2LBFA

Solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 60S acidic ribosomal protein P1
publication title Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2011-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lbfA00
3A1YA 2LBFB 2W1OA 4BEHA 4BEHB 2LBFA
chains in the Genus database with same CATH superfamily
2OQRA 1HLVA 3JSOA 2EZKA 2GA2A 2W25A 1WI3A 1ETKA 3FMQA 1ZRFA 3CCEI 2LY1A 4HSRA 3CQZJ 3CCUI 1IRGA 1O7FA 2XKOA 3DTKA 4OU0A 2FD5A 4ZZDA 5LD2C 2M0CA 2DXIA 3PNTA 2E1MB 3TGNA 4EVIA 2BY2A 4LG0A 4AIHA 4L0ZB 1Y1WJ 1FLIA 3IWZA 3SYTA 4F93B 3WTYC 3RZDJ 3GYHX 4BU2A 1FMVA 4DYQA 4L5EA 2VE9A 2IAIA 2DMNA 1VQ6I 3ECHA 3I54A 4UXNA 1APLC 2ZNZA 5L3CA 1P4XA 3RSNA 1QZZA 4IEJA 2L7MP 2BV6A 1O3SA 2JA2A 2KRFA 4WWCA 1BI3A 1STZA 3SZTA 4EGZA 1S7EA 2K4JA 2FBIA 1X3UA 3KEQA 2XAUA 4UB8C 3Q0VA 1G4DA 3S1MJ 1T8IA 3HRTA 5BMZA 3E97A 5KVRA 2HPIA 5H6RA 2DLLA 3LSGA 3AG1H 3EPZA 4J00A 4Y17A 4Q4ZF 2DAOA 1ZG5A 3H35A 2FMLA 3K69A 3DEUA 3M1CA 4OOIA 2IGOA 2RNJA 3GFMA 3RPQA 3B73A 4UNOA 3REOA 3TMOA 4HW0A 2HPMA 1G6NA 3M9AA 2ZJ2A 3ONQA 3V7CA 1YIOA 1XSVA 5L3BA 2ISZA 1GV5A 3WG9A 1O7LA 3G1OA 5LRSA 2QENA 1MBEA 2CU7A 3L09A 1G3WA 5IT9K 2FQ4A 1B8IB 3FX3A 2XAGA 2L9SA 5FKNA 1QHHD 2L4AA 2Y0SA 1MGTA 4A0YA 2PMZA 4MTEA 5DD8A 2JT1A 3O3KA 3O8GA 3O8HA 2PEXA 2CS3A 3FBNB 1FOYA 5CVIA 4I98B 3BR2A 2W85A 4U0WA 4ENKA 2D1VA 2EH3A 2MA3A 4AD9A 5K5QA 4R79A 2VBXA 1I1SA 4LIUA 1AKHB 4KMUX 2O8XA 1FY7A 2J5OA 3LSRA 3AKZA 2M34A 3S8PA 3NRVA 4HLYA 4I01A 3GTJJ 3MZHA 3FM3A 4E4HA 5FD5A 1LFPA 4HNUA 2VBZA 1QBJA 2NNNA 3JTGA 3I56I 1LVKA 2DYRH 3ERMA 1MW7A 4LLGF 4RAGA 1K6OA 3PO2J 1UCRA 3DEEA 4UY8I 4RDUA 2HYJA 2HEOA 3ZMVA 3CP2A 2DFEA 1HC8A 3OY9A 2CW8A 4FISA 2Z3YA 4U87A 4XLNF 2TRTA 2GQQA 2DFIA 1QZYA 4ESFA 4KMFA 1XDSA 3B02A 4I02A 4BXFA 2ZB9A 1KA8A 1OPCA 4N9HA 1P2FA 5M5XJ 4RB1A 3J7AY 4OMYA 3LA2A 3A0HC 4YFXF 2ZSIB 2H6BA 1TWFJ 1DPRA 1JUSA 4G7HF 2VONA 2R5ZB 1CQTA 2EIJH 3CJQB 4RLFA 1WJDA 2Z99A 3T8TA 1TTYA 4HLXA 4U0VA 3KETA 2FXAA 2Y0MA 3RPUA 1RNLA 3FXJA 4IHVA 4II3A 3FHNA 1RKTA 2NVQJ 1S8NA 2Y31A 2K9LA 4FE4A 2O5RA 4E7SA 2QBYA 4G7OF 2DFFA 2JN6A 4I09A 1VQNI 2XGXA 2P81A 1BJAA 1SVOA 1SFUA 2GWRA 3ZQ7A 1HW1A 1DP7P 4KISA 4ZTJA 3HOXJ 2ZXJA 3CF2A 4IRIA 1WJCA 4JP0A 2R7DA 1R1TA 4C30A 4EMSA 2BY0A 2BW3B 4FX0A 2OZ6A 4OIOF 2R7QA 1QQIA 1LVAA 3TBIA 2GM4A 5LFAA 5IT9Z 2F5FA 4ENMA 4UV8A 4BKXA 1MDMA 2CSOA 2IEKA 3FXOA 1FBUA 2X1CA 2COMA 1LEAA 2CV2A 3WTVC 3GZNB 1TL8A 1MBJA 2PMHA 3E6MA 5KAIC 1YW7A 3DEWA 4L9NA 4L9VA 2W4SA 3G2BA 2W00A 4ZTFA 1I1GA 1JTXA 2EQRA 1Y6IA 2QQBA 2M87A 4O3MA 1G3TA 2V6CA 1R5GA 2WAQA 3HZJA 1JUMA 1F9NA 2DA4A 2IGNA 3I64A 5FRMA 3CDLA 3Q9VA 2ID6A 4P55A 3OYAA 3CC7I 3HPHA 2L2OA 4BY1J 1W36D 2LNBA 3S32A 1HKTA 3V7SA 3OOUA 1JI8A 3RKWA 5D4SA 2KLOA 2DT7B 1HA8A 1T6SA 2CJJA 3L7WA 1XTAA 1Y56A 3JRAA 2NOJB 4PGHA 3HPGA 4KN7X 1UB9A 2VQLA 2X6YA 1OCTC 2R7WA 3FBIB 1O3TA 3BROA 3DKYA 2EIKH 3SDBA 3I59B 2E2JJ 3SZPA 3WG7H 4BJTA 1IRZA 3BQZA 2FNAA 4ZYDA 1YOVB 3ROUA 1JT6A 1R1VA 3D5LA 4KIFA 2KZVA 2K85A 3MKWB 2AXTC 2XROA 3T0YA 4AIJA 4I76A 5JLWA 3OIOA 1SAXA 1BJZA 3BR1A 4HNVA 2PJRA 1TNTA 3V8JA 4E7HA 3HG9A 2L9RA 5D6FA 3G73A 3HSEA 3IH3A 1SFXA 2DQRA 3ASNH 2KKOA 1W1WE 5LRRA 2CQXA 3BJAA 4K2EA 2XGEA 5TJJA 4PJLA 4ZYGA 1HQCA 3KEOA 1X3ZB 3BJOA 5J40A 1QGPA 1W36C 4E70A 2ZMEB 3EYIA 3P9CA 1YFHA 4B47A 1U5TA 5EYRA 5LGTA 4QTRA 4OAYA 2L9NA 3ESWB 3GUDA 3K0LA 4QPOA 4HF1A 3FK7A 1X4OA 2KL4A 4XKCA 3L00A 3Q5FA 1M1EB 2COBA 4RA2A 3W2VA 1I6HJ 4ZH4F 1VI0A 3FXUA 5CQGA 1TQIA 1Y8QB 4OINF 3ZCOA 3GLLA 3A1YA 3QPTA 4CUGA 2Q8KA 3TO6A 1QRYA 5M5YJ 4IQJA 3WGGA 1X1AA 2JA7J 3K4JA 4ASNA 3OYLA 3KIOA 1V55H 3CCVI 4IL6C 2MC3A 1LPQA 1HW5A 1FJLA 4M6VA 4MQVA 4XIDA 1PUFA 4Q47A 1SVMA 2R0QC 1MJAA 3WU1B 2JVGA 3CUQB 2W1OA 2KT0A 4IOCF 2EB7A 2CO5A 1TWGJ 3I55I 2F5EA 1MMGA 3PNVA 2MG4A 1KYZA 1IDYA 2MGQA 2STWA 1QU3A 9ANTA 3KZIC 2VBWA 4QPQA 2BOLA 2QA4I 3IP4B 3KP3A 4HEA2 3DBHB 3R6SA 4D5CA 2CFOA 5E8IA 3GTKJ 3QPHA 4Q5SF 3D5SC 1MSEC 2M2EA 4NNJA 1FBQA 3FKIJ 4ESJA 2CUJA 5HLIA 1O3RA 3S2HJ 5LEKA 2GBYA 2OUMA 1MBGA 1I5ZA 2PQ8A 1BM9A 1I6XA 3S3OA 3GEZA 2VKHA 1W7PD 5LGNA 3E5UA 2BXYA 4WK8F 2O61A 4BDZA 1G8XA 3KZYA 2V9KA 4A3DJ 2FX0A 2NVXJ 4S05A 1LKXA 5GPAA 2Y69H 2IS6A 2R4GA 3LSHA 4N4NB 4CO8A 2H1LA 3PL8A 1QPIA 3C2HA 2IP2A 2E7XA 4A5NA 4LLLA 3IKVA 1FP2A 1OCRH 3IKTA 3COAC 4D5FA 1S9HA 4CZZA 2ECCA 3BDDA 2ETHA 3CMEI 2LYCA 1K78B 1VQ7I 2D45A 3F72A 3BG3A 2UV1A 2VXZA 5LBQA 1EV7A 4IQ4A 2NS8A 4OIQF 2R92J 1Y39A 5IYBJ 2KHMA 3F0CA 2VJJA 1MZBA 5J1YA 3KYDB 2V79A 2UXNA 4G6TB 3CMAI 2GXBA 5EG0A 4M74A 1SMYF 1R4MB 2IW5A 3MKYB 1FTTA 5FLVA 4XLAA 2XPVA 4CCJA 5LLQA 2QYOA 2XAFA 1HBXG 2RKHA 4IRHA 3OYEA 2X6XA 2BHYA 3EYYA 3OYKA 1ZGWA 3D0SA 1WVRA 1BR2A 4E7ZA 2HGCA 5IOZA 2E60A 2DJNA 4X6AJ 3EETA 2XF6A 4KICA 2H6CA 1VQ5I 5F1RA 1FTZA 2W48A 4IPAA 2NOGA 1U6GA 3OSFA 2CUFA 1CF7A 2AHQA 3FWEA 1WHUA 2L7ZA 3BY6A 2DT6A 3SJMA 3CJTB 2CQ7A 2X48A 4BQAA 2AXLA 2DU9A 5CVRA 3IL2A 2KRCA 5F0FA 2OZUA 3F8CA 1NTCA 1MD0A 2V1UA 1OYIA 2ZNYA 1JKQC 5J3LA 2F5CA 4V19K 3A03A 2PJPA 4RB3C 2ZBKA 3GW2A 1X1CA 3VEPA 1XGSA 5D8KB 5FJ8J 3KP2A 4EEFG 2WA0A 5F64A 1FMWA 3IC7A 1IGNA 3LA7A 1TC3C 5FRNA 2HNHA 3MKZA 2EJRA 1L0OC 2EIMH 2OJED 2K27A 1WWXA 3W3CA 1LUJB 4A3CJ 4ZDOA 1JE8A 2O9LA 3HRMA 4KFCA 4HV5A 4HG2A 1K83J 1SD7A 4F3QA 2AQFA 4DZJA 4JK1X 2K02A 5DDGA 4BBSJ 4PSWA 5K5OA 1WGXA 4PCQA 1AHDP 2XVCA 3VYTB 3LSMA 3HL2A 4UUVA 1FZPB 2KDOA 2Y0SN 4RGRA 5GADJ 3LA3A 2O3FA 2CV0A 1LDJA 3F22A 2PMZN 1MJ9A 1ITYA 4BUPA 3M8EA 2HDWA 1GVDA 5EEGA 3V8KA 1OCOH 4BBRJ 4UUSB 3BOQA 2HTSA 1TWCJ 2WBMA 2XGCA 2F2EA 1Q1HA 2LF8A 2VKDA 2C6YA 2IS4A 3FKJA 2OCEA 1K79A 5HS8A 2P6TA 2QM3A 3QYEA 2D2WA 1KGSA 3MMYB 3HOYJ 3EUAA 4AM3A 2X1DA 1TBXA 4JQFA 5B5EC 2E1CA 1Y1VJ 1OKRA 4F91B 2NVTJ 1N78A 4S04A 4CSWA 4BXXJ 3CF5F 3RQ4A 5DUIA 1VNDA 3A02A 3C2GA 4N4OB 4M6YA 4XLFA 3E3VA 4M3BA 2OQGA 3LNQA 1WJFA 5J47A 3HRSA 1OYWA 1FP1D 4HYEA 1XCVA 5EZHA 1P7JA 3H0DA 2TDXA 4PZJA 1X19A 1X3WB 5E1ZB 3L2VA 2IA0A 3M3YJ 3F8FA 2PBIA 2X51A 2EFPA 3HUGA 1ZRCA 1UG0A 2HQAA 2TCTA 1ENHA 2DA5A 3DPLC 1GT0C 3W6VA 5IP7J 3P7NA 2PFBA 3PIOF 2EV5A 1SMTA 3SEQA 1USTA 3IV5A 1OLTA 2FQ3A 3DP7A 5C3EJ 4BS9A 1IN5A 5DM6F 2MLGA 4XRFA 2WC2A 4EV0A 3OYGA 1POGA 4JOMA 1EH6A 1ON2A 5LHIA 3K4BA 4KITB 4M6XA 1QVUA 1H0MA 4V2GA 1P92A 3C18A 3QAHA 3UR3C 1JGGA 4KA4A 2VJ5A 2KIMA 3WHBA 3WU2C 1YJWI 3JCUC 1MBFA 5D5UB 2FOWA 1ZELA 1AU7A 4EJVA 4KJZA 3CCYA 4IF4A 1FWZA 2QLZA 2NRAC 5EF6A 4Y15A 1KQ9A 3FF5A 4D7MA 4OWRB 5FD6A 2MC4A 2XAJA 2P5KA 3CTAA 2JRTA 1AA7A 4DQ2A 3FXQA 1MH4A 4M73A 1VF9A 3V7RA 2MYSA 1GHCA 2XPWA 3F23A 4M72A 2F5VA 2WV0A 3QPSA 1VQ9I 2JVHA 4BEHB 3PSIA 5TISC 5E20A 1QO0D 3HHHA 3RIRA 1YG2A 2W7NA 3J80K 1PUEE 2IA2A 2QF7A 5K5RA 1VQPI 4N0BA 3BPXA 1EF4A 3OS2A 2JSCA 2P4WA 4BQQA 1W7PB 5IT3A 1RKWA 1Y8RB 4IHYA 1NH3A 3ZP5A 2LBFB 1BC7C 1IW7F 3BZKA 3PNYA 1BI2A 1TZLA 3CUOA 3QU6A 4ZYEA 4NC8A 3GFIA 2HYFA 1A6QA 1MJBA 2WAQN 4I0AA 4PJNA 3RI4A 1QHGA 3LQQA 2DMTA 3HOUJ 2YU3A 2DT5A 1JKOC 2DTZA 1IV6A 2H27A 2UWMA 1VQKI 5AIQA 5K7ZA 4MNUA 3H36A 1X1PA 3ZQCA 2MABA 5IP6A 4KT5C 2VQGA 3G71I 2DCEA 1MBHA 2IGMA 1AKHA 2QZ8A 2OU2A 3Q9SA 3DCFA 3BPVA 4BY7J 1X1DA 2A3SA 2G7UA 2I5UA 2M45A 4A3GJ 3J7YJ 1V5EA 1X2MA 2KJBA 3DQVC 4RB2C 3HDDA 2BGCA 4ETSA 3CO7C 1J59A 5B66C 3R0JA 5GAHJ 3S15J 1IXCA 1EA3A 1TW3A 2GLOA 1OMIA 1WI9A 5FKKA 3OYIA 2IXSA 3S16J 2Z2SB 2IA1A 1Z6TA 4ENNA 3AG2H 2WAFA 2EV6A 2Y75A 5JFRA 2CQNA 1WKMA 5TGTA 4BL0B 3WODF 1Z9CA 4KIGA 4YG2F 1EKEA 5KNLA 2MBFA 3DPUA 2R5YB 2Z5UA 2VLAA 2LR8A 3IUOA 5E17F 