3ZMDA

Crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
148
structure length
148
Chain Sequence
TRWLTDTEQCAWRTHLEVNRLLTHQLEKDLQPFGLTMNDYEILVNLSESEGDRMRMSDLATATMQSKSRLSHQITRMENANLVRRENCESDRRGLFAVLTEHGLETMRKVAPHHVASVRRHFIDLLAPEDLTELDKALKPIAEHLRGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE TRANSCRIPTIONAL REGULATOR
publication title Crystal Structure of Absc, a Marr Family Transcriptional Regulator from Streptomyces Coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 54
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zmdA00
4FX0A 2STWA 3VB2A 1Q1HA 5HDGA 5FO5A 1BOAA 2JT1A 2V1DA 2KKOA 3I59A 2XHKA 2L3DA 2M5WA 3F23A 2XGXA 2DU9A 3LA7A 4I2OA 3FMQA 1LEAA 1R36A 3LFKA 2IW5A 3FXRA 1IF1A 5LLQA 2XAHA 2E7WA 2M8EA 2DLLA 4ZZLA 4EMSA 4U0YA 1XB4A 1XCBA 2XASA 2FNPA 1SFEA 2VT2A 1YFHA 3ZMSA 3KP7A 2EFOA 3GUDA 3HUGA 4CYDA 1B4AA 2V1UA 2DO7A 1HXDA 4A0ZA 1I1GA 2P7VB 1C0WA 1PDNC 4PDKA 4UV8A 5D5VB 2XAGA 1IN6A 4EVIA 2O0YA 3C7JA 5HDNA 5LBQA 3ZMDA 1YG2A 3QRFF 1W7PA 2KIMA 1XGSA 4ETSA 3T0YA 3ECHA 4GCVA 4MTEA 2MH9A 2CGPA 3WG9A 1USSA 5JVTA 4HQMA 2AXLA 1KQ0A 1WWXA 2QQAA 3ABUA 3I0TA 1FZPB 4B09A 2WV0A 2H94A 2M1BA 4AWXB 2P5LC 2FOKA 1R7JA 2VN2A 6PAXA 1ZHFA 2VOPA 5A2QZ 4OU0A 1TQMA 1OR7A 3LWFA 1ZG5A 5E18F 3E6BA 3F3XA 4BYYA 2X4HA 4CDGA 3HTUA 4JK1X 2UWMA 3VOEA 1SD5A 4KUMA 5ED4A 4O3MA 4OIOF 2HKXA 2Q2EA 2DK5A 1USTA 3Q5FA 2EV0A 5DUKA 3IWZA 4S05A 1ZG3A 3FMSA 2HOEA 3GO5A 4KFCA 1LNWA 5BS6A 4A5MA 1R5HA 5FB2A 4XLNF 3EDPA 1XN7A 2R3SA 1OKRA 5DYMA 3M9AA 3GFMA 3K2ZA 4QWQA 5HVQC 1WSUA 1QO0D 3FX3A 4GXOA 2XAFA 1HBXG 4KN4X 2IT0A 2IJLA 2G7UA 1TQIA 1YTYA 2B0LA 3KP6A 4M71A 3ABTA 5A2QK 2EV6A 1LEBA 5FGMA 2ACJA 5JFRA 4LG0B 4ESJA 1LQ1A 2K27A 1W7PD 1AWCA 1ONVA 2H27A 5L3DA 1H9GA 1TBXA 5DD4A 4RGUA 4IJAA 1FP1D 3GEZA 3MCZA 3J80Z 1XGNA 3DEUA 2LKPA 4HV5A 1U5TA 3F22A 2VE9A 5HS9A 2MD5A 1JGSA 3O3KA 2WTEA 3C3WA 2DQRA 4MEXF 5E8IA 1MZBA 4D0PA 2J5PA 3HRMA 1W5TA 1XGOA 1KYWA 2OA4A 1R1TA 3ISPA 5E17F 2A5YB 2JRTA 1XGMA 2BEOA 4EM0B 3OV8A 2RC4A 2HS5A 1TQPA 4KMFA 1B9NA 4Y17A 1O3TA 3ZPLA 1B59A 4EJTA 4HOBA 5D4RA 1FOKA 2DAOA 2JTVA 1K6OA 4UXNA 2ZO4A 5ICFA 3EYYA 3G73A 4HLYA 3DPTA 3WTUC 1JHFA 3AAFA 4FHTA 1R1VA 5DUIA 1FP2A 3C1DA 4DQ2A 3TOAA 1KYZA 2A07F 1OYYA 2GQQA 3BP8A 5JHUA 3CDHA 3M7GA 3QAHA 5DCMB 4HX7A 4RGRA 3J80K 2VXZA 1QBJA 3G3ZA 3U1DA 1U2WA 2VE8A 4BHCA 4A6EA 2NNNA 4L5JA 4NB5A 1XCVA 4YG2F 3GLXA 1IXRC 4TV7A 3WTTC 1R00A 2XROA 1ZGJA 2FSWA 1QZZA 5HLGA 3E5UA 2ISZA 3JTHA 2AS5F 5J8FA 4KN7X 2KJCA 3R4KA 4MHGA 2WC2A 4L18B 2ZNYA 4FT8A 2ETHA 1TW3A 1U6GA 3CUOA 1F1ZA 2ZFWA 3IKTA 1HW1A 4H0EA 3V7SA 5H20A 4A5NA 5LGTA 4LB5A 2GA1A 2F2EA 2DW4A 2DPUA 2PLYA 2EFWA 2K02A 1ZLKA 1MJ9A 5AIPA 4M9SA 2Q8KA 1ULYA 1D8KA 2VBYA 2P4WA 3IHUA 3DV8A 4OIRF 1MD0A 3RKYA 3WU1B 1WQ2A 1K79A 1S29A 2LF8A 3R60A 3MQ0A 4HW0A 5CYVA 1X3UA 5L3CA 4XRFA 3VFZA 1CF7B 1IXSB 3OOPA 4L9TA 4U0WA 5LGUA 1R23A 1MDMB 1G3WA 3I71A 2ESNA 3BPVA 2YPRA 3U2RA 2L02A 3TOBA 3DP7A 1HW5A 1WKMA 2PFBA 3ERED 2Z5UA 1TW2A 1G3SA 1MGTA 1B9MA 4FX4A 2PBIA 4U7BA 5ICGA 4UV9A 5L3EA 1R5GA 1HSJA 5DCFA 3GWZA 3LSTA 5H6RA 3HRUA 4DNCA 2FU4A 4OMYA 4HBLA 2MC3A 3LQQA 1FNNA 5D8LB 2IVMA 3P9IA 2XUBA 4UNOA 1XSVA 3ZMUA 1S7OA 4P5OA 1W5SA 3LA2A 3W6JB 2P6TA 3IRQA 1YO5C 3FF5A 5ILVA 3CLOA 2PJPA 4Y13A 4RAZA 2D45A 1BN5A 1ZGAA 5DDGA 3T8RA 1T6SA 2HQNA 1R1UA 1SMTA 4M72A 2OZ6A 3HRSA 1KU3A 2FF4A 4P55A 1RNLA 4PGGA 1WI9A 2PMUA 3RYRA 3KZZA 4ENKA 3SFZA 2Z33A 4L0ZB 5D5WB 3P9CA 5EEHA 1H9TA 2GA2A 4LK1F 3T5XA 1HW2A 1REPC 2VONA 3JAMZ 1FSHA 4L9VA 1U3EM 4KICA 2DPDA 1VTNC 1LJ9A 1S6LA 3FWEA 2OBPA 1OYWA 2Z3YA 3I64A 4JQFA 1JXSA 1LB2A 1D3YA 4CZZA 3E6DA 2C6YA 3H3UA 5CVRA 4Z2YA 5IT9Z 1GXQA 1XMKA 1YYVA 1DPUA 4U0VA 5TRDA 1U8RA 5BPDA 3Q9SA 4LG0A 2PG4A 3CUQB 3B02A 1TNTA 3VEPA 3RPQA 1UHWA 2M45A 4BQAA 5E20A 3HSEA 2W85A 2HYFA 3V4GA 2K4JA 3FHZA 1ZRCA 2HKOA 3TGNA 2QYOA 4RAYA 3LAJA 1RUOA 2HQRA 3KZYA 2L4AA 3FZVA 3QU6A 2LF7A 2QVOA 4YIIA 2IRFG 3F8NA 3BJAA 3V7CA 1HQCA 2G9WA 1QZYA 3H3ZA 1YW7A 5K5RA 1BC8C 4G8XA 3CUQC 4IF4A 2UXNA 3BROA 4M6XA 2O3FA 1GVJA 2JSCA 1J7KA 1XDSA 3JAMK 3RKXA 4E70A 1R58A 4I0AA 2EJRA 2KRFA 2LSOA 3GZ5A 1OMIA 4OINF 5ICEA 2DFIA 5IT9K 3SQNA 4KA4A 3M8EA 2NRAC 1HKTA 2QZ8A 4XBFA 2GXBA 4UVAA 4O6JA 1SMYF 3I58A 2FBHA 4PGHA 1F9NA 1IN8A 3EETA 1V3FA 2ADUA 4WXHA 5DCMA 3N4MA 2BYVE 3HTSB 5BOXA 1T38A 1KU7A 2FXAA 4I09A 3WE3A 4BNCA 1P4AA 3IL2A 2M30A 3M8FA 1IW7F 2VT3A 2VOOA 5CVUA 4NQWA 5FLXZ 4ESBA 4Q4ZF 1P2FA 3KCCA 2HR3A 4G7OF 4RB0A 5ERIA 1P4WA 3L09A 1D8JA 1Z6TA 3WU0A 3ZN1A 4CXFA 2HZTA 1BC7C 1IRGA 1ZG1A 3KLOA 4HDVA 3WTVC 4HV6A 1XSXA 2BV6A 3D0SA 1E17A 5HOOA 2CG4A 2KIUA 5F64A 5H6QA 2V79A 3RTRA 4U88A 3B73A 2FMYA 3V8KA 2F5EA 3NEUA 2EWNA 2ZBKA 4R79A 2Y48A 2QUFA 2IA1A 3TO6A 3T1BA 4EGYA 3BWGA 4LK0F 2LNBA 3KP5A 2EV5A 2IPQX 1BI3A 4M73A 1AOYA 3HYIA 2OU2A 2IP2A 4MTDA 2STTA 2A3SA 1P92A 4ZYDA 1O3QA 1L3LA 3EUHA 2PQ8A 1SD7A 2COMA 5FD6A 4IRIA 4JBAA 3WGIA 3K9TA 4BHBA 1T98A 2XRNA 5F1RA 2F5DA 2IA2A 4HAMA 1IN5A 4HZFA 4EJOA 2MBFA 5JR3A 4MQ9F 5TJJA 1ZLJA 5FLXK 2QBYB 2RVCA 3QP6A 4KIGA 1O3RA 1BI0A 1FYMA 4P9UA 1I1SA 2FBKA 1K78B 3RI4A 1CF7A 1ZRFA 4HDUA 2E1CA 4IRGA 1FY7A 1MDMA 3WGGA 4G6QA 3V8LA 3E6MA 5KVRA 2L54A 1BJAA 5E1ZB 2Y0MA 3S2WA 2L4MA 3GX4X 2GAUA 3RPUA 2D1HA 1P6RA 3KFWX 1G6NA 3QP5A 2FE3A 3WTXC 2OAZA 3Q9VA 2DI3A 1Z9CA 5L3BA 1NHAA 2Q0OA 1DPRA 4ENNA 4G94A 1KA8A 1MJBA 3J7AO 2D2WA 4HF2A 4LD5A 2GIVA 4CICA 1J59A 1FBUA 4XSXF 1T0FA 4M9XA 5E1XA 4HLXA 3J81Z 3RJPA 4YFNF 2A69F 5D4SA 1FX7A 3IWFA 2L01A 1BIBA 1LDJA 2OZUA 3MEXA 4CGZA 2RKHA 4KIBA 1GHCA 2EK5A 5EEGA 4N0BA 2RNJA 2VC1A 2O8XA 5HLHA 2KIFA 2HYGD 5D8KB 1B1BA 3RKWA 2GZWA 3BPXA 2QQ9A 4L9NA 2GXGA 5D6EA 3F8BA 4R1HA 5LHIA 3KETA 4OIPF 1ZREA 3WTZA 1WRJA 2CSOA 4S04A 2MLKA 1U78A 3F6VA 2CWEA 1JE8A 4Y15A 2X0LA 2PMHA 1RZ4A 3PQKA 4HF1A 3ZMZA 1ZAOA 1ON1A 3ROUA 1KQ9A 3REOA 4GYIA 2PEXA 3FMRA 3BDDA 1J2XA 3JW4A 2BBYA 4YIFA 5J8CA 4AVPA 3HHHA 4MNUA 5LRSA 1E2XA 3J81K 3L7WA 3LA3A 1G3TA 5D5UB 1EH7A 5L3FA 2WWYA 4UVCA 4RB3C 3QPTA 4HYEA 3HOTA 3T8TA 1IN4A 4B8XA 2OD5A 3NQOA 1G4DA 3W6KB 2DTRA 3VODA 1SAXA 2QM3A 4RGXA 2VBWA 5BPIA 5D6FA 3E3VA 5ILSA 2V1XA 3L2CA 3CUQA 3EYIA 5DEQA 2HGCA 5CVVA 4GYGA 1STZA 1PP7U 2R7DA 2ZJ2A 1P4XA 1IZ1A 2M87A 3GFIA 1ZH5A 3TDZC 4EJWA 1TLHB 2XKOA 4ZYEA 3C18A 5FD5A 1QNTA 3RDIA 2QWWA 1Z7UA 1T39A 3DF8A 2A6HF 1J5YA 2XVCA 1QQIA 1XDUA 2RV8A 3K69A 3IC7A 5JI6A 1FWZA 1UCRA 1O7LA 1YLFA 1Z05A 3LAPA 3HHGA 2CFXA 2HWVA 3RIRA 1GXPA 2HDCA 2J5OA 4I7HA 4N9HA 2RQPA 2EFPA 1A04A 1HSTA 3L9FA 2NYXA 2DQLA 4ZYGA 4IHTA 5CVJA 2ZNZA 2A6EF 5IT3A 3K1PA 3HOSA 3BOQA 4KT5C 1XMAA 3SZTA 3SZPA 2P5VA 4IVNA 1F4KA 2QENA 1Z1DA 4PZJA 3I4PA 3GVAA 4LB6B 3SXYA 3NRVA 1EH6A 2JZYA 4UVBA 3DQVC 3MAJA 3I54A 4IXAA 4M6YA 1FBSA 1TNSA 3EQLF 2ELHA 3N97A 2NNYA 2P7CB 4EGZA 3DXJF 2FNAA 3P9KA 3LQRA 4HX4A 2TDXA 1Y0UA 4M9ZA 4KNYA 4R8HA 5LHHA 4WXCA 4ZH4F 4G9YA 4EV0A 2VBXA 4UHTA 2K4BA 2YR2A 3QPHA 4GGGA 1DP7P 3F8CA 2KJBA 1YW9A 2HTJA 2FBIA 4BHPA 3ZMTA 5E1WA 2XAQA 1FBQA 4HF0A 1RI7A 4G7ZF 4N9IA 2Z9OA 2K7LA 3ZQ7A 4KIFA 3TO7A 4CO8A 3D5LA 3PFIA 1KU2A 4LLLA 3R61A 5HS8A 4IHSA 1Z91A 1PUEE 3MZHA 4OMZA 3K1MA 5F6FA 1BM9A 3E97A 2H6CA 4I0BA 4Q5SF 2ZMEB 3TDUC 1S7AA 3DKWA 4EQQA 4Q48A 2ESHA 2NAZA 5D5XB 2F5FA 2R7FA 2FRHA 2P8TA 4RS8A 2NS0A 1S3JA 2QBYA 3PQJA 4G7HF 4EJUA 3ZP5A 1K78A 2EA4A 3JSOA 3KP2A 1UHMA 3H92A 1FPQA 1FC3A 4ZYHA 1QGPA 3I59B 4LJZF 4XSZF 3ELKA 5KK1A 5J6XA 3F6OA 4AIJA 5K1YA 1IAWA 4UUVA 3V8JA 2HEOA 4HX8A 2YX7A 4L9JA 1IRFA 2G7HA 2OQRA 1IN7A 3TQNA 2XV4S 3GYHX 3V7RA 1KU9A 2XIGA 3CJNA 3GW2A 3MFKA 2CQKA 1LDKB 2EB7A 2PI0A 2RGVA 2ZKZA 1I5ZA 4AD9A 1HKSA 1DUXC 3IKVA 1LDDA 3RYPA 2CYYA 1BIAA 4MGRA 1I6XA 1RUNA 4LFUA 4K2EA 5L3GA 1MKMA 3R0JA 3F8FA 5CVIA 4KDPA 3GXOA 1W7PB 3IRRA 3KE2A 3KP3A 1FSEA 3FXQA 3WTWC 5BQTA 4LLGF 5HLIA 2W25A 2V6CA 1BBYA 1ZYRF 2Z99A 2OQGA 5ILUA 3ZN0A 4KYWA 3K0LA 3SHFA 1CGPA 3DPLC 2ZCWA 4XLPF 1R22A 4ESFA 4P9FA 2V9VA 2MH2A 3GZ6A 3E6CC 2E7XA 4I01A 4IRHA 2LDUA 1SFUA 4AIHA 1ZRDA 2YX4A 5CJ9A 3KEOA 3JSPA 4NHJA 2RN7A 1ZARA 3MZYA 2XAJA 1SFXA 3F21A 3KP4A 4HA8A 3ECOA 4GO1A 3BJ6A 5FFXA 4OIQF 3BJOA 5DV5A 4EM2A 2EFNA 1W4MA 4A2UA 5LGNA 2DBBA 4CHUA 2EA2A 3HIFA 4RB1A 3WTSC 1O3SA 3O2PE 3ML6A 2O61A 1BI1A 1I27A 2QQBA 3GFJA 4QLCU 4WF2A 3GFLA 4RB2C 1YW8A 3E5QA 3TO9A 1IXCA 1TTYA 4WWCA 4BAYA 2BE5F 2EFQA 5FFZA 4ASNA 5K5OA 3KEQA 5LEKA 3P7NA 3CO7C 4G6DA 1QPMA 1YIOA 3GF2A 2F5CA 2W84A 4O5VA 2ISYA 2K86A 2RDPA 5AONA 1HKQA 4P96A 4IPAA 4I02A 1KGSA 1B6AA 1Z6RA 1YS6A 4F7ZA 1RIOH 1SD6A 4KMUX 3COAC 3E5XA 3ZMVA 3F72A 4WCGA 3R6SA 3HSFA 1ON2A 1O7FA 5BMZA 2MA3A 1J9IA 4WK8F 3KLNA 4EM1A 4AIKA 4A0YA 1U5TB 2FA5A 2MLGA 4ZZDA 3WE2A 1JHHA 2H6BA 1XD7A 4U7DA 1J75A 1T2KA 3R0AA 1J0RA 2W57A 4BH9A 3WTYC 3U9GA 1UB9A 4RGSA 4I98B 3ULQB 1O57A 3TKYA 3I5UA 1IUYA 5HS7A 2A68F 4HQEA 4YFXF 3O6BB 2VODA 1KQ8A 2D1VA 2E1NA 1L0OC 3CTAA 3M1EA 3CO6C 1YS7A 1MJAA 4L5IA 2CO5A 1EV7A 1V4RA 3WGHA 2CW0F 4OOIA 3K1NA 3BZ6A 1U5TC 5HDKA 4WX9A 1XSDA 3DFGA 1S8NA 2FMLA 2JPCA 4MQVA 1ODDA 2H09A 4L0YB 1SD4A 4A12A 1FYKA 2HTSA 2FQ3A 2PN6A 1FLIA 1FYLA 3WODF 3JTGA 5CLSA 2UZKA 2UXXA 1FT9A 2GWRA 4PCQA 1PP8F 2YU3A 1EH8A 5K5QA 3MWMA 1OYIA 1G3YA 1D5VA 5E8GA 5LRRA 2Y75A 4LLNA 2VC0A 4ON0A 2O03A 3L00A 4A0XA 4ENMA 1UFMA 4A6DA 3QU3A 2JPBA 1ZN2A 4YFKF 4EJVA 2O6GE 5LEJA 5LHGA 3F8MA 5DD8A 3FM3A 1OPCA 4M74A 4LGWA 4MEYF 4WXDA 2FEZA 2P6SA 2YSRA 2BGCA 4ENJA 1LVAA 2XKPA 3HSRA 1DDNA 4BXUA 3HRTA 5ICCA 2VBZA 3I53A 2A61A 1BI2A 2DK8A 1F5TA 2IA0A 2QLZA 3FM5A 2P5KA 3FXUA 2HFHA 5AIQA 2ZXJA 2ZMEA 1H0MA 1YQAA 2W24A 2DT5A 1K7AA 3QOPA 3BY6A 4Q47A 4LMYA
chains in the Genus database with same CATH superfamily
4FX0A 3H9JA 4HPQA 2CW8A 3PSIA 3VB2A 1X1CA 2STWA 3HDDA 1Q1HA 2JRMA 5HDGA 4A3BJ 5FO5A 1BOAA 1B8IA 2JT1A 2V1DA 2KKOA 2KLOA 3I59A 1MMNA 2XHKA 3K70D 2L3DA 2M5WA 2Y0SA 2EILH 3F23A 2XGXA 2LD5A 2QKLB 2DU9A 3LA7A 4I2OA 3FMQA 1LEAA 2YS9A 1R36A 3BG6A 3LFKA 4Z6YA 4XQFA 2IW5A 3TP3A 3FXRA 2CQXA 1IF1A 3OYHA 2X1CA 4XICA 5LLQA 2QA4I 2VKEA 1R5ID 2XAHA 2E7WA 2EQRA 2M8EA 3CP2A 3H35A 2ZFUA 2DLLA 4ZZLA 3C2HA 4EMSA 4U0YA 1SAUA 1XB4A 1XCBA 2ID6A 2XASA 4FE7A 3TW7A 2FNPA 1SFEA 2VT2A 1FTZA 3A1YA 1YFHA 1N78A 3ZMSA 3KP7A 4HRIA 2EFOA 3GUDA 4HG2A 3HUGA 1K61A 2UUZA 4CYDA 3FK6A 3OS0A 1B4AA 1VZ0A 2V1UA 5FKKA 2DO7A 1HXDA 3G1LA 4A0ZA 1G2HA 4PJJA 5E79C 2V1NA 1I1GA 2P7VB 1VQ7I 1J09A 1C0WA 1P7JA 3ESWB 1PDNC 4PDKA 1XC5A 1A36A 3OWTA 3AG3H 4UV8A 5D5VB 2XAGA 1IN6A 4EVIA 2O0YA 3C7JA 5HDNA 1YRNA 3G2BA 5LBQA 4IL6C 4XM3A 3ZMDA 1ENHA 1YG2A 3QRFF 1W7PA 1FIAA 2KIMA 1XGSA 3GZNB 2H1KA 4ETSA 3T0YA 1EKEA 3VYUB 3ECHA 4GCVA 4MTEA 3ZGKA 2MH9A 3G6EI 3CCVI 2DJNA 1ZKGA 2CGPA 1E3PA 3OMYA 3WG9A 1USSA 2TRTA 1F36A 5HNFA 5JVTA 1XS9A 2R7WA 2HDDA 4HQMA 4A69C 1VQNI 1TL8A 4LITA 2AXLA 1KQ0A 1WWXA 2L9VA 2QQAA 3EPZA 3ABUA 3I0TA 1FZPB 4B09A 2WV0A 2H94A 3H9QA 4II2A 2M1BA 4AU7A 4AWXB 2P5LC 2FOKA 2R7TA 2CUJA 4S0HB 4B47A 5HLTA 1SC7A 1R7JA 3MMYB 3OYCA 2VN2A 6PAXA 1ZHFA 3GLLA 3WHBA 4HSRA 4OU0A 5A2QZ 2VOPA 1P7IA 1TQMA 1OR7A 3LWFA 3LSMA 5EJCA 1ZG5A 3HOWJ 4C2TA 3LL7A 5E18F 3E6BA 3JRBA 3F3XA 5TGTA 4BYYA 2X4HA 3H1CA 3HTUA 4JK1X 4CDGA 1BL0A 2UWMA 3VOEA 2ME0A 1SD5A 2KIQA 5J3LA 2VKDA 2HVRA 2LK2A 2WY8Q 2V6EA 3K4KA 2DMPA 2E60A 2QSHX 2GOXB 4C3HJ 4KUMA 2AXTC 2QKMB 5ED4A 4O3MA 4OIOF 5IYBJ 1HOMA 2HKXA 1OISA 2Q2EA 2DK5A 1USTA 3S32A 4B4CA 5GPCA 3Q5FA 2R5YA 4U87A 4Y4RA 2EV0A 4V2GA 5DUKA 3IWZA 5EZGA 4S05A 2JVGA 2E5ZA 1QVTA 4XK4A 1ZG3A 3VSLA 3FMSA 2HOEA 2LP0A 3GO5A 1GV2A 4CYCB 1VQ9I 4KFCA 3MVPA 2L9SA 2NS8A 2VIXA 3PIOF 1LNWA 4BE2A 1T08B 1H88C 4PJNA 2R92J 5BS6A 1XX5A 4A5MA 1R5HA 5FB2A 3QWLA 2LFBA 4UY8I 4XL9A 4XLNF 3EDPA 1XN7A 2QEXI 3SYTA 2R3SA 1OKRA 3ABLH 1U9NA 2HQAA 5DYMA 3M9AA 2K9QA 1IJWC 3GFMA 3OS1A 2GLOA 3K2ZA 2X51A 1HA8A 2HPIA 1ORKA 4QWQA 3GTLJ 5HVQC 