2CQXA

Solution structure of rsgi ruh-034, a homeodomain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
b'GSSGSSGGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVRKIQCWFRHRRNQDKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LAG1 longevity assurance homolog 5
publication title Solution structure of RSGI RUH-034, a homeodomain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 72
sequence length 72
ec nomenclature ec 2.3.1.24: Sphingosine N-acyltransferase.
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cqxA01
4J19A 1U78A 1MSFC 2HOAA 2W48A 3JR9A 2MSYA 5FKNA 3JRDA 2LKXA 3HOVJ 2O9LA 4XICA 4CYCB 3HGYA 4IHWA 3IH3A 1RKTA 1WH5A 1RR7A 4D5CA 1GUUA 4B4CA 4DYRA 1X2NA 2HYJA 1TC3C 1JT6A 4JX5A 3GTQJ 3HOYJ 3ZQFA 4M3FA 5J1YA 2DTZA 2Y31A 2XB5A 1VNDA 1ORKA 3LSGA 2OPTA 2AHQA 2JN6A 4ABZA 4QIWN 3F0CA 3S16J 1TWAJ 1U8BA 3SJMA 1MBJA 4A3FJ 1JKPC 2DA3A 5K7HA 2XRLA 3WHBA 3BQZA 3A01B 1DU0A 3IH2A 4BBSJ 2Y9YA 3BTLA 5GP9A 5JLWA 1F36A 1IJWC 5EZGA 4Y52J 1XC5A 1ZTRA 2ZB9A 2JK3A 3JRCA 2VKVA 1IUFA 3JRAA 1HOMA 2FQ4A 2MG4A 5EF6A 2LR8A 4X6AJ 5F0HA 3RQIA 3Q0UA 2B63J 5FJ8J 4JX6A 1T33A 3DCFA 1UMQA 2P81A 1NK2P 1BL0A 1P7IA 1FIPA 1AKHB 1RETA 3PO3J 1B72A 4IHVA 3HGGA 3GTMJ 5EGOB 3GTJJ 2H1KA 3S17J 1D5YA 4XK4A 4IEJA 1MSEC 1B8IA 5IPAA 4BKXA 4D5FA 2JWTA 4NDLA 2PMZN 4DYCA 5J1UA 1MBHA 1RKWA 3B6AA 1U9OA 4M6VA 2COBA 2LK2A 1ZQ3P 4MLOA 3QQAA 3JRGA 3LSRA 3JRFA 3ZQIA 3QPSA 3M4OJ 2Y9ZA 5IYDJ 5FLVA 1TWCJ 1SANA 4I6ZA 2NVXJ 2K9SA 1JKOC 5E3OA 2DMUA 3S1NJ 2R92J 4DYQA 3ZQLA 2L7ZA 3LSJA 5BNGA 2DMPA 3HOXJ 2TCTA 5IP6A 1IRZA 2HQ5A 2VKEA 2ECCA 5IP7J 1HCRA 5FKOA 3BQYA 5FKLA 2WB1N 2XGCA 2X48A 4FCYA 1DU6A 4UUTA 3S15J 1K83J 4BBRJ 2E2HJ 1JUSA 3HOWJ 1MBFA 1Z77A 3S2DJ 3HOUJ 3O8HA 4JYKA 1HF0A 3HB9A 2IEKA 1ETVA 4JP0A 1ZR4A 3RZDJ 1TWHJ 4A3CJ 3JRIA 3A02A 1MBEA 2DA6A 2CJJA 2LY9A 5M3FJ 5JLXA 3ZQHA 1LE8A 4M3BA 3JRBA 2HI3A 3L1PA 4S0HB 2KDZA 2IAIA 2R7ZJ 3FISA 1BJZA 1ZK8A 3CDLA 3C2BA 3BG3A 1APLC 1JTXA 5HODA 1ITYA 2CQXA 1WPKA 2XPUA 2XPVA 5EG0B 5M5XJ 3CMYA 1WH7A 4GFBA 4FISA 3PO2J 3ZOBA 4C3JJ 1LFUP 2E19A 1BW5A 3PM1A 2QF7A 3GTPJ 2LD5A 1MH4A 3BTCA 1TWGJ 2LTPA 3CQZJ 2JMWA 2DA4A 2VUMJ 2NVTJ 3RZOJ 2Y30A 2XB0X 3BR2A 5EYRA 4UUSA 3FK7A 2HXOA 4FE4A 4C3IJ 5EG0A 3BG9A 5C44J 4QTRA 5E3NA 2M0CA 2O8KA 5C4JJ 1IC8A 1T56A 5IYBJ 2JA6J 5FKKA 1B72B 4XRSA 4AC0A 1YRNA 3M3YJ 2R5YA 5J1RA 3HM5A 1B8IB 1H88C 1HLVA 2VI6A 4MIMA 5E3MA 3OSGA 2FD5A 4QSHA 3JREA 3HOZJ 1PUFA 2LVSA 1O4XA 2HXIA 5IOZA 1CQTA 3W6VA 4A3LJ 1F43A 1A5JA 4MFEA 1I6HJ 3G1LA 4G12A 1ZR2A 2NOGA 1QVTA 1JUPA 3MKLA 1QRYA 1XG1A 2DA7A 2M34A 2DA1A 3BR1A 3OIOA 1A6IA 4RDUA 4A3KJ 3CCYA 5F04A 2JA5J 2GLOA 5F27A 1Y1VJ 2KT0A 3S1RJ 2EZIA 3HBLA 4W97A 4HNVA 4A3IJ 3GTLJ 1RPWA 2HDDA 3BR3A 4FTHA 5F1JA 1W0UA 3D1NI 2R5ZA 3SDGA 5C4XJ 4RBOA 2CUFA 3QPLA 1ZKGA 2OF7A 4XRMA 1G2HA 1GT0C 3Q0VA 1WCMJ 2CRGA 2ID6A 4DZJA 3I4MJ 2NVYJ 3UKGA 4A3BJ 3BR6A 2EZKA 4A3EJ 1AHDP 1OFCX 3B6CA 4L5EA 4D7MA 3LNQA 3ZQCA 1Y1WJ 1LE8B 2R93J 3LOCA 4X1EA 5C3EJ 2E2JJ 5FKMA 4MFDA 1JUMA 2DJNA 2DN0A 1U9NA 2EBIA 4M3EA 1UG2A 1HDPA 3IV5A 4A3MJ 1QPIA 2N8GA 4A69C 3K2AA 3H3VK 4B1RA 3G1OA 5IYCJ 3DEWA 3SFIA 1UHSA 4EEFG 4BY1J 1FEXA 5EZHA 3GTKJ 5F0CA 2XPWA 2L9RA 2ME6A 1GV5A 4AUXA 1JJ6C 4D7NA 3OSFA 2ECBA 2LP0A 1IGNA 1FJLA 3WHCA 2MW8A 3E7LA 1H8AC 2FJ1A 2XGEA 1FTTA 2DMNA 4UUSB 5M5WJ 3BTIA 3S1QJ 2JA8J 1MBKA 2GBYA 2NS7A 1WGXA 2IBDA 1IDZA 5DS9A 5EDNA 2CUEA 2XSDC 5M5YJ 1YRNB 3A03A 5IOYA 1GVDA 4M3DA 4B3AA 1ETWA 2R5YB 2R0QC 1JT0A 2E1OA 2JA7J 1Z0XA 1OCTC 1I3QJ 4LOCA 5E3LA 1XS9A 1PUFB 1Q1VA 2K9NA 1BA5A 3IH4A 2E2IJ 2M2EA 2O7OA 1JTYA 2G0EA 1H89C 1GV2A 2WAQN 3O8GA 2QCOA 5K7ZA 1AU7A 2ME0A 2LFBA 1QVUA 1VF9A 2I10A 4XIDA 2L7FP 2M9HA 1E3OC 3BT9A 2Y2ZA 1NTCA 3GBGA 4IHXA 3S1MJ 4CYCA 2YUSA 1LFBA 2LLKA 3MN2A 3NARA 3RKQA 5IP9J 2FX0A 9ANTA 4A3GJ 2GM4A 1JJ8C 2R5ZB 3OOUA 2DMQA 3FK6A 2L0KA 3VPRA 3S14J 1MBGA 2X6OA 5GPAA 3HEFA 4MO7A 2H8RA 2EQRA 2WV1A 3TW6A 2L7MP 4C2MJ 2VPRA 2CU7A 2HOSA 1JKQC 1JGGA 2Y0SN 4BY7J 2K9QA 3GTOJ 1JKRC 3A01A 2ELKA 4V2GA 1TWFJ 1ETYA 1POGA 1W0TA 1OJLA 2JJ7A 1FTZA 1ETXA 1OCPA 1WI3A 2CQQA 3FKIJ 3NAUA 1X2MA 5M3MJ 3K7AJ 4DW6A 4IHYA 3BR5A 2EH3A 5GPCA 2RAEA 1K61A 1MNMC 2DA5A 3HKZN 4M3GA 5F08A 3TW7A 4V2FA 3BG5A 1S7EA 4A3JJ 1P7JA 5J3LA 3I4NJ 1ETOA 2AO9A 1AKHA 2XGDA 2EZLA 1SFOJ 3Q3SA 3TP0A 2M8GX 3ZQGA 5EGOA 4BXXJ 4XRSG 2EZHA 4A93J 1ZGWA 4W1UA 1EF4A 2X9DA 4C3HJ 3LSPA 5K7FA 3MVPA 4I76A 1X58A 1RESA 3FIWA 1I50J 3BR0A 2ID3A 4JX4A 2TRTA 2YU9J 1BW6A 3GTGJ 3H0GJ 5DTDA 2DA2A 4FE7A 2NS8A 3HDDA 4DZPA 2NVQJ 1VI0A 2DMTA 1GDTA 1HDDC 5F0FA 3Q0WA 1VFCA 1IG7A 2YS9A 1R9TJ 3S2HJ 3BTJA 2MGQA 3G1MA 3JRHA 2D5VA 1IV6A 4Y7NJ 1FIAA 1ETKA 1ETQA 1IDYA 1MH3A 2K40A 1NK3P 3TEDA 2HOTA 4A3DJ 5FLMJ 3TP3A 5EEAA 4AYBN 1ENHA
chains in the Genus database with same CATH superfamily
3CCUI 2V6EA 2HOAA 4XLAA 3JR9A 2PEXA 5D6EA 2OZ6A 3HOVJ 1T0FC 1MDMA 3HGYA 3EPZA 2OV7A 1LEBA 1IV8A 4A0XA 4B4CA 4DYRA 3R0JA 1Q1HA 1D0XA 3MWMA 3OWTA 3KIOA 1DUXC 2LREA 3PJRA 2X4HA 3B73A 4BEHB 1J9IA 2Y31A 3J7YJ 2XB5A 4FT8A 4YFNF 3RKXA 1ORKA 3LSGA 2WWYA 3FXOA 2VJJA 2R7UA 3FXLA 4GO1A 4M9ZA 3AKZA 2ZMEB 1JKPC 5ILVA 4KT5C 3ERED 5HLTA 2XRLA 2IS2A 5D4RA 2R7DA 2J5OA 1N75A 3E0JB 3VYRB 4A0ZA 2WTEA 3QPTA 1T38A 3HYIA 2F5VA 2F5EA 4R1HA 4U0YA 3ZMZA 2RNGA 1XC5A 1FBSA 4IXAA 3LSMA 2QSGX 3RI4A 2VKVA 3BZCA 3IL2A 4QPOA 3F8MA 1E3HA 1UHMA 2ELHA 3TL4X 2DYSH 3RQIA 4P5OA 3Q0UA 4BACA 1T33A 3DCFA 1XD7A 1XDUA 4UVCA 2RGVA 2LKSA 2DYRH 2M30A 4U0VA 5F6FA 3TKYA 5LBQA 2OQGA 4IRHA 3RKWA 2ISZA 4BE2A 1YI2I 3GTJJ 4M72A 1X1BA 2XVCA 2GAUA 1D5YA 1GHCA 1B8IA 2W85A 2V9VA 2L7KA 4EGZA 2L2OA 2Z33A 1REPC 3KP4A 3J81K 4NDLA 2PMZN 1XCVA 1RKWA 1ZHFA 5LRRA 4B3XA 5ICCA 1X19A 2ZMEC 2COBA 4BE0A 2IS1A 3M9AA 2PJRB 4IRGA 3ZQIA 1SVLA 3M4OJ 1XGOA 5IYDJ 3J80K 3CC4I 1TWCJ 2B0LA 1JKOC 2ISYA 2JUCA 3FXMA 2DMUA 3ASNH 2R92J 3DLAA 3LSJA 1IN7A 2FBIA 2ZXHA 3CJTB 1Z3XA 3HOXJ 2TCTA 1IRZA 1Y39A 1WFXA 1QO0D 2M4KA 5LHGA 5GADJ 2XGCA 1U0JA 4FCYA 3BZ6A 5L3BA 1MBFA 2WA0A 2I5UA 1Z77A 2CW0F 2E34A 3HOUJ 2LMDA 4PJLA 3OL3A 2VQHA 5FFXA 1ETVA 3KZIC 3TQNA 2C6YA 3RZDJ 1OISA 3KP7A 4BJTA 1F5TA 5FD6A 4L5JA 3REOA 3ZQHA 1SFUA 5E79C 2DDAA 2V79A 3FDYA 5E8IA 2R7ZJ 2GQQA 3W6JB 1V4RA 3CDLA 4LLLA 3WGIA 1J75A 3OOPA 1RZ4A 4UV8A 4EJUA 2O0YA 4BJ6C 2CQXA 1D1AA 2Y48A 1WPKA 5EG0B 5M5XJ 2E7WA 2Z5UA 2K3PA 3DTEA 4ZTFA 5JVTA 2PJPA 1PP8F 1BW5A 1TNSA 4RLQA 4O6JA 2DK8A 2LD5A 3C2HA 2X0LA 4PJNA 4HX8A 4TV7A 1YE9A 2OCEA 3W6KB 2RKHA 2EB7A 3ML6A 3ZP5A 3E5XA 2OZUA 3FK7A 2HXOA 4AWXB 5CVVA 2KZGA 4CCJA 3E1SA 2FF4A 3CF5F 3HC7A 4YFKF 3OYGA 4B44A 1QBJA 3S3MA 1PYVA 5E3NA 3IWZA 3Q9VA 1R5ID 4ZTJA 1LVAA 3BWGA 5LEJA 1LNWA 3BZKA 1K79A 1UHWA 2VQCA 1YRNA 2VLAA 2K7LA 3L9FA 2RQPA 3M3YJ 4J00A 2GA1A 1H88C 4KT6A 2RN7A 3MQ0A 4QSHA 3JREA 1PUFA 2LVSA 1O4XA 3FXKA 3W6VA 1F43A 3AG4H 4MFEA 4CDGA 5DUKA 2STWA 1V5EA 4G12A 3H5AA 4LMYA 4UUVA 4LFUA 3QP6A 4FETA 2MH9A 4BQQA 2ZJQF 5DCMA 3V8JA 1VQMI 5D4SA 2M34A 3OV8A 3IKTA 3C18A 1ZLKA 2OD5A 3R4KA 1FBQA 2CFXA 3H35A 1VQ4I 1TLHB 1WJFA 4RS8A 1XSDA 2H27A 2CYYA 2GLOA 2Y75A 5F27A 1X1CA 2ICWG 4HNVA 4A3IJ 2K85A 2B9SA 1R1TA 3TDZC 2EFWA 2R5ZA 1K78B 3SDGA 5C4XJ 3DP7A 2NOJB 4RBOA 2CUFA 2QQBA 2EILH 3QPLA 4AIHA 1G2HA 2QEXI 1Z6TA 1X3ZB 3UR3C 2EV0A 3I9V2 5H2FC 5HNHA 1U6GA 3EUKL 1TNTA 4CCNA 1ZG1A 4GXOA 3BR6A 2EZKA 3CCLI 4A3EJ 1AHDP 2LF7A 3B6CA 3DWLE 3P9IA 2G7HA 4L5EA 4D7MA 1LE8B 1JHFA 5GAEJ 5C3EJ 1JUMA 1FNNA 2DJNA 1G59A 5ILSA 2XROA 4M3EA 3LSKA 1MZBA 4HF1A 4PDKA 2X1DA 3HTUA 5E1ZB 3V8KA 1QPIA 3J7AO 1IUYA 4OOIA 4DBRA 1HQCA 1WVRA 1LKXA 1RNLA 4BHCA 2BBYA 2XAHA 4FASD 5J8FA 2QQ9A 3DEWA 4L9NA 1ZYRF 2ADUA 2P7VB 1I3AA 2CW7A 2WAQA 4IOCF 5EZHA 1SD5A 3OIPA 3DBHB 2XPWA 2L9RA 2ME6A 4AUXA 3OS0A 4D7NA 3LA3A 2OCCH 1IGNA 2EWNA 3WHCA 5DCFA 2VC1A 1W5SA 4ON0A 3WG7H 3M1EA 3ZQQA 2O8XA 5KCMA 1T6SA 1FPQA 2HFHA 3BTIA 3KYCB 4L0YB 3F8NA 2KJCA 2GBYA 1NH3A 2IBDA 1R4NB 3FF5A 2EA4A 5LFAA 3PSIA 2XSDC 4L9JA 3A03A 3RSNA 5K5QA 3C1DA 1GVDA 4L18B 3RJPA 4CCKA 2O6GE 3Q9SA 1X1PA 1KU7A 1JT0A 4PUSA 3KYLA 1ZREA 3DEEA 1E2XA 1I3QJ 5E3LA 3CUQB 2F5DA 2DT5A 1FOYA 3F8BA 2DTRA 2E5NA 1KQ9A 2R7OA 2Y0SA 3E6BA 3IH4A 3K4LA 2E2IJ 2M2EA 2XF7A 4GYGA 2O7OA 2J5PA 2A07F 3PL8A 1VTNC 4EQQA 4A6EA 4U87A 2AXTC 1W4MA 1E0EA 2QCOA 5K7ZA 1P4XA 2XAUA 1W5TA 1YS6A 2KIFA 5FFZA 1LPQA 2BGCA 4LLNA 1NG7A 1SD6A 3LQRA 1LVKA 1IN5A 1NTCA 2RREA 3GBGA 3K4NA 3CMAI 3MN2A 1G6NA 5DV5A 2FX0A 2WADA 1VQKI 3WTSC 4AIKA 1FP1D 4HOBA 4E7SA 3T1BA 4ZYEA 3J80Z 4HRIA 2HR3A 3H1CA 4F92B 2ZCWA 3I71A 2DMQA 3S32A 2M45A 3QPHA 3O6BB 3S14J 4GDFA 1USTA 2W4SA 4C2UA 2IA0A 4ZZDA 2PG4A 4CUGA 4EJVA 3TW6A 4XQFA 4XR6A 3JW4A 1SAUA 4PJ0C 3HXLA 1SC7A 1LDKB 4M74A 2BOLA 1JKRC 4CCLA 3A01A 2KIMA 3LFKA 3CUQC 1WJBA 1FSHA 2V1XA 1OJLA 4E7LA 4ANJA 1H9GA 4NB5A 2Q2EB 1XPXA 