2CQXA

Solution structure of rsgi ruh-034, a homeodomain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
b'GSSGSSGGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVRKIQCWFRHRRNQDKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LAG1 longevity assurance homolog 5
publication title Solution structure of RSGI RUH-034, a homeodomain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 72
sequence length 72
ec nomenclature ec 2.3.1.24: Sphingosine N-acyltransferase.
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cqxA01
4M3DA 1NTCA 3ZQCA 1U9OA 5M3FJ 1FIAA 3S15J 4HNVA 2NS8A 3ZQGA 2WAQN 2ID3A 3GTKJ 3BG3A 1IRZA 1QRYA 4M3BA 4AYBN 1JT0A 2QF7A 1K61A 2NVXJ 2N8GA 2OPTA 4C2MJ 4DZJA 2M0CA 1X2MA 2CUEA 4A93J 5GPCA 2LTPA 3FKIJ 3FIWA 3GTJJ 3RZDJ 2YU9J 3HGYA 3JRGA 1Y1VJ 4FCYA 5F0FA 2IBDA 1POGA 4MLOA 1SANA 2XPUA 3DEWA 4D7NA 4C3HJ 3CDLA 3F0CA 5M5XJ 1ZKGA 2LKXA 3LSRA 5BNGA 1FJLA 3IH2A 1P7JA 2B63J 4M3GA 4XIDA 2EZKA 1AHDP 1HDPA 1MBFA 4B1RA 4GFBA 5IP7J 3FK7A 5J1UA 1MBJA 2IEKA 4DW6A 3G1MA 3NAUA 1Z0XA 2X48A 3HKZN 3JRAA 2R92J 1ETKA 3CCYA 4D7MA 2E2HJ 2DMQA 2GBYA 1ETYA 2Y9ZA 2E2IJ 5IYBJ 4A69C 5E3OA 3GTQJ 4XRSG 3S17J 1G2HA 2EBIA 4XICA 2HOAA 4BY7J 1IUFA 2AO9A 3HM5A 1FTZA 5IOZA 1Z77A 1FTTA 3FISA 1TWCJ 2CRGA 4MO7A 1ETXA 2LFBA 3G1OA 2ECBA 3M3YJ 4EEFG 2CU7A 5F0CA 3SFIA 2MGQA 3HB9A 2YS9A 5EF6A 1LFUP 1OFCX 3SJMA 3FK6A 1IDYA 1RETA 3I4NJ 1B8IB 2HQ5A 3L1PA 2DA2A 1GV2A 3BQZA 1S7EA 1JUMA 5FLVA 1R9TJ 5FKLA 2NVTJ 2XSDC 2XGDA 1A5JA 2DTZA 2LR8A 2LK2A 1NK2P 5J3LA 5FLMJ 1IJWC 1A6IA 1ETQA 2JK3A 1ITYA 3JREA 4L5EA 3RQIA 3OSGA 4LOCA 1JGGA 1D5YA 5E3NA 4X6AJ 1GDTA 2P81A 5GPAA 2K40A 5F0HA 2R7ZJ 4V2FA 1XS9A 3S2DJ 2DA7A 4QIWN 2MW8A 4UUSB 2K9NA 2MG4A 3GTMJ 1K83J 2K9QA 1TWHJ 3BR3A 1ZK8A 2HOSA 1B8IA 5EG0B 1QPIA 3PO3J 2XGCA 4UUTA 3I4MJ 2O9LA 2WV1A 2XPVA 2FX0A 1JKRC 1ENHA 2HI3A 3TEDA 3HOUJ 1H8AC 3S1RJ 3WHCA 2H1KA 3O8HA 3B6CA 3S14J 2MSYA 5FKNA 2OF7A 3SDGA 1JKOC 1MSFC 1MSEC 5EGOB 1AU7A 1Q1VA 5EYRA 2JA8J 4A3LJ 2CQXA 2CUFA 3OSFA 5M5YJ 1U8BA 1I6HJ 3Q0UA 1FIPA 2R5YB 4QTRA 4M3EA 1WCMJ 4A3EJ 4A3FJ 3TW6A 1WH7A 3LSGA 5F08A 4UUSA 3HOWJ 3BTCA 4DYQA 2RAEA 3JRIA 3ZQFA 4D5CA 4MIMA 5M5WJ 4JX6A 2O7OA 1JUSA 1HOMA 2W48A 2NOGA 1HCRA 5EG0A 3PM1A 2EQRA 1SFOJ 3LOCA 1UHSA 1GVDA 5IP6A 3QPLA 1ETVA 2YUSA 3UKGA 3VPRA 1XC5A 3ZQHA 2R93J 2DN0A 1H88C 5EGOA 3BG9A 2LY9A 1ORKA 5J1YA 1H89C 1ZGWA 3BQYA 3TW7A 5F27A 5C3EJ 4JX4A 5HODA 2DA3A 2R5YA 1IC8A 1YRNA 2VKVA 2XPWA 1LFBA 3H0GJ 3BR1A 4DZPA 1MNMC 4JP0A 4V2GA 3HOXJ 1T56A 2VKEA 1XG1A 1WH5A 4MFEA 4I6ZA 3O8GA 9ANTA 2ME6A 3ZQLA 4S0HB 1RPWA 2X6OA 1X58A 1VFCA 1ETOA 1JUPA 2DMTA 1TWGJ 3BTLA 4J19A 3S2HJ 2E2JJ 3OOUA 2XGEA 4W1UA 4FISA 4BBSJ 3BR0A 2LD5A 3MKLA 2E1OA 1GT0C 2HOTA 4DYCA 4IEJA 1LE8A 1MH3A 4RDUA 4A3KJ 3ZQIA 1TWAJ 3GTOJ 1MH4A 1HDDC 2H8RA 2TRTA 5IYDJ 3LSPA 4NDLA 3CMYA 3ZOBA 1F43A 4A3MJ 5JLXA 2NVYJ 5K7FA 3RZOJ 4Y52J 2COBA 5FKMA 2WB1N 2VUMJ 1ZR2A 3HBLA 2NVQJ 2XB0X 2KT0A 1F36A 2JA5J 1GUUA 1JTXA 4A3BJ 1JT6A 2Y30A 3DCFA 1WI3A 2VPRA 1RR7A 2FJ1A 2R0QC 1U9NA 1Y1WJ 3E7LA 2JWTA 1JKPC 1OCPA 4G12A 4FE4A 1TC3C 3BG5A 3LNQA 2M34A 1ZQ3P 4MFDA 4I76A 2HXOA 2DA6A 3B6AA 1JKQC 5E3MA 1E3OC 3A02A 2G0EA 1RKTA 3TP0A 2TCTA 3BR2A 3OIOA 2NS7A 4M3FA 3MVPA 5IYCJ 2DMUA 4CYCB 4BKXA 5FJ8J 2LLKA 1ZR4A 3GBGA 1HLVA 2Y2ZA 2DJNA 2JA6J 2PMZN 3MN2A 2O8KA 2HXIA 3BTJA 3GTLJ 2EZLA 4C3JJ 3QQAA 2CQQA 1BJZA 2E19A 1YRNB 1DU0A 1IG7A 1DU6A 3JRHA 2M9HA 4JYKA 2ELKA 2DMPA 3A03A 5EDNA 1OJLA 2EZHA 1JTYA 5DTDA 2Y0SN 3CQZJ 1NK3P 2EH3A 4FE7A 4BXXJ 5DS9A 1W0TA 3WHBA 3G1LA 3BR6A 4IHWA 2EZIA 4A3JJ 2L0KA 2D5VA 1MBKA 1OCTC 4XK4A 2KDZA 1MBHA 4RBOA 3S1QJ 1MBEA 1QVTA 4A3GJ 2JJ7A 2L7ZA 5F1JA 3Q3SA 4CYCA 1RESA 1AKHB 1LE8B 2DA1A 4AUXA 1TWFJ 2Y31A 2HDDA 2DA4A 2JN6A 3Q0WA 5J1RA 3JRDA 3IH3A 3BTIA 4BBRJ 3IV5A 3S16J 1B72B 3C2BA 2M8GX 1FEXA 3M4OJ 2GLOA 1IGNA 2K9SA 4XRSA 1VF9A 2FQ4A 1HF0A 1RKWA 5FKKA 5IOYA 4QSHA 3BT9A 1WPKA 3TP3A 3IH4A 5EZGA 5C44J 4BY1J 3A01B 4FTHA 3QPSA 3GTPJ 4ABZA 1X2NA 2AHQA 2XRLA 4B4CA 1IV6A 5IPAA 3NARA 1U78A 1UMQA 1BW5A 2QCOA 2HYJA 1I50J 2LP0A 3HGGA 3Q0VA 1WGXA 5EEAA 3HOZJ 1AKHA 1UG2A 4IHVA 1MBGA 1PUFB 2L9RA 3K2AA 3S1NJ 5C4XJ 2L7FP 2R5ZB 1B72A 1JJ8C 2IAIA 2VI6A 5M3MJ 4JX5A 2ECCA 4XRMA 1ETWA 4Y7NJ 4A3CJ 1P7IA 1BA5A 2GM4A 4A3IJ 4IHYA 3D1NI 5F04A 1T33A 3BR5A 4W97A 1ZTRA 1APLC 5IP9J 3RKQA 2I10A 1JJ6C 3K7AJ 3JRFA 5GP9A 1I3QJ 2M2EA 3A01A 3H3VK 1BW6A 2LVSA 1QVUA 5K7HA 2XB5A 3LSJA 4DYRA 2ID6A 4B3AA 1VNDA 1O4XA 3PO2J 2X9DA 2CJJA 2L7MP 3HDDA 1EF4A 1IDZA 3S1MJ 4C3IJ 5FKOA 3JRBA 3HOVJ 2JMWA 3W6VA 3GTGJ 5EZHA 1CQTA 2DMNA 2DA5A 2ME0A 1BL0A 4D5FA 3HEFA 3HOYJ 1PUFA 4A3DJ 2ZB9A 4M6VA 5JLWA 4X1EA 2JA7J 2R5ZA 1VI0A 5E3LA 1GV5A 3JRCA 5C4JJ 3JR9A 4AC0A 1W0UA 2Y9YA 2FD5A 4IHXA 5K7ZA
chains in the Genus database with same CATH superfamily
2EV6A 1U9OA 2KISA 3WTSC 3S15J 4HNVA 1ODDA 3OV8A 3QWLA 3WG7H 2ID3A 1HW5A 3BG3A 3FHNA 4AYBN 3SZGA 2DT5A 3K4BA 3LSTA 2HPMA 4ESJA 4KIBA 2FOWA 1X2MA 3SYTA 2XAFA 2CUEA 4A93J 2EA2A 4B44A 1D1BA 3FKIJ 3RZDJ 4EQQA 1A36A 1OCZH 1YHQI 1E17A 2DYSH 3ERMA 1SFKA 1K4SA 1XSXA 2BVLA 4KA4A 2GAUA 3CDLA 3CCLI 2QA4I 5FFZA 5M5XJ 2CV0A 2LKXA 2XIGA 4I0BA 5BNGA 3LSRA 2OA4A 2Q2EB 2GXBA 3IH2A 2ZFWA 2R7QA 3DQVC 3SZTA 2XGXA 2M4GA 1P92A 3DEUA 2DK8A 5J1UA 2FSWA 2Y0MA 1S7OA 4PSXA 3G1MA 2H6CA 2X48A 1FC3A 3JRAA 1SAXA 2R92J 1W4MA 3CCYA 3NEUA 4D7MA 3RPUA 1J0RA 2DMQA 2GBYA 2R7WA 2E2HJ 1ETYA 2Y9ZA 1ZH5A 2VE8A 3LAJA 3J7AO 3O6BB 2D1HA 3GTQJ 1WJDA 2F4IA 5BQTA 1FOXA 4GDFA 3QYEA 2WBMA 3K4LA 5IOZA 5L3GA 3E6MA 2E1CA 3ULQB 5HDKA 1ZG5A 1ETXA 2M8EA 4EEFG 2D2WA 1B1BA 3K4CA 2BHYA 2MGQA 2QZ8A 4ZYEA 3F23A 4OIRF 2HDWA 4G7HF 3T8RA 1IDYA 1KA8A 2XROA 4HLYA 1B8IB 4HNUA 3L1PA 1V55H 3F72A 1R9TJ 2L4AA 2VIXA 2W24A 3MQ0A 1A5JA 3LA7A 2KIFA 3CTAA 3DKXA 1R23A 4RGUA 4F55A 3G4SI 4LFUA 4EATA 1Z05A 4RMNA 2BE5F 4BNCA 4L5EA 1EJ9A 3E3VA 1XGMA 3E0JB 1IZ1A 1D5YA 1T0FA 2V6CA 2DW4A 3GLXA 1TQMA 5GPAA 4WX9A 3HL2A 1I6XA 1QNTA 4U7BA 1RR8C 2XV4S 1DGRM 2L4MA 2R3SA 2VQHA 2G7HA 4UB6C 3HZJA 1YW9A 4XR6A 1P9QC 1MD0A 5D8KB 2W00A 2RDPA 2MLKA 1BOAA 2ZC2A 2JQ7A 5KK1A 1OMIA 1Z3YA 4GCVA 1TWHJ 2FNPA 2PJRB 3CO7C 1QA6A 1ZK8A 2L01A 3K10A 4L0YB 1B8IA 3IRRA 2L9NA 5KVRA 4B3XA 2H6BA 2DFHA 2ZJPF 1R22A 5D4SA 3CDHA 3ZXSA 1G3TA 4JK1X 4UUTA 5E79C 2WV1A 3HRSA 2DDBA 2FX0A 4RM3A 5DD8A 3Q5FA 1FPQA 4U88A 2YPRA 2LMDA 2K86A 1Z7LA 4CCKA 2H1KA 2DPDA 3B6CA 4L18B 2V1UA 2MSYA 2P5KA 1FBSA 2BY2A 3H5RA 2BGCA 4IRGA 4PZJA 4XKVA 5J40A 3S2WA 3J81K 5EGOB 1AU7A 1MSFC 5EYRA 2JA8J 1IF1A 3UNGC 3AG1H 3VB2A 5CKTA 3OSFA 3GVAA 4O6JA 3ZP5A 1FIPA 3SEQA 3O3KA 3VYSB 1HSTA 3GWZA 3MWMA 3QOPA 3QP6A 5DM6F 4A3EJ 3TW6A 3C2HA 3CD6I 3HOTA 2HVSA 2FMLA 4XLHA 5ICEA 4YFNF 2CH0A 2PJRA 3R6SA 2NOGA 3N97A 1HCRA 4DBQA 5HLTA 5TRDA 1OYYA 4MTDA 3CESA 1S8NA 5CQEA 2MABA 2XSJC 4RGXA 3BZCA 3BP8A 3QPLA 4UVBA 5DD4A 1A31A 4GRIA 2ZXHA 2IS4A 3MEXA 2R7UA 2ACJA 4LGWA 1XSVA 2V6EA 2LNBA 3OYMA 3K4KA 2BHZA 1I1SA 2HVQA 4BXFA 2LC2A 2R93J 4F93B 4XSZF 4HQEA 5EGOA 2H8WA 1G6NA 4J01A 1ZGWA 2LF8A 3BQYA 1H0MA 3TW7A 1A04A 2HKXA 5F27A 4YRVA 2BVMA 4KN7X 5L3FA 1U6GA 1G3SA 2BEOA 3ZR8X 5CVVA 1IC8A 1P4AA 2XPWA 4X0GA 4HEA2 1LFBA 4DZPA 2JSCA 3T5XA 2PJPA 2VKEA 3ZMVA 1TLHB 1HKSA 2M0MA 3PUFA 2QSHX 4MFEA 4WXHA 2H94A 2FF4A 4I6ZA 3O8GA 3CCUI 1R5ID 3ZQLA 2H1LA 4U0WA 5HLGA 1O7FA 2MD5A 2WC2A 2GOMA 4D0PA 1ETOA 4HF0A 2I8DA 3TL4X 2Z9OA 1W1WE 3ABLH 2VONA 1UHWA 1ON1A 4FISA 3COAC 2FEZA 4BBSJ 3PNYA 4BHBA 2LG4A 1DQUA 2HOTA 1GHCA 2QWWA 1LE8A 1LEBA 1MH3A 2V9VA 1FNNA 2CG4A 3ZQIA 1DGWY 3DWLE 2E60A 3GTOJ 2ZBKA 1LVKA 4K2EA 5IYDJ 3LSPA 3CMYA 3CLOA 2Z99A 3OYKA 2ZCWA 4A3MJ 3RZOJ 2NYXA 4Y52J 4P1WA 3F3XA 2VUMJ 3E5UA 4RAYA 3HBLA 1SFXA 2R7XA 2DOEA 2WAEA 1F36A 2LBFA 1GUUA 1RUOA 4AIHA 3EQLF 1BI3A 4IVNA 4NBQA 2OV7A 2FJ1A 5FD6A 1QZYA 2B7EA 2R0QC 2H27A 1XMKA 4PJLA 1U9NA 1Y1WJ 3E7LA 2JWTA 3BG7A 3H3UA 3RCOA 4G12A 3FX3A 3MFKA 2F2EA 5L3DA 1R36A 1X1CA 2DA6A 1E3OC 1W7PA 4HV5A 3BR2A 4M6XA 3ECOA 2IW5A 2DFEA 2DMUA 3M1EA 5FJ8J 3JSPA 3BWGA 4I09A 4GO1A 1XSDA 1HLVA 2Y2ZA 1TZLA 5L3EA 3DPLC 4ZDLA 1ZREA 1MJAA 2ZKZA 3HUGB 3CJNA 3OYJA 4M9SA 5JVTA 4CXFA 2R7DA 2VKDA 4IRHA 1M1EB 1V4RA 2W84A 4MNUA 3QQAA 4OIQF 1BJZA 3A4CA 1S5LC 1PDNC 2E19A 1YRNB 4Q5SF 3DXJF 3DKWA 2KP6A 5GADJ 5DUIA 5ERIA 1G59A 4QPOA 4QPQA 2HDCA 1IUYA 2ZMEA 4L5IA 5EDNA 1JTYA 2YX7A 2Y0SN 3BZKA 3HKZA 4UXNA 3K0LA 2VODA 2JVGA 4BXXJ 3FXRA 4HX8A 3WHBA 1Y56A 1S29A 3ASNH 2EZIA 3WGIA 4G6TB 3ZMUA 2XKOA 1BC7C 4XK4A 3C3WA 2HQRA 5KAIC 1YJ9I 1MBHA 3OYAA 3M9AA 1ZN2A 2V79A 2QVOA 3WGHA 3P9IA 1MBEA 3ZN0A 4EM0B 3P9KA 2JJ7A 2HTSA 4PFOA 5BOXA 1IN8A 1ZARA 1RESA 2V7FA 1AKHB 2DA1A 1TWFJ 4CCOA 4UUVA 2DA4A 3MD2A 4M6YA 3VYRB 1XMAA 4FQGA 4EGYA 5EJCA 5J1RA 3HUGA 5LRRA 4I02A 3KP2A 1P4XA 3WTVC 3M4OJ 4EM1A 2GLOA 1IN5A 4LB6B 1VQ4I 