2CQXA

Solution structure of rsgi ruh-034, a homeodomain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
GSSGSSGGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVRKIQCWFRHRRNQDKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-034, a homeodomain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords LAG1 longevity assurance homolog 5
total genus 10
structure length 72
sequence length 72
ec nomenclature ec 2.3.1.24: Sphingosine N-acyltransferase.
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cqxA01
1Y1VJ 2XB5A 2O9LA 2YU9J 5FKOA 2XGEA 2TRTA 2MG4A 2DMNA 1JT0A 2PMZN 2MSYA 3ZQHA 5IP6A 3ZQGA 1YRNB 1GUUA 1NTCA 1XC5A 4LOCA 3HOXJ 3LNQA 4AYBN 4UUSA 5EGOB 1UG2A 2HOTA 1Q1VA 4FISA 4XRSA 2JMWA 2TCTA 2O8KA 9ANTA 5FLMJ 5EG0A 2EZIA 3A01B 2Y31A 4MLOA 2HI3A 1D5YA 1ETYA 4W97A 1JT6A 2DA6A 2HDDA 1DU0A 2Y9YA 1B8IB 3GTJJ 1GDTA 1FJLA 4B1RA 3ZQFA 1ETWA 5J1UA 5IP7J 1POGA 2KT0A 3RKQA 2E1OA 2LTPA 5IOZA 3BTCA 2CJJA 2DA2A 2CUFA 2CQXA 2JJ7A 1TWGJ 3HOWJ 2DA4A 2ECCA 3OSGA 1UHSA 1X2MA 4A3JJ 5EZGA 3I4NJ 1RETA 2JWTA 2L7ZA 2E2HJ 1H89C 1NK3P 1MNMC 3IV5A 4A3CJ 1GV2A 1X2NA 3BQYA 3PM1A 4JX4A 4XIDA 1ENHA 5IYCJ 1ETXA 3HKZN 2LY9A 1MBFA 1BW6A 1H8AC 1ETVA 2GBYA 3VPRA 4V2GA 4X6AJ 5M5WJ 3A03A 1EF4A 4UUTA 2AO9A 4I6ZA 2DMPA 3JRDA 2NOGA 2EBIA 3HOUJ 2MGQA 5C4JJ 1U9NA 3CQZJ 5EYRA 1A6IA 3O8HA 2DJNA 5EZHA 3GTGJ 4M6VA 1JKQC 1B72B 2R0QC 3Q0WA 1AU7A 3MN2A 2LD5A 2HXIA 3S1RJ 1IRZA 5K7HA 4DW6A 3GBGA 1ETQA 5FKMA 3A01A 1U9OA 2JA8J 2R5YA 5E3OA 1B8IA 3S2DJ 1IDZA 1MBEA 3MVPA 3S16J 4XRSG 4C2MJ 2NVQJ 3FIWA 3Q0UA 2G0EA 1ZKGA 1I6HJ 1K61A 3IH3A 3GTKJ 2KDZA 2LP0A 3JRBA 3F0CA 4A3GJ 2ZB9A 1HCRA 4FTHA 4MFDA 5F27A 2P81A 1PUFB 2DN0A 3IH2A 1BJZA 3JRIA 1WI3A 2LK2A 5IPAA 5E3LA 4B3AA 4A3IJ 3FK6A 4AUXA 2HYJA 2CU7A 4DYRA 5F0HA 3QQAA 5C4XJ 5FKKA 2NVYJ 3TW6A 4JP0A 1TWAJ 2E19A 1JKOC 5DS9A 1P7IA 1HDPA 1RR7A 4A3BJ 1GV5A 2R5ZA 2E2JJ 5EEAA 1FIPA 4D5FA 3NAUA 4XICA 3G1MA 3OOUA 5IYBJ 3A02A 4A3LJ 5JLWA 2LKXA 3C2BA 1B72A 2M8GX 3JRAA 1ZR2A 1QRYA 1CQTA 3RZDJ 3HM5A 1XS9A 1RESA 4B4CA 3GTOJ 2COBA 2HXOA 4CYCB 2EZLA 1ZQ3P 2IEKA 3HBLA 2R5YB 1JKPC 5F0CA 1TC3C 5IOYA 4IHXA 2X9DA 2LFBA 3FK7A 4ABZA 2DTZA 3GTLJ 2M0CA 1F36A 5GP9A 3G1LA 2LLKA 4JX6A 5GPAA 4A93J 2XB0X 2M34A 4D5CA 3CMYA 1GT0C 1ORKA 1MSEC 2XPVA 3GTQJ 2OF7A 3LSGA 1ZK8A 4Y7NJ 3NARA 3ZQLA 2ME0A 3Q3SA 2M9HA 3SDGA 1JKRC 2Y30A 1WH5A 2FX0A 2X48A 2GM4A 3O8GA 1APLC 3WHCA 1IV6A 3W6VA 2DA3A 2K9QA 2NVXJ 4DZJA 1VI0A 1TWCJ 2VPRA 3FISA 2AHQA 2XRLA 5C44J 4QSHA 3HB9A 1OCTC 4MFEA 2R93J 2ME6A 2FQ4A 4DYQA 4UUSB 4BBRJ 2JA7J 5HODA 3BR3A 5K7FA 2B63J 2VKEA 2XGCA 1UMQA 1TWFJ 3M3YJ 3BTIA 2Y0SN 1TWHJ 4CYCA 3I4MJ 3SJMA 4M3EA 5DTDA 2ELKA 3OIOA 1LE8B 2VUMJ 2LR8A 4M3BA 1K83J 1RKTA 3B6CA 1SFOJ 2VI6A 4A3DJ 5M3FJ 4GFBA 2JK3A 1ZR4A 2W48A 2GLOA 1IGNA 1YRNA 2JA5J 3GTMJ 1S7EA 2QF7A 4M3GA 2HOAA 1A5JA 3CDLA 3BG9A 3WHBA 1IG7A 4HNVA 4DYCA 5EG0B 3CCYA 1ZGWA 4I76A 3RZOJ 5M5XJ 1OJLA 3RQIA 5J3LA 3H0GJ 3ZQIA 2IAIA 4QIWN 2XPUA 2I10A 4BY7J 1SANA 3BTLA 1LFBA 1JJ6C 2E2IJ 4M3DA 4IHVA 4RBOA 3K7AJ 4XRMA 1MBJA 3FKIJ 5FLVA 1X58A 2K40A 5FKLA 4JX5A 5E3MA 3GTPJ 2H8RA 2MW8A 3TP3A 3LSPA 3TW7A 3ZOBA 2ID6A 3L1PA 5M3MJ 3DEWA 2FJ1A 3QPSA 1WPKA 1MH3A 2L7MP 1HLVA 3BG3A 1FTZA 3LSJA 1BW5A 3ZQCA 2CUEA 2EZKA 1WGXA 3BR2A 4D7NA 4L5EA 2HQ5A 2N8GA 2YUSA 5IP9J 1Z77A 3JRCA 3TEDA 2XSDC 2XPWA 5EDNA 1XG1A 1RKWA 2K9SA 4J19A 1LE8A 3LSRA 5FJ8J 3HOYJ 2EH3A 2WV1A 1R9TJ 3SFIA 3S1QJ 4DZPA 3PO3J 2RAEA 4FE7A 5C3EJ 4A3EJ 2Y2ZA 2R7ZJ 3IH4A 2CRGA 3K2AA 4BY1J 3S1MJ 2H1KA 3BG5A 3QPLA 5M5YJ 4C3IJ 3S17J 1QPIA 3LOCA 3HGYA 4W1UA 4D7MA 5F1JA 1GVDA 5E3NA 4FCYA 1VFCA 2XGDA 3Q0VA 3BR6A 3DCFA 5GPCA 3H3VK 1JTYA 1AKHB 1MBGA 3MKLA 1FTTA 1JUSA 2Y9ZA 1JGGA 1JUPA 1HF0A 1QVUA 3BR5A 4A69C 2DA1A 3TP0A 1WCMJ 2OPTA 5F0FA 3UKGA 1VNDA 1JUMA 4BKXA 1P7JA 3JRGA 2R5ZB 3BR0A 2WB1N 3HOVJ 1ETOA 5JLXA 1HOMA 4C3JJ 2L7FP 2R92J 4IHWA 3JRHA 1PUFA 1ZTRA 1MSFC 3S2HJ 3BQZA 2EQRA 2ID3A 2EZHA 2NS7A 3S14J 3BR1A 2IBDA 2O7OA 4RDUA 5EF6A 2JA6J 2L9RA 4XK4A 1U78A 4IHYA 2HOSA 5K7ZA 2M2EA 1NK2P 1E3OC 3B6AA 3G1OA 5FKNA 4AC0A 4M3FA 2K9NA 1IJWC 1BA5A 3JR9A 1T33A 3HEFA 4FE4A 4JYKA 1W0TA 3M4OJ 5F04A 2FD5A 2YS9A 1DU6A 2VKVA 3HGGA 2LVSA 1VF9A 4A3FJ 1T56A 1LFUP 4QTRA 3BT9A 4IEJA 5EGOA 2NVTJ 3JRFA 1FIAA 3D1NI 5IYDJ 2JN6A 5J1YA 4NDLA 2CQQA 1FEXA 2DMUA 1JTXA 1IC8A 4Y52J 2DA7A 1ETKA 1I3QJ 1MBHA 1Z0XA 2DMTA 1AKHA 4EEFG 2DA5A 4BXXJ 1MH4A 3BTJA 4S0HB 1F43A 1O4XA 1Y1WJ 1I50J 2D5VA 4C3HJ 1G2HA 2L0KA 4X1EA 1U8BA 4MIMA 3E7LA 2X6OA 2DMQA 2NS8A 5F08A 1OCPA 5BNGA 4G12A 1W0UA 3JREA 3OSFA 3S1NJ 1MBKA 4MO7A 1BL0A 4A3MJ 3PO2J 3S15J 4BBSJ 4V2FA 1ITYA 1HDDC 1OFCX 3HDDA 1IUFA 2WAQN 2ECBA 4A3KJ 3HOZJ 1H88C 1AHDP 1QVTA 1WH7A 2QCOA 1JJ8C 5J1RA 1IDYA 1RPWA
chains in the Genus database with same CATH superfamily
3L2QA 4KDPA 5FKOA 2A69F 3NQOA 1JT0A 2DMNA 2F5FA 4U7DA 4A0XA 4M6XA 3AG1H 2F48A 1YHQI 3AFHA 4AYBN 1UG2A 2HOTA 1Q1VA 1R58A 2JMWA 2FBKA 4PJ0C 5EG0A 4XBFA 3CJTB 1FWZA 5AIPA 1H9GA 1TQIA 3A01B 4RB2C 2XF5A 3CLOA 4MLOA 2HI3A 4N4OB 4ESBA 1TQPA 1JT6A 1MD0A 4G6TB 2W25A 2Y9YA 1K4TA 4QWQA 3ZQFA 4QLCU 1ETWA 5E20A 4XLEA 5CVIA 5IP7J 3OYCA 1C0WA 2FMLA 2V26A 2BY3A 3OYFA 3SEQA 2DA2A 2CUFA 2CQXA 2V1DA 3ABUA 1D3YA 3NWTA 5DEQA 3CCMI 1X2MA 4A3JJ 1SVMA 1YE9A 1D8KA 2OQRA 4WK8F 2M7BA 3I4NJ 3OV8A 1RETA 4PJMA 3TL4X 2JWTA 2L7ZA 4XL9A 3T0YA 2GA1A 2M4KA 4U87A 4CCMA 1YIOA 5H6RA 3EQLF 2LY9A 4YELA 3R0AA 5H20A 5DD4A 5DCMB 2VE8A 1G3TA 3K10A 3OYKA 5ERIA 3GO5A 3O2PE 2QSGX 3BG6A 1SMTA 1KONA 1SAXA 2AO9A 4I6ZA 2DMPA 2MGQA 3A2KA 3GUDA 1U9NA 4BU2A 4KT6A 5EYRA 4E7JA 1Z7LA 3K4KA 2DAOA 1OYWA 4M6VA 1ZARA 4M72A 2ELHA 2R0QC 3I58A 3MN2A 2LD5A 1BIBA 1FSEA 5J8FA 4UHTA 2P5LC 3A01A 5KK1A 2W82A 1UFMA 2IA2A 1FNNA 1IUYA 1BI3A 1U9OA 4KMFA 3PNVA 3GYHX 4IOAF 5HDKA 1R1VA 4PJNA 1MBEA 3S8PA 1RIOH 3MVPA 3S32A 3V7SA 4F91B 3ROUA 2AXTC 3HPGA 5E1XA 4G8XA 1KYWA 4BYYA 4IJAA 4YFXF 2IS4A 3BDDA 3ABTA 3IH3A 3RTRA 1VQ7I 5CVJA 1UCRA 2OCCH 1YX5A 3F23A 2P81A 2M45A 5E8IA 1LDDA 5KCMA 3IH2A 1ZG1A 2BYVE 1VTNC 3PNTA 4EM0B 1XGNA 1YJNI 2QEXI 2LK2A 2K3PA 4XLHA 5E3LA 2ELJA 2V79A 3FXQA 4AUXA 1PUEE 4RAFA 4ZYEA 4ZYDA 2NOJB 2HDCA 2HDWA 4KMUX 2KDOA 2VJ5A 3PQKA 4XSZF 1LUJB 1P7IA 3HPHA 4A3BJ 2CQ7A 4LITA 4WXHA 5EEAA 4PCQA 1OCOH 1YS6A 2W00A 2ZXIA 3GW2A 5IYBJ 3FDYA 2WWYA 1U2WA 2RNGA 3QAHA 1P6RA 2QZ8A 4HQMA 4XSXF 2GAUA 2DQLA 2OAZA 2G7UA 2M8GX 2ZFWA 3JRAA 1QRYA 2OTJI 2XAQA 3HM5A 3CJQB 3X2QH 2COBA 5F6FA 2HKOA 4CYCB 3I5UA 2H09A 2L9NA 2MD0A 2BW3B 2CG4A 2YX7A 5F0CA 4I02A 1TC3C 5IOYA 1B9NA 4IHXA 3EPZA 2LRDA 3TDUC 2Q8KA 2RQQA 3GTLJ 2DTZA 3J7AY 2M3AA 4NNJA 2PEXA 1X1BA 2ISYA 2GIZA 5GPAA 1S6LA 2QA4I 2K4BA 3WTTC 3OMYA 1DP3A 4D5CA 3CMYA 3MFKA 3BJAA 3CP2A 5DM6F 2M30A 2XPVA 4EATA 1ZLJA 2O03A 3HOTA 2L3DA 3E3VA 2QGUA 2DDAA 3P7NA 1OKRA 2ME0A 3Q3SA 1YITI 3H5AA 2FX0A 1MMAA 2RREA 2X48A 1S8NA 1Y39A 2RDPA 4XM3A 1IV6A 2K9QA 1T08B 2B0LA 1ZAOA 3DBLB 1VI0A 3E5XA 1TWCJ 3VYUB 2VPRA 3FISA 4A2UA 3V8LA 1U5TC 3JTHA 1JI8A 1UHWA 4BQOA 4KISA 5C44J 4QSHA 2IGOA 1OCTC 2X1CA 2E7XA 4DYQA 3HRSA 3G2BA 4BBRJ 1N78A 3U1DA 5FROA 2B63J 3CD6I 1TWFJ 2G9WA 2YSRA 2FBHA 2Y0SN 5KAIC 4CYCA 3I4MJ 3V42A 5DYMA 1LDJA 3HXLA 2EB7A 3FX3A 3OIOA 5DTDA 4DIQA 1LE8B 1ON2A 3HSFA 2VUMJ 1OQYA 2A61A 5B1AH 4XQFA 3GCMA 3EUHA 2PX9A 4IRIA 2L01A 5M3FJ 2DOFA 1ZR4A 2GLOA 1WFXA 1YS7A 5BQTA 3RCOA 5CYVA 4MNUA 3AG4H 4XKCA 5EG0B 1H9TA 3L2VA 3RZOJ 3KEOA 1OJLA 3F8MA 4UV9A 4A6DA 3ZRGA 1IRXA 1R4MB 1USTA 2IAIA 3H0GJ 1TTYA 1FP1D 2XPUA 3VSLA 5CLSA 4EM1A 2A07F 1LFBA 1PP8F 4GGGA 2DO7A 2EILH 1V4RA 4RBOA 1GXPA 5K5OA 4Y15A 1RR8C 3G71I 1MBJA 2NAZA 2WAFA 3OS1A 3HRMA 2H8RA 3H9JA 1TT5B 2MW8A 2X1EA 3QYFA 4G94A 2ZMEA 5KNLA 4BDZA 2OJED 1HA8A 2NXNB 1X4PA 1W1WE 4BS9A 4UV8A 2XKOA 5M3MJ 3AG3H 2FJ1A 3QPSA 4RB1A 1XSVA 2BV6A 5B5EC 3BG3A 1WJAA 3WE3A 1WRJA 3LSJA 2AXLA 2XC7A 1HC8A 2NYXA 2W7NA 3B73A 1D0YA 3IKVA 4L5EA 4A6EA 2UZKA 3U21A 1WJBA 1FBQA 3WTZA 4OMYA 3CMAI 1Z77A 2LKPA 3F6VA 1FMWA 4EMSA 2LC2A 4KIBA 3QYBA 1R71A 1MMNA 2XPWA 3FKJA 1XG1A 2NRAC 2Z99A 1JGSA 1AWCA 2QQ8A 3LSRA 4NUBA 3PL8A 1V54H 3J7ZI 4ESJA 4EJUA 3SFIA 3S1QJ 4KICA 4FX0A 2XHKA 2V4JC 3DPLC 5EEGA 4FE7A 2Y2ZA 2R7ZJ 2CQKA 4LG0B 3SDBA 3QWLA 5KVRA 2VQGA 2QQ9A 3VYSB 4BY1J 5DDGA 1J5YA 5LLQA 1HSTA 2X1DA 3QPLA 2EA4A 2ZJQF 3FZVA 3ULQB 2H1KA 3LOCA 5F1JA 2JRMA 1VFCA 4JOMA 3H3VK 3CC4I 1AKHB 1ZRDA 1QGPA 1MBGA 3I64A 3TO9A 2J5PA 2IP2A 3BR5A 3MMYB 2ZJRF 4L5JA 3TP0A 5IT9Z 4KJZA 5F0FA 1VNDA 2V9PA 1SAUA 1P7JA 2ZMEB 3L2RA 1WHUA 1YJWI 2HYFA 3WODF 4R8HA 5JLXA 2L2OA 2R92J 3JRHA 1ZTRA 3OYMA 1S72I 3BQZA 2EQRA 5K1YA 2EZHA 4ENJA 3S14J 3I9V2 2QUFA 2O7OA 2WTEA 5LEJA 1V55H 4HX8A 2O5RA 1T8IA 1XGOA 3ZMZA 3I4PA 4LG3A 2STTA 1S9HA 1YJ9I 3B6AA 1QZZA 3F6OA 3G1OA 4XKWA 5HLGA 2JZYA 3JR9A 6PAXA 5FLXZ 3E6BA 3M4OJ 