2O6GE

Crystal structure of irf-3 bound to the interferon-b enhancer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords interferon-b enhancer
publication title An Atomic Model of the Interferon-beta Enhanceosome.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2o6gE01
2O8XA 4YFXF 3CJNA 1B1BA 1YLFA 3SFZA 2WV0A 2UZKA 1P2FA 2M45A 5AONA 1IXSB 5KVRA 2MH9A 3VB2A 2DQRA 2P5VA 1WSUA 1JE8A 1ZAOA 2OZ6A 3KP4A 2A3SA 4U88A 4HQEA 3KEOA 1T0FA 1R5GA 2P5KA 4HW0A 4IF4A 1ZYRF 1RZ4A 3RKWA 3K69A 3MEXA 3F8NA 2XVCA 4RGUA 3GX4X 5FLXZ 4B09A 3QU3A 5HLGA 4PZJA 1YYVA 4AIKA 1FOKA 4CXFA 3Q5FA 1D5VA 1E2XA 2QLZA 4HV5A 2RKHA 2VBWA 3DXJF 4AIHA 1LEAA 3IRQA 3WTTC 2TDXA 4M72A 1XDUA 1PDNC 1ULYA 1JXSA 3EUHA 1GVJA 3REOA 1HBXG 5E1ZB 5CVVA 5ILUA 3GFLA 2VE8A 5F64A 3CTAA 1Z6RA 1WI9A 3K9TA 2GZWA 3IRRA 3DFGA 4BNCA 1TQIA 5KK1A 3M9AA 3ZPLA 2HGCA 1ZG5A 2IA0A 2HR3A 1U5TB 1BI1A 2PN6A 4KDPA 2HKXA 3KP5A 5DD4A 4ZYDA 1QPMA 2FMLA 3PFIA 2GAUA 3FF5A 3ROUA 1U3EM 3G3ZA 1U6GA 3E6DA 5DCMB 5IT9K 1R22A 4ZYEA 4HF0A 3R6SA 2STWA 1H0MA 2J5OA 1KGSA 2Z33A 2A5YB 4EJVA 2XAHA 4L9VA 4G7OF 4BH9A 1PP8F 4O6JA 1BOAA 2CYYA 4P9FA 2ZFWA 1ZRCA 4XSXF 4BHPA 1IN8A 2NYXA 3WTWC 4NB5A 2M1BA 4ON0A 1D8KA 2XHKA 2R3SA 4KA4A 2HKOA 1TQPA 3VOEA 4O3MA 5JFRA 2IP2A 1FY7A 4LJZF 2MBFA 5CJ9A 2LKPA 2Q2EA 3COAC 1XDSA 4ZYGA 3WGIA 4WF2A 2IPQX 2ESHA 5L3DA 2Q8KA 1VTNC 1ZLJA 2V1DA 4G6DA 4WX9A 3RKYA 3WODF 2FXAA 3U1DA 1YQAA 4N9IA 2OBPA 5LLQA 4BHCA 2JRTA 3GFIA 2M8EA 1QO0D 1CF7A 5H6RA 2XKPA 2XAGA 3U2RA 2X0LA 4WWCA 1OYIA 3M8FA 3Q9SA 2UXXA 1RUNA 2BE5F 4BYYA 3ULQB 3K1MA 1MDMB 3KP6A 3I4PA 4A12A 5D5UB 3J80K 1HXDA 3ELKA 4ENNA 4D0PA 4IVNA 4UV9A 2RQPA 4L9JA 3BJOA 3TGNA 2ZJ2A 4KMUX 4I01A 1W7PD 4R79A 5K5OA 1J9IA 3TO7A 5E18F 3T0YA 2HOEA 1HKQA 4HX8A 2L4MA 3T8TA 3N97A 1IN6A 2DK8A 1XGNA 5E1XA 2Z3YA 1PUEE 3I64A 2IVMA 1IN4A 2EA4A 1KYZA 4HDVA 5HOOA 5LEJA 2YX4A 3Q9VA 2FBIA 2VOPA 2F5FA 5HS7A 2P7CB 1XD7A 4ESBA 2COMA 1HQCA 1J75A 4ENJA 1XSVA 2PG4A 5L3GA 5E8GA 5LHGA 2JZYA 4Q48A 1DP7P 3HRTA 1T38A 2H6CA 1RI7A 1U2WA 3WU1B 4I7HA 3U9GA 3HRMA 1K79A 2W84A 1W5SA 3HRUA 4PCQA 5IT9Z 1R36A 3B02A 1K78A 1BM9A 1USTA 1IAWA 3BPVA 3IKVA 5A2QZ 2IA2A 3WTSC 5ICFA 4HF1A 2FEZA 4CHUA 1KU3A 1F5TA 4RAYA 3ERED 4A5NA 2DFIA 5D5WB 3CLOA 3E6BA 2QQBA 3F23A 1FX7A 3LA7A 3JTGA 1SFEA 4WK8F 4RB2C 2XV4S 2VBZA 3V4GA 2NNYA 3LAPA 1O3QA 1FC3A 5H6QA 5FD6A 4L0YB 5EEGA 2IRFG 2MLKA 4M6YA 4OINF 3HIFA 2FQ3A 4U7DA 1OMIA 5K5RA 4OMYA 5L3BA 3L00A 2DO7A 4IJAA 1HSTA 1SAXA 3SZTA 3TQNA 1I6XA 3IWZA 2JPCA 2VC0A 2M30A 2QBYA 1QZZA 5ICCA 1XGMA 3DQVC 1TW3A 4OOIA 5JI6A 4RGXA 2D2WA 1DDNA 2ZBKA 3ZN1A 3K1PA 4ESJA 1QQIA 3F6VA 3F8CA 4U0WA 1B59A 1KQ8A 1R1UA 2G7HA 2DLLA 5CLSA 3F22A 3IC7A 2HEOA 3QP5A 1J5YA 2JTVA 3RJPA 2VN2A 5ICGA 2Z9OA 2EWNA 3E5XA 1ZGAA 3LWFA 3FMQA 5J8CA 4O5VA 2ACJA 1ZH5A 2A07F 3TDUC 1KU7A 1MGTA 4E70A 5CVIA 1WWXA 5EEHA 3RDIA 1C0WA 2KJBA 2FBHA 2QM3A 3C1DA 4L9NA 1W7PA 1J59A 1ZRDA 2EK5A 3KFWX 3MCZA 1LVAA 2A69F 2MA3A 3LFKA 2K02A 5BPDA 4UHTA 4Q4ZF 1FZPB 3FMRA 4KUMA 5D5XB 2M5WA 3PQJA 2DK5A 1R7JA 2JSCA 2HTJA 2O61A 4ESFA 3BP8A 4MHGA 1G3TA 1SMTA 3WGGA 5DCFA 1ON1A 2V1XA 5ED4A 2XAFA 3C3WA 4AD9A 2MD5A 4L0ZB 3GW2A 1O57A 2RC4A 3FM3A 1UHWA 3FZVA 4LLGF 4FX0A 4U0YA 1DPUA 3E6MA 5D6FA 1Z6TA 4ASNA 1B9NA 2HYFA 1FT9A 3ML6A 3E5UA 1HW5A 3J81Z 5IT3A 2GWRA 1FBUA 1REPC 5DD8A 3DF8A 4M6XA 4IXAA 1P92A 1QGPA 3FX3A 5HDNA 2J5PA 2IA1A 2Z99A 1KQ0A 3BY6A 1FSHA 1S29A 2DI3A 5H20A 1KQ9A 4HX4A 2HFHA 1G3SA 1U8RA 2HZTA 3OV8A 1ONVA 2LNBA 4MQ9F 1J0RA 2E7WA 1JGSA 4WCGA 2LDUA 1B6AA 2EFWA 4YIIA 4MNUA 1P4WA 1HKSA 1XSXA 1GHCA 4ENMA 2VE9A 4G8XA 4XBFA 5LEKA 2ZO4A 4BAYA 1Z7UA 1ZG1A 4UNOA 1BI3A 3ZMUA 5TRDA 1EH8A 3N4MA 3JSOA 2IT0A 1G4DA 4CDGA 1Z91A 3TO9A 2RN7A 4TV7A 3R4KA 5FB2A 3FXUA 4G7ZF 5HS9A 3W6JB 2EJRA 3GWZA 3P9KA 1BJAA 5HVQC 2OQGA 3ABTA 1V4RA 3QU6A 2K4BA 2IW5A 4LK0F 1LDDA 4KIBA 4ZH4F 1ZHFA 1OYYA 4LK1F 2ADUA 4OIRF 4GYGA 2H09A 1T98A 1IW7F 2HS5A 3DP7A 2NNNA 2HQNA 3HSFA 3DV8A 1G3WA 2E7XA 4Q5SF 4A0ZA 3BROA 2D1HA 4RB0A 4UUVA 4EQQA 1ZARA 3RI4A 2LF8A 3FXRA 3MQ0A 4EM2A 3FMSA 3TKYA 1IUYA 4WXHA 2YSRA 5TJJA 2AXLA 3V8KA 1CGPA 1KU9A 1TLHB 1XGOA 3JAMK 2H94A 1FLIA 3ZP5A 1FP2A 3HTUA 5E8IA 3KCCA 4AVPA 3WG9A 1CF7B 2FRHA 1BN5A 4LLNA 1W4MA 1G3YA 2ZMEB 2G7UA 4AIJA 2V6CA 5DV5A 5DEQA 2RDPA 3KZYA 4HLXA 2GA2A 2JT1A 1YIOA 4XLPF 5F6FA 3DPLC 5DUIA 1O3TA 3EDPA 3V8JA 5D8KB 2OAZA 1SD4A 3DPTA 4KT5C 3HRSA 1LEBA 2A61A 3QPTA 4EM1A 3I58A 2QYOA 2VBYA 5CYVA 5FFZA 4M74A 4LLLA 4HAMA 2ZCWA 4I0AA 5FGMA 2Y75A 2ISZA 4DNCA 2CG4A 2FU4A 4CO8A 4F7ZA 4G94A 1UB9A 2O6GE 4LG0A 3S2WA 4OMZA 4RAZA 1QZYA 2ZKZA 3DEUA 1JHFA 5CVJA 4RGRA 4LB5A 4YFNF 4KIFA 2XROA 3H3ZA 2F5CA 2HQRA 1BI2A 2PBIA 3RKXA 4N9HA 2CW0F 2RVCA 4UVCA 3SXYA 3EETA 1KU2A 1UCRA 3M1EA 2PI0A 1K78B 3B73A 4ENKA 2RNJA 2ZNZA 2R7DA 2KKOA 3NQOA 3HYIA 5AIPA 2EV6A 4RGSA 2EFNA 2FSWA 3KP3A 3E6CC 4EGYA 4R1HA 3ZMSA 1WQ2A 3J7AO 2FNAA 5E1WA 3QP6A 4KIGA 1FSEA 1XMAA 1ZG3A 1YW9A 1J2XA 2XIGA 3R60A 2HWVA 1I1SA 1U78A 1EH7A 1R23A 4P9UA 4CICA 3V7SA 5D6EA 5BS6A 2BBYA 3RYRA 2GXGA 3P9IA 2V9VA 3F6OA 4L5IA 4M73A 1YO5C 2VXZA 4UXNA 4MTDA 1Z1DA 3BPXA 1LDKB 4G7HF 1IN7A 2JPBA 3CUQA 2LF7A 2OZUA 3L09A 5LHHA 4U7BA 3KZZA 4LGWA 2QBYB 4GGGA 2WC2A 4Z2YA 2O0YA 1W5TA 2QVOA 2KRFA 1R5HA 3L9FA 3F72A 3GO5A 2F5DA 2QZ8A 5FO5A 3WTVC 3TOAA 1J7KA 3LQQA 4IPAA 4DQ2A 3CO7C 2CQKA 3F8BA 4A2UA 5D5VB 1FNNA 3WE2A 3ECOA 4HA8A 4B8XA 2HTSA 3I59A 1EV7A 1F1ZA 1U5TC 3ZMVA 1HKTA 3K0LA 2FNPA 4G6QA 1O3RA 1IRGA 1Z9CA 3O6BB 5FD5A 3KEQA 2XRNA 4ZZLA 4EJTA 1Q1HA 4XRFA 2XKOA 4CGZA 2VC1A 2RV8A 1RIOH 4FX4A 1OKRA 4EJUA 1LDJA 1W7PB 3QAHA 4U0VA 4BXUA 3J80Z 3GZ5A 3WTUC 1BC8C 1O7FA 2G9WA 3F21A 3C18A 4P5OA 3FM5A 5L3FA 2MLGA 4L18B 3IHUA 2PLYA 2DPUA 3LA3A 4WXDA 3GUDA 1BIBA 2FOKA 3VEPA 2DT5A 3LQRA 2GIVA 1MZBA 1S6LA 4M9SA 2DPDA 1HW2A 4OIPF 1FPQA 3KLNA 3QRFF 1O7LA 3F3XA 3ZMDA 4CYDA 4HQMA 3JSPA 2DBBA 2PJPA 4IHSA 4XLNF 4L9TA 4OIOF 3FWEA 3W6KB 3M7GA 2BYVE 1YTYA 4BQAA 3GYHX 3ZMZA 4HYEA 3I0TA 4IRGA 1XCBA 4YIFA 1YW8A 5HLIA 3MZYA 2P4WA 1I1GA 1XN7A 3TDZC 1R58A 3T5XA 4UV8A 4A0XA 4MTEA 2STTA 3BJAA 3I53A 4XSZF 2BEOA 4MQVA 2HYGD 2DQLA 3HOSA 3WTZA 1R1TA 1AWCA 1XCVA 4KN7X 1FBSA 1FYLA 1Y0UA 1MJ9A 5HS8A 2QWWA 5HDGA 2CSOA 4LB6B 3OOPA 1GXPA 2FA5A 1ZREA 5J8FA 2KJCA 1FYKA 2K4JA 2KIUA 4Y15A 2V79A 1QBJA 1X3UA 4Y13A 4GXOA 3WTXC 3ZN0A 1IRFA 1TNTA 2PMUA 4NQWA 3CUQC 2D1VA 4Q47A 3EYYA 3P7NA 1DPRA 1JHHA 3HHHA 2VODA 1FWZA 3E3VA 3R61A 1A04A 2WWYA 2KIMA 3VFZA 3FHZA 3IWFA 2AS5F 2YPRA 1YS6A 3SHFA 2NRAC 3BDDA 2VONA 1DUXC 4S04A 4P96A 2XGXA 2UWMA 1V3FA 1LQ1A 1IZ1A 1KYWA 3FXQA 1H9GA 2A6HF 1ZN2A 3ZQ7A 1BI0A 1LNWA 1P4AA 4HDUA 3JW4A 4Y17A 4KMFA 3F8FA 1WKMA 1EH6A 2OD5A 3LSTA 3BWGA 3HSRA 1P6RA 5ICEA 5BQTA 2XAJA 3LAJA 4LD5A 5LGTA 4I0BA 3L2CA 4IHTA 2M87A 3E97A 4NHJA 5JR3A 4KN4X 3GXOA 4I2OA 2GXBA 4KICA 1SD7A 2A68F 4HLYA 2IJLA 5K5QA 1ZGJA 1MD0A 4OU0A 4QLCU 2P5LC 4FHTA 5DYMA 4MEXF 1ON2A 4I09A 4HZFA 3V8LA 1LB2A 5ILSA 3LA2A 5ERIA 3MZHA 1IF1A 5E17F 1E17A 3WGHA 1F9NA 1R1VA 2YU3A 3HSEA 1IN5A 3KP7A 2X4HA 4KNYA 2CFXA 4RB3C 2WTEA 5DUKA 1LJ9A 5A2QK 3CO6C 1L3LA 1U5TA 2ISYA 3MAJA 2XAQA 2UXNA 2ETHA 4EJWA 4FT8A 5AIQA 3BJ6A 3GFMA 2FMYA 1I5ZA 4GYIA 1SFUA 2YR2A 5DCMA 4PDKA 1T6SA 2K86A 4LG0B 1BBYA 4BHBA 4HOBA 3NRVA 4PGGA 4G9YA 4L5JA 3O2PE 1YS7A 2EV5A 3IL2A 2R7FA 3V7RA 1Z05A 2MC3A 5L3CA 3SZPA 4RS8A 5LRSA 3ABUA 3H3UA 1S7OA 2L54A 1T39A 5D4SA 2L4AA 5BPIA 1D3YA 2CO5A 2QQAA 4R8HA 3BZ6A 5DDGA 2ZMEA 3TO6A 5HLHA 2E1NA 3RTRA 3K1NA 4GO1A 1FYMA 3JTHA 3RPQA 4EVIA 4A0YA 1USSA 1I27A 3KLOA 4ZYHA 3D0SA 3GFJA 2PFBA 3GLXA 2D45A 2EFQA 3T1BA 4MGRA 1BC7C 2V1UA 2OA4A 4KFCA 3KE2A 1SMYF 4YG2F 2O03A 1HSJA 1FP1D 4S05A 2H27A 3VODA 5L3EA 3C7JA 5CVUA 2K7LA 4GCVA 5K1YA 3TOBA 1BIAA 5D4RA 3PQKA 2RGVA 3GVAA 3IKTA 4JBAA 1MDMA 2GQQA 3CUOA 3CUQB 1F4KA 2NS0A 2VOOA 5LGNA 2Y0MA 4M9ZA 1TBXA 3H92A 2FBKA 3NEUA 3SQNA 2C6YA 2EFPA 2W25A 2PEXA 1MJBA 2B0LA 3P9CA 1AOYA 3DKWA 3QPHA 2OU2A 2BGCA 2P6TA 2Y48A 2FF4A 1XGSA 3GEZA 2XASA 3I59B 3JAMZ 1TTYA 5BOXA 2DU9A 2P7VB 4QWQA 3F8MA 4PGHA 4I02A 4IRHA 6PAXA 4JQFA 1B9MA 2ELHA 2DW4A 2CWEA 1GXQA 2XUBA 2ZXJA 3J81K 3M8EA 1R00A 2DAOA 3GZ6A 1P4XA 1O3SA 3ECHA 1RUOA 4JK1X 3WE3A 1ZRFA 5LGUA 2ESNA 1XSDA 2CGPA 4M71A 1XMKA 1IXCA 4EJOA 3RIRA 2MH2A 2BV6A 4HX7A 2EFOA 2LSOA 2QQ9A 2W85A 1B4AA 1IXRC 4K2EA 2ZNYA 2VT3A 3RPUA 5F1RA 2EB7A 4A6EA 3HHGA 2P8TA 4M9XA 4HBLA 4A5MA 5D8LB 5LBQA 4A6DA 5JVTA 5FLXK 1ZLKA 2OQRA 3ZMTA 1MJAA 2FE3A 4LFUA 2W57A 4YFKF 2L02A 2QUFA 3EQLF 3EYIA 2GA1A 3BOQA 2L01A 2Z5UA 3D5LA 3I54A 4AWXB 2H6BA 5FFXA 4EM0B 1TNSA 1T2KA 3HUGA 2PMHA 2YX7A 2VBXA 1MKMA 1UHMA 3I5UA 3G73A 2K27A 1HW1A 1ODDA 3WTYC 1K7AA 1QNTA 2P6SA 2QENA 1L0OC 2A6EF 2HDCA 5CVRA 1G6NA 1TQMA 2F2EA 3MWMA 4UVBA 3V7CA 3GF2A 3HOTA 5E20A 4EGZA 1KA8A 1XB4A 3CDHA 1SD5A 1SFXA 1STZA 2L3DA 3KP2A 2O3FA 1D8JA 3R0AA 1YW7A 3QOPA 4ZZDA 2W24A 4KYWA 2F5EA 4EV0A 3MFKA 4HV6A 1S7AA 1SD6A 4ETSA 3RYPA 5J6XA 3O3KA 4I98B 1OR7A 4N0BA 4RB1A 1K6OA 4P55A 5ILVA 3L7WA 1NHAA 4UVAA 3K2ZA 2VT2A 3WU0A 4MEYF 1S3JA 4CZZA 4WXCA 4IRIA 2EV0A 1H9TA 1YFHA 1OYWA 5LHIA 2DTRA 4OIQF 5LRRA 2KIFA 3ISPA 1UFMA 1RNLA 3HTSB 5JHUA 1FBQA 1TW2A 2Q0OA 3E5QA 1WRJA 3T8RA 1YG2A 3AAFA 5BMZA 4EMSA 5HDKA 1OPCA 3KETA 4H0EA 3R0JA 2E1CA 1S8NA 2PQ8A 4LMYA 2EA2A 1PP7U 3I71A 2NAZA 4HF2A
chains in the Genus database with same CATH superfamily
2O8XA 3HC7A 4YFXF 3ZOBA 2MABA 4XMYA 2JMWA 3DBLB 2JSPA 3LSHA 3CJNA 2ZFUA 4RA2A 1B1BA 3IH2A 1YLFA 3VYUB 3SFZA 4CCKA 2Z16A 2V9KA 2WV0A 1LFPA 2M0MA 2NOGA 3HL2A 2UZKA 3TEDA 1P2FA 1LPQA 5F0FA 2DMTA 2M45A 3H5AA 5AONA 1PUFA 1IXSB 5KVRA 1TWFJ 2MH9A 2X6WA 5GAHJ 3VB2A 3CF2A 3BR5A 2DQRA 2P5VA 1WSUA 1JE8A 2BXYA 1ZAOA 3DEWA 1A6QA 4ITVA 5HLTA 2OZ6A 3KP4A 1MBGA 2A3SA 3JRIA 2R7RA 3BG3A 3CMEI 3BG9A 4U88A 1JUMA 3SDBA 2K9LA 1BW6A 4HQEA 2ME6A 2VPLA 3KEOA 1T0FA 1R5GA 2P5KA 4HW0A 4IF4A 1ZYRF 1RZ4A 1WJ5A 3RKWA 3K69A 4C2TA 1WJDA 4UY8I 4AYBN 3MEXA 1YJWI 2AQFA 3F8NA 5FROA 2JWTA 2L0KA 2XVCA 4RGUA 1VZ0A 3SDGA 3GX4X 2QA4I 3ABKH 1VQ8I 1W0TA 2Y9YA 5FLXZ 3DKXA 1B8IB 4B09A 3QU3A 5HLGA 4AIDA 4PZJA 1YYVA 3CMMA 4AIKA 3CDLA 1FOKA 4CXFA 2VJ5A 3ERMA 1B72B 1GLNA 3Q5FA 1D5VA 4MO7A 3HG9A 1E2XA 3HKZN 2QLZA 3HBLA 4HV5A 2RKHA 2VBWA 4CCOA 4XR6A 4MIMA 1ZELA 4LIVA 3DLLF 3K2AA 3DXJF 1NH3A 4AIHA 1LEAA 3IRQA 3WTTC 2TDXA 4M72A 2JA6J 1IUFA 1XDUA 1X58A 3V42A 2LH9A 1PDNC 4PFPA 1ULYA 2BY2A 1JXSA 3EUHA 1GVJA 3JREA 4XL9A 3REOA 1HBXG 1JGGA 1R4MB 5E1ZB 2JA2A 4F93B 5EDNA 2TRTA 3TL4X 5CVVA 2IGOA 1PYVA 2E60A 5ILUA 3GFLA 2VE8A 5M5XJ 5F64A 3CTAA 2NOJB 1Z6RA 1OCOH 1WI9A 2VKVA 3K9TA 3K4NA 1YRNA 3I4MJ 3HOZJ 2DJNA 2EH3A 3GTOJ 2GZWA 3IRRA 2KRHA 3DFGA 4BNCA 1TQIA 2ZJRF 1SFOJ 2JQ7A 5KK1A 3M9AA 4ZDPA 3ZPLA 2HGCA 1ZG5A 2IA0A 2HR3A 1U5TB 1X1BA 3S2DJ 1BI1A 4M3FA 2PN6A 4KDPA 2HKXA 3VYTB 3KP5A 1YJNI 2XGDA 5DD4A 3LSMA 2NVYJ 1Z7LA 3S32A 3HDDA 5M5YJ 4ZYDA 1YX3A 1QPMA 4BE1A 2FMLA 3PFIA 4XLFA 2GAUA 3FXJA 3OYIA 3FF5A 3ROUA 1U3EM 2V6EA 3G3ZA 3VWBA 2CS3A 4D7MA 3Q0UA 1U6GA 2QEXI 3E6DA 5DCMB 3MVPA 3G1LA 5IT9K 1R22A 4ZYEA 4HF0A 4IQJA 3R6SA 2STWA 1H0MA 2J5OA 1KGSA 2QCOA 4JP0A 2Z33A 2A5YB 5IOYA 3HOYJ 4EJVA 3OSFA 2W7NA 2XAHA 4L9VA 4G7OF 2DFHA 4BH9A 1OCZH 1PP8F 4O6JA 1BOAA 2CYYA 2W1OA 4P9FA 2ZFWA 1ZRCA 4XSXF 4BHPA 2V1NA 2KL4A 2MW8A 1IN8A 1OR7C 2R4GA 2NYXA 3WTWC 2XPVA 4NB5A 2M1BA 2LKSA 4ON0A 1D8KA 2XHKA 2R3SA 4KA4A 2HKOA 1TQPA 1UG0A 4M3DA 3VOEA 4DZPA 4O3MA 5JFRA 2IP2A 1FY7A 1K83J 4LJZF 3UNGC 2M9HA 2MBFA 3ZQIA 1T56A 4XKWA 5CJ9A 3VDXA 4HPQA 2Y30A 2KFDA 4IL6C 3RPUD 2LKPA 2Q2EA 2OTLI 3TP3A 3COAC 1IV6A 1XDSA 4ZYGA 4ABZA 4X6AJ 1MMGA 5HODA 3WGIA 3PNYA 4WF2A 5KNLA 2IPQX 2ESHA 4D7NA 4PJNA 4AM3A 5L3DA 2Q8KA 1VTNC 1ZLJA 2V1DA 1VQOI 5GPCA 3PUBA 4G6DA 4WX9A 3RKYA 2BHYA 3WODF 2FXAA 3U1DA 1YQAA 4PJJA 