1WSUA 1AHDP 1QO0D 2M0MA 3CD6I 3NAUA 4FASD 2WAFA 2DDAA 3FX3A 4GXOA 3CCRI 4XLCA 2XAFA 3ZQLA 1RETA 1HBXG 4KN4X 4V2FA 3LSGA 5IP6A 2XSDC 4ZDLA 2IT0A 5IP9J 2CW7A 2IJLA 2G7UA 1TQIA 5FLVA 2LYCA 1K4TA 1YTYA 2B0LA 3KP6A 3IUOA 3DBLB 4M71A 3ABTA 2BXYA 2KRCA 2EV6A 5A2QK 1LEBA 5FGMA 2ACJA 2IS6A 4CCOA 5JFRA 3DU6A 4PK4A 2DA2A 3KZIC 2VPRA 3CF2A 1ETKA 4LG0B 2O9LA 4AYBN 2IS4A 4ESJA 1LQ1A 2K27A 3S1MJ 1W7PD 1AWCA 4IKFA 1ONVA 3H9GA 4L5EA 4BQOA 2KRHA 2CH0A 1ZGWA 2H27A 5L3DA 3H36A 1QRYA 2LKXA 5IYCJ 2JWTA 1H9GA 1TBXA 2DMTA 5FJ8J 3MKYB 5DD4A 4RGUA 4IJAA 3ZR8X 1FP1D 3GEZA 3MCZA 4ABZA 4BGDA 3J80Z 4DGWB 1XGNA 2DOAA 1YJNI 3GTMJ 1MNMC 3DEUA 2LKPA 4HV5A 1E3OC 3BCAA 1U5TA 1T95A 2JMWA 5CQEA 2HOTA 3DBRB 3F22A 4BBSJ 1FEXA 2VE9A 5HS9A 2MD5A 1POGA 2DFEA 1JGSA 4JYKA 3K7AJ 4F55A 1OCCH 1H89C 3HOYJ 1XG1A 2WTEA 3O3KA 2MD0A 3C3WA 2DQRA 4MEXF 1XMXA 2IGMA 1U0JA 3U1KA 1VF9A 5E8IA 5KNLA 2EINH 1MMSA 2Y9YA 1MZBA 1TWHJ 1Y39A 1GDTA 3A01B 4D0PA 3JREA 1IDYA 2J5PA 3HRMA 1VFCA 1W5TA 2DMNA 1XGOA 4ZDPA 1KYWA 2K9NA 3V42A 2OA4A 3HB9A 3HOVJ 1R1TA 3ISPA 5E17F 1SEUA 2A5YB 2KT0A 1HF0A 2JRTA 1MNEA 1XGMA 2BEOA 4EM0B 3OV8A 4YELA 2RC4A 2HS5A 1TQPA 2XDVA 5J4YA 4KMFA 1B9NA 3AG1H 3LMMA 4BQQA 1Z21A 5FRNA 2VQLA 4Y17A 2CV1A 1MNDA 1VQMI 1O3TA 1JKOC 3ZPLA 1B59A 3K4NA 3L2VA 4EJTA 4HOBA 3HBLA 5D4RA 1FOKA 1QHHD 2DAOA 2L7ZA 2JTVA 2M8GX 1K6OA 3CLQA 4UXNA 1UJ8A 2ZO4A 2KQRA 5ICFA 3EYYA 1RRJA 1JTYA 3G73A 4N4NB 3DPTA 1YX3A 5FROA 3WTUC 1JHFA 4HLYA 3AAFA 4FHTA 1R1VA 5DUIA 1FP2A 3C1DA 3I3LA 3TOAA 4DQ2A 1KYZA 2A07F 3P5JA 3D1NI 3CC7I 9ANTA 1OYYA 2GQQA 2HI3A 3BP8A 2E34A 3VWBA 4LIVA 2ZXWH 5JHUA 3CDHA 2HXOA 4JP0A 3M7GA 3QAHA 5DCMB 4DBQA 1K83J 4IEJA 1JJ6C 1Y0NA 1D1AA 2JUCA 4HX7A 3JRAA 3FBIB 4RGRA 3J80K 2HZDA 2VXZA 2KPMA 1IV6A 1QBJA 3G3ZA 2ZXHA 3JR9A 3U1DA 3GCMA 3OL4A 1U2WA 2VE8A 4CCNA 3BT9A 4A6EA 4BHCA 5DS9A 2DA3A 4BL0B 3PSFA 4DYRA 2NNNA 4L5JA 4NB5A 1V5FA 1XCVA 3HPGA 5EG0A 3WHCA 4YG2F 3GLXA 1IXRC 4NQWB 1FOXA 5EGOB 4TV7A 2E2JJ 3WTTC 1ZR4A 1R00A 1ZGJA 2FSWA 2XROA 1QZZA 4A3CJ 5HLGA 3E5UA 2M4KA 2ISZA 1T33A 2X1EA 2LBFB 3S93A 2DYRH 3JTHA 3KX2A 3OYGA 2AS5F 5J8FA 1E0EA 2KP6A 4GFBA 4KN7X 2KJCA 4BKXA 3R4KA 5LD2C 4MHGA 4DYQA 3I55I 1IRXA 1S9HA 2WC2A 4L18B 2ZNYA 4FT8A 1MMAA 3O8HA 2JA7J 2ETHA 1TW3A 1OLTA 1U6GA 3CUOA 1F1ZA 2ZFWA 3IKTA 1HW1A 2VI6A 2HQ5A 4H0EA 2IGKA 3K6GA 1DU0A 3V7SA 2WB1N 4XNFA 5H20A 4A5NA 5LGTA 4LB5A 1MH4A 5FKNA 2GA1A 2F2EA 2DW4A 2DPUA 4HEA2 5TISC 2PLYA 1BR2A 2EFWA 3ONQA 1ZQ3P 3S1RJ 2EZKA 2K02A 2R5ZA 1ZLKA 1UG0A 2M2EA 3PO2J 1MJ9A 5GP9A 1XPXA 5AIPA 4NC8A 4FE4A 3HKZN 2GIZA 1D0ZA 1X19A 2CQNA 4M9SA 2Q8KA 2R7SA 1ULYA 1JGGA 3QYFA 1D8KA 2X6WA 2KHMA 3O8GA 3CJQB 2VBYA 5HNHA 3KIOA 1G8XA 1N25A 1UELB 2P4WA 3IHUA 3DV8A 4G12A 3PNYA 4FISA 4MFEA 1SVMA 4RDUA 4OIRF 4PJ0C 1MD0A 3ASNH 2QCOA 3RKYA 3WU1B 3OYMA 1WQ2A 1K79A 3LSPA 2CS3A 1S29A 1X2MA 5FKLA 3MN2A 2K85A 2LF8A 3R60A 3MQ0A 4XKWA 4HW0A 5DM7F 5CYVA 2QQ8A 2ZC2A 3PNTA 3ZQIA 3J7YJ 4DBRA 2OTLI 1RR7A 1X3UA 5L3CA 3BCBA 4XRFA 3VFZA 1CF7B 1IXSB 2WADA 2E1OA 3OOPA 4L9TA 4U0WA 3J7AY 5LGUA 2PX9A 1R23A 1MDMB 1G3WA 3I71A 4A3EJ 2XAUA 2ESNA 3BPVA 3K4MA 3DEEA 2PMZA 2DCEA 2YPRA 2XF7A 4D9JA 3U2RA 2L02A 3TOBA 4DW6A 3DP7A 1HW5A 1WKMA 3EUHC 2Y2ZA 1WJEA 1V5EA 2PFBA 3ERED 2Z5UA 3IH4A 1OFCX 1TW2A 1YE9A 3CCQI 1G3SA 1MGTA 2F5VA 2IS1A 1B9MA 5B5EC 4UUTA 4QPOA 4FX4A 5F0HA 3L2WA 4ZTJA 5J1UA 3DLAA 2PBIA 3DEWA 1Y1VJ 2RAEA 4U7BA 5ICGA 4AYBA 4UV9A 5L3EA 1R5GA 2F4MB 4CCKA 1HSJA 5DCFA 2AHQA 3GWZA 3LSTA 5H6RA 3UR3C 3HRUA 3BTLA 4DNCA 3ZQGA 2FU4A 4OMYA 4HBLA 2MC3A 1U9OA 3FXMA 1Q1VA 3LQQA 2LG4A 2Y9ZA 1FNNA 5D8LB 1D1BA 2LTPA 3F0CA 3QOEA 2NOGA 4PJLA 1KONA 2HOAA 2IVMA 1JJ8C 3P9IA 4E7HA 1JT0A 3S1NJ 2XUBA 4UNOA 3FIWA 4XONA 3GTJJ 1XSVA 4XKCA 3ZMUA 1S7OA 4P5OA 1IV8A 2KDOA 1W5SA 5FLMJ 1X3ZB 3CCEI 3LA2A 3AFHA 3W6JB 1I6HJ 2HNHA 2EBIA 2P6TA 2HDWA 3IRQA 2JA8J 1YO5C 3JRIA 3FF5A 5ILVA 3CLOA 5GAGJ 3OR1C 3FXOA 1G59A 2EPFA 2PJPA 3LNQA 2M34A 4AUXA 4Y13A 4RAZA 2D45A 1IO2A 1BN5A 4DOZA 2MYSA 3E1SA 1ZGAA 1T0FC 2L7MP 3OYEA 1TP4A 3ZQHA 4GRIA 4ZC3A 2CV0A 2K9LA 1NG6A 5DDGA 3JCUC 3T8RA 1T6SA 3JRFA 2HQNA 4XLEA 2E2HJ 1R1UA 2BW3B 2O5RA 5FKMA 2G0EA 1SMTA 3CESA 4M72A 4CYCA 2OZ6A 3HRSA 1KU3A 3S15J 1EJ9A 1MBJA 5IY5H 4KT6A 2FF4A 4M3FA 4RLQA 4P55A 1RNLA 4E7ZA 4PGGA 2M7BA 1WI9A 2I8DA 3OL3A 4Y7NJ 1PYVA 3F9KA 2PMUA 2FX0A 3RYRA 3KZZA 4ENKA 2AQEA 3SFZA 2Z33A 3W6VA 4L0ZB 3B6CA 2NVYJ 5D5WB 3D5SC 3P9CA 5EEHA 2NVXJ 1H9TA 4PSXA 2GA2A 1W36C 3IV5A 4A3FJ 4LK1F 3T5XA 3CC2I 4DIQA 1HW2A 3ZOBA 1REPC 1GV5A 1A5JA 2VONA 1IG7A 1MSFC 3JAMZ 1FSHA 3VYRB 4L9VA 3DKYA 1U3EM 4KICA 1JUMA 2DPDA 1VTNC 1Y8RB 1ZTRA 1LJ9A 1S6LA 3FWEA 2OBPA 1T8IA 1MMDA 1MH3A 1OYWA 2Z3YA 4NC7A 2BOLA 3I64A 4M3EA 4JQFA 1JXSA 1LB2A 1D3YA 1HC8A 4CZZA 3E6DA 2C6YA 3H3UA 5CVRA 4Z2YA 5IT9Z 1GXQA 4E7SA 1WHUA 1XMKA 1YYVA 1DPUA 2JK3A 4U0VA 4B3XA 3S3OA 5TRDA 1U8RA 2LLKA 2BY3A 5BPDA 1VQLI 3Q9SA 2XRLA 4LG0A 1B72B 4NBQA 2OCCH 1DQUA 4NNJA 2PG4A 3CUQB 3B02A 1TNTA 5EF6A 3VEPA 2R7VA 3RPQA 1UHWA 2M45A 1FOYA 4BQAA 5E20A 3HSEA 2W85A 5JLXA 2HYFA 3LSKA 3V4GA 1TWCJ 3OYDA 2K4JA 2RNGA 3QPLA 3FHZA 1ZRCA 1NK2P 2HKOA 3TGNA 2N8GA 2QYOA 1Z7LA 1ZELA 4RAYA 5CQGA 3HGGA 3LAJA 1MBHA 2DA5A 1CQTA 1RUOA 2WB1A 2E35A 2HQRA 4C30A 3KZYA 2L4AA 3FZVA 3QU6A 4CCMA 2LF7A 3BR5A 4QIWN 2QVOA 4PUSA 4YIIA 2IRFG 3F8NA 3BJAA 3V7CA 1HQCA 4B43A 2W4SA 2VL8A 1IUFA 2G9WA 2KFDA 1QZYA 3A01A 3H3ZA 1R6RA 1YW7A 5K5RA 1BC8C 4G8XA 2MABA 3CUQC 4IF4A 2UXNA 4KITB 3BROA 3HKZA 1GLNA 1I39A 4M6XA 3WG7H 2O3FA 4CZCA 2VQHA 1GVJA 3FISA 4ZYAA 5JHFA 1LFPA 5E3LA 2FD5A 2JSCA 4DYCA 4GDFA 1J7KA 4ZDOA 2R0QC 1XDSA 3HM5A 2VJIA 3JAMK 3RKXA 3M1CA 1R58A 4E70A 2E1MB 4I0AA 4KJZA 5KCMA 1X1PA 1JUSA 2EJRA 3OR2C 1R71A 5CKTA 2KRFA 2BVLA 2LSOA 3GZ5A 1OMIA 2VQGA 4OINF 5ICEA 2ZJPF 4RLFA 2DFIA 5IT9K 1Y56A 3SQNA 4KA4A 3CCYA 3M8EA 2NRAC 3C2GA 1BR4A 1HKTA 1V55H 2QZ8A 4XBFA 2X6YA 1MBGA 1X2NA 3HGYA 3ZQQA 4E6KG 2GXBA 3VYSB 4UVAA 3KYDB 4FCYA 4O6JA 4BJ5C 1JI8A 1SMYF 3I58A 2LMDA 2FBHA 4PGHA 1A35A 1F9NA 1IN8A 3EETA 1V3FA 2ADUA 4WXHA 5DCMA 4ZJZA 2PMZN 3N4MA 2BYVE 3HTSB 3CMMA 5BOXA 1T38A 2E36A 2V9KA 3BTIA 2X9DA 1KU7A 2FXAA 2WV1A 4I09A 2E1MC 3WE3A 4BNCA 1P4AA 2M30A 3M8FA 3IL2A 1Z3XA 3JRHA 1IW7F 2HVQA 1W0UA 2VT3A 1MW7A 3VPRA 1PVEA 4IX7A 1OJLA 2VOOA 3PM1A 5CVUA 4NQWA 1UG2A 5FLXZ 4ESBA 5EGOA 4Q4ZF 1P2FA 3KCCA 4CCLA 4JX6A 3MKZA 2HR3A 3TMOA 4G7OF 4RB0A 1Y6IA 1YIJI 5C4XJ 4JX4A 5KAFC 1Z3YA 5ERIA 4BJ6C 4D7NA 1LE8B 3GTOJ 1P4WA 3W2WA 2E71A 2OCEA 3L09A 1D8JA 2LBFA 1IRZA 1Z6TA 2M9HA 2DODA 2ZSIB 3WU0A 3ZN1A 4CXFA 3K10A 1R9TJ 2HZTA 1BC7C 2RQQA 2V9PA 3A2KA 1ZG1A 1IRGA 3A4CA 3KLOA 1RESA 4PFPA 4HDVA 3CJTB 3WTVC 4HV6A 1XSXA 2VUMJ 2BV6A 3D0SA 4XLHA 2HU9A 2BHZA 1E17A 3NWTA 5HOOA 4BXXJ 2JA6J 1QZEA 2CG4A 2KIUA 5F64A 4I6ZA 1W1WE 5H6QA 2V79A 3RTRA 1Y8QB 3CQZJ 4U88A 2JA5J 1X3WB 3B73A 2FMYA 2ZXIA 3V8KA 2F5EA 4UUSB 5E3MA 3NEUA 2EWNA 3DLLF 2ZBKA 4R79A 2Y48A 1APLC 2QUFA 2IA1A 3TO6A 3T1BA 2DTZA 3LSIA 4EGYA 5M5XJ 3BWGA 4LK0F 2LNBA 3KP5A 2EV5A 2IPQX 5K7HA 1BI3A 4M73A 1AOYA 3L2UA 3BR3A 1WI3A 4EEFG 3HYIA 2OU2A 4YIRX 2XF6A 1RPWA 2L0KA 2IP2A 4MTDA 2STTA 2A3SA 4HNVA 3OYBA 1P92A 2M4GA 1MIJA 4ZYDA 1JT6A 1O3QA 1L3LA 5IYDJ 3EUHA 3ERMA 1ACIA 2PQ8A 1SD7A 3FDYA 2COMA 5FD6A 1BA5A 2R7OA 4IRIA 4JBAA 3WGIA 3PNVA 3K9TA 1ETXA 4BHBA 1T98A 2XRNA 3OY9A 5F1RA 2R93J 1W5CC 2F5DA 2IA2A 4XRSA 4HAMA 2ME6A 3ABKH 2DYSH 3S8PA 1IN5A 4HZFA 3GTKJ 4EJOA 2MBFA 4P1WA 4IOAF 3M07A 5JR3A 3A0HC 4MQ9F 1LUJB 2NXNB 5TJJA 1ZLJA 5EDNA 5FLXK 2QBYB 1R4MB 2RVCA 3QP6A 4KIGA 1O3RA 1BI0A 4E7KA 1FYMA 4P9UA 1I1SA 2FBKA 1K78B 4DZJA 3X2QH 3RI4A 1CF7A 1ZRFA 3GMEA 4HDUA 3BR0A 4W97A 1K4SA 2E1CA 4IRGA 1FY7A 1MDMA 1I3QJ 2NVTJ 2CUFA 3WGGA 4G6QA 2OPTA 3V8LA 1FMWA 1UHSA 3LFUA 4AVZA 3E6MA 1M1EB 5KVRA 2L54A 4J00A 1BJAA 5E1ZB 4XOPA 2CQ7A 2Y0MA 3S2DJ 1TT0A 3S2WA 3H0DA 2L4MA 3GX4X 4OAZA 2GAUA 1VQOI 5GTIC 3RPUA 2D1HA 1P6RA 1BJZA 2FJ1A 3KFWX 1S72I 1G6NA 3QP5A 4XIDA 1ETYA 4HSTA 3VSKA 5CPRB 2FE3A 3WTXC 2Q1ZB 3OYLA 2OAZA 3Q9VA 2DI3A 1Z9CA 5L3BA 1NHAA 2Q0OA 1DPRA 4F52A 4ENNA 1VQPI 1VQKI 1RKTA 2CJJA 4G94A 4YRVA 2MFZA 2EZHA 1KA8A 1NG7A 3BG3A 3OIPA 1MJBA 3J7AO 2D2WA 2P81A 4HF2A 4LD5A 2FQ4A 2GIVA 4CICA 1J59A 1FBUA 4M6VA 4XSXF 1T0FA 4BBRJ 4M9XA 5E1XA 4XKVA 4HLXA 3RJPA 3J81Z 4YFNF 3TL4X 2A69F 5D4SA 1FX7A 3BLYA 3IWFA 2L01A 2XF5A 3TW6A 2L5QA 1BIBA 1LDJA 2ID3A 4D5CA 5C44J 2XSJC 4QSHA 2OZUA 5IOZA 3MEXA 4CGZA 2RKHA 4KIBA 1GHCA 1MBFA 2EK5A 2K9SA 3QPSA 2W00A 5EEGA 2WY7Q 4RMNA 4RAGA 3E7LA 4IHVA 4N0BA 2M7AA 2RNJA 2VC1A 2K9MA 2ZB9A 3ASOH 5F1JA 3CCUI 4A3JJ 2O8XA 1UZCA 5HLHA 1WZ2A 1WVRA 2KIFA 2HYGD 3EUKL 5B1BH 1QHGA 1JKPC 5D8KB 2ICWG 5M3FJ 1B1BA 3RKWA 2GZWA 1EA3A 2ELKA 3BPXA 2QQ9A 2JQ7A 4L9NA 2GXGA 4PSWA 5D6EA 3F8BA 4R1HA 2X85A 5LHIA 3KETA 2IXSA 4XN3A 3OS2A 4OIPF 2BW3A 1DP3A 1ZREA 3WTZA 1WRJA 2CSOA 3AG4H 5M3MJ 1I3AA 4RA2A 2MLKA 4UB8C 4S04A 4IZZA 1U78A 3F6VA 1D5YA 4IQJA 2CWEA 1JE8A 4Y15A 1YJ9I 2X0LA 2PMHA 3ZQFA 2CUZA 1RZ4A 3PQKA 3HOZJ 2JA2A 1SANA 2LRDA 1NK3P 4HF1A 3ZMZA 1ZAOA 1ON1A 3ROUA 2GOMA 1TZLA 3OSGA 1YITI 3H5RA 1KQ9A 3CMYA 3RZDJ 2Z1DA 3REOA 1QU3A 4GYIA 4IHYA 2PEXA 1HLVA 2WAQN 3FMRA 3BDDA 1J2XA 3JW4A 1VNDA 2BBYA 4YIFA 3OYIA 5J8CA 3G1MA 2JJ7A 2NOJB 3CC4I 4AVPA 1BW5A 2OUMA 3HHHA 4MLOA 1F43A 4C3IJ 5B3SH 4MNUA 5LRSA 1E2XA 3J81K 3L7WA 4BXFA 1WJ5A 3LA3A 1G3TA 3TP0A 5D5UB 1EH7A 4BEHB 5L3FA 2WWYA 3GTPJ 4LIUA 2LVSA 4UVCA 3CCSI 2VXDA 2CFOA 5GTHC 4RB3C 1AKHB 3QPTA 5GPAA 4HYEA 3HOTA 3CMEI 3CJRB 3T8TA 1IN4A 4B8XA 2OD5A 3OIOA 3NQOA 1G4DA 3LSJA 3FXJA 1P9QC 3W6KB 4B48A 4RBOA 2GBYA 4FETA 2DTRA 4J19A 3VODA 3LSHA 3RPUD 1SAXA 2QM3A 3HZJA 3G71I 1N77A 4RGXA 2KZVA 2VBWA 3W3CA 5K7FA 2E2IJ 1FIPA 2F6CA 3IAS2 5BPIA 5D6FA 1B72A 1ITYA 3E3VA 5ILSA 3OSFA 1IGNA 3L2QA 4A3DJ 3D5RC 2V1XA 3L2CA 3A02A 3CUQA 1PUFB 3EYIA 5DEQA 4IQ4A 4M3DA 2HGCA 2LOOA 5CVVA 4BE1A 4GYGA 1STZA 2QF7A 1PP7U 2R7DA 2ZJ2A 1P4XA 1IZ1A 2M87A 3GFIA 1ZH5A 3TDZC 5H2FC 4EJWA 1TLHB 1ETWA 1ETQA 2XKOA 2Y69H 3IH3A 3DU5A 3MD2A 2V7FA 4ZYEA 3C18A 3S1QJ 5IOYA 5FD5A 3AKZA 1QNTA 3DBHB 3K4BA 2JN6A 1ETVA 3RDIA 2Z16A 2QWWA 2TCTA 3BG5A 3PJRA 1N75A 3FKJA 1Z7UA 1T39A 3DF8A 2A6HF 3DWLE 3AG2H 2F4IA 1J5YA 4BQNA 2YU9J 2XVCA 2XGCA 4UB6C 1QQIA 2E19A 1WPKA 1QPIA 4N4OB 3CDLA 2DMQA 2VJ5A 3HOUJ 1XDUA 2RV8A 3K69A 3IC7A 1W36D 2HPMA 3SEZA 5JI6A 4B1RA 1BOBA 3IH2A 1FWZA 4BDZA 5M5WJ 3SJMA 1UCRA 4Y3OA 1O7LA 4BE0A 1YLFA 1I50J 1Z05A 3LAPA 3S17J 4F3QA 2WA0A 3HHGA 4H4KC 2CFXA 2HWVA 4X6AJ 3RIRA 1ERDA 3K4CA 2XB0X 1GXPA 3CCJI 2HDCA 2J5OA 2MG4A 2Y31A 1VQ6I 4I7HA 2OC6A 4N9HA 1KZHA 2RQPA 2EFPA 1A04A 1HSTA 3L9FA 2HXIA 2XPVA 2NYXA 2DQLA 4ZYGA 4IHTA 5CVJA 4A3IJ 2ZNZA 2A6EF 2I10A 1FTTA 5IT3A 3K1PA 3HOSA 3BOQA 2KL4A 3B6AA 1JKRC 3BG9A 4KT5C 3K2AA 1XMAA 3PUFA 3SZTA 5BNGA 3SZPA 2P5VA 3WU2C 4IVNA 1F4KA 2QENA 4XMYA 1Z1DA 4XLFA 2WAEA 1NTCA 4PZJA 3I4PA 3KEYA 3GVAA 3BR6A 3KYLA 1UMQA 4LB6B 2PJRB 3SFIA 5EYRA 3SXYA 1HDDC 3NRVA 1EH6A 2JZYA 5B66C 5C3EJ 4UVBA 3GTGJ 3DQVC 1S5LC 1AU7A 1VQ4I 3MAJA 2W1OA 2EH3A 2A5WA 3I54A 4IXAA 3OYKA 2GM4A 4M6YA 4IOCF 2X6OA 5F27A 1FBSA 3FXLA 2R4GA 4AIDA 1TNSA 3E0JB 3EQLF 2BXZA 3BQZA 2ELHA 4ITVA 4Y52J 1PJRA 5JVGF 3N97A 2NNYA 2P7CB 3HL2A 4EGZA 4X1EA 3DXJF 3GTQJ 2FNAA 3P9KA 3S2HJ 3LQRA 2COBA 1WGXA 4HX4A 2TDXA 2DDBA 1LE8A 1Y0UA 3H5NA 4M9ZA 4KNYA 4R8HA 1OCTC 1OCPA 5LHHA 4WXCA 4ZH4F 1ZK8A 1VQ5I 1JUPA 4G9YA 1A6IA 2VKVA 1BR1A 4EV0A 4XRSG 3HOXJ 3K70C 2VBXA 2H1LA 4UHTA 2YR2A 1X1BA 2K4BA 1WFXA 1GUUA 3QPHA 5J1YA 4GGGA 2DJIA 3F8CA 1DP7P 3S3MA 1JKQC 2KJBA 1YW9A 1VQ8I 2HTJA 2NS7A 4QPQA 1T56A 3HC7A 1VI0A 3JRDA 2FBIA 3MKWB 4UUSA 4BHPA 2DT6A 3ZMTA 2ZJRF 5E1WA 2XAQA 5FRMA 1FBQA 3U21A 4XKBA 4HF0A 4JOMA 1RI7A 1YX5A 4G7ZF 2OTJI 2LR8A 4E7JA 4D1QA 1NH3A 1H8AC 3CMAI 2JUGA 4N9IA 2BY2A 2Z9OA 1FOWA 2K7LA 2R7QA 3ZQ7A 4KIFA 3TO7A 