3ZMDA

Crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
148
structure length
148
Chain Sequence
TRWLTDTEQCAWRTHLEVNRLLTHQLEKDLQPFGLTMNDYEILVNLSESEGDRMRMSDLATATMQSKSRLSHQITRMENANLVRRENCESDRRGLFAVLTEHGLETMRKVAPHHVASVRRHFIDLLAPEDLTELDKALKPIAEHLRGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PUTATIVE TRANSCRIPTIONAL REGULATOR
publication title Crystal Structure of Absc, a Marr Family Transcriptional Regulator from Streptomyces Coelicolor
rcsb
source organism Streptomyces coelicolor
total genus 54
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zmdA00
2XRNA 2H27A 1TW3A 2M8EA 4BHBA 3ELKA 2MC3A 5BQTA 1RNLA 3DF8A 1J0RA 2EFPA 4I0AA 4N9HA 2E7XA 4RB3C 4ESBA 4ZYDA 1ZRDA 4RGSA 1FC3A 3MAJA 5ICEA 2M87A 4HW0A 3RKXA 1Z6RA 3SZPA 4M72A 4FHTA 3WE3A 3FMSA 4L5IA 3GUDA 3BJOA 3E6MA 3L2CA 5JI6A 1BIAA 1KQ8A 4M6YA 4Y13A 4BQAA 4IXAA 5FLXZ 4HF1A 3CUQC 3F3XA 4DNCA 2Z33A 4BH9A 2VC0A 1XGOA 4H0EA 2V1XA 1LDDA 1Z7UA 3QOPA 3LAPA 2K27A 4KN7X 3QP6A 2EV0A 5HLHA 3K2ZA 1XSVA 4YG2F 2CYYA 3JW4A 4JBAA 4TV7A 3O6BB 1HKSA 1H0MA 3P9CA 4XBFA 2RDPA 4G6DA 4GYIA 2PBIA 3MQ0A 3HOSA 4L9JA 5K5OA 1KYWA 1SD7A 3HOTA 2VBXA 2FBHA 2GA2A 2PLYA 1R7JA 4NQWA 1KU2A 1J5YA 1BI3A 2XASA 5HDGA 1BIBA 3DV8A 4N9IA 4P9FA 1TTYA 2DI3A 1YTYA 2WV0A 2JRTA 2XAQA 2QLZA 1R00A 1XB4A 2Q8KA 5CVVA 2EV5A 3EYIA 2JSCA 3VEPA 3FHZA 1S6LA 2H09A 3F21A 1KA8A 1FY7A 1ZREA 1IW7F 1J9IA 3WU0A 4XRFA 5HLGA 3R0JA 4PDKA 5LHGA 5DUIA 2Q0OA 3FMRA 5CJ9A 3OOPA 3TO9A 2HEOA 5JFRA 5HDKA 4PZJA 2G9WA 4QLCU 4I0BA 5H20A 4ZYEA 1P2FA 3R60A 5LEJA 5E18F 4AD9A 3T1BA 4BAYA 3LA2A 2MH2A 2CO5A 5ILVA 1JE8A 3O3KA 4EGZA 4UV8A 3T0YA 3IKTA 4RAYA 3DPTA 4KMFA 1IN8A 1SD5A 4YIIA 2XAFA 1YO5C 1K79A 2BV6A 2P8TA 3DPLC 5LHHA 2FU4A 3RJPA 1OYWA 3NQOA 4HDUA 3BZ6A 1LNWA 3FXRA 1XCVA 2DK5A 