2QBYB 1Z6RA 1BI3A 3FKIJ 4C30A 1J5YA 5M3MJ 2VKDA 4KMFA 2EH3A 2Z16A 1FX7A 4ZYDA 1BIBA 4NHJA 1EJ9A 5L3EA 3HKZN 3FMSA 3T8RA 1U3EM 5F64A 2DI3A 3TW7A 4IO9F 4RB0A 1QNTA 4A3JJ 1P7JA 3OS2A 1IN6A 3DKYA 2ZJPF 4IVNA 2CGPA 2HNHA 3DXJF 3I59B 2PFBA 4PJJA 2A05A 3K4JA 3CUOA 4HX4A 2K4JA 2L54A 3K1PA 4BXXJ 2LOOA 3I56I 2F2EA 2CQNA 2XAFA 2EZHA 1ZGWA 2DOFA 4W1UA 4RB1A 2CQKA 5K7FA 2YPRA 3MVPA 3H5RA 1X58A 1YLFA 3CO6C 2TRTA 4KIFA 4AM3A 2R7SA 4GRIA 4IJAA 2MABA 1T8IA 5CQEA 4FE7A 2NS8A 2G9WA 3JAMZ 1YS7A 2YU3A 1VI0A 3DTIA 3WG9A 3BDDA 2QKLB 1ZGJA 5EJCA 5DUIA 1VFCA 5TJJA 2YS9A 2EINH 4F52A 3CF2A 3IHUA 1BOAA 3G1MA 2FMYA 3JRHA 1IV6A 1ETKA 4RB3C 4MTEA 4PZJA 4KUMA 1QU3A 1X1AA 2HEOA 1Z21A 3E6MA 5B5EC 2F4IA 4HDUA 1G4DA 5FLMJ 4P55A 1IZ1A 1GLNA 4CZZA 1ZRDA 1ENHA 2MYSA 1U78A 2VONA 4BYYA 6PAXA 4M9XA 2VXDA 3I58A 3A1YA 2R7QA 3JRDA 4IHWA 4XICA 4CYCB 4BUPA 2YR2A 1D1CA 1RKTA 2E7XA 1RR7A 4IQ4A 4D5CA 3G71I 3OR1C 2IGKA 4HW0A 1O3RA 1G3SA 1Y8QB 2HYJA 4WWCA 3GFIA 2QYOA 1TC3C 4JX5A 3GTQJ 3HOYJ 2DT6A 3BLYA 3MEXA 3SDBA 3BP8A 1QZEA 2LBFA 5J1YA 1AA7A 2EV6A 3DLLF 4FX0A 1VNDA 3HPHA 2JPCA 3D5LA 1MMGA 1S9HA 4EM1A 3ONQA 2LG4A 1TWAJ 5FRMA 3R61A 1OMIA 1V3FA 1MBJA 2D2WA 2KHMA 1Z67A 4LJZF 3SQNA 2DA3A 4DNCA 1F1ZA 1JE8A 3CJQB 3V8LA 2CMPA 3CESA 1CF7A 3DFGA 3E6DA 5ERIA 3KYDB 3J7ZI 2R7VA 2PMZA 5HLHA 2Z2SB 4WXDA 3QOEA 4G7OF 1FMVA 2Y9YA 1S29A 2K4BA 1ZARA 1F36A 4L9TA 1YOVB 3K69A 3GFMA 2ZB9A 2YX7A 3JRCA 1IUFA 1MJBA 4QWQA 5EEHA 2FQ4A 2YSRA 2VBYA 4AU7A 4BU2A 2LR8A 4ETSA 3L2VA 4IPAA 1R23A 3ROUA 3PQKA 2B63J 3CC2I 4JX6A 3W3CA 2KL4A 2RV8A 3DBRB 2F4MB 1NK2P 1FIPA 2UV1A 1Y56A 2XGXA 3DV8A 1AKHB 4FQGA 2KMUA 1F9NA 1U8RA 1EH6A 4Q48A 1X3UA 4IHVA 3HGGA 3J7AY 4GGGA 2XKPA 3HSFA 4Y33A 4D9JA 4N4OB 1G3TA 4PSXA 4D5FA 4PFOA 4LIVA 3H36A 3KX2A 2JWTA 1S72I 2CW8A 4DYCA 2ZFWA 3QQAA 3JRGA 3MKWB 1RR8C 3WE2A 2M87A 4XRFA 4G8XA 1SFXA 3DEUA 2K9MA 5FLVA 2JSCA 2PMUA 5HDGA 2NVXJ 1FOWA 3S1NJ 4YFXF 4OWRB 3EUHA 3ZQLA 1OCZH 2LRDA 3ABMH 1MMSA 3MKZA 3KEQA 3SZGA 5IP6A 1OR7A 2BVLA 1BR4A 2VKEA 4NC6A 1P4AA 1IRXA 2B7EA 5IP7J 5FKOA 1DU6A 1L0OC 2X48A 5CVUA 4A5NA 2GWRA 3WU0A 2IGNA 4UUTA 1P4WA 1K83J 2L9VA 4JQFA 5ILUA 2QM3A 4OAZA 1X4PA 4HLYA 2AXLA 1K6YA 3S2DJ 4OINF 3LL7A 2DQRA 4E4HA 4N9IA 2XAGA 3F9KA 5HS8A 2IEKA 4XSZF 4CZCA 1KU2A 5BQTA 3LSHA 3D5SC 4WF2A 1ON1A 4RGRA 3L2QA 3EYIA 1O7LA 4C2TA 4A3CJ 3JRIA 2VJ5A 3F6VA 1I1GA 2ZXJA 2QQ8A 1MBEA 2HGCA 2DA6A 3HUGA 2CJJA 2ZNYA 2IA2A 3JRBA 2LNBA 3OYNA 4I2OA 2KDZA 2A5YB 2IAIA 1SVMA 3FISA 4H4KC 1BJZA 1ZK8A 5HLGA 3MZYA 3QYFA 3T8TA 1R00A 5CVJA 5KAIC 1J7KA 2XAQA 1S5LC 2DQLA 2GIZA 2V4JC 2DXIA 4CCOA 3PO2J 4RM3A 3PM1A 2LC2A 2LKPA 3KEOA 3ZPLA 3HIFA 2QF7A 3GTPJ 4HX7A 2ZFUA 1MH4A 1TWGJ 3OYLA 2LTPA 3CQZJ 1R1UA 2KRHA 2JMWA 4HG2A 1WSUA 1XDSA 4RB2C 1J0RA 4O5VA 3FM5A 4YG2F 4L5IA 4M9SA 4UUSA 4C3IJ 3ZR8X 5DYMA 1D8KA 3GLXA 3HHGA 2A61A 4HV6A 5E20A 5IYBJ 4KYWA 1B72B 3G6EI 1DGRM 2P8TA 4XKVA 2HOEA 3OY9A 4NC8A 4PSWA 4ZDOA 3OSGA 4EM2A 2FD5A 3HOZJ 2H6BA 3IRQA 2QSHX 5IT9Z 3NWSA 5IOZA 5A2QZ 1BR1A 3ZQ7A 3E3VA 3ZCOA 2BW3B 5CVRA 3WU2C 2FEZA 5E18F 4YIFA 1W7PB 1R49A 1JUPA 2MH2A 3MKLA 1QRYA 2UZKA 2EJRA 5ICGA 2W25A 3IAM2 3CCVI 4U7BA 1TP4A 2R7XA 5J4YA 2VPLA 4HNTA 4BHPA 1L3LA 3ZRGA 3RYRA 4OIQF 1X1DA 5DDGA 3PFYA 3O3KA 1S7AA 2K86A 3IAS2 4M6YA 2OAZA 1XCBA 2QZ8A 1Y1VJ 1JHHA 1IRFA 3OS1A 1JGSA 2K02A 2WC2A 2P7CB 1RPWA 3DKWA 5F1JA 1UB9A 2UXNA 2M8EA 3D1NI 1W0UA 2ZXWH 2KISA 5LEKA 3CTAA 3H92A 4GYIA 2Y69H 5ED4A 3GO5A 1HSJA 1R1VA 1YFHA 2GXAA 5DM6F 3ZMDA 2ID6A 5H6QA 3I4MJ 1I5ZA 4MGRA 4G6QA 2VJIA 2NVYJ 3K10A 1LDJA 3OYDA 3MCZA 1Z91A 2JVHA 2IGOA 2L3DA 3V7RA 3LNQA 4PGGA 3ZQCA 1Y1WJ 2R93J 1SEUA 4X1EA 2E2JJ 2FA5A 1J2XA 2EFOA 1BN5A 2NRAC 3QU3A 1Y0UA 3DF8A 4BQNA 4ZH4F 1R5HA 4E7ZA 4OU0A 3M8EA 3IV5A 4A3MJ 2N8GA 3E97A 1IN4A 2W7NA 3VFZA 3H3VK 2JUGA 2HDWA 5HVQC 4KIGA 2K27A 3G1OA 4O3MA 5HS9A 3H9GA 2W1OA 1UHSA 1T0FA 1Z05A 4B8XA 3OYIA 4BY1J 1FEXA 4CXFA 1WJEA 3GTKJ 2FOWA 2X6XA 4LLGF 4OMZA 5F0CA 4CH7A 1GV5A 3CP2A 3SFZA 4BXUA 3FXQA 2ECBA 2LP0A 1IW7F 4LG0A 3DU5A 2BEOA 2NYXA 4RAGA 1TL8A 2IJLA 1FTTA 2P0WA 3CDIA 1WJAA 5HDKA 1T95A 4P96A 1B9MA 2JA8J 2HTSA 2NS7A 1IXCA 1WGXA 1ONVA 4UY8I 3P7NA 2F5CA 1LJ9A 2CUEA 2KQRA 4EJTA 3H3ZA 2F6CA 4F3QA 4M3DA 4B3AA 2R5YB 1DP7P 2E1OA 4HV5A 1SAXA 3WTXC 2JA7J 1Z0XA 4EV0A 3G2BA 1XX5A 1UZCA 3JTGA 1GXPA 4D1QA 3VB2A 2PX9A 2K9LA 2CV1A 3CCEI 2EFPA 4Y4RA 3JAMK 2A69F 5GTIC 1TT0A 4IL6C 1O3SA 3F8CA 3CCQI 3N97A 5LD2C 1VZ0A 3CCSI 3VYSB 3FXUA 1AU7A 3VOEA 4IHTA 5BS6A 2KIUA 1HKQA 2V1DA 4QLCU 3PUBA 4I01A 4UVAA 5K5OA 4MNUA 2M9HA 1E3OC 5DD4A 2QGUA 3HTSB 2Y2ZA 2JPBA 4IHXA 3M1CA 3GEZA 3RKQA 2MA3A 3NARA 1W36C 1TT5B 3HKZA 5IP9J 2GM4A 4MTDA 2P6TA 1YW9A 5CYVA 3LAJA 4IOAF 1E17A 4BEHA 4PCQA 1NHAA 4IKFA 4WCGA 3E5QA 5AIPA 3VYUB 3FBIB 3FZVA 2K3FA 4HLXA 1YJNI 4MO7A 3OYCA 2WV1A 2L7MP 2ZMEA 4YIIA 4C2MJ 2VPRA 2CU7A 2HOSA 3CZ6A 5B1BH 4V2GA 1G3YA 1POGA 1W0TA 2JJ7A 1FTZA 3FXJA 2EA2A 1UCRA 3V42A 2HYFA 1Z7UA 1Y0NA 1LDDA 1OCPA 1VQ8I 4EATA 2CQQA 5JI6A 3P5JA 2Z3YA 3K7AJ 4IHYA 3BR5A 4LG3A 1ZG5A 1I27A 1WJDA 4G6TB 2PI0A 2AQEA 3CLOA 2DA5A 2IRFG 1RI7A 1T98A 2XV4S 1AOYA 4M3GA 5LLQA 3MZHA 2TDXA 1Z3YA 3K4BA 3HL2A 3BG5A 5J3LA 4BH9A 3L09A 2BY2A 2XGDA 5AONA 1TZLA 3W2AA 3RTRA 3QP5A 3M7GA 5CPRB 1SFOJ 2LDUA 5KVRA 5KNLA 3TP0A 2DOAA 2M8GX 1FWZA 3AG3H 2JTVA 3H9JA 3BY6A 4KMUX 2LY2A 4XRSG 2XSJC 4CHUA 2KLOA 1UG0A 4Y15A 2VN2A 1HC8A 4X0GA 2WY7Q 5CJ9A 3ECOA 1UELB 2HQRA 4IRIA 4I76A 2PBIA 2HZDA 2ID3A 4JX4A 2YU9J 1EH7A 3H0GJ 4G6DA 1I6XA 2X85A 2JZYA 5LGTA 2FBKA 2PJRA 2W84A 3ABTA 2OBPA 4BHBA 2CSOA 3LSIA 2HPIA 4MQVA 2DMTA 1ACIA 4DIQA 3Q0WA 2ZSHB 1VQNI 2R7TA 2VXZA 4G7HF 1IG7A 2AQFA 3GFJA 3GZ5A 5DEQA 1R9TJ 3S2HJ 3BJ6A 3BTJA 1LEAA 5FGMA 4XOTA 2D5VA 3BPVA 2X1CA 1NK3P 1ETQA 4KDPA 2FSWA 3DKXA 1O57A 4Q5SF 1ZAOA 4A3DJ 1K6OA 5ICFA 2VQGA 5EEAA 4Q4ZF 4J19A 1ZRCA 5GTHC 3EYYA 4P1WA 3KETA 3AG2H 4XNFA 1BM9A 3L2RA 3IH3A 2DAOA 1WH5A 1S3JA 4OMYA 3T5XA 1JT6A 4DQ2A 4XONA 3ZQFA 4M3FA 1IO2A 4A5MA 2DTZA 2V1NA 4UHTA 4KIBA 1U5TB 3PUFA 1PVEA 2L01A 2OPTA 4OIRF 2VQLA 1Z1DA 2JN6A 2JSPA 4ABZA 4QIWN 2KIQA 3TBIA 3ZN0A 3O2PE 4AD9A 3UNGC 2IP2A 4XSXF 5LHIA 3GF2A 2O3FA 5K7HA 1OKRA 3ASOH 2FE3A 1DU0A 1FOKA 3IH2A 4BBSJ 3OYKA 4PGHA 4N0BA 2KP6A 3BTLA 5GP9A 5JLWA 1IJWC 4PK4A 3I0TA 4Y52J 2E1MB 3SEQA 3BG6A 1KQ0A 2P4WA 1HA8A 2CWEA 2HU9A 3F23A 2X51A 4G9YA 1OCRH 3BG7A 2X1EA 4X6AJ 4E6KG 5F0HA 1BBYA 1FOXA 2QQAA 3GYHX 1UMQA 2P81A 4XM3A 1RETA 3GCMA 5D8KB 1MMAA 3K70C 4UB6C 1MGTA 2PQ8A 4BAYA 3SYTA 1IN8A 3GVAA 4BDZA 2DT7B 5EGOB 3GTMJ 1ULYA 3HOTA 2I8DA 2OC6A 4FX4A 4XK4A 4IEJA 1MSEC 3WODF 2BZTA 3W2VA 3KZZA 2V6CA 5E17F 1U5TC 2ZC2A 5H20A 5K1YA 2ELJA 2MD5A 5CVIA 5J1UA 1SD4A 3B6AA 2OTLI 3H3UA 1V5GA 1RC9A 1ZQ3P 1DQUA 2WAEA 4MLOA 5TGTA 5IT9K 5LGUA 5HOOA 4RAYA 3LSRA 5A2QK 3JRFA 2VT2A 1LFPA 4NQWB 2Y9ZA 3CDHA 2DOEA 3IUOA 3LA7A 3GUDA 3VEPA 5E3OA 2IS6A 3VSLA 1EA3A 2FBHA 2E1MC 4XKCA 1B1BA 2L7ZA 4HNUA 4LITA 3S3OA 5TISC 1R6RA 3DPUA 2A6HF 2ECCA 4HEA2 2E1NA 1HCRA 4NNJA 1YITI 3BQYA 4ZJZA 2RQQA 1TQIA 2KJBA 3S15J 3F8FA 4CGZA 2E2HJ 4NC7A 1JUSA 3FM3A 1I39A 1KGSA 1YW7A 1MDMB 3O8HA 1ON2A 4N9HA 2D45A 4JYKA 1HF0A 3GFLA 2KZVA 3HB9A 4XLPF 2AS5F 1ZR4A 3RDIA 1TWHJ 1YQAA 3SZPA 4UVBA 3L2WA 3WTUC 1MW7A 1C0WA 3KCCA 5JLXA 1W36D 2X6WA 1LE8A 2HI3A 3CO7C 2RC4A 3GMEA 3V4GA 4KA4A 2KPMA 1G3WA 3C2BA 3BG3A 1APLC 2DFEA 1JTXA 1QGPA 2W57A 4LIUA 4WK8F 3K4MA 5ICEA 2HDCA 4I99C 2VL8A 2XPVA 1U2WA 3BCAA 3KPHA 4Z2YA 3HRUA 4GFBA 3E6CC 2W00A 1YG2A 2E19A 3PNVA 4K2EA 2FOKA 1SFEA 4XL9A 1O3TA 2XRNA 5KHDA 3L7WA 3M07A 3BTCA 3BPXA 4ZZLA 3RYPA 1D0ZA 1F4KA 4MQ9F 5J8CA 3CJNA 4ZYHA 1QA6A 4KITB 2OTJI 2CV2A 2VUMJ 1OQYA 3OR2C 3RZOJ 2Y30A 3Q5FA 2XB0X 3BR2A 1VQLI 5EYRA 2GOMA 2FUG2 4YRVA 3MAJA 4BE1A 2GZWA 5C44J 1IF1A 1HW2A 1YX3A 4XN3A 4QTRA 1K4SA 1IC8A 1T56A 3RCOA 1D0YA 4A0YA 2O03A 4NBQA 1OCOH 4XRSA 4RM2A 2JRTA 1BOBA 5FD5A 4KICA 3KFWX 5JHUA 5J1RA 3HM5A 1B8IB 4ENJA 4HF0A 2VI6A 4MIMA 2DPUA 2HZTA 3CUQA 3QODA 2OQRA 2BVMA 1D3YA 4EMSA 5D5WB 3FKJA 2CUZA 2W82A 3MZ8A 4I7HA 3G1LA 2PMHA 2WY8Q 2M1BA 2NOGA 1OYYA 1V54H 1XG1A 2DA7A 4HYEA 4XLFA 5E8GA 1QZYA 1A6IA 4A3KJ 2MC4A 3CCYA 5F04A 2JA5J 2DU9A 4XLEA 2ZKZA 3HJEA 3MKYB 3D5RC 3S1RJ 4BL0B 2L02A 3HBLA 3L2CA 3N05A 4W97A 1QQIA 2CS3A 4HBLA 3A4CA 1VQ9I 2KRFA 2HDDA 4FTHA 1OYWA 2CUJA 3HZJA 3VYTB 2Z9OA 4E7KA 3WTZA 2VJ4A 4IQJA 3FHNA 3X2QH 1SD7A 2OF7A 3K1NA 4XRMA 2L4MA 1GVJA 2HYGD 1FBUA 2CRGA 4OIPF 4LK0F 1A6QA 1V55H 2Z99A 3R60A 4ZDLA 1A04A 2M4GA 3EETA 2F4OB 4MFDA 2QBYA 1ERDA 3E5UA 1XTAA 3SZTA 3AG1H 3JTHA 2EBIA 1PDNC 3BC8A 1UG2A 3ERMA 4I0AA 1HDPA 1DPRA 3KE2A 4A69C 2LF8A 4YELA 3K4KA 2QSFX 2EFNA 4B1RA 3HRTA 4KN4X 4AYBN 4JBAA 2FNAA 4E70A 4DJAA 4EEFG 4BDYA 5L3GA 3AFHA 4XKBA 1JJ6C 3OSFA 2ZXIA 5DD8A 1WZ2A 4XLNF 1FJLA 2MW8A 3E7LA 1H8AC 2K5CA 1X3WB 