2F4OB

The mouse pngase-hr23 complex reveals a complete remodulation of the protein-protein interface compared to its yeast orthologs
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
GHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide N-glycanase
publication title Structure of the mouse peptide N-glycanase-HR23 complex suggests co-evolution of the endoplasmic reticulum-associated degradation and DNA repair pathways.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2f4oB00
1X3WB 4YIRX 1PVEA 2QSHX 1QZEA 1OQYA 2F4MB 2QSFX 3ESWB 1TP4A 2QSGX 1X3ZB 2F4OB
chains in the Genus database with same CATH superfamily
2DMPA 1Y6IA 1SD5A 4WWCA 4CCLA 3BCBA 3FXQA 1S7EA 5E18F 5DD8A 1H89C 1K78B 3QYBA 4BKXA 2HI3A 3EYYA 3NAUA 2CW8A 1KYWA 3ERED 2EZHA 4YEJA 1T8IA 2KMUA 3V7CA 1EKEA 1N77A 1I1GA 2XB0X 4PJLA 2O0YA 2Z3YA 5H6QA 1ETYA 4BXUA 3K10A 4HF0A 2DTZA 3IH2A 4U88A 3F8BA 2HR3A 1QA6A 4KYWA 1KZHA 2DXIA 1FP2A 2ZNYA 1HKSA 2LDUA 2JA8J 2R7UA 1ORKA 2WV0A 3H1CA 1E2XA 5FO5A 2E1OA 3EUHA 1ETXA 2R5ZA 1TL8A 2VKHA 3HJEA 4PJNA 2VODA 4NB5A 3S1MJ 1B9NA 1X1DA 3CCQI 3MZYA 4CO8A 2LVSA 2PQ8A 4DIQA 2XAUA 1SFEA 4HA8A 1I1SA 4UUSA 1V3FA 2P6SA 2IS4A 5FROA 1FYLA 1AHDP 4Q5SF 3IKVA 4UB6C 3DFGA 5ILUA 3HOSA 1VQPI 1OMIA 4HV5A 4M3EA 1DQUA 1F1ZA 3MMYB 1KQ9A 1EV7A 1KONA 4CDGA 4KN4X 3HZJA 1YYVA 4U0VA 2DTRA 5F0CA 1WWXA 1XGOA 2Z99A 4ZYDA 1MD0A 2XKPA 2RDPA 5H2FC 1I50J 1IN7A 4HV6A 1K83J 2CO5A 3FDYA 2BZTA 3HXLA 4KA4A 2M1BA 1Z3XA 2HVQA 3O8HA 5GPCA 1ZG5A 2JA6J 2DN0A 2LH9A 1SFXA 2H6CA 4HX7A 3OIPA 1U5TB 3IRQA 1B72A 1O57A 3W6JB 1YX5A 2CV0A 1H8AC 2WB1A 4KNYA 1OISA 4CA0A 1PYVA 1XS9A 2QENA 4G8XA 5IY5H 5DV5A 2K3FA 2EPFA 3U1KA 1ZGJA 4YRVA 3AFHA 3KIOA 3WTYC 1XGSA 3CDHA 4U0YA 2R5YB 5KCMA 3HM5A 3PM1A 3LAJA 1Z6TA 1U2WA 2CMPA 1K61A 1ZARA 4B09A 3WU1B 3T8RA 5EGOA 1T33A 1JTYA 3ABUA 1U9NA 4FE4A 1G3TA 3P9IA 1XB4A 1TNTA 3K4NA 5GTIC 1D5VA 3K7AJ 4RM3A 5GAHJ 5BPDA 3LA3A 1R00A 1DPUA 4W1UA 3ZN1A 2IJLA 5GP9A 4QIWN 3OYGA 1RI7A 4A3BJ 1DPRA 1FP1D 2K9LA 4A6DA 3HUGB 4LGWA 3Q0VA 4A0XA 4BJ6C 3TOAA 3RSNA 3U1DA 3TW7A 5IPAA 3X2QH 1W0TA 4Z6YA 5EG0B 2VC1A 3BJOA 1OCOH 1TBXA 1W5TA 2UUZA 1FTTA 1BI1A 5CPRB 3MN2A 2QQ9A 2CGPA 1QO0D 3ZQFA 2ME6A 4V19K 1TTYA 4KUMA 1ETVA 4DZPA 4CYCA 4UXNA 2Q8KA 3S15J 4PFOA 4RAYA 3H9QA 1RUOA 2NXNB 1YS6A 3DKYA 4I09A 2CV2A 2R7SA 4A93J 4KIBA 2CRGA 3V8LA 2NS8A 4NHJA 2X51A 4DOZA 2P5KA 1TZLA 2HOTA 2WAEA 4RAFA 2YU9J 2AS5F 3BR6A 2XHKA 4G7ZF 2F4MB 3LSRA 3ESWB 3FXMA 2IAIA 5F64A 1R22A 2R7QA 5D5UB 2VE9A 5M5XJ 2JA7J 2WBMA 5B1AH 5E3OA 1LVAA 4WXCA 1J09A 3QRFF 2L7KA 2V1NA 1JUMA 1BJAA 3K9TA 2FNAA 4LITA 3G4SI 1WI3A 3EYIA 4EVIA 4CCOA 4RA2A 1IV6A 4PK4A 3CMYA 4RGRA 1LNWA 2PX9A 1O3QA 3CCRI 2RAEA 2XGEA 4HF2A 2K3PA 1PJRA 3TO9A 2IGOA 2ID6A 4D7NA 3JR9A 1EJ9A 2IVMA 2F48A 4OAZA 3G6EI 2IT0A 1SFUA 1VQ8I 5CYVA 2K7LA 3K4CA 1OFCX 3BPVA 3CUQC 3TQNA 3PQJA 5DCFA 3EPZA 2BBYA 4BE2A 2CG4A 4M3DA 5BQTA 3PNVA 2CJJA 4EJVA 2R7OA 3JAMZ 1B1BA 3FWEA 1YTYA 1W7PD 4NQWB 1XPXA 2NRAC 1YG2A 3BWGA 1K4TA 4HF1A 5CVUA 4ZZLA 4HSTA 3HTUA 4MHGA 1A31A 3NEUA 1FIAA 1Z9CA 2X6WA 4D1QA 3AKZA 2VQLA 2MFZA 1X3WB 4BH9A 3QOEA 2CUJA 3ELKA 3BQZA 1P9QC 3CTAA 1YRNB 4MIMA 5EEAA 4G7OF 4B8XA 2DPUA 3BR2A 3M7GA 2YPRA 4PJMA 3OSFA 3HKZN 2O8KA 5B1BH 3QU6A 2JPBA 1BW6A 4FT8A 1W5CC 1BI2A 2MH2A 2R4GA 2GAUA 4DBQA 3IAM2 4NC8A 3MKZA 1XD7A 3WGIA 4D5CA 3RKXA 1K6YA 2PMUA 2M87A 3A0HC 5M5WJ 5DYMA 1X1PA 3JRFA 3CQZJ 1LB2A 1D1AA 4QWQA 5ICCA 1XSVA 2DFEA 2EFQA 2D1VA 2P81A 1W7PA 3BG6A 3M1EA 3HG9A 1KU2A 4HG2A 4XMYA 2ECBA 3RIRA 3OYAA 3KCCA 4AIKA 2O5RA 1UHMA 1ENHA 4NC7A 5F0FA 1IN4A 1VQ9I 2BE5F 2VT3A 1PUEE 4XIDA 2VQHA 1IUYA 4UUTA 1S7AA 4C3IJ 3KZYA 1ITYA 4DGWB 2ZMEB 1U5TA 4ENJA 1ZQ3P 3VSKA 2QBYB 1R36A 2DODA 4ZZDA 3PFIA 1G59A 3S32A 1SC7A 3F8NA 4MLOA 4I99C 3W2WA 2HQAA 2ME0A 1FWZA 4Q48A 1I27A 5BS6A 5IYCJ 4BYYA 1WJ5A 1BR4A 3O8GA 4V2FA 3LSPA 4GO1A 1U6GA 1IRZA 3F8MA 1G3SA 3J7YJ 2HOSA 4QPQA 2CUFA 5JHFA 1MBGA 1FSHA 2XROA 3J80K 2P8TA 4XLCA 2IGMA 4XRMA 4RAZA 1S29A 3ULQB 3PJRA 2MYSA 1IO2A 3CUQA 2BY2A 1EH8A 1AKHA 5K7HA 2CFXA 1SAXA 4OIOF 3FHNA 1VI0A 5EEGA 3L7WA 5E79C 2XPWA 4YG2F 3GX4X 1R7JA 4ZYEA 1V4RA 2DO7A 2ZBKA 1TQPA 4S04A 1QPMA 1EH7A 2HVRA 1U8RA 2HEOA 3CP8A 1IC8A 1JKPC 3I54A 4DQ2A 5GTHC 2COBA 2IW5A 3FK6A 2ECCA 3LFKA 2DOAA 1XDUA 3AG2H 2KQRA 3S3OA 2PLYA 4C2TA 1Z6RA 3OIOA 4BU2A 5DCMB 2AHQA 1HBXG 3DQVC 1ZAOA 2XKOA 3LOCA 4Y13A 2KRCA 3FBNB 4N4NB 1MZBA 5F1RA 5LBQA 1N78A 4MTEA 3CP2A 2VJ5A 3M4OJ 2HNHA 4OIQF 1BJZA 2PMZA 2XGDA 2EFNA 4U0WA 1CF7B 2JRTA 5FD6A 1LDKB 1FOWA 4XK4A 2E5NA 3HBLA 4B44A 3K4LA 2X0LA 5B5EC 5FLMJ 2O9LA 3P9KA 4GYIA 3MWMA 2RVCA 3C7JA 3IAS2 4CHUA 3K6GA 2EIMH 3CLQA 1FOXA 1X3UA 5ILVA 1T0FC 1MSFC 3SYTA 1SD4A 1W5SA 3HPGA 1ZG3A 4L9TA 3CCJI 3KP3A 3FXLA 3CCVI 1S5LC 2R93J 5C44J 4KT5C 1J2XA 1GV2A 2HYJA 1JKOC 2H1KA 4XKWA 2W48A 2GZWA 3BLYA 5B3SH 5LHHA 3MKWB 1H88C 1OLTA 2HYFA 1LQ1A 2NVQJ 1LE8A 5EYRA 5CKTA 3MZ8A 1ZTRA 4BQOA 2EFOA 4AYBN 2DA2A 3HPHA 1G8XA 3OYCA 3CO6C 2V9KA 2D2WA 4BXXJ 3ZP5A 3CUOA 1FC3A 3I0TA 4M71A 1KU9A 1OCCH 2M8EA 2DK5A 1X1AA 2F5DA 5IOYA 2I8DA 5HODA 3T1BA 1RIOH 1ZR4A 1LFUP 3RZOJ 3KYDB 3K4BA 2RKHA 3WG7H 1IAWA 3U9GA 3DPUA 3HOUJ 2AQEA 4C9YA 1J0RA 2M2EA 4EJWA 4MEYF 2BXZA 2FNPA 3IH4A 1F9NA 1IRFA 1FIPA 1YW7A 1UHWA 4I76A 4Y15A 4A2UA 2DT6A 2HQNA 4MFDA 4KIGA 1T39A 2Y75A 4XRFA 1U9OA 4MO7A 2IBDA 1ETOA 2Z9OA 3S16J 4E7SA 3J81K 4PGHA 1G2HA 3I64A 4XONA 2ID3A 4ZYAA 2BYVE 2K9SA 3I5UA 4B47A 4PZJA 2R7ZJ 2R5ZB 4XLEA 4BXFA 2PMHA 1NG7A 1TWHJ 2P5LC 2BY1A 4FX0A 2ZFWA 2L9SA 2HKOA 3DEUA 4K2EA 1CQTA 3W2VA 4MTDA 2KLOA 1W36C 2Z2SB 3ZQQA 2HOAA 4KIFA 4UUSB 3L1PA 2H8RA 1HW1A 5E1WA 2M3AA 1APLC 4QPOA 3BY6A 1SEUA 2E1MB 3HGGA 2XAJA 1IDZA 5FKKA 2EJRA 4FISA 5D8KB 2K9NA 4A3EJ 3F6OA 3LQQA 5F1JA 4E7IA 1VF9A 3WTUC 2RGVA 3G2BA 3OY9A 4BAYA 2QGUA 3CC7I 2R7VA 1JTXA 1OPCA 4JX4A 1N25A 2X1EA 3CF5F 2ISZA 4NC6A 1IXSB 1IN5A 4N4OB 3CDLA 3QODA 3A0BC 2ZO4A 4M6VA 1RESA 2GXBA 1T0FA 4N0BA 5K5OA 1WH7A 2LOOA 2R7FA 1FMWA 2Y9ZA 4XN3A 5EJCA 3LSIA 1MDMA 1UB9A 2HPMA 5TISC 1B72B 1HW2A 2WC2A 2O6GE 2DMTA 3BG5A 3TDZC 3C1DA 1FOYA 1WJDA 2BGCA 3FM5A 5HS8A 4M73A 3DP7A 1S72I 1TT0A 2MH9A 5K5QA 4FASD 2KIFA 1B8IB 3HSFA 2PN6A 3I53A 