1T2KA 5D5XB 4PCQA 1XSDA 5E1XA 3J81K 5HOOA 2VE9A 4ENJA 3ZMTA 4LB6B 3MZYA 3GFMA 1QPMA 3DXJF 5L3FA 3FM5A 5A2QZ 2PN6A 1T6SA 1X3UA 4A0YA 4IF4A 4EQQA 3VODA 2YSRA 1J59A 1XMKA 2FNPA 3VB2A 1GVJA 4MTEA 3K1MA 1F9NA 2A5YB 1R22A 2EB7A 3E3VA 3ZMSA 3E5UA 4I02A 4RAZA 5HS7A 5ICCA 1YG2A 4LK0F 4EM0B 2W84A 4P55A 2TDXA 2VONA 4KYWA 1ZLKA 2IJLA 3TKYA 2Z99A 3ZMDA 1BM9A 2XAJA 1REPC 1FBQA 3SZTA 2GIVA 3V7CA 4Y15A 2CWEA 5ILUA 2RN7A 1OR7A 1GHCA 3H3ZA 2XKPA 1G3TA 5FGMA 3FX3A 2VE8A 2VOPA 4BHCA 2NNYA 2XKOA 1DP7P 2R7DA 1NHAA 4RGRA 4L0ZB 2F5CA 4HV5A 4BNCA 5LLQA 4CO8A 3LA3A 2LF8A 3E6CC 2C6YA 5HLIA 3J81Z 4M9XA 4P5OA 1FT9A 3T8RA 1XMAA 2FBKA 2E1NA 2IVMA 1W7PA 3RDIA 1OMIA 4M73A 1BN5A 5LHIA 2MLGA 3ULQB 2K7LA 4AIJA 4OIPF 2BGCA 3IWZA 1O3QA 1F4KA 4CXFA 2HFHA 1P6RA 3MCZA 1ZN2A 2HTJA 2VXZA 2NYXA 2UZKA 2R3SA 2QQBA 4YIFA 4JK1X 5BMZA 1P4AA 2MH9A 3FF5A 1TNSA 1VTNC 3ZN1A 3I59A 1W5TA 5BPIA 2JT1A 2KIFA 5D6EA 3KEQA 1T0FA 3VFZA 3ZN0A 3R6SA 2EA2A 4CZZA 3J80Z 1U78A 1UHWA 3P7NA 3DQVC 2XAGA 1YW9A 2YPRA 1EV7A 4ZZLA 4I2OA 2GA1A 3G3ZA 4IHTA 2LDUA 2PQ8A 3CDHA 1HKQA 2RQPA 1SAXA 1P92A 1DPUA 2A6HF 3RPQA 2HTSA 2V6CA 3F6OA 1KGSA 1I27A 3V8LA 3CTAA 2ZNZA 3BDDA 4CDGA 1S8NA 3RKYA 1BI0A 2HKXA 5E17F 3WU1B 2HQNA 1O3SA 3DFGA 5J8FA 1SMYF 2CQKA 3HRUA 4G9YA 3GFJA 4S04A 3FWEA 3V8JA 3GZ6A 1HXDA 2V79A 3KP6A 5DV5A 2KKOA 3CLOA 1MJBA 1FPQA 2F5FA 1L0OC 3HIFA 4ZYGA 5DCFA 1WRJA 4LG0A 5AIPA 3Q9VA 4OU0A 2Y75A 2P5LC 4EMSA 1JHHA 1R5GA 5D8KB 4O5VA 2VC1A 4OOIA 4D0PA 1R5HA 3QPHA 2NS0A 2CW0F 4EJUA 4MHGA 4RB2C 5KK1A 1WKMA 1PP7U 1Z05A 3ROUA 2IW5A 2IA1A 5LRSA 3KP4A 3W6KB 4KDPA 2P6TA 4HYEA 2EFWA 4MNUA 3RI4A 4HLYA 3GEZA 4KNYA 2BE5F 4KT5C 1Y0UA 3HRTA 1D3YA 2RVCA 4R79A 5F1RA 5L3DA 3BPVA 3JSOA 5F64A 3ABTA 2NAZA 1ZHFA 2IA0A 4ESJA 3N4MA 1HW2A 3GFLA 2IPQX 3ISPA 4OIQF 4WXHA 