3TQNA

Structure of the transcriptional regulator of the gntr family, from coxiella burnetii.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
107
Chain Sequence
MMRWDDKKPIYQQLRDKIVEAIIDGSYVEGEMIPSIRKISTEYQINPLTVSKAYQSLLDDNVIEKRRGLGMLVKAGARQRLLTQEKQYFLKKQWPQIKNKLERLGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transcription
molecule keywords Transcriptional regulator, GntR family
total genus 31
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tqnA01
5ILVA 3GFIA 1HKSA 3FMRA 3S2WA 2L3DA 3TDZC 1P6RA 2P5KA 3IKVA 3V7CA 3I54A 3M7GA 5BS6A 1PUEE 2RQPA 4I01A 2OU2A 2CG4A 3E5UA 5TRDA 1YW7A 3MWMA 2GIVA 1QBJA 2QWWA 2V1UA 1U5TC 3OV8A 1R58A 3FHZA 1TTYA 1HBXG 1A04A 4ENKA 5F64A 1KU3A 5FD6A 3FXRA 1O3TA 1S3JA 2PN6A 2HQNA 2VONA 2YR2A 2L54A 3WGGA 5IT9Z 2XUBA 1F9NA 5D5VB 5JI6A 3GX4X 1HKQA 1G3SA 4EJOA 1KU2A 1Z05A 4Y13A 3SQNA 4WWCA 4HX8A 1B9NA 3H3UA 3KP5A 2C6YA 1UB9A 2LF8A 5D6FA 3DPLC 3GW2A 1BI3A 2YSRA 3V7SA 5H6QA 3KP4A 4M73A 2GA1A 2D1HA 3GVAA 2XAJA 2E1CA 4RGUA 3SZTA 5D8KB 2V6CA 2OZUA 1ZHFA 1EH7A 2Z99A 1T6SA 1RUNA 4CYDA 1ZN2A 2JSCA 1K79A 2H27A 4LG0B 3COAC 1HW5A 2J5PA 2PQ8A 3PFIA 1CF7A 2CGPA 4K2EA 3KEQA 2F2EA 1SD4A 4G7ZF 4B09A 4BHCA 4CO8A 3R0JA 5FD5A 2IA1A 3ELKA 2XAHA 2E1NA 1DPRA 5CVJA 4KA4A 3LA3A 3M1EA 1J7KA 3MZHA 4EGZA 2PLYA 2VBZA 4BXUA 2EV6A 1I27A 1CF7B 3C1DA 4P9FA 1ZGAA 3VOEA 2HTJA 5A2QK 1ZLJA 2DLLA 3LAPA 4EJTA 2QYOA 2VN2A 1SAXA 1XN7A 3CUQA 3TOBA 2RKHA 1TW3A 2MLKA 3FX3A 4LGWA 2RC4A 4O3MA 1MDMA 2DU9A 3M8FA 1OMIA 2OD5A 4LK1F 3RTRA 5DD4A 4L0YB 1DUXC 1BJAA 2Q2EA 5HS9A 1ZG3A 3V4GA 1BI0A 5CVVA 3BPXA 4GXOA 3IC7A 2HGCA 1W4MA 4NHJA 4RGSA 3QU3A 2FE3A 5LHGA 4KMUX 5FFXA 4YFKF 2LDUA 2EV0A 4O6JA 4IHTA 2O3FA 4ASNA 1ULYA 2FMYA 2FSWA 3IWZA 4PGHA 2UXNA 5ICCA 1O3SA 4YIFA 1D8JA 2CFXA 5DUIA 2DI3A 4RB1A 3HSRA 1RIOH 1IUYA 2O6GE 2OBPA 4IRGA 2AS5F 4GGGA 2KJCA 4U7DA 5F6FA 2P5VA 4RGRA 2HS5A 3Q5FA 1XGNA 5LGUA 3IRRA 1XDSA 3ZMZA 2EFPA 2IRFG 3ISPA 1MDMB 4ENNA 2KIUA 1YFHA 2FRHA 2F5EA 3HYIA 5DDGA 1R1UA 3FWEA 5F1RA 1LEAA 2NS0A 1T39A 2X4HA 4G9YA 2M8EA 3F72A 3RPUA 2K4BA 1UHWA 4EM1A 1G3TA 4MEYF 4HYEA 4R79A 4M9XA 1HXDA 3GZ6A 1U3EM 1HW1A 1R36A 5LGTA 5L3EA 5ICEA 2XASA 3LAJA 4ZYEA 1UCRA 2A6HF 3ZP5A 2P5LC 4WK8F 4HF2A 4HQMA 5LHHA 3HHGA 1UFMA 1QZZA 4PGGA 3RKWA 3I59B 4S05A 3R0AA 1GVJA 3BWGA 4GYIA 2ZXJA 1IXSB 4EM0B 5BMZA 4L9JA 1K78B 2EA2A 4ZZLA 1F1ZA 4L0ZB 5D4RA 1K7AA 4A6EA 1JE8A 2RV8A 1IZ1A 4LB5A 4LFUA 1YTYA 1K78A 5CYVA 1F5TA 4BQAA 4KUMA 1P4AA 3RKXA 3C7JA 3FZVA 3CLOA 3VEPA 3I59A 2DFIA 3WU0A 3FMQA 4HLYA 5BQTA 2KIFA 3PQKA 1SMTA 5FGMA 4HV6A 5H6RA 4HW0A 4HOBA 1ZAOA 3F8FA 1I1SA 1H9TA 2E7WA 5FB2A 2ETHA 1YW9A 2DO7A 4KDPA 3D0SA 2RNJA 4Q5SF 2W25A 2V79A 4HZFA 2ZNZA 4U0YA 1J5YA 2OA4A 2VE9A 2QZ8A 3TQNA 2HYGD 3NQOA 4G8XA 3RJPA 1FWZA 1YQAA 4OIOF 2KJBA 4FX4A 3FXQA 4YIIA 2QLZA 5ILSA 1O57A 4EJVA 2ISZA 3BJ6A 5DCFA 2B0LA 5LRSA 1F4KA 1TNTA 2H6BA 1GXQA 3E6CC 3FMSA 3GYHX 3I58A 3I53A 4KIGA 1OYIA 3ML6A 2JPBA 2V1XA 1TBXA 1HKTA 1YYVA 4ESBA 4RAZA 1FPQA 2AXLA 3WTZA 1HSTA 2O61A 2P4WA 4DNCA 4Z2YA 2UWMA 2EK5A 1U78A 1BIAA 1MJ9A 3WTUC 3CUQB 4MHGA 3RPQA 5JVTA 2LSOA 3ABTA 3RYPA 1CGPA 2CSOA 4YG2F 1FT9A 1SD7A 2QVOA 1GHCA 3LA7A 1W5SA 4HAMA 4I98B 1U2WA 1KA8A 2NNNA 3KZZA 1LDKB 5LEJA 1IN6A 2EFNA 3MZYA 1OYYA 3ZMDA 2XKOA 1DPUA 3Q9SA 3K69A 3J7AO 3L9FA 1S7AA 5DEQA 4XBFA 1OPCA 5JFRA 2M87A 3QPHA 2P7CB 4LLNA 3HSFA 3JTGA 2VBWA 4G6QA 1YS7A 4IXAA 2Q0OA 1WI9A 2PFBA 5HDGA 3BZ6A 4KIBA 6PAXA 2BGCA 3KP3A 1FC3A 3HSEA 2A69F 2XKPA 1SD6A 1FSHA 4BNCA 1BBYA 3KP7A 3MFKA 4EJUA 2R3SA 1FOKA 3BP8A 5LLQA 3CUQC 3E97A 4LG0A 1L0OC 2E7XA 3HIFA 4MTDA 1S8NA 4I02A 3DV8A 4RB3C 1I6XA 3WE2A 1X3UA 1R1VA 4U0WA 1G3WA 2JT1A 1FP1D 1S29A 2WC2A 4PDKA 3I5UA 1R7JA 4WXDA 2RN7A 5L3BA 5CJ9A 1BIBA 2HOEA 5E20A 2M1BA 2L01A 5HVQC 4ESFA 1LQ1A 1SFUA 4A0XA 1ZG5A 4I0AA 1XGOA 4ETSA 3TOAA 4MQ9F 2NAZA 2BBYA 2IW5A 2MC3A 1TNSA 4WXHA 3O2PE 1L3LA 4UUVA 4HF0A 2A6EF 1ZLKA 3ZQ7A 2VOOA 4G7OF 4UXNA 5LBQA 1I1GA 3KP6A 4JBAA 5D5UB 2P7VB 1R5HA 4PZJA 4MQVA 4XSXF 3KFWX 3D5LA 1YG2A 2BV6A 5FFZA 4OMYA 2JPCA 3WTXC 5BPDA 4UVBA 4A2UA 1ZRFA 4KIFA 5CVIA 4AD9A 4WXCA 3CJNA 2PMUA 5DV5A 2IA2A 3DQVC 3F22A 1ZRDA 1I5ZA 2O03A 1Y0UA 2EWNA 4E70A 3EETA 2DPDA 3KETA 3KE2A 4BHBA 1MKMA 4L5IA 2OAZA 2IPQX 3IHUA 2W84A 4EQQA 4BYYA 3CO6C 3NRVA 1FYKA 1B9MA 1YO5C 3WGIA 1B59A 4AIHA 2VC1A 2DK8A 3OOPA 4CICA 2FBIA 2DK5A 1R1TA 3GXOA 3TDUC 4MEXF 5HDKA 5LRRA 3RIRA 3J80Z 4OOIA 2PEXA 2WWYA 1NHAA 4LMYA 1IW7F 1EH6A 1HSJA 1IRFA 2XHKA 4L9NA 4PCQA 4CGZA 1XSXA 2Y48A 3F8BA 2K02A 4N9HA 3BY6A 3IKTA 3K1MA 3B73A 5HS7A 2K86A 4I7HA 2PBIA 3T1BA 3VFZA 2PI0A 2HDCA 3HRSA 2L4MA 1OR7A 1FYMA 4LLGF 1TLHB 4M6XA 5TJJA 1XGMA 2G7HA 4Q4ZF 2HWVA 1FBUA 4L9VA 1OYWA 4A12A 1J75A 1IN4A 1R22A 4AIJA 1J59A 1USTA 5J8FA 5D8LB 3HRMA 1IN5A 4NQWA 2FNAA 1FY7A 2A68F 1IXCA 3IWFA 3CTAA 1LDJA 1Q1HA 2DT5A 2OQGA 3TO9A 2YX7A 3F8MA 5DD8A 1U6GA 3FXUA 2GXGA 1IF1A 5KVRA 2M45A 3ZN0A 1JHFA 2HYFA 5FLXK 5D5XB 1BC8C 2CQKA 2R7DA 4CZZA 3JAMZ 1DDNA 2Z5UA 5E8IA 2GXBA 3E6DA 1FBQA 4HA8A 1XCBA 2TDXA 3K1NA 3BROA 3H3ZA 4RGXA 1XSDA 4ZYHA 3JW4A 3LQQA 4LK0F 2D1VA 1IXRC 2ZFWA 3ECOA 3WGHA 4G94A 3GLXA 1OKRA 4UNOA 1JXSA 4Q47A 2Z9OA 5K1YA 1Z1DA 3HOTA 1XD7A 3HUGA 1SD5A 2XRNA 4EJWA 5IT3A 3U1DA 1D8KA 3DKWA 2DPUA 2Y0MA 2IA0A 3SXYA 3JTHA 3C3WA 4LD5A 5AIPA 1R00A 4F7ZA 4HF1A 4I2OA 4KYWA 1QPMA 3WODF 2RGVA 3E6MA 2GAUA 2P8TA 3JAMK 2ZMEA 5HLHA 5ICFA 2FEZA 4KICA 4KT5C 3E3VA 1FLIA 3E6BA 3L00A 3E5QA 4CXFA 4IPAA 1P2FA 2IT0A 2RVCA 3QPTA 2NRAC 4Q48A 3GWZA 5KK1A 2ESHA 2H09A 2HZTA 1BI2A 4UVCA 1ZRCA 1P4WA 3REOA 1V3FA 2J5OA 2STTA 2ZBKA 1KYZA 5ICGA 1ZH5A 1U8RA 3F8CA 5DYMA 1Z9CA 2ISYA 1HQCA 4G7HF 1K6OA 2JRTA 4A0YA 3G73A 1RI7A 5JR3A 1RZ4A 5L3GA 2XIGA 2K27A 4ENMA 4FX0A 1FX7A 1ZREA 4HDVA 3HHHA 2F5FA 4BH9A 1QO0D 2ADUA 2HKOA 2MA3A 4QLCU 3KLNA 3L2CA 4LLLA 3GFLA 3DXJF 2PJPA 1IAWA 2VOPA 2DW4A 3MCZA 1YW8A 4OIPF 3RI4A 2LKPA 1J9IA 1FBSA 3P9KA 1EH8A 5K5QA 4ENJA 1DP7P 2A3SA 3E5XA 1G6NA 1WWXA 2RDPA 1REPC 4CHUA 3RDIA 4HDUA 3U9GA 2DAOA 1XCVA 1GXPA 1HW2A 4QWQA 4MGRA 4Y17A 3F21A 2IJLA 3EYIA 4H0EA 4EV0A 2VC0A 2PMHA 4WX9A 1KQ9A 1ZGJA 4HBLA 3F6VA 3BJAA 4UV8A 3ZPLA 1XB4A 2DBBA 5EEHA 1EV7A 4GCVA 2L02A 1TW2A 2UZKA 3CO7C 2EV5A 1LNWA 3ZMVA 3BPVA 3Q9VA 1KQ0A 2O0YA 2QENA 4NB5A 3WU1B 4M9ZA 2COMA 3N97A 1MGTA 2NYXA 1ZG1A 3KLOA 2VE8A 4A5MA 3ROUA 3R61A 4LJZF 4AWXB 3EQLF 1FNNA 1R23A 4CDGA 4M71A 4TV7A 3O6BB 4IJAA 3IRQA 3RYRA 1VTNC 3FM3A 2QQ9A 3K2ZA 1E17A 2FF4A 2W85A 3F3XA 1MD0A 1ONVA 2H6CA 4YFNF 2KKOA 5L3FA 3EDPA 3CUOA 2ZKZA 4RAYA 4KN4X 1XGSA 2CO5A 4KMFA 3J81K 1ZYRF 3KEOA 2F5DA 1FZPB 1J2XA 1Z7UA 2EJRA 3QOPA 2DTRA 2FBKA 4UVAA 5AONA 2EFOA 2VT3A 2FXAA 2FOKA 1P4XA 4HX7A 4OINF 2FMLA 4O5VA 2ACJA 5ILUA 4RB0A 3EUHA 4HV5A 3B02A 3FF5A 2FNPA 3ZMSA 5LHIA 1FYLA 1KU9A 3IL2A 5FO5A 5E18F 1O7FA 4IF4A 1PP8F 3WE3A 3BOQA 1TQMA 3NEUA 1QZYA 5HLGA 3I64A 2Y75A 3T5XA 2D2WA 3HTSB 2P6SA 5E1WA 4YFXF 3K9TA 1WRJA 4A0ZA 1PDNC 1W5TA 2K7LA 2QM3A 2MLGA 2NNYA 2VXZA 1P92A 3ZMUA 2MH2A 1Z6TA 3QP5A 4ON0A 4EMSA 4XRFA 5HLIA 3MAJA 2GA2A 1Z6RA 5J6XA 4OMZA 3QRFF 2ESNA 3QU6A 5DCMB 2FA5A 1KQ8A 1MJBA 3HRTA 5J8CA 3LWFA 3ZN1A 3LA2A 1YS6A 2BEOA 2FU4A 1RNLA 2VT2A 2OQRA 2QBYB 2JZYA 3KZYA 4RS8A 4P9UA 2DQLA 3HTUA 2HKXA 3LQRA 5DCMA 5ED4A 4IVNA 1T0FA 1T38A 4MTEA 2EA4A 3K0LA 4JQFA 4U7BA 3R6SA 4M74A 2BE5F 3TO6A 3V8KA 4ZH4F 1H0MA 3V8JA 1H9GA 3J80K 2ZJ2A 5CVRA 3V7RA 3K1PA 5BPIA 2PG4A 4HLXA 4D0PA 4KFCA 1QQIA 4LB6B 4M9SA 2EB7A 2XROA 2VODA 3F23A 2Z33A 2H94A 4HQEA 1KGSA 5IT9K 4I09A 3SFZA 3BJOA 4OIRF 2HEOA 4ESJA 3ULQB 5H20A 2L4AA 1T98A 1USSA 2P6TA 1YIOA 3VODA 5D5WB 1RUOA 2STWA 2CW0F 4A5NA 3KP2A 4P96A 4U88A 4XLNF 3T0YA 1B1BA 4R1HA 5LEKA 2ZNYA 4BHPA 4FT8A 1WQ2A 1IN8A 3WTYC 2V9VA 3ECHA 3KCCA 1PP7U 4AVPA 3DF8A 5E1XA 1BOAA 1W7PD 4KN7X 2IP2A 2Q8KA 3T8RA 1TQPA 5EEGA 4FHTA 1B6AA 2O8XA 1LVAA 3LSTA 1MZBA 1E2XA 1D5VA 3ZMTA 1YLFA 3GEZA 3PQJA 2D45A 1UHMA 2M5WA 2OZ6A 4WCGA 3VB2A 3GO5A 4M72A 4GYGA 1FP2A 4R8HA 3WG9A 3LFKA 3RKYA 2W24A 5HDNA 2XVCA 2YX4A 3QP6A 3EYYA 4ZZDA 1ON2A 1ZARA 2FBHA 3WTWC 2EFWA 1JHHA 4EM2A 2MH9A 3DFGA 3MEXA 2CWEA 1BN5A 2G7UA 3BDDA 1S7OA 1C0WA 2K4JA 1WKMA 3TKYA 1ODDA 1XDUA 1O3QA 4OIQF 1SFEA 3GF2A 3C18A 2DQRA 1BM9A 1AWCA 3ERED 2KRFA 2ELHA 1LDDA 2GWRA 2XV4S 4KNYA 5CLSA 2UXXA 1U5TB 1IRGA 3GFMA 3I4PA 2A61A 4L5JA 1S6LA 3P7NA 2XAFA 1G4DA 3GFJA 2A07F 2GZWA 2WTEA 4EGYA 1U5TA 4IRIA 1TQIA 3J81Z 3H92A 1SMYF 2QQAA 3P9CA 1QNTA 3R60A 4XSZF 3CDHA 4XLPF 1LB2A 2GQQA 4ZYGA 2V1DA 1R5GA 1JGSA 3F8NA 2QUFA 2HR3A 2VBXA 5LGNA 1ON1A 2FQ3A 1W7PB 1D3YA 3GUDA 1MJAA 2QQBA 2X0LA 1LEBA 4DQ2A 5E8GA 1IN7A 1LJ9A 2XGXA 4Y15A 1AOYA 2HFHA 2Z3YA 4IRHA 2KIMA 3MQ0A 3L09A 2YU3A 2BYVE 2MD5A 4M6YA 5ERIA 3WTTC 4BAYA 2LNBA 3FM5A 4AIKA 3M8EA 1J0RA 4HX4A 4UV9A 3DPTA 1STZA 3AAFA 2MBFA 5E1ZB 3N4MA 3ABUA 1BC7C 2CYYA 3SHFA 1BI1A 1O7LA 3T8TA 1V4RA 5E17F 2JTVA 3HOSA 5D6EA 3QAHA 4P55A 1WSUA 5DUKA 5BOXA 3GZ5A 1W7PA 4I0BA 5A2QZ 3HRUA 1FSEA 5CVUA 3W6JB 1KYWA 4G6DA 3I0TA 2VBYA 4U0VA 1T2KA 2HTSA 2QBYA 1G3YA 3WTSC 3SZPA 3DEUA 5L3CA 2YPRA 1XSVA 3WTVC 4MNUA 4RB2C 1B4AA 1QGPA 4A6DA 2ZO4A 3I71A 5HS8A 3F6OA 2WV0A 5L3DA 2A5YB 2W57A 4P5OA 5K5RA 5D4SA 3TO7A 1XMAA 5HOOA 4ZYDA 5FLXZ 2XAGA 4L9TA 4IHSA 1Z91A 3G3ZA 3P9IA 5K5OA 2EFQA 4JK1X 4N9IA 4B8XA 4N0BA 4S04A 1O3RA 4GO1A 3JSOA 3TGNA 4EVIA 2LF7A 3DP7A 3JSPA 3O3KA 3U2RA 5JHUA 2G9WA 1SFXA 2HQRA 3L7WA 2ZMEB 3R4KA 2R7FA 1KU7A 4UHTA 5AIQA 2F5CA 2ZCWA 2IVMA 4WF2A 3V8LA 3M9AA 2M30A 2XAQA 1XMKA 4OU0A 3W6KB 4L18B
chains in the Genus database with same CATH superfamily
5ILVA 3GFIA 1HKSA 3FMRA 3H5NA 4IEJA 3S2WA 2L3DA 4CCOA 3TDZC 1P6RA 1X1PA 2P5KA 3D5RC 3IKVA 5FKMA 4E7LA 3V7CA 4PUSA 3I4MJ 4I99C 5FLVA 2VJ4A 3I54A 3M7GA 3MD2A 5BS6A 4E7JA 2HVRA 1PUEE 2RQPA 4I01A 2HXIA 2OU2A 1GV2A 2VUMJ 4CYCB 2CG4A 2WY8Q 3E5UA 5TRDA 1YW7A 1K6YA 3BC8A 5GP9A 1APLC 1Y6IA 3MWMA 2GIVA 2VKEA 4HNVA 1QBJA 4GFBA 2KIQA 2QWWA 2V1UA 1U5TC 3OV8A 3BR2A 4IQJA 4LOCA 1R58A 2V1NA 5EF6A 4AYBA 3FHZA 1TTYA 1OCOH 1BL0A 2O7OA 2H1LA 1HBXG 1A04A 3Q0UA 3TBIA 4ENKA 5F64A 1KU3A 5FD6A 4F93B 4UUSA 3FK6A 3FXRA 1O3TA 3ZQCA 4XLEA 1IDYA 3IH3A 5JVGF 1S3JA 2PN6A 2HQNA 1YI2I 4BQNA 2VONA 2YR2A 2L54A 3WGGA 5IT9Z 5J1UA 1E3OC 1NTCA 3I3LA 2EIKH 4KISA 2XUBA 2GBYA 2NOJB 1F9NA 4XL9A 5D5VB 2DA3A 2WADA 5JI6A 3GX4X 4DGWB 1HKQA 3SZGA 1G3SA 4EJOA 1KU2A 4N4OB 3K70D 1Z05A 1Y1WJ 4Y13A 3SQNA 4WWCA 2Q2EB 1W5CC 1TT5B 2HPMA 2DN0A 4HX8A 3HPGA 3VPRA 1B9NA 1WVRA 3ZXSA 4IZZA 3H3UA 2DMPA 2ELKA 3KP5A 2C6YA 4BACA 3OS0A 1UB9A 2LF8A 5EG0A 4AM3A 5D6FA 3OYJA 3DPLC 3GW2A 2QSHX 1BI3A 2YSRA 3V7SA 5H6QA 3KP4A 1D0YA 4M73A 2GA1A 3W3CA 2D1HA 4C3HJ 3BCBA 4I76A 1NK3P 1E3HA 3GVAA 2XAJA 4L5EA 3IAM2 4ZDPA 2E1CA 4RGUA 2VI6A 3SZTA 2LYCA 5D8KB 2IXSA 1DU6A 2V6CA 2OZUA 1ZHFA 1EH7A 2LTPA 2KL4A 2Z99A 4XOTA 3VYTB 1D0XA 1T6SA 2L9RA 3K10A 1RUNA 4CYDA 4AIDA 3RPUD 1ZN2A 3VWBA 4D9JA 3JRAA 2JSCA 1IO2A 2IS6A 1K79A 2R7OA 2H27A 4LG0B 2NS7A 3COAC 1HW5A 2J5PA 2PQ8A 3PFIA 2VQLA 1CF7A 2CGPA 3AL0B 4K2EA 3KEQA 2F2EA 2XPUA 1BW5A 3CP8A 5FKOA 3IH2A 1SD4A 1UMQA 2KISA 1HDDC 4G7ZF 3QPLA 4B09A 4A93J 4BHCA 4CO8A 2WY7Q 3R0JA 5FD5A 1VQKI 3H0DA 2F4MB 2IA1A 3ELKA 4A3EJ 2XAHA 2E1NA 1DPRA 4BDZA 5CVJA 4KA4A 1VQ7I 3LA3A 3M1EA 3O8HA 3K6GA 1J7KA 4ZC3A 3MZHA 3A0HC 4EGZA 2W48A 2LH9A 4XN3A 2MGQA 2PLYA 2VBZA 2DA5A 4BXUA 5EDNA 3CCMI 1I27A 2EV6A 5TGTA 1CF7B 3C1DA 4P9FA 1ZGAA 4Y3OA 2HTJA 3S32A 3VOEA 5A2QK 1ZLJA 3PIOF 3LSIA 1GUUA 4PJJA 2N8GA 1DP3A 2VKVA 4QPOA 1DGWY 1FTZA 2QSFX 2DLLA 1X1BA 3LAPA 2QYOA 2VN2A 3JR9A 3MMYB 2WB1A 2ZJRF 4EJTA 1SAXA 2E2HJ 1VQOI 1XN7A 3CUQA 3LSMA 3TOBA 2RKHA 2ZC2A 3M07A 1MBEA 3K4LA 2R5ZA 1TW3A 2MLKA 2E2IJ 1FMWA 3FX3A 3GMEA 4LGWA 3AL0C 2RC4A 4XM3A 2DOAA 4O3MA 1MDMA 2DU9A 3M8FA 4CH7A 1BR4A 4B3XA 1OMIA 2OD5A 2QEXI 4LK1F 4W97A 