3S93A 2XGEA 3ABLH 4HSRA 3RIRA 4R79A 5JHFA 1PUEE 4ITVA 2VT3A 3F22A 3IKVA 3F21A 4Z6YA 5DS9A 3WGHA 2IGMA 4M71A 1A35A 1EH8A 4I0BA 1YRNB 4F7ZA 5M5YJ 4U88A 5IOYA 4HDVA 3MD2A 2P5LC 4CA0A 1ETWA 1E3PA 2L9NA 1R22A 2HS5A 1S8NA 1OYIA 1PUFB 1FC3A 3K70D 3OYFA 1Q1VA 1W5CC 2VBXA 1KYZA 1BA5A 1N25A 2OUMA 2UWMA 1FP2A 1WRJA 3FX3A 3OL4A 1H0MA 2XKOA 5L3CA 2G0EA 1H89C 4EJWA 3H0DA 3CCJI 4BGDA 5DCMB 5CQGA 4CSWA 2ME0A 3ZMSA 4RLFA 2LFBA 2HPMA 1JXSA 1QVUA 1VF9A 3GX4X 2MBFA 2KRCA 1J59A 2LSOA 3ECHA 1SMTA 2EIKH 4BS9A 4B48A 3S1MJ 1ZG3A 3HPGA 4CYCA 4ENKA 5FRNA 5FO5A 2LLKA 1FZPB 2DDBA 2WBMA 2ZJ2A 3IRRA 4OIOF 3L2UA 2NNNA 5B3SH 2E60A 3ZMVA 3ELKA 2R5ZB 4Y3OA 1B4AA 1ZRFA 2DJIA 2L0KA 2NAZA 4A12A 1P92A 1MBGA 2XUBA 3ZN1A 2A6EF 5BPDA 3HEFA 4D0PA 2EQRA 3BCBA 3HRMA 1JGGA 2KDOA 4QPQA 2K9QA 3GZ6A 3GTOJ 3B02A 2P5VA 2P5KA 2ELKA 2IPQX 2W24A 1TWFJ 2RVCA 4N4NB 4XBFA 4J01A 4U7DA 1KA8A 2WB1A 2RDPA 1ETXA 1WI3A 4M73A 3OYHA 1X2MA 3RPQA 4MEXF 4LK1F 1XB4A 3VWBA 1QZZA 4DW6A 4Q47A 3I3LA 2RNJA 2F5FA 4CO8A 5CLSA 5GPCA 1ODDA 3KP3A 3I64A 2RAEA 5FROA 1EKEA 2GXGA 1P6RA 2OU2A 3LSTA 2LH9A 5HNFA 1MJ9A 2E5ZA 2ETHA 3EQLF 1A36A 3RQ4A 3KEYA 3DPLC 2BHYA 2L5QA 4WXHA 2VOOA 1ETOA 1AKHA 3TO6A 2QVOA 3PNYA 2STTA 3ZQGA 4DGWB 4GCVA 1P2FA 5D6FA 3K0LA 3CCRI 4IX7A 3QRFF 1EF4A 2X9DA 3LSPA 2EIJH 5D8LB 4ZYAA 1KONA 1RESA 1ZELA 4CCMA 1I50J 3WTYC 3PIOF 3PSFA 3SHFA 3N4MA 5DTDA 3W2WA 3K1MA 4C9YA 2NVQJ 1GDTA 4AVPA 4IZZA 1TQPA 5HLIA 4AVZA 2R7RA 3VSKA 2MGQA 2VKHA 1J09A 4F91B 5TRDA 1FIAA 1IDYA 2K40A 1N78A 2R3SA 4UNOA 2HOTA 2VE9A 2EV5A 3C7JA 1SVOA 1WQ2A 2MLKA 1HW5A 3I4PA 1MSFC 2W48A 3I5UA 2MSYA 3HSEA 1LB2A 1TTYA 4M6XA 2ZNZA 5FKNA 2LKXA 2O9LA 3U21A 2IVMA 1GUUA 2ZBKA 5BMZA 3I54A 4CICA 1X2NA 4PJMA 4Y17A 3CD6I 3DTKA 3FXRA 5B1AH 1M1EB 1HKSA 2DBBA 3CC7I 2IT0A 4AIJA 2AHQA 1XSXA 3OYMA 3S16J 3F0CA 2L4AA 1UJ8A 2Z1DA 1U8BA 1S7OA 3SJMA 1FLIA 3BOQA 5J6XA 4A3FJ 4YEJA 2NVUB 1BR2A 5KAFC 3IC7A 3WHBA 1IXSB 4ZDPA 3BQZA 4ESJA 3F72A 4JK1X 3NQOA 3A01B 1WJ5A 2FMLA 1RIOH 3HG9A 1XN7A 2KKOA 3TDUC 3CMEI 1FYLA 4HF2A 2EFQA 2M5WA 1DPUA 5HDNA 4V19K 5EZGA 5AIQA 5J4VA 1ZTRA 4B47A 2JK3A 3JRAA 4XMYA 4I98B 2PLYA 1HOMA 1STZA 1TQMA 2VASA 3DU6A 2MG4A 1HKTA 1TBXA 4DOZA 5KK1A 5EF6A 2E35A 1ZN2A 1BC8C 2ZSIB 2E71A 4AIDA 5FJ8J 1YIJI 1YW8A 1USSA 2LY1A 1BL0A 1P7IA 3DQVC 1HXDA 4ZC3A 3ZXSA 3FWEA 3PO3J 1B72A 1MNEA 1SFKA 1T39A 4F55A 2Q1ZB 4EGYA 2XDVA 1WI9A 1BI1A 2H1KA 4RA2A 3S17J 3WE3A 1FT9A 5IPAA 1VQ7I 3VODA 2OJED 4BKXA 2HQAA 5D5VB 2A68F 4G94A 2CG4A 1MBHA 2HKOA 3LAPA 1XMAA 1K4TA 4L0ZB 1U9OA 2BW3A 4M6VA 2LK2A 2V1UA 1W7PA 4KJZA 4HAMA 1O7FA 3QPSA 2BY0A 3F6OA 4II3A 5JVGF 3LMMA 2NNYA 4XORA 1SANA 1DGWY 4FHTA 2M0MA 2K9SA 4I6ZA 1FYMA 2DK5A 2M3AA 5D5XB 4E7IA 3TOAA 4DYQA 2DODA 4RAFA 3M8FA 5BNGA 2DMPA 2X6YA 4F93B 1LUJB 2BYVE 2HQ5A 1NG6A 3NWTA 1ZGAA 3AL0B 5H6RA 5FKLA 2WB1N 2ZO4A 3SEZA 4BBRJ 3AAFA 1RRJA 3TGNA 1MKMA 2XIGA 3QYEA 3HOWJ 2ESNA 3QAHA 2DCEA 2VC0A 1V5FA 2DFHA 3I55I 2NXNB 4ENNA 1KYWA 3PQJA 3C2GA 3GXOA 4JP0A 1FY7A 1R71A 4P9UA 1R5GA 1AWCA 3FBNB 3BROA 3A02A 2LBFB 5BOXA 2DFFA 3RPUA 2BY1A 3VDXA 2LY9A 4HZFA 1OPCA 1HW1A 3C3WA 5M3FJ 5FLXK 4M3BA 2JVGA 2D1VA 3L1PA 4S0HB 2VBZA 2IW5A 2XASA 2QENA 1OLTA 1UFMA 3A2KA 2HVQA 1S6LA 3NEUA 2ACJA 1Y8RB 3TO7A 1CF7B 5HODA 4XLCA 1ITYA 2QWWA 2XPUA 3G4SI 3CMYA 1WH7A 4FISA 3ZOBA 4ESFA 4JOMA 4C3JJ 1LFUP 2EPFA 2XAJA 4KFCA 3K4CA 3U9GA 1MIJA 3FMQA 1PJRA 3WGGA 4LB5A 1WJCA 1ZLJA 5L3FA 4RGXA 3ABUA 4IHSA 3K2ZA 2IXSA 1D5VA 2GIVA 2CH0A 1B9NA 3AL0C 1EV7A 2DA4A 3PIPF 4E7HA 4CYDA 3KP2A 2NVTJ 2H6CA 4FE4A 4HQEA 2L9SA 5EG0A 2H94A 3S2WA 3BG9A 4RGSA 2M0CA 2O8KA 5C4JJ 3KZYA 3MFKA 1MMNA 2JA6J 5FKKA 5GAHJ 2HVSA 4AC0A 4S04A 3J81Z 4BQAA 4H0EA 3HSRA 2R5YA 1MJAA 1HLVA 5E3MA 5B66C 3S3NA 1G8XA 2HQNA 3RKYA 5IY5H 1BC7C 3DPTA 1BIAA 2HXIA 2V9PA 5EEGA 4Y13A 4G7ZF 1CQTA 4A3LJ 2CFOA 1A5JA 3LQQA 1I6HJ 5D5UB 2BY3A 2H09A 4UV9A 3WTVC 1D8JA 2FRHA 1W7PD 1ZR2A 1XGNA 2BV6A 4IF4A 1QVTA 1KU9A 2MLGA 1YO5C 3BJOA 1QPMA 5E1WA 2NS0A 3A0BC 2DA1A 3BR1A 3LA2A 2CV0A 3BJAA 3OIOA 4LD5A 4EJOA 1Z9CA 1YX5A 4RDUA 5LRSA 1DP3A 1MMDA 2EK5A 3I53A 2BHZA 4ASNA 1MNDA 1TW3A 2KT0A 5BPIA 2EZIA 1BJAA 2Q0OA 2JRMA 5CKTA 4DBQA 3GTLJ 3BR3A 2XF6A 1QHGA 4R8HA 2VOPA 2WV0A 3LWFA 3U2RA 2V9KA 1ZKGA 1QHHD 2GA2A 2VIXA 3MMYB 3Q0VA 2R4GA 4XN0A 1WCMJ 3CCMI 3OYAA 1GT0C 4DZJA 5J40A 2QUFA 3F3XA 3OYBA 2H1LA 2HVRA 3UKGA 1T2KA 4KNYA 3QU6A 4A3BJ 2H8WA 2R7FA 1OFCX 3OYEA 3RPUD 3HUGB 1MD0A 4LB6B 5IT3A 1XGSA 4ZYGA 2HTJA 3LOCA 4ESBA 1K78A 1FYKA 5FKMA 5DM7F 4S05A 2DN0A 1B6AA 1HSTA 2COMA 1U9NA 4AYBA 1TW2A 2QLZA 3COAC 3LFUA 4EM0B 4E7JA 4MEYF 3TOBA 2BXYA 2FXAA 2CQ7A 3K2AA 3OMYA 1RUNA 1FSEA 2HWVA 5IYCJ 1P9QC 4XKWA 3SFIA 3EUHC 2QA4I 4RGUA 2G7UA 2MC3A 1OR7C 3NRVA 4U0WA 3ULQB 1H9TA 1R58A 1KU3A 4HSTA 1RUOA 2FJ1A 2XHKA 3PFIA 4RMNA 3EUAA 2DMNA 4A6DA 5JFRA 3ABKH 4UUSB 2PN6A 5M5WJ 1WWXA 3S1QJ 2VBWA 2Y0MA 1MBKA 2DO7A 2F48A 1IDZA 3JCUC 2A3SA 1YIOA 3QWLA 5EDNA 3WU1B 2GXBA 2LYCA 4BNCA 3P9KA 3GLLA 3CLQA 2R0QC 2FNPA 2DW4A 1OCTC 3U1KA 4LOCA 1XS9A 1XMXA 3OIQA 1YYVA 2K9NA 3EDPA 2E1CA 2QKMB 4II2A 1FMWA 4MHGA 5JR3A 5K5RA 1JTYA 4UXNA 4XLHA 4XOPA 1GV2A 2WAQN 2MFZA 2JT1A 2V26A 2M7BA 2V7FA 2BXZA 3CMMA 3L00A 3O8GA 2VB6A 4I09A 2GOXB 1GXQA 1BI0A 2UXXA 2A6TA 2I10A 4XIDA 2L7FP 3D0SA 3ZMTA 3BT9A 2ESHA 3FHZA 2FU4A 4B09A 2YUSA 3G73A 1LFBA 3PNTA 4WXCA 1WHUA 4BXFA 4KISA 1YJ9I 9ANTA 4A3GJ 2FQ3A 1W1WE 3GWZA 2IA1A 3H5NA 5GAGJ 3H9QA 5HS7A 1JJ8C 4PFPA 1JI8A 5LHHA 3OOUA 2JQ7A 3IP4B 4BQOA 1U5TA 3FK6A 1YJWI 2ZJRF 2D1HA 3VPRA 2O5RA 2X6OA 5GPAA 1N77A 1VQ5I 2H8RA 2IS4A 3S8PA 2DPDA 3IWFA 5LGNA 1JKQC 2HKXA 3KLNA 2Y0SN 1ZH5A 4BY7J 3T0YA 3ZMUA 3K6GA 4HA8A 1ETYA 3WTWC 1Y6IA 4EVIA 2O61A 5E1XA 4HQMA 2XC7A 1PP7U 1T08B 1IAWA 2KFDA 2XF5A 2P6SA 1YTYA 2BE5F 3KP6A 3NAUA 2M7AA 3V7CA 1XSVA 3QYBA 4OAYA 2Q8KA 5J47A 4ENMA 3G3ZA 3JSPA 3JSOA 1WKMA 1K61A 5FLXZ 1MNMC 3R6SA 2A5WA 3SXYA 2MD0A 1SMYF 5F08A 4V2FA 1B59A 2VE8A 1VQOI 2R7WA 3FMRA 3M8JA 1S7EA 2DFIA 3I4NJ 2AO9A 3WTTC 3K9TA 2EZLA 3TO9A 4NUBA 3KP5A 2Q2EA 1Z7LA 3Q3SA 4YIRX 1O3QA 3ISPA 1UAAA 3OYJA 5FB2A 5EGOA 4A2UA 4LG0B 2VODA 2UUZA 3KLOA 4A93J 3U1DA 3P9CA 4I02A 1R7JA 3ESWB 4WX9A 4C3HJ 4L9VA 1X4OA 1K7AA 5L3DA 1LQ1A 3FIWA 3BR0A 3CJRB 1A31A 1R36A 1BW6A 3GTGJ 2DA2A 3TMOA 4P9FA 5F1RA 3I59A 3HHHA 3ZGKA 3HDDA 1R4MB 2DLLA 4LGWA 4NQWA 3A0HC 4RAZA 4DZPA 1IRGA 1KZHA 1HDDC 1I1SA 2WAFA 5F0FA 4UB8C 3CP8A 4B43A 4KN7X 4BJ5C 1CGPA 1XGMA 1DDNA 3V7SA 3GZNB 2JA2A 1VQ6I 1VQPI 3QOPA 1IXRC 2YX4A 3DBLB 1KQ8A 1BI2A 4HPQA 1XMKA 4Y7NJ 3HOSA 1D1BA 1MH3A 2OA4A 3TEDA 2EIMH 1YHQI 3HRSA 2E36A 3GW2A 3TP3A 3R0AA 2CO5A 1HBXG 1OCCH
chains in the Genus database with same CATH topology
4J19A 1U78A 1MSFC 2HOAA 2W48A 3JR9A 2MSYA 5FKNA 3JRDA 2LKXA 3HOVJ 2O9LA 4XICA 4CYCB 3HGYA 4IHWA 3IH3A 1RKTA 1WH5A 1RR7A 4D5CA 1GUUA 4B4CA 4DYRA 1X2NA 2HYJA 1TC3C 1JT6A 4JX5A 3GTQJ 3HOYJ 3ZQFA 4M3FA 5J1YA 2DTZA 2Y31A 2XB5A 1VNDA 1ORKA 3LSGA 2OPTA 2AHQA 2JN6A 4ABZA 4QIWN 3F0CA 3S16J 1TWAJ 1U8BA 3SJMA 1MBJA 4A3FJ 1JKPC 2DA3A 5K7HA 2XRLA 3WHBA 3BQZA 3A01B 1DU0A 3IH2A 4BBSJ 2Y9YA 3BTLA 5GP9A 5JLWA 1F36A 1IJWC 5EZGA 4Y52J 1XC5A 1ZTRA 2ZB9A 2JK3A 3JRCA 2VKVA 1IUFA 3JRAA 1HOMA 2FQ4A 2MG4A 5EF6A 2LR8A 4X6AJ 5F0HA 3RQIA 3Q0UA 2B63J 5FJ8J 4JX6A 1T33A 3DCFA 1UMQA 2P81A 1NK2P 1BL0A 1P7IA 1FIPA 1AKHB 1RETA 3PO3J 1B72A 4IHVA 3HGGA 3GTMJ 5EGOB 3GTJJ 2H1KA 3S17J 1D5YA 4XK4A 4IEJA 1MSEC 1B8IA 5IPAA 4BKXA 4D5FA 2JWTA 4NDLA 2PMZN 4DYCA 5J1UA 1MBHA 1RKWA 3B6AA 1U9OA 4M6VA 2COBA 2LK2A 1ZQ3P 4MLOA 3QQAA 3JRGA 3LSRA 3JRFA 3ZQIA 3QPSA 3M4OJ 2Y9ZA 5IYDJ 5FLVA 1TWCJ 1SANA 4I6ZA 2NVXJ 2K9SA 1JKOC 5E3OA 2DMUA 3S1NJ 2R92J 4DYQA 3ZQLA 2L7ZA 3LSJA 5BNGA 2DMPA 3HOXJ 2TCTA 5IP6A 1IRZA 2HQ5A 2VKEA 2ECCA 5IP7J 1HCRA 5FKOA 3BQYA 5FKLA 2WB1N 2XGCA 2X48A 4FCYA 1DU6A 4UUTA 3S15J 1K83J 4BBRJ 2E2HJ 1JUSA 3HOWJ 1MBFA 1Z77A 3S2DJ 3HOUJ 3O8HA 4JYKA 1HF0A 3HB9A 2IEKA 1ETVA 4JP0A 1ZR4A 3RZDJ 1TWHJ 4A3CJ 3JRIA 3A02A 1MBEA 2DA6A 2CJJA 2LY9A 5M3FJ 5JLXA 3ZQHA 1LE8A 4M3BA 3JRBA 2HI3A 3L1PA 4S0HB 2KDZA 2IAIA 2R7ZJ 3FISA 1BJZA 1ZK8A 3CDLA 3C2BA 3BG3A 1APLC 1JTXA 5HODA 1ITYA 2CQXA 1WPKA 2XPUA 2XPVA 5EG0B 5M5XJ 3CMYA 1WH7A 4GFBA 4FISA 3PO2J 3ZOBA 4C3JJ 1LFUP 2E19A 1BW5A 3PM1A 2QF7A 3GTPJ 2LD5A 1MH4A 3BTCA 1TWGJ 2LTPA 3CQZJ 2JMWA 2DA4A 2VUMJ 2NVTJ 3RZOJ 2Y30A 2XB0X 3BR2A 5EYRA 4UUSA 3FK7A 2HXOA 4FE4A 4C3IJ 5EG0A 3BG9A 5C44J 4QTRA 5E3NA 2M0CA 2O8KA 5C4JJ 1IC8A 1T56A 5IYBJ 2JA6J 5FKKA 1B72B 4XRSA 4AC0A 1YRNA 3M3YJ 2R5YA 5J1RA 3HM5A 1B8IB 1H88C 1HLVA 2VI6A 4MIMA 5E3MA 3OSGA 2FD5A 4QSHA 3JREA 3HOZJ 1PUFA 2LVSA 1O4XA 2HXIA 5IOZA 1CQTA 3W6VA 4A3LJ 1F43A 1A5JA 4MFEA 1I6HJ 3G1LA 4G12A 1ZR2A 2NOGA 1QVTA 1JUPA 3MKLA 1QRYA 1XG1A 2DA7A 2M34A 2DA1A 3BR1A 3OIOA 1A6IA 4RDUA 4A3KJ 3CCYA 5F04A 2JA5J 2GLOA 5F27A 