2F4OB

The mouse pngase-hr23 complex reveals a complete remodulation of the protein-protein interface compared to its yeast orthologs
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
GHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords peptide N-glycanase
publication title Structure of the mouse peptide N-glycanase-HR23 complex suggests co-evolution of the endoplasmic reticulum-associated degradation and DNA repair pathways.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2f4oB00
3ESWB 1TP4A 1X3WB 2F4MB 2QSHX 1X3ZB 2F4OB 1PVEA 1OQYA 2QSFX 4YIRX 2QSGX 1QZEA
chains in the Genus database with same CATH superfamily
2FNPA 4HOBA 4CSWA 2PMHA 3IWZA 3KIOA 2EWNA 1REPC 1P4AA 2BVLA 4XNFA 3S14J 1IN8A 1I5ZA 1S29A 2B0LA 3BROA 1I1GA 2FE3A 4J01A 3KP6A 2OU2A 3OYFA 2AXTC 3BQYA 3CCLI 1ZN2A 2KP6A 4ABZA 3RIRA 1J0RA 4A3MJ 1LKXA 2DJIA 4BL0B 3T1BA 2LOOA 4XMYA 2STTA 1B59A 1R22A 3RYPA 3PFIA 3N97A 4XONA 4FQGA 3BZKA 3NWSA 2Q2EB 4I0BA 4RAGA 2FOWA 1OQYA 1IV6A 1VQ7I 3HOYJ 1HW2A 1W5CC 2HVQA 2VBZA 1O3TA 1S7OA 1SAUA 4NHJA 2VT2A 2HZTA 2L4MA 2OF7A 1D8JA 3DCFA 2EILH 1LDKB 2VKHA 3PNTA 1VQ5I 3NARA 3J7AY 5FLVA 4N0BA 2NYXA 5B3SH 3AG1H 2JA8J 2UV1A 1D0XA 2FMYA 4BQQA 2RC4A 4KDPA 1BI1A 2ETHA 2W7NA 4A6EA 1BM9A 3H5AA 4DNCA 5BNGA 5C4JJ 2OZUA 2X85A 1QPIA 1K78A 5L3BA 1MIJA 5ILSA 1SFOJ 3HDDA 3VFZA 2YUSA 3RTRA 3B73A 4KISA 3C7JA 4ENMA 4HQMA 3I5UA 4DZJA 4MHGA 5LHGA 3CD6I 1JGSA 5JHUA 5ICFA 1IV8A 3EUKL 5J1RA 2FF4A 3L9FA 2IA2A 3E5UA 3WU1B 2MH9A 2NOJB 2VBWA 3J7ZI 1DDNA 2M87A 2XROA 2TDXA 2NVUB 2IPQX 3S3MA 3CDIA 3HRSA 5K5OA 1MH3A 5FB2A 4RLFA 2RVCA 3F9KA 3VSLA 1TWHJ 1JUPA 4H0EA 2JVGA 3CUQC 2M7AA 1LPQA 1WPKA 4BHCA 5B5EC 3WTTC 4RDUA 5M5XJ 4HX8A 4YFXF 2WB1N 2K27A 5DS9A 4D9JA 5D5UB 3AG2H 4RB0A 3ABUA 4I0AA 3U2RA 1PVEA 2DPDA 1SD5A 5IYBJ 3WE3A 3CO7C 2XC7A 3H92A 1E0EA 4EEFG 2W24A 3VDXA 1MNEA 5GTIC 1YTYA 2VQHA 1F5TA 4G6TB 1RESA 2RGVA 5HDKA 3J81K 3PO3J 2K3FA 1WGXA 1YRNA 2CYYA 4FASD 4HDUA 2UUZA 1BJAA 1G3TA 3OWTA 2P6TA 4PK4A 1EA3A 3EDPA 3M7GA 5BPDA 4G7ZF 1RUNA 4PSWA 3RZDJ 4R1HA 5J4YA 3PNYA 4BJ6C 3FKIJ 1WJDA 5IP7J 4AD9A 1K61A 1YFHA 2EK5A 4FE4A 2Z99A 2NOGA 3BT9A 3BZCA 3RCOA 2HDWA 3L2UA 1WJEA 3GTPJ 1MMSA 1A31A 2Q8KA 1F1ZA 4HEA2 1R23A 4XRSA 1TBXA 4OIPF 3V4GA 1BW6A 2L7KA 4BXFA 1LVAA 4ZH4F 1B8IB 1IRGA 4LG0A 1FYLA 1O3RA 2FNAA 2Y2ZA 3HHHA 4CCOA 1ETXA 1VQKI 2K5CA 1WJCA 4FT8A 5LEJA 5HNFA 3VWBA 2GM4A 1XDUA 3BR2A 3F23A 1CF7A 4Q48A 2B7EA 4IXAA 3RKYA 1E2XA 4B3XA 3BG6A 4IKFA 5BMZA 2XSJC 2EZLA 4PJ0C 2XAFA 3BR1A 1BOBA 1RZ4A 2F5CA 3HOWJ 2M8EA 3EUHC 3MMYB 1RKWA 5FFXA 1T33A 3IRRA 3H35A 2QBYA 3GTLJ 1IUYA 3LA2A 4B47A 1T38A 1MSEC 5D8LB 1NH3A 1JT0A 2EIMH 2P4WA 2LY2A 2ZNYA 2E1CA 2DYSH 3MEXA 1A6QA 2BGCA 2HNHA 4CDGA 2L01A 1T2KA 1JTXA 3TW6A 1N77A 2DA7A 3H0GJ 3I59A 4MIMA 2R7TA 3FHZA 3I56I 4F92B 3CCYA 4BEHA 4I6ZA 2EFOA 1C0WA 3K7AJ 5FLXK 1TWFJ 3IP4B 2IS1A 2YPRA 4Q5SF 3ZOBA 2P81A 5HLHA 1J59A 2KQRA 4M9ZA 2LH9A 5JR3A 5FRMA 1ETKA 2L2OA 4KJZA 2RNGA 3SQNA 3OOUA 3ZQQA 4MTDA 1LQ1A 3CMYA 1YS6A 2IW5A 3H5NA 2M9HA 1UCRA 2JRMA 3BCBA 4PCQA 4NC8A 5DD4A 2KJBA 2EPFA 1UB9A 4E7JA 3TO9A 1XD7A 1WZ2A 3GLXA 5F0CA 3TL4X 4A12A 2YSRA 1GV5A 4OMZA 5ICCA 4F52A 1RRJA 1P9QC 1Y8RB 2XAHA 2NXNB 1QZZA 4D1QA 1V55H 5HODA 3HC7A 4MFEA 4OWRB 3VYUB 2HEOA 4RAZA 4F7ZA 1X1AA 2BBYA 5L3CA 1FSEA 2HQNA 2E1MC 1JTYA 1BI3A 5CVIA 2NS7A 2E36A 4I01A 2FX0A 3F8MA 1GUUA 1YG2A 2R7OA 3ZMSA 2MSYA 1PP7U 1ERDA 1O7LA 2ZMEA 4A69C 1BW5A 2VL8A 3DV8A 2JMWA 2IA1A 1RKTA 1Z3XA 4RGSA 1R36A 3DU6A 2LG4A 1APLC 2BW3A 2Q0OA 3PUFA 1I6HJ 2NS0A 3MN2A 2W84A 5FKOA 5DTDA 3A2KA 2PMUA 3BR0A 2ZJPF 1BOAA 2CV1A 2EA4A 1SMYF 3I9V2 4C3JJ 1VQMI 1LB2A 3CJNA 1MMNA 2DOFA 3CQZJ 2VIXA 1TC3C 2P8TA 2ELJA 1TNTA 3OYGA 2BZTA 2E5NA 1ZREA 1BL0A 1W7PA 1KZHA 2Z2SB 1MMDA 2DODA 4C2MJ 1R5GA 1F43A 1WVRA 1EH6A 3GX4X 5BPIA 4WX9A 2VPLA 4HAMA 4I98B 2GIZA 2J5PA 1JKQC 3GFMA 4HV5A 3QU6A 2FQ3A 1SAXA 2A05A 5LGNA 2UXNA 1XPXA 1ODDA 1DPUA 1E3HA 2DOAA 3HB9A 4L5EA 3CC2I 2DA5A 1D0YA 3M1CA 5K7FA 1WSUA 4ENNA 3NWTA 4NQWA 2Y0MA 3EUAA 4CZZA 4XLCA 4BUPA 2KDOA 5ICGA 2L5QA 5DCFA 4U7DA 2O3FA 4EM2A 3Q9VA 2ZB9A 1MNMC 3ZXSA 1HC8A 4JK1X 5M5WJ 2HKOA 2OPTA 4L0YB 5F1RA 2RREA 3KYCB 2HU9A 2Z3YA 3ESWB 4DBQA 3CC4I 2VOPA 6PAXA 2Y48A 4RAFA 3I58A 4PSXA 3LSGA 2JUGA 4HF0A 1T6SA 2D1HA 4IHTA 4UXNA 3DPTA 2DYRH 3CMMA 4BNCA 2JVHA 4B44A 1VFCA 4N4OB 1FOYA 3HG9A 2CV0A 2LC2A 5K5RA 3L2WA 1HCRA 4XLFA 5TRDA 2WBMA 4EJOA 1UG0A 1ZGWA 4IF4A 2PFBA 4UUTA 1QZEA 2PX9A 2E2IJ 3NEUA 2X6XA 4GYIA 1JKRC 2VKDA 3MKZA 4ZTJA 4Y17A 1QA6A 1ETYA 2L9VA 3JRBA 1YIOA 2KLOA 3JTHA 3COAC 1LE8B 1JHFA 2Y9YA 1BR2A 3QYFA 3FK7A 4YIFA 1E3PA 4DZPA 1FLIA 5JLXA 3K2ZA 1BN5A 2WC2A 2NS8A 1MGTA 3BTLA 3DLLF 2QWWA 2VKEA 1NG7A 3E5XA 2V7FA 3KYLA 1F4KA 4I09A 2XF7A 3LSTA 1DGRM 4JQFA 5J47A 1OCTC 2ELKA 2LK2A 5IP9J 1P6RA 5F64A 2WY8Q 2X48A 1YIJI 4J00A 3SEQA 2WAQA 2XPUA 5DD8A 4QTRA 5D5XB 4OIOF 2FBIA 2OTJI 1UHMA 1G6NA 3MKYB 1QHHD 2VT3A 1GVDA 3M8FA 1LNWA 2VPRA 4MEYF 2VJIA 2EB7A 4BXXJ 2MD0A 4LLNA 3NAUA 3CCUI 1YHQI 3BTIA 1IW7F 4QWQA 1ZR2A 3JRGA 1S3JA 3HL2A 2DMNA 4II2A 2L9RA 1QBJA 4FE7A 1XB4A 1ZARA 2L7FP 3Q9SA 4YIIA 2LYCA 2LF8A 4A3IJ 2KJCA 3CF5F 1CQTA 5HNHA 3EPZA 1B1BA 3K4JA 4ZC3A 5GAEJ 3RZOJ 2O61A 1FIAA 4BE2A 1D1AA 3MZHA 4ZYAA 3BY6A 3ECOA 3O8HA 1TT5B 2DA6A 5JI6A 3SEZA 3WGIA 2JUCA 2X9DA 2EV6A 2VOOA 3K1PA 1FBQA 4IOCF 3CUQA 5IPAA 4BBRJ 3C3WA 1PUEE 3REOA 3SZTA 4KN7X 2W57A 3ZPLA 4IQ4A 1V3FA 3IH2A 4CCNA 2QLZA 3SJMA 4LB5A 1L0OC 2PJRB 3V8JA 1PDNC 2JT1A 1A6IA 2IBDA 1RI7A 3PFYA 1VZ0A 5JHFA 1YLFA 1IF1A 2VXDA 3U21A 4CUGA 1WRJA 3VB2A 4BY7J 2QEXI 2LP0A 2E35A 1X2NA 2W25A 3LSMA 4H4KC 3ZRGA 1O3SA 3BJAA 1N25A 3CCQI 3FDYA 2P6SA 3O3KA 3JREA 1MW7A 2DDAA 5FRNA 2ZXIA 3SDBA 5JFRA 5DUKA 2ID6A 4OINF 5HDGA 2Y30A 4XLHA 2XGXA 5DCMA 3D0SA 3CC7I 2KT0A 3HOUJ 2GOMA 3FM3A 1TL8A 4A3GJ 2Z1DA 3DBHB 1XMKA 1EF4A 2CQ7A 3LFUA 5BS6A 2E7WA 3RKWA 1IN5A 4N9HA 4YELA 4BXUA 1TQMA 3K1MA 3QYEA 3RPUA 2MLKA 1AKHA 4ZZLA 2GQQA 2XV4S 3K4BA 2V9VA 3VSKA 1ONVA 1MBGA 1Y0UA 2ZMEC 3DWLE 2XSDC 4C3HJ 4MQVA 4ESFA 2OC6A 2DBBA 3QPSA 1U5TC 4A6DA 2EFWA 3E6MA 3HXLA 3K9TA 3TP0A 1P7JA 1IAWA 1TW2A 1DQUA 1T98A 2P5KA 2RQPA 4JBAA 4S0HB 3A01B 2X1DA 1DP7P 2AS5F 