3M3YJ 2X6XA 4N9IA 1YX5A 2H8WA 3M1CA 4XLAA 1OISA 2DA3A 1ETQA 2OBPA 1JKQC 4Y52J 5EF6A 5DS9A 5LLQA 5DM6F 4BHCA 4V2FA 2JRTA 3GFIA 4A3EJ 5FKOA 2M8EA 2QKLB 5IYDJ 1QO0D 3FXMA 5H6RA 1CF7A 2XKPA 2XAGA 1X3WB 3U1KA 2B63J 3U2RA 2R92J 3AL0B 2ELJA 2X0LA 4WWCA 3K4KA 1UHSA 1OYIA 2X9DA 1ETXA 5K7FA 3M8FA 3Q9SA 2UXXA 3SEZA 2L5QA 1RUNA 2WAQN 3U21A 2BE5F 3RKQA 4BYYA 1SFKA 4PFOA 3ULQB 4BE2A 3K1MA 4HEA2 4FQGA 1MDMB 3BR6A 1PVEA 2I8DA 3CC4I 3KP6A 3OR2C 3NWSA 4ZJZA 5J4YA 3I4PA 4A12A 2JUGA 5D5UB 1QA6A 2UUZA 3J80K 2OC6A 1HXDA 2F48A 3ELKA 5KCMA 4ENNA 4D0PA 4BQNA 4IVNA 4Y7NJ 3OYNA 4UV9A 1BR1A 3S2HJ 3PUFA 2E36A 4QPQA 2RQPA 4L9JA 3BJOA 3TGNA 2ZJ2A 4KMUX 4I01A 3TMOA 1W7PD 4R79A 5K5OA 2R7WA 2L9VA 1J9IA 3TO7A 2ECCA 2Z2SB 5E18F 3PO2J 1A36A 3T0YA 2HOEA 1HKQA 2TCTA 4HX8A 2L4MA 3T8TA 3AG2H 4UUSB 4XN3A 3WHBA 4DGWB 3N97A 1IN6A 2DK8A 3OYHA 1XGNA 5E1XA 1WH5A 2Z3YA 2ID6A 1PUEE 1G59A 3I64A 1POGA 1ETVA 2DA1A 2IVMA 1IN4A 2EA4A 2OUMA 1KYZA 4HDVA 4KJZA 1R5ID 3D5RC 2WADA 5HOOA 5LEJA 2YX4A 3BCAA 2FBIA 3Q9VA 2VOPA 3FIWA 2F5FA 2R5ZA 1LE8A 5HS7A 2P7CB 4UUTA 2AXTC 2DYSH 2E1MC 1XD7A 1GT0C 4ESBA 1X4OA 2COMA 3QODA 4NC8A 4F55A 1HQCA 5HNHA 1J75A 4ENJA 1XSVA 2LOOA 2BW3B 3OSGA 1ETOA 2PG4A 3KYLA 2M7AA 5L3GA 5E8GA 5LHGA 2JZYA 4Q48A 2NXNB 1DP7P 3LSIA 3HRTA 1T38A 2H6CA 1XS9A 1RI7A 4DBRA 1U2WA 3OYDA 2O8KA 3WU1B 4I7HA 3U9GA 5BNGA 3HRMA 2HPIA 1K79A 4RM2A 3BC8A 2W84A 4ZDOA 1W5SA 3HRUA 4F52A 4PCQA 2OF7A 5F0HA 5IT9Z 3GTPJ 1ENHA 1R36A 2X6YA 3B02A 3EPZA 4BJ6C 1BM9A 4C3IJ 1K78A 2K40A 9ANTA 3AFHA 1USTA 1IAWA 3BPVA 3IKVA 5A2QZ 2IA2A 3MN2A 3WTSC 1K6YA 5ICFA 1J09A 2IS1A 4HF1A 3F9KA 2FEZA 1RPWA 4CHUA 4N4OB 1FOXA 2VPRA 3OS1A 1KU3A 4YRVA 1F5TA 3FKJA 4RAYA 3W3CA 1ORKA 5IP6A 3ERED 2M2EA 4A5NA 2DFIA 1WH7A 5D5WB 3FK7A 3JRAA 3CLOA 3E6BA 3K4JA 2JVGA 1FTZA 1HA8A 1XC5A 3HOXJ 1MNDA 2QQBA 3F23A 3C2BA 1BA5A 1FX7A 3LA7A 4DYCA 3JTGA 1SFEA 4PSWA 4WK8F 2ZC2A 4RB2C 2VASA 2XV4S 1NK3P 2VBZA 2XF6A 2Z1DA 3V4GA 3OIPA 2NNYA 3LAPA 3CC2I 2WY7Q 3HUGB 3H35A 1O3QA 1FC3A 5H6QA 5FD6A 1APLC 4L0YB 1GV5A 5EEGA 1JJ6C 2IRFG 2MLKA 4A3BJ 4M6YA 1RR8C 4OINF 3HIFA 4D1QA 2HXIA 2FQ3A 4U7DA 4XK4A 1GV2A 1OMIA 5K5RA 2WY8Q 2A5WA 2KDOA 4OMYA 2GLOA 5L3BA 3L00A 4IHWA 4AYBA 2E5ZA 2DO7A 4ZTFA 1QHGA 4IJAA 1HSTA 2R7UA 2KZVA 2X85A 2JN6A 3DTIA 4DZJA 1QPIA 2R7SA 2IS4A 1SAXA 2COBA 3SZTA 3TQNA 1I6XA 3IWZA 5EGOA 2JPCA 2VC0A 2M30A 2QBYA 1QZZA 5ICCA 1XGMA 2JA5J 1O4XA 2ICWG 2Y2ZA 3DQVC 1TW3A 4OOIA 3KEYA 1UG2A 5JI6A 4RGXA 2D2WA 3UR3C 1DDNA 2ZBKA 3CZ6A 3L2UA 3ZRGA 4C9YA 3BG7A 1TWHJ 3ZN1A 2DA2A 3HKZA 4ZC3A 1MBHA 3K1PA 1YI2I 3CCEI 4ESJA 1QQIA 2R5YA 4BQQA 3ZQLA 3F6VA 2Q1ZB 3F8CA 5FLMJ 4U0WA 1WZ2A 2XPWA 1LVKA 5C44J 2KRCA 3BCBA 2VQLA 1B59A 1AKHB 1KQ8A 1QU3A 1R1UA 2G7HA 2DLLA 4A3LJ 5CLSA 4BBRJ 3IC7A 4XKVA 3F22A 4NBQA 2HEOA 4GFBA 2F4OB 2M8GX 3QP5A 1J5YA 2JTVA 1T33A 3LMMA 4IQ4A 1HOMA 2L7FP 4RLFA 4XRMA 3QWLA 3MZ8A 3RJPA 3S16J 2VN2A 5ICGA 2AO9A 2Z9OA 2EWNA 3E5XA 1ZGAA 3LWFA 3HXLA 4BBSJ 2FX0A 3FMQA 5J8CA 4O5VA 2ACJA 4DYRA 3LSRA 2HOAA 2DMPA 1ZH5A 1Y1WJ 2A07F 3TDUC 1KU7A 1MGTA 2ME0A 1VQ9I 4E70A 2R7XA 5CVIA 1MNMC 1WWXA 5EEHA 3MKZA 3RDIA 1C0WA 2KJBA 2FBHA 2QM3A 3C1DA 1YOVB 4G6TB 4L9NA 3X2QH 1W7PA 3S3NA 2X6OA 1J59A 1ZRDA 1IJWC 3K4BA 1GDTA 1XMXA 2EK5A 2B9SA 2XAUA 3KFWX 1W0UA 3DLAA 3MCZA 2LMDA 1LVAA 1VQ6I 2CJJA 4A69C 2A69F 2MA3A 3LFKA 3TW7A 2K02A 4XLCA 5BPDA 2E2JJ 4UHTA 4Q4ZF 1FZPB 3FMRA 4KUMA 5D5XB 3PIOF 2M5WA 3PQJA 2DK5A 1R7JA 4FETA 2JSCA 2HTJA 3TW6A 2BOLA 2O61A 2LY9A 4ESFA 2R7QA 3BP8A 4MHGA 1WFXA 1G3TA 1SMTA 3WGGA 5DCFA 4BACA 1ON1A 3K7AJ 2V1XA 1V5GA 2I10A 3OS0A 5ED4A 2XAFA 3C3WA 3GMEA 4AD9A 2MD5A 4II3A 3DWLE 1HCRA 3GW2A 4L0ZB 1XPXA 2E34A 1ZR4A 3CD6I 5GAEJ 1O57A 2RC4A 3IH3A 3FM3A 1UHWA 1RESA 3VYRB 3JR9A 3FZVA 4LLGF 4FX0A 4U0YA 4M3GA 1DPUA 3E6MA 2JUCA 1Z6TA 5D6FA 4ASNA 1B9NA 3G1OA 2HYFA 4PK4A 1FT9A 2H1LA 3GTQJ 3ML6A 3E5UA 4E7KA 1AU7A 1HW5A 3J81Z 1DU6A 1I39A 5IT3A 3A1YA 2GWRA 1FBUA 1REPC 2AHQA 5DD8A 3K6GA 3CF5F 3DF8A 4M6XA 1WCMJ 1P92A 4IXAA 1QGPA 3FX3A 2GBYA 5HDNA 2J5PA 5DM7F 2IA1A 2Z99A 1KQ0A 3BY6A 1FSHA 2QSGX 2QGUA 3LSGA 2CFOA 3Q3SA 1S29A 2DI3A 5H20A 5M5WJ 1KQ9A 4HX4A 5B1BH 2HFHA 3HGGA 1G3SA 2K9SA 5JVGF 2W00A 5LD2C 1U8RA 5GPAA 5LFAA 1X19A 2HZTA 3EUAA 1X2MA 3OV8A 1ONVA 1FJLA 2DMNA 2LNBA 4MQ9F 1J0RA 2E7WA 3BG5A 1IRZA 1JGSA 4D5FA 4WCGA 4XONA 2RREA 4OWRB 2LDUA 5GAGJ 1B6AA 2EFWA 1E3HA 4YIIA 3CESA 1RC9A 2OTJI 4MNUA 4A3GJ 2D5VA 1P4WA 3H36A 1HKSA 2LG4A 1XSXA 1GHCA 4ENMA 3ZGKA 4ZDLA 3PNVA 1WJBA 4KISA 2VE9A 1XTAA 4PUSA 4G8XA 3FK6A 3LOCA 4XBFA 5E3MA 1TZLA 5LEKA 2ZO4A 4BAYA 1Z7UA 2GIZA 1ZG1A 4P1WA 2WAQA 1P7JA 4HNUA 4BS9A 3CCJI 4UNOA 1BI3A 2XB5A 3ZMUA 5TRDA 1EH8A 3CMAI 3N4MA 1MMNA 3CCMI 3S1MJ 3JSOA 2F5VA 2IT0A 3ASOH 5M3FJ 4DIQA 1HF0A 1G4DA 4CDGA 1CQTA 4Y33A 1Z91A 3BT9A 3TO9A 1X2NA 3DBRB 2RN7A 2DODA 1E3PA 4TV7A 2PX9A 2LK2A 3R4KA 4XICA 5FB2A 4XRSG 2FUG2 4RAGA 4XN0A 1T95A 1Y0NA 3SYTA 1MH3A 3FXUA 4OAZA 5HS9A 3W6JB 4G7ZF 2EJRA 3BTIA 2LRDA 3HOVJ 3GWZA 3P9KA 5F1JA 1BJAA 5HVQC 1VFCA 2OQGA 4L5EA 2LBFA 3ABTA 5M3MJ 1V4RA 1JTYA 1MBFA 4F3QA 3QU6A 1LKXA 2K4BA 3HGYA 2IW5A 1I3AA 4LK0F 4IHVA 2IGKA 1LDDA 1ZKGA 4KIBA 4ZH4F 2VKDA 1ZHFA 1OYYA 1A35A 3MKWB 5F0CA 2K9MA 4LK1F 4XQFA 2H1KA 1T08B 2ID3A 4J19A 2GM4A 3ZQQA 3BTCA 1KZHA 4BXFA 2ADUA 4OIRF 3PFYA 1AA7A 4GYGA 4HSTA 3QYEA 2H09A 3LL7A 1T98A 1XG1A 3JRBA 1IW7F 4IZZA 2HS5A 1ITYA 3DP7A 2NNNA 2NVQJ 2HQNA 1MIJA 3HSFA 4HRIA 3CJRB 3DV8A 3L2RA 1G3WA 5J3LA 3CCVI 2BZTA 3OYLA 2IS6A 2E7XA 4UB6C 4Q5SF 2Y9ZA 5F27A 2R7TA 2CW8A 4A0ZA 3BROA 1EA3A 2D1HA 3G4SI 4E7LA 1WVRA 3M8JA 4RB0A 4UUVA 3OYFA 4EQQA 1ZGWA 3A01A 1E0EA 2N8GA 1ZARA 4V19K 3LNQA 2E71A 4JX6A 3IUOA 3HPHA 3RI4A 2LF8A 2Q2EB 4BY1J 3FXRA 1WHUA 1MBKA 3MQ0A 4EM2A 3FMSA 3TKYA 3SJMA 1IUYA 1K4TA 4WXHA 2YSRA 5IOZA 2HYJA 5TJJA 2AXLA 2R7VA 1X1CA 3LSKA 1SC7A 2QSFX 3QOEA 3V8KA 3I4NJ 2EIKH 2PJRA 4CCJA 1X3ZB 1CGPA 1KU9A 3G1MA 1VQ5I 4IHXA 2HNHA 3QYBA 1TLHB 1XGOA 4V2GA 3JAMK 2H94A 1FLIA 4RLQA 3ZP5A 1FP2A 3HTUA 4JYKA 3FBIB 5GTHC 3OYBA 1TP4A 3W6VA 5E8IA 3KCCA 4AVPA 3WG9A 2BHZA 1CF7B 2FRHA 1BN5A 2E19A 3DBHB 1WJCA 4LLNA 1W4MA 1WPKA 1G3YA 2EBIA 2ZMEB 2G7UA 2JRMA 4GDFA 4FCYA 4C2MJ 4IO9F 2W4SA 2V6CA 2KHMA 4CA0A 4AIJA 5DV5A 5DEQA 4DJAA 2RDPA 1FOYA 3KZYA 4FTHA 4HLXA 4B4CA 3JRHA 2GA2A 2WB1N 1K4SA 2JT1A 1YIOA 2LY1A 5F6FA 3DPLC 4XLPF 5DUIA 5EG0A 3MKYB 1O3TA 3EDPA 3V8JA 1MMDA 2OAZA 5D8KB 1SD4A 4M3EA 3DPTA 4MLOA 4KT5C 3HRSA 1LEBA 1S72I 2A61A 3QPTA 4EM1A 3AKZA 4BKXA 3I58A 2IXSA 3NWTA 2QYOA 1Z0XA 2DOAA 2VBYA 3FXOA 5CQEA 5CYVA 4DW6A 5FFZA 4C2UA 4M74A 3GLLA 5TGTA 4LLLA 4HAMA 2ZCWA 4I0AA 5FGMA 1BW5A 2Y75A 1UMQA 4BEHA 2ISZA 2KLOA 2HU9A 4DNCA 2M0CA 2EINH 2DJIA 1WGXA 2X1DA 3A03A 3C2GA 2CQXA 2CG4A 1TT0A 1JJ8C 1D5YA 3IP4B 2FU4A 2OCCH 3G2BA 4CO8A 2F4IA 2G0EA 4F7ZA 4G94A 4XKCA 1IO2A 3WHCA 2QF7A 1UB9A 4BJ5C 2DA5A 1X1PA 4BDYA 2R5ZB 1ETYA 2O6GE 4LG0A 1FIPA 3S2WA 1T8IA 4OMZA 1MMAA 3KYDB 4RAZA 1QZYA 2LR8A 2ZKZA 3DEUA 1I6HJ 1JHFA 5CVJA 1IDYA 1U8BA 5EEAA 4RGRA 4LB5A 4YFNF 4KIFA 2XROA 3H3ZA 3OR1C 1S5LC 2F5CA 2HQRA 2DMQA 3BTLA 1BI2A 5FRMA 5IYBJ 4HNTA 3E0JB 2PBIA 1LFBA 3RKXA 4N9HA 4A3MJ 3AG1H 1QRYA 2CW0F 2ZXIA 2RVCA 5CPRB 3KIOA 4UVCA 1PJRA 5CKTA 2RQQA 3SXYA 3EETA 2R7OA 4A3JJ 3FDYA 2K9NA 1KU2A 1UCRA 2CW7A 3BQZA 3M1EA 2DXIA 2PI0A 1VF9A 3FHNA 1K78B 3B73A 4QTRA 5C3EJ 1H89C 4ENKA 2KP6A 4XLHA 2FOWA 2RNJA 2ZNZA 2R7DA 3S1RJ 3OIOA 2KKOA 3NAUA 3HYIA 3NQOA 5AIPA 1OQYA 2EV6A 2GOMA 4RGSA 1JUPA 3KPHA 2EFNA 2FSWA 2EZKA 3KP3A 3E6CC 4EGYA 4R1HA 2CH0A 2FQ4A 1WQ2A 3ZMSA 3AG4H 2BY3A 3J7AO 2EQRA 2FNAA 2QQ8A 5FKNA 3ZR8X 1Y8QB 2XC7A 4CH7A 5E1WA 4E4HA 3QP6A 4KIGA 1FSEA 2V26A 1XMAA 3VSKA 1ZG3A 1YW9A 1J2XA 4BJTA 2XIGA 3R60A 4AUXA 2HWVA 1I1SA 1U78A 2M4KA 1EH7A 4PJ0C 1R23A 3DKYA 4P9UA 1Z3XA 4CICA 3V7SA 1FMWA 5D6EA 5BS6A 2HZDA 5EZGA 3ZCOA 2BBYA 3RYRA 2CUEA 2P81A 5J40A 2GXGA 2VXDA 3GTLJ 3P9IA 1ZTRA 1ZQ3P 3LFUA 3BTJA 2V9VA 3CP8A 3PL8A 1D0ZA 3F6OA 4L5IA 3ESWB 1D1CA 2ZSHB 2NVUB 4M73A 1YO5C 2VXZA 2F4MB 4UXNA 4NC6A 4MTDA 2PMZA 3OYMA 2E35A 1K61A 2CUFA 1Z1DA 2WAEA 4YEJA 4A3KJ 2V9PA 2VUMJ 3BPXA 1LDKB 4G7HF 3CUQA 1IN7A 2HQ5A 2JPBA 2IGMA 2LF7A 2OZUA 4B48A 3L09A 5LHHA 4U7BA 4E7ZA 3FBNB 3KZZA 4FE4A 1D0XA 5EGOB 1I3QJ 4LGWA 2QBYB 4GGGA 4EEFG 2YU9J 2WC2A 1I50J 4Z2YA 2O0YA 4CZCA 3BZCA 1W5TA 1OLTA 2QVOA 2ZJQF 2KRFA 1R5HA 2KZGA 3CCLI 3L9FA 3F72A 3GO5A 3S8PA 3ONQA 4E7IA 1IDZA 3S3MA 2F5DA 2QZ8A 5FO5A 3WTVC 3TOAA 1J7KA 3LQQA 3H9QA 2R5YB 4NUBA 3BZKA 3M07A 5K7HA 1Z3YA 3DTEA 4IPAA 1IV8A 4A3CJ 4DQ2A 4BY7J 3TBIA 2MG4A 4LITA 3CO7C 5GTIC 2CQKA 3L2VA 3A2KA 4FE7A 3F8BA 4A2UA 3K4LA 5D5VB 1G2HA 1FNNA 3WE2A 3ECOA 4HA8A 4B8XA 3H0DA 2HTSA 4QSHA 3I59A 5JLXA 1EV7A 1IGNA 4Y4RA 1F1ZA 1U5TC 2HXOA 3ZMVA 1HKTA 5KAFC 3K0LA 2FNPA 2UV1A 4G6QA 4II2A 2DTZA 4XNFA 1R4NB 1O3RA 1IRGA 1Z9CA 2BY0A 3EUKL 1DGWY 3OY9A 3O6BB 3OL4A 5FKLA 3OYAA 1WJAA 2DDBA 3ZQHA 5FD5A 4J01A 3KEQA 2XRNA 1W5CC 3A02A 4ZZLA 5B3SH 4EJTA 1P7IA 1Q1HA 4XRFA 2XKOA 1D1AA 4CGZA 2VC1A 2RV8A 3O8HA 4JX5A 4FX4A 1RIOH 1OKRA 4EJUA 3ZQCA 1LDJA 1WI3A 4F92B 1W7PB 3QAHA 4U0VA 5FLVA 2LTPA 4BXUA 1JT6A 2EIMH 1Y39A 1JKOC 1BR4A 3D5SC 2GXAA 5B1AH 3J80Z 2I5UA 3GZ5A 2P0WA 3L2QA 3WTUC 2A05A 1BC8C 3S14J 4XORA 4FASD 3DEEA 2V7FA 1O7FA 2G9WA 3BLYA 3PIPF 2HQAA 2R93J 3F21A 3C18A 4P5OA 5E3LA 2JVHA 2MD0A 2EPFA 3CMYA 3FM5A 2XGEA 5L3FA 1FEXA 2MLGA 4L18B 2VB6A 5E3OA 3IHUA 3B6AA 4XIDA 1R9TJ 2PLYA 1X1DA 2DPUA 3LA3A 2K5CA 3GUDA 4WXDA 2KDZA 2K85A 1BIBA 3K4CA 2DA4A 5IPAA 2FOKA 3VEPA 4X0GA 2DT5A 4Y3OA 3LQRA 2GIVA 1MZBA 1S6LA 4M9SA 2DPDA 2DFEA 1HW2A 2DT6A 2VL8A 4OIPF 1FPQA 3KLNA 3QRFF 1O7LA 3QQAA 3F3XA 3ZMDA 1DU0A 3JRCA 2EIJH 4CYDA 3DU5A 4HQMA 3Q0WA 3JSPA 4LIUA 2DBBA 2PJPA 4IHSA 4XLNF 4L9TA 4OIOF 3JRDA 3FWEA 3W6KB 3M7GA 2BYVE 4IOAF 4Z6YA 1YTYA 4BQAA 3GYHX 1AKHA 2VJJA 3ZMZA 3K4MA 4HYEA 3I0TA 1PUFB 4IRGA 1XCBA 2A6TA 4YIFA 2K3FA 3RQ4A 1YW8A 5HLIA 3MZYA 2P4WA 3I56I 1I1GA 5EJCA 1XN7A 3TDZC 1R58A 2DMUA 3T5XA 2VJIA 4UV8A 1H88C 4A0XA 2CMPA 4MTEA 2STTA 3BJAA 3ABLH 2YUSA 3I53A 2BEOA 4MQVA 2ELKA 4XSZF 2HYGD 2DQLA 3HOSA 3WTZA 3G6EI 2ZSIB 1R1TA 2ZJPF 1UAAA 4IHYA 1AWCA 4HNVA 1XCVA 4KN7X 2R0QC 4XM3A 1FBSA 1FYLA 1Y0UA 1MBEA 1WJFA 1NK2P 1MJ9A 5HS8A 1R49A 1NG7A 3OL3A 1VQLI 2QWWA 5HDGA 4E7JA 4XRSA 2CSOA 1IRXA 3BR0A 4B3AA 4LB6B 2QKMB 2GOXB 5F04A 2OJED 3OYJA 1TWGJ 3OOPA 3K70C 1GXPA 2FA5A 3L2WA 2XB0X 3NARA 2WB1A 4N4NB 4IX7A 4CUGA 3IAS2 3OS2A 2BXZA 1ZREA 5J8FA 2KJCA 1FYKA 2K4JA 2LLKA 2KIUA 4Y15A 2V79A 1QBJA 4I99C 1X3UA 2HVQA 4Y13A 2RAEA 4ANJA 2E1MB 4GXOA 5K7ZA 3H5RA 3WTXC 3ZN0A 1IRFA 1TNTA 1Z67A 2PMUA 2XSDC 3B6CA 4NQWA 3CUQC 4A3DJ 2D1VA 4HSRA 4Q47A 2LBFB 3EYYA 1OJLA 3CJQB 3P7NA 1DPRA 1JHHA 5B66C 4B1RA 5FKKA 3HHHA 4CCMA 2VODA 2W82A 1FWZA 2FD5A 3E3VA 3R61A 1DQUA 1YE9A 1JI8A 4XLEA 4CYCA 3S3OA 1A04A 1YRNB 2WWYA 2KIMA 2CU7A 4KITB 3J7ZI 3VFZA 3FHZA 2H8RA 3IWFA 2AS5F 2YPRA 1YS6A 2XPUA 5KAIC 3SHFA 5J1YA 4YELA 2CUJA 2NRAC 3BDDA 2DDAA 3FXKA 2VONA 1DUXC 1VQ4I 1TWAJ 5J4VA 4S04A 4P96A 2XGXA 2L9SA 1FIAA 3ZQGA 2UWMA 3OYEA 1V3FA 2FJ1A 3CQZJ 1QHHD 2CQ7A 1LQ1A 1IZ1A 1KYWA 3H1CA 3IH4A 3H0GJ 5EYRA 3FXQA 4IKFA 1VQNI 1H9GA 3UKGA 3SZGA 2A6HF 2MFZA 4RAFA 2F6CA 1TWCJ 2IAIA 2XF5A 3HJEA 5GADJ 2Y31A 5JLWA 1BJZA 1ZN2A 2X1EA 3ZQ7A 4AC0A 3A01B 1BI0A 1LNWA 1P4AA 1ETWA 2K3PA 3JW4A 4HDUA 4Y17A 4KMFA 3F8FA 5IY5H 1RKWA 1WKMA 1EH6A 2OD5A 1YHQI 3LSTA 2XRLA 2NS7A 2HVSA 1QZEA 2LP0A 3BWGA 1FMVA 3HSRA 1P6RA 4NDLA 5ICEA 3W2AA 1P9QC 3BR2A 4G12A 5BQTA 4BGDA 2ZXWH 2XAJA 1YJ9I 3LAJA 1HLVA 2PJRB 3PSFA 4LD5A 5LGTA 4I0BA 1VQPI 3L2CA 4IHTA 2M87A 3E97A 5C4JJ 1B8IA 3I3LA 4NHJA 1GUUA 4F91B 1U9OA 5JR3A 4KN4X 3GXOA 4I2OA 4XOPA 2X1CA 3O8GA 2JJ7A 3K70D 3GTMJ 2Y0SN 2GXBA 4KICA 1SD7A 3P5JA 4BE0A 3CCYA 2A68F 3JCUC 1B72A 5H2FC 3A0HC 3ZXSA 