1ZQ3P 3RTRA 1ETOA 3S3OA 5DD4A 2M4GA 4L0YB 1DUXC 1BJAA 2Q2EA 5HS9A 3OYMA 1AKHB 1ZG3A 3V4GA 1BI0A 5CVVA 4F91B 4MFDA 3BPXA 4E7KA 3HDDA 2M34A 5EEAA 2MG4A 4GXOA 3IC7A 1SVOA 4UY8I 3Q3SA 2HGCA 5F0HA 2WAEA 2M3AA 1A31A 1W4MA 4NHJA 2AXTC 4RGSA 3OOUA 1K4TA 2ECBA 3QU3A 2R7QA 1JJ6C 1X4PA 4RM3A 2LP0A 2HVSA 2FE3A 1NG7A 1V54H 4M3FA 3BLYA 5LHGA 4KMUX 5FFXA 3ASOH 4NNJA 4YFKF 1ZELA 2LDUA 1A35A 4IHYA 4IL6C 2EV0A 4O6JA 1JUPA 4IHTA 2O3FA 1IJWC 4V19K 4ASNA 1ULYA 2FMYA 3VYRB 3PL8A 4LG3A 2FSWA 3IWZA 1Q1VA 4PGHA 3W2AA 2UXNA 4CCLA 4IHWA 5ICCA 2EIMH 3CCQI 1O3SA 4YIFA 1O4XA 1D8JA 2CFXA 5DUIA 2DI3A 4RB1A 3HSRA 1RIOH 3BR5A 1IUYA 2O6GE 1SAUA 4D5CA 2OBPA 4IRGA 2AS5F 4F55A 4GGGA 2E60A 3W2WA 2KJCA 4U7DA 3RZOJ 2KPMA 5F6FA 4XKVA 2P5VA 4RGRA 4AYBN 2X51A 4BY1J 4FE7A 2HS5A 2ID3A 3Q5FA 3D5SC 4XKCA 1T95A 1XGNA 5LGUA 2DFEA 3IRRA 4M6VA 2R92J 2DT7B 1XDSA 3CJTB 3ZMZA 2WAQN 2IGKA 2EFPA 3G1MA 2IRFG 3ISPA 2VJIA 1IRZA 3MKYB 4AU7A 1MDMB 4PSWA 4ENNA 2BXYA 2CRGA 1HDPA 3CMAI 4Z6YA 2KIUA 1YFHA 1WCMJ 2BY2A 4I6ZA 2EQRA 2FRHA 3JCUC 2F5EA 3HYIA 5DDGA 1R1UA 3GTLJ 4KT6A 3FWEA 5F1RA 1V5GA 2K5CA 1LEAA 2M2EA 5KCMA 4E7ZA 2NS0A 1T39A 2X4HA 4G9YA 2M8EA 3F72A 1Y8RB 1B72A 3RPUA 2ZMEC 2K4BA 1PYVA 1UHWA 1Z0XA 4EM1A 3J7AY 2ZSHB 3WHBA 1G3TA 4MEYF 4HYEA 4R79A 3A03A 2NXNB 4M9XA 1HXDA 3GZ6A 4RBOA 1U3EM 1D0ZA 1HW1A 1OQYA 3PNYA 1R36A 2BXZA 4GRIA 2BVLA 3FISA 5LGTA 2LD5A 5L3EA 2ME0A 5ICEA 4CYCA 2VPLA 2XASA 3LAJA 4ZYEA 1UCRA 2A6HF 3L2RA 3ZP5A 2Z2SB 2P5LC 2KP6A 3LSKA 2X6YA 4WK8F 4HF2A 4RMNA 4HQMA 2OPTA 3P5JA 5LHHA 3HHGA 2LG4A 2PJRB 1UFMA 1QZZA 4PGGA 3RKWA 3H9QA 3I59B 4S05A 3R0AA 1R6RA 3L2QA 1GVJA 2DDAA 3BWGA 3BQYA 4GYIA 2ZXJA 2VL8A 1IXSB 4EM0B 3PSIA 3NARA 5BMZA 4L9JA 1K78B 2EA2A 4XRSG 4ZZLA 1F1ZA 2AQEA 1XS9A 4L0ZB 3MVPA 3K4MA 1D1CA 2K9LA 4BJ5C 5D4RA 1K7AA 4A6EA 1BJZA 1OLTA 2V9KA 2YUSA 2RV8A 2VLAA 1JE8A 2RQQA 1IZ1A 1RKWA 1IC8A 4XR6A 4LB5A 1WZ2A 4LFUA 1YTYA 1K78A 5CYVA 1SANA 1F5TA 4KUMA 1P4AA 3RKXA 4BQAA 3M4OJ 5HNFA 1F43A 3IUOA 3C7JA 3FZVA 4HPQA 3CLOA 3HKZA 2IGNA 3VEPA 3S2HJ 1I50J 3I59A 2HOTA 2DFIA 3WU0A 3FMQA 5C4JJ 4HLYA 1EA3A 3FHNA 2KIFA 4Y4RA 2M4KA 5BQTA 1CQTA 3PQKA 1SMTA 5FGMA 3OYHA 2BHYA 4HV6A 5H6RA 4HW0A 1QVUA 4HOBA 4M3DA 1YJNI 1FJLA 1ZAOA 3K4KA 3F8FA 1BA5A 1MNDA 1I1SA 1H9TA 3H9JA 2E7WA 5FB2A 2ETHA 4C3JJ 4YRVA 1X1DA 1YW9A 2DO7A 4KDPA 3OYFA 3D0SA 2CFOA 2RNJA 3OIQA 1ENHA 2X6OA 3CMEI 3S1RJ 2W25A 4Q5SF 2V79A 1UG2A 4HZFA 1LVKA 1QRYA 2ZNZA 3OYAA 1BW6A 1J5YA 3OL4A 4KJZA 2OA4A 4XQFA 5KHDA 5J1YA 5EG0B 4U0YA 1JKRC 2VE9A 5IYDJ 1N77A 2QZ8A 2E1OA 3TQNA 2HYGD 3NQOA 1BR1A 2VIXA 4G8XA 3RJPA 1FWZA 2XPVA 2EH3A 1YQAA 5EYRA 2HQAA 4OIOF 3OR2C 2KJBA 5JHFA 4FX4A 2A05A 1K4SA 3FXQA 1LE8A 4YIIA 1P7IA 2XGCA 3FIWA 2QLZA 3RZDJ 5ILSA 1O57A 3LNQA 2B7EA 4EJVA 2JA5J 2ISZA 1ZR4A 3BJ6A 5JLWA 5DCFA 3RQIA 2B0LA 5LRSA 1F4KA 3KX2A 5EJCA 1TNTA 2XSJC 3DLLF 2H6BA 3HEFA 3PFYA 5E3MA 1GXQA 3E6CC 4CCNA 3FMSA 3C2GA 2X1DA 3I58A 3GYHX 3GTMJ 1FOWA 4C3IJ 3LSHA 2I10A 2OTLI 3I53A 4KIGA 2R7RA 2Y0SA 1OYIA 1KZHA 3ML6A 2JPBA 2V1XA 3DKXA 1TBXA 3CC2I 2KDZA 1RC9A 1HKTA 1T0FC 1YYVA 4ESBA 1JKOC 4RAZA 1FPQA 2AXLA 5IYCJ 2EBIA 2EZHA 3WTZA 2LY1A 2JUCA 1HSTA 2O61A 2VB6A 9ANTA 2P4WA 4DNCA 4Z2YA 2UWMA 2VJ5A 2EK5A 1U78A 3BR3A 1BIAA 1MJ9A 3WTUC 3CUQB 3KYCB 4MHGA 5IOZA 3CCEI 1TC3C 3RPQA 1MIJA 5JVTA 2LSOA 1LFPA 3ABTA 2DA1A 3RYPA 1CGPA 2CSOA 3PIPF 1FOXA 4YG2F 3G2BA 2M8GX 3U21A 5EZHA 1FT9A 1SD7A 2QVOA 3CZ6A 1PUFB 2OJED 1GHCA 3J7YJ 5CQEA 4XLFA 3LA7A 2IAIA 1W5SA 1JKPC 1Y56A 1FIPA 2K9QA 3QODA 4HAMA 3ZQHA 1WJFA 3CQZJ 4I98B 1R4NB 4IQ4A 2Y2ZA 5FKKA 3WU2C 1FIAA 1U2WA 3Q0WA 1KA8A 1TWGJ 2NNNA 3KZZA 1Y39A 3TP0A 1X4OA 1LDKB 5LEJA 1IN6A 2EZKA 2EFNA 3MZYA 1HLVA 4H4KC 1OYYA 3ZMDA 2XKOA 1ETQA 1GLNA 1DPUA 2DYSH 3BG5A 3K69A 3Q9SA 3J7AO 2PMZN 3QPSA 3L9FA 1S7AA 5DEQA 4XBFA 1OPCA 5JFRA 2M87A 3QPHA 2P7CB 1MBJA 4LLNA 3HSFA 5HLTA 3AFHA 3JTGA 2VBWA 2GIZA 1GVDA 3S1NJ 3DU6A 4G6QA 2CJJA 3OYGA 4CZCA 1YS7A 4IXAA 2E5NA 3W6VA 4XKWA 1TT0A 2Q0OA 1WI9A 1Z21A 2PFBA 5HDGA 3BZ6A 2ICWG 2KZVA 1SFOJ 2ZJPF 4KIBA 6PAXA 3F9KA 2BGCA 4D1QA 1Y0NA 3H5RA 3KP3A 1FC3A 4P1WA 3HSEA 3Q0VA 4XKBA 1D5YA 2L0KA 4PJ0C 4RDUA 2A69F 3RKQA 1VQPI 3W2VA 3OSGA 2XKPA 4BBSJ 4D7NA 3BTIA 1JT0A 1SD6A 4MIMA 1FSHA 3HOXJ 4BNCA 1BBYA 3KP7A 3HZJA 3MFKA 4EJUA 2R3SA 5GTHC 1FOKA 3CCSI 3BP8A 5LLQA 3WG7H 3LMMA 3CUQC 3E97A 1LUJB 2TCTA 3BTJA 4LG0A 4FCYA 3S1MJ 4B44A 1L0OC 2E7XA 3HIFA 2R5YB 4MTDA 1S8NA 4I02A 4HNTA 3DV8A 4RB3C 1I6XA 1G2HA 3WE2A 1X3UA 1R1VA 3QYEA 4A69C 1JT6A 1VF9A 3PM1A 4U0WA 1G3WA 2CUFA 2CQ7A 3H9GA 2JT1A 1FP1D 2LKXA 1S29A 2WC2A 2Y30A 4PDKA 4PJNA 5BNGA 1YHQI 3I5UA 1R7JA 4WXDA 2RN7A 5L3BA 2LLKA 5CJ9A 4DZJA 1U9OA 3K70C 3RCOA 5IP6A 1BIBA 1M1EB 2HOEA 5E20A 4LIUA 2M1BA 2L01A 5HVQC 4ESFA 2DA6A 3LSPA 1LQ1A 1SFUA 1YOVB 4A0XA 2R7XA 1ZG5A 3LOCA 3I9V2 3ONQA 2XPWA 1GV5A 4I0AA 4OWRB 1XGOA 3BT9A 4ETSA 3TOAA 4MQ9F 2DT6A 2NAZA 2BBYA 2IW5A 2MC3A 1TNSA 4FETA 3O2PE 4WXHA 1L3LA 2VASA 4UUVA 4D5FA 4HF0A 2A6EF 1ZLKA 3CDLA 1JKQC 3ZQ7A 2VOOA 2DJIA 4G7OF 3BR1A 4A3DJ 4UXNA 2VPRA 5LBQA 1I1GA 3KP6A 4JBAA 3ABMH 5D5UB 2P7VB 1R5HA 3N05A 4PZJA 5FLMJ 4MQVA 4XSXF 3KFWX 2XDVA 1UELB 3D5LA 1YG2A 2BV6A 2DJNA 5FFZA 2DMUA 5B5EC 4OMYA 2Y69H 2JPCA 4EATA 4CUGA 3WTXC 4EEFG 5BPDA 2CQQA 2L7MP 4MLOA 1IUFA 2L2OA 3KZIC 4UVBA 4FTHA 3GTOJ 4A2UA 2O5RA 2HVQA 3OMYA 1TWFJ 2E1MC 2XC7A 1YITI 1ZRFA 4KIFA 4FE4A 5CVIA 4AD9A 4WXCA 3OS2A 3CJNA 1OCCH 2PMUA 2QKLB 3BTLA 3SEQA 5DV5A 3H0GJ 2BOLA 2QKMB 2IA2A 4BE2A 3DQVC 4DIQA 2M7AA 1VI0A 3F22A 4XOPA 1W0TA 1ZRDA 1I5ZA 1MSEC 2O03A 1Y0UA 1MMDA 4BEHA 2KRHA 1MBKA 2EWNA 4E70A 1QU3A 4HG2A 1MW7A 2ZSIB 3EETA 3MKWB 2DPDA 2NVYJ 2R7UA 3KETA 5J3LA 3KE2A 4BHBA 1MKMA 4L5IA 2OAZA 2IPQX 3IHUA 2W84A 4X1EA 3SFIA 5B66C 5J4YA 4EQQA 1TWCJ 5H2FC 3PJRA 3E0JB 3VSLA 2CV2A 3GZNB 2B63J 4BYYA 2F4IA 3NRVA 3CO6C 4BL0B 1FYKA 5GADJ 3TEDA 4ZTJA 2VXDA 2BHZA 1B9MA 3QWLA 1YO5C 3DBRB 3WGIA 1B59A 4AIHA 2VC1A 2DK8A 3OOPA 3S1QJ 4CICA 1B8IB 1QVTA 2FBIA 2DK5A 1R1TA 3GXOA 3L2UA 3TDUC 2OUMA 5E3NA 1IDZA 4MEXF 3OYNA 5HDKA 5LRRA 3KYDB 1WJCA 3RIRA 3S93A 3J80Z 4OOIA 4B48A 2D5VA 2PEXA 2WWYA 2DFFA 1NHAA 4LMYA 1IW7F 5FROA 1R9TJ 1EH6A 2CH0A 4HRIA 3EUHC 1HSJA 1IRFA 5FKLA 2XHKA 1VQMI 5F04A 4L9NA 3M3YJ 1VQ4I 1TP4A 4PCQA 4PJMA 1XPXA 4CGZA 2EPFA 1VQLI 1X1AA 3AG1H 1XSXA 5EGOA 2Y48A 3F8BA 4OAZA 4IO9F 3NAUA 1IV6A 2HQ5A 2K02A 4N9HA 3BY6A 3IKTA 4IOAF 2CMPA 4KITB 3K1MA 4XRMA 3SJMA 3B73A 5HS7A 2XAUA 4LIVA 2K86A 4I7HA 1OCTC 2PBIA 3T1BA 2ZB9A 4S0HB 2F4OB 3VFZA 1G8XA 2PI0A 2HDCA 3HRSA 2L4MA 1POGA 1AKHA 1OR7A 1WJBA 1FYMA 1SC7A 2V9PA 5GPCA 2FQ4A 4LLGF 1TLHB 4M6XA 5TJJA 3CCRI 1XGMA 2G7HA 2IGMA 4Q4ZF 2HWVA 1FBUA 4L9VA 1UAAA 1OYWA 4MO7A 4A3CJ 4A12A 3HOVJ 1FEXA 1Z3YA 1J75A 1J09A 1IN4A 1R22A 2BZTA 2F48A 4AIJA 1J59A 1WGXA 2L7ZA 1USTA 5J8FA 5D8LB 2GLOA 3HRMA 1XC5A 1IN5A 4NQWA 2FNAA 5K7FA 4C2MJ 3A02A 4FISA 1FY7A 2A68F 1IXCA 2NVQJ 3IWFA 3CTAA 1LDJA 1W0UA 3HG9A 1Q1HA 2DT5A 5M3FJ 1MMNA 1AHDP 2OQGA 1XX5A 3TO9A 2YX7A 2QF7A 3F8MA 5DD8A 1U6GA 4A3BJ 3FXUA 2GXGA 1XTAA 3OIOA 1IF1A 5KVRA 2M45A 3ZN0A 3FK7A 3PUFA 1JHFA 2HYFA 5FLXK 5D5XB 1BC8C 2CQKA 2FOWA 4UB6C 2NVTJ 2R7DA 4BUPA 4BQOA 4M3EA 3HGYA 3UR3C 1OR7C 2MD0A 4CZZA 2PMZA 4DYRA 3JAMZ 1DDNA 5DS9A 2Z5UA 5E8IA 2GXBA 1ETVA 3ZR8X 2CS3A 1X3ZB 2LREA 4BEHB 4GDFA 2W82A 3E6DA 1FBQA 3NWTA 1XCBA 4HA8A 2TDXA 4X6AJ 4RLFA 2DA7A 1S72I 4A3MJ 3K1NA 3BROA 3H3ZA 3UNGC 1VZ0A 4RGXA 1XSDA 4ZYHA 3JW4A 4NC6A 3LQQA 4LK0F 2A6TA 2G0EA 3MKLA 2D1VA 3ASNH 1IXRC 2ZFWA 4XNFA 2LMDA 2AQFA 1ETXA 1ZTRA 3ECOA 3WGHA 1T8IA 1WJ5A 2CUJA 4G94A 2E35A 1X2NA 2HDDA 4B43A 5EGOB 3ERMA 4NC7A 3GLXA 1OKRA 4UNOA 1JXSA 2JK3A 4Q47A 2Z9OA 2IS4A 5K1YA 1Z1DA 2ZXWH 1PUFA 4AC0A 4XRSA 1IRXA 3HOTA 4XONA 1XD7A 3DKYA 3HUGA 5B3SH 1SD5A 2XRNA 4EJWA 5IT3A 1E0EA 3U1DA 2ELJA 1Z3XA 1D8KA 3K7AJ 3DKWA 2DPUA 1VQ8I 2GM4A 2Y0MA 2IA0A 3SXYA 3JTHA 3C3WA 4LD5A 1A6QA 5AIPA 2MC4A 3B6CA 1MSFC 1R00A 4UB8C 4F7ZA 3OL3A 2QCOA 3LSJA 1FTTA 3TP3A 4HF1A 3OIPA 4I2OA 1QPMA 3WODF 4KYWA 2DA4A 2RGVA 5KAIC 5C44J 3E6MA 3TL4X 2GAUA 2P8TA 3JAMK 2ZMEA 5HLHA 5ICFA 2FEZA 4KICA 3HOWJ 4KT5C 2K9MA 3E7LA 3JRCA 2CV0A 4YELA 4C2UA 3PO2J 3E3VA 3S16J 2W7NA 4DJAA 1H8AC 1FLIA 4E7IA 1U9NA 3E6BA 2BVMA 2IBDA 2ID6A 2BY1A 3L00A 3HL2A 3E5QA 4A3LJ 4CXFA 3OYKA 3IV5A 2Z16A 4IPAA 4E7HA 1P2FA 2XB0X 2IT0A 2QSGX 3GTPJ 2R5ZB 2RVCA 3QPTA 2NRAC 2Y0SN 4Q48A 3GWZA 5KK1A 2ESHA 2H09A 2HZTA 1BI2A 4UVCA 1LE8B 1ZRCA 3RQ4A 1WH5A 4B4CA 2VQHA 1N25A 1P4WA 3REOA 4M3BA 1V3FA 2J5OA 3CESA 2STTA 3G6EI 1SVMA 2ZBKA 1KYZA 5ICGA 3JRBA 1ZH5A 1U8RA 3F8CA 5DYMA 2M7BA 4DZPA 1Z9CA 2ISYA 2LY2A 1HQCA 5HNHA 2DMQA 4G7HF 1K6OA 4F92B 2EILH 2XF7A 2JRTA 3EPZA 4A0YA 3G73A 1RI7A 5JR3A 1RZ4A 4PSXA 1YJWI 2HI3A 2WV1A 5L3GA 1MNMC 3PUBA 2QA4I 4A3IJ 2MFZA 2X85A 2XIGA 2K27A 4IKFA 1R71A 4ENMA 4FX0A 4C30A 4Y33A 1FX7A 4ABZA 1ZREA 3VYSB 4HDVA 1N75A 1JUMA 2XRLA 3HHHA 2F5FA 1WI3A 4BH9A 2DXIA 2GXAA 3S3NA 1QO0D 2HOAA 3L1PA 1T56A 2ADUA 2HKOA 2MA3A 2JJ7A 2LKSA 4ITVA 4QLCU 2LK2A 3KLNA 3L2CA 4LLLA 2LVSA 3OY9A 3GFLA 3DXJF 2PJPA 4J01A 5IY5H 1IAWA 1I39A 2VOPA 1FOYA 1V5EA 4V2FA 4RAFA 2DW4A 3I56I 1EJ9A 3CD6I 1ZR2A 3MCZA 1MBHA 1YW8A 4OIPF 2W4SA 4AUXA 3RI4A 5F08A 2LKPA 3JRHA 1J9IA 1FBSA 2E71A 2LBFA 3P9KA 2K40A 1AA7A 3S2DJ 1ZK8A 1EH8A 5JLXA 5K5QA 2WB1N 4ENJA 3GCMA 1DP7P 3FDYA 2A3SA 3E5XA 1G6NA 1WWXA 2RDPA 1REPC 4CHUA 1TWAJ 3HOYJ 1A5JA 3RDIA 1XG1A 4HDUA 4CCMA 3U9GA 2DAOA 1XCVA 1GXPA 5M3MJ 2MSYA 2WBMA 4A3KJ 1HW2A 2WAQA 4QWQA 3CJQB 4MGRA 4Y17A 3F21A 2IJLA 1QA6A 4XIDA 3EYIA 4H0EA 4EV0A 3L2VA 2MABA 2VC0A 2PMHA 1B72B 4WX9A 1KQ9A 2BW3B 2YU9J 1ZGJA 4HBLA 5CKTA 5IP7J 1VQ9I 3F6VA 5FRMA 1HA8A 2QQ8A 2Z1DA 2KLOA 5F0FA 3BJAA 1WJAA 4UV8A 4NUBA 5J40A 1XB4A 2E5ZA 3ZPLA 1VQ6I 3VDXA 3G71I 2M0CA 2DBBA 1X58A 1LFBA 5EEHA 3OSFA 1EV7A 2BW3A 2PX9A 4GCVA 2L02A 2DOFA 1RKTA 3OYEA 1TW2A 2BY3A 3BTCA 1T33A 3HC7A 4HEA2 2UZKA 4JX5A 3CO7C 2EV5A 3KYLA 1LNWA 3HGGA 2H8WA 3HPHA 3G4SI 1YX5A 3ZMVA 3BPVA 3Q9VA 2R7WA 1KQ0A 2O0YA 1LFUP 2QENA 3A1YA 4E4HA 4NB5A 3WU1B 1T08B 2KHMA 4M9ZA 2NS8A 2COMA 2FJ1A 3N97A 1MGTA 2NYXA 3BG6A 2KMUA 1ZG1A 3KLOA 2VE8A 1EKEA 2LFBA 4A5MA 1IGNA 3ROUA 3R61A 1Y8QB 4LJZF 3LSRA 3GTJJ 2HYJA 4AWXB 3KEYA 3EQLF 1FNNA 1R23A 4CDGA 1OJLA 2DDBA 4M71A 1W1WE 4TV7A 3O6BB 4IJAA 3IRQA 3RYRA 1VTNC 5KAFC 3FM3A 4DW6A 2DOEA 1WH7A 2O9LA 3RSNA 2DYRH 1OCZH 3TW6A 2QQ9A 1G59A 3K2ZA 1E17A 1HOMA 2FF4A 2W85A 3F3XA 1MD0A 1ONVA 1W36C 2H6CA 1NH3A 1NK2P 4YFNF 3LL7A 1GT0C 4XICA 2KKOA 5L3FA 3OYDA 3EDPA 3ABLH 3CUOA 1I3AA 3BZCA 2ZKZA 4RAYA 4JX4A 4KN4X 1XGSA 2A5WA 2HU9A 2GOMA 2CO5A 2CQNA 2B9SA 2K85A 2H1KA 1UHSA 4XMYA 4KMFA 3J81K 2VKDA 1ZYRF 3KEOA 1RR8C 2RREA 2F5DA 5CQGA 3FXLA 2KFDA 1FZPB 2KRCA 1YIJI 2HZDA 1J2XA 1Z7UA 3DWLE 1QHHD 2EJRA 3QOPA 2DTRA 2OCCH 2FBKA 3BG9A 4UVAA 5AONA 2EFOA 1OCPA 3K4BA 1RPWA 2VT3A 1X3WB 2FXAA 1MMSA 2FOKA 1P4XA 4HX7A 3PNTA 4OINF 2FMLA 3M8JA 1MH4A 5DM6F 1LPQA 2Q1ZB 4O5VA 3UKGA 2GOXB 1JI8A 2ACJA 2MYSA 3HOZJ 3QQAA 3G1LA 4BBRJ 3DEWA 1WJDA 5GAGJ 5ILUA 4XN0A 1HCRA 3ZOBA 2HXOA 4RB0A 3EUHA 4RA2A 1RETA 5DM7F 4HV5A 3B02A 2MW8A 3BCAA 3FF5A 5IPAA 2FNPA 4JP0A 2EZIA 3ZMSA 5LHIA 2K3FA 4ZDLA 1FYLA 3JREA 2FD5A 1KU9A 2DFHA 2CU7A 2NVXJ 4BQQA 3WHCA 2JVGA 2ECCA 4HSRA 5FO5A 5E18F 2NVUB 1O7FA 3IL2A 4IF4A 3KIOA 1ZGWA 1PP8F 1K83J 3WE3A 3BQZA 3BOQA 1YJ9I 1QZEA 1R49A 1TQMA 1ZKGA 3NEUA 3S14J 5GPAA 3BZKA 1QZYA 1SFKA 5HLGA 3I64A 2IEKA 2Y75A 3T5XA 1X1CA 3A01A 2R7SA 2X1EA 4B3AA 2D2WA 1H88C 3HTSB 2P6SA 5E1WA 4YFXF 3K9TA 1WRJA 4A0ZA 1P9QC 1PDNC 3ZQIA 1PVEA 2O8KA 3S15J 2P81A 3JRIA 3A2KA 3FKIJ 4YEJA 3CCYA 4NQWB 1W5TA 2K7LA 4F3QA 3HUGB 4J19A 2QM3A 2MLGA 1ETWA 1R5ID 2NNYA 2R7TA 2VXZA 1OISA 3FXKA 5KNLA 3HJEA 4BE1A 1P92A 1PJRA 3ZMUA 2MH2A 2COBA 1Z6TA 3QP5A 1RRJA 4ON0A 4EMSA 4G6TB 4XRFA 5HLIA 3MAJA 2GA2A 