3ZMDA

Crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
148
structure length
148
Chain Sequence
TRWLTDTEQCAWRTHLEVNRLLTHQLEKDLQPFGLTMNDYEILVNLSESEGDRMRMSDLATATMQSKSRLSHQITRMENANLVRRENCESDRRGLFAVLTEHGLETMRKVAPHHVASVRRHFIDLLAPEDLTELDKALKPIAEHLRGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Absc, a Marr Family Transcriptional Regulator from Streptomyces Coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords PUTATIVE TRANSCRIPTIONAL REGULATOR
total genus 54
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zmdA00
3EETA 2BBYA 2Q0OA 1UHMA 4BXUA 1IAWA 4Y17A 5AONA 5D8LB 2CGPA 4U0WA 3SZTA 4M72A 3BPVA 5TJJA 5CVIA 4BH9A 4HDUA 2Z9OA 3F8NA 2TDXA 2R3SA 2V1DA 3V8LA 2FRHA 1R23A 2O8XA 2C6YA 4MGRA 1LNWA 4I0BA 4YIIA 1MD0A 4O3MA 1ODDA 4U7DA 5H6QA 2HTJA 2PI0A 4MHGA 4HYEA 1KYWA 1TNTA 3KZZA 3WTSC 4OMYA 3K1NA 3R0AA 4YFXF 5E8IA 2FQ3A 1JXSA 5HDKA 2LNBA 2X4HA 1PDNC 3W6KB 3M9AA 3TO6A 4I2OA 3F8BA 2YX4A 3GUDA 1BBYA 1IXRC 5JI6A 1FZPB 2LDUA 3KCCA 4L9NA 4B8XA 5D4SA 2RGVA 2PEXA 3F6OA 1HW2A 1HQCA 3LQQA 1AWCA 3QPTA 1D5VA 2QYOA 3KP2A 1R1UA 2FOKA 4L9TA 3GO5A 4LFUA 1YFHA 3LQRA 5LHIA 2VBYA 5KK1A 4UVBA 1I5ZA 4NB5A 2UWMA 2Z3YA 3T8TA 1Z6TA 2F5DA 1RNLA 1ZRCA 5D4RA 2KJBA 3IRRA 1HKTA 3D5LA 2ADUA 3E5XA 4WXCA 2NRAC 3HUGA 4OINF 1ZLJA 4IRGA 1Z91A 2OBPA 3LFKA 5E1ZB 3C3WA 4R8HA 4WF2A 2PN6A 5LRSA 2FE3A 2IVMA 3HIFA 4HAMA 3GFLA 2E1CA 3N4MA 2Y0MA 4YG2F 1IN5A 1G3YA 1ZHFA 3M1EA 3BOQA 3KP5A 3KP6A 2A3SA 4RAYA 1F5TA 2QQAA 1D8KA 3CDHA 3RPQA 3S2WA 3JTGA 3IL2A 5BPIA 2GAUA 4PGGA 2XUBA 5HS9A 5K5RA 5TRDA 3V7SA 3Q9VA 5ILSA 2K4BA 4RAZA 4M9SA 3BP8A 2GA1A 2K02A 2EB7A 2P7VB 4MTEA 1BC7C 3P9CA 1V4RA 1YW9A 4JQFA 1XSVA 5IT9K 3KP4A 3PQKA 1G3SA 1T2KA 4XLPF 3J80K 1PP8F 1E17A 3U9GA 4KN7X 4KMUX 4LB6B 3WU0A 5ICGA 1IN7A 1MDMB 1GVJA 1SFUA 5LGNA 4I7HA 2HKXA 3K1MA 1YO5C 4WX9A 2UXNA 2XROA 2HKOA 2M45A 1TQPA 2VODA 5E1XA 3T5XA 2EFOA 4L18B 1WQ2A 4CO8A 1V3FA 1XD7A 2JPBA 2A68F 4A5MA 5DV5A 4KUMA 5FLXK 4LK1F 4UXNA 1J75A 3U1DA 5J8FA 3E3VA 3RKYA 1R5GA 2OQGA 1ZG1A 2E7WA 3ZPLA 5F64A 1BJAA 4Z2YA 3LA2A 2DI3A 1MGTA 4WK8F 4NHJA 5FFZA 4EV0A 4B09A 1IUYA 3ULQB 2RDPA 2D2WA 1E2XA 2FU4A 3VB2A 4KIGA 3J81K 2GQQA 3GX4X 2MD5A 5HS8A 3FM3A 2DPDA 3RJPA 2L4MA 3TO7A 4GYIA 4YFKF 3QP6A 1O3QA 3HRSA 3DEUA 4ESBA 1P4WA 1EH8A 1FYKA 2XV4S 4I01A 2F5EA 1KU2A 3ZMTA 3ECHA 4LMYA 4EGYA 4WWCA 3TQNA 4LLGF 3T0YA 4KMFA 2A6HF 3QU6A 2JTVA 3B02A 4AD9A 3IHUA 4GYGA 1L0OC 1ULYA 2HTSA 4A0YA 5BS6A 4KYWA 2KJCA 2VT2A 2HDCA 5DUKA 1FSHA 1T0FA 2FNAA 2HQNA 2VT3A 3F21A 5E1WA 2UZKA 1JHHA 4P9FA 2VBXA 4L5JA 2NNNA 4MEYF 5FD5A 1SFEA 2ISZA 1S8NA 1TTYA 5JHUA 3IWZA 5K1YA 2ZFWA 5F6FA 2O61A 3DKWA 2V6CA 1HBXG 3ABTA 3ERED 2QQ9A 2DLLA 3R0JA 1XSXA 2CSOA 3ROUA 1UFMA 4RB0A 1RIOH 5L3BA 4MTDA 5KVRA 1YLFA 4G8XA 5JFRA 3N97A 4E70A 1U8RA 1W7PA 4G7OF 5J8CA 2DBBA 2ZO4A 2PFBA 2JT1A 2H09A 2BYVE 4ENMA 2H6CA 4GCVA 3SXYA 2LSOA 3BDDA 3FMSA 2XAJA 3WODF 2VONA 2PQ8A 2IT0A 5A2QZ 3DFGA 4M6XA 3EYIA 2K4JA 1EH6A 1MJAA 3HSEA 4ZYEA 5L3CA 1IW7F 3ML6A 4G6DA 1J59A 5D6FA 1QPMA 1XGOA 1H9GA 4HA8A 1BIAA 2MLGA 1KU7A 2RKHA 5E8GA 1A04A 2FBHA 3GXOA 2H27A 1B1BA 1G6NA 3P9IA 1CGPA 2Y75A 1K78A 5DUIA 5JVTA 3DPLC 3O6BB 2W24A 1FBSA 3ZMDA 1X3UA 5CJ9A 2KKOA 1S29A 2HQRA 1I27A 1F4KA 2M30A 2P8TA 2O3FA 3W6JB 2J5OA 2FSWA 5CVJA 1ZG5A 2E7XA 3P9KA 2EFPA 3TDUC 4KT5C 1UHWA 3BJOA 1OMIA 5FD6A 3TDZC 1MJBA 3F6VA 2MLKA 4CHUA 2Y48A 2V1XA 4QLCU 5LHHA 5H20A 1PP7U 5J6XA 1YW7A 2HEOA 2V1UA 3EQLF 3L09A 2ACJA 3KETA 2ELHA 2WWYA 2QLZA 2F5FA 2OA4A 2MH9A 2RVCA 2KIMA 1H9TA 5D5WB 1P4XA 2DK8A 3I59B 1YW8A 3C7JA 3MCZA 2DAOA 2KIFA 1HXDA 4M71A 2DQRA 3J80Z 2PLYA 2VOOA 1R36A 1LEBA 1FY7A 2WV0A 4YIFA 1W7PB 2HZTA 4LGWA 4N9IA 2ISYA 3WG9A 2H6BA 1LDKB 4AIHA 4JK1X 2VC0A 3MZHA 1TBXA 5AIPA 2HGCA 1BI3A 1QZZA 1XMKA 1G3TA 2EWNA 4P96A 1R22A 3NQOA 3GZ5A 1BIBA 3HRMA 3J81Z 2EA2A 3E6MA 3BJAA 2EFNA 4EMSA 1LEAA 5DD8A 3V4GA 1Z6RA 1YTYA 3VEPA 5FFXA 1MKMA 3LSTA 1CF7B 3M7GA 2RC4A 2PMUA 1P92A 3HTUA 4XSXF 2EFQA 3IRQA 1DP7P 5HVQC 3R6SA 3BROA 1USTA 4IVNA 3GVAA 3TOAA 1IZ1A 2W84A 4R79A 4LLNA 2OD5A 3MZYA 2VOPA 1HKSA 4FT8A 2ZBKA 2MH2A 2HR3A 2ESNA 3WTWC 2DU9A 2HYGD 1GXQA 1O7LA 3GFMA 5D5XB 3GLXA 5LLQA 4IRHA 1RUOA 1T39A 4H0EA 3KEOA 5L3GA 4S05A 3KEQA 1U5TC 3SHFA 2QBYB 3DF8A 1IN8A 3ABUA 1R00A 3ZMVA 1SMTA 2DT5A 1MDMA 1RUNA 2STWA 2AXLA 2P6SA 4FX0A 1U6GA 3EDPA 3VFZA 2GZWA 3TOBA 4UNOA 3GEZA 3HRTA 2G7UA 1REPC 1HSTA 3K69A 2Q2EA 4MQVA 1SD4A 2XKOA 3GFIA 2DO7A 4OMZA 4MNUA 4ETSA 1QQIA 1KQ9A 3I71A 5FLXZ 3O3KA 2P6TA 2ZJ2A 5K5OA 2XAGA 4EJVA 1IF1A 1FYLA 4M9XA 4QWQA 1XGNA 4CDGA 3J7AO 1FT9A 4KIBA 3GZ6A 1FP1D 5FO5A 5HLHA 1FPQA 1R1VA 4RGUA 4BAYA 4U0VA 2YX7A 4IRIA 1B4AA 1JE8A 2CG4A 1I1GA 2O03A 2UXXA 1WWXA 3AAFA 1OPCA 1T38A 1IXCA 4L0ZB 5LBQA 1G3WA 5LHGA 2OZUA 1IXSB 3I53A 1L3LA 1XSDA 3HSRA 2FF4A 1GHCA 2KIUA 2FBIA 2MC3A 2QBYA 3C18A 3GW2A 3I58A 4EJTA 2HFHA 2IP2A 1BI2A 1DUXC 2NS0A 5D5UB 4G6QA 1R5HA 1C0WA 3GWZA 1WRJA 2XVCA 3FX3A 4IXAA 3MQ0A 1O3TA 4RB2C 4ZYDA 2CO5A 3JW4A 2X0LA 1OYWA 2BEOA 2P5LC 2LF7A 2BV6A 4A0ZA 3FMRA 3C1DA 4HQEA 3DPTA 4ASNA 1BI0A 3VODA 3NRVA 2Z33A 2CWEA 3GFJA 1TW3A 3KLNA 3B73A 1NHAA 3O2PE 1BI1A 2XGXA 4NQWA 4AIJA 1LDDA 5LEKA 5ICEA 4ENKA 4HLXA 4HLYA 2BGCA 4LG0A 2COMA 3I64A 1OKRA 2VE8A 2QM3A 3IKTA 4KNYA 2FEZA 3RKXA 4G7HF 5CLSA 5DDGA 3QU3A 4N9HA 2GIVA 4ENNA 2D1HA 3DXJF 2IA0A 2L54A 3F8FA 4BHCA 4MEXF 5ED4A 2HWVA 4OU0A 1ON2A 1S3JA 4HOBA 3Q9SA 5DD4A 4I98B 5ILUA 2PBIA 2PJPA 1QNTA 3HOSA 3I5UA 6PAXA 2W25A 3WGHA 1H0MA 4GXOA 1XGSA 2IPQX 3E5UA 1TNSA 2QVOA 3FHZA 5L3DA 3R61A 3K9TA 3L00A 4UVCA 2YPRA 4RB1A 2H94A 4GO1A 4A6EA 3LAPA 2FMLA 1BM9A 4HV5A 2P5KA 1IN4A 1FBUA 5HS7A 2FNPA 4RGRA 4UV8A 4M74A 4O6JA 2MA3A 3EUHA 5LGUA 4Q4ZF 1ZRFA 5BOXA 4I02A 2FXAA 3TO9A 5E20A 2XKPA 1JHFA 2IA2A 5IT9Z 2EK5A 2ZNYA 1IRGA 2WTEA 1KGSA 2QWWA 3F8MA 2A61A 1TQMA 2ZCWA 3REOA 1BOAA 4JBAA 4BNCA 4CZZA 3L2CA 1XGMA 5IT3A 2AS5F 4TV7A 5HOOA 3K1PA 4KN4X 1ZN2A 4L5IA 1ZARA 2RV8A 3ZMSA 1BC8C 2ZNZA 1KYZA 1Y0UA 4HV6A 2E1NA 3WTYC 2IA1A 1YS6A 3BJ6A 2M5WA 3HSFA 2XAFA 1JGSA 4HW0A 3K0LA 1DDNA 3F22A 4U7BA 3WU1B 4WXDA 1S6LA 3M8FA 4OIOF 5CVVA 2EA4A 3COAC 1K79A 2GXBA 1OR7A 1BN5A 5LRRA 1FWZA 2G7HA 1FSEA 2CYYA 1I6XA 2FMYA 4OIRF 4HBLA 2OQRA 5JR3A 3FZVA 2EV6A 1VTNC 2VBZA 1GXPA 5HLIA 4A0XA 3RI4A 4M6YA 1KQ0A 1KU9A 2ZKZA 4RB3C 3E6CC 3M8EA 2GXGA 3WGGA 3MEXA 1B9NA 3RIRA 1I1SA 3TGNA 3QPHA 3CO6C 1WSUA 1SMYF 1ZYRF 2L3DA 4HQMA 2PG4A 3P7NA 3E5QA 3BZ6A 1MJ9A 4IHSA 4Y13A 3KP7A 3WGIA 2D45A 3WTVC 2K86A 3H92A 4LB5A 3V7CA 3ISPA 2P5VA 1YQAA 4U88A 3I0TA 4UVAA 1TLHB 1SD6A 4ZYGA 2QENA 1FP2A 3QP5A 2IRFG 2QZ8A 5LEJA 3RKWA 4UUVA 1DPUA 3KLOA 1YG2A 4XRFA 4KIFA 4UHTA 2BE5F 1F1ZA 5ICCA 2P4WA 5BQTA 1YYVA 4EM0B 2GA2A 1KA8A 1B59A 2R7DA 2J5PA 3HTSB 3IKVA 1P2FA 1SFXA 4DQ2A 2VXZA 2RN7A 2Z99A 2VE9A 4O5VA 3WTTC 2F5CA 4G7ZF 1HW1A 5BMZA 3FWEA 3HHHA 1ZLKA 3E6BA 3JAMZ 4P9UA 4RGSA 4A6DA 3OOPA 4IF4A 1XCVA 3I4PA 1CF7A 3PQJA 2W57A 4L9JA 3H3UA 2F2EA 2ZMEA 3I54A 2W85A 1ZGAA 3DV8A 2FA5A 3FXUA 4IHTA 1T6SA 4OOIA 1XN7A 4UV9A 3JSOA 4S04A 4N0BA 3R60A 1XMAA 3QOPA 2A69F 2HOEA 2YR2A 1YIOA 4L9VA 1Z05A 3RDIA 4RGXA 2XAHA 3MAJA 4KA4A 4PGHA 1QGPA 1HW5A 2DFIA 2IW5A 4EJUA 1LB2A 3RYPA 4I09A 1HKQA 2YSRA 4ZH4F 4KICA 1IRFA 5DCFA 1EH7A 3T8RA 2O6GE 4HZFA 5EEGA 4HX4A 5E18F 4LK0F 3CJNA 3LAJA 2JZYA 4WXHA 1IN6A 3TKYA 1OYIA 4PZJA 1O3SA 1ZH5A 1FNNA 4F7ZA 5L3EA 2R7FA 1J0RA 4ZZDA 2FBKA 1FX7A 1KU3A 1Z9CA 3WTUC 1U78A 3V8JA 4HX8A 5D6EA 3ZN1A 2M8EA 4EM1A 3K2ZA 4HF0A 1XCBA 1S7AA 4XBFA 3FXQA 4CXFA 2IJLA 3FMQA 5HLGA 2V9VA 2QQBA 1G4DA 3JSPA 1T98A 2M1BA 4FHTA 1FLIA 1WI9A 1DPRA 5FGMA 3KZYA 3FM5A 3WE3A 4MQ9F 4CGZA 2K27A 3RYRA 4Q5SF 2ZXJA 3FF5A 1K78B 1FOKA 4EGZA 1HSJA 2VN2A 4HX7A 3Q5FA 4PDKA 1P4AA 5ILVA 1TQIA 4Q47A 3QAHA 2ZMEB 5HDGA 1SD7A 4I0AA 4ESJA 3KFWX 3L7WA 1RZ4A 5LGTA 5E17F 1XDUA 2JRTA 1FC3A 2DTRA 4OIPF 2ETHA 3BWGA 2OAZA 3GF2A 3HYIA 1W7PD 1AOYA 3OV8A 2CFXA 1R58A 3RTRA 3HHGA 3ZQ7A 5A2QK 1R7JA 1WKMA 3WTXC 2L02A 1EV7A 1XDSA 3RPUA 2XAQA 1O7FA 3JTHA 5DCMA 2OZ6A 3JAMK 3IWFA 3ECOA 4L0YB 3PFIA 2HYFA 5ERIA 5F1RA 5D5VB 1U5TB 1W5SA 2O0YA 3WE2A 2CW0F 4EJWA 2Q8KA 4K2EA 4A12A 2ESHA 4WCGA 3SQNA 4EM2A 4HF2A 3ZN0A 2L01A 5CVRA 3G73A 1TW2A 3HRUA 4EJOA 3FXRA 3V8KA 2XASA 3CUQC 4XSZF 3ZMZA 2XIGA 3HOTA 3DP7A 3BPXA 4DNCA 2EV5A 2VC1A 2RQPA 1O3RA 1J5YA 4HDVA 2LF8A 2V79A 1ZRDA 1QZYA 1MZBA 3BY6A 2CQKA 3U2RA 3E6DA 2MBFA 3CTAA 3F8CA 4KFCA 2NNYA 1UB9A 1P6RA 1ZGJA 4LD5A 4OIQF 3ZMUA 1ONVA 1LVAA 4ZYHA 5FB2A 3CUQB 1B6AA 5DYMA 4KDPA 2XHKA 1USSA 1S7OA 4XLNF 3LA7A 1R1TA 1QO0D 1ZREA 4BHPA 3I59A 2DPUA 4EQQA 1LDJA 1QBJA 4M9ZA 2L4AA 4GGGA 2HS5A 3R4KA 4LJZF 3F23A 1ZG3A 4U0YA 5CYVA 4LG0B 1Z7UA 2Z5UA 3CUOA 2RNJA 4G9YA 2D1VA 1U3EM 3SZPA 1D3YA 2DW4A 4FX4A 1U5TA 2NAZA 3D0SA 2DK5A 2DQLA 3KP3A 5AIQA 2VBWA 1SD5A 3ZP5A 4AVPA 1OYYA 2A6EF 1D8JA 2A5YB 4CYDA 1J9IA 3IC7A 4P55A 5HDNA 1W4MA 4A5NA 2QUFA 2NYXA 4YFNF 4P5OA 1STZA 4PCQA 3VOEA 1LQ1A 2EFWA 5L3FA 1F9NA 1W5TA 3ELKA 3G3ZA 3GYHX 4ENJA 4HF1A 5CVUA 2P7CB 3F3XA 3MFKA 3WTZA 4ZZLA 2EV0A 4Q48A 2B0LA 3T1BA 1FYMA 5DEQA 2JPCA 2JSCA 3LA3A 2OU2A 4BYYA 2EJRA 1U2WA 1ON1A 3CO7C 3V7RA 1J2XA 1B9MA 1SAXA 4A2UA 5H6RA 1O57A 3KE2A 1XB4A 2LKPA 3EYYA 3LWFA 2GWRA 3SFZA 2XRNA 2WC2A 4M73A 5DCMB 3NEUA 1UCRA 4LLLA 3DQVC 3H3ZA 4G94A 5ICFA 4BQAA 4RS8A 2PMHA 4D0PA 1YS7A 4BHBA 1LJ9A 3CUQA 1K6OA 1PUEE 1J7KA 1Z1DA 3F72A 4IPAA 2M87A 4AWXB 2STTA 3QRFF 2K7LA 4Y15A 5EEHA 3CLOA 2YU3A 1ZAOA 1KQ8A 2KRFA 5K5QA 5BPDA 1RI7A 4EVIA 4ESFA 1Q1HA 2G9WA 3E97A 4ON0A 4R1HA 4AIKA 4CICA 4IJAA 3MWMA 1FBQA 3L9FA 2A07F 5D8KB 1K7AA
chains in the Genus database with same CATH superfamily
3EETA 2BBYA 2Q0OA 3H9GA 3OYBA 1LFBA 1UHMA 3CCJI 4BXUA 1IAWA 3O8HA 4Y17A 2HVRA 5AONA 5D8LB 3S2DJ 2CGPA 1Z3XA 4U0WA 3SZTA 4M72A 3BPVA 5TJJA 1YJNI 4CCKA 3CP2A 2DCEA 5CVIA 4BH9A 3IV5A 3BR3A 3MKWB 2DJIA 4AVZA 4CA0A 2M3AA 3S17J 4E7LA 1XPXA 4HDUA 3ONQA 2Z9OA 1NH3A 3F8NA 2PJRA 3HOYJ 2TDXA 2R3SA 3HGYA 1OCZH 2V1DA 5KAFC 1MBKA 3V8LA 2FRHA 1R23A 2O8XA 5IP7J 2C6YA 2TRTA 3ABLH 4MGRA 1LNWA 4I0BA 4YIIA 1MD0A 1OR7C 5TGTA 3L2VA 4A3IJ 2CUEA 2VL8A 4E7KA 2IBDA 1ODDA 4RDUA 4O3MA 2KRHA 1VQ5I 5HNFA 2VQGA 4CCOA 4U7DA 5H6QA 2HTJA 2PI0A 4MHGA 2TCTA 4HYEA 1V5EA 3BQZA 1KYWA 4DYRA 1EF4A 3JRDA 1YX5A 1Z21A 1WJ5A 1YITI 4J00A 1TNTA 4XRSA 3HOZJ 3KZZA 1WZ2A 3WTSC 4OMYA 1E3OC 3K1NA 2XGDA 5M5WJ 3R0AA 4YFXF 5E8IA 4DYCA 1WJCA 2FQ3A 3PM1A 1JXSA 5HDKA 2LNBA 3CCLI 3S3NA 2X4HA 3DTEA 1PDNC 1YI2I 4NQWB 4ZJZA 4LIUA 3W6KB 2MC4A 3JR9A 2DOAA 3M9AA 3TO6A 4I2OA 3F8BA 2YX4A 3GUDA 4E7HA 4A3EJ 1IG7A 1YJWI 1XMXA 1BBYA 4EATA 1IXRC 4PSWA 5JI6A 1FZPB 2LDUA 3S3MA 3KCCA 4L9NA 1FIAA 4F92B 3HC7A 4B8XA 1X1BA 2X51A 2Y69H 3W2WA 1S72I 5D4SA 2RGVA 2ZJPF 2PEXA 1TWHJ 3F6OA 3A01B 1HW2A 1HQCA 3LQQA 1AWCA 3QPTA 1D5VA 2QYOA 3AFHA 3K4NA 3KP2A 4EEFG 1N75A 2YUSA 1H89C 2HPIA 1R1UA 2FOKA 4L9TA 2HNHA 3GO5A 4LFUA 3K70C 2WA0A 3S2HJ 3HDDA 1YFHA 3LQRA 2IGOA 4HPQA 3W6VA 3LOCA 5LHIA 2VBYA 5KK1A 4UVBA 3FK6A 2M8GX 2R7QA 1YX3A 1I5ZA 4NB5A 2UWMA 2Z3YA 2M7AA 3T8TA 3G6EI 3OMYA 3PO3J 2AQEA 1FOYA 2BY2A 1Z6TA 1R71A 3ESWB 3S14J 2E5NA 2F5DA 1RNLA 2CQQA 1ZRCA 4PUSA 1X1CA 5D4RA 2CJJA 2EILH 2KJBA 3IRRA 1HKTA 3D5LA 1S9HA 2L9NA 4RBOA 2ADUA 3B6CA 1MBFA 5EF6A 2JVHA 3E5XA 4WXCA 2NRAC 3HUGA 4OINF 1ZLJA 1PUFB 4IRGA 1Z91A 3LFUA 2M34A 2OBPA 3LFKA 5E1ZB 2AQFA 3AG4H 1MMSA 1ITYA 1RETA 2OCEA 3C3WA 4R8HA 4WF2A 5GPCA 4BXXJ 4M3EA 2PN6A 1TWCJ 3DEWA 5LRSA 2FE3A 2VLAA 4XLHA 2VJ4A 2WV1A 2IVMA 3HIFA 3HGGA 4Y4RA 3HOVJ 3BTIA 4HRIA 4HAMA 3GFLA 5C44J 1F43A 2DYRH 2E1OA 3N4MA 2E1CA 2Y0MA 4YG2F 1IN5A 2KL4A 4CSWA 3WU2C 2XPUA 3QODA 4CYCA 2EZKA 5EJCA 2KIQA 1G3YA 2AXTC 1HLVA 4FTHA 1ZHFA 3M1EA 4NC6A 1ENHA 2DOFA 4D1QA 3BOQA 3KP5A 3KP6A 4DZPA 2A3SA 2CQXA 4RAYA 1F5TA 3HOXJ 2QQAA 1D8KA 1QVTA 2MSYA 3CDHA 3RPQA 