3WTVC 5J6XA 2R7FA 4LG0B 2QENA 2IRFG 4WK8F 5L3GA 3GZ5A 2DT5A 2HDCA 3JTHA 2XIGA 5E1ZB 2X4HA 5TRDA 4ESFA 2ISYA 2UXXA 2DQRA 4WXDA 2M30A 2FQ3A 3CUOA 3LWFA 2Z3YA 2MLKA 4BYYA 1AWCA 1U3EM 1KQ0A 1GXPA 1QZZA 4HX7A 3RPUA 1KU9A 3PQJA 1U6GA 2HZTA 2PFBA 3LQQA 5BPDA 3HSFA 2CGPA 2W85A 2QYOA 4BXUA 3N97A 4OIRF 1XGNA 2G7HA 1FSEA 2L54A 2EV6A 2P6SA 3IWFA 2PMUA 3KP2A 1WSUA 2OD5A 1B9MA 3V8KA 1IXCA 1RZ4A 2STWA 3GYHX 4R1HA 4UVBA 5D5UB 1RUOA 4LK1F 1HKTA 4EM2A 4IVNA 1FLIA 3QPTA 1RIOH 2K02A 2HYGD 5E1WA 1I1GA 3ZMUA 1T39A 2OU2A 3HSEA 2HYFA 1DPRA 1FBUA 1TQMA 1FX7A 2ZKZA 5F6FA 3E6BA 3K1PA 3KP5A 4MTDA 1QGPA 2FOKA 1UB9A 3D5LA 1OPCA 3WTXC 3ML6A 5FO5A 2PI0A 1UFMA 1QO0D 1MKMA 1IZ1A 1USTA 3HUGA 4DQ2A 1H9GA 4F7ZA 1HSJA 1CGPA 2QVOA 1Z1DA 2XVCA 4EV0A 1SFEA 4NHJA 3R0AA 1IUYA 1YW7A 4N0BA 3ZP5A 5IT9K 3LQRA 3F22A 1ZLJA 4FX0A 3P9KA 4L9NA 3GW2A 4ZYHA 2QQ9A 4CGZA 4Y17A 1ONVA 4HV6A 3RYPA 5ERIA 4KIBA 1FBSA 5LBQA 3OV8A 3S2WA 4AVPA 1FYKA 2P5KA 3ECHA 2YX4A 2XROA 4M6XA 4KMUX 2FA5A 1OYYA 1LEAA 1HQCA 1K78A 5FB2A 1Q1HA 3C1DA 3QRFF 1YW8A 5DEQA 3GF2A 4MEXF 4GYGA 1T38A 2GXBA 1ZRFA 4LLLA 3KP7A 2RGVA 3C18A 1XCBA 4U7BA 2IT0A 5LGUA 2M5WA 4I09A 3TDZC 1YS7A 1Z9CA 1IN7A 1OKRA 2CFXA 4WXCA 3G73A 2COMA 1BC7C 2MD5A 3JAMK 3FZVA 5L3EA 2EJRA 3BWGA 3WGHA 2KIMA 4RB0A 2HS5A 1S7AA 2EK5A 2DQLA 3RKWA 3ERED 5D5WB 3COAC 2AXLA 1ZGAA 4U88A 2VODA 1ZARA 3WTUC 2O0YA 4LGWA 4MEYF 2A68F 4Q48A 3TO7A 1K78B 2H94A 2DW4A 2VBZA 2P7CB 3WODF 3B73A 2L3DA 1XSXA 2ZO4A 3E6DA 1BI1A 3K0LA 3Q9SA 2QBYA 3ZQ7A 3IKVA 4CYDA 4K2EA 3GXOA 3LSTA 5E8GA 1UHMA 4ZZDA 2RKHA 4L0YB 4UXNA 3FXUA 1F1ZA 4I01A 1I1SA 2Z5UA 3KP3A 2Y0MA 3H92A 2O03A 4LB5A 4O3MA 3D0SA 1XGSA 1P4WA 1BI2A 4P9UA 2ETHA 2A69F 2OZUA 4HAMA 4G8XA 2VOOA 2NNNA 2F5EA 2DLLA 2BBYA 1IF1A 2FMYA 2HGCA 5K1YA 5AONA 4EJOA 3ECOA 