4CO8A 3D5LA 1GT0C 3PFIA 1DGRM 2BHYA 2XGDA 1S7EA 1KU2A 4LLLA 5E3OA 4RAFA 4BY1J 3R61A 3K4JA 2VPLA 1R4NB 5HS8A 4IHSA 1WJBA 2VJJA 1OQYA 2EIMH 3PL8A 1Z91A 4I76A 5GADJ 2HYJA 5F04A 2A05A 1PUEE 3SEQA 3MZHA 4OMZA 5K7ZA 3K1MA 4FTHA 1LVKA 3DPUA 5F6FA 1BM9A 3E97A 2H6CA 4I0BA 4Q5SF 4RM3A 2ZMEB 3W2AA 3DTKA 3TDUC 1S7AA 3DKWA 1X1AA 3KYCB 4EQQA 4Q48A 2ESHA 2F48A 2NAZA 5D5XB 4BDYA 2F5FA 2R7FA 2FRHA 3ZXSA 1SVOA 2P8TA 4RS8A 4ANJA 2NS0A 5KHDA 1S3JA 2QBYA 2DOEA 2MGQA 1TWGJ 3BQYA 1TC3C 3PQJA 4G7HF 5F0CA 4EJUA 1LFBA 1Z77A 2BY0A 4XRMA 2K3PA 2LKSA 3ZP5A 1K78A 2LC2A 4FQGA 2EA4A 2WAQA 3KP2A 3JSOA 1UHMA 3H92A 2JSPA 3ZQCA 1FPQA 1FC3A 4J01A 1B8IB 3HEFA 1Z0XA 4C3JJ 4ZYHA 1D0YA 1QGPA 3I59B 4LJZF 4XSZF 2R7RA 3ELKA 2KMUA 5KK1A 5J6XA 4AM3A 3F6OA 2IGNA 4AIJA 3S3NA 5K1YA 1V54H 3Q0WA 4NDLA 1IDZA 3VYTB 1IAWA 3LSRA 4UUVA 3V8JA 4YEJA 2HEOA 2ECCA 2FUG2 4HX8A 3RKQA 5C4JJ 3PFYA 2YX7A 4L9JA 2V26A 3ZCOA 1IRFA 5IP7J 2G7HA 2OQRA 4F91B 1IN7A 4BJTA 4A93J 2DN0A 3TQNA 2XV4S 3GYHX 2DA1A 1DU6A 3V7RA 2HOSA 1LFUP 1KU9A 2ZMEC 2XIGA 2JVHA 3CJNA 3GW2A 3IP4B 2LREA 3MFKA 2CQKA 1LDKB 2EB7A 4B3AA 2PI0A 2EIKH 2RGVA 3CCMI 2ZKZA 3OYFA 2KISA 1I5ZA 3HUGB 4AD9A 1HKSA 1DUXC 4LG3A 3QYEA 3IKVA 1LDDA 3RYPA 2CYYA 4BY7J 4W1UA 2B7EA 1BIAA 3RZOJ 4IO9F 4MGRA 1I6XA 1RUNA 4LFUA 2EZIA 4K2EA 4OWRB 1MKMA 3R0JA 5L3GA 3F8FA 3IAM2 5CVIA 4CSWA 4KDPA 4A3GJ 1YRNB 2BY1A 2K5CA 4M3BA 2P0WA 3GXOA 1W7PB 3IRRA 3KE2A 3KP3A 3CCLI 1FSEA 3UKGA 3FXQA 3I9V2 3WTWC 5BQTA 4LLGF 4NC6A 5HLIA 2W25A 2V6CA 1BBYA 1ZYRF 2Z99A 1Y1WJ 2OQGA 5ILUA 2IS2A 1MMGA 3BTJA 3ZN0A 3EUAA 2BVMA 4A3KJ 4KYWA 3K0LA 2DOFA 3SHFA 4DJAA 1CGPA 1QA6A 1XTAA 3DPLC 2ZCWA 4XLPF 2KZGA 1R22A 4ESFA 1WJFA 4P9FA 2V9VA 3PIPF 2XPWA 4DZPA 2X48A 1DGWY 2MH2A 3BTCA 3GZ6A 2DXIA 3E6CC 2E7XA 4I01A 3AL0B 4E7LA 2H8RA 4IRHA 2LDUA 3RCOA 1SFUA 2VB6A 3I4MJ 4AIHA 1ZRDA 2YX4A 2O8KA 4E7IA 1U8BA 5CJ9A 3KEOA 3JSPA 2QSFX 4NHJA 2W48A 2RN7A 1ZARA 3MZYA 2B63J 2XAJA 1SFXA 3F21A 3KP4A 3S14J 3H5AA 4HA8A 3ECOA 4GO1A 3BJ6A 5FFXA 3BZKA 3BJOA 4OIQF 1BW6A 1X1DA 5DV5A 4EM2A 2EFNA 1W4MA 2W82A 1YHQI 2F4OB 4A2UA 2DBBA 5LGNA 4BACA 4CHUA 3N05A 4C2UA 3Q0VA 2EA2A 5J47A 2CU7A 1WJCA 2CV2A 5GAHJ 4ZTFA 3HIFA 2Q2EB 4HNUA 4RB1A 3WTSC 4A3LJ 2R5YB 3I4NJ 1O3SA 1OCOH 3SDGA 4CA0A 5DTDA 4QTRA 3ZRGA 3O2PE 4XN0A 3HXLA 3OOUA 3ML6A 2O61A 2Y0SN 1BI1A 3TEDA 1I27A 4BEHA 2I5UA 2MW8A 1Z67A 1D0XA 4PJMA 2QQBA 5F08A 3GFJA 4QLCU 4WF2A 3AL0C 1AKHA 3Q3SA 3CZ6A 1OR7C 2H8WA 3GFLA 4RB2C 1WH5A 1YW8A 3E5QA 3TO9A 1UAAA 1IXCA 1TTYA 4WWCA 3FXKA 3BZCA 4BAYA 5F0FA 2BE5F 2EFQA 5EEAA 2DA7A 2VASA 5FFZA 4ASNA 3CDIA 1LKXA 5K5OA 3KEQA 5LEKA 2D5VA 3P7NA 3NWSA 3CO7C 1WH7A 4G6DA 1QPMA 1RKWA 1YIOA 2X6XA 3GF2A 2F5CA 3SZGA 1TWAJ 1PUFA 2OF7A 3FHNA 3QODA 4CH7A 2CQQA 2W84A 3RQIA 4O5VA 2VLAA 1RC9A 3KPHA 2ISYA 2K86A 2RDPA 5AONA 1OCRH 3FBNB 1HKQA 2WBMA 4P96A 3OYNA 4IPAA 2L7KA 3G1OA 3M3YJ 1K6YA 3FKIJ 4I02A 5LFAA 1KGSA 1B6AA 2EZLA 1Z6RA 1YS6A 4II3A 4F7ZA 1RIOH 2M3AA 2NVQJ 5M5YJ 2LY2A 2FOWA 2Y30A 1SD6A 2KDZA 2RREA 4KMUX 3COAC 3E5XA 1A6QA 2MSYA 3ZMVA 3A03A 3F72A 4WCGA 4NUBA 2B9SA 2E5NA 3JRGA 3R6SA 3HSFA 5DM6F 4XR6A 1TWFJ 1ON2A 1O7FA 5BMZA 4PFOA 1MBKA 4KISA 4BS9A 2XPUA 2L2OA 2UV1A 2MA3A 4B44A 1J9IA 3I56I 2R7UA 1ZR2A 2QGUA 4CCJA 4WK8F 2HVSA 3KLNA 4X0GA 4EM1A 4AIKA 1D1CA 2DFHA 3W2VA 4A0YA 1U5TB 3OIQA 3S16J 1E3HA 3Q0UA 1X4PA 2FA5A 2MLGA 3FK7A 4ZZDA 1EF4A 3WE2A 1JHHA 2H6BA 1XD7A 4U7DA 1IC8A 1J75A 4IHWA 2ZJQF 1T2KA 3R0AA 1J0RA 2W57A 3H0GJ 4XORA 4BH9A 1WCMJ 3WTYC 3U9GA 3PUBA 1UB9A 4RGSA 4I98B 2OV7A 3PO3J 1MSEC 3ULQB 1O57A 3TKYA 3I5UA 1IUYA 4I99C 5HS7A 2A68F 4HQEA 5EZHA 3OYJA 4YFXF 4D5FA 3O6BB 3GBGA 3HPHA 2VODA 1KQ8A 2M0CA 2D1VA 4D7MA 1SFKA 2E1NA 1L0OC 2BZTA 2L9RA 3CTAA 3M1EA 1RR8C 3CO6C 1YS7A 1MJAA 2ZSHB 4L5IA 2R7XA 1QVUA 1SVLA 2CO5A 1EV7A 2PJRA 1V4RA 3WGHA 2ECBA 4BUPA 2IGOA 1V5GA 2CW0F 4OOIA 3K1NA 3BZ6A 2YUSA 4F92B 3HG9A 1U5TC 5HDKA 3VDXA 4WX9A 2CRGA 1XSDA 2Z2SB 1A31A 3J7ZI 3CF5F 4F93B 3DCFA 5E3NA 3DFGA 4IHXA 2XGEA 1S8NA 2FMLA 2JPCA 1W0TA 4MQVA 3NARA 3H3VK 1ODDA 2H09A 3L1PA 4XLAA 4L0YB 1SD4A 4A12A 3L2RA 1FYKA 2HTSA 2FQ3A 1LPQA 2CMPA 2IEKA 2PN6A 2DFFA 2NVUB 1FLIA 3OYAA 1FYLA 3BR1A 3WODF 5GAEJ 3UNGC 3JTGA 5CLSA 2VJ4A 2DT7B 2UZKA 2UXXA 3QYBA 1HCRA 1YJWI 3MZ8A 2AQFA 1FT9A 2GWRA 3BG7A 4A3MJ 4PCQA 2R7ZJ 2XC7A 1PP8F 2YU3A 1EH8A 2LY9A 3MWMA 1OYIA 1G3YA 2L9NA 5K5QA 1D5VA 2VKHA 1O4XA 5E8GA 5LRRA 5JLWA 4XOTA 2Y75A 5J40A 4JX5A 2IBDA 3CP8A 4EATA 2K40A 2ELJA 4LLNA 1OCZH 4CUGA 2VC0A 2MC4A 4ON0A 3K4LA 5EG0B 2O03A 3L00A 4A0XA 2W7NA 4ENMA 1UFMA 4A6DA 4MFDA 1WJDA 3QU3A 4C9YA 2VQCA 1YI2I 2JPBA 4V19K 4OAYA 1ZN2A 3HJEA 4YFKF 4HNTA 5HODA 2LH9A 5IPAA 4EJVA 2EIJH 2L7FP 5J4VA 2O6GE 5LEJA 3RSNA 5LHGA 3F8MA 5DD8A 2A6TA 2DMUA 3FM3A 3M4OJ 4BU2A 1OPCA 3QQAA 3LOCA 2XB5A 4M74A 4LGWA 4MEYF 2K3FA 4WXDA 2FEZA 3M8JA 3ABMH 2P6SA 4Y33A 2YSRA 2BGCA 4MO7A 1AA7A 1WJAA 3MKLA 2DA4A 1HDPA 4ENJA 1LVAA 4E4HA 2XKPA 3HSRA 1DDNA 4BXUA 2X1DA 2OJED 4LOCA 3RQ4A 5J1RA 1SFOJ 2DA6A 3HRTA 2VBZA 3I53A 1ETOA 5ICCA 1TT5B 1R49A 4C2MJ 2A61A 4RM2A 1BI2A 1X58A 2DK8A 1F5TA 2IA0A 2QLZA 2GXAA 4MIMA 1FMVA 1MBEA 2LY1A 3FM5A 5KAIC 3JRCA 2P5KA 1YOVB 4M3GA 1GVDA 2HFHA 3FXUA 3BR2A 5AIQA 3G4SI 2R5ZB 2ZXJA 5B1AH 2ZMEA 1H0MA 3TBIA 5FKOA 2CUEA 1YQAA 3DKXA 2W24A 3BC8A 1FJLA 4AC0A 2V4JC 3DTEA 2QSGX 2O7OA 3C2BA 3A0BC 3DTIA 1X4OA 3SDBA 4G6TB 2AO9A 2DT5A 2IAIA 1JTXA 1K7AA 3QOPA 3BY6A 4Q47A 4LMYA
chains in the Genus database with same CATH topology
4FX0A 2STWA 3VB2A 1Q1HA 5HDGA 5FO5A 1BOAA 2JT1A 2V1DA 2KKOA 3I59A 2XHKA 2L3DA 2M5WA 3F23A 2XGXA 2DU9A 3LA7A 4I2OA 3FMQA 1LEAA 1R36A 3LFKA 2IW5A 3FXRA 1IF1A 5LLQA 2XAHA 2E7WA 2M8EA 2DLLA 4ZZLA 4EMSA 4U0YA 1XB4A 1XCBA 2XASA 2FNPA 1SFEA 2VT2A 1YFHA 3ZMSA 3KP7A 2EFOA 3GUDA 3HUGA 4CYDA 1B4AA 2V1UA 2DO7A 1HXDA 4A0ZA 1I1GA 2P7VB 1C0WA 1PDNC 4PDKA 4UV8A 5D5VB 2XAGA 1IN6A 4EVIA 2O0YA 3C7JA 5HDNA 5LBQA 3ZMDA 1YG2A 3QRFF 1W7PA 2KIMA 1XGSA 4ETSA 3T0YA 3ECHA 4GCVA 4MTEA 2MH9A 2CGPA 3WG9A 1USSA 5JVTA 4HQMA 2AXLA 1KQ0A 1WWXA 2QQAA 3ABUA 3I0TA 1FZPB 4B09A 2WV0A 2H94A 2M1BA 4AWXB 2P5LC 2FOKA 1R7JA 2VN2A 6PAXA 1ZHFA 2VOPA 5A2QZ 4OU0A 1TQMA 1OR7A 3LWFA 1ZG5A 5E18F 3E6BA 3F3XA 4BYYA 2X4HA 4CDGA 3HTUA 4JK1X 2UWMA 3VOEA 1SD5A 4KUMA 5ED4A 4O3MA 4OIOF 2HKXA 2Q2EA 2DK5A 1USTA 3Q5FA 2EV0A 5DUKA 3IWZA 4S05A 1ZG3A 3FMSA 2HOEA 3GO5A 4KFCA 1LNWA 5BS6A 4A5MA 1R5HA 5FB2A 4XLNF 3EDPA 1XN7A 2R3SA 1OKRA 5DYMA 3M9AA 3GFMA 3K2ZA 4QWQA 5HVQC 1WSUA 1QO0D 3FX3A 4GXOA 2XAFA 1HBXG 4KN4X 2IT0A 2IJLA 2G7UA 1TQIA 1YTYA 2B0LA 3KP6A 4M71A 3ABTA 5A2QK 2EV6A 1LEBA 5FGMA 2ACJA 5JFRA 4LG0B 4ESJA 1LQ1A 2K27A 1W7PD 1AWCA 1ONVA 2H27A 5L3DA 1H9GA 1TBXA 5DD4A 4RGUA 4IJAA 1FP1D 3GEZA 3MCZA 3J80Z 1XGNA 3DEUA 2LKPA 4HV5A 1U5TA 3F22A 2VE9A 5HS9A 2MD5A 1JGSA 3O3KA 2WTEA 3C3WA 2DQRA 4MEXF 5E8IA 1MZBA 4D0PA 2J5PA 3HRMA 1W5TA 1XGOA 1KYWA 2OA4A 1R1TA 3ISPA 5E17F 2A5YB 2JRTA 1XGMA 2BEOA 4EM0B 3OV8A 2RC4A 2HS5A 1TQPA 4KMFA 1B9NA 4Y17A 1O3TA 3ZPLA 1B59A 4EJTA 4HOBA 5D4RA 1FOKA 2DAOA 2JTVA 1K6OA 4UXNA 2ZO4A 5ICFA 3EYYA 3G73A 4HLYA 3DPTA 3WTUC 1JHFA 3AAFA 4FHTA 1R1VA 5DUIA 1FP2A 3C1DA 4DQ2A 3TOAA 1KYZA 2A07F 1OYYA 2GQQA 3BP8A 5JHUA 3CDHA 3M7GA 3QAHA 5DCMB 4HX7A 4RGRA 3J80K 2VXZA 1QBJA 3G3ZA 3U1DA 1U2WA 2VE8A 4BHCA 4A6EA 2NNNA 4L5JA 4NB5A 1XCVA 4YG2F 3GLXA 1IXRC 4TV7A 3WTTC 1R00A 2XROA 1ZGJA 2FSWA 1QZZA 5HLGA 3E5UA 2ISZA 3JTHA 2AS5F 5J8FA 4KN7X 2KJCA 3R4KA 4MHGA 2WC2A 4L18B 2ZNYA 4FT8A 2ETHA 1TW3A 1U6GA 3CUOA 1F1ZA 2ZFWA 3IKTA 1HW1A 4H0EA 3V7SA 5H20A 4A5NA 5LGTA 4LB5A 2GA1A 2F2EA 2DW4A 2DPUA 2PLYA 2EFWA 2K02A 1ZLKA 1MJ9A 5AIPA 4M9SA 2Q8KA 1ULYA 1D8KA 2VBYA 2P4WA 3IHUA 3DV8A 4OIRF 1MD0A 3RKYA 3WU1B 1WQ2A 1K79A 1S29A 2LF8A 3R60A 3MQ0A 4HW0A 5CYVA 1X3UA 5L3CA 4XRFA 3VFZA 1CF7B 1IXSB 3OOPA 4L9TA 4U0WA 5LGUA 1R23A 1MDMB 1G3WA 3I71A 2ESNA 3BPVA 2YPRA 3U2RA 2L02A 3TOBA 3DP7A 1HW5A 1WKMA 2PFBA 3ERED 2Z5UA 1TW2A 1G3SA 1MGTA 1B9MA 4FX4A 2PBIA 4U7BA 5ICGA 4UV9A 5L3EA 1R5GA 1HSJA 5DCFA 3GWZA 3LSTA 5H6RA 3HRUA 4DNCA 2FU4A 4OMYA 4HBLA 2MC3A 3LQQA 1FNNA 5D8LB 2IVMA 3P9IA 2XUBA 4UNOA 1XSVA 3ZMUA 1S7OA 4P5OA 1W5SA 3LA2A 3W6JB 2P6TA 3IRQA 1YO5C 3FF5A 5ILVA 3CLOA 2PJPA 4Y13A 4RAZA 2D45A 1BN5A 1ZGAA 5DDGA 3T8RA 1T6SA 2HQNA 1R1UA 1SMTA 4M72A 2OZ6A 3HRSA 1KU3A 2FF4A 4P55A 1RNLA 4PGGA 1WI9A 2PMUA 3RYRA 3KZZA 4ENKA 3SFZA 2Z33A 4L0ZB 5D5WB 3P9CA 5EEHA 1H9TA 2GA2A 4LK1F 3T5XA 1HW2A 1REPC 2VONA 3JAMZ 1FSHA 4L9VA 1U3EM 4KICA 2DPDA 1VTNC 1LJ9A 1S6LA 3FWEA 2OBPA 1OYWA 2Z3YA 3I64A 4JQFA 1JXSA 1LB2A 1D3YA 4CZZA 3E6DA 2C6YA 3H3UA 5CVRA 4Z2YA 5IT9Z 1GXQA 1XMKA 1YYVA 1DPUA 4U0VA 5TRDA 1U8RA 5BPDA 3Q9SA 4LG0A 2PG4A 3CUQB 3B02A 1TNTA 3VEPA 3RPQA 1UHWA 2M45A 4BQAA 5E20A 3HSEA 2W85A 2HYFA 3V4GA 2K4JA 3FHZA 1ZRCA 2HKOA 3TGNA 2QYOA 4RAYA 3LAJA 1RUOA 2HQRA 3KZYA 2L4AA 3FZVA 3QU6A 2LF7A 2QVOA 4YIIA 2IRFG 3F8NA 3BJAA 3V7CA 1HQCA 2G9WA 1QZYA 3H3ZA 1YW7A 5K5RA 1BC8C 4G8XA 3CUQC 4IF4A 2UXNA 3BROA 4M6XA 2O3FA 1GVJA 2JSCA 1J7KA 1XDSA 3JAMK 3RKXA 4E70A 1R58A 4I0AA 2EJRA 2KRFA 2LSOA 3GZ5A 1OMIA 4OINF 5ICEA 2DFIA 5IT9K 3SQNA 4KA4A 3M8EA 2NRAC 1HKTA 2QZ8A 4XBFA 2GXBA 4UVAA 4O6JA 1SMYF 3I58A 2FBHA 4PGHA 1F9NA 1IN8A 3EETA 1V3FA 2ADUA 4WXHA 5DCMA 3N4MA 2BYVE 3HTSB 5BOXA 1T38A 1KU7A 2FXAA 4I09A 3WE3A 4BNCA 1P4AA 3IL2A 2M30A 3M8FA 1IW7F 2VT3A 2VOOA 5CVUA 4NQWA 5FLXZ 4ESBA 4Q4ZF 1P2FA 3KCCA 2HR3A 4G7OF 4RB0A 5ERIA 1P4WA 3L09A 1D8JA 1Z6TA 3WU0A 3ZN1A 4CXFA 2HZTA 1BC7C 1IRGA 1ZG1A 3KLOA 4HDVA 3WTVC 4HV6A 1XSXA 2BV6A 3D0SA 1E17A 5HOOA 2CG4A 2KIUA 5F64A 5H6QA 2V79A 3RTRA 4U88A 3B73A 2FMYA 3V8KA 2F5EA 3NEUA 2EWNA 2ZBKA 4R79A 2Y48A 2QUFA 2IA1A 3TO6A 3T1BA 4EGYA 3BWGA 4LK0F 2LNBA 3KP5A 2EV5A 2IPQX 1BI3A 4M73A 1AOYA 3HYIA 2OU2A 2IP2A 4MTDA 2STTA 2A3SA 1P92A 4ZYDA 1O3QA 1L3LA 3EUHA 2PQ8A 1SD7A 2COMA 5FD6A 4IRIA 4JBAA 3WGIA 3K9TA 4BHBA 1T98A 2XRNA 5F1RA 2F5DA 2IA2A 4HAMA 1IN5A 4HZFA 4EJOA 2MBFA 5JR3A 4MQ9F 5TJJA 1ZLJA 5FLXK 2QBYB 2RVCA 3QP6A 4KIGA 1O3RA 1BI0A 1FYMA 4P9UA 1I1SA 2FBKA 1K78B 3RI4A 1CF7A 1ZRFA 4HDUA 2E1CA 4IRGA 1FY7A 1MDMA 3WGGA 4G6QA 3V8LA 3E6MA 5KVRA 2L54A 1BJAA 5E1ZB 2Y0MA 3S2WA 2L4MA 3GX4X 2GAUA 3RPUA 2D1HA 1P6RA 3KFWX 1G6NA 3QP5A 2FE3A 3WTXC 2OAZA 3Q9VA 2DI3A 1Z9CA 5L3BA 1NHAA 2Q0OA 1DPRA 4ENNA 4G94A 1KA8A 1MJBA 3J7AO 2D2WA 4HF2A 4LD5A 2GIVA 4CICA 1J59A 1FBUA 4XSXF 1T0FA 4M9XA 5E1XA 4HLXA 3J81Z 3RJPA 4YFNF 2A69F 5D4SA 1FX7A 3IWFA 2L01A 1BIBA 1LDJA 2OZUA 3MEXA 4CGZA 2RKHA 4KIBA 1GHCA 2EK5A 5EEGA 4N0BA 2RNJA 2VC1A 2O8XA 5HLHA 2KIFA 2HYGD 5D8KB 1B1BA 3RKWA 2GZWA 3BPXA 2QQ9A 4L9NA 2GXGA 5D6EA 3F8BA 4R1HA 5LHIA 3KETA 4OIPF 1ZREA 3WTZA 1WRJA 2CSOA 4S04A 2MLKA 1U78A 3F6VA 2CWEA 1JE8A 4Y15A 2X0LA 2PMHA 1RZ4A 3PQKA 4HF1A 3ZMZA 1ZAOA 1ON1A 3ROUA 1KQ9A 3REOA 4GYIA 2PEXA 3FMRA 3BDDA 1J2XA 3JW4A 2BBYA 4YIFA 5J8CA 4AVPA 3HHHA 4MNUA 5LRSA 1E2XA 3J81K 3L7WA 3LA3A 1G3TA 5D5UB 1EH7A 5L3FA 2WWYA 4UVCA 4RB3C 3QPTA 4HYEA 3HOTA 3T8TA 1IN4A 4B8XA 2OD5A 3NQOA 1G4DA 3W6KB 2DTRA 3VODA 1SAXA 2QM3A 4RGXA 2VBWA 5BPIA 5D6FA 3E3VA 5ILSA 2V1XA 3L2CA 3CUQA 3EYIA 5DEQA 2HGCA 5CVVA 4GYGA 1STZA 1PP7U 2R7DA 2ZJ2A 1P4XA 1IZ1A 2M87A 3GFIA 1ZH5A 3TDZC 4EJWA 1TLHB 2XKOA 4ZYEA 3C18A 5FD5A 1QNTA 3RDIA 2QWWA 1Z7UA 1T39A 3DF8A 2A6HF 1J5YA 2XVCA 1QQIA 1XDUA 2RV8A 3K69A 3IC7A 5JI6A 1FWZA 1UCRA 1O7LA 1YLFA 1Z05A 3LAPA 3HHGA 2CFXA 2HWVA 3RIRA 1GXPA 2HDCA 2J5OA 4I7HA 4N9HA 2RQPA 2EFPA 1A04A 1HSTA 3L9FA 2NYXA 2DQLA 4ZYGA 4IHTA 5CVJA 2ZNZA 2A6EF 5IT3A 3K1PA 3HOSA 3BOQA 4KT5C 1XMAA 3SZTA 3SZPA 2P5VA 4IVNA 1F4KA 2QENA 1Z1DA 4PZJA 3I4PA 3GVAA 4LB6B 3SXYA 3NRVA 1EH6A 2JZYA 4UVBA 3DQVC 3MAJA 3I54A 4IXAA 4M6YA 1FBSA 1TNSA 3EQLF 2ELHA 3N97A 2NNYA 2P7CB 4EGZA 3DXJF 2FNAA 3P9KA 3LQRA 4HX4A 2TDXA 1Y0UA 4M9ZA 4KNYA 4R8HA 5LHHA 4WXCA 4ZH4F 4G9YA 4EV0A 