2O6GE

Crystal structure of irf-3 bound to the interferon-b enhancer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Atomic Model of the Interferon-beta Enhanceosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords interferon-b enhancer
total genus 17
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2o6gE01
4QLCU 1BI0A 5FLXK 3SZTA 3E97A 5H20A 1FT9A 1X3UA 5BMZA 2KRFA 2EA2A 3HRUA 2ESHA 4WX9A 1O3TA 1UHWA 3FF5A 2VBYA 5E20A 4HAMA 3GUDA 2ADUA 4NQWA 2KKOA 4BNCA 4OMZA 2CGPA 2VE8A 5DD8A 3E6DA 2XKPA 1W7PD 5LHGA 3N97A 5ICGA 3BY6A 2QENA 3TDUC 3JTHA 2KJCA 2KIMA 1YW9A 1W5TA 5FFXA 3SFZA 3DXJF 4OINF 2RGVA 5L3EA 3NRVA 2ZMEB 1IN5A 4LB6B 4PGGA 1L0OC 4BH9A 2FQ3A 2VODA 4EJUA 3FXRA 1P4XA 1RI7A 4KICA 4HDUA 2G7UA 1EH6A 3CUQC 2M8EA 3V4GA 4DQ2A 4EGZA 1F1ZA 2FBIA 1YO5C 5LHIA 1FYLA 2QQ9A 2NRAC 3BPXA 4AIJA 2HQNA 1BC7C 2A07F 2L01A 2PBIA 3KEOA 4EV0A 4LG0A 4M71A 3BJAA 1QGPA 1GHCA 3L9FA 2XAFA 4EJOA 2PLYA 5IT9Z 1IF1A 1Y0UA 1XMAA 3P9CA 4EMSA 4RB1A 3HSRA 4KN7X 1CGPA 3N4MA 5LLQA 4UVAA 3ROUA 3DF8A 3BJOA 1R5GA 1MJAA 2H94A 3SXYA 4P96A 4KIBA 1G6NA 1FYKA 5JHUA 4HBLA 1MDMB 3GYHX 2P6TA 4WXHA 1O3RA 1HSJA 3QPHA 4PCQA 2YX7A 1J0RA 1S3JA 5LGUA 1U3EM 3GXOA 4IVNA 1WWXA 2CG4A 5LGNA 3MWMA 1UB9A 4GO1A 4ESFA 2GQQA 4ZYDA 3FZVA 4XSZF 2J5OA 2FSWA 5DCFA 3WTVC 5E1XA 3W6JB 1QO0D 4ZZLA 1ONVA 2MA3A 1SMTA 1WRJA 4ZH4F 4A2UA 4MHGA 4LJZF 4IF4A 2CSOA 4RAYA 2HDCA 1SAXA 5E8GA 3MCZA 4EM0B 1I27A 2Y48A 5TJJA 2EFNA 3P7NA 3C18A 1XGSA 1J9IA 4R79A 3TDZC 4BHBA 4A0ZA 3G73A 1LDKB 1XCVA 4S04A 3DQVC 1YQAA 2XUBA 3RTRA 1LVAA 3T0YA 3M8EA 3Q9SA 1TQPA 1P92A 1FNNA 4LLLA 2Q0OA 1ZRDA 1JHFA 4IRHA 4A5NA 3TO6A 3V8KA 3J80Z 5HS9A 5HDNA 4U0VA 2DI3A 2ZJ2A 4B8XA 4LFUA 1HW5A 3WTUC 2E1CA 2Z33A 1FX7A 2ZBKA 3V7CA 3C1DA 3I59B 3LQQA 2YU3A 3WODF 4JBAA 4HF1A 4A12A 2EA4A 2ZMEA 3ZQ7A 1HW2A 2BYVE 4WWCA 2G9WA 4MTEA 5CVVA 1OKRA 1O3SA 4CDGA 3QU3A 4NB5A 1R7JA 1XSXA 1J7KA 3O6BB 2M1BA 5HLHA 2L54A 3EQLF 3I71A 3KP5A 2QYOA 2A61A 4CHUA 1USTA 3BWGA 5DDGA 4O6JA 3MFKA 3HRMA 2EFWA 3TQNA 1W5SA 2HGCA 2GA1A 3ABTA 1R58A 2X4HA 3D0SA 3REOA 2L3DA 1SFXA 1S8NA 4L5IA 4HV6A 2P8TA 1J5YA 4WCGA 4OOIA 1YTYA 1ON1A 2OZUA 2PMUA 2OQRA 2GXGA 4UHTA 4EVIA 4MQ9F 4HX8A 1J59A 2RNJA 3I58A 1TW3A 4EGYA 2GIVA 4HX4A 5LRSA 4MNUA 2Y75A 2FE3A 4M6XA 1XGOA 2GZWA 3M7GA 4IHSA 4M9SA 3RPUA 3IWZA 1CF7B 4A6EA 4CGZA 2IA2A 3I0TA 4RB0A 3JAMK 3WGIA 3K1NA 4CYDA 2XAGA 2WTEA 2IRFG 4G7HF 1LDJA 2ZNYA 3SHFA 3DPTA 2ZFWA 2C6YA 4KNYA 3WTXC 3P9KA 1HXDA 3EYIA 3HRSA 3WE3A 2VT3A 3PFIA 5FD6A 1CF7A 5ILSA 3RDIA 2O61A 1G3WA 4I01A 4A0YA 1WI9A 4L9NA 2KJBA 4KN4X 5E8IA 2EWNA 1BIBA 3HSEA 2DFIA 4HQEA 4WF2A 1F5TA 1Z6RA 1FPQA 1D5VA 2STTA 2P7VB 2IA1A 1LQ1A 4XRFA 2PFBA 1XGMA 2A69F 4KYWA 3C7JA 5FLXZ 4RGRA 3ZMVA 1Z1DA 2LF8A 2LF7A 1ZG5A 5LHHA 2Z5UA 3LA7A 2FOKA 3E6CC 1BOAA 1TNTA 4ZYEA 3R61A 1B6AA 1FBUA 1ZRCA 3WU0A 4OMYA 1TBXA 2RQPA 1FOKA 3SZPA 2DO7A 2F2EA 3K1PA 2ZNZA 5L3CA 2FEZA 1IXSB 1TTYA 4FX0A 5FO5A 2VN2A 2YX4A 4UV9A 4ENJA 5HLIA 1QQIA 3ZMUA 3W6KB 2LKPA 4H0EA 1HW1A 3E5QA 1DPUA 1FWZA 1WQ2A 1ULYA 3EYYA 1TQIA 4I0BA 1MKMA 5E1ZB 2MBFA 1JE8A 3T8TA 1MJ9A 2IVMA 3AAFA 1KGSA 3VEPA 4IRIA 3BPVA 1I1SA 3WTZA 1MJBA 4MEXF 3IWFA 4B09A 1R1TA 5ICEA 1T38A 1XDUA 3EUHA 5CVRA 3FXUA 1K7AA 3VODA 2MC3A 5CVJA 2VXZA 4EJVA 5D5WB 2F5DA 3ZN1A 4HLYA 2TDXA 3WTSC 4L0ZB 3GF2A 3RPQA 2VOOA 1EH8A 3ZMDA 2AS5F 2ISZA 3F8CA 2HQRA 1S7AA 2JTVA 2XAJA 1R36A 2HYGD 1XB4A 6PAXA 4N9IA 1ZGJA 2Z99A 4XBFA 3RYRA 3FX3A 3HTSB 4G94A 1IRFA 4EJWA 4Y15A 1H0MA 3WE2A 1ZREA 3RI4A 2DK8A 5K5OA 1ZG3A 1B4AA 2HKXA 3T1BA 2IA0A 5CJ9A 2X0LA 2O6GE 4BHCA 4KIGA 1U78A 1XGNA 1B9MA 1K78A 5D8LB 1ZRFA 3TKYA 4GCVA 4M6YA 2RV8A 1MZBA 2HZTA 3I4PA 1RZ4A 3F21A 5D4SA 1T6SA 1BBYA 4PGHA 2YSRA 2ELHA 4G9YA 4ON0A 2MD5A 1QPMA 3IKTA 3BP8A 3GZ5A 5D5UB 4LMYA 1L3LA 2GA2A 2NS0A 5ICFA 1LB2A 4MEYF 4EM2A 1B9NA 2PQ8A 3V8LA 1BI1A 1FC3A 1SD6A 2DT5A 1XDSA 4GXOA 1R00A 2FU4A 4L9TA 4YFXF 1Z05A 5H6RA 4HZFA 3KETA 1TLHB 1IUYA 1USSA 3ZMSA 4Q48A 1DDNA 3K0LA 1AWCA 4Z2YA 3KP7A 1ZN2A 2RC4A 3CDHA 5BS6A 2W84A 3DFGA 1QBJA 1R1VA 2HOEA 2IPQX 2EV0A 3E5XA 4MTDA 2A68F 1FBQA 4UVBA 4I09A 3OOPA 3L09A 3BOQA 4ESBA 3R0AA 2LDUA 5ERIA 3MAJA 4HDVA 1T98A 5LRRA 3S2WA 3WTWC 5KVRA 4P9FA 3F22A 2BV6A 2WV0A 1YW7A 2Z3YA 4PZJA 2JT1A 3TOBA 2IP2A 2R7FA 2A5YB 2HR3A 3GEZA 5E18F 2ZCWA 4WXCA 5DCMB 2AXLA 1FP1D 2K02A 2YPRA 2P4WA 5CVUA 3HHHA 4KA4A 1UFMA 2DK5A 2XV4S 2E7WA 3ULQB 2D2WA 3M8FA 5FB2A 2QQAA 5EEHA 2BBYA 4AD9A 4IRGA 5DUIA 2FMYA 3OV8A 4R8HA 4UVCA 1Z91A 5L3FA 3LAPA 4UUVA 5TRDA 2W85A 1KA8A 5H6QA 1EH7A 4CO8A 3CJNA 5EEGA 3E3VA 3LWFA 4F7ZA 3FXQA 1T39A 2OBPA 2OD5A 1H9GA 5J8FA 1B59A 5HDKA 4OIQF 4M73A 3FM5A 3NQOA 1F9NA 5A2QZ 3KZZA 3KLNA 2XASA 2A6HF 3QP5A 3I53A 1KQ0A 5A2QK 4O5VA 3F8NA 3ERED 4BYYA 3EDPA 3GFJA 1G4DA 4FHTA 2CYYA 5HOOA 2H6BA 5D8KB 5IT3A 4R1HA 4M74A 2ZO4A 3FMSA 1D8JA 2B0LA 2Z9OA 2QZ8A 4P55A 1MGTA 1IN7A 5LEKA 1R5HA 3RJPA 4YFNF 1WSUA 3QAHA 3JSOA 1IRGA 3HSFA 3CUOA 2RN7A 4U7BA 2V1XA 3O2PE 1K6OA 2OZ6A 1BJAA 1B1BA 1PDNC 5FFZA 2V9VA 2JPBA 2G7HA 1GXPA 3K1MA 2R3SA 2V79A 3V7SA 2QVOA 3ZP5A 1D3YA 1V3FA 2CWEA 2IJLA 2KIUA 2OQGA 4EM1A 4A0XA 2XIGA 3WG9A 2L4AA 4U0WA 1YIOA 5DUKA 3H92A 2P6SA 1REPC 5F1RA 2MLKA 4ESJA 1IN4A 2EV6A 3F6VA 1OYIA 2R7DA 1I1GA 1ZH5A 3LA3A 1WKMA 4I98B 1R22A 1IN8A 1KU3A 3KP6A 2YR2A 1O7FA 1J75A 4HYEA 3GLXA 4HLXA 2BE5F 5E1WA 2NAZA 3ZN0A 4GYGA 4YIFA 3GO5A 3CO7C 4L9JA 3TGNA 2NYXA 3F8MA 4AIHA 5DCMA 1UCRA 1A04A 3QPTA 1KYZA 3GVAA 3MZHA 4BQAA 4YIIA 4LB5A 4GGGA 1SFUA 4G6DA 5KK1A 2JSCA 4KT5C 2XGXA 2UZKA 5DEQA 3RIRA 1SMYF 2OAZA 2XAQA 2P5VA 1S6LA 1EV7A 2FBKA 1GVJA 3ECHA 3ML6A 2F5FA 3KLOA 2FF4A 2HEOA 2Q8KA 3F23A 1HSTA 4L9VA 3WGGA 3FM3A 4CXFA 1XCBA 5BPIA 3ELKA 3HUGA 1TQMA 1G3YA 2FBHA 3HIFA 2QBYA 4N9HA 2XKOA 1KQ9A 3IL2A 4LK1F 1KU2A 2GXBA 3WTYC 1XMKA 2D1VA 4EJTA 1D8KA 3GX4X 5HVQC 3VOEA 3T5XA 2MLGA 2O03A 2CO5A 1OPCA 3IRRA 2K86A 3F6OA 3F8FA 5L3GA 3CUQB 5IT9K 4G8XA 4LGWA 3BROA 5L3BA 2H27A 3PQKA 2ACJA 2VOPA 4ZZDA 5DYMA 2DQRA 4JK1X 4ENKA 2VC0A 3BJ6A 1QZZA 1JHHA 5JR3A 1G3SA 2W24A 1S29A 3LA2A 4BXUA 3JSPA 2UWMA 2UXXA 4K2EA 3ECOA 1VTNC 1HBXG 4YG2F 3ABUA 5DV5A 4OIRF 1HKSA 2H6CA 2HYFA 1FSEA 3RKXA 3L7WA 1PP7U 2Y0MA 5BQTA 3KP4A 3JAMZ 5HS7A 3HOSA 4HF2A 3B02A 1R1UA 3HOTA 3MZYA 1SD7A 1T0FA 4QWQA 2DBBA 4Y13A 3DPLC 5LEJA 2LNBA 2WWYA 2VT2A 2E7XA 1AOYA 1FBSA 3J80K 1YS7A 5ICCA 3KFWX 1BI3A 1LEAA 1FY7A 2JZYA 2M30A 2PJPA 4KIFA 4P9UA 1T2KA 1P4WA 2ISYA 1LJ9A 1JXSA 1U8RA 2M5WA 3RKYA 4HQMA 4M72A 2QWWA 1YYVA 2HTSA 2A3SA 3JTGA 5AONA 2HS5A 4LK0F 2DPDA 1STZA 2H09A 3DP7A 4UNOA 3CUQA 4HA8A 1SD5A 2OU2A 4KDPA 5CYVA 2DTRA 3ZMZA 4P5OA 3LQRA 1S7OA 3HTUA 3HHGA 1KU7A 3MEXA 2D1HA 2V6CA 1C0WA 1YW8A 4WXDA 1W7PA 4ETSA 1ZG1A 2K4BA 4ENMA 5D5XB 1HKTA 2M87A 4HF0A 3IC7A 4AVPA 3Q9VA 2EB7A 3FMRA 1I5ZA 4AWXB 5AIPA 2HKOA 1XD7A 2NNNA 4O3MA 5CVIA 1I6XA 1P4AA 3LAJA 5K5RA 1O57A 4FT8A 1R23A 2COMA 3EETA 4RAZA 5D6FA 1RUOA 1IN6A 2P5KA 4I7HA 1MDMA 5K5QA 1W7PB 4M9XA 4Q5SF 2EV5A 1JGSA 1U5TC 4UV8A 2VBXA 3IKVA 5J8CA 1DPRA 2ZXJA 1FSHA 1J2XA 3V7RA 2VC1A 4BAYA 3ZPLA 3DV8A 1IAWA 1MD0A 4LLGF 3QOPA 2XRNA 4L18B 1IXCA 2HWVA 5F6FA 2VBZA 4EQQA 3BZ6A 2CQKA 5ILUA 2PI0A 4IJAA 5D5VB 2Q2EA 3VB2A 3CTAA 4RGSA 3K69A 2RKHA 2RVCA 4RB3C 3GFMA 3Q5FA 1BN5A 3DKWA 2VE9A 4FX4A 2XHKA 4MQVA 4I2OA 4U88A 4IXAA 1ZLJA 2JPCA 2IW5A 1KQ8A 1FP2A 5DD4A 2EFQA 2FA5A 1OR7A 4ASNA 4S05A 3KP2A 4RGXA 1TNSA 2OA4A 1Z9CA 3PQJA 2PN6A 4KMFA 1IXRC 3WU1B 2QLZA 3RKWA 1ZAOA 1XSVA 4WK8F 2PEXA 2V1DA 4JQFA 4L0YB 2P7CB 2BEOA 4XLNF 3QRFF 3V8JA 2NNYA 5JI6A 1K78B 3R6SA 2FRHA 3KP3A 4GYIA 4N0BA 4G7ZF 4U0YA 2K27A 4KFCA 3LSTA 2XVCA 5HLGA 3L2CA 1LDDA 2RDPA 1XSDA 4OU0A 3B73A 5BOXA 1Q1HA 2D45A 1F4KA 4KMUX 2DQLA 3I64A 5F64A 2QM3A 4BHPA 4LG0B 2FNAA 1U5TA 1FZPB 3ZMTA 4XLPF 1SFEA 4CZZA 4A6DA 1ZGAA 4IHTA 2DU9A 3COAC 3DEUA 3FHZA 2E1NA 1O3QA 4Q47A 3JW4A 4U7DA 4RS8A 1TW2A 3GW2A 3MQ0A 2VBWA 4TV7A 3J7AO 3WTTC 3GFIA 2WC2A 2M45A 1W4MA 3H3ZA 2VONA 4HOBA 5D4RA 3F8BA 3BDDA 1G3TA 1KYWA 3G3ZA 3ISPA 1QNTA 2A6EF 3E6MA 2O3FA 4MGRA 3U2RA 4I0AA 3QP6A 4YFKF 1QZYA 3KEQA 1ZYRF 3FWEA 3I59A 1FYMA 5BPDA 2XROA 2EK5A 2MH9A 1GXQA 4I02A 2EFOA 3WGHA 2KIFA 3L00A 2IT0A 1YG2A 4ZYHA 2QBYB 2ETHA 4G7OF 3I54A 3T8RA 4Y17A 3J81K 1FLIA 2MH2A 3FMQA 4UXNA 4L5JA 4RGUA 2O0YA 3IRQA 4PDKA 2GAUA 3U9GA 2PG4A 3F72A 1UHMA 2QQBA 1YFHA 2DLLA 1BIAA 1E2XA 1OYWA 2J5PA 1K79A 3CLOA 5AIQA 2EFPA 1U6GA 1Z7UA 1H9TA 1IW7F 4D0PA 1O7LA 3IHUA 5LBQA 5ED4A 1ZHFA 3O3KA 4HW0A 3K9TA 3TOAA 2ZKZA 1RUNA 5HS8A 5FGMA 3J81Z 1PP8F 4KUMA 1V4RA 3U1DA 2FXAA 1Z6TA 2FNPA 2JRTA 1P6RA 2EJRA 1BM9A 3TO9A 4CICA 3D5LA 1RIOH 4LD5A 3H3UA 1ODDA 1E17A 1U2WA 5E17F 1ON2A 1BC8C 4G6QA 1LEBA 4AIKA 1OMIA 2DW4A 2QUFA 4XSXF 3CO6C 2DPUA 2L02A 1KU9A 2UXNA 5ILVA 3E6BA 3KZYA 1SD4A 4NHJA 3GWZA 2BGCA 3RYPA 2F5EA 1DUXC 2F5CA 4RB2C 3NEUA 2XAHA 5LGTA 2FMLA 1YS6A 3SQNA 5JVTA 5J6XA 3GFLA 5JFRA 3HRTA 2W25A 3GZ6A 5HDGA 4M9ZA 1U5TB 2O8XA 1NHAA 4LLNA 1XN7A 3R0JA 3KE2A 2HTJA 2W57A 4ZYGA 5L3DA 4DNCA 2GWRA 3KCCA 1ZLKA 5D6EA 3M9AA 1DP7P 4ENNA 2P5LC 1P2FA 4IPAA 5FD5A 2ESNA 4HV5A 1PUEE 4OIPF 2DAOA 2LSOA 1RNLA 3QU6A 2L4MA 4OIOF 3R4KA 1IZ1A 1HKQA 3R60A 2CFXA 3I5UA 3E5UA 3VFZA 5K1YA 4E70A 1BI2A 2PMHA 4HX7A 1ZARA 2K7LA 3K2ZA 1OYYA 2HFHA 5CLSA 3P9IA 3C3WA 1YLFA 3HYIA 4Q4ZF 4A5MA 3F3XA 1LNWA 3LFKA 2V1UA 1HQCA 2CW0F 2STWA 3TO7A 2K4JA 3M1EA
chains in the Genus database with same CATH superfamily
4QLCU 3WG7H 5GAEJ 9ANTA 1BI0A 5FLXK 1I3QJ 1ETXA 3SZTA 1GUUA 3E97A 5H20A 1FT9A 3K70D 2B7EA 2R93J 1VQKI 1X3UA 2NOJB 4DYCA 5BMZA 2KRFA 4A3MJ 3E1SA 2EA2A 4RDUA 1VQOI 2DFFA 3HRUA 4QPOA 2ESHA 4D7MA 4WX9A 4HRIA 4NDLA 1O3TA 2LG4A 1JI8A 2R7OA 2H8WA 3H5AA 2M0MA 1UHWA 3FF5A 3OOUA 2QSFX 2VBYA 5E20A 4HAMA 4RBOA 2M7AA 3GUDA 1LE8B 2ADUA 3S15J 4NQWA 2KKOA 1APLC 4BNCA 4OMZA 2CGPA 2VE8A 5DD8A 3E6DA 2XKPA 2K9MA 1W7PD 3ZQGA 5LHGA 1M1EB 3N97A 1R49A 4QTRA 5ICGA 3BY6A 2QENA 3TDUC 3JTHA 2KJCA 2HNHA 1V54H 2KIMA 1YW9A 2VQHA 1W5TA 3MD2A 5FFXA 3SFZA 1PUFB 3DXJF 4KJZA 4OINF 2RGVA 5L3EA 4XN0A 2EQRA 2ZMEB 3NRVA 1IN5A 4LB6B 1UAAA 4PGGA 4XICA 1MIJA 3M1CA 1L0OC 4BH9A 5GPCA 2FQ3A 2BW3A 2VODA 4EJUA 2JUCA 3FK6A 3FXRA 2RQQA 3FXJA 3G1MA 1P4XA 4XLFA 4BACA 1RI7A 4KICA 2E35A 4HDUA 3QOEA 2G7UA 1EH6A 3CUQC 1G59A 2M8EA 3RZDJ 3V4GA 3I4NJ 1MMGA 1Z3YA 3FKIJ 4DQ2A 5J1YA 4EGZA 1F1ZA 2K40A 4S0HB 2FBIA 1YO5C 5LHIA 1FYLA 1KONA 2QQ9A 4D7NA 4KITB 2NRAC 3BPXA 5BNGA 4AIJA 2HQNA 1BC7C 1UHSA 2A07F 2L01A 2PBIA 3KEOA 1T0FC 1X1AA 4EV0A 2XC7A 1WHUA 4LG0A 4A3KJ 2JA5J 3HOUJ 4M71A 3BJAA 4BE2A 2Y2ZA 1QGPA 1GHCA 3L9FA 2XAFA 4MLOA 4EJOA 1WZ2A 2PLYA 3S2HJ 5IT9Z 1IF1A 1Y0UA 1XMAA 5B1AH 3KPHA 2QKLB 3P9CA 2GOXB 4EMSA 1TT5B 4RB1A 3HSRA 4KN7X 1I39A 1CGPA 3N4MA 5LLQA 4UVAA 3ROUA 3DF8A 1VQ9I 3BJOA 3SDBA 2KZVA 2L0KA 1R5GA 2DA6A 1MJAA 2H94A 3SXYA 5CQGA 2VKDA 4XKBA 3C2HA 4X0GA 4P96A 4F92B 5IYCJ 4KIBA 2M2EA 1G6NA 4EATA 1FYKA 1SAUA 5JHUA 1OCCH 4D5CA 4HBLA 1MDMB 3GYHX 3O8GA 2P6TA 3CC2I 3DKYA 4HG2A 2L7FP 2CUZA 4WXHA 3M3YJ 1EF4A 1O3RA 2TRTA 3CQZJ 3OIQA 2A6TA 1HSJA 4BEHB 1JGGA 3BG5A 2W4SA 3VPRA 2O5RA 3K2AA 3QPHA 3RKQA 4PCQA 1MW7A 2YX7A 3LOCA 3OYFA 3ZXSA 1J0RA 3OYIA 2VKVA 5LFAA 1VNDA 1I6HJ 2H1KA 1S3JA 4QIWN 5LGUA 2EZIA 3CJQB 2DA7A 4NUBA 1U3EM 3GXOA 4IVNA 5F27A 1WWXA 2CG4A 5LGNA 3MWMA 4XL9A 3G4SI 4JYKA 2ELKA 3UR3C 2JA2A 3Q0VA 1UB9A 4GO1A 4ESFA 2GQQA 2KFDA 3A0HC 3FZVA 4ZYDA 4XSZF 2J5OA 3W2WA 2FSWA 1R4NB 3OYCA 3IP4B 5DCFA 3S16J 3S8PA 1YHQI 3WTVC 5E1XA 3W6JB 1QO0D 4ZZLA 1ONVA 2MA3A 1SMTA 4Z6YA 2V26A 1WRJA 2MC4A 2CQQA 4ZH4F 4A2UA 3CMYA 2XPVA 4MHGA 4LJZF 4IF4A 2X1DA 2F5VA 2CSOA 2BOLA 2OV7A 4RAYA 4FETA 2HDCA 3VYSB 1SAXA 5E8GA 3MCZA 4EM0B 2CQNA 1I27A 4FQGA 2Y48A 5TJJA 2EFNA 3P7NA 2MSYA 4XKCA 1BR1A 1OLTA 3C18A 1XGSA 1J9IA 4R79A 1BL0A 1OCTC 3TDZC 4BHBA 