4I0BA 3OV8A 5BOXA 4L18B 2RVCA 1A35A 5CVJA 4I2OA 5M5WJ 3G4SI 1TQPA 3AFHA 2FNPA 3MZ8A 4YELA 4ESBA 3KE2A 2A6EF 3M4OJ 3TP3A 3FISA 1IC8A 3OSGA 2B9SA 2ZMEC 2MD0A 2BE5F 3BR6A 2HKXA 2CQKA 4GO1A 1B4AA 1T0FC 2M9HA 3HXLA 1BC8C 4HDVA 1XGNA 3IH4A 2A6HF 3ZMUA 1ULYA 2QQAA 3OIPA 4N9IA 4P96A 3SZGA 4XSZF 4UHTA 2O7OA 1BI1A 2IVMA 3FXKA 4LG3A 4RBOA 1QNTA 5DCMA 3LWFA 3EUHC 2OTJI 2FRHA 1OR7A 3FIWA 4PJJA 5CLSA 1P4AA 3J80Z 1YI2I 1W5CC 4BGDA 3ZQGA 3M07A 4IHWA 3FXLA 2NS7A 3K1PA 1HXDA 2BW3A 3LOCA 3QODA 1GDTA 2VBYA 1MKMA 2HYGD 3VSLA 4LG0B 1B72A 3S93A 5GPCA 2WADA 1S72I 5K1YA 4G6QA 3CUQC 3QP6A 5ICCA 1IXRC 3LSJA 4B1RA 3OYJA 2XHKA 3FZVA 1YQAA 2XB5A 2I8DA 2XF7A 3OYFA 1XGOA 1MMAA 1N75A 1IUYA 3DBRB 1BBYA 1ZREA 2CUZA 3X2QH 1LFUP 1MIJA 2XV4S 4Z2YA 3H1CA 1ETYA 4LMYA 3BTJA 2EZHA 1R58A 1IXSB 2HXOA 2OBPA 3LFKA 5J4YA 3EDPA 3V4GA 4F92B 2M7BA 5CJ9A 4BHBA 3I3LA 3U2RA 1ZHFA 1L3LA 1IAWA 5KAFC 1ZH5A 3CJNA 3MQ0A 1IZ1A 1DDNA 2EPFA 2VE8A 4MQ9F 2E1NA 5EGOA 4AIDA 1C0WA 3F8MA 3RKYA 3KEYA 2D1HA 2YSRA 3I59A 1WFXA 3F6OA 3LMMA 3FDYA 3DLAA 4LITA 1HDDC 3K10A 5DV5A 2KZGA 4A69C 3FMSA 1XSDA 3ELKA 2OPTA 2EILH 4DYCA 3BR3A 2A5WA 2O6GE 2Y30A 1RIOH 4BNCA 3VDXA 4C2MJ 1U5TC 3CCSI 4WXCA 4ZDPA 4YFNF 3K7AJ 3CCQI 5DTDA 3BG9A 3TOBA 1J09A 2LC2A 5FROA 1RUNA 3Q0UA 4YIRX 4HQEA 3QOEA 2H1KA 3HGYA 4XICA 2PLYA 2NAZA 2WY8Q 2BVLA 2QSHX 3BR0A 4ON0A 1YITI 1B6AA 3G1MA 3F3XA 3GXOA 4GGGA 4L9JA 5L3GA 3PUFA 3T1BA 3OYBA 2H09A 1OCPA 3SDGA 5EEAA 1I27A 2KJCA 4HBLA 1HKSA 1J9IA 1ZGJA 1BW6A 3MWMA 3H3VK 5HDGA 1R22A 1WPKA 4BXUA 2DQLA 3DLLF 4A93J 3OYNA 2Q2EA 4JX6A 3GTGJ 3ABKH 1SC7A 4KIBA 3S2DJ 1LE8B 1TLHB 2IPQX 5BNGA 5HVQC 2QSFX 3BTIA 1D0YA 2EWNA 3MFKA 3HTUA 4U0YA 2BHZA 2W57A 4IHTA 1FPQA 2N8GA 4IO9F 2HTJA 4XNFA 2Z33A 1D5YA 1K6YA 2CMPA 1V5GA 3KLOA 2X0LA 4EGYA 3K1MA 4NUBA 1BR1A 5D5VB 5M3MJ 3ZGKA 1J2XA 4MLOA 5FKMA 2FOKA 3RYPA 3ZN1A 5C44J 5KHDA 3QWLA 3TO9A 3BG7A 4WXHA 1R36A 1OJLA 2JPCA 2QVOA 3DWLE 3GF2A 3K1NA 5E18F 4HAMA 2QBYB 2ZFUA 2G0EA 2W84A 2EFWA 2UUZA 4BE0A 1W4MA 4A3MJ 1WCMJ 2QSGX 3E5QA 4CCNA 4C3HJ 4B3XA 1A5JA 3T8RA 4ZDLA 3JAMZ 1FYKA 2JRMA 1H9GA 2E5NA 3ABUA 3HKZA 4ZC3A 2CV1A 1RPWA 1XGMA 4A0XA 1LDDA 2VT3A 5IY5H 3CCJI 2CH0A 2FSWA 4IOAF 1I3QJ 1YX3A 1AOYA 3BP8A 4A6EA 4O6JA 1YRNA 4KDPA 2QWWA 3S3NA 3S1QJ 3RYRA 2M4KA 1J5YA 5HNFA 4HX7A 3LAJA 4PFPA 2VOOA 1U0JA 4IXAA 2LREA 3CC4I 5EEHA 3HC7A 2V6EA 3FXRA 5E8GA 3CLQA 3WTXC 1P7IA 4A0ZA 5KCMA 4XR6A 1H88C 1KU2A 4XN3A 2W82A 4AUXA 2R7ZJ 3JRIA 2K3FA 4NC7A 2DFHA 4P9FA 2K9MA 3JRFA 2KISA 4XSXF 2QQ9A 5FFZA 4I6ZA 5BPIA 2W24A 3H9GA 3QYFA 4WXDA 5F0CA 3M1EA 1YYVA 2RREA 4E7IA 1N25A 1XB4A 2YPRA 4MGRA 1Z91A 1E3PA 1WJ5A 4BHCA 5DEQA 4CH7A 3I58A 2FUG2 3ERED 4AVPA 4EM1A 2GOMA 1D0ZA 4L5IA 2VC1A 1J7KA 4ABZA 5IYCJ 2ACJA 1I39A 5HNHA 4JX5A 1R49A 1FC3A 1FEXA 3QQAA 1IN8A 3MKLA 3GTLJ 1D1AA 1I50J 1X4PA 3PQKA 3H3UA 1R1UA 4HA8A 1A31A 4A3BJ 2PJRB 3R0AA 5HDNA 3K4MA 4HX8A 1YJNI 1FX7A 1U9NA 5FKLA 4EJUA 1KQ8A 3HYIA 1ETVA 1Z6RA 2L02A 1TW2A 1MBKA 1T2KA 3RTRA 4S0HB 5D8LB 3JRGA 1PVEA 5FLMJ 4E7KA 2JA8J 4KUMA 2STTA 4DNCA 4EQQA 5E79C 4YRVA 1OFCX 2F6CA 3PM1A 1Z67A 1VTNC 2PN6A 2ZJQF 2O0YA 4DZPA 1U5TB 4WCGA 1BN5A 2YX7A 4H4KC 4XLHA 2M30A 3P5JA 2CFXA 4KYWA 3J81K 5IYDJ 3VSKA 2K7LA 3TW7A 2LKSA 4UV9A 4CICA 4FASD 3OS1A 2ME6A 2JMWA 3GVAA 1EJ9A 2A6TA 1USSA 2V1NA 4PUSA 3SFIA 1JKRC 3DFGA 4IJAA 3CJRB 4EATA 1RI7A 1VQMI 1QZEA 1ZN2A 5ILUA 3I53A 4A3FJ 3ZXSA 3W6KB 3E6CC 4GFBA 2H8WA 3A01A 2JQ7A 2OD5A 1W0UA 3IRRA 4EM2A 1XD7A 2XKPA 3DV8A 2DPDA 1H89C 3K2ZA 5F27A 3K4KA 2XAHA 3V42A 1Z1DA 3OYCA 3HIFA 1D1CA 1WRJA 2CGPA 4LK1F 1HOMA 4D0PA 3FHZA 1ZTRA 2DOFA 4MIMA 2LH9A 4C3IJ 1VQ8I 5M3FJ 1F36A 1SD4A 4PJ0C 4MHGA 3CP8A 1F43A 3RKQA 1S3JA 4XK4A 2RN7A 2XSJC 1S5LC 4XBFA 3UNGC 3SFZA 1TT0A 1U78A 2Y9YA 3AAFA 2ZC2A 2LG4A 4CYCB 2CW0F 1LEBA 2VC0A 4QWQA 2CG4A 3RDIA 2FEZA 1T56A 4LJZF 4RAYA 2XB0X 4RMNA 3G6EI 3F21A 3CO6C 2A07F 1W5TA 2R93J 1OISA 2YR2A 5FLXK 3J7AO 3VOEA 5EZGA 4OIRF 2VJ4A 4BQOA 2OF7A 1R7JA 1NK3P 2DDBA 2FE3A 1Z0XA 2KFDA 3F6VA 2EK5A 4C2TA 4FE7A 3TL4X 5H6QA 3Q0WA 2XGDA 3I9V2 1RETA 3KX2A 1V5FA 2JJ7A 1R23A 5TRDA 3QYBA 4DBRA 2ADUA 5E3MA 3I4PA 4G9YA 3H5AA 1MH3A 3KP5A 3S2WA 2X4HA 2WTEA 2P7CB 4MTDA 2KMUA 2GXAA 2P8TA 4V2FA 2P6SA 3HOSA 4RS8A 4CHUA 2MW8A 4E7JA 1W0TA 1HDPA 4ITVA 1G3SA 3BZCA 4GXOA 4JBAA 2DA7A 1TWHJ 3K4CA 2DMQA 1WZ2A 1UAAA 4DBQA 3JW4A 1MMNA 1D3YA 1DUXC 3PQJA 4CA0A 1UZCA 2K4BA 1YTYA 3NQOA 1V54H 2Z9OA 2HDDA 5JLXA 3PO3J 2E2HJ 3JSPA 4IHXA 2EA4A 1A36A 2E71A 1R6RA 3PSFA 4RGXA 2VXDA 3WHCA 1OCZH 1ZARA 4P9UA 3KP7A 1ZLKA 2VPLA 4XL9A 5ICFA 3GLXA 3HOVJ 3H9QA 5EJCA 2M1BA 2RC4A 3J81Z 1IV8A 5GTHC 3HSRA 5JHUA 1O4XA 2CRGA 2RGVA 3ABTA 3R61A 2HS5A 3I5UA 4A6DA 1LB2A 1W7PA 4LB6B 3OS0A 1IF1A 2LDUA 2YU9J 4OAZA 4RM3A 5GAEJ 5L3FA 4AYBA 5H2FC 4O5VA 2R3SA 2WB1A 3ABMH 4A3IJ 2L5QA 3OIQA 4HSTA 3ZPLA 4LOCA 5EDNA 2CYYA 2P5VA 1GXPA 5FKOA 4M3DA 1A04A 2E5ZA 1TWAJ 2LMDA 4G8XA 3RJPA 2FBHA 2JK3A 2O8KA 2KRHA 2H94A 2F4OB 5E1WA 2R7SA 3N4MA 2PG4A 4UVAA 3MN2A 3BWGA 3PFIA 4XM3A 4A3LJ 2AS5F 4Y52J 1DQUA 1GVJA 2HVQA 4DW6A 1FYLA 4LIVA 3HGGA 2DA1A 3T5XA 1IJWC 3FM5A 3MAJA 1ZG3A 2OTLI 1B9NA 3TW6A 1XX5A 4CDGA 3NWSA 4WF2A 1ETXA 4RB0A 3Q3SA 3ECOA 5CVVA 3TOAA 1ZR4A 1WQ2A 3H0GJ 1XPXA 3A4CA 1K61A 1F5TA 4HRIA 1ACIA 4ZYAA 1IRXA 5FLXZ 1UMQA 1XCBA 3R4KA 3LSIA 3R60A 1BR4A 2ZXIA 4JX4A 3DKXA 1D5VA 1VQOI 4KNYA 1HKQA 1EH7A 4GYIA 4MO7A 2QKLB 3D1NI 4F55A 2MLKA 3RQIA 4D7NA 1CGPA 1NK2P 2LSOA 2HI3A 2XDVA 1RZ4A 3E7LA 5GAGJ 4II2A 1XMAA 3P9IA 1FBSA 4GCVA 2VPRA 1UJ8A 3FK6A 3L2RA 4C2UA 1V4RA 2VL8A 2ME0A 3E1SA 3M8FA 4XOPA 5GP9A 2R7VA 2RAEA 4CCLA 1S7OA 2FMYA 4EJWA 1IN7A 1B8IA 3ISPA 3VWBA 3OR1C 3S3MA 5DS9A 2LF7A 1KU3A 2EA2A 4WX9A 3KYCB 3HRUA 1ERDA 4BE1A 3F9KA 5HLGA 1ZYRF 5GTIC 4D1QA 3L9FA 3RPUD 4QIWN 3AL0C 1VQLI 4LD5A 1UFMA 3HUGB 1QPMA 1YIJI 4B8XA 3WTTC 4D9JA 5D4RA 1JHHA 3OOPA 1ONVA 4G6DA 4F7ZA 2QQ8A 1JGSA 2VKEA 3KP4A 1KQ0A 3CCLI 3GMEA 4RAZA 4NQWB 5DUKA 3BTCA 1R5ID 1LQ1A 1FSEA 5BPDA 2K9QA 2EV0A 4XKBA 1ZR2A 5B3SH 3NARA 4FQGA 3W2AA 5CPRB 3EQLF 3CDIA 3GTPJ 3HSFA 2L3DA 2Y48A 3BG6A 3SQNA 2P7VB 4YIFA 2DBBA 2ELJA 3CDHA 4BH9A 4EM0B 2X1EA 3NAUA 1KYWA 1Z7LA 1WJBA 1ODDA 2GIZA 4XLCA 2M8GX 1Z3XA 3IAS2 1BW5A 2A68F 1HSJA 4B43A 3PIPF 2WY7Q 2Y2ZA 2A69F 3QOPA 2A05A 5CQEA 2IGKA 1ZG1A 2R5ZA 1Z21A 2ECBA 4XRSA 1K4SA 3U1DA 2R7TA 4XRMA 2VJIA 2M8EA 5F1JA 1U8BA 4HPQA 2BYVE 2OCCH 3HKZN 4W1UA 3TO7A 4RGUA 2XRLA 3DXJF 3GFLA 2HQRA 5K7FA 1XC5A 5E1XA 4AU7A 1DPUA 1PYVA 4P5OA 1PP8F 3IRQA 2L4MA 1ZRDA 3C7JA 3GBGA 3GTOJ 2R7UA 1KONA 4UB6C 4FT8A 3IAM2 2P0WA 3ZRGA 4HF0A 3KCCA 3HOWJ 1U9OA 3VB2A 1ETWA 2LY9A 2QGUA 1U2WA 4M9ZA 1Z05A 2HWVA 3TP0A 5HLHA 2OV7A 1SEUA 4MEXF 1SD6A 1T39A 3RZOJ 2DO7A 4RM2A 3KZZA 4U7DA 5L3DA 4CXFA 1ETQA 4J01A 1LNWA 2GAUA 1F4KA 1UG2A 2E1OA 1TP4A 3L2CA 1XDUA 2K86A 4LFUA 2X85A 2IT0A 3KP6A 3DU6A 4GRIA 1SFOJ 1JJ6C 4CCMA 2JA5J 5IOYA 1BOAA 4IVNA 3VPRA 4XQFA 2K3PA 3JREA 1R5HA 2DA3A 1BOBA 4KN4X 1MMSA 4M3GA 3QPLA 4C3JJ 2GXGA 2HOSA 1Z7UA 2LVSA 2ICWG 1D1BA 1YE9A 2CWEA 1BL0A 2Q0OA 1FOWA 2LD5A 1D8KA 2YX4A 2UZKA 1BI0A 3WTUC 1YW9A 1G59A 2VN2A 2KIFA 2LK2A 2ZO4A 2ELHA 4LB5A 4A2UA 2O03A 3O6BB 1FIPA 3ZMZA 1REPC 1Y0UA 2GZWA 3K70D 2B63J 3IWFA 2IJLA 1FOKA 3I4NJ 3BTLA 1RC9A 1YO5C 1XMKA 5C4JJ 3VYRB 2LKXA 1HCRA 3JAMK 2F5DA 1G2HA 2BY3A 2GOXB 4RAFA 1E3HA 2VASA 1O3QA 4AVZA 1JTYA 2WAEA 4XKWA 1LE8A 1F1ZA 3MD2A 3HOTA 2NYXA 1XN7A 3ABLH 3MVPA 3OYHA 5ED4A 1JXSA 3L2UA 2X6OA 4PDKA 4X1EA 3W2WA 4YEJA 5D5XB 3OL3A 1YS6A 3SXYA 3GZ5A 3LQRA 