2O6GE

Crystal structure of irf-3 bound to the interferon-b enhancer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
b'TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interferon-b enhancer
publication title An Atomic Model of the Interferon-beta Enhanceosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 17
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2o6gE01
4KA4A 3ISPA 1QPMA 1HW5A 3RYPA 4UV8A 3WTZA 3M8FA 2DQLA 4I98B 4G6QA 2DFIA 3EETA 4UUVA 4CO8A 4CDGA 2V1XA 4O6JA 2VE9A 2OA4A 2HGCA 2HR3A 2Z99A 3GVAA 2B0LA 3K9TA 5DD4A 1WSUA 3GFIA 2PBIA 4MEYF 4UVAA 5L3GA 4WXHA 1V3FA 4N9IA 2KJBA 4MTEA 5HVQC 4MGRA 2O6GE 3KP5A 4L9VA 2FQ3A 4A0YA 2A3SA 1AOYA 1FP2A 1S7AA 3ULQB 2ELHA 1S29A 1TNTA 4L0ZB 2ETHA 4OINF 1T0FA 1WWXA 2RGVA 6PAXA 4GCVA 3HOTA 3FZVA 1LEBA 4KT5C 4RB1A 3JAMK 2L01A 4Y13A 1I1SA 5HLIA 3I71A 1U5TA 1MDMA 1XB4A 2KKOA 2VC1A 2CO5A 3Q9VA 3WTWC 2EA2A 4N0BA 4IF4A 2R3SA 2P4WA 5CJ9A 3GFMA 2QVOA 3NRVA 2HYFA 3V7RA 4IVNA 3WGHA 5DD8A 2O61A 3CLOA 2PFBA 3ELKA 3R60A 4CHUA 4O3MA 1R7JA 3R0JA 2HDCA 4OIOF 3K69A 1E2XA 3FXQA 4EV0A 2V79A 4CICA 2R7DA 5LEKA 4ENMA 1USSA 1R23A 5LHIA 2DQRA 2QM3A 1Z7UA 2ZJ2A 4YIFA 1QZYA 4KN4X 5E1ZB 4Q47A 2EB7A 3RKYA 5DUIA 3HIFA 2L02A 1R22A 4BYYA 2HOEA 2DK8A 3HOSA 1BIBA 1LJ9A 4AD9A 5IT9Z 4LGWA 4ZH4F 1ON1A 2A61A 4ENNA 2F2EA 1OPCA 2VOPA 1HKSA 3MAJA 2EFPA 4AIHA 2V6CA 2EV5A 4P96A 3ABTA 3EYYA 1R1VA 3QPTA 4R79A 4D0PA 5L3BA 1HKTA 1YS7A 4LG0B 3DFGA 1HBXG 2DW4A 3V8JA 2XV4S 1O3RA 2MLGA 1G3SA 2OBPA 4M72A 4OMZA 1I5ZA 3ZN1A 1K78B 4CGZA 3V8LA 5HS7A 1U8RA 1ZGAA 2XKPA 1OYWA 1K6OA 2IRFG 1TLHB 4G8XA 1QZZA 3DF8A 2F5EA 4WK8F 1IF1A 1YS6A 3E6MA 1HKQA 2YX4A 2XASA 3ZP5A 1IN7A 2JPBA 5ILVA 4EMSA 1QQIA 2HEOA 3R6SA 3REOA 1MJBA 1B9MA 1Q1HA 2H27A 4M74A 3NQOA 3O3KA 1MD0A 1XD7A 3I4PA 2K02A 1ZRCA 1IZ1A 3RJPA 2P6SA 4RGRA 4E70A 2X0LA 1KGSA 1HW1A 1H9TA 1MKMA 2G7HA 3KCCA 2P7CB 2Y0MA 4ESJA 3FM5A 1EV7A 3FXUA 2E1NA 2KRFA 2VOOA 4KYWA 2DT5A 4MTDA 4DQ2A 1LDJA 2ZMEB 1NHAA 3F8FA 3T1BA 5K1YA 2DI3A 4CYDA 1XGNA 3FWEA 3T8RA 1LQ1A 1XN7A 4AIJA 3DP7A 4H0EA 3L09A 5H20A 1PDNC 3BJ6A 4EM1A 4KDPA 4WF2A 4OU0A 5D5VB 2Q2EA 4M6YA 4I01A 3VOEA 4WX9A 2DTRA 1HSTA 2LF8A 4P5OA 2FMLA 3VODA 3HTSB 3ABUA 4HX8A 5DCFA 3BZ6A 4HLXA 5LGNA 3ZMTA 2XHKA 5FGMA 3HSRA 5E1WA 4GXOA 5F6FA 2ESHA 2PMHA 3PQJA 5A2QZ 3MWMA 2W24A 3F8NA 3CUQC 4RB2C 5LBQA 4HDUA 3QU6A 2Z9OA 4P55A 2LNBA 3TOBA 1P2FA 1XDSA 1Z6TA 3RKXA 1XGSA 2BEOA 1GHCA 4LMYA 2RNJA 1K79A 4HOBA 2FA5A 2RV8A 4EM0B 4LG0A 1B9NA 4BQAA 1IXRC 3W6JB 3KP2A 1SD4A 2EK5A 4KNYA 1K78A 2NAZA 3F22A 1EH8A 3GX4X 3LWFA 5IT9K 1K7AA 2YX7A 2Z5UA 2EFNA 5E8IA 4ESBA 3O2PE 3HHHA 4PGHA 1PP7U 4HX7A 4RB3C 3QP5A 4AIKA 4ENJA 4HW0A 3PQKA 4HV6A 1XGOA 2MH9A 4RAZA 3EQLF 1CGPA 5LRSA 2E1CA 1UB9A 1FBQA 2F5FA 4GO1A 3GFLA 5J8CA 2KJCA 1LNWA 1ZRDA 1G6NA 2OZ6A 1TQPA 4B8XA 1R5HA 2W25A 2ZMEA 1JHFA 1ZLJA 2ESNA 3ZQ7A 1UFMA 1O3SA 2PEXA 5KK1A 4BHCA 1SFUA 4Q4ZF 1ODDA 2IT0A 3KE2A 5E18F 3BJOA 2ISZA 3HYIA 3HTUA 2XAJA 3KZZA 5FB2A 3GW2A 1FP1D 1R36A 2DO7A 4M9XA 3EDPA 1FOKA 1HW2A 3CUOA 1IN6A 1R1TA 5LLQA 4A12A 4IRGA 1SMTA 1OYYA 2FRHA 2D45A 3IWFA 4HF0A 3OOPA 2E7XA 3I59B 5L3DA 2MD5A 3F23A 1OKRA 2XGXA 5FFZA 1YLFA 1JGSA 1ZLKA 3KLOA 5LGUA 2RVCA 3DV8A 2E7WA 3Q5FA 1FYLA 2UZKA 2FMYA 5BS6A 5D5UB 3TKYA 5L3EA 3WU1B 3P9IA 2GQQA 3M7GA 2DK5A 3ZMZA 1REPC 4XSZF 3IRRA 4L9NA 1XMAA 1QO0D 5HLHA 4LD5A 1Z91A 3I53A 5L3CA 2VBWA 3SQNA 2MC3A 3VFZA 2WWYA 5LGTA 4NHJA 3E6BA 2HKXA 4NB5A 3SXYA 1Y0UA 4CXFA 2QQAA 5AONA 1TQIA 1R58A 4YFXF 2G7UA 1S3JA 4A0ZA 1P4XA 2NRAC 5A2QK 1IRGA 3H3UA 1FSHA 1G4DA 2HKOA 2BE5F 4FX0A 4EGYA 1JHHA 3TO6A 2K27A 5H6RA 2ADUA 3F6OA 1IRFA 2EA4A 5TRDA 5AIQA 2XAFA 4HX4A 3P9CA 4XRFA 3IL2A 4U0VA 3CTAA 4AWXB 1FZPB 1D5VA 1F4KA 2F5DA 1P6RA 2EFOA 2M30A 1TNSA 4GYIA 2WV0A 3KETA 3I54A 2GZWA 4ZZLA 3ZPLA 2STTA 3Q9SA 1T39A 3WTVC 3M8EA 1YQAA 1JXSA 2TDXA 4HF2A 5LHGA 2QZ8A 3I0TA 2L4MA 1BOAA 1UHMA 2Q8KA 4ZYHA 2WTEA 4LK0F 2P5KA 2ISYA 2BV6A 2FXAA 1G3YA 1OYIA 3E3VA 5D6EA 4RAYA 3KFWX 1T38A 2JTVA 1PP8F 4BH9A 2JSCA 1J2XA 5E17F 2VT2A 4KMUX 5D4SA 2STWA 4PZJA 1DPRA 1KQ9A 1TQMA 2CWEA 4ZYDA 5CYVA 3JSPA 2HQNA 2KIUA 2GA1A 1WQ2A 4JBAA 2EFQA 3I59A 3K1NA 4LLGF 1WI9A 4IJAA 1IXCA 4MEXF 2M1BA 2GXBA 5DCMB 1SFEA 4HA8A 5IT3A 2A6EF 4KICA 4Q48A 2IA0A 2D1VA 3V7CA 2GAUA 5ILSA 2EV6A 1GVJA 4BHBA 4FX4A 1E17A 5JVTA 2NNYA 1Z9CA 1VTNC 5HDKA 3CO6C 2Y48A 1B4AA 2A69F 5CVUA 2HFHA 1DP7P 3HRMA 3CDHA 3JSOA 4EJOA 5HS8A 1LDKB 2ZXJA 1LDDA 3VB2A 3ECHA 1MJ9A 4DNCA 2KIMA 1BI1A 2ZCWA 5FO5A 3E6DA 3FF5A 4HAMA 1DPUA 3C7JA 2ACJA 3HRUA 3J81Z 3KLNA 3V4GA 1FWZA 3KP6A 3FXRA 4M6XA 1RIOH 3BJAA 1DDNA 1TBXA 2CFXA 4L9TA 4R8HA 4G7HF 2VBZA 4I09A 2HZTA 4FHTA 2DPDA 1X3UA 1B1BA 2JPCA 1IN5A 1XCVA 3RPQA 1XSXA 2HQRA 2VXZA 3TQNA 5ICGA 4UVBA 1RNLA 3C18A 1H0MA 4LJZF 1S7OA 3BWGA 1FNNA 3F21A 3ERED 2QBYB 1HQCA 1GXPA 2RQPA 4GYGA 3WU0A 1BM9A 1Z05A 3M9AA 4PDKA 2IA1A 3ZMSA 2PG4A 1FSEA 5ED4A 2VT3A 2GXGA 1FT9A 1TW3A 3U9GA 3EUHA 5CVVA 3P9KA 5HDGA 4GGGA 4P9FA 2QUFA 3GEZA 1W4MA 5TJJA 3ROUA 1BI3A 1BC8C 3T0YA 2OQGA 2DBBA 3D5LA 3KP7A 4Y17A 2XAHA 1XMKA 2OD5A 4AVPA 3TO9A 3K1MA 3L9FA 1G3TA 2RC4A 4A5MA 5D4RA 4WCGA 4P9UA 1O7LA 5CLSA 1O57A 5DCMA 1L0OC 1BIAA 3P7NA 2FBHA 3U1DA 3I5UA 4ETSA 4HF1A 1RUOA 5ICCA 4OIRF 1QBJA 5E1XA 2EV0A 3WGGA 1FBSA 2COMA 1EH7A 3GXOA 3F8MA 4MQVA 4HLYA 2W84A 5EEHA 2VE8A 2IA2A 2ZBKA 4G6DA 2H6BA 3RI4A 2UXXA 1FYKA 2GA2A 3HUGA 1YTYA 4M9SA 4JK1X 3GZ5A 1AWCA 5JHUA 2QENA 1O3TA 3BPVA 3FHZA 3MFKA 2VBYA 3T8TA 4MQ9F 2XAQA 1R5GA 4UNOA 4I0AA 4KIFA 2FOKA 2XIGA 4BHPA 4HV5A 2XUBA 1FBUA 3MQ0A 1Z6RA 5E20A 4MHGA 2BYVE 2AS5F 3W6KB 4LB6B 3IHUA 1HXDA 3FX3A 1ZHFA 5HS9A 1FPQA 2DLLA 1KYWA 2PMUA 5DYMA 2FBIA 3KZYA 3MEXA 2LKPA 2K7LA 1S8NA 3E97A 2IP2A 4A0XA 5LEJA 2P5LC 2QBYA 1EH6A 1IUYA 4HZFA 3O6BB 2K4JA 2UWMA 3R61A 1KU3A 1KQ0A 5BMZA 4L0YB 4YG2F 5ILUA 2QYOA 3SZTA 3E6CC 2PN6A 4KIGA 5JI6A 1TW2A 1W5SA 5DUKA 4HQEA 4KFCA 3GO5A 3TO7A 4XBFA 3KP4A 2KIFA 2BGCA 1IW7F 4ZZDA 3IKTA 4A2UA 1W5TA 3OV8A 1G3WA 2QWWA 1SFXA 2H6CA 1FYMA 1YG2A 4LB5A 1O7FA 3WODF 2PJPA 3GWZA 1LEAA 2ZO4A 4M71A 1U3EM 3JW4A 4OIQF 3GUDA 3I58A 1CF7B 5FLXZ 2HYGD 4A6DA 1BI2A 3FMRA 3NEUA 4EM2A 2W85A 3SFZA 4S04A 2H94A 2NYXA 1YW9A 3E5QA 5AIPA 3HRSA 2EWNA 2NS0A 1I27A 3DPLC 4HDVA 3TDZC 2GIVA 5D6FA 2M8EA 3I64A 1PUEE 3ECOA 2O3FA 3K0LA 2OQRA 3DQVC 3DXJF 2Z3YA 3L7WA 2VC0A 3IRQA 4XSXF 2FBKA 4WXDA 2XROA 3QP6A 2H09A 1YW7A 1ZREA 2FU4A 1BBYA 1ZARA 5K5QA 4O5VA 1XDUA 3F6VA 1RI7A 1RZ4A 3RIRA 4RS8A 4IHTA 4U7BA 2AXLA 2OU2A 3DKWA 4I02A 2MBFA 3FMQA 1MJAA 1Z1DA 1T6SA 4RGUA 1RUNA 1D3YA 3G73A 1YYVA 2QQ9A 3GFJA 3RTRA 2OZUA 4U7DA 1U6GA 1XCBA 2V1UA 3BOQA 4Q5SF 2IJLA 1BN5A 3SHFA 2CQKA 4EJUA 3HHGA 3QPHA 4QWQA 1A04A 1IAWA 2P7VB 1F9NA 1ZGJA 2L4AA 1W7PB 1R00A 2CYYA 3DEUA 3WG9A 3WTXC 2A6HF 2ZNYA 2VODA 1FY7A 2MH2A 1L3LA 4EJVA 5FD6A 1BI0A 5JR3A 1CF7A 2LSOA 2FNAA 4QLCU 3J80Z 2FE3A 2CSOA 5FFXA 4OOIA 4XLNF 2IVMA 1R1UA 4U0WA 4YFNF 3BP8A 2HTSA 2A5YB 4IRHA 4G94A 3K2ZA 2RDPA 4ZYGA 4N9HA 4G7OF 3R4KA 3DPTA 4I0BA 4A5NA 3TDUC 4KUMA 5BPDA 5ERIA 3GLXA 4R1HA 3WTUC 3LA3A 2Y75A 5K5OA 4CZZA 2P8TA 2XKOA 4TV7A 3V7SA 2A07F 5FLXK 3VEPA 2YR2A 4EGZA 2C6YA 1QNTA 2GWRA 1KQ8A 4RGSA 1W7PD 1ULYA 3MCZA 2LF7A 3WE2A 2HTJA 1FLIA 3QAHA 3EYIA 1UHWA 5K5RA 1OR7A 3B73A 1ZRFA 3BY6A 5LHHA 3L00A 5DV5A 5BOXA 3LQQA 3G3ZA 4UVCA 1ZAOA 4U0YA 5BPIA 1YO5C 3K1PA 1LB2A 3MZYA 3AAFA 2CGPA 2JZYA 2WC2A 4NQWA 3RDIA 5L3FA 4G7ZF 4EQQA 3HSEA 4HBLA 3TOAA 4ESFA 1J59A 1IN8A 2QQBA 4UV9A 1GXQA 1FX7A 4IPAA 3F8BA 2FF4A 2HS5A 2CW0F 4IRIA 2OAZA 2W57A 2M87A 2D1HA 3KP3A 1KU9A 3RPUA 4WWCA 3E5UA 1HSJA 4I2OA 1SD5A 2BBYA 2VONA 1U78A 1SD7A 4L5JA 3KEOA 4S05A 2F5CA 5J8FA 1DUXC 3LQRA 4LK1F 4UHTA 4F7ZA 1W7PA 5CVRA 4A6EA 4B09A 5FD5A 1J5YA 4YIIA 1LVAA 4XLPF 1XGMA 4Z2YA 4OMYA 1F5TA 3T5XA 3IKVA 4RB0A 5HLGA 2ZKZA 2M5WA 3LFKA 5CVIA 3KEQA 2RKHA 2XVCA 4BXUA 3L2CA 3LAPA 3H92A 1J75A 1QGPA 1ZYRF 1ONVA 4I7HA 4M9ZA 1OMIA 4K2EA 1UCRA 4ON0A 1ON2A 2YSRA 1STZA 4M73A 3H3ZA 4EJWA 2DU9A 4PCQA 2YPRA 3ZN0A 1KYZA 1U2WA 1O3QA 1J7KA 2L3DA 5ICEA 4HYEA 5D8KB 4HQMA 3D0SA 5J6XA 4Y15A 1IN4A 3TGNA 1F1ZA 4UXNA 4BAYA 3J80K 4EJTA 2L54A 3BPXA 3QOPA 3SZPA 1YIOA 1T2KA 2M45A 2PI0A 2CG4A 1S6LA 2RN7A 3CUQB 3GYHX 5DDGA 2V1DA 1XSDA 3C1DA 3GF2A 3HSFA 3E5XA 5DEQA 1IXSB 2FEZA 2IPQX 4RGXA 2ZFWA 3CJNA 1MZBA 1ZH5A 2JRTA 1J9IA 5BQTA 1YW8A 1I6XA 4FT8A 3IWZA 2D2WA 3F72A 5H6QA 2VN2A 5HDNA 2J5PA 3ZMVA 5F1RA 2JT1A 4IHSA 2V9VA 3ML6A 2DPUA 4LLLA 4IXAA 3CO7C 2PQ8A 5ICFA 1SD6A 1KU2A 1SMYF 1SAXA 2VBXA 2P6TA 5LRRA 5D5XB 2FNPA 4WXCA 1KA8A 1TTYA 4G9YA 3U2RA 2QLZA 4EVIA 2R7FA 1KU7A 3JTHA 3J7AO 1D8JA 4OIPF 3J81K 2K86A 1ZG5A 2X4HA 3ZMDA 1MGTA 3JAMZ 3B02A 1USTA 4KN7X 4LLNA 2A68F 3WTYC 3C3WA 2XAGA 5E8GA 4L5IA 1WRJA 3N97A 2J5OA 2UXNA 3WGIA 5CVJA 1I1GA 4L18B 2PLYA 4KIBA 3RKWA 3MZHA 3R0AA 1V4RA 1P92A 2MA3A 2IW5A 5D8LB 3FMSA 2O8XA 4LFUA 4MNUA 1J0RA 3LA7A 1U5TB 1MDMB 1C0WA 1B59A 1FC3A 2XRNA 1BJAA 3HRTA 1T98A 3RYRA 5EEGA 4PGGA 1B6AA 1P4WA 3BROA 4KMFA 3WTTC 1ZG3A 1U5TC 1YFHA 4BNCA 3QRFF 5D5WB 1BC7C 3WE3A 5JFRA 3V8KA 2G9WA 3S2WA 3FM3A 2DAOA 2FSWA 3F3XA 5KVRA 4YFKF 2ZNZA 3ZMUA 3COAC 3CUQA 3PFIA 2Z33A 3QU3A 2EFWA 1ZG1A 2O03A 5HOOA 4ENKA 3GZ6A 2YU3A 1H9GA 1JE8A 3WTSC 3M1EA 2LDUA 2EJRA 4JQFA 4ASNA 1P4AA 5F64A 2P5VA 2MLKA 3LSTA 1WKMA 3LAJA 3LA2A 2NNNA 2K4BA 2Q0OA 3IC7A 3N4MA 4ZYEA 1XSVA 2O0YA 4L9JA 3F8CA 1D8KA 1ZN2A 3BDDA 2HWVA 4U88A 3JTGA
chains in the Genus database with same CATH superfamily
2A5WA 4KA4A 3ISPA 1QPMA 2IAIA 1HW5A 4J00A 3RYPA 5IOYA 4KISA 2O8KA 4UV8A 3WTZA 3LSIA 3M8FA 2YS9A 1N25A 2DQLA 4I98B 1MBHA 3HKZA 3KZIC 4G6QA 3M4OJ 4QSHA 2DFIA 4M3GA 2O5RA 2GIZA 3EETA 4UUVA 4CO8A 4CDGA 5CPRB 2V1XA 4O6JA 2K9NA 3W3CA 2VE9A 1HDDC 2OA4A 2MGQA 2HGCA 2JMWA 2HR3A 2Z99A 3GVAA 4E4HA 2B0LA 3K9TA 5DD4A 1WSUA 2R7ZJ 3GFIA 2PBIA 1X1AA 4MEYF 3HGGA 4QPOA 2E1MB 2W00A 3OYEA 3S16J 4UVAA 3S93A 3W2VA 2M34A 2FUG2 5L3GA 1K4SA 1X4OA 4WXHA 1VQ4I 4YRVA 4UB8C 1V3FA 4N9IA 3VWBA 2KJBA 4I76A 2VI6A 4MTEA 5DM7F 5HVQC 4XQFA 4MGRA 2O6GE 2E1MC 3KP5A 3KIOA 4BXFA 4XLHA 3BTJA 3ZOBA 2M2EA 3ABLH 4L9VA 2FQ3A 4A0YA 2A3SA 1AOYA 4PUSA 1FP2A 2QKMB 1S7AA 2K9SA 4AUXA 2L2OA 3U1KA 1YOVB 3HOUJ 3ULQB 4CA0A 2NVYJ 2XF6A 5E3NA 2ELHA 2FQ4A 1S29A 1TNTA 4L0ZB 2ETHA 2ELJA 3L2RA 4OINF 4HNTA 1T0FA 1LE8A 1WWXA 2RGVA 1K6YA 3OYFA 4GCVA 3CCSI 3HOTA 6PAXA 2Y9YA 5KHDA 1X3WB 3FZVA 3OYIA 2Z1DA 3F0CA 1LEBA 3K4KA 4KT5C 3SYTA 1Q1VA 3BQZA 4RB1A 3JAMK 2L01A 4Y13A 1I1SA 5HLIA 2VIXA 1AU7A 1JT0A 3I71A 3TP0A 1U5TA 1MDMA 3GTOJ 1WH7A 3H0GJ 3CLQA 3OS0A 1XB4A 1V5FA 1TWFJ 2KKOA 4C2TA 2R93J 4GFBA 2VC1A 2CO5A 2M3AA 3Q9VA 2DA1A 2K9QA 3WTWC 2EA2A 2KZGA 4N0BA 5LD2C 1D1AA 3K4LA 3DCFA 4IF4A 2R3SA 3GTMJ 2P4WA 5CJ9A 3GFMA 1E0EA 2QVOA 1BJZA 2PMZN 3OYMA 3NRVA 4BJ5C 2UUZA 2HYFA 2E5ZA 1SVOA 3V7RA 4IVNA 4Y33A 3WGHA 4PFPA 5DD8A 2O61A 3CLOA 2PFBA 3ELKA 3OL3A 3R60A 4CZCA 4CHUA 4O3MA 1R7JA 1GLNA 3R0JA 2HDCA 4OIOF 3K69A 2W7NA 1FOWA 1LUJB 3S3OA 1TT5B 1Z21A 4CCMA 1E2XA 3FXQA 4DGWB 4EV0A 1K83J 1YJ9I 3IH2A 4PJLA 3A1YA 1ETYA 2V79A 2PJRB 3CF2A 4CICA 2R7DA 1R4MB 4XKWA 1LPQA 5LEKA 3FXKA 2O9LA 2JSPA 4ENMA 1USSA 4M3EA 4NDLA 3A02A 1R23A 5LHIA 2DQRA 5HODA 2QM3A 1Z7UA 2LVSA 1G8XA 2ZJ2A 4YIFA 4A3IJ 1QZYA 2ZJPF 4KN4X 5E1ZB 2Q2EB 2P0WA 4AYBN 5EEAA 3F9KA 4D7MA 4DZPA 2ZFUA 4Q47A 2EB7A 3AL0B 3RKYA 5DUIA 1H89C 3HIFA 2LBFA 2L02A 1ACIA 5FROA 3A0HC 1R22A 5IY5H 1OCPA 2HOEA 4BYYA 1RR7A 1AHDP 1MH4A 2DK8A 1XX5A 3DLAA 4AYBA 3HOSA 1BIBA 1LJ9A 4AD9A 3AL0C 1LVKA 1PUFA 5IT9Z 4LGWA 2EZLA 1ON1A 2A61A 2CUEA 4Y3OA 4ZH4F 4XORA 1B72B 4ENNA 2F2EA 3AKZA 1OPCA 1FEXA 2VOPA 5FKMA 1HKSA 3NAUA 1WJFA 3MAJA 1BR1A 2EFPA 1T33A 4AIHA 1IUFA 2V6CA 2NS7A 2A6TA 1SVMA 1S9HA 2EV5A 4P96A 3CCEI 3ABTA 1QZEA 2ZJQF 2DMTA 1R6RA 2R7OA 2WBMA 3EYYA 2MSYA 