3I64A 1K6OA 1EH7A 4KN4X 4HBLA 1FZPB 2IP2A 4OMZA 3R4KA 5L3BA 4R8HA 2QBYB 4GCVA 2XV4S 5TJJA 2ZJ2A 4QWQA 1BOAA 2E1CA 1YFHA 4IRGA 1IN4A 2M1BA 1AOYA 5LGNA 3SFZA 3WTSC 1KYZA 3T5XA 1LVAA 4A0ZA 1O7LA 1FOKA 3L09A 1QBJA 4I98B 4M71A 4HZFA 2L4AA 2ISZA 5AIQA 2VN2A 3M8EA 5KVRA 1LDKB 4G7ZF 4E70A 3I58A 1IXRC 1TQPA 1G6NA 3IHUA 4Z2YA 2J5OA 5JHUA 3SXYA 2UXNA 2PEXA 2FNAA 3IRRA 4A0XA 3PQKA 4RGXA 1MGTA 3WG9A 1XDSA 4FT8A 3ABUA 3F8FA 4ASNA 2FXAA 1ZG3A 1G3YA 3KETA 3GX4X 4L5JA 2GXGA 5E8IA 3KCCA 3KZZA 5D4RA 3KFWX 4AIHA 1HBXG 1B1BA 1LDJA 1ON1A 2GWRA 2ESHA 3K9TA 3E97A 4M9SA 2EFQA 5ED4A 3TGNA 5EEGA 2WWYA 1OYIA 3L00A 4WX9A 2OZ6A 4B8XA 3BPXA 1R1VA 5D5VB 1WWXA 1L3LA 3FXQA 3QU6A 5CVIA 4L18B 2HQRA 6PAXA 2EFOA 3F8MA 1O3TA 2UWMA 1IRFA 2OBPA 3T8TA 2OA4A 3C3WA 1IN5A 2HKOA 3K1NA 3O2PE 4A5NA 1D5VA 3M7GA 3F8NA 5DCMB 1LJ9A 5IT3A 4WCGA 5CYVA 4RGUA 3TDUC 3CUQB 4A12A 3I5UA 3FMQA 2A61A 3QU3A 1YS6A 2GQQA 2ACJA 4EVIA 2P4WA 4UV9A 2MA3A 1FP2A 2K4JA 1YLFA 4UUVA 3NEUA 1TNTA 4YFKF 4BHPA 3RTRA 2Q2EA 3HSRA 3AAFA 4A6DA 1F5TA 1FP1D 1PP8F 2W24A 2L02A 5JVTA 2HWVA 3W6JB 1B59A 2A07F 1U5TB 5HS9A 4UVAA 4PGHA 1GXQA 2QWWA 3U9GA 3SHFA 2DPUA 2NRAC 1QZYA 1FWZA 4L9VA 5K5QA 4PGGA 3CJNA 4HX4A 5DDGA 5FFZA 4HA8A 3MZHA 3LFKA 2K86A 5FD5A 3KZYA 3GVAA 3L7WA 2CG4A 2LKPA 3I71A 1ULYA 3C7JA 3JTGA 1G3WA 3I53A 3K69A 3ZMVA 2ELHA 4EJTA 1BC8C 1ZAOA 2XUBA 4KIFA 4ETSA 3U2RA 2F2EA 2QQAA 3EETA 4LLGF 3WGGA 3MFKA 4ENKA 3HRSA 3KLNA 5DUKA 1ODDA 1S3JA 3Q5FA 4KUMA 4CHUA 3F8BA 4LMYA 1A04A 2LSOA 2E7WA 1BBYA 2DU9A 5DYMA 2W25A 2O8XA 1C0WA 1U5TC 2XHKA 5CLSA 2AS5F 4KICA 4ENMA 2LNBA 3WTYC 1DUXC 5A2QK 3ZPLA 4UHTA 4OINF 3HYIA 1B6AA 1EH8A 1O3RA 4HOBA 1JGSA 1XDUA 2IA2A 4HQMA 5ICGA 5JR3A 2QUFA 2GZWA 4O6JA 2V9VA 4U0VA 2QZ8A 4AWXB 1MJ9A 4EJVA 2FF4A 1TW2A 3IC7A 1J75A 2Z9OA 3L9FA 