3TDZC 2B7EA 1UHSA 2HU9A 2VUMJ 2XSDC 3LFUA 1RR7A 2MFZA 4LLNA 2L54A 2XF5A 4DYRA 2HVRA 3GTQJ 4G12A 1FT9A 2HKOA 3I4MJ 3B6AA 2LRDA 3E0JB 3QU3A 4LGWA 3AG4H 2M3AA 3H9JA 1P6RA 5F04A 1RESA 1ZAOA 2LFBA 3NWTA 2JSPA 3K70C 1DP3A 3EUKL 2K5CA 3U1KA 2L01A 2F4IA 2RDPA 3C3WA 1K7AA 2XC7A 1YLFA 5DCMB 2ZMEA 4YFKF 3HOZJ 1SFKA 3QP5A 5E3LA 5JVTA 2LLKA 1T0FA 4L5JA 2V9VA 3TEDA 3BCAA 3JRBA 5ERIA 5DM7F 3AL0B 4I7HA 5D6EA 2DJIA 2M7AA 3WGIA 2DODA 4NDLA 2V1XA 2XPUA 4YIIA 5CVUA 1B72B 4ENJA 1UHWA 2LY2A 4OMZA 3U21A 4M3FA 1B9MA 3CMMA 3TKYA 2MD5A 3EUHA 3OR2C 2PX9A 2DI3A 2DTRA 3KPHA 5HLTA 1OYYA 3OL4A 4G7ZF 3KYLA 5FFXA 2ZXHA 1IG7A 1IDZA 2NVUB 2V4JC 3FMRA 4IKFA 4CCKA 1XS9A 3SEZA 4MEYF 4XKVA 1S7AA 2ZFWA 3D5RC 1D8JA 2GIVA 4Y13A 1HW2A 3WTWC 4Z6YA 4GDFA 2DK8A 2V9PA 3CUQA 1VZ0A 3DBLB 2BBYA 3I71A 2VODA 4BE2A 2VB6A 1WJAA 3ZOBA 5BS6A 2MH2A 4ZJZA 3N97A 1J0RA 4FHTA 5HS7A 4A3JJ 3WE3A 1HSTA 3PUBA 2IS2A 2ESHA 4PSXA 1R9TJ 1JHFA 5DCFA 3WTZA 1SVLA 4QLCU 1E17A 4R8HA 2MH9A 3ZQIA 5J1UA 2VIXA 3ZMDA 3JRDA 3S1NJ 4XLEA 2XASA 5EGOB 2IBDA 4BQNA 2R7FA 3ML6A 3GCMA 5AIPA 4NB5A 1VQ4I 3WTSC 2QEXI 4FCYA 1KU9A 1T33A 2DA2A 5J1RA 2ZJRF 2AQEA 3V8LA 2NXNB 2E2IJ 2M4GA 2EZIA 3BLYA 1E0EA 3H3ZA 2PI0A 3A0BC 2L9VA 2FJ1A 4J19A 5E3OA 1FNNA 1H8AC 3CZ6A 2QCOA 4XMYA 2A5YB 2DPUA 3CC2I 3MZYA 4B3AA 2NS0A 5IP9J 1WH5A 3NEUA 2DK5A 1EH8A 3L2QA 3JTHA 3ASOH 1MDMB 2L0KA 1K78A 2HQNA 4XOTA 4A5MA 4BJ6C 1RRJA 1U8RA 1R00A 2KIQA 4HDUA 3E6BA 2ZCWA 2G7HA 1KU7A 2HR3A 3ZR8X 1HF0A 1JUPA 4CZCA 2XRNA 3GWZA 1VFCA 4AYBN 4FX4A 2DOEA 4HOBA 2E19A 2WB1N 2L7KA 2RQPA 1YW8A 3GZ6A 1RR8C 3OMYA 5ILSA 1T95A 3M7GA 5LHHA 4E7LA 1TNSA 2DMUA 2FA5A 4TV7A 1GXQA 1UELB 2RV8A 2ID3A 2ZJPF 1MNMC 4PK4A 1MNDA 4FETA 1DGRM 2HZDA 2Q1ZB 3G3ZA 1QVTA 2Q2EB 3LSPA 3OYDA 3MEXA 2IS1A 3GTMJ 1V3FA 3BR5A 1JT0A 2ZKZA 1SFEA 4Y4RA 5FB2A 1SD5A 3A2KA 1R4NB 3H92A 3TDUC 4L9TA 5LEJA 5K7HA 2DYSH 3K4NA 3AG3H 3BCBA 2GA1A 2VKVA 3DPTA 5IPAA 4HNTA 5L3EA 2E35A 4G94A 4M71A 2V7FA 1PJRA 3BZ6A 1WJEA 1XSXA 5A2QK 2NNYA 2H8RA 2QUFA 2BEOA 4CYCA 5HDKA 1NG6A 1Q1VA 2VI6A 1WSUA 4BDYA 3K2AA 1IO2A 3DTIA 4DIQA 2DA6A 3PJRA 2EFNA 2YUSA 2JUGA 1YHQI 2KPMA 2MSYA 4NBQA 2WV1A 3K4LA 3M8JA 1OCCH 2OA4A 3HM5A 2M5WA 1IN6A 3BC8A 2HOAA 2PMUA 2RNGA 2KIUA 1D0XA 3L1PA 4ANJA 2FBKA 1T38A 3UKGA 1ETOA 4QSHA 3BQYA 5FO5A 3CCMI 3DU5A 1XMXA 1G3YA 5DYMA 5J4VA 2B0LA 5ICGA 5F08A 4XORA 1K4TA 3J7ZI 3SHFA 1NHAA 3IH2A 1YRNB 1ZQ3P 2JUCA 1J75A 3VYSB 4RLQA 3OYMA 4HX4A 2JWTA 1QA6A 1MMDA 1X2NA 3VYUB 4UUSA 1U3EM 3ZN0A 1LDKB 4AC0A 5H20A 2VQHA 3HHGA 1LJ9A 3ZQHA 3BG5A 1LFBA 2RQQA 2LTPA 4XONA 3CD6I 2WWYA 2CUEA 1BA5A 3U9GA 1PUFB 5J6XA 1W5SA 1FIAA 3H5NA 2F48A 3JR9A 1ZK8A 4A3EJ 4DGWB 2HDCA 2Z1DA 3TQNA 1GUUA 1Y0NA 2JZYA 5E3NA 4R1HA 2FU4A 2KDZA 1Z3YA 3P9KA 3HB9A 2HVSA 2HXIA 3ULQB 4XN0A 2ZXWH 4E6KG 5JI6A 4ZYHA 5B1AH 1OQYA 2OC6A 1FOXA 2JTVA 4HZFA 3RCOA 1E2XA 5F0HA 1DGWY 2E1MC 1YJ9I 3E5XA 3B6CA 1ORKA 1B59A 4Q48A 2HZTA 2Z16A 5FGMA 4HF2A 5JR3A 1N77A 2EBIA 2CQQA 2KQRA 3ZQFA 2HFHA 2JA6J 1GV2A 2L7FP 4CGZA 4MFDA 4PJMA 2DN0A 1TQMA 1SAUA 2DDAA 3KLNA 4UUTA 2J5PA 3WGHA 1X58A 4IX7A 3GX4X 1ZKGA 2BXZA 2LOOA 5ICEA 4IZZA 1BIBA 4JYKA 2BY1A 2K40A 1ZGAA 2XAQA 4EJOA 3HEFA 2ESNA 3JRCA 5A2QZ 4Y3OA 4HV6A 4BAYA 4BYYA 1JKPC 2EZLA 1IUFA 2X9DA 4Y33A 3G1LA 2LKPA 2E7WA 3DKWA 2OAZA 1P4WA 5EG0B 1E3OC 3CLOA 1ZLJA 4XRSG 3H5RA 3LAPA 2IRFG 2AO9A 3WU0A 3IHUA 3HJEA 5BQTA 3K6GA 1S29A 2DMPA 3GO5A 4W97A 4C9YA 4AIKA 4I99C 5D5WB 4EJTA 1MSFC 4P1WA 2K9NA 2DW4A 4BEHA 3S17J 2E34A 2R7XA 3A01B 1RUOA 3N05A 2VOPA 4BJ5C 4DOZA 1SANA 2HOEA 5J8FA 3JRHA 2E36A 2Y9ZA 1CF7B 4ZZLA 5HOOA 1JJ8C 4M9XA 2X6WA 3CESA 4U7BA 2LBFA 2CW7A 5F6FA 1S6LA 2G9WA 4MFEA 2ISYA 3OWTA 1WH7A 1PP7U 4AWXB 2VT2A 2NVYJ 2ELKA 5CYVA 1XG1A 1T08B 2DOAA 2VQCA 3HBLA 2QKMB 2P5LC 3E6DA 5C4XJ 3L2WA 3QRFF 3VFZA 4BACA 2A61A 4B48A 3WE2A 1I3AA 4B44A 3S1RJ 3F8NA 3ZMSA 4L0YB 1B1BA 4PGGA 3FXMA 4IHSA 4B09A 3ZQLA 1T98A 3GFJA 1PDNC 4DJAA 2V1DA 4U88A 4NQWA 4X0GA 1GLNA 2M0MA 3F8BA 5KK1A 3S14J 4HQMA 2FF4A 3RKXA 2R7OA 1A6IA 5LHGA 3BT9A 5HODA 2I10A 3BJ6A 3DTEA 1MNEA 2EFOA 5CKTA 1KZHA 4FTHA 1H9TA 4GYGA 3LSKA 4XLPF 1O57A 4IRGA 2BVMA 4UVBA 3MCZA 3C2BA 4H0EA 3CMYA 5ILVA 2XIGA 4M9SA 4RGSA 1X1BA 1NG7A 2HOTA 4M3EA 5J8CA 3KFWX 2HQ5A 4CCOA 1FYMA 3O2PE 1P9QC 2D5VA 1YX5A 2F4MB 5B1BH 2LP0A 3LL7A 3LSTA 5LGUA 5AONA 2R5YA 4NC6A 3C1DA 3I0TA 4Y7NJ 1IRFA 4A3KJ 1DU0A 1R71A 5HS9A 4CYDA 3K9TA 5DD4A 3VODA 4A12A 3CCRI 2R7RA 4PFOA 2KP6A 1DU6A 1FSHA 4B4CA 2EINH 2JPBA 4LK0F 3ZMTA 1AWCA 5JHFA 3HTSB 3W6JB 1UHMA 2XUBA 2UXXA 6PAXA 2BZTA 5JVGF 3DF8A 4KT6A 4NHJA 4OIPF 3PFYA 1YS7A 2V26A 1TT5B 1OR7C 3ZQQA 1BIAA 4BHPA 4F52A 1IN4A 2K9SA 4UVCA 1Z77A 1ON1A 2YS9A 2ZSHB 2EFQA
chains in the Genus database with same CATH topology
4ZDOA 1U0JA 2GOXB 2VASA 2LREA 4HG2A 4AVZA 4XKWA 2WAEA 3HC7A 3MD2A 4F3QA 2AQFA 2V6EA 3HOTA 2LY1A 3OYHA 4HSRA 3L2UA 5KCMA 4PSWA 3W2WA 4YEJA 4XR6A 3OL3A 4XN3A 3VYTB 2W82A 3DTKA 3LSMA 3HL2A 2HU9A 3LFUA 5LD2C 2MFZA 4NC7A 2DXIA 2XF5A 2KDOA 2E1MB 2K9MA 3PNTA 2CV0A 2HVRA 4BUPA 2HDWA 3SYTA 4F93B 2LRDA 3H9GA 3QYFA 2WBMA 3E0JB 4BU2A 2M3AA 1FMVA 2RREA 2VKDA 3H9JA 4E7IA 2IS4A 3FKJA 3NWTA 2JSPA 3K70C 1WJ5A 1DP3A 3EUKL 4CH7A 2K5CA 2FUG2 3RSNA 3QYEA 3MMYB 3EUAA 2F4IA 2X1DA 4JQFA 2GOMA 2XC7A 1D0ZA 2JA2A 1SFKA 4F91B 1N78A 4CSWA 5HNHA 3RQ4A 2XAUA 3BCAA 3AL0B 3C2GA 4N4OB 1D1AA 4XLFA 1X4PA 2HPIA 3LSGA 2DJIA 1WJFA 2M7AA 3EPZA 4J00A 2PJRB 3K4MA 3H35A 3H0DA 3M1CA 2LY2A 2IGOA 3U21A 3CMMA 1X19A 3TMOA 3OR2C 3RTRA 3L2VA 2HPMA 2X51A 5HLTA 3OL4A 3ONQA 3KYLA 2ZXHA 4E7KA 1UG0A 2HQAA 2V4JC 3DPLC 4IKFA 4CCKA 3SEZA 4XKVA 4YRVA 2F6CA 3D5RC 3SEQA 1OLTA 4H4KC 4XLHA 1VZ0A 3VSKA 4BS9A 2L9SA 2VB6A 1QHHD 1WJAA 4BE2A 2Y0SA 4ZJZA 4FASD 3OS1A 2PMZA 3OYGA 2CS3A 2A6TA 3FBNB 2V1NA 4JOMA 4PUSA 3PUBA 2IS2A 4PSXA 3K4BA 3CJRB 4EATA 4KITB 2VIXA 3UR3C 3ZXSA 2VJ5A 4XLEA 4BQNA 4R79A 4LIUA 1ZELA 4KJZA 3K4KA 3AKZA 3S8PA 3V42A 3OYCA 1D1CA 2AQEA 2LH9A 4OWRB 2M4GA 4E4HA 2MC4A 1LFPA 4HNUA 1AA7A 3BLYA 1E0EA 3CP8A 1LVKA 1MW7A 2MYSA 3CZ6A 2XSJC 3DEEA 4XMYA 3UNGC 2F5VA 1TT0A 3CP2A 3OY9A 2CW8A 2JVHA 2LG4A 3PSIA 4U87A 4BEHB 3L2QA 2W7NA 4RMNA 4BXFA 4XOTA 4BJ6C 3OS2A 4BQOA 2VJ4A 4BQQA 3J7AY 3ZR8X 4CZCA 2ZSIB 2LBFB 4C2TA 3TL4X 3PNYA 3I9V2 1TZLA 3KX2A 1V5FA 4NC8A 3QYBA 4DBRA 2L7KA 4PJNA 3OMYA 1QHGA 3CJQB 3H5AA 1T95A 4RLFA 1WJDA 4E7LA 2UWMA 2KMUA 3HOSA 2MABA 1UELB 4E7JA 4II3A 3FHNA 4ITVA 4PK4A 1MNDA 2VQGA 4FETA 2K9LA 1DGRM 2O5RA 4E7SA 2DCEA 2HZDA 2Q1ZB 2IGMA 2Q2EB 3K4CA 3OYDA 2IS1A 1UAAA 1X1DA 4DBQA 1MMNA 4CA0A 4Y4RA 1V5EA 3A2KA 3DQVC 4KISA 4ZTJA 3CF2A 3K4NA 3BCBA 3DPTA 4HNTA 1WJCA 1R6RA 3PSFA 2VXDA 2V7FA 1PJRA 1EA3A 1WJEA 4C30A 2VPLA 2BW3B 4XL9A 2R7QA 3H9QA 3TBIA 5LFAA 1NG6A 3OYIA 4BDYA 2IXSA 2Z2SB 3DTIA 4DIQA 3PJRA 2JUGA 2WAFA 2X1CA 2KPMA 2CV2A 4BL0B 3M8JA 3K4LA 5TGTA 3BC8A 3OS0A 5KNLA 2W4SA 3G2BA 2RNGA 2W00A 4OAZA 4RM3A 3DPUA 4ZTFA 1D0XA 4ANJA 2VLAA 3IUOA 4AYBA 1Y6IA 2WB1A 2L5QA 3OIQA 2WAQA 4HSTA 3DU5A 3AFHA 4YELA 2IGNA 5FRMA 2E5ZA 4XORA 3OYAA 3HPHA 2KRHA 2L2OA 1W36D 3S32A 2R7SA 3VYSB 4RLQA 2MD0A 3OOUA 3OYMA 1JI8A 1MMDA 3VYUB 2KLOA 2DT7B 1HA8A 1T0FC 3HXLA 1LDKB 4XM3A 1DQUA 2HVQA 1Y56A 2VQHA 4LIVA 2NOJB 3HPGA 3OIPA 2VQLA 2X6YA 3SZGA 2R7WA 2RQQA 3NWSA 3FBIB 4XONA 3DKYA 3SDBA 4LG3A 4BJTA 3EUHC 4PJJA 3H5NA 3A4CA 4HRIA 4BGDA 3D5LA 1IRXA 4ZYAA 4DGWB 2KZVA 2Z1DA 3LSIA 3MKWB 1BR4A 2BW3A 2ZXIA 3DKXA 3QODA 1Z3YA 2PJRA 3VSLA 2HVSA 4E7HA 3HG9A 4XN0A 2QKLB 3S93A 2WADA 4F55A 2XDVA 4E6KG 4II2A 2OC6A 