5DM6F 3S2WA 3JTGA 2V4JC 1QRYA 1JKOC 5FKNA 3IL2A 5BPIA 2GAUA 4PGGA 2XUBA 5HS9A 4UB6C 5K5RA 4S0HB 4HNUA 2DYSH 3S1NJ 5TRDA 3V7SA 3KEYA 3Q9VA 5IOYA 5ILSA 2K4BA 3S93A 3SEZA 1LPQA 4RAZA 4M9SA 3BP8A 2ZC2A 2GA1A 5EGOA 1V5GA 2K02A 3M07A 2EB7A 2P7VB 4MTEA 4HNTA 1BC7C 3P9CA 2R0QC 1V4RA 1YW9A 4JQFA 1APLC 3IUOA 2Y9ZA 1XSVA 2Q1ZB 5B5EC 5IT9K 3KP4A 3PQKA 2F4OB 3OYMA 1G3SA 3FXLA 4C2MJ 1T2KA 4XLPF 2QKMB 3J80K 4A3KJ 4IHVA 3QYBA 4F55A 5FKLA 1PP8F 3GTLJ 1E17A 2CV2A 2F4IA 5IYDJ 3U9GA 2W48A 4ZTFA 4KN7X 3NAUA 4KMUX 3OIPA 4LB6B 4NBQA 3WU0A 1V54H 5ICGA 1M1EB 4F91B 4XM3A 1TC3C 1IN7A 4PJMA 1MDMB 1GVJA 2WAQN 3W2VA 1MMAA 1TL8A 2ZFUA 1SFUA 5LGNA 4I7HA 4XL9A 2HKXA 3K1MA 1YO5C 4WX9A 2UXNA 2XROA 2HKOA 2VPRA 2M45A 4M3FA 1TQPA 2VODA 3BZKA 5E1XA 1OFCX 3RKQA 3T5XA 3A0HC 2EFOA 4L18B 1WQ2A 4CO8A 1V3FA 2HXIA 2HPMA 2L9SA 3HPGA 2JUGA 1XD7A 4YELA 2JPBA 1I39A 1AA7A 4BEHB 2A68F 4A5MA 5DV5A 2NVYJ 1O4XA 3S1MJ 4KUMA 5C4XJ 5FLXK 2D5VA 3DEEA 4LK1F 4UXNA 1SAUA 3ZXSA 1J75A 3U1DA 5J8FA 2WAEA 3A4CA 3E3VA 3RKYA 1R5ID 1ZELA 1R5GA 2OQGA 1ZG1A 1AKHA 1N77A 3FKJA 2E7WA 3QPLA 3ZPLA 5JVGF 5F64A 2CU7A 4M6VA 1JJ6C 1S5LC 1BJAA 1LKXA 4JOMA 4BBSJ 2NXNB 2Y30A 4Z2YA 3LA2A 1TWFJ 1KONA 1MGTA 2DI3A 2F6CA 3LSHA 4PSXA 4WK8F 2I5UA 1V55H 4NHJA 4L5EA 1MBGA 5FFZA 3LNQA 2XF6A 4EV0A 4B09A 1H88C 1K4SA 1JKRC 1FOXA 4J01A 1IUYA 3ULQB 5HLTA 2RDPA 2D2WA 1E2XA 2FU4A 2E5ZA 3VB2A 4KIGA 2M2EA 2BW3A 3BCAA 3J81K 3F9KA 2GQQA 3GX4X 2MD5A 5HS8A 3FM3A 1FMVA 2XPVA 2LBFA 2HVSA 3Q0WA 1JUPA 4BBRJ 3ABKH 3JRBA 2DPDA 4A3BJ 1UG2A 3VSKA 3RJPA 2L4MA 3TO7A 2W4SA 4F52A 4GYIA 1P7IA 3KX2A 4YFKF 2MYSA 3QP6A 3VSLA 1O3QA 3HRSA 2QEXI 3DEUA 2IAIA 4ZDPA 4ESBA 1P4WA 1EH8A 2B7EA 1T08B 1X2MA 1FYKA 2XV4S 1RPWA 4I01A 4XRMA 4CCMA 2F5EA 1KU2A 1MW7A 3ZMTA 3ECHA 1W5CC 4LMYA 2KDOA 3OYKA 3GCMA 3PSFA 4BY7J 3V42A 4EGYA 2HDWA 3AG2H 2BXYA 3H5AA 2X48A 4WWCA 3TQNA 4LLGF 2F5VA 3T0YA 4KMFA 2A6HF 5IY5H 3QU6A 2JTVA 3B02A 4AD9A 3G4SI 1A35A 2P81A 3IHUA 4GYGA 1L0OC 1ULYA 2DMNA 2HTSA 4FE7A 4MFDA 4A0YA 1SC7A 2VI6A 1Z0XA 5BS6A 5M5YJ 4KYWA 4XQFA 2Z2SB 4BJ5C 4LG3A 1TWGJ 2ZMEC 3FHNA 2KJCA 3AG3H 5KNLA 2OJED 2VT2A 2HDCA 3OYGA 2ZXWH 3PIOF 3B6AA 4B47A 2Y2ZA 5DUKA 1FSHA 1T0FA 2FNAA 3TBIA 1OCCH 3W3CA 4B4CA 2HQNA 2VT3A 2ZSHB 2CRGA 2DMTA 3PFYA 3F21A 5E1WA 3CJQB 3OYHA 2UZKA 1ACIA 2KQRA 2EPFA 1JHHA 5DM7F 2R7SA 4P9FA 2VBXA 4L5JA 4CZCA 2L7FP 2NNNA 4MEYF 5FD5A 1SFEA 5C3EJ 2LC2A 1X3WB 4IOCF 2ISZA 4B48A 1S8NA 1TTYA 5JHUA 3GTMJ 1IDZA 1U8BA 3CMMA 3IWZA 3RQIA 4JX6A 2XPWA 5K1YA 2ZFWA 5F6FA 2O61A 3DKWA 2V6CA 4A3JJ 2QSHX 3IAS2 2HOAA 4BE1A 1IUFA 1HBXG 1W36C 3ABTA 3ERED 2QQ9A 2IS6A 2DLLA 3R0JA 1XSXA 3L2UA 2CSOA 1DP3A 4D7NA 2JMWA 3ROUA 1UFMA 2WY8Q 4RB0A 1RIOH 5L3BA 3D1NI 2B63J 4MTDA 2X6YA 5KVRA 1YLFA 2GM4A 4G8XA 5JFRA 2LTPA 3N97A 3CC7I 4E70A 5C4JJ 2NOGA 4V2FA 1U8RA 1W7PA 4PFOA 5JLXA 3HB9A 5J8CA 2NVXJ 4G7OF 1P7JA 1GVDA 4C9YA 2DBBA 3KZIC 2ZO4A 2FQ4A 2PFBA 1OCOH 2JT1A 1BW5A 2H09A 1UHSA 2BYVE 3FIWA 2H6CA 4ENMA 4GCVA 3CDLA 2JJ7A 3SXYA 2LSOA 3G2BA 3OR2C 4GRIA 3BDDA 3FMSA 2XAJA 1KZHA 3WODF 2M0CA 2A05A 2VONA 2PQ8A 3G1MA 2IT0A 3JRHA 5A2QZ 3I56I 2ECCA 1QHGA 2E71A 3DFGA 2OTLI 2X1DA 4BQOA 4M6XA 3EYIA 4BJTA 2K4JA 1EH6A 1MJAA 2KHMA 3K2AA 2LKXA 3HSEA 4ZYEA 1Z67A 3WG7H 5L3CA 1GDTA 2XDVA 1IW7F 3I4NJ 1RKTA 3ML6A 3PUFA 4RMNA 3JRIA 4G6DA 1J59A 2KISA 4Y33A 5D6FA 5M5XJ 1QPMA 1XGOA 3ZQHA 1H9GA 1FTZA 4HA8A 3CQZJ 1BIAA 2ZB9A 2MLGA 4PJ0C 5LD2C 1KU7A 2RKHA 4MIMA 1D1BA 1JT6A 2V26A 2KFDA 5E8GA 1A04A 2FBHA 3GXOA 2H27A 1B1BA 1G6NA 2WADA 2GIZA 3P9IA 1CGPA 1TZLA 2Y75A 1K78A 1A6QA 5DUIA 5JVTA 3DPLC 3O6BB 2KPMA 4QPQA 2W24A 5F1JA 1H8AC 1FBSA 3ZMDA 2A6TA 1X3UA 5CJ9A 2P0WA 3EPZA 2KKOA 5CQEA 1S29A 2HQRA 2VKVA 1I27A 3HUGB 1PUFA 1N78A 5EZGA 4XRSG 1HC8A 1F4KA 2M30A 2P8TA 1WJFA 2Z16A 2XC7A 2O3FA 3W6JB 2J5OA 2FSWA 4JYKA 5CVJA 5F04A 5DS9A 1ZG5A 2E7XA 2L7ZA 3P9KA 2EFPA 2EIKH 3TDUC 2ZXIA 1NTCA 4KT5C 1UHWA 3BJOA 1OMIA 2O7OA 5FJ8J 2ZSIB 3E1SA 2ID3A 3NWTA 5FD6A 1XTAA 2PJRB 3C2GA 2OUMA 3ZQQA 2R92J 2DFHA 4BGDA 2M7BA 3TDZC 1MJBA 1EJ9A 3F6VA 1ERDA 1IO2A 4BEHA 2MLKA 3HZJA 2H1KA 4CHUA 3K70D 2Y48A 2E1MB 2V1XA 4PK4A 4A93J 1QVUA 3DKXA 2AHQA 2K9QA 3SDBA 4QLCU 5LHHA 4BDZA 5H20A 4II3A 1PP7U 5J6XA 1YW7A 2HEOA 2R5ZA 1LFPA 2V1UA 4BUPA 2W82A 4DBQA 3EQLF 3L09A 3LL7A 2ACJA 3KETA 4AYBN 2ELHA 4N4NB 2WWYA 2R5YA 2FOWA 1R6RA 3FDYA 2RREA 2QLZA 2DA1A 1FOWA 2F5FA 2OA4A 4F3QA 2MH9A 5J4YA 2RVCA 1IC8A 2HOSA 4B1RA 1E3PA 2KIMA 1ZTRA 1H9TA 2XAUA 5IYBJ 3LSJA 1VQLI 5D5WB 1P4XA 2DK8A 5B1AH 3I59B 2LG4A 3NARA 1YW8A 3C7JA 3MCZA 2DAOA 2KIFA 1HXDA 4M71A 2DQRA 3J80Z 2PLYA 2BY3A 2VOOA 1R36A 3CC2I 2CW8A 1LEBA 1FY7A 2WV0A 1JUSA 3DBHB 3J7ZI 3BT9A 3OSGA 3TP0A 4YIFA 2BHYA 3BTJA 5FKOA 5GPAA 2FUG2 1W7PB 3OSFA 1VQ9I 2HZTA 4LGWA 4N9IA 2ISYA 3CJTB 3WG9A 3LSIA 5E79C 2H6BA 3RPUD 5K7HA 3EUHC 1LDKB 4AIHA 2E2IJ 4JK1X 2VC0A 3MZHA 1A36A 1TBXA 2BVLA 1LVKA 2ME0A 1R4MB 2BOLA 2E2HJ 5AIPA 4DW6A 1UELB 2HGCA 1BI3A 1QZZA 1XMKA 1G3TA 2CUZA 2EWNA 4P96A 5FRMA 3UKGA 4E6KG 1B72A 1R22A 3NQOA 2V1NA 5GTHC 3GZ5A 1N25A 4FETA 1BIBA 3HRMA 2DT7B 3J81Z 1A6IA 2EA2A 3E0JB 3E6MA 4XONA 3DLAA 3K4LA 3CCEI 3BJAA 2EFNA 2IEKA 3DCFA 4EMSA 3HJEA 1LEAA 5J40A 1DGWY 5EG0B 2KDZA 2LR8A 5DD8A 3V4GA 2K3FA 1Z6RA 4A3LJ 1YTYA 3VEPA 3BTLA 2R5ZB 5FFXA 2X1CA 1QA6A 1MKMA 2CV1A 2HQAA 5J47A 5FRNA 3LSTA 1CF7B 3FBNB 3M7GA 3BG7A 4XKCA 2RC4A 2JA2A 2PMUA 1P92A 3HTUA 4XSXF 2EFQA 3IRQA 1DP7P 5HVQC 4PJLA 2QF7A 1Y56A 2RNGA 3FISA 3R6SA 3GTPJ 2UV1A 3BROA 3OS1A 1B8IA 2JK3A 2E60A 1USTA 4IVNA 3VPRA 1GV2A 3GVAA 3K4MA 3N05A 3TOAA 1IZ1A 2W84A 1PJRA 3ZOBA 4R79A 4AYBA 4LLNA 2OD5A 3NWSA 2QCOA 3MZYA 5K7ZA 2VOPA 2WB1N 2EZLA 1HKSA 3RZOJ 4AC0A 4FT8A 3K6GA 1I6HJ 2ZBKA 1AHDP 2MH2A 2WY7Q 2HR3A 2ESNA 1VQ6I 4BQQA 3WTWC 2EZHA 2VKHA 5FLMJ 4IKFA 3M8JA 2DU9A 9ANTA 2HYGD 3H9JA 1GXQA 2XB5A 1AKHB 1O7LA 3GFMA 5D5XB 2LY2A 2FJ1A 1VZ0A 3GBGA 3GLXA 5LLQA 2V7FA 4IRHA 1RUOA 2KLOA 2Y0SA 3LMMA 2RAEA 2I8DA 4QTRA 2EIJH 1WHUA 3MMYB 1I3QJ 2EQRA 1T39A 2DXIA 1IGNA 3OWTA 4H0EA 3KEOA 5L3GA 3HG9A 3BG6A 3OS0A 1Z7LA 4S05A 3KEQA 1U5TC 2XF7A 3SHFA 2I10A 4C3IJ 1JGGA 2QBYB 3DF8A 5EYRA 2JUCA 3FK7A 1VQOI 1XC5A 2BW3B 2DT6A 2NS7A 1IN8A 4LOCA 2IS1A 4M3BA 3ABUA 2IXSA 1R00A 3ZMVA 1JKQC 1NG6A 3QPSA 1SMTA 2DT5A 4IX7A 3VYUB 1MDMA 2AXLA 2P6SA 1RUNA 2STWA 3ZQFA 1ZR4A 2XGEA 2JWTA 3ZQGA 1MNEA 1SVLA 1IDYA 4FX0A 1U6GA 1IV6A 5F08A 3EDPA 2ICWG 1POGA 3CDIA 3VFZA 3HKZA 2GZWA 3TOBA 4C2UA 4UNOA 5IYCJ 3GEZA 3HRTA 2G7UA 4ZYAA 1U0JA 1REPC 1HSTA 4BE0A 3K69A 2DA5A 2Q2EA 4MQVA 1SD4A 2XKOA 3GFIA 2DO7A 4OMZA 1MBJA 3OIQA 4MNUA 2NVQJ 4ETSA 1QQIA 3FXKA 4CCNA 2F48A 1KQ9A 3I71A 5FLXZ 1ETYA 1UMQA 3O3KA 2AO9A 2P6TA 2Q2EB 2ZJ2A 5K5OA 2XAGA 4EJVA 2LFBA 1IF1A 1ZQ3P 3S1QJ 1FYLA 4M9XA 4QWQA 4I6ZA 1XGNA 4CDGA 1WJEA 2VB6A 4ZDOA 3QQAA 1UZCA 3J7AO 5J3LA 1FT9A 4KIBA 2K9MA 1D0XA 3TW6A 3GZ6A 1FP1D 5FO5A 2GOXB 5HLHA 1GUUA 1FPQA 2X6OA 1RR8C 2ME6A 1IRXA 1R1VA 3K4JA 1T33A 4RGUA 3RCOA 4BAYA 1HOMA 1OCTC 4U0VA 4Z6YA 2YX7A 4XLEA 2N8GA 3RZDJ 4IRIA 1B4AA 1JE8A 5FKKA 2CG4A 1I1GA 2R4GA 2O03A 4NC7A 2UXXA 2L7MP 1WWXA 3TL4X 3AAFA 3IP4B 3ZR8X 4CYCB 2JN6A 4XNFA 1OPCA 2QGUA 2Y0SN 4CCJA 1GLNA 3SJMA 5M3MJ 1BJZA 1BR1A 3CCUI 2DA3A 4U87A 1T38A 1IXCA 3G71I 1D0ZA 1WVRA 1K61A 4L0ZB 2QA4I 2LD5A 5LBQA 1G3WA 5LHGA 2OZUA 3RSNA 1MBHA 2R7OA 1IXSB 2VQCA 4P1WA 3I53A 2RQQA 4UUSB 1L3LA 1XSDA 3HSRA 2QSGX 5CQGA 4XKVA 1WCMJ 1VI0A 1Y6IA 2FF4A 2L0KA 1GHCA 2KIUA 2FBIA 3K4BA 1GV5A 4OAYA 2MC3A 2QBYA 3C18A 3GW2A 3I58A 4HNVA 5H2FC 4EJTA 4V19K 1B72B 3VYTB 2HFHA 2IP2A 3LSRA 2X9DA 1BI2A 2LMDA 4LITA 1DUXC 3CC4I 2NS0A 5D5UB 1XX5A 4A3MJ 4XKWA 2GXAA 2UUZA 4G6QA 4C3JJ 1R5HA 2A5WA 1C0WA 3A2KA 4I99C 3GWZA 4Y52J 1X3ZB 1WRJA 2XVCA 3FX3A 4IXAA 4XLCA 2YS9A 3MQ0A 1O3TA 2EBIA 2VIXA 4RB2C 4ZYDA 2CO5A 2E36A 3JW4A 2X0LA 4A69C 1VQKI 1OYWA 3IH2A 2BEOA 2CQ7A 4QSHA 2P5LC 2LF7A 2BV6A 4A0ZA 5B1BH 3CMEI 5K7FA 3FMRA 3C1DA 4HQEA 1FEXA 3DPTA 4ASNA 3W2AA 1BI0A 4Y3OA 2VKDA 1ZK8A 3VODA 3NRVA 4RAFA 2IS2A 2Z33A 3RQ4A 2CWEA 3GFJA 1TW3A 4V2GA 1MNMC 3FXOA 3FKIJ 3JCUC 3KLNA 3B73A 1NHAA 3O2PE 2R5YB 1BI1A 2XGXA 5GADJ 1MSEC 2JQ7A 5CKTA 4NQWA 4AIJA 1HDPA 4MO7A 5F0CA 3ZQLA 2NVUB 1LDDA 5JHFA 3OYJA 1MSFC 2DFEA 2COBA 5LEKA 4W1UA 5ICEA 4ENKA 4AIDA 2EINH 1UG0A 3SEQA 2XSDC 3GTJJ 3H0DA 3DLLF 3A0BC 5KHDA 4HLXA 4HLYA 2BGCA 4LG0A 5IP9J 2COMA 4E7JA 3I64A 1OKRA 2VE8A 2QM3A 3H0GJ 3PIPF 1K6YA 3IKTA 4KNYA 2HYJA 2FEZA 3RKXA 2KRCA 4G7HF 1LE8A 3OL4A 5BNGA 4M3DA 5CLSA 3HXLA 2VASA 2W7NA 3M1CA 3QU3A 5DDGA 5TISC 2KMUA 1FTTA 3QOEA 4N9HA 2GIVA 4ENNA 1SFKA 2D1HA 3AG1H 3DXJF 1WPKA 2IA0A 3AL0C 2L54A 3F8FA 3K7AJ 1MMNA 4BHCA 4MEXF 5ED4A 2HWVA 4OU0A 2ZXHA 1ON2A 5KAIC 1S3JA 4HOBA 3GTGJ 1VQ4I 1ETXA 2HXOA 3Q9SA 1R49A 1X1AA 5DD4A 1J09A 4I98B 4XORA 4N4OB 5ILUA 2PBIA 2PJPA 1QNTA 1BR2A 3HOSA 2EIMH 3I5UA 6PAXA 2E34A 2W25A 3WGHA 1H0MA 1MBEA 4GXOA 5GAHJ 1XGSA 2IPQX 3E5UA 1TNSA 3LSGA 4FE4A 2QVOA 1DQUA 3FHZA 3EUKL 2X6XA 5L3DA 3A02A 3R61A 2PX9A 3K9TA 3Q0UA 3L00A 3UR3C 4BE2A 1U9NA 4UVCA 2YPRA 2DA2A 4RB1A 2H94A 4GO1A 1JT0A 3CD6I 4A6EA 3LAPA 4XN0A 3ABMH 2E1MC 2FMLA 4HEA2 5EDNA 5EGOB 1BM9A 1JUMA 2KP6A 2CUFA 3IH3A 1EA3A 4HV5A 4A3GJ 2P5KA 4DBRA 1IN4A 2HQ5A 4BXFA 1T95A 1FBUA 5HS7A 2VQLA 2FNPA 1F36A 4RGRA 3DPUA 4UV8A 1YHQI 4M74A 3BQYA 4O6JA 1SFOJ 2MA3A 2O5RA 3H1CA 2CW7A 3EUHA 5LGUA 5FROA 4Q4ZF 1ZRFA 5BOXA 3BZCA 4I02A 1D5YA 2FXAA 2W00A 3TO9A 4ZC3A 3OYEA 1I50J 5E20A 3DWLE 2R7RA 2XKPA 1JHFA 2IA2A 3PNVA 1LE8B 5IT9Z 2EK5A 2ZNYA 3H9QA 1IRGA 2WTEA 1SVMA 1KGSA 1WH5A 3ZRGA 2QWWA 2OTJI 3F8MA 2GBYA 3JREA 1X58A 2A61A 1TQMA 2ZCWA 4RLFA 1K83J 2MD0A 3REOA 1BOAA 3FBIB 4JBAA 3UNGC 4CZZA 4BNCA 3L2CA 1XGMA 5IT3A 1NK3P 2HDDA 2AS5F 4TV7A 2X85A 1ETQA 5HOOA 3A01A 3K1PA 4KN4X 1Z77A 1ZN2A 1ZARA 2RV8A 4L5IA 3ZMSA 4YRVA 3MKZA 1BC8C 1IJWC 1BOBA 3M3YJ 2ZNZA 1KYZA 1Y0UA 4BU2A 4HV6A 2E1NA 3WTYC 2IA1A 2QSFX 2BY0A 2VJIA 1YS6A 3KPHA 3BJ6A 2M5WA 3HSFA 2XAFA 1GT0C 1JGSA 4RM2A 2HVQA 3CCSI 4HW0A 2HZDA 3K0LA 1DDNA 4NUBA 2K9NA 3F22A 1D1CA 4U7BA 3WU1B 1P9QC 1OCRH 3ASNH 1S6LA 4WXDA 3M8FA 1X1DA 4HSRA 2MG4A 4OIOF 5CVVA 4IL6C 3D5SC 1ZKGA 2EA4A 3COAC 1K79A 4B3XA 2GXBA 1OR7A 1BN5A 1PVEA 5LRRA 4E7SA 1TP4A 4YEJA 1FWZA 3SFIA 2G7HA 1FSEA 2L7KA 2CYYA 1TWAJ 1I6XA 2FMYA 3KYDB 3C2BA 4OIRF 2KT0A 4HBLA 5GAEJ 2OQRA 5JR3A 3FZVA 2LOOA 5E3NA 1E0EA 3JRGA 2EV6A 2LKSA 5HNHA 1VTNC 5M3FJ 4AUXA 2DMUA 2VBZA 1HA8A 1T0FC 5GP9A 3Q0VA 5J1UA 5DTDA 5HLIA 3ZQIA 1GXPA 2K5CA 3WHBA 4A0XA 4RM3A 4XKBA 3RI4A 3GTKJ 4M6YA 1MMGA 3CF5F 1KQ0A 1K4TA 1KU9A 2ZKZA 4RB3C 3EUAA 4A3CJ 3E6CC 3M8EA 3ZGKA 2GXGA 1V5FA 1XS9A 3WGGA 3MEXA 1B9NA 3RIRA 2KZVA 2DFFA 1I1SA 1B8IB 3TGNA 1Y8QB 2PMZN 3GTOJ 3PO2J 1FMWA 3QPHA 3CO6C 1WSUA 2CFOA 1SMYF 1ZYRF 4BJ6C 2L3DA 1U9OA 4HQMA 5B66C 2PG4A 3P7NA 3DU6A 3E5QA 3BZ6A 3MKLA 1MJ9A 3CESA 4ITVA 3DTKA 2Y31A 4A3FJ 1ZGWA 4JX5A 3OL3A 4IHSA 4Y13A 1ETWA 3KP7A 1ORKA 3WGIA 2D45A 4XLAA 3WTVC 2XB0X 4D9JA 2K86A 4FCYA 1X2NA 1BW6A 3H92A 4XN3A 4LB5A 3V7CA 4IO9F 3ISPA 3JRCA 3ZCOA 2P5VA 1EKEA 5IPAA 4D5FA 1YQAA 3BG5A 4U88A 5CPRB 1W1WE 3I0TA 3OYLA 1G8XA 5KCMA 2XGCA 4BDYA 4UVAA 1JKPC 1TLHB 1SD6A 1CQTA 4ZYGA 2QENA 3QWLA 2R7WA 4KITB 1FP2A 2VJ5A 3QP5A 2FD5A 4E7ZA 2IRFG 2QZ8A 4X1EA 2PMZA 3K4CA 2F4MB 3PJRA 2H1LA 5IOZA 5LEJA 3RKWA 3H3VK 2ZJRF 4UUVA 2DMPA 4FISA 3DBRB 1DPUA 3KLOA 1YG2A 4M3GA 4XRFA 4QIWN 3D5RC 4KIFA 3KIOA 4GFBA 1JTXA 4UHTA 2BE5F 1F1ZA 5ICCA 4E7IA 2P4WA 5BQTA 1YYVA 4EM0B 2GA2A 2LY1A 3TEDA 1KA8A 4G12A 1B59A 2Z1DA 2R7DA 2J5PA 1A5JA 3M4OJ 4KISA 3HTSB 1Z3YA 3IKVA 1P2FA 1SFXA 4DQ2A 2VXZA 2NS8A 1MNDA 2RN7A 2Z99A 2VE9A 1FJLA 2XF5A 4MLOA 4O5VA 2IGMA 3WTTC 3BG3A 2F5CA 2R7ZJ 4G7ZF 3S3OA 1HW1A 3I4MJ 5BMZA 3FWEA 2LRDA 3HHHA 1ZLKA 3E6BA 2WB1A 4UY8I 4XICA 3JAMZ 1E3HA 1QU3A 3SYTA 4P9UA 2H8RA 2L5QA 4RGSA 3OOPA 4A6DA 2JA6J 2VQHA 4IF4A 1XCVA 