2LBFA

Solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S acidic ribosomal protein P1
publication title Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
total genus 18
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2011-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lbfA00
4BEHB 2LBFA 2W1OA 3A1YA 4BEHA 2LBFB
chains in the Genus database with same CATH superfamily
1RUOA 3CF5F 2HGCA 1MSFC 3H3VK 2Y75A 3MMYB 5EGOB 1FYLA 4G9YA 2ID6A 1DP7P 1PDNC 4G8XA 4A69C 4XLPF 3TL4X 5C3EJ 1ETKA 1ZHFA 3HEFA 2EIKH 3LSPA 2STTA 2MW8A 5H6RA 3WG9A 2NRAC 1MKMA 4PK4A 2OUMA 3DCFA 3ZMSA 4G7OF 4DZJA 2AO9A 1N77A 2ME0A 4EJWA 3HSRA 3BG3A 3M1CA 4RA2A 1STZA 2YR2A 4XICA 1J09A 2TRTA 4A3BJ 1ETOA 3KYCB 3HJEA 1TNSA 1KYZA 2Z5UA 5E20A 4ZC3A 1NK3P 2OJED 1SD7A 3B02A 4B48A 4DGWB 3RJPA 4V2FA 4PJMA 4MHGA 3A03A 3K69A 1J75A 4UB8C 3S32A 2TDXA 2W25A 3H5RA 3E5XA 4BEHB 1K61A 4CYDA 2E5ZA 2A68F 4KA4A 4LOCA 3L2CA 3LMMA 3GFMA 2B7EA 4N9HA 4WXDA 5DDGA 4PJLA 2COMA 2VC0A 4A2UA 2Y31A 2HDWA 5E79C 1WJDA 2DDBA 4D0PA 3PNYA 1U5TA 3O3KA 3S1NJ 2HTSA 1WZ2A 4ZJZA 1UMQA 3JAMZ 2VT2A 4AIJA 3ROUA 1XSXA 2L54A 1XGMA 3FBIB 1FMWA 2PQ8A 2VKHA 3KP5A 2ZJQF 5GPAA 4E6KG 1SD4A 1FBUA 1IN5A 2R5ZB 2HTJA 3FISA 4H4KC 5ERIA 3ZMUA 4MO7A 1OPCA 3F8NA 3V7RA 4UHTA 2ZMEB 3KCCA 1IO2A 1P9QC 4MFEA 1IUYA 5FKKA 4BHCA 3DTIA 3HDDA 4BJ6C 4BQAA 1R23A 1NTCA 3QU3A 4EJOA 5E3NA 4FE7A 3BDDA 2MC4A 2ZXJA 4LB6B 1T8IA 4LIVA 4Y15A 2VE9A 2EV6A 2PJPA 2M34A 2O03A 2XKPA 4B8XA 2D2WA 2OA4A 1Z05A 3CMYA 4I99C 1U8BA 1VQKI 3J7AO 5KCMA 1MMGA 2BZTA 2K85A 4JYKA 1H9GA 1FBSA 1ZGJA 3A4CA 4D5FA 1TT0A 2R7VA 1P2FA 2RV8A 3GO5A 4RB2C 2Y30A 3KEOA 3CTAA 2R7SA 1OYWA 1I1GA 5DS9A 1OFCX 4UUVA 1B8IB 1DUXC 1VTNC 3BQYA 1AHDP 4NQWA 3MKLA 1V54H 4II3A 2JA2A 5H6QA 1O3TA 1YI2I 3I3LA 3REOA 3AG3H 4KIGA 3HZJA 3JRGA 3OV8A 1AKHA 1EJ9A 3JREA 1Z77A 2BY0A 1MBJA 4C2UA 2ISZA 4AVPA 4J00A 3AAFA 1WJ5A 1K6OA 2BHYA 2QGUA 3E6BA 4M3GA 3ULQB 3OYEA 2IP2A 1QHGA 4MTEA 3AG1H 4BHPA 1YIJI 3HM5A 3K1PA 3HG9A 2JVGA 1F36A 4MQVA 1G3YA 3HRTA 2QA4I 1TQMA 1G4DA 4XQFA 3G6EI 4Y4RA 5CVUA 3GTMJ 1S8NA 1LQ1A 2C6YA 3ZPLA 2ISYA 2KLOA 2OZUA 3K4JA 2I5UA 3T5XA 2VBZA 5L3EA 3CMAI 4PFPA 4ZYAA 5F0FA 5IYDJ 2OCEA 2QF7A 1BJAA 3V8LA 3LQRA 5FRMA 5FFXA 1PUFA 1W7PB 4EM2A 1UCRA 1YTYA 2M45A 2KRFA 2DODA 2E7XA 2HFHA 2NOJB 4LJZF 3Q3SA 4ASNA 5D5UB 1Y1WJ 3I4MJ 3TP0A 4F3QA 3K0LA 3GFJA 3COAC 3HYIA 5KVRA 4BGDA 4KISA 3BPVA 3HSEA 2RGVA 1RETA 1CGPA 3ERMA 3BZCA 1ZR2A 2BXYA 3HOSA 2R7TA 3OMYA 1YW8A 5B3SH 5LHIA 2MSYA 4UXNA 2ELJA 1IGNA 3L2RA 2KIFA 2XAGA 3DBLB 4ZZDA 1M1EB 3I5UA 5IOYA 3I58A 4AVZA 3W6JB 3ZXSA 2CU7A 3PFIA 2HI3A 1LVKA 2XPUA 2VBYA 4UV8A 2GXAA 2CUEA 3S1MJ 2UV1A 4XRSG 1K4SA 1UAAA 2KDOA 2BY3A 2RQPA 2W85A 4F7ZA 4G6DA 3KZIC 1U8RA 4EM0B 1B4AA 2MBFA 3BZ6A 3NEUA 1YS7A 4Y33A 1MD0A 2E36A 3CP2A 3K4KA 3PIPF 2ZNZA 3CF2A 2ZFWA 4XKVA 4M74A 4LK0F 5FRNA 3OIOA 1NHAA 1YJWI 4C30A 3KP7A 5KAIC 1SMYF 2ECCA 5BNGA 3RI4A 1DDNA 4WCGA 3HOYJ 2XAHA 5JVTA 2KMUA 3QQAA 1ZAOA 3ZN0A 3VYRB 2NVQJ 5DEQA 4AWXB 4BXXJ 3BR6A 2ESNA 3WTXC 2JA7J 3IAM2 3G73A 2XGDA 1S72I 3C1DA 2IT0A 2MFZA 2VKDA 5GP9A 3EQLF 5KHDA 1VQ9I 1V4RA 1H89C 1ETYA 3A0BC 5L3DA 2CW0F 2LDUA 3O2PE 3E5UA 5J8FA 4GYIA 3E5QA 2COBA 3EUHC 1FOKA 2JK3A 3SJMA 1F9NA 2KIMA 2IXSA 1SFOJ 1IZ1A 3CESA 4G94A 4YIIA 3GUDA 5F0CA 2JUCA 3HOTA 3ZQQA 4QPOA 2HDCA 1MJ9A 3UKGA 1JKPC 3K6GA 1O3QA 2VPRA 4D7MA 1KQ9A 1TT5B 1XS9A 2EZKA 4A3CJ 1IUFA 1X3ZB 2V9KA 1FPQA 5IP9J 2ELHA 4XLCA 1ZN2A 2W57A 3OYDA 2ICWG 2HYJA 2E1MC 1O3SA 4UB6C 4XL9A 1R4MB 2NNNA 5CVIA 5FKOA 2LY1A 3CUQC 3F6OA 2X1DA 5C4XJ 4AD9A 1AA7A 3BJAA 2MLKA 2BVLA 4QWQA 2OZ6A 2P81A 2HQ5A 4JX6A 3HKZA 5ED4A 4WXCA 2L02A 2OTJI 3LSMA 2QQAA 3DEUA 5HVQC 5F1RA 3WU1B 3S17J 1WGXA 3LSGA 5JHFA 1Q1HA 1SVOA 3LSTA 3BG6A 3QP6A 1BC7C 1MGTA 1ZLJA 1YE9A 5EEHA 4JBAA 4K2EA 1ETQA 4RM3A 1LB2A 4X6AJ 3WE2A 1X1PA 1XG1A 3OWTA 2DTZA 2WY8Q 4HV5A 5DM7F 4CSWA 2K9NA 1YW9A 4YRVA 1RR8C 5HNHA 2XIGA 2VIXA 3OYLA 1TTYA 1WPKA 3JSPA 3G1OA 4PFOA 4IHWA 1LDKB 4AC0A 1UJ8A 3QPHA 4B44A 4GYGA 3DXJF 1ZYRF 3FM5A 3I71A 4IHVA 2NS7A 2XRLA 1G59A 1FX7A 3HOVJ 4JX5A 3CCYA 4CYCA 3ZN1A 2YSRA 3FK6A 1WKMA 4AIKA 1Z0XA 1BBYA 4GFBA 1JHFA 4BE0A 3S3NA 2X6YA 1X3UA 2A05A 3NAUA 4OMYA 4CHUA 3VWBA 1P7IA 4A3LJ 4HV6A 4P9UA 2QLZA 1B6AA 5BPDA 3AL0C 5FGMA 3DEWA 5FD5A 1J5YA 2NYXA 1R00A 4P1WA 5J47A 1HCRA 5LHHA 1YLFA 1PUFB 4RAFA 1WJBA 2D5VA 3ZCOA 3FIWA 3DP7A 3DTKA 2RAEA 3GZNB 1NH3A 2VN2A 3ZMVA 4KMUX 2Y9YA 1W0UA 1X19A 4IL6C 5FKMA 2KJCA 2QUFA 3RZDJ 2OV7A 3WHCA 2DMPA 3S15J 4L9TA 2ZFUA 2IGMA 1D1AA 1QQIA 3JTGA 1Z1DA 2UXXA 2WY7Q 3BOQA 4O6JA 4QPQA 3FXKA 4HLYA 1JT0A 4D1QA 1U5TC 3M8FA 3SEQA 4RAYA 2YPRA 4W1UA 5FO5A 4E70A 3OOPA 5K7HA 2DPDA 2CQKA 5ICEA 4IF4A 1IRGA 3WGHA 3CCQI 3UNGC 4L5JA 2H1LA 2DK8A 2QCOA 3M9AA 5GAHJ 1IXCA 1T98A 4HPQA 2ZKZA 1SVLA 3K4MA 1ZH5A 4C2TA 4A3JJ 4BBRJ 4EATA 1WHUA 3ABTA 1Z91A 4BXUA 4HEA2 4ZTFA 2ACJA 1V3FA 1T33A 4IVNA 3W3CA 3LFUA 1Z67A 4C2MJ 3CCLI 1L3LA 2A61A 2HVSA 5GTIC 2A3SA 2EFNA 3DU6A 3M3YJ 2JA8J 1OCCH 1R5HA 3K4CA 4CO8A 1TNTA 4A3EJ 3HOXJ 1A31A 2F4MB 1SAUA 4RLFA 3BTJA 4M73A 3T0YA 3OSGA 1B9MA 2M4KA 4CUGA 3VSKA 4PJ0C 3WTUC 2J5OA 2NVYJ 1FIAA 3PL8A 4RGRA 3NWSA 1OCPA 3WTWC 4CH7A 2DA6A 1AWCA 3DPLC 4Y7NJ 1YRNB 5CVJA 2E1NA 5LHGA 1FWZA 5FKNA 5GPCA 3FHZA 3MEXA 1MZBA 1TWHJ 3SDGA 3TOBA 4BEHA 4ZTJA 1D1BA 4CCNA 1ACIA 2Z99A 4I7HA 1SFXA 1T6SA 2OD5A 1S9HA 2CG4A 3FMQA 3F21A 2CWEA 1MBEA 4XONA 3OIPA 5HLHA 3SDBA 3BG7A 5IYBJ 4HF0A 3H9QA 4M9ZA 2Y2ZA 3L2WA 3ML6A 2L0KA 3ZQ7A 1XTAA 4M9XA 1XX5A 1LFBA 1ENHA 4DIQA 1KU7A 3JRAA 4XLHA 3JRHA 3F8MA 4EV0A 5EG0B 3KZYA 2OAZA 3H9GA 1VQPI 2R5ZA 4Q47A 5HOOA 3CC4I 4IRIA 2ECBA 2DW4A 2CW8A 4U87A 4BAYA 5C44J 3QYFA 4EJUA 2W84A 2GBYA 5ICGA 1TW3A 4MQ9F 2P7CB 2DFIA 2LG4A 5DYMA 5LRSA 2ZMEA 3P7NA 3CCUI 3HGYA 2FA5A 4M72A 4DBQA 2L5QA 1V55H 3HIFA 3E6DA 3ZQFA 2F5CA 2LF8A 1APLC 2EA4A 2XGEA 1BW6A 2W00A 2O8KA 5E1WA 1VQLI 1LE8B 1HW1A 5A2QZ 3JW4A 4RDUA 4DYQA 3RPQA 4A6DA 2FBHA 3BTLA 2MC3A 1V5EA 3J80K 2IPQX 2Z9OA 3ZQCA 3C2HA 1T2KA 4EEFG 3Q0UA 3VDXA 2H1KA 3E6CC 1REPC 1BI2A 2LF7A 3VYSB 2DPUA 4HAMA 1WJFA 3OYIA 1KA8A 3DKYA 3R6SA 2DAOA 1SFEA 2GAUA 4LG3A 2GXBA 3HSFA 2J5PA 1O7LA 2W4SA 1GLNA 1VNDA 5KAFC 5GADJ 1FT9A 5K7FA 4CYCB 4KFCA 4Z2YA 1C0WA 2DA7A 2GA1A 4JK1X 1SEUA 3GTKJ 3S2DJ 3H92A 4BUPA 3LSJA 2WB1A 5GAGJ 2M0CA 4A3GJ 3TEDA 2V26A 5IT9Z 2N8GA 4ENJA 4M3BA 2IA0A 4XMYA 2KRHA 2DOAA 2FU4A 3RCOA 4LITA 5D5WB 5K7ZA 2MH9A 5TISC 2L7MP 3K9TA 2V79A 4ENMA 2CQ7A 3MAJA 4HZFA 4WF2A 2EQRA 5LGNA 3DPUA 1OJLA 2O8XA 4WX9A 2RVCA 3ZQIA 2K86A 1Z7UA 2XF5A 2AXTC 1Y6IA 2LVSA 4CCMA 1W7PA 4RGXA 2ZCWA 1A36A 2LD5A 4RB0A 4XRMA 4RS8A 5LFAA 2HXIA 3QPTA 1PJRA 2XDVA 4M71A 4LFUA 5FLVA 2YUSA 2UXNA 5J1YA 4RGSA 5F08A 1YQAA 2QENA 5B66C 1TC3C 4G7HF 1BN5A 2K27A 1G8XA 4XNFA 3HRUA 1ITYA 2V1DA 5D8KB 2XHKA 2EZHA 2WTEA 4O5VA 1KGSA 1S29A 4U0VA 5CQEA 2FBKA 2MH2A 1RZ4A 4YELA 2LLKA 4B09A 1E0EA 1QNTA 1R36A 3U2RA 1Y39A 1VQ6I 4BY7J 1LDJA 4YFKF 2DFHA 3I56I 2OC6A 3OYCA 3C7JA 1HA8A 1FYMA 1TQIA 3P5JA 4N4OB 4BHBA 4I6ZA 1W5TA 1XSDA 1E3OC 2BXZA 3PSIA 1YITI 1R58A 3FZVA 3F6VA 3MFKA 4BDYA 1W7PD 4DJAA 2V7FA 2PMHA 1ULYA 2M8EA 4I01A 4RLQA 4OWRB 3WU2C 1Z3XA 2GWRA 5HLTA 1GT0C 1MNMC 3QODA 1SFKA 3GEZA 3M4OJ 1QZEA 2HPIA 4U0YA 1D8JA 2VI6A 2BBYA 4Y13A 2HZTA 3GTLJ 2A6HF 3CQZJ 1UHWA 5DCMA 3BTCA 4BJ5C 1SVMA 2ZJRF 2CRGA 2OQRA 4N9IA 1I6HJ 2JQ7A 2A6EF 2RNJA 3HTSB 1ODDA 4XKBA 2VJ5A 4UVBA 1BC8C 3I54A 4UV9A 1ONVA 4N0BA 2HKOA 2JPCA 2K7LA 5KK1A 2R7UA 1D8KA 3WTTC 4HRIA 2ZSHB 3JSOA 