP A;  2IPQ X;  1W0T A;  2K85 A;  2HXI A;  2ZJQ F;  4EMS A;  1HKT A;  2GA2 A;  1R5H A;  3RQ4 A;  3BTL A;  4HW0 A;  4BJ6 C;  4WK8 F;  3EUH A;  4NHJ A;  2CRG A;  5E79 C;  2M30 A;  5IYB J;  1SAX A;  1I39 A;  5J8C A;  2HZD A;  2B9S A;  2MGQ A;  5CQG A;  3H0G J;  2P5L C;  2ACJ A;  2P8T A;  3IHU A;  3OIQ A;  2CV1 A;  1UJ8 A;  3F8M A;  4OIR F;  4OAY A;  4KIT B;  2DA5 A;  4YEJ A;  1A6I A;  1P9Q C;  4M3E A;  1U3E M;  3HTU A;  2JPB A;  4M73 A;  3VDX A;  2CW8 A;  5EGO B;  2OJE D;  5LHH A;  1JKO C;  1BR4 A;  4PGH A;  5HDG A;  1X1D A;  2F6C A;  2QA4 I;  2D1V A;  3DEW A;  3CDL A;  1J0R A;  3BJO A;  1HW1 A;  2X6O A;  1J9I A;  1RZ4 A;  2OU2 A;  2P7C B;  2YR2 A;  4L0Y B;  2M4K A;  1QBJ A;  2DA3 A;  5FLX Z;  2KMU A;  3QU3 A;  3SEZ A;  2ID3 A;  4OIO F;  3FXO A;  4FE7 A;  2HFH A;  3CCR I;  2K40 A;  1V5G A;  1IRX A;  2O3F A;  5AON A;  2HTJ A;  3F8C A;  3U2R A;  2KRC A;  2G7U A;  3HIF A;  4DOZ A;  1B9N A;  4LOC A;  1IUY A;  4IEJ A;  3BG6 A;  5DEQ A;  2L7K A;  3QQA A;  2H8R A;  2VKV A;  4LG3 A;  2DT5 A;  1IDZ A;  1STZ A;  3SQN A;  2LY9 A;  1KA8 A;  3OL4 A;  1XCV A;  2BXY A;  4ENM A;  1A35 A;  2Y0M A;  1SMY F;  1YIJ I;  1FYK A;  3D5S C;  3ZRG A;  1ENH A;  3CC2 I;  2COM A;  3BZC A;  5DYM A;  3LA2 A;  3QAH A;  1E3O C;  3Q3S A;  3HJE A;  4IQJ A;  2JZY A;  2LRE A;  2XB5 A;  4XRF A;  4RGS A;  4D0P A;  4I01 A;  1ERD A;  5EG0 A;  4BE0 A;  3SJM A;  1ZR4 A;  1ZHF A;  2H1K A;  2BW3 A;  2VE8 A;  3C2H A;  2OQG A;  4A0Y A;  4AVP A;  5HLG A;  2MLG A;  4X0G A;  1IN6 A;  1ACI A;  3OV8 A;  2V7F A;  4J19 A;  2XB0 X;  2L02 A;  2VN2 A;  4HV6 A;  2CG4 A;  1T0F A;  1YS7 A;  2GZW A;  1J09 A;  4PDK A;  3QP6 A;  1W36 C;  4RB0 A;  2DOA A;  4B47 A;  4II3 A;  3FXQ A;  4OAZ A;  1DU6 A;  3QPT A;  5CVV A;  1IV6 A;  4MTD A;  3N05 A;  5LHI A;  4DIQ A;  1WJA A;  4KT6 A;  1AOY A;  3CLO A;  2LVS A;  4KN7 X;  5JVG F;  2HVQ A;  2L9R A;  1VQ6 I;  2IS4 A;  2AO9 A;  1ZRD A;  1WJB A;  4JX6 A;  1FPQ A;  1X1C A;  4I09 A;  3HZJ A;  2CV0 A;  5B3S H;  5L3C A;  2ME0 A;  1XD7 A;  2JJ7 A;  3O8H A;  1Z0X A;  1GVD A;  4LJZ F;  4CYD A;  1U9N A;  1MMN A;  2P6T A;  3LQQ A;  2R7V A;  1CGP A;  1S29 A;  3CMA I;  2B0L A;  4F91 B;  1ZRF A;  4YEL A;  4UUV A;  1W1W E;  2BYV E;  3ABU A;  3ZN1 A;  2VJ4 A;  3GME A;  2J5O A;  3OYL A;  1NG7 A;  2LOO A;  2LLK A;  3BR2 A;  3KZI C;  4S05 A;  2TDX A;  3JRD A;  2VXD A;  3IAM 2;  2GIZ A;  4DGW B;  3LWF A;  