1R1VA 3QPTA 2V9KA 4R79A 4D0PA 5L3BA 5E3LA 2VLAA 5J47A 1HKTA 2JQ7A 2JA7J 3FKIJ 4A93J 1YS7A 4LG0B 1OLTA 3DFGA 1HBXG 3IH4A 2DW4A 4E7LA 3V8JA 2XV4S 1O3RA 2MLGA 1G3SA 2OBPA 3W2AA 4XRSA 1WJEA 4M72A 5JLWA 4OMZA 4UUSB 3BZKA 4JX5A 4A3LJ 4CCLA 1I5ZA 3J7ZI 3ZN1A 1K78B 4CGZA 3V8LA 2R7TA 5HS7A 5CKTA 1U8RA 1R71A 1ZGAA 2XKPA 2L5QA 3BR1A 4C2UA 1OYWA 4F55A 4XKVA 1VQMI 3ZR8X 2X51A 1K6OA 1TLHB 2K5CA 2ZXIA 4XKBA 2IRFG 3S15J 4G8XA 1QZZA 3DF8A 3CP2A 1JKQC 2F5EA 2HU9A 1FIAA 4WK8F 2JA6J 1IF1A 1YS6A 5FRMA 3OS2A 4FASD 3E6MA 2IGKA 3G71I 3C2GA 1HKQA 2YX4A 5KNLA 2XASA 3ZP5A 1IN7A 2JPBA 5ILVA 4EMSA 4XOPA 1QQIA 2HEOA 1X19A 3R6SA 1W36C 3REOA 2EINH 1MJBA 1B9MA 1Q1HA 2H27A 4M74A 3NQOA 3O3KA 4B3AA 4CCJA 1MD0A 1U9OA 1XD7A 3K7AJ 3I4PA 2K02A 3I4NJ 1ZRCA 1A5JA 2CW8A 1VQPI 3G1MA 3AG3H 1IZ1A 3RJPA 2P6SA 4RGRA 4E70A 2X0LA 3Q0UA 1KGSA 1HW1A 1H9TA 3H1CA 2L7KA 1MKMA 2G7HA 1B8IB 3KCCA 1QRYA 3OYGA 5JLXA 2P7CB 2Y0MA 4ESJA 2BW3B 3FM5A 2IS2A 2DMPA 1EV7A 3FXUA 3ASOH 4RLFA 4IHVA 2E1NA 2KRFA 2VOOA 4KYWA 2DT5A 2YUSA 1LKXA 4IQ4A 3L2WA 4MTDA 4DQ2A 1LDJA 2ZMEB 2XDVA 1NG7A 1OCCH 1NHAA 2ECCA 1FLIA 3F8FA 3T1BA 2DTZA 5K1YA 1HLVA 4IHYA 2DI3A 4CYDA 2QSGX 1XGNA 2CJJA 3S3MA 2JJ7A 3FWEA 3T8RA 3CMMA 5IOZA 3BG6A 2L9VA 3DTEA 5K7HA 1E3HA 3G1LA 1LQ1A 2PJRA 2ZMEC 5GADJ 5M5WJ 3BR6A 1WCMJ 3HGYA 1XN7A 2AXTC 2F5VA 1YJNI 2IEKA 2DYRH 3BR3A 4AIJA 2HXIA 3DP7A 4H0EA 3L09A 5H20A 1PDNC 1W36D 3BJ6A 4EM1A 5GAHJ 3K2AA 4KDPA 4WF2A 4OU0A 5D5VB 1VZ0A 1Y0NA 2Q2EA 4M6YA 4Y7NJ 4LG3A 3MZ8A 4I01A 3VOEA 4BUPA 4WX9A 2M9HA 2LK2A 4FQGA 2DTRA 1HSTA 3S2DJ 2LF8A 4P5OA 4B1RA 2X1EA 2QA4I 4X6AJ 2FMLA 3RCOA 1R4NB 3BG9A 3VODA 1A35A 1FTTA 3HTSB 2KMUA 3ABUA 1Z77A 1M1EB 1OQYA 2EH3A 1X1CA 2HPIA 4HX8A 4FE7A 5DCFA 1MW7A 3BZ6A 4HLXA 5LGNA 4X0GA 3W2WA 2X9DA 3ZMTA 2XHKA 5FGMA 3HSRA 5E1WA 4C3HJ 1B72A 2X1CA 1IDYA 3G6EI 4GXOA 5F6FA 1I3AA 2ESHA 2XSJC 2PMHA 3PQJA 5A2QZ 2W1OA 2W24A 3MWMA 3F8NA 5F27A 3CUQC 4RB2C 3S32A 5LBQA 4HDUA 4DBRA 4DYQA 1OCZH 4FISA 3QU6A 4Z6YA 2Z9OA 4P55A 1IV6A 2LNBA 3TOBA 4B44A 1P2FA 1XDSA 3QYFA 1Z6TA 3RKXA 1XGSA 1RRJA 2BEOA 3HPHA 3MD2A 2RNJA 4LMYA 5GPCA 1ZGWA 1K79A 1GHCA 1ENHA 4HOBA 1IGNA 2H8WA 4YIRX 2FA5A 2RV8A 4LIVA 4EM0B 4LG0A 1B9NA 4BQAA 5CQGA 4XOTA 1IXRC 2LREA 3W6JB 3CF5F 3KP2A 1MNMC 1N75A 4UUSA 1SD4A 2EK5A 4KNYA 1K78A 2NAZA 3LSGA 3HG9A 3F22A 1EH8A 1OFCX 3GX4X 1HDPA 3LWFA 2ZJRF 5KCMA 5IT9K 2I5UA 2QEXI 1I3QJ 1K7AA 2YX7A 2Z5UA 3ZXSA 2X6OA 2EFNA 5E8IA 3OR2C 2P81A 3ZRGA 1IV8A 4XMYA 2NXNB 4ESBA 3CJQB 3O2PE 1Z7LA 1T08B 3S14J 3BG3A 3HHHA 4PGHA 2E1OA 4D7NA 3H5RA 4IL6C 1PP7U 2DJIA 4HX7A 1YIJI 4JP0A 4RB3C 3QP5A 1NH3A 4AIKA 4ENJA 4HW0A 2K9LA 2LG4A 2DOFA 3GTKJ 2ECBA 3PQKA 4HV6A 1MBKA 3QPSA 1XGOA 2ELKA 2MH9A 5IP7J 1JKOC 3CJTB 2NVQJ 5EF6A 3W6VA 1IRXA 4RAZA 2Y9ZA 3EQLF 1CGPA 1NK3P 2L9NA 1FOYA 3ABMH 5LRSA 2E1CA 2BHZA 1UB9A 3RZDJ 1FBQA 2F5FA 1Z0XA 4GO1A 2DA7A 3GFLA 5J8CA 2KJCA 4KJZA 1B8IA 1X2MA 2F4MB 1LNWA 2BVMA 4GRIA 1ZRDA 1T95A 2BW3A 1G6NA 3CDIA 2OZ6A 4FTHA 3BCBA 2W4SA 3ZQIA 2GXAA 1TQPA 4B8XA 1R5HA 2W25A 2ZMEA 1MMAA 2H1KA 5F0CA 5IYBJ 3RKQA 1JHFA 2M4KA 1ZLJA 5GPAA 2ESNA 3ZQ7A 2Y2ZA 1UFMA 2GBYA 1O3SA 2V7FA 3K6GA 2PEXA 5KK1A 3BZCA 4BHCA 1TWAJ 1N77A 1SFUA 4Q4ZF 4MO7A 1ODDA 1A36A 1W1WE 2D5VA 4E7ZA 5EGOB 4ZDOA 4XRSG 2IT0A 3KE2A 5E18F 3UKGA 3BJOA 4RAFA 2OUMA 2ISZA 2DA3A 3HYIA 3CCVI 1A31A 4QPQA 2VJJA 2HDDA 2OPTA 3HTUA 2XAJA 2QGUA 3KZZA 2EBIA 5FB2A 3GW2A 2WA0A 1FP1D 4XR6A 1R36A 2B7EA 2DO7A 4M9XA 3O8HA 3EDPA 1FOKA 3U21A 1HW2A 2DMQA 3CUOA 2E60A 1PVEA 4CSWA 2E35A 2VKDA 1VQ9I 2MG4A 2DOEA 4V19K 4II3A 1IN6A 1R1TA 3VSKA 5LLQA 2XC7A 4A12A 4IRGA 4IZZA 1SMTA 1ORKA 1OYYA 1TZLA 2FRHA 3C2BA 2D45A 3P5JA 3IWFA 1VQOI 3K4CA 4HF0A 4LIUA 3OOPA 2E7XA 2HPMA 3I59B 1YITI 1I50J 5L3DA 2R5ZB 5E3MA 2MD5A 3F23A 1OKRA 2XGXA 4PJ0C 5FFZA 5DM6F 1P7JA 3CCQI 1YLFA 4JOMA 5FKKA 5E3OA 1JGSA 1ZLKA 3KLOA 5LGUA 2RVCA 3DV8A 2E7WA 5J1YA 3Q5FA 2JA5J 1FYLA 2UZKA 3GMEA 2FMYA 5BS6A 3X2QH 1VF9A 1RPWA 3FK7A 3HEFA 3TKYA 4BKXA 4A69C 5L3EA 5M3MJ 5D5UB 1OCRH 3HXLA 3WU1B 3O8GA 3P9IA 2GQQA 3M7GA 2DK5A 3ZMZA 1REPC 1R5ID 4XSZF 3IRRA 4L9NA 1XMAA 1KZHA 3Q0WA 4RAGA 1QO0D 3DKYA 4LD5A 1Z91A 5HLHA 3I53A 5L3CA 2F4IA 4E7SA 2XF5A 2VBWA 3N05A 1WH5A 3BLYA 3SQNA 1YI2I 2MC3A 2COBA 3VFZA 2WWYA 5LGTA 2OV7A 1BW6A 4NHJA 3E6BA 2WAEA 2WAFA 2HKXA 4NB5A 4BE1A 2DOAA 3SXYA 4NBQA 1Y0UA 4UUTA 2BY0A 4CXFA 2QQAA 5AONA 1TQIA 1PJRA 3LSMA 2IBDA 1R58A 5FKNA 4YFXF 2G7UA 1S3JA 4A0ZA 2DT6A 2VJ4A 1P4XA 2NRAC 5A2QK 1IRGA 3H3UA 1FSHA 1G4DA 2HKOA 3KEYA 2CUFA 3DEWA 2BE5F 4FX0A 4EGYA 5J1RA 1JHHA 2CW7A 1NG6A 1S7EA 1JJ6C 3TO6A 2V6EA 1XTAA 2K27A 4HNVA 4JX4A 5H6RA 4DZJA 3HOWJ 2LY1A 2ADUA 3D1NI 1QPIA 3F6OA 3OYBA 1IRFA 2EA4A 5TRDA 5AIQA 5IYDJ 2VKVA 2XAFA 3P9CA 4HX4A 4XRFA 3IL2A 4U0VA 3CTAA 4AWXB 1FZPB 1D5VA 1NTCA 3KX2A 1F4KA 2CS3A 2F5DA 1P6RA 2EFOA 2M30A 3EUKL 2LD5A 1MBEA 2JUCA 1TNSA 3RSNA 2OF7A 3GBGA 1V54H 4GYIA 5LFAA 1JUMA 4E7JA 2WV0A 3KETA 3I54A 1Y39A 1UJ8A 2GZWA 4ZZLA 3ZPLA 1GV2A 2AQFA 2STTA 3Q9SA 1T39A 3WTVC 3M8EA 4M3FA 1YQAA 1JXSA 2TDXA 3L1PA 4HF2A 4LOCA 5F08A 5IP9J 5LHGA 2QZ8A 3I0TA 2OC6A 2L4MA 2R7RA 1UG0A 3L2UA 1BOAA 2NVXJ 2K3FA 1UHMA 2Q8KA 3J7AY 4ZYHA 2WTEA 4LK0F 2P5KA 1MBJA 3ZQHA 3PIOF 2ISYA 4M3BA 2BV6A 5EGOA 3AG1H 4F52A 2FXAA 1G3YA 2LOOA 2BXZA 3I55I 1OYIA 3E3VA 3M3YJ 5D6EA 4ZDPA 4RAYA 3KFWX 1T38A 2JTVA 3BTIA 4BE2A 1PP8F 1PYVA 4IQJA 4BH9A 2JSCA 1J2XA 3H0DA 4PJJA 1HC8A 3VYTB 5E17F 2VT2A 4YELA 4KMUX 1QU3A 5D4SA 2STWA 2Y0SN 1XS9A 3FXJA 4PZJA 1D0YA 1DPRA 3VYUB 1KQ9A 1WVRA 1TQMA 2CQNA 3M8JA 4IO9F 5EYRA 4CH7A 1JUPA 2Y30A 3EUHC 2CWEA 1WJDA 4ZYDA 1U9NA 5CYVA 3OYDA 3JSPA 3HOYJ 2HQNA 2KIUA 3LFUA 2GA1A 3JRCA 1WQ2A 2PMZA 4JBAA 2EFQA 4BL0B 3I59A 3K1NA 4LLGF 1WI9A 2R5ZA 2Y0SA 2ZB9A 1IXCA 4IJAA 5J4YA 4MEXF 2M1BA 2WAQN 4CCKA 2GXBA 5DCMB 1SFEA 4HA8A 3OSFA 5B5EC 5IT3A 3CC4I 2A6EF 4KICA 4Q48A 1FMWA 2W82A 3H35A 4XLAA 1WGXA 2IA0A 2JA2A 2D1VA 1T56A 3DKXA 3V7CA 2EIKH 2GAUA 3H9GA 5ILSA 3CCRI 2EV6A 1GVJA 4BXXJ 4BHBA 4FX4A 1TL8A 2WAQA 4D1QA 4IHXA 4CCOA 3MKZA 1E17A 5JVTA 3BTLA 2NNYA 1ITYA 1Z9CA 1ETKA 1VTNC 5HDKA 3CO6C 2Y48A 4XLEA 1TP4A 1B4AA 2A69F 5CVUA 4E7IA 1D0ZA 2HFHA 2FOWA 4BEHB 4FETA 4ZTFA 3ERMA 5E79C 3RPUD 3V42A 1I39A 1DP7P 1DQUA 3HRMA 3CDHA 3JSOA 4EJOA 3ABKH 5HS8A 1LDKB 2ZXJA 1LDDA 3HJEA 3VB2A 2LY9A 1HOMA 3BG7A 3ECHA 1MJ9A 3A03A 5JHFA 1YHQI 3K4MA 4DNCA 3CQZJ 4ZJZA 3OYJA 3HUGB 2KIMA 3S1MJ 4MLOA 1BI1A 2ZCWA 5FO5A 3E6DA 4Y52J 2NOGA 3BG5A 1XG1A 4RM3A 3BTCA 4J01A 3OYLA 1Y6IA 3FF5A 4HAMA 2LP0A 1DPUA 2BY2A 3C7JA 2ACJA 3HRUA 3J81Z 1RC9A 2OTJI 1JI8A 3KLNA 2VQCA 3V4GA 1ZELA 1FWZA 3KP6A 5FKLA 4HG2A 3FXRA 4M6XA 1MNEA 2XPWA 2H8RA 2Y31A 1ZK8A 5M5XJ 4DW6A 1RIOH 3BJAA 4F3QA 1DDNA 2A05A 1TBXA 2CFXA 4L9TA 4R8HA 3WHBA 4G7HF 9ANTA 2VBZA 4I09A 2VKEA 3FXLA 2HZTA 2IS1A 4FHTA 3BQYA 2DPDA 1X3UA 3OWTA 1JUSA 2R92J 1B1BA 3E1SA 5C44J 3CDLA 2JPCA 2VB6A 2EIMH 2HVRA 3SEZA 3H5NA 1IN5A 1XCVA 4BDZA 2FJ1A 1MMNA 1A6QA 3RPQA 5M5YJ 1XSXA 2BXYA 1J09A 2HQRA 1SFKA 2VASA 1TWHJ 2VXZA 3TQNA 5ICGA 3S1RJ 1JTXA 4UVBA 1RNLA 2JK3A 4W97A 3OR1C 2XF7A 3C18A 3K70C 2EZHA 4LJZF 1H0MA 3HB9A 3AG2H 4C2MJ 3FK6A 1S7OA 3BWGA 1FNNA 3IP4B 3F21A 3ERED 5BNGA 2QBYB 2HI3A 1HQCA 2VJIA 3B6AA 1GXPA 3H3VK 2KRCA 5F0FA 2RQPA 4GYGA 3WU0A 1FTZA 2LR8A 1BM9A 4A3EJ 1Z05A 2LLKA 3M9AA 3IV5A 4PDKA 1QVTA 2IA1A 2PG4A 3ZMSA 4S0HB 1RKTA 1FSEA 2AO9A 5ED4A 2WY7Q 2VT3A 1Y1WJ 2GXGA 1FT9A 1TW3A 3U9GA 3EUHA 5K7ZA 1VFCA 4MIMA 5CVVA 3DWLE 3P9KA 5HDGA 4GGGA 4P9FA 2QUFA 3I3LA 3GEZA 1W4MA 5KAIC 5TJJA 3QYEA 3ROUA 1BI3A 2BOLA 1ZKGA 1HCRA 2FD5A 1BC8C 1JTYA 3JRDA 3T0YA 3K4BA 5EZHA 2OQGA 2DBBA 3D5LA 2F6CA 3KP7A 4Y17A 3OL4A 2XAHA 5GP9A 1XMKA 2OD5A 2VPRA 3TO9A 4AVPA 5KAFC 3DPUA 1BL0A 3HOXJ 2M0CA 3HOVJ 1D1BA 3K1MA 3L9FA 1G3TA 4V2GA 2VKHA 2RC4A 4A5MA 5D4RA 3A4CA 3NARA 4P9UA 4WCGA 1O7LA 2LKSA 5CLSA 1O57A 5DCMA 1L0OC 3GTPJ 1BIAA 3D5SC 1GV5A 3NWSA 3P7NA 2FBHA 3U1DA 3I5UA 4ETSA 4HF1A 1RUOA 5C4XJ 5ICCA 4XONA 3OIQA 4OIRF 3LSPA 4EATA 1QBJA 3K70D 5EJCA 3L2VA 4ZTJA 5E1XA 1GT0C 1YX5A 3HPGA 1HF0A 2EV0A 4DYRA 4LITA 1MBFA 3WGGA 1FBSA 4RDUA 1K4TA 1FIPA 2COMA 3S1NJ 1EH7A 2X48A 1H8AC 2VJ5A 3GXOA 3F8MA 2CV1A 2DCEA 1JT6A 1X1BA 3CMAI 1MSFC 1VQ7I 4BY1J 2R7WA 3B6CA 2ZC2A 4MQVA 4HLYA 2LH9A 4BEHA 2W84A 2IS6A 2JRMA 4RBOA 5EEHA 1VQ6I 2VE8A 4DBQA 1APLC 2IA2A 3A0BC 3MKYB 1XPXA 2ZBKA 4G6DA 4XM3A 2H6BA 3RI4A 4ITVA 2UXXA 1FYKA 2O7OA 2RNGA 2GA2A 3HDDA 3HUGA 1YTYA 5J40A 4M9SA 1AA7A 2WY8Q 4XRMA 3GTGJ 4JK1X 2FX0A 4P1WA 3DEEA 3GZ5A 3KPHA 3EPZA 2CUJA 1AWCA 5JHUA 2QENA 4C30A 1DP3A 1TT0A 3VYSB 3J7YJ 1O3TA 2UV1A 3BPVA 3FHZA 4HPQA 3TL4X 3OYKA 3MFKA 2VBYA 2EIJH 3T8TA 5M3FJ 4MQ9F 2XAQA 4UB6C 1NK2P 1R5GA 4UNOA 4I0AA 4KIFA 3CCMI 2X1DA 2ZSHB 3PNTA 2OJED 2FOKA 2XIGA 4BHPA 4HV5A 2IXSA 2XUBA 1FBUA 3FBNB 1ZR4A 3PO3J 4AVZA 3Q3SA 3MQ0A 1Z6RA 2DT7B 2K85A 5E20A 2BYVE 4MHGA 2AS5F 2IGNA 3W6KB 1SVLA 4LB6B 3VYRB 2H1LA 2KRHA 4KITB 1UG2A 3H9JA 3IHUA 1BOBA 2CRGA 3K4JA 1HXDA 4BQOA 1F36A 3FX3A 2M8GX 2CQQA 1ZHFA 2K3PA 1Z3YA 3QYBA 5HS9A 2V4JC 1FPQA 2DLLA 1KYWA 1VQ5I 3OYNA 2PMUA 5DYMA 2FBIA 2DFFA 3KZYA 2R0QC 3MEXA 4ABZA 1UHSA 2LKPA 3TW6A 2K7LA 1S8NA 1X2NA 3E97A 2IP2A 3ZGKA 4A0XA 1IC8A 5LEJA 2P5LC 2W48A 4BQQA 1SEUA 1MH3A 1WFXA 2QBYA 1EH6A 1ETWA 4D5CA 1IUYA 4HZFA 3O6BB 4A3CJ 2K4JA 5IYCJ 3TP3A 2UWMA 3QQAA 3R61A 2XPVA 1KU3A 1VI0A 5DTDA 1W5CC 1KQ0A 5BMZA 4L0YB 1D5YA 2BY3A 4YG2F 3IAM2 2K9MA 2VL8A 3TBIA 3HBLA 3PUFA 2QYOA 4YEJA 3SZTA 3QODA 5ILUA 3E6CC 3PL8A 2PN6A 3QWLA 4KIGA 2TCTA 5JI6A 4A3BJ 1UMQA 2KISA 5J4VA 3IUOA 1UZCA 1TW2A 5IP6A 4A3JJ 3DU6A 3LSKA 4XN3A 1W5SA 2M4GA 5DUKA 2DDBA 3GO5A 3TO7A 4HQEA 1ZR2A 1CQTA 4KFCA 4BBSJ 4XBFA 3CP8A 1WJ5A 3KP4A 2KIFA 3SDBA 1Z67A 2BGCA 3K4NA 1IW7F 2DN0A 1QVUA 4ZZDA 4A2UA 3IKTA 1W5TA 3OV8A 1D0XA 1G3WA 3JRBA 5GTIC 2QWWA 3LNQA 1SFXA 2H6CA 3EUAA 5B1AH 3CESA 2Y69H 3RQ4A 1QHHD 5EDNA 3FISA 3ZQLA 1FYMA 5HNHA 4PK4A 1YG2A 2XSDC 1DU0A 4LB5A 3BC8A 1O7FA 3WODF 2PJPA 3GWZA 4DYCA 4H4KC 1LEAA 2ZO4A 4M71A 1U3EM 3JW4A 1I6HJ 4BGDA 4OIQF 3GUDA 2XPUA 3I58A 1CF7B 1POGA 3G2BA 5FLXZ 2HYGD 4BU2A 4A6DA 1BI2A 3FMRA 2DMUA 4F93B 2X85A 3NEUA 5DS9A 4EM2A 2W85A 3SFZA 2NVUB 2M7AA 2VQHA 2OTLI 3MVPA 1JJ8C 2GOMA 4KT6A 4S04A 1EJ9A 1LFPA 5J1UA 2H94A 2NYXA 1YW9A 3E5QA 3JRAA 1LFBA 1GVDA 2WADA 5AIPA 3HRSA 3I4MJ 2EWNA 2HDWA 2ID6A 2NS0A 4I6ZA 1I27A 4RM2A 1EF4A 3DPLC 4HDVA 3A01B 3CMYA 3TDZC 4A3GJ 2ID3A 3QOEA 1FMVA 2GIVA 5D6FA 2M8EA 2QSFX 3I64A 3I56I 1PUEE 3ECOA 2O3FA 2LTPA 4IX7A 2E34A 3K0LA 4OWRB 3PJRA 2OQRA 3DLLF 3M1CA 3DQVC 4NC6A 3DXJF 2KP6A 4CUGA 3LSRA 2Z3YA 3L7WA 4X1EA 1WHUA 2B63J 2VC0A 5TGTA 3IRQA 2E36A 4XSXF 2FBKA 4WXDA 4EEFG 2XROA 3QP6A 2R7QA 3HKZN 4B48A 1RKWA 2HQ5A 4AM3A 2BVLA 2H09A 2E71A 2XB0X 3PIPF 2DXIA 1YW7A 1ZREA 1Y8QB 1F43A 1MSEC 2HVSA 2R7SA 1MIJA 1JGGA 1ZQ3P 2KHMA 2FU4A 4NC7A 4AU7A 5GAGJ 1BBYA 5FLMJ 2LRDA 1ZARA 1IRZA 5K5QA 3DU5A 4O5VA 4RLQA 1XDUA 3F6VA 1RI7A 1RZ4A 2QQ8A 3OYHA 3CCJI 3RIRA 4RS8A 1OR7C 2DYSH 1V55H 3S2HJ 5H2FC 1BR4A 3JRIA 4IHTA 4U7BA 4NQWB 2AXLA 2OU2A 1GUUA 1VNDA 3OMYA 3MKLA 4IOCF 1VQNI 3ASNH 5F1JA 3DKWA 4I02A 2EPFA 2MBFA 3FMQA 4JYKA 1U8BA 4ZC3A 1MJAA 2CH0A 1DU6A 1Z1DA 1T6SA 4RGUA 4J19A 4IEJA 1RUNA 1D3YA 5C3EJ 3G73A 3DBRB 2DFHA 3BR5A 1YYVA 3FBIB 1VQ8I 1E3PA 2QQ9A 3GFJA 3LOCA 3RTRA 2OZUA 4U7DA 2VXDA 1U6GA 1XCBA 5EZGA 3BT9A 2V1UA 2LC2A 2CV2A 2KPMA 3FDYA 3GZNB 3BOQA 4Q5SF 1WPKA 2IJLA 1BN5A 1LFUP 3SHFA 2CQKA 4EJUA 3SJMA 3HHGA 3RZOJ 3QPHA 4QWQA 2R5YB 1A04A 1SFOJ 3FXMA 1IAWA 2P7VB 1F9NA 1ZGJA 2L4AA 1W7PB 3OIPA 2DODA 2KT0A 1R00A 2HZDA 2I10A 3FXOA 3JRGA 2CYYA 3A2KA 3VPRA 2GM4A 2LMDA 3PNVA 2ME0A 4BE0A 3DEUA 1E3OC 1QA6A 4BJ6C 4E7KA 3WG9A 3WTXC 2A6HF 2MC4A 2ZNYA 4HSRA 2VODA 2KQRA 1FY7A 2MH2A 3UNGC 1L3LA 4EJVA 5FD6A 1BI0A 2BZTA 4V2FA 2XB5A 5JR3A 1CF7A 2LSOA 