1LFUP 4QIWN 4HLYA 1OCCH 1U0JA 3RZDJ 2W48A 2IJLA 4KT6A 4C3JJ 4CCLA 2E2HJ 2CV1A 5K5QA 1ZGJA 4BU2A 1NG6A 1MD0A 3IV5A 3HPGA 1D1BA 4OU0A 4QLCU 2DOFA 2P5LC 3FISA 2VIXA 4FHTA 5DYMA 4MEXF 1S7EA 1JKPC 1ON2A 4I09A 4HZFA 3V8LA 1RRJA 4W1UA 1LB2A 5ILSA 2XDVA 3LA2A 5ERIA 2DYRH 3MZHA 3PJRA 4ZTJA 1IC8A 1SAUA 1IF1A 1RR7A 2RNGA 1MBJA 2O7OA 2XF7A 4E7SA 5E17F 3SEQA 2CQQA 3WGHA 1E17A 5EZHA 5EG0B 3PNTA 4LG3A 1F9NA 1R1VA 2NVXJ 3RQIA 2YU3A 1JUSA 1UZCA 4ZYAA 5IP9J 3HSEA 1IN5A 3CP2A 3KP7A 2O5RA 2X4HA 4KNYA 4BXXJ 1MH4A 2CFXA 2WTEA 5DUKA 4RB3C 2XGCA 5J1UA 1LJ9A 3MMYB 3RZOJ 2KPMA 5A2QK 3CO6C 2HOTA 3F0CA 1L3LA 1U5TA 3CCRI 2ISYA 2NS8A 3JRGA 3HOWJ 2VKHA 4I76A 1IG7A 2VJ4A 3MAJA 1ACIA 2XAQA 2UXNA 1SVLA 4MFEA 2ETHA 4EJWA 1H8AC 3BR3A 4BEHB 4FT8A 5AIQA 3BJ6A 3OYGA 1OCTC 1OCRH 3GFMA 4DYQA 2FMYA 4XOTA 1I5ZA 1X4PA 4GYIA 4E6KG 3TP0A 1SFUA 2YR2A 5DCMA 4PDKA 2O9LA 1T6SA 4OAYA 4AVZA 2K86A 4LG0B 2L9RA 3S1QJ 2IS2A 1BBYA 4BHBA 4HOBA 3NRVA 2LREA 4PGGA 1R71A 1R6RA 4G9YA 4CSWA 5B5EC 2KIQA 2WAFA 2LYCA 4L5JA 2M7BA 3O2PE 1YS7A 3CCUI 1JKRC 2EV5A 3IL2A 1GVDA 1DP3A 2CUZA 3WG7H 1N77A 5JHFA 5DTDA 2R7FA 3V7RA 1Z05A 1X1AA 1V5FA 2MC3A 5L3CA 3SZPA 4RS8A 2L9NA 5LRSA 3ABUA 4QPOA 1Y56A 4NNJA 4D9JA 3H3UA 4FISA 1S7OA 2QSHX 3HEFA 5IYCJ 1SVOA 1TC3C 3S15J 4J00A 2L54A 3S93A 4NC7A 2L4AA 5D4SA 1T39A 5BPIA 1M1EB 1D3YA 2CO5A 2QQAA 4R8HA 3BZ6A 5DDGA 4M3BA 2ZMEA 3TO6A 1MNEA 1LE8B 5HLHA 2E1NA 2IBDA 3RTRA 3K1NA 1VQ7I 4PJMA 4GO1A 3JRFA 1EKEA 4IOCF 1FYMA 1A6IA 3JTHA 3OMYA 1JTXA 3RPQA 4A0YA 4EVIA 5FJ8J 1USSA 1I27A 3KLOA 2JA7J 4ZYHA 1W36C 3D0SA 3GFJA 4B44A 1V55H 2PFBA 3GLXA 2Y69H 2D45A 1QVTA 2EFQA 3T1BA 3D1NI 1AHDP 4MGRA 1KONA 1BOBA 1BC7C 2V1UA 2OA4A 1T0FC 4KFCA 2R7ZJ 2BVLA 3KE2A 1SMYF 4YG2F 2LD5A 2O03A 1MSFC 1E3OC 3A0BC 1HSJA 3K10A 4U87A 1FP1D 3HZJA 4S05A 2H27A 3VODA 5L3EA 3C7JA 3S1NJ 5CVUA 2K7LA 3ASNH 3PSIA 4GCVA 5K1YA 3TOBA 1BIAA 5D4RA 3PQKA 2RGVA 3RCOA 2YS9A 3N05A 3GVAA 3IKTA 4JBAA 5HNFA 4B3XA 2ZB9A 1RKTA 5J47A 1MDMA 2GQQA 3CUOA 3ZQFA 2EZHA 3CUQB 1F4KA 2NS0A 1YIJI 2VOOA 1D0YA 2CQNA 4BUPA 2WBMA 5LGNA 2Y0MA 4M9ZA 3VSLA 1TBXA 4I6ZA 1V5EA 2EILH 3H92A 2EZIA 2FBKA 3NEUA 1HC8A 1VQKI 1G8XA 2E1OA 3SQNA 4BQOA 2X48A 2C6YA 2EFPA 2KT0A 1DGRM 2BVMA 5F08A 2W25A 4PJLA 3RSNA 3CLQA 2DA6A 2PEXA 3EUHC 1MJBA 3I9V2 1ZR2A 2B0LA 3P9CA 2CV0A 1AOYA 3DKWA 3QPHA 2OU2A 2HOSA 1N78A 1A5JA 2BGCA 1F43A 2P6TA 3A4CA 1BR2A 1Z21A 2Y48A 2L7ZA 3OYKA 2EZLA 4RM3A 1Z77A 1XX5A 4UUSA 2FF4A 4H4KC 1XGSA 1ZK8A 3GEZA 2XASA 1V54H 4AU7A 4B47A 1FTTA 3WU2C 1LUJB 3QPSA 3I59B 5E79C 4DOZA 1TTYA 3JAMZ 5BOXA 1HDPA 2DU9A 2P7VB 2M3AA 4W97A 3BR1A 3VYSB 4QWQA 3F8MA 4PGHA 4I02A 4IRHA 6PAXA 1SANA 3DU6A 5J1RA 1MW7A 3S17J 4JQFA 1B9MA 3FKIJ 4JOMA 2MYSA 2MC4A 2VQGA 2VQHA 2ELHA 3J7YJ 2DW4A 2CWEA 1GXQA 2XUBA 2ZXJA 3OIQA 4RMNA 3J81K 3CDIA 5FRNA 1F36A 3M8EA 1MMSA 1R00A 3L1PA 4DBQA 2DAOA 3GZ6A 1MSEC 1W36D 1P4XA 2BW3A 2CV2A 2DFFA 1O3SA 3ECHA 1N25A 1JT0A 1NTCA 3G71I 5GP9A 1RUOA 2OPTA 3SFIA 4JK1X 1EJ9A 2ECBA 3WE3A 1ZRFA 3E1SA 5LGUA 4B43A 3GCMA 4D5CA 1OCPA 2ESNA 1TL8A 1SEUA 2DOEA 1XSDA 2HPMA 2CGPA 2K9QA 1XMKA 4M71A 1IXCA 2HVRA 4EJOA 2M4GA 2MH2A 3RIRA 2L2OA 2BV6A 4RBOA 2WA0A 4HX7A 1WJEA 2E5NA 2EFOA 2LSOA 2QQ9A 2W85A 4CCNA 1B4AA 1IXRC 3QPLA 3ABMH 3HB9A 4K2EA 5FKMA 3MD2A 2ZNYA 2HI3A 2VT3A 3RPUA 5F1RA 2EB7A 4A6EA 3HHGA 4YIRX 2P8TA 4M9XA 4HBLA 4A5MA 3H3VK 5D8LB 5LBQA 4JX4A 4A6DA 3H5NA 5JVTA 3KZIC 5FLXK 4IEJA 1ZLKA 5KHDA 3M4OJ 2OQRA 3W2VA 3ZMTA 1MJAA 4XKBA 2FE3A 4LFUA 1Y6IA 2W57A 4YFKF 2E2IJ 3DPUA 2L02A 2QUFA 3EQLF 3VPRA 4A3FJ 3EYIA 2LFBA 2GA1A 3BOQA 2L01A 2LVSA 2Z5UA 4PSXA 1Y1VJ 2AQEA 1HDDC 3D5LA 3I54A 2DCEA 4AWXB 5IP7J 2H6BA 2M34A 5FFXA 4EM0B 1OFCX 1TNSA 1QVUA 3KYCB 3GBGA 5E3NA 1T2KA 3HUGA 2PMHA 2YX7A 2VKEA 2VBXA 2HDWA 2NVTJ 1MKMA 1UHMA 3I5UA 4RDUA 3KX2A 2K27A 1HW1A 1ODDA 3WTYC 3G73A 1K7AA 1QNTA 3PM1A 2P6SA 2QENA 4M6VA 2JA8J 1L0OC 2A6EF 3I55I 2DA7A 2HDCA 3CCSI 5CVRA 1G6NA 1TQMA 2F2EA 3MWMA 4UVBA 3PO3J 3HOUJ 3V7CA 4S0HB 3GF2A 1S9HA 3GTJJ 2LKXA 4GRIA 2WV1A 3HOTA 5E20A 3C2HA 4E7HA 3GTKJ 4EGZA 3H9JA 2LC2A 1KA8A 1XB4A 3FXLA 1U9NA 2ZMEC 3BG6A 3CDHA 3GZNB 1SD5A 1SFXA 1STZA 3LSJA 2L3DA 3KP2A 2Y0SA 2L7MP 1W1WE 3QYFA 2O3FA 3BQYA 4A3IJ 1D8JA 3R0AA 1YW7A 3OWTA 2L7KA 3QOPA 4ZZDA 2VQCA 3W2WA 2W24A 2IGNA 4KYWA 1Q1VA 2F5EA 3OYCA 4EV0A 3MFKA 1UJ8A 4EATA 4HV6A 2VI6A 1S7AA 1SD6A 4ETSA 3RYPA 5C4XJ 5J6XA 3O3KA 4I98B 1OR7A 2X51A 4N0BA 1FOWA 3MKLA 5TISC 4UB8C 1A31A 4RB1A 2KISA 1K6OA 1VQMI 4P55A 1SVMA 1Y8RB 2MGQA 5ILVA 3L7WA 2DN0A 3CJTB 1NHAA 2BY1A 4UVAA 3K2ZA 2VT2A 3WU0A 3H9GA 4MEYF 3E7LA 1S3JA 4CZZA 4WXCA 4BL0B 3AL0C 4IRIA 4C30A 1RETA 2XSJC 4MFDA 2EV0A 3HM5A 1YFHA 3DCFA 1H9TA 1OYWA 1ERDA 5LHIA 2DTRA 2KMUA 3CC7I 4OIQF 2IEKA 1BL0A 5LRRA 2KIFA 3ISPA 2B7EA 1ETKA 4C3HJ 2JK3A 2VLAA 1UFMA 2KQRA 4HG2A 2CRGA 1RNLA 4NQWB 3HTSB 2HDDA 5JHUA 1FBQA 3LSPA 2ZXHA 2V4JC 1TW2A 2Q0OA 1TT5B 3E5QA 3CCQI 1WRJA 2OV7A 3J7AY 4BDZA 3OOUA 4LOCA 5CQGA 3T8RA 1EF4A 1YG2A 4A93J 3AAFA 5BMZA 1VI0A 4EMSA 5HDKA 1N75A 3GTGJ 1OPCA 2DT7B 3DTKA 3KETA 4H0EA 4CYCB 3R0JA 2E1CA 1UELB 1S8NA 2PQ8A 4LMYA 2OCEA 2MSYA 2PMZN 1YITI 2EA2A 3IAM2 3AG3H 4X1EA 1PP7U 3I71A 2NAZA 4HF2A 3Q0VA 2LY2A 1VNDA
chains in the Genus database with same CATH topology
2O8XA 4YFXF 3CJNA 1B1BA 1YLFA 3SFZA 2WV0A 2UZKA 1P2FA 2M45A 5AONA 1IXSB 5KVRA 2MH9A 3VB2A 2DQRA 2P5VA 1WSUA 1JE8A 1ZAOA 2OZ6A 3KP4A 2A3SA 4U88A 4HQEA 3KEOA 1T0FA 1R5GA 2P5KA 4HW0A 4IF4A 1ZYRF 1RZ4A 3RKWA 3K69A 3MEXA 3F8NA 2XVCA 4RGUA 3GX4X 5FLXZ 4B09A 3QU3A 5HLGA 4PZJA 1YYVA 4AIKA 1FOKA 4CXFA 3Q5FA 1D5VA 1E2XA 2QLZA 4HV5A 2RKHA 2VBWA 3DXJF 4AIHA 1LEAA 3IRQA 3WTTC 2TDXA 4M72A 1XDUA 1PDNC 1ULYA 1JXSA 3EUHA 1GVJA 3REOA 1HBXG 5E1ZB 5CVVA 5ILUA 3GFLA 2VE8A 5F64A 3CTAA 1Z6RA 1WI9A 3K9TA 2GZWA 3IRRA 3DFGA 4BNCA 1TQIA 5KK1A 3M9AA 3ZPLA 2HGCA 1ZG5A 2IA0A 2HR3A 1U5TB 1BI1A 2PN6A 4KDPA 2HKXA 3KP5A 5DD4A 4ZYDA 1QPMA 2FMLA 3PFIA 2GAUA 3FF5A 3ROUA 1U3EM 3G3ZA 1U6GA 3E6DA 5DCMB 5IT9K 1R22A 4ZYEA 4HF0A 3R6SA 2STWA 1H0MA 2J5OA 1KGSA 2Z33A 2A5YB 4EJVA 2XAHA 4L9VA 4G7OF 4BH9A 1PP8F 4O6JA 1BOAA 2CYYA 4P9FA 2ZFWA 1ZRCA 4XSXF 4BHPA 1IN8A 2NYXA 3WTWC 4NB5A 2M1BA 4ON0A 1D8KA 2XHKA 2R3SA 4KA4A 2HKOA 1TQPA 3VOEA 4O3MA 5JFRA 2IP2A 1FY7A 4LJZF 2MBFA 5CJ9A 2LKPA 2Q2EA 3COAC 1XDSA 4ZYGA 3WGIA 4WF2A 2IPQX 2ESHA 5L3DA 2Q8KA 1VTNC 1ZLJA 2V1DA 4G6DA 4WX9A 3RKYA 3WODF 2FXAA 3U1DA 1YQAA 4N9IA 2OBPA 5LLQA 4BHCA 2JRTA 3GFIA 2M8EA 1QO0D 1CF7A 5H6RA 2XKPA 2XAGA 3U2RA 2X0LA 4WWCA 1OYIA 3M8FA 3Q9SA 2UXXA 1RUNA 2BE5F 4BYYA 3ULQB 3K1MA 1MDMB 3KP6A 3I4PA 4A12A 5D5UB 3J80K 1HXDA 3ELKA 4ENNA 4D0PA 4IVNA 4UV9A 2RQPA 4L9JA 3BJOA 3TGNA 2ZJ2A 4KMUX 4I01A 1W7PD 4R79A 5K5OA 1J9IA 3TO7A 5E18F 3T0YA 2HOEA 1HKQA 4HX8A 2L4MA 3T8TA 3N97A 1IN6A 2DK8A 1XGNA 5E1XA 2Z3YA 1PUEE 3I64A 2IVMA 1IN4A 2EA4A 1KYZA 4HDVA 5HOOA 5LEJA 2YX4A 3Q9VA 2FBIA 2VOPA 2F5FA 5HS7A 2P7CB 1XD7A 4ESBA 2COMA 1HQCA 1J75A 4ENJA 1XSVA 2PG4A 5L3GA 5E8GA 5LHGA 2JZYA 4Q48A 1DP7P 3HRTA 1T38A 2H6CA 1RI7A 1U2WA 3WU1B 4I7HA 3U9GA 3HRMA 1K79A 2W84A 1W5SA 3HRUA 4PCQA 5IT9Z 1R36A 3B02A 1K78A 1BM9A 1USTA 1IAWA 3BPVA 3IKVA 5A2QZ 2IA2A 3WTSC 5ICFA 4HF1A 2FEZA 4CHUA 1KU3A 1F5TA 4RAYA 3ERED 4A5NA 2DFIA 5D5WB 3CLOA 3E6BA 2QQBA 3F23A 1FX7A 3LA7A 3JTGA 1SFEA 4WK8F 4RB2C 2XV4S 2VBZA 3V4GA 2NNYA 3LAPA 1O3QA 1FC3A 5H6QA 5FD6A 4L0YB 5EEGA 2IRFG 2MLKA 4M6YA 4OINF 3HIFA 2FQ3A 4U7DA 1OMIA 5K5RA 4OMYA 5L3BA 3L00A 2DO7A 4IJAA 1HSTA 1SAXA 3SZTA 3TQNA 1I6XA 3IWZA 2JPCA 2VC0A 2M30A 2QBYA 1QZZA 5ICCA 1XGMA 3DQVC 1TW3A 4OOIA 5JI6A 4RGXA 2D2WA 1DDNA 2ZBKA 3ZN1A 3K1PA 4ESJA 1QQIA 3F6VA 3F8CA 4U0WA 1B59A 1KQ8A 1R1UA 2G7HA 2DLLA 5CLSA 3F22A 3IC7A 2HEOA 3QP5A 1J5YA 2JTVA 3RJPA 2VN2A 5ICGA 2Z9OA 2EWNA 3E5XA 1ZGAA 3LWFA 3FMQA 5J8CA 4O5VA 2ACJA 1ZH5A 2A07F 3TDUC 1KU7A 1MGTA 4E70A 5CVIA 1WWXA 5EEHA 3RDIA 1C0WA 2KJBA 2FBHA 2QM3A 3C1DA 4L9NA 1W7PA 1J59A 1ZRDA 2EK5A 3KFWX 3MCZA 1LVAA 2A69F 2MA3A 3LFKA 2K02A 5BPDA 4UHTA 4Q4ZF 1FZPB 3FMRA 4KUMA 5D5XB 2M5WA 3PQJA 2DK5A 1R7JA 2JSCA 2HTJA 2O61A 4ESFA 3BP8A 4MHGA 1G3TA 1SMTA 3WGGA 5DCFA 1ON1A 2V1XA 5ED4A 2XAFA 3C3WA 4AD9A 2MD5A 4L0ZB 3GW2A 1O57A 2RC4A 3FM3A 1UHWA 3FZVA 4LLGF 4FX0A 4U0YA 1DPUA 3E6MA 5D6FA 1Z6TA 4ASNA 1B9NA 2HYFA 1FT9A 3ML6A 3E5UA 1HW5A 3J81Z 5IT3A 2GWRA 1FBUA 1REPC 5DD8A 3DF8A 4M6XA 4IXAA 1P92A 1QGPA 3FX3A 5HDNA 2J5PA 2IA1A 2Z99A 1KQ0A 3BY6A 1FSHA 1S29A 2DI3A 5H20A 1KQ9A 4HX4A 2HFHA 1G3SA 1U8RA 2HZTA 3OV8A 1ONVA 2LNBA 4MQ9F 1J0RA 2E7WA 1JGSA 4WCGA 2LDUA 1B6AA 2EFWA 4YIIA 4MNUA 1P4WA 1HKSA 1XSXA 1GHCA 4ENMA 2VE9A 4G8XA 4XBFA 5LEKA 2ZO4A 4BAYA 1Z7UA 1ZG1A 4UNOA 1BI3A 3ZMUA 5TRDA 1EH8A 3N4MA 3JSOA 2IT0A 1G4DA 4CDGA 1Z91A 3TO9A 2RN7A 4TV7A 3R4KA 5FB2A 3FXUA 4G7ZF 5HS9A 3W6JB 2EJRA 3GWZA 3P9KA 1BJAA 5HVQC 2OQGA 3ABTA 1V4RA 3QU6A 2K4BA 2IW5A 4LK0F 1LDDA 4KIBA 4ZH4F 1ZHFA 1OYYA 4LK1F 2ADUA 4OIRF 4GYGA 2H09A 1T98A 1IW7F 2HS5A 3DP7A 2NNNA 2HQNA 3HSFA 3DV8A 1G3WA 2E7XA 4Q5SF 4A0ZA 3BROA 2D1HA 4RB0A 4UUVA 4EQQA 1ZARA 3RI4A 2LF8A 3FXRA 3MQ0A 4EM2A 3FMSA 3TKYA 1IUYA 4WXHA 2YSRA 5TJJA 2AXLA 3V8KA 1CGPA 1KU9A 1TLHB 1XGOA 3JAMK 2H94A 1FLIA 3ZP5A 1FP2A 3HTUA 5E8IA 3KCCA 4AVPA 3WG9A 1CF7B 2FRHA 1BN5A 4LLNA 1W4MA 1G3YA 2ZMEB 2G7UA 4AIJA 2V6CA 5DV5A 5DEQA 2RDPA 3KZYA 4HLXA 2GA2A 2JT1A 1YIOA 4XLPF 5F6FA 3DPLC 5DUIA 1O3TA 3EDPA 3V8JA 5D8KB 2OAZA 1SD4A 3DPTA 4KT5C 3HRSA 1LEBA 2A61A 3QPTA 4EM1A 3I58A 2QYOA 2VBYA 5CYVA 5FFZA 4M74A 4LLLA 4HAMA 2ZCWA 4I0AA 5FGMA 2Y75A 2ISZA 4DNCA 2CG4A 2FU4A 4CO8A 4F7ZA 4G94A 1UB9A 2O6GE 4LG0A 3S2WA 4OMZA 4RAZA 1QZYA 2ZKZA 3DEUA 1JHFA 5CVJA 4RGRA 4LB5A 4YFNF 4KIFA 2XROA 3H3ZA 2F5CA 2HQRA 1BI2A 2PBIA 3RKXA 4N9HA 2CW0F 2RVCA 4UVCA 3SXYA 3EETA 1KU2A 1UCRA 3M1EA 2PI0A 1K78B 3B73A 4ENKA 2RNJA 2ZNZA 2R7DA 2KKOA 3NQOA 3HYIA 5AIPA 2EV6A 4RGSA 2EFNA 2FSWA 3KP3A 3E6CC 4EGYA 4R1HA 3ZMSA 1WQ2A 3J7AO 2FNAA 5E1WA 3QP6A 4KIGA 1FSEA 1XMAA 1ZG3A 1YW9A 1J2XA 2XIGA 3R60A 2HWVA 1I1SA 1U78A 1EH7A 1R23A 4P9UA 4CICA 3V7SA 5D6EA 5BS6A 2BBYA 3RYRA 2GXGA 3P9IA 2V9VA 3F6OA 4L5IA 4M73A 1YO5C 2VXZA 4UXNA 4MTDA 1Z1DA 3BPXA 1LDKB 4G7HF 1IN7A 2JPBA 3CUQA 2LF7A 2OZUA 3L09A 5LHHA 4U7BA 3KZZA 4LGWA 2QBYB 4GGGA 2WC2A 4Z2YA 2O0YA 1W5TA 2QVOA 2KRFA 1R5HA 3L9FA 3F72A 3GO5A 2F5DA 2QZ8A 5FO5A 3WTVC 3TOAA 1J7KA 3LQQA 4IPAA 4DQ2A 3CO7C 2CQKA 3F8BA 4A2UA 5D5VB 1FNNA 3WE2A 3ECOA 4HA8A 4B8XA 2HTSA 3I59A 1EV7A 1F1ZA 1U5TC 3ZMVA 1HKTA 3K0LA 2FNPA 4G6QA 1O3RA 1IRGA 1Z9CA 3O6BB 5FD5A 3KEQA 2XRNA 4ZZLA 4EJTA 1Q1HA 4XRFA 2XKOA 4CGZA 2VC1A 2RV8A 1RIOH 4FX4A 1OKRA 4EJUA 1LDJA 1W7PB 3QAHA 4U0VA 4BXUA 3J80Z 3GZ5A 3WTUC 1BC8C 1O7FA 2G9WA 3F21A 3C18A 4P5OA 3FM5A 5L3FA 2MLGA 4L18B 3IHUA 2PLYA 2DPUA 3LA3A 4WXDA 3GUDA 1BIBA 2FOKA 3VEPA 2DT5A 3LQRA 2GIVA 1MZBA 1S6LA 4M9SA 2DPDA 1HW2A 4OIPF 1FPQA 3KLNA 3QRFF 1O7LA 3F3XA 3ZMDA 4CYDA 4HQMA 3JSPA 2DBBA 2PJPA 4IHSA 4XLNF 4L9TA 4OIOF 3FWEA 3W6KB 3M7GA 2BYVE 1YTYA 4BQAA 3GYHX 3ZMZA 4HYEA 3I0TA 4IRGA 1XCBA 4YIFA 1YW8A 5HLIA 3MZYA 2P4WA 1I1GA 1XN7A 3TDZC 1R58A 3T5XA 4UV8A 4A0XA 4MTEA 2STTA 3BJAA 3I53A 4XSZF 2BEOA 4MQVA 2HYGD 2DQLA 3HOSA 3WTZA 1R1TA 1AWCA 1XCVA 4KN7X 1FBSA 1FYLA 1Y0UA 1MJ9A 5HS8A 2QWWA 5HDGA 2CSOA 4LB6B 3OOPA 1GXPA 2FA5A 1ZREA 5J8FA 2KJCA 1FYKA 2K4JA 2KIUA 4Y15A 2V79A 1QBJA 1X3UA 4Y13A 4GXOA 3WTXC 3ZN0A 1IRFA 1TNTA 2PMUA 4NQWA 3CUQC 2D1VA 4Q47A 3EYYA 3P7NA 1DPRA 1JHHA 3HHHA 2VODA 1FWZA 3E3VA 3R61A 1A04A 2WWYA 2KIMA 3VFZA 3FHZA 3IWFA 2AS5F 2YPRA 1YS6A 3SHFA 2NRAC 3BDDA 2VONA 1DUXC 4S04A 4P96A 2XGXA 2UWMA 1V3FA 1LQ1A 1IZ1A 1KYWA 3FXQA 1H9GA 2A6HF 1ZN2A 3ZQ7A 1BI0A 1LNWA 1P4AA 4HDUA 3JW4A 4Y17A 4KMFA 3F8FA 1WKMA 1EH6A 2OD5A 3LSTA 3BWGA 3HSRA 1P6RA 5ICEA 5BQTA 2XAJA 3LAJA 4LD5A 5LGTA 4I0BA 3L2CA 4IHTA 2M87A 3E97A 