2LBFA

Solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S acidic ribosomal protein P1
publication title Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
total genus 18
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2011-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lbfA00
2LBFB 2W1OA 4BEHB 2LBFA 3A1YA 4BEHA
chains in the Genus database with same CATH superfamily
5LGNA 4ESBA 2JN6A 1YTYA 1ZRCA 2LKPA 3A4CA 1U8BA 3L2QA 5DD4A 5L3FA 5LGTA 1WJEA 1ENHA 4LG0B 4NC6A 2JZYA 3WU2C 3OOPA 2F4IA 3HSFA 1B4AA 3C7JA 2JK3A 5H2FC 2HDWA 4DYRA 4CCMA 3EYYA 2VKHA 1P4WA 1G8XA 3IP4B 2H6CA 1X1CA 4W97A 3HB9A 2FMYA 3IL2A 3T5XA 1PP7U 4A3JJ 3OOUA 5IP9J 3PIOF 3DLAA 4HW0A 2J5OA 5FD6A 3R0AA 1ZRFA 3IAS2 4Y7NJ 1Y56A 4HNVA 3CJQB 4EM1A 5D5UB 4A3GJ 2JA5J 3EYIA 2RQPA 5IY5H 4EJTA 3TW6A 2DW4A 2FF4A 1PJRA 3KYLA 2I5UA 2M5WA 3FHZA 3MAJA 4LD5A 4FE4A 2LH9A 4YFNF 5K7HA 5HODA 2K4BA 3N05A 3COAC 2Q2EA 1R5GA 2BY1A 2BY2A 1TT5B 1Z1DA 3CO6C 3S1MJ 2ZSIB 2Y31A 4Y4RA 4IHWA 3HDDA 3SEQA 3PO3J 3SFIA 2NOGA 4NHJA 2DYSH 3R6SA 2XKPA 5HNFA 1RRJA 1I1GA 4LLLA 2HOSA 4N9IA 4P9UA 5GPAA 4ZJZA 3I54A 3VSLA 1T8IA 3JREA 1UJ8A 1WJ5A 5K7ZA 2DBBA 1IW7F 1ETXA 3ZQLA 3HRMA 4BEHB 1MSEC 2LFBA 3CJTB 3RI4A 3IH2A 3CCMI 3B6CA 3HYIA 1MDMB 1X2NA 1IRFA 3C2BA 4V2FA 2R7XA 3D0SA 2CSOA 2QEXI 1YRNB 4UUTA 3RZOJ 1U0JA 1BIBA 4HF2A 3T8TA 4KN7X 1EJ9A 2GZWA 3AAFA 4G6DA 3ZGKA 1ZELA 1PUEE 3JRAA 3QPLA 4PK4A 1X2MA 3IV5A 3CDIA 2PJRB 2L02A 4EM0B 5C3EJ 3SDGA 4U7BA 1C0WA 3F3XA 2GA1A 1QPIA 5GAEJ 3DKYA 1YS7A 2X48A 5C4XJ 4KDPA 1TWGJ 1ZLJA 2M3AA 3LAJA 3H3ZA 1XCBA 2FA5A 3JTHA 5GPCA 4D7MA 3OYCA 3KEYA 2ACJA 5E79C 1YJWI 3JRGA 2IBDA 3VYTB 3CF5F 2LBFB 3WTVC 3HTSB 3S1RJ 1SFUA 1DU0A 4A6DA 3IRRA 4OINF 2OCCH 4G12A 1FMWA 2DU9A 3TDUC 3K1NA 5JLWA 3VB2A 3BC8A 1SAXA 4G7OF 4IO9F 3SHFA 2QLZA 1V5GA 2DA6A 2Y0MA 2VLAA 1ETOA 2Y2ZA 4RM2A 4B48A 1QZEA 1W36C 1OCTC 3OR2C 4AWXB 4BXXJ 1Y6IA 5EEAA 2F5DA 2DT6A 3I4PA 2R7VA 2EWNA 3IKTA 2DLLA 3HOSA 5F64A 3GFLA 3GF2A 4AU7A 2LKXA 1ZLKA 2VKEA 2IS1A 2EIJH 3K4MA 1AKHA 2ECBA 4PSWA 3ZN1A 4HQMA 2UUZA 1P92A 3H35A 4QPOA 2JRTA 3FXOA 1KA8A 5LRRA 1I6HJ 1IN8A 1YX5A 5CYVA 1F43A 5B5EC 1UAAA 3GXOA 4FT8A 1JI8A 4M73A 1K61A 2NS8A 5CQGA 2Y0SA 3DQVC 1OR7A 3HOWJ 1DGRM 2R5YB 2ISYA 5IYCJ 3H9QA 4GYIA 1YW7A 4OIOF 4DYQA 2WV0A 1VQ4I 1O3QA 1FBUA 3AG2H 3FXJA 1DGWY 1X4OA 2BYVE 5TGTA 4CUGA 2HFHA 2E34A 1BOBA 5L3DA 1ZREA 2OTJI 1TQIA 1TP4A 1E3HA 3EUHC 5D4RA 1U5TA 3GTLJ 4MEYF 2G7HA 1AA7A 2EZIA 1JUSA 2RREA 5EYRA 5F0CA 4B3XA 2KJBA 2FX0A 4XM3A 2OPTA 1PP8F 3MZ8A 2CQKA 3DKXA 1MGTA 1LDKB 4P9FA 2XGDA 1VNDA 4EATA 4M9ZA 5KCMA 3GX4X 3GVAA 3ISPA 1VQKI 4DQ2A 2K9LA 2CUJA 3OYIA 2CQ7A 4E7JA 4JK1X 1YLFA 1WCMJ 2R5ZB 4KT6A 5TRDA 4I7HA 2CUZA 3GTPJ 2M0CA 4HF1A 1QBJA 1J0RA 2E60A 2PJPA 1HQCA 2MD0A 1YI2I 1MZBA 4A69C 4AC0A 1SMYF 4WK8F 3PUBA 3TGNA 2FQ3A 1MIJA 2MG4A 2V1DA 4I0BA 3WU0A 2R7TA 2WBMA 1R71A 5F1RA 3CMYA 3QU3A 2FNPA 3PNVA 3CO7C 4HA8A 3K69A 1BI1A 1Z77A 4A3MJ 4HOBA 2E19A 3KP6A 2YR2A 1V55H 2NNNA 2R7DA 4HX8A 3A1YA 5H6QA 3BG3A 3E3VA 1JGGA 3K6GA 2VQGA 4C9YA 4PGGA 1LKXA 1FOKA 4G94A 1FMVA 2VPRA 1TTYA 1MMDA 1ZAOA 3ZQFA 4G7ZF 3ZMDA 3QPSA 1RIOH 1KU7A 3DEUA 1TQPA 4ENMA 4Q5SF 1TWAJ 2VKDA 3ZPLA 2DTZA 2ZB9A 1UFMA 3GFMA 5J8CA 5IYBJ 4OIQF 3O8HA 4XLCA 4K2EA 3K9TA 4M3EA 5GADJ 2LLKA 4A0YA 1KYWA 4HLYA 1BL0A 1BN5A 2KLOA 2D1HA 1Z21A 2VJ5A 2XRNA 2VBZA 2HDDA 2FNAA 5F0HA 3QRFF 4RGSA 2AO9A 5ICCA 3H5RA 5EG0B 3GWZA 1OYWA 2EILH 1T98A 4A3EJ 2OC6A 3F72A 1VQOI 1NK3P 5JR3A 3Q0WA 2DMNA 4XNFA 1IUFA 2E1CA 2UXXA 5B1AH 5E20A 1SAUA 2PLYA 2CS3A 3I55I 3CCEI 2XDVA 1K6YA 2OAZA 3W2VA 2E5ZA 2DAOA 3RKXA 5J3LA 3M1EA 5CVIA 2DFEA 2NVYJ 4F92B 2HVSA 3K4KA 1XTAA 3IRQA 3BPXA 2QUFA 3TW7A 3R4KA 5JI6A 5FLMJ 3RDIA 4ETSA 4XN3A 2M1BA 3TOBA 5D5WB 2L7KA 4PUSA 3UNGC 2Q1ZB 3A0HC 2X0LA 5HS7A 3V7RA 2R4GA 5JVGF 4UUSB 1OCPA 4HNTA 2DPDA 2VOPA 1IN5A 3P7NA 4KNYA 2RC4A 3OYGA 3T1BA 1T2KA 3ZP5A 2XV4S 2O61A 2R7QA 1N75A 1GVJA 1R6RA 2XF6A 3P9KA 3VSKA 5DM7F 3GTGJ 4A0XA 1VQMI 3CC2I 4L9VA 3ZMZA 5E8IA 3WGHA 3LSJA 2XKOA 4MTDA 2VASA 2KP6A 3H0GJ 4AIKA 3SXYA 2I8DA 4ZC3A 1BR2A 3PSIA 1R4MB 5BNGA 3HUGA 2P5LC 4KIFA 3HRUA 1TC3C 5H6RA 2JVHA 2GAUA 1SD7A 3L2WA 3TEDA 1VZ0A 2ZJRF 3GLLA 1Q1VA 5TISC 5JHFA 5A2QZ 1YS6A 2EK5A 3O8GA 3JSPA 2DJIA 4CCOA 3FXLA 2WWYA 3BTCA 3I58A 4AIDA 2P0WA 5FRNA 4GRIA 4Y33A 3DKWA 1XMXA 2D45A 4BQAA 4UXNA 2JA7J 2VE8A 1YJ9I 3M07A 4MO7A 3B73A 4I09A 4Y13A 4Q47A 2VC1A 3FXQA 1YIOA 2W82A 2HKOA 3CUQC 1G59A 3OYHA 2XF7A 5J1RA 2IGKA 2Q0OA 2K9MA 3OWTA 3R60A 4BHBA 1WQ2A 3E6MA 3HBLA 2VJ4A 2Y48A 2OJED 3FHNA 1UHSA 4S05A 2EFWA 4WX9A 2PI0A 2VQLA 2B0LA 4PJ0C 1S72I 1GT0C 3G71I 4BDZA 1UHWA 2Y75A 3LL7A 3BR3A 3NWTA 3GTOJ 1JKRC 1WJBA 4PGHA 1D1BA 3FK6A 3B02A 2H1KA 5M5YJ 3PSFA 3G6EI 2NOJB 1K78A 1QHHD 3IWFA 5ICEA 1JKOC 3RPUA 3CMAI 3DP7A 3DEWA 4KIBA 1F9NA 5E8GA 3WTZA 4O5VA 1MBKA 4WXDA 2KKOA 5A2QK 3L2UA 3BROA 4LG0A 4GCVA 3PJRA 4XKVA 4G7HF 3F22A 6PAXA 4XLNF 5E1ZB 5DD8A 5L3GA 3LNQA 1V5FA 4S0HB 3NWSA 3LSTA 2TRTA 1LJ9A 2Y9YA 1XPXA 4RA2A 4L5IA 4CCJA 2EQRA 2VBYA 1CF7B 3CESA 5BMZA 3J7AY 2KISA 2MYSA 1BM9A 1RETA 2DDAA 4AM3A 1W5TA 2WAQA 3S1NJ 2GOMA 3HKZN 4C3JJ 5LHIA 2WY7Q 1XGNA 2HOTA 5IYDJ 3CCQI 4BUPA 2X1EA 3BG9A 2MLKA 1LUJB 3FXMA 3KETA 2VONA 1YJNI 4HSRA 1O3TA 2CW0F 1GVDA 3A01A 1B8IA 1LE8A 1W5CC 2XHKA 2HWVA 4KMFA 3HEFA 2BZTA 2XAUA 1Z9CA 3RSNA 1KQ8A 2FUG2 1WSUA 2E1NA 2FQ4A 4IXAA 3G1OA 2GQQA 5EGOA 1GV2A 2PBIA 3KP5A 4IEJA 3UR3C 5L3CA 5M5XJ 1BI2A 2RAEA 4M9SA 5M5WJ 2R7WA 2ID3A 4DGWB 4XL9A 3S1QJ 3ZMVA 4BEHA 3WTUC 3OYKA 1WHUA 3PQJA 3F8BA 2QA4I 2CW7A 1H8AC 4EMSA 5D8KB 1O3RA 1R58A 1Y8QB 2GXGA 4II2A 4B44A 1PUFB 2E2JJ 4XORA 3BTLA 1ZQ3P 5CLSA 2GIVA 2V4JC 4A3DJ 3HGYA 1H9TA 1YRNA 3PIPF 5JFRA 2K9SA 4HDUA 3M7GA 1MKMA 2NRAC 4IZZA 2FBHA 4OAYA 4AYBA 2CG4A 3M8FA 2XROA 3KEOA 5CJ9A 3L7WA 2M87A 2V1UA 1QPMA 4AYBN 5EEHA 1S7EA 1UZCA 2HPIA 2OV7A 3GFJA 2K3FA 3OS2A 2LMDA 3M9AA 4XOTA 1IN4A 2OZUA 3WE3A 1J59A 3BG6A 2CJJA 1FTZA 3K4BA 1J9IA 4BL0B 3KEQA 3NQOA 3OL3A 4C2TA 3P5JA 2QF7A 3GTKJ 2COBA 2OD5A 1PVEA 2LNBA 4XKCA 3QP6A 3QYFA 2L4MA 2EV0A 2K3PA 3ZMUA 2PMZA 2NS0A 1VQPI 2Y30A 2H8WA 5IT9Z 3ZN0A 2PMZN 4OAZA 1YE9A 2ZO4A 3BJAA 1VFCA 1CQTA 1HCRA 5DCMA 3V4GA 5E1XA 3GLXA 3FMQA 4A12A 3MFKA 2W00A 1T95A 2OBPA 1XG1A 2A6EF 1WWXA 2EIMH 4RAZA 2RQQA 4IRHA 2QSHX 4XBFA 2V9PA 4DJAA 4LLNA 1OJLA 2F48A 3J7ZI 4BE0A 4LK1F 3BQYA 5F6FA 5FD5A 1XGSA 1HKSA 2PFBA 4UVCA 3UKGA 2DA5A 3IUOA 4AVZA 3GCMA 1TL8A 2X6YA 3EPZA 1JTXA 5ICFA 3KP4A 2E1OA 4HSTA 4L5JA 3TMOA 3C2HA 2P7CB 1DQUA 1I39A 4F93B 2OZ6A 3IH4A 4NQWA 3VYUB 2R5YA 3CUQA 3SZGA 1ETVA 5ICGA 1YG2A 1I50J 3MKYB 1SFOJ 2FBKA 1X4PA 4FQGA 3W6VA 3C18A 1JKQC 2LSOA 1HKTA 4LIVA 4UHTA 4A3BJ 5LEJA 4YELA 3HZJA 3I59B 3BJ6A 3BG5A 3I9V2 1R5ID 1I6XA 2M7BA 2CUEA 2WAFA 1BI0A 3DU6A 1U5TC 2EFOA 1EV7A 2LY1A 3LAPA 5IT9K 2CO5A 2GWRA 1D1CA 4RS8A 4BNCA 3K0LA 2DMQA 2F5VA 2QWWA 3DCFA 3F6OA 4A93J 4MQ9F 2E36A 4BBSJ 1YO5C 1W4MA 3QYEA 3ZCOA 4LLGF 1B6AA 3DTIA 1FNNA 1HDPA 2W24A 3S3OA 2DTRA 4PFOA 5J8FA 2ESHA 4DZPA 3CCSI 5DCFA 1J5YA 2RNJA 5FB2A 1A6IA 2IS4A 3LSMA 4EJUA 2HQNA 3SJMA 2VB6A 4LMYA 4GDFA 1KU2A 4BHPA 3DF8A 3VWBA 4ZH4F 2DQLA 1OCOH 1IN7A 1GDTA 2WAEA 1SC7A 2RNGA 3TO7A 1FC3A 5J6XA 3LA2A 3K70C 5AIPA 3JAMZ 3HSEA 2CV0A 4LITA 2B63J 1IDZA 3G2BA 3T8RA 1Z91A 4DW6A 1S7OA 1M1EB 3BTIA 2WC2A 1B59A 2QKMB 1IXCA 1R49A 4C3HJ 3HPHA 1P9QC 3DEEA 3F23A 3W6JB 1D3YA 1O7FA 3K1MA 4QSHA 2EZLA 5J4VA 3W2WA 3AL0B 2DK5A 4F55A 4Q48A 4U87A 2VXDA 3QAHA 2IA2A 3QODA 3KCCA 5JLXA 3BCAA 