3TQNA

Structure of the transcriptional regulator of the gntr family, from coxiella burnetii.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
107
Chain Sequence
MMRWDDKKPIYQQLRDKIVEAIIDGSYVEGEMIPSIRKISTEYQINPLTVSKAYQSLLDDNVIEKRRGLGMLVKAGARQRLLTQEKQYFLKKQWPQIKNKLERLGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transcription
molecule keywords Transcriptional regulator, GntR family
total genus 31
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tqnA01
2GWRA 2VC0A 4YG2F 4OMYA 3W6KB 2F5CA 1TQPA 2PN6A 2XRNA 4Y15A 5HLGA 1J59A 1P92A 1BOAA 1W5SA 2KRFA 1O3SA 4YFKF 1LEBA 2GIVA 4LLNA 5EEGA 3IL2A 1WRJA 4L0ZB 1P6RA 3GVAA 4KYWA 1YW8A 3KE2A 3HTUA 4NHJA 1F5TA 5DYMA 4YFXF 5LGTA 3IRRA 5A2QK 4HBLA 4HLYA 2IA0A 1R1TA 2XAGA 4EV0A 1JHHA 1BIAA 4O5VA 5K5RA 3QP6A 1TTYA 4U7DA 1IAWA 6PAXA 1AOYA 4P5OA 1O3TA 1HW2A 2O0YA 4BYYA 1S29A 5LHHA 4IRGA 1QZYA 2DU9A 5J8FA 3QU6A 3T5XA 5ICEA 5E8GA 4KMFA 1P2FA 5LLQA 5LEJA 2Y75A 1JGSA 4AWXB 3EQLF 3HUGA 5E1WA 3HTSB 2YU3A 1IN8A 3WTVC 5E17F 4XRFA 3EUHA 4IRIA 3DFGA 2XIGA 3C7JA 5CVRA 1MKMA 4M9ZA 5H20A 4HX8A 1LVAA 2HTSA 5JVTA 1HW5A 4I01A 2OQRA 1MZBA 4M9XA 2AS5F 3DP7A 4EMSA 2HQRA 3RYPA 3GUDA 2QLZA 2QYOA 3ULQB 1YO5C 1KYWA 3HIFA 1ON2A 1TBXA 1GXPA 3CJNA 3H92A 4KFCA 2E7XA 4IVNA 2F5EA 2QQ9A 3KP5A 3E6DA 1BM9A 1MJBA 3DPTA 2M8EA 5CLSA 3QRFF 1G6NA 3RIRA 3KLOA 1LNWA 3VFZA 2XAHA 5ICGA 3FMQA 2Q8KA 3JTHA 3I54A 1U5TB 4LLLA 3LQRA 4L5JA 2K86A 1XCBA 2Z99A 3DF8A 1MD0A 4M74A 5LHIA 1V4RA 1IZ1A 3LA3A 3JAMZ 3HRSA 3Q9VA 2ZBKA 2PJPA 4G7ZF 2VT3A 3D0SA 3GFLA 3GFIA 3ZMTA 5L3DA 1OPCA 2FSWA 1Z6TA 3L7WA 3ROUA 3RYRA 2EWNA 2M1BA 2FMLA 3U1DA 5HS8A 1IXRC 1SMYF 2AXLA 1Z9CA 2QBYA 3E5XA 4M72A 2E1NA 2EFOA 3K1NA 1YFHA 1XGSA 3F6VA 5ILUA 2KIUA 2KIMA 3ZQ7A 2TDXA 2MH2A 2PBIA 5D5UB 3IHUA 3M7GA 5IT9K 4A5NA 3LA7A 2W25A 3B73A 4EJVA 2EFNA 5FGMA 3WTSC 1O7LA 4WK8F 4P55A 1IF1A 4M9SA 1P4XA 1KQ8A 2DLLA 3JTGA 2MH9A 5DV5A 5K5QA 3R61A 1BIBA 3J81Z 3DXJF 3KETA 3MQ0A 4UVCA 2O8XA 2FE3A 3LWFA 4LD5A 2Y48A 2ZO4A 4PZJA 2VBZA 3E5UA 3I71A 2HZTA 4KICA 2VBWA 1FBSA 2D45A 2IA2A 2A5YB 1YW9A 3QU3A 3WTZA 4CICA 3V7RA 3I58A 2DO7A 4N9HA 1OR7A 5FFZA 4JK1X 4M6YA 2Z9OA 5BPIA 1USSA 2DFIA 1B59A 5DUIA 1G3TA 2HYGD 2ISZA 1IXSB 3V7CA 4ENJA 4EM2A 3T8RA 3GZ5A 2MLKA 2EFWA 5J8CA 3J7AO 2Y0MA 3I59B 2GXBA 5L3EA 1SD7A 3WU1B 2O3FA 2GZWA 2RC4A 5FFXA 1HSJA 4UVBA 3M8EA 4WXHA 4Q4ZF 2PFBA 2P7CB 1LQ1A 3ERED 4N9IA 3ZMZA 4N0BA 2GA2A 4G6DA 2OA4A 2RDPA 5HLIA 2IP2A 2UXXA 2FNAA 2EJRA 3V8KA 1Z7UA 3I64A 1HKTA 5E1XA 3BP8A 4ENKA 1TW3A 4RGSA 3RPUA 2E7WA 4U0YA 3GFJA 4I0AA 4H0EA 3WE3A 4GGGA 5ILSA 4Q5SF 3ZMDA 3E6BA 1W7PD 1ZGJA 4K2EA 3WODF 3BJ6A 2DK8A 3F72A 1ZN2A 1CGPA 2LF7A 1EH6A 4XLPF 3J80Z 4Y17A 4ON0A 2K4JA 2YR2A 2H27A 1S6LA 1R36A 3RTRA 3RKYA 3KZYA 4HF0A 2GQQA 4OOIA 5ILVA 2ISYA 1D5VA 3SZTA 4A0XA 4KA4A 3M9AA 2FRHA 1K7AA 4Q48A 1U6GA 5F6FA 5L3GA 5D5WB 5E8IA 2VOOA 5CVJA 3ZMUA 5D6EA 1ZRDA 4ZH4F 5DCMB 1SMTA 2HFHA 5HVQC 3RJPA 1KQ0A 1Z05A 2BV6A 1O3RA 2KIFA 1XSDA 2PQ8A 4M6XA 5DCFA 5CVVA 3PQKA 1ZG5A 2F2EA 1FNNA 2M30A 3SFZA 4ESJA 1B6AA 2RKHA 1JXSA 4RB3C 4P9UA 4UV9A 3GZ6A 2P8TA 5CJ9A 3SXYA 2G9WA 2P6SA 1CF7B 2ZNYA 2D1VA 3K1MA 3GWZA 3T0YA 3G73A 4AIJA 1RI7A 2VXZA 4ENMA 1J75A 4WF2A 1LJ9A 1J7KA 4BXUA 2OZUA 4EJUA 4CHUA 1RNLA 4MEYF 4I0BA 1J2XA 2R7DA 2ZCWA 2IJLA 2YPRA 1ZH5A 2HS5A 2UWMA 1SFEA 1DPRA 1R5HA 1LEAA 1XCVA 2M5WA 2L02A 1S8NA 3P7NA 2V6CA 5ICFA 4BHCA 1R58A 3VODA 3BPXA 5JFRA 1FP1D 3E97A 5L3FA 2ESHA 3IWFA 1CF7A 4KDPA 3QP5A 1SFUA 2L01A 3K69A 3VOEA 5L3BA 3JSPA 1MJ9A 4XBFA 5BMZA 4RAZA 3V8LA 2DPUA 2KJCA 2W24A 5FO5A 4P9FA 2QWWA 1FLIA 5DCMA 2PI0A 1Z6RA 2FBHA 1BN5A 2R3SA 2EA4A 4HYEA 3HOTA 3BWGA 4FT8A 1LDJA 1LDKB 4CZZA 3KCCA 1XSVA 2OBPA 3WGIA 2O6GE 2UXNA 4EM0B 5DDGA 4MTDA 2A6EF 3ABTA 2L54A 2IRFG 4UNOA 2XASA 1B4AA 2X4HA 2VT2A 2ZJ2A 3U9GA 3KP4A 1K78B 1DUXC 1QGPA 1TNTA 4LMYA 1SD6A 1AWCA 1K79A 1D8KA 1U5TC 1FX7A 2K4BA 4FHTA 3KLNA 4OINF 5H6RA 3FMRA 4MNUA 3IC7A 5EEHA 2BGCA 5LEKA 1DPUA 5FD6A 2O03A 4KN7X 1FYLA 3F8CA 4MEXF 4OIOF 1ZLJA 1L0OC 3TDZC 5F1RA 1J0RA 1HKSA 2QVOA 3Q9SA 3O3KA 1IUYA 4EGYA 3F6OA 3ZMSA 3PFIA 1LDDA 1H0MA 1R1UA 2MC3A 1T6SA 4CO8A 2JSCA 2BE5F 3WTTC 4A0YA 3DEUA 2B0LA 3O6BB 1WKMA 3RKXA 4HLXA 1I1GA 4OIRF 2BBYA 2P5LC 3I59A 1P4WA 2BEOA 5D8KB 4FX0A 1KU3A 2BYVE 2XVCA 3LFKA 4ESFA 4L5IA 3V4GA 5F64A 1E17A 4XSZF 2D2WA 3TOBA 4L0YB 2DQRA 2RVCA 1I5ZA 1HBXG 5DD8A 2Z3YA 3TOAA 2HQNA 2P6TA 1W4MA 3RPQA 3BDDA 4EM1A 1RUOA 1FYMA 4ASNA 1J9IA 2VE9A 2XV4S 1XGOA 2HWVA 1YS6A 4A6EA 3GF2A 4UXNA 4O3MA 3G3ZA 2JRTA 2FXAA 2NRAC 3IKTA 2K7LA 1SD4A 1STZA 4IF4A 2ADUA 4R1HA 2G7HA 4EQQA 3F8MA 2EA2A 4G6QA 2VOPA 3SZPA 3GX4X 3FXUA 2RGVA 4I7HA 2HR3A 5K1YA 4OU0A 3QPTA 1BI1A 5CVUA 1UFMA 2C6YA 3WE2A 3M8FA 4WX9A 2JT1A 4HX4A 1OYYA 4MQ9F 3EYIA 5JR3A 5D6FA 4LJZF 1S7OA 3ML6A 1EV7A 2ZKZA 1FBQA 3KFWX 3K0LA 1T39A 3TO9A 2H94A 2H6BA 2W57A 2PLYA 5HDGA 4LB6B 2P5KA 2MBFA 2X0LA 3PQJA 2LKPA 4HV6A 2FF4A 3Q5FA 2MLGA 2VBXA 1T38A 1ZLKA 2XHKA 1E2XA 1XN7A 5D4RA 3FM3A 1GHCA 3N4MA 2R7FA 3QOPA 1U5TA 4RS8A 4GYGA 3V8JA 4IJAA 3RKWA 3R0AA 4BAYA 2Q0OA 2V1UA 4HAMA 5BPDA 4EJWA 4GO1A 2JZYA 1XMAA 3VB2A 4QWQA 4PGHA 2NNYA 4GYIA 1GXQA 1MJAA 5LBQA 5TJJA 1F4KA 1UB9A 3SHFA 1H9TA 1RZ4A 1BC8C 5DD4A 3E3VA 1MGTA 3M1EA 1PP8F 4HF2A 2CFXA 3HSEA 2CWEA 2IT0A 1KU2A 4G94A 4LG0A 4NB5A 5JI6A 4LK1F 4PDKA 1KYZA 4YIFA 3CO7C 2XKOA 1BJAA 1YTYA 5HS7A 2YX7A 4LB5A 4KMUX 1G3WA 1KU9A 3B02A 3GW2A 2NS0A 5KVRA 3F8NA 2HYFA 3KEQA 4U7BA 1IN5A 3ZN0A 3ZN1A 1JHFA 3BJAA 1K78A 4E70A 1OMIA 2WTEA 2LDUA 1LB2A 3W6JB 1UCRA 1IXCA 3HRMA 2XUBA 2A6HF 4LK0F 1YG2A 3ZPLA 4KT5C 2FU4A 4M73A 1BI2A 3HRTA 3BPVA 4MGRA 2RQPA 1BC7C 5HDKA 1Z1DA 4CGZA 1I1SA 5D4SA 2CGPA 1D3YA 2NYXA 3RDIA 1TQMA 1TNSA 1HKQA 3HHHA 3DPLC 3E5QA 2P4WA 2QQBA 2QZ8A 4I2OA 4JQFA 3CTAA 3FX3A 4EGZA 3JAMK 2DPDA 4O6JA 4PGGA 2PEXA 3TO7A 1FY7A 3CUOA 2F5FA 4UUVA 1ZG3A 1SFXA 4Q47A 5ERIA 4ZYDA 2G7UA 1ODDA 1FT9A 3COAC 4L9TA 3FF5A 1ZARA 3KEOA 1NHAA 2OZ6A 1S3JA 1TLHB 3AAFA 2KKOA 1G4DA 2XAJA 2IA1A 3NRVA 1TW2A 2W85A 1XSXA 5CVIA 3IRQA 1Z91A 4ZZDA 1OYWA 2M45A 3S2WA 3JW4A 3WTUC 2CW0F 3LA2A 4I98B 3OOPA 4KIGA 4A2UA 2EK5A 2OD5A 3I53A 5E18F 5LGNA 3KP7A 2LNBA 2PMUA 2HOEA 4XSXF 1RUNA 2VBYA 5D5VB 3DV8A 3P9IA 1EH8A 2CO5A 3QAHA 4L18B 3LQQA 1V3FA 1W5TA 1K6OA 5J6XA 3WGGA 1MDMA 2EV6A 1QBJA 3BZ6A 2RV8A 2V1DA 2J5OA 1XDUA 4A0ZA 1C0WA 1IRGA 1KQ9A 1W7PB 4I09A 4CDGA 2P7VB 2MD5A 4IHSA 2RN7A 2A07F 3DQVC 5A2QZ 2V9VA 1OYIA 5FB2A 2QQAA 4WXCA 1R22A 3WGHA 2GXGA 3F23A 2W84A 1EH7A 2ZMEB 3KP3A 3WTYC 3L09A 3F8FA 4RB1A 2DW4A 2EV0A 1YIOA 2XAFA 4G9YA 5HOOA 1FSEA 1FP2A 2OU2A 3GFMA 4EJOA 4AVPA 1SD5A 3F21A 2DT5A 4IHTA 3NQOA 1IN4A 3CUQA 2XROA 1R7JA 4HDUA 3RI4A 4KIFA 2H6CA 2F5DA 3E6CC 2O61A 2NAZA 5LRRA 1Q1HA 2DAOA 2CSOA 3I0TA 4RAYA 3F22A 1QO0D 1WSUA 5HDNA 3R6SA 4LGWA 3HRUA 3GLXA 5FLXK 3FWEA 4AD9A 3U2RA 2WC2A 5D5XB 1BI3A 2L3DA 3MZYA 5HS9A 5LHGA 3WTXC 3V7SA 3ISPA 4MTEA 1ZREA 4RB2C 2OAZA 1XGMA 1J5YA 1U8RA 1UHWA 2VONA 1HQCA 4AIHA 1R00A 4HZFA 4L9NA 3IWZA 3J81K 4HA8A 2HGCA 2P5VA 1OKRA 1IN6A 3KP6A 3HYIA 3F8BA 4UHTA 4OIQF 1I6XA 3BY6A 4A12A 4NQWA 2ETHA 3WU0A 1B9NA 2XKPA 3EDPA 4S05A 1I27A 1R5GA 3CO6C 2J5PA 1G3YA 4WWCA 4HF1A 1UHMA 3O2PE 1ZAOA 4OIPF 3ZP5A 2LF8A 4XLNF 3GEZA 1FOKA 2IVMA 1L3LA 1B1BA 2HKXA 3FMSA 1W7PA 5JHUA 4P96A 1U2WA 2FOKA 4HDVA 1P4AA 3E6MA 2A69F 1XD7A 4KN4X 2FBIA 1DP7P 4FX4A 1T0FA 4QLCU 2EV5A 2K27A 3L9FA 1RIOH 3C1DA 1B9MA 1ZRCA 1O3QA 2QBYB 1QNTA 4DQ2A 1Y0UA 1R23A 2E1CA 1MDMB 4B8XA 2CQKA 4RGXA 3F3XA 2Z33A 4R79A 5KK1A 2YSRA 1XGNA 1ULYA 4BH9A 4D0PA 2STTA 1FYKA 2XAQA 3NEUA 4KUMA 2EFPA 2MA3A 1YQAA 4ZYGA 4TV7A 4AIKA 3KZZA 2XGXA 3I4PA 3MFKA 1H9GA 2L4AA 3TDUC 4LFUA 3K9TA 3MZHA 1JE8A 2L4MA 2HDCA 3TO6A 4RGRA 1HSTA 1PDNC 3N97A 3FHZA 2ZNZA 1F1ZA 1ONVA 1FBUA 1WI9A 4HOBA 5E20A 1BBYA 2DQLA 3BJOA 5ED4A 1YS7A 3HHGA 2RNJA 3JSOA 4G7OF 4OMZA 3H3ZA 2HKOA 4YFNF 2A3SA 4HW0A 1HW1A 2DK5A 2K02A 1KGSA 3LAJA 2FNPA 1YLFA 3R4KA 5CYVA 3WG9A 2WWYA 1T98A 4M71A 4L9JA 1SAXA 1IW7F 1X3UA 1XMKA 4A5MA 4U0WA 1TQIA 4RB0A 2FMYA 2JPCA 2V79A 4UVAA 3BOQA 5DEQA 3TQNA 1KA8A 1WWXA 2ACJA 1T2KA 1ON1A 3VEPA 2WV0A 2KJBA 2ESNA 3MCZA 1XDSA 2VE8A 1G3SA 4IXAA 4CXFA 1REPC 1IN7A 4EJTA 4IPAA 5FD5A 4GCVA 2D1HA 4G7HF 4EVIA 4ZYHA 1YW7A 3HOSA 5K5OA 1QQIA 3HSFA 3ELKA 4BHPA 4L9VA 2DI3A 2IW5A 5LRSA 3FM5A 2Q2EA 2EFQA 4ZZLA 1YYVA 4F7ZA 2QUFA 4UV8A 4JBAA 5TRDA 3T8TA 3TGNA 1PUEE 5ICCA 3BROA 2V1XA 5AONA 3ECOA 3P9CA 3TKYA 1ZGAA 2FQ3A 2CG4A 4PCQA 3CDHA 4LG0B 1FC3A 4R8HA 3GXOA 4G8XA 3QPHA 1S7AA 3FXRA 4WCGA 1ZHFA 4Y13A 4Z2YA 4KIBA 4HQEA 1FZPB 4WXDA 2COMA 1O7FA 2YX4A 4I02A 3KP2A 4MHGA 3P9KA 3WTWC 1A04A 2JTVA 2UZKA 5AIPA 2A68F 3K2ZA 5BQTA 2VC1A 3R0JA 3L2CA 4A6DA 4ETSA 3ABUA 3H3UA 5IT3A 2DBBA 2PG4A 4ESBA 3IKVA 5BS6A 5IT9Z 3SQNA 3CUQB 3CLOA 1ZRFA 2FA5A 1ZG1A 4KNYA 1F9NA 5DUKA 1VTNC 1WQ2A 3EETA 4DNCA 1DDNA 2ELHA 1XB4A 3LAPA 2FBKA 5FLXZ 3FXQA 4ENNA 3ECHA 2FEZA 5D8LB 3CUQC 4MQVA 2STWA 2HEOA 2QENA 1IRFA 5AIQA 5H6QA 2ZMEA 3I5UA 1R1VA 4BQAA 1U3EM 3LSTA 2QM3A 4B09A 5LGUA 4BNCA 4U0VA 4RGUA 4S04A 4IRHA 4YIIA 2CYYA 3HSRA 2VN2A 2A61A 2Z5UA 1FSHA 4HX7A 3T1BA 3K1PA 2NNNA 1U78A 1PP7U 2PMHA 2GA1A 5HLHA 1HXDA 2HTJA 2JPBA 3MAJA 1D8JA 1QPMA 3D5LA 4CYDA 5BOXA 2ZXJA 1BI0A 3GYHX 3DKWA 3R60A 3MWMA 2VODA 5L3CA 2EB7A 2M87A 4BHBA 4U88A 2GAUA 2OQGA 3C3WA 3GO5A 3ZMVA 3REOA 4GXOA 1FWZA 4HV5A 3C18A 3MEXA 1FPQA 2H09A 1KU7A 3FZVA 3L00A 3EYYA 1GVJA 5E1ZB 1O57A 4LLGF 2ZFWA 2DTRA 4ZYEA 1ZYRF 1QZZA 3J80K 3OV8A 2LSOA 2IPQX 4HQMA 1USTA
chains in the Genus database with same CATH superfamily
2GWRA 5M3FJ 5JLXA 3HOUJ 1OCPA 3HOYJ 4BEHA 3I4MJ 2R7SA 2VC0A 4YG2F 1VQ8I 4OMYA 2XGCA 3S32A 3SYTA 3W6KB 2F5CA 2K85A 3J7AY 1TQPA 2M9HA 2PN6A 2XRNA 4Y15A 5HLGA 1J59A 1P92A 5DTDA 3L2QA 1D0YA 2O7OA 1VQ7I 3HJEA 2IAIA 4ABZA 4BDZA 1BOAA 1W5SA 2KRFA 1BW5A 1E3PA 1X1DA 1O3SA 4CZCA 1OJLA 2R5ZB 2TCTA 4YFKF 2OCCH 1LEBA 1LVKA 2GIVA 4LLNA 5EEGA 3S16J 3GTJJ 3IL2A 1WRJA 4D5FA 4L0ZB 1AA7A 4AYBA 1NG6A 1P6RA 1POGA 3BG5A 3GVAA 3IAS2 4II3A 4KYWA 1YW8A 3KE2A 3HTUA 2VXDA 2KPMA 4NHJA 3CESA 4JX4A 3HKZA 1F5TA 5DYMA 5K7HA 2KQRA 4YFXF 4A3LJ 5LGTA 2M0MA 3OYMA 3IRRA 1YX5A 3I56I 5A2QK 4HBLA 2JSPA 1ZGWA 4HLYA 2IA0A 2KL4A 5M5YJ 3MKLA 3RZOJ 4OAYA 2L7ZA 1R1TA 2XAGA 4EV0A 1JHHA 1OFCX 1BIAA 4JP0A 2GIZA 4O5VA 5K5RA 2VKEA 1IV6A 3QP6A 3SJMA 1TTYA 4U7DA 4E7LA 1IUFA 1EKEA 3FBIB 1IAWA 6PAXA 2XF5A 4P5OA 1AOYA 2XDVA 1O3TA 1HW2A 1QRYA 2O0YA 5B66C 3ASNH 2CV0A 5F04A 3FXOA 3O8GA 4BYYA 1S29A 2DXIA 5LHHA 4IRGA 5GTIC 5GAHJ 1QZYA 2DU9A 5J8FA 3QU6A 3T5XA 4BU2A 1U0JA 4DBRA 4I76A 5ICEA 5E8GA 4KMFA 1P2FA 3CC2I 5LLQA 3ABLH 1WI3A 4XORA 2QGUA 5LEJA 2Y75A 3OOUA 4XKBA 1JGSA 4AWXB 3EQLF 3HUGA 3U21A 5E1WA 3HTSB 5J40A 2YU3A 4MO7A 1IN8A 2PMZN 3WTVC 5E17F 4XRFA 3EUHA 4IRIA 3DEWA 1OQYA 3DFGA 2XF6A 2XIGA 3C7JA 4M6VA 1AKHB 5CVRA 1MKMA 4FE4A 4M9ZA 5H20A 4N4NB 4HX8A 3D1NI 2PJRB 4BBSJ 1LVAA 1W5CC 2F4OB 2HTSA 3A0BC 5JVTA 1QVTA 1ERDA 4C3JJ 1HW5A 2LBFB 3DBHB 4I01A 5M3MJ 2OQRA 1MZBA 4M9XA 1W0UA 2AS5F 3M4OJ 3DP7A 3KIOA 4EMSA 4A93J 4V2GA 4B47A 2HQRA 1X2MA 3RYPA 4PFPA 2R7XA 5GAGJ 4DIQA 1FEXA 3CMEI 2ME0A 3RPUD 3GUDA 2QLZA 2HVQA 2QYOA 4C2TA 3VDXA 4Y52J 3ULQB 4BJ5C 2RQQA 1YO5C 4F92B 1KYWA 4FQGA 2WADA 4F91B 3RZDJ 2DFEA 3HIFA 1ON2A 4MFDA 2BY1A 1TBXA 1GXPA 4XLAA 1Y1VJ 3CJNA 1JUSA 3H92A 3H9QA 4KFCA 2E7XA 3B6AA 4IVNA 3BR3A 3OIPA 2GLOA 3HBLA 2F5EA 2QQ9A 3KP5A 1VQLI 2GXAA 2CQXA 2ZXHA 2BVMA 2KRCA 3E6DA 3OYFA 1BM9A 4BDYA 1YRNB 1T0FC 1MJBA 3G1LA 3DPTA 1OCRH 1OCZH 2M8EA 2IGKA 3DBRB 5CLSA 4Z6YA 3OYIA 3QRFF 1G6NA 3RIRA 1SVOA 4BL0B 3KLOA 1LNWA 3VFZA 3K6GA 2XAHA 2ZXIA 5ICGA 3FMQA 2Q8KA 3JTHA 3I54A 3K4LA 2Y0SA 1U5TB 4LLLA 3CCJI 3TW7A 3OY9A 3LQRA 4L5JA 2K86A 1XCBA 2Z99A 3DF8A 3U1KA 1DU6A 4NDLA 2HDDA 3DKYA 1MD0A 4M74A 5LHIA 1V4RA 