2CQXA

Solution structure of rsgi ruh-034, a homeodomain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
GSSGSSGGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVRKIQCWFRHRRNQDKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LAG1 longevity assurance homolog 5
publication title Solution structure of RSGI RUH-034, a homeodomain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 72
sequence length 72
ec nomenclature ec 2.3.1.24: Sphingosine N-acyltransferase.
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cqxA01
1GT0C 1BL0A 2XSDC 4C2MJ 1QRYA 1P7IA 2M2EA 4B3AA 4DZPA 3LSRA 1W0UA 1JKOC 1WPKA 3A03A 4IHXA 1JKRC 2N8GA 2NOGA 2LD5A 2I10A 4L5EA 4FISA 5C44J 1PUFB 1MSFC 4FE7A 5F1JA 1LE8A 1JUPA 3B6CA 3MN2A 4HNVA 3W6VA 2ECCA 2LKXA 4G12A 3JRFA 2FQ4A 3JR9A 1JKQC 1IJWC 1A5JA 3OOUA 3GTLJ 3HOVJ 2JWTA 2ECBA 3BR3A 3IH3A 3LSPA 3A02A 1X2MA 2W48A 2ID6A 4AYBN 2DMNA 4S0HB 3HDDA 2DJNA 1EF4A 3TW6A 2JA8J 2L9RA 2Y30A 1ETYA 1MH3A 1K61A 5IYCJ 3M4OJ 2DMUA 3A01B 2COBA 2EZIA 1ENHA 2YUSA 2EZHA 2ZB9A 3FK7A 3FK6A 3Q0WA 2XB0X 2JA7J 5E3LA 2P81A 1RKWA 2WV1A 1F36A 4BKXA 2VKEA 2PMZN 1H8AC 1ZR4A 1IC8A 4XICA 1F43A 1WH5A 1ZKGA 2K9SA 5IP6A 4A3BJ 1QVTA 5EEAA 1HDPA 5J1RA 2NS7A 4EEFG 1UG2A 3G1MA 4MO7A 4A3KJ 4IEJA 3SJMA 3LSJA 1X2NA 2FX0A 1XC5A 2JN6A 4BBRJ 1PUFA 1I6HJ 1IV6A 3S1RJ 1WGXA 1MBKA 2XPUA 1MBFA 2IBDA 1O4XA 5BNGA 1RPWA 3TP0A 1LFUP 1QPIA 3E7LA 3FKIJ 2OPTA 4JP0A 1Y1WJ 1ORKA 2DMPA 1SFOJ 1S7EA 1ZTRA 2VKVA 2L0KA 2ID3A 2R5YA 1WH7A 3ZQCA 3GTJJ 1ETXA 3IH4A 3BT9A 4QIWN 4QTRA 3MVPA 3JRBA 1I3QJ 4D5CA 3MKLA 3PO3J 5FKNA 2CQQA 4A3JJ 2JA6J 2MGQA 1W0TA 4RBOA 2O8KA 2K9QA 3S2DJ 4I76A 4NDLA 3S14J 4ABZA 3BR6A 1WCMJ 3CMYA 1HOMA 1T56A 4V2GA 3ZOBA 2YU9J 4Y52J 1MBGA 4M3DA 3L1PA 5IYDJ 4XIDA 1FJLA 2XPWA 3UKGA 3WHBA 3OSFA 1ZR2A 1CQTA 4DW6A 4MFEA 1RESA 2JJ7A 1I50J 2NVTJ 3GBGA 2ME6A 5E3NA 1RETA 4MIMA 2DN0A 1AKHB 4FE4A 2TCTA 3HGYA 5M5YJ 3CDLA 4M3FA 3S1NJ 2LY9A 1B72B 1ETWA 2YS9A 2EZKA 2NVQJ 2K40A 3I4MJ 4JYKA 2XGDA 3JRGA 3PO2J 1JTXA 1OFCX 1HF0A 1IRZA 1A6IA 1ZK8A 1Y1VJ 2H1KA 2DA2A 2LVSA 3FIWA 1Z0XA 3HOZJ 1U8BA 2OF7A 3HBLA 4FTHA 1NK2P 2JA5J 2LK2A 2KDZA 1BA5A 5F08A 1VF9A 2R92J 1T33A 3JRIA 1TWFJ 3RZDJ 2EBIA 1HDDC 3GTKJ 3RZOJ 2Y31A 3TP3A 4XRSG 1IUFA 1DU6A 5K7FA 2GM4A 5IP7J 1SANA 1H88C 4MFDA 1APLC 4M3GA 3F0CA 1OJLA 5EG0B 2L7ZA 4A3MJ 1K83J 2GLOA 2IEKA 1AKHA 1TWAJ 1TWGJ 4AUXA 3ZQFA 1B72A 1RKTA 4D5FA 4UUTA 4A69C 3BTLA 2RAEA 1B8IB 4AC0A 4V2FA 5IOYA 3JRDA 2Y9ZA 3HOUJ 5J3LA 3I4NJ 5JLXA 3JRHA 5E3OA 1HLVA 4IHWA 3SDGA 1JJ8C 5F0CA 1ETOA 4FCYA 1MNMC 2TRTA 3LSGA 5DS9A 4A3LJ 4A3FJ 1YRNB 3QQAA 5GPAA 3S1QJ 4B4CA 5M5WJ 2MW8A 1GVDA 2MG4A 1JT6A 4D7NA 1LFBA 2CUFA 2HXIA 5K7HA 4XK4A 5FKKA 5J1UA 3A01A 3GTGJ 5C4XJ 1FTZA 1TC3C 1QVUA 5JLWA 5FKLA 3JRAA 2R5ZB 1AU7A 2Y2ZA 5EGOB 4IHYA 2LP0A 2DA1A 3BTIA 3O8HA 3B6AA 3S2HJ 3G1OA 2O7OA 3WHCA 1ETVA 2CQXA 3BG9A 1GDTA 1MBEA 9ANTA 1IG7A 4X1EA 4MLOA 4W97A 1B8IA 3HOXJ 4DYRA 3BTJA 3H0GJ 4M6VA 2VI6A 3OSGA 1LE8B 3HOWJ 3RKQA 1FEXA 2E1OA 1U9OA 2HI3A 1BW5A 1FIAA 5FLMJ 5C4JJ 1FIPA 5IP9J 5J1YA 2X6OA 3DCFA 2E19A 2VPRA 2XPVA 4XRMA 4BY1J 4A3GJ 1R9TJ 2JMWA 3NARA 3PM1A 2E2IJ 2HOAA 1YRNA 3O8GA 4I6ZA 1TWCJ 4M3BA 1TWHJ 3CCYA 1UMQA 1NK3P 2DA5A 1OCTC 1VI0A 4C3IJ 2B63J 1MBJA 4X6AJ 3HGGA 3IH2A 3GTMJ 1WI3A 3S17J 2LFBA 2XRLA 2Y9YA 5EDNA 2VUMJ 2ELKA 4A3IJ 2XGEA 2R7ZJ 3LNQA 1AHDP 3DEWA 2AHQA 5FKOA 2NS8A 3K7AJ 2DMQA 3HOYJ 4J19A 1ETQA 4JX4A 3NAUA 1UHSA 3HKZN 2R5ZA 4D7MA 5EGOA 2CUEA 3RQIA 3ZQLA 3LOCA 2X48A 1BJZA 2DTZA 2M9HA 3Q3SA 5C3EJ 2HOTA 1XS9A 2D5VA 1U9NA 2HYJA 1XG1A 2M0CA 1JUSA 4LOCA 2WAQN 3GTQJ 3ZQIA 4JX6A 3IV5A 3BQYA 3HB9A 1HCRA 5M5XJ 1ZQ3P 2L7FP 5F0FA 3BQZA 1E3OC 2EZLA 3OIOA 3QPLA 2DA6A 2ME0A 5GP9A 2CRGA 4DYQA 2XB5A 2HDDA 2R5YB 1IGNA 2LR8A 3Q0VA 4DZJA 1D5YA 5K7ZA 3Q0UA 5FLVA 1JUMA 3BTCA 1FTTA 4A3DJ 2LTPA 3QPSA 1JT0A 4CYCB 2DMTA 4C3HJ 2R93J 1JGGA 1VNDA 5M3FJ 3S16J 1NTCA 2H8RA 1DU0A 2E2HJ 3JRCA 2EH3A 3BR1A 5EYRA 4BY7J 2JK3A 5F0HA 2WB1N 3BR2A 5EZGA 2LLKA 2HOSA 1RR7A 5F04A 3BR5A 2CJJA 3FISA 1U78A 3ZQGA 4UUSB 1Q1VA 5HODA 3JREA 3TW7A 1JJ6C 4RDUA 2FJ1A 2DA4A 3G1LA 2KT0A 2FD5A 2L7MP 2NVXJ 2XGCA 2HQ5A 5FKMA 3TEDA 4M3EA 3SFIA 5EG0A 5F27A 5E3MA 2NVYJ 3C2BA 1X58A 3ZQHA 4W1UA 2QF7A 5GPCA 3H3VK 2CU7A 4A93J 2M8GX 5IPAA 5FJ8J 2R0QC 4BXXJ 1G2HA 3BG3A 3M3YJ 2AO9A 1Z77A 1VFCA 1MBHA 2K9NA 4JX5A 1MH4A 4CYCA 2GBYA 1IDZA 5DTDA 3HEFA 1OCPA 4DYCA 2M34A 1MSEC 1JTYA 2IAIA 1GUUA 3VPRA 1P7JA 1BW6A 1POGA 4Y7NJ 2G0EA 1H89C 3S15J 3K2AA 2DA3A 4UUSA 5M3MJ 4QSHA 4C3JJ 2EQRA 2MSYA 2QCOA 3BG5A 1JKPC 2E2JJ 2X9DA 1ITYA 4A3EJ 3CQZJ 5IOZA 3HM5A 1ZGWA 5EZHA 3S1MJ 3GTOJ 1GV5A 3BR0A 4BBSJ 5IYBJ 4GFBA 2HXOA 4XRSA 1ETKA 1GV2A 3GTPJ 1IDYA 2Y0SN 4B1RA 3D1NI 4A3CJ 2DA7A 2O9LA 4IHVA 5EF6A
chains in the Genus database with same CATH superfamily
2L3DA 3RPUD 1BL0A 2IT0A 4N9HA 2E5NA 4DZPA 3LSRA 4J01A 1R1UA 2XAJA 4BQNA 1PUFB 3L2CA 5F1JA 4PDKA 1K79A 1X4PA 1LE8A 4MHGA 4HNVA 2IGOA 3OS1A 2ECCA 2QQ9A 1O3TA 2DDAA 2A6EF 4HSRA 4G7ZF 1U2WA 1LB2A 2HS5A 1FBSA 2FF4A 2A3SA 4EMSA 4U7BA 3OOUA 3LFUA 1G3SA 5LGTA 2WC2A 3GW2A 1A36A 3IH3A 4A0XA 2DLLA 3LSPA 1G4DA 3LMMA 4G7OF 2PLYA 2HEOA 4AYBN 1RR8C 4DBRA 1IW7F 4S0HB 2KRFA 1EF4A 1VQ8I 3H0DA 1QU3A 3DP7A 3TMOA 2Y30A 5ICGA 5IYCJ 1TW2A 3M8JA 2COBA 2EZIA 5CVIA 3RKWA 3IC7A 1U6GA 1IZ1A 1X4OA 2JA7J 3CCEI 3I0TA 1RKWA 4BGDA 2XROA 1U5TA 1OCRH 1F43A 4BL0B 1D0ZA 1N77A 2LOOA 1S7AA 3LQRA 3KX2A 2ZFUA 3FXUA 1OPCA 3G1MA 4A3KJ 3SJMA 2Q8KA 1OQYA 3ZMTA 4V19K 1T38A 5LBQA 1A31A 1OCOH 1P6RA 2FNPA 2XRNA 1MBFA 4XSXF 3K1PA 3J7YJ 1R7JA 1OR7C 3CCUI 5L3FA 4KICA 4BS9A 2E35A 4IKFA 4UY8I 3IP4B 4RB2C 2JA2A 1B4AA 2BBYA 3FKIJ 4NC6A 2OPTA 3PFIA 2MC4A 1S7EA 3FXQA 3B73A 3G4SI 3GUDA 3K70C 1T6SA 3A2KA 2CWEA 3AG4H 4BHPA 4U87A 2HGCA 2VJJA 4QIWN 4F92B 3ML6A 3HHHA 4QTRA 1XGNA 3DEUA 2GWRA 3T8TA 1I3QJ 2PFBA 2MH2A 5KVRA 1ACIA 3PO3J 5FKNA 2BOLA 2IGNA 4ANJA 3WGHA 4A12A 4LMYA 3TL4X 3S2DJ 1HW1A 5D5VB 4ABZA 3BR6A 3F8MA 2PN6A 1T56A 1AA7A 1W7PB 2DO7A 2EIMH 2KKOA 2V9VA 2ZMEB 5CQGA 2LBFB 2XF6A 2K4JA 2OJED 3OYCA 5HDGA 4BJ6C 1YJNI 2PJPA 3L1PA 5FGMA 1XDUA 2M3AA 5IYDJ 3UKGA 4AWXB 3OSFA 1KQ0A 2M4GA 4ZZLA 3P5JA 4DJAA 1R5HA 6PAXA 1DP3A 3L9FA 3OV8A 3DKXA 2QQAA 3G2BA 1Q1HA 1QGPA 1WJAA 2MC3A 3S93A 1YS7A 3GX4X 2DN0A 1R71A 1MKMA 2VJ4A 3CDHA 2M1BA 4UXNA 5M5YJ 5JR3A 5J6XA 4DNCA 1OYYA 3OYMA 3H1CA 2IPQX 2QKLB 2PX9A 2O6GE 2XHKA 2W85A 4ZDLA 4O5VA 1OFCX 2V1XA 1FPQA 4HG2A 1Y1VJ 1LVAA 1E17A 2NYXA 2OF7A 4CZCA 1LJ9A 3AG2H 4ASNA 4K2EA 1BA5A 5F08A 3VDXA 2LH9A 2DOFA 2E60A 2R92J 3JW4A 3MD2A 2Z3YA 1F4KA 2DPDA 4LLGF 1A35A 4PGHA 4M6YA 1UAAA 3FDYA 2VOOA 2OD5A 3KP6A 3GEZA 1H0MA 2VBXA 1EA3A 1WJ5A 3JTHA 4EQQA 2CV1A 4F91B 5K7FA 2CO5A 4HV6A 1SANA 1YX5A 4MFDA 1NG6A 4KMUX 2HOEA 4XLEA 1OJLA 2K86A 2L7ZA 4A3MJ 2BW3A 3MZYA 5B1BH 3H35A 3J80Z 2QSGX 3ESWB 2CFOA 1TWGJ 4AUXA 1LKXA 1TW3A 1RZ4A 3OR1C 1PDNC 4YFXF 1RKTA 2DODA 3LSMA 5CVUA 2MABA 3BTLA 2IA0A 3L2RA 1KU2A 1B8IB 2EPFA 3GXOA 4V2FA 1ZG3A 1P4XA 3I4NJ 1P4AA 5JLXA 2DK5A 2DI3A 4KN7X 3HPGA 3FX3A 5E3OA 3H9GA 4KYWA 1TLHB 3N05A 3GFJA 1VQLI 5DUIA 1RIOH 3QODA 2TRTA 4IPAA 1P9QC 4PFOA 4A3LJ 2XAHA 4XNFA 3GZ6A 2IGMA 1YYVA 4A3FJ 1YO5C 1DDNA 1MMAA 1N25A 2JSPA 4MTEA 3BJ6A 3O2PE 2I5UA 1YITI 2DXIA 2EV6A 2PEXA 2G7UA 4E4HA 5HLTA 4I0AA 5BMZA 2IXSA 4KMFA 4UUVA 1VQOI 1VQ7I 1FLIA 4LK0F 4L9TA 3I71A 1YFHA 5FKLA 2QWWA 3L00A 4CSWA 4CA0A 4HNTA 4CXFA 1D8JA 2Z16A 3BTIA 2HNHA 2M4KA 3O8HA 4I01A 5D5UB 4YG2F 4BJTA 1ETVA 1GDTA 1VQPI 2R7WA 2G7HA 1KZHA 2HWVA 3BTJA 4BEHB 3EDPA 3H0GJ 2VN2A 3OSGA 1FOKA 4A6DA 4OIPF 4FHTA 2HI3A 4HRIA 1FIAA 3IWFA 3SQNA 2Y69H 3FMSA 2JZYA 4U0YA 3DCFA 2E19A 4RAZA 2E7XA 4XRMA 4BY1J 3CJNA 3WGGA 2H27A 3PM1A 4BHBA 3OYLA 3GLLA 1BOAA 2OCCH 1RUNA 3CCYA 4XLFA 1K78B 2AQFA 1VI0A 5JHFA 3G71I 3HGGA 3KP7A 3GTMJ 2VE8A 4LIVA 2DFFA 2XRLA 1XSDA 5EDNA 3GF2A 2VUMJ 4HV5A 4HPQA 4PJ0C 5LHIA 2ELKA 3K4JA 4IOCF 4A3IJ 3T8RA 3LNQA 1QBJA 2LREA 3LFKA 3OR2C 2QVOA 3HUGB 3HOYJ 1ETQA 1I1SA 4G6DA 3HKZN 2ZMEC 3RQIA 2CQNA 2FUG2 3ULQB 5DCFA 3OYGA 2HTSA 3QYEA 2DFHA 3GZNB 2STWA 1W7PA 3M1CA 4CZZA 2LBFA 2HOTA 1UFMA 1XS9A 1L0OC 2VB6A 2FA5A 3AKZA 1IN4A 4MEXF 4XOPA 3A4CA 3TEDA 3ONQA 3BQYA 4UV8A 1HCRA 2O61A 1R4NB 2W7NA 2NNNA 1REPC 5D5WB 4I98B 2VXDA 1NH3A 2R7DA 4DOZA 3BQZA 1E3OC 1V5FA 2PMUA 1KU7A 2QSFX 1FMWA 2HR3A 4XMYA 3LSTA 4XM3A 3JSPA 1YHQI 2CUZA 2DA6A 2ME0A 4IZZA 5GP9A 2XB5A 2I8DA 2UZKA 2BE5F 2EV0A 4ZJZA 1F1ZA 2LR8A 2MLGA 3Q0VA 4FQGA 5K7ZA 1IN6A 5FB2A 3SZGA 3LSHA 4XOTA 3DBLB 4A2UA 4ZYDA 3ZN0A 2ISYA 4C3HJ 2DBBA 1VNDA 2DK8A 2GXGA 2F4OB 1X3ZB 1NTCA 1DU0A 2BYVE 2EH3A 3BR1A 4OU0A 3MKWB 2FMLA 3BR2A 2XV4S 3KEYA 5EZGA 5BPDA 1PVEA 3KP2A 1BI3A 4C2TA 1RR7A 5F04A 2CJJA 3AL0C 3FISA 1U78A 1R1TA 1Q1VA 2ADUA 2J5PA 3IHUA 2OUMA 2Y48A 3TW7A 4H0EA 5LHHA 