4IHSA 2ADUA 2MH9A 2R93J 2K27A 2DODA 5K5RA 1X1PA 1WJDA 1FZPB 5LRSA 4GFBA 1HC8A 2VBXA 2IS6A 4GYGA 2F5EA 4I01A 2GBYA 2ZMEB 1WH5A 2BXZA 2XPVA 4MGRA 4BS9A 5D6FA 3ABMH 2NS7A 2KHMA 3I0TA 3SDBA 2EBIA 4KISA 2MW8A 4ZYAA 3BPVA 1BW5A 5IOZA 3HOVJ 3RKWA 2V9KA 2KRCA 3ASOH 1RUNA 2VT3A 3HL2A 3F8CA 4P55A 1Y0UA 2J5PA 3W2AA 2YU3A 4U0WA 3FF5A 1MMAA 2XPUA 1ORKA 3BJOA 1RI7A 3L2CA 3JAMK 2E1MC 2A6TA 2VI6A 4FISA 2K9QA 4OWRB 1QGPA 4UV9A 2KRHA 1MH4A 3GTQJ 1ACIA 3K4LA 3Q0VA 4BJ5C 4BXFA 3KYCB 1SFEA 1JJ8C 1JT0A 1HSTA 5FKNA 4CZZA 4LFUA 4CO8A 3TOAA 1VQNI 4ABZA 3PL8A 2ELHA 2Y9ZA 4EM2A 2B7EA 4IVNA 1G2HA 4CHUA 1FOYA 3OIOA 1RUOA 4PDKA 2W85A 1TWHJ 2X9DA 2ELKA 1Y1VJ 2R7UA 1OYIA 3JRFA 1ZYRF 4KJZA 1UB9A 2GM4A 4BJ6C 4WF2A 3D5SC 2JJ7A 1UHMA 4KMUX 2H8RA 3HOYJ 5HLTA 3ECHA 5HLHA 1ODDA 1NHAA 1U78A 2RDPA 3ZRGA 4BAYA 3M3YJ 4PJNA 1FJLA 1P4AA 2QQBA 1WZ2A 4FHTA 2O5RA 4XRSA 3WGIA 4RGXA 4HV5A 3CF2A 4KA4A 3JRBA 2B9SA 1ITYA 2GA2A 4B1RA 3FMRA 2Z9OA 4ZYHA 3WHCA 3M8JA 5GAGJ 1XN7A 3CCLI 1BR1A 3DFGA 3K4JA 2ZKZA 1RKTA 2JSPA 3OYMA 1D5YA 4B43A 3ABKH 4MTEA 3OMYA 1O4XA 3KE2A 3R0JA 4OMZA 4IF4A 3GMEA 1MBFA 3LSKA 1HF0A 1DU6A 5C44J 2XAFA 3MQ0A 1FOXA 2R3SA 1A36A 5DTDA 2UXNA 1S8NA 2A5WA 3S93A 1Z7LA 5BPIA 2K85A 5ED4A 1BIAA 3JR9A 2R7OA 1T38A 3KYDB 2DO7A 3S15J 1APLC 1G3YA 2PMUA 1MMSA 2VPLA 2YPRA 1U8RA 4AIHA 1RPWA 3BR6A 3IHUA 3TQNA 2FXAA 2L9VA 4JBAA 4C3IJ 4EJWA 2H6BA 4OIPF 1ZGWA 1ETQA 1ZTRA 1JKPC 4TV7A 3AG1H 2FEZA 3PUFA 2LG4A 3VFZA 1YX3A 1LNWA 4L18B 3CCYA 4A6EA 4H4KC 2IA0A 3KLNA 3L00A 1B1BA 1BC8C 4GXOA 2AXTC 1VQ8I 1UG2A 1JJ6C 4FE7A 1SD4A 4BQOA 4IHVA 2KIUA 2K4JA 2LREA 1LDDA 1Z7UA 2HYGD 2IGNA 3QQAA 3CLQA 1FIAA 3ZR8X 2BBYA 4PJLA 2F2EA 1XSVA 1ZK8A 3IC7A 1ETWA 1IRZA 3FISA 5JHUA 1WPKA 5EEGA 1ZR4A 3H9GA 2AQFA 2ZNZA 2DK8A 3I3LA 1MSFC 3FXUA 1ZG1A 1OCRH 3ELKA 2V6EA 4RDUA 2K7LA 3HTUA 3M4OJ 1G6NA 1KU3A 2X1CA 1PYVA 5K5QA 2G0EA 2H09A 1QQIA 1MBHA 2PMHA 3F6VA 4GO1A 1RR8C 2CRGA 2VC0A 3WTSC 4RAYA 1MNEA 2JRMA 5IOYA 3HOTA 4PZJA 4YEJA 5ILUA 3KP7A 4M9XA 2CH0A 4L0ZB 4XRMA 3I4MJ 1H9GA 3KP2A 2P5VA 1X1BA 3E6DA 4OIRF 2YX4A 2R7ZJ 1MJBA 1YYVA 5ERIA 4UNOA 2JWTA 2Q2EB 3I56I 3H36A 3AFHA 2A3SA 4KUMA 5J47A 1FYKA 3VEPA 3RYRA 3S2WA 3DBRB 4Q4ZF 1GV5A 3WTYC 1MMNA 4HG2A 2AQEA 5M3FJ 3N97A 5L3EA 3REOA 3EDPA 2A69F 2LDUA 5FFZA 1I5ZA 3KPHA 1RESA 2A5YB 2F5FA 2JA6J 1Z67A 2QGUA 1QVTA 4JQFA 1U6GA 2XUBA 3RCOA 2Z99A 4IHXA 1P6RA 1FBSA 4RM3A 4E7KA 2ECCA 3BWGA 3E1SA 3IWZA 3ZMTA 3L2VA 5K1YA 2M0MA 2Z5UA 3K2AA 1CGPA 3Q0UA 4HBLA 2PX9A 3KFWX 1NG7A 3MWMA 4OU0A 3HSRA 5B3SH 1UMQA 2XGCA 2LTPA 5C4JJ 3MVPA 4QWQA 3FKJA 2RV8A 4X6AJ 4CYCA 3ABTA 2BGCA 2EH3A 2DA7A 2LK2A 3GZNB 3GEZA 4HNUA 2HDCA 1JHFA 2MC4A 4NC7A 4RB0A 5LBQA 4D1QA 1KZHA 4ENJA 4YRVA 2VE9A 1FEXA 2L0KA 2G7UA 1MJAA 3FDYA 3JSOA 4YIRX 3OSFA 2I10A 4CCKA 1OPCA 1A04A 5FKLA 2D1VA 3DPTA 3CCJI 2AS5F 1XD7A 2E7WA 3I64A 3HXLA 3BDDA 3TO6A 2LD5A 1F36A 4BY7J 3K7AJ 3FXKA 3M8EA 1OLTA 2WA0A 5GP9A 1L0OC 4HRIA 3S2DJ 1DPUA 1R00A 5AIQA 3W3CA 2JUGA 4J00A 1J09A 1HW1A 2X1DA 4PFPA 4XKWA 3F9KA 2Z3YA 4ZYEA 4JP0A 4UV8A 1XMAA 5DUIA 2QBYB 1SANA 1A35A 1D0XA 1Q1HA 3GFIA 2O6GE 1HKQA 2M4GA 4CGZA 3OYDA 1XC5A 3OV8A 2UWMA 3BZKA 1E0EA 2X6OA 2JPBA 3HIFA 1MBEA 3RKQA 2OCEA 3QPTA 1AKHB 1V3FA 3HM5A 3L2RA 1IO2A 4IRIA 2BW3A 3C1DA 4PSXA 4B09A 2O9LA 3S32A 2DPUA 1T08B 2ZXHA 3E6CC 2BHZA 1FSHA 2P81A 4KIGA 1ON1A 4D5FA 4LB5A 2R7FA 2O03A 1OQYA 1B72A 3HOUJ 2HVRA 4S04A 1JTYA 1IDYA 3SZTA 4M6VA 3BT9A 2VN2A 4I76A 1T0FC 2M30A 4XIDA 3G3ZA 3FM3A 2ZJQF 3JCUC 5CVJA 5F08A 5TJJA 2XIGA 4A3FJ 1Y39A 1LFUP 3OIPA 2A05A 1LPQA 1U5TB 3LQRA 2IJLA 5HS9A 3KZYA 1TLHB 3HHGA 2H94A 2VIXA 1U9OA 1Z05A 1VQ6I 2KIMA 3DBLB 4JX6A 1LQ1A 2TCTA 1J75A 5HVQC 2CQXA 3ONQA 3QYBA 3ZQQA 4XK4A 5F0FA 4BU2A 3CQZJ 3U2RA 1W5SA 1XDSA 1D5VA 3MKZA 2QSGX 2DN0A 4EV0A 3LA3A 2NXNB 5CQEA 4BXUA 4XONA 3G1LA 1YQAA 2A61A 1W0TA 4BHCA 4LOCA 3CD6I 1FP1D 3MKLA 2HKXA 3HOZJ 1IXSB 2MH2A 2FOWA 5HDKA 4UY8I 5EZHA 1BJAA 3TL4X 4ASNA 3HKZA 5EZGA 3VYRB 2DT5A 1Y8RB 3J80Z 2Z16A 4HZFA 3F8FA 1K7AA 1G3TA 2O0YA 3LSGA 1BC7C 3BZCA 4CH7A 2MBFA 4KICA 2LC2A 3OYEA 3TBIA 4D5CA 2RN7A 1W0UA 3NRVA 4RB3C 1EKEA 4XLPF 1WKMA 3RPQA 1WI9A 4FX4A 2DA3A 4ESJA 3HOXJ 4D0PA 1H0MA 2KPMA 4M71A 4P1WA 2X51A 4JX5A 3NAUA 2KMUA 1EA3A 1ZHFA 1XS9A 1E3OC 1Z6TA 3EUKL 4BH9A 3SZPA 5LFAA 4F3QA 2FE3A 3V42A 3SQNA 3ABUA 1A31A 2L9SA 3D5RC 2EJRA 3CCVI 1FP2A 2CU7A 4XLAA 4J19A 4FETA 3N4MA 2BV6A 2ZMEA 2HTJA 4UB8C 3F8NA 4FTHA 1AU7A 2DFFA 5E17F 3M1CA 1MD0A 4V2GA 2EFQA 2L9NA 1KQ9A 1J7KA 2HVQA 3BQZA 3ZMSA 1MDMA 1S9HA 3CTAA 4FX0A 2XVCA 3LSPA 3CZ6A 1SVLA 3V8KA 1MMGA 5EF6A 4CSWA 3VPRA 1GXQA 4RGRA 4B3AA 2PJRA 3MCZA 3FK7A 4HYEA 2O3FA 1Z3XA 1SEUA 3CDLA 2LKSA 3TKYA 3A2KA 3J80K 3OYBA 2KT0A 4M6XA 1X1AA 3KP3A 2IRFG 5L3BA 1HBXG 1I1SA 4EJVA 4ZDLA 5KVRA 3IAM2 3OS1A 1GUUA 3LA7A 1FTTA 1Y1WJ 2LBFA 3DPLC 4UVAA 1MBJA 2JUCA 1FIPA 3E5QA 4QPQA 2GOXB 3V8LA 1H88C 3ZQCA 1IXRC 3ROUA 2XSJC 3GZ6A 3SEZA 2HOAA 3VOEA 3FX3A 2EFPA 3RJPA 4PJMA 4ZZDA 4M3DA 2ZFWA 1QNTA 2W1OA 1MW7A 4R79A 3BOQA 4WXCA 1W36D 4HX4A 2EIKH 5IPAA 2DOEA 1MNMC 2W4SA 3P9IA 2X85A 1V5EA 3DLLF 1OKRA 4MFEA 5D5VB 3BR2A 2CFOA 2R7RA 3S16J 2VQCA 3LFKA 5D5XB 1D8KA 3A03A 4LGWA 4RLQA 4YIFA 4ZDOA 4AIJA 1TW2A 1D8JA 2MC3A 1KONA 3TO9A 1W7PD 4BJTA 3RQIA 1A5JA 3QOPA 2V1NA 1BBYA 2Y69H 1OMIA 3HGGA 4NB5A 1NH3A 2F5CA 3E5UA 1XGOA 4IOCF 3SFZA 3ULQB 1IUYA 4MQVA 4AD9A 2STTA 2LYCA 1Z3YA 2CYYA 1IV8A 2L4AA 4LIUA 2NVTJ 2E5NA 1S6LA 4KITB 4CXFA 2GLOA 2M9HA 1BR4A 2EB7A 4I6ZA 1W7PB 1SD5A 2CW8A 4NNJA 4C30A 1WRJA 4LB6B 1MNDA 4XKBA 2E2IJ 3OYNA 1X58A 3OR1C 3WU1B 3E7LA 3JRHA 3E5XA 2HQAA 3S3NA 1LEBA 2V6CA 2GXAA 3G4SI 4JYKA 2HU9A 1I3QJ 4E6KG 5E3MA 1R9TJ 2ESNA 2OQGA 3B6AA 2XF5A 1DP7P 2PQ8A 1T0FA 1WI3A 4EJOA 3CP8A 1IN6A 3OYLA 4EGZA 4IJAA 4MIMA 1VF9A 4UB6C 2VOOA 2A07F 2IGOA 2MLGA 2HNHA 2VXZA 1DPRA 5E3NA 4E7LA 1LFBA 2M8EA 1ZRDA 3WE2A 2R5ZA 1ZGAA 1UG0A 1SFKA 4A5MA 3KX2A 5KAIC 2OUMA 3LOCA 4IOAF 3QPHA 5E3OA 2Z1DA 5E18F 2DFIA 5H20A 1K78B 4CCNA 5BQTA 4A3KJ 5HNHA 1E3PA 2QSFX 4NDLA 5DYMA 1VQLI 2GXBA 4DBRA 1IC8A 2MABA 2VBWA 5CVUA 3LFUA 3LSRA 3KIOA 2K9NA 2Q8KA 1IRGA 1HLVA 2JA8J 2JMWA 1SD6A 3GBGA 1R22A 1DP3A 3GO5A 4HV6A 1QZYA 4BYYA 2VQHA 2HYFA 4XRFA 2OTLI 2ME0A 1WJCA 5KNLA 1HXDA 2BY0A 2L7MP 4V19K 3FZVA 3S8PA 1GLNA 5HDNA 4X1EA 2XRLA 1D1AA 1VTNC 2ZBKA 3VODA 3CCUI 4CCLA 4IHTA 4XSZF 1XSDA 5K5OA 3K4NA 3CJNA 1POGA 4IQ4A 4RB1A 4L9JA 1JT6A 5EG0A 1K4SA 4YFKF 3A01B 1B8IB 4U88A 1LE8B 1K6OA 1TWCJ 4MEXF 3H3UA 2VT2A 2HXIA 2DA1A 2IA1A 4KT5C 4XLHA 4RAFA 3GYHX 4RAGA 2HZTA 3DTKA 2WB1A 3MMYB 1XGMA 2W48A 4IKFA 5EDNA 2WB1N 5EGOB 2HQRA 1TQMA 1QZZA 5D4SA 4D7NA 1E2XA 5LLQA 2M45A 2NVQJ 4A3LJ 1Z6RA 2UZKA 1F1ZA 1QVUA 2RGVA 2WV1A 4U0VA 1RZ4A 4ZTFA 3QOEA 1R23A 4XLFA 2ZXJA 1HW5A 5HLIA 2OQRA 3FWEA 3ZQHA 2JVGA 5BS6A 4HEA2 3OYAA 1RNLA 4HDVA 3J7YJ 3U9GA 3K4CA 4DOZA 2DMPA 3K2ZA 5GTIC 1P2FA 4UUSA 4RLFA 3ZOBA 2HGCA 4FCYA 3G1MA 3U1DA 2ZC2A 4N0BA 1ZN2A 5FROA 2DMTA 3GTMJ 3BR5A 1JUMA 3ML6A 2FSWA 4YG2F 1IJWC 5FKMA 1UCRA 2DJNA 1G4DA 1S7AA 1ONVA 4JOMA 3PNYA 4CZCA 3WTXC 2LVSA 1TBXA 4M3BA 2DMUA 1IV6A 2V7FA 3ERED 2K86A 1E17A 3ZQIA 4Z6YA 3KZZA 4I98B 4IQJA 1MBGA 2COMA 1NK2P 1MJ9A 1X19A 1EF4A 3JRCA 4RB2C 1R1UA 1NTCA 1O57A 5FKOA 4G8XA 3GTJJ 3S14J 1R1TA 1ZG3A 5DCMB 5CVRA 1FSEA 3BCBA 3GZ5A 5D6EA 2QBYA 2OU2A 1I27A 1N25A 3S2HJ 2Z2SB 4B8XA 4II3A 4WXHA 4ZYDA 2FU4A 3WHBA 1IRXA 4ESFA 4U7DA 3CMEI 2ZFUA 4PJJA 2E2HJ 1B9NA 4WWCA 2V1XA 4DBQA 2QQ9A 4M74A 4Y17A 2F4MB 3I53A 1FOWA 2DA4A 1HW2A 2PEXA 4A3CJ 2VJIA 