3K4CA 1LFBA 1IZ1A 3LA3A 3JAMZ 2VQHA 2IGNA 3IH2A 2R7VA 3HRSA 1IC8A 3Q9VA 2ZBKA 2PJPA 4DZJA 4G7ZF 3A02A 4XR6A 2VT3A 3D0SA 2E34A 1IJWC 3GFLA 3GFIA 3ZMTA 5L3DA 1BR2A 1OPCA 4BQNA 4FCYA 4LOCA 2FSWA 1Z6TA 3L7WA 3ROUA 4V19K 3PNVA 3RYRA 4ZYAA 2EWNA 3CCEI 3GTKJ 4IHVA 2RREA 2M1BA 2FMLA 3L2RA 3U1DA 1MMDA 5HS8A 1IXRC 3OYLA 1H8AC 1SMYF 5EEAA 2QF7A 2QKLB 2AXLA 5DM7F 3CMYA 1Z9CA 2QBYA 2XSDC 3CC4I 3E5XA 4M72A 2E1NA 2EFOA 3K1NA 3ZCOA 4BACA 1YFHA 5HLTA 1N25A 5C3EJ 1XGSA 3F6VA 5FJ8J 3H9GA 2KIUA 5ILUA 2KIMA 3ZQ7A 2TDXA 3HC7A 2MH2A 2X9DA 4PSWA 2PBIA 5D5UB 3IHUA 3M7GA 4IHXA 5IT9K 3LSKA 4XLFA 2E71A 4E7SA 4A5NA 3LA7A 5EZHA 2W25A 2HZDA 3B73A 3LSMA 4EJVA 4KISA 5IP7J 2EFNA 5FGMA 2KISA 3WTSC 1J09A 1O7LA 1ORKA 4WK8F 2W00A 4P55A 1IF1A 2EZLA 2ZC2A 4M9SA 1P4XA 1KQ8A 2DLLA 1LPQA 1Y6IA 4B3AA 3JTGA 2MH9A 5DV5A 5K5QA 1DGWY 2NVTJ 3R61A 1BIBA 4S0HB 1SFKA 3J81Z 2V9KA 3AL0C 3DXJF 5F0CA 3KETA 3MQ0A 4OAZA 4UVCA 3PUFA 1UZCA 3VWBA 2O8XA 2FE3A 1WJDA 4B4CA 3LWFA 4XNFA 4LD5A 2Y48A 3OS2A 2ZO4A 4PZJA 2VBZA 3E5UA 2HNHA 1RPWA 3I71A 2HZTA 3BTCA 4KICA 2EIMH 2VBWA 3CJTB 1FBSA 2D45A 3IUOA 2IA2A 1SANA 2H1LA 5J4YA 2A5YB 2CMPA 1YW9A 1DU0A 3QU3A 1I3AA 1A31A 3WTZA 1WVRA 2LTPA 4CICA 3V7RA 1MBJA 3I58A 2DO7A 1X1CA 4N9HA 1YJ9I 1OR7A 3S1RJ 5FFZA 5EGOB 5EDNA 1LFPA 4JK1X 4M6YA 5KHDA 2Z9OA 4IZZA 2Z16A 2A6TA 5BPIA 1USSA 2DFIA 2WAQN 1B59A 2P0WA 2EQRA 3AG2H 4IEJA 3S2DJ 2CJJA 1MIJA 1G3TA 5DUIA 2HYGD 3PSFA 2ISZA 1IXSB 2Y31A 3PNTA 3V7CA 3A01A 4ENJA 2LR8A 4EM2A 3F9KA 2CH0A 2W4SA 2IBDA 1IRZA 3T8RA 3GZ5A 2MLKA 2V1NA 5J8CA 2EFWA 3S93A 3Q0VA 4B44A 2B9SA 5CQGA 3J7AO 2Y0MA 3I59B 3CF5F 2GXBA 5L3EA 1SD7A 4C3HJ 3CCQI 3WU1B 2O3FA 2GZWA 1UAAA 2IS1A 2RC4A 5FFXA 3MMYB 3K10A 3QYFA 3J7ZI 1TWGJ 1HSJA 4UVBA 2EBIA 1Y56A 3M8EA 3OMYA 4WXHA 3SZGA 4Q4ZF 3DCFA 2PFBA 2H1KA 2K9NA 4RMNA 2R93J 2P7CB 3CQZJ 1LQ1A 3ERED 4N9IA 2BOLA 3ZMZA 4N0BA 1YJWI 2GA2A 4G6DA 2OA4A 1QHHD 2RDPA 3RKQA 5HLIA 2R7UA 4I6ZA 3H5AA 4DBQA 2LLKA 2IP2A 3HZJA 4IX7A 2UXXA 2FNAA 2Z2SB 2EJRA 5B1BH 2XAUA 1N78A 3UKGA 2LOOA 3V8KA 1Z7UA 3I64A 3IH3A 1HKTA 1UG2A 5E1XA 3BP8A 1BJZA 4ENKA 1TW3A 3JR9A 2ZJRF 4RGSA 3RPUA 2E7WA 1OR7C 4U0YA 2BVLA 1VF9A 5EJCA 3GFJA 3ZQQA 4XOTA 4I0AA 5LD2C 3GTLJ 3KPHA 1F43A 4BY7J 4H0EA 3WE3A 4GGGA 5ILSA 3TP3A 4Q5SF 1BR4A 2LREA 4A3IJ 3ZMDA 3E6BA 1HCRA 2F6CA 1W7PD 1ZGJA 4XOPA 1DQUA 4K2EA 3WODF 3BJ6A 2DK8A 3F72A 1ZN2A 1CGPA 2LF7A 1EH6A 4XLPF 3S3NA 3K70D 1E0EA 3J80Z 4J01A 3PFYA 4Y17A 4ON0A 2K4JA 2YR2A 2JVGA 2M4GA 1QPIA 2H27A 1S6LA 1R36A 3OL3A 2XGDA 3RTRA 3RKYA 3KZYA 4XK4A 4AU7A 1VQ6I 4HF0A 4RBOA 2LKXA 2GQQA 2LH9A 4OOIA 4RAGA 3FKJA 2H8WA 5TGTA 5ILVA 2M34A 1V5EA 2ISYA 1D5VA 3SZTA 1KZHA 4A0XA 4ZDPA 5FLVA 4KA4A 3M9AA 2FRHA 1K7AA 4Q48A 2HOAA 1U6GA 3H9JA 5F6FA 5L3GA 1G8XA 1WPKA 3FXLA 5D5WB 1G59A 5E8IA 2VOOA 5CVJA 1Y8RB 2LC2A 3ZMUA 5D6EA 1ZRDA 4ZH4F 2B7EA 5DCMB 1SMTA 1X4OA 2NOGA 4XRSA 3AG4H 2HFHA 5HVQC 3RJPA 1ETKA 1KQ0A 1Z05A 3BTJA 2BV6A 1MW7A 5CPRB 1O3RA 2KIFA 1XSDA 4AUXA 2PQ8A 4M6XA 5DCFA 3SDBA 5CVVA 2Q1ZB 3MN2A 3PQKA 2TRTA 2F2EA 1ZG5A 1FNNA 2M30A 4NUBA 3SFZA 4ESJA 1B6AA 2RKHA 2V26A 3FXMA 2K3PA 1JXSA 3GTPJ 4RB3C 4P9UA 4UV9A 3GZ6A 2NOJB 2VL8A 2P8TA 1HC8A 4FETA 4PJLA 3S14J 3IH4A 5CJ9A 3SXYA 1OCOH 2G9WA 2P6SA 3K4BA 1CF7B 3JREA 1UHSA 2ZNYA 1JUMA 2Y69H 1RR7A 4BUPA 2D1VA 3K1MA 3GWZA 3T0YA 2GOMA 2DA5A 3G73A 4AIJA 1RI7A 3H36A 3JRCA 2VQGA 3S1NJ 2VXZA 1VQMI 4ENMA 1P9QC 2W1OA 2VIXA 1VFCA 3OS0A 2HQAA 3K4KA 1J75A 3S17J 4WF2A 1LJ9A 1J7KA 4BXUA 2VQLA 3KYCB 2OZUA 5DM6F 4EJUA 4CHUA 1RNLA 4MEYF 4I0BA 1J2XA 2R7DA 2ZCWA 2IJLA 3H0GJ 3S3OA 3TEDA 2MYSA 2YPRA 1ZH5A 2QSHX 2HS5A 2UWMA 2IS6A 1SFEA 1DPRA 1R5HA 3ZR8X 2ECBA 1TWHJ 1LEAA 2JK3A 1XCVA 2DA6A 2DMNA 2M5WA 2L02A 3CCLI 4A3FJ 1S8NA 3P7NA 2V6CA 5ICFA 4RM2A 1HLVA 3PUBA 1ITYA 2L0KA 4BHCA 2EILH 4AIDA 1R58A 2I10A 3VODA 2WAFA 3K4MA 3BPXA 4I99C 4PJMA 1MSFC 4H4KC 5JFRA 1D0XA 3OYGA 1FP1D 3E97A 5L3FA 3DBLB 2ESHA 4CCOA 1ZR2A 3IWFA 1CF7A 4KDPA 3QP5A 2COBA 1SFUA 3I4NJ 3LNQA 3BQZA 3QPLA 2L01A 2JA2A 3HOVJ 3K69A 3VOEA 4A3CJ 4RAFA 1HA8A 1G2HA 5L3BA 4B48A 2KLOA 3JSPA 1MJ9A 4XBFA 2LP0A 5BMZA 3GLLA 3HGYA 2JQ7A 3AKZA 4M3BA 2K5CA 3FHNA 3GCMA 2HXIA 2NS8A 4RAZA 3V8LA 2DPUA 2KJCA 1U9NA 2W24A 5FO5A 4P9FA 2QWWA 1FLIA 5DCMA 2PI0A 1Z7LA 1EF4A 3GBGA 1Z6RA 3E1SA 2FBHA 3JRAA 1BN5A 3BQYA 4KT6A 4DYQA 2R3SA 3JRGA 2EA4A 4HYEA 3HOTA 3ZGKA 3BWGA 2DMTA 3CLQA 1QA6A 4E7HA 1WHUA 4FT8A 1N75A 3M1CA 2PJRA 3BG3A 4D7MA 3CF2A 1LDJA 1LDKB 1HOMA 4CZZA 3KYDB 2X1DA 3KCCA 1XSVA 3AFHA 2OBPA 3WGIA 1ETYA 5C4XJ 2O6GE 2P81A 1Q1VA 2HVSA 2UXNA 4EM0B 5DDGA 1U9OA 4J00A 4MTDA 4XM3A 2A6EF 3Q0UA 1YHQI 2Y9ZA 2DDAA 3ABTA 1A6IA 3HUGB 4GFBA 2L54A 4FASD 2HQ5A 1ACIA 2IRFG 4UNOA 2MSYA 2XASA 1GLNA 5KNLA 1B4AA 2X4HA 2VT2A 2ZJ2A 3U9GA 3KP4A 2R7WA 1K78B 4XRSG 2HU9A 2XF7A 3UNGC 4AC0A 1DUXC 2F48A 1QGPA 1MBEA 1TNTA 4LMYA 1Z0XA 4PUSA 1SD6A 1W1WE 1K79A 1GV5A 1AWCA 4Y4RA 1D8KA 4X1EA 3DLLF 1MNEA 1U5TC 1YI2I 1FX7A 1JKOC 4MIMA 2K4BA 4ZDOA 4FHTA 3KLNA 5J1UA 2VPRA 3TP0A 2KDZA 1T33A 1HDPA 2XB5A 4OINF 2IS4A 4B43A 3CCVI 3S1MJ 1WFXA 3AG1H 1W36D 1K4TA 5H6RA 2K9QA 3FMRA 4MNUA 1ZELA 3IC7A 5EEHA 2BGCA 5LEKA 1DPUA 5FD6A 1FOYA 5FKMA 1JKRC 4XLEA 2O03A 1JKPC 4M3FA 1TT5B 1BL0A 2IS2A 1S72I 1O4XA 4KN7X 1FYLA 3F8CA 4XIDA 1NK3P 4MEXF 2HVRA 4OIOF 1ZLJA 2M4KA 1L0OC 5CQEA 4HSTA 1LKXA 3TDZC 1X3WB 4A3MJ 5F1RA 1J0RA 4DJAA 1HKSA 2QVOA 3Q9SA 3O3KA 1IUYA 4EGYA 3F6OA 3PJRA 3ZMSA 3LFUA 3PFIA 4J19A 4DYRA 2EIJH 1GVDA 1SC7A 1LDDA 1H0MA 4F3QA 1R1UA 3GZNB 3PIPF 1D5YA 5DS9A 2MC3A 2AQEA 4E4HA 1T6SA 2JA7J 2QEXI 4CO8A 1AU7A 2JSCA 2X6WA 2BE5F 2QKMB 1I6HJ 3WTTC 4A0YA 3DEUA 5FKLA 4BBRJ 4EATA 2VPLA 2B0LA 3BCAA 3O6BB 1ZR4A 1WKMA 2WB1A 2O5RA 3RKXA 4CH7A 4HLXA 3OR1C 4B3XA 1I1GA 4F55A 4OIRF 2V4JC 2BBYA 2WY7Q 3TL4X 1UMQA 2P5LC 3I59A 1P4WA 2BEOA 3VYSB 5D8KB 4ZTFA 1OCCH 4FX0A 1KU3A 1WCMJ 4E7KA 3DEEA 2BYVE 2XVCA 3LFKA 4ESFA 4L5IA 2R7QA 3OSFA 3V4GA 5F64A 2JUCA 1E17A 4XSZF 4XONA 2D2WA 3TOBA 4L0YB 1WJFA 2DQRA 2RVCA 2GM4A 1I5ZA 2DMQA 2QSGX 5E79C 2BHYA 1HBXG 3OYBA 4KJZA 5DD8A 2Z3YA 3TOAA 2HQNA 2P6TA 1W4MA 3RPQA 5J4VA 1RETA 3BDDA 4EM1A 2MGQA 4FTHA 1RUOA 3ZQGA 2BHZA 1FYMA 4Y3OA 3BG7A 4ASNA 3GTQJ 1J9IA 1H88C 2EIKH 2L5QA 2VE9A 2XV4S 2M0CA 4LIUA 1XGOA 5F0HA 2R5YA 2KP6A 4IOCF 2HWVA 3KZIC 1YS6A 2BW3B 3X2QH 3G71I 5IY5H 4A6EA 3GF2A 4HPQA 4UXNA 1MBHA 4O3MA 3BR0A 3HPGA 3G3ZA 3MD2A 3PL8A 1JTXA 2JRTA 2FXAA 3A2KA 2NRAC 3IKTA 2K7LA 2MD0A 4BE1A 1SD4A 2JN6A 1STZA 4IF4A 2ADUA 1A6QA 1Z3YA 3OS1A 3BG6A 4R1HA 2LKSA 2G7HA 1D0ZA 4X0GA 4EQQA 3F8MA 1AHDP 5GADJ 1K6YA 1I3QJ 3PNYA 2BXZA 3WHBA 1UG0A 2EA2A 4G6QA 2ID6A 4UB6C 2VOPA 4YEJA 3SZPA 2DJIA 3GX4X 2HI3A 3A1YA 2JJ7A 2RGVA 3FXUA 4I7HA 3OYAA 2HR3A 5K1YA 3AG3H 4OU0A 3QPTA 3E7LA 1BI1A 5CVUA 1UFMA 2OCEA 2C6YA 3WE2A 3M8FA 3OIQA 4WX9A 4CUGA 2JT1A 1P7JA 4HX4A 1OYYA 1SAUA 4MQ9F 2EZIA 3BZKA 1JGGA 3EYIA 5JR3A 5D6FA 5HODA 4BJTA 4LJZF 1S7OA 2BY2A 4DYCA 3ML6A 1EV7A 2ZKZA 1FBQA 3KFWX 3K0LA 1T56A 2X1CA 1T39A 4KITB 4RLQA 3TO9A 3FXJA 1JKQC 4GDFA 2H94A 2BW3A 4RDUA 1JJ6C 2H6BA 3DPUA 2W57A 3DTKA 2PLYA 1JI8A 1FOWA 5HDGA 4LB6B 2WY8Q 2P5KA 3I55I 2MBFA 3SDGA 2X0LA 1F36A 5FRNA 3PQJA 2LKPA 4HV6A 4JX6A 3L2WA 1WH7A 3OYHA 1MNMC 1TC3C 1FTZA 1HDDC 2FF4A 2MLGA 2XSJC 2VBXA 3Q5FA 1T38A 5M5WJ 3ONQA 1ZLKA 2XHKA 1Z67A 1E2XA 3DKXA 2ME6A 5J1YA 2WV1A 1XN7A 3QYBA 1SVLA 5D4RA 1KONA 5EZGA 3FM3A 1XTAA 1GHCA 3N4MA 2R7FA 3HM5A 1Z21A 3QOPA 1U5TA 2OJED 4IQJA 1MH3A 4GYGA 4RS8A 1XS9A 3V8JA 2E1MC 1GV2A 2I8DA 1VI0A 2Z1DA 1NK2P 4IJAA 4BS9A 3RKWA 3R0AA 4BAYA 4C9YA 4MLOA 3DU6A 1YRNA 1VQKI 2OV7A 2Q0OA 4IQ4A 2V1UA 4HAMA 5HNHA 2ELJA 5BPDA 4EJWA 1R6RA 2JZYA 1IO2A 2KRHA 4GO1A 4PJJA 3JRBA 1XMAA 3VB2A 4C2UA 1TP4A 3KEYA 2DA3A 4PGHA 4QWQA 2BXYA 1IV8A 4HEA2 2NNYA 4GYIA 1GXQA 1MJAA 5LBQA 5TJJA 1F4KA 3IAM2 1UB9A 3SHFA 1H9TA 1RZ4A 3MKWB 3L2UA 2N8GA 5DD4A 3E3VA 3JRFA 1BC8C 4CA0A 3W6VA 1MGTA 3M1EA 1MH4A 1PP8F 2CFXA 3HSEA 4HF2A 2LY1A 4HG2A 2XC7A 2CWEA 2IT0A 2MFZA 3WHCA 1KU2A 3QWLA 2W7NA 2ZJQF 4G94A 3FK7A 4LG0A 3FIWA 4NB5A 5JI6A 1VQ9I 4LK1F 3N05A 4PDKA 5E3LA 1KYZA 1YOVB 4YIFA 5GAEJ 3CO7C 2M3AA 2XKOA 1XMXA 1BJAA 4A3GJ 3G2BA 3HGGA 1YTYA 5HS7A 2YX7A 3H35A 1AKHA 4LB5A 1BR1A 4KMUX 3L2VA 1G3WA 3BR6A 2VKDA 1KU9A 3B02A 3GW2A 4NC7A 2NS0A 5KVRA 3F8NA 3VSLA 5EGOA 2HYFA 2XPUA 3KEQA 3VYTB 4U7BA 4HNUA 3CDIA 1IN5A 1IGNA 2E1OA 3ZN0A 3ZN1A 1JHFA 3BJAA 1K78A 4E70A 1OMIA 4BQOA 2DA2A 2WTEA 3ZQHA 1LFUP 2LDUA 2QCOA 3LSPA 5KCMA 1LB2A 3W6JB 3HOWJ 2X85A 2JA6J 1UCRA 2BZTA 4XICA 3LSRA 1IXCA 2PMZA 2R4GA 3HRMA 2HYJA 4Y33A 2FJ1A 2XUBA 3ZRGA 3OYJA 2A6HF 4LK0F 4A3JJ 4PK4A 5M5XJ 3I3LA 1YG2A 2E5ZA 3ZPLA 4KT5C 2FU4A 4M73A 5LFAA 1BI2A 5K7FA 3HRTA 2E2IJ 3BTIA 5F27A 2MG4A 3BPVA 4MGRA 2FUG2 2R7OA 2RQPA 3W2WA 1DGRM 1BC7C 5HDKA 5JHFA 4BGDA 1Z1DA 4CGZA 1I1SA 4XL9A 3Q3SA 5D4SA 2CGPA 1D3YA 2NYXA 5IP9J 3RDIA 1YIJI 2DDBA 4BXFA 2EH3A 1TQMA 1VNDA 1TNSA 4HNVA 1HKQA 3HHHA 3VPRA 3DPLC 3E5QA 3UR3C 2P4WA 2QQBA 2QZ8A 4I2OA 1MMSA 2X6OA 4JQFA 3G6EI 3CTAA 3FX3A 1D1AA 4IHYA 5C44J 1R5ID 2ID3A 4EGZA 3JAMK 5BNGA 2DPDA 3ZQFA 3A03A 4O6JA 3LSHA 4PGGA 2PEXA 2A05A 3TO7A 1FY7A 3CUOA 4UUTA 1FTTA 2K9MA 2F5FA 2JA5J 2NS7A 2DA7A 3CP8A 2QSFX 4UUVA 1ZG3A 1SFXA 2MABA 2Y9YA 4Q47A 5ERIA 2E36A 3OYNA 1WJCA 4W97A 3BLYA 3KX2A 3C2BA 1N77A 2R7ZJ 4ZYDA 1NG7A 4XQFA 3PO2J 2G7UA 1Z77A 1ODDA 1FT9A 4AYBN 3COAC 4L9TA 1TWAJ 3FF5A 1ZARA 1IDZA 3KEOA 1NHAA 2OZ6A 3DTEA 2R0QC 3CCYA 1S3JA 1TLHB 3AAFA 2KKOA 4MFEA 1G4DA 2XAJA 2IA1A 3NRVA 1TW2A 4E6KG 2W85A 3W2AA 2IXSA 3HG9A 2YUSA 1RR8C 1V5FA 1XSXA 5CVIA 4DOZA 2DFHA 1Z91A 4LITA 4ZZDA 5GPCA 3IRQA 1OYWA 4UY8I 2M45A 3S2WA 3JW4A 5KAIC 3WTUC 2CW0F 1V55H 3LA2A 5H2FC 4I98B 2NVYJ 2LMDA 2KHMA 2CS3A 3BZCA 3OOPA 2E5NA 4DZPA 4ZJZA 4LG3A 4KIGA 4D1QA 3ESWB 1X1BA 1X58A 5J1RA 4A2UA 2EK5A 2IEKA 2OD5A 2LK2A 2PX9A 3I53A 5E18F 5LGNA 4LIVA 4YIRX 1FIPA 2L7FP 2NVXJ 3KP7A 1BW6A 2LNBA 4CCNA 2PMUA 2HOEA 4UB8C 2OUMA 1YITI 1FJLA 4QSHA 1T08B 4XSXF 1RUNA 4JX5A 2VBYA 3HOZJ 2GBYA 5D5VB 3DV8A 3P9IA 1EH8A 2CO5A 3OYDA 3QAHA 2X51A 2DFFA 2OTJI 3V42A 4L18B 3LQQA 1V3FA 2DTZA 2Y2ZA 1SFOJ 1WJ5A 1X3ZB 1W5TA 3CCRI 2NVUB 1K6OA 2XB0X 5J6XA 3WGGA 1MDMA 3M3YJ 2DJNA 3C2HA 3CCSI 1XG1A 2EV6A 3O8HA 1QBJA 4ZDLA 5J47A 2KZGA 3BC8A 3I9V2 3BZ6A 1WJAA 2RV8A 1EA3A 3KYLA 1WZ2A 1NH3A 3E0JB 2V1DA 2Y30A 4XKVA 4NC6A 1MBGA 2J5OA 1XDUA 2M2EA 3M8JA 2L7KA 1R49A 4A0ZA 4M3EA 4QTRA 2VKHA 3SEQA 1C0WA 1RKWA 4C3IJ 2CQNA 1IRGA 1KQ9A 2LBFA 3JRDA 1W7PB 3CJRB 4I09A 4CDGA 2F4IA 2P7VB 1RC9A 2RAEA 4C30A 2X1EA 2W82A 1U8BA 2CV2A 2MD5A 4IHSA 4B1RA 2VUMJ 2RN7A 2A07F 2JA8J 2ICWG 4E7IA 3DQVC 5A2QZ 4A3EJ 3BG9A 2V9VA 4L5EA 3ERMA 1OYIA 2L9NA 1B8IB 4XN3A 1OCTC 5FB2A 1BA5A 2QQAA 2RNGA 4WXCA 1R22A 3WGHA 2GXGA 3F23A 3K4NA 3OIOA 2W84A 1EH7A 2ZMEB 3F0CA 3KP3A 3WTYC 3D5SC 4BE2A 4OWRB 3L09A 4AM3A 3F8FA 3D5RC 1GDTA 2H8RA 4W1UA 4RB1A 2DW4A 2EV0A 1YIOA 1BOBA 3BT9A 2W48A 2XAFA 5FKNA 2AO9A 5J3LA 1S9HA 2CW7A 1WH5A 3JRHA 4G9YA 1E3OC 5HOOA 4BE0A 5IYBJ 1FSEA 4ZTJA 1JUPA 1ZKGA 3NWSA 5IYDJ 4XLHA 1TT0A 2UUZA 1FP2A 2OU2A 1MNDA 3GFMA 1W36C 4EJOA 1XX5A 2VJ5A 4II2A 4AVPA 1SD5A 3F21A 2DT5A 4IHTA 3NQOA 2YU9J 1IN4A 3HKZN 4JYKA 1YX3A 3CUQA 5EG0B 2XROA 3ZQCA 3Q0WA 1QU3A 1R7JA 3B6CA 1X2NA 4HDUA 3IV5A 3TBIA 3RI4A 4KIFA 2H6CA 2F5DA 4BQQA 2O9LA 5FKOA 2LY9A 3E6CC 2O61A 2NAZA 1PJRA 5LRRA 1FIAA 2FOWA 1Q1HA 2DAOA 2CSOA 4D7NA 4IO9F 5IYCJ 4NC8A 1JT0A 3I0TA 4CCMA 4RAYA 3F22A 1QO0D 1I39A 1WSUA 5HDNA 2CUZA 2LVSA 2HOSA 2K9LA 3G1MA 3LSJA 2M8GX 5F1JA 2O8KA 3R6SA 4CCKA 2VI6A 4LGWA 4BY1J 3MVPA 3HRUA 3GLXA 5FLXK 3FWEA 3LL7A 4AD9A 1H89C 3BR5A 3U2RA 1T95A 3LSGA 2ZSIB 2WC2A 3DU5A 5D5XB 1WJEA 4P1WA 2B63J 2OPTA 1WJBA 2L9RA 1BI3A 2L3DA 2ECCA 3MZYA 5HS9A 2CQQA 3FXKA 3JRIA 5LHGA 5EF6A 2M7BA 2DMUA 3QYEA 3HL2A 2E2JJ 3TW6A 3WTXC 2ZJPF 2X6XA 3V7SA 3ISPA 3QOEA 