2O6GE

Crystal structure of irf-3 bound to the interferon-b enhancer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interferon-b enhancer
publication title An Atomic Model of the Interferon-beta Enhanceosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 17
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2o6gE01
4BQAA 3I0TA 2CW0F 4LLNA 4UV9A 4U88A 3JAMZ 5HDKA 4A6EA 2ZBKA 5TRDA 2XKPA 3E97A 1RNLA 1VTNC 5J8FA 5ICFA 1IW7F 2XAJA 2O0YA 1E17A 1XCVA 5CVRA 3TQNA 1LJ9A 3H92A 2BE5F 3HOTA 5CJ9A 4WXCA 5FD6A 4P55A 1C0WA 1U3EM 2LNBA 2PFBA 2BEOA 4YFNF 1ON1A 4M6YA 4L9VA 3AAFA 1HKQA 3NEUA 1YQAA 3HRMA 2PMHA 3KP7A 3R0JA 4BXUA 2EFPA 3DV8A 5D8KB 2L01A 2M1BA 4RGUA 3PQKA 3I54A 4P96A 5CYVA 3O3KA 1FPQA 1BBYA 1IN6A 2KRFA 1B9MA 3ISPA 3J81Z 1WI9A 3RJPA 3FXRA 3FM5A 3U9GA 3JAMK 1MZBA 1P4XA 2F5DA 3DKWA 3REOA 2D1HA 4ON0A 4IVNA 1R1VA 1TW2A 5KK1A 2Q8KA 2BBYA 1BOAA 2RGVA 2LKPA 4M74A 1U8RA 3NRVA 2V79A 4KIFA 1TTYA 3GFLA 4MEYF 1REPC 2NNNA 1R36A 1O3QA 4WK8F 3WU1B 5HS8A 4P5OA 2W25A 2FRHA 1U5TA 4UHTA 5DD4A 4ZH4F 1S29A 1W5SA 2CQKA 1T98A 3QP6A 5A2QZ 3J81K 5D4SA 4HAMA 1ONVA 3GUDA 5E8IA 2K7LA 2QQ9A 1FBSA 4IRHA 2P5KA 2IP2A 3K1PA 3VFZA 1SFEA 3E3VA 4G7HF 1SD5A 2WWYA 4FHTA 3TO9A 4G8XA 3HSFA 3MAJA 1TQPA 5TJJA 1B1BA 4HX4A 4BAYA 3GVAA 4ESJA 1S6LA 5LEJA 1R5HA 4L9TA 1O3RA 1YG2A 1LDJA 1YS6A 4E70A 2ETHA 2D1VA 2DTRA 4BH9A 2D45A 2XVCA 5JFRA 2P6TA 1P4WA 1Z6RA 1XGOA 5A2QK 2RV8A 3F8CA 1O57A 2STTA 4KFCA 4I98B 4N0BA 5BQTA 2VC0A 3ML6A 1RI7A 1T39A 3FF5A 2QVOA 1U5TB 3ZN0A 2Y75A 3U1DA 2LDUA 1DP7P 2DW4A 5FD5A 4OMZA 1L3LA 3KP4A 1SFUA 4JQFA 2ZO4A 4LGWA 2MH9A 3I71A 3F6VA 5FFZA 2HYFA 1XCBA 1XSDA 3CUQC 2G9WA 2X0LA 1LNWA 1ZLKA 1I1SA 2K02A 2DU9A 1QNTA 1S8NA 1XD7A 4HYEA 2R7FA 3WODF 2GQQA 5D6EA 2FXAA 1PP8F 1ZRCA 3T5XA 5DUIA 4HA8A 3S2WA 3Q9SA 1ZH5A 2YU3A 2FMLA 1XDUA 4NHJA 4L9JA 4RAZA 2UXXA 4BHPA 5D5UB 4MQ9F 3TDZC 3E5XA 5F1RA 2DBBA 2OQRA 5DCMB 2YR2A 3F8NA 4OIRF 2VOPA 5ERIA 1SMTA 1ZYRF 1YIOA 3RDIA 1O7LA 2H94A 4I01A 3TDUC 2KJBA 2GA2A 2QYOA 1LEAA 5CLSA 2XAQA 1AOYA 4U0WA 2VBYA 3W6KB 5LRSA 1NHAA 3ZMSA 2EA2A 2CO5A 1ZARA 2M87A 2MBFA 1LDDA 2HWVA 1CGPA 5L3CA 2O3FA 1XMKA 2A07F 1LEBA 1HXDA 1SD7A 2RVCA 3MWMA 5E1WA 4HF1A 2XAHA 4LB6B 2GIVA 4M6XA 5D6FA 2C6YA 4PGHA 2A68F 4I7HA 2QQAA 4EJOA 3N4MA 1KYWA 2P7CB 4YFXF 3QP5A 4G7OF 1ODDA 1SMYF 1MJ9A 2MLKA 4AIKA 5HS7A 3WTZA 2EB7A 1R00A 3RPUA 4A12A 2P7VB 2PQ8A 1HQCA 1HW1A 5F64A 4S05A 1FNNA 5FGMA 1MJBA 4KICA 5DEQA 5DYMA 3L7WA 2KJCA 1ZLJA 1DUXC 4CICA 4AIHA 5ICEA 2M45A 1KYZA 2O61A 3KP5A 1Z1DA 3WTVC 2WTEA 2CSOA 1BIBA 3ZMDA 5CVJA 1KU2A 3GXOA 4G7ZF 4IRGA 1RZ4A 3COAC 1QQIA 3QPTA 4UXNA 3KE2A 3BJOA 2VOOA 3J80Z 2KIMA 3ECHA 1DPRA 4BHCA 4HX7A 5HOOA 3O6BB 5BMZA 4GYIA 1CF7A 2EWNA 4Q47A 1ON2A 4OIPF 2EFOA 2EJRA 3HTSB 4AD9A 2Y48A 1ZAOA 3VB2A 4CGZA 5L3FA 5E1XA 3RKWA 3EUHA 4HDVA 1D8JA 3BZ6A 2PEXA 1SD4A 2NRAC 2XROA 2FU4A 1K7AA 2RN7A 4Q5SF 2JRTA 2JT1A 5L3EA 2A3SA 1W4MA 2D2WA 4U0YA 3KP2A 1R1UA 2H6CA 3F72A 3F6OA 1BI2A 2MA3A 1OR7A 3G3ZA 2L4MA 4CXFA 2VBZA 1XDSA 1R22A 4IHSA 3BPVA 2UZKA 1J59A 4GCVA 2Y0MA 2P6SA 3HSRA 3K2ZA 2XAGA 4A0ZA 3BJ6A 1HKTA 3MZHA 3J80K 1W7PB 2ZNYA 3GW2A 3LAPA 3C7JA 4OIQF 3RIRA 1OYWA 1B9NA 3MQ0A 3WU0A 4IHTA 1MKMA 4PZJA 3T8TA 1ZG3A 2ISYA 3E5QA 3ZP5A 2QZ8A 3DXJF 4O6JA 5ED4A 2OD5A 3WE2A 1U6GA 4MGRA 3I64A 2JSCA 4L0ZB 2HKOA 4FT8A 1BJAA 1LDKB 2W85A 4P9FA 2KKOA 5CVIA 2FBIA 1FYKA 3M9AA 3KLNA 4OIOF 1CF7B 3F8BA 1SFXA 2GWRA 2IA0A 2A5YB 2DFIA 4IXAA 3MEXA 1IUYA 4I2OA 3P9CA 3HYIA 2EV0A 5ILUA 2F5FA 2PMUA 1MGTA 2LF7A 4P9UA 1OYYA 2IA1A 3GFJA 3ABTA 2EFWA 4FX4A 2WC2A 2GZWA 1ZHFA 4L5IA 1XMAA 4EJVA 3F21A 5HLGA 4M73A 4M71A 4ASNA 4IRIA 2W57A 3GX4X 4K2EA 2PI0A 1QO0D 3RPQA 3TO7A 2FOKA 1GHCA 2VONA 3KEOA 1HW2A 4IF4A 4PGGA 2PJPA 1R23A 4YFKF 1F4KA 3R60A 4UV8A 1RUNA 4KNYA 1IAWA 1J0RA 3EETA 2YPRA 4LB5A 2GA1A 2OBPA 4F7ZA 2DI3A 5LHGA 3CJNA 3CUOA 1YTYA 5K5RA 3WTWC 1MD0A 3CO7C 1BIAA 1P92A 1O7FA 1HKSA 4WCGA 2HDCA 3M1EA 3SXYA 3IRQA 1YFHA 3M8FA 1JGSA 3WTUC 1QPMA 4R8HA 3GO5A 1B4AA 4QWQA 3B02A 3HSEA 1KQ8A 3WE3A 5H20A 2QBYA 5L3BA 1WKMA 3CLOA 3BOQA 1EH6A 1R5GA 2F5EA 2HTJA 2DPDA 5ILSA 2RNJA 2EV5A 3QU6A 1YO5C 3KCCA 1D3YA 2HTSA 1HBXG 1EH8A 1IF1A 2H27A 2IT0A 3N97A 5D5WB 5HLIA 4CHUA 2UXNA 4IPAA 1J75A 2A6EF 3L9FA 5DCMA 5DCFA 1LB2A 3V8KA 1IXRC 3JSOA 1KQ0A 3E6BA 1G4DA 2MLGA 3KZZA 1USTA 4I0AA 3E6MA 2QM3A 5FB2A 4KDPA 1FWZA 5IT9Z 4M72A 1F1ZA 2FBKA 4H0EA 4DNCA 1KGSA 4HF2A 3SZPA 5FLXZ 1FSEA 3NQOA 4OMYA 4XSXF 1XGNA 2ESNA 4WXHA 4LJZF 1KQ9A 2HQNA 1W7PD 4QLCU 2WV0A 4L0YB 4XLPF 2V1UA 1BI1A 1FYLA 3LWFA 3R4KA 1V4RA 2IPQX 2L02A 2ACJA 3GFMA 3ZQ7A 3GWZA 2MD5A 1P6RA 3ZMZA 2B0LA 3JW4A 2DK8A 3L09A 2PBIA 2QBYB 2XKOA 4EVIA 5DV5A 6PAXA 2E1CA 3I5UA 1OMIA 1I6XA 4G6QA 2R3SA 1I5ZA 4I09A 3TKYA 1BN5A 2ADUA 1I1GA 3FMRA 2YSRA 2VE9A 3ABUA 3V8LA 1FC3A 3BPXA 2OZ6A 3D0SA 1WRJA 2IA2A 2OA4A 1X3UA 4U7BA 5FO5A 4LK0F 5BOXA 2K4JA 3WTYC 2VT3A 1ULYA 1RUOA 4NQWA 3Q9VA 4EMSA 3VOEA 1FZPB 1ZREA 4ZYGA 5D4RA 2Z9OA 1YW8A 4ENKA 1F5TA 2PN6A 1KA8A 1IRGA 1WWXA 2A69F 5JHUA 5K5QA 3H3UA 4UUVA 5E8GA 1Z7UA 3ULQB 4WF2A 3HUGA 1XGMA 3I4PA 3ZN1A 1V3FA 2FBHA 3WGIA 3BP8A 1Z05A 3M7GA 2RKHA 1LVAA 1FOKA 1RIOH 2ZMEB 3SZTA 1JHHA 3WGGA 4AVPA 4G94A 3TOAA 1FP2A 1L0OC 5BS6A 1J2XA 3IKTA 2BV6A 3OOPA 4LLGF 4Y13A 1DPUA 4HDUA 5AONA 3VODA 2CWEA 2YX7A 2KIUA 3DEUA 3HHGA 4EQQA 2GXBA 4A0XA 2AS5F 4G9YA 4UVBA 2IVMA 3KLOA 3RKYA 1J7KA 2FNPA 1FY7A 1K78A 2HZTA 4MNUA 3K0LA 3T0YA 4XLNF 4MHGA 3FXQA 4Z2YA 3ERED 2L4AA 2CYYA 1G3SA 5ILVA 4HV6A 1YYVA 4RGSA 2F2EA 2XHKA 3WTTC 1W7PA 2ZKZA 4XRFA 2P4WA 1OKRA 1P4AA 3P9KA 2HKXA 3LQRA 1IN8A 1OPCA 1TLHB 2E7XA 2RC4A 2G7HA 4ETSA 2DAOA 2XASA 4ZYHA 1ZG1A 3BJAA 4KMUX 4KIGA 2VXZA 4HW0A 2AXLA 4HOBA 3LSTA 4BYYA 1FP1D 4N9IA 5AIQA 2DLLA 1S7OA 3MCZA 1SD6A 2NS0A 1XSXA 1TQIA 5CVUA 4HLXA 1JE8A 2JZYA 3V7SA 2EA4A 3U2RA 2H09A 2OZUA 4D0PA 2JPBA 2V9VA 3CUQB 3LQQA 4TV7A 4HLYA 4YG2F 3RTRA 3D5LA 5JI6A 2HFHA 4OU0A 3ZMTA 2DT5A 1G6NA 4KYWA 3FZVA 2X4HA 2M30A 1MDMA 4KN7X 2DK5A 1BC7C 4NB5A 1K78B 4U7DA 1FX7A 3DQVC 5EEHA 3GZ6A 1JHFA 3R6SA 2EV6A 3C1DA 1SAXA 2QQBA 1QZZA 2OU2A 2QWWA 3DPTA 2QENA 1K6OA 2HS5A 1IXSB 1UHMA 3TO6A 2Z3YA 4R79A 5E20A 5BPDA 3TOBA 2VE8A 3B73A 3KP6A 2K4BA 2ZNZA 1Z91A 3DF8A 4CZZA 1MJAA 2XGXA 2O6GE 3RYPA 3ELKA 2NNYA 4ENNA 2O03A 4KIBA 4M9ZA 1ZG5A 2FMYA 4A6DA 1H0MA 1BM9A 2IW5A 1GXQA 4GO1A 2ZXJA 1TW3A 5HS9A 1BC8C 1FT9A 1HSTA 2KIFA 2VBXA 3IHUA 2W84A 4LFUA 2M8EA 5H6RA 3HOSA 5D5XB 2RDPA 4YIIA 1A04A 1BI0A 4R1HA 2MH2A 5LHIA 2HOEA 4GGGA 5AIPA 2CG4A 4EJUA 3SHFA 1QBJA 1OYIA 1D8KA 1R7JA 5H6QA 4WXDA 1U5TC 4GYGA 1GVJA 4O5VA 2P5LC 3RYRA 3CTAA 2E1NA 4I02A 1Q1HA 3FM3A 4ESBA 1STZA 2FNAA 3O2PE 2FA5A 4B8XA 3IWZA 1E2XA 3ZMVA 1MDMB 4RB2C 4EGZA 2R7DA 5L3DA 4OINF 2ZFWA 4L18B 3E6DA 3EDPA 1LQ1A 3WGHA 4A2UA 4BHBA 1UB9A 3Q5FA 3GFIA 4HQMA 3I59A 3C18A 4LD5A 1YS7A 5K5OA 1Z9CA 2P8TA 1T0FA 2OAZA 5L3GA 2FQ3A 5JR3A 1TQMA 3DP7A 5E1ZB 2EFNA 1IN4A 5HDNA 2VT2A 4ZYEA 4HZFA 1ZGJA 3LFKA 3GEZA 3ECOA 5LHHA 2Z33A 2ZCWA 4I0BA 3GYHX 3K1MA 1JXSA 4KA4A 4EV0A 1S3JA 3WTXC 3HRSA 3QRFF 3KP3A 1KU3A 2DQLA 3K1NA 2JTVA 3BWGA 3HHHA 4EM2A 4ENJA 4HF0A 2GXGA 3ZPLA 3V4GA 4UNOA 3SFZA 2GAUA 1U2WA 3PQJA 4JK1X 1QGPA 5CVVA 4A0YA 3WTSC 4FX0A 4BNCA 4KT5C 4RGRA 2PG4A 4L5JA 3FXUA 3QPHA 4RS8A 5HVQC 3W6JB 4Q48A 2V6CA 2QUFA 3V7CA 2L54A 2M5WA 3IWFA 4ZZLA 1G3YA 1UFMA 2ESHA 2PLYA 3RI4A 2Q0OA 1P2FA 3QAHA 3TGNA 2HYGD 3IC7A 3P7NA 3K9TA 5DUKA 5K1YA 5J6XA 4HQEA 3GLXA 4ZZDA 5DD8A 2RQPA 3I59B 4DQ2A 3V8JA 1J5YA 3F8MA 1K79A 2ELHA 1R58A 4L9NA 2QLZA 5ICCA 3P9IA 3VEPA 3QU3A 1PDNC 3LAJA 4ENMA 2OQGA 1USSA 1YLFA 5DDGA 5LLQA 1O3SA 3C3WA 1XGSA 3FMSA 2FE3A 2JPCA 4IJAA 5IT3A 4M9XA 2ZMEA 1KU7A 1IZ1A 2A6HF 3QOPA 4RB1A 4PCQA 1B6AA 4A5NA 1FBUA 3EYYA 5E17F 3FHZA 2Z99A 3JSPA 2HGCA 4GXOA 2FEZA 1UCRA 1I27A 4U0VA 4A5MA 4UVAA 4O3MA 5JVTA 3R61A 3FMQA 1O3TA 2F5CA 2O8XA 3KFWX 1ZGAA 4CYDA 4HV5A 1G3TA 1G3WA 3HTUA 5BPIA 1T6SA 3L2CA 1WQ2A 4EGYA 2ISZA 5IT9K 1T2KA 3KZYA 2BGCA 2NAZA 4XSZF 5KVRA 5FLXK 1U78A 3EYIA 3WG9A 2Q2EA 3F23A 2K27A 4Q4ZF 2V1XA 1UHWA 5LBQA 2IRFG 1B59A 2FSWA 4XBFA 1H9TA 4WX9A 2E7WA 3V7RA 1R1TA 3LA2A 4MQVA 4MTDA 5FFXA 2W24A 2VODA 2XIGA 3CO6C 2J5OA 2MC3A 1TNSA 2HR3A 3EQLF 3CUQA 2XUBA 5D8LB 1BI3A 3BY6A 4S04A 3T8RA 4RB3C 1AWCA 1XB4A 2CFXA 3ROUA 2EK5A 3F8FA 3H3ZA 3K69A 3SQNA 4CO8A 1IRFA 2G7UA 5LGTA 1EV7A 5F6FA 4RAYA 2VBWA 5J8CA 4Y15A 4YIFA 1FLIA 2P5VA 1IN7A 3IKVA 3T1BA 1W5TA 1ZRFA 1GXPA 5HLHA 2HQRA 3CDHA 1XSVA 3L00A 5LGUA 2YX4A 2H6BA 4EJWA 2VC1A 3RKXA 3DFGA 1IXCA 1WSUA 2XAFA 4EJTA 2COMA 4OOIA 5ICGA 2LF8A 3FWEA 3E6CC 5LRRA 2L3DA 5HDGA 3F22A 2DPUA 1Y0UA 2VN2A 3F3XA 3M8EA 2XV4S 1H9GA 4RGXA 4ESFA 3HIFA 3R0AA 1S7AA 4EM1A 4LG0A 2HEOA 4JBAA 4KUMA 1PP7U 3MFKA 4N9HA 1ZRDA 5LGNA 3E5UA 2ZJ2A 2K86A 3HRUA 1J9IA 3ZMUA 3HRTA 3LA3A 1YW7A 2FF4A 3LA7A 4EM0B 1TBXA 4B09A 4LLLA 4MEXF 4KN4X 5E18F 2Z5UA 2XRNA 4HX8A 2UWMA 3GZ5A 4WWCA 3G73A 2DO7A 4CDGA 4HBLA 1KU9A 1HSJA 1F9NA 2EFQA 1PUEE 5EEGA 3FX3A 2IJLA 4M9SA 3IRRA 2DQRA 4PDKA 4UVCA 2CGPA 4G6DA 1QZYA 3KETA 2J5PA 1EH7A 3I53A 1TNTA 3OV8A 1ZN2A 3IL2A 2LSOA 2BYVE 1FYMA 3GF2A 1T38A 1IN5A 3J7AO 5D5VB 1YW9A 1Z6TA 3JTHA 1DDNA 3PFIA 3JTGA 1D5VA 4MTEA 2STWA 3DPLC 2A61A 4KMFA 2NYXA 4LK1F 4LMYA 1XN7A 3MZYA 1FBQA 4AIJA 3BDDA 4AWXB 3I58A 1HW5A 3KEQA 4RB0A 4LG0B 4Y17A 1FSHA 2V1DA 2TDXA 3BROA 5LEKA 4ZYDA
chains in the Genus database with same CATH superfamily
1B72B 2VPRA 5DTDA 4BQAA 2R7VA 3VYUB 3I0TA 2CW0F 4CA0A 4LLNA 4UV9A 4DBQA 4U88A 3JAMZ 4FASD 3ZR8X 4QPOA 3VSKA 5HDKA 4A6EA 4YELA 2ZBKA 2VIXA 2XKPA 3AG4H 5TRDA 1MBJA 3E97A 1RNLA 1VTNC 5J8FA 1WVRA 5ICFA 1IW7F 2XAJA 1UG2A 1X4PA 2DA4A 1VQ6I 5B66C 5E3MA 2O0YA 4HEA2 1XCVA 5CVRA 3TQNA 1E17A 1LJ9A 3H92A 2BE5F 1P7IA 5CJ9A 3HOTA 4DYQA 1MBGA 4WXCA 5FD6A 4P55A 1C0WA 1U3EM 2LNBA 3JRAA 5IYBJ 2PFBA 1I39A 2DMPA 2BEOA 3DTKA 4YFNF 2DTZA 1MIJA 1ON1A 2EZIA 1MH3A 2K9NA 4M6YA 2AO9A 4L9VA 3AAFA 1HKQA 3A1YA 3NEUA 1YQAA 3HRMA 2PMHA 3KP7A 3R0JA 4BXUA 2EFPA 3DV8A 5D8KB 2L01A 3CQZJ 2M1BA 4E7ZA 1AKHB 1LFPA 4RGUA 2HQ5A 5J4YA 4C2UA 4XIDA 3PUFA 4KJZA 2KP6A 1K6YA 3PQKA 3I54A 4P96A 5CYVA 3O3KA 1FPQA 2MSYA 1BBYA 2CW8A 3HDDA 1D1CA 3GTGJ 1IN6A 2VPLA 3G1OA 2ZFUA 2KFDA 2LP0A 2KRFA 3X2QH 3JRBA 1B9MA 3ISPA 2ZXWH 4XL9A 3BR1A 3J81Z 2O7OA 1N25A 1WI9A 1NK2P 3RJPA 1YHQI 4J00A 3FXRA 4LITA 1ETVA 3FM5A 3CCYA 1DQUA 3A01B 3OR2C 3U9GA 3HC7A 3JAMK 1MZBA 2BW3A 3AL0C 3DKYA 1P4XA 2F5DA 4A3FJ 3DKWA 3K4CA 4RAGA 3REOA 3CF5F 2M0MA 4PJMA 2D1HA 2VQLA 4LG3A 5IP9J 2LRDA 3QYEA 5TISC 1X1CA 4ON0A 2R7RA 4IVNA 2LKXA 1R1VA 1YRNB 2KT0A 1ZTRA 3KYLA 1TW2A 2WADA 2KHMA 4H4KC 3PO3J 5KK1A 2Q8KA 2BBYA 1BOAA 2RGVA 5IYDJ 2LYCA 1MBKA 1Q1VA 2LKPA 3AKZA 2CUEA 4M74A 2GOMA 1U8RA 3DBHB 2LG4A 3NRVA 3TW7A 2Y2ZA 2V79A 4KIFA 1TTYA 3GFLA 4MEYF 3HPGA 1REPC 2NNNA 3KPHA 1R36A 1O3QA 4WK8F 3WU1B 3HZJA 1KZHA 5HS8A 1OLTA 2BXZA 1P7JA 4D7NA 2NVTJ 4P5OA 2W25A 3W2AA 2FRHA 1U5TA 2XF5A 2L7KA 2HXOA 2V9KA 4UHTA 3D5SC 5DD4A 3NWTA 4ZH4F 1QZEA 2X51A 2DA7A 2ZMEC 1S29A 1ZR4A 1W5SA 3M1CA 5F04A 1A35A 2CQKA 3HOZJ 4A93J 4RM2A 1MSFC 2WY8Q 1T98A 3QP6A 5A2QZ 3J81K 2MG4A 3OS1A 4E7HA 1VF9A 1DU6A 2HI3A 4HAMA 5D4SA 1UELB 1ONVA 2F4MB 3GUDA 5E8IA 2K7LA 1LE8A 1X1AA 5E3NA 3MN2A 2XSDC 2QQ9A 2JWTA 5KAIC 2NVYJ 1FBSA 4IRHA 2P5KA 2IP2A 5KCMA 2L5QA 3PM1A 4BQOA 4AC0A 1G8XA 3K1PA 3VFZA 1SFEA 3E3VA 1S9HA 3UNGC 4G7HF 1SD5A 3LSGA 4NC7A 2WWYA 4FHTA 4LOCA 3TO9A 4G8XA 3HSFA 1FMVA 1JUSA 3ZRGA 3MAJA 3FK6A 2XGCA 1TQPA 5TJJA 1B1BA 1SFKA 2XF7A 4HX4A 4XN0A 3GVAA 4BAYA 2XC7A 4ESJA 1S6LA 1Y6IA 4M3FA 5LEJA 1R5HA 2XPWA 2Y69H 4L9TA 1OISA 4F55A 3GCMA 1O3RA 1YG2A 4IHVA 3DTIA 2BZTA 5IP7J 3I55I 3GTPJ 3OYDA 1LDJA 2D5VA 1YS6A 3A0HC 1Z7LA 4E70A 4XKVA 3G71I 3RPUD 4BQQA 2MD0A 1FIAA 1T8IA 4BBRJ 2ETHA 2D1VA 2DTRA 