1Y1VJ 2KT0A 3S1RJ 2EZIA 3HBLA 4W97A 4HNVA 4A3IJ 3GTLJ 1RPWA 2HDDA 3BR3A 4FTHA 5F1JA 1W0UA 3D1NI 2R5ZA 3SDGA 5C4XJ 4RBOA 2CUFA 3QPLA 1ZKGA 2OF7A 4XRMA 1G2HA 1GT0C 3Q0VA 1WCMJ 2CRGA 2ID6A 4DZJA 3I4MJ 2NVYJ 3UKGA 4A3BJ 3BR6A 2EZKA 4A3EJ 1AHDP 1OFCX 3B6CA 4L5EA 4D7MA 3LNQA 3ZQCA 1Y1WJ 1LE8B 2R93J 3LOCA 4X1EA 5C3EJ 2E2JJ 5FKMA 4MFDA 1JUMA 2DJNA 2DN0A 1U9NA 2EBIA 4M3EA 1UG2A 1HDPA 3IV5A 4A3MJ 1QPIA 2N8GA 4A69C 3K2AA 3H3VK 4B1RA 3G1OA 5IYCJ 3DEWA 3SFIA 1UHSA 4EEFG 4BY1J 1FEXA 5EZHA 3GTKJ 5F0CA 2XPWA 2L9RA 2ME6A 1GV5A 4AUXA 1JJ6C 4D7NA 3OSFA 2ECBA 2LP0A 1IGNA 1FJLA 3WHCA 2MW8A 3E7LA 1H8AC 2FJ1A 2XGEA 1FTTA 2DMNA 4UUSB 5M5WJ 3BTIA 3S1QJ 2JA8J 1MBKA 2GBYA 2NS7A 1WGXA 2IBDA 1IDZA 5DS9A 5EDNA 2CUEA 2XSDC 5M5YJ 1YRNB 3A03A 5IOYA 1GVDA 4M3DA 4B3AA 1ETWA 2R5YB 2R0QC 1JT0A 2E1OA 2JA7J 1Z0XA 1OCTC 1I3QJ 4LOCA 5E3LA 1XS9A 1PUFB 1Q1VA 2K9NA 1BA5A 3IH4A 2E2IJ 2M2EA 2O7OA 1JTYA 2G0EA 1H89C 1GV2A 2WAQN 3O8GA 2QCOA 5K7ZA 1AU7A 2ME0A 2LFBA 1QVUA 1VF9A 2I10A 4XIDA 2L7FP 2M9HA 1E3OC 3BT9A 2Y2ZA 1NTCA 3GBGA 4IHXA 3S1MJ 4CYCA 2YUSA 1LFBA 2LLKA 3MN2A 3NARA 3RKQA 5IP9J 2FX0A 9ANTA 4A3GJ 2GM4A 1JJ8C 2R5ZB 3OOUA 2DMQA 3FK6A 2L0KA 3VPRA 3S14J 1MBGA 2X6OA 5GPAA 3HEFA 4MO7A 2H8RA 2EQRA 2WV1A 3TW6A 2L7MP 4C2MJ 2VPRA 2CU7A 2HOSA 1JKQC 1JGGA 2Y0SN 4BY7J 2K9QA 3GTOJ 1JKRC 3A01A 2ELKA 4V2GA 1TWFJ 1ETYA 1POGA 1W0TA 1OJLA 2JJ7A 1FTZA 1ETXA 1OCPA 1WI3A 2CQQA 3FKIJ 3NAUA 1X2MA 5M3MJ 3K7AJ 4DW6A 4IHYA 3BR5A 2EH3A 5GPCA 2RAEA 1K61A 1MNMC 2DA5A 3HKZN 4M3GA 5F08A 3TW7A 4V2FA 3BG5A 1S7EA 4A3JJ 1P7JA 5J3LA 3I4NJ 1ETOA 2AO9A 1AKHA 2XGDA 2EZLA 1SFOJ 3Q3SA 3TP0A 2M8GX 3ZQGA 5EGOA 4BXXJ 4XRSG 2EZHA 4A93J 1ZGWA 4W1UA 1EF4A 2X9DA 4C3HJ 3LSPA 5K7FA 3MVPA 4I76A 1X58A 1RESA 3FIWA 1I50J 3BR0A 2ID3A 4JX4A 2TRTA 2YU9J 1BW6A 3GTGJ 3H0GJ 5DTDA 2DA2A 4FE7A 2NS8A 3HDDA 4DZPA 2NVQJ 1VI0A 2DMTA 1GDTA 1HDDC 5F0FA 3Q0WA 1VFCA 1IG7A 2YS9A 1R9TJ 3S2HJ 3BTJA 2MGQA 3G1MA 3JRHA 2D5VA 1IV6A 4Y7NJ 1FIAA 1ETKA 1ETQA 1IDYA 1MH3A 2K40A 1NK3P 3TEDA 2HOTA 4A3DJ 5FLMJ 3TP3A 5EEAA 4AYBN 1ENHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J19 A;  1U78 A;  1MSF C;  2HOA A;  2W48 A;  3JR9 A;  2MSY A;  5FKN A;  3JRD A;  2LKX A;  3HOV J;  2O9L A;  4XIC A;  4CYC B;  3HGY A;  4IHW A;  3IH3 A;  1RKT A;  1WH5 A;  1RR7 A;  4D5C A;  1GUU A;  4B4C A;  4DYR A;  1X2N A;  2HYJ A;  1TC3 C;  1JT6 A;  4JX5 A;  3GTQ J;  3HOY J;  3ZQF A;  4M3F A;  5J1Y A;  2DTZ A;  2Y31 A;  2XB5 A;  1VND A;  1ORK A;  3LSG A;  2OPT A;  2AHQ A;  2JN6 A;  4ABZ A;  4QIW N;  3F0C A;  3S16 J;  1TWA J;  1U8B A;  3SJM A;  1MBJ A;  4A3F J;  1JKP C;  2DA3 A;  5K7H A;  2XRL A;  3WHB A;  3BQZ A;  3A01 B;  1DU0 A;  3IH2 A;  4BBS J;  2Y9Y A;  3BTL A;  5GP9 A;  5JLW A;  1F36 A;  1IJW C;  5EZG A;  4Y52 J;  1XC5 A;  1ZTR A;  2ZB9 A;  2JK3 A;  3JRC A;  2VKV A;  1IUF A;  3JRA A;  1HOM A;  2FQ4 A;  2MG4 A;  5EF6 A;  2LR8 A;  4X6A J;  5F0H A;  3RQI A;  3Q0U A;  2B63 J;  5FJ8 J;  4JX6 A;  1T33 A;  3DCF A;  1UMQ A;  2P81 A;  1NK2 P;  1BL0 A;  1P7I A;  1FIP A;  1AKH B;  1RET A;  3PO3 J;  1B72 A;  4IHV A;  3HGG A;  3GTM J;  5EGO B;  3GTJ J;  2H1K A;  3S17 J;  1D5Y A;  4XK4 A;  4IEJ A;  1MSE C;  1B8I A;  5IPA A;  4BKX A;  4D5F A;  2JWT A;  4NDL A;  2PMZ N;  4DYC A;  5J1U A;  1MBH A;  1RKW A;  3B6A A;  1U9O A;  4M6V A;  2COB A;  2LK2 A;  1ZQ3 P;  4MLO A;  3QQA A;  3JRG A;  3LSR A;  3JRF A;  3ZQI A;  3QPS A;  3M4O J;  2Y9Z A;  5IYD J;  5FLV A;  1TWC J;  1SAN A;  4I6Z A;  2NVX J;  2K9S A;  1JKO C;  5E3O A;  2DMU A;  3S1N J;  2R92 J;  4DYQ A;  3ZQL A;  2L7Z A;  3LSJ A;  5BNG A;  2DMP A;  3HOX J;  2TCT A;  5IP6 A;  1IRZ A;  2HQ5 A;  2VKE A;  2ECC A;  5IP7 J;  1HCR A;  5FKO A;  3BQY A;  5FKL A;  2WB1 N;  2XGC A;  2X48 A;  4FCY A;  1DU6 A;  4UUT A;  3S15 J;  1K83 J;  4BBR J;  2E2H J;  1JUS A;  3HOW J;  1MBF A;  1Z77 A;  3S2D J;  3HOU J;  3O8H A;  4JYK A;  1HF0 A;  3HB9 A;  2IEK A;  1ETV A;  4JP0 A;  1ZR4 A;  3RZD J;  1TWH J;  4A3C J;  3JRI A;  3A02 A;  1MBE A;  2DA6 A;  2CJJ A;  2LY9 A;  5M3F J;  5JLX A;  3ZQH A;  1LE8 A;  4M3B A;  3JRB A;  2HI3 A;  3L1P A;  4S0H B;  2KDZ A;  2IAI A;  2R7Z J;  3FIS A;  1BJZ A;  1ZK8 A;  3CDL A;  3C2B A;  3BG3 A;  1APL C;  1JTX A;  5HOD A;  1ITY A;  2CQX A;  1WPK A;  2XPU A;  2XPV A;  5EG0 B;  5M5X J;  3CMY A;  1WH7 A;  4GFB A;  4FIS A;  3PO2 J;  3ZOB A;  4C3J J;  1LFU P;  2E19 A;  1BW5 A;  3PM1 A;  2QF7 A;  3GTP J;  2LD5 A;  1MH4 A;  3BTC A;  1TWG J;  2LTP A;  3CQZ J;  2JMW A;  2DA4 A;  2VUM J;  2NVT J;  3RZO J;  2Y30 A;  2XB0 X;  3BR2 A;  5EYR A;  4UUS A;  3FK7 A;  2HXO A;  4FE4 A;  4C3I J;  5EG0 A;  3BG9 A;  5C44 J;  4QTR A;  5E3N A;  2M0C A;  2O8K A;  5C4J J;  1IC8 A;  1T56 A;  5IYB J;  2JA6 J;  5FKK A;  1B72 B;  4XRS A;  4AC0 A;  1YRN A;  3M3Y J;  2R5Y A;  5J1R A;  3HM5 A;  1B8I B;  1H88 C;  1HLV A;  2VI6 A;  4MIM A;  5E3M A;  3OSG A;  2FD5 A;  4QSH A;  3JRE A;  3HOZ J;  1PUF A;  2LVS A;  1O4X A;  2HXI A;  5IOZ A;  1CQT A;  3W6V A;  4A3L J;  1F43 A;  1A5J A;  4MFE A;  1I6H J;  3G1L A;  4G12 A;  1ZR2 A;  2NOG A;  1QVT A;  1JUP A;  3MKL A;  1QRY A;  1XG1 A;  2DA7 A;  2M34 A;  2DA1 A;  3BR1 A;  3OIO A;  1A6I A;  4RDU A;  4A3K J;  3CCY A;  5F04 A;  2JA5 J;  2GLO A;  5F27 A;  1Y1V J;  2KT0 A;  3S1R J;  2EZI A;  3HBL A;  4W97 A;  4HNV A;  4A3I J;  3GTL J;  1RPW A;  2HDD A;  3BR3 A;  4FTH A;  5F1J A;  1W0U A;  3D1N I;  2R5Z A;  3SDG A;  5C4X J;  4RBO A;  2CUF A;  3QPL A;  1ZKG A;  2OF7 A;  4XRM A;  1G2H A;  1GT0 C;  3Q0V A;  1WCM J;  2CRG A;  2ID6 A;  4DZJ A;  3I4M J;  2NVY J;  3UKG A;  4A3B J;  3BR6 A;  2EZK A;  4A3E J;  1AHD P;  1OFC X;  3B6C A;  4L5E A;  4D7M A;  3LNQ A;  3ZQC A;  1Y1W J;  1LE8 B;  2R93 J;  3LOC A;  4X1E A;  5C3E J;  2E2J J;  5FKM A;  4MFD A;  1JUM A;  2DJN A;  2DN0 A;  1U9N A;  2EBI A;  4M3E A;  1UG2 A;  1HDP A;  3IV5 A;  4A3M J;  1QPI A;  2N8G A;  4A69 C;  3K2A A;  3H3V K;  4B1R A;  3G1O A;  5IYC J;  3DEW A;  3SFI A;  1UHS A;  4EEF G;  4BY1 J;  1FEX A;  5EZH A;  3GTK J;  5F0C A;  2XPW A;  2L9R A;  2ME6 A;  1GV5 A;  4AUX A;  1JJ6 C;  4D7N A;  3OSF A;  2ECB A;  2LP0 A;  1IGN A;  1FJL A;  3WHC A;  2MW8 A;  3E7L A;  1H8A C;  2FJ1 A;  2XGE A;  1FTT A;  2DMN A;  4UUS B;  5M5W J;  3BTI A;  3S1Q J;  2JA8 J;  1MBK A;  2GBY A;  2NS7 A;  1WGX A;  2IBD A;  1IDZ A;  5DS9 A;  5EDN A;  2CUE A;  2XSD C;  5M5Y J;  1YRN B;  3A03 A;  5IOY A;  1GVD A;  4M3D A;  4B3A A;  1ETW A;  2R5Y B;  2R0Q C;  1JT0 A;  2E1O A;  2JA7 J;  1Z0X A;  1OCT C;  1I3Q J;  4LOC A;  5E3L A;  1XS9 A;  1PUF B;  1Q1V A;  2K9N A;  1BA5 A;  3IH4 A;  2E2I J;  2M2E A;  2O7O A;  1JTY A;  2G0E A;  1H89 C;  1GV2 A;  2WAQ N;  3O8G A;  2QCO A;  5K7Z A;  1AU7 A;  2ME0 A;  2LFB A;  1QVU A;  1VF9 A;  2I10 A;  4XID A;  2L7F P;  2M9H A;  1E3O C;  3BT9 A;  2Y2Z A;  1NTC A;  3GBG A;  4IHX A;  3S1M J;  4CYC A;  2YUS A;  1LFB A;  2LLK A;  3MN2 A;  3NAR A;  3RKQ A;  5IP9 J;  2FX0 A;  9ANT A;  4A3G J;  2GM4 A;  1JJ8 C;  2R5Z B;  3OOU A;  2DMQ A;  3FK6 A;  2L0K A;  3VPR A;  3S14 J;  1MBG A;  2X6O A;  5GPA A;  3HEF A;  4MO7 A;  2H8R A;  2EQR A;  2WV1 A;  3TW6 A;  2L7M P;  4C2M J;  2VPR A;  2CU7 A;  2HOS A;  1JKQ C;  1JGG A;  2Y0S N;  4BY7 J;  2K9Q A;  3GTO J;  1JKR C;  3A01 A;  2ELK A;  4V2G A;  1TWF J;  1ETY A;  1POG A;  1W0T A;  1OJL A;  2JJ7 A;  1FTZ A;  1ETX A;  1OCP A;  1WI3 A;  2CQQ A;  3FKI J;  3NAU A;  1X2M A;  5M3M J;  3K7A J;  4DW6 A;  4IHY A;  3BR5 A;  2EH3 A;  5GPC A;  2RAE A;  1K61 A;  1MNM C;  2DA5 A;  3HKZ N;  4M3G A;  5F08 A;  3TW7 A;  4V2F A;  3BG5 A;  1S7E A;  4A3J J;  1P7J A;  5J3L A;  3I4N J;  1ETO A;  2AO9 A;  1AKH A;  2XGD A;  2EZL A;  1SFO J;  3Q3S A;  3TP0 A;  2M8G X;  3ZQG A;  5EGO A;  4BXX J;  4XRS G;  2EZH A;  4A93 J;  1ZGW A;  4W1U A;  1EF4 A;  2X9D A;  4C3H J;  3LSP A;  5K7F A;  3MVP A;  4I76 A;  1X58 A;  1RES A;  3FIW A;  1I50 J;  3BR0 A;  2ID3 A;  4JX4 A;  2TRT A;  2YU9 J;  1BW6 A;  3GTG J;  3H0G J;  5DTD A;  2DA2 A;  4FE7 A;  2NS8 A;  3HDD A;  4DZP A;  2NVQ J;  1VI0 A;  2DMT A;  1GDT A;  1HDD C;  5F0F A;  3Q0W A;  1VFC A;  1IG7 A;  2YS9 A;  1R9T J;  3S2H J;  3BTJ A;  2MGQ A;  3G1M A;  3JRH A;  2D5V A;  1IV6 A;  4Y7N J;  1FIA A;  1ETK A;  1ETQ A;  1IDY A;  1MH3 A;  2K40 A;  1NK3 P;  3TED A;  2HOT A;  4A3D J;  5FLM J;  3TP3 A;  5EEA A;  4AYB N;  1ENH A; 
#chains in the Genus database with same CATH topology