4A0ZA 1TL8A 3FBNB 3G73A 4NBQA 3LSIA 1LDKB 1XCVA 4S04A 2BHYA 3DQVC 3VDXA 1YQAA 2XUBA 3RTRA 1LVAA 2IS2A 1W36C 3T0YA 3M8EA 3OMYA 3Q9SA 1AU7A 1TQPA 1P92A 5C44J 2X6XA 4BJ6C 1FNNA 4LLLA 4A3DJ 2Q0OA 1ZRDA 1JHFA 4IRHA 5JVGF 1NG6A 4A5NA 1XMXA 3TO6A 3V8KA 4CCKA 3J80Z 5KCMA 3EUKL 5HS9A 2OTJI 5HDNA 3BCAA 2AXTC 4U0VA 5J4VA 2DI3A 2K9SA 2ZJ2A 4B8XA 2X85A 1A35A 4J00A 4LFUA 1HW5A 2AQEA 3WTUC 2E1CA 2Z33A 4E4HA 2WAQN 1FX7A 2ZBKA 3V7CA 3C1DA 2R7XA 3SDGA 3I59B 4ZYAA 3LQQA 2YU3A 3X2QH 4Y33A 4B48A 4PJLA 3J7YJ 2R7QA 3WODF 4JBAA 4HF1A 2VKEA 4A12A 3GCMA 2EA4A 2IGMA 2ZMEA 2R5YB 3ZQ7A 4G6TB 2LBFB 1HW2A 2R92J 2BYVE 1WGXA 4WWCA 1UMQA 2G9WA 4MTEA 5CVVA 1BW6A 5FKKA 1HLVA 1IGNA 1OKRA 3BG7A 2QF7A 3OIPA 3LSKA 1BR4A 3CP2A 3OYEA 2BVMA 5B3SH 1CQTA 3H35A 1O3SA 4QSHA 3CCUI 1X19A 4CDGA 3QU3A 4NB5A 2EZLA 1R7JA 3HG9A 2OCCH 1T33A 1XSXA 2ZB9A 1RR7A 3L2VA 1U9NA 3AG3H 1J7KA 2YU9J 3O6BB 4BY1J 2HOSA 4ZDPA 1XG1A 2DJNA 2KIQA 4ANJA 1OCZH 2M1BA 4CH7A 5HLHA 5CPRB 2L54A 3EQLF 3VYUB 3I71A 3KP5A 4BQOA 4OAYA 2QYOA 2A61A 5E3MA 4CHUA 1USTA 1TWGJ 3BWGA 3E0JB 5J1UA 3HOXJ 4XQFA 5DDGA 1XPXA 2M8GX 4O6JA 3MFKA 2LVSA 3HRMA 2Y69H 2EFWA 3TQNA 1W5SA 5K7ZA 5EF6A 2HGCA 3HJEA 1YIJI 2GA1A 2XF6A 3ABTA 3TP0A 1R58A 2X4HA 4PFOA 1W5CC 3D0SA 3HOZJ 3REOA 4FASD 2L3DA 5M3FJ 2DODA 2VJ4A 1SFXA 1S8NA 4L5IA 2BY0A 4HV6A 2P8TA 2Y9YA 1OFCX 2MG4A 3BQZA 1J5YA 5HNHA 3DKXA 2HQ5A 4WCGA 4OOIA 1YTYA 1ON1A 2OZUA 4G12A 2K9QA 2XSJC 3QQAA 3DWLE 2PMUA 2OQRA 2GXGA 2KLOA 4UHTA 4MQ9F 2WADA 4HSTA 4EVIA 3CC4I 3DU5A 2EH3A 1W0TA 1T08B 4HX8A 1J59A 5HODA 2RNJA 2WY7Q 3DEWA 3I58A 4YIRX 1TW3A 5EDNA 4EGYA 2GIVA 4HX4A 3ABLH 5LRSA 1ZGWA 2RREA 1QHHD 3BG9A 4MNUA 3G6EI 2Y75A 2FE3A 3UKGA 2JA6J 4XOPA 2GOMA 4M6XA 1XGOA 2GZWA 3DTIA 3M7GA 4YELA 1Q1VA 4IHSA 4M9SA 4XORA 3RPUA 3AG4H 3IWZA 1CF7B 4GDFA 2KQRA 3CDIA 1K4SA 4A6EA 1VQ5I 3ESWB 1XC5A 3TBIA 4CGZA 3OS2A 4IOAF 3G71I 2IA2A 3I0TA 4RB0A 1IC8A 3JAMK 2WY8Q 3WGIA 3H5NA 1K83J 3K1NA 4RAFA 4XRSG 4CYDA 2LP0A 2XAGA 1SVOA 2XPUA 1MH4A 4AYBA 2WTEA 2IRFG 2VI6A 2NVQJ 4G7HF 1LDJA 2QKMB 2ZNYA 3SHFA 3W2AA 2VPRA 3DPTA 2ZFWA 2C6YA 4KNYA 3WTXC 3P9KA 2F4OB 2HQAA 2Y0SN 2NS8A 2OUMA 4E7IA 3A2KA 2MD0A 1HXDA 2KMUA 3EYIA 3HRSA 3WE3A 5B66C 2KDOA 2VT3A 3PFIA 5J3LA 3LMMA 5FD6A 4IKFA 4XMYA 1P9QC 5FKOA 1CF7A 3D1NI 3H0GJ 5ILSA 2L5QA 2CRGA 3RDIA 2O61A 2DMUA 1G3WA 4I01A 2FUG2 4A0YA 1WI9A 4L9NA 4BE0A 1B72B 4CYCA 4XNFA 2KJBA 1YRNA 4BDZA 4KN4X 2ICWG 5E8IA 1YJWI 2EWNA 1BIBA 2HYJA 4AM3A 3HSEA 2DFIA 1LFUP 2IS6A 1IJWC 4C2TA 3HKZA 4HQEA 4WF2A 3K70C 1Z6RA 3S3NA 4ZTFA 1F5TA 3CCLI 1FPQA 4E6KG 1D5VA 2STTA 2P7VB 2IA1A 1X1DA 1RKTA 4A3EJ 1LQ1A 4FE7A 4CCMA 4XRFA 4A3FJ 1MBJA 2L9SA 4B4CA 3GTLJ 2PFBA 1XGMA 1V55H 2A69F 1D0XA 4KYWA 1TWCJ 3C7JA 5FLXZ 1D0YA 4RGRA 4Y3OA 1JT6A 3ZMVA 4YRVA 1Z1DA 2LF8A 2V7FA 2KL4A 2ELJA 2LF7A 1ZG5A 3K4NA 5LHHA 1GT0C 1FTZA 2LY9A 3RCOA 4J19A 2JQ7A 2Z5UA 3LA7A 2FOKA 4M3GA 4GFBA 1LE8A 1YE9A 1FEXA 3E6CC 1GVDA 1BOAA 4V2GA 1TNTA 4ZYEA 3R61A 4UY8I 2CQXA 2HVQA 1B6AA 1FBUA 2X6WA 1ZRCA 2K3FA 3WU0A 3G1OA 4XRMA 4OMYA 1TBXA 2RQPA 1FOKA 4Y7NJ 5F0FA 4A3IJ 3SZPA 2DO7A 2F2EA 3K1PA 2E5NA 1Y8RB 2ZNZA 5L3CA 4JP0A 2F6CA 4JX5A 4W1UA 4ZDOA 4M3DA 2DA1A 3CCRI 2FEZA 1IXSB 1TTYA 1VQ7I 1FOWA 2LKXA 2L7ZA 2YS9A 1Y56A 4H4KC 4FX0A 4DYRA 5FO5A 2VN2A 2YX4A 3E7LA 4UV9A 4ENJA 5HLIA 2R5YA 5GPAA 2LBFA 2P81A 4MIMA 4XR6A 4IQ4A 5IP7J 1QQIA 3ZCOA 3ZMUA 3W6KB 5F08A 2LKPA 3ZQQA 1RR8C 4H0EA 1HW1A 1IO2A 1ENHA 4CUGA 2DFEA 3E5QA 1DPUA 1R4MB 1FWZA 3QYFA 1WQ2A 1ULYA 3EYYA 3SYTA 1MMAA 5DS9A 1TQIA 4BL0B 2HPMA 4I0BA 3L1PA 2A5WA 1MKMA 2ECBA 2MBFA 3BR3A 4XOTA 5E1ZB 3T8TA 1MJ9A 3ZGKA 5GAHJ 2DYRH 2KDZA 1JE8A 2IVMA 3AAFA 3FXMA 1KGSA 3VEPA 4IRIA 3BPVA 2EIJH 2NVUB 3ZR8X 1I1SA 3WTZA 1MJBA 1K61A 3IWFA 4MEXF 2CFOA 2AO9A 4RLFA 4B09A 1R1TA 1K4TA 2CU7A 5ICEA 1T38A 1XDUA 2DJIA 3EUHA 5CVRA 3FXUA 3OYJA 3FISA 3FXOA 4ZC3A 1K7AA 3VODA 2MC3A 5CVJA 2L7MP 4E7KA 2GXAA 3SFIA 1ORKA 2VXZA 4HSRA 3VSKA 4EJVA 5D5WB 2F5DA 3MMYB 2VJIA 3ZN1A 2VUMJ 2FQ4A 4HLYA 3DTEA 2TDXA 2ZXIA 3WTSC 1IDZA 3CCEI 1TWAJ 4X1EA 4L0ZB 3GF2A 3RPQA 2XPWA 2VOOA 4UB8C 1NK2P 1EH8A 3ZMDA 1VQNI 2AS5F 5GTIC 3F8CA 3RSNA 2ISZA 1B8IB 2HQRA 1S7AA 2JTVA 3ABMH 2R4GA 2XAJA 3FXLA 1R36A 1X1CA 2HYGD 2CV2A 3U1KA 1XB4A 2EZKA 4RM2A 1Y0NA 6PAXA 4N9IA 1LUJB 1FIPA 2M34A 2R5ZA 3LL7A 2OCEA 1ZGJA 2Z99A 4BJTA 4FTHA 4XBFA 3OS1A 3RYRA 3MKZA 3FX3A 3HTSB 3HC7A 4G94A 2DOEA 1N78A 3HL2A 4XLHA 1SANA 3CZ6A 1IRFA 1HOMA 4EJWA 4ITVA 4Y15A 2K5CA 3F9KA 2LH9A 1JJ8C 1Z3XA 3EPZA 1H0MA 5M3MJ 1NK3P 3WE2A 2ME0A 1ZREA 3RI4A 2DK8A 1ZG3A 5K5OA 1B4AA 5IYDJ 3KX2A 2HKXA 4B43A 1AHDP 1ETOA 1DGWY 2VL8A 3T1BA 2EBIA 2OPTA 4D1QA 2IA0A 5CJ9A 3CCJI 2X0LA 2O6GE 1OCOH 4BHCA 4HPQA 3K4LA 1RETA 4KIGA 1U78A 4NNJA 1XGNA 2W48A 1B9MA 3MN2A 1K78A 5D8LB 3OYLA 1ZRFA 2ZSHB 3BT9A 1XTAA 2JUGA 3TKYA 2R5ZB 1SFOJ 4GCVA 4M6YA 3BR1A 2RV8A 1MZBA 2HZTA 3I4PA 1RZ4A 1H89C 1IRZA 5EYRA 3F21A 5D4SA 3JR9A 5K7FA 1T6SA 2Y0SA 1X1BA 1BBYA 2H1LA 3SEQA 4PGHA 2VASA 3H0DA 1W36D 2YSRA 1N77A 2ELHA 2P0WA 4G9YA 4ON0A 2MD5A 1N25A 2CUJA 1QPMA 3IKTA 3BP8A 3GZ5A 3VWBA 1E0EA 3LSPA 2KHMA 3N05A 5D5UB 4LMYA 2Y30A 2GA2A 2NS0A 5ICFA 1LB2A 1L3LA 4MEYF 2CMPA 4EM2A 1B9NA 2PQ8A 3V8LA 2R7WA 1OJLA 2IS1A 5KAFC 4E7HA 1BI1A 2V6EA 4DYQA 1FC3A 1SD6A 2DT5A 4RAGA 1XDSA 3K4CA 4GXOA 3HOYJ 1R00A 2FU4A 2LY1A 4L9TA 2DYSH 4AYBN 5E3NA 4YFXF 4HNUA 1Z05A 5H6RA 2PMZN 3LNQA 4HZFA 3VYTB 3KETA 1TLHB 2DN0A 1OCRH 4ABZA 1IUYA 3DPUA 3DBRB 1USSA 1YITI 4XM3A 3HOWJ 2NXNB 2E2HJ 3ZMSA 2WA0A 4Q48A 1PJRA 1WJBA 1WJ5A 5CQEA 1DDNA 4J01A 3JRHA 4MFDA 5FRNA 3CMAI 3K0LA 4BXFA 4BBRJ 4Z2YA 1AWCA 3KP7A 1ZN2A 2RC4A 3CDHA 3K4MA 5IY5H 2E19A 4C3JJ 5BS6A 1HC8A 2W84A 3GZNB 3DFGA 1QBJA 4XLAA 4ZTJA 1R1VA 3W3CA 3OL3A 2HOEA 2XDVA 3CESA 2IPQX 2EV0A 3E5XA 2KT0A 5EG0B 2UUZA 2M7BA 3G1LA 4MTDA 2ZXHA 2A68F 1FBQA 2DMQA 4UVBA 4I09A 3OOPA 1A31A 4DBQA 3L09A 4NQWB 3BOQA 4ESBA 1DP3A 3SZGA 3R0AA 2LDUA 3BR2A 5ERIA 3TEDA 3MAJA 4HDVA 1ACIA 3BTJA 2JMWA 1T98A 1VQ8I 5LRRA 3S2WA 3WTWC 5KVRA 4P9FA 3F22A 1GLNA 1LVKA 2BV6A 2WV0A 1YW7A 4DZPA 4XIDA 2IS4A 2Z3YA 4PZJA 2JT1A 4PUSA 3A02A 3TOBA 2E1OA 1P7IA 2IP2A 1VQPI 2R7FA 5C4XJ 3K4JA 2A5YB 2A05A 2HR3A 3GEZA 4QPQA 4AIDA 3CJTB 2ME6A 3IV5A 3V42A 5E18F 2ZCWA 4WXCA 5DCMB 2AXLA 3CD6I 1FP1D 2K02A 2YPRA 3MKYB 2VQLA 4A93J 2P4WA 5CVUA 4M3EA 3KYDB 4C30A 4F55A 3HHHA 1SFKA 2FJ1A 4KA4A 1RESA 1UFMA 2DK5A 2M4GA 2TCTA 1ZR2A 2XV4S 2E7WA 3ULQB 2I5UA 2D2WA 2L9VA 3M8FA 5FB2A 2QQAA 5EEHA 1LKXA 2BBYA 3PNYA 4IRGA 4AD9A 2FMYA 3OV8A 5GTHC 1X2NA 5IOYA 5IP6A 5DUIA 2F48A 4R8HA 1IDYA 4UVCA 1Z91A 5L3FA 3LAPA 4UUVA 2JA8J 5TRDA 2R0QC 2W85A 2FOWA 2NS7A 1KA8A 4BJ5C 5H6QA 2CW7A 4EEFG 1EH7A 3A1YA 4CO8A 1MBEA 3ASOH 3CJNA 4N4OB 2V9KA 2LC2A 3AL0B 5EEGA 2KPMA 2DTZA 4MO7A 3S1MJ 3E3VA 3LWFA 3O8HA 4F7ZA 3FXQA 3WHCA 1MBKA 1T39A 1DQUA 2QA4I 2OBPA 2OD5A 3PIPF 1H9GA 5J8FA 1B59A 2X51A 3H9QA 1Z21A 3OWTA 1S9HA 5HDKA 4OIQF 4M73A 3FM5A 3NQOA 3WU2C 1ETQA 1A6QA 1F9NA 2Z2SB 1YOVB 3I3LA 5A2QZ 1MNEA 3KZZA 3QWLA 2B9SA 3KLNA 2XASA 1E3OC 1VF9A 2A6HF 4B3XA 1TWHJ 3QP5A 3I53A 3Q3SA 1KQ0A 5A2QK 2CV0A 3W2VA 4O5VA 3F8NA 2R7RA 2LY2A 3ERED 3TP3A 2E1MB 4BYYA 3EDPA 3GFJA 1G4DA 3HEFA 4FHTA 2CYYA 5HOOA 2H6BA 5D8KB 2EINH 3JRFA 3GBGA 5IT3A 4R1HA 4M74A 2ZO4A 3FMSA 1MSEC 1D8JA 1NTCA 2XSDC 1RC9A 2B0LA 3HBLA 2Z9OA 5LD2C 2QZ8A 3KYCB 4P55A 3L2UA 1MGTA 1IN7A 5LEKA 3GLLA 2ID3A 1R5HA 3PO2J 2BY1A 5JLWA 1E3PA 3RJPA 4YFNF 1WSUA 3QAHA 3JSOA 1IRGA 3FHNA 3HSFA 4IHYA 3CUOA 2RN7A 2OJED 4U7BA 2V1XA 4PFPA 2I10A 3O2PE 1A36A 1K6OA 3IAS2 2OZ6A 3MZ8A 1BJAA 1S5LC 2LREA 2LKSA 3BQYA 4FE4A 1B1BA 4BY7J 1PDNC 5FFZA 2O7OA 3ASNH 3OR2C 2LOOA 2M9HA 2V9VA 2JPBA 2G7HA 1GXPA 2BHZA 3K1MA 1A6IA 2R3SA 2GM4A 2V79A 4F91B 2ID6A 1BW5A 1UG0A 3V7SA 2QVOA 1A5JA 1TP4A 3ZP5A 2ZC2A 1WPKA 1D3YA 1IV6A 3BC8A 2L9NA 1V3FA 5TISC 2CWEA 5JHFA 2IJLA 3JREA 2ZJRF 2KIUA 2OQGA 4EM1A 1IG7A 1VQ6I 2K9NA 1Y39A 4A0XA 2XIGA 3WG9A 5B5EC 4IX7A 2FD5A 2M0CA 3PSIA 2L4AA 4U0WA 1YIOA 5K7HA 5DUKA 3H92A 2WB1A 2P6SA 4LIVA 1REPC 3S93A 2MLKA 1KZHA 5F1RA 3M8JA 1BR2A 2V4JC 3JRDA 4BU2A 2B63J 2AHQA 4ESJA 2D5VA 1IN4A 2XB5A 1VFCA 1IRXA 2EV6A 1YX5A 3F6VA 3A03A 3JRAA 1ETVA 1OYIA 3EUHC 1I3AA 2R7DA 3TW6A 1I1GA 1ZH5A 3LA3A 1POGA 1WKMA 4I98B 3H9GA 2G0EA 2HXIA 2VKHA 3M07A 3CF5F 2HDDA 1R22A 2E60A 2O8KA 1DGRM 1IN8A 3CDLA 2NVXJ 1KU3A 2DA2A 3KP6A 2Y9ZA 2YR2A 2JJ7A 1Y1WJ 1O7FA 4IHVA 4Y4RA 1QA6A 3CC7I 1J75A 4HYEA 5EGOA 4PJNA 3GLXA 3K7AJ 4HLXA 2BE5F 5E1WA 2NAZA 1Y6IA 2XGCA 3ZN0A 1IUFA 4GYGA 4YIFA 3GO5A 4PJ0C 2KRHA 3CO7C 4L9JA 3TGNA 2NYXA 2JRMA 3F8MA 4CCOA 4RLQA 3TMOA 4AIHA 5DCMA 4C3IJ 1TT0A 1UCRA 1A04A 3J7AY 1FIAA 1MSFC 3QPTA 2MW8A 1X58A 2QGUA 4AUXA 4CZCA 1KYZA 3GVAA 3OSGA 1ETYA 3MZHA 4BQAA 4YIIA 3BZCA 1PYVA 4UUSA 4PJMA 4LB5A 4GGGA 1SFUA 4G6DA 5KK1A 1ZR4A 2JSCA 2XAUA 5GAGJ 3CCMI 2QCOA 3PJRA 4KT5C 2XGXA 2UZKA 2BXZA 2PX9A 2W1OA 5DEQA 3RIRA 1SMYF 2OAZA 2XAQA 5EG0A 2P5VA 1S6LA 1EV7A 4DGWB 3W6VA 5J4YA 2FBKA 2AQFA 2MYSA 1GVJA 1MMSA 3ECHA 3ML6A 1Y1VJ 2F5FA 1LFPA 2ECCA 3KLOA 2FF4A 2HEOA 4Y52J 3A4CA 3AG2H 2Q8KA 3C2BA 3F23A 2OF7A 1HSTA 4L9VA 3WGGA 3FM3A 4CXFA 1XCBA 5BPIA 3ELKA 3HUGA 1WJDA 1TQMA 3ZQLA 1G3YA 2BY2A 2FBHA 5HLTA 5FLMJ 1HDPA 1ERDA 3HIFA 2QBYA 4N9HA 2XKOA 1XS9A 4LOCA 1KQ9A 4JOMA 3IL2A 3S3OA 3DEEA 5KNLA 4IHWA 4LK1F 2VIXA 3BG3A 1KU2A 2GXBA 4C3HJ 1B72A 1VQLI 3S14J 2MABA 3WTYC 1XMKA 2D1VA 4XK4A 1AKHA 1IV8A 2XRLA 5E3OA 1YI2I 4EJTA 4BUPA 2IAIA 1D8KA 2EIMH 3P5JA 3GX4X 3PNTA 5HVQC 1MNMC 1FTTA 3VOEA 4NC7A 2PMZA 3OIOA 3T5XA 1MMDA 2MLGA 2O03A 2LR8A 2CO5A 2IEKA 1OPCA 1UZCA 1N75A 3IRRA 5FJ8J 2K86A 4XN3A 1SVLA 4A3CJ 3F6OA 3PUFA 3F8FA 4RM3A 5L3GA 3CUQB 1MBGA 5IT9K 1WJCA 4G8XA 4LGWA 3BROA 3CLQA 3ZQCA 5L3BA 2HOTA 2H27A 1R71A 3PQKA 1ZKGA 3GTQJ 2ACJA 3S32A 2VOPA 4ZZDA 1OR7C 5DYMA 2DQRA 1SVMA 2KRCA 3CP8A 4JK1X 2VQCA 2VLAA 2LK2A 2VC0A 3BJ6A 4ENKA 4AC0A 1QZZA 1JHHA 3LSJA 5JR3A 1G3SA 2W24A 2VB6A 2CUFA 3K10A 2DOAA 4E7JA 1S29A 3LA2A 2CJJA 4BXUA 4HNTA 3JSPA 5FKLA 2UWMA 2UXXA 4K2EA 2XGEA 2N8GA 3LSRA 3ECOA 3K4KA 2QSGX 1VTNC 1HBXG 2DMNA 4YG2F 3ABUA 5DV5A 4OIRF 3FXKA 1HKSA 1JT0A 2R7SA 2H6CA 1QRYA 2HYFA 1FSEA 3M4OJ 3RKXA 3L7WA 2HU9A 1PP7U 2Y0MA 2QSHX 3GTPJ 4D5FA 5BQTA 3KP4A 4A3LJ 1VQMI 3JAMZ 2DT6A 5HS7A 3HOSA 4HF2A 3LSGA 3B02A 1R1UA 2QEXI 5DM7F 3MKLA 3HGYA 2L9RA 3GMEA 4XRSA 3DLLF 3HOTA 3MZYA 1SD7A 1T0FA 2E1MC 4QWQA 2DBBA 3HOVJ 4Y13A 3DPLC 5LEJA 1GV2A 1JUPA 2LNBA 1ZQ3P 3LSHA 2WWYA 3FK7A 4YEJA 2VT2A 2E7XA 2W82A 1YJNI 2CV1A 1FBSA 1AOYA 3J80K 1YS7A 5ICCA 3QYBA 4DIQA 3HZJA 1R5ID 3EUAA 3KFWX 3D5SC 1JKQC 1GDTA 3OR1C 3IUOA 1BI3A 5EJCA 1LEAA 3OY9A 1FY7A 2JZYA 2IGNA 2M30A 5C4JJ 4BQQA 2PJPA 2X6OA 3IH3A 4KIFA 4P9UA 1T2KA 1P4WA 2ISYA 2GBYA 5F1JA 1LJ9A 3QYEA 1JXSA 3AG1H 1BJZA 5M5YJ 2X48A 4LITA 1U8RA 1P7JA 2M5WA 3RKYA 2BXYA 2KISA 4HQMA 2IXSA 3AFHA 4M72A 5DM6F 1X2MA 2QWWA 3HPGA 3RQ4A 1ETKA 1YYVA 2HTSA 2A3SA 1D1AA 3JTGA 5AONA 2HS5A 3L2QA 1QVTA 5FKNA 4A3JJ 4LK0F 2DPDA 1STZA 2H09A 3DP7A 4UNOA 3CUQA 1TC3C 3JRIA 3LFUA 4HA8A 1SD5A 2OU2A 3DU6A 3QPSA 2CS3A 3JCUC 3CF2A 5CYVA 2DTRA 4KDPA 3ZMZA 2WAFA 4P5OA 3LQRA 1S7OA 3HTUA 1Z7LA 3HHGA 1KU7A 3F0CA 3MEXA 4B47A 2D1HA 2V6CA 3OYHA 1C0WA 3PM1A 4A69C 1YW8A 3RZOJ 4WXDA 1W7PA 2Y31A 4ETSA 1TZLA 2LMDA 4M6VA 2R7UA 1ZG1A 3WHBA 1OCPA 2K4BA 4ENMA 4IO9F 5D5XB 2DXIA 4FCYA 1QVUA 1HKTA 1QZEA 2M87A 4HF0A 3IC7A 3OYNA 1FOYA 5M5WJ 1X3WB 4AVPA 3Q9VA 2EB7A 1MH3A 3FMRA 1I5ZA 4AWXB 5AIPA 3LSMA 2HKOA 1XD7A 2NNNA 4O3MA 5CVIA 1I6XA 1P4AA 2JSPA 3LAJA 5K5RA 1K6YA 4IZZA 1O57A 1AA7A 4FT8A 1R23A 2COMA 3QODA 2DA4A 1WJFA 2DCEA 4OAZA 3EETA 1R9TJ 4CYCB 4RAZA 5E79C 2K9LA 2VPLA 4XONA 3CMEI 5D6FA 1RUOA 3ZRGA 4B44A 1IN6A 1EKEA 2P5KA 4DZJA 4I7HA 1WJEA 3S2DJ 1MDMA 5K5QA 4DW6A 5IOZA 1W7PB 4M9XA 4Q5SF 2LYCA 1WFXA 2EV5A 1JGSA 4RA2A 