2LBFA

Solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
molecule keywords 60S acidic ribosomal protein P1
total genus 18
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2011-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lbfA00
2LBFB 4BEHB 2W1OA 3A1YA 2LBFA 4BEHA
chains in the Genus database with same CATH superfamily
3KP4A 3H9JA 4NBQA 1U0JA 2AXTC 2JPBA 4QSHA 1LDDA 3N05A 1A6IA 1HA8A 3BG7A 4A0YA 2R7ZJ 3P9KA 2X1DA 3E5QA 4HPQA 5E1ZB 5FLVA 1YOVB 5F0FA 2LTPA 1LVKA 1WJDA 4Y13A 2LLKA 1R58A 3E3VA 1X2NA 2FBKA 3DPTA 2JSCA 4II2A 3IV5A 5ILSA 3ZMTA 1R00A 2R7WA 1B8IA 3TW6A 3ELKA 1D0YA 5J8FA 5CVIA 3X2QH 4ITVA 4ASNA 3HHGA 1ODDA 4IOAF 4CHUA 3QOPA 3GMEA 4UHTA 1U5TB 4XORA 2ELJA 3ZPLA 4ZJZA 5B3SH 4M74A 5KK1A 3WHBA 4OINF 3ZP5A 3C2GA 3ULQB 2W24A 3BJ6A 1O3SA 2EB7A 2VKEA 3BLYA 2CU7A 5M5XJ 4MQ9F 5E3OA 2XRNA 1JUPA 2KRHA 2VXDA 4RGSA 4LLNA 3LQQA 4A0XA 3EPZA 3BTLA 1IJWC 1W7PD 3MKWB 2UV1A 3DFGA 2RVCA 2W00A 3WTXC 3BR3A 3SZPA 1GV5A 3ZQQA 3IP4B 4EV0A 4MIMA 1P4XA 3AG1H 3PQJA 5EG0A 3BDDA 2X1EA 4BJ5C 2QKLB 4BEHA 5C4JJ 4Q5SF 3HTUA 2VT3A 2CQXA 4EM0B 1YS7A 4EM1A 1PVEA 2UXNA 1LDKB 3SEQA 3S2DJ 3KFWX 1GUUA 1VF9A 3GTLJ 4A3KJ 4U0YA 2YX7A 2E71A 2HYFA 3CJQB 4AU7A 1H9TA 1AWCA 1RR7A 4HNUA 2L3DA 4HQEA 2MLKA 5FRMA 3M4OJ 3A0BC 2ZXHA 5B66C 3OYKA 4I98B 3OIPA 3BY6A 4P1WA 4RA2A 4QWQA 1J09A 2DYSH 4UUSB 1UAAA 1T56A 1EV7A 3HOVJ 1ONVA 3Q0WA 1W36D 2HVQA 2KIMA 5LGTA 2XROA 3G73A 1LQ1A 3DWLE 5HS7A 4KISA 1TW2A 4IHVA 2NNYA 3RIRA 4BJTA 1RKWA 3TQNA 2MABA 2JQ7A 1QVUA 3CMYA 2JT1A 3T1BA 2OAZA 4EATA 3LSHA 3CUQC 3H36A 4BBRJ 3ABLH 4AYBN 1U9NA 2FE3A 2V9VA 4J00A 4ZTFA 5BS6A 1F4KA 2PI0A 1ETOA 3JW4A 1MZBA 3REOA 5M5WJ 3F72A 4FE7A 1K78A 4C2UA 4I01A 3SFZA 1JGSA 2VC1A 5CPRB 3L7WA 4PJ0C 4BJ6C 1O3QA 1TWAJ 1HDPA 1ZK8A 4ZDPA 3S1QJ 2R7RA 3VPRA 1JUMA 2XB5A 2DLLA 1WH5A 4CCMA 2BEOA 4CCKA 3C3WA 4M3DA 5TGTA 3K9TA 4XQFA 1G6NA 1NK2P 1SFUA 3HRSA 3OOPA 2AQEA 1OJLA 5JLXA 1FYLA 5FFXA 2HFHA 3DBHB 3TOBA 4LG0B 1OCPA 1B8IB 2COMA 3WU2C 4UV8A 1RETA 1U8BA 3CLOA 4BQOA 3GLLA 2W48A 5EEHA 2LKXA 1H89C 3C7JA 2QSHX 1P6RA 1UELB 5EZGA 1MBFA 2DJNA 1D8JA 3G2BA 3V7RA 1R1UA 2DU9A 4KYWA 5D6FA 5DM6F 1R7JA 1O7FA 2CV1A 2H6BA 4E7HA 2TCTA 5EF6A 1TC3C 4JOMA 3FX3A 3TL4X 3ZRGA 2K5CA 2DQRA 2LREA 4M72A 2DO7A 1A36A 3IAS2 3HSFA 4HSTA 3IWZA 2G7HA 4MNUA 4XLHA 5HLHA 1ZG5A 1LFUP 2NS0A 2XKPA 3BTIA 1MJAA 1MMAA 1I1GA 2XAQA 4B8XA 5FLXZ 3OS1A 1YJNI 3EUHC 3CUQA 1K78B 1H8AC 4F93B 2ZJPF 4P55A 1T38A 3ABUA 2DK8A 5K7FA 2EILH 2K85A 1QGPA 2AQFA 3H5AA 3PFYA 4XK4A 1R71A 4DYQA 2F5FA 1V5EA 5AIQA 4LFUA 2P5KA 1IGNA 2L4MA 5EGOA 4C9YA 2WTEA 4E70A 2VPRA 1X1PA 2XV4S 2ZNZA 1T0FC 4NQWB 1ETKA 1O3TA 3AKZA 2K9QA 1QRYA 2R5ZB 2DMNA 2HU9A 3Q0UA 2GIZA 5L3CA 1AHDP 3DKXA 3BPVA 4MQVA 2EQRA 4LG3A 2VBXA 4XONA 3MZ8A 1RKTA 3F3XA 4GFBA 3QPLA 1IDYA 4I76A 4BEHB 3JREA 2M2EA 2DXIA 1J7KA 4IKFA 2V9KA 1F9NA 4PSWA 1W1WE 3ZQIA 2MD5A 3BR2A 3F0CA 3H5RA 4XMYA 2VQCA 1X2MA 1DGRM 2VBYA 3CTAA 3JRFA 3CZ6A 3GEZA 4B4CA 2F4IA 4W97A 2OJED 4IHYA 5HNFA 3MWMA 3WG9A 2CUZA 3K4MA 1TWCJ 1MKMA 2CQNA 4RMNA 1IXRC 5D8LB 3SXYA 3IH2A 2R3SA 3Q0VA 4E7IA 1IC8A 3V7CA 4ON0A 2ECBA 4XSXF 4RAYA 2W57A 4C3HJ 3FXQA 4XKCA 3CCVI 3WG7H 5FROA 2P8TA 4MFDA 2WV0A 1YJWI 4UB8C 5A2QK 1NH3A 3UKGA 1C0WA 1R5GA 1IRZA 2WY8Q 5E3MA 4BE1A 2W25A 2HKOA 2M1BA 3IH4A 5L3DA 3PSIA 3WTVC 3H0DA 2LFBA 3P9IA 4KIGA 3ECOA 4LIUA 3CJRB 2CO5A 2VJJA 2ZBKA 2MYSA 3OL3A 1I3QJ 4G94A 3QQAA 2BY1A 4IQJA 3K69A 2DMPA 3KEOA 2NAZA 2KLOA 1A6QA 3TO9A 3JRHA 2Y2ZA 2X6YA 2X51A 3OYGA 1Y0UA 4U0WA 2FNAA 1MBHA 3PQKA 1LE8A 4BXUA 2YR2A 1X1BA 1BOBA 1ON1A 2DMUA 3DF8A 5K1YA 4UUTA 1MBKA 5IT3A 4RAZA 1OCRH 1T98A 3HGGA 2KISA 1J0RA 3HKZA 3WTYC 4IHSA 4CZZA 1P7IA 2R7XA 4PJNA 4N9HA 2A6EF 4PJMA 2O6GE 3KYCB 5HS9A 2WAQN 2DT5A 2I10A 4EJTA 4OIQF 4LJZF 1E0EA 1I27A 3QPTA 3F22A 4Y17A 1BW5A 2CW8A 1IRFA 2EFOA 1PJRA 4FTHA 2EWNA 2Z2SB 4M3BA 1OLTA 2L54A 2NYXA 3GCMA 4Y52J 3PFIA 4LLGF 2CV0A 5FKKA 3HHHA 2XSDC 3QAHA 1YRNB 4GGGA 4UXNA 5JLWA 5E1XA 3B6CA 3NWTA 1EJ9A 1F5TA 3RTRA 3O6BB 3GX4X 3W2AA 3GZNB 3PNVA 1LPQA 4KT5C 4ZTJA 3DPUA 1NG6A 1Z6TA 4C2MJ 4DQ2A 2CJJA 3D0SA 2R4GA 4C30A 3ZGKA 1CGPA 2PMHA 2ZJ2A 5DD4A 3BG5A 3ZMDA 1BOAA 4EVIA 5E20A 4NHJA 2ICWG 1OCCH 1K4SA 2QSFX 2XPWA 4D1QA 4Y33A 1XGNA 4G12A 1VQNI 2ZMEA 2PEXA 1HLVA 1FTZA 5DEQA 1YQAA 2JWTA 1Q1HA 1VI0A 1D0ZA 3O2PE 4TV7A 4Y4RA 4BHPA 2V9PA 2CW7A 1ZLJA 2HKXA 3HL2A 4A6DA 3VYSB 2VODA 1I6XA 3FF5A 4I6ZA 4RB1A 5LBQA 5ICGA 3CO6C 3VOEA 3GTKJ 2VC0A 1HKQA 1WJFA 4W1UA 2HYGD 3WHCA 5M5YJ 1VQMI 1HKTA 2FQ3A 1FMWA 5DDGA 3FHNA 1JGGA 2CUJA 3LSJA 2DFFA 3A01B 1VQ4I 2ZB9A 2FOWA 4L9VA 2PG4A 5E17F 3S3NA 1K7AA 1FSEA 1ZAOA 4XKWA 1OR7C 4HYEA 2V4JC 1JTYA 2ETHA 2ELKA 2VI6A 4L0ZB 4XR6A 3OR1C 2EPFA 4E7SA 5CQEA 4FT8A 1FOXA 3V7SA 2YPRA 5KVRA 4BE0A 2ID3A 2W4SA 2O8KA 2MSYA 5BPDA 3BG6A 3PNYA 2CWEA 5LHHA 4ZC3A 1W7PB 3HPGA 3S2HJ 3MVPA 3I9V2 1KQ9A 1V54H 3VODA 2ID6A 4K2EA 4UNOA 4V2GA 2P6SA 4P9FA 4GO1A 2R7TA 3NAUA 4S04A 4MEXF 2LYCA 3HJEA 4AM3A 2VOOA 3KP6A 3H0GJ 4Z2YA 5H2FC 3QPHA 3FHZA 4ZZDA 2DA7A 2V26A 3K4NA 2PBIA 5J40A 4XRSG 1BI1A 2VJ5A 3L2UA 3JSOA 4IO9F 1OYYA 1P9QC 4LK1F 3G1LA 2JA6J 3OYFA 1EH8A 2VB6A 2TDXA 1BJZA 2CFOA 2YU3A 1N77A 4CA0A 1LE8B 3EUHA 4U0VA 3IRQA 2E19A 4Y7NJ 3I56I 5BPIA 1BIAA 2L7FP 3CO7C 2STTA 3LA7A 1VQKI 1DPRA 4DW6A 1IXCA 2QVOA 2ME0A 3AG2H 2R7VA 2RV8A 4KDPA 3A01A 1WFXA 4D0PA 2HVRA 1HXDA 3DCFA 3U21A 1XX5A 1U9OA 3PJRA 1E2XA 3CQZJ 2LBFB 4CDGA 2L02A 1ZLKA 1QZYA 3J7YJ 1EH7A 2JK3A 2Y31A 1EH6A 4LITA 3AAFA 1YLFA 1B6AA 3L2WA 1OCZH 2A5YB 1W0TA 1WJCA 3C1DA 5BNGA 1SEUA 1ERDA 3FBNB 4ZYHA 3DQVC 3FBIB 3ZMSA 5ICEA 1SAXA 2A69F 4YIRX 1FPQA 1TL8A 2JVGA 2Y48A 2O3FA 2GOXB 2VQHA 4KIFA 1F36A 2Z5UA 3WTWC 3OYEA 4UVAA 5CQGA 5FFZA 1MDMA 3PIOF 5D5VB 2BXZA 5D4SA 1R1TA 1W36C 3HRTA 4L5EA 2WWYA 1VQOI 2OCCH 1R9TJ 2LR8A 2P6TA 4HX8A 3PL8A 2R5YB 1HOMA 4B47A 3CF5F 2DK5A 4U88A 5EGOB 3BZCA 3CCJI 2LSOA 2AXLA 4ESJA 4A3LJ 2M4GA 3M07A 4DZJA 2F2EA 4AVPA 4BHCA 3EQLF 4M3FA 2HZDA 5D4RA 2XAHA 1QVTA 1APLC 4OIRF 1UCRA 1XMAA 1TQMA 3LSMA 3FK6A 1O3RA 2HXIA 3CCEI 3CC4I 3QU6A 5GADJ 2EFNA 3SHFA 1JKPC 1YIOA 3GFLA 2DPUA 3JTHA 1KQ8A 1MBGA 4GXOA 2IA0A 2Z16A 3LQRA 4E6KG 2Q2EB 3S15J 1MGTA 3FK7A 4YG2F 1UZCA 2FEZA 3WU0A 4BKXA 4LMYA 5CJ9A 1TLHB 1TTYA 1ZRCA 3LAJA 5DV5A 3EYIA 3QP6A 2B9SA 5FGMA 4Q47A 4BS9A 2MH2A 4GDFA 3ZQ7A 4IZZA 5FD5A 2Q2EA 1MMGA 5IP9J 1USSA 4M3EA 2A68F 3TW7A 2R7OA 4IJAA 5K5OA 1P92A 1HQCA 5IOZA 4EJOA 4A3BJ 2OC6A 2BY2A 3W3CA 4A69C 3N97A 5E79C 1Z67A 2VASA 1YE9A 2BE5F 3K4BA 3QODA 4MLOA 4M9SA 3DBLB 2NS7A 3DU6A 3DKWA 3FM5A 3T5XA 1ACIA 2R5ZA 4XLPF 3CCQI 1EA3A 2WB1A 4ZZLA 2XGCA 2E36A 2ZSIB 4XLCA 3HIFA 5L3GA 3ZMZA 2XUBA 2K4BA 2ZSHB 4NB5A 2E35A 4V19K 1ITYA 4HV5A 4WX9A 3KEYA 2R7QA 3MZYA 2EFQA 2JA2A 4BQNA 1ETQA 3BTCA 3GLXA 3PM1A 2DW4A 2NVQJ 1T08B 5F64A 4DJAA 5F04A 1U8RA 2CRGA 1RUNA 2D5VA 2PN6A 2G7UA 2PJPA 1EF4A 5H6RA 1WRJA 3O8HA 1M1EB 1P7JA 1V5GA 2EZKA 3BPXA 3ONQA 4YFXF 2C6YA 2M9HA 4N4OB 2Q1ZB 1IG7A 3VB2A 1KU3A 2MC3A 1MIJA 2F4MB 4B43A 4XN0A 1Y0NA 1ZTRA 1FWZA 1QHHD 4L5IA 4OAYA 1X3WB 3NRVA 1OCOH 2JZYA 1BC7C 5TISC 3BCBA 3ZMVA 3CDLA 2QF7A 5EJCA 3CCMI 2GXBA 2L9NA 2DODA 2OTLI 2M30A 2BVLA 1D1AA 3DTKA 1RRJA 1QZZA 4G7ZF 2KIFA 3I55I 2M34A 4ANJA 1SMTA 2M8EA 3K10A 3CCLI 2IRFG 2IS6A 1HW1A 2EIKH 2LOOA 2XAFA 4RGRA 3HOYJ 4DBQA 1S5LC 1XSDA 2BGCA 2G0EA 1LFPA 2H1KA 1MNEA 2Z3YA 1XSXA 2FXAA 2ZJQF 2JMWA 2FNPA 2K40A 1B1BA 2FUG2 2ELHA 2ADUA 2F6CA 2DA2A 5F1JA 1WWXA 3BR1A 5CLSA 2HQAA 4KIBA 3A0HC 3A02A 4Z6YA 