3REO A;  1E17 A;  1IN4 A;  4KMF A;  1ZAO A;  1J2X A;  2E1C A;  3MZ8 A;  3H3U A;  4E7H A;  2GIV A;  3HEF A;  1FMW A;  1XGS A;  1GHC A;  1P7J A;  3T0Y A;  5FB2 A;  3HOT A;  3ZPL A;  3PSI A;  2VPL A;  1QHG A;  1I3A A;  1X4O A;  2LH9 A;  2O6G E;  2PJR B;  3BR0 A;  4HAM A;  2JSC A;  3KET A;  1MDM B;  1HC8 A;  1S3J A;  2PEX A;  3D5R C;  2CQK A;  1TL8 A;  2K3F A;  3ZGK A;  5KHD A;  5C44 J;  4B4C A;  4A3M J;  4BE1 A;  3RPQ A;  4F52 A;  2BY3 A;  1H0M A;  1IGN A;  3N4M A;  3HDD A;  4PJL A;  2LRD A;  2M4G A;  2V9V A;  3WTT C;  4G9Y A;  1FYM A;  4BHC A;  2Z1D A;  2DW4 A;  3BP8 A;  4AC0 A;  1U6G A;  4E70 A;  3A01 A;  1FMV A;  2XIG A;  1YRN A;  2WY8 Q;  3BCB A;  1APL C;  3RPU A;  2EFP A;  2PI0 A;  3S14 J;  2LBF A;  2HPM A;  4GCV A;  2RGV A;  1UG0 A;  4B3X A;  5E20 A;  2KRH A;  2XGX A;  4HPQ A;  2KKO A;  2VIX A;  3LSJ A;  3JR9 A;  3TMO A;  1BI2 A;  1S8N A;  2FNA A;  2KIU A;  2L9N A;  2V26 A;  3OR1 C;  4D7N A;  1YX5 A;  5FLM J;  3CC7 I;  1FYL A;  4WX9 A;  1GXP A;  2PJP A;  5ILS A;  4HBL A;  5GPA A;  3U1K A;  4I7H A;  3I5U A;  4MQV A;  2DN0 A;  2P6S A;  1Z6T A;  3BR6 A;  1KON A;  2ZB9 A;  3P7N A;  3FBI B;  4PGG A;  3PSF A;  2MLK A;  5EDN A;  2LK2 A;  4MHG A;  1XCB A;  4EM2 A;  2ISZ A;  2VPR A;  3LSI A;  2QGU A;  5F27 A;  5IYD J;  2QQB A;  4RAZ A;  3ZMV A;  1VQ4 I;  1MMD A;  1R58 A;  2FMY A;  1IN7 A;  1MJ9 A;  4UVA A;  3VB2 A;  2VBW A;  1MW7 A;  1YQA A;  1YHQ I;  2FXA A;  2M45 A;  2DA4 A;  2X6W A;  3OYF A;  2EQR A;  1B59 A;  3TED A;  3CF5 F;  2JA7 J;  2IBD A;  3LOC A;  3V8L A;  5DS9 A;  2WB1 N;  3S2H J;  2WV0 A;  1Y1W J;  3ECO A;  4O3M A;  3E6M A;  4A0X A;  1R4N B;  3DTK A;  2HYJ A;  2E1O A;  3S3N A;  3WGH A;  3HRU A;  1MGT A;  3CCQ I;  3K1P A;  3KX2 A;  3QPS A;  5EEA A;  1HOM A;  5IT3 A;  3TDZ C;  5FRM A;  1JUS A;  1K83 J;  2CUF A;  5E3L A;  3RDI A;  4P5O A;  5CVJ A;  3H36 A;  2EA4 A;  3PQJ A;  1RKW A;  5HDN A;  1UCR A;  5E18 F;  5CLS A;  1SMT A;  1EH8 A;  3H3Z A;  4ZC3 A;  1QNT A;  2DMT A;  3LFK A;  1GDT A;  3I4N J;  1K6O A;  3KP7 A;  1XSX A;  1CQT A;  3CJR B;  3M8E A;  4L5J A;  2JA5 J;  1SFE A;  4N9H A;  3HKZ A;  1QZY A;  3DKW A;  2A07 F;  3LSR A;  5CKT A;  1LVA A;  3DEU A;  3BG7 A;  4LIT A;  1QRY A;  2RNG A;  1G3S A;  1K4T A;  1HST A;  1MNM C;  3EYI A;  1YS6 A;  4LK0 F;  2E19 A;  3CCL I;  1VF9 A;  3E5Q A;  2E2H J;  2EZL A;  1ZRE A;  4PJN A;  4WWC A;  4AM3 A;  2XUB A;  2VKH