1RESA 1Z6RA 5J6XA 4OMZA 3BG7A 3JRGA 4XORA 3QRFF 2ESNA 3QU6A 5DCMB 3CJRB 2TRTA 1EF4A 2HNHA 2L5QA 3LSGA 2FA5A 1KQ8A 1TL8A 1MJBA 3HRTA 4DYQA 5J8CA 3LWFA 5FJ8J 3H5AA 2K9SA 2E36A 3CDIA 5J1RA 3ZN1A 1NG6A 4CSWA 3LA2A 2AHQA 1YS6A 2BEOA 4OAYA 2XB5A 2FU4A 1RNLA 2VT2A 4U87A 2PJRA 2OQRA 5IOYA 2QBYB 3AKZA 2ZXIA 2JA6J 1DU0A 2JZYA 3GTGJ 3KZYA 4RS8A 4P9UA 2DQLA 3HTUA 2HKXA 3LQRA 2OC6A 5DCMA 1P7JA 5ED4A 4IVNA 4BDYA 4IHVA 1T0FA 1SEUA 1T38A 5B1AH 4MTEA 2EA4A 1X2MA 3K0LA 4JQFA 3HKZN 4N4NB 3R6SA 4U7BA 4M74A 2BE5F 2R7VA 3TO6A 3V8KA 4ZH4F 4BU2A 2LOOA 5E79C 1YRNB 2DMTA 1H0MA 3V8JA 1H9GA 2FX0A 3V42A 5M5YJ 3J80K 1VFCA 2ZJ2A 5CVRA 3H35A 1JJ8C 1Y1VJ 5C4XJ 3V7RA 3K1PA 2CW7A 3GLLA 5BPIA 1S7EA 3FBIB 3DU5A 2PG4A 5LD2C 1K61A 4HLXA 4D0PA 4KFCA 1A6IA 3ZGKA 1QQIA 4FQGA 4LB6B 2F6CA 2R4GA 4NC8A 4M9SA 2EB7A 5K7HA 2JA2A 2XROA 4UUSB 2VODA 3FXJA 2L7FP 1YX3A 2LRDA 3JRDA 3F23A 1HC8A 2HPIA 2Z33A 2H94A 4HQEA 1KGSA 5IT9K 4I09A 3SFZA 3BJOA 3GTKJ 3NWSA 3A01B 4OIRF 2HDWA 3ZCOA 2HEOA 1E3PA 3K4NA 4DYCA 1AU7A 4MFEA 3DBHB 4ESJA 3M1CA 3ULQB 2I8DA 5H20A 1KONA 2L4AA 2CV1A 1SVLA 1T98A 2E1MB 1USSA 2P6TA 1YIOA 3VODA 5D5WB 1RUOA 4LITA 2STWA 2CW0F 4A5NA 3KP2A 4P96A 4U88A 3BR0A 3OWTA 3PNVA 4NDLA 5F27A 4XLNF 3T0YA 1OCRH 1B1BA 3U1KA 4R1HA 5LEKA 4QPQA 2ZNYA 4BHPA 4X0GA 1DQUA 4FT8A 1WQ2A 1IN8A 2EZLA 2CW8A 2V7FA 3WTYC 2V9VA 1FMVA 2HOSA 3ECHA 3KCCA 1PP7U 3L2WA 1JTYA 4AVPA 2R5YA 3DF8A 5E1XA 1BOAA 3ZQFA 1I3QJ 3VSKA 2OCEA 1W7PD 4KN7X 1Z7LA 3CC7I 2IP2A 5GAEJ 2Q8KA 4NBQA 3T8RA 1TQPA 5EEGA 4QSHA 1UG0A 4FHTA 1B6AA 2JUGA 2O8XA 1LVAA 3LSTA 3CC4I 3GTQJ 3ESWB 4E7SA 1MZBA 3HM5A 3G1OA 1E2XA 1D5VA 1U8BA 1YRNA 3ZMTA 1YLFA 5GAHJ 3GEZA 3PQJA 4DBRA 3CP2A 2R93J 1X19A 4CCJA 1V55H 1TZLA 2D45A 3DTIA 1UHMA 3A0BC 2M5WA 4CA0A 4B1RA 2OZ6A 5E3LA 4A3FJ 2JRMA 4WCGA 1WJEA 2WA0A 3D1NI 1MBGA 1H89C 3VB2A 1B8IA 3GO5A 4M72A 4GYGA 2JMWA 5C3EJ 2ZXHA 5E3OA 2JA8J 1FP2A 4ZJZA 4R8HA 3SEZA 3WG9A 5K7ZA 3QOEA 1XMXA 3LFKA 3RKYA 3H1CA 2EIJH 2W24A 5HDNA 2KT0A 2XVCA 4HNUA 2YX4A 3HBLA 5GTIC 3QP6A 3EYYA 4ZZDA 1ON2A 1ZARA 3CCUI 2FBHA 2JVHA 2NOGA 4ANJA 2LR8A 2ZJQF 2VQCA 3WTWC 3C2BA 2EFWA 4JYKA 1JHHA 4XK4A 1QPIA 4EM2A 4B47A 2MH9A 1R4MB 3DFGA 3MEXA 3EUKL 2CWEA 3FXMA 2Y9ZA 1BN5A 2G7UA 3BDDA 1S7OA 1JTXA 1TWHJ 1C0WA 4G12A 2K4JA 1WKMA 3TKYA 1ODDA 1XDUA 1O3QA 4OIQF 1SFEA 3GF2A 3C18A 2DQRA 4RAGA 1BM9A 2E19A 2VJJA 4BS9A 3ERED 1AWCA 1S9HA 2KRFA 2ELHA 3MKZA 3QYBA 1LDDA 3OYCA 3CF5F 4PK4A 3HB9A 3ABKH 2GWRA 2XV4S 4KNYA 5CLSA 3ZQGA 2UXXA 1U5TB 1LKXA 1IRGA 1WPKA 3GFMA 2A61A 2UUZA 3I4PA 3MN2A 2H8RA 1MBFA 2E2JJ 1JGGA 3VYUB 4L5JA 1S6LA 1MMGA 3P7NA 2XAFA 2KDOA 1G4DA 3GFJA 2A07F 2GZWA 2WTEA 4EGYA 1U5TA 3OYBA 4IRIA 3IH4A 1TQIA 4IHXA 3J81Z 3H92A 1SMYF 4BJ6C 2IGOA 2QQAA 3P9CA 5FKNA 1QNTA 3R60A 1RR7A 2K3PA 3QYFA 3CLQA 4XSZF 4Y52J 3CDHA 4XLPF 1LB2A 2GQQA 3S3MA 4QIWN 4IOCF 2RNGA 3OYIA 4ZYGA 2V1DA 3F8NA 1R5GA 1JGSA 1DGRM 4XLHA 3MZ8A 1BR2A 2QUFA 3HOUJ 3BG3A 4IX7A 2HR3A 2VBXA 2XGEA 5LGNA 2V6EA 1ON1A 2DCEA 2FQ3A 1W7PB 1D3YA 3GUDA 1WHUA 1VQNI 1MJAA 2QQBA 3H3VK 4A3GJ 2X0LA 2LBFB 1MNEA 2M9HA 1LEBA 3K2AA 3IAS2 2CUEA 4M3GA 4DQ2A 5E8GA 2L9VA 3HXLA 2CQXA 1IN7A 1V5FA 1LJ9A 1ETYA 3KPHA 2XGXA 2YS9A 4Y15A 1AOYA 4BY7J 2HFHA 2Z3YA 4BGDA 4IRHA 4QTRA 1MMAA 2KIMA 3MQ0A 1OFCX 3DCFA 2YU3A 3L09A 2BYVE 2MD5A 1N78A 3CCJI 4M6YA 4BKXA 2Y9YA 5ERIA 2E34A 2ME6A 3SDGA 4XLCA 2K9NA 3WTTC 4BAYA 3GBGA 3CMYA 2LNBA 2VQGA 4DBQA 2KQRA 4RLQA 3FM5A 4AIKA 3M8EA 1J0RA 2V26A 4PFPA 4HX4A 4UV9A 3OYLA 4C9YA 3DPTA 1STZA 2DMNA 3BR6A 5LFAA 3AAFA 2MBFA 1Z67A 5E1ZB 3DTKA 3O8GA 2LC2A 3AG3H 3ABUA 3N4MA 1BC7C 1D1AA 2CYYA 3SHFA 5F1JA 4UUTA 1BI1A 1O7LA 3T8TA 1V4RA 3FBNB 5M5XJ 5E17F 3FXOA 2DA2A 2JTVA 3HOSA 5D6EA 3QAHA 4ZYAA 4P55A 4D7MA 1F36A 5TISC 1D1BA 2F5VA 1WSUA 5IP9J 2L9SA 2UV1A 3IP4B 5DUKA 1A36A 3DEEA 4Y7NJ 5M5WJ 5BOXA 3GZ5A 1W7PA 2JWTA 2XF5A 4I0BA 3EUAA 1I6HJ 3ZRGA 5A2QZ 3HRUA 4II2A 2W1OA 4ZDOA 1FSEA 5CVUA 2OV7A 3AG2H 1KYWA 3W6JB 4G6DA 5IYBJ 2VKHA 2LY9A 3I0TA 3CCVI 2I5UA 2VBYA 4U0VA 5CPRB 4YIRX 1T2KA 3K4CA 4E6KG 3F0CA 2X9DA 2HTSA 2QBYA 3OS1A 1G3YA 2V4JC 3WTSC 1BOBA 2X6XA 4FASD 2ZFUA 3SZPA 3DEUA 5L3CA 3DTEA 3J7ZI 4ZTFA 2JN6A 2IS2A 2XSDC 4HSTA 3PSFA 5HODA 2Y31A 2YPRA 1XSVA 3A4CA 3OR1C 3WTVC 4MNUA 4RB2C 3TW7A 2IS1A 4XLAA 2R0QC 3FKJA 1B4AA 3DBLB 3TMOA 1QGPA 4A6DA 2W00A 2X1CA 2ZO4A 1MH3A 1JUSA 2R7ZJ 1ORKA 3E1SA 1HF0A 3I71A 5HS8A 2RAEA 5DTDA 3F6OA 3CF2A 2WV0A 3B6AA 5L3DA 1GDTA 2A5YB 2W57A 2DODA 1ACIA 3K4JA 4P5OA 3S8PA 5D4SA 5K5RA 3TO7A 1XMAA 4RM2A 2XGDA 4A3JJ 4AVZA 5HOOA 4ZYDA 1UZCA 5FLXZ 2M0MA 2XAGA 3DPUA 3H36A 4L9TA 2JQ7A 4BE0A 4IHSA 1Z91A 5EZGA 4JX6A 4PFOA 4CCKA 3G3ZA 3P9IA 5F0CA 2X48A 5K5OA 2KZGA 2EFQA 2L9NA 4JK1X 3DLAA 4N9IA 4V2GA 2AO9A 2QGUA 4B8XA 4N0BA 4C2TA 4S04A 5B1BH 1O3RA 2JA7J 3I4NJ 3S17J 4GO1A 4BXFA 1VQ5I 3JSOA 3JRFA 1IG7A 3CMMA 1WFXA 3TGNA 4EVIA 2LF7A 3DP7A 2L7KA 3JSPA 2X6WA 1U0JA 3LFUA 1UJ8A 3O3KA 3U2RA 3C2HA 2BY0A 2P0WA 1ITYA 4II3A 4F52A 3CCLI 4W1UA 5J4VA 5JHUA 2OF7A 1S5LC 1W36D 1QHGA 2G9WA 4BJTA 1SFXA 2HQRA 3L7WA 2EINH 2ZMEB 2DTZA 3ZQLA 3PO3J 3R4KA 2R7FA 1KU7A 1Z77A 4UHTA 1YE9A 3ZQQA 1ERDA 5AIQA 2WAFA 2F5CA 2CUZA 2ZCWA 2IVMA 4DOZA 4WF2A 3I55I 2OTJI 3V8LA 2JSPA 4JOMA 4PJLA 3M9AA 5J47A 2M30A 2XAQA 5FRNA 4BXXJ 1IV8A 2XF6A 1XMKA 3AG4H 4OU0A 1VNDA 1ETKA 3X2QH 2FUG2 3W6KB 3SYTA 3SDBA 4L18B 4J00A
chains in the Genus database with same CATH topology
5ILVA 3GFIA 1HKSA 3FMRA 3S2WA 2L3DA 3TDZC 1P6RA 2P5KA 3IKVA 3V7CA 3I54A 3M7GA 5BS6A 1PUEE 2RQPA 4I01A 2OU2A 2CG4A 3E5UA 5TRDA 1YW7A 3MWMA 2GIVA 1QBJA 2QWWA 2V1UA 1U5TC 3OV8A 1R58A 3FHZA 1TTYA 1HBXG 1A04A 4ENKA 5F64A 1KU3A 5FD6A 3FXRA 1O3TA 1S3JA 2PN6A 2HQNA 2VONA 2YR2A 2L54A 3WGGA 5IT9Z 2XUBA 1F9NA 5D5VB 5JI6A 3GX4X 1HKQA 1G3SA 4EJOA 1KU2A 1Z05A 4Y13A 3SQNA 4WWCA 4HX8A 1B9NA 3H3UA 3KP5A 2C6YA 1UB9A 2LF8A 5D6FA 3DPLC 3GW2A 1BI3A 2YSRA 3V7SA 5H6QA 3KP4A 4M73A 2GA1A 2D1HA 3GVAA 2XAJA 2E1CA 4RGUA 3SZTA 5D8KB 2V6CA 2OZUA 1ZHFA 1EH7A 2Z99A 1T6SA 1RUNA 4CYDA 1ZN2A 2JSCA 1K79A 2H27A 4LG0B 3COAC 1HW5A 2J5PA 2PQ8A 3PFIA 1CF7A 2CGPA 4K2EA 3KEQA 2F2EA 1SD4A 4G7ZF 4B09A 4BHCA 4CO8A 3R0JA 5FD5A 2IA1A 3ELKA 2XAHA 2E1NA 1DPRA 5CVJA 4KA4A 3LA3A 3M1EA 1J7KA 3MZHA 4EGZA 2PLYA 2VBZA 4BXUA 2EV6A 1I27A 1CF7B 3C1DA 4P9FA 1ZGAA 3VOEA 2HTJA 5A2QK 1ZLJA 2DLLA 3LAPA 4EJTA 2QYOA 2VN2A 1SAXA 1XN7A 3CUQA 3TOBA 2RKHA 1TW3A 2MLKA 3FX3A 4LGWA 2RC4A 4O3MA 1MDMA 2DU9A 3M8FA 1OMIA 2OD5A 4LK1F 3RTRA 5DD4A 4L0YB 1DUXC 1BJAA 2Q2EA 5HS9A 1ZG3A 3V4GA 1BI0A 5CVVA 3BPXA 4GXOA 3IC7A 2HGCA 1W4MA 4NHJA 4RGSA 3QU3A 2FE3A 5LHGA 4KMUX 5FFXA 4YFKF 2LDUA 2EV0A 4O6JA 4IHTA 2O3FA 4ASNA 1ULYA 2FMYA 2FSWA 3IWZA 4PGHA 2UXNA 5ICCA 1O3SA 4YIFA 1D8JA 2CFXA 5DUIA 2DI3A 4RB1A 3HSRA 1RIOH 1IUYA 2O6GE 2OBPA 4IRGA 2AS5F 4GGGA 2KJCA 4U7DA 5F6FA 2P5VA 4RGRA 2HS5A 3Q5FA 1XGNA 5LGUA 3IRRA 1XDSA 3ZMZA 2EFPA 2IRFG 3ISPA 1MDMB 4ENNA 2KIUA 1YFHA 2FRHA 2F5EA 3HYIA 5DDGA 1R1UA 3FWEA 5F1RA 1LEAA 2NS0A 1T39A 2X4HA 4G9YA 2M8EA 3F72A 3RPUA 2K4BA 1UHWA 4EM1A 1G3TA 4MEYF 4HYEA 4R79A 4M9XA 1HXDA 3GZ6A 1U3EM 1HW1A 1R36A 5LGTA 5L3EA 5ICEA 2XASA 3LAJA 4ZYEA 1UCRA 2A6HF 3ZP5A 2P5LC 4WK8F 4HF2A 4HQMA 5LHHA 3HHGA 1UFMA 1QZZA 4PGGA 3RKWA 3I59B 4S05A 3R0AA 1GVJA 3BWGA 4GYIA 2ZXJA 1IXSB 4EM0B 5BMZA 4L9JA 1K78B 2EA2A 4ZZLA 1F1ZA 4L0ZB 5D4RA 1K7AA 4A6EA 1JE8A 2RV8A 1IZ1A 4LB5A 4LFUA 1YTYA 1K78A 5CYVA 1F5TA 4BQAA 4KUMA 1P4AA 3RKXA 3C7JA 3FZVA 3CLOA 3VEPA 3I59A 2DFIA 3WU0A 3FMQA 4HLYA 5BQTA 2KIFA 3PQKA 1SMTA 5FGMA 4HV6A 5H6RA 4HW0A 4HOBA 1ZAOA 3F8FA 1I1SA 1H9TA 2E7WA 5FB2A 2ETHA 1YW9A 2DO7A 4KDPA 3D0SA 2RNJA 4Q5SF 2W25A 2V79A 4HZFA 2ZNZA 4U0YA 1J5YA 2OA4A 2VE9A 2QZ8A 3TQNA 2HYGD 3NQOA 4G8XA 3RJPA 1FWZA 1YQAA 4OIOF 2KJBA 4FX4A 3FXQA 4YIIA 2QLZA 5ILSA 1O57A 4EJVA 2ISZA 3BJ6A 5DCFA 2B0LA 5LRSA 1F4KA 1TNTA 2H6BA 1GXQA 3E6CC 3FMSA 3GYHX 3I58A 3I53A 4KIGA 1OYIA 3ML6A 2JPBA 2V1XA 1TBXA 1HKTA 1YYVA 4ESBA 4RAZA 1FPQA 2AXLA 3WTZA 1HSTA 2O61A 2P4WA 4DNCA 4Z2YA 2UWMA 2EK5A 1U78A 1BIAA 1MJ9A 3WTUC 3CUQB 4MHGA 3RPQA 5JVTA 2LSOA 3ABTA 3RYPA 1CGPA 2CSOA 4YG2F 1FT9A 1SD7A 2QVOA 1GHCA 3LA7A 1W5SA 4HAMA 4I98B 1U2WA 1KA8A 2NNNA 3KZZA 1LDKB 5LEJA 1IN6A 2EFNA 3MZYA 1OYYA 3ZMDA 2XKOA 1DPUA 3Q9SA 3K69A 3J7AO 3L9FA 1S7AA 5DEQA 4XBFA 1OPCA 5JFRA 2M87A 3QPHA 2P7CB 4LLNA 3HSFA 3JTGA 2VBWA 4G6QA 1YS7A 4IXAA 2Q0OA 1WI9A 2PFBA 5HDGA 3BZ6A 4KIBA 6PAXA 2BGCA 3KP3A 1FC3A 3HSEA 2A69F 2XKPA 1SD6A 1FSHA 4BNCA 1BBYA 3KP7A 3MFKA 4EJUA 2R3SA 1FOKA 3BP8A 5LLQA 3CUQC 3E97A 4LG0A 1L0OC 2E7XA 3HIFA 4MTDA 1S8NA 4I02A 3DV8A 4RB3C 1I6XA 3WE2A 1X3UA 1R1VA 4U0WA 1G3WA 2JT1A 1FP1D 1S29A 2WC2A 4PDKA 3I5UA 1R7JA 4WXDA 2RN7A 5L3BA 5CJ9A 1BIBA 2HOEA 5E20A 2M1BA 2L01A 5HVQC 4ESFA 1LQ1A 1SFUA 4A0XA 1ZG5A 4I0AA 1XGOA 4ETSA 3TOAA 4MQ9F 2NAZA 2BBYA 2IW5A 2MC3A 1TNSA 4WXHA 3O2PE 1L3LA 4UUVA 4HF0A 2A6EF 1ZLKA 3ZQ7A 2VOOA 4G7OF 4UXNA 5LBQA 1I1GA 3KP6A 4JBAA 5D5UB 2P7VB 1R5HA 4PZJA 4MQVA 4XSXF 3KFWX 3D5LA 1YG2A 2BV6A 5FFZA 4OMYA 2JPCA 3WTXC 5BPDA 4UVBA 4A2UA 1ZRFA 4KIFA 5CVIA 4AD9A 4WXCA 3CJNA 2PMUA 5DV5A 2IA2A 3DQVC 3F22A 1ZRDA 1I5ZA 2O03A 1Y0UA 2EWNA 4E70A 3EETA 2DPDA 3KETA 3KE2A 4BHBA 1MKMA 4L5IA 2OAZA 2IPQX 3IHUA 2W84A 4EQQA 4BYYA 3CO6C 3NRVA 1FYKA 1B9MA 1YO5C 3WGIA 1B59A 4AIHA 2VC1A 2DK8A 3OOPA 4CICA 2FBIA 2DK5A 1R1TA 3GXOA 3TDUC 4MEXF 5HDKA 5LRRA 3RIRA 3J80Z 4OOIA 2PEXA 2WWYA 1NHAA 4LMYA 1IW7F 1EH6A 1HSJA 1IRFA 2XHKA 4L9NA 4PCQA 4CGZA 1XSXA 2Y48A 3F8BA 2K02A 4N9HA 3BY6A 3IKTA 3K1MA 3B73A 5HS7A 2K86A 4I7HA 2PBIA 3T1BA 3VFZA 2PI0A 2HDCA 3HRSA 2L4MA 1OR7A 1FYMA 4LLGF 1TLHB 4M6XA 5TJJA 1XGMA 2G7HA 4Q4ZF 2HWVA 1FBUA 4L9VA 1OYWA 4A12A 1J75A 1IN4A 1R22A 4AIJA 1J59A 1USTA 5J8FA 5D8LB 3HRMA 1IN5A 4NQWA 2FNAA 1FY7A 2A68F 1IXCA 3IWFA 3CTAA 1LDJA 1Q1HA 2DT5A 2OQGA 3TO9A 2YX7A 3F8MA 5DD8A 1U6GA 3FXUA 2GXGA 1IF1A 5KVRA 2M45A 3ZN0A 1JHFA 2HYFA 5FLXK 5D5XB 1BC8C 2CQKA 2R7DA 4CZZA 3JAMZ 1DDNA 2Z5UA 5E8IA 2GXBA 3E6DA 1FBQA 4HA8A 1XCBA 2TDXA 3K1NA 3BROA 3H3ZA 4RGXA 1XSDA 4ZYHA 3JW4A 3LQQA 4LK0F 2D1VA 1IXRC 2ZFWA 3ECOA 3WGHA 4G94A 3GLXA 1OKRA 4UNOA 1JXSA 4Q47A 2Z9OA 5K1YA 1Z1DA 3HOTA 1XD7A 3HUGA 1SD5A 2XRNA 4EJWA 5IT3A 3U1DA 1D8KA 3DKWA 2DPUA 2Y0MA 2IA0A 3SXYA 3JTHA 3C3WA 4LD5A 5AIPA 1R00A 4F7ZA 4HF1A 4I2OA 4KYWA 1QPMA 3WODF 2RGVA 3E6MA 2GAUA 2P8TA 3JAMK 2ZMEA 5HLHA 5ICFA 2FEZA 4KICA 4KT5C 3E3VA 1FLIA 3E6BA 3L00A 3E5QA 4CXFA 4IPAA 1P2FA 2IT0A 2RVCA 3QPTA 2NRAC 4Q48A 3GWZA 5KK1A 2ESHA 2H09A 2HZTA 1BI2A 4UVCA 1ZRCA 1P4WA 3REOA 1V3FA 2J5OA 2STTA 2ZBKA 1KYZA 5ICGA 1ZH5A 1U8RA 3F8CA 5DYMA 1Z9CA 2ISYA 1HQCA 4G7HF 1K6OA 2JRTA 4A0YA 3G73A 1RI7A 5JR3A 1RZ4A 5L3GA 2XIGA 2K27A 4ENMA 4FX0A 1FX7A 1ZREA 4HDVA 3HHHA 2F5FA 4BH9A 1QO0D 2ADUA 2HKOA 2MA3A 4QLCU 3KLNA 3L2CA 4LLLA 3GFLA 3DXJF 2PJPA 1IAWA 2VOPA 2DW4A 3MCZA 1YW8A 4OIPF 3RI4A 2LKPA 1J9IA 1FBSA 3P9KA 1EH8A 5K5QA 4ENJA 1DP7P 2A3SA 3E5XA 1G6NA 1WWXA 2RDPA 1REPC 4CHUA 3RDIA 4HDUA 3U9GA 2DAOA 1XCVA 1GXPA 1HW2A 4QWQA 4MGRA 4Y17A 3F21A 2IJLA 3EYIA 4H0EA 4EV0A 2VC0A 2PMHA 4WX9A 1KQ9A 1ZGJA 4HBLA 3F6VA 3BJAA 4UV8A 3ZPLA 1XB4A 2DBBA 5EEHA 1EV7A 4GCVA 2L02A 1TW2A 2UZKA 3CO7C 2EV5A 1LNWA 3ZMVA 3BPVA 3Q9VA 1KQ0A 2O0YA 2QENA 4NB5A 3WU1B 4M9ZA 2COMA 3N97A 1MGTA 2NYXA 1ZG1A 3KLOA 2VE8A 4A5MA 3ROUA 3R61A 4LJZF 4AWXB 3EQLF 1FNNA 1R23A 4CDGA 4M71A 4TV7A 3O6BB 4IJAA 3IRQA 3RYRA 1VTNC 3FM3A 2QQ9A 3K2ZA 1E17A 2FF4A 2W85A 3F3XA 1MD0A 1ONVA 2H6CA 4YFNF 2KKOA 5L3FA 3EDPA 3CUOA 2ZKZA 4RAYA 4KN4X 1XGSA 2CO5A 4KMFA 3J81K 1ZYRF 3KEOA 2F5DA 1FZPB 1J2XA 1Z7UA 2EJRA 3QOPA 2DTRA 2FBKA 4UVAA 5AONA 2EFOA 2VT3A 2FXAA 2FOKA 1P4XA 4HX7A 4OINF 2FMLA 4O5VA 2ACJA 5ILUA 4RB0A 3EUHA 4HV5A 3B02A 3FF5A 2FNPA 3ZMSA 5LHIA 1FYLA 1KU9A 3IL2A 5FO5A 5E18F 1O7FA 4IF4A 1PP8F 3WE3A 3BOQA 1TQMA 3NEUA 