3BP8A 2E5ZA 3F72A 2YS9A 5LGUA 2JQ7A 3HGGA 1T56A 4LK0F 1TW2A 4IEJA 3K9TA 3ASOH 5EGOA 4UNOA 2BHZA 3J7YJ 2R7RA 5IYDJ 4I98B 2XUBA 2FBIA 4NDLA 5J1YA 4OAYA 2YU3A 2DMUA 4M9ZA 5LGNA 4LB6B 1R7JA 4Y33A 3GZ6A 2DA7A 2FQ3A 3FM3A 5GAHJ 1G3WA 1I3QJ 3ZN0A 1KYZA 3SQNA 5FFXA 1D1CA 3K4JA 2Q2EA 5J6XA 3CC2I 1MIJA 3VYRB 1Y1WJ 2UV1A 5D5XB 3ZP5A 3F8FA 1G2HA 4M73A 3C7JA 1MMDA 2HR3A 4IZZA 1OCPA 1W0UA 2TDXA 2H8WA 3ZQQA 4A3MJ 3F8BA 3PO2J 4BBSJ 5D6EA 3SHFA 1ITYA 3I56I 4BHPA 3EETA 4P1WA 1XB4A 5JHFA 3HDDA 3MKYB 3H92A 2XRNA 2CW0F 4RA2A 4KYWA 5CVVA 3G73A 2ECBA 3SZGA 3HOZJ 4ANJA 4IHTA 4RM3A 3ISPA 2RN7A 5L3GA 1WH7A 2QCOA 4HA8A 2VKDA 5J4YA 2XB5A 2K3FA 1OISA 2O9LA 4LLGF 1DUXC 2ZMEC 2R7VA 1SD6A 2MSYA 1MJBA 3LNQA 2DJIA 1FZPB 4G9YA 4UUSA 9ANTA 2MLKA 2IW5A 5FLMJ 2KRCA 2Y31A 3PSIA 4RAZA 1IN5A 4W97A 5D4SA 3CCVI 3RJPA 3KYLA 2IA0A 2Z16A 3GTJJ 1YFHA 5J1UA 5TJJA 1WJ5A 4EJTA 1LQ1A 4FETA 3EUHC 3K4MA 1Z1DA 3BY6A 3ZCOA 3P9CA 2DA4A 1FBSA 2IGMA 1J7KA 3R61A 1KQ0A 3OSGA 1YIJI 1FLIA 2KHMA 3J7AO 2W85A 1T98A 2ZSIB 4QPOA 2VQHA 2EFWA 4A3CJ 3H3ZA 4IL6C 4YEJA 1GV2A 1X2NA 2Z9OA 4JX4A 4QPQA 4L9JA 4BGDA 2OCEA 4XRFA 4BHBA 4DQ2A 1Z21A 4CICA 2V6CA 3DKYA 1ETVA 2GBYA 1B59A 1EH8A 3DEEA 3VPRA 4V2GA 4Q5SF 2BBYA 3FF5A 1EF4A 2ZXJA 2BE5F 2DFIA 1XCBA 2EINH 3W6KB 2DI3A 3JRDA 2R7QA 2L02A 2ETHA 2ZXHA 4U88A 1UZCA 4H4KC 1EKEA 5F1RA 5DUKA 1WJCA 4FT8A 3TBIA 4GDFA 2DJNA 2P4WA 3DBHB 1JKQC 1QZYA 2VODA 3Q0WA 1AU7A 4TV7A 1WVRA 1MZBA 4D0PA 2QM3A 2EA2A 2P6TA 3CO7C 1ETQA 2Y48A 2R7WA 2PJRA 2MBFA 4PZJA 1OYYA 3E97A 3GF2A 3F9KA 3BROA 2NVUB 3BLYA 2DK8A 3FXUA 2IJLA 5E3OA 1IDZA 4YFKF 4Q4ZF 2G7HA 3K4LA 2VXDA 3S16J 1QHGA 1W5CC 4C2MJ 5CKTA 2AQEA 1EH7A 4HSTA 1PJRA 5DCFA 4J00A 2FOKA 1G3YA 2P8TA 2NVQJ 2XV4S 4DBRA 3D5LA 4CHUA 2BXZA 3ZN1A 4Q47A 4ZDLA 2JT1A 4BDYA 4L18B 3MKZA 2LY1A 1XGMA 3F0CA 1K7AA 4A3GJ 4FTHA 1FOYA 5LHHA 3TMOA 1K6OA 3JRIA 4I0AA 3PIOF 4CZZA 3ML6A 4L5IA 5LRRA 2BY1A 4RB0A 3ZQ7A 2EFQA 1IN8A 1O57A 4B3AA 4P9UA 2KKOA 4R79A 5E1WA 1SC7A 3BG7A 4LFUA 5C4XJ 4EJOA 3KLNA 4GRIA 4M71A 4JP0A 3H9QA 3LMMA 1HDPA 2BVLA 3F22A 4ENMA 2OQGA 2E2JJ 1RI7A 3QPHA 1RUOA 4LGWA 5LFAA 3NAUA 1MDMA 4EGZA 1MNEA 3VWBA 2MABA 3KP2A 3OOUA 1UELB 2MA3A 4IF4A 5JLWA 2IS1A 3DBRB 4LMYA 2LKXA 2BEOA 4PSWA 4DBQA 4YIRX 3LSMA 4XMYA 3J81K 1BBYA 3B02A 1CQTA 2CV1A 5FB2A 5E17F 3CJRB 3WTXC 2ICWG 3GTOJ 2I5UA 5TISC 3CF2A 1XMAA 2KQRA 2PJRB 3FWEA 2HKXA 2XKPA 3JSOA 2V1UA 3L2CA 4E7IA 3HBLA 3OIPA 2F5EA 2Y0SA 1FX7A 1GXQA 5ICCA 3ERED 2X6XA 4K2EA 4MQ9F 2X9DA 1AA7A 3FK7A 2LNBA 5JR3A 4ABZA 4KIFA 1FY7A 5GP9A 3DFGA 2Z1DA 2M1BA 4WCGA 4XLAA 1SVLA 1QHHD 4H0EA 3SZPA 2RKHA 1WI9A 1R6RA 3RYPA 1OCRH 4OAZA 3QRFF 5HLIA 2OF7A 3ZMTA 4BEHB 1ZK8A 1PP7U 3LA3A 3SDGA 2FXAA 3K6GA 3OYJA 1WH5A 2X85A 4XR6A 2PI0A 3WTYC 4I7HA 3AL0C 3O8GA 3TKYA 3W6VA 5JFRA 2R7TA 2LSOA 3WG9A 4Y4RA 1K78B 2STWA 5H6QA 1P4XA 3U9GA 2GOMA 3J80Z 2UUZA 1BC7C 1ZGAA 2R7FA 2AHQA 5CPRB 4OIPF 1ZLKA 3NRVA 1Y6IA 4HZFA 3Q5FA 5L3CA 4F52A 1IRFA 2ZFUA 4OWRB 4CO8A 2XDVA 1MGTA 3OYLA 3BR3A 1KU7A 1WJEA 2YR2A 3K4CA 3OR2C 1VQ5I 1FT9A 2LG4A 2BZTA 3M9AA 3AG2H 2HNHA 4DJAA 2ISZA 3C2HA 2HVRA 2PG4A 1VQ8I 1HBXG 3JSPA 3P9IA 4RGUA 4CCJA 4M3EA 2FE3A 4G6DA 3QU3A 1L3LA 2LR8A 3CTAA 3KP6A 4B44A 2KIUA 2ZC2A 2OA4A 5LHGA 1QBJA 3QYEA 1RKTA 1Z3XA 2VI6A 1Z7UA 3G4SI 4GFBA 1IV8A 2JK3A 1IN7A 1QA6A 1I6XA 1IGNA 1A6QA 2JA5J 3GTMJ 3REOA 3I55I 2QF7A 1DGRM 4E7HA 1R5HA 3BG9A 2E71A 3WHBA 2PLYA 4PGHA 4HNVA 1OCCH 4DYCA 2J5OA 3F8NA 4HAMA 3DV8A 4I09A 5J3LA 2A5YB 1QNTA 2LREA 4LB5A 4RMNA 4QIWN 3LA7A 4UUVA 2L9SA 2VJ4A 3T8RA 2EV5A 2D45A 3RKXA 5AONA 3A0HC 1LDKB 4II3A 1F4KA 5FLVA 1X58A 3CMMA 1E0EA 1A04A 2KIQA 4JX5A 3Q9SA 1OPCA 2HGCA 3GFMA 3M8JA 1J0RA 3SYTA 1K78A 1TNSA 5GADJ 2DW4A 2QBYA 2Q1ZB 3ZOBA 3V7RA 3FM5A 4BUPA 5L3FA 3RIRA 2IXSA 4ON0A 3ABLH 4ZTFA 5FO5A 1G8XA 4ZH4F 3ZQCA 4IO9F 2ZXWH 1WGXA 3BR2A 3CZ6A 3LWFA 2IGKA 2FSWA 2N8GA 2KPMA 4BE1A 4O5VA 5IP9J 4OU0A 1X1AA 4C30A 2OUMA 1T2KA 2F6CA 5BS6A 1KU3A 4ZYGA 4HV5A 3I0TA 1LE8A 5F64A 2H94A 5FJ8J 4AD9A 2XAFA 4B09A 2VKHA 3A1YA 5DUIA 3Q9VA 4DZPA 3AAFA 1I27A 2LBFB 3MZHA 4LLLA 2QYOA 4RB3C 2CRGA 2PQ8A 4XN0A 3DF8A 1WKMA 4ZC3A 3IUOA 3K1NA 5JVGF 3W2WA 1A31A 1FSHA 4KN4X 5M5YJ 4BE0A 4PJLA 2XIGA 1KZHA 3HGYA 3GFLA 4D7MA 3K0LA 3Q0VA 3BR6A 1W5SA 1W36D 1JTYA 5D8LB 2EFOA 3RPQA 3MKLA 2QWWA 1JUPA 2HS5A 4B8XA 4G7HF 3ZR8X 2ZJ2A 4HLXA 1B6AA 1E2XA 3QU6A 3GFIA 1YYVA 3FXRA 1W7PB 3JW4A 3JCUC 2QBYB 1FC3A 2DQRA 5CQGA 5HDNA 5LRSA 4MEXF 1AOYA 1ZN2A 2M7AA 2MLGA 1HOMA 3CC7I 4C3JJ 2L7FP 2JSCA 2E35A 2UXXA 3S2HJ 3PFIA 5LEKA 2PBIA 2HQRA 5KHDA 2NS7A 2QENA 3BR1A 2L5QA 3SFZA 3CCUI 2XAJA 3HRTA 3IWZA 1X3WB 5J47A 5BPDA 2JA6J 2L9RA 1BOBA 3O3KA 4XK4A 3LQQA 1BI2A 1U78A 4XONA 4YIFA 3G3ZA 2E5NA 2M2EA 1ULYA 1E3OC 2F4IA 2LOOA 4HSRA 4M3FA 1BA5A 1S29A 3OYHA 3HEFA 3HHHA 4MHGA 1P4WA 5F04A 2VKVA 1ACIA 4IPAA 4LIVA 1LFUP 1MW7A 1IXRC 2DU9A 3BT9A 3GLXA 2BHYA 2VC0A 3JRFA 1YOVB 3L2WA 4KN7X 4GO1A 4LG0A 2VASA 2X51A 3OS2A 4HPQA 1B4AA 3VDXA 1JTXA 5FGMA 4Y52J 4HNUA 2HU9A 4AIDA 2ACJA 5EJCA 1MBHA 4AWXB 4NBQA 2DYRH 2DMTA 1AKHA 4RAYA 4B3XA 1SD4A 3S3NA 2WBMA 2F4MB 5GTHC 1NHAA 1YTYA 4HF2A 5LGTA 3C3WA 2X6OA 1T0FC 3UNGC 2RGVA 2F2EA 3EDPA 3CDIA 4BQNA 1QU3A 4G12A 3EYIA 1OR7A 1O3SA 2M8EA 3OWTA 3H36A 1N77A 1MBKA 4MO7A 1BL0A 4OIQF 1MMGA 4RM2A 4V2FA 1TZLA 1XN7A 4BEHA 3BZKA 4M9XA 2RQPA 3OL4A 5ICGA 2XASA 3K2ZA 1HDDC 4RGSA 1OFCX 2L9VA 1U6GA 2I8DA 3BPXA 4A3KJ 1LVAA 3KZZA 1L0OC 2O3FA 2X6YA 4EQQA 3WTWC 2ZO4A 2XAHA 3CMEI 3DEUA 3K1PA 3L7WA 2P6SA 1LKXA 2TRTA 2D1VA 2MG4A 2QSHX 2KFDA 2PMZN 3RPUD 3ZQHA 1TL8A 1YRNB 3R4KA 1GUUA 1NTCA 3GVAA 4LOCA 4AVZA 3HOXJ 2PMHA 5J4VA 2E1MB 5EGOB 1VQ4I 2O8KA 1Z6RA 2TCTA 4KT5C 3QP5A 2KZVA 4XORA 3ZGKA 2EZIA 4N9HA 3GZNB 1D5YA 1ETYA 4I99C 1G4DA 2E7WA 3MQ0A 5HLTA 2HDDA 1DU0A 1B8IB 2R7OA 1T6SA 4EJVA 1FJLA 4B1RA 3QOPA 3V8KA 2E1MC 3M1CA 1NG6A 1I3AA 1KU9A 2H1LA 1POGA 2VL8A 3KP7A 3K69A 2Q2EB 2QKMB 4AM3A 4RS8A 3LSIA 2NNNA 2LTPA 5IOZA 4KA4A 1YW7A 3I53A 5D8KB 4E7KA 2H27A 4L0ZB 3WTSC 1TWGJ 1W7PD 1TBXA 2ECCA 2JRTA 3GFJA 2WAEA 1UHSA 2VBZA 3NEUA 5EZGA 2Y75A 1IO2A 5FFZA 5GTIC 1R1UA 1NK3P 5TRDA 2EPFA 4C2UA 3BQYA 3PM1A 4I01A 1ENHA 5IYCJ 1ETXA 4Y17A 2PMZA 1GHCA 2HQNA 1DPRA 3HKZN 1H8AC 4HX4A 2PN6A 4A5MA 1H0MA 5HS8A 5FLXK 3VYTB 2FF4A 4F93B 1YG2A 5M5WJ 4HF0A 3A03A 1T0FA 5HOOA 1SD7A 4UUTA 3V4GA 2M5WA 5FD6A 2GXAA 1ZHFA 2VOPA 3HOUJ 2EIKH 2R4GA 1XTAA 4P5OA 3PFYA 1I1GA 1R1TA 3O8HA 5EZHA 3GTGJ 3HL2A 1BM9A 4HV6A 3R6SA 3FXMA 3DLLF 2HXIA 1IRZA 1N25A 1VZ0A 2CO5A 4DW6A 2XSJC 2VE9A 2K27A 4CXFA 1K4SA 3KE2A 1K79A 1FYMA 5FKMA 4IRHA 5ICEA 1PVEA 2EIMH 2HTJA 2JA8J 2R5YA 3O6BB 1B8IA 3S2DJ 1YX3A 5B66C 2EFNA 1B9MA 2DT6A 4XRSG 4PGGA 4J01A 5IT9K 5ICFA 3W2AA 4HDUA 2K02A 1KQ9A 2NS0A 1WQ2A 1XDUA 2JPBA 1BR4A 2XROA 2VT2A 3Q0UA 2LBFA 2G0EA 4M74A 1HSJA 1RNLA 1USSA 1ZKGA 1KQ8A 1I6HJ 1K61A 2K7LA 1O3QA 3NWSA 1FOWA 3VFZA 3GTKJ 2LP0A 3JRBA 1XX5A 1LNWA 3WE2A 2ZB9A 1HCRA 5F27A 1PUFB 2A5WA 4GCVA 2V7FA 4OIOF 3HRUA 1BJZA 2KRFA 2PMUA 4N0BA 1WI3A 1X3ZB 1RRJA 5IPAA 3FK6A 2HYJA 2CV0A 5F0HA 3QQAA 2LF7A 5FKKA 5ED4A 3TW6A 3N4MA 3K70C 3ASNH 4L0YB 3OIQA 1ZYRF 1RR7A 3DQVC 1JXSA 1MJAA 4WWCA 2CQNA 3BPVA 4U0YA 3S3MA 4D5FA 1UG0A 3ZXSA 3KIOA 1FOXA 4XICA 1UHMA 3HZJA 2XAUA 1BI0A 2R7XA 1YI2I 1BC8C 5GAEJ 3E5QA 4CZCA 4A3LJ 2CS3A 2A6HF 3R0JA 3WTUC 3C2BA 3KLOA 1G6NA 3DPUA 2EFPA 4WXDA 1LPQA 2W24A 2MC3A 1E17A 1R5GA 3EYYA 3CCLI 1XS9A 2DOAA 2AS5F 1KU2A 3DTKA 2HXOA 2EZLA 1Z67A 3KYCB 1CF7A 4AVPA 1SVOA 2V6EA 2LFBA 2COMA 4JK1X 1LEBA 1W4MA 3ONQA 4CA0A 4XOTA 2OC6A 2M0CA 1F36A 2K5CA 4NQWB 3KEQA 1U3EM 3FMQA 1PYVA 1R4NB 3G1LA 3VODA 4JX6A 1LB2A 1P92A 2GA2A 5L3BA 2RVCA 1MSEC 4L9TA 1NH3A 3GTQJ 1J2XA 1FOKA 2Z33A 3HYIA 4B43A 3V7CA 2M9HA 4RLFA 4IXAA 1JKRC 2LDUA 1BJAA 4G7ZF 3S2WA 2GM4A 1APLC 3IC7A 3VSKA 2BY2A 2DA3A 2NVXJ 2F5DA 2HVQA 4BAYA 2OD5A 1STZA 2CW7A 2DK5A 2K9LA 3KPHA 4ZDOA 2CUZA 3BCBA 4HYEA 5DD8A 4RLQA 5K5QA 2R93J 2ME6A 2FQ4A 3L00A 4PK4A 4CYDA 1ZG5A 5D4RA 2Z5UA 4U0WA 1CGPA 4Y3OA 3MD2A 4ESFA 4BXFA 1UJ8A 4MQVA 4ZDPA 4ZZLA 1Z91A 2K85A 3RI4A 2VKEA 2M87A 2HTSA 3GEZA 1UMQA 2ZNZA 3M3YJ 2VT3A 3BTIA 2QQAA 2XAGA 5LD2C 3LQRA 1BOAA 1TWHJ 2IGNA 4HNTA 2UXNA 2DYSH 4IQ4A 3SJMA 2ELKA 1D0ZA 3L09A 3C18A 5K5RA 3BZCA 4XLNF 3WGGA 3B6CA 2FMYA 4A3DJ 3MCZA 3LSKA 4BQAA 4UXNA 1YRNA 3DXJF 5ILSA 4M3GA 2DFFA 4O6JA 4XKVA 3LAPA 3H1CA 3CDLA 2HEOA 1IG7A 5EEHA 2A68F 2GQQA 3CCYA 1ZGWA 4I76A 3ELKA 5A2QZ 4D1QA 4A0YA 1GLNA 2I10A 3BTLA 1JJ6C 2E2IJ 4M3DA 3IWFA 4IHVA 1HQCA 2DFHA 3T1BA 2DCEA 2LF8A 3DTEA 2ESHA 3IRQA 1FP2A 3CUQA 3RYRA 5FKLA 1VQMI 4KUMA 1TP4A 4HW0A 3TDZC 2KIMA 3E6DA 3JAMZ 4MTDA 2WAQA 3HSRA 2IRFG 2ID6A 4FQGA 2VJJA 2WV0A 3OYIA 2IA1A 2VBXA 3DEWA 4I2OA 4F92B 2X6WA 2KL4A 1WPKA 3HSEA 4KIGA 2KLOA 3E6CC 1HLVA 1FTZA 3CUQC 1BW5A 2PJPA 2EZKA 2W84A 3KX2A 