1VQ6I 2OTJI 1KA8A 1K6YA 4XRSA 2IP2A 1U78A 1BBYA 4GRIA 1S9HA 5IYCJ 2GWRA 3KP5A 1S8NA 1X1AA 2HQ5A 4FHTA 2O9LA 4B3AA 4HV6A 3KP2A 3ZQGA 1JKRC 1USTA 2ZNYA 3R4KA 1ZELA 3DEEA 2HDDA 1PUEE 4DGWB 2IT0A 2JA5J 1D3YA 3HOSA 4B48A 2HS5A 2LY9A 3BG3A 1E17A 2CUEA 1HKSA 5HODA 3TP0A 1FOKA 2K86A 4L9NA 1F43A 3BJOA 2QBYA 1G3YA 1OQYA 5HVQC 1WJAA 2E1NA 5EDNA 3TDZC 1JT0A 2L7ZA 3SJMA 3EYYA 4BDZA 3NWSA 2EA4A 3ZOBA 3FXMA 1IAWA 2LMDA 4XM3A 4BH9A 2FBHA 3I4NJ 1ZG1A 1R5ID 2UZKA 3RPUA 2F5DA 3U2RA 2NOJB 4E7ZA 4RLFA 4ZYEA 3TEDA 3CJTB 3GXOA 3MN2A 2XB0X 1XGOA 3EETA 4HA8A 2BBYA 3CF2A 3M8EA 5D5UB 2VIXA 1MH3A 1FP1D 1G3SA 3RI4A 3SQNA 3L2CA 2O7OA 4RGXA 4ENJA 5DCMB 2RQQA 1BC8C 1Z3YA 1MBEA 3SDGA 3R0AA 2YX4A 1FLIA 1KU2A 3LFKA 2BW3A 2RGVA 1XG1A 2P4WA 2V6EA 5J1UA 3CCYA 2E5NA 4G7OF 2W1OA 1QNTA 1QZEA 2X6XA 4CZCA 3SDBA 1LDJA 1YX5A 1MNDA 1HDDC 3DEWA 3VDXA 1LEAA 4A6EA 2LF8A 1V3FA 5C4XJ 4BGDA 1HBXG 2IXSA 4CSWA 5IPAA 4BQAA 3KETA 4FQGA 5E1WA 1OFCX 2VXZA 2XPVA 3OSFA 5E3LA 1JE8A 4IHTA 4UY8I 3DP7A 3DBRB 3R0JA 3BC8A 2XAJA 4UUSA 1MBJA 3ISPA 2B7EA 1V4RA 2LG4A 2XAUA 3BQZA 3K70D 4AIHA 2A5WA 2LKPA 1Z21A 3DKYA 1JXSA 4KICA 2VE8A 2WB1N 1VTNC 2DFEA 3RKQA 3CCUI 2KHMA 2MFZA 4NUBA 2PMZA 3MKZA 2DMTA 4GYGA 2CW0F 2EIJH 5DS9A 3Q9VA 1FOWA 2FX0A 2FQ4A 1B9MA 2D1HA 4O3MA 4A3FJ 1FZPB 3F23A 1Z7UA 3I59B 2R7FA 3KP3A 4OOIA 5B5EC 1T39A 2OZ6A 1DQUA 5L3BA 2Z99A 4I0BA 3V8JA 3E6DA 1R49A 1E3HA 1HF0A 2K3PA 4IQ4A 3T0YA 3I0TA 5GTIC 5HLGA 4YFKF 2JVHA 1G3TA 4LOCA 1TNSA 2QKMB 4CCLA 2AO9A 4G6DA 3JAMK 5C44J 3U1KA 4HDVA 2O0YA 3F8CA 3OYHA 1J2XA 2EIMH 4HG2A 2VJ4A 3BQYA 3TBIA 3TKYA 2QEXI 3G71I 1LVAA 1V55H 3OR2C 1X1CA 2QZ8A 1XDUA 3E6BA 3E97A 3MAJA 4CYCA 1BA5A 2I5UA 4F91B 3IH3A 4E7KA 4MHGA 2P5LC 3M1EA 3QYBA 1X58A 3HUGB 3J80Z 1KONA 3HM5A 2R93J 3K1PA 4CYCB 3HKZN 2XASA 1KU7A 1XTAA 3HGYA 5LHIA 3G1OA 3K4KA 1ZGAA 1XGMA 1XS9A 3D5RC 3I3LA 3GBGA 3LSGA 5CVRA 3LL7A 2R0QC 1RPWA 2QLZA 4EMSA 2IGMA 3K7AJ 3JRAA 2IBDA 2XF7A 2OCEA 3BZKA 2PLYA 1S72I 2NVXJ 1N78A 1LUJB 1IW7F 2GZWA 4F92B 5IYBJ 4A3EJ 2BOLA 1Y56A 4RS8A 4B09A 3PUBA 4RM3A 2CG4A 3F9KA 2M0MA 1R4NB 3BR0A 4DBRA 1Z05A 2KFDA 3M9AA 1J59A 1Y8RB 3M8FA 4KN4X 4D7MA 3IAM2 2QGUA 3OYNA 3KEQA 3CUOA 4J19A 4PJJA 1I3AA 2DYRH 2NVUB 1YO5C 1GT0C 3PO3J 2DT7B 3TP3A 1RIOH 1J5YA 3LA3A 2ZMEB 1IO2A 1IN5A 2DCEA 1ZR4A 5LEJA 4I99C 2DFHA 2KL4A 4PJLA 1HW2A 1RZ4A 2OPTA 2CQQA 3I58A 3ABKH 1JJ6C 2L01A 5TRDA 3BR6A 1X3ZB 3ZMUA 4EGZA 2M4KA 3H92A 1UB9A 4HBLA 2KT0A 1SD5A 2E1MB 1A04A 3MMYB 3WGIA 2QSGX 2HOSA 4RB2C 1VQPI 1L0OC 2PX9A 1JHHA 3GTMJ 2CQ7A 5JHUA 3KPHA 2E60A 2DDAA 5FKMA 2EJRA 3BP8A 3OIQA 3FXLA 2V1XA 5E8IA 3OY9A 1SVOA 1WKMA 1XPXA 1R1VA 1MJBA 2EZIA 2KP6A 3QYEA 4H4KC 2BYVE 4IVNA 1ETXA 2JJ7A 4EJVA 2DA1A 3AG4H 4YRVA 5KNLA 3QU3A 2HEOA 4EEFG 4CGZA 3NEUA 4KJZA 2H27A 2GXAA 1KU9A 4BL0B 3HSEA 4U7DA 3IL2A 3JRIA 1GHCA 3ERED 5JVTA 1U6GA 3HRMA 3ROUA 1MNMC 3S16J 1OISA 2GA1A 2DBBA 2HOAA 2RN7A 1ZYRF 2JUCA 1SD7A 3J81K 3TGNA 3SZTA 2O8XA 3QRFF 4C3IJ 3O8GA 3S3OA 4I2OA 4BXFA 1WI9A 5J1YA 2LY1A 3V4GA 4RLQA 2KKOA 3CP2A 2K3FA 3ABTA 4PCQA 1AA7A 2EV5A 2RKHA 4L18B 4GCVA 4XRMA 3S8PA 2F48A 4PK4A 1TQIA 4B1RA 1SVMA 1E3PA 1I39A 1J75A 3CMAI 3WTTC 2R7SA 4IRGA 3IHUA 3U9GA 2BW3B 4XLAA 2OV7A 2ISZA 1P4AA 5D6EA 4X0GA 3K4CA 1FEXA 2QQ9A 1FSHA 2WAFA 1VQLI 3AL0B 4OIOF 1ZH5A 3WODF 5IOYA 5K7HA 1TWGJ 2XIGA 5LD2C 2MG4A 1QPMA 2FD5A 3DTEA 3I5UA 3TO6A 2Y0MA 3OIOA 2O61A 1KGSA 1T8IA 1KQ0A 2HWVA 3OS0A 2R92J 2VQGA 1MW7A 5LFAA 1H88C 5HDNA 4P96A 4G7HF 2M7BA 1IRGA 1AU7A 1U5TC 2IEKA 2LD5A 3HXLA 3KX2A 2X6OA 1N25A 5F08A 1GDTA 1GV2A 4RB0A 3S93A 4JBAA 1GVJA 2Y9YA 3IKTA 4RAFA 4JX4A 1JT6A 3AL0C 3LSRA 1S29A 3HG9A 2F5VA 1NHAA 2L0KA 4BY7J 3Q5FA 1SANA 2HTJA 3A03A 1A31A 3HBLA 2R7DA 5E3NA 1VQ9I 1XMXA 3S14J 4ETSA 1BR4A 3S1NJ 3FZVA 2V1NA 4M9ZA 1ETYA 2GM4A 1BI0A 2Y75A 1JTXA 4N0BA 1WH7A 3FKIJ 2E1CA 3IWFA 3M8JA 2LH9A 4ZYAA 3VYUB 1WGXA 2EH3A 1IN6A 1Z6RA 3I4MJ 5DTDA 3KCCA 3FM3A 4IRHA 4M6YA 3V8KA 2ZMEC 5CVUA 3ZQLA 3W2VA 4D5CA 3H3UA 1A35A 4UVBA 1IV8A 4FCYA 4R8HA 4QPQA 2DOAA 3IRRA 4OU0A 3HEFA 3FISA 2AS5F 1W7PA 2QCOA 1Y6IA 2OU2A 2X1CA 3LA2A 2CV2A 1RESA 6PAXA 3ESWB 1SMYF 4Y3OA 3VFZA 2EV0A 1FJLA 1Y39A 2VT2A 4XLFA 3T8RA 4B3XA 3R61A 3WE2A 3MZHA 4BAYA 2MLGA 3H3VK 5BQTA 3JRCA 1DP7P 3HZJA 3Q9SA 1X4PA 1MMDA 4IRIA 1YG2A 1MMSA 4DNCA 3DPLC 1IV6A 4LG0A 5J4YA 4BDYA 1PUFA 1TWHJ 4HF1A 1DDNA 5F0HA 2IS1A 2QWWA 3R6SA 3ASNH 5LRSA 4IHXA 1XDSA 3L1PA 4DZPA 2RDPA 1Y1WJ 2DA6A 1LKXA 2COBA 2LVSA 3GUDA 4Q4ZF 5DM7F 1K79A 1UG0A 5LHGA 1ZQ3P 1BM9A 3JTGA 2CFXA 1IXSB 5K7ZA 2E1MC 4AIJA 5BMZA 1ORKA 5HLTA 3OYMA 5EZHA 3HB9A 3TO7A 4ESBA 1KZHA 4XIDA 2KMUA 4MTDA 1FIAA 3GZ5A 1EKEA 2XRLA 4PGHA 1QA6A 2CSOA 2CUFA 3GWZA 2Q0OA 4A93J 1SFXA 2NS8A 4DYRA 1DP3A 3CMEI 3MKYB 3CDHA 3OV8A 2XPUA 1H0MA 3K2AA 1R6RA 3M7GA 3GTQJ 2BVMA 2VONA 1BIBA 1KYZA 3AFHA 3CC2I 1RR8C 2GAUA 3HRUA 3B73A 2M3AA 4BHBA 1SFOJ 1XB4A 2RQPA 1UJ8A 4G8XA 2GA2A 2Z33A 2KRFA 5D5WB 1V5FA 3FKJA 4I0AA 2QM3A 1QU3A 1JKOC 3CUQB 1HW5A 1FX7A 1Z91A 2DJIA 1VQ7I 5HOOA 5IYDJ 1TBXA 4BE2A 3LSIA 1OYIA 4KA4A 1MDMB 2LBFA 2XDVA 4ZYGA 4R1HA 3K70C 2CMPA 3MCZA 1VZ0A 1R5HA 2BHYA 3D5LA 4ABZA 2D45A 2FMYA 3GTGJ 2VE9A 1X4OA 1ZREA 1R22A 2RNGA 4MFEA 2KIUA 2H09A 1D1CA 2IA1A 4MGRA 3DLAA 5DD8A 3CC7I 2ZO4A 4HLXA 1REPC 4LIVA 1MJ9A 2L5QA 4UB6C 5JI6A 1XGSA 2RAEA 3GFIA 3TMOA 2VPLA 1BJAA 2VKDA 3K1MA 2R5YA 2GBYA 2EV6A 2LKSA 3LOCA 4HAMA 4M71A 3JCUC 5KAIC 3W6KB 4NDLA 3H9QA 4IF4A 2PJRA 3GFJA 1TNTA 3UNGC 4Y15A 5FLMJ 1YYVA 3GO5A 3GYHX 3NARA 4KMUX 4BNCA 1FY7A 1HSJA 3J81Z 1HC8A 3WGHA 4FETA 1ZN2A 2K4JA 4O5VA 1B72A 1ETVA 3FXOA 1YW7A 2XKOA 3FXKA 4OIPF 1BN5A 5ILVA 4XN3A 5GPCA 1TT0A 2V7FA 2P7VB 5J4VA 3VSLA 5JFRA 3M3YJ 2N8GA 2YS9A 3PNTA 1UHWA 4PGGA 3QP5A 4JX5A 1CF7A 4XLEA 3JAMZ 1G2HA 5DYMA 1TP4A 4UV9A 1LNWA 3F6OA 4HF0A 4CCJA 4WCGA 2MBFA 4C2TA 5H6QA 2WBMA 2JN6A 3L9FA 4HZFA 2IA2A 1OKRA 4YFNF 2B63J 1S3JA 4EQQA 4ENNA 5IT9Z 3PO2J 4DYCA 1O7LA 3TDUC 1VNDA 1NTCA 2IGKA 2UUZA 4RDUA 3DXJF 3FXUA 1XCBA 4AVZA 3E7LA 1Y8QB 2M5WA 2W82A 4FISA 4HQMA 4O6JA 3OYJA 2D1VA 2P7CB 2HOEA 2NVYJ 4A0ZA 2FA5A 3W6JB 1DGWY 5GTHC 5B1AH 1UG2A 2LNBA 1OR7A 3W2WA 2MA3A 2OQGA 3BR5A 3E0JB 4HNTA 3DTIA 4IPAA 4M9XA 1WJ5A 4RAGA 1DU6A 1X3UA 2X0LA 5FB2A 2MW8A 1RI7A 2L9VA 3V42A 1D0XA 4EJUA 4WXDA 4XKVA 2LC2A 3G6EI 3GTOJ 5B1BH 1PYVA 5M3MJ 3OSGA 2HZTA 3GF2A 3RKYA 3R60A 3RJPA 2VN2A 4H0EA 3K6GA 2UXXA 3H35A 5TJJA 3VYTB 4KT6A 4AD9A 1WHUA 2Q8KA 1B4AA 3I53A 3LSKA 2KJBA 3F8MA 2NXNB 3E6CC 1BI3A 2XC7A 2L7MP 3BROA 2WAQA 4M6VA 2VL8A 2H8RA 3F8FA 5J6XA 3LWFA 3I54A 1P2FA 1YS6A 2K9NA 5LRRA 3L2VA 1W5SA 5F0CA 2OQRA 2NOGA 4B44A 2IS2A 4XBFA 2K9LA 1AOYA 3HDDA 2ZFUA 3BTJA 3OYBA 2YSRA 5KAFC 1XC5A 2M8GX 4A5NA 4E7JA 3BZ6A 2AHQA 3K4JA 2VOPA 1IN8A 4C3JJ 5F1RA 4BXXJ 3EUKL 2M7AA 2PMUA 2HDWA 4A5MA 3EUAA 2QQAA 3A4CA 2ZXIA 5ILUA 2PQ8A 3FDYA 2KZVA 4L0YB 2O5RA 2LDUA 2Y9ZA 1ZARA 3E5XA 4PDKA 3CD6I 3J80K 5GP9A 3VSKA 4KMFA 2E7WA 2MGQA 3BT9A 2P81A 2HQRA 1JHFA 5DCFA 1T0FA 1O57A 2GIVA 1Q1VA 4ZYDA 2CQKA 5HS8A 2VJIA 1ZKGA 1F1ZA 1SFKA 3G1MA 4XOPA 3HSRA 5LGNA 4F3QA 1O4XA 2EBIA 2QBYB 1Z77A 5HNHA 4RGUA 1ENHA 1RC9A 2HYJA 3ABMH 2TRTA 4OWRB 2K7LA 2VKVA 3KYDB 1T33A 4BQQA 2YU9J 2VBWA 3RPQA 2FOKA 4GYIA 2LF7A 4YELA 4II3A 3SZGA 4X1EA 4A3GJ 2IGNA 1YX3A 5J3LA 1BW6A 1H9GA 2HGCA 3OWTA 3RCOA 1FYMA 1G59A 4WXCA 1BL0A 2V79A 1LEBA 1IUYA 2NRAC 3E6MA 3S17J 2DA3A 2GOMA 4KNYA 3BG9A 5A2QZ 4BYYA 1XD7A 1JKQC 3BWGA 1SC7A 4CH7A 1ZRDA 1YIJI 4XLNF 3K0LA 3F8NA 5J47A 3PUFA 2HVSA 2KIQA 1IUFA 2M0CA 1XN7A 