2VKEA 2X6OA 4ABZA 1QU3A 4UNOA 1P6RA 2WV0A 1G3WA 3PNTA 3ZQHA 4E7HA 4HNUA 2XAUA 2QQ9A 2CFOA 1I27A 1FLIA 4A0ZA 2ZXIA 1MH4A 3BLYA 3FWEA 1E17A 4GO1A 2KZVA 2R3SA 3S16J 5D8LB 2XAQA 2E7WA 3BT9A 2A07F 2VQCA 3NQOA 1AU7A 2G7HA 5EJCA 2FEZA 4C3HJ 4EGZA 1O3RA 3KE2A 3PO2J 5ICFA 4RBOA 4FX0A 2ME6A 3OL4A 2M9HA 2XB0X 4IRGA 1OYYA 2FSWA 3WODF 3WGGA 2DT6A 1VFCA 2DMQA 5IT3A 3V7SA 1MNDA 2LC2A 3ABUA 1W1WE 4WWCA 1DP3A 3GTQJ 3QPSA 2E71A 1S6LA 5HDNA 2Z16A 1ZRDA 1WQ2A 4Y17A 5DD8A 3DV8A 3DQVC 1WI9A 3FDYA 5J6XA 2EFQA 3GZ5A 4FT8A 2YU9J 1QVTA 5CLSA 3MZYA 1D0ZA 4XR6A 4IOCF 1GV5A 1F5TA 3L2UA 2IA2A 3H9JA 1A5JA 2V6EA 5BPIA 3F8BA 1TWAJ 4IRHA 1Z6TA 3BR0A 1YYVA 4ESFA 2BY1A 1RR7A 2FXAA 4HOBA 1HW5A 3LAPA 4EQQA 3CO7C 3FXOA 3SQNA 1KQ8A 3RKYA 1FTTA 2Q0OA 5D6FA 1MBFA 2BOLA 2VQLA 4B3AA 4P9FA 1D5YA 3SXYA 2Q1ZB 3V8JA 2OCCH 3HBLA 3BR3A 2AQEA 2LOOA 5JI6A 2EZIA 4NDLA 2BEOA 4XKWA 5EEAA 3OSFA 2VODA 4XOPA 3LL7A 1ZTRA 2X9DA 4LMYA 1ZELA 5EDNA 2H8RA 2E2IJ 2JSPA 1XCVA 5HDKA 2F4OB 5JLWA 2M8GX 1V5GA 4HQEA 1BIAA 1K79A 5E1ZB 5FLXZ 1IRXA 2JN6A 5D5VB 3GTOJ 2EFOA 2HXOA 2X1EA 2Y69H 5M5XJ 1T38A 1MMSA 1JT6A 2G0EA 2VLAA 3UR3C 3LSIA 2DXIA 2L9SA 3BZKA 3GX4X 1XGOA 1XCBA 2CV0A 1LFUP 1I50J 3TMOA 3D5RC 2M4GA 1HQCA 2HVQA 1O4XA 3A2KA 1D0YA 3JRBA 2KL4A 2M7BA 2JSCA 2F4IA 3HPHA 1PP8F 1VF9A 3QYBA 3OIQA 2V4JC 2R92J 1HOMA 1BR2A 5KNLA 4J01A 3SZTA 2GOXB 2VE8A 3VB2A 1K83J 2V9VA 3LQQA 3OYMA 4DBRA 1TBXA 5LEKA 3CCVI 4HLXA 1LFPA 2YX7A 1X1AA 1DPRA 2WAQN 4KICA 1VQ4I 2ZMEC 4U7DA 3JAMK 3D5LA 1WWXA 9ANTA 3N05A 1R1VA 2AQFA 2GZWA 1UELB 3IC7A 4IX7A 1IC8A 1K78A 5TRDA 4CICA 1BL0A 1QPMA 3QPLA 2WADA 3A02A 3S3MA 1ZLKA 2KIQA 2ZJ2A 4S04A 3HRMA 4F92B 2OTLI 5DCMB 1YIOA 2IA1A 2L7ZA 1RC9A 1N78A 1JKQC 2Y9ZA 1Y8RB 2VQHA 5AIQA 4JQFA 5BOXA 2HNHA 3KZZA 2FE3A 2HOTA 1B72B 1XMAA 3ECOA 5LBQA 4KIFA 4KJZA 2Z2SB 3H3UA 4XN3A 2DDAA 3U21A 3H0GJ 1Z9CA 1YRNA 1S5LC 4Q4ZF 4BS9A 3NWTA 3WTZA 1N75A 3F22A 3KETA 3MVPA 4RMNA 4XRSA 1FSEA 4LIUA 2CS3A 2NS0A 1IXRC 2CYYA 3BG5A 4HA8A 2KQRA 4KIBA 1LVAA 4OINF 3CCRI 3T8RA 2XGCA 2LRDA 2MD0A 4R79A 2IAIA 3PQKA 4FQGA 2HWVA 3CLQA 2GQQA 5LEJA 1W5CC 2ELKA 3QWLA 4G12A 4AYBA 4L0ZB 5K5OA 3OYHA 4KT6A 1TZLA 3CDIA 2HU9A 4A5NA 1OMIA 2QKMB 1I39A 1SD5A 1QO0D 2CUZA 1Z7LA 3RTRA 5J4YA 1J59A 3IKTA 1JKRC 2LTPA 1HW2A 2JUGA 4PZJA 1ZRCA 2RDPA 4DNCA 5EG0A 1JGSA 1K6YA 2XF7A 4E7LA 3KLNA 2E34A 1UFMA 3G1MA 3OS1A 5D4SA 4MEXF 4FASD 2EH3A 1XMKA 2PMZA 3ERED 1X2NA 1ZG5A 1HKTA 4FTHA 4B47A 4Y3OA 4EMSA 1JGGA 3CJTB 3ZR8X 3R60A 4PGHA 4V2GA 2IRFG 1BJZA 1EH8A 1RI7A 1MMNA 3LSHA 1FMVA 1WSUA 3H1CA 3OS2A 5IOZA 1MDMB 4B1RA 1LE8A 4BL0B 2GIZA 3VYTB 2V6CA 5M5WJ 3BCAA 3BP8A 4UVCA 3U1KA 3HL2A 2QM3A 2A5YB 5CYVA 4LK1F 3HUGB 5E18F 1VQ7I 2Q2EB 4ESBA 3ZRGA 2KHMA 5L3CA 4DYCA 5DUIA 2QKLB 1LJ9A 4HQMA 4CDGA 5F1JA 3EETA 2JZYA 2AHQA 3HC7A 4BQOA 1U9NA 2FOWA 2QEXI 2R5YA 4ETSA 5IYCJ 4RB3C 3D1NI 4CGZA 4MLOA 1XB4A 3I4PA 2M5WA 2V1UA 2X1CA 2R7XA 4ITVA 2IS2A 2L9NA 2P5VA 4II2A 4R1HA 2O0YA 3GBGA 1QA6A 1R9TJ 4FETA 3A1YA 5CQGA 2DO7A 5L3GA 2FBIA 1BOBA 5CVVA 2QQ8A 3CC2I 3ZQGA 2L01A 3VPRA 1YX3A 3EUAA 1SFUA 1UZCA 3M7GA 1D1CA 3N4MA 1BR4A 4BDZA 3CMEI 1YJ9I 1SAXA 4C3JJ 1GHCA 3HHHA 4BH9A 4H0EA 2H94A 3K1MA 1LEBA 1MMDA 1TW2A 5K5QA 3J80Z 3P9KA 5E17F 3K4BA 3Q9VA 3AKZA 2VOOA 3I4NJ 2ZSIB 3K10A 3OR2C 2IS6A 5FFZA 3LOCA 2F48A 1HDPA 2MA3A 3FHNA 4XLAA 1MIJA 2K4JA 1U2WA 2EBIA 3LFKA 2X48A 1K7AA 1O7FA 3WTVC 3JCUC 1JI8A 3I9V2 4PDKA 2BE5F 2KISA 2LSOA 4NB5A 2XROA 4HF1A 2CV2A 2XGXA 3U1DA 3GXOA 3KP3A 2D45A 4UUSA 4OIOF 1A04A 3MZHA 1RRJA 4QTRA 2L3DA 4TV7A 3ASOH 4EVIA 3RZOJ 4BBSJ 2K9QA 3CLOA 5J3LA 3ZMZA 3JRIA 1GXQA 1RPWA 3OS0A 2LK2A 3J81Z 4BQQA 2H8WA 3JRFA 3F9KA 2L9VA 3DBRB 2LKPA 4XKCA 4HX8A 1MBGA 1PYVA 4PSWA 5HODA 1IXSB 4R8HA 4A5MA 1K78B 1IV6A 2IGNA 2ZB9A 1Y1VJ 2DT5A 3IL2A 2HDDA 2GLOA 1KQ0A 2W48A 1MW7A 2F2EA 4HSRA 3G4SI 2BY2A 2X4HA 5F6FA 2Q8KA 1DGRM 1YOVB 3FKJA 2Y0MA 4BXFA 1OCOH 4ZDOA 3RYPA 3GCMA 3H5AA 3OYBA 1HLVA 5HS9A 1ZRFA 1POGA 2K4BA 1XPXA 1G3TA 2QWWA 2BYVE 4MNUA 1A35A 1ZR4A 4M6VA 4S0HB 2BVMA 2DA5A 4E7ZA 3ELKA 3RIRA 3GTGJ 3RPUA 3RDIA 4HW0A 3Q0VA 2NS8A 4IHXA 4L9VA 1CQTA 1DU0A 3K1NA 2MYSA 3IWFA 3QYEA 2KRCA 1ETXA 3WHBA 1JKOC 1FNNA 2WAEA 2P8TA 4FHTA 1J9IA 1R22A 2HKXA 2HZDA 2UZKA 4IHTA 2ESHA 1G3SA 4XIDA 2P7VB 3I53A 2M87A 3CZ6A 2R7FA 1X58A 3BY6A 3DLAA 2HVRA 4WK8F 3ASNH 1G2HA 4CCJA 5LGTA 5HDGA 2NVXJ 1YFHA 2KJBA 5JHUA 4NHJA 2IVMA 3K4LA 1UG0A 3KP6A 2KDZA 1QRYA 4BQNA 3F23A 1JE8A 1FTZA 2K9SA 4B3XA 1H8AC 1ZKGA 1MSEC 1OR7A 1P7JA 3EDPA 3GTJJ 1S7EA 1RESA 4GGGA 3HGGA 4M3FA 1WJEA 3E3VA 1ZGWA 3RPUD 3FXMA 5IP7J 1JUPA 3HOUJ 5K1YA 4XLFA 4QLCU 5JVGF 1YJNI 4L9JA 2DBBA 3IRQA 2ZNYA 1LKXA 5EYRA 4ON0A 1JUMA 2XKOA 2R7RA 1GUUA 2EK5A 3ZGKA 4KNYA 1IRZA 2VC1A 2X0LA 3I55I 1T0FA 4I98B 1HDDC 2HEOA 4KDPA 1Z3YA 5DUKA 1R5GA 2E1OA 3M8JA 2DA3A 1U0JA 2I10A 4YEJA 2HOSA 5ICCA 1IRFA 2PI0A 1ZGAA 1OCZH 2LMDA 2CJJA 1DPUA 4BKXA 2XSDC 3IKVA 5JLXA 3VEPA 3G2BA 4ZYHA 3FMSA 4J19A 1S7OA 2R5YB 5AONA 2MLGA 2EFPA 3L09A 1X1CA 3B73A 3HOZJ 3G3ZA 2PX9A 3GZ6A 3TP3A 4DW6A 3KP4A 4C9YA 3H35A 2FNAA 3CO6C 3I59A 2JRTA 3A01B 2I8DA 5DV5A 4U0WA 4A3IJ 4F52A 3S8PA 4MGRA 4D7NA 3OYGA 1IN8A 2VUMJ 1MBHA 4U7BA 1RIOH 1EH7A 4KN4X 5EZHA 2GA2A 4HBLA 5BMZA 1EA3A 3CJQB 2XPVA 1FP2A 4FISA 1YX5A 3PM1A 2CQXA 3DU5A 1D3YA 2RREA 4XM3A 1FOYA 3RYRA 5DM6F 4MTDA 5H20A 1A6QA 4LLNA 3M07A 3MKZA 1ZG3A 4JX4A 3GFLA 2WA0A 1KYWA 1BA5A 2WAQA 1D5VA 2RN7A 5HLGA 2B9SA 2KFDA 3CUOA 3QOEA 3V7CA 2ZC2A 1XC5A 1ETVA 4E7KA 1EV7A 2JPBA 5E3LA 2H6CA 2P5LC 4JOMA 4PSXA 1U78A 1XSVA 3L7WA 4F91B 5J1RA 3R0AA 2A5WA 2EFWA 3TO6A 2PJRA 2L2OA 3SZPA 3LSKA 5L3FA 4ZZLA 2R7ZJ 3OYFA 2XPWA 3HKZN 1UG2A 2DK5A 3R61A 1ON1A 3S14J 3BROA 1HSJA 1A6IA 4HYEA 2B0LA 4IOAF 4A12A 4ENKA 2BGCA 2EWNA 4UUSB 2WAFA 3NRVA 2QVOA 1TWFJ 2OU2A 4AUXA 1H88C 2MABA 3CCJI 4LG0B 4OAZA 4GXOA 2F5VA 2X6WA 3GLLA 1GVJA 4LD5A 1WH7A 1YG2A 2LBFB 2RQQA 2QYOA 1Y8QB 3I64A 1FYKA 1SD6A 2WBMA 2JMWA 4HX7A 5FJ8J 1TLHB 1YO5C 5HS7A 4L0YB 4M3EA 5J1UA 3LWFA 4OOIA 2DA1A 2X51A 4XLEA 3RQIA 3WE3A 2XC7A 3QU6A 3MZ8A 3VFZA 2IW5A 4U88A 5CPRB 4IKFA 3O6BB 3X2QH 2FOKA 3ESWB 2W1OA 1W36D 1K4TA 5C4JJ 3H3ZA 4OU0A 1UHMA 2XAFA 1VI0A 3ECHA 5IP6A 2DMNA 3NARA 1YS6A 3K4NA 3RSNA 3TKYA 2CQQA 4AM3A 3WU0A 2V1NA 1ERDA 1JJ8C 3M8EA 5K5RA 4IPAA 2CO5A 2Z1DA 1TQPA 2PLYA 1X1BA 3HPGA 4KUMA 3BR2A 4NC8A 3CDLA 1B72A 1MJBA 3F8CA 2W24A 1R5ID 3FMRA 1I5ZA 1X4OA 3O8GA 3CCMI 1QPIA 2D1HA 4E4HA 1P92A 3ABLH 2VPLA 4HF2A 6PAXA 1I3AA 1W4MA 1RKTA 2VBXA 3MCZA 5A2QK 4E7JA 2G7UA 1DQUA 3C2BA 3W6VA 4A6EA 2E5NA 2F5EA 4BACA 1B9NA 1F1ZA 1OISA 2TCTA 1OKRA 2EPFA 3K7AJ 3WTSC 3T1BA 1OCRH 1JXSA 3F72A 2QBYA 4I09A 4AIDA 1RUNA 3C18A 3VSLA 3ZOBA 4XOTA 2X85A 2ZXHA 4XORA 3CMMA 2Z3YA 3DKWA 2O9LA 3LAJA 2DU9A 5E3OA 1BI0A 3CCSI 1WFXA 4B43A 1IG7A 1ZQ3P 3LA7A 3IH2A 3PFYA 1WJAA 4IEJA 3BWGA 1H9TA 2DN0A 2VONA 2WV1A 4MEYF 2VJJA 2RKHA 1WCMJ 4JP0A 2DT7B 2Z33A 1JUSA 1VQMI 1EF4A 4N4NB 1GXPA 3C2GA 3S1QJ 5IT9K 3FKIJ 1DU6A 2DJIA 4YFXF 4L9NA 4P96A 4GCVA 5F27A 2DTRA 2YS9A 4M6YA 2JVHA 2VQGA 2MG4A 3I59B 1MDMA 2CMPA 2XUBA 3D5SC 4F93B 4L5EA 2ZXWH 4YG2F 1X4PA 2R93J 2HYGD 3ISPA 4G6TB 4PCQA 5TGTA 2HQNA 5JFRA 2LR8A 1FBQA 2RC4A 2IJLA 1F4KA 3DF8A 4CA0A 3HUGA 1YW7A 3ABMH 2NOGA 3BTIA 4RAZA 4BNCA 3HB9A 3PUFA 1B1BA 2Q2EA 1RKWA 5ILVA 4C3IJ 3F0CA 2F5FA 3GMEA 3IRRA 3TGNA 3IWZA 3V4GA 1FOWA 2PG4A 4HG2A 3OY9A 2VJIA 4LLLA 2HOAA 5D4RA 1XGSA 2MGQA 1U3EM 2E19A 3B6AA 4O3MA 4NUBA 3J7YJ 2FUG2 1B59A 3MQ0A 3DTEA 4ZDLA 4LB5A 1FSHA 4E7SA 1BW5A 2EZLA 2VKVA 