1JGGA

Even-skipped homeodomain complexed to at-rich dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
57
structure length
57
Chain Sequence
RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the even-skipped homeodomain complexed to AT-rich DNA: new perspectives on homeodomain specificity.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords 5'-D(P*TP*AP*AP*TP*TP*GP*AP*AP*TP*T)-3'
total genus 19
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jggA00
1VI0A 5JLWA 1YRNA 4Y52J 2R92J 1H88C 2RAEA 4LOCA 1RKTA 1QRYA 4A3EJ 3S15J 1X2NA 5IYDJ 4C3JJ 3HDDA 1JT6A 4MLOA 5FKNA 1BL0A 1OFCX 3D1NI 2R5ZB 5EG0B 1XS9A 1HCRA 2GBYA 1H89C 2JN6A 3Q3SA 5FKOA 1HOMA 1ZK8A 1IUFA 3ZQGA 1JUSA 2EZKA 2XGDA 5EGOA 1NK3P 4BBSJ 2I10A 3GTMJ 2EZHA 3GTKJ 2Y30A 5FKMA 4A3BJ 3MN2A 1MBFA 1WI3A 2Y2ZA 2CJJA 1MSFC 2M8GX 1JKOC 1GUUA 3BQZA 4QIWN 3BT9A 1P7IA 1Y1WJ 3DCFA 3HOUJ 4M3BA 1I50J 3Q0WA 2PMZN 3S1QJ 2M34A 4FISA 4UUTA 1TWFJ 5FJ8J 4C3HJ 3JRCA 1QPIA 2ELKA 3CCYA 2DMUA 2DMTA 4RDUA 5IYBJ 4D7NA 1RPWA 2MGQA 2ECBA 1X2MA 2AHQA 1FJLA 4A3LJ 2DN0A 2TCTA 1TWCJ 3HKZN 2ME0A 1FIPA 3GTQJ 4M3EA 3TP3A 4G12A 2EQRA 2ID3A 4FE7A 5IP9J 4XRSA 5FKLA 4C3IJ 2OF7A 3L1PA 2NVYJ 3HBLA 2H1KA 3BR2A 2DA6A 3SDGA 3F0CA 2NOGA 1WGXA 3HGGA 5IOZA 5EZHA 1WPKA 1VFCA 1JUMA 5F1JA 3FK7A 2XGEA 4MFEA 5F04A 2K9NA 3WHCA 5K7ZA 3CMYA 1RR7A 1NTCA 2DA7A 5F0FA 4XRSG 3GBGA 1X58A 3IH3A 3CQZJ 3BG5A 3QQAA 1Z77A 1ZGWA 3BQYA 2DA1A 4MIMA 1MH3A 1OJLA 3W6VA 4IHVA 2Y9YA 2DMQA 1BW5A 3HOWJ 5GPCA 3ZQFA 1IJWC 2FQ4A 2EZLA 2HYJA 2E2HJ 1NK2P 1CQTA 1S7EA 3LOCA 5EG0A 2DA2A 1WCMJ 4J19A 3OSFA 2DTZA 2M9HA 4FTHA 5EEAA 3B6AA 5FLMJ 2JA6J 3S17J 2E19A 3BR1A 1ZKGA 3BTJA 4JX5A 3TEDA 1JUPA 1SFOJ 1Z0XA 3HOXJ 2EBIA 3JRDA 1MNMC 3HEFA 1XC5A 4A3CJ 2JA7J 5EZGA 1BW6A 4RBOA 4W97A 1EF4A 3RQIA 3GTLJ 2LR8A 4DYQA 3JRGA 3FIWA 1R9TJ 3E7LA 3JRFA 2EZIA 2NS7A 2COBA 2K9SA 5HODA 5F27A 2NVTJ 5M5XJ 1WH7A 5J1RA 1IV6A 2CRGA 2CUEA 1A5JA 3S1NJ 2XSDC 1IG7A 3TW7A 1Y1VJ 5E3LA 4FCYA 2GM4A 2LFBA 5GPAA 3JREA 1K83J 1B8IB 2O7OA 1GDTA 2VI6A 5DTDA 1ETVA 1FEXA 1AKHB 1GVDA 2YUSA 2XPUA 2HXOA 4S0HB 1AHDP 2M0CA 2WB1N 3BTIA 4UUSA 2R7ZJ 2JK3A 2W48A 1W0UA 4XIDA 5JLXA 2VPRA 1JTXA 1UHSA 1LFBA 1P7JA 4W1UA 3A01A 2R0QC 1UG2A 2ME6A 1TWAJ 3S2HJ 2EH3A 3G1OA 1F36A 2LVSA 4M3FA 3S1RJ 1RETA 2Y0SN 1MBEA 1T56A 3OIOA 1GT0C 1Q1VA 3RZOJ 3SJMA 5E3OA 4AC0A 3HOYJ 3OSGA 2DA3A 2ECCA 1AU7A 2JA5J 4B1RA 5E3NA 2LK2A 5M5YJ 1IRZA 1ETOA 3HOZJ 3JR9A 3LSJA 1QVUA 4GFBA 4D7MA 3UKGA 5FKKA 4V2GA 3Q0UA 3DEWA 1GV5A 2QF7A 1ZR4A 5C4JJ 5F0CA 1PUFB 3IV5A 1TWGJ 4X1EA 1O4XA 3ZQLA 2JMWA 4A93J 1OCPA 5F08A 3IH4A 1FTZA 5BNGA 2L9RA 1JKRC 5J3LA 5E3MA 3G1LA 3H3VK 3VPRA 4JX4A 5F0HA 4XICA 2FJ1A 3LSRA 2Y9ZA 5IYCJ 5K7HA 3ZQIA 4ABZA 2HOSA 2HI3A 2R5YB 1YRNB 1VNDA 3K2AA 3GTJJ 1ORKA 2XGCA 3S1MJ 5IOYA 3S14J 1JJ8C 4CYCA 2CU7A 2NS8A 4HNVA 1PUFA 2DMNA 3JRBA 2HOTA 4DZPA 3FK6A 2QCOA 1RKWA 1B72A 3GTPJ 2X48A 3HM5A 4QSHA 2L7ZA 2K40A 4XK4A 2L7MP 4IEJA 2FX0A 4A3IJ 5J1UA 1BA5A 4A3DJ 3FKIJ 5FLVA 1TWHJ 3SFIA 4EEFG 1JJ6C 2MW8A 4B3AA 1UMQA 4M3DA 3H0GJ 3MKLA 4A3FJ 3RKQA 1VF9A 3PO3J 1GV2A 4BY7J 2E1OA 3BR5A 3BTLA 3JRAA 1DU6A 3B6CA 3S2DJ 2DMPA 2VKEA 4A3JJ 1ZTRA 2IBDA 3I4NJ 2LY9A 3BG9A 2KT0A 2WV1A 2XPVA 4DYCA 1B72B 1RESA 3A02A 3Q0VA 4FE4A 1MSEC 3BTCA 5GP9A 2XPWA 1IC8A 3GTOJ 5DS9A 2JWTA 3QPLA 2NVXJ 1I3QJ 4B4CA 5C4XJ 3LSPA 4NDLA 2NVQJ 4IHXA 3ZQHA 2JA8J 4QTRA 3FISA 2R5YA 3S16J 3K7AJ 3LSGA 3IH2A 2HQ5A 1JGGA 1FTTA 3O8GA 1ETKA 4A3MJ 5J1YA 5EDNA 3A01B 2FD5A 1HLVA 1LE8B 1JT0A 3ZQCA 1JKPC 4XRMA 3I4MJ 3M3YJ 2LD5A 1TC3C 4IHWA 2B63J 1IDZA 3PM1A 2Y31A 5EYRA 4BY1J 2K9QA 1POGA 1JTYA 4C2MJ 2LKXA 4V2FA 3MVPA 2AO9A 3HB9A 5EGOB 3HOVJ 1U9NA 5C3EJ 3TP0A 1ITYA 1U8BA 2ZB9A 4BKXA 1I6HJ 2D5VA 4A69C 3NAUA 2M2EA 2LLKA 5M3MJ 5IPAA 2XB5A 3O8HA 1MBKA 2DA4A 1LFUP 1HF0A 4D5FA 2X6OA 1QVTA 4D5CA 2DA5A 3CDLA 1JKQC 1HDPA 1A6IA 4BBRJ 2CQXA 5EF6A 1LE8A 1ETYA 1IDYA 2XRLA 2E2JJ 5M3FJ 1ETXA 2IEKA 2YS9A 3ZOBA 3OOUA 4AUXA 4UUSB 1ENHA 4JP0A 1XG1A 4Y7NJ 2P81A 1U9OA 1FIAA 1AKHA 4L5EA 1BJZA 1K61A 3BR6A 4X6AJ 3C2BA 3HGYA 1HDDC 1ZQ3P 2L7FP 3WHBA 2CQQA 2VUMJ 4DYRA 1D5YA 4DW6A 1W0TA 2OPTA 3GTGJ 4MFDA 1E3OC 2YU9J 2TRTA 2R93J 3LNQA 1APLC 5K7FA 4JYKA 3M4OJ 1G2HA 1ZR2A 2CUFA 1WH5A 2N8GA 4A3GJ 2IAIA 2XB0X 1MBGA 1SANA 4IHYA 3RZDJ 2O9LA 2LP0A 2GLOA 3JRIA 3A03A 2VKVA 1DU0A 2JJ7A 2MSYA 1U78A 2HXIA 2MG4A 3NARA 4DZJA 1MH4A 2G0EA 3BR3A 2WAQN 1H8AC 1B8IA 1OCTC 2X9DA 4AYBN 5IP7J 2LTPA 4M6VA 1MBHA 5C44J 2H8RA 1IGNA 2HOAA 4I6ZA 1ETQA 1T33A 9ANTA 2L0KA 2E2IJ 4M3GA 5M5WJ 1ETWA 3PO2J 2O8KA 3QPSA 3BR0A 4A3KJ 4JX6A 2KDZA 2HDDA 1F43A 2DJNA 5IP6A 4MO7A 4CYCB 2ID6A 3TW6A 3BG3A 3JRHA 4I76A 2R5ZA 3G1MA 4BXXJ 1MBJA
chains in the Genus database with same CATH superfamily
1Y0NA 1VI0A 1MMGA 1LDKB 4Q4ZF 1HBXG 2R92J 2Q1ZB 2EPFA 2RAEA 1XCBA 4LOCA 1RKTA 4NUBA 2QVOA 4EJOA 1QRYA 3S15J 4KICA 2P6TA 2IA1A 3GWZA 5JHFA 2CV1A 3DPUA 3SZGA 1BL0A 4G6TB 4XRFA 3AG4H 2QKLB 2JN6A 3TO7A 2IP2A 2GAUA 4B47A 1FP1D 1R00A 3ZMDA 4J01A 2MFZA 2V26A 2OQRA 5EGOA 2ZFUA 4U88A 2DK8A 1TNSA 3P7NA 2UV1A 3BPVA 4XLNF 5KHDA 1BC8C 3HC7A 4IF4A 2WWYA 2E7XA 3GEZA 4BU2A 5DUKA 1MBFA 1RRJA 3H3UA 4KT6A 1I3AA 1S7AA 2CJJA 3H5RA 2M8GX 4RB1A 1MSFC 5GAEJ 2ESHA 3LSHA 3BQZA 2IGMA 4QIWN 4P9UA 3BT9A 1ODDA 1DP7P 3DCFA 4F92B 4YIFA 3CJQB 1BM9A 3A0BC 3S32A 4YFXF 2GA2A 4A6DA 3EPZA 2BBYA 1IRFA 5FJ8J 3OYHA 1SAXA 5DD4A 4CZCA 4H4KC 4RMNA 1L3LA 1KU3A 4II2A 1J9IA 2HZTA 2V1NA 2ECBA 3F23A 2M87A 4KMUX 3ZMVA 3M1EA 2V9KA 2XAFA 1RZ4A 4ZZLA 3HKZN 2RC4A 2Z1DA 4HV6A 2L2OA 2L9SA 4M3EA 3K1PA 1YIJI 5J4YA 2EQRA 3G73A 4FE7A 5L3CA 4ESJA 5TRDA 3OL4A 4KN4X 3L1PA 2DOEA 2NVYJ 1MJBA 5FLXK 3BR2A 5K5QA 3SDGA 3HHHA 1AA7A 1Z6TA 4BJ5C 3JSOA 3CF2A 1WGXA 5KCMA 2XHKA 2P0WA 2W4SA 4F3QA 4KN7X 4YG2F 2MYSA 4JOMA 2KLOA 5H6QA 3MEXA 1K79A 3SQNA 3T5XA 1K4SA 1YLFA 4M6YA 5F1JA 2KIMA 2Z2SB 2MH2A 2Q2EB 3FK7A 4MFEA 5F04A 3TDZC 3WHCA 1QNTA 4KIBA 3LA3A 4G8XA 1UHMA 3TO6A 4R79A 2QSGX 3RJPA 2KZGA 1JXSA 1J2XA 4RLFA 1YW7A 2GWRA 1Z77A 1ZGWA 3GFJA 2PI0A 4OIRF 3L2CA 3F9KA 4L9NA 3PIOF 2E34A 2R7WA 2DMQA 3CCUI 1IV8A 1WJBA 1XSDA 5GPCA 3OWTA 1FX7A 4WWCA 2LDUA 5HLHA 4OIOF 3RKWA 4RB0A 1IJWC 2HYJA 1IAWA 1E3PA 4CCLA 3O2PE 2M9HA 4KIGA 4RAGA 5LHIA 5EEAA 2EV5A 3B6AA 3KCCA 3F6VA 4ZYGA 2BW3A 3OYDA 4C2UA 2CW7A 3S17J 1HSJA 1W5SA 4XORA 3TEDA 2LBFA 1NH3A 4C30A 4B48A 1SFOJ 3U21A 1V3FA 3GVAA 1VQMI 3HEFA 2HKOA 3DEEA 5TISC 4EATA 2JA7J 4A3CJ 2E71A 4E7IA 1R1TA 4XQFA 2QLZA 4DQ2A 4RBOA 1WFXA 4W97A 3RQIA 4HF1A 3GTLJ 2PEXA 3R0JA 4M9SA 3HG9A 1XN7A 4HQMA 3JRGA 2L54A 4F7ZA 1R9TJ 1VQ6I 1TZLA 3JRFA 4IRHA 5F27A 2NVTJ 1S5LC 5D5UB 3OYFA 4G94A 5M5XJ 5J1RA 2QYOA 1K4TA 2OU2A 2MC4A 2CRGA 2HR3A 2HFHA 5HLTA 1F4KA 4FX4A 4A0YA 3TDUC 2LFBA 5GPAA 3JREA 5CVRA 3LSTA 4BQNA 5E1ZB 1HQCA 3L7WA 2H94A 1B8IB 1ETVA 4IQJA 4CGZA 2IGKA 5TJJA 5BMZA 2CYYA 1KU7A 1F5TA 1D5VA 3H5NA 3WTSC 4HEA2 3QOPA 1W0UA 2L01A 2PN6A 1LFBA 1TL8A 2Z33A 3HPGA 4A5NA 4AD9A 1H9TA 3K9TA 3LSIA 4M3FA 3S1RJ 3DFGA 2WV0A 3FMSA 1MBEA 2FA5A 2QQ9A 4PFPA 1GT0C 2HZDA 1OCOH 3SJMA 2KIQA 4A6EA 2XGXA 5E3OA 3SEZA 4I99C 3L00A 3H0DA 5DYMA 4YRVA 2W57A 4ENMA 1BI3A 2ECCA 2K7LA 3OSGA 3WTVC 4AYBA 3LSJA 1BR1A 2MLKA 1IN8A 3ROUA 4HA8A 1Z7LA 2GQQA 5ILUA 4D7MA 2FNAA 2MD5A 2KKOA 5FLXZ 1Z1DA 1R1VA 2B0LA 2TDXA 2M7BA 3DEWA 5A2QZ 1JI8A 2QF7A 1P2FA 1ZR4A 5C4JJ 5F0CA 1R5ID 3FX3A 1JGSA 2WC2A 1VQ4I 4X1EA 3ZQLA 3K70D 3IL2A 2EK5A 3J7AY 3P9IA 2FRHA 5HS7A 3BG7A 3GZ5A 1ZRFA 4NC8A 1P6RA 2BZTA 2B7EA 2DFFA 4XICA 5BPIA 1XDSA 1TTYA 3RCOA 5IYCJ 3T1BA 3I59B 4XKBA 1RR8C 5ICGA 2CWEA 2HI3A 3RPUD 4S04A 2R7OA 5F1RA 3D5SC 2W24A 2NNYA 3ASOH 2X0LA 2HPMA 2XGCA 3S14J 4LIVA 3FXQA 1JJ8C 5IY5H 5CVJA 4ASNA 2NS8A 3JRBA 1PUEE 3DTIA 1GVJA 3FDYA 2XSJC 1HW2A 4P1WA 2L7ZA 2XAGA 1BIAA 1XMXA 2K40A 3K70C 5D4SA 3EETA 3HZJA 3ECHA 2FX0A 3UR3C 1UELB 4R8HA 4S05A 3I56I 4A3IJ 4UHTA 3LMMA 1BA5A 3CD6I 1F9NA 2XAHA 3QWLA 5FGMA 3P9KA 2HYGD 1TWHJ 3AG3H 3DPTA 3SFIA 2DT5A 5HNHA 2DPUA 2OAZA 4OOIA 3VSLA 1JJ6C 4F91B 5CKTA 3H92A 4A0ZA 3QPHA 5HVQC 1U2WA 3FXOA 3H1CA 2E1NA 4BY7J 1OPCA 3QP6A 2VIXA 3JAMZ 4PZJA 3JRAA 3HOSA 4KYWA 5KAIC 2VL8A 2EIKH 3DP7A 5EEGA 5EEHA 2ZSIB 1BI2A 4IQ4A 1U6GA 5FRMA 4KIFA 2JSCA 3X2QH 4WXHA 2KT0A 5LLQA 4HW0A 1B1BA 1FBQA 2XPVA 2XIGA 3IUOA 1B72B 3IHUA 2ELHA 4KDPA 3A4CA 3A02A 1TBXA 5ICFA 4ITVA 5LFAA 1EH6A 1IC8A 3SZTA 2VBXA 3L2RA 4IOCF 1I27A 1MGTA 3FXLA 4EM1A 1I3QJ 3CMEI 2ESNA 5AONA 3BLYA 4NDLA 2MH9A 3HRMA 5ICEA 5JVGF 4GCVA 2R5YA 3K7AJ 3IH2A 4ZZDA 1JGGA 3O8GA 4YEJA 4A3MJ 2R7UA 5JVTA 1YITI 2VQHA 1VQ8I 3OYNA 2K9MA 3I4MJ 1TC3C 1SVOA 5CPRB 5LGNA 2QKMB 4RGSA 2A6EF 2LF8A 1MD0A 4FX0A 2Y31A 4L9VA 1N75A 1FY7A 4IVNA 4EJUA 4OWRB 2LKXA 3CP8A 4NNJA 4LITA 4V2FA 5CQGA 1X1PA 5EGOB 2CG4A 4CCJA 4BKXA 3KFWX 4A69C 3HXLA 2KIUA 2X6YA 3K2ZA 