2LBFA

Solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
b'MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S acidic ribosomal protein P1
publication title Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
total genus 18
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2011-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lbfA00
4BEHA 4BEHB 3A1YA 2LBFA 2LBFB 2W1OA
chains in the Genus database with same CATH superfamily
4ZYGA 2P7CB 2M8EA 2W82A 4QWQA 3WU0A 2BY0A 4A3GJ 4YIFA 3ONQA 1V5FA 1Y8RB 2DFEA 2HQAA 4A6EA 1V5GA 3VSKA 2EIMH 1BL0A 5IOZA 1OKRA 2JTVA 3L9FA 5J8FA 2XUBA 4JOMA 5DCMB 2NVQJ 5BS6A 4BGDA 3JTHA 3JRGA 3PO3J 1DPUA 4ZJZA 3CO6C 4AM3A 3S16J 4A5MA 4XN0A 1Z3XA 1OYWA 2DOEA 5C44J 2K27A 4GXOA 2VKEA 3NRVA 3DTIA 2EH3A 4BNCA 1A36A 4A3IJ 3T1BA 3GW2A 1LDJA 3FZVA 2UWMA 4EJUA 3L2WA 2PJPA 1WPKA 3P9CA 1MNEA 5CQEA 5E1WA 2R5YB 2GM4A 2CU7A 3N05A 2VKHA 1K78B 2W48A 2LK2A 4AIHA 2WAQA 3CTAA 4IHVA 2DA4A 1YS7A 1KYZA 4ZYAA 3OS2A 3H3VK 3SFZA 3FBNB 4KIGA 4BHCA 1APLC 3QOEA 4LG3A 3HOSA 4IEJA 1F36A 3L2VA 1K4SA 2VONA 5IP6A 3M8JA 2IRFG 2IBDA 1RKTA 4HBLA 1U0JA 3HL2A 2LG4A 1HBXG 1FZPB 2VN2A 3PSIA 3MAJA 1AA7A 5HNHA 1IN5A 1BJAA 2J5PA 4F3QA 1IAWA 5EZHA 3MZYA 4E7JA 5DD4A 2XF7A 4MQVA 4P5OA 4ZZDA 4Q48A 4C3HJ 1G4DA 1FT9A 3GTGJ 3HOWJ 3LQQA 3JAMZ 3CC7I 1KYWA 2Y0SN 3B6AA 3DV8A 4A12A 3O3KA 4N0BA 2MABA 2MBFA 1E3HA 3LSJA 2IP2A 2R3SA 2D1VA 5BNGA 1NTCA 3ZMUA 3ESWB 4CXFA 1R5GA 4S05A 1IN6A 1RIOH 1PP8F 4ESJA 1H89C 3C7JA 1YTYA 4OIOF 3KEQA 3GTJJ 3WG7H 3BJOA 2COMA 1WJCA 2A68F 5CVJA 3VWBA 2YS9A 2Y0MA 1PJRA 1FNNA 1OCZH 4A3MJ 1TWGJ 2EV6A 5M5WJ 2NVTJ 4UNOA 2CSOA 2XB5A 5A2QK 2XAGA 4OIRF 2E7WA 4XLFA 1AU7A 2M3AA 1UHMA 1NH3A 1IO2A 2K9SA 4CA0A 3ECOA 4RB3C 4QSHA 3HKZN 1VQLI 5FRNA 1LEAA 2J5OA 2E1MB 5EZGA 2L7ZA 1HOMA 3S93A 4Y15A 2V26A 4UHTA 1U9NA 2FF4A 4LLLA 1XDSA 4B3AA 2ZFWA 3BWGA 3SQNA 4XSZF 2GZWA 1WQ2A 2GIZA 1IUFA 1XC5A 2G9WA 1L0OC 4BXUA 5CPRB 2Y2ZA 1ZAOA 4IF4A 2QGUA 2AQEA 2DA3A 3WTTC 1LVAA 3HTSB 3GCMA 1AKHB 3SZPA 1TNTA 3I3LA 3IHUA 3I56I 4IOCF 4B48A 4BHPA 4QIWN 3PNTA 1TT5B 5CVRA 3QU3A 1QA6A 4CYCA 5ICGA 2KHMA 1S7EA 1YJ9I 3BLYA 4UV8A 4KT5C 1N77A 2PEXA 3SZGA 2Z5UA 4PSXA 1W7PA 3CQZJ 4DNCA 1BJZA 3RPUD 5JLXA 1MBKA 2WY7Q 3OYNA 3SYTA 4EGZA 2AO9A 2FMLA 2PG4A 3HOVJ 1LFPA 1WJBA 2K9NA 3RYRA 3ZMVA 4A3EJ 1A31A 2OTJI 1YIOA 5ILUA 2L4AA 1SFUA 4G12A 3J81K 3MKZA 4C2MJ 4YG2F 3HRSA 1B1BA 4A93J 3CUQC 1JKRC 3MFKA 2LRDA 4FCYA 1WJEA 4XMYA 5C3EJ 1TW3A 5FKLA 4MO7A 5H6QA 2G7HA 5KAFC 4FASD 4MFDA 2EFOA 3MZ8A 3H1CA 2A5YB 4O5VA 1SC7A 3QYBA 3L2QA 4FX0A 4QTRA 2ETHA 5ERIA 1U8RA 3DU5A 2IVMA 2PQ8A 5CLSA 1GVJA 2E5NA 2NAZA 4XR6A 1XSVA 1EA3A 3LSIA 1MNMC 4BHBA 4XLPF 5HLGA 5J40A 2XGCA 3F3XA 2R7UA 2M0CA 3FXMA 5ICCA 1V55H 2YPRA 3FXLA 1ZLKA 2W57A 1ERDA 3QQAA 2IJLA 1R22A 1YJNI 4CYCB 2MG4A 4WXDA 2KMUA 2IA0A 3IUOA 4XICA 3CCEI 1FOXA 1AWCA 1BIBA 3JREA 3ZRGA 3G3ZA 2ZO4A 3ZOBA 4J19A 4KJZA 3LSTA 2ELHA 1SAXA 1MKMA 1VQNI 2G0EA 2UXXA 4WXCA 2ADUA 4LJZF 3KETA 4HF1A 2XB0X 3ISPA 3EYYA 5BPIA 3VOEA 2D2WA 3E3VA 1OISA 4AVZA 4C3IJ 2CFOA 4RB0A 3R0AA 4M3EA 5ICFA 1TQPA 2DT5A 3TW6A 2B7EA 3L7WA 2JVGA 2L7KA 5HOOA 1JI8A 4KIFA 1HA8A 1O3RA 1Y0NA 3CC4I 5HS7A 1WH5A 1O3TA 1IGNA 5EF6A 4D5FA 1MIJA 4ESBA 2A69F 2NS0A 2ZNZA 1LNWA 3OYKA 1WJFA 3ZQFA 2RDPA 3ZP5A 4X6AJ 3ZXSA 1CF7A 1A6IA 1OCRH 3V4GA 3E5UA 3HRTA 3HOYJ 1OYIA 3GO5A 2P4WA 4XLNF 3WU1B 2HWVA 2NXNB 2M4KA 2MC4A 3PSFA 2DJIA 2KJCA 1HSJA 3TDUC 5AIQA 2FU4A 2WV0A 3W6VA 1SD7A 1XCVA 5C4XJ 1E17A 2GA2A 2VL8A 2WA0A 1J0RA 3LL7A 2X48A 5E79C 4E7KA 1PVEA 2X4HA 4I0AA 3GZ5A 4CYDA 1SFKA 4H4KC 3LFKA 2ZMEA 3KE2A 2KZVA 1F9NA 2ELKA 2ZNYA 1Y1VJ 3CF2A 3LSHA 4PJLA 3PL8A 1OQYA 5K5QA 3J80Z 1T38A 1T0FC 2ESHA 3OMYA 1XPXA 4EGYA 3M8FA 4YEJA 4BJ6C 5F1RA 5GADJ 2KRFA 3QPSA 1IXRC 2TRTA 3GLXA 5EYRA 5LLQA 4DZPA 2HXOA 3F8CA 1RRJA 1TTYA 5FD6A 3PIPF 1G2HA 1VQPI 5FJ8J 2RC4A 3OYEA 3ZQGA 5IP9J 5FFXA 3GTMJ 3OYGA 1FYKA 3U2RA 4MLOA 1XMKA 3E1SA 3E5XA 2WB1N 4JYKA 4ZDPA 1CF7B 1EKEA 5JVTA 3WE3A 3ZQLA 3JTGA 4CO8A 3FXKA 3D1NI 1QZEA 4RAYA 3J7ZI 2LKXA 2G7UA 2QBYA 2CRGA 4DYRA 2N8GA 1IRFA 3OYHA 2M45A 2VPLA 1OCCH 3WGIA 2L54A 3DTEA 1YG2A 1IRGA 1CQTA 5CVUA 2CS3A 1ZN2A 2CO5A 1S8NA 3OYJA 2H1LA 3F21A 1LJ9A 3CCMI 1T2KA 1RETA 5E3OA 4IHXA 2DFIA 1FTZA 1J9IA 4D7NA 1OR7C 2WV1A 1FBUA 2DK8A 2L9NA 2OPTA 2XGEA 4NC6A 3SXYA 4A3LJ 2CV1A 1DDNA 4LOCA 2K9MA 3HXLA 1IW7F 3OS1A 1FOKA 2ZMEB 1KU3A 1VQ9I 1FWZA 4DW6A 4U87A 3PFYA 2MSYA 2Y75A 4LIVA 2TCTA 2UUZA 4XORA 1YS6A 2CV2A 3HUGA 2R7OA 4RAGA 1UFMA 4JX6A 4UVBA 4XKWA 1WI9A 3DP7A 4G7OF 3FF5A 4BY7J 2WAFA 4L0YB 3A4CA 1UCRA 2KISA 2I5UA 5DUIA 3A2KA 3BDDA 3K0LA 2IGOA 1P2FA 1YW8A 4XRMA 3FXRA 1I6XA 3QPTA 2HVSA 2H8WA 3D5LA 2Q2EA 4HQMA 1O4XA 1VQMI 1BI1A 2IPQX 1HKSA 3C2HA 2F6CA 3MD2A 3I64A 1Y0UA 3JRAA 5DM6F 4DGWB 3OYLA 2Z99A 2QBYB 1YOVB 2A61A 2ID6A 3E6BA 2IGNA 3A1YA 3H5RA 2CW7A 2W7NA 4BBSJ 1I5ZA 1G6NA 1D0XA 2W00A 4KT6A 4D7MA 4YRVA 1F4KA 3HOZJ 2WAQN 3FXUA 4CCKA 3LAJA 3RCOA 3LA2A 3QPLA 3H0GJ 1E0EA 4A3BJ 1V54H 1XGNA 2OU2A 1MBJA 3RIRA 4B1RA 4N9HA 2VOOA 2H6CA 1TW2A 2X6XA 2E60A 1S7OA 4HX7A 4XN3A 4IJAA 4UB8C 4JP0A 3KIOA 4KUMA 3BZKA 5LRRA 3KP4A 3VYSB 1MSFC 5D4RA 5JVGF 2OZ6A 3HUGB 2Z3YA 5LFAA 2VC0A 4EJVA 5LGUA 1T6SA 2YSRA 2IAIA 1IDZA 2E35A 1MMNA 4N4NB 1OLTA 2CV0A 2EPFA 3FBIB 2NRAC 1GLNA 2CMPA 5FROA 1YIJI 1P92A 2A5WA 3X2QH 1J2XA 3K4BA 2Q2EB 5J1UA 1H8AC 2V79A 2O6GE 3M4OJ 4XLCA 1UHSA 1R71A 3GFMA 1FY7A 2M8GX 3W2VA 1SMYF 3ZQQA 1V3FA 3WGGA 1ZK8A 2E2HJ 2VBXA 4II3A 2VXZA 3VYTB 4I7HA 1W5TA 1ITYA 2BV6A 3K1MA 3IKVA 3NAUA 5D5VB 2QSHX 2RKHA 3IWFA 5EEAA 2A07F 3UNGC 1KU2A 1N25A 5A2QZ 1MBGA 2K3FA 3WTUC 1X19A 3S1QJ 4OU0A 4Y13A 2H94A 5GAGJ 5M5XJ 3FKJA 2OCEA 3V8JA 5GAEJ 3GUDA 1X4PA 3KFWX 4ZYEA 3OYCA 2DW4A 1U2WA 2P5KA 2KQRA 3JR9A 3AKZA 2HOSA 4HSTA 5EJCA 4I0BA 3S3NA 2GQQA 4XLAA 3W6KB 4IX7A 3C2BA 1ETWA 1KU9A 4O6JA 3ZMDA 3FWEA 1BIAA 3K2ZA 1MBFA 4AUXA 3SJMA 1ZRDA 1YX3A 3KYDB 5EG0A 2EFWA 3BTJA 2F4IA 4EM1A 2R7XA 5E8IA 1VQ7I 2EV0A 4I02A 2ECBA 3U21A 1OPCA 2ZKZA 3S2WA 2VJIA 3TOAA 2VT3A 3GF2A 1R23A 2GBYA 2K02A 4LLGF 4IQ4A 4KDPA 2EA2A 2EIJH 1OCTC 1Z77A 1VI0A 3IWZA 3TOBA 4E7IA 4PDKA 2X51A 4RAZA 3SHFA 1J75A 1BI2A 3HIFA 2KL4A 3R60A 4U0WA 1LB2A 2IEKA 2X6WA 2IGKA 3DXJF 2DPUA 1POGA 1WKMA 2FBKA 5DS9A 4BH9A 1USSA 4HRIA 1B59A 2LREA 3L2RA 2P5LC 1HF0A 1MJ9A 2DMNA 3GTOJ 5TJJA 2Y30A 2NS7A 2HR3A 1XMAA 4ZDOA 3VYUB 2VQHA 2R7WA 1W4MA 3S3MA 1X2MA 3KYLA 3FXOA 3PJRA 4MTDA 2COBA 2ISZA 3HDDA 3J81Z 4HV6A 3G1LA 4HDVA 4EJOA 3U9GA 1BI3A 2DMTA 2B0LA 3P5JA 5GAHJ 3OYAA 4HNUA 3BPVA 3CCSI 2DXIA 1S29A 3OY9A 5EG0B 4YFNF 3BOQA 1GT0C 2KDZA 4IQJA 3A03A 1XGMA 2R7QA 1BM9A 1Z91A 2L7MP 4BDZA 4A69C 3JRBA 2M1BA 4AIDA 1ZELA 5KCMA 4HF2A 5FKNA 2R7FA 3LA3A 4I2OA 2R93J 2R4GA 3ZN0A 2HXIA 2VB6A 2A3SA 2ZXIA 2XSDC 4RGRA 1YI2I 1RZ4A 1VZ0A 2KIFA 4KYWA 5TISC 1AHDP 2MD0A 4FETA 1MMSA 2E1NA 5CVVA 5IT3A 3CCRI 4KA4A 3W2AA 2KIMA 5E18F 2VBZA 3VFZA 3J7YJ 1ZQ3P 2VE8A 5B1BH 3DBHB 2MH2A 3ZR8X 1K79A 3SDBA 1ZGAA 5J4YA 1IZ1A 2Z1DA 4IOAF 3QPHA 1DGRM 2MGQA 2DA5A 5DM7F 1ZG5A 4GYIA 1UG0A 2JK3A 3V7SA 4OWRB 1ZRFA 1FJLA 1FC3A 2OBPA 4I09A 2E2IJ 4GDFA 3EUKL 4LG0A 4RLQA 1YFHA 4GGGA 4HX4A 4MEYF 4A2UA 4FE7A 1EJ9A 3I0TA 1XTAA 3CCYA 4BE0A 1IRZA 4IKFA 2BBYA 3LQRA 2V1DA 1D3YA 1WH7A 5FKOA 3F6VA 2A6HF 3IRRA 3OIPA 5E3MA 1MJBA 1K61A 3OSFA 1U6GA 4RAFA 4RDUA 2D5VA 2UXNA 3G1OA 3CP2A 1S72I 1BW5A 3F8FA 5HDGA 1MH4A 4DJAA 2Z2SB 1MMDA 2I10A 2JUGA 2ZMEC 3RZDJ 1ZH5A 5FLXK 3FMQA 3P9KA 2XAQA 1A04A 2RVCA 1ZG1A 3ROUA 2VLAA 