3IAS2 2KPMA 3PUBA 3CD6I 2WWYA 1KU3A 4YIRX 3E0JB 4M3DA 2R7WA 2PJRB 4W97A 4BJTA 1P4AA 2JRMA 5E8IA 3GFIA 1ZG1A 4D9JA 2E1MB 2FD5A 3BR5A 3EUKL 3GLXA 2DMTA 1AOYA 1IN4A 1BIBA 3CUQB 3LA2A 2STWA 2RNGA 2MD5A 1XD7A 4XSXF 5ILUA 3W2VA 3KEYA 1KU2A 2Y48A 1IDYA 4S05A 1OCTC 5M3MJ 3HTUA 1XMXA 1E3PA 4UY8I 2A6TA 3TW6A 2NAZA 3PNVA 2CUJA 1D0XA 3ZMDA 4A0XA 2L4MA 5BS6A 2ZJPF 1S7AA 3QRFF 3TOAA 2GIVA 1I1SA 3S93A 3OYNA 1Z21A 2QQBA 3U9GA 4NBQA 3RKWA 3VOEA 3L1PA 4E7IA 3TDZC 2E2JJ 1ZK8A 1I6XA 5M5YJ 5IPAA 2DJNA 3K70D 4HDVA 2B63J 3BQZA 2P4WA 4QIWN 1R71A 1HC8A 3RQ4A 3GWZA 4NC7A 2FX0A 2KKOA 4CXFA 2BV6A 1FEXA 2FQ4A 1OR7C 2ETHA 1FY7A 3SEZA 1CF7A 2IGKA 2XVCA 2WB1N 2IBDA 3TO7A 2DA2A 4HNTA 1XGNA 4UVAA 1ZREA 1BI1A 3RKXA 1Q1VA 3AL0B 2FQ3A 1KONA 2P6SA 1TP4A 5FROA 2L7KA 2FJ1A 4FX4A 2FF4A 3MN2A 4PGGA 3WG7H 4CCLA 5FB2A 1YHQI 2D1VA 3HRSA 3MKWB 1J7KA 5JR3A 1T0FC 3L2VA 5J8CA 3CCEI 3IUOA 3WGIA 1BI3A 2KT0A 2X6XA 4M6XA 1T95A 4P55A 2CUFA 5LLQA 4OIQF 2ID3A 4I0AA 3M1EA 1F43A 1X3WB 3MD2A 2CH0A 3F8FA 3IV5A 3E6MA 2R7OA 2HOEA 1IW7F 1Y0UA 4PJNA 4OIPF 1QHHD 1QZYA 4RM2A 4XRFA 3HXLA 4X0GA 3CJNA 5LGUA 4L18B 2EA2A 5HLIA 3BPXA 2Y0SN 2EV5A 3TO9A 2DI3A 2OQGA 3OYJA 1U5TB 2JWTA 2WC2A 1FOXA 1VZ0A 2HPMA 5F04A 3LA3A 2LY9A 1HF0A 2QBYB 2DOEA 4PUSA 3PIOF 4RGUA 1LPQA 2F5DA 5J4VA 2HR3A 3L2QA 4ZYDA 4HNVA 2LH9A 1HKSA 3LNQA 3BR1A 4A3FJ 1VQOI 1MJAA 1MH3A 2P0WA 2W82A 3B6CA 5CVRA 4FE4A 1QGPA 2BHZA 4B4CA 2LREA 1H0MA 4I76A 3JRCA 3QOPA 3BC8A 1WI3A 4YFNF 1IAWA 1R6RA 3LSRA 2EB7A 5F0HA 3SFZA 1PVEA 1SANA 1MBKA 2P5KA 3VODA 5F64A 2EIMH 2VXDA 5FD6A 2JJ7A 3K2ZA 3OR1C 2BW3A 4RAGA 3J7ZI 3DBHB 3GVAA 2P6TA 3OYAA 2QSHX 4KT5C 2E60A 3MKYB 1R4NB 1USTA 2W7NA 4Q5SF 4A3DJ 3SFIA 4XK4A 2CSOA 2FRHA 1U6GA 2K40A 1TL8A 2PBIA 4AIHA 1T08B 2NVUB 2EILH 4EJVA 4HSTA 1MNEA 3OYKA 2GXGA 1NG7A 3DKXA 5ILSA 1R49A 3J7AY 3FF5A 2NNYA 3KFWX 1HBXG 1W36C 2M2EA 4ENNA 3BJOA 4BE1A 1DGWY 3HOWJ 4NQWB 5FLXK 3GTPJ 4V19K 1R1TA 3W2AA 2H27A 1VQ5I 2FNPA 5EF6A 2A69F 2XASA 3K2AA 3S2WA 4A0YA 3IH3A 3KX2A 2KP6A 2O7OA 1QVUA 1SMTA 3W6KB 1AKHB 3KIOA 3RKQA 3A01A 2V1XA 3AG2H 1ORKA 2JT1A 3F3XA 3H0DA 4XN0A 2QSGX 1LNWA 1EH6A 3ONQA 4G6QA 1SC7A 1JTXA 3OOUA 5IY5H 3FXLA 1WJCA 2FMYA 4I02A 2O3FA 1E2XA 2H09A 4MFDA 5DCFA 3GYHX 4MIMA 5H2FC 3N97A 2GM4A 2UWMA 1W5SA 3EYYA 2R7DA 4NC6A 4ESJA 2IS1A 1ON2A 3KEQA 4KYWA 4I0BA 4IO9F 2DFFA 5CJ9A 2KZGA 2V9PA 2E1CA 1J2XA 3S2HJ 2YX4A 2K5CA 4IJAA 1WRJA 3T8TA 3GW2A 2EINH 4ZYGA 1JTYA 2M7AA 2QSFX 2HQRA 2EIJH 5GTHC 1LUJB 5BQTA 3Q9SA 3PJRA 1TWCJ 1G6NA 3IP4B 4OMZA 2CV1A 1E3HA 3JTHA 2E35A 2LKSA 3C3WA 5CKTA 3VYUB 4AU7A 1NK2P 2CQNA 2DYRH 1IDZA 1XDUA 3DWLE 4XSZF 1CF7B 4DOZA 1U9OA 4LG0A 2VBWA 4DZPA 1USSA 3DEEA 2H6BA 1JHHA 4ZYEA 1PP7U 2IEKA 2LBFA 3TBIA 4F55A 2AXLA 1HKQA 2DFEA 3DLLF 3PO3J 2XB5A 2CGPA 1GV2A 2ZO4A 2XV4S 3TQNA 2VJ4A 2XF6A 1NG6A 5EGOA 3KYLA 5B5EC 4EJTA 3IH4A 1LDDA 3QAHA 1UB9A 4EGYA 2GOMA 3KPHA 4X1EA 3A0HC 1GVDA 2ZBKA 1OYIA 4IQ4A 4Z6YA 5AIPA 4IHSA 3CJRB 1HSTA 1XN7A 2DYSH 2HQAA 1IJWC 4IZZA 2IGOA 3KYDB 1MMAA 1UHSA 1IN7A 1RNLA 4CCOA 4YIFA 3BCBA 4Q48A 1GDTA 2VT3A 5EZGA 2LKXA 1BM9A 4KMFA 2DMUA 4CZCA 2UUZA 5DD4A 3BG9A 2K3PA 4NNJA 1Y0NA 2PFBA 2M1BA 3MWMA 2L4AA 4CZZA 4HX4A 1FIPA 4P5OA 2PN6A 2R7QA 3PSFA 4WXHA 2K02A 3AFHA 4QSHA 1QZZA 1L0OC 2HYFA 2AS5F 3V8KA 1FC3A 4A93J 1BR1A 3CDHA 4BE2A 3FXUA 1FJLA 2G9WA 5GAEJ 4BYYA 3G71I 2VXZA 4XLNF 5HS8A 1IV8A 1BOAA 2VASA 3AG4H 3EYIA 1QBJA 1J0RA 1OLTA 2VB6A 3R4KA 1HXDA 1OQYA 2CFXA 2EJRA 5FLMJ 3Q5FA 1FP1D 2M3AA 1WH5A 2K3FA 2LP0A 2OPTA 4XBFA 3K70C 2ADUA 2BW3B 3OL3A 2O61A 4Y52J 3HHGA 2OBPA 4BY1J 2DOFA 3FM3A 3H5NA 2IS4A 3L9FA 3IHUA 5DTDA 3DFGA 3ZP5A 3O8HA 3G1LA 3S1RJ 2DQLA 4EM1A 2R4GA 1FZPB 1X2MA 1R1UA 5HNFA 2JA6J 3E97A 3KP2A 1IF1A 1P4XA 4D5CA 1TWGJ 3EPZA 4IXAA 5E8GA 2HS5A 3P9IA 5E3MA 3S3OA 2K9LA 3E1SA 3FBNB 3PQJA 4LGWA 4UUTA 3JR9A 1T56A 2M0MA 3FXQA 1PUEE 2O6GE 2QZ8A 1ETWA 5M3FJ 1VQNI 2F6CA 3H36A 4RB1A 1WVRA 5FKLA 3R0JA 2L7FP 4OIRF 2DLLA 2L9RA 2XAJA 2XRNA 3CC7I 4ANJA 1VQ8I 2CW7A 2DQRA 3KLOA 1Y56A 1X1DA 3SHFA 2KIUA 1ZARA 1Z6RA 3GF2A 4PJJA 1JJ6C 2LFBA 5B1AH 4KITB 2PMUA 4IQJA 4A3MJ 4ZDPA 1V5FA 2PEXA 4FCYA 1B8IA 4AYBN 3Q0WA 3TW7A 3EUHA 3FX3A 1R7JA 1N25A 1EKEA 5LD2C 4ZH4F 1P4WA 3CP8A 3ABKH 3E7LA 3V42A 2O5RA 1IN6A 5EEGA 4CCKA 1XDSA 4KN7X 4LLGF 4M9SA 3SZGA 4A3KJ 4GDFA 3P9CA 2R0QC 4HDUA 1W0TA 2EV0A 4DYRA 3J81K 2E2HJ 2DA4A 2K9MA 2PMZN 5J40A 1T39A 2NVTJ 2NXNB 1S3JA 2VL8A 2DCEA 3CUQA 3FK7A 2LNBA 2FMLA 5D6EA 3JRDA 3ZQLA 3BJ6A 3FXJA 4G7ZF 3D0SA 5B1BH 2JTVA 3TDUC 2JA5J 1O57A 2XSJC 3ZMTA 5D5XB 5L3BA 3W2WA 3QP5A 1KZHA 4IHYA 1LEAA 1KU9A 4L5IA 1I3QJ 4OAYA 2LY2A 5TJJA 4BU2A 4DQ2A 2LYCA 2Y0SA 3I0TA 2M30A 3L00A 4I2OA 2VOPA 4GRIA 5E1XA 2OF7A 3SYTA 3FXRA 3WTYC 2YU3A 3DPTA 5LRRA
chains in the Genus database with same CATH topology
3ZR8X 2KPMA 3PUBA 2R7WA 3E0JB 3MMYB 2PJRB 4BEHA 4ZTJA 4BJTA 1MMNA 3LSHA 1FMVA 1D1BA 3TL4X 4CCNA 3OS2A 4D9JA 1S9HA 2E1MB 3EUKL 4BL0B 4XONA 3OIPA 3VYTB 3SDBA 3BG7A 4PK4A 3BCAA 3H9QA 3HL2A 2OUMA 3L2WA 2RNGA 3HUGB 3W2VA 3KEYA 1N77A 4DIQA 3M1CA 2Q2EB 4XLHA 3ZRGA 2KHMA 1J09A 2A6TA 2QKLB 3H9GA 3PNVA 2CUJA 1D0XA 3HC7A 4BQOA 5HOOA 4ZC3A 2CW8A 4U87A 3QYFA 4B48A 3S93A 3OYNA 2LG4A 1Z21A 4MLOA 4DGWB 4E7IA 4PJMA 4DBQA 2L5QA 2X1CA 2R7XA 4ITVA 3S32A 2IS2A 2L9NA 3K70D 3H5RA 4II2A 4BEHB 3GBGA 2E5ZA 4FETA 3A1YA 5CQGA 2W00A 3RQ4A 4NC7A 3LMMA 1BOBA 4PJLA 1OR7C 3SEZA 2HDWA 2IGKA 1WJDA 1YX3A 3EUAA 3PNYA 1D1CA 1BR4A 4BDZA 1V5EA 4HNTA 4ZJZA 1MMDA 3C2HA 3K4BA 3AKZA 3VDXA 3FBIB 1FMWA 2VKHA 2ZSIB 3K10A 1KONA 3OR2C 3AL0B 5FROA 2L7KA 3VYSB 4E6KG 1WJFA 3OYIA 2IS6A 3DKYA 3FHNA 4H4KC 4LG3A 4CCLA 4XLAA 3MKWB 1T0FC 3L2VA 3IUOA 2X6XA 2W4SA 1T95A 1GLNA 1JI8A 1P9QC 3I9V2 3MD2A 3DTIA 2CH0A 2R7OA 4BJ6C 4PJNA 1QHHD 4RM2A 2CV2A 4BUPA 3HXLA 4X0GA 2WB1A 2MC4A 4LIVA 2V26A 4XMYA 2KRHA 3OS0A 3OYJA 2DOAA 4BQQA 3RCOA 1VZ0A 2HPMA 3F9KA 5KCMA 4XKCA 4LITA 1MMGA 4PUSA 1PYVA 4PSWA 3L2QA 2IGNA 3A4CA 1TT0A 2R7VA 2LH9A 1MW7A 2R7SA 3DPUA 4HSRA 2P0WA 1DGRM 2W82A 3FKJA 4BXFA 4II3A 2JA2A 2XF5A 4ZDOA 3H5AA 2LREA 3OYBA 1Y6IA 3I3LA 3BC8A 4CCMA 5LFAA 2BVMA 1R6RA 4E7ZA 4C2UA 1PJRA 2XDVA 4J00A 1WJ5A 3OYEA 2VXDA 2MYSA 1QHGA 2KRCA 3QYEA 3OR1C 1G8XA 2BW3A 4XNFA 2WAEA 3HG9A 2JVGA 3OYAA 2HZDA 2E60A 5CQEA 3MKYB 4YELA 4XQFA 2W7NA 1E0EA 4Y4RA 3CZ6A 2HVRA 3DLAA 2KLOA 3K4JA 4CCJA 4HSTA 1MNEA 3OYKA 3DKXA 1NG7A 2OC6A 4PFPA 4ZYAA 3OYCA 1W36C 3J7AY 1HA8A 4N4OB 4BE1A 3K4LA 1UG0A 1DGWY 4BQNA 3PSIA 4NQWB 5FRMA 4B3XA 3W2AA 4BDYA 4DJAA 2V7FA 4RLQA 5HLTA 3KX2A 2KP6A 1Z3XA 4OWRB 3QODA 1SFKA 1WJEA 3RPUD 2NOJB 2HPIA 4XLFA 3H0DA 4F3QA 4XN0A 1LKXA 3ONQA 3OOUA 2R7RA 4BGDA 4KISA 1WJCA 3ZGKA 4BJ5C 1Z3YA 2UWMA 3HOSA 4XKBA 2VJ5A 3OMYA 2R7TA 3M8JA 2IS1A 1U0JA 4YEJA 2ELJA 3L2RA 2R7UA 4HRIA 4AVZA 2ZSHB 3ZXSA 1LVKA 1QU3A 3G2BA 2K5CA 2UV1A 1UAAA 1X1CA 2KDOA 2M7AA 3PNTA 4E7HA 4HNUA 4C9YA 3H35A 2XAUA 2CFOA 2I8DA 2ZXIA 4F52A 3S8PA 3PJRA 3BLYA 4Y33A 3OYGA 3IP4B 2CV1A 3CP2A 4U7BA 3K4KA 2KZVA 3CF2A 2VQCA 5CKTA 4XKVA 3VYUB 4AU7A 1EA3A 3CJQB 5FRNA 1YX5A 3DU5A 3DWLE 4C30A 2RREA 4XM3A 4DOZA 3OL4A 3DEEA 2KMUA 3MKZA 2WA0A 2DT6A 2LBFA 2WAQA 3VYRB 3TBIA 1MNDA 2LC2A 4F55A 1DP3A 2Z16A 3QOEA 3IAM2 3DQVC 4E7KA 3FDYA 2MFZA 2VKDA 2XF6A 2VJ4A 4JOMA 4PSXA 4F91B 5KHDA 1NG6A 2PJRA 2A5WA 3KYLA 1D0ZA 4XR6A 2L2OA 3LSKA 3L2UA 3H9JA 2V6EA 2GOMA 3OYFA 3EUHC 4IQ4A 2IXSA 3CJRB 3CESA 2HQAA 2WAFA 3HOTA 3ZQQA 4QPOA 2IGOA 4IZZA 1MMAA 3K6GA 4CCOA 3BCBA 2BOLA 2VQLA 2V9KA 2MABA 4OAZA 4CZCA 2UUZA 2K3PA 4NNJA 4XLCA 