3CF2A 3I4PA 1CF7A 3PQJA 4DGWB 3GTQJ 2W57A 3ERMA 4L9JA 3H3UA 2R93J 2VKEA 2F2EA 3P5JA 2OCCH 2ZMEA 3I54A 2W85A 4Y7NJ 1ZGAA 3DV8A 2FA5A 4J19A 3I55I 3BR0A 2JVGA 3FXUA 1Y0NA 4IHTA 1T6SA 4OOIA 2K3PA 2HU9A 1XN7A 4UV9A 5EEAA 3JSOA 4S04A 4N0BA 3R60A 1XMAA 4F93B 3QOPA 2JA5J 2A69F 4GDFA 3H5RA 2IS4A 3CP8A 2LREA 1SEUA 1IV8A 2HOEA 2VXDA 2YR2A 1YIOA 2K9LA 4L9VA 1WFXA 1W0UA 4B3AA 2E2JJ 3LSMA 4XR6A 1Z05A 1X19A 3RDIA 2ELKA 2CH0A 4RGXA 2K85A 2XAHA 2OF7A 3MAJA 2DDBA 3S16J 4KA4A 3J7AY 5JLWA 4PGHA 1YRNA 1QGPA 1HW5A 3HL2A 2LH9A 2G0EA 2OV7A 2DFIA 2IW5A 2LLKA 4EJUA 3MN2A 1VFCA 1LB2A 1QHHD 4HG2A 3HKZN 2X6WA 3HOUJ 3RYPA 1D1AA 2HI3A 4I09A 1HKQA 2YSRA 4AU7A 2Y9YA 4ZH4F 4KICA 3L1PA 3BCBA 1IRFA 5DCFA 1VQNI 2BZTA 1EH7A 3T8RA 2O6GE 4HZFA 1YE9A 3PSIA 2BY1A 2L2OA 5EEGA 5GTIC 4HX4A 4PFPA 5E18F 4LK0F 4RLQA 3CJNA 3LAJA 3BR6A 2JZYA 4WXHA 1IN6A 3TKYA 1OYIA 1MMDA 1DU6A 2EH3A 3CJRB 4PZJA 1O3SA 2V9PA 3BLYA 1ZH5A 1FNNA 4F7ZA 4DJAA 2DA6A 5L3EA 3JRFA 4BKXA 2R7FA 1NG7A 4XK4A 1J0RA 4ZZDA 4BACA 3O8GA 4OAZA 2VPLA 4UB8C 3S8PA 1Y8RB 1FX7A 1KU3A 2FBKA 1Z9CA 4DIQA 1WJBA 3WTUC 1U78A 3V8JA 1JI8A 4HX8A 5D6EA 3ZN1A 2M8EA 4EM1A 1LFUP 3K2ZA 4HF0A 2V6EA 1XCBA 5LFAA 2EZIA 4DYQA 4IHYA 2CS3A 1S7AA 4XBFA 3FXQA 1HDDC 4CXFA 1I3AA 1ETVA 2BVMA 2IJLA 3FXMA 3FMQA 5HLGA 2V9VA 3I9V2 1W36D 4X0GA 2M4GA 4E4HA 2QQBA 3C2HA 1G4DA 2E19A 3JSPA 1T98A 2BXZA 2M1BA 4BQNA 4IZZA 1G2HA 4H4KC 3L2QA 4FHTA 1FLIA 1WI9A 1DPRA 4OWRB 5FGMA 4XIDA 2VUMJ 3L2WA 3KZYA 3FM5A 3WE3A 4MQ9F 2K27A 4HSTA 4CGZA 2DMQA 2LVSA 4RAGA 5GAGJ 2V9KA 3RYRA 3U1KA 4Q5SF 3BTCA 2IGKA 2ZXJA 1WH7A 1RESA 3FF5A 1K78B 1FOKA 4EGZA 1VQPI 3AL0B 4D7MA 1HSJA 2VN2A 4HX7A 3Q5FA 4PDKA 1P4AA 2WAFA 5ILVA 2QKLB 1TQIA 4Q47A 3K10A 5F0FA 3OYDA 3QAHA 2LY9A 2ZMEB 5HDGA 1SD7A 4I0AA 4ESJA 3KFWX 4IQ4A 3DTIA 3L7WA 1RZ4A 2K9SA 3PNYA 4IEJA 5LGTA 5E17F 2LBFB 1XDUA 2JRTA 1Y1WJ 1FC3A 2DTRA 2NOJB 4MFEA 5EG0A 4OIPF 2ETHA 3BWGA 2OAZA 3GF2A 3HYIA 3S15J 1W7PD 5FLVA 1AOYA 3OV8A 2CFXA 1R58A 3RTRA 3CZ6A 3HHGA 3MZ8A 1WJAA 2IGNA 3CCQI 2FX0A 3ZQ7A 2DA7A 5A2QK 1R7JA 4PJJA 3CLQA 1WKMA 3WTXC 1G59A 2L02A 3GMEA 1EV7A 1YIJI 1XDSA 3RPUA 1A31A 2XAQA 2DA4A 3CCYA 3S1RJ 3OYAA 1VQ8I 1O7FA 3JTHA 5DCMA 2OZ6A 3AKZA 4KT6A 4II2A 3JAMK 3HPHA 3IWFA 3KYLA 3ECOA 5J1RA 4L0YB 2OC6A 2DDAA 3PFIA 2HYFA 5ERIA 5F1RA 5HODA 5D5VB 1U5TB 1W5SA 3VWBA 2O0YA 1S7EA 2CW0F 3WE2A 4EJWA 2Q8KA 2R7TA 2JSPA 4K2EA 1T56A 4A12A 2ESHA 4WCGA 2E35A 3SQNA 4EM2A 1R9TJ 5J1YA 4HF2A 3ZN0A 3LSPA 1WGXA 2L01A 2WBMA 1ETOA 2OPTA 5CVRA 3G73A 1TW2A 1DGRM 2M9HA 3HRUA 5FKMA 4LIVA 4EJOA 4B44A 3FXRA 3V8KA 2XASA 3CUQC 4PJNA 1OCPA 4XSZF 3ZMZA 2XIGA 3A1YA 1OLTA 3HOTA 2DJNA 3DP7A 3BPXA 2MFZA 4DNCA 1UAAA 3BC8A 1SANA 2EV5A 2VC1A 2DN0A 2RQPA 4XLFA 3IH4A 1O3RA 1J5YA 4HDVA 2LF8A 2V79A 1ZRDA 1QZYA 4XOPA 4FASD 1MZBA 3BY6A 2LK2A 1MIJA 4CH7A 4BY1J 2KZGA 1BL0A 2CQKA 3BG9A 3U2RA 3E6DA 4A3DJ 3I3LA 2MBFA 3CTAA 3F8CA 3IAM2 2X1EA 2R7XA 4KFCA 2NNYA 1QPIA 1WI3A 4JP0A 4IOAF 3X2QH 1UB9A 1OQYA 1P6RA 1ZGJA 4LD5A 3FXJA 4OIQF 3ZMUA 1ONVA 2K40A 1LVAA 3PNTA 4XMYA 4ZYHA 4DOZA 3SDGA 3TMOA 3U21A 5FB2A 3CUQB 1B6AA 3Q3SA 5DYMA 3CCRI 2B9SA 2MW8A 4KDPA 2NVTJ 1YRNB 1OJLA 2XHKA 3H35A 3KYCB 5J4VA 3VYSB 3VYRB 3OYNA 2M4KA 1USSA 1S7OA 3DKYA 4BS9A 1JJ8C 4CCLA 1DU0A 4XLNF 4X6AJ 3LA7A 3DBLB 1R1TA 1QO0D 1ZREA 1IRZA 3BR1A 1X4OA 4BHPA 3I59A 4CUGA 2DPUA 3JRAA 3HBLA 4EQQA 1LDJA 1VQMI 1QBJA 3GLLA 4M9ZA 2HOTA 4IQJA 2L4AA 3TW7A 4ANJA 3CCMI 4GGGA 5E3LA 2ID6A 1RRJA 2HS5A 3R4KA 4LJZF 3F23A 3F0CA 3GZNB 1ZG3A 1D0YA 1HF0A 4U0YA 5CYVA 3CMAI 2L9VA 1X1PA 1HCRA 1LUJB 4LG0B 5F27A 1Z7UA 2Z5UA 4C30A 3ZQCA 4ZTJA 3CUOA 1OISA 2RNJA 4G9YA 3S32A 2CUJA 2D1VA 1U3EM 1UJ8A 3SZPA 3H36A 1D3YA 2JA8J 3E7LA 2XSJC 2MGQA 2DW4A 2H8WA 3L2RA 4FX4A 1U5TA 2NAZA 3D0SA 2DK5A 4FQGA 2DQLA 3KP3A 3G1LA 2JA7J 5F0HA 5AIQA 1R4NB 2VBWA 3OS2A 1SD5A 3OY9A 2WAQA 5E3MA 3ZP5A 2GOMA 4AVPA 5IP6A 2M0MA 1OYYA 2A6EF 4AM3A 1D8JA 4QPOA 1RC9A 2A5YB 4CYDA 2DTZA 1SVOA 2YU9J 1J9IA 2R7VA 4G6TB 1FIPA 3IC7A 4P55A 2L9RA 5HDNA 1W4MA 3BR2A 4NDLA 4A5NA 2QUFA 2NYXA 4YFNF 4P5OA 1STZA 3OIOA 2O9LA 4PCQA 2CMPA 3VOEA 1LQ1A 4UUSA 2EFWA 1AU7A 2R7UA 1RR7A 5L3FA 4C3HJ 1F9NA 1TT5B 1W5TA 3ELKA 3G3ZA 3PL8A 3GYHX 3OYIA 4ENJA 4JX4A 3OR1C 4YIRX 1VQ7I 2O8KA 3BR5A 1MH4A 4KJZA 3SZGA 3K4KA 4HF1A 5CVUA 2P7CB 2QQ8A 3F3XA 3MVPA 3MFKA 3WTZA 4ZZLA 2EV0A 4C2TA 4Q48A 2B0LA 3T1BA 4B43A 1FYMA 5DEQA 5E3OA 2JPCA 2JSCA 3LA3A 3CMYA 2OU2A 1WJDA 4BYYA 3QYFA 2EJRA 1VF9A 1U2WA 1ON1A 2W1OA 3CO7C 3WHCA 1YJ9I 4W97A 2ECBA 3V7RA 4RA2A 2CV0A 3CCVI 5EZHA 1J2XA 1B9MA 1SAXA 4IHXA 3HEFA 3MKYB 4A2UA 5H6RA 4I76A 1O57A 3KE2A 1XB4A 3QYEA 2LKPA 3EYYA 3LWFA 1RKWA 2GWRA 3SFZA 4ABZA 2XRNA 1Y39A 2GLOA 2WC2A 4M73A 5DCMB 2CQNA 3NEUA 3OYCA 1UCRA 3OOUA 1ZR2A 4LLLA 3DQVC 2VJJA 1X4PA 1Y1VJ 3H3ZA 4G94A 5ICFA 4BQAA 4RS8A 4D5CA 2PMHA 3OYFA 4D0PA 1NK2P 2ELJA 1YS7A 1W0TA 3MD2A 3PUBA 4BHBA 1JTYA 1LJ9A 3A03A 1T8IA 3CUQA 1ETKA 1K6OA 1VNDA 3HOWJ 1PUEE 1J7KA 3HM5A 1Z1DA 2MABA 1PYVA 2DODA 3F72A 4IPAA 5B3SH 1BR4A 3LSKA 2M87A 1QZEA 3VDXA 3G1OA 1TT0A 4AWXB 2K7LA 4Y15A 3QRFF 5EEHA 2STTA 2JRMA 3CLOA 2LYCA 2YU3A 1ZAOA 3ASOH 3DU5A 2KRFA 2ZJQF 1KQ8A 5K5QA 4UUTA 3J7YJ 2DOEA 2BHZA 5BPDA 1RI7A 4EVIA 4ESFA 1Q1HA 4BL0B 2G9WA 1MH3A 3H5NA 4ZDLA 1Q1VA 1XG1A 2LP0A 4IHWA 3E97A 4ON0A 4R1HA 4DZJA 4AIKA 4CICA 3TP3A 4IJAA 4NC8A 3MWMA 1FBQA 3L9FA 2A07F 4XOTA 1BA5A 5D8KB 4NNJA 1YOVB 1K7AA 2XRLA
chains in the Genus database with same CATH topology
3EETA 2BBYA 2Q0OA 1UHMA 4BXUA 1IAWA 4Y17A 5AONA 5D8LB 2CGPA 4U0WA 3SZTA 4M72A 3BPVA 5TJJA 5CVIA 4BH9A 4HDUA 2Z9OA 3F8NA 2TDXA 2R3SA 2V1DA 3V8LA 2FRHA 1R23A 2O8XA 2C6YA 4MGRA 1LNWA 4I0BA 4YIIA 1MD0A 4O3MA 1ODDA 4U7DA 5H6QA 2HTJA 2PI0A 4MHGA 4HYEA 1KYWA 1TNTA 3KZZA 3WTSC 4OMYA 3K1NA 3R0AA 4YFXF 5E8IA 2FQ3A 1JXSA 5HDKA 2LNBA 2X4HA 1PDNC 3W6KB 3M9AA 3TO6A 4I2OA 3F8BA 2YX4A 3GUDA 1BBYA 1IXRC 5JI6A 1FZPB 2LDUA 3KCCA 4L9NA 4B8XA 5D4SA 2RGVA 2PEXA 3F6OA 1HW2A 1HQCA 3LQQA 1AWCA 3QPTA 1D5VA 2QYOA 3KP2A 1R1UA 2FOKA 4L9TA 3GO5A 4LFUA 1YFHA 3LQRA 5LHIA 2VBYA 5KK1A 4UVBA 1I5ZA 4NB5A 2UWMA 2Z3YA 3T8TA 1Z6TA 2F5DA 1RNLA 1ZRCA 5D4RA 2KJBA 3IRRA 1HKTA 3D5LA 2ADUA 3E5XA 4WXCA 2NRAC 3HUGA 4OINF 1ZLJA 4IRGA 1Z91A 2OBPA 3LFKA 5E1ZB 3C3WA 4R8HA 4WF2A 2PN6A 5LRSA 2FE3A 2IVMA 3HIFA 4HAMA 3GFLA 2E1CA 3N4MA 2Y0MA 4YG2F 1IN5A 1G3YA 1ZHFA 3M1EA 3BOQA 3KP5A 3KP6A 2A3SA 4RAYA 1F5TA 2QQAA 1D8KA 3CDHA 3RPQA 3S2WA 3JTGA 3IL2A 5BPIA 2GAUA 4PGGA 2XUBA 5HS9A 5K5RA 5TRDA 3V7SA 3Q9VA 5ILSA 2K4BA 4RAZA 4M9SA 3BP8A 2GA1A 2K02A 2EB7A 2P7VB 4MTEA 1BC7C 3P9CA 1V4RA 1YW9A 4JQFA 1XSVA 5IT9K 3KP4A 3PQKA 1G3SA 1T2KA 4XLPF 3J80K 1PP8F 1E17A 3U9GA 4KN7X 4KMUX 4LB6B 3WU0A 5ICGA 1IN7A 1MDMB 1GVJA 1SFUA 5LGNA 4I7HA 2HKXA 3K1MA 1YO5C 4WX9A 2UXNA 2XROA 2HKOA 2M45A 1TQPA 2VODA 5E1XA 3T5XA 2EFOA 4L18B 1WQ2A 4CO8A 1V3FA 1XD7A 2JPBA 2A68F 4A5MA 5DV5A 4KUMA 5FLXK 4LK1F 4UXNA 1J75A 3U1DA 5J8FA 3E3VA 3RKYA 1R5GA 2OQGA 1ZG1A 2E7WA 3ZPLA 5F64A 1BJAA 4Z2YA 3LA2A 2DI3A 1MGTA 4WK8F 4NHJA 5FFZA 4EV0A 4B09A 1IUYA 3ULQB 2RDPA 2D2WA 1E2XA 2FU4A 3VB2A 4KIGA 3J81K 2GQQA 3GX4X 2MD5A 5HS8A 3FM3A 2DPDA 3RJPA 2L4MA 3TO7A 4GYIA 4YFKF 3QP6A 1O3QA 3HRSA 3DEUA 4ESBA 1P4WA 1EH8A 1FYKA 2XV4S 4I01A 2F5EA 1KU2A 3ZMTA 3ECHA 4LMYA 4EGYA 4WWCA 3TQNA 4LLGF 3T0YA 4KMFA 2A6HF 3QU6A 2JTVA 3B02A 4AD9A 3IHUA 4GYGA 1L0OC 1ULYA 2HTSA 4A0YA 5BS6A 4KYWA 2KJCA 2VT2A 2HDCA 5DUKA 1FSHA 1T0FA 2FNAA 2HQNA 2VT3A 3F21A 5E1WA 2UZKA 1JHHA 4P9FA 2VBXA 4L5JA 2NNNA 4MEYF 5FD5A 1SFEA 2ISZA 1S8NA 1TTYA 5JHUA 3IWZA 5K1YA 2ZFWA 5F6FA 2O61A 3DKWA 2V6CA 1HBXG 3ABTA 3ERED 2QQ9A 2DLLA 3R0JA 1XSXA 2CSOA 3ROUA 1UFMA 4RB0A 1RIOH 5L3BA 4MTDA 5KVRA 1YLFA 4G8XA 5JFRA 3N97A 4E70A 1U8RA 1W7PA 4G7OF 5J8CA 2DBBA 2ZO4A 2PFBA 2JT1A 2H09A 2BYVE 4ENMA 2H6CA 4GCVA 3SXYA 2LSOA 3BDDA 3FMSA 2XAJA 3WODF 2VONA 2PQ8A 2IT0A 5A2QZ 3DFGA 4M6XA 3EYIA 2K4JA 1EH6A 1MJAA 3HSEA 4ZYEA 5L3CA 1IW7F 3ML6A 4G6DA 1J59A 5D6FA 1QPMA 1XGOA 1H9GA 4HA8A 1BIAA 2MLGA 1KU7A 2RKHA 5E8GA 1A04A 2FBHA 3GXOA 2H27A 1B1BA 1G6NA 3P9IA 1CGPA 2Y75A 1K78A 5DUIA 5JVTA 3DPLC 3O6BB 2W24A 1FBSA 3ZMDA 1X3UA 5CJ9A 2KKOA 1S29A 2HQRA 1I27A 1F4KA 2M30A 2P8TA 2O3FA 3W6JB 2J5OA 2FSWA 5CVJA 1ZG5A 2E7XA 3P9KA 2EFPA 3TDUC 4KT5C 1UHWA 3BJOA 1OMIA 5FD6A 3TDZC 1MJBA 3F6VA 2MLKA 4CHUA 2Y48A 2V1XA 4QLCU 5LHHA 5H20A 1PP7U 5J6XA 1YW7A 2HEOA 2V1UA 3EQLF 3L09A 2ACJA 3KETA 2ELHA 2WWYA 2QLZA 2F5FA 2OA4A 2MH9A 2RVCA 2KIMA 1H9TA 5D5WB 1P4XA 2DK8A 3I59B 1YW8A 3C7JA 3MCZA 2DAOA 2KIFA 1HXDA 4M71A 2DQRA 3J80Z 2PLYA 2VOOA 1R36A 1LEBA 1FY7A 2WV0A 4YIFA 1W7PB 2HZTA 4LGWA 4N9IA 2ISYA 3WG9A 2H6BA 1LDKB 4AIHA 4JK1X 2VC0A 3MZHA 1TBXA 5AIPA 2HGCA 1BI3A 1QZZA 1XMKA 1G3TA 2EWNA 4P96A 1R22A 3NQOA 3GZ5A 1BIBA 3HRMA 3J81Z 2EA2A 3E6MA 3BJAA 2EFNA 4EMSA 1LEAA 5DD8A 3V4GA 1Z6RA 1YTYA 3VEPA 5FFXA 1MKMA 3LSTA 1CF7B 3M7GA 2RC4A 2PMUA 1P92A 3HTUA 4XSXF 2EFQA 3IRQA 1DP7P 5HVQC 3R6SA 3BROA 1USTA 4IVNA 3GVAA 3TOAA 1IZ1A 2W84A 4R79A 4LLNA 2OD5A 3MZYA 2VOPA 1HKSA 4FT8A 2ZBKA 2MH2A 2HR3A 2ESNA 3WTWC 2DU9A 2HYGD 1GXQA 1O7LA 3GFMA 5D5XB 3GLXA 5LLQA 4IRHA 1RUOA 1T39A 4H0EA 3KEOA 5L3GA 4S05A 3KEQA 1U5TC 3SHFA 2QBYB 3DF8A 1IN8A 3ABUA 1R00A 3ZMVA 1SMTA 2DT5A 1MDMA 1RUNA 2STWA 2AXLA 2P6SA 4FX0A 1U6GA 3EDPA 3VFZA 2GZWA 3TOBA 4UNOA 3GEZA 3HRTA 2G7UA 1REPC 1HSTA 3K69A 2Q2EA 4MQVA 1SD4A 2XKOA 3GFIA 2DO7A 4OMZA 4MNUA 4ETSA 1QQIA 1KQ9A 3I71A 5FLXZ 3O3KA 2P6TA 2ZJ2A 5K5OA 2XAGA 4EJVA 1IF1A 1FYLA 4M9XA 4QWQA 1XGNA 4CDGA 3J7AO 1FT9A 4KIBA 3GZ6A 1FP1D 5FO5A 5HLHA 1FPQA 1R1VA 4RGUA 4BAYA 4U0VA 2YX7A 4IRIA 1B4AA 1JE8A 2CG4A 1I1GA 2O03A 2UXXA 1WWXA 3AAFA 1OPCA 1T38A 1IXCA 4L0ZB 5LBQA 1G3WA 5LHGA 2OZUA 1IXSB 3I53A 1L3LA 1XSDA 3HSRA 2FF4A 1GHCA 2KIUA 2FBIA 2MC3A 2QBYA 3C18A 3GW2A 3I58A 4EJTA 2HFHA 2IP2A 1BI2A 1DUXC 2NS0A 5D5UB 4G6QA 1R5HA 1C0WA 3GWZA 1WRJA 2XVCA 3FX3A 4IXAA 3MQ0A 1O3TA 4RB2C 4ZYDA 2CO5A 3JW4A 2X0LA 1OYWA 2BEOA 2P5LC 2LF7A 2BV6A 4A0ZA 3FMRA 3C1DA 4HQEA 3DPTA 4ASNA 1BI0A 3VODA 3NRVA 2Z33A 2CWEA 3GFJA 1TW3A 3KLNA 3B73A 1NHAA 3O2PE 1BI1A 2XGXA 4NQWA 4AIJA 1LDDA 5LEKA 5ICEA 4ENKA 4HLXA 4HLYA 2BGCA 4LG0A 2COMA 3I64A 1OKRA 2VE8A 2QM3A 3IKTA 4KNYA 2FEZA 3RKXA 4G7HF 5CLSA 5DDGA 3QU3A 4N9HA 2GIVA 4ENNA 2D1HA 3DXJF 2IA0A 2L54A 3F8FA 4BHCA 4MEXF 5ED4A 2HWVA 4OU0A 1ON2A 1S3JA 4HOBA 3Q9SA 5DD4A 4I98B 5ILUA 2PBIA 2PJPA 1QNTA 3HOSA 3I5UA 6PAXA 2W25A 3WGHA 1H0MA 4GXOA 1XGSA 2IPQX 3E5UA 1TNSA 2QVOA 3FHZA 5L3DA 3R61A 3K9TA 3L00A 4UVCA 2YPRA 4RB1A 2H94A 4GO1A 4A6EA 3LAPA 2FMLA 1BM9A 4HV5A 2P5KA 1IN4A 1FBUA 5HS7A 2FNPA 4RGRA 4UV8A 4M74A 4O6JA 2MA3A 3EUHA 5LGUA 4Q4ZF 1ZRFA 5BOXA 4I02A 2FXAA 3TO9A 5E20A 2XKPA 1JHFA 2IA2A 5IT9Z 2EK5A 2ZNYA 1IRGA 2WTEA 1KGSA 2QWWA 3F8MA 2A61A 1TQMA 2ZCWA 3REOA 1BOAA 4JBAA 4BNCA 4CZZA 3L2CA 1XGMA 5IT3A 2AS5F 4TV7A 5HOOA 3K1PA 4KN4X 1ZN2A 4L5IA 1ZARA 2RV8A 3ZMSA 1BC8C 2ZNZA 1KYZA 1Y0UA 4HV6A 2E1NA 3WTYC 2IA1A 1YS6A 3BJ6A 2M5WA 3HSFA 2XAFA 1JGSA 4HW0A 3K0LA 1DDNA 3F22A 4U7BA 3WU1B 4WXDA 1S6LA 3M8FA 4OIOF 5CVVA 2EA4A 3COAC 1K79A 2GXBA 1OR7A 1BN5A 5LRRA 1FWZA 2G7HA 1FSEA 2CYYA 1I6XA 2FMYA 4OIRF 4HBLA 2OQRA 5JR3A 3FZVA 2EV6A 1VTNC 2VBZA 1GXPA 5HLIA 4A0XA 3RI4A 4M6YA 1KQ0A 1KU9A 2ZKZA 4RB3C 3E6CC 3M8EA 2GXGA 3WGGA 3MEXA 1B9NA 3RIRA 1I1SA 3TGNA 3QPHA 3CO6C 1WSUA 1SMYF 1ZYRF 2L3DA 4HQMA 2PG4A 3P7NA 3E5QA 3BZ6A 1MJ9A 4IHSA 4Y13A 3KP7A 3WGIA 2D45A 3WTVC 2K86A 3H92A 4LB5A 3V7CA 3ISPA 2P5VA 1YQAA 4U88A 3I0TA 4UVAA 1TLHB 1SD6A 4ZYGA 2QENA 1FP2A 3QP5A 2IRFG 2QZ8A 5LEJA 3RKWA 4UUVA 1DPUA 3KLOA 1YG2A 4XRFA 4KIFA 4UHTA 2BE5F 1F1ZA 5ICCA 2P4WA 5BQTA 1YYVA 4EM0B 2GA2A 1KA8A 1B59A 2R7DA 2J5PA 3HTSB 3IKVA 1P2FA 1SFXA 4DQ2A 2VXZA 2RN7A 2Z99A 2VE9A 4O5VA 3WTTC 2F5CA 4G7ZF 1HW1A 5BMZA 3FWEA 3HHHA 1ZLKA 3E6BA 3JAMZ 4P9UA 4RGSA 