 3CCU I;  2V6E A;  2HOA A;  4XLA A;  3JR9 A;  2PEX A;  5D6E A;  2OZ6 A;  3HOV J;  1T0F C;  1MDM A;  3HGY A;  3EPZ A;  2OV7 A;  1LEB A;  1IV8 A;  4A0X A;  4B4C A;  4DYR A;  3R0J A;  1Q1H A;  1D0X A;  3MWM A;  3OWT A;  3KIO A;  1DUX C;  2LRE A;  3PJR A;  2X4H A;  3B73 A;  4BEH B;  1J9I A;  2Y31 A;  3J7Y J;  2XB5 A;  4FT8 A;  4YFN F;  3RKX A;  1ORK A;  3LSG A;  2WWY A;  3FXO A;  2VJJ A;  2R7U A;  3FXL A;  4GO1 A;  4M9Z A;  3AKZ A;  2ZME B;  1JKP C;  5ILV A;  4KT5 C;  3ERE D;  5HLT A;  2XRL A;  2IS2 A;  5D4R A;  2R7D A;  2J5O A;  1N75 A;  3E0J B;  3VYR B;  4A0Z A;  2WTE A;  3QPT A;  1T38 A;  3HYI A;  2F5V A;  2F5E A;  4R1H A;  4U0Y A;  3ZMZ A;  2RNG A;  1XC5 A;  1FBS A;  4IXA A;  3LSM A;  2QSG X;  3RI4 A;  2VKV A;  3BZC A;  3IL2 A;  4QPO A;  3F8M A;  1E3H A;  1UHM A;  2ELH A;  3TL4 X;  2DYS H;  3RQI A;  4P5O A;  3Q0U A;  4BAC A;  1T33 A;  3DCF A;  1XD7 A;  1XDU A;  4UVC A;  2RGV A;  2LKS A;  2DYR H;  2M30 A;  4U0V A;  5F6F A;  3TKY A;  5LBQ A;  2OQG A;  4IRH A;  3RKW A;  2ISZ A;  4BE2 A;  1YI2 I;  3GTJ J;  4M72 A;  1X1B A;  2XVC A;  2GAU A;  1D5Y A;  1GHC A;  1B8I A;  2W85 A;  2V9V A;  2L7K A;  4EGZ A;  2L2O A;  2Z33 A;  1REP C;  3KP4 A;  3J81 K;  4NDL A;  2PMZ N;  1XCV A;  1RKW A;  1ZHF A;  5LRR A;  4B3X A;  5ICC A;  1X19 A;  2ZME C;  2COB A;  4BE0 A;  2IS1 A;  3M9A A;  2PJR B;  4IRG A;  3ZQI A;  1SVL A;  3M4O J;  1XGO A;  5IYD J;  3J80 K;  3CC4 I;  1TWC J;  2B0L A;  1JKO C;  2ISY A;  2JUC A;  3FXM A;  2DMU A;  3ASN H;  2R92 J;  3DLA A;  3LSJ A;  1IN7 A;  2FBI A;  2ZXH A;  3CJT B;  1Z3X A;  3HOX J;  2TCT A;  1IRZ A;  1Y39 A;  1WFX A;  1QO0 D;  2M4K A;  5LHG A;  5GAD J;  2XGC A;  1U0J A;  4FCY A;  3BZ6 A;  5L3B A;  1MBF A;  2WA0 A;  2I5U A;  1Z77 A;  2CW0 F;  2E34 A;  3HOU J;  2LMD A;  4PJL A;  3OL3 A;  2VQH A;  5FFX A;  1ETV A;  3KZI C;  3TQN A;  2C6Y A;  3RZD J;  1OIS A;  3KP7 A;  4BJT A;  1F5T A;  5FD6 A;  4L5J A;  3REO A;  3ZQH A;  1SFU A;  5E79 C;  2DDA A;  2V79 A;  3FDY A;  5E8I A;  2R7Z J;  2GQQ A;  3W6J B;  1V4R A;  3CDL A;  4LLL A;  3WGI A;  1J75 A;  3OOP A;  1RZ4 A;  4UV8 A;  4EJU A;  2O0Y A;  4BJ6 C;  2CQX A;  1D1A A;  2Y48 A;  1WPK A;  5EG0 B;  5M5X J;  2E7W A;  2Z5U A;  2K3P A;  3DTE A;  4ZTF A;  5JVT A;  2PJP A;  1PP8 F;  1BW5 A;  1TNS A;  4RLQ A;  4O6J A;  2DK8 A;  2LD5 A;  3C2H A;  2X0L A;  4PJN A;  4HX8 A;  4TV7 A;  1YE9 A;  2OCE A;  3W6K B;  2RKH A;  2EB7 A;  3ML6 A;  3ZP5 A;  3E5X A;  2OZU A;  3FK7 A;  2HXO A;  4AWX B;  5CVV A;  2KZG A;  4CCJ A;  3E1S A;  2FF4 A;  3CF5 F;  3HC7 A;  4YFK F;  3OYG A;  4B44 A;  1QBJ A;  3S3M A;  1PYV A;  5E3N A;  3IWZ A;  3Q9V A;  1R5I D;  4ZTJ A;  1LVA A;  3BWG A;  5LEJ A;  1LNW A;  3BZK A;  1K79 A;  1UHW A;  2VQC A;  1YRN A;  2VLA A;  2K7L A;  3L9F A;  2RQP A;  3M3Y J;  4J00 A;  2GA1 A;  1H88 C;  4KT6 A;  2RN7 A;  3MQ0 A;  4QSH A;  3JRE A;  1PUF A;  2LVS A;  1O4X A;  3FXK A;  3W6V A;  1F43 A;  3AG4 H;  4MFE A;  4CDG A;  5DUK A;  2STW A;  1V5E A;  4G12 A;  3H5A A;  4LMY A;  4UUV A;  4LFU A;  3QP6 A;  4FET A;  2MH9 A;  4BQQ A;  2ZJQ F;  5DCM A;  3V8J A;  1VQM I;  5D4S A;  2M34 A;  3OV8 A;  3IKT A;  3C18 A;  1ZLK A;  2OD5 A;  3R4K A;  1FBQ A;  2CFX A;  3H35 A;  1VQ4 I;  1TLH B;  1WJF A;  4RS8 A;  1XSD A;  2H27 A;  2CYY A;  2GLO A;  2Y75 A;  5F27 A;  1X1C A;  2ICW G;  4HNV A;  4A3I J;  2K85 A;  2B9S A;  1R1T A;  3TDZ C;  2EFW A;  2R5Z A;  1K78 B;  3SDG A;  5C4X J;  3DP7 A;  2NOJ B;  4RBO A;  2CUF A;  2QQB A;  2EIL H;  3QPL A;  4AIH A;  1G2H A;  2QEX I;  1Z6T A;  1X3Z B;  3UR3 C;  2EV0 A;  3I9V 2;  5H2F C;  5HNH A;  1U6G A;  3EUK L;  1TNT A;  4CCN A;  1ZG1 A;  4GXO A;  3BR6 A;  2EZK A;  3CCL I;  4A3E J;  1AHD P;  2LF7 A;  3B6C A;  3DWL E;  3P9I A;  2G7H A;  4L5E A;  4D7M A;  1LE8 B;  1JHF A;  5GAE J;  5C3E J;  1JUM A;  1FNN A;  2DJN A;  1G59 A;  5ILS A;  2XRO A;  4M3E A;  3LSK A;  1MZB A;  4HF1 A;  4PDK A;  2X1D A;  3HTU A;  5E1Z B;  3V8K A;  1QPI A;  3J7A O;  1IUY A;  4OOI A;  4DBR A;  1HQC A;  1WVR A;  1LKX A;  1RNL A;  4BHC A;  2BBY A;  2XAH A;  4FAS D;  5J8F A;  2QQ9 A;  3DEW A;  4L9N A;  1ZYR F;  2ADU A;  2P7V B;  1I3A A;  2CW7 A;  2WAQ A;  4IOC F;  5EZH A;  1SD5 A;  3OIP A;  3DBH B;  2XPW A;  2L9R A;  2ME6 A;  4AUX A;  3OS0 A;  4D7N A;  3LA3 A;  2OCC H;  1IGN A;  2EWN A;  3WHC A;  5DCF A;  2VC1 A;  1W5S A;  4ON0 A;  3WG7 H;  3M1E A;  3ZQQ A;  2O8X A;  5KCM A;  1T6S A;  1FPQ A;  2HFH A;  3BTI A;  3KYC B;  4L0Y B;  3F8N A;  2KJC A;  2GBY A;  1NH3 A;  2IBD A;  1R4N B;  3FF5 A;  2EA4 A;  5LFA A;  3PSI A;  2XSD C;  4L9J A;  3A03 A;  3RSN A;  5K5Q A;  3C1D A;  1GVD A;  4L18 B;  3RJP A;  4CCK A;  2O6G E;  3Q9S A;  1X1P A;  1KU7 A;  1JT0 A;  4PUS A;  3KYL A;  1ZRE A;  3DEE A;  1E2X A;  1I3Q J;  5E3L A;  3CUQ B;  2F5D A;  2DT5 A;  1FOY A;  3F8B A;  2DTR A;  2E5N A;  1KQ9 A;  2R7O A;  2Y0S A;  3E6B A;  3IH4 A;  3K4L A;  2E2I J;  2M2E A;  2XF7 A;  4GYG A;  2O7O A;  2J5P A;  2A07 F;  3PL8 A;  1VTN C;  4EQQ A;  4A6E A;  4U87 A;  2AXT C;  1W4M A;  1E0E A;  2QCO A;  5K7Z A;  1P4X A;  2XAU A;  1W5T A;  1YS6 A;  2KIF A;  5FFZ A;  1LPQ A;  2BGC A;  4LLN A;  1NG7 A;  1SD6 A;  3LQR A;  1LVK A;  1IN5 A;  1NTC A;  2RRE A;  3GBG A;  3K4N A;  3CMA I;  3MN2 A;  1G6N A;  5DV5 A;  2FX0 A;  2WAD A;  1VQK I;  3WTS C;  4AIK A;  1FP1 D;  4HOB A;  4E7S A;  3T1B A;  4ZYE A;  3J80 Z;  4HRI A;  2HR3 A;  3H1C A;  4F92 B;  2ZCW A;  3I71 A;  2DMQ A;  3S32 A;  2M45 A;  3QPH A;  3O6B B;  3S14 J;  4GDF A;  1UST A;  2W4S A;  4C2U A;  2IA0 A;  4ZZD A;  2PG4 A;  4CUG A;  4EJV A;  3TW6 A;  4XQF A;  4XR6 A;  3JW4 A;  1SAU A;  4PJ0 C;  3HXL A;  1SC7 A;  1LDK B;  4M74 A;  2BOL A;  1JKR C;  4CCL A;  3A01 A;  2KIM A;  3LFK A;  3CUQ C;  1WJB A;  1FSH A;  2V1X A;  1OJL A;  4E7L A;  4ANJ A;  1H9G A;  4NB5 A;  2Q2E B;  1XPX A;  2QBY B;  1Z6R A;  1BI3 A;  3FKI J;  4C30 A;  1J5Y A;  5M3M J;  2VKD A;  4KMF A;  2EH3 A;  2Z16 A;  1FX7 A;  4ZYD A;  1BIB A;  4NHJ A;  1EJ9 A;  5L3E A;  3HKZ N;  3FMS A;  3T8R A;  1U3E M;  5F64 A;  2DI3 A;  3TW7 A;  4IO9 F;  4RB0 A;  1QNT A;  4A3J J;  1P7J A;  3OS2 A;  1IN6 A;  3DKY A;  2ZJP F;  4IVN A;  2CGP A;  2HNH A;  3DXJ F;  3I59 B;  2PFB A;  4PJJ A;  2A05 A;  3K4J A;  3CUO A;  4HX4 A;  2K4J A;  2L54 A;  3K1P A;  4BXX J;  2LOO A;  3I56 I;  2F2E A;  2CQN A;  2XAF A;  2EZH A;  1ZGW A;  2DOF A;  4W1U A;  4RB1 A;  2CQK A;  5K7F A;  2YPR A;  3MVP A;  3H5R A;  1X58 A;  1YLF A;  3CO6 C;  2TRT A;  4KIF A;  4AM3 A;  2R7S A;  4GRI A;  4IJA A;  2MAB A;  1T8I A;  5CQE A;  4FE7 A;  2NS8 A;  2G9W A;  3JAM Z;  1YS7 A;  2YU3 A;  1VI0 A;  3DTI A;  3WG9 A;  3BDD A;  2QKL B;  1ZGJ A;  5EJC A;  5DUI A;  1VFC A;  5TJJ A;  2YS9 A;  2EIN H;  4F52 A;  3CF2 A;  3IHU A;  1BOA A;  3G1M A;  2FMY A;  3JRH A;  1IV6 A;  1ETK A;  4RB3 C;  4MTE A;  4PZJ A;  4KUM A;  1QU3 A;  1X1A A;  2HEO A;  1Z21 A;  3E6M A;  5B5E C;  2F4I A;  4HDU A;  1G4D A;  5FLM J;  4P55 A;  1IZ1 A;  1GLN A;  4CZZ A;  1ZRD A;  1ENH A;  2MYS A;  1U78 A;  2VON A;  4BYY A;  6PAX A;  4M9X A;  2VXD A;  3I58 A;  3A1Y A;  2R7Q A;  3JRD A;  4IHW A;  4XIC A;  4CYC B;  4BUP A;  2YR2 A;  1D1C A;  1RKT A;  2E7X A;  1RR7 A;  4IQ4 A;  4D5C A;  3G71 I;  3OR1 C;  2IGK A;  4HW0 A;  1O3R A;  1G3S A;  1Y8Q B;  2HYJ A;  4WWC A;  3GFI A;  2QYO A;  1TC3 C;  4JX5 A;  3GTQ J;  3HOY J;  2DT6 A;  3BLY A;  3MEX A;  3SDB A;  3BP8 A;  1QZE A;  2LBF A;  5J1Y A;  1AA7 A;  2EV6 A;  3DLL F;  4FX0 A;  1VND A;  3HPH A;  2JPC A;  3D5L A;  1MMG A;  1S9H A;  4EM1 A;  3ONQ A;  2LG4 A;  1TWA J;  5FRM A;  3R61 A;  1OMI A;  1V3F A;  1MBJ A;  2D2W A;  2KHM A;  1Z67 A;  4LJZ F;  3SQN A;  2DA3 A;  4DNC A;  1F1Z A;  1JE8 A;  3CJQ B;  3V8L A;  2CMP A;  3CES A;  1CF7 A;  3DFG A;  3E6D A;  5ERI A;  3KYD B;  3J7Z I;  2R7V A;  2PMZ A;  5HLH A;  2Z2S B;  4WXD A;  3QOE A;  4G7O F;  1FMV A;  2Y9Y A;  1S29 A;  2K4B A;  1ZAR A;  1F36 A;  4L9T A;  1YOV B;  3K69 A;  3GFM A;  2ZB9 A;  2YX7 A;  3JRC A;  1IUF A;  1MJB A;  4QWQ A;  5EEH A;  2FQ4 A;  2YSR A;  2VBY A;  4AU7 A;  4BU2 A;  2LR8 A;  4ETS A;  3L2V A;  4IPA A;  1R23 A;  3ROU A;  3PQK A;  2B63 J;  3CC2 I;  4JX6 A;  3W3C A;  2KL4 A;  2RV8 A;  3DBR B;  2F4M B;  1NK2 P;  1FIP A;  2UV1 A;  1Y56 A;  2XGX A;  3DV8 A;  1AKH B;  4FQG A;  2KMU A;  1F9N A;  1U8R A;  1EH6 A;  4Q48 A;  1X3U A;  4IHV A;  3HGG A;  3J7A Y;  4GGG A;  2XKP A;  3HSF A;  4Y33 A;  4D9J A;  4N4O B;  1G3T A;  4PSX A;  4D5F A;  4PFO A;  4LIV A;  3H36 A;  3KX2 A;  2JWT A;  1S72 I;  2CW8 A;  4DYC A;  2ZFW A;  3QQA A;  3JRG A;  3MKW B;  1RR8 C;  3WE2 A;  2M87 A;  4XRF A;  4G8X A;  1SFX A;  3DEU A;  2K9M A;  5FLV A;  2JSC A;  2PMU A;  5HDG A;  2NVX J;  1FOW A;  3S1N J;  4YFX F;  4OWR B;  3EUH A;  3ZQL A;  1OCZ H;  2LRD A;  3ABM H;  1MMS A;  3MKZ A;  3KEQ A;  3SZG A;  5IP6 A;  1OR7 A;  2BVL A;  1BR4 A;  2VKE A;  4NC6 A;  1P4A A;  1IRX A;  2B7E A;  5IP7 J;  5FKO A;  1DU6 A;  1L0O C;  2X48 A;  