2Q1ZB 2F5VA 2X6WA 3OYDA 2E1MC 4XL9A 4P5OA 2LBFB 2AQEA 2LOOA 2RQQA 2LY1A 2R7QA 2X1DA 1AA7A 2BVLA 2WBMA 3PSFA 4XKWA 3AFHA 3HKZA 4XOPA 3LL7A 3LSMA 1ZELA 5HVQC 3LSGA 2JSPA 1BR1A 2X51A 4XLEA 5JHFA 4BE2A 3BG6A 1V5GA 2XC7A 1YE9A 2VXZA 4RM3A 1IRXA 5CPRB 4IKFA 2VASA 2X1EA 3OWTA 1OLTA 2VB6A 2WY8Q 2W1OA 1W36D 2VLAA 3UR3C 3LSIA 4CSWA 2DXIA 2L9SA 4YRVA 5HNHA 3OYLA 2VIXA 2M3AA 2CV0A 4PFOA 3K70C 1LDKB 2BW3B 3K4NA 3OL3A 3RSNA 3TMOA 3D5RC 2M4GA 4B44A 2V1NA 2HVQA 1ERDA 3H5NA 2IS4A 3A2KA 2Z1DA 1D0YA 1G59A 2KL4A 2M7BA 2F4IA 1X1BA 3HPGA 3HPHA 4NC8A 2R4GA 5HNFA 4BE0A 3S3NA 2X6YA 1X4OA 3OIQA 3QYBA 2V4JC 3EPZA 3VWBA 1BR2A 4E4HA 5KNLA 2VPLA 4J01A 2GOXB 3AL0C 3S3OA 2K9LA 3E1SA 3FBNB 4E7JA 2M0MA 4P1WA 3OYMA 1DQUA 4DBRA 2E5NA 1LFPA 1X1AA 4BACA 1WJBA 2F6CA 3ZCOA 3D5LA 4ANJA 3DTKA 2CW7A 3N05A 1Y56A 2AQFA 1UELB 1X1DA 4IX7A 3VSLA 4PJJA 1X19A 2WADA 4XOTA 3S3MA 2X85A 2ZXHA 4XORA 4KITB 3CMMA 4F92B 4IQJA 2OV7A 4ZDPA 1V5FA 2ZFUA 2IGMA 1D1AA 1WFXA 1N78A 2WY7Q 4QPQA 4B43A 3PFYA 4D1QA 2VQHA 1WJAA 3SEQA 4JQFA 2HNHA 2VJJA 5LD2C 3CP8A 4KJZA 2DT7B 2Z2SB 3UNGC 4N4NB 4XN3A 3U21A 3C2GA 3V42A 4BS9A 4HPQA 2O5RA 3NWTA 3K4MA 4CCKA 3SZGA 1N75A 2DJIA 4C2TA 4RMNA 4LIUA 2CS3A 4EATA 2KQRA 4HEA2 4ZTFA 2JVHA 3W3CA 2K9MA 2LRDA 2VQGA 3LFUA 2MD0A 4R79A 2CMPA 4F93B 3D5SC 2HVSA 1X4PA 3DU6A 2VL8A 2DCEA 4G6TB 5TGTA 4AYBA 3OYHA 4KT6A 3K4CA 1TZLA 2HU9A 4CA0A 2QKMB 2XSJC 2CUZA 1Z7LA 3RTRA 3W2WA 1SAUA 2JUGA 4RLFA 2M4KA 4OAYA 4CUGA 2LY2A 4BU2A 4E7LA 1K6YA 2XF7A 3VSKA 4HG2A 3OY9A 2VJIA 2LYCA 3PL8A 2Y0SA 3OS1A 4FASD 3NWSA 4GRIA 4NUBA 2PMZA 2FUG2 3SYTA 4CH7A 3DTEA 4ZDLA 3DPTA 3DPLC 4B47A 4Y3OA 4E7SA 3IAS2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEH B;  2LBF A;  2W1O A;  3A1Y A;  4BEH A;  2LBF B; 
#chains in the Genus database with same CATH topology
 1RUO A;  3CF5 F;  2HGC A;  1MSF C;  3H3V K;  2Y75 A;  3MMY B;  5EGO B;  1FYL A;  4G9Y A;  2ID6 A;  1DP7 P;  1PDN C;  4G8X A;  4A69 C;  4XLP F;  3TL4 X;  5C3E J;  1ETK A;  1ZHF A;  3HEF A;  2EIK H;  3LSP A;  2STT A;  2MW8 A;  5H6R A;  3WG9 A;  2NRA C;  1MKM A;  4PK4 A;  2OUM A;  3DCF A;  3ZMS A;  4G7O F;  4DZJ A;  2AO9 A;  1N77 A;  2ME0 A;  4EJW A;  3HSR A;  3BG3 A;  3M1C A;  4RA2 A;  1STZ A;  2YR2 A;  4XIC A;  1J09 A;  2TRT A;  4A3B J;  1ETO A;  3KYC B;  3HJE A;  1TNS A;  1KYZ A;  2Z5U A;  5E20 A;  4ZC3 A;  1NK3 P;  2OJE D;  1SD7 A;  3B02 A;  4B48 A;  4DGW B;  3RJP A;  4V2F A;  4PJM A;  4MHG A;  3A03 A;  3K69 A;  1J75 A;  4UB8 C;  3S32 A;  2TDX A;  2W25 A;  3H5R A;  3E5X A;  4BEH B;  1K61 A;  4CYD A;  2E5Z A;  2A68 F;  4KA4 A;  4LOC A;  3L2C A;  3LMM A;  3GFM A;  2B7E A;  4N9H A;  4WXD A;  5DDG A;  4PJL A;  2COM A;  2VC0 A;  4A2U A;  2Y31 A;  2HDW A;  5E79 C;  1WJD A;  2DDB A;  4D0P A;  3PNY A;  1U5T A;  3O3K A;  3S1N J;  2HTS A;  1WZ2 A;  4ZJZ A;  1UMQ A;  3JAM Z;  2VT2 A;  4AIJ A;  3ROU A;  1XSX A;  2L54 A;  1XGM A;  3FBI B;  1FMW A;  2PQ8 A;  2VKH A;  3KP5 A;  2ZJQ F;  5GPA A;  4E6K G;  1SD4 A;  1FBU A;  1IN5 A;  2R5Z B;  2HTJ A;  3FIS A;  4H4K C;  5ERI A;  3ZMU A;  4MO7 A;  1OPC A;  3F8N A;  3V7R A;  4UHT A;  2ZME B;  3KCC A;  1IO2 A;  1P9Q C;  4MFE A;  1IUY A;  5FKK A;  4BHC A;  3DTI A;  3HDD A;  4BJ6 C;  4BQA A;  1R23 A;  1NTC A;  3QU3 A;  4EJO A;  5E3N A;  4FE7 A;  3BDD A;  2MC4 A;  2ZXJ A;  4LB6 B;  1T8I A;  4LIV A;  4Y15 A;  2VE9 A;  2EV6 A;  2PJP A;  2M34 A;  2O03 A;  2XKP A;  4B8X A;  2D2W A;  2OA4 A;  1Z05 A;  3CMY A;  4I99 C;  1U8B A;  1VQK I;  3J7A O;  5KCM A;  1MMG A;  2BZT A;  2K85 A;  4JYK A;  1H9G A;  1FBS A;  1ZGJ A;  3A4C A;  4D5F A;  1TT0 A;  2R7V A;  1P2F A;  2RV8 A;  3GO5 A;  4RB2 C;  2Y30 A;  3KEO A;  3CTA A;  2R7S A;  1OYW A;  1I1G A;  5DS9 A;  1OFC X;  4UUV A;  1B8I B;  1DUX C;  1VTN C;  3BQY A;  1AHD P;  4NQW A;  3MKL A;  1V54 H;  4II3 A;  2JA2 A;  5H6Q A;  1O3T A;  1YI2 I;  3I3L A;  3REO A;  3AG3 H;  4KIG A;  3HZJ A;  3JRG A;  3OV8 A;  1AKH A;  1EJ9 A;  3JRE A;  1Z77 A;  2BY0 A;  1MBJ A;  4C2U A;  2ISZ A;  4AVP A;  4J00 A;  3AAF A;  1WJ5 A;  1K6O A;  2BHY A;  2QGU A;  3E6B A;  4M3G A;  3ULQ B;  3OYE A;  2IP2 A;  1QHG A;  4MTE A;  3AG1 H;  4BHP A;  1YIJ I;  3HM5 A;  3K1P A;  3HG9 A;  2JVG A;  1F36 A;  4MQV A;  1G3Y A;  3HRT A;  2QA4 I;  1TQM A;  1G4D A;  4XQF A;  3G6E I;  4Y4R A;  5CVU A;  3GTM J;  1S8N A;  1LQ1 A;  2C6Y A;  3ZPL A;  2ISY A;  2KLO A;  2OZU A;  3K4J A;  2I5U A;  3T5X A;  2VBZ A;  5L3E A;  3CMA I;  4PFP A;  4ZYA A;  5F0F A;  5IYD J;  2OCE A;  2QF7 A;  1BJA A;  3V8L A;  3LQR A;  5FRM A;  5FFX A;  1PUF A;  1W7P B;  4EM2 A;  1UCR A;  1YTY A;  2M45 A;  2KRF A;  2DOD A;  2E7X A;  2HFH A;  2NOJ B;  4LJZ F;  3Q3S A;  4ASN A;  5D5U B;  1Y1W J;  3I4M J;  3TP0 A;  4F3Q A;  3K0L A;  3GFJ A;  3COA C;  3HYI A;  5KVR A;  4BGD A;  4KIS A;  3BPV A;  3HSE A;  2RGV A;  1RET A;  1CGP A;  3ERM A;  3BZC A;  1ZR2 A;  2BXY A;  3HOS A;  2R7T A;  3OMY A;  1YW8 A;  5B3S H;  5LHI A;  2MSY A;  4UXN A;  2ELJ A;  1IGN A;  3L2R A;  2KIF A;  2XAG A;  3DBL B;  4ZZD A;  1M1E B;  3I5U A;  5IOY A;  3I58 A;  4AVZ A;  3W6J B;  3ZXS A;  2CU7 A;  3PFI A;  2HI3 A;  1LVK A;  2XPU A;  2VBY A;  4UV8 A;  2GXA A;  2CUE A;  3S1M J;  2UV1 A;  4XRS G;  1K4S A;  1UAA A;  2KDO A;  2BY3 A;  2RQP A;  2W85 A;  4F7Z A;  4G6D A;  3KZI C;  1U8R A;  4EM0 B;  1B4A A;  2MBF A;  3BZ6 A;  3NEU A;  1YS7 A;  4Y33 A;  1MD0 A;  2E36 A;  3CP2 A;  3K4K A;  3PIP F;  2ZNZ A;  3CF2 A;  2ZFW A;  4XKV A;  4M74 A;  4LK0 F;  5FRN A;  3OIO A;  1NHA A;  1YJW I;  4C30 A;  3KP7 A;  5KAI C;  1SMY F;  2ECC A;  5BNG A;  3RI4 A;  1DDN A;  4WCG A;  3HOY J;  2XAH A;  5JVT A;  2KMU A;  3QQA A;  1ZAO A;  3ZN0 A;  3VYR B;  2NVQ J;  5DEQ A;  4AWX B;  4BXX J;  3BR6 A;  2ESN A;  3WTX C;  2JA7 J;  3IAM 2;  3G73 A;  2XGD A;  1S72 I;  3C1D A;  2IT0 A;  2MFZ A;  2VKD A;  5GP9 A;  3EQL F;  5KHD A;  1VQ9 I;  1V4R A;  1H89 C;  1ETY A;  3A0B C;  5L3D A;  2CW0 F;  2LDU A;  3O2P E;  3E5U A;  5J8F A;  4GYI A;  3E5Q A;  2COB A;  3EUH C;  1FOK A;  2JK3 A;  3SJM A;  1F9N A;  2KIM A;  2IXS A;  1SFO J;  1IZ1 A;  3CES A;  4G94 A;  4YII A;  3GUD A;  5F0C A;  2JUC A;  3HOT A;  3ZQQ A;  4QPO A;  2HDC A;  1MJ9 A;  3UKG A;  1JKP C;  3K6G A;  1O3Q A;  2VPR A;  4D7M A;  1KQ9 A;  1TT5 B;  1XS9 A;  2EZK A;  4A3C J;  1IUF A;  1X3Z B;  2V9K A;  1FPQ A;  5IP9 J;  2ELH A;  4XLC A;  1ZN2 A;  2W57 A;  3OYD A;  2ICW G;  2HYJ A;  2E1M C;  1O3S A;  4UB6 C;  4XL9 A;  1R4M B;  2NNN A;  5CVI A;  5FKO A;  2LY1 A;  3CUQ C;  3F6O A;  2X1D A;  5C4X J;  4AD9 A;  1AA7 A;  3BJA A;  2MLK A;  2BVL A;  4QWQ A;  2OZ6 A;  2P81 A;  2HQ5 A;  4JX6 A;  3HKZ A;  5ED4 A;  4WXC A;  2L02 A;  2OTJ I;  3LSM A;  2QQA A;  3DEU A;  5HVQ C;  5F1R A;  3WU1 B;  3S17 J;  1WGX A;  3LSG A;  5JHF A;  1Q1H A;  1SVO A;  3LST A;  3BG6 A;  3QP6 A;  1BC7 C;  1MGT A;  1ZLJ A;  1YE9 A;  5EEH A;  4JBA A;  4K2E A;  1ETQ A;  4RM3 A;  1LB2 A;  4X6A J;  3WE2 A;  1X1P A;  1XG1 A;  3OWT A;  2DTZ A;  2WY8 Q;  4HV5 A;  5DM7 F;  4CSW A;  2K9N A;  1YW9 A;  4YRV A;  1RR8 C;  5HNH A;  2XIG A;  2VIX A;  3OYL A;  1TTY A;  1WPK A;  3JSP A;  3G1O A;  4PFO A;  4IHW A;  1LDK B;  4AC0 A;  1UJ8 A;  3QPH A;  4B44 A;  4GYG A;  3DXJ F;  1ZYR F;  3FM5 A;  3I71 A;  4IHV A;  2NS7 A;  2XRL A;  1G59 A;  1FX7 A;  3HOV J;  4JX5 A;  3CCY A;  4CYC A;  3ZN1 A;  2YSR A;  3FK6 A;  1WKM A;  4AIK A;  1Z0X A;  1BBY A;  4GFB A;  1JHF A;  4BE0 A;  3S3N