5F27A 3UR3C 4BH9A 2XVCA 3RZDJ 2D45A 5JFRA 3MD2A 4D7MA 1JKQC 2A6TA 2P6TA 4JX5A 4FE7A 4ZDOA 1P4WA 1Z6RA 1JKPC 1XGOA 3H3VK 5A2QK 2RV8A 3PJRA 5DM6F 3F8CA 1O57A 3PL8A 2STTA 4BQNA 4KFCA 1Y1WJ 4I98B 4N0BA 5BQTA 1QHHD 2VC0A 3KYCB 1V55H 3ML6A 4X0GA 1RI7A 3OYJA 1T39A 4UB8C 3FF5A 2QVOA 1U5TB 3ZN0A 3FXJA 3H9QA 2OTJI 2Y75A 3U1DA 2QCOA 2LDUA 2LC2A 1DP7P 2DW4A 5FD5A 2O8KA 4OMZA 1L3LA 3KP4A 3CP8A 4ZYAA 3H1CA 2M34A 1MMSA 1Y8QB 1SFUA 4JQFA 3S15J 2ZO4A 4II3A 4LGWA 2MH9A 1ETQA 3BLYA 3I71A 3F6VA 5FFZA 2HYFA 1XCBA 1XSDA 4F92B 1VQ8I 3CUQC 2G9WA 2X0LA 5C3EJ 1Y8RB 3MKWB 1LNWA 2K85A 1ZLKA 4A3EJ 1I1SA 2K02A 2DU9A 1QNTA 1S8NA 1AHDP 3N05A 1XD7A 3M4OJ 3OWTA 4HYEA 3QPLA 4II2A 1LE8B 2E35A 4V19K 2R7FA 3WODF 3S2HJ 2GQQA 4BBSJ 1I3QJ 5KAFC 5D6EA 2FXAA 1PP8F 1ZRCA 3T5XA 1HF0A 3WG7H 1EJ9A 2LY2A 2E1MB 3LOCA 5DUIA 4HA8A 2RNGA 2HDDA 3S2WA 5EZGA 5FKKA 3Q9SA 4XONA 1P9QC 1ZH5A 2YU3A 2FMLA 1XDUA 4NHJA 2HOTA 4L9JA 4RAZA 2UXXA 2VQHA 2VUMJ 1GV5A 4BHPA 5D5UB 4MQ9F 3TDZC 1Y1VJ 1FOXA 2VQGA 3E5XA 5F1RA 2DBBA 2OQRA 1TL8A 5DCMB 3OOUA 2YR2A 3DBRB 3F8NA 3I4NJ 4OIRF 2VOPA 3PNYA 3IUOA 4AYBN 1W1WE 3PO2J 2VKVA 4GRIA 5ERIA 4BEHA 1HDDC 1A36A 1ETXA 1SMTA 4PFOA 2ZSIB 1ZYRF 3GTMJ 1A6QA 1YIOA 3RDIA 2BXYA 1O7LA 2H94A 2UV1A 4I01A 3TDUC 3OSGA 2KJBA 4C3JJ 1TZLA 3S32A 2GA2A 2QYOA 1LEAA 1XC5A 5CLSA 2XAQA 1AOYA 4KISA 1IDYA 4U0WA 4E6KG 2VBYA 3W6KB 5LRSA 1JJ6C 1NHAA 3HOVJ 4CCLA 3ZMSA 5J3LA 2ZXHA 2EA2A 1X3WB 2X6OA 2CO5A 3PSFA 3PIPF 1ZARA 1XS9A 2M87A 2MBFA 1LDDA 1TWGJ 2HWVA 4KITB 1SFOJ 1CGPA 3DEEA 1Z21A 4F3QA 5L3CA 2O3FA 1XMKA 3CZ6A 2A07F 2G0EA 1LEBA 1HXDA 1SD7A 1Y0NA 3AG2H 4XNFA 2RVCA 3MWMA 5E1WA 1X4OA 4IHWA 1GV2A 4HF1A 2X6YA 2XAHA 4LB6B 3S8PA 3U1KA 2GIVA 1RKTA 1GUUA 2VKHA 4M6XA 5D6FA 3S17J 1AU7A 3FBIB 4YIRX 2VJ4A 2C6YA 4PGHA 2A68F 3LSMA 4I7HA 5M3FJ 2QQAA 2R5YB 4EJOA 3N4MA 1KYWA 2P7CB 4YFXF 3QP5A 4G7OF 2K3FA 4B47A 1ODDA 3CC2I 1PYVA 1SMYF 4AUXA 1MJ9A 4BE2A 1YOVB 2MLKA 4AIKA 5HS7A 3WTZA 2EB7A 1R00A 3RPUA 4A12A 4DZPA 4IKFA 4A3CJ 1GLNA 3ABLH 2XRLA 2YUSA 2P7VB 2PQ8A 1R6RA 1HQCA 2CQNA 1HW1A 5F64A 4S05A 3QOEA 1VQKI 1FNNA 5FGMA 4CCJA 4ZDLA 2JVHA 1XG1A 1MJBA 3CCQI 5J1RA 2QKMB 4KICA 3LFUA 3K4BA 5DEQA 1YX3A 5DYMA 3L7WA 3RCOA 4DIQA 2E2HJ 3BQZA 2KJCA 3IV5A 1ZLJA 1DUXC 5B5EC 4CICA 4AIHA 3U21A 5ICEA 2M45A 2JRMA 1KYZA 3RKQA 2O61A 3KP5A 1Z1DA 3WTVC 3H35A 3OYFA 2WTEA 2CSOA 1BIBA 3ZMDA 2A5WA 2H1KA 5CVJA 2ELKA 1KU2A 2CS3A 3GXOA 4IRGA 4G7ZF 2DMNA 1R9TJ 1WI3A 1VQ9I 1RZ4A 4XLFA 1NH3A 3COAC 1QQIA 3QPTA 4UXNA 3KE2A 3BJOA 2VOOA 3J80Z 1OCCH 2KIMA 3ECHA 3HUGB 1DPRA 4BHCA 2M4GA 2KDOA 2V4JC 4HX7A 5HOOA 3O6BB 5BMZA 1WZ2A 4GYIA 2XB0X 5B3SH 1CF7A 2EWNA 3HOUJ 3PSIA 4Q47A 1ON2A 3VPRA 2EFOA 2EJRA 3HTSB 4AD9A 4OIPF 2AQEA 4D1QA 2Y48A 1ZAOA 3VB2A 4CGZA 5L3FA 5E1XA 1JI8A 1A5JA 2LBFA 2EIKH 3RKWA 1OFCX 3DLLF 2E60A 4E7LA 3EUHA 4HDVA 2K9SA 2VXDA 1D8JA 1RR7A 3C2BA 3BZ6A 2PEXA 2CUFA 3Q0UA 3OSFA 1SD4A 1WJEA 2NRAC 2CW7A 2XROA 4CCKA 5LD2C 2FU4A 2DMQA 1K7AA 1VZ0A 2RN7A 2L2OA 4Q5SF 3CCMI 1OQYA 3A2KA 2JRTA 2Z16A 4ABZA 2JT1A 3IH3A 2E71A 5L3EA 1JKRC 1IGNA 2A3SA 4AIDA 1W4MA 2D2WA 2W00A 4MO7A 4U0YA 3HEFA 3KP2A 1R4MB 2MC4A 3BZCA 3Q0WA 1JGGA 1R1UA 2H6CA 3F72A 3H36A 2LK2A 3F6OA 3OR1C 4A3BJ 1BI2A 2MA3A 4FQGA 1OR7A 1OCTC 2X6XA 1MBFA 3C2GA 2V1NA 2R4GA 3G3ZA 2KZGA 4OWRB 1Z0XA 2L4MA 3OL3A 4CXFA 3J7AY 2VBZA 2HPIA 4IHXA 2DDBA 4W97A 1FOWA 1XDSA 1R22A 3LMMA 4IHSA 4XKWA 3BPVA 2UZKA 2DMUA 1J59A 4GCVA 2Y0MA 2LH9A 4BS9A 2P6SA 3HSRA 4CYCA 2R7TA 3K70D 3K2ZA 2XAGA 4A0ZA 4A69C 1HDPA 4IZZA 3BJ6A 3FXKA 1HKTA 3MZHA 2Y0SA 5GADJ 3J80K 2V26A 4BKXA 4IEJA 1D0YA 1W7PB 1X3ZB 2ZNYA 3GW2A 3LAPA 2ICWG 5F0HA 2KISA 3ESWB 2EIMH 3C7JA 4OIQF 3RIRA 1I50J 1OYWA 4HPQA 1B9NA 3RQ4A 4BJ6C 3MQ0A 3WU0A 4IHTA 1JUPA 1MKMA 3L2RA 1MW7A 2L7FP 4PZJA 3T8TA 1ZG3A 2ISYA 3E5QA 3ZP5A 2CFOA 3LSHA 2QZ8A 3DXJF 2IGNA 3ASOH 4O6JA 1YITI 3I4MJ 5ED4A 1W5CC 1J09A 2OD5A 3WE2A 1U6GA 1S7EA 2DODA 3I64A 4MGRA 1N75A 5GPCA 3VWBA 2QGUA 2JSCA 2V7FA 2OCEA 4L0ZB 2HKOA 4FT8A 1BJAA 3L1PA 3ZOBA 1LDKB 2W85A 1OCZH 3DPUA 4P9FA 2DOAA 2IGKA 2KQRA 1LPQA 5J1YA 2KKOA 1VI0A 5CVIA 1X19A 2FBIA 1FYKA 3M9AA 4CZCA 3KLNA 1E3PA 2CV2A 4OIOF 1CF7B 4NDLA 4XLAA 3F8BA 1SANA 1SFXA 2GWRA 4HRIA 3BR5A 2IA0A 2A5YB 2N8GA 5J47A 2DFIA 4IXAA 3MEXA 1IUYA 2LBFB 4B48A 1ETKA 3P9CA 4I2OA 2Y0SN 3G1LA 3HYIA 3Q3SA 2EV0A 3H0GJ 5ILUA 2CQ7A 2F5FA 3FXOA 3O8GA 2PMUA 1MGTA 2LF7A 3K4KA 1OYYA 2IA1A 3GFJA 3K4NA 4P9UA 4XR6A 5KNLA 3ABTA 2EFWA 1APLC 4BE0A 1YX5A 2IGOA 4E4HA 3OYMA 1VQPI 3ONQA 4XLEA 4FX4A 3MKYB 3DTEA 2AHQA 3J7ZI 5F0CA 1AA7A 2WC2A 2F48A 2GZWA 3VYRB 2JA7J 2K9QA 3BG9A 1ZHFA 4L5IA 1JT6A 1XMAA 4EJVA 3F21A 3SYTA 5HLGA 4M73A 4A3LJ 2HNHA 4U87A 3CD6I 1IO2A 4M71A 4BDYA 3AFHA 4ASNA 4IRIA 2JJ7A 2W57A 3GX4X 4K2EA 4RAFA 1HLVA 2IAIA 4PJJA 4CYCB 2PI0A 1QO0D 2DOEA 3RPQA 3TO7A 5EGOA 1ITYA 2Y31A 1XTAA 1TWCJ 2FOKA 1GHCA 1BR2A 2VONA 3KEOA 2X1CA 3A03A 1HW2A 4IF4A 1QRYA 4PGGA 3M8JA 2PJPA 1R23A 4YFKF 1F4KA 2XF6A 3R60A 4HSRA 3GTJJ 2BHYA 4UV8A 1RUNA 4KNYA 2PMZA 1IAWA 1J0RA 4F91B 4M6VA 3EETA 2YPRA 3TP3A 4LB5A 1LFUP 2GA1A 2OBPA 2E1OA 4F7ZA 2DI3A 2QSGX 1UG0A 5LHGA 1K4TA 3CJNA 2R7WA 3L2QA 2GM4A 2DYRH 3CUOA 1YTYA 1EF4A 5K5RA 4IO9F 1W36D 4C2MJ 3PFYA 2ID3A 3WTWC 1MD0A 3CO7C 2I5UA 1GT0C 1BIAA 2M0CA 4XOPA 1P92A 1O7FA 1HKSA 4WCGA 2HDCA 3M1EA 3SXYA 2QSHX 3IRQA 1ZGWA 2BHZA 1YFHA 4DBRA 2KMUA 3M8FA 1JGSA 3WTUC 1QPMA 3CJQB 4R8HA 3GO5A 1B4AA 3OS2A 4QWQA 3B02A 3HSEA 2RQQA 2CU7A 3WE3A 1KQ8A 5H20A 3FDYA 2QBYA 4XOTA 2AXTC 5L3BA 2DA6A 1WKMA 3CLOA 4C3IJ 4QSHA 3BOQA 4EEFG 2ZJQF 1DP3A 1EH6A 1WGXA 2BVMA 1R5GA 2F5EA 2HTJA 1ZR2A 2DPDA 5ILSA 3L2UA 1WH5A 1VQ5I 2RNJA 2EV5A 3A4CA 2LVSA 3QU6A 1MBHA 1YO5C 3HB9A 2X85A 4M3DA 2PMZN 3KCCA 1D3YA 1TWFJ 2HTSA 1Y56A 1HA8A 2P0WA 3QPSA 1EH8A 3G4SI 1HBXG 1IF1A 2H27A 2IT0A 3N97A 5D5WB 1JUMA 3FK7A 5FRNA 5HLIA 3LNQA 3HJEA 4CHUA 1FMWA 2L9SA 2PX9A 1WJAA 2UXNA 4CH7A 1U8BA 4XRMA 1X1PA 4IPAA 1J75A 1ZK8A 1ZKGA 2A6EF 2WB1A 3L9FA 2I10A 5DCMA 2VJ5A 5DCFA 5JLWA 1H8AC 5IPAA 1LB2A 3B6AA 3V8KA 1FJLA 1IXRC 3OIQA 3JSOA 4P1WA 2JA6J 1KQ0A 4ZDPA 3E6BA 1G4DA 2MLGA 3KZZA 1USTA 4I0AA 2OTLI 5C44J 1WHUA 3E6MA 3K4MA 3BTCA 4M3BA 2QM3A 5FB2A 4KDPA 2VKEA 2DA5A 5B1BH 5EG0A 1FWZA 4DW6A 5EGOB 5IT9Z 3HGYA 4M72A 1F1ZA 2FBKA 2Y9ZA 4H0EA 4DNCA 1KGSA 3HG9A 4X6AJ 3FBNB 4HF2A 3SZPA 5FLXZ 1G59A 2YU9J 1FSEA 2FQ4A 3NQOA 4OMYA 2NOGA 1XGNA 4XSXF 4RA2A 5GAEJ 1RESA 3S93A 2ESNA 4WXHA 4LJZF 2F5VA 3PNVA 5EJCA 2WAFA 1YI2I 4BGDA 3OYEA 2FOWA 1PUFA 1KQ9A 2HQNA 1W7PD 4QLCU 2NS7A 4ZTFA 1VQLI 2WV0A 4Y33A 1QVTA 4XK4A 4L0YB 3NWSA 4XLPF 4E7SA 3GTQJ 3MKZA 5FROA 2V1UA 1BI1A 1RRJA 1FYLA 2I8DA 1K4SA 3LWFA 2WB1N 3R4KA 2LLKA 1V4RA 2O9LA 2IPQX 4X1EA 2L02A 2ACJA 3GFMA 4HNVA 4JP0A 3ZQ7A 3IH2A 4IHYA 3CMMA 3GWZA 3DEWA 2MD5A 1P6RA 2GBYA 3ZMZA 2B0LA 3JW4A 2R5YA 1EKEA 2DK8A 3L09A 2PBIA 2QBYB 2XKOA 3BT9A 3OYHA 2K3PA 4EVIA 5DV5A 4XORA 4XICA 2DYSH 6PAXA 2E1CA 4Y3OA 2DFHA 3I5UA 1OMIA 4UUSA 1HCRA 1I6XA 4G6QA 2R3SA 3FIWA 3HOXJ 2DOFA 2WA0A 1I5ZA 3L2WA 5JVGF 1VQMI 4I09A 1YJ9I 3CCEI 3TKYA 1BN5A 2ADUA 3CLQA 1I1GA 3FMRA 1FTZA 1KONA 1PJRA 2YSRA 3ABUA 3V8LA 2VE9A 1FC3A 2VJJA 2OZ6A 3BPXA 1QHGA 3D0SA 1WRJA 3GBGA 2IA2A 2L9VA 2OA4A 3AG3H 5CQGA 1X3UA 4U7BA 5FO5A 3ZQQA 4LK0F 4ZTJA 5BOXA 2K4JA 3WTYC 2VT3A 1ULYA 2KLOA 3H9GA 2HXIA 2IS1A 1RUOA 4NQWA 4CUGA 4PSXA 3Q9VA 1U9NA 4EMSA 3VOEA 3E7LA 1FZPB 2Z1DA 4ZYGA 5D4RA 1ZREA 2Z9OA 1D1BA 4C30A 1YW8A 4NC6A 4ENKA 2CRGA 1F5TA 3HGGA 2PN6A 4GDFA 2E19A 2WBMA 3S1NJ 1KA8A 1IRGA 1IC8A 1WWXA 1UJ8A 2WY7Q 4NUBA 3CCSI 2A69F 2ZSHB 5JHFA 5JHUA 1HC8A 5EG0B 3JR9A 5K5QA 1IUFA 3BQYA 1FTTA 3H3UA 3OYGA 3SJMA 4F52A 3VYTB 2P81A 3A0BC 4B3AA 4UUVA 1ERDA 3GLLA 3I9V2 1Z7UA 5E8GA 2ZC2A 3ULQB 4WF2A 2F4IA 3HUGA 2M4KA 1XGMA 3I4PA 3ZN1A 1V3FA 2COBA 2FBHA 3WGIA 1MMNA 3BR2A 3BP8A 1Z05A 3M7GA 4L5EA 2RKHA 1PUFB 4RDUA 1LVAA 1FOKA 1RIOH 3OYKA 5HNHA 3FKIJ 1MMGA 2JUCA 2ZMEB 2MYSA 3SZTA 2QF7A 1JHHA 5HLTA 1T33A 2DDAA 3WGGA 4AVPA 4G94A 3TOAA 1FP2A 1L0OC 5BS6A 3G6EI 2R7ZJ 2DT6A 4OAYA 2RAEA 1J2XA 3IKTA 4B43A 3JRHA 2CJJA 2BV6A 3G2BA 3OOPA 4LLGF 4Y13A 2MGQA 3BG6A 1DPUA 1A6IA 4HDUA 3OL4A 5AONA 3VODA 2K5CA 2CWEA 2YX7A 3IH4A 4HNTA 2KIUA 3DEUA 5M5YJ 2PJRA 4Z6YA 3HHGA 4EQQA 4JOMA 2TCTA 2GXBA 4A0XA 2AS5F 3DBLB 2A05A 4Y4RA 1JT0A 2KL4A 2F6CA 4G9YA 5M5WJ 2OC6A 2HVQA 1X1DA 3H0DA 3HOWJ 4UVBA 1MSEC 2IVMA 5EZHA 3KLOA 1J7KA 2FNPA 3RKYA 1FY7A 3EUHC 1K78A 2HZTA 4MNUA 3K0LA 5E3LA 3T0YA 2HOAA 3V42A 1I3AA 4UUSB 4XLNF 4MHGA 3FXQA 3RZOJ 1LKXA 4Z2YA 3ERED 2L4AA 1WJBA 5J40A 3ZXSA 2CYYA 1G3SA 5ILVA 4BU2A 3CCUI 4HV6A 3JRCA 1YYVA 4RGSA 2F2EA 2XHKA 2L9RA 2VJIA 3WTTC 3OIOA 3ZGKA 1WCMJ 3CDIA 1W7PA 2HVRA 2ZKZA 2QA4I 3BTJA 4XRFA 2P4WA 4NQWB 2B9SA 1OKRA 4B44A 3FXMA 1R71A 1OR7C 1P4AA 3Q0VA 4PJNA 3P9KA 2HKXA 3LQRA 4A3GJ 1IN8A 1R49A 2X9DA 5GTIC 4XRSG 5GAGJ 3S1MJ 1RKWA 4MIMA 1OPCA 1MH4A 2QEXI 4IX7A 3QQAA 1TLHB 3BZKA 3GZNB 5M5XJ 2E7XA 2RC4A 2G7HA 1D1AA 3CMEI 4Y7NJ 3H5NA 4ETSA 3CCVI 2DAOA 2XASA 3QODA 4ZYHA 1ZG1A 3BJAA 3SEQA 4KMUX 5EDNA 1WFXA 3ABKH 4KIGA 2VXZA 2X1EA 4HW0A 2M2EA 5EYRA 3EUKL 2AXLA 1D5YA 2JA2A 3H5RA 3ZQGA 4HOBA 3LSTA 1BOBA 3KYDB 4BYYA 3K7AJ 1FP1D 4N9IA 5AIQA 2OCCH 3JRIA 2DLLA 3TBIA 1S7OA 3MCZA 1SD6A 3PIOF 2VLAA 2NS0A 1W0TA 3O8HA 2W48A 4LIUA 1XSXA 3D5RC 2EZLA 5FRMA 1Z67A 1TQIA 5CVUA 4HLXA 1JE8A 3W2VA 2JZYA 1RPWA 3V7SA 2DFEA 2W82A 4DOZA 4FTHA 2JN6A 2EA4A 4V2FA 3U2RA 2H09A 2OZUA 4D0PA 4XQFA 2JPBA 1Z3YA 2V9VA 2QSFX 2Z2SB 3CUQB 3LQQA 4TV7A 3M07A 4CCOA 3S3NA 4HLYA 4YG2F 5K7FA 3RTRA 3D5LA 5JI6A 2HFHA 4OU0A 3ZMTA 2PJRB 2DT5A 1RETA 1G6NA 4KYWA 5F08A 1BR1A 2WAEA 3FZVA 2X4HA 3TMOA 5FLMJ 2R7SA 2M30A 1MDMA 4KN7X 3CESA 2DK5A 1BC7C 4E7JA 3LL7A 2XDVA 4NB5A 1K78B 5FKOA 4U7DA 2XPUA 1FX7A 1VNDA 1SVLA 2BY3A 2HQAA 2ZXIA 5KHDA 2VL8A 3DQVC 5EEHA 3GZ6A 2ZJPF 1JHFA 3R6SA 2EV6A 2EILH 3C1DA 3BG3A 1SAXA 2QQBA 1QZZA 2OU2A 2QWWA 4IL6C 2FD5A 3DPTA 2QENA 1VQOI 4GFBA 1K6OA 2CV1A 4J01A 2HS5A 1IXSB 1UHMA 3TO6A 2HDWA 2KZVA 2Z3YA 2EH3A 1A31A 4R79A 4N4OB 5E20A 2M3AA 1OCPA 2LREA 5BPDA 3TOBA 2VE8A 3B73A 3KP6A 2K4BA 2FUG2 2GIZA 2JK3A 3P5JA 1Y39A 3D1NI 4DGWB 2ZNZA 2E36A 1Z91A 2OF7A 3DF8A 4CZZA 1MJAA 2XGXA 2O6GE 3RYPA 3ELKA 2NNYA 4ENNA 2EZHA 1IV6A 1BW5A 5FKNA 2O03A 3DKXA 2XPVA 4KIBA 1ORKA 2QQ8A 4M9ZA 1ZG5A 2M8GX 2FMYA 1UMQA 3F9KA 1T95A 3CDLA 1RC9A 2R92J 1H88C 1D0XA 4A6DA 1H0MA 1BM9A 2IW5A 2LR8A 1MNEA 1GXQA 4I76A 4GO1A 2ZXJA 2IBDA 1NG7A 1D0ZA 1TW3A 5HS9A 4CCNA 4DYRA 1BC8C 4PSWA 3EUAA 1FT9A 1HSTA 2DT7B 2XGDA 3K6GA 2KIFA 2OJED 2VBXA 2HYJA 2W4SA 3IHUA 2W84A 1JTYA 1H89C 4LFUA 2M8EA 5IY5H 5H6RA 3HOSA 5IP6A 5D5XB 2RDPA 4YIIA 5K7HA 3JREA 1A04A 2LKSA 1BI0A 4R1HA 2MH2A 1WJFA 5LHIA 2HOEA 4GGGA 1XMXA 5AIPA 2CG4A 4PK4A 1DGWY 2CUJA 2E34A 4EJUA 5F0FA 3SHFA 4QPQA 2VQCA 2GLOA 1QBJA 1OYIA 1D8KA 1R7JA 4MFDA 5H6QA 1XPXA 4WXDA 1U5TC 4GYGA 2Y30A 3BTIA 1GVJA 4O5VA 4PUSA 4EATA 3CJTB 2P5LC 3RYRA 4M3EA 3WHCA 3CTAA 2E1NA 1QPIA 3CP2A 4I02A 1EA3A 4ITVA 1Q1HA 3FM3A 1SVMA 4ESBA 1STZA 3HXLA 2FNAA 3O2PE 2FA5A 4B8XA 1QVUA 4B3XA 1R4NB 3IWZA 1E2XA 1X2MA 3ZMVA 4RBOA 1FOYA 3E0JB 3S2DJ 1MDMB 4RB2C 2NXNB 2R7DA 3K4LA 4EGZA 5L3DA 1TP4A 4G12A 4OINF 4BACA 2ZFWA 5BNGA 2YS9A 3ZQHA 4L18B 3E6DA 3DCFA 3G1MA 3K70C 4J19A 4C2TA 1MBEA 2NS8A 3DWLE 1T08B 3EDPA 3ERMA 1LQ1A 1IDZA 3BG5A 3WGHA 4FCYA 1MMDA 4A2UA 4BHBA 5LFAA 1UB9A 4RMNA 3Q5FA 3BCAA 1VQ7I 3GFIA 2X48A 1ETOA 2E1MC 4HQMA 3CCJI 3I59A 3C18A 4LD5A 1YS7A 2ZJRF 1ACIA 1U9OA 5K5OA 1Z9CA 4RM3A 4BY1J 2P8TA 1T0FA 2ZB9A 4PFPA 1OJLA 4CCMA 1IRXA 1IV8A 2OAZA 2CMPA 4DZJA 5L3GA 1U0JA 2FQ3A 5JR3A 3KEYA 1TQMA 3DP7A 5E1ZB 2EFNA 2OUMA 3CMYA 1IN4A 5HDNA 2VT2A 2H8RA 3GMEA 4ZYEA 4HZFA 2B7EA 1ZGJA 3LFKA 1SC7A 3QWLA 4G6TB 3GEZA 3ECOA 3OIPA 5LHHA 2UUZA 1TWAJ 2Z33A 2ZCWA 3F0CA 3OYAA 1W0UA 2L7ZA 1VFCA 4I0BA 