3L09A 3CESA 3SZTA 5D8LB 2DMUA 1B9MA 1KU3A 4ZC3A 3GTMJ 5KNLA 1I6XA 2JSCA 2NYXA 4M3FA 5EGOB 1KQ0A 3OYLA 2LNBA 5LGTA 2LBFA 3I4MJ 3A4CA 2JSPA 2F6CA 4E7ZA 3P5JA 3GMEA 4UVAA 1O4XA 2NS7A 4UV8A 3ZMVA 2IS1A 3GFIA 3ABMH 1GV5A 1HF0A 5KAFC 1HDPA 4L0ZB 1T95A 1OR7C 3D1NI 3H36A 4A3KJ 2UXNA 1L3LA 1Z7LA 4A3GJ 5F6FA 3D5SC 1IZ1A 3V7RA 2QCOA 2R7DA 4E7KA 4LJZF 3F8FA 3DXJF 1H9TA 3A01A 3MCZA 1WJBA 3DV8A 1MSEC 3L2UA 3CC4I 2L9NA 1ZELA 1Q1HA 4BDYA 4BBSJ 4A0ZA 3KEYA 1JGSA 2M7AA 5CLSA 2QKLB 1A5JA 1B4AA 1QU3A 5LGNA 4ZTFA 1BC7C 1P4AA 1UJ8A 4FHTA 4B3XA 4G12A 4XBFA 3RKQA 2X6YA 3K4MA 4CYCB 2J5PA 4HLYA 4EGYA 4M72A 2CV1A 3HOZJ 2WY7Q 2F5VA 3VB2A 2CW0F 1BI0A 2NVXJ 4UY8I 3BP8A 4ENMA 2HS5A 3F23A 1QGPA 2RV8A 3CO7C 1I3QJ 3RQIA 1Y39A 2NVYJ 1ZGWA 1FJLA 3KYCB 5E3LA 1Z3YA 3WTTC 1WH5A 2NNNA 2O3FA 5JR3A 3OYNA 2OF7A 1OJLA 4AC0A 3S1RJ 4HAMA 1X2NA 3JSPA 3HGYA 2K5CA 1Z77A 5C4JJ 4M9ZA 4JYKA 5IP7J 2KL4A 4KICA 4BUPA 2ZCWA 2KDZA 4CCJA 2VE8A 2E36A 4HQMA 3ZRGA 3R6SA 5L3BA 2YU3A 3DTKA 2OCEA 4EJTA 3JRHA 1LJ9A 1FBQA 3VPRA 1FTZA 5HNHA 3RPQA 4Y3OA 2LG4A 4E4HA 3H92A 5JI6A 3M8JA 1QVTA 2DA4A 2K27A 2EFWA 1USSA 4M6XA 4ZTJA 2ETHA 2EINH 2YS9A 3BR5A 4BHCA 1T98A 1A36A 3OL3A 5AIQA 4RB2C 1W0UA 3BG9A 3E0JB 2DK8A 2XGCA 2XAFA 3WTWC 2EA4A 3BROA 3R60A 4OINF 2GLOA 4CGZA 1STZA 3MQ0A 3CMMA 4LOCA 3DCFA 3MKLA 2L4AA 4KMUX 3AL0B 4OIPF 3J7ZI 1R5ID 2FUG2 3L00A 5FB2A 1YS7A 3OYFA 4DJAA 1LUJB 2H6BA 3VWBA 2MSYA 3FIWA 3R0AA 1QZEA 3KLOA 1WKMA 2P0WA 2UV1A 2WAQA 2Y69H 4RGXA 1ZHFA 3JRAA 3GTLJ 1HSJA 5D5WB 4IX7A 3OYEA 2K40A 2P4WA 3GTQJ 1R71A 4ESJA 3PIOF 4HX4A 1BIAA 3WTSC 3WGHA 4A0YA 1WCMJ 2IPQX 1T2KA 2BV6A 5K1YA 1FNNA 4XSZF 3F3XA 3MKYB 4LD5A 5HLTA 1W7PB 3D5RC 2LK2A 2Y0SN 3DU6A 3HOYJ 3GBGA 2OTLI 1BOBA 1QVUA 2MLKA 4P9FA 5IP9J 1DU6A 1YW9A 2LF7A 1D3YA 3KEOA 3IWFA 3KEQA 3Q9VA 1NH3A 1IN6A 2ZXHA 4EGZA 2QSGX 1FSEA 3W6VA 1KYZA 1YO5C 1BBYA 1BI3A 3RDIA 1POGA 2RNGA 3H5RA 2E2HJ 4AIHA 4ZYGA 2LY2A 2DCEA 1GXQA 4HZFA 5KK1A 1R58A 3ZMDA 1U8BA 3IH3A 2J5OA 2K86A 2NS0A 4XORA 2OQGA 1RKWA 3SDBA 2XGXA 5FD5A 2DAOA 1FX7A 5LHGA 3BG7A 2E35A 2Z1DA 4L5IA 2F5FA 2QZ8A 4B3AA 1B8IA 5IT9Z 5J1UA 3K2ZA 2DW4A 4F92B 2DFFA 4LMYA 1VNDA 3JAMK 3UKGA 3IKTA 2X1CA 5D4RA 5HNFA 4WF2A 1RR7A 3CUQB 4ZDPA 2EA2A 1GVDA 4JBAA 3U21A 3FM3A 4DZJA 3DTEA 3GLLA 3OYBA 1AKHB 5JVTA 4BY1J 1HXDA 1OCZH 4Z2YA 1FBSA 2VIXA 3E5QA 3EDPA 2OU2A 1Z7UA 4A3IJ 1F4KA 2OTJI 1VQNI 4UV9A 1BIBA 4P55A 2KDOA 4JX6A 2FEZA 4LK1F 1FOKA 2OUMA 1LDJA 2VI6A 2EILH 2VJJA 5F27A 2G7UA 3TL4X 5J6XA 1ZLJA 2W85A 1MNDA 2WA0A 4YELA 4ZDLA 2JWTA 5F08A 3KFWX 2DJNA 3IHUA 2V9VA 1MJAA 4M3BA 4X6AJ 2ZSHB 3BT9A 1A6IA 3MEXA 1T38A 1XX5A 4IQ4A 3GZ5A 1BL0A 2KRFA 1VFCA 2VOPA 3RKWA 1YIOA 2PBIA 3ASNH 1IV8A 3SFZA 3HKZA 1VQ5I 1LDDA 3FX3A 2CFOA 4MGRA 3VOEA 5GAEJ 3CD6I 4EM1A 2HZDA 1XC5A 1WVRA 4OOIA 3GTJJ 2D5VA 3C2GA 1Y8QB 3HHHA 4AIDA 4GYGA 3JCUC 4XOPA 4GFBA 4GDFA 2I5UA 1P7IA 3DBRB 3EUAA 3KZIC 2DPDA 2CUZA 4IHWA 2YSRA 2XV4S 4S0HB 2VJIA 2NVUB 4G6TB 2WB1N 3MZHA 4LLGF 3L2QA 2YX4A 3R0JA 1QHHD 2E19A 2GM4A 1Z21A 1PUFA 2R92J 4BQQA 4A3LJ 1ULYA 3AG3H 4XN0A 2JT1A 5LGUA 1MIJA 3GO5A 2EFPA 4ITVA 2W84A 4UVCA 1G4DA 3RCOA 1ON1A 1LE8B 3QP5A 5E20A 3SFIA 2O03A 1S6LA 2JK3A 1JE8A 3OOUA 3GWZA 5DDGA 3QYFA 5FKMA 1FBUA 1P92A 2LKSA 4L9JA 1U0JA 2FJ1A 3OMYA 1D0ZA 5KAIC 3O6BB 4MNUA 3GF2A 5L3GA 4EJUA 4IVNA 2RREA 3HRUA 4XL9A 2GIVA 5HS9A 2XSDC 2V79A 1I6HJ 2LTPA 4IOAF 3GZNB 3BTCA 4IHXA 4U7BA 1YJWI 5HOOA 4ESFA 3UNGC 2ZKZA 3DBHB 2M0CA 3B6AA 4OIRF 3ZMTA 2W82A 1TQIA 2DBBA 1XCBA 3GYHX 1XN7A 3A2KA 1ZR2A 4BNCA 3TP0A 3SJMA 5FRNA 2VLAA 1JXSA 5C4XJ 3DU5A 3I59A 4CUGA 2IRFG 5DM7F 4C3HJ 5E8IA 5D5XB 3HOXJ 4RDUA 2KISA 3AAFA 2QQ8A 2DMQA 2BY0A 3GVAA 3IWZA 1J9IA 4AVPA 3JRDA 5K7FA 4L9VA 2B9SA 2JA2A 3QOPA 3TMOA 2LY1A 3VYRB 3QPHA 1J5YA 3T5XA 4JP0A 1ZYRF 1Y1WJ 1PDNC 1E17A 2JMWA 1N75A 2X6OA 2XASA 3LAPA 3VYTB 1E3HA 2R7RA 4LIUA 1WFXA 1LKXA 4RGSA 1F5TA 3BZKA 1GXPA 4LIVA 3GZ6A 4GGGA 1BA5A 3PL8A 4QSHA 4HYEA 5CQGA 1WI9A 5ICFA 1UFMA 1FMVA 1TW3A 3MVPA 3WGGA 2V1XA 4OWRB 3RI4A 1MDMB 1ZRFA 2L5QA 1LEBA 4HDUA 2A69F 1SVLA 1D8KA 3D5LA 2CS3A 2DA3A 4N9IA 2ISYA 3QPSA 2L54A 2XDVA 3LL7A 2FA5A 3H0DA 5FLVA 2UWMA 3AG1H 3OYMA 3JRBA 2WAFA 4HDVA 3NARA 2HU9A 1MBKA 1JGGA 4YIFA 4LG3A 1UMQA 3PIPF 2TRTA 3P9CA 2P7VB 4MQ9F 3I56I 5JVGF 3CCEI 2XAGA 3LSTA 3MAJA 3Q3SA 2CQXA 2JZYA 3IRRA 2CQQA 1RPWA 2PI0A 4KMFA 1E3OC 1YHQI 2L3DA 3GEZA 2HYGD 4BE0A 1QQIA 5FKOA 2LBFB 3FXOA 1TC3C 1YW8A 5J1YA 3CCSI 2V7FA 3NRVA 4HBLA 3HSEA 4HX8A 4WXDA 3RZDJ 2W00A 3TGNA 1FZPB 4I0AA 3ZQIA 1IRXA 3OS1A 4KT6A 4MFEA 2CW7A 1XCVA 2M0MA 4R1HA 4EJOA 4BJTA 5JLXA 3S17J 3ZMSA 1IN8A 3CCYA 5AONA 2MABA 5F0HA 2M45A 2Y2ZA 3A01B 2XF6A 2OV7A 2FMLA 2DT7B 2O61A 4XLHA 1YQAA 3QPLA 3OSGA 1JI8A 5LLQA 2ZXIA 1IXCA 1NTCA 2FBKA 1QPIA 1I39A 1VQLI 3KP6A 1OQYA 4RAGA 5E8GA 3LMMA 4Y4RA 1TWGJ 3SDGA 4XOTA 1D8JA 1RNLA 1KU7A 3E7LA 4U7DA 3S1NJ 3OL4A 3TDUC 4L9NA 3BTJA 4PJJA 1HSTA 2IS2A 4BJ5C 3SHFA 3FKJA 2NOGA 1B59A 3G1MA 2HDDA 2G7HA 5D4SA 4ASNA 3K4JA 1XG1A 5IYDJ 3S14J 2EH3A 2TDXA 3BJ6A 4P96A 2QSHX 1WRJA 4RBOA 2M4GA 4LFUA 1FT9A 4B43A 4IHVA 1ETQA 2M7BA 2L7ZA 2BW3B 2DOFA 3BG3A 3W3CA 2L7MP 2IXSA 1GVJA 4ENKA 2I10A 2LREA 3I3LA 1TLHB 2LD5A 2KRHA 4BHBA 3JTGA 3TKYA 2O7OA 3FISA 5ERIA 1LPQA 1QBJA 2L9VA 4EATA 4O6JA 4IKFA 3G3ZA 5LFAA 2PFBA 4M9XA 1RZ4A 1UHSA 3ABTA 4A3MJ 3M8FA 3WHCA 5BPIA 3PFYA 2EIKH 4IRGA 3I55I 2DQLA 3HSRA 2OZUA 2KJCA 2E34A 3OOPA 2VKDA 5LEKA 2COMA 5HDKA 4LB5A 2HTSA 5K7ZA 1OYIA 1HOMA 1TP4A 1FLIA 3K4KA 2DOEA 2ZJPF 4LG0A 4JX5A 3FKIJ 3E6MA 3H0GJ 1X4PA 1IRGA 2ELHA 3WTXC 2Y30A 3G1LA 1R1TA 1GUUA 1FPQA 5LRSA 1FEXA 2YR2A 2BOLA 1EF4A 1YI2I 2WTEA 3GW2A 3T8TA 1UCRA 2QSFX 5FGMA 3J80Z 5HLIA 3CCMI 3L9FA 5A2QZ 1ETWA 3WU0A 2B63J 3OR2C 4BL0B 4XLFA 5BMZA 3I4NJ 2EQRA 1NG6A 4EEFG 3QQAA 1GLNA 2M9HA 1X1CA 2ADUA 5J40A 1R6RA 4ETSA 2A07F 1JHHA 4I7HA 2PMZN 2RNJA 4AWXB 2V1UA 1W4MA 5LHIA 4RB3C 4BY7J 4UVBA 5DTDA 5CVIA 3BR1A 4O5VA 3LSJA 1SAUA 3DLAA 2K4BA 2NOJB 3ZMZA 4V2GA 1Y0NA 2ZSIB 1ZKGA 1MJBA 2QYOA 4ZDOA 1REPC 1G6NA 2L02A 2XSJC 3S3NA 3M1CA 3PO3J 3CMEI 2PJRA 1R1UA 5K5RA 1P6RA 2DMNA 4HNVA 5H6RA 1BR1A 2HVSA 3KP4A 1G3WA 1SMTA 4D7MA 5FKNA 5FFXA 2WADA 2LF8A 3I4PA 5KHDA 2B7EA 1O3TA 2CYYA 