4NHJA 5JR3A 4KN4X 3GXOA 4I2OA 2GXBA 4KICA 1SD7A 2A68F 4HLYA 2IJLA 5K5QA 1ZGJA 1MD0A 4OU0A 4QLCU 2P5LC 4FHTA 5DYMA 4MEXF 1ON2A 4I09A 4HZFA 3V8LA 1LB2A 5ILSA 3LA2A 5ERIA 3MZHA 1IF1A 5E17F 1E17A 3WGHA 1F9NA 1R1VA 2YU3A 3HSEA 1IN5A 3KP7A 2X4HA 4KNYA 2CFXA 4RB3C 2WTEA 5DUKA 1LJ9A 5A2QK 3CO6C 1L3LA 1U5TA 2ISYA 3MAJA 2XAQA 2UXNA 2ETHA 4EJWA 4FT8A 5AIQA 3BJ6A 3GFMA 2FMYA 1I5ZA 4GYIA 1SFUA 2YR2A 5DCMA 4PDKA 1T6SA 2K86A 4LG0B 1BBYA 4BHBA 4HOBA 3NRVA 4PGGA 4G9YA 4L5JA 3O2PE 1YS7A 2EV5A 3IL2A 2R7FA 3V7RA 1Z05A 2MC3A 5L3CA 3SZPA 4RS8A 5LRSA 3ABUA 3H3UA 1S7OA 2L54A 1T39A 5D4SA 2L4AA 5BPIA 1D3YA 2CO5A 2QQAA 4R8HA 3BZ6A 5DDGA 2ZMEA 3TO6A 5HLHA 2E1NA 3RTRA 3K1NA 4GO1A 1FYMA 3JTHA 3RPQA 4EVIA 4A0YA 1USSA 1I27A 3KLOA 4ZYHA 3D0SA 3GFJA 2PFBA 3GLXA 2D45A 2EFQA 3T1BA 4MGRA 1BC7C 2V1UA 2OA4A 4KFCA 3KE2A 1SMYF 4YG2F 2O03A 1HSJA 1FP1D 4S05A 2H27A 3VODA 5L3EA 3C7JA 5CVUA 2K7LA 4GCVA 5K1YA 3TOBA 1BIAA 5D4RA 3PQKA 2RGVA 3GVAA 3IKTA 4JBAA 1MDMA 2GQQA 3CUOA 3CUQB 1F4KA 2NS0A 2VOOA 5LGNA 2Y0MA 4M9ZA 1TBXA 3H92A 2FBKA 3NEUA 3SQNA 2C6YA 2EFPA 2W25A 2PEXA 1MJBA 2B0LA 3P9CA 1AOYA 3DKWA 3QPHA 2OU2A 2BGCA 2P6TA 2Y48A 2FF4A 1XGSA 3GEZA 2XASA 3I59B 3JAMZ 1TTYA 5BOXA 2DU9A 2P7VB 4QWQA 3F8MA 4PGHA 4I02A 4IRHA 6PAXA 4JQFA 1B9MA 2ELHA 2DW4A 2CWEA 1GXQA 2XUBA 2ZXJA 3J81K 3M8EA 1R00A 2DAOA 3GZ6A 1P4XA 1O3SA 3ECHA 1RUOA 4JK1X 3WE3A 1ZRFA 5LGUA 2ESNA 1XSDA 2CGPA 4M71A 1XMKA 1IXCA 4EJOA 3RIRA 2MH2A 2BV6A 4HX7A 2EFOA 2LSOA 2QQ9A 2W85A 1B4AA 1IXRC 4K2EA 2ZNYA 2VT3A 3RPUA 5F1RA 2EB7A 4A6EA 3HHGA 2P8TA 4M9XA 4HBLA 4A5MA 5D8LB 5LBQA 4A6DA 5JVTA 5FLXK 1ZLKA 2OQRA 3ZMTA 1MJAA 2FE3A 4LFUA 2W57A 4YFKF 2L02A 2QUFA 3EQLF 3EYIA 2GA1A 3BOQA 2L01A 2Z5UA 3D5LA 3I54A 4AWXB 2H6BA 5FFXA 4EM0B 1TNSA 1T2KA 3HUGA 2PMHA 2YX7A 2VBXA 1MKMA 1UHMA 3I5UA 3G73A 2K27A 1HW1A 1ODDA 3WTYC 1K7AA 1QNTA 2P6SA 2QENA 1L0OC 2A6EF 2HDCA 5CVRA 1G6NA 1TQMA 2F2EA 3MWMA 4UVBA 3V7CA 3GF2A 3HOTA 5E20A 4EGZA 1KA8A 1XB4A 3CDHA 1SD5A 1SFXA 1STZA 2L3DA 3KP2A 2O3FA 1D8JA 3R0AA 1YW7A 3QOPA 4ZZDA 2W24A 4KYWA 2F5EA 4EV0A 3MFKA 4HV6A 1S7AA 1SD6A 4ETSA 3RYPA 5J6XA 3O3KA 4I98B 1OR7A 4N0BA 4RB1A 1K6OA 4P55A 5ILVA 3L7WA 1NHAA 4UVAA 3K2ZA 2VT2A 3WU0A 4MEYF 1S3JA 4CZZA 4WXCA 4IRIA 2EV0A 1H9TA 1YFHA 1OYWA 5LHIA 2DTRA 4OIQF 5LRRA 2KIFA 3ISPA 1UFMA 1RNLA 3HTSB 5JHUA 1FBQA 1TW2A 2Q0OA 3E5QA 1WRJA 3T8RA 1YG2A 3AAFA 5BMZA 4EMSA 5HDKA 1OPCA 3KETA 4H0EA 3R0JA 2E1CA 1S8NA 2PQ8A 4LMYA 2EA2A 1PP7U 3I71A 2NAZA 4HF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O8X A;  4YFX F;  3CJN A;  1B1B A;  1YLF A;  3SFZ A;  2WV0 A;  2UZK A;  1P2F A;  2M45 A;  5AON A;  1IXS B;  5KVR A;  2MH9 A;  3VB2 A;  2DQR A;  2P5V A;  1WSU A;  1JE8 A;  1ZAO A;  2OZ6 A;  3KP4 A;  2A3S A;  4U88 A;  4HQE A;  3KEO A;  1T0F A;  1R5G A;  2P5K A;  4HW0 A;  4IF4 A;  1ZYR F;  1RZ4 A;  3RKW A;  3K69 A;  3MEX A;  3F8N A;  2XVC A;  4RGU A;  3GX4 X;  5FLX Z;  4B09 A;  3QU3 A;  5HLG A;  4PZJ A;  1YYV A;  4AIK A;  1FOK A;  4CXF A;  3Q5F A;  1D5V A;  1E2X A;  2QLZ A;  4HV5 A;  2RKH A;  2VBW A;  3DXJ F;  4AIH A;  1LEA A;  3IRQ A;  3WTT C;  2TDX A;  4M72 A;  1XDU A;  1PDN C;  1ULY A;  1JXS A;  3EUH A;  1GVJ A;  3REO A;  1HBX G;  5E1Z B;  5CVV A;  5ILU A;  3GFL A;  2VE8 A;  5F64 A;  3CTA A;  1Z6R A;  1WI9 A;  3K9T A;  2GZW A;  3IRR A;  3DFG A;  4BNC A;  1TQI A;  5KK1 A;  3M9A A;  3ZPL A;  2HGC A;  1ZG5 A;  2IA0 A;  2HR3 A;  1U5T B;  1BI1 A;  2PN6 A;  4KDP A;  2HKX A;  3KP5 A;  5DD4 A;  4ZYD A;  1QPM A;  2FML A;  3PFI A;  2GAU A;  3FF5 A;  3ROU A;  1U3E M;  3G3Z A;  1U6G A;  3E6D A;  5DCM B;  5IT9 K;  1R22 A;  4ZYE A;  4HF0 A;  3R6S A;  2STW A;  1H0M A;  2J5O A;  1KGS A;  2Z33 A;  2A5Y B;  4EJV A;  2XAH A;  4L9V A;  4G7O F;  4BH9 A;  1PP8 F;  4O6J A;  1BOA A;  2CYY A;  4P9F A;  2ZFW A;  1ZRC A;  4XSX F;  4BHP A;  1IN8 A;  2NYX A;  3WTW C;  4NB5 A;  2M1B A;  4ON0 A;  1D8K A;  2XHK A;  2R3S A;  4KA4 A;  2HKO A;  1TQP A;  3VOE A;  4O3M A;  5JFR A;  2IP2 A;  1FY7 A;  4LJZ F;  2MBF A;  5CJ9 A;  2LKP A;  2Q2E A;  3COA C;  1XDS A;  4ZYG A;  3WGI A;  4WF2 A;  2IPQ X;  2ESH A;  5L3D A;  2Q8K A;  1VTN C;  1ZLJ A;  2V1D A;  4G6D A;  4WX9 A;  3RKY A;  3WOD F;  2FXA A;  3U1D A;  1YQA A;  4N9I A;  2OBP A;  5LLQ A;  4BHC A;  2JRT A;  3GFI A;  2M8E A;  1QO0 D;  1CF7 A;  5H6R A;  2XKP A;  2XAG A;  3U2R A;  2X0L A;  4WWC A;  1OYI A;  3M8F A;  3Q9S A;  2UXX A;  1RUN A;  2BE5 F;  4BYY A;  3ULQ B;  3K1M A;  1MDM B;  3KP6 A;  3I4P A;  4A12 A;  5D5U B;  3J80 K;  1HXD A;  3ELK A;  4ENN A;  4D0P A;  4IVN A;  4UV9 A;  2RQP A;  4L9J A;  3BJO A;  3TGN A;  2ZJ2 A;  4KMU X;  4I01 A;  1W7P D;  4R79 A;  5K5O A;  1J9I A;  3TO7 A;  5E18 F;  3T0Y A;  2HOE A;  1HKQ A;  4HX8 A;  2L4M A;  3T8T A;  3N97 A;  1IN6 A;  2DK8 A;  1XGN A;  5E1X A;  2Z3Y A;  1PUE E;  3I64 A;  2IVM A;  1IN4 A;  2EA4 A;  1KYZ A;  4HDV A;  5HOO A;  5LEJ A;  2YX4 A;  3Q9V A;  2FBI A;  2VOP A;  2F5F A;  5HS7 A;  2P7C B;  1XD7 A;  4ESB A;  2COM A;  1HQC A;  1J75 A;  4ENJ A;  1XSV A;  2PG4 A;  5L3G A;  5E8G A;  5LHG A;  2JZY A;  4Q48 A;  1DP7 P;  3HRT A;  1T38 A;  2H6C A;  1RI7 A;  1U2W A;  3WU1 B;  4I7H A;  3U9G A;  3HRM A;  1K79 A;  2W84 A;  1W5S A;  3HRU A;  4PCQ A;  5IT9 Z;  1R36 A;  3B02 A;  1K78 A;  1BM9 A;  1UST A;  1IAW A;  3BPV A;  3IKV A;  5A2Q Z;  2IA2 A;  3WTS C;  5ICF A;  4HF1 A;  2FEZ A;  4CHU A;  1KU3 A;  1F5T A;  4RAY A;  3ERE D;  4A5N A;  2DFI A;  5D5W B;  3CLO A;  3E6B A;  2QQB A;  3F23 A;  1FX7 A;  3LA7 A;  3JTG A;  1SFE A;  4WK8 F;  4RB2 C;  2XV4 S;  2VBZ A;  3V4G A;  2NNY A;  3LAP A;  1O3Q A;  1FC3 A;  5H6Q A;  5FD6 A;  4L0Y B;  5EEG A;  2IRF G;  2MLK A;  4M6Y A;  4OIN F;  3HIF A;  2FQ3 A;  4U7D A;  1OMI A;  5K5R A;  4OMY A;  5L3B A;  3L00 A;  2DO7 A;  4IJA A;  1HST A;  1SAX A;  3SZT A;  3TQN A;  1I6X A;  3IWZ A;  2JPC A;  2VC0 A;  2M30 A;  2QBY A;  1QZZ A;  5ICC A;  1XGM A;  3DQV C;  1TW3 A;  4OOI A;  5JI6 A;  4RGX A;  2D2W A;  1DDN A;  2ZBK A;  3ZN1 A;  3K1P A;  4ESJ A;  1QQI A;  3F6V A;  3F8C A;  4U0W A;  1B59 A;  1KQ8 A;  1R1U A;  2G7H A;  2DLL A;  5CLS A;  3F22 A;  3IC7 A;  2HEO A;  3QP5 A;  1J5Y A;  2JTV A;  3RJP A;  2VN2 A;  5ICG A;  2Z9O A;  2EWN A;  3E5X A;  1ZGA A;  3LWF A;  3FMQ A;  5J8C A;  4O5V A;  2ACJ A;  1ZH5 A;  2A07 F;  3TDU C;  1KU7 A;  1MGT A;  4E70 A;  5CVI A;  1WWX A;  5EEH A;  3RDI A;  1C0W A;  2KJB A;  2FBH A;  2QM3 A;  3C1D A;  4L9N A;  1W7P A;  1J59 A;  1ZRD A;  2EK5 A;  3KFW X;  3MCZ A;  1LVA A;  2A69 F;  2MA3 A;  3LFK A;  2K02 A;  5BPD A;  4UHT A;  4Q4Z F;  1FZP B;  3FMR A;  4KUM A;  5D5X B;  2M5W A;  3PQJ A;  2DK5 A;  1R7J A;  2JSC A;  2HTJ A;  2O61 A;  4ESF A;  3BP8 A;  4MHG A;  1G3T A;  1SMT A;  3WGG A;  5DCF A;  1ON1 A;  2V1X A;  5ED4 A;  2XAF A;  3C3W A;  4AD9 A;  2MD5 A;  4L0Z B;  3GW2 A;  1O57 A;  2RC4 A;  3FM3 A;  1UHW A;  3FZV A;  4LLG F;  4FX0 A;  4U0Y A;  1DPU A;  3E6M A;  5D6F A;  1Z6T A;  4ASN A;  1B9N A;  2HYF A;  1FT9 A;  3ML6 A;  3E5U A;  1HW5 A;  3J81 Z;  5IT3 A;  2GWR A;  1FBU A;  1REP C;  5DD8 A;  3DF8 A;  4M6X A;  4IXA A;  1P92 A;  1QGP A;  3FX3 A;  5HDN A;  2J5P A;  2IA1 A;  2Z99 A;  1KQ0 A;  3BY6 A;  1FSH A;  1S29 A;  2DI3 A;  5H20 A;  1KQ9 A;  4HX4 A;  2HFH A;  1G3S A;  1U8R A;  2HZT A;  3OV8 A;  1ONV A;  2LNB A;  4MQ9 F;  1J0R A;  2E7W A;  1JGS A;  4WCG A;  2LDU A;  1B6A A;  2EFW A;  4YII A;  4MNU A;  1P4W A;  1HKS A;  1XSX A;  1GHC A;  4ENM A;  2VE9 A;  4G8X A;  4XBF A;  5LEK A;  2ZO4 A;  4BAY A;  1Z7U A;  1ZG1 A;  4UNO A;  1BI3 A;  3ZMU A;  5TRD A;  1EH8 A;  3N4M A;  3JSO A;  2IT0 A;  1G4D A;  4CDG A;  1Z91 A;  3TO9 A;  2RN7 A;  4TV7 A;  3R4K A;  5FB2 A;  3FXU A;  4G7Z F;  5HS9 A;  3W6J B;  2EJR A;  3GWZ A;  3P9K A;  1BJA A;  5HVQ C;  2OQG A;  3ABT A;  1V4R A;  3QU6 A;  2K4B A;  2IW5 A;  4LK0 F;  1LDD A;  4KIB A;  4ZH4 F;  1ZHF A;  1OYY A;  4LK1 F;  2ADU A;  4OIR F;  4GYG A;  2H09 A;  1T98 A;  1IW7 F;  2HS5 A;  3DP7 A;  2NNN A;  2HQN A;  3HSF A;  3DV8 A;  1G3W A;  2E7X A;  4Q5S F;  4A0Z A;  3BRO A;  2D1H A;  4RB0 A;  4UUV A;  4EQQ A;  1ZAR A;  3RI4 A;  2LF8 A;  3FXR A;  3MQ0 A;  4EM2 A;  3FMS A;  3TKY A;  1IUY A;  4WXH A;  2YSR A;  5TJJ A;  2AXL A;  3V8K A;  1CGP A;  1KU9 A;  1TLH B;  1XGO A;  3JAM K;  2H94 A;  1FLI A;  3ZP5 A;  1FP2 A;  3HTU A;  5E8I A;  3KCC A;  4AVP A;  3WG9 A;  1CF7 B;  2FRH A;  1BN5 A;  4LLN A;  1W4M A;  1G3Y A;  2ZME B;  2G7U A;  4AIJ A;  2V6C A;  5DV5 A;  5DEQ A;  2RDP A;  3KZY A;  4HLX A;  2GA2 A;  2JT1 A;  1YIO A;  4XLP F;  5F6F A;  3DPL C;  5DUI A;  1O3T A;  3EDP A;  3V8J A;  5D8K B;  2OAZ A;  1SD4 A;  3DPT A;  4KT5 C;  3HRS A;  1LEB A;  2A61 A;  3QPT A;  4EM1 A;  3I58 A;  2QYO A;  2VBY A;  5CYV A;  5FFZ A;  4M74 A;  4LLL A;  4HAM A;  2ZCW A;  4I0A A;  5FGM A;  2Y75 A;  2ISZ A;  4DNC A;  2CG4 A;  2FU4 A;  4CO8 A;  4F7Z A;  4G94 A;  1UB9 A;  2O6G E;  4LG0 A;  3S2W A;  4OMZ A;  4RAZ A;  1QZY A;  2ZKZ A;  3DEU A;  1JHF A;  5CVJ A;  4RGR A;  4LB5 A;  4YFN F;  4KIF A;  2XRO A;  3H3Z A;  2F5C A;  2HQR A;  1BI2 A;  2PBI A;  3RKX A;  4N9H A;  2CW0 F;  2RVC A;  4UVC A;  3SXY A;  3EET A;  1KU2 A;  1UCR A;  3M1E A;  2PI0 A;  1K78 B;  3B73 A;  4ENK A;  2RNJ A;  2ZNZ A;  2R7D A;  2KKO A;  3NQO A;  3HYI A;  5AIP A;  2EV6 A;  4RGS A;  2EFN A;  2FSW A;  3KP3 A;  3E6C C;  4EGY A;  4R1H A;  3ZMS A;  1WQ2 A;  3J7A O;  2FNA A;  5E1W A;  3QP6 A;  4KIG A;  1FSE A;  1XMA A;  1ZG3 A;  1YW9 A;  1J2X A;  2XIG A;  3R60 A;  2HWV A;  1I1S A;  1U78 A;  1EH7 A;  1R23 A;  4P9U A;  4CIC A;  3V7S A;  5D6E A;  5BS6 A;  2BBY A;  3RYR A;  2GXG A;  3P9I A;  2V9V A;  3F6O A;  4L5I A;  4M73 A;  1YO5 C;  2VXZ A;  4UXN A;  4MTD A;  1Z1D A;  3BPX A;  1LDK B;  4G7H F;  1IN7 A;  2JPB A;  3CUQ A;  2LF7 A;  2OZU A;  3L09 A;  5LHH A;  4U7B A;  3KZZ A;  4LGW A;  2QBY B;  4GGG A;  2WC2 A;  4Z2Y A;  2O0Y A;  1W5T A;  2QVO A;  2KRF A;  1R5H A;  3L9F A;  3F72 A;  3GO5 A;  2F5D A;  2QZ8 A;  5FO5 A;  3WTV C;  3TOA A;  1J7K A;  3LQQ A;  4IPA A;  4DQ2 A;  3CO7 C;  2CQK A;  3F8B A;  4A2U A;  5D5V B;  1FNN A;  3WE2 A;  3ECO A;  4HA8 A;  4B8X A;  2HTS A;  3I59 A;  1EV7 A;  1F1Z A;  1U5T C;  3ZMV A;  1HKT A;  3K0L A;  2FNP A;  4G6Q A;  1O3R A;  1IRG A;  1Z9C A;  3O6B B;  5FD5 A;  3KEQ A;  2XRN A;  4ZZL A;  4EJT A;  1Q1H A;  4XRF A;  2XKO A;  4CGZ A;  2VC1 A;  2RV8 A;  1RIO H;  4FX4 A;  1OKR A;  4EJU A;  1LDJ A;  1W7P B;  3QAH A;  4U0V A;  4BXU A;  3J80 Z;  3GZ5 A;  3WTU C;  1BC8 C;  1O7F A;  2G9W A;  3F21 A;  3C18 A;  4P5O A;  3FM5 A;  5L3F A;  2MLG A;  4L18 B;  3IHU A;  2PLY A;  2DPU A;  3LA3 A;  4WXD A;  3GUD A;  1BIB A;  2FOK A;  3VEP A;  2DT5 A;  3LQR A;  2GIV A;  1MZB A;  1S6L A;  4M9S A;  2DPD A;  1HW2 A;  4OIP F;  1FPQ A;  3KLN A;  3QRF F;  1O7L A;  3F3X A;  3ZMD A;  4CYD A;  4HQM A;  3JSP A;  2DBB A;  2PJP A;  4IHS A;  4XLN F;  4L9T A;  4OIO F;  3FWE A;  3W6K B;  3M7G A;  2BYV E;  1YTY A;  4BQA A;  3GYH X;  3ZMZ A;  4HYE A;  3I0T A;  4IRG A;  1XCB A;  4YIF A;  1YW8 A;  5HLI A;  3MZY A;  2P4W A;  1I1G A;  1XN7 A;  3TDZ C;  1R58 A;  3T5X A;  4UV8 A;  4A0X A;  4MTE A;  2STT A;  3BJA A;  3I53 A;  4XSZ F;  2BEO A;  4MQV A;  2HYG D;  2DQL A;  3HOS A;  3WTZ A;  1R1T A;  1AWC A;  1XCV A;  4KN7 X;  1FBS A;  1FYL A;  1Y0U A;  1MJ9 A;  5HS8 A;  2QWW A;  5HDG A;  2CSO A;  4LB6 B;  3OOP A;  1GXP A;  2FA5 A;  1ZRE A;  5J8F A;  2KJC A;  1FYK A;  2K4J A;  2KIU A;  4Y15 A;  2V79 A;  1QBJ A;  1X3U A;  4Y13 A;  4GXO A;  3WTX C;  3ZN0 A;  1IRF A;  1TNT A;  2PMU A;  4NQW A;  3CUQ C;  2D1V A;  4Q47 A;  3EYY A;  3P7N A;  1DPR A;  1JHH A;  3HHH A;  2VOD