2O3FA 5H6RA 4LD5A 1V4RA 5L3CA 3V4GA 3VOEA 4MGRA 4Q47A 3EUHA 2BEOA 1FNNA 1YIOA 4MQVA 2D1HA 3RIRA 3HTUA 5D4SA 4UVCA 3WTWC 3LAJA 1XN7A 1ZRCA 2L4MA 1G4DA 2G7UA 1PDNC 2FEZA 3H3UA 2VBWA 5DD8A 4OMYA 4EGYA 2QM3A 5BOXA 3EYYA 1XGMA 2RNJA 3TOAA 2ZXJA 2L01A 1R58A 2DPDA 4LFUA 2XAHA 2ZBKA 1SD4A 3U1DA 3GFIA 3DKWA 4IRHA 2XGXA 1W5SA 2D1VA 1B4AA 3HHGA 3TO6A 5LGTA 2FSWA 1D8JA 3J7AO 5E20A 3M1EA 1Z91A 2HR3A 2X0LA 1SFUA 1ZH5A 4WWCA 1U8RA 1ON2A 4B09A 4GGGA 4Q5SF 3M9AA 1XD7A 3NRVA 4GO1A 5J8CA 2M45A 3FM3A 4GXOA 1G3SA 1J7KA 2YR2A 4U0YA 4RS8A 4M74A 2STTA 4P96A 5CVUA 1MJAA 4KA4A 4JQFA 3MWMA 2RV8A 2H6CA 2OQRA 2VBYA 4G7HF 3BROA 3F72A 5HDNA 1S29A 3HRMA 3EDPA 2PJPA 4G94A 4YFNF 5CVRA 3WGIA 2FRHA 1LEBA 4EJWA 2H6BA 4HLXA 2DBBA 5HVQC 3CO6C 4NB5A 4RB1A 1MZBA 1YYVA 1JXSA 1U2WA 5DD4A 1RI7A 1KQ9A 4A5MA 4U7DA 1ZG1A 1R23A 1S7OA 3ZMZA 2JZYA 5IT9Z 3PFIA 4G6QA 4L9TA 2WC2A 1J2XA 2DO7A 1TLHB 2GAUA 1ZGJA 1UCRA 2YU3A 1KU7A 1JHFA 1STZA 2V1DA 1HW1A 4AIKA 1USSA 3MEXA 3J80K 2A6EF 2P5VA 3P9IA 2F5DA 2A3SA 4YFXF 5LEKA 3BJ6A 2FE3A 5K5RA 3WE2A 1R1TA 5LRRA 4I7HA 2K4BA 2CSOA 5FFXA 3DEUA 1T98A 2DTRA 5BS6A 3F23A 2B0LA 5CVJA 1SFXA 1R36A 3SQNA 2VT2A 1BJAA 1WQ2A 3IRQA 2JTVA 3REOA 2ADUA 1B9NA 3QAHA 4HQEA 5FD6A 1QQIA 4HF2A 1LQ1A 2KJBA 4S05A 2ZFWA 2O6GE 3RYRA 3HTSB 2O61A 3HHHA 3I0TA 5EEHA 3JAMZ 2VT3A 3M8FA 4WF2A 1CF7A 1ZYRF 4OIOF 2EFNA 3F6VA 3KEOA 5HS8A 1Z6TA 1MDMA 1RUNA 4IJAA 4IPAA 1V3FA 2D2WA 3F8CA 1H9TA 1E17A 2ZNYA 4Q4ZF 2V1UA 2Y48A 4FX4A 1FSHA 3BP8A 2FMLA 2JPCA 3WTTC 3BY6A 3WTZA 1TQIA 1I6XA 3KE2A 1W4MA 4U0WA 1E2XA 3TQNA 1HW5A 1IN6A 4HX8A 2KJCA 2RC4A 1I5ZA 2DAOA 1YQAA 2OAZA 3JSPA 1P4XA 1SMTA 4KFCA 3GWZA 5D6FA 1IXSB 3LA7A 2HOEA 1O7FA 1KU3A 1O57A 5DCMA 4EM1A 4ON0A 1W7PB 4M9ZA 4CICA 2ZMEA 5D8LB 1WI9A 1LB2A 5H6QA 2EA4A 3CUQA 3B02A 