2LLKA 1LUJB 1FSHA 3WTZA 3BJ6A 1XB4A 2DA4A 4N9HA 2F5EA 3K69A 4ZDOA 1QVTA 2H6CA 5LD2C 4ZYEA 1WJCA 3OYAA 4XKVA 5D5WB 4XLAA 2VLAA 4I09A 4KFCA 1IXRC 3DKYA 4LIUA 2W84A 4L5IA 1DGRM 1LE8A 1BC7C 1QZEA 2A61A 3LQRA 2E2JJ 1KQ9A 2A6HF 3WGHA 3SEQA 1A04A 3K0LA 2XAUA 1K78B 1SFXA 3GFLA 2ZXWH 1VQ7I 3LAPA 5HOOA 3BR6A 3LL7A 4CA0A 2KQRA 3L2VA 5DCMA 1KQ8A 1N78A 1P4AA 3HKZA 4IL6C 2R4GA 5B66C 2JPCA 3HGYA 1ZLJA 1S72I 5K1YA 3DKWA 1OQYA 2CQQA 3HIFA 4P5OA 3J7YJ 1W5TA 2KRCA 4Z2YA 3OYJA 2P5LC 1VQKI 4MFDA 1YO5C 2RGVA 2TRTA 2JVGA 2R93J 2VT2A 1Z05A 3M4OJ 1X4PA 2VPLA 1W36D 1ZR2A 2CQ7A 5FFZA 2CUFA 2N8GA 1FNNA 5KAFC 2WY7Q 2F4OB 1SANA 4ON0A 4D1QA 3A0HC 1SEUA 2O9LA 2GLOA 2ZCWA 4UNOA 4RGUA 5BPDA 3C3WA 1IUYA 2MG4A 3NWSA 3PSIA 4RB3C 1TW3A 2BYVE 2X9DA 4AYBN 5IP7J 3W6KB 4M6VA 1MBHA 2H8RA 2HOAA 3E97A 2XAJA 3HSRA 4CHUA 1T33A 1S3JA 2HEOA 4GXOA 1ETWA 1R5HA 4I01A 3N05A 4XL9A 4A3KJ 2A07F 2O8KA 1ZHFA 2CQKA 3VYTB 2ZJQF 1A35A 1KU2A 5IP6A 4MO7A 4UVCA 4NBQA 3COAC 2ISZA 1VQPI 5HNFA 2R5ZA 1QZYA 4A12A 1W4MA 4BXXJ 1LFUP 3W2WA 1HKTA 4U0YA 2DFEA 2QEXI 1UFMA 2UXXA 4A3EJ 3RDIA 3CC7I 1KYWA 1TW2A 4Q47A 4BDZA 2VXZA 2AS5F 4MLOA 5DCFA 3KPHA 4HSRA 2R5ZB 4BDYA 3ECOA 1NG6A 3Q3SA 1S29A 5FKOA 3VOEA 4GDFA 4HRIA 1XGOA 3MZ8A 1IUFA 1EKEA 4UB6C 3ZQGA 1X3ZB 2VC0A 2VQLA 2LH9A 3GO5A 2GOXB 3JW4A 1NK3P 2EFWA 1SD7A 4BBSJ 4BS9A 2EZHA 2LYCA 4U87A 1YJWI 3BZCA 1D8KA 1WI3A 3OY9A 3I0TA 2X85A 2WA0A 2RVCA 3E6CC 1P7IA 3RYPA 1WVRA 4M3BA 3K1MA 3Q0WA 3RPUA 1OMIA 2M34A 3ZGKA 3CP2A 4N4OB 4FISA 4CH7A 4MGRA 4BE0A 3QAHA 4YELA 2G7UA 1TWFJ 1S9HA 5FFXA 4C3HJ 4CUGA 1V5GA 2CMPA 3CCYA 2Q8KA 2DMUA 2DMTA 3V42A 1D1AA 3GCMA 2ZNZA 1QU3A 3R61A 1X2MA 3ELKA 4BJTA 3D5LA 4RLQA 4YFNF 3H9JA 4IX7A 3GTQJ 2VE8A 2LC2A 3VSKA 1OCRH 4NC6A 2A5WA 4G12A 4XRSA 2QSFX 3N97A 3DV8A 1LFPA 1XGMA 1A36A 4G7OF 2LSOA 3DTEA 1T6SA 2H1KA 2DA6A 3BCBA 1T98A 2A68F 2L9VA 3CCMI 4CCMA 2E7WA 2DT6A 4ENKA 2CV2A 4UXNA 2ZJRF 1IRGA 3IRQA 4DBQA 4BE1A 2BV6A 1IO2A 2XGEA 3TOBA 4WF2A 5CVUA 2C6YA 1RR7A 5L3EA 2UZKA 2DDAA 3GBGA 1X58A 3IH3A 4I02A 3CQZJ 2WAFA 3R4KA 3QQAA 2GIZA 1UCRA 2ZNYA 2DCEA 3I53A 1J0RA 2DA1A 2OZ6A 4BACA 1MH3A 3FXUA 2Y9YA 3HOWJ 2YPRA 3PFYA 2ZKZA 1MMAA 1BIBA 4Q5SF 1HW5A 4J19A 5EG0A 3OSFA 2OJED 3DPLC 2F48A 1DDNA 2DOFA 2XKPA 4GRIA 5FLMJ 4Y3OA 2W7NA 3LSKA 3JSPA 1T0FC 1F1ZA 4C2TA 3WU1B 3BR1A 3SYTA 2ZSHB 3J7ZI 2M1BA 2UUZA 1ZREA 2Y0MA 4G7ZF 2BXZA 2EBIA 2KHMA 4OU0A 5K5RA 1XC5A 2IS1A 1Z9CA 1T39A 2ZXHA 4L18B 3FIWA 3E7LA 2EZIA 2KJCA 2COBA 2K9SA 3CJNA 1FT9A 1G6NA 2L4AA 4LFUA 3OR1C 4E7JA 2DQLA 1R6RA 3PIPF 4N0BA 1A5JA 4O3MA 3S1NJ 2XSDC 4PJJA 3NRVA 5E3LA 1EH8A 1FMVA 3CF5F 3T0YA 3S3NA 5JHUA 2F5DA 5E18F 4KITB 2O7OA 4JK1X 2E5ZA 1WI9A 5DTDA 5CQEA 3T8RA 2QA4I 1AHDP 4S0HB 1U5TA 3BJOA 3EUHC 2F5FA 2V9PA 2DFIA 2HQAA 2R7ZJ 4U7BA 4XIDA 5JLXA 3FWEA 1ZN2A 4XBFA 3CLQA 3H36A 3A01A 2R0QC 2Z9OA 1I39A 2XF7A 4M74A 3MZHA 1YW8A 2LVSA 5B1AH 2Y0SN 3GYHX 2KFDA 1OYIA 4DGWB 2DT7B 1SFUA 3RZOJ 3CLOA 1FOYA 1D8JA 2VJ5A 3KYDB 4B1RA 1J75A 2LK2A 1B9NA 5M5YJ 3GLLA 4FT8A 4HLXA 3VWBA 4GFBA 2J5PA 3UKGA 3CCQI 2L7KA 2D2WA 4V2GA 1WWXA 4B3XA 3K1NA 4M71A 1I6XA 4A93J 4LK0F 1OCPA 5F08A 1I1GA 4Y13A 5D6EA 2VASA 2L9RA 2K3PA 2Q2EA 3H3VK 3WTWC 4I0AA 3KLNA 5F0HA 4L0ZB 1MNDA 4AM3A 3LSRA 2ZMEC 1KYZA 2JZYA 2RQPA 3I4PA 3VFZA 4IKFA 3ZQIA 2XROA 2R5YB 3KP2A 1R1UA 3G4SI 1BOBA 1VNDA 3M1CA 3SFZA 4XLPF 1WKMA 2EILH 5HLIA 3ZRGA 3ZP5A 2EV0A 2FMYA 3S1MJ 3I5UA 2STTA 2BY3A 5KNLA 2XV4S 1BR2A 4HNVA 3CESA 3OS1A 4MTDA 1PUFA 3HTSB 2DI3A 2V9VA 2E1MC 4WCGA 3WTTC 2K3FA 2NYXA 2HTJA 3KZIC 1O57A 3FHZA 1B72A 1ZG5A 4QSHA 3HM5A 4EQQA 5ILVA 5CVVA 3S8PA 1BJAA 5DM6F 2L7MP 3J80Z 2V6CA 4UB8C 4Y4RA 3EDPA 5J1UA 1Y8QB 4A3DJ 2HQNA 1ZGAA 1BI1A 2EFOA 3H9QA 4XONA 2GIVA 5FO5A 2VONA 1ACIA 2MW8A 3SDBA 4M3DA 3ZQQA 4F52A 1TQPA 2OTJI 3U2RA 4EMSA 2PJRB 1NG7A 3OS2A 2E1OA 4Y33A 3BR5A 3BTLA 4BEHB 1DU6A 4KJZA 3B6CA 3F8MA 3S2DJ 1O3RA 1V5FA 5GTIC 2H6BA 3I4NJ 1Z91A 2RDPA 2LY9A 1G4DA 2P4WA 1ULYA 4BXFA 2WV1A 1T38A 1VQ9I 4IRGA 3K4MA 2M0MA 2RV8A 1RESA 1LVAA 1XDUA 3BTCA 5DCMB 3GTOJ 1GHCA 5DS9A 3QPLA 2OA4A 1Z3YA 3JTHA 4L9JA 1YS7A 3I3LA 3LSPA 3BPXA 3FXMA 4XLHA 2NVQJ 2NAZA 4LJZF 2GOMA 3ZQHA 1K78A 2JA8J 3F8NA 3S16J 2BOLA 3LSGA 3ABLH 1FTTA 5J1YA 2E1MB 3A01B 2FD5A 2KMUA 4RGRA 5HS8A 1K7AA 1JKPC 4XRMA 2XC7A 2B63J 3HOTA 3BDDA 3G3ZA 1RNLA 2BVMA 2H1LA 1YX3A 2FU4A 3AFHA 2H8WA 3F3XA 3W6JB 3C1DA 4EJWA 3LWFA 3GF2A 4BJ6C 1YG2A 3CUQC 3FXKA 2XDVA 2D5VA 2VKDA 4XOPA 3OYGA 2IGNA 2VQGA 2MABA 2V79A 2DLLA 5DDGA 4G7HF 4ETSA 3CDHA 5M3MJ 2KISA 4RGXA 2ZFWA 2XB5A 3IWFA 1S8NA 3FBNB 4RAFA 1HF0A 3DWLE 3G6EI 1X1BA 1R5GA 2X6OA 2Z16A 4PFOA 4D5CA 4E7SA 2CUJA 1G3TA 2DA5A 5GTHC 2E36A 1J5YA 3GX4X 1FLIA 1J09A 2BGCA 2Q0OA 4BUPA 1A6IA 2X1CA 1G59A 2CQXA 2ETHA 2I5UA 2VT3A 3CUQA 5IT9Z 4HAMA 2KDOA 1M1EB 2X6WA 2WTEA 1FWZA 2DBBA 3C2GA 2IGOA 2QBYB 1W1WE 1ETXA 3OOUA 5B3SH 4UUSB 3V7RA 1MMDA 1XG1A 4Y7NJ 1LEBA 5EJCA 4HNUA 2LKSA 1SFKA 4P9FA 5GADJ 2UWMA 1W7PB 2W85A 3IWZA 1FOWA 1FIAA 2IXSA 4LG0B 3DLLF 3QOEA 3GFIA 3C2BA 3KP3A 3CCLI 1Z21A 2MC3A 3O3KA 3ZMSA 1ZQ3P 5ILSA 3WHBA 2OBPA 3E1SA 1CF7B 4DYRA 2VJ4A 1D5YA 4DW6A 3M7GA 2OPTA 1EA3A 2M8EA 3Q9VA 2G9WA 3HSEA 3DBLB 4RB2C 3W3CA 2BEOA 1APLC 2R3SA 2G7HA 3RYRA 2JSPA 3ZMTA 5DEQA 1G2HA 2EINH 5J40A 3PNYA 3WGIA 2AXTC 2QSHX 4IHYA 1YJNI 2QQ8A 3RZDJ 3CCVI 1MIJA 2VKVA 3AL0B 4I0BA 4XSZF 3QP5A 2HXIA 2WB1A 3NARA 3BR3A 1RC9A 2WAQN 2GXBA 1OCTC 4KT5C 2K9LA 3TMOA 2QUFA 2LY1A 4LD5A 2L0KA 2E2IJ 3P9CA 2W00A 1DQUA 4M3GA 4M9XA 1ZAOA 3PO2J 2DYRH 3BR0A 3K4NA 2VOOA 3ZN0A 2CW0F 2FXAA 2DJNA 3LSMA 4CYCB 2ELJA 4HPQA 4NQWB 4ESBA 1P4WA 4PJNA 1D1BA 3RTRA 4HG2A 3G1MA 1BBYA 2XKOA 2VBYA 4Y52J 1YTYA 1LEAA 4XSXF 3ZR8X 5GAHJ 2HQRA 3P5JA 1H88C 4HNTA 2A69F 2O61A 3KLOA 1TQMA 1X2NA 1KA8A 1I5ZA 2QM3A 4ZC3A 3RSNA 3PNVA 5FKNA 4CZZA 2LOOA 5J4VA 3J7AO 1XS9A 5EG0B 2GBYA 1H89C 3E0JB 3FZVA 1USSA 1YX5A 2O8XA 1ERDA 2OC6A 3TBIA 5E17F 4M9ZA 3CCJI 1X1CA 3ZN1A 2EIMH 2XGDA 3MAJA 3S2WA 1DPUA 2I10A 3GTMJ 4XLEA 5D4RA 3GTKJ 3OIQA 3FBIB 2DO7A 2ZMEA 2FNPA 3MN2A 5FKMA 3K10A 2JA2A 2ICWG 2Y2ZA 3AG2H 3H9GA 1GUUA 3K4KA 4LB6B 4EM0B 3VB2A 1UJ8A 2IPQX 4PJLA 1I50J 1HXDA 2EV6A 2PMZN 4ZDLA 3KIOA 1XGSA 2E35A 4UUTA 2IW5A 1X3UA 2MA3A 2BY1A 4EGZA 1HKSA 1OYWA 1QHHD 2P8TA 1X19A 3CJTB 4PSWA 3RKYA 5D5VB 2ELKA 3JRCA 2VQCA 3HUGA 2DYSH 3FKJA 4BHBA 3KP5A 1ZARA 2ZMEB 1JE8A 4IRIA 2AHQA 1FJLA 3KP4A 3WTYC 4HQEA 3LA2A 2CH0A 2GXAA 4LLLA 1TWCJ 2ME0A 4ZYHA 1RUOA 4L9TA 4II3A 4QLCU 1JHFA 1YFHA 5IP9J 2ID3A 5FKLA 5LHHA 3CO7C 4C3IJ 2OF7A 3WG9A 4B43A 5D5XB 3RIRA 1E0EA 3FMQA 2HS5A 3FXJA 4I2OA 4JBAA 4KISA 1Z67A 2NOGA 4A2UA 3KX2A 4I98B 5IOZA 3EUHA 1WPKA 1VFCA 2VE9A 5L3BA 2NNNA 2DOAA 4HDVA 1JUMA 2NXNB 1SC7A 1SFEA 4F55A 2XF6A 2LBFB 4MHGA 3CMYA 2X51A 1NTCA 1ZELA 1QHGA 2FBHA 1BN5A 4MEXF 1U5TB 2DA7A 1R23A 5F0FA 4XRSG 3C18A 3GXOA 4ENJA 3HJEA 4CXFA 2KL4A 2M45A 4IPAA 3OYEA 2VB6A 1HC8A 2K4JA 3T8TA 5BQTA 4IHVA 1SD6A 2M7AA 1QBJA 3BCAA 2O6GE 3ZQFA 1E3HA 3HRTA 3H3ZA 2FQ4A 2EZLA 2E2HJ 1NK2P 1S7EA 2PBIA 1O7LA 2F5CA 2O5RA 1HKQA 3ABUA 3IAS2 3VODA 4FTHA 4EJTA 3F8FA 2OQGA 1ZKGA 4B8XA 4JX5A 3I64A 4BQAA 3QU3A 3HOXJ 3MQ0A 4K2EA 2L4MA 2BY0A 1QA6A 3TL4X 1BW6A 4CDGA 5HDKA 3CCRI 2FQ3A 3FM5A 1ONVA 1TQIA 1EF4A 1WQ2A 2YSRA 2LR8A 2QENA 4AWXB 5JFRA 1O3SA 1L0OC 3UNGC 2H27A 2AXLA 3CC2I 3I54A 3L2QA 1Z6RA 2R7VA 2MBFA 1KQ0A 4KNYA 1WH7A 3MKZA 3B73A 3KEQA 5LEJA 2CUEA 1UG0A 5D8LB 2GM4A 1Y1VJ 2PMZA 4LG0A 5E1XA 2F4IA 1KU9A 2VI6A 3OYMA 4AIKA 1FEXA 2A05A 1AKHB 1GVDA 2YUSA 2XPUA 3WTXC 2M0CA 3KZYA 3BTIA 3VDXA 4FASD 4LB5A 2K86A 4UUSA 2EFPA 2XRNA 5FRNA 2QBYA 4W1UA 1P7JA 3OYKA 4O5VA 2P7CB 3RPQA 1FP2A 1UG2A 1TWAJ 3S2HJ 2EH3A 4HSTA 1F36A 1RETA 3O6BB 1R7JA 1T56A 2RN7A 5JR3A 3OIOA 5DUIA 2IJLA 3ONQA 1Q1VA 4MQ9F 2RNGA 3KP6A 4OINF 4U0WA 3HOYJ 1FOXA 2P7VB 3ABTA 1C0WA 1X1DA 3OS0A 1N25A 2DA3A 3RI4A 1AU7A 2JA5J 5E3NA 1R58A 3DBHB 1ETOA 3JR9A 1FPQA 2F5VA 5D8KB 3N4MA 4BQQA 3ZCOA 2FOWA 5FKKA 1YYVA 3QRFF 2R7DA 3M07A 1GV5A 3U1DA 1TT5B 3CCEI 1PUFB 4G6QA 3H35A 3FHNA 1TWGJ 1P9QC 2HU9A 4BHCA 3QPTA 2FBKA 3IH4A 4HV5A 3TQNA 5BNGA 4BHPA 5E3MA 3G1LA 3MMYB 3ERMA 1PYVA 3F8CA 2EIJH 4JX4A 5D6FA 2FJ1A 2EA2A 2Y9ZA 3WE3A 3IAM2 5K7HA 3OR2C 4IXAA 2AQFA 4ABZA 4HF0A 2HOSA 1UHWA 6PAXA 3PUBA 3K2AA 1FMWA 1LKXA 1Y39A 3E5QA 3WTUC 2R7TA 3BZKA 3L2UA 2DXIA 2OCCH 4CYCA 4OIQF 2CU7A 4HDUA 2HOTA 3IKTA 4DZPA 4UVBA 3FK6A 5E8GA 1FBUA 2QCOA 1RKWA 5L3GA 1YS6A 3NWTA 3GFMA 3I71A 2X1EA 3Q5FA 5J8CA 2Y69H 2LY2A 1E2XA 1R36A 1G3YA 2HDWA 3L2WA 3QYFA 3VYSB 1R4MB 1VQOI 2HGCA 4DNCA 4U7DA 3FKIJ 5H2FC 1LJ9A 5DD8A 4EEFG 4RS8A 3BY6A 1R49A 2R7XA 1NHAA 2O0YA 1UMQA 5HS9A 3D5RC 3H0GJ 4A0XA 4A3FJ 3RKQA 4M6XA 3VYRB 5J8FA 4WXCA 3J81Z 1XD7A 3EUAA 3LA7A 4FETA 2I8DA 2EFNA 3HRUA 3AAFA 2YX4A 4V19K 1MJ9A 2VKEA 3BWGA 3PQJA 4EVIA 2JTVA 2JPBA 