2FNAA 3QPLA 4QLCU 1S5LC 3J80Z 2FE3A 2CSOA 1G2HA 3LSJA 1HA8A 3HZJA 4PFOA 2OCEA 2MYSA 5FFXA 4OOIA 4XLNF 2IVMA 2E5NA 4FCYA 2BY1A 1R1UA 4U0WA 1XMXA 4YFNF 2L9RA 3BP8A 2HTSA 2A5YB 4HRIA 3HOZJ 4IRHA 3GTQJ 4G94A 3K2ZA 2RDPA 4ZYGA 1ETQA 2DA5A 4G12A 4N9HA 4G7OF 2XRLA 3R4KA 3DPTA 4I0BA 4GDFA 3H36A 1X1PA 3ESWB 1YE9A 3PNYA 4A5NA 3TDUC 4KUMA 4W1UA 5IPAA 2CFOA 3I9V2 5BPDA 3E0JB 3A01A 5ERIA 3GLXA 4R1HA 3KYDB 3WTUC 1EKEA 1ERDA 1N78A 3LA3A 2Y75A 2KL4A 5K5OA 4CZZA 3JREA 2XGCA 2P8TA 2XKOA 4C3IJ 3G1OA 1MMDA 3CMEI 3MKWB 4TV7A 3V7SA 2A07F 5FLXK 4A3KJ 3BR2A 3VEPA 1DGRM 2M7BA 2YR2A 4EGZA 1TC3C 2C6YA 1QNTA 2GWRA 2L0KA 2KZVA 1KQ8A 3KYCB 3CD6I 4XICA 3LMMA 2Z2SB 2HXOA 4RGSA 2K40A 5TISC 4HSTA 1BA5A 1W7PD 3CCLI 1ULYA 5FKOA 3MCZA 4M6VA 5B1BH 2LF7A 4ZDLA 2HTJA 2MD0A 3QAHA 3SDGA 1X3ZB 2ME6A 3WE2A 3OY9A 1VQLI 2Z16A 3EYIA 1UHWA 2E2HJ 3CCYA 5K5RA 1OR7A 4E6KG 1U0JA 4PSWA 3B73A 2GOXB 2XGEA 1IJWC 4U87A 4BDYA 1ZRFA 3BY6A 3ZQQA 3L00A 5LHHA 5DV5A 5BOXA 2TRTA 2IS4A 3LQQA 3G3ZA 4UVCA 1H88C 3M07A 1ZAOA 4U0YA 3DTIA 3TMOA 5BPIA 2E2JJ 1YO5C 3K1PA 1LB2A 3MZYA 4BBRJ 3AAFA 2CGPA 4QTRA 1IG7A 1IO2A 3JRFA 2JZYA 2WC2A 4NQWA 2L7ZA 3RDIA 3HM5A 2QF7A 5L3FA 4G7ZF 4EQQA 2RREA 3VSLA 3HSEA 1DGWY 4OAZA 2VQGA 3MMYB 4HBLA 4NC8A 1Y8RB 3TOAA 4ESFA 3CC7I 1J59A 3OIOA 1D1CA 1IN8A 2QQBA 3IH3A 4UV9A 2NOJB 1GXQA 5C4JJ 1FX7A 4IPAA 3F8BA 1WJAA 2FF4A 2HS5A 2CW0F 1SC7A 4IRIA 2OAZA 2HOAA 3PSFA 4DJAA 2W57A 2M87A 2D1HA 2JN6A 2DA2A 3SZGA 3KP3A 2Q1ZB 1KU9A 3VDXA 2N8GA 2DA4A 4OAYA 3RPUA 4WWCA 3E5UA 1HSJA 3ZQFA 4I2OA 3TW7A 1SD5A 4XL9A 1FJLA 2IGOA 2BBYA 2VONA 5FLVA 1U78A 1SD7A 5EG0B 2V26A 4L5JA 3KEOA 4S05A 2F5CA 5J8FA 1ETVA 2R5YA 1DUXC 2LYCA 3LQRA 4LK1F 2V9PA 1R9TJ 4UHTA 4F7ZA 1W7PA 1RR8C 5CVRA 4A6EA 2AHQA 4B09A 5FD5A 1J5YA 4YIIA 4ANJA 4N4OB 4BACA 4D5FA 1LVAA 2R7XA 4XLPF 1XGMA 4M3DA 4HEA2 2CQXA 2JA8J 4Z2YA 2QSHX 2KDOA 1F5TA 4OMYA 3T5XA 3IKVA 4RB0A 4AIDA 5GTHC 5HLGA 2E2IJ 2ZKZA 2M5WA 3LFKA 5CVIA 1P9QC 3KEQA 2RKHA 3GTJJ 2XVCA 4BXUA 2EILH 3L2CA 2EQRA 3CJRB 5F0HA 3LAPA 4F91B 3UR3C 3H92A 1J75A 1X4PA 5FRNA 4BS9A 3RQIA 1QGPA 1ZYRF 1ONVA 1WJBA 4I7HA 1TWCJ 2DJNA 2XAUA 1OMIA 4M9ZA 2JUGA 1UCRA 2CMPA 4K2EA 4ON0A 1ON2A 3PO2J 1FOXA 3CZ6A 5B3SH 2YSRA 1STZA 4M73A 4PSXA 3OOUA 1A6IA 3H3ZA 4I99C 4EJWA 1WJCA 4MFDA 2HOTA 2DU9A 1OISA 4PCQA 5J3LA 2YPRA 4XNFA 3H9QA 4XK4A 1IDZA 3ZN0A 1KYZA 2L7FP 2NVTJ 1U2WA 1O3QA 1J7KA 2HYJA 2GLOA 3S1QJ 2L3DA 2JVHA 1MMSA 5ICEA 4HYEA 5D8KB 4HQMA 3D0SA 1S72I 1RESA 5J6XA 3HL2A 4Y15A 1IN4A 3OS1A 1AKHB 4RMNA 3TGNA 1F1ZA 3GTLJ 4UXNA 4BAYA 4CYCB 2R7VA 3J80K 3ZQCA 4EJTA 2L54A 3BPXA 2B9SA 3QOPA 3SZPA 4DOZA 1YIOA 1T2KA 2M45A 3S17J 4FE4A 2PI0A 4MFEA 2CG4A 5HLTA 3DBHB 2DA6A 1S6LA 2RN7A 3CUQB 3GYHX 2DFEA 5DDGA 2V1DA 1XSDA 3C1DA 3GF2A 3HSFA 1Y1VJ 4B3XA 3DBLB 3E5XA 5DEQA 4NNJA 1V5GA 1IXSB 2FEZA 2IPQX 4IOAF 4RGXA 4Y4RA 5JVGF 2ZFWA 3CJNA 2RAEA 1MZBA 5B66C 5F04A 1ZH5A 2JRTA 1J9IA 5BQTA 1RETA 3HC7A 1YW8A 2I8DA 1I6XA 3OYCA 4FT8A 4G6TB 3IWZA 2D2WA 3F72A 3JR9A 1KONA 4ZYAA 5H6QA 2VN2A 5HDNA 2X6WA 4C9YA 2J5PA 4PJMA 3Q0VA 3ZMVA 5F1RA 2JT1A 4QIWN 4IHSA 2VUMJ 2V9VA 3JCUC 3ML6A 4XLCA 2DPUA 4LLLA 4IXAA 3E7LA 4XIDA 3CO7C 2PQ8A 1YRNB 5ICFA 2VQLA 3ZCOA 4HNUA 1SD6A 1VQKI 1Y56A 2ICWG 2CV0A 1KU2A 3MN2A 1G59A 1SMYF 4N4NB 2L9SA 3DTKA 1SAXA 2VBXA 2P6TA 5LRRA 4XLFA 5CQEA 4BJTA 5D5XB 2FNPA 4WXCA 2JWTA 1KA8A 1TTYA 4G9YA 1ETXA 2EZIA 3S8PA 3U2RA 4B47A 2QLZA 4EVIA 2KLOA 2R7FA 1KU7A 1MMGA 3JTHA 3J7AO 1D8JA 2HQAA 1MBGA 2RQQA 2G0EA 4OIPF 3J81K 2K86A 4CCNA 2DMNA 1ZG5A 2X4HA 3ZMDA 1MGTA 2WB1N 4XKCA 3JAMZ 4A3DJ 3B02A 1USTA 4KN7X 1K61A 3IAS2 1P7IA 2EZKA 2A68F 4NUBA 1YJWI 4LLNA 2LFBA 5EG0A 3WTYC 1V5EA 3C3WA 4B43A 1YX3A 2XAGA 3OSGA 5E8GA 2BHYA 4L5IA 1WRJA 1MNDA 5HNFA 3N97A 2J5OA 2UXNA 3WGIA 5CVJA 4E7HA 2HOSA 4A3MJ 1I1GA 1JKRC 4PJNA 4L18B 2WB1A 3WG7H 2PLYA 1BW5A 1OCTC 4UY8I 3WHCA 4KIBA 4BY7J 3RKWA 2CUZA 1W0TA 3H5AA 3S3NA 1T8IA 3MZHA 3R0AA 3GLLA 1V4RA 1P92A 3PM1A 2MA3A 3K10A 4JX6A 2CQ7A 3BCAA 2IW5A 1XC5A 4RA2A 5D8LB 1W0UA 2MW8A 3FMSA 1R49A 1LE8B 2O8XA 2LY2A 4IKFA 2KIQA 1JKPC 1WI3A 4II2A 4LFUA 3LL7A 3D5RC 3PSIA 4MNUA 2YU9J 1SANA 1J0RA 3LA7A 3SFIA 1WZ2A 1T0FC 1U5TB 3SEQA 1MDMB 2R4GA 2X6YA 1B59A 1C0WA 1Z3XA 2AQEA 2E19A 3FKJA 1UELB 1FC3A 2JVGA 3G4SI 2XRNA 3AG4H 3C2HA 1BJAA 1X1DA 4D9JA 3HRTA 1T98A 3RYRA 5EEGA 4PGGA 1B6AA 1OCOH 1P4WA 3BROA 4DIQA 3WTTC 1ZG3A 4KMFA 1U5TC 1OJLA 4C3JJ 1YFHA 4BNCA 2PX9A 3QRFF 5D5WB 1BC7C 3WE3A 5JFRA 3V8KA 3LSHA 3ONQA 1ETOA 1UAAA 2G9WA 2DDAA 3S2WA 1AKHA 4F92B 4CYCA 3ZQGA 2VPLA 2MABA 3FM3A 2WV1A 2DAOA 2FSWA 1ZTRA 5K7FA 4L5EA 1SAUA 3FIWA 2IGMA 4A3FJ 2HVQA 3F3XA 1GDTA 3L2QA 3BR0A 5KVRA 4YFKF 2ZNZA 4XN0A 3ZMUA 3CUQA 3COAC 5FJ8J 3PUBA 3TEDA 2V1NA 1EA3A 2X6XA 1TWGJ 3PFIA 2Z33A 3QU3A 2EFWA 4BQNA 2O03A 5HOOA 4ENKA 4AC0A 2LKXA 1ZG1A 4IHWA 3GZ6A 2YU3A 2M0MA 2NS8A 3PFYA 2ZSIB 1H9GA 1JE8A 2KDZA 3WTSC 2CU7A 2F48A 3M1EA 3WU2C 1BR2A 2LDUA 3JRHA 2ZXWH 2EJRA 2HNHA 4JQFA 3OYAA 2MFZA 3AFHA 3KYLA 3GCMA 2L7MP 2R7UA 2XGDA 4ASNA 2QCOA 1P4AA 5F64A 2P5VA 2MLKA 3LSTA 2LBFB 1WKMA 3FHNA 2QKLB 2KFDA 3LAJA 2ZXHA 3CCUI 1QHGA 2OCCH 1X58A 3LA2A 2NNNA 2K4BA 2Q0OA 3IC7A 3NWTA 4ZYEA 3N4MA 1XSVA 2F4OB 3CC2I 4B4CA 2O0YA 1YRNA 4L9JA 3F8CA 1D8KA 1O4XA 1PUFB 1ZN2A 5GAEJ 3BDDA 2HWVA 4U88A 3JTGA
chains in the Genus database with same CATH topology
4KA4A 3ISPA 1QPMA 1HW5A 3RYPA 4UV8A 3WTZA 3M8FA 2DQLA 4I98B 4G6QA 2DFIA 3EETA 4UUVA 4CO8A 4CDGA 2V1XA 4O6JA 2VE9A 2OA4A 2HGCA 2HR3A 2Z99A 3GVAA 2B0LA 3K9TA 5DD4A 1WSUA 3GFIA 2PBIA 4MEYF 4UVAA 5L3GA 4WXHA 1V3FA 4N9IA 2KJBA 4MTEA 5HVQC 4MGRA 2O6GE 3KP5A 4L9VA 2FQ3A 4A0YA 2A3SA 1AOYA 1FP2A 1S7AA 3ULQB 2ELHA 1S29A 1TNTA 4L0ZB 2ETHA 4OINF 1T0FA 1WWXA 2RGVA 6PAXA 4GCVA 3HOTA 3FZVA 1LEBA 4KT5C 4RB1A 3JAMK 2L01A 4Y13A 1I1SA 5HLIA 3I71A 1U5TA 1MDMA 1XB4A 2KKOA 2VC1A 2CO5A 3Q9VA 3WTWC 2EA2A 4N0BA 4IF4A 2R3SA 2P4WA 5CJ9A 3GFMA 2QVOA 3NRVA 2HYFA 3V7RA 4IVNA 3WGHA 5DD8A 2O61A 3CLOA 2PFBA 3ELKA 3R60A 4CHUA 4O3MA 1R7JA 3R0JA 2HDCA 4OIOF 3K69A 1E2XA 3FXQA 4EV0A 2V79A 4CICA 2R7DA 5LEKA 4ENMA 1USSA 1R23A 5LHIA 2DQRA 2QM3A 1Z7UA 2ZJ2A 4YIFA 1QZYA 4KN4X 5E1ZB 4Q47A 2EB7A 3RKYA 5DUIA 3HIFA 2L02A 1R22A 4BYYA 2HOEA 2DK8A 3HOSA 1BIBA 1LJ9A 4AD9A 5IT9Z 4LGWA 4ZH4F 1ON1A 2A61A 4ENNA 2F2EA 1OPCA 2VOPA 1HKSA 3MAJA 2EFPA 4AIHA 2V6CA 2EV5A 4P96A 3ABTA 3EYYA 1R1VA 3QPTA 4R79A 4D0PA 5L3BA 1HKTA 1YS7A 4LG0B 3DFGA 1HBXG 2DW4A 3V8JA 2XV4S 1O3RA 2MLGA 1G3SA 2OBPA 4M72A 4OMZA 1I5ZA 3ZN1A 1K78B 4CGZA 3V8LA 5HS7A 1U8RA 1ZGAA 2XKPA 1OYWA 1K6OA 2IRFG 1TLHB 4G8XA 1QZZA 3DF8A 2F5EA 4WK8F 1IF1A 1YS6A 3E6MA 1HKQA 2YX4A 2XASA 3ZP5A 1IN7A 2JPBA 5ILVA 4EMSA 1QQIA 2HEOA 3R6SA 3REOA 1MJBA 1B9MA 1Q1HA 2H27A 4M74A 3NQOA 3O3KA 1MD0A 1XD7A 3I4PA 2K02A 1ZRCA 1IZ1A 3RJPA 2P6SA 4RGRA 4E70A 2X0LA 1KGSA 1HW1A 1H9TA 1MKMA 2G7HA 3KCCA 2P7CB 2Y0MA 4ESJA 3FM5A 1EV7A 3FXUA 2E1NA 2KRFA 2VOOA 4KYWA 2DT5A 4MTDA 4DQ2A 1LDJA 2ZMEB 1NHAA 3F8FA 3T1BA 5K1YA 2DI3A 4CYDA 1XGNA 3FWEA 3T8RA 1LQ1A 1XN7A 4AIJA 3DP7A 4H0EA 3L09A 5H20A 1PDNC 3BJ6A 4EM1A 4KDPA 4WF2A 4OU0A 5D5VB 2Q2EA 4M6YA 4I01A 3VOEA 4WX9A 2DTRA 1HSTA 2LF8A 4P5OA 2FMLA 3VODA 3HTSB 3ABUA 4HX8A 5DCFA 3BZ6A 4HLXA 5LGNA 3ZMTA 2XHKA 5FGMA 3HSRA 5E1WA 4GXOA 5F6FA 2ESHA 2PMHA 3PQJA 5A2QZ 3MWMA 2W24A 3F8NA 3CUQC 4RB2C 5LBQA 4HDUA 3QU6A 2Z9OA 4P55A 2LNBA 3TOBA 1P2FA 1XDSA 1Z6TA 3RKXA 1XGSA 2BEOA 1GHCA 4LMYA 2RNJA 1K79A 4HOBA 2FA5A 2RV8A 4EM0B 4LG0A 1B9NA 4BQAA 1IXRC 3W6JB 3KP2A 1SD4A 2EK5A 4KNYA 1K78A 2NAZA 3F22A 1EH8A 3GX4X 3LWFA 5IT9K 1K7AA 2YX7A 2Z5UA 2EFNA 5E8IA 4ESBA 3O2PE 3HHHA 4PGHA 1PP7U 4HX7A 4RB3C 3QP5A 4AIKA 4ENJA 4HW0A 3PQKA 4HV6A 1XGOA 2MH9A 4RAZA 3EQLF 1CGPA 5LRSA 2E1CA 1UB9A 1FBQA 2F5FA 4GO1A 3GFLA 5J8CA 2KJCA 1LNWA 1ZRDA 1G6NA 2OZ6A 1TQPA 4B8XA 1R5HA 2W25A 2ZMEA 1JHFA 1ZLJA 2ESNA 3ZQ7A 1UFMA 1O3SA 2PEXA 5KK1A 4BHCA 1SFUA 4Q4ZF 1ODDA 2IT0A 3KE2A 5E18F 3BJOA 2ISZA 3HYIA 3HTUA 2XAJA 3KZZA 5FB2A 3GW2A 1FP1D 1R36A 2DO7A 4M9XA 3EDPA 1FOKA 1HW2A 3CUOA 1IN6A 1R1TA 5LLQA 4A12A 4IRGA 1SMTA 1OYYA 2FRHA 2D45A 3IWFA 4HF0A 3OOPA 2E7XA 3I59B 5L3DA 2MD5A 3F23A 1OKRA 2XGXA 5FFZA 1YLFA 1JGSA 1ZLKA 3KLOA 5LGUA 2RVCA 3DV8A 2E7WA 3Q5FA 1FYLA 2UZKA 2FMYA 5BS6A 5D5UB 3TKYA 5L3EA 3WU1B 3P9IA 2GQQA 3M7GA 2DK5A 3ZMZA 1REPC 4XSZF 3IRRA 4L9NA 1XMAA 1QO0D 5HLHA 4LD5A 1Z91A 3I53A 5L3CA 2VBWA 3SQNA 2MC3A 3VFZA 2WWYA 5LGTA 4NHJA 3E6BA 2HKXA 4NB5A 3SXYA 1Y0UA 4CXFA 2QQAA 5AONA 1TQIA 1R58A 4YFXF 2G7UA 1S3JA 4A0ZA 1P4XA 2NRAC 5A2QK 1IRGA 3H3UA 1FSHA 1G4DA 2HKOA 2BE5F 4FX0A 4EGYA 1JHHA 3TO6A 2K27A 5H6RA 2ADUA 3F6OA 1IRFA 2EA4A 5TRDA 5AIQA 2XAFA 4HX4A 3P9CA 4XRFA 3IL2A 4U0VA 3CTAA 4AWXB 1FZPB 1D5VA 1F4KA 2F5DA 1P6RA 2EFOA 2M30A 1TNSA 4GYIA 2WV0A 3KETA 3I54A 2GZWA 4ZZLA 3ZPLA 2STTA 3Q9SA 1T39A 3WTVC 3M8EA 1YQAA 1JXSA 2TDXA 4HF2A 5LHGA 2QZ8A 3I0TA 2L4MA 1BOAA 1UHMA 2Q8KA 4ZYHA 2WTEA 4LK0F 2P5KA 2ISYA 2BV6A 2FXAA 1G3YA 1OYIA 3E3VA 5D6EA 4RAYA 3KFWX 1T38A 2JTVA 1PP8F 4BH9A 2JSCA 1J2XA 5E17F 2VT2A 4KMUX 5D4SA 2STWA 4PZJA 1DPRA 1KQ9A 1TQMA 2CWEA 4ZYDA 5CYVA 3JSPA 2HQNA 2KIUA 2GA1A 1WQ2A 4JBAA 2EFQA 3I59A 3K1NA 4LLGF 1WI9A 4IJAA 1IXCA 4MEXF 2M1BA 2GXBA 5DCMB 1SFEA 4HA8A 5IT3A 2A6EF 4KICA 4Q48A 2IA0A 2D1VA 3V7CA 2GAUA 5ILSA 2EV6A 1GVJA 4BHBA 4FX4A 1E17A 5JVTA 2NNYA 1Z9CA 1VTNC 5HDKA 3CO6C 2Y48A 1B4AA 2A69F 5CVUA 2HFHA 1DP7P 3HRMA 3CDHA 3JSOA 4EJOA 5HS8A 1LDKB 2ZXJA 1LDDA 3VB2A 3ECHA 1MJ9A 4DNCA 2KIMA 1BI1A 2ZCWA 5FO5A 3E6DA 3FF5A 4HAMA 1DPUA 3C7JA 2ACJA 3HRUA 3J81Z 3KLNA 3V4GA 1FWZA 3KP6A 3FXRA 4M6XA 1RIOH 3BJAA 1DDNA 1TBXA 2CFXA 4L9TA 4R8HA 4G7HF 2VBZA 4I09A 2HZTA 4FHTA 2DPDA 1X3UA 1B1BA 2JPCA 1IN5A 1XCVA 3RPQA 1XSXA 2HQRA 2VXZA 3TQNA 5ICGA 4UVBA 1RNLA 3C18A 1H0MA 4LJZF 1S7OA 3BWGA 1FNNA 3F21A 3ERED 2QBYB 1HQCA 1GXPA 2RQPA 4GYGA 3WU0A 1BM9A 1Z05A 3M9AA 4PDKA 2IA1A 3ZMSA 2PG4A 1FSEA 5ED4A 2VT3A 2GXGA 1FT9A 1TW3A 3U9GA 3EUHA 5CVVA 3P9KA 5HDGA 4GGGA 4P9FA 2QUFA 3GEZA 1W4MA 5TJJA 3ROUA 1BI3A 1BC8C 3T0YA 2OQGA 2DBBA 3D5LA 3KP7A 4Y17A 2XAHA 1XMKA 2OD5A 4AVPA 3TO9A 3K1MA 3L9FA 1G3TA 2RC4A 4A5MA 5D4RA 4WCGA 4P9UA 1O7LA 5CLSA 1O57A 5DCMA 1L0OC 1BIAA 3P7NA 2FBHA 3U1DA 3I5UA 4ETSA 4HF1A 1RUOA 5ICCA 4OIRF 1QBJA 5E1XA 2EV0A 3WGGA 1FBSA 2COMA 1EH7A 3GXOA 3F8MA 4MQVA 4HLYA 2W84A 5EEHA 2VE8A 2IA2A 2ZBKA 4G6DA 2H6BA 3RI4A 2UXXA 1FYKA 2GA2A 3HUGA 1YTYA 4M9SA 4JK1X 3GZ5A 1AWCA 5JHUA 2QENA 1O3TA 3BPVA 3FHZA 3MFKA 2VBYA 3T8TA 4MQ9F 2XAQA 1R5GA 4UNOA 4I0AA 4KIFA 2FOKA 2XIGA 4BHPA 4HV5A 2XUBA 1FBUA 3MQ0A 1Z6RA 5E20A 4MHGA 2BYVE 2AS5F 3W6KB 4LB6B 3IHUA 1HXDA 3FX3A 1ZHFA 5HS9A 1FPQA 2DLLA 1KYWA 2PMUA 5DYMA 2FBIA 3KZYA 3MEXA 2LKPA 2K7LA 1S8NA 3E97A 2IP2A 4A0XA 5LEJA 2P5LC 2QBYA 1EH6A 1IUYA 4HZFA 3O6BB 2K4JA 2UWMA 3R61A 1KU3A 1KQ0A 5BMZA 4L0YB 4YG2F 5ILUA 2QYOA 3SZTA 3E6CC 2PN6A 4KIGA 5JI6A 1TW2A 1W5SA 5DUKA 4HQEA 4KFCA 3GO5A 3TO7A 4XBFA 3KP4A 2KIFA 2BGCA 1IW7F 4ZZDA 3IKTA 4A2UA 1W5TA 3OV8A 1G3WA 2QWWA 1SFXA 2H6CA 1FYMA 1YG2A 4LB5A 1O7FA 3WODF 2PJPA 3GWZA 1LEAA 2ZO4A 4M71A 1U3EM 3JW4A 4OIQF 3GUDA 3I58A 1CF7B 5FLXZ 2HYGD 4A6DA 1BI2A 3FMRA 3NEUA 4EM2A 2W85A 3SFZA 4S04A 2H94A 2NYXA 1YW9A 3E5QA 5AIPA 3HRSA 2EWNA 2NS0A 1I27A 3DPLC 4HDVA 3TDZC 2GIVA 5D6FA 2M8EA 3I64A 1PUEE 3ECOA 2O3FA 3K0LA 2OQRA 3DQVC 3DXJF 2Z3YA 3L7WA 2VC0A 3IRQA 4XSXF 2FBKA 4WXDA 2XROA 3QP6A 2H09A 1YW7A 1ZREA 2FU4A 1BBYA 1ZARA 5K5QA 4O5VA 1XDUA 3F6VA 1RI7A 1RZ4A 3RIRA 4RS8A 4IHTA 4U7BA 2AXLA 2OU2A 3DKWA 4I02A 2MBFA 3FMQA 1MJAA 1Z1DA 1T6SA 4RGUA 1RUNA 1D3YA 3G73A 1YYVA 2QQ9A 3GFJA 3RTRA 2OZUA 4U7DA 1U6GA 1XCBA 2V1UA 3BOQA 4Q5SF 2IJLA 1BN5A 3SHFA 2CQKA 4EJUA 3HHGA 3QPHA 4QWQA 1A04A 1IAWA 2P7VB 1F9NA 1ZGJA 2L4AA 1W7PB 1R00A 2CYYA 3DEUA 3WG9A 3WTXC 2A6HF 2ZNYA 2VODA 1FY7A 2MH2A 1L3LA 4EJVA 