2VBXA 4UHTA 2K4BA 2YR2A 3QPHA 4GGGA 1DP7P 3F8CA 2KJBA 1YW9A 2HTJA 2FBIA 4BHPA 3ZMTA 5E1WA 2XAQA 1FBQA 4HF0A 1RI7A 4G7ZF 4N9IA 2Z9OA 2K7LA 3ZQ7A 4KIFA 3TO7A 4CO8A 3D5LA 3PFIA 1KU2A 4LLLA 3R61A 5HS8A 4IHSA 1Z91A 1PUEE 3MZHA 4OMZA 3K1MA 5F6FA 1BM9A 3E97A 2H6CA 4I0BA 4Q5SF 2ZMEB 3TDUC 1S7AA 3DKWA 4EQQA 4Q48A 2ESHA 2NAZA 5D5XB 2F5FA 2R7FA 2FRHA 2P8TA 4RS8A 2NS0A 1S3JA 2QBYA 3PQJA 4G7HF 4EJUA 3ZP5A 1K78A 2EA4A 3JSOA 3KP2A 1UHMA 3H92A 1FPQA 1FC3A 4ZYHA 1QGPA 3I59B 4LJZF 4XSZF 3ELKA 5KK1A 5J6XA 3F6OA 4AIJA 5K1YA 1IAWA 4UUVA 3V8JA 2HEOA 4HX8A 2YX7A 4L9JA 1IRFA 2G7HA 2OQRA 1IN7A 3TQNA 2XV4S 3GYHX 3V7RA 1KU9A 2XIGA 3CJNA 3GW2A 3MFKA 2CQKA 1LDKB 2EB7A 2PI0A 2RGVA 2ZKZA 1I5ZA 4AD9A 1HKSA 1DUXC 3IKVA 1LDDA 3RYPA 2CYYA 1BIAA 4MGRA 1I6XA 1RUNA 4LFUA 4K2EA 5L3GA 1MKMA 3R0JA 3F8FA 5CVIA 4KDPA 3GXOA 1W7PB 3IRRA 3KE2A 3KP3A 1FSEA 3FXQA 3WTWC 5BQTA 4LLGF 5HLIA 2W25A 2V6CA 1BBYA 1ZYRF 2Z99A 2OQGA 5ILUA 3ZN0A 4KYWA 3K0LA 3SHFA 1CGPA 3DPLC 2ZCWA 4XLPF 1R22A 4ESFA 4P9FA 2V9VA 2MH2A 3GZ6A 3E6CC 2E7XA 4I01A 4IRHA 2LDUA 1SFUA 4AIHA 1ZRDA 2YX4A 5CJ9A 3KEOA 3JSPA 4NHJA 2RN7A 1ZARA 3MZYA 2XAJA 1SFXA 3F21A 3KP4A 4HA8A 3ECOA 4GO1A 3BJ6A 5FFXA 4OIQF 3BJOA 5DV5A 4EM2A 2EFNA 1W4MA 4A2UA 5LGNA 2DBBA 4CHUA 2EA2A 3HIFA 4RB1A 3WTSC 1O3SA 3O2PE 3ML6A 2O61A 1BI1A 1I27A 2QQBA 3GFJA 4QLCU 4WF2A 3GFLA 4RB2C 1YW8A 3E5QA 3TO9A 1IXCA 1TTYA 4WWCA 4BAYA 2BE5F 2EFQA 5FFZA 4ASNA 5K5OA 3KEQA 5LEKA 3P7NA 3CO7C 4G6DA 1QPMA 1YIOA 3GF2A 2F5CA 2W84A 4O5VA 2ISYA 2K86A 2RDPA 5AONA 1HKQA 4P96A 4IPAA 4I02A 1KGSA 1B6AA 1Z6RA 1YS6A 4F7ZA 1RIOH 1SD6A 4KMUX 3COAC 3E5XA 3ZMVA 3F72A 4WCGA 3R6SA 3HSFA 1ON2A 1O7FA 5BMZA 2MA3A 1J9IA 4WK8F 3KLNA 4EM1A 4AIKA 4A0YA 1U5TB 2FA5A 2MLGA 4ZZDA 3WE2A 1JHHA 2H6BA 1XD7A 4U7DA 1J75A 1T2KA 3R0AA 1J0RA 2W57A 4BH9A 3WTYC 3U9GA 1UB9A 4RGSA 4I98B 3ULQB 1O57A 3TKYA 3I5UA 1IUYA 5HS7A 2A68F 4HQEA 4YFXF 3O6BB 2VODA 1KQ8A 2D1VA 2E1NA 1L0OC 3CTAA 3M1EA 3CO6C 1YS7A 1MJAA 4L5IA 2CO5A 1EV7A 1V4RA 3WGHA 2CW0F 4OOIA 3K1NA 3BZ6A 1U5TC 5HDKA 4WX9A 1XSDA 3DFGA 1S8NA 2FMLA 2JPCA 4MQVA 1ODDA 2H09A 4L0YB 1SD4A 4A12A 1FYKA 2HTSA 2FQ3A 2PN6A 1FLIA 1FYLA 3WODF 3JTGA 5CLSA 2UZKA 2UXXA 1FT9A 2GWRA 4PCQA 1PP8F 2YU3A 1EH8A 5K5QA 3MWMA 1OYIA 1G3YA 1D5VA 5E8GA 5LRRA 2Y75A 4LLNA 2VC0A 4ON0A 2O03A 3L00A 4A0XA 4ENMA 1UFMA 4A6DA 3QU3A 2JPBA 1ZN2A 4YFKF 4EJVA 2O6GE 5LEJA 5LHGA 3F8MA 5DD8A 3FM3A 1OPCA 4M74A 4LGWA 4MEYF 4WXDA 2FEZA 2P6SA 2YSRA 2BGCA 4ENJA 1LVAA 2XKPA 3HSRA 1DDNA 4BXUA 3HRTA 5ICCA 2VBZA 3I53A 2A61A 1BI2A 2DK8A 1F5TA 2IA0A 2QLZA 3FM5A 2P5KA 3FXUA 2HFHA 5AIQA 2ZXJA 2ZMEA 1H0MA 1YQAA 2W24A 2DT5A 1K7AA 3QOPA 3BY6A 4Q47A 4LMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FX0 A;  2STW A;  3VB2 A;  1Q1H A;  5HDG A;  5FO5 A;  1BOA A;  2JT1 A;  2V1D A;  2KKO A;  3I59 A;  2XHK A;  2L3D A;  2M5W A;  3F23 A;  2XGX A;  2DU9 A;  3LA7 A;  4I2O A;  3FMQ A;  1LEA A;  1R36 A;  3LFK A;  2IW5 A;  3FXR A;  1IF1 A;  5LLQ A;  2XAH A;  2E7W A;  2M8E A;  2DLL A;  4ZZL A;  4EMS A;  4U0Y A;  1XB4 A;  1XCB A;  2XAS A;  2FNP A;  1SFE A;  2VT2 A;  1YFH A;  3ZMS A;  3KP7 A;  2EFO A;  3GUD A;  3HUG A;  4CYD A;  1B4A A;  2V1U A;  2DO7 A;  1HXD A;  4A0Z A;  1I1G A;  2P7V B;  1C0W A;  1PDN C;  4PDK A;  4UV8 A;  5D5V B;  2XAG A;  1IN6 A;  4EVI A;  2O0Y A;  3C7J A;  5HDN A;  5LBQ A;  3ZMD A;  1YG2 A;  3QRF F;  1W7P A;  2KIM A;  1XGS A;  4ETS A;  3T0Y A;  3ECH A;  4GCV A;  4MTE A;  2MH9 A;  2CGP A;  3WG9 A;  1USS A;  5JVT A;  4HQM A;  2AXL A;  1KQ0 A;  1WWX A;  2QQA A;  3ABU A;  3I0T A;  1FZP B;  4B09 A;  2WV0 A;  2H94 A;  2M1B A;  4AWX B;  2P5L C;  2FOK A;  1R7J A;  2VN2 A;  6PAX A;  1ZHF A;  2VOP A;  5A2Q Z;  4OU0 A;  1TQM A;  1OR7 A;  3LWF A;  1ZG5 A;  5E18 F;  3E6B A;  3F3X A;  4BYY A;  2X4H A;  4CDG A;  3HTU A;  4JK1 X;  2UWM A;  3VOE A;  1SD5 A;  4KUM A;  5ED4 A;  4O3M A;  4OIO F;  2HKX A;  2Q2E A;  2DK5 A;  1UST A;  3Q5F A;  2EV0 A;  5DUK A;  3IWZ A;  4S05 A;  1ZG3 A;  3FMS A;  2HOE A;  3GO5 A;  4KFC A;  1LNW A;  5BS6 A;  4A5M A;  1R5H A;  5FB2 A;  4XLN F;  3EDP A;  1XN7 A;  2R3S A;  1OKR A;  5DYM A;  3M9A A;  3GFM A;  3K2Z A;  4QWQ A;  5HVQ C;  1WSU A;  1QO0 D;  3FX3 A;  4GXO A;  2XAF A;  1HBX G;  4KN4 X;  2IT0 A;  2IJL A;  2G7U A;  1TQI A;  1YTY A;  2B0L A;  3KP6 A;  4M71 A;  3ABT A;  5A2Q K;  2EV6 A;  1LEB A;  5FGM A;  2ACJ A;  5JFR A;  4LG0 B;  4ESJ A;  1LQ1 A;  2K27 A;  1W7P D;  1AWC A;  1ONV A;  2H27 A;  5L3D A;  1H9G A;  1TBX A;  5DD4 A;  4RGU A;  4IJA A;  1FP1 D;  3GEZ A;  3MCZ A;  3J80 Z;  1XGN A;  3DEU A;  2LKP A;  4HV5 A;  1U5T A;  3F22 A;  2VE9 A;  5HS9 A;  2MD5 A;  1JGS A;  3O3K A;  2WTE A;  3C3W A;  2DQR A;  4MEX F;  5E8I A;  1MZB A;  4D0P A;  2J5P A;  3HRM A;  1W5T A;  1XGO A;  1KYW A;  2OA4 A;  1R1T A;  3ISP A;  5E17 F;  2A5Y B;  2JRT A;  1XGM A;  2BEO A;  4EM0 B;  3OV8 A;  2RC4 A;  2HS5 A;  1TQP A;  4KMF A;  1B9N A;  4Y17 A;  1O3T A;  3ZPL A;  1B59 A;  4EJT A;  4HOB A;  5D4R A;  1FOK A;  2DAO A;  2JTV A;  1K6O A;  4UXN A;  2ZO4 A;  5ICF A;  3EYY A;  3G73 A;  4HLY A;  3DPT A;  3WTU C;  1JHF A;  3AAF A;  4FHT A;  1R1V A;  5DUI A;  1FP2 A;  3C1D A;  4DQ2 A;  3TOA A;  1KYZ A;  2A07 F;  1OYY A;  2GQQ A;  3BP8 A;  5JHU A;  3CDH A;  3M7G A;  3QAH A;  5DCM B;  4HX7 A;  4RGR A;  3J80 K;  2VXZ A;  1QBJ A;  3G3Z A;  3U1D A;  1U2W A;  2VE8 A;  4BHC A;  4A6E A;  2NNN A;  4L5J A;  4NB5 A;  1XCV A;  4YG2 F;  3GLX A;  1IXR C;  4TV7 A;  3WTT C;  1R00 A;  2XRO A;  1ZGJ A;  2FSW A;  1QZZ A;  5HLG A;  3E5U A;  2ISZ A;  3JTH A;  2AS5 F;  5J8F A;  4KN7 X;  2KJC A;  3R4K A;  4MHG A;  2WC2 A;  4L18 B;  2ZNY A;  4FT8 A;  2ETH A;  1TW3 A;  1U6G A;  3CUO A;  1F1Z A;  2ZFW A;  3IKT A;  1HW1 A;  4H0E A;  3V7S A;  5H20 A;  4A5N A;  5LGT A;  4LB5 A;  2GA1 A;  2F2E A;  2DW4 A;  2DPU A;  2PLY A;  2EFW A;  2K02 A;  1ZLK A;  1MJ9 A;  5AIP A;  4M9S A;  2Q8K A;  1ULY A;  1D8K A;  2VBY A;  2P4W A;  3IHU A;  3DV8 A;  4OIR F;  1MD0 A;  3RKY A;  3WU1 B;  1WQ2 A;  1K79 A;  1S29 A;  2LF8 A;  3R60 A;  3MQ0 A;  4HW0 A;  5CYV A;  1X3U A;  5L3C A;  4XRF A;  3VFZ A;  1CF7 B;  1IXS B;  3OOP A;  4L9T A;  4U0W A;  5LGU A;  1R23 A;  1MDM B;  1G3W A;  3I71 A;  2ESN A;  3BPV A;  2YPR A;  3U2R A;  2L02 A;  3TOB A;  3DP7 A;  1HW5 A;  1WKM A;  2PFB A;  3ERE D;  2Z5U A;  1TW2 A;  1G3S A;  1MGT A;  1B9M A;  4FX4 A;  2PBI A;  4U7B A;  5ICG A;  4UV9 A;  5L3E A;  1R5G A;  1HSJ A;  5DCF A;  3GWZ A;  3LST A;  5H6R A;  3HRU A;  4DNC A;  2FU4 A;  4OMY A;  4HBL A;  2MC3 A;  3LQQ A;  1FNN A;  5D8L B;  2IVM A;  3P9I A;  2XUB A;  4UNO A;  1XSV A;  3ZMU A;  1S7O A;  4P5O A;  1W5S A;  3LA2 A;  3W6J B;  2P6T A;  3IRQ A;  1YO5 C;  3FF5 A;  5ILV A;  3CLO A;  2PJP A;  4Y13 A;  4RAZ A;  2D45 A;  1BN5 A;  1ZGA A;  5DDG A;  3T8R A;  1T6S A;  2HQN A;  1R1U A;  1SMT A;  4M72 A;  2OZ6 A;  3HRS A;  1KU3 A;  2FF4 A;  4P55 A;  1RNL A;  4PGG A;  1WI9 A;  2PMU A;  3RYR A;  3KZZ A;  4ENK A;  3SFZ A;  2Z33 A;  4L0Z B;  5D5W B;  3P9C A;  5EEH A;  1H9T A;  2GA2 A;  4LK1 F;  3T5X A;  1HW2 A;  1REP C;  2VON A;  3JAM Z;  1FSH A;  4L9V A;  1U3E M;  4KIC A;  2DPD A;  1VTN C;  1LJ9 A;  1S6L A;  3FWE A;  2OBP A;  1OYW A;  2Z3Y A;  3I64 A;  4JQF A;  1JXS A;  1LB2 A;  1D3Y A;  4CZZ A;  3E6D A;  2C6Y A;  3H3U A;  5CVR A;  4Z2Y A;  5IT9 Z;  1GXQ A;  1XMK A;  1YYV A;  1DPU A;  4U0V A;  5TRD A;  1U8R A;  5BPD A;  3Q9S A;  4LG0 A;  2PG4 A;  3CUQ B;  3B02 A;  1TNT A;  3VEP A;  3RPQ A;  1UHW A;  2M45 A;  4BQA A;  5E20 A;  3HSE A;  2W85 A;  2HYF A;  3V4G A;  2K4J A;  3FHZ A;  1ZRC A;  2HKO A;  3TGN A;  2QYO A;  4RAY A;  3LAJ A;  1RUO A;  2HQR A;  3KZY A;  2L4A A;  3FZV A;  3QU6 A;  2LF7 A;  2QVO A;  4YII A;  2IRF G;  3F8N A;  3BJA A;  3V7C A;  1HQC A;  2G9W A;  1QZY A;  3H3Z A;  1YW7 A;  5K5R A;  1BC8 C;  4G8X A;  3CUQ C;  4IF4 A;  2UXN A;  3BRO A;  4M6X A;  2O3F A;  1GVJ A;  2JSC A;  1J7K A;  1XDS A;  3JAM K;  3RKX A;  4E70 A;  1R58 A;  4I0A A;  2EJR A;  2KRF A;  2LSO A;  3GZ5 A;  1OMI A;  4OIN F;  5ICE A;  2DFI A;  5IT9 K;  3SQN A;  4KA4 A;  3M8E A;  2NRA C;  1HKT A;  2QZ8 A;  4XBF A;  2GXB A;  4UVA A;  4O6J A;  1SMY F;  3I58 A;  2FBH A;  4PGH A;  1F9N A;  1IN8 A;  3EET A;  1V3F A;  2ADU A;  4WXH A;  5DCM A;  3N4M A;  2BYV E;  3HTS B;  5BOX A;  1T38 A;  1KU7 A;  2FXA A;  4I09 A;  3WE3 A;  4BNC A;  1P4A A;  3IL2 A;  2M30 A;  3M8F A;  1IW7 F;  2VT3 A;  2VOO A;  5CVU A;  4NQW A;  5FLX Z;  4ESB A;  4Q4Z F;  1P2F A;  3KCC A;  2HR3 A;  4G7O F;  4RB0 A;  5ERI A;  1P4W A;  3L09 A;  1D8J A;  1Z6T A;  3WU0 A;  3ZN1 A;  4CXF A;  2HZT A;  1BC7 C;  1IRG A;  1ZG1 A;  3KLO A;  4HDV A;  3WTV C;  4HV6 A;  1XSX A;  2BV6 A;  3D0S A;  1E17 A;  5HOO A;  2CG4 A;  2KIU A;  5F64 A;  5H6Q A;  2V79 A;  3RTR A;  4U88 A;  3B73 A;  2FMY A;  3V8K A;  2F5E A;  3NEU A;  2EWN A;  2ZBK A;  4R79 A;  2Y48 A;  2QUF A;  2IA1 A;  3TO6 A;  3T1B A;  4EGY A;  3BWG A;  4LK0 F;  2LNB A;  3KP5 A;  2EV5 A;  2IPQ X;  1BI3 A;  4M73 A;  1AOY A;  3HYI A;  2OU2 A;  2IP2 A;  4MTD A;  2STT A;  2A3S A;  1P92 A;  4ZYD A;  1O3Q A;  1L3L A;  3EUH A;  2PQ8 A;  1SD7 A;  2COM A;  5FD6 A;  4IRI A;  4JBA A;  3WGI A;  3K9T A;  4BHB A;  1T98 A;  2XRN A;  5F1R A;  2F5D A;  2IA2 A;  4HAM A;  1IN5 A;  4HZF A;  4EJO A;  2MBF A;  5JR3 A;  4MQ9 F;  5TJJ A;  1ZLJ A;  5FLX K;  2QBY B;  2RVC A;  3QP6 A;  4KIG A;  1O3R A;  1BI0 A;  1FYM A;  4P9U A;  1I1S A;  2FBK A;  1K78 B;  3RI4 A;  1CF7 A;  1ZRF A;  4HDU A;  2E1C A;  4IRG A;  1FY7 A;  1MDM A;  3WGG A;  4G6Q A;  3V8L A;  3E6M A;  5KVR A;  2L54 A;  1BJA A;  5E1Z B;  2Y0M A;  3S2W A;  2L4M A;  3GX4 X;  2GAU A;  3RPU A;  2D1H A;  1P6R A;  3KFW X;  1G6N A;  3QP5 A;  2FE3 A;  3WTX C;  2OAZ A;  3Q9V A;  2DI3 A;  1Z9C A;  5L3B A;  1NHA A;  2Q0O A;  1DPR A;  4ENN A;  4G94 A;  1KA8 A;  1MJB A;  3J7A O;  2D2W A;  4HF2 A;  4LD5 A;  2GIV A;  4CIC A;  1J59 A;  1FBU A;  4XSX F;  1T0F A;  4M9X A;  5E1X A;  4HLX A;  3J81 Z;  3RJP A;  4YFN F;  2A69 F;  5D4S A;  1FX7 A;  3IWF A;  2L01 A;  1BIB A;  1LDJ A;  2OZU A;  3MEX A;  4CGZ A;  2RKH A;  4KIB A;  1GHC A;  2EK5 A;  5EEG A;  4N0B A;  2RNJ A;  2VC1 A;  2O8X A;  5HLH A;  2KIF A;  2HYG D;  5D8K B;  1B1B A;  3RKW A;  2GZW A;  3BPX A;  2QQ9 A;  4L9N A;  2GXG A;  5D6E A;  3F8B A;  4R1H A;  5LHI A;  3KET A;  4OIP F;  1ZRE A;  3WTZ A;  1WRJ A;  2CSO A;  4S04 A;  2MLK A;  1U78 A;  3F6V A;  2CWE A;  1JE8 A;  4Y15 A;  2X0L A;  2PMH A;  1RZ4 A;  3PQK A;  4HF1 A;  3ZMZ A;  1ZAO A;  1ON1 A;  3ROU A;  1KQ9 A;  3REO A;  4GYI A;  2PEX A;  3FMR A;  3BDD A;  1J2X A;  3JW4 A;  2BBY A;  4YIF A;  5J8C A;  4AVP A;  3HHH A;  4MNU A;  5LRS A;  1E2X A;  3J81 K;  3L7W A;  3LA3 A;  1G3T A;  5D5U B;  1EH7 A;  5L3F A;  2WWY A;  4UVC A;  4RB3 C;  3QPT A;  4HYE A;  3HOT A;  3T8T A;  1IN4 A;  4B8X A;  2OD5 A;  3NQO A;  1G4D A;  3W6K B;  2DTR A;  3VOD A;  1SAX A;  2QM3 A;  4RGX A;  2VBW A;  5BPI A;  5D6F A;  3E3V A;  5ILS A;  2V1X A;  3L2C A;  3CUQ A;  3EYI A;  5DEQ A;  2HGC A;  5CVV A;  4GYG A;  1STZ A;  1PP7 U;  2R7D A;  2ZJ2 A;  1P4X A;  1IZ1 A;  2M87 A;  3GFI A;  1ZH5 A;  3TDZ C;  4EJW A;  1TLH B;  2XKO A;  4ZYE A;  3C18 A;  5FD5 A;  1QNT A;  3RDI A;  2QWW A;  1Z7U A;  1T39 A;  3DF8 A;  2A6H F;  1J5Y A;  2XVC A;  1QQI A;  1XDU A;  2RV8 A;  3K69 A;  3IC7 A;  5JI6 A;  1FWZ A;  1UCR A;  1O7L A;  1YLF A;  1Z05 A;  3LAP A;  3HHG A;  2CFX A;  2HWV A;  3RIR A;  1GXP A;  2HDC A;  2J5O A;  4I7H A;  4N9H A;  2RQP A;  2EFP A;  1A04 A;  1HST A;  3L9F A;  2NYX A;  2DQL A;  4ZYG A;  4IHT A;  5CVJ A;  2ZNZ A;  2A6E F;  5IT3 A;  3K1P A;  3HOS A;  3BOQ A;  4KT5 C;  1XMA A;  3SZT A;  