3H5NA 1FBSA 3KYCB 4KN4X 3DF8A 4DYQA 3HGGA 5F64A 1A35A 1IF1A 2DOFA 2LNBA 4PCQA 4ASNA 1VQ8I 2JSCA 1EF4A 3H36A 3QYFA 3HSEA 4CICA 2ZXJA 2QQAA 1QVUA 3F72A 3RKXA 2F4OB 1MBHA 2P6SA 2LDUA 3A02A 2HDWA 2KIUA 2XASA 3EUAA 3M8EA 2E7XA 4PGGA 1MW7A 4Q47A 3CLOA 5E20A 4Q5SF 4LG0B 1DU0A 2ICWG 2K4BA 1EV7A 3ABMH 4LK1F 1HLVA 1X3ZB 2EWNA 4B43A 1JE8A 3OV8A 3C3WA 3WHBA 1YRNA 3ZQ7A 2DYRH 2NNNA 3DBLB 1S9HA 3TDZC 3MZHA 4BXFA 1G3SA 5D5UB 3WTWC 4U0YA 2HVRA 3AG2H 4CGZA 3OWTA 2QYOA 4M3FA 3SEQA 5IP7J 4IRHA 3KEYA 3VDXA 3R6SA 1FLIA 2EB7A 1K83J 2X0LA 1I3QJ 2VPRA 1JKPC 1P6RA 1QHHD 4CDGA 1ULYA 3MEXA 2VIXA 3OOPA 4PUSA 1U9OA 2KPMA 3M3YJ 3H9QA 3FK6A 5E3LA 3DFGA 3VB2A 3L2UA 1X2NA 2Q0OA 1JUPA 2LTPA 2KP6A 1TWCJ 2M9HA 3BTCA 4NBQA 2A6TA 2DN0A 3C1DA 3IRQA 4AYBA 3BG6A 2HZDA 2KRHA 4Q4ZF 2FOWA 3ML6A 1R6RA 3GWZA 3LA7A 3OL3A 4BBRJ 1H0MA 2DPDA 2XGXA 3S1MJ 2W1OA 3BR6A 4E7HA 1FEXA 4NC7A 2OUMA 4DQ2A 2O7OA 1R58A 3GBGA 1VQOI 5FKKA 5IYDJ 3E5QA 3KX2A 2Z9OA 3CO7C 2FBHA 1W5CC 1LFUP 2F4MB 5K5RA 3MKWB 1SD5A 2PX9A 1W7PD 4DZJA 4HQEA 2FD5A 2LR8A 5DD8A 3R4KA 4HA8A 2HOEA 3V7CA 1BR2A 4FT8A 1D8JA 4CCOA 1YRNB 4AWXB 3VPRA 1FOYA 1J7KA 4HSRA 1X58A 5ILVA 1SVLA 4M6YA 2KZGA 1T95A 1TC3C 2XAHA 1KA8A 3PQKA 2M87A 2BGCA 2CJJA 5AIPA 3DCFA 4CUGA 2XSJC 4G94A 1YHQI 3R0JA 2LY9A 1A6QA 5HNFA 2K5CA 4A3KJ 4M71A 2XVCA 5KVRA 4M74A 4XL9A 2QEXI 2O5RA 1BOBA 1Z7LA 1R5HA 1ZKGA 1GV2A 3K4JA 1R4NB 3BG7A 3TO6A 3BJ6A 3E6CC 3I59A 1QU3A 1H9GA 2YR2A 2P8TA 1P4XA 1IDYA 2HI3A 2QSGX 3EDPA 4F93B 4BKXA 1MGTA 4KITB 2O8XA 5LHIA 1Y39A 3GTLJ 2OQGA 2E34A 2JA2A 2EV5A 3I54A 2M5WA 2NYXA 3BR1A 1MNDA 2K9QA 1SD6A 3CLQA 3KPHA 2CQNA 2JN6A 1WWXA 5HDKA 1T98A 4PJNA 4CHUA 5K7ZA 3EYIA 1ETKA 2HVQA 4OAYA 3HG9A 4UVCA 2F5VA 4Y52J 1MZBA 1FIAA 1LQ1A 3S2DJ 3T5XA 2DO7A 4HYEA 3FXQA 2ME0A 2YX7A 4MFEA 1NK2P 1T08B 1W7PB 2HQ5A 4BL0B 2BXZA 1D0ZA 4AIKA 4KN7X 2LFBA 1S3JA 1QRYA 1Z3YA 4XKCA 2Y48A 4WX9A 4NNJA 4UY8I 2BW3A 3LFUA 4XIDA 3QWLA 3PFIA 4A3FJ 2CUJA 2HNHA 1JT6A 3UR3C 1JJ8C 1R36A 2GA1A 1U8BA 2M7BA 2X85A 3K1NA 2OA4A 2EZHA 3HBLA 1Q1VA 2CQXA 4X1EA 3BR0A 5DUKA 3J7AO 1UHWA 2FJ1A 2O8KA 3RSNA 1XCBA 5LBQA 1WJ5A 4HNVA 2M7AA 3I59B 3QRFF 3HC7A 2XAUA 2F5CA 4B09A 3I5UA 2FEZA 3HTUA 1QHGA 4LFUA 2R5ZA 1R9TJ 3H5AA 4BS9A 2DT7B 4UUTA 5D4SA 2VUMJ 2IA1A 3HPGA 1KONA 3PNVA 5CQGA 3L1PA 1U5TA 4EATA 1G8XA 4IHWA 2CFXA 4XBFA 5K7FA 1UELB 2BY3A 1TL8A 3B6CA 1HKTA 3JRDA 1XG1A 2VT2A 4GYGA 4MTEA 3RTRA 4B4CA 1Z21A 3HM5A 1HW2A 4RM2A 2JPCA 1ZGWA 2JUCA 2XAFA 4F52A 2GOMA 3E6DA 3ZPLA 4ZDLA 5FGMA 3PO2J 3CUOA 4EEFG 1GXPA 3K6GA 2O3FA 3M1CA 2OV7A 1DQUA 1JTXA 4IPAA 3D5SC 2R92J 2RNJA 3I58A 3MVPA 3Q0UA 2K86A 3RQIA 4C30A 1QPMA 3A01A 3K4CA 2DK5A 1XGOA 1FTTA 2GOXB 4S04A 3TP0A 2W84A 2BW3B 1ZREA 4P9UA 1HQCA 3B02A 1MJAA 1R4MB 2XF6A 1BC7C 1U3EM 1XGSA 2CQQA 2DA2A 1IN7A 3OYMA 1Z9CA 1IC8A 5H6RA 1B72A 4QPQA 2L9SA 4Y33A 4C2TA 1VQ6I 4BXXJ 3WTXC 3HHHA 3BR2A 2VJJA 3ECHA 3ERMA 5GPAA 1MD0A 3OIOA 1W5SA 2XKOA 1TZLA 2AXLA 4PJMA 2R5ZB 2QA4I 2NS8A 3KLNA 4XSXF 3F0CA 2QCOA 3T8RA 1MDMA 3ZMZA 2LC2A 1U5TB 3S8PA 5FRMA 2DTZA 5CYVA 2VOPA 5KK1A 1TQMA 2ISYA 2VBWA 2Z33A 4BJTA 2CGPA 5D8KB 2V9VA 1V4RA 4RMNA 5F6FA 3OSGA 4B47A 3H35A 2FSWA 4LD5A 2DFFA 2LMDA 3TMOA 2QKLB 3HOUJ 1X1AA 3F8BA 4EJTA 4II2A 3RQ4A 3KZIC 3I55I 1DP7P 1HW5A 1LPQA 1JT0A 3T8TA 1B9MA 1PUFA 1N78A 3K7AJ 3GMEA 1FYLA 5F04A 3C2GA 3JSPA 2ZJRF 2X1CA 2HU9A 2LOOA 1XD7A 3A01B 2KIQA 4BQOA 3BZCA 2D45A 3PQJA 4G6DA 2PJRA 2RAEA 1IRXA 2JWTA 3M9AA 3DLLF 3MKYB 5BQTA 2LY2A 5LEKA 2CYYA 4ENNA 1TWAJ 3FXJA 4KIBA 2V9KA 1B72B 2XPWA 3F8MA 1FMWA 2PMZA 3COAC 5FFZA 3L09A 1LKXA 4FX4A 3P9IA 3F9KA 1BR1A 4XLHA 1ZR2A 1RR8C 1A5JA 2ZCWA 1Z6TA 4OOIA 3HHGA 2DCEA 3PM1A 1ZGJA 1QQIA 1GV5A 2HKOA 2HKXA 4WK8F 2HEOA 2GXAA 2JZYA 1KGSA 4UVAA 5HLHA 1MDMB 3KP6A 3M07A 3AL0B 1OJLA 2OZUA 1HDPA 2F5EA 2E1MC 3CDLA 4TV7A 1PYVA 2DA1A 1KZHA 4XNFA 1W36D 3BJAA 3L00A 1UAAA 1UG2A 3RKYA 4CSWA 2JA7J 2DOAA 3V8LA 3ABLH 2LLKA 2VQLA 2IXSA 1DPRA 4ZH4F 4JK1X 1F43A 2FA5A 2R7ZJ 2FUG2 2NOGA 4XRSA 5FLXZ 1PUFB 2DYSH 1DP3A 4RGXA 4GCVA 1B9NA 4NDLA 2X6OA 3KCCA 4U88A 4ZYDA 2P0WA 2JRMA 4LGWA 3D0SA 3D5RC 3NWSA 4NUBA 2RREA 1D8KA 4M73A 4CCJA 2PJRB 1UZCA 3ZCOA 1IJWC 1SEUA 4XONA 3OYDA 1Y56A 1JJ6C 4A0XA 2EFNA 3HYIA 3GTQJ 4HAMA 1B8IA 2DLLA 3WG9A 2DFHA 4P96A 3OS0A 3U1KA 2ZJ2A 1Z6RA 5LGNA 1IXCA 1VQKI 1I50J 5J3LA 1RC9A 2BYVE 5EGOA 5EEHA 1SMTA 2E2JJ 1O7FA 3JRHA 1YLFA 4ANJA 2HPMA 2XF5A 1Z67A 4DOZA 2ID3A 4D1QA 1ZHFA 4L18B 1WZ2A 4OINF 4M9XA 4WCGA 3VODA 2M34A 5LHHA 4CCLA 4ENKA 3RI4A 2BE5F 2W85A 3OIQA 5GTHC 1W0UA 1E3PA 3FK7A 1ETOA 4HPQA 2ZC2A 3DLAA 2AS5F 3IH2A 5JLWA 3EPZA 1M1EB 1TWFJ 1RNLA 1J59A 4BAYA 2CG4A 2LD5A 2K85A 5FD5A 5FKMA 3VEPA 2E1CA 2RGVA 3HPHA 1R00A 5HVQC 1G3TA 1W0TA 4MGRA 3RJPA 3GVAA 2V1NA 3WTYC 1SFXA 3BTIA 3GTPJ 1BC8C 3HJEA 2QQBA 4AYBN 3G4SI 1B4AA 1D0YA 3H92A 4XM3A 4R79A 4BU2A 2CQKA 2DQRA 3SFIA 3WTZA 2X6YA 5JHFA 4IO9F 1NG7A 1OCPA 2XV4S 1B8IB 1HXDA 3ELKA 2AXTC 2VKDA 2VODA 1H88C 4FISA 1SFEA 3MN2A 3ZQCA 2ZXWH 2MYSA 1QZYA 3ZGKA 3QOPA 1ORKA 2YUSA 4J00A 2WADA 2ECCA 3CZ6A 4F7ZA 4HF0A 5EGOB 2JA6J 5J1YA 5JR3A 3W3CA 5C4JJ 1P7JA 1ETYA 3MKLA 1RPWA 4HOBA 1BBYA 1RR7A 2L4MA 4B44A 3BCAA 5J1RA 2OTLI 5KAIC 3E97A 5LEJA 1HSTA 3IL2A 2V9PA 1T39A 1X3WB 4E7ZA 2ZSIB 4W97A 4ON0A 2HYJA 4U0VA 4MHGA 5KNLA 1D1CA 1XX5A 2M2EA 1IN8A 4RBOA 3OR2C 2VJ4A 3RDIA 3H0DA 2LH9A 2W24A 2XGDA 2OQRA 3DEUA 3IP4B 4XQFA 2FOKA 1W1WE 1D5YA 2XHKA 2WTEA 3QU6A 2STTA 3CDIA 5HLIA 4IRGA 3S1NJ 1K6OA 4AC0A 1D1AA 1FP1D 4AU7A 2KKOA 2L5QA 4O3MA 2FNAA 4NQWA 4K2EA 3CJQB 1F5TA 1EH6A 2EZIA 3AAFA 1MSEC 2FRHA 3BPXA 2DT6A 2HYFA 2F2EA 3S1RJ 1YW9A 2BHYA 3CESA 1WRJA 1NK3P 2B63J 1K6YA 2XRLA 1N75A 3FIWA 1YYVA 3F6OA 1Y8QB 2IT0A 4L5EA 3IH4A 3DKWA 1OMIA 3G6EI 2IW5A 1QPIA 3K10A 1ETQA 3B73A 4AD9A 2QKMB 1J09A 4ABZA 2NVXJ 3O8HA 2HDCA 4M6VA 1YO5C 1BOAA 4FHTA 4NC8A 5BMZA 1QNTA 1O3QA 5B66C 2L02A 5DDGA 2HTJA 2OC6A 3R61A 2ZFUA 1ETVA 2LKSA 1SVMA 2CUZA 2VKVA 4M3GA 4DYCA 2DMUA 3K4MA 4EM0B 4KMFA 2FMYA 3GX4X 2MD5A 2OJED 2DDAA 3FM3A 5K1YA 3LOCA 3Q5FA 1U78A 4GRIA 1X3UA 3BTLA 3I4PA 5M3MJ 2JT1A 3TL4X 3BZ6A 2HPIA 3MQ0A 3FKIJ 2ZJPF 1OR7A 3LSPA 4IXAA 4P9FA 4IZZA 4E4HA 2I8DA 4CCMA 3F8NA 1LVKA 3LSMA 3NWTA 4FE4A 5D6FA 2OF7A 3BG3A 3K1PA 4G9YA 4NQWB 2FQ3A 1B6AA 1U5TC 2HTSA 1JHHA 2EZKA 1JHFA 2QENA 4U7BA 3HB9A 4OMYA 2V7FA 2OCCH 2V1UA 2DMPA 2GWRA 2GAUA 2Q1ZB 4NHJA 3K4NA 3BG9A 3KZZA 2BVLA 2JMWA 3V42A 2HFHA 3G71I 2R7TA 3DEEA 1C0WA 3EUHA 3AG4H 1REPC 4OMZA 1RESA 4GO1A 1LEBA 2JSPA 1F1ZA 5F1JA 5J47A 2HOAA 1FSEA 2DBBA 1QVTA 3QP6A 2MA3A 3WHCA 1XDUA 4XOPA 1S5LC 4LB5A 3DBRB 2BXYA 4HV5A 1T33A 3AG3H 3FM5A 4QPOA 1WGXA 2P7VB 3JCUC 1P9QC 4PK4A 2QM3A 4OIPF 3TGNA 4C2UA 3JRCA 1PUEE 3J7AY 1Z0XA 3OOUA 1FPQA 3CMYA 1JKQC 1TLHB 1R1UA 1SVOA 2CUFA 3FMSA 2LVSA 1GHCA 4A0YA 2V6CA 1E2XA 4HNTA 2YX4A 1IG7A 1EH7A 1I1SA 4G6TB 2EILH 2QUFA 4BDYA 2O61A 3DKXA 3PNYA 2CQ7A 4MQ9F 4I98B 3AL0C 2PN6A 2PLYA 1BA5A 1GVDA 3JW4A 3CDHA 3H9GA 1UMQA 2L0KA 5M3FJ 2BOLA 2XDVA 4PJJA 3GZNB 1AKHA 4S0HB 1T8IA 2LSOA 4P55A 1SAUA 2CUEA 3A0BC 4ESFA 4ZZLA 5HODA 4BE2A 1MBEA 3LAPA 3EETA 5ICEA 4XLEA 4KICA 3TO9A 3DEWA 1FP2A 3HGYA 3LWFA 3CMEI 3CJTB 2IGMA 2HS5A 4YIRX 4MIMA 4RLFA 3JRIA 2ZJQF 4M9SA 4C9YA 3Q9VA 1XSXA 1HCRA 2VBYA 3SDGA 3RPQA 2P81A 5F08A 4XOTA 2F5FA 1ON2A 3ASNH 4QLCU 3OR1C 3S3OA 3IAM2 2W25A 1VF9A 2WY8Q 4N4OB 3HSRA 3GTKJ 3FMRA 4XRFA 1Y6IA 3I4MJ 2QZ8A 4D5CA 3CCVI 1JUSA 1YQAA 1LE8A 2QWWA 4I01A 3ZQHA 4WF2A 4I99C 4BACA 2EINH 1MMGA 2DDBA 3SZTA 1O57A 2Q8KA 3DQVC 2R7SA 1LDDA 3KEOA 3DTKA 