3GYHX 3K1MA 3GTOJ 2IS6A 1JXSA 4IQJA 1E3OC 3WHBA 1V54H 4KA4A 2FX0A 3BG7A 4EV0A 4NC8A 1S3JA 3WTXC 3HRSA 3QRFF 4BJTA 2LOOA 1WH7A 3KP3A 1KU3A 2DQLA 3VYSB 5HODA 2Y9YA 3K1NA 2JTVA 1MMAA 3BWGA 3HHHA 4D5CA 3GTLJ 4EM2A 4ENJA 2EBIA 4HF0A 2DFFA 2GXGA 5M3MJ 3QYBA 3ZPLA 2MFZA 3V4GA 4UNOA 4OAZA 5CPRB 3SFZA 4BY7J 2GAUA 1U2WA 3PQJA 4HG2A 4JK1X 3OYLA 3OMYA 1O4XA 1QGPA 4LIVA 4DJAA 5CVVA 4A0YA 3WTSC 3JCUC 4FX0A 4ZC3A 3EPZA 4BNCA 2NVQJ 4KT5C 3I3LA 2NVXJ 4RGRA 2PG4A 4L5JA 1ENHA 4I6ZA 3FXUA 1JTXA 3QPHA 4RS8A 1VQ4I 5HVQC 3HKZA 3BTLA 1HOMA 3W6JB 4Q48A 1FIPA 2NOJB 4XLCA 1V5GA 1LFBA 5CKTA 2V6CA 4PJLA 3J7YJ 3H5AA 3BR6A 1M1EB 2QUFA 1F43A 3V7CA 4HNUA 2L54A 2M5WA 3IWFA 3SFIA 4ZZLA 1G3YA 1UFMA 3CCRI 5H2FC 4A3IJ 2ESHA 3QYFA 2PLYA 3RI4A 2Q0OA 3MVPA 1P2FA 3QAHA 3TGNA 2HYGD 2HZDA 4UUTA 2X6WA 3IC7A 3P7NA 3K9TA 5DUKA 5K1YA 1QA6A 5J6XA 4HQEA 3GLXA 4BL0B 1OCOH 4ZZDA 5DD8A 2RQPA 3I59B 4A3MJ 4DQ2A 2JMWA 2DMTA 3IP4B 2HOSA 3V8JA 1J5YA 3DU5A 3F8MA 1K79A 4PJ0C 5GAHJ 2ELHA 3KIOA 3E1SA 1R58A 4L9NA 1N77A 2QLZA 2VKDA 5GPAA 2R0QC 2E5NA 2L9NA 5ICCA 2DCEA 3P9IA 2JQ7A 3VEPA 3QU3A 1PDNC 2BW3B 1POGA 3LAJA 4ENMA 2CQXA 2OQGA 3OYBA 1USSA 1W36C 1YLFA 5DDGA 5LLQA 4N4NB 3H9JA 1O3SA 3C3WA 1XGSA 3FMSA 3BR3A 2FE3A 1JKOC 1NTCA 3HKZN 2LMDA 2JPCA 4IJAA 2EQRA 3SDGA 5IT3A 3IAS2 3PUBA 4M9XA 4NNJA 3GTKJ 2ME6A 1ZELA 2ZMEA 2VB6A 2MABA 1KU7A 4DYCA 1IZ1A 2A6HF 3QOPA 4RB1A 4PCQA 1B6AA 4D9JA 2ELJA 4XN3A 4A5NA 2L0KA 3LSPA 2BVLA 3JRFA 2DJIA 2DA2A 1FBUA 3EYYA 5E17F 3S3MA 2OPTA 3FHZA 2F4OB 2Z99A 1X2NA 3JSPA 3OS0A 1PVEA 2HGCA 2E5ZA 3C2HA 4GXOA 4MFEA 1K61A 2O5RA 2FEZA 2JA8J 5JLXA 2CUZA 3W6VA 1RR8C 4XRSA 1UCRA 3FKJA 4QTRA 1I27A 1WPKA 4BDZA 2IS4A 4U0VA 4M3GA 2JSPA 2XSJC 1DU0A 3NARA 4A5MA 4UVAA 4O3MA 2VASA 5JVTA 3R61A 3K10A 4AYBA 3FMQA 5FLVA 1O3TA 2F5CA 3A02A 2O8XA 1T56A 2LY1A 3KFWX 1ZGAA 5E3OA 2KIQA 2IEKA 2WV1A 3TL4X 4CYDA 4HV5A 3IAM2 1G3TA 4HSTA 1K83J 1G3WA 2W1OA 1GDTA 2HVSA 2NVUB 2KDZA 4Y52J 1R5ID 1V5FA 3HTUA 4JX6A 1T6SA 3L2CA 1WQ2A 4YRVA 4EGYA 5BPIA 2ISZA 2JA5J 4A3JJ 5B1AH 5IT9K 3K2AA 3TW6A 2W7NA 1T2KA 2R7QA 4F93B 3KZYA 2BGCA 5DM7F 2R93J 2NAZA 4XSZF 5KVRA 5FLXK 4BXXJ 2VI6A 1U78A 2TRTA 3EYIA 3FISA 3WG9A 1DGRM 5TGTA 3AL0B 3CJRB 2Q2EA 2DA1A 4B1RA 3WU2C 3JRDA 3F23A 2K27A 3LSIA 4Q4ZF 2V1XA 1UHWA 3OYIA 1IJWC 2B63J 2Q1ZB 5LBQA 2IRFG 3DLAA 1B59A 3BC8A 1WJCA 4D5FA 2FSWA 4XBFA 1H9TA 4WX9A 2E7WA 4E7KA 3V7RA 4AVZA 4NBQA 2HU9A 1YE9A 2R5ZA 2EINH 2KPMA 1TT0A 1R1TA 3LA2A 3AG1H 4MQVA 2K40A 4B4CA 2ME0A 3RSNA 1BA5A 1E0EA 3HPHA 4MTDA 5FFXA 3JRGA 4W1UA 2W24A 2VODA 2XIGA 3CO6C 4MLOA 1IRZA 1YJWI 2J5OA 2MC3A 1LUJB 1TNSA 4BUPA 4JX4A 2DJNA 2HR3A 3CF2A 3EQLF 2LD5A 2ECBA 3VSLA 2HPMA 3W3CA 3VDXA 2E2IJ 3S16J 5C4JJ 2CH0A 3BR0A 2CQQA 3CUQA 2XUBA 5D8LB 4C9YA 1BI3A 3BY6A 4S04A 1CQTA 3T8RA 1S5LC 4RB3C 1B8IA 1AWCA 1XB4A 2CFXA 3ROUA 2EK5A 2RREA 3F8FA 3H3ZA 4ANJA 3MMYB 2ECCA 3K69A 3SQNA 4CO8A 1UAAA 1IRFA 1NK3P 2G7UA 5LGTA 1EV7A 2V9PA 5F6FA 4RAYA 1IG7A 2VBWA 5J8CA 3OY9A 1BJZA 4I99C 4Y15A 4E7IA 4YIFA 1FLIA 2P5VA 3S1QJ 3CCLI 1IN7A 3IKVA 2KRCA 3T1BA 5C4XJ 1W5TA 1ZRFA 3FHNA 5IOZA 1S72I 1YJNI 3B6CA 5HLHA 1GXPA 2K9LA 1TT5B 1UHSA 2HQRA 3CDHA 1XSVA 1JJ8C 3L00A 2GOXB 5LGUA 1ETYA 2YX4A 2H6BA 4EJWA 2VC1A 3RKXA 2OV7A 2AQFA 3DFGA 2IS2A 1QU3A 1MNDA 2R7UA 3ZQCA 1IXCA 2BY1A 5GP9A 2DXIA 1WSUA 2XAFA 1SAUA 2R7OA 5F1JA 3ABMH 4EJTA 2COMA 3HM5A 4OOIA 5ICGA 2LF8A 3FWEA 2M7BA 3E6CC 5LRRA 4IQ4A 2L3DA 5HDGA 2Q2EB 3F22A 2DPUA 3KZIC 3HOYJ 2LFBA 1Y0UA 5DS9A 2VN2A 1Z77A 3F3XA 3M8EA 3ZQFA 2XV4S 1H9GA 4RGXA 3HIFA 4ESFA 3R0AA 1ZQ3P 2E2JJ 4AM3A 1S7AA 2QKLB 4S0HB 4EM1A 2WAQA 1VQNI 1YIJI 4LG0A 1X58A 4CSWA 2HEOA 4XKCA 3M3YJ 2R5ZB 4JBAA 3ZCOA 2MW8A 1WJ5A 4KUMA 4BEHB 1PP7U 3MFKA 4N9HA 1B72A 1I6HJ 2IGMA 1G2HA 5FJ8J 5LGNA 3E5UA 2XGEA 1ZRDA 2ZJ2A 2K86A 3HRUA 4FE4A 2JVGA 5EF6A 1J9IA 4JYKA 3ZMUA 3HRTA 3LA3A 3PNTA 1YW7A 2FF4A 3LA7A 3CC4I 4EM0B 4A3KJ 5IOYA 1TBXA 4B09A 5GTHC 4LLLA 4MEXF 1FEXA 4KN4X 3OYCA 3L2VA 5E18F 1E3HA 2Z5UA 2BY2A 4BXFA 2BY0A 2XRNA 1UZCA 3ZQIA 3S3OA 2M9HA 4HX8A 2UWMA 1ETWA 3GZ5A 4V2GA 4WWCA 2LTPA 2DO7A 3G73A 3BCBA 4IOCF 2XAUA 3LSRA 4UB6C 2ID6A 4AU7A 2BOLA 5J1UA 2X1DA 9ANTA 4CDGA 1B8IB 4HBLA 1KU9A 1HSJA 4XKBA 1F9NA 1XX5A 2EFQA 1F36A 1PUEE 3HL2A 5EEGA 3FX3A 1N78A 3OYNA 2WAQN 2IJLA 4XLHA 4A3DJ 4M9SA 3IRRA 5IYCJ 2DQRA 5EEAA 2KRHA 1OCRH 4PDKA 2JUGA 4UVCA 5HNFA 3HBLA 2CGPA 4G6DA 1QZYA 2J5PA 1EH7A 3I53A 3OV8A 1TNTA 3KETA 1AKHA 1ZN2A 3S1RJ 3ZQLA 2FJ1A 4FISA 2LY9A 4RLQA 2EIJH 3FXLA 3SDBA 3IL2A 2LSOA 2BYVE 1FYMA 3GF2A 3TEDA 1T38A 2R7XA 1IN5A 5E79C 3J7AO 5D5VB 1YW9A 3MZ8A 2DN0A 1Z6TA 3JTHA 1DDNA 1LVKA 2H1LA 5FKMA 2XB5A 3PFIA 3JTGA 4IOAF 4ZJZA 1X1BA 1D5VA 4XM3A 4MTEA 2EZKA 5CQEA 2STWA 3LSJA 1WJDA 3RQIA 3I56I 2L7MP 1V5EA 3LSKA 1MNMC 4BE1A 3MKLA 4QIWN 4FETA 3CC7I 3TP0A 3DPLC 2A61A 2M7AA 3W2WA 4KMFA 2NYXA 3SEZA 3A01A 3UKGA 4LK1F 1BR4A 5J4VA 4KT6A 4LMYA 3CMAI 1XN7A 3S14J 3MZYA 1FBQA 4AIJA 2EPFA 4BJ5C 3BDDA 5K7ZA 1TC3C 2IXSA 4XMYA 4RLFA 4AWXB 1GVDA 3I58A 1YRNA 4UY8I 1HW5A 3KEQA 4RB0A 3NAUA 4C3HJ 4LG0B 2K9MA 1TWHJ 2CV0A 3ASNH 4Y17A 1FSHA 1T0FC 2V1DA 3DU6A 1NG6A 2TDXA 2H8WA 3KX2A 1BW6A 3SZGA 4YEJA 2GXAA 3BROA 3K4JA 5LEKA 1SEUA 1Z3XA 1SVOA 5FKLA 1BL0A 2DA3A 4ZYDA 2V6EA
chains in the Genus database with same CATH topology
4BQAA 3I0TA 2CW0F 4LLNA 4UV9A 4U88A 3JAMZ 5HDKA 4A6EA 2ZBKA 5TRDA 2XKPA 3E97A 1RNLA 1VTNC 5J8FA 5ICFA 1IW7F 2XAJA 2O0YA 1E17A 1XCVA 5CVRA 3TQNA 1LJ9A 3H92A 2BE5F 3HOTA 5CJ9A 4WXCA 5FD6A 4P55A 1C0WA 1U3EM 2LNBA 2PFBA 2BEOA 4YFNF 1ON1A 4M6YA 4L9VA 3AAFA 1HKQA 3NEUA 1YQAA 3HRMA 2PMHA 3KP7A 3R0JA 4BXUA 2EFPA 3DV8A 5D8KB 2L01A 2M1BA 4RGUA 3PQKA 3I54A 4P96A 5CYVA 3O3KA 1FPQA 1BBYA 1IN6A 2KRFA 1B9MA 3ISPA 3J81Z 1WI9A 3RJPA 3FXRA 3FM5A 3U9GA 3JAMK 1MZBA 1P4XA 2F5DA 3DKWA 3REOA 2D1HA 4ON0A 4IVNA 1R1VA 1TW2A 5KK1A 2Q8KA 2BBYA 1BOAA 2RGVA 2LKPA 4M74A 1U8RA 3NRVA 2V79A 4KIFA 1TTYA 3GFLA 4MEYF 1REPC 2NNNA 1R36A 1O3QA 4WK8F 3WU1B 5HS8A 4P5OA 2W25A 2FRHA 1U5TA 4UHTA 5DD4A 4ZH4F 1S29A 1W5SA 2CQKA 1T98A 3QP6A 5A2QZ 3J81K 5D4SA 4HAMA 1ONVA 3GUDA 5E8IA 2K7LA 2QQ9A 1FBSA 4IRHA 2P5KA 2IP2A 3K1PA 3VFZA 1SFEA 3E3VA 4G7HF 1SD5A 2WWYA 4FHTA 3TO9A 4G8XA 3HSFA 3MAJA 1TQPA 5TJJA 1B1BA 4HX4A 4BAYA 3GVAA 4ESJA 1S6LA 5LEJA 1R5HA 4L9TA 1O3RA 1YG2A 1LDJA 1YS6A 4E70A 2ETHA 2D1VA 2DTRA 4BH9A 2D45A 2XVCA 5JFRA 2P6TA 1P4WA 1Z6RA 1XGOA 5A2QK 2RV8A 3F8CA 1O57A 2STTA 4KFCA 4I98B 4N0BA 5BQTA 2VC0A 3ML6A 1RI7A 1T39A 3FF5A 2QVOA 1U5TB 3ZN0A 2Y75A 3U1DA 2LDUA 1DP7P 2DW4A 5FD5A 4OMZA 1L3LA 3KP4A 1SFUA 4JQFA 2ZO4A 4LGWA 2MH9A 3I71A 3F6VA 5FFZA 2HYFA 1XCBA 1XSDA 3CUQC 2G9WA 2X0LA 1LNWA 1ZLKA 1I1SA 2K02A 2DU9A 1QNTA 1S8NA 1XD7A 4HYEA 2R7FA 3WODF 2GQQA 5D6EA 2FXAA 1PP8F 1ZRCA 3T5XA 5DUIA 4HA8A 3S2WA 3Q9SA 1ZH5A 2YU3A 2FMLA 1XDUA 4NHJA 4L9JA 4RAZA 2UXXA 4BHPA 5D5UB 4MQ9F 3TDZC 3E5XA 5F1RA 2DBBA 2OQRA 5DCMB 2YR2A 3F8NA 4OIRF 2VOPA 5ERIA 1SMTA 1ZYRF 1YIOA 3RDIA 1O7LA 2H94A 4I01A 3TDUC 2KJBA 2GA2A 2QYOA 1LEAA 5CLSA 2XAQA 1AOYA 4U0WA 2VBYA 3W6KB 5LRSA 1NHAA 3ZMSA 2EA2A 2CO5A 1ZARA 2M87A 2MBFA 1LDDA 2HWVA 1CGPA 5L3CA 2O3FA 1XMKA 2A07F 1LEBA 1HXDA 1SD7A 2RVCA 3MWMA 5E1WA 4HF1A 2XAHA 4LB6B 2GIVA 4M6XA 5D6FA 2C6YA 4PGHA 2A68F 4I7HA 2QQAA 4EJOA 3N4MA 1KYWA 2P7CB 4YFXF 3QP5A 4G7OF 1ODDA 1SMYF 1MJ9A 2MLKA 4AIKA 5HS7A 3WTZA 2EB7A 1R00A 3RPUA 4A12A 2P7VB 2PQ8A 1HQCA 1HW1A 5F64A 4S05A 1FNNA 5FGMA 1MJBA 4KICA 5DEQA 5DYMA 3L7WA 2KJCA 1ZLJA 1DUXC 4CICA 4AIHA 5ICEA 2M45A 1KYZA 2O61A 3KP5A 1Z1DA 3WTVC 2WTEA 2CSOA 1BIBA 3ZMDA 5CVJA 1KU2A 3GXOA 4G7ZF 4IRGA 1RZ4A 3COAC 1QQIA 3QPTA 4UXNA 3KE2A 3BJOA 2VOOA 3J80Z 2KIMA 3ECHA 1DPRA 4BHCA 4HX7A 5HOOA 3O6BB 5BMZA 4GYIA 1CF7A 2EWNA 4Q47A 1ON2A 4OIPF 2EFOA 2EJRA 3HTSB 4AD9A 2Y48A 1ZAOA 3VB2A 4CGZA 5L3FA 5E1XA 3RKWA 3EUHA 4HDVA 1D8JA 3BZ6A 2PEXA 1SD4A 2NRAC 2XROA 2FU4A 1K7AA 2RN7A 4Q5SF 2JRTA 2JT1A 5L3EA 2A3SA 1W4MA 2D2WA 4U0YA 3KP2A 1R1UA 2H6CA 3F72A 3F6OA 1BI2A 2MA3A 1OR7A 3G3ZA 2L4MA 4CXFA 2VBZA 1XDSA 1R22A 4IHSA 3BPVA 2UZKA 1J59A 4GCVA 2Y0MA 2P6SA 3HSRA 3K2ZA 2XAGA 4A0ZA 3BJ6A 1HKTA 3MZHA 3J80K 1W7PB 2ZNYA 3GW2A 3LAPA 3C7JA 4OIQF 3RIRA 1OYWA 1B9NA 3MQ0A 3WU0A 4IHTA 1MKMA 4PZJA 3T8TA 1ZG3A 2ISYA 3E5QA 3ZP5A 2QZ8A 3DXJF 4O6JA 5ED4A 2OD5A 3WE2A 1U6GA 4MGRA 3I64A 2JSCA 4L0ZB 2HKOA 4FT8A 1BJAA 1LDKB 2W85A 4P9FA 2KKOA 5CVIA 2FBIA 1FYKA 3M9AA 3KLNA 4OIOF 1CF7B 3F8BA 1SFXA 2GWRA 2IA0A 2A5YB 2DFIA 4IXAA 3MEXA 1IUYA 4I2OA 3P9CA 3HYIA 2EV0A 5ILUA 2F5FA 2PMUA 1MGTA 2LF7A 4P9UA 1OYYA 2IA1A 3GFJA 3ABTA 2EFWA 4FX4A 2WC2A 2GZWA 1ZHFA 4L5IA 1XMAA 4EJVA 3F21A 5HLGA 4M73A 4M71A 4ASNA 4IRIA 2W57A 3GX4X 4K2EA 2PI0A 1QO0D 3RPQA 3TO7A 2FOKA 1GHCA 2VONA 3KEOA 1HW2A 4IF4A 4PGGA 2PJPA 1R23A 4YFKF 1F4KA 3R60A 4UV8A 1RUNA 4KNYA 1IAWA 1J0RA 3EETA 2YPRA 4LB5A 2GA1A 2OBPA 4F7ZA 2DI3A 5LHGA 3CJNA 3CUOA 1YTYA 5K5RA 3WTWC 1MD0A 3CO7C 1BIAA 1P92A 1O7FA 1HKSA 4WCGA 2HDCA 3M1EA 3SXYA 3IRQA 1YFHA 3M8FA 1JGSA 3WTUC 1QPMA 4R8HA 3GO5A 1B4AA 4QWQA 3B02A 3HSEA 1KQ8A 3WE3A 5H20A 2QBYA 5L3BA 1WKMA 3CLOA 3BOQA 1EH6A 1R5GA 2F5EA 2HTJA 2DPDA 5ILSA 2RNJA 2EV5A 3QU6A 1YO5C 3KCCA 1D3YA 2HTSA 1HBXG 1EH8A 1IF1A 2H27A 2IT0A 3N97A 5D5WB 5HLIA 4CHUA 2UXNA 4IPAA 1J75A 2A6EF 3L9FA 5DCMA 5DCFA 1LB2A 3V8KA 1IXRC 3JSOA 1KQ0A 3E6BA 1G4DA 2MLGA 3KZZA 1USTA 4I0AA 3E6MA 2QM3A 5FB2A 4KDPA 1FWZA 5IT9Z 4M72A 1F1ZA 2FBKA 4H0EA 4DNCA 1KGSA 4HF2A 3SZPA 5FLXZ 1FSEA 3NQOA 4OMYA 4XSXF 1XGNA 2ESNA 4WXHA 4LJZF 1KQ9A 2HQNA 1W7PD 4QLCU 2WV0A 4L0YB 4XLPF 2V1UA 1BI1A 1FYLA 3LWFA 3R4KA 1V4RA 2IPQX 2L02A 2ACJA 3GFMA 3ZQ7A 3GWZA 2MD5A 1P6RA 3ZMZA 2B0LA 3JW4A 2DK8A 3L09A 2PBIA 2QBYB 2XKOA 4EVIA 5DV5A 6PAXA 2E1CA 3I5UA 1OMIA 1I6XA 4G6QA 2R3SA 1I5ZA 4I09A 3TKYA 1BN5A 2ADUA 1I1GA 3FMRA 2YSRA 2VE9A 3ABUA 3V8LA 1FC3A 3BPXA 2OZ6A 3D0SA 1WRJA 2IA2A 2OA4A 1X3UA 4U7BA 5FO5A 4LK0F 5BOXA 2K4JA 3WTYC 2VT3A 1ULYA 1RUOA 4NQWA 3Q9VA 4EMSA 3VOEA 1FZPB 1ZREA 4ZYGA 5D4RA 2Z9OA 1YW8A 4ENKA 1F5TA 2PN6A 1KA8A 1IRGA 1WWXA 2A69F 5JHUA 5K5QA 3H3UA 4UUVA 5E8GA 1Z7UA 3ULQB 4WF2A 3HUGA 1XGMA 3I4PA 3ZN1A 1V3FA 2FBHA 3WGIA 3BP8A 1Z05A 3M7GA 2RKHA 1LVAA 1FOKA 1RIOH 2ZMEB 3SZTA 1JHHA 3WGGA 4AVPA 4G94A 3TOAA 1FP2A 1L0OC 5BS6A 1J2XA 3IKTA 2BV6A 3OOPA 4LLGF 4Y13A 1DPUA 4HDUA 5AONA 3VODA 2CWEA 2YX7A 2KIUA 3DEUA 3HHGA 4EQQA 2GXBA 4A0XA 2AS5F 4G9YA 4UVBA 2IVMA 3KLOA 3RKYA 1J7KA 2FNPA 1FY7A 1K78A 2HZTA 4MNUA 3K0LA 3T0YA 4XLNF 4MHGA 3FXQA 4Z2YA 3ERED 2L4AA 2CYYA 1G3SA 5ILVA 4HV6A 1YYVA 4RGSA 2F2EA 2XHKA 3WTTC 1W7PA 2ZKZA 4XRFA 2P4WA 1OKRA 1P4AA 3P9KA 2HKXA 3LQRA 1IN8A 1OPCA 1TLHB 2E7XA 2RC4A 2G7HA 4ETSA 2DAOA 2XASA 4ZYHA 1ZG1A 3BJAA 4KMUX 4KIGA 2VXZA 4HW0A 2AXLA 4HOBA 3LSTA 4BYYA 1FP1D 4N9IA 5AIQA 2DLLA 1S7OA 3MCZA 1SD6A 2NS0A 1XSXA 1TQIA 5CVUA 4HLXA 1JE8A 2JZYA 3V7SA 2EA4A 3U2RA 2H09A 2OZUA 4D0PA 2JPBA 2V9VA 3CUQB 3LQQA 4TV7A 4HLYA 4YG2F 3RTRA 3D5LA 5JI6A 2HFHA 4OU0A 3ZMTA 2DT5A 1G6NA 4KYWA 3FZVA 2X4HA 2M30A 1MDMA 4KN7X 2DK5A 1BC7C 4NB5A 1K78B 4U7DA 1FX7A 3DQVC 5EEHA 3GZ6A 1JHFA 3R6SA 2EV6A 3C1DA 1SAXA 2QQBA 1QZZA 2OU2A 2QWWA 3DPTA 2QENA 1K6OA 2HS5A 1IXSB 1UHMA 3TO6A 2Z3YA 4R79A 5E20A 5BPDA 3TOBA 2VE8A 3B73A 3KP6A 2K4BA 2ZNZA 1Z91A 3DF8A 4CZZA 1MJAA 2XGXA 2O6GE 3RYPA 3ELKA 2NNYA 4ENNA 2O03A 4KIBA 4M9ZA 1ZG5A 2FMYA 4A6DA 1H0MA 1BM9A 2IW5A 1GXQA 4GO1A 2ZXJA 1TW3A 5HS9A 1BC8C 1FT9A 1HSTA 2KIFA 2VBXA 3IHUA 2W84A 4LFUA 2M8EA 5H6RA 3HOSA 5D5XB 2RDPA 4YIIA 1A04A 1BI0A 4R1HA 2MH2A 5LHIA 2HOEA 4GGGA 5AIPA 2CG4A 4EJUA 3SHFA 1QBJA 1OYIA 1D8KA 1R7JA 5H6QA 4WXDA 1U5TC 4GYGA 1GVJA 4O5VA 2P5LC 3RYRA 3CTAA 2E1NA 4I02A 1Q1HA 3FM3A 4ESBA 1STZA 2FNAA 3O2PE 2FA5A 4B8XA 3IWZA 1E2XA 3ZMVA 1MDMB 4RB2C 4EGZA 2R7DA 5L3DA 4OINF 2ZFWA 4L18B 3E6DA 3EDPA 1LQ1A 3WGHA 4A2UA 4BHBA 1UB9A 