4A6DA 3OOPA 4IF4A 1XCVA 3I4PA 1CF7A 3PQJA 2W57A 4L9JA 3H3UA 2F2EA 2ZMEA 3I54A 2W85A 1ZGAA 3DV8A 2FA5A 3FXUA 4IHTA 1T6SA 4OOIA 1XN7A 4UV9A 3JSOA 4S04A 4N0BA 3R60A 1XMAA 3QOPA 2A69F 2HOEA 2YR2A 1YIOA 4L9VA 1Z05A 3RDIA 4RGXA 2XAHA 3MAJA 4KA4A 4PGHA 1QGPA 1HW5A 2DFIA 2IW5A 4EJUA 1LB2A 3RYPA 4I09A 1HKQA 2YSRA 4ZH4F 4KICA 1IRFA 5DCFA 1EH7A 3T8RA 2O6GE 4HZFA 5EEGA 4HX4A 5E18F 4LK0F 3CJNA 3LAJA 2JZYA 4WXHA 1IN6A 3TKYA 1OYIA 4PZJA 1O3SA 1ZH5A 1FNNA 4F7ZA 5L3EA 2R7FA 1J0RA 4ZZDA 2FBKA 1FX7A 1KU3A 1Z9CA 3WTUC 1U78A 3V8JA 4HX8A 5D6EA 3ZN1A 2M8EA 4EM1A 3K2ZA 4HF0A 1XCBA 1S7AA 4XBFA 3FXQA 4CXFA 2IJLA 3FMQA 5HLGA 2V9VA 2QQBA 1G4DA 3JSPA 1T98A 2M1BA 4FHTA 1FLIA 1WI9A 1DPRA 5FGMA 3KZYA 3FM5A 3WE3A 4MQ9F 4CGZA 2K27A 3RYRA 4Q5SF 2ZXJA 3FF5A 1K78B 1FOKA 4EGZA 1HSJA 2VN2A 4HX7A 3Q5FA 4PDKA 1P4AA 5ILVA 1TQIA 4Q47A 3QAHA 2ZMEB 5HDGA 1SD7A 4I0AA 4ESJA 3KFWX 3L7WA 1RZ4A 5LGTA 5E17F 1XDUA 2JRTA 1FC3A 2DTRA 4OIPF 2ETHA 3BWGA 2OAZA 3GF2A 3HYIA 1W7PD 1AOYA 3OV8A 2CFXA 1R58A 3RTRA 3HHGA 3ZQ7A 5A2QK 1R7JA 1WKMA 3WTXC 2L02A 1EV7A 1XDSA 3RPUA 2XAQA 1O7FA 3JTHA 5DCMA 2OZ6A 3JAMK 3IWFA 3ECOA 4L0YB 3PFIA 2HYFA 5ERIA 5F1RA 5D5VB 1U5TB 1W5SA 2O0YA 3WE2A 2CW0F 4EJWA 2Q8KA 4K2EA 4A12A 2ESHA 4WCGA 3SQNA 4EM2A 4HF2A 3ZN0A 2L01A 5CVRA 3G73A 1TW2A 3HRUA 4EJOA 3FXRA 3V8KA 2XASA 3CUQC 4XSZF 3ZMZA 2XIGA 3HOTA 3DP7A 3BPXA 4DNCA 2EV5A 2VC1A 2RQPA 1O3RA 1J5YA 4HDVA 2LF8A 2V79A 1ZRDA 1QZYA 1MZBA 3BY6A 2CQKA 3U2RA 3E6DA 2MBFA 3CTAA 3F8CA 4KFCA 2NNYA 1UB9A 1P6RA 1ZGJA 4LD5A 4OIQF 3ZMUA 1ONVA 1LVAA 4ZYHA 5FB2A 3CUQB 1B6AA 5DYMA 4KDPA 2XHKA 1USSA 1S7OA 4XLNF 3LA7A 1R1TA 1QO0D 1ZREA 4BHPA 3I59A 2DPUA 4EQQA 1LDJA 1QBJA 4M9ZA 2L4AA 4GGGA 2HS5A 3R4KA 4LJZF 3F23A 1ZG3A 4U0YA 5CYVA 4LG0B 1Z7UA 2Z5UA 3CUOA 2RNJA 4G9YA 2D1VA 1U3EM 3SZPA 1D3YA 2DW4A 4FX4A 1U5TA 2NAZA 3D0SA 2DK5A 2DQLA 3KP3A 5AIQA 2VBWA 1SD5A 3ZP5A 4AVPA 1OYYA 2A6EF 1D8JA 2A5YB 4CYDA 1J9IA 3IC7A 4P55A 5HDNA 1W4MA 4A5NA 2QUFA 2NYXA 4YFNF 4P5OA 1STZA 4PCQA 3VOEA 1LQ1A 2EFWA 5L3FA 1F9NA 1W5TA 3ELKA 3G3ZA 3GYHX 4ENJA 4HF1A 5CVUA 2P7CB 3F3XA 3MFKA 3WTZA 4ZZLA 2EV0A 4Q48A 2B0LA 3T1BA 1FYMA 5DEQA 2JPCA 2JSCA 3LA3A 2OU2A 4BYYA 2EJRA 1U2WA 1ON1A 3CO7C 3V7RA 1J2XA 1B9MA 1SAXA 4A2UA 5H6RA 1O57A 3KE2A 1XB4A 2LKPA 3EYYA 3LWFA 2GWRA 3SFZA 2XRNA 2WC2A 4M73A 5DCMB 3NEUA 1UCRA 4LLLA 3DQVC 3H3ZA 4G94A 5ICFA 4BQAA 4RS8A 2PMHA 4D0PA 1YS7A 4BHBA 1LJ9A 3CUQA 1K6OA 1PUEE 1J7KA 1Z1DA 3F72A 4IPAA 2M87A 4AWXB 2STTA 3QRFF 2K7LA 4Y15A 5EEHA 3CLOA 2YU3A 1ZAOA 1KQ8A 2KRFA 5K5QA 5BPDA 1RI7A 4EVIA 4ESFA 1Q1HA 2G9WA 3E97A 4ON0A 4R1HA 4AIKA 4CICA 4IJAA 3MWMA 1FBQA 3L9FA 2A07F 5D8KB 1K7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EET A;  2BBY A;  2Q0O A;  1UHM A;  4BXU A;  1IAW A;  4Y17 A;  5AON A;  5D8L B;  2CGP A;  4U0W A;  3SZT A;  4M72 A;  3BPV A;  5TJJ A;  5CVI A;  4BH9 A;  4HDU A;  2Z9O A;  3F8N A;  2TDX A;  2R3S A;  2V1D A;  3V8L A;  2FRH A;  1R23 A;  2O8X A;  2C6Y A;  4MGR A;  1LNW A;  4I0B A;  4YII A;  1MD0 A;  4O3M A;  1ODD A;  4U7D A;  5H6Q A;  2HTJ A;  2PI0 A;  4MHG A;  4HYE A;  1KYW A;  1TNT A;  3KZZ A;  3WTS C;  4OMY A;  3K1N A;  3R0A A;  4YFX F;  5E8I A;  2FQ3 A;  1JXS A;  5HDK A;  2LNB A;  2X4H A;  1PDN C;  3W6K B;  3M9A A;  3TO6 A;  4I2O A;  3F8B A;  2YX4 A;  3GUD A;  1BBY A;  1IXR C;  5JI6 A;  1FZP B;  2LDU A;  3KCC A;  4L9N A;  4B8X A;  5D4S A;  2RGV A;  2PEX A;  3F6O A;  1HW2 A;  1HQC A;  3LQQ A;  1AWC A;  3QPT A;  1D5V A;  2QYO A;  3KP2 A;  1R1U A;  2FOK A;  4L9T A;  3GO5 A;  4LFU A;  1YFH A;  3LQR A;  5LHI A;  2VBY A;  5KK1 A;  4UVB A;  1I5Z A;  4NB5 A;  2UWM A;  2Z3Y A;  3T8T A;  1Z6T A;  2F5D A;  1RNL A;  1ZRC A;  5D4R A;  2KJB A;  3IRR A;  1HKT A;  3D5L A;  2ADU A;  3E5X A;  4WXC A;  2NRA C;  3HUG A;  4OIN F;  1ZLJ A;  4IRG A;  1Z91 A;  2OBP A;  3LFK A;  5E1Z B;  3C3W A;  4R8H A;  4WF2 A;  2PN6 A;  5LRS A;  2FE3 A;  2IVM A;  3HIF A;  4HAM A;  3GFL A;  2E1C A;  3N4M A;  2Y0M A;  4YG2 F;  1IN5 A;  1G3Y A;  1ZHF A;  3M1E A;  3BOQ A;  3KP5 A;  3KP6 A;  2A3S A;  4RAY A;  1F5T A;  2QQA A;  1D8K A;  3CDH A;  3RPQ A;  3S2W A;  3JTG A;  3IL2 A;  5BPI A;  2GAU A;  4PGG A;  2XUB A;  5HS9 A;  5K5R A;  5TRD A;  3V7S A;  3Q9V A;  5ILS A;  2K4B A;  4RAZ A;  4M9S A;  3BP8 A;  2GA1 A;  2K02 A;  2EB7 A;  2P7V B;  4MTE A;  1BC7 C;  3P9C A;  1V4R A;  1YW9 A;  4JQF A;  1XSV A;  5IT9 K;  3KP4 A;  3PQK A;  1G3S A;  1T2K A;  4XLP F;  3J80 K;  1PP8 F;  1E17 A;  3U9G A;  4KN7 X;  4KMU X;  4LB6 B;  3WU0 A;  5ICG A;  1IN7 A;  1MDM B;  1GVJ A;  1SFU A;  5LGN A;  4I7H A;  2HKX A;  3K1M A;  1YO5 C;  4WX9 A;  2UXN A;  2XRO A;  2HKO A;  2M45 A;  1TQP A;  2VOD A;  5E1X A;  3T5X A;  2EFO A;  4L18 B;  1WQ2 A;  4CO8 A;  1V3F A;  1XD7 A;  2JPB A;  2A68 F;  4A5M A;  5DV5 A;  4KUM A;  5FLX K;  4LK1 F;  4UXN A;  1J75 A;  3U1D A;  5J8F A;  3E3V A;  3RKY A;  1R5G A;  2OQG A;  1ZG1 A;  2E7W A;  3ZPL A;  5F64 A;  1BJA A;  4Z2Y A;  3LA2 A;  2DI3 A;  1MGT A;  4WK8 F;  4NHJ A;  5FFZ A;  4EV0 A;  4B09 A;  1IUY A;  3ULQ B;  2RDP A;  2D2W A;  1E2X A;  2FU4 A;  3VB2 A;  4KIG A;  3J81 K;  2GQQ A;  3GX4 X;  2MD5 A;  5HS8 A;  3FM3 A;  2DPD A;  3RJP A;  2L4M A;  3TO7 A;  4GYI A;  4YFK F;  3QP6 A;  1O3Q A;  3HRS A;  3DEU A;  4ESB A;  1P4W A;  1EH8 A;  1FYK A;  2XV4 S;  4I01 A;  2F5E A;  1KU2 A;  3ZMT A;  3ECH A;  4LMY A;  4EGY A;  4WWC A;  3TQN A;  4LLG F;  3T0Y A;  4KMF A;  2A6H F;  3QU6 A;  2JTV A;  3B02 A;  4AD9 A;  3IHU A;  4GYG A;  1L0O C;  1ULY A;  2HTS A;  4A0Y A;  5BS6 A;  4KYW A;  2KJC A;  2VT2 A;  2HDC A;  5DUK A;  1FSH A;  1T0F A;  2FNA A;  2HQN A;  2VT3 A;  3F21 A;  5E1W A;  2UZK A;  1JHH A;  4P9F A;  2VBX A;  4L5J A;  2NNN A;  4MEY F;  5FD5 A;  1SFE A;  2ISZ A;  1S8N A;  1TTY A;  5JHU A;  3IWZ A;  5K1Y A;  2ZFW A;  5F6F A;  2O61 A;  3DKW A;  2V6C A;  1HBX G;  3ABT A;  3ERE D;  2QQ9 A;  2DLL A;  3R0J A;  1XSX A;  2CSO A;  3ROU A;  1UFM A;  4RB0 A;  1RIO H;  5L3B A;  4MTD A;  5KVR A;  1YLF A;  4G8X A;  5JFR A;  3N97 A;  4E70 A;  1U8R A;  1W7P A;  4G7O F;  5J8C A;  2DBB A;  2ZO4 A;  2PFB A;  2JT1 A;  2H09 A;  2BYV E;  4ENM A;  2H6C A;  4GCV A;  3SXY A;  2LSO A;  3BDD A;  3FMS A;  2XAJ A;  3WOD F;  2VON A;  2PQ8 A;  2IT0 A;  5A2Q Z;  3DFG A;  4M6X A;  3EYI A;  2K4J A;  1EH6 A;  1MJA A;  3HSE A;  4ZYE A;  5L3C A;  1IW7 F;  3ML6 A;  4G6D A;  1J59 A;  5D6F A;  1QPM A;  1XGO A;  1H9G A;  4HA8 A;  1BIA A;  2MLG A;  1KU7 A;  2RKH A;  5E8G A;  1A04 A;  2FBH A;  3GXO A;  2H27 A;  1B1B A;  1G6N A;  3P9I A;  1CGP A;  2Y75 A;  1K78 A;  5DUI A;  5JVT A;  3DPL C;  3O6B B;  2W24 A;  1FBS A;  3ZMD A;  1X3U A;  5CJ9 A;  2KKO A;  1S29 A;  2HQR A;  1I27 A;  1F4K A;  2M30 A;  2P8T A;  2O3F A;  3W6J B;  2J5O A;  2FSW A;  5CVJ A;  1ZG5 A;  2E7X A;  3P9K A;  2EFP A;  3TDU C;  4KT5 C;  1UHW A;  3BJO A;  1OMI A;  5FD6 A;  3TDZ C;  1MJB A;  3F6V A;  2MLK A;  4CHU A;  2Y48 A;  2V1X A;  4QLC U;  5LHH A;  5H20 A;  1PP7 U;  5J6X A;  1YW7 A;  2HEO A;  2V1U A;  3EQL F;  3L09 A;  2ACJ A;  3KET A;  2ELH A;  2WWY A;  2QLZ A;  2F5F A;  2OA4 A;  2MH9 A;  2RVC A;  2KIM A;  1H9T A;  5D5W B;  1P4X A;  2DK8 A;  3I59 B;  1YW8 A;  3C7J A;  3MCZ A;  2DAO A;  2KIF A;  1HXD A;  4M71 A;  2DQR A;  3J80 Z;  2PLY A;  2VOO A;  1R36 A;  1LEB A;  1FY7 A;  2WV0 A;  4YIF A;  1W7P B;  2HZT A;  4LGW A;  4N9I A;  2ISY A;  3WG9 A;  2H6B A;  1LDK B;  4AIH A;  4JK1 X;  2VC0 A;  3MZH A;  1TBX A;  5AIP A;  2HGC A;  1BI3 A;  1QZZ A;  1XMK A;  1G3T A;  2EWN A;  4P96 A;  1R22 A;  3NQO A;  3GZ5 A;  1BIB A;  3HRM A;  3J81 Z;  2EA2 A;  3E6M A;  3BJA A;  2EFN A;  4EMS A;  1LEA A;  5DD8 A;  3V4G A;  1Z6R A;  1YTY A;  3VEP A;  5FFX A;  1MKM A;  3LST A;  1CF7 B;  3M7G A;  2RC4 A;  2PMU A;  1P92 A;  3HTU A;  4XSX F;  2EFQ A;  3IRQ A;  1DP7 P;  5HVQ C;  3R6S A;  3BRO A;  1UST A;  4IVN A;  3GVA A;  3TOA A;  1IZ1 A;  2W84 A;  4R79 A;  4LLN A;  2OD5 A;  3MZY A;  2VOP A;  1HKS A;  4FT8 A;  2ZBK A;  2MH2 A;  2HR3 A;  2ESN A;  3WTW C;  2DU9 A;  2HYG D;  1GXQ A;  1O7L A;  3GFM A;  5D5X B;  3GLX A;  5LLQ A;  4IRH A;  1RUO A;  1T39 A;  4H0E A;  3KEO A;  5L3G A;  4S05 A;  3KEQ A;  1U5T C;  3SHF A;  2QBY B;  3DF8 A;  1IN8 A;  3ABU A;  1R00 A;  3ZMV A;  1SMT A;  2DT5 A;  1MDM A;  1RUN A;  2STW A;  2AXL A;  2P6S A;  4FX0 A;  1U6G A;  3EDP A;  3VFZ A;  2GZW A;  3TOB A;  4UNO A;  3GEZ A;  3HRT A;  2G7U A;  1REP C;  1HST A;  3K69 A;  2Q2E A;  4MQV A;  1SD4 A;  2XKO A;  3GFI A;  2DO7 A;  4OMZ A;  4MNU A;  4ETS A;  1QQI A;  1KQ9 A;  3I71 A;  5FLX Z;  3O3K A;  2P6T A;  2ZJ2 A;  5K5O A;  2XAG A;  4EJV A;  1IF1 A;  1FYL A;  4M9X A;  4QWQ A;  1XGN A;  4CDG A;  3J7A O;  1FT9 A;  4KIB A;  3GZ6 A;  1FP1 D;  5FO5 A;  5HLH A;  1FPQ A;  1R1V A;  4RGU A;  4BAY A;  4U0V A;  2YX7 A;  4IRI A;  1B4A A;  1JE8 A;  2CG4 A;  1I1G A;  2O03 A;  2UXX A;  1WWX A;  3AAF A;  1OPC A;  1T38 A;  1IXC A;  4L0Z B;  5LBQ A;  1G3W A;  5LHG A;  2OZU A;  1IXS B;  3I53 A;  1L3L A;  1XSD A;  3HSR A;  2FF4 A;  1GHC A;  2KIU A;  2FBI A;  2MC3 A;  2QBY A;  3C18 A;  3GW2 A;  3I58 A;  4EJT A;  2HFH A;  2IP2 A;  1BI2 A;  1DUX C;  2NS0 A;  5D5U B;  4G6Q A;  1R5H A;  1C0W A;  3GWZ A;  1WRJ A;  2XVC A;  3FX3 A;  4IXA A;  3MQ0 A;  1O3T A;  4RB2 C;  4ZYD A;  2CO5 A;  3JW4 A;  2X0L A;  1OYW A;  2BEO A;  2P5L C;  2LF7 A;  2BV6 A;  4A0Z A;  3FMR A;  3C1D A;  4HQE A;  3DPT A;  4ASN A;  1BI0 A;  3VOD A;  3NRV A;  2Z33 A;  2CWE A;  3GFJ A;  1TW3 A;  3KLN A;  3B73 A;  1NHA A;  3O2P E;  1BI1 A;  2XGX A;  4NQW A;  4AIJ A;  1LDD A;  5LEK A;  5ICE A;  4ENK A;  4HLX A;  4HLY A;  2BGC A;  4LG0 A;  2COM A;  3I64 A;  1OKR A;  2VE8 A;  2QM3 A;  3IKT A;  4KNY A;  2FEZ A;  3RKX A;  4G7H F;  5CLS A;  5DDG A;  3QU3 A;  4N9H A;  2GIV A;  4ENN A;  2D1H A;  3DXJ F;  2IA0 A;  2L54 A;  3F8F A;  4BHC A;  4MEX F;  5ED4 A;  2HWV A;  4OU0 A;  1ON2 A;  1S3J A;  4HOB A;  3Q9S A;  5DD4 A;  4I98 B;  5ILU A;  2PBI A;  2PJP A;  1QNT A;  3HOS A;  3I5U A;  6PAX A;  2W25 A;  3WGH A;  1H0M A;  4GXO A;  1XGS A;  2IPQ X;  3E5U A;  1TNS A;  2QVO A;  3FHZ A;  5L3D A;  3R61 A;  3K9T A;  3L00 A;  4UVC A;  2YPR A;  4RB1 A;  2H94 A;  4GO1 A;  4A6E A;  3LAP A;  2FML A;  1BM9 A;  4HV5 A;  2P5K A;  1IN4 A;  1FBU A;  5HS7 A;  2FNP A;  4RGR A;  4UV8 A;  4M74 A;  4O6J A;  2MA3 A;  3EUH A;  5LGU A;  4Q4Z F;  1ZRF A;  5BOX A;  4I02 A;  2FXA A;  3TO9 A;  5E20 A;  2XKP A;  1JHF A;  2IA2 A;  5IT9 Z;  2EK5 A;  2ZNY A;  1IRG A;  2WTE A;  1KGS A;  2QWW A;  3F8M A;  2A61 A;  1TQM A;  2ZCW A;  3REO A;  1BOA A;  4JBA A;  4BNC A;  4CZZ A;  3L2C A;  1XGM A;  5IT3 A;  2AS5 F;  4TV7 A;  5HOO A;  3K1P A;  4KN4 X;  1ZN2 A;  4L5I A;  1ZAR A;  2RV8 A;  3ZMS A;  1BC8 C;  2ZNZ A;  1KYZ A;  1Y0U A;  4HV6 A;  2E1N A;  3WTY C;  2IA1 A;  1YS6 A;  3BJ6 A;  2M5W A;  3HSF A;  2XAF A;  1JGS A;  4HW0 A;  3K0L A;  1DDN A;  3F22 A;  4U7B A;  3WU1 B;  4WXD A;  1S6L A;  3M8F A;  4OIO F;  5CVV A;  2EA4 A;  3COA C;  1K79 A;  2GXB A;  1OR7 A;  1BN5 A;  5LRR A;  1FWZ A;  2G7H A;  1FSE A;  2CYY A;  1I6X A;  2FMY A;  4OIR F;  4HBL A;  2OQR A;  5JR3 A;  3FZV A;  2EV6 A;  1VTN C;  2VBZ A;  1GXP A;  5HLI A;  4A0X A;  3RI4 A;  4M6Y A;  1KQ0 A;  1KU9 A;  2ZKZ A;  4RB3 C;  3E6C C;  3M8E A;  2GXG A;  3WGG A;  3MEX A;  1B9N A;  3RIR A;  1I1S A;  3TGN A;  3QPH A;  3CO6 C;  1WSU A;  1SMY F;  1ZYR F;  2L3D A;  4HQM A;  2PG4 A;  3P7N A;  3E5Q A;  3BZ6 A;  1MJ9 A;  4IHS A;  4Y13 A;  3KP7 A;  3WGI A;  2D45 A;  3WTV C;  2K86 A;  3H92 A;  4LB5 A;  3V7C A;  3ISP A;  2P5V A;  1YQA A;  4U88 A;  3I0T A;  4UVA A;  1TLH B;  1SD6 A;  4ZYG A;  2QEN A;  1FP2 A;  3QP5 A;  2IRF G;  