3HPHA 1QHGA 2OD5A 1ZG3A 4RM2A 4QLCU 2ACJA 1ULYA 1YJ9I 3C18A 2Y0SN 5FD6A 4HDUA 3ZCOA 4AYBA 2G9WA 2ESHA 2HPMA 4WXHA 1WJBA 4N4NB 1LJ9A 3O3KA 3CCSI 2F5EA 3MFKA 1PUFB 2XGXA 3J7AO 2DAOA 5HDGA 5L3EA 4I7HA 1SD6A 2XSJC 4HLYA 4LB6B 4CXFA 3OYIA 4HOBA 1VQ5I 4HEA2 2P0WA 4J01A 1WPKA 3CESA 1LB2A 4A3DJ 4XSZF 3KLNA 4P5OA 1K4TA 1OYWA 2OF7A 2JA7J 3CDIA 1MSEC 5ICFA 5LEKA 4UVCA 3H9GA 1UFMA 1T2KA 4ESFA 4A3JJ 1ZR2A 2KQRA 3KE2A 4DIQA 1VQ8I 1TQPA 2DN0A 5HLIA 1IF1A 1XCVA 3GTJJ 3WGGA 1WI3A 4M73A 4X6AJ 3DLLF 2EZHA 2K02A 5CVJA 4XL9A 4AUXA 1WSUA 2XHKA 2ZFWA 3S32A 4P9UA 4LB5A 1CQTA 2XAGA 3PIPF 2PFBA 4M3GA 4NC8A 2FF4A 4HNVA 2WC2A 4YIIA 2DQLA 2Y0SA 2QQBA 3QWLA 3WTUC 1D5YA 3MEXA 4RB3C 1MH4A 2V1DA 3E5UA 4FASD 1T6SA 4OMYA 5LLQA 1D1BA 2JRTA 3KP7A 1IZ1A 5CVVA 1FNNA 1SVLA 4KUMA 4S0HB 3D1NI 2VBZA 2XF5A 5GAGJ 1QQIA 2XGDA 1D5VA 3S2WA 4XOTA 2L7KA 3I4PA 4A2UA 1S7AA 3LMMA 1UHSA 4PFOA 2HDCA 2DTRA 1FC3A 2NVTJ 5GAEJ 2DA5A 3QYFA 4E4HA 5J1RA 2LRDA 4ENKA 2EK5A 1HSTA 2I8DA 3PSFA 3SEZA 3FXRA 1IRXA 4D7NA 1R36A 2DOEA 1XMKA 4ZDLA 5ED4A 5AIPA 4D5FA 2E2HJ 5FKNA 2ZKZA 1BI2A 2ESNA 5FKOA 3HYIA 4IXAA 1J9IA 1Z9CA 2D2WA 4NQWA 3ZN0A 3GTPJ 3HC7A 3GFMA 3UR3C 2GXGA 4CO8A 3DV8A 3OL4A 3COAC 1FBUA 1YW9A 4NC7A 1K61A 1PDNC 1JI8A 3RQ4A 2BV6A 4U7BA 4BY1J 2A6TA 4XICA 3ZN1A 2MC4A 3BCAA 2DI3A 3IKVA 3M1CA 3MD2A 5IP6A 1IN7A 3VYRB 4I09A 4E7LA 2V1UA 2H6CA 4HSRA 2OA4A 2A6HF 3OYDA 2QUFA 2A05A 4PFPA 3KYLA 2X9DA 3JR9A 1W5TA 5IP7J 2JUGA 1PP7U 2X6WA 1JUSA 1K83J 2WV1A 4HX7A 2ZXWH 4NC6A 4XNFA 2OZUA 1U5TA 5K5QA 3P7NA 4FX0A 2IS4A 1NK3P 1P4WA 1FIPA 2ZCWA 4U87A 3C2BA 4D9JA 2Y30A 1WCMJ 5D8KB 2QA4I 1XSVA 3HOXJ 2RNJA 4ZDOA 2KRCA 1WJEA 2CS3A 2W7NA 3ASOH 1D8KA 4A3IJ 2Z9OA 4YEJA 4F7ZA 4MO7A 2QYOA 1K6OA 5CYVA 1I50J 3RYPA 1SAUA 5AONA 4HF2A 3H5NA 4LGWA 2DA4A 2LK2A 3JSPA 4AWXB 3Q3SA 5D5XB 2FJ1A 1L3LA 2PJRB 3W6VA 2DFIA 1G4DA 1Z0XA 3K4LA 1I1SA 1N75A 2E1OA 3KZYA 1YW8A 1NG7A 2PMZN 1SFEA 2BY0A 2ZJRF 4WWCA 5EEAA 3ERMA 3B6AA 5FLXK 5E8GA 1DU0A 1JJ8C 3V8LA 2E2IJ 2H8WA 3HTSB 4LK0F 4JQFA 4R79A 2CH0A 2FBIA 5KHDA 5LGUA 3KLOA 2DDBA 1FYKA 5H20A 2X4HA 4F52A 5GPAA 3CLQA 4CUGA 3CCRI 1ZGJA 2HQNA 4DOZA 4IHWA 2H1LA 2IGOA 3BOQA 4L5JA 1A5JA 2BZTA 2VUMJ 2DTZA 2JSPA 3RYRA 4JP0A 1I5ZA 3DEUA 2X48A 4AC0A 4FX4A 3OS2A 1BR2A 4KN7X 2GLOA 3VEPA 3CMMA 3FMRA 4JX6A 4CCNA 2STWA 4OAZA 4CYDA 5C3EJ 2JRMA 3HOWJ 4AIKA 3E1SA 1FBQA 3LAPA 1B9NA 3ZQCA 3H3ZA 3P9CA 5FJ8J 2EFPA 1ZRFA 2MH9A 1TT5B 3FMQA 2F5CA 1TZLA 3OYLA 2E2JJ 3EDPA 3RDIA 4MEYF 2L9SA 1W4MA 3WU1B 1U3EM 3IC7A 3OMYA 3OYAA 5ERIA 2QQ8A 1T95A 4G9YA 4XKBA 2W84A 3AG3H 3ZR8X 3F21A 1OMIA 3LSPA 3L2RA 3KZZA 2DOFA 2DPDA 4A12A 3I71A 2W85A 4V2FA 3ZQHA 3RZOJ 2X85A 1DPUA 4ZH4F 2J5PA 1MSFC 5FO5A 2ZXJA 1UHMA 1RNLA 2KDZA 1QPIA 2JPCA 3T8TA 5FKLA 3H1CA 2EFWA 3K2ZA 2R7UA 5JVGF 1YHQI 5IT9K 4L9TA 3RZDJ 1GXQA 1IN4A 2XGEA 4KFCA 3A2KA 2UWMA 1WZ2A 2EINH 5KCMA 2P5VA 2L4AA 1TW3A 2O03A 3VWBA 5DCMA 1FP2A 2L2OA 3SFIA 2ECCA 3RKXA 1WQ2A 4WF2A 1YRNA 1RUOA 4M6XA 1ZGWA 3K1NA 3L00A 2J5OA 1KYWA 3GZ6A 1OPCA 4JYKA 2IVMA 2KJCA 2LY2A 2QENA 2M87A 3LSTA 2RREA 2KZGA 4JK1X 1TWFJ 2FRHA 3MKLA 4G6TB 5GAHJ 2K27A 1CF7B 1X1DA 2HI3A 4F55A 3C2HA 3CP8A 2ME6A 1I6HJ 3JRGA 3G4SI 1IDZA 5EG0B 4QIWN 1GXPA 1WVRA 3N4MA 2FSWA 2IJLA 4IEJA 5J8CA 1ZHFA 1SD4A 5F27A 2ZC2A 5IY5H 4BBSJ 1QO0D 5CKTA 3RPUD 4BUPA 3BJAA 2HNHA 3FXJA 2A61A 5EEGA 1LFBA 3DU5A 1S7EA 4QPOA 5JR3A 3NQOA 1YTYA 2YUSA 4L9JA 3LFUA 1POGA 2GQQA 2VLAA 3S3MA 3QPSA 3S1RJ 1STZA 3SYTA 3JRBA 4HX4A 2JTVA 1GLNA 2E5ZA 2CYYA 3KZIC 2BHZA 5HDKA 4EGYA 9ANTA 3J7ZI 5BOXA 1MMNA 3L2QA 4HRIA 2VQLA 2Y69H 3LNQA 2K9SA 3ZQFA 3G3ZA 1G3WA 2BXYA 3F8BA 3FIWA 1X19A 1W0UA 1B72B 4IOCF 1S6LA 1R4MB 4AIDA 1BR1A 3GVAA 2WA0A 2WAEA 3ML6A 5ICCA 2A07F 2HR3A 4CICA 2OUMA 2E7XA 1FMVA 5K5RA 4EJWA 1VFCA 5EYRA 1UMQA 1YITI 4LD5A 2IAIA 2WY7Q 2WADA 3RQIA 3FMSA 2KPMA 4WK8F 3A1YA 3OOUA 3P5JA 4XRFA 3S1MJ 2OBPA 1U2WA 1Z3XA 3RKWA 5DUIA 2LP0A 4NNJA 3F6VA 3L09A 3QOEA 5JHFA 2L9RA 1FBSA 3MQ0A 4EM2A 1G8XA 5DUKA 4PUSA 5L3FA 1YI2I 3ECHA 1PP8F 4I02A 2FU4A 3WE3A 4RBOA 3IUOA 1FTTA 3D5SC 4Q48A 3KIOA 5E18F 2IPQX 3ZXSA 2FMLA 2Z1DA 3FWEA 1GVDA 1DUXC 2JA8J 2MD0A 1Y1VJ 4HW0A 2DMQA 2H94A 5F6FA 4BU2A 2EA2A 4UUVA 1Z7LA 1AKHA 2E34A 4MTEA 4S05A 1Z1DA 3HUGA 1QBJA 1OCTC 4PSXA 2ISYA 2NNNA 2HXOA 2K9MA 3I64A 1B59A 1ON2A 2BY3A 4IL6C 4ENMA 3CJNA 4FE4A 1W5CC 1ETWA 4QTRA 1YFHA 3HOUJ 4A3CJ 3U1DA 2M45A 2DT6A 2F4OB 2XVCA 2A3SA 3GW2A 3OYCA 1MD0A 2EZLA 4CCOA 2HPIA 1AKHB 1FT9A 4G6QA 2CGPA 3J7AY 3WTZA 1FOYA 3RSNA 2HOTA 2B0LA 1HCRA 4N9IA 4BACA 4YIFA 5M3FJ 2VKHA 4KITB 4OMZA 4PZJA 4IX7A 2HTSA 3WTSC 4A3MJ 2RC4A 3TOAA 1S7OA 2IW5A 5FRNA 2XF6A 2KDOA 3JRDA 3B02A 3HOZJ 4LLLA 3I59A 1R23A 1E3OC 2V6CA 3HOTA
chains in the Genus database with same CATH topology
3SZGA 3H9JA 3U21A 1U0JA 3OIQA 3OY9A 3N05A 2IGNA 3PJRA 1HA8A 3BG7A 1YX3A 3RCOA 3OWTA 1G59A 2X1DA 2LBFB 4HPQA 1LVKA 1WJDA 4LITA 2GOMA 3L2WA 2KP6A 3QYEA 4H4KC 3DPTA 1WJCA 4II2A 4CH7A 1ERDA 3FBNB 4YRVA 3DQVC 3FBIB 5KNLA 2R7WA 4KJZA 4BL0B 2JVGA 1D0YA 2HVSA 4ITVA 2GOXB 2VQHA 3HPHA 1QHGA 3OYEA 4RM2A 5CQGA 4XORA 2ELJA 3ZCOA 4AYBA 2HPMA 4ZJZA 1W36C 1WJBA 3C2GA 4N4NB 3S3OA 3BLYA 4BXFA 2LY1A 2KRHA 4RLQA 2VXDA 3PL8A 3CP2A 4B47A 1AA7A 3EPZA 3S8PA 3MKWB 4PK4A 2UV1A 2W00A 2XSJC 2M4GA 3ZQQA 2R7SA 3IP4B 3OYIA 2BW3B 2X1EA 4HEA2 4XLAA 2P0WA 2OV7A 2HZDA 4BJ5C 4J01A 3CESA 2QKLB 4X0GA 4BEHA 3K4CA 4P5OA 2WAFA 3AL0B 3LSMA 3H9GA 3SEQA 1LDKB 2KQRA 4DIQA 5LD2C 3CJQB 3DTEA 4AU7A 4HNUA 5FRMA 2Z16A 4E6KG 3OS0A 2Q2EB 2VQGA 2ZXHA 1MW7A 5LFAA 4XL9A 3OYKA 3OIPA 2M7BA 3S32A 4P1WA 1J09A 1UAAA 3HXLA 3KX2A 4NC8A 1W36D 2HVQA 4KISA 4BS9A 2Y0SA 3DWLE 3S93A 4IZZA 1MMGA 2R7OA 3AL0C 4BJTA 4FASD 2OC6A 3HG9A 2F5VA 2MABA 3W3CA 1D1BA 2VASA 1YE9A 3K4BA 4EATA 3QODA 2XF5A 4MLOA 3LSHA 4XOTA 3DU6A 2L7KA 1BR4A 3LMMA 2V1NA 4PFOA 1EA3A 2WB1A 4J00A 4ZTFA 2ZSIB 4XLCA 3QYFA 4E4HA 2LRDA 3M8JA 2I8DA 2ZSHB 3PSFA 3SEZA 2LH9A 4ZYAA 3VYUB 2HVRA 4C2UA 3KEYA 2R7QA 1IRXA 5CPRB 2JA2A 4BQNA 4ZDLA 4BJ6C 4DJAA 4ZDPA 3W2VA 2R7RA 4CCMA 4CCKA 5TGTA 4QPQA 2DOAA 4XQFA 1V5GA 3HC7A 3ONQA 3UR3C 2AQEA 3OL4A 1Y6IA 2X1CA 4NC7A 4N4OB 2Q1ZB 2CV2A 3RQ4A 1JI8A 4U7BA 4Y3OA 4II3A 2A6TA 4XLFA 4B3XA 4B43A 4XN0A 2MC4A 3BCAA 4BQOA 1QHHD 3M1CA 3MD2A 4OAYA 1X4PA 1MMDA 3VYRB 1UELB 4E7LA 3G2BA 3BCBA 4HSRA 3DPLC 2CV1A 2L9NA 3OYDA 4E7HA 4BDYA 4JOMA 3TL4X 3ZRGA 2BVLA 3KYLA 1D1AA 2K5CA 2LREA 3DTKA 4PFPA 2IS1A 4ANJA 3IAS2 3K10A 2IS6A 4HSTA 2JUGA 2LOOA 2X6WA 4DBQA 4XLHA 1LFPA 4XNFA 1LKXA 1MNEA 1MMAA 1UG0A 2IS4A 2FUG2 4U87A 2F6CA 4D9JA 3OS1A 2E1MC 2HQAA 3EUHC 5HLTA 4ZDOA 2KRCA 4F93B 3OYMA 1WJEA 1K6YA 2CS3A 2W7NA 4GRIA 2AQFA 2KMUA 3H5AA 3PFYA 1S9HA 4YEJA 1V5EA 1X1AA 4C9YA 1SAUA 3H5NA 1DP3A 1T0FC 4NQWB 1ZELA 3DEEA 3AKZA 3MKYB 2PJRB 4DGWB 2HU9A 3K4LA 3HOSA 3DKXA 4B48A 1R6RA 1N75A 2BVMA 4LG3A 1NG7A 4XONA 3AFHA 4BEHB 4IKFA 2DXIA 2V9KA 2M3AA 4PSWA 3H5RA 4XMYA 5HVQC 1WJAA 2VQCA 1DGRM 4JQFA 3CZ6A 1V5FA 3FKJA 4R79A 2CH0A 2F4IA 3NWSA 5KHDA 4BDZA 1QU3A 4F52A 5HNFA 2DJIA 4CUGA 5HOOA 4XM3A 2CUZA 3K4MA 4DOZA 2IGOA 4RMNA 4BE2A 3LSIA 4E7ZA 2NOJB 2JSPA 4RLFA 4E7IA 2LBFA 2XDVA 3OS2A 1BR2A 3K70C 2CMPA 4XKCA 1VZ0A 5FROA 3CMMA 4CCNA 3D5LA 4OAZA 3CF2A 3E1SA 2VIXA 1X4OA 2WY8Q 4BE1A 2RNGA 3OYLA 1TZLA 2RQQA 2L9SA 1D1CA 3PSIA 1Z3YA 3H0DA 3DLAA 3OMYA 3OYAA 2BW3A 4LIUA 3CJRB 2V6EA 1T95A 4XKBA 2VJJA 2E5NA 2MYSA 2W1OA 3OL3A 4LIVA 3ZR8X 2X6XA 4CZCA 4IQJA 2L5QA 3SDBA 3L2RA 1YX5A 1MNDA 2KLOA 3VDXA 3TMOA 2VPLA 2VKDA 2X85A 2X6YA 4BGDA 2X51A 