3KPHA 2GZWA 2GXGA 3F21A 1WWXA 4RS8A 4OAZA 3EYYA 3FHNA 3BTCA 2JSCA 3SXYA 2AQFA 4O3MA 3EUHA 4I02A 2ID3A 3KCCA 1GVJA 4XLNF 5LEKA 1HDDC 1JI8A 1V5GA 2IGKA 3GCMA 3G71I 4G7HF 2DFIA 4QPOA 3IV5A 2M4KA 2E2HJ 1LEAA 3HGYA 4GYGA 4CYCA 4D5CA 1LFPA 3ONQA 1DUXC 4Y7NJ 1YITI 1KU9A 2CW0F 5EG0A 5D6FA 2FBHA 1YQAA 3H3UA 2K4BA 3K4LA 3F22A 1ZG1A 1LEBA 2Z5UA 4XSZF 5GP9A 4EVIA 1JUMA 4CXFA 2EZKA 4D7NA 2IS2A 1XTAA 2QA4I 2BXYA 4XK4A 1RC9A 1QVUA 2F6CA 3F6VA 3K4CA 1VQ8I 4ASNA 3DKXA 2IP2A 4UB8C 1FSHA 3GEZA 4AIDA 1E17A 3NRVA 3IWFA 2F4OB 1XS9A 2R3SA 1H9GA 1TZLA 1B72B 3H3VK 4XLPF 2KDZA 1G2HA 5FKLA 3U1KA 2M1BA 1SVOA 4IHYA 5AIQA 4XN3A 4BJ5C 4V19K 4GFBA 4MQ9F 3FISA 5TISC 3B02A 4E7KA 4LLLA 3RPUD 2Q1ZB 5M3FJ 3MD2A 4JX6A 1U9OA 5E3NA 3GTJJ 3ZQFA 1JXSA 5GPCA 3HKZN 3D1NI 1FTTA 2M2EA 5KVRA 3PL8A 4ZDLA 2OQGA 4NC7A 2ECBA 2AO9A 3HPGA 5K1YA 2DCEA 1IDZA 1G3SA 1I50J 3OL3A 5B1AH 5F6FA 4S05A 3VODA 3S1MJ 3DXJF 1T39A 1KQ8A 3HOVJ 2A6HF 2DQRA 3WTWC 4LFUA 3LFKA 3IUOA 4M3BA 3F0CA 2HVSA 4AU7A 5M5YJ 1R71A 4FX0A 2PN6A 3TQNA 3TGNA 1JUSA 2EFPA 1H88C 2COMA 2YX4A 3E97A 3LQQA 2HWVA 2VUMJ 1RUOA 3ELKA 1XGNA 3RJPA 1D5YA 1ZLKA 1PJRA 4RLQA 1KU2A 2HQAA 1G59A 5J40A 3KLOA 1KU3A 3SDGA 2I10A 3BLYA 3DP7A 2WTEA 3UNGC 2BEOA 4M3GA 4M72A 5L3DA 1MH4A 3VYRB 1ETOA 3FKJA 4LGWA 2HPIA 2HXOA 1XGMA 3AAFA 3LA3A 2W82A 3JTGA 1R1UA 4IRHA 2A69F 3S15J 3BCAA 2L02A 2O8KA 2OBPA 2JSPA 4FETA 3V42A 2UWMA 1WQ2A 1ZGJA 2E5ZA 2VJ4A 4OMYA 1A36A 3IRQA 1E3OC 4L5IA 2A6EF 2MFZA 2Y9ZA 4QPQA 2IS6A 3HBLA 3GTQJ 4M3FA 3CCSI 2WAFA 1VI0A 4PFOA 3CTAA 3CP2A 1SFUA 2P5LC 4PJLA 3RSNA 2JWTA 1OCOH 3GTMJ 4XRSG 4JOMA 3T5XA 5J1UA 3HUGB 2VQLA 3FK6A 3HGGA 2XKOA 3E6BA 4LJZF 2V79A 5FROA 2CG4A 1WHUA 1L3LA 1XSVA 3T0YA 3Q5FA 1WCMJ 2RNJA 1BIAA 5LHHA 1NHAA 2ZXJA 1BC8C 3ZMDA 1X4PA 2ZSHB 1QRYA 4ESJA 2LVSA 4UHTA 4EJWA 4CGZA 5LBQA 4OIQF 5IT9K 3BG7A 2ZCWA 1ACIA 3TO6A 5CLSA 3CDHA 5F27A 3BTJA 5E8IA 2ZXWH 4PDKA 3CESA 3DEEA 2A68F 2O0YA 4RB3C 4EJTA 3C1DA 3ECHA 3FIWA 4DYRA 3PSFA 5A2QZ 2RDPA 5LLQA 1KGSA 4CH7A 4KIFA 5FKMA 2EV5A 2HQRA 1IN7A 4BE0A 5FKNA 1FJLA 3E3VA 2VE8A 1IXCA 2RQQA 1S6LA 4YFNF 4G9YA 4UV8A 3D5LA 2HYFA 1OYIA 2M0MA 3Q0UA 3LSIA 4Y4RA 3OR1C 4PGGA 2A6TA 3FXLA 5BOXA 3ZQGA 2DFHA 2XF5A 4AYBN 5EGOB 2VJJA 3R4KA 1FTZA 5L3EA 2OAZA 5D5VB 3HIFA 1NK3P 4P1WA 5HLGA 2DXIA 4UV9A 3WHCA 5GAHJ 5K7HA 2NVQJ 4JYKA 1QZYA 3UR3C 1PUFB 3G1LA 3S1NJ 4Z6YA 1U9NA 4IEJA 1VQPI 5C3EJ 4EQQA 3QQAA 3E1SA 1SFEA 3KZZA 4E4HA 1HLVA 1AOYA 1Z1DA 2HOTA 3BPVA 3MQ0A 4IO9F 3MCZA 3MFKA 4LIUA 3O8GA 3G3ZA 4V2GA 1IGNA 1U3EM 3ABTA 3LSRA 1RR7A 2E7XA 2PMZA 1S9HA 5CVJA 5CVUA 2WWYA 5DM7F 4LLGF 1ZRFA 3E0JB 5D5WB 1WJBA 4CO8A 1I1SA 2OCEA 2Y0SA 1USTA 1TNSA 2FJ1A 2HOAA 3G1MA 2K85A 2AXLA 2QQ8A 4GXOA 2QCOA 3S32A 4KUMA 2VJ5A 1RPWA 2P7VB 3PM1A 1IG7A 3OYKA 3ZMZA 5JVGF 2V4JC 1R49A 2LLKA 4FX4A 3LA7A 4CZCA 1VF9A 2PJRA 4BHPA 3JRCA 4HQEA 2D45A 3IL2A 1R4NB 2ZNZA 4GO1A 1MDMA 1Z67A 4A3LJ 2MH2A 1J75A 2E60A 4JP0A 2CSOA 4HLYA 1Z7LA 1HKQA 1ZHFA 1K6YA 2YX7A 2EINH 4HPQA 2EIKH 2F5FA 1YX3A 4P9UA 3V7RA 2Z33A 3Q3SA 1BA5A 2X4HA 2R5ZB 4L0ZB 1R1TA 3WG9A 1X19A 5J8FA 3DPUA 4A3BJ 2HOEA 2KIUA 2H27A 1W0TA 3OIQA 1TQIA 2MBFA 3FXOA 3FF5A 1F9NA 2ECCA 3L1PA 2HZDA 4A2UA 4WXCA 3GUDA 1ZG5A 5ED4A 2R7UA 1X2MA 3D5RC 4QIWN 4YEJA 4E7LA 3U9GA 3E6CC 3F8BA 1A5JA 3B6CA 2KIFA 4A3KJ 1H89C 4X6AJ 2OUMA 4ON0A 1A04A 1P7IA 2A5YB 3ZQ7A 2R7ZJ 2K7LA 1V5EA 4RA2A 3MWMA 3IKVA 4XQFA 2XASA 2ZO4A 3ZMVA 2E1NA 3ULQB 4DYQA 1U78A 1MJ9A 2M34A 2CUJA 2I5UA 2W00A 4AWXB 3CCVI 1R5ID 1QU3A 1YOVB 3L2RA 4BBSJ 2F2EA 2MLGA 4KT5C 3WTZA 4Y52J 2KFDA 2IGNA 1ORKA 3KP7A 5L3GA 3N4MA 1TWGJ 4A3CJ 1FYKA 3C18A 4M71A 5LHIA 4XLEA 4C3IJ 2ZFWA 2XAUA 1IJWC 3ZN1A 5CJ9A 3LSJA 4MGRA 3J81Z 1WH5A 5JVTA 3QP6A 1HQCA 1R6RA 2MA3A 1LDJA 2XGDA 3VPRA 4PZJA 2KRFA 1SD7A 5KK1A 5IYDJ 2LBFB 3K2AA 1ITYA 1AWCA 2M3AA 3A4CA 3FZVA 3BR3A 1U5TA 1Z9CA 3K4NA 3K69A 1VQ6I 1EKEA 3TO7A 3KEYA 3WTUC 2P0WA 2G7HA 1JE8A 4HNTA 2E34A 2X1CA 1JKOC 5E79C 2NVXJ 3LMMA 3HRMA 3JRDA 1J7KA 2VBYA 4KNYA 2PQ8A 4M3EA 2VN2A 4NDLA 4EM1A 4G7OF 3OYMA 1BI2A 3BOQA 3DTEA 4OU0A 2E19A 3IH4A 3DEUA 2KRHA 3L00A 2R5YB 3UKGA 4LK1F 2GA1A 1HOMA 3GZ5A 3I53A 5KAIC 1YO5C 3FXUA 3C2HA 1XGSA 2L54A 3L7WA 2LKSA 5ILVA 4B3AA 3A03A 3CLQA 4B48A 1Z77A 2PBIA 1UMQA 2ESHA 3FXJA 4NBQA 5HLIA 5HLTA 1UG2A 3LAPA 4UUSB 4EM0B 2RAEA 1HW5A 1YJWI 2E1MB 3KYDB 1RIOH 2HS5A 2BV6A 1ZTRA 1N78A 3OV8A 2K9NA 3DPLC 3GTKJ 4XR6A 2XPWA 4HSTA 1UZCA 5FJ8J 2R7SA 3G1OA 1OMIA 4EGZA 2QSFX 2HVRA 1FP1D 2MC4A 1T8IA 3GFLA 2NVYJ 2BY0A 5JLWA 1UJ8A 5J1YA 5EEGA 4G6QA 5IOYA 2D5VA 1VQ9I 4LMYA 3J7YJ 1K83J 5J3LA 5AIPA 5E18F 2L7MP 5FLXZ 3GTGJ 1ZGAA 2Q2EA 3C2BA 3WTVC 2XKPA 2FA5A 3HEFA 2HYJA 4KIGA 5LGUA 1CGPA 2F48A 4PJMA 2CGPA 4WXDA 3H9JA 2N8GA 3GYHX 3W2AA 1EV7A 2OD5A 3J80K 2V9KA 4MO7A 5CVRA 4BGDA 3CMAI 2DT5A 3PUBA 1K78B 4UY8I 4DIQA 1MBEA 4RBOA 2QUFA 5DV5A 3BJ6A 5LFAA 2IT0A 3SYTA 2IGMA 3OYCA 5E3LA 3ZQIA 2CU7A 3L2CA 3F6OA 1ENHA 3V8KA 1OKRA 4BJTA 2STWA 3QP5A 4ENKA 4IOAF 2DK8A 1W7PD 4ZDOA 2DAOA 2G7UA 4LOCA 2OA4A 3IC7A 4KT6A 1FEXA 1MJAA 2ME6A 2ACJA 2FEZA 5EZHA 2JPCA 3I71A 1MZBA 5HS8A 1D1CA 3HRUA 2OTLI 3HSFA 4WXHA 4IRIA 3K4MA 5HOOA 1R58A 1X4OA 2LF7A 3ZP5A 2DU9A 1SFKA 5FGMA 4A0YA 1X3ZB 3S8PA 4A5NA 2QSGX 1WH7A 4LIVA 4RM3A 2CUEA 4PJNA 3OSFA 1OCCH 5B1BH 1XMAA 2DN0A 3AKZA 1HSTA 2HDCA 2K3PA 3EQLF 4PUSA 4GDFA 2JRTA 4EGYA 3OYAA 3H3ZA 2WB1A 2W1OA 3S2WA 5IP6A 4L9NA 2XRLA 3OSGA 4A3JJ 1YRNB 3DTKA 5F0HA 1Z21A 2Y75A 2RN7A 4IZZA 2X0LA 3Q0WA 2EZIA 2W48A 1U8BA 3FX3A 3R61A 2KZGA 4KMUX 3CF2A 5H20A 5E3OA 3QAHA 1Q1VA 2HGCA 2WV1A 3PIOF 1IC8A 5D6EA 4HX7A 2YR2A 1J2XA 3M1EA 2AQEA 2CH0A 4I99C 4ZYEA 3KEOA 1W4MA 3M8EA 3HSRA 2H8RA 1D1BA 5EGOA 1TT0A 4M3DA 5AONA 3JRAA 1OYWA 1ETQA 1SVMA 4L5JA 3O6BB 2LY1A 4LD5A 3G6EI 4LG0B 3FXKA 4HV6A 1UHSA 2BHZA 2YU3A 2JTVA 4B1RA 4ZZDA 5GTHC 1OYYA 4U0YA 4HZFA 4FISA 3TP3A 4KA4A 2DA4A 4CICA 3F72A 3ERED 4KYWA 4G12A 5FLMJ 2DMUA 5KHDA 3ZR8X 2XB5A 3GTOJ 1CF7B 4HYEA 3IAM2 1IRZA 1Z6RA 1B8IA 1Z6TA 3CP8A 5E17F 3QRFF 5GPAA 5FKKA 2HTSA 4ZYGA 5K5QA 2XAJA 5F0FA 2H09A 1G3YA 2HXIA 4RM2A 5ICEA 4A3FJ 3OYHA 1EH7A 3ZMTA 4ETSA 3OYJA 4C2TA 3JAMK 5HS9A 3KETA 1VTNC 1GXQA 3BQZA 3AL0C 3GW2A 3LL7A 1HF0A 3OYLA 1HBXG 2DMPA 