1ZREA 1M1EB 1JJ6C 4RAGA 1WJBA 2HKXA 2FJ1A 3OL3A 4Y33A 4UNOA 1E0EA 3C2GA 5DCMB 2VC1A 1TQIA 4KN4X 5D8KB 2NVXJ 2E1MB 4XLCA 4E7IA 4PJNA 2HQ5A 4B48A 5FLXK 1JI8A 3EPZA 3IAM2 4RS8A 2HDWA 2NVYJ 3WG9A 2QF7A 3AG3H 2V1UA 3H3VK 5E8GA 5IPAA 2RC4A 2YU3A 3VYSB 2GXAA 2R0QC 5ERIA 2W57A 2P5KA 1G2HA 2R7UA 4BXFA 2K9MA 1Y6IA 3K70D 5DYMA 1O7LA 2GIZA 3NQOA 4YIIA 3K4LA 4MTDA 2IRFG 4KT5C 3BG7A 3W2AA 4Z6YA 1Z7LA 3WTYC 5DTDA 4A0ZA 3CF5F 3WTUC 4RGSA 5E20A 4M9ZA 1SFKA 3HXLA 1PP8F 1MSEC 1JTYA 4CCMA 4L9JA 2G0EA 3S15J 3K2AA 2M30A 1R00A 1YIJI 1WFXA 2F5CA 1KU9A 3CF2A 5ICFA 4EJWA 2C6YA 4Q48A 2E1CA 4CCJA 4NHJA 1WWXA 5CLSA 2XDVA 1GHCA 3CCQI 5HLIA 1JKPC 2ZC2A 2NRAC 1GXPA 4LG3A 1ZGAA 3KZIC 2NNYA 1YW8A 3NRVA 3X2QH 3CQZJ 5IOZA 3RI4A 2EWNA 1ZGWA 4LB6B 5IY5H 4OOIA 3LWFA 3BR0A 1MMDA 3O3KA 2E7WA 2OQRA 4ZTFA 2VPLA 3E6CC 1WRJA 4N9IA 5IYBJ 1FOXA 2QKMB 4F7ZA 1G6NA 4BDZA 3R60A 2DT7B 3D1NI 2CG4A 4IHVA 3UR3C 2MYSA 1XGOA 3ZQ7A 2HQAA 1QHGA 4IJAA 1QRYA 2W25A 3ZR8X 1E3PA 3HRUA 1A6QA 4ZYAA 2NOGA 4BEHA 1ZG1A 1MSFC 4L5EA 2HZTA 1WVRA 4FE7A 2IA2A 1UJ8A 1TL8A 3RYPA 3B6CA 2AXTC 3W6VA 4E7JA 2LKXA 4G12A 1RNLA 2FQ4A 1JKQC 2HFHA 1BOBA 1Z1DA 3JSOA 2W4SA 3GTLJ 3CLQA 3HOVJ 2JWTA 5BOXA 5ILSA 3BR3A 4BXUA 1SC7A 3HTSB 2CYYA 2YSRA 2EJRA 4UV9A 2XC7A 3F72A 3F8CA 1WJFA 2W48A 2ID6A 3R0JA 1ZRFA 2DCEA 2Q2EA 2L7KA 3KP4A 3TW6A 1K78A 3IUOA 2FEZA 2KDOA 1VQNI 4FETA 2K4BA 3ABKH 1ETYA 1MH3A 2LRDA 2WB1A 5KAFC 2DMUA 3HOSA 3A01B 5F6FA 3BJOA 4Y4RA 4H4KC 5E1ZB 2EZHA 1XSXA 3CCVI 1OKRA 3K9TA 3QWLA 4OWRB 3FK6A 3H5RA 2XB0X 4M6XA 5E3LA 2P81A 3CUQB 2B7EA 1F36A 2WV0A 1IC8A 1JE8A 3G6EI 2K9LA 1ZKGA 3CESA 1BR2A 2K9SA 1YX3A 2P6TA 2WADA 3HIFA 4MQVA 4I99C 5J1RA 2R7OA 3CJTB 5FROA 5HLHA 2D1HA 4Q5SF 4MO7A 2DT6A 2BVMA 3H3ZA 4E7SA 4XORA 3E5QA 1SFUA 4MNUA 1WGXA 1MBKA 1YE9A 4P1WA 1BM9A 3ISPA 3K4NA 5JFRA 4I02A 2BXYA 2FNAA 2X0LA 4EJVA 5BNGA 4OINF 1LFUP 3R4KA 3V42A 4AVPA 2QGUA 2IJLA 3W6JB 3V4GA 2WWYA 1Y1WJ 1G3TA 2EFQA 2H09A 4OIQF 5B5EC 1LNWA 4II3A 3HHGA 1GLNA 2V9PA 3GTJJ 2L9NA 1LVKA 4IX7A 2G9WA 3MVPA 3CCJI 4D5CA 4BJ5C 2HVSA 4ZC3A 1D3YA 3QOPA 2CQQA 3MKZA 1YJ9I 2MGQA 1SMYF 3QYBA 5HNFA 4OMZA 4BAYA 2EB7A 3K2ZA 4NDLA 4E7KA 1MNEA 1XPXA 1R49A 3S14J 1WCMJ 3J7ZI 2V6CA 2X6WA 1HOMA 5J4VA 1QO0D 2VBZA 1T08B 3I58A 4V2GA 1MMNA 3I3LA 2CGPA 4XIDA 2B0LA 2XPWA 2JUCA 2XIGA 2E1MC 1KU3A 1CQTA 4MFEA 2JSCA 1B1BA 2JJ7A 1I50J 4PSXA 3I9V2 2NVTJ 2XAGA 2H6CA 2BW3B 3D5SC 5E3NA 4AIKA 2Y75A 4LLLA 2JT1A 3HGYA 3T5XA 3RTRA 3QP5A 3RSNA 3SEZA 2LY9A 3BG6A 3KETA 4EATA 3CMMA 2EZKA 1EJ9A 2LDUA 4M9SA 3F23A 2DYRH 4JYKA 2XGDA 3I4MJ 2FRHA 4LK1F 3JAMK 1HF0A 2STTA 1P92A 2ZSHB 3FIWA 1Z0XA 3H36A 1TBXA 4NC7A 3HOZJ 1MJ9A 3L09A 1U8BA 1OYWA 2KZVA 2ZXWH 3HBLA 4FTHA 2A61A 2KDZA 1LDKB 3U21A 3DXJF 3HZJA 3BLYA 1W7PD 1K4TA 5BQTA 3VSKA 2UWMA 4CICA 2P5LC 2VKDA 1TWFJ 2KHMA 3E1SA 2CW7A 1IRFA 1SD7A 3ASOH 3NWTA 3RZOJ 4XRSG 2E36A 3ASNH 1IUFA 4BQAA 1H88C 1BC7C 2MD5A 4M3GA 5E1WA 1BBYA 2EINH 2PMZA 3V7RA 1TP4A 1KGSA 2O03A 2ZCWA 2R7RA 4E70A 2KJCA 1K83J 1N75A 1U5TC 5H20A 4S04A 3WE3A 1NG7A 2IEKA 4RLQA 1AKHA 1FC3A 1WZ2A 3VODA 3H9QA 5GADJ 2HU9A 1HSJA 3GMEA 3NWSA 3R6SA 3DU6A 1FYMA 3GCMA 4NC8A 2BHZA 4OAYA 5FLXZ 2ELHA 2RAEA 4HF0A 2CS3A 1OYIA 1ZYRF 2VL8A 3KYCB 5DD8A 3JRDA 2Y9ZA 3M7GA 3BCAA 2IGKA 3JRHA 1MDMB 5H6RA 1T95A 2YX7A 1IRXA 2NS0A 3FZVA 2YR2A 1YI2I 4ZYGA 4FCYA 1FOYA 3LSGA 3WU2C 2EFWA 4S05A 1Z3XA 5B3SH 4PGGA 3QQAA 5GPAA 4NQWB 5M5WJ 1F5TA 5ILVA 5DDGA 2QZ8A 1GVDA 2HYFA 2MG4A 2P7VB 1D1AA 3P9KA 2BY0A 4D7NA 2PQ8A 5HNHA 4C9YA 5K7HA 3A01A 4U0VA 2W82A 3WTVC 3BOQA 3CUQC 4E6KG 3U2RA 1TC3C 4BE2A 4LB5A 2GIVA 2XF5A 3JRAA 1AU7A 1D0YA 3TDUC 3CUQA 2P8TA 2Y2ZA 4FX4A 2Z9OA 4LIUA 2HVRA 4BNCA 4IHYA 2DA1A 3B6AA 3PSFA 3G1OA 5EEGA 3ECOA 2LG4A 2COMA 2CV2A 3M9AA 3I59A 3RDIA 3G73A 4KISA 4QWQA 4X1EA 4MLOA 2WA0A 3COAC 1Z7UA 3HOXJ 4IL6C 5FO5A 4G6TB 2P7CB 4WXCA 3VB2A 1BI2A 4M6VA 1HC8A 3HOWJ 3RKQA 1W5TA 1V4RA 4ZTJA 1WJCA 2V9KA 1BW5A 2GAUA 1O3RA 5FLMJ 4II2A 5J1YA 5JVGF 2X6OA 1VQ6I 1J5YA 2XPVA 3VYUB 1Y0UA 5EJCA 1R9TJ 3NARA 3BCBA 2A5WA 2E2IJ 4CDGA 2HOAA 2V26A 1FSEA 1D0XA 1EH6A 5F64A 4Z2YA 1TWHJ 2CQ7A 1SVMA 4XRFA 2R7TA 1OCTC 3QRFF 3WTTC 5BPIA 2DW4A 3N97A 1WI3A 1S29A 3S17J 2LFBA 4OIOF 1F9NA 2UUZA 1KQ8A 3RCOA 2ZJRF 5E1XA 2XAUA 2XGEA 4RB0A 1X3WB 1AHDP 2KJBA 3DEWA 2AHQA 5FKOA 2NS8A 3PQJA 3U1KA 4J19A 4JX4A 2CSOA 3FBNB 4FX0A 3GLXA 3VOEA 2JRMA 3PL8A 2X48A 1SVLA 1C0WA 5HOOA 3FXKA 1TTYA 1U9NA 3D5RC 1XG1A 1JUSA 2WAQN 2YPRA 3GTQJ 4IOAF 3ZQIA 2EA2A 3TDZC 1FYLA 4XLAA 5CVRA 3S2WA 3HB9A 3PNTA 4LGWA 2DOAA 1D5VA 3DWLE 5M5XJ 3NEUA 1DGWY 3DTKA 2X51A 5F0FA 3CCMI 2EZLA 1S9HA 3OIOA 3QPLA 2W00A 1G3YA 2KIUA 3OYFA 2VONA 2CRGA 2EFOA 2O8XA 3M8FA 2R5YB 2ETHA 4C30A 2LYCA 1FP1D 5L3BA 3Q0UA 2CH0A 2K7LA 1HKSA 1SVOA 5J4YA 1JT0A 4A3DJ 3L2QA 2DMTA 1R6RA 3PFYA 3EYIA 1ZAOA 1LDDA 3MQ0A 3L2VA 5M3FJ 2MLKA 3BZCA 3S16J 2H8RA 3TQNA 2HPIA 4E7ZA 4RM3A 5EYRA 2A6HF 5F0HA 2BY1A 1IXRC 3K0LA 4CO8A 5HDKA 1IXCA 2DQLA 5J47A 3E3VA 4KIFA 1WKMA 4EVIA 4CH7A 5CJ9A 1QNTA 4JBAA 4DBQA 2BZTA 3EQLF 1ZG5A 2DA4A 3H5NA 2LMDA 3HRSA 4GYIA 1DP7P 4GYGA 2FD5A 1TT5B 3G3ZA 2XGCA 4YELA 4JOMA 3LSIA 3OWTA 5E3MA 3M07A 4G6QA 2A05A 1V5GA 3C2BA 2PI0A 4W1UA 1G59A 4KNYA 2CU7A 1ZN2A 4HDUA 3KP3A 4O6JA 3RJPA 1FBQA 1LUJB 2E1NA 2A07F 3BG3A 4ZYEA 2OQGA 1SFXA 3M3YJ 3MMYB 1VFCA 1MBHA 2VQGA 4JX5A 1BN5A 3MAJA 4WK8F 2XUBA 4CYCA 2ZXHA 1IDZA 1ZLJA 5L3CA 4DGWB 2VIXA 4HA8A 2HQNA 1MDMA 1NHAA 1OCPA 1IAWA 2RREA 3OYAA 1Z6RA 2M34A 3ZMSA 5J8CA 3VPRA 4IHTA 2W84A 2DA3A 3N4MA 4XKVA 2R7QA 1IN5A 5A2QK 3QOEA 1R58A 4BQOA 1Z67A 3MZ8A 4NQWA 3MCZA 4PJMA 2Q2EB 5FRMA 2EQRA 3P9CA 1KYZA 3TOBA 2M5WA 4KDPA 3K1MA 2QM3A 5BS6A 2L5QA 3I54A 4A3EJ 2ZXJA 5L3DA 3H3UA 4BDYA 1SD4A 4LITA 2XKPA 2QLZA 4EV0A 4BBSJ 2FQ3A 2NAZA 1Y56A 5HS9A 3V8LA 1A04A 3OYKA 4XLPF 1J09A 5D4SA 4HX4A 1I6XA 4AIJA 3EUHC 3EUKL 1GT0C 1Z3YA 3S8PA 2HDCA 3RPUA 4AVZA 2V7FA 3BWGA 3DFGA 4B3AA 3EUHA 1JKOC 3A03A 1RUOA 5DM6F 2N8GA 3F3XA 4L5JA 2M8EA 3F22A 4HOBA 2ISZA 2LD5A 3FMRA 4FISA 3I56I 3CLOA 1FY7A 2WAEA 4MQ9F 3F8NA 5GAEJ 1KA8A 4BHCA 4AM3A 2DOEA 3DLLF 1A5JA 3S3MA 2A5YB 5L3GA 2UXXA 2WY7Q 3A0HC 3CO6C 1D1BA 2KIFA 2MH9A 1H9GA 4OAZA 1MMSA 3OIQA 3K10A 3A02A 1USSA 1X2MA 1U3EM 2ESNA 1LEAA 2X6YA 1MJBA 2DMNA 3OYBA 2FE3A 3HDDA 1XCVA 2DJNA 2Z99A 1UELB 1I3AA 3U1DA 2L9RA 3RQ4A 2X1CA 1K61A 1K7AA 1B9MA 1CF7A 4HW0A 2H8WA 3RKYA 4F52A 3BROA 4L0ZB 4XKCA 3WTSC 2ZB9A 3FK7A 5LRRA 3J81K 1IV8A 4BKXA 2VKEA 5LGNA 1FP2A 4L0YB 3M8EA 5HS7A 1DGRM 4GCVA 1DQUA 1WH5A 2HTJA 2RKHA 3ZXSA 5IP6A 3FBIB 2IS1A 1QVTA 3PUFA 3BDDA 4WXHA 1W5CC 1HDPA 5GTIC 2CMPA 1SAXA 2KRCA 1T8IA 2F6CA 2VODA 4KUMA 1QHHD 3GZ5A 2FX0A 2CQKA 2IW5A 3D5LA 4RM2A 3SEQA 4BBRJ 5GAGJ 1I6HJ 4DIQA 1BR4A 1IV6A 4G94A 4U7DA 4IQ4A 4IXAA 3S1RJ 2FMYA 4NNJA 4N4NB 2IBDA 3KP5A 4HZFA 5ICCA 1RPWA 1QPIA 1EH7A 3E97A 2GOMA 2MD0A 4JP0A 2VQLA 1ORKA 2DMPA 1ZTRA 2ZJQF 2R5YA 1WH7A 2V79A 3HPHA 3MZHA 1I27A 1R5GA 4P5OA 4B3XA 1VQ5I 2VOPA 3ROUA 2O3FA 2D2WA 4BU2A 3TKYA 4YFKF 2M0MA 2VT3A 3MKLA 4PFPA 3FWEA 2OCEA 4EM0B 3OYIA 4A3JJ 2JA6J 2KP6A 5D8LB 4KFCA 2KL4A 1W0TA 5KK1A 1YQAA 1YW7A 2K9QA 2RV8A 3V8JA 2L4AA 1VTNC 1MNDA 4KIBA 4XLHA 3K4CA 5B1AH 1CGPA 2VKHA 2KQRA 5K5OA 3WTXC 3BC8A 4XLNF 2YU9J 1VQ4I 4Y52J 1W4MA 1Y0NA 4HSTA 4M3DA 1V54H 4IQJA 4EJOA 1XTAA 1RI7A 3F8FA 2FBKA 3CDIA 1W36D 1ZR2A 3BJAA 2Y0SA 2R7FA 1Y39A 3DBRB 4CUGA 1I1GA 2H1LA 3CZ6A 2NVUB 3GBGA 1QZYA 3ECHA 2QSHX 1R1VA 1RETA 4ON0A 2O0YA 1AKHB 5E17F 2GA1A 2OAZA 3CDLA 4M3FA 2DT5A 1X1AA 3EETA 1V3FA 3SFZA 2DJIA 4RMNA 1ETWA 2YS9A 3TO9A 4CCNA 2KFDA 3C18A 2F4MB 2NVQJ 2K40A 4PZJA 1JTXA 4QLCU 3CUOA 1A6IA 1BI0A 1ZK8A 1XGMA 2DA2A 2LVSA 2RN7A 3TGNA 5F1RA 4G9YA 2VC0A 3RYRA 4L9NA 2A69F 3PIPF 2ZKZA 3GFIA 2IS4A 2LNBA 4AYBA 4IVNA 2OC6A 4BACA 1HA8A 4Y15A 4NBQA 2F5FA 2FBHA 1OCCH 3SDBA 3KEOA 4IRHA 3RZDJ 2K5CA 1HDDC 3GTKJ 1S7OA 5E18F 4OMYA 5H2FC 1J9IA 2NOJB 2GM4A 4GO1A 2JPCA 2UV1A 2CUJA 2PBIA 3FXLA 1APLC 3C7JA 1XDSA 2W24A 1SAUA 2RGVA 3FXMA 1EKEA 5LRSA 2KIQA 3QU3A 2VQCA 3DPLC 4AU7A 1ZELA 1B72A 1STZA 1N78A 4D5FA 3WTWC 3CCSI 4CHUA 3I59B 4UUTA 2BGCA 1RC9A 3SHFA 2E5ZA 1W1WE 4AC0A 3VYRB 1WHUA 5FRNA 3HOUJ 1T0FC 5J3LA 3S32A 1L3LA 3P7NA 1D8KA 1SFEA 4IHWA 1T0FA 3FF5A 5HLGA 2PMHA 1LDJA 3CJQB 5F0CA 4U0WA 1XMXA 1ETOA 1ON1A 2L54A 3S3OA 2WAFA 2LF7A 3U9GA 1YLFA 4E7HA 2XVCA 4WWCA 3GWZA 3S1QJ 2MW8A 4CCKA 3IL2A 1JT6A 4RB1A 4B43A 4RAFA 1LFBA 3DTEA 4KJZA 5LD2C 2CUFA 3DV8A 5HVQC 4MGRA 3BZKA 4XK4A 5FKKA 5J1UA 3OS2A 3GTGJ 5C4XJ 1YG2A 5A2QZ 1FTZA 3O6BB 3WE2A 5JLWA 2A6TA 1YJWI 4RAYA 4XL9A 4XQFA 2WY8Q 1YS6A 1ON2A 3E6DA 2ELJA 2DFIA 2L9SA 2KIMA 1J0RA 3R0AA 2FU4A 3JCUC 2CQXA 4HQEA 9ANTA 3PUBA 3F6VA 3T0YA 3CCLI 1ZRCA 4XKWA 4HEA2 4HF1A 3QPHA 1LEBA 5CPRB 4UVCA 2VI6A 2ZNZA 3LA3A 1U9OA 5FD5A 1V55H 1O7FA 4CGZA 5C4JJ 2L02A 5CVJA 2EK5A 