2IXSA 4CSWA 3OYGA 2VXZA 3H9QA 2PJRA 2R7UA 1X1BA 3UNGC 1BOBA 3A2KA 3HKZA 3BC8A 2UWMA 4FETA 2R7XA 5KCMA 4PJNA 3VWBA 2LG4A 2XAUA 4PJMA 2L2OA 3K70D 4XN3A 1TT0A 2V7FA 3VSLA 2A5WA 1Z21A 3DKYA 3PNTA 1E0EA 2CW8A 4XLEA 2KHMA 2MFZA 1PJRA 4NUBA 2PMZA 3MKZA 4CCJA 4C2TA 2Z2SB 2WBMA 2LY2A 2RREA 1OLTA 4G6TB 2CV0A 1X1DA 4F55A 3C2HA 3CP8A 3NWTA 3RTRA 3W2AA 3PNVA 2IGKA 2UUZA 1DQUA 4AVZA 4ZTJA 3DPUA 1NG6A 2K3PA 2W82A 4IQ4A 5CKTA 4C30A 2R4GA 3OYJA 2JVHA 3RPUD 3ZGKA 4BUPA 2HNHA 2QKMB 3DU5A 4CCLA 1DGWY 4QPOA 3LFUA 3OYHA 3W2WA 4HNTA 3E0JB 2VLAA 3S3MA 3DTIA 4HG2A 3SYTA 2VJ4A 1WJ5A 3TBIA 4D1QA 1GLNA 2E5ZA 4Y33A 3V42A 1D0XA 3OR2C 1X1CA 4XKVA 1MMNA 2LC2A 3L2QA 4HRIA 1D0ZA 2VQLA 1PYVA 4Y4RA 4F91B 2CW7A 4E7KA 1X19A 3QYBA 3HL2A 3HUGB 1KONA 1BR1A 3VYSB 3K6GA 2WA0A 2WAEA 3H35A 3VYTB 4KT6A 3K4KA 2OUMA 1FMVA 1WJFA 3LSKA 3D5RC 3I3LA 3LSGA 3GBGA 1FMWA 3LL7A 2WY7Q 2WADA 3FHNA 2CUJA 2KPMA 3A1YA 2WAQA 3OOUA 2XC7A 2IGMA 2VL8A 2XF7A 1Z3XA 1N78A 3S3NA 4NNJA 4F92B 3L2VA 2BOLA 3QOEA 1Y56A 4B44A 3PUBA 4RM3A 4XKWA 1OR7C 5JHFA 2IS2A 2V4JC 1G8XA 2K9LA 2M0MA 3F9KA 4PUSA 4XR6A 3OR1C 2ZFUA 4DBRA 4E7SA 3OYBA 3IUOA 5CQEA 3D5SC 4E7JA 3ZXSA 3K4JA 2Z1DA 4BE0A 2W4SA 3IAM2 2MD0A 3OYNA 3EUKL 2M7AA 2HDWA 4BU2A 3BG6A 3EUAA 3PNYA 4PJJA 1Z7LA 4ZC3A 3A4CA 2ZXIA 3HPGA 3FDYA 2KZVA 4PSXA 2O5RA 3I9V2 2K9MA 2DT7B 2R7TA 2DCEA 2KL4A 2LYCA 4PJLA 2DT6A 3VSKA 3OYCA 4CCOA 2HPIA 3J7AY 3RSNA 2V26A 3K4NA 2M4KA 2VJIA 4BACA 3L2UA 2VJ5A 1SFKA 2E1MB 4XOPA 2VKHA 1P9QC 4F3QA 4KITB 3OYFA 5HNHA 3MMYB 4IX7A 2VB6A 2CFOA 1N77A 4OWRB 4CA0A 4BQQA 5FRNA 2XF6A 2KDOA 2R7VA 4YELA 3HOTA 2E60A 1WFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBF B;  4BEH B;  2W1O A;  3A1Y A;  2LBF A;  4BEH A; 
#chains in the Genus database with same CATH topology
 3KP4 A;  3H9J A;  4NBQ A;  1U0J A;  2AXT C;  2JPB A;  4QSH A;  1LDD A;  3N05 A;  1A6I A;  1HA8 A;  3BG7 A;  4A0Y A;  2R7Z J;  3P9K A;  2X1D A;  3E5Q A;  4HPQ A;  5E1Z B;  5FLV A;  1YOV B;  5F0F A;  2LTP A;  1LVK A;  1WJD A;  4Y13 A;  2LLK A;  1R58 A;  3E3V A;  1X2N A;  2FBK A;  3DPT A;  2JSC A;  4II2 A;  3IV5 A;  5ILS A;  3ZMT A;  1R00 A;  2R7W A;  1B8I A;  3TW6 A;  3ELK A;  1D0Y A;  5J8F A;  5CVI A;  3X2Q H;  4ITV A;  4ASN A;  3HHG A;  1ODD A;  4IOA F;  4CHU A;  3QOP A;  3GME A;  4UHT A;  1U5T B;  4XOR A;  2ELJ A;  3ZPL A;  4ZJZ A;  5B3S H;  4M74 A;  5KK1 A;  3WHB A;  4OIN F;  3ZP5 A;  3C2G A;  3ULQ B;  2W24 A;  3BJ6 A;  1O3S A;  2EB7 A;  2VKE A;  3BLY A;  2CU7 A;  5M5X J;  4MQ9 F;  5E3O A;  2XRN A;  1JUP A;  2KRH A;  2VXD A;  4RGS A;  4LLN A;  3LQQ A;  4A0X A;  3EPZ A;  3BTL A;  1IJW C;  1W7P D;  3MKW B;  2UV1 A;  3DFG A;  2RVC A;  2W00 A;  3WTX C;  3BR3 A;  3SZP A;  1GV5 A;  3ZQQ A;  3IP4 B;  4EV0 A;  4MIM A;  1P4X A;  3AG1 H;  3PQJ A;  5EG0 A;  3BDD A;  2X1E A;  4BJ5 C;  2QKL B;  4BEH A;  5C4J J;  4Q5S F;  3HTU A;  2VT3 A;  2CQX A;  4EM0 B;  1YS7 A;  4EM1 A;  1PVE A;  2UXN A;  1LDK B;  3SEQ A;  3S2D J;  3KFW X;  1GUU A;  1VF9 A;  3GTL J;  4A3K J;  4U0Y A;  2YX7 A;  2E71 A;  2HYF A;  3CJQ B;  4AU7 A;  1H9T A;  1AWC A;  1RR7 A;  4HNU A;  2L3D A;  4HQE A;  2MLK A;  5FRM A;  3M4O J;  3A0B C;  2ZXH A;  5B66 C;  3OYK A;  4I98 B;  3OIP A;  3BY6 A;  4P1W A;  4RA2 A;  4QWQ A;  1J09 A;  2DYS H;  4UUS B;  1UAA A;  1T56 A;  1EV7 A;  3HOV J;  1ONV A;  3Q0W A;  1W36 D;  2HVQ A;  2KIM A;  5LGT A;  2XRO A;  3G73 A;  1LQ1 A;  3DWL E;  5HS7 A;  4KIS A;  1TW2 A;  4IHV A;  2NNY A;  3RIR A;  4BJT A;  1RKW A;  3TQN A;  2MAB A;  2JQ7 A;  1QVU A;  3CMY A;  2JT1 A;  3T1B A;  2OAZ A;  4EAT A;  3LSH A;  3CUQ C;  3H36 A;  4BBR J;  3ABL H;  4AYB N;  1U9N A;  2FE3 A;  2V9V A;  4J00 A;  4ZTF A;  5BS6 A;  1F4K A;  2PI0 A;  1ETO A;  3JW4 A;  1MZB A;  3REO A;  5M5W J;  3F72 A;  4FE7 A;  1K78 A;  4C2U A;  4I01 A;  3SFZ A;  1JGS A;  2VC1 A;  5CPR B;  3L7W A;  4PJ0 C;  4BJ6 C;  1O3Q A;  1TWA J;  1HDP A;  1ZK8 A;  4ZDP A;  3S1Q J;  2R7R A;  3VPR A;  1JUM A;  2XB5 A;  2DLL A;  1WH5 A;  4CCM A;  2BEO A;  4CCK A;  3C3W A;  4M3D A;  5TGT A;  3K9T A;  4XQF A;  1G6N A;  1NK2 P;  1SFU A;  3HRS A;  3OOP A;  2AQE A;  1OJL A;  5JLX A;  1FYL A;  5FFX A;  2HFH A;  3DBH B;  3TOB A;  4LG0 B;  1OCP A;  1B8I B;  2COM A;  3WU2 C;  4UV8 A;  1RET A;  1U8B A;  3CLO A;  4BQO A;  3GLL A;  2W48 A;  5EEH A;  2LKX A;  1H89 C;  3C7J A;  2QSH X;  1P6R A;  1UEL B;  5EZG A;  1MBF A;  2DJN A;  1D8J A;  3G2B A;  3V7R A;  1R1U A;  2DU9 A;  4KYW A;  5D6F A;  5DM6 F;  1R7J A;  1O7F A;  2CV1 A;  2H6B A;  4E7H A;  2TCT A;  5EF6 A;  1TC3 C;  4JOM A;  3FX3 A;  3TL4 X;  3ZRG A;  2K5C A;  2DQR A;  2LRE A;  4M72 A;  2DO7 A;  1A36 A;  3IAS 2;  3HSF A;  4HST A;  3IWZ A;  2G7H A;  4MNU A;  4XLH A;  5HLH A;  1ZG5 A;  1LFU P;  2NS0 A;  2XKP A;  3BTI A;  1MJA A;  1MMA A;  1I1G A;  2XAQ A;  4B8X A;  5FLX Z;  3OS1 A;  1YJN I;  3EUH C;  3CUQ A;  1K78 B;  1H8A C;  4F93 B;  2ZJP F;  4P55 A;  1T38 A;  3ABU A;  2DK8 A;  5K7F A;  2EIL H;  2K85 A;  1QGP A;  2AQF A;  3H5A A;  3PFY A;  4XK4 A;  1R71 A;  4DYQ A;  2F5F A;  1V5E A;  5AIQ A;  4LFU A;  2P5K A;  1IGN A;  2L4M A;  5EGO A;  4C9Y A;  2WTE A;  4E70 A;  2VPR A;  1X1P A;  2XV4 S;  2ZNZ A;  1T0F C;  4NQW B;  1ETK A;  1O3T A;  3AKZ A;  2K9Q A;  1QRY A;  2R5Z B;  2DMN A;  2HU9 A;  3Q0U A;  2GIZ A;  5L3C A;  1AHD P;  3DKX A;  3BPV A;  4MQV A;  2EQR A;  4LG3 A;  2VBX A;  4XON A;  3MZ8 A;  1RKT A;  3F3X A;  4GFB A;  3QPL A;  1IDY A;  4I76 A;  4BEH B;  3JRE A;  2M2E A;  2DXI A;  1J7K A;  4IKF A;  2V9K A;  1F9N A;  4PSW A;  1W1W E;  3ZQI A;  2MD5 A;  3BR2 A;  3F0C A;  3H5R A;  4XMY A;  2VQC A;  1X2M A;  1DGR M;  2VBY A;  3CTA A;  3JRF A;  3CZ6 A;  3GEZ A;  4B4C A;  2F4I A;  4W97 A;  2OJE D;  4IHY A;  5HNF A;  3MWM A;  3WG9 A;  2CUZ A;  3K4M A;  1TWC J;  1MKM A;  2CQN A;  4RMN A;  1IXR C;  5D8L B;  3SXY A;  3IH2 A;  2R3S A;  3Q0V A;  4E7I A;  1IC8 A;  3V7C A;  4ON0 A;  2ECB A;  4XSX F;  4RAY A;  2W57 A;  4C3H J;  3FXQ A;  4XKC A;  3CCV I;  3WG7 H;  5FRO A;  2P8T A;  4MFD A;  2WV0 A;  1YJW I;  4UB8 C;  5A2Q K;  1NH3 A;  3UKG A;  1C0W A;  1R5G A;  1IRZ A;  2WY8 Q;  5E3M A;  4BE1 A;  2W25 A;  2HKO A;  2M1B A;  3IH4 A;  5L3D A;  3PSI A;  3WTV C;  3H0D A;  2LFB A;  3P9I A;  4KIG A;  3ECO A;  4LIU A;  3CJR B;  2CO5 A;  2VJJ A;  2ZBK A;  2MYS A;  3OL3 A;  1I3Q J;  4G94 A;  3QQA A;  2BY1 A;  4IQJ A;  3K69 A;  2DMP A;  3KEO A;  2NAZ A;  2KLO A;  1A6Q A;  3TO9 A;  3JRH A;  2Y2Z A;  2X6Y A;  2X51 A;  3OYG A;  1Y0U A;  4U0W A;  2FNA A;  1MBH A;  3PQK A;  1LE8 A;  4BXU A;  2YR2 A;  1X1B A;  1BOB A;  1ON1 A;  2DMU A;  3DF8 A;  5K1Y A;  4UUT A;  1MBK A;  5IT3 A;  4RAZ A;  1OCR H;  1T98 A;  3HGG A;  2KIS A;  1J0R A;  3HKZ A;  3WTY C;  4IHS A;  4CZZ A;  1P7I A;  2R7X A;  4PJN A;  4N9H A;  2A6E F;  4PJM A;  2O6G E;  3KYC B;  5HS9 A;  2WAQ N;  2DT5 A;  2I10 A;  4EJT A;  4OIQ F;  4LJZ F;  1E0E A;  1I27 A;  3QPT A;  3F22 A;  4Y17 A;  1BW5 A;  2CW8 A;  1IRF A;  2EFO A;  1PJR A;  4FTH A;  2EWN A;  2Z2S B;  4M3B A;  1OLT A;  2L54 A;  2NYX A;  3GCM A;  4Y52 J;  3PFI A;  4LLG F;  2CV0 A;  5FKK A;  3HHH A;  2XSD C;  3QAH A;  1YRN B;  4GGG A;  4UXN A;  5JLW A;  5E1X A;  3B6C A;  3NWT A;  1EJ9 A;  1F5T A;  3RTR A;  3O6B B;  3GX4 X;  3W2A A;  3GZN B;  3PNV A;  1LPQ A;  4KT5 C;  4ZTJ A;  3DPU A;  1NG6 A;  1Z6T A;  4C2M J;  4DQ2 A;  2CJJ A;  3D0S A;  2R4G A;  4C30 A;  3ZGK A;  1CGP A;  