5FD6A 1BI0A 5JR3A 1CF7A 2LSOA 2FNAA 4QLCU 3J80Z 2FE3A 2CSOA 5FFXA 4OOIA 4XLNF 2IVMA 1R1UA 4U0WA 4YFNF 3BP8A 2HTSA 2A5YB 4IRHA 4G94A 3K2ZA 2RDPA 4ZYGA 4N9HA 4G7OF 3R4KA 3DPTA 4I0BA 4A5NA 3TDUC 4KUMA 5BPDA 5ERIA 3GLXA 4R1HA 3WTUC 3LA3A 2Y75A 5K5OA 4CZZA 2P8TA 2XKOA 4TV7A 3V7SA 2A07F 5FLXK 3VEPA 2YR2A 4EGZA 2C6YA 1QNTA 2GWRA 1KQ8A 4RGSA 1W7PD 1ULYA 3MCZA 2LF7A 3WE2A 2HTJA 1FLIA 3QAHA 3EYIA 1UHWA 5K5RA 1OR7A 3B73A 1ZRFA 3BY6A 5LHHA 3L00A 5DV5A 5BOXA 3LQQA 3G3ZA 4UVCA 1ZAOA 4U0YA 5BPIA 1YO5C 3K1PA 1LB2A 3MZYA 3AAFA 2CGPA 2JZYA 2WC2A 4NQWA 3RDIA 5L3FA 4G7ZF 4EQQA 3HSEA 4HBLA 3TOAA 4ESFA 1J59A 1IN8A 2QQBA 4UV9A 1GXQA 1FX7A 4IPAA 3F8BA 2FF4A 2HS5A 2CW0F 4IRIA 2OAZA 2W57A 2M87A 2D1HA 3KP3A 1KU9A 3RPUA 4WWCA 3E5UA 1HSJA 4I2OA 1SD5A 2BBYA 2VONA 1U78A 1SD7A 4L5JA 3KEOA 4S05A 2F5CA 5J8FA 1DUXC 3LQRA 4LK1F 4UHTA 4F7ZA 1W7PA 5CVRA 4A6EA 4B09A 5FD5A 1J5YA 4YIIA 1LVAA 4XLPF 1XGMA 4Z2YA 4OMYA 1F5TA 3T5XA 3IKVA 4RB0A 5HLGA 2ZKZA 2M5WA 3LFKA 5CVIA 3KEQA 2RKHA 2XVCA 4BXUA 3L2CA 3LAPA 3H92A 1J75A 1QGPA 1ZYRF 1ONVA 4I7HA 4M9ZA 1OMIA 4K2EA 1UCRA 4ON0A 1ON2A 2YSRA 1STZA 4M73A 3H3ZA 4EJWA 2DU9A 4PCQA 2YPRA 3ZN0A 1KYZA 1U2WA 1O3QA 1J7KA 2L3DA 5ICEA 4HYEA 5D8KB 4HQMA 3D0SA 5J6XA 4Y15A 1IN4A 3TGNA 1F1ZA 4UXNA 4BAYA 3J80K 4EJTA 2L54A 3BPXA 3QOPA 3SZPA 1YIOA 1T2KA 2M45A 2PI0A 2CG4A 1S6LA 2RN7A 3CUQB 3GYHX 5DDGA 2V1DA 1XSDA 3C1DA 3GF2A 3HSFA 3E5XA 5DEQA 1IXSB 2FEZA 2IPQX 4RGXA 2ZFWA 3CJNA 1MZBA 1ZH5A 2JRTA 1J9IA 5BQTA 1YW8A 1I6XA 4FT8A 3IWZA 2D2WA 3F72A 5H6QA 2VN2A 5HDNA 2J5PA 3ZMVA 5F1RA 2JT1A 4IHSA 2V9VA 3ML6A 2DPUA 4LLLA 4IXAA 3CO7C 2PQ8A 5ICFA 1SD6A 1KU2A 1SMYF 1SAXA 2VBXA 2P6TA 5LRRA 5D5XB 2FNPA 4WXCA 1KA8A 1TTYA 4G9YA 3U2RA 2QLZA 4EVIA 2R7FA 1KU7A 3JTHA 3J7AO 1D8JA 4OIPF 3J81K 2K86A 1ZG5A 2X4HA 3ZMDA 1MGTA 3JAMZ 3B02A 1USTA 4KN7X 4LLNA 2A68F 3WTYC 3C3WA 2XAGA 5E8GA 4L5IA 1WRJA 3N97A 2J5OA 2UXNA 3WGIA 5CVJA 1I1GA 4L18B 2PLYA 4KIBA 3RKWA 3MZHA 3R0AA 1V4RA 1P92A 2MA3A 2IW5A 5D8LB 3FMSA 2O8XA 4LFUA 4MNUA 1J0RA 3LA7A 1U5TB 1MDMB 1C0WA 1B59A 1FC3A 2XRNA 1BJAA 3HRTA 1T98A 3RYRA 5EEGA 4PGGA 1B6AA 1P4WA 3BROA 4KMFA 3WTTC 1ZG3A 1U5TC 1YFHA 4BNCA 3QRFF 5D5WB 1BC7C 3WE3A 5JFRA 3V8KA 2G9WA 3S2WA 3FM3A 2DAOA 2FSWA 3F3XA 5KVRA 4YFKF 2ZNZA 3ZMUA 3COAC 3CUQA 3PFIA 2Z33A 3QU3A 2EFWA 1ZG1A 2O03A 5HOOA 4ENKA 3GZ6A 2YU3A 1H9GA 1JE8A 3WTSC 3M1EA 2LDUA 2EJRA 4JQFA 4ASNA 1P4AA 5F64A 2P5VA 2MLKA 3LSTA 1WKMA 3LAJA 3LA2A 2NNNA 2K4BA 2Q0OA 3IC7A 3N4MA 4ZYEA 1XSVA 2O0YA 4L9JA 3F8CA 1D8KA 1ZN2A 3BDDA 2HWVA 4U88A 3JTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KA4 A;  3ISP A;  1QPM A;  1HW5 A;  3RYP A;  4UV8 A;  3WTZ A;  3M8F A;  2DQL A;  4I98 B;  4G6Q A;  2DFI A;  3EET A;  4UUV A;  4CO8 A;  4CDG A;  2V1X A;  4O6J A;  2VE9 A;  2OA4 A;  2HGC A;  2HR3 A;  2Z99 A;  3GVA A;  2B0L A;  3K9T A;  5DD4 A;  1WSU A;  3GFI A;  2PBI A;  4MEY F;  4UVA A;  5L3G A;  4WXH A;  1V3F A;  4N9I A;  2KJB A;  4MTE A;  5HVQ C;  4MGR A;  2O6G E;  3KP5 A;  4L9V A;  2FQ3 A;  4A0Y A;  2A3S A;  1AOY A;  1FP2 A;  1S7A A;  3ULQ B;  2ELH A;  1S29 A;  1TNT A;  4L0Z B;  2ETH A;  4OIN F;  1T0F A;  1WWX A;  2RGV A;  6PAX A;  4GCV A;  3HOT A;  3FZV A;  1LEB A;  4KT5 C;  4RB1 A;  3JAM K;  2L01 A;  4Y13 A;  1I1S A;  5HLI A;  3I71 A;  1U5T A;  1MDM A;  1XB4 A;  2KKO A;  2VC1 A;  2CO5 A;  3Q9V A;  3WTW C;  2EA2 A;  4N0B A;  4IF4 A;  2R3S A;  2P4W A;  5CJ9 A;  3GFM A;  2QVO A;  3NRV A;  2HYF A;  3V7R A;  4IVN A;  3WGH A;  5DD8 A;  2O61 A;  3CLO A;  2PFB A;  3ELK A;  3R60 A;  4CHU A;  4O3M A;  1R7J A;  3R0J A;  2HDC A;  4OIO F;  3K69 A;  1E2X A;  3FXQ A;  4EV0 A;  2V79 A;  4CIC A;  2R7D A;  5LEK A;  4ENM A;  1USS A;  1R23 A;  5LHI A;  2DQR A;  2QM3 A;  1Z7U A;  2ZJ2 A;  4YIF A;  1QZY A;  4KN4 X;  5E1Z B;  4Q47 A;  2EB7 A;  3RKY A;  5DUI A;  3HIF A;  2L02 A;  1R22 A;  4BYY A;  2HOE A;  2DK8 A;  3HOS A;  1BIB A;  1LJ9 A;  4AD9 A;  5IT9 Z;  4LGW A;  4ZH4 F;  1ON1 A;  2A61 A;  4ENN A;  2F2E A;  1OPC A;  2VOP A;  1HKS A;  3MAJ A;  2EFP A;  4AIH A;  2V6C A;  2EV5 A;  4P96 A;  3ABT A;  3EYY A;  1R1V A;  3QPT A;  4R79 A;  4D0P A;  5L3B A;  1HKT A;  1YS7 A;  4LG0 B;  3DFG A;  1HBX G;  2DW4 A;  3V8J A;  2XV4 S;  1O3R A;  2MLG A;  1G3S A;  2OBP A;  4M72 A;  4OMZ A;  1I5Z A;  3ZN1 A;  1K78 B;  4CGZ A;  3V8L A;  5HS7 A;  1U8R A;  1ZGA A;  2XKP A;  1OYW A;  1K6O A;  2IRF G;  1TLH B;  4G8X A;  1QZZ A;  3DF8 A;  2F5E A;  4WK8 F;  1IF1 A;  1YS6 A;  3E6M A;  1HKQ A;  2YX4 A;  2XAS A;  3ZP5 A;  1IN7 A;  2JPB A;  5ILV A;  4EMS A;  1QQI A;  2HEO A;  3R6S A;  3REO A;  1MJB A;  1B9M A;  1Q1H A;  2H27 A;  4M74 A;  3NQO A;  3O3K A;  1MD0 A;  1XD7 A;  3I4P A;  2K02 A;  1ZRC A;  1IZ1 A;  3RJP A;  2P6S A;  4RGR A;  4E70 A;  2X0L A;  1KGS A;  1HW1 A;  1H9T A;  1MKM A;  2G7H A;  3KCC A;  2P7C B;  2Y0M A;  4ESJ A;  3FM5 A;  1EV7 A;  3FXU A;  2E1N A;  2KRF A;  2VOO A;  4KYW A;  2DT5 A;  4MTD A;  4DQ2 A;  1LDJ A;  2ZME B;  1NHA A;  3F8F A;  3T1B A;  5K1Y A;  2DI3 A;  4CYD A;  1XGN A;  3FWE A;  3T8R A;  1LQ1 A;  1XN7 A;  4AIJ A;  3DP7 A;  4H0E A;  3L09 A;  5H20 A;  1PDN C;  3BJ6 A;  4EM1 A;  4KDP A;  4WF2 A;  4OU0 A;  5D5V B;  2Q2E A;  4M6Y A;  4I01 A;  3VOE A;  4WX9 A;  2DTR A;  1HST A;  2LF8 A;  4P5O A;  2FML A;  3VOD A;  3HTS B;  3ABU A;  4HX8 A;  5DCF A;  3BZ6 A;  4HLX A;  5LGN A;  3ZMT A;  2XHK A;  5FGM A;  3HSR A;  5E1W A;  4GXO A;  5F6F A;  2ESH A;  2PMH A;  3PQJ A;  5A2Q Z;  3MWM A;  2W24 A;  3F8N A;  3CUQ C;  4RB2 C;  5LBQ A;  4HDU A;  3QU6 A;  2Z9O A;  4P55 A;  2LNB A;  3TOB A;  1P2F A;  1XDS A;  1Z6T A;  3RKX A;  1XGS A;  2BEO A;  1GHC A;  4LMY A;  2RNJ A;  1K79 A;  4HOB A;  2FA5 A;  2RV8 A;  4EM0 B;  4LG0 A;  1B9N A;  4BQA A;  1IXR C;  3W6J B;  3KP2 A;  1SD4 A;  2EK5 A;  4KNY A;  1K78 A;  2NAZ A;  3F22 A;  1EH8 A;  3GX4 X;  3LWF A;  5IT9 K;  1K7A A;  2YX7 A;  2Z5U A;  2EFN A;  5E8I A;  4ESB A;  3O2P E;  3HHH A;  4PGH A;  1PP7 U;  4HX7 A;  4RB3 C;  3QP5 A;  4AIK A;  4ENJ A;  4HW0 A;  3PQK A;  4HV6 A;  1XGO A;  2MH9 A;  4RAZ A;  3EQL F;  1CGP A;  5LRS A;  2E1C A;  1UB9 A;  1FBQ A;  2F5F A;  4GO1 A;  3GFL A;  5J8C A;  2KJC A;  1LNW A;  1ZRD A;  1G6N A;  2OZ6 A;  1TQP A;  4B8X A;  1R5H A;  2W25 A;  2ZME A;  1JHF A;  1ZLJ A;  2ESN A;  3ZQ7 A;  1UFM A;  1O3S A;  2PEX A;  5KK1 A;  4BHC A;  1SFU A;  4Q4Z F;  1ODD A;  2IT0 A;  3KE2 A;  5E18 F;  3BJO A;  2ISZ A;  3HYI A;  3HTU A;  2XAJ A;  3KZZ A;  5FB2 A;  3GW2 A;  1FP1 D;  1R36 A;  2DO7 A;  4M9X A;  3EDP A;  1FOK A;  1HW2 A;  3CUO A;  1IN6 A;  1R1T A;  5LLQ A;  4A12 A;  4IRG A;  1SMT A;  1OYY A;  2FRH A;  2D45 A;  3IWF A;  4HF0 A;  3OOP A;  2E7X A;  3I59 B;  5L3D A;  2MD5 A;  3F23 A;  1OKR A;  2XGX A;  5FFZ A;  1YLF A;  1JGS A;  1ZLK A;  3KLO A;  5LGU A;  2RVC A;  3DV8 A;  2E7W A;  3Q5F A;  1FYL A;  2UZK A;  2FMY A;  5BS6 A;  5D5U B;  3TKY A;  5L3E A;  3WU1 B;  3P9I A;  2GQQ A;  3M7G A;  2DK5 A;  3ZMZ A;  1REP C;  4XSZ F;  3IRR A;  4L9N A;  1XMA A;  1QO0 D;  5HLH A;  4LD5 A;  1Z91 A;  3I53 A;  5L3C A;  2VBW A;  3SQN A;  2MC3 A;  3VFZ A;  2WWY A;  5LGT A;  4NHJ A;  3E6B A;  2HKX A;  4NB5 A;  3SXY A;  1Y0U A;  4CXF A;  2QQA A;  5AON A;  1TQI A;  1R58 A;  4YFX F;  2G7U A;  1S3J A;  4A0Z A;  1P4X A;  2NRA C;  5A2Q K;  1IRG A;  3H3U A;  1FSH A;  1G4D A;  2HKO A;  2BE5 F;  4FX0 A;  4EGY A;  1JHH A;  3TO6 A;  2K27 A;  5H6R A;  2ADU A;  3F6O A;  1IRF A;  2EA4 A;  5TRD A;  5AIQ A;  2XAF A;  4HX4 A;  3P9C A;  4XRF A;  3IL2 A;  4U0V A;  3CTA A;  4AWX B;  1FZP B;  1D5V A;  1F4K A;  2F5D A;  1P6R A;  2EFO A;  2M30 A;  1TNS A;  4GYI A;  2WV0 A;  3KET A;  3I54 A;  2GZW A;  4ZZL A;  3ZPL A;  2STT A;  3Q9S A;  1T39 A;  3WTV C;  3M8E A;  1YQA A;  1JXS A;  2TDX A;  4HF2 A;  5LHG A;  2QZ8 A;  3I0T A;  2L4M A;  1BOA A;  1UHM A;  2Q8K A;  4ZYH A;  2WTE A;  4LK0 F;  2P5K A;  2ISY A;  2BV6 A;  2FXA A;  1G3Y A;  1OYI A;  3E3V A;  5D6E A;  4RAY A;  3KFW X;  1T38 A;  2JTV A;  1PP8 F;  4BH9 A;  2JSC A;  1J2X A;  5E17 F;  2VT2 A;  4KMU X;  5D4S A;  2STW A;  4PZJ A;  1DPR A;  1KQ9 A;  1TQM A;  2CWE A;  4ZYD A;  5CYV A;  3JSP A;  2HQN A;  2KIU A;  2GA1 A;  1WQ2 A;  4JBA A;  2EFQ A;  3I59 A;  3K1N A;  4LLG F;  1WI9 A;  4IJA A;  1IXC A;  4MEX F;  2M1B A;  2GXB A;  5DCM B;  1SFE A;  4HA8 A;  5IT3 A;  2A6E F;  4KIC A;  4Q48 A;  2IA0 A;  2D1V A;  3V7C A;  2GAU A;  5ILS A;  2EV6 A;  1GVJ A;  4BHB A;  4FX4 A;  1E17 A;  5JVT A;  2NNY A;  1Z9C A;  1VTN C;  5HDK A;  3CO6 C;  2Y48 A;  1B4A A;  2A69 F;  5CVU A;  2HFH A;  1DP7 P;  3HRM A;  3CDH A;  3JSO A;  4EJO A;  5HS8 A;  1LDK B;  2ZXJ A;  1LDD A;  3VB2 A;  3ECH A;  1MJ9 A;  4DNC A;  2KIM A;  1BI1 A;  2ZCW A;  5FO5 A;  3E6D A;  3FF5 A;  4HAM A;  1DPU A;  3C7J A;  2ACJ A;  3HRU A;  3J81 Z;  3KLN A;  3V4G A;  1FWZ A;  3KP6 A;  3FXR A;  4M6X A;  1RIO H;  3BJA A;  1DDN A;  1TBX A;  2CFX A;  4L9T A;  4R8H A;  4G7H F;  2VBZ A;  4I09 A;  2HZT A;  4FHT A;  2DPD A;  1X3U A;  1B1B A;  2JPC A;  1IN5 A;  1XCV A;  3RPQ A;  1XSX A;  2HQR A;  2VXZ A;  3TQN A;  5ICG A;  4UVB A;  1RNL A;  3C18 A;  1H0M A;  4LJZ F;  1S7O A;  3BWG A;  1FNN A;  3F21 A;  3ERE D;  2QBY B;  1HQC A;  1GXP A;  2RQP A;  4GYG A;  3WU0 A;  1BM9 A;  1Z05 A;  3M9A A;  4PDK A;  2IA1 A;  3ZMS A;  2PG4 A;  1FSE A;  5ED4 A;  2VT3 A;  2GXG A;  1FT9 A;  1TW3 A;  3U9G A;  3EUH A;  5CVV A;  3P9K A;  5HDG A;  4GGG A;  4P9F A;  2QUF A;  3GEZ A;  1W4M A;  5TJJ A;  3ROU A;  1BI3 A;  1BC8 C;  3T0Y A;  2OQG A;  2DBB A;  3D5L A;  3KP7 A;  4Y17 A;  2XAH A;  1XMK A;  2OD5 A;  4AVP A;  3TO9 A;  3K1M A;  3L9F A;  1G3T A;  2RC4 A;  4A5M A;  5D4R A;  4WCG A;  4P9U A;  1O7L A;  5CLS A;  1O57 A;  5DCM A;  1L0O C;  1BIA A;  3P7N A;  2FBH A;  3U1D A;  3I5U A;  4ETS A;  4HF1 A;  1RUO A;  5ICC A;  4OIR F;  1QBJ A;  5E1X A;  2EV0 A;  3WGG A;  1FBS A;  2COM A;  1EH7 A;  3GXO A;  3F8M A;  4MQV A;  4HLY A;  2W84 A;  5EEH A;  2VE8 A;  2IA2 A;  2ZBK A;  4G6D A;  2H6B A;  3RI4 A;  2UXX A;  1FYK A;  2GA2 A;  3HUG A;  1YTY A;  4M9S A;  4JK1 X;  3GZ5 A;  1AWC A;  5JHU A;  2QEN A;  1O3T A;  3BPV A;  3FHZ A;  3MFK A;  2VBY A;  3T8T A;  4MQ9 F;  2XAQ A;  1R5G A;  4UNO A;  4I0A A;  4KIF A;  2FOK A;  2XIG A;  4BHP A;  4HV5 A;  2XUB A;  1FBU A;  3MQ0 A;  1Z6R A;  5E20 A;  4MHG A;  2BYV E;  2AS5 F;  3W6K B;  4LB6 B;  3IHU A;  1HXD A;  3FX3 A;  1ZHF A;  5HS9 A;  1FPQ A;  2DLL A;  1KYW A;  2PMU A;  5DYM A;  2FBI A;  3KZY A;  3MEX A;  2LKP A;  2K7L A;  1S8N A;  3E97 A;  2IP2 A;  4A0X A;  5LEJ A;  2P5L C;  2QBY A;  1EH6 A;  1IUY A;  4HZF A;  3O6B B;  2K4J A;  2UWM A;  3R61 A;  1KU3 A;  1KQ0 A;  5BMZ A;  4L0Y B;  4YG2 F;  5ILU A;  2QYO A;  3SZT A;  3E6C C;  2PN6 A;  4KIG A;  5JI6 A;  1TW2 A;  1W5S A;  5DUK A;  4HQE A;  4KFC A;  3GO5 A;  3TO7 A;  4XBF A;  3KP4 A;  2KIF A;  2BGC A;  1IW7 F;  4ZZD A;  3IKT A;  4A2U A;  1W5T A;  3OV8 A;  1G3W A;  2QWW A;  1SFX A;  2H6C A;  1FYM A;  1YG2 A;  4LB5 A;  1O7F A;  3WOD F;  2PJP A;  3GWZ A;  1LEA A;  2ZO4 A;  4M71 A;  1U3E M;  3JW4 A;  4OIQ F;  3GUD A;  3I58 A;  1CF7 B;  5FLX Z;  2HYG D;  4A6D A;  1BI2 A;  3FMR A;  3NEU A;  4EM2 A;  2W85 A;  3SFZ A;  4S04 A;  2H94 A;  2NYX A;  1YW9 A;  3E5Q A;  5AIP A;  3HRS A;  2EWN A;  2NS0 A;  1I27 A;  3DPL C;  4HDV A;  3TDZ C;  2GIV A;  5D6F A;  2M8E A;  3I64 A;  1PUE E;  3ECO A;  2O3F A;  3K0L A;  2OQR A;  3DQV C;  3DXJ F;  2Z3Y A;  3L7W A;  2VC0 A;  3IRQ A;  4XSX F;  2FBK A;  4WXD A;  2XRO A;  3QP6 A;  2H09 A;  1YW7 A;  1ZRE A;  2FU4 A;  1BBY A;  1ZAR A;  5K5Q A;  4O5V A;  1XDU A;  3F6V A;  1RI7 A;  1RZ4 A;  3RIR A;  4RS8 A;  4IHT A;  4U7B