A;  5KCM A;  3JRI A;  2K4B A;  2W48 A;  1ORK A;  2R3S A;  1M1E B;  3WTW C;  3ERE D;  1KU9 A;  4XKC A;  2IRF G;  4C3I J;  3I59 B;  5IP9 J;  1QPI A;  1U0J A;  1XGN A;  1AHD P;  1GXQ A;  1R23 A;  3ELK A;  4E6K G;  5FKM A;  2EV6 A;  2RKH A;  3SDB A;  3OSG A;  3I4P A;  3OSF A;  1Y56 A;  1MMS A;  3PNT A;  4AIH A;  1KGS A;  2RVC A;  3QPH A;  4O6J A;  3H9Q A;  5BNG A;  2K02 A;  1VQO I;  1HDD C;  2DTR A;  2JA2 A;  2GM4 A;  3E6D A;  1DP3 A;  5JI6 A;  2L54 A;  3ZMD A;  3F3X A;  4HSR A;  2XV4 S;  3KLO A;  2CS3 A;  4ESB A;  4N4N B;  4IHW A;  3JRC A;  1SVM A;  2XC7 A;  1U5T B;  1FZP B;  1S9H A;  1Y8Q B;  3CCE I;  3WU2 C;  2L7F P;  2IS1 A;  1WJC A;  2FD5 A;  1MBE A;  3FK6 A;  1G59 A;  1NTC A;  2O9L A;  3BCA A;  4M9X A;  2JT1 A;  4BBS J;  1R1U A;  3K4B A;  1NG6 A;  3TQN A;  1TW2 A;  3DBL B;  1ZGW A;  5KK1 A;  4ZDP A;  2QUF A;  1V5F A;  3I58 A;  3I0T A;  4RBO A;  1TWG J;  3NQO A;  4XRS G;  4IL6 C;  2LKP A;  4M72 A;  4IOC F;  2EZH A;  5F0F A;  1BI0 A;  3S3O A;  3HBL A;  2F4I A;  1E3P A;  5ICG A;  4HLY A;  3BJ6 A;  3BY6 A;  4E4H A;  4PFP A;  2RDP A;  1S7O A;  2HTS A;  5LBQ A;  3HOY J;  4RB2 C;  4AIJ A;  2KHM A;  1ITY A;  5DUK A;  3CO7 C;  1MZB A;  2XGE A;  5FKN A;  2R7F A;  1GV2 A;  2HXO A;  4HDU A;  2FNP A;  1ONV A;  3BR5 A;  1MBJ A;  1EA3 A;  1NHA A;  2QWW A;  2EBI A;  2DJN A;  2QBY A;  4QPQ A;  2HDD A;  2RQQ A;  1TT0 A;  3H3V K;  2GXA A;  2Y2Z A;  4X6A J;  5HVQ C;  2CU7 A;  1U5T C;  3CDI A;  3HSE A;  3MFK A;  1XDU A;  2K3P A;  4D9J A;  5M5W J;  5C4X J;  4BHP A;  2O03 A;  4DW6 A;  2FQ3 A;  3LNQ A;  2HKO A;  3PFI A;  5M5X J;  2HVR A;  2GXG A;  5FO5 A;  4A0Z A;  3DF8 A;  1FIA A;  4PUS A;  1BR1 A;  2J5P A;  3D0S A;  3GLL A;  4HEA 2;  4WXH A;  3FHZ A;  3A2K A;  1DP7 P;  1D0X A;  3JTH A;  1R5I D;  3S1Q J;  2Y0S A;  4OU0 A;  2A61 A;  4Q47 A;  3A01 B;  4YIF A;  2XSJ C;  5E3N A;  1X58 A;  4XQF A;  2OA4 A;  1UHM A;  2H6C A;  3PM1 A;  1AKH A;  3TBI A;  3CCJ I;  4LIV A;  4IRI A;  2IS6 A;  4XLA A;  3FIW A;  4MLO A;  1I1S A;  3WHB A;  4IOA F;  1BW6 A;  1KU7 A;  3S2D J;  3OYD A;  1LUJ B;  1F9N A;  3FZV A;  5DM6 F;  3I71 A;  5CYV A;  1G2H A;  2I5U A;  3KP5 A;  4HNV A;  4MO7 A;  1D1C A;  2M7B A;  5M3F J;  2IGO A;  2FU4 A;  4KNY A;  3IP4 B;  3A0H C;  2HU9 A;  5DV5 A;  1OIS A;  4ITV A;  5DTD A;  3PNY A;  4PJM A;  3GFI A;  3UNG C;  1BC8 C;  4N9I A;  4LLN A;  3HL2 A;  3L2V A;  2I8D A;  2K9L A;  