5CYVA 1DPUA 2F48A 1J2XA 2VPRA 1K6OA 3E6BA 4A3GJ 2JMWA 3BPXA 4B47A 3IRRA 1Z05A 2X6XA 4E7LA 3KCCA 2IS2A 3V7CA 3O8GA 1YRNA 3F8BA 4I6ZA 3A1YA 1TWCJ 3MWMA 4M3BA 1IO2A 2B63J 1MBJA 3H92A 3IH2A 3PIOF 3OYJA 2L4MA 3CMEI 2MA3A 2Y9YA 4F93B 4ENMA 2X85A 4BQQA 3KIOA 1BJAA 3KZYA 3ZCOA 2DMQA 3FXRA 3NAUA 3QP6A 2R5ZA 4D7MA 4G8XA 4XKBA 5EGOA 5JI6A 2CUEA 1MJAA 2BXZA 2PG4A 3ZQLA 1BJZA 2DTZA 3Q3SA 4UVAA 3OMYA 1HW2A 2D5VA 2HYJA 3KFWX 5KAIC 4LOCA 1QZZA 3CTAA 4KT6A 5D5XB 3J81Z 4XN3A 5AIPA 1S6LA 2XAQA 1Y8RB 4Y13A 4YFNF 3WU0A 3FXOA 1B6AA 2E34A 1ZQ3P 1P2FA 2L7FP 2R7VA 1GXQA 2M7BA 5DM7F 2VASA 4ENNA 3C2HA 4KA4A 4DYQA 2P0WA 1IGNA 1JUMA 3BTCA 1WJDA 2LTPA 2RNGA 2IA1A 4CYCB 5ICEA 4MEYF 2TDXA 4I0BA 4IRGA 3IKVA 2JK3A 2DFEA 4BY7J 2WB1N 3WTZA 4P9UA 4BE1A 4A0YA 5LHGA 1ZHFA 2VT2A 4JK1X 3HC7A 3OYNA 3WG7H 3BR5A 5EEHA 5GTHC 5GAHJ 2ZNYA 1MD0A 3ZQGA 5HODA 2K02A 5AIQA 2ZJ2A 5IT9K 3D0SA 3HSRA 4RDUA 3QAHA 4G7HF 5JHUA 3ZPLA 4P9FA 2VJ5A 2XKOA 4LG0A 1J75A 3AFHA 1R4MB 2KT0A 1TNSA 3VFZA 2PJRA 3TBIA 2L7MP 2LKSA 2CW0F 1XMAA 2A68F 2KLOA 2L01A 5FKMA 4HQMA 2FBIA 4M3EA 3SZTA 3TO6A 2M87A 3IRQA 1OR7A 4RGUA 1X58A 3ZQHA 5L3EA 2F2EA 5DV5A 4HAMA 3SXYA 3UNGC 2QBYB 1T39A 2JTVA 1YIOA 1QA6A 4GGGA 4O3MA 2AO9A 1Z77A 4FT8A 4PUSA 2LY1A 2VXZA 2K9NA 2MFZA 1S72I 1MH4A 2GBYA 1W36C 1DPRA 4ETSA 4RLFA 3PNYA 5ED4A 3HEFA 2H94A 5LLQA 1FBUA 1JHHA 4L9VA 3VWBA 3LQQA 2UXNA 2IAIA 4IHSA 1GUUA 5D4RA 1BW6A 1POGA 1FMVA 4ZDOA 3Q5FA 2V4JC 3DPUA 4Y17A 1IXSB 5FFZA 4N4OB 3GFMA 1O3SA 1E3HA 4UUSA 5M3MJ 4C3JJ 2GXBA 1JGSA 2HYGD 3BG5A 3CP8A 1B9NA 2E2JJ 3SYTA 4XSZF 1ZH5A 3F21A 3FM5A 3E5UA 1P4WA 1ZGJA 3HKZA 1CF7B 3HM5A 3ZMZA 3GTOJ 3HSFA 1GV5A 1PJRA 2WTEA 2CV0A 1VQKI 2DAOA 2OU2A 2HXOA 1OLTA 4XRSA 1KONA 1GV2A 3GTPJ 1IDYA 4B1RA 3QU6A 3S3NA 2R7XA 3TOAA 2O9LA 1XX5A 2JPBA 5EF6A 2F5EA 5E8IA 1Z9CA 2XSDC 4C2MJ 2H6BA 2V1DA 1P7IA 2M2EA 4CYDA 3L2UA 1W0UA 4IHXA 1WPKA 3QYFA 1W5SA 5LGUA 1JKRC 2VQHA 2X1DA 3B02A 2K85A 2I10A 4BYYA 5C44J 1JUPA 2VJIA 3MN2A 3IWZA 1HSTA 4QPQA 3ABLH 1MMGA 3ZMDA 3JRFA 2LKPA 3JR9A 1IJWC 4A6EA 3MFKA 1QPMA 1JHFA 2E71A 5HDNA 3I5UA 4D0PA 3KEQA 1ZLKA 2ECBA 4N0BA 2QENA 3HOTA 3A0BC 2Z5UA 2JVGA 4EGYA 3AL0B 3HRTA 3CO7C 3BY6A 3FKJA 1K4SA 1R5ID 2JA8J 1G8XA 1DUXC 3M4OJ 3J7AO 1ENHA 2BHYA 1AOYA 2RVCA 1WJEA 1E2XA 2YUSA 3GYHX 2HZDA 4I09A 1WI9A 3Q0WA 2HVQA 2ZXIA 1FT9A 4J00A 4EM1A 3CD6I 2WV1A 3Q9SA 2RDPA 3W2WA 2PMZN 1H8AC 1ZR4A 4XICA 3OYEA 2EA4A 3HJEA 1FSHA 3RPQA 4A3BJ 3PJRA 5EEAA 1X3UA 3DPTA 3TO7A 2DTRA 3W2VA 2NS7A 4EEFG 1UG2A 4M74A 1G3WA 4IEJA 3LSJA 4D1QA 1X2NA 1XC5A 2JN6A 1PUFA 1AWCA 5LFAA 3HRMA 3LA7A 3ZRGA 4HLYA 2XPUA 2JVHA 1O4XA 4D9JA 4ZYHA 3TP0A 4NB5A 3EYYA 3E7LA 3HSEA 3KE2A 5D6EA 1SFOJ 2VKVA 2L0KA 2ID3A 4YIRX 4IO9F 3ZQCA 1ETXA 3IH4A 3BT9A 4ENKA 3BPVA 4L5IA 2VE9A 1ZARA 1U0JA 3OY9A 3JRBA 2J5OA 2EILH 2M45A 2VBWA 4ZDPA 2VLAA 1IN7A 1T2KA 2BY2A 4HYEA 3WODF 3C1DA 3CCRI 1YTYA 4Q47A 4RBOA 2O8KA 3LAJA 1FWZA 4I76A 1D1CA 4GDFA 3GVAA 4TV7A 2P4WA 4PJLA 3CMYA 3JAMZ 3ERED 3JTGA 4CCOA 3FXJA 3SZPA 5K1YA 1TQMA 1Y8QB 3ZOBA 1FOWA 2QUFA 2OV7A 1MBGA 2ACJA 1XCBA 5DD4A 4P55A 3C3WA 2XSJC 1FJLA 3WHBA 2BY3A 4QPOA 3M1EA 2JQ7A 5J40A 4DW6A 3ZQQA 4AIDA 1Z21A 3V7SA 5LEJA 1RESA 1TZLA 4PK4A 2BEOA 1GVJA 2ME6A 3K4BA 5ILUA 4MIMA 1XSVA 4A5NA 4FE4A 2TCTA 2JRTA 2V6EA 3S1NJ 4RGRA 2QBYA 1VQ9I 1B72B 1XD7A 5J8FA 2ZJPF 1QZEA 1HW5A 3JRGA 2Z1DA 3OYHA 3ABMH 3PO2J 1MW7A 1O3QA 2P6SA 1IRZA 5KCMA 3BZ6A 1Z91A 2WBMA 3K69A 2H1KA 3I55I 1HQCA 3OL4A 3AG1H 4ENJA 2DDBA 2Z2SB 1UCRA 5FFXA 2Q0OA 4PCQA 5CQEA 3L7WA 1NK2P 2JA5J 2LK2A 4LJZF 3ZMVA 1XMKA 3CMAI 1VF9A 4AIHA 1T33A 2ZMEA 2Z33A 3JRIA 4XBFA 2K3PA 2EBIA 2Q1ZB 1KYWA 1FNNA 4UHTA 3VSLA 1ZRDA 3HTUA 2Y31A 3E5XA 3TP3A 1DU6A 2GOXB 4UB8C 1X1DA 5IP7J 2L9VA 3F0CA 3OYDA 1BI1A 5EG0B 2QEXI 4FASD 4M72A 3CP2A 2V1NA 2GLOA 5IT9Z 4EJTA 2HQRA 3ERMA 1TWAJ 2DQRA 3H9JA 4DQ2A 2OTLI 1IRGA 3K6GA 3ZQFA 3I4PA 5KHDA 2K3FA 3RKXA 4HDVA 2ESHA 4KITB 4A69C 3W6KB 2QYOA 3DKWA 1R23A 4M71A 3KZZA 1BC8C 5IOYA 1MZBA 3CC7I 3FMQA 3VYTB 2BV6A 4B44A 2OA4A 3ZGKA 3WGIA 5LEKA 1HLVA 2XGXA 3SDGA 1JJ8C 2IP2A 4OIRF 1PP7U 5CKTA 1MNMC 4IF4A 4I2OA 2L2OA 2FXAA 5DS9A 1YRNB 1K6YA 3FHNA 3ZN1A 3CC4I 4HX8A 2DPUA 4B4CA 2B9SA 4LLNA 2ZSIB 5TRDA 3MEXA 1YW9A 3KPHA 4HNUA 1PUEE 4F3QA 4PSWA 2HXIA 3MKYB 4CCLA 1ONVA 4BH9A 4Y3OA 2RQQA 2KMUA 3F6OA 1QVUA 4Q4ZF 2OZ6A 2R5ZB 5EGOB 2LP0A 1R22A 3S2HJ 2X4HA 3PSIA 2O7OA 2ZBKA 3WHCA 3BG9A 3E6MA 2XAFA 1MBEA 3DF8A 1IG7A 4W97A 1B8IA 2HKOA 2LSOA 3OS0A 1TNTA 1TT0A 2AQEA 1MGTA 3ABTA 4JQFA 4DYRA 2LC2A 4XN0A 1B59A 4ESBA 2LF8A 4YIFA 2KZGA 4M73A 2BVLA 1PYVA 1LE8B 1BIBA 1FEXA 2E1OA 2EIKH 4X0GA 4F55A 2D1VA 1SD6A 1TQPA 1FYKA 4WXDA 4B8XA 1ULYA 1I5ZA 1FIPA 5IP9J 2CFXA 5K5QA 3EUAA 4WX9A 4U88A 2QA4I 1KQ9A 1LFPA 3T1BA 4HLXA 3HG9A 3AAFA 3FM3A 1UHWA 1XN7A 2X1EA 4ZH4F 1YOVB 3HYIA 4RB3C 3HL2A 1UMQA 1NK3P 3DU5A 2R7SA 2DA5A 2F5DA 4ZZDA 5DEQA 4C3IJ 1OMIA 4X6AJ 1UB9A 2D45A 1X1BA 2OTJI 1VQMI 1Z6TA 4AD9A 2R4GA 4UVBA 1LPQA 1V5EA 4PJJA 5KNLA 2R7ZJ 1XB4A 1X19A 4ESFA 3WU1B 3K7AJ 2DYSH 2QQBA 3VEPA 1UHSA 1XGSA 4ESJA 1FZPB 1U5TB 3LSKA 1MIJA 4P96A 1QQIA 1ERDA 3LOCA 3CJRB 2M9HA 5C3EJ 3QPTA 3H5AA 1OCZH 2M0CA 3ELKA 4KIGA 3I53A 1I39A 3ABUA 4M9XA 3KYDB 4LG0B 2EV5A 4JX6A 3IV5A 2F5VA 4R8HA 1IUYA 3LA2A 3RIRA 2M7AA 2PJRB 1X1PA 1OISA 3PNVA 1FX7A 1EH8A 5AONA 4IRIA 1HKTA 2NXNB 2OBPA 2HDDA 1S5LC 2DU9A 1LQ1A 3REOA 2XF7A 4C2UA 2VBYA 4ITVA 2KRHA 4A5MA 1D5YA 4DZJA 5FLVA 5H6QA 1H9TA 1FTTA 2FOKA 3QPSA 1HXDA 1SMTA 1VZ0A 4YEJA 5TISC 2R93J 1JGGA 4YRVA 3W3CA 4HX7A 3DTIA 3F9KA 3IAS2 1IF1A 2E2HJ 4GXOA 3JRCA 1BR1A 3HUGA 5B66C 2ICWG 5TGTA 2LLKA 3KLNA 5CVVA 2HOSA 2FSWA 2YX4A 4UB6C 4BE0A 2QQ8A 2KISA 4UUSB 2AXLA 3I64A 3JREA 4EJUA 4XONA 1BIAA 2P5VA 1SD5A 3K1NA 4LFUA 5K5RA 3J80K 4EGZA 3K4MA 1J7KA 4L18B 1HBXG 2OZUA 3ZMUA 3G1LA 3DLAA 2EFPA 2LY2A 1U8RA 4R79A 3DEEA 1S8NA 3R61A 2R3SA 2GA2A 4NUBA 4XR6A 4I7HA 3SFIA 5E79C 5EG0A 4GRIA 2JUGA 2F4IA 5F27A 5TJJA 1RRJA 3OOPA 2RNJA 2CW8A 5GPCA 2ZFWA 4A93J 2FOWA 2M8GX 1USTA 5FJ8J 4BXXJ 1S3JA 5D6FA 1T98A 1UZCA 2EFNA 3LL7A 3J7AY 5FD6A 2IVMA 3PQKA 3P9IA 2IS6A 5HS8A 1O57A 2ZO4A 2O5RA 4HF2A 3K4KA 3IKTA 5JVTA 1UHMA 4DYCA 1SEUA 4B09A 2GZWA 1X1CA 1J59A 1JXSA 3ZP5A 3FHZA 1UG0A 2MBFA 4LD5A 3DQVC 5IT3A 3E0JB 3CC2I 1P7JA 4Y7NJ 3V8KA 1WSUA 1H89C 2GQQA 1IN8A 3BP8A 2HPMA 3GO5A 1ODDA 4HBLA 3L2WA 3LAPA 4EM2A 4QSHA 2EIJH 4WF2A 1R36A 2MSYA 2QCOA 3OIPA 2W1OA 2Y0MA 2KPMA 5DUKA 1HKQA 3DKYA 2X9DA 1ITYA 4RGXA 5DCMA 5EZHA 3S1MJ 4R1HA 4RA2A 2XASA 2K27A 3DBHB 4GFBA 1WQ2A 1ETKA 3KLOA 2Y0SN 3GFLA 2RQPA 3Q9VA 4A3CJ 2WAQA 2DA7A 4WCGA 1EV7A 4BUPA 3KYLA 2AS5F
chains in the Genus database with same CATH topology
1GT0C 1BL0A 2XSDC 4C2MJ 1QRYA 1P7IA 2M2EA 4B3AA 4DZPA 3LSRA 1W0UA 1JKOC 1WPKA 3A03A 4IHXA 1JKRC 2N8GA 2NOGA 2LD5A 2I10A 4L5EA 4FISA 5C44J 1PUFB 1MSFC 4FE7A 5F1JA 1LE8A 1JUPA 3B6CA 3MN2A 4HNVA 3W6VA 2ECCA 2LKXA 4G12A 3JRFA 2FQ4A 3JR9A 1JKQC 1IJWC 1A5JA 3OOUA 3GTLJ 3HOVJ 2JWTA 2ECBA 3BR3A 3IH3A 3LSPA 3A02A 1X2MA 2W48A 2ID6A 4AYBN 2DMNA 4S0HB 3HDDA 2DJNA 1EF4A 3TW6A 2JA8J 2L9RA 2Y30A 1ETYA 1MH3A 1K61A 5IYCJ 3M4OJ 2DMUA 3A01B 2COBA 2EZIA 1ENHA 2YUSA 2EZHA 2ZB9A 3FK7A 3FK6A 3Q0WA 2XB0X 2JA7J 5E3LA 2P81A 1RKWA 2WV1A 1F36A 4BKXA 2VKEA 2PMZN 1H8AC 1ZR4A 1IC8A 4XICA 1F43A 1WH5A 1ZKGA 2K9SA 5IP6A 4A3BJ 1QVTA 5EEAA 1HDPA 5J1RA 2NS7A 4EEFG 1UG2A 3G1MA 4MO7A 4A3KJ 4IEJA 3SJMA 3LSJA 1X2NA 2FX0A 1XC5A 2JN6A 4BBRJ 1PUFA 1I6HJ 1IV6A 3S1RJ 1WGXA 1MBKA 2XPUA 1MBFA 2IBDA 1O4XA 5BNGA 1RPWA 3TP0A 1LFUP 1QPIA 3E7LA 3FKIJ 2OPTA 4JP0A 1Y1WJ 1ORKA 2DMPA 1SFOJ 1S7EA 1ZTRA 2VKVA 2L0KA 2ID3A 2R5YA 1WH7A 3ZQCA 3GTJJ 1ETXA 3IH4A 3BT9A 4QIWN 4QTRA 3MVPA 3JRBA 1I3QJ 4D5CA 3MKLA 3PO3J 5FKNA 2CQQA 4A3JJ 2JA6J 2MGQA 1W0TA 4RBOA 2O8KA 2K9QA 3S2DJ 4I76A 4NDLA 3S14J 4ABZA 3BR6A 1WCMJ 3CMYA 1HOMA 1T56A 4V2GA 3ZOBA 2YU9J 4Y52J 1MBGA 4M3DA 3L1PA 5IYDJ 4XIDA 1FJLA 2XPWA 3UKGA 3WHBA 3OSFA 1ZR2A 1CQTA 4DW6A 4MFEA 1RESA 2JJ7A 1I50J 2NVTJ 3GBGA 2ME6A 5E3NA 1RETA 4MIMA 2DN0A 1AKHB 4FE4A 2TCTA 3HGYA 5M5YJ 3CDLA 4M3FA 3S1NJ 2LY9A 1B72B 1ETWA 2YS9A 2EZKA 2NVQJ 2K40A 3I4MJ 4JYKA 2XGDA 3JRGA 3PO2J 1JTXA 1OFCX 1HF0A 1IRZA 1A6IA 1ZK8A 1Y1VJ 2H1KA 2DA2A 2LVSA 3FIWA 1Z0XA 3HOZJ 1U8BA 2OF7A 3HBLA 4FTHA 1NK2P 2JA5J 2LK2A 2KDZA 1BA5A 5F08A 1VF9A 2R92J 1T33A 3JRIA 1TWFJ 3RZDJ 2EBIA 1HDDC 3GTKJ 3RZOJ 2Y31A 3TP3A 4XRSG 1IUFA 1DU6A 5K7FA 2GM4A 5IP7J 1SANA 1H88C 4MFDA 1APLC 4M3GA 3F0CA 1OJLA 5EG0B 2L7ZA 4A3MJ 1K83J 2GLOA 2IEKA 1AKHA 1TWAJ 1TWGJ 4AUXA 3ZQFA 1B72A 1RKTA 4D5FA 4UUTA 4A69C 3BTLA 2RAEA 1B8IB 4AC0A 4V2FA 5IOYA 3JRDA 2Y9ZA 3HOUJ 5J3LA 3I4NJ 5JLXA 3JRHA 5E3OA 1HLVA 4IHWA 3SDGA 1JJ8C 5F0CA 1ETOA 4FCYA 1MNMC 2TRTA 3LSGA 5DS9A 4A3LJ 4A3FJ 1YRNB 3QQAA 5GPAA 3S1QJ 4B4CA 5M5WJ 2MW8A 1GVDA 2MG4A 1JT6A 