3DKWA 4HRIA 2KISA 2V6CA 2O9LA 3WU0A 2BHYA 2DFFA 2DOEA 2CQKA 3ZGKA 1ZELA 2DT6A 5J8CA 2COBA 1XC5A 2VASA 2ZXHA 4BY1J 3M07A 4X0GA 2E2JJ 3I59B 4HA8A 3A02A 5LRRA 1F36A 2DQLA 4BEHB 4E7ZA 1VQOI 1SD4A 2O8XA 4KMFA 4I7HA 1ZRCA 1LDDA 1UELB 2I8DA 2L7ZA 4U0WA 4XKWA 5HS7A 2LKPA 4C9YA 5B66C 2EBIA 2NNYA 4X1EA 2VXZA 3KX2A 2H1KA 3JSPA 3MVPA 3OYIA 2V1XA 1R00A 3KEQA 1K4TA 1Q1HA 3FWEA 2KIMA 3PQJA 1FMVA 2L0KA 3AFHA 4P5OA 1AU7A 3QODA 4WWCA 1T08B 1TW3A 2JN6A 4W1UA 1STZA 5EEHA 2DA2A 1ZG3A 3HTUA 2R4GA 1YW8A 1BI0A 2LY9A 9ANTA 1XSDA 5HVQC 1G8XA 3S93A 1Y1VJ 2WADA 3BC8A 4LITA 4XKVA 3IH3A 5J4VA 3WTYC 2QM3A 4AVZA 1IXSB 3K4KA 4HNUA 1O57A 1SANA 4DW6A 1ZH5A 2LFBA 3CMEI 3W3CA 3LOCA 2LKXA 1YJNI 2PLYA 4A0ZA 3BG9A 3F8NA 2XDVA 3H0DA 3ABMH 2K86A 1IN4A 2R7WA 4HF2A 1ON2A 5F1JA 2K4JA 3GVAA 1B6AA 3W6JB 4E70A 2QKLB 2XUBA 3PO2J 4FHTA 3H36A 2CW8A 1X1CA 4XKCA 4CYDA 1OCZH 1SC7A 2HI3A 3KZYA 2QGUA 2BW3B 2V26A 4W97A 1MBHA 2R7FA 1FY7A 2OCCH 3GF2A 3RKXA 4IHWA 1Z7UA 5TJJA 1PP8F 1D3YA 1ZKGA 5FO5A 3ABKH 1FBUA 4E6KG 5CKTA 3HM5A 1LUJB 3E5QA 4I2OA 3KP3A 1YX5A 3FMSA 3JR9A 5H6QA 2R7VA 3ZMUA 2W4SA 4N4NB 3HPHA 2CS3A 1JKPC 3RYRA 1WJ5A 4HG2A 5CPRB 3BZ6A 3E7LA 4DBRA 4EV0A 4D0PA 1HA8A 3PNVA 2RV8A 1KYWA 2GIVA 3ABLH 4NUBA 1DU0A 2WAEA 3L09A 4ZYHA 1XN7A 2IAIA 3LQRA 3ZN0A 5GAGJ 4XKBA 2HFHA 2A3SA 2W85A 2ELHA 1Z91A 2H6CA 3QOPA 4XRFA 4AIHA 4DGWB 3PIPF 3J7AO 1W36C 3F8FA 4BACA 5C44J 2GA2A 1YS7A 3JAMZ 1GXPA 2X1EA 3FBNB 2WV0A 2PJPA 3N05A 3WTXC 4OIRF 3S3NA 4NQWB 4PFPA 2GXBA 1NK2P 2XRNA 4KN4X 4UUSA 2GLOA 3ASOH 1BR4A 2O03A 4NNJA 4B8XA 4RB1A 1TWAJ 1HKSA 5DYMA 3HRTA 1USSA 2K9MA 4LG3A 2LD5A 2DA1A 2VONA 1U2WA 1J9IA 2G0EA 1ULYA 2ZBKA 1Y56A 1SEUA 3JRIA 2GBYA 4AVPA 1D5VA 2V1DA 3CZ6A 3LSKA 2FSWA 5K7ZA 4RMNA 1OLTA 1ETWA 3LSHA 3IAS2 4M73A 1HXDA 3BPXA 1T95A 4NB5A 1ZQ3P 2C6YA 2LSOA 4ZYDA 2O7OA 2UZKA 3MZYA 5LD2C 1FNNA 4G6DA 1EJ9A 1XG1A 2VODA 1VQLI 5E1XA 2IA0A 2XIGA 3RDIA 1X1DA 1MSFC 3P9IA 3K70C 1QQIA 4EJUA 2HDDA 4U87A 1QNTA 5D8KB 3BJOA 1J09A 5IT3A 5TGTA 3G2BA 2M30A 4UNOA 3I54A 2M0CA 2XHKA 5ERIA 3K0LA 1Z3YA 2Y69H 4DQ2A 2ADUA 2NAZA 3G73A 1MMGA 1TP4A 1LE8A 2GWRA 4U0VA 3SZPA 2QENA 4LK0F 4L18B 4RGXA 2HYGD 3LNQA 1IN6A 4BQNA 3JCUC 2E71A 4O6JA 2ICWG 2DT7B 4GRIA 4A3EJ 2H1LA 3DLAA 5F08A 1ZR4A 2BYVE 2MABA 1TQPA 1BC7C 1R9TJ 1FX7A 3M3YJ 5E20A 2CFOA 2DMQA 1ZLJA 4XICA 2QQ9A 4XM3A 3S1RJ 3HJEA 2VBXA 1Z05A 1ON1A 5E8GA 3HSEA 2LMDA 5GADJ 2WAQN 2JA6J 1IRXA 3ROUA 1KQ0A 2B63J 5IOZA 3ZQLA 4IPAA 4XOTA 3QPTA 5EDNA 1KYZA 2DW4A 4BKXA 2LRDA 1WI3A 2D2WA 1K7AA 3M9AA 2Z9OA 1WJFA 2IJLA 1U8RA 4XOPA 3KLNA 3VOEA 1D8KA 2EH3A 1JJ8C 4IJAA 2K02A 3E6DA 2X6YA 1RNLA 1ETVA 2MGQA 1Y0NA 3BG3A 1FMWA 2JZYA 5DEQA 4U88A 4GGGA 3AG4H 4I76A 1I39A 1JT6A 2A07F 4AUXA 2XAGA 3S1QJ 1HDPA 2DDBA 2ISYA 3CUQB 3GO5A 3V7CA 1JGGA 4MEXF 3JSOA 2QVOA 2NNNA 3S2HJ 1M1EB 2ZJRF 2JA2A 3ZCOA 3CCMI 1A35A 3P5JA 5BQTA 4AC0A 5EYRA 2LREA 1LVKA 4ZDPA 3OS2A 3A1YA 4IVNA 3F8CA 4HSRA 2KMUA 1OR7A 1X58A 2GAUA 2X51A 4JX4A 1MKMA 2QZ8A 4DYCA 2MYSA 1O7FA 3SHFA 4ZTFA 1T56A 2XVCA 3TDUC 3ML6A 3OL4A 2R0QC 1QVTA 1GT0C 4O5VA 1LFUP 4OOIA 2MW8A 3GWZA 2IVMA 2ESNA 5DCMB 4MLOA 4F3QA 4UVCA 4MTEA 2CV2A 2JQ7A 1IZ1A 3LWFA 2F4MB 2LDUA 4YFKF 1FZPB 3QU3A 5H2FC 2K9SA 2GXAA 3IHUA 4Z2YA 4F55A 2ISZA 4PJJA 2MD5A 4XBFA 3TMOA 1K79A 4ZJZA 1AKHB 2ME0A 2NRAC 2LTPA 4KICA 2JA5J 2M8GX 1I3AA 4IL6C 2IEKA 4IQJA 2JK3A 2XB0X 4CCJA 1R4MB 1T0FA 3B6AA 5KNLA 3I0TA 3TOAA 2WY7Q 3I55I 2E1OA 3DU5A 3TKYA 1R7JA 5HDNA 4IRGA 5KAFC 3GMEA 5H6RA 5IYCJ 5IT9Z 1D0ZA 5CQEA 2DLLA 3WGHA 1SMTA 3FMRA 1VQ4I 4E7IA 4CHUA 3DQVC 4HW0A 3QYBA 1S7AA 3A01A 2X6WA 2CMPA 3CCRI 3ZQHA 3W6KB 3VEPA 3VYTB 3U1DA 2H8WA 2F5EA 2ZSIB 1XCVA 4P96A 1QPMA 3M8JA 2CQQA 3VYSB 4M6XA 2ZJQF 1FYMA 4CYCB 4LB6B 5EG0B 2H6BA 3S17J 3A0HC 1FIPA 3CJTB 3R0AA 1UFMA 1U6GA 1Z0XA 1ZYRF 2D1VA 2OQRA 1S7EA 4L9JA 1OCRH 3OYBA 3PJRA 4UVBA 1XCBA 3JW4A 5FFZA 3DBLB 3R6SA 1GV2A 1BJZA 2ZJ2A 2M4GA 4R79A 2L3DA 2R92J 4BAYA 3PQKA 1XSXA 5E1WA 3WGGA 2KZVA 3WU2C 1JJ6C 5EZGA 4AIJA 1OFCX 2LNBA 5F04A 2IXSA 3K6GA 1YJ9I 4B09A 3RI4A 4V2FA 1R1VA 2CUZA 3MKLA 4D7MA 2KIQA 4KIBA 3I4NJ 2DA3A 1MMAA 1MBJA 4KFCA 1VQNI 2XGEA 1B72A 1R5HA 4KITB 2KHMA 3GBGA 3FXRA 4A93J 1XX5A 4GCVA 4BS9A 2VC0A 3GZ6A 2PG4A 3W2WA 4C2UA 3HOTA 1FPQA 4M9SA 4RB2C 3L2QA 1BIBA 3WODF 3JRFA 4BDZA 5DUIA 5CVVA 4EJVA 1GHCA 2PEXA 4XIDA 3CJRB 2R93J 3A0BC 3ERMA 1FC3A 2QQBA 3HKZA 1K6OA 2A5WA 2ZKZA 3DTIA 4M74A 2V6EA 4FTHA 2XAQA 1OPCA 1X1BA 4HBLA 3TBIA 3BP8A 1SD6A 2BOLA 2FXAA 2DTRA 1W0UA 3D5SC 1S5LC 2ZFUA 3H1CA 2KL4A 2X6OA 3NQOA 1Y1WJ 1U0JA 3RQIA 3CLOA 4G8XA 4XORA 4B43A 2PI0A 2EZHA 1QGPA 4WF2A 2EIJH 3HTSB 4RGUA 1YI2I 3HYIA 4AIKA 1P92A 2F5VA 1KU7A 4NC6A 3IKTA 2L9NA 1V4RA 2EQRA 2Z16A 2QYOA 3HOXJ 1RETA 3KP5A 1DPRA 1FWZA 4P55A 2VQGA 4TV7A 2O6GE 1DGWY 4XSXF 2F4IA 3KP4A 4AM3A 2EFNA 1W5SA 2WA0A 1X3WB 5EJCA 2BY2A 2FOKA 2KPMA 3GLLA 3BR6A 4ANJA 3GFJA 3ZQCA 3FM5A 4HF1A 4A3DJ 2R7DA 5D4RA 2JPBA 2M45A 4S04A 3GXOA 2BY3A 1SFXA 2ZC2A 4RAYA 4ENJA 4F93B 4BDYA 3OOPA 3DKYA 4MFDA 5LRSA 3HUGA 1O3QA 3V8LA 4Y33A 3CDLA 1W5TA 3TDZC 3QWLA 1H8AC 4BQOA 5FD6A 2R7RA 4IHVA 4MNUA 4YRVA 3MAJA 4BH9A 2K9LA 5EEAA 1QO0D 1HSJA 3ISPA 1Y39A 1K4SA 3S2DJ 4L9VA 1WKMA 2CQXA 2HQ5A 1BBYA 2FQ4A 2VE9A 1TWCJ 1IXRC 1OR7C 3MKWB 4WK8F 4BE1A 3I3LA 5DM6F 1FP2A 2M7BA 1FOXA 1MBFA 1X3UA 3T8TA 3BG5A 1HKTA 1TLHB 1S8NA 2GOXB 2HKXA 2QF7A 1ZAOA 5M3MJ 3HHGA 1H0MA 2FRHA 4Q4ZF 2JJ7A 1B9MA 3RQ4A 3OY9A 2FUG2 4Y13A 2CO5A 2G9WA 1BR1A 2V1UA 4IX7A 3ASNH 1XDSA 1ZK8A 4RGRA 1O4XA 4HLXA 1RR8C 2OZ6A 4YIRX 3H5RA 4AYBA 3KP2A 3G4SI 4XL9A 2TCTA 4U7BA 1MBKA 4P9FA 4BQAA 1I27A 3WG7H 2HTJA 3V7SA 2M5WA 3QPLA 1B9NA 2DI3A 2CQNA 1IO2A 3WHBA 5D4SA 1WJAA 2F5DA 3P9CA 1W36D 1PUFA 1I3QJ 4G94A 2XGCA 2KKOA 2PMZN 4ITVA 1B4AA 2QKMB 4K2EA 1T0FC 5FD5A 2HPMA 2BXZA 1YW7A 1X1PA 2FMLA 3FMQA 3JRHA 1XMXA 2Y0SN 1KQ9A 2EA2A 2EFQA 4E7SA 1DU6A 5L3FA 3F3XA 2L9SA 3HOSA 2DPUA 5LGTA 1G4DA 4UVAA 3R60A 3BWGA 3O2PE 1GDTA 2NVTJ 2V1NA 3P7NA 3TEDA 3AG3H 5ILUA 2CRGA 3DEWA 2YU9J 2VQCA 2CFXA 1POGA 3RPQA 3MZ8A 2LR8A 2QBYB 1JHHA 2H94A 1IDYA 3CCJI 1FOKA 4HNVA 1TTYA 2FD5A 1EH8A 4N9IA 3QPHA 1LJ9A 3RKQA 1MDMB 1IRFA 3H9QA 3QOEA 3SFZA 2EV0A 2P7CB 1FOWA 2O5RA 4II3A 5E3MA 3J80Z 