5CVU A;  4A5N A;  2GWR A;  3WU0 A;  2IGN A;  4UUT A;  1P4W A;  1K83 J;  2L9V A;  4JQF A;  5ILU A;  2QM3 A;  4OAZ A;  1X4P A;  4HLY A;  2AXL A;  1K6Y A;  3S2D J;  4OIN F;  3LL7 A;  2DQR A;  4E4H A;  4N9I A;  2XAG A;  3F9K A;  5HS8 A;  2IEK A;  4XSZ F;  4CZC A;  1KU2 A;  5BQT A;  3LSH A;  3D5S C;  4WF2 A;  1ON1 A;  4RGR A;  3L2Q A;  3EYI A;  1O7L A;  4C2T A;  4A3C J;  3JRI A;  2VJ5 A;  3F6V A;  1I1G A;  2ZXJ A;  2QQ8 A;  1MBE A;  2HGC A;  2DA6 A;  3HUG A;  2CJJ A;  2ZNY A;  2IA2 A;  3JRB A;  2LNB A;  3OYN A;  4I2O A;  2KDZ A;  2A5Y B;  2IAI A;  1SVM A;  3FIS A;  4H4K C;  1BJZ A;  1ZK8 A;  5HLG A;  3MZY A;  3QYF A;  3T8T A;  1R00 A;  5CVJ A;  5KAI C;  1J7K A;  2XAQ A;  1S5L C;  2DQL A;  2GIZ A;  2V4J C;  2DXI A;  4CCO A;  3PO2 J;  4RM3 A;  3PM1 A;  2LC2 A;  2LKP A;  3KEO A;  3ZPL A;  3HIF A;  2QF7 A;  3GTP J;  4HX7 A;  2ZFU A;  1MH4 A;  1TWG J;  3OYL A;  2LTP A;  3CQZ J;  1R1U A;  2KRH A;  2JMW A;  4HG2 A;  1WSU A;  1XDS A;  4RB2 C;  1J0R A;  4O5V A;  3FM5 A;  4YG2 F;  4L5I A;  4M9S A;  4UUS A;  4C3I J;  3ZR8 X;  5DYM A;  1D8K A;  3GLX A;  3HHG A;  2A61 A;  4HV6 A;  5E20 A;  5IYB J;  4KYW A;  1B72 B;  3G6E I;  1DGR M;  2P8T A;  4XKV A;  2HOE A;  3OY9 A;  4NC8 A;  4PSW A;  4ZDO A;  3OSG A;  4EM2 A;  2FD5 A;  3HOZ J;  2H6B A;  3IRQ A;  2QSH X;  5IT9 Z;  3NWS A;  5IOZ A;  5A2Q Z;  1BR1 A;  3ZQ7 A;  3E3V A;  3ZCO A;  2BW3 B;  5CVR A;  3WU2 C;  2FEZ A;  5E18 F;  4YIF A;  1W7P B;  1R49 A;  1JUP A;  2MH2 A;  3MKL A;  1QRY A;  2UZK A;  2EJR A;  5ICG A;  2W25 A;  3IAM 2;  3CCV I;  4U7B A;  1TP4 A;  2R7X A;  5J4Y A;  2VPL A;  4HNT A;  4BHP A;  1L3L A;  3ZRG A;  3RYR A;  4OIQ F;  1X1D A;  5DDG A;  3PFY A;  3O3K A;  1S7A A;  2K86 A;  3IAS 2;  4M6Y A;  2OAZ A;  1XCB A;  2QZ8 A;  1Y1V J;  1JHH A;  1IRF A;  3OS1 A;  1JGS A;  2K02 A;  2WC2 A;  2P7C B;  1RPW A;  3DKW A;  5F1J A;  1UB9 A;  2UXN A;  2M8E A;  3D1N I;  1W0U A;  2ZXW H;  2KIS A;  5LEK A;  3CTA A;  3H92 A;  4GYI A;  2Y69 H;  5ED4 A;  3GO5 A;  1HSJ A;  1R1V A;  1YFH A;  2GXA A;  5DM6 F;  3ZMD A;  2ID6 A;  5H6Q A;  3I4M J;  1I5Z A;  4MGR A;  4G6Q A;  2VJI A;  2NVY J;  3K10 A;  1LDJ A;  3OYD A;  3MCZ A;  1Z91 A;  2JVH A;  2IGO A;  2L3D A;  3V7R A;  3LNQ A;  4PGG A;  3ZQC A;  1Y1W J;  2R93 J;  1SEU A;  4X1E A;  2E2J J;  2FA5 A;  1J2X A;  2EFO A;  1BN5 A;  2NRA C;  3QU3 A;  1Y0U A;  3DF8 A;  4BQN A;  4ZH4 F;  1R5H A;  4E7Z A;  4OU0 A;  3M8E A;  3IV5 A;  4A3M J;  2N8G A;  3E97 A;  1IN4 A;  2W7N A;  3VFZ A;  3H3V K;  2JUG A;  2HDW A;  5HVQ C;  4KIG A;  2K27 A;  3G1O A;  4O3M A;  5HS9 A;  3H9G A;  2W1O A;  1UHS A;  1T0F A;  1Z05 A;  4B8X A;  3OYI A;  4BY1 J;  1FEX A;  4CXF A;  1WJE A;  3GTK J;  2FOW A;  2X6X A;  4LLG F;  4OMZ A;  5F0C A;  4CH7 A;  1GV5 A;  3CP2 A;  3SFZ A;  4BXU A;  3FXQ A;  2ECB A;  2LP0 A;  1IW7 F;  4LG0 A;  3DU5 A;  2BEO A;  2NYX A;  4RAG A;  1TL8 A;  2IJL A;  1FTT A;  2P0W A;  3CDI A;  1WJA A;  5HDK A;  1T95 A;  4P96 A;  1B9M A;  2JA8 J;  2HTS A;  2NS7 A;  1IXC A;  1WGX A;  1ONV A;  4UY8 I;  3P7N A;  2F5C A;  1LJ9 A;  2CUE A;  2KQR A;  4EJT A;  3H3Z A;  2F6C A;  4F3Q A;  4M3D A;  4B3A A;  2R5Y B;  1DP7 P;  2E1O A;  4HV5 A;  1SAX A;  3WTX C;  2JA7 J;  1Z0X A;  4EV0 A;  3G2B A;  1XX5 A;  1UZC A;  3JTG A;  1GXP A;  4D1Q A;  3VB2 A;  2PX9 A;  2K9L A;  2CV1 A;  3CCE I;  2EFP A;  4Y4R A;  3JAM K;  2A69 F;  5GTI C;  1TT0 A;  4IL6 C;  1O3S A;  3F8C A;  3CCQ I;  3N97 A;  5LD2 C;  1VZ0 A;  3CCS I;  3VYS B;  3FXU A;  1AU7 A;  3VOE A;  4IHT A;  5BS6 A;  2KIU A;  1HKQ A;  2V1D A;  4QLC U;  3PUB A;  4I01 A;  4UVA A;  5K5O A;  4MNU A;  2M9H A;  1E3O C;  5DD4 A;  2QGU A;  3HTS B;  2Y2Z A;  2JPB A;  4IHX A;  3M1C A;  3GEZ A;  3RKQ A;  2MA3 A;  3NAR A;  1W36 C;  1TT5 B;  3HKZ A;  5IP9 J;  2GM4 A;  4MTD A;  2P6T A;  1YW9 A;  5CYV A;  3LAJ A;  4IOA F;  1E17 A;  4BEH A;  4PCQ A;  1NHA A;  4IKF A;  4WCG A;  3E5Q A;  5AIP A;  3VYU B;  3FBI B;  3FZV A;  2K3F A;  4HLX A;  1YJN I;  4MO7 A;  3OYC A;  2WV1 A;  2L7M P;  2ZME A;  4YII A;  4C2M J;  2VPR A;  2CU7 A;  2HOS A;  3CZ6 A;  5B1B H;  4V2G A;  1G3Y A;  1POG A;  1W0T A;  2JJ7 A;  1FTZ A;  3FXJ A;  2EA2 A;  1UCR A;  3V42 A;  2HYF A;  1Z7U A;  1Y0N A;  1LDD A;  1OCP A;  1VQ8 I;  4EAT A;  2CQQ A;  5JI6 A;  3P5J A;  2Z3Y A;  3K7A J;  4IHY A;  3BR5 A;  4LG3 A;  1ZG5 A;  1I27 A;  1WJD A;  4G6T B;  2PI0 A;  2AQE A;  3CLO A;  2DA5 A;  2IRF G;  1RI7 A;  1T98 A;  2XV4 S;  1AOY A;  4M3G A;  5LLQ A;  3MZH A;  2TDX A;  1Z3Y A;  3K4B A;  3HL2 A;  3BG5 A;  5J3L A;  4BH9 A;  3L09 A;  2BY2 A;  2XGD A;  5AON A;  1TZL A;  3W2A A;  3RTR A;  3QP5 A;  3M7G A;  5CPR B;  1SFO J;  2LDU A;  5KVR A;  5KNL A;  3TP0 A;  2DOA A;  2M8G X;  1FWZ A;  3AG3 H;  2JTV A;  3H9J A;  3BY6 A;  4KMU X;  2LY2 A;  4XRS G;  2XSJ C;  4CHU A;  2KLO A;  1UG0 A;  4Y15 A;  2VN2 A;  1HC8 A;  4X0G A;  2WY7 Q;  5CJ9 A;  3ECO A;  1UEL B;  2HQR A;  4IRI A;  4I76 A;  2PBI A;  2HZD A;  2ID3 A;  4JX4 A;  2YU9 J;  1EH7 A;  3H0G J;  4G6D A;  1I6X A;  2X85 A;  2JZY A;  5LGT A;  2FBK A;  2PJR A;  2W84 A;  3ABT A;  2OBP A;  4BHB A;  2CSO A;  3LSI A;  2HPI A;  4MQV A;  2DMT A;  1ACI A;  4DIQ A;  3Q0W A;  2ZSH B;  1VQN I;  2R7T A;  2VXZ A;  4G7H F;  1IG7 A;  2AQF A;  3GFJ A;  3GZ5 A;  5DEQ A;  1R9T J;  3S2H J;  3BJ6 A;  3BTJ A;  1LEA A;  5FGM A;  4XOT A;  2D5V A;  3BPV A;  2X1C A;  1NK3 P;  1ETQ A;  4KDP A;  2FSW A;  3DKX A;  1O57 A;  4Q5S F;  1ZAO A;  4A3D J;  1K6O A;  5ICF A;  2VQG A;  5EEA A;  4Q4Z F;  4J19 A;  1ZRC A;  5GTH C;  3EYY A;  4P1W A;  3KET A;  3AG2 H;  4XNF A;  1BM9 A;  3L2R A;  3IH3 A;  2DAO A;  1WH5 A;  1S3J A;  4OMY A;  3T5X A;  1JT6 A;  4DQ2 A;  4XON A;  3ZQF A;  4M3F A;  1IO2 A;  4A5M A;  2DTZ A;  2V1N A;  4UHT A;  4KIB A;  1U5T B;  3PUF A;  1PVE A;  2L01 A;  2OPT A;  4OIR F;  2VQL A;  1Z1D A;  2JN6 A;  2JSP A;  4ABZ A;  4QIW N;  2KIQ A;  3TBI A;  3ZN0 A;  3O2P E;  4AD9 A;  3UNG C;  2IP2 A;  4XSX F;  5LHI A;  3GF2 A;  2O3F A;  5K7H A;  1OKR A;  3ASO H;  2FE3 A;  1DU0 A;  1FOK A;  3IH2 A;  4BBS J;  3OYK A;  4PGH A;  4N0B A;  2KP6 A;  3BTL A;  5GP9 A;  5JLW A;  1IJW C;  4PK4 A;  3I0T A;  4Y52 J;  2E1M B;  3SEQ A;  3BG6 A;  1KQ0 A;  2P4W A;  1HA8 A;  2CWE A;  2HU9 A;  3F23 A;  2X51 A;  4G9Y A;  1OCR H;  3BG7 A;  2X1E A;  4X6A J;  4E6K G;  5F0H A;  1BBY A;  1FOX A;  2QQA A;  3GYH X;  1UMQ A;  2P81 A;  4XM3 A;  1RET A;  3GCM A;  5D8K B;  1MMA A;  3K70 C;  4UB6 C;  1MGT A;  2PQ8 A;  4BAY A;  3SYT A;  1IN8 A;  3GVA A;  4BDZ A;  2DT7 B;  5EGO B;  3GTM J;  1ULY A;  3HOT A;  2I8D A;  2OC6 A;  4FX4 A;  4XK4 A;  4IEJ A;  1MSE C;  3WOD F;  2BZT A;  3W2V A;  3KZZ A;  2V6C A;  5E17 F;  1U5T C;  2ZC2 A;  5H20 A;  5K1Y A;  2ELJ A;  2MD5 A;  5CVI A;  5J1U A;  1SD4 A;  3B6A A;  2OTL I;  3H3U A;  1V5G A;  1RC9 A;  1ZQ3 P;  1DQU A;  2WAE A;  4MLO A;  5TGT A;  5IT9 K;  5LGU A;  5HOO A;  4RAY A;  3LSR A;  5A2Q K;  3JRF A;  2VT2 A;  1LFP A;  4NQW B;  2Y9Z A;  3CDH A;  2DOE A;  3IUO A;  3LA7 A;  3GUD A;  3VEP A;  5E3O A;  2IS6 A;  3VSL A;  1EA3 A;  2FBH A;  2E1M C;  4XKC A;  1B1B A;  2L7Z A;  4HNU A;  4LIT A;  3S3O A;  5TIS C;  1R6R A;  3DPU A;  2A6H F;  2ECC A;  4HEA 2;  2E1N A;  1HCR A;  4NNJ A;  1YIT I;  3BQY A;  4ZJZ A;  2RQQ A;  1TQI A;  2KJB A;  3S15 J;  3F8F A;  4CGZ A;  2E2H J;  4NC7 A;  1JUS A;  3FM3 A;  1I39 A;  1KGS A;  1YW7 A;  1MDM B;  3O8H A;  1ON2 A;  4N9H A;  2D45 A;  4JYK A;  1HF0 A;  3GFL A;  2KZV A;  3HB9 A;  4XLP F;  2AS5 F;  1ZR4 A;  3RDI A;  1TWH J;  1YQA A;  3SZP A;  4UVB A;  3L2W A;  3WTU C;  1MW7 A;  1C0W A;  3KCC A;  5JLX A;  1W36 D;  2X6W A;  1LE8 A;  2HI3 A;  3CO7 C;  2RC4 A;  3GME A;  3V4G A;  4KA4 A;  2KPM A;  1G3W A;  3C2B A;  3BG3 A;  1APL C;  2DFE A;  1JTX A;  1QGP A;  2W57 A;  4LIU A;  4WK8 F;  3K4M A;  5ICE A;  2HDC A;  4I99 C;  2VL8 A;  2XPV A;  1U2W A;  3BCA A;  3KPH A;  4Z2Y A;  3HRU A;  4GFB A;  3E6C C;  2W00 A;  1YG2 A;  2E19 A;  3PNV A;  4K2E A;  2FOK A;  1SFE A;  4XL9 A;  1O3T A;  2XRN A;  5KHD A;  3L7W A;  3M07 A;  3BTC A;  3BPX A;  4ZZL A;  3RYP A;  1D0Z A;  1F4K A;  4MQ9 F;  5J8C A;  3CJN A;  4ZYH A;  1QA6 A;  4KIT B;  2OTJ I;  2CV2 A;  2VUM J;  1OQY A;  3OR2 C;  3RZO J;  2Y30 A;  3Q5F A;  2XB0 X;  3BR2 A;  1VQL I;  5EYR A;  2GOM A;  2FUG 2;  4YRV A;  3MAJ A;  4BE1 A;  2GZW A;  5C44 J;  1IF1 A;  1HW2 A;  1YX3 A;  4XN3 A;  4QTR A;  1K4S A;  1IC8 A;  1T56 A;  3RCO A;  1D0Y A;  4A0Y A;  2O03 A;  4NBQ A;  1OCO H;  4XRS A;  4RM2 A;  2JRT A;  1BOB A;  5FD5 A;  4KIC A;  3KFW X;  5JHU A;  5J1R A;  3HM5 A;  1B8I B;  4ENJ A;  4HF0 A;  2VI6 A;  4MIM A;  2DPU A;  2HZT A;  3CUQ A;  3QOD A;  2OQR A;  