2G0EA 2VQCA 1S8NA 3ISPA 5J4VA 4J00A 2LP0A 2FD5A 3DKXA 3JRGA 1YFHA 1FYKA 2LFBA 2EV5A 2V4JC 5J47A 2Y48A 2XRLA 2Z33A 1ON2A 2QWWA 4IOCF 2DYRH 2E1CA 2VC0A 4C2UA 2MW8A 3F72A 3F22A 3C18A 2DLLA 1W1WE 1WQ2A 1DUXC 2CSOA 1JT6A 2E7XA 4NDLA 5JLWA 3HYIA 3HDDA 1WHUA 2GOXB 3ZQ7A 4HOBA 1OCTC 3B02A 1MJ9A 3BC8A 1E0EA 2W24A 4ENNA 4E7HA 5HLGA 2L01A 2X4HA 3FXRA 2EBIA 4E7JA 1W36D 1FY7A 2BVLA 4A5MA 1YE9A 1HCRA 1D0XA 2XUBA 3M8EA 4S05A 1TWCJ 3ZQGA 1LVKA 1DGRM 3O3KA 1A35A 3FK7A 2QKMB 4ON0A 4P9UA 4ABZA 2HDCA 2M34A 1MNMC 4PDKA 3DLLF 2GWRA 3ROUA 1DU0A 1JHFA 3JSOA 2KIUA 3GTPJ 1T08B 3H5NA 3LSMA 2E5ZA 2VBZA 4WK8F 3S2HJ 4G7HF 3ECOA 3D0SA 3J7AY 2CQ7A 5D6EA 2FF4A 4NNJA 1I3AA 1Z1DA 4IF4A 4CXFA 5ED4A 3EUHC 2ZJRF 4UB8C 2M8GX 3E5XA 3NQOA 2OZ6A 1OYWA 4FTHA 3QPTA 3NWTA 2GBYA 1SD6A 4P5OA 4N9HA 2W1OA 2VBXA 1VTNC 4FX4A 5GADJ 5J8FA 1OKRA 1U3EM 2BY3A 2DFIA 5BNGA 2FXAA 3HB9A 1E3PA 4G6DA 2L2OA 3QYEA 1XMKA 3IC7A 3HRTA 2BW3A 4KISA 1P2FA 3ABLH 2VXDA 1M1EB 3M07A 1R4NB 3ERMA 2QQAA 4M3GA 4YFNF 4R79A 2KT0A 3S2WA 2A61A 1ZLKA 1OCPA 2HTJA 3GFLA 4JQFA 5L3EA 5HLHA 1BM9A 4CH7A 1YITI 2JPCA 2Q1ZB 1PUFB 1VQ6I 3HIFA 4XQFA 5IT9K 3H9JA 4QLCU 4I02A 4G6QA 3QAHA 2IA0A 1KGSA 4A3FJ 1IJWC 3PUFA 1TW2A 2V1DA 3HHGA 3CJTB 3BQYA 1XSDA 3LA7A 2HWVA 3EQLF 4AD9A 1O3SA 1Q1VA 3W2AA 3N05A 4XRSA 1FYMA 3QP6A 3ZN0A 3DF8A 4KITB 1HQCA 3ECHA 1WJAA 3QWLA 3VEPA 4W97A 1JKRC 2CWEA 3EUKL 2AO9A 5C3EJ 1VQ4I 1P4WA 4ANJA 1A04A 3ZQLA 5HDGA 1Y8RB 3V4GA 3L2WA 2DDAA 1OR7A 1USTA 2FSWA 1HDDC 3ZR8X 2LMDA 4EMSA 1S7OA 1BC8C 1ZREA 1AU7A 3ZXSA 1K6OA 2FBHA 3JRIA 3ZGKA 3H35A 2ELKA 4HEA2 2BXYA 2W57A 2E2IJ 3K70C 2H1LA 2IS6A 4LLNA 4L5JA 1ZK8A 3WE3A 3JREA 4B1RA 2W7NA 2A3SA 3C2HA 4RLQA 1VQKI 1UG2A 3I59B 3ML6A 1NK2P 4D5FA 5DEQA 4DYCA 4EM2A 3JRCA 4HW0A 1X1BA 1Z05A 1H9GA 2KKOA 1YOVB 4XNFA 4CZZA 3VODA 1NK3P 4PSWA 4IJAA 1IF1A 2F5CA 3BTLA 2QVOA 4CZCA 3S3MA 2FU4A 3OYJA 2D45A 1SMYF 1JKQC 1V5GA 5L3DA 2VL8A 5IOZA 2M5WA 5FLXZ 2DT5A 2DJIA 2NVTJ 3GLXA 2VQGA 1ZN2A 2XAQA 1GT0C 4L5EA 2XF5A 3OR1C 1QNTA 4DYRA 4F52A 1O3RA 2XPUA 2XRNA 2G9WA 4LLLA 3WHBA 4YIIA 1ODDA 2DA1A 3CJRB 3E6CC 4BE1A 1R49A 3T0YA 1VQ7I 2A05A 2JVGA 3GTOJ 4PUSA 2VN2A 2Y9YA 4XLAA 4EV0A 3FMQA 2VB6A 2W4SA 1SFOJ 5FKLA 4Y7NJ 3IP4B 2XF7A 2Q2EA 4F7ZA 1R9TJ 3ASOH 4M6YA 3BR3A 3BZCA 3R4KA 2QUFA 2KZVA 3BZ6A 3TW6A 1WPKA 2GA1A 3NWSA 2P5VA 3K70D 1A6QA 3BOQA 3ABKH 3HOWJ 2VOOA 4F93B 4A6EA 3OWTA 1D0YA 1K4SA 2GXGA 2MG4A 4BS9A 3A02A 3I9V2 5TJJA 4UHTA 3V7SA 3Q0UA 3RYRA 3WE2A 4XM3A 3M3YJ 3DPLC 2MBFA 1WGXA 2WAQN 3DKWA 4A3DJ 4PFPA 2ZXJA 2M30A 1R4MB 4G9YA 1S3JA 2L7FP 3G71I 3AL0C 4PSXA 3A1YA 4RS8A 1K79A 3V42A 4DW6A 3CMAI 4GRIA 3WODF 4A3CJ 2EK5A 3F0CA 3N97A 3HC7A 2VASA 2EV6A 3H3ZA 1JJ6C 2R0QC 1R5HA 4KDPA 2ZFUA 2DA5A 2AQFA 2RQPA 3SEZA 4A3JJ 2DU9A 3PSFA 4DYQA 4BEHA 1ZH5A 2FX0A 2E7WA 2ZJQF 3DTIA 4NUBA 1HKQA 2V6CA 2ZNZA 3GTGJ 1RC9A 1ZGAA 5L3CA 4H0EA 2VONA 1RKTA 2UXXA 1Z0XA 2DDBA 4CCNA 2A6TA 4BQAA 4XR6A 4XLNF 2ZJ2A 2KIQA 2EB7A 2JRMA 4A12A 2EV0A 4IHSA 1B6AA 1S9HA 1TT5B 1AOYA 2MA3A 5M3FJ 5DD4A 3BJAA 1SVOA 2H94A 3G1OA 4R8HA 2NNYA 3GFJA 5HVQC 2A5YB 2OCCH 5FJ8J 3WTVC 2LLKA 3CDIA 1U5TC 1UAAA 1XDSA 4Y52J 4J19A 2Z5UA 3SXYA 2UZKA 3K1PA 3E5UA 2VUMJ 5JFRA 3DWLE 3MD2A 1T56A 4UUVA 3HTSB 2A5WA 2L4MA 1V54H 3BDDA 3GTKJ 4C30A 4RB1A 2F2EA 1KQ8A 1X19A 1ERDA 1MH3A 4G94A 3Q0WA 3K69A 1X3ZB 4F3QA 2PEXA 4ZJZA 1V5FA 3B73A 2BHYA 3KP5A 3SQNA 1LFBA 4Q4ZF 5ILSA 2MLGA 4EQQA 1YJNI 2YUSA 2WV1A 4LG0B 2NAZA 3K1MA 1OCRH 3JW4A 5LD2C 5IP6A 3KETA 3K1NA 2HXIA 4JOMA 1CGPA 4A5NA 4E70A 2IGNA 1EA3A 2VT2A 1K78A 4LK0F 5F04A 3OYDA 2KPMA 3OYHA 2EIJH 3LQRA 1ONVA 1QRYA 2IGKA 2MC4A 4ESBA 3BR0A 1SVMA 4RGUA 2JUGA 2AXLA 2QEXI 4WXHA 5J4YA 6PAXA 5J3LA 3PSIA 4H4KC 4X1EA 2JN6A 3HL2A 4TV7A 2CU7A 1PP8F 2HZTA 3KP2A 2LYCA 1HA8A 4IXAA 4BDZA 1R1VA 4ZYHA 1R23A 3TBIA 2LY9A 3S2DJ 1X4OA 3TEDA 3WG9A 1DP3A 1UG0A 5FFZA 2MD5A 3F21A 2HQ5A 1LEAA 1BN5A 4X0GA 3FHZA 3VFZA 1P7JA 4PJ0C 4AUXA 4WCGA 3RKYA 1IGNA 1XSXA 2PJRB 5LEJA 2W25A 2BHZA 1AWCA 3QU3A 5FRMA 3C2BA 3KPHA 5GPAA 3K0LA 2FQ3A 4GXOA 3Q5FA 1RR8C 3WU2C 3PQKA 3GCMA 3CC2I 2IA1A 2OA4A 3LSKA 2A68F 2JJ7A 1BR2A 4IPAA 3IL2A 4IQJA 4HPQA 1D1CA 1JUPA 3VSLA 2KP6A 5EEHA 3DEEA 4NBQA 4IZZA 2X6XA 2DQRA 2QQBA 2V9PA 3COAC 2VPRA 3HOTA 1J7KA 4I0BA 2DFHA 2CQKA 1WJCA 1MMNA 3LFUA 2K9QA 2P6TA 2CQNA 4BQNA 2V26A 3REOA 2JA5J 3FBIB 1G3YA 2IEKA 3FXKA 3TO7A 3ZOBA 4Y17A 1MBHA 4IO9F 2E60A 2IP2A 1KA8A 3C3WA 2HQRA 2FE3A 2X9DA 2R5YA 4II2A 3L2CA 4ZH4F 5M3MJ 2ELJA 2K4JA 2X1DA 4B4CA 1YJ9I 3HEFA 2ESNA 1D1BA 4I2OA 4AYBA 2F4IA 3CJNA 5A2QK 3WTZA 1MBJA 3RJPA 3KP7A 1HLVA 2F5EA 3U2RA 3CCLI 3GXOA 3OYIA 2HKXA 2QM3A 5DUIA 4Q47A 2E2JJ 2FQ4A 3CJQB 1JJ8C 5TRDA 2Z16A 4IL6C 5E1ZB 3HUGA 3UR3C 5CJ9A 3J7AO 3R61A 4LB6B 4HNTA 4DBRA 3CF2A 2KHMA 1AA7A 4U87A 3H3VK 5EG0A 1QZZA 1Y0UA 2OJED 3BTIA 5J1RA 1X58A 3S1QJ 4RM2A 3RQ4A 1JT0A 2K9MA 5CVJA 3OS2A 1MBEA 2XC7A 1O7LA 1F43A 5CVRA 1VZ0A 4BGDA 2FBIA 2FMYA 2FRHA 3M9AA 4I6ZA 4MEXF 4E6KG 1ZRDA 1TQMA 5KVRA 3FZVA 4I01A 2LSOA 1WJFA 3PNTA 4FETA 1IW7F 1R5GA 3HRMA 3N4MA 1MMGA 2OPTA 4MQVA 3RTRA 1ZG1A 2ZMEC 3ZMUA 3B6CA 1Y56A 3LSGA 3GFMA 4B48A 4BBRJ 4IEJA 5ICEA 2WWYA 4M9SA 3E6BA 4I98B 2KJBA 3E3VA 1XMAA 3G73A 1V55H 3TO6A 2HGCA 4XRSG 3OYKA 1VQOI 4DNCA 2KIMA 3LA2A 4CCMA 3RPUD 2N8GA 1J75A 2JTVA 3H9GA 4CSWA 1MMAA 3FMRA 4RMNA 2B0LA 4C2MJ 5HDNA 3RYPA 1JUSA 4HQEA 2LKPA 2PG4A 2YX7A 2CH0A 1MNEA 2MD0A 1YLFA 2GOMA 4OAYA 3ZQCA 3DBLB 2WY8Q 2M4KA 3CZ6A 4HSRA 2VJ4A 2GXAA 2BVMA 3E6DA 3S93A 2F4OB 4UNOA 4CCKA 4HNUA 2QA4I 4HRIA 4NQWA 3ONQA 3VYSB 4XSXF 1LFPA 2L9RA 2XB5A 3VDXA 2RQQA 3I58A 4KJZA 3VYUB 3MFKA 1IG7A 3L2VA 3F8CA 1Y1VJ 4IHTA 1K7AA 3KX2A 5TGTA 4FE7A 2KZGA 2EZIA 2H27A 3OV8A 3FF5A 5EZHA 3HRSA 4D9JA 4EM0B 4XICA 4IRIA 2O8XA 2OBPA 1WJEA 3L2RA 3RPUA 1XGNA 4E7LA 2RC4A 3KYLA 2HFHA 1YRNA 2OQRA 3AG4H 3P7NA 4QTRA 1UELB 5HS7A 4XKVA 4BHPA 1L0OC 2XVCA 4IRHA 3CLOA 2VBWA 4PGGA 1IXRC 1MMDA 1TNSA 2XPVA 3EETA 1PVEA 1MBFA 4AIJA 4BACA 1YX3A 5M5YJ 4XKBA 2ZXWH 5E17F 2EZKA 2Q0OA 2RN7A 3FXJA 5E1XA 4CYDA 4CICA 4L0YB 2XIGA 2QLZA 3HOVJ 4GCVA 1ETKA 1MMSA 5D6FA 1HKTA 2LRDA 2XAHA 1RUNA 4XKCA 3FMSA 3KZZA 3TP3A 3CCUI 1RRJA 2IA2A 2V6EA 1QZYA 2OC6A 3DPTA 3SZGA 4OMZA 4OU0A 1OYYA 