3RCOA 3OYJA 1DGWY 2E1MC 3L2RA 4C2UA 2VL8A 2I8DA 2XF7A 3OYFA 1MMAA 4PJLA 3E1SA 4XOPA 1W36C 1N75A 2Z16A 1N77A 2R7VA 2KQRA 4B47A 4CCLA 2CUZA 4OAYA 2L9NA 4PJMA 4QPOA 3W3CA 1SAUA 3VWBA 3OR1C 1X4OA 2KL4A 4XKCA 3S3MA 3W2VA 5CQGA 4IX7A 1ERDA 4BE1A 3ZCOA 3F9KA 2LOOA 4F92B 2M7BA 3A1YA 4IZZA 4CUGA 4D1QA 3RPUD 3I3LA 3AL0C 4IQJA 1X1AA 3HUGB 3K4JA 4D9JA 4Y3OA 3OYLA 3KEYA 1WFXA 3LMMA 4Y33A 3FDYA 3DLAA 4LITA 3K10A 4NQWB 2JVGA 2W1OA 3H5RA 1MMGA 2A5WA 3PNVA 4XKBA 3K6GA 1QU3A 4C9YA 3VDXA 4QPQA 2BOLA 3IP4B 5CPRB 3W2AA 4HEA2 4P1WA 2CFOA 3D5SC 4ZDPA 4NNJA 2CUJA 4BEHA 3BG6A 2R7XA 2OUMA 3N05A 2ELJA 4BJ5C 3S3OA 4DOZA 2X1EA 1J09A 2LC2A 2VKHA 1Z7LA 5FROA 1WJBA 4XLCA 4BDZA 1G8XA 3IAS2 1Z3XA 5HOOA 3QOEA 4B43A 2X6WA 2V9KA 3CESA 2WY7Q 2WY8Q 4U7BA 2BVLA 2LBFA 2CW7A 5CQEA 1LKXA 2IGKA 3OWTA 1Z21A 2IS6A 2R7TA 2R4GA 2VJIA 3LSHA 4N4NB 3OYBA 3PL8A 3C2HA 4HPQA 2DOAA 2VQCA 4AU7A 1S9HA 2QKMB 1PYVA 4P5OA 3L2WA 4BACA 3GBGA 4B48A 2R7UA 1KONA 4B44A 3IAM2 2LYCA 2P0WA 3ZRGA 2UV1A 2VXZA 4IQ4A 3OYNA 2KHMA 2VJJA 4DJAA 2OV7A 4X0GA 1GLNA 2M0MA 4G6TB 4RM2A 5HVQC 1D0YA 4J01A 2R7OA 3MKYB 3DTEA 4XLAA 1MNEA 4XNFA 5CKTA 4CCJA 2X85A 1K6YA 2CMPA 1V5GA 3DU6A 4GRIA 4NUBA 1BR1A 3OYEA 4CCMA 2X6XA 3ZGKA 3LSKA 3OYKA 4XQFA 1BR2A 4MLOA 4E7ZA 2K3PA 2BVMA 2E60A 5KHDA 2XF6A 1BOBA 3BG7A 1X1BA 1NG7A 3DWLE 4CCOA 2ZFUA 1P9QC 4BE0A 1YX5A 2UUZA 3LL7A 1D1BA 1YE9A 2DT6A 4CCNA 4B3XA 2KRCA 4ZDLA 1G59A 2E5NA 3HKZA 4ZC3A 2CV1A 2R7RA 4PFOA 3K70D 2CH0A 2KP6A 1X1CA 1YX3A 5JHFA 2WA0A 1FMWA 3S3NA 4KT6A 2M4KA 5FRNA 3PFYA 3ZQQA 2V26A 2HNHA 1OR7C 4F52A 3MKZA 3VYRB 5HNFA 2ZSHB 4PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1Y A;  2LBF B;  2W1O A;  4BEH A;  4BEH B;  2LBF A; 
#chains in the Genus database with same CATH topology
 2OQR A;  1HLV A;  3JSO A;  2EZK A;  2GA2 A;  2W25 A;  1WI3 A;  1ETK A;  3FMQ A;  1ZRF A;  3CCE I;  2LY1 A;  4HSR A;  3CQZ J;  3CCU I;  1IRG A;  1O7F A;  2XKO A;  3DTK A;  4OU0 A;  2FD5 A;  4ZZD A;  5LD2 C;  2M0C A;  2DXI A;  3PNT A;  2E1M B;  3TGN A;  4EVI A;  2BY2 A;  4LG0 A;  4AIH A;  4L0Z B;  1Y1W J;  1FLI A;  3IWZ A;  3SYT A;  4F93 B;  3WTY C;  3RZD J;  3GYH X;  4BU2 A;  1FMV A;  4DYQ A;  4L5E A;  2VE9 A;  2IAI A;  2DMN A;  1VQ6 I;  3ECH A;  3I54 A;  4UXN A;  1APL C;  2ZNZ A;  5L3C A;  1P4X A;  3RSN A;  1QZZ A;  4IEJ A;  2L7M P;  2BV6 A;  1O3S A;  2JA2 A;  2KRF A;  4WWC A;  1BI3 A;  1STZ A;  3SZT A;  4EGZ A;  1S7E A;  2K4J A;  2FBI A;  1X3U A;  3KEQ A;  2XAU A;  4UB8 C;  3Q0V A;  1G4D A;  3S1M J;  1T8I A;  3HRT A;  5BMZ A;  3E97 A;  5KVR A;  2HPI A;  5H6R A;  2DLL A;  3LSG A;  3AG1 H;  3EPZ A;  4J00 A;  4Y17 A;  4Q4Z F;  2DAO A;  1ZG5 A;  3H35 A;  2FML A;  3K69 A;  3DEU A;  3M1C A;  4OOI A;  2IGO A;  2RNJ A;  3GFM A;  3RPQ A;  3B73 A;  4UNO A;  3REO A;  3TMO A;  4HW0 A;  2HPM A;  1G6N A;  3M9A A;  2ZJ2 A;  3ONQ A;  3V7C A;  1YIO A;  1XSV A;  5L3B A;  2ISZ A;  1GV5 A;  3WG9 A;  1O7L A;  3G1O A;  5LRS A;  2QEN A;  1MBE A;  2CU7 A;  3L09 A;  1G3W A;  5IT9 K;  2FQ4 A;  1B8I B;  3FX3 A;  2XAG A;  2L9S A;  5FKN A;  1QHH D;  2L4A A;  2Y0S A;  1MGT A;  4A0Y A;  2PMZ A;  4MTE A;  5DD8 A;  2JT1 A;  3O3K A;  3O8G A;  3O8H A;  2PEX A;  2CS3 A;  3FBN B;  1FOY A;  5CVI A;  4I98 B;  3BR2 A;  2W85 A;  4U0W A;  4ENK A;  2D1V A;  2EH3 A;  2MA3 A;  4AD9 A;  5K5Q A;  4R79 A;  2VBX A;  1I1S A;  4LIU A;  1AKH B;  4KMU X;  2O8X A;  1FY7 A;  2J5O A;  3LSR A;  3AKZ A;  2M34 A;  3S8P A;  3NRV A;  4HLY A;  4I01 A;  3GTJ J;  3MZH A;  3FM3 A;  4E4H A;  5FD5 A;  1LFP A;  4HNU A;  2VBZ A;  1QBJ A;  2NNN A;  3JTG A;  3I56 I;  1LVK A;  2DYR H;  3ERM A;  1MW7 A;  4LLG F;  4RAG A;  1K6O A;  3PO2 J;  1UCR A;  3DEE A;  4UY8 I;  4RDU A;  2HYJ A;  2HEO A;  3ZMV A;  3CP2 A;  2DFE A;  1HC8 A;  3OY9 A;  2CW8 A;  4FIS A;  2Z3Y A;  4U87 A;  4XLN F;  2TRT A;  2GQQ A;  2DFI A;  1QZY A;  4ESF A;  4KMF A;  1XDS A;  3B02 A;  4I02 A;  4BXF A;  2ZB9 A;  1KA8 A;  1OPC A;  4N9H A;  1P2F A;  5M5X J;  4RB1 A;  3J7A Y;  4OMY A;  3LA2 A;  3A0H C;  4YFX F;  2ZSI B;  2H6B A;  1TWF J;  1DPR A;  1JUS A;  4G7H F;  2VON A;  2R5Z B;  1CQT A;  2EIJ H;  3CJQ B;  4RLF A;  1WJD A;  2Z99 A;  3T8T A;  1TTY A;  4HLX A;  4U0V A;  3KET A;  2FXA A;  2Y0M A;  3RPU A;  1RNL A;  3FXJ A;  4IHV A;  4II3 A;  3FHN A;  1RKT A;  2NVQ J;  1S8N A;  2Y31 A;  2K9L A;  4FE4 A;  2O5R A;  4E7S A;  2QBY A;  4G7O F;  2DFF A;  2JN6 A;  4I09 A;  1VQN I;  2XGX A;  2P81 A;  1BJA A;  1SVO A;  1SFU A;  2GWR A;  3ZQ7 A;  1HW1 A;  1DP7 P;  4KIS A;  4ZTJ A;  3HOX J;  2ZXJ A;  3CF2 A;  4IRI A;  1WJC A;  4JP0 A;  2R7D A;  1R1T A;  4C30 A;  4EMS A;  2BY0 A;  2BW3 B;  4FX0 A;  2OZ6 A;  4OIO F;  2R7Q A;  1QQI A;  1LVA A;  3TBI A;  2GM4 A;  5LFA A;  5IT9 Z;  2F5F A;  4ENM A;  4UV8 A;  4BKX A;  1MDM A;  2CSO A;  2IEK A;  3FXO A;  1FBU A;  2X1C A;  2COM A;  1LEA A;  2CV2 A;  3WTV C;  3GZN B;  1TL8 A;  1MBJ A;  2PMH A;  3E6M A;  5KAI C;  1YW7 A;  3DEW A;  4L9N A;  4L9V A;  2W4S A;  3G2B A;  2W00 A;  4ZTF A;  1I1G A;  1JTX A;  2EQR A;  1Y6I A;  2QQB A;  2M87 A;  4O3M A;  1G3T A;  2V6C A;  1R5G A;  2WAQ A;  3HZJ A;  1JUM A;  1F9N A;  2DA4 A;  2IGN A;  3I64 A;  5FRM A;  3CDL A;  3Q9V A;  2ID6 A;  4P55 A;  3OYA A;  3CC7 I;  3HPH A;  2L2O A;  4BY1 J;  1W36 D;  2LNB A;  3S32 A;  1HKT A;  3V7S A;  3OOU A;  1JI8 A;  3RKW A;  5D4S A;  2KLO A;  2DT7 B;  1HA8 A;  1T6S A;  2CJJ A;  3L7W A;  1XTA A;  1Y56 A;  3JRA A;  2NOJ B;  4PGH A;  3HPG A;  4KN7 X;  1UB9 A;  2VQL A;  2X6Y A;  1OCT C;  2R7W A;  3FBI B;  1O3T A;  3BRO A;  3DKY A;  2EIK H;  3SDB A;  3I59 B;  2E2J J;  3SZP A;  3WG7 H;  4BJT A;  1IRZ A;  3BQZ A;  2FNA A;  4ZYD A;  1YOV B;  3ROU A;  1JT6 A;  1R1V A;  3D5L A;  4KIF A;  2KZV A;  2K85 A;  3MKW B;  2AXT C;  2XRO A;  3T0Y A;  4AIJ A;  4I76 A;  5JLW A;  3OIO A;  1SAX A;  1BJZ A;  3BR1 A;  4HNV A;  2PJR A;  1TNT A;  3V8J A;  4E7H A;  3HG9 A;  2L9R A;  5D6F A;  3G73 A;  3HSE A;  3IH3 A;  1SFX A;  2DQR A;  3ASN H;  2KKO A;  1W1W E;  5LRR A;  2CQX A;  3BJA A;  4K2E A;  2XGE A;  5TJJ A;  4PJL A;  4ZYG A;  1HQC A;  3KEO A;  1X3Z B;  3BJO A;  5J40 A;  1QGP A;  1W36 C;  4E70 A;  2ZME B;  3EYI A;  3P9C A;  1YFH A;  4B47 A;  1U5T A;  5EYR A;  5LGT A;  4QTR A;  4OAY A;  2L9N A;  3ESW B;  3GUD A;  3K0L A;  4QPO A;  4HF1 A;  3FK7 A;  1X4O A;  2KL4 A;  4XKC A;  3L00 A;  3Q5F A;  1M1E B;  2COB A;  4RA2 A;  3W2V A;  1I6H J;  4ZH4 F;  1VI0 A;  3FXU A;  5CQG A;  1TQI A;  1Y8Q B;  4OIN F;  3ZCO A;  3GLL A;  3A1Y A;  3QPT A;  4CUG A;  2Q8K A;  3TO6 A;  1QRY A;  5M5Y J;  4IQJ A;  3WGG A;  1X1A A;  2JA7 J;  3K4J A;  4ASN A;  3OYL A;  3KIO A;  1V55 H;  3CCV I;  4IL6 C;  2MC3 A;  1LPQ A;  1HW5 A;  1FJL A;  4M6V A;  4MQV A;  4XID A;  1PUF A;  4Q47 A;  1SVM A;  2R0Q C;  1MJA A;  3WU1 B;  2JVG A;  3CUQ B;  2W1O A;  2KT0 A;  4IOC F;  2EB7 A;  2CO5 A;  1TWG J;  3I55 I;  2F5E A;  1MMG A;  3PNV A;  2MG4 A;  1KYZ A;  1IDY A;  2MGQ A;  2STW A;  1QU3 A;  9ANT A;  3KZI C;  2VBW A;  4QPQ A;  2BOL A;  2QA4 I;  3IP4 B;  3KP3 A;  4HEA 2;  3DBH B;  3R6S A;  4D5C A;  2CFO A;  5E8I A;  3GTK J;  3QPH A;  4Q5S F;  3D5S C;  1MSE C;  2M2E A;  4NNJ A;  1FBQ A;  3FKI J;  4ESJ A;  2CUJ A;  5HLI A;  1O3R A;  3S2H J;  5LEK A;  2GBY A;  2OUM A;  1MBG A;  1I5Z A;  2PQ8 A;  1BM9 A;  1I6X A;  3S3O A;  3GEZ A;  2VKH A;  1W7P D;  5LGN A;  3E5U A;  2BXY A;  4WK8 F;  2O61 A;  4BDZ A;  