1U5TC 4UV8A 2VBXA 3IKVA 5J8CA 3A01B 1G2HA 2DDBA 1DPRA 2ZXJA 3K4BA 3CCVI 2IBDA 1HA8A 5TGTA 1EJ9A 1FSHA 2VJJA 3IH4A 1J2XA 5J1RA 3V7RA 2VC1A 4PSWA 2ZXWH 2JVGA 2PJRB 3VSLA 4BAYA 4E7SA 3OS0A 3ZPLA 3DV8A 3DLAA 1IAWA 4IQJA 1MD0A 4LLGF 3QOPA 2XRNA 4L18B 3OSFA 1IXCA 1JTYA 2HWVA 4MFEA 1U9OA 5F6FA 2H8RA 2WB1N 2R7VA 4I6ZA 2VBZA 2GIZA 3HXLA 4EQQA 3BZ6A 4PSXA 2CQKA 5EEAA 4FISA 1HF0A 5ILUA 5IPAA 2PI0A 4IJAA 5GP9A 3ZQFA 5D5VB 4IHXA 2Q2EA 3VB2A 3CCQI 3CTAA 4RGSA 2COBA 3JRCA 3K69A 2RKHA 2RVCA 2VQGA 3ERMA 4RB3C 3K6GA 4JX4A 2DFHA 4C9YA 1ZELA 3GTKJ 3GFMA 2OC6A 3Q5FA 1BN5A 3DKWA 2VE9A 1VI0A 3PIOF 2XHKA 3FDYA 4FX4A 4MQVA 4I2OA 3S3MA 4U88A 4IXAA 3ABKH 1ZLJA 3BR5A 3TL4X 3KZIC 2JPCA 5FKMA 2VXDA 2IW5A 1KQ8A 1JJ6C 1FP2A 5DD4A 1FMWA 2CQ7A 4NC6A 2EFQA 2BY3A 2FA5A 5HNFA 1OR7A 4ASNA 4S05A 3KP2A 4RGXA 1TNSA 2OA4A 1V5FA 5DTDA 5KAIC 4F93B 1Z9CA 3PQJA 4C2UA 2PN6A 1JKPC 4KMFA 2E2JJ 1X3ZB 1IXRC 3KEYA 3WU1B 3Q0UA 2WBMA 4LIUA 1DU6A 2QLZA 3KYLA 5FRMA 2NVTJ 3RKWA 5M5XJ 4OWRB 1ZAOA 2E2IJ 2RNGA 1XSVA 2V9PA 2PEXA 4WK8F 2V1DA 3CCSI 3PUBA 3QPLA 4IEJA 4JQFA 4L0YB 3H1CA 2P7CB 2BEOA 2DOFA 2X6YA 4L5EA 4XLNF 3QRFF 3V8JA 2NNYA 5JI6A 2HPIA 1O4XA 1K78B 2L2OA 2ZSIB 3R6SA 2FRHA 3KP3A 4GYIA 3BG6A 1Z0XA 3BCBA 4N0BA 4NC8A 4G7ZF 2JK3A 2ZMEC 2K27A 4U0YA 4KFCA 3LSTA 2XVCA 2E71A 5HLGA 3L2CA 3JRGA 2MFZA 3ZQIA 1UJ8A 2ZJQF 1YRNB 1LDDA 3H9JA 3UNGC 2RDPA 1XSDA 4E7LA 4OU0A 2E34A 2Z1DA 3B73A 2CUEA 5BOXA 1D0ZA 1Q1HA 2D45A 1WH5A 1F4KA 2DA3A 4KMUX 2DQLA 1YX3A 4CA0A 3TW7A 3HUGB 3I64A 5F64A 2QM3A 4BHPA 3OYKA 1HCRA 2JN6A 2IGKA 4LG0B 2BZTA 2FNAA 1U5TA 1FZPB 3BTCA 3ZMTA 4XLPF 1SFEA 3DCFA 3CCYA 4CZZA 2XF5A 1QU3A 4A6DA 2ZFUA 1ZGAA 4IHTA 2DU9A 3PFYA 3COAC 5E3LA 3BLYA 3DEUA 4ZJZA 3FHZA 5JLXA 2DT7B 3PO3J 2E1NA 4PK4A 2HVSA 3PNVA 1BOBA 5C3EJ 3G2BA 1O3QA 3OYMA 1MBFA 2E5ZA 3PSFA 4Q47A 3JW4A 3B6AA 5FROA 1MNDA 3SEZA 4U7DA 4RS8A 1LFBA 1VZ0A 1U0JA 4M3BA 1B8IA 2CW8A 1R6RA 1TW2A 3GW2A 3MQ0A 2VBWA 4TV7A 3FBIB 4E7ZA 2CH0A 3J7AO 3WTTC 4IOCF 3GFIA 2WC2A 3BZKA 2QQ8A 5B1BH 3AKZA 4UUSB 2M45A 2HZDA 1W4MA 3H3ZA 1RKWA 4HOBA 2VONA 5D4RA 3F8BA 3ONQA 3IH2A 2XB0X 3BDDA 1G3TA 1KYWA 3G3ZA 1F36A 3ISPA 1QNTA 2A6EF 3E6MA 5EZHA 2O3FA 4MGRA 4CCNA 5J47A 3U2RA 2HXOA 4I0AA 3QP6A 4CCJA 5IP9J 4YFKF 4LG3A 1QZYA 3KEQA 1ZYRF 3FWEA 3I59A 1FYMA 5BPDA 2X1EA 1X1PA 2XROA 2EK5A 2MH9A 1GXQA 1U8BA 4I02A 2DMTA 2EFOA 3WGHA 2EIKH 2Q1ZB 2KIFA 4IL6C 3HGGA 3J7ZI 3L00A 2IT0A 1YG2A 2RAEA 3MVPA 4ZYHA 5KHDA 4JX6A 2ETHA 2QBYB 2EILH 4G7OF 3I54A 4X6AJ 1XX5A 4BDYA 3T8RA 4Y17A 3J81K 2LRDA 2V1NA 1FLIA 2MH2A 3FMQA 3H3VK 4UXNA 2F4MB 1X4OA 3NAUA 4L5JA 3B6CA 1EA3A 1RRJA 1JUSA 4HNVA 3BTLA 5F0CA 4RGUA 2O0YA 4BQNA 3U21A 4BKXA 3IRQA 4PDKA 2GAUA 1WI3A 3NARA 1S7EA 2F4IA 2BW3B 3GTOJ 2NVYJ 3U9GA 1WCMJ 2PG4A 3F72A 3IAM2 2JWTA 5H2FC 1JKOC 1UHMA 2QQBA 2M4KA 1YFHA 2DLLA 1BIAA 1E2XA 1TWFJ 4U87A 1GV5A 1OYWA 2J5PA 1ITYA 2WV1A 1K79A 3CLOA 5AIQA 1WH7A 2EFPA 5CKTA 3CMMA 1U6GA 1ETWA 1Z7UA 1IW7F 1H9TA 4D0PA 3S17J 1T95A 1ZK8A 1O7LA 4II3A 1F43A 2KP6A 3IHUA 2EPFA 5LBQA 5IYBJ 3GTMJ 3JRBA 3L2RA 2HVRA 2HI3A 3HB9A 5ED4A 1ZHFA 1J09A 1YJ9I 3O3KA 3NWSA 4HW0A 1D5YA 1FMVA 2E36A 3K9TA 4F3QA 3TOAA 4DOZA 2ZKZA 3A01A 1RUNA 3C2GA 5HS8A 2W7NA 5FGMA 3J81Z 1PP8F 1VQ4I 2XGDA 4XLCA 1T56A 2Z16A 3ZOBA 1Y8QB 4XLEA 3HKZN 1UELB 4BBSJ 2L7KA 3HPHA 4KUMA 2K85A 5EGOB 1UG2A 1V4RA 1ZTRA 3I55I 3BR6A 3U1DA 2FXAA 3I9V2 3GTGJ 2EZHA 1QHGA 1Z6TA 2FNPA 2GLOA 2JRTA 1P6RA 2EJRA 2I8DA 1BM9A 3TO9A 2LTPA 4CICA 1T8IA 2Q2EB 2DDAA 3D5LA 3OYBA 3S1QJ 1RIOH 1RPWA 1AKHB 3Q0WA 4LD5A 3H3UA 1PUFA 4BGDA 1MMNA 1ODDA 3RPUD 1E17A 1U2WA 5E17F 1ON2A 1BC8C 2KZGA 4G6QA 1W1WE 1LEBA 2IGOA 4AIKA 2HDWA 1OMIA 2DW4A 2QUFA 4XSXF 3CO6C 1X4PA 2DPUA 2L02A 1KU9A 2VJ5A 3ZQHA 2UXNA 4RMNA 4P1WA 3E6BA 5ILVA 3PL8A 3H36A 2K3PA 3KZYA 4II2A 4BEHA 1SD4A 4N4NB 3DBLB 3SJMA 3GWZA 4NHJA 3AL0C 2ZJPF 2X1CA 2XF7A 1FOXA 4I76A 2BGCA 3RYPA 2NOGA 2F5EA 2F5CA 1DUXC 4RB2C 3NEUA 2XAHA 1WJAA 5LGTA 1S72I 4M3FA 4UUTA 2FMLA 1YS6A 3SQNA 5JVTA 1JUMA 5J6XA 4KISA 1MBHA 3GFLA 2O9LA 3DTKA 5JFRA 3OYAA 3HRTA 2W25A 4XKVA 3GZ6A 1V5GA 5HDGA 4M9ZA 4DJAA 1U5TB 2R7TA 2UV1A 4A3BJ 2O8XA 1NHAA 4LLNA 1G8XA 1D1BA 1XN7A 1W0UA 2DA5A 3R0JA 3KE2A 3VYRB 2HTJA 2W57A 1NG7A 5F0HA 3RQIA 4ZYGA 5L3DA 3DBHB 1SC7A 4V19K 4AU7A 4DNCA 2GWRA 3KCCA 3OYGA 1ZLKA 1FJLA 3BTIA 2X9DA 5D6EA 4BE1A 2YUSA 1Z67A 3M9AA 1DP7P 4A3GJ 5FLVA 4ENNA 5F04A 2OTLI 2P5LC 1HDDC 4CSWA 1E3HA 1JTXA 1Z77A 4D9JA 1H8AC 2LLKA 3D5RC 3I56I 1P2FA 4IPAA 5FD5A 1DU0A 2ESNA 4HV5A 3BR0A 1PUEE 3HDDA 1BA5A 1SEUA 3A0BC 4OIPF 4BXXJ 4F52A 2DAOA 2LSOA 1RNLA 3QU6A 2L4MA 4UB6C 2BVLA 2WAEA 3R4KA 4OIOF 1IZ1A 1HKQA 2R7ZJ 5GADJ 4CCLA 4C2MJ 3R60A 2CFXA 4B3AA 3CJRB 5EZGA 3I5UA 3E5UA 3VFZA 4XKWA 5K1YA 4E70A 1BI2A 3OL4A 2WAQA 2PMHA 3HM5A 4HX7A 2HOAA 3NWTA 3FKJA 1I50J 1ZARA 2M3AA 2PJRA 1H88C 1V5EA 3KIOA 1OQYA 1LPQA 2K7LA 2FX0A 4V2FA 2LFBA 3K2ZA 4DBRA 1D1CA 3MKWB 1OYYA 2HFHA 3H5RA 3OYDA 5CLSA 3P9IA 3C3WA 4AVZA 1OISA 5J40A 1YLFA 1WVRA 3HYIA 4Q4ZF 4A5MA 4HEA2 4GRIA 3F3XA 4KT6A 1LNWA 2JA7J 3LFKA 1NH3A 1JKRC 2V1UA 4W97A 1HQCA 2CW0F 3S1RJ 2JVHA 4PJJA 2STWA 1QPIA 3TO7A 3GTJJ 3FIWA 4I99C 4BS9A 1PVEA 3I4MJ 4ZDLA 2MGQA 4B1RA 2K4JA 3S1NJ 3M1EA 3L2WA 2DMPA 2LD5A 2W00A
chains in the Genus database with same CATH topology
4QLCU 1BI0A 5FLXK 3SZTA 3E97A 5H20A 1FT9A 1X3UA 5BMZA 2KRFA 2EA2A 3HRUA 2ESHA 4WX9A 1O3TA 1UHWA 3FF5A 2VBYA 5E20A 4HAMA 3GUDA 2ADUA 4NQWA 2KKOA 4BNCA 4OMZA 2CGPA 2VE8A 5DD8A 3E6DA 2XKPA 1W7PD 5LHGA 3N97A 5ICGA 3BY6A 2QENA 3TDUC 3JTHA 2KJCA 2KIMA 1YW9A 1W5TA 5FFXA 3SFZA 3DXJF 4OINF 2RGVA 5L3EA 3NRVA 2ZMEB 1IN5A 4LB6B 4PGGA 1L0OC 4BH9A 2FQ3A 2VODA 4EJUA 3FXRA 1P4XA 1RI7A 4KICA 4HDUA 2G7UA 1EH6A 3CUQC 2M8EA 3V4GA 4DQ2A 4EGZA 1F1ZA 2FBIA 1YO5C 5LHIA 1FYLA 2QQ9A 2NRAC 3BPXA 4AIJA 2HQNA 1BC7C 2A07F 2L01A 2PBIA 3KEOA 4EV0A 4LG0A 4M71A 3BJAA 1QGPA 1GHCA 3L9FA 2XAFA 4EJOA 2PLYA 5IT9Z 1IF1A 1Y0UA 1XMAA 3P9CA 4EMSA 4RB1A 3HSRA 4KN7X 1CGPA 3N4MA 5LLQA 4UVAA 3ROUA 3DF8A 3BJOA 1R5GA 1MJAA 2H94A 3SXYA 4P96A 4KIBA 1G6NA 1FYKA 5JHUA 4HBLA 1MDMB 3GYHX 2P6TA 4WXHA 1O3RA 1HSJA 3QPHA 4PCQA 2YX7A 1J0RA 1S3JA 5LGUA 1U3EM 3GXOA 4IVNA 1WWXA 2CG4A 5LGNA 3MWMA 1UB9A 4GO1A 4ESFA 2GQQA 4ZYDA 3FZVA 4XSZF 2J5OA 2FSWA 5DCFA 3WTVC 5E1XA 3W6JB 1QO0D 4ZZLA 1ONVA 2MA3A 1SMTA 1WRJA 4ZH4F 4A2UA 4MHGA 4LJZF 4IF4A 2CSOA 4RAYA 2HDCA 1SAXA 5E8GA 3MCZA 4EM0B 1I27A 2Y48A 5TJJA 2EFNA 3P7NA 3C18A 1XGSA 1J9IA 4R79A 3TDZC 4BHBA 4A0ZA 3G73A 1LDKB 1XCVA 4S04A 3DQVC 1YQAA 2XUBA 3RTRA 1LVAA 3T0YA 3M8EA 3Q9SA 1TQPA 1P92A 1FNNA 4LLLA 2Q0OA 1ZRDA 1JHFA 4IRHA 4A5NA 3TO6A 3V8KA 3J80Z 5HS9A 5HDNA 4U0VA 2DI3A 2ZJ2A 4B8XA 4LFUA 1HW5A 3WTUC 2E1CA 2Z33A 1FX7A 2ZBKA 3V7CA 3C1DA 3I59B 3LQQA 2YU3A 3WODF 4JBAA 4HF1A 4A12A 2EA4A 2ZMEA 3ZQ7A 1HW2A 2BYVE 4WWCA 2G9WA 4MTEA 5CVVA 1OKRA 1O3SA 4CDGA 3QU3A 4NB5A 1R7JA 1XSXA 1J7KA 3O6BB 2M1BA 5HLHA 2L54A 3EQLF 3I71A 3KP5A 2QYOA 2A61A 4CHUA 1USTA 3BWGA 5DDGA 4O6JA 3MFKA 3HRMA 2EFWA 3TQNA 1W5SA 2HGCA 2GA1A 3ABTA 1R58A 2X4HA 3D0SA 3REOA 2L3DA 1SFXA 1S8NA 4L5IA 4HV6A 2P8TA 1J5YA 4WCGA 4OOIA 1YTYA 1ON1A 2OZUA 2PMUA 2OQRA 2GXGA 4UHTA 4EVIA 4MQ9F 4HX8A 1J59A 2RNJA 3I58A 1TW3A 4EGYA 2GIVA 4HX4A 5LRSA 4MNUA 2Y75A 2FE3A 4M6XA 1XGOA 2GZWA 3M7GA 4IHSA 4M9SA 3RPUA 3IWZA 1CF7B 4A6EA 4CGZA 2IA2A 3I0TA 4RB0A 3JAMK 3WGIA 3K1NA 4CYDA 2XAGA 2WTEA 2IRFG 4G7HF 1LDJA 2ZNYA 3SHFA 3DPTA 2ZFWA 2C6YA 4KNYA 3WTXC 3P9KA 1HXDA 3EYIA 3HRSA 3WE3A 2VT3A 3PFIA 5FD6A 1CF7A 5ILSA 3RDIA 2O61A 1G3WA 4I01A 4A0YA 1WI9A 4L9NA 2KJBA 4KN4X 5E8IA 2EWNA 1BIBA 3HSEA 2DFIA 4HQEA 4WF2A 1F5TA 1Z6RA 1FPQA 1D5VA 2STTA 2P7VB 2IA1A 1LQ1A 4XRFA 2PFBA 1XGMA 2A69F 4KYWA 3C7JA 5FLXZ 4RGRA 3ZMVA 1Z1DA 2LF8A 2LF7A 1ZG5A 5LHHA 2Z5UA 3LA7A 2FOKA 3E6CC 1BOAA 1TNTA 4ZYEA 3R61A 1B6AA 1FBUA 1ZRCA 3WU0A 4OMYA 1TBXA 2RQPA 1FOKA 3SZPA 2DO7A 2F2EA 3K1PA 2ZNZA 5L3CA 2FEZA 1IXSB 1TTYA 4FX0A 5FO5A 2VN2A 2YX4A 4UV9A 4ENJA 5HLIA 1QQIA 3ZMUA 3W6KB 2LKPA 4H0EA 1HW1A 3E5QA 1DPUA 1FWZA 1WQ2A 1ULYA 3EYYA 1TQIA 4I0BA 1MKMA 5E1ZB 2MBFA 1JE8A 3T8TA 1MJ9A 2IVMA 3AAFA 1KGSA 3VEPA 4IRIA 3BPVA 1I1SA 3WTZA 1MJBA 4MEXF 3IWFA 4B09A 1R1TA 5ICEA 1T38A 1XDUA 3EUHA 5CVRA 3FXUA 1K7AA 3VODA 2MC3A 5CVJA 2VXZA 4EJVA 5D5WB 2F5DA 3ZN1A 4HLYA 2TDXA 3WTSC 4L0ZB 3GF2A 3RPQA 2VOOA 1EH8A 3ZMDA 2AS5F 2ISZA 3F8CA 2HQRA 1S7AA 2JTVA 2XAJA 1R36A 2HYGD 1XB4A 6PAXA 4N9IA 1ZGJA 2Z99A 4XBFA 3RYRA 3FX3A 3HTSB 4G94A 1IRFA 4EJWA 4Y15A 1H0MA 3WE2A 1ZREA 3RI4A 2DK8A 5K5OA 1ZG3A 1B4AA 2HKXA 3T1BA 2IA0A 5CJ9A 2X0LA 2O6GE 4BHCA 4KIGA 1U78A 1XGNA 1B9MA 1K78A 5D8LB 1ZRFA 3TKYA 4GCVA 4M6YA 2RV8A 1MZBA 2HZTA 3I4PA 1RZ4A 3F21A 5D4SA 1T6SA 1BBYA 4PGHA 2YSRA 2ELHA 4G9YA 4ON0A 2MD5A 1QPMA 3IKTA 3BP8A 3GZ5A 5D5UB 4LMYA 1L3LA 2GA2A 2NS0A 5ICFA 1LB2A 4MEYF 4EM2A 1B9NA 2PQ8A 3V8LA 1BI1A 1FC3A 1SD6A 2DT5A 1XDSA 4GXOA 1R00A 2FU4A 4L9TA 4YFXF 1Z05A 5H6RA 4HZFA 3KETA 1TLHB 1IUYA 1USSA 3ZMSA 4Q48A 1DDNA 3K0LA 1AWCA 4Z2YA 3KP7A 1ZN2A 2RC4A 3CDHA 5BS6A 2W84A 3DFGA 1QBJA 1R1VA 2HOEA 2IPQX 2EV0A 3E5XA 4MTDA 2A68F 1FBQA 4UVBA 4I09A 3OOPA 3L09A 3BOQA 4ESBA 3R0AA 2LDUA 5ERIA 3MAJA 4HDVA 1T98A 5LRRA 3S2WA 3WTWC 5KVRA 4P9FA 3F22A 2BV6A 2WV0A 1YW7A 2Z3YA 4PZJA 2JT1A 3TOBA 2IP2A 2R7FA 2A5YB 2HR3A 3GEZA 5E18F 2ZCWA 4WXCA 5DCMB 2AXLA 1FP1D 2K02A 2YPRA 2P4WA 5CVUA 3HHHA 4KA4A 1UFMA 2DK5A 2XV4S 2E7WA 3ULQB 2D2WA 3M8FA 5FB2A 2QQAA 5EEHA 2BBYA 4AD9A 4IRGA 5DUIA 2FMYA 3OV8A 4R8HA 4UVCA 1Z91A 5L3FA 3LAPA 4UUVA 5TRDA 2W85A 1KA8A 5H6QA 1EH7A 4CO8A 3CJNA 5EEGA 3E3VA 3LWFA 4F7ZA 3FXQA 1T39A 2OBPA 2OD5A 1H9GA 5J8FA 1B59A 5HDKA 4OIQF 4M73A 3FM5A 3NQOA 1F9NA 5A2QZ 3KZZA 3KLNA 2XASA 2A6HF 3QP5A 3I53A 1KQ0A 5A2QK 4O5VA 3F8NA 3ERED 4BYYA 3EDPA 3GFJA 1G4DA 4FHTA 2CYYA 5HOOA 2H6BA 5D8KB 5IT3A 4R1HA 4M74A 2ZO4A 3FMSA 1D8JA 2B0LA 2Z9OA 2QZ8A 4P55A 1MGTA 1IN7A 5LEKA 1R5HA 3RJPA 4YFNF 1WSUA 3QAHA 3JSOA 1IRGA 3HSFA 3CUOA 2RN7A 4U7BA 2V1XA 3O2PE 1K6OA 2OZ6A 1BJAA 1B1BA 1PDNC 5FFZA 2V9VA 2JPBA 2G7HA 1GXPA 3K1MA 2R3SA 2V79A 3V7SA 2QVOA 3ZP5A 1D3YA 1V3FA 2CWEA 2IJLA 2KIUA 2OQGA 4EM1A 4A0XA 2XIGA 3WG9A 2L4AA 4U0WA 1YIOA 5DUKA 3H92A 2P6SA 1REPC 5F1RA 2MLKA 4ESJA 1IN4A 2EV6A 3F6VA 1OYIA 2R7DA 1I1GA 1ZH5A 3LA3A 1WKMA 4I98B 1R22A 1IN8A 1KU3A 3KP6A 2YR2A 1O7FA 1J75A 4HYEA 3GLXA 4HLXA 2BE5F 5E1WA 2NAZA 3ZN0A 4GYGA 4YIFA 3GO5A 3CO7C 4L9JA 3TGNA 2NYXA 3F8MA 4AIHA 5DCMA 1UCRA 1A04A 3QPTA 1KYZA 3GVAA 3MZHA 4BQAA 4YIIA 4LB5A 4GGGA 1SFUA 4G6DA 5KK1A 2JSCA 4KT5C 2XGXA 2UZKA 5DEQA 3RIRA 1SMYF 2OAZA 2XAQA 2P5VA 1S6LA 1EV7A 2FBKA 1GVJA 3ECHA 3ML6A 2F5FA 3KLOA 2FF4A 2HEOA 2Q8KA 3F23A 1HSTA 4L9VA 3WGGA 3FM3A 4CXFA 1XCBA 5BPIA 3ELKA 3HUGA 1TQMA 1G3YA 2FBHA 3HIFA 2QBYA 4N9HA 2XKOA 1KQ9A 3IL2A 4LK1F 1KU2A 2GXBA 3WTYC 1XMKA 2D1VA 4EJTA 1D8KA 3GX4X 5HVQC 3VOEA 3T5XA 2MLGA 2O03A 2CO5A 1OPCA 3IRRA 2K86A 3F6OA 3F8FA 5L3GA 3CUQB 5IT9K 4G8XA 4LGWA 3BROA 5L3BA 2H27A 3PQKA 2ACJA 2VOPA 4ZZDA 5DYMA 2DQRA 4JK1X 4ENKA 2VC0A 3BJ6A 1QZZA 1JHHA 5JR3A 1G3SA 2W24A 1S29A 3LA2A 4BXUA 3JSPA 2UWMA 2UXXA 4K2EA 3ECOA 1VTNC 1HBXG 4YG2F 3ABUA 5DV5A 4OIRF 1HKSA 2H6CA 2HYFA 1FSEA 3RKXA 3L7WA 1PP7U 2Y0MA 5BQTA 3KP4A 3JAMZ 5HS7A 3HOSA 4HF2A 3B02A 1R1UA 3HOTA 3MZYA 1SD7A 1T0FA 4QWQA 2DBBA 4Y13A 3DPLC 5LEJA 2LNBA 2WWYA 2VT2A 2E7XA 1AOYA 1FBSA 3J80K 1YS7A 5ICCA 3KFWX 1BI3A 1LEAA 1FY7A 2JZYA 2M30A 2PJPA 4KIFA 4P9UA 1T2KA 1P4WA 2ISYA 1LJ9A 1JXSA 1U8RA 2M5WA 3RKYA 4HQMA 4M72A 2QWWA 1YYVA 2HTSA 2A3SA 3JTGA 5AONA 2HS5A 4LK0F 2DPDA 1STZA 2H09A 3DP7A 4UNOA 3CUQA 4HA8A 1SD5A 2OU2A 4KDPA 5CYVA 2DTRA 3ZMZA 4P5OA 3LQRA 1S7OA 3HTUA 3HHGA 1KU7A 3MEXA 2D1HA 2V6CA 1C0WA 1YW8A 4WXDA 1W7PA 4ETSA 1ZG1A 2K4BA 4ENMA 5D5XB 1HKTA 2M87A 4HF0A 3IC7A 4AVPA 3Q9VA 2EB7A 3FMRA 1I5ZA 4AWXB 