3ZCOA 4F55A 5ICGA 1Z91A 2Y0MA 3A03A 4KFCA 2TCTA 4AU7A 1P4XA 1WSUA 1DP7P 1F36A 5B66C 4L18B 1QHGA 2ZMEA 2VKVA 2OAZA 1MGTA 2VXZA 3BPXA 2C6YA 1MW7A 2QBYA 3Q9SA 4HLXA 1NHAA 2EZLA 3S8PA 2K85A 4P1WA 2CUEA 3F9KA 2R7XA 5LRRA 4D0PA 2Q2EB 2ACJA 1Z67A 2HPIA 5J8CA 3I71A 2LKXA 3IV5A 2EWNA 3K2AA 2Y31A 4AVZA 3LNQA 2E1NA 5EDNA 2STTA 5BOXA 2QF7A 2R3SA 2JQ7A 3JTHA 5H20A 2DYSH 3ZQHA 1TWAJ 3PNYA 2ICWG 3SEQA 4XLPF 1J59A 4RLFA 1RETA 1ZRCA 2LR8A 1H0MA 1SANA 2ZB9A 4KN7X 2DA6A 1UZCA 2HDWA 3LWFA 1IUFA 4AM3A 2R7WA 3H3UA 1IDYA 5IYBJ 4C3JJ 4F91B 5DUKA 3OS0A 1DDNA 1DGWY 2K02A 5L3FA 2KFDA 5E3NA 2ZC2A 1WZ2A 5JHUA 3PO2J 3E97A 4JK1X 1XMXA 2VKEA 3ZPLA 5DCMA 3IUOA 4A69C 3J81Z 2H09A 4BEHB 3E1SA 3KLNA 2DI3A 2P7CB 2DA7A 1HW5A 3SZPA 1MH4A 5AIPA 2E1MC 2PJPA 4RB0A 1BOAA 5FLXK 4II3A 1CF7A 9ANTA 2X48A 4M74A 3V8KA 5EF6A 1SFKA 2JUCA 4YIRX 1XGMA 1ACIA 3F6VA 2GQQA 1X2MA 4WX9A 1TWFJ 3W6KB 1GDTA 3GUDA 2ESHA 5CQEA 3PUBA 5D5VB 1U78A 1T6SA 2AXTC 4YFXF 2H8WA 2HOEA 2Y0SA 4FQGA 3TOBA 2BEOA 1BW5A 4O3MA 1MKMA 3DEWA 2D1HA 1XTAA 4Y33A 3FXUA 1O7FA 2FOWA 5DS9A 1EH6A 5DM6F 1GHCA 1YIJI 4J01A 4YFKF 2OD5A 1SD7A 2LC2A 2A6HF 3V8JA 1VQMI 1D5YA 4OMYA 1V5EA 2L0KA 5GAGJ 2R7TA 3KE2A 2VPLA 2GIZA 2MGQA 2X85A 5E3MA 2A6EF 5IT3A 4FCYA 1I5ZA 3OIQA 2VBYA 2HXOA 3LSHA 5CVVA 4IHYA 3H5AA 3O2PE 2FOKA 2STWA 1PP7U 2GA2A 3BCAA 5EZGA 1HC8A 2E71A 4PCQA 1C0WA 2JVHA 2MC3A
chains in the Genus database with same CATH topology
1X3WB 4YIRX 1PVEA 2QSHX 1QZEA 1OQYA 2F4MB 2QSFX 3ESWB 1TP4A 2QSGX 1X3ZB 2F4OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3W B;  4YIR X;  1PVE A;  2QSH X;  1QZE A;  1OQY A;  2F4M B;  2QSF X;  3ESW B;  1TP4 A;  2QSG X;  1X3Z B;  2F4O B; 
#chains in the Genus database with same CATH topology
 2DMP A;  1Y6I A;  1SD5 A;  4WWC A;  4CCL A;  3BCB A;  3FXQ A;  1S7E A;  5E18 F;  5DD8 A;  1H89 C;  1K78 B;  3QYB A;  4BKX A;  2HI3 A;  3EYY A;  3NAU A;  2CW8 A;  1KYW A;  3ERE D;  2EZH A;  4YEJ A;  1T8I A;  2KMU A;  3V7C A;  1EKE A;  1N77 A;  1I1G A;  2XB0 X;  4PJL A;  2O0Y A;  2Z3Y A;  5H6Q A;  1ETY A;  4BXU A;  3K10 A;  4HF0 A;  2DTZ A;  3IH2 A;  4U88 A;  3F8B A;  2HR3 A;  1QA6 A;  4KYW A;  1KZH A;  2DXI A;  1FP2 A;  2ZNY A;  1HKS A;  2LDU A;  2JA8 J;  2R7U A;  1ORK A;  2WV0 A;  3H1C A;  1E2X A;  5FO5 A;  2E1O A;  3EUH A;  1ETX A;  2R5Z A;  1TL8 A;  2VKH A;  3HJE A;  4PJN A;  2VOD A;  4NB5 A;  3S1M J;  1B9N A;  1X1D A;  3CCQ I;  3MZY A;  4CO8 A;  2LVS A;  2PQ8 A;  4DIQ A;  2XAU A;  1SFE A;  4HA8 A;  1I1S A;  4UUS A;  1V3F A;  2P6S A;  2IS4 A;  5FRO A;  1FYL A;  1AHD P;  4Q5S F;  3IKV A;  4UB6 C;  3DFG A;  5ILU A;  3HOS A;  1VQP I;  1OMI A;  4HV5 A;  4M3E A;  1DQU A;  1F1Z A;  3MMY B;  1KQ9 A;  1EV7 A;  1KON A;  4CDG A;  4KN4 X;  3HZJ A;  1YYV A;  4U0V A;  2DTR A;  5F0C A;  1WWX A;  1XGO A;  2Z99 A;  4ZYD A;  1MD0 A;  2XKP A;  2RDP A;  5H2F C;  1I50 J;  1IN7 A;  4HV6 A;  1K83 J;  2CO5 A;  3FDY A;  2BZT A;  3HXL A;  4KA4 A;  2M1B A;  1Z3X A;  2HVQ A;  3O8H A;  5GPC A;  1ZG5 A;  2JA6 J;  2DN0 A;  2LH9 A;  1SFX A;  2H6C A;  4HX7 A;  3OIP A;  1U5T B;  3IRQ A;  1B72 A;  1O57 A;  3W6J B;  1YX5 A;  2CV0 A;  1H8A C;  2WB1 A;  4KNY A;  1OIS A;  4CA0 A;  1PYV A;  1XS9 A;  2QEN A;  4G8X A;  5IY5 H;  5DV5 A;  2K3F A;  2EPF A;  3U1K A;  1ZGJ A;  4YRV A;  3AFH A;  3KIO A;  3WTY C;  1XGS A;  3CDH A;  4U0Y A;  2R5Y B;  5KCM A;  3HM5 A;  3PM1 A;  3LAJ A;  1Z6T A;  1U2W A;  2CMP A;  1K61 A;  1ZAR A;  4B09 A;  3WU1 B;  3T8R A;  5EGO A;  1T33 A;  1JTY A;  3ABU A;  1U9N A;  4FE4 A;  1G3T A;  3P9I A;  1XB4 A;  1TNT A;  3K4N A;  5GTI C;  1D5V A;  3K7A J;  4RM3 A;  5GAH J;  5BPD A;  3LA3 A;  1R00 A;  1DPU A;  4W1U A;  3ZN1 A;  2IJL A;  5GP9 A;  4QIW N;  3OYG A;  1RI7 A;  4A3B J;  1DPR A;  1FP1 D;  2K9L A;  4A6D A;  3HUG B;  4LGW A;  3Q0V A;  4A0X A;  4BJ6 C;  3TOA A;  3RSN A;  3U1D A;  3TW7 A;  5IPA A;  3X2Q H;  1W0T A;  4Z6Y A;  5EG0 B;  2VC1 A;  3BJO A;  1OCO H;  1TBX A;  1W5T A;  2UUZ A;  1FTT A;  1BI1 A;  5CPR B;  3MN2 A;  2QQ9 A;  2CGP A;  1QO0 D;  3ZQF A;  2ME6 A;  4V19 K;  1TTY A;  4KUM A;  1ETV A;  4DZP A;  4CYC A;  4UXN A;  2Q8K A;  3S15 J;  4PFO A;  4RAY A;  3H9Q A;  1RUO A;  2NXN B;  1YS6 A;  3DKY A;  4I09 A;  2CV2 A;  2R7S A;  4A93 J;  4KIB A;  2CRG A;  3V8L A;  2NS8 A;  4NHJ A;  2X51 A;  4DOZ A;  2P5K A;  1TZL A;  2HOT A;  2WAE A;  4RAF A;  2YU9 J;  2AS5 F;  3BR6 A;  2XHK A;  4G7Z F;  2F4M B;  3LSR A;  3ESW B;  3FXM A;  2IAI A;  5F64 A;  1R22 A;  2R7Q A;  5D5U B;  2VE9 A;  5M5X J;  2JA7 J;  2WBM A;  5B1A H;  5E3O A;  1LVA A;  4WXC A;  1J09 A;  3QRF F;  2L7K A;  2V1N A;  1JUM A;  1BJA A;  3K9T A;  2FNA A;  4LIT A;  3G4S I;  1WI3 A;  3EYI A;  4EVI A;  4CCO A;  4RA2 A;  1IV6 A;  4PK4 A;  3CMY A;  4RGR A;  1LNW A;  2PX9 A;  1O3Q A;  3CCR I;  2RAE A;  2XGE A;  4HF2 A;  2K3P A;  1PJR A;  3TO9 A;  2IGO A;  2ID6 A;  4D7N A;  3JR9 A;  1EJ9 A;  2IVM A;  2F48 A;  4OAZ A;  3G6E I;  2IT0 A;  1SFU A;  1VQ8 I;  5CYV A;  2K7L A;  3K4C A;  1OFC X;  3BPV A;  3CUQ C;  3TQN A;  3PQJ A;  5DCF A;  3EPZ A;  2BBY A;  4BE2 A;  2CG4 A;  4M3D A;  5BQT A;  3PNV A;  2CJJ A;  4EJV A;  2R7O A;  3JAM Z;  1B1B A;  3FWE A;  1YTY A;  1W7P D;  4NQW B;  1XPX A;  2NRA C;  1YG2 A;  3BWG A;  1K4T A;  4HF1 A;  5CVU A;  4ZZL A;  4HST A;  3HTU A;  4MHG A;  1A31 A;  3NEU A;  1FIA A;  1Z9C A;  2X6W A;  4D1Q A;  3AKZ A;  2VQL A;  2MFZ A;  1X3W B;  4BH9 A;  3QOE A;  2CUJ A;  3ELK A;  3BQZ A;  1P9Q C;  3CTA A;  1YRN B;  4MIM A;  5EEA A;  4G7O F;  4B8X A;  2DPU A;  3BR2 A;  3M7G A;  2YPR A;  4PJM A;  3OSF A;  3HKZ N;  2O8K A;  5B1B H;  3QU6 A;  2JPB A;  1BW6 A;  4FT8 A;  1W5C C;  1BI2 A;  2MH2 A;  2R4G A;  2GAU A;  4DBQ A;  3IAM 2;  4NC8 A;  3MKZ A;  1XD7 A;  3WGI A;  4D5C A;  3RKX A;  1K6Y A;  2PMU A;  2M87 A;  3A0H C;  5M5W J;  5DYM A;  1X1P A;  3JRF A;  3CQZ J;  1LB2 A;  1D1A A;  4QWQ A;  5ICC A;  1XSV A;  2DFE A;  2EFQ A;  2D1V A;  2P81 A;  1W7P A;  3BG6 A;  3M1E A;  3HG9 A;  1KU2 A;  4HG2 A;  4XMY A;  2ECB A;  3RIR A;  3OYA A;  3KCC A;  4AIK A;  2O5R A;  1UHM A;  1ENH A;  4NC7 A;  5F0F A;  1IN4 A;  1VQ9 I;  2BE5 