3Q5FA 3GFIA 4HQMA 3I59A 3C18A 4LD5A 1YS7A 5K5OA 1Z9CA 2P8TA 1T0FA 2OAZA 5L3GA 2FQ3A 5JR3A 1TQMA 3DP7A 5E1ZB 2EFNA 1IN4A 5HDNA 2VT2A 4ZYEA 4HZFA 1ZGJA 3LFKA 3GEZA 3ECOA 5LHHA 2Z33A 2ZCWA 4I0BA 3GYHX 3K1MA 1JXSA 4KA4A 4EV0A 1S3JA 3WTXC 3HRSA 3QRFF 3KP3A 1KU3A 2DQLA 3K1NA 2JTVA 3BWGA 3HHHA 4EM2A 4ENJA 4HF0A 2GXGA 3ZPLA 3V4GA 4UNOA 3SFZA 2GAUA 1U2WA 3PQJA 4JK1X 1QGPA 5CVVA 4A0YA 3WTSC 4FX0A 4BNCA 4KT5C 4RGRA 2PG4A 4L5JA 3FXUA 3QPHA 4RS8A 5HVQC 3W6JB 4Q48A 2V6CA 2QUFA 3V7CA 2L54A 2M5WA 3IWFA 4ZZLA 1G3YA 1UFMA 2ESHA 2PLYA 3RI4A 2Q0OA 1P2FA 3QAHA 3TGNA 2HYGD 3IC7A 3P7NA 3K9TA 5DUKA 5K1YA 5J6XA 4HQEA 3GLXA 4ZZDA 5DD8A 2RQPA 3I59B 4DQ2A 3V8JA 1J5YA 3F8MA 1K79A 2ELHA 1R58A 4L9NA 2QLZA 5ICCA 3P9IA 3VEPA 3QU3A 1PDNC 3LAJA 4ENMA 2OQGA 1USSA 1YLFA 5DDGA 5LLQA 1O3SA 3C3WA 1XGSA 3FMSA 2FE3A 2JPCA 4IJAA 5IT3A 4M9XA 2ZMEA 1KU7A 1IZ1A 2A6HF 3QOPA 4RB1A 4PCQA 1B6AA 4A5NA 1FBUA 3EYYA 5E17F 3FHZA 2Z99A 3JSPA 2HGCA 4GXOA 2FEZA 1UCRA 1I27A 4U0VA 4A5MA 4UVAA 4O3MA 5JVTA 3R61A 3FMQA 1O3TA 2F5CA 2O8XA 3KFWX 1ZGAA 4CYDA 4HV5A 1G3TA 1G3WA 3HTUA 5BPIA 1T6SA 3L2CA 1WQ2A 4EGYA 2ISZA 5IT9K 1T2KA 3KZYA 2BGCA 2NAZA 4XSZF 5KVRA 5FLXK 1U78A 3EYIA 3WG9A 2Q2EA 3F23A 2K27A 4Q4ZF 2V1XA 1UHWA 5LBQA 2IRFG 1B59A 2FSWA 4XBFA 1H9TA 4WX9A 2E7WA 3V7RA 1R1TA 3LA2A 4MQVA 4MTDA 5FFXA 2W24A 2VODA 2XIGA 3CO6C 2J5OA 2MC3A 1TNSA 2HR3A 3EQLF 3CUQA 2XUBA 5D8LB 1BI3A 3BY6A 4S04A 3T8RA 4RB3C 1AWCA 1XB4A 2CFXA 3ROUA 2EK5A 3F8FA 3H3ZA 3K69A 3SQNA 4CO8A 1IRFA 2G7UA 5LGTA 1EV7A 5F6FA 4RAYA 2VBWA 5J8CA 4Y15A 4YIFA 1FLIA 2P5VA 1IN7A 3IKVA 3T1BA 1W5TA 1ZRFA 1GXPA 5HLHA 2HQRA 3CDHA 1XSVA 3L00A 5LGUA 2YX4A 2H6BA 4EJWA 2VC1A 3RKXA 3DFGA 1IXCA 1WSUA 2XAFA 4EJTA 2COMA 4OOIA 5ICGA 2LF8A 3FWEA 3E6CC 5LRRA 2L3DA 5HDGA 3F22A 2DPUA 1Y0UA 2VN2A 3F3XA 3M8EA 2XV4S 1H9GA 4RGXA 4ESFA 3HIFA 3R0AA 1S7AA 4EM1A 4LG0A 2HEOA 4JBAA 4KUMA 1PP7U 3MFKA 4N9HA 1ZRDA 5LGNA 3E5UA 2ZJ2A 2K86A 3HRUA 1J9IA 3ZMUA 3HRTA 3LA3A 1YW7A 2FF4A 3LA7A 4EM0B 1TBXA 4B09A 4LLLA 4MEXF 4KN4X 5E18F 2Z5UA 2XRNA 4HX8A 2UWMA 3GZ5A 4WWCA 3G73A 2DO7A 4CDGA 4HBLA 1KU9A 1HSJA 1F9NA 2EFQA 1PUEE 5EEGA 3FX3A 2IJLA 4M9SA 3IRRA 2DQRA 4PDKA 4UVCA 2CGPA 4G6DA 1QZYA 3KETA 2J5PA 1EH7A 3I53A 1TNTA 3OV8A 1ZN2A 3IL2A 2LSOA 2BYVE 1FYMA 3GF2A 1T38A 1IN5A 3J7AO 5D5VB 1YW9A 1Z6TA 3JTHA 1DDNA 3PFIA 3JTGA 1D5VA 4MTEA 2STWA 3DPLC 2A61A 4KMFA 2NYXA 4LK1F 4LMYA 1XN7A 3MZYA 1FBQA 4AIJA 3BDDA 4AWXB 3I58A 1HW5A 3KEQA 4RB0A 4LG0B 4Y17A 1FSHA 2V1DA 2TDXA 3BROA 5LEKA 4ZYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQA A;  3I0T A;  2CW0 F;  4LLN A;  4UV9 A;  4U88 A;  3JAM Z;  5HDK A;  4A6E A;  2ZBK A;  5TRD A;  2XKP A;  3E97 A;  1RNL A;  1VTN C;  5J8F A;  5ICF A;  1IW7 F;  2XAJ A;  2O0Y A;  1E17 A;  1XCV A;  5CVR A;  3TQN A;  1LJ9 A;  3H92 A;  2BE5 F;  3HOT A;  5CJ9 A;  4WXC A;  5FD6 A;  4P55 A;  1C0W A;  1U3E M;  2LNB A;  2PFB A;  2BEO A;  4YFN F;  1ON1 A;  4M6Y A;  4L9V A;  3AAF A;  1HKQ A;  3NEU A;  1YQA A;  3HRM A;  2PMH A;  3KP7 A;  3R0J A;  4BXU A;  2EFP A;  3DV8 A;  5D8K B;  2L01 A;  2M1B A;  4RGU A;  3PQK A;  3I54 A;  4P96 A;  5CYV A;  3O3K A;  1FPQ A;  1BBY A;  1IN6 A;  2KRF A;  1B9M A;  3ISP A;  3J81 Z;  1WI9 A;  3RJP A;  3FXR A;  3FM5 A;  3U9G A;  3JAM K;  1MZB A;  1P4X A;  2F5D A;  3DKW A;  3REO A;  2D1H A;  4ON0 A;  4IVN A;  1R1V A;  1TW2 A;  5KK1 A;  2Q8K A;  2BBY A;  1BOA A;  2RGV A;  2LKP A;  4M74 A;  1U8R A;  3NRV A;  2V79 A;  4KIF A;  1TTY A;  3GFL A;  4MEY F;  1REP C;  2NNN A;  1R36 A;  1O3Q A;  4WK8 F;  3WU1 B;  5HS8 A;  4P5O A;  2W25 A;  2FRH A;  1U5T A;  4UHT A;  5DD4 A;  4ZH4 F;  1S29 A;  1W5S A;  2CQK A;  1T98 A;  3QP6 A;  5A2Q Z;  3J81 K;  5D4S A;  4HAM A;  1ONV A;  3GUD A;  5E8I A;  2K7L A;  2QQ9 A;  1FBS A;  4IRH A;  2P5K A;  2IP2 A;  3K1P A;  3VFZ A;  1SFE A;  3E3V A;  4G7H F;  1SD5 A;  2WWY A;  4FHT A;  3TO9 A;  4G8X A;  3HSF A;  3MAJ A;  1TQP A;  5TJJ A;  1B1B A;  4HX4 A;  4BAY A;  3GVA A;  4ESJ A;  1S6L A;  5LEJ A;  1R5H A;  4L9T A;  1O3R A;  1YG2 A;  1LDJ A;  1YS6 A;  4E70 A;  2ETH A;  2D1V A;  2DTR A;  4BH9 A;  2D45 A;  2XVC A;  5JFR A;  2P6T A;  1P4W A;  1Z6R A;  1XGO A;  5A2Q K;  2RV8 A;  3F8C A;  1O57 A;  2STT A;  4KFC A;  4I98 B;  4N0B A;  5BQT A;  2VC0 A;  3ML6 A;  1RI7 A;  1T39 A;  3FF5 A;  2QVO A;  1U5T B;  3ZN0 A;  2Y75 A;  3U1D A;  2LDU A;  1DP7 P;  2DW4 A;  5FD5 A;  4OMZ A;  1L3L A;  3KP4 A;  1SFU A;  4JQF A;  2ZO4 A;  4LGW A;  2MH9 A;  3I71 A;  3F6V A;  5FFZ A;  2HYF A;  1XCB A;  1XSD A;  3CUQ C;  2G9W A;  2X0L A;  1LNW A;  1ZLK A;  1I1S A;  2K02 A;  2DU9 A;  1QNT A;  1S8N A;  1XD7 A;  4HYE A;  2R7F A;  3WOD F;  2GQQ A;  5D6E A;  2FXA A;  1PP8 F;  1ZRC A;  3T5X A;  5DUI A;  4HA8 A;  3S2W A;  3Q9S A;  1ZH5 A;  2YU3 A;  2FML A;  1XDU A;  4NHJ A;  4L9J A;  4RAZ A;  2UXX A;  4BHP A;  5D5U B;  4MQ9 F;  3TDZ C;  3E5X A;  5F1R A;  2DBB A;  2OQR A;  5DCM B;  2YR2 A;  3F8N A;  4OIR F;  2VOP A;  5ERI A;  1SMT A;  1ZYR F;  1YIO A;  3RDI A;  1O7L A;  2H94 A;  4I01 A;  3TDU C;  2KJB A;  2GA2 A;  2QYO A;  1LEA A;  5CLS A;  2XAQ A;  1AOY A;  4U0W A;  2VBY A;  3W6K B;  5LRS A;  1NHA A;  3ZMS A;  2EA2 A;  2CO5 A;  1ZAR A;  2M87 A;  2MBF A;  1LDD A;  2HWV A;  1CGP A;  5L3C A;  2O3F A;  1XMK A;  2A07 F;  1LEB A;  1HXD A;  1SD7 A;  2RVC A;  3MWM A;  5E1W A;  4HF1 A;  2XAH A;  4LB6 B;  2GIV A;  4M6X A;  5D6F A;  2C6Y A;  4PGH A;  2A68 F;  4I7H A;  2QQA A;  4EJO A;  3N4M A;  1KYW A;  2P7C B;  4YFX F;  3QP5 A;  4G7O F;  1ODD A;  1SMY F;  1MJ9 A;  2MLK A;  4AIK A;  5HS7 A;  3WTZ A;  2EB7 A;  1R00 A;  3RPU A;  4A12 A;  2P7V B;  2PQ8 A;  1HQC A;  1HW1 A;  5F64 A;  4S05 A;  1FNN A;  5FGM A;  1MJB A;  4KIC A;  5DEQ A;  5DYM A;  3L7W A;  2KJC A;  1ZLJ A;  1DUX C;  4CIC A;  4AIH A;  5ICE A;  2M45 A;  1KYZ A;  2O61 A;  3KP5 A;  1Z1D A;  3WTV C;  2WTE A;  2CSO A;  1BIB A;  3ZMD A;  5CVJ A;  1KU2 A;  3GXO A;  4G7Z F;  4IRG A;  1RZ4 A;  3COA C;  1QQI A;  3QPT A;  4UXN A;  3KE2 A;  3BJO A;  2VOO A;  3J80 Z;  2KIM A;  3ECH A;  1DPR A;  4BHC A;  4HX7 A;  5HOO A;  3O6B B;  5BMZ A;  4GYI A;  1CF7 A;  2EWN A;  4Q47 A;  1ON2 A;  4OIP F;  2EFO A;  2EJR A;  3HTS B;  4AD9 A;  2Y48 A;  1ZAO A;  3VB2 A;  4CGZ A;  5L3F A;  5E1X A;  3RKW A;  3EUH A;  4HDV A;  1D8J A;  3BZ6 A;  2PEX A;  1SD4 A;  2NRA C;  2XRO A;  2FU4 A;  1K7A A;  2RN7 A;  4Q5S F;  2JRT A;  2JT1 A;  5L3E A;  2A3S A;  1W4M A;  2D2W A;  4U0Y A;  3KP2 A;  1R1U A;  2H6C A;  3F72 A;  3F6O A;  1BI2 A;  2MA3 A;  1OR7 A;  3G3Z A;  2L4M A;  4CXF A;  2VBZ A;  1XDS A;  1R22 A;  4IHS A;  3BPV A;  2UZK A;  1J59 A;  4GCV A;  2Y0M A;  2P6S A;  3HSR A;  3K2Z A;  2XAG A;  4A0Z A;  3BJ6 A;  1HKT A;  3MZH A;  3J80 K;  1W7P B;  2ZNY A;  3GW2 A;  3LAP A;  3C7J A;  4OIQ F;  3RIR A;  1OYW A;  1B9N A;  3MQ0 A;  3WU0 A;  4IHT A;  1MKM A;  4PZJ A;  3T8T A;  1ZG3 A;  2ISY A;  3E5Q A;  3ZP5 A;  2QZ8 A;  3DXJ F;  4O6J A;  5ED4 A;  2OD5 A;  3WE2 A;  1U6G A;  4MGR A;  3I64 A;  2JSC A;  4L0Z B;  2HKO A;  4FT8 A;  1BJA A;  1LDK B;  2W85 A;  4P9F A;  2KKO A;  5CVI A;  2FBI A;  1FYK A;  3M9A A;  3KLN A;  4OIO F;  1CF7 B;  3F8B A;  1SFX A;  2GWR A;  2IA0 A;  2A5Y B;  2DFI A;  4IXA A;  3MEX A;  1IUY A;  4I2O A;  3P9C A;  3HYI A;  2EV0 A;  5ILU A;  2F5F A;  2PMU A;  1MGT A;  2LF7 A;  4P9U A;  1OYY A;  2IA1 A;  3GFJ A;  3ABT A;  2EFW A;  4FX4 A;  2WC2 A;  2GZW A;  1ZHF A;  4L5I A;  1XMA A;  4EJV A;  3F21 A;  5HLG A;  4M73 A;  4M71 A;  4ASN A;  4IRI A;  2W57 A;  3GX4 X;  4K2E A;  2PI0 A;  1QO0 D;  3RPQ A;  3TO7 A;  2FOK A;  1GHC A;  2VON A;  3KEO A;  1HW2 A;  4IF4 A;  4PGG A;  2PJP A;  1R23 A;  4YFK F;  1F4K A;  3R60 A;  4UV8 A;  1RUN A;  4KNY A;  1IAW A;  1J0R A;  3EET A;  2YPR A;  4LB5 A;  2GA1 A;  2OBP A;  4F7Z A;  2DI3 A;  5LHG A;  3CJN A;  3CUO A;  1YTY A;  5K5R A;  3WTW C;  1MD0 A;  3CO7 C;  1BIA A;  1P92 A;  1O7F A;  1HKS A;  4WCG A;  2HDC A;  3M1E A;  3SXY A;  3IRQ A;  1YFH A;  3M8F A;  1JGS A;  3WTU C;  1QPM A;  4R8H A;  3GO5 A;  1B4A A;  4QWQ A;  3B02 A;  3HSE A;  1KQ8 A;  3WE3 A;  5H20 A;  2QBY A;  5L3B A;  1WKM A;  3CLO A;  3BOQ A;  1EH6 A;  1R5G A;  2F5E A;  2HTJ A;  2DPD A;  5ILS A;  2RNJ A;  2EV5 A;  3QU6 A;  1YO5 C;  3KCC A;  1D3Y A;  2HTS A;  1HBX G;  1EH8 A;  1IF1 A;  2H27 A;  2IT0 A;  3N97 A;  5D5W B;  5HLI A;  4CHU A;  2UXN A;  4IPA A;  1J75 A;  2A6E F;  3L9F A;  5DCM A;  5DCF A;  1LB2 A;  3V8K A;  1IXR C;  3JSO A;  1KQ0 A;  3E6B A;  1G4D A;  2MLG A;  3KZZ A;  1UST A;  4I0A A;  3E6M A;  2QM3 A;  5FB2 A;  4KDP A;  1FWZ A;  5IT9 Z;  4M72 A;  1F1Z A;  2FBK A;  4H0E A;  4DNC A;  1KGS A;  4HF2 A;  3SZP A;  5FLX Z;  1FSE A;  3NQO A;  4OMY A;  4XSX F;  1XGN A;  2ESN A;  4WXH A;  4LJZ F;  1KQ9 A;  2HQN A;  1W7P D;  4QLC U;  2WV0 A;  4L0Y B;  4XLP F;  2V1U A;  1BI1 A;  1FYL A;  3LWF A;  3R4K A;  1V4R A;  2IPQ X;  2L02 A;  2ACJ A;  3GFM A;  3ZQ7 A;  3GWZ A;  2MD5 A;  1P6R A;  3ZMZ A;  2B0L A;  3JW4 A;  2DK8 A;  3L09 A;  2PBI A;  2QBY B;  2XKO A;  4EVI A;  5DV5 A;  6PAX A;  2E1C A;  3I5U A;  1OMI A;  1I6X A;  4G6Q A;  2R3S A;  1I5Z A;  4I09 A;  3TKY A;  1BN5 A;  2ADU A;  1I1G A;  3FMR A;  2YSR A;  2VE9 A;  3ABU A;  3V8L A;  1FC3 A;  3BPX A;  2OZ6 A;  3D0S A;  1WRJ A;  2IA2 A;  2OA4 A;  1X3U A;  4U7B A;  5FO5 A;  4LK0 F;  5BOX A;  2K4J A;  3WTY C;  2VT3 A;  1ULY A;  1RUO A;  4NQW A;  3Q9V A;  4EMS A;  3VOE A;  1FZP B;  1ZRE A;  4ZYG A;  5D4R A;  2Z9O A;  1YW8 A;  4ENK A;  1F5T A;  2PN6 A;  1KA8 A;  1IRG A;  1WWX A;  2A69 F;  5JHU A;  5K5Q A;  3H3U A;  4UUV A;  5E8G A;  1Z7U A;  3ULQ B;  4WF2 A;  3HUG A;  1XGM A;  3I4P A;  3ZN1 A;  1V3F A;  2FBH A;  3WGI A;  3BP8 A;  1Z05 A;  3M7G A;  2RKH A;  1LVA A;  1FOK A;  1RIO H;  2ZME B;  3SZT A;  1JHH A;  3WGG A;  4AVP A;  4G94 A;  3TOA A;  1FP2 A;  1L0O C;  5BS6 A;  1J2X A;  3IKT A;  2BV6 A;  3OOP A;  4LLG F;  4Y13 A;  1DPU A;  4HDU A;  5AON A;  3VOD A;  2CWE A;  2YX7 A;  2KIU A;  3DEU A;  3HHG A;  4EQQ A;  2GXB A;  4A0X A;  2AS5 F;  4G9Y A;  4UVB A;  2IVM A;  3KLO A;  3RKY A;  1J7K A;  2FNP A;  1FY7 A;  1K78 A;  2HZT A;  4MNU A;  3K0L A;  3T0Y A;  4XLN F;  4MHG A;  3FXQ A;  4Z2Y A;  3ERE D;  2L4A A;  2CYY A;  1G3S A;  5ILV A;  4HV6 A;  1YYV A;  4RGS A;  2F2E A;  2XHK A;  3WTT C;  1W7P A;  2ZKZ A;  4XRF A;  2P4W A;  1OKR A;  1P4A A;  3P9K A;  2HKX A;  3LQR A;  1IN8 A;  1OPC A;  1TLH B;  2E7X A;  2RC4 A;  2G7H A;  4ETS A;  2DAO A;  2XAS A;  4ZYH A;  1ZG1 A;  3BJA A;  4KMU X;  4KIG A;  2VXZ A;  4HW0 A;  2AXL A;  4HOB A;  3LST A;  4BYY A;  1FP1 D;  4N9I A;  5AIQ A;  2DLL A;  1S7O A;  3MCZ A;  1SD6 A;  2NS0 A;  1XSX A;  1TQI A;  5CVU A;  4HLX A;  1JE8 A;  2JZY A;  3V7S A;  2EA4 A;  3U2R A;  2H09 A;  2OZU A;  4D0P A;  2JPB A;  2V9V A;  3CUQ B;  3LQQ A;  4TV7 A;  4HLY A;  4YG2 F;  3RTR A;  3D5L A;  5JI6 A;  2HFH A;  4OU0 A;  3ZMT A;  2DT5 A;  1G6N A;  4KYW A;  3FZV A;  2X4H A;  2M30 A;  1MDM A;  4KN7 X;  2DK5 A;  1BC7 C;  4NB5 A;  1K78 B;  4U7D A;  1FX7 A;  3DQV C;  5EEH A;  3GZ6 A;  1JHF A;  3R6S A;  2EV6 A;  3C1D A;  1SAX A;  2QQB A;  1QZZ A;  2OU2 A;  2QWW A;  3DPT A;  2QEN A;  1K6O A;  2HS5 A;  1IXS B;  1UHM A;  3TO6 A;  2Z3Y A;  4R79 A;  5E20 A;  5BPD A;  3TOB A;  2VE8 A;  3B73 A;  3KP6 A;  2K4B A;  2ZNZ A;  1Z91 A;  3DF8 A;  4CZZ A;  1MJA A;  2XGX A;  2O6G E;  3RYP A;  3ELK A;  2NNY A;  4ENN A;  2O03 A;  4KIB A;  4M9Z A;  1ZG5 A;  2FMY A;  4A6D A;  1H0M A;  1BM9 A;  2IW5 A;  1GXQ A;  4GO1 A;  2ZXJ A;  1TW3 A;  5HS9 A;  1BC8 C;  1FT9 A;  1HST A;  2KIF A;  2VBX A;  3IHU A;  2W84 A;  4LFU A;  2M8E A;  5H6R A;  3HOS A;  5D5X B;  