3BG9A 5LHGA 3BOQA 4M72A 3A2KA 4DYCA 1TT0A 4M73A 3TOAA 1BR4A 3KYLA 3ZPLA 4FE4A 2W1OA 3GZ6A 2XPWA 2JWTA 1UAAA 1QQIA 2NVXJ 1YQAA 4E7ZA 2M5WA 1Y8RB 2P5VA 5C4XJ 3AG1H 4IHXA 2A3SA 5KK1A 4QTRA 2KRFA 3FISA 4RA2A 4ZTFA 1E17A 1XSXA 3MWMA 4OMZA 4PGHA 4EV0A 4MTEA 2PLYA 2NRAC 2JUGA 5LGTA 4IHTA 3CUOA 1IXCA 5FROA 1HLVA 3TKYA 1JT0A 1DPRA 2IT0A 1JHHA 2Z99A 3M3YJ 4IZZA 3F6OA 1WJDA 4HOBA 1IDZA 2CFOA 3VEPA 1GXPA 2L9NA 4BY1J 2K9QA 1JTYA 2E5NA 2VODA 3MVPA 1IN7A 2AO9A 3HB9A 3H5AA 1V5EA 2W25A 2FUG2 3V8LA 5F6FA 1KZHA 1I6HJ 1H0MA 1LDJA 2JVHA 4E6KG 3CMMA 5J6XA 2PG4A 4BL0B 1ZH5A 1Z3XA 3NAUA 2O03A 1T0FA 3HSFA 4ZTJA 2DQRA 4XKWA 2DAOA 4KUMA 4IJAA 2OUMA 5LBQA 1T8IA 3CDLA 1JKQC 2PQ8A 1HDPA 1G8XA 1Q1HA 2YR2A 1D3YA 3I59A 4HX7A 2V1XA 2VBZA 2LMDA 1MKMA 1P4XA 5EF6A 2GXGA 5K5OA 1IDYA 1TP4A 2XRLA 4XN0A 3WE2A 3DTKA 4ZDPA 2YS9A 3PFIA 3ZOBA 5LEKA 1ENHA 1FYKA 2NS0A 4EM2A 3GZNB 3TGNA 1A31A 4GYGA 4CCKA 5ED4A 1EJ9A 3SHFA 1U9OA 5E8IA 3EYYA 1BJZA 2M3AA 5E79C 2KZVA 2OCEA 4XKCA 4X6AJ 2VBWA 2HOEA 2A5YB 2E1CA 1PJRA 2IA0A 4IHSA 1HDDC 1U5TC 5L3FA 2HPIA 5B5EC 2VUMJ 1FZPB 5H6RA 3W2VA 5ICCA 3M8EA 1FYMA 1ZGJA 3GTGJ 1SAUA 4H0EA 3DBRB 2IS6A 1Y56A 2YU9J 2CW8A 3FXRA 4FQGA 4BEHA 2XUBA 2D45A 5K7FA 5HDNA 2CFXA 2PJPA 2X4HA 1K6OA 4A3GJ 2K27A 2IAIA 4CICA 3C2HA 4MQVA 1IN4A 1TLHB 2V4JC 4LMYA 4C9YA 5LGUA 1YI2I 4OMYA 4ZJZA 5GAGJ 5HLGA 3JRIA 3A03A 4AIJA 1YOVB 5KVRA 1O7FA 2NOJB 2PMHA 2MSYA 1BOAA 1U78A 3KETA 4OAZA 4BXUA 3HL2A 4BH9A 1MH4A 3I55I 1CF7A 3OIPA 2VOPA 4UV9A 1B8IA 1ZG1A 3PSFA 1X4OA 3V8KA 4CYDA 1IGNA 1QZZA 4I6ZA 5BOXA 9ANTA 5M5WJ 4XLCA 1AWCA 3RQ4A 4Q48A 1D1CA 4Z6YA 3ZMZA 4NC7A 3QYBA 3REOA 1F43A 1XSVA 2KJBA 1WJEA 4PCQA 3TW6A 1CGPA 4HF2A 5CYVA 4I76A 3MD2A 1IW7F 5TGTA 3F8BA 1W36C 2L3DA 2P6SA 3GLXA 1T08B 3V7SA 4GGGA 5AIQA 3E6BA 1YRNA 5JLWA 4YIRX 1XCVA 4QWQA 1G3WA 2RQQA 4A5MA 2DJIA 2ZJPF 1GLNA 3BZ6A 4MEYF 5IYDJ 4CO8A 4C3JJ 3HDDA 2ZJ2A 1ZRDA 1JT6A 2COMA 5LRSA 3V8JA 5CVIA 3NQOA 1OLTA 2VKHA 3ASNH 3CJRB 4YIIA 1OFCX 2RKHA 4BYYA 3OYCA 1J7KA 4LK1F 3D1NI 1T2KA 1HCRA 1ON2A 2D1VA 4ZH4F 2IVMA 1J59A 2IRFG 1MMNA 3EQLF 1USTA 1HOMA 1ZK8A 3OYBA 1DUXC 2KIFA 1JUSA 2EZKA 4BGDA 1SD4A 3G2BA 2WBMA 4HX8A 4E4HA 4HBLA 5FB2A 2FEZA 2PMUA 3OOPA 2Y30A 2XAQA 2WAQA 1A6QA 4A3BJ 1YIOA 1JKOC 2CGPA 1Y1WJ 1REPC 2DTRA 1HA8A 1D0XA 1QO0D 3HOUJ 3KEYA 3OYIA 4AIHA 2OTLI 3S1QJ 2DW4A 1QPMA 3ESWB 2KPMA 3ML6A 1WJFA 1MJAA 1QPIA 3I9V2 2ZO4A 1MMSA 1OR7C 4XLFA 4RDUA 4D9JA 2V1UA 5IYBJ 4D7NA 1XMAA 4HYEA 1RPWA 2DODA 2MGQA 1ZG3A 1XPXA 3ERED 4E7LA 4LLGF 4XR6A 4A3LJ 4Y17A 4XN3A 2DN0A 2TCTA 2V7FA 3KP7A 2XVCA 2K85A 1FIPA 2HVSA 1SVMA 3TP3A 3CDIA 5LRRA 1AOYA 3WG7H 2X1DA 2MD0A 3I58A 2Z5UA 3HBLA 1GXQA 3HUGB 2YU3A 4YFKF 2JRMA 2M4KA 4FHTA 3F0CA 3K6GA 3S93A 4PJ0C 1SVLA 1IN6A 3GMEA 4X0GA 3HGGA 3MCZA 3C7JA 5EZHA 3V4GA 2R7SA 1T95A 2M30A 3ZQ7A 2FE3A 4XMYA 2OV7A 2K9NA 5K7ZA 1PP8F 1U0JA 3WGGA 4AVPA 2WY8Q 2STWA 1YHQI 4BQOA 3QU6A 3HRSA 3BG5A 1STZA 2DFHA 3BQYA 1P92A 4KMFA 4MIMA 4D0PA 3HHGA 1OCZH 1OJLA 3W6VA 1XTAA 3F72A 3DEUA 1BW5A 2JQ7A 4RAYA 1B9MA 4EGYA 4EJVA 4ZYDA 3R60A 3IC7A 1CQTA 3JCUC 3LOCA 2DA2A 1WCMJ 2DTZA 3FF5A 1G3SA 2KRHA 2JA6J 1ON1A 2LNBA 5B1BH 3U9GA 2E19A 3BROA 3BTJA 3TO9A 3MKWB 1LVKA 3RKXA 1LNWA 1JUPA 3D0SA 4ANJA 2FSWA 1Z0XA 4IO9F 2IS4A 1MNMC 3JRDA 2CS3A 5EZGA 4LG3A 3IP4B 3CUQB 4KA4A 2EB7A 4G6DA 2QWWA 1W7PD 2L02A 4DYQA 4NQWA 1R4NB 2NS7A 5HODA 5IT9K 3BP8A 3CTAA 2XASA 4E70A 4J00A 3JTGA 3CMAI 3CZ6A 4UUVA 1IV6A 1UZCA 4BE2A 2IS2A 1S7OA 2KP6A 1IG7A 3TW7A 4FCYA 3DXJF 5F64A 4TV7A 1K83J 4RM3A 4WK8F 2CUZA 3HYIA 2DPDA 1GDTA 1HW1A 1LB2A 2HXOA 4BAYA 1PDNC 2WB1N 1H9GA 2BVLA 3DU6A 5FD5A 2JK3A 3OYLA 4HLYA 2W48A 3FMRA 2GA1A 3J80K 2VPRA 1JTXA 1UHSA 2JRTA 4OIPF 3KZZA 2FOKA 1XX5A 2QQAA 3PNTA 2ME6A 2LREA 2WADA 1FSEA 3WODF 3KE2A 3G1OA 4HX4A 4E7HA 4ZYAA 4N4NB 4CCNA 1D0ZA 1MW7A 4AC0A 1V54H 2EJRA 1LQ1A 4XNFA 1IRZA 2BHYA 1FOKA 3HOZJ 2DU9A 4DIQA 1QVUA 2WAEA 2ZXJA 1IZ1A 3IKVA 2HDCA 1OKRA 3Q0UA 1EV7A 3CO6C 4AVZA 1YW9A 2UXNA 5E1WA 3HPHA 1WSUA 1W7PA 2DDBA 2ZBKA 3IV5A 1O4XA 4UY8I 2JMWA 3E5XA 2F6CA 3K4BA 4JQFA 1N77A 1FTZA 3EYIA 1JKRC 3A1YA 5J3LA 2BXYA 3ZMUA 3VPRA 2PJRA 5CLSA 4WX9A 2FF4A 2ACJA 3QYEA 3DF8A 1BI0A 3IRRA 1YJ9I 4AIDA 2K4BA 4XM3A 1B4AA 3CCSI 1YRNB 1I1SA 3KYCB 2Y75A 3R0AA 2PX9A 3E3VA 2CQNA 3GTJJ 1ORKA 1RIOH 5IOYA 1DGWY 1Z7UA 3U1KA 3J81K 4DBRA 5A2QK 4QPQA 4UVAA 5JI6A 1S6LA 2DMNA 2LKPA 2R7QA 2V1DA 4ESFA 1ZLKA 3GTPJ 2HKXA 2X48A 4MNUA 1YE9A 3PQKA 5ERIA 4XK4A 3DKXA 4IEJA 3LFKA 2QQBA 3GW2A 2Y48A 4DJAA 5J47A 3M8JA 2M4GA 3B02A 2DK5A 1B59A 3LQQA 5AIPA 2A6TA 5FLVA 1B6AA 2ZC2A 1UB9A 1FYLA 2NVUB 4IOAF 1U3EM 1HSTA 1Y6IA 3DLAA 4B3AA 2W82A 3G71I 2HVRA 3MKLA 1EH7A 1IRXA 1MNEA 1VF9A 2CV0A 3PO3J 1GV2A 1WRJA 3PUFA 1SD5A 4XOTA 3V7CA 3E6MA 2BY2A 4B44A 2DMPA 4P55A 4A3JJ 1ZRCA 1R71A 1ZTRA 1MDMB 1FC3A 2IBDA 2MLGA 1VTNC 4WXDA 1Y0UA 2EFQA 2FBIA 1IF1A 2D1HA 1LDDA 1IN5A 1RI7A 3Q0VA 1MSEC 4F93B 5GP9A 3ABKH 3ABMH 4B4CA 3Q9SA 2HWVA 2HYFA 3M8FA 4I7HA 3L9FA 3DQVC 3LAJA 1OYYA 2J5OA 2LRDA 2O3FA 2XF5A 3PL8A 2R7FA 3OL3A 2EWNA 4OAYA 1OR7A 2HQ5A 2X6XA 3K4LA 3ZXSA 2GZWA 1ETKA 2R7RA 3F22A 5EDNA 1V55H 1PP7U 1LE8B 2PFBA 1XMKA 2F2EA 3ISPA 3ZQCA 2VXDA 1IXSB 2LD5A 1W5CC 4IHWA 1ZYRF 3PM1A 3BC8A 4GYIA 5EYRA 3JAMK 1OISA 3CC4I 2BW3B 3KEOA 1POGA 4C2MJ 2HVQA 4LLNA 1D0YA 3SZPA 1VQNI 5L3DA 3HOVJ 2JUCA 1U9NA 5C3EJ 2LF7A 2FMLA 3TP0A 1ITYA 1U8BA 4UV8A 2ZB9A 3K4CA 3E6DA 2K5CA 3VYUB 2M2EA 2ZXIA 5IPAA 3O8HA 1MBKA 1VQLI 1LPQA 2VJIA 4D5FA 5CJ9A 4AU7A 4PSXA 5DM7F 3S3MA 4PJMA 4CSWA 3ULQB 2V6EA 5E20A 1WJ5A 1V4RA 2ISYA 1XGNA 4BBRJ 3EUKL 3LFUA 4PUSA 1ETYA 4E7KA 5M3FJ 2F4MB 2IEKA 1X3WB 4R1HA 2RNJA 4AUXA 4DOZA 1RUNA 2OD5A 4JP0A 4PK4A 2HTSA 2ADUA 5FD6A 2P81A 1K6YA 5H20A 3BG6A 3BJAA 4NB5A 4O6JA 4L5EA 1AKHA 2RREA 1PVEA 2QGUA 1K61A 3WU2C 1WJAA 2CO5A 2EA4A 2VJJA 2B9SA 2BHZA 3NEUA 3L09A 3AKZA 3MZYA 2L7FP 3S3OA 2LG4A 4QPOA 2H09A 1QGPA 1O3QA 1W0TA 2HNHA 1E3OC 1TNTA 2AQEA 5DV5A 3FM3A 1WZ2A 3LNQA 4PGGA 3M9AA 1KONA 4JYKA 1DP3A 1R22A 1VQ5I 2VN2A 1WH5A 3QODA 4RM2A 2L5QA 3GUDA 2XB0X 4B09A 1VZ0A 3HTUA 5BS6A 3W2AA 1MBGA 4LGWA 2LP0A 3R6SA 1MZBA 3OV8A 2E60A 1DU0A 2JJ7A 3SXYA 4ENNA 5HDGA 4DZJA 1H8AC 1SMYF 2G0EA 4N9IA 4CCOA 3E5UA 4NHJA 3F21A 2BE5F 4L5JA 1OCCH 2LTPA 4HZFA 1WHUA 2YX7A 5C44J 3MFKA 2VC1A 4Y15A 2IA2A 1ETQA 4L0YB 1X1AA 3AL0C 3K4JA 4RAZA 2CSOA 3QPSA 4PDKA 4P96A 2Y0SA 4JX6A 4U0VA 2JT1A 2KDZA 4BNCA 1MDMA 2HDDA 1O3TA 2ID6A 5IT3A 2Z3YA 2QZ8A 3BG3A 1FBSA 3JRHA 4GO1A 4G9YA 2OZUA 3MKYB 1U8RA 3OMYA 1SMTA 2K02A 3WU0A 1KGSA 3PJRA 3DU5A 2P5KA 1MBJA
chains in the Genus database with same CATH topology
1VI0A 5JLWA 1YRNA 4Y52J 2R92J 1H88C 2RAEA 4LOCA 1RKTA 1QRYA 4A3EJ 3S15J 1X2NA 5IYDJ 4C3JJ 3HDDA 1JT6A 4MLOA 5FKNA 1BL0A 1OFCX 3D1NI 2R5ZB 5EG0B 1XS9A 1HCRA 2GBYA 1H89C 2JN6A 3Q3SA 5FKOA 1HOMA 1ZK8A 1IUFA 3ZQGA 1JUSA 2EZKA 2XGDA 5EGOA 1NK3P 4BBSJ 2I10A 3GTMJ 2EZHA 3GTKJ 2Y30A 5FKMA 4A3BJ 3MN2A 1MBFA 1WI3A 2Y2ZA 2CJJA 1MSFC 2M8GX 1JKOC 1GUUA 3BQZA 4QIWN 3BT9A 1P7IA 1Y1WJ 3DCFA 3HOUJ 4M3BA 1I50J 3Q0WA 2PMZN 3S1QJ 2M34A 4FISA 4UUTA 1TWFJ 5FJ8J 4C3HJ 3JRCA 1QPIA 2ELKA 3CCYA 2DMUA 2DMTA 4RDUA 5IYBJ 4D7NA 1RPWA 2MGQA 2ECBA 1X2MA 2AHQA 1FJLA 4A3LJ 2DN0A 2TCTA 1TWCJ 3HKZN 2ME0A 1FIPA 3GTQJ 4M3EA 3TP3A 4G12A 2EQRA 2ID3A 4FE7A 5IP9J 4XRSA 5FKLA 4C3IJ 2OF7A 3L1PA 2NVYJ 3HBLA 2H1KA 3BR2A 2DA6A 3SDGA 3F0CA 2NOGA 1WGXA 3HGGA 5IOZA 5EZHA 1WPKA 1VFCA 1JUMA 5F1JA 3FK7A 2XGEA 4MFEA 5F04A 2K9NA 3WHCA 5K7ZA 3CMYA 1RR7A 1NTCA 2DA7A 5F0FA 4XRSG 3GBGA 1X58A 3IH3A 3CQZJ 3BG5A 3QQAA 1Z77A 1ZGWA 3BQYA 2DA1A 4MIMA 1MH3A 1OJLA 3W6VA 4IHVA 2Y9YA 2DMQA 1BW5A 3HOWJ 5GPCA 3ZQFA 1IJWC 2FQ4A 2EZLA 2HYJA 2E2HJ 1NK2P 1CQTA 1S7EA 3LOCA 5EG0A 2DA2A 1WCMJ 4J19A 3OSFA 2DTZA 2M9HA 4FTHA 5EEAA 3B6AA 5FLMJ 2JA6J 3S17J 2E19A 3BR1A 1ZKGA 3BTJA 4JX5A 3TEDA 1JUPA 1SFOJ 1Z0XA 3HOXJ 2EBIA 3JRDA 1MNMC 3HEFA 1XC5A 4A3CJ 2JA7J 5EZGA 1BW6A 4RBOA 4W97A 1EF4A 3RQIA 3GTLJ 2LR8A 4DYQA 3JRGA 3FIWA 1R9TJ 3E7LA 3JRFA 2EZIA 2NS7A 2COBA 2K9SA 5HODA 5F27A 2NVTJ 5M5XJ 1WH7A 5J1RA 1IV6A 2CRGA 2CUEA 1A5JA 3S1NJ 2XSDC 1IG7A 3TW7A 1Y1VJ 5E3LA 4FCYA 2GM4A 2LFBA 5GPAA 3JREA 1K83J 1B8IB 2O7OA 1GDTA 2VI6A 5DTDA 1ETVA 1FEXA 1AKHB 1GVDA 2YUSA 2XPUA 2HXOA 4S0HB 1AHDP 2M0CA 2WB1N 3BTIA 4UUSA 2R7ZJ 2JK3A 2W48A 1W0UA 4XIDA 5JLXA 2VPRA 1JTXA 1UHSA 1LFBA 1P7JA 4W1UA 3A01A 2R0QC 1UG2A 2ME6A 1TWAJ 3S2HJ 2EH3A 3G1OA 1F36A 2LVSA 4M3FA 3S1RJ 1RETA 2Y0SN 1MBEA 1T56A 3OIOA 1GT0C 1Q1VA 3RZOJ 3SJMA 5E3OA 4AC0A 3HOYJ 3OSGA 2DA3A 2ECCA 1AU7A 2JA5J 4B1RA 5E3NA 2LK2A 5M5YJ 1IRZA 1ETOA 3HOZJ 3JR9A 3LSJA 1QVUA 4GFBA 4D7MA 3UKGA 5FKKA 4V2GA 3Q0UA 3DEWA 1GV5A 2QF7A 1ZR4A 5C4JJ 5F0CA 1PUFB 3IV5A 1TWGJ 4X1EA 1O4XA 3ZQLA 2JMWA 4A93J 1OCPA 5F08A 3IH4A 1FTZA 5BNGA 2L9RA 1JKRC 5J3LA 