1H89C 4L9NA 1FYMA 3CC7I 5LD2C 1I3AA 1GHCA 1Y0NA 5F04A 5FO5A 2STWA 4NQWB 3CUQB 3RTRA 2Y0SN 2FOKA 3U1KA 2DA2A 5GTHC 4WCGA 1F4KA 1AOYA 2FMLA 4YFXF 3P9CA 5LGUA 3WODF 3S3MA 3H0DA 5B66C 1T56A 2KRFA 3JW4A 2N8GA 2O7OA 2VJJA 2LP0A 3RQ4A 3EUAA 4OOIA 2IT0A 1TWFJ 2KJCA 4EGYA 2CGPA 3ZQ7A 3WTTC 4BE1A 1ZKGA 4IL6C 3NARA 4ENNA 3CC4I 4BQQA 4IHYA 1KU9A 2QM3A 5FLXZ 2X6XA 2ZXIA 2R92J 2JA2A 2ZNYA 4N4NB 2CWEA 3F21A 2FJ1A 1T33A 2P7VB 1XB4A 3R61A 4BBRJ 4M3FA 4DIQA 2TDXA 3PM1A 3I4NJ 2EV5A 3BLYA 3RYPA 2O8KA 3CJRB 2HOEA 4BDYA 1TT0A 3BZ6A 5F1JA 1CF7A 2M8GX 3H3VK 2HR3A 5F27A 1X3WB 4X0GA 3DWLE 1R7JA 2EFNA 4G6QA 3MN2A 3AKZA 2E7XA 3TDZC 4UVBA 3RZDJ 2M34A 3OYFA 2IGMA 5CVVA 1STZA 5DV5A 2LF8A 3AL0C 1ETYA 1LFPA 4C2UA 2EINH 3LSIA 2DYRH 2ZXWH 3J81Z 4ZTJA 2K40A 4DYCA 2DXIA 3BR0A 3LMMA 2ICWG 3MKWB 2OA4A 1YHQI 3K10A 5IP6A 3E97A 5KHDA 4A3IJ 5DS9A 3KLOA 5GAHJ 2L01A 1WFXA 2KIQA 2ZMEC 2AXLA 4R1HA 3W6KB 1ZG5A 1F5TA 2LRDA 4F7ZA 1FYLA 2VODA 1D0YA 1V54H 2QQAA 5FLXK 3O3KA 1PUFA 1IF1A 3LWFA 1YOVB 3CP2A 1B9MA 2KQRA 4E7HA 2FBIA 4Y3OA 1XCVA 1REPC 5LHGA 3HRSA 3I71A 3FXRA 2HZDA 2BOLA 4F91B 1ON2A 5KAFC 1EH7A 4UUVA 2EZHA 1D0ZA 2V26A 1S29A 2HS5A 1K83J 1KQ0A 3BY6A 1XDUA 3TP3A 5LEKA 5HOOA 4EQQA 3NEUA 4XMYA 4CDGA 5J4YA 2LY2A 1S3JA 3DBHB 3WG9A 1T6SA 1ERDA 1BJZA 3E0JB 1HDDC 5BOXA 1U2WA 2R7SA 2RKHA 1OYYA 1T39A 3J81K 3WGGA 2K02A 5DM6F 4BQNA 2MA3A 5K7FA 2IEKA 1YW8A 4M6YA 5LHHA 2R0QC 1BA5A 2W57A 3Q9VA 2E71A 2Z33A 2P6TA 4ZYGA 4O6JA 3BTJA 2G9WA 1QA6A 1SVOA 4XLEA 4A2UA 5HS8A 4M72A 2QCOA 1K4TA 2YS9A 5FGMA 3BP8A 2JQ7A 4CICA 1OISA 2GIZA 2H1LA 3FBIB 2MGQA 3H1CA 4DZJA 4EVIA 1R4NB 3Q5FA 3VYSB 3V7CA 3WG7H 1R36A 4F52A 1LVKA 1VQ5I 1X3UA 1JXSA 2V79A 1HA8A 2V9VA 4RBOA 1RKWA 2W25A 1BOAA 2CV2A 4G9YA 3FKIJ 3HHHA 3HC7A 2H27A 1QHGA 2XAJA 3JRDA 2NVUB 2QQ8A 2D5VA 1EH8A 3CLOA 3QWLA 3L09A 2XB0X 1U9NA 2ZCWA 4HPQA 3S17J 5DEQA 4D9JA 5J40A 3QP5A 1WGXA 3BR1A 2LF7A 2M2EA 1W7PA 2ETHA 3PO2J 4IPAA 1R1VA 1QRYA 3PNTA 2VUMJ 1O3SA 1TW3A 2BHYA 3I59A 4B47A 1YFHA 1LDJA 3HPGA 3FIWA 1ULYA 4LG3A 2NNYA 1O7LA 4R8HA 1DUXC 4MFDA 4M3GA 4CA0A 1G3SA 3EETA 3RKYA 2ME6A 1G3WA 2YUSA 1WH7A 4XQFA 2IPQX 2VL8A 3Q3SA 4E4HA 2A68F 3CCRI 3DU5A 1W1WE 4MLOA 1N78A 4G6TB 2L54A 3GUDA 1XSXA 4U0YA 3HJEA 3VDXA 2K5CA 2BVMA 2CQQA 2O8XA 2AHQA 3X2QH 1XX5A 3O2PE 3EUHA 2X4HA 4N4OB 2XC7A 2IVMA 4MNUA 1JUPA 2XAQA 5E1WA 3BG7A 2CFXA 2DFHA 3DPUA 2RVCA 2EZKA 1S5LC 1FX7A 3AG3H 4O3MA 2EA4A 1YITI 2DT7B 5FLVA 1R5HA 4XR6A 3EQLF 1NG6A 2XGXA 3K70D 4NUBA 3MZHA 2L9RA 4OMYA 2QZ8A 5KK1A 1TNSA 2DCEA 3HRTA 4BY1J 4FASD 4XOPA 1ZGJA 4B4CA 1SMTA 1SVMA 1XMKA 3OS0A 4BKXA 4PCQA 3PQKA 4I0AA 2L2OA 1HOMA 4J01A 3LSHA 2YU9J 3HG9A 2NYXA 3C3WA 4P5OA 4E70A 1AHDP 3V7SA 1Z0XA 2XB5A 3GW2A 4I02A 2ID6A 5HLGA 2M7AA 4IX7A 2DOFA 1J2XA 5B1BH 4QIWN 1IAWA 4DNCA 2DQRA 3L9FA 4LJZF 1KYZA 4L5EA 3T0YA 3F0CA 3F8MA 1TZLA 5BPDA 2F6CA 2QYOA 2WAQN 3RIRA 4XICA 2XSDC 5J1YA 3CUOA 3FMSA 5FJ8J 1PDNC 4JX4A 1K79A 1RR7A 2XAGA 2BY3A 4XN0A 3PFIA 3ECOA 3TP0A 2W7NA 3JTGA 9ANTA 5M3MJ 2QKLB 2P5KA 2QENA 5IP7J 1VQ9I 2E35A 2CMPA 2DI3A 2FD5A 4L9TA 2WTEA 5IT3A 3OIQA 1ZARA 3FBNB 4KFCA 1JE8A 1RC9A 3JRIA 2OF7A 4XSXF 3D1NI 4RMNA 5FRMA 2HTSA 1N77A 2UV1A 4EEFG 4E7SA 5D8LB 4P96A 1LVAA 2MD5A 4XRSG 2HI3A 3DXJF 3V8JA 2A6HF 2XASA 3ABLH 1FBQA 1USTA 2PN6A 3OSGA 3KZIC 1HSJA 2WY8Q 1P7IA 3MEXA 2P8TA 3ZQGA 2DDBA 2P4WA 2IW5A 2E1MB 4H0EA 3MD2A 3O6BB 2KZVA 4I99C 3SYTA 4N9HA 1JGSA 2KIFA 3J7AO 4Y15A 2QVOA 2ZSHB 2YSRA 3ZXSA 2IP2A 3C2GA 4HLXA 2KZGA 2HPMA 1X1DA 1VQ7I 3IH3A 1FPQA 3PFYA 2EPFA 3OY9A 4Y52J 4E7ZA 1FLIA 4BGDA 3U21A 2NAZA 1UELB 4A0ZA 2P6SA 2W84A 1IGNA 4KYWA 2VKVA 4KN4X 4L0YB 4ENKA 4CYCB 5EJCA 1MH3A 2JSCA 1FT9A 2IAIA 3L1PA 4HX7A 2XAHA 1V4RA 2JT1A 4LK0F 2JPCA 3OL4A 2C6YA 4HQEA 3K1PA 1TNTA 1OFCX 4YIIA 1WVRA 1DDNA 1A6QA 2FRHA 2XGEA 2ZJ2A 2IS2A 4W1UA 3ERMA 5FFXA 1WJFA 1BI3A 4BE2A 1BW6A 2WADA 3H5AA 1JHHA 2XPWA 3E6BA 3CDHA 5CKTA 3G73A 3H9JA 3HUGB 2KDZA 2BE5F 4RGUA 4ON0A 1ZH5A 3CMMA 2ZJPF 2KDOA 2L7FP 5ILVA 5J1UA 1KGSA 2YX7A 4A5NA 4CYDA 3OYJA 4C2MJ 3ESWB 1OCZH 2MSYA 3H92A 2EV6A 2L3DA 1QO0D 3I5UA 1AWCA 2F4OB 4NBQA 2ELJA 1ETKA 3DTEA 3A0BC 2NVXJ 5DUKA 1SFXA 2LY9A 2KL4A 2LR8A 1FY7A 4MHGA 3WTWC 3AG4H 4BACA 3H5NA 4GGGA 4ZZLA 1QU3A 4IRGA 2CQNA 3DV8A 1WJAA 4HF0A 2HYJA 4AVPA 1ZR2A 1P4XA 1OR7C 2KFDA 4ITVA 2HXOA 4I2OA 2ISZA 1FWZA 5CPRB 5AONA 5FKKA 3IKVA 1EH6A 2BEOA 4HAMA 1GXPA 2BW3B 2X6WA 3LQQA 1USSA 1YIJI 2L5QA 2EA2A 1L3LA 3D5LA 2D2WA 3ASNH 3A02A 2M4KA 1U3EM 4ANJA 2JTVA 2HQ5A 3FM5A 1IZ1A 3RPUD 1LB2A 2HEOA 2PG4A 2BXYA 3QU6A 4QLCU 5HDGA 1B72B 3Q9SA 1IG7A 1OCCH 2IXSA 2LOOA 1X3ZB 2BVLA 2CUFA 4E7IA 4ZDPA 4QTRA 2MFZA 1VI0A 4AUXA 2DOAA 2CV1A 5DDGA 1LEAA 5E3LA 1P7JA 2L7ZA 4NC8A 4Z2YA 3MZYA 1YW9A 5JVTA 5ILSA
chains in the Genus database with same CATH topology
4DBQA 4HNUA 2FUG2 2MC4A 4NC7A 4D1QA 3A4CA 3UR3C 3L2QA 4YRVA 2VJIA 1WJEA 2R7WA 4DGWB 5LD2C 3FDYA 4XL9A 2F4IA 4BEHA 2HDWA 3OYKA 4CCMA 2VKHA 4CCKA 3DPTA 2CW7A 1G8XA 4NQWB 3IP4B 3RTRA 1X1CA 4II2A 4B44A 4XORA 3OOUA 2V4JC 3DLAA 3HXLA 4IZZA 3IAS2 4OAYA 1Y56A 4AYBA 3CJQB 3S3MA 1OLTA 2WA0A 3H0DA 4HRIA 3RQ4A 2VJJA 3W3CA 1PJRA 2JUGA 3EUAA 3KYLA 1J09A 2X1DA 4J00A 2LH9A 2HPIA 4PFPA 4XKWA 3F9KA 4BE1A 2OV7A 3N05A 1D0XA 2M4GA 3OS2A 4XOTA 3OYDA 2ZSIB 4BQQA 2UWMA 4Y4RA 2X6XA 2ZXIA 3SEQA 3BG6A 2JA2A 1E0EA 4N4NB 3K4BA 4BL0B 3OL3A 4C2TA 4DIQA 5HNFA 3BLYA 3CJRB 4ZJZA 3VSLA 3L2RA 4BDYA 4XKCA 1TT0A 2BW3A 3QYFA 4PSXA 3S32A 2K3PA 2ZXHA 4X0GA 1WJ5A 2PMZA 3DWLE 4BEHB 3AKZA 4OAZA 1YE9A 3OYFA 2IGMA 2W00A 2HVRA 2R7XA 1T95A 3AL0C 1T0FC 2RQQA 1LFPA 4C2UA 1U0JA 3LSIA 4DJAA 4ZTJA 4BE0A 2DXIA 3LMMA 1ZELA 3ZGKA 3MKWB 4PK4A 2PJRB 3OIPA 3K10A 4U7BA 3IUOA 4AVZA 3DKYA 2VIXA 5KHDA 2X6YA 2M3AA 3EPZA 1WFXA 5HVQC 3QYBA 3ONQA 4HSTA 3TMOA 3ZQQA 3C2HA 4BU2A 1DQUA 3OYCA 3KEYA 2LRDA 1D0YA 3MKZA 4F93B 3VYTB 3VYUB 5CQEA 2LBFB 4XONA 3SZGA 3MKYB 1X4PA 1FMWA 3CP2A 4LIVA 2KQRA 4E7HA 4Y3OA 3BC8A 3TL4X 4YELA 1V5GA 3HKZA 2VLAA 3VYRB 4RM2A 3I9V2 4B48A 2HZDA 2Z16A 2M7BA 2WAFA 2BOLA 4F91B 3DU6A 1W36C 3LSGA 2LY1A 1D0ZA 2V26A 3OR2C 4CH7A 3OYEA 2LC2A 1Y6IA 1D1CA 3TBIA 2F5VA 2DT6A 2R7VA 5HOOA 4XMYA 3HOSA 2LY2A 3QYEA 3ZCOA 1ERDA 2KPMA 4P1WA 3DTIA 4AU7A 2X51A 3E0JB 2KMUA 1EA3A 2R7SA 3K4MA 2IS1A 3S3OA 3EUKL 5LFAA 4PSWA 4PFOA 4F3QA 2UUZA 3V42A 3H35A 4BQNA 4QPOA 2L9SA 3D5RC 2IS4A 3LSMA 4XLAA 4FETA 1YX5A 2VB6A 1UAAA 1JI8A 5CQGA 2Y0SA 3M1CA 4XLEA 3DQVC 3VWBA 1DGRM 2L9NA 3H9QA 2HVQA 2WAEA 2RNGA 1S9HA 3CZ6A 3K70C 2CV0A 1MMGA 4LITA 4CSWA 1DGWY 1X4OA 3FBIB 5TGTA 3G2BA 4CUGA 1BOBA 3VYSB 4F52A 2QKMB 2PJRA 3EUHC 1LVKA 1Z3XA 1HA8A 1AA7A 3HPHA 2CV2A 1P9QC 3HC7A 3DEEA 3A2KA 2RREA 1QHGA 4B3XA 3OYBA 3AL0B 4XM3A 1X1AA 3W2WA 4F55A 4U87A 3DKXA 2VXDA 1LDKB 4HPQA 4ZDLA 3IAM2 3OS1A 4D9JA 4EATA 2LBFA 3DPLC 3QODA 5KCMA 3BCAA 4QPQA 2GOXB 2K9LA 2CUJA 3OYIA 2XSJC 4E7JA 1WJDA 3SEZA 4KT6A 4PJMA 2IS6A 3PNTA 2CUZA 2W1OA 4BS9A 1MW7A 4B47A 2E60A 3SDBA 2KHMA 3HPGA 2MD0A 4LG3A 4R79A 1W36D 4ZYAA 4KISA 4CA0A 2W4SA 3PUBA 2X85A 1V5EA 2V9KA 2R7TA 4XQFA 2VL8A 2WBMA 4E4HA 2KRCA 3DU5A 3PNVA 4MLOA 1N78A 4G6TB 3HL2A 2CFOA 3VDXA 2R7RA 2VQCA 3W2AA 4ZDOA 2K5CA 4RLQA 1MMAA 2BVMA 1KONA 2E1MC 3A1YA 2A6TA 4BJTA 3K6GA 4N4OB 2VQGA 4C9YA 1LKXA 2XC7A 1FMVA 2V1NA 4OWRB 1MMDA 2KRHA 3BG7A 3DPUA 3K4LA 4BJ5C 2LYCA 4BXFA 1Z3YA 2VKDA 4LIUA 2E5NA 4KITB 3PL8A 4XLCA 1BR4A 2DT7B 4XR6A 1NG6A 2CW8A 4NNJA 3K70D 4C30A 4NUBA 2KLOA 2R7UA 1Z21A 1MNDA 2VJ5A 4XKBA 4KJZA 2DCEA 3OYNA 3OR1C 4BJ6C 4FASD 3D5SC 3H5RA 4XOPA 