1Y6IA 3CO6C 1MNDA 3R0JA 3SFIA 4DOZA 3OS0A 4L9TA 2IS4A 1KA8A 3OS1A 4XRMA 1NTCA 3TW7A 4EMSA 3BDDA 3OMYA 3GFIA 2VI6A 2CJJA 3I4MJ 4CCMA 2XF6A 4WCGA 3K70D 2CWEA 4XN0A 1OJLA 3K1NA 3TOBA 1HW1A 4A5MA 2YS9A 5J6XA 4E7HA 2VKVA 2UXXA 4BYYA 2DJNA 2DFEA 3KFWX 3OIOA 5CQGA 2VC1A 4DJAA 1IUFA 4IHSA 1S72I 1MD0A 3C2GA 2MC3A 2JA7J 2R5ZA 1V5FA 4UB6C 2V9PA 3L2VA 1UHWA 2EJRA 3W6VA 1ZRDA 5IY5H 3KZIC 3DBRB 2A61A 1V54H 1I6XA 3CJQB 4PGHA 1W1WE 2Y31A 2OJED 1FT9A 2P5VA 3LAJA 3PSIA 3BR5A 4C30A 3OR2C 3AL0B 2OV7A 2VB6A 2QQAA 2CUFA 4Y3OA 2BY1A 5KCMA 1XGOA 4M9XA 1QHGA 3I4PA 4UUVA 3S3OA 3FBIB 4QLCU 2IGOA 4A0XA 4HX4A 2DK5A 3CCEI 2K9QA 4M6VA 4Y15A 3OYDA 2MG4A 2AHQA 3EETA 1FBSA 2DO7A 2FU4A 1H9TA 3P9KA 5CYVA 3W2VA 2BE5F 1YE9A 4EATA 4R8HA 2BVMA 2HOSA 3H9GA 2J5OA 2ZMEB 1Y8QB 3OYNA 3HZJA 3FXMA 1U5TB 4BHBA 3DF8A 4YG2F 1AHDP 1LFBA 2B9SA 2CW7A 3OIPA 1WFXA 2DMTA 3DFGA 2RKHA 5E1ZB 3HOZJ 4M6YA 2LBFA 1P4WA 1SVLA 1DP3A 1N75A 2QSHX 4QSHA 1WI9A 2VLAA 5DDGA 3I64A 5A2QK 5EF6A 4ESBA 3FXQA 1OISA 4IHXA 1NG6A 2KRCA 4J19A 2FBKA 4F91B 1P4XA 1W7PB 1J5YA 4OAYA 3WE2A 3M4OJ 3S16J 3GZNB 1G3WA 4FCYA 3X2QH 4CCKA 3LSPA 1OCPA 1MJBA 3Q0VA 1UAAA 3EYIA 2HR3A 1PYVA 1AA7A 2R7QA 4Q47A 4D5FA 2R5YA 4HDVA 4CCLA 2R7XA 1P2FA 1YW9A 1YYVA 2DTZA 2L4AA 2XPVA 3K10A 4CA0A 5C4XJ 4JX5A 2IRFG 3SZGA 3WTSC 3T8RA 3CUOA 2TRTA 4B4CA 4BU2A 3OYEA 1GLNA 1VNDA 1KONA 2K40A 3KE2A 4XLAA
chains in the Genus database with same CATH topology
3ESWB 1TP4A 1X3WB 2F4MB 2QSHX 1X3ZB 2F4OB 1PVEA 1OQYA 2QSFX 4YIRX 2QSGX 1QZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESW B;  1TP4 A;  1X3W B;  2F4M B;  2QSH X;  1X3Z B;  2F4O B;  1PVE A;  1OQY A;  2QSF X;  4YIR X;  2QSG X;  1QZE A; 
#chains in the Genus database with same CATH topology
 2FNP A;  4HOB A;  4CSW A;  2PMH A;  3IWZ A;  3KIO A;  2EWN A;  1REP C;  1P4A A;  2BVL A;  4XNF A;  3S14 J;  1IN8 A;  1I5Z A;  1S29 A;  2B0L A;  3BRO A;  1I1G A;  2FE3 A;  4J01 A;  3KP6 A;  2OU2 A;  3OYF A;  2AXT C;  3BQY A;  3CCL I;  1ZN2 A;  2KP6 A;  4ABZ A;  3RIR A;  1J0R A;  4A3M J;  1LKX A;  2DJI A;  4BL0 B;  3T1B A;  2LOO A;  4XMY A;  2STT A;  1B59 A;  1R22 A;  3RYP A;  3PFI A;  3N97 A;  4XON A;  4FQG A;  3BZK A;  3NWS A;  2Q2E B;  4I0B A;  4RAG A;  2FOW A;  1OQY A;  1IV6 A;  1VQ7 I;  3HOY J;  1HW2 A;  1W5C C;  2HVQ A;  2VBZ A;  1O3T A;  1S7O A;  1SAU A;  4NHJ A;  2VT2 A;  2HZT A;  2L4M A;  2OF7 A;  1D8J A;  3DCF A;  2EIL H;  1LDK B;  2VKH A;  3PNT A;  1VQ5 I;  3NAR A;  3J7A Y;  5FLV A;  4N0B A;  2NYX A;  5B3S H;  3AG1 H;  2JA8 J;  2UV1 A;  1D0X A;  2FMY A;  4BQQ A;  2RC4 A;  4KDP A;  1BI1 A;  2ETH A;  2W7N A;  4A6E A;  1BM9 A;  3H5A A;  4DNC A;  5BNG A;  5C4J J;  2OZU A;  2X85 A;  1QPI A;  1K78 A;  5L3B A;  1MIJ A;  5ILS A;  1SFO J;  3HDD A;  3VFZ A;  2YUS A;  3RTR A;  3B73 A;  4KIS A;  3C7J A;  4ENM A;  4HQM A;  3I5U A;  4DZJ A;  4MHG A;  5LHG A;  3CD6 I;  1JGS A;  5JHU A;  5ICF A;  1IV8 A;  3EUK L;  5J1R A;  2FF4 A;  3L9F A;  2IA2 A;  3E5U A;  3WU1 B;  2MH9 A;  2NOJ B;  2VBW A;  3J7Z I;  1DDN A;  2M87 A;  2XRO A;  2TDX A;  2NVU B;  2IPQ X;  3S3M A;  3CDI A;  3HRS A;  5K5O A;  1MH3 A;  5FB2 A;  4RLF A;  2RVC A;  3F9K A;  3VSL A;  1TWH J;  1JUP A;  4H0E A;  2JVG A;  3CUQ C;  2M7A A;  1LPQ A;  1WPK A;  4BHC A;  5B5E C;  3WTT C;  4RDU A;  5M5X J;  4HX8 A;  4YFX F;  2WB1 N;  2K27 A;  5DS9 A;  4D9J A;  5D5U B;  3AG2 H;  4RB0 A;  3ABU A;  4I0A A;  3U2R A;  1PVE A;  2DPD A;  1SD5 A;  5IYB J;  3WE3 A;  3CO7 C;  2XC7 A;  3H92 A;  1E0E A;  4EEF G;  2W24 A;  3VDX A;  1MNE A;  5GTI C;  1YTY A;  2VQH A;  1F5T A;  4G6T B;  1RES A;  2RGV A;  5HDK A;  3J81 K;  3PO3 J;  2K3F A;  1WGX A;  1YRN A;  2CYY A;  4FAS D;  4HDU A;  2UUZ A;  1BJA A;  1G3T A;  3OWT A;  2P6T A;  4PK4 A;  1EA3 A;  3EDP A;  3M7G A;  5BPD A;  4G7Z F;  1RUN A;  4PSW A;  3RZD J;  4R1H A;  5J4Y A;  3PNY A;  4BJ6 C;  3FKI J;  1WJD A;  5IP7 J;  4AD9 A;  1K61 A;  1YFH A;  2EK5 A;  4FE4 A;  2Z99 A;  2NOG A;  3BT9 A;  3BZC A;  3RCO A;  2HDW A;  3L2U A;  1WJE A;  3GTP J;  1MMS A;  1A31 A;  2Q8K A;  1F1Z A;  4HEA 2;  1R23 A;  4XRS A;  1TBX A;  4OIP F;  3V4G A;  1BW6 A;  2L7K A;  4BXF A;  1LVA A;  4ZH4 F;  1B8I B;  1IRG A;  4LG0 A;  1FYL A;  1O3R A;  2FNA A;  2Y2Z A;  3HHH A;  4CCO A;  1ETX A;  1VQK I;  2K5C A;  1WJC A;  4FT8 A;  5LEJ A;  5HNF A;  3VWB A;  2GM4 A;  1XDU A;  3BR2 A;  3F23 A;  1CF7 A;  4Q48 A;  2B7E A;  4IXA A;  3RKY A;  1E2X A;  4B3X A;  3BG6 A;  4IKF A;  5BMZ A;  2XSJ C;  2EZL A;  4PJ0 C;  2XAF A;  3BR1 A;  1BOB A;  1RZ4 A;  2F5C A;  3HOW J;  2M8E A;  3EUH C;  3MMY B;  1RKW A;  5FFX A;  1T33 A;  3IRR A;  3H35 A;  2QBY A;  3GTL J;  1IUY A;  3LA2 A;  4B47 A;  1T38 A;  1MSE C;  5D8L B;  1NH3 A;  1JT0 A;  2EIM H;  2P4W A;  2LY2 A;  2ZNY A;  2E1C A;  2DYS H;  3MEX A;  1A6Q A;  2BGC A;  2HNH A;  4CDG A;  2L01 A;  1T2K A;  1JTX A;  3TW6 A;  1N77 A;  2DA7 A;  3H0G J;  3I59 A;  4MIM A;  2R7T A;  3FHZ A;  3I56 I;  4F92 B;  3CCY A;  4BEH A;  4I6Z A;  2EFO A;  1C0W A;  3K7A J;  5FLX K;  1TWF J;  3IP4 B;  2IS1 A;  2YPR A;  4Q5S F;  3ZOB A;  2P81 A;  5HLH A;  1J59 A;  2KQR A;  4M9Z A;  2LH9 A;  5JR3 A;  5FRM A;  1ETK A;  2L2O A;  4KJZ A;  2RNG A;  3SQN A;  3OOU A;  3ZQQ A;  4MTD A;  1LQ1 A;  3CMY A;  1YS6 A;  2IW5 A;  3H5N A;  2M9H A;  1UCR A;  2JRM A;  3BCB A;  4PCQ A;  4NC8 A;  5DD4 A;  2KJB A;  2EPF A;  1UB9 A;  4E7J A;  3TO9 A;  1XD7 A;  1WZ2 A;  3GLX A;  5F0C A;  3TL4 X;  4A12 A;  2YSR A;  1GV5 A;  4OMZ A;  5ICC A;  4F52 A;  1RRJ A;  1P9Q C;  1Y8R B;  2XAH A;  2NXN B;  1QZZ A;  4D1Q A;  1V55 H;  5HOD A;  3HC7 A;  4MFE A;  4OWR B;  3VYU B;  2HEO A;  4RAZ A;  4F7Z A;  1X1A A;  2BBY A;  5L3C A;  1FSE A;  2HQN A;  2E1M C;  1JTY A;  1BI3 A;  5CVI A;  2NS7 A;  2E36 A;  4I01 A;  2FX0 A;  3F8M A;  1GUU A;  1YG2 A;  2R7O A;  3ZMS A;  2MSY A;  1PP7 U;  1ERD A;  1O7L A;  2ZME A;  4A69 C;  1BW5 A;  2VL8 A;  3DV8 A;  2JMW A;  2IA1 A;  1RKT A;  1Z3X A;  4RGS A;  1R36 A;  3DU6 A;  2LG4 A;  1APL C;  2BW3 A;  2Q0O A;  3PUF A;  1I6H J;  2NS0 A;  3MN2 A;  2W84 A;  5FKO A;  5DTD A;  3A2K A;  2PMU A;  3BR0 A;  2ZJP F;  