4D7NA 1LFBA 2CUFA 2HXIA 5K7HA 4XK4A 5FKKA 5J1UA 3A01A 3GTGJ 5C4XJ 1FTZA 1TC3C 1QVUA 5JLWA 5FKLA 3JRAA 2R5ZB 1AU7A 2Y2ZA 5EGOB 4IHYA 2LP0A 2DA1A 3BTIA 3O8HA 3B6AA 3S2HJ 3G1OA 2O7OA 3WHCA 1ETVA 2CQXA 3BG9A 1GDTA 1MBEA 9ANTA 1IG7A 4X1EA 4MLOA 4W97A 1B8IA 3HOXJ 4DYRA 3BTJA 3H0GJ 4M6VA 2VI6A 3OSGA 1LE8B 3HOWJ 3RKQA 1FEXA 2E1OA 1U9OA 2HI3A 1BW5A 1FIAA 5FLMJ 5C4JJ 1FIPA 5IP9J 5J1YA 2X6OA 3DCFA 2E19A 2VPRA 2XPVA 4XRMA 4BY1J 4A3GJ 1R9TJ 2JMWA 3NARA 3PM1A 2E2IJ 2HOAA 1YRNA 3O8GA 4I6ZA 1TWCJ 4M3BA 1TWHJ 3CCYA 1UMQA 1NK3P 2DA5A 1OCTC 1VI0A 4C3IJ 2B63J 1MBJA 4X6AJ 3HGGA 3IH2A 3GTMJ 1WI3A 3S17J 2LFBA 2XRLA 2Y9YA 5EDNA 2VUMJ 2ELKA 4A3IJ 2XGEA 2R7ZJ 3LNQA 1AHDP 3DEWA 2AHQA 5FKOA 2NS8A 3K7AJ 2DMQA 3HOYJ 4J19A 1ETQA 4JX4A 3NAUA 1UHSA 3HKZN 2R5ZA 4D7MA 5EGOA 2CUEA 3RQIA 3ZQLA 3LOCA 2X48A 1BJZA 2DTZA 2M9HA 3Q3SA 5C3EJ 2HOTA 1XS9A 2D5VA 1U9NA 2HYJA 1XG1A 2M0CA 1JUSA 4LOCA 2WAQN 3GTQJ 3ZQIA 4JX6A 3IV5A 3BQYA 3HB9A 1HCRA 5M5XJ 1ZQ3P 2L7FP 5F0FA 3BQZA 1E3OC 2EZLA 3OIOA 3QPLA 2DA6A 2ME0A 5GP9A 2CRGA 4DYQA 2XB5A 2HDDA 2R5YB 1IGNA 2LR8A 3Q0VA 4DZJA 1D5YA 5K7ZA 3Q0UA 5FLVA 1JUMA 3BTCA 1FTTA 4A3DJ 2LTPA 3QPSA 1JT0A 4CYCB 2DMTA 4C3HJ 2R93J 1JGGA 1VNDA 5M3FJ 3S16J 1NTCA 2H8RA 1DU0A 2E2HJ 3JRCA 2EH3A 3BR1A 5EYRA 4BY7J 2JK3A 5F0HA 2WB1N 3BR2A 5EZGA 2LLKA 2HOSA 1RR7A 5F04A 3BR5A 2CJJA 3FISA 1U78A 3ZQGA 4UUSB 1Q1VA 5HODA 3JREA 3TW7A 1JJ6C 4RDUA 2FJ1A 2DA4A 3G1LA 2KT0A 2FD5A 2L7MP 2NVXJ 2XGCA 2HQ5A 5FKMA 3TEDA 4M3EA 3SFIA 5EG0A 5F27A 5E3MA 2NVYJ 3C2BA 1X58A 3ZQHA 4W1UA 2QF7A 5GPCA 3H3VK 2CU7A 4A93J 2M8GX 5IPAA 5FJ8J 2R0QC 4BXXJ 1G2HA 3BG3A 3M3YJ 2AO9A 1Z77A 1VFCA 1MBHA 2K9NA 4JX5A 1MH4A 4CYCA 2GBYA 1IDZA 5DTDA 3HEFA 1OCPA 4DYCA 2M34A 1MSEC 1JTYA 2IAIA 1GUUA 3VPRA 1P7JA 1BW6A 1POGA 4Y7NJ 2G0EA 1H89C 3S15J 3K2AA 2DA3A 4UUSA 5M3MJ 4QSHA 4C3JJ 2EQRA 2MSYA 2QCOA 3BG5A 1JKPC 2E2JJ 2X9DA 1ITYA 4A3EJ 3CQZJ 5IOZA 3HM5A 1ZGWA 5EZHA 3S1MJ 3GTOJ 1GV5A 3BR0A 4BBSJ 5IYBJ 4GFBA 2HXOA 4XRSA 1ETKA 1GV2A 3GTPJ 1IDYA 2Y0SN 4B1RA 3D1NI 4A3CJ 2DA7A 2O9LA 4IHVA 5EF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GT0 C;  1BL0 A;  2XSD C;  4C2M J;  1QRY A;  1P7I A;  2M2E A;  4B3A A;  4DZP A;  3LSR A;  1W0U A;  1JKO C;  1WPK A;  3A03 A;  4IHX A;  1JKR C;  2N8G A;  2NOG A;  2LD5 A;  2I10 A;  4L5E A;  4FIS A;  5C44 J;  1PUF B;  1MSF C;  4FE7 A;  5F1J A;  1LE8 A;  1JUP A;  3B6C A;  3MN2 A;  4HNV A;  3W6V A;  2ECC A;  2LKX A;  4G12 A;  3JRF A;  2FQ4 A;  3JR9 A;  1JKQ C;  1IJW C;  1A5J A;  3OOU A;  3GTL J;  3HOV J;  2JWT A;  2ECB A;  3BR3 A;  3IH3 A;  3LSP A;  3A02 A;  1X2M A;  2W48 A;  2ID6 A;  4AYB N;  2DMN A;  4S0H B;  3HDD A;  2DJN A;  1EF4 A;  3TW6 A;  2JA8 J;  2L9R A;  2Y30 A;  1ETY A;  1MH3 A;  1K61 A;  5IYC J;  3M4O J;  2DMU A;  3A01 B;  2COB A;  2EZI A;  1ENH A;  2YUS A;  2EZH A;  2ZB9 A;  3FK7 A;  3FK6 A;  3Q0W A;  2XB0 X;  2JA7 J;  5E3L A;  2P81 A;  1RKW A;  2WV1 A;  1F36 A;  4BKX A;  2VKE A;  2PMZ N;  1H8A C;  1ZR4 A;  1IC8 A;  4XIC A;  1F43 A;  1WH5 A;  1ZKG A;  2K9S A;  5IP6 A;  4A3B J;  1QVT A;  5EEA A;  1HDP A;  5J1R A;  2NS7 A;  4EEF G;  1UG2 A;  3G1M A;  4MO7 A;  4A3K J;  4IEJ A;  3SJM A;  3LSJ A;  1X2N A;  2FX0 A;  1XC5 A;  2JN6 A;  4BBR J;  1PUF A;  1I6H J;  1IV6 A;  3S1R J;  1WGX A;  1MBK A;  2XPU A;  1MBF A;  2IBD A;  1O4X A;  5BNG A;  1RPW A;  3TP0 A;  1LFU P;  1QPI A;  3E7L A;  3FKI J;  2OPT A;  4JP0 A;  1Y1W J;  1ORK A;  2DMP A;  1SFO J;  1S7E A;  1ZTR A;  2VKV A;  2L0K A;  2ID3 A;  2R5Y A;  1WH7 A;  3ZQC A;  3GTJ J;  1ETX A;  3IH4 A;  3BT9 A;  4QIW N;  4QTR A;  3MVP A;  3JRB A;  1I3Q J;  4D5C A;  3MKL A;  3PO3 J;  5FKN A;  2CQQ A;  4A3J J;  2JA6 J;  2MGQ A;  1W0T A;  4RBO A;  2O8K A;  2K9Q A;  3S2D J;  4I76 A;  4NDL A;  3S14 J;  4ABZ A;  3BR6 A;  1WCM J;  3CMY A;  1HOM A;  1T56 A;  4V2G A;  3ZOB A;  2YU9 J;  4Y52 J;  1MBG A;  4M3D A;  3L1P A;  5IYD J;  4XID A;  1FJL A;  2XPW A;  3UKG A;  3WHB A;  3OSF A;  1ZR2 A;  1CQT A;  4DW6 A;  4MFE A;  1RES A;  2JJ7 A;  1I50 J;  2NVT J;  3GBG A;  2ME6 A;  5E3N A;  1RET A;  4MIM A;  2DN0 A;  1AKH B;  4FE4 A;  2TCT A;  3HGY A;  5M5Y J;  3CDL A;  4M3F A;  3S1N J;  2LY9 A;  1B72 B;  1ETW A;  2YS9 A;  2EZK A;  2NVQ J;  2K40 A;  3I4M J;  4JYK A;  2XGD A;  3JRG A;  3PO2 J;  1JTX A;  1OFC X;  1HF0 A;  1IRZ A;  1A6I A;  1ZK8 A;  1Y1V J;  2H1K A;  2DA2 A;  2LVS A;  3FIW A;  1Z0X A;  3HOZ J;  1U8B A;  2OF7 A;  3HBL A;  4FTH A;  1NK2 P;  2JA5 J;  2LK2 A;  2KDZ A;  1BA5 A;  5F08 A;  1VF9 A;  2R92 J;  1T33 A;  3JRI A;  1TWF J;  3RZD J;  2EBI A;  1HDD C;  3GTK J;  3RZO J;  2Y31 A;  3TP3 A;  4XRS G;  1IUF A;  1DU6 A;  5K7F A;  2GM4 A;  5IP7 J;  1SAN A;  1H88 C;  4MFD A;  1APL C;  4M3G A;  3F0C A;  1OJL A;  5EG0 B;  2L7Z A;  4A3M J;  1K83 J;  2GLO A;  2IEK A;  1AKH A;  1TWA J;  1TWG J;  4AUX A;  3ZQF A;  1B72 A;  1RKT A;  4D5F A;  4UUT A;  4A69 C;  3BTL A;  2RAE A;  1B8I B;  4AC0 A;  4V2F A;  5IOY A;  3JRD A;  2Y9Z A;  3HOU J;  5J3L A;  3I4N J;  5JLX A;  3JRH A;  5E3O A;  1HLV A;  4IHW A;  3SDG A;  1JJ8 C;  5F0C A;  1ETO A;  4FCY A;  1MNM C;  2TRT A;  3LSG A;  5DS9 A;  4A3L J;  4A3F J;  1YRN B;  3QQA A;  5GPA A;  3S1Q J;  4B4C A;  5M5W J;  2MW8 A;  1GVD A;  2MG4 A;  1JT6 A;  4D7N A;  1LFB A;  2CUF A;  2HXI A;  5K7H A;  4XK4 A;  5FKK A;  5J1U A;  3A01 A;  3GTG J;  5C4X J;  1FTZ A;  1TC3 C;  1QVU A;  5JLW A;  5FKL A;  3JRA A;  2R5Z B;  1AU7 A;  2Y2Z A;  5EGO B;  4IHY A;  2LP0 A;  2DA1 A;  3BTI A;  3O8H A;  3B6A A;  3S2H J;  3G1O A;  2O7O A;  3WHC A;  1ETV A;  2CQX A;  3BG9 A;  1GDT A;  1MBE A;  9ANT A;  1IG7 A;  4X1E A;  4MLO A;  4W97 A;  1B8I A;  3HOX J;  4DYR A;  3BTJ A;  3H0G J;  4M6V A;  2VI6 A;  3OSG A;  1LE8 B;  3HOW J;  3RKQ A;  1FEX A;  2E1O A;  1U9O A;  2HI3 A;  1BW5 A;  1FIA A;  5FLM J;  5C4J J;  1FIP A;  5IP9 J;  5J1Y A;  2X6O A;  3DCF A;  2E19 A;  2VPR A;  2XPV A;  4XRM A;  4BY1 J;  4A3G J;  1R9T J;  2JMW A;  3NAR A;  3PM1 A;  2E2I J;  2HOA A;  1YRN A;  3O8G A;  4I6Z A;  1TWC J;  4M3B A;  1TWH J;  3CCY A;  1UMQ A;  1NK3 P;  2DA5 A;  1OCT C;  1VI0 A;  4C3I J;  2B63 J;  1MBJ A;  4X6A J;  3HGG A;  3IH2 A;  3GTM J;  1WI3 A;  3S17 J;  2LFB A;  2XRL A;  2Y9Y A;  5EDN A;  2VUM J;  2ELK A;  4A3I J;  2XGE A;  2R7Z J;  3LNQ A;  1AHD P;  3DEW A;  2AHQ A;  5FKO A;  2NS8 A;  3K7A J;  2DMQ A;  3HOY J;  4J19 A;  1ETQ A;  4JX4 A;  3NAU A;  1UHS A;  3HKZ N;  2R5Z A;  4D7M A;  5EGO A;  2CUE A;  3RQI A;  3ZQL A;  3LOC A;  2X48 A;  1BJZ A;  2DTZ A;  2M9H A;  3Q3S A;  5C3E J;  2HOT A;  1XS9 A;  2D5V A;  1U9N A;  2HYJ A;  1XG1 A;  2M0C A;  1JUS A;  4LOC A;  2WAQ N;  3GTQ J;  3ZQI A;  4JX6 A;  3IV5 A;  3BQY A;  3HB9 A;  1HCR A;  5M5X J;  1ZQ3 P;  2L7F P;  5F0F A;  3BQZ A;  1E3O C;  2EZL A;  3OIO A;  3QPL A;  2DA6 A;  2ME0 A;  5GP9 A;  2CRG A;  4DYQ A;  2XB5 A;  2HDD A;  2R5Y B;  1IGN A;  2LR8 A;  3Q0V A;  4DZJ A;  1D5Y A;  5K7Z A;  3Q0U A;  5FLV A;  1JUM A;  3BTC A;  1FTT A;  4A3D J;  2LTP A;  3QPS A;  1JT0 A;  4CYC B;  2DMT A;  4C3H J;  2R93 J;  1JGG A;  1VND A;  5M3F J;  3S16 J;  1NTC A;  2H8R A;  1DU0 A;  2E2H J;  3JRC A;  2EH3 A;  3BR1 A;  5EYR A;  4BY7 J;  2JK3 A;  5F0H A;  2WB1 N;  3BR2 A;  5EZG A;  2LLK A;  2HOS A;  1RR7 A;  5F04 A;  3BR5 A;  2CJJ A;  3FIS A;  1U78 A;  3ZQG A;  4UUS B;  1Q1V A;  5HOD A;  3JRE A;  3TW7 A;  1JJ6 C;  4RDU A;  2FJ1 A;  2DA4 A;  3G1L A;  2KT0 A;  2FD5 A;  2L7M P;  2NVX J;  2XGC A;  2HQ5 A;  5FKM A;  3TED A;  4M3E A;  3SFI A;  5EG0 A;  5F27 A;  5E3M A;  2NVY J;  3C2B A;  1X58 A;  3ZQH A;  4W1U A;  2QF7 A;  5GPC A;  3H3V K;  2CU7 A;  4A93 J;  2M8G X;  5IPA A;  5FJ8 J;  2R0Q C;  4BXX J;  1G2H A;  3BG3 A;  3M3Y J;  2AO9 A;  1Z77 A;  1VFC A;  1MBH A;  2K9N A;  4JX5 A;  1MH4 A;  4CYC A;  2GBY A;  1IDZ A;  5DTD A;  3HEF A;  1OCP A;  4DYC A;  2M34 A;  1MSE C;  1JTY A;  2IAI A;  1GUU A;  3VPR A;  1P7J A;  1BW6 A;  1POG A;  4Y7N J;  2G0E A;  1H89 C;  3S15 J;  3K2A A;  2DA3 A;  4UUS A;  5M3M J;  4QSH A;  4C3J J;  2EQR A;  2MSY A;  2QCO A;  3BG5 A;  1JKP C;  2E2J J;  2X9D A;  1ITY A;  4A3E J;  3CQZ J;  5IOZ A;  3HM5 A;  1ZGW A;  5EZH A;  3S1M J;  3GTO J;  1GV5 A;  3BR0 A;  4BBS J;  5IYB J;  4GFB A;  2HXO A;  4XRS A;  1ETK A;  1GV2 A;  3GTP J;  1IDY A;  2Y0S N;  4B1R A;  3D1N I;  4A3C J;  2DA7 A;  2O9L A;  4IHV A;  5EF6 A; 
#chains in the Genus database with same CATH topology