2QZ8 A;  5LEJ A;  3RKW A;  4UUV A;  1DPU A;  3KLO A;  1YG2 A;  4XRF A;  4KIF A;  4UHT A;  2BE5 F;  1F1Z A;  5ICC A;  2P4W A;  5BQT A;  1YYV A;  4EM0 B;  2GA2 A;  1KA8 A;  1B59 A;  2R7D A;  2J5P A;  3HTS B;  3IKV A;  1P2F A;  1SFX A;  4DQ2 A;  2VXZ A;  2RN7 A;  2Z99 A;  2VE9 A;  4O5V A;  3WTT C;  2F5C A;  4G7Z F;  1HW1 A;  5BMZ A;  3FWE A;  3HHH A;  1ZLK A;  3E6B A;  3JAM Z;  4P9U A;  4RGS A;  4A6D A;  3OOP A;  4IF4 A;  1XCV A;  3I4P A;  1CF7 A;  3PQJ A;  2W57 A;  4L9J A;  3H3U A;  2F2E A;  2ZME A;  3I54 A;  2W85 A;  1ZGA A;  3DV8 A;  2FA5 A;  3FXU A;  4IHT A;  1T6S A;  4OOI A;  1XN7 A;  4UV9 A;  3JSO A;  4S04 A;  4N0B A;  3R60 A;  1XMA A;  3QOP A;  2A69 F;  2HOE A;  2YR2 A;  1YIO A;  4L9V A;  1Z05 A;  3RDI A;  4RGX A;  2XAH A;  3MAJ A;  4KA4 A;  4PGH A;  1QGP A;  1HW5 A;  2DFI A;  2IW5 A;  4EJU A;  1LB2 A;  3RYP A;  4I09 A;  1HKQ A;  2YSR A;  4ZH4 F;  4KIC A;  1IRF A;  5DCF A;  1EH7 A;  3T8R A;  2O6G E;  4HZF A;  5EEG A;  4HX4 A;  5E18 F;  4LK0 F;  3CJN A;  3LAJ A;  2JZY A;  4WXH A;  1IN6 A;  3TKY A;  1OYI A;  4PZJ A;  1O3S A;  1ZH5 A;  1FNN A;  4F7Z A;  5L3E A;  2R7F A;  1J0R A;  4ZZD A;  2FBK A;  1FX7 A;  1KU3 A;  1Z9C A;  3WTU C;  1U78 A;  3V8J A;  4HX8 A;  5D6E A;  3ZN1 A;  2M8E A;  4EM1 A;  3K2Z A;  4HF0 A;  1XCB A;  1S7A A;  4XBF A;  3FXQ A;  4CXF A;  2IJL A;  3FMQ A;  5HLG A;  2V9V A;  2QQB A;  1G4D A;  3JSP A;  1T98 A;  2M1B A;  4FHT A;  1FLI A;  1WI9 A;  1DPR A;  5FGM A;  3KZY A;  3FM5 A;  3WE3 A;  4MQ9 F;  4CGZ A;  2K27 A;  3RYR A;  4Q5S F;  2ZXJ A;  3FF5 A;  1K78 B;  1FOK A;  4EGZ A;  1HSJ A;  2VN2 A;  4HX7 A;  3Q5F A;  4PDK A;  1P4A A;  5ILV A;  1TQI A;  4Q47 A;  3QAH A;  2ZME B;  5HDG A;  1SD7 A;  4I0A A;  4ESJ A;  3KFW X;  3L7W A;  1RZ4 A;  5LGT A;  5E17 F;  1XDU A;  2JRT A;  1FC3 A;  2DTR A;  4OIP F;  2ETH A;  3BWG A;  2OAZ A;  3GF2 A;  3HYI A;  1W7P D;  1AOY A;  3OV8 A;  2CFX A;  1R58 A;  3RTR A;  3HHG A;  3ZQ7 A;  5A2Q K;  1R7J A;  1WKM A;  3WTX C;  2L02 A;  1EV7 A;  1XDS A;  3RPU A;  2XAQ A;  1O7F A;  3JTH A;  5DCM A;  2OZ6 A;  3JAM K;  3IWF A;  3ECO A;  4L0Y B;  3PFI A;  2HYF A;  5ERI A;  5F1R A;  5D5V B;  1U5T B;  1W5S A;  2O0Y A;  3WE2 A;  2CW0 F;  4EJW A;  2Q8K A;  4K2E A;  4A12 A;  2ESH A;  4WCG A;  3SQN A;  4EM2 A;  4HF2 A;  3ZN0 A;  2L01 A;  5CVR A;  3G73 A;  1TW2 A;  3HRU A;  4EJO A;  3FXR A;  3V8K A;  2XAS A;  3CUQ C;  4XSZ F;  3ZMZ A;  2XIG A;  3HOT A;  3DP7 A;  3BPX A;  4DNC A;  2EV5 A;  2VC1 A;  2RQP A;  1O3R A;  1J5Y A;  4HDV A;  2LF8 A;  2V79 A;  1ZRD A;  1QZY A;  1MZB A;  3BY6 A;  2CQK A;  3U2R A;  3E6D A;  2MBF A;  3CTA A;  3F8C A;  4KFC A;  2NNY A;  1UB9 A;  1P6R A;  1ZGJ A;  4LD5 A;  4OIQ F;  3ZMU A;  1ONV A;  1LVA A;  4ZYH A;  5FB2 A;  3CUQ B;  1B6A A;  5DYM A;  4KDP A;  2XHK A;  1USS A;  1S7O A;  4XLN F;  3LA7 A;  1R1T A;  1QO0 D;  1ZRE A;  4BHP A;  3I59 A;  2DPU A;  4EQQ A;  1LDJ A;  1QBJ A;  4M9Z A;  2L4A A;  4GGG A;  2HS5 A;  3R4K A;  4LJZ F;  3F23 A;  1ZG3 A;  4U0Y A;  5CYV A;  4LG0 B;  1Z7U A;  2Z5U A;  3CUO A;  2RNJ A;  4G9Y A;  2D1V A;  1U3E M;  3SZP A;  1D3Y A;  2DW4 A;  4FX4 A;  1U5T A;  2NAZ A;  3D0S A;  2DK5 A;  2DQL A;  3KP3 A;  5AIQ A;  2VBW A;  1SD5 A;  3ZP5 A;  4AVP A;  1OYY A;  2A6E F;  1D8J A;  2A5Y B;  4CYD A;  1J9I A;  3IC7 A;  4P55 A;  5HDN A;  1W4M A;  4A5N A;  2QUF A;  2NYX A;  4YFN F;  4P5O A;  1STZ A;  4PCQ A;  3VOE A;  1LQ1 A;  2EFW A;  5L3F A;  1F9N A;  1W5T A;  3ELK A;  3G3Z A;  3GYH X;  4ENJ A;  4HF1 A;  5CVU A;  2P7C B;  3F3X A;  3MFK A;  3WTZ A;  4ZZL A;  2EV0 A;  4Q48 A;  2B0L A;  3T1B A;  1FYM A;  5DEQ A;  2JPC A;  2JSC A;  3LA3 A;  2OU2 A;  4BYY A;  2EJR A;  1U2W A;  1ON1 A;  3CO7 C;  3V7R A;  1J2X A;  1B9M A;  1SAX A;  4A2U A;  5H6R A;  1O57 A;  3KE2 A;  1XB4 A;  2LKP A;  3EYY A;  3LWF A;  2GWR A;  3SFZ A;  2XRN A;  2WC2 A;  4M73 A;  5DCM B;  3NEU A;  1UCR A;  4LLL A;  3DQV C;  3H3Z A;  4G94 A;  5ICF A;  4BQA A;  4RS8 A;  2PMH A;  4D0P A;  1YS7 A;  4BHB A;  1LJ9 A;  3CUQ A;  1K6O A;  1PUE E;  1J7K A;  1Z1D A;  3F72 A;  4IPA A;  2M87 A;  4AWX B;  2STT A;  3QRF F;  2K7L A;  4Y15 A;  5EEH A;  3CLO A;  2YU3 A;  1ZAO A;  1KQ8 A;  2KRF A;  5K5Q A;  5BPD A;  1RI7 A;  4EVI A;  4ESF A;  1Q1H A;  2G9W A;  3E97 A;  4ON0 A;  4R1H A;  4AIK A;  4CIC A;  4IJA A;  3MWM A;  1FBQ A;  3L9F A;  2A07 F;  5D8K B;  1K7A A; 
#chains in the Genus database with same CATH topology
 3EET A;  2BBY A;  2Q0O A;  3H9G A;  3OYB A;  1LFB A;  1UHM A;  3CCJ I;  4BXU A;  1IAW A;  3O8H A;  4Y17 A;  2HVR A;  5AON A;  5D8L B;  3S2D J;  2CGP A;  1Z3X A;  4U0W A;  3SZT A;  4M72 A;  3BPV A;  5TJJ A;  1YJN I;  4CCK A;  3CP2 A;  2DCE A;  5CVI A;  4BH9 A;  3IV5 A;  3BR3 A;  3MKW B;  2DJI A;  4AVZ A;  4CA0 A;  2M3A A;  3S17 J;  4E7L A;  1XPX A;  4HDU A;  3ONQ A;  2Z9O A;  1NH3 A;  3F8N A;  2PJR A;  3HOY J;  2TDX A;  2R3S A;  3HGY A;  1OCZ H;  2V1D A;  5KAF C;  1MBK A;  3V8L A;  2FRH A;  1R23 A;  2O8X A;  5IP7 J;  2C6Y A;  2TRT A;  3ABL H;  4MGR A;  1LNW A;  4I0B A;  4YII A;  1MD0 A;  1OR7 C;  5TGT A;  3L2V A;  4A3I J;  2CUE A;  2VL8 A;  4E7K A;  2IBD A;  1ODD A;  4RDU A;  4O3M A;  2KRH A;  1VQ5 I;  5HNF A;  2VQG A;  4CCO A;  4U7D A;  5H6Q A;  2HTJ A;  2PI0 A;  4MHG A;  2TCT A;  4HYE A;  1V5E A;  3BQZ A;  1KYW A;  4DYR A;  1EF4 A;  3JRD A;  1YX5 A;  1Z21 A;  1WJ5 A;  1YIT I;  4J00 A;  1TNT A;  4XRS A;  3HOZ J;  3KZZ A;  1WZ2 A;  3WTS C;  4OMY A;  1E3O C;  3K1N A;  2XGD A;  5M5W J;  3R0A A;  4YFX F;  5E8I A;  4DYC A;  1WJC A;  2FQ3 A;  3PM1 A;  1JXS A;  5HDK A;  2LNB A;  3CCL I;  3S3N A;  2X4H A;  3DTE A;  1PDN C;  1YI2 I;  4NQW B;  4ZJZ A;  4LIU A;  3W6K B;  2MC4 A;  3JR9 A;  2DOA A;  3M9A A;  3TO6 A;  4I2O A;  3F8B A;  2YX4 A;  3GUD A;  4E7H A;  4A3E J;  1IG7 A;  1YJW I;  1XMX A;  1BBY A;  4EAT A;  1IXR C;  4PSW A;  5JI6 A;  1FZP B;  2LDU A;  3S3M A;  3KCC A;  4L9N A;  1FIA A;  4F92 B;  3HC7 A;  4B8X A;  1X1B A;  2X51 A;  2Y69 H;  3W2W A;  1S72 I;  5D4S A;  2RGV A;  2ZJP F;  2PEX A;  1TWH J;  3F6O A;  3A01 B;  1HW2 A;  1HQC A;  3LQQ A;  1AWC A;  3QPT A;  1D5V A;  2QYO A;  3AFH A;  3K4N A;  3KP2 A;  4EEF G;  1N75 A;  2YUS A;  1H89 C;  2HPI A;  1R1U A;  2FOK A;  4L9T A;  2HNH A;  3GO5 A;  4LFU A;  3K70 C;  2WA0 A;  3S2H J;  3HDD A;  1YFH A;  3LQR A;  2IGO A;  4HPQ A;  3W6V A;  3LOC A;  5LHI A;  2VBY A;  5KK1 A;  4UVB A;  3FK6 A;  2M8G X;  2R7Q A;  1YX3 A;  1I5Z A;  4NB5 A;  2UWM A;  2Z3Y A;  2M7A A;  3T8T A;  3G6E I;  3OMY A;  3PO3 J;  2AQE A;  1FOY A;  2BY2 A;  1Z6T A;  1R71 A;  3ESW B;  3S14 J;  2E5N A;  2F5D A;  1RNL A;  2CQQ A;  1ZRC A;  4PUS A;  1X1C A;  5D4R A;  2CJJ A;  2EIL H;  2KJB A;  3IRR A;  1HKT A;  3D5L A;  1S9H A;  2L9N A;  4RBO A;  2ADU A;  3B6C A;  1MBF A;  5EF6 A;  2JVH A;  3E5X A;  4WXC A;  2NRA C;  3HUG A;  4OIN F;  1ZLJ A;  1PUF B;  4IRG A;  1Z91 A;  3LFU A;  2M34 A;  2OBP A;  3LFK A;  5E1Z B;  2AQF A;  3AG4 H;  1MMS A;  1ITY A;  1RET A;  2OCE A;  3C3W A;  4R8H A;  4WF2 A;  5GPC A;  4BXX J;  4M3E A;  2PN6 A;  1TWC J;  3DEW A;  5LRS A;  2FE3 A;  2VLA A;  4XLH A;  2VJ4 A;  2WV1 A;  2IVM A;  3HIF A;  3HGG A;  4Y4R A;  3HOV J;  3BTI A;  4HRI A;  4HAM A;  3GFL A;  5C44 J;  1F43 A;  2DYR H;  2E1O A;  3N4M A;  2E1C A;  2Y0M A;  4YG2 F;  1IN5 A;  2KL4 A;  4CSW A;  3WU2 C;  2XPU A;  3QOD A;  4CYC A;  2EZK A;  5EJC A;  2KIQ A;  1G3Y A;  2AXT C;  1HLV A;  4FTH A;  1ZHF A;  3M1E A;  4NC6 A;  1ENH A;  2DOF A;  4D1Q A;  3BOQ A;  3KP5 A;  3KP6 A;  4DZP A;  2A3S A;  2CQX A;  4RAY A;  1F5T A;  3HOX J;  2QQA A;  1D8K A;  1QVT A;  2MSY A;  3CDH A;  3RPQ A;  5DM6 F;  3S2W A;  3JTG A;  2V4J C;  1QRY A;  1JKO C;  5FKN A;  3IL2 A;  5BPI A;  2GAU A;  4PGG A;  2XUB A;  5HS9 A;  4UB6 C;  5K5R A;  4S0H B;  4HNU A;  2DYS H;  3S1N J;  5TRD A;  3V7S A;  3KEY A;  3Q9V A;  5IOY A;  5ILS A;  2K4B A;  3S93 A;  3SEZ A;  1LPQ A;  4RAZ A;  4M9S A;  3BP8 A;  2ZC2 A;  2GA1 A;  5EGO A;  1V5G A;  2K02 A;  3M07 A;  2EB7 A;  2P7V B;  4MTE A;  4HNT A;  1BC7 C;  3P9C A;  2R0Q C;  1V4R A;  1YW9 A;  4JQF A;  1APL C;  3IUO A;  2Y9Z A;  1XSV A;  2Q1Z B;  5B5E C;  5IT9 K;  3KP4 A;  3PQK A;  2F4O B;  3OYM A;  1G3S A;  3FXL A;  4C2M J;  1T2K A;  4XLP F;  2QKM B;  3J80 K;  4A3K J;  4IHV A;  3QYB A;  4F55 A;  5FKL A;  1PP8 F;  3GTL J;  1E17 A;  2CV2 A;  2F4I A;  5IYD J;  3U9G A;  2W48 A;  4ZTF A;  4KN7 X;  3NAU A;  4KMU X;  3OIP A;  4LB6 B;  4NBQ A;  3WU0 A;  1V54 H;  5ICG A;  1M1E B;  4F91 B;  4XM3 A;  1TC3 C;  1IN7 A;  4PJM A;  1MDM B;  1GVJ A;  2WAQ N;  3W2V A;  1MMA A;  1TL8 A;  2ZFU A;  1SFU A;  5LGN A;  4I7H A;  4XL9 A;  2HKX A;  3K1M A;  1YO5 C;  4WX9 A;  2UXN A;  2XRO A;  2HKO A;  2VPR A;  2M45 A;  4M3F A;  1TQP A;  2VOD A;  3BZK A;  5E1X A;  1OFC X;  3RKQ A;  3T5X A;  3A0H C;  2EFO A;  4L18 B;  1WQ2 A;  4CO8 A;  1V3F A;  2HXI A;  2HPM A;  2L9S A;  3HPG A;  2JUG A;  1XD7 A;  4YEL A;  2JPB A;  1I39 A;  1AA7 A;  4BEH B;  2A68 F;  4A5M A;  5DV5 A;  2NVY J;  1O4X A;  3S1M J;  4KUM A;  5C4X J;  5FLX K;  2D5V A;  3DEE A;  4LK1 F;  4UXN A;  1SAU A;  3ZXS A;  1J75 A;  3U1D A;  5J8F A;  2WAE A;  3A4C A;  3E3V A;  3RKY A;  1R5I D;  1ZEL A;  1R5G A;  2OQG A;  1ZG1 A;  1AKH A;  1N77 A;  3FKJ A;  2E7W A;  3QPL A;  3ZPL A;  5JVG F;  5F64 A;  2CU7 A;  4M6V A;  1JJ6 C;  1S5L C;  1BJA A;  1LKX A;  4JOM A;  4BBS J;  2NXN B;  2Y30 A;  4Z2Y A;  3LA2 A;  1TWF J;  1KON A;  1MGT A;  2DI3 A;  2F6C A;  3LSH A;  4PSX A;  4WK8 F;  2I5U A;  1V55 H;  4NHJ A;  4L5E A;  1MBG A;  5FFZ A;  3LNQ A;  2XF6 A;  4EV0 A;  4B09 A;  1H88 C;  1K4S A;  1JKR C;  1FOX A;  4J01 A;  1IUY A;  3ULQ B;  5HLT A;  2RDP A;  2D2W A;  1E2X A;  2FU4 A;  2E5Z A;  3VB2 A;  4KIG A;  2M2E A;  2BW3 A;  3BCA A;  3J81 K;  3F9K A;  2GQQ A;  3GX4 X;  2MD5 A;  5HS8 A;  3FM3 A;  1FMV A;  2XPV A;  2LBF A;  2HVS A;  3Q0W A;  1JUP A;  4BBR J;  3ABK H;  3JRB A;  2DPD A;  4A3B J;  1UG2 A;  3VSK A;  3RJP A;  2L4M A;  3TO7 A;  2W4S A;  4F52 A;  4GYI A;  1P7I A;  3KX2 A;  4YFK F;  2MYS A;  3QP6 A;  3VSL A;  1O3Q A;  3HRS A;  2QEX I;  3DEU A;  2IAI A;  4ZDP A;  4ESB A;  1P4W A;  1EH8 A;  2B7E A;  1T08 B;  1X2M A;  1FYK A;  2XV4 S;  1RPW A;  4I01 A;  4XRM A;  4CCM A;  2F5E A;  1KU2 A;  1MW7 A;  3ZMT A;  3ECH A;  1W5C C;  4LMY A;  2KDO A;  3OYK A;  3GCM A;  3PSF A;  4BY7 J;  3V42 A;  4EGY A;  2HDW A;  3AG2 H;  2BXY A;  3H5A A;  2X48 A;  4WWC A;  3TQN A;  4LLG F;  2F5V A;  3T0Y A;  4KMF A;  2A6H F;  5IY5 H;  3QU6 A;  2JTV A;  3B02 A;  4AD9 A;  3G4S I;  1A35 A;  2P81 A;  3IHU A;  4GYG A;  1L0O C;  1ULY A;  2DMN A;  2HTS A;  4FE7 A;  4MFD A;  4A0Y A;  1SC7 A;  2VI6 A;  1Z0X A;  5BS6 A;  5M5Y J;  4KYW A;  4XQF A;  2Z2S B;  4BJ5 C;  4LG3 A;  1TWG J;  2ZME C;  3FHN A;  2KJC A;  3AG3 H;  5KNL A;  2OJE D;  2VT2 A;  2HDC A;  3OYG A;  2ZXW H;  3PIO F;  3B6A A;  4B47 A;  2Y2Z A;  5DUK A;  1FSH A;  1T0F A;  2FNA A;  3TBI A;  1OCC H;  3W3C A;  4B4C A;  2HQN A;  2VT3 A;  2ZSH B;  2CRG A;  2DMT A;  3PFY A;  3F21 A;  5E1W A;  3CJQ B;  3OYH A;  2UZK A;  1ACI A;  2KQR A;  2EPF A;  1JHH A;  5DM7 F;  2R7S A;  4P9F A;  2VBX A;  4L5J A;  4CZC A;  2L7F P;  2NNN A;  4MEY F;  5FD5 A;  1SFE A;  5C3E J;  2LC2 A;  1X3W B;  4IOC F;  2ISZ A;  4B48 A;  1S8N A;  1TTY A;  5JHU A;  3GTM J;  1IDZ A;  1U8B A;  3CMM A;  3IWZ A;  3RQI A;  4JX6 A;  2XPW A;  5K1Y A;  2ZFW A;  5F6F A;  2O61 A;  3DKW A;  2V6C A;  4A3J J;  2QSH X;  3IAS 2;  2HOA A;  4BE1 A;  1IUF A;  1HBX G;  1W36 C;  3ABT A;  3ERE D;  2QQ9 A;  2IS6 A;  2DLL A;  3R0J A;  1XSX A;  3L2U A;  2CSO A;  1DP3 A;  4D7N A;  2JMW A;  3ROU A;  1UFM