A;  2AXL A;  2OU2 A;  3DKW A;  4I02 A;  2MBF A;  3FMQ A;  1MJA A;  1Z1D A;  1T6S A;  4RGU A;  1RUN A;  1D3Y A;  3G73 A;  1YYV A;  2QQ9 A;  3GFJ A;  3RTR A;  2OZU A;  4U7D A;  1U6G A;  1XCB A;  2V1U A;  3BOQ A;  4Q5S F;  2IJL A;  1BN5 A;  3SHF A;  2CQK A;  4EJU A;  3HHG A;  3QPH A;  4QWQ A;  1A04 A;  1IAW A;  2P7V B;  1F9N A;  1ZGJ A;  2L4A A;  1W7P B;  1R00 A;  2CYY A;  3DEU A;  3WG9 A;  3WTX C;  2A6H F;  2ZNY A;  2VOD A;  1FY7 A;  2MH2 A;  1L3L A;  4EJV A;  5FD6 A;  1BI0 A;  5JR3 A;  1CF7 A;  2LSO A;  2FNA A;  4QLC U;  3J80 Z;  2FE3 A;  2CSO A;  5FFX A;  4OOI A;  4XLN F;  2IVM A;  1R1U A;  4U0W A;  4YFN F;  3BP8 A;  2HTS A;  2A5Y B;  4IRH A;  4G94 A;  3K2Z A;  2RDP A;  4ZYG A;  4N9H A;  4G7O F;  3R4K A;  3DPT A;  4I0B A;  4A5N A;  3TDU C;  4KUM A;  5BPD A;  5ERI A;  3GLX A;  4R1H A;  3WTU C;  3LA3 A;  2Y75 A;  5K5O A;  4CZZ A;  2P8T A;  2XKO A;  4TV7 A;  3V7S A;  2A07 F;  5FLX K;  3VEP A;  2YR2 A;  4EGZ A;  2C6Y A;  1QNT A;  2GWR A;  1KQ8 A;  4RGS A;  1W7P D;  1ULY A;  3MCZ A;  2LF7 A;  3WE2 A;  2HTJ A;  1FLI A;  3QAH A;  3EYI A;  1UHW A;  5K5R A;  1OR7 A;  3B73 A;  1ZRF A;  3BY6 A;  5LHH A;  3L00 A;  5DV5 A;  5BOX A;  3LQQ A;  3G3Z A;  4UVC A;  1ZAO A;  4U0Y A;  5BPI A;  1YO5 C;  3K1P A;  1LB2 A;  3MZY A;  3AAF A;  2CGP A;  2JZY A;  2WC2 A;  4NQW A;  3RDI A;  5L3F A;  4G7Z F;  4EQQ A;  3HSE A;  4HBL A;  3TOA A;  4ESF A;  1J59 A;  1IN8 A;  2QQB A;  4UV9 A;  1GXQ A;  1FX7 A;  4IPA A;  3F8B A;  2FF4 A;  2HS5 A;  2CW0 F;  4IRI A;  2OAZ A;  2W57 A;  2M87 A;  2D1H A;  3KP3 A;  1KU9 A;  3RPU A;  4WWC A;  3E5U A;  1HSJ A;  4I2O A;  1SD5 A;  2BBY A;  2VON A;  1U78 A;  1SD7 A;  4L5J A;  3KEO A;  4S05 A;  2F5C A;  5J8F A;  1DUX C;  3LQR A;  4LK1 F;  4UHT A;  4F7Z A;  1W7P A;  5CVR A;  4A6E A;  4B09 A;  5FD5 A;  1J5Y A;  4YII A;  1LVA A;  4XLP F;  1XGM A;  4Z2Y A;  4OMY A;  1F5T A;  3T5X A;  3IKV A;  4RB0 A;  5HLG A;  2ZKZ A;  2M5W A;  3LFK A;  5CVI A;  3KEQ A;  2RKH A;  2XVC A;  4BXU A;  3L2C A;  3LAP A;  3H92 A;  1J75 A;  1QGP A;  1ZYR F;  1ONV A;  4I7H A;  4M9Z A;  1OMI A;  4K2E A;  1UCR A;  4ON0 A;  1ON2 A;  2YSR A;  1STZ A;  4M73 A;  3H3Z A;  4EJW A;  2DU9 A;  4PCQ A;  2YPR A;  3ZN0 A;  1KYZ A;  1U2W A;  1O3Q A;  1J7K A;  2L3D A;  5ICE A;  4HYE A;  5D8K B;  4HQM A;  3D0S A;  5J6X A;  4Y15 A;  1IN4 A;  3TGN A;  1F1Z A;  4UXN A;  4BAY A;  3J80 K;  4EJT A;  2L54 A;  3BPX A;  3QOP A;  3SZP A;  1YIO A;  1T2K A;  2M45 A;  2PI0 A;  2CG4 A;  1S6L A;  2RN7 A;  3CUQ B;  3GYH X;  5DDG A;  2V1D A;  1XSD A;  3C1D A;  3GF2 A;  3HSF A;  3E5X A;  5DEQ A;  1IXS B;  2FEZ A;  2IPQ X;  4RGX A;  2ZFW A;  3CJN A;  1MZB A;  1ZH5 A;  2JRT A;  1J9I A;  5BQT A;  1YW8 A;  1I6X A;  4FT8 A;  3IWZ A;  2D2W A;  3F72 A;  5H6Q A;  2VN2 A;  5HDN A;  2J5P A;  3ZMV A;  5F1R A;  2JT1 A;  4IHS A;  2V9V A;  3ML6 A;  2DPU A;  4LLL A;  4IXA A;  3CO7 C;  2PQ8 A;  5ICF A;  1SD6 A;  1KU2 A;  1SMY F;  1SAX A;  2VBX A;  2P6T A;  5LRR A;  5D5X B;  2FNP A;  4WXC A;  1KA8 A;  1TTY A;  4G9Y A;  3U2R A;  2QLZ A;  4EVI A;  2R7F A;  1KU7 A;  3JTH A;  3J7A O;  1D8J A;  4OIP F;  3J81 K;  2K86 A;  1ZG5 A;  2X4H A;  3ZMD A;  1MGT A;  3JAM Z;  3B02 A;  1UST A;  4KN7 X;  4LLN A;  2A68 F;  3WTY C;  3C3W A;  2XAG A;  5E8G A;  4L5I A;  1WRJ A;  3N97 A;  2J5O A;  2UXN A;  3WGI A;  5CVJ A;  1I1G A;  4L18 B;  2PLY A;  4KIB A;  3RKW A;  3MZH A;  3R0A A;  1V4R A;  1P92 A;  2MA3 A;  2IW5 A;  5D8L B;  3FMS A;  2O8X A;  4LFU A;  4MNU A;  1J0R A;  3LA7 A;  1U5T B;  1MDM B;  1C0W A;  1B59 A;  1FC3 A;  2XRN A;  1BJA A;  3HRT A;  1T98 A;  3RYR A;  5EEG A;  4PGG A;  1B6A A;  1P4W A;  3BRO A;  4KMF A;  3WTT C;  1ZG3 A;  1U5T C;  1YFH A;  4BNC A;  3QRF F;  5D5W B;  1BC7 C;  3WE3 A;  5JFR A;  3V8K A;  2G9W A;  3S2W A;  3FM3 A;  2DAO A;  2FSW A;  3F3X A;  5KVR A;  4YFK F;  2ZNZ A;  3ZMU A;  3COA C;  3CUQ A;  3PFI A;  2Z33 A;  3QU3 A;  2EFW A;  1ZG1 A;  2O03 A;  5HOO A;  4ENK A;  3GZ6 A;  2YU3 A;  1H9G A;  1JE8 A;  3WTS C;  3M1E A;  2LDU A;  2EJR A;  4JQF A;  4ASN A;  1P4A A;  5F64 A;  2P5V A;  2MLK A;  3LST A;  1WKM A;  3LAJ A;  3LA2 A;  2NNN A;  2K4B A;  2Q0O A;  3IC7 A;  3N4M A;  4ZYE A;  1XSV A;  2O0Y A;  4L9J A;  3F8C A;  1D8K A;  1ZN2 A;  3BDD A;  2HWV A;  4U88 A;  3JTG A; 
#chains in the Genus database with same CATH topology
 2A5W A;  4KA4 A;  3ISP A;  1QPM A;  2IAI A;  1HW5 A;  4J00 A;  3RYP A;  5IOY A;  4KIS A;  2O8K A;  4UV8 A;  3WTZ A;  3LSI A;  3M8F A;  2YS9 A;  1N25 A;  2DQL A;  4I98 B;  1MBH A;  3HKZ A;  3KZI C;  4G6Q A;  3M4O J;  4QSH A;  2DFI A;  4M3G A;  2O5R A;  2GIZ A;  3EET A;  4UUV A;  4CO8 A;  4CDG A;  5CPR B;  2V1X A;  4O6J A;  2K9N A;  3W3C A;  2VE9 A;  1HDD C;  2OA4 A;  2MGQ A;  2HGC A;  2JMW A;  2HR3 A;  2Z99 A;  3GVA A;  4E4H A;  2B0L A;  3K9T A;  5DD4 A;  1WSU A;  2R7Z J;  3GFI A;  2PBI A;  1X1A A;  4MEY F;  3HGG A;  4QPO A;  2E1M B;  2W00 A;  3OYE A;  3S16 J;  4UVA A;  3S93 A;  3W2V A;  2M34 A;  2FUG 2;  5L3G A;  1K4S A;  1X4O A;  4WXH A;  1VQ4 I;  4YRV A;  4UB8 C;  1V3F A;  4N9I A;  3VWB A;  2KJB A;  4I76 A;  2VI6 A;  4MTE A;  5DM7 F;  5HVQ C;  4XQF A;  4MGR A;  2O6G E;  2E1M C;  3KP5 A;  3KIO A;  4BXF A;  4XLH A;  3BTJ A;  3ZOB A;  2M2E A;  3ABL H;  4L9V A;  2FQ3 A;  4A0Y A;  2A3S A;  1AOY A;  4PUS A;  1FP2 A;  2QKM B;  1S7A A;  2K9S A;  4AUX A;  2L2O A;  3U1K A;  1YOV B;  3HOU J;  3ULQ B;  4CA0 A;  2NVY J;  2XF6 A;  5E3N A;  2ELH A;  2FQ4 A;  1S29 A;  1TNT A;  4L0Z B;  2ETH A;  2ELJ A;  3L2R A;  4OIN F;  4HNT A;  1T0F A;  1LE8 A;  1WWX A;  2RGV A;  1K6Y A;  3OYF A;  4GCV A;  3CCS I;  3HOT A;  6PAX A;  2Y9Y A;  5KHD A;  1X3W B;  3FZV A;  3OYI A;  2Z1D A;  3F0C A;  1LEB A;  3K4K A;  4KT5 C;  3SYT A;  1Q1V A;  3BQZ A;  4RB1 A;  3JAM K;  2L01 A;  4Y13 A;  1I1S A;  5HLI A;  2VIX A;  1AU7 A;  1JT0 A;  3I71 A;  3TP0 A;  1U5T A;  1MDM A;  3GTO J;  1WH7 A;  3H0G J;  3CLQ A;  3OS0 A;  1XB4 A;  1V5F A;  1TWF J;  2KKO A;  4C2T A;  2R93 J;  4GFB A;  2VC1 A;  2CO5 A;  2M3A A;  3Q9V A;  2DA1 A;  2K9Q A;  3WTW C;  2EA2 A;  2KZG A;  4N0B A;  5LD2 C;  1D1A A;  3K4L A;  3DCF A;  4IF4 A;  2R3S A;  3GTM J;  2P4W A;  5CJ9 A;  3GFM A;  1E0E A;  2QVO A;  1BJZ A;  2PMZ N;  3OYM A;  3NRV A;  4BJ5 C;  2UUZ A;  2HYF A;  2E5Z A;  1SVO A;  3V7R A;  4IVN A;  4Y33 A;  3WGH A;  4PFP A;  5DD8 A;  2O61 A;  3CLO A;  2PFB A;  3ELK A;  3OL3 A;  3R60 A;  4CZC A;  4CHU A;  4O3M A;  1R7J A;  1GLN A;  3R0J A;  2HDC A;  4OIO F;  3K69 A;  2W7N A;  1FOW A;  1LUJ B;  3S3O A;  1TT5 B;  1Z21 A;  4CCM A;  1E2X A;  3FXQ A;  4DGW B;  4EV0 A;  1K83 J;  1YJ9 I;  3IH2 A;  4PJL A;  3A1Y A;  1ETY A;  2V79 A;  2PJR B;  3CF2 A;  4CIC A;  2R7D A;  1R4M B;  4XKW A;  1LPQ A;  5LEK A;  3FXK A;  2O9L A;  2JSP A;  4ENM A;  1USS A;  4M3E A;  4NDL A;  3A02 A;  1R23 A;  5LHI A;  2DQR A;  5HOD A;  2QM3 A;  1Z7U A;  2LVS A;  1G8X A;  2ZJ2 A;  4YIF A;  4A3I J;  1QZY A;  2ZJP F;  4KN4 X;  5E1Z B;  2Q2E B;  2P0W A;  4AYB N;  5EEA A;  3F9K A;  4D7M A;  4DZP A;  2ZFU A;  4Q47 A;  2EB7 A;  3AL0 B;  3RKY A;  5DUI A;  1H89 C;  3HIF A;  2LBF A;  2L02 A;  1ACI A;  5FRO A;  3A0H C;  1R22 A;  5IY5 H;  1OCP A;  2HOE A;  4BYY A;  1RR7 A;  1AHD P;  1MH4 A;  2DK8 A;  1XX5 A;  3DLA A;  4AYB A;  3HOS A;  1BIB A;  1LJ9 A;  4AD9 A;  3AL0 C;  1LVK A;  1PUF A;  5IT9 Z;  4LGW A;  2EZL A;  1ON1 A;  2A61 A;  2CUE A;  4Y3O A;  4ZH4 F;  4XOR A;  1B72 B;  4ENN A;  2F2E A;  3AKZ A;  1OPC A;  1FEX A;  2VOP A;  5FKM A;  1HKS A;  3NAU A;  1WJF A;  3MAJ A;  1BR1 A;  2EFP A;  1T33 A;  4AIH A;  1IUF A;  2V6C A;  2NS7 A;  2A6T A;  1SVM A;  1S9H A;  2EV5 A;  4P96 A;  3CCE I;  3ABT A;  1QZE A;  2ZJQ F;  2DMT A;  1R6R A;  2R7O A;  2WBM A;  3EYY A;  2MSY A;  1R1V A;  3QPT A;  2V9K A;  4R79 A;  4D0P A;  5L3B A;  5E3L A;  2VLA A;  5J47 A;  1HKT A;  2JQ7 A;  2JA7 J;  3FKI J;  4A93 J;  1YS7 A;  4LG0 B;  1OLT A;  3DFG A;  1HBX G;  3IH4 A;  2DW4 A;  4E7L A;  3V8J A;  2XV4 S;  1O3R A;  2MLG A;  1G3S A;  2OBP A;  3W2A A;  4XRS A;  1WJE A;  4M72 A;  5JLW A;  4OMZ A;  4UUS B;  3BZK A;  4JX5 A;  4A3L J;  4CCL A;  1I5Z A;  3J7Z I;  3ZN1 A;  1K78 B;  4CGZ A;  3V8L A;  2R7T A;  5HS7 A;  5CKT A;  1U8R A;  1R71 A;  1ZGA A;  2XKP A;  2L5Q A;  3BR1 A;  4C2U A;  1OYW A;  4F55 A;  4XKV A;  1VQM I;  3ZR8 X;  2X51 A;  1K6O A;  1TLH B;  2K5C A;  2ZXI A;  4XKB A;  2IRF G;  3S15 J;  4G8X A;  1QZZ A;  3DF8 A;  3CP2 A;  1JKQ C;  2F5E A;  2HU9 A;  1FIA A;  4WK8 F;  2JA6 J;  1IF1 A;  1YS6 A;  5FRM A;  3OS2 A;  4FAS D;  3E6M A;  2IGK A;  3G71 I;  3C2G A;  1HKQ A;  2YX4 A;  5KNL A;  2XAS A;  3ZP5 A;  1IN7 A;  2JPB A;  5ILV A;  4EMS A;  4XOP A;  1QQI A;  2HEO A;  1X19 A;  3R6S A;  1W36 C;  3REO A;  2EIN H;  1MJB A;  1B9M A;  1Q1H A;  2H27 A;  4M74 A;  3NQO A;  3O3K A;  4B3A A;  4CCJ A;  1MD0 A;  1U9O A;  1XD7 A;  3K7A J;  3I4P A;  2K02 A;  3I4N J;  1ZRC A;  1A5J A;  2CW8 A;  1VQP I;  3G1M A;  3AG3 H;  1IZ1 A;  3RJP A;  2P6S A;  4RGR A;  4E70 A;  2X0L A;  3Q0U A;  1KGS A;  1HW1 A;  1H9T A;  3H1C A;  2L7K A;  1MKM A;  2G7H A;  1B8I B;  3KCC A;  1QRY A;  3OYG A;  5JLX A;  2P7C B;  2Y0M A;  4ESJ A;  2BW3 B;  3FM5 A;  2IS2 A;  2DMP A;  1EV7 A;  3FXU A;  3ASO H;  4RLF A;  4IHV A;  2E1N A;  2KRF A;  2VOO A;  4KYW A;  2DT5 A;  2YUS A;  1LKX A;  4IQ4 A;  3L2W A;  4MTD A;  4DQ2 A;  1LDJ A;  2ZME B;  2XDV A;  1NG7 A;  1OCC H;  1NHA A;  2ECC A;  1FLI A;  3F8F A;  3T1B A;  2DTZ A;  5K1Y A;  1HLV A;  4IHY A;  2DI3 A;  4CYD A;  2QSG X;  1XGN A;  2CJJ A;  3S3M A;  2JJ7 A;  3FWE A;  3T8R A;  3CMM A;  5IOZ A;  3BG6 A;  2L9V A;  3DTE A;  5K7H A;  1E3H A;  3G1L A;  1LQ1 A;  2PJR A;  2ZME C;  5GAD J;  5M5W J;  3BR6 A;  1WCM J;  3HGY A;  1XN7 A;  2AXT C;  2F5V A;  1YJN I;  2IEK A;  2DYR H;  3BR3 A;  4AIJ A;  2HXI A;  3DP7 A;  4H0E A;  3L09 A;  5H20 A;  1PDN C;  1W36 D;  3BJ6 A;  4EM1 A;  5GAH J;  3K2A A;  4KDP A;  4WF2 A;  4OU0 A;  5D5V B;  1VZ0 A;  1Y0N A;  2Q2E A;  4M6Y A;  4Y7N J;  4LG3 A;  3MZ8 A;  4I01 A;  3VOE A;  4BUP A;  4WX9 A;  2M9H A;  2LK2 A;  4FQG A;  2DTR A;  1HST A;  3S2D J;  2LF8 A;  4P5O A;  4B1R A;  2X1E A;  2QA4 I;  4X6A J;  2FML A;  3RCO A;  1R4N B;  3BG9 A;  3VOD A;  1A35 A;  1FTT A;  3HTS B;  2KMU A;  3ABU A;  1Z77 A;  1M1E B;  1OQY A;  2EH3 A;  1X1C A;  2HPI A;  4HX8 A;  4FE7 A;  5DCF A;  1MW7 A;  3BZ6 A;  4HLX A;  5LGN A;  4X0G A;  3W2W A;  2X9D A;  3ZMT A;  2XHK A;  5FGM A;  3HSR A;  5E1W A;  4C3H J;  1B72 A;  2X1C A;  1IDY A;  3G6E I;  4GXO A;  5F6F A;  1I3A A;  2ESH A;  2XSJ C;  2PMH A;  3PQJ A;  5A2Q Z;  2W1O A;  2W24 A;  3MWM A;  3F8N A;  5F27 A;  3CUQ C;  4RB2 C;  3S32 A;  5LBQ A;  4HDU A;  4DBR A;  4DYQ A;  1OCZ H;  4FIS A;  3QU6 A;  4Z6Y A;  2Z9O A;  4P55 A;  1IV6 A;  2LNB A;  3TOB A;  4B44 A;  1P2F A;  1XDS A;  3QYF A;  1Z6T A;  3RKX A;  1XGS A;  1RRJ A;  2BEO A;  3HPH A;  3MD2 A;  2RNJ A;  4LMY A;  5GPC A;  1ZGW A;  1K79 A;  1GHC A;  1ENH A;  4HOB A;  1IGN A;  2H8W A;  4YIR X;  2FA5 A;  2RV8 A;  4LIV A;  4EM0 B;  4LG0 A;  1B9N A;  4BQA A;  5CQG A;  4XOT A;  1IXR C;  2LRE A;  3W6J B;  3CF5 F;  3KP2 A;  1MNM C;  1N75 A;  4UUS A;  1SD4 A;  2EK5 A;  4KNY A;  1K78 A;  2NAZ A;  3LSG A;  3HG9 A;  3F22 A;  1EH8 A;  1OFC X;  3GX4 X;  1HDP A;  3LWF A;  2ZJR F;  5KCM A;  5IT9 K;  2I5U A;  2QEX I;  1I3Q J;  1K7A A;  2YX7 A;  2Z5U A;  3ZXS A;  2X6O A;  2EFN A;  5E8I A;  3OR2 C;  2P81 A;  3ZRG A;  1IV8 A;  4XMY A;  2NXN B;  4ESB A;  3CJQ B;  3O2P E;  1Z7L A;  1T08 B;  3S14 J;  3BG3 A;  3HHH A;  4PGH A;  2E1O A;  4D7N A;  3H5R A;  4IL6 C;  1PP7 U;  2DJI A;  