5AIPA 2HKOA 1XD7A 2NNNA 4O3MA 5CVIA 1I6XA 1P4AA 3LAJA 5K5RA 1O57A 4FT8A 1R23A 2COMA 3EETA 4RAZA 5D6FA 1RUOA 1IN6A 2P5KA 4I7HA 1MDMA 5K5QA 1W7PB 4M9XA 4Q5SF 2EV5A 1JGSA 1U5TC 4UV8A 2VBXA 3IKVA 5J8CA 1DPRA 2ZXJA 1FSHA 1J2XA 3V7RA 2VC1A 4BAYA 3ZPLA 3DV8A 1IAWA 1MD0A 4LLGF 3QOPA 2XRNA 4L18B 1IXCA 2HWVA 5F6FA 2VBZA 4EQQA 3BZ6A 2CQKA 5ILUA 2PI0A 4IJAA 5D5VB 2Q2EA 3VB2A 3CTAA 4RGSA 3K69A 2RKHA 2RVCA 4RB3C 3GFMA 3Q5FA 1BN5A 3DKWA 2VE9A 4FX4A 2XHKA 4MQVA 4I2OA 4U88A 4IXAA 1ZLJA 2JPCA 2IW5A 1KQ8A 1FP2A 5DD4A 2EFQA 2FA5A 1OR7A 4ASNA 4S05A 3KP2A 4RGXA 1TNSA 2OA4A 1Z9CA 3PQJA 2PN6A 4KMFA 1IXRC 3WU1B 2QLZA 3RKWA 1ZAOA 1XSVA 4WK8F 2PEXA 2V1DA 4JQFA 4L0YB 2P7CB 2BEOA 4XLNF 3QRFF 3V8JA 2NNYA 5JI6A 1K78B 3R6SA 2FRHA 3KP3A 4GYIA 4N0BA 4G7ZF 4U0YA 2K27A 4KFCA 3LSTA 2XVCA 5HLGA 3L2CA 1LDDA 2RDPA 1XSDA 4OU0A 3B73A 5BOXA 1Q1HA 2D45A 1F4KA 4KMUX 2DQLA 3I64A 5F64A 2QM3A 4BHPA 4LG0B 2FNAA 1U5TA 1FZPB 3ZMTA 4XLPF 1SFEA 4CZZA 4A6DA 1ZGAA 4IHTA 2DU9A 3COAC 3DEUA 3FHZA 2E1NA 1O3QA 4Q47A 3JW4A 4U7DA 4RS8A 1TW2A 3GW2A 3MQ0A 2VBWA 4TV7A 3J7AO 3WTTC 3GFIA 2WC2A 2M45A 1W4MA 3H3ZA 2VONA 4HOBA 5D4RA 3F8BA 3BDDA 1G3TA 1KYWA 3G3ZA 3ISPA 1QNTA 2A6EF 3E6MA 2O3FA 4MGRA 3U2RA 4I0AA 3QP6A 4YFKF 1QZYA 3KEQA 1ZYRF 3FWEA 3I59A 1FYMA 5BPDA 2XROA 2EK5A 2MH9A 1GXQA 4I02A 2EFOA 3WGHA 2KIFA 3L00A 2IT0A 1YG2A 4ZYHA 2QBYB 2ETHA 4G7OF 3I54A 3T8RA 4Y17A 3J81K 1FLIA 2MH2A 3FMQA 4UXNA 4L5JA 4RGUA 2O0YA 3IRQA 4PDKA 2GAUA 3U9GA 2PG4A 3F72A 1UHMA 2QQBA 1YFHA 2DLLA 1BIAA 1E2XA 1OYWA 2J5PA 1K79A 3CLOA 5AIQA 2EFPA 1U6GA 1Z7UA 1H9TA 1IW7F 4D0PA 1O7LA 3IHUA 5LBQA 5ED4A 1ZHFA 3O3KA 4HW0A 3K9TA 3TOAA 2ZKZA 1RUNA 5HS8A 5FGMA 3J81Z 1PP8F 4KUMA 1V4RA 3U1DA 2FXAA 1Z6TA 2FNPA 2JRTA 1P6RA 2EJRA 1BM9A 3TO9A 4CICA 3D5LA 1RIOH 4LD5A 3H3UA 1ODDA 1E17A 1U2WA 5E17F 1ON2A 1BC8C 4G6QA 1LEBA 4AIKA 1OMIA 2DW4A 2QUFA 4XSXF 3CO6C 2DPUA 2L02A 1KU9A 2UXNA 5ILVA 3E6BA 3KZYA 1SD4A 4NHJA 3GWZA 2BGCA 3RYPA 2F5EA 1DUXC 2F5CA 4RB2C 3NEUA 2XAHA 5LGTA 2FMLA 1YS6A 3SQNA 5JVTA 5J6XA 3GFLA 5JFRA 3HRTA 2W25A 3GZ6A 5HDGA 4M9ZA 1U5TB 2O8XA 1NHAA 4LLNA 1XN7A 3R0JA 3KE2A 2HTJA 2W57A 4ZYGA 5L3DA 4DNCA 2GWRA 3KCCA 1ZLKA 5D6EA 3M9AA 1DP7P 4ENNA 2P5LC 1P2FA 4IPAA 5FD5A 2ESNA 4HV5A 1PUEE 4OIPF 2DAOA 2LSOA 1RNLA 3QU6A 2L4MA 4OIOF 3R4KA 1IZ1A 1HKQA 3R60A 2CFXA 3I5UA 3E5UA 3VFZA 5K1YA 4E70A 1BI2A 2PMHA 4HX7A 1ZARA 2K7LA 3K2ZA 1OYYA 2HFHA 5CLSA 3P9IA 3C3WA 1YLFA 3HYIA 4Q4ZF 4A5MA 3F3XA 1LNWA 3LFKA 2V1UA 1HQCA 2CW0F 2STWA 3TO7A 2K4JA 3M1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QLC U;  1BI0 A;  5FLX K;  3SZT A;  3E97 A;  5H20 A;  1FT9 A;  1X3U A;  5BMZ A;  2KRF A;  2EA2 A;  3HRU A;  2ESH A;  4WX9 A;  1O3T A;  1UHW A;  3FF5 A;  2VBY A;  5E20 A;  4HAM A;  3GUD A;  2ADU A;  4NQW A;  2KKO A;  4BNC A;  4OMZ A;  2CGP A;  2VE8 A;  5DD8 A;  3E6D A;  2XKP A;  1W7P D;  5LHG A;  3N97 A;  5ICG A;  3BY6 A;  2QEN A;  3TDU C;  3JTH A;  2KJC A;  2KIM A;  1YW9 A;  1W5T A;  5FFX A;  3SFZ A;  3DXJ F;  4OIN F;  2RGV A;  5L3E A;  3NRV A;  2ZME B;  1IN5 A;  4LB6 B;  4PGG A;  1L0O C;  4BH9 A;  2FQ3 A;  2VOD A;  4EJU A;  3FXR A;  1P4X A;  1RI7 A;  4KIC A;  4HDU A;  2G7U A;  1EH6 A;  3CUQ C;  2M8E A;  3V4G A;  4DQ2 A;  4EGZ A;  1F1Z A;  2FBI A;  1YO5 C;  5LHI A;  1FYL A;  2QQ9 A;  2NRA C;  3BPX A;  4AIJ A;  2HQN A;  1BC7 C;  2A07 F;  2L01 A;  2PBI A;  3KEO A;  4EV0 A;  4LG0 A;  4M71 A;  3BJA A;  1QGP A;  1GHC A;  3L9F A;  2XAF A;  4EJO A;  2PLY A;  5IT9 Z;  1IF1 A;  1Y0U A;  1XMA A;  3P9C A;  4EMS A;  4RB1 A;  3HSR A;  4KN7 X;  1CGP A;  3N4M A;  5LLQ A;  4UVA A;  3ROU A;  3DF8 A;  3BJO A;  1R5G A;  1MJA A;  2H94 A;  3SXY A;  4P96 A;  4KIB A;  1G6N A;  1FYK A;  5JHU A;  4HBL A;  1MDM B;  3GYH X;  2P6T A;  4WXH A;  1O3R A;  1HSJ A;  3QPH A;  4PCQ A;  2YX7 A;  1J0R A;  1S3J A;  5LGU A;  1U3E M;  3GXO A;  4IVN A;  1WWX A;  2CG4 A;  5LGN A;  3MWM A;  1UB9 A;  4GO1 A;  4ESF A;  2GQQ A;  4ZYD A;  3FZV A;  4XSZ F;  2J5O A;  2FSW A;  5DCF A;  3WTV C;  5E1X A;  3W6J B;  1QO0 D;  4ZZL A;  1ONV A;  2MA3 A;  1SMT A;  1WRJ A;  4ZH4 F;  4A2U A;  4MHG A;  4LJZ F;  4IF4 A;  2CSO A;  4RAY A;  2HDC A;  1SAX A;  5E8G A;  3MCZ A;  4EM0 B;  1I27 A;  2Y48 A;  5TJJ A;  2EFN A;  3P7N A;  3C18 A;  1XGS A;  1J9I A;  4R79 A;  3TDZ C;  4BHB A;  4A0Z A;  3G73 A;  1LDK B;  1XCV A;  4S04 A;  3DQV C;  1YQA A;  2XUB A;  3RTR A;  1LVA A;  3T0Y A;  3M8E A;  3Q9S A;  1TQP A;  1P92 A;  1FNN A;  4LLL A;  2Q0O A;  1ZRD A;  1JHF A;  4IRH A;  4A5N A;  3TO6 A;  3V8K A;  3J80 Z;  5HS9 A;  5HDN A;  4U0V A;  2DI3 A;  2ZJ2 A;  4B8X A;  4LFU A;  1HW5 A;  3WTU C;  2E1C A;  2Z33 A;  1FX7 A;  2ZBK A;  3V7C A;  3C1D A;  3I59 B;  3LQQ A;  2YU3 A;  3WOD F;  4JBA A;  4HF1 A;  4A12 A;  2EA4 A;  2ZME A;  3ZQ7 A;  1HW2 A;  2BYV E;  4WWC A;  2G9W A;  4MTE A;  5CVV A;  1OKR A;  1O3S A;  4CDG A;  3QU3 A;  4NB5 A;  1R7J A;  1XSX A;  1J7K A;  3O6B B;  2M1B A;  5HLH A;  2L54 A;  3EQL F;  3I71 A;  3KP5 A;  2QYO A;  2A61 A;  4CHU A;  1UST A;  3BWG A;  5DDG A;  4O6J A;  3MFK A;  3HRM A;  2EFW A;  3TQN A;  1W5S A;  2HGC A;  2GA1 A;  3ABT A;  1R58 A;  2X4H A;  3D0S A;  3REO A;  2L3D A;  1SFX A;  1S8N A;  4L5I A;  4HV6 A;  2P8T A;  1J5Y A;  4WCG A;  4OOI A;  1YTY A;  1ON1 A;  2OZU A;  2PMU A;  2OQR A;  2GXG A;  4UHT A;  4EVI A;  4MQ9 F;  4HX8 A;  1J59 A;  2RNJ A;  3I58 A;  1TW3 A;  4EGY A;  2GIV A;  4HX4 A;  5LRS A;  4MNU A;  2Y75 A;  2FE3 A;  4M6X A;  1XGO A;  2GZW A;  3M7G A;  4IHS A;  4M9S A;  3RPU A;  3IWZ A;  1CF7 B;  4A6E A;  4CGZ A;  2IA2 A;  3I0T A;  4RB0 A;  3JAM K;  3WGI A;  3K1N A;  4CYD A;  2XAG A;  2WTE A;  2IRF G;  4G7H F;  1LDJ A;  2ZNY A;  3SHF A;  3DPT A;  2ZFW A;  2C6Y A;  4KNY A;  3WTX C;  3P9K A;  1HXD A;  3EYI A;  3HRS A;  3WE3 A;  2VT3 A;  3PFI A;  5FD6 A;  1CF7 A;  5ILS A;  3RDI A;  2O61 A;  1G3W A;  4I01 A;  4A0Y A;  1WI9 A;  4L9N A;  2KJB A;  4KN4 X;  5E8I A;  2EWN A;  1BIB A;  3HSE A;  2DFI A;  4HQE A;  4WF2 A;  1F5T A;  1Z6R A;  1FPQ A;  1D5V A;  2STT A;  2P7V B;  2IA1 A;  1LQ1 A;  4XRF A;  2PFB A;  1XGM A;  2A69 F;  4KYW A;  3C7J A;  5FLX Z;  4RGR A;  3ZMV A;  1Z1D A;  2LF8 A;  2LF7 A;  1ZG5 A;  5LHH A;  2Z5U A;  3LA7 A;  2FOK A;  3E6C C;  1BOA A;  1TNT A;  4ZYE A;  3R61 A;  1B6A A;  1FBU A;  1ZRC A;  3WU0 A;  4OMY A;  1TBX A;  2RQP A;  1FOK A;  3SZP A;  2DO7 A;  2F2E A;  3K1P A;  2ZNZ A;  5L3C A;  2FEZ A;  1IXS B;  1TTY A;  4FX0 A;  5FO5 A;  2VN2 A;  2YX4 A;  4UV9 A;  4ENJ A;  5HLI A;  1QQI A;  3ZMU A;  3W6K B;  2LKP A;  4H0E A;  1HW1 A;  3E5Q A;  1DPU A;  1FWZ A;  1WQ2 A;  1ULY A;  3EYY A;  1TQI A;  4I0B A;  1MKM A;  5E1Z B;  2MBF A;  1JE8 A;  3T8T A;  1MJ9 A;  2IVM A;  3AAF A;  1KGS A;  3VEP A;  4IRI A;  3BPV A;  1I1S A;  3WTZ A;  1MJB A;  4MEX F;  3IWF A;  4B09 A;  1R1T A;  5ICE A;  1T38 A;  1XDU A;  3EUH A;  5CVR A;  3FXU A;  1K7A A;  3VOD A;  2MC3 A;  5CVJ A;  2VXZ A;  4EJV A;  5D5W B;  2F5D A;  3ZN1 A;  4HLY A;  2TDX A;  3WTS C;  4L0Z B;  3GF2 A;  3RPQ A;  2VOO A;  1EH8 A;  3ZMD A;  2AS5 F;  2ISZ A;  3F8C A;  2HQR A;  1S7A A;  2JTV A;  2XAJ A;  1R36 A;  2HYG D;  1XB4 A;  6PAX A;  4N9I A;  1ZGJ A;  2Z99 A;  4XBF A;  3RYR A;  3FX3 A;  3HTS B;  4G94 A;  1IRF A;  4EJW A;  4Y15 A;  1H0M A;  3WE2 A;  1ZRE A;  3RI4 A;  2DK8 A;  5K5O A;  1ZG3 A;  1B4A A;  2HKX A;  3T1B A;  2IA0 A;  5CJ9 A;  2X0L A;  2O6G E;  4BHC A;  4KIG A;  1U78 A;  1XGN A;  1B9M A;  1K78 A;  5D8L B;  1ZRF A;  3TKY A;  4GCV A;  4M6Y A;  2RV8 A;  1MZB A;  2HZT A;  3I4P A;  1RZ4 A;  3F21 A;  5D4S A;  1T6S A;  1BBY A;  4PGH A;  2YSR A;  2ELH A;  4G9Y A;  4ON0 A;  2MD5 A;  1QPM A;  3IKT A;  3BP8 A;  3GZ5 A;  5D5U B;  4LMY A;  1L3L A;  2GA2 A;  2NS0 A;  5ICF A;  1LB2 A;  4MEY F;  4EM2 A;  1B9N A;  2PQ8 A;  3V8L A;  1BI1 A;  1FC3 A;  1SD6 A;  2DT5 A;  1XDS A;  4GXO A;  1R00 A;  2FU4 A;  4L9T A;  4YFX F;  1Z05 A;  5H6R A;  4HZF A;  3KET A;  1TLH B;  1IUY A;  1USS A;  3ZMS A;  4Q48 A;  1DDN A;  3K0L A;  1AWC A;  4Z2Y A;  3KP7 A;  1ZN2 A;  2RC4 A;  3CDH A;  5BS6 A;  2W84 A;  3DFG A;  1QBJ A;  1R1V A;  2HOE A;  2IPQ X;  2EV0 A;  3E5X A;  4MTD A;  2A68 F;  1FBQ A;  4UVB A;  4I09 A;  3OOP A;  3L09 A;  3BOQ A;  4ESB A;  3R0A A;  2LDU A;  5ERI A;  3MAJ A;  4HDV A;  1T98 A;  5LRR A;  3S2W A;  3WTW C;  5KVR A;  4P9F A;  3F22 A;  2BV6 A;  2WV0 A;  1YW7 A;  2Z3Y A;  4PZJ A;  2JT1 A;  3TOB A;  2IP2 A;  2R7F A;  2A5Y B;  2HR3 A;  3GEZ A;  5E18 F;  2ZCW A;  4WXC A;  5DCM B;  2AXL A;  1FP1 D;  2K02 A;  2YPR A;  2P4W A;  5CVU A;  3HHH A;  4KA4 A;  1UFM A;  2DK5 A;  2XV4 S;  2E7W A;  3ULQ B;  2D2W A;  3M8F A;  5FB2 A;  2QQA A;  5EEH A;  2BBY A;  4AD9 A;  4IRG A;  5DUI A;  2FMY A;  3OV8 A;  4R8H A;  4UVC A;  1Z91 A;  5L3F A;  3LAP A;  4UUV A;  5TRD A;  2W85 A;  1KA8 A;  5H6Q A;  1EH7 A;  4CO8 A;  3CJN A;  5EEG A;  3E3V A;  3LWF A;  4F7Z A;  3FXQ A;  1T39 A;  2OBP A;  2OD5 A;  1H9G A;  5J8F A;  1B59 A;  5HDK A;  4OIQ F;  4M73 A;  3FM5 A;  3NQO A;  1F9N A;  5A2Q Z;  3KZZ A;  3KLN A;  2XAS A;  2A6H F;  3QP5 A;  3I53 A;  1KQ0 A;  5A2Q K;  4O5V A;  3F8N A;  3ERE D;  4BYY A;  3EDP A;  3GFJ A;  1G4D A;  4FHT A;  2CYY A;  5HOO A;  2H6B A;  5D8K B;  5IT3 A;  4R1H A;  4M74 A;  2ZO4 A;  3FMS A;  1D8J A;  2B0L A;  2Z9O A;  2QZ8 A;  4P55 A;  1MGT A;  1IN7 A;  5LEK A;  1R5H A;  3RJP A;  4YFN F;  1WSU A;  3QAH A;  3JSO A;  1IRG A;  3HSF A;  3CUO A;  2RN7 A;  4U7B A;  2V1X A;  3O2P E;  1K6O A;  2OZ6 A;  1BJA A;  1B1B A;  1PDN C;  5FFZ A;  2V9V A;  2JPB A;  2G7H A;  1GXP A;  3K1M A;  2R3S A;  2V79 A;  3V7S A;  2QVO A;  3ZP5 A;  1D3Y A;  1V3F A;  2CWE A;  2IJL A;  2KIU A;  2OQG A;  4EM1 A;  4A0X A;  2XIG A;  3WG9 A;  2L4A A;  4U0W A;  1YIO A;  5DUK A;  3H92 A;  2P6S A;  1REP C;  5F1R A;  2MLK A;  4ESJ A;  1IN4 A;  2EV6 A;  3F6V A;  1OYI A;  2R7D A;  1I1G A;  1ZH5 A;  3LA3 A;  1WKM A;  4I98 B;  1R22 A;  1IN8 A;  1KU3 A;  3KP6 A;  2YR2 A;  1O7F A;  1J75 A;  4HYE A;  3GLX A;  4HLX A;  2BE5 F;  5E1W A;  2NAZ A;  3ZN0 A;  4GYG A;  4YIF A;  3GO5 A;  3CO7 C;  4L9J A;  3TGN A;  2NYX A;  3F8M A;  4AIH A;  5DCM A;  1UCR A;  1A04 A;  3QPT A;  1KYZ A;  3GVA A;  3MZH A;  4BQA A;  4YII A;  4LB5 A;  4GGG A;  1SFU A;  4G6D A;  5KK1 A;  2JSC A;  4KT5 C;  2XGX A;  2UZK A;  5DEQ A;  3RIR A;  1SMY F;  2OAZ A;  2XAQ A;  2P5V A;  1S6L A;  1EV7 A;  2FBK A;  1GVJ A;  3ECH A;  3ML6 A;  2F5F A;  3KLO A;  2FF4 A;  2HEO A;  2Q8K A;  3F23 A;  1HST A;  4L9V A;  3WGG A;  3FM3 A;  4CXF A;  1XCB A;  5BPI A;  3ELK A;  3HUG A;  1TQM A;  1G3Y A;  2FBH A;  3HIF A;  2QBY A;  4N9H A;  2XKO A;  1KQ9 A;  3IL2 A;  4LK1 F;  1KU2 A;  2GXB A;  3WTY C;  1XMK A;  2D1V A;  4EJT A;  1D8K A;  3GX4 X;  5HVQ C;  3VOE A;  3T5X A;  2MLG A;  2O03 A;  2CO5 A;  1OPC A;  3IRR A;  2K86 A;  3F6O A;  3F8F A;  5L3G A;  3CUQ B;  5IT9 K;  4G8X A;  4LGW A;  3BRO A;  5L3B A;  2H27 A;  3PQK A;  2ACJ A;  2VOP A;  4ZZD A;  5DYM A;  2DQR A;  4JK1 X;  4ENK A;  2VC0 A;  3BJ6 A;  1QZZ A;  1JHH A;  5JR3 A;  1G3S A;  2W24 A;  1S29 A;  3LA2 A;  4BXU A;  3JSP A;  2UWM A;  2UXX A;  4K2E A;  3ECO A;  1VTN C;  1HBX G;  4YG2 F;  3ABU A;  5DV5 A;  4OIR F;  1HKS A;  2H6C A;  2HYF A;  1FSE A;  3RKX A;  3L7W A;  1PP7 U;  2Y0M A;  5BQT A;  3KP4 A;  3JAM Z;  5HS7 A;  3HOS A;  4HF2 A;  3B02 A;  1R1U A;  3HOT A;  3MZY A;  1SD7 A;  1T0F A;  4QWQ A;  2DBB A;  4Y13 A;  3DPL C;  5LEJ A;  2LNB A;  2WWY A;  2VT2 A;  2E7X A;  1AOY A;  1FBS A;  3J80 K;  1YS7 A;  5ICC A;  3KFW X;  1BI3 A;  1LEA A;  1FY7 A;  2JZY A;  2M30 A;  2PJP A;  4KIF A;  4P9U A;  1T2K A;  1P4W A;  2ISY A;  1LJ9 A;  1JXS A;  