F;  2VT3 A;  1PUE E;  4XID A;  2VQH A;  1IUY A;  4UUT A;  1S7A A;  4C3I J;  3KZY A;  1ITY A;  4DGW B;  2ZME B;  1U5T A;  4ENJ A;  1ZQ3 P;  3VSK A;  2QBY B;  1R36 A;  2DOD A;  4ZZD A;  3PFI A;  1G59 A;  3S32 A;  1SC7 A;  3F8N A;  4MLO A;  4I99 C;  3W2W A;  2HQA A;  2ME0 A;  1FWZ A;  4Q48 A;  1I27 A;  5BS6 A;  5IYC J;  4BYY A;  1WJ5 A;  1BR4 A;  3O8G A;  4V2F A;  3LSP A;  4GO1 A;  1U6G A;  1IRZ A;  3F8M A;  1G3S A;  3J7Y J;  2HOS A;  4QPQ A;  2CUF A;  5JHF A;  1MBG A;  1FSH A;  2XRO A;  3J80 K;  2P8T A;  4XLC A;  2IGM A;  4XRM A;  4RAZ A;  1S29 A;  3ULQ B;  3PJR A;  2MYS A;  1IO2 A;  3CUQ A;  2BY2 A;  1EH8 A;  1AKH A;  5K7H A;  2CFX A;  1SAX A;  4OIO F;  3FHN A;  1VI0 A;  5EEG A;  3L7W A;  5E79 C;  2XPW A;  4YG2 F;  3GX4 X;  1R7J A;  4ZYE A;  1V4R A;  2DO7 A;  2ZBK A;  1TQP A;  4S04 A;  1QPM A;  1EH7 A;  2HVR A;  1U8R A;  2HEO A;  3CP8 A;  1IC8 A;  1JKP C;  3I54 A;  4DQ2 A;  5GTH C;  2COB A;  2IW5 A;  3FK6 A;  2ECC A;  3LFK A;  2DOA A;  1XDU A;  3AG2 H;  2KQR A;  3S3O A;  2PLY A;  4C2T A;  1Z6R A;  3OIO A;  4BU2 A;  5DCM B;  2AHQ A;  1HBX G;  3DQV C;  1ZAO A;  2XKO A;  3LOC A;  4Y13 A;  2KRC A;  3FBN B;  4N4N B;  1MZB A;  5F1R A;  5LBQ A;  1N78 A;  4MTE A;  3CP2 A;  2VJ5 A;  3M4O J;  2HNH A;  4OIQ F;  1BJZ A;  2PMZ A;  2XGD A;  2EFN A;  4U0W A;  1CF7 B;  2JRT A;  5FD6 A;  1LDK B;  1FOW A;  4XK4 A;  2E5N A;  3HBL A;  4B44 A;  3K4L A;  2X0L A;  5B5E C;  5FLM J;  2O9L A;  3P9K A;  4GYI A;  3MWM A;  2RVC A;  3C7J A;  3IAS 2;  4CHU A;  3K6G A;  2EIM H;  3CLQ A;  1FOX A;  1X3U A;  5ILV A;  1T0F C;  1MSF C;  3SYT A;  1SD4 A;  1W5S A;  3HPG A;  1ZG3 A;  4L9T A;  3CCJ I;  3KP3 A;  3FXL A;  3CCV I;  1S5L C;  2R93 J;  5C44 J;  4KT5 C;  1J2X A;  1GV2 A;  2HYJ A;  1JKO C;  2H1K A;  4XKW A;  2W48 A;  2GZW A;  3BLY A;  5B3S H;  5LHH A;  3MKW B;  1H88 C;  1OLT A;  2HYF A;  1LQ1 A;  2NVQ J;  1LE8 A;  5EYR A;  5CKT A;  3MZ8 A;  1ZTR A;  4BQO A;  2EFO A;  4AYB N;  2DA2 A;  3HPH A;  1G8X A;  3OYC A;  3CO6 C;  2V9K A;  2D2W A;  4BXX J;  3ZP5 A;  3CUO A;  1FC3 A;  3I0T A;  4M71 A;  1KU9 A;  1OCC H;  2M8E A;  2DK5 A;  1X1A A;  2F5D A;  5IOY A;  2I8D A;  5HOD A;  3T1B A;  1RIO H;  1ZR4 A;  1LFU P;  3RZO J;  3KYD B;  3K4B A;  2RKH A;  3WG7 H;  1IAW A;  3U9G A;  3DPU A;  3HOU J;  2AQE A;  4C9Y A;  1J0R A;  2M2E A;  4EJW A;  4MEY F;  2BXZ A;  2FNP A;  3IH4 A;  1F9N A;  1IRF A;  1FIP A;  1YW7 A;  1UHW A;  4I76 A;  4Y15 A;  4A2U A;  2DT6 A;  2HQN A;  4MFD A;  4KIG A;  1T39 A;  2Y75 A;  4XRF A;  1U9O A;  4MO7 A;  2IBD A;  1ETO A;  2Z9O A;  3S16 J;  4E7S A;  3J81 K;  4PGH A;  1G2H A;  3I64 A;  4XON A;  2ID3 A;  4ZYA A;  2BYV E;  2K9S A;  3I5U A;  4B47 A;  4PZJ A;  2R7Z J;  2R5Z B;  4XLE A;  4BXF A;  2PMH A;  1NG7 A;  1TWH J;  2P5L C;  2BY1 A;  4FX0 A;  2ZFW A;  2L9S A;  2HKO A;  3DEU A;  4K2E A;  1CQT A;  3W2V A;  4MTD A;  2KLO A;  1W36 C;  2Z2S B;  3ZQQ A;  2HOA A;  4KIF A;  4UUS B;  3L1P A;  2H8R A;  1HW1 A;  5E1W A;  2M3A A;  1APL C;  4QPO A;  3BY6 A;  1SEU A;  2E1M B;  3HGG A;  2XAJ A;  1IDZ A;  5FKK A;  2EJR A;  4FIS A;  5D8K B;  2K9N A;  4A3E J;  3F6O A;  3LQQ A;  5F1J A;  4E7I A;  1VF9 A;  3WTU C;  2RGV A;  3G2B A;  3OY9 A;  4BAY A;  2QGU A;  3CC7 I;  2R7V A;  1JTX A;  1OPC A;  4JX4 A;  1N25 A;  2X1E A;  3CF5 F;  2ISZ A;  4NC6 A;  1IXS B;  1IN5 A;  4N4O B;  3CDL A;  3QOD A;  3A0B C;  2ZO4 A;  4M6V A;  1RES A;  2GXB A;  1T0F A;  4N0B A;  5K5O A;  1WH7 A;  2LOO A;  2R7F A;  1FMW A;  2Y9Z A;  4XN3 A;  5EJC A;  3LSI A;  1MDM A;  1UB9 A;  2HPM A;  5TIS C;  1B72 B;  1HW2 A;  2WC2 A;  2O6G E;  2DMT A;  3BG5 A;  3TDZ C;  3C1D A;  1FOY A;  1WJD A;  2BGC A;  3FM5 A;  5HS8 A;  4M73 A;  3DP7 A;  1S72 I;  1TT0 A;  2MH9 A;  5K5Q A;  4FAS D;  2KIF A;  1B8I B;  3HSF A;  2PN6 A;  3I53 A;  3L09 A;  3CES A;  3SZT A;  5D8L B;  2DMU A;  1B9M A;  1KU3 A;  4ZC3 A;  3GTM J;  5KNL A;  1I6X A;  2JSC A;  2NYX A;  4M3F A;  5EGO B;  1KQ0 A;  3OYL A;  2LNB A;  5LGT A;  2LBF A;  3I4M J;  3A4C A;  2JSP A;  2F6C A;  4E7Z A;  3P5J A;  3GME A;  4UVA A;  1O4X A;  2NS7 A;  4UV8 A;  3ZMV A;  2IS1 A;  3GFI A;  3ABM H;  1GV5 A;  1HF0 A;  5KAF C;  1HDP A;  4L0Z B;  1T95 A;  1OR7 C;  3D1N I;  3H36 A;  4A3K J;  2UXN A;  1L3L A;  1Z7L A;  4A3G J;  5F6F A;  3D5S C;  1IZ1 A;  3V7R A;  2QCO A;  2R7D A;  4E7K A;  4LJZ F;  3F8F A;  3DXJ F;  1H9T A;  3A01 A;  3MCZ A;  1WJB A;  3DV8 A;  1MSE C;  3L2U A;  3CC4 I;  2L9N A;  1ZEL A;  1Q1H A;  4BDY A;  4BBS J;  4A0Z A;  3KEY A;  1JGS A;  2M7A A;  5CLS A;  2QKL B;  1A5J A;  1B4A A;  1QU3 A;  5LGN A;  4ZTF A;  1BC7 C;  1P4A A;  1UJ8 A;  4FHT A;  4B3X A;  4G12 A;  4XBF A;  3RKQ A;  2X6Y A;  3K4M A;  4CYC B;  2J5P A;  4HLY A;  4EGY A;  4M72 A;  2CV1 A;  3HOZ J;  2WY7 Q;  2F5V A;  3VB2 A;  2CW0 F;  1BI0 A;  2NVX J;  4UY8 I;  3BP8 A;  4ENM A;  2HS5 A;  3F23 A;  1QGP A;  2RV8 A;  3CO7 C;  1I3Q J;  3RQI A;  1Y39 A;  2NVY J;  1ZGW A;  1FJL A;  3KYC B;  5E3L A;  1Z3Y A;  3WTT C;  1WH5 A;  2NNN A;  2O3F A;  5JR3 A;  3OYN A;  2OF7 A;  1OJL A;  4AC0 A;  3S1R J;  4HAM A;  1X2N A;  3JSP A;  3HGY A;  2K5C A;  1Z77 A;  5C4J J;  4M9Z A;  4JYK A;  5IP7 J;  2KL4 A;  4KIC A;  4BUP A;  2ZCW A;  2KDZ A;  4CCJ A;  2VE8 A;  2E36 A;  4HQM A;  3ZRG A;  3R6S A;  5L3B A;  2YU3 A;  3DTK A;  2OCE A;  4EJT A;  3JRH A;  1LJ9 A;  1FBQ A;  3VPR A;  1FTZ A;  5HNH A;  3RPQ A;  4Y3O A;  2LG4 A;  4E4H A;  3H92 A;  5JI6 A;  3M8J A;  1QVT A;  2DA4 A;  2K27 A;  2EFW A;  1USS A;  4M6X A;  4ZTJ A;  2ETH A;  2EIN H;  2YS9 A;  3BR5 A;  4BHC A;  1T98 A;  1A36 A;  3OL3 A;  5AIQ A;  4RB2 C;  1W0U A;  3BG9 A;  3E0J B;  2DK8 A;  2XGC A;  2XAF A;  3WTW C;  2EA4 A;  3BRO A;  3R60 A;  4OIN F;  2GLO A;  4CGZ A;  1STZ A;  3MQ0 A;  3CMM A;  4LOC A;  3DCF A;  3MKL A;  2L4A A;  4KMU X;  3AL0 B;  4OIP F;  3J7Z I;  1R5I D;  2FUG 2;  3L00 A;  5FB2 A;  1YS7 A;  3OYF A;  4DJA A;  1LUJ B;  2H6B A;  3VWB A;  2MSY A;  3FIW A;  3R0A A;  1QZE A;  3KLO A;  1WKM A;  2P0W A;  2UV1 A;  2WAQ A;  2Y69 H;  4RGX A;  1ZHF A;  3JRA A;  3GTL J;  1HSJ A;  5D5W B;  4IX7 A;  3OYE A;  2K40 A;  