2BVM A;  1D3Y A;  4EMS A;  5D5W B;  3FKJ A;  2CUZ A;  2W82 A;  3MZ8 A;  4I7H A;  3G1L A;  2PMH A;  2WY8 Q;  2M1B A;  2NOG A;  1OYY A;  1V54 H;  1XG1 A;  2DA7 A;  4HYE A;  4XLF A;  5E8G A;  1QZY A;  1A6I A;  4A3K J;  2MC4 A;  3CCY A;  5F04 A;  2JA5 J;  2DU9 A;  4XLE A;  2ZKZ A;  3HJE A;  3MKY B;  3D5R C;  3S1R J;  4BL0 B;  2L02 A;  3HBL A;  3L2C A;  3N05 A;  4W97 A;  1QQI A;  2CS3 A;  4HBL A;  3A4C A;  1VQ9 I;  2KRF A;  2HDD A;  4FTH A;  1OYW A;  2CUJ A;  3HZJ A;  3VYT B;  2Z9O A;  4E7K A;  3WTZ A;  2VJ4 A;  4IQJ A;  3FHN A;  3X2Q H;  1SD7 A;  2OF7 A;  3K1N A;  4XRM A;  2L4M A;  1GVJ A;  2HYG D;  1FBU A;  2CRG A;  4OIP F;  4LK0 F;  1A6Q A;  1V55 H;  2Z99 A;  3R60 A;  4ZDL A;  1A04 A;  2M4G A;  3EET A;  2F4O B;  4MFD A;  2QBY A;  1ERD A;  3E5U A;  1XTA A;  3SZT A;  3AG1 H;  3JTH A;  2EBI A;  1PDN C;  3BC8 A;  1UG2 A;  3ERM A;  4I0A A;  1HDP A;  1DPR A;  3KE2 A;  4A69 C;  2LF8 A;  4YEL A;  3K4K A;  2QSF X;  2EFN A;  4B1R A;  3HRT A;  4KN4 X;  4AYB N;  4JBA A;  2FNA A;  4E70 A;  4DJA A;  4EEF G;  4BDY A;  5L3G A;  3AFH A;  4XKB A;  1JJ6 C;  3OSF A;  2ZXI A;  5DD8 A;  1WZ2 A;  4XLN F;  1FJL A;  2MW8 A;  3E7L A;  1H8A C;  2K5C A;  1X3W B;  3S93 A;  2XGE A;  3ABL H;  4HSR A;  3RIR A;  4R79 A;  5JHF A;  1PUE E;  4ITV A;  2VT3 A;  3F22 A;  3IKV A;  3F21 A;  4Z6Y A;  5DS9 A;  3WGH A;  2IGM A;  4M71 A;  1A35 A;  1EH8 A;  4I0B A;  1YRN B;  4F7Z A;  5M5Y J;  4U88 A;  5IOY A;  4HDV A;  3MD2 A;  2P5L C;  4CA0 A;  1ETW A;  1E3P A;  2L9N A;  1R22 A;  2HS5 A;  1S8N A;  1OYI A;  1PUF B;  1FC3 A;  3K70 D;  3OYF A;  1Q1V A;  1W5C C;  2VBX A;  1KYZ A;  1BA5 A;  1N25 A;  2OUM A;  2UWM A;  1FP2 A;  1WRJ A;  3FX3 A;  3OL4 A;  1H0M A;  2XKO A;  5L3C A;  2G0E A;  1H89 C;  4EJW A;  3H0D A;  3CCJ I;  4BGD A;  5DCM B;  5CQG A;  4CSW A;  2ME0 A;  3ZMS A;  4RLF A;  2LFB A;  2HPM A;  1JXS A;  1QVU A;  1VF9 A;  3GX4 X;  2MBF A;  2KRC A;  1J59 A;  2LSO A;  3ECH A;  1SMT A;  2EIK H;  4BS9 A;  4B48 A;  3S1M J;  1ZG3 A;  3HPG A;  4CYC A;  4ENK A;  5FRN A;  5FO5 A;  2LLK A;  1FZP B;  2DDB A;  2WBM A;  2ZJ2 A;  3IRR A;  4OIO F;  3L2U A;  2NNN A;  5B3S H;  2E60 A;  3ZMV A;  3ELK A;  2R5Z B;  4Y3O A;  1B4A A;  1ZRF A;  2DJI A;  2L0K A;  2NAZ A;  4A12 A;  1P92 A;  1MBG A;  2XUB A;  3ZN1 A;  2A6E F;  5BPD A;  3HEF A;  4D0P A;  2EQR A;  3BCB A;  3HRM A;  1JGG A;  2KDO A;  4QPQ A;  2K9Q A;  3GZ6 A;  3GTO J;  3B02 A;  2P5V A;  2P5K A;  2ELK A;  2IPQ X;  2W24 A;  1TWF J;  2RVC A;  4N4N B;  4XBF A;  4J01 A;  4U7D A;  1KA8 A;  2WB1 A;  2RDP A;  1ETX A;  1WI3 A;  4M73 A;  3OYH A;  1X2M A;  3RPQ A;  4MEX F;  4LK1 F;  1XB4 A;  3VWB A;  1QZZ A;  4DW6 A;  4Q47 A;  3I3L A;  2RNJ A;  2F5F A;  4CO8 A;  5CLS A;  5GPC A;  1ODD A;  3KP3 A;  3I64 A;  2RAE A;  5FRO A;  1EKE A;  2GXG A;  1P6R A;  2OU2 A;  3LST A;  2LH9 A;  5HNF A;  1MJ9 A;  2E5Z A;  2ETH A;  3EQL F;  1A36 A;  3RQ4 A;  3KEY A;  3DPL C;  2BHY A;  2L5Q A;  4WXH A;  2VOO A;  1ETO A;  1AKH A;  3TO6 A;  2QVO A;  3PNY A;  2STT A;  3ZQG A;  4DGW B;  4GCV A;  1P2F A;  5D6F A;  3K0L A;  3CCR I;  4IX7 A;  3QRF F;  1EF4 A;  2X9D A;  3LSP A;  2EIJ H;  5D8L B;  4ZYA A;  1KON A;  1RES A;  1ZEL A;  4CCM A;  1I50 J;  3WTY C;  3PIO F;  3PSF A;  3SHF A;  3N4M A;  5DTD A;  3W2W A;  3K1M A;  4C9Y A;  2NVQ J;  1GDT A;  4AVP A;  4IZZ A;  1TQP A;  5HLI A;  4AVZ A;  2R7R A;  3VSK A;  2MGQ A;  2VKH A;  1J09 A;  4F91 B;  5TRD A;  1FIA A;  1IDY A;  2K40 A;  1N78 A;  2R3S A;  4UNO A;  2HOT A;  2VE9 A;  2EV5 A;  3C7J A;  1SVO A;  1WQ2 A;  2MLK A;  1HW5 A;  3I4P A;  1MSF C;  2W48 A;  3I5U A;  2MSY A;  3HSE A;  1LB2 A;  1TTY A;  4M6X A;  2ZNZ A;  5FKN A;  2LKX A;  2O9L A;  3U21 A;  2IVM A;  1GUU A;  2ZBK A;  5BMZ A;  3I54 A;  4CIC A;  1X2N A;  4PJM A;  4Y17 A;  3CD6 I;  3DTK A;  3FXR A;  5B1A H;  1M1E B;  1HKS A;  2DBB A;  3CC7 I;  2IT0 A;  4AIJ A;  2AHQ A;  1XSX A;  3OYM A;  3S16 J;  3F0C A;  2L4A A;  1UJ8 A;  2Z1D A;  1U8B A;  1S7O A;  3SJM A;  1FLI A;  3BOQ A;  5J6X A;  4A3F J;  4YEJ A;  2NVU B;  1BR2 A;  5KAF C;  3IC7 A;  3WHB A;  1IXS B;  4ZDP A;  3BQZ A;  4ESJ A;  3F72 A;  4JK1 X;  3NQO A;  3A01 B;  1WJ5 A;  2FML A;  1RIO H;  3HG9 A;  1XN7 A;  2KKO A;  3TDU C;  3CME I;  1FYL A;  4HF2 A;  2EFQ A;  2M5W A;  1DPU A;  5HDN A;  4V19 K;  5EZG A;  5AIQ A;  5J4V A;  1ZTR A;  4B47 A;  2JK3 A;  3JRA A;  4XMY A;  4I98 B;  2PLY A;  1HOM A;  1STZ A;  1TQM A;  2VAS A;  3DU6 A;  2MG4 A;  1HKT A;  1TBX A;  4DOZ A;  5KK1 A;  5EF6 A;  2E35 A;  1ZN2 A;  1BC8 C;  2ZSI B;  2E71 A;  4AID A;  5FJ8 J;  1YIJ I;  1YW8 A;  1USS A;  2LY1 A;  1BL0 A;  1P7I A;  3DQV C;  1HXD A;  4ZC3 A;  3ZXS A;  3FWE A;  3PO3 J;  1B72 A;  1MNE A;  1SFK A;  1T39 A;  4F55 A;  2Q1Z B;  4EGY A;  2XDV A;  1WI9 A;  1BI1 A;  2H1K A;  4RA2 A;  3S17 J;  3WE3 A;  1FT9 A;  5IPA A;  1VQ7 I;  3VOD A;  2OJE D;  4BKX A;  2HQA A;  5D5V B;  2A68 F;  4G94 A;  2CG4 A;  1MBH A;  2HKO A;  3LAP A;  1XMA A;  1K4T A;  4L0Z B;  1U9O A;  2BW3 A;  4M6V A;  2LK2 A;  2V1U A;  1W7P A;  4KJZ A;  4HAM A;  1O7F A;  3QPS A;  2BY0 A;  3F6O A;  4II3 A;  5JVG F;  3LMM A;  2NNY A;  4XOR A;  1SAN A;  1DGW Y;  4FHT A;  2M0M A;  2K9S A;  4I6Z A;  1FYM A;  2DK5 A;  2M3A A;  5D5X B;  4E7I A;  3TOA A;  4DYQ A;  2DOD A;  4RAF A;  3M8F A;  5BNG A;  2DMP A;  2X6Y A;  4F93 B;  1LUJ B;  2BYV E;  2HQ5 A;  1NG6 A;  3NWT A;  1ZGA A;  3AL0 B;  5H6R A;  5FKL A;  2WB1 N;  2ZO4 A;  3SEZ A;  4BBR J;  3AAF A;  1RRJ A;  3TGN A;  1MKM A;  2XIG A;  3QYE A;  3HOW J;  2ESN A;  3QAH A;  2DCE A;  2VC0 A;  1V5F A;  2DFH A;  3I55 I;  2NXN B;  4ENN A;  1KYW A;  3PQJ A;  3C2G A;  3GXO A;  4JP0 A;  1FY7 A;  1R71 A;  4P9U A;  1R5G A;  1AWC A;  3FBN B;  3BRO A;  3A02 A;  2LBF B;  5BOX A;  2DFF A;  3RPU A;  2BY1 A;  3VDX A;  2LY9 A;  4HZF A;  1OPC A;  1HW1 A;  3C3W A;  5M3F J;  5FLX K;  4M3B A;  2JVG A;  2D1V A;  3L1P A;  4S0H B;  2VBZ A;  2IW5 A;  2XAS A;  2QEN A;  1OLT A;  1UFM A;  3A2K A;  2HVQ A;  1S6L A;  3NEU A;  2ACJ A;  1Y8R B;  3TO7 A;  1CF7 B;  5HOD A;  4XLC A;  1ITY A;  2QWW A;  2XPU A;  3G4S I;  3CMY A;  1WH7 A;  4FIS A;  3ZOB A;  4ESF A;  4JOM A;  4C3J J;  1LFU P;  2EPF A;  2XAJ A;  4KFC A;  3K4C A;  3U9G A;  1MIJ A;  3FMQ A;  1PJR A;  3WGG A;  4LB5 A;  1WJC A;  1ZLJ A;  5L3F A;  4RGX A;  3ABU A;  4IHS A;  3K2Z A;  2IXS A;  1D5V A;  2GIV A;  2CH0 A;  1B9N A;  3AL0 C;  1EV7 A;  2DA4 A;  3PIP F;  4E7H A;  4CYD A;  3KP2 A;  2NVT J;  2H6C A;  4FE4 A;  4HQE A;  2L9S A;  5EG0 A;  2H94 A;  3S2W A;  3BG9 A;  4RGS A;  2M0C A;  2O8K A;  5C4J J;  3KZY A;  3MFK A;  1MMN A;  2JA6 J;  5FKK A;  5GAH J;  2HVS A;  4AC0 A;  4S04 A;  3J81 Z;  4BQA A;  4H0E A;  3HSR A;  2R5Y A;  1MJA A;  1HLV A;  5E3M A;  5B66 C;  3S3N A;  1G8X A;  2HQN A;  3RKY A;  5IY5 H;  1BC7 C;  3DPT A;  1BIA A;  2HXI A;  2V9P A;  5EEG A;  4Y13 A;  4G7Z F;  1CQT A;  4A3L J;  2CFO A;  1A5J A;  3LQQ A;  1I6H J;  5D5U B;  2BY3 A;  2H09 A;  4UV9 A;  3WTV C;  1D8J A;  2FRH A;  1W7P D;  1ZR2 A;  1XGN A;  2BV6 A;  4IF4 A;  1QVT A;  1KU9 A;  2MLG A;  1YO5 C;  3BJO A;  1QPM A;  5E1W A;  2NS0 A;  3A0B C;  2DA1 A;  3BR1 A;  3LA2 A;  2CV0 A;  3BJA A;  3OIO A;  4LD5 A;  4EJO A;  1Z9C A;  1YX5 A;  4RDU A;  5LRS A;  1DP3 A;  1MMD A;  2EK5 A;  3I53 A;  2BHZ A;  4ASN A;  1MND A;  1TW3 A;  2KT0 A;  5BPI A;  2EZI A;  1BJA A;  2Q0O A;  2JRM A;  5CKT A;  4DBQ A;  3GTL J;  3BR3 A;  2XF6 A;  1QHG A;  4R8H A;  2VOP A;  2WV0 A;  3LWF A;  3U2R A;  2V9K A;  1ZKG A;  1QHH D;  2GA2 A;  2VIX A;  3MMY B;  3Q0V A;  2R4G A;  4XN0 A;  1WCM J;  3CCM I;  3OYA A;  1GT0 C;  4DZJ A;  5J40 A;  2QUF A;  3F3X A;  3OYB A;  2H1L A;  2HVR A;  3UKG A;  1T2K A;  4KNY A;  3QU6 A;  4A3B J;  2H8W A;  2R7F A;  1OFC X;  3OYE A;  3RPU D;  3HUG B;  1MD0 A;  4LB6 B;  5IT3 A;  1XGS A;  4ZYG A;  2HTJ A;  3LOC A;  4ESB A;  1K78 A;  1FYK A;  5FKM A;  5DM7 F;  4S05 A;  2DN0 A;  1B6A A;  1HST A;  2COM A;  1U9N A;  4AYB A;  1TW2 A;  2QLZ A;  3COA C;  3LFU A;  4EM0 B;  4E7J A;  4MEY F;  3TOB A;  2BXY A;  2FXA A;  2CQ7 A;  3K2A A;  3OMY A;  1RUN A;  1FSE A;  2HWV A;  5IYC J;  1P9Q C;  4XKW A;  3SFI A;  3EUH C;  2QA4 I;  4RGU A;  2G7U A;  2MC3 A;  1OR7 C;  3NRV A;  4U0W A;  3ULQ B;  1H9T A;  1R58 A;  1KU3 A;  4HST A;  1RUO A;  2FJ1 A;  2XHK A;  3PFI A;  4RMN A;  3EUA A;  2DMN A;  4A6D A;  5JFR A;  3ABK H;  4UUS B;  2PN6 A;  5M5W J;  1WWX A;  3S1Q J;  2VBW A;  2Y0M A;  1MBK A;  2DO7 A;  2F48 A;  1IDZ A;  3JCU C;  2A3S A;  1YIO A;  3QWL A;  5EDN A;  3WU1 B;  2GXB A;  2LYC A;  4BNC A;  3P9K A;  3GLL A;  3CLQ A;  2R0Q C;  2FNP A;  2DW4 A;  1OCT C;  3U1K A;  4LOC A;  1XS9 A;  1XMX A;  