1U8R A;  2M5W A;  3RKY A;  4HQM A;  4M72 A;  2QWW A;  1YYV A;  2HTS A;  2A3S A;  3JTG A;  5AON A;  2HS5 A;  4LK0 F;  2DPD A;  1STZ A;  2H09 A;  3DP7 A;  4UNO A;  3CUQ A;  4HA8 A;  1SD5 A;  2OU2 A;  4KDP A;  5CYV A;  2DTR A;  3ZMZ A;  4P5O A;  3LQR A;  1S7O A;  3HTU A;  3HHG A;  1KU7 A;  3MEX A;  2D1H A;  2V6C A;  1C0W A;  1YW8 A;  4WXD A;  1W7P A;  4ETS A;  1ZG1 A;  2K4B A;  4ENM A;  5D5X B;  1HKT A;  2M87 A;  4HF0 A;  3IC7 A;  4AVP A;  3Q9V A;  2EB7 A;  3FMR A;  1I5Z A;  4AWX B;  5AIP A;  2HKO A;  1XD7 A;  2NNN A;  4O3M A;  5CVI A;  1I6X A;  1P4A A;  3LAJ A;  5K5R A;  1O57 A;  4FT8 A;  1R23 A;  2COM A;  3EET A;  4RAZ A;  5D6F A;  1RUO A;  1IN6 A;  2P5K A;  4I7H A;  1MDM A;  5K5Q A;  1W7P B;  4M9X A;  4Q5S F;  2EV5 A;  1JGS A;  1U5T C;  4UV8 A;  2VBX A;  3IKV A;  5J8C A;  1DPR A;  2ZXJ A;  1FSH A;  1J2X A;  3V7R A;  2VC1 A;  4BAY A;  3ZPL A;  3DV8 A;  1IAW A;  1MD0 A;  4LLG F;  3QOP A;  2XRN A;  4L18 B;  1IXC A;  2HWV A;  5F6F A;  2VBZ A;  4EQQ A;  3BZ6 A;  2CQK A;  5ILU A;  2PI0 A;  4IJA A;  5D5V B;  2Q2E A;  3VB2 A;  3CTA A;  4RGS A;  3K69 A;  2RKH A;  2RVC A;  4RB3 C;  3GFM A;  3Q5F A;  1BN5 A;  3DKW A;  2VE9 A;  4FX4 A;  2XHK A;  4MQV A;  4I2O A;  4U88 A;  4IXA A;  1ZLJ A;  2JPC A;  2IW5 A;  1KQ8 A;  1FP2 A;  5DD4 A;  2EFQ A;  2FA5 A;  1OR7 A;  4ASN A;  4S05 A;  3KP2 A;  4RGX A;  1TNS A;  2OA4 A;  1Z9C A;  3PQJ A;  2PN6 A;  4KMF A;  1IXR C;  3WU1 B;  2QLZ A;  3RKW A;  1ZAO A;  1XSV A;  4WK8 F;  2PEX A;  2V1D A;  4JQF A;  4L0Y B;  2P7C B;  2BEO A;  4XLN F;  3QRF F;  3V8J A;  2NNY A;  5JI6 A;  1K78 B;  3R6S A;  2FRH A;  3KP3 A;  4GYI A;  4N0B A;  4G7Z F;  4U0Y A;  2K27 A;  4KFC A;  3LST A;  2XVC A;  5HLG A;  3L2C A;  1LDD A;  2RDP A;  1XSD A;  4OU0 A;  3B73 A;  5BOX A;  1Q1H A;  2D45 A;  1F4K A;  4KMU X;  2DQL A;  3I64 A;  5F64 A;  2QM3 A;  4BHP A;  4LG0 B;  2FNA A;  1U5T A;  1FZP B;  3ZMT A;  4XLP F;  1SFE A;  4CZZ A;  4A6D A;  1ZGA A;  4IHT A;  2DU9 A;  3COA C;  3DEU A;  3FHZ A;  2E1N A;  1O3Q A;  4Q47 A;  3JW4 A;  4U7D A;  4RS8 A;  1TW2 A;  3GW2 A;  3MQ0 A;  2VBW A;  4TV7 A;  3J7A O;  3WTT C;  3GFI A;  2WC2 A;  2M45 A;  1W4M A;  3H3Z A;  2VON A;  4HOB A;  5D4R A;  3F8B A;  3BDD A;  1G3T A;  1KYW A;  3G3Z A;  3ISP A;  1QNT A;  2A6E F;  3E6M A;  2O3F A;  4MGR A;  3U2R A;  4I0A A;  3QP6 A;  4YFK F;  1QZY A;  3KEQ A;  1ZYR F;  3FWE A;  3I59 A;  1FYM A;  5BPD A;  2XRO A;  2EK5 A;  2MH9 A;  1GXQ A;  4I02 A;  2EFO A;  3WGH A;  2KIF A;  3L00 A;  2IT0 A;  1YG2 A;  4ZYH A;  2QBY B;  2ETH A;  4G7O F;  3I54 A;  3T8R A;  4Y17 A;  3J81 K;  1FLI A;  2MH2 A;  3FMQ A;  4UXN A;  4L5J A;  4RGU A;  2O0Y A;  3IRQ A;  4PDK A;  2GAU A;  3U9G A;  2PG4 A;  3F72 A;  1UHM A;  2QQB A;  1YFH A;  2DLL A;  1BIA A;  1E2X A;  1OYW A;  2J5P A;  1K79 A;  3CLO A;  5AIQ A;  2EFP A;  1U6G A;  1Z7U A;  1H9T A;  1IW7 F;  4D0P A;  1O7L A;  3IHU A;  5LBQ A;  5ED4 A;  1ZHF A;  3O3K A;  4HW0 A;  3K9T A;  3TOA A;  2ZKZ A;  1RUN A;  5HS8 A;  5FGM A;  3J81 Z;  1PP8 F;  4KUM A;  1V4R A;  3U1D A;  2FXA A;  1Z6T A;  2FNP A;  2JRT A;  1P6R A;  2EJR A;  1BM9 A;  3TO9 A;  4CIC A;  3D5L A;  1RIO H;  4LD5 A;  3H3U A;  1ODD A;  1E17 A;  1U2W A;  5E17 F;  1ON2 A;  1BC8 C;  4G6Q A;  1LEB A;  4AIK A;  1OMI A;  2DW4 A;  2QUF A;  4XSX F;  3CO6 C;  2DPU A;  2L02 A;  1KU9 A;  2UXN A;  5ILV A;  3E6B A;  3KZY A;  1SD4 A;  4NHJ A;  3GWZ A;  2BGC A;  3RYP A;  2F5E A;  1DUX C;  2F5C A;  4RB2 C;  3NEU A;  2XAH A;  5LGT A;  2FML A;  1YS6 A;  3SQN A;  5JVT A;  5J6X A;  3GFL A;  5JFR A;  3HRT A;  2W25 A;  3GZ6 A;  5HDG A;  4M9Z A;  1U5T B;  2O8X A;  1NHA A;  4LLN A;  1XN7 A;  3R0J A;  3KE2 A;  2HTJ A;  2W57 A;  4ZYG A;  5L3D A;  4DNC A;  2GWR A;  3KCC A;  1ZLK A;  5D6E A;  3M9A A;  1DP7 P;  4ENN A;  2P5L C;  1P2F A;  4IPA A;  5FD5 A;  2ESN A;  4HV5 A;  1PUE E;  4OIP F;  2DAO A;  2LSO A;  1RNL A;  3QU6 A;  2L4M A;  4OIO F;  3R4K A;  1IZ1 A;  1HKQ A;  3R60 A;  2CFX A;  3I5U A;  3E5U A;  3VFZ A;  5K1Y A;  4E70 A;  1BI2 A;  2PMH A;  4HX7 A;  1ZAR A;  2K7L A;  3K2Z A;  1OYY A;  2HFH A;  5CLS A;  3P9I A;  3C3W A;  1YLF A;  3HYI A;  4Q4Z F;  4A5M A;  3F3X A;  1LNW A;  3LFK A;  2V1U A;  1HQC A;  2CW0 F;  2STW A;  3TO7 A;  2K4J A;  3M1E A; 
#chains in the Genus database with same CATH topology
 4QLC U;  3WG7 H;  5GAE J;  9ANT A;  1BI0 A;  5FLX K;  1I3Q J;  1ETX A;  3SZT A;  1GUU A;  3E97 A;  5H20 A;  1FT9 A;  3K70 D;  2B7E A;  2R93 J;  1VQK I;  1X3U A;  2NOJ B;  4DYC A;  5BMZ A;  2KRF A;  4A3M J;  3E1S A;  2EA2 A;  4RDU A;  1VQO I;  2DFF A;  3HRU A;  4QPO A;  2ESH A;  4D7M A;  4WX9 A;  4HRI A;  4NDL A;  1O3T A;  2LG4 A;  1JI8 A;  2R7O A;  2H8W A;  3H5A A;  2M0M A;  1UHW A;  3FF5 A;  3OOU A;  2QSF X;  2VBY A;  5E20 A;  4HAM A;  4RBO A;  2M7A A;  3GUD A;  1LE8 B;  2ADU A;  3S15 J;  4NQW A;  2KKO A;  1APL C;  4BNC A;  4OMZ A;  2CGP A;  2VE8 A;  5DD8 A;  3E6D A;  2XKP A;  2K9M A;  1W7P D;  3ZQG A;  5LHG A;  1M1E B;  3N97 A;  1R49 A;  4QTR A;  5ICG A;  3BY6 A;  2QEN A;  3TDU C;  3JTH A;  2KJC A;  2HNH A;  1V54 H;  2KIM A;  1YW9 A;  2VQH A;  1W5T A;  3MD2 A;  5FFX A;  3SFZ A;  1PUF B;  3DXJ F;  4KJZ A;  4OIN F;  2RGV A;  5L3E A;  4XN0 A;  2EQR A;  2ZME B;  3NRV A;  1IN5 A;  4LB6 B;  1UAA A;  4PGG A;  4XIC A;  1MIJ A;  3M1C A;  1L0O C;  4BH9 A;  5GPC A;  2FQ3 A;  2BW3 A;  2VOD A;  4EJU A;  2JUC A;  3FK6 A;  3FXR A;  2RQQ A;  3FXJ A;  3G1M A;  1P4X A;  4XLF A;  4BAC A;  1RI7 A;  4KIC A;  2E35 A;  4HDU A;  3QOE A;  2G7U A;  1EH6 A;  3CUQ C;  1G59 A;  2M8E A;  3RZD J;  3V4G A;  3I4N J;  1MMG A;  1Z3Y A;  3FKI J;  4DQ2 A;  5J1Y A;  4EGZ A;  1F1Z A;  2K40 A;  4S0H B;  2FBI A;  1YO5 C;  5LHI A;  1FYL A;  1KON A;  2QQ9 A;  4D7N A;  4KIT B;  2NRA C;  3BPX A;  5BNG A;  4AIJ A;  2HQN A;  1BC7 C;  1UHS A;  2A07 F;  2L01 A;  2PBI A;  3KEO A;  1T0F C;  1X1A A;  4EV0 A;  2XC7 A;  1WHU A;  4LG0 A;  4A3K J;  2JA5 J;  3HOU J;  4M71 A;  3BJA A;  4BE2 A;  2Y2Z A;  1QGP A;  1GHC A;  3L9F A;  2XAF A;  4MLO A;  4EJO A;  1WZ2 A;  2PLY A;  3S2H J;  5IT9 Z;  1IF1 A;  1Y0U A;  1XMA A;  5B1A H;  3KPH A;  2QKL B;  3P9C A;  2GOX B;  4EMS A;  1TT5 B;  4RB1 A;  3HSR A;  4KN7 X;  1I39 A;  1CGP A;  3N4M A;  5LLQ A;  4UVA A;  3ROU A;  3DF8 A;  1VQ9 I;  3BJO A;  3SDB A;  2KZV A;  2L0K A;  1R5G A;  2DA6 A;  1MJA A;  2H94 A;  3SXY A;  5CQG A;  2VKD A;  4XKB A;  3C2H A;  4X0G A;  4P96 A;  4F92 B;  5IYC J;  4KIB A;  2M2E A;  1G6N A;  4EAT A;  1FYK A;  1SAU A;  5JHU A;  1OCC H;  4D5C A;  4HBL A;  1MDM B;  3GYH X;  3O8G A;  2P6T A;  3CC2 I;  3DKY A;  4HG2 A;  2L7F P;  2CUZ A;  4WXH A;  3M3Y J;  1EF4 A;  1O3R A;  2TRT A;  3CQZ J;  3OIQ A;  2A6T A;  1HSJ A;  4BEH B;  1JGG A;  3BG5 A;  2W4S A;  3VPR A;  2O5R A;  3K2A A;  3QPH A;  3RKQ A;  4PCQ A;  1MW7 A;  2YX7 A;  3LOC A;  3OYF A;  3ZXS A;  1J0R A;  3OYI A;  2VKV A;  5LFA A;  1VND A;  1I6H J;  2H1K A;  1S3J A;  4QIW N;  5LGU A;  2EZI A;  3CJQ B;  2DA7 A;  4NUB A;  1U3E M;  3GXO A;  4IVN A;  5F27 A;  1WWX A;  2CG4 A;  5LGN A;  3MWM A;  4XL9 A;  3G4S I;  4JYK A;  2ELK A;  3UR3 C;  2JA2 A;  3Q0V A;  1UB9 A;  4GO1 A;  4ESF A;  2GQQ A;  2KFD A;  3A0H C;  3FZV A;  4ZYD A;  4XSZ F;  2J5O A;  3W2W A;  2FSW A;  1R4N B;  3OYC A;  3IP4 B;  5DCF A;  3S16 J;  3S8P A;  1YHQ I;  3WTV C;  5E1X A;  3W6J B;  1QO0 D;  4ZZL A;  1ONV A;  2MA3 A;  1SMT A;  4Z6Y A;  2V26 A;  1WRJ A;  2MC4 A;  2CQQ A;  4ZH4 F;  4A2U A;  3CMY A;  2XPV A;  4MHG A;  4LJZ F;  4IF4 A;  2X1D A;  2F5V A;  2CSO A;  2BOL A;  2OV7 A;  4RAY A;  4FET A;  2HDC A;  3VYS B;  1SAX A;  5E8G A;  3MCZ A;  4EM0 B;  2CQN A;  1I27 A;  4FQG A;  2Y48 A;  5TJJ A;  2EFN A;  3P7N A;  2MSY A;  4XKC A;  1BR1 A;  1OLT A;  3C18 A;  1XGS A;  1J9I A;  4R79 A;  1BL0 A;  1OCT C;  3TDZ C;  4BHB A;  4A0Z A;  1TL8 A;  3FBN B;  3G73 A;  4NBQ A;  3LSI A;  1LDK B;  1XCV A;  4S04 A;  2BHY A;  3DQV C;  3VDX A;  1YQA A;  2XUB A;  3RTR A;  1LVA A;  2IS2 A;  1W36 C;  3T0Y A;  3M8E A;  3OMY A;  3Q9S A;  1AU7 A;  1TQP A;  1P92 A;  5C44 J;  2X6X A;  4BJ6 C;  1FNN A;  4LLL A;  4A3D J;  2Q0O A;  1ZRD A;  1JHF A;  4IRH A;  5JVG F;  1NG6 A;  4A5N A;  1XMX A;  3TO6 A;  3V8K A;  4CCK A;  3J80 Z;  5KCM A;  3EUK L;  5HS9 A;  2OTJ I;  5HDN A;  3BCA A;  2AXT C;  4U0V A;  5J4V A;  2DI3 A;  2K9S A;  2ZJ2 A;  4B8X A;  2X85 A;  1A35 A;  4J00 A;  4LFU A;  1HW5 A;  2AQE A;  3WTU C;  2E1C A;  2Z33 A;  4E4H A;  2WAQ N;  1FX7 A;  2ZBK A;  3V7C A;  3C1D A;  2R7X A;  3SDG A;  3I59 B;  4ZYA A;  3LQQ A;  2YU3 A;  3X2Q H;  4Y33 A;  4B48 A;  4PJL A;  3J7Y J;  2R7Q A;  3WOD F;  4JBA A;  4HF1 A;  2VKE A;  4A12 A;  3GCM A;  2EA4 A;  2IGM A;  2ZME A;  2R5Y B;  3ZQ7 A;  4G6T B;  2LBF B;  1HW2 A;  2R92 J;  2BYV E;  1WGX A;  4WWC A;  1UMQ A;  2G9W A;  4MTE A;  5CVV A;  1BW6 A;  5FKK A;  1HLV A;  1IGN A;  1OKR A;  3BG7 A;  2QF7 A;  3OIP A;  3LSK A;  1BR4 A;  3CP2 A;  3OYE A;  2BVM A;  5B3S H;  1CQT A;  3H35 A;  1O3S A;  4QSH A;  3CCU I;  1X19 A;  4CDG A;  3QU3 A;  4NB5 A;  2EZL A;  1R7J A;  3HG9 A;  2OCC H;  1T33 A;  1XSX A;  2ZB9 A;  1RR7 A;  3L2V A;  1U9N A;  3AG3 H;  1J7K A;  2YU9 J;  3O6B B;  4BY1 J;  2HOS A;  4ZDP A;  1XG1 A;  2DJN A;  2KIQ A;  4ANJ A;  1OCZ H;  2M1B A;  4CH7 A;  5HLH A;  5CPR B;  2L54 A;  3EQL F;  3VYU B;  3I71 A;  3KP5 A;  4BQO A;  4OAY A;  2QYO A;  2A61 A;  5E3M A;  4CHU A;  1UST A;  1TWG J;  3BWG A;  3E0J B;  5J1U A;  3HOX J;  4XQF A;  5DDG A;  1XPX A;  2M8G X;  4O6J A;  3MFK A;  2LVS A;  3HRM A;  2Y69 H;  2EFW A;  3TQN A;  1W5S A;  5K7Z A;  5EF6 A;  2HGC A;  3HJE A;  1YIJ I;  2GA1 A;  2XF6 A;  3ABT A;  3TP0 A;  1R58 A;  2X4H A;  4PFO A;  1W5C C;  3D0S A;  3HOZ J;  3REO A;  4FAS D;  2L3D A;  5M3F J;  2DOD A;  2VJ4 A;  1SFX A;  1S8N A;  4L5I A;  2BY0 A;  4HV6 A;  2P8T A;  2Y9Y A;  1OFC X;  2MG4 A;  3BQZ A;  1J5Y A;  5HNH A;  3DKX A;  2HQ5 A;  4WCG A;  4OOI A;  1YTY A;  1ON1 A;  2OZU A;  4G12 A;  2K9Q A;  2XSJ C;  3QQA A;  3DWL E;  2PMU A;  2OQR A;  2GXG A;  2KLO A;  4UHT A;  4MQ9 F;  2WAD A;  4HST A;  4EVI A;  3CC4 I;  3DU5 A;  2EH3 A;  1W0T A;  1T08 B;  4HX8 A;  1J59 A;  5HOD A;  2RNJ A;  2WY7 Q;  3DEW A;  3I58 A;  4YIR X;  1TW3 A;  5EDN A;  4EGY A;  2GIV A;  4HX4 A;  3ABL H;  5LRS A;  1ZGW A;  2RRE A;  1QHH D;  3BG9 A;  4MNU A;  3G6E I;  2Y75 A;  2FE3 A;  3UKG A;  2JA6 J;  4XOP A;  2GOM A;  4M6X A;  1XGO A;  2GZW A;  3DTI A;  3M7G A;  4YEL A;  1Q1V A;  4IHS A;  4M9S A;  4XOR A;  3RPU A;  3AG4 H;  3IWZ A;  1CF7 B;  4GDF A;  2KQR A;  3CDI A;  1K4S A;  4A6E A;  1VQ5 I;  3ESW B;  1XC5 A;  3TBI A;  4CGZ A;  3OS2 A;  4IOA F;  3G71 I;  2IA2 A;  3I0T A;  4RB0 A;  1IC8 A;  3JAM K;  2WY8 Q;  3WGI A;  3H5N A;  1K83 J;  3K1N A;  4RAF A;  4XRS G;  4CYD A;  2LP0 A;  2XAG A;  1SVO A;  2XPU A;  1MH4 A;  4AYB A;  2WTE A;  2IRF G;  2VI6 A;  2NVQ J;  4G7H F;  1LDJ A;  2QKM B;  2ZNY A;  3SHF A;  3W2A A;  2VPR A;  3DPT A;  2ZFW A;  2C6Y A;  4KNY A;  3WTX C;  3P9K A;  2F4O B;  2HQA A;  2Y0S N;  2NS8 A;  2OUM A;  4E7I A;  3A2K A;  2MD0 A;  1HXD A;  2KMU A;  3EYI A;  3HRS A;  3WE3 A;  5B66 C;  2KDO A;  2VT3 A;  3PFI A;  5J3L A;  3LMM A;  5FD6 A;  4IKF A;  4XMY A;  1P9Q C;  5FKO A;  1CF7 A;  3D1N I;  3H0G J;  5ILS A;  2L5Q A;  2CRG A;  3RDI A;  2O61 A;  2DMU A;  1G3W A;  4I01 A;  2FUG 2;  4A0Y A;  1WI9 A;  4L9N A;  4BE0 A;  1B72 B;  4CYC A;  4XNF A;  2KJB A;  1YRN A;  4BDZ A;  4KN4 X;  2ICW G;  5E8I A;  1YJW I;  2EWN A;  1BIB A;  2HYJ A;  4AM3 A;  3HSE A;  2DFI A;  1LFU P;  2IS6 A;  1IJW C;  4C2T A;  3HKZ A;  4HQE A;  4WF2 A;  3K70 C;  1Z6R A;  3S3N