1G8X A;  3KZY A;  2V9K A;  4A3D J;  2FX0 A;  2NVX J;  4S05 A;  1LKX A;  5GPA A;  2Y69 H;  2IS6 A;  2R4G A;  3LSH A;  4N4N B;  4CO8 A;  2H1L A;  3PL8 A;  1QPI A;  3C2H A;  2IP2 A;  2E7X A;  4A5N A;  4LLL A;  3IKV A;  1FP2 A;  1OCR H;  3IKT A;  3COA C;  4D5F A;  1S9H A;  4CZZ A;  2ECC A;  3BDD A;  2ETH A;  3CME I;  2LYC A;  1K78 B;  1VQ7 I;  2D45 A;  3F72 A;  3BG3 A;  2UV1 A;  2VXZ A;  5LBQ A;  1EV7 A;  4IQ4 A;  2NS8 A;  4OIQ F;  2R92 J;  1Y39 A;  5IYB J;  2KHM A;  3F0C A;  2VJJ A;  1MZB A;  5J1Y A;  3KYD B;  2V79 A;  2UXN A;  4G6T B;  3CMA I;  2GXB A;  5EG0 A;  4M74 A;  1SMY F;  1R4M B;  2IW5 A;  3MKY B;  1FTT A;  5FLV A;  4XLA A;  2XPV A;  4CCJ A;  5LLQ A;  2QYO A;  2XAF A;  1HBX G;  2RKH A;  4IRH A;  3OYE A;  2X6X A;  2BHY A;  3EYY A;  3OYK A;  1ZGW A;  3D0S A;  1WVR A;  1BR2 A;  4E7Z A;  2HGC A;  5IOZ A;  2E60 A;  2DJN A;  4X6A J;  3EET A;  2XF6 A;  4KIC A;  2H6C A;  1VQ5 I;  5F1R A;  1FTZ A;  2W48 A;  4IPA A;  2NOG A;  1U6G A;  3OSF A;  2CUF A;  1CF7 A;  2AHQ A;  3FWE A;  1WHU A;  2L7Z A;  3BY6 A;  2DT6 A;  3SJM A;  3CJT B;  2CQ7 A;  2X48 A;  4BQA A;  2AXL A;  2DU9 A;  5CVR A;  3IL2 A;  2KRC A;  5F0F A;  2OZU A;  3F8C A;  1NTC A;  1MD0 A;  2V1U A;  1OYI A;  2ZNY A;  1JKQ C;  5J3L A;  2F5C A;  4V19 K;  3A03 A;  2PJP A;  4RB3 C;  2ZBK A;  3GW2 A;  1X1C A;  3VEP A;  1XGS A;  5D8K B;  5FJ8 J;  3KP2 A;  4EEF G;  2WA0 A;  5F64 A;  1FMW A;  3IC7 A;  1IGN A;  3LA7 A;  1TC3 C;  5FRN A;  2HNH A;  3MKZ A;  2EJR A;  1L0O C;  2EIM H;  2OJE D;  2K27 A;  1WWX A;  3W3C A;  1LUJ B;  4A3C J;  4ZDO A;  1JE8 A;  2O9L A;  3HRM A;  4KFC A;  4HV5 A;  4HG2 A;  1K83 J;  1SD7 A;  4F3Q A;  2AQF A;  4DZJ A;  4JK1 X;  2K02 A;  5DDG A;  4BBS J;  4PSW A;  5K5O A;  1WGX A;  4PCQ A;  1AHD P;  2XVC A;  3VYT B;  3LSM A;  3HL2 A;  4UUV A;  1FZP B;  2KDO A;  2Y0S N;  4RGR A;  5GAD J;  3LA3 A;  2O3F A;  2CV0 A;  1LDJ A;  3F22 A;  2PMZ N;  1MJ9 A;  1ITY A;  4BUP A;  3M8E A;  2HDW A;  1GVD A;  5EEG A;  3V8K A;  1OCO H;  4BBR J;  4UUS B;  3BOQ A;  2HTS A;  1TWC J;  2WBM A;  2XGC A;  2F2E A;  1Q1H A;  2LF8 A;  2VKD A;  2C6Y A;  2IS4 A;  3FKJ A;  2OCE A;  1K79 A;  5HS8 A;  2P6T A;  2QM3 A;  3QYE A;  2D2W A;  1KGS A;  3MMY B;  3HOY J;  3EUA A;  4AM3 A;  2X1D A;  1TBX A;  4JQF A;  5B5E C;  2E1C A;  1Y1V J;  1OKR A;  4F91 B;  2NVT J;  1N78 A;  4S04 A;  4CSW A;  4BXX J;  3CF5 F;  3RQ4 A;  5DUI A;  1VND A;  3A02 A;  3C2G A;  4N4O B;  4M6Y A;  4XLF A;  3E3V A;  4M3B A;  2OQG A;  3LNQ A;  1WJF A;  5J47 A;  3HRS A;  1OYW A;  1FP1 D;  4HYE A;  1XCV A;  5EZH A;  1P7J A;  3H0D A;  2TDX A;  4PZJ A;  1X19 A;  1X3W B;  5E1Z B;  3L2V A;  2IA0 A;  3M3Y J;  3F8F A;  2PBI A;  2X51 A;  2EFP A;  3HUG A;  1ZRC A;  1UG0 A;  2HQA A;  2TCT A;  1ENH A;  2DA5 A;  3DPL C;  1GT0 C;  3W6V A;  5IP7 J;  3P7N A;  2PFB A;  3PIO F;  2EV5 A;  1SMT A;  3SEQ A;  1UST A;  3IV5 A;  1OLT A;  2FQ3 A;  3DP7 A;  5C3E J;  4BS9 A;  1IN5 A;  5DM6 F;  2MLG A;  4XRF A;  2WC2 A;  4EV0 A;  3OYG A;  1POG A;  4JOM A;  1EH6 A;  1ON2 A;  5LHI A;  3K4B A;  4KIT B;  4M6X A;  1QVU A;  1H0M A;  4V2G A;  1P92 A;  3C18 A;  3QAH A;  3UR3 C;  1JGG A;  4KA4 A;  2VJ5 A;  2KIM A;  3WHB A;  3WU2 C;  1YJW I;  3JCU C;  1MBF A;  5D5U B;  2FOW A;  1ZEL A;  1AU7 A;  4EJV A;  4KJZ A;  3CCY A;  4IF4 A;  1FWZ A;  2QLZ A;  2NRA C;  5EF6 A;  4Y15 A;  1KQ9 A;  3FF5 A;  4D7M A;  4OWR B;  5FD6 A;  2MC4 A;  2XAJ A;  2P5K A;  3CTA A;  2JRT A;  1AA7 A;  4DQ2 A;  3FXQ A;  1MH4 A;  4M73 A;  1VF9 A;  3V7R A;  2MYS A;  1GHC A;  2XPW A;  3F23 A;  4M72 A;  2F5V A;  2WV0 A;  3QPS A;  1VQ9 I;  2JVH A;  4BEH B;  3PSI A;  5TIS C;  5E20 A;  1QO0 D;  3HHH A;  3RIR A;  1YG2 A;  2W7N A;  3J80 K;  1PUE E;  2IA2 A;  2QF7 A;  5K5R A;  1VQP I;  4N0B A;  3BPX A;  1EF4 A;  3OS2 A;  2JSC A;  2P4W A;  4BQQ A;  1W7P B;  5IT3 A;  1RKW A;  1Y8R B;  4IHY A;  1NH3 A;  3ZP5 A;  2LBF B;  1BC7 C;  1IW7 F;  3BZK A;  3PNY A;  1BI2 A;  1TZL A;  3CUO A;  3QU6 A;  4ZYE A;  4NC8 A;  3GFI A;  2HYF A;  1A6Q A;  1MJB A;  2WAQ N;  4I0A A;  4PJN A;  3RI4 A;  1QHG A;  3LQQ A;  2DMT A;  3HOU J;  2YU3 A;  2DT5 A;  1JKO C;  2DTZ A;  1IV6 A;  2H27 A;  2UWM A;  1VQK I;  5AIQ A;  5K7Z A;  4MNU A;  3H36 A;  1X1P A;  3ZQC A;  2MAB A;  5IP6 A;  4KT5 C;  2VQG A;  3G71 I;  2DCE A;  1MBH A;  2IGM A;  1AKH A;  2QZ8 A;  2OU2 A;  3Q9S A;  3DCF A;  3BPV A;  4BY7 J;  1X1D A;  2A3S A;  2G7U A;  2I5U A;  2M45 A;  4A3G J;  3J7Y J;  1V5E A;  1X2M A;  2KJB A;  3DQV C;  4RB2 C;  3HDD A;  2BGC A;  4ETS A;  3CO7 C;  1J59 A;  5B66 C;  3R0J A;  5GAH J;  3S15 J;  1IXC A;  1EA3 A;  1TW3 A;  2GLO A;  1OMI A;  1WI9 A;  5FKK A;  3OYI A;  2IXS A;  3S16 J;  2Z2S B;  2IA1 A;  1Z6T A;  4ENN A;  3AG2 H;  2WAF A;  2EV6 A;  2Y75 A;  5JFR A;  2CQN A;  1WKM A;  5TGT A;  4BL0 B;  3WOD F;  1Z9C A;  4KIG A;  4YG2 F;  1EKE A;  5KNL A;  2MBF A;  3DPU A;  2R5Y B;  2Z5U A;  2VLA A;  2LR8 A;  3IUO A;  5E17 F;  4I0B A;  3OV8 A;  5BOX A;  4L18 B;  2RVC A;  1A35 A;  5CVJ A;  4I2O A;  5M5W J;  3G4S I;  1TQP A;  3AFH A;  2FNP A;  3MZ8 A;  4YEL A;  4ESB A;  3KE2 A;  2A6E F;  3M4O J;  3TP3 A;  3FIS A;  1IC8 A;  3OSG A;  2B9S A;  2ZME C;  2MD0 A;  2BE5 F;  3BR6 A;  2HKX A;  2CQK A;  4GO1 A;  1B4A A;  1T0F C;  2M9H A;  3HXL A;  1BC8 C;  4HDV A;  1XGN A;  3IH4 A;  2A6H F;  3ZMU A;  1ULY A;  2QQA A;  3OIP A;  4N9I A;  4P96 A;  3SZG A;  4XSZ F;  4UHT A;  2O7O A;  1BI1 A;  2IVM A;  3FXK A;  4LG3 A;  4RBO A;  1QNT A;  5DCM A;  3LWF A;  3EUH C;  2OTJ I;  2FRH A;  1OR7 A;  3FIW A;  4PJJ A;  5CLS A;  1P4A A;  3J80 Z;  1YI2 I;  1W5C C;  4BGD A;  3ZQG A;  3M07 A;  4IHW A;  3FXL A;  2NS7 A;  3K1P A;  1HXD A;  2BW3 A;  3LOC A;  3QOD A;  1GDT A;  2VBY A;  1MKM A;  2HYG D;  3VSL A;  4LG0 B;  1B72 A;  3S93 A;  5GPC A;  2WAD A;  1S72 I;  5K1Y A;  4G6Q A;  3CUQ C;  3QP6 A;  5ICC A;  1IXR C;  3LSJ A;  4B1R A;  3OYJ A;  2XHK A;  3FZV A;  1YQA A;  2XB5 A;  2I8D A;  2XF7 A;  3OYF A;  1XGO A;  1MMA A;  1N75 A;  1IUY A;  3DBR B;  1BBY A;  1ZRE A;  2CUZ A;  3X2Q H;  1LFU P;  1MIJ A;  2XV4 S;  4Z2Y A;  3H1C A;  1ETY A;  4LMY A;  3BTJ A;  2EZH A;  1R58 A;  1IXS B;  2HXO A;  2OBP A;  3LFK A;  5J4Y A;  3EDP A;  3V4G A;  4F92 B;  2M7B A;  5CJ9 A;  4BHB A;  3I3L A;  3U2R A;  1ZHF A;  1L3L A;  1IAW A;  5KAF C;  1ZH5 A;  3CJN A;  3MQ0 A;  1IZ1 A;  1DDN A;  2EPF A;  2VE8 A;  4MQ9 F;  2E1N A;  5EGO A;  4AID A;  1C0W A;  3F8M A;  3RKY A;  3KEY A;  2D1H A;  2YSR A;  3I59 A;  1WFX A;  3F6O A;  3LMM A;  3FDY A;  3DLA A;  4LIT A;  1HDD C;  3K10 A;  5DV5 A;  2KZG A;  4A69 C;  3FMS A;  1XSD A;  3ELK A;  2OPT A;  2EIL H;  4DYC A;  3BR3 A;  2A5W A;  2O6G E;  2Y30 A;  1RIO H;  4BNC A;  3VDX A;  4C2M J;  1U5T C;  3CCS I;  4WXC A;  4ZDP A;  4YFN F;  3K7A J;  3CCQ I;  5DTD A;  3BG9 A;  3TOB A;  1J09 A;  2LC2 A;  5FRO A;  1RUN A;  3Q0U A;  4YIR X;  4HQE A;  3QOE A;  2H1K A;  3HGY A;  4XIC A;  2PLY A;  2NAZ A;  2WY8 Q;  2BVL A;  2QSH X;  3BR0 A;  4ON0 A;  1YIT I;  1B6A A;  3G1M A;  3F3X A;  3GXO A;  4GGG A;  4L9J A;  5L3G A;  3PUF A;  3T1B A;  3OYB A;  2H09 A;  1OCP A;  3SDG A;  5EEA A;  1I27 A;  2KJC A;  4HBL A;  1HKS A;  1J9I A;  1ZGJ A;  1BW6 A;  3MWM A;  3H3V K;  5HDG A;  1R22 A;  1WPK A;  4BXU A;  2DQL A;  3DLL F;  4A93 J;  3OYN A;  2Q2E A;  4JX6 A;  3GTG J;  3ABK H;  1SC7 A;  4KIB A;  3S2D J;  1LE8 B;  1TLH B;  2IPQ X;  5BNG