A;  2WY8 Q;  4RB0 A;  1RIO H;  5L3B A;  3D1N I;  2B63 J;  4MTD A;  2X6Y A;  5KVR A;  1YLF A;  2GM4 A;  4G8X A;  5JFR A;  2LTP A;  3N97 A;  3CC7 I;  4E70 A;  5C4J J;  2NOG A;  4V2F A;  1U8R A;  1W7P A;  4PFO A;  5JLX A;  3HB9 A;  5J8C A;  2NVX J;  4G7O F;  1P7J A;  1GVD A;  4C9Y A;  2DBB A;  3KZI C;  2ZO4 A;  2FQ4 A;  2PFB A;  1OCO H;  2JT1 A;  1BW5 A;  2H09 A;  1UHS A;  2BYV E;  3FIW A;  2H6C A;  4ENM A;  4GCV A;  3CDL A;  2JJ7 A;  3SXY A;  2LSO A;  3G2B A;  3OR2 C;  4GRI A;  3BDD A;  3FMS A;  2XAJ A;  1KZH A;  3WOD F;  2M0C A;  2A05 A;  2VON A;  2PQ8 A;  3G1M A;  2IT0 A;  3JRH A;  5A2Q Z;  3I56 I;  2ECC A;  1QHG A;  2E71 A;  3DFG A;  2OTL I;  2X1D A;  4BQO A;  4M6X A;  3EYI A;  4BJT A;  2K4J A;  1EH6 A;  1MJA A;  2KHM A;  3K2A A;  2LKX A;  3HSE A;  4ZYE A;  1Z67 A;  3WG7 H;  5L3C A;  1GDT A;  2XDV A;  1IW7 F;  3I4N J;  1RKT A;  3ML6 A;  3PUF A;  4RMN A;  3JRI A;  4G6D A;  1J59 A;  2KIS A;  4Y33 A;  5D6F A;  5M5X J;  1QPM A;  1XGO A;  3ZQH A;  1H9G A;  1FTZ A;  4HA8 A;  3CQZ J;  1BIA A;  2ZB9 A;  2MLG A;  4PJ0 C;  5LD2 C;  1KU7 A;  2RKH A;  4MIM A;  1D1B A;  1JT6 A;  2V26 A;  2KFD A;  5E8G A;  1A04 A;  2FBH A;  3GXO A;  2H27 A;  1B1B A;  1G6N A;  2WAD A;  2GIZ A;  3P9I A;  1CGP A;  1TZL A;  2Y75 A;  1K78 A;  1A6Q A;  5DUI A;  5JVT A;  3DPL C;  3O6B B;  2KPM A;  4QPQ A;  2W24 A;  5F1J A;  1H8A C;  1FBS A;  3ZMD A;  2A6T A;  1X3U A;  5CJ9 A;  2P0W A;  3EPZ A;  2KKO A;  5CQE A;  1S29 A;  2HQR A;  2VKV A;  1I27 A;  3HUG B;  1PUF A;  1N78 A;  5EZG A;  4XRS G;  1HC8 A;  1F4K A;  2M30 A;  2P8T A;  1WJF A;  2Z16 A;  2XC7 A;  2O3F A;  3W6J B;  2J5O A;  2FSW A;  4JYK A;  5CVJ A;  5F04 A;  5DS9 A;  1ZG5 A;  2E7X A;  2L7Z A;  3P9K A;  2EFP A;  2EIK H;  3TDU C;  2ZXI A;  1NTC A;  4KT5 C;  1UHW A;  3BJO A;  1OMI A;  2O7O A;  5FJ8 J;  2ZSI B;  3E1S A;  2ID3 A;  3NWT A;  5FD6 A;  1XTA A;  2PJR B;  3C2G A;  2OUM A;  3ZQQ A;  2R92 J;  2DFH A;  4BGD A;  2M7B A;  3TDZ C;  1MJB A;  1EJ9 A;  3F6V A;  1ERD A;  1IO2 A;  4BEH A;  2MLK A;  3HZJ A;  2H1K A;  4CHU A;  3K70 D;  2Y48 A;  2E1M B;  2V1X A;  4PK4 A;  4A93 J;  1QVU A;  3DKX A;  2AHQ A;  2K9Q A;  3SDB A;  4QLC U;  5LHH A;  4BDZ A;  5H20 A;  4II3 A;  1PP7 U;  5J6X A;  1YW7 A;  2HEO A;  2R5Z A;  1LFP A;  2V1U A;  4BUP A;  2W82 A;  4DBQ A;  3EQL F;  3L09 A;  3LL7 A;  2ACJ A;  3KET A;  4AYB N;  2ELH A;  4N4N B;  2WWY A;  2R5Y A;  2FOW A;  1R6R A;  3FDY A;  2RRE A;  2QLZ A;  2DA1 A;  1FOW A;  2F5F A;  2OA4 A;  4F3Q A;  2MH9 A;  5J4Y A;  2RVC A;  1IC8 A;  2HOS A;  4B1R A;  1E3P A;  2KIM A;  1ZTR A;  1H9T A;  2XAU A;  5IYB J;  3LSJ A;  1VQL I;  5D5W B;  1P4X A;  2DK8 A;  5B1A H;  3I59 B;  2LG4 A;  3NAR A;  1YW8 A;  3C7J A;  3MCZ A;  2DAO A;  2KIF A;  1HXD A;  4M71 A;  2DQR A;  3J80 Z;  2PLY A;  2BY3 A;  2VOO A;  1R36 A;  3CC2 I;  2CW8 A;  1LEB A;  1FY7 A;  2WV0 A;  1JUS A;  3DBH B;  3J7Z I;  3BT9 A;  3OSG A;  3TP0 A;  4YIF A;  2BHY A;  3BTJ A;  5FKO A;  5GPA A;  2FUG 2;  1W7P B;  3OSF A;  1VQ9 I;  2HZT A;  4LGW A;  4N9I A;  2ISY A;  3CJT B;  3WG9 A;  3LSI A;  5E79 C;  2H6B A;  3RPU D;  5K7H A;  3EUH C;  1LDK B;  4AIH A;  2E2I J;  4JK1 X;  2VC0 A;  3MZH A;  1A36 A;  1TBX A;  2BVL A;  1LVK A;  2ME0 A;  1R4M B;  2BOL A;  2E2H J;  5AIP A;  4DW6 A;  1UEL B;  2HGC A;  1BI3 A;  1QZZ A;  1XMK A;  1G3T A;  2CUZ A;  2EWN A;  4P96 A;  5FRM A;  3UKG A;  4E6K G;  1B72 A;  1R22 A;  3NQO A;  2V1N A;  5GTH C;  3GZ5 A;  1N25 A;  4FET A;  1BIB A;  3HRM A;  2DT7 B;  3J81 Z;  1A6I A;  2EA2 A;  3E0J B;  3E6M A;  4XON A;  3DLA A;  3K4L A;  3CCE I;  3BJA A;  2EFN A;  2IEK A;  3DCF A;  4EMS A;  3HJE A;  1LEA A;  5J40 A;  1DGW Y;  5EG0 B;  2KDZ A;  2LR8 A;  5DD8 A;  3V4G A;  2K3F A;  1Z6R A;  4A3L J;  1YTY A;  3VEP A;  3BTL A;  2R5Z B;  5FFX A;  2X1C A;  1QA6 A;  1MKM A;  2CV1 A;  2HQA A;  5J47 A;  5FRN A;  3LST A;  1CF7 B;  3FBN B;  3M7G A;  3BG7 A;  4XKC A;  2RC4 A;  2JA2 A;  2PMU A;  1P92 A;  3HTU A;  4XSX F;  2EFQ A;  3IRQ A;  1DP7 P;  5HVQ C;  4PJL A;  2QF7 A;  1Y56 A;  2RNG A;  3FIS A;  3R6S A;  3GTP J;  2UV1 A;  3BRO A;  3OS1 A;  1B8I A;  2JK3 A;  2E60 A;  1UST A;  4IVN A;  3VPR A;  1GV2 A;  3GVA A;  3K4M A;  3N05 A;  3TOA A;  1IZ1 A;  2W84 A;  1PJR A;  3ZOB A;  4R79 A;  4AYB A;  4LLN A;  2OD5 A;  3NWS A;  2QCO A;  3MZY A;  5K7Z A;  2VOP A;  2WB1 N;  2EZL A;  1HKS A;  3RZO J;  4AC0 A;  4FT8 A;  3K6G A;  1I6H J;  2ZBK A;  1AHD P;  2MH2 A;  2WY7 Q;  2HR3 A;  2ESN A;  1VQ6 I;  4BQQ A;  3WTW C;  2EZH A;  2VKH A;  5FLM J;  4IKF A;  3M8J A;  2DU9 A;  9ANT A;  2HYG D;  3H9J A;  1GXQ A;  2XB5 A;  1AKH B;  1O7L A;  3GFM A;  5D5X B;  2LY2 A;  2FJ1 A;  1VZ0 A;  3GBG A;  3GLX A;  5LLQ A;  2V7F A;  4IRH A;  1RUO A;  2KLO A;  2Y0S A;  3LMM A;  2RAE A;  2I8D A;  4QTR A;  2EIJ H;  1WHU A;  3MMY B;  1I3Q J;  2EQR A;  1T39 A;  2DXI A;  1IGN A;  3OWT A;  4H0E A;  3KEO A;  5L3G A;  3HG9 A;  3BG6 A;  3OS0 A;  1Z7L A;  4S05 A;  3KEQ A;  1U5T C;  2XF7 A;  3SHF A;  2I10 A;  4C3I J;  1JGG A;  2QBY B;  3DF8 A;  5EYR A;  2JUC A;  3FK7 A;  1VQO I;  1XC5 A;  2BW3 B;  2DT6 A;  2NS7 A;  1IN8 A;  4LOC A;  2IS1 A;  4M3B A;  3ABU A;  2IXS A;  1R00 A;  3ZMV A;  1JKQ C;  1NG6 A;  3QPS A;  1SMT A;  2DT5 A;  4IX7 A;  3VYU B;  1MDM A;  2AXL A;  2P6S A;  1RUN A;  2STW A;  3ZQF A;  1ZR4 A;  2XGE A;  2JWT A;  3ZQG A;  1MNE A;  1SVL A;  1IDY A;  4FX0 A;  1U6G A;  1IV6 A;  5F08 A;  3EDP A;  2ICW G;  1POG A;  3CDI A;  3VFZ A;  3HKZ A;  2GZW A;  3TOB A;  4C2U A;  4UNO A;  5IYC J;  3GEZ A;  3HRT A;  2G7U A;  4ZYA A;  1U0J A;  1REP C;  1HST A;  4BE0 A;  3K69 A;  2DA5 A;  2Q2E A;  4MQV A;  1SD4 A;  2XKO A;  3GFI A;  2DO7 A;  4OMZ A;  1MBJ A;  3OIQ A;  4MNU A;  2NVQ J;  4ETS A;  1QQI A;  3FXK A;  4CCN A;  2F48 A;  1KQ9 A;  3I71 A;  5FLX Z;  1ETY A;  1UMQ A;  3O3K A;  2AO9 A;  2P6T A;  2Q2E B;  2ZJ2 A;  5K5O A;  2XAG A;  4EJV A;  2LFB A;  1IF1 A;  1ZQ3 P;  3S1Q J;  1FYL A;  4M9X A;  4QWQ A;  4I6Z A;  1XGN A;  4CDG A;  1WJE A;  2VB6 A;  4ZDO A;  3QQA A;  1UZC A;  3J7A O;  5J3L A;  1FT9 A;  4KIB A;  2K9M A;  1D0X A;  3TW6 A;  3GZ6 A;  1FP1 D;  5FO5 A;  2GOX B;  5HLH A;  1GUU A;  1FPQ A;  2X6O A;  1RR8 C;  2ME6 A;  1IRX A;  1R1V A;  3K4J A;  1T33 A;  4RGU A;  3RCO A;  4BAY A;  1HOM A;  1OCT C;  4U0V A;  4Z6Y A;  2YX7 A;  4XLE A;  2N8G A;  3RZD J;  4IRI A;  1B4A A;  1JE8 A;  5FKK A;  2CG4 A;  1I1G A;  2R4G A;  2O03 A;  4NC7 A;  2UXX A;  2L7M P;  1WWX A;  3TL4 X;  3AAF A;  3IP4 B;  3ZR8 X;  4CYC B;  2JN6 A;  4XNF A;  1OPC A;  2QGU A;  2Y0S N;  4CCJ A;  1GLN A;  3SJM A;  5M3M J;  1BJZ A;  1BR1 A;  3CCU I;  2DA3 A;  4U87 A;  1T38 A;  1IXC A;  3G71 I;  1D0Z A;  1WVR A;  1K61 A;  4L0Z B;  2QA4 I;  2LD5 A;  5LBQ A;  1G3W A;  5LHG A;  2OZU A;  3RSN A;  1MBH A;  2R7O A;  1IXS B;  2VQC A;  4P1W A;  3I53 A;  2RQQ A;  4UUS B;  1L3L A;  1XSD A;  3HSR A;  2QSG X;  5CQG A;  4XKV A;  1WCM J;  1VI0 A;  1Y6I A;  2FF4 A;  2L0K A;  1GHC A;  2KIU A;  2FBI A;  3K4B A;  1GV5 A;  4OAY A;  2MC3 A;  2QBY A;  3C18 A;  3GW2 A;  3I58 A;  4HNV A;  5H2F C;  4EJT A;  4V19 K;  1B72 B;  3VYT B;  2HFH A;  2IP2 A;  3LSR A;  2X9D A;  1BI2 A;  2LMD A;  4LIT A;  1DUX C;  3CC4 I;  2NS0 A;  5D5U B;  1XX5 A;  4A3M J;  4XKW A;  2GXA A;  2UUZ A;  4G6Q A;  4C3J J;  1R5H A;  2A5W A;  1C0W A;  3A2K A;  4I99 C;  3GWZ A;  4Y52 J;  1X3Z B;  1WRJ A;  2XVC A;  3FX3 A;  4IXA A;  4XLC A;  2YS9 A;  3MQ0 A;  1O3T A;  2EBI A;  2VIX A;  4RB2 C;  4ZYD A;  2CO5 A;  2E36 A;  3JW4 A;  2X0L A;  4A69 C;  1VQK I;  1OYW A;  3IH2 A;  2BEO A;  2CQ7 A;  4QSH A;  2P5L C;  2LF7 A;  2BV6 A;  4A0Z A;  5B1B H;  3CME I;  5K7F A;  3FMR A;  3C1D A;  4HQE A;  1FEX A;  3DPT A;  4ASN A;  3W2A A;  1BI0 A;  4Y3O A;  2VKD A;  1ZK8 A;  3VOD A;  3NRV A;  4RAF A;  2IS2 A;  2Z33 A;  3RQ4 A;  2CWE A;  3GFJ A;  1TW3 A;  4V2G A;  1MNM C;  3FXO A;  3FKI J;  3JCU C;  3KLN A;  3B73 A;  1NHA A;  3O2P E;  2R5Y B;  1BI1 A;  2XGX A;  5GAD J;  1MSE C;  2JQ7 A;  5CKT A;  4NQW A;  4AIJ A;  1HDP A;  4MO7 A;  5F0C A;  3ZQL A;  2NVU B;  1LDD A;  5JHF A;  3OYJ A;  1MSF C;  2DFE A;  2COB A;  5LEK A;  4W1U A;  5ICE A;  4ENK A;  4AID A;  2EIN H;  1UG0 A;  3SEQ A;  2XSD C;  3GTJ J;  3H0D A;  3DLL F;  3A0B C;  5KHD A;  4HLX A;  4HLY A;  2BGC A;  4LG0 A;  5IP9 J;  2COM A;  4E7J A;  3I64 A;  1OKR A;  2VE8 A;  2QM3 A;  3H0G J;  3PIP F;  1K6Y A;  3IKT A;  4KNY A;  2HYJ A;  2FEZ A;  3RKX A;  2KRC A;  4G7H F;  1LE8 A;  3OL4 A;  5BNG A;  4M3D A;  5CLS A;  3HXL A;  2VAS A;  2W7N A;  3M1C A;  3QU3 A;  5DDG A;  5TIS C;  2KMU A;  1FTT A;  3QOE A;  4N9H A;  2GIV A;  4ENN A;  1SFK A;  2D1H A;  3AG1 H;  3DXJ F;  1WPK A;  2IA0 A;  3AL0 C;  2L54 A;  3F8F A;  3K7A J;  1MMN A;  4BHC A;  4MEX F;  5ED4 A;  2HWV A;  4OU0 A;  2ZXH A;  1ON2 A;  5KAI C;  1S3J A;  4HOB A;  3GTG J;  1VQ4 I;  1ETX A;  2HXO A;  3Q9S A;  1R49 A;  1X1A A;  5DD4 A;  1J09 A;  4I98 B;  4XOR A;  4N4O B;  5ILU A;  2PBI A;  2PJP A;  1QNT A;  1BR2 A;  3HOS A;  2EIM H;  3I5U A;  6PAX A;  2E34 A;  2W25 A;  3WGH A;  1H0M A;  1MBE A;  4GXO A;  5GAH J;  1XGS A;  2IPQ X;  3E5U A;  1TNS A;  3LSG A;  4FE4 A;  2QVO A;  1DQU A;  3FHZ A;  3EUK L;  2X6X A;  5L3D A;  3A02 A;  3R61 A;  2PX9 A;  3K9T A;  3Q0U A;  3L00 A;  3UR3 C;  4BE2 A;  1U9N A;  4UVC A;  2YPR A;  2DA2 A;  4RB1 A;  2H94 A;  4GO1 A;  1JT0 A;  3CD6 I;  4A6E A;  3LAP A;  4XN0 A;  3ABM H;  2E1M C;  2FML A;  4HEA 2;  5EDN A;  5EGO B;  1BM9 A;  1JUM A;  2KP6 A;  2CUF A;  3IH3 A;  1EA3 A;  4HV5 A;  4A3G J;  2P5K A;  4DBR A;  1IN4 A;  2HQ5 A;  4BXF A;  1T95 A;  1FBU A;  5HS7 A;  2VQL A;  2FNP A;  1F36 A;  4RGR A;  3DPU A;  4UV8 A;  1YHQ I;  4M74 A;  3BQY A;  4O6J A;  1SFO J;  2MA3 A;  2O5R A;  3H1C A;  2CW7 A;  3EUH A;  5LGU A;  5FRO A;  4Q4Z F;  1ZRF A;  5BOX A;  3BZC A;  4I02 A;  1D5Y A;  2FXA A;  2W00 A;  3TO9 A;  4ZC3 A;  3OYE A;  1I50 J;  5E20 A;  3DWL E;  2R7R A;  2XKP A;  1JHF A;  2IA2 A;  3PNV A;  1LE8 B;  5IT9 Z;  2EK5 A;  2ZNY A;  3H9Q A;  1IRG A;  2WTE A;  1SVM A;  1KGS A;  1WH5 A;  3ZRG A;  2QWW A;  2OTJ I;  3F8M A;  2GBY A;  3JRE A;  1X58 A;  2A61 A;  1TQM A;  2ZCW A;  4RLF A;  1K83 J;  2MD0 A;  3REO A;  1BOA A;  3FBI B;  4JBA A;  3UNG C;  4CZZ A;  4BNC A;  3L2C A;  1XGM A;  5IT3 A;  1NK3 P;  2HDD A;  2AS5 F;  4TV7 A;  2X85 A;  1ETQ A;  5HOO A;  3A01 A;  3K1P A;  4KN4 X;  1Z77 A;  1ZN2 A;  1ZAR A;  2RV8 A;  4L5I A;  3ZMS A;  4YRV A;  3MKZ A;  1BC8 C;  1IJW C;  1BOB A;  3M3Y J;  2ZNZ A;  1KYZ A;  1Y0U A;  4BU2 A;  4HV6 A;  2E1N A;  3WTY C;  2IA1 A;  2QSF X;  2BY0 A;  2VJI A;  1YS6 A;  3KPH A;  3BJ6 A;  2M5W A;  3HSF A;  2XAF A;  1GT0 C;  1JGS A;  4RM2 A;  2HVQ A;  3CCS I;  4HW0 A;  2HZD A;  3K0L A;  1DDN A;  4NUB A;  2K9N A;  3F22 A;  1D1C A;  4U7B A;  3WU1 B;  1P9Q C;  1OCR H;  3ASN H;  1S6L A;  4WXD A;  3M8F A;  1X1D A;  4HSR A;  2MG4 A;  4OIO F;  5CVV A;  4IL6 C;  3D5S C;  1ZKG A;  2EA4 A;  3COA C;  1K79 A;  4B3X A;  2GXB A;  1OR7 A;  1BN5 A;  1PVE A;  5LRR A;  4E7S A;  1TP4 A;  4YEJ A;  1FWZ A;  3SFI A;  2G7H A;  1FSE A;  2L7K A;  2CYY A;  1TWA J;  1I6X A;  2FMY A;  3KYD B;  3C2B A;  4OIR F;  2KT0 A;  4HBL A;  5GAE J;  2OQR A;  5JR3 A;  3FZV A;  2LOO A;  5E3N A;  1E0E A;  3JRG A;  2EV6 A;  2LKS A;  5HNH A;  1VTN C;  5M3F J;  4AUX A;  2DMU A;  2VBZ A;  1HA8 A;  1T0F C;  5GP9 A;  3Q0V A;  5J1U A;  5DTD A;  5HLI A;  3ZQI A;  1GXP A;  2K5C A;  3WHB A;  4A0X A;  4RM3 A;  4XKB A;  3RI4 A;  3GTK J;  4M6Y A;  1MMG A;  3CF5 F;  1KQ0 A;  1K4T A;  1KU9 A;  2ZKZ A;  4RB3 C;  3EUA A;  4A3C J;  3E6C C;  3M8E A;  3ZGK A;  2GXG A;  1V5F A;  1XS9 