A;  4ZTF A;  1F5T A;  3CCL I;  1FPQ A;  4E6K G;  1D5V A;  2STT A;  2P7V B;  2IA1 A;  1X1D A;  1RKT A;  4A3E J;  1LQ1 A;  4FE7 A;  4CCM A;  4XRF A;  4A3F J;  1MBJ A;  2L9S A;  4B4C A;  3GTL J;  2PFB A;  1XGM A;  1V55 H;  2A69 F;  1D0X A;  4KYW A;  1TWC J;  3C7J A;  5FLX Z;  1D0Y A;  4RGR A;  4Y3O A;  1JT6 A;  3ZMV A;  4YRV A;  1Z1D A;  2LF8 A;  2V7F A;  2KL4 A;  2ELJ A;  2LF7 A;  1ZG5 A;  3K4N A;  5LHH A;  1GT0 C;  1FTZ A;  2LY9 A;  3RCO A;  4J19 A;  2JQ7 A;  2Z5U A;  3LA7 A;  2FOK A;  4M3G A;  4GFB A;  1LE8 A;  1YE9 A;  1FEX A;  3E6C C;  1GVD A;  1BOA A;  4V2G A;  1TNT A;  4ZYE A;  3R61 A;  4UY8 I;  2CQX A;  2HVQ A;  1B6A A;  1FBU A;  2X6W A;  1ZRC A;  2K3F A;  3WU0 A;  3G1O A;  4XRM A;  4OMY A;  1TBX A;  2RQP A;  1FOK A;  4Y7N J;  5F0F A;  4A3I J;  3SZP A;  2DO7 A;  2F2E A;  3K1P A;  2E5N A;  1Y8R B;  2ZNZ A;  5L3C A;  4JP0 A;  2F6C A;  4JX5 A;  4W1U A;  4ZDO A;  4M3D A;  2DA1 A;  3CCR I;  2FEZ A;  1IXS B;  1TTY A;  1VQ7 I;  1FOW A;  2LKX A;  2L7Z A;  2YS9 A;  1Y56 A;  4H4K C;  4FX0 A;  4DYR A;  5FO5 A;  2VN2 A;  2YX4 A;  3E7L A;  4UV9 A;  4ENJ A;  5HLI A;  2R5Y A;  5GPA A;  2LBF A;  2P81 A;  4MIM A;  4XR6 A;  4IQ4 A;  5IP7 J;  1QQI A;  3ZCO A;  3ZMU A;  3W6K B;  5F08 A;  2LKP A;  3ZQQ A;  1RR8 C;  4H0E A;  1HW1 A;  1IO2 A;  1ENH A;  4CUG A;  2DFE A;  3E5Q A;  1DPU A;  1R4M B;  1FWZ A;  3QYF A;  1WQ2 A;  1ULY A;  3EYY A;  3SYT A;  1MMA A;  5DS9 A;  1TQI A;  4BL0 B;  2HPM A;  4I0B A;  3L1P A;  2A5W A;  1MKM A;  2ECB A;  2MBF A;  3BR3 A;  4XOT A;  5E1Z B;  3T8T A;  1MJ9 A;  3ZGK A;  5GAH J;  2DYR H;  2KDZ A;  1JE8 A;  2IVM A;  3AAF A;  3FXM A;  1KGS A;  3VEP A;  4IRI A;  3BPV A;  2EIJ H;  2NVU B;  3ZR8 X;  1I1S A;  3WTZ A;  1MJB A;  1K61 A;  3IWF A;  4MEX F;  2CFO A;  2AO9 A;  4RLF A;  4B09 A;  1R1T A;  1K4T A;  2CU7 A;  5ICE A;  1T38 A;  1XDU A;  2DJI A;  3EUH A;  5CVR A;  3FXU A;  3OYJ A;  3FIS A;  3FXO A;  4ZC3 A;  1K7A A;  3VOD A;  2MC3 A;  5CVJ A;  2L7M P;  4E7K A;  2GXA A;  3SFI A;  1ORK A;  2VXZ A;  4HSR A;  3VSK A;  4EJV A;  5D5W B;  2F5D A;  3MMY B;  2VJI A;  3ZN1 A;  2VUM J;  2FQ4 A;  4HLY A;  3DTE A;  2TDX A;  2ZXI A;  3WTS C;  1IDZ A;  3CCE I;  1TWA J;  4X1E A;  4L0Z B;  3GF2 A;  3RPQ A;  2XPW A;  2VOO A;  4UB8 C;  1NK2 P;  1EH8 A;  3ZMD A;  1VQN I;  2AS5 F;  5GTI C;  3F8C A;  3RSN A;  2ISZ A;  1B8I B;  2HQR A;  1S7A A;  2JTV A;  3ABM H;  2R4G A;  2XAJ A;  3FXL A;  1R36 A;  1X1C A;  2HYG D;  2CV2 A;  3U1K A;  1XB4 A;  2EZK A;  4RM2 A;  1Y0N A;  6PAX A;  4N9I A;  1LUJ B;  1FIP A;  2M34 A;  2R5Z A;  3LL7 A;  2OCE A;  1ZGJ A;  2Z99 A;  4BJT A;  4FTH A;  4XBF A;  3OS1 A;  3RYR A;  3MKZ A;  3FX3 A;  3HTS B;  3HC7 A;  4G94 A;  2DOE A;  1N78 A;  3HL2 A;  4XLH A;  1SAN A;  3CZ6 A;  1IRF A;  1HOM A;  4EJW A;  4ITV A;  4Y15 A;  2K5C A;  3F9K A;  2LH9 A;  1JJ8 C;  1Z3X A;  3EPZ A;  1H0M A;  5M3M J;  1NK3 P;  3WE2 A;  2ME0 A;  1ZRE A;  3RI4 A;  2DK8 A;  1ZG3 A;  5K5O A;  1B4A A;  5IYD J;  3KX2 A;  2HKX A;  4B43 A;  1AHD P;  1ETO A;  1DGW Y;  2VL8 A;  3T1B A;  2EBI A;  2OPT A;  4D1Q A;  2IA0 A;  5CJ9 A;  3CCJ I;  2X0L A;  2O6G E;  1OCO H;  4BHC A;  4HPQ A;  3K4L A;  1RET A;  4KIG A;  1U78 A;  4NNJ A;  1XGN A;  2W48 A;  1B9M A;  3MN2 A;  1K78 A;  5D8L B;  3OYL A;  1ZRF A;  2ZSH B;  3BT9 A;  1XTA A;  2JUG A;  3TKY A;  2R5Z B;  1SFO J;  4GCV A;  4M6Y A;  3BR1 A;  2RV8 A;  1MZB A;  2HZT A;  3I4P A;  1RZ4 A;  1H89 C;  1IRZ A;  5EYR A;  3F21 A;  5D4S A;  3JR9 A;  5K7F A;  1T6S A;  2Y0S A;  1X1B A;  1BBY A;  2H1L A;  3SEQ A;  4PGH A;  2VAS A;  3H0D A;  1W36 D;  2YSR A;  1N77 A;  2ELH A;  2P0W A;  4G9Y A;  4ON0 A;  2MD5 A;  1N25 A;  2CUJ A;  1QPM A;  3IKT A;  3BP8 A;  3GZ5 A;  3VWB A;  1E0E A;  3LSP A;  2KHM A;  3N05 A;  5D5U B;  4LMY A;  2Y30 A;  2GA2 A;  2NS0 A;  5ICF A;  1LB2 A;  1L3L A;  4MEY F;  2CMP A;  4EM2 A;  1B9N A;  2PQ8 A;  3V8L A;  2R7W A;  1OJL A;  2IS1 A;  5KAF C;  4E7H A;  1BI1 A;  2V6E A;  4DYQ A;  1FC3 A;  1SD6 A;  2DT5 A;  4RAG A;  1XDS A;  3K4C A;  4GXO A;  3HOY J;  1R00 A;  2FU4 A;  2LY1 A;  4L9T A;  2DYS H;  4AYB N;  5E3N A;  4YFX F;  4HNU A;  1Z05 A;  5H6R A;  2PMZ N;  3LNQ A;  4HZF A;  3VYT B;  3KET A;  1TLH B;  2DN0 A;  1OCR H;  4ABZ A;  1IUY A;  3DPU A;  3DBR B;  1USS A;  1YIT I;  4XM3 A;  3HOW J;  2NXN B;  2E2H J;  3ZMS A;  2WA0 A;  4Q48 A;  1PJR A;  1WJB A;  1WJ5 A;  5CQE A;  1DDN A;  4J01 A;  3JRH A;  4MFD A;  5FRN A;  3CMA I;  3K0L A;  4BXF A;  4BBR J;  4Z2Y A;  1AWC A;  3KP7 A;  1ZN2 A;  2RC4 A;  3CDH A;  3K4M A;  5IY5 H;  2E19 A;  4C3J J;  5BS6 A;  1HC8 A;  2W84 A;  3GZN B;  3DFG A;  1QBJ A;  4XLA A;  4ZTJ A;  1R1V A;  3W3C A;  3OL3 A;  2HOE A;  2XDV A;  3CES A;  2IPQ X;  2EV0 A;  3E5X A;  2KT0 A;  5EG0 B;  2UUZ A;  2M7B A;  3G1L A;  4MTD A;  2ZXH A;  2A68 F;  1FBQ A;  2DMQ A;  4UVB A;  4I09 A;  3OOP A;  1A31 A;  4DBQ A;  3L09 A;  4NQW B;  3BOQ A;  4ESB A;  1DP3 A;  3SZG A;  3R0A A;  2LDU A;  3BR2 A;  5ERI A;  3TED A;  3MAJ A;  4HDV A;  1ACI A;  3BTJ A;  2JMW A;  1T98 A;  1VQ8 I;  5LRR A;  3S2W A;  3WTW C;  5KVR A;  4P9F A;  3F22 A;  1GLN A;  1LVK A;  2BV6 A;  2WV0 A;  1YW7 A;  4DZP A;  4XID A;  2IS4 A;  2Z3Y A;  4PZJ A;  2JT1 A;  4PUS A;  3A02 A;  3TOB A;  2E1O A;  1P7I A;  2IP2 A;  1VQP I;  2R7F A;  5C4X J;  3K4J A;  2A5Y B;  2A05 A;  2HR3 A;  3GEZ A;  4QPQ A;  4AID A;  3CJT B;  2ME6 A;  3IV5 A;  3V42 A;  5E18 F;  2ZCW A;  4WXC A;  5DCM B;  2AXL A;  3CD6 I;  1FP1 D;  2K02 A;  2YPR A;  3MKY B;  2VQL A;  4A93 J;  2P4W A;  5CVU A;  4M3E A;  3KYD B;  4C30 A;  4F55 A;  3HHH A;  1SFK A;  2FJ1 A;  4KA4 A;  1RES A;  1UFM A;  2DK5 A;  2M4G A;  2TCT A;  1ZR2 A;  2XV4 S;  2E7W A;  3ULQ B;  2I5U A;  2D2W A;  2L9V A;  3M8F A;  5FB2 A;  2QQA A;  5EEH A;  1LKX A;  2BBY A;  3PNY A;  4IRG A;  4AD9 A;  2FMY A;  3OV8 A;  5GTH C;  1X2N A;  5IOY A;  5IP6 A;  5DUI A;  2F48 A;  4R8H A;  1IDY A;  4UVC A;  1Z91 A;  5L3F A;  3LAP A;  4UUV A;  2JA8 J;  5TRD A;  2R0Q C;  2W85 A;  2FOW A;  2NS7 A;  1KA8 A;  4BJ5 C;  5H6Q A;  2CW7 A;  4EEF G;  1EH7 A;  3A1Y A;  4CO8 A;  1MBE A;  3ASO H;  3CJN A;  4N4O B;  2V9K A;  2LC2 A;  3AL0 B;  5EEG A;  2KPM A;  2DTZ A;  4MO7 A;  3S1M J;  3E3V A;  3LWF A;  3O8H A;  4F7Z A;  3FXQ A;  3WHC A;  1MBK A;  1T39 A;  1DQU A;  2QA4 I;  2OBP A;  2OD5 A;  3PIP F;  1H9G A;  5J8F A;  1B59 A;  2X51 A;  3H9Q A;  1Z21 A;  3OWT A;  1S9H A;  5HDK A;  4OIQ F;  4M73 A;  3FM5 A;  3NQO A;  3WU2 C;  1ETQ A;  1A6Q A;  1F9N A;  2Z2S B;  1YOV B;  3I3L A;  5A2Q Z;  1MNE A;  3KZZ A;  3QWL A;  2B9S A;  3KLN A;  2XAS A;  1E3O C;  1VF9 A;  2A6H F;  4B3X A;  1TWH J;  3QP5 A;  3I53 A;  3Q3S A;  1KQ0 A;  5A2Q K;  2CV0 A;  3W2V A;  4O5V A;  3F8N A;  2R7R A;  2LY2 A;  3ERE D;  3TP3 A;  2E1M B;  4BYY A;  3EDP A;  3GFJ A;  1G4D A;  3HEF A;  4FHT A;  2CYY A;  5HOO A;  2H6B A;  5D8K B;  2EIN H;  3JRF A;  3GBG A;  5IT3 A;  4R1H A;  4M74 A;  2ZO4 A;  3FMS A;  1MSE C;  1D8J A;  1NTC A;  2XSD C;  1RC9 A;  2B0L A;  3HBL A;  2Z9O A;  5LD2 C;  2QZ8 A;  3KYC B;  4P55 A;  3L2U A;  1MGT A;  1IN7 A;  5LEK A;  3GLL A;  2ID3 A;  1R5H A;  3PO2 J;  2BY1 A;  5JLW A;  1E3P A;  3RJP A;  4YFN F;  1WSU A;  3QAH A;  3JSO A;  1IRG A;  3FHN A;  3HSF A;  4IHY A;  3CUO A;  2RN7 A;  2OJE D;  4U7B A;  2V1X A;  4PFP A;  2I10 A;  3O2P E;  1A36 A;  1K6O A;  3IAS 2;  2OZ6 A;  3MZ8 A;  1BJA A;  1S5L C;  2LRE A;  2LKS A;  3BQY A;  4FE4 A;  1B1B A;  4BY7 J;  1PDN C;  5FFZ A;  2O7O A;  3ASN H;  3OR2 C;  2LOO A;  2M9H A;  2V9V A;  2JPB A;  2G7H A;  1GXP A;  2BHZ A;  3K1M A;  1A6I A;  2R3S A;  2GM4 A;  2V79 A;  4F91 B;  2ID6 A;  1BW5 A;  1UG0 A;  3V7S A;  2QVO A;  1A5J A;  1TP4 A;  3ZP5 A;  2ZC2 A;  1WPK A;  1D3Y A;  1IV6 A;  3BC8 A;  2L9N A;  1V3F A;  5TIS C;  2CWE A;  5JHF A;  2IJL A;  3JRE A;  2ZJR F;  2KIU A;  2OQG A;  4EM1 A;  1IG7 A;  1VQ6 I;  2K9N A;  1Y39 A;  4A0X A;  2XIG A;  3WG9 A;  5B5E C;  4IX7 A;  2FD5 A;  2M0C A;  3PSI A;  2L4A A;  4U0W A;  1YIO A;  5K7H A;  5DUK A;  3H92 A;  2WB1 A;  2P6S A;  4LIV A;  1REP C;  3S93 A;  2MLK A;  1KZH A;  5F1R A;  3M8J A;  1BR2 A;  2V4J C;  3JRD A;  4BU2 A;  2B63 J;  2AHQ A;  4ESJ A;  2D5V A;  1IN4 A;  2XB5 A;  1VFC A;  1IRX A;  2EV6 A;  1YX5 A;  3F6V A;  3A03 A;  3JRA A;  1ETV A;  1OYI A;  3EUH C;  1I3A A;  2R7D A;  3TW6 A;  1I1G A;  1ZH5 A;  3LA3 A;  1POG A;  1WKM A;  4I98 B;  3H9G A;  2G0E A;  2HXI A;  2VKH A;  3M07 A;  3CF5 F;  2HDD A;  1R22 A;  2E60 A;  2O8K A;  1DGR M;  1IN8 A;  3CDL A;  2NVX J;  1KU3 A;  2DA2 A;  3KP6 A;  2Y9Z A;  2YR2 A;  2JJ7 A;  1Y1W J;  1O7F A;  4IHV A;  4Y4R A;  1QA6 A;  3CC7 I;  1J75 A;  4HYE A;  5EGO A;  4PJN A;  3GLX A;  3K7A J;  4HLX A;  2BE5 F;  5E1W A;  2NAZ A;  1Y6I A;  2XGC A;  3ZN0 A;  1IUF A;  4GYG A;  4YIF A;  3GO5 A;  4PJ0 C;  2KRH A;  3CO7 C;  4L9J A;  3TGN A;  2NYX A;  2JRM A;  3F8M A;  4CCO A;  4RLQ A;  3TMO A;  4AIH A;  5DCM A;  4C3I J;  1TT0 A;  1UCR A;  1A04 A;  3J7A Y;  1FIA A;  1MSF C;  3QPT A;  2MW8 A;  1X58 A;  2QGU A;  4AUX A;  4CZC A;  1KYZ A;  3GVA A;  3OSG A;  1ETY A;  3MZH A;  4BQA A;  4YII A;  3BZC A;  1PYV A;  4UUS A;  4PJM A;  4LB5 A;  4GGG A;  1SFU A;  4G6D A;  5KK1 A;  1ZR4 A;  2JSC A;  2XAU A;  5GAG J;  3CCM I;  2QCO A;  3PJR A;  4KT5 C;  2XGX A;  2UZK A;  2BXZ A;  2PX9 A;  2W1O A;  5DEQ A;  3RIR A;  1SMY F;  2OAZ A;  2XAQ A;  5EG0 A;  2P5V A;  1S6L A;  1EV7 A;  4DGW B;  3W6V A;  5J4Y A;  2FBK A;  2AQF A;  2MYS A;  1GVJ A;  1MMS A;  3ECH A;  3ML6 A;  1Y1V J;  2F5F A;  1LFP A;  2ECC A;  3KLO A;  2FF4 A;  2HEO A;  4Y52 J;  3A4C A;  3AG2 H;  2Q8K A;  3C2B A;  3F23 A;  2OF7 A;  1HST A;  4L9V A;  3WGG A;  3FM3 A;  4CXF A;  1XCB A;  5BPI A;  3ELK A;  3HUG A;  1WJD A;  1TQM A;  3ZQL A;  1G3Y A;  2BY2 A;  2FBH A;  5HLT A;  5FLM J;  1HDP A;  1ERD A;  3HIF A;  2QBY A;  4N9H A;  2XKO A;  1XS9 A;  4LOC A;  1KQ9 A;  4JOM A;  3IL2 A;  3S3O A;  3DEE A;  5KNL A;  4IHW A;  4LK1 F;  2VIX A;  3BG3 A;  1KU2 A;  2GXB A;  4C3H J;  1B72 A;  1VQL I;  3S14 J;  2MAB A;  3WTY C;  1XMK A;  2D1V A;  4XK4 A;  1AKH A;  1IV8 A;  2XRL A;  5E3O A;  1YI2 I;  4EJT A;  4BUP A;  2IAI A;  1D8K A;  2EIM H;  3P5J A;  3GX4 X;  3PNT A;  5HVQ C;  1MNM C;  1FTT A;  3VOE A;  4NC7 A;  2PMZ A;  3OIO A;  3T5X A;  1MMD A;  2MLG A;  2O03 A;  2LR8 A;  2CO5 A;  2IEK A;  1OPC A;  1UZC A;  1N75 A;  3IRR A;  5FJ8 J;  2K86 A;  4XN3 A;  1SVL A;  4A3C J;  3F6O A;  3PUF A;  3F8F A;  4RM3 A;  5L3G A;  3CUQ B;  1MBG A;  5IT9 K;  1WJC A;  4G8X A;  4LGW A;  3BRO A;  3CLQ A;  3ZQC A;  5L3B A;  2HOT A;  2H27 A;  1R71 A;  3PQK A;  1ZKG A;  3GTQ J;  2ACJ A;  3S32 A;  2VOP A;  4ZZD A;  1OR7 C;  5DYM A;  2DQR A;  1SVM A;  2KRC A;  3CP8 A;  4JK1 X;  2VQC A;  2VLA A;  2LK2 A;  2VC0 A;  3BJ6 A;  4ENK A;  4AC0 A;  1QZZ A;  1JHH A;  3LSJ A;  5JR3 A;  1G3S A;  2W24 A;  2VB6 A;  2CUF A;  3K10 A;  2DOA A;  4E7J A;  1S29 A;  3LA2 A;  2CJJ A;  4BXU A;  4HNT A;  3JSP A;  5FKL A;  2UWM A;  2UXX A;  4K2E A;  2XGE A;  2N8G A;  3LSR A;  3ECO A;  3K4K A;  2QSG X;  1VTN C;  1HBX G;  2DMN A;  4YG2 F;  3ABU A;  5DV5 A;  4OIR F;  3FXK A;  1HKS A;  1JT0 A;  2R7S A;  2H6C A;  1QRY A;  2HYF A;  1FSE A;  3M4O J;  3RKX A;  3L7W A;  2HU9 A;  1PP7 U;  2Y0M A;  2QSH X;  3GTP J;  4D5F A;  5BQT A;  3KP4 A;  4A3L J;  1VQM I;  3JAM Z;  2DT6 A;  5HS7 A;  3HOS A;  4HF2 A;  3LSG A;  3B02 A;  1R1U A;  2QEX I;  5DM7 F;  3MKL A;  3HGY A;  2L9R A;  3GME A;  4XRS A;  3DLL F;  3HOT A;  3MZY A;  1SD7 A;  1T0F A;  2E1M C;  4QWQ A;  2DBB A;  3HOV J;  4Y13 A;  3DPL C;  5LEJ A;  1GV2 A;  1JUP A;  2LNB A;  1ZQ3 