2HQAA 5HLTA 3S3NA 2OC6A 3OS0A 3ZRGA 4XNFA 2L2OA 4PJNA 4J01A 2HU9A 4E6KG 2XF5A 3LSHA 3HG9A 4P5OA 1SAUA 2O5RA 2CS3A 2XDVA 3CF2A 3CP8A 2M7AA 1K6YA 3OYLA 3W2VA 2E5ZA 4IX7A 2IGOA 2HNHA 2VXZA 3M8JA 4E7LA 1BR1A 1TZLA 2F6CA 3K4JA 4F92B 3OYMA 2JSPA 2HVSA 3K4KA 4B43A 1UG0A 3OMYA 1SFKA 3KX2A 2OUMA 4XN3A 2L7KA 3LSKA 4PUSA 4XN0A 3UNGC 2Z1DA 2Q1ZB 2W7NA 4CCNA 2QKLB 5HNHA 2R4GA 4HNTA 2CMPA 4DBRA 2A5WA 3S93A 1Z7LA 3OYGA 2MABA 3OIQA 3FBNB 3LFUA 2R7QA 2R7OA 1N75A 1R6RA 2XF6A 3VSKA 4RMNA 5FRMA 1N77A 3GBGA 2UV1A 4E7SA 1DP3A 2VPLA 2VQHA 2VASA 2KP6A 1WJCA 5KNLA 2WY8Q 2I8DA 4ZC3A 1BR2A 3PSIA 3S8PA 1GLNA 1D1AA 2JVHA 3L2WA 2E1MB 2LG4A 1VZ0A 3MD2A 1YX3A 2KZVA 5JHFA 4CCLA 3SYTA 4H4KC 3ZXSA 2ZSHB 3K4NA 2DJIA 4CCOA 3C2GA 2HPMA 1X1DA 2P0WA 3PFYA 4GRIA 4IQ4A 4Y33A 5FRNA 3OY9A 4E7ZA 4BQOA 4BGDA 3U21A 1UELB 2LREA 2IGNA 2W82A 4XLHA 1G59A 3OYHA 2XF7A 3ZR8X 2IGKA 3DTKA 2WB1A 4PJLA 3MMYB 2K9MA 3OWTA 4IKFA 3OL4A 3H9GA 2AQFA 2VJ4A 3FHNA 3I3LA 2V6EA 2IS2A 2VQLA 4ZTFA 3QOEA 4XLFA 1WJFA 4BDZA 2JVGA 4BE2A 2X1CA 1PYVA 2WADA 3H5AA 3LL7A 4HEA2 3NWTA 3OYAA 5CKTA 1WJBA 1D1BA 3H9JA 3HUGB 3HOTA 1MNEA 3PSFA 2NOJB 3K4CA 4YEJA 3CMMA 2KDOA 4DOZA 3OYJA 1QHHD 2CH0A 4RLFA 1X1BA 2ELJA 3DTEA 2KL4A 2Q2EB 5FROA 3L2UA 3AFHA 4BACA 3H5NA 1QU3A 3PJRA 4XKVA 1WJAA 1MMNA 4HG2A 2AQEA 4ITVA 1OR7C 1V5FA 3NWSA 4JOMA 3PNYA 4CZCA 5CPRB 2V7FA 4CCJA 2BW3B 4JQFA 2X6WA 3CESA 3RCOA 2L5QA 3J7AY 4IQJA 2MYSA 3D5LA 4RM3A 4E7KA 2WAQA 1X19A 2M4KA 2GOMA 4ANJA 3E1SA 3L2VA 3RPUD 2WY7Q 2M0MA 2X1EA 4BUPA 2IXSA 3BCBA 2LOOA 1NG7A 2BVLA 4HSRA 4E7IA 2Z2SB 4ZDPA 4II3A 1IRXA 2MFZA 3FKJA 2DOAA 2CV1A 2ZFUA 4NC8A 4PJJA 2XAUA 3RSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBF B;  2W1O A;  4BEH B;  2LBF A;  3A1Y A;  4BEH A; 
#chains in the Genus database with same CATH topology
 5LGN A;  4ESB A;  2JN6 A;  1YTY A;  1ZRC A;  2LKP A;  3A4C A;  1U8B A;  3L2Q A;  5DD4 A;  5L3F A;  5LGT A;  1WJE A;  1ENH A;  4LG0 B;  4NC6 A;  2JZY A;  3WU2 C;  3OOP A;  2F4I A;  3HSF A;  1B4A A;  3C7J A;  2JK3 A;  5H2F C;  2HDW A;  4DYR A;  4CCM A;  3EYY A;  2VKH A;  1P4W A;  1G8X A;  3IP4 B;  2H6C A;  1X1C A;  4W97 A;  3HB9 A;  2FMY A;  3IL2 A;  3T5X A;  1PP7 U;  4A3J J;  3OOU A;  5IP9 J;  3PIO F;  3DLA A;  4HW0 A;  2J5O A;  5FD6 A;  3R0A A;  1ZRF A;  3IAS 2;  4Y7N J;  1Y56 A;  4HNV A;  3CJQ B;  4EM1 A;  5D5U B;  4A3G J;  2JA5 J;  3EYI A;  2RQP A;  5IY5 H;  4EJT A;  3TW6 A;  2DW4 A;  2FF4 A;  1PJR A;  3KYL A;  2I5U A;  2M5W A;  3FHZ A;  3MAJ A;  4LD5 A;  4FE4 A;  2LH9 A;  4YFN F;  5K7H A;  5HOD A;  2K4B A;  3N05 A;  3COA C;  2Q2E A;  1R5G A;  2BY1 A;  2BY2 A;  1TT5 B;  1Z1D A;  3CO6 C;  3S1M J;  2ZSI B;  2Y31 A;  4Y4R A;  4IHW A;  3HDD A;  3SEQ A;  3PO3 J;  3SFI A;  2NOG A;  4NHJ A;  2DYS H;  3R6S A;  2XKP A;  5HNF A;  1RRJ A;  1I1G A;  4LLL A;  2HOS A;  4N9I A;  4P9U A;  5GPA A;  4ZJZ A;  3I54 A;  3VSL A;  1T8I A;  3JRE A;  1UJ8 A;  1WJ5 A;  5K7Z A;  2DBB A;  1IW7 F;  1ETX A;  3ZQL A;  3HRM A;  4BEH B;  1MSE C;  2LFB A;  3CJT B;  3RI4 A;  3IH2 A;  3CCM I;  3B6C A;  3HYI A;  1MDM B;  1X2N A;  1IRF A;  3C2B A;  4V2F A;  2R7X A;  3D0S A;  2CSO A;  2QEX I;  1YRN B;  4UUT A;  3RZO J;  1U0J A;  1BIB A;  4HF2 A;  3T8T A;  4KN7 X;  1EJ9 A;  2GZW A;  3AAF A;  4G6D A;  3ZGK A;  1ZEL A;  1PUE E;  3JRA A;  3QPL A;  4PK4 A;  1X2M A;  3IV5 A;  3CDI A;  2PJR B;  2L02 A;  4EM0 B;  5C3E J;  3SDG A;  4U7B A;  1C0W A;  3F3X A;  2GA1 A;  1QPI A;  5GAE J;  3DKY A;  1YS7 A;  2X48 A;  5C4X J;  4KDP A;  1TWG J;  1ZLJ A;  2M3A A;  3LAJ A;  3H3Z A;  1XCB A;  2FA5 A;  3JTH A;  5GPC A;  4D7M A;  3OYC A;  3KEY A;  2ACJ A;  5E79 C;  1YJW I;  3JRG A;  2IBD A;  3VYT B;  3CF5 F;  2LBF B;  3WTV C;  3HTS B;  3S1R J;  1SFU A;  1DU0 A;  4A6D A;  3IRR A;  4OIN F;  2OCC H;  4G12 A;  1FMW A;  2DU9 A;  3TDU C;  3K1N A;  5JLW A;  3VB2 A;  3BC8 A;  1SAX A;  4G7O F;  4IO9 F;  3SHF A;  2QLZ A;  1V5G A;  2DA6 A;  2Y0M A;  2VLA A;  1ETO A;  2Y2Z A;  4RM2 A;  4B48 A;  1QZE A;  1W36 C;  1OCT C;  3OR2 C;  4AWX B;  4BXX J;  1Y6I A;  5EEA A;  2F5D A;  2DT6 A;  3I4P A;  2R7V A;  2EWN A;  3IKT A;  2DLL A;  3HOS A;  5F64 A;  3GFL A;  3GF2 A;  4AU7 A;  2LKX A;  1ZLK A;  2VKE A;  2IS1 A;  2EIJ H;  3K4M A;  1AKH A;  2ECB A;  4PSW A;  3ZN1 A;  4HQM A;  2UUZ A;  1P92 A;  3H35 A;  4QPO A;  2JRT A;  3FXO A;  1KA8 A;  5LRR A;  1I6H J;  1IN8 A;  1YX5 A;  5CYV A;  1F43 A;  5B5E C;  1UAA A;  3GXO A;  4FT8 A;  1JI8 A;  4M73 A;  1K61 A;  2NS8 A;  5CQG A;  2Y0S A;  3DQV C;  1OR7 A;  3HOW J;  1DGR M;  2R5Y B;  2ISY A;  5IYC J;  3H9Q A;  4GYI A;  1YW7 A;  4OIO F;  4DYQ A;  2WV0 A;  1VQ4 I;  1O3Q A;  1FBU A;  3AG2 H;  3FXJ A;  1DGW Y;  1X4O A;  2BYV E;  5TGT A;  4CUG A;  2HFH A;  2E34 A;  1BOB A;  5L3D A;  1ZRE A;  2OTJ I;  1TQI A;  1TP4 A;  1E3H A;  3EUH C;  5D4R A;  1U5T A;  3GTL J;  4MEY F;  2G7H A;  1AA7 A;  2EZI A;  1JUS A;  2RRE A;  5EYR A;  5F0C A;  4B3X A;  2KJB A;  2FX0 A;  4XM3 A;  2OPT A;  1PP8 F;  3MZ8 A;  2CQK A;  3DKX A;  1MGT A;  1LDK B;  4P9F A;  2XGD A;  1VND A;  4EAT A;  4M9Z A;  5KCM A;  3GX4 X;  3GVA A;  3ISP A;  1VQK I;  4DQ2 A;  2K9L A;  2CUJ A;  3OYI A;  2CQ7 A;  4E7J A;  4JK1 X;  1YLF A;  1WCM J;  2R5Z B;  4KT6 A;  5TRD A;  4I7H A;  2CUZ A;  3GTP J;  2M0C A;  4HF1 A;  1QBJ A;  1J0R A;  2E60 A;  2PJP A;  1HQC A;  2MD0 A;  1YI2 I;  1MZB A;  4A69 C;  4AC0 A;  1SMY F;  4WK8 F;  3PUB A;  3TGN A;  2FQ3 A;  1MIJ A;  2MG4 A;  2V1D A;  4I0B A;  3WU0 A;  2R7T A;  2WBM A;  1R71 A;  5F1R A;  3CMY A;  3QU3 A;  2FNP A;  3PNV A;  3CO7 C;  4HA8 A;  3K69 A;  1BI1 A;  1Z77 A;  4A3M J;  4HOB A;  2E19 A;  3KP6 A;  2YR2 A;  1V55 H;  2NNN A;  2R7D A;  4HX8 A;  3A1Y A;  5H6Q A;  3BG3 A;  3E3V A;  1JGG A;  3K6G A;  2VQG A;  4C9Y A;  4PGG A;  1LKX A;  1FOK A;  4G94 A;  1FMV A;  2VPR A;  1TTY A;  1MMD A;  1ZAO A;  3ZQF A;  4G7Z F;  3ZMD A;  3QPS A;  1RIO H;  1KU7 A;  3DEU A;  1TQP A;  4ENM A;  4Q5S F;  1TWA J;  2VKD A;  3ZPL A;  2DTZ A;  2ZB9 A;  1UFM A;  3GFM A;  5J8C A;  5IYB J;  4OIQ F;  3O8H A;  4XLC A;  4K2E A;  3K9T A;  4M3E A;  5GAD J;  2LLK A;  4A0Y A;  1KYW A;  4HLY A;  1BL0 A;  1BN5 A;  2KLO A;  2D1H A;  1Z21 A;  2VJ5 A;  2XRN A;  2VBZ A;  2HDD A;  2FNA A;  5F0H A;  3QRF F;  4RGS A;  2AO9 A;  5ICC A;  3H5R A;  5EG0 B;  3GWZ A;  1OYW A;  2EIL H;  1T98 A;  4A3E J;  2OC6 A;  3F72 A;  1VQO I;  1NK3 P;  5JR3 A;  3Q0W A;  2DMN A;  4XNF A;  1IUF A;  2E1C A;  2UXX A;  5B1A H;  5E20 A;  1SAU A;  2PLY A;  2CS3 A;  3I55 I;  3CCE I;  2XDV A;  1K6Y A;  2OAZ A;  3W2V A;  2E5Z A;  2DAO A;  3RKX A;  5J3L A;  3M1E A;  5CVI A;  2DFE A;  2NVY J;  4F92 B;  2HVS A;  3K4K A;  1XTA A;  3IRQ A;  3BPX A;  2QUF A;  3TW7 A;  3R4K A;  5JI6 A;  5FLM J;  3RDI A;  4ETS A;  4XN3 A;  2M1B A;  3TOB A;  5D5W B;  2L7K A;  4PUS A;  3UNG C;  2Q1Z B;  3A0H C;  2X0L A;  5HS7 A;  3V7R A;  2R4G A;  5JVG F;  4UUS B;  1OCP A;  4HNT A;  2DPD A;  2VOP A;  1IN5 A;  3P7N A;  4KNY A;  2RC4 A;  3OYG A;  3T1B A;  1T2K A;  3ZP5 A;  2XV4 S;  2O61 A;  2R7Q A;  1N75 A;  1GVJ A;  1R6R A;  2XF6 A;  3P9K A;  3VSK A;  5DM7 F;  3GTG J;  4A0X A;  1VQM I;  3CC2 I;  4L9V A;  3ZMZ A;  5E8I A;  3WGH A;  3LSJ A;  2XKO A;  4MTD A;  2VAS A;  2KP6 A;  3H0G J;  4AIK A;  3SXY A;  2I8D A;  4ZC3 A;  1BR2 A;  3PSI A;  1R4M B;  5BNG A;  3HUG A;  2P5L C;  4KIF A;  3HRU A;  1TC3 C;  5H6R A;  2JVH A;  2GAU A;  1SD7 A;  3L2W