A;  2X6Y A;  1X3U A;  2A05 A;  3NAU A;  4OMY A;  4CHU A;  3VWB A;  1P7I A;  4A3L J;  4HV6 A;  4P9U A;  2QLZ A;  1B6A A;  5BPD A;  3AL0 C;  5FGM A;  3DEW A;  5FD5 A;  1J5Y A;  2NYX A;  1R00 A;  4P1W A;  5J47 A;  1HCR A;  5LHH A;  1YLF A;  1PUF B;  4RAF A;  1WJB A;  2D5V A;  3ZCO A;  3FIW A;  3DP7 A;  3DTK A;  2RAE A;  3GZN B;  1NH3 A;  2VN2 A;  3ZMV A;  4KMU X;  2Y9Y A;  1W0U A;  1X19 A;  4IL6 C;  5FKM A;  2KJC A;  2QUF A;  3RZD J;  2OV7 A;  3WHC A;  2DMP A;  3S15 J;  4L9T A;  2ZFU A;  2IGM A;  1D1A A;  1QQI A;  3JTG A;  1Z1D A;  2UXX A;  2WY7 Q;  3BOQ A;  4O6J A;  4QPQ A;  3FXK A;  4HLY A;  1JT0 A;  4D1Q A;  1U5T C;  3M8F A;  3SEQ A;  4RAY A;  2YPR A;  4W1U A;  5FO5 A;  4E70 A;  3OOP A;  5K7H A;  2DPD A;  2CQK A;  5ICE A;  4IF4 A;  1IRG A;  3WGH A;  3CCQ I;  3UNG C;  4L5J A;  2H1L A;  2DK8 A;  2QCO A;  3M9A A;  5GAH J;  1IXC A;  1T98 A;  4HPQ A;  2ZKZ A;  1SVL A;  3K4M A;  1ZH5 A;  4C2T A;  4A3J J;  4BBR J;  4EAT A;  1WHU A;  3ABT A;  1Z91 A;  4BXU A;  4HEA 2;  4ZTF A;  2ACJ A;  1V3F A;  1T33 A;  4IVN A;  3W3C A;  3LFU A;  1Z67 A;  4C2M J;  3CCL I;  1L3L A;  2A61 A;  2HVS A;  5GTI C;  2A3S A;  2EFN A;  3DU6 A;  3M3Y J;  2JA8 J;  1OCC H;  1R5H A;  3K4C A;  4CO8 A;  1TNT A;  4A3E J;  3HOX J;  1A31 A;  2F4M B;  1SAU A;  4RLF A;  3BTJ A;  4M73 A;  3T0Y A;  3OSG A;  1B9M A;  2M4K A;  4CUG A;  3VSK A;  4PJ0 C;  3WTU C;  2J5O A;  2NVY J;  1FIA A;  3PL8 A;  4RGR A;  3NWS A;  1OCP A;  3WTW C;  4CH7 A;  2DA6 A;  1AWC A;  3DPL C;  4Y7N J;  1YRN B;  5CVJ A;  2E1N A;  5LHG A;  1FWZ A;  5FKN A;  5GPC A;  3FHZ A;  3MEX A;  1MZB A;  1TWH J;  3SDG A;  3TOB A;  4BEH A;  4ZTJ A;  1D1B A;  4CCN A;  1ACI A;  2Z99 A;  4I7H A;  1SFX A;  1T6S A;  2OD5 A;  1S9H A;  2CG4 A;  3FMQ A;  3F21 A;  2CWE A;  1MBE A;  4XON A;  3OIP A;  5HLH A;  3SDB A;  3BG7 A;  5IYB J;  4HF0 A;  3H9Q A;  4M9Z A;  2Y2Z A;  3L2W A;  3ML6 A;  2L0K A;  3ZQ7 A;  1XTA A;  4M9X A;  1XX5 A;  1LFB A;  1ENH A;  4DIQ A;  1KU7 A;  3JRA A;  4XLH A;  3JRH A;  3F8M A;  4EV0 A;  5EG0 B;  3KZY A;  2OAZ A;  3H9G A;  1VQP I;  2R5Z A;  4Q47 A;  5HOO A;  3CC4 I;  4IRI A;  2ECB A;  2DW4 A;  2CW8 A;  4U87 A;  4BAY A;  5C44 J;  3QYF A;  4EJU A;  2W84 A;  2GBY A;  5ICG A;  1TW3 A;  4MQ9 F;  2P7C B;  2DFI A;  2LG4 A;  5DYM A;  5LRS A;  2ZME A;  3P7N A;  3CCU I;  3HGY A;  2FA5 A;  4M72 A;  4DBQ A;  2L5Q A;  1V55 H;  3HIF A;  3E6D A;  3ZQF A;  2F5C A;  2LF8 A;  1APL C;  2EA4 A;  2XGE A;  1BW6 A;  2W00 A;  2O8K A;  5E1W A;  1VQL I;  1LE8 B;  1HW1 A;  5A2Q Z;  3JW4 A;  4RDU A;  4DYQ A;  3RPQ A;  4A6D A;  2FBH A;  3BTL A;  2MC3 A;  1V5E A;  3J80 K;  2IPQ X;  2Z9O A;  3ZQC A;  3C2H A;  1T2K A;  4EEF G;  3Q0U A;  3VDX A;  2H1K A;  3E6C C;  1REP C;  1BI2 A;  2LF7 A;  3VYS B;  2DPU A;  4HAM A;  1WJF A;  3OYI A;  1KA8 A;  3DKY A;  3R6S A;  2DAO A;  1SFE A;  2GAU A;  4LG3 A;  2GXB A;  3HSF A;  2J5P A;  1O7L A;  2W4S A;  1GLN A;  1VND A;  5KAF C;  5GAD J;  1FT9 A;  5K7F A;  4CYC B;  4KFC A;  4Z2Y A;  1C0W A;  2DA7 A;  2GA1 A;  4JK1 X;  1SEU A;  3GTK J;  3S2D J;  3H92 A;  4BUP A;  3LSJ A;  2WB1 A;  5GAG J;  2M0C A;  4A3G J;  3TED A;  2V26 A;  5IT9 Z;  2N8G A;  4ENJ A;  4M3B A;  2IA0 A;  4XMY A;  2KRH A;  2DOA A;  2FU4 A;  3RCO A;  4LIT A;  5D5W B;  5K7Z A;  2MH9 A;  5TIS C;  2L7M P;  3K9T A;  2V79 A;  4ENM A;  2CQ7 A;  3MAJ A;  4HZF A;  4WF2 A;  2EQR A;  5LGN A;  3DPU A;  1OJL A;  2O8X A;  4WX9 A;  2RVC A;  3ZQI A;  2K86 A;  1Z7U A;  2XF5 A;  2AXT C;  1Y6I A;  2LVS A;  4CCM A;  1W7P A;  4RGX A;  2ZCW A;  1A36 A;  2LD5 A;  4RB0 A;  4XRM A;  4RS8 A;  5LFA A;  2HXI A;  3QPT A;  1PJR A;  2XDV A;  4M71 A;  4LFU A;  5FLV A;  2YUS A;  2UXN A;  5J1Y A;  4RGS A;  5F08 A;  1YQA A;  2QEN A;  5B66 C;  1TC3 C;  4G7H F;  1BN5 A;  2K27 A;  1G8X A;  4XNF A;  3HRU A;  1ITY A;  2V1D A;  5D8K B;  2XHK A;  2EZH A;  2WTE A;  4O5V A;  1KGS A;  1S29 A;  4U0V A;  5CQE A;  2FBK A;  2MH2 A;  1RZ4 A;  4YEL A;  2LLK A;  4B09 A;  1E0E A;  1QNT A;  1R36 A;  3U2R A;  1Y39 A;  1VQ6 I;  4BY7 J;  1LDJ A;  4YFK F;  2DFH A;  3I56 I;  2OC6 A;  3OYC A;  3C7J A;  1HA8 A;  1FYM A;  1TQI A;  3P5J A;  4N4O B;  4BHB A;  4I6Z A;  1W5T A;  1XSD A;  1E3O C;  2BXZ A;  3PSI A;  1YIT I;  1R58 A;  3FZV A;  3F6V A;  3MFK A;  4BDY A;  1W7P D;  4DJA A;  2V7F A;  2PMH A;  1ULY A;  2M8E A;  4I01 A;  4RLQ A;  4OWR B;  3WU2 C;  1Z3X A;  2GWR A;  5HLT A;  1GT0 C;  1MNM C;  3QOD A;  1SFK A;  3GEZ A;  3M4O J;  1QZE A;  2HPI A;  4U0Y A;  1D8J A;  2VI6 A;  2BBY A;  4Y13 A;  2HZT A;  3GTL J;  2A6H F;  3CQZ J;  1UHW A;  5DCM A;  3BTC A;  4BJ5 C;  1SVM A;  2ZJR F;  2CRG A;  2OQR A;  4N9I A;  1I6H J;  2JQ7 A;  2A6E F;  2RNJ A;  3HTS B;  1ODD A;  4XKB A;  2VJ5 A;  4UVB A;  1BC8 C;  3I54 A;  4UV9 A;  1ONV A;  4N0B A;  2HKO A;  2JPC A;  2K7L A;  5KK1 A;  2R7U A;  1D8K A;  3WTT C;  4HRI A;  2ZSH B;  3JSO A;  2VKE A;  2X6O A;  4ABZ A;  1QU3 A;  4UNO A;  1P6R A;  2WV0 A;  1G3W A;  3PNT A;  3ZQH A;  4E7H A;  4HNU A;  2XAU A;  2QQ9 A;  2CFO A;  1I27 A;  1FLI A;  4A0Z A;  2ZXI A;  1MH4 A;  3BLY A;  3FWE A;  1E17 A;  4GO1 A;  2KZV A;  2R3S A;  3S16 J;  5D8L B;  2XAQ A;  2E7W A;  3BT9 A;  2A07 F;  2VQC A;  3NQO A;  1AU7 A;  2G7H A;  5EJC A;  2FEZ A;  4C3H J;  4EGZ A;  1O3R A;  3KE2 A;  3PO2 J;  5ICF A;  4RBO A;  4FX0 A;  2ME6 A;  3OL4 A;  2M9H A;  2XB0 X;  4IRG A;  1OYY A;  2FSW A;  3WOD F;  3WGG A;  2DT6 A;  1VFC A;  2DMQ A;  5IT3 A;  3V7S A;  1MND A;  2LC2 A;  3ABU A;  1W1W E;  4WWC A;  1DP3 A;  3GTQ J;  3QPS A;  2E71 A;  1S6L A;  5HDN A;  2Z16 A;  1ZRD A;  1WQ2 A;  4Y17 A;  5DD8 A;  3DV8 A;  3DQV C;  1WI9 A;  3FDY A;  5J6X A;  2EFQ A;  3GZ5 A;  4FT8 A;  2YU9 J;  1QVT A;  5CLS A;  3MZY A;  1D0Z A;  4XR6 A;  4IOC F;  1GV5 A;  1F5T A;  3L2U A;  2IA2 A;  3H9J A;  1A5J A;  2V6E A;  5BPI A;  3F8B A;  1TWA J;  4IRH A;  1Z6T A;  3BR0 A;  1YYV A;  4ESF A;  2BY1 A;  1RR7 A;  2FXA A;  4HOB A;  1HW5 A;  3LAP A;  4EQQ A;  3CO7 C;  3FXO A;  3SQN A;  1KQ8 A;  3RKY A;  1FTT A;  2Q0O A;  5D6F A;  1MBF A;  2BOL A;  2VQL A;  4B3A A;  4P9F A;  1D5Y A;  3SXY A;  2Q1Z B;  3V8J A;  2OCC H;  3HBL A;  3BR3 A;  2AQE A;  2LOO A;  5JI6 A;  2EZI A;  4NDL A;  2BEO A;  4XKW A;  5EEA A;  3OSF A;  2VOD A;  4XOP A;  3LL7 A;  1ZTR A;  2X9D A;  4LMY A;  1ZEL A;  5EDN A;  2H8R A;  2E2I J;  2JSP A;  1XCV A;  5HDK A;  2F4O B;  5JLW A;  2M8G X;  1V5G A;  4HQE A;  1BIA A;  1K79 A;  5E1Z B;  5FLX Z;  1IRX A;  2JN6 A;  5D5V B;  3GTO J;  2EFO A;  2HXO A;  2X1E A;  2Y69 H;  5M5X J;  1T38 A;  1MMS A;  1JT6 A;  2G0E A;  2VLA A;  3UR3 C;  3LSI A;  2DXI A;  2L9S A;  3BZK A;  3GX4 X;  1XGO A;  1XCB A;  2CV0 A;  1LFU P;  1I50 J;  3TMO A;  3D5R C;  2M4G A;  1HQC A;  2HVQ A;  1O4X A;  3A2K A;  1D0Y A;  3JRB A;  2KL4 A;  2M7B A;  2JSC A;  2F4I A;  3HPH A;  1PP8 F;  1VF9 A;  3QYB A;  3OIQ A;  2V4J C;  2R92 J;  1HOM A;  1BR2 A;  5KNL A;  4J01 A;  3SZT A;  2GOX B;  2VE8 A;  3VB2 A;  1K83 J;  2V9V A;  3LQQ A;  3OYM A;  4DBR A;  1TBX A;  5LEK A;  3CCV I;  4HLX A;  1LFP A;  2YX7 A;  1X1A A;  1DPR A;  2WAQ N;  4KIC A;  1VQ4 I;  2ZME C;  4U7D A;  3JAM K;  3D5L A;  1WWX A;  9ANT A;  3N05 A;  1R1V A;  2AQF A;  2GZW A;  1UEL B;  3IC7 A;  4IX7 A;  1IC8 A;  1K78 A;  5TRD A;  4CIC A;  1BL0 A;  1QPM A;  3QPL A;  2WAD A;  3A02 A;  3S3M A;  1ZLK A;  2KIQ A;  2ZJ2 A;  4S04 A;  3HRM A;  4F92 B;  2OTL