2JUGA 4MTEA 2FD5A 1ZREA 4RB2C 1ZQ3P 2OAZA 3A01B 1XGMA 1VQ5I 1J5YA 1Y0NA 3CCMI 1MMNA 3DWLE 1U8RA 2ZXWH 4YRVA 3SEZA 1UHWA 3CCUI 4V2FA 2VONA 1XC5A 3BCBA 1HQCA 4AIHA 2VB6A 2E35A 4ITVA 5B5EC 5FROA 1R00A 4HZFA 4L9NA 3IWZA 3HDDA 3J81K 1JT6A 4HA8A 2HGCA 4F93B 2E1MB 4EEFG 2P5VA 4UUSA 1I50J 1OLTA 3FBNB 1OKRA 2BY3A 1IN6A 2LD5A 3KP6A 3HYIA 1R9TJ 3F8BA 4UHTA 4OIQF 3PM1A 1I6XA 3BY6A 5B3SH 4A12A 4NQWA 2D5VA 2CU7A 2ETHA 2DA4A 2AXTC 2NVQJ 3WU0A 1B9NA 2XKPA 3EDPA 5FLMJ 4S05A 1I27A 1R5GA 2E2HJ 4RM3A 3CO6C 3S15J 2J5PA 1G3YA 4WWCA 2CUEA 4HF1A 1UHMA 2X6YA 3O2PE 1XPXA 3CMMA 3CZ6A 2ZSHB 1ZAOA 2E60A 4OIPF 3ZP5A 2LF8A 4XLNF 1YE9A 3GEZA 1FOKA 4BXXJ 2IVMA 3LMMA 1L3LA 1B1BA 2HKXA 3FMSA 1W7PA 5JHUA 1MBKA 4P96A 1U2WA 3LOCA 3ZOBA 3G1OA 2FOKA 2X48A 4NBQA 4HDVA 1P4AA 3E6MA 2A69F 1SEUA 1XD7A 2KDOA 5EYRA 4KN4X 3GTGJ 2CW8A 2DYRH 1FOXA 2FBIA 1ETVA 1DP7P 3EUHC 2DOAA 4FX4A 4E7ZA 2GOXB 3WU2C 2MC4A 2K40A 1QZEA 1T0FA 2DMPA 4QLCU 2EV5A 4RLFA 5FRMA 1X1PA 5F0FA 2K27A 3L9FA 1RIOH 2VQCA 3C1DA 1B9MA 2IGMA 1VQ4I 1ZRCA 1O3QA 2QBYB 1QNTA 4DQ2A 2VJIA 1Y0UA 1E3HA 2WAQA 2R7RA 2WAEA 1R23A 2E1CA 1TWCJ 1MDMB 4B8XA 5JVGF 2JWTA 2CQKA 4RGXA 4XKCA 1Y39A 1MSEC 4RA2A 1FMWA 3F3XA 2Z33A 4R79A 5KK1A 2YSRA 1XGNA 1PYVA 1ULYA 3PIOF 3BR1A 3M07A 4BH9A 4D0PA 1A35A 1V54H 2STTA 4E7JA 4PJNA 3J7YJ 1FYKA 2XAQA 3NEUA 4D9JA 5IOZA 4KUMA 3H1CA 2EFPA 3CJQB 2MA3A 3PO3J 1T8IA 3H0DA 5TISC 3CMAI 1UELB 1YQAA 4ZYGA 4TV7A 4AIKA 3KZZA 9ANTA 2XGXA 5E3NA 2CUJA 2VJ4A 1SVMA 3I4PA 3CC7I 3MFKA 1JTYA 1EJ9A 2CFOA 1ENHA 1H9GA 2L4AA 1X4PA 3TDUC 2VJJA 2L9VA 3QQAA 4HSRA 4LFUA 3K9TA 3MZHA 1Y1WJ 3RSNA 2L4MA 1JE8A 2HDCA 2FQ4A 3TO6A 4RGRA 1R4MB 2WA0A 1Z3XA 4XLCA 2CV1A 2XPVA 1IG7A 1HSTA 2KIQA 1ETQA 1PDNC 2DA1A 5C4JJ 4AVZA 1MMGA 3S3MA 3N97A 2HOTA 3FHZA 3ABMH 3DLAA 2ZNZA 1VQPI 1F1ZA 1ONVA 2CRGA 2CUFA 1FBUA 1WI9A 3HEFA 4HOBA 5E20A 4HNTA 2V6EA 3GTOJ 2FX0A 3AL0B 3S1QJ 1BBYA 2DQLA 1ZTRA 3MZ8A 3BJOA 2DT6A 2DCEA 5ED4A 1YS7A 3HHGA 2K9SA 2RNJA 2KMUA 1D1CA 3JSOA 4G7OF 4Y7NJ 4GRIA 2EPFA 4OMZA 3H3ZA 2HKOA 3VYRB 3VSKA 4YFNF 1M1EB 1S5LC 3RQ4A 2A3SA 4HW0A 1HW1A 1X1AA 3H5RA 2ZB9A 2DK5A 2WBMA 2HXOA 3HPHA 2K02A 1KGSA 1V5GA 3S8PA 2JVHA 3LAJA 4N4OB 2FNPA 1YLFA 2R7TA 4IKFA 3ASOH 3R4KA 5CYVA 3EPZA 3WG9A 2YS9A 1MMAA 2WWYA 1T98A 4M71A 2Q2EB 2OC6A 4L9JA 1SAXA 3BR2A 1UJ8A 1IW7F 1QVUA 1X3UA 4JOMA 1XMKA 3A0HC 3MKZA 4A5MA 4U0WA 1TQIA 4RB0A 2FMYA 1PUFA 2DYSH 2JPCA 2V79A 4UVAA 2G0EA 3HB9A 3TMOA 5GTHC 4IOAF 3BOQA 2L9SA 4XN0A 3ABKH 5DEQA 1R71A 2OTLI 3TQNA 1KA8A 1WWXA 4NQWB 2ACJA 1T2KA 1ON1A 2Y0SN 3CDLA 3VEPA 2WV0A 2KJBA 3NAUA 2ESNA 5GP9A 3MCZA 2KFDA 4XRMA 3OR2C 2MW8A 1XDSA 1A5JA 2VE8A 1G3SA 4IXAA 4CXFA 2CQ7A 4PFOA 1REPC 1IN7A 3NWTA 4EJTA 3RCOA 4IPAA 5FD5A 4CCLA 4GCVA 2D1HA 4M3DA 4G7HF 5E3MA 3S2HJ 4EVIA 4ZYHA 1YW7A 3HOSA 5K5OA 1QQIA 3HSFA 2R92J 1PUFB 3ELKA 3H3VK 4BHPA 5IPAA 4L9VA 5F08A 3GMEA 2F4MB 2DI3A 2BY0A 4IHWA 2A5WA 2IW5A 3FKIJ 5LRSA 3FM5A 2Q2EA 1RESA 2EFQA 2V9PA 4ZZLA 1YYVA 2QUFA 4UV8A 4F7ZA 4JBAA 5TRDA 2K3FA 3T8TA 3TGNA 1PUEE 4IL6C 3IP4B 4C2MJ 5ICCA 3BROA 2V1XA 5AONA 5IOYA 3ECOA 3P9CA 3QODA 1ZGAA 2FQ3A 3SFIA 3TKYA 1A36A 3RQIA 2DT7B 2CG4A 4PCQA 2LY2A 3CDHA 1GT0C 2AHQA 2KT0A 4LG0B 4BKXA 4FISA 1FC3A 4R8HA 2DODA 1MBFA 4QPOA 3GXOA 3FDYA 2ELKA 3H5NA 2UV1A 4G8XA 3QPHA 1S7AA 2E19A 3MKYB 3CP2A 4CSWA 3FXRA 3A4CA 4WCGA 1ZHFA 3G4SI 4ANJA 4Y13A 4Z2YA 4KIBA 2R5ZA 4ZC3A 3K70C 4HQEA 1FZPB 4WXDA 4U87A 2COMA 1O7FA 2YX4A 4I02A 3KP2A 4MHGA 3P9KA 3WTWC 3VYUB 1A04A 1OISA 3P5JA 2JTVA 3OL4A 2VLAA 2UZKA 3NARA 4QPQA 4BJ6C 2KZVA 5AIPA 2A68F 3GTMJ 3K2ZA 2EINH 1X19A 2VASA 1RRJA 5BQTA 4BEHB 2VC1A 3R0JA 4FE7A 3L2CA 4A6DA 4ETSA 3ABUA 1APLC 3H3UA 2VKVA 5IT3A 1K83J 2DBBA 2PG4A 4ESBA 3IKVA 1ZK8A 5BS6A 5IT9Z 4XMYA 4PSXA 1W0TA 1K61A 4D5CA 4DW6A 1ETWA 3SQNA 3PSIA 3CUQB 2M7AA 5EG0A 4DGWB 1PVEA 3CLOA 1NTCA 1ZRFA 2FA5A 2NXNB 3OSGA 1ZG1A 3OWTA 5K7ZA 1YJNI 1ETOA 4KNYA 4A3DJ 1F9NA 5DUKA 1LE8B 1VTNC 1ETXA 1VZ0A 1WQ2A 3EETA 1P7IA 4DNCA 1DDNA 2LG4A 3K7AJ 3K4JA 2ELHA 5JLWA 1XB4A 3JCUC 3LAPA 2FBKA 3K2AA 3DTIA 1B72B 5FLXZ 3FXQA 4ENNA 3BTLA 3ECHA 2FEZA 5D8LB 3CUQC 4MQVA 2STWA 2HEOA 4CYCA 3OYEA 2QENA 5FKKA 1IRFA 4M3GA 5AIQA 5E3OA 5H6QA 2DN0A 2ZMEA 3I5UA 4QIWN 1R4NB 3HXLA 2XRLA 1R1VA 3HOXJ 3ZXSA 4BQAA 1JJ8C 1U3EM 1B8IA 1TZLA 4HRIA 3LSTA 3QPSA 1IDYA 2QM3A 2L7MP 2F5VA 4B09A 5LGUA 2XGEA 4BNCA 3CD6I 4U0VA 4RGUA 4S04A 2QQ8A 4IRHA 1HF0A 1DP3A 2QA4I 2LFBA 4NNJA 4YIIA 3ZQIA 2CYYA 3HSRA 2VN2A 1D1BA 3FISA 4F52A 2A61A 2Z5UA 1FSHA 4HX7A 3W3CA 3T1BA 2DOEA 3K1PA 2NNNA 2LRDA 1S7EA 5IP6A 1U78A 2HPMA 1QHGA 1PP7U 2HPIA 2PMHA 2LYCA 2GA1A 1RKTA 2JMWA 2ZMEC 5HLHA 1HXDA 2HTJA 2L2OA 3OYKA 4PJ0C 4A3KJ 2JPBA 3MAJA 1D8JA 2WB1N 1QPMA 1TWFJ 3D5LA 1IRXA 1TL8A 5HNFA 4CYDA 5BOXA 2ZXJA 1BI0A 5B1AH 1K4SA 2DOFA 3GYHX 1LUJB 1Y8QB 3DKWA 3R60A 5GPAA 2V7FA 3EUKL 3L1PA 4A69C 3MWMA 2EZHA 1VQNI 4A3BJ 2XPWA 2VODA 5L3CA 2EB7A 2M87A 4BHBA 4U88A 2GAUA 4CYCB 2JRMA 2OQGA 3C3WA 5CKTA 3GO5A 3ZMVA 3REOA 4GXOA 1FWZA 3LSIA 1B72A 4HV5A 5KAFC 4UUSB 3EUAA 2R5YB 1GUUA 4X6AJ 3W2VA 4YELA 3C18A 3MEXA 3ZQLA 1LE8A 1FPQA 2EZKA 3FK6A 2H09A 3L00A 3FZVA 1KU7A 3EYYA 1GVJA 5E1ZB 2I5UA 2OF7A 4CCJA 1CQTA 3WG7H 1O57A 2AQFA 2ZFUA 4LLGF 1FMVA 2ZFWA 2DTRA 4ZYEA 1ZYRF 4G12A 4G6TB 1QZZA 2IGOA 3J80K 2HDWA 3OV8A 1WGXA 4XKWA 3OYCA 2LSOA 2IPQX 4HQMA 1USTA 1VQOI 3C2GA
chains in the Genus database with same CATH topology
2GWRA 2VC0A 4YG2F 4OMYA 3W6KB 2F5CA 1TQPA 2PN6A 2XRNA 4Y15A 5HLGA 1J59A 1P92A 1BOAA 1W5SA 2KRFA 1O3SA 4YFKF 1LEBA 2GIVA 4LLNA 5EEGA 3IL2A 1WRJA 4L0ZB 1P6RA 3GVAA 4KYWA 1YW8A 3KE2A 3HTUA 4NHJA 1F5TA 5DYMA 4YFXF 5LGTA 3IRRA 5A2QK 4HBLA 4HLYA 2IA0A 1R1TA 2XAGA 4EV0A 1JHHA 1BIAA 4O5VA 5K5RA 3QP6A 1TTYA 4U7DA 1IAWA 6PAXA 1AOYA 4P5OA 1O3TA 1HW2A 2O0YA 4BYYA 1S29A 5LHHA 4IRGA 1QZYA 2DU9A 5J8FA 3QU6A 3T5XA 5ICEA 5E8GA 4KMFA 1P2FA 5LLQA 5LEJA 2Y75A 1JGSA 4AWXB 3EQLF 3HUGA 5E1WA 3HTSB 2YU3A 1IN8A 3WTVC 5E17F 4XRFA 3EUHA 4IRIA 3DFGA 2XIGA 3C7JA 5CVRA 1MKMA 4M9ZA 5H20A 4HX8A 1LVAA 2HTSA 5JVTA 1HW5A 4I01A 2OQRA 1MZBA 4M9XA 2AS5F 3DP7A 4EMSA 2HQRA 3RYPA 3GUDA 2QLZA 2QYOA 3ULQB 1YO5C 1KYWA 3HIFA 1ON2A 1TBXA 1GXPA 3CJNA 3H92A 4KFCA 2E7XA 4IVNA 2F5EA 2QQ9A 3KP5A 3E6DA 1BM9A 1MJBA 3DPTA 2M8EA 5CLSA 3QRFF 1G6NA 3RIRA 3KLOA 1LNWA 3VFZA 2XAHA 5ICGA 3FMQA 2Q8KA 3JTHA 3I54A 1U5TB 4LLLA 3LQRA 4L5JA 2K86A 1XCBA 2Z99A 3DF8A 1MD0A 4M74A 5LHIA 1V4RA 1IZ1A 3LA3A 3JAMZ 3HRSA 3Q9VA 2ZBKA 2PJPA 4G7ZF 2VT3A 3D0SA 3GFLA 3GFIA 3ZMTA 5L3DA 1OPCA 2FSWA 1Z6TA 3L7WA 3ROUA 3RYRA 2EWNA 2M1BA 2FMLA 3U1DA 5HS8A 1IXRC 1SMYF 2AXLA 1Z9CA 2QBYA 3E5XA 4M72A 2E1NA 2EFOA 3K1NA 1YFHA 1XGSA 3F6VA 5ILUA 2KIUA 2KIMA 3ZQ7A 2TDXA 2MH2A 2PBIA 5D5UB 3IHUA 3M7GA 5IT9K 4A5NA 3LA7A 2W25A 3B73A 4EJVA 2EFNA 5FGMA 3WTSC 1O7LA 4WK8F 4P55A 1IF1A 4M9SA 1P4XA 1KQ8A 2DLLA 3JTGA 2MH9A 5DV5A 5K5QA 3R61A 1BIBA 3J81Z 3DXJF 3KETA 3MQ0A 4UVCA 2O8XA 2FE3A 3LWFA 4LD5A 2Y48A 2ZO4A 4PZJA 2VBZA 3E5UA 3I71A 2HZTA 4KICA 2VBWA 1FBSA 2D45A 2IA2A 2A5YB 1YW9A 3QU3A 3WTZA 4CICA 3V7RA 3I58A 2DO7A 4N9HA 1OR7A 5FFZA 4JK1X 4M6YA 2Z9OA 5BPIA 1USSA 2DFIA 1B59A 5DUIA 1G3TA 2HYGD 2ISZA 1IXSB 3V7CA 4ENJA 4EM2A 3T8RA 3GZ5A 2MLKA 2EFWA 5J8CA 3J7AO 2Y0MA 3I59B 2GXBA 5L3EA 1SD7A 3WU1B 2O3FA 2GZWA 2RC4A 5FFXA 1HSJA 4UVBA 3M8EA 4WXHA 4Q4ZF 2PFBA 2P7CB 1LQ1A 3ERED 4N9IA 3ZMZA 4N0BA 2GA2A 4G6DA 2OA4A 2RDPA 5HLIA 2IP2A 2UXXA 2FNAA 2EJRA 3V8KA 1Z7UA 3I64A 1HKTA 5E1XA 3BP8A 4ENKA 1TW3A 4RGSA 3RPUA 2E7WA 4U0YA 3GFJA 4I0AA 4H0EA 3WE3A 4GGGA 5ILSA 4Q5SF 3ZMDA 3E6BA 1W7PD 1ZGJA 4K2EA 3WODF 3BJ6A 2DK8A 3F72A 1ZN2A 1CGPA 2LF7A 1EH6A 4XLPF 3J80Z 4Y17A 4ON0A 2K4JA 2YR2A 2H27A 1S6LA 1R36A 3RTRA 3RKYA 3KZYA 4HF0A 2GQQA 4OOIA 5ILVA 2ISYA 1D5VA 3SZTA 4A0XA 4KA4A 3M9AA 2FRHA 1K7AA 4Q48A 1U6GA 5F6FA 5L3GA 5D5WB 5E8IA 2VOOA 5CVJA 3ZMUA 5D6EA 1ZRDA 4ZH4F 5DCMB 1SMTA 2HFHA 5HVQC 3RJPA 1KQ0A 1Z05A 2BV6A 1O3RA 2KIFA 1XSDA 2PQ8A 4M6XA 5DCFA 5CVVA 3PQKA 1ZG5A 2F2EA 1FNNA 2M30A 3SFZA 4ESJA 1B6AA 2RKHA 1JXSA 4RB3C 4P9UA 4UV9A 3GZ6A 2P8TA 5CJ9A 3SXYA 2G9WA 2P6SA 1CF7B 2ZNYA 2D1VA 3K1MA 3GWZA 3T0YA 3G73A 4AIJA 1RI7A 2VXZA 4ENMA 1J75A 4WF2A 1LJ9A 1J7KA 4BXUA 2OZUA 4EJUA 4CHUA 1RNLA 4MEYF 4I0BA 1J2XA 2R7DA 2ZCWA 2IJLA 2YPRA 1ZH5A 2HS5A 2UWMA 1SFEA 1DPRA 1R5HA 1LEAA 1XCVA 2M5WA 2L02A 1S8NA 3P7NA 2V6CA 5ICFA 4BHCA 1R58A 3VODA 3BPXA 5JFRA 1FP1D 3E97A 5L3FA 2ESHA 3IWFA 1CF7A 4KDPA 3QP5A 1SFUA 2L01A 3K69A 3VOEA 5L3BA 3JSPA 1MJ9A 4XBFA 5BMZA 4RAZA 3V8LA 2DPUA 2KJCA 2W24A 5FO5A 4P9FA 2QWWA 1FLIA 5DCMA 2PI0A 1Z6RA 2FBHA 1BN5A 2R3SA 2EA4A 4HYEA 3HOTA 3BWGA 4FT8A 1LDJA 1LDKB 4CZZA 3KCCA 1XSVA 2OBPA 3WGIA 2O6GE 2UXNA 4EM0B 5DDGA 4MTDA 2A6EF 3ABTA 2L54A 2IRFG 4UNOA 2XASA 1B4AA 2X4HA 2VT2A 2ZJ2A 3U9GA 3KP4A 1K78B 1DUXC 1QGPA 1TNTA 4LMYA 1SD6A 1AWCA 1K79A 1D8KA 1U5TC 1FX7A 2K4BA 4FHTA 3KLNA 4OINF 5H6RA 3FMRA 4MNUA 3IC7A 5EEHA 2BGCA 5LEKA 1DPUA 5FD6A 2O03A 4KN7X 1FYLA 3F8CA 4MEXF 4OIOF 1ZLJA 1L0OC 3TDZC 5F1RA 1J0RA 1HKSA 2QVOA 3Q9SA 3O3KA 1IUYA 4EGYA 3F6OA 3ZMSA 3PFIA 1LDDA 1H0MA 1R1UA 2MC3A 1T6SA 4CO8A 2JSCA 2BE5F 3WTTC 4A0YA 3DEUA 2B0LA 3O6BB 1WKMA 3RKXA 4HLXA 1I1GA 4OIRF 2BBYA 2P5LC 3I59A 1P4WA 2BEOA 5D8KB 4FX0A 1KU3A 2BYVE 2XVCA 3LFKA 4ESFA 4L5IA 3V4GA 5F64A 1E17A 4XSZF 2D2WA 3TOBA 4L0YB 2DQRA 2RVCA 1I5ZA 1HBXG 5DD8A 2Z3YA 3TOAA 2HQNA 2P6TA 1W4MA 3RPQA 3BDDA 4EM1A 1RUOA 1FYMA 4ASNA 1J9IA 2VE9A 2XV4S 1XGOA 2HWVA 1YS6A 4A6EA 3GF2A 4UXNA 4O3MA 3G3ZA 2JRTA 2FXAA 2NRAC 3IKTA 2K7LA 1SD4A 1STZA 4IF4A 2ADUA 4R1HA 2G7HA 4EQQA 3F8MA 2EA2A 4G6QA 2VOPA 3SZPA 3GX4X 3FXUA 2RGVA 4I7HA 2HR3A 5K1YA 4OU0A 3QPTA 1BI1A 5CVUA 1UFMA 2C6YA 3WE2A 3M8FA 4WX9A 2JT1A 4HX4A 1OYYA 4MQ9F 3EYIA 5JR3A 5D6FA 4LJZF 1S7OA 3ML6A 1EV7A 2ZKZA 1FBQA 3KFWX 3K0LA 1T39A 3TO9A 2H94A 2H6BA 2W57A 2PLYA 5HDGA 4LB6B 2P5KA 2MBFA 2X0LA 3PQJA 2LKPA 4HV6A 2FF4A 3Q5FA 2MLGA 2VBXA 1T38A 1ZLKA 2XHKA 1E2XA 1XN7A 5D4RA 3FM3A 1GHCA 3N4MA 2R7FA 3QOPA 1U5TA 4RS8A 4GYGA 3V8JA 4IJAA 3RKWA 3R0AA 4BAYA 2Q0OA 2V1UA 4HAMA 5BPDA 4EJWA 4GO1A 2JZYA 1XMAA 3VB2A 4QWQA 4PGHA 2NNYA 4GYIA 1GXQA 1MJAA 5LBQA 5TJJA 1F4KA 1UB9A 3SHFA 1H9TA 1RZ4A 1BC8C 5DD4A 3E3VA 1MGTA 3M1EA 1PP8F 4HF2A 2CFXA 3HSEA 2CWEA 2IT0A 1KU2A 4G94A 4LG0A 4NB5A 5JI6A 4LK1F 4PDKA 1KYZA 4YIFA 3CO7C 2XKOA 1BJAA 1YTYA 5HS7A 2YX7A 4LB5A 4KMUX 1G3WA 1KU9A 3B02A 3GW2A 2NS0A 5KVRA 3F8NA 2HYFA 3KEQA 4U7BA 1IN5A 3ZN0A 3ZN1A 1JHFA 3BJAA 1K78A 4E70A 1OMIA 2WTEA 2LDUA 1LB2A 3W6JB 1UCRA 1IXCA 3HRMA 2XUBA 2A6HF 4LK0F 1YG2A 3ZPLA 4KT5C 2FU4A 4M73A 1BI2A 3HRTA 3BPVA 4MGRA 2RQPA 1BC7C 5HDKA 1Z1DA 4CGZA 1I1SA 5D4SA 2CGPA 1D3YA 2NYXA 3RDIA 1TQMA 1TNSA 1HKQA 3HHHA 3DPLC 3E5QA 2P4WA 2QQBA 2QZ8A 4I2OA 4JQFA 3CTAA 3FX3A 4EGZA 3JAMK 2DPDA 4O6JA 4PGGA 2PEXA 3TO7A 1FY7A 3CUOA 2F5FA 4UUVA 1ZG3A 1SFXA 4Q47A 5ERIA 4ZYDA 2G7UA 1ODDA 1FT9A 3COAC 4L9TA 3FF5A 1ZARA 3KEOA 1NHAA 2OZ6A 1S3JA 1TLHB 3AAFA 2KKOA 1G4DA 2XAJA 2IA1A 3NRVA 1TW2A 2W85A 1XSXA 5CVIA 3IRQA 1Z91A 4ZZDA 1OYWA 2M45A 3S2WA 3JW4A 3WTUC 2CW0F 3LA2A 4I98B 3OOPA 4KIGA 4A2UA 2EK5A 2OD5A 3I53A 5E18F 5LGNA 3KP7A 2LNBA 2PMUA 2HOEA 4XSXF 1RUNA 2VBYA 5D5VB 3DV8A 3P9IA 1EH8A 2CO5A 3QAHA 4L18B 3LQQA 1V3FA 1W5TA 1K6OA 5J6XA 3WGGA 1MDMA 2EV6A 1QBJA 3BZ6A 2RV8A 2V1DA 2J5OA 1XDUA 4A0ZA 1C0WA 1IRGA 1KQ9A 1W7PB 4I09A 4CDGA 2P7VB 2MD5A 4IHSA 2RN7A 2A07F 3DQVC 5A2QZ 2V9VA 1OYIA 5FB2A 2QQAA 4WXCA 1R22A 3WGHA 2GXGA 3F23A 2W84A 1EH7A 2ZMEB 3KP3A 3WTYC 3L09A 3F8FA 4RB1A 2DW4A 2EV0A 1YIOA 2XAFA 4G9YA 5HOOA 1FSEA 1FP2A 2OU2A 3GFMA 4EJOA 4AVPA 1SD5A 3F21A 2DT5A 4IHTA 3NQOA 1IN4A 3CUQA 2XROA 1R7JA 4HDUA 3RI4A 4KIFA 2H6CA 2F5DA 3E6CC 2O61A 2NAZA 5LRRA 1Q1HA 2DAOA 2CSOA 3I0TA 4RAYA 3F22A 1QO0D 1WSUA 5HDNA 3R6SA 4LGWA 3HRUA 3GLXA 5FLXK 3FWEA 4AD9A 3U2RA 2WC2A 5D5XB 