A;  3TED A;  1VZ0 A;  2ZJR F;  3GLL A;  1Q1V A;  5TIS C;  5JHF A;  5A2Q Z;  1YS6 A;  2EK5 A;  3O8G A;  3JSP A;  2DJI A;  4CCO A;  3FXL A;  2WWY A;  3BTC A;  3I58 A;  4AID A;  2P0W A;  5FRN A;  4GRI A;  4Y33 A;  3DKW A;  1XMX A;  2D45 A;  4BQA A;  4UXN A;  2JA7 J;  2VE8 A;  1YJ9 I;  3M07 A;  4MO7 A;  3B73 A;  4I09 A;  4Y13 A;  4Q47 A;  2VC1 A;  3FXQ A;  1YIO A;  2W82 A;  2HKO A;  3CUQ C;  1G59 A;  3OYH A;  2XF7 A;  5J1R A;  2IGK A;  2Q0O A;  2K9M A;  3OWT A;  3R60 A;  4BHB A;  1WQ2 A;  3E6M A;  3HBL A;  2VJ4 A;  2Y48 A;  2OJE D;  3FHN A;  1UHS A;  4S05 A;  2EFW A;  4WX9 A;  2PI0 A;  2VQL A;  2B0L A;  4PJ0 C;  1S72 I;  1GT0 C;  3G71 I;  4BDZ A;  1UHW A;  2Y75 A;  3LL7 A;  3BR3 A;  3NWT A;  3GTO J;  1JKR C;  1WJB A;  4PGH A;  1D1B A;  3FK6 A;  3B02 A;  2H1K A;  5M5Y J;  3PSF A;  3G6E I;  2NOJ B;  1K78 A;  1QHH D;  3IWF A;  5ICE A;  1JKO C;  3RPU A;  3CMA I;  3DP7 A;  3DEW A;  4KIB A;  1F9N A;  5E8G A;  3WTZ A;  4O5V A;  1MBK A;  4WXD A;  2KKO A;  5A2Q K;  3L2U A;  3BRO A;  4LG0 A;  4GCV A;  3PJR A;  4XKV A;  4G7H F;  3F22 A;  6PAX A;  4XLN F;  5E1Z B;  5DD8 A;  5L3G A;  3LNQ A;  1V5F A;  4S0H B;  3NWS A;  3LST A;  2TRT A;  1LJ9 A;  2Y9Y A;  1XPX A;  4RA2 A;  4L5I A;  4CCJ A;  2EQR A;  2VBY A;  1CF7 B;  3CES A;  5BMZ A;  3J7A Y;  2KIS A;  2MYS A;  1BM9 A;  1RET A;  2DDA A;  4AM3 A;  1W5T A;  2WAQ A;  3S1N J;  2GOM A;  3HKZ N;  4C3J J;  5LHI A;  2WY7 Q;  1XGN A;  2HOT A;  5IYD J;  3CCQ I;  4BUP A;  2X1E A;  3BG9 A;  2MLK A;  1LUJ B;  3FXM A;  3KET A;  2VON A;  1YJN I;  4HSR A;  1O3T A;  2CW0 F;  1GVD A;  3A01 A;  1B8I A;  1LE8 A;  1W5C C;  2XHK A;  2HWV A;  4KMF A;  3HEF A;  2BZT A;  2XAU A;  1Z9C A;  3RSN A;  1KQ8 A;  2FUG 2;  1WSU A;  2E1N A;  2FQ4 A;  4IXA A;  3G1O A;  2GQQ A;  5EGO A;  1GV2 A;  2PBI A;  3KP5 A;  4IEJ A;  3UR3 C;  5L3C A;  5M5X J;  1BI2 A;  2RAE A;  4M9S A;  5M5W J;  2R7W A;  2ID3 A;  4DGW B;  4XL9 A;  3S1Q J;  3ZMV A;  4BEH A;  3WTU C;  3OYK A;  1WHU A;  3PQJ A;  3F8B A;  2QA4 I;  2CW7 A;  1H8A C;  4EMS A;  5D8K B;  1O3R A;  1R58 A;  1Y8Q B;  2GXG A;  4II2 A;  4B44 A;  1PUF B;  2E2J J;  4XOR A;  3BTL A;  1ZQ3 P;  5CLS A;  2GIV A;  2V4J C;  4A3D J;  3HGY A;  1H9T A;  1YRN A;  3PIP F;  5JFR A;  2K9S A;  4HDU A;  3M7G A;  1MKM A;  2NRA C;  4IZZ A;  2FBH A;  4OAY A;  4AYB A;  2CG4 A;  3M8F A;  2XRO A;  3KEO A;  5CJ9 A;  3L7W A;  2M87 A;  2V1U A;  1QPM A;  4AYB N;  5EEH A;  1S7E A;  1UZC A;  2HPI A;  2OV7 A;  3GFJ A;  2K3F A;  3OS2 A;  2LMD A;  3M9A A;  4XOT A;  1IN4 A;  2OZU A;  3WE3 A;  1J59 A;  3BG6 A;  2CJJ A;  1FTZ A;  3K4B A;  1J9I A;  4BL0 B;  3KEQ A;  3NQO A;  3OL3 A;  4C2T A;  3P5J A;  2QF7 A;  3GTK J;  2COB A;  2OD5 A;  1PVE A;  2LNB A;  4XKC A;  3QP6 A;  3QYF A;  2L4M A;  2EV0 A;  2K3P A;  3ZMU A;  2PMZ A;  2NS0 A;  1VQP I;  2Y30 A;  2H8W A;  5IT9 Z;  3ZN0 A;  2PMZ N;  4OAZ A;  1YE9 A;  2ZO4 A;  3BJA A;  1VFC A;  1CQT A;  1HCR A;  5DCM A;  3V4G A;  5E1X A;  3GLX A;  3FMQ A;  4A12 A;  3MFK A;  2W00 A;  1T95 A;  2OBP A;  1XG1 A;  2A6E F;  1WWX A;  2EIM H;  4RAZ A;  2RQQ A;  4IRH A;  2QSH X;  4XBF A;  2V9P A;  4DJA A;  4LLN A;  1OJL A;  2F48 A;  3J7Z I;  4BE0 A;  4LK1 F;  3BQY A;  5F6F A;  5FD5 A;  1XGS A;  1HKS A;  2PFB A;  4UVC A;  3UKG A;  2DA5 A;  3IUO A;  4AVZ A;  3GCM A;  1TL8 A;  2X6Y A;  3EPZ A;  1JTX A;  5ICF A;  3KP4 A;  2E1O A;  4HST A;  4L5J A;  3TMO A;  3C2H A;  2P7C B;  1DQU A;  1I39 A;  4F93 B;  2OZ6 A;  3IH4 A;  4NQW A;  3VYU B;  2R5Y A;  3CUQ A;  3SZG A;  1ETV A;  5ICG A;  1YG2 A;  1I50 J;  3MKY B;  1SFO J;  2FBK A;  1X4P A;  4FQG A;  3W6V A;  3C18 A;  1JKQ C;  2LSO A;  1HKT A;  4LIV A;  4UHT A;  4A3B J;  5LEJ A;  4YEL A;  3HZJ A;  3I59 B;  3BJ6 A;  3BG5 A;  3I9V 2;  1R5I D;  1I6X A;  2M7B A;  2CUE A;  2WAF A;  1BI0 A;  3DU6 A;  1U5T C;  2EFO A;  1EV7 A;  2LY1 A;  3LAP A;  5IT9 K;  2CO5 A;  2GWR A;  1D1C A;  4RS8 A;  4BNC A;  3K0L A;  2DMQ A;  2F5V A;  2QWW A;  3DCF A;  3F6O A;  4A93 J;  4MQ9 F;  2E36 A;  4BBS J;  1YO5 C;  1W4M A;  3QYE A;  3ZCO A;  4LLG F;  1B6A A;  3DTI A;  1FNN A;  1HDP A;  2W24 A;  3S3O A;  2DTR A;  4PFO A;  5J8F A;  2ESH A;  4DZP A;  3CCS I;  5DCF A;  1J5Y A;  2RNJ A;  5FB2 A;  1A6I A;  2IS4 A;  3LSM A;  4EJU A;  2HQN A;  3SJM A;  2VB6 A;  4LMY A;  4GDF A;  1KU2 A;  4BHP A;  3DF8 A;  3VWB A;  4ZH4 F;  2DQL A;  1OCO H;  1IN7 A;  1GDT A;  2WAE A;  1SC7 A;  2RNG A;  3TO7 A;  1FC3 A;  5J6X A;  3LA2 A;  3K70 C;  5AIP A;  3JAM Z;  3HSE A;  2CV0 A;  4LIT A;  2B63 J;  1IDZ A;  3G2B A;  3T8R A;  1Z91 A;  4DW6 A;  1S7O A;  1M1E B;  3BTI A;  2WC2 A;  1B59 A;  2QKM B;  1IXC A;  1R49 A;  4C3H J;  3HPH A;  1P9Q C;  3DEE A;  3F23 A;  3W6J B;  1D3Y A;  1O7F A;  3K1M A;  4QSH A;  2EZL A;  5J4V A;  3W2W A;  3AL0 B;  2DK5 A;  4F55 A;  4Q48 A;  4U87 A;  2VXD A;  3QAH A;  2IA2 A;  3QOD A;  3KCC A;  5JLX A;  3BCA A;  4IHS A;  2ADU A;  2MH9 A;  2R93 J;  2K27 A;  2DOD A;  5K5R A;  1X1P A;  1WJD A;  1FZP B;  5LRS A;  4GFB A;  1HC8 A;  2VBX A;  2IS6 A;  4GYG A;  2F5E A;  4I01 A;  2GBY A;  2ZME B;  1WH5 A;  2BXZ A;  2XPV A;  4MGR A;  4BS9 A;  5D6F A;  3ABM H;  2NS7 A;  2KHM A;  3I0T A;  3SDB A;  2EBI A;  4KIS A;  2MW8 A;  4ZYA A;  3BPV A;  1BW5 A;  5IOZ A;  3HOV J;  3RKW A;  2V9K A;  2KRC A;  3ASO H;  1RUN A;  2VT3 A;  3HL2 A;  3F8C A;  4P55 A;  1Y0U A;  2J5P A;  3W2A A;  2YU3 A;  4U0W A;  3FF5 A;  1MMA A;  2XPU A;  1ORK A;  3BJO A;  1RI7 A;  3L2C A;  3JAM K;  2E1M C;  2A6T A;  2VI6 A;  4FIS A;  2K9Q A;  4OWR B;  1QGP A;  4UV9 A;  2KRH A;  1MH4 A;  3GTQ J;  1ACI A;  3K4L A;  3Q0V A;  4BJ5 C;  4BXF A;  3KYC B;  1SFE A;  1JJ8 C;  1JT0 A;  1HST A;  5FKN A;  4CZZ A;  4LFU A;  4CO8 A;  3TOA A;  1VQN I;  4ABZ A;  3PL8 A;  2ELH A;  2Y9Z A;  4EM2 A;  2B7E A;  4IVN A;  1G2H A;  4CHU A;  1FOY A;  3OIO A;  1RUO A;  4PDK A;  2W85 A;  1TWH J;  2X9D A;  2ELK A;  1Y1V J;  2R7U A;  1OYI A;  3JRF A;  1ZYR F;  4KJZ A;  1UB9 A;  2GM4 A;  4BJ6 C;  4WF2 A;  3D5S C;  2JJ7 A;  1UHM A;  4KMU X;  2H8R A;  3HOY J;  5HLT A;  3ECH A;  5HLH A;  1ODD A;  1NHA A;  1U78 A;  2RDP A;  3ZRG A;  4BAY A;  3M3Y J;  4PJN A;  1FJL A;  1P4A A;  2QQB A;  1WZ2 A;  4FHT A;  2O5R A;  4XRS A;  3WGI A;  4RGX A;  4HV5 A;  3CF2 A;  4KA4 A;  3JRB A;  2B9S A;  1ITY A;  2GA2 A;  4B1R A;  3FMR A;  2Z9O A;  4ZYH A;  3WHC A;  3M8J A;  5GAG J;  1XN7 A;  3CCL I;  1BR1 A;  3DFG A;  3K4J A;  2ZKZ A;  1RKT A;  2JSP A;  3OYM A;  1D5Y A;  4B43 A;  3ABK H;  4MTE A;  3OMY A;  1O4X A;  3KE2 A;  3R0J A;  4OMZ A;  4IF4 A;  3GME A;  1MBF A;  3LSK A;  1HF0 A;  1DU6 A;  5C44 J;  2XAF A;  3MQ0 A;  1FOX A;  2R3S A;  1A36 A;  5DTD A;  2UXN A;  1S8N A;  2A5W A;  3S93 A;  1Z7L A;  5BPI A;  2K85 A;  5ED4 A;  1BIA A;  3JR9 A;  2R7O A;  1T38 A;  3KYD B;  2DO7 A;  3S15 J;  1APL C;  1G3Y A;  2PMU A;  1MMS A;  2VPL A;  2YPR A;  1U8R A;  4AIH A;  1RPW A;  3BR6 A;  3IHU A;  3TQN A;  2FXA A;  2L9V A;  4JBA A;  4C3I J;  4EJW A;  2H6B A;  4OIP F;  1ZGW A;  1ETQ A;  1ZTR A;  1JKP C;  4TV7 A;  3AG1 H;  2FEZ A;  3PUF A;  2LG4 A;  3VFZ A;  1YX3 A;  1LNW A;  4L18 B;  3CCY A;  4A6E A;  4H4K C;  2IA0 A;  3KLN A;  3L00 A;  1B1B A;  1BC8 C;  4GXO A;  2AXT C;  1VQ8 I;  1UG2 A;  1JJ6 C;  4FE7 A;  1SD4 A;  4BQO A;  4IHV A;  2KIU A;  2K4J A;  2LRE A;  1LDD A;  1Z7U A;  2HYG D;  2IGN A;  3QQA A;  3CLQ A;  1FIA A;  3ZR8 X;  2BBY A;  4PJL