4D7NA 2KMUA 2FRHA 2L54A 3FXLA 2YUSA 1ON1A 3DU5A 4LJZF 2Z3YA 3SXYA 2BVMA 3ESWB 4P96A 5BMZA 1ZRFA 2FU4A 2W57A 2A6EF 1RKWA 4MTEA 4J19A 3HOYJ 2EH3A 2FUG2 4NC7A 1ERDA 2KJCA 2RAEA 3BZ6A 4GXOA 3DU6A 4CCNA 4CSWA 4ZYHA 5C3EJ 4A3EJ 1F5TA 1Y0NA 3K2AA 4FASD 3HUGA 3BG5A 2QLZA 2A3SA 4FX4A 1HKSA 4RGRA 2A6TA 5FRNA 4BH9A 3PSFA 4W1UA 4FCYA 5E3NA 1QPIA 4B48A 2XGDA 4N9IA 3FMSA 2OBPA 3FMRA 1JUSA 1VQOI 1J59A 1HF0A 4Q48A 1QVUA 4YIIA 2V1NA 3LAJA 1OMIA 2H6CA 3UKGA 5A2QK 1JUMA 3MKWB 4BKXA 1RC9A 3BWGA 2R5ZB 3OYEA 3DKWA 3BR0A 1ZG3A 2WB1N 2YPRA 2OU2A 5IT3A 3CCQI 2HOEA 1R23A 3E5UA 1BR1A 2LKSA 1EJ9A 2VPLA 2EV0A 2QSFX 4OMZA 1VQ6I 3K1MA 2W1OA 4IHWA 2HWVA 1MSFC 2CV2A 3OYGA 4BNCA 5HS9A 3J81Z 2JTVA 3DKXA 2MC4A 2B9SA 1ZH5A 2P5KA 3HG9A 3PJRA 3I59B 3H0DA 1ONVA 3BJOA 5JI6A 2HOSA 3ECHA 3H3UA 3T5XA 2BW3A 2V1XA 2RC4A 3WG7H 5FKNA 3WGIA 1DDNA 2K9NA 3CF5F 2K9MA 2ZKZA 4MGRA 1D0XA 2DDBA 4FE4A 3W2VA 2HPMA 1DU6A 2FOWA 2JUGA 3VEPA 1SFUA 2LVSA 1VF9A 1G3SA 4R1HA 4A3FJ 3K70D 1BR2A 2WADA 4QTRA 3KETA 3I54A 1XMXA 3LSHA 3BOQA 1TQMA 2Y69H 3FHZA 3D1NI 1K6YA 3ZMSA 2GIVA 2HFHA 2V9KA 4PFOA 2CQQA 3E1SA 3M7GA 1FYKA 3GXOA 1FEXA 4HDVA 1Y56A 2CW8A 3K4BA 1YO5C 4U7BA 4BHCA 3P5JA 3GWZA 2R3SA 1T39A 1W5TA 4UVBA 1Z0XA 5AIQA 1IN6A 3S3OA 3DP7A 2OTLI 2K4JA 3TO7A 1X3UA 2E36A 4MEYF 1MH4A 3BTJA 3BC8A 1F43A 4ZZDA 1O4XA 2V9VA 3IRRA 4C3HJ 4AIHA 1HKQA 4X1EA 1W7PA 2NS8A 1MKMA 1KGSA 5F08A 5BNGA 4IRGA 1OYIA 1HXDA 3JREA 2VXZA 3OSFA 2R7SA 3IHUA 1BIAA 1Y8RB 3S1NJ 3G6EI 1T95A 3S15J 2Z2SB 4A5NA 3LA2A 4ETSA 3FXJA 1JHHA 3GMEA 1A35A 3I71A 1DGWY 3C1DA 5DM7F 3HTUA 4XLCA 4D9JA 1XCVA 2WAQN 2X4HA 3KP5A 4HLYA 3S93A 3FHNA 1X4OA 3CO6C 4E7ZA 1KA8A 1AHDP 5CJ9A 1LEAA 3VB2A 5J1RA 1IDYA 1HKTA 1Y1VJ 4GYIA 2YU9J 2XGEA 2VBYA 4DOZA 1SFXA 1V5EA 3MAJA 2P7VB 3ZQGA 5IP6A 2DXIA 1XC5A 3WGHA 2MFZA 3H35A 3T8TA 1UB9A 1DP7P 3HIFA 1WZ2A 3MEXA 4XRSA 4FISA 2F5CA 1OLTA 3MZ8A 5D5WB 2PFBA 1V5FA 2ADUA 1N75A 2DA6A 3LFUA 2P7CB 4IHSA 2P5VA 1ODDA 2VQCA 3HKZA 4HBLA 1GDTA 5GAGJ 2O8XA 3KCCA 4DNCA 4O3MA 4P55A 1TNTA 2KT0A 1U5TB 3RKQA 1BI1A 1S3JA 4ZYAA 3DPTA 4EV0A 2E1OA 1IZ1A 3BTCA 2CJJA 3PQJA 5HNHA 3OYNA 4PSXA 2JJ7A 3RKWA 3PUBA 3QODA 2QQBA 3HOWJ 3EUAA 1ZREA 2QVOA 1IN4A 1XMKA 1VQNI 4XNFA 4BL0B 4A12A 1IF1A 1Y0UA 4Y13A 4ENNA 4BJTA 2E2HJ 2WY7Q 1H89C 2VC1A 1MNMC 3IV5A 2IS2A 4WF2A 1SD5A 3TOBA 3ECOA 3L9FA 4XKBA 3OYBA 2RNJA 4XIDA 3GX4X 1VQLI 4S05A 2JA2A 2LH9A 3IP4B 1MBFA 1BW6A 1IXSB 1R22A 3IAS2 2M4GA 1J75A 4OIRF 3CUQB 2KZGA 3SZTA 3MWMA 4F7ZA 4X6AJ 2BGCA 2JVGA 3AKZA 3A0BC 4PDKA 1P4AA 3ABKH 1MJ9A 1EH6A 2EBIA 1SMYF 2NOGA 4F3QA 5C4JJ 3KP4A 1O7FA 3CQZJ 1A6IA 2VB6A 1SFEA 3U1KA 4ITVA 2O61A 1B72B 2MH2A 1B1BA 2O0YA 2R7DA 2XF7A 2FEZA 2RV8A 3HJEA 2WA0A 1DQUA 2DFEA 1U8RA 1WWXA 4OOIA 5LHIA 3S1RJ 5K7HA 3R60A 3GBGA 1Z3YA 5J40A 1XDSA 2EV6A 4E7LA 1WSUA 3OOPA 2A05A 3CCRI 2VBWA 3P9KA 4G6QA 3FXOA 3CDHA 1GVJA 2CFXA 2MYSA 1F1ZA 3N05A 2WC2A 3M1EA 3TOAA 1D1BA 1TLHB 4PUSA 3PNYA 3TQNA 3FIWA 3ZMDA 5BOXA 3IL2A 3F8CA 2P0WA 1HW1A 2KDZA 4ENKA 3OR1C 4MFDA 1OCZH 2JUCA 3RSNA 2D1HA 2DN0A 3LL7A 4E4HA 1F9NA 2EJRA 3COAC 1MNDA 4C2TA 1NG7A 2XGXA 1R00A 4JBAA 4A3IJ 3KEYA 3IAM2 2CU7A 3PUFA 3WU2C 4DYRA 5HDGA 2VQLA 2W4SA 2JPCA 3M07A 2EIJH 2NVYJ 1M1EB 2GWRA 1TWAJ 2E19A 1JKOC 5DS9A 5HS7A 1Z6TA 3JTGA 5H2FC 3FBIB 3ZMUA 1OR7C 4EJWA 1GV5A 3V8JA 2R5ZA 2CUJA 3WU0A 1FIPA 3M8EA 4E7SA 3ZPLA 4IKFA 3G1MA 3A02A 3ZMVA 1FYLA 4HQEA 4HX7A 1HW2A 1B72A 4XLPF 2VLAA 4EGYA 2ESNA 1LFPA 2OV7A 4GYGA 1IW7F 1ZR2A 4RGXA 1WJDA 4XN3A 3JAMK 1YQAA 3RZDJ 2VJIA 3I59A 2DOEA 1SEUA 1RESA 4B4CA 5TGTA 2L4MA 4YRVA 1U0JA 2ZNYA 3KFWX 1ZQ3P 3U2RA 2IEKA 4AU7A 2Y0MA 2R5YB 1JKPC 3FXKA 4AIKA 4XOPA 4M9SA 2M0MA 4UVCA 2HPIA 4B47A 1I1SA 4A0ZA 2EWNA 3BCAA 4DGWB 2LY2A 2LLKA 4A93J 2ZBKA 2XB0X 5HNFA 4NC8A 3C2GA 1V3FA 4Z6YA 2M34A 2GZWA 2E1NA 1GT0C 1ORKA 5CVUA 5D5VB 4BJ6C 1FMVA 3LSGA 5E8GA 4Y7NJ 5HLHA 3NARA 4HRIA 3ZQLA 4NHJA 3OS0A 2GXGA 3W3CA 3IKTA 3WTVC 2Y30A 4I0BA 1X1CA 3LFKA 2IPQX 4PJJA 4AIJA 4UY8I 3LSTA 2E60A 2LYCA 2OZ6A 5HVQC 2CH0A 3J80K 3WHCA 1RZ4A 1X19A 3HC7A 3KZIC 1XGSA 1IAWA 4DZJA 2ZJPF 4ZJZA 3VOEA 3ABMH 2VONA 4IX7A 4EVIA 2VN2A 2XRLA 4Z2YA 3HB9A 4MFEA 4UB6C 3N97A 4NB5A 1S5LC 1YLFA 4PFPA 2QKLB 4UUSB 4BXUA 4X0GA 4CUGA 2FA5A 2JA7J 2FNAA 4KITB 5HODA 1I5ZA 1I39A 5E1ZB 5K7FA 2XVCA 2XGCA 3TO6A 3HHGA 4E70A 5B3SH 2F4OB 3CCSI 3OYDA 2BOLA 2VIXA 4C9YA 2IT0A 3L2UA 1S7AA 1P9QC 4ZTJA 1PDNC 2Q0OA 3H5NA 2CFOA 2D2WA 4UVAA 4II2A 4FHTA 4M3BA 3M8FA 1K83J 1X1PA 1SFOJ 5ILVA 3HTSB 2W48A 4CCOA 1S7EA 3F21A 4ASNA 3DWLE 3GLLA 2HOAA 3CLQA 1A5JA 1R5ID 1Y8QB 5CVRA 2GOXB 5D6FA 1P2FA 3E0JB 5M5XJ 1VQ9I 3RQIA 5BPIA 2ZSHB 1J9IA 3ZQIA 1QPMA 4BY7J 1SANA 3CUOA 5D5UB 2HZTA 3DLAA 4WX9A 4S04A 4F55A 3RPUA 3K7AJ 4XRMA 3CESA 4CGZA 3FKIJ 1O3RA 1U5TA 2K40A 3EUKL 3GTPJ 5E3MA 1D8JA 1ZRCA 2HVSA 3TP3A 5DV5A 3LSPA 3TW7A 3F3XA 3L1PA 2DTRA 2BXYA 2CWEA 1J09A 2JVHA 1MH3A 2L7MP 4HOBA 3W6JB 3E6MA 3AL0B 1DPUA 2CUEA 2WB1A 3CP8A 1A36A 1Z05A 4HF1A 2HQ5A 1SFKA 2UWMA 1REPC 4OINF 3MZYA 4L9NA 1E3PA 3JRCA 4BE2A 3TEDA 1UAAA 2XSDC 5EDNA 1EV7A 2K9SA 2KJBA 2L4AA 1TW3A 2WV1A 1R9TJ 2JSPA 3PO3J 1R36A 3OYAA 4NC6A 3UR3C 1T38A 1WJFA 3IH4A 2H6BA 2LMDA 4HEA2 3RQ4A 4IQJA 3S1MJ 1QQIA 4M6YA 4C3IJ 3S17J 1VQKI 3H5RA 1XSXA 1GVDA 2CSOA 1BN5A 4LK1F 5FD5A 3DCFA 5GPCA 3D0SA 4WXCA 4KFCA 3D5SC 1FTTA 3QP6A 2Y9ZA 1JGGA 1O7LA 1R49A 4L9VA 2ZCWA 4A69C 2DLLA 2DA1A 4JQFA 3PIPF 5L3DA 1WCMJ 1Q1HA 2OPTA 3RKYA 5FRMA 3KZYA 1QO0D 4U0VA 5JHUA 3JRGA 1O3TA 4E6KG 4V19K 3RDIA 1MDMB 3HOVJ 1ETOA 1VQPI 2HQAA 4LIUA 5CQEA 1FPQA 2KISA 2X0LA 3WU1B 4P9FA 1PUFA 3OY9A 1D5VA 3CCEI 2HYGD 4CDGA 2ID3A 2KIFA 3HOSA 5KAFC 2IBDA 3BJ6A 4RDUA 5EF6A 1YW8A 4XLFA 2K86A 3KP3A 2XF6A 1D1AA 3ERMA 4IHYA 3H9GA 1MMSA 5K7ZA 1E3HA 2DBBA 1NK2P 1JHFA 2KP6A 1IXCA 1G59A 1IRGA 2OZUA 4AC0A 1S7OA 1RUNA 1FBUA 1IJWC 4IVNA 2DT5A 1T33A 1HW5A 4JYKA 1W0TA 5ILUA 3QPTA 4HG2A 2FD5A 4KNYA 5L3EA 2NNYA 4AYBA 4BJ5C 1JE8A 2NVTJ 2MD5A 3DTIA 4CH7A 1FIAA 2IVMA 2EK5A 5IY5H 2JN6A 3D5RC 2F5VA 3HUGB 4N4NB 2AQFA 3SEZA 5E18F 1IC8A 1V5GA 2C6YA 1QZEA 2KRHA 2CGPA 4CCKA 3TGNA 1ETKA 1EA3A 3I3LA 2CMPA 2CYYA 3GZ5A 3FBNB 3A4CA 5E79C 1ZELA 4EEFG 2DA5A 1CF7B 4UB8C 4CCLA 3K4NA 3CJNA 4IOCF 4BXXJ 3CCJI 4S0HB 5B1BH 1W36C 2E1CA 1I50J 2D5VA 2VOOA 4NQWA 1ZGJA 2L0KA 2YX4A 1U8BA 4MIMA 2DPUA 2IS6A 3E7LA 2R7UA 2DMQA 1XPXA 2DT7B 3OL3A 1XSDA 4LLNA 2FNPA 4RAGA 4G7OF 2DODA 1YW9A 2MH9A 4EM2A 2O6GE 1LJ9A 4BQQA 1LVKA 4YFNF 1TT0A 2WY8Q 5J8CA 2BY0A 5LBQA 1Z9CA 2DPDA 1IUFA 1XD7A 2E34A 3QOEA 4BACA 4LD5A 2B7EA 5DCMA 4YG2F 2GXBA 1H88C 1X1DA 1QVTA 5JVTA 1JJ8C 3KYDB 2HZDA 1RPWA 2L7KA
chains in the Genus database with same CATH topology
1Y1VJ 2XB5A 2O9LA 2YU9J 5FKOA 2XGEA 2TRTA 2MG4A 2DMNA 1JT0A 2PMZN 2MSYA 3ZQHA 5IP6A 3ZQGA 1YRNB 1GUUA 1NTCA 1XC5A 4LOCA 3HOXJ 3LNQA 4AYBN 4UUSA 5EGOB 1UG2A 2HOTA 1Q1VA 4FISA 4XRSA 2JMWA 2TCTA 2O8KA 9ANTA 5FLMJ 5EG0A 2EZIA 3A01B 2Y31A 4MLOA 2HI3A 1D5YA 1ETYA 4W97A 1JT6A 2DA6A 2HDDA 1DU0A 2Y9YA 1B8IB 3GTJJ 1GDTA 1FJLA 4B1RA 3ZQFA 1ETWA 5J1UA 5IP7J 1POGA 2KT0A 3RKQA 2E1OA 2LTPA 5IOZA 3BTCA 2CJJA 2DA2A 2CUFA 2CQXA 2JJ7A 1TWGJ 3HOWJ 2DA4A 2ECCA 3OSGA 1UHSA 1X2MA 4A3JJ 5EZGA 3I4NJ 1RETA 2JWTA 2L7ZA 2E2HJ 1H89C 1NK3P 1MNMC 3IV5A 4A3CJ 1GV2A 1X2NA 3BQYA 3PM1A 4JX4A 4XIDA 1ENHA 5IYCJ 1ETXA 3HKZN 2LY9A 1MBFA 1BW6A 1H8AC 1ETVA 2GBYA 3VPRA 4V2GA 4X6AJ 5M5WJ 3A03A 1EF4A 4UUTA 2AO9A 4I6ZA 2DMPA 3JRDA 2NOGA 2EBIA 3HOUJ 2MGQA 5C4JJ 1U9NA 3CQZJ 5EYRA 1A6IA 3O8HA 2DJNA 5EZHA 3GTGJ 4M6VA 1JKQC 1B72B 2R0QC 3Q0WA 1AU7A 3MN2A 2LD5A 2HXIA 3S1RJ 1IRZA 5K7HA 4DW6A 3GBGA 1ETQA 5FKMA 3A01A 1U9OA 2JA8J 2R5YA 5E3OA 1B8IA 3S2DJ 1IDZA 1MBEA 3MVPA 3S16J 4XRSG 4C2MJ 2NVQJ 3FIWA 3Q0UA 2G0EA 1ZKGA 1I6HJ 1K61A 3IH3A 3GTKJ 2KDZA 2LP0A 3JRBA 3F0CA 4A3GJ 2ZB9A 1HCRA 4FTHA 4MFDA 5F27A 2P81A 1PUFB 2DN0A 3IH2A 1BJZA 3JRIA 1WI3A 2LK2A 5IPAA 5E3LA 4B3AA 4A3IJ 3FK6A 4AUXA 2HYJA 2CU7A 4DYRA 5F0HA 3QQAA 5C4XJ 5FKKA 2NVYJ 3TW6A 4JP0A 1TWAJ 2E19A 1JKOC 5DS9A 1P7IA 1HDPA 1RR7A 4A3BJ 1GV5A 2R5ZA 2E2JJ 5EEAA 1FIPA 4D5FA 3NAUA 4XICA 3G1MA 3OOUA 5IYBJ 3A02A 4A3LJ 5JLWA 2LKXA 3C2BA 1B72A 2M8GX 3JRAA 1ZR2A 1QRYA 1CQTA 3RZDJ 3HM5A 1XS9A 1RESA 4B4CA 3GTOJ 2COBA 2HXOA 4CYCB 2EZLA 1ZQ3P 2IEKA 3HBLA 2R5YB 1JKPC 5F0CA 1TC3C 5IOYA 4IHXA 2X9DA 2LFBA 3FK7A 4ABZA 2DTZA 3GTLJ 2M0CA 1F36A 5GP9A 3G1LA 2LLKA 4JX6A 5GPAA 4A93J 2XB0X 2M34A 4D5CA 3CMYA 1GT0C 1ORKA 1MSEC 2XPVA 3GTQJ 2OF7A 3LSGA 1ZK8A 4Y7NJ 3NARA 3ZQLA 2ME0A 3Q3SA 2M9HA 3SDGA 1JKRC 2Y30A 1WH5A 2FX0A 2X48A 2GM4A 3O8GA 1APLC 3WHCA 1IV6A 3W6VA 2DA3A 2K9QA 2NVXJ 4DZJA 1VI0A 1TWCJ 2VPRA 3FISA 2AHQA 2XRLA 5C44J 4QSHA 3HB9A 1OCTC 4MFEA 2R93J 2ME6A 2FQ4A 4DYQA 4UUSB 4BBRJ 2JA7J 5HODA 3BR3A 5K7FA 2B63J 2VKEA 2XGCA 1UMQA 1TWFJ 3M3YJ 3BTIA 2Y0SN 1TWHJ 4CYCA 3I4MJ 