5E3MA 3G1LA 3H3VK 3VPRA 4JX4A 5F0HA 4XICA 2FJ1A 3LSRA 2Y9ZA 5IYCJ 5K7HA 3ZQIA 4ABZA 2HOSA 2HI3A 2R5YB 1YRNB 1VNDA 3K2AA 3GTJJ 1ORKA 2XGCA 3S1MJ 5IOYA 3S14J 1JJ8C 4CYCA 2CU7A 2NS8A 4HNVA 1PUFA 2DMNA 3JRBA 2HOTA 4DZPA 3FK6A 2QCOA 1RKWA 1B72A 3GTPJ 2X48A 3HM5A 4QSHA 2L7ZA 2K40A 4XK4A 2L7MP 4IEJA 2FX0A 4A3IJ 5J1UA 1BA5A 4A3DJ 3FKIJ 5FLVA 1TWHJ 3SFIA 4EEFG 1JJ6C 2MW8A 4B3AA 1UMQA 4M3DA 3H0GJ 3MKLA 4A3FJ 3RKQA 1VF9A 3PO3J 1GV2A 4BY7J 2E1OA 3BR5A 3BTLA 3JRAA 1DU6A 3B6CA 3S2DJ 2DMPA 2VKEA 4A3JJ 1ZTRA 2IBDA 3I4NJ 2LY9A 3BG9A 2KT0A 2WV1A 2XPVA 4DYCA 1B72B 1RESA 3A02A 3Q0VA 4FE4A 1MSEC 3BTCA 5GP9A 2XPWA 1IC8A 3GTOJ 5DS9A 2JWTA 3QPLA 2NVXJ 1I3QJ 4B4CA 5C4XJ 3LSPA 4NDLA 2NVQJ 4IHXA 3ZQHA 2JA8J 4QTRA 3FISA 2R5YA 3S16J 3K7AJ 3LSGA 3IH2A 2HQ5A 1JGGA 1FTTA 3O8GA 1ETKA 4A3MJ 5J1YA 5EDNA 3A01B 2FD5A 1HLVA 1LE8B 1JT0A 3ZQCA 1JKPC 4XRMA 3I4MJ 3M3YJ 2LD5A 1TC3C 4IHWA 2B63J 1IDZA 3PM1A 2Y31A 5EYRA 4BY1J 2K9QA 1POGA 1JTYA 4C2MJ 2LKXA 4V2FA 3MVPA 2AO9A 3HB9A 5EGOB 3HOVJ 1U9NA 5C3EJ 3TP0A 1ITYA 1U8BA 2ZB9A 4BKXA 1I6HJ 2D5VA 4A69C 3NAUA 2M2EA 2LLKA 5M3MJ 5IPAA 2XB5A 3O8HA 1MBKA 2DA4A 1LFUP 1HF0A 4D5FA 2X6OA 1QVTA 4D5CA 2DA5A 3CDLA 1JKQC 1HDPA 1A6IA 4BBRJ 2CQXA 5EF6A 1LE8A 1ETYA 1IDYA 2XRLA 2E2JJ 5M3FJ 1ETXA 2IEKA 2YS9A 3ZOBA 3OOUA 4AUXA 4UUSB 1ENHA 4JP0A 1XG1A 4Y7NJ 2P81A 1U9OA 1FIAA 1AKHA 4L5EA 1BJZA 1K61A 3BR6A 4X6AJ 3C2BA 3HGYA 1HDDC 1ZQ3P 2L7FP 3WHBA 2CQQA 2VUMJ 4DYRA 1D5YA 4DW6A 1W0TA 2OPTA 3GTGJ 4MFDA 1E3OC 2YU9J 2TRTA 2R93J 3LNQA 1APLC 5K7FA 4JYKA 3M4OJ 1G2HA 1ZR2A 2CUFA 1WH5A 2N8GA 4A3GJ 2IAIA 2XB0X 1MBGA 1SANA 4IHYA 3RZDJ 2O9LA 2LP0A 2GLOA 3JRIA 3A03A 2VKVA 1DU0A 2JJ7A 2MSYA 1U78A 2HXIA 2MG4A 3NARA 4DZJA 1MH4A 2G0EA 3BR3A 2WAQN 1H8AC 1B8IA 1OCTC 2X9DA 4AYBN 5IP7J 2LTPA 4M6VA 1MBHA 5C44J 2H8RA 1IGNA 2HOAA 4I6ZA 1ETQA 1T33A 9ANTA 2L0KA 2E2IJ 4M3GA 5M5WJ 1ETWA 3PO2J 2O8KA 3QPSA 3BR0A 4A3KJ 4JX6A 2KDZA 2HDDA 1F43A 2DJNA 5IP6A 4MO7A 4CYCB 2ID6A 3TW6A 3BG3A 3JRHA 4I76A 2R5ZA 3G1MA 4BXXJ 1MBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI0 A;  5JLW A;  1YRN A;  4Y52 J;  2R92 J;  1H88 C;  2RAE A;  4LOC A;  1RKT A;  1QRY A;  4A3E J;  3S15 J;  1X2N A;  5IYD J;  4C3J J;  3HDD A;  1JT6 A;  4MLO A;  5FKN A;  1BL0 A;  1OFC X;  3D1N I;  2R5Z B;  5EG0 B;  1XS9 A;  1HCR A;  2GBY A;  1H89 C;  2JN6 A;  3Q3S A;  5FKO A;  1HOM A;  1ZK8 A;  1IUF A;  3ZQG A;  1JUS A;  2EZK A;  2XGD A;  5EGO A;  1NK3 P;  4BBS J;  2I10 A;  3GTM J;  2EZH A;  3GTK J;  2Y30 A;  5FKM A;  4A3B J;  3MN2 A;  1MBF A;  1WI3 A;  2Y2Z A;  2CJJ A;  1MSF C;  2M8G X;  1JKO C;  1GUU A;  3BQZ A;  4QIW N;  3BT9 A;  1P7I A;  1Y1W J;  3DCF A;  3HOU J;  4M3B A;  1I50 J;  3Q0W A;  2PMZ N;  3S1Q J;  2M34 A;  4FIS A;  4UUT A;  1TWF J;  5FJ8 J;  4C3H J;  3JRC A;  1QPI A;  2ELK A;  3CCY A;  2DMU A;  2DMT A;  4RDU A;  5IYB J;  4D7N A;  1RPW A;  2MGQ A;  2ECB A;  1X2M A;  2AHQ A;  1FJL A;  4A3L J;  2DN0 A;  2TCT A;  1TWC J;  3HKZ N;  2ME0 A;  1FIP A;  3GTQ J;  4M3E A;  3TP3 A;  4G12 A;  2EQR A;  2ID3 A;  4FE7 A;  5IP9 J;  4XRS A;  5FKL A;  4C3I J;  2OF7 A;  3L1P A;  2NVY J;  3HBL A;  2H1K A;  3BR2 A;  2DA6 A;  3SDG A;  3F0C A;  2NOG A;  1WGX A;  3HGG A;  5IOZ A;  5EZH A;  1WPK A;  1VFC A;  1JUM A;  5F1J A;  3FK7 A;  2XGE A;  4MFE A;  5F04 A;  2K9N A;  3WHC A;  5K7Z A;  3CMY A;  1RR7 A;  1NTC A;  2DA7 A;  5F0F A;  4XRS G;  3GBG A;  1X58 A;  3IH3 A;  3CQZ J;  3BG5 A;  3QQA A;  1Z77 A;  1ZGW A;  3BQY A;  2DA1 A;  4MIM A;  1MH3 A;  1OJL A;  3W6V A;  4IHV A;  2Y9Y A;  2DMQ A;  1BW5 A;  3HOW J;  5GPC A;  3ZQF A;  1IJW C;  2FQ4 A;  2EZL A;  2HYJ A;  2E2H J;  1NK2 P;  1CQT A;  1S7E A;  3LOC A;  5EG0 A;  2DA2 A;  1WCM J;  4J19 A;  3OSF A;  2DTZ A;  2M9H A;  4FTH A;  5EEA A;  3B6A A;  5FLM J;  2JA6 J;  3S17 J;  2E19 A;  3BR1 A;  1ZKG A;  3BTJ A;  4JX5 A;  3TED A;  1JUP A;  1SFO J;  1Z0X A;  3HOX J;  2EBI A;  3JRD A;  1MNM C;  3HEF A;  1XC5 A;  4A3C J;  2JA7 J;  5EZG A;  1BW6 A;  4RBO A;  4W97 A;  1EF4 A;  3RQI A;  3GTL J;  2LR8 A;  4DYQ A;  3JRG A;  3FIW A;  1R9T J;  3E7L A;  3JRF A;  2EZI A;  2NS7 A;  2COB A;  2K9S A;  5HOD A;  5F27 A;  2NVT J;  5M5X J;  1WH7 A;  5J1R A;  1IV6 A;  2CRG A;  2CUE A;  1A5J A;  3S1N J;  2XSD C;  1IG7 A;  3TW7 A;  1Y1V J;  5E3L A;  4FCY A;  2GM4 A;  2LFB A;  5GPA A;  3JRE A;  1K83 J;  1B8I B;  2O7O A;  1GDT A;  2VI6 A;  5DTD A;  1ETV A;  1FEX A;  1AKH B;  1GVD A;  2YUS A;  2XPU A;  2HXO A;  4S0H B;  1AHD P;  2M0C A;  2WB1 N;  3BTI A;  4UUS A;  2R7Z J;  2JK3 A;  2W48 A;  1W0U A;  4XID A;  5JLX A;  2VPR A;  1JTX A;  1UHS A;  1LFB A;  1P7J A;  4W1U A;  3A01 A;  2R0Q C;  1UG2 A;  2ME6 A;  1TWA J;  3S2H J;  2EH3 A;  3G1O A;  1F36 A;  2LVS A;  4M3F A;  3S1R J;  1RET A;  2Y0S N;  1MBE A;  1T56 A;  3OIO A;  1GT0 C;  1Q1V A;  3RZO J;  3SJM A;  5E3O A;  4AC0 A;  3HOY J;  3OSG A;  2DA3 A;  2ECC A;  1AU7 A;  2JA5 J;  4B1R A;  5E3N A;  2LK2 A;  5M5Y J;  1IRZ A;  1ETO A;  3HOZ J;  3JR9 A;  3LSJ A;  1QVU A;  4GFB A;  4D7M A;  3UKG A;  5FKK A;  4V2G A;  3Q0U A;  3DEW A;  1GV5 A;  2QF7 A;  1ZR4 A;  5C4J J;  5F0C A;  1PUF B;  3IV5 A;  1TWG J;  4X1E A;  1O4X A;  3ZQL A;  2JMW A;  4A93 J;  1OCP A;  5F08 A;  3IH4 A;  1FTZ A;  5BNG A;  2L9R A;  1JKR C;  5J3L A;  5E3M A;  3G1L A;  3H3V K;  3VPR A;  4JX4 A;  5F0H A;  4XIC A;  2FJ1 A;  3LSR A;  2Y9Z A;  5IYC J;  5K7H A;  3ZQI A;  4ABZ A;  2HOS A;  2HI3 A;  2R5Y B;  1YRN B;  1VND A;  3K2A A;  3GTJ J;  1ORK A;  2XGC A;  3S1M J;  5IOY A;  3S14 J;  1JJ8 C;  4CYC A;  2CU7 A;  2NS8 A;  4HNV A;  1PUF A;  2DMN A;  3JRB A;  2HOT A;  4DZP A;  3FK6 A;  2QCO A;  1RKW A;  1B72 A;  3GTP J;  2X48 A;  3HM5 A;  4QSH A;  2L7Z A;  2K40 A;  4XK4 A;  2L7M P;  4IEJ A;  2FX0 A;  4A3I J;  5J1U A;  1BA5 A;  4A3D J;  3FKI J;  5FLV A;  1TWH J;  3SFI A;  4EEF G;  1JJ6 C;  2MW8 A;  4B3A A;  1UMQ A;  4M3D A;  3H0G J;  3MKL A;  4A3F J;  3RKQ A;  1VF9 A;  3PO3 J;  1GV2 A;  4BY7 J;  2E1O A;  3BR5 A;  3BTL A;  3JRA A;  1DU6 A;  3B6C A;  3S2D J;  2DMP A;  2VKE A;  4A3J J;  1ZTR A;  2IBD A;  3I4N J;  2LY9 A;  3BG9 A;  2KT0 A;  2WV1 A;  2XPV A;  4DYC A;  1B72 B;  1RES A;  3A02 A;  3Q0V A;  4FE4 A;  1MSE C;  3BTC A;  5GP9 A;  2XPW A;  1IC8 A;  3GTO J;  5DS9 A;  2JWT A;  3QPL A;  2NVX J;  1I3Q J;  4B4C A;  5C4X J;  3LSP A;  4NDL A;  2NVQ J;  4IHX A;  3ZQH A;  2JA8 J;  4QTR A;  3FIS A;  2R5Y A;  3S16 J;  3K7A J;  3LSG A;  3IH2 A;  2HQ5 A;  1JGG A;  1FTT A;  3O8G A;  1ETK A;  4A3M J;  5J1Y A;  5EDN A;  3A01 B;  2FD5 A;  1HLV A;  1LE8 B;  1JT0 A;  3ZQC A;  1JKP C;  4XRM A;  3I4M J;  3M3Y J;  2LD5 A;  1TC3 C;  4IHW A;  2B63 J;  1IDZ A;  3PM1 A;  2Y31 A;  5EYR A;  4BY1 J;  2K9Q A;  1POG A;  1JTY A;  4C2M J;  2LKX A;  4V2F A;  3MVP A;  2AO9 A;  3HB9 A;  5EGO B;  3HOV J;  1U9N A;  5C3E J;  3TP0 A;  1ITY A;  1U8B A;  2ZB9 A;  4BKX A;  1I6H J;  2D5V A;  4A69 C;  3NAU A;  2M2E A;  2LLK A;  5M3M J;  5IPA A;  2XB5 A;  3O8H A;  1MBK A;  2DA4 A;  1LFU P;  1HF0 A;  4D5F A;  2X6O A;  1QVT A;  4D5C A;  2DA5 A;  3CDL A;  1JKQ C;  1HDP A;  1A6I A;  4BBR J;  2CQX A;  5EF6 A;  1LE8 A;  1ETY A;  1IDY A;  2XRL A;  2E2J J;  5M3F J;  1ETX A;  2IEK A;  2YS9 A;  3ZOB A;  3OOU A;  4AUX A;  4UUS B;  1ENH A;  4JP0 A;  1XG1 A;  4Y7N J;  2P81 A;  1U9O A;  1FIA A;  1AKH A;  4L5E A;  1BJZ A;  1K61 A;  3BR6 A;  4X6A J;  3C2B A;  3HGY A;  1HDD C;  1ZQ3 P;  2L7F P;  3WHB A;  2CQQ A;  2VUM J;  4DYR A;  1D5Y A;  4DW6 A;  1W0T A;  2OPT A;  3GTG J;  4MFD A;  1E3O C;  2YU9 J;  2TRT A;  2R93 J;  3LNQ A;  1APL C;  5K7F A;  4JYK A;  3M4O J;  1G2H A;  1ZR2 A;  2CUF A;  1WH5 A;  2N8G A;  4A3G J;  2IAI A;  2XB0 X;  1MBG A;  1SAN A;  4IHY A;  3RZD J;  2O9L A;  2LP0 A;  2GLO A;  3JRI A;  3A03 A;  2VKV A;  1DU0 A;  2JJ7 A;  2MSY A;  1U78 A;  2HXI A;  2MG4 A;  3NAR A;  4DZJ A;  1MH4 A;  2G0E A;  3BR3 A;  2WAQ N;  1H8A C;  1B8I A;  1OCT C;  2X9D A;  4AYB N;  5IP7 J;  2LTP A;  4M6V A;  1MBH A;  5C44 J;  2H8R A;  1IGN A;  2HOA A;  4I6Z A;  1ETQ A;  1T33 A;  9ANT A;  2L0K A;  2E2I J;  4M3G A;  5M5W J;  1ETW A;  3PO2 J;  2O8K A;  3QPS A;  3BR0 A;  4A3K J;  4JX6 A;  2KDZ A;  2HDD A;  1F43 A;  2DJN A;  5IP6 A;  4MO7 A;  4CYC B;  2ID6 A;  3TW6 A;  3BG3 A;  3JRH A;  4I76 A;  2R5Z A;  3G1M A;  4BXX J;  1MBJ A; 
#chains in the Genus database with same CATH topology