4HX7 A;  1YIJ I;  4JP0 A;  4RB3 C;  3QP5 A;  1NH3 A;  4AIK A;  4ENJ A;  4HW0 A;  2K9L A;  2LG4 A;  2DOF A;  3GTK J;  2ECB A;  3PQK A;  4HV6 A;  1MBK A;  3QPS A;  1XGO A;  2ELK A;  2MH9 A;  5IP7 J;  1JKO C;  3CJT B;  2NVQ J;  5EF6 A;  3W6V A;  1IRX A;  4RAZ A;  2Y9Z A;  3EQL F;  1CGP A;  1NK3 P;  2L9N A;  1FOY A;  3ABM H;  5LRS A;  2E1C A;  2BHZ A;  1UB9 A;  3RZD J;  1FBQ A;  2F5F A;  1Z0X A;  4GO1 A;  2DA7 A;  3GFL A;  5J8C A;  2KJC A;  4KJZ A;  1B8I A;  1X2M A;  2F4M B;  1LNW A;  2BVM A;  4GRI A;  1ZRD A;  1T95 A;  2BW3 A;  1G6N A;  3CDI A;  2OZ6 A;  4FTH A;  3BCB A;  2W4S A;  3ZQI A;  2GXA A;  1TQP A;  4B8X A;  1R5H A;  2W25 A;  2ZME A;  1MMA A;  2H1K A;  5F0C A;  5IYB J;  3RKQ A;  1JHF A;  2M4K A;  1ZLJ A;  5GPA A;  2ESN A;  3ZQ7 A;  2Y2Z A;  1UFM A;  2GBY A;  1O3S A;  2V7F A;  3K6G A;  2PEX A;  5KK1 A;  3BZC A;  4BHC A;  1TWA J;  1N77 A;  1SFU A;  4Q4Z F;  4MO7 A;  1ODD A;  1A36 A;  1W1W E;  2D5V A;  4E7Z A;  5EGO B;  4ZDO A;  4XRS G;  2IT0 A;  3KE2 A;  5E18 F;  3UKG A;  3BJO A;  4RAF A;  2OUM A;  2ISZ A;  2DA3 A;  3HYI A;  3CCV I;  1A31 A;  4QPQ A;  2VJJ A;  2HDD A;  2OPT A;  3HTU A;  2XAJ A;  2QGU A;  3KZZ A;  2EBI A;  5FB2 A;  3GW2 A;  2WA0 A;  1FP1 D;  4XR6 A;  1R36 A;  2B7E A;  2DO7 A;  4M9X A;  3O8H A;  3EDP A;  1FOK A;  3U21 A;  1HW2 A;  2DMQ A;  3CUO A;  2E60 A;  1PVE A;  4CSW A;  2E35 A;  2VKD A;  1VQ9 I;  2MG4 A;  2DOE A;  4V19 K;  4II3 A;  1IN6 A;  1R1T A;  3VSK A;  5LLQ A;  2XC7 A;  4A12 A;  4IRG A;  4IZZ A;  1SMT A;  1ORK A;  1OYY A;  1TZL A;  2FRH A;  3C2B A;  2D45 A;  3P5J A;  3IWF A;  1VQO I;  3K4C A;  4HF0 A;  4LIU A;  3OOP A;  2E7X A;  2HPM A;  3I59 B;  1YIT I;  1I50 J;  5L3D A;  2R5Z B;  5E3M A;  2MD5 A;  3F23 A;  1OKR A;  2XGX A;  4PJ0 C;  5FFZ A;  5DM6 F;  1P7J A;  3CCQ I;  1YLF A;  4JOM A;  5FKK A;  5E3O A;  1JGS A;  1ZLK A;  3KLO A;  5LGU A;  2RVC A;  3DV8 A;  2E7W A;  5J1Y A;  3Q5F A;  2JA5 J;  1FYL A;  2UZK A;  3GME A;  2FMY A;  5BS6 A;  3X2Q H;  1VF9 A;  1RPW A;  3FK7 A;  3HEF A;  3TKY A;  4BKX A;  4A69 C;  5L3E A;  5M3M J;  5D5U B;  1OCR H;  3HXL A;  3WU1 B;  3O8G A;  3P9I A;  2GQQ A;  3M7G A;  2DK5 A;  3ZMZ A;  1REP C;  1R5I D;  4XSZ F;  3IRR A;  4L9N A;  1XMA A;  1KZH A;  3Q0W A;  4RAG A;  1QO0 D;  3DKY A;  4LD5 A;  1Z91 A;  5HLH A;  3I53 A;  5L3C A;  2F4I A;  4E7S A;  2XF5 A;  2VBW A;  3N05 A;  1WH5 A;  3BLY A;  3SQN A;  1YI2 I;  2MC3 A;  2COB A;  3VFZ A;  2WWY A;  5LGT A;  2OV7 A;  1BW6 A;  4NHJ A;  3E6B A;  2WAE A;  2WAF A;  2HKX A;  4NB5 A;  4BE1 A;  2DOA A;  3SXY A;  4NBQ A;  1Y0U A;  4UUT A;  2BY0 A;  4CXF A;  2QQA A;  5AON A;  1TQI A;  1PJR A;  3LSM A;  2IBD A;  1R58 A;  5FKN A;  4YFX F;  2G7U A;  1S3J A;  4A0Z A;  2DT6 A;  2VJ4 A;  1P4X A;  2NRA C;  5A2Q K;  1IRG A;  3H3U A;  1FSH A;  1G4D A;  2HKO A;  3KEY A;  2CUF A;  3DEW A;  2BE5 F;  4FX0 A;  4EGY A;  5J1R A;  1JHH A;  2CW7 A;  1NG6 A;  1S7E A;  1JJ6 C;  3TO6 A;  2V6E A;  1XTA A;  2K27 A;  4HNV A;  4JX4 A;  5H6R A;  4DZJ A;  3HOW J;  2LY1 A;  2ADU A;  3D1N I;  1QPI A;  3F6O A;  3OYB A;  1IRF A;  2EA4 A;  5TRD A;  5AIQ A;  5IYD J;  2VKV A;  2XAF A;  3P9C A;  4HX4 A;  4XRF A;  3IL2 A;  4U0V A;  3CTA A;  4AWX B;  1FZP B;  1D5V A;  1NTC A;  3KX2 A;  1F4K A;  2CS3 A;  2F5D A;  1P6R A;  2EFO A;  2M30 A;  3EUK L;  2LD5 A;  1MBE A;  2JUC A;  1TNS A;  3RSN A;  2OF7 A;  3GBG A;  1V54 H;  4GYI A;  5LFA A;  1JUM A;  4E7J A;  2WV0 A;  3KET A;  3I54 A;  1Y39 A;  1UJ8 A;  2GZW A;  4ZZL A;  3ZPL A;  1GV2 A;  2AQF A;  2STT A;  3Q9S A;  1T39 A;  3WTV C;  3M8E A;  4M3F A;  1YQA A;  1JXS A;  2TDX A;  3L1P A;  4HF2 A;  4LOC A;  5F08 A;  5IP9 J;  5LHG A;  2QZ8 A;  3I0T A;  2OC6 A;  2L4M A;  2R7R A;  1UG0 A;  3L2U A;  1BOA A;  2NVX J;  2K3F A;  1UHM A;  2Q8K A;  3J7A Y;  4ZYH A;  2WTE A;  4LK0 F;  2P5K A;  1MBJ A;  3ZQH A;  3PIO F;  2ISY A;  4M3B A;  2BV6 A;  5EGO A;  3AG1 H;  4F52 A;  2FXA A;  1G3Y A;  2LOO A;  2BXZ A;  3I55 I;  1OYI A;  3E3V A;  3M3Y J;  5D6E A;  4ZDP A;  4RAY A;  3KFW X;  1T38 A;  2JTV A;  3BTI A;  4BE2 A;  1PP8 F;  1PYV A;  4IQJ A;  4BH9 A;  2JSC A;  1J2X A;  3H0D A;  4PJJ A;  1HC8 A;  3VYT B;  5E17 F;  2VT2 A;  4YEL A;  4KMU X;  1QU3 A;  5D4S A;  2STW A;  2Y0S N;  1XS9 A;  3FXJ A;  4PZJ A;  1D0Y A;  1DPR A;  3VYU B;  1KQ9 A;  1WVR A;  1TQM A;  2CQN A;  3M8J A;  4IO9 F;  5EYR A;  4CH7 A;  1JUP A;  2Y30 A;  3EUH C;  2CWE A;  1WJD A;  4ZYD A;  1U9N A;  5CYV A;  3OYD A;  3JSP A;  3HOY J;  2HQN A;  2KIU A;  3LFU A;  2GA1 A;  3JRC A;  1WQ2 A;  2PMZ A;  4JBA A;  2EFQ A;  4BL0 B;  3I59 A;  3K1N A;  4LLG F;  1WI9 A;  2R5Z A;  2Y0S A;  2ZB9 A;  1IXC A;  4IJA A;  5J4Y A;  4MEX F;  2M1B A;  2WAQ N;  4CCK A;  2GXB A;  5DCM B;  1SFE A;  4HA8 A;  3OSF A;  5B5E C;  5IT3 A;  3CC4 I;  2A6E F;  4KIC A;  4Q48 A;  1FMW A;  2W82 A;  3H35 A;  4XLA A;  1WGX A;  2IA0 A;  2JA2 A;  2D1V A;  1T56 A;  3DKX A;  3V7C A;  2EIK H;  2GAU A;  3H9G A;  5ILS A;  3CCR I;  2EV6 A;  1GVJ A;  4BXX J;  4BHB A;  4FX4 A;  1TL8 A;  2WAQ A;  4D1Q A;  4IHX A;  4CCO A;  3MKZ A;  1E17 A;  5JVT A;  3BTL A;  2NNY A;  1ITY A;  1Z9C A;  1ETK A;  1VTN C;  5HDK A;  3CO6 C;  2Y48 A;  4XLE A;  1TP4 A;  1B4A A;  2A69 F;  5CVU A;  4E7I A;  1D0Z A;  2HFH A;  2FOW A;  4BEH B;  4FET A;  4ZTF A;  3ERM A;  5E79 C;  3RPU D;  3V42 A;  1I39 A;  1DP7 P;  1DQU A;  3HRM A;  3CDH A;  3JSO A;  4EJO A;  3ABK H;  5HS8 A;  1LDK B;  2ZXJ A;  1LDD A;  3HJE A;  3VB2 A;  2LY9 A;  1HOM A;  3BG7 A;  3ECH A;  1MJ9 A;  3A03 A;  5JHF A;  1YHQ I;  3K4M A;  4DNC A;  3CQZ J;  4ZJZ A;  3OYJ A;  3HUG B;  2KIM A;  3S1M J;  4MLO A;  1BI1 A;  2ZCW A;  5FO5 A;  3E6D A;  4Y52 J;  2NOG A;  3BG5 A;  1XG1 A;  4RM3 A;  3BTC A;  4J01 A;  3OYL A;  1Y6I A;  3FF5 A;  4HAM A;  2LP0 A;  1DPU A;  2BY2 A;  3C7J A;  2ACJ A;  3HRU A;  3J81 Z;  1RC9 A;  2OTJ I;  1JI8 A;  3KLN A;  2VQC A;  3V4G A;  1ZEL A;  1FWZ A;  3KP6 A;  5FKL A;  4HG2 A;  3FXR A;  4M6X A;  1MNE A;  2XPW A;  2H8R A;  2Y31 A;  1ZK8 A;  5M5X J;  4DW6 A;  1RIO H;  3BJA A;  4F3Q A;  1DDN A;  2A05 A;  1TBX A;  2CFX A;  4L9T A;  4R8H A;  3WHB A;  4G7H F;  9ANT A;  2VBZ A;  4I09 A;  2VKE A;  3FXL A;  2HZT A;  2IS1 A;  4FHT A;  3BQY A;  2DPD A;  1X3U A;  3OWT A;  1JUS A;  2R92 J;  1B1B A;  3E1S A;  5C44 J;  3CDL A;  2JPC A;  2VB6 A;  2EIM H;  2HVR A;  3SEZ A;  3H5N A;  1IN5 A;  1XCV A;  4BDZ A;  2FJ1 A;  1MMN A;  1A6Q A;  3RPQ A;  5M5Y J;  1XSX A;  2BXY A;  1J09 A;  2HQR A;  1SFK A;  2VAS A;  1TWH J;  2VXZ A;  3TQN A;  5ICG A;  3S1R J;  1JTX A;  4UVB A;  1RNL A;  2JK3 A;  4W97 A;  3OR1 C;  2XF7 A;  3C18 A;  3K70 C;  2EZH A;  4LJZ F;  1H0M A;  3HB9 A;  3AG2 H;  4C2M J;  3FK6 A;  1S7O A;  3BWG A;  1FNN A;  3IP4 B;  3F21 A;  3ERE D;  5BNG A;  2QBY B;  2HI3 A;  1HQC A;  2VJI A;  3B6A A;  1GXP A;  3H3V K;  2KRC A;  5F0F A;  2RQP A;  4GYG A;  3WU0 A;  1FTZ A;  2LR8 A;  1BM9 A;  4A3E J;  1Z05 A;  2LLK A;  3M9A A;  3IV5 A;  4PDK A;  1QVT A;  2IA1 A;  2PG4 A;  3ZMS A;  4S0H B;  1RKT A;  1FSE A;  2AO9 A;  5ED4 A;  2WY7 Q;  2VT3 A;  1Y1W J;  2GXG A;  1FT9 A;  1TW3 A;  3U9G A;  3EUH A;  5K7Z A;  1VFC A;  4MIM A;  5CVV A;  3DWL E;  3P9K A;  5HDG A;  4GGG A;  4P9F A;  2QUF A;  3I3L A;  3GEZ A;  1W4M A;  5KAI C;  5TJJ A;  3QYE A;  3ROU A;  1BI3 A;  2BOL A;  1ZKG A;  1HCR A;  2FD5 A;  1BC8 C;  1JTY A;  3JRD A;  3T0Y A;  3K4B A;  5EZH A;  2OQG A;  2DBB A;  3D5L A;  2F6C A;  3KP7 A;  4Y17 A;  3OL4 A;  2XAH A;  5GP9 A;  1XMK A;  2OD5 A;  2VPR A;  3TO9 A;  4AVP A;  5KAF C;  3DPU A;  1BL0 A;  3HOX J;  2M0C A;  3HOV J;  1D1B A;  3K1M A;  3L9F A;  1G3T A;  4V2G A;  2VKH A;  2RC4 A;  4A5M A;  5D4R A;  3A4C A;  3NAR A;  4P9U A;  4WCG A;  1O7L A;  2LKS A;  5CLS A;  1O57 A;  5DCM A;  1L0O C;  3GTP J;  1BIA A;  3D5S C;  1GV5 A;  3NWS A;  3P7N A;  2FBH A;  3U1D A;  3I5U A;  4ETS A;  4HF1 A;  1RUO A;  5C4X J;  5ICC A;  4XON A;  3OIQ A;  4OIR F;  3LSP A;  4EAT A;  1QBJ A;  3K70 D;  5EJC A;  3L2V A;  4ZTJ A;  5E1X A;  1GT0 C;  1YX5 A;  3HPG A;  1HF0 A;  2EV0 A;  4DYR A;  4LIT A;  1MBF A;  3WGG A;  1FBS A;  4RDU A;  1K4T A;  1FIP A;  2COM A;  3S1N J;  1EH7 A;  2X48 A;  1H8A C;  2VJ5 A;  3GXO A;  3F8M A;  2CV1 A;  2DCE A;  1JT6 A;  1X1B A;  3CMA I;  1MSF C;  1VQ7 I;  4BY1 J;  2R7W A;  3B6C A;  2ZC2 A;  4MQV A;  4HLY A;  2LH9 A;  4BEH A;  2W84 A;  2IS6 A;  2JRM A;  4RBO A;  5EEH A;  1VQ6 I;  2VE8 A;  4DBQ A;  1APL C;  2IA2 A;  3A0B C;  3MKY B;  1XPX A;  2ZBK A;  4G6D A;  4XM3 A;  2H6B A;  3RI4 A;  4ITV A;  2UXX A;  1FYK A;  2O7O A;  2RNG A;  2GA2 A;  3HDD A;  3HUG A;  1YTY A;  5J40 A;  4M9S A;  1AA7 A;  2WY8 Q;  4XRM A;  3GTG J;  4JK1 X;  2FX0 A;  4P1W A;  3DEE A;  3GZ5 A;  3KPH A;  3EPZ A;  2CUJ A;  1AWC A;  5JHU A;  2QEN A;  4C30 A;  1DP3 A;  1TT0 A;  3VYS B;  3J7Y J;  1O3T A;  2UV1 A;  3BPV A;  3FHZ A;  4HPQ A;  3TL4 X;  3OYK A;  3MFK A;  2VBY A;  2EIJ H;  3T8T A;  5M3F J;  4MQ9 F;  2XAQ A;  4UB6 C;  1NK2 P;  1R5G A;  4UNO A;  4I0A A;  4KIF A;  3CCM I;  2X1D A;  2ZSH B;  3PNT A;  2OJE D;  2FOK A;  2XIG A;  4BHP A;  4HV5 A;  2IXS A;  2XUB A;  1FBU A;  3FBN B;  1ZR4 A;  3PO3 J;  4AVZ A;  3Q3S A;  3MQ0 A;  1Z6R A;  2DT7 B;  2K85 A;  5E20 A;  2BYV E;  4MHG A;  2AS5 F;  2IGN A;  3W6K B;  1SVL A;  4LB6 B;  3VYR B;  2H1L A;  2KRH A;  4KIT B;  1UG2 A;  3H9J A;  3IHU A;  1BOB A;  2CRG A;  3K4J A;  1HXD A;  4BQO A;  1F36 A;  3FX3 A;  2M8G X;  2CQQ A;  1ZHF A;  2K3P A;  1Z3Y A;  3QYB A;  5HS9 A;  2V4J C;  1FPQ A;  2DLL A;  1KYW A;  1VQ5 I;  3OYN A;  2PMU A;  5DYM A;  2FBI A;  2DFF A;  3KZY A;  2R0Q C;  3MEX A;  4ABZ A;  1UHS A;  2LKP A;  3TW6 A;  2K7L A;  1S8N A;  1X2N A;  3E97 A;  2IP2 A;  3ZGK A;  4A0X A;  1IC8 A;  5LEJ A;  2P5L C;  2W48 A;  4BQQ A;  1SEU A;  1MH3 A;  1WFX A;  2QBY A;  1EH6 A;  1ETW A;  4D5C A;  1IUY A;  4HZF A;  3O6B B;  4A3C J;  2K4J A;  5IYC J;  3TP3 A;  2UWM A;  3QQA A;  3R61 A;  2XPV A;  1KU3 A;  1VI0 A;  5DTD A;  1W5C C;  1KQ0 A;  5BMZ A;  4L0Y B;  1D5Y A;  2BY3 A;  4YG2 F;  3IAM 2;  2K9M A;  2VL8 A;  3TBI A;  3HBL A;  3PUF A;  2QYO A;  4YEJ A;  3SZT A;  3QOD A;  5ILU A;  3E6C C;  3PL8 A;  2PN6 A;  3QWL A;  4KIG A;  2TCT A;  5JI6 A;  4A3B J;  1UMQ A;  2KIS A;  5J4V A;  3IUO A;  1UZC A;  1TW2 A;  5IP6 A;  4A3J J;  3DU6 A;  3LSK A;  4XN3 A;  1W5S A;  2M4G A;  5DUK A;  2DDB A;  3GO5 A;  3TO7 A;  4HQE A;  1ZR2 A;  1CQT A;  4KFC A;  4BBS J;  4XBF A;  3CP8 A;  1WJ5 A;  3KP4 A;  2KIF A;  3SDB A;  1Z67 A;  2BGC A;  3K4N A;  1IW7 F;  2DN0 A;  1QVU A;  4ZZD A;  4A2U A;  3IKT A;  1W5T A;  3OV8 A;  1D0X A;  1G3W A;  3JRB A;  5GTI C;  2QWW A;  3LNQ A;  1SFX A;  2H6C A;  3EUA A;  5B1A H;  3CES A;  2Y69 H;  3RQ4 A;  1QHH D;  5EDN A;  3FIS A;  3ZQL A;  1FYM A;  5HNH A;  4PK4 A;  1YG2 A;  2XSD C;  1DU0 A;  4LB5 A;  3BC8 A;  1O7F A;  3WOD F;  2PJP A;  3GWZ A;  4DYC A;  4H4K C;  1LEA A;  2ZO4 A;  4M71 A;  1U3E M;  3JW4 A;  1I6H J;  4BGD A;  4OIQ F;  3GUD A;  2XPU A;  3I58 A;  1CF7 B;  1POG A;  3G2B A;  5FLX Z;  2HYG D;  4BU2 A;  4A6D A;  1BI2 A;  3FMR A;  2DMU A;  4F93 B;  2X85 A;  3NEU A;  5DS9 A;  4EM2 A;  2W85 A;  3SFZ A;  2NVU B;  2M7A A;  2VQH A;  2OTL I;  3MVP A;  1JJ8 C;  2GOM A;  4KT6 A;  4S04 A;  1EJ9 A;  1LFP A;  5J1U A;  2H94 A;  2NYX A;  1YW9 A;  3E5Q A;  3JRA A;  1LFB A;  1GVD A;  2WAD A;  5AIP A;  3HRS A;  3I4M J;  2EWN A;  2HDW A;  2ID6 A;  2NS0 A;  4I6Z A;  1I27 A;  4RM2 A;  1EF4 A;  3DPL C;  4HDV A;  3A01 B;  3CMY A;  3TDZ C;  4A3G J;  2ID3 A;  3QOE A;  1FMV A;  2GIV A;  5D6F A;  2M8E A;  2QSF X;  3I64 A;  3I56 I;  1PUE E;  3ECO A;  2O3F