2RDP A;  4YII A;  1A04 A;  1BI0 A;  4R1H A;  2MH2 A;  5LHI A;  2HOE A;  4GGG A;  5AIP A;  2CG4 A;  4EJU A;  3SHF A;  1QBJ A;  1OYI A;  1D8K A;  1R7J A;  5H6Q A;  4WXD A;  1U5T C;  4GYG A;  1GVJ A;  4O5V A;  2P5L C;  3RYR A;  3CTA A;  2E1N A;  4I02 A;  1Q1H A;  3FM3 A;  4ESB A;  1STZ A;  2FNA A;  3O2P E;  2FA5 A;  4B8X A;  3IWZ A;  1E2X A;  3ZMV A;  1MDM B;  4RB2 C;  4EGZ A;  2R7D A;  5L3D A;  4OIN F;  2ZFW A;  4L18 B;  3E6D A;  3EDP A;  1LQ1 A;  3WGH A;  4A2U A;  4BHB A;  1UB9 A;  3Q5F A;  3GFI A;  4HQM A;  3I59 A;  3C18 A;  4LD5 A;  1YS7 A;  5K5O A;  1Z9C A;  2P8T A;  1T0F A;  2OAZ A;  5L3G A;  2FQ3 A;  5JR3 A;  1TQM A;  3DP7 A;  5E1Z B;  2EFN A;  1IN4 A;  5HDN A;  2VT2 A;  4ZYE A;  4HZF A;  1ZGJ A;  3LFK A;  3GEZ A;  3ECO A;  5LHH A;  2Z33 A;  2ZCW A;  4I0B A;  3GYH X;  3K1M A;  1JXS A;  4KA4 A;  4EV0 A;  1S3J A;  3WTX C;  3HRS A;  3QRF F;  3KP3 A;  1KU3 A;  2DQL A;  3K1N A;  2JTV A;  3BWG A;  3HHH A;  4EM2 A;  4ENJ A;  4HF0 A;  2GXG A;  3ZPL A;  3V4G A;  4UNO A;  3SFZ A;  2GAU A;  1U2W A;  3PQJ A;  4JK1 X;  1QGP A;  5CVV A;  4A0Y A;  3WTS C;  4FX0 A;  4BNC A;  4KT5 C;  4RGR A;  2PG4 A;  4L5J A;  3FXU A;  3QPH A;  4RS8 A;  5HVQ C;  3W6J B;  4Q48 A;  2V6C A;  2QUF A;  3V7C A;  2L54 A;  2M5W A;  3IWF A;  4ZZL A;  1G3Y A;  1UFM A;  2ESH A;  2PLY A;  3RI4 A;  2Q0O A;  1P2F A;  3QAH A;  3TGN A;  2HYG D;  3IC7 A;  3P7N A;  3K9T A;  5DUK A;  5K1Y A;  5J6X A;  4HQE A;  3GLX A;  4ZZD A;  5DD8 A;  2RQP A;  3I59 B;  4DQ2 A;  3V8J A;  1J5Y A;  3F8M A;  1K79 A;  2ELH A;  1R58 A;  4L9N A;  2QLZ A;  5ICC A;  3P9I A;  3VEP A;  3QU3 A;  1PDN C;  3LAJ A;  4ENM A;  2OQG A;  1USS A;  1YLF A;  5DDG A;  5LLQ A;  1O3S A;  3C3W A;  1XGS A;  3FMS A;  2FE3 A;  2JPC A;  4IJA A;  5IT3 A;  4M9X A;  2ZME A;  1KU7 A;  1IZ1 A;  2A6H F;  3QOP A;  4RB1 A;  4PCQ A;  1B6A A;  4A5N A;  1FBU A;  3EYY A;  5E17 F;  3FHZ A;  2Z99 A;  3JSP A;  2HGC A;  4GXO A;  2FEZ A;  1UCR A;  1I27 A;  4U0V A;  4A5M A;  4UVA A;  4O3M A;  5JVT A;  3R61 A;  3FMQ A;  1O3T A;  2F5C A;  2O8X A;  3KFW X;  1ZGA A;  4CYD A;  4HV5 A;  1G3T A;  1G3W A;  3HTU A;  5BPI A;  1T6S A;  3L2C A;  1WQ2 A;  4EGY A;  2ISZ A;  5IT9 K;  1T2K A;  3KZY A;  2BGC A;  2NAZ A;  4XSZ F;  5KVR A;  5FLX K;  1U78 A;  3EYI A;  3WG9 A;  2Q2E A;  3F23 A;  2K27 A;  4Q4Z F;  2V1X A;  1UHW A;  5LBQ A;  2IRF G;  1B59 A;  2FSW A;  4XBF A;  1H9T A;  4WX9 A;  2E7W A;  3V7R A;  1R1T A;  3LA2 A;  4MQV A;  4MTD A;  5FFX A;  2W24 A;  2VOD A;  2XIG A;  3CO6 C;  2J5O A;  2MC3 A;  1TNS A;  2HR3 A;  3EQL F;  3CUQ A;  2XUB A;  5D8L B;  1BI3 A;  3BY6 A;  4S04 A;  3T8R A;  4RB3 C;  1AWC A;  1XB4 A;  2CFX A;  3ROU A;  2EK5 A;  3F8F A;  3H3Z A;  3K69 A;  3SQN A;  4CO8 A;  1IRF A;  2G7U A;  5LGT A;  1EV7 A;  5F6F A;  4RAY A;  2VBW A;  5J8C A;  4Y15 A;  4YIF A;  1FLI A;  2P5V A;  1IN7 A;  3IKV A;  3T1B A;  1W5T A;  1ZRF A;  1GXP A;  5HLH A;  2HQR A;  3CDH A;  1XSV A;  3L00 A;  5LGU A;  2YX4 A;  2H6B A;  4EJW A;  2VC1 A;  3RKX A;  3DFG A;  1IXC A;  1WSU A;  2XAF A;  4EJT A;  2COM A;  4OOI A;  5ICG A;  2LF8 A;  3FWE A;  3E6C C;  5LRR A;  2L3D A;  5HDG A;  3F22 A;  2DPU A;  1Y0U A;  2VN2 A;  3F3X A;  3M8E A;  2XV4 S;  1H9G A;  4RGX A;  4ESF A;  3HIF A;  3R0A A;  1S7A A;  4EM1 A;  4LG0 A;  2HEO A;  4JBA A;  4KUM A;  1PP7 U;  3MFK A;  4N9H A;  1ZRD A;  5LGN A;  3E5U A;  2ZJ2 A;  2K86 A;  3HRU A;  1J9I A;  3ZMU A;  3HRT A;  3LA3 A;  1YW7 A;  2FF4 A;  3LA7 A;  4EM0 B;  1TBX A;  4B09 A;  4LLL A;  4MEX F;  4KN4 X;  5E18 F;  2Z5U A;  2XRN A;  4HX8 A;  2UWM A;  3GZ5 A;  4WWC A;  3G73 A;  2DO7 A;  4CDG A;  4HBL A;  1KU9 A;  1HSJ A;  1F9N A;  2EFQ A;  1PUE E;  5EEG A;  3FX3 A;  2IJL A;  4M9S A;  3IRR A;  2DQR A;  4PDK A;  4UVC A;  2CGP A;  4G6D A;  1QZY A;  3KET A;  2J5P A;  1EH7 A;  3I53 A;  1TNT A;  3OV8 A;  1ZN2 A;  3IL2 A;  2LSO A;  2BYV E;  1FYM A;  3GF2 A;  1T38 A;  1IN5 A;  3J7A O;  5D5V B;  1YW9 A;  1Z6T A;  3JTH A;  1DDN A;  3PFI A;  3JTG A;  1D5V A;  4MTE A;  2STW A;  3DPL C;  2A61 A;  4KMF A;  2NYX A;  4LK1 F;  4LMY A;  1XN7 A;  3MZY A;  1FBQ A;  4AIJ A;  3BDD A;  4AWX B;  3I58 A;  1HW5 A;  3KEQ A;  4RB0 A;  4LG0 B;  4Y17 A;  1FSH A;  2V1D A;  2TDX A;  3BRO A;  5LEK A;  4ZYD A; 
#chains in the Genus database with same CATH topology
 1B72 B;  2VPR A;  5DTD A;  4BQA A;  2R7V A;  3VYU B;  3I0T A;  2CW0 F;  4CA0 A;  4LLN A;  4UV9 A;  4DBQ A;  4U88 A;  3JAM Z;  4FAS D;  3ZR8 X;  4QPO A;  3VSK A;  5HDK A;  4A6E A;  4YEL A;  2ZBK A;  2VIX A;  2XKP A;  3AG4 H;  5TRD A;  1MBJ A;  3E97 A;  1RNL A;  1VTN C;  5J8F A;  1WVR A;  5ICF A;  1IW7 F;  2XAJ A;  1UG2 A;  1X4P A;  2DA4 A;  1VQ6 I;  5B66 C;  5E3M A;  2O0Y A;  4HEA 2;  1XCV A;  5CVR A;  3TQN A;  1E17 A;  1LJ9 A;  3H92 A;  2BE5 F;  1P7I A;  5CJ9 A;  3HOT A;  4DYQ A;  1MBG A;  4WXC A;  5FD6 A;  4P55 A;  1C0W A;  1U3E M;  2LNB A;  3JRA A;  5IYB J;  2PFB A;  1I39 A;  2DMP A;  2BEO A;  3DTK A;  4YFN F;  2DTZ A;  1MIJ A;  1ON1 A;  2EZI A;  1MH3 A;  2K9N A;  4M6Y A;  2AO9 A;  4L9V A;  3AAF A;  1HKQ A;  3A1Y A;  3NEU A;  1YQA A;  3HRM A;  2PMH A;  3KP7 A;  3R0J A;  4BXU A;  2EFP A;  3DV8 A;  5D8K B;  2L01 A;  3CQZ J;  2M1B A;  4E7Z A;  1AKH B;  1LFP A;  4RGU A;  2HQ5 A;  5J4Y A;  4C2U A;  4XID A;  3PUF A;  4KJZ A;  2KP6 A;  1K6Y A;  3PQK A;  3I54 A;  4P96 A;  5CYV A;  3O3K A;  1FPQ A;  2MSY A;  1BBY A;  2CW8 A;  3HDD A;  1D1C A;  3GTG J;  1IN6 A;  2VPL A;  3G1O A;  2ZFU A;  2KFD A;  2LP0 A;  2KRF A;  3X2Q H;  3JRB A;  1B9M A;  3ISP A;  2ZXW H;  4XL9 A;  3BR1 A;  3J81 Z;  2O7O A;  1N25 A;  1WI9 A;  1NK2 P;  3RJP A;  1YHQ I;  4J00 A;  3FXR A;  4LIT A;  1ETV A;  3FM5 A;  3CCY A;  1DQU A;  3A01 B;  3OR2 C;  3U9G A;  3HC7 A;  3JAM K;  1MZB A;  2BW3 A;  3AL0 C;  3DKY A;  1P4X A;  2F5D A;  4A3F J;  3DKW A;  3K4C A;  4RAG A;  3REO A;  3CF5 F;  2M0M A;  4PJM A;  2D1H A;  2VQL A;  4LG3 A;  5IP9 J;  2LRD A;  3QYE A;  5TIS C;  1X1C A;  4ON0 A;  2R7R A;  4IVN A;  2LKX A;  1R1V A;  1YRN B;  2KT0 A;  1ZTR A;  3KYL A;  1TW2 A;  2WAD A;  2KHM A;  4H4K C;  3PO3 J;  5KK1 A;  2Q8K A;  2BBY A;  1BOA A;  2RGV A;  5IYD J;  2LYC A;  1MBK A;  1Q1V A;  2LKP A;  3AKZ A;  2CUE A;  4M74 A;  2GOM A;  1U8R A;  3DBH B;  2LG4 A;  3NRV A;  3TW7 A;  2Y2Z A;  2V79 A;  4KIF A;  1TTY A;  3GFL A;  4MEY F;  3HPG A;  1REP C;  2NNN A;  3KPH A;  1R36 A;  1O3Q A;  4WK8 F;  3WU1 B;  3HZJ A;  1KZH A;  5HS8 A;  1OLT A;  2BXZ A;  1P7J A;  4D7N A;  2NVT J;  4P5O A;  2W25 A;  3W2A A;  2FRH A;  1U5T A;  2XF5 A;  2L7K A;  2HXO A;  2V9K A;  4UHT A;  3D5S C;  5DD4 A;  3NWT A;  4ZH4 F;  1QZE A;  2X51 A;  2DA7 A;  2ZME C;  1S29 A;  1ZR4 A;  1W5S A;  3M1C A;  5F04 A;  1A35 A;  2CQK A;  3HOZ J;  4A93 J;  4RM2 A;  1MSF C;  2WY8 Q;  1T98 A;  3QP6 A;  5A2Q Z;  3J81 K;  2MG4 A;  3OS1 A;  4E7H A;  1VF9 A;  1DU6 A;  2HI3 A;  4HAM A;  5D4S A;  1UEL B;  1ONV A;  2F4M B;  3GUD A;  5E8I A;  2K7L A;  1LE8 A;  1X1A A;  5E3N A;  3MN2 A;  2XSD C;  2QQ9 A;  2JWT A;  5KAI C;  2NVY J;  1FBS A;  4IRH A;  2P5K A;  2IP2 A;  5KCM A;  2L5Q A;  3PM1 A;  4BQO A;  4AC0 A;  1G8X A;  3K1P A;  3VFZ A;  1SFE A;  3E3V A;  1S9H A;  3UNG C;  4G7H F;  1SD5 A;  3LSG A;  4NC7 A;  2WWY A;  4FHT A;  4LOC A;  3TO9 A;  4G8X A;  3HSF A;  1FMV A;  1JUS A;  3ZRG A;  3MAJ A;  3FK6 A;  2XGC A;  1TQP A;  5TJJ A;  1B1B A;  1SFK A;  2XF7 A;  4HX4 A;  4XN0 A;  3GVA A;  4BAY A;  2XC7 A;  4ESJ A;  1S6L A;  1Y6I A;  4M3F A;  5LEJ A;  1R5H A;  2XPW A;  2Y69 H;  4L9T A;  1OIS A;  4F55 A;  3GCM A;  1O3R A;  1YG2 A;  4IHV A;  3DTI A;  2BZT A;  5IP7 J;  3I55 I;  3GTP J;  3OYD A;  1LDJ A;  2D5V A;  1YS6 A;  3A0H C;  1Z7L A;  4E70 A;  4XKV A;  3G71 I;  3RPU D;  4BQQ A;  2MD0 A;  1FIA A;  1T8I A;  4BBR J;  2ETH A;  2D1V A;  2DTR A;  5F27 A;  3UR3 C;  4BH9 A;  2XVC A;  3RZD J;  2D45 A;  5JFR A;  3MD2 A;  4D7M A;  1JKQ C;  2A6T A;  2P6T A;  4JX5 A;  4FE7 A;  4ZDO A;  1P4W A;  1Z6R A;  1JKP C;  1XGO A;  3H3V K;  5A2Q K;  2RV8 A;  3PJR A;  5DM6 F;  3F8C A;  1O57 A;  3PL8 A;  2STT A;  4BQN A;  4KFC A;  1Y1W J;  4I98 B;  4N0B A;  5BQT A;  1QHH D;  2VC0 A;  3KYC B;  1V55 H;  3ML6 A;  4X0G A;  1RI7 A;  3OYJ A;  1T39 A;  4UB8 C;  3FF5 A;  2QVO A;  1U5T B;  3ZN0 A;  3FXJ A;  3H9Q A;  2OTJ I;  2Y75 A;  3U1D A;  2QCO A;  2LDU A;  2LC2 A;  1DP7 P;  2DW4 A;  5FD5 A;  2O8K A;  4OMZ A;  1L3L A;  3KP4 A;  3CP8 A;  4ZYA A;  3H1C A;  2M34 A;  1MMS A;  1Y8Q B;  1SFU A;  4JQF A;  3S15 J;  2ZO4 A;  4II3 A;  4LGW A;  2MH9 A;  1ETQ A;  3BLY A;  3I71 A;  3F6V A;  5FFZ A;  2HYF A;  1XCB A;  1XSD A;  4F92 B;  1VQ8 I;  3CUQ C;  2G9W A;  2X0L A;  5C3E J;  1Y8R B;  3MKW B;  1LNW A;  2K85 A;  1ZLK A;  4A3E J;  1I1S A;  2K02 A;  2DU9 A;  1QNT A;  1S8N A;  1AHD P;  3N05 A;  1XD7 A;  3M4O J;  3OWT A;  4HYE A;  3QPL A;  4II2 A;  1LE8 B;  2E35 A;  4V19 K;  2R7F A;  3WOD F;  3S2H J;  2GQQ A;  4BBS J;  1I3Q J;  5KAF C;  5D6E A;  2FXA A;  1PP8 F;  1ZRC A;  3T5X A;  1HF0 A;  3WG7 H;  1EJ9 A;  2LY2 A;  2E1M B;  3LOC A;  5DUI A;  4HA8 A;  2RNG A;  2HDD A;  3S2W A;  5EZG A;  5FKK A;  3Q9S A;  4XON A;  1P9Q C;  1ZH5 A;  2YU3 A;  2FML A;  1XDU A;  4NHJ A;  2HOT A;  4L9J A;  4RAZ A;  2UXX A;  2VQH A;  2VUM J;  1GV5 A;  4BHP A;  5D5U B;  4MQ9 F;  3TDZ C;  1Y1V J;  1FOX A;  2VQG A;  3E5X A;  5F1R A;  2DBB A;  2OQR A;  1TL8 A;  5DCM B;  3OOU A;  2YR2 A;  3DBR B;  3F8N A;  3I4N J;  4OIR F;  2VOP A;  3PNY A;  3IUO A;  4AYB N;  1W1W E;  3PO2 J;  2VKV A;  4GRI A;  5ERI A;  4BEH A;  1HDD C;  1A36 A;  1ETX A;  1SMT A;  4PFO A;  2ZSI B;  1ZYR F;  3GTM J;  1A6Q A;  1YIO A;  3RDI A;  2BXY A;  1O7L A;  2H94 A;  2UV1 A;  4I01 A;  3TDU C;  3OSG A;  2KJB A;  4C3J J;  1TZL A;  3S32 A;  2GA2 A;  2QYO A;  1LEA A;  1XC5 A;  5CLS A;  2XAQ A;  1AOY A;  4KIS A;  1IDY A;  4U0W A;  4E6K G;  2VBY A;  3W6K B;  5LRS A;  1JJ6 C;  1NHA A;  3HOV J;  4CCL A;  3ZMS A;  5J3L A;  2ZXH A;  2EA2 A;  1X3W B;  2X6O A;  2CO5 A;  3PSF A;  3PIP F;  1ZAR A;  1XS9 A;  2M87 A;  2MBF A;  1LDD A;  1TWG J;  2HWV A;  4KIT B;  1SFO J;  1CGP A;  3DEE A;  1Z21 A;  4F3Q A;  5L3C A;  2O3F A;  1XMK A;  3CZ6 A;  2A07 F;  2G0E A;  1LEB A;  1HXD A;  1SD7 A;  1Y0N A;  3AG2 H;  4XNF A;  2RVC A;  3MWM A;  5E1W A;  1X4O A;  4IHW A;  1GV2 A;  4HF1 A;  2X6Y A;  2XAH A;  4LB6 B;  3S8P A;  3U1K A;  2GIV A;  1RKT A;  1GUU A;  2VKH A;  4M6X A;  5D6F A;  3S17 J;  1AU7 A;  3FBI B;  4YIR X;  2VJ4 A;  2C6Y A;  4PGH A;  2A68 F;  3LSM A;  4I7H A;  5M3F J;  2QQA A;  2R5Y B;  4EJO A;  3N4M A;  1KYW A;  2P7C B;  4YFX F;  3QP5 A;  4G7O F;  2K3F A;  4B47 A;  1ODD A;  3CC2 I;  1PYV A;  1SMY F;  4AUX A;  1MJ9 A;  4BE2 A;  1YOV B;  2MLK A;  4AIK A;  5HS7 A;  3WTZ A;  2EB7 A;  1R00 A;  3RPU A;  4A12 A;  4DZP A;  4IKF A;  4A3C J;  1GLN A;  3ABL H;  2XRL A;  2YUS A;  2P7V B;  2PQ8 A;  1R6R A;  1HQC A;  2CQN A;  1HW1 A;  5F64 A;  4S05 A;  3QOE A;  1VQK I;  1FNN A;  5FGM A;  4CCJ A;  4ZDL A;  2JVH A;  1XG1 A;  1MJB A;  3CCQ I;  5J1R A;  2QKM B;  4KIC A;  3LFU A;  3K4B A;  5DEQ A;  1YX3 A;  5DYM A;  3L7W A;  3RCO A;  4DIQ A;  2E2H J;  3BQZ A;  2KJC A;  3IV5 A;  1ZLJ A;  1DUX C;  5B5E C;  4CIC A;  4AIH A;  3U21 A;  5ICE A;  2M45 A;  2JRM A;  1KYZ A;  3RKQ A;  2O61 A;  3KP5 A;  1Z1D A;  3WTV C;  3H35 A;  3OYF A;  2WTE A;  2CSO A;  1BIB A;  3ZMD A;  2A5W A;  2H1K A;  5CVJ A;  2ELK A;  1KU2 A;  2CS3 A;  3GXO A;  4IRG A;  4G7Z F;  2DMN A;  1R9T J;  1WI3 A;  1VQ9 I;  1RZ4 A;  4XLF A;  1NH3 A;  3COA C;  1QQI A;  3QPT A;  4UXN A;  3KE2 A;  3BJO A;  2VOO A;  3J80 Z;  1OCC H;  2KIM A;  3ECH