1BI3A 2L3DA 3MZYA 5HS9A 5LHGA 3WTXC 3V7SA 3ISPA 4MTEA 1ZREA 4RB2C 2OAZA 1XGMA 1J5YA 1U8RA 1UHWA 2VONA 1HQCA 4AIHA 1R00A 4HZFA 4L9NA 3IWZA 3J81K 4HA8A 2HGCA 2P5VA 1OKRA 1IN6A 3KP6A 3HYIA 3F8BA 4UHTA 4OIQF 1I6XA 3BY6A 4A12A 4NQWA 2ETHA 3WU0A 1B9NA 2XKPA 3EDPA 4S05A 1I27A 1R5GA 3CO6C 2J5PA 1G3YA 4WWCA 4HF1A 1UHMA 3O2PE 1ZAOA 4OIPF 3ZP5A 2LF8A 4XLNF 3GEZA 1FOKA 2IVMA 1L3LA 1B1BA 2HKXA 3FMSA 1W7PA 5JHUA 4P96A 1U2WA 2FOKA 4HDVA 1P4AA 3E6MA 2A69F 1XD7A 4KN4X 2FBIA 1DP7P 4FX4A 1T0FA 4QLCU 2EV5A 2K27A 3L9FA 1RIOH 3C1DA 1B9MA 1ZRCA 1O3QA 2QBYB 1QNTA 4DQ2A 1Y0UA 1R23A 2E1CA 1MDMB 4B8XA 2CQKA 4RGXA 3F3XA 2Z33A 4R79A 5KK1A 2YSRA 1XGNA 1ULYA 4BH9A 4D0PA 2STTA 1FYKA 2XAQA 3NEUA 4KUMA 2EFPA 2MA3A 1YQAA 4ZYGA 4TV7A 4AIKA 3KZZA 2XGXA 3I4PA 3MFKA 1H9GA 2L4AA 3TDUC 4LFUA 3K9TA 3MZHA 1JE8A 2L4MA 2HDCA 3TO6A 4RGRA 1HSTA 1PDNC 3N97A 3FHZA 2ZNZA 1F1ZA 1ONVA 1FBUA 1WI9A 4HOBA 5E20A 1BBYA 2DQLA 3BJOA 5ED4A 1YS7A 3HHGA 2RNJA 3JSOA 4G7OF 4OMZA 3H3ZA 2HKOA 4YFNF 2A3SA 4HW0A 1HW1A 2DK5A 2K02A 1KGSA 3LAJA 2FNPA 1YLFA 3R4KA 5CYVA 3WG9A 2WWYA 1T98A 4M71A 4L9JA 1SAXA 1IW7F 1X3UA 1XMKA 4A5MA 4U0WA 1TQIA 4RB0A 2FMYA 2JPCA 2V79A 4UVAA 3BOQA 5DEQA 3TQNA 1KA8A 1WWXA 2ACJA 1T2KA 1ON1A 3VEPA 2WV0A 2KJBA 2ESNA 3MCZA 1XDSA 2VE8A 1G3SA 4IXAA 4CXFA 1REPC 1IN7A 4EJTA 4IPAA 5FD5A 4GCVA 2D1HA 4G7HF 4EVIA 4ZYHA 1YW7A 3HOSA 5K5OA 1QQIA 3HSFA 3ELKA 4BHPA 4L9VA 2DI3A 2IW5A 5LRSA 3FM5A 2Q2EA 2EFQA 4ZZLA 1YYVA 4F7ZA 2QUFA 4UV8A 4JBAA 5TRDA 3T8TA 3TGNA 1PUEE 5ICCA 3BROA 2V1XA 5AONA 3ECOA 3P9CA 3TKYA 1ZGAA 2FQ3A 2CG4A 4PCQA 3CDHA 4LG0B 1FC3A 4R8HA 3GXOA 4G8XA 3QPHA 1S7AA 3FXRA 4WCGA 1ZHFA 4Y13A 4Z2YA 4KIBA 4HQEA 1FZPB 4WXDA 2COMA 1O7FA 2YX4A 4I02A 3KP2A 4MHGA 3P9KA 3WTWC 1A04A 2JTVA 2UZKA 5AIPA 2A68F 3K2ZA 5BQTA 2VC1A 3R0JA 3L2CA 4A6DA 4ETSA 3ABUA 3H3UA 5IT3A 2DBBA 2PG4A 4ESBA 3IKVA 5BS6A 5IT9Z 3SQNA 3CUQB 3CLOA 1ZRFA 2FA5A 1ZG1A 4KNYA 1F9NA 5DUKA 1VTNC 1WQ2A 3EETA 4DNCA 1DDNA 2ELHA 1XB4A 3LAPA 2FBKA 5FLXZ 3FXQA 4ENNA 3ECHA 2FEZA 5D8LB 3CUQC 4MQVA 2STWA 2HEOA 2QENA 1IRFA 5AIQA 5H6QA 2ZMEA 3I5UA 1R1VA 4BQAA 1U3EM 3LSTA 2QM3A 4B09A 5LGUA 4BNCA 4U0VA 4RGUA 4S04A 4IRHA 4YIIA 2CYYA 3HSRA 2VN2A 2A61A 2Z5UA 1FSHA 4HX7A 3T1BA 3K1PA 2NNNA 1U78A 1PP7U 2PMHA 2GA1A 5HLHA 1HXDA 2HTJA 2JPBA 3MAJA 1D8JA 1QPMA 3D5LA 4CYDA 5BOXA 2ZXJA 1BI0A 3GYHX 3DKWA 3R60A 3MWMA 2VODA 5L3CA 2EB7A 2M87A 4BHBA 4U88A 2GAUA 2OQGA 3C3WA 3GO5A 3ZMVA 3REOA 4GXOA 1FWZA 4HV5A 3C18A 3MEXA 1FPQA 2H09A 1KU7A 3FZVA 3L00A 3EYYA 1GVJA 5E1ZB 1O57A 4LLGF 2ZFWA 2DTRA 4ZYEA 1ZYRF 1QZZA 3J80K 3OV8A 2LSOA 2IPQX 4HQMA 1USTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GWR A;  2VC0 A;  4YG2 F;  4OMY A;  3W6K B;  2F5C A;  1TQP A;  2PN6 A;  2XRN A;  4Y15 A;  5HLG A;  1J59 A;  1P92 A;  1BOA A;  1W5S A;  2KRF A;  1O3S A;  4YFK F;  1LEB A;  2GIV A;  4LLN A;  5EEG A;  3IL2 A;  1WRJ A;  4L0Z B;  1P6R A;  3GVA A;  4KYW A;  1YW8 A;  3KE2 A;  3HTU A;  4NHJ A;  1F5T A;  5DYM A;  4YFX F;  5LGT A;  3IRR A;  5A2Q K;  4HBL A;  4HLY A;  2IA0 A;  1R1T A;  2XAG A;  4EV0 A;  1JHH A;  1BIA A;  4O5V A;  5K5R A;  3QP6 A;  1TTY A;  4U7D A;  1IAW A;  6PAX A;  1AOY A;  4P5O A;  1O3T A;  1HW2 A;  2O0Y A;  4BYY A;  1S29 A;  5LHH A;  4IRG A;  1QZY A;  2DU9 A;  5J8F A;  3QU6 A;  3T5X A;  5ICE A;  5E8G A;  4KMF A;  1P2F A;  5LLQ A;  5LEJ A;  2Y75 A;  1JGS A;  4AWX B;  3EQL F;  3HUG A;  5E1W A;  3HTS B;  2YU3 A;  1IN8 A;  3WTV C;  5E17 F;  4XRF A;  3EUH A;  4IRI A;  3DFG A;  2XIG A;  3C7J A;  5CVR A;  1MKM A;  4M9Z A;  5H20 A;  4HX8 A;  1LVA A;  2HTS A;  5JVT A;  1HW5 A;  4I01 A;  2OQR A;  1MZB A;  4M9X A;  2AS5 F;  3DP7 A;  4EMS A;  2HQR A;  3RYP A;  3GUD A;  2QLZ A;  2QYO A;  3ULQ B;  1YO5 C;  1KYW A;  3HIF A;  1ON2 A;  1TBX A;  1GXP A;  3CJN A;  3H92 A;  4KFC A;  2E7X A;  4IVN A;  2F5E A;  2QQ9 A;  3KP5 A;  3E6D A;  1BM9 A;  1MJB A;  3DPT A;  2M8E A;  5CLS A;  3QRF F;  1G6N A;  3RIR A;  3KLO A;  1LNW A;  3VFZ A;  2XAH A;  5ICG A;  3FMQ A;  2Q8K A;  3JTH A;  3I54 A;  1U5T B;  4LLL A;  3LQR A;  4L5J A;  2K86 A;  1XCB A;  2Z99 A;  3DF8 A;  1MD0 A;  4M74 A;  5LHI A;  1V4R A;  1IZ1 A;  3LA3 A;  3JAM Z;  3HRS A;  3Q9V A;  2ZBK A;  2PJP A;  4G7Z F;  2VT3 A;  3D0S A;  3GFL A;  3GFI A;  3ZMT A;  5L3D A;  1OPC A;  2FSW A;  1Z6T A;  3L7W A;  3ROU A;  3RYR A;  2EWN A;  2M1B A;  2FML A;  3U1D A;  5HS8 A;  1IXR C;  1SMY F;  2AXL A;  1Z9C A;  2QBY A;  3E5X A;  4M72 A;  2E1N A;  2EFO A;  3K1N A;  1YFH A;  1XGS A;  3F6V A;  5ILU A;  2KIU A;  2KIM A;  3ZQ7 A;  2TDX A;  2MH2 A;  2PBI A;  5D5U B;  3IHU A;  3M7G A;  5IT9 K;  4A5N A;  3LA7 A;  2W25 A;  3B73 A;  4EJV A;  2EFN A;  5FGM A;  3WTS C;  1O7L A;  4WK8 F;  4P55 A;  1IF1 A;  4M9S A;  1P4X A;  1KQ8 A;  2DLL A;  3JTG A;  2MH9 A;  5DV5 A;  5K5Q A;  3R61 A;  1BIB A;  3J81 Z;  3DXJ F;  3KET A;  3MQ0 A;  4UVC A;  2O8X A;  2FE3 A;  3LWF A;  4LD5 A;  2Y48 A;  2ZO4 A;  4PZJ A;  2VBZ A;  3E5U A;  3I71 A;  2HZT A;  4KIC A;  2VBW A;  1FBS A;  2D45 A;  2IA2 A;  2A5Y B;  1YW9 A;  3QU3 A;  3WTZ A;  4CIC A;  3V7R A;  3I58 A;  2DO7 A;  4N9H A;  1OR7 A;  5FFZ A;  4JK1 X;  4M6Y A;  2Z9O A;  5BPI A;  1USS A;  2DFI A;  1B59 A;  5DUI A;  1G3T A;  2HYG D;  2ISZ A;  1IXS B;  3V7C A;  4ENJ A;  4EM2 A;  3T8R A;  3GZ5 A;  2MLK A;  2EFW A;  5J8C A;  3J7A O;  2Y0M A;  3I59 B;  2GXB A;  5L3E A;  1SD7 A;  3WU1 B;  2O3F A;  2GZW A;  2RC4 A;  5FFX A;  1HSJ A;  4UVB A;  3M8E A;  4WXH A;  4Q4Z F;  2PFB A;  2P7C B;  1LQ1 A;  3ERE D;  4N9I A;  3ZMZ A;  4N0B A;  2GA2 A;  4G6D A;  2OA4 A;  2RDP A;  5HLI A;  2IP2 A;  2UXX A;  2FNA A;  2EJR A;  3V8K A;  1Z7U A;  3I64 A;  1HKT A;  5E1X A;  3BP8 A;  4ENK A;  1TW3 A;  4RGS A;  3RPU A;  2E7W A;  4U0Y A;  3GFJ A;  4I0A A;  4H0E A;  3WE3 A;  4GGG A;  5ILS A;  4Q5S F;  3ZMD A;  3E6B A;  1W7P D;  1ZGJ A;  4K2E A;  3WOD F;  3BJ6 A;  2DK8 A;  3F72 A;  1ZN2 A;  1CGP A;  2LF7 A;  1EH6 A;  4XLP F;  3J80 Z;  4Y17 A;  4ON0 A;  2K4J A;  2YR2 A;  2H27 A;  1S6L A;  1R36 A;  3RTR A;  3RKY A;  3KZY A;  4HF0 A;  2GQQ A;  4OOI A;  5ILV A;  2ISY A;  1D5V A;  3SZT A;  4A0X A;  4KA4 A;  3M9A A;  2FRH A;  1K7A A;  4Q48 A;  1U6G A;  5F6F A;  5L3G A;  5D5W B;  5E8I A;  2VOO A;  5CVJ A;  3ZMU A;  5D6E A;  1ZRD A;  4ZH4 F;  5DCM B;  1SMT A;  2HFH A;  5HVQ C;  3RJP A;  1KQ0 A;  1Z05 A;  2BV6 A;  1O3R A;  2KIF A;  1XSD A;  2PQ8 A;  4M6X A;  5DCF A;  5CVV A;  3PQK A;  1ZG5 A;  2F2E A;  1FNN A;  2M30 A;  3SFZ A;  4ESJ A;  1B6A A;  2RKH A;  1JXS A;  4RB3 C;  4P9U A;  4UV9 A;  3GZ6 A;  2P8T A;  5CJ9 A;  3SXY A;  2G9W A;  2P6S A;  1CF7 B;  2ZNY A;  2D1V A;  3K1M A;  3GWZ A;  3T0Y A;  3G73 A;  4AIJ A;  1RI7 A;  2VXZ A;  4ENM A;  1J75 A;  4WF2 A;  1LJ9 A;  1J7K A;  4BXU A;  2OZU A;  4EJU A;  4CHU A;  1RNL A;  4MEY F;  4I0B A;  1J2X A;  2R7D A;  2ZCW A;  2IJL A;  2YPR A;  1ZH5 A;  2HS5 A;  2UWM A;  1SFE A;  1DPR A;  1R5H A;  1LEA A;  1XCV A;  2M5W A;  2L02 A;  1S8N A;  3P7N A;  2V6C A;  5ICF A;  4BHC A;  1R58 A;  3VOD A;  3BPX A;  5JFR A;  1FP1 D;  3E97 A;  5L3F A;  2ESH A;  3IWF A;  1CF7 A;  4KDP A;  3QP5 A;  1SFU A;  2L01 A;  3K69 A;  3VOE A;  5L3B A;  3JSP A;  1MJ9 A;  4XBF A;  5BMZ A;  4RAZ A;  3V8L A;  2DPU A;  2KJC A;  2W24 A;  5FO5 A;  4P9F A;  2QWW A;  1FLI A;  5DCM A;  2PI0 A;  1Z6R A;  2FBH A;  1BN5 A;  2R3S A;  2EA4 A;  4HYE A;  3HOT A;  3BWG A;  4FT8 A;  1LDJ A;  1LDK B;  4CZZ A;  3KCC A;  1XSV A;  2OBP A;  3WGI A;  2O6G E;  2UXN A;  4EM0 B;  5DDG A;  4MTD A;  2A6E F;  3ABT A;  2L54 A;  2IRF G;  4UNO A;  2XAS A;  1B4A A;  2X4H A;  2VT2 A;  2ZJ2 A;  3U9G A;  3KP4 A;  1K78 B;  1DUX C;  1QGP A;  1TNT A;  4LMY A;  1SD6 A;  1AWC A;  1K79 A;  1D8K A;  1U5T C;  1FX7 A;  2K4B A;  4FHT A;  3KLN A;  4OIN F;  5H6R A;  3FMR A;  4MNU A;  3IC7 A;  5EEH A;  2BGC A;  5LEK A;  1DPU A;  5FD6 A;  2O03 A;  4KN7 X;  1FYL A;  3F8C A;  4MEX F;  4OIO F;  1ZLJ A;  1L0O C;  3TDZ C;  5F1R A;  1J0R A;  1HKS A;  2QVO A;  3Q9S A;  3O3K A;  1IUY A;  4EGY A;  3F6O A;  3ZMS A;  3PFI A;  1LDD A;  1H0M A;  1R1U A;  2MC3 A;  1T6S A;  4CO8 A;  2JSC A;  2BE5 F;  3WTT C;  4A0Y A;  3DEU A;  2B0L A;  3O6B B;  1WKM A;  3RKX A;  4HLX A;  1I1G A;  4OIR F;  2BBY A;  2P5L C;  3I59 A;  1P4W A;  2BEO A;  5D8K B;  4FX0 A;  1KU3 A;  2BYV E;  2XVC A;  3LFK A;  4ESF A;  4L5I A;  3V4G A;  5F64 A;  1E17 A;  4XSZ F;  2D2W A;  3TOB A;  4L0Y B;  2DQR A;  2RVC A;  1I5Z A;  1HBX G;  5DD8 A;  2Z3Y A;  3TOA A;  2HQN A;  2P6T A;  1W4M A;  3RPQ A;  3BDD A;  4EM1 A;  1RUO A;  1FYM A;  4ASN A;  1J9I A;  2VE9 A;  2XV4 S;  1XGO A;  2HWV A;  1YS6 A;  4A6E A;  3GF2 A;  4UXN A;  4O3M A;  3G3Z A;  2JRT A;  2FXA A;  2NRA C;  3IKT A;  2K7L A;  1SD4 A;  1STZ A;  4IF4 A;  2ADU A;  4R1H A;  2G7H A;  4EQQ A;  3F8M A;  2EA2 A;  4G6Q A;  2VOP A;  3SZP A;  3GX4 X;  3FXU A;  2RGV A;  4I7H A;  2HR3 A;  5K1Y A;  4OU0 A;  3QPT A;  1BI1 A;  5CVU A;  1UFM A;  2C6Y A;  3WE2 A;  3M8F A;  4WX9 A;  2JT1 A;  4HX4 A;  1OYY A;  4MQ9 F;  3EYI A;  5JR3 A;  5D6F A;  4LJZ F;  1S7O A;  3ML6 A;  1EV7 A;  2ZKZ A;  1FBQ A;  3KFW X;  3K0L A;  1T39 A;  3TO9 A;  2H94 A;  2H6B A;  2W57 A;  2PLY A;  5HDG A;  4LB6 B;  2P5K A;  2MBF A;  2X0L A;  3PQJ A;  2LKP A;  4HV6 A;  2FF4 A;  3Q5F A;  2MLG A;  2VBX A;  1T38 A;  1ZLK A;  2XHK A;  1E2X A;  1XN7 A;  5D4R A;  3FM3 A;  1GHC A;  3N4M A;  2R7F A;  3QOP A;  1U5T A;  4RS8 A;  4GYG A;  3V8J A;  4IJA A;  3RKW A;  3R0A A;  4BAY A;  2Q0O A;  2V1U A;  4HAM A;  5BPD A;  4EJW A;  4GO1 A;  2JZY A;  1XMA A;  3VB2 A;  4QWQ A;  4PGH A;  2NNY A;  4GYI A;  1GXQ A;  1MJA A;  5LBQ A;  5TJJ A;  1F4K A;  1UB9 A;  3SHF A;  1H9T A;  1RZ4 A;  1BC8 C;  5DD4 A;  3E3V A;  1MGT A;  3M1E A;  1PP8 F;  4HF2 A;  2CFX A;  3HSE A;  2CWE A;  2IT0 A;  1KU2 A;  4G94 A;  4LG0 A;  4NB5 A;  5JI6 A;  4LK1 F;  4PDK A;  1KYZ A;  4YIF A;  3CO7 C;  2XKO A;  1BJA A;  1YTY A;  5HS7 A;  2YX7 A;  4LB5 A;  4KMU X;  1G3W A;  1KU9 A;  3B02 A;  3GW2 A;  2NS0 A;  5KVR A;  3F8N A;  2HYF A;  3KEQ A;  4U7B A;  1IN5 A;  3ZN0 A;  3ZN1 A;  1JHF A;  3BJA A;  1K78 A;  4E70 A;  1OMI A;  2WTE A;  2LDU A;  1LB2 A;  3W6J B;  1UCR A;  1IXC A;  3HRM A;  2XUB A;  2A6H F;  4LK0 F;  1YG2 A;  3ZPL A;  4KT5 C;  2FU4 A;  4M73 A;  1BI2 A;  3HRT A;  3BPV A;  4MGR A;  2RQP A;  1BC7 C;  5HDK A;  1Z1D A;  4CGZ A;  1I1S A;  5D4S A;  2CGP A;  1D3Y A;  2NYX A;  3RDI A;  1TQM A;  1TNS A;  1HKQ A;  3HHH A;  3DPL C;  3E5Q A;  2P4W A;  2QQB A;  2QZ8 A;  4I2O A;  4JQF A;  3CTA A;  3FX3 A;  4EGZ A;  3JAM K;  2DPD A;  4O6J A;  4PGG A;  2PEX A;  3TO7 A;  1FY7 A;  3CUO A;  2F5F A;  4UUV A;  1ZG3 A;  1SFX A;  4Q47 A;  5ERI A;  4ZYD A;  2G7U A;  1ODD A;  1FT9 A;  3COA C;  4L9T A;  3FF5 A;  1ZAR A;  3KEO A;  1NHA A;  2OZ6 A;  1S3J A;  1TLH B;  3AAF A;  2KKO A;  1G4D A;  2XAJ A;  2IA1 A;  3NRV A;  1TW2 A;  2W85 A;  1XSX A;  5CVI A;  3IRQ A;  1Z91 A;  4ZZD A;  1OYW A;  2M45 A;  3S2W A;  3JW4 A;  3WTU C;  2CW0 F;  3LA2 A;  4I98 B;  3OOP A;  4KIG A;  4A2U A;  2EK5 A;  2OD5 A;  3I53 A;  5E18 F;  5LGN A;  3KP7 A;  2LNB A;  2PMU A;  2HOE A;  4XSX F;  1RUN A;  2VBY A;  5D5V B;  3DV8 A;  3P9I A;  1EH8 A;  2CO5 A;  3QAH A;  4L18 B;  3LQQ A;  1V3F A;  1W5T A;  1K6O A;  5J6X A;  3WGG A;  1MDM A;  2EV6 A;  1QBJ A;  3BZ6 A;  2RV8 A;  2V1D A;  2J5O A;  1XDU A;  4A0Z A;  1C0W A;  1IRG A;  1KQ9 A;  1W7P B;  4I09 A;  4CDG A;  2P7V B;  2MD5 A;  4IHS A;  2RN7 A;  2A07 F;  3DQV C;  5A2Q Z;  2V9V A;  1OYI A;  5FB2 A;  2QQA A;  4WXC A;  1R22 A;  3WGH A;  2GXG A;  3F23 A;  2W84 A;  1EH7 A;  2ZME B;  3KP3 A;  3WTY C;  3L09 A;  3F8F A;  4RB1 A;  2DW4 A;  2EV0 A;  