3SJMA 4M3EA 5DTDA 2ELKA 3OIOA 1LE8B 2VUMJ 2LR8A 4M3BA 1K83J 1RKTA 3B6CA 1SFOJ 2VI6A 4A3DJ 5M3FJ 4GFBA 2JK3A 1ZR4A 2W48A 2GLOA 1IGNA 1YRNA 2JA5J 3GTMJ 1S7EA 2QF7A 4M3GA 2HOAA 1A5JA 3CDLA 3BG9A 3WHBA 1IG7A 4HNVA 4DYCA 5EG0B 3CCYA 1ZGWA 4I76A 3RZOJ 5M5XJ 1OJLA 3RQIA 5J3LA 3H0GJ 3ZQIA 2IAIA 4QIWN 2XPUA 2I10A 4BY7J 1SANA 3BTLA 1LFBA 1JJ6C 2E2IJ 4M3DA 4IHVA 4RBOA 3K7AJ 4XRMA 1MBJA 3FKIJ 5FLVA 1X58A 2K40A 5FKLA 4JX5A 5E3MA 3GTPJ 2H8RA 2MW8A 3TP3A 3LSPA 3TW7A 3ZOBA 2ID6A 3L1PA 5M3MJ 3DEWA 2FJ1A 3QPSA 1WPKA 1MH3A 2L7MP 1HLVA 3BG3A 1FTZA 3LSJA 1BW5A 3ZQCA 2CUEA 2EZKA 1WGXA 3BR2A 4D7NA 4L5EA 2HQ5A 2N8GA 2YUSA 5IP9J 1Z77A 3JRCA 3TEDA 2XSDC 2XPWA 5EDNA 1XG1A 1RKWA 2K9SA 4J19A 1LE8A 3LSRA 5FJ8J 3HOYJ 2EH3A 2WV1A 1R9TJ 3SFIA 3S1QJ 4DZPA 3PO3J 2RAEA 4FE7A 5C3EJ 4A3EJ 2Y2ZA 2R7ZJ 3IH4A 2CRGA 3K2AA 4BY1J 3S1MJ 2H1KA 3BG5A 3QPLA 5M5YJ 4C3IJ 3S17J 1QPIA 3LOCA 3HGYA 4W1UA 4D7MA 5F1JA 1GVDA 5E3NA 4FCYA 1VFCA 2XGDA 3Q0VA 3BR6A 3DCFA 5GPCA 3H3VK 1JTYA 1AKHB 1MBGA 3MKLA 1FTTA 1JUSA 2Y9ZA 1JGGA 1JUPA 1HF0A 1QVUA 3BR5A 4A69C 2DA1A 3TP0A 1WCMJ 2OPTA 5F0FA 3UKGA 1VNDA 1JUMA 4BKXA 1P7JA 3JRGA 2R5ZB 3BR0A 2WB1N 3HOVJ 1ETOA 5JLXA 1HOMA 4C3JJ 2L7FP 2R92J 4IHWA 3JRHA 1PUFA 1ZTRA 1MSFC 3S2HJ 3BQZA 2EQRA 2ID3A 2EZHA 2NS7A 3S14J 3BR1A 2IBDA 2O7OA 4RDUA 5EF6A 2JA6J 2L9RA 4XK4A 1U78A 4IHYA 2HOSA 5K7ZA 2M2EA 1NK2P 1E3OC 3B6AA 3G1OA 5FKNA 4AC0A 4M3FA 2K9NA 1IJWC 1BA5A 3JR9A 1T33A 3HEFA 4FE4A 4JYKA 1W0TA 3M4OJ 5F04A 2FD5A 2YS9A 1DU6A 2VKVA 3HGGA 2LVSA 1VF9A 4A3FJ 1T56A 1LFUP 4QTRA 3BT9A 4IEJA 5EGOA 2NVTJ 3JRFA 1FIAA 3D1NI 5IYDJ 2JN6A 5J1YA 4NDLA 2CQQA 1FEXA 2DMUA 1JTXA 1IC8A 4Y52J 2DA7A 1ETKA 1I3QJ 1MBHA 1Z0XA 2DMTA 1AKHA 4EEFG 2DA5A 4BXXJ 1MH4A 3BTJA 4S0HB 1F43A 1O4XA 1Y1WJ 1I50J 2D5VA 4C3HJ 1G2HA 2L0KA 4X1EA 1U8BA 4MIMA 3E7LA 2X6OA 2DMQA 2NS8A 5F08A 1OCPA 5BNGA 4G12A 1W0UA 3JREA 3OSFA 3S1NJ 1MBKA 4MO7A 1BL0A 4A3MJ 3PO2J 3S15J 4BBSJ 4V2FA 1ITYA 1HDDC 1OFCX 3HDDA 1IUFA 2WAQN 2ECBA 4A3KJ 3HOZJ 1H88C 1AHDP 1QVTA 1WH7A 2QCOA 1JJ8C 5J1RA 1IDYA 1RPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V J;  2XB5 A;  2O9L A;  2YU9 J;  5FKO A;  2XGE A;  2TRT A;  2MG4 A;  2DMN A;  1JT0 A;  2PMZ N;  2MSY A;  3ZQH A;  5IP6 A;  3ZQG A;  1YRN B;  1GUU A;  1NTC A;  1XC5 A;  4LOC A;  3HOX J;  3LNQ A;  4AYB N;  4UUS A;  5EGO B;  1UG2 A;  2HOT A;  1Q1V A;  4FIS A;  4XRS A;  2JMW A;  2TCT A;  2O8K A;  9ANT A;  5FLM J;  5EG0 A;  2EZI A;  3A01 B;  2Y31 A;  4MLO A;  2HI3 A;  1D5Y A;  1ETY A;  4W97 A;  1JT6 A;  2DA6 A;  2HDD A;  1DU0 A;  2Y9Y A;  1B8I B;  3GTJ J;  1GDT A;  1FJL A;  4B1R A;  3ZQF A;  1ETW A;  5J1U A;  5IP7 J;  1POG A;  2KT0 A;  3RKQ A;  2E1O A;  2LTP A;  5IOZ A;  3BTC A;  2CJJ A;  2DA2 A;  2CUF A;  2CQX A;  2JJ7 A;  1TWG J;  3HOW J;  2DA4 A;  2ECC A;  3OSG A;  1UHS A;  1X2M A;  4A3J J;  5EZG A;  3I4N J;  1RET A;  2JWT A;  2L7Z A;  2E2H J;  1H89 C;  1NK3 P;  1MNM C;  3IV5 A;  4A3C J;  1GV2 A;  1X2N A;  3BQY A;  3PM1 A;  4JX4 A;  4XID A;  1ENH A;  5IYC J;  1ETX A;  3HKZ N;  2LY9 A;  1MBF A;  1BW6 A;  1H8A C;  1ETV A;  2GBY A;  3VPR A;  4V2G A;  4X6A J;  5M5W J;  3A03 A;  1EF4 A;  4UUT A;  2AO9 A;  4I6Z A;  2DMP A;  3JRD A;  2NOG A;  2EBI A;  3HOU J;  2MGQ A;  5C4J J;  1U9N A;  3CQZ J;  5EYR A;  1A6I A;  3O8H A;  2DJN A;  5EZH A;  3GTG J;  4M6V A;  1JKQ C;  1B72 B;  2R0Q C;  3Q0W A;  1AU7 A;  3MN2 A;  2LD5 A;  2HXI A;  3S1R J;  1IRZ A;  5K7H A;  4DW6 A;  3GBG A;  1ETQ A;  5FKM A;  3A01 A;  1U9O A;  2JA8 J;  2R5Y A;  5E3O A;  1B8I A;  3S2D J;  1IDZ A;  1MBE A;  3MVP A;  3S16 J;  4XRS G;  4C2M J;  2NVQ J;  3FIW A;  3Q0U A;  2G0E A;  1ZKG A;  1I6H J;  1K61 A;  3IH3 A;  3GTK J;  2KDZ A;  2LP0 A;  3JRB A;  3F0C A;  4A3G J;  2ZB9 A;  1HCR A;  4FTH A;  4MFD A;  5F27 A;  2P81 A;  1PUF B;  2DN0 A;  3IH2 A;  1BJZ A;  3JRI A;  1WI3 A;  2LK2 A;  5IPA A;  5E3L A;  4B3A A;  4A3I J;  3FK6 A;  4AUX A;  2HYJ A;  2CU7 A;  4DYR A;  5F0H A;  3QQA A;  5C4X J;  5FKK A;  2NVY J;  3TW6 A;  4JP0 A;  1TWA J;  2E19 A;  1JKO C;  5DS9 A;  1P7I A;  1HDP A;  1RR7 A;  4A3B J;  1GV5 A;  2R5Z A;  2E2J J;  5EEA A;  1FIP A;  4D5F A;  3NAU A;  4XIC A;  3G1M A;  3OOU A;  5IYB J;  3A02 A;  4A3L J;  5JLW A;  2LKX A;  3C2B A;  1B72 A;  2M8G X;  3JRA A;  1ZR2 A;  1QRY A;  1CQT A;  3RZD J;  3HM5 A;  1XS9 A;  1RES A;  4B4C A;  3GTO J;  2COB A;  2HXO A;  4CYC B;  2EZL A;  1ZQ3 P;  2IEK A;  3HBL A;  2R5Y B;  1JKP C;  5F0C A;  1TC3 C;  5IOY A;  4IHX A;  2X9D A;  2LFB A;  3FK7 A;  4ABZ A;  2DTZ A;  3GTL J;  2M0C A;  1F36 A;  5GP9 A;  3G1L A;  2LLK A;  4JX6 A;  5GPA A;  4A93 J;  2XB0 X;  2M34 A;  4D5C A;  3CMY A;  1GT0 C;  1ORK A;  1MSE C;  2XPV A;  3GTQ J;  2OF7 A;  3LSG A;  1ZK8 A;  4Y7N J;  3NAR A;  3ZQL A;  2ME0 A;  3Q3S A;  2M9H A;  3SDG A;  1JKR C;  2Y30 A;  1WH5 A;  2FX0 A;  2X48 A;  2GM4 A;  3O8G A;  1APL C;  3WHC A;  1IV6 A;  3W6V A;  2DA3 A;  2K9Q A;  2NVX J;  4DZJ A;  1VI0 A;  1TWC J;  2VPR A;  3FIS A;  2AHQ A;  2XRL A;  5C44 J;  4QSH A;  3HB9 A;  1OCT C;  4MFE A;  2R93 J;  2ME6 A;  2FQ4 A;  4DYQ A;  4UUS B;  4BBR J;  2JA7 J;  5HOD A;  3BR3 A;  5K7F A;  2B63 J;  2VKE A;  2XGC A;  1UMQ A;  1TWF J;  3M3Y J;  3BTI A;  2Y0S N;  1TWH J;  4CYC A;  3I4M J;  3SJM A;  4M3E A;  5DTD A;  2ELK A;  3OIO A;  1LE8 B;  2VUM J;  2LR8 A;  4M3B A;  1K83 J;  1RKT A;  3B6C A;  1SFO J;  2VI6 A;  4A3D J;  5M3F J;  4GFB A;  2JK3 A;  1ZR4 A;  2W48 A;  2GLO A;  1IGN A;  1YRN A;  2JA5 J;  3GTM J;  1S7E A;  2QF7 A;  4M3G A;  2HOA A;  1A5J A;  3CDL A;  3BG9 A;  3WHB A;  1IG7 A;  4HNV A;  4DYC A;  5EG0 B;  3CCY A;  1ZGW A;  4I76 A;  3RZO J;  5M5X J;  1OJL A;  3RQI A;  5J3L A;  3H0G J;  3ZQI A;  2IAI A;  4QIW N;  2XPU A;  2I10 A;  4BY7 J;  1SAN A;  3BTL A;  1LFB A;  1JJ6 C;  2E2I J;  4M3D A;  4IHV A;  4RBO A;  3K7A J;  4XRM A;  1MBJ A;  3FKI J;  5FLV A;  1X58 A;  2K40 A;  5FKL A;  4JX5 A;  5E3M A;  3GTP J;  2H8R A;  2MW8 A;  3TP3 A;  3LSP A;  3TW7 A;  3ZOB A;  2ID6 A;  3L1P A;  5M3M J;  3DEW A;  2FJ1 A;  3QPS A;  1WPK A;  1MH3 A;  2L7M P;  1HLV A;  3BG3 A;  1FTZ A;  3LSJ A;  1BW5 A;  3ZQC A;  2CUE A;  2EZK A;  1WGX A;  3BR2 A;  4D7N A;  4L5E A;  2HQ5 A;  2N8G A;  2YUS A;  5IP9 J;  1Z77 A;  3JRC A;  3TED A;  2XSD C;  2XPW A;  5EDN A;  1XG1 A;  1RKW A;  2K9S A;  4J19 A;  1LE8 A;  3LSR A;  5FJ8 J;  3HOY J;  2EH3 A;  2WV1 A;  1R9T J;  3SFI A;  3S1Q J;  4DZP A;  3PO3 J;  2RAE A;  4FE7 A;  5C3E J;  4A3E J;  2Y2Z A;  2R7Z J;  3IH4 A;  2CRG A;  3K2A A;  4BY1 J;  3S1M J;  2H1K A;  3BG5 A;  3QPL A;  5M5Y J;  4C3I J;  3S17 J;  1QPI A;  3LOC A;  3HGY A;  4W1U A;  4D7M A;  5F1J A;  1GVD A;  5E3N A;  4FCY A;  1VFC A;  2XGD A;  3Q0V A;  3BR6 A;  3DCF A;  5GPC A;  3H3V K;  1JTY A;  1AKH B;  1MBG A;  3MKL A;  1FTT A;  1JUS A;  2Y9Z A;  1JGG A;  1JUP A;  1HF0 A;  1QVU A;  3BR5 A;  4A69 C;  2DA1 A;  3TP0 A;  1WCM J;  2OPT A;  5F0F A;  3UKG A;  1VND A;  1JUM A;  4BKX A;  1P7J A;  3JRG A;  2R5Z B;  3BR0 A;  2WB1 N;  3HOV J;  1ETO A;  5JLX A;  1HOM A;  4C3J J;  2L7F P;  2R92 J;  4IHW A;  3JRH A;  1PUF A;  1ZTR A;  1MSF C;  3S2H J;  3BQZ A;  2EQR A;  2ID3 A;  2EZH A;  2NS7 A;  3S14 J;  3BR1 A;  2IBD A;  2O7O A;  4RDU A;  5EF6 A;  2JA6 J;  2L9R A;  4XK4 A;  1U78 A;  4IHY A;  2HOS A;  5K7Z A;  2M2E A;  1NK2 P;  1E3O C;  3B6A A;  3G1O A;  5FKN A;  4AC0 A;  4M3F A;  2K9N A;  1IJW C;  1BA5 A;  3JR9 A;  1T33 A;  3HEF A;  4FE4 A;  4JYK A;  1W0T A;  3M4O J;  5F04 A;  2FD5 A;  2YS9 A;  1DU6 A;  2VKV A;  3HGG A;  2LVS A;  1VF9 A;  4A3F J;  1T56 A;  1LFU P;  4QTR A;  3BT9 A;  4IEJ A;  5EGO A;  2NVT J;  3JRF A;  1FIA A;  3D1N I;  5IYD J;  2JN6 A;  5J1Y A;  4NDL A;  2CQQ A;  1FEX A;  2DMU A;  1JTX A;  1IC8 A;  4Y52 J;  2DA7 A;  1ETK A;  1I3Q J;  1MBH A;  1Z0X A;  2DMT A;  1AKH A;  4EEF G;  2DA5 A;  4BXX J;  1MH4 A;  3BTJ A;  4S0H B;  1F43 A;  1O4X A;  1Y1W J;  1I50 J;  2D5V A;  4C3H J;  1G2H A;  2L0K A;  4X1E A;  1U8B A;  4MIM A;  3E7L A;  2X6O A;  2DMQ A;  2NS8 A;  5F08 A;  1OCP A;  5BNG A;  4G12 A;  1W0U A;  3JRE A;  3OSF A;  3S1N J;  1MBK A;  4MO7 A;  1BL0 A;  4A3M J;  3PO2 J;  3S15 J;  4BBS J;  4V2F A;  1ITY A;  1HDD C;  1OFC X;  3HDD A;  1IUF A;  2WAQ N;  2ECB A;  4A3K J;  3HOZ J;  1H88 C;  1AHD P;  1QVT A;  1WH7 A;  2QCO A;  1JJ8 C;  5J1R A;  1IDY A;  1RPW A; 
#chains in the Genus database with same CATH topology