A;  3HUG B;  1DPR A;  4BHC A;  2M4G A;  2KDO A;  2V4J C;  4HX7 A;  5HOO A;  3O6B B;  5BMZ A;  1WZ2 A;  4GYI A;  2XB0 X;  5B3S H;  1CF7 A;  2EWN A;  3HOU J;  3PSI A;  4Q47 A;  1ON2 A;  3VPR A;  2EFO A;  2EJR A;  3HTS B;  4AD9 A;  4OIP F;  2AQE A;  4D1Q A;  2Y48 A;  1ZAO A;  3VB2 A;  4CGZ A;  5L3F A;  5E1X A;  1JI8 A;  1A5J A;  2LBF A;  2EIK H;  3RKW A;  1OFC X;  3DLL F;  2E60 A;  4E7L A;  3EUH A;  4HDV A;  2K9S A;  2VXD A;  1D8J A;  1RR7 A;  3C2B A;  3BZ6 A;  2PEX A;  2CUF A;  3Q0U A;  3OSF A;  1SD4 A;  1WJE A;  2NRA C;  2CW7 A;  2XRO A;  4CCK A;  5LD2 C;  2FU4 A;  2DMQ A;  1K7A A;  1VZ0 A;  2RN7 A;  2L2O A;  4Q5S F;  3CCM I;  1OQY A;  3A2K A;  2JRT A;  2Z16 A;  4ABZ A;  2JT1 A;  3IH3 A;  2E71 A;  5L3E A;  1JKR C;  1IGN A;  2A3S A;  4AID A;  1W4M A;  2D2W A;  2W00 A;  4MO7 A;  4U0Y A;  3HEF A;  3KP2 A;  1R4M B;  2MC4 A;  3BZC A;  3Q0W A;  1JGG A;  1R1U A;  2H6C A;  3F72 A;  3H36 A;  2LK2 A;  3F6O A;  3OR1 C;  4A3B J;  1BI2 A;  2MA3 A;  4FQG A;  1OR7 A;  1OCT C;  2X6X A;  1MBF A;  3C2G A;  2V1N A;  2R4G A;  3G3Z A;  2KZG A;  4OWR B;  1Z0X A;  2L4M A;  3OL3 A;  4CXF A;  3J7A Y;  2VBZ A;  2HPI A;  4IHX A;  2DDB A;  4W97 A;  1FOW A;  1XDS A;  1R22 A;  3LMM A;  4IHS A;  4XKW A;  3BPV A;  2UZK A;  2DMU A;  1J59 A;  4GCV A;  2Y0M A;  2LH9 A;  4BS9 A;  2P6S A;  3HSR A;  4CYC A;  2R7T A;  3K70 D;  3K2Z A;  2XAG A;  4A0Z A;  4A69 C;  1HDP A;  4IZZ A;  3BJ6 A;  3FXK A;  1HKT A;  3MZH A;  2Y0S A;  5GAD J;  3J80 K;  2V26 A;  4BKX A;  4IEJ A;  1D0Y A;  1W7P B;  1X3Z B;  2ZNY A;  3GW2 A;  3LAP A;  2ICW G;  5F0H A;  2KIS A;  3ESW B;  2EIM H;  3C7J A;  4OIQ F;  3RIR A;  1I50 J;  1OYW A;  4HPQ A;  1B9N A;  3RQ4 A;  4BJ6 C;  3MQ0 A;  3WU0 A;  4IHT A;  1JUP A;  1MKM A;  3L2R A;  1MW7 A;  2L7F P;  4PZJ A;  3T8T A;  1ZG3 A;  2ISY A;  3E5Q A;  3ZP5 A;  2CFO A;  3LSH A;  2QZ8 A;  3DXJ F;  2IGN A;  3ASO H;  4O6J A;  1YIT I;  3I4M J;  5ED4 A;  1W5C C;  1J09 A;  2OD5 A;  3WE2 A;  1U6G A;  1S7E A;  2DOD A;  3I64 A;  4MGR A;  1N75 A;  5GPC A;  3VWB A;  2QGU A;  2JSC A;  2V7F A;  2OCE A;  4L0Z B;  2HKO A;  4FT8 A;  1BJA A;  3L1P A;  3ZOB A;  1LDK B;  2W85 A;  1OCZ H;  3DPU A;  4P9F A;  2DOA A;  2IGK A;  2KQR A;  1LPQ A;  5J1Y A;  2KKO A;  1VI0 A;  5CVI A;  1X19 A;  2FBI A;  1FYK A;  3M9A A;  4CZC A;  3KLN A;  1E3P A;  2CV2 A;  4OIO F;  1CF7 B;  4NDL A;  4XLA A;  3F8B A;  1SAN A;  1SFX A;  2GWR A;  4HRI A;  3BR5 A;  2IA0 A;  2A5Y B;  2N8G A;  5J47 A;  2DFI A;  4IXA A;  3MEX A;  1IUY A;  2LBF B;  4B48 A;  1ETK A;  3P9C A;  4I2O A;  2Y0S N;  3G1L A;  3HYI A;  3Q3S A;  2EV0 A;  3H0G J;  5ILU A;  2CQ7 A;  2F5F A;  3FXO A;  3O8G A;  2PMU A;  1MGT A;  2LF7 A;  3K4K A;  1OYY A;  2IA1 A;  3GFJ A;  3K4N A;  4P9U A;  4XR6 A;  5KNL A;  3ABT A;  2EFW A;  1APL C;  4BE0 A;  1YX5 A;  2IGO A;  4E4H A;  3OYM A;  1VQP I;  3ONQ A;  4XLE A;  4FX4 A;  3MKY B;  3DTE A;  2AHQ A;  3J7Z I;  5F0C A;  1AA7 A;  2WC2 A;  2F48 A;  2GZW A;  3VYR B;  2JA7 J;  2K9Q A;  3BG9 A;  1ZHF A;  4L5I A;  1JT6 A;  1XMA A;  4EJV A;  3F21 A;  3SYT A;  5HLG A;  4M73 A;  4A3L J;  2HNH A;  4U87 A;  3CD6 I;  1IO2 A;  4M71 A;  4BDY A;  3AFH A;  4ASN A;  4IRI A;  2JJ7 A;  2W57 A;  3GX4 X;  4K2E A;  4RAF A;  1HLV A;  2IAI A;  4PJJ A;  4CYC B;  2PI0 A;  1QO0 D;  2DOE A;  3RPQ A;  3TO7 A;  5EGO A;  1ITY A;  2Y31 A;  1XTA A;  1TWC J;  2FOK A;  1GHC A;  1BR2 A;  2VON A;  3KEO A;  2X1C A;  3A03 A;  1HW2 A;  4IF4 A;  1QRY A;  4PGG A;  3M8J A;  2PJP A;  1R23 A;  4YFK F;  1F4K A;  2XF6 A;  3R60 A;  4HSR A;  3GTJ J;  2BHY A;  4UV8 A;  1RUN A;  4KNY A;  2PMZ A;  1IAW A;  1J0R A;  4F91 B;  4M6V A;  3EET A;  2YPR A;  3TP3 A;  4LB5 A;  1LFU P;  2GA1 A;  2OBP A;  2E1O A;  4F7Z A;  2DI3 A;  2QSG X;  1UG0 A;  5LHG A;  1K4T A;  3CJN A;  2R7W A;  3L2Q A;  2GM4 A;  2DYR H;  3CUO A;  1YTY A;  1EF4 A;  5K5R A;  4IO9 F;  1W36 D;  4C2M J;  3PFY A;  2ID3 A;  3WTW C;  1MD0 A;  3CO7 C;  2I5U A;  1GT0 C;  1BIA A;  2M0C A;  4XOP A;  1P92 A;  1O7F A;  1HKS A;  4WCG A;  2HDC A;  3M1E A;  3SXY A;  2QSH X;  3IRQ A;  1ZGW A;  2BHZ A;  1YFH A;  4DBR A;  2KMU A;  3M8F A;  1JGS A;  3WTU C;  1QPM A;  3CJQ B;  4R8H A;  3GO5 A;  1B4A A;  3OS2 A;  4QWQ A;  3B02 A;  3HSE A;  2RQQ A;  2CU7 A;  3WE3 A;  1KQ8 A;  5H20 A;  3FDY A;  2QBY A;  4XOT A;  2AXT C;  5L3B A;  2DA6 A;  1WKM A;  3CLO A;  4C3I J;  4QSH A;  3BOQ A;  4EEF G;  2ZJQ F;  1DP3 A;  1EH6 A;  1WGX A;  2BVM A;  1R5G A;  2F5E A;  2HTJ A;  1ZR2 A;  2DPD A;  5ILS A;  3L2U A;  1WH5 A;  1VQ5 I;  2RNJ A;  2EV5 A;  3A4C A;  2LVS A;  3QU6 A;  1MBH A;  1YO5 C;  3HB9 A;  2X85 A;  4M3D A;  2PMZ N;  3KCC A;  1D3Y A;  1TWF J;  2HTS A;  1Y56 A;  1HA8 A;  2P0W A;  3QPS A;  1EH8 A;  3G4S I;  1HBX G;  1IF1 A;  2H27 A;  2IT0 A;  3N97 A;  5D5W B;  1JUM A;  3FK7 A;  5FRN A;  5HLI A;  3LNQ A;  3HJE A;  4CHU A;  1FMW A;  2L9S A;  2PX9 A;  1WJA A;  2UXN A;  4CH7 A;  1U8B A;  4XRM A;  1X1P A;  4IPA A;  1J75 A;  1ZK8 A;  1ZKG A;  2A6E F;  2WB1 A;  3L9F A;  2I10 A;  5DCM A;  2VJ5 A;  5DCF A;  5JLW A;  1H8A C;  5IPA A;  1LB2 A;  3B6A A;  3V8K A;  1FJL A;  1IXR C;  3OIQ A;  3JSO A;  4P1W A;  2JA6 J;  1KQ0 A;  4ZDP A;  3E6B A;  1G4D A;  2MLG A;  3KZZ A;  1UST A;  4I0A A;  2OTL I;  5C44 J;  1WHU A;  3E6M A;  3K4M A;  3BTC A;  4M3B A;  2QM3 A;  5FB2 A;  4KDP A;  2VKE A;  2DA5 A;  5B1B H;  5EG0 A;  1FWZ A;  4DW6 A;  5EGO B;  5IT9 Z;  3HGY A;  4M72 A;  1F1Z A;  2FBK A;  2Y9Z A;  4H0E A;  4DNC A;  1KGS A;  3HG9 A;  4X6A J;  3FBN B;  4HF2 A;  3SZP A;  5FLX Z;  1G59 A;  2YU9 J;  1FSE A;  2FQ4 A;  3NQO A;  4OMY A;  2NOG A;  1XGN A;  4XSX F;  4RA2 A;  5GAE J;  1RES A;  3S93 A;  2ESN A;  4WXH A;  4LJZ F;  2F5V A;  3PNV A;  5EJC A;  2WAF A;  1YI2 I;  4BGD A;  3OYE A;  2FOW A;  1PUF A;  1KQ9 A;  2HQN A;  1W7P D;  4QLC U;  2NS7 A;  4ZTF A;  1VQL I;  2WV0 A;  4Y33 A;  1QVT A;  4XK4 A;  4L0Y B;  3NWS A;  4XLP F;  4E7S A;  3GTQ J;  3MKZ A;  5FRO A;  2V1U A;  1BI1 A;  1RRJ A;  1FYL A;  2I8D A;  1K4S A;  3LWF A;  2WB1 N;  3R4K A;  2LLK A;  1V4R A;  2O9L A;  2IPQ X;  4X1E A;  2L02 A;  2ACJ A;  3GFM A;  4HNV A;  4JP0 A;  3ZQ7 A;  3IH2 A;  4IHY A;  3CMM A;  3GWZ A;  3DEW A;  2MD5 A;  1P6R A;  2GBY A;  3ZMZ A;  2B0L A;  3JW4 A;  2R5Y A;  1EKE A;  2DK8 A;  3L09 A;  2PBI A;  2QBY B;  2XKO A;  3BT9 A;  3OYH A;  2K3P A;  4EVI A;  5DV5 A;  4XOR A;  4XIC A;  2DYS H;  6PAX A;  2E1C A;  4Y3O A;  2DFH A;  3I5U A;  1OMI A;  4UUS A;  1HCR A;  1I6X A;  4G6Q A;  2R3S A;  3FIW A;  3HOX J;  2DOF A;  2WA0 A;  1I5Z A;  3L2W A;  5JVG F;  1VQM I;  4I09 A;  1YJ9 I;  3CCE I;  3TKY A;  1BN5 A;  2ADU A;  3CLQ A;  1I1G A;  3FMR A;  1FTZ A;  1KON A;  1PJR A;  2YSR A;  3ABU A;  3V8L A;  2VE9 A;  1FC3 A;  2VJJ A;  2OZ6 A;  3BPX A;  1QHG A;  3D0S A;  1WRJ A;  3GBG A;  2IA2 A;  2L9V A;  2OA4 A;  3AG3 H;  5CQG A;  1X3U A;  4U7B A;  5FO5 A;  3ZQQ A;  4LK0 F;  4ZTJ A;  5BOX A;  2K4J A;  3WTY C;  2VT3 A;  1ULY A;  2KLO A;  3H9G A;  2HXI A;  2IS1 A;  1RUO A;  4NQW A;  4CUG A;  4PSX A;  3Q9V A;  1U9N A;  4EMS A;  3VOE A;  3E7L A;  1FZP B;  2Z1D A;  4ZYG A;  5D4R A;  1ZRE A;  2Z9O A;  1D1B A;  4C30 A;  1YW8 A;  4NC6 A;  4ENK A;  2CRG A;  1F5T A;  3HGG A;  2PN6 A;  4GDF A;  2E19 A;  2WBM A;  3S1N J;  1KA8 A;  1IRG A;  1IC8 A;  1WWX A;  1UJ8 A;  2WY7 Q;  4NUB A;  3CCS I;  2A69 F;  2ZSH B;  5JHF A;  5JHU A;  1HC8 A;  5EG0 B;  3JR9 A;  5K5Q A;  1IUF A;  3BQY A;  1FTT A;  3H3U A;  3OYG A;  3SJM A;  4F52 A;  3VYT B;  2P81 A;  3A0B C;  4B3A A;  4UUV A;  1ERD A;  3GLL A;  3I9V 2;  1Z7U A;  5E8G A;  2ZC2 A;  3ULQ B;  4WF2 A;  2F4I A;  3HUG A;  2M4K A;  1XGM A;  3I4P A;  3ZN1 A;  1V3F A;  2COB A;  2FBH A;  3WGI A;  1MMN A;  3BR2 A;  3BP8 A;  1Z05 A;  3M7G A;  4L5E A;  2RKH A;  1PUF B;  4RDU A;  1LVA A;  1FOK A;  1RIO H;  3OYK A;  5HNH A;  3FKI J;  1MMG A;  2JUC A;  2ZME B;  2MYS A;  3SZT A;  2QF7 A;  1JHH A;  5HLT A;  1T33 A;  2DDA A;  3WGG A;  4AVP A;  4G94 A;  3TOA A;  1FP2 A;  1L0O C;  5BS6 A;  3G6E I;  2R7Z J;  2DT6 A;  4OAY A;  2RAE A;  1J2X A;  3IKT A;  4B43 A;  3JRH A;  2CJJ A;  2BV6 A;  3G2B A;  3OOP A;  4LLG F;  4Y13 A;  2MGQ A;  3BG6 A;  1DPU A;  1A6I A;  4HDU A;  3OL4 A;  5AON A;  3VOD A;  2K5C A;  2CWE A;  2YX7 A;  3IH4 A;  4HNT A;  2KIU A;  3DEU A;  5M5Y J;  2PJR A;  4Z6Y A;  3HHG A;  4EQQ A;  4JOM A;  2TCT A;  2GXB A;  4A0X A;  2AS5 F;  3DBL B;  2A05 A;  4Y4R A;  1JT0 A;  2KL4 A;  2F6C A;  4G9Y A;  5M5W J;  2OC6 A;  2HVQ A;  1X1D A;  3H0D A;  3HOW J;  4UVB A;  1MSE C;  2IVM A;  5EZH A;  3KLO A;  1J7K A;  2FNP A;  3RKY A;  1FY7 A;  3EUH C;  1K78 A;  2HZT A;  4MNU A;  3K0L A;  5E3L A;  3T0Y A;  2HOA A;  3V42 A;  1I3A A;  4UUS B;  4XLN F;  4MHG A;  3FXQ A;  3RZO J;  1LKX A;  4Z2Y A;  3ERE D;  2L4A A;  1WJB A;  5J40 A;  3ZXS A;  2CYY A;  1G3S A;  5ILV A;  4BU2 A;  3CCU I;  4HV6 A;  3JRC A;  1YYV A;  4RGS A;  2F2E A;  2XHK A;  2L9R A;  2VJI A;  3WTT C;  3OIO A;  3ZGK A;  1WCM J;  3CDI A;  1W7P A;  2HVR A;  2ZKZ A;  2QA4 I;  3BTJ A;  4XRF A;  2P4W A;  4NQW B;  2B9S A;  1OKR A;  4B44 A;  3FXM A;  1R71 A;  1OR7 C;  1P4A A;  3Q0V A;  4PJN A;  3P9K A;  2HKX A;  3LQR A;  4A3G J;  1IN8 A;  1R49 A;  2X9D A;  5GTI C;  4XRS G;  5GAG J;  3S1M J;  1RKW A;  4MIM A;  1OPC A;  1MH4 A;  2QEX I;  4IX7 A;  3QQA A;  1TLH B;  3BZK A;  3GZN B;  5M5X J;  2E7X A;  2RC4 A;  2G7H A;  1D1A A;  3CME I;  4Y7N J;  3H5N A;  4ETS A;  3CCV I;  2DAO A;  2XAS A;  3QOD A;  4ZYH A;  1ZG1 A;  3BJA A;  3SEQ A;  4KMU X;  5EDN A;  1WFX A;  3ABK H;  4KIG A;  2VXZ A;  2X1E A;  4HW0 A;  2M2E A;  5EYR A;  3EUK L;  2AXL A;  1D5Y A;  2JA2 A;  3H5R A;  3ZQG A;  4HOB A;  3LST A;  1BOB A;  3KYD B;  4BYY A;  3K7A J;  1FP1 D;  4N9I A;  5AIQ A;  2OCC H;  3JRI A;  2DLL A;  3TBI A;  1S7O A;  3MCZ A;  1SD6 A;  3PIO F;  2VLA A;  2NS0 A;  1W0T A;  3O8H A;  2W48 A;  4LIU A;  1XSX A;  3D5R C;  2EZL A;  5FRM A;  1Z67 A;  1TQI A;  5CVU A;  4HLX A;  1JE8 A;  3W2V A;  2JZY A;  1RPW A;  3V7S A;  2DFE A;  2W82 A;  4DOZ A;  4FTH A;  2JN6 A;  2EA4 A;  4V2F A;  3U2R A;  2H09 A;  2OZU A;  4D0P A;  4XQF A;  2JPB A;  1Z3Y A;  2V9V A;  2QSF X;  2Z2S B;  3CUQ B;  3LQQ A;  4TV7 A;  3M07 A;  4CCO A;  3S3N A;  4HLY A;  4YG2 F;  5K7F A;  3RTR A;  3D5L A;  5JI6 A;  2HFH A;  4OU0 A;  3ZMT A;  2PJR B;  2DT5 A;  1RET A;  1G6N A;  4KYW A;  5F08 A;  1BR1 A;  2WAE A;  3FZV A;  2X4H A;  3TMO A;  5FLM J;  2R7S A;  2M30 A;  1MDM A;  4KN7 X;  3CES A;  2DK5 A;  1BC7 C;  4E7J A;  3LL7 A;  2XDV A;  4NB5 A;  1K78 B;  5FKO A;  4U7D A;  2XPU A;  1FX7 A;  1VND A;  1SVL A;  2BY3 A;  2HQA A;  2ZXI A;  5KHD A;  2VL8 A;  3DQV C;  5EEH A;  3GZ6 A;  2ZJP F;  1JHF A;  3R6S A;  2EV6 A;  2EIL H;  3C1D A;  3BG3 A;  1SAX A;  2QQB A;  1QZZ A;  2OU2 A;  2QWW A;  4IL6 C;  2FD5 A;  3DPT A;  2QEN A;  1VQO I;  4GFB A;  1K6O A;  2CV1 A;  4J01 A;  2HS5 A;  1IXS B;  1UHM A;  3TO6 A;  2HDW A;  2KZV A;  2Z3Y A;  2EH3 A;  1A31 A;  4R79 A;  4N4O B;  5E20 A;  2M3A A;  1OCP A;  2LRE A;  5BPD A;  3TOB A;  2VE8 A;  3B73 A;  3KP6 A;  2K4B A;  2FUG 2;  2GIZ A;  2JK3 A;  3P5J A;  1Y39 A;  3D1N I;  4DGW B;  2ZNZ A;  2E36 A;  1Z91 A;  2OF7 A;  3DF8 A;  4CZZ A;  1MJA A;  2XGX A;  2O6G E;  3RYP A;  3ELK A;  2NNY A;  4ENN A;  2EZH A;  1IV6 A;  1BW5 A;  5FKN A;  2O03 A;  3DKX A;  2XPV A;  4KIB A;  1ORK A;  2QQ8 A;  4M9Z A;  1ZG5 A;  2M8G X;  2FMY A;  1UMQ A;  3F9K A;  1T95 A;  3CDL A;  1RC9 A;  2R92 J;  1H88 C;  1D0X A;  4A6D A;  1H0M A;  1BM9 A;  2IW5 A;  2LR8 A;  1MNE A;  1GXQ A;  4I76 A;  4GO1 A;  2ZXJ A;  2IBD A;  1NG7 A;  1D0Z A;  