2P4W A;  3GTQ J;  1R71 A;  4ESJ A;  3PIO F;  4HX4 A;  1BIA A;  3WTS C;  3WGH A;  4A0Y A;  1WCM J;  2IPQ X;  1T2K A;  2BV6 A;  5K1Y A;  1FNN A;  4XSZ F;  3F3X A;  3MKY B;  4LD5 A;  5HLT A;  1W7P B;  3D5R C;  2LK2 A;  2Y0S N;  3DU6 A;  3HOY J;  3GBG A;  2OTL I;  1BOB A;  1QVU A;  2MLK A;  4P9F A;  5IP9 J;  1DU6 A;  1YW9 A;  2LF7 A;  1D3Y A;  3KEO A;  3IWF A;  3KEQ A;  3Q9V A;  1NH3 A;  1IN6 A;  2ZXH A;  4EGZ A;  2QSG X;  1FSE A;  3W6V A;  1KYZ A;  1YO5 C;  1BBY A;  1BI3 A;  3RDI A;  1POG A;  2RNG A;  3H5R A;  2E2H J;  4AIH A;  4ZYG A;  2LY2 A;  2DCE A;  1GXQ A;  4HZF A;  5KK1 A;  1R58 A;  3ZMD A;  1U8B A;  3IH3 A;  2J5O A;  2K86 A;  2NS0 A;  4XOR A;  2OQG A;  1RKW A;  3SDB A;  2XGX A;  5FD5 A;  2DAO A;  1FX7 A;  5LHG A;  3BG7 A;  2E35 A;  2Z1D A;  4L5I A;  2F5F A;  2QZ8 A;  4B3A A;  1B8I A;  5IT9 Z;  5J1U A;  3K2Z A;  2DW4 A;  4F92 B;  2DFF A;  4LMY A;  1VND A;  3JAM K;  3UKG A;  3IKT A;  2X1C A;  5D4R A;  5HNF A;  4WF2 A;  1RR7 A;  3CUQ B;  4ZDP A;  2EA2 A;  1GVD A;  4JBA A;  3U21 A;  3FM3 A;  4DZJ A;  3DTE A;  3GLL A;  3OYB A;  1AKH B;  5JVT A;  4BY1 J;  1HXD A;  1OCZ H;  4Z2Y A;  1FBS A;  2VIX A;  3E5Q A;  3EDP A;  2OU2 A;  1Z7U A;  4A3I J;  1F4K A;  2OTJ I;  1VQN I;  4UV9 A;  1BIB A;  4P55 A;  2KDO A;  4JX6 A;  2FEZ A;  4LK1 F;  1FOK A;  2OUM A;  1LDJ A;  2VI6 A;  2EIL H;  2VJJ A;  5F27 A;  2G7U A;  3TL4 X;  5J6X A;  1ZLJ A;  2W85 A;  1MND A;  2WA0 A;  4YEL A;  4ZDL A;  2JWT A;  5F08 A;  3KFW X;  2DJN A;  3IHU A;  2V9V A;  1MJA A;  4M3B A;  4X6A J;  2ZSH B;  3BT9 A;  1A6I A;  3MEX A;  1T38 A;  1XX5 A;  4IQ4 A;  3GZ5 A;  1BL0 A;  2KRF A;  1VFC A;  2VOP A;  3RKW A;  1YIO A;  2PBI A;  3ASN H;  1IV8 A;  3SFZ A;  3HKZ A;  1VQ5 I;  1LDD A;  3FX3 A;  2CFO A;  4MGR A;  3VOE A;  5GAE J;  3CD6 I;  4EM1 A;  2HZD A;  1XC5 A;  1WVR A;  4OOI A;  3GTJ J;  2D5V A;  3C2G A;  1Y8Q B;  3HHH A;  4AID A;  4GYG A;  3JCU C;  4XOP A;  4GFB A;  4GDF A;  2I5U A;  1P7I A;  3DBR B;  3EUA A;  3KZI C;  2DPD A;  2CUZ A;  4IHW A;  2YSR A;  2XV4 S;  4S0H B;  2VJI A;  2NVU B;  4G6T B;  2WB1 N;  3MZH A;  4LLG F;  3L2Q A;  2YX4 A;  3R0J A;  1QHH D;  2E19 A;  2GM4 A;  1Z21 A;  1PUF A;  2R92 J;  4BQQ A;  4A3L J;  1ULY A;  3AG3 H;  4XN0 A;  2JT1 A;  5LGU A;  1MIJ A;  3GO5 A;  2EFP A;  4ITV A;  2W84 A;  4UVC A;  1G4D A;  3RCO A;  1ON1 A;  1LE8 B;  3QP5 A;  5E20 A;  3SFI A;  2O03 A;  1S6L A;  2JK3 A;  1JE8 A;  3OOU A;  3GWZ A;  5DDG A;  3QYF A;  5FKM A;  1FBU A;  1P92 A;  2LKS A;  4L9J A;  1U0J A;  2FJ1 A;  3OMY A;  1D0Z A;  5KAI C;  3O6B B;  4MNU A;  3GF2 A;  5L3G A;  4EJU A;  4IVN A;  2RRE A;  3HRU A;  4XL9 A;  2GIV A;  5HS9 A;  2XSD C;  2V79 A;  1I6H J;  2LTP A;  4IOA F;  3GZN B;  3BTC A;  4IHX A;  4U7B A;  1YJW I;  5HOO A;  4ESF A;  3UNG C;  2ZKZ A;  3DBH B;  2M0C A;  3B6A A;  4OIR F;  3ZMT A;  2W82 A;  1TQI A;  2DBB A;  1XCB A;  3GYH X;  1XN7 A;  3A2K A;  1ZR2 A;  4BNC A;  3TP0 A;  3SJM A;  5FRN A;  2VLA A;  1JXS A;  5C4X J;  3DU5 A;  3I59 A;  4CUG A;  2IRF G;  5DM7 F;  4C3H J;  5E8I A;  5D5X B;  3HOX J;  4RDU A;  2KIS A;  3AAF A;  2QQ8 A;  2DMQ A;  2BY0 A;  3GVA A;  3IWZ A;  1J9I A;  4AVP A;  3JRD A;  5K7F A;  4L9V A;  2B9S A;  2JA2 A;  3QOP A;  3TMO A;  2LY1 A;  3VYR B;  3QPH A;  1J5Y A;  3T5X A;  4JP0 A;  1ZYR F;  1Y1W J;  1PDN C;  1E17 A;  2JMW A;  1N75 A;  2X6O A;  2XAS A;  3LAP A;  3VYT B;  1E3H A;  2R7R A;  4LIU A;  1WFX A;  1LKX A;  4RGS A;  1F5T A;  3BZK A;  1GXP A;  4LIV A;  3GZ6 A;  4GGG A;  1BA5 A;  3PL8 A;  4QSH A;  4HYE A;  5CQG A;  1WI9 A;  5ICF A;  1UFM A;  1FMV A;  1TW3 A;  3MVP A;  3WGG A;  2V1X A;  4OWR B;  3RI4 A;  1MDM B;  1ZRF A;  2L5Q A;  1LEB A;  4HDU A;  2A69 F;  1SVL A;  1D8K A;  3D5L A;  2CS3 A;  2DA3 A;  4N9I A;  2ISY A;  3QPS A;  2L54 A;  2XDV A;  3LL7 A;  2FA5 A;  3H0D A;  5FLV A;  2UWM A;  3AG1 H;  3OYM A;  3JRB A;  2WAF A;  4HDV A;  3NAR A;  2HU9 A;  1MBK A;  1JGG A;  4YIF A;  4LG3 A;  1UMQ A;  3PIP F;  2TRT A;  3P9C A;  2P7V B;  4MQ9 F;  3I56 I;  5JVG F;  3CCE I;  2XAG A;  3LST A;  3MAJ A;  3Q3S A;  2CQX A;  2JZY A;  3IRR A;  2CQQ A;  1RPW A;  2PI0 A;  4KMF A;  1E3O C;  1YHQ I;  2L3D A;  3GEZ A;  2HYG D;  4BE0 A;  1QQI A;  5FKO A;  2LBF B;  3FXO A;  1TC3 C;  1YW8 A;  5J1Y A;  3CCS I;  2V7F A;  3NRV A;  4HBL A;  3HSE A;  4HX8 A;  4WXD A;  3RZD J;  2W00 A;  3TGN A;  1FZP B;  4I0A A;  3ZQI A;  1IRX A;  3OS1 A;  4KT6 A;  4MFE A;  2CW7 A;  1XCV A;  2M0M A;  4R1H A;  4EJO A;  4BJT A;  5JLX A;  3S17 J;  3ZMS A;  1IN8 A;  3CCY A;  5AON A;  2MAB A;  5F0H A;  2M45 A;  2Y2Z A;  3A01 B;  2XF6 A;  2OV7 A;  2FML A;  2DT7 B;  2O61 A;  4XLH A;  1YQA A;  3QPL A;  3OSG A;  1JI8 A;  5LLQ A;  2ZXI A;  1IXC A;  1NTC A;  2FBK A;  1QPI A;  1I39 A;  1VQL I;  3KP6 A;  1OQY A;  4RAG A;  5E8G A;  3LMM A;  4Y4R A;  1TWG J;  3SDG A;  4XOT A;  1D8J A;  1RNL A;  1KU7 A;  3E7L A;  4U7D A;  3S1N J;  3OL4 A;  3TDU C;  4L9N A;  3BTJ A;  4PJJ A;  1HST A;  2IS2 A;  4BJ5 C;  3SHF A;  3FKJ A;  2NOG A;  1B59 A;  3G1M A;  2HDD A;  2G7H A;  5D4S A;  4ASN A;  3K4J A;  1XG1 A;  5IYD J;  3S14 J;  2EH3 A;  2TDX A;  3BJ6 A;  4P96 A;  2QSH X;  1WRJ A;  4RBO A;  2M4G A;  4LFU A;  1FT9 A;  4B43 A;  4IHV A;  1ETQ A;  2M7B A;  2L7Z A;  2BW3 B;  2DOF A;  3BG3 A;  3W3C A;  2L7M P;  2IXS A;  1GVJ A;  4ENK A;  2I10 A;  2LRE A;  3I3L A;  1TLH B;  2LD5 A;  2KRH A;  4BHB A;  3JTG A;  3TKY A;  2O7O A;  3FIS A;  5ERI A;  1LPQ A;  1QBJ A;  2L9V A;  4EAT A;  4O6J A;  4IKF A;  3G3Z A;  5LFA A;  2PFB A;  4M9X A;  1RZ4 A;  1UHS A;  3ABT A;  4A3M J;  3M8F A;  3WHC A;  5BPI A;  3PFY A;  2EIK H;  4IRG A;  3I55 I;  2DQL A;  3HSR A;  2OZU A;  2KJC A;  2E34 A;  3OOP A;  2VKD A;  5LEK A;  2COM A;  5HDK A;  4LB5 A;  2HTS A;  5K7Z A;  1OYI A;  1HOM A;  1TP4 A;  1FLI A;  3K4K A;  2DOE A;  2ZJP F;  4LG0 A;  4JX5 A;  3FKI J;  3E6M A;  3H0G J;  1X4P A;  1IRG A;  2ELH A;  3WTX C;  2Y30 A;  3G1L A;  1R1T A;  1GUU A;  1FPQ A;  5LRS A;  1FEX A;  2YR2 A;  2BOL A;  1EF4 A;  1YI2 I;  2WTE A;  3GW2 A;  3T8T A;  1UCR A;  2QSF X;  5FGM A;  3J80 Z;  5HLI A;  3CCM I;  3L9F