1BOA A;  2CV1 A;  2EA4 A;  1SMY F;  3I9V 2;  4C3J J;  1VQM I;  1LB2 A;  3CJN A;  1MMN A;  2DOF A;  3CQZ J;  2VIX A;  1TC3 C;  2P8T A;  2ELJ A;  1TNT A;  3OYG A;  2BZT A;  2E5N A;  1ZRE A;  1BL0 A;  1W7P A;  1KZH A;  2Z2S B;  1MMD A;  2DOD A;  4C2M J;  1R5G A;  1F43 A;  1WVR A;  1EH6 A;  3GX4 X;  5BPI A;  4WX9 A;  2VPL A;  4HAM A;  4I98 B;  2GIZ A;  2J5P A;  1JKQ C;  3GFM A;  4HV5 A;  3QU6 A;  2FQ3 A;  1SAX A;  2A05 A;  5LGN A;  2UXN A;  1XPX A;  1ODD A;  1DPU A;  1E3H A;  2DOA A;  3HB9 A;  4L5E A;  3CC2 I;  2DA5 A;  1D0Y A;  3M1C A;  5K7F A;  1WSU A;  4ENN A;  3NWT A;  4NQW A;  2Y0M A;  3EUA A;  4CZZ A;  4XLC A;  4BUP A;  2KDO A;  5ICG A;  2L5Q A;  5DCF A;  4U7D A;  2O3F A;  4EM2 A;  3Q9V A;  2ZB9 A;  1MNM C;  3ZXS A;  1HC8 A;  4JK1 X;  5M5W J;  2HKO A;  2OPT A;  4L0Y B;  5F1R A;  2RRE A;  3KYC B;  2HU9 A;  2Z3Y A;  3ESW B;  4DBQ A;  3CC4 I;  2VOP A;  6PAX A;  2Y48 A;  4RAF A;  3I58 A;  4PSX A;  3LSG A;  2JUG A;  4HF0 A;  1T6S A;  2D1H A;  4IHT A;  4UXN A;  3DPT A;  2DYR H;  3CMM A;  4BNC A;  2JVH A;  4B44 A;  1VFC A;  4N4O B;  1FOY A;  3HG9 A;  2CV0 A;  2LC2 A;  5K5R A;  3L2W A;  1HCR A;  4XLF A;  5TRD A;  2WBM A;  4EJO A;  1UG0 A;  1ZGW A;  4IF4 A;  2PFB A;  4UUT A;  1QZE A;  2PX9 A;  2E2I J;  3NEU A;  2X6X A;  4GYI A;  1JKR C;  2VKD A;  3MKZ A;  4ZTJ A;  4Y17 A;  1QA6 A;  1ETY A;  2L9V A;  3JRB A;  1YIO A;  2KLO A;  3JTH A;  3COA C;  1LE8 B;  1JHF A;  2Y9Y A;  1BR2 A;  3QYF A;  3FK7 A;  4YIF A;  1E3P A;  4DZP A;  1FLI A;  5JLX A;  3K2Z A;  1BN5 A;  2WC2 A;  2NS8 A;  1MGT A;  3BTL A;  3DLL F;  2QWW A;  2VKE A;  1NG7 A;  3E5X A;  2V7F A;  3KYL A;  1F4K A;  4I09 A;  2XF7 A;  3LST A;  1DGR M;  4JQF A;  5J47 A;  1OCT C;  2ELK A;  2LK2 A;  5IP9 J;  1P6R A;  5F64 A;  2WY8 Q;  2X48 A;  1YIJ I;  4J00 A;  3SEQ A;  2WAQ A;  2XPU A;  5DD8 A;  4QTR A;  5D5X B;  4OIO F;  2FBI A;  2OTJ I;  1UHM A;  1G6N A;  3MKY B;  1QHH D;  2VT3 A;  1GVD A;  3M8F A;  1LNW A;  2VPR A;  4MEY F;  2VJI A;  2EB7 A;  4BXX J;  2MD0 A;  4LLN A;  3NAU A;  3CCU I;  1YHQ I;  3BTI A;  1IW7 F;  4QWQ A;  1ZR2 A;  3JRG A;  1S3J A;  3HL2 A;  2DMN A;  4II2 A;  2L9R A;  1QBJ A;  4FE7 A;  1XB4 A;  1ZAR A;  2L7F P;  3Q9S A;  4YII A;  2LYC A;  2LF8 A;  4A3I J;  2KJC A;  3CF5 F;  1CQT A;  5HNH A;  3EPZ A;  1B1B A;  3K4J A;  4ZC3 A;  5GAE J;  3RZO J;  2O61 A;  1FIA A;  4BE2 A;  1D1A A;  3MZH A;  4ZYA A;  3BY6 A;  3ECO A;  3O8H A;  1TT5 B;  2DA6 A;  5JI6 A;  3SEZ A;  3WGI A;  2JUC A;  2X9D A;  2EV6 A;  2VOO A;  3K1P A;  1FBQ A;  4IOC F;  3CUQ A;  5IPA A;  4BBR J;  3C3W A;  1PUE E;  3REO A;  3SZT A;  4KN7 X;  2W57 A;  3ZPL A;  4IQ4 A;  1V3F A;  3IH2 A;  4CCN A;  2QLZ A;  3SJM A;  4LB5 A;  1L0O C;  2PJR B;  3V8J A;  1PDN C;  2JT1 A;  1A6I A;  2IBD A;  1RI7 A;  3PFY A;  1VZ0 A;  5JHF A;  1YLF A;  1IF1 A;  2VXD A;  3U21 A;  4CUG A;  1WRJ A;  3VB2 A;  4BY7 J;  2QEX I;  2LP0 A;  2E35 A;  1X2N A;  2W25 A;  3LSM A;  4H4K C;  3ZRG A;  1O3S A;  3BJA A;  1N25 A;  3CCQ I;  3FDY A;  2P6S A;  3O3K A;  3JRE A;  1MW7 A;  2DDA A;  5FRN A;  2ZXI A;  3SDB A;  5JFR A;  5DUK A;  2ID6 A;  4OIN F;  5HDG A;  2Y30 A;  4XLH A;  2XGX A;  5DCM A;  3D0S A;  3CC7 I;  2KT0 A;  3HOU J;  2GOM A;  3FM3 A;  1TL8 A;  4A3G J;  2Z1D A;  3DBH B;  1XMK A;  1EF4 A;  2CQ7 A;  3LFU A;  5BS6 A;  2E7W A;  3RKW A;  1IN5 A;  4N9H A;  4YEL A;  4BXU A;  1TQM A;  3K1M A;  3QYE A;  3RPU A;  2MLK A;  1AKH A;  4ZZL A;  2GQQ A;  2XV4 S;  3K4B A;  2V9V A;  3VSK A;  1ONV A;  1MBG A;  1Y0U A;  2ZME C;  3DWL E;  2XSD C;  4C3H J;  4MQV A;  4ESF A;  2OC6 A;  2DBB A;  3QPS A;  1U5T C;  4A6D A;  2EFW A;  3E6M A;  3HXL A;  3K9T A;  3TP0 A;  1P7J A;  1IAW A;  1TW2 A;  1DQU A;  1T98 A;  2P5K A;  2RQP A;  4JBA A;  4S0H B;  3A01 B;  2X1D A;  1DP7 P;  2AS5 F;  3KPH A;  2GZW A;  2GXG A;  3F21 A;  1WWX A;  4RS8 A;  4OAZ A;  3EYY A;  3FHN A;  3BTC A;  2JSC A;  3SXY A;  2AQF A;  4O3M A;  3EUH A;  4I02 A;  2ID3 A;  3KCC A;  1GVJ A;  4XLN F;  5LEK A;  1HDD C;  1JI8 A;  1V5G A;  2IGK A;  3GCM A;  3G71 I;  4G7H F;  2DFI A;  4QPO A;  3IV5 A;  2M4K A;  2E2H J;  1LEA A;  3HGY A;  4GYG A;  4CYC A;  4D5C A;  1LFP A;  3ONQ A;  1DUX C;  4Y7N J;  1YIT I;  1KU9 A;  2CW0 F;  5EG0 A;  5D6F A;  2FBH A;  1YQA A;  3H3U A;  2K4B A;  3K4L A;  3F22 A;  1ZG1 A;  1LEB A;  2Z5U A;  4XSZ F;  5GP9 A;  4EVI A;  1JUM A;  4CXF A;  2EZK A;  4D7N A;  2IS2 A;  1XTA A;  2QA4 I;  2BXY A;  4XK4 A;  1RC9 A;  1QVU A;  2F6C A;  3F6V A;  3K4C A;  1VQ8 I;  4ASN A;  3DKX A;  2IP2 A;  4UB8 C;  1FSH A;  3GEZ A;  4AID A;  1E17 A;  3NRV A;  3IWF A;  2F4O B;  1XS9 A;  2R3S A;  1H9G A;  1TZL A;  1B72 B;  3H3V K;  4XLP F;  2KDZ A;  1G2H A;  5FKL A;  3U1K A;  2M1B A;  1SVO A;  4IHY A;  5AIQ A;  4XN3 A;  4BJ5 C;  4V19 K;  4GFB A;  4MQ9 F;  3FIS A;  5TIS C;  3B02 A;  4E7K A;  4LLL A;  3RPU D;  2Q1Z B;  5M3F J;  3MD2 A;  4JX6 A;  1U9O A;  5E3N A;  3GTJ J;  3ZQF A;  1JXS A;  5GPC A;  3HKZ N;  3D1N I;  1FTT A;  2M2E A;  5KVR A;  3PL8 A;  4ZDL A;  2OQG A;  4NC7 A;  2ECB A;  2AO9 A;  3HPG A;  5K1Y A;  2DCE A;  1IDZ A;  1G3S A;  1I50 J;  3OL3 A;  5B1A H;  5F6F A;  4S05 A;  3VOD A;  3S1M J;  3DXJ F;  1T39 A;  1KQ8 A;  3HOV J;  2A6H F;  2DQR A;  3WTW C;  4LFU A;  3LFK A;  3IUO A;  4M3B A;  3F0C A;  2HVS A;  4AU7 A;  5M5Y J;  1R71 A;  4FX0 A;  2PN6 A;  3TQN A;  3TGN A;  1JUS A;  2EFP A;  1H88 C;  2COM A;  2YX4 A;  3E97 A;  3LQQ A;  2HWV A;  2VUM J;  1RUO A;  3ELK A;  1XGN A;  3RJP A;  1D5Y A;  1ZLK A;  1PJR A;  4RLQ A;  1KU2 A;  2HQA A;  1G59 A;  5J40 A;  3KLO A;  1KU3 A;  3SDG A;  2I10 A;  3BLY A;  3DP7 A;  2WTE A;  3UNG C;  2BEO A;  4M3G A;  4M72 A;  5L3D A;  1MH4 A;  3VYR B;  1ETO A;  3FKJ A;  4LGW A;  2HPI A;  2HXO A;  1XGM A;  3AAF A;  3LA3 A;  2W82 A;  3JTG A;  1R1U A;  4IRH A;  2A69 F;  3S15 J;  3BCA A;  2L02 A;  2O8K A;  2OBP A;  2JSP A;  4FET A;  3V42 A;  2UWM A;  1WQ2 A;  1ZGJ A;  2E5Z A;  2VJ4 A;  4OMY A;  1A36 A;  3IRQ A;  1E3O C;  4L5I A;  2A6E F;  2MFZ A;  2Y9Z A;  4QPQ A;  2IS6 A;  3HBL A;  3GTQ J;  4M3F A;  3CCS I;  2WAF A;  1VI0 A;  4PFO A;  3CTA