I;  5DCM B;  1YIO A;  2IA1 A;  2L7Z A;  1RC9 A;  1N78 A;  1JKQ C;  2Y9Z A;  1Y8R B;  2VQH A;  5AIQ A;  4JQF A;  5BOX A;  2HNH A;  3KZZ A;  2FE3 A;  2HOT A;  1B72 B;  1XMA A;  3ECO A;  5LBQ A;  4KIF A;  4KJZ A;  2Z2S B;  3H3U A;  4XN3 A;  2DDA A;  3U21 A;  3H0G J;  1Z9C A;  1YRN A;  1S5L C;  4Q4Z F;  4BS9 A;  3NWT A;  3WTZ A;  1N75 A;  3F22 A;  3KET A;  3MVP A;  4RMN A;  4XRS A;  1FSE A;  4LIU A;  2CS3 A;  2NS0 A;  1IXR C;  2CYY A;  3BG5 A;  4HA8 A;  2KQR A;  4KIB A;  1LVA A;  4OIN F;  3CCR I;  3T8R A;  2XGC A;  2LRD A;  2MD0 A;  4R79 A;  2IAI A;  3PQK A;  4FQG A;  2HWV A;  3CLQ A;  2GQQ A;  5LEJ A;  1W5C C;  2ELK A;  3QWL A;  4G12 A;  4AYB A;  4L0Z B;  5K5O A;  3OYH A;  4KT6 A;  1TZL A;  3CDI A;  2HU9 A;  4A5N A;  1OMI A;  2QKM B;  1I39 A;  1SD5 A;  1QO0 D;  2CUZ A;  1Z7L A;  3RTR A;  5J4Y A;  1J59 A;  3IKT A;  1JKR C;  2LTP A;  1HW2 A;  2JUG A;  4PZJ A;  1ZRC A;  2RDP A;  4DNC A;  5EG0 A;  1JGS A;  1K6Y A;  2XF7 A;  4E7L A;  3KLN A;  2E34 A;  1UFM A;  3G1M A;  3OS1 A;  5D4S A;  4MEX F;  4FAS D;  2EH3 A;  1XMK A;  2PMZ A;  3ERE D;  1X2N A;  1ZG5 A;  1HKT A;  4FTH A;  4B47 A;  4Y3O A;  4EMS A;  1JGG A;  3CJT B;  3ZR8 X;  3R60 A;  4PGH A;  4V2G A;  2IRF G;  1BJZ A;  1EH8 A;  1RI7 A;  1MMN A;  3LSH A;  1FMV A;  1WSU A;  3H1C A;  3OS2 A;  5IOZ A;  1MDM B;  4B1R A;  1LE8 A;  4BL0 B;  2GIZ A;  3VYT B;  2V6C A;  5M5W J;  3BCA A;  3BP8 A;  4UVC A;  3U1K A;  3HL2 A;  2QM3 A;  2A5Y B;  5CYV A;  4LK1 F;  3HUG B;  5E18 F;  1VQ7 I;  2Q2E B;  4ESB A;  3ZRG A;  2KHM A;  5L3C A;  4DYC A;  5DUI A;  2QKL B;  1LJ9 A;  4HQM A;  4CDG A;  5F1J A;  3EET A;  2JZY A;  2AHQ A;  3HC7 A;  4BQO A;  1U9N A;  2FOW A;  2QEX I;  2R5Y A;  4ETS A;  5IYC J;  4RB3 C;  3D1N I;  4CGZ A;  4MLO A;  1XB4 A;  3I4P A;  2M5W A;  2V1U A;  2X1C A;  2R7X A;  4ITV A;  2IS2 A;  2L9N A;  2P5V A;  4II2 A;  4R1H A;  2O0Y A;  3GBG A;  1QA6 A;  1R9T J;  4FET A;  3A1Y A;  5CQG A;  2DO7 A;  5L3G A;  2FBI A;  1BOB A;  5CVV A;  2QQ8 A;  3CC2 I;  3ZQG A;  2L01 A;  3VPR A;  1YX3 A;  3EUA A;  1SFU A;  1UZC A;  3M7G A;  1D1C A;  3N4M A;  1BR4 A;  4BDZ A;  3CME I;  1YJ9 I;  1SAX A;  4C3J J;  1GHC A;  3HHH A;  4BH9 A;  4H0E A;  2H94 A;  3K1M A;  1LEB A;  1MMD A;  1TW2 A;  5K5Q A;  3J80 Z;  3P9K A;  5E17 F;  3K4B A;  3Q9V A;  3AKZ A;  2VOO A;  3I4N J;  2ZSI B;  3K10 A;  3OR2 C;  2IS6 A;  5FFZ A;  3LOC A;  2F48 A;  1HDP A;  2MA3 A;  3FHN A;  4XLA A;  1MIJ A;  2K4J A;  1U2W A;  2EBI A;  3LFK A;  2X48 A;  1K7A A;  1O7F A;  3WTV C;  3JCU C;  1JI8 A;  3I9V 2;  4PDK A;  2BE5 F;  2KIS A;  2LSO A;  4NB5 A;  2XRO A;  4HF1 A;  2CV2 A;  2XGX A;  3U1D A;  3GXO A;  3KP3 A;  2D45 A;  4UUS A;  4OIO F;  1A04 A;  3MZH A;  1RRJ A;  4QTR A;  2L3D A;  4TV7 A;  3ASO H;  4EVI A;  3RZO J;  4BBS J;  2K9Q A;  3CLO A;  5J3L A;  3ZMZ A;  3JRI A;  1GXQ A;  1RPW A;  3OS0 A;  2LK2 A;  3J81 Z;  4BQQ A;  2H8W A;  3JRF A;  3F9K A;  2L9V A;  3DBR B;  2LKP A;  4XKC A;  4HX8 A;  1MBG A;  1PYV A;  4PSW A;  5HOD A;  1IXS B;  4R8H A;  4A5M A;  1K78 B;  1IV6 A;  2IGN A;  2ZB9 A;  1Y1V J;  2DT5 A;  3IL2 A;  2HDD A;  2GLO A;  1KQ0 A;  2W48 A;  1MW7 A;  2F2E A;  4HSR A;  3G4S I;  2BY2 A;  2X4H A;  5F6F A;  2Q8K A;  1DGR M;  1YOV B;  3FKJ A;  2Y0M A;  4BXF A;  1OCO H;  4ZDO A;  3RYP A;  3GCM A;  3H5A A;  3OYB A;  1HLV A;  5HS9 A;  1ZRF A;  1POG A;  2K4B A;  1XPX A;  1G3T A;  2QWW A;  2BYV E;  4MNU A;  1A35 A;  1ZR4 A;  4M6V A;  4S0H B;  2BVM A;  2DA5 A;  4E7Z A;  3ELK A;  3RIR A;  3GTG J;  3RPU A;  3RDI A;  4HW0 A;  3Q0V A;  2NS8 A;  4IHX A;  4L9V A;  1CQT A;  1DU0 A;  3K1N A;  2MYS A;  3IWF A;  3QYE A;  2KRC A;  1ETX A;  3WHB A;  1JKO C;  1FNN A;  2WAE A;  2P8T A;  4FHT A;  1J9I A;  1R22 A;  2HKX A;  2HZD A;  2UZK A;  4IHT A;  2ESH A;  1G3S A;  4XID A;  2P7V B;  3I53 A;  2M87 A;  3CZ6 A;  2R7F A;  1X58 A;  3BY6 A;  3DLA A;  2HVR A;  4WK8 F;  3ASN H;  1G2H A;  4CCJ A;  5LGT A;  5HDG A;  2NVX J;  1YFH A;  2KJB A;  5JHU A;  4NHJ A;  2IVM A;  3K4L A;  1UG0 A;  3KP6 A;  2KDZ A;  1QRY A;  4BQN A;  3F23 A;  1JE8 A;  1FTZ A;  2K9S A;  4B3X A;  1H8A C;  1ZKG A;  1MSE C;  1OR7 A;  1P7J A;  3EDP A;  3GTJ J;  1S7E A;  1RES A;  4GGG A;  3HGG A;  4M3F A;  1WJE A;  3E3V A;  1ZGW A;  3RPU D;  3FXM A;  5IP7 J;  1JUP A;  3HOU J;  5K1Y A;  4XLF A;  4QLC U;  5JVG F;  1YJN I;  4L9J A;  2DBB A;  3IRQ A;  2ZNY A;  1LKX A;  5EYR A;  4ON0 A;  1JUM A;  2XKO A;  2R7R A;  1GUU A;  2EK5 A;  3ZGK A;  4KNY A;  1IRZ A;  2VC1 A;  2X0L A;  3I55 I;  1T0F A;  4I98 B;  1HDD C;  2HEO A;  4KDP A;  1Z3Y A;  5DUK A;  1R5G A;  2E1O A;  3M8J A;  2DA3 A;  1U0J A;  2I10 A;  4YEJ A;  2HOS A;  5ICC A;  1IRF A;  2PI0 A;  1ZGA A;  1OCZ H;  2LMD A;  2CJJ A;  1DPU A;  4BKX A;  2XSD C;  3IKV A;  5JLX A;  3VEP A;  3G2B A;  4ZYH A;  3FMS A;  4J19 A;  1S7O A;  2R5Y B;  5AON A;  2MLG A;  2EFP A;  3L09 A;  1X1C A;  3B73 A;  3HOZ J;  3G3Z A;  2PX9 A;  3GZ6 A;  3TP3 A;  4DW6 A;  3KP4 A;  4C9Y A;  3H35 A;  2FNA A;  3CO6 C;  3I59 A;  2JRT A;  3A01 B;  2I8D A;  5DV5 A;  4U0W A;  4A3I J;  4F52 A;  3S8P A;  4MGR A;  4D7N A;  3OYG A;  1IN8 A;  2VUM J;  1MBH A;  4U7B A;  1RIO H;  1EH7 A;  4KN4 X;  5EZH A;  2GA2 A;  4HBL A;  5BMZ A;  1EA3 A;  3CJQ B;  2XPV A;  1FP2 A;  4FIS A;  1YX5 A;  3PM1 A;  2CQX A;  3DU5 A;  1D3Y A;  2RRE A;  4XM3 A;  1FOY A;  3RYR A;  5DM6 F;  4MTD A;  5H20 A;  1A6Q A;  4LLN A;  3M07 A;  3MKZ A;  1ZG3 A;  4JX4 A;  3GFL A;  2WA0 A;  1KYW A;  1BA5 A;  2WAQ A;  1D5V A;  2RN7 A;  5HLG A;  2B9S A;  2KFD A;  3CUO A;  3QOE A;  3V7C A;  2ZC2 A;  1XC5 A;  1ETV A;  4E7K A;  1EV7 A;  2JPB A;  5E3L A;  2H6C A;  2P5L C;  4JOM A;  4PSX A;  1U78 A;  1XSV A;  3L7W A;  4F91 B;  5J1R A;  3R0A A;  2A5W A;  2EFW A;  3TO6 A;  2PJR A;  2L2O A;  3SZP A;  3LSK A;  5L3F A;  4ZZL A;  2R7Z J;  3OYF A;  2XPW A;  3HKZ N;  1UG2 A;  2DK5 A;  3R61 A;  1ON1 A;  3S14 J;  3BRO A;  1HSJ A;  1A6I A;  4HYE A;  2B0L A;  4IOA F;  4A12 A;  4ENK A;  2BGC A;  2EWN A;  4UUS B;  2WAF A;  3NRV A;  2QVO A;  1TWF J;  2OU2 A;  4AUX A;  1H88 C;  2MAB A;  3CCJ I;  4LG0 B;  4OAZ A;  4GXO A;  2F5V A;  2X6W A;  3GLL A;  1GVJ A;  4LD5 A;  1WH7 A;  1YG2 A;  2LBF B;  2RQQ A;  2QYO A;  1Y8Q B;  3I64 A;  1FYK A;  1SD6 A;  2WBM A;  2JMW A;  4HX7 A;  5FJ8 J;  1TLH B;  1YO5 C;  5HS7 A;  4L0Y B;  4M3E A;  5J1U A;  3LWF A;  4OOI A;  2DA1 A;  2X51 A;  4XLE A;  3RQI A;  3WE3 A;  2XC7 A;  3QU6 A;  3MZ8 A;  3VFZ A;  2IW5 A;  4U88 A;  5CPR B;  4IKF A;  3O6B B;  3X2Q H;  2FOK A;  3ESW B;  2W1O A;  1W36 D;  1K4T A;  5C4J J;  3H3Z A;  4OU0 A;  1UHM A;  2XAF A;  1VI0 A;  3ECH A;  5IP6 A;  2DMN A;  3NAR A;  1YS6 A;  3K4N A;  3RSN A;  3TKY A;  2CQQ A;  4AM3 A;  3WU0 A;  2V1N A;  1ERD A;  1JJ8 C;  3M8E A;  5K5R A;  4IPA A;  2CO5 A;  2Z1D A;  1TQP A;  2PLY A;  1X1B A;  3HPG A;  4KUM A;  3BR2 A;  4NC8 A;  3CDL A;  1B72 A;  1MJB A;  3F8C A;  2W24 A;  1R5I D;  3FMR A;  1I5Z A;  1X4O A;  3O8G A;  3CCM I;  1QPI A;  2D1H A;  4E4H A;  1P92 A;  3ABL H;  2VPL A;  4HF2 A;  6PAX A;  1I3A A;  1W4M A;  1RKT A;  2VBX A;  3MCZ A;  5A2Q K;  4E7J A;  2G7U A;  1DQU A;  3C2B A;  3W6V A;  4A6E A;  2E5N A;  2F5E A;  4BAC A;  1B9N A;  1F1Z A;  1OIS A;  2TCT A;  1OKR A;  2EPF A;  3K7A J;  3WTS C;  3T1B A;  1OCR H;  1JXS A;  3F72 A;  2QBY A;  4I09 A;  4AID A;  1RUN A;  3C18 A;  3VSL A;  3ZOB A;  4XOT A;  2X85 A;  2ZXH A;  