A;  2LTP A;  4IX7 A;  2E34 A;  3K0L A;  4OWR B;  3PJR A;  2OQR A;  3DLL F;  3M1C A;  3DQV C;  4NC6 A;  3DXJ F;  2KP6 A;  4CUG A;  3LSR A;  2Z3Y A;  3L7W A;  4X1E A;  1WHU A;  2B63 J;  2VC0 A;  5TGT A;  3IRQ A;  2E36 A;  4XSX F;  2FBK A;  4WXD A;  4EEF G;  2XRO A;  3QP6 A;  2R7Q A;  3HKZ N;  4B48 A;  1RKW A;  2HQ5 A;  4AM3 A;  2BVL A;  2H09 A;  2E71 A;  2XB0 X;  3PIP F;  2DXI A;  1YW7 A;  1ZRE A;  1Y8Q B;  1F43 A;  1MSE C;  2HVS A;  2R7S A;  1MIJ A;  1JGG A;  1ZQ3 P;  2KHM A;  2FU4 A;  4NC7 A;  4AU7 A;  5GAG J;  1BBY A;  5FLM J;  2LRD A;  1ZAR A;  1IRZ A;  5K5Q A;  3DU5 A;  4O5V A;  4RLQ A;  1XDU A;  3F6V A;  1RI7 A;  1RZ4 A;  2QQ8 A;  3OYH A;  3CCJ I;  3RIR A;  4RS8 A;  1OR7 C;  2DYS H;  1V55 H;  3S2H J;  5H2F C;  1BR4 A;  3JRI A;  4IHT A;  4U7B A;  4NQW B;  2AXL A;  2OU2 A;  1GUU A;  1VND A;  3OMY A;  3MKL A;  4IOC F;  1VQN I;  3ASN H;  5F1J A;  3DKW A;  4I02 A;  2EPF A;  2MBF A;  3FMQ A;  4JYK A;  1U8B A;  4ZC3 A;  1MJA A;  2CH0 A;  1DU6 A;  1Z1D A;  1T6S A;  4RGU A;  4J19 A;  4IEJ A;  1RUN A;  1D3Y A;  5C3E J;  3G73 A;  3DBR B;  2DFH A;  3BR5 A;  1YYV A;  3FBI B;  1VQ8 I;  1E3P A;  2QQ9 A;  3GFJ A;  3LOC A;  3RTR A;  2OZU A;  4U7D A;  2VXD A;  1U6G A;  1XCB A;  5EZG A;  3BT9 A;  2V1U A;  2LC2 A;  2CV2 A;  2KPM A;  3FDY A;  3GZN B;  3BOQ A;  4Q5S F;  1WPK A;  2IJL A;  1BN5 A;  1LFU P;  3SHF A;  2CQK A;  4EJU A;  3SJM A;  3HHG A;  3RZO J;  3QPH A;  4QWQ A;  2R5Y B;  1A04 A;  1SFO J;  3FXM A;  1IAW A;  2P7V B;  1F9N A;  1ZGJ A;  2L4A A;  1W7P B;  3OIP A;  2DOD A;  2KT0 A;  1R00 A;  2HZD A;  2I10 A;  3FXO A;  3JRG A;  2CYY A;  3A2K A;  3VPR A;  2GM4 A;  2LMD A;  3PNV A;  2ME0 A;  4BE0 A;  3DEU A;  1E3O C;  1QA6 A;  4BJ6 C;  4E7K A;  3WG9 A;  3WTX C;  2A6H F;  2MC4 A;  2ZNY A;  4HSR A;  2VOD A;  2KQR A;  1FY7 A;  2MH2 A;  3UNG C;  1L3L A;  4EJV A;  5FD6 A;  1BI0 A;  2BZT A;  4V2F A;  2XB5 A;  5JR3 A;  1CF7 A;  2LSO A;  2FNA A;  3QPL A;  4QLC U;  1S5L C;  3J80 Z;  2FE3 A;  2CSO A;  1G2H A;  3LSJ A;  1HA8 A;  3HZJ A;  4PFO A;  2OCE A;  2MYS A;  5FFX A;  4OOI A;  4XLN F;  2IVM A;  2E5N A;  4FCY A;  2BY1 A;  1R1U A;  4U0W A;  1XMX A;  4YFN F;  2L9R A;  3BP8 A;  2HTS A;  2A5Y B;  4HRI A;  3HOZ J;  4IRH A;  3GTQ J;  4G94 A;  3K2Z A;  2RDP A;  4ZYG A;  1ETQ A;  2DA5 A;  4G12 A;  4N9H A;  4G7O F;  2XRL A;  3R4K A;  3DPT A;  4I0B A;  4GDF A;  3H36 A;  1X1P A;  3ESW B;  1YE9 A;  3PNY A;  4A5N A;  3TDU C;  4KUM A;  4W1U A;  5IPA A;  2CFO A;  3I9V 2;  5BPD A;  3E0J B;  3A01 A;  5ERI A;  3GLX A;  4R1H A;  3KYD B;  3WTU C;  1EKE A;  1ERD A;  1N78 A;  3LA3 A;  2Y75 A;  2KL4 A;  5K5O A;  4CZZ A;  3JRE A;  2XGC A;  2P8T A;  2XKO A;  4C3I J;  3G1O A;  1MMD A;  3CME I;  3MKW B;  4TV7 A;  3V7S A;  2A07 F;  5FLX K;  4A3K J;  3BR2 A;  3VEP A;  1DGR M;  2M7B A;  2YR2 A;  4EGZ A;  1TC3 C;  2C6Y A;  1QNT A;  2GWR A;  2L0K A;  2KZV A;  1KQ8 A;  3KYC B;  3CD6 I;  4XIC A;  3LMM A;  2Z2S B;  2HXO A;  4RGS A;  2K40 A;  5TIS C;  4HST A;  1BA5 A;  1W7P D;  3CCL I;  1ULY A;  5FKO A;  3MCZ A;  4M6V A;  5B1B H;  2LF7 A;  4ZDL A;  2HTJ A;  2MD0 A;  3QAH A;  3SDG A;  1X3Z B;  2ME6 A;  3WE2 A;  3OY9 A;  1VQL I;  2Z16 A;  3EYI A;  1UHW A;  2E2H J;  3CCY A;  5K5R A;  1OR7 A;  4E6K G;  1U0J A;  4PSW A;  3B73 A;  2GOX B;  2XGE A;  1IJW C;  4U87 A;  4BDY A;  1ZRF A;  3BY6 A;  3ZQQ A;  3L00 A;  5LHH A;  5DV5 A;  5BOX A;  2TRT A;  2IS4 A;  3LQQ A;  3G3Z A;  4UVC A;  1H88 C;  3M07 A;  1ZAO A;  4U0Y A;  3DTI A;  3TMO A;  5BPI A;  2E2J J;  1YO5 C;  3K1P A;  1LB2 A;  3MZY A;  4BBR J;  3AAF A;  2CGP A;  4QTR A;  1IG7 A;  1IO2 A;  3JRF A;  2JZY A;  2WC2 A;  4NQW A;  2L7Z A;  3RDI A;  3HM5 A;  2QF7 A;  5L3F A;  4G7Z F;  4EQQ A;  2RRE A;  3VSL A;  3HSE A;  1DGW Y;  4OAZ A;  2VQG A;  3MMY B;  4HBL A;  4NC8 A;  1Y8R B;  3TOA A;  4ESF A;  3CC7 I;  1J59 A;  3OIO A;  1D1C A;  1IN8 A;  2QQB A;  3IH3 A;  4UV9 A;  2NOJ B;  1GXQ A;  5C4J J;  1FX7 A;  4IPA A;  3F8B A;  1WJA A;  2FF4 A;  2HS5 A;  2CW0 F;  1SC7 A;  4IRI A;  2OAZ A;  2HOA A;  3PSF A;  4DJA A;  2W57 A;  2M87 A;  2D1H A;  2JN6 A;  2DA2 A;  3SZG A;  3KP3 A;  2Q1Z B;  1KU9 A;  3VDX A;  2N8G A;  2DA4 A;  4OAY A;  3RPU A;  4WWC A;  3E5U A;  1HSJ A;  3ZQF A;  4I2O A;  3TW7 A;  1SD5 A;  4XL9 A;  1FJL A;  2IGO A;  2BBY A;  2VON A;  5FLV A;  1U78 A;  1SD7 A;  5EG0 B;  2V26 A;  4L5J A;  3KEO A;  4S05 A;  2F5C A;  5J8F A;  1ETV A;  2R5Y A;  1DUX C;  2LYC A;  3LQR A;  4LK1 F;  2V9P A;  1R9T J;  4UHT A;  4F7Z A;  1W7P A;  1RR8 C;  5CVR A;  4A6E A;  2AHQ A;  4B09 A;  5FD5 A;  1J5Y A;  4YII A;  4ANJ A;  4N4O B;  4BAC A;  4D5F A;  1LVA A;  2R7X A;  4XLP F;  1XGM A;  4M3D A;  4HEA 2;  2CQX A;  2JA8 J;  4Z2Y A;  2QSH X;  2KDO A;  1F5T A;  4OMY A;  3T5X A;  3IKV A;  4RB0 A;  4AID A;  5GTH C;  5HLG A;  2E2I J;  2ZKZ A;  2M5W A;  3LFK A;  5CVI A;  1P9Q C;  3KEQ A;  2RKH A;  3GTJ J;  2XVC A;  4BXU A;  2EIL H;  3L2C A;  2EQR A;  3CJR B;  5F0H A;  3LAP A;  4F91 B;  3UR3 C;  3H92 A;  1J75 A;  1X4P A;  5FRN A;  4BS9 A;  3RQI A;  1QGP A;  1ZYR F;  1ONV A;  1WJB A;  4I7H A;  1TWC J;  2DJN A;  2XAU A;  1OMI A;  4M9Z A;  2JUG A;  1UCR A;  2CMP A;  4K2E A;  4ON0 A;  1ON2 A;  3PO2 J;  1FOX A;  3CZ6 A;  5B3S H;  2YSR A;  1STZ A;  4M73 A;  4PSX A;  3OOU A;  1A6I A;  3H3Z A;  4I99 C;  4EJW A;  1WJC A;  4MFD A;  2HOT A;  2DU9 A;  1OIS A;  4PCQ A;  5J3L A;  2YPR A;  4XNF A;  3H9Q A;  4XK4 A;  1IDZ A;  3ZN0 A;  1KYZ A;  2L7F P;  2NVT J;  1U2W A;  1O3Q A;  1J7K A;  2HYJ A;  2GLO A;  3S1Q J;  2L3D A;  2JVH A;  1MMS A;  5ICE A;  4HYE A;  5D8K B;  4HQM A;  3D0S A;  1S72 I;  1RES A;  5J6X A;  3HL2 A;  4Y15 A;  1IN4 A;  3OS1 A;  1AKH B;  4RMN A;  3TGN A;  1F1Z A;  3GTL J;  4UXN A;  4BAY A;  4CYC B;  2R7V A;  3J80 K;  3ZQC A;  4EJT A;  2L54 A;  3BPX A;  2B9S A;  3QOP A;  3SZP A;  4DOZ A;  1YIO A;  1T2K A;  2M45 A;  3S17 J;  4FE4 A;  2PI0 A;  4MFE A;  2CG4 A;  5HLT A;  3DBH B;  2DA6 A;  1S6L A;  2RN7 A;  3CUQ B;  3GYH X;  2DFE A;  5DDG A;  2V1D A;  1XSD A;  3C1D A;  3GF2 A;  3HSF A;  1Y1V J;  4B3X A;  3DBL B;  3E5X A;  5DEQ A;  4NNJ A;  1V5G A;  1IXS B;  2FEZ A;  2IPQ X;  4IOA F;  4RGX A;  4Y4R A;  5JVG F;  2ZFW A;  3CJN A;  2RAE A;  1MZB A;  5B66 C;  5F04 A;  1ZH5 A;  2JRT A;  1J9I A;  5BQT A;  1RET A;  3HC7 A;  1YW8 A;  2I8D A;  1I6X A;  3OYC A;  4FT8 A;  4G6T B;  3IWZ A;  2D2W A;  3F72 A;  3JR9 A;  1KON A;  4ZYA A;  5H6Q A;  2VN2 A;  5HDN A;  2X6W A;  4C9Y A;  2J5P A;  4PJM A;  3Q0V A;  3ZMV A;  5F1R A;  2JT1 A;  4QIW N;  4IHS A;  2VUM J;  2V9V A;  3JCU C;  3ML6 A;  4XLC A;  2DPU A;  4LLL A;  4IXA A;  3E7L A;  4XID A;  3CO7 C;  2PQ8 A;  1YRN B;  5ICF A;  2VQL A;  3ZCO A;  4HNU A;  1SD6 A;  1VQK I;  1Y56 A;  2ICW G;  2CV0 A;  1KU2 A;  3MN2 A;  1G59 A;  1SMY F;  4N4N B;  2L9S A;  3DTK A;  1SAX A;  2VBX A;  2P6T A;  5LRR A;  4XLF A;  5CQE A;  4BJT A;  5D5X B;  2FNP A;  4WXC A;  2JWT A;  1KA8 A;  1TTY A;  4G9Y A;  1ETX A;  2EZI A;  3S8P A;  3U2R A;  4B47 A;  2QLZ A;  4EVI A;  2KLO A;  2R7F A;  1KU7 A;  1MMG A;  3JTH A;  3J7A O;  1D8J A;  2HQA A;  1MBG A;  2RQQ A;  2G0E A;  4OIP F;  3J81 K;  2K86 A;  4CCN A;  2DMN A;  1ZG5 A;  2X4H A;  3ZMD A;  1MGT A;  2WB1 N;  4XKC A;  3JAM Z;  4A3D J;  3B02 A;  1UST A;  4KN7 X;  1K61 A;  3IAS 2;  1P7I A;  2EZK A;  2A68 F;  4NUB A;  1YJW I;  4LLN A;  2LFB A;  5EG0 A;  3WTY C;  1V5E A;  3C3W A;  4B43 A;  1YX3 A;  2XAG A;  3OSG A;  5E8G A;  2BHY A;  4L5I A;  1WRJ A;  1MND A;  5HNF A;  3N97 A;  2J5O A;  2UXN A;  3WGI A;  5CVJ A;  4E7H A;  2HOS A;  4A3M J;  1I1G A;  1JKR C;  4PJN A;  4L18 B;  2WB1 A;  3WG7 H;  2PLY A;  1BW5 A;  1OCT C;  4UY8 I;  3WHC A;  4KIB A;  4BY7 J;  3RKW A;  2CUZ A;  1W0T A;  3H5A A;  3S3N A;  1T8I A;  3MZH A;  3R0A A;  3GLL A;  1V4R A;  1P92 A;  3PM1 A;  2MA3 A;  3K10 A;  4JX6 A;  2CQ7 A;  3BCA A;  2IW5 A;  1XC5 A;  4RA2 A;  5D8L B;  1W0U A;  2MW8 A;  3FMS A;  1R49 A;  1LE8 B;  2O8X A;  2LY2 A;  4IKF A;  2KIQ A;  1JKP C;  1WI3 A;  4II2 A;  4LFU A;  3LL7 A;  3D5R C;  3PSI A;  4MNU A;  2YU9 J;  1SAN A;  1J0R A;  3LA7 A;  3SFI A;  1WZ2 A;  1T0F C;  1U5T B;  3SEQ A;  1MDM B;  2R4G A;  2X6Y A;  1B59 A;  1C0W A;  1Z3X A;  2AQE A;  2E19 A;  3FKJ A;  1UEL B;  1FC3 A;  2JVG A;  3G4S I;  2XRN A;  3AG4 H;  3C2H A;  1BJA A;  1X1D A;  4D9J A;  3HRT A;  1T98 A;  3RYR A;  5EEG A;  4PGG A;  1B6A A;  1OCO H;  1P4W A;  3BRO A;  4DIQ A;  3WTT C;  1ZG3 A;  4KMF A;  1U5T C;  1OJL A;  4C3J J;  1YFH A;  4BNC A;  2PX9 A;  3QRF F;  5D5W B;  1BC7 C;  3WE3 A;  5JFR A;  3V8K A;  3LSH A;  3ONQ A;  1ETO A;  1UAA A;  2G9W A;  2DDA A;  3S2W A;  1AKH A;  4F92 B;  4CYC A;  3ZQG A;  2VPL A;  2MAB A;  3FM3 A;  2WV1 A;  2DAO A;  2FSW A;  1ZTR A;  5K7F A;  4L5E A;  1SAU A;  3FIW A;  2IGM A;  4A3F J;  2HVQ A;  3F3X A;  1GDT A;  3L2Q A;  3BR0 A;  5KVR A;  4YFK F;  2ZNZ A;  4XN0 A;  3ZMU A;  3CUQ A;  3COA C;  5FJ8 J;  3PUB A;  3TED A;  2V1N A;  1EA3 A;  2X6X A;  1TWG J;  3PFI A;  2Z33 A;  3QU3 A;  2EFW A;  4BQN A;  2O03 A;  5HOO A;  4ENK A;  4AC0 A;  2LKX A;  1ZG1 A;  4IHW A;  3GZ6 A;  2YU3 A;  2M0M A;  2NS8 A;  3PFY A;  2ZSI B;  1H9G A;  1JE8 A;  2KDZ A;  3WTS C;  2CU7 A;  2F48 A;  3M1E A;  3WU2 C;  1BR2 A;  2LDU A;  3JRH A;  2ZXW H;  2EJR A;  2HNH A;  4JQF A;  3OYA A;  2MFZ A;  3AFH A;  3KYL A;  3GCM A;  2L7M P;  2R7U A;  2XGD A;  4ASN A;  2QCO A;  1P4A A;  5F64 A;  2P5V A;  2MLK A;  3LST A;  2LBF B;  1WKM A;  3FHN A;  2QKL B;  2KFD A;  3LAJ A;  2ZXH A;  3CCU I;  1QHG A;  2OCC H;  1X58 A;  3LA2 A;  2NNN A;  2K4B A;  2Q0O A;  3IC7 A;  3NWT A;  4ZYE A;  3N4M A;  1XSV A;  2F4O B;  3CC2 I;  4B4C A;  2O0Y A;  1YRN A;  4L9J A;  3F8C A;  1D8K A;  1O4X A;  1PUF B;  1ZN2 A;  5GAE J;  3BDD A;  2HWV A;  4U88 A;  3JTG A; 
#chains in the Genus database with same CATH homology
 4KA4 A;  3ISP A;  1QPM A;  1HW5 A;  3RYP A;  4UV8 A;  3WTZ A;  3M8F A;  2DQL A;  4I98 B;  4G6Q A;  2DFI A;  3EET A;  4UUV A;  4CO8 A;  4CDG A;  2V1X A;  4O6J A;  2VE9 A;  2OA4 A;  2HGC A;  2HR3 A;  2Z99 A;  3GVA A;  2B0L A;  3K9T A;  5DD4 A;  1WSU A;  3GFI A;  2PBI A;  4MEY F;  4UVA A;  5L3G A;  4WXH A;  1V3F A;  4N9I A;  2KJB A;  4MTE A;  5HVQ C;  4MGR A;  2O6G E;  3KP5 A;  4L9V A;  2FQ3 A;  4A0Y A;  2A3S A;  1AOY A;  1FP2 A;  1S7A A;  3ULQ B;  2ELH A;  1S29 A;  1TNT A;  4L0Z B;  2ETH A;  4OIN F;  1T0F A;  1WWX A;  2RGV A;  6PAX A;  4GCV A;  3HOT A;  3FZV A;  1LEB A;  4KT5 C;  4RB1 A;  3JAM K;  2L01 A;  4Y13 A;  1I1S A;  5HLI A;  3I71 A;  1U5T A;  1MDM A;  1XB4 A;  2KKO A;  2VC1 A;  2CO5 A;  3Q9V A;  3WTW C;  2EA2 A;  4N0B A;  4IF4 A;  2R3S A;  2P4W A;  5CJ9 A;  3GFM A;  2QVO A;  3NRV A;  2HYF A;  3V7R A;  4IVN A;  3WGH A;  5DD8 A;  2O61 A;  3CLO A;  2PFB A;  3ELK A;  3R60 A;  4CHU A;  4O3M A;  1R7J A;  3R0J A;  2HDC A;  4OIO F;  3K69 A;  1E2X A;  3FXQ A;  4EV0 A;  2V79 A;  4CIC A;  2R7D A;  5LEK A;  4ENM A;  1USS A;  1R23 A;  5LHI A;  2DQR A;  2QM3 A;  1Z7U A;  2ZJ2 A;  4YIF A;  1QZY A;  4KN4 X;  5E1Z B;  4Q47 A;  2EB7 A;  3RKY A;  5DUI A;  3HIF A;  2L02 A;  1R22 A;  4BYY A;  2HOE A;  2DK8 A;  3HOS A;  1BIB A;  1LJ9 A;  4AD9 A;  5IT9 Z;  4LGW A;  4ZH4 F;  1ON1 A;  2A61 A;  4ENN A;  2F2E A;  1OPC A;  2VOP A;  1HKS A;  3MAJ A;  2EFP A;  4AIH A;  2V6C A;  2EV5 A;  4P96 A;  3ABT A;  3EYY A;  1R1V A;  3QPT A;  4R79 A;  4D0P A;  5L3B A;  1HKT A;  1YS7 A;  4LG0 B;  3DFG A;  1HBX G;  2DW4 A;  3V8J A;  2XV4 S;  1O3R A;  2MLG A;  1G3S A;  2OBP A;  4M72 A;  4OMZ A;  1I5Z A;  3ZN1 A;  1K78 B;  4CGZ A;  3V8L A;  5HS7 A;  1U8R A;  1ZGA A;  2XKP A;  