 1Y0N A;  1VI0 A;  1MMG A;  1LDK B;  4Q4Z F;  1HBX G;  2R92 J;  2Q1Z B;  2EPF A;  2RAE A;  1XCB A;  4LOC A;  1RKT A;  4NUB A;  2QVO A;  4EJO A;  1QRY A;  3S15 J;  4KIC A;  2P6T A;  2IA1 A;  3GWZ A;  5JHF A;  2CV1 A;  3DPU A;  3SZG A;  1BL0 A;  4G6T B;  4XRF A;  3AG4 H;  2QKL B;  2JN6 A;  3TO7 A;  2IP2 A;  2GAU A;  4B47 A;  1FP1 D;  1R00 A;  3ZMD A;  4J01 A;  2MFZ A;  2V26 A;  2OQR A;  5EGO A;  2ZFU A;  4U88 A;  2DK8 A;  1TNS A;  3P7N A;  2UV1 A;  3BPV A;  4XLN F;  5KHD A;  1BC8 C;  3HC7 A;  4IF4 A;  2WWY A;  2E7X A;  3GEZ A;  4BU2 A;  5DUK A;  1MBF A;  1RRJ A;  3H3U A;  4KT6 A;  1I3A A;  1S7A A;  2CJJ A;  3H5R A;  2M8G X;  4RB1 A;  1MSF C;  5GAE J;  2ESH A;  3LSH A;  3BQZ A;  2IGM A;  4QIW N;  4P9U A;  3BT9 A;  1ODD A;  1DP7 P;  3DCF A;  4F92 B;  4YIF A;  3CJQ B;  1BM9 A;  3A0B C;  3S32 A;  4YFX F;  2GA2 A;  4A6D A;  3EPZ A;  2BBY A;  1IRF A;  5FJ8 J;  3OYH A;  1SAX A;  5DD4 A;  4CZC A;  4H4K C;  4RMN A;  1L3L A;  1KU3 A;  4II2 A;  1J9I A;  2HZT A;  2V1N A;  2ECB A;  3F23 A;  2M87 A;  4KMU X;  3ZMV A;  3M1E A;  2V9K A;  2XAF A;  1RZ4 A;  4ZZL A;  3HKZ N;  2RC4 A;  2Z1D A;  4HV6 A;  2L2O A;  2L9S A;  4M3E A;  3K1P A;  1YIJ I;  5J4Y A;  2EQR A;  3G73 A;  4FE7 A;  5L3C A;  4ESJ A;  5TRD A;  3OL4 A;  4KN4 X;  3L1P A;  2DOE A;  2NVY J;  1MJB A;  5FLX K;  3BR2 A;  5K5Q A;  3SDG A;  3HHH A;  1AA7 A;  1Z6T A;  4BJ5 C;  3JSO A;  3CF2 A;  1WGX A;  5KCM A;  2XHK A;  2P0W A;  2W4S A;  4F3Q A;  4KN7 X;  4YG2 F;  2MYS A;  4JOM A;  2KLO A;  5H6Q A;  3MEX A;  1K79 A;  3SQN A;  3T5X A;  1K4S A;  1YLF A;  4M6Y A;  5F1J A;  2KIM A;  2Z2S B;  2MH2 A;  2Q2E B;  3FK7 A;  4MFE A;  5F04 A;  3TDZ C;  3WHC A;  1QNT A;  4KIB A;  3LA3 A;  4G8X A;  1UHM A;  3TO6 A;  4R79 A;  2QSG X;  3RJP A;  2KZG A;  1JXS A;  1J2X A;  4RLF A;  1YW7 A;  2GWR A;  1Z77 A;  1ZGW A;  3GFJ A;  2PI0 A;  4OIR F;  3L2C A;  3F9K A;  4L9N A;  3PIO F;  2E34 A;  2R7W A;  2DMQ A;  3CCU I;  1IV8 A;  1WJB A;  1XSD A;  5GPC A;  3OWT A;  1FX7 A;  4WWC A;  2LDU A;  5HLH A;  4OIO F;  3RKW A;  4RB0 A;  1IJW C;  2HYJ A;  1IAW A;  1E3P A;  4CCL A;  3O2P E;  2M9H A;  4KIG A;  4RAG A;  5LHI A;  5EEA A;  2EV5 A;  3B6A A;  3KCC A;  3F6V A;  4ZYG A;  2BW3 A;  3OYD A;  4C2U A;  2CW7 A;  3S17 J;  1HSJ A;  1W5S A;  4XOR A;  3TED A;  2LBF A;  1NH3 A;  4C30 A;  4B48 A;  1SFO J;  3U21 A;  1V3F A;  3GVA A;  1VQM I;  3HEF A;  2HKO A;  3DEE A;  5TIS C;  4EAT A;  2JA7 J;  4A3C J;  2E71 A;  4E7I A;  1R1T A;  4XQF A;  2QLZ A;  4DQ2 A;  4RBO A;  1WFX A;  4W97 A;  3RQI A;  4HF1 A;  3GTL J;  2PEX A;  3R0J A;  4M9S A;  3HG9 A;  1XN7 A;  4HQM A;  3JRG A;  2L54 A;  4F7Z A;  1R9T J;  1VQ6 I;  1TZL A;  3JRF A;  4IRH A;  5F27 A;  2NVT J;  1S5L C;  5D5U B;  3OYF A;  4G94 A;  5M5X J;  5J1R A;  2QYO A;  1K4T A;  2OU2 A;  2MC4 A;  2CRG A;  2HR3 A;  2HFH A;  5HLT A;  1F4K A;  4FX4 A;  4A0Y A;  3TDU C;  2LFB A;  5GPA A;  3JRE A;  5CVR A;  3LST A;  4BQN A;  5E1Z B;  1HQC A;  3L7W A;  2H94 A;  1B8I B;  1ETV A;  4IQJ A;  4CGZ A;  2IGK A;  5TJJ A;  5BMZ A;  2CYY A;  1KU7 A;  1F5T A;  1D5V A;  3H5N A;  3WTS C;  4HEA 2;  3QOP A;  1W0U A;  2L01 A;  2PN6 A;  1LFB A;  1TL8 A;  2Z33 A;  3HPG A;  4A5N A;  4AD9 A;  1H9T A;  3K9T A;  3LSI A;  4M3F A;  3S1R J;  3DFG A;  2WV0 A;  3FMS A;  1MBE A;  2FA5 A;  2QQ9 A;  4PFP A;  1GT0 C;  2HZD A;  1OCO H;  3SJM A;  2KIQ A;  4A6E A;  2XGX A;  5E3O A;  3SEZ A;  4I99 C;  3L00 A;  3H0D A;  5DYM A;  4YRV A;  2W57 A;  4ENM A;  1BI3 A;  2ECC A;  2K7L A;  3OSG A;  3WTV C;  4AYB A;  3LSJ A;  1BR1 A;  2MLK A;  1IN8 A;  3ROU A;  4HA8 A;  1Z7L A;  2GQQ A;  5ILU A;  4D7M A;  2FNA A;  2MD5 A;  2KKO A;  5FLX Z;  1Z1D A;  1R1V A;  2B0L A;  2TDX A;  2M7B A;  3DEW A;  5A2Q Z;  1JI8 A;  2QF7 A;  1P2F A;  1ZR4 A;  5C4J J;  5F0C A;  1R5I D;  3FX3 A;  1JGS A;  2WC2 A;  1VQ4 I;  4X1E A;  3ZQL A;  3K70 D;  3IL2 A;  2EK5 A;  3J7A Y;  3P9I A;  2FRH A;  5HS7 A;  3BG7 A;  3GZ5 A;  1ZRF A;  4NC8 A;  1P6R A;  2BZT A;  2B7E A;  2DFF A;  4XIC A;  5BPI A;  1XDS A;  1TTY A;  3RCO A;  5IYC J;  3T1B A;  3I59 B;  4XKB A;  1RR8 C;  5ICG A;  2CWE A;  2HI3 A;  3RPU D;  4S04 A;  2R7O A;  5F1R A;  3D5S C;  2W24 A;  2NNY A;  3ASO H;  2X0L A;  2HPM A;  2XGC A;  3S14 J;  4LIV A;  3FXQ A;  1JJ8 C;  5IY5 H;  5CVJ A;  4ASN A;  2NS8 A;  3JRB A;  1PUE E;  3DTI A;  1GVJ A;  3FDY A;  2XSJ C;  1HW2 A;  4P1W A;  2L7Z A;  2XAG A;  1BIA A;  1XMX A;  2K40 A;  3K70 C;  5D4S A;  3EET A;  3HZJ A;  3ECH A;  2FX0 A;  3UR3 C;  1UEL B;  4R8H A;  4S05 A;  3I56 I;  4A3I J;  4UHT A;  3LMM A;  1BA5 A;  3CD6 I;  1F9N A;  2XAH A;  3QWL A;  5FGM A;  3P9K A;  2HYG D;  1TWH J;  3AG3 H;  3DPT A;  3SFI A;  2DT5 A;  5HNH A;  2DPU A;  2OAZ A;  4OOI A;  3VSL A;  1JJ6 C;  4F91 B;  5CKT A;  3H92 A;  4A0Z A;  3QPH A;  5HVQ C;  1U2W A;  3FXO A;  3H1C A;  2E1N A;  4BY7 J;  1OPC A;  3QP6 A;  2VIX A;  3JAM Z;  4PZJ A;  3JRA A;  3HOS A;  4KYW A;  5KAI C;  2VL8 A;  2EIK H;  3DP7 A;  5EEG A;  5EEH A;  2ZSI B;  1BI2 A;  4IQ4 A;  1U6G A;  5FRM A;  4KIF A;  2JSC A;  3X2Q H;  4WXH A;  2KT0 A;  5LLQ A;  4HW0 A;  1B1B A;  1FBQ A;  2XPV A;  2XIG A;  3IUO A;  1B72 B;  3IHU A;  2ELH A;  4KDP A;  3A4C A;  3A02 A;  1TBX A;  5ICF A;  4ITV A;  5LFA A;  1EH6 A;  1IC8 A;  3SZT A;  2VBX A;  3L2R A;  4IOC F;  1I27 A;  1MGT A;  3FXL A;  4EM1 A;  1I3Q J;  3CME I;  2ESN A;  5AON A;  3BLY A;  4NDL A;  2MH9 A;  3HRM A;  5ICE A;  5JVG F;  4GCV A;  2R5Y A;  3K7A J;  3IH2 A;  4ZZD A;  1JGG A;  3O8G A;  4YEJ A;  4A3M J;  2R7U A;  5JVT A;  1YIT I;  2VQH A;  1VQ8 I;  3OYN A;  2K9M A;  3I4M J;  1TC3 C;  1SVO A;  5CPR B;  5LGN A;  2QKM B;  4RGS A;  2A6E F;  2LF8 A;  1MD0 A;  4FX0 A;  2Y31 A;  4L9V A;  1N75 A;  1FY7 A;  4IVN A;  4EJU A;  4OWR B;  2LKX A;  3CP8 A;  4NNJ A;  4LIT A;  4V2F A;  5CQG A;  1X1P A;  5EGO B;  2CG4 A;  4CCJ A;  4BKX A;  3KFW X;  4A69 C;  3HXL A;  2KIU A;  2X6Y A;  3K2Z A;  2LLK A;  1LUJ B;  1FSH A;  3WTZ A;  3BJ6 A;  1XB4 A;  2DA4 A;  4N9H A;  2F5E A;  3K69 A;  4ZDO A;  1QVT A;  2H6C A;  5LD2 C;  4ZYE A;  1WJC A;  3OYA A;  4XKV A;  5D5W B;  4XLA A;  2VLA A;  4I09 A;  4KFC A;  1IXR C;  3DKY A;  4LIU A;  2W84 A;  4L5I A;  1DGR M;  1LE8 A;  1BC7 C;  1QZE A;  2A61 A;  3LQR A;  2E2J J;  1KQ9 A;  2A6H F;  3WGH A;  3SEQ A;  1A04 A;  3K0L A;  2XAU A;  1K78 B;  1SFX A;  3GFL A;  2ZXW H;  1VQ7 I;  3LAP A;  5HOO A;  3BR6 A;  3LL7 A;  4CA0 A;  2KQR A;  3L2V A;  5DCM A;  1KQ8 A;  1N78 A;  1P4A A;  3HKZ A;  4IL6 C;  2R4G A;  5B66 C;  2JPC A;  3HGY A;  1ZLJ A;  1S72 I;  5K1Y A;  3DKW A;  1OQY A;  2CQQ A;  3HIF A;  4P5O A;  3J7Y J;  1W5T A;  2KRC A;  4Z2Y A;  3OYJ A;  2P5L C;  1VQK I;  4MFD A;  1YO5 C;  2RGV A;  2TRT A;  2JVG A;  2R93 J;  2VT2 A;  1Z05 A;  3M4O J;  1X4P A;  2VPL A;  1W36 D;  1ZR2 A;  2CQ7 A;  5FFZ A;  2CUF A;  2N8G A;  1FNN A;  5KAF C;  2WY7 Q;  2F4O B;  1SAN A;  4ON0 A;  4D1Q A;  3A0H C;  1SEU A;  2O9L A;  2GLO A;  2ZCW A;  4UNO A;  4RGU A;  5BPD A;  3C3W A;  1IUY A;  2MG4 A;  3NWS A;  3PSI A;  4RB3 C;  1TW3 A;  2BYV E;  2X9D A;  4AYB N;  5IP7 J;  3W6K B;  4M6V A;  1MBH A;  2H8R A;  2HOA A;  3E97 A;  2XAJ A;  3HSR A;  4CHU A;  1T33 A;  1S3J A;  2HEO A;  4GXO A;  1ETW A;  1R5H A;  4I01 A;  3N05 A;  4XL9 A;  4A3K J;  2A07 F;  2O8K A;  1ZHF A;  2CQK A;  3VYT B;  2ZJQ F;  1A35 A;  1KU2 A;  5IP6 A;  4MO7 A;  4UVC A;  4NBQ A;  3COA C;  2ISZ A;  1VQP I;  5HNF A;  2R5Z A;  1QZY A;  4A12 A;  1W4M A;  4BXX J;  1LFU P;  3W2W A;  1HKT A;  4U0Y A;  2DFE A;  2QEX I;  1UFM A;  2UXX A;  4A3E J;  3RDI A;  3CC7 I;  1KYW A;  1TW2 A;  4Q47 A;  4BDZ A;  2VXZ A;  2AS5 F;  4MLO A;  5DCF A;  3KPH A;  4HSR A;  2R5Z B;  4BDY A;  3ECO A;  1NG6 A;  3Q3S A;  1S29 A;  5FKO A;  3VOE A;  4GDF A;  4HRI A;  1XGO A;  3MZ8 A;  1IUF A;  1EKE A;  4UB6 C;  3ZQG A;  1X3Z B;  2VC0 A;  2VQL A;  2LH9 A;  3GO5 A;  2GOX B;  3JW4 A;  1NK3 P;  2EFW A;  1SD7 A;  4BBS J;  4BS9 A;  2EZH A;  2LYC A;  4U87 A;  1YJW I;  3BZC A;  1D8K A;  1WI3 A;  3OY9 A;  3I0T A;  2X85 A;  2WA0 A;  2RVC A;  3E6C C;  1P7I A;  3RYP A;  1WVR A;  4M3B A;  3K1M A;  3Q0W A;  3RPU A;  1OMI A;  2M34 A;  3ZGK A;  3CP2 A;  4N4O B;  4FIS A;  4CH7 A;  4MGR A;  4BE0 A;  3QAH A;  4YEL A;  2G7U A;  1TWF J;  1S9H A;  5FFX A;  4C3H J;  4CUG A;  1V5G A;  2CMP A;  3CCY A;  2Q8K A;  2DMU A;  2DMT A;  3V42 A;  1D1A A;  3GCM A;  2ZNZ A;  1QU3 A;  3R61 A;  1X2M A;  3ELK A;  4BJT A;  3D5L A;  4RLQ A;  4YFN F;  3H9J A;  4IX7 A;  3GTQ J;  2VE8 A;  2LC2 A;  3VSK A;  1OCR H;  4NC6 A;  2A5W A;  4G12 A;  4XRS A;  2QSF X;  3N97 A;  3DV8 A;  1LFP A;  1XGM A;  1A36 A;  4G7O F;  2LSO A;  3DTE A;  1T6S A;  2H1K A;  2DA6 A;  3BCB A;  1T98 A;  2A68 F;  2L9V A;  3CCM I;  4CCM A;  2E7W A;  2DT6 A;  4ENK A;  2CV2 A;  4UXN A;  2ZJR F;  1IRG A;  3IRQ A;  4DBQ A;  4BE1 A;  2BV6 A;  1IO2 A;  2XGE A;  3TOB A;  4WF2 A;  5CVU A;  2C6Y A;  1RR7 A;  5L3E A;  2UZK A;  2DDA A;  3GBG A;  1X58 A;  3IH3 A;  4I02 A;  