1YIO A;  2XAF A;  4G9Y A;  5HOO A;  1FSE A;  1FP2 A;  2OU2 A;  3GFM A;  4EJO A;  4AVP A;  1SD5 A;  3F21 A;  2DT5 A;  4IHT A;  3NQO A;  1IN4 A;  3CUQ A;  2XRO A;  1R7J A;  4HDU A;  3RI4 A;  4KIF A;  2H6C A;  2F5D A;  3E6C C;  2O61 A;  2NAZ A;  5LRR A;  1Q1H A;  2DAO A;  2CSO A;  3I0T A;  4RAY A;  3F22 A;  1QO0 D;  1WSU A;  5HDN A;  3R6S A;  4LGW A;  3HRU A;  3GLX A;  5FLX K;  3FWE A;  4AD9 A;  3U2R A;  2WC2 A;  5D5X B;  1BI3 A;  2L3D A;  3MZY A;  5HS9 A;  5LHG A;  3WTX C;  3V7S A;  3ISP A;  4MTE A;  1ZRE A;  4RB2 C;  2OAZ A;  1XGM A;  1J5Y A;  1U8R A;  1UHW A;  2VON A;  1HQC A;  4AIH A;  1R00 A;  4HZF A;  4L9N A;  3IWZ A;  3J81 K;  4HA8 A;  2HGC A;  2P5V A;  1OKR A;  1IN6 A;  3KP6 A;  3HYI A;  3F8B A;  4UHT A;  4OIQ F;  1I6X A;  3BY6 A;  4A12 A;  4NQW A;  2ETH A;  3WU0 A;  1B9N A;  2XKP A;  3EDP A;  4S05 A;  1I27 A;  1R5G A;  3CO6 C;  2J5P A;  1G3Y A;  4WWC A;  4HF1 A;  1UHM A;  3O2P E;  1ZAO A;  4OIP F;  3ZP5 A;  2LF8 A;  4XLN F;  3GEZ A;  1FOK A;  2IVM A;  1L3L A;  1B1B A;  2HKX A;  3FMS A;  1W7P A;  5JHU A;  4P96 A;  1U2W A;  2FOK A;  4HDV A;  1P4A A;  3E6M A;  2A69 F;  1XD7 A;  4KN4 X;  2FBI A;  1DP7 P;  4FX4 A;  1T0F A;  4QLC U;  2EV5 A;  2K27 A;  3L9F A;  1RIO H;  3C1D A;  1B9M A;  1ZRC A;  1O3Q A;  2QBY B;  1QNT A;  4DQ2 A;  1Y0U A;  1R23 A;  2E1C A;  1MDM B;  4B8X A;  2CQK A;  4RGX A;  3F3X A;  2Z33 A;  4R79 A;  5KK1 A;  2YSR A;  1XGN A;  1ULY A;  4BH9 A;  4D0P A;  2STT A;  1FYK A;  2XAQ A;  3NEU A;  4KUM A;  2EFP A;  2MA3 A;  1YQA A;  4ZYG A;  4TV7 A;  4AIK A;  3KZZ A;  2XGX A;  3I4P A;  3MFK A;  1H9G A;  2L4A A;  3TDU C;  4LFU A;  3K9T A;  3MZH A;  1JE8 A;  2L4M A;  2HDC A;  3TO6 A;  4RGR A;  1HST A;  1PDN C;  3N97 A;  3FHZ A;  2ZNZ A;  1F1Z A;  1ONV A;  1FBU A;  1WI9 A;  4HOB A;  5E20 A;  1BBY A;  2DQL A;  3BJO A;  5ED4 A;  1YS7 A;  3HHG A;  2RNJ A;  3JSO A;  4G7O F;  4OMZ A;  3H3Z A;  2HKO A;  4YFN F;  2A3S A;  4HW0 A;  1HW1 A;  2DK5 A;  2K02 A;  1KGS A;  3LAJ A;  2FNP A;  1YLF A;  3R4K A;  5CYV A;  3WG9 A;  2WWY A;  1T98 A;  4M71 A;  4L9J A;  1SAX A;  1IW7 F;  1X3U A;  1XMK A;  4A5M A;  4U0W A;  1TQI A;  4RB0 A;  2FMY A;  2JPC A;  2V79 A;  4UVA A;  3BOQ A;  5DEQ A;  3TQN A;  1KA8 A;  1WWX A;  2ACJ A;  1T2K A;  1ON1 A;  3VEP A;  2WV0 A;  2KJB A;  2ESN A;  3MCZ A;  1XDS A;  2VE8 A;  1G3S A;  4IXA A;  4CXF A;  1REP C;  1IN7 A;  4EJT A;  4IPA A;  5FD5 A;  4GCV A;  2D1H A;  4G7H F;  4EVI A;  4ZYH A;  1YW7 A;  3HOS A;  5K5O A;  1QQI A;  3HSF A;  3ELK A;  4BHP A;  4L9V A;  2DI3 A;  2IW5 A;  5LRS A;  3FM5 A;  2Q2E A;  2EFQ A;  4ZZL A;  1YYV A;  4F7Z A;  2QUF A;  4UV8 A;  4JBA A;  5TRD A;  3T8T A;  3TGN A;  1PUE E;  5ICC A;  3BRO A;  2V1X A;  5AON A;  3ECO A;  3P9C A;  3TKY A;  1ZGA A;  2FQ3 A;  2CG4 A;  4PCQ A;  3CDH A;  4LG0 B;  1FC3 A;  4R8H A;  3GXO A;  4G8X A;  3QPH A;  1S7A A;  3FXR A;  4WCG A;  1ZHF A;  4Y13 A;  4Z2Y A;  4KIB A;  4HQE A;  1FZP B;  4WXD A;  2COM A;  1O7F A;  2YX4 A;  4I02 A;  3KP2 A;  4MHG A;  3P9K A;  3WTW C;  1A04 A;  2JTV A;  2UZK A;  5AIP A;  2A68 F;  3K2Z A;  5BQT A;  2VC1 A;  3R0J A;  3L2C A;  4A6D A;  4ETS A;  3ABU A;  3H3U A;  5IT3 A;  2DBB A;  2PG4 A;  4ESB A;  3IKV A;  5BS6 A;  5IT9 Z;  3SQN A;  3CUQ B;  3CLO A;  1ZRF A;  2FA5 A;  1ZG1 A;  4KNY A;  1F9N A;  5DUK A;  1VTN C;  1WQ2 A;  3EET A;  4DNC A;  1DDN A;  2ELH A;  1XB4 A;  3LAP A;  2FBK A;  5FLX Z;  3FXQ A;  4ENN A;  3ECH A;  2FEZ A;  5D8L B;  3CUQ C;  4MQV A;  2STW A;  2HEO A;  2QEN A;  1IRF A;  5AIQ A;  5H6Q A;  2ZME A;  3I5U A;  1R1V A;  4BQA A;  1U3E M;  3LST A;  2QM3 A;  4B09 A;  5LGU A;  4BNC A;  4U0V A;  4RGU A;  4S04 A;  4IRH A;  4YII A;  2CYY A;  3HSR A;  2VN2 A;  2A61 A;  2Z5U A;  1FSH A;  4HX7 A;  3T1B A;  3K1P A;  2NNN A;  1U78 A;  1PP7 U;  2PMH A;  2GA1 A;  5HLH A;  1HXD A;  2HTJ A;  2JPB A;  3MAJ A;  1D8J A;  1QPM A;  3D5L A;  4CYD A;  5BOX A;  2ZXJ A;  1BI0 A;  3GYH X;  3DKW A;  3R60 A;  3MWM A;  2VOD A;  5L3C A;  2EB7 A;  2M87 A;  4BHB A;  4U88 A;  2GAU A;  2OQG A;  3C3W A;  3GO5 A;  3ZMV A;  3REO A;  4GXO A;  1FWZ A;  4HV5 A;  3C18 A;  3MEX A;  1FPQ A;  2H09 A;  1KU7 A;  3FZV A;  3L00 A;  3EYY A;  1GVJ A;  5E1Z B;  1O57 A;  4LLG F;  2ZFW A;  2DTR A;  4ZYE A;  1ZYR F;  1QZZ A;  3J80 K;  3OV8 A;  2LSO A;  2IPQ X;  4HQM A;  1UST A; 
#chains in the Genus database with same CATH topology
 2GWR A;  5M3F J;  5JLX A;  3HOU J;  1OCP A;  3HOY J;  4BEH A;  3I4M J;  2R7S A;  2VC0 A;  4YG2 F;  1VQ8 I;  4OMY A;  2XGC A;  3S32 A;  3SYT A;  3W6K B;  2F5C A;  2K85 A;  3J7A Y;  1TQP A;  2M9H A;  2PN6 A;  2XRN A;  4Y15 A;  5HLG A;  1J59 A;  1P92 A;  5DTD A;  3L2Q A;  1D0Y A;  2O7O A;  1VQ7 I;  3HJE A;  2IAI A;  4ABZ A;  4BDZ A;  1BOA A;  1W5S A;  2KRF A;  1BW5 A;  1E3P A;  1X1D A;  1O3S A;  4CZC A;  1OJL A;  2R5Z B;  2TCT A;  4YFK F;  2OCC H;  1LEB A;  1LVK A;  2GIV A;  4LLN A;  5EEG A;  3S16 J;  3GTJ J;  3IL2 A;  1WRJ A;  4D5F A;  4L0Z B;  1AA7 A;  4AYB A;  1NG6 A;  1P6R A;  1POG A;  3BG5 A;  3GVA A;  3IAS 2;  4II3 A;  4KYW A;  1YW8 A;  3KE2 A;  3HTU A;  2VXD A;  2KPM A;  4NHJ A;  3CES A;  4JX4 A;  3HKZ A;  1F5T A;  5DYM A;  5K7H A;  2KQR A;  4YFX F;  4A3L J;  5LGT A;  2M0M A;  3OYM A;  3IRR A;  1YX5 A;  3I56 I;  5A2Q K;  4HBL A;  2JSP A;  1ZGW A;  4HLY A;  2IA0 A;  2KL4 A;  5M5Y J;  3MKL A;  3RZO J;  4OAY A;  2L7Z A;  1R1T A;  2XAG A;  4EV0 A;  1JHH A;  1OFC X;  1BIA A;  4JP0 A;  2GIZ A;  4O5V A;  5K5R A;  2VKE A;  1IV6 A;  3QP6 A;  3SJM A;  1TTY A;  4U7D A;  4E7L A;  1IUF A;  1EKE A;  3FBI B;  1IAW A;  6PAX A;  2XF5 A;  4P5O A;  1AOY A;  2XDV A;  1O3T A;  1HW2 A;  1QRY A;  2O0Y A;  5B66 C;  3ASN H;  2CV0 A;  5F04 A;  3FXO A;  3O8G A;  4BYY A;  1S29 A;  2DXI A;  5LHH A;  4IRG A;  5GTI C;  5GAH J;  1QZY A;  2DU9 A;  5J8F A;  3QU6 A;  3T5X A;  4BU2 A;  1U0J A;  4DBR A;  4I76 A;  5ICE A;  5E8G A;  4KMF A;  1P2F A;  3CC2 I;  5LLQ A;  3ABL H;  1WI3 A;  4XOR A;  2QGU A;  5LEJ A;  2Y75 A;  3OOU A;  4XKB A;  1JGS A;  4AWX B;  3EQL F;  3HUG A;  3U21 A;  5E1W A;  3HTS B;  5J40 A;  2YU3 A;  4MO7 A;  1IN8 A;  2PMZ N;  3WTV C;  5E17 F;  4XRF A;  3EUH A;  4IRI A;  3DEW A;  1OQY A;  3DFG A;  2XF6 A;  2XIG A;  3C7J A;  4M6V A;  1AKH B;  5CVR A;  1MKM A;  4FE4 A;  4M9Z A;  5H20 A;  4N4N B;  4HX8 A;  3D1N I;  2PJR B;  4BBS J;  1LVA A;  1W5C C;  2F4O B;  2HTS A;  3A0B C;  5JVT A;  1QVT A;  1ERD A;  4C3J J;  1HW5 A;  2LBF B;  3DBH B;  4I01 A;  5M3M J;  2OQR A;  1MZB A;  4M9X A;  1W0U A;  2AS5 F;  3M4O J;  3DP7 A;  3KIO A;  4EMS A;  4A93 J;  4V2G A;  4B47 A;  2HQR A;  1X2M A;  3RYP A;  4PFP A;  2R7X A;  5GAG J;  4DIQ A;  1FEX A;  3CME I;  2ME0 A;  3RPU D;  3GUD A;  2QLZ A;  2HVQ A;  2QYO A;  4C2T A;  3VDX A;  4Y52 J;  3ULQ B;  4BJ5 C;  2RQQ A;  1YO5 C;  4F92 B;  1KYW A;  4FQG A;  2WAD A;  4F91 B;  3RZD J;  2DFE A;  3HIF A;  1ON2 A;  4MFD A;  2BY1 A;  1TBX A;  1GXP A;  4XLA A;  1Y1V J;  3CJN A;  1JUS A;  3H92 A;  3H9Q A;  4KFC A;  2E7X A;  3B6A A;  4IVN A;  3BR3 A;  3OIP A;  2GLO A;  3HBL A;  2F5E A;  2QQ9 A;  3KP5 A;  1VQL I;  2GXA A;  2CQX A;  2ZXH A;  2BVM A;  2KRC A;  3E6D A;  3OYF A;  1BM9 A;  4BDY A;  1YRN B;  1T0F C;  1MJB A;  3G1L A;  3DPT A;  1OCR H;  1OCZ H;  2M8E A;  2IGK A;  3DBR B;  5CLS A;  4Z6Y A;  3OYI A;  3QRF F;  1G6N A;  3RIR A;  1SVO A;  4BL0 B;  3KLO A;  1LNW A;  3VFZ A;  3K6G A;  2XAH A;  2ZXI A;  5ICG A;  3FMQ A;  2Q8K A;  3JTH A;  3I54 A;  3K4L A;  2Y0S A;  1U5T B;  4LLL A;  3CCJ I;  3TW7 A;  3OY9 A;  3LQR A;  4L5J A;  2K86 A;  1XCB A;  2Z99 A;  3DF8 A;  3U1K A;  1DU6 A;  4NDL A;  2HDD A;  3DKY A;  1MD0 A;  4M74 A;  5LHI A;  1V4R A;  3K4C A;  1LFB A;  1IZ1 A;  3LA3 A;  3JAM Z;  2VQH A;  2IGN A;  3IH2 A;  2R7V A;  3HRS A;  1IC8 A;  3Q9V A;  2ZBK A;  2PJP A;  4DZJ A;  4G7Z F;  3A02 A;  4XR6 A;  2VT3 A;  3D0S A;  2E34 A;  1IJW C;  3GFL A;  3GFI A;  3ZMT A;  5L3D A;  1BR2 A;  1OPC A;  4BQN A;  4FCY A;  4LOC A;  2FSW A;  1Z6T A;  3L7W A;  3ROU A;  4V19 K;  3PNV A;  3RYR A;  4ZYA A;  2EWN A;  3CCE I;  3GTK J;  4IHV A;  2RRE A;  2M1B A;  2FML A;  3L2R A;  3U1D A;  1MMD A;  5HS8 A;  1IXR C;  3OYL A;  1H8A C;  1SMY F;  5EEA A;  2QF7 A;  2QKL B;  2AXL A;  5DM7 F;  3CMY A;  1Z9C A;  2QBY A;  2XSD C;  3CC4 I;  3E5X A;  4M72 A;  2E1N A;  2EFO A;  3K1N A;  3ZCO A;  4BAC A;  1YFH A;  5HLT A;  1N25 A;  5C3E J;  1XGS A;  3F6V A;  5FJ8 J;  3H9G A;  2KIU A;  5ILU A;  2KIM A;  3ZQ7 A;  2TDX A;  3HC7 A;  2MH2 A;  2X9D A;  4PSW A;  2PBI A;  5D5U B;  3IHU A;  3M7G A;  4IHX A;  5IT9 K;  3LSK A;  4XLF A;  2E71 A;  4E7S A;  4A5N A;  3LA7 A;  5EZH A;  2W25 A;  2HZD A;  3B73 A;  3LSM A;  4EJV A;  4KIS A;  5IP7 J;  2EFN A;  5FGM A;  2KIS A;  3WTS C;  1J09 A;  1O7L A;  1ORK A;  4WK8 F;  2W00 A;  4P55 A;  1IF1 A;  2EZL A;  2ZC2 A;  4M9S A;  1P4X A;  1KQ8 A;  2DLL A;  1LPQ A;  1Y6I A;  4B3A A;  3JTG A;  2MH9 A;  5DV5 A;  5K5Q A;  1DGW Y;  2NVT J;  3R61 A;  1BIB A;  4S0H B;  1SFK A;  3J81 Z;  2V9K A;  3AL0 C;  3DXJ F;  5F0C A;  3KET A;  3MQ0 A;  4OAZ A;  4UVC A;  3PUF A;  1UZC A;  3VWB A;  2O8X A;  2FE3 A;  1WJD A;  4B4C A;  3LWF A;  4XNF A;  4LD5 A;  2Y48 A;  3OS2 A;  2ZO4 A;  4PZJ A;  2VBZ A;  3E5U A;  2HNH A;  1RPW A;  3I71 A;  2HZT A;  3BTC A;  4KIC A;  2EIM H;  2VBW A;  3CJT B;  1FBS A;  2D45 A;  3IUO A;  2IA2 A;  1SAN A;  2H1L A;  5J4Y A;  2A5Y B;  2CMP A;  1YW9 A;  1DU0 A;  3QU3 A;  1I3A A;  1A31 A;  3WTZ A;  1WVR A;  2LTP A;  4CIC A;  3V7R A;  1MBJ A;  3I58 A;  2DO7 A;  1X1C A;  4N9H A;  1YJ9 I;  1OR7 A;  3S1R J;  5FFZ A;  5EGO B;  5EDN A;  1LFP A;  4JK1 X;  4M6Y A;  5KHD A;  2Z9O A;  4IZZ A;  2Z16 A;  2A6T A;  5BPI A;  1USS A;  2DFI A;  2WAQ N;  1B59 A;  2P0W A;  2EQR A;  3AG2 H;  4IEJ A;  3S2D J;  2CJJ A;  1MIJ A;  1G3T A;  5DUI A;  2HYG D;  3PSF A;  2ISZ A;  1IXS B;  2Y31 A;  3PNT A;  3V7C A;  3A01 A;  4ENJ A;  2LR8 A;  4EM2 A;  3F9K A;  2CH0 A;  2W4S A;  2IBD A;  1IRZ A;  3T8R A;  3GZ5 A;  2MLK A;  2V1N A;  5J8C A;  2EFW A;  3S93 A;  3Q0V A;  4B44 A;  2B9S A;  5CQG A;  3J7A O;  2Y0M A;  3I59 B;  3CF5 F;  2GXB A;  5L3E A;  1SD7 A;  4C3H J;  3CCQ I;  3WU1 B;  2O3F A;  2GZW A;  1UAA A;  2IS1 A;  2RC4 A;  5FFX A;  3MMY B;  3K10 A;  3QYF A;  3J7Z I;  1TWG J;  1HSJ A;  4UVB A;  2EBI A;  1Y56 A;  3M8E A;  3OMY A;  4WXH A;  3SZG A;  4Q4Z F;  3DCF A;  2PFB A;  2H1K A;  2K9N A;  4RMN A;  2R93 J;  2P7C B;  3CQZ J;  1LQ1 A;  3ERE D;  4N9I A;  2BOL A;  3ZMZ A;  4N0B A;  1YJW I;  2GA2 A;  4G6D A;  2OA4 A;  1QHH D;  2RDP A;  3RKQ A;  5HLI A;  2R7U A;  4I6Z A;  3H5A A;  4DBQ A;  2LLK A;  2IP2 A;  3HZJ A;  4IX7 A;  2UXX A;  2FNA A;  2Z2S B;  2EJR A;  5B1B H;  2XAU A;  1N78 A;  3UKG A;  2LOO A;  3V8K A;  1Z7U A;  3I64 A;  3IH3 A;  1HKT A;  1UG2 A;  5E1X A;  3BP8 A;  1BJZ A;  4ENK A;  1TW3 A;  3JR9 A;  2ZJR F;  4RGS A;  3RPU A;  2E7W A;  1OR7 C;  4U0Y A;  2BVL A;  1VF9 A;  5EJC A;  3GFJ A;  3ZQQ A;  4XOT A;  4I0A A;  5LD2 C;  3GTL J;  3KPH A;  1F43 A;  4BY7 J;  4H0E A;  3WE3 A;  4GGG A;  5ILS A;  3TP3 A;  4Q5S F;  1BR4 A;  2LRE A;  4A3I J;  3ZMD A;  3E6B A;  1HCR A;  2F6C A;  1W7P D;  1ZGJ A;  4XOP A;  1DQU A;  4K2E A;  3WOD F;  3BJ6 A;  2DK8 A;  3F72 A;  1ZN2 A;  1CGP A;  2LF7 A;  1EH6 A;  4XLP F;  3S3N A;  3K70 D;  1E0E A;  3J80 Z;  4J01 A;  3PFY A;  4Y17 A;  4ON0 A;  2K4J A;  2YR2 A;  2JVG A;  2M4G A;  1QPI A;  2H27 A;  1S6L A;  1R36 A;  3OL3 A;  2XGD A;  3RTR A;  3RKY A;  3KZY A;  4XK4 A;  4AU7 A;  1VQ6 I;  4HF0 A;  4RBO A;  2LKX A;  2GQQ A;  2LH9 A;  4OOI A;  4RAG A;  3FKJ A;  2H8W A;  5TGT A;  5ILV A;  2M34 A;  1V5E