A;  2F2E A;  1XSV A;  1ZK8 A;  3IC7 A;  1ETW A;  1IRZ A;  3FIS A;  5JHU A;  1WPK A;  5EEG A;  1ZR4 A;  3H9G A;  2AQF A;  2ZNZ A;  2DK8 A;  3I3L A;  1MSF C;  3FXU A;  1ZG1 A;  1OCR H;  3ELK A;  2V6E A;  4RDU A;  2K7L A;  3HTU A;  3M4O J;  1G6N A;  1KU3 A;  2X1C A;  1PYV A;  5K5Q A;  2G0E A;  2H09 A;  1QQI A;  1MBH A;  2PMH A;  3F6V A;  4GO1 A;  1RR8 C;  2CRG A;  2VC0 A;  3WTS C;  4RAY A;  1MNE A;  2JRM A;  5IOY A;  3HOT A;  4PZJ A;  4YEJ A;  5ILU A;  3KP7 A;  4M9X A;  2CH0 A;  4L0Z B;  4XRM A;  3I4M J;  1H9G A;  3KP2 A;  2P5V A;  1X1B A;  3E6D A;  4OIR F;  2YX4 A;  2R7Z J;  1MJB A;  1YYV A;  5ERI A;  4UNO A;  2JWT A;  2Q2E B;  3I56 I;  3H36 A;  3AFH A;  2A3S A;  4KUM A;  5J47 A;  1FYK A;  3VEP A;  3RYR A;  3S2W A;  3DBR B;  4Q4Z F;  1GV5 A;  3WTY C;  1MMN A;  4HG2 A;  2AQE A;  5M3F J;  3N97 A;  5L3E A;  3REO A;  3EDP A;  2A69 F;  2LDU A;  5FFZ A;  1I5Z A;  3KPH A;  1RES A;  2A5Y B;  2F5F A;  2JA6 J;  1Z67 A;  2QGU A;  1QVT A;  4JQF A;  1U6G A;  2XUB A;  3RCO A;  2Z99 A;  4IHX A;  1P6R A;  1FBS A;  4RM3 A;  4E7K A;  2ECC A;  3BWG A;  3E1S A;  3IWZ A;  3ZMT A;  3L2V A;  5K1Y A;  2M0M A;  2Z5U A;  3K2A A;  1CGP A;  3Q0U A;  4HBL A;  2PX9 A;  3KFW X;  1NG7 A;  3MWM A;  4OU0 A;  3HSR A;  5B3S H;  1UMQ A;  2XGC A;  2LTP A;  5C4J J;  3MVP A;  4QWQ A;  3FKJ A;  2RV8 A;  4X6A J;  4CYC A;  3ABT A;  2BGC A;  2EH3 A;  2DA7 A;  2LK2 A;  3GZN B;  3GEZ A;  4HNU A;  2HDC A;  1JHF A;  2MC4 A;  4NC7 A;  4RB0 A;  5LBQ A;  4D1Q A;  1KZH A;  4ENJ A;  4YRV A;  2VE9 A;  1FEX A;  2L0K A;  2G7U A;  1MJA A;  3FDY A;  3JSO A;  4YIR X;  3OSF A;  2I10 A;  4CCK A;  1OPC A;  1A04 A;  5FKL A;  2D1V A;  3DPT A;  3CCJ I;  2AS5 F;  1XD7 A;  2E7W A;  3I64 A;  3HXL A;  3BDD A;  3TO6 A;  2LD5 A;  1F36 A;  4BY7 J;  3K7A J;  3FXK A;  3M8E A;  1OLT A;  2WA0 A;  5GP9 A;  1L0O C;  4HRI A;  3S2D J;  1DPU A;  1R00 A;  5AIQ A;  3W3C A;  2JUG A;  4J00 A;  1J09 A;  1HW1 A;  2X1D A;  4PFP A;  4XKW A;  3F9K A;  2Z3Y A;  4ZYE A;  4JP0 A;  4UV8 A;  1XMA A;  5DUI A;  2QBY B;  1SAN A;  1A35 A;  1D0X A;  1Q1H A;  3GFI A;  2O6G E;  1HKQ A;  2M4G A;  4CGZ A;  3OYD A;  1XC5 A;  3OV8 A;  2UWM A;  3BZK A;  1E0E A;  2X6O A;  2JPB A;  3HIF A;  1MBE A;  3RKQ A;  2OCE A;  3QPT A;  1AKH B;  1V3F A;  3HM5 A;  3L2R A;  1IO2 A;  4IRI A;  2BW3 A;  3C1D A;  4PSX A;  4B09 A;  2O9L A;  3S32 A;  2DPU A;  1T08 B;  2ZXH A;  3E6C C;  2BHZ A;  1FSH A;  2P81 A;  4KIG A;  1ON1 A;  4D5F A;  4LB5 A;  2R7F A;  2O03 A;  1OQY A;  1B72 A;  3HOU J;  2HVR A;  4S04 A;  1JTY A;  1IDY A;  3SZT A;  4M6V A;  3BT9 A;  2VN2 A;  4I76 A;  1T0F C;  2M30 A;  4XID A;  3G3Z A;  3FM3 A;  2ZJQ F;  3JCU C;  5CVJ A;  5F08 A;  5TJJ A;  2XIG A;  4A3F J;  1Y39 A;  1LFU P;  3OIP A;  2A05 A;  1LPQ A;  1U5T B;  3LQR A;  2IJL A;  5HS9 A;  3KZY A;  1TLH B;  3HHG A;  2H94 A;  2VIX A;  1U9O A;  1Z05 A;  1VQ6 I;  2KIM A;  3DBL B;  4JX6 A;  1LQ1 A;  2TCT A;  1J75 A;  5HVQ C;  2CQX A;  3ONQ A;  3QYB A;  3ZQQ A;  4XK4 A;  5F0F A;  4BU2 A;  3CQZ J;  3U2R A;  1W5S A;  1XDS A;  1D5V A;  3MKZ A;  2QSG X;  2DN0 A;  4EV0 A;  3LA3 A;  2NXN B;  5CQE A;  4BXU A;  4XON A;  3G1L A;  1YQA A;  2A61 A;  1W0T A;  4BHC A;  4LOC A;  3CD6 I;  1FP1 D;  3MKL A;  2HKX A;  3HOZ J;  1IXS B;  2MH2 A;  2FOW A;  5HDK A;  4UY8 I;  5EZH A;  1BJA A;  3TL4 X;  4ASN A;  3HKZ A;  5EZG A;  3VYR B;  2DT5 A;  1Y8R B;  3J80 Z;  2Z16 A;  4HZF A;  3F8F A;  1K7A A;  1G3T A;  2O0Y A;  3LSG A;  1BC7 C;  3BZC A;  4CH7 A;  2MBF A;  4KIC A;  2LC2 A;  3OYE A;  3TBI A;  4D5C A;  2RN7 A;  1W0U A;  3NRV A;  4RB3 C;  1EKE A;  4XLP F;  1WKM A;  3RPQ A;  1WI9 A;  4FX4 A;  2DA3 A;  4ESJ A;  3HOX J;  4D0P A;  1H0M A;  2KPM A;  4M71 A;  4P1W A;  2X51 A;  4JX5 A;  3NAU A;  2KMU A;  1EA3 A;  1ZHF A;  1XS9 A;  1E3O C;  1Z6T A;  3EUK L;  4BH9 A;  3SZP A;  5LFA A;  4F3Q A;  2FE3 A;  3V42 A;  3SQN A;  3ABU A;  1A31 A;  2L9S A;  3D5R C;  2EJR A;  3CCV I;  1FP2 A;  2CU7 A;  4XLA A;  4J19 A;  4FET A;  3N4M A;  2BV6 A;  2ZME A;  2HTJ A;  4UB8 C;  3F8N A;  4FTH A;  1AU7 A;  2DFF A;  5E17 F;  3M1C A;  1MD0 A;  4V2G A;  2EFQ A;  2L9N A;  1KQ9 A;  1J7K A;  2HVQ A;  3BQZ A;  3ZMS A;  1MDM A;  1S9H A;  3CTA A;  4FX0 A;  2XVC A;  3LSP A;  3CZ6 A;  1SVL A;  3V8K A;  1MMG A;  5EF6 A;  4CSW A;  3VPR A;  1GXQ A;  4RGR A;  4B3A A;  2PJR A;  3MCZ A;  3FK7 A;  4HYE A;  2O3F A;  1Z3X A;  1SEU A;  3CDL A;  2LKS A;  3TKY A;  3A2K A;  3J80 K;  3OYB A;  2KT0 A;  4M6X A;  1X1A A;  3KP3 A;  2IRF G;  5L3B A;  1HBX G;  1I1S A;  4EJV A;  4ZDL A;  5KVR A;  3IAM 2;  3OS1 A;  1GUU A;  3LA7 A;  1FTT A;  1Y1W J;  2LBF A;  3DPL C;  4UVA A;  1MBJ A;  2JUC A;  1FIP A;  3E5Q A;  4QPQ A;  2GOX B;  3V8L A;  1H88 C;  3ZQC A;  1IXR C;  3ROU A;  2XSJ C;  3GZ6 A;  3SEZ A;  2HOA A;  3VOE A;  3FX3 A;  2EFP A;  3RJP A;  4PJM A;  4ZZD A;  4M3D A;  2ZFW A;  1QNT A;  2W1O A;  1MW7 A;  4R79 A;  3BOQ A;  4WXC A;  1W36 D;  4HX4 A;  2EIK H;  5IPA A;  2DOE A;  1MNM C;  2W4S A;  3P9I A;  2X85 A;  1V5E A;  3DLL F;  1OKR A;  4MFE A;  5D5V B;  3BR2 A;  2CFO A;  2R7R A;  3S16 J;  2VQC A;  3LFK A;  5D5X B;  1D8K A;  3A03 A;  4LGW A;  4RLQ A;  4YIF A;  4ZDO A;  4AIJ A;  1TW2 A;  1D8J A;  2MC3 A;  1KON A;  3TO9 A;  1W7P D;  4BJT A;  3RQI A;  1A5J A;  3QOP A;  2V1N A;  1BBY A;  2Y69 H;  1OMI A;  3HGG A;  4NB5 A;  1NH3 A;  2F5C A;  3E5U A;  1XGO A;  4IOC F;  3SFZ A;  3ULQ B;  1IUY A;  4MQV A;  4AD9 A;  2STT A;  2LYC A;  1Z3Y A;  2CYY A;  1IV8 A;  2L4A A;  4LIU A;  2NVT J;  2E5N A;  1S6L A;  4KIT B;  4CXF A;  2GLO A;  2M9H A;  1BR4 A;  2EB7 A;  4I6Z A;  1W7P B;  1SD5 A;  2CW8 A;  4NNJ A;  4C30 A;  1WRJ A;  4LB6 B;  1MND A;  4XKB A;  2E2I J;  3OYN A;  1X58 A;  3OR1 C;  3WU1 B;  3E7L A;  3JRH A;  3E5X A;  2HQA A;  3S3N A;  1LEB A;  2V6C A;  2GXA A;  3G4S I;  4JYK A;  2HU9 A;  1I3Q J;  4E6K G;  5E3M A;  1R9T J;  2ESN A;  2OQG A;  3B6A A;  2XF5 A;  1DP7 P;  2PQ8 A;  1T0F A;  1WI3 A;  4EJO A;  3CP8 A;  1IN6 A;  3OYL A;  4EGZ A;  4IJA A;  4MIM A;  1VF9 A;  4UB6 C;  2VOO A;  2A07 F;  2IGO A;  2MLG A;  2HNH A;  2VXZ A;  1DPR A;  5E3N A;  4E7L A;  1LFB A;  2M8E A;  1ZRD A;  3WE2 A;  2R5Z A;  1ZGA A;  1UG0 A;  1SFK A;  4A5M A;  3KX2 A;  5KAI C;  2OUM A;  3LOC A;  4IOA F;  3QPH A;  5E3O A;  2Z1D A;  5E18 F;  2DFI A;  5H20 A;  1K78 B;  4CCN A;  5BQT A;  4A3K J;  5HNH A;  1E3P A;  2QSF X;  4NDL A;  5DYM A;  1VQL I;  2GXB A;  4DBR A;  1IC8 A;  2MAB A;  2VBW A;  5CVU A;  3LFU A;  3LSR A;  3KIO A;  2K9N A;  2Q8K A;  1IRG A;  1HLV A;  2JA8 J;  2JMW A;  1SD6 A;  3GBG A;  1R22 A;  1DP3 A;  3GO5 A;  4HV6 A;  1QZY A;  4BYY A;  2VQH A;  2HYF A;  4XRF A;  2OTL I;  2ME0 A;  1WJC A;  5KNL A;  1HXD A;  2BY0 A;  2L7M P;  4V19 K;  3FZV A;  3S8P A;  1GLN A;  5HDN A;  4X1E A;  2XRL A;  1D1A A;  1VTN C;  2ZBK A;  3VOD A;  3CCU I;  4CCL A;  4IHT A;  4XSZ F;  1XSD A;  5K5O A;  3K4N A;  3CJN A;  1POG A;  4IQ4 A;  4RB1 A;  4L9J A;  1JT6 A;  5EG0 A;  1K4S A;  4YFK F;  3A01 B;  1B8I B;  4U88 A;  1LE8 B;  1K6O A;  1TWC J;  4MEX F;  3H3U A;  2VT2 A;  2HXI A;  2DA1 A;  2IA1 A;  4KT5 C;  4XLH A;  4RAF A;  3GYH X;  4RAG A;  2HZT A;  3DTK A;  2WB1 A;  3MMY B;  1XGM A;  2W48 A;  4IKF A;  5EDN A;  2WB1 N;  5EGO B;  2HQR A;  1TQM A;  1QZZ A;  5D4S A;  4D7N A;  1E2X A;  5LLQ A;  2M45 A;  2NVQ J;  4A3L J;  1Z6R A;  2UZK A;  1F1Z A;  1QVU A;  2RGV A;  2WV1 A;  