4IRIA 2ICWG 1YIJI 1VF9A 1HF0A 4CO8A 5FKKA 5IOYA 4EJWA 2VBXA 4IHSA 2NAZA 2V26A 1FBQA 3NWSA 3PQJA 5C44J 1OISA 4FTHA 4IXAA 3QPSA 2FOKA 3L2CA 3S3OA 2CW0F 3U2RA 2UWMA 5TJJA 3RQ4A 3GXOA 4B47A 1SVLA 3QPTA 4A0XA 5LHIA 4N4OB 2DOFA 1JI8A 2K27A 1LDKB 1BW5A 1H9GA 1U5TB 1HA8A 2WY7Q 2EK5A 3TOAA 2LP0A 2LF7A 2EIJH 2ETHA 2IA2A 3BC8A 5F1RA 1TQIA 3CZ6A 5EEAA 1UFMA 1AKHA 3HOZJ 4AIDA 2L9RA 3K70C 4II2A 2GQQA 3S32A 2F6CA 4XONA 3GF2A 4C2UA 3TDUC 4A3CJ 1WKMA 2GM4A 2W57A 5D6FA 4F7ZA 5F04A 1F1ZA 1WVRA 1D1CA 4W97A 5IY5H 1Z91A 2OJED 2W7NA 3JRFA 4WK8F 2F48A 2M2EA 2E5ZA 3H3VK 1MDMB 5K7HA 3A2KA 2X1EA 2DU9A 2ID6A 5FGMA 2QQ8A 5E18F 1SVOA 3MMYB 2VJJA 4XLEA 1QHHD 2X9DA 3RSNA 2IS2A 2L7MP 3OL4A 3L9FA 1IDZA 1VQNI 4C3IJ 2CUJA 5HVQC 1MMNA 1U5TA 2JMWA 1Y8RB 3W6VA 4AIKA 1CQTA 2DA5A 1LDJA 2DPUA 3SEZA 2FRHA 2I5UA 3HEFA 2CV1A 4M6VA 2AXLA 3U1DA 3KZIC 3ML6A 2TDXA 4M72A 3R60A 5E3LA 4YG2F 1GV5A 3ROUA 3JRCA 5C4JJ 3JTGA 4N9HA 1OQYA 4AC0A 4HOBA 2WADA 1W0UA 2FD5A 4CHUA 1ZGAA 2ELHA 2VASA 4A2UA 2QQBA 4ZJZA 5GAEJ 2M5WA 3ZQGA 3I53A 3CCRI 4YFXF 2KJCA 1G8XA 3DV8A 4BQQA 1K79A 2ADUA 3KEYA 1JT0A 2QF7A 1OYWA 1LJ9A 3GZ6A 1Z3XA 1MDMA 1WHUA 2OC6A 2N8GA 3OWTA 2VE9A 4C2MJ 4DZJA 3HRUA 3CJQB 4HAMA 5ILSA 2AXTC 2XAQA 4A0ZA 1KQ9A 1MJ9A 2DK5A 2LTPA 3GTJJ 3HGYA 5CQGA 4Z6YA 4ANJA 4RLQA 3T1BA 1WJAA 4MLOA 1SANA 2XPUA 3DEWA 3OIPA 2DT7B 4D7NA 5E17F 2IPQX 3HHGA 1XN7A 3F8BA 4G7OF 1QO0D 2YU3A 2P7CB 3CUQC 3MAJA 1V54H 4LG0B 1J7KA 2BBYA 4XIDA 1YJWI 2EZKA 1ZHFA 1S9HA 3I9V2 4ASNA 2RN7A 5IP7J 4J00A 1YG2A 3FK7A 4HZFA 4OAZA 4BQOA 3IRQA 2IEKA 3MZYA 3CF2A 3OYHA 2LYCA 4XKCA 2QUFA 3NAUA 1YW8A 3HKZN 2E2IJ 4P96A 5GTIC 4A69C 1IN4A 3CCMI 3K69A 2XAJA 5E3OA 3KPHA 4XRSG 2HZTA 1OCOH 3CP2A 4UNOA 3S17J 1ZELA 2P5LC 3F8FA 3C7JA 2OTLI 1FSHA 4XICA 2HOAA 2NNNA 2AO9A 1FTZA 4ON0A 2MLGA 3IHUA 4FASD 2XKPA 2UXNA 2E7WA 1Z77A 4BE0A 3FISA 2CRGA 3G1OA 4XN3A 4KMFA 2ECBA 4HX4A 4DOZA 3M3YJ 1T98A 1UG0A 3ZQ7A 3HB9A 2YS9A 4PJNA 4O3MA 5E8GA 2DT6A 3FK6A 4LITA 2F4OB 2LH9A 2PEXA 4LG0A 3HRTA 3SJMA 1V3FA 2VQCA 1QU3A 3R0JA 4OMZA 4PK4A 4KT6A 3BOQA 4OAYA 3BQZA 3U1KA 1S7EA 3GW2A 3IAS2 1JUMA 3FMSA 5FLVA 1N77A 2XSDC 2EB7A 2DO7A 2KDOA 2OZ6A 3MZHA 2LR8A 1WRJA 3LFKA 2IP2A 4Y15A 4BQNA 1UAAA 5FLMJ 1W5CC 1DP3A 1A6IA 1ETQA 2FNAA 1IRGA 4XRFA 2JK3A 2VOOA 2NNYA 1FWZA 3GFMA 4MEYF 2Z1DA 4R79A 1VQ7I 1SAUA 2IVMA 3OSGA 5E3NA 4LLGF 4X6AJ 4CH7A 4KISA 3QODA 2K40A 5F0HA 5L3BA 1R1VA 4XOTA 2R7ZJ 2LY1A 1IN6A 1EKEA 3EUAA 3CJRB 1I5ZA 2DA7A 1E3HA 2FQ3A 4UUSB 2EFWA 3LWFA 2NS0A 3ABUA 3GTMJ 4E7LA 1EV7A 1X1AA 2FUG2 2X6YA 1NG7A 2RQPA 1KU2A 3VFZA 1QPIA 5ICCA 1MMAA 1SVMA 1HQCA 3PO3J 2XGCA 3I4MJ 5CVRA 2BXYA 1JKRC 1ENHA 4BGDA 2PI0A 3HG9A 5D8LB 4G6DA 2LOOA 4DBRA 1H8AC 2KRFA 4NB5A 1O3SA 2KRCA 4XM3A 1BJAA 4GYGA 2A07F 5FKNA 3SDGA 3AL0B 4Z2YA 3BZ6A 4Y3OA 1BR4A 2VC1A 4ZDOA 3GLLA 2A5YB 4BDZA 2W25A 1GVJA 2R5YB 3QAHA 4M3EA 1GXPA 4A3FJ 3PIOF 2WV0A 4UUSA 4PGHA 2A69F 4JX6A 1L3LA 3VOEA 1REPC 1BR2A 4XOPA 1F9NA 2W48A 2LRDA 1XCBA 5BPDA 4EJOA 2RC4A 2VBYA 2EQRA 1YE9A 1SFOJ 2STTA 3LOCA 1IN7A 3WGGA 1UHSA 1GVDA 2EJRA 4A12A 4WCGA 4D1QA 3UKGA 1WI9A 1SFUA 4JBAA 4YIIA 1YITI 1XC5A 2VB6A 4I98B 2XF5A 1Y39A 2DN0A 4Q4ZF 1G3WA 5AIQA 3FM3A 1ORKA 5J1YA 5ED4A 1H89C 2DJIA 1MMDA 1WJBA 4BEHB 1T39A 4JX4A 1W36C 3FM5A 3RYPA 2DA3A 2R5YA 1TP4A 1YJNI 2M7AA 3OYNA 4U7DA 5BS6A 5HS8A 3F8NA 1CF7B 4CCNA 2OAZA 2F5DA 2RQQA 4JP0A 1T56A 2Z33A 4ZTJA 3JAMK 4I01A 3I58A 4IZZA 5FROA 3L00A 2MA3A 4XLNF 4XKBA 2K02A 4H4KC 4II3A 5KCMA 3WODF 1VFCA 4CGZA 3TKYA 1TWGJ 4IJAA 2VT2A 1WFXA 2MYSA 5J4YA 2KIMA 3A0HC 1V5EA 1WSUA 4RS8A 3DP7A 3BR0A 2DQRA 2E1OA 2DLLA 3K2ZA 4ZYAA 4RDUA 1NHAA 3FDYA 3IWZA 1TWAJ 2E36A 4BEHA 1FYMA 2KL4A 4A6DA 2JUCA 4N9IA 2X1CA 5JLXA 5K7FA 4ZH4F 3DEEA 2AS5F 4UVAA 5FKMA 3LL7A 2CV2A 2IRFG 1CF7A 2HQAA 2QM3A 4BL0B 4LLNA 4BAYA 1OCRH 1JTXA 2MBFA 3TGNA 3QRFF 2Y30A 4LK1F 3HC7A 4PFPA 2C6YA 3TBIA 1YS7A 1OCPA 2X6WA 4P5OA 1WJFA 3BG5A 1FZPB 1U2WA 1ZQ3P 3G3ZA 1EH6A 2K4JA 2HEOA 1JKQC 4HLXA 5E3MA 5TISC 3EUKL 4JQFA 3OY9A 3A02A 2K7LA 4PSWA 2TCTA 3DU5A 2Y0SA 3LQQA 2Y48A 4M3FA 1RNLA 1Z1DA 5FLXK 3TDZC 3TO9A 5IYCJ 4BKXA 2NRAC 5HNFA 2ZXWH 3ABMH 3HJEA 3K4JA 2DJNA 2JA6J 2VQGA 4XORA 1X1PA 4ENKA 2O8KA 1R58A 3W6KB 4KIGA 2BY0A 2HXIA 3M8JA 4C3JJ 2EWNA 2QKLB 3KFWX 5KAFC 1IG7A 1GXQA 2RKHA 2V9PA 1Z7UA 3TO6A 4IQ4A 3CLQA 3H9JA 4JYKA 3ZMTA 2DMPA 2CUZA 2CQNA 5FFXA 4UV8A 2GZWA 3ZPLA 4IKFA 4AVZA 3KETA 1OJLA 1TBXA 2EZHA 4KIFA 3T8TA 3CQZJ 3WTUC 1NK3P 4HF2A 2A68F 2EH3A 4FE7A 3AG4H 4E4HA 5DS9A 3W6JB 3QOEA 4XSXF 5J8FA 3BR6A 4A3JJ 1IXRC 1EA3A 2G7UA 2X4HA 4U87A 1X1BA 3IP4B 2ZJQF 4RBOA 4CCJA 4ZDPA 5K5RA 3RTRA 4L5JA 2FMYA 2M7BA 3Q3SA 3ECHA 1Z6TA 5D5UB 1X3ZB 2E1MC 1LE8B 2QQ9A 2LSOA 3Q0WA 2Z3YA 5CJ9A 3IV5A 2QEXI 3WTZA 4HSRA 1X4OA 5B66C 1B72B 1YOVB 2M8GX 5CYVA 2A6EF 3MKZA 2IXSA 5BMZA 3K1PA 5E1WA 1RKWA 2EFOA 3MKWB 4PCQA 2LBFB 1IV8A 1FOYA 1KU7A 1T2KA 3MKYB 4NC6A 3LAPA 3JSOA 4IO9F 3GTPJ 1MNDA 5FRNA 1N75A 1KGSA 4XLFA 3PFIA 1IV6A 5IPAA 4RB0A 3N4MA 1MJBA 2DOAA 3E6CC 1W36D 2K85A 3NARA 1U78A 3VWBA 4G7ZF 1UMQA 1ERDA 1X19A 3ZMZA 3CP8A 1W7PB 1I50J 4ZC3A 4LK0F 1D0XA 3Q0VA 3A0BC 1X3WB 3KYLA 3HTSB 4IHVA 4UY8I 5C4XJ 1LUJB 1ZGJA 2OU2A 3ERED 2R5ZB 1B72A 4OMYA 1BI0A 4XRMA 2JVHA 2PQ8A 1P7IA 3DBRB 1BA5A 4UV9A 2HU9A 3D1NI 1J9IA 1T33A 1B4AA 3RKQA 1F4KA 1SD7A 2GA1A 1AA7A 3K7AJ 1YLFA 2DBBA 2E35A 1BW6A 2ZMEB 3SQNA 3LSJA 3KP3A 2IGKA 4CZCA 4NC8A 4YELA 3PO2J 2XDVA 3HDDA 4BE2A 5BPIA 3DKYA 4U0VA 3WTWC 3KYDB 1OR7C 3CO6C 1WJCA 5JVGF 3RI4A 5LRSA 3GMEA 4XLPF 2ZNZA 4KFCA 5EZHA 1Y6IA 2DMNA 3F6VA 4F52A 3CMAI 3K1MA 1SMTA 3E1SA 4IQJA 5JLWA 3WE2A 2OQGA 1XCVA 2R5ZA 3GFLA 4G9YA 3G71I 4C2TA 2Y9YA 4CSWA 5DUKA 2VOPA 5KHDA 3D0SA 4IHXA 1XDUA 3ZN1A 3G2BA 4M3DA 3WU1B 2VC0A 4ESFA 3U21A 5M3FJ 1NG6A 3R61A 2NS8A 5LEKA 1WJEA 2FU4A 4Y4RA 5H6RA 4WF2A 3GTKJ 1IRZA 3E6BA 4M3BA 2L9VA 2P0WA 1DPRA 5DV5A 3TQNA 5ICGA 2KJBA 3M8FA 3AG3H 3MCZA 2VLAA 5B1BH 3IC7A 4IOAF 2IT0A 1X4PA 2JPCA 2W4SA 1K4TA 4MGRA 3DLLF 2IBDA 1FP1D 5FD5A 5F64A 3ZQQA 4E70A 2BW3B 5LBQA 4HDVA 3I0TA 3AG2H 5TGTA 4C3HJ 3BJOA 1ZKGA 1D8KA 3TOBA 1TT5B 3PSFA 3ZMSA 2E5NA 1BM9A 5EEHA 3DTEA 1FJLA 2CYYA 3WU0A 5FRMA 3SFZA 5ILUA 4UB8C 1AHDP 1HDPA 4RA2A 4BQAA 1MBFA 2E7XA 4RGRA 5GAGJ 1B6AA 3OMYA 4IPAA 4DW6A 3QPHA 4E7SA 2L7KA 3KLNA 2MH2A 3EUHC 3V7CA 2EINH 2PX9A 1G2HA 2J5PA 2B0LA 2Q0OA 2O0YA 3DBHB 4HX7A 1W5SA 3H92A 4FT8A 3RKWA 3VYUB 5KNLA 1IUFA 3HM5A 4I0AA 5B3SH 2IS1A 3H0DA 1RZ4A 2JSPA 2BW3A 3R4KA 3BG6A 4MO7A 2LFBA 3CJTB 1KU3A 2CU7A 5F0CA 3SFIA 2HKOA 4ITVA 5EF6A 2XASA 2RNGA 1LFUP 1XGSA 5LGTA 2E71A 3O2PE 1USTA 1RETA 3ELKA 3F6OA 4Y33A 4MEXF 3I4NJ 2HQ5A 3S3MA 1GV2A 4E6KG 2WB1A 1ZRDA 4RGSA 4DGWB 1LPQA 5FKLA 2NVTJ 2XGDA 1BI2A 2VBZA 3OYDA 3PQKA 4BACA 1GLNA 2V1DA 2O03A 2VJIA 2YSRA 2HTJA 3EDPA 2QSFX 3FMQA 3KYCB 4A0YA 3HRMA 4BXUA 1IJWC 3W2VA 3L7WA 1D8JA 4V19K 1S72I 1O57A 1AWCA 3JREA 3OL3A 1ZRCA 3GYHX 3FXLA 3L2UA 1I27A 4LOCA 1JGGA 3KZZA 4M9XA 1Y0UA 2B9SA 2EV5A 5HLIA 3DU6A 2P81A 3KE2A 3DTKA 1HW2A 4F91B 5LFAA 2FBHA 4ENJA 5E8IA 4HRIA 1YFHA 1HC8A 2RGVA 4OU0A 1BC8C 2P5VA 2HYFA 5K5QA 4N4NB 1B9NA 2XF6A 1J5YA 3AKZA 2K9NA 2MG4A 1EH7A 1K83J 4KJZA 2PMZA 3GZNB 2K9QA 4LMYA 5D4RA 1HKTA 1G3YA 2HOSA 4FX0A 5EG0B 2MC3A 2X85A 1PJRA 4PGGA 1DUXC 1N78A 2XPVA 3CC7I 5D5WB 1S3JA 3HOUJ 1QQIA 3KP4A 4KN4X 2WA0A 5D5VB 4BHCA 3WHCA 2QKMB 3CMMA 4RAFA 3PFYA 1Y0NA 2OF7A 1JKOC 4HF1A 4Q47A 5ILVA 2JPBA 3CMEI 1Q1VA 1MSEC 3DPUA 2HPIA 3FXOA 1RIOH 5H6QA 4A3LJ 2CQXA 1HXDA 1I6HJ 1U8BA 2L54A 5M5YJ 1VQPI 5FO5A 5J47A 1IRXA 2BY3A 1O3RA 2R4GA 4QTRA 1TL8A 2DAOA 1WCMJ 2VXDA 3LSGA 5F08A 3HOWJ 3BTCA 3JRIA 3ZQFA 4D5CA 5M5WJ 1O3TA 2HWVA 3UR3C 3EPZA 2HNHA 1LDDA 1VZ0A 2E34A 2L02A 2O7OA 4AU7A 1P4WA 2BY1A 3I59B 4NHJA 1HOMA 1J2XA 5EG0A 4QLCU 3PM1A 4LD5A 4E7JA 1YTYA 2CQKA 3JAMZ 3JCUC 3CUOA 3H5AA 5IP6A 3WTXC 1ETVA 2P4WA 5E20A 1KU9A 1R6RA 3V7RA 2KZGA 3H36A 4XLAA 3CCQI 1YS6A 3HHHA 3P9CA 5J4VA 1U3EM 1H9TA 3L2VA 1DP7P 1F5TA 1R49A 2VXZA 1H88C 4DJAA 2JA2A 3K6GA 3BG9A 1R4MB 2LY9A 2GIZA 1TNTA 2PBIA 4ZZDA 2K4BA 1WQ2A 3OOPA 4RB1A 3WE3A 1FOWA 4G8XA 3OYBA 3LQRA 3CC2I 2GWRA 3A1YA 3H0GJ 3QYFA 3BR1A 5LHHA 3FMRA 2KIQA 4V2GA 2VJ4A 5LGNA 3I59A 2HQNA 4B8XA 2DFIA 1T38A 4HA8A 3J80K 4B43A 1FMVA 1E3PA 1T0FC 2ME6A 2DODA 3EYYA 4RAGA 3HPHA 4MQ9F 2A6TA 4S0HB 1Z67A 4DQ2A 4CUGA 2MD0A 1JUPA 2DMTA 2F4MB 3H3ZA 3BTLA 3L09A 1VQKI 2E2JJ 1PP8F 2XGEA 4W1UA 3ISPA 4CCMA 4BJ6C 3LA3A 3OYCA 1VQLI 1UZCA 4DYCA 4IEJA 4IX7A 3FXKA 3RJPA 2KLOA 4A3KJ 5D6EA 2HYGD 4LJZF 5H20A 5FLXZ 4YIFA 3OYGA 3PJRA 2COMA 3J81Z 4U0YA 1HDDC 4H0EA 2R7VA 4C9YA 2JUGA 4NDLA 5DM7F 1F43A 2NVYJ 3R0AA 1ZAOA 5DEQA 1XPXA 4ZZLA 3FXMA 2WB1N 2X51A 3P7NA 1P2FA 1KONA 4A6EA 2KT0A 3RIRA 1S6LA 1WI3A 2VPRA 4F92B 1RR7A 4DNCA 2IA0A 3I56I 5IT9K 2L9SA 1SC7A 4ENNA 2NVUB 3TMOA 4L9TA 