A;  2ISY A;  1D5V A;  3SZT A;  1KZH A;  4A0X A;  4ZDP A;  5FLV A;  4KA4 A;  3M9A A;  2FRH A;  1K7A A;  4Q48 A;  2HOA A;  1U6G A;  3H9J A;  5F6F A;  5L3G A;  1G8X A;  1WPK A;  3FXL A;  5D5W B;  1G59 A;  5E8I A;  2VOO A;  5CVJ A;  1Y8R B;  2LC2 A;  3ZMU A;  5D6E A;  1ZRD A;  4ZH4 F;  2B7E A;  5DCM B;  1SMT A;  1X4O A;  2NOG A;  4XRS A;  3AG4 H;  2HFH A;  5HVQ C;  3RJP A;  1ETK A;  1KQ0 A;  1Z05 A;  3BTJ A;  2BV6 A;  1MW7 A;  5CPR B;  1O3R A;  2KIF A;  1XSD A;  4AUX A;  2PQ8 A;  4M6X A;  5DCF A;  3SDB A;  5CVV A;  2Q1Z B;  3MN2 A;  3PQK A;  2TRT A;  2F2E A;  1ZG5 A;  1FNN A;  2M30 A;  4NUB A;  3SFZ A;  4ESJ A;  1B6A A;  2RKH A;  2V26 A;  3FXM A;  2K3P A;  1JXS A;  3GTP J;  4RB3 C;  4P9U A;  4UV9 A;  3GZ6 A;  2NOJ B;  2VL8 A;  2P8T A;  1HC8 A;  4FET A;  4PJL A;  3S14 J;  3IH4 A;  5CJ9 A;  3SXY A;  1OCO H;  2G9W A;  2P6S A;  3K4B A;  1CF7 B;  3JRE A;  1UHS A;  2ZNY A;  1JUM A;  2Y69 H;  1RR7 A;  4BUP A;  2D1V A;  3K1M A;  3GWZ A;  3T0Y A;  2GOM A;  2DA5 A;  3G73 A;  4AIJ A;  1RI7 A;  3H36 A;  3JRC A;  2VQG A;  3S1N J;  2VXZ A;  1VQM I;  4ENM A;  1P9Q C;  2W1O A;  2VIX A;  1VFC A;  3OS0 A;  2HQA A;  3K4K A;  1J75 A;  3S17 J;  4WF2 A;  1LJ9 A;  1J7K A;  4BXU A;  2VQL A;  3KYC B;  2OZU A;  5DM6 F;  4EJU A;  4CHU A;  1RNL A;  4MEY F;  4I0B A;  1J2X A;  2R7D A;  2ZCW A;  2IJL A;  3H0G J;  3S3O A;  3TED A;  2MYS A;  2YPR A;  1ZH5 A;  2QSH X;  2HS5 A;  2UWM A;  2IS6 A;  1SFE A;  1DPR A;  1R5H A;  3ZR8 X;  2ECB A;  1TWH J;  1LEA A;  2JK3 A;  1XCV A;  2DA6 A;  2DMN A;  2M5W A;  2L02 A;  3CCL I;  4A3F J;  1S8N A;  3P7N A;  2V6C A;  5ICF A;  4RM2 A;  1HLV A;  3PUB A;  1ITY A;  2L0K A;  4BHC A;  2EIL H;  4AID A;  1R58 A;  2I10 A;  3VOD A;  2WAF A;  3K4M A;  3BPX A;  4I99 C;  4PJM A;  1MSF C;  4H4K C;  5JFR A;  1D0X A;  3OYG A;  1FP1 D;  3E97 A;  5L3F A;  3DBL B;  2ESH A;  4CCO A;  1ZR2 A;  3IWF A;  1CF7 A;  4KDP A;  3QP5 A;  2COB A;  1SFU A;  3I4N J;  3LNQ A;  3BQZ A;  3QPL A;  2L01 A;  2JA2 A;  3HOV J;  3K69 A;  3VOE A;  4A3C J;  4RAF A;  1HA8 A;  1G2H A;  5L3B A;  4B48 A;  2KLO A;  3JSP A;  1MJ9 A;  4XBF A;  2LP0 A;  5BMZ A;  3GLL A;  3HGY A;  2JQ7 A;  3AKZ A;  4M3B A;  2K5C A;  3FHN A;  3GCM A;  2HXI A;  2NS8 A;  4RAZ A;  3V8L A;  2DPU A;  2KJC A;  1U9N A;  2W24 A;  5FO5 A;  4P9F A;  2QWW A;  1FLI A;  5DCM A;  2PI0 A;  1Z7L A;  1EF4 A;  3GBG A;  1Z6R A;  3E1S A;  2FBH A;  3JRA A;  1BN5 A;  3BQY A;  4KT6 A;  4DYQ A;  2R3S A;  3JRG A;  2EA4 A;  4HYE A;  3HOT A;  3ZGK A;  3BWG A;  2DMT A;  3CLQ A;  1QA6 A;  4E7H A;  1WHU A;  4FT8 A;  1N75 A;  3M1C A;  2PJR A;  3BG3 A;  4D7M A;  3CF2 A;  1LDJ A;  1LDK B;  1HOM A;  4CZZ A;  3KYD B;  2X1D A;  3KCC A;  1XSV A;  3AFH A;  2OBP A;  3WGI A;  1ETY A;  5C4X J;  2O6G E;  2P81 A;  1Q1V A;  2HVS A;  2UXN A;  4EM0 B;  5DDG A;  1U9O A;  4J00 A;  4MTD A;  4XM3 A;  2A6E F;  3Q0U A;  1YHQ I;  2Y9Z A;  2DDA A;  3ABT A;  1A6I A;  3HUG B;  4GFB A;  2L54 A;  4FAS D;  2HQ5 A;  1ACI A;  2IRF G;  4UNO A;  2MSY A;  2XAS A;  1GLN A;  5KNL A;  1B4A A;  2X4H A;  2VT2 A;  2ZJ2 A;  3U9G A;  3KP4 A;  2R7W A;  1K78 B;  4XRS G;  2HU9 A;  2XF7 A;  3UNG C;  4AC0 A;  1DUX C;  2F48 A;  1QGP A;  1MBE A;  1TNT A;  4LMY A;  1Z0X A;  4PUS A;  1SD6 A;  1W1W E;  1K79 A;  1GV5 A;  1AWC A;  4Y4R A;  1D8K A;  4X1E A;  3DLL F;  1MNE A;  1U5T C;  1YI2 I;  1FX7 A;  1JKO C;  4MIM A;  2K4B A;  4ZDO A;  4FHT A;  3KLN A;  5J1U A;  2VPR A;  3TP0 A;  2KDZ A;  1T33 A;  1HDP A;  2XB5 A;  4OIN F;  2IS4 A;  4B43 A;  3CCV I;  3S1M J;  1WFX A;  3AG1 H;  1W36 D;  1K4T A;  5H6R A;  2K9Q A;  3FMR A;  4MNU A;  1ZEL A;  3IC7 A;  5EEH A;  2BGC A;  5LEK A;  1DPU A;  5FD6 A;  1FOY A;  5FKM A;  1JKR C;  4XLE A;  2O03 A;  1JKP C;  4M3F A;  1TT5 B;  1BL0 A;  2IS2 A;  1S72 I;  1O4X A;  4KN7 X;  1FYL A;  3F8C A;  4XID A;  1NK3 P;  4MEX F;  2HVR A;  4OIO F;  1ZLJ A;  2M4K A;  1L0O C;  5CQE A;  4HST A;  1LKX A;  3TDZ C;  1X3W B;  4A3M J;  5F1R A;  1J0R A;  4DJA A;  1HKS A;  2QVO A;  3Q9S A;  3O3K A;  1IUY A;  4EGY A;  3F6O A;  3PJR A;  3ZMS A;  3LFU A;  3PFI A;  4J19 A;  4DYR A;  2EIJ H;  1GVD A;  1SC7 A;  1LDD A;  1H0M A;  4F3Q A;  1R1U A;  3GZN B;  3PIP F;  1D5Y A;  5DS9 A;  2MC3 A;  2AQE A;  4E4H A;  1T6S A;  2JA7 J;  2QEX I;  4CO8 A;  1AU7 A;  2JSC A;  2X6W A;  2BE5 F;  2QKM B;  1I6H J;  3WTT C;  4A0Y A;  3DEU A;  5FKL A;  4BBR J;  4EAT A;  2VPL A;  2B0L A;  3BCA A;  3O6B B;  1ZR4 A;  1WKM A;  2WB1 A;  2O5R A;  3RKX A;  4CH7 A;  4HLX A;  3OR1 C;  4B3X A;  1I1G A;  4F55 A;  4OIR F;  2V4J C;  2BBY A;  2WY7 Q;  3TL4 X;  1UMQ A;  2P5L C;  3I59 A;  1P4W A;  2BEO A;  3VYS B;  5D8K B;  4ZTF A;  1OCC H;  4FX0 A;  1KU3 A;  1WCM J;  4E7K A;  3DEE A;  2BYV E;  2XVC A;  3LFK A;  4ESF A;  4L5I A;  2R7Q A;  3OSF A;  3V4G A;  5F64 A;  2JUC A;  1E17 A;  4XSZ F;  4XON A;  2D2W A;  3TOB A;  4L0Y B;  1WJF A;  2DQR A;  2RVC A;  2GM4 A;  1I5Z A;  2DMQ A;  2QSG X;  5E79 C;  2BHY A;  1HBX G;  3OYB A;  4KJZ A;  5DD8 A;  2Z3Y A;  3TOA A;  2HQN A;  2P6T A;  1W4M A;  3RPQ A;  5J4V A;  1RET A;  3BDD A;  4EM1 A;  2MGQ A;  4FTH A;  1RUO A;  3ZQG A;  2BHZ A;  1FYM A;  4Y3O A;  3BG7 A;  4ASN A;  3GTQ J;  1J9I A;  1H88 C;  2EIK H;  2L5Q A;  2VE9 A;  2XV4 S;  2M0C A;  4LIU A;  1XGO A;  5F0H A;  2R5Y A;  2KP6 A;  4IOC F;  2HWV A;  3KZI C;  1YS6 A;  2BW3 B;  3X2Q H;  3G71 I;  5IY5 H;  4A6E A;  3GF2 A;  4HPQ A;  4UXN A;  1MBH A;  4O3M A;  3BR0 A;  3HPG A;  3G3Z A;  3MD2 A;  3PL8 A;  1JTX A;  2JRT A;  2FXA A;  3A2K A;  2NRA C;  3IKT A;  2K7L A;  2MD0 A;  4BE1 A;  1SD4 A;  2JN6 A;  1STZ A;  4IF4 A;  2ADU A;  1A6Q A;  1Z3Y A;  3OS1 A;  3BG6 A;  4R1H A;  2LKS A;  2G7H A;  1D0Z A;  4X0G A;  4EQQ A;  3F8M A;  1AHD P;  5GAD J;  1K6Y A;  1I3Q J;  3PNY A;  2BXZ A;  3WHB A;  1UG0 A;  2EA2 A;  4G6Q A;  2ID6 A;  4UB6 C;  2VOP A;  4YEJ A;  3SZP A;  2DJI A;  3GX4 X;  2HI3 A;  3A1Y A;  2JJ7 A;  2RGV A;  3FXU A;  4I7H A;  3OYA A;  2HR3 A;  5K1Y A;  3AG3 H;  4OU0 A;  3QPT A;  3E7L A;  1BI1 A;  5CVU A;  1UFM A;  2OCE A;  2C6Y A;  3WE2 A;  3M8F A;  3OIQ A;  4WX9 A;  4CUG A;  2JT1 A;  1P7J A;  4HX4 A;  1OYY A;  1SAU A;  4MQ9 F;  2EZI A;  3BZK A;  1JGG A;  3EYI A;  5JR3 A;  5D6F A;  5HOD A;  4BJT A;  4LJZ F;  1S7O A;  2BY2 A;  4DYC A;  3ML6 A;  1EV7 A;  2ZKZ A;  1FBQ A;  3KFW X;  3K0L A;  1T56 A;  2X1C A;  1T39 A;  4KIT B;  4RLQ A;  3TO9 A;  3FXJ A;  1JKQ C;  4GDF A;  2H94 A;  2BW3 A;  4RDU A;  1JJ6 C;  2H6B A;  3DPU A;  2W57 A;  3DTK A;  2PLY A;  1JI8 A;  1FOW A;  5HDG A;  4LB6 B;  2WY8 Q;  2P5K A;  3I55 I;  2MBF A;  3SDG A;  2X0L A;  1F36 A;  5FRN A;  3PQJ A;  2LKP A;  4HV6 A;  4JX6 A;  3L2W A;  1WH7 A;  3OYH A;  1MNM C;  1TC3 C;  1FTZ A;  1HDD C;  2FF4 A;  2MLG A;  2XSJ C;  2VBX A;  3Q5F A;  1T38 A;  5M5W J;  3ONQ A;  1ZLK A;  2XHK A;  1Z67 A;  1E2X A;  3DKX A;  2ME6 A;  5J1Y A;  2WV1 A;  1XN7 A;  3QYB A;  1SVL A;  5D4R A;  1KON A;  5EZG A;  3FM3 A;  1XTA A;  1GHC A;  3N4M A;  2R7F A;  3HM5 A;  1Z21 A;  3QOP A;  1U5T A;  2OJE D;  4IQJ A;  1MH3 A;  4GYG A;  4RS8 A;  1XS9 A;  3V8J A;  2E1M C;  1GV2 A;  2I8D A;  1VI0 A;  2Z1D A;  1NK2 P;  4IJA A;  4BS9 A;  3RKW A;  3R0A A;  4BAY A;  4C9Y A;  4MLO A;  3DU6 A;  1YRN A;  1VQK I;  2OV7 A;  2Q0O A;  4IQ4 A;  2V1U A;  4HAM A;  5HNH A;  2ELJ A;  5BPD A;  4EJW A;  1R6R A;  2JZY A;  1IO2 A;  2KRH A;  4GO1 A;  4PJJ A;  3JRB A;  1XMA A;  3VB2 A;  4C2U A;  1TP4 A;  3KEY A;  2DA3 A;  4PGH A;  4QWQ A;  2BXY A;  1IV8 A;  4HEA 2;  2NNY A;  4GYI A;  1GXQ A;  1MJA A;  5LBQ A;  5TJJ A;  1F4K A;  3IAM 2;  1UB9 A;  3SHF A;  1H9T A;  1RZ4 A;  3MKW B;  3L2U A;  2N8G A;  5DD4 A;  3E3V A;  3JRF A;  1BC8 C;  4CA0 A;  3W6V A;  1MGT A;  3M1E A;  1MH4 A;  1PP8 F;  2CFX A;  3HSE A;  4HF2 A;  2LY1 A;  4HG2 A;  2XC7 A;  2CWE A;  2IT0 A;  2MFZ A;  3WHC A;  1KU2 A;  3QWL A;  2W7N A;  2ZJQ F;  4G94 A;  3FK7 A;  4LG0 A;  3FIW A;  4NB5 A;  5JI6 A;  1VQ9 I;  4LK1 F;  3N05 A;  4PDK A;  5E3L A;  1KYZ A;  1YOV B;  4YIF A;  5GAE J;  3CO7 C;  2M3A A;  2XKO A;  1XMX A;  1BJA A;  4A3G J;  3G2B A;  3HGG A;  1YTY A;  5HS7 A;  2YX7 A;  3H35 A;  1AKH A;  4LB5 A;  1BR1 A;  4KMU X;  3L2V A;  1G3W A;  3BR6 A;  2VKD A;  1KU9 A;  3B02 A;  3GW2 A;  4NC7 A;  2NS0 A;  5KVR A;  3F8N A;  3VSL A;  5EGO A;  2HYF A;  2XPU A;  3KEQ A;  3VYT B;  4U7B A;  4HNU A;  3CDI A;  1IN5 A;  1IGN A;  2E1O A;  3ZN0 A;  3ZN1 A;  1JHF A;  3BJA A;  1K78 A;  4E70 A;  1OMI A;  4BQO A;  2DA2 A;  2WTE A;  3ZQH A;  1LFU P;  2LDU A;  2QCO A;  3LSP A;  5KCM A;  1LB2 A;  3W6J B;  3HOW J;  2X85 A;  2JA6 J;  1UCR A;  2BZT A;  4XIC A;  3LSR A;  1IXC A;  2PMZ A;  2R4G A;  3HRM A;  2HYJ A;  4Y33 A;  2FJ1 A;  2XUB A;  3ZRG A;  3OYJ A;  2A6H F;  4LK0 F;  4A3J J;  4PK4 A;  5M5X J;  3I3L A;  1YG2 A;  2E5Z A;  3ZPL A;  4KT5 C;  2FU4 A;  4M73 A;  5LFA A;  1BI2 A;  5K7F A;  3HRT A;  2E2I J;  3BTI A;  5F27 A;  2MG4 A;  3BPV A;  4MGR A;  2FUG 2;  2R7O A;  2RQP A;  3W2W A;  1DGR M;  1BC7 C;  5HDK A;  5JHF A;  4BGD A;  1Z1D A;  4CGZ A;  1I1S A;  4XL9 A;  3Q3S A;  5D4S A;  2CGP A;  1D3Y A;  2NYX A;  5IP9 J;  3RDI A;  1YIJ I;  2DDB A;  4BXF A;  2EH3 A;  1TQM A;  1VND A;  1TNS A;  4HNV A;  1HKQ A;  3HHH A;  3VPR A;  3DPL C;  3E5Q A;  3UR3 C;  2P4W A;  2QQB A;  2QZ8 A;  4I2O A;  1MMS A;  2X6O A;  4JQF A;  3G6E I;  3CTA A;  3FX3 A;  1D1A A;  4IHY A;  5C44 J;  1R5I D;  2ID3 A;  4EGZ A;  3JAM K;  5BNG A;  2DPD A;  3ZQF A;  3A03 A;  4O6J A;  3LSH A;  4PGG A;  2PEX A;  2A05 A;  3TO7 A;  1FY7 A;  3CUO A;  4UUT A;  1FTT A;  2K9M A;  2F5F A;  2JA5 J;  2NS7 A;  2DA7 A;  3CP8 A;  2QSF X;  4UUV A;  1ZG3 A;  1SFX A;  2MAB A;  2Y9Y A;  4Q47 A;  5ERI A;  2E36 A;  3OYN A;  1WJC A;  4W97 A;  3BLY A;  3KX2 A;  3C2B A;  1N77 A;  2R7Z J;  4ZYD A;  1NG7 A;  4XQF A;  3PO2 J;  2G7U A;  1Z77 A;  1ODD A;  1FT9 A;  4AYB N;  3COA C;  4L9T A;  1TWA J;  3FF5 A;  1ZAR A;  1IDZ A;  3KEO A;  1NHA A;  2OZ6 A;  3DTE A;  2R0Q C;  3CCY A;  1S3J A;  1TLH B;  3AAF A;  2KKO A;  4MFE A;  1G4D A;  2XAJ A;  2IA1 A;  3NRV A;  1TW2 A;  4E6K G;  2W85 A;  3W2A A;  2IXS A;  3HG9 A;  2YUS A;  1RR8 C;  1V5F A;  1XSX A;  5CVI A;  4DOZ A;  2DFH A;  1Z91 A;  4LIT A;  4ZZD A;  5GPC A;  3IRQ A;  1OYW A;  4UY8 I;  2M45 A;  3S2W A;  3JW4 A;  5KAI C;  3WTU C;  2CW0 F;  1V55 H;  3LA2 A;  5H2F C;  4I98 B;  2NVY J;  2LMD A;  2KHM A;  2CS3 A;  3BZC A;  3OOP A;  2E5N A;  4DZP A;  4ZJZ A;  4LG3 A;  4KIG A;  4D1Q A;  3ESW B;  1X1B A;  1X58 A;  5J1R A;  4A2U A;  2EK5 A;  2IEK A;  2OD5 A;  2LK2 A;  2PX9 A;  3I53 A;  5E18 F;  5LGN A;  4LIV A;  4YIR X;  1FIP A;  2L7F P;  2NVX J;  3KP7 A;  1BW6 A;  2LNB A;  4CCN A;  2PMU A;  2HOE A;  4UB8 C;  2OUM A;  1YIT I;  1FJL A;  4QSH A;  1T08 B;  4XSX F;  1RUN A;  4JX5 A;  2VBY A;  3HOZ J;  2GBY A;  5D5V B;  3DV8 A;  3P9I A;  1EH8 A;  2CO5 A;  3OYD A;  3QAH A;  2X51 A;  2DFF A;  2OTJ I;  3V42 A;  4L18 B;  3LQQ A;  1V3F A;  2DTZ A;  2Y2Z A;  1SFO J;  1WJ5 A;  1X3Z B;  1W5T A;  3CCR I;  2NVU B;  1K6O A;  2XB0 X;  5J6X A;  3WGG A;  1MDM A;  3M3Y J;  2DJN A;  3C2H A;  3CCS I;  1XG1 A;  2EV6 A;  3O8H A;  1QBJ A;  4ZDL A;  5J47 A;  2KZG A;  3BC8 A;  3I9V 2;  3BZ6 A;  1WJA A;  2RV8 A;  1EA3 A;  3KYL A;  1WZ2 A;  1NH3 A;  3E0J B;  2V1D A;  2Y30 A;  4XKV A;  4NC6 A;  1MBG A;  2J5O A;  1XDU A;  2M2E A;  3M8J A;  2L7K A;  1R49 A;  4A0Z A;  4M3E A;  4QTR A;  2VKH A;  3SEQ A;  1C0W A;  1RKW A;  4C3I J;  2CQN A;  1IRG A;  1KQ9 A;  2LBF A;  3JRD A;  1W7P B;  3CJR B;  4I09 A;  4CDG A;  2F4I A;  2P7V B;  1RC9 A;  2RAE A;  4C30 A;  2X1E A;  2W82 A;  1U8B A;  2CV2 A;  