3CQZ J;  2WAF A;  3R4K A;  3QQA A;  2GIZ A;  1UCR A;  2ZNY A;  2DCE A;  3I53 A;  1J0R A;  2DA1 A;  2OZ6 A;  4BAC A;  1MH3 A;  3FXU A;  2Y9Y A;  3HOW J;  2YPR A;  3PFY A;  2ZKZ A;  1MMA A;  1BIB A;  4Q5S F;  1HW5 A;  4J19 A;  5EG0 A;  3OSF A;  2OJE D;  3DPL C;  2F48 A;  1DDN A;  2DOF A;  2XKP A;  4GRI A;  5FLM J;  4Y3O A;  2W7N A;  3LSK A;  3JSP A;  1T0F C;  1F1Z A;  4C2T A;  3WU1 B;  3BR1 A;  3SYT A;  2ZSH B;  3J7Z I;  2M1B A;  2UUZ A;  1ZRE A;  2Y0M A;  4G7Z F;  2BXZ A;  2EBI A;  2KHM A;  4OU0 A;  5K5R A;  1XC5 A;  2IS1 A;  1Z9C A;  1T39 A;  2ZXH A;  4L18 B;  3FIW A;  3E7L A;  2EZI A;  2KJC A;  2COB A;  2K9S A;  3CJN A;  1FT9 A;  1G6N A;  2L4A A;  4LFU A;  3OR1 C;  4E7J A;  2DQL A;  1R6R A;  3PIP F;  4N0B A;  1A5J A;  4O3M A;  3S1N J;  2XSD C;  4PJJ A;  3NRV A;  5E3L A;  1EH8 A;  1FMV A;  3CF5 F;  3T0Y A;  3S3N A;  5JHU A;  2F5D A;  5E18 F;  4KIT B;  2O7O A;  4JK1 X;  2E5Z A;  1WI9 A;  5DTD A;  5CQE A;  3T8R A;  2QA4 I;  1AHD P;  4S0H B;  1U5T A;  3BJO A;  3EUH C;  2F5F A;  2V9P A;  2DFI A;  2HQA A;  2R7Z J;  4U7B A;  4XID A;  5JLX A;  3FWE A;  1ZN2 A;  4XBF A;  3CLQ A;  3H36 A;  3A01 A;  2R0Q C;  2Z9O A;  1I39 A;  2XF7 A;  4M74 A;  3MZH A;  1YW8 A;  2LVS A;  5B1A H;  2Y0S N;  3GYH X;  2KFD A;  1OYI A;  4DGW B;  2DT7 B;  1SFU A;  3RZO J;  3CLO A;  1FOY A;  1D8J A;  2VJ5 A;  3KYD B;  4B1R A;  1J75 A;  2LK2 A;  1B9N A;  5M5Y J;  3GLL A;  4FT8 A;  4HLX A;  3VWB A;  4GFB A;  2J5P A;  3UKG A;  3CCQ I;  2L7K A;  2D2W A;  4V2G A;  1WWX A;  4B3X A;  3K1N A;  4M71 A;  1I6X A;  4A93 J;  4LK0 F;  1OCP A;  5F08 A;  1I1G A;  4Y13 A;  5D6E A;  2VAS A;  2L9R A;  2K3P A;  2Q2E A;  3H3V K;  3WTW C;  4I0A A;  3KLN A;  5F0H A;  4L0Z B;  1MND A;  4AM3 A;  3LSR A;  2ZME C;  1KYZ A;  2JZY A;  2RQP A;  3I4P A;  3VFZ A;  4IKF A;  3ZQI A;  2XRO A;  2R5Y B;  3KP2 A;  1R1U A;  3G4S I;  1BOB A;  1VND A;  3M1C A;  3SFZ A;  4XLP F;  1WKM A;  2EIL H;  5HLI A;  3ZRG A;  3ZP5 A;  2EV0 A;  2FMY A;  3S1M J;  3I5U A;  2STT A;  2BY3 A;  5KNL A;  2XV4 S;  1BR2 A;  4HNV A;  3CES A;  3OS1 A;  4MTD A;  1PUF A;  3HTS B;  2DI3 A;  2V9V A;  2E1M C;  4WCG A;  3WTT C;  2K3F A;  2NYX A;  2HTJ A;  3KZI C;  1O57 A;  3FHZ A;  1B72 A;  1ZG5 A;  4QSH A;  3HM5 A;  4EQQ A;  5ILV A;  5CVV A;  3S8P A;  1BJA A;  5DM6 F;  2L7M P;  3J80 Z;  2V6C A;  4UB8 C;  4Y4R A;  3EDP A;  5J1U A;  1Y8Q B;  4A3D J;  2HQN A;  1ZGA A;  1BI1 A;  2EFO A;  3H9Q A;  4XON A;  2GIV A;  5FO5 A;  2VON A;  1ACI A;  2MW8 A;  3SDB A;  4M3D A;  3ZQQ A;  4F52 A;  1TQP A;  2OTJ I;  3U2R A;  4EMS A;  2PJR B;  1NG7 A;  3OS2 A;  2E1O A;  4Y33 A;  3BR5 A;  3BTL A;  4BEH B;  1DU6 A;  4KJZ A;  3B6C A;  3F8M A;  3S2D J;  1O3R A;  1V5F A;  5GTI C;  2H6B A;  3I4N J;  1Z91 A;  2RDP A;  2LY9 A;  1G4D A;  2P4W A;  1ULY A;  4BXF A;  2WV1 A;  1T38 A;  1VQ9 I;  4IRG A;  3K4M A;  2M0M A;  2RV8 A;  1RES A;  1LVA A;  1XDU A;  3BTC A;  5DCM B;  3GTO J;  1GHC A;  5DS9 A;  3QPL A;  2OA4 A;  1Z3Y A;  3JTH A;  4L9J A;  1YS7 A;  3I3L A;  3LSP A;  3BPX A;  3FXM A;  4XLH A;  2NVQ J;  2NAZ A;  4LJZ F;  2GOM A;  3ZQH A;  1K78 A;  2JA8 J;  3F8N A;  3S16 J;  2BOL A;  3LSG A;  3ABL H;  1FTT A;  5J1Y A;  2E1M B;  3A01 B;  2FD5 A;  2KMU A;  4RGR A;  5HS8 A;  1K7A A;  1JKP C;  4XRM A;  2XC7 A;  2B63 J;  3HOT A;  3BDD A;  3G3Z A;  1RNL A;  2BVM A;  2H1L A;  1YX3 A;  2FU4 A;  3AFH A;  2H8W A;  3F3X A;  3W6J B;  3C1D A;  4EJW A;  3LWF A;  3GF2 A;  4BJ6 C;  1YG2 A;  3CUQ C;  3FXK A;  2XDV A;  2D5V A;  2VKD A;  4XOP A;  3OYG A;  2IGN A;  2VQG A;  2MAB A;  2V79 A;  2DLL A;  5DDG A;  4G7H F;  4ETS A;  3CDH A;  5M3M J;  2KIS A;  4RGX A;  2ZFW A;  2XB5 A;  3IWF A;  1S8N A;  3FBN B;  4RAF A;  1HF0 A;  3DWL E;  3G6E I;  1X1B A;  1R5G A;  2X6O A;  2Z16 A;  4PFO A;  4D5C A;  4E7S A;  2CUJ A;  1G3T A;  2DA5 A;  5GTH C;  2E36 A;  1J5Y A;  3GX4 X;  1FLI A;  1J09 A;  2BGC A;  2Q0O A;  4BUP A;  1A6I A;  2X1C A;  1G59 A;  2CQX A;  2ETH A;  2I5U A;  2VT3 A;  3CUQ A;  5IT9 Z;  4HAM A;  2KDO A;  1M1E B;  2X6W A;  2WTE A;  1FWZ A;  2DBB A;  3C2G A;  2IGO A;  2QBY B;  1W1W E;  1ETX A;  3OOU A;  5B3S H;  4UUS B;  3V7R A;  1MMD A;  1XG1 A;  4Y7N J;  1LEB A;  5EJC A;  4HNU A;  2LKS A;  1SFK A;  4P9F A;  5GAD J;  2UWM A;  1W7P B;  2W85 A;  3IWZ A;  1FOW A;  1FIA A;  2IXS A;  4LG0 B;  3DLL F;  3QOE A;  3GFI A;  3C2B A;  3KP3 A;  3CCL I;  1Z21 A;  2MC3 A;  3O3K A;  3ZMS A;  1ZQ3 P;  5ILS A;  3WHB A;  2OBP A;  3E1S A;  1CF7 B;  4DYR A;  2VJ4 A;  1D5Y A;  4DW6 A;  3M7G A;  2OPT A;  1EA3 A;  2M8E A;  3Q9V A;  2G9W A;  3HSE A;  3DBL B;  4RB2 C;  3W3C A;  2BEO A;  1APL C;  2R3S A;  2G7H A;  3RYR A;  2JSP A;  3ZMT A;  5DEQ A;  1G2H A;  2EIN H;  5J40 A;  3PNY A;  3WGI A;  2AXT C;  2QSH X;  4IHY A;  1YJN I;  2QQ8 A;  3RZD J;  3CCV I;  1MIJ A;  2VKV A;  3AL0 B;  4I0B A;  4XSZ F;  3QP5 A;  2HXI A;  2WB1 A;  3NAR A;  3BR3 A;  1RC9 A;  2WAQ N;  2GXB A;  1OCT C;  4KT5 C;  2K9L A;  3TMO A;  2QUF A;  2LY1 A;  4LD5 A;  2L0K A;  2E2I J;  3P9C A;  2W00 A;  1DQU A;  4M3G A;  4M9X A;  1ZAO A;  3PO2 J;  2DYR H;  3BR0 A;  3K4N A;  2VOO A;  3ZN0 A;  2CW0 F;  2FXA A;  2DJN A;  3LSM A;  4CYC B;  2ELJ A;  4HPQ A;  4NQW B;  4ESB A;  1P4W A;  4PJN A;  1D1B A;  3RTR A;  4HG2 A;  3G1M A;  1BBY A;  2XKO A;  2VBY A;  4Y52 J;  1YTY A;  1LEA A;  4XSX F;  3ZR8 X;  5GAH J;  2HQR A;  3P5J A;  1H88 C;  4HNT A;  2A69 F;  2O61 A;  3KLO A;  1TQM A;  1X2N A;  1KA8 A;  1I5Z A;  2QM3 A;  4ZC3 A;  3RSN A;  3PNV A;  5FKN A;  4CZZ A;  2LOO A;  5J4V A;  3J7A O;  1XS9 A;  5EG0 B;  2GBY A;  1H89 C;  3E0J B;  3FZV A;  1USS A;  1YX5 A;  2O8X A;  1ERD A;  2OC6 A;  3TBI A;  5E17 F;  4M9Z A;  3CCJ I;  1X1C A;  3ZN1 A;  2EIM H;  2XGD A;  3MAJ A;  3S2W A;  1DPU A;  2I10 A;  3GTM J;  4XLE A;  5D4R A;  3GTK J;  3OIQ A;  3FBI B;  2DO7 A;  2ZME A;  2FNP A;  3MN2 A;  5FKM A;  3K10 A;  2JA2 A;  2ICW G;  2Y2Z A;  3AG2 H;  3H9G A;  1GUU A;  3K4K A;  4LB6 B;  4EM0 B;  3VB2 A;  1UJ8 A;  2IPQ X;  4PJL A;  1I50 J;  1HXD A;  2EV6 A;  2PMZ N;  4ZDL A;  3KIO A;  1XGS A;  2E35 A;  4UUT A;  2IW5 A;  1X3U A;  2MA3 A;  2BY1 A;  4EGZ A;  1HKS A;  1OYW A;  1QHH D;  2P8T A;  1X19 A;  3CJT B;  4PSW A;  3RKY A;  5D5V B;  2ELK A;  3JRC A;  2VQC A;  3HUG A;  2DYS H;  3FKJ A;  4BHB A;  3KP5 A;  1ZAR A;  2ZME B;  1JE8 A;  4IRI A;  2AHQ A;  1FJL A;  3KP4 A;  3WTY C;  4HQE A;  3LA2 A;  2CH0 A;  2GXA A;  4LLL A;  1TWC J;  2ME0 A;  4ZYH A;  1RUO A;  4L9T A;  4II3 A;  4QLC U;  1JHF A;  1YFH A;  5IP9 J;  2ID3 A;  5FKL A;  5LHH A;  3CO7 C;  4C3I J;  2OF7 A;  3WG9 A;  4B43 A;  5D5X B;  3RIR A;  1E0E A;  3FMQ A;  2HS5 A;  3FXJ A;  4I2O A;  4JBA A;  4KIS A;  1Z67 A;  2NOG A;  4A2U A;  3KX2 A;  4I98 B;  5IOZ A;  3EUH A;  1WPK A;  1VFC A;  2VE9 A;  5L3B A;  2NNN A;  2DOA A;  4HDV A;  1JUM A;  2NXN B;  1SC7 A;  1SFE A;  4F55 A;  2XF6 A;  2LBF B;  4MHG A;  3CMY A;  2X51 A;  1NTC A;  1ZEL A;  1QHG A;  2FBH A;  1BN5 A;  4MEX F;  1U5T B;  2DA7 A;  1R23 A;  5F0F A;  4XRS G;  3C18 A;  3GXO A;  4ENJ A;  3HJE A;  4CXF A;  2KL4 A;  2M45 A;  4IPA A;  3OYE A;  2VB6 A;  1HC8 A;  2K4J A;  3T8T A;  5BQT A;  4IHV A;  1SD6 A;  2M7A A;  1QBJ A;  3BCA A;  2O6G E;  3ZQF A;  1E3H A;  3HRT A;  3H3Z A;  2FQ4 A;  2EZL A;  2E2H J;  1NK2 P;  1S7E A;  2PBI A;  1O7L A;  2F5C A;  2O5R A;  1HKQ A;  3ABU A;  3IAS 2;  3VOD A;  4FTH A;  4EJT A;  3F8F A;  2OQG A;  1ZKG A;  4B8X A;  4JX5 A;  3I64 A;  4BQA A;  3QU3 A;  3HOX J;  3MQ0 A;  4K2E A;  2L4M A;  2BY0 A;  1QA6 A;  3TL4 X;  1BW6 A;  4CDG A;  5HDK A;  3CCR I;  2FQ3 A;  3FM5 A;  1ONV A;  1TQI A;  1EF4 A;  1WQ2 A;  2YSR A;  2LR8 A;  2QEN A;  4AWX B;  5JFR A;  1O3S A;  1L0O C;  3UNG C;  2H27 A;  2AXL A;  3CC2 I;  3I54 A;  3L2Q A;  1Z6R A;  2R7V A;  2MBF A;  1KQ0 A;  4KNY A;  1WH7 A;  3MKZ A;  3B73 A;  3KEQ A;  5LEJ A;  2CUE A;  1UG0 A;  5D8L B;  2GM4 A;  1Y1V J;  2PMZ A;  4LG0 A;  5E1X A;  2F4I A;  1KU9 A;  2VI6 A;  3OYM A;  4AIK A;  1FEX A;  2A05 A;  1AKH B;  1GVD A;  2YUS A;  2XPU A;  3WTX C;  2M0C A;  3KZY A;  3BTI A;  3VDX A;  4FAS D;  4LB5 A;  2K86 A;  4UUS A;  2EFP A;  2XRN A;  5FRN A;  2QBY A;  4W1U A;  1P7J A;  3OYK A;  4O5V A;  2P7C B;  3RPQ A;  1FP2 A;  1UG2 A;  1TWA J;  3S2H J;  2EH3 A;  4HST A;  1F36 A;  1RET A;  3O6B B;  1R7J A;  1T56 A;  2RN7 A;  5JR3 A;  3OIO A;  5DUI A;  2IJL A;  3ONQ A;  1Q1V A;  4MQ9 F;  2RNG A;  3KP6 A;  4OIN F;  4U0W A;  3HOY J;  1FOX A;  2P7V B;  3ABT A;  1C0W A;  1X1D A;  3OS0 A;  1N25 A;  2DA3 A;  3RI4 A;  1AU7 A;  2JA5 J;  5E3N A;  1R58 A;  3DBH B;  1ETO A;  3JR9 A;  1FPQ A;  2F5V A;  5D8K B;  3N4M A;  4BQQ A;  3ZCO A;  