A;  5A2Q Z;  1ETW A;  3WU0 A;  2B63 J;  3OR2 C;  4BL0 B;  4XLF A;  5BMZ A;  3I4N J;  2EQR A;  1NG6 A;  4EEF G;  3QQA A;  1GLN A;  2M9H A;  1X1C A;  2ADU A;  5J40 A;  1R6R A;  4ETS A;  2A07 F;  1JHH A;  4I7H A;  2PMZ N;  2RNJ A;  4AWX B;  2V1U A;  1W4M A;  5LHI A;  4RB3 C;  4BY7 J;  4UVB A;  5DTD A;  5CVI A;  3BR1 A;  4O5V A;  3LSJ A;  1SAU A;  3DLA A;  2K4B A;  2NOJ B;  3ZMZ A;  4V2G A;  1Y0N A;  2ZSI B;  1ZKG A;  1MJB A;  2QYO A;  4ZDO A;  1REP C;  1G6N A;  2L02 A;  2XSJ C;  3S3N A;  3M1C A;  3PO3 J;  3CME I;  2PJR A;  1R1U A;  5K5R A;  1P6R A;  2DMN A;  4HNV A;  5H6R A;  1BR1 A;  2HVS A;  3KP4 A;  1G3W A;  1SMT A;  4D7M A;  5FKN A;  5FFX A;  2WAD A;  2LF8 A;  3I4P A;  5KHD A;  2B7E A;  1O3T A;  2CYY A;  2G0E A;  2VQC A;  1S8N A;  3ISP A;  5J4V A;  4J00 A;  2LP0 A;  2FD5 A;  3DKX A;  3JRG A;  1YFH A;  1FYK A;  2LFB A;  2EV5 A;  2V4J C;  5J47 A;  2Y48 A;  2XRL A;  2Z33 A;  1ON2 A;  2QWW A;  4IOC F;  2DYR H;  2E1C A;  2VC0 A;  4C2U A;  2MW8 A;  3F72 A;  3F22 A;  3C18 A;  2DLL A;  1W1W E;  1WQ2 A;  1DUX C;  2CSO A;  1JT6 A;  2E7X A;  4NDL A;  5JLW A;  3HYI A;  3HDD A;  1WHU A;  2GOX B;  3ZQ7 A;  4HOB A;  1OCT C;  3B02 A;  1MJ9 A;  3BC8 A;  1E0E A;  2W24 A;  4ENN A;  4E7H A;  5HLG A;  2L01 A;  2X4H A;  3FXR A;  2EBI A;  4E7J A;  1W36 D;  1FY7 A;  2BVL A;  4A5M A;  1YE9 A;  1HCR A;  1D0X A;  2XUB A;  3M8E A;  4S05 A;  1TWC J;  3ZQG A;  1LVK A;  1DGR M;  3O3K A;  1A35 A;  3FK7 A;  2QKM B;  4ON0 A;  4P9U A;  4ABZ A;  2HDC A;  2M34 A;  1MNM C;  4PDK A;  3DLL F;  2GWR A;  3ROU A;  1DU0 A;  1JHF A;  3JSO A;  2KIU A;  3GTP J;  1T08 B;  3H5N A;  3LSM A;  2E5Z A;  2VBZ A;  4WK8 F;  3S2H J;  4G7H F;  3ECO A;  3D0S A;  3J7A Y;  2CQ7 A;  5D6E A;  2FF4 A;  4NNJ A;  1I3A A;  1Z1D A;  4IF4 A;  4CXF A;  5ED4 A;  3EUH C;  2ZJR F;  4UB8 C;  2M8G X;  3E5X A;  3NQO A;  2OZ6 A;  1OYW A;  4FTH A;  3QPT A;  3NWT A;  2GBY A;  1SD6 A;  4P5O A;  4N9H A;  2W1O A;  2VBX A;  1VTN C;  4FX4 A;  5GAD J;  5J8F A;  1OKR A;  1U3E M;  2BY3 A;  2DFI A;  5BNG A;  2FXA A;  3HB9 A;  1E3P A;  4G6D A;  2L2O A;  3QYE A;  1XMK A;  3IC7 A;  3HRT A;  2BW3 A;  4KIS A;  1P2F A;  3ABL H;  2VXD A;  1M1E B;  3M07 A;  1R4N B;  3ERM A;  2QQA A;  4M3G A;  4YFN F;  4R79 A;  2KT0 A;  3S2W A;  2A61 A;  1ZLK A;  1OCP A;  2HTJ A;  3GFL A;  4JQF A;  5L3E A;  5HLH A;  1BM9 A;  4CH7 A;  1YIT I;  2JPC A;  2Q1Z B;  1PUF B;  1VQ6 I;  3HIF A;  4XQF A;  5IT9 K;  3H9J A;  4QLC U;  4I02 A;  4G6Q A;  3QAH A;  2IA0 A;  1KGS A;  4A3F J;  1IJW C;  3PUF A;  1TW2 A;  2V1D A;  3HHG A;  3CJT B;  3BQY A;  1XSD A;  3LA7 A;  2HWV A;  3EQL F;  4AD9 A;  1O3S A;  1Q1V A;  3W2A A;  3N05 A;  4XRS A;  1FYM A;  3QP6 A;  3ZN0 A;  3DF8 A;  4KIT B;  1HQC A;  3ECH A;  1WJA A;  3QWL A;  3VEP A;  4W97 A;  1JKR C;  2CWE A;  3EUK L;  2AO9 A;  5C3E J;  1VQ4 I;  1P4W A;  4ANJ A;  1A04 A;  3ZQL A;  5HDG A;  1Y8R B;  3V4G A;  3L2W A;  2DDA A;  1OR7 A;  1UST A;  2FSW A;  1HDD C;  3ZR8 X;  2LMD A;  4EMS A;  1S7O A;  1BC8 C;  1ZRE A;  1AU7 A;  3ZXS A;  1K6O A;  2FBH A;  3JRI A;  3ZGK A;  3H35 A;  2ELK A;  4HEA 2;  2BXY A;  2W57 A;  2E2I J;  3K70 C;  2H1L A;  2IS6 A;  4LLN A;  4L5J A;  1ZK8 A;  3WE3 A;  3JRE A;  4B1R A;  2W7N A;  2A3S A;  3C2H A;  4RLQ A;  1VQK I;  1UG2 A;  3I59 B;  3ML6 A;  1NK2 P;  4D5F A;  5DEQ A;  4DYC A;  4EM2 A;  3JRC A;  4HW0 A;  1X1B A;  1Z05 A;  1H9G A;  2KKO A;  1YOV B;  4XNF A;  4CZZ A;  3VOD A;  1NK3 P;  4PSW A;  4IJA A;  1IF1 A;  2F5C A;  3BTL A;  2QVO A;  4CZC A;  3S3M A;  2FU4 A;  3OYJ A;  2D45 A;  1SMY F;  1JKQ C;  1V5G A;  5L3D A;  2VL8 A;  5IOZ A;  2M5W A;  5FLX Z;  2DT5 A;  2DJI A;  2NVT J;  3GLX A;  2VQG A;  1ZN2 A;  2XAQ A;  1GT0 C;  4L5E A;  2XF5 A;  3OR1 C;  1QNT A;  4DYR A;  4F52 A;  1O3R A;  2XPU A;  2XRN A;  2G9W A;  4LLL A;  3WHB A;  4YII A;  1ODD A;  2DA1 A;  3CJR B;  3E6C C;  4BE1 A;  1R49 A;  3T0Y A;  1VQ7 I;  2A05 A;  2JVG A;  3GTO J;  4PUS A;  2VN2 A;  2Y9Y A;  4XLA A;  4EV0 A;  3FMQ A;  2VB6 A;  2W4S A;  1SFO J;  5FKL A;  4Y7N J;  3IP4 B;  2XF7 A;  2Q2E A;  4F7Z A;  1R9T J;  3ASO H;  4M6Y A;  3BR3 A;  3BZC A;  3R4K A;  2QUF A;  2KZV A;  3BZ6 A;  3TW6 A;  1WPK A;  2GA1 A;  3NWS A;  2P5V A;  3K70 D;  1A6Q A;  3BOQ A;  3ABK H;  3HOW J;  2VOO A;  4F93 B;  4A6E A;  3OWT A;  1D0Y A;  1K4S A;  2GXG A;  2MG4 A;  4BS9 A;  3A02 A;  3I9V 2;  5TJJ A;  4UHT A;  3V7S A;  3Q0U A;  3RYR A;  3WE2 A;  4XM3 A;  3M3Y J;  3DPL C;  2MBF A;  1WGX A;  2WAQ N;  3DKW A;  4A3D J;  4PFP A;  2ZXJ A;  2M30 A;  1R4M B;  4G9Y A;  1S3J A;  2L7F P;  3G71 I;  3AL0 C;  4PSX A;  3A1Y A;  4RS8 A;  1K79 A;  3V42 A;  4DW6 A;  3CMA I;  4GRI A;  3WOD F;  4A3C J;  2EK5 A;  3F0C A;  3N97 A;  3HC7 A;  2VAS A;  2EV6 A;  3H3Z A;  1JJ6 C;  2R0Q C;  1R5H A;  4KDP A;  2ZFU A;  2DA5 A;  2AQF A;  2RQP A;  3SEZ A;  4A3J J;  2DU9 A;  3PSF A;  4DYQ A;  4BEH A;  1ZH5 A;  2FX0 A;  2E7W A;  2ZJQ F;  3DTI A;  4NUB A;  1HKQ A;  2V6C A;  2ZNZ A;  3GTG J;  1RC9 A;  1ZGA A;  5L3C A;  4H0E A;  2VON A;  1RKT A;  2UXX A;  1Z0X A;  2DDB A;  4CCN A;  2A6T A;  4BQA A;  4XR6 A;  4XLN F;  2ZJ2 A;  2KIQ A;  2EB7 A;  2JRM A;  4A12 A;  2EV0 A;  4IHS A;  1B6A A;  1S9H A;  1TT5 B;  1AOY A;  2MA3 A;  5M3F J;  5DD4 A;  3BJA A;  1SVO A;  2H94 A;  3G1O A;  4R8H A;  2NNY A;  3GFJ A;  5HVQ C;  2A5Y B;  2OCC H;  5FJ8 J;  3WTV C;  2LLK A;  3CDI A;  1U5T C;  1UAA A;  1XDS A;  4Y52 J;  4J19 A;  2Z5U A;  3SXY A;  2UZK A;  3K1P A;  3E5U A;  2VUM J;  5JFR A;  3DWL E;  3MD2 A;  1T56 A;  4UUV A;  3HTS B;  2A5W A;  2L4M A;  1V54 H;  3BDD A;  3GTK J;  4C30 A;  4RB1 A;  2F2E A;  1KQ8 A;  1X19 A;  1ERD A;  1MH3 A;  4G94 A;  3Q0W A;  3K69 A;  1X3Z B;  4F3Q A;  2PEX A;  4ZJZ A;  1V5F A;  3B73 A;  2BHY A;  3KP5 A;  3SQN A;  1LFB A;  4Q4Z F;  5ILS A;  2MLG A;  4EQQ A;  1YJN I;  2YUS A;  2WV1 A;  4LG0 B;  2NAZ A;  3K1M A;  1OCR H;  3JW4 A;  5LD2 C;  5IP6 A;  3KET A;  3K1N A;  2HXI A;  4JOM A;  1CGP A;  4A5N A;  4E70 A;  2IGN A;  1EA3 A;  2VT2 A;  1K78 A;  4LK0 F;  5F04 A;  3OYD A;  2KPM A;  3OYH A;  2EIJ H;  3LQR A;  1ONV A;  1QRY A;  2IGK A;  2MC4 A;  4ESB A;  3BR0 A;  1SVM A;  4RGU A;  2JUG A;  2AXL A;  2QEX I;  4WXH A;  5J4Y A;  6PAX A;  5J3L A;  3PSI A;  4H4K C;  4X1E A;  2JN6 A;  3HL2 A;  4TV7 A;  2CU7 A;  1PP8 F;  2HZT A;  3KP2 A;  2LYC A;  1HA8 A;  4IXA A;  4BDZ A;  1R1V A;  4ZYH A;  1R23 A;  3TBI A;  2LY9 A;  3S2D J;  1X4O A;  3TED A;  3WG9 A;  1DP3 A;  1UG0 A;  5FFZ A;  2MD5 A;  3F21 A;  2HQ5 A;  1LEA A;  1BN5 A;  4X0G A;  3FHZ A;  3VFZ A;  1P7J A;  4PJ0 C;  4AUX A;  4WCG A;  3RKY A;  1IGN A;  1XSX A;  2PJR B;  5LEJ A;  2W25 A;  2BHZ A;  1AWC A;  3QU3 A;  5FRM A;  3C2B A;  3KPH A;  5GPA A;  3K0L A;  2FQ3 A;  4GXO A;  3Q5F A;  1RR8 C;  3WU2 C;  3PQK A;  3GCM A;  3CC2 I;  2IA1 A;  2OA4 A;  3LSK A;  2A68 F;  2JJ7 A;  1BR2 A;  4IPA A;  3IL2 A;  4IQJ A;  4HPQ A;  1D1C A;  1JUP A;  3VSL A;  2KP6 A;  5EEH A;  3DEE A;  4NBQ A;  4IZZ A;  2X6X A;  2DQR A;  2QQB A;  2V9P A;  3COA C;  2VPR A;  3HOT A;  1J7K A;  4I0B A;  2DFH A;  2CQK A;  1WJC A;  1MMN A;  3LFU A;  2K9Q A;  2P6T A;  2CQN A;  4BQN A;  2V26 A;  3REO A;  2JA5 J;  3FBI B;  1G3Y A;  2IEK A;  3FXK A;  3TO7 A;  3ZOB A;  4Y17 A;  1MBH A;  4IO9 F;  2E60 A;  2IP2 A;  1KA8 A;  3C3W A;  2HQR A;  2FE3 A;  2X9D A;  2R5Y A;  4II2 A;  3L2C A;  4ZH4 F;  5M3M J;  2ELJ A;  2K4J A;  2X1D A;  4B4C A;  1YJ9 I;  3HEF A;  2ESN A;  1D1B A;  4I2O A;  4AYB A;  2F4I A;  3CJN A;  5A2Q K;  3WTZ A;  1MBJ A;  3RJP A;  3KP7 A;  1HLV A;  2F5E A;  3U2R A;  3CCL I;  3GXO A;  3OYI A;  2HKX A;  2QM3 A;  5DUI A;  4Q47 A;  2E2J J;  2FQ4 A;  3CJQ B;  1JJ8 C;  5TRD A;  2Z16 A;  4IL6 C;  5E1Z B;  3HUG A;  3UR3 C;  5CJ9 A;  3J7A O;  3R61 A;  4LB6 B;  4HNT A;  4DBR A;  3CF2 A;  2KHM A;  1AA7 A;  4U87 A;  3H3V K;  5EG0 A;  1QZZ A;  1Y0U A;  2OJE D;  3BTI A;  5J1R A;  1X58 A;  3S1Q J;  4RM2 A;  3RQ4 A;  1JT0 A;  2K9M A;  5CVJ A;  3OS2 A;  1MBE A;  2XC7 A;  1O7L A;  1F43 A;  5CVR A;  1VZ0 A;  4BGD A;  2FBI A;  2FMY A;  2FRH A;  3M9A A;  4I6Z A;  4MEX F;  4E6K G;  1ZRD A;  1TQM A;  5KVR A;  3FZV A;  4I01 A;  2LSO A;  1WJF A;  3PNT A;  4FET A;  1IW7 F;  1R5G A;  3HRM A;  3N4M A;  1MMG A;  2OPT A;  4MQV A;  3RTR A;  1ZG1 A;  2ZME C;  3ZMU A;  3B6C A;  1Y56 A;  3LSG A;  3GFM A;  4B48 A;  4BBR J;  4IEJ A;  5ICE A;  2WWY A;  4M9S A;  3E6B A;  4I98 B;  2KJB A;  3E3V A;  1XMA A;  3G73 A;  1V55 H;  3TO6 A;  2HGC A;  4XRS G;  3OYK A;  1VQO I;  4DNC A;  2KIM A;  3LA2 A;  4CCM A;  3RPU D;  2N8G A;  1J75 A;  2JTV A;  3H9G A;  4CSW A;  1MMA A;  3FMR A;  4RMN A;  2B0L A;  4C2M J;  5HDN A;  3RYP A;  1JUS A;  4HQE A;  2LKP A;  2PG4 A;  2YX7 A;  2CH0 A;  1MNE A;  2MD0 A;  1YLF A;  2GOM A;  4OAY A;  3ZQC A;  3DBL B;  2WY8 Q;  2M4K A;  3CZ6 A;  4HSR A;  2VJ4 A;  2GXA A;  2BVM A;  3E6D A;  3S93 A;  2F4O B;  4UNO A;  4CCK A;  4HNU A;  2QA4 I;  4HRI A;  4NQW A;  3ONQ A;  3VYS B;  4XSX F;  1LFP A;  2L9R A;  2XB5 A;  3VDX A;  2RQQ A;  3I58 A;  4KJZ A;  3VYU B;  3MFK A;  1IG7 A;  3L2V A;  3F8C A;  1Y1V J;  4IHT A;  1K7A A;  3KX2 A;  5TGT A;  4FE7 A;  2KZG A;  2EZI A;  2H27 A;  3OV8 A;  3FF5 A;  5EZH A;  3HRS A;  4D9J A;  4EM0 B;  4XIC A;  4IRI A;  2O8X A;  2OBP A;  1WJE A;  3L2R A;  3RPU A;  1XGN A;  4E7L A;  2RC4 A;  3KYL A;  2HFH A;  1YRN A;  2OQR A;  3AG4 H;  3P7N A;  4QTR A;  1UEL B;  5HS7 A;  4XKV A;  4BHP A;  1L0O C;  2XVC A;  4IRH A;  3CLO A;  2VBW A;  4PGG A;  1IXR C;  1MMD A;  1TNS A;  2XPV A;  3EET A;  1PVE A;  1MBF A;  4AIJ A;  4BAC A;  1YX3 A;  5M5Y J;  4XKB A;  2ZXW H;  5E17 F;  2EZK A;  2Q0O A;  2RN7 A;  3FXJ A;  5E1X A;  4CYD A;  4CIC A;  4L0Y B;  2XIG A;  2QLZ A;  3HOV J;  4GCV A;  1ETK A;  1MMS A;  5D6F A;  1HKT A;  2LRD A;  2XAH A;  1RUN A;  4XKC A;  3FMS A;  3KZZ A;  3TP3 A;  3CCU I;  1RRJ A;  2IA2 A;  2V6E A;  1QZY A;  2OC6 A;  3DPT A;  3SZG A;  4OMZ A;  4OU0 A;  1OYY A;  3ZCO A;  4F55 A;  5ICG A;  1Z91 A;  2Y0M A;  3A03 A;  4KFC A;  2TCT A;  4AU7 A;  1P4X A;  1WSU A;  1DP7 P;  1F36 A;  5B66 C;  4L18 B;  1QHG A;  2ZME A;  2VKV A;  2OAZ A;  1MGT A;  2VXZ A;  3BPX A;  2C6Y A;  1MW7 A;  2QBY A;  3Q9S A;  4HLX A;  1NHA A;  2EZL A;  3S8P A;  2K85 A;  4P1W A;  2CUE A;  3F9K A;  2R7X A;  5LRR A;  4D0P A;  2Q2E B;  2ACJ A;  1Z67 A;  2HPI A;  5J8C A;  3I71 A;  2LKX A;  3IV5 A;  2EWN A;  3K2A A;  2Y31 A;  4AVZ A;  3LNQ A;  2E1N A;  5EDN A;  2STT A;  5BOX A;  2QF7 A;  2R3S A;  2JQ7 A;  3JTH A;  5H20 A;  2DYS H;  3ZQH A;  1TWA J;  3PNY A;  2ICW G;  3SEQ A;  4XLP F;  1J59 A;  4RLF A;  1RET A;  1ZRC A;  2LR8 A;  1H0M A;  1SAN A;  2ZB9 A;  4KN7 X;  2DA6 A;  1UZC A;  2HDW A;  3LWF A;  1IUF A;  4AM3 A;  2R7W A;  3H3U A;  1IDY A;  5IYB J;  4C3J J;  4F91 B;  5DUK A;  3OS0 A;  1DDN A;  1DGW Y;  2K02 A;  5L3F A;  2KFD A;  5E3N A;  2ZC2 A;  1WZ2 A;  5JHU A;  3PO2 J;  3E97 A;  4JK1 X;  1XMX A;  2VKE A;  3ZPL A;  5DCM A;  3IUO A;  4A69 C;  3J81 Z;  2H09 A;  4BEH B;  3E1S A;  3KLN A;  2DI3 A;  2P7C B;  2DA7 A;  1HW5 A;  3SZP A;  1MH4 A;  5AIP A;  2E1M C;  2PJP A;  4RB0 A;  1BOA A;  5FLX K;  4II3 A;  1CF7 A;  9ANT A;  2X48 A;  4M74 A;  3V8K A;  5EF6 A;  1SFK A;  2JUC A;  4YIR X;  1XGM A;  1ACI A;  3F6V A;  2GQQ A;  1X2M A;  4WX9 A;  1TWF J;  3W6K B;  1GDT A;  3GUD A;  2ESH A;  5CQE A;  3PUB A;  5D5V B;  1U78 A;  1T6S A;  2AXT C;  4YFX F;  2H8W A;  2HOE A;  2Y0S A;  4FQG A;  3TOB A;  2BEO A;  1BW5 A;  4O3M A;  1MKM A;  3DEW A;  2D1H A;  1XTA A;  4Y33 A;  3FXU A;  1O7F A;  2FOW A;  5DS9 A;  1EH6 A;  5DM6 F;  1GHC A;  1YIJ I;  4J01 A;  4YFK F;  2OD5 A;  1SD7 A;  2LC2 A;  2A6H F;  3V8J A;  1VQM I;  1D5Y A;  4OMY A;  1V5E A;  2L0K A;  5GAG J;  2R7T A;  3KE2 A;  2VPL A;  2GIZ A;  2MGQ A;  2X85 A;  5E3M A;  2A6E F;  5IT3 A;  4FCY A;  1I5Z A;  3OIQ A;  2VBY A;  2HXO A;  3LSH A;  5CVV A;  4IHY A;  3H5A A;  3O2P E;  2FOK A;  2STW A;  1PP7 U;  2GA2 A;  3BCA A;  5EZG A;  1HC8 A;  2E71 A;  4PCQ A;  1C0W A;  2JVH A;  2MC3 A; 
#chains in the Genus database with same CATH homology
 1X3W B;  4YIR X;  1PVE A;  2QSH X;  1QZE A;  1OQY A;  2F4M B;  2QSF X;  3ESW B;  1TP4 A;  2QSG X;  1X3Z B;  2F4O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...