 3L2Q A;  4KDP A;  5FKO A;  2A69 F;  3NQO A;  1JT0 A;  2DMN A;  2F5F A;  4U7D A;  4A0X A;  4M6X A;  3AG1 H;  2F48 A;  1YHQ I;  3AFH A;  4AYB N;  1UG2 A;  2HOT A;  1Q1V A;  1R58 A;  2JMW A;  2FBK A;  4PJ0 C;  5EG0 A;  4XBF A;  3CJT B;  1FWZ A;  5AIP A;  1H9G A;  1TQI A;  3A01 B;  4RB2 C;  2XF5 A;  3CLO A;  4MLO A;  2HI3 A;  4N4O B;  4ESB A;  1TQP A;  1JT6 A;  1MD0 A;  4G6T B;  2W25 A;  2Y9Y A;  1K4T A;  4QWQ A;  3ZQF A;  4QLC U;  1ETW A;  5E20 A;  4XLE A;  5CVI A;  5IP7 J;  3OYC A;  1C0W A;  2FML A;  2V26 A;  2BY3 A;  3OYF A;  3SEQ A;  2DA2 A;  2CUF A;  2CQX A;  2V1D A;  3ABU A;  1D3Y A;  3NWT A;  5DEQ A;  3CCM I;  1X2M A;  4A3J J;  1SVM A;  1YE9 A;  1D8K A;  2OQR A;  4WK8 F;  2M7B A;  3I4N J;  3OV8 A;  1RET A;  4PJM A;  3TL4 X;  2JWT A;  2L7Z A;  4XL9 A;  3T0Y A;  2GA1 A;  2M4K A;  4U87 A;  4CCM A;  1YIO A;  5H6R A;  3EQL F;  2LY9 A;  4YEL A;  3R0A A;  5H20 A;  5DD4 A;  5DCM B;  2VE8 A;  1G3T A;  3K10 A;  3OYK A;  5ERI A;  3GO5 A;  3O2P E;  2QSG X;  3BG6 A;  1SMT A;  1KON A;  1SAX A;  2AO9 A;  4I6Z A;  2DMP A;  2MGQ A;  3A2K A;  3GUD A;  1U9N A;  4BU2 A;  4KT6 A;  5EYR A;  4E7J A;  1Z7L A;  3K4K A;  2DAO A;  1OYW A;  4M6V A;  1ZAR A;  4M72 A;  2ELH A;  2R0Q C;  3I58 A;  3MN2 A;  2LD5 A;  1BIB A;  1FSE A;  5J8F A;  4UHT A;  2P5L C;  3A01 A;  5KK1 A;  2W82 A;  1UFM A;  2IA2 A;  1FNN A;  1IUY A;  1BI3 A;  1U9O A;  4KMF A;  3PNV A;  3GYH X;  4IOA F;  5HDK A;  1R1V A;  4PJN A;  1MBE A;  3S8P A;  1RIO H;  3MVP A;  3S32 A;  3V7S A;  4F91 B;  3ROU A;  2AXT C;  3HPG A;  5E1X A;  4G8X A;  1KYW A;  4BYY A;  4IJA A;  4YFX F;  2IS4 A;  3BDD A;  3ABT A;  3IH3 A;  3RTR A;  1VQ7 I;  5CVJ A;  1UCR A;  2OCC H;  1YX5 A;  3F23 A;  2P81 A;  2M45 A;  5E8I A;  1LDD A;  5KCM A;  3IH2 A;  1ZG1 A;  2BYV E;  1VTN C;  3PNT A;  4EM0 B;  1XGN A;  1YJN I;  2QEX I;  2LK2 A;  2K3P A;  4XLH A;  5E3L A;  2ELJ A;  2V79 A;  3FXQ A;  4AUX A;  1PUE E;  4RAF A;  4ZYE A;  4ZYD A;  2NOJ B;  2HDC A;  2HDW A;  4KMU X;  2KDO A;  2VJ5 A;  3PQK A;  4XSZ F;  1LUJ B;  1P7I A;  3HPH A;  4A3B J;  2CQ7 A;  4LIT A;  4WXH A;  5EEA A;  4PCQ A;  1OCO H;  1YS6 A;  2W00 A;  2ZXI A;  3GW2 A;  5IYB J;  3FDY A;  2WWY A;  1U2W A;  2RNG A;  3QAH A;  1P6R A;  2QZ8 A;  4HQM A;  4XSX F;  2GAU A;  2DQL A;  2OAZ A;  2G7U A;  2M8G X;  2ZFW A;  3JRA A;  1QRY A;  2OTJ I;  2XAQ A;  3HM5 A;  3CJQ B;  3X2Q H;  2COB A;  5F6F A;  2HKO A;  4CYC B;  3I5U A;  2H09 A;  2L9N A;  2MD0 A;  2BW3 B;  2CG4 A;  2YX7 A;  5F0C A;  4I02 A;  1TC3 C;  5IOY A;  1B9N A;  4IHX A;  3EPZ A;  2LRD A;  3TDU C;  2Q8K A;  2RQQ A;  3GTL J;  2DTZ A;  3J7A Y;  2M3A A;  4NNJ A;  2PEX A;  1X1B A;  2ISY A;  2GIZ A;  5GPA A;  1S6L A;  2QA4 I;  2K4B A;  3WTT C;  3OMY A;  1DP3 A;  4D5C A;  3CMY A;  3MFK A;  3BJA A;  3CP2 A;  5DM6 F;  2M30 A;  2XPV A;  4EAT A;  1ZLJ A;  2O03 A;  3HOT A;  2L3D A;  3E3V A;  2QGU A;  2DDA A;  3P7N A;  1OKR A;  2ME0 A;  3Q3S A;  1YIT I;  3H5A A;  2FX0 A;  1MMA A;  2RRE A;  2X48 A;  1S8N A;  1Y39 A;  2RDP A;  4XM3 A;  1IV6 A;  2K9Q A;  1T08 B;  2B0L A;  1ZAO A;  3DBL B;  1VI0 A;  3E5X A;  1TWC J;  3VYU B;  2VPR A;  3FIS A;  4A2U A;  3V8L A;  1U5T C;  3JTH A;  1JI8 A;  1UHW A;  4BQO A;  4KIS A;  5C44 J;  4QSH A;  2IGO A;  1OCT C;  2X1C A;  2E7X A;  4DYQ A;  3HRS A;  3G2B A;  4BBR J;  1N78 A;  3U1D A;  5FRO A;  2B63 J;  3CD6 I;  1TWF J;  2G9W A;  2YSR A;  2FBH A;  2Y0S N;  5KAI C;  4CYC A;  3I4M J;  3V42 A;  5DYM A;  1LDJ A;  3HXL A;  2EB7 A;  3FX3 A;  3OIO A;  5DTD A;  4DIQ A;  1LE8 B;  1ON2 A;  3HSF A;  2VUM J;  1OQY A;  2A61 A;  5B1A H;  4XQF A;  3GCM A;  3EUH A;  2PX9 A;  4IRI A;  2L01 A;  5M3F J;  2DOF A;  1ZR4 A;  2GLO A;  1WFX A;  1YS7 A;  5BQT A;  3RCO A;  5CYV A;  4MNU A;  3AG4 H;  4XKC A;  5EG0 B;  1H9T A;  3L2V A;  3RZO J;  3KEO A;  1OJL A;  3F8M A;  4UV9 A;  4A6D A;  3ZRG A;  1IRX A;  1R4M B;  1UST A;  2IAI A;  3H0G J;  1TTY A;  1FP1 D;  2XPU A;  3VSL A;  5CLS A;  4EM1 A;  2A07 F;  1LFB A;  1PP8 F;  4GGG A;  2DO7 A;  2EIL H;  1V4R A;  4RBO A;  1GXP A;  5K5O A;  4Y15 A;  1RR8 C;  3G71 I;  1MBJ A;  2NAZ A;  2WAF A;  3OS1 A;  3HRM A;  2H8R A;  3H9J A;  1TT5 B;  2MW8 A;  2X1E A;  3QYF A;  4G94 A;  2ZME A;  5KNL A;  4BDZ A;  2OJE D;  1HA8 A;  2NXN B;  1X4P A;  1W1W E;  4BS9 A;  4UV8 A;  2XKO A;  5M3M J;  3AG3 H;  2FJ1 A;  3QPS A;  4RB1 A;  1XSV A;  2BV6 A;  5B5E C;  3BG3 A;  1WJA A;  3WE3 A;  1WRJ A;  3LSJ A;  2AXL A;  2XC7 A;  1HC8 A;  2NYX A;  2W7N A;  3B73 A;  1D0Y A;  3IKV A;  4L5E A;  4A6E A;  2UZK A;  3U21 A;  1WJB A;  1FBQ A;  3WTZ A;  4OMY A;  3CMA I;  1Z77 A;  2LKP A;  3F6V A;  1FMW A;  4EMS A;  2LC2 A;  4KIB A;  3QYB A;  1R71 A;  1MMN A;  2XPW A;  3FKJ A;  1XG1 A;  2NRA C;  2Z99 A;  1JGS A;  1AWC A;  2QQ8 A;  3LSR A;  4NUB A;  3PL8 A;  1V54 H;  3J7Z I;  4ESJ A;  4EJU A;  3SFI A;  3S1Q J;  4KIC A;  4FX0 A;  2XHK A;  2V4J C;  3DPL C;  5EEG A;  4FE7 A;  2Y2Z A;  2R7Z J;  2CQK A;  4LG0 B;  3SDB A;  3QWL A;  5KVR A;  2VQG A;  2QQ9 A;  3VYS B;  4BY1 J;  5DDG A;  1J5Y A;  5LLQ A;  1HST A;  2X1D A;  3QPL A;  2EA4 A;  2ZJQ F;  3FZV A;  3ULQ B;  2H1K A;  3LOC A;  5F1J A;  2JRM A;  1VFC A;  4JOM A;  3H3V K;  3CC4 I;  1AKH B;  1ZRD A;  1QGP A;  1MBG A;  3I64 A;  3TO9 A;  2J5P A;  2IP2 A;  3BR5 A;  3MMY B;  2ZJR F;  4L5J A;  3TP0 A;  5IT9 Z;  4KJZ A;  5F0F A;  1VND A;  2V9P A;  1SAU A;  1P7J A;  2ZME B;  3L2R A;  1WHU A;  1YJW I;  2HYF A;  3WOD F;  4R8H A;  5JLX A;  2L2O A;  2R92 J;  3JRH A;  1ZTR A;  3OYM A;  1S72 I;  3BQZ A;  2EQR A;  5K1Y A;  2EZH A;  4ENJ A;  3S14 J;  3I9V 2;  2QUF A;  2O7O A;  2WTE A;  5LEJ A;  1V55 H;  4HX8 A;  2O5R A;  1T8I A;  1XGO A;  3ZMZ A;  3I4P A;  4LG3 A;  2STT A;  1S9H A;  1YJ9 I;  3B6A A;  1QZZ A;  3F6O A;  3G1O A;  4XKW A;  5HLG A;  2JZY A;  3JR9 A;  6PAX A;  5FLX Z;  3E6B A;  3M4O J;  3BP8 A;  2E5Z A;  3F72 A;  2YS9 A;  5LGU A;  2JQ7 A;  3HGG A;  1T56 A;  4LK0 F;  1TW2 A;  4IEJ A;  3K9T A;  3ASO H;  5EGO A;  4UNO A;  2BHZ A;  3J7Y J;  2R7R A;  5IYD J;  4I98 B;  2XUB A;  2FBI A;  4NDL A;  5J1Y A;  4OAY A;  2YU3 A;  2DMU A;  4M9Z A;  5LGN A;  4LB6 B;  1R7J A;  4Y33 A;  3GZ6 A;  2DA7 A;  2FQ3 A;  3FM3 A;  5GAH J;  1G3W A;  1I3Q J;  3ZN0 A;  1KYZ A;  3SQN A;  5FFX A;  1D1C A;  3K4J A;  2Q2E A;  5J6X A;  3CC2 I;  1MIJ A;  3VYR B;  1Y1W J;  2UV1 A;  5D5X B;  3ZP5 A;  3F8F A;  1G2H A;  4M73 A;  3C7J A;  1MMD A;  2HR3 A;  4IZZ A;  1OCP A;  1W0U A;  2TDX A;  2H8W A;  3ZQQ A;  4A3M J;  3F8B A;  3PO2 J;  4BBS J;  5D6E A;  3SHF A;  1ITY A;  3I56 I;  4BHP A;  3EET A;  4P1W A;  1XB4 A;  5JHF A;  3HDD A;  3MKY B;  3H92 A;  2XRN A;  2CW0 F;  4RA2 A;  4KYW A;  5CVV A;  3G73 A;  2ECB A;  3SZG A;  3HOZ J;  4ANJ A;  4IHT A;  4RM3 A;  3ISP A;  2RN7 A;  5L3G A;  1WH7 A;  2QCO A;  4HA8 A;  2VKD A;  5J4Y A;  2XB5 A;  2K3F A;  1OIS A;  2O9L A;  4LLG F;  1DUX C;  2ZME C;  2R7V A;  1SD6 A;  2MSY A;  1MJB A;  3LNQ A;  2DJI A;  1FZP B;  4G9Y A;  4UUS A;  9ANT A;  2MLK A;  2IW5 A;  5FLM J;  2KRC A;  2Y31 A;  3PSI A;  4RAZ A;  1IN5 A;  4W97 A;  5D4S A;  3CCV I;  3RJP A;  3KYL A;  2IA0 A;  2Z16 A;  3GTJ J;  1YFH A;  5J1U A;  5TJJ A;  1WJ5 A;  4EJT A;  1LQ1 A;  4FET A;  3EUH C;  3K4M A;  1Z1D A;  3BY6 A;  3ZCO A;  3P9C A;  2DA4 A;  1FBS A;  2IGM A;  1J7K A;  3R61 A;  1KQ0 A;  3OSG A;  1YIJ I;  1FLI A;  2KHM A;  3J7A O;  2W85 A;  1T98 A;  2ZSI B;  4QPO A;  2VQH A;  2EFW A;  4A3C J;  3H3Z A;  4IL6 C;  4YEJ A;  1GV2 A;  1X2N A;  2Z9O A;  4JX4 A;  4QPQ A;  4L9J A;  4BGD A;  2OCE A;  4XRF A;  4BHB A;  4DQ2 A;  1Z21 A;  4CIC A;  2V6C A;  3DKY A;  1ETV A;  2GBY A;  1B59 A;  1EH8 A;  3DEE A;  3VPR A;  4V2G A;  4Q5S F;  2BBY A;  3FF5 A;  1EF4 A;  2ZXJ A;  2BE5 F;  2DFI A;  1XCB A;  2EIN H;  3W6K B;  2DI3 A;  3JRD A;  2R7Q A;  2L02 A;  2ETH A;  2ZXH A;  4U88 A;  1UZC A;  4H4K C;  1EKE A;  5F1R A;  5DUK A;  1WJC A;  4FT8 A;  3TBI A;  4GDF A;  2DJN A;  2P4W A;  3DBH B;  1JKQ C;  1QZY A;  2VOD A;  3Q0W A;  1AU7 A;  4TV7 A;  1WVR A;  1MZB A;  4D0P A;  2QM3 A;  2EA2 A;  2P6T A;  3CO7 C;  1ETQ A;  2Y48 A;  2R7W A;  2PJR A;  2MBF A;  4PZJ A;  1OYY A;  3E97 A;  3GF2 A;  3F9K A;  3BRO A;  2NVU B;  3BLY A;  2DK8 A;  3FXU A;  2IJL A;  5E3O A;  1IDZ A;  4YFK F;  4Q4Z F;  2G7H A;  3K4L A;  2VXD A;  3S16 J;  1QHG A;  1W5C C;  4C2M J;  5CKT A;  2AQE A;  1EH7 A;  4HST A;  1PJR A;  5DCF A;  4J00 A;  2FOK A;  1G3Y A;  2P8T A;  2NVQ J;  2XV4 S;  4DBR A;  3D5L A;  4CHU A;  2BXZ A;  3ZN1 A;  4Q47 A;  4ZDL A;  2JT1 A;  4BDY A;  4L18 B;  3MKZ A;  2LY1 A;  1XGM A;  3F0C A;  1K7A A;  4A3G J;  4FTH A;  1FOY A;  5LHH A;  3TMO A;  1K6O A;  3JRI A;  4I0A A;  3PIO F;  4CZZ A;  3ML6 A;  4L5I A;  5LRR A;  2BY1 A;  4RB0 A;  3ZQ7 A;  2EFQ A;  1IN8 A;  1O57 A;  4B3A A;  4P9U A;  2KKO A;  4R79 A;  5E1W A;  1SC7 A;  3BG7 A;  4LFU A;  5C4X J;  4EJO A;  3KLN A;  4GRI A;  4M71 A;  4JP0 A;  3H9Q A;  3LMM A;  1HDP A;  2BVL A;  3F22 A;  4ENM