2FOW A;  5FKK A;  1YYV A;  3QRF F;  2R7D A;  3M07 A;  1GV5 A;  3U1D A;  1TT5 B;  3CCE I;  1PUF B;  4G6Q A;  3H35 A;  3FHN A;  1TWG J;  1P9Q C;  2HU9 A;  4BHC A;  3QPT A;  2FBK A;  3IH4 A;  4HV5 A;  3TQN A;  5BNG A;  4BHP A;  5E3M A;  3G1L A;  3MMY B;  3ERM A;  1PYV A;  3F8C A;  2EIJ H;  4JX4 A;  5D6F A;  2FJ1 A;  2EA2 A;  2Y9Z A;  3WE3 A;  3IAM 2;  5K7H A;  3OR2 C;  4IXA A;  2AQF A;  4ABZ A;  4HF0 A;  2HOS A;  1UHW A;  6PAX A;  3PUB A;  3K2A A;  1FMW A;  1LKX A;  1Y39 A;  3E5Q A;  3WTU C;  2R7T A;  3BZK A;  3L2U A;  2DXI A;  2OCC H;  4CYC A;  4OIQ F;  2CU7 A;  4HDU A;  2HOT A;  3IKT A;  4DZP A;  4UVB A;  3FK6 A;  5E8G A;  1FBU A;  2QCO A;  1RKW A;  5L3G A;  1YS6 A;  3NWT A;  3GFM A;  3I71 A;  2X1E A;  3Q5F A;  5J8C A;  2Y69 H;  2LY2 A;  1E2X A;  1R36 A;  1G3Y A;  2HDW A;  3L2W A;  3QYF A;  3VYS B;  1R4M B;  1VQO I;  2HGC A;  4DNC A;  4U7D A;  3FKI J;  5H2F C;  1LJ9 A;  5DD8 A;  4EEF G;  4RS8 A;  3BY6 A;  1R49 A;  2R7X A;  1NHA A;  2O0Y A;  1UMQ A;  5HS9 A;  3D5R C;  3H0G J;  4A0X A;  4A3F J;  3RKQ A;  4M6X A;  3VYR B;  5J8F A;  4WXC A;  3J81 Z;  1XD7 A;  3EUA A;  3LA7 A;  4FET A;  2I8D A;  2EFN A;  3HRU A;  3AAF A;  2YX4 A;  4V19 K;  1MJ9 A;  2VKE A;  3BWG A;  3PQJ A;  4EVI A;  2JTV A;  2JPB A;  3BG9 A;  5LHG A;  3BOQ A;  4M72 A;  3A2K A;  4DYC A;  1TT0 A;  4M73 A;  3TOA A;  1BR4 A;  3KYL A;  3ZPL A;  4FE4 A;  2W1O A;  3GZ6 A;  2XPW A;  2JWT A;  1UAA A;  1QQI A;  2NVX J;  1YQA A;  4E7Z A;  2M5W A;  1Y8R B;  2P5V A;  5C4X J;  3AG1 H;  4IHX A;  2A3S A;  5KK1 A;  4QTR A;  2KRF A;  3FIS A;  4RA2 A;  4ZTF A;  1E17 A;  1XSX A;  3MWM A;  4OMZ A;  4PGH A;  4EV0 A;  4MTE A;  2PLY A;  2NRA C;  2JUG A;  5LGT A;  4IHT A;  3CUO A;  1IXC A;  5FRO A;  1HLV A;  3TKY A;  1JT0 A;  1DPR A;  2IT0 A;  1JHH A;  2Z99 A;  3M3Y J;  4IZZ A;  3F6O A;  1WJD A;  4HOB A;  1IDZ A;  2CFO A;  3VEP A;  1GXP A;  2L9N A;  4BY1 J;  2K9Q A;  1JTY A;  2E5N A;  2VOD A;  3MVP A;  1IN7 A;  2AO9 A;  3HB9 A;  3H5A A;  1V5E A;  2W25 A;  2FUG 2;  3V8L A;  5F6F A;  1KZH A;  1I6H J;  1H0M A;  1LDJ A;  2JVH A;  4E6K G;  3CMM A;  5J6X A;  2PG4 A;  4BL0 B;  1ZH5 A;  1Z3X A;  3NAU A;  2O03 A;  1T0F A;  3HSF A;  4ZTJ A;  2DQR A;  4XKW A;  2DAO A;  4KUM A;  4IJA A;  2OUM A;  5LBQ A;  1T8I A;  3CDL A;  1JKQ C;  2PQ8 A;  1HDP A;  1G8X A;  1Q1H A;  2YR2 A;  1D3Y A;  3I59 A;  4HX7 A;  2V1X A;  2VBZ A;  2LMD A;  1MKM A;  1P4X A;  5EF6 A;  2GXG A;  5K5O A;  1IDY A;  1TP4 A;  2XRL A;  4XN0 A;  3WE2 A;  3DTK A;  4ZDP A;  2YS9 A;  3PFI A;  3ZOB A;  5LEK A;  1ENH A;  1FYK A;  2NS0 A;  4EM2 A;  3GZN B;  3TGN A;  1A31 A;  4GYG A;  4CCK A;  5ED4 A;  1EJ9 A;  3SHF A;  1U9O A;  5E8I A;  3EYY A;  1BJZ A;  2M3A A;  5E79 C;  2KZV A;  2OCE A;  4XKC A;  4X6A J;  2VBW A;  2HOE A;  2A5Y B;  2E1C A;  1PJR A;  2IA0 A;  4IHS A;  1HDD C;  1U5T C;  5L3F A;  2HPI A;  5B5E C;  2VUM J;  1FZP B;  5H6R A;  3W2V A;  5ICC A;  3M8E A;  1FYM A;  1ZGJ A;  3GTG J;  1SAU A;  4H0E A;  3DBR B;  2IS6 A;  1Y56 A;  2YU9 J;  2CW8 A;  3FXR A;  4FQG A;  4BEH A;  2XUB A;  2D45 A;  5K7F A;  5HDN A;  2CFX A;  2PJP A;  2X4H A;  1K6O A;  4A3G J;  2K27 A;  2IAI A;  4CIC A;  3C2H A;  4MQV A;  1IN4 A;  1TLH B;  2V4J C;  4LMY A;  4C9Y A;  5LGU A;  1YI2 I;  4OMY A;  4ZJZ A;  5GAG J;  5HLG A;  3JRI A;  3A03 A;  4AIJ A;  1YOV B;  5KVR A;  1O7F A;  2NOJ B;  2PMH A;  2MSY A;  1BOA A;  1U78 A;  3KET A;  4OAZ A;  4BXU A;  3HL2 A;  4BH9 A;  1MH4 A;  3I55 I;  1CF7 A;  3OIP A;  2VOP A;  4UV9 A;  1B8I A;  1ZG1 A;  3PSF A;  1X4O A;  3V8K A;  4CYD A;  1IGN A;  1QZZ A;  4I6Z A;  5BOX A;  9ANT A;  5M5W J;  4XLC A;  1AWC A;  3RQ4 A;  4Q48 A;  1D1C A;  4Z6Y A;  3ZMZ A;  4NC7 A;  3QYB A;  3REO A;  1F43 A;  1XSV A;  2KJB A;  1WJE A;  4PCQ A;  3TW6 A;  1CGP A;  4HF2 A;  5CYV A;  4I76 A;  3MD2 A;  1IW7 F;  5TGT A;  3F8B A;  1W36 C;  2L3D A;  2P6S A;  3GLX A;  1T08 B;  3V7S A;  4GGG A;  5AIQ A;  3E6B A;  1YRN A;  5JLW A;  4YIR X;  1XCV A;  4QWQ A;  1G3W A;  2RQQ A;  4A5M A;  2DJI A;  2ZJP F;  1GLN A;  3BZ6 A;  4MEY F;  5IYD J;  4CO8 A;  4C3J J;  3HDD A;  2ZJ2 A;  1ZRD A;  1JT6 A;  2COM A;  5LRS A;  3V8J A;  5CVI A;  3NQO A;  1OLT A;  2VKH A;  3ASN H;  3CJR B;  4YII A;  1OFC X;  2RKH A;  4BYY A;  3OYC A;  1J7K A;  4LK1 F;  3D1N I;  1T2K A;  1HCR A;  1ON2 A;  2D1V A;  4ZH4 F;  2IVM A;  1J59 A;  2IRF G;  1MMN A;  3EQL F;  1UST A;  1HOM A;  1ZK8 A;  3OYB A;  1DUX C;  2KIF A;  1JUS A;  2EZK A;  4BGD A;  1SD4 A;  3G2B A;  2WBM A;  4HX8 A;  4E4H A;  4HBL A;  5FB2 A;  2FEZ A;  2PMU A;  3OOP A;  2Y30 A;  2XAQ A;  2WAQ A;  1A6Q A;  4A3B J;  1YIO A;  1JKO C;  2CGP A;  1Y1W J;  1REP C;  2DTR A;  1HA8 A;  1D0X A;  1QO0 D;  3HOU J;  3KEY A;  3OYI A;  4AIH A;  2OTL I;  3S1Q J;  2DW4 A;  1QPM A;  3ESW B;  2KPM A;  3ML6 A;  1WJF A;  1MJA A;  1QPI A;  3I9V 2;  2ZO4 A;  1MMS A;  1OR7 C;  4XLF A;  4RDU A;  4D9J A;  2V1U A;  5IYB J;  4D7N A;  1XMA A;  4HYE A;  1RPW A;  2DOD A;  2MGQ A;  1ZG3 A;  1XPX A;  3ERE D;  4E7L A;  4LLG F;  4XR6 A;  4A3L J;  4Y17 A;  4XN3 A;  2DN0 A;  2TCT A;  2V7F A;  3KP7 A;  2XVC A;  2K85 A;  1FIP A;  2HVS A;  1SVM A;  3TP3 A;  3CDI A;  5LRR A;  1AOY A;  3WG7 H;  2X1D A;  2MD0 A;  3I58 A;  2Z5U A;  3HBL A;  1GXQ A;  3HUG B;  2YU3 A;  4YFK F;  2JRM A;  2M4K A;  4FHT A;  3F0C A;  3K6G A;  3S93 A;  4PJ0 C;  1SVL A;  1IN6 A;  3GME A;  4X0G A;  3HGG A;  3MCZ A;  3C7J A;  5EZH A;  3V4G A;  2R7S A;  1T95 A;  2M30 A;  3ZQ7 A;  2FE3 A;  4XMY A;  2OV7 A;  2K9N A;  5K7Z A;  1PP8 F;  1U0J A;  3WGG A;  4AVP A;  2WY8 Q;  2STW A;  1YHQ I;  4BQO A;  3QU6 A;  3HRS A;  3BG5 A;  1STZ A;  2DFH A;  3BQY A;  1P92 A;  4KMF A;  4MIM A;  4D0P A;  3HHG A;  1OCZ H;  1OJL A;  3W6V A;  1XTA A;  3F72 A;  3DEU A;  1BW5 A;  2JQ7 A;  4RAY A;  1B9M A;  4EGY A;  4EJV A;  4ZYD A;  3R60 A;  3IC7 A;  1CQT A;  3JCU C;  3LOC A;  2DA2 A;  1WCM J;  2DTZ A;  3FF5 A;  1G3S A;  2KRH A;  2JA6 J;  1ON1 A;  2LNB A;  5B1B H;  3U9G A;  2E19 A;  3BRO A;  3BTJ A;  3TO9 A;  3MKW B;  1LVK A;  3RKX A;  1LNW A;  1JUP A;  3D0S A;  4ANJ A;  2FSW A;  1Z0X A;  4IO9 F;  2IS4 A;  1MNM C;  3JRD A;  2CS3 A;  5EZG A;  4LG3 A;  3IP4 B;  3CUQ B;  4KA4 A;  2EB7 A;  4G6D A;  2QWW A;  1W7P D;  2L02 A;  4DYQ A;  4NQW A;  1R4N B;  2NS7 A;  5HOD A;  5IT9 K;  3BP8 A;  3CTA A;  2XAS A;  4E70 A;  4J00 A;  3JTG A;  3CMA I;  3CZ6 A;  4UUV A;  1IV6 A;  1UZC A;  4BE2 A;  2IS2 A;  1S7O A;  2KP6 A;  1IG7 A;  3TW7 A;  4FCY A;  3DXJ F;  5F64 A;  4TV7 A;  1K83 J;  4RM3 A;  4WK8 F;  2CUZ A;  3HYI A;  2DPD A;  1GDT A;  1HW1 A;  1LB2 A;  2HXO A;  4BAY A;  1PDN C;  2WB1 N;  1H9G A;  2BVL A;  3DU6 A;  5FD5 A;  2JK3 A;  3OYL A;  4HLY A;  2W48 A;  3FMR A;  2GA1 A;  3J80 K;  2VPR A;  1JTX A;  1UHS A;  2JRT A;  4OIP F;  3KZZ A;  2FOK A;  1XX5 A;  2QQA A;  3PNT A;  2ME6 A;  2LRE A;  2WAD A;  1FSE A;  3WOD F;  3KE2 A;  3G1O A;  4HX4 A;  4E7H A;  4ZYA A;  4N4N B;  4CCN A;  1D0Z A;  1MW7 A;  4AC0 A;  1V54 H;  2EJR A;  1LQ1 A;  4XNF A;  1IRZ A;  2BHY A;  1FOK A;  3HOZ J;  2DU9 A;  4DIQ A;  1QVU A;  2WAE A;  2ZXJ A;  1IZ1 A;  3IKV A;  2HDC A;  1OKR A;  3Q0U A;  1EV7 A;  3CO6 C;  4AVZ A;  1YW9 A;  2UXN A;  5E1W A;  3HPH A;  1WSU A;  1W7P A;  2DDB A;  2ZBK A;  3IV5 A;  1O4X A;  4UY8 I;  2JMW A;  3E5X A;  2F6C A;  3K4B A;  4JQF A;  1N77 A;  1FTZ A;  3EYI A;  1JKR C;  3A1Y A;  5J3L A;  2BXY A;  3ZMU A;  3VPR A;  2PJR A;  5CLS A;  4WX9 A;  2FF4 A;  2ACJ A;  3QYE A;  3DF8 A;  1BI0 A;  3IRR A;  1YJ9 I;  4AID A;  2K4B A;  4XM3 A;  1B4A A;  3CCS I;  1YRN B;  1I1S A;  3KYC B;  2Y75 A;  3R0A A;  2PX9 A;  3E3V A;  2CQN A;  3GTJ J;  1ORK A;  1RIO H;  5IOY A;  1DGW Y;  1Z7U A;  3U1K A;  3J81 K;  4DBR A;  5A2Q K;  4QPQ A;  4UVA A;  5JI6 A;  1S6L A;  2DMN A;  2LKP A;  2R7Q A;  2V1D A;  4ESF A;  1ZLK A;  3GTP J;  2HKX A;  2X48 A;  4MNU A;  1YE9 A;  3PQK A;  5ERI A;  4XK4 A;  3DKX A;  4IEJ A;  3LFK A;  2QQB A;  3GW2 A;  2Y48 A;  4DJA A;  5J47 A;  3M8J A;  2M4G A;  3B02 A;  2DK5 A;  1B59 A;  3LQQ A;  5AIP A;  2A6T A;  5FLV A;  1B6A A;  2ZC2 A;  1UB9 A;  1FYL A;  2NVU B;  4IOA F;  1U3E M;  1HST A;  1Y6I A;  3DLA A;  4B3A A;  2W82 A;  3G71 I;  2HVR A;  3MKL A;  1EH7 A;  1IRX A;  1MNE A;  1VF9 A;  2CV0 A;  3PO3 J;  1GV2 A;  1WRJ A;  3PUF A;  1SD5 A;  4XOT A;  3V7C A;  3E6M A;  2BY2 A;  4B44 A;  2DMP A;  4P55 A;  4A3J J;  1ZRC A;  1R71 A;  1ZTR A;  1MDM B;  1FC3 A;  2IBD A;  2MLG A;  1VTN C;  4WXD A;  1Y0U A;  2EFQ A;  2FBI A;  1IF1 A;  2D1H A;  1LDD A;  1IN5 A;  1RI7 A;  3Q0V A;  1MSE C;  4F93 B;  5GP9 A;  3ABK H;  3ABM H;  4B4C A;  3Q9S A;  2HWV A;  2HYF A;  3M8F A;  4I7H