3SZP A;  2P5V A;  4IVN A;  1F4K A;  2QEN A;  1Z1D A;  4PZJ A;  3I4P A;  3GVA A;  4LB6 B;  3SXY A;  3NRV A;  1EH6 A;  2JZY A;  4UVB A;  3DQV C;  3MAJ A;  3I54 A;  4IXA A;  4M6Y A;  1FBS A;  1TNS A;  3EQL F;  2ELH A;  3N97 A;  2NNY A;  2P7C B;  4EGZ A;  3DXJ F;  2FNA A;  3P9K A;  3LQR A;  4HX4 A;  2TDX A;  1Y0U A;  4M9Z A;  4KNY A;  4R8H A;  5LHH A;  4WXC A;  4ZH4 F;  4G9Y A;  4EV0 A;  2VBX A;  4UHT A;  2K4B A;  2YR2 A;  3QPH A;  4GGG A;  1DP7 P;  3F8C A;  2KJB A;  1YW9 A;  2HTJ A;  2FBI A;  4BHP A;  3ZMT A;  5E1W A;  2XAQ A;  1FBQ A;  4HF0 A;  1RI7 A;  4G7Z F;  4N9I A;  2Z9O A;  2K7L A;  3ZQ7 A;  4KIF A;  3TO7 A;  4CO8 A;  3D5L A;  3PFI A;  1KU2 A;  4LLL A;  3R61 A;  5HS8 A;  4IHS A;  1Z91 A;  1PUE E;  3MZH A;  4OMZ A;  3K1M A;  5F6F A;  1BM9 A;  3E97 A;  2H6C A;  4I0B A;  4Q5S F;  2ZME B;  3TDU C;  1S7A A;  3DKW A;  4EQQ A;  4Q48 A;  2ESH A;  2NAZ A;  5D5X B;  2F5F A;  2R7F A;  2FRH A;  2P8T A;  4RS8 A;  2NS0 A;  1S3J A;  2QBY A;  3PQJ A;  4G7H F;  4EJU A;  3ZP5 A;  1K78 A;  2EA4 A;  3JSO A;  3KP2 A;  1UHM A;  3H92 A;  1FPQ A;  1FC3 A;  4ZYH A;  1QGP A;  3I59 B;  4LJZ F;  4XSZ F;  3ELK A;  5KK1 A;  5J6X A;  3F6O A;  4AIJ A;  5K1Y A;  1IAW A;  4UUV A;  3V8J A;  2HEO A;  4HX8 A;  2YX7 A;  4L9J A;  1IRF A;  2G7H A;  2OQR A;  1IN7 A;  3TQN A;  2XV4 S;  3GYH X;  3V7R A;  1KU9 A;  2XIG A;  3CJN A;  3GW2 A;  3MFK A;  2CQK A;  1LDK B;  2EB7 A;  2PI0 A;  2RGV A;  2ZKZ A;  1I5Z A;  4AD9 A;  1HKS A;  1DUX C;  3IKV A;  1LDD A;  3RYP A;  2CYY A;  1BIA A;  4MGR A;  1I6X A;  1RUN A;  4LFU A;  4K2E A;  5L3G A;  1MKM A;  3R0J A;  3F8F A;  5CVI A;  4KDP A;  3GXO A;  1W7P B;  3IRR A;  3KE2 A;  3KP3 A;  1FSE A;  3FXQ A;  3WTW C;  5BQT A;  4LLG F;  5HLI A;  2W25 A;  2V6C A;  1BBY A;  1ZYR F;  2Z99 A;  2OQG A;  5ILU A;  3ZN0 A;  4KYW A;  3K0L A;  3SHF A;  1CGP A;  3DPL C;  2ZCW A;  4XLP F;  1R22 A;  4ESF A;  4P9F A;  2V9V A;  2MH2 A;  3GZ6 A;  3E6C C;  2E7X A;  4I01 A;  4IRH A;  2LDU A;  1SFU A;  4AIH A;  1ZRD A;  2YX4 A;  5CJ9 A;  3KEO A;  3JSP A;  4NHJ A;  2RN7 A;  1ZAR A;  3MZY A;  2XAJ A;  1SFX A;  3F21 A;  3KP4 A;  4HA8 A;  3ECO A;  4GO1 A;  3BJ6 A;  5FFX A;  4OIQ F;  3BJO A;  5DV5 A;  4EM2 A;  2EFN A;  1W4M A;  4A2U A;  5LGN A;  2DBB A;  4CHU A;  2EA2 A;  3HIF A;  4RB1 A;  3WTS C;  1O3S A;  3O2P E;  3ML6 A;  2O61 A;  1BI1 A;  1I27 A;  2QQB A;  3GFJ A;  4QLC U;  4WF2 A;  3GFL A;  4RB2 C;  1YW8 A;  3E5Q A;  3TO9 A;  1IXC A;  1TTY A;  4WWC A;  4BAY A;  2BE5 F;  2EFQ A;  5FFZ A;  4ASN A;  5K5O A;  3KEQ A;  5LEK A;  3P7N A;  3CO7 C;  4G6D A;  1QPM A;  1YIO A;  3GF2 A;  2F5C A;  2W84 A;  4O5V A;  2ISY A;  2K86 A;  2RDP A;  5AON A;  1HKQ A;  4P96 A;  4IPA A;  4I02 A;  1KGS A;  1B6A A;  1Z6R A;  1YS6 A;  4F7Z A;  1RIO H;  1SD6 A;  4KMU X;  3COA C;  3E5X A;  3ZMV A;  3F72 A;  4WCG A;  3R6S A;  3HSF A;  1ON2 A;  1O7F A;  5BMZ A;  2MA3 A;  1J9I A;  4WK8 F;  3KLN A;  4EM1 A;  4AIK A;  4A0Y A;  1U5T B;  2FA5 A;  2MLG A;  4ZZD A;  3WE2 A;  1JHH A;  2H6B A;  1XD7 A;  4U7D A;  1J75 A;  1T2K A;  3R0A A;  1J0R A;  2W57 A;  4BH9 A;  3WTY C;  3U9G A;  1UB9 A;  4RGS A;  4I98 B;  3ULQ B;  1O57 A;  3TKY A;  3I5U A;  1IUY A;  5HS7 A;  2A68 F;  4HQE A;  4YFX F;  3O6B B;  2VOD A;  1KQ8 A;  2D1V A;  2E1N A;  1L0O C;  3CTA A;  3M1E A;  3CO6 C;  1YS7 A;  1MJA A;  4L5I A;  2CO5 A;  1EV7 A;  1V4R A;  3WGH A;  2CW0 F;  4OOI A;  3K1N A;  3BZ6 A;  1U5T C;  5HDK A;  4WX9 A;  1XSD A;  3DFG A;  1S8N A;  2FML A;  2JPC A;  4MQV A;  1ODD A;  2H09 A;  4L0Y B;  1SD4 A;  4A12 A;  1FYK A;  2HTS A;  2FQ3 A;  2PN6 A;  1FLI A;  1FYL A;  3WOD F;  3JTG A;  5CLS A;  2UZK A;  2UXX A;  1FT9 A;  2GWR A;  4PCQ A;  1PP8 F;  2YU3 A;  1EH8 A;  5K5Q A;  3MWM A;  1OYI A;  1G3Y A;  1D5V A;  5E8G A;  5LRR A;  2Y75 A;  4LLN A;  2VC0 A;  4ON0 A;  2O03 A;  3L00 A;  4A0X A;  4ENM A;  1UFM A;  4A6D A;  3QU3 A;  2JPB A;  1ZN2 A;  4YFK F;  4EJV A;  2O6G E;  5LEJ A;  5LHG A;  3F8M A;  5DD8 A;  3FM3 A;  1OPC A;  4M74 A;  4LGW A;  4MEY F;  4WXD A;  2FEZ A;  2P6S A;  2YSR A;  2BGC A;  4ENJ A;  1LVA A;  2XKP A;  3HSR A;  1DDN A;  4BXU A;  3HRT A;  5ICC A;  2VBZ A;  3I53 A;  2A61 A;  1BI2 A;  2DK8 A;  1F5T A;  2IA0 A;  2QLZ A;  3FM5 A;  2P5K A;  3FXU A;  2HFH A;  5AIQ A;  2ZXJ A;  2ZME A;  1H0M A;  1YQA A;  2W24 A;  2DT5 A;  1K7A A;  3QOP A;  3BY6 A;  4Q47 A;  4LMY A; 
#chains in the Genus database with same CATH topology
 4FX0 A;  3H9J A;  4HPQ A;  2CW8 A;  3PSI A;  3VB2 A;  1X1C A;  2STW A;  3HDD A;  1Q1H A;  2JRM A;  5HDG A;  4A3B J;  5FO5 A;  1BOA A;  1B8I A;  2JT1 A;  2V1D A;  2KKO A;  2KLO A;  3I59 A;  1MMN A;  2XHK A;  3K70 D;  2L3D A;  2M5W A;  2Y0S A;  2EIL H;  3F23 A;  2XGX A;  2LD5 A;  2QKL B;  2DU9 A;  3LA7 A;  4I2O A;  3FMQ A;  1LEA A;  2YS9 A;  1R36 A;  3BG6 A;  3LFK A;  4Z6Y A;  4XQF A;  2IW5 A;  3TP3 A;  3FXR A;  2CQX A;  1IF1 A;  3OYH A;  2X1C A;  4XIC A;  5LLQ A;  2QA4 I;  2VKE A;  1R5I D;  2XAH A;  2E7W A;  2EQR A;  2M8E A;  3CP2 A;  3H35 A;  2ZFU A;  2DLL A;  4ZZL A;  3C2H A;  4EMS A;  4U0Y A;  1SAU A;  1XB4 A;  1XCB A;  2ID6 A;  2XAS A;  4FE7 A;  3TW7 A;  2FNP A;  1SFE A;  2VT2 A;  1FTZ A;  3A1Y A;  1YFH A;  1N78 A;  3ZMS A;  3KP7 A;  4HRI A;  2EFO A;  3GUD A;  4HG2 A;  3HUG A;  1K61 A;  2UUZ A;  4CYD A;  3FK6 A;  3OS0 A;  1B4A A;  1VZ0 A;  2V1U A;  5FKK A;  2DO7 A;  1HXD A;  3G1L A;  4A0Z A;  1G2H A;  4PJJ A;  5E79 C;  2V1N A;  1I1G A;  2P7V B;  1VQ7 I;  1J09 A;  1C0W A;  1P7J A;  3ESW B;  1PDN C;  4PDK A;  1XC5 A;  1A36 A;  3OWT A;  3AG3 H;  4UV8 A;  5D5V B;  2XAG A;  1IN6 A;  4EVI A;  2O0Y A;  3C7J A;  5HDN A;  1YRN A;  3G2B A;  5LBQ A;  4IL6 C;  4XM3 A;  3ZMD A;  1ENH A;  1YG2 A;  3QRF F;  1W7P A;  1FIA A;  2KIM A;  1XGS A;  3GZN B;  2H1K A;  4ETS A;  3T0Y A;  1EKE A;  3VYU B;  3ECH A;  4GCV A;  4MTE A;  3ZGK A;  2MH9 A;  3G6E I;  3CCV I;  2DJN A;  1ZKG A;  2CGP A;  1E3P A;  3OMY A;  3WG9 A;  1USS A;  2TRT A;  1F36 A;  5HNF A;  5JVT A;  1XS9 A;  2R7W A;  2HDD A;  4HQM A;  4A69 C;  1VQN I;  1TL8 A;  4LIT A;  2AXL A;  1KQ0 A;  1WWX A;  2L9V A;  2QQA A;  3EPZ A;  3ABU A;  3I0T A;  1FZP B;  4B09 A;  2WV0 A;  2H94 A;  3H9Q A;  4II2 A;  2M1B A;  4AU7 A;  4AWX B;  2P5L C;  2FOK A;  2R7T A;  2CUJ A;  4S0H B;  4B47 A;  5HLT A;  1SC7 A;  1R7J A;  3MMY B;  3OYC A;  2VN2 A;  6PAX A;  1ZHF A;  3GLL A;  3WHB A;  4HSR A;  4OU0 A;  5A2Q Z;  2VOP A;  1P7I A;  1TQM A;  1OR7 A;  3LWF A;  3LSM A;  5EJC A;  1ZG5 A;  3HOW J;  4C2T A;  3LL7 A;  5E18 F;  3E6B A;  3JRB A;  3F3X A;  5TGT A;  4BYY A;  2X4H A;  3H1C A;  3HTU A;  4JK1 X;  4CDG A;  1BL0 A;  2UWM A;  3VOE A;  2ME0 A;  1SD5 A;  2KIQ A;  5J3L A;  2VKD A;  2HVR A;  2LK2 A;  2WY8 Q;  2V6E A;  3K4K A;  2DMP A;  2E60 A;  2QSH X;  2GOX B;  4C3H J;  4KUM A;  2AXT C;  2QKM B;  5ED4 A;  4O3M A;  4OIO F;  5IYB J;  1HOM A;  2HKX A;  1OIS A;  2Q2E A;  2DK5 A;  1UST A;  3S32 A;  4B4C A;  5GPC A;  3Q5F A;  2R5Y A;  4U87 A;  4Y4R A;  2EV0 A;  4V2G A;  5DUK A;  3IWZ A;  5EZG A;  4S05 A;  2JVG A;  2E5Z A;  1QVT A;  4XK4 A;  1ZG3 A;  3VSL A;  3FMS A;  2HOE A;  2LP0 A;  3GO5 A;  1GV2 A;  4CYC B;  1VQ9 I;  4KFC A;  3MVP A;  2L9S A;  2NS8 A;  2VIX A;  3PIO F;  1LNW A;  4BE2 A;  1T08 B;  1H88 C;  4PJN A;  2R92 J;  5BS6 A;  1XX5 A;  4A5M A;  1R5H A;  5FB2 A;  3QWL A;  2LFB A;  4UY8 I;  4XL9 A;  4XLN F;  3EDP A;  1XN7 A;  2QEX I;  3SYT A;  2R3S A;  1OKR A;  3ABL H;  1U9N A;  2HQA A;  5DYM A;  3M9A A;  2K9Q A;  1IJW C;  3GFM A;  3OS1 A;  2GLO A;  3K2Z A;  2X51 A;  1HA8 A;  2HPI A;  1ORK A;  4QWQ A;  3GTL J;  5HVQ C;  1WSU A;  1AHD P;  1QO0 D;  2M0M A;  3CD6 I;  3NAU A;  4FAS D;  2WAF A;  2DDA A;  3FX3 A;  4GXO A;  3CCR I;  4XLC A;  2XAF A;  3ZQL A;  1RET A;  1HBX G;  4KN4 X;  4V2F A;  3LSG A;  5IP6 A;  2XSD C;  4ZDL A;  2IT0 A;  5IP9 J;  2CW7 A;  2IJL A;  2G7U A;  1TQI A;  5FLV A;  2LYC A;  1K4T A;  1YTY A;  2B0L A;  3KP6 A;  3IUO A;  3DBL B;  4M71 A;  3ABT A;  2BXY A;  2KRC A;  2EV6 A;  5A2Q K;  1LEB A;  5FGM A;  2ACJ A;  2IS6 A;  4CCO A;  5JFR A;  3DU6 A;  4PK4 A;  2DA2 A;  3KZI C;  2VPR A;  3CF2 A;  1ETK A;  4LG0 B;  2O9L A;  4AYB N;  2IS4 A;  4ESJ A;  1LQ1 A;  2K27 A;  3S1M J;  1W7P D;  1AWC A;  4IKF A;  1ONV A;  3H9G A;  4L5E A;  4BQO A;  2KRH A;  2CH0 A;  1ZGW A;  2H27 A;  5L3D A;  3H36 A;  1QRY A;  2LKX A;  5IYC J;  2JWT A;  1H9G A;  1TBX A;  2DMT A;  5FJ8 J;  3MKY B;  5DD4 A;  4RGU A;  4IJA A;  3ZR8 X;  1FP1 D;  3GEZ A;  3MCZ A;  4ABZ A;  4BGD A;  3J80 Z;  4DGW B;  1XGN A;  2DOA A;  1YJN I;  3GTM J;  1MNM C;  3DEU A;  2LKP A;  4HV5 A;  1E3O C;  3BCA A;  1U5T A;  1T95 A;  2JMW A;  5CQE A;  2HOT A;  3DBR B;  3F22 A;  4BBS J;  1FEX A;  2VE9 A;  5HS9 A;  2MD5 A;  1POG A;  2DFE A;  1JGS A;  4JYK A;  3K7A J;  4F55 A;  1OCC H;  1H89 C;  3HOY J;  1XG1 A;  2WTE A;  3O3K A;  2MD0 A;  3C3W A;  2DQR A;  4MEX F;  1XMX A;  2IGM A;  1U0J A;  3U1K A;  1VF9 A;  5E8I A;  5KNL A;  2EIN H;  1MMS A;  2Y9Y A;  1MZB A;  1TWH J;  1Y39 A;  1GDT A;  3A01 B;  4D0P A;  3JRE A;  1IDY A;  2J5P A;  3HRM A;  1VFC A;  1W5T A;  2DMN A;  1XGO A;  4ZDP A;  1KYW A;  2K9N A;  3V42 A;  2OA4 A;  3HB9 A;  3HOV J;  1R1T A;  3ISP A;  5E17 F;  1SEU A;  2A5Y B;  2KT0 A;  1HF0 A;  2JRT A;  1MNE A;  1XGM A;  2BEO A;  4EM0 B;  3OV8 A;  4YEL A;  2RC4 A;  2HS5 A;  1TQP A;  2XDV A;  5J4Y A;  4KMF A;  1B9N A;  3AG1 H;  3LMM A;  4BQQ A;  1Z21 A;  5FRN A;  2VQL A;  4Y17 A;  2CV1 A;  1MND A;  1VQM I;  1O3T A;  1JKO C;  3ZPL A;  1B59 A;  3K4N A;  3L2V A;  4EJT A;  4HOB A;  3HBL A;  5D4R A;  1FOK A;  1QHH D;  2DAO A;  2L7Z A;  2JTV A;  2M8G X;  1K6O A;  3CLQ A;  4UXN A;  1UJ8 A;  2ZO4 A;  2KQR A;  5ICF A;  3EYY A;  1RRJ A;  1JTY A;  3G73 A;  4N4N B;  3DPT A;  1YX3 A;  5FRO A;  3WTU C;  1JHF A;  4HLY A;  3AAF A;  4FHT A;  1R1V A;  5DUI A;  1FP2 A;  3C1D A;  3I3L A;  3TOA A;  4DQ2 A;  1KYZ A;  2A07 F;  3P5J A;  3D1N I;  3CC7 I;  9ANT A;  1OYY A;  2GQQ A;  2HI3 A;  3BP8 A;  2E34 A;  3VWB A;  4LIV A;  2ZXW H;  5JHU A;  3CDH A;  2HXO A;  4JP0 A;  3M7G A;  3QAH A;  5DCM B;  4DBQ A;  1K83 J;  4IEJ A;  1JJ6 C;  1Y0N A;  1D1A A;  2JUC A;  4HX7 A;  3JRA A;  3FBI B;  4RGR A;  3J80 K;  2HZD A;  2VXZ A;  2KPM A;  1IV6 A;  1QBJ A;  3G3Z A;  2ZXH A;  3JR9 A;  3U1D A;  3GCM A;  3OL4 A;  1U2W A;  2VE8 A;  4CCN A;  3BT9 A;  4A6E A;  4BHC A;  5DS9 A;  2DA3 A;  4BL0 B;  3PSF A;  4DYR A;  2NNN A;  4L5J A;  4NB5 A;  1V5F A;  1XCV A;  3HPG A;  5EG0 A;  3WHC A;  4YG2 F;  3GLX A;  1IXR C;  4NQW B;  1FOX A;  5EGO B;  4TV7 A;  2E2J J;  3WTT C;  1ZR4 A;  1R00 A;  1ZGJ A;  2FSW A;  2XRO A;  1QZZ A;  4A3C J;  5HLG A;  3E5U A;  2M4K A;  2ISZ A;  1T33 A;  2X1E A;  2LBF B;  3S93 A;  2DYR H;  3JTH A;  3KX2 A;  3OYG A;  2AS5 F;  5J8F A;  1E0E A;  2KP6 A;  4GFB A;  4KN7 X;  2KJC A;  4BKX A;  3R4K A;  5LD2 C;  4MHG A;  4DYQ A;  3I55 I;  1IRX A;  1S9H A;  2WC2 A;  4L18 B;  2ZNY A;  4FT8 A;  1MMA A;  3O8H A;  2JA7 J;  2ETH A;  1TW3 A;  1OLT A;  1U6G A;  3CUO A;  1F1Z A;  2ZFW A;  3IKT A;  1HW1 A;  2VI6 A;  2HQ5 A;  4H0E A;  2IGK A;  3K6G A;  1DU0 A;  3V7S A;  2WB1 N;  4XNF A;  5H20 A;  4A5N A;  5LGT A;  4LB5 A;  1MH4 A;  5FKN A;  2GA1 A;  2F2E A;  2DW4 A;  2DPU A;  4HEA 2;  5TIS C;  2PLY A;  1BR2 A;  2EFW A;  3ONQ A;  1ZQ3 P;  3S1R J;  2EZK A;  2K02 A;  2R5Z A;  1ZLK A;  1UG0 A;  2M2E A;  3PO2 J;  1MJ9 A;  5GP9 A;  1XPX A;  5AIP A;  4NC8 A;  4FE4 A;  3HKZ N;  2GIZ A;  1D0Z A;  1X19 A;  2CQN A;  4M9S A;  2Q8K A;  2R7S A;  1ULY A;  1JGG A;  3QYF A;  1D8K A;  2X6W A;  2KHM A;  3O8G A;  3CJQ B;  2VBY A;  5HNH A;  3KIO A;  1G8X A;  