 2L3D A;  3RPU D;  1BL0 A;  2IT0 A;  4N9H A;  2E5N A;  4DZP A;  3LSR A;  4J01 A;  1R1U A;  2XAJ A;  4BQN A;  1PUF B;  3L2C A;  5F1J A;  4PDK A;  1K79 A;  1X4P A;  1LE8 A;  4MHG A;  4HNV A;  2IGO A;  3OS1 A;  2ECC A;  2QQ9 A;  1O3T A;  2DDA A;  2A6E F;  4HSR A;  4G7Z F;  1U2W A;  1LB2 A;  2HS5 A;  1FBS A;  2FF4 A;  2A3S A;  4EMS A;  4U7B A;  3OOU A;  3LFU A;  1G3S A;  5LGT A;  2WC2 A;  3GW2 A;  1A36 A;  3IH3 A;  4A0X A;  2DLL A;  3LSP A;  1G4D A;  3LMM A;  4G7O F;  2PLY A;  2HEO A;  4AYB N;  1RR8 C;  4DBR A;  1IW7 F;  4S0H B;  2KRF A;  1EF4 A;  1VQ8 I;  3H0D A;  1QU3 A;  3DP7 A;  3TMO A;  2Y30 A;  5ICG A;  5IYC J;  1TW2 A;  3M8J A;  2COB A;  2EZI A;  5CVI A;  3RKW A;  3IC7 A;  1U6G A;  1IZ1 A;  1X4O A;  2JA7 J;  3CCE I;  3I0T A;  1RKW A;  4BGD A;  2XRO A;  1U5T A;  1OCR H;  1F43 A;  4BL0 B;  1D0Z A;  1N77 A;  2LOO A;  1S7A A;  3LQR A;  3KX2 A;  2ZFU A;  3FXU A;  1OPC A;  3G1M A;  4A3K J;  3SJM A;  2Q8K A;  1OQY A;  3ZMT A;  4V19 K;  1T38 A;  5LBQ A;  1A31 A;  1OCO H;  1P6R A;  2FNP A;  2XRN A;  1MBF A;  4XSX F;  3K1P A;  3J7Y J;  1R7J A;  1OR7 C;  3CCU I;  5L3F A;  4KIC A;  4BS9 A;  2E35 A;  4IKF A;  4UY8 I;  3IP4 B;  4RB2 C;  2JA2 A;  1B4A A;  2BBY A;  3FKI J;  4NC6 A;  2OPT A;  3PFI A;  2MC4 A;  1S7E A;  3FXQ A;  3B73 A;  3G4S I;  3GUD A;  3K70 C;  1T6S A;  3A2K A;  2CWE A;  3AG4 H;  4BHP A;  4U87 A;  2HGC A;  2VJJ A;  4QIW N;  4F92 B;  3ML6 A;  3HHH A;  4QTR A;  1XGN A;  3DEU A;  2GWR A;  3T8T A;  1I3Q J;  2PFB A;  2MH2 A;  5KVR A;  1ACI A;  3PO3 J;  5FKN A;  2BOL A;  2IGN A;  4ANJ A;  3WGH A;  4A12 A;  4LMY A;  3TL4 X;  3S2D J;  1HW1 A;  5D5V B;  4ABZ A;  3BR6 A;  3F8M A;  2PN6 A;  1T56 A;  1AA7 A;  1W7P B;  2DO7 A;  2EIM H;  2KKO A;  2V9V A;  2ZME B;  5CQG A;  2LBF B;  2XF6 A;  2K4J A;  2OJE D;  3OYC A;  5HDG A;  4BJ6 C;  1YJN I;  2PJP A;  3L1P A;  5FGM A;  1XDU A;  2M3A A;  5IYD J;  3UKG A;  4AWX B;  3OSF A;  1KQ0 A;  2M4G A;  4ZZL A;  3P5J A;  4DJA A;  1R5H A;  6PAX A;  1DP3 A;  3L9F A;  3OV8 A;  3DKX A;  2QQA A;  3G2B A;  1Q1H A;  1QGP A;  1WJA A;  2MC3 A;  3S93 A;  1YS7 A;  3GX4 X;  2DN0 A;  1R71 A;  1MKM A;  2VJ4 A;  3CDH A;  2M1B A;  4UXN A;  5M5Y J;  5JR3 A;  5J6X A;  4DNC A;  1OYY A;  3OYM A;  3H1C A;  2IPQ X;  2QKL B;  2PX9 A;  2O6G E;  2XHK A;  2W85 A;  4ZDL A;  4O5V A;  1OFC X;  2V1X A;  1FPQ A;  4HG2 A;  1Y1V J;  1LVA A;  1E17 A;  2NYX A;  2OF7 A;  4CZC A;  1LJ9 A;  3AG2 H;  4ASN A;  4K2E A;  1BA5 A;  5F08 A;  3VDX A;  2LH9 A;  2DOF A;  2E60 A;  2R92 J;  3JW4 A;  3MD2 A;  2Z3Y A;  1F4K A;  2DPD A;  4LLG F;  1A35 A;  4PGH A;  4M6Y A;  1UAA A;  3FDY A;  2VOO A;  2OD5 A;  3KP6 A;  3GEZ A;  1H0M A;  2VBX A;  1EA3 A;  1WJ5 A;  3JTH A;  4EQQ A;  2CV1 A;  4F91 B;  5K7F A;  2CO5 A;  4HV6 A;  1SAN A;  1YX5 A;  4MFD A;  1NG6 A;  4KMU X;  2HOE A;  4XLE A;  1OJL A;  2K86 A;  2L7Z A;  4A3M J;  2BW3 A;  3MZY A;  5B1B H;  3H35 A;  3J80 Z;  2QSG X;  3ESW B;  2CFO A;  1TWG J;  4AUX A;  1LKX A;  1TW3 A;  1RZ4 A;  3OR1 C;  1PDN C;  4YFX F;  1RKT A;  2DOD A;  3LSM A;  5CVU A;  2MAB A;  3BTL A;  2IA0 A;  3L2R A;  1KU2 A;  1B8I B;  2EPF A;  3GXO A;  4V2F A;  1ZG3 A;  1P4X A;  3I4N J;  1P4A A;  5JLX A;  2DK5 A;  2DI3 A;  4KN7 X;  3HPG A;  3FX3 A;  5E3O A;  3H9G A;  4KYW A;  1TLH B;  3N05 A;  3GFJ A;  1VQL I;  5DUI A;  1RIO H;  3QOD A;  2TRT A;  4IPA A;  1P9Q C;  4PFO A;  4A3L J;  2XAH A;  4XNF A;  3GZ6 A;  2IGM A;  1YYV A;  4A3F J;  1YO5 C;  1DDN A;  1MMA A;  1N25 A;  2JSP A;  4MTE A;  3BJ6 A;  3O2P E;  2I5U A;  1YIT I;  2DXI A;  2EV6 A;  2PEX A;  2G7U A;  4E4H A;  5HLT A;  4I0A A;  5BMZ A;  2IXS A;  4KMF A;  4UUV A;  1VQO I;  1VQ7 I;  1FLI A;  4LK0 F;  4L9T A;  3I71 A;  1YFH A;  5FKL A;  2QWW A;  3L00 A;  4CSW A;  4CA0 A;  4HNT A;  4CXF A;  1D8J A;  2Z16 A;  3BTI A;  2HNH A;  2M4K A;  3O8H A;  4I01 A;  5D5U B;  4YG2 F;  4BJT A;  1ETV A;  1GDT A;  1VQP I;  2R7W A;  2G7H A;  1KZH A;  2HWV A;  3BTJ A;  4BEH B;  3EDP A;  3H0G J;  2VN2 A;  3OSG A;  1FOK A;  4A6D A;  4OIP F;  4FHT A;  2HI3 A;  4HRI A;  1FIA A;  3IWF A;  3SQN A;  2Y69 H;  3FMS A;  2JZY A;  4U0Y A;  3DCF A;  2E19 A;  4RAZ A;  2E7X A;  4XRM A;  4BY1 J;  3CJN A;  3WGG A;  2H27 A;  3PM1 A;  4BHB A;  3OYL A;  3GLL A;  1BOA A;  2OCC H;  1RUN A;  3CCY A;  4XLF A;  1K78 B;  2AQF A;  1VI0 A;  5JHF A;  3G71 I;  3HGG A;  3KP7 A;  3GTM J;  2VE8 A;  4LIV A;  2DFF A;  2XRL A;  1XSD A;  5EDN A;  3GF2 A;  2VUM J;  4HV5 A;  4HPQ A;  4PJ0 C;  5LHI A;  2ELK A;  3K4J A;  4IOC F;  4A3I J;  3T8R A;  3LNQ A;  1QBJ A;  2LRE A;  3LFK A;  3OR2 C;  2QVO A;  3HUG B;  3HOY J;  1ETQ A;  1I1S A;  4G6D A;  3HKZ N;  2ZME C;  3RQI A;  2CQN A;  2FUG 2;  3ULQ B;  5DCF A;  3OYG A;  2HTS A;  3QYE A;  2DFH A;  3GZN B;  2STW A;  1W7P A;  3M1C A;  4CZZ A;  2LBF A;  2HOT A;  1UFM A;  1XS9 A;  1L0O C;  2VB6 A;  2FA5 A;  3AKZ A;  1IN4 A;  4MEX F;  4XOP A;  3A4C A;  3TED A;  3ONQ A;  3BQY A;  4UV8 A;  1HCR A;  2O61 A;  1R4N B;  2W7N A;  2NNN A;  1REP C;  5D5W B;  4I98 B;  2VXD A;  1NH3 A;  2R7D A;  4DOZ A;  3BQZ A;  1E3O C;  1V5F A;  2PMU A;  1KU7 A;  2QSF X;  1FMW A;  2HR3 A;  4XMY A;  3LST A;  4XM3 A;  3JSP A;  1YHQ I;  2CUZ A;  2DA6 A;  2ME0 A;  4IZZ A;  5GP9 A;  2XB5 A;  2I8D A;  2UZK A;  2BE5 F;  2EV0 A;  4ZJZ A;  1F1Z A;  2LR8 A;  2MLG A;  3Q0V A;  4FQG A;  5K7Z A;  1IN6 A;  5FB2 A;  3SZG A;  3LSH A;  4XOT A;  3DBL B;  4A2U A;  4ZYD A;  3ZN0 A;  2ISY A;  4C3H J;  2DBB A;  1VND A;  2DK8 A;  2GXG A;  2F4O B;  1X3Z B;  1NTC A;  1DU0 A;  2BYV E;  2EH3 A;  3BR1 A;  4OU0 A;  3MKW B;  2FML A;  3BR2 A;  2XV4 S;  3KEY A;  5EZG A;  5BPD A;  1PVE A;  3KP2 A;  1BI3 A;  4C2T A;  1RR7 A;  5F04 A;  2CJJ A;  3AL0 C;  3FIS A;  1U78 A;  1R1T A;  1Q1V A;  2ADU A;  2J5P A;  3IHU A;  2OUM A;  2Y48 A;  3TW7 A;  4H0E A;  5LHH A;  1ZRE A;  1M1E B;  1JJ6 C;  4RAG A;  1WJB A;  2HKX A;  2FJ1 A;  3OL3 A;  4Y33 A;  4UNO A;  1E0E A;  3C2G A;  5DCM B;  2VC1 A;  1TQI A;  4KN4 X;  5D8K B;  2NVX J;  2E1M B;  4XLC A;  4E7I A;  4PJN A;  2HQ5 A;  4B48 A;  5FLX K;  1JI8 A;  3EPZ A;  3IAM 2;  4RS8 A;  2HDW A;  2NVY J;  3WG9 A;  2QF7 A;  3AG3 H;  2V1U A;  3H3V K;  5E8G A;  5IPA A;  2RC4 A;  2YU3 A;  3VYS B;  2GXA A;  2R0Q C;  5ERI A;  2W57 A;  2P5K A;  1G2H A;  2R7U A;  4BXF A;  2K9M A;  1Y6I A;  3K70 D;  5DYM A;  1O7L A;  2GIZ A;  3NQO A;  4YII A;  3K4L A;  4MTD A;  2IRF G;  4KT5 C;  3BG7 A;  3W2A A;  4Z6Y A;  1Z7L A;  3WTY C;  5DTD A;  4A0Z A;  3CF5 F;  3WTU C;  4RGS A;  5E20 A;  4M9Z A;  1SFK A;  3HXL A;  1PP8 F;  1MSE C;  1JTY A;  4CCM A;  4L9J A;  2G0E A;  3S15 J;  3K2A A;  2M30 A;  1R00 A;  1YIJ I;  1WFX A;  2F5C A;  1KU9 A;  3CF2 A;  5ICF A;  4EJW A;  2C6Y A;  4Q48 A;  2E1C A;  4CCJ A;  4NHJ A;  1WWX A;  5CLS A;  2XDV A;  1GHC A;  3CCQ I;  5HLI A;  1JKP C;  2ZC2 A;  2NRA C;  1GXP A;  4LG3 A;  1ZGA A;  3KZI C;  2NNY A;  1YW8 A;  3NRV A;  3X2Q H;  3CQZ J;  5IOZ A;  3RI4 A;  2EWN A;  1ZGW A;  4LB6 B;  5IY5 H;  4OOI A;  3LWF A;  3BR0 A;  1MMD A;  3O3K A;  2E7W A;  2OQR A;  4ZTF A;  2VPL A;  3E6C C;  1WRJ A;  4N9I A;  5IYB J;  1FOX A;  2QKM B;  4F7Z A;  1G6N A;  4BDZ A;  3R60 A;  2DT7 B;  3D1N I;  2CG4 A;  4IHV A;  3UR3 C;  2MYS A;  1XGO A;  3ZQ7 A;  2HQA A;  1QHG A;  4IJA A;  1QRY A;  2W25 A;  3ZR8 X;  1E3P A;  3HRU A;  1A6Q A;  4ZYA A;  2NOG A;  4BEH A;  1ZG1 A;  1MSF C;  4L5E A;  2HZT A;  1WVR A;  4FE7 A;  2IA2 A;  1UJ8 A;  1TL8 A;  3RYP A;  3B6C A;  2AXT C;  3W6V A;  4E7J A;  2LKX A;  4G12 A;  1RNL A;  2FQ4 A;  1JKQ C;  2HFH A;  1BOB A;  1Z1D A;  3JSO A;  2W4S A;  3GTL J;  3CLQ A;  3HOV J;  2JWT A;  5BOX A;  5ILS A;  3BR3 A;  4BXU A;  1SC7 A;  3HTS B;  2CYY A;  2YSR A;  2EJR A;  4UV9 A;  2XC7 A;  3F72 A;  3F8C A;  1WJF A;  2W48 A;  2ID6 A;  3R0J A;  1ZRF A;  2DCE A;  2Q2E A;  2L7K A;  3KP4 A;  3TW6 A;  1K78 A;  3IUO A;  2FEZ A;  2KDO A;  1VQN I;  4FET A;  2K4B A;  3ABK H;  1ETY A;  1MH3 A;  2LRD A;  2WB1 A;  5KAF C;  2DMU A;  3HOS A;  3A01 B;  5F6F A;  3BJO A;  4Y4R A;  4H4K C;  5E1Z B;  2EZH A;  1XSX A;  3CCV I;  1OKR A;  3K9T A;  3QWL A;  4OWR B;  3FK6 A;  3H5R A;  2XB0 X;  4M6X A;  5E3L A;  2P81 A;  3CUQ B;  2B7E A;  1F36 A;  2WV0 A;  1IC8 A;  1JE8 A;  3G6E I;  2K9L A;  1ZKG A;  3CES A;  1BR2 A;  2K9S A;  1YX3 A;  2P6T A;  2WAD A;  3HIF A;  4MQV A;  4I99 C;  5J1R A;  2R7O A;  3CJT B;  5FRO A;  5HLH A;  2D1H A;  4Q5S F;  4MO7 A;  2DT6 A;  2BVM A;  3H3Z A;  4E7S A;  4XOR A;  3E5Q A;  1SFU A;  4MNU A;  1WGX A;  1MBK A;  1YE9 A;  4P1W A;  1BM9 A;  3ISP A;  3K4N A;  5JFR A;  4I02 A;  2BXY A;  2FNA A;  2X0L A;  4EJV A;  5BNG A;  4OIN F;  1LFU P;  3R4K A;  3V42 A;  4AVP A;  2QGU A;  2IJL A;  3W6J B;  3V4G A;  2WWY A;  1Y1W J;  1G3T A;  2EFQ A;  2H09 A;  4OIQ F;  5B5E C;  1LNW A;  4II3 A;  3HHG A;  1GLN A;  2V9P A;  3GTJ J;  2L9N A;  1LVK A;  4IX7 A;  2G9W A;  3MVP A;  3CCJ I;  4D5C A;  4BJ5 C;  2HVS A;  4ZC3 A;  1D3Y A;  3QOP A;  