A;  5HVQ C;  2QSF X;  3BTI A;  1D0Y A;  2EWN A;  3MFK A;  3HTU A;  4U0Y A;  2BHZ A;  2W57 A;  4IHT A;  1FPQ A;  2N8G A;  4IO9 F;  2HTJ A;  4XNF A;  2Z33 A;  1D5Y A;  1K6Y A;  2CMP A;  1V5G A;  3KLO A;  2X0L A;  4EGY A;  3K1M A;  4NUB A;  1BR1 A;  5D5V B;  5M3M J;  3ZGK A;  1J2X A;  4MLO A;  5FKM A;  2FOK A;  3RYP A;  3ZN1 A;  5C44 J;  5KHD A;  3QWL A;  3TO9 A;  3BG7 A;  4WXH A;  1R36 A;  1OJL A;  2JPC A;  2QVO A;  3DWL E;  3GF2 A;  3K1N A;  5E18 F;  4HAM A;  2QBY B;  2ZFU A;  2G0E A;  2W84 A;  2EFW A;  2UUZ A;  4BE0 A;  1W4M A;  4A3M J;  1WCM J;  2QSG X;  3E5Q A;  4CCN A;  4C3H J;  4B3X A;  1A5J A;  3T8R A;  4ZDL A;  3JAM Z;  1FYK A;  2JRM A;  1H9G A;  2E5N A;  3ABU A;  3HKZ A;  4ZC3 A;  2CV1 A;  1RPW A;  1XGM A;  4A0X A;  1LDD A;  2VT3 A;  5IY5 H;  3CCJ I;  2CH0 A;  2FSW A;  4IOA F;  1I3Q J;  1YX3 A;  1AOY A;  3BP8 A;  4A6E A;  4O6J A;  1YRN A;  4KDP A;  2QWW A;  3S3N A;  3S1Q J;  3RYR A;  2M4K A;  1J5Y A;  5HNF A;  4HX7 A;  3LAJ A;  4PFP A;  2VOO A;  1U0J A;  4IXA A;  2LRE A;  3CC4 I;  5EEH A;  3HC7 A;  2V6E A;  3FXR A;  5E8G A;  3CLQ A;  3WTX C;  1P7I A;  4A0Z A;  5KCM A;  4XR6 A;  1H88 C;  1KU2 A;  4XN3 A;  2W82 A;  4AUX A;  2R7Z J;  3JRI A;  2K3F A;  4NC7 A;  2DFH A;  4P9F A;  2K9M A;  3JRF A;  2KIS A;  4XSX F;  2QQ9 A;  5FFZ A;  4I6Z A;  5BPI A;  2W24 A;  3H9G A;  3QYF A;  4WXD A;  5F0C A;  3M1E A;  1YYV A;  2RRE A;  4E7I A;  1N25 A;  1XB4 A;  2YPR A;  4MGR A;  1Z91 A;  1E3P A;  1WJ5 A;  4BHC A;  5DEQ A;  4CH7 A;  3I58 A;  2FUG 2;  3ERE D;  4AVP A;  4EM1 A;  2GOM A;  1D0Z A;  4L5I A;  2VC1 A;  1J7K A;  4ABZ A;  5IYC J;  2ACJ A;  1I39 A;  5HNH A;  4JX5 A;  1R49 A;  1FC3 A;  1FEX A;  3QQA A;  1IN8 A;  3MKL A;  3GTL J;  1D1A A;  1I50 J;  1X4P A;  3PQK A;  3H3U A;  1R1U A;  4HA8 A;  1A31 A;  4A3B J;  2PJR B;  3R0A A;  5HDN A;  3K4M A;  4HX8 A;  1YJN I;  1FX7 A;  1U9N A;  5FKL A;  4EJU A;  1KQ8 A;  3HYI A;  1ETV A;  1Z6R A;  2L02 A;  1TW2 A;  1MBK A;  1T2K A;  3RTR A;  4S0H B;  5D8L B;  3JRG A;  1PVE A;  5FLM J;  4E7K A;  2JA8 J;  4KUM A;  2STT A;  4DNC A;  4EQQ A;  5E79 C;  4YRV A;  1OFC X;  2F6C A;  3PM1 A;  1Z67 A;  1VTN C;  2PN6 A;  2ZJQ F;  2O0Y A;  4DZP A;  1U5T B;  4WCG A;  1BN5 A;  2YX7 A;  4H4K C;  4XLH A;  2M30 A;  3P5J A;  2CFX A;  4KYW A;  3J81 K;  5IYD J;  3VSK A;  2K7L A;  3TW7 A;  2LKS A;  4UV9 A;  4CIC A;  4FAS D;  3OS1 A;  2ME6 A;  2JMW A;  3GVA A;  1EJ9 A;  2A6T A;  1USS A;  2V1N A;  4PUS A;  3SFI A;  1JKR C;  3DFG A;  4IJA A;  3CJR B;  4EAT A;  1RI7 A;  1VQM I;  1QZE A;  1ZN2 A;  5ILU A;  3I53 A;  4A3F J;  3ZXS A;  3W6K B;  3E6C C;  4GFB A;  2H8W A;  3A01 A;  2JQ7 A;  2OD5 A;  1W0U A;  3IRR A;  4EM2 A;  1XD7 A;  2XKP A;  3DV8 A;  2DPD A;  1H89 C;  3K2Z A;  5F27 A;  3K4K A;  2XAH A;  3V42 A;  1Z1D A;  3OYC A;  3HIF A;  1D1C A;  1WRJ A;  2CGP A;  4LK1 F;  1HOM A;  4D0P A;  3FHZ A;  1ZTR A;  2DOF A;  4MIM A;  2LH9 A;  4C3I J;  1VQ8 I;  5M3F J;  1F36 A;  1SD4 A;  4PJ0 C;  4MHG A;  3CP8 A;  1F43 A;  3RKQ A;  1S3J A;  4XK4 A;  2RN7 A;  2XSJ C;  1S5L C;  4XBF A;  3UNG C;  3SFZ A;  1TT0 A;  1U78 A;  2Y9Y A;  3AAF A;  2ZC2 A;  2LG4 A;  4CYC B;  2CW0 F;  1LEB A;  2VC0 A;  4QWQ A;  2CG4 A;  3RDI A;  2FEZ A;  1T56 A;  4LJZ F;  4RAY A;  2XB0 X;  4RMN A;  3G6E I;  3F21 A;  3CO6 C;  2A07 F;  1W5T A;  2R93 J;  1OIS A;  2YR2 A;  5FLX K;  3J7A O;  3VOE A;  5EZG A;  4OIR F;  2VJ4 A;  4BQO A;  2OF7 A;  1R7J A;  1NK3 P;  2DDB A;  2FE3 A;  1Z0X A;  2KFD A;  3F6V A;  2EK5 A;  4C2T A;  4FE7 A;  3TL4 X;  5H6Q A;  3Q0W A;  2XGD A;  3I9V 2;  1RET A;  3KX2 A;  1V5F A;  2JJ7 A;  1R23 A;  5TRD A;  3QYB A;  4DBR A;  2ADU A;  5E3M A;  3I4P A;  4G9Y A;  3H5A A;  1MH3 A;  3KP5 A;  3S2W A;  2X4H A;  2WTE A;  2P7C B;  4MTD A;  2KMU A;  2GXA A;  2P8T A;  4V2F A;  2P6S A;  3HOS A;  4RS8 A;  4CHU A;  2MW8 A;  4E7J A;  1W0T A;  1HDP A;  4ITV A;  1G3S A;  3BZC A;  4GXO A;  4JBA A;  2DA7 A;  1TWH J;  3K4C A;  2DMQ A;  1WZ2 A;  1UAA A;  4DBQ A;  3JW4 A;  1MMN A;  1D3Y A;  1DUX C;  3PQJ A;  4CA0 A;  1UZC A;  2K4B A;  1YTY A;  3NQO A;  1V54 H;  2Z9O A;  2HDD A;  5JLX A;  3PO3 J;  2E2H J;  3JSP A;  4IHX A;  2EA4 A;  1A36 A;  2E71 A;  1R6R A;  3PSF A;  4RGX A;  2VXD A;  3WHC A;  1OCZ H;  1ZAR A;  4P9U A;  3KP7 A;  1ZLK A;  2VPL A;  4XL9 A;  5ICF A;  3GLX A;  3HOV J;  3H9Q A;  5EJC A;  2M1B A;  2RC4 A;  3J81 Z;  1IV8 A;  5GTH C;  3HSR A;  5JHU A;  1O4X A;  2CRG A;  2RGV A;  3ABT A;  3R61 A;  2HS5 A;  3I5U A;  4A6D A;  1LB2 A;  1W7P A;  4LB6 B;  3OS0 A;  1IF1 A;  2LDU A;  2YU9 J;  4OAZ A;  4RM3 A;  5GAE J;  5L3F A;  4AYB A;  5H2F C;  4O5V A;  2R3S A;  2WB1 A;  3ABM H;  4A3I J;  2L5Q A;  3OIQ A;  4HST A;  3ZPL A;  4LOC A;  5EDN A;  2CYY A;  2P5V A;  1GXP A;  5FKO A;  4M3D A;  1A04 A;  2E5Z A;  1TWA J;  2LMD A;  4G8X A;  3RJP A;  2FBH A;  2JK3 A;  2O8K A;  2KRH A;  2H94 A;  2F4O B;  5E1W A;  2R7S A;  3N4M A;  2PG4 A;  4UVA A;  3MN2 A;  3BWG A;  3PFI A;  4XM3 A;  4A3L J;  2AS5 F;  4Y52 J;  1DQU A;  1GVJ A;  2HVQ A;  4DW6 A;  1FYL A;  4LIV A;  3HGG A;  2DA1 A;  3T5X A;  1IJW C;  3FM5 A;  3MAJ A;  1ZG3 A;  2OTL I;  1B9N A;  3TW6 A;  1XX5 A;  4CDG A;  3NWS A;  4WF2 A;  1ETX A;  4RB0 A;  3Q3S A;  3ECO A;  5CVV A;  3TOA A;  1ZR4 A;  1WQ2 A;  3H0G J;  1XPX A;  3A4C A;  1K61 A;  1F5T A;  4HRI A;  1ACI A;  4ZYA A;  1IRX A;  5FLX Z;  1UMQ A;  1XCB A;  3R4K A;  3LSI A;  3R60 A;  1BR4 A;  2ZXI A;  4JX4 A;  3DKX A;  1D5V A;  1VQO I;  4KNY A;  1HKQ A;  1EH7 A;  4GYI A;  4MO7 A;  2QKL B;  3D1N I;  4F55 A;  2MLK A;  3RQI A;  4D7N A;  1CGP A;  1NK2 P;  2LSO A;  2HI3 A;  2XDV A;  1RZ4 A;  3E7L A;  5GAG J;  4II2 A;  1XMA A;  3P9I A;  1FBS A;  4GCV A;  2VPR A;  1UJ8 A;  3FK6 A;  3L2R A;  4C2U A;  1V4R A;  2VL8 A;  2ME0 A;  3E1S A;  3M8F A;  4XOP A;  5GP9 A;  2R7V A;  2RAE A;  4CCL A;  1S7O A;  2FMY A;  4EJW A;  1IN7 A;  1B8I A;  3ISP A;  3VWB A;  3OR1 C;  3S3M A;  5DS9 A;  2LF7 A;  1KU3 A;  2EA2 A;  4WX9 A;  3KYC B;  3HRU A;  1ERD A;  4BE1 A;  3F9K A;  5HLG A;  1ZYR F;  5GTI C;  4D1Q A;  3L9F A;  3RPU D;  4QIW N;  3AL0 C;  1VQL I;  4LD5 A;  1UFM A;  3HUG B;  1QPM A;  1YIJ I;  4B8X A;  3WTT C;  4D9J A;  5D4R A;  1JHH A;  3OOP A;  1ONV A;  4G6D A;  4F7Z A;  2QQ8 A;  1JGS A;  2VKE A;  3KP4 A;  1KQ0 A;  3CCL I;  3GME A;  4RAZ A;  4NQW B;  5DUK A;  3BTC A;  1R5I D;  1LQ1 A;  1FSE A;  5BPD A;  2K9Q A;  2EV0 A;  4XKB A;  1ZR2 A;  5B3S H;  3NAR A;  4FQG A;  3W2A A;  5CPR B;  3EQL F;  3CDI A;  3GTP J;  3HSF A;  2L3D A;  2Y48 A;  3BG6 A;  3SQN A;  2P7V B;  4YIF A;  2DBB A;  2ELJ A;  3CDH A;  4BH9 A;  4EM0 B;  2X1E A;  3NAU A;  1KYW A;  1Z7L A;  1WJB A;  1ODD A;  2GIZ A;  4XLC A;  2M8G X;  1Z3X A;  3IAS 2;  1BW5 A;  2A68 F;  1HSJ A;  4B43 A;  3PIP F;  2WY7 Q;  2Y2Z A;  2A69 F;  3QOP A;  2A05 A;  5CQE A;  2IGK A;  1ZG1 A;  2R5Z A;  1Z21 A;  2ECB A;  4XRS A;  1K4S A;  3U1D A;  2R7T A;  4XRM A;  2VJI A;  2M8E A;  5F1J A;  1U8B A;  4HPQ A;  2BYV E;  2OCC H;  3HKZ N;  4W1U A;  3TO7 A;  4RGU A;  2XRL A;  3DXJ F;  3GFL A;  2HQR A;  5K7F A;  1XC5 A;  5E1X A;  4AU7 A;  1DPU A;  1PYV A;  4P5O A;  1PP8 F;  3IRQ A;  2L4M A;  1ZRD A;  3C7J A;  3GBG A;  3GTO J;  2R7U A;  1KON A;  4UB6 C;  4FT8 A;  3IAM 2;  2P0W A;  3ZRG A;  4HF0 A;  3KCC A;  3HOW J;  1U9O A;  3VB2 A;  1ETW A;  2LY9 A;  2QGU A;  1U2W A;  4M9Z A;  1Z05 A;  2HWV A;  3TP0 A;  