1TW3 A;  5HS9 A;  4CCN A;  4DYR A;  1BC8 C;  4PSW A;  3EUA A;  1FT9 A;  1HST A;  2DT7 B;  2XGD A;  3K6G A;  2KIF A;  2OJE D;  2VBX A;  2HYJ A;  2W4S A;  3IHU A;  2W84 A;  1JTY A;  1H89 C;  4LFU A;  2M8E A;  5IY5 H;  5H6R A;  3HOS A;  5IP6 A;  5D5X B;  2RDP A;  4YII A;  5K7H A;  3JRE A;  1A04 A;  2LKS A;  1BI0 A;  4R1H A;  2MH2 A;  1WJF A;  5LHI A;  2HOE A;  4GGG A;  1XMX A;  5AIP A;  2CG4 A;  4PK4 A;  1DGW Y;  2CUJ A;  2E34 A;  4EJU A;  5F0F A;  3SHF A;  4QPQ A;  2VQC A;  2GLO A;  1QBJ A;  1OYI A;  1D8K A;  1R7J A;  4MFD A;  5H6Q A;  1XPX A;  4WXD A;  1U5T C;  4GYG A;  2Y30 A;  3BTI A;  1GVJ A;  4O5V A;  4PUS A;  4EAT A;  3CJT B;  2P5L C;  3RYR A;  4M3E A;  3WHC A;  3CTA A;  2E1N A;  1QPI A;  3CP2 A;  4I02 A;  1EA3 A;  4ITV A;  1Q1H A;  3FM3 A;  1SVM A;  4ESB A;  1STZ A;  3HXL A;  2FNA A;  3O2P E;  2FA5 A;  4B8X A;  1QVU A;  4B3X A;  1R4N B;  3IWZ A;  1E2X A;  1X2M A;  3ZMV A;  4RBO A;  1FOY A;  3E0J B;  3S2D J;  1MDM B;  4RB2 C;  2NXN B;  2R7D A;  3K4L A;  4EGZ A;  5L3D A;  1TP4 A;  4G12 A;  4OIN F;  4BAC A;  2ZFW A;  5BNG A;  2YS9 A;  3ZQH A;  4L18 B;  3E6D A;  3DCF A;  3G1M A;  3K70 C;  4J19 A;  4C2T A;  1MBE A;  2NS8 A;  3DWL E;  1T08 B;  3EDP A;  3ERM A;  1LQ1 A;  1IDZ A;  3BG5 A;  3WGH A;  4FCY A;  1MMD A;  4A2U A;  4BHB A;  5LFA A;  1UB9 A;  4RMN A;  3Q5F A;  3BCA A;  1VQ7 I;  3GFI A;  2X48 A;  1ETO A;  2E1M C;  4HQM A;  3CCJ I;  3I59 A;  3C18 A;  4LD5 A;  1YS7 A;  2ZJR F;  1ACI A;  1U9O A;  5K5O A;  1Z9C A;  4RM3 A;  4BY1 J;  2P8T A;  1T0F A;  2ZB9 A;  4PFP A;  1OJL A;  4CCM A;  1IRX A;  1IV8 A;  2OAZ A;  2CMP A;  4DZJ A;  5L3G A;  1U0J A;  2FQ3 A;  5JR3 A;  3KEY A;  1TQM A;  3DP7 A;  5E1Z B;  2EFN A;  2OUM A;  3CMY A;  1IN4 A;  5HDN A;  2VT2 A;  2H8R A;  3GME A;  4ZYE A;  4HZF A;  2B7E A;  1ZGJ A;  3LFK A;  1SC7 A;  3QWL A;  4G6T B;  3GEZ A;  3ECO A;  3OIP A;  5LHH A;  2UUZ A;  1TWA J;  2Z33 A;  2ZCW A;  3F0C A;  3OYA A;  1W0U A;  2L7Z A;  1VFC A;  4I0B A;  3GYH X;  3K1M A;  3GTO J;  2IS6 A;  1JXS A;  4IQJ A;  1E3O C;  3WHB A;  1V54 H;  4KA4 A;  2FX0 A;  3BG7 A;  4EV0 A;  4NC8 A;  1S3J A;  3WTX C;  3HRS A;  3QRF F;  4BJT A;  2LOO A;  1WH7 A;  3KP3 A;  1KU3 A;  2DQL A;  3VYS B;  5HOD A;  2Y9Y A;  3K1N A;  2JTV A;  1MMA A;  3BWG A;  3HHH A;  4D5C A;  3GTL J;  4EM2 A;  4ENJ A;  2EBI A;  4HF0 A;  2DFF A;  2GXG A;  5M3M J;  3QYB A;  3ZPL A;  2MFZ A;  3V4G A;  4UNO A;  4OAZ A;  5CPR B;  3SFZ A;  4BY7 J;  2GAU A;  1U2W A;  3PQJ A;  4HG2 A;  4JK1 X;  3OYL A;  3OMY A;  1O4X A;  1QGP A;  4LIV A;  4DJA A;  5CVV A;  4A0Y A;  3WTS C;  3JCU C;  4FX0 A;  4ZC3 A;  3EPZ A;  4BNC A;  2NVQ J;  4KT5 C;  3I3L A;  2NVX J;  4RGR A;  2PG4 A;  4L5J A;  1ENH A;  4I6Z A;  3FXU A;  1JTX A;  3QPH A;  4RS8 A;  1VQ4 I;  5HVQ C;  3HKZ A;  3BTL A;  1HOM A;  3W6J B;  4Q48 A;  1FIP A;  2NOJ B;  4XLC A;  1V5G A;  1LFB A;  5CKT A;  2V6C A;  4PJL A;  3J7Y J;  3H5A A;  3BR6 A;  1M1E B;  2QUF A;  1F43 A;  3V7C A;  4HNU A;  2L54 A;  2M5W A;  3IWF A;  3SFI A;  4ZZL A;  1G3Y A;  1UFM A;  3CCR I;  5H2F C;  4A3I J;  2ESH A;  3QYF A;  2PLY A;  3RI4 A;  2Q0O A;  3MVP A;  1P2F A;  3QAH A;  3TGN A;  2HYG D;  2HZD A;  4UUT A;  2X6W A;  3IC7 A;  3P7N A;  3K9T A;  5DUK A;  5K1Y A;  1QA6 A;  5J6X A;  4HQE A;  3GLX A;  4BL0 B;  1OCO H;  4ZZD A;  5DD8 A;  2RQP A;  3I59 B;  4A3M J;  4DQ2 A;  2JMW A;  2DMT A;  3IP4 B;  2HOS A;  3V8J A;  1J5Y A;  3DU5 A;  3F8M A;  1K79 A;  4PJ0 C;  5GAH J;  2ELH A;  3KIO A;  3E1S A;  1R58 A;  4L9N A;  1N77 A;  2QLZ A;  2VKD A;  5GPA A;  2R0Q C;  2E5N A;  2L9N A;  5ICC A;  2DCE A;  3P9I A;  2JQ7 A;  3VEP A;  3QU3 A;  1PDN C;  2BW3 B;  1POG A;  3LAJ A;  4ENM A;  2CQX A;  2OQG A;  3OYB A;  1USS A;  1W36 C;  1YLF A;  5DDG A;  5LLQ A;  4N4N B;  3H9J A;  1O3S A;  3C3W A;  1XGS A;  3FMS A;  3BR3 A;  2FE3 A;  1JKO C;  1NTC A;  3HKZ N;  2LMD A;  2JPC A;  4IJA A;  2EQR A;  3SDG A;  5IT3 A;  3IAS 2;  3PUB A;  4M9X A;  4NNJ A;  3GTK J;  2ME6 A;  1ZEL A;  2ZME A;  2VB6 A;  2MAB A;  1KU7 A;  4DYC A;  1IZ1 A;  2A6H F;  3QOP A;  4RB1 A;  4PCQ A;  1B6A A;  4D9J A;  2ELJ A;  4XN3 A;  4A5N A;  2L0K A;  3LSP A;  2BVL A;  3JRF A;  2DJI A;  2DA2 A;  1FBU A;  3EYY A;  5E17 F;  3S3M A;  2OPT A;  3FHZ A;  2F4O B;  2Z99 A;  1X2N A;  3JSP A;  3OS0 A;  1PVE A;  2HGC A;  2E5Z A;  3C2H A;  4GXO A;  4MFE A;  1K61 A;  2O5R A;  2FEZ A;  2JA8 J;  5JLX A;  2CUZ A;  3W6V A;  1RR8 C;  4XRS A;  1UCR A;  3FKJ A;  4QTR A;  1I27 A;  1WPK A;  4BDZ A;  2IS4 A;  4U0V A;  4M3G A;  2JSP A;  2XSJ C;  1DU0 A;  3NAR A;  4A5M A;  4UVA A;  4O3M A;  2VAS A;  5JVT A;  3R61 A;  3K10 A;  4AYB A;  3FMQ A;  5FLV A;  1O3T A;  2F5C A;  3A02 A;  2O8X A;  1T56 A;  2LY1 A;  3KFW X;  1ZGA A;  5E3O A;  2KIQ A;  2IEK A;  2WV1 A;  3TL4 X;  4CYD A;  4HV5 A;  3IAM 2;  1G3T A;  4HST A;  1K83 J;  1G3W A;  2W1O A;  1GDT A;  2HVS A;  2NVU B;  2KDZ A;  4Y52 J;  1R5I D;  1V5F A;  3HTU A;  4JX6 A;  1T6S A;  3L2C A;  1WQ2 A;  4YRV A;  4EGY A;  5BPI A;  2ISZ A;  2JA5 J;  4A3J J;  5B1A H;  5IT9 K;  3K2A A;  3TW6 A;  2W7N A;  1T2K A;  2R7Q A;  4F93 B;  3KZY A;  2BGC A;  5DM7 F;  2R93 J;  2NAZ A;  4XSZ F;  5KVR A;  5FLX K;  4BXX J;  2VI6 A;  1U78 A;  2TRT A;  3EYI A;  3FIS A;  3WG9 A;  1DGR M;  5TGT A;  3AL0 B;  3CJR B;  2Q2E A;  2DA1 A;  4B1R A;  3WU2 C;  3JRD A;  3F23 A;  2K27 A;  3LSI A;  4Q4Z F;  2V1X A;  1UHW A;  3OYI A;  1IJW C;  2B63 J;  2Q1Z B;  5LBQ A;  2IRF G;  3DLA A;  1B59 A;  3BC8 A;  1WJC A;  4D5F A;  2FSW A;  4XBF A;  1H9T A;  4WX9 A;  2E7W A;  4E7K A;  3V7R A;  4AVZ A;  4NBQ A;  2HU9 A;  1YE9 A;  2R5Z A;  2EIN H;  2KPM A;  1TT0 A;  1R1T A;  3LA2 A;  3AG1 H;  4MQV A;  2K40 A;  4B4C A;  2ME0 A;  3RSN A;  1BA5 A;  1E0E A;  3HPH A;  4MTD A;  5FFX A;  3JRG A;  4W1U A;  2W24 A;  2VOD A;  2XIG A;  3CO6 C;  4MLO A;  1IRZ A;  1YJW I;  2J5O A;  2MC3 A;  1LUJ B;  1TNS A;  4BUP A;  4JX4 A;  2DJN A;  2HR3 A;  3CF2 A;  3EQL F;  2LD5 A;  2ECB A;  3VSL A;  2HPM A;  3W3C A;  3VDX A;  2E2I J;  3S16 J;  5C4J J;  2CH0 A;  3BR0 A;  2CQQ A;  3CUQ A;  2XUB A;  5D8L B;  4C9Y A;  1BI3 A;  3BY6 A;  4S04 A;  1CQT A;  3T8R A;  1S5L C;  4RB3 C;  1B8I A;  1AWC A;  1XB4 A;  2CFX A;  3ROU A;  2EK5 A;  2RRE A;  3F8F A;  3H3Z A;  4ANJ A;  3MMY B;  2ECC A;  3K69 A;  3SQN A;  4CO8 A;  1UAA A;  1IRF A;  1NK3 P;  2G7U A;  5LGT A;  1EV7 A;  2V9P A;  5F6F A;  4RAY A;  1IG7 A;  2VBW A;  5J8C A;  3OY9 A;  1BJZ A;  4I99 C;  4Y15 A;  4E7I A;  4YIF A;  1FLI A;  2P5V A;  3S1Q J;  3CCL I;  1IN7 A;  3IKV A;  2KRC A;  3T1B A;  5C4X J;  1W5T A;  1ZRF A;  3FHN A;  5IOZ A;  1S72 I;  1YJN I;  3B6C A;  5HLH A;  1GXP A;  2K9L A;  1TT5 B;  1UHS A;  2HQR A;  3CDH A;  1XSV A;  1JJ8 C;  3L00 A;  2GOX B;  5LGU A;  1ETY A;  2YX4 A;  2H6B A;  4EJW A;  2VC1 A;  3RKX A;  2OV7 A;  2AQF A;  3DFG A;  2IS2 A;  1QU3 A;  1MND A;  2R7U A;  3ZQC A;  1IXC A;  2BY1 A;  5GP9 A;  2DXI A;  1WSU A;  2XAF A;  1SAU A;  2R7O A;  5F1J A;  3ABM H;  4EJT A;  2COM A;  3HM5 A;  4OOI A;  5ICG A;  2LF8 A;  3FWE A;  2M7B A;  3E6C C;  5LRR A;  4IQ4 A;  2L3D A;  5HDG A;  2Q2E B;  3F22 A;  2DPU A;  3KZI C;  3HOY J;  2LFB A;  1Y0U A;  5DS9 A;  2VN2 A;  1Z77 A;  3F3X A;  3M8E A;  3ZQF A;  2XV4 S;  1H9G A;  4RGX A;  3HIF A;  4ESF A;  3R0A A;  1ZQ3 P;  2E2J J;  4AM3 A;  1S7A A;  2QKL B;  4S0H B;  4EM1 A;  2WAQ A;  1VQN I;  1YIJ I;  4LG0 A;  1X58 A;  4CSW A;  2HEO A;  4XKC A;  3M3Y J;  2R5Z B;  4JBA A;  3ZCO A;  2MW8 A;  1WJ5 A;  4KUM A;  4BEH B;  1PP7 U;  3MFK A;  4N9H A;  1B72 A;  1I6H J;  2IGM A;  1G2H A;  5FJ8 J;  5LGN A;  3E5U A;  2XGE A;  1ZRD A;  2ZJ2 A;  2K86 A;  3HRU A;  4FE4 A;  2JVG A;  5EF6 A;  1J9I A;  4JYK A;  3ZMU A;  3HRT A;  3LA3 A;  3PNT A;  1YW7 A;  2FF4 A;  3LA7 A;  3CC4 I;  4EM0 B;  4A3K J;  5IOY A;  1TBX A;  4B09 A;  5GTH C;  4LLL A;  4MEX F;  1FEX A;  4KN4 X;  3OYC A;  3L2V A;  5E18 F;  1E3H A;  2Z5U A;  2BY2 A;  4BXF A;  2BY0 A;  2XRN A;  1UZC A;  3ZQI A;  3S3O A;  2M9H A;  4HX8 A;  2UWM A;  1ETW A;  3GZ5 A;  4V2G A;  4WWC A;  2LTP A;  2DO7 A;  3G73 A;  3BCB A;  4IOC F;  2XAU A;  3LSR A;  4UB6 C;  2ID6 A;  4AU7 A;  2BOL A;  5J1U A;  2X1D A;  9ANT A;  4CDG A;  1B8I B;  4HBL A;  1KU9 A;  1HSJ A;  4XKB A;  1F9N A;  1XX5 A;  2EFQ A;  1F36 A;  1PUE E;  3HL2 A;  5EEG A;  3FX3 A;  1N78 A;  3OYN A;  2WAQ N;  2IJL A;  4XLH A;  4A3D J;  4M9S A;  3IRR A;  5IYC J;  2DQR A;  5EEA A;  2KRH A;  1OCR H;  4PDK A;  2JUG A;  4UVC A;  5HNF A;  3HBL A;  2CGP A;  4G6D A;  1QZY A;  2J5P A;  1EH7 A;  3I53 A;  3OV8 A;  1TNT A;  3KET A;  1AKH A;  1ZN2 A;  3S1R J;  3ZQL A;  2FJ1 A;  4FIS A;  2LY9 A;  4RLQ A;  2EIJ H;  3FXL A;  3SDB A;  3IL2 A;  2LSO A;  2BYV E;  1FYM A;  3GF2 A;  3TED A;  1T38 A;  2R7X A;  1IN5 A;  5E79 C;  3J7A O;  5D5V B;  1YW9 A;  3MZ8 A;  2DN0 A;  1Z6T A;  3JTH A;  1DDN A;  1LVK A;  2H1L A;  5FKM A;  2XB5 A;  3PFI A;  3JTG A;  4IOA F;  4ZJZ A;  1X1B A;  1D5V A;  4XM3 A;  4MTE A;  2EZK A;  5CQE A;  2STW A;  3LSJ A;  1WJD A;  3RQI A;  3I56 I;  2L7M P;  1V5E A;  3LSK A;  1MNM C;  4BE1 A;  3MKL A;  4QIW N;  4FET A;  3CC7 I;  3TP0 A;  3DPL C;  2A61 A;  2M7A A;  3W2W A;  4KMF A;  2NYX A;  3SEZ A;  3A01 A;  3UKG A;  4LK1 F;  1BR4 A;  5J4V A;  4KT6 A;  4LMY A;  3CMA I;  1XN7 A;  3S14 J;  3MZY A;  1FBQ A;  4AIJ A;  2EPF A;  4BJ5 C;  3BDD A;  5K7Z A;  1TC3 C;  2IXS A;  4XMY A;  4RLF A;  4AWX B;  1GVD A;  3I58 A;  1YRN A;  4UY8 I;  1HW5 A;  3KEQ A;  4RB0 A;  3NAU A;  4C3H J;  4LG0 B;  2K9M A;  1TWH J;  2CV0 A;  3ASN H;  4Y17 A;  1FSH A;  1T0F C;  2V1D A;  3DU6 A;  1NG6 A;  2TDX A;  2H8W A;  3KX2 A;  1BW6 A;  3SZG A;  4YEJ A;  2GXA A;  3BRO A;  3K4J A;  5LEK A;  1SEU A;  1Z3X A;  1SVO A;  5FKL A;  1BL0 A;  2DA3 A;  4ZYD A;  2V6E A; 
#chains in the Genus database with same CATH homology
 4BQA A;  3I0T A;  2CW0 F;  4LLN A;  4UV9 A;  4U88 A;  3JAM Z;  5HDK A;  4A6E A;  2ZBK A;  5TRD A;  2XKP A;  3E97 A;  1RNL A;  1VTN C;  5J8F A;  5ICF A;  1IW7 F;  2XAJ A;  2O0Y A;  1E17 A;  1XCV A;  5CVR A;  3TQN A;  1LJ9 A;  3H92 A;  2BE5 F;  3HOT A;  5CJ9 A;  4WXC A;  5FD6 A;  4P55 A;  1C0W A;  1U3E M;  2LNB A;  2PFB A;  2BEO A;  4YFN F;  1ON1 A;  4M6Y A;  4L9V A;  3AAF A;  1HKQ A;  3NEU A;  1YQA A;  3HRM A;  2PMH A;  3KP7 A;  3R0J A;  4BXU A;  2EFP A;  3DV8 A;  5D8K B;  2L01 A;  2M1B A;  4RGU A;  3PQK A;  3I54 A;  4P96 A;  5CYV A;  3O3K A;  1FPQ A;  1BBY A;  1IN6 A;  2KRF A;  1B9M A;  3ISP A;  3J81 Z;  1WI9 A;  3RJP A;  3FXR A;  3FM5 A;  3U9G A;  3JAM K;  1MZB A;  1P4X A;  2F5D A;  3DKW A;  3REO A;  2D1H A;  4ON0 A;  4IVN A;  1R1V A;  1TW2 A;  5KK1 A;  2Q8K A;  2BBY A;  1BOA A;  2RGV A;  2LKP A;  4M74 A;  1U8R A;  3NRV A;  2V79 A;  4KIF A;  1TTY A;  3GFL A;  4MEY F;  1REP C;  2NNN A;  1R36 A;  1O3Q A;  4WK8 F;  3WU1 B;  5HS8 A;  4P5O A;  2W25 A;  2FRH A;  1U5T A;  4UHT A;  5DD4 A;  4ZH4 F;  1S29 A;  1W5S A;  2CQK A;  1T98 A;  3QP6 A;  5A2Q Z;  3J81 K;  5D4S A;  4HAM A;  1ONV A;  3GUD A;  5E8I A;  2K7L A;  2QQ9 A;  1FBS A;  4IRH A;  2P5K A;  2IP2 A;  3K1P A;  3VFZ A;  1SFE A;  3E3V A;  4G7H F;  1SD5 A;  2WWY A;  4FHT A;  3TO9 A;  4G8X A;  3HSF A;  3MAJ A;  1TQP A;  5TJJ A;  1B1B A;  4HX4 A;  4BAY A;  3GVA A;  4ESJ A;  1S6L A;  5LEJ A;  1R5H A;  4L9T A;  1O3R A;  1YG2 A;  1LDJ A;  1YS6 A;  4E70 A;  2ETH A;  2D1V A;  2DTR A;  4BH9 A;  2D45 A;  2XVC A;  5JFR A;  2P6T A;  1P4W A;  1Z6R A;  1XGO A;  5A2Q K;  2RV8 A;  3F8C A;  1O57 A;  2STT A;  4KFC A;  4I98 B;  4N0B A;  5BQT A;  2VC0 A;  3ML6 A;  1RI7 A;  1T39 A;  3FF5 A;  2QVO A;  1U5T B;  3ZN0 A;  