A;  3CP2 A;  1SFU A;  2P5L C;  4PJL A;  3RSN A;  2JWT A;  1OCO H;  3GTM J;  4XRS G;  4JOM A;  3T5X A;  5J1U A;  3HUG B;  2VQL A;  3FK6 A;  3HGG A;  2XKO A;  3E6B A;  4LJZ F;  2V79 A;  5FRO A;  2CG4 A;  1WHU A;  1L3L A;  1XSV A;  3T0Y A;  3Q5F A;  1WCM J;  2RNJ A;  1BIA A;  5LHH A;  1NHA A;  2ZXJ A;  1BC8 C;  3ZMD A;  1X4P A;  2ZSH B;  1QRY A;  4ESJ A;  2LVS A;  4UHT A;  4EJW A;  4CGZ A;  5LBQ A;  4OIQ F;  5IT9 K;  3BG7 A;  2ZCW A;  1ACI A;  3TO6 A;  5CLS A;  3CDH A;  5F27 A;  3BTJ A;  5E8I A;  2ZXW H;  4PDK A;  3CES A;  3DEE A;  2A68 F;  2O0Y A;  4RB3 C;  4EJT A;  3C1D A;  3ECH A;  3FIW A;  4DYR A;  3PSF A;  5A2Q Z;  2RDP A;  5LLQ A;  1KGS A;  4CH7 A;  4KIF A;  5FKM A;  2EV5 A;  2HQR A;  1IN7 A;  4BE0 A;  5FKN A;  1FJL A;  3E3V A;  2VE8 A;  1IXC A;  2RQQ A;  1S6L A;  4YFN F;  4G9Y A;  4UV8 A;  3D5L A;  2HYF A;  1OYI A;  2M0M A;  3Q0U A;  3LSI A;  4Y4R A;  3OR1 C;  4PGG A;  2A6T A;  3FXL A;  5BOX A;  3ZQG A;  2DFH A;  2XF5 A;  4AYB N;  5EGO B;  2VJJ A;  3R4K A;  1FTZ A;  5L3E A;  2OAZ A;  5D5V B;  3HIF A;  1NK3 P;  4P1W A;  5HLG A;  2DXI A;  4UV9 A;  3WHC A;  5GAH J;  5K7H A;  2NVQ J;  4JYK A;  1QZY A;  3UR3 C;  1PUF B;  3G1L A;  3S1N J;  4Z6Y A;  1U9N A;  4IEJ A;  1VQP I;  5C3E J;  4EQQ A;  3QQA A;  3E1S A;  1SFE A;  3KZZ A;  4E4H A;  1HLV A;  1AOY A;  1Z1D A;  2HOT A;  3BPV A;  3MQ0 A;  4IO9 F;  3MCZ A;  3MFK A;  4LIU A;  3O8G A;  3G3Z A;  4V2G A;  1IGN A;  1U3E M;  3ABT A;  3LSR A;  1RR7 A;  2E7X A;  2PMZ A;  1S9H A;  5CVJ A;  5CVU A;  2WWY A;  5DM7 F;  4LLG F;  1ZRF A;  3E0J B;  5D5W B;  1WJB A;  4CO8 A;  1I1S A;  2OCE A;  2Y0S A;  1UST A;  1TNS A;  2FJ1 A;  2HOA A;  3G1M A;  2K85 A;  2AXL A;  2QQ8 A;  4GXO A;  2QCO A;  3S32 A;  4KUM A;  2VJ5 A;  1RPW A;  2P7V B;  3PM1 A;  1IG7 A;  3OYK A;  3ZMZ A;  5JVG F;  2V4J C;  1R49 A;  2LLK A;  4FX4 A;  3LA7 A;  4CZC A;  1VF9 A;  2PJR A;  4BHP A;  3JRC A;  4HQE A;  2D45 A;  3IL2 A;  1R4N B;  2ZNZ A;  4GO1 A;  1MDM A;  1Z67 A;  4A3L J;  2MH2 A;  1J75 A;  2E60 A;  4JP0 A;  2CSO A;  4HLY A;  1Z7L A;  1HKQ A;  1ZHF A;  1K6Y A;  2YX7 A;  2EIN H;  4HPQ A;  2EIK H;  2F5F A;  1YX3 A;  4P9U A;  3V7R A;  2Z33 A;  3Q3S A;  1BA5 A;  2X4H A;  2R5Z B;  4L0Z B;  1R1T A;  3WG9 A;  1X19 A;  5J8F A;  3DPU A;  4A3B J;  2HOE A;  2KIU A;  2H27 A;  1W0T A;  3OIQ A;  1TQI A;  2MBF A;  3FXO A;  3FF5 A;  1F9N A;  2ECC A;  3L1P A;  2HZD A;  4A2U A;  4WXC A;  3GUD A;  1ZG5 A;  5ED4 A;  2R7U A;  1X2M A;  3D5R C;  4QIW N;  4YEJ A;  4E7L A;  3U9G A;  3E6C C;  3F8B A;  1A5J A;  3B6C A;  2KIF A;  4A3K J;  1H89 C;  4X6A J;  2OUM A;  4ON0 A;  1A04 A;  1P7I A;  2A5Y B;  3ZQ7 A;  2R7Z J;  2K7L A;  1V5E A;  4RA2 A;  3MWM A;  3IKV A;  4XQF A;  2XAS A;  2ZO4 A;  3ZMV A;  2E1N A;  3ULQ B;  4DYQ A;  1U78 A;  1MJ9 A;  2M34 A;  2CUJ A;  2I5U A;  2W00 A;  4AWX B;  3CCV I;  1R5I D;  1QU3 A;  1YOV B;  3L2R A;  4BBS J;  2F2E A;  2MLG A;  4KT5 C;  3WTZ A;  4Y52 J;  2KFD A;  2IGN A;  1ORK A;  3KP7 A;  5L3G A;  3N4M A;  1TWG J;  4A3C J;  1FYK A;  3C18 A;  4M71 A;  5LHI A;  4XLE A;  4C3I J;  2ZFW A;  2XAU A;  1IJW C;  3ZN1 A;  5CJ9 A;  3LSJ A;  4MGR A;  3J81 Z;  1WH5 A;  5JVT A;  3QP6 A;  1HQC A;  1R6R A;  2MA3 A;  1LDJ A;  2XGD A;  3VPR A;  4PZJ A;  2KRF A;  1SD7 A;  5KK1 A;  5IYD J;  2LBF B;  3K2A A;  1ITY A;  1AWC A;  2M3A A;  3A4C A;  3FZV A;  3BR3 A;  1U5T A;  1Z9C A;  3K4N A;  3K69 A;  1VQ6 I;  1EKE A;  3TO7 A;  3KEY A;  3WTU C;  2P0W A;  2G7H A;  1JE8 A;  4HNT A;  2E34 A;  2X1C A;  1JKO C;  5E79 C;  2NVX J;  3LMM A;  3HRM A;  3JRD A;  1J7K A;  2VBY A;  4KNY A;  2PQ8 A;  4M3E A;  2VN2 A;  4NDL A;  4EM1 A;  4G7O F;  3OYM A;  1BI2 A;  3BOQ A;  3DTE A;  4OU0 A;  2E19 A;  3IH4 A;  3DEU A;  2KRH A;  3L00 A;  2R5Y B;  3UKG A;  4LK1 F;  2GA1 A;  1HOM A;  3GZ5 A;  3I53 A;  5KAI C;  1YO5 C;  3FXU A;  3C2H A;  1XGS A;  2L54 A;  3L7W A;  2LKS A;  5ILV A;  4B3A A;  3A03 A;  3CLQ A;  4B48 A;  1Z77 A;  2PBI A;  1UMQ A;  2ESH A;  3FXJ A;  4NBQ A;  5HLI A;  5HLT A;  1UG2 A;  3LAP A;  4UUS B;  4EM0 B;  2RAE A;  1HW5 A;  1YJW I;  2E1M B;  3KYD B;  1RIO H;  2HS5 A;  2BV6 A;  1ZTR A;  1N78 A;  3OV8 A;  2K9N A;  3DPL C;  3GTK J;  4XR6 A;  2XPW A;  4HST A;  1UZC A;  5FJ8 J;  2R7S A;  3G1O A;  1OMI A;  4EGZ A;  2QSF X;  2HVR A;  1FP1 D;  2MC4 A;  1T8I A;  3GFL A;  2NVY J;  2BY0 A;  5JLW A;  1UJ8 A;  5J1Y A;  5EEG A;  4G6Q A;  5IOY A;  2D5V A;  1VQ9 I;  4LMY A;  3J7Y J;  1K83 J;  5J3L A;  5AIP A;  5E18 F;  2L7M P;  5FLX Z;  3GTG J;  1ZGA A;  2Q2E A;  3C2B A;  3WTV C;  2XKP A;  2FA5 A;  3HEF A;  2HYJ A;  4KIG A;  5LGU A;  1CGP A;  2F48 A;  4PJM A;  2CGP A;  4WXD A;  3H9J A;  2N8G A;  3GYH X;  3W2A A;  1EV7 A;  2OD5 A;  3J80 K;  2V9K A;  4MO7 A;  5CVR A;  4BGD A;  3CMA I;  2DT5 A;  3PUB A;  1K78 B;  4UY8 I;  4DIQ A;  1MBE A;  4RBO A;  2QUF A;  5DV5 A;  3BJ6 A;  5LFA A;  2IT0 A;  3SYT A;  2IGM A;  3OYC A;  5E3L A;  3ZQI A;  2CU7 A;  3L2C A;  3F6O A;  1ENH A;  3V8K A;  1OKR A;  4BJT A;  2STW A;  3QP5 A;  4ENK A;  4IOA F;  2DK8 A;  1W7P D;  4ZDO A;  2DAO A;  2G7U A;  4LOC A;  2OA4 A;  3IC7 A;  4KT6 A;  1FEX A;  1MJA A;  2ME6 A;  2ACJ A;  2FEZ A;  5EZH A;  2JPC A;  3I71 A;  1MZB A;  5HS8 A;  1D1C A;  3HRU A;  2OTL I;  3HSF A;  4WXH A;  4IRI A;  3K4M A;  5HOO A;  1R58 A;  1X4O A;  2LF7 A;  3ZP5 A;  2DU9 A;  1SFK A;  5FGM A;  4A0Y A;  1X3Z B;  3S8P A;  4A5N A;  2QSG X;  1WH7 A;  4LIV A;  4RM3 A;  2CUE A;  4PJN A;  3OSF A;  1OCC H;  5B1B H;  1XMA A;  2DN0 A;  3AKZ A;  1HST A;  2HDC A;  2K3P A;  3EQL F;  4PUS A;  4GDF A;  2JRT A;  4EGY A;  3OYA A;  3H3Z A;  2WB1 A;  2W1O A;  3S2W A;  5IP6 A;  4L9N A;  2XRL A;  3OSG A;  4A3J J;  1YRN B;  3DTK A;  5F0H A;  1Z21 A;  2Y75 A;  2RN7 A;  4IZZ A;  2X0L A;  3Q0W A;  2EZI A;  2W48 A;  1U8B A;  3FX3 A;  3R61 A;  2KZG A;  4KMU X;  3CF2 A;  5H20 A;  5E3O A;  3QAH A;  1Q1V A;  2HGC A;  2WV1 A;  3PIO F;  1IC8 A;  5D6E A;  4HX7 A;  2YR2 A;  1J2X A;  3M1E A;  2AQE A;  2CH0 A;  4I99 C;  4ZYE A;  3KEO A;  1W4M A;  3M8E A;  3HSR A;  2H8R A;  1D1B A;  5EGO A;  1TT0 A;  4M3D A;  5AON A;  3JRA