1OYW A;  1K6O A;  2IRF G;  1TLH B;  4G8X A;  1QZZ A;  3DF8 A;  2F5E A;  4WK8 F;  1IF1 A;  1YS6 A;  3E6M A;  1HKQ A;  2YX4 A;  2XAS A;  3ZP5 A;  1IN7 A;  2JPB A;  5ILV A;  4EMS A;  1QQI A;  2HEO A;  3R6S A;  3REO A;  1MJB A;  1B9M A;  1Q1H A;  2H27 A;  4M74 A;  3NQO A;  3O3K A;  1MD0 A;  1XD7 A;  3I4P A;  2K02 A;  1ZRC A;  1IZ1 A;  3RJP A;  2P6S A;  4RGR A;  4E70 A;  2X0L A;  1KGS A;  1HW1 A;  1H9T A;  1MKM A;  2G7H A;  3KCC A;  2P7C B;  2Y0M A;  4ESJ A;  3FM5 A;  1EV7 A;  3FXU A;  2E1N A;  2KRF A;  2VOO A;  4KYW A;  2DT5 A;  4MTD A;  4DQ2 A;  1LDJ A;  2ZME B;  1NHA A;  3F8F A;  3T1B A;  5K1Y A;  2DI3 A;  4CYD A;  1XGN A;  3FWE A;  3T8R A;  1LQ1 A;  1XN7 A;  4AIJ A;  3DP7 A;  4H0E A;  3L09 A;  5H20 A;  1PDN C;  3BJ6 A;  4EM1 A;  4KDP A;  4WF2 A;  4OU0 A;  5D5V B;  2Q2E A;  4M6Y A;  4I01 A;  3VOE A;  4WX9 A;  2DTR A;  1HST A;  2LF8 A;  4P5O A;  2FML A;  3VOD A;  3HTS B;  3ABU A;  4HX8 A;  5DCF A;  3BZ6 A;  4HLX A;  5LGN A;  3ZMT A;  2XHK A;  5FGM A;  3HSR A;  5E1W A;  4GXO A;  5F6F A;  2ESH A;  2PMH A;  3PQJ A;  5A2Q Z;  3MWM A;  2W24 A;  3F8N A;  3CUQ C;  4RB2 C;  5LBQ A;  4HDU A;  3QU6 A;  2Z9O A;  4P55 A;  2LNB A;  3TOB A;  1P2F A;  1XDS A;  1Z6T A;  3RKX A;  1XGS A;  2BEO A;  1GHC A;  4LMY A;  2RNJ A;  1K79 A;  4HOB A;  2FA5 A;  2RV8 A;  4EM0 B;  4LG0 A;  1B9N A;  4BQA A;  1IXR C;  3W6J B;  3KP2 A;  1SD4 A;  2EK5 A;  4KNY A;  1K78 A;  2NAZ A;  3F22 A;  1EH8 A;  3GX4 X;  3LWF A;  5IT9 K;  1K7A A;  2YX7 A;  2Z5U A;  2EFN A;  5E8I A;  4ESB A;  3O2P E;  3HHH A;  4PGH A;  1PP7 U;  4HX7 A;  4RB3 C;  3QP5 A;  4AIK A;  4ENJ A;  4HW0 A;  3PQK A;  4HV6 A;  1XGO A;  2MH9 A;  4RAZ A;  3EQL F;  1CGP A;  5LRS A;  2E1C A;  1UB9 A;  1FBQ A;  2F5F A;  4GO1 A;  3GFL A;  5J8C A;  2KJC A;  1LNW A;  1ZRD A;  1G6N A;  2OZ6 A;  1TQP A;  4B8X A;  1R5H A;  2W25 A;  2ZME A;  1JHF A;  1ZLJ A;  2ESN A;  3ZQ7 A;  1UFM A;  1O3S A;  2PEX A;  5KK1 A;  4BHC A;  1SFU A;  4Q4Z F;  1ODD A;  2IT0 A;  3KE2 A;  5E18 F;  3BJO A;  2ISZ A;  3HYI A;  3HTU A;  2XAJ A;  3KZZ A;  5FB2 A;  3GW2 A;  1FP1 D;  1R36 A;  2DO7 A;  4M9X A;  3EDP A;  1FOK A;  1HW2 A;  3CUO A;  1IN6 A;  1R1T A;  5LLQ A;  4A12 A;  4IRG A;  1SMT A;  1OYY A;  2FRH A;  2D45 A;  3IWF A;  4HF0 A;  3OOP A;  2E7X A;  3I59 B;  5L3D A;  2MD5 A;  3F23 A;  1OKR A;  2XGX A;  5FFZ A;  1YLF A;  1JGS A;  1ZLK A;  3KLO A;  5LGU A;  2RVC A;  3DV8 A;  2E7W A;  3Q5F A;  1FYL A;  2UZK A;  2FMY A;  5BS6 A;  5D5U B;  3TKY A;  5L3E A;  3WU1 B;  3P9I A;  2GQQ A;  3M7G A;  2DK5 A;  3ZMZ A;  1REP C;  4XSZ F;  3IRR A;  4L9N A;  1XMA A;  1QO0 D;  5HLH A;  4LD5 A;  1Z91 A;  3I53 A;  5L3C A;  2VBW A;  3SQN A;  2MC3 A;  3VFZ A;  2WWY A;  5LGT A;  4NHJ A;  3E6B A;  2HKX A;  4NB5 A;  3SXY A;  1Y0U A;  4CXF A;  2QQA A;  5AON A;  1TQI A;  1R58 A;  4YFX F;  2G7U A;  1S3J A;  4A0Z A;  1P4X A;  2NRA C;  5A2Q K;  1IRG A;  3H3U A;  1FSH A;  1G4D A;  2HKO A;  2BE5 F;  4FX0 A;  4EGY A;  1JHH A;  3TO6 A;  2K27 A;  5H6R A;  2ADU A;  3F6O A;  1IRF A;  2EA4 A;  5TRD A;  5AIQ A;  2XAF A;  4HX4 A;  3P9C A;  4XRF A;  3IL2 A;  4U0V A;  3CTA A;  4AWX B;  1FZP B;  1D5V A;  1F4K A;  2F5D A;  1P6R A;  2EFO A;  2M30 A;  1TNS A;  4GYI A;  2WV0 A;  3KET A;  3I54 A;  2GZW A;  4ZZL A;  3ZPL A;  2STT A;  3Q9S A;  1T39 A;  3WTV C;  3M8E A;  1YQA A;  1JXS A;  2TDX A;  4HF2 A;  5LHG A;  2QZ8 A;  3I0T A;  2L4M A;  1BOA A;  1UHM A;  2Q8K A;  4ZYH A;  2WTE A;  4LK0 F;  2P5K A;  2ISY A;  2BV6 A;  2FXA A;  1G3Y A;  1OYI A;  3E3V A;  5D6E A;  4RAY A;  3KFW X;  1T38 A;  2JTV A;  1PP8 F;  4BH9 A;  2JSC A;  1J2X A;  5E17 F;  2VT2 A;  4KMU X;  5D4S A;  2STW A;  4PZJ A;  1DPR A;  1KQ9 A;  1TQM A;  2CWE A;  4ZYD A;  5CYV A;  3JSP A;  2HQN A;  2KIU A;  2GA1 A;  1WQ2 A;  4JBA A;  2EFQ A;  3I59 A;  3K1N A;  4LLG F;  1WI9 A;  4IJA A;  1IXC A;  4MEX F;  2M1B A;  2GXB A;  5DCM B;  1SFE A;  4HA8 A;  5IT3 A;  2A6E F;  4KIC A;  4Q48 A;  2IA0 A;  2D1V A;  3V7C A;  2GAU A;  5ILS A;  2EV6 A;  1GVJ A;  4BHB A;  4FX4 A;  1E17 A;  5JVT A;  2NNY A;  1Z9C A;  1VTN C;  5HDK A;  3CO6 C;  2Y48 A;  1B4A A;  2A69 F;  5CVU A;  2HFH A;  1DP7 P;  3HRM A;  3CDH A;  3JSO A;  4EJO A;  5HS8 A;  1LDK B;  2ZXJ A;  1LDD A;  3VB2 A;  3ECH A;  1MJ9 A;  4DNC A;  2KIM A;  1BI1 A;  2ZCW A;  5FO5 A;  3E6D A;  3FF5 A;  4HAM A;  1DPU A;  3C7J A;  2ACJ A;  3HRU A;  3J81 Z;  3KLN A;  3V4G A;  1FWZ A;  3KP6 A;  3FXR A;  4M6X A;  1RIO H;  3BJA A;  1DDN A;  1TBX A;  2CFX A;  4L9T A;  4R8H A;  4G7H F;  2VBZ A;  4I09 A;  2HZT A;  4FHT A;  2DPD A;  1X3U A;  1B1B A;  2JPC A;  1IN5 A;  1XCV A;  3RPQ A;  1XSX A;  2HQR A;  2VXZ A;  3TQN A;  5ICG A;  4UVB A;  1RNL A;  3C18 A;  1H0M A;  4LJZ F;  1S7O A;  3BWG A;  1FNN A;  3F21 A;  3ERE D;  2QBY B;  1HQC A;  1GXP A;  2RQP A;  4GYG A;  3WU0 A;  1BM9 A;  1Z05 A;  3M9A A;  4PDK A;  2IA1 A;  3ZMS A;  2PG4 A;  1FSE A;  5ED4 A;  2VT3 A;  2GXG A;  1FT9 A;  1TW3 A;  3U9G A;  3EUH A;  5CVV A;  3P9K A;  5HDG A;  4GGG A;  4P9F A;  2QUF A;  3GEZ A;  1W4M A;  5TJJ A;  3ROU A;  1BI3 A;  1BC8 C;  3T0Y A;  2OQG A;  2DBB A;  3D5L A;  3KP7 A;  4Y17 A;  2XAH A;  1XMK A;  2OD5 A;  4AVP A;  3TO9 A;  3K1M A;  3L9F A;  1G3T A;  2RC4 A;  4A5M A;  5D4R A;  4WCG A;  4P9U A;  1O7L A;  5CLS A;  1O57 A;  5DCM A;  1L0O C;  1BIA A;  3P7N A;  2FBH A;  3U1D A;  3I5U A;  4ETS A;  4HF1 A;  1RUO A;  5ICC A;  4OIR F;  1QBJ A;  5E1X A;  2EV0 A;  3WGG A;  1FBS A;  2COM A;  1EH7 A;  3GXO A;  3F8M A;  4MQV A;  4HLY A;  2W84 A;  5EEH A;  2VE8 A;  2IA2 A;  2ZBK A;  4G6D A;  2H6B A;  3RI4 A;  2UXX A;  1FYK A;  2GA2 A;  3HUG A;  1YTY A;  4M9S A;  4JK1 X;  3GZ5 A;  1AWC A;  5JHU A;  2QEN A;  1O3T A;  3BPV A;  3FHZ A;  3MFK A;  2VBY A;  3T8T A;  4MQ9 F;  2XAQ A;  1R5G A;  4UNO A;  4I0A A;  4KIF A;  2FOK A;  2XIG A;  4BHP A;  4HV5 A;  2XUB A;  1FBU A;  3MQ0 A;  1Z6R A;  5E20 A;  4MHG A;  2BYV E;  2AS5 F;  3W6K B;  4LB6 B;  3IHU A;  1HXD A;  3FX3 A;  1ZHF A;  5HS9 A;  1FPQ A;  2DLL A;  1KYW A;  2PMU A;  5DYM A;  2FBI A;  3KZY A;  3MEX A;  2LKP A;  2K7L A;  1S8N A;  3E97 A;  2IP2 A;  4A0X A;  5LEJ A;  2P5L C;  2QBY A;  1EH6 A;  1IUY A;  4HZF A;  3O6B B;  2K4J A;  2UWM A;  3R61 A;  1KU3 A;  1KQ0 A;  5BMZ A;  4L0Y B;  4YG2 F;  5ILU A;  2QYO A;  3SZT A;  3E6C C;  2PN6 A;  4KIG A;  5JI6 A;  1TW2 A;  1W5S A;  5DUK A;  4HQE A;  4KFC A;  3GO5 A;  3TO7 A;  4XBF A;  3KP4 A;  2KIF A;  2BGC A;  1IW7 F;  4ZZD A;  3IKT A;  4A2U A;  1W5T A;  3OV8 A;  1G3W A;  2QWW A;  1SFX A;  2H6C A;  1FYM A;  1YG2 A;  4LB5 A;  1O7F A;  3WOD F;  2PJP A;  3GWZ A;  1LEA A;  2ZO4 A;  4M71 A;  1U3E M;  3JW4 A;  4OIQ F;  3GUD A;  3I58 A;  1CF7 B;  5FLX Z;  2HYG D;  4A6D A;  1BI2 A;  3FMR A;  3NEU A;  4EM2 A;  2W85 A;  3SFZ A;  4S04 A;  2H94 A;  2NYX A;  1YW9 A;  3E5Q A;  5AIP A;  3HRS A;  2EWN A;  2NS0 A;  1I27 A;  3DPL C;  4HDV A;  3TDZ C;  2GIV A;  5D6F A;  2M8E A;  3I64 A;  1PUE E;  3ECO A;  2O3F A;  3K0L A;  2OQR A;  3DQV C;  3DXJ F;  2Z3Y A;  3L7W A;  2VC0 A;  3IRQ A;  4XSX F;  2FBK A;  4WXD A;  2XRO A;  3QP6 A;  2H09 A;  1YW7 A;  1ZRE A;  2FU4 A;  1BBY A;  1ZAR A;  5K5Q A;  4O5V A;  1XDU A;  3F6V A;  1RI7 A;  1RZ4 A;  3RIR A;  4RS8 A;  4IHT A;  4U7B A;  2AXL A;  2OU2 A;  3DKW A;  4I02 A;  2MBF A;  3FMQ A;  1MJA A;  1Z1D A;  1T6S A;  4RGU A;  1RUN A;  1D3Y A;  3G73 A;  1YYV A;  2QQ9 A;  3GFJ A;  3RTR A;  2OZU A;  4U7D A;  1U6G A;  1XCB A;  2V1U A;  3BOQ A;  4Q5S F;  2IJL A;  1BN5 A;  3SHF A;  2CQK A;  4EJU A;  3HHG A;  3QPH A;  4QWQ A;  1A04 A;  1IAW A;  2P7V B;  1F9N A;  1ZGJ A;  2L4A A;  1W7P B;  1R00 A;  2CYY A;  3DEU A;  3WG9 A;  3WTX C;  2A6H F;  2ZNY A;  2VOD A;  1FY7 A;  2MH2 A;  1L3L A;  4EJV A;  5FD6 A;  1BI0 A;  5JR3 A;  1CF7 A;  2LSO A;  2FNA A;  4QLC U;  3J80 Z;  2FE3 A;  2CSO A;  5FFX A;  4OOI A;  4XLN F;  2IVM A;  1R1U A;  4U0W A;  4YFN F;  3BP8 A;  2HTS A;  2A5Y B;  4IRH A;  4G94 A;  3K2Z A;  2RDP A;  4ZYG A;  4N9H A;  4G7O F;  3R4K A;  3DPT A;  4I0B A;  4A5N A;  3TDU C;  4KUM A;  5BPD A;  5ERI A;  3GLX A;  4R1H A;  3WTU C;  3LA3 A;  2Y75 A;  5K5O A;  4CZZ A;  2P8T A;  2XKO A;  4TV7 A;  3V7S A;  2A07 F;  5FLX K;  3VEP A;  2YR2 A;  4EGZ A;  2C6Y A;  1QNT A;  2GWR A;  1KQ8 A;  4RGS A;  1W7P D;  1ULY A;  3MCZ A;  2LF7 A;  3WE2 A;  2HTJ A;  1FLI A;  3QAH A;  3EYI A;  1UHW A;  5K5R A;  1OR7 A;  3B73 A;  1ZRF A;  3BY6 A;  5LHH A;  3L00 A;  5DV5 A;  5BOX A;  3LQQ A;  3G3Z A;  4UVC A;  1ZAO A;  4U0Y A;  5BPI A;  1YO5 C;  3K1P A;  1LB2 A;  3MZY A;  3AAF A;  2CGP A;  2JZY A;  2WC2 A;  4NQW A;  3RDI A;  5L3F A;  4G7Z F;  4EQQ A;  3HSE A;  4HBL A;  3TOA A;  4ESF A;  1J59 A;  1IN8 A;  2QQB A;  4UV9 A;  1GXQ A;  1FX7 A;  4IPA A;  3F8B A;  2FF4 A;  2HS5 A;  2CW0 F;  4IRI A;  2OAZ A;  2W57 A;  2M87 A;  2D1H A;  3KP3 A;  1KU9 A;  3RPU A;  4WWC A;  3E5U A;  1HSJ A;  4I2O A;  1SD5 A;  2BBY A;  2VON A;  1U78 A;  1SD7 A;  4L5J A;  3KEO A;  4S05 A;  2F5C A;  5J8F A;  1DUX C;  3LQR A;  4LK1 F;  4UHT A;  4F7Z A;  1W7P A;  5CVR A;  4A6E A;  4B09 A;  5FD5 A;  1J5Y A;  4YII A;  1LVA A;  4XLP F;  1XGM A;  4Z2Y A;  4OMY A;  1F5T A;  3T5X A;  3IKV A;  4RB0 A;  5HLG A;  2ZKZ A;  2M5W A;  3LFK A;  5CVI A;  3KEQ A;  2RKH A;  2XVC A;  4BXU A;  3L2C A;  3LAP A;  3H92 A;  1J75 A;  1QGP A;  1ZYR F;  1ONV A;  4I7H A;  4M9Z A;  1OMI A;  4K2E A;  1UCR A;  4ON0 A;  1ON2 A;  2YSR A;  1STZ A;  4M73 A;  3H3Z A;  4EJW A;  2DU9 A;  4PCQ A;  2YPR A;  3ZN0 A;  1KYZ A;  1U2W A;  1O3Q A;  1J7K A;  2L3D A;  5ICE A;  4HYE A;  5D8K B;  4HQM A;  3D0S A;  5J6X A;  4Y15 A;  1IN4 A;  3TGN A;  1F1Z A;  4UXN A;  4BAY A;  3J80 K;  4EJT A;  2L54 A;  3BPX A;  3QOP A;  3SZP A;  1YIO A;  1T2K A;  2M45 A;  2PI0 A;  2CG4 A;  1S6L A;  2RN7 A;  3CUQ B;  3GYH X;  5DDG A;  2V1D A;  1XSD A;  3C1D A;  3GF2 A;  3HSF A;  3E5X A;  5DEQ A;  1IXS B;  2FEZ A;  2IPQ X;  4RGX A;  2ZFW A;  3CJN A;  1MZB A;  1ZH5 A;  2JRT A;  1J9I A;  5BQT A;  1YW8 A;  1I6X A;  4FT8 A;  3IWZ A;  2D2W A;  3F72 A;  5H6Q A;  2VN2 A;  5HDN A;  2J5P A;  3ZMV A;  5F1R A;  2JT1 A;  4IHS A;  2V9V A;  3ML6 A;  2DPU A;  4LLL A;  4IXA A;  3CO7 C;  2PQ8 A;  5ICF A;  1SD6 A;  1KU2 A;  1SMY F;  1SAX A;  2VBX A;  2P6T A;  5LRR A;  5D5X B;  2FNP A;  4WXC A;  1KA8 A;  1TTY A;  4G9Y A;  3U2R A;  2QLZ A;  4EVI A;  2R7F A;  1KU7 A;  3JTH A;  3J7A O;  1D8J A;  4OIP F;  3J81 K;  2K86 A;  1ZG5 A;  2X4H A;  3ZMD A;  1MGT A;  3JAM Z;  3B02 A;  1UST A;  4KN7 X;  4LLN A;  2A68 F;  3WTY C;  3C3W A;  2XAG A;  5E8G A;  4L5I A;  1WRJ A;  3N97 A;  2J5O A;  2UXN A;  3WGI A;  5CVJ A;  1I1G A;  4L18 B;  2PLY A;  4KIB A;  3RKW A;  3MZH A;  3R0A A;  1V4R A;  1P92 A;  2MA3 A;  2IW5 A;  5D8L B;  3FMS A;  2O8X A;  4LFU A;  4MNU A;  1J0R A;  3LA7 A;  1U5T B;  1MDM B;  1C0W A;  1B59 A;  1FC3 A;  2XRN A;  1BJA A;  3HRT A;  1T98 A;  3RYR A;  5EEG A;  4PGG A;  1B6A A;  1P4W A;  3BRO A;  4KMF A;  3WTT C;  1ZG3 A;  1U5T C;  1YFH A;  4BNC A;  3QRF F;  5D5W B;  1BC7 C;  3WE3 A;  5JFR A;  3V8K A;  2G9W A;  3S2W A;  3FM3 A;  2DAO A;  2FSW A;  3F3X A;  5KVR A;  4YFK F;  2ZNZ A;  3ZMU A;  3COA C;  3CUQ A;  3PFI A;  2Z33 A;  3QU3 A;  2EFW A;  1ZG1 A;  2O03 A;  5HOO A;  4ENK A;  3GZ6 A;  2YU3 A;  1H9G A;  1JE8 A;  3WTS C;  3M1E A;  2LDU A;  2EJR A;  4JQF A;  4ASN A;  1P4A A;  5F64 A;  2P5V A;  2MLK A;  3LST A;  1WKM A;  3LAJ A;  3LA2 A;  2NNN A;  2K4B A;  2Q0O A;  3IC7 A;  3N4M A;  4ZYE A;  1XSV A;  2O0Y A;  4L9J A;  3F8C A;  1D8K A;  1ZN2 A;  3BDD A;  2HWV A;  4U88 A;  3JTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...