2MD5 A;  4IHS A;  4B1R A;  2VUM J;  2RN7 A;  2A07 F;  2JA8 J;  2ICW G;  4E7I A;  3DQV C;  5A2Q Z;  4A3E J;  3BG9 A;  2V9V A;  4L5E A;  3ERM A;  1OYI A;  2L9N A;  1B8I B;  4XN3 A;  1OCT C;  5FB2 A;  1BA5 A;  2QQA A;  2RNG A;  4WXC A;  1R22 A;  3WGH A;  2GXG A;  3F23 A;  3K4N A;  3OIO A;  2W84 A;  1EH7 A;  2ZME B;  3F0C A;  3KP3 A;  3WTY C;  3D5S C;  4BE2 A;  4OWR B;  3L09 A;  4AM3 A;  3F8F A;  3D5R C;  1GDT A;  2H8R A;  4W1U A;  4RB1 A;  2DW4 A;  2EV0 A;  1YIO A;  1BOB A;  3BT9 A;  2W48 A;  2XAF A;  5FKN A;  2AO9 A;  5J3L A;  1S9H A;  2CW7 A;  1WH5 A;  3JRH A;  4G9Y A;  1E3O C;  5HOO A;  4BE0 A;  5IYB J;  1FSE A;  4ZTJ A;  1JUP A;  1ZKG A;  3NWS A;  5IYD J;  4XLH A;  1TT0 A;  2UUZ A;  1FP2 A;  2OU2 A;  1MND A;  3GFM A;  1W36 C;  4EJO A;  1XX5 A;  2VJ5 A;  4II2 A;  4AVP A;  1SD5 A;  3F21 A;  2DT5 A;  4IHT A;  3NQO A;  2YU9 J;  1IN4 A;  3HKZ N;  4JYK A;  1YX3 A;  3CUQ A;  5EG0 B;  2XRO A;  3ZQC A;  3Q0W A;  1QU3 A;  1R7J A;  3B6C A;  1X2N A;  4HDU A;  3IV5 A;  3TBI A;  3RI4 A;  4KIF A;  2H6C A;  2F5D A;  4BQQ A;  2O9L A;  5FKO A;  2LY9 A;  3E6C C;  2O61 A;  2NAZ A;  1PJR A;  5LRR A;  1FIA A;  2FOW A;  1Q1H A;  2DAO A;  2CSO A;  4D7N A;  4IO9 F;  5IYC J;  4NC8 A;  1JT0 A;  3I0T A;  4CCM A;  4RAY A;  3F22 A;  1QO0 D;  1I39 A;  1WSU A;  5HDN A;  2CUZ A;  2LVS A;  2HOS A;  2K9L A;  3G1M A;  3LSJ A;  2M8G X;  5F1J A;  2O8K A;  3R6S A;  4CCK A;  2VI6 A;  4LGW A;  4BY1 J;  3MVP A;  3HRU A;  3GLX A;  5FLX K;  3FWE A;  3LL7 A;  4AD9 A;  1H89 C;  3BR5 A;  3U2R A;  1T95 A;  3LSG A;  2ZSI B;  2WC2 A;  3DU5 A;  5D5X B;  1WJE A;  4P1W A;  2B63 J;  2OPT A;  1WJB A;  2L9R A;  1BI3 A;  2L3D A;  2ECC A;  3MZY A;  5HS9 A;  2CQQ A;  3FXK A;  3JRI A;  5LHG A;  5EF6 A;  2M7B A;  2DMU A;  3QYE A;  3HL2 A;  2E2J J;  3TW6 A;  3WTX C;  2ZJP F;  2X6X A;  3V7S A;  3ISP A;  3QOE A;  2JUG A;  4MTE A;  2FD5 A;  1ZRE A;  4RB2 C;  1ZQ3 P;  2OAZ A;  3A01 B;  1XGM A;  1VQ5 I;  1J5Y A;  1Y0N A;  3CCM I;  1MMN A;  3DWL E;  1U8R A;  2ZXW H;  4YRV A;  3SEZ A;  1UHW A;  3CCU I;  4V2F A;  2VON A;  1XC5 A;  3BCB A;  1HQC A;  4AIH A;  2VB6 A;  2E35 A;  4ITV A;  5B5E C;  5FRO A;  1R00 A;  4HZF A;  4L9N A;  3IWZ A;  3HDD A;  3J81 K;  1JT6 A;  4HA8 A;  2HGC A;  4F93 B;  2E1M B;  4EEF G;  2P5V A;  4UUS A;  1I50 J;  1OLT A;  3FBN B;  1OKR A;  2BY3 A;  1IN6 A;  2LD5 A;  3KP6 A;  3HYI A;  1R9T J;  3F8B A;  4UHT A;  4OIQ F;  3PM1 A;  1I6X A;  3BY6 A;  5B3S H;  4A12 A;  4NQW A;  2D5V A;  2CU7 A;  2ETH A;  2DA4 A;  2AXT C;  2NVQ J;  3WU0 A;  1B9N A;  2XKP A;  3EDP A;  5FLM J;  4S05 A;  1I27 A;  1R5G A;  2E2H J;  4RM3 A;  3CO6 C;  3S15 J;  2J5P A;  1G3Y A;  4WWC A;  2CUE A;  4HF1 A;  1UHM A;  2X6Y A;  3O2P E;  1XPX A;  3CMM A;  3CZ6 A;  2ZSH B;  1ZAO A;  2E60 A;  4OIP F;  3ZP5 A;  2LF8 A;  4XLN F;  1YE9 A;  3GEZ A;  1FOK A;  4BXX J;  2IVM A;  3LMM A;  1L3L A;  1B1B A;  2HKX A;  3FMS A;  1W7P A;  5JHU A;  1MBK A;  4P96 A;  1U2W A;  3LOC A;  3ZOB A;  3G1O A;  2FOK A;  2X48 A;  4NBQ A;  4HDV A;  1P4A A;  3E6M A;  2A69 F;  1SEU A;  1XD7 A;  2KDO A;  5EYR A;  4KN4 X;  3GTG J;  2CW8 A;  2DYR H;  1FOX A;  2FBI A;  1ETV A;  1DP7 P;  3EUH C;  2DOA A;  4FX4 A;  4E7Z A;  2GOX B;  3WU2 C;  2MC4 A;  2K40 A;  1QZE A;  1T0F A;  2DMP A;  4QLC U;  2EV5 A;  4RLF A;  5FRM A;  1X1P A;  5F0F A;  2K27 A;  3L9F A;  1RIO H;  2VQC A;  3C1D A;  1B9M A;  2IGM A;  1VQ4 I;  1ZRC A;  1O3Q A;  2QBY B;  1QNT A;  4DQ2 A;  2VJI A;  1Y0U A;  1E3H A;  2WAQ A;  2R7R A;  2WAE A;  1R23 A;  2E1C A;  1TWC J;  1MDM B;  4B8X A;  5JVG F;  2JWT A;  2CQK A;  4RGX A;  4XKC A;  1Y39 A;  1MSE C;  4RA2 A;  1FMW A;  3F3X A;  2Z33 A;  4R79 A;  5KK1 A;  2YSR A;  1XGN A;  1PYV A;  1ULY A;  3PIO F;  3BR1 A;  3M07 A;  4BH9 A;  4D0P A;  1A35 A;  1V54 H;  2STT A;  4E7J A;  4PJN A;  3J7Y J;  1FYK A;  2XAQ A;  3NEU A;  4D9J A;  5IOZ A;  4KUM A;  3H1C A;  2EFP A;  3CJQ B;  2MA3 A;  3PO3 J;  1T8I A;  3H0D A;  5TIS C;  3CMA I;  1UEL B;  1YQA A;  4ZYG A;  4TV7 A;  4AIK A;  3KZZ A;  9ANT A;  2XGX A;  5E3N A;  2CUJ A;  2VJ4 A;  1SVM A;  3I4P A;  3CC7 I;  3MFK A;  1JTY A;  1EJ9 A;  2CFO A;  1ENH A;  1H9G A;  2L4A A;  1X4P A;  3TDU C;  2VJJ A;  2L9V A;  3QQA A;  4HSR A;  4LFU A;  3K9T A;  3MZH A;  1Y1W J;  3RSN A;  2L4M A;  1JE8 A;  2HDC A;  2FQ4 A;  3TO6 A;  4RGR A;  1R4M B;  2WA0 A;  1Z3X A;  4XLC A;  2CV1 A;  2XPV A;  1IG7 A;  1HST A;  2KIQ A;  1ETQ A;  1PDN C;  2DA1 A;  5C4J J;  4AVZ A;  1MMG A;  3S3M A;  3N97 A;  2HOT A;  3FHZ A;  3ABM H;  3DLA A;  2ZNZ A;  1VQP I;  1F1Z A;  1ONV A;  2CRG A;  2CUF A;  1FBU A;  1WI9 A;  3HEF A;  4HOB A;  5E20 A;  4HNT A;  2V6E A;  3GTO J;  2FX0 A;  3AL0 B;  3S1Q J;  1BBY A;  2DQL A;  1ZTR A;  3MZ8 A;  3BJO A;  2DT6 A;  2DCE A;  5ED4 A;  1YS7 A;  3HHG A;  2K9S A;  2RNJ A;  2KMU A;  1D1C A;  3JSO A;  4G7O F;  4Y7N J;  4GRI A;  2EPF A;  4OMZ A;  3H3Z A;  2HKO A;  3VYR B;  3VSK A;  4YFN F;  1M1E B;  1S5L C;  3RQ4 A;  2A3S A;  4HW0 A;  1HW1 A;  1X1A A;  3H5R A;  2ZB9 A;  2DK5 A;  2WBM A;  2HXO A;  3HPH A;  2K02 A;  1KGS A;  1V5G A;  3S8P A;  2JVH A;  3LAJ A;  4N4O B;  2FNP A;  1YLF A;  2R7T A;  4IKF A;  3ASO H;  3R4K A;  5CYV A;  3EPZ A;  3WG9 A;  2YS9 A;  1MMA A;  2WWY A;  1T98 A;  4M71 A;  2Q2E B;  2OC6 A;  4L9J A;  1SAX A;  3BR2 A;  1UJ8 A;  1IW7 F;  1QVU A;  1X3U A;  4JOM A;  1XMK A;  3A0H C;  3MKZ A;  4A5M A;  4U0W A;  1TQI A;  4RB0 A;  2FMY A;  1PUF A;  2DYS H;  2JPC A;  2V79 A;  4UVA A;  2G0E A;  3HB9 A;  3TMO A;  5GTH C;  4IOA F;  3BOQ A;  2L9S A;  4XN0 A;  3ABK H;  5DEQ A;  1R71 A;  2OTL I;  3TQN A;  1KA8 A;  1WWX A;  4NQW B;  2ACJ A;  1T2K A;  1ON1 A;  2Y0S N;  3CDL A;  3VEP A;  2WV0 A;  2KJB A;  3NAU A;  2ESN A;  5GP9 A;  3MCZ A;  2KFD A;  4XRM A;  3OR2 C;  2MW8 A;  1XDS A;  1A5J A;  2VE8 A;  1G3S A;  4IXA A;  4CXF A;  2CQ7 A;  4PFO A;  1REP C;  1IN7 A;  3NWT A;  4EJT A;  3RCO A;  4IPA A;  5FD5 A;  4CCL A;  4GCV A;  2D1H A;  4M3D A;  4G7H F;  5E3M A;  3S2H J;  4EVI A;  4ZYH A;  1YW7 A;  3HOS A;  5K5O A;  1QQI A;  3HSF A;  2R92 J;  1PUF B;  3ELK A;  3H3V K;  4BHP A;  5IPA A;  4L9V A;  5F08 A;  3GME A;  2F4M B;  2DI3 A;  2BY0 A;  4IHW A;  2A5W A;  2IW5 A;  3FKI J;  5LRS A;  3FM5 A;  2Q2E A;  1RES A;  2EFQ A;  2V9P A;  4ZZL A;  1YYV A;  2QUF A;  4UV8 A;  4F7Z A;  4JBA A;  5TRD A;  2K3F A;  3T8T A;  3TGN A;  1PUE E;  4IL6 C;  3IP4 B;  4C2M J;  5ICC A;  3BRO A;  2V1X A;  5AON A;  5IOY A;  3ECO A;  3P9C A;  3QOD A;  1ZGA A;  2FQ3 A;  3SFI A;  3TKY A;  1A36 A;  3RQI A;  2DT7 B;  2CG4 A;  4PCQ A;  2LY2 A;  3CDH A;  1GT0 C;  2AHQ A;  2KT0 A;  4LG0 B;  4BKX A;  4FIS A;  1FC3 A;  4R8H A;  2DOD A;  1MBF A;  4QPO A;  3GXO A;  3FDY A;  2ELK A;  3H5N A;  2UV1 A;  4G8X A;  3QPH A;  1S7A A;  2E19 A;  3MKY B;  3CP2 A;  4CSW A;  3FXR A;  3A4C A;  4WCG A;  1ZHF A;  3G4S I;  4ANJ A;  4Y13 A;  4Z2Y A;  4KIB A;  2R5Z A;  4ZC3 A;  3K70 C;  4HQE A;  1FZP B;  4WXD A;  4U87 A;  2COM A;  1O7F A;  2YX4 A;  4I02 A;  3KP2 A;  4MHG A;  3P9K A;  3WTW C;  3VYU B;  1A04 A;  1OIS A;  3P5J A;  2JTV A;  3OL4 A;  2VLA A;  2UZK A;  3NAR A;  4QPQ A;  4BJ6 C;  2KZV A;  5AIP A;  2A68 F;  3GTM J;  3K2Z A;  2EIN H;  1X19 A;  2VAS A;  1RRJ A;  5BQT A;  4BEH B;  2VC1 A;  3R0J A;  4FE7 A;  3L2C A;  4A6D A;  4ETS A;  3ABU A;  1APL C;  3H3U A;  2VKV A;  5IT3 A;  1K83 J;  2DBB A;  2PG4 A;  4ESB A;  3IKV A;  1ZK8 A;  5BS6 A;  5IT9 Z;  4XMY A;  4PSX A;  1W0T A;  1K61 A;  4D5C A;  4DW6 A;  1ETW A;  3SQN A;  3PSI A;  3CUQ B;  2M7A A;  5EG0 A;  4DGW B;  1PVE A;  3CLO A;  1NTC A;  1ZRF A;  2FA5 A;  2NXN B;  3OSG A;  1ZG1 A;  3OWT A;  5K7Z A;  1YJN I;  1ETO A;  4KNY A;  4A3D J;  1F9N A;  5DUK A;  1LE8 B;  1VTN C;  1ETX A;  1VZ0 A;  1WQ2 A;  3EET A;  1P7I A;  4DNC A;  1DDN A;  2LG4 A;  3K7A J;  3K4J A;  2ELH A;  5JLW A;  1XB4 A;  3JCU C;  3LAP A;  2FBK A;  3K2A A;  3DTI A;  1B72 B;  5FLX Z;  3FXQ A;  4ENN A;  3BTL A;  3ECH A;  2FEZ A;  5D8L B;  3CUQ C;  4MQV A;  2STW A;  2HEO A;  4CYC A;  3OYE A;  2QEN A;  5FKK A;  1IRF A;  4M3G A;  5AIQ A;  5E3O A;  5H6Q A;  2DN0 A;  2ZME A;  3I5U A;  4QIW N;  1R4N B;  3HXL A;  2XRL A;  1R1V A;  3HOX J;  3ZXS A;  4BQA A;  1JJ8 C;  1U3E M;  1B8I A;  1TZL A;  4HRI A;  3LST A;  3QPS A;  1IDY A;  2QM3 A;  2L7M P;  2F5V A;  4B09 A;  5LGU A;  2XGE A;  4BNC A;  3CD6 I;  4U0V A;  4RGU A;  4S04 A;  2QQ8 A;  4IRH A;  1HF0 A;  1DP3 A;  2QA4 I;  2LFB A;  4NNJ A;  4YII A;  3ZQI A;  2CYY A;  3HSR A;  2VN2 A;  1D1B A;  3FIS A;  4F52 A;  2A61 A;  2Z5U A;  1FSH A;  4HX7 A;  3W3C A;  3T1B A;  2DOE A;  3K1P A;  2NNN A;  2LRD A;  1S7E A;  5IP6 A;  1U78 A;  2HPM A;  1QHG A;  1PP7 U;  2HPI A;  2PMH A;  2LYC A;  2GA1 A;  1RKT A;  2JMW A;  2ZME C;  5HLH A;  1HXD A;  2HTJ A;  2L2O A;  3OYK A;  4PJ0 C;  4A3K J;  2JPB A;  3MAJ A;  1D8J A;  2WB1 N;  1QPM A;  1TWF J;  3D5L A;  1IRX A;  1TL8 A;  5HNF A;  4CYD A;  5BOX A;  2ZXJ A;  1BI0 A;  5B1A H;  1K4S A;  2DOF A;  3GYH X;  1LUJ B;  1Y8Q B;  3DKW A;  3R60 A;  5GPA A;  2V7F A;  3EUK L;  3L1P A;  4A69 C;  3MWM A;  2EZH A;  1VQN I;  4A3B J;  2XPW A;  2VOD A;  5L3C A;  2EB7 A;  2M87 A;  4BHB A;  4U88 A;  2GAU A;  4CYC B;  2JRM A;  2OQG A;  3C3W A;  5CKT A;  3GO5 A;  3ZMV A;  3REO A;  4GXO A;  1FWZ A;  3LSI A;  1B72 A;  4HV5 A;  5KAF C;  4UUS B;  3EUA A;  2R5Y B;  1GUU A;  4X6A J;  3W2V A;  4YEL A;  3C18 A;  3MEX A;  3ZQL A;  1LE8 A;  1FPQ A;  2EZK A;  3FK6 A;  2H09 A;  3L00 A;  3FZV A;  1KU7 A;  3EYY A;  1GVJ A;  5E1Z B;  2I5U A;  2OF7 A;  4CCJ A;  1CQT A;  3WG7 H;  1O57 A;  2AQF A;  2ZFU A;  4LLG F;  1FMV A;  2ZFW A;  2DTR A;  4ZYE A;  1ZYR F;  4G12 A;  4G6T B;  1QZZ A;  2IGO A;  3J80 K;  2HDW A;  3OV8 A;  1WGX A;  4XKW A;  3OYC A;  2LSO A;  2IPQ X;  4HQM A;  1UST A;  1VQO I;  3C2G A; 
#chains in the Genus database with same CATH homology
 2GWR A;  2VC0 A;  4YG2 F;  4OMY A;  3W6K B;  2F5C A;  1TQP A;  2PN6 A;  2XRN A;  4Y15 A;  5HLG A;  1J59 A;  1P92 A;  1BOA A;  1W5S A;  2KRF A;  1O3S A;  4YFK F;  1LEB A;  2GIV A;  4LLN A;  5EEG A;  3IL2 A;  1WRJ A;  4L0Z B;  1P6R A;  3GVA A;  4KYW A;  1YW8 A;  3KE2 A;  3HTU A;  4NHJ A;  1F5T A;  5DYM A;  4YFX F;  5LGT A;  3IRR A;  5A2Q K;  4HBL A;  4HLY A;  2IA0 A;  1R1T A;  2XAG A;  4EV0 A;  1JHH A;  1BIA A;  4O5V A;  5K5R A;  3QP6 A;  1TTY A;  4U7D A;  1IAW A;  6PAX A;  1AOY A;  4P5O A;  1O3T A;  1HW2 A;  2O0Y A;  4BYY A;  1S29 A;  5LHH A;  4IRG A;  1QZY A;  2DU9 A;  5J8F A;  3QU6 A;  3T5X A;  5ICE A;  5E8G A;  4KMF A;  1P2F A;  5LLQ A;  5LEJ A;  2Y75 A;  1JGS A;  4AWX B;  3EQL F;  3HUG A;  5E1W A;  3HTS B;  2YU3 A;  1IN8 A;  3WTV C;  5E17 F;  4XRF A;  3EUH A;  4IRI A;  3DFG A;  2XIG A;  3C7J A;  5CVR A;  1MKM A;  4M9Z A;  5H20 A;  4HX8 A;  1LVA A;  2HTS A;  5JVT A;  1HW5 A;  4I01 A;  2OQR A;  1MZB A;  4M9X A;  2AS5 F;  3DP7 A;  4EMS A;  2HQR A;  3RYP A;  3GUD A;  2QLZ A;  2QYO A;  3ULQ B;  1YO5 C;  1KYW A;  3HIF A;  1ON2 A;  1TBX A;  1GXP A;  3CJN A;  3H92 A;  4KFC A;  2E7X A;  4IVN A;  2F5E A;  2QQ9 A;  3KP5 A;  3E6D A;  1BM9 A;  1MJB A;  3DPT A;  2M8E A;  5CLS A;  3QRF F;  1G6N A;  3RIR A;  3KLO A;  1LNW A;  3VFZ A;  2XAH A;  5ICG A;  3FMQ A;  2Q8K A;  3JTH A;  3I54 A;  1U5T B;  4LLL A;  3LQR A;  4L5J A;  2K86 A;  1XCB A;  2Z99 A;  3DF8 A;  1MD0 A;  4M74 A;  5LHI A;  1V4R A;  1IZ1 A;  3LA3 A;  3JAM Z;  3HRS A;  3Q9V A;  2ZBK A;  2PJP A;  4G7Z F;  2VT3 A;  3D0S A;  3GFL A;  3GFI A;  3ZMT A;  5L3D A;  1OPC A;  2FSW A;  1Z6T A;  3L7W A;  3ROU A;  3RYR A;  2EWN A;  2M1B A;  2FML A;  3U1D A;  5HS8 A;  1IXR C;  1SMY F;  2AXL A;  