1T98 A;  2KFD A;  2CUE A;  2ZXW H;  1FIP A;  1LEB A;  1TW3 A;  1TP4 A;  3FK7 A;  4Y52 J;  3WE2 A;  3FM5 A;  4L18 B;  3C7J A;  4C2U A;  2ZJ2 A;  3C18 A;  2R5Y B;  5LGT A;  3CCV I;  1FOY A;  5LEK A;  4XLC A;  5H6Q A;  4FTH A;  1W7P D;  4KN4 X;  4XLF A;  5D4S A;  5DD8 A;  2KLO A;  1SD5 A;  2OAZ A;  2Z16 A;  3NEU A;  2F5V A;  3WTU C;  3VWB A;  3H92 A;  4I6Z A;  2DDA A;  4HYE A;  5LLQ A;  1Y6I A;  4A93 J;  2OUM A;  4AYB A;  2MW8 A;  3EQL F;  3K70 C;  5J6X A;  3LSK A;  3ZR8 X;  4EJU A;  1WJD A;  2E1M B;  1RNL A;  3LQR A;  1MSE C;  3RZO J;  1I6X A;  2IVM A;  1PUF A;  4GRI A;  4N0B A;  3IV5 A;  1XMX A;  2E2I J;  4OIQ F;  4ZDO A;  2DI3 A;  1KYW A;  1IUF A;  3DPL C;  3AL0 B;  2Y75 A;  1BR2 A;  2KT0 A;  2VON A;  4U0Y A;  1ETQ A;  2R7O A;  5CQE A;  2Q0O A;  1WWX A;  3M1E A;  3CJT B;  2FBK A;  4NQW B;  4KMU X;  2VBX A;  2GOX B;  5ICC A;  1XSD A;  2ZME B;  1Z77 A;  1P2F A;  2RAE A;  2ECC A;  3FXJ A;  1XG1 A;  2WC2 A;  3HUG B;  3T5X A;  4L5E A;  1S7E A;  1BJA A;  3K1M A;  2HQ5 A;  1WH5 A;  3HOZ J;  3FXL A;  5FD6 A;  4BGD A;  4IHX A;  3SEQ A;  2BY2 A;  3ESW B;  2ADU A;  3LFU A;  5H20 A;  3F21 A;  3B73 A;  3ZP5 A;  5JHF A;  3GEZ A;  4A3L J;  3KP4 A;  1I6H J;  4OIN F;  3CF2 A;  1YW7 A;  1X2N A;  4KIG A;  4XLH A;  3BOQ A;  2DT7 B;  1YIO A;  1QO0 D;  1OCZ H;  3S17 J;  1KQ8 A;  3SFZ A;  1FY7 A;  2D1H A;  2CQN A;  2COB A;  2RRE A;  2EIL H;  4BKX A;  4D5C A;  2KL4 A;  1V55 H;  2A05 A;  4Y7N J;  5IY5 H;  1TBX A;  3F6O A;  2Q2E A;  2E1M C;  2HQA A;  2QCO A;  2UXX A;  4ZYG A;  4UVC A;  5TIS C;  3R60 A;  3AKZ A;  4AWX B;  2HVS A;  4YG2 F;  3GZ6 A;  3AL0 C;  3IKV A;  4ESJ A;  2JA6 J;  3W6K B;  4BQQ A;  2R7T A;  5FFX A;  2V1N A;  2VC1 A;  1K79 A;  3I53 A;  1HA8 A;  4QIW N;  2HKX A;  3KYD B;  1XGM A;  4BH9 A;  1MH3 A;  3K4L A;  3FMS A;  5L3D A;  3GZN B;  2ZME C;  1OPC A;  5CVR A;  2VOO A;  1JUM A;  1OCO H;  1U2W A;  2DYR H;  3SXY A;  1N75 A;  2HQR A;  5JLW A;  3RKW A;  1G6N A;  1YW8 A;  2RV8 A;  4P9U A;  2F5C A;  5B1A H;  3FWE A;  2R93 J;  5CVU A;  1FEX A;  1BIA A;  1T95 A;  3AFH A;  5GAH J;  3LA3 A;  2QSG X;  4OWR B;  3HPG A;  4UHT A;  4WF2 A;  3SYT A;  4R79 A;  1LFU P;  1S72 I;  3OIP A;  2M1B A;  2HPI A;  2YX4 A;  4B3A A;  2DO7 A;  5E1W A;  4W1U A;  1IN5 A;  2FSW A;  5D5X B;  4LG0 B;  3RIR A;  5HNF A;  1WGX A;  1JKR C;  4UUS A;  1Z7L A;  1Z21 A;  2V9P A;  2EPF A;  3WTV C;  4RDU A;  3CUQ B;  1W5C C;  3DBR B;  3Q9S A;  1G8X A;  1ETV A;  2O8X A;  3OR2 C;  4P9F A;  3MD2 A;  4HZF A;  1A04 A;  1LNW A;  4R1H A;  1HKS A;  2LC2 A;  4GYG A;  5FKK A;  3GTG J;  3O3K A;  4DZP A;  5HOD A;  1SAU A;  1T6S A;  3OYM A;  5J1U A;  3HGY A;  1VZ0 A;  2DDB A;  4S04 A;  3L2U A;  1HCR A;  6PAX A;  1FTZ A;  3BG3 A;  4MTE A;  2DPU A;  2HNH A;  3IH2 A;  2ZFU A;  3M7G A;  1DDN A;  2M8G X;  3CJQ B;  1X3W B;  2I10 A;  4G6D A;  1SD4 A;  5H6R A;  2VXZ A;  2LP0 A;  4CYC B;  1O3S A;  1TLH B;  4AU7 A;  2MFZ A;  4DJA A;  2NYX A;  5DCM A;  3F22 A;  3EUK L;  1CF7 B;  3ZQI A;  4XL9 A;  1B72 B;  1PP7 U;  3TO7 A;  1K78 B;  3JCU C;  4HST A;  2ID6 A;  3HXL A;  1QGP A;  2NOG A;  2ZNZ A;  4NUB A;  1TNT A;  2L9V A;  1D0Y A;  3GX4 X;  2O8K A;  4MIM A;  3F6V A;  4UVB A;  4ZYA A;  4KIS A;  2JN6 A;  2AHQ A;  3E7L A;  4MQ9 F;  4DNC A;  3ABM H;  3JRF A;  1ZKG A;  4L5I A;  2M2E A;  1J75 A;  3TDU C;  4V2G A;  3U21 A;  1W0U A;  2CYY A;  1H88 C;  4N4O B;  5F6F A;  5GPC A;  1A31 A;  3OMY A;  3E97 A;  4J01 A;  1TQP A;  3GLX A;  2W84 A;  3OIO A;  3L1P A;  1RI7 A;  2XAG A;  3CUQ C;  3KFW X;  4XKW A;  1Y0N A;  3M07 A;  5EZG A;  2WV1 A;  2Y9Y A;  1OLT A;  4E7L A;  4FQG A;  3A03 A;  4M6X A;  5M5Y J;  3K4J A;  1LFB A;  1WQ2 A;  3GF2 A;  2LY1 A;  3DU5 A;  3M8J A;  2EFW A;  1LQ1 A;  3S8P A;  2OCC H;  4E7J A;  3O2P E;  1LE8 B;  1XS9 A;  1JGS A;  2YU9 J;  5J4V A;  1BW5 A;  4JK1 X;  3IH4 A;  3S93 A;  1ZN2 A;  5FKL A;  4BJT A;  3Q0W A;  4QTR A;  4M9Z A;  2IW5 A;  4DQ2 A;  1IC8 A;  2E7W A;  3I54 A;  4BEH B;  1Z91 A;  1Z67 A;  2V79 A;  4UB8 C;  1F5T A;  1H9G A;  1S5L C;  1HLV A;  1IRF A;  2FML A;  4MFD A;  3CC4 I;  1MBG A;  5KNL A;  3MWM A;  4NB5 A;  1B8I A;  2PBI A;  3KEO A;  2ZJR F;  1KZH A;  1Y8R B;  2M5W A;  2IEK A;  2A3S A;  2NVT J;  1IXS B;  4B43 A;  2M9H A;  2QVO A;  4MGR A;  4A3I J;  1JUP A;  4RAF A;  3WTS C;  2JTV A;  4Y3O A;  5HS7 A;  3AG1 H;  3WU0 A;  4BDY A;  1G3T A;  2NAZ A;  3GTJ J;  2HS5 A;  1WPK A;  3BPV A;  1HW5 A;  3K0L A;  1W36 D;  1JXS A;  4KJZ A;  1JTY A;  1O4X A;  3C3W A;  1DU0 A;  2LDU A;  2UZK A;  3ZMS A;  1FBS A;  5IP6 A;  1OJL A;  2NVY J;  2P0W A;  3VEP A;  5KAI C;  1OFC X;  3GBG A;  2XPU A;  3IRR A;  4HG2 A;  2VE9 A;  1OMI A;  1Z05 A;  5DDG A;  1JKP C;  3HOX J;  1JTX A;  2A5W A;  2PMZ A;  2VT2 A;  2X85 A;  3W2W A;  4F93 B;  1F36 A;  3ZQH A;  2CQ7 A;  1W7P A;  2KJC A;  3F72 A;  2W7N A;  