1QZYA 5HLGA 3I64A 2Y75A 3T5XA 2D2WA 3HTSB 2P6SA 5E1WA 4YFXF 3K9TA 1WRJA 4A0ZA 1PDNC 1W5TA 2K7LA 2QM3A 2MLGA 2NNYA 2VXZA 1P92A 3ZMUA 2MH2A 1Z6TA 3QP5A 4ON0A 4EMSA 4XRFA 5HLIA 3MAJA 2GA2A 1Z6RA 5J6XA 4OMZA 3QRFF 2ESNA 3QU6A 5DCMB 2FA5A 1KQ8A 1MJBA 3HRTA 5J8CA 3LWFA 3ZN1A 3LA2A 1YS6A 2BEOA 2FU4A 1RNLA 2VT2A 2OQRA 2QBYB 2JZYA 3KZYA 4RS8A 4P9UA 2DQLA 3HTUA 2HKXA 3LQRA 5DCMA 5ED4A 4IVNA 1T0FA 1T38A 4MTEA 2EA4A 3K0LA 4JQFA 4U7BA 3R6SA 4M74A 2BE5F 3TO6A 3V8KA 4ZH4F 1H0MA 3V8JA 1H9GA 3J80K 2ZJ2A 5CVRA 3V7RA 3K1PA 5BPIA 2PG4A 4HLXA 4D0PA 4KFCA 1QQIA 4LB6B 4M9SA 2EB7A 2XROA 2VODA 3F23A 2Z33A 2H94A 4HQEA 1KGSA 5IT9K 4I09A 3SFZA 3BJOA 4OIRF 2HEOA 4ESJA 3ULQB 5H20A 2L4AA 1T98A 1USSA 2P6TA 1YIOA 3VODA 5D5WB 1RUOA 2STWA 2CW0F 4A5NA 3KP2A 4P96A 4U88A 4XLNF 3T0YA 1B1BA 4R1HA 5LEKA 2ZNYA 4BHPA 4FT8A 1WQ2A 1IN8A 3WTYC 2V9VA 3ECHA 3KCCA 1PP7U 4AVPA 3DF8A 5E1XA 1BOAA 1W7PD 4KN7X 2IP2A 2Q8KA 3T8RA 1TQPA 5EEGA 4FHTA 1B6AA 2O8XA 1LVAA 3LSTA 1MZBA 1E2XA 1D5VA 3ZMTA 1YLFA 3GEZA 3PQJA 2D45A 1UHMA 2M5WA 2OZ6A 4WCGA 3VB2A 3GO5A 4M72A 4GYGA 1FP2A 4R8HA 3WG9A 3LFKA 3RKYA 2W24A 5HDNA 2XVCA 2YX4A 3QP6A 3EYYA 4ZZDA 1ON2A 1ZARA 2FBHA 3WTWC 2EFWA 1JHHA 4EM2A 2MH9A 3DFGA 3MEXA 2CWEA 1BN5A 2G7UA 3BDDA 1S7OA 1C0WA 2K4JA 1WKMA 3TKYA 1ODDA 1XDUA 1O3QA 4OIQF 1SFEA 3GF2A 3C18A 2DQRA 1BM9A 1AWCA 3ERED 2KRFA 2ELHA 1LDDA 2GWRA 2XV4S 4KNYA 5CLSA 2UXXA 1U5TB 1IRGA 3GFMA 3I4PA 2A61A 4L5JA 1S6LA 3P7NA 2XAFA 1G4DA 3GFJA 2A07F 2GZWA 2WTEA 4EGYA 1U5TA 4IRIA 1TQIA 3J81Z 3H92A 1SMYF 2QQAA 3P9CA 1QNTA 3R60A 4XSZF 3CDHA 4XLPF 1LB2A 2GQQA 4ZYGA 2V1DA 1R5GA 1JGSA 3F8NA 2QUFA 2HR3A 2VBXA 5LGNA 1ON1A 2FQ3A 1W7PB 1D3YA 3GUDA 1MJAA 2QQBA 2X0LA 1LEBA 4DQ2A 5E8GA 1IN7A 1LJ9A 2XGXA 4Y15A 1AOYA 2HFHA 2Z3YA 4IRHA 2KIMA 3MQ0A 3L09A 2YU3A 2BYVE 2MD5A 4M6YA 5ERIA 3WTTC 4BAYA 2LNBA 3FM5A 4AIKA 3M8EA 1J0RA 4HX4A 4UV9A 3DPTA 1STZA 3AAFA 2MBFA 5E1ZB 3N4MA 3ABUA 1BC7C 2CYYA 3SHFA 1BI1A 1O7LA 3T8TA 1V4RA 5E17F 2JTVA 3HOSA 5D6EA 3QAHA 4P55A 1WSUA 5DUKA 5BOXA 3GZ5A 1W7PA 4I0BA 5A2QZ 3HRUA 1FSEA 5CVUA 3W6JB 1KYWA 4G6DA 3I0TA 2VBYA 4U0VA 1T2KA 2HTSA 2QBYA 1G3YA 3WTSC 3SZPA 3DEUA 5L3CA 2YPRA 1XSVA 3WTVC 4MNUA 4RB2C 1B4AA 1QGPA 4A6DA 2ZO4A 3I71A 5HS8A 3F6OA 2WV0A 5L3DA 2A5YB 2W57A 4P5OA 5K5RA 5D4SA 3TO7A 1XMAA 5HOOA 4ZYDA 5FLXZ 2XAGA 4L9TA 4IHSA 1Z91A 3G3ZA 3P9IA 5K5OA 2EFQA 4JK1X 4N9IA 4B8XA 4N0BA 4S04A 1O3RA 4GO1A 3JSOA 3TGNA 4EVIA 2LF7A 3DP7A 3JSPA 3O3KA 3U2RA 5JHUA 2G9WA 1SFXA 2HQRA 3L7WA 2ZMEB 3R4KA 2R7FA 1KU7A 4UHTA 5AIQA 2F5CA 2ZCWA 2IVMA 4WF2A 3V8LA 3M9AA 2M30A 2XAQA 1XMKA 4OU0A 3W6KB 4L18B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILV A;  3GFI A;  1HKS A;  3FMR A;  3S2W A;  2L3D A;  3TDZ C;  1P6R A;  2P5K A;  3IKV A;  3V7C A;  3I54 A;  3M7G A;  5BS6 A;  1PUE E;  2RQP A;  4I01 A;  2OU2 A;  2CG4 A;  3E5U A;  5TRD A;  1YW7 A;  3MWM A;  2GIV A;  1QBJ A;  2QWW A;  2V1U A;  1U5T C;  3OV8 A;  1R58 A;  3FHZ A;  1TTY A;  1HBX G;  1A04 A;  4ENK A;  5F64 A;  1KU3 A;  5FD6 A;  3FXR A;  1O3T A;  1S3J A;  2PN6 A;  2HQN A;  2VON A;  2YR2 A;  2L54 A;  3WGG A;  5IT9 Z;  2XUB A;  1F9N A;  5D5V B;  5JI6 A;  3GX4 X;  1HKQ A;  1G3S A;  4EJO A;  1KU2 A;  1Z05 A;  4Y13 A;  3SQN A;  4WWC A;  4HX8 A;  1B9N A;  3H3U A;  3KP5 A;  2C6Y A;  1UB9 A;  2LF8 A;  5D6F A;  3DPL C;  3GW2 A;  1BI3 A;  2YSR A;  3V7S A;  5H6Q A;  3KP4 A;  4M73 A;  2GA1 A;  2D1H A;  3GVA A;  2XAJ A;  2E1C A;  4RGU A;  3SZT A;  5D8K B;  2V6C A;  2OZU A;  1ZHF A;  1EH7 A;  2Z99 A;  1T6S A;  1RUN A;  4CYD A;  1ZN2 A;  2JSC A;  1K79 A;  2H27 A;  4LG0 B;  3COA C;  1HW5 A;  2J5P A;  2PQ8 A;  3PFI A;  1CF7 A;  2CGP A;  4K2E A;  3KEQ A;  2F2E A;  1SD4 A;  4G7Z F;  4B09 A;  4BHC A;  4CO8 A;  3R0J A;  5FD5 A;  2IA1 A;  3ELK A;  2XAH A;  2E1N A;  1DPR A;  5CVJ A;  4KA4 A;  3LA3 A;  3M1E A;  1J7K A;  3MZH A;  4EGZ A;  2PLY A;  2VBZ A;  4BXU A;  2EV6 A;  1I27 A;  1CF7 B;  3C1D A;  4P9F A;  1ZGA A;  3VOE A;  2HTJ A;  5A2Q K;  1ZLJ A;  2DLL A;  3LAP A;  4EJT A;  2QYO A;  2VN2 A;  1SAX A;  1XN7 A;  3CUQ A;  3TOB A;  2RKH A;  1TW3 A;  2MLK A;  3FX3 A;  4LGW A;  2RC4 A;  4O3M A;  1MDM A;  2DU9 A;  3M8F A;  1OMI A;  2OD5 A;  4LK1 F;  3RTR A;  5DD4 A;  4L0Y B;  1DUX C;  1BJA A;  2Q2E A;  5HS9 A;  1ZG3 A;  3V4G A;  1BI0 A;  5CVV A;  3BPX A;  4GXO A;  3IC7 A;  2HGC A;  1W4M A;  4NHJ A;  4RGS A;  3QU3 A;  2FE3 A;  5LHG A;  4KMU X;  5FFX A;  4YFK F;  2LDU A;  2EV0 A;  4O6J A;  4IHT A;  2O3F A;  4ASN A;  1ULY A;  2FMY A;  2FSW A;  3IWZ A;  4PGH A;  2UXN A;  5ICC A;  1O3S A;  4YIF A;  1D8J A;  2CFX A;  5DUI A;  2DI3 A;  4RB1 A;  3HSR A;  1RIO H;  1IUY A;  2O6G E;  2OBP A;  4IRG A;  2AS5 F;  4GGG A;  2KJC A;  4U7D A;  5F6F A;  2P5V A;  4RGR A;  2HS5 A;  3Q5F A;  1XGN A;  5LGU A;  3IRR A;  1XDS A;  3ZMZ A;  2EFP A;  2IRF G;  3ISP A;  1MDM B;  4ENN A;  2KIU A;  1YFH A;  2FRH A;  2F5E A;  3HYI A;  5DDG A;  1R1U A;  3FWE A;  5F1R A;  1LEA A;  2NS0 A;  1T39 A;  2X4H A;  4G9Y A;  2M8E A;  3F72 A;  3RPU A;  2K4B A;  1UHW A;  4EM1 A;  1G3T A;  4MEY F;  4HYE A;  4R79 A;  4M9X A;  1HXD A;  3GZ6 A;  1U3E M;  1HW1 A;  1R36 A;  5LGT A;  5L3E A;  5ICE A;  2XAS A;  3LAJ A;  4ZYE A;  1UCR A;  2A6H F;  3ZP5 A;  2P5L C;  4WK8 F;  4HF2 A;  4HQM A;  5LHH A;  3HHG A;  1UFM A;  1QZZ A;  4PGG A;  3RKW A;  3I59 B;  4S05 A;  3R0A A;  1GVJ A;  3BWG A;  4GYI A;  2ZXJ A;  1IXS B;  4EM0 B;  5BMZ A;  4L9J A;  1K78 B;  2EA2 A;  4ZZL A;  1F1Z A;  4L0Z B;  5D4R A;  1K7A A;  4A6E A;  1JE8 A;  2RV8 A;  1IZ1 A;  4LB5 A;  4LFU A;  1YTY A;  1K78 A;  5CYV A;  1F5T A;  4BQA A;  4KUM A;  1P4A A;  3RKX A;  3C7J A;  3FZV A;  3CLO A;  3VEP A;  3I59 A;  2DFI A;  3WU0 A;  3FMQ A;  4HLY A;  5BQT A;  2KIF A;  3PQK A;  1SMT A;  5FGM A;  4HV6 A;  5H6R A;  4HW0 A;  4HOB A;  1ZAO A;  3F8F A;  1I1S A;  1H9T A;  2E7W A;  5FB2 A;  2ETH A;  1YW9 A;  2DO7 A;  4KDP A;  3D0S A;  2RNJ A;  4Q5S F;  2W25 A;  2V79 A;  4HZF A;  2ZNZ A;  4U0Y A;  1J5Y A;  2OA4 A;  2VE9 A;  2QZ8 A;  3TQN A;  2HYG D;  3NQO A;  4G8X A;  3RJP A;  1FWZ A;  1YQA A;  4OIO F;  2KJB A;  4FX4 A;  3FXQ A;  4YII A;  2QLZ A;  5ILS A;  1O57 A;  4EJV A;  2ISZ A;  3BJ6 A;  5DCF A;  2B0L A;  5LRS A;  1F4K A;  1TNT A;  2H6B A;  1GXQ A;  3E6C C;  3FMS A;  3GYH X;  3I58 A;  3I53 A;  4KIG A;  1OYI A;  3ML6 A;  2JPB A;  2V1X A;  1TBX A;  1HKT A;  1YYV A;  4ESB A;  4RAZ A;  1FPQ A;  2AXL A;  3WTZ A;  1HST A;  2O61 A;  2P4W A;  4DNC A;  4Z2Y A;  2UWM A;  2EK5 A;  1U78 A;  1BIA A;  1MJ9 A;  3WTU C;  3CUQ B;  4MHG A;  3RPQ A;  5JVT A;  2LSO A;  3ABT A;  3RYP A;  1CGP A;  2CSO A;  4YG2 F;  1FT9 A;  1SD7 A;  2QVO A;  1GHC A;  3LA7 A;  1W5S A;  4HAM A;  4I98 B;  1U2W A;  1KA8 A;  2NNN A;  3KZZ A;  1LDK B;  5LEJ A;  1IN6 A;  2EFN A;  3MZY A;  1OYY A;  3ZMD A;  2XKO A;  1DPU A;  3Q9S A;  3K69 A;  3J7A O;  3L9F A;  1S7A A;  5DEQ A;  4XBF A;  1OPC A;  5JFR A;  2M87 A;  3QPH A;  2P7C B;  4LLN A;  3HSF A;  3JTG A;  2VBW A;  4G6Q A;  1YS7 A;  4IXA A;  2Q0O A;  1WI9 A;  2PFB A;  5HDG A;  3BZ6 A;  4KIB A;  6PAX A;  2BGC A;  3KP3 A;  1FC3 A;  3HSE A;  2A69 F;  2XKP A;  1SD6 A;  1FSH A;  4BNC A;  1BBY A;  3KP7 A;  3MFK A;  4EJU A;  2R3S A;  1FOK A;  3BP8 A;  5LLQ A;  3CUQ C;  3E97 A;  4LG0 A;  1L0O C;  2E7X A;  3HIF A;  4MTD A;  1S8N A;  4I02 A;  3DV8 A;  4RB3 C;  1I6X A;  3WE2 A;  1X3U A;  1R1V A;  4U0W A;  1G3W A;  2JT1 A;  1FP1 D;  1S29 A;  2WC2 A;  4PDK A;  3I5U A;  1R7J A;  4WXD A;  2RN7 A;  5L3B A;  5CJ9 A;  1BIB A;  2HOE A;  5E20 A;  2M1B A;  2L01 A;  5HVQ C;  4ESF A;  1LQ1 A;  1SFU A;  4A0X A;  1ZG5 A;  4I0A A;  1XGO A;  4ETS A;  3TOA A;  4MQ9 F;  2NAZ A;  2BBY A;  2IW5 A;  2MC3 A;  1TNS A;  4WXH A;  3O2P E;  1L3L A;  4UUV A;  4HF0 A;  2A6E F;  1ZLK A;  3ZQ7 A;  2VOO A;  4G7O F;  4UXN A;  5LBQ A;  1I1G A;  3KP6 A;  4JBA A;  5D5U B;  2P7V B;  1R5H A;  4PZJ A;  4MQV A;  4XSX F;  3KFW X;  3D5L A;  1YG2 A;  2BV6 A;  5FFZ A;  4OMY A;  2JPC A;  3WTX C;  5BPD A;  4UVB A;  4A2U A;  1ZRF A;  4KIF A;  5CVI A;  4AD9 A;  4WXC A;  3CJN A;  2PMU A;  5DV5 A;  2IA2 A;  3DQV C;  3F22 A;  1ZRD A;  1I5Z A;  2O03 A;  1Y0U A;  2EWN A;  4E70 A;  3EET A;  2DPD A;  3KET A;  3KE2 A;  4BHB A;  1MKM A;  4L5I A;  2OAZ A;  2IPQ X;  3IHU A;  2W84 A;  4EQQ A;  4BYY A;  3CO6 C;  3NRV A;  1FYK A;  1B9M A;  1YO5 C;  3WGI A;  1B59 A;  4AIH A;  2VC1 A;  2DK8 A;  3OOP A;  4CIC A;  2FBI A;  2DK5 A;  1R1T A;  3GXO A;  3TDU C;  4MEX F;  5HDK A;  5LRR A;  3RIR A;  3J80 Z;  4OOI A;  2PEX A;  2WWY A;  1NHA A;  4LMY A;  1IW7 F;  1EH6 A;  1HSJ A;  1IRF A;  2XHK A;  4L9N A;  4PCQ A;  4CGZ A;  1XSX A;  2Y48 A;  3F8B A;  2K02 A;  4N9H A;  3BY6 A;  3IKT A;  3K1M A;  3B73 A;  5HS7 A;  2K86 A;  4I7H A;  2PBI A;  3T1B A;  3VFZ A;  2PI0 A;  2HDC A;  3HRS A;  2L4M A;  1OR7 A;  1FYM A;  4LLG F;  1TLH B;  4M6X A;  5TJJ A;  1XGM A;  2G7H A;  4Q4Z F;  2HWV A;  1FBU A;  4L9V A;  1OYW A;  4A12 A;  1J75 A;  1IN4 A;  1R22 A;  4AIJ A;  1J59 A;  1UST A;  5J8F A;  5D8L B;  3HRM A;  1IN5 A;  4NQW A;  2FNA A;  1FY7 A;  2A68 F;  1IXC A;  3IWF A;  3CTA A;  1LDJ A;  1Q1H A;  2DT5 A;  2OQG A;  3TO9 A;  2YX7 A;  3F8M A;  5DD8 A;  1U6G A;  3FXU A;  2GXG A;  1IF1 A;  5KVR A;  2M45 A;  3ZN0 A;  1JHF A;  2HYF A;  5FLX K;  5D5X B;  1BC8 C;  2CQK A;  2R7D A;  4CZZ A;  3JAM Z;  1DDN A;  2Z5U A;  5E8I A;  2GXB A;  3E6D A;  1FBQ A;  4HA8 A;  1XCB A;  2TDX A;  3K1N A;  3BRO A;  3H3Z A;  4RGX A;  1XSD A;  4ZYH A;  3JW4 A;  3LQQ A;  4LK0 F;  2D1V A;  1IXR C;  2ZFW A;  3ECO A;  3WGH A;  4G94 A;  3GLX A;  1OKR A;  4UNO A;  1JXS A;  4Q47 A;  2Z9O A;  5K1Y A;  1Z1D A;  3HOT A;  1XD7 A;  3HUG A;  1SD5 A;  2XRN A;  4EJW A;  5IT3 A;  3U1D A;  1D8K A;  3DKW A;  2DPU A;  2Y0M A;  2IA0 A;  3SXY A;  3JTH A;  3C3W A;  4LD5 A;  5AIP A;  1R00 A;  4F7Z A;  4HF1 A;  4I2O A;  4KYW A;  1QPM A;  3WOD F;  2RGV A;  3E6M A;  2GAU A;  2P8T A;  3JAM K;  2ZME A;  5HLH A;  5ICF A;  2FEZ A;  4KIC A;  4KT5 C;  3E3V A;  1FLI A;  3E6B A;  3L00 A;  3E5Q A;  4CXF A;  4IPA A;  1P2F A;  2IT0 A;  2RVC A;  3QPT A;  2NRA C;  4Q48 A;  3GWZ A;  5KK1 A;  2ESH A;  2H09 A;  2HZT A;  1BI2 A;  4UVC A;  1ZRC A;  1P4W A;  3REO A;  1V3F A;  2J5O A;  2STT A;  2ZBK A;  1KYZ A;  5ICG A;  1ZH5 A;  1U8R A;  3F8C A;  5DYM A;  1Z9C A;  2ISY A;  1HQC A;  4G7H F;  1K6O A;  2JRT A;  4A0Y A;  3G73 A;  1RI7 A;  5JR3 A;  1RZ4 A;  5L3G A;  2XIG A;  2K27 A;  4ENM A;  4FX0 A;  1FX7 A;  1ZRE A;  4HDV A;  3HHH A;  2F5F A;  4BH9 A;  1QO0 D;  2ADU A;  2HKO A;  2MA3 A;  4QLC U;  3KLN A;  3L2C A;  4LLL A;  3GFL A;  3DXJ F;  2PJP A;  1IAW A;  2VOP A;  2DW4 A;  3MCZ A;  1YW8 A;  4OIP F;  3RI4 A;  2LKP A;  1J9I A;  1FBS A;  3P9K A;  1EH8 A;  5K5Q A;  4ENJ A;  1DP7 P;  2A3S A;  3E5X A;  1G6N A;  1WWX A;  2RDP A;  1REP C;  4CHU A;  3RDI A;  4HDU A;  3U9G A;  2DAO A;  1XCV A;  1GXP A;  1HW2 A;  4QWQ A;  4MGR A;  4Y17 A;  3F21 A;  2IJL A;  3EYI A;  4H0E A;  4EV0 A;  2VC0 A;  2PMH A;  4WX9 A;  1KQ9 A;  1ZGJ A;  4HBL A;  3F6V A;  3BJA A;  4UV8 A;  3ZPL A;  1XB4 A;  2DBB A;  5EEH A;  1EV7 A;  4GCV A;  2L02 A;  1TW2 A;  2UZK A;  3CO7 C;  2EV5 A;  1LNW A;  3ZMV A;  3BPV A;  3Q9V A;  1KQ0 A;  2O0Y A;  2QEN A;  4NB5 A;  3WU1 B;  4M9Z A;  2COM A;  3N97 A;  1MGT A;  2NYX A;  1ZG1 A;  3KLO A;  2VE8 A;  4A5M A;  3ROU A;  3R61 A;  4LJZ F;  4AWX B;  3EQL F;  1FNN A;  1R23 A;  4CDG A;  4M71 A;  4TV7 A;  3O6B B;  4IJA A;  3IRQ A;  3RYR A;  1VTN C;  3FM3 A;  2QQ9 A;  3K2Z A;  1E17 A;  2FF4 A;  2W85 A;  3F3X A;  1MD0 A;  1ONV A;  2H6C A;  4YFN F;  2KKO A;  5L3F A;  3EDP A;  3CUO A;  2ZKZ A;  4RAY A;  4KN4 X;  