2CQQ A;  3MKZ A;  1YJ9 I;  2MGQ A;  1SMY F;  3QYB A;  5HNF A;  4OMZ A;  4BAY A;  2EB7 A;  3K2Z A;  4NDL A;  4E7K A;  1MNE A;  1XPX A;  1R49 A;  3S14 J;  1WCM J;  3J7Z I;  2V6C A;  2X6W A;  1HOM A;  5J4V A;  1QO0 D;  2VBZ A;  1T08 B;  3I58 A;  4V2G A;  1MMN A;  3I3L A;  2CGP A;  4XID A;  2B0L A;  2XPW A;  2JUC A;  2XIG A;  2E1M C;  1KU3 A;  1CQT A;  4MFE A;  2JSC A;  1B1B A;  2JJ7 A;  1I50 J;  4PSX A;  3I9V 2;  2NVT J;  2XAG A;  2H6C A;  2BW3 B;  3D5S C;  5E3N A;  4AIK A;  2Y75 A;  4LLL A;  2JT1 A;  3HGY A;  3T5X A;  3RTR A;  3QP5 A;  3RSN A;  3SEZ A;  2LY9 A;  3BG6 A;  3KET A;  4EAT A;  3CMM A;  2EZK A;  1EJ9 A;  2LDU A;  4M9S A;  3F23 A;  2DYR H;  4JYK A;  2XGD A;  3I4M J;  2FRH A;  4LK1 F;  3JAM K;  1HF0 A;  2STT A;  1P92 A;  2ZSH B;  3FIW A;  1Z0X A;  3H36 A;  1TBX A;  4NC7 A;  3HOZ J;  1MJ9 A;  3L09 A;  1U8B A;  1OYW A;  2KZV A;  2ZXW H;  3HBL A;  4FTH A;  2A61 A;  2KDZ A;  1LDK B;  3U21 A;  3DXJ F;  3HZJ A;  3BLY A;  1W7P D;  1K4T A;  5BQT A;  3VSK A;  2UWM A;  4CIC A;  2P5L C;  2VKD A;  1TWF J;  2KHM A;  3E1S A;  2CW7 A;  1IRF A;  1SD7 A;  3ASO H;  3NWT A;  3RZO J;  4XRS G;  2E36 A;  3ASN H;  1IUF A;  4BQA A;  1H88 C;  1BC7 C;  2MD5 A;  4M3G A;  5E1W A;  1BBY A;  2EIN H;  2PMZ A;  3V7R A;  1TP4 A;  1KGS A;  2O03 A;  2ZCW A;  2R7R A;  4E70 A;  2KJC A;  1K83 J;  1N75 A;  1U5T C;  5H20 A;  4S04 A;  3WE3 A;  1NG7 A;  2IEK A;  4RLQ A;  1AKH A;  1FC3 A;  1WZ2 A;  3VOD A;  3H9Q A;  5GAD J;  2HU9 A;  1HSJ A;  3GME A;  3NWS A;  3R6S A;  3DU6 A;  1FYM A;  3GCM A;  4NC8 A;  2BHZ A;  4OAY A;  5FLX Z;  2ELH A;  2RAE A;  4HF0 A;  2CS3 A;  1OYI A;  1ZYR F;  2VL8 A;  3KYC B;  5DD8 A;  3JRD A;  2Y9Z A;  3M7G A;  3BCA A;  2IGK A;  3JRH A;  1MDM B;  5H6R A;  1T95 A;  2YX7 A;  1IRX A;  2NS0 A;  3FZV A;  2YR2 A;  1YI2 I;  4ZYG A;  4FCY A;  1FOY A;  3LSG A;  3WU2 C;  2EFW A;  4S05 A;  1Z3X A;  5B3S H;  4PGG A;  3QQA A;  5GPA A;  4NQW B;  5M5W J;  1F5T A;  5ILV A;  5DDG A;  2QZ8 A;  1GVD A;  2HYF A;  2MG4 A;  2P7V B;  1D1A A;  3P9K A;  2BY0 A;  4D7N A;  2PQ8 A;  5HNH A;  4C9Y A;  5K7H A;  3A01 A;  4U0V A;  2W82 A;  3WTV C;  3BOQ A;  3CUQ C;  4E6K G;  3U2R A;  1TC3 C;  4BE2 A;  4LB5 A;  2GIV A;  2XF5 A;  3JRA A;  1AU7 A;  1D0Y A;  3TDU C;  3CUQ A;  2P8T A;  2Y2Z A;  4FX4 A;  2Z9O A;  4LIU A;  2HVR A;  4BNC A;  4IHY A;  2DA1 A;  3B6A A;  3PSF A;  3G1O A;  5EEG A;  3ECO A;  2LG4 A;  2COM A;  2CV2 A;  3M9A A;  3I59 A;  3RDI A;  3G73 A;  4KIS A;  4QWQ A;  4X1E A;  4MLO A;  2WA0 A;  3COA C;  1Z7U A;  3HOX J;  4IL6 C;  5FO5 A;  4G6T B;  2P7C B;  4WXC A;  3VB2 A;  1BI2 A;  4M6V A;  1HC8 A;  3HOW J;  3RKQ A;  1W5T A;  1V4R A;  4ZTJ A;  1WJC A;  2V9K A;  1BW5 A;  2GAU A;  1O3R A;  5FLM J;  4II2 A;  5J1Y A;  5JVG F;  2X6O A;  1VQ6 I;  1J5Y A;  2XPV A;  3VYU B;  1Y0U A;  5EJC A;  1R9T J;  3NAR A;  3BCB A;  2A5W A;  2E2I J;  4CDG A;  2HOA A;  2V26 A;  1FSE A;  1D0X A;  1EH6 A;  5F64 A;  4Z2Y A;  1TWH J;  2CQ7 A;  1SVM A;  4XRF A;  2R7T A;  1OCT C;  3QRF F;  3WTT C;  5BPI A;  2DW4 A;  3N97 A;  1WI3 A;  1S29 A;  3S17 J;  2LFB A;  4OIO F;  1F9N A;  2UUZ A;  1KQ8 A;  3RCO A;  2ZJR F;  5E1X A;  2XAU A;  2XGE A;  4RB0 A;  1X3W B;  1AHD P;  2KJB A;  3DEW A;  2AHQ A;  5FKO A;  2NS8 A;  3PQJ A;  3U1K A;  4J19 A;  4JX4 A;  2CSO A;  3FBN B;  4FX0 A;  3GLX A;  3VOE A;  2JRM A;  3PL8 A;  2X48 A;  1SVL A;  1C0W A;  5HOO A;  3FXK A;  1TTY A;  1U9N A;  3D5R C;  1XG1 A;  1JUS A;  2WAQ N;  2YPR A;  3GTQ J;  4IOA F;  3ZQI A;  2EA2 A;  3TDZ C;  1FYL A;  4XLA A;  5CVR A;  3S2W A;  3HB9 A;  3PNT A;  4LGW A;  2DOA A;  1D5V A;  3DWL E;  5M5X J;  3NEU A;  1DGW Y;  3DTK A;  2X51 A;  5F0F A;  3CCM I;  2EZL A;  1S9H A;  3OIO A;  3QPL A;  2W00 A;  1G3Y A;  2KIU A;  3OYF A;  2VON A;  2CRG A;  2EFO A;  2O8X A;  3M8F A;  2R5Y B;  2ETH A;  4C30 A;  2LYC A;  1FP1 D;  5L3B A;  3Q0U A;  2CH0 A;  2K7L A;  1HKS A;  1SVO A;  5J4Y A;  1JT0 A;  4A3D J;  3L2Q A;  2DMT A;  1R6R A;  3PFY A;  3EYI A;  1ZAO A;  1LDD A;  3MQ0 A;  3L2V A;  5M3F J;  2MLK A;  3BZC A;  3S16 J;  2H8R A;  3TQN A;  2HPI A;  4E7Z A;  4RM3 A;  5EYR A;  2A6H F;  5F0H A;  2BY1 A;  1IXR C;  3K0L A;  4CO8 A;  5HDK A;  1IXC A;  2DQL A;  5J47 A;  3E3V A;  4KIF A;  1WKM A;  4EVI A;  4CH7 A;  5CJ9 A;  1QNT A;  4JBA A;  4DBQ A;  2BZT A;  3EQL F;  1ZG5 A;  2DA4 A;  3H5N A;  2LMD A;  3HRS A;  4GYI A;  1DP7 P;  4GYG A;  2FD5 A;  1TT5 B;  3G3Z A;  2XGC A;  4YEL A;  4JOM A;  3LSI A;  3OWT A;  5E3M A;  3M07 A;  4G6Q A;  2A05 A;  1V5G A;  3C2B A;  2PI0 A;  4W1U A;  1G59 A;  4KNY A;  2CU7 A;  1ZN2 A;  4HDU A;  3KP3 A;  4O6J A;  3RJP A;  1FBQ A;  1LUJ B;  2E1N A;  2A07 F;  3BG3 A;  4ZYE A;  2OQG A;  1SFX A;  3M3Y J;  3MMY B;  1VFC A;  1MBH A;  2VQG A;  4JX5 A;  1BN5 A;  3MAJ A;  4WK8 F;  2XUB A;  4CYC A;  2ZXH A;  1IDZ A;  1ZLJ A;  5L3C A;  4DGW B;  2VIX A;  4HA8 A;  2HQN A;  1MDM A;  1NHA A;  1OCP A;  1IAW A;  2RRE A;  3OYA A;  1Z6R A;  2M34 A;  3ZMS A;  5J8C A;  3VPR A;  4IHT A;  2W84 A;  2DA3 A;  3N4M A;  4XKV A;  2R7Q A;  1IN5 A;  5A2Q K;  3QOE A;  1R58 A;  4BQO A;  1Z67 A;  3MZ8 A;  4NQW A;  3MCZ A;  4PJM A;  2Q2E B;  5FRM A;  2EQR A;  3P9C A;  1KYZ A;  3TOB A;  2M5W A;  4KDP A;  3K1M A;  2QM3 A;  5BS6 A;  2L5Q A;  3I54 A;  4A3E J;  2ZXJ A;  5L3D A;  3H3U A;  4BDY A;  1SD4 A;  4LIT A;  2XKP A;  2QLZ A;  4EV0 A;  4BBS J;  2FQ3 A;  2NAZ A;  1Y56 A;  5HS9 A;  3V8L A;  1A04 A;  3OYK A;  4XLP F;  1J09 A;  5D4S A;  4HX4 A;  1I6X A;  4AIJ A;  3EUH C;  3EUK L;  1GT0 C;  1Z3Y A;  3S8P A;  2HDC A;  3RPU A;  4AVZ A;  2V7F A;  3BWG A;  3DFG A;  4B3A A;  3EUH A;  1JKO C;  3A03 A;  1RUO A;  5DM6 F;  2N8G A;  3F3X A;  4L5J A;  2M8E A;  3F22 A;  4HOB A;  2ISZ A;  2LD5 A;  3FMR A;  4FIS A;  3I56 I;  3CLO A;  1FY7 A;  2WAE A;  4MQ9 F;  3F8N A;  5GAE J;  1KA8 A;  4BHC A;  4AM3 A;  2DOE A;  3DLL F;  1A5J A;  3S3M A;  2A5Y B;  5L3G A;  2UXX A;  2WY7 Q;  3A0H C;  3CO6 C;  1D1B A;  2KIF A;  2MH9 A;  1H9G A;  4OAZ A;  1MMS A;  3OIQ A;  3K10 A;  3A02 A;  1USS A;  1X2M A;  1U3E M;  2ESN A;  1LEA A;  2X6Y A;  1MJB A;  2DMN A;  3OYB A;  2FE3 A;  3HDD A;  1XCV A;  2DJN A;  2Z99 A;  1UEL B;  1I3A A;  3U1D A;  2L9R A;  3RQ4 A;  2X1C A;  1K61 A;  1K7A A;  1B9M A;  1CF7 A;  4HW0 A;  2H8W A;  3RKY A;  4F52 A;  3BRO A;  4L0Z B;  4XKC A;  3WTS C;  2ZB9 A;  3FK7 A;  5LRR A;  3J81 K;  1IV8 A;  4BKX A;  2VKE A;  5LGN A;  1FP2 A;  4L0Y B;  3M8E A;  5HS7 A;  1DGR M;  4GCV A;  1DQU A;  1WH5 A;  2HTJ A;  2RKH A;  3ZXS A;  5IP6 A;  3FBI B;  2IS1 A;  1QVT A;  3PUF A;  3BDD A;  4WXH A;  1W5C C;  1HDP A;  5GTI C;  2CMP A;  1SAX A;  2KRC A;  1T8I A;  2F6C A;  2VOD A;  4KUM A;  1QHH D;  3GZ5 A;  2FX0 A;  2CQK A;  2IW5 A;  3D5L A;  4RM2 A;  3SEQ A;  4BBR J;  5GAG J;  1I6H J;  4DIQ A;  1BR4 A;  1IV6 A;  4G94 A;  4U7D A;  4IQ4 A;  4IXA A;  3S1R J;  2FMY A;  4NNJ A;  4N4N B;  2IBD A;  3KP5 A;  4HZF A;  5ICC A;  1RPW A;  1QPI A;  1EH7 A;  3E97 A;  2GOM A;  2MD0 A;  4JP0 A;  2VQL A;  1ORK A;  2DMP A;  1ZTR A;  2ZJQ F;  2R5Y A;  1WH7 A;  2V79 A;  3HPH A;  3MZH A;  1I27 A;  1R5G A;  4P5O A;  4B3X A;  1VQ5 I;  2VOP A;  3ROU A;  2O3F A;  2D2W A;  4BU2 A;  3TKY A;  4YFK F;  2M0M A;  2VT3 A;  3MKL A;  4PFP A;  3FWE A;  2OCE A;  4EM0 B;  3OYI A;  4A3J J;  2JA6 J;  2KP6 A;  5D8L B;  4KFC A;  2KL4 A;  1W0T A;  5KK1 A;  1YQA A;  1YW7 A;  2K9Q A;  2RV8 A;  3V8J A;  2L4A A;  1VTN C;  1MND A;  4KIB A;  4XLH A;  3K4C A;  5B1A H;  1CGP A;  2VKH A;  2KQR A;  5K5O A;  3WTX C;  3BC8 A;  4XLN F;  2YU9 J;  1VQ4 I;  4Y52 J;  1W4M A;  1Y0N A;  4HST A;  4M3D A;  1V54 H;  4IQJ A;  4EJO A;  1XTA A;  1RI7 A;  3F8F A;  2FBK A;  3CDI A;  1W36 D;  1ZR2 A;  3BJA A;  2Y0S A;  2R7F A;  1Y39 A;  3DBR B;  4CUG A;  1I1G A;  2H1L A;  3CZ6 A;  2NVU B;  3GBG A;  1QZY A;  3ECH A;  2QSH X;  1R1V A;  1RET A;  4ON0 A;  2O0Y A;  1AKH B;  5E17 F;  2GA1 A;  2OAZ A;  3CDL A;  4M3F A;  2DT5 A;  1X1A A;  3EET A;  1V3F A;  3SFZ A;  2DJI A;  4RMN A;  1ETW A;  2YS9 A;  3TO9 A;  4CCN A;  2KFD A;  3C18 A;  2F4M B;  2NVQ J;  2K40 A;  4PZJ A;  1JTX A;  4QLC U;  3CUO A;  1A6I A;  1BI0 A;  1ZK8 A;  1XGM A;  2DA2 A;  2LVS A;  2RN7 A;  3TGN A;  5F1R A;  4G9Y A;  2VC0 A;  3RYR A;  4L9N A;  2A69 F;  3PIP F;  2ZKZ A;  3GFI A;  2IS4 A;  2LNB A;  4AYB A;  4IVN A;  2OC6 A;  4BAC A;  1HA8 A;  4Y15 A;  4NBQ A;  2F5F A;  2FBH A;  1OCC H;  3SDB A;  3KEO A;  4IRH A;  3RZD J;  2K5C A;  1HDD C;  3GTK J;  1S7O A;  5E18 F;  4OMY A;  5H2F C;  1J9I A;  2NOJ B;  2GM4 A;  4GO1 A;  2JPC A;  2UV1 A;  2CUJ A;  2PBI A;  3FXL A;  1APL C;  3C7J A;  1XDS A;  2W24 A;  1SAU A;  2RGV A;  3FXM A;  