2XPUA 1O7LA 1P4WA 3KLOA 1IUYA 2PMZN 2FNPA 3TP3A 3E0JB 3LSKA 4MNUA 5HS8A 1HKQA 3TKYA 2L01A 3QAHA 1YE9A 1SD4A 3RZOJ 2UZKA 4H0EA 3KP3A 4L5JA 2MLGA 4V2FA 1LFBA 2DMQA 2EK5A 3ABUA 3E6MA 5E1XA 1S7AA 4UUSA 5LGTA 1ODDA 1R49A 3HZJA 3I71A 3MMYB 1W36C 1BR4A 4IHYA 3DKYA 3IH3A 1USTA 3S15J 9ANTA 4AVPA 2Z16A 2MC3A 2AQFA 1QO0D 3LSGA 4BEHA 1RI7A 2VE9A 5CJ9A 4EJWA 1ZRCA 1I6HJ 4M3BA 2XIGA 3PUFA 2CW0F 3GXOA 1ONVA 3I53A 3DPUA 4J01A 1FYMA 3ASOH 1WI3A 2M30A 3RPUA 4ZYHA 1DUXC 4BQAA 3RKQA 4IRIA 2RNGA 5DYMA 5B5EC 1L3LA 3L2CA 1LE8B 2H27A 4BYYA 2K7LA 2HGCA 2EJRA 4HEA2 3CCQI 1JGGA 1NG6A 5J6XA 3V7RA 1FOWA 3PUBA 4DIQA 2MLKA 3K70D 4UB6C 3F23A 4JX4A 5K5OA 1SFOJ 1YX5A 6PAXA 2V1XA 3HOXJ 4L9JA 4HZFA 1VQ5I 2CW8A 1ZYRF 4BUPA 4OIQF 3WTSC 1ZLJA 5H2FC 2LYCA 1X1BA 3O8GA 4EM2A 2FBIA 2DJNA 2GIVA 5F0FA 4M6XA 2O03A 2XRNA 2KT0A 4UUSB 2EZLA 1JXSA 2L9VA 4ENJA 1G3YA 1ON1A 2XROA 5F0CA 3M1EA 3GFJA 3HSFA 1O3SA 1TP4A 3S2HJ 2QVOA 3LNQA 3K2AA 1R1VA 2ELJA 3WTVC 4ITVA 2M0MA 3GFLA 2E71A 3GEZA 3UKGA 1QBJA 5IOYA 5IPAA 4D9JA 2ESNA 1JKOC 2JQ7A 4KISA 1TBXA 4MEXF 1EH8A 4BEHB 3TEDA 1VQ4I 2DQLA 2KDOA 3TO7A 2BVMA 2WWYA 4LITA 3FISA 4HX8A 3V8KA 1BW6A 2DA6A 1G59A 2HZTA 4XK4A 4Y4RA 5TGTA 5IT9Z 4UV9A 2KLOA 1IXSB 4CCNA 2NOJB 2VQCA 5DV5A 3I4NJ 2EIKH 2XPVA 3I9V2 4Z2YA 4A0ZA 3BT9A 3W2WA 2LBFA 3QP5A 2ME6A 1V5EA 3ULQB 4RB2C 2GXGA 4PJ0C 4DBRA 5BPDA 2WBMA 1R5ID 3OYIA 2EQRA 3GLLA 4D0PA 3QODA 1I1GA 3CCUI 1MMAA 2BY2A 5E1ZB 5K7HA 2DA7A 1FSHA 3FDYA 1FBQA 2EFQA 2TDXA 3KZYA 4IVNA 5DEQA 4Z6YA 5HDNA 4JBAA 1RKWA 1KQ9A 1WFXA 1PDNC 2HQNA 3HRUA 1D1BA 2L9RA 4Y3OA 1VNDA 3DPLC 1UJ8A 3AFHA 4E6KG 2GXBA 4LLNA 2MW8A 2Y9ZA 4B8XA 4E7SA 2VQGA 3BCBA 4F55A 2IA2A 1YW7A 2OD5A 2Y0SA 2RQPA 4XKVA 3Q0VA 4A3CJ 2DTRA 1PP7U 1QGPA 3U1DA 4I76A 4NB5A 3JAMK 1DGWY 5GTIC 1KU7A 4U7DA 1KQ0A 2A05A 3ABTA 5B1AH 1K4TA 2LF8A 2ZXHA 1GXQA 4M3DA 1VTNC 5GPCA 3HOTA 4LIUA 3S32A 4JQFA 3KP7A 5GP9A 3HEFA 4RB1A 2HYGD 3OYFA 4LMYA 4F92B 1XSDA 4Y17A 1Y1WJ 2IS4A 3S14J 3H3ZA 4UUVA 2QSFX 3WU2C 2LBFB 1ZARA 4CZZA 2R7DA 1XB4A 1AOYA 3TW7A 1E3OC 1OFCX 2HDDA 1QZZA 1SANA 5DTDA 2DI3A 4ETSA 2STWA 4XKBA 3K4LA 2VASA 3K9TA 4YFKF 2R0QC 3N4MA 2PI0A 2WC2A 2DODA 2ACJA 1ACIA 3OYBA 4PFOA 4GFBA 4L9VA 1ZTRA 3HKZA 2F48A 1I3AA 2VXDA 1X1DA 2X1EA 3OL4A 2HQRA 4BE1A 3BQZA 4RGUA 1CGPA 5FLMJ 3A0HC 5EEGA 2CH0A 1HW1A 1ZG3A 2R7VA 2FE3A 2PFBA 5D5XB 5HLTA 3MCZA 4ZTJA 3T0YA 1IV6A 1R1TA 3LSRA 4LK0F 4ENMA 5HS9A 4IL6C 4E70A 4RM3A 1JGSA 2FX0A 2ZSHB 4HLXA 2UV1A 4R8HA 1K7AA 2X9DA 3ZQIA 4V19K 2ZBKA 3M7GA 4I6ZA 1ETXA 3O6BB 1Z7UA 2BZTA 5AONA 3CF5F 2ZB9A 3RKWA 1J5YA 5B3SH 4RS8A 3JSOA 3BP8A 4UXNA 1TT0A 3LMMA 2Y31A 5L3BA 5ED4A 4IHTA 3C18A 4L0ZB 1BI0A 1LUJB 2PMHA 3CMMA 2XKPA 4WXHA 3VYRB 2W4SA 1S6LA 3EUHC 3ZN1A 1NHAA 2RN7A 2JVHA 2V4JC 4B3XA 1TQIA 5D6EA 3ZMSA 1BN5A 2BY1A 4YFXF 1RUNA 2JA5J 2E19A 2F5DA 2MFZA 4YIIA 1TNSA 3E7LA 2H6BA 4AIJA 2H1KA 3CJRB 4L9TA 1FIPA 1WVRA 4W1UA 2BHZA 4BJ5C 3G2BA 4R1HA 2E36A 2L7FP 4N9IA 5L3DA 2NVYJ 2VI6A 3CJNA 3IC7A 5L3EA 4ZTFA 2B9SA 2QQ9A 5ILSA 2R7RA 2E5ZA 2A6EF 2QQ8A 3H3UA 1WHUA 4EQQA 3FX3A 5D5WB 1D5VA 4XRSG 2XC7A 3F22A 5L3GA 5J4VA 1LDKB 3SEZA 5H20A 3CCLI 2M4GA 4KMUX 5DCFA 1X4OA 3KP2A 3CUQA 3Q3SA 5KHDA 4ZC3A 2PBIA 3ZMTA 3CC2I 3VSLA 4IHSA 5IY5H 5LRSA 5LD2C 1GDTA 5FO5A 1JTYA 3AG1H 1HDDC 4M9ZA 2O0YA 2RQQA 3G73A 2V6EA 4A6DA 2MH9A 2OAZA 5CKTA 2Y69H 3BQYA 4C3JJ 2JJ7A 3FHZA 2XAJA 5FB2A 4KNYA 1T56A 2QLZA 4A3DJ 3TQNA 1Z05A 3NARA 5J8CA 4PZJA 2D1HA 4P1WA 2C6YA 1IV8A 2H8RA 5LHGA 3WODF 2RV8A 2VJ5A 2KRCA 2WAEA 3TBIA 3GYHX 4A3JJ 3K4KA 1FX7A 1H9TA 2QF7A 5F0HA 5D8LB 4E7LA 5L3FA 2L2OA 1MH3A 4PFPA 5IYBJ 1YJWI 1TWHJ 3BROA 4G7HF 2O9LA 1XS9A 3KP5A 4V2GA 2JRTA 2KJBA 3BG5A 3ABKH 5IT9K 1GUUA 3IKTA 3HRMA 1JUMA 1WJDA 1XMXA 4G7ZF 1ZR4A 3ERED 5IYCJ 4X0GA 2K9LA 3IAS2 4HW0A 2EBIA 3S17J 5F27A 5BOXA 2K4JA 5M5YJ 2AHQA 4L9NA 4PGHA 4EV0A 3NQOA 2IS6A 2NVUB 3CUQB 4RGSA 2GLOA 3O2PE 4HG2A 4DBQA 2EA4A 5E3NA 4EVIA 3RYPA 4CH7A 2EFPA 3G1MA 3GZ6A 2E1OA 1FMVA 2BEOA 2CWEA 4L5IA 3BR5A 1UB9A 3IV5A 1HC8A 2H09A 3BC8A 4JX5A 4OAZA 3DU6A 2LKPA 2K40A 1XN7A 4A5NA 4Y7NJ 4G8XA 5CVIA 1RUOA 3BR3A 3K69A 2JPBA 3FHNA 2NNYA 2PMUA 5FLVA 3CMAI 3Q0WA 4G6QA 4BQNA 1WSUA 2FQ4A 1P4AA 1I27A 3H9JA 3P7NA 5EDNA 4RA2A 1I39A 3JRFA 2Y9YA 1VFCA 3J80K 1DU6A 4FTHA 4LB6B 1Q1HA 3BY6A 4HLYA 2P6TA 3GFIA 1IN4A 2X1DA 4WWCA 2IS2A 5DCMA 5TRDA 4BQQA 4M72A 2LF7A 3QYEA 1T0FA 1R7JA 1STZA 3W6JB 4PSWA 4HDUA 2P5VA 1KQ8A 1WCMJ 2DU9A 2WB1A 2KFDA 1P7IA 1X1PA 2JA8J 1ENHA 2YU9J 3CD6I 2IS1A 1X1CA 3CP8A 1G3WA 1OYYA 2VC1A 4EMSA 4F91B 2LP0A 4YELA 3WE2A 3DPTA 5JFRA 4CZCA 3N97A 2DAOA 3WGHA 2R5YA 5JHUA 1OCOH 3Q9SA 2LY1A 5L3CA 3REOA 1K78A 5E8GA 2HOTA 3PIOF 4KFCA 2YU3A 4FQGA 3K70C 2L3DA 3DWLE 4BY1J 1WJAA 2FXAA 3CCJI 5E17F 1Z1DA 5JI6A 3EQLF 1YITI 3MWMA 2K3PA 3NEUA
chains in the Genus database with same CATH topology
1MMNA 4N4NB 1OLTA 3DTKA 4C30A 2W82A 3FBIB 3K4CA 1GLNA 2CMPA 5FROA 2GOXB 2A5WA 3ONQA 1V5FA 3E0JB 3LSKA 2HQAA 2BW3B 3K4BA 2Q2EB 1V5GA 2XF6A 3VSKA 1YE9A 4XLCA 3W2VA 3ZQQA 3OYMA 4JOMA 4QPQA 2L9SA 4Y33A 4BGDA 4C2TA 4II3A 2VXZA 3VYTB 4ZJZA 2VJJA 4XN0A 1Z3XA 3MMYB 1W36C 1BR4A 3DKYA 3UNGC 3DTIA 1TZLA 4PJMA 1X19A 2Z16A 2AQFA 3LSGA 3FKJA 4BEHA 1X4PA 2UWMA 2LC2A 3L2WA 3S8PA 3OYCA 5FRMA 1MNEA 5CQEA 4BJTA 2KQRA 3AKZA 3N05A 4HSTA 2VKHA 4RMNA 3S3NA 4B47A 4XLAA 3H35A 2WAQA 4IX7A 3DPUA 4J01A 3TMOA 4ZYAA 2QKLB 3OS2A 3FBNB 1X1AA 2RNGA 1YX3A 4II2A 3QOEA 4LG3A 3HOSA 3RQ4A 3L2VA 2F4IA 3M8JA 1N78A 2R7XA 4HEA2 3C2GA 1U0JA 3HL2A 2LG4A 1NG6A 2X1CA 3PSIA 1AA7A 3PUBA 3U21A 4DIQA 5HNHA 2HU9A 2LOOA 2VJIA 4BQOA 4F3QA 3K70D 1YX5A 4E7JA 2PJRA 2XF7A 4P5OA 4IQ4A 2CW8A 4BUPA 1IRXA 4E7IA 3MKYB 2X51A 2LYCA 2LY2A 1X1BA 2KL4A 2X6WA 2V9KA 2IGKA 2MABA 1FMWA 2PMZA 1LKXA 4HRIA 2LREA 3L2RA 3F9KA 1BR1A 4XLHA 2ELJA 4ITVA 2M0MA 2DCEA 4D9JA 4KISA 4ZDOA 3VYUB 2VQHA 2R7WA 4BEHB 3S3MA 3KYLA 3PJRA 3AL0B 1WJCA 3VWBA 2KDOA 2E1MC 1PJRA 2BVMA 4LITA 1PYVA 4XNFA 1G59A 1W36D 4Y4RA 5TGTA 1UAAA 4CSWA 2DOAA 2KLOA 3OYAA 4CCNA 2NOJB 2VQCA 2VQLA 2IXSA 4XLFA 4HNUA 2M3AA 2DXIA 3OY9A 2FUG2 3I9V2 4CA0A 4IQJA 2R7QA 2LBFA 3W2WA 5FRNA 1V5EA 1DP3A 4DBRA 2E1MB 2WBMA 3OYIA 4BDZA 3QODA 2P0WA 1MMAA 1ZELA 3D5RC 3NWSA 5KCMA 4NUBA 2RREA 2PJRB 3S93A 4CCJA 2V26A 3FDYA 3ZCOA 4XONA 3OYDA 1Y56A 2R4GA 1WFXA 1D1BA 2VB6A 3DPLC 4Y3OA 4E6KG 3AFHA 2ZXIA 3OS0A 5CPRB 1VZ0A 4E7SA 2MD0A 4FETA 2VQGA 2AQEA 3BCBA 4F55A 3W2AA 2Y0SA 4XKVA 3I3LA 1DGWY 4B48A 3ZR8X 3SDBA 4ANJA 2HPMA 3PNTA 2XF5A 2Z1DA 2ZXHA 4DOZA 1DGRM 2KHMA 4D1QA 3HOTA 3BLYA 1UG0A 4LIUA 4OWRB 3S32A 4JQFA 1N77A 3SZGA 3EUKL 4PSXA 4RLQA 3RPUD 4CCLA 3OYFA 2WY7Q 3OYNA 3OIQA 3SYTA 4F92B 4BE0A 2IS4A 4IKFA 4HPQA 1LFPA 1WJBA 3DLAA 3EPZA 2LBFB 3MKZA 3OIPA 3HPHA 5HVQC 2V1NA 2LRDA 4XKBA 3K4LA 1WJEA 2VASA 4XMYA 3CP2A 1D0YA 3OYBA 4PFOA 3HKZA 2VXDA 4XM3A 1X1DA 2X1EA 4R79A 4BU2A 4FASD 4DJAA 2Z2SB 1MMDA 2JUGA 3OL4A 4BE1A 2X6YA 3QYBA 5JHFA 3L2QA 1NG7A 3DU5A 2CH0A 2VKDA 2VLAA 2E5NA 3H5NA 4XR6A 2R7VA 1EA3A 2MYSA 3LSIA 5HLTA 3ZGKA 4ZTJA 4J00A 2WADA 3CZ6A 4RM3A 3QYFA 3W3CA 2R7UA 2ZSHB 2UV1A 4B44A 3BCAA 1ERDA 2KMUA 3IUOA 2HDWA 3EUAA 2ZSIB 4E7ZA 1MW7A 3ZRGA 1TT0A 3LMMA 4KJZA 5KNLA 1D1CA 4B43A 3CMMA 2VJ4A 3OR2C 3H0DA 2LH9A 3VYRB 2W4SA 3EUHC 3IP4B 4XQFA 4AVZA 1S9HA 4BXFA 2CFOA 2HVRA 2JVHA 2V4JC 3OWTA 4B3XA 3SEQA 1D1AA 3KEYA 3VDXA 4AU7A 2JVGA 2L7KA 5HOOA 2MFZA 2L5QA 1JI8A 1HA8A 1QHHD 2VIXA 3CJQB 4PUSA 2KPMA 3CJRB 3H9QA 2DT6A 3OYKA 1WJFA 3L2UA 4BJ5C 3CESA 3G2BA 3ZXSA 2KP6A 1K6YA 4ZTFA 1N75A 2A6TA 2R7RA 