5HLH A;  2OV7 A;  1SEU A;  4MEX F;  1SD6 A;  1T39 A;  3RZO J;  2DO7 A;  4RM2 A;  3KZZ A;  4U7D A;  5L3D A;  4CXF A;  1ETQ A;  4J01 A;  1LNW A;  2GAU A;  1F4K A;  1UG2 A;  2E1O A;  1TP4 A;  3L2C A;  1XDU A;  2K86 A;  4LFU A;  2X85 A;  2IT0 A;  3KP6 A;  3DU6 A;  4GRI A;  1SFO J;  1JJ6 C;  4CCM A;  2JA5 J;  5IOY A;  1BOA A;  4IVN A;  3VPR A;  4XQF A;  2K3P A;  3JRE A;  1R5H A;  2DA3 A;  1BOB A;  4KN4 X;  1MMS A;  4M3G A;  3QPL A;  4C3J J;  2GXG A;  2HOS A;  1Z7U A;  2LVS A;  2ICW G;  1D1B A;  1YE9 A;  2CWE A;  1BL0 A;  2Q0O A;  1FOW A;  2LD5 A;  1D8K A;  2YX4 A;  2UZK A;  1BI0 A;  3WTU C;  1YW9 A;  1G59 A;  2VN2 A;  2KIF A;  2LK2 A;  2ZO4 A;  2ELH A;  4LB5 A;  4A2U A;  2O03 A;  3O6B B;  1FIP A;  3ZMZ A;  1REP C;  1Y0U A;  2GZW A;  3K70 D;  2B63 J;  3IWF A;  2IJL A;  1FOK A;  3I4N J;  3BTL A;  1RC9 A;  1YO5 C;  1XMK A;  5C4J J;  3VYR B;  2LKX A;  1HCR A;  3JAM K;  2F5D A;  1G2H A;  2BY3 A;  2GOX B;  4RAF A;  1E3H A;  2VAS A;  1O3Q A;  4AVZ A;  1JTY A;  2WAE A;  4XKW A;  1LE8 A;  1F1Z A;  3MD2 A;  3HOT A;  2NYX A;  1XN7 A;  3ABL H;  3MVP A;  3OYH A;  5ED4 A;  1JXS A;  3L2U A;  2X6O A;  4PDK A;  4X1E A;  3W2W A;  4YEJ A;  5D5X B;  3OL3 A;  1YS6 A;  3SXY A;  3GZ5 A;  3LQR A;  3TDZ C;  2B7E A;  1UHS A;  2HU9 A;  2VUM J;  2XSD C;  3LFU A;  1RR7 A;  2MFZ A;  4LLN A;  2L54 A;  2XF5 A;  4DYR A;  2HVR A;  3GTQ J;  4G12 A;  1FT9 A;  2HKO A;  3I4M J;  3B6A A;  2LRD A;  3E0J B;  3QU3 A;  4LGW A;  3AG4 H;  2M3A A;  3H9J A;  1P6R A;  5F04 A;  1RES A;  1ZAO A;  2LFB A;  3NWT A;  2JSP A;  3K70 C;  1DP3 A;  3EUK L;  2K5C A;  3U1K A;  2L01 A;  2F4I A;  2RDP A;  3C3W A;  1K7A A;  2XC7 A;  1YLF A;  5DCM B;  2ZME A;  4YFK F;  3HOZ J;  1SFK A;  3QP5 A;  5E3L A;  5JVT A;  2LLK A;  1T0F A;  4L5J A;  2V9V A;  3TED A;  3BCA A;  3JRB A;  5ERI A;  5DM7 F;  3AL0 B;  4I7H A;  5D6E A;  2DJI A;  2M7A A;  3WGI A;  2DOD A;  4NDL A;  2V1X A;  2XPU A;  4YII A;  5CVU A;  1B72 B;  4ENJ A;  1UHW A;  2LY2 A;  4OMZ A;  3U21 A;  4M3F A;  1B9M A;  3CMM A;  3TKY A;  2MD5 A;  3EUH A;  3OR2 C;  2PX9 A;  2DI3 A;  2DTR A;  3KPH A;  5HLT A;  1OYY A;  3OL4 A;  4G7Z F;  3KYL A;  5FFX A;  2ZXH A;  1IG7 A;  1IDZ A;  2NVU B;  2V4J C;  3FMR A;  4IKF A;  4CCK A;  1XS9 A;  3SEZ A;  4MEY F;  4XKV A;  1S7A A;  2ZFW A;  3D5R C;  1D8J A;  2GIV A;  4Y13 A;  1HW2 A;  3WTW C;  4Z6Y A;  4GDF A;  2DK8 A;  2V9P A;  3CUQ A;  1VZ0 A;  3DBL B;  2BBY A;  3I71 A;  2VOD A;  4BE2 A;  2VB6 A;  1WJA A;  3ZOB A;  5BS6 A;  2MH2 A;  4ZJZ A;  3N97 A;  1J0R A;  4FHT A;  5HS7 A;  4A3J J;  3WE3 A;  1HST A;  3PUB A;  2IS2 A;  2ESH A;  4PSX A;  1R9T J;  1JHF A;  5DCF A;  3WTZ A;  1SVL A;  4QLC U;  1E17 A;  4R8H A;  2MH9 A;  3ZQI A;  5J1U A;  2VIX A;  3ZMD A;  3JRD A;  3S1N J;  4XLE A;  2XAS A;  5EGO B;  2IBD A;  4BQN A;  2R7F A;  3ML6 A;  3GCM A;  5AIP A;  4NB5 A;  1VQ4 I;  3WTS C;  2QEX I;  4FCY A;  1KU9 A;  1T33 A;  2DA2 A;  5J1R A;  2ZJR F;  2AQE A;  3V8L A;  2NXN B;  2E2I J;  2M4G A;  2EZI A;  3BLY A;  1E0E A;  3H3Z A;  2PI0 A;  3A0B C;  2L9V A;  2FJ1 A;  4J19 A;  5E3O A;  1FNN A;  1H8A C;  3CZ6 A;  2QCO A;  4XMY A;  2A5Y B;  2DPU A;  3CC2 I;  3MZY A;  4B3A A;  2NS0 A;  5IP9 J;  1WH5 A;  3NEU A;  2DK5 A;  1EH8 A;  3L2Q A;  3JTH A;  3ASO H;  1MDM B;  2L0K A;  1K78 A;  2HQN A;  4XOT A;  4A5M A;  4BJ6 C;  1RRJ A;  1U8R A;  1R00 A;  2KIQ A;  4HDU A;  3E6B A;  2ZCW A;  2G7H A;  1KU7 A;  2HR3 A;  3ZR8 X;  1HF0 A;  1JUP A;  4CZC A;  2XRN A;  3GWZ A;  1VFC A;  4AYB N;  4FX4 A;  2DOE A;  4HOB A;  2E19 A;  2WB1 N;  2L7K A;  2RQP A;  1YW8 A;  3GZ6 A;  1RR8 C;  3OMY A;  5ILS A;  1T95 A;  3M7G A;  5LHH A;  4E7L A;  1TNS A;  2DMU A;  2FA5 A;  4TV7 A;  1GXQ A;  1UEL B;  2RV8 A;  2ID3 A;  2ZJP F;  1MNM C;  4PK4 A;  1MND A;  4FET A;  1DGR M;  2HZD A;  2Q1Z B;  3G3Z A;  1QVT A;  2Q2E B;  3LSP A;  3OYD A;  3MEX A;  2IS1 A;  3GTM J;  1V3F A;  3BR5 A;  1JT0 A;  2ZKZ A;  1SFE A;  4Y4R A;  5FB2 A;  1SD5 A;  3A2K A;  1R4N B;  3H92 A;  3TDU C;  4L9T A;  5LEJ A;  5K7H A;  2DYS H;  3K4N A;  3AG3 H;  3BCB A;  2GA1 A;  2VKV A;  3DPT A;  5IPA A;  4HNT A;  5L3E A;  2E35 A;  4G94 A;  4M71 A;  2V7F A;  1PJR A;  3BZ6 A;  1WJE A;  1XSX A;  5A2Q K;  2NNY A;  2H8R A;  2QUF A;  2BEO A;  4CYC A;  5HDK A;  1NG6 A;  1Q1V A;  2VI6 A;  1WSU A;  4BDY A;  3K2A A;  1IO2 A;  3DTI A;  4DIQ A;  2DA6 A;  3PJR A;  2EFN A;  2YUS A;  2JUG A;  1YHQ I;  2KPM A;  2MSY A;  4NBQ A;  2WV1 A;  3K4L A;  3M8J A;  1OCC H;  2OA4 A;  3HM5 A;  2M5W A;  1IN6 A;  3BC8 A;  2HOA A;  2PMU A;  2RNG A;  2KIU A;  1D0X A;  3L1P A;  4ANJ A;  2FBK A;  1T38 A;  3UKG A;  1ETO A;  4QSH A;  3BQY A;  5FO5 A;  3CCM I;  3DU5 A;  1XMX A;  1G3Y A;  5DYM A;  5J4V A;  2B0L A;  5ICG A;  5F08 A;  4XOR A;  1K4T A;  3J7Z I;  3SHF A;  1NHA A;  3IH2 A;  1YRN B;  1ZQ3 P;  2JUC A;  1J75 A;  3VYS B;  4RLQ A;  3OYM A;  4HX4 A;  2JWT A;  1QA6 A;  1MMD A;  1X2N A;  3VYU B;  4UUS A;  1U3E M;  3ZN0 A;  1LDK B;  4AC0 A;  5H20 A;  2VQH A;  3HHG A;  1LJ9 A;  3ZQH A;  3BG5 A;  1LFB A;  2RQQ A;  2LTP A;  4XON A;  3CD6 I;  2WWY A;  2CUE A;  1BA5 A;  3U9G A;  1PUF B;  5J6X A;  1W5S A;  1FIA A;  3H5N A;  2F48 A;  3JR9 A;  1ZK8 A;  4A3E J;  4DGW B;  2HDC A;  2Z1D A;  3TQN A;  1GUU A;  1Y0N A;  2JZY A;  5E3N A;  4R1H A;  2FU4 A;  2KDZ A;  1Z3Y A;  3P9K A;  3HB9 A;  2HVS A;  2HXI A;  3ULQ B;  4XN0 A;  2ZXW H;  4E6K G;  5JI6 A;  4ZYH A;  5B1A H;  1OQY A;  2OC6 A;  1FOX A;  2JTV A;  4HZF A;  3RCO A;  1E2X A;  5F0H A;  1DGW Y;  2E1M C;  1YJ9 I;  3E5X A;  3B6C A;  1ORK A;  1B59 A;  4Q48 A;  2HZT A;  2Z16 A;  5FGM A;  4HF2 A;  5JR3 A;  1N77 A;  2EBI A;  2CQQ A;  2KQR A;  3ZQF A;  2HFH A;  2JA6 J;  1GV2 A;  2L7F P;  4CGZ A;  4MFD A;  4PJM A;  2DN0 A;  1TQM A;  1SAU A;  2DDA A;  3KLN A;  4UUT A;  2J5P A;  3WGH A;  1X58 A;  4IX7 A;  3GX4 X;  1ZKG A;  2BXZ A;  2LOO A;  5ICE A;  4IZZ A;  1BIB A;  4JYK A;  2BY1 A;  2K40 A;  1ZGA A;  2XAQ A;  4EJO A;  3HEF A;  2ESN A;  3JRC A;  5A2Q Z;  4Y3O A;  4HV6 A;  4BAY A;  4BYY A;  1JKP C;  2EZL A;  1IUF A;  2X9D A;  4Y33 A;  3G1L A;  2LKP A;  2E7W A;  3DKW A;  2OAZ A;  1P4W A;  5EG0 B;  1E3O C;  3CLO A;  1ZLJ A;  4XRS G;  3H5R A;  3LAP A;  2IRF G;  2AO9 A;  3WU0 A;  3IHU A;  3HJE A;  5BQT A;  3K6G A;  1S29 A;  2DMP A;  3GO5 A;  4W97 A;  4C9Y A;  4AIK A;  4I99 C;  5D5W B;  4EJT A;  1MSF C;  4P1W A;  2K9N A;  2DW4 A;  4BEH A;  3S17 J;  2E34 A;  2R7X A;  3A01 B;  1RUO A;  3N05 A;  2VOP A;  4BJ5 C;  4DOZ A;  1SAN A;  2HOE A;  5J8F A;  3JRH A;  2E36 A;  2Y9Z A;  1CF7 B;  4ZZL A;  5HOO A;  1JJ8 C;  4M9X A;  2X6W A;  3CES A;  4U7B A;  2LBF A;  2CW7 A;  5F6F A;  1S6L A;  2G9W A;  4MFE A;  2ISY A;  3OWT A;  1WH7 A;  1PP7 U;  4AWX B;  2VT2 A;  2NVY J;  2ELK A;  5CYV A;  1XG1 A;  1T08 B;  2DOA A;  2VQC A;  3HBL A;  2QKM B;  2P5L C;  3E6D A;  5C4X J;  3L2W A;  3QRF F;  3VFZ A;  4BAC A;  2A61 A;  4B48 A;  3WE2 A;  1I3A A;  4B44 A;  3S1R J;  3F8N A;  3ZMS A;  4L0Y B;  1B1B A;  4PGG A;  3FXM A;  4IHS A;  4B09 A;  3ZQL A;  1T98 A;  3GFJ A;  1PDN C;  4DJA A;  2V1D A;  4U88 A;  4NQW A;  4X0G A;  1GLN A;  2M0M A;  3F8B A;  5KK1 A;  3S14 J;  4HQM A;  2FF4 A;  3RKX A;  2R7O A;  1A6I A;  5LHG A;  3BT9 A;  5HOD A;  2I10 A;  3BJ6 A;  3DTE A;  1MNE A;  2EFO A;  5CKT A;  1KZH A;  4FTH A;  1H9T A;  4GYG A;  3LSK A;  4XLP F;  1O57 A;  4IRG A;  2BVM A;  4UVB A;  3MCZ A;  3C2B A;  4H0E A;  3CMY A;  5ILV A;  2XIG A;  4M9S A;  4RGS A;  1X1B A;  1NG7 A;  2HOT A;  4M3E A;  5J8C A;  3KFW X;  2HQ5 A;  4CCO A;  1FYM A;  3O2P E;  1P9Q C;  2D5V A;  1YX5 A;  2F4M B;  5B1B H;  2LP0 A;  3LL7 A;  3LST A;  5LGU A;  5AON A;  2R5Y A;  4NC6 A;  3C1D A;  3I0T A;  4Y7N J;  1IRF A;  4A3K J;  1DU0 A;  1R71 A;  5HS9 A;  4CYD A;  3K9T A;  5DD4 A;  3VOD A;  4A12 A;  3CCR I;  2R7R A;  4PFO A;  2KP6 A;  1DU6 A;  1FSH A;  4B4C A;  2EIN H;  2JPB A;  4LK0 F;  3ZMT A;  1AWC A;  5JHF A;  3HTS B;  3W6J B;  1UHM A;  2XUB A;  2UXX A;  6PAX A;  2BZT A;  5JVG F;  3DF8 A;  4KT6 A;  4NHJ A;  4OIP F;  3PFY A;  1YS7 A;  2V26 A;  1TT5 B;  1OR7 C;  3ZQQ A;  1BIA A;  4BHP A;  4F52 A;  1IN4 A;  2K9S A;  4UVC A;  1Z77 A;  1ON1 A;  2YS9 A;  2ZSH B;  2EFQ A; 