2PMH A;  2ZJ2 A;  5DD4 A;  3BG5 A;  3ZMD A;  1BOA A;  4EVI A;  5E20 A;  4NHJ A;  2ICW G;  1OCC H;  1K4S A;  2QSF X;  2XPW A;  4D1Q A;  4Y33 A;  1XGN A;  4G12 A;  1VQN I;  2ZME A;  2PEX A;  1HLV A;  1FTZ A;  5DEQ A;  1YQA A;  2JWT A;  1Q1H A;  1VI0 A;  1D0Z A;  3O2P E;  4TV7 A;  4Y4R A;  4BHP A;  2V9P A;  2CW7 A;  1ZLJ A;  2HKX A;  3HL2 A;  4A6D A;  3VYS B;  2VOD A;  1I6X A;  3FF5 A;  4I6Z A;  4RB1 A;  5LBQ A;  5ICG A;  3CO6 C;  3VOE A;  3GTK J;  2VC0 A;  1HKQ A;  1WJF A;  4W1U A;  2HYG D;  3WHC A;  5M5Y J;  1VQM I;  1HKT A;  2FQ3 A;  1FMW A;  5DDG A;  3FHN A;  1JGG A;  2CUJ A;  3LSJ A;  2DFF A;  3A01 B;  1VQ4 I;  2ZB9 A;  2FOW A;  4L9V A;  2PG4 A;  5E17 F;  3S3N A;  1K7A A;  1FSE A;  1ZAO A;  4XKW A;  1OR7 C;  4HYE A;  2V4J C;  1JTY A;  2ETH A;  2ELK A;  2VI6 A;  4L0Z B;  4XR6 A;  3OR1 C;  2EPF A;  4E7S A;  5CQE A;  4FT8 A;  1FOX A;  3V7S A;  2YPR A;  5KVR A;  4BE0 A;  2ID3 A;  2W4S A;  2O8K A;  2MSY A;  5BPD A;  3BG6 A;  3PNY A;  2CWE A;  5LHH A;  4ZC3 A;  1W7P B;  3HPG A;  3S2H J;  3MVP A;  3I9V 2;  1KQ9 A;  1V54 H;  3VOD A;  2ID6 A;  4K2E A;  4UNO A;  4V2G A;  2P6S A;  4P9F A;  4GO1 A;  2R7T A;  3NAU A;  4S04 A;  4MEX F;  2LYC A;  3HJE A;  4AM3 A;  2VOO A;  3KP6 A;  3H0G J;  4Z2Y A;  5H2F C;  3QPH A;  3FHZ A;  4ZZD A;  2DA7 A;  2V26 A;  3K4N A;  2PBI A;  5J40 A;  4XRS G;  1BI1 A;  2VJ5 A;  3L2U A;  3JSO A;  4IO9 F;  1OYY A;  1P9Q C;  4LK1 F;  3G1L A;  2JA6 J;  3OYF A;  1EH8 A;  2VB6 A;  2TDX A;  1BJZ A;  2CFO A;  2YU3 A;  1N77 A;  4CA0 A;  1LE8 B;  3EUH A;  4U0V A;  3IRQ A;  2E19 A;  4Y7N J;  3I56 I;  5BPI A;  1BIA A;  2L7F P;  3CO7 C;  2STT A;  3LA7 A;  1VQK I;  1DPR A;  4DW6 A;  1IXC A;  2QVO A;  2ME0 A;  3AG2 H;  2R7V A;  2RV8 A;  4KDP A;  3A01 A;  1WFX A;  4D0P A;  2HVR A;  1HXD A;  3DCF A;  3U21 A;  1XX5 A;  1U9O A;  3PJR A;  1E2X A;  3CQZ J;  2LBF B;  4CDG A;  2L02 A;  1ZLK A;  1QZY A;  3J7Y J;  1EH7 A;  2JK3 A;  2Y31 A;  1EH6 A;  4LIT A;  3AAF A;  1YLF A;  1B6A A;  3L2W A;  1OCZ H;  2A5Y B;  1W0T A;  1WJC A;  3C1D A;  5BNG A;  1SEU A;  1ERD A;  3FBN B;  4ZYH A;  3DQV C;  3FBI B;  3ZMS A;  5ICE A;  1SAX A;  2A69 F;  4YIR X;  1FPQ A;  1TL8 A;  2JVG A;  2Y48 A;  2O3F A;  2GOX B;  2VQH A;  4KIF A;  1F36 A;  2Z5U A;  3WTW C;  3OYE A;  4UVA A;  5CQG A;  5FFZ A;  1MDM A;  3PIO F;  5D5V B;  2BXZ A;  5D4S A;  1R1T A;  1W36 C;  3HRT A;  4L5E A;  2WWY A;  1VQO I;  2OCC H;  1R9T J;  2LR8 A;  2P6T A;  4HX8 A;  3PL8 A;  2R5Y B;  1HOM A;  4B47 A;  3CF5 F;  2DK5 A;  4U88 A;  5EGO B;  3BZC A;  3CCJ I;  2LSO A;  2AXL A;  4ESJ A;  4A3L J;  2M4G A;  3M07 A;  4DZJ A;  2F2E A;  4AVP A;  4BHC A;  3EQL F;  4M3F A;  2HZD A;  5D4R A;  2XAH A;  1QVT A;  1APL C;  4OIR F;  1UCR A;  1XMA A;  1TQM A;  3LSM A;  3FK6 A;  1O3R A;  2HXI A;  3CCE I;  3CC4 I;  3QU6 A;  5GAD J;  2EFN A;  3SHF A;  1JKP C;  1YIO A;  3GFL A;  2DPU A;  3JTH A;  1KQ8 A;  1MBG A;  4GXO A;  2IA0 A;  2Z16 A;  3LQR A;  4E6K G;  2Q2E B;  3S15 J;  1MGT A;  3FK7 A;  4YG2 F;  1UZC A;  2FEZ A;  3WU0 A;  4BKX A;  4LMY A;  5CJ9 A;  1TLH B;  1TTY A;  1ZRC A;  3LAJ A;  5DV5 A;  3EYI A;  3QP6 A;  2B9S A;  5FGM A;  4Q47 A;  4BS9 A;  2MH2 A;  4GDF A;  3ZQ7 A;  4IZZ A;  5FD5 A;  2Q2E A;  1MMG A;  5IP9 J;  1USS A;  4M3E A;  2A68 F;  3TW7 A;  2R7O A;  4IJA A;  5K5O A;  1P92 A;  1HQC A;  5IOZ A;  4EJO A;  4A3B J;  2OC6 A;  2BY2 A;  3W3C A;  4A69 C;  3N97 A;  5E79 C;  1Z67 A;  2VAS A;  1YE9 A;  2BE5 F;  3K4B A;  3QOD A;  4MLO A;  4M9S A;  3DBL B;  2NS7 A;  3DU6 A;  3DKW A;  3FM5 A;  3T5X A;  1ACI A;  2R5Z A;  4XLP F;  3CCQ I;  1EA3 A;  2WB1 A;  4ZZL A;  2XGC A;  2E36 A;  2ZSI B;  4XLC A;  3HIF A;  5L3G A;  3ZMZ A;  2XUB A;  2K4B A;  2ZSH B;  4NB5 A;  2E35 A;  4V19 K;  1ITY A;  4HV5 A;  4WX9 A;  3KEY A;  2R7Q A;  3MZY A;  2EFQ A;  2JA2 A;  4BQN A;  1ETQ A;  3BTC A;  3GLX A;  3PM1 A;  2DW4 A;  2NVQ J;  1T08 B;  5F64 A;  4DJA A;  5F04 A;  1U8R A;  2CRG A;  1RUN A;  2D5V A;  2PN6 A;  2G7U A;  2PJP A;  1EF4 A;  5H6R A;  1WRJ A;  3O8H A;  1M1E B;  1P7J A;  1V5G A;  2EZK A;  3BPX A;  3ONQ A;  4YFX F;  2C6Y A;  2M9H A;  4N4O B;  2Q1Z B;  1IG7 A;  3VB2 A;  1KU3 A;  2MC3 A;  1MIJ A;  2F4M B;  4B43 A;  4XN0 A;  1Y0N A;  1ZTR A;  1FWZ A;  1QHH D;  4L5I A;  4OAY A;  1X3W B;  3NRV A;  1OCO H;  2JZY A;  1BC7 C;  5TIS C;  3BCB A;  3ZMV A;  3CDL A;  2QF7 A;  5EJC A;  3CCM I;  2GXB A;  2L9N A;  2DOD A;  2OTL I;  2M30 A;  2BVL A;  1D1A A;  3DTK A;  1RRJ A;  1QZZ A;  4G7Z F;  2KIF A;  3I55 I;  2M34 A;  4ANJ A;  1SMT A;  2M8E A;  3K10 A;  3CCL I;  2IRF G;  2IS6 A;  1HW1 A;  2EIK H;  2LOO A;  2XAF A;  4RGR A;  3HOY J;  4DBQ A;  1S5L C;  1XSD A;  2BGC A;  2G0E A;  1LFP A;  2H1K A;  1MNE A;  2Z3Y A;  1XSX A;  2FXA A;  2ZJQ F;  2JMW A;  2FNP A;  2K40 A;  1B1B A;  2FUG 2;  2ELH A;  2ADU A;  2F6C A;  2DA2 A;  5F1J A;  1WWX A;  3BR1 A;  5CLS A;  2HQA A;  4KIB A;  3A0H C;  3A02 A;  4Z6Y A;  1VQ6 I;  2OTJ I;  1KA8 A;  1K6Y A;  4XRS A;  2IP2 A;  1U78 A;  1BBY A;  4GRI A;  1S9H A;  5IYC J;  2GWR A;  3KP5 A;  1S8N A;  1X1A A;  2HQ5 A;  4FHT A;  2O9L A;  4B3A A;  4HV6 A;  3KP2 A;  3ZQG A;  1JKR C;  1UST A;  2ZNY A;  3R4K A;  1ZEL A;  3DEE A;  2HDD A;  1PUE E;  4DGW B;  2IT0 A;  2JA5 J;  1D3Y A;  3HOS A;  4B48 A;  2HS5 A;  2LY9 A;  3BG3 A;  1E17 A;  2CUE A;  1HKS A;  5HOD A;  3TP0 A;  1FOK A;  2K86 A;  4L9N A;  1F43 A;  3BJO A;  2QBY A;  1G3Y A;  1OQY A;  5HVQ C;  1WJA A;  2E1N A;  5EDN A;  3TDZ C;  1JT0 A;  2L7Z A;  3SJM A;  3EYY A;  4BDZ A;  3NWS A;  2EA4 A;  3ZOB A;  3FXM A;  1IAW A;  2LMD A;  4XM3 A;  4BH9 A;  2FBH A;  3I4N J;  1ZG1 A;  1R5I D;  2UZK A;  3RPU A;  2F5D A;  3U2R A;  2NOJ B;  4E7Z A;  4RLF A;  4ZYE A;  3TED A;  3CJT B;  3GXO A;  3MN2 A;  2XB0 X;  1XGO A;  3EET A;  4HA8 A;  2BBY A;  3CF2 A;  3M8E A;  5D5U B;  2VIX A;  1MH3 A;  1FP1 D;  1G3S A;  3RI4 A;  3SQN A;  3L2C A;  2O7O A;  4RGX A;  4ENJ A;  5DCM B;  2RQQ A;  1BC8 C;  1Z3Y A;  1MBE A;  3SDG A;  3R0A A;  2YX4 A;  1FLI A;  1KU2 A;  3LFK A;  2BW3 A;  2RGV A;  1XG1 A;  2P4W A;  2V6E A;  5J1U A;  3CCY A;  2E5N A;  4G7O F;  2W1O A;  1QNT A;  1QZE A;  2X6X A;  4CZC A;  3SDB A;  1LDJ A;  1YX5 A;  1MND A;  1HDD C;  3DEW A;  3VDX A;  1LEA A;  4A6E A;  2LF8 A;  1V3F A;  5C4X J;  4BGD A;  1HBX G;  2IXS A;  4CSW A;  5IPA A;  4BQA A;  3KET A;  4FQG A;  5E1W A;  1OFC X;  2VXZ A;  2XPV A;  3OSF A;  5E3L A;  1JE8 A;  4IHT A;  4UY8 I;  3DP7 A;  3DBR B;  3R0J A;  3BC8 A;  2XAJ A;  4UUS A;  1MBJ A;  3ISP A;  2B7E A;  1V4R A;  2LG4 A;  2XAU A;  3BQZ A;  3K70 D;  4AIH A;  2A5W A;  2LKP A;  1Z21 A;  3DKY A;  1JXS A;  4KIC A;  2VE8 A;  2WB1 N;  1VTN C;  2DFE A;  3RKQ A;  3CCU I;  2KHM A;  2MFZ A;  4NUB A;  2PMZ A;  3MKZ A;  2DMT A;  4GYG A;  2CW0 F;  2EIJ H;  5DS9 A;  3Q9V A;  1FOW A;  2FX0 A;  2FQ4 A;  1B9M A;  2D1H A;  4O3M A;  4A3F J;  1FZP B;  3F23 A;  1Z7U A;  3I59 B;  2R7F A;  3KP3 A;  4OOI A;  5B5E C;  1T39 A;  2OZ6 A;  1DQU A;  5L3B A;  2Z99 A;  4I0B A;  3V8J A;  3E6D A;  1R49 A;  1E3H A;  1HF0 A;  2K3P A;  4IQ4 A;  3T0Y A;  3I0T A;  5GTI C;  5HLG A;  4YFK F;  2JVH A;  1G3T A;  4LOC A;  1TNS A;  2QKM B;  4CCL A;  2AO9 A;  4G6D A;  3JAM K;  5C44 J;  3U1K A;  4HDV A;  2O0Y A;  3F8C A;  3OYH A;  1J2X A;  2EIM H;  4HG2 A;  2VJ4 A;  3BQY A;  3TBI A;  3TKY A;  2QEX I;  3G71 I;  1LVA A;  1V55 H;  3OR2 C;  1X1C A;  2QZ8 A;  