2KHMA 1A6QA 3BJAA 4Q48A 4Y17A 2DYRH 1R1TA 3DLAA 5D5XB 3KP7A 4I76A 4P9UA 3CCJI 2P6TA 5F6FA 3H9GA 4F3QA 1V5FA 5H2FC 1YQAA 3B6AA 5JFRA 4ENMA 3VYTB 4KDPA 2JRMA 1JXSA 1RKTA 3HXLA 3E97A 2JRTA 3TP0A 1ZG3A 4AWXB 2W85A 2NS7A 2OUMA 3OIQA 4CYCB 1ZR4A 2LLKA 2QYOA 1VQ9I 2JTVA 1FOKA 3V42A 2LKPA 3CCEI 3ZGKA 1JHFA 3KEOA 2PMZN 4XMYA 2WWYA 1ZLKA 3BTJA 3GTLJ 2CQQA 2Y69H 2ZSIB 2L5QA 1DU0A 1DU6A 2A3SA 4KITB 4E7HA 4CCLA 3W2AA 5J8CA 2VL8A 3RKYA 3CUQB 3HIFA 1UHMA 2HR3A 3DFGA 2FE3A 1YW7A 2Z16A 2PMHA 1KZHA 3SXYA 3LFUA 2ZXIA 1ZLJA 1L0OC 5JI6A 3G1LA 4IHWA 5EEGA 4HW0A 2KDZA 3VSLA 1FBUA 3V8LA 4CA0A 5DCFA 4BUPA 2YX4A 2ZSHB 3GUDA 4XN0A 3RPUD 3OS0A 1OLTA 1U8RA 4M74A 2Y75A 4A3GJ 4XNFA 4NNJA 1X1DA 1OPCA 4CYCA 4PDKA 2HGCA 1XX5A 1UCRA 3GZ5A 2HDDA 3M07A 4OOIA 3IH3A 3BTIA 4B09A 3S16J 2XVCA 3FKJA 1ONVA 5E1XA 4G6QA 2WY8Q 3D5SC 3ZRGA 1FEXA 4KYWA 4NUBA 2GIVA 2EILH 3BCBA 4LB5A 2ISYA 3GFJA 4EJVA 4XRSA 3WU2C 1IXSB 2M87A 1TNSA 3C2GA 2M1BA 4CICA 3G6EI 2MH9A 1VQOI 3HSEA 3IH4A 4LIVA 3CUQA 1U0JA 5EZGA 2X1DA 3CC4I 2V1NA 2FXAA 2IGOA 3V4GA 1XD7A 4ABZA 2AHQA 1X3UA 3DPTA 5A2QK 2LDUA 4LIUA 2BV6A 1PVEA 2D45A 2UXXA 1BIAA 1BR1A 3M8EA 2HYJA 2JZYA 2EFPA 1WJ5A 3I64A 1R71A 1SD6A 2DDAA 2Q2EA 1XDSA 1UG2A 5CVUA 2QQAA 1MBGA 3H35A 1TT0A 3I3LA 1RRJA 2L7FP 3ASOH 1PYVA 4ZYGA 1JJ8C 2VI6A 5M3MJ 1TW3A 4M71A 2D1VA 2M30A 3KEQA 4A3IJ 2CWEA 4IHYA 5CVJA 2F5EA 3BR5A 1ZTRA 4C30A 1APLC 3BY6A 2I10A 1JJ6C 1I3QJ 4M73A 4HNTA 1IW7F 4KUMA 5JHFA 2LVSA 1QVUA 5HDNA 1HSJA 2A05A 4O5VA 2XB5A 3KP6A 5LD2C 4DYRA 4B3AA 3ZCOA 2CGPA 2PMUA 1QBJA 2O3FA 2CJJA 1IO2A 1D0ZA 4QWQA 4BS9A 1EF4A 2OD5A 3CCSI 4BDYA 1YIOA 3I71A 1FT9A 1G4DA 3FZVA 3L2QA 4OIOF 3GTGJ 1S7AA 1XGNA 3S3NA 3LMMA 2ME0A 1J75A 2RVCA 1TQPA 4A3DJ 4X1EA 2ZMEC 2OQRA 1SD4A 3HSFA 3RPQA 3VDXA 3J7AY 4KT5C 5AIPA 1DDNA 3KLOA 2R7TA 1VQ6I 5CPRB 4AIJA 3JR9A 4EJTA 5HS7A 1RC9A 4IHTA 1ZR2A 3H5NA 5JHUA 2GA2A 4UVCA 3L2RA 1IXCA 1NTCA 1A35A 4OINF 3ZQCA 2ESHA 1FIAA 2WAQN 2M3AA 2NXNB 3FHZA 1QRYA 1K61A 3G73A 2NVXJ 3KZYA 1O7LA 3ONQA 4HV6A 1FYKA 2OPTA 2M0CA 3SHFA 1UB9A 2CW8A 5GPCA 2PFBA 3FIWA 2YU9J 3JRGA 1Y1VJ 1SMYF 3LA2A 3J7YJ 4FCYA 1VTNC 5F0FA 4EM2A 1POGA 1BOBA 4LLLA 2HS5A 1NH3A 1K6OA 1KYZA 5JR3A 2EFNA 1SEUA 1LFPA 2H09A 2R7FA 3F0CA 3D5LA 4R8HA 3RDIA 2PLYA 3KX2A 2YR2A 3AAFA 1WZ2A 5FB2A 1P7JA 2B63J 3OYEA 4M3GA 2CW7A 4BE1A 4RB2C 2L3DA 4B1RA 2K3PA 3F21A 4GFBA 4IOCF 3VSKA 1MBJA 3BLYA 4ZYHA 1N25A 4OWRB 1FYLA 1JHHA 4BYYA 1Z0XA 1ETKA 3DBLB 3SZPA 1YO5C 5IYBJ 1Z9CA 1VQ8I 1Z6RA 1P6RA 2HZDA 4OIPF 1UJ8A 5LEJA 5LHGA 5DDGA 1YI2I 1ZRFA 3W2WA 2QLZA 2EBIA 4AM3A 3ABKH 4PJJA 4BY7J 2VT3A 3B73A 4XBFA 2VN2A 3J7ZI 4EVIA 1I3AA 2MC4A 1QHGA 2VPLA 2Z2SB 2QGUA 1BN5A 2V4JC 1KYWA 4HSTA 1C0WA 1FTTA 1TWCJ 4WXDA 1XB4A 2PG4A 4R1HA 1R00A 2M4KA 4RAZA 1E0EA 3HSRA 3HTUA 1OFCX 2V9KA 4FX4A 2K3FA 1MNEA 4YFKF 2GXGA 1CGPA 4DIQA 3OR2C 2DA2A 3SDBA 3QYBA 2FBKA 5K5OA 3GFIA 2CSOA 3D5RC 2ESNA 2DTZA 2M45A 2LK2A 3JTHA 3PNVA 4JOMA 1W5TA 1SFEA 1NK2P 1TW2A 1U5TC 5J3LA 4E7ZA 3L2WA 1D5VA 1ITYA 2K9MA 3RQIA 1BI1A 1OCCH 2LY2A 2IJLA 3FF5A 2RV8A 1GDTA 1UELB 3BJ6A 5HNHA 3P5JA 1T08B 2XAUA 2KPMA 2NOJB 2CQ7A 2F5FA 4L9VA 4G94A 1BBYA 4V2FA 2CS3A 3S93A 1XS9A 3S2DJ 1ON2A 1LKXA 3LSIA 2XC7A 4QIWN 3N05A 2ZFUA 1TTYA 2KFDA 2MW8A 1W7PD 4I99C 2DCEA 2IGNA 1IRFA 5HOOA 3GCMA 3B02A 3BR3A 2K9LA 2G9WA 2QBYB 5L3CA 1LQ1A 1B59A 2L2OA 1FP2A 3OR1C 1LB2A 3F9KA 2BZTA 3DTIA 1ULYA 3WTTC 2O9LA 2JT1A 3KP5A 2KIUA 2HI3A 3TEDA 4L9NA 3BROA 3H1CA 3S1RJ 2DXIA 3O8HA 4L0ZB 3S14J 2IS6A 1I39A 3PSIA 3M1CA 1DPUA 3V8JA 4XL9A 1AOYA 4MQVA 5AONA 5CVIA 4S04A 2CUFA 1LEAA 4L9JA 3VODA 1MMGA 2IGMA 3Q0UA 1MKMA 3T0YA 4HG2A 1R7JA 2W1OA 2CFXA 4I7HA 1PP7U 2CO5A 4HBLA 1WH7A 4DYQA 2RAEA 1HKQA 4CDGA 4EMSA 4MIMA 3NQOA 1FLIA 2UUZA 4XKWA 1JUSA 3I4PA 2E1MB 2ISZA 2QBYA 1FY7A 1R5GA 1HBXG 2X6XA 3J80Z 3BDDA 3PUBA 3IWFA 2YUSA 5LLQA 3K4MA 5B5EC 4A5MA 4ESBA 3VPRA 1IAWA 2CFOA 4P55A 4D9JA 2A5WA 3ZQHA 2PN6A 4IL6C 3U9GA 1I1GA 2DI3A 1XTAA 3K4NA 3FBIB 1V5GA 3LSMA 4UHTA 4EV0A 5C3EJ 3WG9A 3QU3A 5HODA 2FA5A 3IUOA 4ZTFA 1YRNA 2VKVA 4KNYA 3Q9SA 1WWXA 1K7AA 1MNMC 4BHPA 3HOXJ 1D1AA 2LKSA 1WH5A 1XG1A 4P9FA 4PUSA 5CLSA 2KMUA 3IKTA 4KMUX 9ANTA 1YX5A 3LSHA 1RUNA 2X0LA 1D3YA 3W3CA 4EGZA 2Q1ZB 2XHKA 3TO7A 4CYDA 1VQ5I 3NRVA 5IT9Z 1RPWA 4PJ0C 2HVRA 2X6OA 1X58A 1ACIA 3VEPA 3HPGA 4J19A 3S2HJ 2XRNA 4BU2A 3OOUA 2KQRA 3BPXA 3QU6A 4XLCA 3MKLA 3DF8A 4B48A 5LGUA 2LD5A 1GT0C 2OTJI 3OYIA 2VBWA 3CCVI 3CDIA 1MH4A 1QZZA 2H8RA 2TRTA 3GX4X 3V8KA 4TV7A 2CMPA 3ZOBA 3I5UA 4NQWB 2COBA 4IF4A 4EJUA 1ZG1A 5HDGA 2K5CA 2XB0X 2NVQJ 2ZO4A 1BIBA 4E7IA 2JA5J 1J09A 4A3BJ 1JT6A 2ZJRF 4N0BA 1SD5A 3DCFA 3RKXA 2BYVE 3RYRA 3I55I 2R7SA 2O5RA 1JKPC 4FE4A 1TC3C 1FSEA 4NC7A 3LNQA 1QGPA 3LSKA 2M34A 4HPQA 4MFDA 2O61A 2HXOA 4AYBA 1D0YA 2UV1A 4M9ZA 3K9TA 2G0EA 4PJMA 1KQ8A 1XMXA 4ZYDA 3Q9VA 4S05A 3OIOA 1Q1HA 3MVPA 2R7RA 2DTRA 2E1NA 3GBGA 2WAFA 3FBNB 2ZNYA 2J5OA 4HQMA 1EH8A 1Z21A 3K1NA 4ETSA 1FX7A 3MN2A 1T95A 4NQWA 2Q8KA 2EZLA 4MTEA 1OR7A 4BH9A 2QSGX 4WXCA 3ABTA 1QZEA 2RREA 3ZMDA 1T8IA 3JRHA 2M9HA 3X2QH 2ELKA 2KRHA 2LREA 3A03A 2Z5UA 3FXUA 3H9QA 4FHTA 4HYEA 5E1ZB 3OS2A 3AL0C 1MGTA 3F22A 2OZUA 2IA1A 2VQLA 1JE8A 5DTDA 2EA4A 2A61A 1T6SA 2XF7A 4BJTA 3FXQA 1W0TA 2GXAA 4GYIA 3AFHA 2O8XA 2GOXB 2XUBA 5A2QZ 2L0KA 2D5VA 1MBKA 3FWEA 1OCTC 3C1DA 2ELJA 2QENA 3I54A 4MHGA 4E7KA 3S1QJ 3E5QA 3MZ8A 3IKVA 3E5XA 1LNWA 2EV0A 1QVTA 2HOEA 3S8PA 1O3QA 2L7ZA 5F1JA 1K78B 2EIKH 1HW1A 2OBPA 3V7SA 4AUXA 2Y31A 2JN6A 2ZXJA 3JRDA 5B1AH 3HOSA 5IT3A 4BBRJ 3ESWB 2EIMH 3EYIA 2O6GE 4GXOA 3C2BA 2EPFA 4A5NA 2WTEA 2KKOA 1VQMI 2MFZA 1IGNA 1YX3A 2K9SA 2F5VA 5GTHC 2FQ4A 5ICFA 1QPMA 4QSHA 4HDUA 3BT9A 1WPKA 3M7GA 5DCMB 3TP3A 2BXZA 2P7VB 6PAXA 5HLHA 4BY1J 1ZYRF 3PL8A 2HFHA 3A01B 1KQ0A 4RB3C 1OYIA 2DFFA 4AVPA 3WTYC 2A6HF 3GO5A 1X2NA 2F5CA 1E2XA 2DQLA 2XRLA 3HYIA 4B4CA 4BJ5C 3OS1A 1R1UA 3IL2A 1XGOA 2AQEA 3CF5F 1J59A 1PUEE 1MIJA 2ZJ2A 2QCOA 3EUHA 2V1XA 1Y8QB 1FMWA 1MZBA 3F8MA 3HGGA 1K78A 3BPVA 3BCAA 1WGXA 3OYLA 1PUFB 3K2AA 3S1NJ 1OKRA 2VKHA 5GAHJ 2STWA 1B9MA 2IAIA 1RI7A 4AD9A 4JX5A 2ECCA 2XAGA 1K6YA 1ETWA 4Y7NJ 4Y13A 3PIPF 2P6SA 1YYVA 1MW7A 2OCCH 4RM2A 3F8CA 1USSA 2VJ5A 1R5HA 5DCMA 2R7OA 2W82A 1LVAA 4FETA 4GGGA 4LG3A 4XQFA 3KCCA 5IP9J 2FBIA 4I2OA 4YEJA 5GP9A 3NWTA 3A01A 2UZKA 3FXJA 3K70D 3PNTA 5HS9A 2OCEA 2EFQA 1VNDA 3KIOA 1O4XA 4YIRX 5DYMA 3JW4A 2WAQA 4WWCA 2P8TA 3S1MJ 5FKOA 3EETA 3JRBA 4CZZA 2BOLA 1R4NB 3HOVJ 3OYFA 1MMSA 3E6DA 3REOA 1BL0A 5J6XA 4D5FA 2KZVA 3QP5A 2RNJA 3HOYJ 1PUFA 3C18A 2ZB9A 4RLFA 2JA7J 1STZA 2AQFA 3IAM2 1VI0A 3GEZA 4KICA 2XAHA 5K1YA 1JGSA 5K7ZA
chains in the Genus database with same CATH topology
4M3DA 1NTCA 3ZQCA 1U9OA 5M3FJ 1FIAA 3S15J 4HNVA 2NS8A 3ZQGA 2WAQN 2ID3A 3GTKJ 3BG3A 1IRZA 1QRYA 4M3BA 4AYBN 1JT0A 2QF7A 1K61A 2NVXJ 2N8GA 2OPTA 4C2MJ 4DZJA 2M0CA 1X2MA 2CUEA 4A93J 5GPCA 2LTPA 3FKIJ 3FIWA 3GTJJ 3RZDJ 2YU9J 3HGYA 3JRGA 1Y1VJ 4FCYA 5F0FA 2IBDA 1POGA 4MLOA 1SANA 2XPUA 3DEWA 4D7NA 4C3HJ 3CDLA 3F0CA 5M5XJ 1ZKGA 2LKXA 3LSRA 5BNGA 1FJLA 3IH2A 1P7JA 2B63J 4M3GA 4XIDA 2EZKA 1AHDP 1HDPA 1MBFA 4B1RA 4GFBA 5IP7J 3FK7A 5J1UA 1MBJA 2IEKA 4DW6A 3G1MA 3NAUA 1Z0XA 2X48A 3HKZN 3JRAA 2R92J 1ETKA 3CCYA 4D7MA 2E2HJ 2DMQA 2GBYA 1ETYA 2Y9ZA 2E2IJ 5IYBJ 4A69C 5E3OA 3GTQJ 4XRSG 3S17J 1G2HA 2EBIA 4XICA 2HOAA 4BY7J 1IUFA 2AO9A 3HM5A 1FTZA 5IOZA 1Z77A 1FTTA 3FISA 1TWCJ 2CRGA 4MO7A 1ETXA 2LFBA 3G1OA 2ECBA 3M3YJ 4EEFG 2CU7A 5F0CA 3SFIA 2MGQA 3HB9A 2YS9A 5EF6A 1LFUP 1OFCX 3SJMA 3FK6A 1IDYA 1RETA 3I4NJ 1B8IB 2HQ5A 3L1PA 2DA2A 1GV2A 3BQZA 1S7EA 1JUMA 5FLVA 1R9TJ 5FKLA 2NVTJ 2XSDC 2XGDA 1A5JA 2DTZA 2LR8A 2LK2A 1NK2P 5J3LA 5FLMJ 1IJWC 1A6IA 1ETQA 2JK3A 1ITYA 3JREA 4L5EA 3RQIA 3OSGA 4LOCA 1JGGA 1D5YA 5E3NA 4X6AJ 1GDTA 2P81A 5GPAA 2K40A 5F0HA 2R7ZJ 4V2FA 1XS9A 3S2DJ 2DA7A 4QIWN 2MW8A 4UUSB 2K9NA 2MG4A 3GTMJ 1K83J 2K9QA 1TWHJ 3BR3A 1ZK8A 2HOSA 1B8IA 5EG0B 1QPIA 3PO3J 2XGCA 4UUTA 3I4MJ 2O9LA 2WV1A 2XPVA 2FX0A 1JKRC 1ENHA 2HI3A 3TEDA 3HOUJ 1H8AC 3S1RJ 3WHCA 2H1KA 3O8HA 3B6CA 3S14J 2MSYA 5FKNA 2OF7A 3SDGA 1JKOC 1MSFC 1MSEC 5EGOB 1AU7A 1Q1VA 5EYRA 2JA8J 4A3LJ 2CQXA 2CUFA 3OSFA 5M5YJ 1U8BA 1I6HJ 3Q0UA 1FIPA 2R5YB 4QTRA 4M3EA 1WCMJ 4A3EJ 4A3FJ 3TW6A 1WH7A 3LSGA 5F08A 4UUSA 3HOWJ 3BTCA 4DYQA 2RAEA 3JRIA 3ZQFA 4D5CA 4MIMA 5M5WJ 4JX6A 2O7OA 1JUSA 1HOMA 2W48A 2NOGA 1HCRA 5EG0A 3PM1A 2EQRA 1SFOJ 3LOCA 1UHSA 1GVDA 5IP6A 3QPLA 1ETVA 2YUSA 3UKGA 3VPRA 1XC5A 3ZQHA 2R93J 2DN0A 1H88C 5EGOA 3BG9A 2LY9A 1ORKA 5J1YA 1H89C 1ZGWA 3BQYA 3TW7A 5F27A 5C3EJ 4JX4A 5HODA 2DA3A 2R5YA 1IC8A 1YRNA 2VKVA 2XPWA 1LFBA 3H0GJ 3BR1A 4DZPA 1MNMC 4JP0A 4V2GA 3HOXJ 1T56A 2VKEA 1XG1A 1WH5A 4MFEA 4I6ZA 3O8GA 9ANTA 2ME6A 3ZQLA 4S0HB 1RPWA 2X6OA 1X58A 1VFCA 1ETOA 1JUPA 2DMTA 1TWGJ 3BTLA 4J19A 3S2HJ 2E2JJ 