A;  2OQG A;  2E2J J;  1RI7 A;  3QPH A;  1RUO A;  4LGW A;  5LFA A;  3NAU A;  1MDM A;  4EGZ A;  1MNE A;  3VWB A;  2MAB A;  3KP2 A;  3OOU A;  1UEL B;  2MA3 A;  4IF4 A;  5JLW A;  2IS1 A;  3DBR B;  4LMY A;  2LKX A;  2BEO A;  4PSW A;  4DBQ A;  4YIR X;  3LSM A;  4XMY A;  3J81 K;  1BBY A;  3B02 A;  1CQT A;  2CV1 A;  5FB2 A;  5E17 F;  3CJR B;  3WTX C;  2ICW G;  3GTO J;  2I5U A;  5TIS C;  3CF2 A;  1XMA A;  2KQR A;  2PJR B;  3FWE A;  2HKX A;  2XKP A;  3JSO A;  2V1U A;  3L2C A;  4E7I A;  3HBL A;  3OIP A;  2F5E A;  2Y0S A;  1FX7 A;  1GXQ A;  5ICC A;  3ERE D;  2X6X A;  4K2E A;  4MQ9 F;  2X9D A;  1AA7 A;  3FK7 A;  2LNB A;  5JR3 A;  4ABZ A;  4KIF A;  1FY7 A;  5GP9 A;  3DFG A;  2Z1D A;  2M1B A;  4WCG A;  4XLA A;  1SVL A;  1QHH D;  4H0E A;  3SZP A;  2RKH A;  1WI9 A;  1R6R A;  3RYP A;  1OCR H;  4OAZ A;  3QRF F;  5HLI A;  2OF7 A;  3ZMT A;  4BEH B;  1ZK8 A;  1PP7 U;  3LA3 A;  3SDG A;  2FXA A;  3K6G A;  3OYJ A;  1WH5 A;  2X85 A;  4XR6 A;  2PI0 A;  3WTY C;  4I7H A;  3AL0 C;  3O8G A;  3TKY A;  3W6V A;  5JFR A;  2R7T A;  2LSO A;  3WG9 A;  4Y4R A;  1K78 B;  2STW A;  5H6Q A;  1P4X A;  3U9G A;  2GOM A;  3J80 Z;  2UUZ A;  1BC7 C;  1ZGA A;  2R7F A;  2AHQ A;  5CPR B;  4OIP F;  1ZLK A;  3NRV A;  1Y6I A;  4HZF A;  3Q5F A;  5L3C A;  4F52 A;  1IRF A;  2ZFU A;  4OWR B;  4CO8 A;  2XDV A;  1MGT A;  3OYL A;  3BR3 A;  1KU7 A;  1WJE A;  2YR2 A;  3K4C A;  3OR2 C;  1VQ5 I;  1FT9 A;  2LG4 A;  2BZT A;  3M9A A;  3AG2 H;  2HNH A;  4DJA A;  2ISZ A;  3C2H A;  2HVR A;  2PG4 A;  1VQ8 I;  1HBX G;  3JSP A;  3P9I A;  4RGU A;  4CCJ A;  4M3E A;  2FE3 A;  4G6D A;  3QU3 A;  1L3L A;  2LR8 A;  3CTA A;  3KP6 A;  4B44 A;  2KIU A;  2ZC2 A;  2OA4 A;  5LHG A;  1QBJ A;  3QYE A;  1RKT A;  1Z3X A;  2VI6 A;  1Z7U A;  3G4S I;  4GFB A;  1IV8 A;  2JK3 A;  1IN7 A;  1QA6 A;  1I6X A;  1IGN A;  1A6Q A;  2JA5 J;  3GTM J;  3REO A;  3I55 I;  2QF7 A;  1DGR M;  4E7H A;  1R5H A;  3BG9 A;  2E71 A;  3WHB A;  2PLY A;  4PGH A;  4HNV A;  1OCC H;  4DYC A;  2J5O A;  3F8N A;  4HAM A;  3DV8 A;  4I09 A;  5J3L A;  2A5Y B;  1QNT A;  2LRE A;  4LB5 A;  4RMN A;  4QIW N;  3LA7 A;  4UUV A;  2L9S A;  2VJ4 A;  3T8R A;  2EV5 A;  2D45 A;  3RKX A;  5AON A;  3A0H C;  1LDK B;  4II3 A;  1F4K A;  5FLV A;  1X58 A;  3CMM A;  1E0E A;  1A04 A;  2KIQ A;  4JX5 A;  3Q9S A;  1OPC A;  2HGC A;  3GFM A;  3M8J A;  1J0R A;  3SYT A;  1K78 A;  1TNS A;  5GAD J;  2DW4 A;  2QBY A;  2Q1Z B;  3ZOB A;  3V7R A;  3FM5 A;  4BUP A;  5L3F A;  3RIR A;  2IXS A;  4ON0 A;  3ABL H;  4ZTF A;  5FO5 A;  1G8X A;  4ZH4 F;  3ZQC A;  4IO9 F;  2ZXW H;  1WGX A;  3BR2 A;  3CZ6 A;  3LWF A;  2IGK A;  2FSW A;  2N8G A;  2KPM A;  4BE1 A;  4O5V A;  5IP9 J;  4OU0 A;  1X1A A;  4C30 A;  2OUM A;  1T2K A;  2F6C A;  5BS6 A;  1KU3 A;  4ZYG A;  4HV5 A;  3I0T A;  1LE8 A;  5F64 A;  2H94 A;  5FJ8 J;  4AD9 A;  2XAF A;  4B09 A;  2VKH A;  3A1Y A;  5DUI A;  3Q9V A;  4DZP A;  3AAF A;  1I27 A;  2LBF B;  3MZH A;  4LLL A;  2QYO A;  4RB3 C;  2CRG A;  2PQ8 A;  4XN0 A;  3DF8 A;  1WKM A;  4ZC3 A;  3IUO A;  3K1N A;  5JVG F;  3W2W A;  1A31 A;  1FSH A;  4KN4 X;  5M5Y J;  4BE0 A;  4PJL A;  2XIG A;  1KZH A;  3HGY A;  3GFL A;  4D7M A;  3K0L A;  3Q0V A;  3BR6 A;  1W5S A;  1W36 D;  1JTY A;  5D8L B;  2EFO A;  3RPQ A;  3MKL A;  2QWW A;  1JUP A;  2HS5 A;  4B8X A;  4G7H F;  3ZR8 X;  2ZJ2 A;  4HLX A;  1B6A A;  1E2X A;  3QU6 A;  3GFI A;  1YYV A;  3FXR A;  1W7P B;  3JW4 A;  3JCU C;  2QBY B;  1FC3 A;  2DQR A;  5CQG A;  5HDN A;  5LRS A;  4MEX F;  1AOY A;  1ZN2 A;  2M7A A;  2MLG A;  1HOM A;  3CC7 I;  4C3J J;  2L7F P;  2JSC A;  2E35 A;  2UXX A;  3S2H J;  3PFI A;  5LEK A;  2PBI A;  2HQR A;  5KHD A;  2NS7 A;  2QEN A;  3BR1 A;  2L5Q A;  3SFZ A;  3CCU I;  2XAJ A;  3HRT A;  3IWZ A;  1X3W B;  5J47 A;  5BPD A;  2JA6 J;  2L9R A;  1BOB A;  3O3K A;  4XK4 A;  3LQQ A;  1BI2 A;  1U78 A;  4XON A;  4YIF A;  3G3Z A;  2E5N A;  2M2E A;  1ULY A;  1E3O C;  2F4I A;  2LOO A;  4HSR A;  4M3F A;  1BA5 A;  1S29 A;  3OYH A;  3HEF A;  3HHH A;  4MHG A;  1P4W A;  5F04 A;  2VKV A;  1ACI A;  4IPA A;  4LIV A;  1LFU P;  1MW7 A;  1IXR C;  2DU9 A;  3BT9 A;  3GLX A;  2BHY A;  2VC0 A;  3JRF A;  1YOV B;  3L2W A;  4KN7 X;  4GO1 A;  4LG0 A;  2VAS A;  2X51 A;  3OS2 A;  4HPQ A;  1B4A A;  3VDX A;  1JTX A;  5FGM A;  4Y52 J;  4HNU A;  2HU9 A;  4AID A;  2ACJ A;  5EJC A;  1MBH A;  4AWX B;  4NBQ A;  2DYR H;  2DMT A;  1AKH A;  4RAY A;  4B3X A;  1SD4 A;  3S3N A;  2WBM A;  2F4M B;  5GTH C;  1NHA A;  1YTY A;  4HF2 A;  5LGT A;  3C3W A;  2X6O A;  1T0F C;  3UNG C;  2RGV A;  2F2E A;  3EDP A;  3CDI A;  4BQN A;  1QU3 A;  4G12 A;  3EYI A;  1OR7 A;  1O3S A;  2M8E A;  3OWT A;  3H36 A;  1N77 A;  1MBK A;  4MO7 A;  1BL0 A;  4OIQ F;  1MMG A;  4RM2 A;  4V2F A;  1TZL A;  1XN7 A;  4BEH A;  3BZK A;  4M9X A;  2RQP A;  3OL4 A;  5ICG A;  2XAS A;  3K2Z A;  1HDD C;  4RGS A;  1OFC X;  2L9V A;  1U6G A;  2I8D A;  3BPX A;  4A3K J;  1LVA A;  3KZZ A;  1L0O C;  2O3F A;  2X6Y A;  4EQQ A;  3WTW C;  2ZO4 A;  2XAH A;  3CME I;  3DEU A;  3K1P A;  3L7W A;  2P6S A;  1LKX A;  2TRT A;  2D1V A;  2MG4 A;  2QSH X;  2KFD A;  2PMZ N;  3RPU D;  3ZQH A;  1TL8 A;  1YRN B;  3R4K A;  1GUU A;  1NTC A;  3GVA A;  4LOC A;  4AVZ A;  3HOX J;  2PMH A;  5J4V A;  2E1M B;  5EGO B;  1VQ4 I;  2O8K A;  1Z6R A;  2TCT A;  4KT5 C;  3QP5 A;  2KZV A;  4XOR A;  3ZGK A;  2EZI A;  4N9H A;  3GZN B;  1D5Y A;  1ETY A;  4I99 C;  1G4D A;  2E7W A;  3MQ0 A;  5HLT A;  2HDD A;  1DU0 A;  1B8I B;  2R7O A;  1T6S A;  4EJV A;  1FJL A;  4B1R A;  3QOP A;  3V8K A;  2E1M C;  3M1C A;  1NG6 A;  1I3A A;  1KU9 A;  2H1L A;  1POG A;  2VL8 A;  3KP7 A;  3K69 A;  2Q2E B;  2QKM B;  4AM3 A;  4RS8 A;  3LSI A;  2NNN A;  2LTP A;  5IOZ A;  4KA4 A;  1YW7 A;  3I53 A;  5D8K B;  4E7K A;  2H27 A;  4L0Z B;  3WTS C;  1TWG J;  1W7P D;  1TBX A;  2ECC A;  2JRT A;  3GFJ A;  2WAE A;  1UHS A;  2VBZ A;  3NEU A;  5EZG A;  2Y75 A;  1IO2 A;  5FFZ A;  5GTI C;  1R1U A;  1NK3 P;  5TRD A;  2EPF A;  4C2U A;  3BQY A;  3PM1 A;  4I01 A;  1ENH A;  5IYC J;  1ETX A;  4Y17 A;  2PMZ A;  1GHC A;  2HQN A;  1DPR A;  3HKZ N;  1H8A C;  4HX4 A;  2PN6 A;  4A5M A;  1H0M A;  5HS8 A;  5FLX K;  3VYT B;  2FF4 A;  4F93 B;  1YG2 A;  5M5W J;  4HF0 A;  3A03 A;  1T0F A;  5HOO A;  1SD7 A;  4UUT A;  3V4G A;  2M5W A;  5FD6 A;  2GXA A;  1ZHF A;  2VOP A;  3HOU J;  2EIK H;  2R4G A;  1XTA A;  4P5O A;  3PFY A;  1I1G A;  1R1T A;  3O8H A;  5EZH A;  3GTG J;  3HL2 A;  1BM9 A;  4HV6 A;  3R6S A;  3FXM A;  3DLL F;  2HXI A;  1IRZ A;  1N25 A;  1VZ0 A;  2CO5 A;  4DW6 A;  2XSJ C;  2VE9 A;  2K27 A;  4CXF A;  1K4S A;  3KE2 A;  1K79 A;  1FYM A;  5FKM A;  4IRH A;  5ICE A;  1PVE A;  2EIM H;  2HTJ A;  2JA8 J;  2R5Y A;  3O6B B;  1B8I A;  3S2D J;  1YX3 A;  5B66 C;  2EFN A;  1B9M A;  2DT6 A;  4XRS G;  4PGG A;  4J01 A;  5IT9 K;  5ICF A;  3W2A A;  4HDU A;  2K02 A;  1KQ9 A;  2NS0 A;  1WQ2 A;  1XDU A;  2JPB A;  1BR4 A;  2XRO A;  2VT2 A;  3Q0U A;  2LBF A;  2G0E A;  4M74 A;  1HSJ A;  1RNL A;  1USS A;  1ZKG A;  1KQ8 A;  1I6H J;  1K61 A;  2K7L A;  1O3Q A;  3NWS A;  1FOW A;  3VFZ A;  3GTK J;  2LP0 A;  3JRB A;  1XX5 A;  1LNW A;  3WE2 A;  2ZB9 A;  1HCR A;  5F27 A;  1PUF B;  2A5W A;  4GCV A;  2V7F A;  4OIO F;  3HRU A;  1BJZ A;  2KRF A;  2PMU A;  4N0B A;  1WI3 A;  1X3Z B;  1RRJ A;  5IPA A;  3FK6 A;  2HYJ A;  2CV0 A;  5F0H A;  3QQA A;  2LF7 A;  5FKK A;  5ED4 A;  3TW6 A;  3N4M A;  3K70 C;  3ASN H;  4L0Y B;  3OIQ A;  1ZYR F;  1RR7 A;  3DQV C;  1JXS A;  1MJA A;  4WWC A;  2CQN A;  3BPV A;  4U0Y A;  3S3M A;  4D5F A;  1UG0 A;  3ZXS A;  3KIO A;  1FOX A;  4XIC A;  1UHM A;  3HZJ A;  2XAU A;  1BI0 A;  2R7X A;  1YI2 I;  1BC8 C;  5GAE J;  3E5Q A;  4CZC A;  4A3L J;  2CS3 A;  2A6H F;  3R0J A;  3WTU C;  3C2B A;  3KLO A;  1G6N A;  3DPU A;  2EFP A;  4WXD A;  1LPQ A;  2W24 A;  2MC3 A;  1E17 A;  1R5G A;  3EYY A;  3CCL I;  1XS9 A;  2DOA A;  2AS5 F;  1KU2 A;  3DTK A;  2HXO A;  2EZL A;  1Z67 A;  3KYC B;  1CF7 A;  4AVP A;  1SVO A;  2V6E A;  2LFB A;  2COM A;  4JK1 X;  1LEB A;  1W4M A;  3ONQ A;  4CA0 A;  4XOT A;  2OC6 A;  2M0C A;  1F36 A;  2K5C A;  4NQW B;  3KEQ A;  1U3E M;  3FMQ A;  1PYV A;  1R4N B;  3G1L A;  3VOD A;  4JX6 A;  1LB2 A;  1P92 A;  2GA2 A;  5L3B A;  2RVC A;  1MSE C;  4L9T A;  1NH3 A;  3GTQ J;  1J2X A;  1FOK A;  2Z33 A;  3HYI A;  4B43 A;  3V7C A;  2M9H A;  4RLF A;  4IXA A;  1JKR C;  2LDU A;  1BJA A;  4G7Z F;  3S2W A;  2GM4 A;  1APL C;  3IC7 A;  3VSK A;  2BY2 A;  2DA3 A;  2NVX J;  2F5D A;  2HVQ A;  4BAY A;  2OD5 A;  1STZ A;  2CW7 A;  2DK5 A;  2K9L A;  3KPH A;  4ZDO A;  2CUZ A;  3BCB A;  4HYE A;  5DD8 A;  4RLQ A;  5K5Q A;  2R93 J;  2ME6 A;  2FQ4 A;  3L00 A;  4PK4 A;  4CYD A;  1ZG5 A;  5D4R