1XGS A;  2CO5 A;  4KMF A;  3J81 K;  1ZYR F;  3KEO A;  2F5D A;  1FZP B;  1J2X A;  1Z7U A;  2EJR A;  3QOP A;  2DTR A;  2FBK A;  4UVA A;  5AON A;  2EFO A;  2VT3 A;  2FXA A;  2FOK A;  1P4X A;  4HX7 A;  4OIN F;  2FML A;  4O5V A;  2ACJ A;  5ILU A;  4RB0 A;  3EUH A;  4HV5 A;  3B02 A;  3FF5 A;  2FNP A;  3ZMS A;  5LHI A;  1FYL A;  1KU9 A;  3IL2 A;  5FO5 A;  5E18 F;  1O7F A;  4IF4 A;  1PP8 F;  3WE3 A;  3BOQ A;  1TQM A;  3NEU A;  1QZY A;  5HLG A;  3I64 A;  2Y75 A;  3T5X A;  2D2W A;  3HTS B;  2P6S A;  5E1W A;  4YFX F;  3K9T A;  1WRJ A;  4A0Z A;  1PDN C;  1W5T A;  2K7L A;  2QM3 A;  2MLG A;  2NNY A;  2VXZ A;  1P92 A;  3ZMU A;  2MH2 A;  1Z6T A;  3QP5 A;  4ON0 A;  4EMS A;  4XRF A;  5HLI A;  3MAJ A;  2GA2 A;  1Z6R A;  5J6X A;  4OMZ A;  3QRF F;  2ESN A;  3QU6 A;  5DCM B;  2FA5 A;  1KQ8 A;  1MJB A;  3HRT A;  5J8C A;  3LWF A;  3ZN1 A;  3LA2 A;  1YS6 A;  2BEO A;  2FU4 A;  1RNL A;  2VT2 A;  2OQR A;  2QBY B;  2JZY A;  3KZY A;  4RS8 A;  4P9U A;  2DQL A;  3HTU A;  2HKX A;  3LQR A;  5DCM A;  5ED4 A;  4IVN A;  1T0F A;  1T38 A;  4MTE A;  2EA4 A;  3K0L A;  4JQF A;  4U7B A;  3R6S A;  4M74 A;  2BE5 F;  3TO6 A;  3V8K A;  4ZH4 F;  1H0M A;  3V8J A;  1H9G A;  3J80 K;  2ZJ2 A;  5CVR A;  3V7R A;  3K1P A;  5BPI A;  2PG4 A;  4HLX A;  4D0P A;  4KFC A;  1QQI A;  4LB6 B;  4M9S A;  2EB7 A;  2XRO A;  2VOD A;  3F23 A;  2Z33 A;  2H94 A;  4HQE A;  1KGS A;  5IT9 K;  4I09 A;  3SFZ A;  3BJO A;  4OIR F;  2HEO A;  4ESJ A;  3ULQ B;  5H20 A;  2L4A A;  1T98 A;  1USS A;  2P6T A;  1YIO A;  3VOD A;  5D5W B;  1RUO A;  2STW A;  2CW0 F;  4A5N A;  3KP2 A;  4P96 A;  4U88 A;  4XLN F;  3T0Y A;  1B1B A;  4R1H A;  5LEK A;  2ZNY A;  4BHP A;  4FT8 A;  1WQ2 A;  1IN8 A;  3WTY C;  2V9V A;  3ECH A;  3KCC A;  1PP7 U;  4AVP A;  3DF8 A;  5E1X A;  1BOA A;  1W7P D;  4KN7 X;  2IP2 A;  2Q8K A;  3T8R A;  1TQP A;  5EEG A;  4FHT A;  1B6A A;  2O8X A;  1LVA A;  3LST A;  1MZB A;  1E2X A;  1D5V A;  3ZMT A;  1YLF A;  3GEZ A;  3PQJ A;  2D45 A;  1UHM A;  2M5W A;  2OZ6 A;  4WCG A;  3VB2 A;  3GO5 A;  4M72 A;  4GYG A;  1FP2 A;  4R8H A;  3WG9 A;  3LFK A;  3RKY A;  2W24 A;  5HDN A;  2XVC A;  2YX4 A;  3QP6 A;  3EYY A;  4ZZD A;  1ON2 A;  1ZAR A;  2FBH A;  3WTW C;  2EFW A;  1JHH A;  4EM2 A;  2MH9 A;  3DFG A;  3MEX A;  2CWE A;  1BN5 A;  2G7U A;  3BDD A;  1S7O A;  1C0W A;  2K4J A;  1WKM A;  3TKY A;  1ODD A;  1XDU A;  1O3Q A;  4OIQ F;  1SFE A;  3GF2 A;  3C18 A;  2DQR A;  1BM9 A;  1AWC A;  3ERE D;  2KRF A;  2ELH A;  1LDD A;  2GWR A;  2XV4 S;  4KNY A;  5CLS A;  2UXX A;  1U5T B;  1IRG A;  3GFM A;  3I4P A;  2A61 A;  4L5J A;  1S6L A;  3P7N A;  2XAF A;  1G4D A;  3GFJ A;  2A07 F;  2GZW A;  2WTE A;  4EGY A;  1U5T A;  4IRI A;  1TQI A;  3J81 Z;  3H92 A;  1SMY F;  2QQA A;  3P9C A;  1QNT A;  3R60 A;  4XSZ F;  3CDH A;  4XLP F;  1LB2 A;  2GQQ A;  4ZYG A;  2V1D A;  1R5G A;  1JGS A;  3F8N A;  2QUF A;  2HR3 A;  2VBX A;  5LGN A;  1ON1 A;  2FQ3 A;  1W7P B;  1D3Y A;  3GUD A;  1MJA A;  2QQB A;  2X0L A;  1LEB A;  4DQ2 A;  5E8G A;  1IN7 A;  1LJ9 A;  2XGX A;  4Y15 A;  1AOY A;  2HFH A;  2Z3Y A;  4IRH A;  2KIM A;  3MQ0 A;  3L09 A;  2YU3 A;  2BYV E;  2MD5 A;  4M6Y A;  5ERI A;  3WTT C;  4BAY A;  2LNB A;  3FM5 A;  4AIK A;  3M8E A;  1J0R A;  4HX4 A;  4UV9 A;  3DPT A;  1STZ A;  3AAF A;  2MBF A;  5E1Z B;  3N4M A;  3ABU A;  1BC7 C;  2CYY A;  3SHF A;  1BI1 A;  1O7L A;  3T8T A;  1V4R A;  5E17 F;  2JTV A;  3HOS A;  5D6E A;  3QAH A;  4P55 A;  1WSU A;  5DUK A;  5BOX A;  3GZ5 A;  1W7P A;  4I0B A;  5A2Q Z;  3HRU A;  1FSE A;  5CVU A;  3W6J B;  1KYW A;  4G6D A;  3I0T A;  2VBY A;  4U0V A;  1T2K A;  2HTS A;  2QBY A;  1G3Y A;  3WTS C;  3SZP A;  3DEU A;  5L3C A;  2YPR A;  1XSV A;  3WTV C;  4MNU A;  4RB2 C;  1B4A A;  1QGP A;  4A6D A;  2ZO4 A;  3I71 A;  5HS8 A;  3F6O A;  2WV0 A;  5L3D A;  2A5Y B;  2W57 A;  4P5O A;  5K5R A;  5D4S A;  3TO7 A;  1XMA A;  5HOO A;  4ZYD A;  5FLX Z;  2XAG A;  4L9T A;  4IHS A;  1Z91 A;  3G3Z A;  3P9I A;  5K5O A;  2EFQ A;  4JK1 X;  4N9I A;  4B8X A;  4N0B A;  4S04 A;  1O3R A;  4GO1 A;  3JSO A;  3TGN A;  4EVI A;  2LF7 A;  3DP7 A;  3JSP A;  3O3K A;  3U2R A;  5JHU A;  2G9W A;  1SFX A;  2HQR A;  3L7W A;  2ZME B;  3R4K A;  2R7F A;  1KU7 A;  4UHT A;  5AIQ A;  2F5C A;  2ZCW A;  2IVM A;  4WF2 A;  3V8L A;  3M9A A;  2M30 A;  2XAQ A;  1XMK A;  4OU0 A;  3W6K B;  4L18 B; 
#chains in the Genus database with same CATH topology
 5ILV A;  3GFI A;  1HKS A;  3FMR A;  3H5N A;  4IEJ A;  3S2W A;  2L3D A;  4CCO A;  3TDZ C;  1P6R A;  1X1P A;  2P5K A;  3D5R C;  3IKV A;  5FKM A;  4E7L A;  3V7C A;  4PUS A;  3I4M J;  4I99 C;  5FLV A;  2VJ4 A;  3I54 A;  3M7G A;  3MD2 A;  5BS6 A;  4E7J A;  2HVR A;  1PUE E;  2RQP A;  4I01 A;  2HXI A;  2OU2 A;  1GV2 A;  2VUM J;  4CYC B;  2CG4 A;  2WY8 Q;  3E5U A;  5TRD A;  1YW7 A;  1K6Y A;  3BC8 A;  5GP9 A;  1APL C;  1Y6I A;  3MWM A;  2GIV A;  2VKE A;  4HNV A;  1QBJ A;  4GFB A;  2KIQ A;  2QWW A;  2V1U A;  1U5T C;  3OV8 A;  3BR2 A;  4IQJ A;  4LOC A;  1R58 A;  2V1N A;  5EF6 A;  4AYB A;  3FHZ A;  1TTY A;  1OCO H;  1BL0 A;  2O7O A;  2H1L A;  1HBX G;  1A04 A;  3Q0U A;  3TBI A;  4ENK A;  5F64 A;  1KU3 A;  5FD6 A;  4F93 B;  4UUS A;  3FK6 A;  3FXR A;  1O3T A;  3ZQC A;  4XLE A;  1IDY A;  3IH3 A;  5JVG F;  1S3J A;  2PN6 A;  2HQN A;  1YI2 I;  4BQN A;  2VON A;  2YR2 A;  2L54 A;  3WGG A;  5IT9 Z;  5J1U A;  1E3O C;  1NTC A;  3I3L A;  2EIK H;  4KIS A;  2XUB A;  2GBY A;  2NOJ B;  1F9N A;  4XL9 A;  5D5V B;  2DA3 A;  2WAD A;  5JI6 A;  3GX4 X;  4DGW B;  1HKQ A;  3SZG A;  1G3S A;  4EJO A;  1KU2 A;  4N4O B;  3K70 D;  1Z05 A;  1Y1W J;  4Y13 A;  3SQN A;  4WWC A;  2Q2E B;  1W5C C;  1TT5 B;  2HPM A;  2DN0 A;  4HX8 A;  3HPG A;  3VPR A;  1B9N A;  1WVR A;  3ZXS A;  4IZZ A;  3H3U A;  2DMP A;  2ELK A;  3KP5 A;  2C6Y A;  4BAC A;  3OS0 A;  1UB9 A;  2LF8 A;  5EG0 A;  4AM3 A;  5D6F A;  3OYJ A;  3DPL C;  3GW2 A;  2QSH X;  1BI3 A;  2YSR A;  3V7S A;  5H6Q A;  3KP4 A;  1D0Y A;  4M73 A;  2GA1 A;  3W3C A;  2D1H A;  4C3H J;  3BCB A;  4I76 A;  1NK3 P;  1E3H A;  3GVA A;  2XAJ A;  4L5E A;  3IAM 2;  4ZDP A;  2E1C A;  4RGU A;  2VI6 A;  3SZT A;  2LYC A;  5D8K B;  2IXS A;  1DU6 A;  2V6C A;  2OZU A;  1ZHF A;  1EH7 A;  2LTP A;  2KL4 A;  2Z99 A;  4XOT A;  3VYT B;  1D0X A;  1T6S A;  2L9R A;  3K10 A;  1RUN A;  4CYD A;  4AID A;  3RPU D;  1ZN2 A;  3VWB A;  4D9J A;  3JRA A;  2JSC A;  1IO2 A;  2IS6 A;  1K79 A;  2R7O A;  2H27 A;  4LG0 B;  2NS7 A;  3COA C;  1HW5 A;  2J5P A;  2PQ8 A;  3PFI A;  2VQL A;  1CF7 A;  2CGP A;  3AL0 B;  4K2E A;  3KEQ A;  2F2E A;  2XPU A;  1BW5 A;  3CP8 A;  5FKO A;  3IH2 A;  1SD4 A;  1UMQ A;  2KIS A;  1HDD C;  4G7Z F;  3QPL A;  4B09 A;  4A93 J;  4BHC A;  4CO8 A;  2WY7 Q;  3R0J A;  5FD5 A;  1VQK I;  3H0D A;  2F4M B;  2IA1 A;  3ELK A;  4A3E J;  2XAH A;  2E1N A;  1DPR A;  4BDZ A;  5CVJ A;  4KA4 A;  1VQ7 I;  3LA3 A;  3M1E A;  3O8H A;  3K6G A;  1J7K A;  4ZC3 A;  3MZH A;  3A0H C;  4EGZ A;  2W48 A;  2LH9 A;  4XN3 A;  2MGQ A;  2PLY A;  2VBZ A;  2DA5 A;  4BXU A;  5EDN A;  3CCM I;  1I27 A;  2EV6 A;  5TGT A;  1CF7 B;  3C1D A;  4P9F A;  1ZGA A;  4Y3O A;  2HTJ A;  3S32 A;  3VOE A;  5A2Q K;  1ZLJ A;  3PIO F;  3LSI A;  1GUU A;  4PJJ A;  2N8G A;  1DP3 A;  2VKV A;  4QPO A;  1DGW Y;  1FTZ A;  2QSF X;  2DLL A;  1X1B A;  3LAP A;  2QYO A;  2VN2 A;  3JR9 A;  3MMY B;  2WB1 A;  2ZJR F;  4EJT A;  1SAX A;  2E2H J;  1VQO I;  1XN7 A;  3CUQ A;  3LSM A;  3TOB A;  2RKH A;  2ZC2 A;  3M07 A;  1MBE A;  3K4L A;  2R5Z A;  1TW3 A;  2MLK A;  2E2I J;  1FMW A;  3FX3 A;  3GME A;  4LGW A;  3AL0 C;  2RC4 A;  4XM3 A;  2DOA A;  4O3M A;  1MDM A;  2DU9 A;  3M8F A;  4CH7 A;  1BR4 A;  4B3X A;  1OMI A;  2OD5 A;  2QEX I;  4LK1 F;  4W97 A;  1ZQ3 P;  3RTR A;  1ETO A;  3S3O A;  5DD4 A;  2M4G A;  4L0Y B;  1DUX C;  1BJA A;  2Q2E A;  5HS9 A;  3OYM A;  1AKH B;  1ZG3 A;  3V4G A;  1BI0 A;  5CVV A;  4F91 B;  4MFD A;  3BPX A;  4E7K A;  3HDD A;  2M34 A;  5EEA A;  2MG4 A;  4GXO A;  3IC7 A;  1SVO A;  4UY8 I;  3Q3S A;  2HGC A;  5F0H A;  2WAE A;  2M3A A;  1A31 A;  1W4M A;  4NHJ A;  2AXT C;  4RGS A;  3OOU A;  1K4T A;  2ECB A;  3QU3 A;  2R7Q A;  1JJ6 C;  1X4P A;  4RM3 A;  2LP0 A;  2HVS A;  2FE3 A;  1NG7 A;  1V54 H;  4M3F A;  3BLY A;  5LHG A;  4KMU X;  5FFX A;  3ASO H;  4NNJ A;  4YFK F;  1ZEL A;  2LDU A;  1A35 A;  4IHY A;  4IL6 C;  2EV0 A;  4O6J A;  1JUP A;  4IHT A;  2O3F A;  1IJW C;  4V19 K;  4ASN A;  1ULY A;  2FMY A;  3VYR B;  3PL8 A;  4LG3 A;  2FSW A;  3IWZ A;  1Q1V A;  4PGH A;  3W2A A;  2UXN A;  4CCL A;  4IHW A;  5ICC A;  2EIM H;  3CCQ I;  1O3S A;  4YIF A;  1O4X A;  1D8J A;  2CFX A;  5DUI A;  2DI3 A;  4RB1 A;  3HSR A;  1RIO H;  3BR5 A;  1IUY A;  2O6G E;  1SAU A;  4D5C A;  2OBP A;  4IRG A;  2AS5 F;  4F55 A;  4GGG A;  2E60 A;  3W2W A;  2KJC A;  4U7D A;  3RZO J;  2KPM A;  5F6F A;  4XKV A;  2P5V A;  4RGR A;  4AYB N;  2X51 A;  4BY1 J;  4FE7 A;  2HS5 A;  2ID3 A;  3Q5F A;  3D5S C;  4XKC A;  1T95 A;  1XGN A;  5LGU A;  2DFE A;  3IRR A;  4M6V A;  2R92 J;  2DT7 B;  1XDS A;  3CJT B;  3ZMZ A;  2WAQ N;  2IGK A;  2EFP A;  3G1M A;  2IRF G;  3ISP A;  2VJI A;  1IRZ A;  3MKY B;  4AU7 A;  1MDM B;  4PSW A;  4ENN A;  2BXY A;  2CRG A;  1HDP A;  3CMA I;  4Z6Y A;  2KIU A;  1YFH A;  1WCM J;  2BY2 A;  4I6Z A;  2EQR A;  2FRH A;  3JCU C;  2F5E A;  3HYI A;  5DDG A;  1R1U A;  3GTL J;  4KT6 A;  3FWE A;  5F1R A;  1V5G A;  2K5C A;  1LEA A;  2M2E A;  5KCM A;  4E7Z A;  2NS0 A;  1T39 A;  2X4H A;  4G9Y A;  2M8E A;  3F72 A;  1Y8R B;  1B72 A;  3RPU A;  2ZME C;  2K4B A;  1PYV A;  1UHW A;  1Z0X A;  4EM1 A;  3J7A Y;  2ZSH B;  3WHB A;  1G3T A;  4MEY F;  4HYE A;  4R79 A;  3A03 A;  2NXN B;  4M9X A;  1HXD A;  3GZ6 A;  4RBO A;  1U3E M;  1D0Z A;  1HW1 A;  1OQY A;  3PNY A;  1R36 A;  2BXZ A;  4GRI A;  2BVL A;  3FIS A;  5LGT A;  2LD5 A;  5L3E A;  2ME0 A;  5ICE A;  4CYC A;  2VPL A;  2XAS A;  3LAJ A;  4ZYE A;  1UCR A;  2A6H F;  3L2R A;  3ZP5 A;  2Z2S B;  2P5L C;  2KP6 A;  3LSK A;  2X6Y A;  4WK8 F;  4HF2 A;  4RMN A;  4HQM A;  2OPT A;  3P5J A;  5LHH A;  3HHG A;  2LG4 A;  2PJR B;  1UFM A;  1QZZ A;  4PGG A;  3RKW A;  3H9Q A;  3I59 B;  4S05 A;  3R0A A;  1R6R A;  3L2Q A;  1GVJ A;  2DDA A;  3BWG A;  3BQY A;  4GYI A;  2ZXJ A;  2VL8 A;  1IXS B;  4EM0 B;  3PSI A;  3NAR A;  5BMZ A;  4L9J A;  1K78 B;  2EA2 A;  4XRS G;  4ZZL A;  1F1Z A;  2AQE A;  1XS9 A;  4L0Z B;  3MVP A;  3K4M A;  1D1C A;  2K9L A;  4BJ5 C;  5D4R A;  1K7A A;  4A6E A;  1BJZ A;  1OLT A;  2V9K A;  2YUS A;  2RV8 A;  2VLA A;  1JE8 A;  2RQQ A;  1IZ1 A;  1RKW A;  1IC8 A;  4XR6 A;  4LB5 A;  1WZ2 A;  4LFU A;  1YTY A;  1K78 A;  5CYV A;  1SAN A;  1F5T A;  4KUM A;  1P4A A;  3RKX A;  4BQA A;  3M4O J;  5HNF A;  1F43 A;  3IUO A;  3C7J A;  3FZV A;  4HPQ A;  3CLO A;  3HKZ A;  2IGN A;  3VEP A;  3S2H J;  1I50 J;  3I59 A;  2HOT A;  2DFI A;  3WU0 A;  3FMQ A;  5C4J J;  4HLY A;  1EA3 A;  3FHN A;  2KIF A;  4Y4R A;  2M4K A;  5BQT A;  1CQT A;  3PQK A;  1SMT A;  5FGM A;  3OYH A;  2BHY A;  4HV6 A;  5H6R A;  4HW0 A;  1QVU A;  4HOB A;  4M3D A;  1YJN I;  1FJL A;  1ZAO A;  3K4K A;  3F8F A;  1BA5 A;  1MND A;  1I1S A;  1H9T A;  3H9J A;  2E7W A;  5FB2 A;  2ETH A;  4C3J J;  4YRV A;  1X1D A;  1YW9 A;  2DO7 A;  4KDP A;  3OYF A;  3D0S A;  2CFO A;  2RNJ A;  3OIQ A;  1ENH A;  2X6O A;  3CME I;  3S1R J;  2W25 A;  4Q5S F;  2V79 A;  1UG2 A;  4HZF A;  1LVK A;  1QRY A;  2ZNZ A;  3OYA A;  1BW6 A;  1J5Y A;  3OL4 A;  4KJZ A;  2OA4 A;  4XQF A;  5KHD A;  5J1Y A;  5EG0 B;  4U0Y A;  1JKR C;  2VE9 A;  5IYD J;  1N77 A;  2QZ8 A;  2E1O A;  3TQN A;  2HYG D;  3NQO A;  1BR1 A;  2VIX A;  4G8X A;  3RJP A;  1FWZ A;  2XPV A;  2EH3 A;  1YQA A;  5EYR A;  2HQA