A;  1FWZ A;  3E3V A;  3R61 A;  1A04 A;  2WWY A;  2KIM A;  3VFZ A;  3FHZ A;  3IWF A;  2AS5 F;  2YPR A;  1YS6 A;  3SHF A;  2NRA C;  3BDD A;  2VON A;  1DUX C;  4S04 A;  4P96 A;  2XGX A;  2UWM A;  1V3F A;  1LQ1 A;  1IZ1 A;  1KYW A;  3FXQ A;  1H9G A;  2A6H F;  1ZN2 A;  3ZQ7 A;  1BI0 A;  1LNW A;  1P4A A;  4HDU A;  3JW4 A;  4Y17 A;  4KMF A;  3F8F A;  1WKM A;  1EH6 A;  2OD5 A;  3LST A;  3BWG A;  3HSR A;  1P6R A;  5ICE A;  5BQT A;  2XAJ A;  3LAJ A;  4LD5 A;  5LGT A;  4I0B A;  3L2C A;  4IHT A;  2M87 A;  3E97 A;  4NHJ A;  5JR3 A;  4KN4 X;  3GXO A;  4I2O A;  2GXB A;  4KIC A;  1SD7 A;  2A68 F;  4HLY A;  2IJL A;  5K5Q A;  1ZGJ A;  1MD0 A;  4OU0 A;  4QLC U;  2P5L C;  4FHT A;  5DYM A;  4MEX F;  1ON2 A;  4I09 A;  4HZF A;  3V8L A;  1LB2 A;  5ILS A;  3LA2 A;  5ERI A;  3MZH A;  1IF1 A;  5E17 F;  1E17 A;  3WGH A;  1F9N A;  1R1V A;  2YU3 A;  3HSE A;  1IN5 A;  3KP7 A;  2X4H A;  4KNY A;  2CFX A;  4RB3 C;  2WTE A;  5DUK A;  1LJ9 A;  5A2Q K;  3CO6 C;  1L3L A;  1U5T A;  2ISY A;  3MAJ A;  2XAQ A;  2UXN A;  2ETH A;  4EJW A;  4FT8 A;  5AIQ A;  3BJ6 A;  3GFM A;  2FMY A;  1I5Z A;  4GYI A;  1SFU A;  2YR2 A;  5DCM A;  4PDK A;  1T6S A;  2K86 A;  4LG0 B;  1BBY A;  4BHB A;  4HOB A;  3NRV A;  4PGG A;  4G9Y A;  4L5J A;  3O2P E;  1YS7 A;  2EV5 A;  3IL2 A;  2R7F A;  3V7R A;  1Z05 A;  2MC3 A;  5L3C A;  3SZP A;  4RS8 A;  5LRS A;  3ABU A;  3H3U A;  1S7O A;  2L54 A;  1T39 A;  5D4S A;  2L4A A;  5BPI A;  1D3Y A;  2CO5 A;  2QQA A;  4R8H A;  3BZ6 A;  5DDG A;  2ZME A;  3TO6 A;  5HLH A;  2E1N A;  3RTR A;  3K1N A;  4GO1 A;  1FYM A;  3JTH A;  3RPQ A;  4EVI A;  4A0Y A;  1USS A;  1I27 A;  3KLO A;  4ZYH A;  3D0S A;  3GFJ A;  2PFB A;  3GLX A;  2D45 A;  2EFQ A;  3T1B A;  4MGR A;  1BC7 C;  2V1U A;  2OA4 A;  4KFC A;  3KE2 A;  1SMY F;  4YG2 F;  2O03 A;  1HSJ A;  1FP1 D;  4S05 A;  2H27 A;  3VOD A;  5L3E A;  3C7J A;  5CVU A;  2K7L A;  4GCV A;  5K1Y A;  3TOB A;  1BIA A;  5D4R A;  3PQK A;  2RGV A;  3GVA A;  3IKT A;  4JBA A;  1MDM A;  2GQQ A;  3CUO A;  3CUQ B;  1F4K A;  2NS0 A;  2VOO A;  5LGN A;  2Y0M A;  4M9Z A;  1TBX A;  3H92 A;  2FBK A;  3NEU A;  3SQN A;  2C6Y A;  2EFP A;  2W25 A;  2PEX A;  1MJB A;  2B0L A;  3P9C A;  1AOY A;  3DKW A;  3QPH A;  2OU2 A;  2BGC A;  2P6T A;  2Y48 A;  2FF4 A;  1XGS A;  3GEZ A;  2XAS A;  3I59 B;  3JAM Z;  1TTY A;  5BOX A;  2DU9 A;  2P7V B;  4QWQ A;  3F8M A;  4PGH A;  4I02 A;  4IRH A;  6PAX A;  4JQF A;  1B9M A;  2ELH A;  2DW4 A;  2CWE A;  1GXQ A;  2XUB A;  2ZXJ A;  3J81 K;  3M8E A;  1R00 A;  2DAO A;  3GZ6 A;  1P4X A;  1O3S A;  3ECH A;  1RUO A;  4JK1 X;  3WE3 A;  1ZRF A;  5LGU A;  2ESN A;  1XSD A;  2CGP A;  4M71 A;  1XMK A;  1IXC A;  4EJO A;  3RIR A;  2MH2 A;  2BV6 A;  4HX7 A;  2EFO A;  2LSO A;  2QQ9 A;  2W85 A;  1B4A A;  1IXR C;  4K2E A;  2ZNY A;  2VT3 A;  3RPU A;  5F1R A;  2EB7 A;  4A6E A;  3HHG A;  2P8T A;  4M9X A;  4HBL A;  4A5M A;  5D8L B;  5LBQ A;  4A6D A;  5JVT A;  5FLX K;  1ZLK A;  2OQR A;  3ZMT A;  1MJA A;  2FE3 A;  4LFU A;  2W57 A;  4YFK F;  2L02 A;  2QUF A;  3EQL F;  3EYI A;  2GA1 A;  3BOQ A;  2L01 A;  2Z5U A;  3D5L A;  3I54 A;  4AWX B;  2H6B A;  5FFX A;  4EM0 B;  1TNS A;  1T2K A;  3HUG A;  2PMH A;  2YX7 A;  2VBX A;  1MKM A;  1UHM A;  3I5U A;  3G73 A;  2K27 A;  1HW1 A;  1ODD A;  3WTY C;  1K7A A;  1QNT A;  2P6S A;  2QEN A;  1L0O C;  2A6E F;  2HDC A;  5CVR A;  1G6N A;  1TQM A;  2F2E A;  3MWM A;  4UVB A;  3V7C A;  3GF2 A;  3HOT A;  5E20 A;  4EGZ A;  1KA8 A;  1XB4 A;  3CDH A;  1SD5 A;  1SFX A;  1STZ A;  2L3D A;  3KP2 A;  2O3F A;  1D8J A;  3R0A A;  1YW7 A;  3QOP A;  4ZZD A;  2W24 A;  4KYW A;  2F5E A;  4EV0 A;  3MFK A;  4HV6 A;  1S7A A;  1SD6 A;  4ETS A;  3RYP A;  5J6X A;  3O3K A;  4I98 B;  1OR7 A;  4N0B A;  4RB1 A;  1K6O A;  4P55 A;  5ILV A;  3L7W A;  1NHA A;  4UVA A;  3K2Z A;  2VT2 A;  3WU0 A;  4MEY F;  1S3J A;  4CZZ A;  4WXC A;  4IRI A;  2EV0 A;  1H9T A;  1YFH A;  1OYW A;  5LHI A;  2DTR A;  4OIQ F;  5LRR A;  2KIF A;  3ISP A;  1UFM A;  1RNL A;  3HTS B;  5JHU A;  1FBQ A;  1TW2 A;  2Q0O A;  3E5Q A;  1WRJ A;  3T8R A;  1YG2 A;  3AAF A;  5BMZ A;  4EMS A;  5HDK A;  1OPC A;  3KET A;  4H0E A;  3R0J A;  2E1C A;  1S8N A;  2PQ8 A;  4LMY A;  2EA2 A;  1PP7 U;  3I71 A;  2NAZ A;  4HF2 A; 
#chains in the Genus database with same CATH topology
 2O8X A;  3HC7 A;  4YFX F;  3ZOB A;  2MAB A;  4XMY A;  2JMW A;  3DBL B;  2JSP A;  3LSH A;  3CJN A;  2ZFU A;  4RA2 A;  1B1B A;  3IH2 A;  1YLF A;  3VYU B;  3SFZ A;  4CCK A;  2Z16 A;  2V9K A;  2WV0 A;  1LFP A;  2M0M A;  2NOG A;  3HL2 A;  2UZK A;  3TED A;  1P2F A;  1LPQ A;  5F0F A;  2DMT A;  2M45 A;  3H5A A;  5AON A;  1PUF A;  1IXS B;  5KVR A;  1TWF J;  2MH9 A;  2X6W A;  5GAH J;  3VB2 A;  3CF2 A;  3BR5 A;  2DQR A;  2P5V A;  1WSU A;  1JE8 A;  2BXY A;  1ZAO A;  3DEW A;  1A6Q A;  4ITV A;  5HLT A;  2OZ6 A;  3KP4 A;  1MBG A;  2A3S A;  3JRI A;  2R7R A;  3BG3 A;  3CME I;  3BG9 A;  4U88 A;  1JUM A;  3SDB A;  2K9L A;  1BW6 A;  4HQE A;  2ME6 A;  2VPL A;  3KEO A;  1T0F A;  1R5G A;  2P5K A;  4HW0 A;  4IF4 A;  1ZYR F;  1RZ4 A;  1WJ5 A;  3RKW A;  3K69 A;  4C2T A;  1WJD A;  4UY8 I;  4AYB N;  3MEX A;  1YJW I;  2AQF A;  3F8N A;  5FRO A;  2JWT A;  2L0K A;  2XVC A;  4RGU A;  1VZ0 A;  3SDG A;  3GX4 X;  2QA4 I;  3ABK H;  1VQ8 I;  1W0T A;  2Y9Y A;  5FLX Z;  3DKX A;  1B8I B;  4B09 A;  3QU3 A;  5HLG A;  4AID A;  4PZJ A;  1YYV A;  3CMM A;  4AIK A;  3CDL A;  1FOK A;  4CXF A;  2VJ5 A;  3ERM A;  1B72 B;  1GLN A;  3Q5F A;  1D5V A;  4MO7 A;  3HG9 A;  1E2X A;  3HKZ N;  2QLZ A;  3HBL A;  4HV5 A;  2RKH A;  2VBW A;  4CCO A;  4XR6 A;  4MIM A;  1ZEL A;  4LIV A;  3DLL F;  3K2A A;  3DXJ F;  1NH3 A;  4AIH A;  1LEA A;  3IRQ A;  3WTT C;  2TDX A;  4M72 A;  2JA6 J;  1IUF A;  1XDU A;  1X58 A;  3V42 A;  2LH9 A;  1PDN C;  4PFP A;  1ULY A;  2BY2 A;  1JXS A;  3EUH A;  1GVJ A;  3JRE A;  4XL9 A;  3REO A;  1HBX G;  1JGG A;  1R4M B;  5E1Z B;  2JA2 A;  4F93 B;  5EDN A;  2TRT A;  3TL4 X;  5CVV A;  2IGO A;  1PYV A;  2E60 A;  5ILU A;  3GFL A;  2VE8 A;  5M5X J;  5F64 A;  3CTA A;  2NOJ B;  1Z6R A;  1OCO H;  1WI9 A;  2VKV A;  3K9T A;  3K4N A;  1YRN A;  3I4M J;  3HOZ J;  2DJN A;  2EH3 A;  3GTO J;  2GZW A;  3IRR A;  2KRH A;  3DFG A;  4BNC A;  1TQI A;  2ZJR F;  1SFO J;  2JQ7 A;  5KK1 A;  3M9A A;  4ZDP A;  3ZPL A;  2HGC A;  1ZG5 A;  2IA0 A;  2HR3 A;  1U5T B;  1X1B A;  3S2D J;  1BI1 A;  4M3F A;  2PN6 A;  4KDP A;  2HKX A;  3VYT B;  3KP5 A;  1YJN I;  2XGD A;  5DD4 A;  3LSM A;  2NVY J;  1Z7L A;  3S32 A;  3HDD A;  5M5Y J;  4ZYD A;  1YX3 A;  1QPM A;  4BE1 A;  2FML A;  3PFI A;  4XLF A;  2GAU A;  3FXJ A;  3OYI A;  3FF5 A;  3ROU A;  1U3E M;  2V6E A;  3G3Z A;  3VWB A;  2CS3 A;  4D7M A;  3Q0U A;  1U6G A;  2QEX I;  3E6D A;  5DCM B;  3MVP A;  3G1L A;  5IT9 K;  1R22 A;  4ZYE A;  4HF0 A;  4IQJ A;  3R6S A;  2STW A;  1H0M A;  2J5O A;  1KGS A;  2QCO A;  4JP0 A;  2Z33 A;  2A5Y B;  5IOY A;  3HOY J;  4EJV A;  3OSF A;  2W7N A;  2XAH A;  4L9V A;  4G7O F;  2DFH A;  4BH9 A;  1OCZ H;  1PP8 F;  4O6J A;  1BOA A;  2CYY A;  2W1O A;  4P9F A;  2ZFW A;  1ZRC A;  4XSX F;  4BHP A;  2V1N A;  2KL4 A;  2MW8 A;  1IN8 A;  1OR7 C;  2R4G A;  2NYX A;  3WTW C;  2XPV A;  4NB5 A;  2M1B A;  2LKS A;  4ON0 A;  1D8K A;  2XHK A;  2R3S A;  4KA4 A;  2HKO A;  1TQP A;  1UG0 A;  4M3D A;  3VOE A;  4DZP A;  4O3M A;  5JFR A;  2IP2 A;  1FY7 A;  1K83 J;  4LJZ F;  3UNG C;  2M9H A;  2MBF A;  3ZQI A;  1T56 A;  4XKW A;  5CJ9 A;  3VDX A;  4HPQ A;  2Y30 A;  2KFD A;  4IL6 C;  3RPU D;  2LKP A;  2Q2E A;  2OTL I;  3TP3 A;  3COA C;  1IV6 A;  1XDS A;  4ZYG A;  4ABZ A;  4X6A J;  1MMG A;  5HOD A;  3WGI A;  3PNY A;  4WF2 A;  5KNL A;  2IPQ X;  2ESH A;  4D7N A;  4PJN A;  4AM3 A;  5L3D A;  2Q8K A;  1VTN C;  1ZLJ A;  2V1D A;  1VQO I;  5GPC A;  3PUB A;  4G6D A;  4WX9 A;  3RKY A;  2BHY A;  3WOD F;  2FXA A;  3U1D A;  1YQA A;  4PJJ A;  3M3Y J;  2X6X A;  4N9I A;  1YX5 A;  2H8W A;  3M1C A;  4XLA A;  1OIS A;  2DA3 A;  1ETQ A;  2OBP A;  1JKQ C;  4Y52 J;  5EF6 A;  5DS9 A;  5LLQ A;  5DM6 F;  4BHC A;  4V2F A;  2JRT A;  3GFI A;  4A3E J;  5FKO A;  2M8E A;  2QKL B;  5IYD J;  1QO0 D;  3FXM A;  5H6R A;  1CF7 A;  2XKP A;  2XAG A;  1X3W B;  3U1K A;  2B63 J;  3U2R A;  2R92 J;  3AL0 B;  2ELJ A;  2X0L A;  4WWC A;  3K4K A;  1UHS A;  1OYI A;  2X9D A;  1ETX A;  5K7F A;  3M8F A;  3Q9S A;  2UXX A;  3SEZ A;  2L5Q A;  1RUN A;  2WAQ N;  3U21 A;  2BE5 F;  3RKQ A;  4BYY A;  1SFK A;  4PFO A;  3ULQ B;  4BE2 A;  3K1M A;  4HEA 2;  4FQG A;  1MDM B;  3BR6 A;  1PVE A;  2I8D A;  3CC4 I;  3KP6 A;  3OR2 C;  3NWS A;  4ZJZ A;  5J4Y A;  3I4P A;  4A12 A;  2JUG A;  5D5U B;  1QA6 A;  2UUZ A;  3J80 K;  2OC6 A;  1HXD A;  2F48 A;  3ELK A;  5KCM A;  4ENN A;  4D0P A;  4BQN A;  4IVN A;  4Y7N J;  3OYN A;  4UV9 A;  1BR1 A;  3S2H J;  3PUF A;  2E36 A;  4QPQ A;  2RQP A;  4L9J A;  3BJO A;  3TGN A;  2ZJ2 A;  4KMU X;  4I01 A;  3TMO A;  1W7P D;  4R79 A;  5K5O A;  2R7W A;  2L9V A;  1J9I A;  3TO7 A;  2ECC A;  2Z2S B;  5E18 F;  3PO2 J;  1A36 A;  3T0Y A;  2HOE A;  1HKQ A;  2TCT A;  4HX8 A;  2L4M A;  3T8T A;  3AG2 H;  4UUS B;  4XN3 A;  3WHB A;  4DGW B;  3N97 A;  1IN6 A;  2DK8 A;  3OYH A;  1XGN A;  5E1X A;  1WH5 A;  2Z3Y A;  2ID6 A;  1PUE E;  1G59 A;  3I64 A;  1POG A;  1ETV A;  2DA1 A;  2IVM A;  1IN4 A;  2EA4 A;  2OUM A;  1KYZ A;  4HDV A;  4KJZ A;  1R5I D;  3D5R C;  2WAD A;  5HOO A;  5LEJ A;  2YX4 A;  3BCA A;  2FBI A;  3Q9V A;  2VOP A;  3FIW A;  2F5F A;  2R5Z A;  1LE8 A;  5HS7 A;  2P7C B;  4UUT A;  2AXT C;  2DYS H;  2E1M C;  1XD7 A;  1GT0 C;  4ESB A;  1X4O A;  2COM A;  3QOD A;  4NC8 A;  4F55 A;  1HQC A;  5HNH A;  1J75 A;  4ENJ A;  1XSV A;  2LOO A;  2BW3 B;  3OSG A;  1ETO A;  2PG4 A;  3KYL A;  2M7A A;  5L3G A;  5E8G A;  5LHG A;  2JZY A;  4Q48 A;  2NXN B;  1DP7 P;  3LSI A;  3HRT A;  1T38 A;  2H6C A;  1XS9 A;  1RI7 A;  4DBR A;  1U2W A;  3OYD A;  2O8K A;  3WU1 B;  4I7H A;  3U9G A;  5BNG A;  3HRM A;  2HPI A;  1K79 A;  4RM2 A;  3BC8 A;  2W84 A;  4ZDO A;  1W5S A;  3HRU A;  4F52 A;  4PCQ A;  2OF7 A;  5F0H A;  5IT9 Z;  3GTP J;  1ENH A;  1R36 A;  2X6Y A;  3B02 A;  3EPZ A;  4BJ6 C;  1BM9 A;  4C3I J;  1K78 A;  2K40 A;  9ANT A;  3AFH A;  1UST A;  1IAW A;  3BPV A;  3IKV A;  5A2Q Z;  2IA2 A;  3MN2 A;  3WTS C;  1K6Y A;  5ICF A;  1J09 A;  2IS1 A;  4HF1 A;  3F9K A;  2FEZ A;  1RPW A;  4CHU A;  4N4O B;  1FOX A;  2VPR A;  3OS1 A;  1KU3 A;  4YRV A;  1F5T A;  3FKJ A;  4RAY A;  3W3C A;  1ORK A;  5IP6 A;  3ERE D;  2M2E A;  4A5N A;  2DFI A;  1WH7 A;  5D5W B;  3FK7 A;  3JRA A;  3CLO A;  3E6B A;  3K4J A;  2JVG A;  1FTZ A;  1HA8 A;  1XC5 A;  3HOX J;  1MND A;  2QQB A;  3F23 A;  3C2B A;  1BA5 A;  1FX7 A;  3LA7 A;  4DYC A;  3JTG A;  1SFE A;  4PSW A;  4WK8 F;  2ZC2 A;  4RB2 C;  2VAS A;  2XV4 S;  1NK3 P;  2VBZ A;  2XF6 A;  2Z1D A;  3V4G A;  3OIP A;  2NNY A;  3LAP A;  3CC2 I;  2WY7 Q;  3HUG B;  3H35 A;  1O3Q A;  1FC3 A;  5H6Q A;  5FD6 A;  1APL C;  4L0Y B;  1GV5 A;  5EEG A;  1JJ6 C;  2IRF G;  2MLK A;  4A3B J;  4M6Y A;  1RR8 C;  4OIN F;  3HIF A;  4D1Q A;  2HXI A;  2FQ3 A;  4U7D A;  4XK4 A;  1GV2 A;  1OMI A;  5K5R A;  2WY8 Q;  2A5W A;  2KDO A;  4OMY A;  2GLO A;  5L3B A;  3L00 A;  4IHW A;  4AYB A;  2E5Z A;  2DO7 A;  4ZTF A;  1QHG A;  4IJA A;  1HST A;  2R7U A;  2KZV A;  2X85 A;  2JN6 A;  3DTI A;  4DZJ A;  1QPI A;  2R7S A;  2IS4 A;  1SAX A;  2COB A;  3SZT A;  3TQN A;  1I6X A;  3IWZ A;  5EGO A;  2JPC A;  2VC0 A;  2M30 A;  2QBY A;  1QZZ A;  5ICC A;  1XGM A;  2JA5 J;  1O4X A;  2ICW G;  2Y2Z A;  3DQV C;  1TW3 A;  4OOI A;  3KEY A;  1UG2 A;  5JI6 A;  4RGX A;  2D2W A;  3UR3 C;  1DDN A;  2ZBK A;  3CZ6 A;  3L2U A;  3ZRG