4AYBA 2E5ZA 3BG6A 2HZDA 2KRHA 1R6RA 3K10A 3OL3A 2XC7A 2M4KA 1LDKB 2MC4A 3PSFA 2QKMB 1J09A 2DJIA 2M4GA 3SEZA 2W1OA 1X4OA 4E7HA 4NC7A 4NC8A 2OUMA 2VL8A 2WA0A 3GBGA 4ZC3A 3LL7A 5KHDA 2OC6A 3VSLA 4E7KA 3KX2A 2ZFUA 3MKWB 5LD2C 1SFKA 2CUZA 4H4KC 3K4MA 2RQQA 2V6EA 2KZVA 4GRIA 3CF2A 5CKTA 3LSHA 4PJLA 3PL8A 1BR2A 3TL4X 1T0FC 4CCOA 2HPIA 3OMYA 4YEJA 4BJ6C 4HSRA 4IZZA 4E4HA 2I8DA 4P1WA 4CCMA 3LSMA 1LVKA 3NWTA 1T95A 2VJ5A 2KRCA 2WAEA 3TBIA 3K4KA 4NQWB 4CUGA 4E7LA 2XSJC 2L2OA 3OYEA 4PFPA 5HNFA 2K5CA 3OYGA 4U7BA 4MLOA 2V7FA 3E1SA 4ZDPA 4XL9A 2O5RA 1BOBA 2Q1ZB 1WJDA 3K4NA 1Z7LA 2BVLA 3K4JA 3V42A 3BG7A 4X0GA 2R7TA 2K9LA 3DEEA 3IAS2 3OYHA 1QU3A 2VPLA 2JSPA 3DTEA 2IS6A 4F93B 2CS3A 4KITB 3OYJA 4HG2A 4DBQA 2JA2A 4CH7A 1OR7C 2L9NA 4XOPA 2CV1A 1MNDA 2K9MA 3HXLA 3OS1A 1FMVA 4QPOA 4PJNA 1P9QC 4PK4A 2HVQA 4U87A 3BC8A 4OAYA 3HG9A 3PFYA 4C2UA 4OAZA 2F5VA 3DU6A 4LIVA 3J7AY 2UUZA 3OOUA 4XORA 2CV2A 2R7OA 4XKWA 3FHNA 4BL0B 1D0ZA 2WAFA 3A4CA 4BQNA 3A2KA 4HNTA 2IGOA 1Z3YA 4G6TB 3H9JA 4XKCA 4BDYA 3DKXA 2HVSA 3PNYA 3D5LA 3AL0C 4NNJA 2BW3A 3LFUA 2CUJA 2HNHA 3H9GA 3UR3C 2X1DA 2IS2A 2BOLA 2XDVA 2M7BA 2F6CA 2X85A 3C2HA 4PJJA 3MD2A 4BQQA 4DGWB 1SAUA 3OYLA 3QYEA 3RSNA 4BE2A 1WJ5A 4PSWA 2IGNA 3A1YA 3H5RA 2M7AA 4XLEA 2CW7A 2WB1A 3HC7A 2XAUA 2W7NA 1D0XA 2IGMA 2W00A 1X1CA 4KT6A 2IS1A 3CP8A 1QHGA 4YRVA 4RLFA 3H5AA 4BS9A 2DT7B 4CCKA 4C9YA 4F91B 3RCOA 4YELA 1E0EA 3HPGA 1KONA 3DPTA 3PNVA 5CQGA 4XOTA 4EATA 4CZCA 1G8XA 3OR1C 3S3OA 3IAM2 2WY8Q 4N4OB 2LY1A 1UELB 2X6XA 2E60A 1Y6IA 4XN3A 3K70C 3DWLE 3RTRA 1Z21A 1WJAA 3VYSB 4RM2A 3HUGB 4F52A 5LFAA 2GOMA 4BACA 1MMGA 4ZDLA 3K6GA 3M1CA 2OV7A 3DQVC 1DQUA 2R7SA 2K3PA 3D5SC 2CV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEH A;  4BEH B;  3A1Y A;  2LBF A;  2LBF B;  2W1O A; 
#chains in the Genus database with same CATH topology
 4ZYG A;  2P7C B;  2M8E A;  2W82 A;  4QWQ A;  3WU0 A;  2BY0 A;  4A3G J;  4YIF A;  3ONQ A;  1V5F A;  1Y8R B;  2DFE A;  2HQA A;  4A6E A;  1V5G A;  3VSK A;  2EIM H;  1BL0 A;  5IOZ A;  1OKR A;  2JTV A;  3L9F A;  5J8F A;  2XUB A;  4JOM A;  5DCM B;  2NVQ J;  5BS6 A;  4BGD A;  3JTH A;  3JRG A;  3PO3 J;  1DPU A;  4ZJZ A;  3CO6 C;  4AM3 A;  3S16 J;  4A5M A;  4XN0 A;  1Z3X A;  1OYW A;  2DOE A;  5C44 J;  2K27 A;  4GXO A;  2VKE A;  3NRV A;  3DTI A;  2EH3 A;  4BNC A;  1A36 A;  4A3I J;  3T1B A;  3GW2 A;  1LDJ A;  3FZV A;  2UWM A;  4EJU A;  3L2W A;  2PJP A;  1WPK A;  3P9C A;  1MNE A;  5CQE A;  5E1W A;  2R5Y B;  2GM4 A;  2CU7 A;  3N05 A;  2VKH A;  1K78 B;  2W48 A;  2LK2 A;  4AIH A;  2WAQ A;  3CTA A;  4IHV A;  2DA4 A;  1YS7 A;  1KYZ A;  4ZYA A;  3OS2 A;  3H3V K;  3SFZ A;  3FBN B;  4KIG A;  4BHC A;  1APL C;  3QOE A;  4LG3 A;  3HOS A;  4IEJ A;  1F36 A;  3L2V A;  1K4S A;  2VON A;  5IP6 A;  3M8J A;  2IRF G;  2IBD A;  1RKT A;  4HBL A;  1U0J A;  3HL2 A;  2LG4 A;  1HBX G;  1FZP B;  2VN2 A;  3PSI A;  3MAJ A;  1AA7 A;  5HNH A;  1IN5 A;  1BJA A;  2J5P A;  4F3Q A;  1IAW A;  5EZH A;  3MZY A;  4E7J A;  5DD4 A;  2XF7 A;  4MQV A;  4P5O A;  4ZZD A;  4Q48 A;  4C3H J;  1G4D A;  1FT9 A;  3GTG J;  3HOW J;  3LQQ A;  3JAM Z;  3CC7 I;  1KYW A;  2Y0S N;  3B6A A;  3DV8 A;  4A12 A;  3O3K A;  4N0B A;  2MAB A;  2MBF A;  1E3H A;  3LSJ A;  2IP2 A;  2R3S A;  2D1V A;  5BNG A;  1NTC A;  3ZMU A;  3ESW B;  4CXF A;  1R5G A;  4S05 A;  1IN6 A;  1RIO H;  1PP8 F;  4ESJ A;  1H89 C;  3C7J A;  1YTY A;  4OIO F;  3KEQ A;  3GTJ J;  3WG7 H;  3BJO A;  2COM A;  1WJC A;  2A68 F;  5CVJ A;  3VWB A;  2YS9 A;  2Y0M A;  1PJR A;  1FNN A;  1OCZ H;  4A3M J;  1TWG J;  2EV6 A;  5M5W J;  2NVT J;  4UNO A;  2CSO A;  2XB5 A;  5A2Q K;  2XAG A;  4OIR F;  2E7W A;  4XLF A;  1AU7 A;  2M3A A;  1UHM A;  1NH3 A;  1IO2 A;  2K9S A;  4CA0 A;  3ECO A;  4RB3 C;  4QSH A;  3HKZ N;  1VQL I;  5FRN A;  1LEA A;  2J5O A;  2E1M B;  5EZG A;  2L7Z A;  1HOM A;  3S93 A;  4Y15 A;  2V26 A;  4UHT A;  1U9N A;  2FF4 A;  4LLL A;  1XDS A;  4B3A A;  2ZFW A;  3BWG A;  3SQN A;  4XSZ F;  2GZW A;  1WQ2 A;  2GIZ A;  1IUF A;  1XC5 A;  2G9W A;  1L0O C;  4BXU A;  5CPR B;  2Y2Z A;  1ZAO A;  4IF4 A;  2QGU A;  2AQE A;  2DA3 A;  3WTT C;  1LVA A;  3HTS B;  3GCM A;  1AKH B;  3SZP A;  1TNT A;  3I3L A;  3IHU A;  3I56 I;  4IOC F;  4B48 A;  4BHP A;  4QIW N;  3PNT A;  1TT5 B;  5CVR A;  3QU3 A;  1QA6 A;  4CYC A;  5ICG A;  2KHM A;  1S7E A;  1YJ9 I;  3BLY A;  4UV8 A;  4KT5 C;  1N77 A;  2PEX A;  3SZG A;  2Z5U A;  4PSX A;  1W7P A;  3CQZ J;  4DNC A;  1BJZ A;  3RPU D;  5JLX A;  1MBK A;  2WY7 Q;  3OYN A;  3SYT A;  4EGZ A;  2AO9 A;  2FML A;  2PG4 A;  3HOV J;  1LFP A;  1WJB A;  2K9N A;  3RYR A;  3ZMV A;  4A3E J;  1A31 A;  2OTJ I;  1YIO A;  5ILU A;  2L4A A;  1SFU A;  4G12 A;  3J81 K;  3MKZ A;  4C2M J;  4YG2 F;  3HRS A;  1B1B A;  4A93 J;  3CUQ C;  1JKR C;  3MFK A;  2LRD A;  4FCY A;  1WJE A;  4XMY A;  5C3E J;  1TW3 A;  5FKL A;  4MO7 A;  5H6Q A;  2G7H A;  5KAF C;  4FAS D;  4MFD A;  2EFO A;  3MZ8 A;  3H1C A;  2A5Y B;  4O5V A;  1SC7 A;  3QYB A;  3L2Q A;  4FX0 A;  4QTR A;  2ETH A;  5ERI A;  1U8R A;  3DU5 A;  2IVM A;  2PQ8 A;  5CLS A;  1GVJ A;  2E5N A;  2NAZ A;  4XR6 A;  1XSV A;  1EA3 A;  3LSI A;  1MNM C;  4BHB A;  4XLP F;  5HLG A;  5J40 A;  2XGC A;  3F3X A;  2R7U A;  2M0C A;  3FXM A;  5ICC A;  1V55 H;  2YPR A;  3FXL A;  1ZLK A;  2W57 A;  1ERD A;  3QQA A;  2IJL A;  1R22 A;  1YJN I;  4CYC B;  2MG4 A;  4WXD A;  2KMU A;  2IA0 A;  3IUO A;  4XIC A;  3CCE I;  1FOX A;  1AWC A;  1BIB A;  3JRE A;  3ZRG A;  3G3Z A;  2ZO4 A;  3ZOB A;  4J19 A;  4KJZ A;  3LST A;  2ELH A;  1SAX A;  1MKM A;  1VQN I;  2G0E A;  2UXX A;  4WXC A;  2ADU A;  4LJZ F;  3KET A;  4HF1 A;  2XB0 X;  3ISP A;  3EYY A;  5BPI A;  3VOE A;  2D2W A;  3E3V A;  1OIS A;  4AVZ A;  4C3I J;  2CFO A;  4RB0 A;  3R0A A;  4M3E A;  5ICF A;  1TQP A;  2DT5 A;  3TW6 A;  2B7E A;  3L7W A;  2JVG A;  2L7K A;  5HOO A;  1JI8 A;  4KIF A;  1HA8 A;  1O3R A;  1Y0N A;  3CC4 I;  5HS7 A;  1WH5 A;  1O3T A;  1IGN A;  5EF6 A;  4D5F A;  1MIJ A;  4ESB A;  2A69 F;  2NS0 A;  2ZNZ A;  1LNW A;  3OYK A;  1WJF A;  3ZQF A;  2RDP A;  3ZP5 A;  4X6A J;  3ZXS A;  1CF7 A;  1A6I A;  1OCR H;  3V4G A;  3E5U A;  3HRT A;  3HOY J;  1OYI A;  3GO5 A;  2P4W A;  4XLN F;  3WU1 B;  2HWV A;  2NXN B;  2M4K A;  2MC4 A;  3PSF A;  2DJI A;  2KJC A;  1HSJ A;  3TDU C;  5AIQ A;  2FU4 A;  2WV0 A;  3W6V A;  1SD7 A;  1XCV A;  5C4X J;  1E17 A;  2GA2 A;  2VL8 A;  2WA0 A;  1J0R A;  3LL7 A;  2X48 A;  5E79 C;  4E7K A;  1PVE A;  2X4H A;  4I0A A;  3GZ5 A;  4CYD A;  1SFK A;  4H4K C;  3LFK A;  2ZME A;  3KE2 A;  2KZV A;  1F9N A;  2ELK A;  2ZNY A;  1Y1V J;  3CF2 A;  3LSH A;  4PJL A;  3PL8 A;  1OQY A;  5K5Q A;  3J80 Z;  1T38 A;  1T0F C;  2ESH A;  3OMY A;  1XPX A;  4EGY A;  3M8F A;  4YEJ A;  4BJ6 C;  5F1R A;  5GAD J;  2KRF A;  3QPS A;  1IXR C;  2TRT A;  3GLX A;  5EYR A;  5LLQ A;  4DZP A;  2HXO A;  3F8C A;  1RRJ A;  1TTY A;  5FD6 A;  3PIP F;  1G2H A;  1VQP I;  5FJ8 J;  2RC4 A;  3OYE A;  3ZQG A;  5IP9 J;  5FFX A;  3GTM J;  3OYG A;  1FYK A;  3U2R A;  4MLO A;  1XMK A;  3E1S A;  3E5X A;  2WB1 N;  4JYK A;  4ZDP A;  1CF7 B;  1EKE A;  5JVT A;  3WE3 A;  3ZQL A;  3JTG A;  4CO8 A;  3FXK A;  3D1N I;  1QZE A;  4RAY A;  3J7Z I;  2LKX A;  2G7U A;  2QBY A;  2CRG A;  4DYR A;  2N8G A;  1IRF A;  3OYH A;  2M45 A;  2VPL A;  1OCC H;  3WGI A;  2L54 A;  3DTE A;  1YG2 A;  1IRG A;  1CQT A;  5CVU A;  2CS3 A;  1ZN2 A;  2CO5 A;  1S8N A;  3OYJ A;  2H1L A;  3F21 A;  