3OOUA 2XGEA 4W1UA 4FISA 4BBSJ 3BR0A 2LD5A 3MKLA 2E1OA 1GT0C 2HOTA 4DYCA 4IEJA 1LE8A 1MH3A 4RDUA 4A3KJ 3ZQIA 1TWAJ 3GTOJ 1MH4A 1HDDC 2H8RA 2TRTA 5IYDJ 3LSPA 4NDLA 3CMYA 3ZOBA 1F43A 4A3MJ 5JLXA 2NVYJ 5K7FA 3RZOJ 4Y52J 2COBA 5FKMA 2WB1N 2VUMJ 1ZR2A 3HBLA 2NVQJ 2XB0X 2KT0A 1F36A 2JA5J 1GUUA 1JTXA 4A3BJ 1JT6A 2Y30A 3DCFA 1WI3A 2VPRA 1RR7A 2FJ1A 2R0QC 1U9NA 1Y1WJ 3E7LA 2JWTA 1JKPC 1OCPA 4G12A 4FE4A 1TC3C 3BG5A 3LNQA 2M34A 1ZQ3P 4MFDA 4I76A 2HXOA 2DA6A 3B6AA 1JKQC 5E3MA 1E3OC 3A02A 2G0EA 1RKTA 3TP0A 2TCTA 3BR2A 3OIOA 2NS7A 4M3FA 3MVPA 5IYCJ 2DMUA 4CYCB 4BKXA 5FJ8J 2LLKA 1ZR4A 3GBGA 1HLVA 2Y2ZA 2DJNA 2JA6J 2PMZN 3MN2A 2O8KA 2HXIA 3BTJA 3GTLJ 2EZLA 4C3JJ 3QQAA 2CQQA 1BJZA 2E19A 1YRNB 1DU0A 1IG7A 1DU6A 3JRHA 2M9HA 4JYKA 2ELKA 2DMPA 3A03A 5EDNA 1OJLA 2EZHA 1JTYA 5DTDA 2Y0SN 3CQZJ 1NK3P 2EH3A 4FE7A 4BXXJ 5DS9A 1W0TA 3WHBA 3G1LA 3BR6A 4IHWA 2EZIA 4A3JJ 2L0KA 2D5VA 1MBKA 1OCTC 4XK4A 2KDZA 1MBHA 4RBOA 3S1QJ 1MBEA 1QVTA 4A3GJ 2JJ7A 2L7ZA 5F1JA 3Q3SA 4CYCA 1RESA 1AKHB 1LE8B 2DA1A 4AUXA 1TWFJ 2Y31A 2HDDA 2DA4A 2JN6A 3Q0WA 5J1RA 3JRDA 3IH3A 3BTIA 4BBRJ 3IV5A 3S16J 1B72B 3C2BA 2M8GX 1FEXA 3M4OJ 2GLOA 1IGNA 2K9SA 4XRSA 1VF9A 2FQ4A 1HF0A 1RKWA 5FKKA 5IOYA 4QSHA 3BT9A 1WPKA 3TP3A 3IH4A 5EZGA 5C44J 4BY1J 3A01B 4FTHA 3QPSA 3GTPJ 4ABZA 1X2NA 2AHQA 2XRLA 4B4CA 1IV6A 5IPAA 3NARA 1U78A 1UMQA 1BW5A 2QCOA 2HYJA 1I50J 2LP0A 3HGGA 3Q0VA 1WGXA 5EEAA 3HOZJ 1AKHA 1UG2A 4IHVA 1MBGA 1PUFB 2L9RA 3K2AA 3S1NJ 5C4XJ 2L7FP 2R5ZB 1B72A 1JJ8C 2IAIA 2VI6A 5M3MJ 4JX5A 2ECCA 4XRMA 1ETWA 4Y7NJ 4A3CJ 1P7IA 1BA5A 2GM4A 4A3IJ 4IHYA 3D1NI 5F04A 1T33A 3BR5A 4W97A 1ZTRA 1APLC 5IP9J 3RKQA 2I10A 1JJ6C 3K7AJ 3JRFA 5GP9A 1I3QJ 2M2EA 3A01A 3H3VK 1BW6A 2LVSA 1QVUA 5K7HA 2XB5A 3LSJA 4DYRA 2ID6A 4B3AA 1VNDA 1O4XA 3PO2J 2X9DA 2CJJA 2L7MP 3HDDA 1EF4A 1IDZA 3S1MJ 4C3IJ 5FKOA 3JRBA 3HOVJ 2JMWA 3W6VA 3GTGJ 5EZHA 1CQTA 2DMNA 2DA5A 2ME0A 1BL0A 4D5FA 3HEFA 3HOYJ 1PUFA 4A3DJ 2ZB9A 4M6VA 5JLWA 4X1EA 2JA7J 2R5ZA 1VI0A 5E3LA 1GV5A 3JRCA 5C4JJ 3JR9A 4AC0A 1W0UA 2Y9YA 2FD5A 4IHXA 5K7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3D A;  1NTC A;  3ZQC A;  1U9O A;  5M3F J;  1FIA A;  3S15 J;  4HNV A;  2NS8 A;  3ZQG A;  2WAQ N;  2ID3 A;  3GTK J;  3BG3 A;  1IRZ A;  1QRY A;  4M3B A;  4AYB N;  1JT0 A;  2QF7 A;  1K61 A;  2NVX J;  2N8G A;  2OPT A;  4C2M J;  4DZJ A;  2M0C A;  1X2M A;  2CUE A;  4A93 J;  5GPC A;  2LTP A;  3FKI J;  3FIW A;  3GTJ J;  3RZD J;  2YU9 J;  3HGY A;  3JRG A;  1Y1V J;  4FCY A;  5F0F A;  2IBD A;  1POG A;  4MLO A;  1SAN A;  2XPU A;  3DEW A;  4D7N A;  4C3H J;  3CDL A;  3F0C A;  5M5X J;  1ZKG A;  2LKX A;  3LSR A;  5BNG A;  1FJL A;  3IH2 A;  1P7J A;  2B63 J;  4M3G A;  4XID A;  2EZK A;  1AHD P;  1HDP A;  1MBF A;  4B1R A;  4GFB A;  5IP7 J;  3FK7 A;  5J1U A;  1MBJ A;  2IEK A;  4DW6 A;  3G1M A;  3NAU A;  1Z0X A;  2X48 A;  3HKZ N;  3JRA A;  2R92 J;  1ETK A;  3CCY A;  4D7M A;  2E2H J;  2DMQ A;  2GBY A;  1ETY A;  2Y9Z A;  2E2I J;  5IYB J;  4A69 C;  5E3O A;  3GTQ J;  4XRS G;  3S17 J;  1G2H A;  2EBI A;  4XIC A;  2HOA A;  4BY7 J;  1IUF A;  2AO9 A;  3HM5 A;  1FTZ A;  5IOZ A;  1Z77 A;  1FTT A;  3FIS A;  1TWC J;  2CRG A;  4MO7 A;  1ETX A;  2LFB A;  3G1O A;  2ECB A;  3M3Y J;  4EEF G;  2CU7 A;  5F0C A;  3SFI A;  2MGQ A;  3HB9 A;  2YS9 A;  5EF6 A;  1LFU P;  1OFC X;  3SJM A;  3FK6 A;  1IDY A;  1RET A;  3I4N J;  1B8I B;  2HQ5 A;  3L1P A;  2DA2 A;  1GV2 A;  3BQZ A;  1S7E A;  1JUM A;  5FLV A;  1R9T J;  5FKL A;  2NVT J;  2XSD C;  2XGD A;  1A5J A;  2DTZ A;  2LR8 A;  2LK2 A;  1NK2 P;  5J3L A;  5FLM J;  1IJW C;  1A6I A;  1ETQ A;  2JK3 A;  1ITY A;  3JRE A;  4L5E A;  3RQI A;  3OSG A;  4LOC A;  1JGG A;  1D5Y A;  5E3N A;  4X6A J;  1GDT A;  2P81 A;  5GPA A;  2K40 A;  5F0H A;  2R7Z J;  4V2F A;  1XS9 A;  3S2D J;  2DA7 A;  4QIW N;  2MW8 A;  4UUS B;  2K9N A;  2MG4 A;  3GTM J;  1K83 J;  2K9Q A;  1TWH J;  3BR3 A;  1ZK8 A;  2HOS A;  1B8I A;  5EG0 B;  1QPI A;  3PO3 J;  2XGC A;  4UUT A;  3I4M J;  2O9L A;  2WV1 A;  2XPV A;  2FX0 A;  1JKR C;  1ENH A;  2HI3 A;  3TED A;  3HOU J;  1H8A C;  3S1R J;  3WHC A;  2H1K A;  3O8H A;  3B6C A;  3S14 J;  2MSY A;  5FKN A;  2OF7 A;  3SDG A;  1JKO C;  1MSF C;  1MSE C;  5EGO B;  1AU7 A;  1Q1V A;  5EYR A;  2JA8 J;  4A3L J;  2CQX A;  2CUF A;  3OSF A;  5M5Y J;  1U8B A;  1I6H J;  3Q0U A;  1FIP A;  2R5Y B;  4QTR A;  4M3E A;  1WCM J;  4A3E J;  4A3F J;  3TW6 A;  1WH7 A;  3LSG A;  5F08 A;  4UUS A;  3HOW J;  3BTC A;  4DYQ A;  2RAE A;  3JRI A;  3ZQF A;  4D5C A;  4MIM A;  5M5W J;  4JX6 A;  2O7O A;  1JUS A;  1HOM A;  2W48 A;  2NOG A;  1HCR A;  5EG0 A;  3PM1 A;  2EQR A;  1SFO J;  3LOC A;  1UHS A;  1GVD A;  5IP6 A;  3QPL A;  1ETV A;  2YUS A;  3UKG A;  3VPR A;  1XC5 A;  3ZQH A;  2R93 J;  2DN0 A;  1H88 C;  5EGO A;  3BG9 A;  2LY9 A;  1ORK A;  5J1Y A;  1H89 C;  1ZGW A;  3BQY A;  3TW7 A;  5F27 A;  5C3E J;  4JX4 A;  5HOD A;  2DA3 A;  2R5Y A;  1IC8 A;  1YRN A;  2VKV A;  2XPW A;  1LFB A;  3H0G J;  3BR1 A;  4DZP A;  1MNM C;  4JP0 A;  4V2G A;  3HOX J;  1T56 A;  2VKE A;  1XG1 A;  1WH5 A;  4MFE A;  4I6Z A;  3O8G A;  9ANT A;  2ME6 A;  3ZQL A;  4S0H B;  1RPW A;  2X6O A;  1X58 A;  1VFC A;  1ETO A;  1JUP A;  2DMT A;  1TWG J;  3BTL A;  4J19 A;  3S2H J;  2E2J J;  3OOU A;  2XGE A;  4W1U A;  4FIS A;  4BBS J;  3BR0 A;  2LD5 A;  3MKL A;  2E1O A;  1GT0 C;  2HOT A;  4DYC A;  4IEJ A;  1LE8 A;  1MH3 A;  4RDU A;  4A3K J;  3ZQI A;  1TWA J;  3GTO J;  1MH4 A;  1HDD C;  2H8R A;  2TRT A;  5IYD J;  3LSP A;  4NDL A;  3CMY A;  3ZOB A;  1F43 A;  4A3M J;  5JLX A;  2NVY J;  5K7F A;  3RZO J;  4Y52 J;  2COB A;  5FKM A;  2WB1 N;  2VUM J;  1ZR2 A;  3HBL A;  2NVQ J;  2XB0 X;  2KT0 A;  1F36 A;  2JA5 J;  1GUU A;  1JTX A;  4A3B J;  1JT6 A;  2Y30 A;  3DCF A;  1WI3 A;  2VPR A;  1RR7 A;  2FJ1 A;  2R0Q C;  1U9N A;  1Y1W J;  3E7L A;  2JWT A;  1JKP C;  1OCP A;  4G12 A;  4FE4 A;  1TC3 C;  3BG5 A;  3LNQ A;  2M34 A;  1ZQ3 P;  4MFD A;  4I76 A;  2HXO A;  2DA6 A;  3B6A A;  1JKQ C;  5E3M A;  1E3O C;  3A02 A;  2G0E A;  1RKT A;  3TP0 A;  2TCT A;  3BR2 A;  3OIO A;  2NS7 A;  4M3F A;  3MVP A;  5IYC J;  2DMU A;  4CYC B;  4BKX A;  5FJ8 J;  2LLK A;  1ZR4 A;  3GBG A;  1HLV A;  2Y2Z A;  2DJN A;  2JA6 J;  2PMZ N;  3MN2 A;  2O8K A;  2HXI A;  3BTJ A;  3GTL J;  2EZL A;  4C3J J;  3QQA A;  2CQQ A;  1BJZ A;  2E19 A;  1YRN B;  1DU0 A;  1IG7 A;  1DU6 A;  3JRH A;  2M9H A;  4JYK A;  2ELK A;  2DMP A;  3A03 A;  5EDN A;  1OJL A;  2EZH A;  1JTY A;  5DTD A;  2Y0S N;  3CQZ J;  1NK3 P;  2EH3 A;  4FE7 A;  4BXX J;  5DS9 A;  1W0T A;  3WHB A;  3G1L A;  3BR6 A;  4IHW A;  2EZI A;  4A3J J;  2L0K A;  2D5V A;  1MBK A;  1OCT C;  4XK4 A;  2KDZ A;  1MBH A;  4RBO A;  3S1Q J;  1MBE A;  1QVT A;  4A3G J;  2JJ7 A;  2L7Z A;  5F1J A;  3Q3S A;  4CYC A;  1RES A;  1AKH B;  1LE8 B;  2DA1 A;  4AUX A;  1TWF J;  2Y31 A;  2HDD A;  2DA4 A;  2JN6 A;  3Q0W A;  5J1R A;  3JRD A;  3IH3 A;  3BTI A;  4BBR J;  3IV5 A;  3S16 J;  1B72 B;  3C2B A;  2M8G X;  1FEX A;  3M4O J;  2GLO A;  1IGN A;  2K9S A;  4XRS A;  1VF9 A;  2FQ4 A;  1HF0 A;  1RKW A;  5FKK A;  5IOY A;  4QSH A;  3BT9 A;  1WPK A;  3TP3 A;  3IH4 A;  5EZG A;  5C44 J;  4BY1 J;  3A01 B;  4FTH A;  3QPS A;  3GTP J;  4ABZ A;  1X2N A;  2AHQ A;  2XRL A;  4B4C A;  1IV6 A;  5IPA A;  3NAR A;  1U78 A;  1UMQ A;  1BW5 A;  2QCO A;  2HYJ A;  1I50 J;  2LP0 A;  3HGG A;  3Q0V A;  1WGX A;  5EEA A;  3HOZ J;  1AKH A;  1UG2 A;  4IHV A;  1MBG A;  1PUF B;  2L9R A;  3K2A A;  3S1N J;  5C4X J;  2L7F P;  2R5Z B;  1B72 A;  1JJ8 C;  2IAI A;  2VI6 A;  5M3M J;  4JX5 A;  2ECC A;  4XRM A;  1ETW A;  4Y7N J;  4A3C J;  1P7I A;  1BA5 A;  2GM4 A;  4A3I J;  4IHY A;  3D1N I;  5F04 A;  1T33 A;  3BR5 A;  4W97 A;  1ZTR A;  1APL C;  5IP9 J;  3RKQ A;  2I10 A;  1JJ6 C;  3K7A J;  3JRF A;  5GP9 A;  1I3Q J;  2M2E A;  3A01 A;  3H3V K;  1BW6 A;  2LVS A;  1QVU A;  5K7H A;  2XB5 A;  3LSJ A;  4DYR A;  2ID6 A;  4B3A A;  1VND A;  1O4X A;  3PO2 J;  2X9D A;  2CJJ A;  2L7M P;  3HDD A;  1EF4 A;  1IDZ A;  3S1M J;  4C3I J;  5FKO A;  3JRB A;  3HOV J;  2JMW A;  3W6V A;  3GTG J;  5EZH A;  1CQT A;  2DMN A;  2DA5 A;  2ME0 A;  1BL0 A;  4D5F A;  3HEF A;  3HOY J;  1PUF A;  4A3D J;  2ZB9 A;  4M6V A;  5JLW A;  4X1E A;  2JA7 J;  2R5Z A;  1VI0 A;  5E3L A;  1GV5 A;  3JRC A;  5C4J J;  3JR9 A;  4AC0 A;  1W0U A;  2Y9Y A;  2FD5 A;  4IHX A;  5K7Z A; 
#chains in the Genus database with same CATH topology