3OIQ A;  1YYV A;  2K9N A;  3EDP A;  2E1C A;  2QKM B;  4II2 A;  1FMW A;  4MHG A;  5JR3 A;  5K5R A;  1JTY A;  4UXN A;  4XLH A;  4XOP A;  1GV2 A;  2WAQ N;  2MFZ A;  2JT1 A;  2V26 A;  2M7B A;  2V7F A;  2BXZ A;  3CMM A;  3L00 A;  3O8G A;  2VB6 A;  4I09 A;  2GOX B;  1GXQ A;  1BI0 A;  2UXX A;  2A6T A;  2I10 A;  4XID A;  2L7F P;  3D0S A;  3ZMT A;  3BT9 A;  2ESH A;  3FHZ A;  2FU4 A;  4B09 A;  2YUS A;  3G73 A;  1LFB A;  3PNT A;  4WXC A;  1WHU A;  4BXF A;  4KIS A;  1YJ9 I;  9ANT A;  4A3G J;  2FQ3 A;  1W1W E;  3GWZ A;  2IA1 A;  3H5N A;  5GAG J;  3H9Q A;  5HS7 A;  1JJ8 C;  4PFP A;  1JI8 A;  5LHH A;  3OOU A;  2JQ7 A;  3IP4 B;  4BQO A;  1U5T A;  3FK6 A;  1YJW I;  2ZJR F;  2D1H A;  3VPR A;  2O5R A;  2X6O A;  5GPA A;  1N77 A;  1VQ5 I;  2H8R A;  2IS4 A;  3S8P A;  2DPD A;  3IWF A;  5LGN A;  1JKQ C;  2HKX A;  3KLN A;  2Y0S N;  1ZH5 A;  4BY7 J;  3T0Y A;  3ZMU A;  3K6G A;  4HA8 A;  1ETY A;  3WTW C;  1Y6I A;  4EVI A;  2O61 A;  5E1X A;  4HQM A;  2XC7 A;  1PP7 U;  1T08 B;  1IAW A;  2KFD A;  2XF5 A;  2P6S A;  1YTY A;  2BE5 F;  3KP6 A;  3NAU A;  2M7A A;  3V7C A;  1XSV A;  3QYB A;  4OAY A;  2Q8K A;  5J47 A;  4ENM A;  3G3Z A;  3JSP A;  3JSO A;  1WKM A;  1K61 A;  5FLX Z;  1MNM C;  3R6S A;  2A5W A;  3SXY A;  2MD0 A;  1SMY F;  5F08 A;  4V2F A;  1B59 A;  2VE8 A;  1VQO I;  2R7W A;  3FMR A;  3M8J A;  1S7E A;  2DFI A;  3I4N J;  2AO9 A;  3WTT C;  3K9T A;  2EZL A;  3TO9 A;  4NUB A;  3KP5 A;  2Q2E A;  1Z7L A;  3Q3S A;  4YIR X;  1O3Q A;  3ISP A;  1UAA A;  3OYJ A;  5FB2 A;  5EGO A;  4A2U A;  4LG0 B;  2VOD A;  2UUZ A;  3KLO A;  4A93 J;  3U1D A;  3P9C A;  4I02 A;  1R7J A;  3ESW B;  4WX9 A;  4C3H J;  4L9V A;  1X4O A;  1K7A A;  5L3D A;  1LQ1 A;  3FIW A;  3BR0 A;  3CJR B;  1A31 A;  1R36 A;  1BW6 A;  3GTG J;  2DA2 A;  3TMO A;  4P9F A;  5F1R A;  3I59 A;  3HHH A;  3ZGK A;  3HDD A;  1R4M B;  2DLL A;  4LGW A;  4NQW A;  3A0H C;  4RAZ A;  4DZP A;  1IRG A;  1KZH A;  1HDD C;  1I1S A;  2WAF A;  5F0F A;  4UB8 C;  3CP8 A;  4B43 A;  4KN7 X;  4BJ5 C;  1CGP A;  1XGM A;  1DDN A;  3V7S A;  3GZN B;  2JA2 A;  1VQ6 I;  1VQP I;  3QOP A;  1IXR C;  2YX4 A;  3DBL B;  1KQ8 A;  1BI2 A;  4HPQ A;  1XMK A;  4Y7N J;  3HOS A;  1D1B A;  1MH3 A;  2OA4 A;  3TED A;  2EIM H;  1YHQ I;  3HRS A;  2E36 A;  3GW2 A;  3TP3 A;  3R0A A;  2CO5 A;  1HBX G;  1OCC H; 
#chains in the Genus database with same CATH homology
 4J19 A;  1U78 A;  1MSF C;  2HOA A;  2W48 A;  3JR9 A;  2MSY A;  5FKN A;  3JRD A;  2LKX A;  3HOV J;  2O9L A;  4XIC A;  4CYC B;  3HGY A;  4IHW A;  3IH3 A;  1RKT A;  1WH5 A;  1RR7 A;  4D5C A;  1GUU A;  4B4C A;  4DYR A;  1X2N A;  2HYJ A;  1TC3 C;  1JT6 A;  4JX5 A;  3GTQ J;  3HOY J;  3ZQF A;  4M3F A;  5J1Y A;  2DTZ A;  2Y31 A;  2XB5 A;  1VND A;  1ORK A;  3LSG A;  2OPT A;  2AHQ A;  2JN6 A;  4ABZ A;  4QIW N;  3F0C A;  3S16 J;  1TWA J;  1U8B A;  3SJM A;  1MBJ A;  4A3F J;  1JKP C;  2DA3 A;  5K7H A;  2XRL A;  3WHB A;  3BQZ A;  3A01 B;  1DU0 A;  3IH2 A;  4BBS J;  2Y9Y A;  3BTL A;  5GP9 A;  5JLW A;  1F36 A;  1IJW C;  5EZG A;  4Y52 J;  1XC5 A;  1ZTR A;  2ZB9 A;  2JK3 A;  3JRC A;  2VKV A;  1IUF A;  3JRA A;  1HOM A;  2FQ4 A;  2MG4 A;  5EF6 A;  2LR8 A;  4X6A J;  5F0H A;  3RQI A;  3Q0U A;  2B63 J;  5FJ8 J;  4JX6 A;  1T33 A;  3DCF A;  1UMQ A;  2P81 A;  1NK2 P;  1BL0 A;  1P7I A;  1FIP A;  1AKH B;  1RET A;  3PO3 J;  1B72 A;  4IHV A;  3HGG A;  3GTM J;  5EGO B;  3GTJ J;  2H1K A;  3S17 J;  1D5Y A;  4XK4 A;  4IEJ A;  1MSE C;  1B8I A;  5IPA A;  4BKX A;  4D5F A;  2JWT A;  4NDL A;  2PMZ N;  4DYC A;  5J1U A;  1MBH A;  1RKW A;  3B6A A;  1U9O A;  4M6V A;  2COB A;  2LK2 A;  1ZQ3 P;  4MLO A;  3QQA A;  3JRG A;  3LSR A;  3JRF A;  3ZQI A;  3QPS A;  3M4O J;  2Y9Z A;  5IYD J;  5FLV A;  1TWC J;  1SAN A;  4I6Z A;  2NVX J;  2K9S A;  1JKO C;  5E3O A;  2DMU A;  3S1N J;  2R92 J;  4DYQ A;  3ZQL A;  2L7Z A;  3LSJ A;  5BNG A;  2DMP A;  3HOX J;  2TCT A;  5IP6 A;  1IRZ A;  2HQ5 A;  2VKE A;  2ECC A;  5IP7 J;  1HCR A;  5FKO A;  3BQY A;  5FKL A;  2WB1 N;  2XGC A;  2X48 A;  4FCY A;  1DU6 A;  4UUT A;  3S15 J;  1K83 J;  4BBR J;  2E2H J;  1JUS A;  3HOW J;  1MBF A;  1Z77 A;  3S2D J;  3HOU J;  3O8H A;  4JYK A;  1HF0 A;  3HB9 A;  2IEK A;  1ETV A;  4JP0 A;  1ZR4 A;  3RZD J;  1TWH J;  4A3C J;  3JRI A;  3A02 A;  1MBE A;  2DA6 A;  2CJJ A;  2LY9 A;  5M3F J;  5JLX A;  3ZQH A;  1LE8 A;  4M3B A;  3JRB A;  2HI3 A;  3L1P A;  4S0H B;  2KDZ A;  2IAI A;  2R7Z J;  3FIS A;  1BJZ A;  1ZK8 A;  3CDL A;  3C2B A;  3BG3 A;  1APL C;  1JTX A;  5HOD A;  1ITY A;  2CQX A;  1WPK A;  2XPU A;  2XPV A;  5EG0 B;  5M5X J;  3CMY A;  1WH7 A;  4GFB A;  4FIS A;  3PO2 J;  3ZOB A;  4C3J J;  1LFU P;  2E19 A;  1BW5 A;  3PM1 A;  2QF7 A;  3GTP J;  2LD5 A;  1MH4 A;  3BTC A;  1TWG J;  2LTP A;  3CQZ J;  2JMW A;  2DA4 A;  2VUM J;  2NVT J;  3RZO J;  2Y30 A;  2XB0 X;  3BR2 A;  5EYR A;  4UUS A;  3FK7 A;  2HXO A;  4FE4 A;  4C3I J;  5EG0 A;  3BG9 A;  5C44 J;  4QTR A;  5E3N A;  2M0C A;  2O8K A;  5C4J J;  1IC8 A;  1T56 A;  5IYB J;  2JA6 J;  5FKK A;  1B72 B;  4XRS A;  4AC0 A;  1YRN A;  3M3Y J;  2R5Y A;  5J1R A;  3HM5 A;  1B8I B;  1H88 C;  1HLV A;  2VI6 A;  4MIM A;  5E3M A;  3OSG A;  2FD5 A;  4QSH A;  3JRE A;  3HOZ J;  1PUF A;  2LVS A;  1O4X A;  2HXI A;  5IOZ A;  1CQT A;  3W6V A;  4A3L J;  1F43 A;  1A5J A;  4MFE A;  1I6H J;  3G1L A;  4G12 A;  1ZR2 A;  2NOG A;  1QVT A;  1JUP A;  3MKL A;  1QRY A;  1XG1 A;  2DA7 A;  2M34 A;  2DA1 A;  3BR1 A;  3OIO A;  1A6I A;  4RDU A;  4A3K J;  3CCY A;  5F04 A;  2JA5 J;  2GLO A;  5F27 A;  1Y1V J;  2KT0 A;  3S1R J;  2EZI A;  3HBL A;  4W97 A;  4HNV A;  4A3I J;  3GTL J;  1RPW A;  2HDD A;  3BR3 A;  4FTH A;  5F1J A;  1W0U A;  3D1N I;  2R5Z A;  3SDG A;  5C4X J;  4RBO A;  2CUF A;  3QPL A;  1ZKG A;  2OF7 A;  4XRM A;  1G2H A;  1GT0 C;  3Q0V A;  1WCM J;  2CRG A;  2ID6 A;  4DZJ A;  3I4M J;  2NVY J;  3UKG A;  4A3B J;  3BR6 A;  2EZK A;  4A3E J;  1AHD P;  1OFC X;  3B6C A;  4L5E A;  4D7M A;  3LNQ A;  3ZQC A;  1Y1W J;  1LE8 B;  2R93 J;  3LOC A;  4X1E A;  5C3E J;  2E2J J;  5FKM A;  4MFD A;  1JUM A;  2DJN A;  2DN0 A;  1U9N A;  2EBI A;  4M3E A;  1UG2 A;  1HDP A;  3IV5 A;  4A3M J;  1QPI A;  2N8G A;  4A69 C;  3K2A A;  3H3V K;  4B1R A;  3G1O A;  5IYC J;  3DEW A;  3SFI A;  1UHS A;  4EEF G;  4BY1 J;  1FEX A;  5EZH A;  3GTK J;  5F0C A;  2XPW A;  2L9R A;  2ME6 A;  1GV5 A;  4AUX A;  1JJ6 C;  4D7N A;  3OSF A;  2ECB A;  2LP0 A;  1IGN A;  1FJL A;  3WHC A;  2MW8 A;  3E7L A;  1H8A C;  2FJ1 A;  2XGE A;  1FTT A;  2DMN A;  4UUS B;  5M5W J;  3BTI A;  3S1Q J;  2JA8 J;  1MBK A;  2GBY A;  2NS7 A;  1WGX A;  2IBD A;  1IDZ A;  5DS9 A;  5EDN A;  2CUE A;  2XSD C;  5M5Y J;  1YRN B;  3A03 A;  5IOY A;  1GVD A;  4M3D A;  4B3A A;  1ETW A;  2R5Y B;  2R0Q C;  1JT0 A;  2E1O A;  2JA7 J;  1Z0X A;  1OCT C;  1I3Q J;  4LOC A;  5E3L A;  1XS9 A;  1PUF B;  1Q1V A;  2K9N A;  1BA5 A;  3IH4 A;  2E2I J;  2M2E A;  2O7O A;  1JTY A;  2G0E A;  1H89 C;  1GV2 A;  2WAQ N;  3O8G A;  2QCO A;  5K7Z A;  1AU7 A;  2ME0 A;  2LFB A;  1QVU A;  1VF9 A;  2I10 A;  4XID A;  2L7F P;  2M9H A;  1E3O C;  3BT9 A;  2Y2Z A;  1NTC A;  3GBG A;  4IHX A;  3S1M J;  4CYC A;  2YUS A;  1LFB A;  2LLK A;  3MN2 A;  3NAR A;  3RKQ A;  5IP9 J;  2FX0 A;  9ANT A;  4A3G J;  2GM4 A;  1JJ8 C;  2R5Z B;  3OOU A;  2DMQ A;  3FK6 A;  2L0K A;  3VPR A;  3S14 J;  1MBG A;  2X6O A;  5GPA A;  3HEF A;  4MO7 A;  2H8R A;  2EQR A;  2WV1 A;  3TW6 A;  2L7M P;  4C2M J;  2VPR A;  2CU7 A;  2HOS A;  1JKQ C;  1JGG A;  2Y0S N;  4BY7 J;  2K9Q A;  3GTO J;  1JKR C;  3A01 A;  2ELK A;  4V2G A;  1TWF J;  1ETY A;  1POG A;  1W0T A;  1OJL A;  2JJ7 A;  1FTZ A;  1ETX A;  1OCP A;  1WI3 A;  2CQQ A;  3FKI J;  3NAU A;  1X2M A;  5M3M J;  3K7A J;  4DW6 A;  4IHY A;  3BR5 A;  2EH3 A;  5GPC A;  2RAE A;  1K61 A;  1MNM C;  2DA5 A;  3HKZ N;  4M3G A;  5F08 A;  3TW7 A;  4V2F A;  3BG5 A;  1S7E A;  4A3J J;  1P7J A;  5J3L A;  3I4N J;  1ETO A;  2AO9 A;  1AKH A;  2XGD A;  2EZL A;  1SFO J;  3Q3S A;  3TP0 A;  2M8G X;  3ZQG A;  5EGO A;  4BXX J;  4XRS G;  2EZH A;  4A93 J;  1ZGW A;  4W1U A;  1EF4 A;  2X9D A;  4C3H J;  3LSP A;  5K7F A;  3MVP A;  4I76 A;  1X58 A;  1RES A;  3FIW A;  1I50 J;  3BR0 A;  2ID3 A;  4JX4 A;  2TRT A;  2YU9 J;  1BW6 A;  3GTG J;  3H0G J;  5DTD A;  2DA2 A;  4FE7 A;  2NS8 A;  3HDD A;  4DZP A;  2NVQ J;  1VI0 A;  2DMT A;  1GDT A;  1HDD C;  5F0F A;  3Q0W A;  1VFC A;  1IG7 A;  2YS9 A;  1R9T J;  3S2H J;  3BTJ A;  2MGQ A;  3G1M A;  3JRH A;  2D5V A;  1IV6 A;  4Y7N J;  1FIA A;  1ETK A;  1ETQ A;  1IDY A;  1MH3 A;  2K40 A;  1NK3 P;  3TED A;  2HOT A;  4A3D J;  5FLM J;  3TP3 A;  5EEA A;  4AYB N;  1ENH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...