2Y75 A;  3U1D A;  2LDU A;  1DP7 P;  2DW4 A;  5FD5 A;  4OMZ A;  1L3L A;  3KP4 A;  1SFU A;  4JQF A;  2ZO4 A;  4LGW A;  2MH9 A;  3I71 A;  3F6V A;  5FFZ A;  2HYF A;  1XCB A;  1XSD A;  3CUQ C;  2G9W A;  2X0L A;  1LNW A;  1ZLK A;  1I1S A;  2K02 A;  2DU9 A;  1QNT A;  1S8N A;  1XD7 A;  4HYE A;  2R7F A;  3WOD F;  2GQQ A;  5D6E A;  2FXA A;  1PP8 F;  1ZRC A;  3T5X A;  5DUI A;  4HA8 A;  3S2W A;  3Q9S A;  1ZH5 A;  2YU3 A;  2FML A;  1XDU A;  4NHJ A;  4L9J A;  4RAZ A;  2UXX A;  4BHP A;  5D5U B;  4MQ9 F;  3TDZ C;  3E5X A;  5F1R A;  2DBB A;  2OQR A;  5DCM B;  2YR2 A;  3F8N A;  4OIR F;  2VOP A;  5ERI A;  1SMT A;  1ZYR F;  1YIO A;  3RDI A;  1O7L A;  2H94 A;  4I01 A;  3TDU C;  2KJB A;  2GA2 A;  2QYO A;  1LEA A;  5CLS A;  2XAQ A;  1AOY A;  4U0W A;  2VBY A;  3W6K B;  5LRS A;  1NHA A;  3ZMS A;  2EA2 A;  2CO5 A;  1ZAR A;  2M87 A;  2MBF A;  1LDD A;  2HWV A;  1CGP A;  5L3C A;  2O3F A;  1XMK A;  2A07 F;  1LEB A;  1HXD A;  1SD7 A;  2RVC A;  3MWM A;  5E1W A;  4HF1 A;  2XAH A;  4LB6 B;  2GIV A;  4M6X A;  5D6F A;  2C6Y A;  4PGH A;  2A68 F;  4I7H A;  2QQA A;  4EJO A;  3N4M A;  1KYW A;  2P7C B;  4YFX F;  3QP5 A;  4G7O F;  1ODD A;  1SMY F;  1MJ9 A;  2MLK A;  4AIK A;  5HS7 A;  3WTZ A;  2EB7 A;  1R00 A;  3RPU A;  4A12 A;  2P7V B;  2PQ8 A;  1HQC A;  1HW1 A;  5F64 A;  4S05 A;  1FNN A;  5FGM A;  1MJB A;  4KIC A;  5DEQ A;  5DYM A;  3L7W A;  2KJC A;  1ZLJ A;  1DUX C;  4CIC A;  4AIH A;  5ICE A;  2M45 A;  1KYZ A;  2O61 A;  3KP5 A;  1Z1D A;  3WTV C;  2WTE A;  2CSO A;  1BIB A;  3ZMD A;  5CVJ A;  1KU2 A;  3GXO A;  4G7Z F;  4IRG A;  1RZ4 A;  3COA C;  1QQI A;  3QPT A;  4UXN A;  3KE2 A;  3BJO A;  2VOO A;  3J80 Z;  2KIM A;  3ECH A;  1DPR A;  4BHC A;  4HX7 A;  5HOO A;  3O6B B;  5BMZ A;  4GYI A;  1CF7 A;  2EWN A;  4Q47 A;  1ON2 A;  4OIP F;  2EFO A;  2EJR A;  3HTS B;  4AD9 A;  2Y48 A;  1ZAO A;  3VB2 A;  4CGZ A;  5L3F A;  5E1X A;  3RKW A;  3EUH A;  4HDV A;  1D8J A;  3BZ6 A;  2PEX A;  1SD4 A;  2NRA C;  2XRO A;  2FU4 A;  1K7A A;  2RN7 A;  4Q5S F;  2JRT A;  2JT1 A;  5L3E A;  2A3S A;  1W4M A;  2D2W A;  4U0Y A;  3KP2 A;  1R1U A;  2H6C A;  3F72 A;  3F6O A;  1BI2 A;  2MA3 A;  1OR7 A;  3G3Z A;  2L4M A;  4CXF A;  2VBZ A;  1XDS A;  1R22 A;  4IHS A;  3BPV A;  2UZK A;  1J59 A;  4GCV A;  2Y0M A;  2P6S A;  3HSR A;  3K2Z A;  2XAG A;  4A0Z A;  3BJ6 A;  1HKT A;  3MZH A;  3J80 K;  1W7P B;  2ZNY A;  3GW2 A;  3LAP A;  3C7J A;  4OIQ F;  3RIR A;  1OYW A;  1B9N A;  3MQ0 A;  3WU0 A;  4IHT A;  1MKM A;  4PZJ A;  3T8T A;  1ZG3 A;  2ISY A;  3E5Q A;  3ZP5 A;  2QZ8 A;  3DXJ F;  4O6J A;  5ED4 A;  2OD5 A;  3WE2 A;  1U6G A;  4MGR A;  3I64 A;  2JSC A;  4L0Z B;  2HKO A;  4FT8 A;  1BJA A;  1LDK B;  2W85 A;  4P9F A;  2KKO A;  5CVI A;  2FBI A;  1FYK A;  3M9A A;  3KLN A;  4OIO F;  1CF7 B;  3F8B A;  1SFX A;  2GWR A;  2IA0 A;  2A5Y B;  2DFI A;  4IXA A;  3MEX A;  1IUY A;  4I2O A;  3P9C A;  3HYI A;  2EV0 A;  5ILU A;  2F5F A;  2PMU A;  1MGT A;  2LF7 A;  4P9U A;  1OYY A;  2IA1 A;  3GFJ A;  3ABT A;  2EFW A;  4FX4 A;  2WC2 A;  2GZW A;  1ZHF A;  4L5I A;  1XMA A;  4EJV A;  3F21 A;  5HLG A;  4M73 A;  4M71 A;  4ASN A;  4IRI A;  2W57 A;  3GX4 X;  4K2E A;  2PI0 A;  1QO0 D;  3RPQ A;  3TO7 A;  2FOK A;  1GHC A;  2VON A;  3KEO A;  1HW2 A;  4IF4 A;  4PGG A;  2PJP A;  1R23 A;  4YFK F;  1F4K A;  3R60 A;  4UV8 A;  1RUN A;  4KNY A;  1IAW A;  1J0R A;  3EET A;  2YPR A;  4LB5 A;  2GA1 A;  2OBP A;  4F7Z A;  2DI3 A;  5LHG A;  3CJN A;  3CUO A;  1YTY A;  5K5R A;  3WTW C;  1MD0 A;  3CO7 C;  1BIA A;  1P92 A;  1O7F A;  1HKS A;  4WCG A;  2HDC A;  3M1E A;  3SXY A;  3IRQ A;  1YFH A;  3M8F A;  1JGS A;  3WTU C;  1QPM A;  4R8H A;  3GO5 A;  1B4A A;  4QWQ A;  3B02 A;  3HSE A;  1KQ8 A;  3WE3 A;  5H20 A;  2QBY A;  5L3B A;  1WKM A;  3CLO A;  3BOQ A;  1EH6 A;  1R5G A;  2F5E A;  2HTJ A;  2DPD A;  5ILS A;  2RNJ A;  2EV5 A;  3QU6 A;  1YO5 C;  3KCC A;  1D3Y A;  2HTS A;  1HBX G;  1EH8 A;  1IF1 A;  2H27 A;  2IT0 A;  3N97 A;  5D5W B;  5HLI A;  4CHU A;  2UXN A;  4IPA A;  1J75 A;  2A6E F;  3L9F A;  5DCM A;  5DCF A;  1LB2 A;  3V8K A;  1IXR C;  3JSO A;  1KQ0 A;  3E6B A;  1G4D A;  2MLG A;  3KZZ A;  1UST A;  4I0A A;  3E6M A;  2QM3 A;  5FB2 A;  4KDP A;  1FWZ A;  5IT9 Z;  4M72 A;  1F1Z A;  2FBK A;  4H0E A;  4DNC A;  1KGS A;  4HF2 A;  3SZP A;  5FLX Z;  1FSE A;  3NQO A;  4OMY A;  4XSX F;  1XGN A;  2ESN A;  4WXH A;  4LJZ F;  1KQ9 A;  2HQN A;  1W7P D;  4QLC U;  2WV0 A;  4L0Y B;  4XLP F;  2V1U A;  1BI1 A;  1FYL A;  3LWF A;  3R4K A;  1V4R A;  2IPQ X;  2L02 A;  2ACJ A;  3GFM A;  3ZQ7 A;  3GWZ A;  2MD5 A;  1P6R A;  3ZMZ A;  2B0L A;  3JW4 A;  2DK8 A;  3L09 A;  2PBI A;  2QBY B;  2XKO A;  4EVI A;  5DV5 A;  6PAX A;  2E1C A;  3I5U A;  1OMI A;  1I6X A;  4G6Q A;  2R3S A;  1I5Z A;  4I09 A;  3TKY A;  1BN5 A;  2ADU A;  1I1G A;  3FMR A;  2YSR A;  2VE9 A;  3ABU A;  3V8L A;  1FC3 A;  3BPX A;  2OZ6 A;  3D0S A;  1WRJ A;  2IA2 A;  2OA4 A;  1X3U A;  4U7B A;  5FO5 A;  4LK0 F;  5BOX A;  2K4J A;  3WTY C;  2VT3 A;  1ULY A;  1RUO A;  4NQW A;  3Q9V A;  4EMS A;  3VOE A;  1FZP B;  1ZRE A;  4ZYG A;  5D4R A;  2Z9O A;  1YW8 A;  4ENK A;  1F5T A;  2PN6 A;  1KA8 A;  1IRG A;  1WWX A;  2A69 F;  5JHU A;  5K5Q A;  3H3U A;  4UUV A;  5E8G A;  1Z7U A;  3ULQ B;  4WF2 A;  3HUG A;  1XGM A;  3I4P A;  3ZN1 A;  1V3F A;  2FBH A;  3WGI A;  3BP8 A;  1Z05 A;  3M7G A;  2RKH A;  1LVA A;  1FOK A;  1RIO H;  2ZME B;  3SZT A;  1JHH A;  3WGG A;  4AVP A;  4G94 A;  3TOA A;  1FP2 A;  1L0O C;  5BS6 A;  1J2X A;  3IKT A;  2BV6 A;  3OOP A;  4LLG F;  4Y13 A;  1DPU A;  4HDU A;  5AON A;  3VOD A;  2CWE A;  2YX7 A;  2KIU A;  3DEU A;  3HHG A;  4EQQ A;  2GXB A;  4A0X A;  2AS5 F;  4G9Y A;  4UVB A;  2IVM A;  3KLO A;  3RKY A;  1J7K A;  2FNP A;  1FY7 A;  1K78 A;  2HZT A;  4MNU A;  3K0L A;  3T0Y A;  4XLN F;  4MHG A;  3FXQ A;  4Z2Y A;  3ERE D;  2L4A A;  2CYY A;  1G3S A;  5ILV A;  4HV6 A;  1YYV A;  4RGS A;  2F2E A;  2XHK A;  3WTT C;  1W7P A;  2ZKZ A;  4XRF A;  2P4W A;  1OKR A;  1P4A A;  3P9K A;  2HKX A;  3LQR A;  1IN8 A;  1OPC A;  1TLH B;  2E7X A;  2RC4 A;  2G7H A;  4ETS A;  2DAO A;  2XAS A;  4ZYH A;  1ZG1 A;  3BJA A;  4KMU X;  4KIG A;  2VXZ A;  4HW0 A;  2AXL A;  4HOB A;  3LST A;  4BYY A;  1FP1 D;  4N9I A;  5AIQ A;  2DLL A;  1S7O A;  3MCZ A;  1SD6 A;  2NS0 A;  1XSX A;  1TQI A;  5CVU A;  4HLX A;  1JE8 A;  2JZY A;  3V7S A;  2EA4 A;  3U2R A;  2H09 A;  2OZU A;  4D0P A;  2JPB A;  2V9V A;  3CUQ B;  3LQQ A;  4TV7 A;  4HLY A;  4YG2 F;  3RTR A;  3D5L A;  5JI6 A;  2HFH A;  4OU0 A;  3ZMT A;  2DT5 A;  1G6N A;  4KYW A;  3FZV A;  2X4H A;  2M30 A;  1MDM A;  4KN7 X;  2DK5 A;  1BC7 C;  4NB5 A;  1K78 B;  4U7D A;  1FX7 A;  3DQV C;  5EEH A;  3GZ6 A;  1JHF A;  3R6S A;  2EV6 A;  3C1D A;  1SAX A;  2QQB A;  1QZZ A;  2OU2 A;  2QWW A;  3DPT A;  2QEN A;  1K6O A;  2HS5 A;  1IXS B;  1UHM A;  3TO6 A;  2Z3Y A;  4R79 A;  5E20 A;  5BPD A;  3TOB A;  2VE8 A;  3B73 A;  3KP6 A;  2K4B A;  2ZNZ A;  1Z91 A;  3DF8 A;  4CZZ A;  1MJA A;  2XGX A;  2O6G E;  3RYP A;  3ELK A;  2NNY A;  4ENN A;  2O03 A;  4KIB A;  4M9Z A;  1ZG5 A;  2FMY A;  4A6D A;  1H0M A;  1BM9 A;  2IW5 A;  1GXQ A;  4GO1 A;  2ZXJ A;  1TW3 A;  5HS9 A;  1BC8 C;  1FT9 A;  1HST A;  2KIF A;  2VBX A;  3IHU A;  2W84 A;  4LFU A;  2M8E A;  5H6R A;  3HOS A;  5D5X B;  2RDP A;  4YII A;  1A04 A;  1BI0 A;  4R1H A;  2MH2 A;  5LHI A;  2HOE A;  4GGG A;  5AIP A;  2CG4 A;  4EJU A;  3SHF A;  1QBJ A;  1OYI A;  1D8K A;  1R7J A;  5H6Q A;  4WXD A;  1U5T C;  4GYG A;  1GVJ A;  4O5V A;  2P5L C;  3RYR A;  3CTA A;  2E1N A;  4I02 A;  1Q1H A;  3FM3 A;  4ESB A;  1STZ A;  2FNA A;  3O2P E;  2FA5 A;  4B8X A;  3IWZ A;  1E2X A;  3ZMV A;  1MDM B;  4RB2 C;  4EGZ A;  2R7D A;  5L3D A;  4OIN F;  2ZFW A;  4L18 B;  3E6D A;  3EDP A;  1LQ1 A;  3WGH A;  4A2U A;  4BHB A;  1UB9 A;  3Q5F A;  3GFI A;  4HQM A;  3I59 A;  3C18 A;  4LD5 A;  1YS7 A;  5K5O A;  1Z9C A;  2P8T A;  1T0F A;  2OAZ A;  5L3G A;  2FQ3 A;  5JR3 A;  1TQM A;  3DP7 A;  5E1Z B;  2EFN A;  1IN4 A;  5HDN A;  2VT2 A;  4ZYE A;  4HZF A;  1ZGJ A;  3LFK A;  3GEZ A;  3ECO A;  5LHH A;  2Z33 A;  2ZCW A;  4I0B A;  3GYH X;  3K1M A;  1JXS A;  4KA4 A;  4EV0 A;  1S3J A;  3WTX C;  3HRS A;  3QRF F;  3KP3 A;  1KU3 A;  2DQL A;  3K1N A;  2JTV A;  3BWG A;  3HHH A;  4EM2 A;  4ENJ A;  4HF0 A;  2GXG A;  3ZPL A;  3V4G A;  4UNO A;  3SFZ A;  2GAU A;  1U2W A;  3PQJ A;  4JK1 X;  1QGP A;  5CVV A;  4A0Y A;  3WTS C;  4FX0 A;  4BNC A;  4KT5 C;  4RGR A;  2PG4 A;  4L5J A;  3FXU A;  3QPH A;  4RS8 A;  5HVQ C;  3W6J B;  4Q48 A;  2V6C A;  2QUF A;  3V7C A;  2L54 A;  2M5W A;  3IWF A;  4ZZL A;  1G3Y A;  1UFM A;  2ESH A;  2PLY A;  3RI4 A;  2Q0O A;  1P2F A;  3QAH A;  3TGN A;  2HYG D;  3IC7 A;  3P7N A;  3K9T A;  5DUK A;  5K1Y A;  5J6X A;  4HQE A;  3GLX A;  4ZZD A;  5DD8 A;  2RQP A;  3I59 B;  4DQ2 A;  3V8J A;  1J5Y A;  3F8M A;  1K79 A;  2ELH A;  1R58 A;  4L9N A;  2QLZ A;  5ICC A;  3P9I A;  3VEP A;  3QU3 A;  1PDN C;  3LAJ A;  4ENM A;  2OQG A;  1USS A;  1YLF A;  5DDG A;  5LLQ A;  1O3S A;  3C3W A;  1XGS A;  3FMS A;  2FE3 A;  2JPC A;  4IJA A;  5IT3 A;  4M9X A;  2ZME A;  1KU7 A;  1IZ1 A;  2A6H F;  3QOP A;  4RB1 A;  4PCQ A;  1B6A A;  4A5N A;  1FBU A;  3EYY A;  5E17 F;  3FHZ A;  2Z99 A;  3JSP A;  2HGC A;  4GXO A;  2FEZ A;  1UCR A;  1I27 A;  4U0V A;  4A5M A;  4UVA A;  4O3M A;  5JVT A;  3R61 A;  3FMQ A;  1O3T A;  2F5C A;  2O8X A;  3KFW X;  1ZGA A;  4CYD A;  4HV5 A;  1G3T A;  1G3W A;  3HTU A;  5BPI A;  1T6S A;  3L2C A;  1WQ2 A;  4EGY A;  2ISZ A;  5IT9 K;  1T2K A;  3KZY A;  2BGC A;  2NAZ A;  4XSZ F;  5KVR A;  5FLX K;  1U78 A;  3EYI A;  3WG9 A;  2Q2E A;  3F23 A;  2K27 A;  4Q4Z F;  2V1X A;  1UHW A;  5LBQ A;  2IRF G;  1B59 A;  2FSW A;  4XBF A;  1H9T A;  4WX9 A;  2E7W A;  3V7R A;  1R1T A;  3LA2 A;  4MQV A;  4MTD A;  5FFX A;  2W24 A;  2VOD A;  2XIG A;  3CO6 C;  2J5O A;  2MC3 A;  1TNS A;  2HR3 A;  3EQL F;  3CUQ A;  2XUB A;  5D8L B;  1BI3 A;  3BY6 A;  4S04 A;  3T8R A;  4RB3 C;  1AWC A;  1XB4 A;  2CFX A;  3ROU A;  2EK5 A;  3F8F A;  3H3Z A;  3K69 A;  3SQN A;  4CO8 A;  1IRF A;  2G7U A;  5LGT A;  1EV7 A;  5F6F A;  4RAY A;  2VBW A;  5J8C A;  4Y15 A;  4YIF A;  1FLI A;  2P5V A;  1IN7 A;  3IKV A;  3T1B A;  1W5T A;  1ZRF A;  1GXP A;  5HLH A;  2HQR A;  3CDH A;  1XSV A;  3L00 A;  5LGU A;  2YX4 A;  2H6B A;  4EJW A;  2VC1 A;  3RKX A;  3DFG A;  1IXC A;  1WSU A;  2XAF A;  4EJT A;  2COM A;  4OOI A;  5ICG A;  2LF8 A;  3FWE A;  3E6C C;  5LRR A;  2L3D A;  5HDG A;  3F22 A;  2DPU A;  1Y0U A;  2VN2 A;  3F3X A;  3M8E A;  2XV4 S;  1H9G A;  4RGX A;  4ESF A;  3HIF A;  3R0A A;  1S7A A;  4EM1 A;  4LG0 A;  2HEO A;  4JBA A;  4KUM A;  1PP7 U;  3MFK A;  4N9H A;  1ZRD A;  5LGN A;  3E5U A;  2ZJ2 A;  2K86 A;  3HRU A;  1J9I A;  3ZMU A;  3HRT A;  3LA3 A;  1YW7 A;  2FF4 A;  3LA7 A;  4EM0 B;  1TBX A;  4B09 A;  4LLL A;  4MEX F;  4KN4 X;  5E18 F;  2Z5U A;  2XRN A;  4HX8 A;  2UWM A;  3GZ5 A;  4WWC A;  3G73 A;  2DO7 A;  4CDG A;  4HBL A;  1KU9 A;  1HSJ A;  1F9N A;  2EFQ A;  1PUE E;  5EEG A;  3FX3 A;  2IJL A;  4M9S A;  3IRR A;  2DQR A;  4PDK A;  4UVC A;  2CGP A;  4G6D A;  1QZY A;  3KET A;  2J5P A;  1EH7 A;  3I53 A;  1TNT A;  3OV8 A;  1ZN2 A;  3IL2 A;  2LSO A;  2BYV E;  1FYM A;  3GF2 A;  1T38 A;  1IN5 A;  3J7A O;  5D5V B;  1YW9 A;  1Z6T A;  3JTH A;  1DDN A;  3PFI A;  3JTG A;  1D5V A;  4MTE A;  2STW A;  3DPL C;  2A61 A;  4KMF A;  2NYX A;  4LK1 F;  4LMY A;  1XN7 A;  3MZY A;  1FBQ A;  4AIJ A;  3BDD A;  4AWX B;  3I58 A;  1HW5 A;  3KEQ A;  4RB0 A;  4LG0 B;  4Y17 A;  1FSH A;  2V1D A;  2TDX A;  3BRO A;  5LEK A;  4ZYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...