 2EV6 A;  1U9O A;  2KIS A;  3WTS C;  3S15 J;  4HNV A;  1ODD A;  3OV8 A;  3QWL A;  3WG7 H;  2ID3 A;  1HW5 A;  3BG3 A;  3FHN A;  4AYB N;  3SZG A;  2DT5 A;  3K4B A;  3LST A;  2HPM A;  4ESJ A;  4KIB A;  2FOW A;  1X2M A;  3SYT A;  2XAF A;  2CUE A;  4A93 J;  2EA2 A;  4B44 A;  1D1B A;  3FKI J;  3RZD J;  4EQQ A;  1A36 A;  1OCZ H;  1YHQ I;  1E17 A;  2DYS H;  3ERM A;  1SFK A;  1K4S A;  1XSX A;  2BVL A;  4KA4 A;  2GAU A;  3CDL A;  3CCL I;  2QA4 I;  5FFZ A;  5M5X J;  2CV0 A;  2LKX A;  2XIG A;  4I0B A;  5BNG A;  3LSR A;  2OA4 A;  2Q2E B;  2GXB A;  3IH2 A;  2ZFW A;  2R7Q A;  3DQV C;  3SZT A;  2XGX A;  2M4G A;  1P92 A;  3DEU A;  2DK8 A;  5J1U A;  2FSW A;  2Y0M A;  1S7O A;  4PSX A;  3G1M A;  2H6C A;  2X48 A;  1FC3 A;  3JRA A;  1SAX A;  2R92 J;  1W4M A;  3CCY A;  3NEU A;  4D7M A;  3RPU A;  1J0R A;  2DMQ A;  2GBY A;  2R7W A;  2E2H J;  1ETY A;  2Y9Z A;  1ZH5 A;  2VE8 A;  3LAJ A;  3J7A O;  3O6B B;  2D1H A;  3GTQ J;  1WJD A;  2F4I A;  5BQT A;  1FOX A;  4GDF A;  3QYE A;  2WBM A;  3K4L A;  5IOZ A;  5L3G A;  3E6M A;  2E1C A;  3ULQ B;  5HDK A;  1ZG5 A;  1ETX A;  2M8E A;  4EEF G;  2D2W A;  1B1B A;  3K4C A;  2BHY A;  2MGQ A;  2QZ8 A;  4ZYE A;  3F23 A;  4OIR F;  2HDW A;  4G7H F;  3T8R A;  1IDY A;  1KA8 A;  2XRO A;  4HLY A;  1B8I B;  4HNU A;  3L1P A;  1V55 H;  3F72 A;  1R9T J;  2L4A A;  2VIX A;  2W24 A;  3MQ0 A;  1A5J A;  3LA7 A;  2KIF A;  3CTA A;  3DKX A;  1R23 A;  4RGU A;  4F55 A;  3G4S I;  4LFU A;  4EAT A;  1Z05 A;  4RMN A;  2BE5 F;  4BNC A;  4L5E A;  1EJ9 A;  3E3V A;  1XGM A;  3E0J B;  1IZ1 A;  1D5Y A;  1T0F A;  2V6C A;  2DW4 A;  3GLX A;  1TQM A;  5GPA A;  4WX9 A;  3HL2 A;  1I6X A;  1QNT A;  4U7B A;  1RR8 C;  2XV4 S;  1DGR M;  2L4M A;  2R3S A;  2VQH A;  2G7H A;  4UB6 C;  3HZJ A;  1YW9 A;  4XR6 A;  1P9Q C;  1MD0 A;  5D8K B;  2W00 A;  2RDP A;  2MLK A;  1BOA A;  2ZC2 A;  2JQ7 A;  5KK1 A;  1OMI A;  1Z3Y A;  4GCV A;  1TWH J;  2FNP A;  2PJR B;  3CO7 C;  1QA6 A;  1ZK8 A;  2L01 A;  3K10 A;  4L0Y B;  1B8I A;  3IRR A;  2L9N A;  5KVR A;  4B3X A;  2H6B A;  2DFH A;  2ZJP F;  1R22 A;  5D4S A;  3CDH A;  3ZXS A;  1G3T A;  4JK1 X;  4UUT A;  5E79 C;  2WV1 A;  3HRS A;  2DDB A;  2FX0 A;  4RM3 A;  5DD8 A;  3Q5F A;  1FPQ A;  4U88 A;  2YPR A;  2LMD A;  2K86 A;  1Z7L A;  4CCK A;  2H1K A;  2DPD A;  3B6C A;  4L18 B;  2V1U A;  2MSY A;  2P5K A;  1FBS A;  2BY2 A;  3H5R A;  2BGC A;  4IRG A;  4PZJ A;  4XKV A;  5J40 A;  3S2W A;  3J81 K;  5EGO B;  1AU7 A;  1MSF C;  5EYR A;  2JA8 J;  1IF1 A;  3UNG C;  3AG1 H;  3VB2 A;  5CKT A;  3OSF A;  3GVA A;  4O6J A;  3ZP5 A;  1FIP A;  3SEQ A;  3O3K A;  3VYS B;  1HST A;  3GWZ A;  3MWM A;  3QOP A;  3QP6 A;  5DM6 F;  4A3E J;  3TW6 A;  3C2H A;  3CD6 I;  3HOT A;  2HVS A;  2FML A;  4XLH A;  5ICE A;  4YFN F;  2CH0 A;  2PJR A;  3R6S A;  2NOG A;  3N97 A;  1HCR A;  4DBQ A;  5HLT A;  5TRD A;  1OYY A;  4MTD A;  3CES A;  1S8N A;  5CQE A;  2MAB A;  2XSJ C;  4RGX A;  3BZC A;  3BP8 A;  3QPL A;  4UVB A;  5DD4 A;  1A31 A;  4GRI A;  2ZXH A;  2IS4 A;  3MEX A;  2R7U A;  2ACJ A;  4LGW A;  1XSV A;  2V6E A;  2LNB A;  3OYM A;  3K4K A;  2BHZ A;  1I1S A;  2HVQ A;  4BXF A;  2LC2 A;  2R93 J;  4F93 B;  4XSZ F;  4HQE A;  5EGO A;  2H8W A;  1G6N A;  4J01 A;  1ZGW A;  2LF8 A;  3BQY A;  1H0M A;  3TW7 A;  1A04 A;  2HKX A;  5F27 A;  4YRV A;  2BVM A;  4KN7 X;  5L3F A;  1U6G A;  1G3S A;  2BEO A;  3ZR8 X;  5CVV A;  1IC8 A;  1P4A A;  2XPW A;  4X0G A;  4HEA 2;  1LFB A;  4DZP A;  2JSC A;  3T5X A;  2PJP A;  2VKE A;  3ZMV A;  1TLH B;  1HKS A;  2M0M A;  3PUF A;  2QSH X;  4MFE A;  4WXH A;  2H94 A;  2FF4 A;  4I6Z A;  3O8G A;  3CCU I;  1R5I D;  3ZQL A;  2H1L A;  4U0W A;  5HLG A;  1O7F A;  2MD5 A;  2WC2 A;  2GOM A;  4D0P A;  1ETO A;  4HF0 A;  2I8D A;  3TL4 X;  2Z9O A;  1W1W E;  3ABL H;  2VON A;  1UHW A;  1ON1 A;  4FIS A;  3COA C;  2FEZ A;  4BBS J;  3PNY A;  4BHB A;  2LG4 A;  1DQU A;  2HOT A;  1GHC A;  2QWW A;  1LE8 A;  1LEB A;  1MH3 A;  2V9V A;  1FNN A;  2CG4 A;  3ZQI A;  1DGW Y;  3DWL E;  2E60 A;  3GTO J;  2ZBK A;  1LVK A;  4K2E A;  5IYD J;  3LSP A;  3CMY A;  3CLO A;  2Z99 A;  3OYK A;  2ZCW A;  4A3M J;  3RZO J;  2NYX A;  4Y52 J;  4P1W A;  3F3X A;  2VUM J;  3E5U A;  4RAY A;  3HBL A;  1SFX A;  2R7X A;  2DOE A;  2WAE A;  1F36 A;  2LBF A;  1GUU A;  1RUO A;  4AIH A;  3EQL F;  1BI3 A;  4IVN A;  4NBQ A;  2OV7 A;  2FJ1 A;  5FD6 A;  1QZY A;  2B7E A;  2R0Q C;  2H27 A;  1XMK A;  4PJL A;  1U9N A;  1Y1W J;  3E7L A;  2JWT A;  3BG7 A;  3H3U A;  3RCO A;  4G12 A;  3FX3 A;  3MFK A;  2F2E A;  5L3D A;  1R36 A;  1X1C A;  2DA6 A;  1E3O C;  1W7P A;  4HV5 A;  3BR2 A;  4M6X A;  3ECO A;  2IW5 A;  2DFE A;  2DMU A;  3M1E A;  5FJ8 J;  3JSP A;  3BWG A;  4I09 A;  4GO1 A;  1XSD A;  1HLV A;  2Y2Z A;  1TZL A;  5L3E A;  3DPL C;  4ZDL A;  1ZRE A;  1MJA A;  2ZKZ A;  3HUG B;  3CJN A;  3OYJ A;  4M9S A;  5JVT A;  4CXF A;  2R7D A;  2VKD A;  4IRH A;  1M1E B;  1V4R A;  2W84 A;  4MNU A;  3QQA A;  4OIQ F;  1BJZ A;  3A4C A;  1S5L C;  1PDN C;  2E19 A;  1YRN B;  4Q5S F;  3DXJ F;  3DKW A;  2KP6 A;  5GAD J;  5DUI A;  5ERI A;  1G59 A;  4QPO A;  4QPQ A;  2HDC A;  1IUY A;  2ZME A;  4L5I A;  5EDN A;  1JTY A;  2YX7 A;  2Y0S N;  3BZK A;  3HKZ A;  4UXN A;  3K0L A;  2VOD A;  2JVG A;  4BXX J;  3FXR A;  4HX8 A;  3WHB A;  1Y56 A;  1S29 A;  3ASN H;  2EZI A;  3WGI A;  4G6T B;  3ZMU A;  2XKO A;  1BC7 C;  4XK4 A;  3C3W A;  2HQR A;  5KAI C;  1YJ9 I;  1MBH A;  3OYA A;  3M9A A;  1ZN2 A;  2V79 A;  2QVO A;  3WGH A;  3P9I A;  1MBE A;  3ZN0 A;  4EM0 B;  3P9K A;  2JJ7 A;  2HTS A;  4PFO A;  5BOX A;  1IN8 A;  1ZAR A;  1RES A;  2V7F A;  1AKH B;  2DA1 A;  1TWF J;  4CCO A;  4UUV A;  2DA4 A;  3MD2 A;  4M6Y A;  3VYR B;  1XMA A;  4FQG A;  4EGY A;  5EJC A;  5J1R A;  3HUG A;  5LRR A;  4I02 A;  3KP2 A;  1P4X A;  3WTV C;  3M4O J;  4EM1 A;  2GLO A;  1IN5 A;  4LB6 B;  1VQ4 I;  4IRI A;  2ICW G;  1YIJ I;  1VF9 A;  1HF0 A;  4CO8 A;  5FKK A;  5IOY A;  4EJW A;  2VBX A;  4IHS A;  2NAZ A;  2V26 A;  1FBQ A;  3NWS A;  3PQJ A;  5C44 J;  1OIS A;  4FTH A;  4IXA A;  3QPS A;  2FOK A;  3L2C A;  3S3O A;  2CW0 F;  3U2R A;  2UWM A;  5TJJ A;  3RQ4 A;  3GXO A;  4B47 A;  1SVL A;  3QPT A;  4A0X A;  5LHI A;  4N4O B;  2DOF A;  1JI8 A;  2K27 A;  1LDK B;  1BW5 A;  1H9G A;  1U5T B;  1HA8 A;  2WY7 Q;  2EK5 A;  3TOA A;  2LP0 A;  2LF7 A;  2EIJ H;  2ETH A;  2IA2 A;  3BC8 A;  5F1R A;  1TQI A;  3CZ6 A;  5EEA A;  1UFM A;  1AKH A;  3HOZ J;  4AID A;  2L9R A;  3K70 C;  4II2 A;  2GQQ A;  3S32 A;  2F6C A;  4XON A;  3GF2 A;  4C2U A;  3TDU C;  4A3C J;  1WKM A;  2GM4 A;  2W57 A;  5D6F A;  4F7Z A;  5F04 A;  1F1Z A;  1WVR A;  1D1C A;  4W97 A;  5IY5 H;  1Z91 A;  2OJE D;  2W7N A;  3JRF A;  4WK8 F;  2F48 A;  2M2E A;  2E5Z A;  3H3V K;  1MDM B;  5K7H A;  3A2K A;  2X1E A;  2DU9 A;  2ID6 A;  5FGM A;  2QQ8 A;  5E18 F;  1SVO A;  3MMY B;  2VJJ A;  4XLE A;  1QHH D;  2X9D A;  3RSN A;  2IS2 A;  2L7M P;  3OL4 A;  3L9F A;  1IDZ A;  1VQN I;  4C3I J;  2CUJ A;  5HVQ C;  1MMN A;  1U5T A;  2JMW A;  1Y8R B;  3W6V A;  4AIK A;  1CQT A;  2DA5 A;  1LDJ A;  2DPU A;  3SEZ A;  2FRH A;  2I5U A;  3HEF A;  2CV1 A;  4M6V A;  2AXL A;  3U1D A;  3KZI C;  3ML6 A;  2TDX A;  4M72 A;  3R60 A;  5E3L A;  4YG2 F;  1GV5 A;  3ROU A;  3JRC A;  5C4J J;  3JTG A;  4N9H A;  1OQY A;  4AC0 A;  4HOB A;  2WAD A;  1W0U A;  2FD5 A;  4CHU A;  1ZGA A;  2ELH A;  2VAS A;  4A2U A;  2QQB A;  4ZJZ A;  5GAE J;  2M5W A;  3ZQG A;  3I53 A;  3CCR I;  4YFX F;  2KJC A;  1G8X A;  3DV8 A;  4BQQ A;  1K79 A;  2ADU A;  3KEY A;  1JT0 A;  2QF7 A;  1OYW A;  1LJ9 A;  3GZ6 A;  1Z3X A;  1MDM A;  1WHU A;  2OC6 A;  2N8G A;  3OWT A;  2VE9 A;  4C2M J;  4DZJ A;  3HRU A;  3CJQ B;  4HAM A;  5ILS A;  2AXT C;  2XAQ A;  4A0Z A;  1KQ9 A;  1MJ9 A;  2DK5 A;  2LTP A;  3GTJ J;  3HGY A;  5CQG A;  4Z6Y A;  4ANJ A;  4RLQ A;  3T1B A;  1WJA A;  4MLO A;  1SAN A;  2XPU A;  3DEW A;  3OIP A;  2DT7 B;  4D7N A;  5E17 F;  2IPQ X;  3HHG A;  1XN7 A;  3F8B A;  4G7O F;  1QO0 D;  2YU3 A;  2P7C B;  3CUQ C;  3MAJ A;  1V54 H;  4LG0 B;  1J7K A;  2BBY A;  4XID A;  1YJW I;  2EZK A;  1ZHF A;  1S9H A;  3I9V 2;  4ASN A;  2RN7 A;  5IP7 J;  4J00 A;  1YG2 A;  3FK7 A;  4HZF A;  4OAZ A;  4BQO A;  3IRQ A;  2IEK A;  3MZY A;  3CF2 A;  3OYH A;  2LYC A;  4XKC A;  2QUF A;  3NAU A;  1YW8 A;  3HKZ N;  2E2I J;  4P96 A;  5GTI C;  4A69 C;  1IN4 A;  3CCM I;  3K69 A;  2XAJ A;  5E3O A;  3KPH A;  4XRS G;  2HZT A;  1OCO H;  3CP2 A;  4UNO A;  3S17 J;  1ZEL A;  2P5L C;  3F8F A;  3C7J A;  2OTL I;  1FSH A;  4XIC A;  2HOA A;  2NNN A;  2AO9 A;  1FTZ A;  4ON0 A;  2MLG A;  3IHU A;  4FAS D;  2XKP A;  2UXN A;  2E7W A;  1Z77 A;  4BE0 A;  3FIS A;  2CRG A;  3G1O A;  4XN3 A;  4KMF A;  2ECB A;  4HX4 A;  4DOZ A;  3M3Y J;  1T98 A;  1UG0 A;  3ZQ7 A;  3HB9 A;  2YS9 A;  4PJN A;  4O3M A;  5E8G A;  2DT6 A;  3FK6 A;  4LIT A;  2F4O B;  2LH9 A;  2PEX A;  4LG0 A;  3HRT A;  3SJM A;  1V3F A;  2VQC A;  1QU3 A;  3R0J A;  4OMZ A;  4PK4 A;  4KT6 A;  3BOQ A;  4OAY A;  3BQZ A;  