A;  1OYW A;  1ETQ A;  1SVM A;  4L5J A;  3O6B B;  2LY1 A;  4LD5 A;  3G6E I;  4LG0 B;  3FXK A;  4HV6 A;  1UHS A;  2BHZ A;  2YU3 A;  2JTV A;  4B1R A;  4ZZD A;  5GTH C;  1OYY A;  4U0Y A;  4HZF A;  4FIS A;  3TP3 A;  4KA4 A;  2DA4 A;  4CIC A;  3F72 A;  3ERE D;  4KYW A;  4G12 A;  5FLM J;  2DMU A;  5KHD A;  3ZR8 X;  2XB5 A;  3GTO J;  1CF7 B;  4HYE A;  3IAM 2;  1IRZ A;  1Z6R A;  1B8I A;  1Z6T A;  3CP8 A;  5E17 F;  3QRF F;  5GPA A;  5FKK A;  2HTS A;  4ZYG A;  5K5Q A;  2XAJ A;  5F0F A;  2H09 A;  1G3Y A;  2HXI A;  4RM2 A;  5ICE A;  4A3F J;  3OYH A;  1EH7 A;  3ZMT A;  4ETS A;  3OYJ A;  4C2T A;  3JAM K;  5HS9 A;  3KET A;  1VTN C;  1GXQ A;  3BQZ A;  3AL0 C;  3GW2 A;  3LL7 A;  1HF0 A;  3OYL A;  1HBX G;  2DMP A;  3DKW A;  4HRI A;  2KIS A;  2V6C A;  2O9L A;  3WU0 A;  2BHY A;  2DFF A;  2DOE A;  2CQK A;  3ZGK A;  1ZEL A;  2DT6 A;  5J8C A;  2COB A;  1XC5 A;  2VAS A;  2ZXH A;  4BY1 J;  3M07 A;  4X0G A;  2E2J J;  3I59 B;  4HA8 A;  3A02 A;  5LRR A;  1F36 A;  2DQL A;  4BEH B;  4E7Z A;  1VQO I;  1SD4 A;  2O8X A;  4KMF A;  4I7H A;  1ZRC A;  1LDD A;  1UEL B;  2I8D A;  2L7Z A;  4U0W A;  4XKW A;  5HS7 A;  2LKP A;  4C9Y A;  5B66 C;  2EBI A;  2NNY A;  4X1E A;  2VXZ A;  3KX2 A;  2H1K A;  3JSP A;  3MVP A;  3OYI A;  2V1X A;  1R00 A;  3KEQ A;  1K4T A;  1Q1H A;  3FWE A;  2KIM A;  3PQJ A;  1FMV A;  2L0K A;  3AFH A;  4P5O A;  1AU7 A;  3QOD A;  4WWC A;  1T08 B;  1TW3 A;  2JN6 A;  4W1U A;  1STZ A;  5EEH A;  2DA2 A;  1ZG3 A;  3HTU A;  2R4G A;  1YW8 A;  1BI0 A;  2LY9 A;  9ANT A;  1XSD A;  5HVQ C;  1G8X A;  3S93 A;  1Y1V J;  2WAD A;  3BC8 A;  4LIT A;  4XKV A;  3IH3 A;  5J4V A;  3WTY C;  2QM3 A;  4AVZ A;  1IXS B;  3K4K A;  4HNU A;  1O57 A;  1SAN A;  4DW6 A;  1ZH5 A;  2LFB A;  3CME I;  3W3C A;  3LOC A;  2LKX A;  1YJN I;  2PLY A;  4A0Z A;  3BG9 A;  3F8N A;  2XDV A;  3H0D A;  3ABM H;  2K86 A;  1IN4 A;  2R7W A;  4HF2 A;  1ON2 A;  5F1J A;  2K4J A;  3GVA A;  1B6A A;  3W6J B;  4E70 A;  2QKL B;  2XUB A;  3PO2 J;  4FHT A;  3H36 A;  2CW8 A;  1X1C A;  4XKC A;  4CYD A;  1OCZ H;  1SC7 A;  2HI3 A;  3KZY A;  2QGU A;  2BW3 B;  2V26 A;  4W97 A;  1MBH A;  2R7F A;  1FY7 A;  2OCC H;  3GF2 A;  3RKX A;  4IHW A;  1Z7U A;  5TJJ A;  1PP8 F;  1D3Y A;  1ZKG A;  5FO5 A;  3ABK H;  1FBU A;  4E6K G;  5CKT A;  3HM5 A;  1LUJ B;  3E5Q A;  4I2O A;  3KP3 A;  1YX5 A;  3FMS A;  3JR9 A;  5H6Q A;  2R7V A;  3ZMU A;  2W4S A;  4N4N B;  3HPH A;  2CS3 A;  1JKP C;  3RYR A;  1WJ5 A;  4HG2 A;  5CPR B;  3BZ6 A;  3E7L A;  4DBR A;  4EV0 A;  4D0P A;  1HA8 A;  3PNV A;  2RV8 A;  1KYW A;  2GIV A;  3ABL H;  4NUB A;  1DU0 A;  2WAE A;  3L09 A;  4ZYH A;  1XN7 A;  2IAI A;  3LQR A;  3ZN0 A;  5GAG J;  4XKB A;  2HFH A;  2A3S A;  2W85 A;  2ELH A;  1Z91 A;  2H6C A;  3QOP A;  4XRF A;  4AIH A;  4DGW B;  3PIP F;  3J7A O;  1W36 C;  3F8F A;  4BAC A;  5C44 J;  2GA2 A;  1YS7 A;  3JAM Z;  1GXP A;  2X1E A;  3FBN B;  2WV0 A;  2PJP A;  3N05 A;  3WTX C;  4OIR F;  3S3N A;  4NQW B;  4PFP A;  2GXB A;  1NK2 P;  2XRN A;  4KN4 X;  4UUS A;  2GLO A;  3ASO H;  1BR4 A;  2O03 A;  4NNJ A;  4B8X A;  4RB1 A;  1TWA J;  1HKS A;  5DYM A;  3HRT A;  1USS A;  2K9M A;  4LG3 A;  2LD5 A;  2DA1 A;  2VON A;  1U2W A;  1J9I A;  2G0E A;  1ULY A;  2ZBK A;  1Y56 A;  1SEU A;  3JRI A;  2GBY A;  4AVP A;  1D5V A;  2V1D A;  3CZ6 A;  3LSK A;  2FSW A;  5K7Z A;  4RMN A;  1OLT A;  1ETW A;  3LSH A;  3IAS 2;  4M73 A;  1HXD A;  3BPX A;  1T95 A;  4NB5 A;  1ZQ3 P;  2C6Y A;  2LSO A;  4ZYD A;  2O7O A;  2UZK A;  3MZY A;  5LD2 C;  1FNN A;  4G6D A;  1EJ9 A;  1XG1 A;  2VOD A;  1VQL I;  5E1X A;  2IA0 A;  2XIG A;  3RDI A;  1X1D A;  1MSF C;  3P9I A;  3K70 C;  1QQI A;  4EJU A;  2HDD A;  4U87 A;  1QNT A;  5D8K B;  3BJO A;  1J09 A;  5IT3 A;  5TGT A;  3G2B A;  2M30 A;  4UNO A;  3I54 A;  2M0C A;  2XHK A;  5ERI A;  3K0L A;  1Z3Y A;  2Y69 H;  4DQ2 A;  2ADU A;  2NAZ A;  3G73 A;  1MMG A;  1TP4 A;  1LE8 A;  2GWR A;  4U0V A;  3SZP A;  2QEN A;  4LK0 F;  4L18 B;  4RGX A;  2HYG D;  3LNQ A;  1IN6 A;  4BQN A;  3JCU C;  2E71 A;  4O6J A;  2ICW G;  2DT7 B;  4GRI A;  4A3E J;  2H1L A;  3DLA A;  5F08 A;  1ZR4 A;  2BYV E;  2MAB A;  1TQP A;  1BC7 C;  1R9T J;  1FX7 A;  3M3Y J;  5E20 A;  2CFO A;  2DMQ A;  1ZLJ A;  4XIC A;  2QQ9 A;  4XM3 A;  3S1R J;  3HJE A;  2VBX A;  1Z05 A;  1ON1 A;  5E8G A;  3HSE A;  2LMD A;  5GAD J;  2WAQ N;  2JA6 J;  1IRX A;  3ROU A;  1KQ0 A;  2B63 J;  5IOZ A;  3ZQL A;  4IPA A;  4XOT A;  3QPT A;  5EDN A;  1KYZ A;  2DW4 A;  4BKX A;  2LRD A;  1WI3 A;  2D2W A;  1K7A A;  3M9A A;  2Z9O A;  1WJF A;  2IJL A;  1U8R A;  4XOP A;  3KLN A;  3VOE A;  1D8K A;  2EH3 A;  1JJ8 C;  4IJA A;  2K02 A;  3E6D A;  2X6Y A;  1RNL A;  1ETV A;  2MGQ A;  1Y0N A;  3BG3 A;  1FMW A;  2JZY A;  5DEQ A;  4U88 A;  4GGG A;  3AG4 H;  4I76 A;  1I39 A;  1JT6 A;  2A07 F;  4AUX A;  2XAG A;  3S1Q J;  1HDP A;  2DDB A;  2ISY A;  3CUQ B;  3GO5 A;  3V7C A;  1JGG A;  4MEX F;  3JSO A;  2QVO A;  2NNN A;  3S2H J;  1M1E B;  2ZJR F;  2JA2 A;  3ZCO A;  3CCM I;  1A35 A;  3P5J A;  5BQT A;  4AC0 A;  5EYR A;  2LRE A;  1LVK A;  4ZDP A;  3OS2 A;  3A1Y A;  4IVN A;  3F8C A;  4HSR A;  2KMU A;  1OR7 A;  1X58 A;  2GAU A;  2X51 A;  4JX4 A;  1MKM A;  2QZ8 A;  4DYC A;  2MYS A;  1O7F A;  3SHF A;  4ZTF A;  1T56 A;  2XVC A;  3TDU C;  3ML6 A;  3OL4 A;  2R0Q C;  1QVT A;  1GT0 C;  4O5V A;  1LFU P;  4OOI A;  2MW8 A;  3GWZ A;  2IVM A;  2ESN A;  5DCM B;  4MLO A;  4F3Q A;  4UVC A;  4MTE A;  2CV2 A;  2JQ7 A;  1IZ1 A;  3LWF A;  2F4M B;  2LDU A;  4YFK F;  1FZP B;  3QU3 A;  5H2F C;  2K9S A;  2GXA A;  3IHU A;  4Z2Y A;  4F55 A;  2ISZ A;  4PJJ A;  2MD5 A;  4XBF A;  3TMO A;  1K79 A;  4ZJZ A;  1AKH B;  2ME0 A;  2NRA C;  2LTP A;  4KIC A;  2JA5 J;  2M8G X;  1I3A A;  4IL6 C;  2IEK A;  4IQJ A;  2JK3 A;  2XB0 X;  4CCJ A;  1R4M B;  1T0F A;  3B6A A;  5KNL A;  3I0T A;  3TOA A;  2WY7 Q;  3I55 I;  2E1O A;  3DU5 A;  3TKY A;  1R7J A;  5HDN A;  4IRG A;  5KAF C;  3GME A;  5H6R A;  5IYC J;  5IT9 Z;  1D0Z A;  5CQE A;  2DLL A;  3WGH A;  1SMT A;  3FMR A;  1VQ4 I;  4E7I A;  4CHU A;  3DQV C;  4HW0 A;  3QYB A;  1S7A A;  3A01 A;  2X6W A;  2CMP A;  3CCR I;  3ZQH A;  