1XDU A;  3E6B A;  3E97 A;  3MAJ A;  4CYC A;  1BA5 A;  2I5U A;  4F91 B;  3IH3 A;  4E7K A;  4MHG A;  2P5L C;  3M1E A;  3QYB A;  1X58 A;  3HUG B;  3J80 Z;  1KON A;  3HM5 A;  2R93 J;  3K1P A;  4CYC B;  3HKZ N;  2XAS A;  1KU7 A;  1XTA A;  3HGY A;  5LHI A;  3G1O A;  3K4K A;  1ZGA A;  1XGM A;  1XS9 A;  3D5R C;  3I3L A;  3GBG A;  3LSG A;  5CVR A;  3LL7 A;  2R0Q C;  1RPW A;  2QLZ A;  4EMS A;  2IGM A;  3K7A J;  3JRA A;  2IBD A;  2XF7 A;  2OCE A;  3BZK A;  2PLY A;  1S72 I;  2NVX J;  1N78 A;  1LUJ B;  1IW7 F;  2GZW A;  4F92 B;  5IYB J;  4A3E J;  2BOL A;  1Y56 A;  4RS8 A;  4B09 A;  3PUB A;  4RM3 A;  2CG4 A;  3F9K A;  2M0M A;  1R4N B;  3BR0 A;  4DBR A;  1Z05 A;  2KFD A;  3M9A A;  1J59 A;  1Y8R B;  3M8F A;  4KN4 X;  4D7M A;  3IAM 2;  2QGU A;  3OYN A;  3KEQ A;  3CUO A;  4J19 A;  4PJJ A;  1I3A A;  2DYR H;  2NVU B;  1YO5 C;  1GT0 C;  3PO3 J;  2DT7 B;  3TP3 A;  1RIO H;  1J5Y A;  3LA3 A;  2ZME B;  1IO2 A;  1IN5 A;  2DCE A;  1ZR4 A;  5LEJ A;  4I99 C;  2DFH A;  2KL4 A;  4PJL A;  1HW2 A;  1RZ4 A;  2OPT A;  2CQQ A;  3I58 A;  3ABK H;  1JJ6 C;  2L01 A;  5TRD A;  3BR6 A;  1X3Z B;  3ZMU A;  4EGZ A;  2M4K A;  3H92 A;  1UB9 A;  4HBL A;  2KT0 A;  1SD5 A;  2E1M B;  1A04 A;  3MMY B;  3WGI A;  2QSG X;  2HOS A;  4RB2 C;  1VQP I;  1L0O C;  2PX9 A;  1JHH A;  3GTM J;  2CQ7 A;  5JHU A;  3KPH A;  2E60 A;  2DDA A;  5FKM A;  2EJR A;  3BP8 A;  3OIQ A;  3FXL A;  2V1X A;  5E8I A;  3OY9 A;  1SVO A;  1WKM A;  1XPX A;  1R1V A;  1MJB A;  2EZI A;  2KP6 A;  3QYE A;  4H4K C;  2BYV E;  4IVN A;  1ETX A;  2JJ7 A;  4EJV A;  2DA1 A;  3AG4 H;  4YRV A;  5KNL A;  3QU3 A;  2HEO A;  4EEF G;  4CGZ A;  3NEU A;  4KJZ A;  2H27 A;  2GXA A;  1KU9 A;  4BL0 B;  3HSE A;  4U7D A;  3IL2 A;  3JRI A;  1GHC A;  3ERE D;  5JVT A;  1U6G A;  3HRM A;  3ROU A;  1MNM C;  3S16 J;  1OIS A;  2GA1 A;  2DBB A;  2HOA A;  2RN7 A;  1ZYR F;  2JUC A;  1SD7 A;  3J81 K;  3TGN A;  3SZT A;  2O8X A;  3QRF F;  4C3I J;  3O8G A;  3S3O A;  4I2O A;  4BXF A;  1WI9 A;  5J1Y A;  2LY1 A;  3V4G A;  4RLQ A;  2KKO A;  3CP2 A;  2K3F A;  3ABT A;  4PCQ A;  1AA7 A;  2EV5 A;  2RKH A;  4L18 B;  4GCV A;  4XRM A;  3S8P A;  2F48 A;  4PK4 A;  1TQI A;  4B1R A;  1SVM A;  1E3P A;  1I39 A;  1J75 A;  3CMA I;  3WTT C;  2R7S A;  4IRG A;  3IHU A;  3U9G A;  2BW3 B;  4XLA A;  2OV7 A;  2ISZ A;  1P4A A;  5D6E A;  4X0G A;  3K4C A;  1FEX A;  2QQ9 A;  1FSH A;  2WAF A;  1VQL I;  3AL0 B;  4OIO F;  1ZH5 A;  3WOD F;  5IOY A;  5K7H A;  1TWG J;  2XIG A;  5LD2 C;  2MG4 A;  1QPM A;  2FD5 A;  3DTE A;  3I5U A;  3TO6 A;  2Y0M A;  3OIO A;  2O61 A;  1KGS A;  1T8I A;  1KQ0 A;  2HWV A;  3OS0 A;  2R92 J;  2VQG A;  1MW7 A;  5LFA A;  1H88 C;  5HDN A;  4P96 A;  4G7H F;  2M7B A;  1IRG A;  1AU7 A;  1U5T C;  2IEK A;  2LD5 A;  3HXL A;  3KX2 A;  2X6O A;  1N25 A;  5F08 A;  1GDT A;  1GV2 A;  4RB0 A;  3S93 A;  4JBA A;  1GVJ A;  2Y9Y A;  3IKT A;  4RAF A;  4JX4 A;  1JT6 A;  3AL0 C;  3LSR A;  1S29 A;  3HG9 A;  2F5V A;  1NHA A;  2L0K A;  4BY7 J;  3Q5F A;  1SAN A;  2HTJ A;  3A03 A;  1A31 A;  3HBL A;  2R7D A;  5E3N A;  1VQ9 I;  1XMX A;  3S14 J;  4ETS A;  1BR4 A;  3S1N J;  3FZV A;  2V1N A;  4M9Z A;  1ETY A;  2GM4 A;  1BI0 A;  2Y75 A;  1JTX A;  4N0B A;  1WH7 A;  3FKI J;  2E1C A;  3IWF A;  3M8J A;  2LH9 A;  4ZYA A;  3VYU B;  1WGX A;  2EH3 A;  1IN6 A;  1Z6R A;  3I4M J;  5DTD A;  3KCC A;  3FM3 A;  4IRH A;  4M6Y A;  3V8K A;  2ZME C;  5CVU A;  3ZQL A;  3W2V A;  4D5C A;  3H3U A;  1A35 A;  4UVB A;  1IV8 A;  4FCY A;  4R8H A;  4QPQ A;  2DOA A;  3IRR A;  4OU0 A;  3HEF A;  3FIS A;  2AS5 F;  1W7P A;  2QCO A;  1Y6I A;  2OU2 A;  2X1C A;  3LA2 A;  2CV2 A;  1RES A;  6PAX A;  3ESW B;  1SMY F;  4Y3O A;  3VFZ A;  2EV0 A;  1FJL A;  1Y39 A;  2VT2 A;  4XLF A;  3T8R A;  4B3X A;  3R61 A;  3WE2 A;  3MZH A;  4BAY A;  2MLG A;  3H3V K;  5BQT A;  3JRC A;  1DP7 P;  3HZJ A;  3Q9S A;  1X4P A;  1MMD A;  4IRI A;  1YG2 A;  1MMS A;  4DNC A;  3DPL C;  1IV6 A;  4LG0 A;  5J4Y A;  4BDY A;  1PUF A;  1TWH J;  4HF1 A;  1DDN A;  5F0H A;  2IS1 A;  2QWW A;  3R6S A;  3ASN H;  5LRS A;  4IHX A;  1XDS A;  3L1P A;  4DZP A;  2RDP A;  1Y1W J;  2DA6 A;  1LKX A;  2COB A;  2LVS A;  3GUD A;  4Q4Z F;  5DM7 F;  1K79 A;  1UG0 A;  5LHG A;  1ZQ3 P;  1BM9 A;  3JTG A;  2CFX A;  1IXS B;  5K7Z A;  2E1M C;  4AIJ A;  5BMZ A;  1ORK A;  5HLT A;  3OYM A;  5EZH A;  3HB9 A;  3TO7 A;  4ESB A;  1KZH A;  4XID A;  2KMU A;  4MTD A;  1FIA A;  3GZ5 A;  1EKE A;  2XRL A;  4PGH A;  1QA6 A;  2CSO A;  2CUF A;  3GWZ A;  2Q0O A;  4A93 J;  1SFX A;  2NS8 A;  4DYR A;  1DP3 A;  3CME I;  3MKY B;  3CDH A;  3OV8 A;  2XPU A;  1H0M A;  3K2A A;  1R6R A;  3M7G A;  3GTQ J;  2BVM A;  2VON A;  1BIB A;  1KYZ A;  3AFH A;  3CC2 I;  1RR8 C;  2GAU A;  3HRU A;  3B73 A;  2M3A A;  4BHB A;  1SFO J;  1XB4 A;  2RQP A;  1UJ8 A;  4G8X A;  2GA2 A;  2Z33 A;  2KRF A;  5D5W B;  1V5F A;  3FKJ A;  4I0A A;  2QM3 A;  1QU3 A;  1JKO C;  3CUQ B;  1HW5 A;  1FX7 A;  1Z91 A;  2DJI A;  1VQ7 I;  5HOO A;  5IYD J;  1TBX A;  4BE2 A;  3LSI A;  1OYI A;  4KA4 A;  1MDM B;  2LBF A;  2XDV A;  4ZYG A;  4R1H A;  3K70 C;  2CMP A;  3MCZ A;  1VZ0 A;  1R5H A;  2BHY A;  3D5L A;  4ABZ A;  2D45 A;  2FMY A;  3GTG J;  2VE9 A;  1X4O A;  1ZRE A;  1R22 A;  2RNG A;  4MFE A;  2KIU A;  2H09 A;  1D1C A;  2IA1 A;  4MGR A;  3DLA A;  5DD8 A;  3CC7 I;  2ZO4 A;  4HLX A;  1REP C;  4LIV A;  1MJ9 A;  2L5Q A;  4UB6 C;  5JI6 A;  1XGS A;  2RAE A;  3GFI A;  3TMO A;  2VPL A;  1BJA A;  2VKD A;  3K1M A;  2R5Y A;  2GBY A;  2EV6 A;  2LKS A;  3LOC A;  4HAM A;  4M71 A;  3JCU C;  5KAI C;  3W6K B;  4NDL A;  3H9Q A;  4IF4 A;  2PJR A;  3GFJ A;  1TNT A;  3UNG C;  4Y15 A;  5FLM J;  1YYV A;  3GO5 A;  3GYH X;  3NAR A;  4KMU X;  4BNC A;  1FY7 A;  1HSJ A;  3J81 Z;  1HC8 A;  3WGH A;  4FET A;  1ZN2 A;  2K4J A;  4O5V A;  1B72 A;  1ETV A;  3FXO A;  1YW7 A;  2XKO A;  3FXK A;  4OIP F;  1BN5 A;  5ILV A;  4XN3 A;  5GPC A;  1TT0 A;  2V7F A;  2P7V B;  5J4V A;  3VSL A;  5JFR A;  3M3Y J;  2N8G A;  2YS9 A;  3PNT A;  1UHW A;  4PGG A;  3QP5 A;  4JX5 A;  1CF7 A;  4XLE A;  3JAM Z;  1G2H A;  5DYM A;  1TP4 A;  4UV9 A;  1LNW A;  3F6O A;  4HF0 A;  4CCJ A;  4WCG A;  2MBF A;  4C2T A;  5H6Q A;  2WBM A;  2JN6 A;  3L9F A;  4HZF A;  2IA2 A;  1OKR A;  4YFN F;  2B63 J;  1S3J A;  4EQQ A;  4ENN A;  5IT9 Z;  3PO2 J;  4DYC A;  1O7L A;  3TDU C;  1VND A;  1NTC A;  2IGK A;  2UUZ A;  4RDU A;  3DXJ F;  3FXU A;  1XCB A;  4AVZ A;  3E7L A;  1Y8Q B;  2M5W A;  2W82 A;  4FIS A;  4HQM A;  4O6J A;  3OYJ A;  2D1V A;  2P7C B;  2HOE A;  2NVY J;  4A0Z A;  2FA5 A;  3W6J B;  1DGW Y;  5GTH C;  5B1A H;  1UG2 A;  2LNB A;  1OR7 A;  3W2W A;  2MA3 A;  2OQG A;  3BR5 A;  3E0J B;  4HNT A;  3DTI A;  4IPA A;  4M9X A;  1WJ5 A;  4RAG A;  1DU6 A;  1X3U A;  2X0L A;  5FB2 A;  2MW8 A;  1RI7 A;  2L9V A;  3V42 A;  1D0X A;  4EJU A;  4WXD A;  4XKV A;  2LC2 A;  3G6E I;  3GTO J;  5B1B H;  1PYV A;  5M3M J;  3OSG A;  2HZT A;  3GF2 A;  3RKY A;  3R60 A;  3RJP A;  2VN2 A;  4H0E A;  3K6G A;  2UXX A;  3H35 A;  5TJJ A;  3VYT B;  4KT6 A;  4AD9 A;  1WHU A;  2Q8K A;  1B4A A;  3I53 A;  3LSK A;  2KJB A;  3F8M A;  2NXN B;  3E6C C;  1BI3 A;  2XC7 A;  2L7M P;  3BRO A;  2WAQ A;  4M6V A;  2VL8 A;  2H8R A;  3F8F A;  5J6X A;  3LWF A;  3I54 A;  1P2F A;  1YS6 A;  2K9N A;  5LRR A;  3L2V A;  1W5S A;  5F0C A;  2OQR A;  2NOG A;  4B44 A;  2IS2 A;  4XBF A;  2K9L A;  1AOY A;  3HDD A;  2ZFU A;  3BTJ A;  3OYB A;  2YSR