1LJ9 A;  3CCM I;  1T2K A;  1RET A;  5E3O A;  4IHX A;  2DFI A;  1FTZ A;  1J9I A;  4D7N A;  1OR7 C;  2WV1 A;  1FBU A;  2DK8 A;  2L9N A;  2OPT A;  2XGE A;  4NC6 A;  3SXY A;  4A3L J;  2CV1 A;  1DDN A;  4LOC A;  2K9M A;  3HXL A;  1IW7 F;  3OS1 A;  1FOK A;  2ZME B;  1KU3 A;  1VQ9 I;  1FWZ A;  4DW6 A;  4U87 A;  3PFY A;  2MSY A;  2Y75 A;  4LIV A;  2TCT A;  2UUZ A;  4XOR A;  1YS6 A;  2CV2 A;  3HUG A;  2R7O A;  4RAG A;  1UFM A;  4JX6 A;  4UVB A;  4XKW A;  1WI9 A;  3DP7 A;  4G7O F;  3FF5 A;  4BY7 J;  2WAF A;  4L0Y B;  3A4C A;  1UCR A;  2KIS A;  2I5U A;  5DUI A;  3A2K A;  3BDD A;  3K0L A;  2IGO A;  1P2F A;  1YW8 A;  4XRM A;  3FXR A;  1I6X A;  3QPT A;  2HVS A;  2H8W A;  3D5L A;  2Q2E A;  4HQM A;  1O4X A;  1VQM I;  1BI1 A;  2IPQ X;  1HKS A;  3C2H A;  2F6C A;  3MD2 A;  3I64 A;  1Y0U A;  3JRA A;  5DM6 F;  4DGW B;  3OYL A;  2Z99 A;  2QBY B;  1YOV B;  2A61 A;  2ID6 A;  3E6B A;  2IGN A;  3A1Y A;  3H5R A;  2CW7 A;  2W7N A;  4BBS J;  1I5Z A;  1G6N A;  1D0X A;  2W00 A;  4KT6 A;  4D7M A;  4YRV A;  1F4K A;  3HOZ J;  2WAQ N;  3FXU A;  4CCK A;  3LAJ A;  3RCO A;  3LA2 A;  3QPL A;  3H0G J;  1E0E A;  4A3B J;  1V54 H;  1XGN A;  2OU2 A;  1MBJ A;  3RIR A;  4B1R A;  4N9H A;  2VOO A;  2H6C A;  1TW2 A;  2X6X A;  2E60 A;  1S7O A;  4HX7 A;  4XN3 A;  4IJA A;  4UB8 C;  4JP0 A;  3KIO A;  4KUM A;  3BZK A;  5LRR A;  3KP4 A;  3VYS B;  1MSF C;  5D4R A;  5JVG F;  2OZ6 A;  3HUG B;  2Z3Y A;  5LFA A;  2VC0 A;  4EJV A;  5LGU A;  1T6S A;  2YSR A;  2IAI A;  1IDZ A;  2E35 A;  1MMN A;  4N4N B;  1OLT A;  2CV0 A;  2EPF A;  3FBI B;  2NRA C;  1GLN A;  2CMP A;  5FRO A;  1YIJ I;  1P92 A;  2A5W A;  3X2Q H;  1J2X A;  3K4B A;  2Q2E B;  5J1U A;  1H8A C;  2V79 A;  2O6G E;  3M4O J;  4XLC A;  1UHS A;  1R71 A;  3GFM A;  1FY7 A;  2M8G X;  3W2V A;  1SMY F;  3ZQQ A;  1V3F A;  3WGG A;  1ZK8 A;  2E2H J;  2VBX A;  4II3 A;  2VXZ A;  3VYT B;  4I7H A;  1W5T A;  1ITY A;  2BV6 A;  3K1M A;  3IKV A;  3NAU A;  5D5V B;  2QSH X;  2RKH A;  3IWF A;  5EEA A;  2A07 F;  3UNG C;  1KU2 A;  1N25 A;  5A2Q Z;  1MBG A;  2K3F A;  3WTU C;  1X19 A;  3S1Q J;  4OU0 A;  4Y13 A;  2H94 A;  5GAG J;  5M5X J;  3FKJ A;  2OCE A;  3V8J A;  5GAE J;  3GUD A;  1X4P A;  3KFW X;  4ZYE A;  3OYC A;  2DW4 A;  1U2W A;  2P5K A;  2KQR A;  3JR9 A;  3AKZ A;  2HOS A;  4HST A;  5EJC A;  4I0B A;  3S3N A;  2GQQ A;  4XLA A;  3W6K B;  4IX7 A;  3C2B A;  1ETW A;  1KU9 A;  4O6J A;  3ZMD A;  3FWE A;  1BIA A;  3K2Z A;  1MBF A;  4AUX A;  3SJM A;  1ZRD A;  1YX3 A;  3KYD B;  5EG0 A;  2EFW A;  3BTJ A;  2F4I A;  4EM1 A;  2R7X A;  5E8I A;  1VQ7 I;  2EV0 A;  4I02 A;  2ECB A;  3U21 A;  1OPC A;  2ZKZ A;  3S2W A;  2VJI A;  3TOA A;  2VT3 A;  3GF2 A;  1R23 A;  2GBY A;  2K02 A;  4LLG F;  4IQ4 A;  4KDP A;  2EA2 A;  2EIJ H;  1OCT C;  1Z77 A;  1VI0 A;  3IWZ A;  3TOB A;  4E7I A;  4PDK A;  2X51 A;  4RAZ A;  3SHF A;  1J75 A;  1BI2 A;  3HIF A;  2KL4 A;  3R60 A;  4U0W A;  1LB2 A;  2IEK A;  2X6W A;  2IGK A;  3DXJ F;  2DPU A;  1POG A;  1WKM A;  2FBK A;  5DS9 A;  4BH9 A;  1USS A;  4HRI A;  1B59 A;  2LRE A;  3L2R A;  2P5L C;  1HF0 A;  1MJ9 A;  2DMN A;  3GTO J;  5TJJ A;  2Y30 A;  2NS7 A;  2HR3 A;  1XMA A;  4ZDO A;  3VYU B;  2VQH A;  2R7W A;  1W4M A;  3S3M A;  1X2M A;  3KYL A;  3FXO A;  3PJR A;  4MTD A;  2COB A;  2ISZ A;  3HDD A;  3J81 Z;  4HV6 A;  3G1L A;  4HDV A;  4EJO A;  3U9G A;  1BI3 A;  2DMT A;  2B0L A;  3P5J A;  5GAH J;  3OYA A;  4HNU A;  3BPV A;  3CCS I;  2DXI A;  1S29 A;  3OY9 A;  5EG0 B;  4YFN F;  3BOQ A;  1GT0 C;  2KDZ A;  4IQJ A;  3A03 A;  1XGM A;  2R7Q A;  1BM9 A;  1Z91 A;  2L7M P;  4BDZ A;  4A69 C;  3JRB A;  2M1B A;  4AID A;  1ZEL A;  5KCM A;  4HF2 A;  5FKN A;  2R7F A;  3LA3 A;  4I2O A;  2R93 J;  2R4G A;  3ZN0 A;  2HXI A;  2VB6 A;  2A3S A;  2ZXI A;  2XSD C;  4RGR A;  1YI2 I;  1RZ4 A;  1VZ0 A;  2KIF A;  4KYW A;  5TIS C;  1AHD P;  2MD0 A;  4FET A;  1MMS A;  2E1N A;  5CVV A;  5IT3 A;  3CCR I;  4KA4 A;  3W2A A;  2KIM A;  5E18 F;  2VBZ A;  3VFZ A;  3J7Y J;  1ZQ3 P;  2VE8 A;  5B1B H;  3DBH B;  2MH2 A;  3ZR8 X;  1K79 A;  3SDB A;  1ZGA A;  5J4Y A;  1IZ1 A;  2Z1D A;  4IOA F;  3QPH A;  1DGR M;  2MGQ A;  2DA5 A;  5DM7 F;  1ZG5 A;  4GYI A;  1UG0 A;  2JK3 A;  3V7S A;  4OWR B;  1ZRF A;  1FJL A;  1FC3 A;  2OBP A;  4I09 A;  2E2I J;  4GDF A;  3EUK L;  4LG0 A;  4RLQ A;  1YFH A;  4GGG A;  4HX4 A;  4MEY F;  4A2U A;  4FE7 A;  1EJ9 A;  3I0T A;  1XTA A;  3CCY A;  4BE0 A;  1IRZ A;  4IKF A;  2BBY A;  3LQR A;  2V1D A;  1D3Y A;  1WH7 A;  5FKO A;  3F6V A;  2A6H F;  3IRR A;  3OIP A;  5E3M A;  1MJB A;  1K61 A;  3OSF A;  1U6G A;  4RAF A;  4RDU A;  2D5V A;  2UXN A;  3G1O A;  3CP2 A;  1S72 I;  1BW5 A;  3F8F A;  5HDG A;  1MH4 A;  4DJA A;  2Z2S B;  1MMD A;  2I10 A;  2JUG A;  2ZME C;  3RZD J;  1ZH5 A;  5FLX K;  3FMQ A;  3P9K A;  2XAQ A;  1A04 A;  2RVC A;  1ZG1 A;  3ROU A;  2VLA A;  3H5N A;  1FBS A;  3KYC B;  4KN4 X;  3DF8 A;  4DYQ A;  3HGG A;  5F64 A;  1A35 A;  1IF1 A;  2DOF A;  2LNB A;  4PCQ A;  4ASN A;  1VQ8 I;  2JSC A;  1EF4 A;  3H36 A;  3QYF A;  3HSE A;  4CIC A;  2ZXJ A;  2QQA A;  1QVU A;  3F72 A;  3RKX A;  2F4O B;  1MBH A;  2P6S A;  2LDU A;  3A02 A;  2HDW A;  2KIU A;  2XAS A;  3EUA A;  3M8E A;  2E7X A;  4PGG A;  1MW7 A;  4Q47 A;  3CLO A;  5E20 A;  4Q5S F;  4LG0 B;  1DU0 A;  2ICW G;  2K4B A;  1EV7 A;  3ABM H;  4LK1 F;  1HLV A;  1X3Z B;  2EWN A;  4B43 A;  1JE8 A;  3OV8 A;  3C3W A;  3WHB A;  1YRN A;  3ZQ7 A;  2DYR H;  2NNN A;  3DBL B;  1S9H A;  3TDZ C;  3MZH A;  4BXF A;  1G3S A;  5D5U B;  3WTW C;  4U0Y A;  2HVR A;  3AG2 H;  4CGZ A;  3OWT A;  2QYO A;  4M3F A;  3SEQ A;  5IP7 J;  4IRH A;  3KEY A;  3VDX A;  3R6S A;  1FLI A;  2EB7 A;  1K83 J;  2X0L A;  1I3Q J;  2VPR A;  1JKP C;  1P6R A;  1QHH D;  4CDG A;  1ULY A;  3MEX A;  2VIX A;  3OOP A;  4PUS A;  1U9O A;  2KPM A;  3M3Y J;  3H9Q A;  3FK6 A;  5E3L A;  3DFG A;  3VB2 A;  3L2U A;  1X2N A;  2Q0O A;  1JUP A;  2LTP A;  2KP6 A;  1TWC J;  2M9H A;  3BTC A;  4NBQ A;  2A6T A;  2DN0 A;  3C1D A;  3IRQ A;  4AYB A;  3BG6 A;  2HZD A;  2KRH A;  4Q4Z F;  2FOW A;  3ML6 A;  1R6R A;  3GWZ A;  3LA7 A;  3OL3 A;  4BBR J;  1H0M A;  2DPD A;  2XGX A;  3S1M J;  2W1O A;  3BR6 A;  4E7H A;  1FEX A;  4NC7 A;  2OUM A;  4DQ2 A;  2O7O A;  1R58 A;  3GBG A;  1VQO I;  5FKK A;  5IYD J;  3E5Q A;  3KX2 A;  2Z9O A;  3CO7 C;  2FBH A;  1W5C C;  1LFU P;  2F4M B;  5K5R A;  3MKW B;  1SD5 A;  2PX9 A;  1W7P D;  4DZJ A;  4HQE A;  2FD5 A;  2LR8 A;  5DD8 A;  3R4K A;  4HA8 A;  2HOE A;  3V7C A;  1BR2 A;  4FT8 A;  1D8J A;  4CCO A;  1YRN B;  4AWX B;  3VPR A;  1FOY A;  1J7K A;  4HSR A;  1X58 A;  5ILV A;  1SVL A;  4M6Y A;  2KZG A;  1T95 A;  1TC3 C;  2XAH A;  1KA8 A;  3PQK A;  2M87 A;  2BGC A;  2CJJ A;  5AIP A;  3DCF A;  4CUG A;  2XSJ C;  4G94 A;  1YHQ I;  3R0J A;  2LY9 A;  1A6Q A;  5HNF A;  2K5C A;  4A3K J;  4M71 A;  2XVC A;  5KVR A;  4M74 A;  4XL9 A;  2QEX I;  2O5R A;  1BOB A;  1Z7L A;  1R5H A;  1ZKG A;  1GV2 A;  3K4J A;  1R4N B;  3BG7 A;  3TO6 A;  3BJ6 A;  3E6C C;  3I59 A;  1QU3 A;  1H9G A;  2YR2 A;  2P8T A;  1P4X A;  1IDY A;  2HI3 A;  2QSG X;  3EDP A;  4F93 B;  4BKX A;  1MGT A;  4KIT B;  2O8X A;  5LHI A;  1Y39 A;  3GTL J;  2OQG A;  2E34 A;  2JA2 A;  2EV5 A;  3I54 A;  2M5W A;  2NYX A;  3BR1 A;  1MND A;  2K9Q A;  1SD6 A;  3CLQ A;  3KPH A;  2CQN A;  2JN6 A;  1WWX A;  5HDK A;  1T98 A;  4PJN A;  4CHU A;  5K7Z A;  3EYI A;  1ETK A;  2HVQ A;  4OAY A;  3HG9 A;  4UVC A;  2F5V