A;  2Z5U A;  4U0W A;  1CGP A;  4Y3O A;  3MD2 A;  4ESF A;  4BXF A;  1UJ8 A;  4MQV A;  4ZDP A;  4ZZL A;  1Z91 A;  2K85 A;  3RI4 A;  2VKE A;  2M87 A;  2HTS A;  3GEZ A;  1UMQ A;  2ZNZ A;  3M3Y J;  2VT3 A;  3BTI A;  2QQA A;  2XAG A;  5LD2 C;  3LQR A;  1BOA A;  1TWH J;  2IGN A;  4HNT A;  2UXN A;  2DYS H;  4IQ4 A;  3SJM A;  2ELK A;  1D0Z A;  3L09 A;  3C18 A;  5K5R A;  3BZC A;  4XLN F;  3WGG A;  3B6C A;  2FMY A;  4A3D J;  3MCZ A;  3LSK A;  4BQA A;  4UXN A;  1YRN A;  3DXJ F;  5ILS A;  4M3G A;  2DFF A;  4O6J A;  4XKV A;  3LAP A;  3H1C A;  3CDL A;  2HEO A;  1IG7 A;  5EEH A;  2A68 F;  2GQQ A;  3CCY A;  1ZGW A;  4I76 A;  3ELK A;  5A2Q Z;  4D1Q A;  4A0Y A;  1GLN A;  2I10 A;  3BTL A;  1JJ6 C;  2E2I J;  4M3D A;  3IWF A;  4IHV A;  1HQC A;  2DFH A;  3T1B A;  2DCE A;  2LF8 A;  3DTE A;  2ESH A;  3IRQ A;  1FP2 A;  3CUQ A;  3RYR A;  5FKL A;  1VQM I;  4KUM A;  1TP4 A;  4HW0 A;  3TDZ C;  2KIM A;  3E6D A;  3JAM Z;  4MTD A;  2WAQ A;  3HSR A;  2IRF G;  2ID6 A;  4FQG A;  2VJJ A;  2WV0 A;  3OYI A;  2IA1 A;  2VBX A;  3DEW A;  4I2O A;  4F92 B;  2X6W A;  2KL4 A;  1WPK A;  3HSE A;  4KIG A;  2KLO A;  3E6C C;  1HLV A;  1FTZ A;  3CUQ C;  1BW5 A;  2PJP A;  2EZK A;  2W84 A;  3KX2 A;  4D7N A;  2KMU A;  2FRH A;  2L54 A;  3FXL A;  2YUS A;  1ON1 A;  3DU5 A;  4LJZ F;  2Z3Y A;  3SXY A;  2BVM A;  3ESW B;  4P96 A;  5BMZ A;  1ZRF A;  2FU4 A;  2W57 A;  2A6E F;  1RKW A;  4MTE A;  4J19 A;  3HOY J;  2EH3 A;  2FUG 2;  4NC7 A;  1ERD A;  2KJC A;  2RAE A;  3BZ6 A;  4GXO A;  3DU6 A;  4CCN A;  4CSW A;  4ZYH A;  5C3E J;  4A3E J;  1F5T A;  1Y0N A;  3K2A A;  4FAS D;  3HUG A;  3BG5 A;  2QLZ A;  2A3S A;  4FX4 A;  1HKS A;  4RGR A;  2A6T A;  5FRN A;  4BH9 A;  3PSF A;  4W1U A;  4FCY A;  5E3N A;  1QPI A;  4B48 A;  2XGD A;  4N9I A;  3FMS A;  2OBP A;  3FMR A;  1JUS A;  1VQO I;  1J59 A;  1HF0 A;  4Q48 A;  1QVU A;  4YII A;  2V1N A;  3LAJ A;  1OMI A;  2H6C A;  3UKG A;  5A2Q K;  1JUM A;  3MKW B;  4BKX A;  1RC9 A;  3BWG A;  2R5Z B;  3OYE A;  3DKW A;  3BR0 A;  1ZG3 A;  2WB1 N;  2YPR A;  2OU2 A;  5IT3 A;  3CCQ I;  2HOE A;  1R23 A;  3E5U A;  1BR1 A;  2LKS A;  1EJ9 A;  2VPL A;  2EV0 A;  2QSF X;  4OMZ A;  1VQ6 I;  3K1M A;  2W1O A;  4IHW A;  2HWV A;  1MSF C;  2CV2 A;  3OYG A;  4BNC A;  5HS9 A;  3J81 Z;  2JTV A;  3DKX A;  2MC4 A;  2B9S A;  1ZH5 A;  2P5K A;  3HG9 A;  3PJR A;  3I59 B;  3H0D A;  1ONV A;  3BJO A;  5JI6 A;  2HOS A;  3ECH A;  3H3U A;  3T5X A;  2BW3 A;  2V1X A;  2RC4 A;  3WG7 H;  5FKN A;  3WGI A;  1DDN A;  2K9N A;  3CF5 F;  2K9M A;  2ZKZ A;  4MGR A;  1D0X A;  2DDB A;  4FE4 A;  3W2V A;  2HPM A;  1DU6 A;  2FOW A;  2JUG A;  3VEP A;  1SFU A;  2LVS A;  1VF9 A;  1G3S A;  4R1H A;  4A3F J;  3K70 D;  1BR2 A;  2WAD A;  4QTR A;  3KET A;  3I54 A;  1XMX A;  3LSH A;  3BOQ A;  1TQM A;  2Y69 H;  3FHZ A;  3D1N I;  1K6Y A;  3ZMS A;  2GIV A;  2HFH A;  2V9K A;  4PFO A;  2CQQ A;  3E1S A;  3M7G A;  1FYK A;  3GXO A;  1FEX A;  4HDV A;  1Y56 A;  2CW8 A;  3K4B A;  1YO5 C;  4U7B A;  4BHC A;  3P5J A;  3GWZ A;  2R3S A;  1T39 A;  1W5T A;  4UVB A;  1Z0X A;  5AIQ A;  1IN6 A;  3S3O A;  3DP7 A;  2OTL I;  2K4J A;  3TO7 A;  1X3U A;  2E36 A;  4MEY F;  1MH4 A;  3BTJ A;  3BC8 A;  1F43 A;  4ZZD A;  1O4X A;  2V9V A;  3IRR A;  4C3H J;  4AIH A;  1HKQ A;  4X1E A;  1W7P A;  2NS8 A;  1MKM A;  1KGS A;  5F08 A;  5BNG A;  4IRG A;  1OYI A;  1HXD A;  3JRE A;  2VXZ A;  3OSF A;  2R7S A;  3IHU A;  1BIA A;  1Y8R B;  3S1N J;  3G6E I;  1T95 A;  3S15 J;  2Z2S B;  4A5N A;  3LA2 A;  4ETS A;  3FXJ A;  1JHH A;  3GME A;  1A35 A;  3I71 A;  1DGW Y;  3C1D A;  5DM7 F;  3HTU A;  4XLC A;  4D9J A;  1XCV A;  2WAQ N;  2X4H A;  3KP5 A;  4HLY A;  3S93 A;  3FHN A;  1X4O A;  3CO6 C;  4E7Z A;  1KA8 A;  1AHD P;  5CJ9 A;  1LEA A;  3VB2 A;  5J1R A;  1IDY A;  1HKT A;  1Y1V J;  4GYI A;  2YU9 J;  2XGE A;  2VBY A;  4DOZ A;  1SFX A;  1V5E A;  3MAJ A;  2P7V B;  3ZQG A;  5IP6 A;  2DXI A;  1XC5 A;  3WGH A;  2MFZ A;  3H35 A;  3T8T A;  1UB9 A;  1DP7 P;  3HIF A;  1WZ2 A;  3MEX A;  4XRS A;  4FIS A;  2F5C A;  1OLT A;  3MZ8 A;  5D5W B;  2PFB A;  1V5F A;  2ADU A;  1N75 A;  2DA6 A;  3LFU A;  2P7C B;  4IHS A;  2P5V A;  1ODD A;  2VQC A;  3HKZ A;  4HBL A;  1GDT A;  5GAG J;  2O8X A;  3KCC A;  4DNC A;  4O3M A;  4P55 A;  1TNT A;  2KT0 A;  1U5T B;  3RKQ A;  1BI1 A;  1S3J A;  4ZYA A;  3DPT A;  4EV0 A;  2E1O A;  1IZ1 A;  3BTC A;  2CJJ A;  3PQJ A;  5HNH A;  3OYN A;  4PSX A;  2JJ7 A;  3RKW A;  3PUB A;  3QOD A;  2QQB A;  3HOW J;  3EUA A;  1ZRE A;  2QVO A;  1IN4 A;  1XMK A;  1VQN I;  4XNF A;  4BL0 B;  4A12 A;  1IF1 A;  1Y0U A;  4Y13 A;  4ENN A;  4BJT A;  2E2H J;  2WY7 Q;  1H89 C;  2VC1 A;  1MNM C;  3IV5 A;  2IS2 A;  4WF2 A;  1SD5 A;  3TOB A;  3ECO A;  3L9F A;  4XKB A;  3OYB A;  2RNJ A;  4XID A;  3GX4 X;  1VQL I;  4S05 A;  2JA2 A;  2LH9 A;  3IP4 B;  1MBF A;  1BW6 A;  1IXS B;  1R22 A;  3IAS 2;  2M4G A;  1J75 A;  4OIR F;  3CUQ B;  2KZG A;  3SZT A;  3MWM A;  4F7Z A;  4X6A J;  2BGC A;  2JVG A;  3AKZ A;  3A0B C;  4PDK A;  1P4A A;  3ABK H;  1MJ9 A;  1EH6 A;  2EBI A;  1SMY F;  2NOG A;  4F3Q A;  5C4J J;  3KP4 A;  1O7F A;  3CQZ J;  1A6I A;  2VB6 A;  1SFE A;  3U1K A;  4ITV A;  2O61 A;  1B72 B;  2MH2 A;  1B1B A;  2O0Y A;  2R7D A;  2XF7 A;  2FEZ A;  2RV8 A;  3HJE A;  2WA0 A;  1DQU A;  2DFE A;  1U8R A;  1WWX A;  4OOI A;  5LHI A;  3S1R J;  5K7H A;  3R60 A;  3GBG A;  1Z3Y A;  5J40 A;  1XDS A;  2EV6 A;  4E7L A;  1WSU A;  3OOP A;  2A05 A;  3CCR I;  2VBW A;  3P9K A;  4G6Q A;  3FXO A;  3CDH A;  1GVJ A;  2CFX A;  2MYS A;  1F1Z A;  3N05 A;  2WC2 A;  3M1E A;  3TOA A;  1D1B A;  1TLH B;  4PUS A;  3PNY A;  3TQN A;  3FIW A;  3ZMD A;  5BOX A;  3IL2 A;  3F8C A;  2P0W A;  1HW1 A;  2KDZ A;  4ENK A;  3OR1 C;  4MFD A;  1OCZ H;  2JUC A;  3RSN A;  2D1H A;  2DN0 A;  3LL7 A;  4E4H A;  1F9N A;  2EJR A;  3COA C;  1MND A;  4C2T A;  1NG7 A;  2XGX A;  1R00 A;  4JBA A;  4A3I J;  3KEY A;  3IAM 2;  2CU7 A;  3PUF A;  3WU2 C;  4DYR A;  5HDG A;  2VQL A;  2W4S A;  2JPC A;  3M07 A;  2EIJ H;  2NVY J;  1M1E B;  2GWR A;  1TWA J;  2E19 A;  1JKO C;  5DS9 A;  5HS7 A;  1Z6T A;  3JTG A;  5H2F C;  3FBI B;  3ZMU A;  1OR7 C;  4EJW A;  1GV5 A;  3V8J A;  2R5Z A;  2CUJ A;  3WU0 A;  1FIP A;  3M8E A;  4E7S A;  3ZPL A;  4IKF A;  3G1M A;  3A02 A;  3ZMV A;  1FYL A;  4HQE A;  4HX7 A;  1HW2 A;  1B72 A;  4XLP F;  2VLA A;  4EGY A;  2ESN A;  1LFP A;  2OV7 A;  4GYG A;  1IW7 F;  1ZR2 A;  4RGX A;  1WJD A;  4XN3 A;  3JAM K;  1YQA A;  3RZD J;  2VJI A;  3I59 A;  2DOE A;  1SEU A;  1RES A;  4B4C A;  5TGT A;  2L4M A;  4YRV A;  1U0J A;  2ZNY A;  3KFW X;  1ZQ3 P;  3U2R A;  2IEK A;  4AU7 A;  2Y0M A;  2R5Y B;  1JKP C;  3FXK A;  4AIK A;  4XOP A;  4M9S A;  2M0M A;  4UVC A;  2HPI A;  4B47 A;  1I1S A;  4A0Z A;  2EWN A;  3BCA A;  4DGW B;  2LY2 A;  2LLK A;  4A93 J;  2ZBK A;  2XB0 X;  5HNF A;  4NC8 A;  3C2G A;  1V3F A;  4Z6Y A;  2M34 A;  2GZW A;  2E1N A;  1GT0 C;  1ORK A;  5CVU A;  5D5V B;  4BJ6 C;  1FMV A;  3LSG A;  5E8G A;  4Y7N J;  5HLH A;  3NAR A;  4HRI A;  3ZQL A;  4NHJ A;  3OS0 A;  2GXG A;  3W3C A;  3IKT A;  3WTV C;  2Y30 A;  4I0B A;  1X1C A;  3LFK A;  2IPQ X;  4PJJ A;  4AIJ A;  4UY8 I;  3LST A;  2E60 A;  2LYC A;  2OZ6 A;  5HVQ C;  2CH0 A;  3J80 K;  3WHC A;  1RZ4 A;  1X19 A;  3HC7 A;  3KZI C;  1XGS A;  1IAW A;  4DZJ A;  2ZJP F;  4ZJZ A;  3VOE A;  3ABM H;  2VON A;  4IX7 A;  4EVI A;  2VN2 A;  2XRL A;  4Z2Y A;  3HB9 A;  4MFE A;  4UB6 C;  3N97 A;  4NB5 A;  1S5L C;  1YLF A;  4PFP A;  2QKL B;  4UUS B;  4BXU A;  4X0G A;  4CUG A;  2FA5 A;  2JA7 J;  2FNA A;  4KIT B;  5HOD A;  1I5Z A;  1I39 A;  5E1Z B;  5K7F A;  2XVC A;  2XGC A;  3TO6 A;  3HHG A;  4E70 A;  5B3S H;  2F4O B;  3CCS I;  3OYD A;  2BOL A;  2VIX A;  4C9Y A;  2IT0 A;  3L2U A;  1S7A A;  1P9Q C;  4ZTJ A;  1PDN C;  2Q0O A;  3H5N A;  2CFO A;  2D2W A;  4UVA A;  4II2 A;  4FHT A;  4M3B A;  3M8F A;  1K83 J;  1X1P A;  1SFO J;  5ILV A;  3HTS B;  2W48 A;  4CCO A;  1S7E A;  3F21 A;  4ASN A;  3DWL E;  3GLL A;  2HOA A;  3CLQ A;  1A5J A;  1R5I D;  1Y8Q B;  5CVR A;  2GOX B;  5D6F A;  1P2F A;  3E0J B;  5M5X J;  1VQ9 I;  3RQI A;  5BPI A;  2ZSH B;  1J9I A;  3ZQI A;  1QPM A;  4BY7 J;  1SAN A;  3CUO A;  5D5U B;  2HZT A;  3DLA A;  4WX9 A;  4S04 A;  4F55 A;  3RPU A;  3K7A J;  4XRM A;  3CES A;  4CGZ A;  3FKI J;  1O3R A;  1U5T A;  2K40 A;  3EUK L;  3GTP J;  5E3M A;  1D8J A;  1ZRC A;  2HVS A;  3TP3 A;  5DV5 A;  3LSP A;  3TW7 A;  3F3X A;  3L1P A;  2DTR A;  2BXY A;  2CWE A;  1J09 A;  2JVH A;  1MH3 A;  2L7M P;  4HOB A;  3W6J B;  3E6M A;  3AL0 B;  1DPU A;  2CUE A;  2WB1 A;  3CP8 A;  1A36 A;  1Z05 A;  4HF1 A;  2HQ5 A;  1SFK A;  2UWM A;  1REP C;  4OIN F;  3MZY A;  4L9N A;  1E3P A;  