A;  4C9Y A;  3BG7 A;  1TWH J;  3ZN1 A;  2DA2 A;  3HKZ A;  4ZC3 A;  1MBH A;  3K1P A;  1YI2 I;  3CCE I;  4ESJ A;  1QQI A;  2R5Y A;  4BQQ A;  3ZQL A;  3F6V A;  2Q1Z B;  3F8C A;  5FLM J;  4U0W A;  1WZ2 A;  2XPW A;  1LVK A;  5C44 J;  2KRC A;  3BCB A;  2VQL A;  1B59 A;  1AKH B;  1KQ8 A;  1QU3 A;  1R1U A;  2G7H A;  2DLL A;  4A3L J;  5CLS A;  4BBR J;  3IC7 A;  4XKV A;  3F22 A;  4NBQ A;  2HEO A;  4GFB A;  2F4O B;  2M8G X;  3QP5 A;  1J5Y A;  2JTV A;  1T33 A;  3LMM A;  4IQ4 A;  1HOM A;  2L7F P;  4RLF A;  4XRM A;  3QWL A;  3MZ8 A;  3RJP A;  3S16 J;  2VN2 A;  5ICG A;  2AO9 A;  2Z9O A;  2EWN A;  3E5X A;  1ZGA A;  3LWF A;  3HXL A;  4BBS J;  2FX0 A;  3FMQ A;  5J8C A;  4O5V A;  2ACJ A;  4DYR A;  3LSR A;  2HOA A;  2DMP A;  1ZH5 A;  1Y1W J;  2A07 F;  3TDU C;  1KU7 A;  1MGT A;  2ME0 A;  1VQ9 I;  4E70 A;  2R7X A;  5CVI A;  1MNM C;  1WWX A;  5EEH A;  3MKZ A;  3RDI A;  1C0W A;  2KJB A;  2FBH A;  2QM3 A;  3C1D A;  1YOV B;  4G6T B;  4L9N A;  3X2Q H;  1W7P A;  3S3N A;  2X6O A;  1J59 A;  1ZRD A;  1IJW C;  3K4B A;  1GDT A;  1XMX A;  2EK5 A;  2B9S A;  2XAU A;  3KFW X;  1W0U A;  3DLA A;  3MCZ A;  2LMD A;  1LVA A;  1VQ6 I;  2CJJ A;  4A69 C;  2A69 F;  2MA3 A;  3LFK A;  3TW7 A;  2K02 A;  4XLC A;  5BPD A;  2E2J J;  4UHT A;  4Q4Z F;  1FZP B;  3FMR A;  4KUM A;  5D5X B;  3PIO F;  2M5W A;  3PQJ A;  2DK5 A;  1R7J A;  4FET A;  2JSC A;  2HTJ A;  3TW6 A;  2BOL A;  2O61 A;  2LY9 A;  4ESF A;  2R7Q A;  3BP8 A;  4MHG A;  1WFX A;  1G3T A;  1SMT A;  3WGG A;  5DCF A;  4BAC A;  1ON1 A;  3K7A J;  2V1X A;  1V5G A;  2I10 A;  3OS0 A;  5ED4 A;  2XAF A;  3C3W A;  3GME A;  4AD9 A;  2MD5 A;  4II3 A;  3DWL E;  1HCR A;  3GW2 A;  4L0Z B;  1XPX A;  2E34 A;  1ZR4 A;  3CD6 I;  5GAE J;  1O57 A;  2RC4 A;  3IH3 A;  3FM3 A;  1UHW A;  1RES A;  3VYR B;  3JR9 A;  3FZV A;  4LLG F;  4FX0 A;  4U0Y A;  4M3G A;  1DPU A;  3E6M A;  2JUC A;  1Z6T A;  5D6F A;  4ASN A;  1B9N A;  3G1O A;  2HYF A;  4PK4 A;  1FT9 A;  2H1L A;  3GTQ J;  3ML6 A;  3E5U A;  4E7K A;  1AU7 A;  1HW5 A;  3J81 Z;  1DU6 A;  1I39 A;  5IT3 A;  3A1Y A;  2GWR A;  1FBU A;  1REP C;  2AHQ A;  5DD8 A;  3K6G A;  3CF5 F;  3DF8 A;  4M6X A;  1WCM J;  1P92 A;  4IXA A;  1QGP A;  3FX3 A;  2GBY A;  5HDN A;  2J5P A;  5DM7 F;  2IA1 A;  2Z99 A;  1KQ0 A;  3BY6 A;  1FSH A;  2QSG X;  2QGU A;  3LSG A;  2CFO A;  3Q3S A;  1S29 A;  2DI3 A;  5H20 A;  5M5W J;  1KQ9 A;  4HX4 A;  5B1B H;  2HFH A;  3HGG A;  1G3S A;  2K9S A;  5JVG F;  2W00 A;  5LD2 C;  1U8R A;  5GPA A;  5LFA A;  1X19 A;  2HZT A;  3EUA A;  1X2M A;  3OV8 A;  1ONV A;  1FJL A;  2DMN A;  2LNB A;  4MQ9 F;  1J0R A;  2E7W A;  3BG5 A;  1IRZ A;  1JGS A;  4D5F A;  4WCG A;  4XON A;  2RRE A;  4OWR B;  2LDU A;  5GAG J;  1B6A A;  2EFW A;  1E3H A;  4YII A;  3CES A;  1RC9 A;  2OTJ I;  4MNU A;  4A3G J;  2D5V A;  1P4W A;  3H36 A;  1HKS A;  2LG4 A;  1XSX A;  1GHC A;  4ENM A;  3ZGK A;  4ZDL A;  3PNV A;  1WJB A;  4KIS A;  2VE9 A;  1XTA A;  4PUS A;  4G8X A;  3FK6 A;  3LOC A;  4XBF A;  5E3M A;  1TZL A;  5LEK A;  2ZO4 A;  4BAY A;  1Z7U A;  2GIZ A;  1ZG1 A;  4P1W A;  2WAQ A;  1P7J A;  4HNU A;  4BS9 A;  3CCJ I;  4UNO A;  1BI3 A;  2XB5 A;  3ZMU A;  5TRD A;  1EH8 A;  3CMA I;  3N4M A;  1MMN A;  3CCM I;  3S1M J;  3JSO A;  2F5V A;  2IT0 A;  3ASO H;  5M3F J;  4DIQ A;  1HF0 A;  1G4D A;  4CDG A;  1CQT A;  4Y33 A;  1Z91 A;  3BT9 A;  3TO9 A;  1X2N A;  3DBR B;  2RN7 A;  2DOD A;  1E3P A;  4TV7 A;  2PX9 A;  2LK2 A;  3R4K A;  4XIC A;  5FB2 A;  4XRS G;  2FUG 2;  4RAG A;  4XN0 A;  1T95 A;  1Y0N A;  3SYT A;  1MH3 A;  3FXU A;  4OAZ A;  5HS9 A;  3W6J B;  4G7Z F;  2EJR A;  3BTI A;  2LRD A;  3HOV J;  3GWZ A;  3P9K A;  5F1J A;  1BJA A;  5HVQ C;  1VFC A;  2OQG A;  4L5E A;  2LBF A;  3ABT A;  5M3M J;  1V4R A;  1JTY A;  1MBF A;  4F3Q A;  3QU6 A;  1LKX A;  2K4B A;  3HGY A;  2IW5 A;  1I3A A;  4LK0 F;  4IHV A;  2IGK A;  1LDD A;  1ZKG A;  4KIB A;  4ZH4 F;  2VKD A;  1ZHF A;  1OYY A;  1A35 A;  3MKW B;  5F0C A;  2K9M A;  4LK1 F;  4XQF A;  2H1K A;  1T08 B;  2ID3 A;  4J19 A;  2GM4 A;  3ZQQ A;  3BTC A;  1KZH A;  4BXF A;  2ADU A;  4OIR F;  3PFY A;  1AA7 A;  4GYG A;  4HST A;  3QYE A;  2H09 A;  3LL7 A;  1T98 A;  1XG1 A;  3JRB A;  1IW7 F;  4IZZ A;  2HS5 A;  1ITY A;  3DP7 A;  2NNN A;  2NVQ J;  2HQN A;  1MIJ A;  3HSF A;  4HRI A;  3CJR B;  3DV8 A;  3L2R A;  1G3W A;  5J3L A;  3CCV I;  2BZT A;  3OYL A;  2IS6 A;  2E7X A;  4UB6 C;  4Q5S F;  2Y9Z A;  5F27 A;  2R7T A;  2CW8 A;  4A0Z A;  3BRO A;  1EA3 A;  2D1H A;  3G4S I;  4E7L A;  1WVR A;  3M8J A;  4RB0 A;  4UUV A;  3OYF A;  4EQQ A;  1ZGW A;  3A01 A;  1E0E A;  2N8G A;  1ZAR A;  4V19 K;  3LNQ A;  2E71 A;  4JX6 A;  3IUO A;  3HPH A;  3RI4 A;  2LF8 A;  2Q2E B;  4BY1 J;  3FXR A;  1WHU A;  1MBK A;  3MQ0 A;  4EM2 A;  3FMS A;  3TKY A;  3SJM A;  1IUY A;  1K4T A;  4WXH A;  2YSR A;  5IOZ A;  2HYJ A;  5TJJ A;  2AXL A;  2R7V A;  1X1C A;  3LSK A;  1SC7 A;  2QSF X;  3QOE A;  3V8K A;  3I4N J;  2EIK H;  2PJR A;  4CCJ A;  1X3Z B;  1CGP A;  1KU9 A;  3G1M A;  1VQ5 I;  4IHX A;  2HNH A;  3QYB A;  1TLH B;  1XGO A;  4V2G A;  3JAM K;  2H94 A;  1FLI A;  4RLQ A;  3ZP5 A;  1FP2 A;  3HTU A;  4JYK A;  3FBI B;  5GTH C;  3OYB A;  1TP4 A;  3W6V A;  5E8I A;  3KCC A;  4AVP A;  3WG9 A;  2BHZ A;  1CF7 B;  2FRH A;  1BN5 A;  2E19 A;  3DBH B;  1WJC A;  4LLN A;  1W4M A;  1WPK A;  1G3Y A;  2EBI A;  2ZME B;  2G7U A;  2JRM A;  4GDF A;  4FCY A;  4C2M J;  4IO9 F;  2W4S A;  2V6C A;  2KHM A;  4CA0 A;  4AIJ A;  5DV5 A;  5DEQ A;  4DJA A;  2RDP A;  1FOY A;  3KZY A;  4FTH A;  4HLX A;  4B4C A;  3JRH A;  2GA2 A;  2WB1 N;  1K4S A;  2JT1 A;  1YIO A;  2LY1 A;  5F6F A;  3DPL C;  4XLP F;  5DUI A;  5EG0 A;  3MKY B;  1O3T A;  3EDP A;  3V8J A;  1MMD A;  2OAZ A;  5D8K B;  1SD4 A;  4M3E A;  3DPT A;  4MLO A;  4KT5 C;  3HRS A;  1LEB A;  1S72 I;  2A61 A;  3QPT A;  4EM1 A;  3AKZ A;  4BKX A;  3I58 A;  2IXS A;  3NWT A;  2QYO A;  1Z0X A;  2DOA A;  2VBY A;  3FXO A;  5CQE A;  5CYV A;  4DW6 A;  5FFZ A;  4C2U A;  4M74 A;  3GLL A;  5TGT A;  4LLL A;  4HAM A;  2ZCW A;  4I0A A;  5FGM A;  1BW5 A;  2Y75 A;  1UMQ A;  4BEH A;  2ISZ A;  2KLO A;  2HU9 A;  4DNC A;  2M0C A;  2EIN H;  2DJI A;  1WGX A;  2X1D A;  3A03 A;  3C2G A;  2CQX A;  2CG4 A;  1TT0 A;  1JJ8 C;  1D5Y A;  3IP4 B;  2FU4 A;  2OCC H;  3G2B A;  4CO8 A;  2F4I A;  2G0E A;  4F7Z A;  4G94 A;  4XKC A;  1IO2 A;  3WHC A;  2QF7 A;  1UB9 A;  4BJ5 C;  2DA5 A;  1X1P A;  4BDY A;  2R5Z B;  1ETY A;  2O6G E;  4LG0 A;  1FIP A;  3S2W A;  1T8I A;  4OMZ A;  1MMA A;  3KYD B;  4RAZ A;  1QZY A;  2LR8 A;  2ZKZ A;  3DEU A;  1I6H J;  1JHF A;  5CVJ A;  1IDY A;  1U8B A;  5EEA A;  4RGR A;  4LB5 A;  4YFN F;  4KIF A;  2XRO A;  3H3Z A;  3OR1 C;  1S5L C;  2F5C A;  2HQR A;  2DMQ A;  3BTL A;  1BI2 A;  5FRM A;  5IYB J;  4HNT A;  3E0J B;  2PBI A;  1LFB A;  3RKX A;  4N9H A;  4A3M J;  3AG1 H;  1QRY A;  2CW0 F;  2ZXI A;  2RVC A;  5CPR B;  3KIO A;  4UVC A;  1PJR A;  5CKT A;  2RQQ A;  3SXY A;  3EET A;  2R7O A;  4A3J J;  3FDY A;  2K9N A;  1KU2 A;  1UCR A;  2CW7 A;  3BQZ A;  3M1E A;  2DXI A;  2PI0 A;  1VF9 A;  3FHN A;  1K78 B;  3B73 A;  4QTR A;  5C3E J;  1H89 C;  4ENK A;  2KP6 A;  4XLH A;  2FOW A;  2RNJ A;  2ZNZ A;  2R7D A;  3S1R J;  3OIO A;  2KKO A;  3NAU A;  3HYI A;  3NQO A;  5AIP A;  1OQY A;  2EV6 A;  2GOM A;  4RGS A;  1JUP A;  3KPH A;  2EFN A;  2FSW A;  2EZK A;  3KP3 A;  3E6C C;  4EGY A;  4R1H A;  2CH0 A;  2FQ4 A;  1WQ2 A;  3ZMS A;  3AG4 H;  2BY3 A;  3J7A O;  2EQR A;  2FNA A;  2QQ8 A;  5FKN A;  3ZR8 X;  1Y8Q B;  2XC7 A;  4CH7 A;  5E1W A;  4E4H A;  3QP6 A;  4KIG A;  1FSE A;  2V26 A;  1XMA A;  3VSK A;  1ZG3 A;  1YW9 A;  1J2X A;  4BJT A;  2XIG A;  3R60 A;  4AUX A;  2HWV A;  1I1S A;  1U78 A;  2M4K A;  1EH7 A;  4PJ0 C;  1R23 A;  3DKY A;  4P9U A;  1Z3X A;  4CIC A;  3V7S A;  1FMW A;  5D6E A;  5BS6 A;  2HZD A;  5EZG A;  3ZCO A;  2BBY A;  3RYR A;  2CUE A;  2P81 A;  5J40 A;  2GXG A;  2VXD A;  3GTL J;  3P9I A;  1ZTR A;  1ZQ3 P;  3LFU A;  3BTJ A;  2V9V A;  3CP8 A;  3PL8 A;  1D0Z A;  3F6O A;  4L5I A;  3ESW B;  1D1C A;  2ZSH B;  2NVU B;  4M73 A;  1YO5 C;  2VXZ A;  2F4M B;  4UXN A;  4NC6 A;  4MTD A;  2PMZ A;  3OYM A;  2E35 A;  1K61 A;  2CUF A;  1Z1D A;  2WAE A;  4YEJ A;  4A3K J;  2V9P A;  2VUM J;  3BPX A;  1LDK B;  4G7H F;  3CUQ A;  1IN7 A;  2HQ5 A;  2JPB A;  2IGM A;  2LF7 A;  2OZU A;  4B48 A;  3L09 A;  5LHH A;  4U7B A;  4E7Z A;  3FBN B;  3KZZ A;  4FE4 A;  1D0X A;  5EGO B;  1I3Q J;  4LGW A;  2QBY B;  4GGG A;  4EEF G;  2YU9 J;  2WC2 A;  1I50 J;  4Z2Y A;  2O0Y A;  4CZC A;  3BZC A;  1W5T A;  1OLT A;  2QVO A;  2ZJQ F;  2KRF A;  1R5H A;  2KZG A;  3CCL I;  3L9F A;  3F72 A;  3GO5 A;  3S8P A;  3ONQ A;  4E7I A;  1IDZ A;  3S3M A;  2F5D A;  2QZ8 A;  5FO5 A;  3WTV C;  3TOA A;  1J7K A;  3LQQ A;  3H9Q A;  2R5Y B;  4NUB A;  3BZK A;  3M07 A;  5K7H A;  1Z3Y A;  3DTE A;  4IPA A;  1IV8 A;  4A3C J;  4DQ2 A;  4BY7 J;  3TBI A;  2MG4 A;  4LIT A;  3CO7 C;  5GTI C;  2CQK A;  3L2V A;  3A2K A;  4FE7 A;  3F8B A;  4A2U A;  3K4L A;  5D5V B;  1G2H A;  1FNN A;  3WE2 A;  3ECO A;  4HA8 A;  4B8X A;  3H0D A;  2HTS A;  4QSH A;  3I59 A;  5JLX A;  1EV7 A;  1IGN A;  4Y4R A;  1F1Z A;  1U5T C;  2HXO A;  3ZMV A;  1HKT A;  5KAF C;  3K0L A;  2FNP A;  2UV1 A;  4G6Q A;  4II2 A;  2DTZ A;  4XNF A;  1R4N B;  1O3R A;  1IRG A;  1Z9C A;  2BY0 A;  3EUK L;  1DGW Y;  3OY9 A;  3O6B B;  3OL4 A;  5FKL A;  3OYA A;  1WJA A;  2DDB A;  3ZQH A;  5FD5 A;  4J01 A;  3KEQ A;  2XRN A;  1W5C C;  3A02 A;  4ZZL A;  5B3S H;  4EJT A;  1P7I A;  1Q1H A;  4XRF A;  2XKO A;  1D1A A;  4CGZ A;  2VC1 A;  2RV8 A;  3O8H A;  4JX5 A;  4FX4 A;  1RIO H;  1OKR A;  4EJU A;  3ZQC A;  1LDJ A;  1WI3 A;  4F92 B;  1W7P B;  3QAH A;  4U0V A;  5FLV A;  2LTP A;  4BXU A;  1JT6 A;  2EIM H;  1Y39 A;  1JKO C;  1BR4 A;  3D5S C;  2GXA A;  5B1A H;  3J80 Z;  2I5U A;  3GZ5 A;  2P0W A;  3L2Q A;  3WTU C;  2A05 A;  1BC8 C;  3S14 J;  4XOR A;  4FAS D;  3DEE A;  2V7F A;  1O7F A;  2G9W A;  3BLY A;  3PIP F;  2HQA A;  2R93 J;  3F21 A;  3C18 A;  4P5O A;  5E3L A;  2JVH A;  2MD0 A;  2EPF A;  3CMY A;  3FM5 A;  2XGE A;  5L3F A;  1FEX A;  2MLG A;  4L18 B;  2VB6 A;  5E3O A;  3IHU A;  3B6A A;  4XID A;  1R9T J;  2PLY A;  1X1D A;  2DPU A;  3LA3 A;  2K5C A;  3GUD A;  4WXD A;  2KDZ A;  2K85 A;  1BIB A;  3K4C A;  2DA4 A;  5IPA A;  2FOK A;  3VEP A;  4X0G A;  2DT5 A;  4Y3O A;  3LQR A;  2GIV A;  1MZB A;  1S6L A;  4M9S A;  2DPD A;  2DFE A;  1HW2 A;  2DT6 A;  2VL8 A;  4OIP F;  1FPQ A;  3KLN A;  3QRF F;  1O7L A;  3QQA A;  3F3X A;  3ZMD A;  1DU0 A;  3JRC A;  2EIJ H;  4CYD A;  3DU5 A;  4HQM A;  3Q0W A;  3JSP A;  4LIU A;  2DBB A;  2PJP A;  4IHS A;  4XLN F;  4L9T A;  4OIO F;  3JRD A;  3FWE A;  3W6K B;  3M7G A;  2BYV E;  4IOA F;  4Z6Y A;  1YTY A;  4BQA A;  3GYH X;  1AKH A;  2VJJ A;  3ZMZ A;  3K4M A;  4HYE A;  3I0T A;  1PUF B;  4IRG A;  1XCB A;  2A6T A;  4YIF A;  2K3F A;  3RQ4 A;  1YW8 A;  5HLI A;  3MZY A;  2P4W A;  3I56 I;  1I1G A;  5EJC A;  1XN7 A;  3TDZ C;  1R58 A;  2DMU A;  3T5X A;  2VJI A;  4UV8 A;  1H88 C;  4A0X A;  2CMP A;  4MTE A;  2STT A;  3BJA A;  3ABL H;  2YUS A;  3I53 A;  2BEO A;  4MQV A;  2ELK A;  4XSZ F;  2HYG D;  2DQL A;  3HOS A;  3WTZ A;  3G6E I;  2ZSI B;  1R1T A;  2ZJP F;  1UAA A;  4IHY A;  1AWC A;  4HNV A;  1XCV A;  4KN7 X;  2R0Q C;  4XM3 A;  1FBS A;  1FYL A;  1Y0U A;  1MBE A;  1WJF A;  1NK2 P;  1MJ9 A;  5HS8 A;  1R49 A;  1NG7 A;  3OL3 A;  1VQL I;  2QWW A;  5HDG A;  4E7J A;  4XRS A;  2CSO A;  1IRX A;  3BR0 A;  4B3A A;  4LB6 B;  2QKM B;  2GOX B;  5F04 A;  2OJE D;  3OYJ A;  1TWG J;  3OOP A;  3K70 C;  1GXP A;  2FA5 A;  3L2W A;  2XB0 X;  3NAR A;  2WB1 