3W6K B;  3VEP A;  3VYT B;  3U1D A;  2H8W A;  2F5E A;  2ZSI B;  1XCV A;  4P96 A;  1QPM A;  3M8J A;  2CQQ A;  3VYS B;  4M6X A;  2ZJQ F;  1FYM A;  4CYC B;  4LB6 B;  5EG0 B;  2H6B A;  3S17 J;  3A0H C;  1FIP A;  3CJT B;  3R0A A;  1UFM A;  1U6G A;  1Z0X A;  1ZYR F;  2D1V A;  2OQR A;  1S7E A;  4L9J A;  1OCR H;  3OYB A;  3PJR A;  4UVB A;  1XCB A;  3JW4 A;  5FFZ A;  3DBL B;  3R6S A;  1GV2 A;  1BJZ A;  2ZJ2 A;  2M4G A;  4R79 A;  2L3D A;  2R92 J;  4BAY A;  3PQK A;  1XSX A;  5E1W A;  3WGG A;  2KZV A;  3WU2 C;  1JJ6 C;  5EZG A;  4AIJ A;  1OFC X;  2LNB A;  5F04 A;  2IXS A;  3K6G A;  1YJ9 I;  4B09 A;  3RI4 A;  4V2F A;  1R1V A;  2CUZ A;  3MKL A;  4D7M A;  2KIQ A;  4KIB A;  3I4N J;  2DA3 A;  1MMA A;  1MBJ A;  4KFC A;  1VQN I;  2XGE A;  1B72 A;  1R5H A;  4KIT B;  2KHM A;  3GBG A;  3FXR A;  4A93 J;  1XX5 A;  4GCV A;  4BS9 A;  2VC0 A;  3GZ6 A;  2PG4 A;  3W2W A;  4C2U A;  3HOT A;  1FPQ A;  4M9S A;  4RB2 C;  3L2Q A;  1BIB A;  3WOD F;  3JRF A;  4BDZ A;  5DUI A;  5CVV A;  4EJV A;  1GHC A;  2PEX A;  4XID A;  3CJR B;  2R93 J;  3A0B C;  3ERM A;  1FC3 A;  2QQB A;  3HKZ A;  1K6O A;  2A5W A;  2ZKZ A;  3DTI A;  4M74 A;  2V6E A;  4FTH A;  2XAQ A;  1OPC A;  1X1B A;  4HBL A;  3TBI A;  3BP8 A;  1SD6 A;  2BOL A;  2FXA A;  2DTR A;  1W0U A;  3D5S C;  1S5L C;  2ZFU A;  3H1C A;  2KL4 A;  2X6O A;  3NQO A;  1Y1W J;  1U0J A;  3RQI A;  3CLO A;  4G8X A;  4XOR A;  4B43 A;  2PI0 A;  2EZH A;  1QGP A;  4WF2 A;  2EIJ H;  3HTS B;  4RGU A;  1YI2 I;  3HYI A;  4AIK A;  1P92 A;  2F5V A;  1KU7 A;  4NC6 A;  3IKT A;  2L9N A;  1V4R A;  2EQR A;  2Z16 A;  2QYO A;  3HOX J;  1RET A;  3KP5 A;  1DPR A;  1FWZ A;  4P55 A;  2VQG A;  4TV7 A;  2O6G E;  1DGW Y;  4XSX F;  2F4I A;  3KP4 A;  4AM3 A;  2EFN A;  1W5S A;  2WA0 A;  1X3W B;  5EJC A;  2BY2 A;  2FOK A;  2KPM A;  3GLL A;  3BR6 A;  4ANJ A;  3GFJ A;  3ZQC A;  3FM5 A;  4HF1 A;  4A3D J;  2R7D A;  5D4R A;  2JPB A;  2M45 A;  4S04 A;  3GXO A;  2BY3 A;  1SFX A;  2ZC2 A;  4RAY A;  4ENJ A;  4F93 B;  4BDY A;  3OOP A;  3DKY A;  4MFD A;  5LRS A;  3HUG A;  1O3Q A;  3V8L A;  4Y33 A;  3CDL A;  1W5T A;  3TDZ C;  3QWL A;  1H8A C;  4BQO A;  5FD6 A;  2R7R A;  4IHV A;  4MNU A;  4YRV A;  3MAJ A;  4BH9 A;  2K9L A;  5EEA A;  1QO0 D;  1HSJ A;  3ISP A;  1Y39 A;  1K4S A;  3S2D J;  4L9V A;  1WKM A;  2CQX A;  2HQ5 A;  1BBY A;  2FQ4 A;  2VE9 A;  1TWC J;  1IXR C;  1OR7 C;  3MKW B;  4WK8 F;  4BE1 A;  3I3L A;  5DM6 F;  1FP2 A;  2M7B A;  1FOX A;  1MBF A;  1X3U A;  3T8T A;  3BG5 A;  1HKT A;  1TLH B;  1S8N A;  2GOX B;  2HKX A;  2QF7 A;  1ZAO A;  5M3M J;  3HHG A;  1H0M A;  2FRH A;  4Q4Z F;  2JJ7 A;  1B9M A;  3RQ4 A;  3OY9 A;  2FUG 2;  4Y13 A;  2CO5 A;  2G9W A;  1BR1 A;  2V1U A;  4IX7 A;  3ASN H;  1XDS A;  1ZK8 A;  4RGR A;  1O4X A;  4HLX A;  1RR8 C;  2OZ6 A;  4YIR X;  3H5R A;  4AYB A;  3KP2 A;  3G4S I;  4XL9 A;  2TCT A;  4U7B A;  1MBK A;  4P9F A;  4BQA A;  1I27 A;  3WG7 H;  2HTJ A;  3V7S A;  2M5W A;  3QPL A;  1B9N A;  2DI3 A;  2CQN A;  1IO2 A;  3WHB A;  5D4S A;  1WJA A;  2F5D A;  3P9C A;  1W36 D;  1PUF A;  1I3Q J;  4G94 A;  2XGC A;  2KKO A;  2PMZ N;  4ITV A;  1B4A A;  2QKM B;  4K2E A;  1T0F C;  5FD5 A;  2HPM A;  2BXZ A;  1YW7 A;  1X1P A;  2FML A;  3FMQ A;  3JRH A;  1XMX A;  2Y0S N;  1KQ9 A;  2EA2 A;  2EFQ A;  4E7S A;  1DU6 A;  5L3F A;  3F3X A;  2L9S A;  3HOS A;  2DPU A;  5LGT A;  1G4D A;  4UVA A;  3R60 A;  3BWG A;  3O2P E;  1GDT A;  2NVT J;  2V1N A;  3P7N A;  3TED A;  3AG3 H;  5ILU A;  2CRG A;  3DEW A;  2YU9 J;  2VQC A;  2CFX A;  1POG A;  3RPQ A;  3MZ8 A;  2LR8 A;  2QBY B;  1JHH A;  2H94 A;  1IDY A;  3CCJ I;  1FOK A;  4HNV A;  1TTY A;  2FD5 A;  1EH8 A;  4N9I A;  3QPH A;  1LJ9 A;  3RKQ A;  1MDM B;  1IRF A;  3H9Q A;  3QOE A;  3SFZ A;  2EV0 A;  2P7C B;  1FOW A;  2O5R A;  4II3 A;  5E3M A;  3J80 Z;  1Y6I A;  3CO6 C;  1MND A;  3R0J A;  3SFI A;  4DOZ A;  3OS0 A;  4L9T A;  2IS4 A;  1KA8 A;  3OS1 A;  4XRM A;  1NTC A;  3TW7 A;  4EMS A;  3BDD A;  3OMY A;  3GFI A;  2VI6 A;  2CJJ A;  3I4M J;  4CCM A;  2XF6 A;  4WCG A;  3K70 D;  2CWE A;  4XN0 A;  1OJL A;  3K1N A;  3TOB A;  1HW1 A;  4A5M A;  2YS9 A;  5J6X A;  4E7H A;  2VKV A;  2UXX A;  4BYY A;  2DJN A;  2DFE A;  3KFW X;  3OIO A;  5CQG A;  2VC1 A;  4DJA A;  1IUF A;  4IHS A;  1S72 I;  1MD0 A;  3C2G A;  2MC3 A;  2JA7 J;  2R5Z A;  1V5F A;  4UB6 C;  2V9P A;  3L2V A;  1UHW A;  2EJR A;  3W6V A;  1ZRD A;  5IY5 H;  3KZI C;  3DBR B;  2A61 A;  1V54 H;  1I6X A;  3CJQ B;  4PGH A;  1W1W E;  2Y31 A;  2OJE D;  1FT9 A;  2P5V A;  3LAJ A;  3PSI A;  3BR5 A;  4C30 A;  3OR2 C;  3AL0 B;  2OV7 A;  2VB6 A;  2QQA A;  2CUF A;  4Y3O A;  2BY1 A;  5KCM A;  1XGO A;  4M9X A;  1QHG A;  3I4P A;  4UUV A;  3S3O A;  3FBI B;  4QLC U;  2IGO A;  4A0X A;  4HX4 A;  2DK5 A;  3CCE I;  2K9Q A;  4M6V A;  4Y15 A;  3OYD A;  2MG4 A;  2AHQ A;  3EET A;  1FBS A;  2DO7 A;  2FU4 A;  1H9T A;  3P9K A;  5CYV A;  3W2V A;  2BE5 F;  1YE9 A;  4EAT A;  4R8H A;  2BVM A;  2HOS A;  3H9G A;  2J5O A;  2ZME B;  1Y8Q B;  3OYN A;  3HZJ A;  3FXM A;  1U5T B;  4BHB A;  3DF8 A;  4YG2 F;  1AHD P;  1LFB A;  2B9S A;  2CW7 A;  3OIP A;  1WFX A;  2DMT A;  3DFG A;  2RKH A;  5E1Z B;  3HOZ J;  4M6Y A;  2LBF A;  1P4W A;  1SVL A;  1DP3 A;  1N75 A;  2QSH X;  4QSH A;  1WI9 A;  2VLA A;  5DDG A;  3I64 A;  5A2Q K;  5EF6 A;  4ESB A;  3FXQ A;  1OIS A;  4IHX A;  1NG6 A;  2KRC A;  4J19 A;  2FBK A;  4F91 B;  1P4X A;  1W7P B;  1J5Y A;  4OAY A;  3WE2 A;  3M4O J;  3S16 J;  3GZN B;  1G3W A;  4FCY A;  3X2Q H;  4CCK A;  3LSP A;  1OCP A;  1MJB A;  3Q0V A;  1UAA A;  3EYI A;  2HR3 A;  1PYV A;  1AA7 A;  2R7Q A;  4Q47 A;  4D5F A;  2R5Y A;  4HDV A;  4CCL A;  2R7X A;  1P2F A;  1YW9 A;  1YYV A;  2DTZ A;  2L4A A;  2XPV A;  3K10 A;  4CA0 A;  5C4X J;  4JX5 A;  2IRF G;  3SZG A;  3WTS C;  3T8R A;  3CUO A;  2TRT A;  4B4C A;  4BU2 A;  3OYE A;  1GLN A;  1VND A;  1KON A;  2K40 A;  3KE2 A;  4XLA A; 
#chains in the Genus database with same CATH homology
 3ESW B;  1TP4 A;  1X3W B;  2F4M B;  2QSH X;  1X3Z B;  2F4O B;  1PVE A;  1OQY A;  2QSF X;  4YIR X;  2QSG X;  1QZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...