1Z9C A;  2QBY A;  3E5X A;  4M72 A;  2E1N A;  2EFO A;  3K1N A;  1YFH A;  1XGS A;  3F6V A;  5ILU A;  2KIU A;  2KIM A;  3ZQ7 A;  2TDX A;  2MH2 A;  2PBI A;  5D5U B;  3IHU A;  3M7G A;  5IT9 K;  4A5N A;  3LA7 A;  2W25 A;  3B73 A;  4EJV A;  2EFN A;  5FGM A;  3WTS C;  1O7L A;  4WK8 F;  4P55 A;  1IF1 A;  4M9S A;  1P4X A;  1KQ8 A;  2DLL A;  3JTG A;  2MH9 A;  5DV5 A;  5K5Q A;  3R61 A;  1BIB A;  3J81 Z;  3DXJ F;  3KET A;  3MQ0 A;  4UVC A;  2O8X A;  2FE3 A;  3LWF A;  4LD5 A;  2Y48 A;  2ZO4 A;  4PZJ A;  2VBZ A;  3E5U A;  3I71 A;  2HZT A;  4KIC A;  2VBW A;  1FBS A;  2D45 A;  2IA2 A;  2A5Y B;  1YW9 A;  3QU3 A;  3WTZ A;  4CIC A;  3V7R A;  3I58 A;  2DO7 A;  4N9H A;  1OR7 A;  5FFZ A;  4JK1 X;  4M6Y A;  2Z9O A;  5BPI A;  1USS A;  2DFI A;  1B59 A;  5DUI A;  1G3T A;  2HYG D;  2ISZ A;  1IXS B;  3V7C A;  4ENJ A;  4EM2 A;  3T8R A;  3GZ5 A;  2MLK A;  2EFW A;  5J8C A;  3J7A O;  2Y0M A;  3I59 B;  2GXB A;  5L3E A;  1SD7 A;  3WU1 B;  2O3F A;  2GZW A;  2RC4 A;  5FFX A;  1HSJ A;  4UVB A;  3M8E A;  4WXH A;  4Q4Z F;  2PFB A;  2P7C B;  1LQ1 A;  3ERE D;  4N9I A;  3ZMZ A;  4N0B A;  2GA2 A;  4G6D A;  2OA4 A;  2RDP A;  5HLI A;  2IP2 A;  2UXX A;  2FNA A;  2EJR A;  3V8K A;  1Z7U A;  3I64 A;  1HKT A;  5E1X A;  3BP8 A;  4ENK A;  1TW3 A;  4RGS A;  3RPU A;  2E7W A;  4U0Y A;  3GFJ A;  4I0A A;  4H0E A;  3WE3 A;  4GGG A;  5ILS A;  4Q5S F;  3ZMD A;  3E6B A;  1W7P D;  1ZGJ A;  4K2E A;  3WOD F;  3BJ6 A;  2DK8 A;  3F72 A;  1ZN2 A;  1CGP A;  2LF7 A;  1EH6 A;  4XLP F;  3J80 Z;  4Y17 A;  4ON0 A;  2K4J A;  2YR2 A;  2H27 A;  1S6L A;  1R36 A;  3RTR A;  3RKY A;  3KZY A;  4HF0 A;  2GQQ A;  4OOI A;  5ILV A;  2ISY A;  1D5V A;  3SZT A;  4A0X A;  4KA4 A;  3M9A A;  2FRH A;  1K7A A;  4Q48 A;  1U6G A;  5F6F A;  5L3G A;  5D5W B;  5E8I A;  2VOO A;  5CVJ A;  3ZMU A;  5D6E A;  1ZRD A;  4ZH4 F;  5DCM B;  1SMT A;  2HFH A;  5HVQ C;  3RJP A;  1KQ0 A;  1Z05 A;  2BV6 A;  1O3R A;  2KIF A;  1XSD A;  2PQ8 A;  4M6X A;  5DCF A;  5CVV A;  3PQK A;  1ZG5 A;  2F2E A;  1FNN A;  2M30 A;  3SFZ A;  4ESJ A;  1B6A A;  2RKH A;  1JXS A;  4RB3 C;  4P9U A;  4UV9 A;  3GZ6 A;  2P8T A;  5CJ9 A;  3SXY A;  2G9W A;  2P6S A;  1CF7 B;  2ZNY A;  2D1V A;  3K1M A;  3GWZ A;  3T0Y A;  3G73 A;  4AIJ A;  1RI7 A;  2VXZ A;  4ENM A;  1J75 A;  4WF2 A;  1LJ9 A;  1J7K A;  4BXU A;  2OZU A;  4EJU A;  4CHU A;  1RNL A;  4MEY F;  4I0B A;  1J2X A;  2R7D A;  2ZCW A;  2IJL A;  2YPR A;  1ZH5 A;  2HS5 A;  2UWM A;  1SFE A;  1DPR A;  1R5H A;  1LEA A;  1XCV A;  2M5W A;  2L02 A;  1S8N A;  3P7N A;  2V6C A;  5ICF A;  4BHC A;  1R58 A;  3VOD A;  3BPX A;  5JFR A;  1FP1 D;  3E97 A;  5L3F A;  2ESH A;  3IWF A;  1CF7 A;  4KDP A;  3QP5 A;  1SFU A;  2L01 A;  3K69 A;  3VOE A;  5L3B A;  3JSP A;  1MJ9 A;  4XBF A;  5BMZ A;  4RAZ A;  3V8L A;  2DPU A;  2KJC A;  2W24 A;  5FO5 A;  4P9F A;  2QWW A;  1FLI A;  5DCM A;  2PI0 A;  1Z6R A;  2FBH A;  1BN5 A;  2R3S A;  2EA4 A;  4HYE A;  3HOT A;  3BWG A;  4FT8 A;  1LDJ A;  1LDK B;  4CZZ A;  3KCC A;  1XSV A;  2OBP A;  3WGI A;  2O6G E;  2UXN A;  4EM0 B;  5DDG A;  4MTD A;  2A6E F;  3ABT A;  2L54 A;  2IRF G;  4UNO A;  2XAS A;  1B4A A;  2X4H A;  2VT2 A;  2ZJ2 A;  3U9G A;  3KP4 A;  1K78 B;  1DUX C;  1QGP A;  1TNT A;  4LMY A;  1SD6 A;  1AWC A;  1K79 A;  1D8K A;  1U5T C;  1FX7 A;  2K4B A;  4FHT A;  3KLN A;  4OIN F;  5H6R A;  3FMR A;  4MNU A;  3IC7 A;  5EEH A;  2BGC A;  5LEK A;  1DPU A;  5FD6 A;  2O03 A;  4KN7 X;  1FYL A;  3F8C A;  4MEX F;  4OIO F;  1ZLJ A;  1L0O C;  3TDZ C;  5F1R A;  1J0R A;  1HKS A;  2QVO A;  3Q9S A;  3O3K A;  1IUY A;  4EGY A;  3F6O A;  3ZMS A;  3PFI A;  1LDD A;  1H0M A;  1R1U A;  2MC3 A;  1T6S A;  4CO8 A;  2JSC A;  2BE5 F;  3WTT C;  4A0Y A;  3DEU A;  2B0L A;  3O6B B;  1WKM A;  3RKX A;  4HLX A;  1I1G A;  4OIR F;  2BBY A;  2P5L C;  3I59 A;  1P4W A;  2BEO A;  5D8K B;  4FX0 A;  1KU3 A;  2BYV E;  2XVC A;  3LFK A;  4ESF A;  4L5I A;  3V4G A;  5F64 A;  1E17 A;  4XSZ F;  2D2W A;  3TOB A;  4L0Y B;  2DQR A;  2RVC A;  1I5Z A;  1HBX G;  5DD8 A;  2Z3Y A;  3TOA A;  2HQN A;  2P6T A;  1W4M A;  3RPQ A;  3BDD A;  4EM1 A;  1RUO A;  1FYM A;  4ASN A;  1J9I A;  2VE9 A;  2XV4 S;  1XGO A;  2HWV A;  1YS6 A;  4A6E A;  3GF2 A;  4UXN A;  4O3M A;  3G3Z A;  2JRT A;  2FXA A;  2NRA C;  3IKT A;  2K7L A;  1SD4 A;  1STZ A;  4IF4 A;  2ADU A;  4R1H A;  2G7H A;  4EQQ A;  3F8M A;  2EA2 A;  4G6Q A;  2VOP A;  3SZP A;  3GX4 X;  3FXU A;  2RGV A;  4I7H A;  2HR3 A;  5K1Y A;  4OU0 A;  3QPT A;  1BI1 A;  5CVU A;  1UFM A;  2C6Y A;  3WE2 A;  3M8F A;  4WX9 A;  2JT1 A;  4HX4 A;  1OYY A;  4MQ9 F;  3EYI A;  5JR3 A;  5D6F A;  4LJZ F;  1S7O A;  3ML6 A;  1EV7 A;  2ZKZ A;  1FBQ A;  3KFW X;  3K0L A;  1T39 A;  3TO9 A;  2H94 A;  2H6B A;  2W57 A;  2PLY A;  5HDG A;  4LB6 B;  2P5K A;  2MBF A;  2X0L A;  3PQJ A;  2LKP A;  4HV6 A;  2FF4 A;  3Q5F A;  2MLG A;  2VBX A;  1T38 A;  1ZLK A;  2XHK A;  1E2X A;  1XN7 A;  5D4R A;  3FM3 A;  1GHC A;  3N4M A;  2R7F A;  3QOP A;  1U5T A;  4RS8 A;  4GYG A;  3V8J A;  4IJA A;  3RKW A;  3R0A A;  4BAY A;  2Q0O A;  2V1U A;  4HAM A;  5BPD A;  4EJW A;  4GO1 A;  2JZY A;  1XMA A;  3VB2 A;  4QWQ A;  4PGH A;  2NNY A;  4GYI A;  1GXQ A;  1MJA A;  5LBQ A;  5TJJ A;  1F4K A;  1UB9 A;  3SHF A;  1H9T A;  1RZ4 A;  1BC8 C;  5DD4 A;  3E3V A;  1MGT A;  3M1E A;  1PP8 F;  4HF2 A;  2CFX A;  3HSE A;  2CWE A;  2IT0 A;  1KU2 A;  4G94 A;  4LG0 A;  4NB5 A;  5JI6 A;  4LK1 F;  4PDK A;  1KYZ A;  4YIF A;  3CO7 C;  2XKO A;  1BJA A;  1YTY A;  5HS7 A;  2YX7 A;  4LB5 A;  4KMU X;  1G3W A;  1KU9 A;  3B02 A;  3GW2 A;  2NS0 A;  5KVR A;  3F8N A;  2HYF A;  3KEQ A;  4U7B A;  1IN5 A;  3ZN0 A;  3ZN1 A;  1JHF A;  3BJA A;  1K78 A;  4E70 A;  1OMI A;  2WTE A;  2LDU A;  1LB2 A;  3W6J B;  1UCR A;  1IXC A;  3HRM A;  2XUB A;  2A6H F;  4LK0 F;  1YG2 A;  3ZPL A;  4KT5 C;  2FU4 A;  4M73 A;  1BI2 A;  3HRT A;  3BPV A;  4MGR A;  2RQP A;  1BC7 C;  5HDK A;  1Z1D A;  4CGZ A;  1I1S A;  5D4S A;  2CGP A;  1D3Y A;  2NYX A;  3RDI A;  1TQM A;  1TNS A;  1HKQ A;  3HHH A;  3DPL C;  3E5Q A;  2P4W A;  2QQB A;  2QZ8 A;  4I2O A;  4JQF A;  3CTA A;  3FX3 A;  4EGZ A;  3JAM K;  2DPD A;  4O6J A;  4PGG A;  2PEX A;  3TO7 A;  1FY7 A;  3CUO A;  2F5F A;  4UUV A;  1ZG3 A;  1SFX A;  4Q47 A;  5ERI A;  4ZYD A;  2G7U A;  1ODD A;  1FT9 A;  3COA C;  4L9T A;  3FF5 A;  1ZAR A;  3KEO A;  1NHA A;  2OZ6 A;  1S3J A;  1TLH B;  3AAF A;  2KKO A;  1G4D A;  2XAJ A;  2IA1 A;  3NRV A;  1TW2 A;  2W85 A;  1XSX A;  5CVI A;  3IRQ A;  1Z91 A;  4ZZD A;  1OYW A;  2M45 A;  3S2W A;  3JW4 A;  3WTU C;  2CW0 F;  3LA2 A;  4I98 B;  3OOP A;  4KIG A;  4A2U A;  2EK5 A;  2OD5 A;  3I53 A;  5E18 F;  5LGN A;  3KP7 A;  2LNB A;  2PMU A;  2HOE A;  4XSX F;  1RUN A;  2VBY A;  5D5V B;  3DV8 A;  3P9I A;  1EH8 A;  2CO5 A;  3QAH A;  4L18 B;  3LQQ A;  1V3F A;  1W5T A;  1K6O A;  5J6X A;  3WGG A;  1MDM A;  2EV6 A;  1QBJ A;  3BZ6 A;  2RV8 A;  2V1D A;  2J5O A;  1XDU A;  4A0Z A;  1C0W A;  1IRG A;  1KQ9 A;  1W7P B;  4I09 A;  4CDG A;  2P7V B;  2MD5 A;  4IHS A;  2RN7 A;  2A07 F;  3DQV C;  5A2Q Z;  2V9V A;  1OYI A;  5FB2 A;  2QQA A;  4WXC A;  1R22 A;  3WGH A;  2GXG A;  3F23 A;  2W84 A;  1EH7 A;  2ZME B;  3KP3 A;  3WTY C;  3L09 A;  3F8F A;  4RB1 A;  2DW4 A;  2EV0 A;  1YIO A;  2XAF A;  4G9Y A;  5HOO A;  1FSE A;  1FP2 A;  2OU2 A;  3GFM A;  4EJO A;  4AVP A;  1SD5 A;  3F21 A;  2DT5 A;  4IHT A;  3NQO A;  1IN4 A;  3CUQ A;  2XRO A;  1R7J A;  4HDU A;  3RI4 A;  4KIF A;  2H6C A;  2F5D A;  3E6C C;  2O61 A;  2NAZ A;  5LRR A;  1Q1H A;  2DAO A;  2CSO A;  3I0T A;  4RAY A;  3F22 A;  1QO0 D;  1WSU A;  5HDN A;  3R6S A;  4LGW A;  3HRU A;  3GLX A;  5FLX K;  3FWE A;  4AD9 A;  3U2R A;  2WC2 A;  5D5X B;  1BI3 A;  2L3D A;  3MZY A;  5HS9 A;  5LHG A;  3WTX C;  3V7S A;  3ISP A;  4MTE A;  1ZRE A;  4RB2 C;  2OAZ A;  1XGM A;  1J5Y A;  1U8R A;  1UHW A;  2VON A;  1HQC A;  4AIH A;  1R00 A;  4HZF A;  4L9N A;  3IWZ A;  3J81 K;  4HA8 A;  2HGC A;  2P5V A;  1OKR A;  1IN6 A;  3KP6 A;  3HYI A;  3F8B A;  4UHT A;  4OIQ F;  1I6X A;  3BY6 A;  4A12 A;  4NQW A;  2ETH A;  3WU0 A;  1B9N A;  2XKP A;  3EDP A;  4S05 A;  1I27 A;  1R5G A;  3CO6 C;  2J5P A;  1G3Y A;  4WWC A;  4HF1 A;  1UHM A;  3O2P E;  1ZAO A;  4OIP F;  3ZP5 A;  2LF8 A;  4XLN F;  3GEZ A;  1FOK A;  2IVM A;  1L3L A;  1B1B A;  2HKX A;  3FMS A;  1W7P A;  5JHU A;  4P96 A;  1U2W A;  2FOK A;  4HDV A;  1P4A A;  3E6M A;  2A69 F;  1XD7 A;  4KN4 X;  2FBI A;  1DP7 P;  4FX4 A;  1T0F A;  4QLC U;  2EV5 A;  2K27 A;  3L9F A;  1RIO H;  3C1D A;  1B9M A;  1ZRC A;  1O3Q A;  2QBY B;  1QNT A;  4DQ2 A;  1Y0U A;  1R23 A;  2E1C A;  1MDM B;  4B8X A;  2CQK A;  4RGX A;  3F3X A;  2Z33 A;  4R79 A;  5KK1 A;  2YSR A;  1XGN A;  1ULY A;  4BH9 A;  4D0P A;  2STT A;  1FYK A;  2XAQ A;  3NEU A;  4KUM A;  2EFP A;  2MA3 A;  1YQA A;  4ZYG A;  4TV7 A;  4AIK A;  3KZZ A;  2XGX A;  3I4P A;  3MFK A;  1H9G A;  2L4A A;  3TDU C;  4LFU A;  3K9T A;  3MZH A;  1JE8 A;  2L4M A;  2HDC A;  3TO6 A;  4RGR A;  1HST A;  1PDN C;  3N97 A;  3FHZ A;  2ZNZ A;  1F1Z A;  1ONV A;  1FBU A;  1WI9 A;  4HOB A;  5E20 A;  1BBY A;  2DQL A;  3BJO A;  5ED4 A;  1YS7 A;  3HHG A;  2RNJ A;  3JSO A;  4G7O F;  4OMZ A;  3H3Z A;  2HKO A;  4YFN F;  2A3S A;  4HW0 A;  1HW1 A;  2DK5 A;  2K02 A;  1KGS A;  3LAJ A;  2FNP A;  1YLF A;  3R4K A;  5CYV A;  3WG9 A;  2WWY A;  1T98 A;  4M71 A;  4L9J A;  1SAX A;  1IW7 F;  1X3U A;  1XMK A;  4A5M A;  4U0W A;  1TQI A;  4RB0 A;  2FMY A;  2JPC A;  2V79 A;  4UVA A;  3BOQ A;  5DEQ A;  3TQN A;  1KA8 A;  1WWX A;  2ACJ A;  1T2K A;  1ON1 A;  3VEP A;  2WV0 A;  2KJB A;  2ESN A;  3MCZ A;  1XDS A;  2VE8 A;  1G3S A;  4IXA A;  4CXF A;  1REP C;  1IN7 A;  4EJT A;  4IPA A;  5FD5 A;  4GCV A;  2D1H A;  4G7H F;  4EVI A;  4ZYH A;  1YW7 A;  3HOS A;  5K5O A;  1QQI A;  3HSF A;  3ELK A;  4BHP A;  4L9V A;  2DI3 A;  2IW5 A;  5LRS A;  3FM5 A;  2Q2E A;  2EFQ A;  4ZZL A;  1YYV A;  4F7Z A;  2QUF A;  4UV8 A;  4JBA A;  5TRD A;  3T8T A;  3TGN A;  1PUE E;  5ICC A;  3BRO A;  2V1X A;  5AON A;  3ECO A;  3P9C A;  3TKY A;  1ZGA A;  2FQ3 A;  2CG4 A;  4PCQ A;  3CDH A;  4LG0 B;  1FC3 A;  4R8H A;  3GXO A;  4G8X A;  3QPH A;  1S7A A;  3FXR A;  4WCG A;  1ZHF A;  4Y13 A;  4Z2Y A;  4KIB A;  4HQE A;  1FZP B;  4WXD A;  2COM A;  1O7F A;  2YX4 A;  4I02 A;  3KP2 A;  4MHG A;  3P9K A;  3WTW C;  1A04 A;  2JTV A;  2UZK A;  5AIP A;  2A68 F;  3K2Z A;  5BQT A;  2VC1 A;  3R0J A;  3L2C A;  4A6D A;  4ETS A;  3ABU A;  3H3U A;  5IT3 A;  2DBB A;  2PG4 A;  4ESB A;  3IKV A;  5BS6 A;  5IT9 Z;  3SQN A;  3CUQ B;  3CLO A;  1ZRF A;  2FA5 A;  1ZG1 A;  4KNY A;  1F9N A;  5DUK A;  1VTN C;  1WQ2 A;  3EET A;  4DNC A;  1DDN A;  2ELH A;  1XB4 A;  3LAP A;  2FBK A;  5FLX Z;  3FXQ A;  4ENN A;  3ECH A;  2FEZ A;  5D8L B;  3CUQ C;  4MQV A;  2STW A;  2HEO A;  2QEN A;  1IRF A;  5AIQ A;  5H6Q A;  2ZME A;  3I5U A;  1R1V A;  4BQA A;  1U3E M;  3LST A;  2QM3 A;  4B09 A;  5LGU A;  4BNC A;  4U0V A;  4RGU A;  4S04 A;  4IRH A;  4YII A;  2CYY A;  3HSR A;  2VN2 A;  2A61 A;  2Z5U A;  1FSH A;  4HX7 A;  3T1B A;  3K1P A;  2NNN A;  1U78 A;  1PP7 U;  2PMH A;  2GA1 A;  5HLH A;  1HXD A;  2HTJ A;  2JPB A;  3MAJ A;  1D8J A;  1QPM A;  3D5L A;  4CYD A;  5BOX A;  2ZXJ A;  1BI0 A;  3GYH X;  3DKW A;  3R60 A;  3MWM A;  2VOD A;  5L3C A;  2EB7 A;  2M87 A;  4BHB A;  4U88 A;  2GAU A;  2OQG A;  3C3W A;  3GO5 A;  3ZMV A;  3REO A;  4GXO A;  1FWZ A;  4HV5 A;  3C18 A;  3MEX A;  1FPQ A;  2H09 A;  1KU7 A;  3FZV A;  3L00 A;  3EYY A;  1GVJ A;  5E1Z B;  1O57 A;  4LLG F;  2ZFW A;  2DTR A;  4ZYE A;  1ZYR F;  1QZZ A;  3J80 K;  3OV8 A;  2LSO A;  2IPQ X;  4HQM A;  1UST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...