1EKE A;  5LRS A;  2KIQ A;  3QU3 A;  2VQC A;  3DPL C;  4AU7 A;  1ZEL A;  1B72 A;  1STZ A;  1N78 A;  4D5F A;  3WTW C;  3CCS I;  4CHU A;  3I59 B;  4UUT A;  2BGC A;  1RC9 A;  3SHF A;  2E5Z A;  1W1W E;  4AC0 A;  3VYR B;  1WHU A;  5FRN A;  3HOU J;  1T0F C;  5J3L A;  3S32 A;  1L3L A;  3P7N A;  1D8K A;  1SFE A;  4IHW A;  1T0F A;  3FF5 A;  5HLG A;  2PMH A;  1LDJ A;  3CJQ B;  5F0C A;  4U0W A;  1XMX A;  1ETO A;  1ON1 A;  2L54 A;  3S3O A;  2WAF A;  2LF7 A;  3U9G A;  1YLF A;  4E7H A;  2XVC A;  4WWC A;  3GWZ A;  3S1Q J;  2MW8 A;  4CCK A;  3IL2 A;  1JT6 A;  4RB1 A;  4B43 A;  4RAF A;  1LFB A;  3DTE A;  4KJZ A;  5LD2 C;  2CUF A;  3DV8 A;  5HVQ C;  4MGR A;  3BZK A;  4XK4 A;  5FKK A;  5J1U A;  3OS2 A;  3GTG J;  5C4X J;  1YG2 A;  5A2Q Z;  1FTZ A;  3O6B B;  3WE2 A;  5JLW A;  2A6T A;  1YJW I;  4RAY A;  4XL9 A;  4XQF A;  2WY8 Q;  1YS6 A;  1ON2 A;  3E6D A;  2ELJ A;  2DFI A;  2L9S A;  2KIM A;  1J0R A;  3R0A A;  2FU4 A;  3JCU C;  2CQX A;  4HQE A;  9ANT A;  3PUB A;  3F6V A;  3T0Y A;  3CCL I;  1ZRC A;  4XKW A;  4HEA 2;  4HF1 A;  3QPH A;  1LEB A;  5CPR B;  4UVC A;  2VI6 A;  2ZNZ A;  3LA3 A;  1U9O A;  5FD5 A;  1V55 H;  1O7F A;  4CGZ A;  5C4J J;  2L02 A;  5CVJ A;  2EK5 A;  5CYV A;  1DPU A;  2F48 A;  1J2X A;  2VPR A;  1K6O A;  3E6B A;  4A3G J;  2JMW A;  3BPX A;  4B47 A;  3IRR A;  1Z05 A;  2X6X A;  4E7L A;  3KCC A;  2IS2 A;  3V7C A;  3O8G A;  1YRN A;  3F8B A;  4I6Z A;  3A1Y A;  1TWC J;  3MWM A;  4M3B A;  1IO2 A;  2B63 J;  1MBJ A;  3H92 A;  3IH2 A;  3PIO F;  3OYJ A;  2L4M A;  3CME I;  2MA3 A;  2Y9Y A;  4F93 B;  4ENM A;  2X85 A;  4BQQ A;  3KIO A;  1BJA A;  3KZY A;  3ZCO A;  2DMQ A;  3FXR A;  3NAU A;  3QP6 A;  2R5Z A;  4D7M A;  4G8X A;  4XKB A;  5EGO A;  5JI6 A;  2CUE A;  1MJA A;  2BXZ A;  2PG4 A;  3ZQL A;  1BJZ A;  2DTZ A;  3Q3S A;  4UVA A;  3OMY A;  1HW2 A;  2D5V A;  2HYJ A;  3KFW X;  5KAI C;  4LOC A;  1QZZ A;  3CTA A;  4KT6 A;  5D5X B;  3J81 Z;  4XN3 A;  5AIP A;  1S6L A;  2XAQ A;  1Y8R B;  4Y13 A;  4YFN F;  3WU0 A;  3FXO A;  1B6A A;  2E34 A;  1ZQ3 P;  1P2F A;  2L7F P;  2R7V A;  1GXQ A;  2M7B A;  5DM7 F;  2VAS A;  4ENN A;  3C2H A;  4KA4 A;  4DYQ A;  2P0W A;  1IGN A;  1JUM A;  3BTC A;  1WJD A;  2LTP A;  2RNG A;  2IA1 A;  4CYC B;  5ICE A;  4MEY F;  2TDX A;  4I0B A;  4IRG A;  3IKV A;  2JK3 A;  2DFE A;  4BY7 J;  2WB1 N;  3WTZ A;  4P9U A;  4BE1 A;  4A0Y A;  5LHG A;  1ZHF A;  2VT2 A;  4JK1 X;  3HC7 A;  3OYN A;  3WG7 H;  3BR5 A;  5EEH A;  5GTH C;  5GAH J;  2ZNY A;  1MD0 A;  3ZQG A;  5HOD A;  2K02 A;  5AIQ A;  2ZJ2 A;  5IT9 K;  3D0S A;  3HSR A;  4RDU A;  3QAH A;  4G7H F;  5JHU A;  3ZPL A;  4P9F A;  2VJ5 A;  2XKO A;  4LG0 A;  1J75 A;  3AFH A;  1R4M B;  2KT0 A;  1TNS A;  3VFZ A;  2PJR A;  3TBI A;  2L7M P;  2LKS A;  2CW0 F;  1XMA A;  2A68 F;  2KLO A;  2L01 A;  5FKM A;  4HQM A;  2FBI A;  4M3E A;  3SZT A;  3TO6 A;  2M87 A;  3IRQ A;  1OR7 A;  4RGU A;  1X58 A;  3ZQH A;  5L3E A;  2F2E A;  5DV5 A;  4HAM A;  3SXY A;  3UNG C;  2QBY B;  1T39 A;  2JTV A;  1YIO A;  1QA6 A;  4GGG A;  4O3M A;  2AO9 A;  1Z77 A;  4FT8 A;  4PUS A;  2LY1 A;  2VXZ A;  2K9N A;  2MFZ A;  1S72 I;  1MH4 A;  2GBY A;  1W36 C;  1DPR A;  4ETS A;  4RLF A;  3PNY A;  5ED4 A;  3HEF A;  2H94 A;  5LLQ A;  1FBU A;  1JHH A;  4L9V A;  3VWB A;  3LQQ A;  2UXN A;  2IAI A;  4IHS A;  1GUU A;  5D4R A;  1BW6 A;  1POG A;  1FMV A;  4ZDO A;  3Q5F A;  2V4J C;  3DPU A;  4Y17 A;  1IXS B;  5FFZ A;  4N4O B;  3GFM A;  1O3S A;  1E3H A;  4UUS A;  5M3M J;  4C3J J;  2GXB A;  1JGS A;  2HYG D;  3BG5 A;  3CP8 A;  1B9N A;  2E2J J;  3SYT A;  4XSZ F;  1ZH5 A;  3F21 A;  3FM5 A;  3E5U A;  1P4W A;  1ZGJ A;  3HKZ A;  1CF7 B;  3HM5 A;  3ZMZ A;  3GTO J;  3HSF A;  1GV5 A;  1PJR A;  2WTE A;  2CV0 A;  1VQK I;  2DAO A;  2OU2 A;  2HXO A;  1OLT A;  4XRS A;  1KON A;  1GV2 A;  3GTP J;  1IDY A;  4B1R A;  3QU6 A;  3S3N A;  2R7X A;  3TOA A;  2O9L A;  1XX5 A;  2JPB A;  5EF6 A;  2F5E A;  5E8I A;  1Z9C A;  2XSD C;  4C2M J;  2H6B A;  2V1D A;  1P7I A;  2M2E A;  4CYD A;  3L2U A;  1W0U A;  4IHX A;  1WPK A;  3QYF A;  1W5S A;  5LGU A;  1JKR C;  2VQH A;  2X1D A;  3B02 A;  2K85 A;  2I10 A;  4BYY A;  5C44 J;  1JUP A;  2VJI A;  3MN2 A;  3IWZ A;  1HST A;  4QPQ A;  3ABL H;  1MMG A;  3ZMD A;  3JRF A;  2LKP A;  3JR9 A;  1IJW C;  4A6E A;  3MFK A;  1QPM A;  1JHF A;  2E71 A;  5HDN A;  3I5U A;  4D0P A;  3KEQ A;  1ZLK A;  2ECB A;  4N0B A;  2QEN A;  3HOT A;  3A0B C;  2Z5U A;  2JVG A;  4EGY A;  3AL0 B;  3HRT A;  3CO7 C;  3BY6 A;  3FKJ A;  1K4S A;  1R5I D;  2JA8 J;  1G8X A;  1DUX C;  3M4O J;  3J7A O;  1ENH A;  2BHY A;  1AOY A;  2RVC A;  1WJE A;  1E2X A;  2YUS A;  3GYH X;  2HZD A;  4I09 A;  1WI9 A;  3Q0W A;  2HVQ A;  2ZXI A;  1FT9 A;  4J00 A;  4EM1 A;  3CD6 I;  2WV1 A;  3Q9S A;  2RDP A;  3W2W A;  2PMZ N;  1H8A C;  1ZR4 A;  4XIC A;  3OYE A;  2EA4 A;  3HJE A;  1FSH A;  3RPQ A;  4A3B J;  3PJR A;  5EEA A;  1X3U A;  3DPT A;  3TO7 A;  2DTR A;  3W2V A;  2NS7 A;  4EEF G;  1UG2 A;  4M74 A;  1G3W A;  4IEJ A;  3LSJ A;  4D1Q A;  1X2N A;  1XC5 A;  2JN6 A;  1PUF A;  1AWC A;  5LFA A;  3HRM A;  3LA7 A;  3ZRG A;  4HLY A;  2XPU A;  2JVH A;  1O4X A;  4D9J A;  4ZYH A;  3TP0 A;  4NB5 A;  3EYY A;  3E7L A;  3HSE A;  3KE2 A;  5D6E A;  1SFO J;  2VKV A;  2L0K A;  2ID3 A;  4YIR X;  4IO9 F;  3ZQC A;  1ETX A;  3IH4 A;  3BT9 A;  4ENK A;  3BPV A;  4L5I A;  2VE9 A;  1ZAR A;  1U0J A;  3OY9 A;  3JRB A;  2J5O A;  2EIL H;  2M45 A;  2VBW A;  4ZDP A;  2VLA A;  1IN7 A;  1T2K A;  2BY2 A;  4HYE A;  3WOD F;  3C1D A;  3CCR I;  1YTY A;  4Q47 A;  4RBO A;  2O8K A;  3LAJ A;  1FWZ A;  4I76 A;  1D1C A;  4GDF A;  3GVA A;  4TV7 A;  2P4W A;  4PJL A;  3CMY A;  3JAM Z;  3ERE D;  3JTG A;  4CCO A;  3FXJ A;  3SZP A;  5K1Y A;  1TQM A;  1Y8Q B;  3ZOB A;  1FOW A;  2QUF A;  2OV7 A;  1MBG A;  2ACJ A;  1XCB A;  5DD4 A;  4P55 A;  3C3W A;  2XSJ C;  1FJL A;  3WHB A;  2BY3 A;  4QPO A;  3M1E A;  2JQ7 A;  5J40 A;  4DW6 A;  3ZQQ A;  4AID A;  1Z21 A;  3V7S A;  5LEJ A;  1RES A;  1TZL A;  4PK4 A;  2BEO A;  1GVJ A;  2ME6 A;  3K4B A;  5ILU A;  4MIM A;  1XSV A;  4A5N A;  4FE4 A;  2TCT A;  2JRT A;  2V6E A;  3S1N J;  4RGR A;  2QBY A;  1VQ9 I;  1B72 B;  1XD7 A;  5J8F A;  2ZJP F;  1QZE A;  1HW5 A;  3JRG A;  2Z1D A;  3OYH A;  3ABM H;  3PO2 J;  1MW7 A;  1O3Q A;  2P6S A;  1IRZ A;  5KCM A;  3BZ6 A;  1Z91 A;  2WBM A;  3K69 A;  2H1K A;  3I55 I;  1HQC A;  3OL4 A;  3AG1 H;  4ENJ A;  2DDB A;  2Z2S B;  1UCR A;  5FFX A;  2Q0O A;  4PCQ A;  5CQE A;  3L7W A;  1NK2 P;  2JA5 J;  2LK2 A;  4LJZ F;  3ZMV A;  1XMK A;  3CMA I;  1VF9 A;  4AIH A;  1T33 A;  2ZME A;  2Z33 A;  3JRI A;  4XBF A;  2K3P A;  2EBI A;  2Q1Z B;  1KYW A;  1FNN A;  4UHT A;  3VSL A;  1ZRD A;  3HTU A;  2Y31 A;  3E5X A;  3TP3 A;  1DU6 A;  2GOX B;  4UB8 C;  1X1D A;  5IP7 J;  2L9V A;  3F0C A;  3OYD A;  1BI1 A;  5EG0 B;  2QEX I;  4FAS D;  4M72 A;  3CP2 A;  2V1N A;  2GLO A;  5IT9 Z;  4EJT A;  2HQR A;  3ERM A;  1TWA J;  2DQR A;  3H9J A;  4DQ2 A;  2OTL I;  1IRG A;  3K6G A;  3ZQF A;  3I4P A;  5KHD A;  2K3F A;  3RKX A;  4HDV A;  2ESH A;  4KIT B;  4A69 C;  3W6K B;  2QYO A;  3DKW A;  1R23 A;  4M71 A;  3KZZ A;  1BC8 C;  5IOY A;  1MZB A;  3CC7 I;  3FMQ A;  3VYT B;  2BV6 A;  4B44 A;  2OA4 A;  3ZGK A;  3WGI A;  5LEK A;  1HLV A;  2XGX A;  3SDG A;  1JJ8 C;  2IP2 A;  4OIR F;  1PP7 U;  5CKT A;  1MNM C;  4IF4 A;  4I2O A;  2L2O A;  2FXA A;  5DS9 A;  1YRN B;  1K6Y A;  3FHN A;  3ZN1 A;  3CC4 I;  4HX8 A;  2DPU A;  4B4C A;  2B9S A;  4LLN A;  2ZSI B;  5TRD A;  3MEX A;  1YW9 A;  3KPH A;  4HNU A;  1PUE E;  4F3Q A;  4PSW A;  2HXI A;  3MKY B;  4CCL A;  1ONV A;  4BH9 A;  4Y3O A;  2RQQ A;  2KMU A;  3F6O A;  1QVU A;  4Q4Z F;  2OZ6 A;  2R5Z B;  5EGO B;  2LP0 A;  1R22 A;  3S2H J;  2X4H A;  3PSI A;  2O7O A;  2ZBK A;  3WHC A;  3BG9 A;  3E6M A;  2XAF A;  1MBE A;  3DF8 A;  1IG7 A;  4W97 A;  1B8I A;  2HKO A;  2LSO A;  3OS0 A;  1TNT A;  1TT0 A;  2AQE A;  1MGT A;  3ABT A;  4JQF A;  4DYR A;  2LC2 A;  4XN0 A;  1B59 A;  4ESB A;  2LF8 A;  4YIF A;  2KZG A;  4M73 A;  2BVL A;  1PYV A;  1LE8 B;  1BIB A;  1FEX A;  2E1O A;  2EIK H;  4X0G A;  4F55 A;  2D1V A;  1SD6 A;  1TQP A;  1FYK A;  4WXD A;  4B8X A;  1ULY A;  1I5Z A;  1FIP A;  5IP9 J;  2CFX A;  5K5Q A;  3EUA A;  4WX9 A;  4U88 A;  2QA4 I;  1KQ9 A;  1LFP A;  3T1B A;  4HLX A;  3HG9 A;  3AAF A;  3FM3 A;  1UHW A;  1XN7 A;  2X1E A;  4ZH4 F;  1YOV B;  3HYI A;  4RB3 C;  3HL2 A;  1UMQ A;  1NK3 P;  3DU5 A;  2R7S A;  2DA5 A;  2F5D A;  4ZZD A;  5DEQ A;  4C3I J;  1OMI A;  4X6A J;  1UB9 A;  2D45 A;  1X1B A;  2OTJ I;  1VQM I;  1Z6T A;  4AD9 A;  2R4G A;  4UVB A;  1LPQ A;  1V5E A;  4PJJ A;  5KNL A;  2R7Z J;  1XB4 A;  1X19 A;  4ESF A;  3WU1 B;  3K7A J;  