3H5R A;  3Q0V A;  4BYY A;  3C1D A;  3SDG A;  3KZY A;  2E60 A;  2IAI A;  4HX8 A;  4Y4R A;  2W82 A;  3FKI J;  3JRA A;  2ELH A;  2MD5 A;  3BDD A;  3S32 A;  3KIO A;  1FBQ A;  1O3T A;  1J5Y A;  2BVL A;  4BAC A;  3GVA A;  1AA7 A;  2CW7 A;  5JR3 A;  1KQ9 A;  2OBP A;  4YRV A;  3OYH A;  2XKP A;  1U8R A;  3PIP F;  1GLN A;  5D8L B;  4C2T A;  2F4O B;  2FQ4 A;  3TL4 X;  2XF6 A;  1T08 B;  3E6B A;  2EK5 A;  5J1Y A;  4PJJ A;  4ABZ A;  2MA3 A;  2DOD A;  3PUF A;  3R0A A;  4L9N A;  5FD5 A;  4Q4Z F;  5K7H A;  1JHF A;  5IT9 Z;  1MMA A;  1XDS A;  4XN3 A;  4A2U A;  4G94 A;  3DXJ F;  5IOY A;  2LY2 A;  5J47 A;  3DEE A;  3WGI A;  4BDZ A;  1QA6 A;  2VJI A;  5M3M J;  3BRO A;  3HKZ N;  2ZNY A;  1O3Q A;  3S1N J;  4NC8 A;  2PN6 A;  2R7Q A;  3F8N A;  2DFF A;  3OS2 A;  3HOV J;  4IKF A;  2DA7 A;  5ICE A;  5ILU A;  1R5G A;  3CLQ A;  2WAQ A;  3GFL A;  3CME I;  1FSH A;  2VL8 A;  1MH4 A;  1ULY A;  2VLA A;  3VSK A;  1FLI A;  1B1B A;  3OYC A; 
#chains in the Genus database with same CATH homology
 3HOY J;  2JK3 A;  2XPW A;  2DMP A;  1ITY A;  2HI3 A;  3BR1 A;  1RET A;  2XGE A;  5FKN A;  3MN2 A;  4D5F A;  1GV2 A;  2PMZ N;  2LKX A;  2HXO A;  1IG7 A;  2MG4 A;  2L7Z A;  1GV5 A;  3BR5 A;  1MBJ A;  4A3F J;  2JMW A;  1JGG A;  2EBI A;  2DJN A;  3RKQ A;  1HF0 A;  2HDD A;  3H3V K;  4JX5 A;  2G0E A;  1U78 A;  1VFC A;  2Y2Z A;  4X6A J;  2CU7 A;  5GP9 A;  5M5W J;  3ZQC A;  5C4X J;  3GTM J;  5FJ8 J;  3GTP J;  4C3J J;  2LD5 A;  4DW6 A;  4IHV A;  3LNQ A;  5M5X J;  4W97 A;  1SFO J;  4XID A;  1ETY A;  2X9D A;  1SAN A;  2ECB A;  1VI0 A;  2HOT A;  1ETX A;  1PUF B;  1FIA A;  4IHY A;  4JYK A;  3MVP A;  1BJZ A;  5E3M A;  4XK4 A;  5EZH A;  3S1Q J;  4A3G J;  2NS7 A;  3M4O J;  3A01 B;  4D7M A;  5E3N A;  1X58 A;  1H8A C;  2CQQ A;  3TW6 A;  3CCY A;  1A5J A;  1OCP A;  3PM1 A;  1AKH A;  4M3B A;  3HB9 A;  3W6V A;  1RPW A;  2WAQ N;  3FIW A;  4MLO A;  4A69 C;  3WHB A;  3GTL J;  1BW6 A;  4BY7 J;  4A3E J;  2GBY A;  4FCY A;  2L0K A;  3S2D J;  3RQI A;  4A3C J;  2ELK A;  4FIS A;  2Y30 A;  1G2H A;  2YS9 A;  2R5Z A;  1MBK A;  4HNV A;  3CQZ J;  4MO7 A;  2LTP A;  1W0T A;  5M3F J;  5FKO A;  2HXI A;  3LSP A;  2CJJ A;  3TW7 A;  5DTD A;  5F08 A;  3QPL A;  3BTL A;  5EG0 B;  3GTO J;  2CRG A;  5K7Z A;  5E3O A;  5IYB J;  1RR7 A;  2CUE A;  1FIP A;  1GT0 C;  3FK7 A;  2MGQ A;  3HGG A;  5F0H A;  4Y52 J;  2E2J J;  3H0G J;  1Q1V A;  2XSD C;  2R5Y B;  2DA5 