1N25 A;  1UEL B;  2P4W A;  3IHU A;  3DV8 A;  4G12 A;  3PNY A;  4FIS A;  4MFE A;  1SVM A;  4RDU A;  4OIR F;  4PJ0 C;  1MD0 A;  3ASN H;  2QCO A;  3RKY A;  3WU1 B;  3OYM A;  1WQ2 A;  1K79 A;  3LSP A;  2CS3 A;  1S29 A;  1X2M A;  5FKL A;  3MN2 A;  2K85 A;  2LF8 A;  3R60 A;  3MQ0 A;  4XKW A;  4HW0 A;  5DM7 F;  5CYV A;  2QQ8 A;  2ZC2 A;  3PNT A;  3ZQI A;  3J7Y J;  4DBR A;  2OTL I;  1RR7 A;  1X3U A;  5L3C A;  3BCB A;  4XRF A;  3VFZ A;  1CF7 B;  1IXS B;  2WAD A;  2E1O A;  3OOP A;  4L9T A;  4U0W A;  3J7A Y;  5LGU A;  2PX9 A;  1R23 A;  1MDM B;  1G3W A;  3I71 A;  4A3E J;  2XAU A;  2ESN A;  3BPV A;  3K4M A;  3DEE A;  2PMZ A;  2DCE A;  2YPR A;  2XF7 A;  4D9J A;  3U2R A;  2L02 A;  3TOB A;  4DW6 A;  3DP7 A;  1HW5 A;  1WKM A;  3EUH C;  2Y2Z A;  1WJE A;  1V5E A;  2PFB A;  3ERE D;  2Z5U A;  3IH4 A;  1OFC X;  1TW2 A;  1YE9 A;  3CCQ I;  1G3S A;  1MGT A;  2F5V A;  2IS1 A;  1B9M A;  5B5E C;  4UUT A;  4QPO A;  4FX4 A;  5F0H A;  3L2W A;  4ZTJ A;  5J1U A;  3DLA A;  2PBI A;  3DEW A;  1Y1V J;  2RAE A;  4U7B A;  5ICG A;  4AYB A;  4UV9 A;  5L3E A;  1R5G A;  2F4M B;  4CCK A;  1HSJ A;  5DCF A;  2AHQ A;  3GWZ A;  3LST A;  5H6R A;  3UR3 C;  3HRU A;  3BTL A;  4DNC A;  3ZQG A;  2FU4 A;  4OMY A;  4HBL A;  2MC3 A;  1U9O A;  3FXM A;  1Q1V A;  3LQQ A;  2LG4 A;  2Y9Z A;  1FNN A;  5D8L B;  1D1B A;  2LTP A;  3F0C A;  3QOE A;  2NOG A;  4PJL A;  1KON A;  2HOA A;  2IVM A;  1JJ8 C;  3P9I A;  4E7H A;  1JT0 A;  3S1N J;  2XUB A;  4UNO A;  3FIW A;  4XON A;  3GTJ J;  1XSV A;  4XKC A;  3ZMU A;  1S7O A;  4P5O A;  1IV8 A;  2KDO A;  1W5S A;  5FLM J;  1X3Z B;  3CCE I;  3LA2 A;  3AFH A;  3W6J B;  1I6H J;  2HNH A;  2EBI A;  2P6T A;  2HDW A;  3IRQ A;  2JA8 J;  1YO5 C;  3JRI A;  3FF5 A;  5ILV A;  3CLO A;  5GAG J;  3OR1 C;  3FXO A;  1G59 A;  2EPF A;  2PJP A;  3LNQ A;  2M34 A;  4AUX A;  4Y13 A;  4RAZ A;  2D45 A;  1IO2 A;  1BN5 A;  4DOZ A;  2MYS A;  3E1S A;  1ZGA A;  1T0F C;  2L7M P;  3OYE A;  1TP4 A;  3ZQH A;  4GRI A;  4ZC3 A;  2CV0 A;  2K9L A;  1NG6 A;  5DDG A;  3JCU C;  3T8R A;  1T6S A;  3JRF A;  2HQN A;  4XLE A;  2E2H J;  1R1U A;  2BW3 B;  2O5R A;  5FKM A;  2G0E A;  1SMT A;  3CES A;  4M72 A;  4CYC A;  2OZ6 A;  3HRS A;  1KU3 A;  3S15 J;  1EJ9 A;  1MBJ A;  5IY5 H;  4KT6 A;  2FF4 A;  4M3F A;  4RLQ A;  4P55 A;  1RNL A;  4E7Z A;  4PGG A;  2M7B A;  1WI9 A;  2I8D A;  3OL3 A;  4Y7N J;  1PYV A;  3F9K A;  2PMU A;  2FX0 A;  3RYR A;  3KZZ A;  4ENK A;  2AQE A;  3SFZ A;  2Z33 A;  3W6V A;  4L0Z B;  3B6C A;  2NVY J;  5D5W B;  3D5S C;  3P9C A;  5EEH A;  2NVX J;  1H9T A;  4PSX A;  2GA2 A;  1W36 C;  3IV5 A;  4A3F J;  4LK1 F;  3T5X A;  3CC2 I;  4DIQ A;  1HW2 A;  3ZOB A;  1REP C;  1GV5 A;  1A5J A;  2VON A;  1IG7 A;  1MSF C;  3JAM Z;  1FSH A;  3VYR B;  4L9V A;  3DKY A;  1U3E M;  4KIC A;  1JUM A;  2DPD A;  1VTN C;  1Y8R B;  1ZTR A;  1LJ9 A;  1S6L A;  3FWE A;  2OBP A;  1T8I A;  1MMD A;  1MH3 A;  1OYW A;  2Z3Y A;  4NC7 A;  2BOL A;  3I64 A;  4M3E A;  4JQF A;  1JXS A;  1LB2 A;  1D3Y A;  1HC8 A;  4CZZ A;  3E6D A;  2C6Y A;  3H3U A;  5CVR A;  4Z2Y A;  5IT9 Z;  1GXQ A;  4E7S A;  1WHU A;  1XMK A;  1YYV A;  1DPU A;  2JK3 A;  4U0V A;  4B3X A;  3S3O A;  5TRD A;  1U8R A;  2LLK A;  2BY3 A;  5BPD A;  1VQL I;  3Q9S A;  2XRL A;  4LG0 A;  1B72 B;  4NBQ A;  2OCC H;  1DQU A;  4NNJ A;  2PG4 A;  3CUQ B;  3B02 A;  1TNT A;  5EF6 A;  3VEP A;  2R7V A;  3RPQ A;  1UHW A;  2M45 A;  1FOY A;  4BQA A;  5E20 A;  3HSE A;  2W85 A;  5JLX A;  2HYF A;  3LSK A;  3V4G A;  1TWC J;  3OYD A;  2K4J A;  2RNG A;  3QPL A;  3FHZ A;  1ZRC A;  1NK2 P;  2HKO A;  3TGN A;  2N8G A;  2QYO A;  1Z7L A;  1ZEL A;  4RAY A;  5CQG A;  3HGG A;  3LAJ A;  1MBH A;  2DA5 A;  1CQT A;  1RUO A;  2WB1 A;  2E35 A;  2HQR A;  4C30 A;  3KZY A;  2L4A A;  3FZV A;  3QU6 A;  4CCM A;  2LF7 A;  3BR5 A;  4QIW N;  2QVO A;  4PUS A;  4YII A;  2IRF G;  3F8N A;  3BJA A;  3V7C A;  1HQC A;  4B43 A;  2W4S A;  2VL8 A;  1IUF A;  2G9W A;  2KFD A;  1QZY A;  3A01 A;  3H3Z A;  1R6R A;  1YW7 A;  5K5R A;  1BC8 C;  4G8X A;  2MAB A;  3CUQ C;  4IF4 A;  2UXN A;  4KIT B;  3BRO A;  3HKZ A;  1GLN A;  1I39 A;  4M6X A;  3WG7 H;  2O3F A;  4CZC A;  2VQH A;  1GVJ A;  3FIS A;  4ZYA A;  5JHF A;  1LFP A;  5E3L A;  2FD5 A;  2JSC A;  4DYC A;  4GDF A;  1J7K A;  4ZDO A;  2R0Q C;  1XDS A;  3HM5 A;  2VJI A;  3JAM K;  3RKX A;  3M1C A;  1R58 A;  4E70 A;  2E1M B;  4I0A A;  4KJZ A;  5KCM A;  1X1P A;  1JUS A;  2EJR A;  3OR2 C;  1R71 A;  5CKT A;  2KRF A;  2BVL A;  2LSO A;  3GZ5 A;  1OMI A;  2VQG A;  4OIN F;  5ICE A;  2ZJP F;  4RLF A;  2DFI A;  5IT9 K;  1Y56 A;  3SQN A;  4KA4 A;  3CCY A;  3M8E A;  2NRA C;  3C2G A;  1BR4 A;  1HKT A;  1V55 H;  2QZ8 A;  4XBF A;  2X6Y A;  1MBG A;  1X2N A;  3HGY A;  3ZQQ A;  4E6K G;  2GXB A;  3VYS B;  4UVA A;  3KYD B;  4FCY A;  4O6J A;  4BJ5 C;  1JI8 A;  1SMY F;  3I58 A;  2LMD A;  2FBH A;  4PGH A;  1A35 A;  1F9N A;  1IN8 A;  3EET A;  1V3F A;  2ADU A;  4WXH A;  5DCM A;  4ZJZ A;  2PMZ N;  3N4M A;  2BYV E;  3HTS B;  3CMM A;  5BOX A;  1T38 A;  2E36 A;  2V9K A;  3BTI A;  2X9D A;  1KU7 A;  2FXA A;  2WV1 A;  4I09 A;  2E1M C;  3WE3 A;  4BNC A;  1P4A A;  2M30 A;  3M8F A;  3IL2 A;  1Z3X A;  3JRH A;  1IW7 F;  2HVQ A;  1W0U A;  2VT3 A;  1MW7 A;  3VPR A;  1PVE A;  4IX7 A;  1OJL A;  2VOO A;  3PM1 A;  5CVU A;  4NQW A;  1UG2 A;  5FLX Z;  4ESB A;  5EGO A;  4Q4Z F;  1P2F A;  3KCC A;  4CCL A;  4JX6 A;  3MKZ A;  2HR3 A;  3TMO A;  4G7O F;  4RB0 A;  1Y6I A;  1YIJ I;  5C4X J;  4JX4 A;  5KAF C;  1Z3Y A;  5ERI A;  4BJ6 C;  4D7N A;  1LE8 B;  3GTO J;  1P4W A;  3W2W A;  2E71 A;  2OCE A;  3L09 A;  1D8J A;  2LBF A;  1IRZ A;  1Z6T A;  2M9H A;  2DOD A;  2ZSI B;  3WU0 A;  3ZN1 A;  4CXF A;  3K10 A;  1R9T J;  2HZT A;  1BC7 C;  2RQQ A;  2V9P A;  3A2K A;  1ZG1 A;  1IRG A;  3A4C A;  3KLO A;  1RES A;  4PFP A;  4HDV A;  3CJT B;  3WTV C;  4HV6 A;  1XSX A;  2VUM J;  2BV6 A;  3D0S A;  4XLH A;  2HU9 A;  2BHZ A;  1E17 A;  3NWT A;  5HOO A;  4BXX J;  2JA6 J;  1QZE A;  2CG4 A;  2KIU A;  5F64 A;  4I6Z A;  1W1W E;  5H6Q A;  2V79 A;  3RTR A;  1Y8Q B;  3CQZ J;  4U88 A;  2JA5 J;  1X3W B;  3B73 A;  2FMY A;  2ZXI A;  3V8K A;  2F5E A;  4UUS B;  5E3M A;  3NEU A;  2EWN A;  3DLL F;  2ZBK A;  4R79 A;  2Y48 A;  1APL C;  2QUF A;  2IA1 A;  3TO6 A;  3T1B A;  2DTZ A;  3LSI A;  4EGY A;  5M5X J;  3BWG A;  4LK0 F;  2LNB A;  3KP5 A;  2EV5 A;  2IPQ X;  5K7H A;  1BI3 A;  4M73 A;  1AOY A;  3L2U A;  3BR3 A;  1WI3 A;  4EEF G;  3HYI A;  2OU2 A;  4YIR X;  2XF6 A;  1RPW A;  2L0K A;  2IP2 A;  4MTD A;  2STT A;  2A3S A;  4HNV A;  3OYB A;  1P92 A;  2M4G A;  1MIJ A;  4ZYD A;  1JT6 A;  1O3Q A;  1L3L A;  5IYD J;  3EUH A;  3ERM A;  1ACI A;  2PQ8 A;  1SD7 A;  3FDY A;  2COM A;  5FD6 A;  1BA5 A;  2R7O A;  4IRI A;  4JBA A;  3WGI A;  3PNV A;  3K9T A;  1ETX A;  4BHB A;  1T98 A;  2XRN A;  3OY9 A;  5F1R A;  2R93 J;  1W5C C;  2F5D A;  2IA2 A;  4XRS A;  4HAM A;  2ME6 A;  3ABK H;  2DYS H;  3S8P A;  1IN5 A;  4HZF A;  3GTK J;  4EJO A;  2MBF A;  4P1W A;  4IOA F;  3M07 A;  5JR3 A;  3A0H C;  4MQ9 F;  1LUJ B;  2NXN B;  5TJJ A;  1ZLJ A;  5EDN A;  5FLX K;  2QBY B;  1R4M B;  2RVC A;  3QP6 A;  4KIG A;  1O3R A;  1BI0 A;  4E7K A;  1FYM A;  4P9U A;  1I1S A;  2FBK A;  1K78 B;  4DZJ A;  3X2Q H;  3RI4 A;  1CF7 A;  1ZRF A;  3GME A;  4HDU A;  3BR0 A;  4W97 A;  1K4S A;  2E1C A;  4IRG A;  1FY7 A;  1MDM A;  1I3Q J;  2NVT J;  2CUF A;  3WGG A;  4G6Q A;  2OPT A;  3V8L A;  1FMW A;  1UHS A;  3LFU A;  4AVZ A;  3E6M A;  1M1E B;  5KVR A;  2L54 A;  4J00 A;  1BJA A;  5E1Z B;  4XOP A;  2CQ7 A;  2Y0M A;  3S2D J;  1TT0 A;  3S2W A;  3H0D A;  2L4M A;  3GX4 X;  4OAZ A;  2GAU A;  1VQO I;  5GTI C;  3RPU A;  2D1H A;  1P6R A;  1BJZ A;  2FJ1 A;  3KFW X;  1S72 I;  1G6N A;  3QP5 A;  4XID A;  1ETY A;  4HST A;  3VSK A;  5CPR B;  2FE3 A;  3WTX C;  2Q1Z B;  3OYL A;  2OAZ A;  3Q9V A;  2DI3 A;  1Z9C A;  5L3B A;  1NHA A;  2Q0O A;  1DPR A;  4F52 A;  4ENN A;  1VQP I;  1VQK I;  1RKT A;  2CJJ A;  4G94 A;  4YRV A;  2MFZ A;  2EZH A;  1KA8 A;  1NG7 A;  3BG3 A;  3OIP A;  1MJB A;  3J7A O;  2D2W A;  2P81 A;  4HF2 A;  4LD5 A;  2FQ4 A;  2GIV A;  4CIC A;  1J59 A;  1FBU A;  4M6V A;  4XSX F;  1T0F A;  4BBR J;  4M9X A;  5E1X A;  4XKV A;  4HLX A;  3RJP A;  3J81 Z;  4YFN F;  3TL4 X;  2A69 F;  5D4S A;  1FX7 A;  3BLY A;  3IWF A;  2L01 A;  2XF5 A;  3TW6 A;  2L5Q A;  1BIB A;  1LDJ A;  2ID3 A;  4D5C A;  5C44 J;  2XSJ C;  4QSH A;  2OZU A;  5IOZ A;  3MEX A;  4CGZ A;  2RKH A;  4KIB A;  1GHC A;  1MBF A;  2EK5 A;  2K9S A;  3QPS A;  2W00 A;  5EEG A;  2WY7 Q;  4RMN A;  4RAG A;  3E7L A;  4IHV A;  4N0B A;  2M7A A;  2RNJ A;  2VC1 A;  2K9M A;  2ZB9 A;  3ASO H;  5F1J A;  3CCU I;  4A3J J;  2O8X A;  1UZC A;  5HLH A;  1WZ2 A;  1WVR A;  2KIF A;  2HYG D;  3EUK L;  5B1B H;  1QHG A;  1JKP C;  5D8K B;  2ICW G;  5M3F J;  1B1B A;  3RKW A;  2GZW A;  1EA3 A;  2ELK A;  3BPX A;  2QQ9 A;  2JQ7 A;  4L9N A;  2GXG A;  4PSW A;  5D6E A;  3F8B A;  4R1H A;  2X85 A;  5LHI A;  3KET A;  2IXS A;  4XN3 A;  3OS2 A;  4OIP F;  2BW3 A;  1DP3 A;  1ZRE A;  3WTZ A;  1WRJ A;  2CSO A;  3AG4 H;  5M3M J;  1I3A A;  4RA2 A;  2MLK A;  4UB8 C;  4S04 A;  4IZZ A;  1U78 A;  3F6V A;  1D5Y A;  4IQJ A;  2CWE A;  1JE8 A;  4Y15 A;  1YJ9 I;  2X0L A;  2PMH A;  3ZQF A;  2CUZ A;  1RZ4 A;  3PQK A;  3HOZ J;  2JA2 A;  1SAN A;  2LRD A;  1NK3 P;  4HF1 A;  3ZMZ A;  1ZAO A;  1ON1 A;  3ROU A;  2GOM A;  1TZL A;  3OSG A;  1YIT I;  3H5R A;  1KQ9 A;  3CMY A;  3RZD J;  2Z1D A;  3REO A;  1QU3 A;  4GYI A;  4IHY A;  2PEX A;  1HLV A;  2WAQ N;  3FMR A;  3BDD A;  1J2X A;  3JW4 A;  1VND A;  2BBY A;  4YIF A;  3OYI A;  5J8C A;  3G1M A;  2JJ7 A;  2NOJ B;  3CC4 I;  4AVP A;  1BW5 A;  2OUM A;  3HHH A;  4MLO A;  1F43 A;  4C3I J;  5B3S H;  4MNU A;  5LRS A;  1E2X A;  3J81 K;  3L7W A;  4BXF A;  1WJ5 A;  3LA3 A;  1G3T A;  3TP0 A;  5D5U B;  1EH7 A;  4BEH B;  5L3F A;  2WWY A;  3GTP J;  4LIU A;  2LVS A;  4UVC A;  3CCS I;  2VXD A;  2CFO A;  5GTH C;  4RB3 C;  1AKH B;  3QPT A;  5GPA A;  4HYE A;  3HOT A;  3CME I;  3CJR B;  3T8T A;  1IN4 A;  4B8X A;  2OD5 A;  3OIO A;  3NQO A;  1G4D A;  3LSJ A;  3FXJ A;  1P9Q C;  3W6K B;  4B48 A;  4RBO A;  2GBY A;  4FET A;  2DTR A;  4J19 A;  3VOD A;  3LSH A;  3RPU D;  1SAX A;  2QM3 A;  3HZJ A;  3G71 I;  1N77 A;  4RGX A;  2KZV A;  2VBW A;  3W3C A;  5K7F A;  2E2I J;  1FIP A;  2F6C A;  3IAS 2;  5BPI A;  5D6F A;  1B72 A;  1ITY A;  3E3V A;  5ILS A;  3OSF A;  1IGN A;  3L2Q A;  4A3D J;  3D5R C;  2V1X A;  3L2C A;  3A02 A;  3CUQ A;  1PUF B;  3EYI A;  5DEQ A;  4IQ4 A;  4M3D A;  2HGC A;  2LOO A;  5CVV A;  4BE1 A;  4GYG A;  1STZ A;  2QF7 A;  1PP7 U;  2R7D A;  2ZJ2 A;  1P4X A;  1IZ1 A;  2M87 A;  3GFI A;  1ZH5 A;  3TDZ C;  5H2F C;  4EJW A;  1TLH B;  1ETW A;  1ETQ A;  2XKO A;  2Y69 H;  3IH3 A;  3DU5 A;  3MD2 A;  2V7F A;  4ZYE A;  3C18 A;  3S1Q J;  5IOY A;  5FD5 A;  3AKZ A;  1QNT A;  3DBH B;  3K4B A;  2JN6 A;  1ETV A;  3RDI A;  2Z16 A;  2QWW A;  2TCT A;  3BG5 A;  3PJR A;  1N75 A;  3FKJ A;  1Z7U A;  1T39 A;  3DF8 A;  2A6H F;  3DWL E;  3AG2 H;  2F4I A;  1J5Y A;  4BQN A;  2YU9 J;  2XVC A;  2XGC A;  4UB6 C;  1QQI A;  2E19 A;  1WPK A;  1QPI A;  4N4O B;  3CDL A;  2DMQ A;  2VJ5 A;  3HOU J;  1XDU A;  2RV8 A;  3K69 A;  3IC7 A;  1W36 D;  2HPM A;  3SEZ A;  5JI6 A;  4B1R A;  1BOB A;  3IH2 A;  1FWZ A;  4BDZ A;  5M5W J;  3SJM A;  1UCR A;  4Y3O A;  1O7L A;  4BE0 A;  1YLF A;  1I50 J;  1Z05 A;  3LAP A;  3S17 J;  4F3Q A;  2WA0 A;  3HHG A;  4H4K C;  2CFX A;  2HWV A;  4X6A J;  3RIR A;  1ERD A;  3K4C A;  2XB0 X;  1GXP A;  3CCJ I;  2HDC A;  2J5O A;  2MG4 A;  2Y31 A;  1VQ6 I;  4I7H A;  2OC6 A;  4N9H A;  1KZH A;  2RQP A;  2EFP A;  1A04 A;  