1CF7B 4A2UA 3IL2A 3DP7A 1MDMB 1HSTA 2D45A 4ZH4F 4MQ9F 2MBFA 1DDNA 3CO7C 2FBIA 3QP5A 1U5TA 3V7SA 4A6EA 2ZCWA 1EH6A 2EWNA 3I59B 3GO5A 2ESNA 4ENNA 2BYVE 3BOQA 5ICFA 5FLXK 4UNOA 5ILSA 2JPBA 3EQLF 1W7PD 3V7RA 2PG4A 1D8KA 2KIUA 4IRIA 4HF0A 1FYMA 1SD6A 2PMHA 2ZMEB 3I4PA 4XLNF 1K7AA 2LF7A 1IRGA 1ZG5A 4IHSA 2P7VB 3GLXA 1TBXA 2J5PA 4XSXF 3E5QA 1PUEE 3TOBA 2KRFA 1R1UA 1FYLA 1IAWA 4G7OF 4KIGA 4LJZF 3BJAA 2OQGA 4LLNA 2YX7A 3R61A 2W57A 4XSZF 1MD0A 2DK8A 4HDVA 3KLOA 2WTEA 4XLPF 3I54A 3E5XA 1QNTA 2DFIA
chains in the Genus database with same CATH superfamily
2XRNA 4BE0A 3UNGC 4HG2A 2H27A 1TW3A 2M8EA 4FASD 4BHBA 3ELKA 2BVMA 2MC3A 5BQTA 1RNLA 1WH7A 3DF8A 1J0RA 2EFPA 1A6QA 1WPKA 4I0AA 4N9HA 2E7XA 2VKHA 4XN0A 4RB3C 1BR1A 4ESBA 4C30A 3FISA 3FIWA 4ZYDA 4RBOA 1ZRDA 4RGSA 3LSJA 4XOTA 1FC3A 3MAJA 1LE8A 5ICEA 3FBIB 2M87A 4HW0A 2NVTJ 3RKXA 3S17J 1Z6RA 3SZPA 4M72A 3K4KA 4FHTA 4G12A 1FEXA 3WE3A 2GLOA 2CQXA 3FMSA 4L5IA 3H5RA 2QSFX 5EJCA 2LKSA 2E5ZA 1JI8A 3CCSI 3GUDA 4DBRA 2VUMJ 4GFBA 3BJOA 3E6MA 4M3EA 3L2CA 5JI6A 2O7OA 1BIAA 1KQ8A 4M6YA 1MNMC 4Y13A 1V5EA 1RC9A 2ZMEC 5LD2C 4BQAA 1YIJI 4B1RA 4IXAA 5FLXZ 4HF1A 4FE4A 3CUQC 3F3XA 4DNCA 3JRBA 2Z33A 3BZCA 1DGRM 4DGWB 3S93A 4BH9A 4FETA 2R4GA 2VC0A 1XGOA 4H0EA 2V1XA 1LDDA 1Z7UA 2Y31A 3QOPA 3LAPA 2H8RA 2K27A 3FKIJ 1WJEA 3OOUA 3PNTA 2O9LA 3CC2I 2FOWA 3OIPA 4KN7X 3FXJA 2VL8A 2EV0A 3QP6A 5HLHA 4J00A 1U8BA 2K9LA 3K2ZA 1XSVA 4YG2F 2CYYA 3JW4A 2WY7Q 3J7AY 4JBAA 4A3KJ 1ETVA 4TV7A 3O6BB 1HKSA 1H0MA 2DFEA 3BTJA 3OWTA 4C3IJ 3P9CA 4XBFA 2RDPA 4G6DA 2CU7A 4P1WA 4GYIA 2MD0A 2ELJA 2PBIA 4PJJA 4DOZA 3MQ0A 3HOSA 3K2AA 4L9JA 1VQOI 1ZKGA 5K5OA 2DA4A 1LPQA 4XIDA 1MBHA 1KYWA 1ETWA 4F3QA 1SD7A 3JRHA 2DXIA 2DOAA 2IGMA 2VBXA 3HOTA 1W0UA 2FBHA 2GA2A 1Y1WJ 2PLYA 1R7JA 4NQWA 1KU2A 