A;  5KAF C;  1XC5 A;  2M8G X;  4A5N A;  4E7J A;  3BZ6 A;  2AHQ A;  3K4J A;  2VOP A;  1IN8 A;  4C3J J;  5F1R A;  4BXX J;  3EUK L;  2M7A A;  2PMU A;  2HDW A;  4A5M A;  3EUA A;  2QQA A;  3A4C A;  2ZXI A;  5ILU A;  2PQ8 A;  3FDY A;  2KZV A;  4L0Y B;  2O5R A;  2LDU A;  2Y9Z A;  1ZAR A;  3E5X A;  4PDK A;  3CD6 I;  3J80 K;  5GP9 A;  3VSK A;  4KMF A;  2E7W A;  2MGQ A;  3BT9 A;  2P81 A;  2HQR A;  1JHF A;  5DCF A;  1T0F A;  1O57 A;  2GIV A;  1Q1V A;  4ZYD A;  2CQK A;  5HS8 A;  2VJI A;  1ZKG A;  1F1Z A;  1SFK A;  3G1M A;  4XOP A;  3HSR A;  5LGN A;  4F3Q A;  1O4X A;  2EBI A;  2QBY B;  1Z77 A;  5HNH A;  4RGU A;  1ENH A;  1RC9 A;  2HYJ A;  3ABM H;  2TRT A;  4OWR B;  2K7L A;  2VKV A;  3KYD B;  1T33 A;  4BQQ A;  2YU9 J;  2VBW A;  3RPQ A;  2FOK A;  4GYI A;  2LF7 A;  4YEL A;  4II3 A;  3SZG A;  4X1E A;  4A3G J;  2IGN A;  1YX3 A;  5J3L A;  1BW6 A;  1H9G A;  2HGC A;  3OWT A;  3RCO A;  1FYM A;  1G59 A;  4WXC A;  1BL0 A;  2V79 A;  1LEB A;  1IUY A;  2NRA C;  3E6M A;  3S17 J;  2DA3 A;  2GOM A;  4KNY A;  3BG9 A;  5A2Q Z;  4BYY A;  1XD7 A;  1JKQ C;  3BWG A;  1SC7 A;  4CH7 A;  1ZRD A;  1YIJ I;  4XLN F;  3K0L A;  3F8N A;  5J47 A;  3PUF A;  2HVS A;  2KIQ A;  1IUF A;  2M0C A;  1XN7 A;  3HPH A;  1QHG A;  2OD5 A;  1ZG3 A;  4RM2 A;  4QLC U;  2ACJ A;  1ULY A;  1YJ9 I;  3C18 A;  2Y0S N;  5FD6 A;  4HDU A;  3ZCO A;  4AYB A;  2G9W A;  2ESH A;  2HPM A;  4WXH A;  1WJB A;  4N4N B;  1LJ9 A;  3O3K A;  3CCS I;  2F5E A;  3MFK A;  1PUF B;  2XGX A;  3J7A O;  2DAO A;  5HDG A;  5L3E A;  4I7H A;  1SD6 A;  2XSJ C;  4HLY A;  4LB6 B;  4CXF A;  3OYI A;  4HOB A;  1VQ5 I;  4HEA 2;  2P0W A;  4J01 A;  1WPK A;  3CES A;  1LB2 A;  4A3D J;  4XSZ F;  3KLN A;  4P5O A;  1K4T A;  1OYW A;  2OF7 A;  2JA7 J;  3CDI A;  1MSE C;  5ICF A;  5LEK A;  4UVC A;  3H9G A;  1UFM A;  1T2K A;  4ESF A;  4A3J J;  1ZR2 A;  2KQR A;  3KE2 A;  4DIQ A;  1VQ8 I;  1TQP A;  2DN0 A;  5HLI A;  1IF1 A;  1XCV A;  3GTJ J;  3WGG A;  1WI3 A;  4M73 A;  4X6A J;  3DLL F;  2EZH A;  2K02 A;  5CVJ A;  4XL9 A;  4AUX A;  1WSU A;  2XHK A;  2ZFW A;  3S32 A;  4P9U A;  4LB5 A;  1CQT A;  2XAG A;  3PIP F;  2PFB A;  4M3G A;  4NC8 A;  2FF4 A;  4HNV A;  2WC2 A;  4YII A;  2DQL A;  2Y0S A;  2QQB A;  3QWL A;  3WTU C;  1D5Y A;  3MEX A;  4RB3 C;  1MH4 A;  2V1D A;  3E5U A;  4FAS D;  1T6S A;  4OMY A;  5LLQ A;  1D1B A;  2JRT A;  3KP7 A;  1IZ1 A;  5CVV A;  1FNN A;  1SVL A;  4KUM A;  4S0H B;  3D1N I;  2VBZ A;  2XF5 A;  5GAG J;  1QQI A;  2XGD A;  1D5V A;  3S2W A;  4XOT A;  2L7K A;  3I4P A;  4A2U A;  1S7A A;  3LMM A;  1UHS A;  4PFO A;  2HDC A;  2DTR A;  1FC3 A;  2NVT J;  5GAE J;  2DA5 A;  3QYF A;  4E4H A;  5J1R A;  2LRD A;  4ENK A;  2EK5 A;  1HST A;  2I8D A;  3PSF A;  3SEZ A;  3FXR A;  1IRX A;  4D7N A;  1R36 A;  2DOE A;  1XMK A;  4ZDL A;  5ED4 A;  5AIP A;  4D5F A;  2E2H J;  5FKN A;  2ZKZ A;  1BI2 A;  2ESN A;  5FKO A;  3HYI A;  4IXA A;  1J9I A;  1Z9C A;  2D2W A;  4NQW A;  3ZN0 A;  3GTP J;  3HC7 A;  3GFM A;  3UR3 C;  2GXG A;  4CO8 A;  3DV8 A;  3OL4 A;  3COA C;  1FBU A;  1YW9 A;  4NC7 A;  1K61 A;  1PDN C;  1JI8 A;  3RQ4 A;  2BV6 A;  4U7B A;  4BY1 J;  2A6T A;  4XIC A;  3ZN1 A;  2MC4 A;  3BCA A;  2DI3 A;  3IKV A;  3M1C A;  3MD2 A;  5IP6 A;  1IN7 A;  3VYR B;  4I09 A;  4E7L A;  2V1U A;  2H6C A;  4HSR A;  2OA4 A;  2A6H F;  3OYD A;  2QUF A;  2A05 A;  4PFP A;  3KYL A;  2X9D A;  3JR9 A;  1W5T A;  5IP7 J;  2JUG A;  1PP7 U;  2X6W A;  1JUS A;  1K83 J;  2WV1 A;  4HX7 A;  2ZXW H;  4NC6 A;  4XNF A;  2OZU A;  1U5T A;  5K5Q A;  3P7N A;  4FX0 A;  2IS4 A;  1NK3 P;  1P4W A;  1FIP A;  2ZCW A;  4U87 A;  3C2B A;  4D9J A;  2Y30 A;  1WCM J;  5D8K B;  2QA4 I;  1XSV A;  3HOX J;  2RNJ A;  4ZDO A;  2KRC A;  1WJE A;  2CS3 A;  2W7N A;  3ASO H;  1D8K A;  4A3I J;  2Z9O A;  4YEJ A;  4F7Z A;  4MO7 A;  2QYO A;  1K6O A;  5CYV A;  1I50 J;  3RYP A;  1SAU A;  5AON A;  4HF2 A;  3H5N A;  4LGW A;  2DA4 A;  2LK2 A;  3JSP A;  4AWX B;  3Q3S A;  5D5X B;  2FJ1 A;  1L3L A;  2PJR B;  3W6V A;  2DFI A;  1G4D A;  1Z0X A;  3K4L A;  1I1S A;  1N75 A;  2E1O A;  3KZY A;  1YW8 A;  1NG7 A;  2PMZ N;  1SFE A;  2BY0 A;  2ZJR F;  4WWC A;  5EEA A;  3ERM A;  3B6A A;  5FLX K;  5E8G A;  1DU0 A;  1JJ8 C;  3V8L A;  2E2I J;  2H8W A;  3HTS B;  4LK0 F;  4JQF A;  4R79 A;  2CH0 A;  2FBI A;  5KHD A;  5LGU A;  3KLO A;  2DDB A;  1FYK A;  5H20 A;  2X4H A;  4F52 A;  5GPA A;  3CLQ A;  4CUG A;  3CCR I;  1ZGJ A;  2HQN A;  4DOZ A;  4IHW A;  2H1L A;  2IGO A;  3BOQ A;  4L5J A;  1A5J A;  2BZT A;  2VUM J;  2DTZ A;  2JSP A;  3RYR A;  4JP0 A;  1I5Z A;  3DEU A;  2X48 A;  4AC0 A;  4FX4 A;  3OS2 A;  1BR2 A;  4KN7 X;  2GLO A;  3VEP A;  3CMM A;  3FMR A;  4JX6 A;  4CCN A;  2STW A;  4OAZ A;  4CYD A;  5C3E J;  2JRM A;  3HOW J;  4AIK A;  3E1S A;  1FBQ A;  3LAP A;  1B9N A;  3ZQC A;  3H3Z A;  3P9C A;  5FJ8 J;  2EFP A;  1ZRF A;  2MH9 A;  1TT5 B;  3FMQ A;  2F5C A;  1TZL A;  3OYL A;  2E2J J;  3EDP A;  3RDI A;  4MEY F;  2L9S A;  1W4M A;  3WU1 B;  1U3E M;  3IC7 A;  3OMY A;  3OYA A;  5ERI A;  2QQ8 A;  1T95 A;  4G9Y A;  4XKB A;  2W84 A;  3AG3 H;  3ZR8 X;  3F21 A;  1OMI A;  3LSP A;  3L2R A;  3KZZ A;  2DOF A;  2DPD A;  4A12 A;  3I71 A;  2W85 A;  4V2F A;  3ZQH A;  3RZO J;  2X85 A;  1DPU A;  4ZH4 F;  2J5P A;  1MSF C;  5FO5 A;  2ZXJ A;  1UHM A;  1RNL A;  2KDZ A;  1QPI A;  2JPC A;  3T8T A;  5FKL A;  3H1C A;  2EFW A;  3K2Z A;  2R7U A;  5JVG F;  1YHQ I;  5IT9 K;  4L9T A;  3RZD J;  1GXQ A;  1IN4 A;  2XGE A;  4KFC A;  3A2K A;  2UWM A;  1WZ2 A;  2EIN H;  5KCM A;  2P5V A;  2L4A A;  1TW3 A;  2O03 A;  3VWB A;  5DCM A;  1FP2 A;  2L2O A;  3SFI A;  2ECC A;  3RKX A;  1WQ2 A;  4WF2 A;  1YRN A;  1RUO A;  4M6X A;  1ZGW A;  3K1N A;  3L00 A;  2J5O A;  1KYW A;  3GZ6 A;  1OPC A;  4JYK A;  2IVM A;  2KJC A;  2LY2 A;  2QEN A;  2M87 A;  3LST A;  2RRE A;  2KZG A;  4JK1 X;  1TWF J;  2FRH A;  3MKL A;  4G6T B;  5GAH J;  2K27 A;  1CF7 B;  1X1D A;  2HI3 A;  4F55 A;  3C2H A;  3CP8 A;  2ME6 A;  1I6H J;  3JRG A;  3G4S I;  1IDZ A;  5EG0 B;  4QIW N;  1GXP A;  1WVR A;  3N4M A;  2FSW A;  2IJL A;  4IEJ A;  5J8C A;  1ZHF A;  1SD4 A;  5F27 A;  2ZC2 A;  5IY5 H;  4BBS J;  1QO0 D;  5CKT A;  3RPU D;  4BUP A;  3BJA A;  2HNH A;  3FXJ A;  2A61 A;  5EEG A;  1LFB A;  3DU5 A;  1S7E A;  4QPO A;  5JR3 A;  3NQO A;  1YTY A;  2YUS A;  4L9J A;  3LFU A;  1POG A;  2GQQ A;  2VLA A;  3S3M A;  3QPS A;  3S1R J;  1STZ A;  3SYT A;  3JRB A;  4HX4 A;  2JTV A;  1GLN A;  2E5Z A;  2CYY A;  3KZI C;  2BHZ A;  5HDK A;  4EGY A;  9ANT A;  3J7Z I;  5BOX A;  1MMN A;  3L2Q A;  4HRI A;  2VQL A;  2Y69 H;  3LNQ A;  2K9S A;  3ZQF A;  3G3Z A;  1G3W A;  2BXY A;  3F8B A;  3FIW A;  1X19 A;  1W0U A;  1B72 B;  4IOC F;  1S6L A;  1R4M B;  4AID A;  1BR1 A;  3GVA A;  2WA0 A;  2WAE A;  3ML6 A;  5ICC A;  2A07 F;  2HR3 A;  4CIC A;  2OUM A;  2E7X A;  1FMV A;  5K5R A;  4EJW A;  1VFC A;  5EYR A;  1UMQ A;  1YIT I;  4LD5 A;  2IAI A;  2WY7 Q;  2WAD A;  3RQI A;  3FMS A;  2KPM A;  4WK8 F;  3A1Y A;  3OOU A;  3P5J A;  4XRF A;  3S1M J;  2OBP A;  1U2W A;  1Z3X A;  3RKW A;  5DUI A;  2LP0 A;  4NNJ A;  3F6V A;  3L09 A;  3QOE A;  5JHF A;  2L9R A;  1FBS A;  3MQ0 A;  4EM2 A;  1G8X A;  5DUK A;  4PUS A;  5L3F A;  1YI2 I;  3ECH A;  1PP8 F;  4I02 A;  2FU4 A;  3WE3 A;  4RBO A;  3IUO A;  1FTT A;  3D5S C;  4Q48 A;  3KIO A;  5E18 F;  2IPQ X;  3ZXS A;  2FML A;  2Z1D A;  3FWE A;  1GVD A;  1DUX C;  2JA8 J;  2MD0 A;  1Y1V J;  4HW0 A;  2DMQ A;  2H94 A;  5F6F A;  4BU2 A;  2EA2 A;  4UUV A;  1Z7L A;  1AKH A;  2E34 A;  4MTE A;  4S05 A;  1Z1D A;  3HUG A;  1QBJ A;  1OCT C;  4PSX A;  2ISY A;  2NNN A;  2HXO A;  2K9M A;  3I64 A;  1B59 A;  1ON2 A;  2BY3 A;  4IL6 C;  4ENM A;  3CJN A;  4FE4 A;  1W5C C;  1ETW A;  4QTR A;  1YFH A;  3HOU J;  4A3C J;  3U1D A;  2M45 A;  2DT6 A;  2F4O B;  2XVC A;  2A3S A;  3GW2 A;  3OYC A;  1MD0 A;  2EZL A;  4CCO A;  2HPI A;  1AKH B;  1FT9 A;  4G6Q A;  2CGP A;  3J7A Y;  3WTZ A;  1FOY A;  3RSN A;  2HOT A;  2B0L A;  1HCR A;  4N9I A;  4BAC A;  4YIF A;  5M3F J;  2VKH A;  4KIT B;  4OMZ A;  4PZJ A;  4IX7 A;  2HTS A;  3WTS C;  4A3M J;  2RC4 A;  3TOA A;  1S7O A;  2IW5 A;  5FRN A;  2XF6 A;  2KDO A;  3JRD A;  3B02 A;  3HOZ J;  4LLL A;  3I59 A;  1R23 A;  1E3O C;  2V6C A;  3HOT A; 