1HST A;  3L9F A;  2HXI A;  2XPV A;  2NYX A;  2DQL A;  4ZYG A;  4IHT A;  5CVJ A;  4A3I J;  2ZNZ A;  2A6E F;  2I10 A;  1FTT A;  5IT3 A;  3K1P A;  3HOS A;  3BOQ A;  2KL4 A;  3B6A A;  1JKR C;  3BG9 A;  4KT5 C;  3K2A A;  1XMA A;  3PUF A;  3SZT A;  5BNG A;  3SZP A;  2P5V A;  3WU2 C;  4IVN A;  1F4K A;  2QEN A;  4XMY A;  1Z1D A;  4XLF A;  2WAE A;  1NTC A;  4PZJ A;  3I4P A;  3KEY A;  3GVA A;  3BR6 A;  3KYL A;  1UMQ A;  4LB6 B;  2PJR B;  3SFI A;  5EYR A;  3SXY A;  1HDD C;  3NRV A;  1EH6 A;  2JZY A;  5B66 C;  5C3E J;  4UVB A;  3GTG J;  3DQV C;  1S5L C;  1AU7 A;  1VQ4 I;  3MAJ A;  2W1O A;  2EH3 A;  2A5W A;  3I54 A;  4IXA A;  3OYK A;  2GM4 A;  4M6Y A;  4IOC F;  2X6O A;  5F27 A;  1FBS A;  3FXL A;  2R4G A;  4AID A;  1TNS A;  3E0J B;  3EQL F;  2BXZ A;  3BQZ A;  2ELH A;  4ITV A;  4Y52 J;  1PJR A;  5JVG F;  3N97 A;  2NNY A;  2P7C B;  3HL2 A;  4EGZ A;  4X1E A;  3DXJ F;  3GTQ J;  2FNA A;  3P9K A;  3S2H J;  3LQR A;  2COB A;  1WGX A;  4HX4 A;  2TDX A;  2DDB A;  1LE8 A;  1Y0U A;  3H5N A;  4M9Z A;  4KNY A;  4R8H A;  1OCT C;  1OCP A;  5LHH A;  4WXC A;  4ZH4 F;  1ZK8 A;  1VQ5 I;  1JUP A;  4G9Y A;  1A6I A;  2VKV A;  1BR1 A;  4EV0 A;  4XRS G;  3HOX J;  3K70 C;  2VBX A;  2H1L A;  4UHT A;  2YR2 A;  1X1B A;  2K4B A;  1WFX A;  1GUU A;  3QPH A;  5J1Y A;  4GGG A;  2DJI A;  3F8C A;  1DP7 P;  3S3M A;  1JKQ C;  2KJB A;  1YW9 A;  1VQ8 I;  2HTJ A;  2NS7 A;  4QPQ A;  1T56 A;  3HC7 A;  1VI0 A;  3JRD A;  2FBI A;  3MKW B;  4UUS A;  4BHP A;  2DT6 A;  3ZMT A;  2ZJR F;  5E1W A;  2XAQ A;  5FRM A;  1FBQ A;  3U21 A;  4XKB A;  4HF0 A;  4JOM A;  1RI7 A;  1YX5 A;  4G7Z F;  2OTJ I;  2LR8 A;  4E7J A;  4D1Q A;  1NH3 A;  1H8A C;  3CMA I;  2JUG A;  4N9I A;  2BY2 A;  2Z9O A;  1FOW A;  2K7L A;  2R7Q A;  3ZQ7 A;  4KIF A;  3TO7 A;  4CO8 A;  3D5L A;  1GT0 C;  3PFI A;  1DGR M;  2BHY A;  2XGD A;  1S7E A;  1KU2 A;  4LLL A;  5E3O A;  4RAF A;  4BY1 J;  3R61 A;  3K4J A;  2VPL A;  1R4N B;  5HS8 A;  4IHS A;  1WJB A;  2VJJ A;  1OQY A;  2EIM H;  3PL8 A;  1Z91 A;  4I76 A;  5GAD J;  2HYJ A;  5F04 A;  2A05 A;  1PUE E;  3SEQ A;  3MZH A;  4OMZ A;  5K7Z A;  3K1M A;  4FTH A;  1LVK A;  3DPU A;  5F6F A;  1BM9 A;  3E97 A;  2H6C A;  4I0B A;  4Q5S F;  4RM3 A;  2ZME B;  3W2A A;  3DTK A;  3TDU C;  1S7A A;  3DKW A;  1X1A A;  3KYC B;  4EQQ A;  4Q48 A;  2ESH A;  2F48 A;  2NAZ A;  5D5X B;  4BDY A;  2F5F A;  2R7F A;  2FRH A;  3ZXS A;  1SVO A;  2P8T A;  4RS8 A;  4ANJ A;  2NS0 A;  5KHD A;  1S3J A;  2QBY A;  2DOE A;  2MGQ A;  1TWG J;  3BQY A;  1TC3 C;  3PQJ A;  4G7H F;  5F0C A;  4EJU A;  1LFB A;  1Z77 A;  2BY0 A;  4XRM A;  2K3P A;  2LKS A;  3ZP5 A;  1K78 A;  2LC2 A;  4FQG A;  2EA4 A;  2WAQ A;  3KP2 A;  3JSO A;  1UHM A;  3H92 A;  2JSP A;  3ZQC A;  1FPQ A;  1FC3 A;  4J01 A;  1B8I B;  3HEF A;  1Z0X A;  4C3J J;  4ZYH A;  1D0Y A;  1QGP A;  3I59 B;  4LJZ F;  4XSZ F;  2R7R A;  3ELK A;  2KMU A;  5KK1 A;  5J6X A;  4AM3 A;  3F6O A;  2IGN A;  4AIJ A;  3S3N A;  5K1Y A;  1V54 H;  3Q0W A;  4NDL A;  1IDZ A;  3VYT B;  1IAW A;  3LSR A;  4UUV A;  3V8J A;  4YEJ A;  2HEO A;  2ECC A;  2FUG 2;  4HX8 A;  3RKQ A;  5C4J J;  3PFY A;  2YX7 A;  4L9J A;  2V26 A;  3ZCO A;  1IRF A;  5IP7 J;  2G7H A;  2OQR A;  4F91 B;  1IN7 A;  4BJT A;  4A93 J;  2DN0 A;  3TQN A;  2XV4 S;  3GYH X;  2DA1 A;  1DU6 A;  3V7R A;  2HOS A;  1LFU P;  1KU9 A;  2ZME C;  2XIG A;  2JVH A;  3CJN A;  3GW2 A;  3IP4 B;  2LRE A;  3MFK A;  2CQK A;  1LDK B;  2EB7 A;  4B3A A;  2PI0 A;  2EIK H;  2RGV A;  3CCM I;  2ZKZ A;  3OYF A;  2KIS A;  1I5Z A;  3HUG B;  4AD9 A;  1HKS A;  1DUX C;  4LG3 A;  3QYE A;  3IKV A;  1LDD A;  3RYP A;  2CYY A;  4BY7 J;  4W1U A;  2B7E A;  1BIA A;  3RZO J;  4IO9 F;  4MGR A;  1I6X A;  1RUN A;  4LFU A;  2EZI A;  4K2E A;  4OWR B;  1MKM A;  3R0J A;  5L3G A;  3F8F A;  3IAM 2;  5CVI A;  4CSW A;  4KDP A;  4A3G J;  1YRN B;  2BY1 A;  2K5C A;  4M3B A;  2P0W A;  3GXO A;  1W7P B;  3IRR A;  3KE2 A;  3KP3 A;  3CCL I;  1FSE A;  3UKG A;  3FXQ A;  3I9V 2;  3WTW C;  5BQT A;  4LLG F;  4NC6 A;  5HLI A;  2W25 A;  2V6C A;  1BBY A;  1ZYR F;  2Z99 A;  1Y1W J;  2OQG A;  5ILU A;  2IS2 A;  1MMG A;  3BTJ A;  3ZN0 A;  3EUA A;  2BVM A;  4A3K J;  4KYW A;  3K0L A;  2DOF A;  3SHF A;  4DJA A;  1CGP A;  1QA6 A;  1XTA A;  3DPL C;  2ZCW A;  4XLP F;  2KZG A;  1R22 A;  4ESF A;  1WJF A;  4P9F A;  2V9V A;  3PIP F;  2XPW A;  4DZP A;  2X48 A;  1DGW Y;  2MH2 A;  3BTC A;  3GZ6 A;  2DXI A;  3E6C C;  2E7X A;  4I01 A;  3AL0 B;  4E7L A;  2H8R A;  4IRH A;  2LDU A;  3RCO A;  1SFU A;  2VB6 A;  3I4M J;  4AIH A;  1ZRD A;  2YX4 A;  2O8K A;  4E7I A;  1U8B A;  5CJ9 A;  3KEO A;  3JSP A;  2QSF X;  4NHJ A;  2W48 A;  2RN7 A;  1ZAR A;  3MZY A;  2B63 J;  2XAJ A;  1SFX A;  3F21 A;  3KP4 A;  3S14 J;  3H5A A;  4HA8 A;  3ECO A;  4GO1 A;  3BJ6 A;  5FFX A;  3BZK A;  3BJO A;  4OIQ F;  1BW6 A;  1X1D A;  5DV5 A;  4EM2 A;  2EFN A;  1W4M A;  2W82 A;  1YHQ I;  2F4O B;  4A2U A;  2DBB A;  5LGN A;  4BAC A;  4CHU A;  3N05 A;  4C2U A;  3Q0V A;  2EA2 A;  5J47 A;  2CU7 A;  1WJC A;  2CV2 A;  5GAH J;  4ZTF A;  3HIF A;  2Q2E B;  4HNU A;  4RB1 A;  3WTS C;  4A3L J;  2R5Y B;  3I4N J;  1O3S A;  1OCO H;  3SDG A;  4CA0 A;  5DTD A;  4QTR A;  3ZRG A;  3O2P E;  4XN0 A;  3HXL A;  3OOU A;  3ML6 A;  2O61 A;  2Y0S N;  1BI1 A;  3TED A;  1I27 A;  4BEH A;  2I5U A;  2MW8 A;  1Z67 A;  1D0X A;  4PJM A;  2QQB A;  5F08 A;  3GFJ A;  4QLC U;  4WF2 A;  3AL0 C;  1AKH A;  3Q3S A;  3CZ6 A;  1OR7 C;  2H8W A;  3GFL A;  4RB2 C;  1WH5 A;  1YW8 A;  3E5Q A;  3TO9 A;  1UAA A;  1IXC A;  1TTY A;  4WWC A;  3FXK A;  3BZC A;  4BAY A;  5F0F A;  2BE5 F;  2EFQ A;  5EEA A;  2DA7 A;  2VAS A;  5FFZ A;  4ASN A;  3CDI A;  1LKX A;  5K5O A;  3KEQ A;  5LEK A;  2D5V A;  3P7N A;  3NWS A;  3CO7 C;  1WH7 A;  4G6D A;  1QPM A;  1RKW A;  1YIO A;  2X6X A;  3GF2 A;  2F5C A;  3SZG A;  1TWA J;  1PUF A;  2OF7 A;  3FHN A;  3QOD A;  4CH7 A;  2CQQ A;  2W84 A;  3RQI A;  4O5V A;  2VLA A;  1RC9 A;  3KPH A;  2ISY A;  2K86 A;  2RDP A;  5AON A;  1OCR H;  3FBN B;  1HKQ A;  2WBM A;  4P96 A;  3OYN A;  4IPA A;  2L7K A;  3G1O A;  3M3Y J;  1K6Y A;  3FKI J;  4I02 A;  5LFA A;  1KGS A;  1B6A A;  2EZL A;  1Z6R A;  1YS6 A;  4II3 A;  4F7Z A;  1RIO H;  2M3A A;  2NVQ J;  5M5Y J;  2LY2 A;  2FOW A;  2Y30 A;  1SD6 A;  2KDZ A;  2RRE A;  4KMU X;  3COA C;  3E5X A;  1A6Q A;  2MSY A;  3ZMV A;  3A03 A;  3F72 A;  4WCG A;  4NUB A;  2B9S A;  2E5N A;  3JRG A;  3R6S A;  3HSF A;  5DM6 F;  4XR6 A;  1TWF J;  1ON2 A;  1O7F A;  5BMZ A;  4PFO A;  1MBK A;  4KIS A;  4BS9 A;  2XPU A;  2L2O A;  2UV1 A;  2MA3 A;  4B44 A;  1J9I A;  3I56 I;  2R7U A;  1ZR2 A;  2QGU A;  4CCJ A;  4WK8 F;  2HVS A;  3KLN A;  4X0G A;  4EM1 A;  4AIK A;  1D1C A;  2DFH A;  3W2V A;  4A0Y A;  1U5T B;  3OIQ A;  3S16 J;  1E3H A;  3Q0U A;  1X4P A;  2FA5 A;  2MLG A;  3FK7 A;  4ZZD A;  1EF4 A;  3WE2 A;  1JHH A;  2H6B A;  1XD7 A;  4U7D A;  1IC8 A;  1J75 A;  4IHW A;  2ZJQ F;  1T2K A;  3R0A A;  1J0R A;  2W57 A;  3H0G J;  4XOR A;  4BH9 A;  1WCM J;  3WTY C;  3U9G A;  3PUB A;  1UB9 A;  4RGS A;  4I98 B;  2OV7 A;  3PO3 J;  1MSE C;  3ULQ B;  1O57 A;  3TKY A;  3I5U A;  1IUY A;  4I99 C;  5HS7 A;  2A68 F;  4HQE A;  5EZH A;  3OYJ A;  4YFX F;  4D5F A;  3O6B B;  3GBG A;  3HPH A;  2VOD A;  1KQ8 A;  2M0C A;  2D1V A;  4D7M A;  1SFK A;  2E1N A;  1L0O C;  2BZT A;  2L9R A;  3CTA A;  3M1E A;  1RR8 C;  3CO6 C;  1YS7 A;  1MJA A;  2ZSH B;  4L5I A;  2R7X A;  1QVU A;  1SVL A;  2CO5 A;  1EV7 A;  2PJR A;  1V4R A;  3WGH A;  2ECB A;  4BUP A;  2IGO A;  1V5G A;  2CW0 F;  4OOI A;  3K1N A;  3BZ6 A;  2YUS A;  4F92 B;  3HG9 A;  1U5T C;  5HDK A;  3VDX A;  4WX9 A;  2CRG A;  1XSD A;  2Z2S B;  1A31 A;  3J7Z I;  3CF5 F;  4F93 B;  3DCF A;  5E3N A;  3DFG A;  4IHX A;  2XGE A;  1S8N A;  2FML A;  2JPC A;  1W0T A;  4MQV A;  3NAR A;  3H3V K;  1ODD A;  2H09 A;  3L1P A;  4XLA A;  4L0Y B;  1SD4 A;  4A12 A;  3L2R A;  1FYK A;  2HTS A;  2FQ3 A;  1LPQ A;  2CMP A;  2IEK A;  2PN6 A;  2DFF A;  2NVU B;  1FLI A;  3OYA A;  1FYL A;  3BR1 A;  3WOD F;  5GAE J;  3UNG C;  3JTG A;  5CLS A;  2VJ4 A;  2DT7 B;  2UZK A;  2UXX A;  3QYB A;  1HCR A;  1YJW I;  3MZ8 A;  2AQF A;  1FT9 A;  2GWR A;  3BG7 A;  4A3M J;  4PCQ A;  2R7Z J;  2XC7 A;  1PP8 F;  2YU3 A;  1EH8 A;  2LY9 A;  3MWM A;  1OYI A;  1G3Y A;  2L9N A;  5K5Q A;  1D5V A;  2VKH A;  1O4X A;  5E8G A;  5LRR A;  5JLW A;  4XOT A;  2Y75 A;  5J40 A;  4JX5 A;  2IBD A;  3CP8 A;  4EAT A;  2K40 A;  2ELJ A;  4LLN A;  1OCZ H;  4CUG A;  2VC0 A;  2MC4 A;  4ON0 A;  3K4L A;  5EG0 B;  2O03 A;  3L00 A;  4A0X A;  2W7N A;  4ENM A;  1UFM A;  4A6D A;  4MFD A;  1WJD A;  3QU3 A;  4C9Y A;  2VQC A;  1YI2 I;  2JPB A;  4V19 K;  4OAY A;  1ZN2 A;  3HJE A;  4YFK F;  4HNT A;  5HOD A;  2LH9 A;  5IPA A;  4EJV A;  2EIJ H;  2L7F P;  5J4V A;  2O6G E;  5LEJ A;  3RSN A;  5LHG A;  3F8M A;  5DD8 A;  2A6T A;  2DMU A;  3FM3 A;  3M4O J;  4BU2 A;  1OPC A;  3QQA A;  3LOC A;  2XB5 A;  4M74 A;  4LGW A;  4MEY F;  2K3F A;  4WXD A;  2FEZ A;  3M8J A;  3ABM H;  2P6S A;  4Y33 A;  2YSR A;  2BGC A;  4MO7 A;  1AA7 A;  1WJA A;  3MKL A;  2DA4 A;  1HDP A;  4ENJ A;  1LVA A;  4E4H A;  2XKP A;  3HSR A;  1DDN A;  4BXU A;  2X1D A;  2OJE D;  4LOC A;  3RQ4 A;  5J1R A;  1SFO J;  2DA6 A;  3HRT A;  2VBZ A;  3I53 A;  1ETO A;  5ICC A;  1TT5 B;  1R49 A;  4C2M J;  2A61 A;  4RM2 A;  1BI2 A;  1X58 A;  2DK8 A;  1F5T A;  2IA0 A;  2QLZ A;  2GXA A;  4MIM A;  1FMV A;  1MBE A;  2LY1 A;  3FM5 A;  5KAI C;  3JRC A;  2P5K A;  1YOV B;  4M3G A;  1GVD A;  2HFH A;  3FXU A;  3BR2 A;  5AIQ A;  3G4S I;  2R5Z B;  2ZXJ A;  5B1A H;  2ZME A;  1H0M A;  3TBI A;  5FKO A;  2CUE A;  1YQA A;  3DKX A;  2W24 A;  3BC8 A;  1FJL A;  4AC0 A;  2V4J C;  3DTE A;  2QSG X;  2O7O A;  3C2B A;  3A0B C;  3DTI A;  1X4O A;  3SDB A;  4G6T B;  2AO9 A;  2DT5 A;  2IAI A;  1JTX A;  1K7A A;  3QOP A;  3BY6 A;  4Q47 A;  4LMY A; 
#chains in the Genus database with same CATH homology