2DYS H;  2QQB A;  3VEP A;  1UHS A;  1XGS A;  4ESJ A;  1FZP B;  1U5T B;  3LSK A;  1MIJ A;  4P96 A;  1QQI A;  1ERD A;  3LOC A;  3CJR B;  2M9H A;  5C3E J;  3QPT A;  3H5A A;  1OCZ H;  2M0C A;  3ELK A;  4KIG A;  3I53 A;  1I39 A;  3ABU A;  4M9X A;  3KYD B;  4LG0 B;  2EV5 A;  4JX6 A;  3IV5 A;  2F5V A;  4R8H A;  1IUY A;  3LA2 A;  3RIR A;  2M7A A;  2PJR B;  1X1P A;  1OIS A;  3PNV A;  1FX7 A;  1EH8 A;  5AON A;  4IRI A;  1HKT A;  2NXN B;  2OBP A;  2HDD A;  1S5L C;  2DU9 A;  1LQ1 A;  3REO A;  2XF7 A;  4C2U A;  2VBY A;  4ITV A;  2KRH A;  4A5M A;  1D5Y A;  4DZJ A;  5FLV A;  5H6Q A;  1H9T A;  1FTT A;  2FOK A;  3QPS A;  1HXD A;  1SMT A;  1VZ0 A;  4YEJ A;  5TIS C;  2R93 J;  1JGG A;  4YRV A;  3W3C A;  4HX7 A;  3DTI A;  3F9K A;  3IAS 2;  1IF1 A;  2E2H J;  4GXO A;  3JRC A;  1BR1 A;  3HUG A;  5B66 C;  2ICW G;  5TGT A;  2LLK A;  3KLN A;  5CVV A;  2HOS A;  2FSW A;  2YX4 A;  4UB6 C;  4BE0 A;  2QQ8 A;  2KIS A;  4UUS B;  2AXL A;  3I64 A;  3JRE A;  4EJU A;  4XON A;  1BIA A;  2P5V A;  1SD5 A;  3K1N A;  4LFU A;  5K5R A;  3J80 K;  4EGZ A;  3K4M A;  1J7K A;  4L18 B;  1HBX G;  2OZU A;  3ZMU A;  3G1L A;  3DLA A;  2EFP A;  2LY2 A;  1U8R A;  4R79 A;  3DEE A;  1S8N A;  3R61 A;  2R3S A;  2GA2 A;  4NUB A;  4XR6 A;  4I7H A;  3SFI A;  5E79 C;  5EG0 A;  4GRI A;  2JUG A;  2F4I A;  5F27 A;  5TJJ A;  1RRJ A;  3OOP A;  2RNJ A;  2CW8 A;  5GPC A;  2ZFW A;  4A93 J;  2FOW A;  2M8G X;  1UST A;  5FJ8 J;  4BXX J;  1S3J A;  5D6F A;  1T98 A;  1UZC A;  2EFN A;  3LL7 A;  3J7A Y;  5FD6 A;  2IVM A;  3PQK A;  3P9I A;  2IS6 A;  5HS8 A;  1O57 A;  2ZO4 A;  2O5R A;  4HF2 A;  3K4K A;  3IKT A;  5JVT A;  1UHM A;  4DYC A;  1SEU A;  4B09 A;  2GZW A;  1X1C A;  1J59 A;  1JXS A;  3ZP5 A;  3FHZ A;  1UG0 A;  2MBF A;  4LD5 A;  3DQV C;  5IT3 A;  3E0J B;  3CC2 I;  1P7J A;  4Y7N J;  3V8K A;  1WSU A;  1H89 C;  2GQQ A;  1IN8 A;  3BP8 A;  2HPM A;  3GO5 A;  1ODD A;  4HBL A;  3L2W A;  3LAP A;  4EM2 A;  4QSH A;  2EIJ H;  4WF2 A;  1R36 A;  2MSY A;  2QCO A;  3OIP A;  2W1O A;  2Y0M A;  2KPM A;  5DUK A;  1HKQ A;  3DKY A;  2X9D A;  1ITY A;  4RGX A;  5DCM A;  5EZH A;  3S1M J;  4R1H A;  4RA2 A;  2XAS A;  2K27 A;  3DBH B;  4GFB A;  1WQ2 A;  1ETK A;  3KLO A;  2Y0S N;  3GFL A;  2RQP A;  3Q9V A;  4A3C J;  2WAQ A;  2DA7 A;  4WCG A;  1EV7 A;  4BUP A;  3KYL A;  2AS5 F; 
#chains in the Genus database with same CATH homology
 1GT0 C;  1BL0 A;  2XSD C;  4C2M J;  1QRY A;  1P7I A;  2M2E A;  4B3A A;  4DZP A;  3LSR A;  1W0U A;  1JKO C;  1WPK A;  3A03 A;  4IHX A;  1JKR C;  2N8G A;  2NOG A;  2LD5 A;  2I10 A;  4L5E A;  4FIS A;  5C44 J;  1PUF B;  1MSF C;  4FE7 A;  5F1J A;  1LE8 A;  1JUP A;  3B6C A;  3MN2 A;  4HNV A;  3W6V A;  2ECC A;  2LKX A;  4G12 A;  3JRF A;  2FQ4 A;  3JR9 A;  1JKQ C;  1IJW C;  1A5J A;  3OOU A;  3GTL J;  3HOV J;  2JWT A;  2ECB A;  3BR3 A;  3IH3 A;  3LSP A;  3A02 A;  1X2M A;  2W48 A;  2ID6 A;  4AYB N;  2DMN A;  4S0H B;  3HDD A;  2DJN A;  1EF4 A;  3TW6 A;  2JA8 J;  2L9R A;  2Y30 A;  1ETY A;  1MH3 A;  1K61 A;  5IYC J;  3M4O J;  2DMU A;  3A01 B;  2COB A;  2EZI A;  1ENH A;  2YUS A;  2EZH A;  2ZB9 A;  3FK7 A;  3FK6 A;  3Q0W A;  2XB0 X;  2JA7 J;  5E3L A;  2P81 A;  1RKW A;  2WV1 A;  1F36 A;  4BKX A;  2VKE A;  2PMZ N;  1H8A C;  1ZR4 A;  1IC8 A;  4XIC A;  1F43 A;  1WH5 A;  1ZKG A;  2K9S A;  5IP6 A;  4A3B J;  1QVT A;  5EEA A;  1HDP A;  5J1R A;  2NS7 A;  4EEF G;  1UG2 A;  3G1M A;  4MO7 A;  4A3K J;  4IEJ A;  3SJM A;  3LSJ A;  1X2N A;  2FX0 A;  1XC5 A;  2JN6 A;  4BBR J;  1PUF A;  1I6H J;  1IV6 A;  3S1R J;  1WGX A;  1MBK A;  2XPU A;  1MBF A;  2IBD A;  1O4X A;  5BNG A;  1RPW A;  3TP0 A;  1LFU P;  1QPI A;  3E7L A;  3FKI J;  2OPT A;  4JP0 A;  1Y1W J;  1ORK A;  2DMP A;  1SFO J;  1S7E A;  1ZTR A;  2VKV A;  2L0K A;  2ID3 A;  2R5Y A;  1WH7 A;  3ZQC A;  3GTJ J;  1ETX A;  3IH4 A;  3BT9 A;  4QIW N;  4QTR A;  3MVP A;  3JRB A;  1I3Q J;  4D5C A;  3MKL A;  3PO3 J;  5FKN A;  2CQQ A;  4A3J J;  2JA6 J;  2MGQ A;  1W0T A;  4RBO A;  2O8K A;  2K9Q A;  3S2D J;  4I76 A;  4NDL A;  3S14 J;  4ABZ A;  3BR6 A;  1WCM J;  3CMY A;  1HOM A;  1T56 A;  4V2G A;  3ZOB A;  2YU9 J;  4Y52 J;  1MBG A;  4M3D A;  3L1P A;  5IYD J;  4XID A;  1FJL A;  2XPW A;  3UKG A;  3WHB A;  3OSF A;  1ZR2 A;  1CQT A;  4DW6 A;  4MFE A;  1RES A;  2JJ7 A;  1I50 J;  2NVT J;  3GBG A;  2ME6 A;  5E3N A;  1RET A;  4MIM A;  2DN0 A;  1AKH B;  4FE4 A;  2TCT A;  3HGY A;  5M5Y J;  3CDL A;  4M3F A;  3S1N J;  2LY9 A;  1B72 B;  1ETW A;  2YS9 A;  2EZK A;  2NVQ J;  2K40 A;  3I4M J;  4JYK A;  2XGD A;  3JRG A;  3PO2 J;  1JTX A;  1OFC X;  1HF0 A;  1IRZ A;  1A6I A;  1ZK8 A;  1Y1V J;  2H1K A;  2DA2 A;  2LVS A;  3FIW A;  1Z0X A;  3HOZ J;  1U8B A;  2OF7 A;  3HBL A;  4FTH A;  1NK2 P;  2JA5 J;  2LK2 A;  2KDZ A;  1BA5 A;  5F08 A;  1VF9 A;  2R92 J;  1T33 A;  3JRI A;  1TWF J;  3RZD J;  2EBI A;  1HDD C;  3GTK J;  3RZO J;  2Y31 A;  3TP3 A;  4XRS G;  1IUF A;  1DU6 A;  5K7F A;  2GM4 A;  5IP7 J;  1SAN A;  1H88 C;  4MFD A;  1APL C;  4M3G A;  3F0C A;  1OJL A;  5EG0 B;  2L7Z A;  4A3M J;  1K83 J;  2GLO A;  2IEK A;  1AKH A;  1TWA J;  1TWG J;  4AUX A;  3ZQF A;  1B72 A;  1RKT A;  4D5F A;  4UUT A;  4A69 C;  3BTL A;  2RAE A;  1B8I B;  4AC0 A;  4V2F A;  5IOY A;  3JRD A;  2Y9Z A;  3HOU J;  5J3L A;  3I4N J;  5JLX A;  3JRH A;  5E3O A;  1HLV A;  4IHW A;  3SDG A;  1JJ8 C;  5F0C A;  1ETO A;  4FCY A;  1MNM C;  2TRT A;  3LSG A;  5DS9 A;  4A3L J;  4A3F J;  1YRN B;  3QQA A;  5GPA A;  3S1Q J;  4B4C A;  5M5W J;  2MW8 A;  1GVD A;  2MG4 A;  1JT6 A;  4D7N A;  1LFB A;  2CUF A;  2HXI A;  5K7H A;  4XK4 A;  5FKK A;  5J1U A;  3A01 A;  3GTG J;  5C4X J;  1FTZ A;  1TC3 C;  1QVU A;  5JLW A;  5FKL A;  3JRA A;  2R5Z B;  1AU7 A;  2Y2Z A;  5EGO B;  4IHY A;  2LP0 A;  2DA1 A;  3BTI A;  3O8H A;  3B6A A;  3S2H J;  3G1O A;  2O7O A;  3WHC A;  1ETV A;  2CQX A;  3BG9 A;  1GDT A;  1MBE A;  9ANT A;  1IG7 A;  4X1E A;  4MLO A;  4W97 A;  1B8I A;  3HOX J;  4DYR A;  3BTJ A;  3H0G J;  4M6V A;  2VI6 A;  3OSG A;  1LE8 B;  3HOW J;  3RKQ A;  1FEX A;  2E1O A;  1U9O A;  2HI3 A;  1BW5 A;  1FIA A;  5FLM J;  5C4J J;  1FIP A;  5IP9 J;  5J1Y A;  2X6O A;  3DCF A;  2E19 A;  2VPR A;  2XPV A;  4XRM A;  4BY1 J;  4A3G J;  1R9T J;  2JMW A;  3NAR A;  3PM1 A;  2E2I J;  2HOA A;  1YRN A;  3O8G A;  4I6Z A;  1TWC J;  4M3B A;  1TWH J;  3CCY A;  1UMQ A;  1NK3 P;  2DA5 A;  1OCT C;  1VI0 A;  4C3I J;  2B63 J;  1MBJ A;  4X6A J;  3HGG A;  3IH2 A;  3GTM J;  1WI3 A;  3S17 J;  2LFB A;  2XRL A;  2Y9Y A;  5EDN A;  2VUM J;  2ELK A;  4A3I J;  2XGE A;  2R7Z J;  3LNQ A;  1AHD P;  3DEW A;  2AHQ A;  5FKO A;  2NS8 A;  3K7A J;  2DMQ A;  3HOY J;  4J19 A;  1ETQ A;  4JX4 A;  3NAU A;  1UHS A;  3HKZ N;  2R5Z A;  4D7M A;  5EGO A;  2CUE A;  3RQI A;  3ZQL A;  3LOC A;  2X48 A;  1BJZ A;  2DTZ A;  2M9H A;  3Q3S A;  5C3E J;  2HOT A;  1XS9 A;  2D5V A;  1U9N A;  2HYJ A;  1XG1 A;  2M0C A;  1JUS A;  4LOC A;  2WAQ N;  3GTQ J;  3ZQI A;  4JX6 A;  3IV5 A;  3BQY A;  3HB9 A;  1HCR A;  5M5X J;  1ZQ3 P;  2L7F P;  5F0F A;  3BQZ A;  1E3O C;  2EZL A;  3OIO A;  3QPL A;  2DA6 A;  2ME0 A;  5GP9 A;  2CRG A;  4DYQ A;  2XB5 A;  2HDD A;  2R5Y B;  1IGN A;  2LR8 A;  3Q0V A;  4DZJ A;  1D5Y A;  5K7Z A;  3Q0U A;  5FLV A;  1JUM A;  3BTC A;  1FTT A;  4A3D J;  2LTP A;  3QPS A;  1JT0 A;  4CYC B;  2DMT A;  4C3H J;  2R93 J;  1JGG A;  1VND A;  5M3F J;  3S16 J;  1NTC A;  2H8R A;  1DU0 A;  2E2H J;  3JRC A;  2EH3 A;  3BR1 A;  5EYR A;  4BY7 J;  2JK3 A;  5F0H A;  2WB1 N;  3BR2 A;  5EZG A;  2LLK A;  2HOS A;  1RR7 A;  5F04 A;  3BR5 A;  2CJJ A;  3FIS A;  1U78 A;  3ZQG A;  4UUS B;  1Q1V A;  5HOD A;  3JRE A;  3TW7 A;  1JJ6 C;  4RDU A;  2FJ1 A;  2DA4 A;  3G1L A;  2KT0 A;  2FD5 A;  2L7M P;  2NVX J;  2XGC A;  2HQ5 A;  5FKM A;  3TED A;  4M3E A;  3SFI A;  5EG0 A;  5F27 A;  5E3M A;  2NVY J;  3C2B A;  1X58 A;  3ZQH A;  4W1U A;  2QF7 A;  5GPC A;  3H3V K;  2CU7 A;  4A93 J;  2M8G X;  5IPA A;  5FJ8 J;  2R0Q C;  4BXX J;  1G2H A;  3BG3 A;  3M3Y J;  2AO9 A;  1Z77 A;  1VFC A;  1MBH A;  2K9N A;  4JX5 A;  1MH4 A;  4CYC A;  2GBY A;  1IDZ A;  5DTD A;  3HEF A;  1OCP A;  4DYC A;  2M34 A;  1MSE C;  1JTY A;  2IAI A;  1GUU A;  3VPR A;  1P7J A;  1BW6 A;  1POG A;  4Y7N J;  2G0E A;  1H89 C;  3S15 J;  3K2A A;  2DA3 A;  4UUS A;  5M3M J;  4QSH A;  4C3J J;  2EQR A;  2MSY A;  2QCO A;  3BG5 A;  1JKP C;  2E2J J;  2X9D A;  1ITY A;  4A3E J;  3CQZ J;  5IOZ A;  3HM5 A;  1ZGW A;  5EZH A;  3S1M J;  3GTO J;  1GV5 A;  3BR0 A;  4BBS J;  5IYB J;  4GFB A;  2HXO A;  4XRS A;  1ETK A;  1GV2 A;  3GTP J;  1IDY A;  2Y0S N;  4B1R A;  3D1N I;  4A3C J;  2DA7 A;  2O9L A;  4IHV A;  5EF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...