4XMYA 3M8JA 3MZ8A 3JRGA 1J5YA 1BI3A 2XASA 1IRXA 2M7BA 3CMAI 3ZRGA 5HDGA 1BIBA 3KPHA 3FXOA 3GTGJ 2PJRA 1Y1VJ 1UELB 1FTZA 3DV8A 4N9IA 4P9FA 4E6KG 1TTYA 3CCMI 2DI3A 4DYRA 3S1RJ 3CF5F 2WV0A 2JRTA 1YTYA 2XAQA 2BY2A 3EUKL 2QLZA 1R00A 1XB4A 2Q8KA 4F52A 5CVVA 4RAGA 3CF2A 4CSWA 2WY8Q 1QVTA 2EV5A 2QSHX 3EYIA 2KFDA 1GV2A 2EIKH 2JSCA 2HPIA 3VEPA 1G8XA 4BXFA 3DBLB 2VQGA 3ZCOA 3FHZA 5HODA 3CCYA 1S6LA 2H09A 3F21A 3M1CA 1KA8A 3BG7A 1FY7A 1ZREA 1IW7F 1J9IA 3WU0A 4XRFA 5HLGA 2EH3A 3R0JA 4PDKA 3DTKA 5LHGA 1MW7A 2E2HJ 5DUIA 3OYNA 2Q0OA 3FMRA 5CJ9A 3OOPA 3TO9A 2HEOA 5JFRA 2EBIA 5HDKA 4PZJA 1XTAA 2G9WA 4QLCU 2L9SA 4I0BA 5H20A 1WJBA 3OYHA 4NC8A 4ZYEA 1P2FA 3LOCA 3R60A 5LEJA 5E18F 1HOMA 1V5GA 2A5WA 4RLQA 3FBNB 2GIZA 2K3FA 2V26A 4AD9A 3SEZA 1XC5A 3T1BA 4BAYA 3LA2A 2MH2A 2OC6A 2CO5A 5ILVA 1JE8A 2JRMA 3ZQQA 3O3KA 4EGZA 4UV8A 3T0YA 5LFAA 1A31A 3IKTA 4RAYA 3DPTA 4KMFA 1IN8A 1SD5A 3K4JA 4YIIA 2PJRB 2N8GA 2XAFA 1YO5C 1K79A 2BV6A 2P8TA 3DPLC 3KZIC 5LHHA 2FU4A 2KLOA 3RJPA 3WU2C 1OYWA 3NQOA 4HDUA 3BZ6A 1LNWA 2HOAA 3FXRA 1XCVA 2DK5A 1U9NA 1T2KA 4DZJA 1QVUA 2ID6A 5D5XB 4PCQA 3VPRA 1XSDA 5KNLA 3BTLA 3H36A 5E1XA 3J81K 5IYDJ 3ONQA 5HOOA 2VE9A 2WAEA 4ENJA 1B8IA 2MSYA 3DBRB 2OUMA 2BZTA 3ZMTA 2GOMA 3S3MA 4LB6B 3MZYA 3GFMA 1QPMA 3DXJF 5L3FA 3FM5A 2V9PA 5A2QZ 3GTLJ 2VPLA 2PN6A 2F5VA 1T6SA 4CCJA 1X3UA 4A0YA 4IF4A 4KT6A 1Z67A 3FK6A 2NVUB 4EQQA 1X2MA 3VODA 1VFCA 2BVLA 1LVKA 2YSRA 3A2KA 1J59A 1XMKA 2FNPA 3OYGA 3VB2A 1GVJA 4MTEA 1PVEA 3ERMA 3K1MA 3W3CA 1F9NA 2A5YB 1R22A 5E3NA 1JUMA 2CJJA 2EB7A 3E3VA 1K61A 3ZMSA 3B6AA 2ECCA 2DJIA 4RAFA 3IH4A 3E5UA 4I02A 4RAZA 5HS7A 5B66C 3CCLI 5ICCA 2NOGA 2AXTC 2Y0SA 1YG2A 4LK0F 4EM0B 2LD5A 4E4HA 1V5FA 2W84A 4P55A 5M3MJ 3L2UA 1ERDA 2BW3A 4QPQA 5GTIC 4A3GJ 2TDXA 2VONA 1ETKA 4KYWA 1ZLKA 