3U1K A;  1S7E A;  3GW2 A;  3IAS 2;  1JUM A;  3FMS A;  5FLV A;  1N77 A;  2XSD C;  2EB7 A;  2DO7 A;  2KDO A;  2OZ6 A;  3MZH A;  2LR8 A;  1WRJ A;  3LFK A;  2IP2 A;  4Y15 A;  4BQN A;  1UAA A;  5FLM J;  1W5C C;  1DP3 A;  1A6I A;  1ETQ A;  2FNA A;  1IRG A;  4XRF A;  2JK3 A;  2VOO A;  2NNY A;  1FWZ A;  3GFM A;  4MEY F;  2Z1D A;  4R79 A;  1VQ7 I;  1SAU A;  2IVM A;  3OSG A;  5E3N A;  4LLG F;  4X6A J;  4CH7 A;  4KIS A;  3QOD A;  2K40 A;  5F0H A;  5L3B A;  1R1V A;  4XOT A;  2R7Z J;  2LY1 A;  1IN6 A;  1EKE A;  3EUA A;  3CJR B;  1I5Z A;  2DA7 A;  1E3H A;  2FQ3 A;  4UUS B;  2EFW A;  3LWF A;  2NS0 A;  3ABU A;  3GTM J;  4E7L A;  1EV7 A;  1X1A A;  2FUG 2;  2X6Y A;  1NG7 A;  2RQP A;  1KU2 A;  3VFZ A;  1QPI A;  5ICC A;  1MMA A;  1SVM A;  1HQC A;  3PO3 J;  2XGC A;  3I4M J;  5CVR A;  2BXY A;  1JKR C;  1ENH A;  4BGD A;  2PI0 A;  3HG9 A;  5D8L B;  4G6D A;  2LOO A;  4DBR A;  1H8A C;  2KRF A;  4NB5 A;  1O3S A;  2KRC A;  4XM3 A;  1BJA A;  4GYG A;  2A07 F;  5FKN A;  3SDG A;  3AL0 B;  4Z2Y A;  3BZ6 A;  4Y3O A;  1BR4 A;  2VC1 A;  4ZDO A;  3GLL A;  2A5Y B;  4BDZ A;  2W25 A;  1GVJ A;  2R5Y B;  3QAH A;  4M3E A;  1GXP A;  4A3F J;  3PIO F;  2WV0 A;  4UUS A;  4PGH A;  2A69 F;  4JX6 A;  1L3L A;  3VOE A;  1REP C;  1BR2 A;  4XOP A;  1F9N A;  2W48 A;  2LRD A;  1XCB A;  5BPD A;  4EJO A;  2RC4 A;  2VBY A;  2EQR A;  1YE9 A;  1SFO J;  2STT A;  3LOC A;  1IN7 A;  3WGG A;  1UHS A;  1GVD A;  2EJR A;  4A12 A;  4WCG A;  4D1Q A;  3UKG A;  1WI9 A;  1SFU A;  4JBA A;  4YII A;  1YIT I;  1XC5 A;  2VB6 A;  4I98 B;  2XF5 A;  1Y39 A;  2DN0 A;  4Q4Z F;  1G3W A;  5AIQ A;  3FM3 A;  1ORK A;  5J1Y A;  5ED4 A;  1H89 C;  2DJI A;  1MMD A;  1WJB A;  4BEH B;  1T39 A;  4JX4 A;  1W36 C;  3FM5 A;  3RYP A;  2DA3 A;  2R5Y A;  1TP4 A;  1YJN I;  2M7A A;  3OYN A;  4U7D A;  5BS6 A;  5HS8 A;  3F8N A;  1CF7 B;  4CCN A;  2OAZ A;  2F5D A;  2RQQ A;  4JP0 A;  1T56 A;  2Z33 A;  4ZTJ A;  3JAM K;  4I01 A;  3I58 A;  4IZZ A;  5FRO A;  3L00 A;  2MA3 A;  4XLN F;  4XKB A;  2K02 A;  4H4K C;  4II3 A;  5KCM A;  3WOD F;  1VFC A;  4CGZ A;  3TKY A;  1TWG J;  4IJA A;  2VT2 A;  1WFX A;  2MYS A;  5J4Y A;  2KIM A;  3A0H C;  1V5E A;  1WSU A;  4RS8 A;  3DP7 A;  3BR0 A;  2DQR A;  2E1O A;  2DLL A;  3K2Z A;  4ZYA A;  4RDU A;  1NHA A;  3FDY A;  3IWZ A;  1TWA J;  2E36 A;  4BEH A;  1FYM A;  2KL4 A;  4A6D A;  2JUC A;  4N9I A;  2X1C A;  5JLX A;  5K7F A;  4ZH4 F;  3DEE A;  2AS5 F;  4UVA A;  5FKM A;  3LL7 A;  2CV2 A;  2IRF G;  1CF7 A;  2HQA A;  2QM3 A;  4BL0 B;  4LLN A;  4BAY A;  1OCR H;  1JTX A;  2MBF A;  3TGN A;  3QRF F;  2Y30 A;  4LK1 F;  3HC7 A;  4PFP A;  2C6Y A;  3TBI A;  1YS7 A;  1OCP A;  2X6W A;  4P5O A;  1WJF A;  3BG5 A;  1FZP B;  1U2W A;  1ZQ3 P;  3G3Z A;  1EH6 A;  2K4J A;  2HEO A;  1JKQ C;  4HLX A;  5E3M A;  5TIS C;  3EUK L;  4JQF A;  3OY9 A;  3A02 A;  2K7L A;  4PSW A;  2TCT A;  3DU5 A;  2Y0S A;  3LQQ A;  2Y48 A;  4M3F A;  1RNL A;  1Z1D A;  5FLX K;  3TDZ C;  3TO9 A;  5IYC J;  4BKX A;  2NRA C;  5HNF A;  2ZXW H;  3ABM H;  3HJE A;  3K4J A;  2DJN A;  2JA6 J;  2VQG A;  4XOR A;  1X1P A;  4ENK A;  2O8K A;  1R58 A;  3W6K B;  4KIG A;  2BY0 A;  2HXI A;  3M8J A;  4C3J J;  2EWN A;  2QKL B;  3KFW X;  5KAF C;  1IG7 A;  1GXQ A;  2RKH A;  2V9P A;  1Z7U A;  3TO6 A;  4IQ4 A;  3CLQ A;  3H9J A;  4JYK A;  3ZMT A;  2DMP A;  2CUZ A;  2CQN A;  5FFX A;  4UV8 A;  2GZW A;  3ZPL A;  4IKF A;  4AVZ A;  3KET A;  1OJL A;  1TBX A;  2EZH A;  4KIF A;  3T8T A;  3CQZ J;  3WTU C;  1NK3 P;  4HF2 A;  2A68 F;  2EH3 A;  4FE7 A;  3AG4 H;  4E4H A;  5DS9 A;  3W6J B;  3QOE A;  4XSX F;  5J8F A;  3BR6 A;  4A3J J;  1IXR C;  1EA3 A;  2G7U A;  2X4H A;  4U87 A;  1X1B A;  3IP4 B;  2ZJQ F;  4RBO A;  4CCJ A;  4ZDP A;  5K5R A;  3RTR A;  4L5J A;  2FMY A;  2M7B A;  3Q3S A;  3ECH A;  1Z6T A;  5D5U B;  1X3Z B;  2E1M C;  1LE8 B;  2QQ9 A;  2LSO A;  3Q0W A;  2Z3Y A;  5CJ9 A;  3IV5 A;  2QEX I;  3WTZ A;  4HSR A;  1X4O A;  5B66 C;  1B72 B;  1YOV B;  2M8G X;  5CYV A;  2A6E F;  3MKZ A;  2IXS A;  5BMZ A;  3K1P A;  5E1W A;  1RKW A;  2EFO A;  3MKW B;  4PCQ A;  2LBF B;  1IV8 A;  1FOY A;  1KU7 A;  1T2K A;  3MKY B;  4NC6 A;  3LAP A;  3JSO A;  4IO9 F;  3GTP J;  1MND A;  5FRN A;  1N75 A;  1KGS A;  4XLF A;  3PFI A;  1IV6 A;  5IPA A;  4RB0 A;  3N4M A;  1MJB A;  2DOA A;  3E6C C;  1W36 D;  2K85 A;  3NAR A;  1U78 A;  3VWB A;  4G7Z F;  1UMQ A;  1ERD A;  1X19 A;  3ZMZ A;  3CP8 A;  1W7P B;  1I50 J;  4ZC3 A;  4LK0 F;  1D0X A;  3Q0V A;  3A0B C;  1X3W B;  3KYL A;  3HTS B;  4IHV A;  4UY8 I;  5C4X J;  1LUJ B;  1ZGJ A;  2OU2 A;  3ERE D;  2R5Z B;  1B72 A;  4OMY A;  1BI0 A;  4XRM A;  2JVH A;  2PQ8 A;  1P7I A;  3DBR B;  1BA5 A;  4UV9 A;  2HU9 A;  3D1N I;  1J9I A;  1T33 A;  1B4A A;  3RKQ A;  1F4K A;  1SD7 A;  2GA1 A;  1AA7 A;  3K7A J;  1YLF A;  2DBB A;  2E35 A;  1BW6 A;  2ZME B;  3SQN A;  3LSJ A;  3KP3 A;  2IGK A;  4CZC A;  4NC8 A;  4YEL A;  3PO2 J;  2XDV A;  3HDD A;  4BE2 A;  5BPI A;  3DKY A;  4U0V A;  3WTW C;  3KYD B;  1OR7 C;  3CO6 C;  1WJC A;  5JVG F;  3RI4 A;  5LRS A;  3GME A;  4XLP F;  2ZNZ A;  4KFC A;  5EZH A;  1Y6I A;  2DMN A;  3F6V A;  4F52 A;  3CMA I;  3K1M A;  1SMT A;  3E1S A;  4IQJ A;  5JLW A;  3WE2 A;  2OQG A;  1XCV A;  2R5Z A;  3GFL A;  4G9Y A;  3G71 I;  4C2T A;  2Y9Y A;  4CSW A;  5DUK A;  2VOP A;  5KHD A;  3D0S A;  4IHX A;  1XDU A;  3ZN1 A;  3G2B A;  4M3D A;  3WU1 B;  2VC0 A;  4ESF A;  3U21 A;  5M3F J;  1NG6 A;  3R61 A;  2NS8 A;  5LEK A;  1WJE A;  2FU4 A;  4Y4R A;  5H6R A;  4WF2 A;  3GTK J;  1IRZ A;  3E6B A;  4M3B A;  2L9V A;  2P0W A;  1DPR A;  5DV5 A;  3TQN A;  5ICG A;  2KJB A;  3M8F A;  3AG3 H;  3MCZ A;  2VLA A;  5B1B H;  3IC7 A;  4IOA F;  2IT0 A;  1X4P A;  2JPC A;  2W4S A;  1K4T A;  4MGR A;  3DLL F;  2IBD A;  1FP1 D;  5FD5 A;  5F64 A;  3ZQQ A;  4E70 A;  2BW3 B;  5LBQ A;  4HDV A;  3I0T A;  3AG2 H;  5TGT A;  4C3H J;  3BJO A;  1ZKG A;  1D8K A;  3TOB A;  1TT5 B;  3PSF A;  3ZMS A;  2E5N A;  1BM9 A;  5EEH A;  3DTE A;  1FJL A;  2CYY A;  3WU0 A;  5FRM A;  3SFZ A;  5ILU A;  4UB8 C;  1AHD P;  1HDP A;  4RA2 A;  4BQA A;  1MBF A;  2E7X A;  4RGR A;  5GAG J;  1B6A A;  3OMY A;  4IPA A;  4DW6 A;  3QPH A;  4E7S A;  2L7K A;  3KLN A;  2MH2 A;  3EUH C;  3V7C A;  2EIN H;  2PX9 A;  1G2H A;  2J5P A;  2B0L A;  2Q0O A;  2O0Y A;  3DBH B;  4HX7 A;  1W5S A;  3H92 A;  4FT8 A;  3RKW A;  3VYU B;  5KNL A;  1IUF A;  3HM5 A;  4I0A A;  5B3S H;  2IS1 A;  3H0D A;  1RZ4 A;  2JSP A;  2BW3 A;  3R4K A;  3BG6 A;  4MO7 A;  2LFB A;  3CJT B;  1KU3 A;  2CU7 A;  5F0C A;  3SFI A;  2HKO A;  4ITV A;  5EF6 A;  2XAS A;  2RNG A;  1LFU P;  1XGS A;  5LGT A;  2E71 A;  3O2P E;  1UST A;  1RET A;  3ELK A;  3F6O A;  4Y33 A;  4MEX F;  3I4N J;  2HQ5 A;  3S3M A;  1GV2 A;  4E6K G;  2WB1 A;  1ZRD A;  4RGS A;  4DGW B;  1LPQ A;  5FKL A;  2NVT J;  2XGD A;  1BI2 A;  2VBZ A;  3OYD A;  3PQK A;  4BAC A;  1GLN A;  2V1D A;  2O03 A;  2VJI A;  2YSR A;  2HTJ A;  3EDP A;  2QSF X;  3FMQ A;  3KYC B;  4A0Y A;  3HRM A;  4BXU A;  1IJW C;  3W2V A;  3L7W A;  1D8J A;  4V19 K;  1S72 I;  1O57 A;  1AWC A;  3JRE A;  3OL3 A;  1ZRC A;  3GYH X;  3FXL A;  3L2U A;  1I27 A;  4LOC A;  1JGG A;  3KZZ A;  4M9X A;  1Y0U A;  2B9S A;  2EV5 A;  5HLI A;  3DU6 A;  2P81 A;  3KE2 A;  3DTK A;  1HW2 A;  4F91 B;  5LFA A;  2FBH A;  4ENJ A;  5E8I A;  4HRI A;  1YFH A;  1HC8 A;  2RGV A;  4OU0 A;  1BC8 C;  2P5V A;  2HYF A;  5K5Q A;  4N4N B;  1B9N A;  2XF6 A;  1J5Y A;  3AKZ A;  2K9N A;  2MG4 A;  1EH7 A;  1K83 J;  4KJZ A;  2PMZ A;  3GZN B;  2K9Q A;  4LMY A;  5D4R A;  1HKT A;  1G3Y A;  2HOS A;  4FX0 A;  5EG0 B;  2MC3 A;  2X85 A;  1PJR A;  4PGG A;  1DUX C;  1N78 A;  2XPV A;  3CC7 I;  5D5W B;  1S3J A;  3HOU J;  1QQI A;  3KP4 A;  4KN4 X;  2WA0 A;  5D5V B;  4BHC A;  3WHC A;  2QKM B;  3CMM A;  4RAF A;  3PFY A;  1Y0N A;  2OF7 A;  1JKO C;  4HF1 A;  4Q47 A;  5ILV A;  2JPB A;  3CME I;  1Q1V A;  1MSE C;  3DPU A;  2HPI A;  3FXO A;  1RIO H;  5H6Q A;  4A3L J;  2CQX A;  1HXD A;  1I6H J;  1U8B A;  2L54 A;  5M5Y J;  1VQP I;  5FO5 A;  5J47 A;  1IRX A;  2BY3 A;  1O3R A;  2R4G A;  4QTR A;  1TL8 A;  2DAO A;  1WCM J;  2VXD A;  3LSG A;  5F08 A;  3HOW J;  3BTC A;  3JRI A;  3ZQF A;  4D5C A;  5M5W J;  1O3T A;  2HWV A;  3UR3 C;  3EPZ A;  2HNH A;  1LDD A;  1VZ0 A;  2E34 A;  2L02 A;  2O7O A;  4AU7 A;  1P4W A;  2BY1 A;  3I59 B;  4NHJ A;  1HOM A;  1J2X A;  5EG0 A;  4QLC U;  3PM1 A;  4LD5 A;  4E7J A;  1YTY A;  2CQK A;  3JAM Z;  3JCU C;  3CUO A;  3H5A A;  5IP6 A;  3WTX C;  1ETV A;  2P4W A;  5E20 A;  1KU9 A;  1R6R A;  3V7R A;  2KZG A;  3H36 A;  4XLA A;  3CCQ I;  1YS6 A;  3HHH A;  3P9C A;  5J4V A;  1U3E M;  1H9T A;  3L2V A;  1DP7 P;  1F5T A;  1R49 A;  2VXZ A;  1H88 C;  