 4FX0 A;  2STW A;  3VB2 A;  1Q1H A;  5HDG A;  5FO5 A;  1BOA A;  2JT1 A;  2V1D A;  2KKO A;  3I59 A;  2XHK A;  2L3D A;  2M5W A;  3F23 A;  2XGX A;  2DU9 A;  3LA7 A;  4I2O A;  3FMQ A;  1LEA A;  1R36 A;  3LFK A;  2IW5 A;  3FXR A;  1IF1 A;  5LLQ A;  2XAH A;  2E7W A;  2M8E A;  2DLL A;  4ZZL A;  4EMS A;  4U0Y A;  1XB4 A;  1XCB A;  2XAS A;  2FNP A;  1SFE A;  2VT2 A;  1YFH A;  3ZMS A;  3KP7 A;  2EFO A;  3GUD A;  3HUG A;  4CYD A;  1B4A A;  2V1U A;  2DO7 A;  1HXD A;  4A0Z A;  1I1G A;  2P7V B;  1C0W A;  1PDN C;  4PDK A;  4UV8 A;  5D5V B;  2XAG A;  1IN6 A;  4EVI A;  2O0Y A;  3C7J A;  5HDN A;  5LBQ A;  3ZMD A;  1YG2 A;  3QRF F;  1W7P A;  2KIM A;  1XGS A;  4ETS A;  3T0Y A;  3ECH A;  4GCV A;  4MTE A;  2MH9 A;  2CGP A;  3WG9 A;  1USS A;  5JVT A;  4HQM A;  2AXL A;  1KQ0 A;  1WWX A;  2QQA A;  3ABU A;  3I0T A;  1FZP B;  4B09 A;  2WV0 A;  2H94 A;  2M1B A;  4AWX B;  2P5L C;  2FOK A;  1R7J A;  2VN2 A;  6PAX A;  1ZHF A;  2VOP A;  5A2Q Z;  4OU0 A;  1TQM A;  1OR7 A;  3LWF A;  1ZG5 A;  5E18 F;  3E6B A;  3F3X A;  4BYY A;  2X4H A;  4CDG A;  3HTU A;  4JK1 X;  2UWM A;  3VOE A;  1SD5 A;  4KUM A;  5ED4 A;  4O3M A;  4OIO F;  2HKX A;  2Q2E A;  2DK5 A;  1UST A;  3Q5F A;  2EV0 A;  5DUK A;  3IWZ A;  4S05 A;  1ZG3 A;  3FMS A;  2HOE A;  3GO5 A;  4KFC A;  1LNW A;  5BS6 A;  4A5M A;  1R5H A;  5FB2 A;  4XLN F;  3EDP A;  1XN7 A;  2R3S A;  1OKR A;  5DYM A;  3M9A A;  3GFM A;  3K2Z A;  4QWQ A;  5HVQ C;  1WSU A;  1QO0 D;  3FX3 A;  4GXO A;  2XAF A;  1HBX G;  4KN4 X;  2IT0 A;  2IJL A;  2G7U A;  1TQI A;  1YTY A;  2B0L A;  3KP6 A;  4M71 A;  3ABT A;  5A2Q K;  2EV6 A;  1LEB A;  5FGM A;  2ACJ A;  5JFR A;  4LG0 B;  4ESJ A;  1LQ1 A;  2K27 A;  1W7P D;  1AWC A;  1ONV A;  2H27 A;  5L3D A;  1H9G A;  1TBX A;  5DD4 A;  4RGU A;  4IJA A;  1FP1 D;  3GEZ A;  3MCZ A;  3J80 Z;  1XGN A;  3DEU A;  2LKP A;  4HV5 A;  1U5T A;  3F22 A;  2VE9 A;  5HS9 A;  2MD5 A;  1JGS A;  3O3K A;  2WTE A;  3C3W A;  2DQR A;  4MEX F;  5E8I A;  1MZB A;  4D0P A;  2J5P A;  3HRM A;  1W5T A;  1XGO A;  1KYW A;  2OA4 A;  1R1T A;  3ISP A;  5E17 F;  2A5Y B;  2JRT A;  1XGM A;  2BEO A;  4EM0 B;  3OV8 A;  2RC4 A;  2HS5 A;  1TQP A;  4KMF A;  1B9N A;  4Y17 A;  1O3T A;  3ZPL A;  1B59 A;  4EJT A;  4HOB A;  5D4R A;  1FOK A;  2DAO A;  2JTV A;  1K6O A;  4UXN A;  2ZO4 A;  5ICF A;  3EYY A;  3G73 A;  4HLY A;  3DPT A;  3WTU C;  1JHF A;  3AAF A;  4FHT A;  1R1V A;  5DUI A;  1FP2 A;  3C1D A;  4DQ2 A;  3TOA A;  1KYZ A;  2A07 F;  1OYY A;  2GQQ A;  3BP8 A;  5JHU A;  3CDH A;  3M7G A;  3QAH A;  5DCM B;  4HX7 A;  4RGR A;  3J80 K;  2VXZ A;  1QBJ A;  3G3Z A;  3U1D A;  1U2W A;  2VE8 A;  4BHC A;  4A6E A;  2NNN A;  4L5J A;  4NB5 A;  1XCV A;  4YG2 F;  3GLX A;  1IXR C;  4TV7 A;  3WTT C;  1R00 A;  2XRO A;  1ZGJ A;  2FSW A;  1QZZ A;  5HLG A;  3E5U A;  2ISZ A;  3JTH A;  2AS5 F;  5J8F A;  4KN7 X;  2KJC A;  3R4K A;  4MHG A;  2WC2 A;  4L18 B;  2ZNY A;  4FT8 A;  2ETH A;  1TW3 A;  1U6G A;  3CUO A;  1F1Z A;  2ZFW A;  3IKT A;  1HW1 A;  4H0E A;  3V7S A;  5H20 A;  4A5N A;  5LGT A;  4LB5 A;  2GA1 A;  2F2E A;  2DW4 A;  2DPU A;  2PLY A;  2EFW A;  2K02 A;  1ZLK A;  1MJ9 A;  5AIP A;  4M9S A;  2Q8K A;  1ULY A;  1D8K A;  2VBY A;  2P4W A;  3IHU A;  3DV8 A;  4OIR F;  1MD0 A;  3RKY A;  3WU1 B;  1WQ2 A;  1K79 A;  1S29 A;  2LF8 A;  3R60 A;  3MQ0 A;  4HW0 A;  5CYV A;  1X3U A;  5L3C A;  4XRF A;  3VFZ A;  1CF7 B;  1IXS B;  3OOP A;  4L9T A;  4U0W A;  5LGU A;  1R23 A;  1MDM B;  1G3W A;  3I71 A;  2ESN A;  3BPV A;  2YPR A;  3U2R A;  2L02 A;  3TOB A;  3DP7 A;  1HW5 A;  1WKM A;  2PFB A;  3ERE D;  2Z5U A;  1TW2 A;  1G3S A;  1MGT A;  1B9M A;  4FX4 A;  2PBI A;  4U7B A;  5ICG A;  4UV9 A;  5L3E A;  1R5G A;  1HSJ A;  5DCF A;  3GWZ A;  3LST A;  5H6R A;  3HRU A;  4DNC A;  2FU4 A;  4OMY A;  4HBL A;  2MC3 A;  3LQQ A;  1FNN A;  5D8L B;  2IVM A;  3P9I A;  2XUB A;  4UNO A;  1XSV A;  3ZMU A;  1S7O A;  4P5O A;  1W5S A;  3LA2 A;  3W6J B;  2P6T A;  3IRQ A;  1YO5 C;  3FF5 A;  5ILV A;  3CLO A;  2PJP A;  4Y13 A;  4RAZ A;  2D45 A;  1BN5 A;  1ZGA A;  5DDG A;  3T8R A;  1T6S A;  2HQN A;  1R1U A;  1SMT A;  4M72 A;  2OZ6 A;  3HRS A;  1KU3 A;  2FF4 A;  4P55 A;  1RNL A;  4PGG A;  1WI9 A;  2PMU A;  3RYR A;  3KZZ A;  4ENK A;  3SFZ A;  2Z33 A;  4L0Z B;  5D5W B;  3P9C A;  5EEH A;  1H9T A;  2GA2 A;  4LK1 F;  3T5X A;  1HW2 A;  1REP C;  2VON A;  3JAM Z;  1FSH A;  4L9V A;  1U3E M;  4KIC A;  2DPD A;  1VTN C;  1LJ9 A;  1S6L A;  3FWE A;  2OBP A;  1OYW A;  2Z3Y A;  3I64 A;  4JQF A;  1JXS A;  1LB2 A;  1D3Y A;  4CZZ A;  3E6D A;  2C6Y A;  3H3U A;  5CVR A;  4Z2Y A;  5IT9 Z;  1GXQ A;  1XMK A;  1YYV A;  1DPU A;  4U0V A;  5TRD A;  1U8R A;  5BPD A;  3Q9S A;  4LG0 A;  2PG4 A;  3CUQ B;  3B02 A;  1TNT A;  3VEP A;  3RPQ A;  1UHW A;  2M45 A;  4BQA A;  5E20 A;  3HSE A;  2W85 A;  2HYF A;  3V4G A;  2K4J A;  3FHZ A;  1ZRC A;  2HKO A;  3TGN A;  2QYO A;  4RAY A;  3LAJ A;  1RUO A;  2HQR A;  3KZY A;  2L4A A;  3FZV A;  3QU6 A;  2LF7 A;  2QVO A;  4YII A;  2IRF G;  3F8N A;  3BJA A;  3V7C A;  1HQC A;  2G9W A;  1QZY A;  3H3Z A;  1YW7 A;  5K5R A;  1BC8 C;  4G8X A;  3CUQ C;  4IF4 A;  2UXN A;  3BRO A;  4M6X A;  2O3F A;  1GVJ A;  2JSC A;  1J7K A;  1XDS A;  3JAM K;  3RKX A;  4E70 A;  1R58 A;  4I0A A;  2EJR A;  2KRF A;  2LSO A;  3GZ5 A;  1OMI A;  4OIN F;  5ICE A;  2DFI A;  5IT9 K;  3SQN A;  4KA4 A;  3M8E A;  2NRA C;  1HKT A;  2QZ8 A;  4XBF A;  2GXB A;  4UVA A;  4O6J A;  1SMY F;  3I58 A;  2FBH A;  4PGH A;  1F9N A;  1IN8 A;  3EET A;  1V3F A;  2ADU A;  4WXH A;  5DCM A;  3N4M A;  2BYV E;  3HTS B;  5BOX A;  1T38 A;  1KU7 A;  2FXA A;  4I09 A;  3WE3 A;  4BNC A;  1P4A A;  3IL2 A;  2M30 A;  3M8F A;  1IW7 F;  2VT3 A;  2VOO A;  5CVU A;  4NQW A;  5FLX Z;  4ESB A;  4Q4Z F;  1P2F A;  3KCC A;  2HR3 A;  4G7O F;  4RB0 A;  5ERI A;  1P4W A;  3L09 A;  1D8J A;  1Z6T A;  3WU0 A;  3ZN1 A;  4CXF A;  2HZT A;  1BC7 C;  1IRG A;  1ZG1 A;  3KLO A;  4HDV A;  3WTV C;  4HV6 A;  1XSX A;  2BV6 A;  3D0S A;  1E17 A;  5HOO A;  2CG4 A;  2KIU A;  5F64 A;  5H6Q A;  2V79 A;  3RTR A;  4U88 A;  3B73 A;  2FMY A;  3V8K A;  2F5E A;  3NEU A;  2EWN A;  2ZBK A;  4R79 A;  2Y48 A;  2QUF A;  2IA1 A;  3TO6 A;  3T1B A;  4EGY A;  3BWG A;  4LK0 F;  2LNB A;  3KP5 A;  2EV5 A;  2IPQ X;  1BI3 A;  4M73 A;  1AOY A;  3HYI A;  2OU2 A;  2IP2 A;  4MTD A;  2STT A;  2A3S A;  1P92 A;  4ZYD A;  1O3Q A;  1L3L A;  3EUH A;  2PQ8 A;  1SD7 A;  2COM A;  5FD6 A;  4IRI A;  4JBA A;  3WGI A;  3K9T A;  4BHB A;  1T98 A;  2XRN A;  5F1R A;  2F5D A;  2IA2 A;  4HAM A;  1IN5 A;  4HZF A;  4EJO A;  2MBF A;  5JR3 A;  4MQ9 F;  5TJJ A;  1ZLJ A;  5FLX K;  2QBY B;  2RVC A;  3QP6 A;  4KIG A;  1O3R A;  1BI0 A;  1FYM A;  4P9U A;  1I1S A;  2FBK A;  1K78 B;  3RI4 A;  1CF7 A;  1ZRF A;  4HDU A;  2E1C A;  4IRG A;  1FY7 A;  1MDM A;  3WGG A;  4G6Q A;  3V8L A;  3E6M A;  5KVR A;  2L54 A;  1BJA A;  5E1Z B;  2Y0M A;  3S2W A;  2L4M A;  3GX4 X;  2GAU A;  3RPU A;  2D1H A;  1P6R A;  3KFW X;  1G6N A;  3QP5 A;  2FE3 A;  3WTX C;  2OAZ A;  3Q9V A;  2DI3 A;  1Z9C A;  5L3B A;  1NHA A;  2Q0O A;  1DPR A;  4ENN A;  4G94 A;  1KA8 A;  1MJB A;  3J7A O;  2D2W A;  4HF2 A;  4LD5 A;  2GIV A;  4CIC A;  1J59 A;  1FBU A;  4XSX F;  1T0F A;  4M9X A;  5E1X A;  4HLX A;  3J81 Z;  3RJP A;  4YFN F;  2A69 F;  5D4S A;  1FX7 A;  3IWF A;  2L01 A;  1BIB A;  1LDJ A;  2OZU A;  3MEX A;  4CGZ A;  2RKH A;  4KIB A;  1GHC A;  2EK5 A;  5EEG A;  4N0B A;  2RNJ A;  2VC1 A;  2O8X A;  5HLH A;  2KIF A;  2HYG D;  5D8K B;  1B1B A;  3RKW A;  2GZW A;  3BPX A;  2QQ9 A;  4L9N A;  2GXG A;  5D6E A;  3F8B A;  4R1H A;  5LHI A;  3KET A;  4OIP F;  1ZRE A;  3WTZ A;  1WRJ A;  2CSO A;  4S04 A;  2MLK A;  1U78 A;  3F6V A;  2CWE A;  1JE8 A;  4Y15 A;  2X0L A;  2PMH A;  1RZ4 A;  3PQK A;  4HF1 A;  3ZMZ A;  1ZAO A;  1ON1 A;  3ROU A;  1KQ9 A;  3REO A;  4GYI A;  2PEX A;  3FMR A;  3BDD A;  1J2X A;  3JW4 A;  2BBY A;  4YIF A;  5J8C A;  4AVP A;  3HHH A;  4MNU A;  5LRS A;  1E2X A;  3J81 K;  3L7W A;  3LA3 A;  1G3T A;  5D5U B;  1EH7 A;  5L3F A;  2WWY A;  4UVC A;  4RB3 C;  3QPT A;  4HYE A;  3HOT A;  3T8T A;  1IN4 A;  4B8X A;  2OD5 A;  3NQO A;  1G4D A;  3W6K B;  2DTR A;  3VOD A;  1SAX A;  2QM3 A;  4RGX A;  2VBW A;  5BPI A;  5D6F A;  3E3V A;  5ILS A;  2V1X A;  3L2C A;  3CUQ A;  3EYI A;  5DEQ A;  2HGC A;  5CVV A;  4GYG A;  1STZ A;  1PP7 U;  2R7D A;  2ZJ2 A;  1P4X A;  1IZ1 A;  2M87 A;  3GFI A;  1ZH5 A;  3TDZ C;  4EJW A;  1TLH B;  2XKO A;  4ZYE A;  3C18 A;  5FD5 A;  1QNT A;  3RDI A;  2QWW A;  1Z7U A;  1T39 A;  3DF8 A;  2A6H F;  1J5Y A;  2XVC A;  1QQI A;  1XDU A;  2RV8 A;  3K69 A;  3IC7 A;  5JI6 A;  1FWZ A;  1UCR A;  1O7L A;  1YLF A;  1Z05 A;  3LAP A;  3HHG A;  2CFX A;  2HWV A;  3RIR A;  1GXP A;  2HDC A;  2J5O A;  4I7H A;  4N9H A;  2RQP A;  2EFP A;  1A04 A;  1HST A;  3L9F A;  2NYX A;  2DQL A;  4ZYG A;  4IHT A;  5CVJ A;  2ZNZ A;  2A6E F;  5IT3 A;  3K1P A;  3HOS A;  3BOQ A;  4KT5 C;  1XMA A;  3SZT A;  3SZP A;  2P5V A;  4IVN A;  1F4K A;  2QEN A;  1Z1D A;  4PZJ A;  3I4P A;  3GVA A;  4LB6 B;  3SXY A;  3NRV A;  1EH6 A;  2JZY A;  4UVB A;  3DQV C;  3MAJ A;  3I54 A;  4IXA A;  4M6Y A;  1FBS A;  1TNS A;  3EQL F;  2ELH A;  3N97 A;  2NNY A;  2P7C B;  4EGZ A;  3DXJ F;  2FNA A;  3P9K A;  3LQR A;  4HX4 A;  2TDX A;  1Y0U A;  4M9Z A;  4KNY A;  4R8H A;  5LHH A;  4WXC A;  4ZH4 F;  4G9Y A;  4EV0 A;  2VBX A;  4UHT A;  2K4B A;  2YR2 A;  3QPH A;  4GGG A;  1DP7 P;  3F8C A;  2KJB A;  1YW9 A;  2HTJ A;  2FBI A;  4BHP A;  3ZMT A;  5E1W A;  2XAQ A;  1FBQ A;  4HF0 A;  1RI7 A;  4G7Z F;  4N9I A;  2Z9O A;  2K7L A;  3ZQ7 A;  4KIF A;  3TO7 A;  4CO8 A;  3D5L A;  3PFI A;  1KU2 A;  4LLL A;  3R61 A;  5HS8 A;  4IHS A;  1Z91 A;  1PUE E;  3MZH A;  4OMZ A;  3K1M A;  5F6F A;  1BM9 A;  3E97 A;  2H6C A;  4I0B A;  4Q5S F;  2ZME B;  3TDU C;  1S7A A;  3DKW A;  4EQQ A;  4Q48 A;  2ESH A;  2NAZ A;  5D5X B;  2F5F A;  2R7F A;  2FRH A;  2P8T A;  4RS8 A;  2NS0 A;  1S3J A;  2QBY A;  3PQJ A;  4G7H F;  4EJU A;  3ZP5 A;  1K78 A;  2EA4 A;  3JSO A;  3KP2 A;  1UHM A;  3H92 A;  1FPQ A;  1FC3 A;  4ZYH A;  1QGP A;  3I59 B;  4LJZ F;  4XSZ F;  3ELK A;  5KK1 A;  5J6X A;  3F6O A;  4AIJ A;  5K1Y A;  1IAW A;  4UUV A;  3V8J A;  2HEO A;  4HX8 A;  2YX7 A;  4L9J A;  1IRF A;  2G7H A;  2OQR A;  1IN7 A;  3TQN A;  2XV4 S;  3GYH X;  3V7R A;  1KU9 A;  2XIG A;  3CJN A;  3GW2 A;  3MFK A;  2CQK A;  1LDK B;  2EB7 A;  2PI0 A;  2RGV A;  2ZKZ A;  1I5Z A;  4AD9 A;  1HKS A;  1DUX C;  3IKV A;  1LDD A;  3RYP A;  2CYY A;  1BIA A;  4MGR A;  1I6X A;  1RUN A;  4LFU A;  4K2E A;  5L3G A;  1MKM A;  3R0J A;  3F8F A;  5CVI A;  4KDP A;  3GXO A;  1W7P B;  3IRR A;  3KE2 A;  3KP3 A;  1FSE A;  3FXQ A;  3WTW C;  5BQT A;  4LLG F;  5HLI A;  2W25 A;  2V6C A;  1BBY A;  1ZYR F;  2Z99 A;  2OQG A;  5ILU A;  3ZN0 A;  4KYW A;  3K0L A;  3SHF A;  1CGP A;  3DPL C;  2ZCW A;  4XLP F;  1R22 A;  4ESF A;  4P9F A;  2V9V A;  2MH2 A;  3GZ6 A;  3E6C C;  2E7X A;  4I01 A;  4IRH A;  2LDU A;  1SFU A;  4AIH A;  1ZRD A;  2YX4 A;  5CJ9 A;  3KEO A;  3JSP A;  4NHJ A;  2RN7 A;  1ZAR A;  3MZY A;  2XAJ A;  1SFX A;  3F21 A;  3KP4 A;  4HA8 A;  3ECO A;  4GO1 A;  3BJ6 A;  5FFX A;  4OIQ F;  3BJO A;  5DV5 A;  4EM2 A;  2EFN A;  1W4M A;  4A2U A;  5LGN A;  2DBB A;  4CHU A;  2EA2 A;  3HIF A;  4RB1 A;  3WTS C;  1O3S A;  3O2P E;  3ML6 A;  2O61 A;  1BI1 A;  1I27 A;  2QQB A;  3GFJ A;  4QLC U;  4WF2 A;  3GFL A;  4RB2 C;  1YW8 A;  3E5Q A;  3TO9 A;  1IXC A;  1TTY A;  4WWC A;  4BAY A;  2BE5 F;  2EFQ A;  5FFZ A;  4ASN A;  5K5O A;  3KEQ A;  5LEK A;  3P7N A;  3CO7 C;  4G6D A;  1QPM A;  1YIO A;  3GF2 A;  2F5C A;  2W84 A;  4O5V A;  2ISY A;  2K86 A;  2RDP A;  5AON A;  1HKQ A;  4P96 A;  4IPA A;  4I02 A;  1KGS A;  1B6A A;  1Z6R A;  1YS6 A;  4F7Z A;  1RIO H;  1SD6 A;  4KMU X;  3COA C;  3E5X A;  3ZMV A;  3F72 A;  4WCG A;  3R6S A;  3HSF A;  1ON2 A;  1O7F A;  5BMZ A;  2MA3 A;  1J9I A;  4WK8 F;  3KLN A;  4EM1 A;  4AIK A;  4A0Y A;  1U5T B;  2FA5 A;  2MLG A;  4ZZD A;  3WE2 A;  1JHH A;  2H6B A;  1XD7 A;  4U7D A;  1J75 A;  1T2K A;  3R0A A;  1J0R A;  2W57 A;  4BH9 A;  3WTY C;  3U9G A;  1UB9 A;  4RGS A;  4I98 B;  3ULQ B;  1O57 A;  3TKY A;  3I5U A;  1IUY A;  5HS7 A;  2A68 F;  4HQE A;  4YFX F;  3O6B B;  2VOD A;  1KQ8 A;  2D1V A;  2E1N A;  1L0O C;  3CTA A;  3M1E A;  3CO6 C;  1YS7 A;  1MJA A;  4L5I A;  2CO5 A;  1EV7 A;  1V4R A;  3WGH A;  2CW0 F;  4OOI A;  3K1N A;  3BZ6 A;  1U5T C;  5HDK A;  4WX9 A;  1XSD A;  3DFG A;  1S8N A;  2FML A;  2JPC A;  4MQV A;  1ODD A;  2H09 A;  4L0Y B;  1SD4 A;  4A12 A;  1FYK A;  2HTS A;  2FQ3 A;  2PN6 A;  1FLI A;  1FYL A;  3WOD F;  3JTG A;  5CLS A;  2UZK A;  2UXX A;  1FT9 A;  2GWR A;  4PCQ A;  1PP8 F;  2YU3 A;  1EH8 A;  5K5Q A;  3MWM A;  1OYI A;  1G3Y A;  1D5V A;  5E8G A;  5LRR A;  2Y75 A;  4LLN A;  2VC0 A;  4ON0 A;  2O03 A;  3L00 A;  4A0X A;  4ENM A;  1UFM A;  4A6D A;  3QU3 A;  2JPB A;  1ZN2 A;  4YFK F;  4EJV A;  2O6G E;  5LEJ A;  5LHG A;  3F8M A;  5DD8 A;  3FM3 A;  1OPC A;  4M74 A;  4LGW A;  4MEY F;  4WXD A;  2FEZ A;  2P6S A;  2YSR A;  2BGC A;  4ENJ A;  1LVA A;  2XKP A;  3HSR A;  1DDN A;  4BXU A;  3HRT A;  5ICC A;  2VBZ A;  3I53 A;  2A61 A;  1BI2 A;  2DK8 A;  1F5T A;  2IA0 A;  2QLZ A;  3FM5 A;  2P5K A;  3FXU A;  2HFH A;  5AIQ A;  2ZXJ A;  2ZME A;  1H0M A;  1YQA A;  2W24 A;  2DT5 A;  1K7A A;  3QOP A;  3BY6 A;  4Q47 A;  4LMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...