A;  3WGG A;  3MEX A;  1B9N A;  3RIR A;  2KZV A;  2DFF A;  1I1S A;  1B8I B;  3TGN A;  1Y8Q B;  2PMZ N;  3GTO J;  3PO2 J;  1FMW A;  3QPH A;  3CO6 C;  1WSU A;  2CFO A;  1SMY F;  1ZYR F;  4BJ6 C;  2L3D A;  1U9O A;  4HQM A;  5B66 C;  2PG4 A;  3P7N A;  3DU6 A;  3E5Q A;  3BZ6 A;  3MKL A;  1MJ9 A;  3CES A;  4ITV A;  3DTK A;  2Y31 A;  4A3F J;  1ZGW A;  4JX5 A;  3OL3 A;  4IHS A;  4Y13 A;  1ETW A;  3KP7 A;  1ORK A;  3WGI A;  2D45 A;  4XLA A;  3WTV C;  2XB0 X;  4D9J A;  2K86 A;  4FCY A;  1X2N A;  1BW6 A;  3H92 A;  4XN3 A;  4LB5 A;  3V7C A;  4IO9 F;  3ISP A;  3JRC A;  3ZCO A;  2P5V A;  1EKE A;  5IPA A;  4D5F A;  1YQA A;  3BG5 A;  4U88 A;  5CPR B;  1W1W E;  3I0T A;  3OYL A;  1G8X A;  5KCM A;  2XGC A;  4BDY A;  4UVA A;  1JKP C;  1TLH B;  1SD6 A;  1CQT A;  4ZYG A;  2QEN A;  3QWL A;  2R7W A;  4KIT B;  1FP2 A;  2VJ5 A;  3QP5 A;  2FD5 A;  4E7Z A;  2IRF G;  2QZ8 A;  4X1E A;  2PMZ A;  3K4C A;  2F4M B;  3PJR A;  2H1L A;  5IOZ A;  5LEJ A;  3RKW A;  3H3V K;  2ZJR F;  4UUV A;  2DMP A;  4FIS A;  3DBR B;  1DPU A;  3KLO A;  1YG2 A;  4M3G A;  4XRF A;  4QIW N;  3D5R C;  4KIF A;  3KIO A;  4GFB A;  1JTX A;  4UHT A;  2BE5 F;  1F1Z A;  5ICC A;  4E7I A;  2P4W A;  5BQT A;  1YYV A;  4EM0 B;  2GA2 A;  2LY1 A;  3TED A;  1KA8 A;  4G12 A;  1B59 A;  2Z1D A;  2R7D A;  2J5P A;  1A5J A;  3M4O J;  4KIS A;  3HTS B;  1Z3Y A;  3IKV A;  1P2F A;  1SFX A;  4DQ2 A;  2VXZ A;  2NS8 A;  1MND A;  2RN7 A;  2Z99 A;  2VE9 A;  1FJL A;  2XF5 A;  4MLO A;  4O5V A;  2IGM A;  3WTT C;  3BG3 A;  2F5C A;  2R7Z J;  4G7Z F;  3S3O A;  1HW1 A;  3I4M J;  5BMZ A;  3FWE A;  2LRD A;  3HHH A;  1ZLK A;  3E6B A;  2WB1 A;  4UY8 I;  4XIC A;  3JAM Z;  1E3H A;  1QU3 A;  3SYT A;  4P9U A;  2H8R A;  2L5Q A;  4RGS A;  3OOP A;  4A6D A;  2JA6 J;  2VQH A;  4IF4 A;  1XCV A;  3CF2 A;  3I4P A;  1CF7 A;  3PQJ A;  4DGW B;  3GTQ J;  2W57 A;  3ERM A;  4L9J A;  3H3U A;  2R93 J;  2VKE A;  2F2E A;  3P5J A;  2OCC H;  2ZME A;  3I54 A;  2W85 A;  4Y7N J;  1ZGA A;  3DV8 A;  2FA5 A;  4J19 A;  3I55 I;  3BR0 A;  2JVG A;  3FXU A;  1Y0N A;  4IHT A;  1T6S A;  4OOI A;  2K3P A;  2HU9 A;  1XN7 A;  4UV9 A;  5EEA A;  3JSO A;  4S04 A;  4N0B A;  3R60 A;  1XMA A;  4F93 B;  3QOP A;  2JA5 J;  2A69 F;  4GDF A;  3H5R A;  2IS4 A;  3CP8 A;  2LRE A;  1SEU A;  1IV8 A;  2HOE A;  2VXD A;  2YR2 A;  1YIO A;  2K9L A;  4L9V A;  1WFX A;  1W0U A;  4B3A A;  2E2J J;  3LSM A;  4XR6 A;  1Z05 A;  1X19 A;  3RDI A;  2ELK A;  2CH0 A;  4RGX A;  2K85 A;  2XAH A;  2OF7 A;  3MAJ A;  2DDB A;  3S16 J;  4KA4 A;  3J7A Y;  5JLW A;  4PGH A;  1YRN A;  1QGP A;  1HW5 A;  3HL2 A;  2LH9 A;  2G0E A;  2OV7 A;  2DFI A;  2IW5 A;  2LLK A;  4EJU A;  3MN2 A;  1VFC A;  1LB2 A;  1QHH D;  4HG2 A;  3HKZ N;  2X6W A;  3HOU J;  3RYP A;  1D1A A;  2HI3 A;  4I09 A;  1HKQ A;  2YSR A;  4AU7 A;  2Y9Y A;  4ZH4 F;  4KIC A;  3L1P A;  3BCB A;  1IRF A;  5DCF A;  1VQN I;  2BZT A;  1EH7 A;  3T8R A;  2O6G E;  4HZF A;  1YE9 A;  3PSI A;  2BY1 A;  2L2O A;  5EEG A;  5GTI C;  4HX4 A;  4PFP A;  5E18 F;  4LK0 F;  4RLQ A;  3CJN A;  3LAJ A;  3BR6 A;  2JZY A;  4WXH A;  1IN6 A;  3TKY A;  1OYI A;  1MMD A;  1DU6 A;  2EH3 A;  3CJR B;  4PZJ A;  1O3S A;  2V9P A;  3BLY A;  1ZH5 A;  1FNN A;  4F7Z A;  4DJA A;  2DA6 A;  5L3E A;  3JRF A;  4BKX A;  2R7F A;  1NG7 A;  4XK4 A;  1J0R A;  4ZZD A;  4BAC A;  3O8G A;  4OAZ A;  2VPL A;  4UB8 C;  3S8P A;  1Y8R B;  1FX7 A;  1KU3 A;  2FBK A;  1Z9C A;  4DIQ A;  1WJB A;  3WTU C;  1U78 A;  3V8J A;  1JI8 A;  4HX8 A;  5D6E A;  3ZN1 A;  2M8E A;  4EM1 A;  1LFU P;  3K2Z A;  4HF0 A;  2V6E A;  1XCB A;  5LFA A;  2EZI A;  4DYQ A;  4IHY A;  2CS3 A;  1S7A A;  4XBF A;  3FXQ A;  1HDD C;  4CXF A;  1I3A A;  1ETV A;  2BVM A;  2IJL A;  3FXM A;  3FMQ A;  5HLG A;  2V9V A;  3I9V 2;  1W36 D;  4X0G A;  2M4G A;  4E4H A;  2QQB A;  3C2H A;  1G4D A;  2E19 A;  3JSP A;  1T98 A;  2BXZ A;  2M1B A;  4BQN A;  4IZZ A;  1G2H A;  4H4K C;  3L2Q A;  4FHT A;  1FLI A;  1WI9 A;  1DPR A;  4OWR B;  5FGM A;  4XID A;  2VUM J;  3L2W A;  3KZY A;  3FM5 A;  3WE3 A;  4MQ9 F;  2K27 A;  4HST A;  4CGZ A;  2DMQ A;  2LVS A;  4RAG A;  5GAG J;  2V9K A;  3RYR A;  3U1K A;  4Q5S F;  3BTC A;  2IGK A;  2ZXJ A;  1WH7 A;  1RES A;  3FF5 A;  1K78 B;  1FOK A;  4EGZ A;  1VQP I;  3AL0 B;  4D7M A;  1HSJ A;  2VN2 A;  4HX7 A;  3Q5F A;  4PDK A;  1P4A A;  2WAF A;  5ILV A;  2QKL B;  1TQI A;  4Q47 A;  3K10 A;  5F0F A;  3OYD A;  3QAH A;  2LY9 A;  2ZME B;  5HDG A;  1SD7 A;  4I0A A;  4ESJ A;  3KFW X;  4IQ4 A;  3DTI A;  3L7W A;  1RZ4 A;  2K9S A;  3PNY A;  4IEJ A;  5LGT A;  5E17 F;  2LBF B;  1XDU A;  2JRT A;  1Y1W J;  1FC3 A;  2DTR A;  2NOJ B;  4MFE A;  5EG0 A;  4OIP F;  2ETH A;  3BWG A;  2OAZ A;  3GF2 A;  3HYI A;  3S15 J;  1W7P D;  5FLV A;  1AOY A;  3OV8 A;  2CFX A;  1R58 A;  3RTR A;  3CZ6 A;  3HHG A;  3MZ8 A;  1WJA A;  2IGN A;  3CCQ I;  2FX0 A;  3ZQ7 A;  2DA7 A;  5A2Q K;  1R7J A;  4PJJ A;  3CLQ A;  1WKM A;  3WTX C;  1G59 A;  2L02 A;  3GME A;  1EV7 A;  1YIJ I;  1XDS A;  3RPU A;  1A31 A;  2XAQ A;  2DA4 A;  3CCY A;  3S1R J;  3OYA A;  1VQ8 I;  1O7F A;  3JTH A;  5DCM A;  2OZ6 A;  3AKZ A;  4KT6 A;  4II2 A;  3JAM K;  3HPH A;  3IWF A;  3KYL A;  3ECO A;  5J1R A;  4L0Y B;  2OC6 A;  2DDA A;  3PFI A;  2HYF A;  5ERI A;  5F1R A;  5HOD A;  5D5V B;  1U5T B;  1W5S A;  3VWB A;  2O0Y A;  1S7E A;  2CW0 F;  3WE2 A;  4EJW A;  2Q8K A;  2R7T A;  2JSP A;  4K2E A;  1T56 A;  4A12 A;  2ESH A;  4WCG A;  2E35 A;  3SQN A;  4EM2 A;  1R9T J;  5J1Y A;  4HF2 A;  3ZN0 A;  3LSP A;  1WGX A;  2L01 A;  2WBM A;  1ETO A;  2OPT A;  5CVR A;  3G73 A;  1TW2 A;  1DGR M;  2M9H A;  3HRU A;  5FKM A;  4LIV A;  4EJO A;  4B44 A;  3FXR A;  3V8K A;  2XAS A;  3CUQ C;  4PJN A;  1OCP A;  4XSZ F;  3ZMZ A;  2XIG A;  3A1Y A;  1OLT A;  3HOT A;  2DJN A;  3DP7 A;  3BPX A;  2MFZ A;  4DNC A;  1UAA A;  3BC8 A;  1SAN A;  2EV5 A;  2VC1 A;  2DN0 A;  2RQP A;  4XLF A;  3IH4 A;  1O3R A;  1J5Y A;  4HDV A;  2LF8 A;  2V79 A;  1ZRD A;  1QZY A;  4XOP A;  4FAS D;  1MZB A;  3BY6 A;  2LK2 A;  1MIJ A;  4CH7 A;  4BY1 J;  2KZG A;  1BL0 A;  2CQK A;  3BG9 A;  3U2R A;  3E6D A;  4A3D J;  3I3L A;  2MBF A;  3CTA A;  3F8C A;  3IAM 2;  2X1E A;  2R7X A;  4KFC A;  2NNY A;  1QPI A;  1WI3 A;  4JP0 A;  4IOA F;  3X2Q H;  1UB9 A;  1OQY A;  1P6R A;  1ZGJ A;  4LD5 A;  3FXJ A;  4OIQ F;  3ZMU A;  1ONV A;  2K40 A;  1LVA A;  3PNT A;  4XMY A;  4ZYH A;  4DOZ A;  3SDG A;  3TMO A;  3U21 A;  5FB2 A;  3CUQ B;  1B6A A;  3Q3S A;  5DYM A;  3CCR I;  2B9S A;  2MW8 A;  4KDP A;  2NVT J;  1YRN B;  1OJL A;  2XHK A;  3H35 A;  3KYC B;  5J4V A;  3VYS B;  3VYR B;  3OYN A;  2M4K A;  1USS A;  1S7O A;  3DKY A;  4BS9 A;  1JJ8 C;  4CCL A;  1DU0 A;  4XLN F;  4X6A J;  3LA7 A;  3DBL B;  1R1T A;  1QO0 D;  1ZRE A;  1IRZ A;  3BR1 A;  1X4O A;  4BHP A;  3I59 A;  4CUG A;  2DPU A;  3JRA A;  3HBL A;  4EQQ A;  1LDJ A;  1VQM I;  1QBJ A;  3GLL A;  4M9Z A;  2HOT A;  4IQJ A;  2L4A A;  3TW7 A;  4ANJ A;  3CCM I;  4GGG A;  5E3L A;  2ID6 A;  1RRJ A;  2HS5 A;  3R4K A;  4LJZ F;  3F23 A;  3F0C A;  3GZN B;  1ZG3 A;  1D0Y A;  1HF0 A;  4U0Y A;  5CYV A;  3CMA I;  2L9V A;  1X1P A;  1HCR A;  1LUJ B;  4LG0 B;  5F27 A;  1Z7U A;  2Z5U A;  4C30 A;  3ZQC A;  4ZTJ A;  3CUO A;  1OIS A;  2RNJ A;  4G9Y A;  3S32 A;  2CUJ A;  2D1V A;  1U3E M;  1UJ8 A;  3SZP A;  3H36 A;  1D3Y A;  2JA8 J;  3E7L A;  2XSJ C;  2MGQ A;  2DW4 A;  2H8W A;  3L2R A;  4FX4 A;  1U5T A;  2NAZ A;  3D0S A;  2DK5 A;  4FQG A;  2DQL A;  3KP3 A;  3G1L A;  2JA7 J;  5F0H A;  5AIQ A;  1R4N B;  2VBW A;  3OS2 A;  1SD5 A;  3OY9 A;  2WAQ A;  5E3M A;  3ZP5 A;  2GOM A;  4AVP A;  5IP6 A;  2M0M A;  1OYY A;  2A6E F;  4AM3 A;  1D8J A;  4QPO A;  1RC9 A;  2A5Y B;  4CYD A;  2DTZ A;  1SVO A;  2YU9 J;  1J9I A;  2R7V A;  4G6T B;  1FIP A;  3IC7 A;  4P55 A;  2L9R A;  5HDN A;  1W4M A;  3BR2 A;  4NDL A;  4A5N A;  2QUF A;  2NYX A;  4YFN F;  4P5O A;  1STZ A;  3OIO A;  2O9L A;  4PCQ A;  2CMP A;  3VOE A;  1LQ1 A;  4UUS A;  2EFW A;  1AU7 A;  2R7U A;  1RR7 A;  5L3F A;  4C3H J;  1F9N A;  1TT5 B;  1W5T A;  3ELK A;  3G3Z A;  3PL8 A;  3GYH X;  3OYI A;  4ENJ A;  4JX4 A;  3OR1 C;  4YIR X;  1VQ7 I;  2O8K A;  3BR5 A;  1MH4 A;  4KJZ A;  3SZG A;  3K4K A;  4HF1 A;  5CVU A;  2P7C B;  2QQ8 A;  3F3X A;  3MVP A;  3MFK A;  3WTZ A;  4ZZL A;  2EV0 A;  4C2T A;  4Q48 A;  2B0L A;  3T1B A;  4B43 A;  1FYM A;  5DEQ A;  5E3O A;  2JPC A;  2JSC A;  3LA3 A;  3CMY A;  2OU2 A;  1WJD A;  4BYY A;  3QYF A;  2EJR A;  1VF9 A;  1U2W A;  1ON1 A;  2W1O A;  3CO7 C;  3WHC A;  1YJ9 I;  4W97 A;  2ECB A;  3V7R A;  4RA2 A;  2CV0 A;  3CCV I;  5EZH A;  1J2X A;  1B9M A;  1SAX A;  4IHX A;  3HEF A;  3MKY B;  4A2U A;  5H6R A;  4I76 A;  1O57 A;  3KE2 A;  1XB4 A;  3QYE A;  2LKP A;  3EYY A;  3LWF A;  1RKW A;  2GWR A;  3SFZ A;  4ABZ A;  2XRN A;  1Y39 A;  2GLO A;  2WC2 A;  4M73 A;  5DCM B;  2CQN A;  3NEU A;  3OYC A;  1UCR A;  3OOU A;  1ZR2 A;  4LLL A;  3DQV C;  2VJJ A;  1X4P A;  1Y1V J;  3H3Z A;  4G94 A;  5ICF A;  4BQA A;  4RS8 A;  4D5C A;  2PMH A;  3OYF A;  4D0P A;  1NK2 P;  2ELJ A;  1YS7 A;  1W0T A;  3MD2 A;  3PUB A;  4BHB A;  1JTY A;  1LJ9 A;  3A03 A;  1T8I A;  3CUQ A;  1ETK A;  1K6O A;  1VND A;  3HOW J;  1PUE E;  1J7K A;  3HM5 A;  1Z1D A;  2MAB A;  1PYV A;  2DOD A;  3F72 A;  4IPA A;  5B3S H;  1BR4 A;  3LSK A;  2M87 A;  1QZE A;  3VDX A;  3G1O A;  1TT0 A;  4AWX B;  2K7L A;  4Y15 A;  3QRF F;  5EEH A;  2STT A;  2JRM A;  3CLO A;  2LYC A;  2YU3 A;  1ZAO A;  3ASO H;  3DU5 A;  2KRF A;  2ZJQ F;  1KQ8 A;  5K5Q A;  4UUT A;  3J7Y J;  2DOE A;  2BHZ A;  5BPD A;  1RI7 A;  4EVI A;  4ESF A;  1Q1H A;  4BL0 B;  2G9W A;  1MH3 A;  3H5N A;  4ZDL A;  1Q1V A;  1XG1 A;  2LP0 A;  4IHW A;  3E97 A;  4ON0 A;  4R1H A;  4DZJ A;  4AIK A;  4CIC A;  3TP3 A;  4IJA A;  4NC8 A;  3MWM A;  1FBQ A;  3L9F A;  2A07 F;  4XOT A;  1BA5 A;  5D8K B;  4NNJ A;  1YOV B;  1K7A A;  2XRL A; 
#chains in the Genus database with same CATH homology