4DJA A;  2JA2 A;  3K6G A;  3BG9 A;  1R4M B;  2LY9 A;  2GIZ A;  1TNT A;  2PBI A;  4ZZD A;  2K4B A;  1WQ2 A;  3OOP A;  4RB1 A;  3WE3 A;  1FOW A;  4G8X A;  3OYB A;  3LQR A;  3CC2 I;  2GWR A;  3A1Y A;  3H0G J;  3QYF A;  3BR1 A;  5LHH A;  3FMR A;  2KIQ A;  4V2G A;  2VJ4 A;  5LGN A;  3I59 A;  2HQN A;  4B8X A;  2DFI A;  1T38 A;  4HA8 A;  3J80 K;  4B43 A;  1FMV A;  1E3P A;  1T0F C;  2ME6 A;  2DOD A;  3EYY A;  4RAG A;  3HPH A;  4MQ9 F;  2A6T A;  4S0H B;  1Z67 A;  4DQ2 A;  4CUG A;  2MD0 A;  1JUP A;  2DMT A;  2F4M B;  3H3Z A;  3BTL A;  3L09 A;  1VQK I;  2E2J J;  1PP8 F;  2XGE A;  4W1U A;  3ISP A;  4CCM A;  4BJ6 C;  3LA3 A;  3OYC A;  1VQL I;  1UZC A;  4DYC A;  4IEJ A;  4IX7 A;  3FXK A;  3RJP A;  2KLO A;  4A3K J;  5D6E A;  2HYG D;  4LJZ F;  5H20 A;  5FLX Z;  4YIF A;  3OYG A;  3PJR A;  2COM A;  3J81 Z;  4U0Y A;  1HDD C;  4H0E A;  2R7V A;  4C9Y A;  2JUG A;  4NDL A;  5DM7 F;  1F43 A;  2NVY J;  3R0A A;  1ZAO A;  5DEQ A;  1XPX A;  4ZZL A;  3FXM A;  2WB1 N;  2X51 A;  3P7N A;  1P2F A;  1KON A;  4A6E A;  2KT0 A;  3RIR A;  1S6L A;  1WI3 A;  2VPR A;  4F92 B;  1RR7 A;  4DNC A;  2IA0 A;  3I56 I;  5IT9 K;  2L9S A;  1SC7 A;  4ENN A;  2NVU B;  3TMO A;  4L9T A;  2KHM A;  1A6Q A;  3BJA A;  4Q48 A;  4Y17 A;  2DYR H;  1R1T A;  3DLA A;  5D5X B;  3KP7 A;  4I76 A;  4P9U A;  3CCJ I;  2P6T A;  5F6F A;  3H9G A;  4F3Q A;  1V5F A;  5H2F C;  1YQA A;  3B6A A;  5JFR A;  4ENM A;  3VYT B;  4KDP A;  2JRM A;  1JXS A;  1RKT A;  3HXL A;  3E97 A;  2JRT A;  3TP0 A;  1ZG3 A;  4AWX B;  2W85 A;  2NS7 A;  2OUM A;  3OIQ A;  4CYC B;  1ZR4 A;  2LLK A;  2QYO A;  1VQ9 I;  2JTV A;  1FOK A;  3V42 A;  2LKP A;  3CCE I;  3ZGK A;  1JHF A;  3KEO A;  2PMZ N;  4XMY A;  2WWY A;  1ZLK A;  3BTJ A;  3GTL J;  2CQQ A;  2Y69 H;  2ZSI B;  2L5Q A;  1DU0 A;  1DU6 A;  2A3S A;  4KIT B;  4E7H A;  4CCL A;  3W2A A;  5J8C A;  2VL8 A;  3RKY A;  3CUQ B;  3HIF A;  1UHM A;  2HR3 A;  3DFG A;  2FE3 A;  1YW7 A;  2Z16 A;  2PMH A;  1KZH A;  3SXY A;  3LFU A;  2ZXI A;  1ZLJ A;  1L0O C;  5JI6 A;  3G1L A;  4IHW A;  5EEG A;  4HW0 A;  2KDZ A;  3VSL A;  1FBU A;  3V8L A;  4CA0 A;  5DCF A;  4BUP A;  2YX4 A;  2ZSH B;  3GUD A;  4XN0 A;  3RPU D;  3OS0 A;  1OLT A;  1U8R A;  4M74 A;  2Y75 A;  4A3G J;  4XNF A;  4NNJ A;  1X1D A;  1OPC A;  4CYC A;  4PDK A;  2HGC A;  1XX5 A;  1UCR A;  3GZ5 A;  2HDD A;  3M07 A;  4OOI A;  3IH3 A;  3BTI A;  4B09 A;  3S16 J;  2XVC A;  3FKJ A;  1ONV A;  5E1X A;  4G6Q A;  2WY8 Q;  3D5S C;  3ZRG A;  1FEX A;  4KYW A;  4NUB A;  2GIV A;  2EIL H;  3BCB A;  4LB5 A;  2ISY A;  3GFJ A;  4EJV A;  4XRS A;  3WU2 C;  1IXS B;  2M87 A;  1TNS A;  3C2G A;  2M1B A;  4CIC A;  3G6E I;  2MH9 A;  1VQO I;  3HSE A;  3IH4 A;  4LIV A;  3CUQ A;  1U0J A;  5EZG A;  2X1D A;  3CC4 I;  2V1N A;  2FXA A;  2IGO A;  3V4G A;  1XD7 A;  4ABZ A;  2AHQ A;  1X3U A;  3DPT A;  5A2Q K;  2LDU A;  4LIU A;  2BV6 A;  1PVE A;  2D45 A;  2UXX A;  1BIA A;  1BR1 A;  3M8E A;  2HYJ A;  2JZY A;  2EFP A;  1WJ5 A;  3I64 A;  1R71 A;  1SD6 A;  2DDA A;  2Q2E A;  1XDS A;  1UG2 A;  5CVU A;  2QQA A;  1MBG A;  3H35 A;  1TT0 A;  3I3L A;  1RRJ A;  2L7F P;  3ASO H;  1PYV A;  4ZYG A;  1JJ8 C;  2VI6 A;  5M3M J;  1TW3 A;  4M71 A;  2D1V A;  2M30 A;  3KEQ A;  4A3I J;  2CWE A;  4IHY A;  5CVJ A;  2F5E A;  3BR5 A;  1ZTR A;  4C30 A;  1APL C;  3BY6 A;  2I10 A;  1JJ6 C;  1I3Q J;  4M73 A;  4HNT A;  1IW7 F;  4KUM A;  5JHF A;  2LVS A;  1QVU A;  5HDN A;  1HSJ A;  2A05 A;  4O5V A;  2XB5 A;  3KP6 A;  5LD2 C;  4DYR A;  4B3A A;  3ZCO A;  2CGP A;  2PMU A;  1QBJ A;  2O3F A;  2CJJ A;  1IO2 A;  1D0Z A;  4QWQ A;  4BS9 A;  1EF4 A;  2OD5 A;  3CCS I;  4BDY A;  1YIO A;  3I71 A;  1FT9 A;  1G4D A;  3FZV A;  3L2Q A;  4OIO F;  3GTG J;  1S7A A;  1XGN A;  3S3N A;  3LMM A;  2ME0 A;  1J75 A;  2RVC A;  1TQP A;  4A3D J;  4X1E A;  2ZME C;  2OQR A;  1SD4 A;  3HSF A;  3RPQ A;  3VDX A;  3J7A Y;  4KT5 C;  5AIP A;  1DDN A;  3KLO A;  2R7T A;  1VQ6 I;  5CPR B;  4AIJ A;  3JR9 A;  4EJT A;  5HS7 A;  1RC9 A;  4IHT A;  1ZR2 A;  3H5N A;  5JHU A;  2GA2 A;  4UVC A;  3L2R A;  1IXC A;  1NTC A;  1A35 A;  4OIN F;  3ZQC A;  2ESH A;  1FIA A;  2WAQ N;  2M3A A;  2NXN B;  3FHZ A;  1QRY A;  1K61 A;  3G73 A;  2NVX J;  3KZY A;  1O7L A;  3ONQ A;  4HV6 A;  1FYK A;  2OPT A;  2M0C A;  3SHF A;  1UB9 A;  2CW8 A;  5GPC A;  2PFB A;  3FIW A;  2YU9 J;  3JRG A;  1Y1V J;  1SMY F;  3LA2 A;  3J7Y J;  4FCY A;  1VTN C;  5F0F A;  4EM2 A;  1POG A;  1BOB A;  4LLL A;  2HS5 A;  1NH3 A;  1K6O A;  1KYZ A;  5JR3 A;  2EFN A;  1SEU A;  1LFP A;  2H09 A;  2R7F A;  3F0C A;  3D5L A;  4R8H A;  3RDI A;  2PLY A;  3KX2 A;  2YR2 A;  3AAF A;  1WZ2 A;  5FB2 A;  1P7J A;  2B63 J;  3OYE A;  4M3G A;  2CW7 A;  4BE1 A;  4RB2 C;  2L3D A;  4B1R A;  2K3P A;  3F21 A;  4GFB A;  4IOC F;  3VSK A;  1MBJ A;  3BLY A;  4ZYH A;  1N25 A;  4OWR B;  1FYL A;  1JHH A;  4BYY A;  1Z0X A;  1ETK A;  3DBL B;  3SZP A;  1YO5 C;  5IYB J;  1Z9C A;  1VQ8 I;  1Z6R A;  1P6R A;  2HZD A;  4OIP F;  1UJ8 A;  5LEJ A;  5LHG A;  5DDG A;  1YI2 I;  1ZRF A;  3W2W A;  2QLZ A;  2EBI A;  4AM3 A;  3ABK H;  4PJJ A;  4BY7 J;  2VT3 A;  3B73 A;  4XBF A;  2VN2 A;  3J7Z I;  4EVI A;  1I3A A;  2MC4 A;  1QHG A;  2VPL A;  2Z2S B;  2QGU A;  1BN5 A;  2V4J C;  1KYW A;  4HST A;  1C0W A;  1FTT A;  1TWC J;  4WXD A;  1XB4 A;  2PG4 A;  4R1H A;  1R00 A;  2M4K A;  4RAZ A;  1E0E A;  3HSR A;  3HTU A;  1OFC X;  2V9K A;  4FX4 A;  2K3F A;  1MNE A;  4YFK F;  2GXG A;  1CGP A;  4DIQ A;  3OR2 C;  2DA2 A;  3SDB A;  3QYB A;  2FBK A;  5K5O A;  3GFI A;  2CSO A;  3D5R C;  2ESN A;  2DTZ A;  2M45 A;  2LK2 A;  3JTH A;  3PNV A;  4JOM A;  1W5T A;  1SFE A;  1NK2 P;  1TW2 A;  1U5T C;  5J3L A;  4E7Z A;  3L2W A;  1D5V A;  1ITY A;  2K9M A;  3RQI A;  1BI1 A;  1OCC H;  2LY2 A;  2IJL A;  3FF5 A;  2RV8 A;  1GDT A;  1UEL B;  3BJ6 A;  5HNH A;  3P5J A;  1T08 B;  2XAU A;  2KPM A;  2NOJ B;  2CQ7 A;  2F5F A;  4L9V A;  4G94 A;  1BBY A;  4V2F A;  2CS3 A;  3S93 A;  1XS9 A;  3S2D J;  1ON2 A;  1LKX A;  3LSI A;  2XC7 A;  4QIW N;  3N05 A;  2ZFU A;  1TTY A;  2KFD A;  2MW8 A;  1W7P D;  4I99 C;  2DCE A;  2IGN A;  1IRF A;  5HOO A;  3GCM A;  3B02 A;  3BR3 A;  2K9L A;  2G9W A;  2QBY B;  5L3C A;  1LQ1 A;  1B59 A;  2L2O A;  1FP2 A;  3OR1 C;  1LB2 A;  3F9K A;  2BZT A;  3DTI A;  1ULY A;  3WTT C;  2O9L A;  2JT1 A;  3KP5 A;  2KIU A;  2HI3 A;  3TED A;  4L9N A;  3BRO A;  3H1C A;  3S1R J;  2DXI A;  3O8H A;  4L0Z B;  3S14 J;  2IS6 A;  1I39 A;  3PSI A;  3M1C A;  1DPU A;  3V8J A;  4XL9 A;  1AOY A;  4MQV A;  5AON A;  5CVI A;  4S04 A;  2CUF A;  1LEA A;  4L9J A;  3VOD A;  1MMG A;  2IGM A;  3Q0U A;  1MKM A;  3T0Y A;  4HG2 A;  1R7J A;  2W1O A;  2CFX A;  4I7H A;  1PP7 U;  2CO5 A;  4HBL A;  1WH7 A;  4DYQ A;  2RAE A;  1HKQ A;  4CDG A;  4EMS A;  4MIM A;  3NQO A;  1FLI A;  2UUZ A;  4XKW A;  1JUS A;  3I4P A;  2E1M B;  2ISZ A;  2QBY A;  1FY7 A;  1R5G A;  1HBX G;  2X6X A;  3J80 Z;  3BDD A;  3PUB A;  3IWF A;  2YUS A;  5LLQ A;  3K4M A;  5B5E C;  4A5M A;  4ESB A;  3VPR A;  1IAW A;  2CFO A;  4P55 A;  4D9J A;  2A5W A;  3ZQH A;  2PN6 A;  4IL6 C;  3U9G A;  1I1G A;  2DI3 A;  1XTA A;  3K4N A;  3FBI B;  1V5G A;  3LSM A;  4UHT A;  4EV0 A;  5C3E J;  3WG9 A;  3QU3 A;  5HOD A;  2FA5 A;  3IUO A;  4ZTF A;  1YRN A;  2VKV A;  4KNY A;  3Q9S A;  1WWX A;  1K7A A;  1MNM C;  4BHP A;  3HOX J;  1D1A A;  2LKS A;  1WH5 A;  1XG1 A;  4P9F A;  4PUS A;  5CLS A;  2KMU A;  3IKT A;  4KMU X;  9ANT A;  1YX5 A;  3LSH A;  1RUN A;  2X0L A;  1D3Y A;  3W3C A;  4EGZ A;  2Q1Z B;  2XHK A;  3TO7 A;  4CYD A;  1VQ5 I;  3NRV A;  5IT9 Z;  1RPW A;  4PJ0 C;  2HVR A;  2X6O A;  1X58 A;  1ACI A;  3VEP A;  3HPG A;  4J19 A;  3S2H J;  2XRN A;  4BU2 A;  3OOU A;  2KQR A;  3BPX A;  3QU6 A;  4XLC A;  3MKL A;  3DF8 A;  4B48 A;  5LGU A;  2LD5 A;  1GT0 C;  2OTJ I;  3OYI A;  2VBW A;  3CCV I;  3CDI A;  1MH4 A;  1QZZ A;  2H8R A;  2TRT A;  3GX4 X;  3V8K A;  4TV7 A;  2CMP A;  3ZOB A;  3I5U A;  4NQW B;  2COB A;  4IF4 A;  4EJU A;  1ZG1 A;  5HDG A;  2K5C A;  2XB0 X;  2NVQ J;  2ZO4 A;  1BIB A;  4E7I A;  2JA5 J;  1J09 A;  4A3B J;  1JT6 A;  2ZJR F;  4N0B A;  1SD5 A;  3DCF A;  3RKX A;  2BYV E;  3RYR A;  3I55 I;  2R7S A;  2O5R A;  1JKP C;  4FE4 A;  1TC3 C;  1FSE A;  4NC7 A;  3LNQ A;  1QGP A;  3LSK A;  2M34 A;  4HPQ A;  4MFD A;  2O61 A;  2HXO A;  4AYB A;  1D0Y A;  2UV1 A;  4M9Z A;  3K9T A;  2G0E A;  4PJM A;  1KQ8 A;  1XMX A;  4ZYD A;  3Q9V A;  4S05 A;  3OIO A;  1Q1H A;  3MVP A;  2R7R A;  2DTR A;  2E1N A;  3GBG A;  2WAF A;  3FBN B;  2ZNY A;  2J5O A;  4HQM A;  1EH8 A;  1Z21 A;  3K1N A;  4ETS A;  1FX7 A;  3MN2 A;  1T95 A;  4NQW A;  2Q8K A;  2EZL A;  4MTE A;  1OR7 A;  4BH9 A;  2QSG X;  4WXC A;  3ABT A;  1QZE A;  