4U0V A;  1RZ4 A;  4ZTF A;  3QOE A;  1R23 A;  4XLF A;  2ZXJ A;  1HW5 A;  5HLI A;  2OQR A;  3FWE A;  3ZQH A;  2JVG A;  5BS6 A;  4HEA 2;  3OYA A;  1RNL A;  4HDV A;  3J7Y J;  3U9G A;  3K4C A;  4DOZ A;  2DMP A;  3K2Z A;  5GTI C;  1P2F A;  4UUS A;  4RLF A;  3ZOB A;  2HGC A;  4FCY A;  3G1M A;  3U1D A;  2ZC2 A;  4N0B A;  1ZN2 A;  5FRO A;  2DMT A;  3GTM J;  3BR5 A;  1JUM A;  3ML6 A;  2FSW A;  4YG2 F;  1IJW C;  5FKM A;  1UCR A;  2DJN A;  1G4D A;  1S7A A;  1ONV A;  4JOM A;  3PNY A;  4CZC A;  3WTX C;  2LVS A;  1TBX A;  4M3B A;  2DMU A;  1IV6 A;  2V7F A;  3ERE D;  2K86 A;  1E17 A;  3ZQI A;  4Z6Y A;  3KZZ A;  4I98 B;  4IQJ A;  1MBG A;  2COM A;  1NK2 P;  1MJ9 A;  1X19 A;  1EF4 A;  3JRC A;  4RB2 C;  1R1U A;  1NTC A;  1O57 A;  5FKO A;  4G8X A;  3GTJ J;  3S14 J;  1R1T A;  1ZG3 A;  5DCM B;  5CVR A;  1FSE A;  3BCB A;  3GZ5 A;  5D6E A;  2QBY A;  2OU2 A;  1I27 A;  1N25 A;  3S2H J;  2Z2S B;  4B8X A;  4II3 A;  4WXH A;  4ZYD A;  2FU4 A;  3WHB A;  1IRX A;  4ESF A;  4U7D A;  3CME I;  2ZFU A;  4PJJ A;  2E2H J;  1B9N A;  4WWC A;  2V1X A;  4DBQ A;  2QQ9 A;  4M74 A;  4Y17 A;  2F4M B;  3I53 A;  1FOW A;  2DA4 A;  1HW2 A;  2PEX A;  4A3C J;  2VJI A;  1H89 C;  4L9N A;  1FYM A;  3CC7 I;  5LD2 C;  1I3A A;  1GHC A;  1Y0N A;  5F04 A;  5FO5 A;  2STW A;  4NQW B;  3CUQ B;  3RTR A;  2Y0S N;  2FOK A;  3U1K A;  2DA2 A;  5GTH C;  4WCG A;  1F4K A;  1AOY A;  2FML A;  4YFX F;  3P9C A;  5LGU A;  3WOD F;  3S3M A;  3H0D A;  5B66 C;  1T56 A;  2KRF A;  3JW4 A;  2N8G A;  2O7O A;  2VJJ A;  2LP0 A;  3RQ4 A;  3EUA A;  4OOI A;  2IT0 A;  1TWF J;  2KJC A;  4EGY A;  2CGP A;  3ZQ7 A;  3WTT C;  4BE1 A;  1ZKG A;  4IL6 C;  3NAR A;  4ENN A;  3CC4 I;  4BQQ A;  4IHY A;  1KU9 A;  2QM3 A;  5FLX Z;  2X6X A;  2ZXI A;  2R92 J;  2JA2 A;  2ZNY A;  4N4N B;  2CWE A;  3F21 A;  2FJ1 A;  1T33 A;  2P7V B;  1XB4 A;  3R61 A;  4BBR J;  4M3F A;  4DIQ A;  2TDX A;  3PM1 A;  3I4N J;  2EV5 A;  3BLY A;  3RYP A;  2O8K A;  3CJR B;  2HOE A;  4BDY A;  1TT0 A;  3BZ6 A;  5F1J A;  1CF7 A;  2M8G X;  3H3V K;  2HR3 A;  5F27 A;  1X3W B;  4X0G A;  3DWL E;  1R7J A;  2EFN A;  4G6Q A;  3MN2 A;  3AKZ A;  2E7X A;  3TDZ C;  4UVB A;  3RZD J;  2M34 A;  3OYF A;  2IGM A;  5CVV A;  1STZ A;  5DV5 A;  2LF8 A;  3AL0 C;  1ETY A;  1LFP A;  4C2U A;  2EIN H;  3LSI A;  2DYR H;  2ZXW H;  3J81 Z;  4ZTJ A;  2K40 A;  4DYC A;  2DXI A;  3BR0 A;  3LMM A;  2ICW G;  3MKW B;  2OA4 A;  1YHQ I;  3K10 A;  5IP6 A;  3E97 A;  5KHD A;  4A3I J;  5DS9 A;  3KLO A;  5GAH J;  2L01 A;  1WFX A;  2KIQ A;  2ZME C;  2AXL A;  4R1H A;  3W6K B;  1ZG5 A;  1F5T A;  2LRD A;  4F7Z A;  1FYL A;  2VOD A;  1D0Y A;  1V54 H;  2QQA A;  5FLX K;  3O3K A;  1PUF A;  1IF1 A;  3LWF A;  1YOV B;  3CP2 A;  1B9M A;  2KQR A;  4E7H A;  2FBI A;  4Y3O A;  1XCV A;  1REP C;  5LHG A;  3HRS A;  3I71 A;  3FXR A;  2HZD A;  2BOL A;  4F91 B;  1ON2 A;  5KAF C;  1EH7 A;  4UUV A;  2EZH A;  1D0Z A;  2V26 A;  1S29 A;  2HS5 A;  1K83 J;  1KQ0 A;  3BY6 A;  1XDU A;  3TP3 A;  5LEK A;  5HOO A;  4EQQ A;  3NEU A;  4XMY A;  4CDG A;  5J4Y A;  2LY2 A;  1S3J A;  3DBH B;  3WG9 A;  1T6S A;  1ERD A;  1BJZ A;  3E0J B;  1HDD C;  5BOX A;  1U2W A;  2R7S A;  2RKH A;  1OYY A;  1T39 A;  3J81 K;  3WGG A;  2K02 A;  5DM6 F;  4BQN A;  2MA3 A;  5K7F A;  2IEK A;  1YW8 A;  4M6Y A;  5LHH A;  2R0Q C;  1BA5 A;  2W57 A;  3Q9V A;  2E71 A;  2Z33 A;  2P6T A;  4ZYG A;  4O6J A;  3BTJ A;  2G9W A;  1QA6 A;  1SVO A;  4XLE A;  4A2U A;  5HS8 A;  4M72 A;  2QCO A;  1K4T A;  2YS9 A;  5FGM A;  3BP8 A;  2JQ7 A;  4CIC A;  1OIS A;  2GIZ A;  2H1L A;  3FBI B;  2MGQ A;  3H1C A;  4DZJ A;  4EVI A;  1R4N B;  3Q5F A;  3VYS B;  3V7C A;  3WG7 H;  1R36 A;  4F52 A;  1LVK A;  1VQ5 I;  1X3U A;  1JXS A;  2V79 A;  1HA8 A;  2V9V A;  4RBO A;  1RKW A;  2W25 A;  1BOA A;  2CV2 A;  4G9Y A;  3FKI J;  3HHH A;  3HC7 A;  2H27 A;  1QHG A;  2XAJ A;  3JRD A;  2NVU B;  2QQ8 A;  2D5V A;  1EH8 A;  3CLO A;  3QWL A;  3L09 A;  2XB0 X;  1U9N A;  2ZCW A;  4HPQ A;  3S17 J;  5DEQ A;  4D9J A;  5J40 A;  3QP5 A;  1WGX A;  3BR1 A;  2LF7 A;  2M2E A;  1W7P A;  2ETH A;  3PO2 J;  4IPA A;  1R1V A;  1QRY A;  3PNT A;  2VUM J;  1O3S A;  1TW3 A;  2BHY A;  3I59 A;  4B47 A;  1YFH A;  1LDJ A;  3HPG A;  3FIW A;  1ULY A;  4LG3 A;  2NNY A;  1O7L A;  4R8H A;  1DUX C;  4MFD A;  4M3G A;  4CA0 A;  1G3S A;  3EET A;  3RKY A;  2ME6 A;  1G3W A;  2YUS A;  1WH7 A;  4XQF A;  2IPQ X;  2VL8 A;  3Q3S A;  4E4H A;  2A68 F;  3CCR I;  3DU5 A;  1W1W E;  4MLO A;  1N78 A;  4G6T B;  2L54 A;  3GUD A;  1XSX A;  4U0Y A;  3HJE A;  3VDX A;  2K5C A;  2BVM A;  2CQQ A;  2O8X A;  2AHQ A;  3X2Q H;  1XX5 A;  3O2P E;  3EUH A;  2X4H A;  4N4O B;  2XC7 A;  2IVM A;  4MNU A;  1JUP A;  2XAQ A;  5E1W A;  3BG7 A;  2CFX A;  2DFH A;  3DPU A;  2RVC A;  2EZK A;  1S5L C;  1FX7 A;  3AG3 H;  4O3M A;  2EA4 A;  1YIT I;  2DT7 B;  5FLV A;  1R5H A;  4XR6 A;  3EQL F;  1NG6 A;  2XGX A;  3K70 D;  4NUB A;  3MZH A;  2L9R A;  4OMY A;  2QZ8 A;  5KK1 A;  1TNS A;  2DCE A;  3HRT A;  4BY1 J;  4FAS D;  4XOP A;  1ZGJ A;  4B4C A;  1SMT A;  1SVM A;  1XMK A;  3OS0 A;  4BKX A;  4PCQ A;  3PQK A;  4I0A A;  2L2O A;  1HOM A;  4J01 A;  3LSH A;  2YU9 J;  3HG9 A;  2NYX A;  3C3W A;  4P5O A;  4E70 A;  1AHD P;  3V7S A;  1Z0X A;  2XB5 A;  3GW2 A;  4I02 A;  2ID6 A;  5HLG A;  2M7A A;  4IX7 A;  2DOF A;  1J2X A;  5B1B H;  4QIW N;  1IAW A;  4DNC A;  2DQR A;  3L9F A;  4LJZ F;  1KYZ A;  4L5E A;  3T0Y A;  3F0C A;  3F8M A;  1TZL A;  5BPD A;  2F6C A;  2QYO A;  2WAQ N;  3RIR A;  4XIC A;  2XSD C;  5J1Y A;  3CUO A;  3FMS A;  5FJ8 J;  1PDN C;  4JX4 A;  1K79 A;  1RR7 A;  2XAG A;  2BY3 A;  4XN0 A;  3PFI A;  3ECO A;  3TP0 A;  2W7N A;  3JTG A;  9ANT A;  5M3M J;  2QKL B;  2P5K A;  2QEN A;  5IP7 J;  1VQ9 I;  2E35 A;  2CMP A;  2DI3 A;  2FD5 A;  4L9T A;  2WTE A;  5IT3 A;  3OIQ A;  1ZAR A;  3FBN B;  4KFC A;  1JE8 A;  1RC9 A;  3JRI A;  2OF7 A;  4XSX F;  3D1N I;  4RMN A;  5FRM A;  2HTS A;  1N77 A;  2UV1 A;  4EEF G;  4E7S A;  5D8L B;  4P96 A;  1LVA A;  2MD5 A;  4XRS G;  2HI3 A;  3DXJ F;  3V8J A;  2A6H F;  2XAS A;  3ABL H;  1FBQ A;  1UST A;  2PN6 A;  3OSG A;  3KZI C;  1HSJ A;  2WY8 Q;  1P7I A;  3MEX A;  2P8T A;  3ZQG A;  2DDB A;  2P4W A;  2IW5 A;  2E1M B;  4H0E A;  3MD2 A;  3O6B B;  2KZV A;  4I99 C;  3SYT A;  4N9H A;  1JGS A;  2KIF A;  3J7A O;  4Y15 A;  2QVO A;  2ZSH B;  2YSR A;  3ZXS A;  2IP2 A;  3C2G A;  4HLX A;  2KZG A;  2HPM A;  1X1D A;  1VQ7 I;  3IH3 A;  1FPQ A;  3PFY A;  2EPF A;  3OY9 A;  4Y52 J;  4E7Z A;  1FLI A;  4BGD A;  3U21 A;  2NAZ A;  1UEL B;  4A0Z A;  2P6S A;  2W84 A;  1IGN A;  4KYW A;  2VKV A;  4KN4 X;  4L0Y B;  4ENK A;  4CYC B;  5EJC A;  1MH3 A;  2JSC A;  1FT9 A;  2IAI A;  3L1P A;  4HX7 A;  2XAH A;  1V4R A;  2JT1 A;  4LK0 F;  2JPC A;  3OL4 A;  2C6Y A;  4HQE A;  3K1P A;  1TNT A;  1OFC X;  4YII A;  1WVR A;  1DDN A;  1A6Q A;  2FRH A;  2XGE A;  2ZJ2 A;  2IS2 A;  4W1U A;  3ERM A;  5FFX A;  1WJF A;  1BI3 A;  4BE2 A;  1BW6 A;  2WAD A;  3H5A A;  1JHH A;  2XPW A;  3E6B A;  3CDH A;  5CKT A;  3G73 A;  3H9J A;  3HUG B;  2KDZ A;  2BE5 F;  4RGU A;  4ON0 A;  1ZH5 A;  3CMM A;  2ZJP F;  2KDO A;  2L7F P;  5ILV A;  5J1U A;  1KGS A;  2YX7 A;  4A5N A;  4CYD A;  3OYJ A;  4C2M J;  3ESW B;  1OCZ H;  2MSY A;  3H92 A;  2EV6 A;  2L3D A;  1QO0 D;  3I5U A;  1AWC A;  2F4O B;  4NBQ A;  2ELJ A;  1ETK A;  3DTE A;  3A0B C;  2NVX J;  5DUK A;  1SFX A;  2LY9 A;  2KL4 A;  2LR8 A;  1FY7 A;  4MHG A;  3WTW C;  3AG4 H;  4BAC A;  3H5N A;  4GGG A;  4ZZL A;  1QU3 A;  4IRG A;  2CQN A;  3DV8 A;  1WJA A;  4HF0 A;  2HYJ A;  4AVP A;  1ZR2 A;  1P4X A;  1OR7 C;  2KFD A;  4ITV A;  2HXO A;  4I2O A;  2ISZ A;  1FWZ A;  5CPR B;  5AON A;  5FKK A;  3IKV A;  1EH6 A;  2BEO A;  4HAM A;  1GXP A;  2BW3 B;  2X6W A;  3LQQ A;  1USS A;  1YIJ I;  2L5Q A;  2EA2 A;  1L3L A;  3D5L A;  2D2W A;  3ASN H;  3A02 A;  2M4K A;  1U3E M;  4ANJ A;  2JTV A;  2HQ5 A;  3FM5 A;  1IZ1 A;  3RPU D;  1LB2 A;  2HEO A;  2PG4 A;  2BXY A;  3QU6 A;  4QLC U;  5HDG A;  1B72 B;  3Q9S A;  1IG7 A;  1OCC H;  2IXS A;  2LOO A;  1X3Z B;  2BVL A;  2CUF A;  4E7I A;  4ZDP A;  4QTR A;  2MFZ A;  1VI0 A;  4AUX A;  2DOA A;  2CV1 A;  5DDG A;  1LEA A;  5E3L A;  1P7J A;  2L7Z A;  4NC8 A;  4Z2Y A;  3MZY A;  1YW9 A;  5JVT A;  5ILS A; 