A;  4Y52 J;  1MZB A;  1FIA A;  1LQ1 A;  3S2D J;  3T5X A;  2DO7 A;  4HYE A;  3FXQ A;  2ME0 A;  2YX7 A;  4MFE A;  1NK2 P;  1T08 B;  1W7P B;  2HQ5 A;  4BL0 B;  2BXZ A;  1D0Z A;  4AIK A;  4KN7 X;  2LFB A;  1S3J A;  1QRY A;  1Z3Y A;  4XKC A;  2Y48 A;  4WX9 A;  4NNJ A;  4UY8 I;  2BW3 A;  3LFU A;  4XID A;  3QWL A;  3PFI A;  4A3F J;  2CUJ A;  2HNH A;  1JT6 A;  3UR3 C;  1JJ8 C;  1R36 A;  2GA1 A;  1U8B A;  2M7B A;  2X85 A;  3K1N A;  2OA4 A;  2EZH A;  3HBL A;  1Q1V A;  2CQX A;  4X1E A;  3BR0 A;  5DUK A;  3J7A O;  1UHW A;  2FJ1 A;  2O8K A;  3RSN A;  1XCB A;  5LBQ A;  1WJ5 A;  4HNV A;  2M7A A;  3I59 B;  3QRF F;  3HC7 A;  2XAU A;  2F5C A;  4B09 A;  3I5U A;  2FEZ A;  3HTU A;  1QHG A;  4LFU A;  2R5Z A;  1R9T J;  3H5A A;  4BS9 A;  2DT7 B;  4UUT A;  5D4S A;  2VUM J;  2IA1 A;  3HPG A;  1KON A;  3PNV A;  5CQG A;  3L1P A;  1U5T A;  4EAT A;  1G8X A;  4IHW A;  2CFX A;  4XBF A;  5K7F A;  1UEL B;  2BY3 A;  1TL8 A;  3B6C A;  1HKT A;  3JRD A;  1XG1 A;  2VT2 A;  4GYG A;  4MTE A;  3RTR A;  4B4C A;  1Z21 A;  3HM5 A;  1HW2 A;  4RM2 A;  2JPC A;  1ZGW A;  2JUC A;  2XAF A;  4F52 A;  2GOM A;  3E6D A;  3ZPL A;  4ZDL A;  5FGM A;  3PO2 J;  3CUO A;  4EEF G;  1GXP A;  3K6G A;  2O3F A;  3M1C A;  2OV7 A;  1DQU A;  1JTX A;  4IPA A;  3D5S C;  2R92 J;  2RNJ A;  3I58 A;  3MVP A;  3Q0U A;  2K86 A;  3RQI A;  4C30 A;  1QPM A;  3A01 A;  3K4C A;  2DK5 A;  1XGO A;  1FTT A;  2GOX B;  4S04 A;  3TP0 A;  2W84 A;  2BW3 B;  1ZRE A;  4P9U A;  1HQC A;  3B02 A;  1MJA A;  1R4M B;  2XF6 A;  1BC7 C;  1U3E M;  1XGS A;  2CQQ A;  2DA2 A;  1IN7 A;  3OYM A;  1Z9C A;  1IC8 A;  5H6R A;  1B72 A;  4QPQ A;  2L9S A;  4Y33 A;  4C2T A;  1VQ6 I;  4BXX J;  3WTX C;  3HHH A;  3BR2 A;  2VJJ A;  3ECH A;  3ERM A;  5GPA A;  1MD0 A;  3OIO A;  1W5S A;  2XKO A;  1TZL A;  2AXL A;  4PJM A;  2R5Z B;  2QA4 I;  2NS8 A;  3KLN A;  4XSX F;  3F0C A;  2QCO A;  3T8R A;  1MDM A;  3ZMZ A;  2LC2 A;  1U5T B;  3S8P A;  5FRM A;  2DTZ A;  5CYV A;  2VOP A;  5KK1 A;  1TQM A;  2ISY A;  2VBW A;  2Z33 A;  4BJT A;  2CGP A;  5D8K B;  2V9V A;  1V4R A;  4RMN A;  5F6F A;  3OSG A;  4B47 A;  3H35 A;  2FSW A;  4LD5 A;  2DFF A;  2LMD A;  3TMO A;  2QKL B;  3HOU J;  1X1A A;  3F8B A;  4EJT A;  4II2 A;  3RQ4 A;  3KZI C;  3I55 I;  1DP7 P;  1HW5 A;  1LPQ A;  1JT0 A;  3T8T A;  1B9M A;  1PUF A;  1N78 A;  3K7A J;  3GME A;  1FYL A;  5F04 A;  3C2G A;  3JSP A;  2ZJR F;  2X1C A;  2HU9 A;  2LOO A;  1XD7 A;  3A01 B;  2KIQ A;  4BQO A;  3BZC A;  2D45 A;  3PQJ A;  4G6D A;  2PJR A;  2RAE A;  1IRX A;  2JWT A;  3M9A A;  3DLL F;  3MKY B;  5BQT A;  2LY2 A;  5LEK A;  2CYY A;  4ENN A;  1TWA J;  3FXJ A;  4KIB A;  2V9K A;  1B72 B;  2XPW A;  3F8M A;  1FMW A;  2PMZ A;  3COA C;  5FFZ A;  3L09 A;  1LKX A;  4FX4 A;  3P9I A;  3F9K A;  1BR1 A;  4XLH A;  1ZR2 A;  1RR8 C;  1A5J A;  2ZCW A;  1Z6T A;  4OOI A;  3HHG A;  2DCE A;  3PM1 A;  1ZGJ A;  1QQI A;  1GV5 A;  2HKO A;  2HKX A;  4WK8 F;  2HEO A;  2GXA A;  2JZY A;  1KGS A;  4UVA A;  5HLH A;  1MDM B;  3KP6 A;  3M07 A;  3AL0 B;  1OJL A;  2OZU A;  1HDP A;  2F5E A;  2E1M C;  3CDL A;  4TV7 A;  1PYV A;  2DA1 A;  1KZH A;  4XNF A;  1W36 D;  3BJA A;  3L00 A;  1UAA A;  1UG2 A;  3RKY A;  4CSW A;  2JA7 J;  2DOA A;  3V8L A;  3ABL H;  2LLK A;  2VQL A;  2IXS A;  1DPR A;  4ZH4 F;  4JK1 X;  1F43 A;  2FA5 A;  2R7Z J;  2FUG 2;  2NOG A;  4XRS A;  5FLX Z;  1PUF B;  2DYS H;  1DP3 A;  4RGX A;  4GCV A;  1B9N A;  4NDL A;  2X6O A;  3KCC A;  4U88 A;  4ZYD A;  2P0W A;  2JRM A;  4LGW A;  3D0S A;  3D5R C;  3NWS A;  4NUB A;  2RRE A;  1D8K A;  4M73 A;  4CCJ A;  2PJR B;  1UZC A;  3ZCO A;  1IJW C;  1SEU A;  4XON A;  3OYD A;  1Y56 A;  1JJ6 C;  4A0X A;  2EFN A;  3HYI A;  3GTQ J;  4HAM A;  1B8I A;  2DLL A;  3WG9 A;  2DFH A;  4P96 A;  3OS0 A;  3U1K A;  2ZJ2 A;  1Z6R A;  5LGN A;  1IXC A;  1VQK I;  1I50 J;  5J3L A;  1RC9 A;  2BYV E;  5EGO A;  5EEH A;  1SMT A;  2E2J J;  1O7F A;  3JRH A;  1YLF A;  4ANJ A;  2HPM A;  2XF5 A;  1Z67 A;  4DOZ A;  2ID3 A;  4D1Q A;  1ZHF A;  4L18 B;  1WZ2 A;  4OIN F;  4M9X A;  4WCG A;  3VOD A;  2M34 A;  5LHH A;  4CCL A;  4ENK A;  3RI4 A;  2BE5 F;  2W85 A;  3OIQ A;  5GTH C;  1W0U A;  1E3P A;  3FK7 A;  1ETO A;  4HPQ A;  2ZC2 A;  3DLA A;  2AS5 F;  3IH2 A;  5JLW A;  3EPZ A;  1M1E B;  1TWF J;  1RNL A;  1J59 A;  4BAY A;  2CG4 A;  2LD5 A;  2K85 A;  5FD5 A;  5FKM A;  3VEP A;  2E1C A;  2RGV A;  3HPH A;  1R00 A;  5HVQ C;  1G3T A;  1W0T A;  4MGR A;  3RJP A;  3GVA A;  2V1N A;  3WTY C;  1SFX A;  3BTI A;  3GTP J;  1BC8 C;  3HJE A;  2QQB A;  4AYB N;  3G4S I;  1B4A A;  1D0Y A;  3H92 A;  4XM3 A;  4R79 A;  4BU2 A;  2CQK A;  2DQR A;  3SFI A;  3WTZ A;  2X6Y A;  5JHF A;  4IO9 F;  1NG7 A;  1OCP A;  2XV4 S;  1B8I B;  1HXD A;  3ELK A;  2AXT C;  2VKD A;  2VOD A;  1H88 C;  4FIS A;  1SFE A;  3MN2 A;  3ZQC A;  2ZXW H;  2MYS A;  1QZY A;  3ZGK A;  3QOP A;  1ORK A;  2YUS A;  4J00 A;  2WAD A;  2ECC A;  3CZ6 A;  4F7Z A;  4HF0 A;  5EGO B;  2JA6 J;  5J1Y A;  5JR3 A;  3W3C A;  5C4J J;  1P7J A;  1ETY A;  3MKL A;  1RPW A;  4HOB A;  1BBY A;  1RR7 A;  2L4M A;  4B44 A;  3BCA A;  5J1R A;  2OTL I;  5KAI C;  3E97 A;  5LEJ A;  1HST A;  3IL2 A;  2V9P A;  1T39 A;  1X3W B;  4E7Z A;  2ZSI B;  4W97 A;  4ON0 A;  2HYJ A;  4U0V A;  4MHG A;  5KNL A;  1D1C A;  1XX5 A;  2M2E A;  1IN8 A;  4RBO A;  3OR2 C;  2VJ4 A;  3RDI A;  3H0D A;  2LH9 A;  2W24 A;  2XGD A;  2OQR A;  3DEU A;  3IP4 B;  4XQF A;  2FOK A;  1W1W E;  1D5Y A;  2XHK A;  2WTE A;  3QU6 A;  2STT A;  3CDI A;  5HLI A;  4IRG A;  3S1N J;  1K6O A;  4AC0 A;  1D1A A;  1FP1 D;  4AU7 A;  2KKO A;  2L5Q A;  4O3M A;  2FNA A;  4NQW A;  4K2E A;  3CJQ B;  1F5T A;  1EH6 A;  2EZI A;  3AAF A;  1MSE C;  2FRH A;  3BPX A;  2DT6 A;  2HYF A;  2F2E A;  3S1R J;  1YW9 A;  2BHY A;  3CES A;  1WRJ A;  1NK3 P;  2B63 J;  1K6Y A;  2XRL A;  1N75 A;  3FIW A;  1YYV A;  3F6O A;  1Y8Q B;  2IT0 A;  4L5E A;  3IH4 A;  3DKW A;  1OMI A;  3G6E I;  2IW5 A;  1QPI A;  3K10 A;  1ETQ A;  3B73 A;  4AD9 A;  2QKM B;  1J09 A;  4ABZ A;  2NVX J;  3O8H A;  2HDC A;  4M6V A;  1YO5 C;  1BOA A;  4FHT A;  4NC8 A;  5BMZ A;  1QNT A;  1O3Q A;  5B66 C;  2L02 A;  5DDG A;  2HTJ A;  2OC6 A;  3R61 A;  2ZFU A;  1ETV A;  2LKS A;  1SVM A;  2CUZ A;  2VKV A;  4M3G A;  4DYC A;  2DMU A;  3K4M A;  4EM0 B;  4KMF A;  2FMY A;  3GX4 X;  2MD5 A;  2OJE D;  2DDA A;  3FM3 A;  5K1Y A;  3LOC A;  3Q5F A;  1U78 A;  4GRI A;  1X3U A;  3BTL A;  3I4P A;  5M3M J;  2JT1 A;  3TL4 X;  3BZ6 A;  2HPI A;  3MQ0 A;  3FKI J;  2ZJP F;  1OR7 A;  3LSP A;  4IXA A;  4P9F A;  4IZZ A;  4E4H A;  2I8D A;  4CCM A;  3F8N A;  1LVK A;  3LSM A;  3NWT A;  4FE4 A;  5D6F A;  2OF7 A;  3BG3 A;  3K1P A;  4G9Y A;  4NQW B;  2FQ3 A;  1B6A A;  1U5T C;  2HTS A;  1JHH A;  2EZK A;  1JHF A;  2QEN A;  4U7B A;  3HB9 A;  4OMY A;  2V7F A;  2OCC H;  2V1U A;  2DMP A;  2GWR A;  2GAU A;  2Q1Z B;  4NHJ A;  3K4N A;  3BG9 A;  3KZZ A;  2BVL A;  2JMW A;  3V42 A;  2HFH A;  3G71 I;  2R7T A;  3DEE A;  1C0W A;  3EUH A;  3AG4 H;  1REP C;  4OMZ A;  1RES A;  4GO1 A;  1LEB A;  2JSP A;  1F1Z A;  5F1J A;  5J47 A;  2HOA A;  1FSE A;  2DBB A;  1QVT A;  3QP6 A;  2MA3 A;  3WHC A;  1XDU A;  4XOP A;  1S5L C;  4LB5 A;  3DBR B;  2BXY A;  4HV5 A;  1T33 A;  3AG3 H;  3FM5 A;  4QPO A;  1WGX A;  2P7V B;  3JCU C;  1P9Q C;  4PK4 A;  2QM3 A;  4OIP F;  3TGN A;  4C2U A;  3JRC A;  1PUE E;  3J7A Y;  1Z0X A;  3OOU A;  1FPQ A;  3CMY A;  1JKQ C;  1TLH B;  1R1U A;  1SVO