2RRE A;  3ZMD A;  1T8I A;  3JRH A;  2M9H A;  3X2Q H;  2ELK A;  2KRH A;  2LRE A;  3A03 A;  2Z5U A;  3FXU A;  3H9Q A;  4FHT A;  4HYE A;  5E1Z B;  3OS2 A;  3AL0 C;  1MGT A;  3F22 A;  2OZU A;  2IA1 A;  2VQL A;  1JE8 A;  5DTD A;  2EA4 A;  2A61 A;  1T6S A;  2XF7 A;  4BJT A;  3FXQ A;  1W0T A;  2GXA A;  4GYI A;  3AFH A;  2O8X A;  2GOX B;  2XUB A;  5A2Q Z;  2L0K A;  2D5V A;  1MBK A;  3FWE A;  1OCT C;  3C1D A;  2ELJ A;  2QEN A;  3I54 A;  4MHG A;  4E7K A;  3S1Q J;  3E5Q A;  3MZ8 A;  3IKV A;  3E5X A;  1LNW A;  2EV0 A;  1QVT A;  2HOE A;  3S8P A;  1O3Q A;  2L7Z A;  5F1J A;  1K78 B;  2EIK H;  1HW1 A;  2OBP A;  3V7S A;  4AUX A;  2Y31 A;  2JN6 A;  2ZXJ A;  3JRD A;  5B1A H;  3HOS A;  5IT3 A;  4BBR J;  3ESW B;  2EIM H;  3EYI A;  2O6G E;  4GXO A;  3C2B A;  2EPF A;  4A5N A;  2WTE A;  2KKO A;  1VQM I;  2MFZ A;  1IGN A;  1YX3 A;  2K9S A;  2F5V A;  5GTH C;  2FQ4 A;  5ICF A;  1QPM A;  4QSH A;  4HDU A;  3BT9 A;  1WPK A;  3M7G A;  5DCM B;  3TP3 A;  2BXZ A;  2P7V B;  6PAX A;  5HLH A;  4BY1 J;  1ZYR F;  3PL8 A;  2HFH A;  3A01 B;  1KQ0 A;  4RB3 C;  1OYI A;  2DFF A;  4AVP A;  3WTY C;  2A6H F;  3GO5 A;  1X2N A;  2F5C A;  1E2X A;  2DQL A;  2XRL A;  3HYI A;  4B4C A;  4BJ5 C;  3OS1 A;  1R1U A;  3IL2 A;  1XGO A;  2AQE A;  3CF5 F;  1J59 A;  1PUE E;  1MIJ A;  2ZJ2 A;  2QCO A;  3EUH A;  2V1X A;  1Y8Q B;  1FMW A;  1MZB A;  3F8M A;  3HGG A;  1K78 A;  3BPV A;  3BCA A;  1WGX A;  3OYL A;  1PUF B;  3K2A A;  3S1N J;  1OKR A;  2VKH A;  5GAH J;  2STW A;  1B9M A;  2IAI A;  1RI7 A;  4AD9 A;  4JX5 A;  2ECC A;  2XAG A;  1K6Y A;  1ETW A;  4Y7N J;  4Y13 A;  3PIP F;  2P6S A;  1YYV A;  1MW7 A;  2OCC H;  4RM2 A;  3F8C A;  1USS A;  2VJ5 A;  1R5H A;  5DCM A;  2R7O A;  2W82 A;  1LVA A;  4FET A;  4GGG A;  4LG3 A;  4XQF A;  3KCC A;  5IP9 J;  2FBI A;  4I2O A;  4YEJ A;  5GP9 A;  3NWT A;  3A01 A;  2UZK A;  3FXJ A;  3K70 D;  3PNT A;  5HS9 A;  2OCE A;  2EFQ A;  1VND A;  3KIO A;  1O4X A;  4YIR X;  5DYM A;  3JW4 A;  2WAQ A;  4WWC A;  2P8T A;  3S1M J;  5FKO A;  3EET A;  3JRB A;  4CZZ A;  2BOL A;  1R4N B;  3HOV J;  3OYF A;  1MMS A;  3E6D A;  3REO A;  1BL0 A;  5J6X A;  4D5F A;  2KZV A;  3QP5 A;  2RNJ A;  3HOY J;  1PUF A;  3C18 A;  2ZB9 A;  4RLF A;  2JA7 J;  1STZ A;  2AQF A;  3IAM 2;  1VI0 A;  3GEZ A;  4KIC A;  2XAH A;  5K1Y A;  1JGS A;  5K7Z A; 
#chains in the Genus database with same CATH homology
 4M3D A;  1NTC A;  3ZQC A;  1U9O A;  5M3F J;  1FIA A;  3S15 J;  4HNV A;  2NS8 A;  3ZQG A;  2WAQ N;  2ID3 A;  3GTK J;  3BG3 A;  1IRZ A;  1QRY A;  4M3B A;  4AYB N;  1JT0 A;  2QF7 A;  1K61 A;  2NVX J;  2N8G A;  2OPT A;  4C2M J;  4DZJ A;  2M0C A;  1X2M A;  2CUE A;  4A93 J;  5GPC A;  2LTP A;  3FKI J;  3FIW A;  3GTJ J;  3RZD J;  2YU9 J;  3HGY A;  3JRG A;  1Y1V J;  4FCY A;  5F0F A;  2IBD A;  1POG A;  4MLO A;  1SAN A;  2XPU A;  3DEW A;  4D7N A;  4C3H J;  3CDL A;  3F0C A;  5M5X J;  1ZKG A;  2LKX A;  3LSR A;  5BNG A;  1FJL A;  3IH2 A;  1P7J A;  2B63 J;  4M3G A;  4XID A;  2EZK A;  1AHD P;  1HDP A;  1MBF A;  4B1R A;  4GFB A;  5IP7 J;  3FK7 A;  5J1U A;  1MBJ A;  2IEK A;  4DW6 A;  3G1M A;  3NAU A;  1Z0X A;  2X48 A;  3HKZ N;  3JRA A;  2R92 J;  1ETK A;  3CCY A;  4D7M A;  2E2H J;  2DMQ A;  2GBY A;  1ETY A;  2Y9Z A;  2E2I J;  5IYB J;  4A69 C;  5E3O A;  3GTQ J;  4XRS G;  3S17 J;  1G2H A;  2EBI A;  4XIC A;  2HOA A;  4BY7 J;  1IUF A;  2AO9 A;  3HM5 A;  1FTZ A;  5IOZ A;  1Z77 A;  1FTT A;  3FIS A;  1TWC J;  2CRG A;  4MO7 A;  1ETX A;  2LFB A;  3G1O A;  2ECB A;  3M3Y J;  4EEF G;  2CU7 A;  5F0C A;  3SFI A;  2MGQ A;  3HB9 A;  2YS9 A;  5EF6 A;  1LFU P;  1OFC X;  3SJM A;  3FK6 A;  1IDY A;  1RET A;  3I4N J;  1B8I B;  2HQ5 A;  3L1P A;  2DA2 A;  1GV2 A;  3BQZ A;  1S7E A;  1JUM A;  5FLV A;  1R9T J;  5FKL A;  2NVT J;  2XSD C;  2XGD A;  1A5J A;  2DTZ A;  2LR8 A;  2LK2 A;  1NK2 P;  5J3L A;  5FLM J;  1IJW C;  1A6I A;  1ETQ A;  2JK3 A;  1ITY A;  3JRE A;  4L5E A;  3RQI A;  3OSG A;  4LOC A;  1JGG A;  1D5Y A;  5E3N A;  4X6A J;  1GDT A;  2P81 A;  5GPA A;  2K40 A;  5F0H A;  2R7Z J;  4V2F A;  1XS9 A;  3S2D J;  2DA7 A;  4QIW N;  2MW8 A;  4UUS B;  2K9N A;  2MG4 A;  3GTM J;  1K83 J;  2K9Q A;  1TWH J;  3BR3 A;  1ZK8 A;  2HOS A;  1B8I A;  5EG0 B;  1QPI A;  3PO3 J;  2XGC A;  4UUT A;  3I4M J;  2O9L A;  2WV1 A;  2XPV A;  2FX0 A;  1JKR C;  1ENH A;  2HI3 A;  3TED A;  3HOU J;  1H8A C;  3S1R J;  3WHC A;  2H1K A;  3O8H A;  3B6C A;  3S14 J;  2MSY A;  5FKN A;  2OF7 A;  3SDG A;  1JKO C;  1MSF C;  1MSE C;  5EGO B;  1AU7 A;  1Q1V A;  5EYR A;  2JA8 J;  4A3L J;  2CQX A;  2CUF A;  3OSF A;  5M5Y J;  1U8B A;  1I6H J;  3Q0U A;  1FIP A;  2R5Y B;  4QTR A;  4M3E A;  1WCM J;  4A3E J;  4A3F J;  3TW6 A;  1WH7 A;  3LSG A;  5F08 A;  4UUS A;  3HOW J;  3BTC A;  4DYQ A;  2RAE A;  3JRI A;  3ZQF A;  4D5C A;  4MIM A;  5M5W J;  4JX6 A;  2O7O A;  1JUS A;  1HOM A;  2W48 A;  2NOG A;  1HCR A;  5EG0 A;  3PM1 A;  2EQR A;  1SFO J;  3LOC A;  1UHS A;  1GVD A;  5IP6 A;  3QPL A;  1ETV A;  2YUS A;  3UKG A;  3VPR A;  1XC5 A;  3ZQH A;  2R93 J;  2DN0 A;  1H88 C;  5EGO A;  3BG9 A;  2LY9 A;  1ORK A;  5J1Y A;  1H89 C;  1ZGW A;  3BQY A;  3TW7 A;  5F27 A;  5C3E J;  4JX4 A;  5HOD A;  2DA3 A;  2R5Y A;  1IC8 A;  1YRN A;  2VKV A;  2XPW A;  1LFB A;  3H0G J;  3BR1 A;  4DZP A;  1MNM C;  4JP0 A;  4V2G A;  3HOX J;  1T56 A;  2VKE A;  1XG1 A;  1WH5 A;  4MFE A;  4I6Z A;  3O8G A;  9ANT A;  2ME6 A;  3ZQL A;  4S0H B;  1RPW A;  2X6O A;  1X58 A;  1VFC A;  1ETO A;  1JUP A;  2DMT A;  1TWG J;  3BTL A;  4J19 A;  3S2H J;  2E2J J;  3OOU A;  2XGE A;  4W1U A;  4FIS A;  4BBS J;  3BR0 A;  2LD5 A;  3MKL A;  2E1O A;  1GT0 C;  2HOT A;  4DYC A;  4IEJ A;  1LE8 A;  1MH3 A;  4RDU A;  4A3K J;  3ZQI A;  1TWA J;  3GTO J;  1MH4 A;  1HDD C;  2H8R A;  2TRT A;  5IYD J;  3LSP A;  4NDL A;  3CMY A;  3ZOB A;  1F43 A;  4A3M J;  5JLX A;  2NVY J;  5K7F A;  3RZO J;  4Y52 J;  2COB A;  5FKM A;  2WB1 N;  2VUM J;  1ZR2 A;  3HBL A;  2NVQ J;  2XB0 X;  2KT0 A;  1F36 A;  2JA5 J;  1GUU A;  1JTX A;  4A3B J;  1JT6 A;  2Y30 A;  3DCF A;  1WI3 A;  2VPR A;  1RR7 A;  2FJ1 A;  2R0Q C;  1U9N A;  1Y1W J;  3E7L A;  2JWT A;  1JKP C;  1OCP A;  4G12 A;  4FE4 A;  1TC3 C;  3BG5 A;  3LNQ A;  2M34 A;  1ZQ3 P;  4MFD A;  4I76 A;  2HXO A;  2DA6 A;  3B6A A;  1JKQ C;  5E3M A;  1E3O C;  3A02 A;  2G0E A;  1RKT A;  3TP0 A;  2TCT A;  3BR2 A;  3OIO A;  2NS7 A;  4M3F A;  3MVP A;  5IYC J;  2DMU A;  4CYC B;  4BKX A;  5FJ8 J;  2LLK A;  1ZR4 A;  3GBG A;  1HLV A;  2Y2Z A;  2DJN A;  2JA6 J;  2PMZ N;  3MN2 A;  2O8K A;  2HXI A;  3BTJ A;  3GTL J;  2EZL A;  4C3J J;  3QQA A;  2CQQ A;  1BJZ A;  2E19 A;  1YRN B;  1DU0 A;  1IG7 A;  1DU6 A;  3JRH A;  2M9H A;  4JYK A;  2ELK A;  2DMP A;  3A03 A;  5EDN A;  1OJL A;  2EZH A;  1JTY A;  5DTD A;  2Y0S N;  3CQZ J;  1NK3 P;  2EH3 A;  4FE7 A;  4BXX J;  5DS9 A;  1W0T A;  3WHB A;  3G1L A;  3BR6 A;  4IHW A;  2EZI A;  4A3J J;  2L0K A;  2D5V A;  1MBK A;  1OCT C;  4XK4 A;  2KDZ A;  1MBH A;  4RBO A;  3S1Q J;  1MBE A;  1QVT A;  4A3G J;  2JJ7 A;  2L7Z A;  5F1J A;  3Q3S A;  4CYC A;  1RES A;  1AKH B;  1LE8 B;  2DA1 A;  4AUX A;  1TWF J;  2Y31 A;  2HDD A;  2DA4 A;  2JN6 A;  3Q0W A;  5J1R A;  3JRD A;  3IH3 A;  3BTI A;  4BBR J;  3IV5 A;  3S16 J;  1B72 B;  3C2B A;  2M8G X;  1FEX A;  3M4O J;  2GLO A;  1IGN A;  2K9S A;  4XRS A;  1VF9 A;  2FQ4 A;  1HF0 A;  1RKW A;  5FKK A;  5IOY A;  4QSH A;  3BT9 A;  1WPK A;  3TP3 A;  3IH4 A;  5EZG A;  5C44 J;  4BY1 J;  3A01 B;  4FTH A;  3QPS A;  3GTP J;  4ABZ A;  1X2N A;  2AHQ A;  2XRL A;  4B4C A;  1IV6 A;  5IPA A;  3NAR A;  1U78 A;  1UMQ A;  1BW5 A;  2QCO A;  2HYJ A;  1I50 J;  2LP0 A;  3HGG A;  3Q0V A;  1WGX A;  5EEA A;  3HOZ J;  1AKH A;  1UG2 A;  4IHV A;  1MBG A;  1PUF B;  2L9R A;  3K2A A;  3S1N J;  5C4X J;  2L7F P;  2R5Z B;  1B72 A;  1JJ8 C;  2IAI A;  2VI6 A;  5M3M J;  4JX5 A;  2ECC A;  4XRM A;  1ETW A;  4Y7N J;  4A3C J;  1P7I A;  1BA5 A;  2GM4 A;  4A3I J;  4IHY A;  3D1N I;  5F04 A;  1T33 A;  3BR5 A;  4W97 A;  1ZTR A;  1APL C;  5IP9 J;  3RKQ A;  2I10 A;  1JJ6 C;  3K7A J;  3JRF A;  5GP9 A;  1I3Q J;  2M2E A;  3A01 A;  3H3V K;  1BW6 A;  2LVS A;  1QVU A;  5K7H A;  2XB5 A;  3LSJ A;  4DYR A;  2ID6 A;  4B3A A;  1VND A;  1O4X A;  3PO2 J;  2X9D A;  2CJJ A;  2L7M P;  3HDD A;  1EF4 A;  1IDZ A;  3S1M J;  4C3I J;  5FKO A;  3JRB A;  3HOV J;  2JMW A;  3W6V A;  3GTG J;  5EZH A;  1CQT A;  2DMN A;  2DA5 A;  2ME0 A;  1BL0 A;  4D5F A;  3HEF A;  3HOY J;  1PUF A;  4A3D J;  2ZB9 A;  4M6V A;  5JLW A;  4X1E A;  2JA7 J;  2R5Z A;  1VI0 A;  5E3L A;  1GV5 A;  3JRC A;  5C4J J;  3JR9 A;  4AC0 A;  1W0U A;  2Y9Y A;  2FD5 A;  4IHX A;  5K7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...