A;  2OF7 A;  4FTH A;  1F43 A;  1EF4 A;  1A6I A;  1H89 C;  4M3E A;  5EGO B;  1JKO C;  1GUU A;  2R92 J;  4XIC A;  4I6Z A;  3DEW A;  3CDL A;  4A93 J;  4C3H J;  2MW8 A;  2X6O A;  1TC3 C;  2Y0S N;  1U9O A;  1MSE C;  3RZO J;  2EH3 A;  4C2M J;  1PUF A;  2DA3 A;  1IDY A;  4XRS A;  1IJW C;  3IV5 A;  2ID3 A;  3G1L A;  2E2I J;  4FE7 A;  1IUF A;  3BTC A;  2K40 A;  2XPV A;  1JJ6 C;  2KT0 A;  2FJ1 A;  4LOC A;  1ETQ A;  4IEJ A;  1JT0 A;  5IOZ A;  3JRG A;  3QQA A;  2NS8 A;  1ZK8 A;  2H8R A;  2VKV A;  4JX4 A;  1IDZ A;  2LY9 A;  1Z77 A;  2Y31 A;  4A3J J;  2RAE A;  2ECC A;  2M0C A;  1P7I A;  1XG1 A;  2L7M P;  4L5E A;  2X48 A;  1S7E A;  2N8G A;  2XRL A;  1ENH A;  2HQ5 A;  1WH5 A;  4UUS B;  3HOZ J;  2Y9Z A;  4IHX A;  5C3E J;  1E3O C;  3Q3S A;  1OCT C;  3ZOB A;  1FJL A;  2XB5 A;  1AU7 A;  4V2F A;  4A3L J;  1I6H J;  5EG0 A;  3BG5 A;  3SJM A;  3DCF A;  3NAU A;  1ZR4 A;  1X2N A;  2B63 J;  5F0C A;  2H1K A;  3S1R J;  3UKG A;  4A3B J;  3S17 J;  4J19 A;  2XB0 X;  3M3Y J;  2COB A;  4BKX A;  5C4J J;  2R5Y A;  4D5C A;  1ZQ3 P;  4Y7N J;  1WI3 A;  1UG2 A;  2QCO A;  2TRT A;  5J1R A;  3K7A J;  4AYB N;  2K9S A;  2O7O A;  4QSH A;  1DU6 A;  4M6V A;  1IV6 A;  2JA6 J;  1BA5 A;  5K7F A;  2GLO A;  3K2A A;  1YRN B;  2JA8 J;  5F04 A;  4AUX A;  2LVS A;  3ZQF A;  4QIW N;  3GTQ J;  2L9R A;  1MH3 A;  2AO9 A;  4M3F A;  1IRZ A;  4JX6 A;  1JUM A;  2ME0 A;  2JJ7 A;  4UUT A;  3O8H A;  3HM5 A;  1Z0X A;  1GVD A;  5JLW A;  3JRB A;  1U9N A;  2DMQ A;  2R93 J;  5IPA A;  4BY1 J;  2DA6 A;  1FEX A;  1UHS A;  2VUM J;  5F1J A;  3FIS A;  3SFI A;  3TP0 A;  1LFU P;  1FTT A;  2LLK A;  3BR2 A;  3BQZ A;  4B3A A;  3JRD A;  4W1U A;  4M3G A;  1WGX A;  1JKR C;  4UUS A;  1ZR2 A;  3I4M J;  1TWH J;  1T56 A;  4RDU A;  3HEF A;  2TCT A;  1ETV A;  1P7J A;  4DYQ A;  3HOU J;  3IH3 A;  5FKK A;  3GTG J;  4DZP A;  1X2M A;  3BR0 A;  2NVX J;  5HOD A;  1ZTR A;  2KDZ A;  2HOA A;  4JP0 A;  2EZI A;  5J1U A;  3HGY A;  1BL0 A;  1HCR A;  1FTZ A;  3BG3 A;  2DTZ A;  5J3L A;  2DMN A;  3IH2 A;  1XC5 A;  4M3D A;  4DYC A;  4B4C A;  2M8G X;  5C44 J;  4A3M J;  3VPR A;  2I10 A;  1B8I B;  1IGN A;  4CYC B;  1WH7 A;  1TWF J;  2LP0 A;  1K61 A;  3HDD A;  3PO3 J;  3BR3 A;  2DMU A;  3ZQL A;  5IYC J;  3BG9 A;  3B6A A;  3ZQI A;  1B72 B;  2DA2 A;  3RZD J;  4AC0 A;  3Q0U A;  3A01 A;  1YRN A;  2ID6 A;  1APL C;  2NOG A;  3S14 J;  4A3D J;  2O8K A;  4MIM A;  4FE4 A;  2R0Q C;  2JN6 