A;  4N4N B;  4IX7 A;  4CUG A;  3IAS 2;  3OS2 A;  2BXZ A;  1ZRE A;  5J8F A;  2KJC A;  1FYK A;  2K4J A;  2LLK A;  2KIU A;  4Y15 A;  2V79 A;  1QBJ A;  4I99 C;  1X3U A;  2HVQ A;  4Y13 A;  2RAE A;  4ANJ A;  2E1M B;  4GXO A;  5K7Z A;  3H5R A;  3WTX C;  3ZN0 A;  1IRF A;  1TNT A;  1Z67 A;  2PMU A;  2XSD C;  3B6C A;  4NQW A;  3CUQ C;  4A3D J;  2D1V A;  4HSR A;  4Q47 A;  2LBF B;  3EYY A;  1OJL A;  3CJQ B;  3P7N A;  1DPR A;  1JHH A;  5B66 C;  4B1R A;  5FKK A;  3HHH A;  4CCM A;  2VOD A;  2W82 A;  1FWZ A;  2FD5 A;  3E3V A;  3R61 A;  1DQU A;  1YE9 A;  1JI8 A;  4XLE A;  4CYC A;  3S3O A;  1A04 A;  1YRN B;  2WWY A;  2KIM A;  2CU7 A;  4KIT B;  3J7Z I;  3VFZ A;  3FHZ A;  2H8R A;  3IWF A;  2AS5 F;  2YPR A;  1YS6 A;  2XPU A;  5KAI C;  3SHF A;  5J1Y A;  4YEL A;  2CUJ A;  2NRA C;  3BDD A;  2DDA A;  3FXK A;  2VON A;  1DUX C;  1VQ4 I;  1TWA J;  5J4V A;  4S04 A;  4P96 A;  2XGX A;  2L9S A;  1FIA A;  3ZQG A;  2UWM A;  3OYE A;  1V3F A;  2FJ1 A;  3CQZ J;  1QHH D;  2CQ7 A;  1LQ1 A;  1IZ1 A;  1KYW A;  3H1C A;  3IH4 A;  3H0G J;  5EYR A;  3FXQ A;  4IKF A;  1VQN I;  1H9G A;  3UKG A;  3SZG A;  2A6H F;  2MFZ A;  4RAF A;  2F6C A;  1TWC J;  2IAI A;  2XF5 A;  3HJE A;  5GAD J;  2Y31 A;  5JLW A;  1BJZ A;  1ZN2 A;  2X1E A;  3ZQ7 A;  4AC0 A;  3A01 B;  1BI0 A;  1LNW A;  1P4A A;  1ETW A;  2K3P A;  3JW4 A;  4HDU A;  4Y17 A;  4KMF A;  3F8F A;  5IY5 H;  1RKW A;  1WKM A;  1EH6 A;  2OD5 A;  1YHQ I;  3LST A;  2XRL A;  2NS7 A;  2HVS A;  1QZE A;  2LP0 A;  3BWG A;  1FMV A;  3HSR A;  1P6R A;  4NDL A;  5ICE A;  3W2A A;  1P9Q C;  3BR2 A;  4G12 A;  5BQT A;  4BGD A;  2ZXW H;  2XAJ A;  1YJ9 I;  3LAJ A;  1HLV A;  2PJR B;  3PSF A;  4LD5 A;  5LGT A;  4I0B A;  1VQP I;  3L2C A;  4IHT A;  2M87 A;  3E97 A;  5C4J J;  1B8I A;  3I3L A;  4NHJ A;  1GUU A;  4F91 B;  1U9O A;  5JR3 A;  4KN4 X;  3GXO A;  4I2O A;  4XOP A;  2X1C A;  3O8G A;  2JJ7 A;  3K70 D;  3GTM J;  2Y0S N;  2GXB A;  4KIC A;  1SD7 A;  3P5J A;  4BE0 A;  3CCY A;  2A68 F;  3JCU C;  1B72 A;  5H2F C;  3A0H C;  3ZXS A;  1LFU P;  4QIW N;  4HLY A;  1OCC H;  1U0J A;  3RZD J;  2W48 A;  2IJL A;  4KT6 A;  4C3J J;  4CCL A;  2E2H J;  2CV1 A;  5K5Q A;  1ZGJ A;  4BU2 A;  1NG6 A;  1MD0 A;  3IV5 A;  3HPG A;  1D1B A;  4OU0 A;  4QLC U;  2DOF A;  2P5L C;  3FIS A;  2VIX A;  4FHT A;  5DYM A;  4MEX F;  1S7E A;  1JKP C;  1ON2 A;  4I09 A;  4HZF A;  3V8L A;  1RRJ A;  4W1U A;  1LB2 A;  5ILS A;  2XDV A;  3LA2 A;  5ERI A;  2DYR H;  3MZH A;  3PJR A;  4ZTJ A;  1IC8 A;  1SAU A;  1IF1 A;  1RR7 A;  2RNG A;  1MBJ A;  2O7O A;  2XF7 A;  4E7S A;  5E17 F;  3SEQ A;  2CQQ A;  3WGH A;  1E17 A;  5EZH A;  5EG0 B;  3PNT A;  4LG3 A;  1F9N A;  1R1V A;  2NVX J;  3RQI A;  2YU3 A;  1JUS A;  1UZC A;  4ZYA A;  5IP9 J;  3HSE A;  1IN5 A;  3CP2 A;  3KP7 A;  2O5R A;  2X4H A;  4KNY A;  4BXX J;  1MH4 A;  2CFX A;  2WTE A;  5DUK A;  4RB3 C;  2XGC A;  5J1U A;  1LJ9 A;  3MMY B;  3RZO J;  2KPM A;  5A2Q K;  3CO6 C;  2HOT A;  3F0C A;  1L3L A;  1U5T A;  3CCR I;  2ISY A;  2NS8 A;  3JRG A;  3HOW J;  2VKH A;  4I76 A;  1IG7 A;  2VJ4 A;  3MAJ A;  1ACI A;  2XAQ A;  2UXN A;  1SVL A;  4MFE A;  2ETH A;  4EJW A;  1H8A C;  3BR3 A;  4BEH B;  4FT8 A;  5AIQ A;  3BJ6 A;  3OYG A;  1OCT C;  1OCR H;  3GFM A;  4DYQ A;  2FMY A;  4XOT A;  1I5Z A;  1X4P A;  4GYI A;  4E6K G;  3TP0 A;  1SFU A;  2YR2 A;  5DCM A;  4PDK A;  2O9L A;  1T6S A;  4OAY A;  4AVZ A;  2K86 A;  4LG0 B;  2L9R A;  3S1Q J;  2IS2 A;  1BBY A;  4BHB A;  4HOB A;  3NRV A;  2LRE A;  4PGG A;  1R71 A;  1R6R A;  4G9Y A;  4CSW A;  5B5E C;  2KIQ A;  2WAF A;  2LYC A;  4L5J A;  2M7B A;  3O2P E;  1YS7 A;  3CCU I;  1JKR C;  2EV5 A;  3IL2 A;  1GVD A;  1DP3 A;  2CUZ A;  3WG7 H;  1N77 A;  5JHF A;  5DTD A;  2R7F A;  3V7R A;  1Z05 A;  1X1A A;  1V5F A;  2MC3 A;  5L3C A;  3SZP A;  4RS8 A;  2L9N A;  5LRS A;  3ABU A;  4QPO A;  1Y56 A;  4NNJ A;  4D9J A;  3H3U A;  4FIS A;  1S7O A;  2QSH X;  3HEF A;  5IYC J;  1SVO A;  1TC3 C;  3S15 J;  4J00 A;  2L54 A;  3S93 A;  4NC7 A;  2L4A A;  5D4S A;  1T39 A;  5BPI A;  1M1E B;  1D3Y A;  2CO5 A;  2QQA A;  4R8H A;  3BZ6 A;  5DDG A;  4M3B A;  2ZME A;  3TO6 A;  1MNE A;  1LE8 B;  5HLH A;  2E1N A;  2IBD A;  3RTR A;  3K1N A;  1VQ7 I;  4PJM A;  4GO1 A;  3JRF A;  1EKE A;  4IOC F;  1FYM A;  1A6I A;  3JTH A;  3OMY A;  1JTX A;  3RPQ A;  4A0Y A;  4EVI A;  5FJ8 J;  1USS A;  1I27 A;  3KLO A;  2JA7 J;  4ZYH A;  1W36 C;  3D0S A;  3GFJ A;  4B44 A;  1V55 H;  2PFB A;  3GLX A;  2Y69 H;  2D45 A;  1QVT A;  2EFQ A;  3T1B A;  3D1N I;  1AHD P;  4MGR A;  1KON A;  1BOB A;  1BC7 C;  2V1U A;  2OA4 A;  1T0F C;  4KFC A;  2R7Z J;  2BVL A;  3KE2 A;  1SMY F;  4YG2 F;  2LD5 A;  2O03 A;  1MSF C;  1E3O C;  3A0B C;  1HSJ A;  3K10 A;  4U87 A;  1FP1 D;  3HZJ A;  4S05 A;  2H27 A;  3VOD A;  5L3E A;  3C7J A;  3S1N J;  5CVU A;  2K7L A;  3ASN H;  3PSI A;  4GCV A;  5K1Y A;  3TOB A;  1BIA A;  5D4R A;  3PQK A;  2RGV A;  3RCO A;  2YS9 A;  3N05 A;  3GVA A;  3IKT A;  4JBA A;  5HNF A;  4B3X A;  2ZB9 A;  1RKT A;  5J47 A;  1MDM A;  2GQQ A;  3CUO A;  3ZQF A;  2EZH A;  3CUQ B;  1F4K A;  2NS0 A;  1YIJ I;  2VOO A;  1D0Y A;  2CQN A;  4BUP A;  2WBM A;  5LGN A;  2Y0M A;  4M9Z A;  3VSL A;  1TBX A;  4I6Z A;  1V5E A;  2EIL H;  3H92 A;  2EZI A;  2FBK A;  3NEU A;  1HC8 A;  1VQK I;  1G8X A;  2E1O A;  3SQN A;  4BQO A;  2X48 A;  2C6Y A;  2EFP A;  2KT0 A;  1DGR M;  2BVM A;  5F08 A;  2W25 A;  4PJL A;  3RSN A;  3CLQ A;  2DA6 A;  2PEX A;  3EUH C;  1MJB A;  3I9V 2;  1ZR2 A;  2B0L A;  3P9C A;  2CV0 A;  1AOY A;  3DKW A;  3QPH A;  2OU2 A;  2HOS A;  1N78 A;  1A5J A;  2BGC A;  1F43 A;  2P6T A;  3A4C A;  1BR2 A;  1Z21 A;  2Y48 A;  2L7Z A;  3OYK A;  2EZL A;  4RM3 A;  1Z77 A;  1XX5 A;  4UUS A;  2FF4 A;  4H4K C;  1XGS A;  1ZK8 A;  3GEZ A;  2XAS A;  1V54 H;  4AU7 A;  4B47 A;  1FTT A;  3WU2 C;  1LUJ B;  3QPS A;  3I59 B;  5E79 C;  4DOZ A;  1TTY A;  3JAM Z;  5BOX A;  1HDP A;  2DU9 A;  2P7V B;  2M3A A;  4W97 A;  3BR1 A;  3VYS B;  4QWQ A;  3F8M A;  4PGH A;  4I02 A;  4IRH A;  6PAX A;  1SAN A;  3DU6 A;  5J1R A;  1MW7 A;  3S17 J;  4JQF A;  1B9M A;  3FKI J;  4JOM A;  2MYS A;  2MC4 A;  2VQG A;  2VQH A;  2ELH A;  3J7Y J;  2DW4 A;  2CWE A;  1GXQ A;  2XUB A;  2ZXJ A;  3OIQ A;  4RMN A;  3J81 K;  3CDI A;  5FRN A;  1F36 A;  3M8E A;  1MMS A;  1R00 A;  3L1P A;  4DBQ A;  2DAO A;  3GZ6 A;  1MSE C;  1W36 D;  1P4X A;  2BW3 A;  2CV2 A;  2DFF A;  1O3S A;  3ECH A;  1N25 A;  1JT0 A;  1NTC A;  3G71 I;  5GP9 A;  1RUO A;  2OPT A;  3SFI A;  4JK1 X;  1EJ9 A;  2ECB A;  3WE3 A;  1ZRF A;  3E1S A;  5LGU A;  4B43 A;  3GCM A;  4D5C A;  1OCP A;  2ESN A;  1TL8 A;  1SEU A;  2DOE A;  1XSD A;  2HPM A;  2CGP A;  2K9Q A;  1XMK A;  4M71 A;  1IXC A;  2HVR A;  4EJO A;  2M4G A;  2MH2 A;  3RIR A;  2L2O A;  2BV6 A;  4RBO A;  2WA0 A;  4HX7 A;  1WJE A;  2E5N A;  2EFO A;  2LSO A;  2QQ9 A;  2W85 A;  4CCN A;  1B4A A;  1IXR C;  3QPL A;  3ABM H;  3HB9 A;  4K2E A;  5FKM A;  3MD2 A;  2ZNY A;  2HI3 A;  2VT3 A;  3RPU A;  5F1R A;  2EB7 A;  4A6E A;  3HHG A;  4YIR X;  2P8T A;  4M9X A;  4HBL A;  4A5M A;  3H3V K;  5D8L B;  5LBQ A;  4JX4 A;  4A6D A;  3H5N A;  5JVT A;  3KZI C;  5FLX K;  4IEJ A;  1ZLK A;  5KHD A;  3M4O J;  2OQR A;  3W2V A;  3ZMT A;  1MJA A;  4XKB A;  2FE3 A;  4LFU A;  1Y6I A;  2W57 A;  4YFK F;  2E2I J;  3DPU A;  2L02 A;  2QUF A;  3EQL F;  3VPR A;  4A3F J;  3EYI A;  2LFB A;  2GA1 A;  3BOQ A;  2L01 A;  2LVS A;  2Z5U A;  4PSX A;  1Y1V J;  2AQE A;  1HDD C;  3D5L A;  3I54 A;  2DCE A;  4AWX B;  5IP7 J;  2H6B A;  2M34 A;  5FFX A;  4EM0 B;  1OFC X;  1TNS A;  1QVU A;  3KYC B;  3GBG A;  5E3N A;  1T2K A;  3HUG A;  2PMH A;  2YX7 A;  2VKE A;  2VBX A;  2HDW A;  2NVT J;  1MKM A;  1UHM A;  3I5U A;  4RDU A;  3KX2 A;  2K27 A;  1HW1 A;  1ODD A;  3WTY C;  3G73 A;  1K7A A;  1QNT A;  3PM1 A;  2P6S A;  2QEN A;  4M6V A;  2JA8 J;  1L0O C;  2A6E F;  3I55 I;  2DA7 A;  2HDC A;  3CCS I;  5CVR A;  1G6N A;  1TQM A;  2F2E A;  3MWM A;  4UVB A;  3PO3 J;  3HOU J;  3V7C A;  4S0H B;  3GF2 A;  1S9H A;  3GTJ J;  2LKX A;  4GRI A;  2WV1 A;  3HOT A;  5E20 A;  3C2H A;  4E7H A;  3GTK J;  4EGZ A;  3H9J A;  2LC2 A;  1KA8 A;  1XB4 A;  3FXL A;  1U9N A;  2ZME C;  3BG6 A;  3CDH A;  3GZN B;  1SD5 A;  1SFX A;  1STZ A;  3LSJ A;  2L3D A;  3KP2 A;  2Y0S A;  2L7M P;  1W1W E;  3QYF A;  2O3F A;  3BQY A;  4A3I J;  1D8J A;  3R0A A;  1YW7 A;  3OWT A;  2L7K A;  3QOP A;  4ZZD A;  2VQC A;  3W2W A;  2W24 A;  2IGN A;  4KYW A;  1Q1V A;  2F5E A;  3OYC A;  4EV0 A;  3MFK A;  1UJ8 A;  4EAT A;  4HV6 A;  2VI6 A;  1S7A A;  1SD6 A;  4ETS A;  3RYP A;  5C4X J;  5J6X A;  3O3K A;  4I98 B;  1OR7 A;  2X51 A;  4N0B A;  1FOW A;  3MKL A;  5TIS C;  4UB8 C;  1A31 A;  4RB1 A;  2KIS A;  1K6O A;  1VQM I;  4P55 A;  1SVM A;  1Y8R B;  2MGQ A;  5ILV A;  3L7W A;  2DN0 A;  3CJT B;  1NHA A;  2BY1 A;  4UVA A;  3K2Z A;  2VT2 A;  3WU0 A;  3H9G A;  4MEY F;  3E7L A;  1S3J A;  4CZZ A;  4WXC A;  4BL0 B;  3AL0 C;  4IRI A;  4C30 A;  1RET A;  2XSJ C;  4MFD A;  2EV0 A;  3HM5 A;  1YFH A;  3DCF A;  1H9T A;  1OYW A;  1ERD A;  5LHI A;  2DTR A;  2KMU A;  3CC7 I;  4OIQ F;  2IEK A;  1BL0 A;  5LRR A;  2KIF A;  3ISP A;  2B7E A;  1ETK A;  4C3H J;  2JK3 A;  2VLA A;  1UFM A;  2KQR A;  4HG2 A;  2CRG A;  1RNL A;  4NQW B;  3HTS B;  2HDD A;  5JHU A;  1FBQ A;  3LSP A;  2ZXH A;  2V4J C;  1TW2 A;  2Q0O A;  1TT5 B;  3E5Q A;  3CCQ I;  1WRJ A;  2OV7 A;  3J7A Y;  4BDZ A;  3OOU A;  4LOC A;  5CQG A;  3T8R A;  1EF4 A;  1YG2 A;  4A93 J;  3AAF A;  5BMZ A;  1VI0 A;  4EMS A;  5HDK A;  1N75 A;  3GTG J;  1OPC A;  2DT7 B;  3DTK A;  3KET A;  4H0E A;  4CYC B;  3R0J A;  2E1C A;  1UEL B;  1S8N A;  2PQ8 A;  4LMY A;  2OCE A;  2MSY A;  2PMZ N;  1YIT I;  2EA2 A;  3IAM 2;  3AG3 H;  4X1E A;  1PP7 U;  3I71 A;  2NAZ A;  4HF2 A;  3Q0V A;  2LY2 A;  1VND A; 
#chains in the Genus database with same CATH homology
 2O8X A;  4YFX F;  3CJN A;  1B1B A;  1YLF A;  3SFZ A;  2WV0 A;  2UZK A;  1P2F A;  2M45 A;  5AON A;  1IXS B;  5KVR A;  2MH9 A;  3VB2 A;  2DQR A;  2P5V A;  1WSU A;  1JE8 A;  1ZAO A;  2OZ6 A;  3KP4 A;  2A3S A;  4U88 A;  4HQE A;  3KEO A;  1T0F A;  1R5G A;  2P5K A;  4HW0 A;  4IF4 A;  1ZYR F;  1RZ4 A;  3RKW A;  3K69 A;  3MEX A;  3F8N A;  2XVC A;  4RGU A;  3GX4 X;  5FLX Z;  4B09 A;  3QU3 A;  5HLG A;  4PZJ A;  1YYV A;  4AIK A;  1FOK A;  4CXF A;  3Q5F A;  1D5V A;  1E2X A;  2QLZ A;  4HV5 A;  2RKH A;  2VBW A;  3DXJ F;  4AIH A;  1LEA A;  3IRQ A;  3WTT C;  2TDX A;  4M72 A;  1XDU A;  1PDN C;  1ULY A;  1JXS A;  3EUH A;  1GVJ A;  3REO A;  1HBX G;  5E1Z B;  5CVV A;  5ILU A;  3GFL A;  2VE8 A;  5F64 A;  3CTA A;  1Z6R A;  1WI9 A;  3K9T A;  2GZW A;  3IRR A;  3DFG A;  4BNC A;  1TQI A;  5KK1 A;  3M9A A;  3ZPL A;  2HGC A;  1ZG5 A;  2IA0 A;  2HR3 A;  1U5T B;  1BI1 A;  2PN6 A;  4KDP A;  2HKX A;  3KP5 A;  5DD4 A;  4ZYD A;  1QPM A;  2FML A;  3PFI A;  2GAU A;  3FF5 A;  3ROU A;  1U3E M;  3G3Z A;  1U6G A;  3E6D A;  5DCM B;  5IT9 K;  1R22 A;  4ZYE A;  4HF0 A;  3R6S A;  2STW A;  1H0M A;  2J5O A;  1KGS A;  2Z33 A;  2A5Y B;  4EJV A;  2XAH A;  4L9V A;  4G7O F;  4BH9 A;  1PP8 F;  4O6J A;  1BOA A;  2CYY A;  4P9F A;  2ZFW A;  1ZRC A;  4XSX F;  4BHP A;  1IN8 A;  2NYX A;  3WTW C;  4NB5 A;  2M1B A;  4ON0 A;  1D8K A;  2XHK A;  2R3S A;  4KA4 A;  2HKO A;  1TQP A;  3VOE A;  4O3M A;  5JFR A;  2IP2 A;  1FY7 A;  4LJZ F;  2MBF A;  5CJ9 A;  2LKP A;  2Q2E A;  3COA C;  1XDS A;  4ZYG A;  3WGI A;  4WF2 A;  2IPQ X;  2ESH A;  5L3D A;  2Q8K A;  1VTN C;  1ZLJ A;  2V1D A;  4G6D A;  4WX9 A;  3RKY A;  3WOD F;  2FXA A;  3U1D A;  1YQA A;  4N9I A;  2OBP A;  5LLQ A;  4BHC A;  2JRT A;  3GFI A;  2M8E A;  1QO0 D;  1CF7 