 3EET A;  2BBY A;  2Q0O A;  1UHM A;  4BXU A;  1IAW A;  4Y17 A;  5AON A;  5D8L B;  2CGP A;  4U0W A;  3SZT A;  4M72 A;  3BPV A;  5TJJ A;  5CVI A;  4BH9 A;  4HDU A;  2Z9O A;  3F8N A;  2TDX A;  2R3S A;  2V1D A;  3V8L A;  2FRH A;  1R23 A;  2O8X A;  2C6Y A;  4MGR A;  1LNW A;  4I0B A;  4YII A;  1MD0 A;  4O3M A;  1ODD A;  4U7D A;  5H6Q A;  2HTJ A;  2PI0 A;  4MHG A;  4HYE A;  1KYW A;  1TNT A;  3KZZ A;  3WTS C;  4OMY A;  3K1N A;  3R0A A;  4YFX F;  5E8I A;  2FQ3 A;  1JXS A;  5HDK A;  2LNB A;  2X4H A;  1PDN C;  3W6K B;  3M9A A;  3TO6 A;  4I2O A;  3F8B A;  2YX4 A;  3GUD A;  1BBY A;  1IXR C;  5JI6 A;  1FZP B;  2LDU A;  3KCC A;  4L9N A;  4B8X A;  5D4S A;  2RGV A;  2PEX A;  3F6O A;  1HW2 A;  1HQC A;  3LQQ A;  1AWC A;  3QPT A;  1D5V A;  2QYO A;  3KP2 A;  1R1U A;  2FOK A;  4L9T A;  3GO5 A;  4LFU A;  1YFH A;  3LQR A;  5LHI A;  2VBY A;  5KK1 A;  4UVB A;  1I5Z A;  4NB5 A;  2UWM A;  2Z3Y A;  3T8T A;  1Z6T A;  2F5D A;  1RNL A;  1ZRC A;  5D4R A;  2KJB A;  3IRR A;  1HKT A;  3D5L A;  2ADU A;  3E5X A;  4WXC A;  2NRA C;  3HUG A;  4OIN F;  1ZLJ A;  4IRG A;  1Z91 A;  2OBP A;  3LFK A;  5E1Z B;  3C3W A;  4R8H A;  4WF2 A;  2PN6 A;  5LRS A;  2FE3 A;  2IVM A;  3HIF A;  4HAM A;  3GFL A;  2E1C A;  3N4M A;  2Y0M A;  4YG2 F;  1IN5 A;  1G3Y A;  1ZHF A;  3M1E A;  3BOQ A;  3KP5 A;  3KP6 A;  2A3S A;  4RAY A;  1F5T A;  2QQA A;  1D8K A;  3CDH A;  3RPQ A;  3S2W A;  3JTG A;  3IL2 A;  5BPI A;  2GAU A;  4PGG A;  2XUB A;  5HS9 A;  5K5R A;  5TRD A;  3V7S A;  3Q9V A;  5ILS A;  2K4B A;  4RAZ A;  4M9S A;  3BP8 A;  2GA1 A;  2K02 A;  2EB7 A;  2P7V B;  4MTE A;  1BC7 C;  3P9C A;  1V4R A;  1YW9 A;  4JQF A;  1XSV A;  5IT9 K;  3KP4 A;  3PQK A;  1G3S A;  1T2K A;  4XLP F;  3J80 K;  1PP8 F;  1E17 A;  3U9G A;  4KN7 X;  4KMU X;  4LB6 B;  3WU0 A;  5ICG A;  1IN7 A;  1MDM B;  1GVJ A;  1SFU A;  5LGN A;  4I7H A;  2HKX A;  3K1M A;  1YO5 C;  4WX9 A;  2UXN A;  2XRO A;  2HKO A;  2M45 A;  1TQP A;  2VOD A;  5E1X A;  3T5X A;  2EFO A;  4L18 B;  1WQ2 A;  4CO8 A;  1V3F A;  1XD7 A;  2JPB A;  2A68 F;  4A5M A;  5DV5 A;  4KUM A;  5FLX K;  4LK1 F;  4UXN A;  1J75 A;  3U1D A;  5J8F A;  3E3V A;  3RKY A;  1R5G A;  2OQG A;  1ZG1 A;  2E7W A;  3ZPL A;  5F64 A;  1BJA A;  4Z2Y A;  3LA2 A;  2DI3 A;  1MGT A;  4WK8 F;  4NHJ A;  5FFZ A;  4EV0 A;  4B09 A;  1IUY A;  3ULQ B;  2RDP A;  2D2W A;  1E2X A;  2FU4 A;  3VB2 A;  4KIG A;  3J81 K;  2GQQ A;  3GX4 X;  2MD5 A;  5HS8 A;  3FM3 A;  2DPD A;  3RJP A;  2L4M A;  3TO7 A;  4GYI A;  4YFK F;  3QP6 A;  1O3Q A;  3HRS A;  3DEU A;  4ESB A;  1P4W A;  1EH8 A;  1FYK A;  2XV4 S;  4I01 A;  2F5E A;  1KU2 A;  3ZMT A;  3ECH A;  4LMY A;  4EGY A;  4WWC A;  3TQN A;  4LLG F;  3T0Y A;  4KMF A;  2A6H F;  3QU6 A;  2JTV A;  3B02 A;  4AD9 A;  3IHU A;  4GYG A;  1L0O C;  1ULY A;  2HTS A;  4A0Y A;  5BS6 A;  4KYW A;  2KJC A;  2VT2 A;  2HDC A;  5DUK A;  1FSH A;  1T0F A;  2FNA A;  2HQN A;  2VT3 A;  3F21 A;  5E1W A;  2UZK A;  1JHH A;  4P9F A;  2VBX A;  4L5J A;  2NNN A;  4MEY F;  5FD5 A;  1SFE A;  2ISZ A;  1S8N A;  1TTY A;  5JHU A;  3IWZ A;  5K1Y A;  2ZFW A;  5F6F A;  2O61 A;  3DKW A;  2V6C A;  1HBX G;  3ABT A;  3ERE D;  2QQ9 A;  2DLL A;  3R0J A;  1XSX A;  2CSO A;  3ROU A;  1UFM A;  4RB0 A;  1RIO H;  5L3B A;  4MTD A;  5KVR A;  1YLF A;  4G8X A;  5JFR A;  3N97 A;  4E70 A;  1U8R A;  1W7P A;  4G7O F;  5J8C A;  2DBB A;  2ZO4 A;  2PFB A;  2JT1 A;  2H09 A;  2BYV E;  4ENM A;  2H6C A;  4GCV A;  3SXY A;  2LSO A;  3BDD A;  3FMS A;  2XAJ A;  3WOD F;  2VON A;  2PQ8 A;  2IT0 A;  5A2Q Z;  3DFG A;  4M6X A;  3EYI A;  2K4J A;  1EH6 A;  1MJA A;  3HSE A;  4ZYE A;  5L3C A;  1IW7 F;  3ML6 A;  4G6D A;  1J59 A;  5D6F A;  1QPM A;  1XGO A;  1H9G A;  4HA8 A;  1BIA A;  2MLG A;  1KU7 A;  2RKH A;  5E8G A;  1A04 A;  2FBH A;  3GXO A;  2H27 A;  1B1B A;  1G6N A;  3P9I A;  1CGP A;  2Y75 A;  1K78 A;  5DUI A;  5JVT A;  3DPL C;  3O6B B;  2W24 A;  1FBS A;  3ZMD A;  1X3U A;  5CJ9 A;  2KKO A;  1S29 A;  2HQR A;  1I27 A;  1F4K A;  2M30 A;  2P8T A;  2O3F A;  3W6J B;  2J5O A;  2FSW A;  5CVJ A;  1ZG5 A;  2E7X A;  3P9K A;  2EFP A;  3TDU C;  4KT5 C;  1UHW A;  3BJO A;  1OMI A;  5FD6 A;  3TDZ C;  1MJB A;  3F6V A;  2MLK A;  4CHU A;  2Y48 A;  2V1X A;  4QLC U;  5LHH A;  5H20 A;  1PP7 U;  5J6X A;  1YW7 A;  2HEO A;  2V1U A;  3EQL F;  3L09 A;  2ACJ A;  3KET A;  2ELH A;  2WWY A;  2QLZ A;  2F5F A;  2OA4 A;  2MH9 A;  2RVC A;  2KIM A;  1H9T A;  5D5W B;  1P4X A;  2DK8 A;  3I59 B;  1YW8 A;  3C7J A;  3MCZ A;  2DAO A;  2KIF A;  1HXD A;  4M71 A;  2DQR A;  3J80 Z;  2PLY A;  2VOO A;  1R36 A;  1LEB A;  1FY7 A;  2WV0 A;  4YIF A;  1W7P B;  2HZT A;  4LGW A;  4N9I A;  2ISY A;  3WG9 A;  2H6B A;  1LDK B;  4AIH A;  4JK1 X;  2VC0 A;  3MZH A;  1TBX A;  5AIP A;  2HGC A;  1BI3 A;  1QZZ A;  1XMK A;  1G3T A;  2EWN A;  4P96 A;  1R22 A;  3NQO A;  3GZ5 A;  1BIB A;  3HRM A;  3J81 Z;  2EA2 A;  3E6M A;  3BJA A;  2EFN A;  4EMS A;  1LEA A;  5DD8 A;  3V4G A;  1Z6R A;  1YTY A;  3VEP A;  5FFX A;  1MKM A;  3LST A;  1CF7 B;  3M7G A;  2RC4 A;  2PMU A;  1P92 A;  3HTU A;  4XSX F;  2EFQ A;  3IRQ A;  1DP7 P;  5HVQ C;  3R6S A;  3BRO A;  1UST A;  4IVN A;  3GVA A;  3TOA A;  1IZ1 A;  2W84 A;  4R79 A;  4LLN A;  2OD5 A;  3MZY A;  2VOP A;  1HKS A;  4FT8 A;  2ZBK A;  2MH2 A;  2HR3 A;  2ESN A;  3WTW C;  2DU9 A;  2HYG D;  1GXQ A;  1O7L A;  3GFM A;  5D5X B;  3GLX A;  5LLQ A;  4IRH A;  1RUO A;  1T39 A;  4H0E A;  3KEO A;  5L3G A;  4S05 A;  3KEQ A;  1U5T C;  3SHF A;  2QBY B;  3DF8 A;  1IN8 A;  3ABU A;  1R00 A;  3ZMV A;  1SMT A;  2DT5 A;  1MDM A;  1RUN A;  2STW A;  2AXL A;  2P6S A;  4FX0 A;  1U6G A;  3EDP A;  3VFZ A;  2GZW A;  3TOB A;  4UNO A;  3GEZ A;  3HRT A;  2G7U A;  1REP C;  1HST A;  3K69 A;  2Q2E A;  4MQV A;  1SD4 A;  2XKO A;  3GFI A;  2DO7 A;  4OMZ A;  4MNU A;  4ETS A;  1QQI A;  1KQ9 A;  3I71 A;  5FLX Z;  3O3K A;  2P6T A;  2ZJ2 A;  5K5O A;  2XAG A;  4EJV A;  1IF1 A;  1FYL A;  4M9X A;  4QWQ A;  1XGN A;  4CDG A;  3J7A O;  1FT9 A;  4KIB A;  3GZ6 A;  1FP1 D;  5FO5 A;  5HLH A;  1FPQ A;  1R1V A;  4RGU A;  4BAY A;  4U0V A;  2YX7 A;  4IRI A;  1B4A A;  1JE8 A;  2CG4 A;  1I1G A;  2O03 A;  2UXX A;  1WWX A;  3AAF A;  1OPC A;  1T38 A;  1IXC A;  4L0Z B;  5LBQ A;  1G3W A;  5LHG A;  2OZU A;  1IXS B;  3I53 A;  1L3L A;  1XSD A;  3HSR A;  2FF4 A;  1GHC A;  2KIU A;  2FBI A;  2MC3 A;  2QBY A;  3C18 A;  3GW2 A;  3I58 A;  4EJT A;  2HFH A;  2IP2 A;  1BI2 A;  1DUX C;  2NS0 A;  5D5U B;  4G6Q A;  1R5H A;  1C0W A;  3GWZ A;  1WRJ A;  2XVC A;  3FX3 A;  4IXA A;  3MQ0 A;  1O3T A;  4RB2 C;  4ZYD A;  2CO5 A;  3JW4 A;  2X0L A;  1OYW A;  2BEO A;  2P5L C;  2LF7 A;  2BV6 A;  4A0Z A;  3FMR A;  3C1D A;  4HQE A;  3DPT A;  4ASN A;  1BI0 A;  3VOD A;  3NRV A;  2Z33 A;  2CWE A;  3GFJ A;  1TW3 A;  3KLN A;  3B73 A;  1NHA A;  3O2P E;  1BI1 A;  2XGX A;  4NQW A;  4AIJ A;  1LDD A;  5LEK A;  5ICE A;  4ENK A;  4HLX A;  4HLY A;  2BGC A;  4LG0 A;  2COM A;  3I64 A;  1OKR A;  2VE8 A;  2QM3 A;  3IKT A;  4KNY A;  2FEZ A;  3RKX A;  4G7H F;  5CLS A;  5DDG A;  3QU3 A;  4N9H A;  2GIV A;  4ENN A;  2D1H A;  3DXJ F;  2IA0 A;  2L54 A;  3F8F A;  4BHC A;  4MEX F;  5ED4 A;  2HWV A;  4OU0 A;  1ON2 A;  1S3J A;  4HOB A;  3Q9S A;  5DD4 A;  4I98 B;  5ILU A;  2PBI A;  2PJP A;  1QNT A;  3HOS A;  3I5U A;  6PAX A;  2W25 A;  3WGH A;  1H0M A;  4GXO A;  1XGS A;  2IPQ X;  3E5U A;  1TNS A;  2QVO A;  3FHZ A;  5L3D A;  3R61 A;  3K9T A;  3L00 A;  4UVC A;  2YPR A;  4RB1 A;  2H94 A;  4GO1 A;  4A6E A;  3LAP A;  2FML A;  1BM9 A;  4HV5 A;  2P5K A;  1IN4 A;  1FBU A;  5HS7 A;  2FNP A;  4RGR A;  4UV8 A;  4M74 A;  4O6J A;  2MA3 A;  3EUH A;  5LGU A;  4Q4Z F;  1ZRF A;  5BOX A;  4I02 A;  2FXA A;  3TO9 A;  5E20 A;  2XKP A;  1JHF A;  2IA2 A;  5IT9 Z;  2EK5 A;  2ZNY A;  1IRG A;  2WTE A;  1KGS A;  2QWW A;  3F8M A;  2A61 A;  1TQM A;  2ZCW A;  3REO A;  1BOA A;  4JBA A;  4BNC A;  4CZZ A;  3L2C A;  1XGM A;  5IT3 A;  2AS5 F;  4TV7 A;  5HOO A;  3K1P A;  4KN4 X;  1ZN2 A;  4L5I A;  1ZAR A;  2RV8 A;  3ZMS A;  1BC8 C;  2ZNZ A;  1KYZ A;  1Y0U A;  4HV6 A;  2E1N A;  3WTY C;  2IA1 A;  1YS6 A;  3BJ6 A;  2M5W A;  3HSF A;  2XAF A;  1JGS A;  4HW0 A;  3K0L A;  1DDN A;  3F22 A;  4U7B A;  3WU1 B;  4WXD A;  1S6L A;  3M8F A;  4OIO F;  5CVV A;  2EA4 A;  3COA C;  1K79 A;  2GXB A;  1OR7 A;  1BN5 A;  5LRR A;  1FWZ A;  2G7H A;  1FSE A;  2CYY A;  1I6X A;  2FMY A;  4OIR F;  4HBL A;  2OQR A;  5JR3 A;  3FZV A;  2EV6 A;  1VTN C;  2VBZ A;  1GXP A;  5HLI A;  4A0X A;  3RI4 A;  4M6Y A;  1KQ0 A;  1KU9 A;  2ZKZ A;  4RB3 C;  3E6C C;  3M8E A;  2GXG A;  3WGG A;  3MEX A;  1B9N A;  3RIR A;  1I1S A;  3TGN A;  3QPH A;  3CO6 C;  1WSU A;  1SMY F;  1ZYR F;  2L3D A;  4HQM A;  2PG4 A;  3P7N A;  3E5Q A;  3BZ6 A;  1MJ9 A;  4IHS A;  4Y13 A;  3KP7 A;  3WGI A;  2D45 A;  3WTV C;  2K86 A;  3H92 A;  4LB5 A;  3V7C A;  3ISP A;  2P5V A;  1YQA A;  4U88 A;  3I0T A;  4UVA A;  1TLH B;  1SD6 A;  4ZYG A;  2QEN A;  1FP2 A;  3QP5 A;  2IRF G;  2QZ8 A;  5LEJ A;  3RKW A;  4UUV A;  1DPU A;  3KLO A;  1YG2 A;  4XRF A;  4KIF A;  4UHT A;  2BE5 F;  1F1Z A;  5ICC A;  2P4W A;  5BQT A;  1YYV A;  4EM0 B;  2GA2 A;  1KA8 A;  1B59 A;  2R7D A;  2J5P A;  3HTS B;  3IKV A;  1P2F A;  1SFX A;  4DQ2 A;  2VXZ A;  2RN7 A;  2Z99 A;  2VE9 A;  4O5V A;  3WTT C;  2F5C A;  4G7Z F;  1HW1 A;  5BMZ A;  3FWE A;  3HHH A;  1ZLK A;  3E6B A;  3JAM Z;  4P9U A;  4RGS A;  4A6D A;  3OOP A;  4IF4 A;  1XCV A;  3I4P A;  1CF7 A;  3PQJ A;  2W57 A;  4L9J A;  3H3U A;  2F2E A;  2ZME A;  3I54 A;  2W85 A;  1ZGA A;  3DV8 A;  2FA5 A;  3FXU A;  4IHT A;  1T6S A;  4OOI A;  1XN7 A;  4UV9 A;  3JSO A;  4S04 A;  4N0B A;  3R60 A;  1XMA A;  3QOP A;  2A69 F;  2HOE A;  2YR2 A;  1YIO A;  4L9V A;  1Z05 A;  3RDI A;  4RGX A;  2XAH A;  3MAJ A;  4KA4 A;  4PGH A;  1QGP A;  1HW5 A;  2DFI A;  2IW5 A;  4EJU A;  1LB2 A;  3RYP A;  4I09 A;  1HKQ A;  2YSR A;  4ZH4 F;  4KIC A;  1IRF A;  5DCF A;  1EH7 A;  3T8R A;  2O6G E;  4HZF A;  5EEG A;  4HX4 A;  5E18 F;  4LK0 F;  3CJN A;  3LAJ A;  2JZY A;  4WXH A;  1IN6 A;  3TKY A;  1OYI A;  4PZJ A;  1O3S A;  1ZH5 A;  1FNN A;  4F7Z A;  5L3E A;  2R7F A;  1J0R A;  4ZZD A;  2FBK A;  1FX7 A;  1KU3 A;  1Z9C A;  3WTU C;  1U78 A;  3V8J A;  4HX8 A;  5D6E A;  3ZN1 A;  2M8E A;  4EM1 A;  3K2Z A;  4HF0 A;  1XCB A;  1S7A A;  4XBF A;  3FXQ A;  4CXF A;  2IJL A;  3FMQ A;  5HLG A;  2V9V A;  2QQB A;  1G4D A;  3JSP A;  1T98 A;  2M1B A;  4FHT A;  1FLI A;  1WI9 A;  1DPR A;  5FGM A;  3KZY A;  3FM5 A;  3WE3 A;  4MQ9 F;  4CGZ A;  2K27 A;  3RYR A;  4Q5S F;  2ZXJ A;  3FF5 A;  1K78 B;  1FOK A;  4EGZ A;  1HSJ A;  2VN2 A;  4HX7 A;  3Q5F A;  4PDK A;  1P4A A;  5ILV A;  1TQI A;  4Q47 A;  3QAH A;  2ZME B;  5HDG A;  1SD7 A;  4I0A A;  4ESJ A;  3KFW X;  3L7W A;  1RZ4 A;  5LGT A;  5E17 F;  1XDU A;  2JRT A;  1FC3 A;  2DTR A;  4OIP F;  2ETH A;  3BWG A;  2OAZ A;  3GF2 A;  3HYI A;  1W7P D;  1AOY A;  3OV8 A;  2CFX A;  1R58 A;  3RTR A;  3HHG A;  3ZQ7 A;  5A2Q K;  1R7J A;  1WKM A;  3WTX C;  2L02 A;  1EV7 A;  1XDS A;  3RPU A;  2XAQ A;  1O7F A;  3JTH A;  5DCM A;  2OZ6 A;  3JAM K;  3IWF A;  3ECO A;  4L0Y B;  3PFI A;  2HYF A;  5ERI A;  5F1R A;  5D5V B;  1U5T B;  1W5S A;  2O0Y A;  3WE2 A;  2CW0 F;  4EJW A;  2Q8K A;  4K2E A;  4A12 A;  2ESH A;  4WCG A;  3SQN A;  4EM2 A;  4HF2 A;  3ZN0 A;  2L01 A;  5CVR A;  3G73 A;  1TW2 A;  3HRU A;  4EJO A;  3FXR A;  3V8K A;  2XAS A;  3CUQ C;  4XSZ F;  3ZMZ A;  2XIG A;  3HOT A;  3DP7 A;  3BPX A;  4DNC A;  2EV5 A;  2VC1 A;  2RQP A;  1O3R A;  1J5Y A;  4HDV A;  2LF8 A;  2V79 A;  1ZRD A;  1QZY A;  1MZB A;  3BY6 A;  2CQK A;  3U2R A;  3E6D A;  2MBF A;  3CTA A;  3F8C A;  4KFC A;  2NNY A;  1UB9 A;  1P6R A;  1ZGJ A;  4LD5 A;  4OIQ F;  3ZMU A;  1ONV A;  1LVA A;  4ZYH A;  5FB2 A;  3CUQ B;  1B6A A;  5DYM A;  4KDP A;  2XHK A;  1USS A;  1S7O A;  4XLN F;  3LA7 A;  1R1T A;  1QO0 D;  1ZRE A;  4BHP A;  3I59 A;  2DPU A;  4EQQ A;  1LDJ A;  1QBJ A;  4M9Z A;  2L4A A;  4GGG A;  2HS5 A;  3R4K A;  4LJZ F;  3F23 A;  1ZG3 A;  4U0Y A;  5CYV A;  4LG0 B;  1Z7U A;  2Z5U A;  3CUO A;  2RNJ A;  4G9Y A;  2D1V A;  1U3E M;  3SZP A;  1D3Y A;  2DW4 A;  4FX4 A;  1U5T A;  2NAZ A;  3D0S A;  2DK5 A;  2DQL A;  3KP3 A;  5AIQ A;  2VBW A;  1SD5 A;  3ZP5 A;  4AVP A;  1OYY A;  2A6E F;  1D8J A;  2A5Y B;  4CYD A;  1J9I A;  3IC7 A;  4P55 A;  5HDN A;  1W4M A;  4A5N A;  2QUF A;  2NYX A;  4YFN F;  4P5O A;  1STZ A;  4PCQ A;  3VOE A;  1LQ1 A;  2EFW A;  5L3F A;  1F9N A;  1W5T A;  3ELK A;  3G3Z A;  3GYH X;  4ENJ A;  4HF1 A;  5CVU A;  2P7C B;  3F3X A;  3MFK A;  3WTZ A;  4ZZL A;  2EV0 A;  4Q48 A;  2B0L A;  3T1B A;  1FYM A;  5DEQ A;  2JPC A;  2JSC A;  3LA3 A;  2OU2 A;  4BYY A;  2EJR A;  1U2W A;  1ON1 A;  3CO7 C;  3V7R A;  1J2X A;  1B9M A;  1SAX A;  4A2U A;  5H6R A;  1O57 A;  3KE2 A;  1XB4 A;  2LKP A;  3EYY A;  3LWF A;  2GWR A;  3SFZ A;  2XRN A;  2WC2 A;  4M73 A;  5DCM B;  3NEU A;  1UCR A;  4LLL A;  3DQV C;  3H3Z A;  4G94 A;  5ICF A;  4BQA A;  4RS8 A;  2PMH A;  4D0P A;  1YS7 A;  4BHB A;  1LJ9 A;  3CUQ A;  1K6O A;  1PUE E;  1J7K A;  1Z1D A;  3F72 A;  4IPA A;  2M87 A;  4AWX B;  2STT A;  3QRF F;  2K7L A;  4Y15 A;  5EEH A;  3CLO A;  2YU3 A;  1ZAO A;  1KQ8 A;  2KRF A;  5K5Q A;  5BPD A;  1RI7 A;  4EVI A;  4ESF A;  1Q1H A;  2G9W A;  3E97 A;  4ON0 A;  4R1H A;  4AIK A;  4CIC A;  4IJA A;  3MWM A;  1FBQ A;  3L9F A;  2A07 F;  5D8K B;  1K7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...