3JRC A;  4BE2 A;  3TED A;  1UAA A;  2XSD C;  5EDN A;  1EV7 A;  2K9S A;  2KJB A;  2L4A A;  1TW3 A;  2WV1 A;  1R9T J;  2JSP A;  3PO3 J;  1R36 A;  3OYA A;  4NC6 A;  3UR3 C;  1T38 A;  1WJF A;  3IH4 A;  2H6B A;  2LMD A;  4HEA 2;  3RQ4 A;  4IQJ A;  3S1M J;  1QQI A;  4M6Y A;  4C3I J;  3S17 J;  1VQK I;  3H5R A;  1XSX A;  1GVD A;  2CSO A;  1BN5 A;  4LK1 F;  5FD5 A;  3DCF A;  5GPC A;  3D0S A;  4WXC A;  4KFC A;  3D5S C;  1FTT A;  3QP6 A;  2Y9Z A;  1JGG A;  1O7L A;  1R49 A;  4L9V A;  2ZCW A;  4A69 C;  2DLL A;  2DA1 A;  4JQF A;  3PIP F;  5L3D A;  1WCM J;  1Q1H A;  2OPT A;  3RKY A;  5FRM A;  3KZY A;  1QO0 D;  4U0V A;  5JHU A;  3JRG A;  1O3T A;  4E6K G;  4V19 K;  3RDI A;  1MDM B;  3HOV J;  1ETO A;  1VQP I;  2HQA A;  4LIU A;  5CQE A;  1FPQ A;  2KIS A;  2X0L A;  3WU1 B;  4P9F A;  1PUF A;  3OY9 A;  1D5V A;  3CCE I;  2HYG D;  4CDG A;  2ID3 A;  2KIF A;  3HOS A;  5KAF C;  2IBD A;  3BJ6 A;  4RDU A;  5EF6 A;  1YW8 A;  4XLF A;  2K86 A;  3KP3 A;  2XF6 A;  1D1A A;  3ERM A;  4IHY A;  3H9G A;  1MMS A;  5K7Z A;  1E3H A;  2DBB A;  1NK2 P;  1JHF A;  2KP6 A;  1IXC A;  1G59 A;  1IRG A;  2OZU A;  4AC0 A;  1S7O A;  1RUN A;  1FBU A;  1IJW C;  4IVN A;  2DT5 A;  1T33 A;  1HW5 A;  4JYK A;  1W0T A;  5ILU A;  3QPT A;  4HG2 A;  2FD5 A;  4KNY A;  5L3E A;  2NNY A;  4AYB A;  4BJ5 C;  1JE8 A;  2NVT J;  2MD5 A;  3DTI A;  4CH7 A;  1FIA A;  2IVM A;  2EK5 A;  5IY5 H;  2JN6 A;  3D5R C;  2F5V A;  3HUG B;  4N4N B;  2AQF A;  3SEZ A;  5E18 F;  1IC8 A;  1V5G A;  2C6Y A;  1QZE A;  2KRH A;  2CGP A;  4CCK A;  3TGN A;  1ETK A;  1EA3 A;  3I3L A;  2CMP A;  2CYY A;  3GZ5 A;  3FBN B;  3A4C A;  5E79 C;  1ZEL A;  4EEF G;  2DA5 A;  1CF7 B;  4UB8 C;  4CCL A;  3K4N A;  3CJN A;  4IOC F;  4BXX J;  3CCJ I;  4S0H B;  5B1B H;  1W36 C;  2E1C A;  1I50 J;  2D5V A;  2VOO A;  4NQW A;  1ZGJ A;  2L0K A;  2YX4 A;  1U8B A;  4MIM A;  2DPU A;  2IS6 A;  3E7L A;  2R7U A;  2DMQ A;  1XPX A;  2DT7 B;  3OL3 A;  1XSD A;  4LLN A;  2FNP A;  4RAG A;  4G7O F;  2DOD A;  1YW9 A;  2MH9 A;  4EM2 A;  2O6G E;  1LJ9 A;  4BQQ A;  1LVK A;  4YFN F;  1TT0 A;  2WY8 Q;  5J8C A;  2BY0 A;  5LBQ A;  1Z9C A;  2DPD A;  1IUF A;  1XD7 A;  2E34 A;  3QOE A;  4BAC A;  4LD5 A;  2B7E A;  5DCM A;  4YG2 F;  2GXB A;  1H88 C;  1X1D A;  1QVT A;  5JVT A;  1JJ8 C;  3KYD B;  2HZD A;  1RPW A;  2L7K A; 
#chains in the Genus database with same CATH homology
 1Y1V J;  2XB5 A;  2O9L A;  2YU9 J;  5FKO A;  2XGE A;  2TRT A;  2MG4 A;  2DMN A;  1JT0 A;  2PMZ N;  2MSY A;  3ZQH A;  5IP6 A;  3ZQG A;  1YRN B;  1GUU A;  1NTC A;  1XC5 A;  4LOC A;  3HOX J;  3LNQ A;  4AYB N;  4UUS A;  5EGO B;  1UG2 A;  2HOT A;  1Q1V A;  4FIS A;  4XRS A;  2JMW A;  2TCT A;  2O8K A;  9ANT A;  5FLM J;  5EG0 A;  2EZI A;  3A01 B;  2Y31 A;  4MLO A;  2HI3 A;  1D5Y A;  1ETY A;  4W97 A;  1JT6 A;  2DA6 A;  2HDD A;  1DU0 A;  2Y9Y A;  1B8I B;  3GTJ J;  1GDT A;  1FJL A;  4B1R A;  3ZQF A;  1ETW A;  5J1U A;  5IP7 J;  1POG A;  2KT0 A;  3RKQ A;  2E1O A;  2LTP A;  5IOZ A;  3BTC A;  2CJJ A;  2DA2 A;  2CUF A;  2CQX A;  2JJ7 A;  1TWG J;  3HOW J;  2DA4 A;  2ECC A;  3OSG A;  1UHS A;  1X2M A;  4A3J J;  5EZG A;  3I4N J;  1RET A;  2JWT A;  2L7Z A;  2E2H J;  1H89 C;  1NK3 P;  1MNM C;  3IV5 A;  4A3C J;  1GV2 A;  1X2N A;  3BQY A;  3PM1 A;  4JX4 A;  4XID A;  1ENH A;  5IYC J;  1ETX A;  3HKZ N;  2LY9 A;  1MBF A;  1BW6 A;  1H8A C;  1ETV A;  2GBY A;  3VPR A;  4V2G A;  4X6A J;  5M5W J;  3A03 A;  1EF4 A;  4UUT A;  2AO9 A;  4I6Z A;  2DMP A;  3JRD A;  2NOG A;  2EBI A;  3HOU J;  2MGQ A;  5C4J J;  1U9N A;  3CQZ J;  5EYR A;  1A6I A;  3O8H A;  2DJN A;  5EZH A;  3GTG J;  4M6V A;  1JKQ C;  1B72 B;  2R0Q C;  3Q0W A;  1AU7 A;  3MN2 A;  2LD5 A;  2HXI A;  3S1R J;  1IRZ A;  5K7H A;  4DW6 A;  3GBG A;  1ETQ A;  5FKM A;  3A01 A;  1U9O A;  2JA8 J;  2R5Y A;  5E3O A;  1B8I A;  3S2D J;  1IDZ A;  1MBE A;  3MVP A;  3S16 J;  4XRS G;  4C2M J;  2NVQ J;  3FIW A;  3Q0U A;  2G0E A;  1ZKG A;  1I6H J;  1K61 A;  3IH3 A;  3GTK J;  2KDZ A;  2LP0 A;  3JRB A;  3F0C A;  4A3G J;  2ZB9 A;  1HCR A;  4FTH A;  4MFD A;  5F27 A;  2P81 A;  1PUF B;  2DN0 A;  3IH2 A;  1BJZ A;  3JRI A;  1WI3 A;  2LK2 A;  5IPA A;  5E3L A;  4B3A A;  4A3I J;  3FK6 A;  4AUX A;  2HYJ A;  2CU7 A;  4DYR A;  5F0H A;  3QQA A;  5C4X J;  5FKK A;  2NVY J;  3TW6 A;  4JP0 A;  1TWA J;  2E19 A;  1JKO C;  5DS9 A;  1P7I A;  1HDP A;  1RR7 A;  4A3B J;  1GV5 A;  2R5Z A;  2E2J J;  5EEA A;  1FIP A;  4D5F A;  3NAU A;  4XIC A;  3G1M A;  3OOU A;  5IYB J;  3A02 A;  4A3L J;  5JLW A;  2LKX A;  3C2B A;  1B72 A;  2M8G X;  3JRA A;  1ZR2 A;  1QRY A;  1CQT A;  3RZD J;  3HM5 A;  1XS9 A;  1RES A;  4B4C A;  3GTO J;  2COB A;  2HXO A;  4CYC B;  2EZL A;  1ZQ3 P;  2IEK A;  3HBL A;  2R5Y B;  1JKP C;  5F0C A;  1TC3 C;  5IOY A;  4IHX A;  2X9D A;  2LFB A;  3FK7 A;  4ABZ A;  2DTZ A;  3GTL J;  2M0C A;  1F36 A;  5GP9 A;  3G1L A;  2LLK A;  4JX6 A;  5GPA A;  4A93 J;  2XB0 X;  2M34 A;  4D5C A;  3CMY A;  1GT0 C;  1ORK A;  1MSE C;  2XPV A;  3GTQ J;  2OF7 A;  3LSG A;  1ZK8 A;  4Y7N J;  3NAR A;  3ZQL A;  2ME0 A;  3Q3S A;  2M9H A;  3SDG A;  1JKR C;  2Y30 A;  1WH5 A;  2FX0 A;  2X48 A;  2GM4 A;  3O8G A;  1APL C;  3WHC A;  1IV6 A;  3W6V A;  2DA3 A;  2K9Q A;  2NVX J;  4DZJ A;  1VI0 A;  1TWC J;  2VPR A;  3FIS A;  2AHQ A;  2XRL A;  5C44 J;  4QSH A;  3HB9 A;  1OCT C;  4MFE A;  2R93 J;  2ME6 A;  2FQ4 A;  4DYQ A;  4UUS B;  4BBR J;  2JA7 J;  5HOD A;  3BR3 A;  5K7F A;  2B63 J;  2VKE A;  2XGC A;  1UMQ A;  1TWF J;  3M3Y J;  3BTI A;  2Y0S N;  1TWH J;  4CYC A;  3I4M J;  3SJM A;  4M3E A;  5DTD A;  2ELK A;  3OIO A;  1LE8 B;  2VUM J;  2LR8 A;  4M3B A;  1K83 J;  1RKT A;  3B6C A;  1SFO J;  2VI6 A;  4A3D J;  5M3F J;  4GFB A;  2JK3 A;  1ZR4 A;  2W48 A;  2GLO A;  1IGN A;  1YRN A;  2JA5 J;  3GTM J;  1S7E A;  2QF7 A;  4M3G A;  2HOA A;  1A5J A;  3CDL A;  3BG9 A;  3WHB A;  1IG7 A;  4HNV A;  4DYC A;  5EG0 B;  3CCY A;  1ZGW A;  4I76 A;  3RZO J;  5M5X J;  1OJL A;  3RQI A;  5J3L A;  3H0G J;  3ZQI A;  2IAI A;  4QIW N;  2XPU A;  2I10 A;  4BY7 J;  1SAN A;  3BTL A;  1LFB A;  1JJ6 C;  2E2I J;  4M3D A;  4IHV A;  4RBO A;  3K7A J;  4XRM A;  1MBJ A;  3FKI J;  5FLV A;  1X58 A;  2K40 A;  5FKL A;  4JX5 A;  5E3M A;  3GTP J;  2H8R A;  2MW8 A;  3TP3 A;  3LSP A;  3TW7 A;  3ZOB A;  2ID6 A;  3L1P A;  5M3M J;  3DEW A;  2FJ1 A;  3QPS A;  1WPK A;  1MH3 A;  2L7M P;  1HLV A;  3BG3 A;  1FTZ A;  3LSJ A;  1BW5 A;  3ZQC A;  2CUE A;  2EZK A;  1WGX A;  3BR2 A;  4D7N A;  4L5E A;  2HQ5 A;  2N8G A;  2YUS A;  5IP9 J;  1Z77 A;  3JRC A;  3TED A;  2XSD C;  2XPW A;  5EDN A;  1XG1 A;  1RKW A;  2K9S A;  4J19 A;  1LE8 A;  3LSR A;  5FJ8 J;  3HOY J;  2EH3 A;  2WV1 A;  1R9T J;  3SFI A;  3S1Q J;  4DZP A;  3PO3 J;  2RAE A;  4FE7 A;  5C3E J;  4A3E J;  2Y2Z A;  2R7Z J;  3IH4 A;  2CRG A;  3K2A A;  4BY1 J;  3S1M J;  2H1K A;  3BG5 A;  3QPL A;  5M5Y J;  4C3I J;  3S17 J;  1QPI A;  3LOC A;  3HGY A;  4W1U A;  4D7M A;  5F1J A;  1GVD A;  5E3N A;  4FCY A;  1VFC A;  2XGD A;  3Q0V A;  3BR6 A;  3DCF A;  5GPC A;  3H3V K;  1JTY A;  1AKH B;  1MBG A;  3MKL A;  1FTT A;  1JUS A;  2Y9Z A;  1JGG A;  1JUP A;  1HF0 A;  1QVU A;  3BR5 A;  4A69 C;  2DA1 A;  3TP0 A;  1WCM J;  2OPT A;  5F0F A;  3UKG A;  1VND A;  1JUM A;  4BKX A;  1P7J A;  3JRG A;  2R5Z B;  3BR0 A;  2WB1 N;  3HOV J;  1ETO A;  5JLX A;  1HOM A;  4C3J J;  2L7F P;  2R92 J;  4IHW A;  3JRH A;  1PUF A;  1ZTR A;  1MSF C;  3S2H J;  3BQZ A;  2EQR A;  2ID3 A;  2EZH A;  2NS7 A;  3S14 J;  3BR1 A;  2IBD A;  2O7O A;  4RDU A;  5EF6 A;  2JA6 J;  2L9R A;  4XK4 A;  1U78 A;  4IHY A;  2HOS A;  5K7Z A;  2M2E A;  1NK2 P;  1E3O C;  3B6A A;  3G1O A;  5FKN A;  4AC0 A;  4M3F A;  2K9N A;  1IJW C;  1BA5 A;  3JR9 A;  1T33 A;  3HEF A;  4FE4 A;  4JYK A;  1W0T A;  3M4O J;  5F04 A;  2FD5 A;  2YS9 A;  1DU6 A;  2VKV A;  3HGG A;  2LVS A;  1VF9 A;  4A3F J;  1T56 A;  1LFU P;  4QTR A;  3BT9 A;  4IEJ A;  5EGO A;  2NVT J;  3JRF A;  1FIA A;  3D1N I;  5IYD J;  2JN6 A;  5J1Y A;  4NDL A;  2CQQ A;  1FEX A;  2DMU A;  1JTX A;  1IC8 A;  4Y52 J;  2DA7 A;  1ETK A;  1I3Q J;  1MBH A;  1Z0X A;  2DMT A;  1AKH A;  4EEF G;  2DA5 A;  4BXX J;  1MH4 A;  3BTJ A;  4S0H B;  1F43 A;  1O4X A;  1Y1W J;  1I50 J;  2D5V A;  4C3H J;  1G2H A;  2L0K A;  4X1E A;  1U8B A;  4MIM A;  3E7L A;  2X6O A;  2DMQ A;  2NS8 A;  5F08 A;  1OCP A;  5BNG A;  4G12 A;  1W0U A;  3JRE A;  3OSF A;  3S1N J;  1MBK A;  4MO7 A;  1BL0 A;  4A3M J;  3PO2 J;  3S15 J;  4BBS J;  4V2F A;  1ITY A;  1HDD C;  1OFC X;  3HDD A;  1IUF A;  2WAQ N;  2ECB A;  4A3K J;  3HOZ J;  1H88 C;  1AHD P;  1QVT A;  1WH7 A;  2QCO A;  1JJ8 C;  5J1R A;  1IDY A;  1RPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...