A;  4OIO F;  3OR2 C;  2KJB A;  5JHF A;  4FX4 A;  2A05 A;  1K4S A;  3FXQ A;  1LE8 A;  4YII A;  1P7I A;  2XGC A;  3FIW A;  2QLZ A;  3RZD J;  5ILS A;  1O57 A;  3LNQ A;  2B7E A;  4EJV A;  2JA5 J;  2ISZ A;  1ZR4 A;  3BJ6 A;  5JLW A;  5DCF A;  3RQI A;  2B0L A;  5LRS A;  1F4K A;  3KX2 A;  5EJC A;  1TNT A;  2XSJ C;  3DLL F;  2H6B A;  3HEF A;  3PFY A;  5E3M A;  1GXQ A;  3E6C C;  4CCN A;  3FMS A;  3C2G A;  2X1D A;  3I58 A;  3GYH X;  3GTM J;  1FOW A;  4C3I J;  3LSH A;  2I10 A;  2OTL I;  3I53 A;  4KIG A;  2R7R A;  2Y0S A;  1OYI A;  1KZH A;  3ML6 A;  2JPB A;  2V1X A;  3DKX A;  1TBX A;  3CC2 I;  2KDZ A;  1RC9 A;  1HKT A;  1T0F C;  1YYV A;  4ESB A;  1JKO C;  4RAZ A;  1FPQ A;  2AXL A;  5IYC J;  2EBI A;  2EZH A;  3WTZ A;  2LY1 A;  2JUC A;  1HST A;  2O61 A;  2VB6 A;  9ANT A;  2P4W A;  4DNC A;  4Z2Y A;  2UWM A;  2VJ5 A;  2EK5 A;  1U78 A;  3BR3 A;  1BIA A;  1MJ9 A;  3WTU C;  3CUQ B;  3KYC B;  4MHG A;  5IOZ A;  3CCE I;  1TC3 C;  3RPQ A;  1MIJ A;  5JVT A;  2LSO A;  1LFP A;  3ABT A;  2DA1 A;  3RYP A;  1CGP A;  2CSO A;  3PIP F;  1FOX A;  4YG2 F;  3G2B A;  2M8G X;  3U21 A;  5EZH A;  1FT9 A;  1SD7 A;  2QVO A;  3CZ6 A;  1PUF B;  2OJE D;  1GHC A;  3J7Y J;  5CQE A;  4XLF A;  3LA7 A;  2IAI A;  1W5S A;  1JKP C;  1Y56 A;  1FIP A;  2K9Q A;  3QOD A;  4HAM A;  3ZQH A;  1WJF A;  3CQZ J;  4I98 B;  1R4N B;  4IQ4 A;  2Y2Z A;  5FKK A;  3WU2 C;  1FIA A;  1U2W A;  3Q0W A;  1KA8 A;  1TWG J;  2NNN A;  3KZZ A;  1Y39 A;  3TP0 A;  1X4O A;  1LDK B;  5LEJ A;  1IN6 A;  2EZK A;  2EFN A;  3MZY A;  1HLV A;  4H4K C;  1OYY A;  3ZMD A;  2XKO A;  1ETQ A;  1GLN A;  1DPU A;  2DYS H;  3BG5 A;  3K69 A;  3Q9S A;  3J7A O;  2PMZ N;  3QPS A;  3L9F A;  1S7A A;  5DEQ A;  4XBF A;  1OPC A;  5JFR A;  2M87 A;  3QPH A;  2P7C B;  1MBJ A;  4LLN A;  3HSF A;  5HLT A;  3AFH A;  3JTG A;  2VBW A;  2GIZ A;  1GVD A;  3S1N J;  3DU6 A;  4G6Q A;  2CJJ A;  3OYG A;  4CZC A;  1YS7 A;  4IXA A;  2E5N A;  3W6V A;  4XKW A;  1TT0 A;  2Q0O A;  1WI9 A;  1Z21 A;  2PFB A;  5HDG A;  3BZ6 A;  2ICW G;  2KZV A;  1SFO J;  2ZJP F;  4KIB A;  6PAX A;  3F9K A;  2BGC A;  4D1Q A;  1Y0N A;  3H5R A;  3KP3 A;  1FC3 A;  4P1W A;  3HSE A;  3Q0V A;  4XKB A;  1D5Y A;  2L0K A;  4PJ0 C;  4RDU A;  2A69 F;  3RKQ A;  1VQP I;  3W2V A;  3OSG A;  2XKP A;  4BBS J;  4D7N A;  3BTI A;  1JT0 A;  1SD6 A;  4MIM A;  1FSH A;  3HOX J;  4BNC A;  1BBY A;  3KP7 A;  3HZJ A;  3MFK A;  4EJU A;  2R3S A;  5GTH C;  1FOK A;  3CCS I;  3BP8 A;  5LLQ A;  3WG7 H;  3LMM A;  3CUQ C;  3E97 A;  1LUJ B;  2TCT A;  3BTJ A;  4LG0 A;  4FCY A;  3S1M J;  4B44 A;  1L0O C;  2E7X A;  3HIF A;  2R5Y B;  4MTD A;  1S8N A;  4I02 A;  4HNT A;  3DV8 A;  4RB3 C;  1I6X A;  1G2H A;  3WE2 A;  1X3U A;  1R1V A;  3QYE A;  4A69 C;  1JT6 A;  1VF9 A;  3PM1 A;  4U0W A;  1G3W A;  2CUF A;  2CQ7 A;  3H9G A;  2JT1 A;  1FP1 D;  2LKX A;  1S29 A;  2WC2 A;  2Y30 A;  4PDK A;  4PJN A;  5BNG A;  1YHQ I;  3I5U A;  1R7J A;  4WXD A;  2RN7 A;  5L3B A;  2LLK A;  5CJ9 A;  4DZJ A;  1U9O A;  3K70 C;  3RCO A;  5IP6 A;  1BIB A;  1M1E B;  2HOE A;  5E20 A;  4LIU A;  2M1B A;  2L01 A;  5HVQ C;  4ESF A;  2DA6 A;  3LSP A;  1LQ1 A;  1SFU A;  1YOV B;  4A0X A;  2R7X A;  1ZG5 A;  3LOC A;  3I9V 2;  3ONQ A;  2XPW A;  1GV5 A;  4I0A A;  4OWR B;  1XGO A;  3BT9 A;  4ETS A;  3TOA A;  4MQ9 F;  2DT6 A;  2NAZ A;  2BBY A;  2IW5 A;  2MC3 A;  1TNS A;  4FET A;  3O2P E;  4WXH A;  1L3L A;  2VAS A;  4UUV A;  4D5F A;  4HF0 A;  2A6E F;  1ZLK A;  3CDL A;  1JKQ C;  3ZQ7 A;  2VOO A;  2DJI A;  4G7O F;  3BR1 A;  4A3D J;  4UXN A;  2VPR A;  5LBQ A;  1I1G A;  3KP6 A;  4JBA A;  3ABM H;  5D5U B;  2P7V B;  1R5H A;  3N05 A;  4PZJ A;  5FLM J;  4MQV A;  4XSX F;  3KFW X;  2XDV A;  1UEL B;  3D5L A;  1YG2 A;  2BV6 A;  2DJN A;  5FFZ A;  2DMU A;  5B5E C;  4OMY A;  2Y69 H;  2JPC A;  4EAT A;  4CUG A;  3WTX C;  4EEF G;  5BPD A;  2CQQ A;  2L7M P;  4MLO A;  1IUF A;  2L2O A;  3KZI C;  4UVB A;  4FTH A;  3GTO J;  4A2U A;  2O5R A;  2HVQ A;  3OMY A;  1TWF J;  2E1M C;  2XC7 A;  1YIT I;  1ZRF A;  4KIF A;  4FE4 A;  5CVI A;  4AD9 A;  4WXC A;  3OS2 A;  3CJN A;  1OCC H;  2PMU A;  2QKL B;  3BTL A;  3SEQ A;  5DV5 A;  3H0G J;  2BOL A;  2QKM B;  2IA2 A;  4BE2 A;  3DQV C;  4DIQ A;  2M7A A;  1VI0 A;  3F22 A;  4XOP A;  1W0T A;  1ZRD A;  1I5Z A;  1MSE C;  2O03 A;  1Y0U A;  1MMD A;  4BEH A;  2KRH A;  1MBK A;  2EWN A;  4E70 A;  1QU3 A;  4HG2 A;  1MW7 A;  2ZSI B;  3EET A;  3MKW B;  2DPD A;  2NVY J;  2R7U A;  3KET A;  5J3L A;  3KE2 A;  4BHB A;  1MKM A;  4L5I A;  2OAZ A;  2IPQ X;  3IHU A;  2W84 A;  4X1E A;  3SFI A;  5B66 C;  5J4Y A;  4EQQ A;  1TWC J;  5H2F C;  3PJR A;  3E0J B;  3VSL A;  2CV2 A;  3GZN B;  2B63 J;  4BYY A;  2F4I A;  3NRV A;  3CO6 C;  4BL0 B;  1FYK A;  5GAD J;  3TED A;  4ZTJ A;  2VXD A;  2BHZ A;  1B9M A;  3QWL A;  1YO5 C;  3DBR B;  3WGI A;  1B59 A;  4AIH A;  2VC1 A;  2DK8 A;  3OOP A;  3S1Q J;  4CIC A;  1B8I B;  1QVT A;  2FBI A;  2DK5 A;  1R1T A;  3GXO A;  3L2U A;  3TDU C;  2OUM A;  5E3N A;  1IDZ A;  4MEX F;  3OYN A;  5HDK A;  5LRR A;  3KYD B;  1WJC A;  3RIR A;  3S93 A;  3J80 Z;  4OOI A;  4B48 A;  2D5V A;  2PEX A;  2WWY A;  2DFF A;  1NHA A;  4LMY A;  1IW7 F;  5FRO A;  1R9T J;  1EH6 A;  2CH0 A;  4HRI A;  3EUH C;  1HSJ A;  1IRF A;  5FKL A;  2XHK A;  1VQM I;  5F04 A;  4L9N A;  3M3Y J;  1VQ4 I;  1TP4 A;  4PCQ A;  4PJM A;  1XPX A;  4CGZ A;  2EPF A;  1VQL I;  1X1A A;  3AG1 H;  1XSX A;  5EGO A;  2Y48 A;  3F8B A;  4OAZ A;  4IO9 F;  3NAU A;  1IV6 A;  2HQ5 A;  2K02 A;  4N9H A;  3BY6 A;  3IKT A;  4IOA F;  2CMP A;  4KIT B;  3K1M A;  4XRM A;  3SJM A;  3B73 A;  5HS7 A;  2XAU A;  4LIV A;  2K86 A;  4I7H A;  1OCT C;  2PBI A;  3T1B A;  2ZB9 A;  4S0H B;  2F4O B;  3VFZ A;  1G8X A;  2PI0 A;  2HDC A;  3HRS A;  2L4M A;  1POG A;  1AKH A;  1OR7 A;  1WJB A;  1FYM A;  1SC7 A;  2V9P A;  5GPC A;  2FQ4 A;  4LLG F;  1TLH B;  4M6X A;  5TJJ A;  3CCR I;  1XGM A;  2G7H A;  2IGM A;  4Q4Z F;  2HWV A;  1FBU A;  4L9V A;  1UAA A;  1OYW A;  4MO7 A;  4A3C J;  4A12 A;  3HOV J;  1FEX A;  1Z3Y A;  1J75 A;  1J09 A;  1IN4 A;  1R22 A;  2BZT A;  2F48 A;  4AIJ A;  1J59 A;  1WGX A;  2L7Z A;  1UST A;  5J8F A;  5D8L B;  2GLO A;  3HRM A;  1XC5 A;  1IN5 A;  4NQW A;  2FNA A;  5K7F A;  4C2M J;  3A02 A;  4FIS A;  1FY7 A;  2A68 F;  1IXC A;  2NVQ J;  3IWF A;  3CTA A;  1LDJ A;  1W0U A;  3HG9 A;  1Q1H A;  2DT5 A;  5M3F J;  1MMN A;  1AHD P;  2OQG A;  1XX5 A;  3TO9 A;  2YX7 A;  2QF7 A;  3F8M A;  5DD8 A;  1U6G A;  4A3B J;  3FXU A;  2GXG A;  1XTA A;  3OIO A;  1IF1 A;  5KVR A;  2M45 A;  3ZN0 A;  3FK7 A;  3PUF A;  1JHF A;  2HYF A;  5FLX K;  5D5X B;  1BC8 C;  2CQK A;  2FOW A;  4UB6 C;  2NVT J;  2R7D A;  4BUP A;  4BQO A;  4M3E A;  3HGY A;  3UR3 C;  1OR7 C;  2MD0 A;  4CZZ A;  2PMZ A;  4DYR A;  3JAM Z;  1DDN A;  5DS9 A;  2Z5U A;  5E8I A;  2GXB A;  1ETV A;  3ZR8 X;  2CS3 A;  1X3Z B;  2LRE A;  4BEH B;  4GDF A;  2W82 A;  3E6D A;  1FBQ A;  3NWT A;  1XCB A;  4HA8 A;  2TDX A;  4X6A J;  4RLF A;  2DA7 A;  1S72 I;  4A3M J;  3K1N A;  3BRO A;  3H3Z A;  3UNG C;  1VZ0 A;  4RGX A;  1XSD A;  4ZYH A;  3JW4 A;  4NC6 A;  3LQQ A;  4LK0 F;  2A6T A;  2G0E A;  3MKL A;  2D1V A;  3ASN H;  1IXR C;  2ZFW A;  4XNF A;  2LMD A;  2AQF A;  1ETX A;  1ZTR A;  3ECO A;  3WGH A;  1T8I A;  1WJ5 A;  2CUJ A;  4G94 A;  2E35 A;  1X2N A;  2HDD A;  4B43 A;  5EGO B;  3ERM A;  4NC7 A;  3GLX A;  1OKR A;  4UNO A;  1JXS A;  2JK3 A;  4Q47 A;  2Z9O A;  2IS4 A;  5K1Y A;  1Z1D A;  2ZXW H;  1PUF A;  4AC0 A;  4XRS A;  1IRX A;  3HOT A;  4XON A;  1XD7 A;  3DKY A;  3HUG A;  5B3S H;  1SD5 A;  2XRN A;  4EJW A;  5IT3 A;  1E0E A;  3U1D A;  2ELJ A;  1Z3X A;  1D8K A;  3K7A J;  3DKW A;  2DPU A;  1VQ8 I;  2GM4 A;  2Y0M A;  2IA0 A;  3SXY A;  3JTH A;  3C3W A;  4LD5 A;  1A6Q A;  5AIP A;  2MC4 A;  3B6C A;  1MSF C;  1R00 A;  4UB8 C;  4F7Z A;  3OL3 A;  2QCO A;  3LSJ A;  1FTT A;  3TP3 A;  4HF1 A;  3OIP A;  4I2O A;  1QPM A;  3WOD F;  4KYW A;  2DA4 A;  2RGV A;  5KAI C;  5C44 J;  3E6M A;  3TL4 X;  2GAU A;  2P8T A;  3JAM K;  2ZME A;  5HLH A;  5ICF A;  2FEZ A;  4KIC A;  3HOW J;  4KT5 C;  2K9M A;  3E7L A;  3JRC A;  2CV0 A;  4YEL A;  4C2U A;  3PO2 J;  3E3V A;  3S16 J;  2W7N A;  4DJA A;  1H8A C;  1FLI A;  4E7I A;  1U9N A;  3E6B A;  2BVM A;  2IBD A;  2ID6 A;  2BY1 A;  3L00 A;  3HL2 A;  3E5Q A;  4A3L J;  4CXF A;  3OYK A;  3IV5 A;  2Z16 A;  4IPA A;  4E7H A;  1P2F A;  2XB0 X;  2IT0 A;  2QSG X;  3GTP J;  2R5Z B;  2RVC A;  3QPT A;  2NRA C;  2Y0S N;  4Q48 A;  3GWZ A;  5KK1 A;  2ESH A;  2H09 A;  2HZT A;  1BI2 A;  4UVC A;  1LE8 B;  1ZRC A;  3RQ4 A;  1WH5 A;  4B4C A;  2VQH A;  1N25 A;  1P4W A;  3REO A;  4M3B A;  1V3F A;  2J5O A;  3CES A;  2STT A;  3G6E I;  1SVM A;  2ZBK A;  1KYZ A;  5ICG A;  3JRB A;  1ZH5 A;  1U8R A;  3F8C A;  5DYM A;  2M7B A;  4DZP A;  1Z9C A;  2ISY A;  2LY2 A;  1HQC A;  5HNH A;  2DMQ A;  4G7H F;  1K6O A;  4F92 B;  2EIL H;  2XF7 A;  2JRT A;  3EPZ A;  4A0Y A;  3G73 A;  1RI7 A;  5JR3 A;  1RZ4 A;  4PSX A;  1YJW I;  2HI3 A;  2WV1 A;  5L3G A;  1MNM C;  3PUB A;  2QA4 I;  4A3I J;  2MFZ A;  2X85 A;  2XIG A;  2K27 A;  4IKF A;  1R71 A;  4ENM A;  4FX0 A;  4C30 A;  4Y33 A;  1FX7 A;  4ABZ A;  1ZRE A;  3VYS B;  4HDV A;  1N75 A;  1JUM A;  2XRL A;  3HHH A;  2F5F A;  1WI3 A;  4BH9 A;  2DXI A;  2GXA A;  3S3N A;  1QO0 D;  2HOA A;  3L1P A;  1T56 A;  2ADU A;  2HKO A;  2MA3 A;  2JJ7 A;  2LKS A;  4ITV A;  4QLC U;  2LK2 A;  3KLN A;  3L2C A;  4LLL A;  2LVS A;  3OY9 A;  3GFL A;  3DXJ F;  2PJP A;  4J01 A;  5IY5 H;  1IAW A;  1I39 A;  2VOP A;  1FOY A;  1V5E A;  4V2F A;  4RAF A;  2DW4 A;  3I56 I;  1EJ9 A;  3CD6 I;  1ZR2 A;  3MCZ A;  1MBH A;  1YW8 A;  4OIP F;  2W4S A;  4AUX A;  3RI4 A;  5F08 A;  2LKP A;  3JRH A;  1J9I A;  1FBS A;  2E71 A;  2LBF A;  3P9K A;  2K40 A;  1AA7 A;  3S2D J;  1ZK8 A;  1EH8 A;  5JLX A;  5K5Q A;  2WB1 N;  4ENJ A;  3GCM A;  1DP7 P;  3FDY A;  2A3S A;  3E5X A;  1G6N A;  1WWX A;  2RDP A;  1REP C;  4CHU A;  1TWA J;  3HOY J;  1A5J A;  3RDI A;  1XG1 A;  4HDU A;  4CCM A;  3U9G A;  2DAO A;  1XCV A;  1GXP A;  5M3M J;  2MSY A;  2WBM A;  4A3K J;  1HW2 A;  2WAQ A;  4QWQ A;  3CJQ B;  4MGR A;  4Y17 A;  3F21 A;  2IJL A;  1QA6 A;  4XID A;  3EYI A;  4H0E A;  4EV0 A;  3L2V A;  2MAB A;  2VC0 A;  2PMH A;  1B72 B;  4WX9 A;  1KQ9 A;  2BW3 B;  2YU9 J;  1ZGJ A;  4HBL A;  5CKT A;  5IP7 J;  1VQ9 I;  3F6V A;  5FRM A;  1HA8 A;  2QQ8 A;  2Z1D A;  2KLO A;  5F0F A;  3BJA A;  1WJA A;  4UV8 A;  4NUB A;  5J40 A;  1XB4 A;  2E5Z A;  3ZPL A;  1VQ6 I;  3VDX A;  3G71 I;  2M0C A;  2DBB A;  1X58 A;  1LFB A;  5EEH A;  3OSF A;  1EV7 A;  2BW3 A;  2PX9 A;  4GCV A;  2L02 A;  2DOF A;  1RKT A;  3OYE A;  1TW2 A;  2BY3 A;  3BTC A;  1T33 A;  3HC7 A;  4HEA 2;  2UZK A;  4JX5 A;  3CO7 C;  2EV5 A;  3KYL A;  1LNW A;  3HGG A;  2H8W A;  3HPH A;  3G4S I;  1YX5 A;  3ZMV A;  3BPV A;  3Q9V A;  2R7W A;  1KQ0 A;  2O0Y A;  1LFU P;  2QEN A;  3A1Y A;  4E4H A;  4NB5 A;  3WU1 B;  1T08 B;  2KHM A;  4M9Z A;  2NS8 A;  2COM A;  2FJ1 A;  3N97 A;  1MGT A;  2NYX A;  3BG6 A;  2KMU A;  1ZG1 A;  3KLO A;  2VE8 A;  1EKE A;  2LFB A;  4A5M A;  1IGN A;  3ROU A;  3R61 A;  1Y8Q B;  4LJZ F;  3LSR A;  3GTJ J;  2HYJ A;  4AWX B;  3KEY A;  3EQL F;  1FNN A;  1R23 A;  4CDG A;  1OJL A;  2DDB A;  4M71 A;  1W1W E;  4TV7 A;  3O6B B;  4IJA A;  3IRQ A;  3RYR A;  1VTN C;  5KAF C;  3FM3 A;  4DW6 A;  2DOE A;  1WH7 A;  2O9L A;  3RSN A;  2DYR H;  1OCZ H;  3TW6 A;  2QQ9 A;  1G59 A;  3K2Z A;  1E17 A;  1HOM A;  2FF4 A;  2W85 A;  3F3X A;  1MD0 A;  1ONV A;  1W36 C;  2H6C A;  1NH3 A;  1NK2 P;  4YFN F;  3LL7 A;  1GT0 C;  4XIC A;  2KKO A;  5L3F A;  3OYD A;  3EDP A;  3ABL H;  3CUO A;  1I3A A;  3BZC