A;  2CUF A;  3FMS A;  2LVS A;  1GHC A;  4A0Y A;  2V6C A;  1E2X A;  4HNT A;  2YX4 A;  1IG7 A;  1EH7 A;  1I1S A;  4G6T B;  2EIL H;  2QUF A;  4BDY A;  2O61 A;  3DKX A;  3PNY A;  2CQ7 A;  4MQ9 F;  4I98 B;  3AL0 C;  2PN6 A;  2PLY A;  1BA5 A;  1GVD A;  3JW4 A;  3CDH A;  3H9G A;  1UMQ A;  2L0K A;  5M3F J;  2BOL A;  2XDV A;  4PJJ A;  3GZN B;  1AKH A;  4S0H B;  1T8I A;  2LSO A;  4P55 A;  1SAU A;  2CUE A;  3A0B C;  4ESF A;  4ZZL A;  5HOD A;  4BE2 A;  1MBE A;  3LAP A;  3EET A;  5ICE A;  4XLE A;  4KIC A;  3TO9 A;  3DEW A;  1FP2 A;  3HGY A;  3LWF A;  3CME I;  3CJT B;  2IGM A;  2HS5 A;  4YIR X;  4MIM A;  4RLF A;  3JRI A;  2ZJQ F;  4M9S A;  4C9Y A;  3Q9V A;  1XSX A;  1HCR A;  2VBY A;  3SDG A;  3RPQ A;  2P81 A;  5F08 A;  4XOT A;  2F5F A;  1ON2 A;  3ASN H;  4QLC U;  3OR1 C;  3S3O A;  3IAM 2;  2W25 A;  1VF9 A;  2WY8 Q;  4N4O B;  3HSR A;  3GTK J;  3FMR A;  4XRF A;  1Y6I A;  3I4M J;  2QZ8 A;  4D5C A;  3CCV I;  1JUS A;  1YQA A;  1LE8 A;  2QWW A;  4I01 A;  3ZQH A;  4WF2 A;  4I99 C;  4BAC A;  2EIN H;  1MMG A;  2DDB A;  3SZT A;  1O57 A;  2Q8K A;  3DQV C;  2R7S A;  1LDD A;  3KEO A;  3DTK A;  2XPU A;  1O7L A;  1P4W A;  3KLO A;  1IUY A;  2PMZ N;  2FNP A;  3TP3 A;  3E0J B;  3LSK A;  4MNU A;  5HS8 A;  1HKQ A;  3TKY A;  2L01 A;  3QAH A;  1YE9 A;  1SD4 A;  3RZO J;  2UZK A;  4H0E A;  3KP3 A;  4L5J A;  2MLG A;  4V2F A;  1LFB A;  2DMQ A;  2EK5 A;  3ABU A;  3E6M A;  5E1X A;  1S7A A;  4UUS A;  5LGT A;  1ODD A;  1R49 A;  3HZJ A;  3I71 A;  3MMY B;  1W36 C;  1BR4 A;  4IHY A;  3DKY A;  3IH3 A;  1UST A;  3S15 J;  9ANT A;  4AVP A;  2Z16 A;  2MC3 A;  2AQF A;  1QO0 D;  3LSG A;  4BEH A;  1RI7 A;  2VE9 A;  5CJ9 A;  4EJW A;  1ZRC A;  1I6H J;  4M3B A;  2XIG A;  3PUF A;  2CW0 F;  3GXO A;  1ONV A;  3I53 A;  3DPU A;  4J01 A;  1FYM A;  3ASO H;  1WI3 A;  2M30 A;  3RPU A;  4ZYH A;  1DUX C;  4BQA A;  3RKQ A;  4IRI A;  2RNG A;  5DYM A;  5B5E C;  1L3L A;  3L2C A;  1LE8 B;  2H27 A;  4BYY A;  2K7L A;  2HGC A;  2EJR A;  4HEA 2;  3CCQ I;  1JGG A;  1NG6 A;  5J6X A;  3V7R A;  1FOW A;  3PUB A;  4DIQ A;  2MLK A;  3K70 D;  4UB6 C;  3F23 A;  4JX4 A;  5K5O A;  1SFO J;  1YX5 A;  6PAX A;  2V1X A;  3HOX J;  4L9J A;  4HZF A;  1VQ5 I;  2CW8 A;  1ZYR F;  4BUP A;  4OIQ F;  3WTS C;  1ZLJ A;  5H2F C;  2LYC A;  1X1B A;  3O8G A;  4EM2 A;  2FBI A;  2DJN A;  2GIV A;  5F0F A;  4M6X A;  2O03 A;  2XRN A;  2KT0 A;  4UUS B;  2EZL A;  1JXS A;  2L9V A;  4ENJ A;  1G3Y A;  1ON1 A;  2XRO A;  5F0C A;  3M1E A;  3GFJ A;  3HSF A;  1O3S A;  1TP4 A;  3S2H J;  2QVO A;  3LNQ A;  3K2A A;  1R1V A;  2ELJ A;  3WTV C;  4ITV A;  2M0M A;  3GFL A;  2E71 A;  3GEZ A;  3UKG A;  1QBJ A;  5IOY A;  5IPA A;  4D9J A;  2ESN A;  1JKO C;  2JQ7 A;  4KIS A;  1TBX A;  4MEX F;  1EH8 A;  4BEH B;  3TED A;  1VQ4 I;  2DQL A;  2KDO A;  3TO7 A;  2BVM A;  2WWY A;  4LIT A;  3FIS A;  4HX8 A;  3V8K A;  1BW6 A;  2DA6 A;  1G59 A;  2HZT A;  4XK4 A;  4Y4R A;  5TGT A;  5IT9 Z;  4UV9 A;  2KLO A;  1IXS B;  4CCN A;  2NOJ B;  2VQC A;  5DV5 A;  3I4N J;  2EIK H;  2XPV A;  3I9V 2;  4Z2Y A;  4A0Z A;  3BT9 A;  3W2W A;  2LBF A;  3QP5 A;  2ME6 A;  1V5E A;  3ULQ B;  4RB2 C;  2GXG A;  4PJ0 C;  4DBR A;  5BPD A;  2WBM A;  1R5I D;  3OYI A;  2EQR A;  3GLL A;  4D0P A;  3QOD A;  1I1G A;  3CCU I;  1MMA A;  2BY2 A;  5E1Z B;  5K7H A;  2DA7 A;  1FSH A;  3FDY A;  1FBQ A;  2EFQ A;  2TDX A;  3KZY A;  4IVN A;  5DEQ A;  4Z6Y A;  5HDN A;  4JBA A;  1RKW A;  1KQ9 A;  1WFX A;  1PDN C;  2HQN A;  3HRU A;  1D1B A;  2L9R A;  4Y3O A;  1VND A;  3DPL C;  1UJ8 A;  3AFH A;  4E6K G;  2GXB A;  4LLN A;  2MW8 A;  2Y9Z A;  4B8X A;  4E7S A;  2VQG A;  3BCB A;  4F55 A;  2IA2 A;  1YW7 A;  2OD5 A;  2Y0S A;  2RQP A;  4XKV A;  3Q0V A;  4A3C J;  2DTR A;  1PP7 U;  1QGP A;  3U1D A;  4I76 A;  4NB5 A;  3JAM K;  1DGW Y;  5GTI C;  1KU7 A;  4U7D A;  1KQ0 A;  2A05 A;  3ABT A;  5B1A H;  1K4T A;  2LF8 A;  2ZXH A;  1GXQ A;  4M3D A;  1VTN C;  5GPC A;  3HOT A;  4LIU A;  3S32 A;  4JQF A;  3KP7 A;  5GP9 A;  3HEF A;  4RB1 A;  2HYG D;  3OYF A;  4LMY A;  4F92 B;  1XSD A;  4Y17 A;  1Y1W J;  2IS4 A;  3S14 J;  3H3Z A;  4UUV A;  2QSF X;  3WU2 C;  2LBF B;  1ZAR A;  4CZZ A;  2R7D A;  1XB4 A;  1AOY A;  3TW7 A;  1E3O C;  1OFC X;  2HDD A;  1QZZ A;  1SAN A;  5DTD A;  2DI3 A;  4ETS A;  2STW A;  4XKB A;  3K4L A;  2VAS A;  3K9T A;  4YFK F;  2R0Q C;  3N4M A;  2PI0 A;  2WC2 A;  2DOD A;  2ACJ A;  1ACI A;  3OYB A;  4PFO A;  4GFB A;  4L9V A;  1ZTR A;  3HKZ A;  2F48 A;  1I3A A;  2VXD A;  1X1D A;  2X1E A;  3OL4 A;  2HQR A;  4BE1 A;  3BQZ A;  4RGU A;  1CGP A;  5FLM J;  3A0H C;  5EEG A;  2CH0 A;  1HW1 A;  1ZG3 A;  2R7V A;  2FE3 A;  2PFB A;  5D5X B;  5HLT A;  3MCZ A;  4ZTJ A;  3T0Y A;  1IV6 A;  1R1T A;  3LSR A;  4LK0 F;  4ENM A;  5HS9 A;  4IL6 C;  4E70 A;  4RM3 A;  1JGS A;  2FX0 A;  2ZSH B;  4HLX A;  2UV1 A;  4R8H A;  1K7A A;  2X9D A;  3ZQI A;  4V19 K;  2ZBK A;  3M7G A;  4I6Z A;  1ETX A;  3O6B B;  1Z7U A;  2BZT A;  5AON A;  3CF5 F;  2ZB9 A;  3RKW A;  1J5Y A;  5B3S H;  4RS8 A;  3JSO A;  3BP8 A;  4UXN A;  1TT0 A;  3LMM A;  2Y31 A;  5L3B A;  5ED4 A;  4IHT A;  3C18 A;  4L0Z B;  1BI0 A;  1LUJ B;  2PMH A;  3CMM A;  2XKP A;  4WXH A;  3VYR B;  2W4S A;  1S6L A;  3EUH C;  3ZN1 A;  1NHA A;  2RN7 A;  2JVH A;  2V4J C;  4B3X A;  1TQI A;  5D6E A;  3ZMS A;  1BN5 A;  2BY1 A;  4YFX F;  1RUN A;  2JA5 J;  2E19 A;  2F5D A;  2MFZ A;  4YII A;  1TNS A;  3E7L A;  2H6B A;  4AIJ A;  2H1K A;  3CJR B;  4L9T A;  1FIP A;  1WVR A;  4W1U A;  2BHZ A;  4BJ5 C;  3G2B A;  4R1H A;  2E36 A;  2L7F P;  4N9I A;  5L3D A;  2NVY J;  2VI6 A;  3CJN A;  3IC7 A;  5L3E A;  4ZTF A;  2B9S A;  2QQ9 A;  5ILS A;  2R7R A;  2E5Z A;  2A6E F;  2QQ8 A;  3H3U A;  1WHU A;  4EQQ A;  3FX3 A;  5D5W B;  1D5V A;  4XRS G;  2XC7 A;  3F22 A;  5L3G A;  5J4V A;  1LDK B;  3SEZ A;  5H20 A;  3CCL I;  2M4G A;  4KMU X;  5DCF A;  1X4O A;  3KP2 A;  3CUQ A;  3Q3S A;  5KHD A;  4ZC3 A;  2PBI A;  3ZMT A;  3CC2 I;  3VSL A;  4IHS A;  5IY5 H;  5LRS A;  5LD2 C;  1GDT A;  5FO5 A;  1JTY A;  3AG1 H;  1HDD C;  4M9Z A;  2O0Y A;  2RQQ A;  3G73 A;  2V6E A;  4A6D A;  2MH9 A;  2OAZ A;  5CKT A;  2Y69 H;  3BQY A;  4C3J J;  2JJ7 A;  3FHZ A;  2XAJ A;  5FB2 A;  4KNY A;  1T56 A;  2QLZ A;  4A3D J;  3TQN A;  1Z05 A;  3NAR A;  5J8C A;  4PZJ A;  2D1H A;  4P1W A;  2C6Y A;  1IV8 A;  2H8R A;  5LHG A;  3WOD F;  2RV8 A;  2VJ5 A;  2KRC A;  2WAE A;  3TBI A;  3GYH X;  4A3J J;  3K4K A;  1FX7 A;  1H9T A;  2QF7 A;  5F0H A;  5D8L B;  4E7L A;  5L3F A;  2L2O A;  1MH3 A;  4PFP A;  5IYB J;  1YJW I;  1TWH J;  3BRO A;  4G7H F;  2O9L A;  1XS9 A;  3KP5 A;  4V2G A;  2JRT A;  2KJB A;  3BG5 A;  3ABK H;  5IT9 K;  1GUU A;  3IKT A;  3HRM A;  1JUM A;  1WJD A;  1XMX A;  4G7Z F;  1ZR4 A;  3ERE D;  5IYC J;  4X0G A;  2K9L A;  3IAS 2;  4HW0 A;  2EBI A;  3S17 J;  5F27 A;  5BOX A;  2K4J A;  5M5Y J;  2AHQ A;  4L9N A;  4PGH A;  4EV0 A;  3NQO A;  2IS6 A;  2NVU B;  3CUQ B;  4RGS A;  2GLO A;  3O2P E;  4HG2 A;  4DBQ A;  2EA4 A;  5E3N A;  4EVI A;  3RYP A;  4CH7 A;  2EFP A;  3G1M A;  3GZ6 A;  2E1O A;  1FMV A;  2BEO A;  2CWE A;  4L5I A;  3BR5 A;  1UB9 A;  3IV5 A;  1HC8 A;  2H09 A;  3BC8 A;  4JX5 A;  4OAZ A;  3DU6 A;  2LKP A;  2K40 A;  1XN7 A;  4A5N A;  4Y7N J;  4G8X A;  5CVI A;  1RUO A;  3BR3 A;  3K69 A;  2JPB A;  3FHN A;  2NNY A;  2PMU A;  5FLV A;  3CMA I;  3Q0W A;  4G6Q A;  4BQN A;  1WSU A;  2FQ4 A;  1P4A A;  1I27 A;  3H9J A;  3P7N A;  5EDN A;  4RA2 A;  1I39 A;  3JRF A;  2Y9Y A;  1VFC A;  3J80 K;  1DU6 A;  4FTH A;  4LB6 B;  1Q1H A;  3BY6 A;  4HLY A;  2P6T A;  3GFI A;  1IN4 A;  2X1D A;  4WWC A;  2IS2 A;  5DCM A;  5TRD A;  4BQQ A;  4M72 A;  2LF7 A;  3QYE A;  1T0F A;  1R7J A;  1STZ A;  3W6J B;  4PSW A;  4HDU A;  2P5V A;  1KQ8 A;  1WCM J;  2DU9 A;  2WB1 A;  2KFD A;  1P7I A;  1X1P A;  2JA8 J;  1ENH A;  2YU9 J;  3CD6 I;  2IS1 A;  1X1C A;  3CP8 A;  1G3W A;  1OYY A;  2VC1 A;  4EMS A;  4F91 B;  2LP0 A;  4YEL A;  3WE2 A;  3DPT A;  5JFR A;  4CZC A;  3N97 A;  2DAO A;  3WGH A;  2R5Y A;  5JHU A;  1OCO H;  3Q9S A;  2LY1 A;  5L3C A;  3REO A;  1K78 A;  5E8G A;  2HOT A;  3PIO F;  4KFC A;  2YU3 A;  4FQG A;  3K70 C;  2L3D A;  3DWL E;  4BY1 J;  1WJA A;  2FXA A;  3CCJ I;  5E17 F;  1Z1D A;  5JI6 A;  3EQL F;  1YIT I;  3MWM A;  2K3P A;  3NEU A; 