#chains in the Genus database with same CATH homology
 3SZG A;  3H9J A;  3U21 A;  1U0J A;  3OIQ A;  3OY9 A;  3N05 A;  2IGN A;  3PJR A;  1HA8 A;  3BG7 A;  1YX3 A;  3RCO A;  3OWT A;  1G59 A;  2X1D A;  2LBF B;  4HPQ A;  1LVK A;  1WJD A;  4LIT A;  2GOM A;  3L2W A;  2KP6 A;  3QYE A;  4H4K C;  3DPT A;  1WJC A;  4II2 A;  4CH7 A;  1ERD A;  3FBN B;  4YRV A;  3DQV C;  3FBI B;  5KNL A;  2R7W A;  4KJZ A;  4BL0 B;  2JVG A;  1D0Y A;  2HVS A;  4ITV A;  2GOX B;  2VQH A;  3HPH A;  1QHG A;  3OYE A;  4RM2 A;  5CQG A;  4XOR A;  2ELJ A;  3ZCO A;  4AYB A;  2HPM A;  4ZJZ A;  1W36 C;  1WJB A;  3C2G A;  4N4N B;  3S3O A;  3BLY A;  4BXF A;  2LY1 A;  2KRH A;  4RLQ A;  2VXD A;  3PL8 A;  3CP2 A;  4B47 A;  1AA7 A;  3EPZ A;  3S8P A;  3MKW B;  4PK4 A;  2UV1 A;  2W00 A;  2XSJ C;  2M4G A;  3ZQQ A;  2R7S A;  3IP4 B;  3OYI A;  2BW3 B;  2X1E A;  4HEA 2;  4XLA A;  2P0W A;  2OV7 A;  2HZD A;  4BJ5 C;  4J01 A;  3CES A;  2QKL B;  4X0G A;  4BEH A;  3K4C A;  4P5O A;  2WAF A;  3AL0 B;  3LSM A;  3H9G A;  3SEQ A;  1LDK B;  2KQR A;  4DIQ A;  5LD2 C;  3CJQ B;  3DTE A;  4AU7 A;  4HNU A;  5FRM A;  2Z16 A;  4E6K G;  3OS0 A;  2Q2E B;  2VQG A;  2ZXH A;  1MW7 A;  5LFA A;  4XL9 A;  3OYK A;  3OIP A;  2M7B A;  3S32 A;  4P1W A;  1J09 A;  1UAA A;  3HXL A;  3KX2 A;  4NC8 A;  1W36 D;  2HVQ A;  4KIS A;  4BS9 A;  2Y0S A;  3DWL E;  3S93 A;  4IZZ A;  1MMG A;  2R7O A;  3AL0 C;  4BJT A;  4FAS D;  2OC6 A;  3HG9 A;  2F5V A;  2MAB A;  3W3C A;  1D1B A;  2VAS A;  1YE9 A;  3K4B A;  4EAT A;  3QOD A;  2XF5 A;  4MLO A;  3LSH A;  4XOT A;  3DU6 A;  2L7K A;  1BR4 A;  3LMM A;  2V1N A;  4PFO A;  1EA3 A;  2WB1 A;  4J00 A;  4ZTF A;  2ZSI B;  4XLC A;  3QYF A;  4E4H A;  2LRD A;  3M8J A;  2I8D A;  2ZSH B;  3PSF A;  3SEZ A;  2LH9 A;  4ZYA A;  3VYU B;  2HVR A;  4C2U A;  3KEY A;  2R7Q A;  1IRX A;  5CPR B;  2JA2 A;  4BQN A;  4ZDL A;  4BJ6 C;  4DJA A;  4ZDP A;  3W2V A;  2R7R A;  4CCM A;  4CCK A;  5TGT A;  4QPQ A;  2DOA A;  4XQF A;  1V5G A;  3HC7 A;  3ONQ A;  3UR3 C;  2AQE A;  3OL4 A;  1Y6I A;  2X1C A;  4NC7 A;  4N4O B;  2Q1Z B;  2CV2 A;  3RQ4 A;  1JI8 A;  4U7B A;  4Y3O A;  4II3 A;  2A6T A;  4XLF A;  4B3X A;  4B43 A;  4XN0 A;  2MC4 A;  3BCA A;  4BQO A;  1QHH D;  3M1C A;  3MD2 A;  4OAY A;  1X4P A;  1MMD A;  3VYR B;  1UEL B;  4E7L A;  3G2B A;  3BCB A;  4HSR A;  3DPL C;  2CV1 A;  2L9N A;  3OYD A;  4E7H A;  4BDY A;  4JOM A;  3TL4 X;  3ZRG A;  2BVL A;  3KYL A;  1D1A A;  2K5C A;  2LRE A;  3DTK A;  4PFP A;  2IS1 A;  4ANJ A;  3IAS 2;  3K10 A;  2IS6 A;  4HST A;  2JUG A;  2LOO A;  2X6W A;  4DBQ A;  4XLH A;  1LFP A;  4XNF A;  1LKX A;  1MNE A;  1MMA A;  1UG0 A;  2IS4 A;  2FUG 2;  4U87 A;  2F6C A;  4D9J A;  3OS1 A;  2E1M C;  2HQA A;  3EUH C;  5HLT A;  4ZDO A;  2KRC A;  4F93 B;  3OYM A;  1WJE A;  1K6Y A;  2CS3 A;  2W7N A;  4GRI A;  2AQF A;  2KMU A;  3H5A A;  3PFY A;  1S9H A;  4YEJ A;  1V5E A;  1X1A A;  4C9Y A;  1SAU A;  3H5N A;  1DP3 A;  1T0F C;  4NQW B;  1ZEL A;  3DEE A;  3AKZ A;  3MKY B;  2PJR B;  4DGW B;  2HU9 A;  3K4L A;  3HOS A;  3DKX A;  4B48 A;  1R6R A;  1N75 A;  2BVM A;  4LG3 A;  1NG7 A;  4XON A;  3AFH A;  4BEH B;  4IKF A;  2DXI A;  2V9K A;  2M3A A;  4PSW A;  3H5R A;  4XMY A;  5HVQ C;  1WJA A;  2VQC A;  1DGR M;  4JQF A;  3CZ6 A;  1V5F A;  3FKJ A;  4R79 A;  2CH0 A;  2F4I A;  3NWS A;  5KHD A;  4BDZ A;  1QU3 A;  4F52 A;  5HNF A;  2DJI A;  4CUG A;  5HOO A;  4XM3 A;  2CUZ A;  3K4M A;  4DOZ A;  2IGO A;  4RMN A;  4BE2 A;  3LSI A;  4E7Z A;  2NOJ B;  2JSP A;  4RLF A;  4E7I A;  2LBF A;  2XDV A;  3OS2 A;  1BR2 A;  3K70 C;  2CMP A;  4XKC A;  1VZ0 A;  5FRO A;  3CMM A;  4CCN A;  3D5L A;  4OAZ A;  3CF2 A;  3E1S A;  2VIX A;  1X4O A;  2WY8 Q;  4BE1 A;  2RNG A;  3OYL A;  1TZL A;  2RQQ A;  2L9S A;  1D1C A;  3PSI A;  1Z3Y A;  3H0D A;  3DLA A;  3OMY A;  3OYA A;  2BW3 A;  4LIU A;  3CJR B;  2V6E A;  1T95 A;  4XKB A;  2VJJ A;  2E5N A;  2MYS A;  2W1O A;  3OL3 A;  4LIV A;  3ZR8 X;  2X6X A;  4CZC A;  4IQJ A;  2L5Q A;  3SDB A;  3L2R A;  1YX5 A;  1MND A;  2KLO A;  3VDX A;  3TMO A;  2VPL A;  2VKD A;  2X85 A;  2X6Y A;  4BGD A;  2X51 A;  2IXS A;  4CSW A;  3OYG A;  2VXZ A;  3H9Q A;  2PJR A;  2R7U A;  1X1B A;  3UNG C;  1BOB A;  3A2K A;  3HKZ A;  3BC8 A;  2UWM A;  4FET A;  2R7X A;  5KCM A;  4PJN A;  3VWB A;  2LG4 A;  2XAU A;  4PJM A;  2L2O A;  3K70 D;  4XN3 A;  1TT0 A;  2V7F A;  3VSL A;  2A5W A;  1Z21 A;  3DKY A;  3PNT A;  1E0E A;  2CW8 A;  4XLE A;  2KHM A;  2MFZ A;  1PJR A;  4NUB A;  2PMZ A;  3MKZ A;  4CCJ A;  4C2T A;  2Z2S B;  2WBM A;  2LY2 A;  2RRE A;  1OLT A;  4G6T B;  2CV0 A;  1X1D A;  4F55 A;  3C2H A;  3CP8 A;  3NWT A;  3RTR A;  3W2A A;  3PNV A;  2IGK A;  2UUZ A;  1DQU A;  4AVZ A;  4ZTJ A;  3DPU A;  1NG6 A;  2K3P A;  2W82 A;  4IQ4 A;  5CKT A;  4C30 A;  2R4G A;  3OYJ A;  2JVH A;  3RPU D;  3ZGK A;  4BUP A;  2HNH A;  2QKM B;  3DU5 A;  4CCL A;  1DGW Y;  4QPO A;  3LFU A;  3OYH A;  3W2W A;  4HNT A;  3E0J B;  2VLA A;  3S3M A;  3DTI A;  4HG2 A;  3SYT A;  2VJ4 A;  1WJ5 A;  3TBI A;  4D1Q A;  1GLN A;  2E5Z A;  4Y33 A;  3V42 A;  1D0X A;  3OR2 C;  1X1C A;  4XKV A;  1MMN A;  2LC2 A;  3L2Q A;  4HRI A;  1D0Z A;  2VQL A;  1PYV A;  4Y4R A;  4F91 B;  2CW7 A;  4E7K A;  1X19 A;  3QYB A;  3HL2 A;  3HUG B;  1KON A;  1BR1 A;  3VYS B;  3K6G A;  2WA0 A;  2WAE A;  3H35 A;  3VYT B;  4KT6 A;  3K4K A;  2OUM A;  1FMV A;  1WJF A;  3LSK A;  3D5R C;  3I3L A;  3LSG A;  3GBG A;  1FMW A;  3LL7 A;  2WY7 Q;  2WAD A;  3FHN A;  2CUJ A;  2KPM A;  3A1Y A;  2WAQ A;  3OOU A;  2XC7 A;  2IGM A;  2VL8 A;  2XF7 A;  1Z3X A;  1N78 A;  3S3N A;  4NNJ A;  4F92 B;  3L2V A;  2BOL A;  3QOE A;  1Y56 A;  4B44 A;  3PUB A;  4RM3 A;  4XKW A;  1OR7 C;  5JHF A;  2IS2 A;  2V4J C;  1G8X A;  2K9L A;  2M0M A;  3F9K A;  4PUS A;  4XR6 A;  3OR1 C;  2ZFU A;  4DBR A;  4E7S A;  3OYB A;  3IUO A;  5CQE A;  3D5S C;  4E7J A;  3ZXS A;  3K4J A;  2Z1D A;  4BE0 A;  2W4S A;  3IAM 2;  2MD0 A;  3OYN A;  3EUK L;  2M7A A;  2HDW A;  4BU2 A;  3BG6 A;  3EUA A;  3PNY A;  4PJJ A;  1Z7L A;  4ZC3 A;  3A4C A;  2ZXI A;  3HPG A;  3FDY A;  2KZV A;  4PSX A;  2O5R A;  3I9V 2;  2K9M A;  2DT7 B;  2R7T A;  2DCE A;  2KL4 A;  2LYC A;  4PJL A;  2DT6 A;  3VSK A;  3OYC A;  4CCO A;  2HPI A;  3J7A Y;  3RSN A;  2V26 A;  3K4N A;  2M4K A;  2VJI A;  4BAC A;  3L2U A;  2VJ5 A;  1SFK A;  2E1M B;  4XOP A;  2VKH A;  1P9Q C;  4F3Q A;  4KIT B;  3OYF A;  5HNH A;  3MMY B;  4IX7 A;  2VB6 A;  2CFO A;  1N77 A;  4OWR B;  4CA0 A;  4BQQ A;  5FRN A;  2XF6 A;  2KDO A;  2R7V A;  4YEL A;  3HOT A;  2E60 A;  1WFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...