A;  3L9F A;  3DQV C;  3LAJ A;  1OYY A;  2J5O A;  2LRD A;  2O3F A;  2XF5 A;  3PL8 A;  2R7F A;  3OL3 A;  2EWN A;  4OAY A;  1OR7 A;  2HQ5 A;  2X6X A;  3K4L A;  3ZXS A;  2GZW A;  1ETK A;  2R7R A;  3F22 A;  5EDN A;  1V55 H;  1PP7 U;  1LE8 B;  2PFB A;  1XMK A;  2F2E A;  3ISP A;  3ZQC A;  2VXD A;  1IXS B;  2LD5 A;  1W5C C;  4IHW A;  1ZYR F;  3PM1 A;  3BC8 A;  4GYI A;  5EYR A;  3JAM K;  1OIS A;  3CC4 I;  2BW3 B;  3KEO A;  1POG A;  4C2M J;  2HVQ A;  4LLN A;  1D0Y A;  3SZP A;  1VQN I;  5L3D A;  3HOV J;  2JUC A;  1U9N A;  5C3E J;  2LF7 A;  2FML A;  3TP0 A;  1ITY A;  1U8B A;  4UV8 A;  2ZB9 A;  3K4C A;  3E6D A;  2K5C A;  3VYU B;  2M2E A;  2ZXI A;  5IPA A;  3O8H A;  1MBK A;  1VQL I;  1LPQ A;  2VJI A;  4D5F A;  5CJ9 A;  4AU7 A;  4PSX A;  5DM7 F;  3S3M A;  4PJM A;  4CSW A;  3ULQ B;  2V6E A;  5E20 A;  1WJ5 A;  1V4R A;  2ISY A;  1XGN A;  4BBR J;  3EUK L;  3LFU A;  4PUS A;  1ETY A;  4E7K A;  5M3F J;  2F4M B;  2IEK A;  1X3W B;  4R1H A;  2RNJ A;  4AUX A;  4DOZ A;  1RUN A;  2OD5 A;  4JP0 A;  4PK4 A;  2HTS A;  2ADU A;  5FD6 A;  2P81 A;  1K6Y A;  5H20 A;  3BG6 A;  3BJA A;  4NB5 A;  4O6J A;  4L5E A;  1AKH A;  2RRE A;  1PVE A;  2QGU A;  1K61 A;  3WU2 C;  1WJA A;  2CO5 A;  2EA4 A;  2VJJ A;  2B9S A;  2BHZ A;  3NEU A;  3L09 A;  3AKZ A;  3MZY A;  2L7F P;  3S3O A;  2LG4 A;  4QPO A;  2H09 A;  1QGP A;  1O3Q A;  1W0T A;  2HNH A;  1E3O C;  1TNT A;  2AQE A;  5DV5 A;  3FM3 A;  1WZ2 A;  3LNQ A;  4PGG A;  3M9A A;  1KON A;  4JYK A;  1DP3 A;  1R22 A;  1VQ5 I;  2VN2 A;  1WH5 A;  3QOD A;  4RM2 A;  2L5Q A;  3GUD A;  2XB0 X;  4B09 A;  1VZ0 A;  3HTU A;  5BS6 A;  3W2A A;  1MBG A;  4LGW A;  2LP0 A;  3R6S A;  1MZB A;  3OV8 A;  2E60 A;  1DU0 A;  2JJ7 A;  3SXY A;  4ENN A;  5HDG A;  4DZJ A;  1H8A C;  1SMY F;  2G0E A;  4N9I A;  4CCO A;  3E5U A;  4NHJ A;  3F21 A;  2BE5 F;  4L5J A;  1OCC H;  2LTP A;  4HZF A;  1WHU A;  2YX7 A;  5C44 J;  3MFK A;  2VC1 A;  4Y15 A;  2IA2 A;  1ETQ A;  4L0Y B;  1X1A A;  3AL0 C;  3K4J A;  4RAZ A;  2CSO A;  3QPS A;  4PDK A;  4P96 A;  2Y0S A;  4JX6 A;  4U0V A;  2JT1 A;  2KDZ A;  4BNC A;  1MDM A;  2HDD A;  1O3T A;  2ID6 A;  5IT3 A;  2Z3Y A;  2QZ8 A;  3BG3 A;  1FBS A;  3JRH A;  4GO1 A;  4G9Y A;  2OZU A;  3MKY B;  1U8R A;  3OMY A;  1SMT A;  2K02 A;  3WU0 A;  1KGS A;  3PJR A;  3DU5 A;  2P5K A;  1MBJ A; 
#chains in the Genus database with same CATH homology
 1VI0 A;  5JLW A;  1YRN A;  4Y52 J;  2R92 J;  1H88 C;  2RAE A;  4LOC A;  1RKT A;  1QRY A;  4A3E J;  3S15 J;  1X2N A;  5IYD J;  4C3J J;  3HDD A;  1JT6 A;  4MLO A;  5FKN A;  1BL0 A;  1OFC X;  3D1N I;  2R5Z B;  5EG0 B;  1XS9 A;  1HCR A;  2GBY A;  1H89 C;  2JN6 A;  3Q3S A;  5FKO A;  1HOM A;  1ZK8 A;  1IUF A;  3ZQG A;  1JUS A;  2EZK A;  2XGD A;  5EGO A;  1NK3 P;  4BBS J;  2I10 A;  3GTM J;  2EZH A;  3GTK J;  2Y30 A;  5FKM A;  4A3B J;  3MN2 A;  1MBF A;  1WI3 A;  2Y2Z A;  2CJJ A;  1MSF C;  2M8G X;  1JKO C;  1GUU A;  3BQZ A;  4QIW N;  3BT9 A;  1P7I A;  1Y1W J;  3DCF A;  3HOU J;  4M3B A;  1I50 J;  3Q0W A;  2PMZ N;  3S1Q J;  2M34 A;  4FIS A;  4UUT A;  1TWF J;  5FJ8 J;  4C3H J;  3JRC A;  1QPI A;  2ELK A;  3CCY A;  2DMU A;  2DMT A;  4RDU A;  5IYB J;  4D7N A;  1RPW A;  2MGQ A;  2ECB A;  1X2M A;  2AHQ A;  1FJL A;  4A3L J;  2DN0 A;  2TCT A;  1TWC J;  3HKZ N;  2ME0 A;  1FIP A;  3GTQ J;  4M3E A;  3TP3 A;  4G12 A;  2EQR A;  2ID3 A;  4FE7 A;  5IP9 J;  4XRS A;  5FKL A;  4C3I J;  2OF7 A;  3L1P A;  2NVY J;  3HBL A;  2H1K A;  3BR2 A;  2DA6 A;  3SDG A;  3F0C A;  2NOG A;  1WGX A;  3HGG A;  5IOZ A;  5EZH A;  1WPK A;  1VFC A;  1JUM A;  5F1J A;  3FK7 A;  2XGE A;  4MFE A;  5F04 A;  2K9N A;  3WHC A;  5K7Z A;  3CMY A;  1RR7 A;  1NTC A;  2DA7 A;  5F0F A;  4XRS G;  3GBG A;  1X58 A;  3IH3 A;  3CQZ J;  3BG5 A;  3QQA A;  1Z77 A;  1ZGW A;  3BQY A;  2DA1 A;  4MIM A;  1MH3 A;  1OJL A;  3W6V A;  4IHV A;  2Y9Y A;  2DMQ A;  1BW5 A;  3HOW J;  5GPC A;  3ZQF A;  1IJW C;  2FQ4 A;  2EZL A;  2HYJ A;  2E2H J;  1NK2 P;  1CQT A;  1S7E A;  3LOC A;  5EG0 A;  2DA2 A;  1WCM J;  4J19 A;  3OSF A;  2DTZ A;  2M9H A;  4FTH A;  5EEA A;  3B6A A;  5FLM J;  2JA6 J;  3S17 J;  2E19 A;  3BR1 A;  1ZKG A;  3BTJ A;  4JX5 A;  3TED A;  1JUP A;  1SFO J;  1Z0X A;  3HOX J;  2EBI A;  3JRD A;  1MNM C;  3HEF A;  1XC5 A;  4A3C J;  2JA7 J;  5EZG A;  1BW6 A;  4RBO A;  4W97 A;  1EF4 A;  3RQI A;  3GTL J;  2LR8 A;  4DYQ A;  3JRG A;  3FIW A;  1R9T J;  3E7L A;  3JRF A;  2EZI A;  2NS7 A;  2COB A;  2K9S A;  5HOD A;  5F27 A;  2NVT J;  5M5X J;  1WH7 A;  5J1R A;  1IV6 A;  2CRG A;  2CUE A;  1A5J A;  3S1N J;  2XSD C;  1IG7 A;  3TW7 A;  1Y1V J;  5E3L A;  4FCY A;  2GM4 A;  2LFB A;  5GPA A;  3JRE A;  1K83 J;  1B8I B;  2O7O A;  1GDT A;  2VI6 A;  5DTD A;  1ETV A;  1FEX A;  1AKH B;  1GVD A;  2YUS A;  2XPU A;  2HXO A;  4S0H B;  1AHD P;  2M0C A;  2WB1 N;  3BTI A;  4UUS A;  2R7Z J;  2JK3 A;  2W48 A;  1W0U A;  4XID A;  5JLX A;  2VPR A;  1JTX A;  1UHS A;  1LFB A;  1P7J A;  4W1U A;  3A01 A;  2R0Q C;  1UG2 A;  2ME6 A;  1TWA J;  3S2H J;  2EH3 A;  3G1O A;  1F36 A;  2LVS A;  4M3F A;  3S1R J;  1RET A;  2Y0S N;  1MBE A;  1T56 A;  3OIO A;  1GT0 C;  1Q1V A;  3RZO J;  3SJM A;  5E3O A;  4AC0 A;  3HOY J;  3OSG A;  2DA3 A;  2ECC A;  1AU7 A;  2JA5 J;  4B1R A;  5E3N A;  2LK2 A;  5M5Y J;  1IRZ A;  1ETO A;  3HOZ J;  3JR9 A;  3LSJ A;  1QVU A;  4GFB A;  4D7M A;  3UKG A;  5FKK A;  4V2G A;  3Q0U A;  3DEW A;  1GV5 A;  2QF7 A;  1ZR4 A;  5C4J J;  5F0C A;  1PUF B;  3IV5 A;  1TWG J;  4X1E A;  1O4X A;  3ZQL A;  2JMW A;  4A93 J;  1OCP A;  5F08 A;  3IH4 A;  1FTZ A;  5BNG A;  2L9R A;  1JKR C;  5J3L A;  5E3M A;  3G1L A;  3H3V K;  3VPR A;  4JX4 A;  5F0H A;  4XIC A;  2FJ1 A;  3LSR A;  2Y9Z A;  5IYC J;  5K7H A;  3ZQI A;  4ABZ A;  2HOS A;  2HI3 A;  2R5Y B;  1YRN B;  1VND A;  3K2A A;  3GTJ J;  1ORK A;  2XGC A;  3S1M J;  5IOY A;  3S14 J;  1JJ8 C;  4CYC A;  2CU7 A;  2NS8 A;  4HNV A;  1PUF A;  2DMN A;  3JRB A;  2HOT A;  4DZP A;  3FK6 A;  2QCO A;  1RKW A;  1B72 A;  3GTP J;  2X48 A;  3HM5 A;  4QSH A;  2L7Z A;  2K40 A;  4XK4 A;  2L7M P;  4IEJ A;  2FX0 A;  4A3I J;  5J1U A;  1BA5 A;  4A3D J;  3FKI J;  5FLV A;  1TWH J;  3SFI A;  4EEF G;  1JJ6 C;  2MW8 A;  4B3A A;  1UMQ A;  4M3D A;  3H0G J;  3MKL A;  4A3F J;  3RKQ A;  1VF9 A;  3PO3 J;  1GV2 A;  4BY7 J;  2E1O A;  3BR5 A;  3BTL A;  3JRA A;  1DU6 A;  3B6C A;  3S2D J;  2DMP A;  2VKE A;  4A3J J;  1ZTR A;  2IBD A;  3I4N J;  2LY9 A;  3BG9 A;  2KT0 A;  2WV1 A;  2XPV A;  4DYC A;  1B72 B;  1RES A;  3A02 A;  3Q0V A;  4FE4 A;  1MSE C;  3BTC A;  5GP9 A;  2XPW A;  1IC8 A;  3GTO J;  5DS9 A;  2JWT A;  3QPL A;  2NVX J;  1I3Q J;  4B4C A;  5C4X J;  3LSP A;  4NDL A;  2NVQ J;  4IHX A;  3ZQH A;  2JA8 J;  4QTR A;  3FIS A;  2R5Y A;  3S16 J;  3K7A J;  3LSG A;  3IH2 A;  2HQ5 A;  1JGG A;  1FTT A;  3O8G A;  1ETK A;  4A3M J;  5J1Y A;  5EDN A;  3A01 B;  2FD5 A;  1HLV A;  1LE8 B;  1JT0 A;  3ZQC A;  1JKP C;  4XRM A;  3I4M J;  3M3Y J;  2LD5 A;  1TC3 C;  4IHW A;  2B63 J;  1IDZ A;  3PM1 A;  2Y31 A;  5EYR A;  4BY1 J;  2K9Q A;  1POG A;  1JTY A;  4C2M J;  2LKX A;  4V2F A;  3MVP A;  2AO9 A;  3HB9 A;  5EGO B;  3HOV J;  1U9N A;  5C3E J;  3TP0 A;  1ITY A;  1U8B A;  2ZB9 A;  4BKX A;  1I6H J;  2D5V A;  4A69 C;  3NAU A;  2M2E A;  2LLK A;  5M3M J;  5IPA A;  2XB5 A;  3O8H A;  1MBK A;  2DA4 A;  1LFU P;  1HF0 A;  4D5F A;  2X6O A;  1QVT A;  4D5C A;  2DA5 A;  3CDL A;  1JKQ C;  1HDP A;  1A6I A;  4BBR J;  2CQX A;  5EF6 A;  1LE8 A;  1ETY A;  1IDY A;  2XRL A;  2E2J J;  5M3F J;  1ETX A;  2IEK A;  2YS9 A;  3ZOB A;  3OOU A;  4AUX A;  4UUS B;  1ENH A;  4JP0 A;  1XG1 A;  4Y7N J;  2P81 A;  1U9O A;  1FIA A;  1AKH A;  4L5E A;  1BJZ A;  1K61 A;  3BR6 A;  4X6A J;  3C2B A;  3HGY A;  1HDD C;  1ZQ3 P;  2L7F P;  3WHB A;  2CQQ A;  2VUM J;  4DYR A;  1D5Y A;  4DW6 A;  1W0T A;  2OPT A;  3GTG J;  4MFD A;  1E3O C;  2YU9 J;  2TRT A;  2R93 J;  3LNQ A;  1APL C;  5K7F A;  4JYK A;  3M4O J;  1G2H A;  1ZR2 A;  2CUF A;  1WH5 A;  2N8G A;  4A3G J;  2IAI A;  2XB0 X;  1MBG A;  1SAN A;  4IHY A;  3RZD J;  2O9L A;  2LP0 A;  2GLO A;  3JRI A;  3A03 A;  2VKV A;  1DU0 A;  2JJ7 A;  2MSY A;  1U78 A;  2HXI A;  2MG4 A;  3NAR A;  4DZJ A;  1MH4 A;  2G0E A;  3BR3 A;  2WAQ N;  1H8A C;  1B8I A;  1OCT C;  2X9D A;  4AYB N;  5IP7 J;  2LTP A;  4M6V A;  1MBH A;  5C44 J;  2H8R A;  1IGN A;  2HOA A;  4I6Z A;  1ETQ A;  1T33 A;  9ANT A;  2L0K A;  2E2I J;  4M3G A;  5M5W J;  1ETW A;  3PO2 J;  2O8K A;  3QPS A;  3BR0 A;  4A3K J;  4JX6 A;  2KDZ A;  2HDD A;  1F43 A;  2DJN A;  5IP6 A;  4MO7 A;  4CYC B;  2ID6 A;  3TW6 A;  3BG3 A;  3JRH A;  4I76 A;  2R5Z A;  3G1M A;  4BXX J;  1MBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...