A;  2AHQ A;  3E7L A;  3TP3 A;  3S15 J;  3F0C A;  3JRF A;  1ZKG A;  2M2E A;  3LSJ A;  3JR9 A;  1RES A;  4V2G A;  1W0U A;  1H88 C;  5GPC A;  4D7N A;  4BXX J;  3S16 J;  1UMQ A;  5FLM J;  3OIO A;  3ZQG A;  3L1P A;  1JKQ C;  5GPA A;  3JRH A;  1HDP A;  2DN0 A;  5EZG A;  3BR6 A;  3BTI A;  1MBF A;  3LSG A;  2WV1 A;  2ZB9 A;  5JLX A;  1I3Q J;  2Y9Y A;  2R7Z J;  3MKL A;  3A03 A;  5EDN A;  2LK2 A;  5M5Y J;  2VPR A;  5F27 A;  5FLV A;  1RKT A;  5IYD J;  1LFB A;  1T33 A;  2FX0 A;  3PO2 J;  1JJ8 C;  3NAR A;  2NVQ J;  1LE8 B;  1XS9 A;  2YU9 J;  2DA4 A;  4G12 A;  1BW5 A;  2EQR A;  3CMY A;  3IH4 A;  4EEF G;  1JT6 A;  3B6C A;  3TED A;  2EZK A;  5FKL A;  2JA7 J;  2IBD A;  3LOC A;  3Q0W A;  4QTR A;  5DS9 A;  5EGO A;  2WB1 N;  2CQX A;  1Y1W J;  3S2H J;  1IC8 A;  1MSF C;  1MBH A;  4DYR A;  4B1R A;  4MFE A;  2HYJ A;  4BBR J;  2MSY A;  2E1O A;  4GFB A;  1HLV A;  1QVT A;  1Y1V J;  4MFD A;  4X1E A;  3QPS A;  1TWC J;  5EEA A;  1HOM A;  3OOU A;  1I50 J;  1MBG A;  3A02 A;  5IP7 J;  3BT9 A;  1B8I A;  1JUS A;  4CYC A;  1K83 J;  2CUF A;  5E3L A;  4DZJ A;  3BQY A;  2JWT A;  2M34 A;  3BTJ A;  2IEK A;  1RKW A;  1B72 A;  2NVT J;  2K9Q A;  2M9H A;  1GDT A;  2DMT A;  3I4N J;  4A3I J;  1JUP A;  2XGC A;  2LFB A;  1ETW A;  1CQT A;  5EYR A;  2JA5 J;  1U8B A;  1TWA J;  3GTJ J;  3LSR A;  2K9N A;  4A3K J;  1WPK A;  1POG A;  2YUS A;  2D5V A;  1VND A;  1QRY A;  3D1N I;  1JTY A;  1O4X A;  2VKE A;  1MNM C;  1DU0 A;  2E19 A;  1VF9 A;  2E2H J;  2EZL A;  2QF7 A;  3WHC A;  5IP6 A;  1D5Y A;  5EF6 A;  1OJL A;  2NVY J;  2XGD A;  1QVU A;  1OFC X;  3GBG A;  2XPU A;  3G1O A;  1WCM J;  3JRI A;  1ORK A;  2W48 A;  2DA1 A;  2LR8 A;  1JKP C;  4C3I J;  5IP9 J;  3HOX J;  1JTX A;  1NK3 P;  1QPI A;  1AHD P;  4NDL A;  3O8G A;  1F36 A;  5FKM A;  3ZQH A;  3OSG A;  3OSF A;  3Q0V A;  3SDG A;  2IAI A;  5BNG A;  3JRE A;  1HDD C;  1LE8 A;  2GM4 A;  3GTK J;  3FKI J;  3JRA A;  3C2B A;  4I76 A;  2OPT A;  3G1M A;  4IHW A;  3JRC A;  9ANT A;  1ETO A;  2FQ4 A;  1ETK A;  5J1Y A;  4ABZ A;  2L7F P;  5K7H A;  2FD5 A;  1MBE A;  3FK6 A;  2O9L A;  1NTC A;  2VI6 A;  5IOY A;  4BBS J;  2HOS A;  2ME6 A;  2P81 A;  1AKH B;  1ZGW A;  5M3M J;  3HKZ N;  3S1N J;  4RBO A;  1TWG J;  4S0H B;  1NK2 P;  1R9T J;  3HOV J;  4XRS G;  2DA7 A;  4XRM A;  2R5Z B;  2EZH A;  5F0F A;  1MH4 A;  3HBL A;  3HOW J;  3S1M J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...