#chains in the Genus database with same CATH homology
 1MMN A;  4N4N B;  1OLT A;  3DTK A;  4C30 A;  2W82 A;  3FBI B;  3K4C A;  1GLN A;  2CMP A;  5FRO A;  2GOX B;  2A5W A;  3ONQ A;  1V5F A;  3E0J B;  3LSK A;  2HQA A;  2BW3 B;  3K4B A;  2Q2E B;  1V5G A;  2XF6 A;  3VSK A;  1YE9 A;  4XLC A;  3W2V A;  3ZQQ A;  3OYM A;  4JOM A;  4QPQ A;  2L9S A;  4Y33 A;  4BGD A;  4C2T A;  4II3 A;  2VXZ A;  3VYT B;  4ZJZ A;  2VJJ A;  4XN0 A;  1Z3X A;  3MMY B;  1W36 C;  1BR4 A;  3DKY A;  3UNG C;  3DTI A;  1TZL A;  4PJM A;  1X19 A;  2Z16 A;  2AQF A;  3LSG A;  3FKJ A;  4BEH A;  1X4P A;  2UWM A;  2LC2 A;  3L2W A;  3S8P A;  3OYC A;  5FRM A;  1MNE A;  5CQE A;  4BJT A;  2KQR A;  3AKZ A;  3N05 A;  4HST A;  2VKH A;  4RMN A;  3S3N A;  4B47 A;  4XLA A;  3H35 A;  2WAQ A;  4IX7 A;  3DPU A;  4J01 A;  3TMO A;  4ZYA A;  2QKL B;  3OS2 A;  3FBN B;  1X1A A;  2RNG A;  1YX3 A;  4II2 A;  3QOE A;  4LG3 A;  3HOS A;  3RQ4 A;  3L2V A;  2F4I A;  3M8J A;  1N78 A;  2R7X A;  4HEA 2;  3C2G A;  1U0J A;  3HL2 A;  2LG4 A;  1NG6 A;  2X1C A;  3PSI A;  1AA7 A;  3PUB A;  3U21 A;  4DIQ A;  5HNH A;  2HU9 A;  2LOO A;  2VJI A;  4BQO A;  4F3Q A;  3K70 D;  1YX5 A;  4E7J A;  2PJR A;  2XF7 A;  4P5O A;  4IQ4 A;  2CW8 A;  4BUP A;  1IRX A;  4E7I A;  3MKY B;  2X51 A;  2LYC A;  2LY2 A;  1X1B A;  2KL4 A;  2X6W A;  2V9K A;  2IGK A;  2MAB A;  1FMW A;  2PMZ A;  1LKX A;  4HRI A;  2LRE A;  3L2R A;  3F9K A;  1BR1 A;  4XLH A;  2ELJ A;  4ITV A;  2M0M A;  2DCE A;  4D9J A;  4KIS A;  4ZDO A;  3VYU B;  2VQH A;  2R7W A;  4BEH B;  3S3M A;  3KYL A;  3PJR A;  3AL0 B;  1WJC A;  3VWB A;  2KDO A;  2E1M C;  1PJR A;  2BVM A;  4LIT A;  1PYV A;  4XNF A;  1G59 A;  1W36 D;  4Y4R A;  5TGT A;  1UAA A;  4CSW A;  2DOA A;  2KLO A;  3OYA A;  4CCN A;  2NOJ B;  2VQC A;  2VQL A;  2IXS A;  4XLF A;  4HNU A;  2M3A A;  2DXI A;  3OY9 A;  2FUG 2;  3I9V 2;  4CA0 A;  4IQJ A;  2R7Q A;  2LBF A;  3W2W A;  5FRN A;  1V5E A;  1DP3 A;  4DBR A;  2E1M B;  2WBM A;  3OYI A;  4BDZ A;  3QOD A;  2P0W A;  1MMA A;  1ZEL A;  3D5R C;  3NWS A;  5KCM A;  4NUB A;  2RRE A;  2PJR B;  3S93 A;  4CCJ A;  2V26 A;  3FDY A;  3ZCO A;  4XON A;  3OYD A;  1Y56 A;  2R4G A;  1WFX A;  1D1B A;  2VB6 A;  3DPL C;  4Y3O A;  4E6K G;  3AFH A;  2ZXI A;  3OS0 A;  5CPR B;  1VZ0 A;  4E7S A;  2MD0 A;  4FET A;  2VQG A;  2AQE A;  3BCB A;  4F55 A;  3W2A A;  2Y0S A;  4XKV A;  3I3L A;  1DGW Y;  4B48 A;  3ZR8 X;  3SDB A;  4ANJ A;  2HPM A;  3PNT A;  2XF5 A;  2Z1D A;  2ZXH A;  4DOZ A;  1DGR M;  2KHM A;  4D1Q A;  3HOT A;  3BLY A;  1UG0 A;  4LIU A;  4OWR B;  3S32 A;  4JQF A;  1N77 A;  3SZG A;  3EUK L;  4PSX A;  4RLQ A;  3RPU D;  4CCL A;  3OYF A;  2WY7 Q;  3OYN A;  3OIQ A;  3SYT A;  4F92 B;  4BE0 A;  2IS4 A;  4IKF A;  4HPQ A;  1LFP A;  1WJB A;  3DLA A;  3EPZ A;  2LBF B;  3MKZ A;  3OIP A;  3HPH A;  5HVQ C;  2V1N A;  2LRD A;  4XKB A;  3K4L A;  1WJE A;  2VAS A;  4XMY A;  3CP2 A;  1D0Y A;  3OYB A;  4PFO A;  3HKZ A;  2VXD A;  4XM3 A;  1X1D A;  2X1E A;  4R79 A;  4BU2 A;  4FAS D;  4DJA A;  2Z2S B;  1MMD A;  2JUG A;  3OL4 A;  4BE1 A;  2X6Y A;  3QYB A;  5JHF A;  3L2Q A;  1NG7 A;  3DU5 A;  2CH0 A;  2VKD A;  2VLA A;  2E5N A;  3H5N A;  4XR6 A;  2R7V A;  1EA3 A;  2MYS A;  3LSI A;  5HLT A;  3ZGK A;  4ZTJ A;  4J00 A;  2WAD A;  3CZ6 A;  4RM3 A;  3QYF A;  3W3C A;  2R7U A;  2ZSH B;  2UV1 A;  4B44 A;  3BCA A;  1ERD A;  2KMU A;  3IUO A;  2HDW A;  3EUA A;  2ZSI B;  4E7Z A;  1MW7 A;  3ZRG A;  1TT0 A;  3LMM A;  4KJZ A;  5KNL A;  1D1C A;  4B43 A;  3CMM A;  2VJ4 A;  3OR2 C;  3H0D A;  2LH9 A;  3VYR B;  2W4S A;  3EUH C;  3IP4 B;  4XQF A;  4AVZ A;  1S9H A;  4BXF A;  2CFO A;  2HVR A;  2JVH A;  2V4J C;  3OWT A;  4B3X A;  3SEQ A;  1D1A A;  3KEY A;  3VDX A;  4AU7 A;  2JVG A;  2L7K A;  5HOO A;  2MFZ A;  2L5Q A;  1JI8 A;  1HA8 A;  1QHH D;  2VIX A;  3CJQ B;  4PUS A;  2KPM A;  3CJR B;  3H9Q A;  2DT6 A;  3OYK A;  1WJF A;  3L2U A;  4BJ5 C;  3CES A;  3G2B A;  3ZXS A;  2KP6 A;  1K6Y A;  4ZTF A;  1N75 A;  2A6T A;  2R7R A;  4AYB A;  2E5Z A;  3BG6 A;  2HZD A;  2KRH A;  1R6R A;  3K10 A;  3OL3 A;  2XC7 A;  2M4K A;  1LDK B;  2MC4 A;  3PSF A;  2QKM B;  1J09 A;  2DJI A;  2M4G A;  3SEZ A;  2W1O A;  1X4O A;  4E7H A;  4NC7 A;  4NC8 A;  2OUM A;  2VL8 A;  2WA0 A;  3GBG A;  4ZC3 A;  3LL7 A;  5KHD A;  2OC6 A;  3VSL A;  4E7K A;  3KX2 A;  2ZFU A;  3MKW B;  5LD2 C;  1SFK A;  2CUZ A;  4H4K C;  3K4M A;  2RQQ A;  2V6E A;  2KZV A;  4GRI A;  3CF2 A;  5CKT A;  3LSH A;  4PJL A;  3PL8 A;  1BR2 A;  3TL4 X;  1T0F C;  4CCO A;  2HPI A;  3OMY A;  4YEJ A;  4BJ6 C;  4HSR A;  4IZZ A;  4E4H A;  2I8D A;  4P1W A;  4CCM A;  3LSM A;  1LVK A;  3NWT A;  1T95 A;  2VJ5 A;  2KRC A;  2WAE A;  3TBI A;  3K4K A;  4NQW B;  4CUG A;  4E7L A;  2XSJ C;  2L2O A;  3OYE A;  4PFP A;  5HNF A;  2K5C A;  3OYG A;  4U7B A;  4MLO A;  2V7F A;  3E1S A;  4ZDP A;  4XL9 A;  2O5R A;  1BOB A;  2Q1Z B;  1WJD A;  3K4N A;  1Z7L A;  2BVL A;  3K4J A;  3V42 A;  3BG7 A;  4X0G A;  2R7T A;  2K9L A;  3DEE A;  3IAS 2;  3OYH A;  1QU3 A;  2VPL A;  2JSP A;  3DTE A;  2IS6 A;  4F93 B;  2CS3 A;  4KIT B;  3OYJ A;  4HG2 A;  4DBQ A;  2JA2 A;  4CH7 A;  1OR7 C;  2L9N A;  4XOP A;  2CV1 A;  1MND A;  2K9M A;  3HXL A;  3OS1 A;  1FMV A;  4QPO A;  4PJN A;  1P9Q C;  4PK4 A;  2HVQ A;  4U87 A;  3BC8 A;  4OAY A;  3HG9 A;  3PFY A;  4C2U A;  4OAZ A;  2F5V A;  3DU6 A;  4LIV A;  3J7A Y;  2UUZ A;  3OOU A;  4XOR A;  2CV2 A;  2R7O A;  4XKW A;  3FHN A;  4BL0 B;  1D0Z A;  2WAF A;  3A4C A;  4BQN A;  3A2K A;  4HNT A;  2IGO A;  1Z3Y A;  4G6T B;  3H9J A;  4XKC A;  4BDY A;  3DKX A;  2HVS A;  3PNY A;  3D5L A;  3AL0 C;  4NNJ A;  2BW3 A;  3LFU A;  2CUJ A;  2HNH A;  3H9G A;  3UR3 C;  2X1D A;  2IS2 A;  2BOL A;  2XDV A;  2M7B A;  2F6C A;  2X85 A;  3C2H A;  4PJJ A;  3MD2 A;  4BQQ A;  4DGW B;  1SAU A;  3OYL A;  3QYE A;  3RSN A;  4BE2 A;  1WJ5 A;  4PSW A;  2IGN A;  3A1Y A;  3H5R A;  2M7A A;  4XLE A;  2CW7 A;  2WB1 A;  3HC7 A;  2XAU A;  2W7N A;  1D0X A;  2IGM A;  2W00 A;  1X1C A;  4KT6 A;  2IS1 A;  3CP8 A;  1QHG A;  4YRV A;  4RLF A;  3H5A A;  4BS9 A;  2DT7 B;  4CCK A;  4C9Y A;  4F91 B;  3RCO A;  4YEL A;  1E0E A;  3HPG A;  1KON A;  3DPT A;  3PNV A;  5CQG A;  4XOT A;  4EAT A;  4CZC A;  1G8X A;  3OR1 C;  3S3O A;  3IAM 2;  2WY8 Q;  4N4O B;  2LY1 A;  1UEL B;  2X6X A;  2E60 A;  1Y6I A;  4XN3 A;  3K70 C;  3DWL E;  3RTR A;  1Z21 A;  1WJA A;  3VYS B;  4RM2 A;  3HUG B;  4F52 A;  5LFA A;  2GOM A;  4BAC A;  1MMG A;  4ZDL A;  3K6G A;  3M1C A;  2OV7 A;  3DQV C;  1DQU A;  2R7S A;  2K3P A;  3D5S C;  2CV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...