P;  3LSH A;  2WWY A;  3FK7 A;  4YEJ A;  2VT2 A;  2E7X A;  2W82 A;  1YJN I;  2CV1 A;  1FBS A;  1AOY A;  3J80 K;  1YS7 A;  5ICC A;  3QYB A;  4DIQ A;  3HZJ A;  1R5I D;  3EUA A;  3KFW X;  3D5S C;  1JKQ C;  1GDT A;  3OR1 C;  3IUO A;  1BI3 A;  5EJC A;  1LEA A;  3OY9 A;  1FY7 A;  2JZY A;  2IGN A;  2M30 A;  5C4J J;  4BQQ A;  2PJP A;  2X6O A;  3IH3 A;  4KIF A;  4P9U A;  1T2K A;  1P4W A;  2ISY A;  2GBY A;  5F1J A;  1LJ9 A;  3QYE A;  1JXS A;  3AG1 H;  1BJZ A;  5M5Y J;  2X48 A;  4LIT A;  1U8R A;  1P7J A;  2M5W A;  3RKY A;  2BXY A;  2KIS A;  4HQM A;  2IXS A;  3AFH A;  4M72 A;  5DM6 F;  1X2M A;  2QWW A;  3HPG A;  3RQ4 A;  1ETK A;  1YYV A;  2HTS A;  2A3S A;  1D1A A;  3JTG A;  5AON A;  2HS5 A;  3L2Q A;  1QVT A;  5FKN A;  4A3J J;  4LK0 F;  2DPD A;  1STZ A;  2H09 A;  3DP7 A;  4UNO A;  3CUQ A;  1TC3 C;  3JRI A;  3LFU A;  4HA8 A;  1SD5 A;  2OU2 A;  3DU6 A;  3QPS A;  2CS3 A;  3JCU C;  3CF2 A;  5CYV A;  2DTR A;  4KDP A;  3ZMZ A;  2WAF A;  4P5O A;  3LQR A;  1S7O A;  3HTU A;  1Z7L A;  3HHG A;  1KU7 A;  3F0C A;  3MEX A;  4B47 A;  2D1H A;  2V6C A;  3OYH A;  1C0W A;  3PM1 A;  4A69 C;  1YW8 A;  3RZO J;  4WXD A;  1W7P A;  2Y31 A;  4ETS A;  1TZL A;  2LMD A;  4M6V A;  2R7U A;  1ZG1 A;  3WHB A;  1OCP A;  2K4B A;  4ENM A;  4IO9 F;  5D5X B;  2DXI A;  4FCY A;  1QVU A;  1HKT A;  1QZE A;  2M87 A;  4HF0 A;  3IC7 A;  3OYN A;  1FOY A;  5M5W J;  1X3W B;  4AVP A;  3Q9V A;  2EB7 A;  1MH3 A;  3FMR A;  1I5Z A;  4AWX B;  5AIP A;  3LSM A;  2HKO A;  1XD7 A;  2NNN A;  4O3M A;  5CVI A;  1I6X A;  1P4A A;  2JSP A;  3LAJ A;  5K5R A;  1K6Y A;  4IZZ A;  1O57 A;  1AA7 A;  4FT8 A;  1R23 A;  2COM A;  3QOD A;  2DA4 A;  1WJF A;  2DCE A;  4OAZ A;  3EET A;  1R9T J;  4CYC B;  4RAZ A;  5E79 C;  2K9L A;  2VPL A;  4XON A;  3CME I;  5D6F A;  1RUO A;  3ZRG A;  4B44 A;  1IN6 A;  1EKE A;  2P5K A;  4DZJ A;  4I7H A;  1WJE A;  3S2D J;  1MDM A;  5K5Q A;  4DW6 A;  5IOZ A;  1W7P B;  4M9X A;  4Q5S F;  2LYC A;  1WFX A;  2EV5 A;  1JGS A;  4RA2 A;  1U5T C;  4UV8 A;  2VBX A;  3IKV A;  5J8C A;  3A01 B;  1G2H A;  2DDB A;  1DPR A;  2ZXJ A;  3K4B A;  3CCV I;  2IBD A;  1HA8 A;  5TGT A;  1EJ9 A;  1FSH A;  2VJJ A;  3IH4 A;  1J2X A;  5J1R A;  3V7R A;  2VC1 A;  4PSW A;  2ZXW H;  2JVG A;  2PJR B;  3VSL A;  4BAY A;  4E7S A;  3OS0 A;  3ZPL A;  3DV8 A;  3DLA A;  1IAW A;  4IQJ A;  1MD0 A;  4LLG F;  3QOP A;  2XRN A;  4L18 B;  3OSF A;  1IXC A;  1JTY A;  2HWV A;  4MFE A;  1U9O A;  5F6F A;  2H8R A;  2WB1 N;  2R7V A;  4I6Z A;  2VBZ A;  2GIZ A;  3HXL A;  4EQQ A;  3BZ6 A;  4PSX A;  2CQK A;  5EEA A;  4FIS A;  1HF0 A;  5ILU A;  5IPA A;  2PI0 A;  4IJA A;  5GP9 A;  3ZQF A;  5D5V B;  4IHX A;  2Q2E A;  3VB2 A;  3CCQ I;  3CTA A;  4RGS A;  2COB A;  3JRC A;  3K69 A;  2RKH A;  2RVC A;  2VQG A;  3ERM A;  4RB3 C;  3K6G A;  4JX4 A;  2DFH A;  4C9Y A;  1ZEL A;  3GTK J;  3GFM A;  2OC6 A;  3Q5F A;  1BN5 A;  3DKW A;  2VE9 A;  1VI0 A;  3PIO F;  2XHK A;  3FDY A;  4FX4 A;  4MQV A;  4I2O A;  3S3M A;  4U88 A;  4IXA A;  3ABK H;  1ZLJ A;  3BR5 A;  3TL4 X;  3KZI C;  2JPC A;  5FKM A;  2VXD A;  2IW5 A;  1KQ8 A;  1JJ6 C;  1FP2 A;  5DD4 A;  1FMW A;  2CQ7 A;  4NC6 A;  2EFQ A;  2BY3 A;  2FA5 A;  5HNF A;  1OR7 A;  4ASN A;  4S05 A;  3KP2 A;  4RGX A;  1TNS A;  2OA4 A;  1V5F A;  5DTD A;  5KAI C;  4F93 B;  1Z9C A;  3PQJ A;  4C2U A;  2PN6 A;  1JKP C;  4KMF A;  2E2J J;  1X3Z B;  1IXR C;  3KEY A;  3WU1 B;  3Q0U A;  2WBM A;  4LIU A;  1DU6 A;  2QLZ A;  3KYL A;  5FRM A;  2NVT J;  3RKW A;  5M5X J;  4OWR B;  1ZAO A;  2E2I J;  2RNG A;  1XSV A;  2V9P A;  2PEX A;  4WK8 F;  2V1D A;  3CCS I;  3PUB A;  3QPL A;  4IEJ A;  4JQF A;  4L0Y B;  3H1C A;  2P7C B;  2BEO A;  2DOF A;  2X6Y A;  4L5E A;  4XLN F;  3QRF F;  3V8J A;  2NNY A;  5JI6 A;  2HPI A;  1O4X A;  1K78 B;  2L2O A;  2ZSI B;  3R6S A;  2FRH A;  3KP3 A;  4GYI A;  3BG6 A;  1Z0X A;  3BCB A;  4N0B A;  4NC8 A;  4G7Z F;  2JK3 A;  2ZME C;  2K27 A;  4U0Y A;  4KFC A;  3LST A;  2XVC A;  2E71 A;  5HLG A;  3L2C A;  3JRG A;  2MFZ A;  3ZQI A;  1UJ8 A;  2ZJQ F;  1YRN B;  1LDD A;  3H9J A;  3UNG C;  2RDP A;  1XSD A;  4E7L A;  4OU0 A;  2E34 A;  2Z1D A;  3B73 A;  2CUE A;  5BOX A;  1D0Z A;  1Q1H A;  2D45 A;  1WH5 A;  1F4K A;  2DA3 A;  4KMU X;  2DQL A;  1YX3 A;  4CA0 A;  3TW7 A;  3HUG B;  3I64 A;  5F64 A;  2QM3 A;  4BHP A;  3OYK A;  1HCR A;  2JN6 A;  2IGK A;  4LG0 B;  2BZT A;  2FNA A;  1U5T A;  1FZP B;  3BTC A;  3ZMT A;  4XLP F;  1SFE A;  3DCF A;  3CCY A;  4CZZ A;  2XF5 A;  1QU3 A;  4A6D A;  2ZFU A;  1ZGA A;  4IHT A;  2DU9 A;  3PFY A;  3COA C;  5E3L A;  3BLY A;  3DEU A;  4ZJZ A;  3FHZ A;  5JLX A;  2DT7 B;  3PO3 J;  2E1N A;  4PK4 A;  2HVS A;  3PNV A;  1BOB A;  5C3E J;  3G2B A;  1O3Q A;  3OYM A;  1MBF A;  2E5Z A;  3PSF A;  4Q47 A;  3JW4 A;  3B6A A;  5FRO A;  1MND A;  3SEZ A;  4U7D A;  4RS8 A;  1LFB A;  1VZ0 A;  1U0J A;  4M3B A;  1B8I A;  2CW8 A;  1R6R A;  1TW2 A;  3GW2 A;  3MQ0 A;  2VBW A;  4TV7 A;  3FBI B;  4E7Z A;  2CH0 A;  3J7A O;  3WTT C;  4IOC F;  3GFI A;  2WC2 A;  3BZK A;  2QQ8 A;  5B1B H;  3AKZ A;  4UUS B;  2M45 A;  2HZD A;  1W4M A;  3H3Z A;  1RKW A;  4HOB A;  2VON A;  5D4R A;  3F8B A;  3ONQ A;  3IH2 A;  2XB0 X;  3BDD A;  1G3T A;  1KYW A;  3G3Z A;  1F36 A;  3ISP A;  1QNT A;  2A6E F;  3E6M A;  5EZH A;  2O3F A;  4MGR A;  4CCN A;  5J47 A;  3U2R A;  2HXO A;  4I0A A;  3QP6 A;  4CCJ A;  5IP9 J;  4YFK F;  4LG3 A;  1QZY A;  3KEQ A;  1ZYR F;  3FWE A;  3I59 A;  1FYM A;  5BPD A;  2X1E A;  1X1P A;  2XRO A;  2EK5 A;  2MH9 A;  1GXQ A;  1U8B A;  4I02 A;  2DMT A;  2EFO A;  3WGH A;  2EIK H;  2Q1Z B;  2KIF A;  4IL6 C;  3HGG A;  3J7Z I;  3L00 A;  2IT0 A;  1YG2 A;  2RAE A;  3MVP A;  4ZYH A;  5KHD A;  4JX6 A;  2ETH A;  2QBY B;  2EIL H;  4G7O F;  3I54 A;  4X6A J;  1XX5 A;  4BDY A;  3T8R A;  4Y17 A;  3J81 K;  2LRD A;  2V1N A;  1FLI A;  2MH2 A;  3FMQ A;  3H3V K;  4UXN A;  2F4M B;  1X4O A;  3NAU A;  4L5J A;  3B6C A;  1EA3 A;  1RRJ A;  1JUS A;  4HNV A;  3BTL A;  5F0C A;  4RGU A;  2O0Y A;  4BQN A;  3U21 A;  4BKX A;  3IRQ A;  4PDK A;  2GAU A;  1WI3 A;  3NAR A;  1S7E A;  2F4I A;  2BW3 B;  3GTO J;  2NVY J;  3U9G A;  1WCM J;  2PG4 A;  3F72 A;  3IAM 2;  2JWT A;  5H2F C;  1JKO C;  1UHM A;  2QQB A;  2M4K A;  1YFH A;  2DLL A;  1BIA A;  1E2X A;  1TWF J;  4U87 A;  1GV5 A;  1OYW A;  2J5P A;  1ITY A;  2WV1 A;  1K79 A;  3CLO A;  5AIQ A;  1WH7 A;  2EFP A;  5CKT A;  3CMM A;  1U6G A;  1ETW A;  1Z7U A;  1IW7 F;  1H9T A;  4D0P A;  3S17 J;  1T95 A;  1ZK8 A;  1O7L A;  4II3 A;  1F43 A;  2KP6 A;  3IHU A;  2EPF A;  5LBQ A;  5IYB J;  3GTM J;  3JRB A;  3L2R A;  2HVR A;  2HI3 A;  3HB9 A;  5ED4 A;  1ZHF A;  1J09 A;  1YJ9 I;  3O3K A;  3NWS A;  4HW0 A;  1D5Y A;  1FMV A;  2E36 A;  3K9T A;  4F3Q A;  3TOA A;  4DOZ A;  2ZKZ A;  3A01 A;  1RUN A;  3C2G A;  5HS8 A;  2W7N A;  5FGM A;  3J81 Z;  1PP8 F;  1VQ4 I;  2XGD A;  4XLC A;  1T56 A;  2Z16 A;  3ZOB A;  1Y8Q B;  4XLE A;  3HKZ N;  1UEL B;  4BBS J;  2L7K A;  3HPH A;  4KUM A;  2K85 A;  5EGO B;  1UG2 A;  1V4R A;  1ZTR A;  3I55 I;  3BR6 A;  3U1D A;  2FXA A;  3I9V 2;  3GTG J;  2EZH A;  1QHG A;  1Z6T A;  2FNP A;  2GLO A;  2JRT A;  1P6R A;  2EJR A;  2I8D A;  1BM9 A;  3TO9 A;  2LTP A;  4CIC A;  1T8I A;  2Q2E B;  2DDA A;  3D5L A;  3OYB A;  3S1Q J;  1RIO H;  1RPW A;  1AKH B;  3Q0W A;  4LD5 A;  3H3U A;  1PUF A;  4BGD A;  1MMN A;  1ODD A;  3RPU D;  1E17 A;  1U2W A;  5E17 F;  1ON2 A;  1BC8 C;  2KZG A;  4G6Q A;  1W1W E;  1LEB A;  2IGO A;  4AIK A;  2HDW A;  1OMI A;  2DW4 A;  2QUF A;  4XSX F;  3CO6 C;  1X4P A;  2DPU A;  2L02 A;  1KU9 A;  2VJ5 A;  3ZQH A;  2UXN A;  4RMN A;  4P1W A;  3E6B A;  5ILV A;  3PL8 A;  3H36 A;  2K3P A;  3KZY A;  4II2 A;  4BEH A;  1SD4 A;  4N4N B;  3DBL B;  3SJM A;  3GWZ A;  4NHJ A;  3AL0 C;  2ZJP F;  2X1C A;  2XF7 A;  1FOX A;  4I76 A;  2BGC A;  3RYP A;  2NOG A;  2F5E A;  2F5C A;  1DUX C;  4RB2 C;  3NEU A;  2XAH A;  1WJA A;  5LGT A;  1S72 I;  4M3F A;  4UUT A;  2FML A;  1YS6 A;  3SQN A;  5JVT A;  1JUM A;  5J6X A;  4KIS A;  1MBH A;  3GFL A;  2O9L A;  3DTK A;  5JFR A;  3OYA A;  3HRT A;  2W25 A;  4XKV A;  3GZ6 A;  1V5G A;  5HDG A;  4M9Z A;  4DJA A;  1U5T B;  2R7T A;  2UV1 A;  4A3B J;  2O8X A;  1NHA A;  4LLN A;  1G8X A;  1D1B A;  1XN7 A;  1W0U A;  2DA5 A;  3R0J A;  3KE2 A;  3VYR B;  2HTJ A;  2W57 A;  1NG7 A;  5F0H A;  3RQI A;  4ZYG A;  5L3D A;  3DBH B;  1SC7 A;  4V19 K;  4AU7 A;  4DNC A;  2GWR A;  3KCC A;  3OYG A;  1ZLK A;  1FJL A;  3BTI A;  2X9D A;  5D6E A;  4BE1 A;  2YUS A;  1Z67 A;  3M9A A;  1DP7 P;  4A3G J;  5FLV A;  4ENN A;  5F04 A;  2OTL I;  2P5L C;  1HDD C;  4CSW A;  1E3H A;  1JTX A;  1Z77 A;  4D9J A;  1H8A C;  2LLK A;  3D5R C;  3I56 I;  1P2F A;  4IPA A;  5FD5 A;  1DU0 A;  2ESN A;  4HV5 A;  3BR0 A;  1PUE E;  3HDD A;  1BA5 A;  1SEU A;  3A0B C;  4OIP F;  4BXX J;  4F52 A;  2DAO A;  2LSO A;  1RNL A;  3QU6 A;  2L4M A;  4UB6 C;  2BVL A;  2WAE A;  3R4K A;  4OIO F;  1IZ1 A;  1HKQ A;  2R7Z J;  5GAD J;  4CCL A;  4C2M J;  3R60 A;  2CFX A;  4B3A A;  3CJR B;  5EZG A;  3I5U A;  3E5U A;  3VFZ A;  4XKW A;  5K1Y A;  4E70 A;  1BI2 A;  3OL4 A;  2WAQ A;  2PMH A;  3HM5 A;  4HX7 A;  2HOA A;  3NWT A;  3FKJ A;  1I50 J;  1ZAR A;  2M3A A;  2PJR A;  1H88 C;  1V5E A;  3KIO A;  1OQY A;  1LPQ A;  2K7L A;  2FX0 A;  4V2F A;  2LFB A;  3K2Z A;  4DBR A;  1D1C A;  3MKW B;  1OYY A;  2HFH A;  3H5R A;  3OYD A;  5CLS A;  3P9I A;  3C3W A;  4AVZ A;  1OIS A;  5J40 A;  1YLF A;  1WVR A;  3HYI A;  4Q4Z F;  4A5M A;  4HEA 2;  4GRI A;  3F3X A;  4KT6 A;  1LNW A;  2JA7 J;  3LFK A;  1NH3 A;  1JKR C;  2V1U A;  4W97 A;  1HQC A;  2CW0 F;  3S1R J;  2JVH A;  4PJJ A;  2STW A;  1QPI A;  3TO7 A;  3GTJ J;  3FIW A;  4I99 C;  4BS9 A;  1PVE A;  3I4M J;  4ZDL A;  2MGQ A;  4B1R A;  2K4J A;  3S1N J;  3M1E A;  3L2W A;  2DMP A;  2LD5 A;  2W00 A; 
#chains in the Genus database with same CATH homology
 4QLC U;  1BI0 A;  5FLX K;  3SZT A;  3E97 A;  5H20 A;  1FT9 A;  1X3U A;  5BMZ A;  2KRF A;  2EA2 A;  3HRU A;  2ESH A;  4WX9 A;  1O3T A;  1UHW A;  3FF5 A;  2VBY A;  5E20 A;  4HAM A;  3GUD A;  2ADU A;  4NQW A;  2KKO A;  4BNC A;  4OMZ A;  2CGP A;  2VE8 A;  5DD8 A;  3E6D A;  2XKP A;  1W7P D;  5LHG A;  3N97 A;  5ICG A;  3BY6 A;  2QEN A;  3TDU C;  3JTH A;  2KJC A;  2KIM A;  1YW9 A;  1W5T A;  5FFX A;  3SFZ A;  3DXJ F;  4OIN F;  2RGV A;  5L3E A;  3NRV A;  2ZME B;  1IN5 A;  4LB6 B;  4PGG A;  1L0O C;  4BH9 A;  2FQ3 A;  2VOD A;  4EJU A;  3FXR A;  1P4X A;  1RI7 A;  4KIC A;  4HDU A;  2G7U A;  1EH6 A;  3CUQ C;  2M8E A;  3V4G A;  4DQ2 A;  4EGZ A;  1F1Z A;  2FBI A;  1YO5 C;  5LHI A;  1FYL A;  2QQ9 A;  2NRA C;  3BPX A;  4AIJ A;  2HQN A;  1BC7 C;  2A07 F;  2L01 A;  2PBI A;  3KEO A;  4EV0 A;  4LG0 A;  4M71 A;  3BJA A;  1QGP A;  1GHC A;  3L9F A;  2XAF A;  4EJO A;  2PLY A;  5IT9 Z;  1IF1 A;  1Y0U A;  1XMA A;  3P9C A;  4EMS A;  4RB1 A;  3HSR A;  4KN7 X;  1CGP A;  3N4M A;  5LLQ A;  4UVA A;  3ROU A;  3DF8 A;  3BJO A;  1R5G A;  1MJA A;  2H94 A;  3SXY A;  4P96 A;  4KIB A;  1G6N A;  1FYK A;  5JHU A;  4HBL A;  1MDM B;  3GYH X;  2P6T A;  4WXH A;  1O3R A;  1HSJ A;  3QPH A;  4PCQ A;  2YX7 A;  1J0R A;  1S3J A;  5LGU A;  1U3E M;  3GXO A;  4IVN A;  1WWX A;  2CG4 A;  5LGN A;  3MWM A;  1UB9 A;  4GO1 A;  4ESF A;  2GQQ A;  4ZYD A;  3FZV A;  4XSZ F;  2J5O A;  2FSW A;  5DCF A;  3WTV C;  5E1X A;  3W6J B;  1QO0 D;  4ZZL A;  1ONV A;  2MA3 A;  1SMT A;  1WRJ A;  4ZH4 F;  4A2U A;  4MHG A;  4LJZ F;  4IF4 A;  2CSO A;  4RAY A;  2HDC A;  1SAX A;  5E8G A;  3MCZ A;  4EM0 B;  1I27 A;  2Y48 A;  5TJJ A;  2EFN A;  3P7N A;  3C18 A;  1XGS A;  1J9I A;  4R79 A;  3TDZ C;  4BHB A;  4A0Z A;  3G73 A;  1LDK B;  