A;  2ZKZ A;  4RAY A;  4JX4 A;  4KN4 X;  1XGS A;  2A5W A;  2HU9 A;  2GOM A;  2CO5 A;  2CQN A;  2B9S A;  2K85 A;  2H1K A;  1UHS A;  4XMY A;  4KMF A;  3J81 K;  2VKD A;  1ZYR F;  3KEO A;  1RR8 C;  2RRE A;  2F5D A;  5CQG A;  3FXL A;  2KFD A;  1FZP B;  2KRC A;  1YIJ I;  2HZD A;  1J2X A;  1Z7U A;  3DWL E;  1QHH D;  2EJR A;  3QOP A;  2DTR A;  2OCC H;  2FBK A;  3BG9 A;  4UVA A;  5AON A;  2EFO A;  1OCP A;  3K4B A;  1RPW A;  2VT3 A;  1X3W B;  2FXA A;  1MMS A;  2FOK A;  1P4X A;  4HX7 A;  3PNT A;  4OIN F;  2FML A;  3M8J A;  1MH4 A;  5DM6 F;  1LPQ A;  2Q1Z B;  4O5V A;  3UKG A;  2GOX B;  1JI8 A;  2ACJ A;  2MYS A;  3HOZ J;  3QQA A;  3G1L A;  4BBR J;  3DEW A;  1WJD A;  5GAG J;  5ILU A;  4XN0 A;  1HCR A;  3ZOB A;  2HXO A;  4RB0 A;  3EUH A;  4RA2 A;  1RET A;  5DM7 F;  4HV5 A;  3B02 A;  2MW8 A;  3BCA A;  3FF5 A;  5IPA A;  2FNP A;  4JP0 A;  2EZI A;  3ZMS A;  5LHI A;  2K3F A;  4ZDL A;  1FYL A;  3JRE A;  2FD5 A;  1KU9 A;  2DFH A;  2CU7 A;  2NVX J;  4BQQ A;  3WHC A;  2JVG A;  2ECC A;  4HSR A;  5FO5 A;  5E18 F;  2NVU B;  1O7F A;  3IL2 A;  4IF4 A;  3KIO A;  1ZGW A;  1PP8 F;  1K83 J;  3WE3 A;  3BQZ A;  3BOQ A;  1YJ9 I;  1QZE A;  1R49 A;  1TQM A;  1ZKG A;  3NEU A;  3S14 J;  5GPA A;  3BZK A;  1QZY A;  1SFK A;  5HLG A;  3I64 A;  2IEK A;  2Y75 A;  3T5X A;  1X1C A;  3A01 A;  2R7S A;  2X1E A;  4B3A A;  2D2W A;  1H88 C;  3HTS B;  2P6S A;  5E1W A;  4YFX F;  3K9T A;  1WRJ A;  4A0Z A;  1P9Q C;  1PDN C;  3ZQI A;  1PVE A;  2O8K A;  3S15 J;  2P81 A;  3JRI A;  3A2K A;  3FKI J;  4YEJ A;  3CCY A;  4NQW B;  1W5T A;  2K7L A;  4F3Q A;  3HUG B;  4J19 A;  2QM3 A;  2MLG A;  1ETW A;  1R5I D;  2NNY A;  2R7T A;  2VXZ A;  1OIS A;  3FXK A;  5KNL A;  3HJE A;  4BE1 A;  1P92 A;  1PJR A;  3ZMU A;  2MH2 A;  2COB A;  1Z6T A;  3QP5 A;  1RRJ A;  4ON0 A;  4EMS A;  4G6T B;  4XRF A;  5HLI A;  3MAJ A;  2GA2 A;  1RES A;  1Z6R A;  5J6X A;  4OMZ A;  3BG7 A;  3JRG A;  4XOR A;  3QRF F;  2ESN A;  3QU6 A;  5DCM B;  3CJR B;  2TRT A;  1EF4 A;  2HNH A;  2L5Q A;  3LSG A;  2FA5 A;  1KQ8 A;  1TL8 A;  1MJB A;  3HRT A;  4DYQ A;  5J8C A;  3LWF A;  5FJ8 J;  3H5A A;  2K9S A;  2E36 A;  3CDI A;  5J1R A;  3ZN1 A;  1NG6 A;  4CSW A;  3LA2 A;  2AHQ A;  1YS6 A;  2BEO A;  4OAY A;  2XB5 A;  2FU4 A;  1RNL A;  2VT2 A;  4U87 A;  2PJR A;  2OQR A;  5IOY A;  2QBY B;  3AKZ A;  2ZXI A;  2JA6 J;  1DU0 A;  2JZY A;  3GTG J;  3KZY A;  4RS8 A;  4P9U A;  2DQL A;  3HTU A;  2HKX A;  3LQR A;  2OC6 A;  5DCM A;  1P7J A;  5ED4 A;  4IVN A;  4BDY A;  4IHV A;  1T0F A;  1SEU A;  1T38 A;  5B1A H;  4MTE A;  2EA4 A;  1X2M A;  3K0L A;  4JQF A;  3HKZ N;  4N4N B;  3R6S A;  4U7B A;  4M74 A;  2BE5 F;  2R7V A;  3TO6 A;  3V8K A;  4ZH4 F;  4BU2 A;  2LOO A;  5E79 C;  1YRN B;  2DMT A;  1H0M A;  3V8J A;  1H9G A;  2FX0 A;  3V42 A;  5M5Y J;  3J80 K;  1VFC A;  2ZJ2 A;  5CVR A;  3H35 A;  1JJ8 C;  1Y1V J;  5C4X J;  3V7R A;  3K1P A;  2CW7 A;  3GLL A;  5BPI A;  1S7E A;  3FBI B;  3DU5 A;  2PG4 A;  5LD2 C;  1K61 A;  4HLX A;  4D0P A;  4KFC A;  1A6I A;  3ZGK A;  1QQI A;  4FQG A;  4LB6 B;  2F6C A;  2R4G A;  4NC8 A;  4M9S A;  2EB7 A;  5K7H A;  2JA2 A;  2XRO A;  4UUS B;  2VOD A;  3FXJ A;  2L7F P;  1YX3 A;  2LRD A;  3JRD A;  3F23 A;  1HC8 A;  2HPI A;  2Z33 A;  2H94 A;  4HQE A;  1KGS A;  5IT9 K;  4I09 A;  3SFZ A;  3BJO A;  3GTK J;  3NWS A;  3A01 B;  4OIR F;  2HDW A;  3ZCO A;  2HEO A;  1E3P A;  3K4N A;  4DYC A;  1AU7 A;  4MFE A;  3DBH B;  4ESJ A;  3M1C A;  3ULQ B;  2I8D A;  5H20 A;  1KON A;  2L4A A;  2CV1 A;  1SVL A;  1T98 A;  2E1M B;  1USS A;  2P6T A;  1YIO A;  3VOD A;  5D5W B;  1RUO A;  4LIT A;  2STW A;  2CW0 F;  4A5N A;  3KP2 A;  4P96 A;  4U88 A;  3BR0 A;  3OWT A;  3PNV A;  4NDL A;  5F27 A;  4XLN F;  3T0Y A;  1OCR H;  1B1B A;  3U1K A;  4R1H A;  5LEK A;  4QPQ A;  2ZNY A;  4BHP A;  4X0G A;  1DQU A;  4FT8 A;  1WQ2 A;  1IN8 A;  2EZL A;  2CW8 A;  2V7F A;  3WTY C;  2V9V A;  1FMV A;  2HOS A;  3ECH A;  3KCC A;  1PP7 U;  3L2W A;  1JTY A;  4AVP A;  2R5Y A;  3DF8 A;  5E1X A;  1BOA A;  3ZQF A;  1I3Q J;  3VSK A;  2OCE A;  1W7P D;  4KN7 X;  1Z7L A;  3CC7 I;  2IP2 A;  5GAE J;  2Q8K A;  4NBQ A;  3T8R A;  1TQP A;  5EEG A;  4QSH A;  1UG0 A;  4FHT A;  1B6A A;  2JUG A;  2O8X A;  1LVA A;  3LST A;  3CC4 I;  3GTQ J;  3ESW B;  4E7S A;  1MZB A;  3HM5 A;  3G1O A;  1E2X A;  1D5V A;  1U8B A;  1YRN A;  3ZMT A;  1YLF A;  5GAH J;  3GEZ A;  3PQJ A;  4DBR A;  3CP2 A;  2R93 J;  1X19 A;  4CCJ A;  1V55 H;  1TZL A;  2D45 A;  3DTI A;  1UHM A;  3A0B C;  2M5W A;  4CA0 A;  4B1R A;  2OZ6 A;  5E3L A;  4A3F J;  2JRM A;  4WCG A;  1WJE A;  2WA0 A;  3D1N I;  1MBG A;  1H89 C;  3VB2 A;  1B8I A;  3GO5 A;  4M72 A;  4GYG A;  2JMW A;  5C3E J;  2ZXH A;  5E3O A;  2JA8 J;  1FP2 A;  4ZJZ A;  4R8H A;  3SEZ A;  3WG9 A;  5K7Z A;  3QOE A;  1XMX A;  3LFK A;  3RKY A;  3H1C A;  2EIJ H;  2W24 A;  5HDN A;  2KT0 A;  2XVC A;  4HNU A;  2YX4 A;  3HBL A;  5GTI C;  3QP6 A;  3EYY A;  4ZZD A;  1ON2 A;  1ZAR A;  3CCU I;  2FBH A;  2JVH A;  2NOG A;  4ANJ A;  2LR8 A;  2ZJQ F;  2VQC A;  3WTW C;  3C2B A;  2EFW A;  4JYK A;  1JHH A;  4XK4 A;  1QPI A;  4EM2 A;  4B47 A;  2MH9 A;  1R4M B;  3DFG A;  3MEX A;  3EUK L;  2CWE A;  3FXM A;  2Y9Z A;  1BN5 A;  2G7U A;  3BDD A;  1S7O A;  1JTX A;  1TWH J;  1C0W A;  4G12 A;  2K4J A;  1WKM A;  3TKY A;  1ODD A;  1XDU A;  1O3Q A;  4OIQ F;  1SFE A;  3GF2 A;  3C18 A;  2DQR A;  4RAG A;  1BM9 A;  2E19 A;  2VJJ A;  4BS9 A;  3ERE D;  1AWC A;  1S9H A;  2KRF A;  2ELH A;  3MKZ A;  3QYB A;  1LDD A;  3OYC A;  3CF5 F;  4PK4 A;  3HB9 A;  3ABK H;  2GWR A;  2XV4 S;  4KNY A;  5CLS A;  3ZQG A;  2UXX A;  1U5T B;  1LKX A;  1IRG A;  1WPK A;  3GFM A;  2A61 A;  2UUZ A;  3I4P A;  3MN2 A;  2H8R A;  1MBF A;  2E2J J;  1JGG A;  3VYU B;  4L5J A;  1S6L A;  1MMG A;  3P7N A;  2XAF A;  2KDO A;  1G4D A;  3GFJ A;  2A07 F;  2GZW A;  2WTE A;  4EGY A;  1U5T A;  3OYB A;  4IRI A;  3IH4 A;  1TQI A;  4IHX A;  3J81 Z;  3H92 A;  1SMY F;  4BJ6 C;  2IGO A;  2QQA A;  3P9C A;  5FKN A;  1QNT A;  3R60 A;  1RR7 A;  2K3P A;  3QYF A;  3CLQ A;  4XSZ F;  4Y52 J;  3CDH A;  4XLP F;  1LB2 A;  2GQQ A;  3S3M A;  4QIW N;  4IOC F;  2RNG A;  3OYI A;  4ZYG A;  2V1D A;  3F8N A;  1R5G A;  1JGS A;  1DGR M;  4XLH A;  3MZ8 A;  1BR2 A;  2QUF A;  3HOU J;  3BG3 A;  4IX7 A;  2HR3 A;  2VBX A;  2XGE A;  5LGN A;  2V6E A;  1ON1 A;  2DCE A;  2FQ3 A;  1W7P B;  1D3Y A;  3GUD A;  1WHU A;  1VQN I;  1MJA A;  2QQB A;  3H3V K;  4A3G J;  2X0L A;  2LBF B;  1MNE A;  2M9H A;  1LEB A;  3K2A A;  3IAS 2;  2CUE A;  4M3G A;  4DQ2 A;  5E8G A;  2L9V A;  3HXL A;  2CQX A;  1IN7 A;  1V5F A;  1LJ9 A;  1ETY A;  3KPH A;  2XGX A;  2YS9 A;  4Y15 A;  1AOY A;  4BY7 J;  2HFH A;  2Z3Y A;  4BGD A;  4IRH A;  4QTR A;  1MMA A;  2KIM A;  3MQ0 A;  1OFC X;  3DCF A;  2YU3 A;  3L09 A;  2BYV E;  2MD5 A;  1N78 A;  3CCJ I;  4M6Y A;  4BKX A;  2Y9Y A;  5ERI A;  2E34 A;  2ME6 A;  3SDG A;  4XLC A;  2K9N A;  3WTT C;  4BAY A;  3GBG A;  3CMY A;  2LNB A;  2VQG A;  4DBQ A;  2KQR A;  4RLQ A;  3FM5 A;  4AIK A;  3M8E A;  1J0R A;  2V26 A;  4PFP A;  4HX4 A;  4UV9 A;  3OYL A;  4C9Y A;  3DPT A;  1STZ A;  2DMN A;  3BR6 A;  5LFA A;  3AAF A;  2MBF A;  1Z67 A;  5E1Z B;  3DTK A;  3O8G A;  2LC2 A;  3AG3 H;  3ABU A;  3N4M A;  1BC7 C;  1D1A A;  2CYY A;  3SHF A;  5F1J A;  4UUT A;  1BI1 A;  1O7L A;  3T8T A;  1V4R A;  3FBN B;  5M5X J;  5E17 F;  3FXO A;  2DA2 A;  2JTV A;  3HOS A;  5D6E A;  3QAH A;  4ZYA A;  4P55 A;  4D7M A;  1F36 A;  5TIS C;  1D1B A;  2F5V A;  1WSU A;  5IP9 J;  2L9S A;  2UV1 A;  3IP4 B;  5DUK A;  1A36 A;  3DEE A;  4Y7N J;  5M5W J;  5BOX A;  3GZ5 A;  1W7P A;  2JWT A;  2XF5 A;  4I0B A;  3EUA A;  1I6H J;  3ZRG A;  5A2Q Z;  3HRU A;  4II2 A;  2W1O A;  4ZDO A;  1FSE A;  5CVU A;  2OV7 A;  3AG2 H;  1KYW A;  3W6J B;  4G6D A;  5IYB J;  2VKH A;  2LY9 A;  3I0T A;  3CCV I;  2I5U A;  2VBY A;  4U0V A;  5CPR B;  4YIR X;  1T2K A;  3K4C A;  4E6K G;  3F0C A;  2X9D A;  2HTS A;  2QBY A;  3OS1 A;  1G3Y A;  2V4J C;  3WTS C;  1BOB A;  2X6X A;  4FAS D;  2ZFU A;  3SZP A;  3DEU A;  5L3C A;  3DTE A;  3J7Z I;  4ZTF A;  2JN6 A;  2IS2 A;  2XSD C;  4HST A;  3PSF A;  5HOD A;  2Y31 A;  2YPR A;  1XSV A;  3A4C A;  3OR1 C;  3WTV C;  4MNU A;  4RB2 C;  3TW7 A;  2IS1 A;  4XLA A;  2R0Q C;  3FKJ A;  1B4A A;  3DBL B;  3TMO A;  1QGP A;  4A6D A;  2W00 A;  2X1C A;  2ZO4 A;  1MH3 A;  1JUS A;  2R7Z J;  1ORK A;  3E1S A;  1HF0 A;  3I71 A;  5HS8 A;  2RAE A;  5DTD A;  3F6O A;  3CF2 A;  2WV0 A;  3B6A A;  5L3D A;  1GDT A;  2A5Y B;  2W57 A;  2DOD A;  1ACI A;  3K4J A;  4P5O A;  3S8P A;  5D4S A;  5K5R A;  3TO7 A;  1XMA A;  4RM2 A;  2XGD A;  4A3J J;  4AVZ A;  5HOO A;  4ZYD A;  1UZC A;  5FLX Z;  2M0M A;  2XAG A;  3DPU A;  3H36 A;  4L9T A;  2JQ7 A;  4BE0 A;  4IHS A;  1Z91 A;  5EZG A;  4JX6 A;  4PFO A;  4CCK A;  3G3Z A;  3P9I A;  5F0C A;  2X48 A;  5K5O A;  2KZG A;  2EFQ A;  2L9N A;  4JK1 X;  3DLA A;  4N9I A;  4V2G A;  2AO9 A;  2QGU A;  4B8X A;  4N0B A;  4C2T A;  4S04 A;  5B1B H;  1O3R A;  2JA7 J;  3I4N J;  3S17 J;  4GO1 A;  4BXF A;  1VQ5 I;  3JSO A;  3JRF A;  1IG7 A;  3CMM A;  1WFX A;  3TGN A;  4EVI A;  2LF7 A;  3DP7 A;  2L7K A;  3JSP A;  2X6W A;  1U0J A;  3LFU A;  1UJ8 A;  3O3K A;  3U2R A;  3C2H A;  2BY0 A;  2P0W A;  1ITY A;  4II3 A;  4F52 A;  3CCL I;  4W1U A;  5J4V A;  5JHU A;  2OF7 A;  1S5L C;  1W36 D;  1QHG A;  2G9W A;  4BJT A;  1SFX A;  2HQR A;  3L7W A;  2EIN H;  2ZME B;  2DTZ A;  3ZQL A;  3PO3 J;  3R4K A;  2R7F A;  1KU7 A;  1Z77 A;  4UHT A;  1YE9 A;  3ZQQ A;  1ERD A;  5AIQ A;  2WAF A;  2F5C A;  2CUZ A;  2ZCW A;  2IVM A;  4DOZ A;  4WF2 A;  3I55 I;  2OTJ I;  3V8L A;  2JSP A;  4JOM A;  4PJL A;  3M9A A;  5J47 A;  2M30 A;  2XAQ A;  5FRN A;  4BXX J;  1IV8 A;  2XF6 A;  1XMK A;  3AG4 H;  4OU0 A;  1VND A;  1ETK A;  3X2Q H;  2FUG 2;  3W6K B;  3SYT A;  3SDB A;  4L18 B;  4J00 A; 
#chains in the Genus database with same CATH homology
 5ILV A;  3GFI A;  1HKS A;  3FMR A;  3S2W A;  2L3D A;  3TDZ C;  1P6R A;  2P5K A;  3IKV A;  3V7C A;  3I54 A;  3M7G A;  5BS6 A;  1PUE E;  2RQP A;  4I01 A;  2OU2 A;  2CG4 A;  3E5U A;  5TRD A;  1YW7 A;  3MWM A;  2GIV A;  1QBJ A;  2QWW A;  2V1U A;  1U5T C;  3OV8 A;  1R58 A;  3FHZ A;  1TTY A;  1HBX G;  1A04 A;  4ENK A;  5F64 A;  1KU3 A;  5FD6 A;  3FXR A;  1O3T A;  1S3J A;  2PN6 A;  2HQN A;  2VON A;  2YR2 A;  2L54 A;  3WGG A;  5IT9 Z;  2XUB A;  1F9N A;  5D5V B;  5JI6 A;  3GX4 X;  1HKQ A;  1G3S A;  4EJO A;  1KU2 A;  1Z05 A;  4Y13 A;  3SQN A;  4WWC A;  4HX8 A;  1B9N A;  3H3U A;  3KP5 A;  2C6Y A;  1UB9 A;  2LF8 A;  5D6F A;  3DPL C;  3GW2 A;  1BI3 A;  2YSR A;  3V7S A;  5H6Q A;  3KP4 A;  4M73 A;  2GA1 A;  2D1H A;  3GVA A;  2XAJ A;  2E1C A;  4RGU A;  3SZT A;  5D8K B;  2V6C A;  2OZU A;  1ZHF A;  1EH7 A;  2Z99 A;  1T6S A;  1RUN A;  4CYD A;  1ZN2 A;  2JSC A;  1K79 A;  2H27 A;  4LG0 B;  3COA C;  1HW5 A;  2J5P A;  2PQ8 A;  3PFI A;  1CF7 A;  2CGP A;  4K2E A;  3KEQ A;  2F2E A;  1SD4 A;  4G7Z F;  4B09 A;  4BHC A;  4CO8 A;  3R0J A;  5FD5 A;  2IA1 A;  3ELK A;  2XAH A;  2E1N A;  1DPR A;  5CVJ A;  4KA4 A;  3LA3 A;  3M1E A;  1J7K A;  3MZH A;  4EGZ A;  2PLY A;  2VBZ A;  4BXU A;  2EV6 A;  1I27 A;  1CF7 B;  3C1D A;  4P9F A;  1ZGA A;  3VOE A;  2HTJ A;  5A2Q K;  1ZLJ A;  2DLL A;  3LAP A;  4EJT A;  2QYO A;  2VN2 A;  1SAX A;  1XN7 A;  3CUQ A;  3TOB A;  2RKH A;  1TW3 A;  2MLK A;  3FX3 A;  4LGW A;  2RC4 A;  4O3M A;  1MDM A;  2DU9 A;  3M8F A;  1OMI A;  2OD5 A;  4LK1 F;  3RTR A;  5DD4 A;  4L0Y B;  1DUX C;  1BJA A;  2Q2E A;  5HS9 A;  1ZG3 A;  3V4G A;  1BI0 A;  5CVV A;  3BPX A;  4GXO A;  3IC7 A;  2HGC A;  1W4M A;  4NHJ A;  4RGS A;  3QU3 A;  2FE3 A;  5LHG A;  4KMU X;  