#chains in the Genus database with same CATH homology
 4DBQ A;  4HNU A;  2FUG 2;  2MC4 A;  4NC7 A;  4D1Q A;  3A4C A;  3UR3 C;  3L2Q A;  4YRV A;  2VJI A;  1WJE A;  2R7W A;  4DGW B;  5LD2 C;  3FDY A;  4XL9 A;  2F4I A;  4BEH A;  2HDW A;  3OYK A;  4CCM A;  2VKH A;  4CCK A;  3DPT A;  2CW7 A;  1G8X A;  4NQW B;  3IP4 B;  3RTR A;  1X1C A;  4II2 A;  4B44 A;  4XOR A;  3OOU A;  2V4J C;  3DLA A;  3HXL A;  4IZZ A;  3IAS 2;  4OAY A;  1Y56 A;  4AYB A;  3CJQ B;  3S3M A;  1OLT A;  2WA0 A;  3H0D A;  4HRI A;  3RQ4 A;  2VJJ A;  3W3C A;  1PJR A;  2JUG A;  3EUA A;  3KYL A;  1J09 A;  2X1D A;  4J00 A;  2LH9 A;  2HPI A;  4PFP A;  4XKW A;  3F9K A;  4BE1 A;  2OV7 A;  3N05 A;  1D0X A;  2M4G A;  3OS2 A;  4XOT A;  3OYD A;  2ZSI B;  4BQQ A;  2UWM A;  4Y4R A;  2X6X A;  2ZXI A;  3SEQ A;  3BG6 A;  2JA2 A;  1E0E A;  4N4N B;  3K4B A;  4BL0 B;  3OL3 A;  4C2T A;  4DIQ A;  5HNF A;  3BLY A;  3CJR B;  4ZJZ A;  3VSL A;  3L2R A;  4BDY A;  4XKC A;  1TT0 A;  2BW3 A;  3QYF A;  4PSX A;  3S32 A;  2K3P A;  2ZXH A;  4X0G A;  1WJ5 A;  2PMZ A;  3DWL E;  4BEH B;  3AKZ A;  4OAZ A;  1YE9 A;  3OYF A;  2IGM A;  2W00 A;  2HVR A;  2R7X A;  1T95 A;  3AL0 C;  1T0F C;  2RQQ A;  1LFP A;  4C2U A;  1U0J A;  3LSI A;  4DJA A;  4ZTJ A;  4BE0 A;  2DXI A;  3LMM A;  1ZEL A;  3ZGK A;  3MKW B;  4PK4 A;  2PJR B;  3OIP A;  3K10 A;  4U7B A;  3IUO A;  4AVZ A;  3DKY A;  2VIX A;  5KHD A;  2X6Y A;  2M3A A;  3EPZ A;  1WFX A;  5HVQ C;  3QYB A;  3ONQ A;  4HST A;  3TMO A;  3ZQQ A;  3C2H A;  4BU2 A;  1DQU A;  3OYC A;  3KEY A;  2LRD A;  1D0Y A;  3MKZ A;  4F93 B;  3VYT B;  3VYU B;  5CQE A;  2LBF B;  4XON A;  3SZG A;  3MKY B;  1X4P A;  1FMW A;  3CP2 A;  4LIV A;  2KQR A;  4E7H A;  4Y3O A;  3BC8 A;  3TL4 X;  4YEL A;  1V5G A;  3HKZ A;  2VLA A;  3VYR B;  4RM2 A;  3I9V 2;  4B48 A;  2HZD A;  2Z16 A;  2M7B A;  2WAF A;  2BOL A;  4F91 B;  3DU6 A;  1W36 C;  3LSG A;  2LY1 A;  1D0Z A;  2V26 A;  3OR2 C;  4CH7 A;  3OYE A;  2LC2 A;  1Y6I A;  1D1C A;  3TBI A;  2F5V A;  2DT6 A;  2R7V A;  5HOO A;  4XMY A;  3HOS A;  2LY2 A;  3QYE A;  3ZCO A;  1ERD A;  2KPM A;  4P1W A;  3DTI A;  4AU7 A;  2X51 A;  3E0J B;  2KMU A;  1EA3 A;  2R7S A;  3K4M A;  2IS1 A;  3S3O A;  3EUK L;  5LFA A;  4PSW A;  4PFO A;  4F3Q A;  2UUZ A;  3V42 A;  3H35 A;  4BQN A;  4QPO A;  2L9S A;  3D5R C;  2IS4 A;  3LSM A;  4XLA A;  4FET A;  1YX5 A;  2VB6 A;  1UAA A;  1JI8 A;  5CQG A;  2Y0S A;  3M1C A;  4XLE A;  3DQV C;  3VWB A;  1DGR M;  2L9N A;  3H9Q A;  2HVQ A;  2WAE A;  2RNG A;  1S9H A;  3CZ6 A;  3K70 C;  2CV0 A;  1MMG A;  4LIT A;  4CSW A;  1DGW Y;  1X4O A;  3FBI B;  5TGT A;  3G2B A;  4CUG A;  1BOB A;  3VYS B;  4F52 A;  2QKM B;  2PJR A;  3EUH C;  1LVK A;  1Z3X A;  1HA8 A;  1AA7 A;  3HPH A;  2CV2 A;  1P9Q C;  3HC7 A;  3DEE A;  3A2K A;  2RRE A;  1QHG A;  4B3X A;  3OYB A;  3AL0 B;  4XM3 A;  1X1A A;  3W2W A;  4F55 A;  4U87 A;  3DKX A;  2VXD A;  1LDK B;  4HPQ A;  4ZDL A;  3IAM 2;  3OS1 A;  4D9J A;  4EAT A;  2LBF A;  3DPL C;  3QOD A;  5KCM A;  3BCA A;  4QPQ A;  2GOX B;  2K9L A;  2CUJ A;  3OYI A;  2XSJ C;  4E7J A;  1WJD A;  3SEZ A;  4KT6 A;  4PJM A;  2IS6 A;  3PNT A;  2CUZ A;  2W1O A;  4BS9 A;  1MW7 A;  4B47 A;  2E60 A;  3SDB A;  2KHM A;  3HPG A;  2MD0 A;  4LG3 A;  4R79 A;  1W36 D;  4ZYA A;  4KIS A;  4CA0 A;  2W4S A;  3PUB A;  2X85 A;  1V5E A;  2V9K A;  2R7T A;  4XQF A;  2VL8 A;  2WBM A;  4E4H A;  2KRC A;  3DU5 A;  3PNV A;  4MLO A;  1N78 A;  4G6T B;  3HL2 A;  2CFO A;  3VDX A;  2R7R A;  2VQC A;  3W2A A;  4ZDO A;  2K5C A;  4RLQ A;  1MMA A;  2BVM A;  1KON A;  2E1M C;  3A1Y A;  2A6T A;  4BJT A;  3K6G A;  4N4O B;  2VQG A;  4C9Y A;  1LKX A;  2XC7 A;  1FMV A;  2V1N A;  4OWR B;  1MMD A;  2KRH A;  3BG7 A;  3DPU A;  3K4L A;  4BJ5 C;  2LYC A;  4BXF A;  1Z3Y A;  2VKD A;  4LIU A;  2E5N A;  4KIT B;  3PL8 A;  4XLC A;  1BR4 A;  2DT7 B;  4XR6 A;  1NG6 A;  2CW8 A;  4NNJ A;  3K70 D;  4C30 A;  4NUB A;  2KLO A;  2R7U A;  1Z21 A;  1MND A;  2VJ5 A;  4XKB A;  4KJZ A;  2DCE A;  3OYN A;  3OR1 C;  4BJ6 C;  4FAS D;  3D5S C;  3H5R A;  4XOP A;  2HQA A;  5HLT A;  3S3N A;  2OC6 A;  3OS0 A;  3ZRG A;  4XNF A;  2L2O A;  4PJN A;  4J01 A;  2HU9 A;  4E6K G;  2XF5 A;  3LSH A;  3HG9 A;  4P5O A;  1SAU A;  2O5R A;  2CS3 A;  2XDV A;  3CF2 A;  3CP8 A;  2M7A A;  1K6Y A;  3OYL A;  3W2V A;  2E5Z A;  4IX7 A;  2IGO A;  2HNH A;  2VXZ A;  3M8J A;  4E7L A;  1BR1 A;  1TZL A;  2F6C A;  3K4J A;  4F92 B;  3OYM A;  2JSP A;  2HVS A;  3K4K A;  4B43 A;  1UG0 A;  3OMY A;  1SFK A;  3KX2 A;  2OUM A;  4XN3 A;  2L7K A;  3LSK A;  4PUS A;  4XN0 A;  3UNG C;  2Z1D A;  2Q1Z B;  2W7N A;  4CCN A;  2QKL B;  5HNH A;  2R4G A;  4HNT A;  2CMP A;  4DBR A;  2A5W A;  3S93 A;  1Z7L A;  3OYG A;  2MAB A;  3OIQ A;  3FBN B;  3LFU A;  2R7Q A;  2R7O A;  1N75 A;  1R6R A;  2XF6 A;  3VSK A;  4RMN A;  5FRM A;  1N77 A;  3GBG A;  2UV1 A;  4E7S A;  1DP3 A;  2VPL A;  2VQH A;  2VAS A;  2KP6 A;  1WJC A;  5KNL A;  2WY8 Q;  2I8D A;  4ZC3 A;  1BR2 A;  3PSI A;  3S8P A;  1GLN A;  1D1A A;  2JVH A;  3L2W A;  2E1M B;  2LG4 A;  1VZ0 A;  3MD2 A;  1YX3 A;  2KZV A;  5JHF A;  4CCL A;  3SYT A;  4H4K C;  3ZXS A;  2ZSH B;  3K4N A;  2DJI A;  4CCO A;  3C2G A;  2HPM A;  1X1D A;  2P0W A;  3PFY A;  4GRI A;  4IQ4 A;  4Y33 A;  5FRN A;  3OY9 A;  4E7Z A;  4BQO A;  4BGD A;  3U21 A;  1UEL B;  2LRE A;  2IGN A;  2W82 A;  4XLH A;  1G59 A;  3OYH A;  2XF7 A;  3ZR8 X;  2IGK A;  3DTK A;  2WB1 A;  4PJL A;  3MMY B;  2K9M A;  3OWT A;  4IKF A;  3OL4 A;  3H9G A;  2AQF A;  2VJ4 A;  3FHN A;  3I3L A;  2V6E A;  2IS2 A;  2VQL A;  4ZTF A;  3QOE A;  4XLF A;  1WJF A;  4BDZ A;  2JVG A;  4BE2 A;  2X1C A;  1PYV A;  2WAD A;  3H5A A;  3LL7 A;  4HEA 2;  3NWT A;  3OYA A;  5CKT A;  1WJB A;  1D1B A;  3H9J A;  3HUG B;  3HOT A;  1MNE A;  3PSF A;  2NOJ B;  3K4C A;  4YEJ A;  3CMM A;  2KDO A;  4DOZ A;  3OYJ A;  1QHH D;  2CH0 A;  4RLF A;  1X1B A;  2ELJ A;  3DTE A;  2KL4 A;  2Q2E B;  5FRO A;  3L2U A;  3AFH A;  4BAC A;  3H5N A;  1QU3 A;  3PJR A;  4XKV A;  1WJA A;  1MMN A;  4HG2 A;  2AQE A;  4ITV A;  1OR7 C;  1V5F A;  3NWS A;  4JOM A;  3PNY A;  4CZC A;  5CPR B;  2V7F A;  4CCJ A;  2BW3 B;  4JQF A;  2X6W A;  3CES A;  3RCO A;  2L5Q A;  3J7A Y;  4IQJ A;  2MYS A;  3D5L A;  4RM3 A;  4E7K A;  2WAQ A;  1X19 A;  2M4K A;  2GOM A;  4ANJ A;  3E1S A;  3L2V A;  3RPU D;  2WY7 Q;  2M0M A;  2X1E A;  4BUP A;  2IXS A;  3BCB A;  2LOO A;  1NG7 A;  2BVL A;  4HSR A;  4E7I A;  2Z2S B;  4ZDP A;  4II3 A;  1IRX A;  2MFZ A;  3FKJ A;  2DOA A;  2CV1 A;  2ZFU A;  4NC8 A;  4PJJ A;  2XAU A;  3RSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...