1XCV A;  4S04 A;  3DQV C;  1YQA A;  2XUB A;  3RTR A;  1LVA A;  3T0Y A;  3M8E A;  3Q9S A;  1TQP A;  1P92 A;  1FNN A;  4LLL A;  2Q0O A;  1ZRD A;  1JHF A;  4IRH A;  4A5N A;  3TO6 A;  3V8K A;  3J80 Z;  5HS9 A;  5HDN A;  4U0V A;  2DI3 A;  2ZJ2 A;  4B8X A;  4LFU A;  1HW5 A;  3WTU C;  2E1C A;  2Z33 A;  1FX7 A;  2ZBK A;  3V7C A;  3C1D A;  3I59 B;  3LQQ A;  2YU3 A;  3WOD F;  4JBA A;  4HF1 A;  4A12 A;  2EA4 A;  2ZME A;  3ZQ7 A;  1HW2 A;  2BYV E;  4WWC A;  2G9W A;  4MTE A;  5CVV A;  1OKR A;  1O3S A;  4CDG A;  3QU3 A;  4NB5 A;  1R7J A;  1XSX A;  1J7K A;  3O6B B;  2M1B A;  5HLH A;  2L54 A;  3EQL F;  3I71 A;  3KP5 A;  2QYO A;  2A61 A;  4CHU A;  1UST A;  3BWG A;  5DDG A;  4O6J A;  3MFK A;  3HRM A;  2EFW A;  3TQN A;  1W5S A;  2HGC A;  2GA1 A;  3ABT A;  1R58 A;  2X4H A;  3D0S A;  3REO A;  2L3D A;  1SFX A;  1S8N A;  4L5I A;  4HV6 A;  2P8T A;  1J5Y A;  4WCG A;  4OOI A;  1YTY A;  1ON1 A;  2OZU A;  2PMU A;  2OQR A;  2GXG A;  4UHT A;  4EVI A;  4MQ9 F;  4HX8 A;  1J59 A;  2RNJ A;  3I58 A;  1TW3 A;  4EGY A;  2GIV A;  4HX4 A;  5LRS A;  4MNU A;  2Y75 A;  2FE3 A;  4M6X A;  1XGO A;  2GZW A;  3M7G A;  4IHS A;  4M9S A;  3RPU A;  3IWZ A;  1CF7 B;  4A6E A;  4CGZ A;  2IA2 A;  3I0T A;  4RB0 A;  3JAM K;  3WGI A;  3K1N A;  4CYD A;  2XAG A;  2WTE A;  2IRF G;  4G7H F;  1LDJ A;  2ZNY A;  3SHF A;  3DPT A;  2ZFW A;  2C6Y A;  4KNY A;  3WTX C;  3P9K A;  1HXD A;  3EYI A;  3HRS A;  3WE3 A;  2VT3 A;  3PFI A;  5FD6 A;  1CF7 A;  5ILS A;  3RDI A;  2O61 A;  1G3W A;  4I01 A;  4A0Y A;  1WI9 A;  4L9N A;  2KJB A;  4KN4 X;  5E8I A;  2EWN A;  1BIB A;  3HSE A;  2DFI A;  4HQE A;  4WF2 A;  1F5T A;  1Z6R A;  1FPQ A;  1D5V A;  2STT A;  2P7V B;  2IA1 A;  1LQ1 A;  4XRF A;  2PFB A;  1XGM A;  2A69 F;  4KYW A;  3C7J A;  5FLX Z;  4RGR A;  3ZMV A;  1Z1D A;  2LF8 A;  2LF7 A;  1ZG5 A;  5LHH A;  2Z5U A;  3LA7 A;  2FOK A;  3E6C C;  1BOA A;  1TNT A;  4ZYE A;  3R61 A;  1B6A A;  1FBU A;  1ZRC A;  3WU0 A;  4OMY A;  1TBX A;  2RQP A;  1FOK A;  3SZP A;  2DO7 A;  2F2E A;  3K1P A;  2ZNZ A;  5L3C A;  2FEZ A;  1IXS B;  1TTY A;  4FX0 A;  5FO5 A;  2VN2 A;  2YX4 A;  4UV9 A;  4ENJ A;  5HLI A;  1QQI A;  3ZMU A;  3W6K B;  2LKP A;  4H0E A;  1HW1 A;  3E5Q A;  1DPU A;  1FWZ A;  1WQ2 A;  1ULY A;  3EYY A;  1TQI A;  4I0B A;  1MKM A;  5E1Z B;  2MBF A;  1JE8 A;  3T8T A;  1MJ9 A;  2IVM A;  3AAF A;  1KGS A;  3VEP A;  4IRI A;  3BPV A;  1I1S A;  3WTZ A;  1MJB A;  4MEX F;  3IWF A;  4B09 A;  1R1T A;  5ICE A;  1T38 A;  1XDU A;  3EUH A;  5CVR A;  3FXU A;  1K7A A;  3VOD A;  2MC3 A;  5CVJ A;  2VXZ A;  4EJV A;  5D5W B;  2F5D A;  3ZN1 A;  4HLY A;  2TDX A;  3WTS C;  4L0Z B;  3GF2 A;  3RPQ A;  2VOO A;  1EH8 A;  3ZMD A;  2AS5 F;  2ISZ A;  3F8C A;  2HQR A;  1S7A A;  2JTV A;  2XAJ A;  1R36 A;  2HYG D;  1XB4 A;  6PAX A;  4N9I A;  1ZGJ A;  2Z99 A;  4XBF A;  3RYR A;  3FX3 A;  3HTS B;  4G94 A;  1IRF A;  4EJW A;  4Y15 A;  1H0M A;  3WE2 A;  1ZRE A;  3RI4 A;  2DK8 A;  5K5O A;  1ZG3 A;  1B4A A;  2HKX A;  3T1B A;  2IA0 A;  5CJ9 A;  2X0L A;  2O6G E;  4BHC A;  4KIG A;  1U78 A;  1XGN A;  1B9M A;  1K78 A;  5D8L B;  1ZRF A;  3TKY A;  4GCV A;  4M6Y A;  2RV8 A;  1MZB A;  2HZT A;  3I4P A;  1RZ4 A;  3F21 A;  5D4S A;  1T6S A;  1BBY A;  4PGH A;  2YSR A;  2ELH A;  4G9Y A;  4ON0 A;  2MD5 A;  1QPM A;  3IKT A;  3BP8 A;  3GZ5 A;  5D5U B;  4LMY A;  1L3L A;  2GA2 A;  2NS0 A;  5ICF A;  1LB2 A;  4MEY F;  4EM2 A;  1B9N A;  2PQ8 A;  3V8L A;  1BI1 A;  1FC3 A;  1SD6 A;  2DT5 A;  1XDS A;  4GXO A;  1R00 A;  2FU4 A;  4L9T A;  4YFX F;  1Z05 A;  5H6R A;  4HZF A;  3KET A;  1TLH B;  1IUY A;  1USS A;  3ZMS A;  4Q48 A;  1DDN A;  3K0L A;  1AWC A;  4Z2Y A;  3KP7 A;  1ZN2 A;  2RC4 A;  3CDH A;  5BS6 A;  2W84 A;  3DFG A;  1QBJ A;  1R1V A;  2HOE A;  2IPQ X;  2EV0 A;  3E5X A;  4MTD A;  2A68 F;  1FBQ A;  4UVB A;  4I09 A;  3OOP A;  3L09 A;  3BOQ A;  4ESB A;  3R0A A;  2LDU A;  5ERI A;  3MAJ A;  4HDV A;  1T98 A;  5LRR A;  3S2W A;  3WTW C;  5KVR A;  4P9F A;  3F22 A;  2BV6 A;  2WV0 A;  1YW7 A;  2Z3Y A;  4PZJ A;  2JT1 A;  3TOB A;  2IP2 A;  2R7F A;  2A5Y B;  2HR3 A;  3GEZ A;  5E18 F;  2ZCW A;  4WXC A;  5DCM B;  2AXL A;  1FP1 D;  2K02 A;  2YPR A;  2P4W A;  5CVU A;  3HHH A;  4KA4 A;  1UFM A;  2DK5 A;  2XV4 S;  2E7W A;  3ULQ B;  2D2W A;  3M8F A;  5FB2 A;  2QQA A;  5EEH A;  2BBY A;  4AD9 A;  4IRG A;  5DUI A;  2FMY A;  3OV8 A;  4R8H A;  4UVC A;  1Z91 A;  5L3F A;  3LAP A;  4UUV A;  5TRD A;  2W85 A;  1KA8 A;  5H6Q A;  1EH7 A;  4CO8 A;  3CJN A;  5EEG A;  3E3V A;  3LWF A;  4F7Z A;  3FXQ A;  1T39 A;  2OBP A;  2OD5 A;  1H9G A;  5J8F A;  1B59 A;  5HDK A;  4OIQ F;  4M73 A;  3FM5 A;  3NQO A;  1F9N A;  5A2Q Z;  3KZZ A;  3KLN A;  2XAS A;  2A6H F;  3QP5 A;  3I53 A;  1KQ0 A;  5A2Q K;  4O5V A;  3F8N A;  3ERE D;  4BYY A;  3EDP A;  3GFJ A;  1G4D A;  4FHT A;  2CYY A;  5HOO A;  2H6B A;  5D8K B;  5IT3 A;  4R1H A;  4M74 A;  2ZO4 A;  3FMS A;  1D8J A;  2B0L A;  2Z9O A;  2QZ8 A;  4P55 A;  1MGT A;  1IN7 A;  5LEK A;  1R5H A;  3RJP A;  4YFN F;  1WSU A;  3QAH A;  3JSO A;  1IRG A;  3HSF A;  3CUO A;  2RN7 A;  4U7B A;  2V1X A;  3O2P E;  1K6O A;  2OZ6 A;  1BJA A;  1B1B A;  1PDN C;  5FFZ A;  2V9V A;  2JPB A;  2G7H A;  1GXP A;  3K1M A;  2R3S A;  2V79 A;  3V7S A;  2QVO A;  3ZP5 A;  1D3Y A;  1V3F A;  2CWE A;  2IJL A;  2KIU A;  2OQG A;  4EM1 A;  4A0X A;  2XIG A;  3WG9 A;  2L4A A;  4U0W A;  1YIO A;  5DUK A;  3H92 A;  2P6S A;  1REP C;  5F1R A;  2MLK A;  4ESJ A;  1IN4 A;  2EV6 A;  3F6V A;  1OYI A;  2R7D A;  1I1G A;  1ZH5 A;  3LA3 A;  1WKM A;  4I98 B;  1R22 A;  1IN8 A;  1KU3 A;  3KP6 A;  2YR2 A;  1O7F A;  1J75 A;  4HYE A;  3GLX A;  4HLX A;  2BE5 F;  5E1W A;  2NAZ A;  3ZN0 A;  4GYG A;  4YIF A;  3GO5 A;  3CO7 C;  4L9J A;  3TGN A;  2NYX A;  3F8M A;  4AIH A;  5DCM A;  1UCR A;  1A04 A;  3QPT A;  1KYZ A;  3GVA A;  3MZH A;  4BQA A;  4YII A;  4LB5 A;  4GGG A;  1SFU A;  4G6D A;  5KK1 A;  2JSC A;  4KT5 C;  2XGX A;  2UZK A;  5DEQ A;  3RIR A;  1SMY F;  2OAZ A;  2XAQ A;  2P5V A;  1S6L A;  1EV7 A;  2FBK A;  1GVJ A;  3ECH A;  3ML6 A;  2F5F A;  3KLO A;  2FF4 A;  2HEO A;  2Q8K A;  3F23 A;  1HST A;  4L9V A;  3WGG A;  3FM3 A;  4CXF A;  1XCB A;  5BPI A;  3ELK A;  3HUG A;  1TQM A;  1G3Y A;  2FBH A;  3HIF A;  2QBY A;  4N9H A;  2XKO A;  1KQ9 A;  3IL2 A;  4LK1 F;  1KU2 A;  2GXB A;  3WTY C;  1XMK A;  2D1V A;  4EJT A;  1D8K A;  3GX4 X;  5HVQ C;  3VOE A;  3T5X A;  2MLG A;  2O03 A;  2CO5 A;  1OPC A;  3IRR A;  2K86 A;  3F6O A;  3F8F A;  5L3G A;  3CUQ B;  5IT9 K;  4G8X A;  4LGW A;  3BRO A;  5L3B A;  2H27 A;  3PQK A;  2ACJ A;  2VOP A;  4ZZD A;  5DYM A;  2DQR A;  4JK1 X;  4ENK A;  2VC0 A;  3BJ6 A;  1QZZ A;  1JHH A;  5JR3 A;  1G3S A;  2W24 A;  1S29 A;  3LA2 A;  4BXU A;  3JSP A;  2UWM A;  2UXX A;  4K2E A;  3ECO A;  1VTN C;  1HBX G;  4YG2 F;  3ABU A;  5DV5 A;  4OIR F;  1HKS A;  2H6C A;  2HYF A;  1FSE A;  3RKX A;  3L7W A;  1PP7 U;  2Y0M A;  5BQT A;  3KP4 A;  3JAM Z;  5HS7 A;  3HOS A;  4HF2 A;  3B02 A;  1R1U A;  3HOT A;  3MZY A;  1SD7 A;  1T0F A;  4QWQ A;  2DBB A;  4Y13 A;  3DPL C;  5LEJ A;  2LNB A;  2WWY A;  2VT2 A;  2E7X A;  1AOY A;  1FBS A;  3J80 K;  1YS7 A;  5ICC A;  3KFW X;  1BI3 A;  1LEA A;  1FY7 A;  2JZY A;  2M30 A;  2PJP A;  4KIF A;  4P9U A;  1T2K A;  1P4W A;  2ISY A;  1LJ9 A;  1JXS A;  1U8R A;  2M5W A;  3RKY A;  4HQM A;  4M72 A;  2QWW A;  1YYV A;  2HTS A;  2A3S A;  3JTG A;  5AON A;  2HS5 A;  4LK0 F;  2DPD A;  1STZ A;  2H09 A;  3DP7 A;  4UNO A;  3CUQ A;  4HA8 A;  1SD5 A;  2OU2 A;  4KDP A;  5CYV A;  2DTR A;  3ZMZ A;  4P5O A;  3LQR A;  1S7O A;  3HTU A;  3HHG A;  1KU7 A;  3MEX A;  2D1H A;  2V6C A;  1C0W A;  1YW8 A;  4WXD A;  1W7P A;  4ETS A;  1ZG1 A;  2K4B A;  4ENM A;  5D5X B;  1HKT A;  2M87 A;  4HF0 A;  3IC7 A;  4AVP A;  3Q9V A;  2EB7 A;  3FMR A;  1I5Z A;  4AWX B;  5AIP A;  2HKO A;  1XD7 A;  2NNN A;  4O3M A;  5CVI A;  1I6X A;  1P4A A;  3LAJ A;  5K5R A;  1O57 A;  4FT8 A;  1R23 A;  2COM A;  3EET A;  4RAZ A;  5D6F A;  1RUO A;  1IN6 A;  2P5K A;  4I7H A;  1MDM A;  5K5Q A;  1W7P B;  4M9X A;  4Q5S F;  2EV5 A;  1JGS A;  1U5T C;  4UV8 A;  2VBX A;  3IKV A;  5J8C A;  1DPR A;  2ZXJ A;  1FSH A;  1J2X A;  3V7R A;  2VC1 A;  4BAY A;  3ZPL A;  3DV8 A;  1IAW A;  1MD0 A;  4LLG F;  3QOP A;  2XRN A;  4L18 B;  1IXC A;  2HWV A;  5F6F A;  2VBZ A;  4EQQ A;  3BZ6 A;  2CQK A;  5ILU A;  2PI0 A;  4IJA A;  5D5V B;  2Q2E A;  3VB2 A;  3CTA A;  4RGS A;  3K69 A;  2RKH A;  2RVC A;  4RB3 C;  3GFM A;  3Q5F A;  1BN5 A;  3DKW A;  2VE9 A;  4FX4 A;  2XHK A;  4MQV A;  4I2O A;  4U88 A;  4IXA A;  1ZLJ A;  2JPC A;  2IW5 A;  1KQ8 A;  1FP2 A;  5DD4 A;  2EFQ A;  2FA5 A;  1OR7 A;  4ASN A;  4S05 A;  3KP2 A;  4RGX A;  1TNS A;  2OA4 A;  1Z9C A;  3PQJ A;  2PN6 A;  4KMF A;  1IXR C;  3WU1 B;  2QLZ A;  3RKW A;  1ZAO A;  1XSV A;  4WK8 F;  2PEX A;  2V1D A;  4JQF A;  4L0Y B;  2P7C B;  2BEO A;  4XLN F;  3QRF F;  3V8J A;  2NNY A;  5JI6 A;  1K78 B;  3R6S A;  2FRH A;  3KP3 A;  4GYI A;  4N0B A;  4G7Z F;  4U0Y A;  2K27 A;  4KFC A;  3LST A;  2XVC A;  5HLG A;  3L2C A;  1LDD A;  2RDP A;  1XSD A;  4OU0 A;  3B73 A;  5BOX A;  1Q1H A;  2D45 A;  1F4K A;  4KMU X;  2DQL A;  3I64 A;  5F64 A;  2QM3 A;  4BHP A;  4LG0 B;  2FNA A;  1U5T A;  1FZP B;  3ZMT A;  4XLP F;  1SFE A;  4CZZ A;  4A6D A;  1ZGA A;  4IHT A;  2DU9 A;  3COA C;  3DEU A;  3FHZ A;  2E1N A;  1O3Q A;  4Q47 A;  3JW4 A;  4U7D A;  4RS8 A;  1TW2 A;  3GW2 A;  3MQ0 A;  2VBW A;  4TV7 A;  3J7A O;  3WTT C;  3GFI A;  2WC2 A;  2M45 A;  1W4M A;  3H3Z A;  2VON A;  4HOB A;  5D4R A;  3F8B A;  3BDD A;  1G3T A;  1KYW A;  3G3Z A;  3ISP A;  1QNT A;  2A6E F;  3E6M A;  2O3F A;  4MGR A;  3U2R A;  4I0A A;  3QP6 A;  4YFK F;  1QZY A;  3KEQ A;  1ZYR F;  3FWE A;  3I59 A;  1FYM A;  5BPD A;  2XRO A;  2EK5 A;  2MH9 A;  1GXQ A;  4I02 A;  2EFO A;  3WGH A;  2KIF A;  3L00 A;  2IT0 A;  1YG2 A;  4ZYH A;  2QBY B;  2ETH A;  4G7O F;  3I54 A;  3T8R A;  4Y17 A;  3J81 K;  1FLI A;  2MH2 A;  3FMQ A;  4UXN A;  4L5J A;  4RGU A;  2O0Y A;  3IRQ A;  4PDK A;  2GAU A;  3U9G A;  2PG4 A;  3F72 A;  1UHM A;  2QQB A;  1YFH A;  2DLL A;  1BIA A;  1E2X A;  1OYW A;  2J5P A;  1K79 A;  3CLO A;  5AIQ A;  2EFP A;  1U6G A;  1Z7U A;  1H9T A;  1IW7 F;  4D0P A;  1O7L A;  3IHU A;  5LBQ A;  5ED4 A;  1ZHF A;  3O3K A;  4HW0 A;  3K9T A;  3TOA A;  2ZKZ A;  1RUN A;  5HS8 A;  5FGM A;  3J81 Z;  1PP8 F;  4KUM A;  1V4R A;  3U1D A;  2FXA A;  1Z6T A;  2FNP A;  2JRT A;  1P6R A;  2EJR A;  1BM9 A;  3TO9 A;  4CIC A;  3D5L A;  1RIO H;  4LD5 A;  3H3U A;  1ODD A;  1E17 A;  1U2W A;  5E17 F;  1ON2 A;  1BC8 C;  4G6Q A;  1LEB A;  4AIK A;  1OMI A;  2DW4 A;  2QUF A;  4XSX F;  3CO6 C;  2DPU A;  2L02 A;  1KU9 A;  2UXN A;  5ILV A;  3E6B A;  3KZY A;  1SD4 A;  4NHJ A;  3GWZ A;  2BGC A;  3RYP A;  2F5E A;  1DUX C;  2F5C A;  4RB2 C;  3NEU A;  2XAH A;  5LGT A;  2FML A;  1YS6 A;  3SQN A;  5JVT A;  5J6X A;  3GFL A;  5JFR A;  3HRT A;  2W25 A;  3GZ6 A;  5HDG A;  4M9Z A;  1U5T B;  2O8X A;  1NHA A;  4LLN A;  1XN7 A;  3R0J A;  3KE2 A;  2HTJ A;  2W57 A;  4ZYG A;  5L3D A;  4DNC A;  2GWR A;  3KCC A;  1ZLK A;  5D6E A;  3M9A A;  1DP7 P;  4ENN A;  2P5L C;  1P2F A;  4IPA A;  5FD5 A;  2ESN A;  4HV5 A;  1PUE E;  4OIP F;  2DAO A;  2LSO A;  1RNL A;  3QU6 A;  2L4M A;  4OIO F;  3R4K A;  1IZ1 A;  1HKQ A;  3R60 A;  2CFX A;  3I5U A;  3E5U A;  3VFZ A;  5K1Y A;  4E70 A;  1BI2 A;  2PMH A;  4HX7 A;  1ZAR A;  2K7L A;  3K2Z A;  1OYY A;  2HFH A;  5CLS A;  3P9I A;  3C3W A;  1YLF A;  3HYI A;  4Q4Z F;  4A5M A;  3F3X A;  1LNW A;  3LFK A;  2V1U A;  1HQC A;  2CW0 F;  2STW A;  3TO7 A;  2K4J A;  3M1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...