5FFX A;  4YFK F;  2LDU A;  2EV0 A;  4O6J A;  4IHT A;  2O3F A;  4ASN A;  1ULY A;  2FMY A;  2FSW A;  3IWZ A;  4PGH A;  2UXN A;  5ICC A;  1O3S A;  4YIF A;  1D8J A;  2CFX A;  5DUI A;  2DI3 A;  4RB1 A;  3HSR A;  1RIO H;  1IUY A;  2O6G E;  2OBP A;  4IRG A;  2AS5 F;  4GGG A;  2KJC A;  4U7D A;  5F6F A;  2P5V A;  4RGR A;  2HS5 A;  3Q5F A;  1XGN A;  5LGU A;  3IRR A;  1XDS A;  3ZMZ A;  2EFP A;  2IRF G;  3ISP A;  1MDM B;  4ENN A;  2KIU A;  1YFH A;  2FRH A;  2F5E A;  3HYI A;  5DDG A;  1R1U A;  3FWE A;  5F1R A;  1LEA A;  2NS0 A;  1T39 A;  2X4H A;  4G9Y A;  2M8E A;  3F72 A;  3RPU A;  2K4B A;  1UHW A;  4EM1 A;  1G3T A;  4MEY F;  4HYE A;  4R79 A;  4M9X A;  1HXD A;  3GZ6 A;  1U3E M;  1HW1 A;  1R36 A;  5LGT A;  5L3E A;  5ICE A;  2XAS A;  3LAJ A;  4ZYE A;  1UCR A;  2A6H F;  3ZP5 A;  2P5L C;  4WK8 F;  4HF2 A;  4HQM A;  5LHH A;  3HHG A;  1UFM A;  1QZZ A;  4PGG A;  3RKW A;  3I59 B;  4S05 A;  3R0A A;  1GVJ A;  3BWG A;  4GYI A;  2ZXJ A;  1IXS B;  4EM0 B;  5BMZ A;  4L9J A;  1K78 B;  2EA2 A;  4ZZL A;  1F1Z A;  4L0Z B;  5D4R A;  1K7A A;  4A6E A;  1JE8 A;  2RV8 A;  1IZ1 A;  4LB5 A;  4LFU A;  1YTY A;  1K78 A;  5CYV A;  1F5T A;  4BQA A;  4KUM A;  1P4A A;  3RKX A;  3C7J A;  3FZV A;  3CLO A;  3VEP A;  3I59 A;  2DFI A;  3WU0 A;  3FMQ A;  4HLY A;  5BQT A;  2KIF A;  3PQK A;  1SMT A;  5FGM A;  4HV6 A;  5H6R A;  4HW0 A;  4HOB A;  1ZAO A;  3F8F A;  1I1S A;  1H9T A;  2E7W A;  5FB2 A;  2ETH A;  1YW9 A;  2DO7 A;  4KDP A;  3D0S A;  2RNJ A;  4Q5S F;  2W25 A;  2V79 A;  4HZF A;  2ZNZ A;  4U0Y A;  1J5Y A;  2OA4 A;  2VE9 A;  2QZ8 A;  3TQN A;  2HYG D;  3NQO A;  4G8X A;  3RJP A;  1FWZ A;  1YQA A;  4OIO F;  2KJB A;  4FX4 A;  3FXQ A;  4YII A;  2QLZ A;  5ILS A;  1O57 A;  4EJV A;  2ISZ A;  3BJ6 A;  5DCF A;  2B0L A;  5LRS A;  1F4K A;  1TNT A;  2H6B A;  1GXQ A;  3E6C C;  3FMS A;  3GYH X;  3I58 A;  3I53 A;  4KIG A;  1OYI A;  3ML6 A;  2JPB A;  2V1X A;  1TBX A;  1HKT A;  1YYV A;  4ESB A;  4RAZ A;  1FPQ A;  2AXL A;  3WTZ A;  1HST A;  2O61 A;  2P4W A;  4DNC A;  4Z2Y A;  2UWM A;  2EK5 A;  1U78 A;  1BIA A;  1MJ9 A;  3WTU C;  3CUQ B;  4MHG A;  3RPQ A;  5JVT A;  2LSO A;  3ABT A;  3RYP A;  1CGP A;  2CSO A;  4YG2 F;  1FT9 A;  1SD7 A;  2QVO A;  1GHC A;  3LA7 A;  1W5S A;  4HAM A;  4I98 B;  1U2W A;  1KA8 A;  2NNN A;  3KZZ A;  1LDK B;  5LEJ A;  1IN6 A;  2EFN A;  3MZY A;  1OYY A;  3ZMD A;  2XKO A;  1DPU A;  3Q9S A;  3K69 A;  3J7A O;  3L9F A;  1S7A A;  5DEQ A;  4XBF A;  1OPC A;  5JFR A;  2M87 A;  3QPH A;  2P7C B;  4LLN A;  3HSF A;  3JTG A;  2VBW A;  4G6Q A;  1YS7 A;  4IXA A;  2Q0O A;  1WI9 A;  2PFB A;  5HDG A;  3BZ6 A;  4KIB A;  6PAX A;  2BGC A;  3KP3 A;  1FC3 A;  3HSE A;  2A69 F;  2XKP A;  1SD6 A;  1FSH A;  4BNC A;  1BBY A;  3KP7 A;  3MFK A;  4EJU A;  2R3S A;  1FOK A;  3BP8 A;  5LLQ A;  3CUQ C;  3E97 A;  4LG0 A;  1L0O C;  2E7X A;  3HIF A;  4MTD A;  1S8N A;  4I02 A;  3DV8 A;  4RB3 C;  1I6X A;  3WE2 A;  1X3U A;  1R1V A;  4U0W A;  1G3W A;  2JT1 A;  1FP1 D;  1S29 A;  2WC2 A;  4PDK A;  3I5U A;  1R7J A;  4WXD A;  2RN7 A;  5L3B A;  5CJ9 A;  1BIB A;  2HOE A;  5E20 A;  2M1B A;  2L01 A;  5HVQ C;  4ESF A;  1LQ1 A;  1SFU A;  4A0X A;  1ZG5 A;  4I0A A;  1XGO A;  4ETS A;  3TOA A;  4MQ9 F;  2NAZ A;  2BBY A;  2IW5 A;  2MC3 A;  1TNS A;  4WXH A;  3O2P E;  1L3L A;  4UUV A;  4HF0 A;  2A6E F;  1ZLK A;  3ZQ7 A;  2VOO A;  4G7O F;  4UXN A;  5LBQ A;  1I1G A;  3KP6 A;  4JBA A;  5D5U B;  2P7V B;  1R5H A;  4PZJ A;  4MQV A;  4XSX F;  3KFW X;  3D5L A;  1YG2 A;  2BV6 A;  5FFZ A;  4OMY A;  2JPC A;  3WTX C;  5BPD A;  4UVB A;  4A2U A;  1ZRF A;  4KIF A;  5CVI A;  4AD9 A;  4WXC A;  3CJN A;  2PMU A;  5DV5 A;  2IA2 A;  3DQV C;  3F22 A;  1ZRD A;  1I5Z A;  2O03 A;  1Y0U A;  2EWN A;  4E70 A;  3EET A;  2DPD A;  3KET A;  3KE2 A;  4BHB A;  1MKM A;  4L5I A;  2OAZ A;  2IPQ X;  3IHU A;  2W84 A;  4EQQ A;  4BYY A;  3CO6 C;  3NRV A;  1FYK A;  1B9M A;  1YO5 C;  3WGI A;  1B59 A;  4AIH A;  2VC1 A;  2DK8 A;  3OOP A;  4CIC A;  2FBI A;  2DK5 A;  1R1T A;  3GXO A;  3TDU C;  4MEX F;  5HDK A;  5LRR A;  3RIR A;  3J80 Z;  4OOI A;  2PEX A;  2WWY A;  1NHA A;  4LMY A;  1IW7 F;  1EH6 A;  1HSJ A;  1IRF A;  2XHK A;  4L9N A;  4PCQ A;  4CGZ A;  1XSX A;  2Y48 A;  3F8B A;  2K02 A;  4N9H A;  3BY6 A;  3IKT A;  3K1M A;  3B73 A;  5HS7 A;  2K86 A;  4I7H A;  2PBI A;  3T1B A;  3VFZ A;  2PI0 A;  2HDC A;  3HRS A;  2L4M A;  1OR7 A;  1FYM A;  4LLG F;  1TLH B;  4M6X A;  5TJJ A;  1XGM A;  2G7H A;  4Q4Z F;  2HWV A;  1FBU A;  4L9V A;  1OYW A;  4A12 A;  1J75 A;  1IN4 A;  1R22 A;  4AIJ A;  1J59 A;  1UST A;  5J8F A;  5D8L B;  3HRM A;  1IN5 A;  4NQW A;  2FNA A;  1FY7 A;  2A68 F;  1IXC A;  3IWF A;  3CTA A;  1LDJ A;  1Q1H A;  2DT5 A;  2OQG A;  3TO9 A;  2YX7 A;  3F8M A;  5DD8 A;  1U6G A;  3FXU A;  2GXG A;  1IF1 A;  5KVR A;  2M45 A;  3ZN0 A;  1JHF A;  2HYF A;  5FLX K;  5D5X B;  1BC8 C;  2CQK A;  2R7D A;  4CZZ A;  3JAM Z;  1DDN A;  2Z5U A;  5E8I A;  2GXB A;  3E6D A;  1FBQ A;  4HA8 A;  1XCB A;  2TDX A;  3K1N A;  3BRO A;  3H3Z A;  4RGX A;  1XSD A;  4ZYH A;  3JW4 A;  3LQQ A;  4LK0 F;  2D1V A;  1IXR C;  2ZFW A;  3ECO A;  3WGH A;  4G94 A;  3GLX A;  1OKR A;  4UNO A;  1JXS A;  4Q47 A;  2Z9O A;  5K1Y A;  1Z1D A;  3HOT A;  1XD7 A;  3HUG A;  1SD5 A;  2XRN A;  4EJW A;  5IT3 A;  3U1D A;  1D8K A;  3DKW A;  2DPU A;  2Y0M A;  2IA0 A;  3SXY A;  3JTH A;  3C3W A;  4LD5 A;  5AIP A;  1R00 A;  4F7Z A;  4HF1 A;  4I2O A;  4KYW A;  1QPM A;  3WOD F;  2RGV A;  3E6M A;  2GAU A;  2P8T A;  3JAM K;  2ZME A;  5HLH A;  5ICF A;  2FEZ A;  4KIC A;  4KT5 C;  3E3V A;  1FLI A;  3E6B A;  3L00 A;  3E5Q A;  4CXF A;  4IPA A;  1P2F A;  2IT0 A;  2RVC A;  3QPT A;  2NRA C;  4Q48 A;  3GWZ A;  5KK1 A;  2ESH A;  2H09 A;  2HZT A;  1BI2 A;  4UVC A;  1ZRC A;  1P4W A;  3REO A;  1V3F A;  2J5O A;  2STT A;  2ZBK A;  1KYZ A;  5ICG A;  1ZH5 A;  1U8R A;  3F8C A;  5DYM A;  1Z9C A;  2ISY A;  1HQC A;  4G7H F;  1K6O A;  2JRT A;  4A0Y A;  3G73 A;  1RI7 A;  5JR3 A;  1RZ4 A;  5L3G A;  2XIG A;  2K27 A;  4ENM A;  4FX0 A;  1FX7 A;  1ZRE A;  4HDV A;  3HHH A;  2F5F A;  4BH9 A;  1QO0 D;  2ADU A;  2HKO A;  2MA3 A;  4QLC U;  3KLN A;  3L2C A;  4LLL A;  3GFL A;  3DXJ F;  2PJP A;  1IAW A;  2VOP A;  2DW4 A;  3MCZ A;  1YW8 A;  4OIP F;  3RI4 A;  2LKP A;  1J9I A;  1FBS A;  3P9K A;  1EH8 A;  5K5Q A;  4ENJ A;  1DP7 P;  2A3S A;  3E5X A;  1G6N A;  1WWX A;  2RDP A;  1REP C;  4CHU A;  3RDI A;  4HDU A;  3U9G A;  2DAO A;  1XCV A;  1GXP A;  1HW2 A;  4QWQ A;  4MGR A;  4Y17 A;  3F21 A;  2IJL A;  3EYI A;  4H0E A;  4EV0 A;  2VC0 A;  2PMH A;  4WX9 A;  1KQ9 A;  1ZGJ A;  4HBL A;  3F6V A;  3BJA A;  4UV8 A;  3ZPL A;  1XB4 A;  2DBB A;  5EEH A;  1EV7 A;  4GCV A;  2L02 A;  1TW2 A;  2UZK A;  3CO7 C;  2EV5 A;  1LNW A;  3ZMV A;  3BPV A;  3Q9V A;  1KQ0 A;  2O0Y A;  2QEN A;  4NB5 A;  3WU1 B;  4M9Z A;  2COM A;  3N97 A;  1MGT A;  2NYX A;  1ZG1 A;  3KLO A;  2VE8 A;  4A5M A;  3ROU A;  3R61 A;  4LJZ F;  4AWX B;  3EQL F;  1FNN A;  1R23 A;  4CDG A;  4M71 A;  4TV7 A;  3O6B B;  4IJA A;  3IRQ A;  3RYR A;  1VTN C;  3FM3 A;  2QQ9 A;  3K2Z A;  1E17 A;  2FF4 A;  2W85 A;  3F3X A;  1MD0 A;  1ONV A;  2H6C A;  4YFN F;  2KKO A;  5L3F A;  3EDP A;  3CUO A;  2ZKZ A;  4RAY A;  4KN4 X;  1XGS A;  2CO5 A;  4KMF A;  3J81 K;  1ZYR F;  3KEO A;  2F5D A;  1FZP B;  1J2X A;  1Z7U A;  2EJR A;  3QOP A;  2DTR A;  2FBK A;  4UVA A;  5AON A;  2EFO A;  2VT3 A;  2FXA A;  2FOK A;  1P4X A;  4HX7 A;  4OIN F;  2FML A;  4O5V A;  2ACJ A;  5ILU A;  4RB0 A;  3EUH A;  4HV5 A;  3B02 A;  3FF5 A;  2FNP A;  3ZMS A;  5LHI A;  1FYL A;  1KU9 A;  3IL2 A;  5FO5 A;  5E18 F;  1O7F A;  4IF4 A;  1PP8 F;  3WE3 A;  3BOQ A;  1TQM A;  3NEU A;  1QZY A;  5HLG A;  3I64 A;  2Y75 A;  3T5X A;  2D2W A;  3HTS B;  2P6S A;  5E1W A;  4YFX F;  3K9T A;  1WRJ A;  4A0Z A;  1PDN C;  1W5T A;  2K7L A;  2QM3 A;  2MLG A;  2NNY A;  2VXZ A;  1P92 A;  3ZMU A;  2MH2 A;  1Z6T A;  3QP5 A;  4ON0 A;  4EMS A;  4XRF A;  5HLI A;  3MAJ A;  2GA2 A;  1Z6R A;  5J6X A;  4OMZ A;  3QRF F;  2ESN A;  3QU6 A;  5DCM B;  2FA5 A;  1KQ8 A;  1MJB A;  3HRT A;  5J8C A;  3LWF A;  3ZN1 A;  3LA2 A;  1YS6 A;  2BEO A;  2FU4 A;  1RNL A;  2VT2 A;  2OQR A;  2QBY B;  2JZY A;  3KZY A;  4RS8 A;  4P9U A;  2DQL A;  3HTU A;  2HKX A;  3LQR A;  5DCM A;  5ED4 A;  4IVN A;  1T0F A;  1T38 A;  4MTE A;  2EA4 A;  3K0L A;  4JQF A;  4U7B A;  3R6S A;  4M74 A;  2BE5 F;  3TO6 A;  3V8K A;  4ZH4 F;  1H0M A;  3V8J A;  1H9G A;  3J80 K;  2ZJ2 A;  5CVR A;  3V7R A;  3K1P A;  5BPI A;  2PG4 A;  4HLX A;  4D0P A;  4KFC A;  1QQI A;  4LB6 B;  4M9S A;  2EB7 A;  2XRO A;  2VOD A;  3F23 A;  2Z33 A;  2H94 A;  4HQE A;  1KGS A;  5IT9 K;  4I09 A;  3SFZ A;  3BJO A;  4OIR F;  2HEO A;  4ESJ A;  3ULQ B;  5H20 A;  2L4A A;  1T98 A;  1USS A;  2P6T A;  1YIO A;  3VOD A;  5D5W B;  1RUO A;  2STW A;  2CW0 F;  4A5N A;  3KP2 A;  4P96 A;  4U88 A;  4XLN F;  3T0Y A;  1B1B A;  4R1H A;  5LEK A;  2ZNY A;  4BHP A;  4FT8 A;  1WQ2 A;  1IN8 A;  3WTY C;  2V9V A;  3ECH A;  3KCC A;  1PP7 U;  4AVP A;  3DF8 A;  5E1X A;  1BOA A;  1W7P D;  4KN7 X;  2IP2 A;  2Q8K A;  3T8R A;  1TQP A;  5EEG A;  4FHT A;  1B6A A;  2O8X A;  1LVA A;  3LST A;  1MZB A;  1E2X A;  1D5V A;  3ZMT A;  1YLF A;  3GEZ A;  3PQJ A;  2D45 A;  1UHM A;  2M5W A;  2OZ6 A;  4WCG A;  3VB2 A;  3GO5 A;  4M72 A;  4GYG A;  1FP2 A;  4R8H A;  3WG9 A;  3LFK A;  3RKY A;  2W24 A;  5HDN A;  2XVC A;  2YX4 A;  3QP6 A;  3EYY A;  4ZZD A;  1ON2 A;  1ZAR A;  2FBH A;  3WTW C;  2EFW A;  1JHH A;  4EM2 A;  2MH9 A;  3DFG A;  3MEX A;  2CWE A;  1BN5 A;  2G7U A;  3BDD A;  1S7O A;  1C0W A;  2K4J A;  1WKM A;  3TKY A;  1ODD A;  1XDU A;  1O3Q A;  4OIQ F;  1SFE A;  3GF2 A;  3C18 A;  2DQR A;  1BM9 A;  1AWC A;  3ERE D;  2KRF A;  2ELH A;  1LDD A;  2GWR A;  2XV4 S;  4KNY A;  5CLS A;  2UXX A;  1U5T B;  1IRG A;  3GFM A;  3I4P A;  2A61 A;  4L5J A;  1S6L A;  3P7N A;  2XAF A;  1G4D A;  3GFJ A;  2A07 F;  2GZW A;  2WTE A;  4EGY A;  1U5T A;  4IRI A;  1TQI A;  3J81 Z;  3H92 A;  1SMY F;  2QQA A;  3P9C A;  1QNT A;  3R60 A;  4XSZ F;  3CDH A;  4XLP F;  1LB2 A;  2GQQ A;  4ZYG A;  2V1D A;  1R5G A;  1JGS A;  3F8N A;  2QUF A;  2HR3 A;  2VBX A;  5LGN A;  1ON1 A;  2FQ3 A;  1W7P B;  1D3Y A;  3GUD A;  1MJA A;  2QQB A;  2X0L A;  1LEB A;  4DQ2 A;  5E8G A;  1IN7 A;  1LJ9 A;  2XGX A;  4Y15 A;  1AOY A;  2HFH A;  2Z3Y A;  4IRH A;  2KIM A;  3MQ0 A;  3L09 A;  2YU3 A;  2BYV E;  2MD5 A;  4M6Y A;  5ERI A;  3WTT C;  4BAY A;  2LNB A;  3FM5 A;  4AIK A;  3M8E A;  1J0R A;  4HX4 A;  4UV9 A;  3DPT A;  1STZ A;  3AAF A;  2MBF A;  5E1Z B;  3N4M A;  3ABU A;  1BC7 C;  2CYY A;  3SHF A;  1BI1 A;  1O7L A;  3T8T A;  1V4R A;  5E17 F;  2JTV A;  3HOS A;  5D6E A;  3QAH A;  4P55 A;  1WSU A;  5DUK A;  5BOX A;  3GZ5 A;  1W7P A;  4I0B A;  5A2Q Z;  3HRU A;  1FSE A;  5CVU A;  3W6J B;  1KYW A;  4G6D A;  3I0T A;  2VBY A;  4U0V A;  1T2K A;  2HTS A;  2QBY A;  1G3Y A;  3WTS C;  3SZP A;  3DEU A;  5L3C A;  2YPR A;  1XSV A;  3WTV C;  4MNU A;  4RB2 C;  1B4A A;  1QGP A;  4A6D A;  2ZO4 A;  3I71 A;  5HS8 A;  3F6O A;  2WV0 A;  5L3D A;  2A5Y B;  2W57 A;  4P5O A;  5K5R A;  5D4S A;  3TO7 A;  1XMA A;  5HOO A;  4ZYD A;  5FLX Z;  2XAG A;  4L9T A;  4IHS A;  1Z91 A;  3G3Z A;  3P9I A;  5K5O A;  2EFQ A;  4JK1 X;  4N9I A;  4B8X A;  4N0B A;  4S04 A;  1O3R A;  4GO1 A;  3JSO A;  3TGN A;  4EVI A;  2LF7 A;  3DP7 A;  3JSP A;  3O3K A;  3U2R A;  5JHU A;  2G9W A;  1SFX A;  2HQR A;  3L7W A;  2ZME B;  3R4K A;  2R7F A;  1KU7 A;  4UHT A;  5AIQ A;  2F5C A;  2ZCW A;  2IVM A;  4WF2 A;  3V8L A;  3M9A A;  2M30 A;  2XAQ A;  1XMK A;  4OU0 A;  3W6K B;  4L18 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...