4XOR A;  3CMM A;  2Z3Y A;  3DKW A;  2O9L A;  3LAJ A;  2DU9 A;  5E3O A;  1BI0 A;  3CCS I;  1WFX A;  4B43 A;  1IG7 A;  1ZQ3 P;  3LA7 A;  3IH2 A;  3PFY A;  1WJA A;  4IEJ A;  3BWG A;  1H9T A;  2DN0 A;  2VON A;  2WV1 A;  4MEY F;  2VJJ A;  2RKH A;  1WCM J;  4JP0 A;  2DT7 B;  2Z33 A;  1JUS A;  1VQM I;  1EF4 A;  4N4N B;  1GXP A;  3C2G A;  3S1Q J;  5IT9 K;  3FKI J;  1DU6 A;  2DJI A;  4YFX F;  4L9N A;  4P96 A;  4GCV A;  5F27 A;  2DTR A;  2YS9 A;  4M6Y A;  2JVH A;  2VQG A;  2MG4 A;  3I59 B;  1MDM A;  2CMP A;  2XUB A;  3D5S C;  4F93 B;  4L5E A;  2ZXW H;  4YG2 F;  1X4P A;  2R93 J;  2HYG D;  3ISP A;  4G6T B;  4PCQ A;  5TGT A;  2HQN A;  5JFR A;  2LR8 A;  1FBQ A;  2RC4 A;  2IJL A;  1F4K A;  3DF8 A;  4CA0 A;  3HUG A;  1YW7 A;  3ABM H;  2NOG A;  3BTI A;  4RAZ A;  4BNC A;  3HB9 A;  3PUF A;  1B1B A;  2Q2E A;  1RKW A;  5ILV A;  4C3I J;  3F0C A;  2F5F A;  3GME A;  3IRR A;  3TGN A;  3IWZ A;  3V4G A;  1FOW A;  2PG4 A;  4HG2 A;  3OY9 A;  2VJI A;  4LLL A;  2HOA A;  5D4R A;  1XGS A;  2MGQ A;  1U3E M;  2E19 A;  3B6A A;  4O3M A;  4NUB A;  3J7Y J;  2FUG 2;  1B59 A;  3MQ0 A;  3DTE A;  4ZDL A;  4LB5 A;  1FSH A;  4E7S A;  1BW5 A;  2EZL A;  2VKV A;  3IAS 2;  2KPM A;  3PUB A;  3CD6 I;  2WWY A;  1KU3 A;  4YIR X;  3E0J B;  4M3D A;  2R7W A;  2PJR B;  4W97 A;  4BJT A;  1P4A A;  2JRM A;  5E8I A;  3GFI A;  1ZG1 A;  4D9J A;  2E1M B;  2FD5 A;  3BR5 A;  3EUK L;  3GLX A;  2DMT A;  1AOY A;  1IN4 A;  1BIB A;  3CUQ B;  3LA2 A;  2STW A;  2RNG A;  2MD5 A;  1XD7 A;  4XSX F;  5ILU A;  3W2V A;  3KEY A;  1KU2 A;  2Y48 A;  1IDY A;  4S05 A;  1OCT C;  5M3M J;  3HTU A;  1XMX A;  1E3P A;  4UY8 I;  2A6T A;  3TW6 A;  2NAZ A;  3PNV A;  2CUJ A;  1D0X A;  3ZMD A;  4A0X A;  2L4M A;  5BS6 A;  2ZJP F;  1S7A A;  3QRF F;  3TOA A;  2GIV A;  1I1S A;  3S93 A;  3OYN A;  1Z21 A;  2QQB A;  3U9G A;  4NBQ A;  3RKW A;  3VOE A;  3L1P A;  4E7I A;  3TDZ C;  2E2J J;  1ZK8 A;  1I6X A;  5M5Y J;  5IPA A;  2DJN A;  3K70 D;  4HDV A;  2B63 J;  3BQZ A;  2P4W A;  4QIW N;  1R71 A;  1HC8 A;  3RQ4 A;  3GWZ A;  4NC7 A;  2FX0 A;  2KKO A;  4CXF A;  2BV6 A;  1FEX A;  2FQ4 A;  1OR7 C;  2ETH A;  1FY7 A;  3SEZ A;  1CF7 A;  2IGK A;  2XVC A;  2WB1 N;  2IBD A;  3TO7 A;  2DA2 A;  4HNT A;  1XGN A;  4UVA A;  1ZRE A;  1BI1 A;  3RKX A;  1Q1V A;  3AL0 B;  2FQ3 A;  1KON A;  2P6S A;  1TP4 A;  5FRO A;  2L7K A;  2FJ1 A;  4FX4 A;  2FF4 A;  3MN2 A;  4PGG A;  3WG7 H;  4CCL A;  5FB2 A;  1YHQ I;  2D1V A;  3HRS A;  3MKW B;  1J7K A;  5JR3 A;  1T0F C;  3L2V A;  5J8C A;  3CCE I;  3IUO A;  3WGI A;  1BI3 A;  2KT0 A;  2X6X A;  4M6X A;  1T95 A;  4P55 A;  2CUF A;  5LLQ A;  4OIQ F;  2ID3 A;  4I0A A;  3M1E A;  1F43 A;  1X3W B;  3MD2 A;  2CH0 A;  3F8F A;  3IV5 A;  3E6M A;  2R7O A;  2HOE A;  1IW7 F;  1Y0U A;  4PJN A;  4OIP F;  1QHH D;  1QZY A;  4RM2 A;  4XRF A;  3HXL A;  4X0G A;  3CJN A;  5LGU A;  4L18 B;  2EA2 A;  5HLI A;  3BPX A;  2Y0S N;  2EV5 A;  3TO9 A;  2DI3 A;  2OQG A;  3OYJ A;  1U5T B;  2JWT A;  2WC2 A;  1FOX A;  1VZ0 A;  2HPM A;  5F04 A;  3LA3 A;  2LY9 A;  1HF0 A;  2QBY B;  2DOE A;  4PUS A;  3PIO F;  4RGU A;  1LPQ A;  2F5D A;  5J4V A;  2HR3 A;  3L2Q A;  4ZYD A;  4HNV A;  2LH9 A;  1HKS A;  3LNQ A;  3BR1 A;  4A3F J;  1VQO I;  1MJA A;  1MH3 A;  2P0W A;  2W82 A;  3B6C A;  5CVR A;  4FE4 A;  1QGP A;  2BHZ A;  4B4C A;  2LRE A;  1H0M A;  4I76 A;  3JRC A;  3QOP A;  3BC8 A;  1WI3 A;  4YFN F;  1IAW A;  1R6R A;  3LSR A;  2EB7 A;  5F0H A;  3SFZ A;  1PVE A;  1SAN A;  1MBK A;  2P5K A;  3VOD A;  5F64 A;  2EIM H;  2VXD A;  5FD6 A;  2JJ7 A;  3K2Z A;  3OR1 C;  2BW3 A;  4RAG A;  3J7Z I;  3DBH B;  3GVA A;  2P6T A;  3OYA A;  2QSH X;  4KT5 C;  2E60 A;  3MKY B;  1R4N B;  1UST A;  2W7N A;  4Q5S F;  4A3D J;  3SFI A;  4XK4 A;  2CSO A;  2FRH A;  1U6G A;  2K40 A;  1TL8 A;  2PBI A;  4AIH A;  1T08 B;  2NVU B;  2EIL H;  4EJV A;  4HST A;  1MNE A;  3OYK A;  2GXG A;  1NG7 A;  3DKX A;  5ILS A;  1R49 A;  3J7A Y;  3FF5 A;  2NNY A;  3KFW X;  1HBX G;  1W36 C;  2M2E A;  4ENN A;  3BJO A;  4BE1 A;  1DGW Y;  3HOW J;  4NQW B;  5FLX K;  3GTP J;  4V19 K;  1R1T A;  3W2A A;  2H27 A;  1VQ5 I;  2FNP A;  5EF6 A;  2A69 F;  2XAS A;  3K2A A;  3S2W A;  4A0Y A;  3IH3 A;  3KX2 A;  2KP6 A;  2O7O A;  1QVU A;  1SMT A;  3W6K B;  1AKH B;  3KIO A;  3RKQ A;  3A01 A;  2V1X A;  3AG2 H;  1ORK A;  2JT1 A;  3F3X A;  3H0D A;  4XN0 A;  2QSG X;  1LNW A;  1EH6 A;  3ONQ A;  4G6Q A;  1SC7 A;  1JTX A;  3OOU A;  5IY5 H;  3FXL A;  1WJC A;  2FMY A;  4I02 A;  2O3F A;  1E2X A;  2H09 A;  4MFD A;  5DCF A;  3GYH X;  4MIM A;  5H2F C;  3N97 A;  2GM4 A;  2UWM A;  1W5S A;  3EYY A;  2R7D A;  4NC6 A;  4ESJ A;  2IS1 A;  1ON2 A;  3KEQ A;  4KYW A;  4I0B A;  4IO9 F;  2DFF A;  5CJ9 A;  2KZG A;  2V9P A;  2E1C A;  1J2X A;  3S2H J;  2YX4 A;  2K5C A;  4IJA A;  1WRJ A;  3T8T A;  3GW2 A;  2EIN H;  4ZYG A;  1JTY A;  2M7A A;  2QSF X;  2HQR A;  2EIJ H;  5GTH C;  1LUJ B;  5BQT A;  3Q9S A;  3PJR A;  1TWC J;  1G6N A;  3IP4 B;  4OMZ A;  2CV1 A;  1E3H A;  3JTH A;  2E35 A;  2LKS A;  3C3W A;  5CKT A;  3VYU B;  4AU7 A;  1NK2 P;  2CQN A;  2DYR H;  1IDZ A;  1XDU A;  3DWL E;  4XSZ F;  1CF7 B;  4DOZ A;  1U9O A;  4LG0 A;  2VBW A;  4DZP A;  1USS A;  3DEE A;  2H6B A;  1JHH A;  4ZYE A;  1PP7 U;  2IEK A;  2LBF A;  3TBI A;  4F55 A;  2AXL A;  1HKQ A;  2DFE A;  3DLL F;  3PO3 J;  2XB5 A;  2CGP A;  1GV2 A;  2ZO4 A;  2XV4 S;  3TQN A;  2VJ4 A;  2XF6 A;  1NG6 A;  5EGO A;  3KYL A;  5B5E C;  4EJT A;  3IH4 A;  1LDD A;  3QAH A;  1UB9 A;  4EGY A;  2GOM A;  3KPH A;  4X1E A;  3A0H C;  1GVD A;  2ZBK A;  1OYI A;  4IQ4 A;  4Z6Y A;  5AIP A;  4IHS A;  3CJR B;  1HST A;  1XN7 A;  2DYS H;  2HQA A;  1IJW C;  4IZZ A;  2IGO A;  3KYD B;  1MMA A;  1UHS A;  1IN7 A;  1RNL A;  4CCO A;  4YIF A;  3BCB A;  4Q48 A;  1GDT A;  2VT3 A;  5EZG A;  2LKX A;  1BM9 A;  4KMF A;  2DMU A;  4CZC A;  2UUZ A;  5DD4 A;  3BG9 A;  2K3P A;  4NNJ A;  1Y0N A;  2PFB A;  2M1B A;  3MWM A;  2L4A A;  4CZZ A;  4HX4 A;  1FIP A;  4P5O A;  2PN6 A;  2R7Q A;  3PSF A;  4WXH A;  2K02 A;  3AFH A;  4QSH A;  1QZZ A;  1L0O C;  2HYF A;  2AS5 F;  3V8K A;  1FC3 A;  4A93 J;  1BR1 A;  3CDH A;  4BE2 A;  3FXU A;  1FJL A;  2G9W A;  5GAE J;  4BYY A;  3G71 I;  2VXZ A;  4XLN F;  5HS8 A;  1IV8 A;  1BOA A;  2VAS A;  3AG4 H;  3EYI A;  1QBJ A;  1J0R A;  1OLT A;  2VB6 A;  3R4K A;  1HXD A;  1OQY A;  2CFX A;  2EJR A;  5FLM J;  3Q5F A;  1FP1 D;  2M3A A;  1WH5 A;  2K3F A;  2LP0 A;  2OPT A;  4XBF A;  3K70 C;  2ADU A;  2BW3 B;  3OL3 A;  2O61 A;  4Y52 J;  3HHG A;  2OBP A;  4BY1 J;  2DOF A;  3FM3 A;  3H5N A;  2IS4 A;  3L9F A;  3IHU A;  5DTD A;  3DFG A;  3ZP5 A;  3O8H A;  3G1L A;  3S1R J;  2DQL A;  4EM1 A;  2R4G A;  1FZP B;  1X2M A;  1R1U A;  5HNF A;  2JA6 J;  3E97 A;  3KP2 A;  1IF1 A;  1P4X A;  4D5C A;  1TWG J;  3EPZ A;  4IXA A;  5E8G A;  2HS5 A;  3P9I A;  5E3M A;  3S3O A;  2K9L A;  3E1S A;  3FBN B;  3PQJ A;  4LGW A;  4UUT A;  3JR9 A;  1T56 A;  2M0M A;  3FXQ A;  1PUE E;  2O6G E;  2QZ8 A;  1ETW A;  5M3F J;  1VQN I;  2F6C A;  3H36 A;  4RB1 A;  1WVR A;  5FKL A;  3R0J A;  2L7F P;  4OIR F;  2DLL A;  2L9R A;  2XAJ A;  2XRN A;  3CC7 I;  4ANJ A;  1VQ8 I;  2CW7 A;  2DQR A;  3KLO A;  1Y56 A;  1X1D A;  3SHF A;  2KIU A;  1ZAR A;  1Z6R A;  3GF2 A;  4PJJ A;  1JJ6 C;  2LFB A;  5B1A H;  4KIT B;  2PMU A;  4IQJ A;  4A3M J;  4ZDP A;  1V5F A;  2PEX A;  4FCY A;  1B8I A;  4AYB N;  3Q0W A;  3TW7 A;  3EUH A;  3FX3 A;  1R7J A;  1N25 A;  1EKE A;  5LD2 C;  4ZH4 F;  1P4W A;  3CP8 A;  3ABK H;  3E7L A;  3V42 A;  2O5R A;  1IN6 A;  5EEG A;  4CCK A;  1XDS A;  4KN7 X;  4LLG F;  4M9S A;  3SZG A;  4A3K J;  4GDF A;  3P9C A;  2R0Q C;  4HDU A;  1W0T A;  2EV0 A;  4DYR A;  3J81 K;  2E2H J;  2DA4 A;  2K9M A;  2PMZ N;  5J40 A;  1T39 A;  2NVT J;  2NXN B;  1S3J A;  2VL8 A;  2DCE A;  3CUQ A;  3FK7 A;  2LNB A;  2FML A;  5D6E A;  3JRD A;  3ZQL A;  3BJ6 A;  3FXJ A;  4G7Z F;  3D0S A;  5B1B H;  2JTV A;  3TDU C;  2JA5 J;  1O57 A;  2XSJ C;  3ZMT A;  5D5X B;  5L3B A;  3W2W A;  3QP5 A;  1KZH A;  4IHY A;  1LEA A;  1KU9 A;  4L5I A;  1I3Q J;  4OAY A;  2LY2 A;  5TJJ A;  4BU2 A;  4DQ2 A;  2LYC A;  2Y0S A;  3I0T A;  2M30 A;  3L00 A;  4I2O A;  2VOP A;  4GRI A;  5E1X A;  2OF7 A;  3SYT A;  3FXR A;  3WTY C;  2YU3 A;  3DPT A;  5LRR A; 