A;  5H6R A;  2XKP A;  2XAG A;  3U2R A;  2X0L A;  4WWC A;  1OYI A;  3M8F A;  3Q9S A;  2UXX A;  1RUN A;  2BE5 F;  4BYY A;  3ULQ B;  3K1M A;  1MDM B;  3KP6 A;  3I4P A;  4A12 A;  5D5U B;  3J80 K;  1HXD A;  3ELK A;  4ENN A;  4D0P A;  4IVN A;  4UV9 A;  2RQP A;  4L9J A;  3BJO A;  3TGN A;  2ZJ2 A;  4KMU X;  4I01 A;  1W7P D;  4R79 A;  5K5O A;  1J9I A;  3TO7 A;  5E18 F;  3T0Y A;  2HOE A;  1HKQ A;  4HX8 A;  2L4M A;  3T8T A;  3N97 A;  1IN6 A;  2DK8 A;  1XGN A;  5E1X A;  2Z3Y A;  1PUE E;  3I64 A;  2IVM A;  1IN4 A;  2EA4 A;  1KYZ A;  4HDV A;  5HOO A;  5LEJ A;  2YX4 A;  3Q9V A;  2FBI A;  2VOP A;  2F5F A;  5HS7 A;  2P7C B;  1XD7 A;  4ESB A;  2COM A;  1HQC A;  1J75 A;  4ENJ A;  1XSV A;  2PG4 A;  5L3G A;  5E8G A;  5LHG A;  2JZY A;  4Q48 A;  1DP7 P;  3HRT A;  1T38 A;  2H6C A;  1RI7 A;  1U2W A;  3WU1 B;  4I7H A;  3U9G A;  3HRM A;  1K79 A;  2W84 A;  1W5S A;  3HRU A;  4PCQ A;  5IT9 Z;  1R36 A;  3B02 A;  1K78 A;  1BM9 A;  1UST A;  1IAW A;  3BPV A;  3IKV A;  5A2Q Z;  2IA2 A;  3WTS C;  5ICF A;  4HF1 A;  2FEZ A;  4CHU A;  1KU3 A;  1F5T A;  4RAY A;  3ERE D;  4A5N A;  2DFI A;  5D5W B;  3CLO A;  3E6B A;  2QQB A;  3F23 A;  1FX7 A;  3LA7 A;  3JTG A;  1SFE A;  4WK8 F;  4RB2 C;  2XV4 S;  2VBZ A;  3V4G A;  2NNY A;  3LAP A;  1O3Q A;  1FC3 A;  5H6Q A;  5FD6 A;  4L0Y B;  5EEG A;  2IRF G;  2MLK A;  4M6Y A;  4OIN F;  3HIF A;  2FQ3 A;  4U7D A;  1OMI A;  5K5R A;  4OMY A;  5L3B A;  3L00 A;  2DO7 A;  4IJA A;  1HST A;  1SAX A;  3SZT A;  3TQN A;  1I6X A;  3IWZ A;  2JPC A;  2VC0 A;  2M30 A;  2QBY A;  1QZZ A;  5ICC A;  1XGM A;  3DQV C;  1TW3 A;  4OOI A;  5JI6 A;  4RGX A;  2D2W A;  1DDN A;  2ZBK A;  3ZN1 A;  3K1P A;  4ESJ A;  1QQI A;  3F6V A;  3F8C A;  4U0W A;  1B59 A;  1KQ8 A;  1R1U A;  2G7H A;  2DLL A;  5CLS A;  3F22 A;  3IC7 A;  2HEO A;  3QP5 A;  1J5Y A;  2JTV A;  3RJP A;  2VN2 A;  5ICG A;  2Z9O A;  2EWN A;  3E5X A;  1ZGA A;  3LWF A;  3FMQ A;  5J8C A;  4O5V A;  2ACJ A;  1ZH5 A;  2A07 F;  3TDU C;  1KU7 A;  1MGT A;  4E70 A;  5CVI A;  1WWX A;  5EEH A;  3RDI A;  1C0W A;  2KJB A;  2FBH A;  2QM3 A;  3C1D A;  4L9N A;  1W7P A;  1J59 A;  1ZRD A;  2EK5 A;  3KFW X;  3MCZ A;  1LVA A;  2A69 F;  2MA3 A;  3LFK A;  2K02 A;  5BPD A;  4UHT A;  4Q4Z F;  1FZP B;  3FMR A;  4KUM A;  5D5X B;  2M5W A;  3PQJ A;  2DK5 A;  1R7J A;  2JSC A;  2HTJ A;  2O61 A;  4ESF A;  3BP8 A;  4MHG A;  1G3T A;  1SMT A;  3WGG A;  5DCF A;  1ON1 A;  2V1X A;  5ED4 A;  2XAF A;  3C3W A;  4AD9 A;  2MD5 A;  4L0Z B;  3GW2 A;  1O57 A;  2RC4 A;  3FM3 A;  1UHW A;  3FZV A;  4LLG F;  4FX0 A;  4U0Y A;  1DPU A;  3E6M A;  5D6F A;  1Z6T A;  4ASN A;  1B9N A;  2HYF A;  1FT9 A;  3ML6 A;  3E5U A;  1HW5 A;  3J81 Z;  5IT3 A;  2GWR A;  1FBU A;  1REP C;  5DD8 A;  3DF8 A;  4M6X A;  4IXA A;  1P92 A;  1QGP A;  3FX3 A;  5HDN A;  2J5P A;  2IA1 A;  2Z99 A;  1KQ0 A;  3BY6 A;  1FSH A;  1S29 A;  2DI3 A;  5H20 A;  1KQ9 A;  4HX4 A;  2HFH A;  1G3S A;  1U8R A;  2HZT A;  3OV8 A;  1ONV A;  2LNB A;  4MQ9 F;  1J0R A;  2E7W A;  1JGS A;  4WCG A;  2LDU A;  1B6A A;  2EFW A;  4YII A;  4MNU A;  1P4W A;  1HKS A;  1XSX A;  1GHC A;  4ENM A;  2VE9 A;  4G8X A;  4XBF A;  5LEK A;  2ZO4 A;  4BAY A;  1Z7U A;  1ZG1 A;  4UNO A;  1BI3 A;  3ZMU A;  5TRD A;  1EH8 A;  3N4M A;  3JSO A;  2IT0 A;  1G4D A;  4CDG A;  1Z91 A;  3TO9 A;  2RN7 A;  4TV7 A;  3R4K A;  5FB2 A;  3FXU A;  4G7Z F;  5HS9 A;  3W6J B;  2EJR A;  3GWZ A;  3P9K A;  1BJA A;  5HVQ C;  2OQG A;  3ABT A;  1V4R A;  3QU6 A;  2K4B A;  2IW5 A;  4LK0 F;  1LDD A;  4KIB A;  4ZH4 F;  1ZHF A;  1OYY A;  4LK1 F;  2ADU A;  4OIR F;  4GYG A;  2H09 A;  1T98 A;  1IW7 F;  2HS5 A;  3DP7 A;  2NNN A;  2HQN A;  3HSF A;  3DV8 A;  1G3W A;  2E7X A;  4Q5S F;  4A0Z A;  3BRO A;  2D1H A;  4RB0 A;  4UUV A;  4EQQ A;  1ZAR A;  3RI4 A;  2LF8 A;  3FXR A;  3MQ0 A;  4EM2 A;  3FMS A;  3TKY A;  1IUY A;  4WXH A;  2YSR A;  5TJJ A;  2AXL A;  3V8K A;  1CGP A;  1KU9 A;  1TLH B;  1XGO A;  3JAM K;  2H94 A;  1FLI A;  3ZP5 A;  1FP2 A;  3HTU A;  5E8I A;  3KCC A;  4AVP A;  3WG9 A;  1CF7 B;  2FRH A;  1BN5 A;  4LLN A;  1W4M A;  1G3Y A;  2ZME B;  2G7U A;  4AIJ A;  2V6C A;  5DV5 A;  5DEQ A;  2RDP A;  3KZY A;  4HLX A;  2GA2 A;  2JT1 A;  1YIO A;  4XLP F;  5F6F A;  3DPL C;  5DUI A;  1O3T A;  3EDP A;  3V8J A;  5D8K B;  2OAZ A;  1SD4 A;  3DPT A;  4KT5 C;  3HRS A;  1LEB A;  2A61 A;  3QPT A;  4EM1 A;  3I58 A;  2QYO A;  2VBY A;  5CYV A;  5FFZ A;  4M74 A;  4LLL A;  4HAM A;  2ZCW A;  4I0A A;  5FGM A;  2Y75 A;  2ISZ A;  4DNC A;  2CG4 A;  2FU4 A;  4CO8 A;  4F7Z A;  4G94 A;  1UB9 A;  2O6G E;  4LG0 A;  3S2W A;  4OMZ A;  4RAZ A;  1QZY A;  2ZKZ A;  3DEU A;  1JHF A;  5CVJ A;  4RGR A;  4LB5 A;  4YFN F;  4KIF A;  2XRO A;  3H3Z A;  2F5C A;  2HQR A;  1BI2 A;  2PBI A;  3RKX A;  4N9H A;  2CW0 F;  2RVC A;  4UVC A;  3SXY A;  3EET A;  1KU2 A;  1UCR A;  3M1E A;  2PI0 A;  1K78 B;  3B73 A;  4ENK A;  2RNJ A;  2ZNZ A;  2R7D A;  2KKO A;  3NQO A;  3HYI A;  5AIP A;  2EV6 A;  4RGS A;  2EFN A;  2FSW A;  3KP3 A;  3E6C C;  4EGY A;  4R1H A;  3ZMS A;  1WQ2 A;  3J7A O;  2FNA A;  5E1W A;  3QP6 A;  4KIG A;  1FSE A;  1XMA A;  1ZG3 A;  1YW9 A;  1J2X A;  2XIG A;  3R60 A;  2HWV A;  1I1S A;  1U78 A;  1EH7 A;  1R23 A;  4P9U A;  4CIC A;  3V7S A;  5D6E A;  5BS6 A;  2BBY A;  3RYR A;  2GXG A;  3P9I A;  2V9V A;  3F6O A;  4L5I A;  4M73 A;  1YO5 C;  2VXZ A;  4UXN A;  4MTD A;  1Z1D A;  3BPX A;  1LDK B;  4G7H F;  1IN7 A;  2JPB A;  3CUQ A;  2LF7 A;  2OZU A;  3L09 A;  5LHH A;  4U7B A;  3KZZ A;  4LGW A;  2QBY B;  4GGG A;  2WC2 A;  4Z2Y A;  2O0Y A;  1W5T A;  2QVO A;  2KRF A;  1R5H A;  3L9F A;  3F72 A;  3GO5 A;  2F5D A;  2QZ8 A;  5FO5 A;  3WTV C;  3TOA A;  1J7K A;  3LQQ A;  4IPA A;  4DQ2 A;  3CO7 C;  2CQK A;  3F8B A;  4A2U A;  5D5V B;  1FNN A;  3WE2 A;  3ECO A;  4HA8 A;  4B8X A;  2HTS A;  3I59 A;  1EV7 A;  1F1Z A;  1U5T C;  3ZMV A;  1HKT A;  3K0L A;  2FNP A;  4G6Q A;  1O3R A;  1IRG A;  1Z9C A;  3O6B B;  5FD5 A;  3KEQ A;  2XRN A;  4ZZL A;  4EJT A;  1Q1H A;  4XRF A;  2XKO A;  4CGZ A;  2VC1 A;  2RV8 A;  1RIO H;  4FX4 A;  1OKR A;  4EJU A;  1LDJ A;  1W7P B;  3QAH A;  4U0V A;  4BXU A;  3J80 Z;  3GZ5 A;  3WTU C;  1BC8 C;  1O7F A;  2G9W A;  3F21 A;  3C18 A;  4P5O A;  3FM5 A;  5L3F A;  2MLG A;  4L18 B;  3IHU A;  2PLY A;  2DPU A;  3LA3 A;  4WXD A;  3GUD A;  1BIB A;  2FOK A;  3VEP A;  2DT5 A;  3LQR A;  2GIV A;  1MZB A;  1S6L A;  4M9S A;  2DPD A;  1HW2 A;  4OIP F;  1FPQ A;  3KLN A;  3QRF F;  1O7L A;  3F3X A;  3ZMD A;  4CYD A;  4HQM A;  3JSP A;  2DBB A;  2PJP A;  4IHS A;  4XLN F;  4L9T A;  4OIO F;  3FWE A;  3W6K B;  3M7G A;  2BYV E;  1YTY A;  4BQA A;  3GYH X;  3ZMZ A;  4HYE A;  3I0T A;  4IRG A;  1XCB A;  4YIF A;  1YW8 A;  5HLI A;  3MZY A;  2P4W A;  1I1G A;  1XN7 A;  3TDZ C;  1R58 A;  3T5X A;  4UV8 A;  4A0X A;  4MTE A;  2STT A;  3BJA A;  3I53 A;  4XSZ F;  2BEO A;  4MQV A;  2HYG D;  2DQL A;  3HOS A;  3WTZ A;  1R1T A;  1AWC A;  1XCV A;  4KN7 X;  1FBS A;  1FYL A;  1Y0U A;  1MJ9 A;  5HS8 A;  2QWW A;  5HDG A;  2CSO A;  4LB6 B;  3OOP A;  1GXP A;  2FA5 A;  1ZRE A;  5J8F A;  2KJC A;  1FYK A;  2K4J A;  2KIU A;  4Y15 A;  2V79 A;  1QBJ A;  1X3U A;  4Y13 A;  4GXO A;  3WTX C;  3ZN0 A;  1IRF A;  1TNT A;  2PMU A;  4NQW A;  3CUQ C;  2D1V A;  4Q47 A;  3EYY A;  3P7N A;  1DPR A;  1JHH A;  3HHH A;  2VOD A;  1FWZ A;  3E3V A;  3R61 A;  1A04 A;  2WWY A;  2KIM A;  3VFZ A;  3FHZ A;  3IWF A;  2AS5 F;  2YPR A;  1YS6 A;  3SHF A;  2NRA C;  3BDD A;  2VON A;  1DUX C;  4S04 A;  4P96 A;  2XGX A;  2UWM A;  1V3F A;  1LQ1 A;  1IZ1 A;  1KYW A;  3FXQ A;  1H9G A;  2A6H F;  1ZN2 A;  3ZQ7 A;  1BI0 A;  1LNW A;  1P4A A;  4HDU A;  3JW4 A;  4Y17 A;  4KMF A;  3F8F A;  1WKM A;  1EH6 A;  2OD5 A;  3LST A;  3BWG A;  3HSR A;  1P6R A;  5ICE A;  5BQT A;  2XAJ A;  3LAJ A;  4LD5 A;  5LGT A;  4I0B A;  3L2C A;  4IHT A;  2M87 A;  3E97 A;  4NHJ A;  5JR3 A;  4KN4 X;  3GXO A;  4I2O A;  2GXB A;  4KIC A;  1SD7 A;  2A68 F;  4HLY A;  2IJL A;  5K5Q A;  1ZGJ A;  1MD0 A;  4OU0 A;  4QLC U;  2P5L C;  4FHT A;  5DYM A;  4MEX F;  1ON2 A;  4I09 A;  4HZF A;  3V8L A;  1LB2 A;  5ILS A;  3LA2 A;  5ERI A;  3MZH A;  1IF1 A;  5E17 F;  1E17 A;  3WGH A;  1F9N A;  1R1V A;  2YU3 A;  3HSE A;  1IN5 A;  3KP7 A;  2X4H A;  4KNY A;  2CFX A;  4RB3 C;  2WTE A;  5DUK A;  1LJ9 A;  5A2Q K;  3CO6 C;  1L3L A;  1U5T A;  2ISY A;  3MAJ A;  2XAQ A;  2UXN A;  2ETH A;  4EJW A;  4FT8 A;  5AIQ A;  3BJ6 A;  3GFM A;  2FMY A;  1I5Z A;  4GYI A;  1SFU A;  2YR2 A;  5DCM A;  4PDK A;  1T6S A;  2K86 A;  4LG0 B;  1BBY A;  4BHB A;  4HOB A;  3NRV A;  4PGG A;  4G9Y A;  4L5J A;  3O2P E;  1YS7 A;  2EV5 A;  3IL2 A;  2R7F A;  3V7R A;  1Z05 A;  2MC3 A;  5L3C A;  3SZP A;  4RS8 A;  5LRS A;  3ABU A;  3H3U A;  1S7O A;  2L54 A;  1T39 A;  5D4S A;  2L4A A;  5BPI A;  1D3Y A;  2CO5 A;  2QQA A;  4R8H A;  3BZ6 A;  5DDG A;  2ZME A;  3TO6 A;  5HLH A;  2E1N A;  3RTR A;  3K1N A;  4GO1 A;  1FYM A;  3JTH A;  3RPQ A;  4EVI A;  4A0Y A;  1USS A;  1I27 A;  3KLO A;  4ZYH A;  3D0S A;  3GFJ A;  2PFB A;  3GLX A;  2D45 A;  2EFQ A;  3T1B A;  4MGR A;  1BC7 C;  2V1U A;  2OA4 A;  4KFC A;  3KE2 A;  1SMY F;  4YG2 F;  2O03 A;  1HSJ A;  1FP1 D;  4S05 A;  2H27 A;  3VOD A;  5L3E A;  3C7J A;  5CVU A;  2K7L A;  4GCV A;  5K1Y A;  3TOB A;  1BIA A;  5D4R A;  3PQK A;  2RGV A;  3GVA A;  3IKT A;  4JBA A;  1MDM A;  2GQQ A;  3CUO A;  3CUQ B;  1F4K A;  2NS0 A;  2VOO A;  5LGN A;  2Y0M A;  4M9Z A;  1TBX A;  3H92 A;  2FBK A;  3NEU A;  3SQN A;  2C6Y A;  2EFP A;  2W25 A;  2PEX A;  1MJB A;  2B0L A;  3P9C A;  1AOY A;  3DKW A;  3QPH A;  2OU2 A;  2BGC A;  2P6T A;  2Y48 A;  2FF4 A;  1XGS A;  3GEZ A;  2XAS A;  3I59 B;  3JAM Z;  1TTY A;  5BOX A;  2DU9 A;  2P7V B;  4QWQ A;  3F8M A;  4PGH A;  4I02 A;  4IRH A;  6PAX A;  4JQF A;  1B9M A;  2ELH A;  2DW4 A;  2CWE A;  1GXQ A;  2XUB A;  2ZXJ A;  3J81 K;  3M8E A;  1R00 A;  2DAO A;  3GZ6 A;  1P4X A;  1O3S A;  3ECH A;  1RUO A;  4JK1 X;  3WE3 A;  1ZRF A;  5LGU A;  2ESN A;  1XSD A;  2CGP A;  4M71 A;  1XMK A;  1IXC A;  4EJO A;  3RIR A;  2MH2 A;  2BV6 A;  4HX7 A;  2EFO A;  2LSO A;  2QQ9 A;  2W85 A;  1B4A A;  1IXR C;  4K2E A;  2ZNY A;  2VT3 A;  3RPU A;  5F1R A;  2EB7 A;  4A6E A;  3HHG A;  2P8T A;  4M9X A;  4HBL A;  4A5M A;  5D8L B;  5LBQ A;  4A6D A;  5JVT A;  5FLX K;  1ZLK A;  2OQR A;  3ZMT A;  1MJA A;  2FE3 A;  4LFU A;  2W57 A;  4YFK F;  2L02 A;  2QUF A;  3EQL F;  3EYI A;  2GA1 A;  3BOQ A;  2L01 A;  2Z5U A;  3D5L A;  3I54 A;  4AWX B;  2H6B A;  5FFX A;  4EM0 B;  1TNS A;  1T2K A;  3HUG A;  2PMH A;  2YX7 A;  2VBX A;  1MKM A;  1UHM A;  3I5U A;  3G73 A;  2K27 A;  1HW1 A;  1ODD A;  3WTY C;  1K7A A;  1QNT A;  2P6S A;  2QEN A;  1L0O C;  2A6E F;  2HDC A;  5CVR A;  1G6N A;  1TQM A;  2F2E A;  3MWM A;  4UVB A;  3V7C A;  3GF2 A;  3HOT A;  5E20 A;  4EGZ A;  1KA8 A;  1XB4 A;  3CDH A;  1SD5 A;  1SFX A;  1STZ A;  2L3D A;  3KP2 A;  2O3F A;  1D8J A;  3R0A A;  1YW7 A;  3QOP A;  4ZZD A;  2W24 A;  4KYW A;  2F5E A;  4EV0 A;  3MFK A;  4HV6 A;  1S7A A;  1SD6 A;  4ETS A;  3RYP A;  5J6X A;  3O3K A;  4I98 B;  1OR7 A;  4N0B A;  4RB1 A;  1K6O A;  4P55 A;  5ILV A;  3L7W A;  1NHA A;  4UVA A;  3K2Z A;  2VT2 A;  3WU0 A;  4MEY F;  1S3J A;  4CZZ A;  4WXC A;  4IRI A;  2EV0 A;  1H9T A;  1YFH A;  1OYW A;  5LHI A;  2DTR A;  4OIQ F;  5LRR A;  2KIF A;  3ISP A;  1UFM A;  1RNL A;  3HTS B;  5JHU A;  1FBQ A;  1TW2 A;  2Q0O A;  3E5Q A;  1WRJ A;  3T8R A;  1YG2 A;  3AAF A;  5BMZ A;  4EMS A;  5HDK A;  1OPC A;  3KET A;  4H0E A;  3R0J A;  2E1C A;  1S8N A;  2PQ8 A;  4LMY A;  2EA2 A;  1PP7 U;  3I71 A;  2NAZ A;  4HF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...