#chains in the Genus database with same CATH homology
 4ZDO A;  1U0J A;  2GOX B;  2VAS A;  2LRE A;  4HG2 A;  4AVZ A;  4XKW A;  2WAE A;  3HC7 A;  3MD2 A;  4F3Q A;  2AQF A;  2V6E A;  3HOT A;  2LY1 A;  3OYH A;  4HSR A;  3L2U A;  5KCM A;  4PSW A;  3W2W A;  4YEJ A;  4XR6 A;  3OL3 A;  4XN3 A;  3VYT B;  2W82 A;  3DTK A;  3LSM A;  3HL2 A;  2HU9 A;  3LFU A;  5LD2 C;  2MFZ A;  4NC7 A;  2DXI A;  2XF5 A;  2KDO A;  2E1M B;  2K9M A;  3PNT A;  2CV0 A;  2HVR A;  4BUP A;  2HDW A;  3SYT A;  4F93 B;  2LRD A;  3H9G A;  3QYF A;  2WBM A;  3E0J B;  4BU2 A;  2M3A A;  1FMV A;  2RRE A;  2VKD A;  3H9J A;  4E7I A;  2IS4 A;  3FKJ A;  3NWT A;  2JSP A;  3K70 C;  1WJ5 A;  1DP3 A;  3EUK L;  4CH7 A;  2K5C A;  2FUG 2;  3RSN A;  3QYE A;  3MMY B;  3EUA A;  2F4I A;  2X1D A;  4JQF A;  2GOM A;  2XC7 A;  1D0Z A;  2JA2 A;  1SFK A;  4F91 B;  1N78 A;  4CSW A;  5HNH A;  3RQ4 A;  2XAU A;  3BCA A;  3AL0 B;  3C2G A;  4N4O B;  1D1A A;  4XLF A;  1X4P A;  2HPI A;  3LSG A;  2DJI A;  1WJF A;  2M7A A;  3EPZ A;  4J00 A;  2PJR B;  3K4M A;  3H35 A;  3H0D A;  3M1C A;  2LY2 A;  2IGO A;  3U21 A;  3CMM A;  1X19 A;  3TMO A;  3OR2 C;  3RTR A;  3L2V A;  2HPM A;  2X51 A;  5HLT A;  3OL4 A;  3ONQ A;  3KYL A;  2ZXH A;  4E7K A;  1UG0 A;  2HQA A;  2V4J C;  3DPL C;  4IKF A;  4CCK A;  3SEZ A;  4XKV A;  4YRV A;  2F6C A;  3D5R C;  3SEQ A;  1OLT A;  4H4K C;  4XLH A;  1VZ0 A;  3VSK A;  4BS9 A;  2L9S A;  2VB6 A;  1QHH D;  1WJA A;  4BE2 A;  2Y0S A;  4ZJZ A;  4FAS D;  3OS1 A;  2PMZ A;  3OYG A;  2CS3 A;  2A6T A;  3FBN B;  2V1N A;  4JOM A;  4PUS A;  3PUB A;  2IS2 A;  4PSX A;  3K4B A;  3CJR B;  4EAT A;  4KIT B;  2VIX A;  3UR3 C;  3ZXS A;  2VJ5 A;  4XLE A;  4BQN A;  4R79 A;  4LIU A;  1ZEL A;  4KJZ A;  3K4K A;  3AKZ A;  3S8P A;  3V42 A;  3OYC A;  1D1C A;  2AQE A;  2LH9 A;  4OWR B;  2M4G A;  4E4H A;  2MC4 A;  1LFP A;  4HNU A;  1AA7 A;  3BLY A;  1E0E A;  3CP8 A;  1LVK A;  1MW7 A;  2MYS A;  3CZ6 A;  2XSJ C;  3DEE A;  4XMY A;  3UNG C;  2F5V A;  1TT0 A;  3CP2 A;  3OY9 A;  2CW8 A;  2JVH A;  2LG4 A;  3PSI A;  4U87 A;  4BEH B;  3L2Q A;  2W7N A;  4RMN A;  4BXF A;  4XOT A;  4BJ6 C;  3OS2 A;  4BQO A;  2VJ4 A;  4BQQ A;  3J7A Y;  3ZR8 X;  4CZC A;  2ZSI B;  2LBF B;  4C2T A;  3TL4 X;  3PNY A;  3I9V 2;  1TZL A;  3KX2 A;  1V5F A;  4NC8 A;  3QYB A;  4DBR A;  2L7K A;  4PJN A;  3OMY A;  1QHG A;  3CJQ B;  3H5A A;  1T95 A;  4RLF A;  1WJD A;  4E7L A;  2UWM A;  2KMU A;  3HOS A;  2MAB A;  1UEL B;  4E7J A;  4II3 A;  3FHN A;  4ITV A;  4PK4 A;  1MND A;  2VQG A;  4FET A;  2K9L A;  1DGR M;  2O5R A;  4E7S A;  2DCE A;  2HZD A;  2Q1Z B;  2IGM A;  2Q2E B;  3K4C A;  3OYD A;  2IS1 A;  1UAA A;  1X1D A;  4DBQ A;  1MMN A;  4CA0 A;  4Y4R A;  1V5E A;  3A2K A;  3DQV C;  4KIS A;  4ZTJ A;  3CF2 A;  3K4N A;  3BCB A;  3DPT A;  4HNT A;  1WJC A;  1R6R A;  3PSF A;  2VXD A;  2V7F A;  1PJR A;  1EA3 A;  1WJE A;  4C30 A;  2VPL A;  2BW3 B;  4XL9 A;  2R7Q A;  3H9Q A;  3TBI A;  5LFA A;  1NG6 A;  3OYI A;  4BDY A;  2IXS A;  2Z2S B;  3DTI A;  4DIQ A;  3PJR A;  2JUG A;  2WAF A;  2X1C A;  2KPM A;  2CV2 A;  4BL0 B;  3M8J A;  3K4L A;  5TGT A;  3BC8 A;  3OS0 A;  5KNL A;  2W4S A;  3G2B A;  2RNG A;  2W00 A;  4OAZ A;  4RM3 A;  3DPU A;  4ZTF A;  1D0X A;  4ANJ A;  2VLA A;  3IUO A;  4AYB A;  1Y6I A;  2WB1 A;  2L5Q A;  3OIQ A;  2WAQ A;  4HST A;  3DU5 A;  3AFH A;  4YEL A;  2IGN A;  5FRM A;  2E5Z A;  4XOR A;  3OYA A;  3HPH A;  2KRH A;  2L2O A;  1W36 D;  3S32 A;  2R7S A;  3VYS B;  4RLQ A;  2MD0 A;  3OOU A;  3OYM A;  1JI8 A;  1MMD A;  3VYU B;  2KLO A;  2DT7 B;  1HA8 A;  1T0F C;  3HXL A;  1LDK B;  4XM3 A;  1DQU A;  2HVQ A;  1Y56 A;  2VQH A;  4LIV A;  2NOJ B;  3HPG A;  3OIP A;  2VQL A;  2X6Y A;  3SZG A;  2R7W A;  2RQQ A;  3NWS A;  3FBI B;  4XON A;  3DKY A;  3SDB A;  4LG3 A;  4BJT A;  3EUH C;  4PJJ A;  3H5N A;  3A4C A;  4HRI A;  4BGD A;  3D5L A;  1IRX A;  4ZYA A;  4DGW B;  2KZV A;  2Z1D A;  3LSI A;  3MKW B;  1BR4 A;  2BW3 A;  2ZXI A;  3DKX A;  3QOD A;  1Z3Y A;  2PJR A;  3VSL A;  2HVS A;  4E7H A;  3HG9 A;  4XN0 A;  2QKL B;  3S93 A;  2WAD A;  4F55 A;  2XDV A;  4E6K G;  4II2 A;  2OC6 A;  3RCO A;  3OYJ A;  1DGW Y;  2E1M C;  3L2R A;  4C2U A;  2VL8 A;  2I8D A;  2XF7 A;  3OYF A;  1MMA A;  4PJL A;  3E1S A;  4XOP A;  1W36 C;  1N75 A;  2Z16 A;  1N77 A;  2R7V A;  2KQR A;  4B47 A;  4CCL A;  2CUZ A;  4OAY A;  2L9N A;  4PJM A;  4QPO A;  3W3C A;  1SAU A;  3VWB A;  3OR1 C;  1X4O A;  2KL4 A;  4XKC A;  3S3M A;  3W2V A;  5CQG A;  4IX7 A;  1ERD A;  4BE1 A;  3ZCO A;  3F9K A;  2LOO A;  4F92 B;  2M7B A;  3A1Y A;  4IZZ A;  4CUG A;  4D1Q A;  3RPU D;  3I3L A;  3AL0 C;  4IQJ A;  1X1A A;  3HUG B;  3K4J A;  4D9J A;  4Y3O A;  3OYL A;  3KEY A;  1WFX A;  3LMM A;  4Y33 A;  3FDY A;  3DLA A;  4LIT A;  3K10 A;  4NQW B;  2JVG A;  2W1O A;  3H5R A;  1MMG A;  2A5W A;  3PNV A;  4XKB A;  3K6G A;  1QU3 A;  4C9Y A;  3VDX A;  4QPQ A;  2BOL A;  3IP4 B;  5CPR B;  3W2A A;  4HEA 2;  4P1W A;  2CFO A;  3D5S C;  4ZDP A;  4NNJ A;  2CUJ A;  4BEH A;  3BG6 A;  2R7X A;  2OUM A;  3N05 A;  2ELJ A;  4BJ5 C;  3S3O A;  4DOZ A;  2X1E A;  1J09 A;  2LC2 A;  2VKH A;  1Z7L A;  5FRO A;  1WJB A;  4XLC A;  4BDZ A;  1G8X A;  3IAS 2;  1Z3X A;  5HOO A;  3QOE A;  4B43 A;  2X6W A;  2V9K A;  3CES A;  2WY7 Q;  2WY8 Q;  4U7B A;  2BVL A;  2LBF A;  2CW7 A;  5CQE A;  1LKX A;  2IGK A;  3OWT A;  1Z21 A;  2IS6 A;  2R7T A;  2R4G A;  2VJI A;  3LSH A;  4N4N B;  3OYB A;  3PL8 A;  3C2H A;  4HPQ A;  2DOA A;  2VQC A;  4AU7 A;  1S9H A;  2QKM B;  1PYV A;  4P5O A;  3L2W A;  4BAC A;  3GBG A;  4B48 A;  2R7U A;  1KON A;  4B44 A;  3IAM 2;  2LYC A;  2P0W A;  3ZRG A;  2UV1 A;  2VXZ A;  4IQ4 A;  3OYN A;  2KHM A;  2VJJ A;  4DJA A;  2OV7 A;  4X0G A;  1GLN A;  2M0M A;  4G6T B;  4RM2 A;  5HVQ C;  1D0Y A;  4J01 A;  2R7O A;  3MKY B;  3DTE A;  4XLA A;  1MNE A;  4XNF A;  5CKT A;  4CCJ A;  2X85 A;  1K6Y A;  2CMP A;  1V5G A;  3DU6 A;  4GRI A;  4NUB A;  1BR1 A;  3OYE A;  4CCM A;  2X6X A;  3ZGK A;  3LSK A;  3OYK A;  4XQF A;  1BR2 A;  4MLO A;  4E7Z A;  2K3P A;  2BVM A;  2E60 A;  5KHD A;  2XF6 A;  1BOB A;  3BG7 A;  1X1B A;  1NG7 A;  3DWL E;  4CCO A;  2ZFU A;  1P9Q C;  4BE0 A;  1YX5 A;  2UUZ A;  3LL7 A;  1D1B A;  1YE9 A;  2DT6 A;  4CCN A;  4B3X A;  2KRC A;  4ZDL A;  1G59 A;  2E5N A;  3HKZ A;  4ZC3 A;  2CV1 A;  2R7R A;  4PFO A;  3K70 D;  2CH0 A;  2KP6 A;  1X1C A;  1YX3 A;  5JHF A;  2WA0 A;  1FMW A;  3S3N A;  4KT6 A;  2M4K A;  5FRN A;  3PFY A;  3ZQQ A;  2V26 A;  2HNH A;  1OR7 C;  4F52 A;  3MKZ A;  3VYR B;  5HNF A;  2ZSH B;  4PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...