#chains in the Genus database with same CATH homology
 3ZR8 X;  2KPM A;  3PUB A;  2R7W A;  3E0J B;  3MMY B;  2PJR B;  4BEH A;  4ZTJ A;  4BJT A;  1MMN A;  3LSH A;  1FMV A;  1D1B A;  3TL4 X;  4CCN A;  3OS2 A;  4D9J A;  1S9H A;  2E1M B;  3EUK L;  4BL0 B;  4XON A;  3OIP A;  3VYT B;  3SDB A;  3BG7 A;  4PK4 A;  3BCA A;  3H9Q A;  3HL2 A;  2OUM A;  3L2W A;  2RNG A;  3HUG B;  3W2V A;  3KEY A;  1N77 A;  4DIQ A;  3M1C A;  2Q2E B;  4XLH A;  3ZRG A;  2KHM A;  1J09 A;  2A6T A;  2QKL B;  3H9G A;  3PNV A;  2CUJ A;  1D0X A;  3HC7 A;  4BQO A;  5HOO A;  4ZC3 A;  2CW8 A;  4U87 A;  3QYF A;  4B48 A;  3S93 A;  3OYN A;  2LG4 A;  1Z21 A;  4MLO A;  4DGW B;  4E7I A;  4PJM A;  4DBQ A;  2L5Q A;  2X1C A;  2R7X A;  4ITV A;  3S32 A;  2IS2 A;  2L9N A;  3K70 D;  3H5R A;  4II2 A;  4BEH B;  3GBG A;  2E5Z A;  4FET A;  3A1Y A;  5CQG A;  2W00 A;  3RQ4 A;  4NC7 A;  3LMM A;  1BOB A;  4PJL A;  1OR7 C;  3SEZ A;  2HDW A;  2IGK A;  1WJD A;  1YX3 A;  3EUA A;  3PNY A;  1D1C A;  1BR4 A;  4BDZ A;  1V5E A;  4HNT A;  4ZJZ A;  1MMD A;  3C2H A;  3K4B A;  3AKZ A;  3VDX A;  3FBI B;  1FMW A;  2VKH A;  2ZSI B;  3K10 A;  1KON A;  3OR2 C;  3AL0 B;  5FRO A;  2L7K A;  3VYS B;  4E6K G;  1WJF A;  3OYI A;  2IS6 A;  3DKY A;  3FHN A;  4H4K C;  4LG3 A;  4CCL A;  4XLA A;  3MKW B;  1T0F C;  3L2V A;  3IUO A;  2X6X A;  2W4S A;  1T95 A;  1GLN A;  1JI8 A;  1P9Q C;  3I9V 2;  3MD2 A;  3DTI A;  2CH0 A;  2R7O A;  4BJ6 C;  4PJN A;  1QHH D;  4RM2 A;  2CV2 A;  4BUP A;  3HXL A;  4X0G A;  2WB1 A;  2MC4 A;  4LIV A;  2V26 A;  4XMY A;  2KRH A;  3OS0 A;  3OYJ A;  2DOA A;  4BQQ A;  3RCO A;  1VZ0 A;  2HPM A;  3F9K A;  5KCM A;  4XKC A;  4LIT A;  1MMG A;  4PUS A;  1PYV A;  4PSW A;  3L2Q A;  2IGN A;  3A4C A;  1TT0 A;  2R7V A;  2LH9 A;  1MW7 A;  2R7S A;  3DPU A;  4HSR A;  2P0W A;  1DGR M;  2W82 A;  3FKJ A;  4BXF A;  4II3 A;  2JA2 A;  2XF5 A;  4ZDO A;  3H5A A;  2LRE A;  3OYB A;  1Y6I A;  3I3L A;  3BC8 A;  4CCM A;  5LFA A;  2BVM A;  1R6R A;  4E7Z A;  4C2U A;  1PJR A;  2XDV A;  4J00 A;  1WJ5 A;  3OYE A;  2VXD A;  2MYS A;  1QHG A;  2KRC A;  3QYE A;  3OR1 C;  1G8X A;  2BW3 A;  4XNF A;  2WAE A;  3HG9 A;  2JVG A;  3OYA A;  2HZD A;  2E60 A;  5CQE A;  3MKY B;  4YEL A;  4XQF A;  2W7N A;  1E0E A;  4Y4R A;  3CZ6 A;  2HVR A;  3DLA A;  2KLO A;  3K4J A;  4CCJ A;  4HST A;  1MNE A;  3OYK A;  3DKX A;  1NG7 A;  2OC6 A;  4PFP A;  4ZYA A;  3OYC A;  1W36 C;  3J7A Y;  1HA8 A;  4N4O B;  4BE1 A;  3K4L A;  1UG0 A;  1DGW Y;  4BQN A;  3PSI A;  4NQW B;  5FRM A;  4B3X A;  3W2A A;  4BDY A;  4DJA A;  2V7F A;  4RLQ A;  5HLT A;  3KX2 A;  2KP6 A;  1Z3X A;  4OWR B;  3QOD A;  1SFK A;  1WJE A;  3RPU D;  2NOJ B;  2HPI A;  4XLF A;  3H0D A;  4F3Q A;  4XN0 A;  1LKX A;  3ONQ A;  3OOU A;  2R7R A;  4BGD A;  4KIS A;  1WJC A;  3ZGK A;  4BJ5 C;  1Z3Y A;  2UWM A;  3HOS A;  4XKB A;  2VJ5 A;  3OMY A;  2R7T A;  3M8J A;  2IS1 A;  1U0J A;  4YEJ A;  2ELJ A;  3L2R A;  2R7U A;  4HRI A;  4AVZ A;  2ZSH B;  3ZXS A;  1LVK A;  1QU3 A;  3G2B A;  2K5C A;  2UV1 A;  1UAA A;  1X1C A;  2KDO A;  2M7A A;  3PNT A;  4E7H A;  4HNU A;  4C9Y A;  3H35 A;  2XAU A;  2CFO A;  2I8D A;  2ZXI A;  4F52 A;  3S8P A;  3PJR A;  3BLY A;  4Y33 A;  3OYG A;  3IP4 B;  2CV1 A;  3CP2 A;  4U7B A;  3K4K A;  2KZV A;  3CF2 A;  2VQC A;  5CKT A;  4XKV A;  3VYU B;  4AU7 A;  1EA3 A;  3CJQ B;  5FRN A;  1YX5 A;  3DU5 A;  3DWL E;  4C30 A;  2RRE A;  4XM3 A;  4DOZ A;  3OL4 A;  3DEE A;  2KMU A;  3MKZ A;  2WA0 A;  2DT6 A;  2LBF A;  2WAQ A;  3VYR B;  3TBI A;  1MND A;  2LC2 A;  4F55 A;  1DP3 A;  2Z16 A;  3QOE A;  3IAM 2;  3DQV C;  4E7K A;  3FDY A;  2MFZ A;  2VKD A;  2XF6 A;  2VJ4 A;  4JOM A;  4PSX A;  4F91 B;  5KHD A;  1NG6 A;  2PJR A;  2A5W A;  3KYL A;  1D0Z A;  4XR6 A;  2L2O A;  3LSK A;  3L2U A;  3H9J A;  2V6E A;  2GOM A;  3OYF A;  3EUH C;  4IQ4 A;  2IXS A;  3CJR B;  3CES A;  2HQA A;  2WAF A;  3HOT A;  3ZQQ A;  4QPO A;  2IGO A;  4IZZ A;  1MMA A;  3K6G A;  4CCO A;  3BCB A;  2BOL A;  2VQL A;  2V9K A;  2MAB A;  4OAZ A;  4CZC A;  2UUZ A;  2K3P A;  4NNJ A;  4XLC A;  2Q1Z B;  2F5V A;  2X6W A;  3OYD A;  2E1M C;  4XL9 A;  4P5O A;  2LBF B;  2AQE A;  2LOO A;  2RQQ A;  2LY1 A;  2R7Q A;  2X1D A;  1AA7 A;  2BVL A;  2WBM A;  3PSF A;  4XKW A;  3AFH A;  3HKZ A;  4XOP A;  3LL7 A;  3LSM A;  1ZEL A;  5HVQ C;  3LSG A;  2JSP A;  1BR1 A;  2X51 A;  4XLE A;  5JHF A;  4BE2 A;  3BG6 A;  1V5G A;  2XC7 A;  1YE9 A;  2VXZ A;  4RM3 A;  1IRX A;  5CPR B;  4IKF A;  2VAS A;  2X1E A;  3OWT A;  1OLT A;  2VB6 A;  2WY8 Q;  2W1O A;  1W36 D;  2VLA A;  3UR3 C;  3LSI A;  4CSW A;  2DXI A;  2L9S A;  4YRV A;  5HNH A;  3OYL A;  2VIX A;  2M3A A;  2CV0 A;  4PFO A;  3K70 C;  1LDK B;  2BW3 B;  3K4N A;  3OL3 A;  3RSN A;  3TMO A;  3D5R C;  2M4G A;  4B44 A;  2V1N A;  2HVQ A;  1ERD A;  3H5N A;  2IS4 A;  3A2K A;  2Z1D A;  1D0Y A;  1G59 A;  2KL4 A;  2M7B A;  2F4I A;  1X1B A;  3HPG A;  3HPH A;  4NC8 A;  2R4G A;  5HNF A;  4BE0 A;  3S3N A;  2X6Y A;  1X4O A;  3OIQ A;  3QYB A;  2V4J C;  3EPZ A;  3VWB A;  1BR2 A;  4E4H A;  5KNL A;  2VPL A;  4J01 A;  2GOX B;  3AL0 C;  3S3O A;  2K9L A;  3E1S A;  3FBN B;  4E7J A;  2M0M A;  4P1W A;  3OYM A;  1DQU A;  4DBR A;  2E5N A;  1LFP A;  1X1A A;  4BAC A;  1WJB A;  2F6C A;  3ZCO A;  3D5L A;  4ANJ A;  3DTK A;  2CW7 A;  3N05 A;  1Y56 A;  2AQF A;  1UEL B;  1X1D A;  4IX7 A;  3VSL A;  4PJJ A;  1X19 A;  2WAD A;  4XOT A;  3S3M A;  2X85 A;  2ZXH A;  4XOR A;  4KIT B;  3CMM A;  4F92 B;  4IQJ A;  2OV7 A;  4ZDP A;  1V5F A;  2ZFU A;  2IGM A;  1D1A A;  1WFX A;  1N78 A;  2WY7 Q;  4QPQ A;  4B43 A;  3PFY A;  4D1Q A;  2VQH A;  1WJA A;  3SEQ A;  4JQF A;  2HNH A;  2VJJ A;  5LD2 C;  3CP8 A;  4KJZ A;  2DT7 B;  2Z2S B;  3UNG C;  4N4N B;  4XN3 A;  3U21 A;  3C2G A;  3V42 A;  4BS9 A;  4HPQ A;  2O5R A;  3NWT A;  3K4M A;  4CCK A;  3SZG A;  1N75 A;  2DJI A;  4C2T A;  4RMN A;  4LIU A;  2CS3 A;  4EAT A;  2KQR A;  4HEA 2;  4ZTF A;  2JVH A;  3W3C A;  2K9M A;  2LRD A;  2VQG A;  3LFU A;  2MD0 A;  4R79 A;  2CMP A;  4F93 B;  3D5S C;  2HVS A;  1X4P A;  3DU6 A;  2VL8 A;  2DCE A;  4G6T B;  5TGT A;  4AYB A;  3OYH A;  4KT6 A;  3K4C A;  1TZL A;  2HU9 A;  4CA0 A;  2QKM B;  2XSJ C;  2CUZ A;  1Z7L A;  3RTR A;  3W2W A;  1SAU A;  2JUG A;  4RLF A;  2M4K A;  4OAY A;  4CUG A;  2LY2 A;  4BU2 A;  4E7L A;  1K6Y A;  2XF7 A;  3VSK A;  4HG2 A;  3OY9 A;  2VJI A;  2LYC A;  3PL8 A;  2Y0S A;  3OS1 A;  4FAS D;  3NWS A;  4GRI A;  4NUB A;  2PMZ A;  2FUG 2;  3SYT A;  4CH7 A;  3DTE A;  4ZDL A;  3DPT A;  3DPL C;  4B47 A;  4Y3O A;  4E7S A;  3IAS 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...