2IJLA 3TKYA 1QA6A 2Z99A 3ZMDA 1BM9A 2XAJA 4B3AA 2FQ4A 1REPC 4ABZA 1MH4A 4PFPA 5FKNA 3S2HJ 1B8IB 1FBQA 5E3MA 3I3LA 3CCJI 4N4OB 2X6OA 1R9TJ 2DFHA 3SZTA 4CCNA 3S15J 2GIVA 3V7CA 4Y15A 2CWEA 4EATA 2I10A 3G2BA 4PSXA 4BGDA 1IO2A 4Y4RA 3PIOF 5ILUA 2RN7A 3JRCA 5J4VA 1ETYA 4RMNA 1OR7A 2DA6A 3SDBA 4BJ5C 2KISA 3Q3SA 4D7NA 2CW7A 3H3ZA 2KQRA 2XKPA 1GHCA 2M2EA 4JP0A 1G3TA 2R7QA 3FX3A 2VE8A 5FGMA 2HDDA 2FUG2 2VOPA 3JCUC 4BHCA 1H8AC 1R6RA 3DU5A 2KDZA 2JMWA 2NNYA 2XKOA 1DP7P 2R7DA 1NHAA 4RGRA 1OCOH 4L0ZB 2F5CA 4HV5A 2F4OB 1YJ9I 2DA7A 4BNCA 5LLQA 4RM3A 4CO8A 3LA3A 4NBQA 2LF8A 2QSGX 4IHVA 3E6CC 2C6YA 2ME6A 2I8DA 4HSRA 2LTPA 4C3JJ 1D1CA 2LP0A 1HF0A 4PJLA 5HLIA 3J81Z 4M9XA 4V2GA 4A93J 3BCAA 2R93J 3H9QA 5J3LA 2M0CA 4P5OA 4XKCA 1FT9A 1O4XA 1I50J 1X3ZB 5F27A 3T8RA 1XMAA 2FBKA 1D0XA 2E1NA 2IVMA 4XN3A 1W7PA 2DMNA 3RDIA 1FOYA 1OMIA 4CYCA 2G0EA 3E7LA 4M73A 3HBLA 1BN5A 5M5WJ 3ASOH 5LHIA 2MLGA 3ULQB 5BNGA 2K7LA 4AIJA 2X6YA 4OIPF 1VQ5I 1JTXA 1T33A 2R0QC 2BGCA 2X9DA 3IWZA 1O3QA 1F4KA 1W36C 4CXFA 1H89C 1E0EA 2HFHA 2RNGA 1P6RA 3MCZA 1ZN2A 2HTJA 4E7ZA 4BDZA 3ZQGA 3RSNA 4XQFA 1OCTC 2VXZA 4NNJA 2NYXA 2UZKA 1QPIA 2R3SA 2QQBA 2DFFA 4XNFA 4YIFA 2L7KA 2JWTA 4JK1X 2JUCA 5BMZA 1P4AA 2MH9A 3K4CA 4BEHA 3FF5A 4HNTA 1TNSA 4X0GA 1VTNC 2DODA 3ZN1A 3I59A 1W5TA 1ENHA 2LREA 5BPIA 2KP6A 1WH5A 2JT1A 2KIFA 3D5RC 2OF7A 2MABA 2IS4A 5D6EA 2JUGA 2L7ZA 5E3OA 1NTCA 3PNYA 3PUBA 1JJ6C 3KEQA 3QOEA 1T0FA 3VFZA 3ZN0A 3AG3H 3R6SA 2GOXB 4PJNA 2VQCA 3S3NA 3I4MJ 3CJRB 2CUFA 2L7FP 4I6ZA 2EA2A 4CZZA 3J80Z 4UY8I 1U78A 1UHWA 3P7NA 2EZHA 1BOBA 2LY2A 3DQVC 2KDOA 2XAGA 1YW9A 2E60A 2YPRA 2LY9A 3BR3A 4YRVA 1EV7A 3S16J 4ZZLA 4XORA 2ZJRF 4I2OA 1D0ZA 2GA1A 2ZC2A 4B3XA 2HU9A 5M5XJ 3G3ZA 3BQZA 4IHTA 4N4NB 2LDUA 2PQ8A 3CDHA 1HKQA 2Z16A 2RQPA 1SAXA 1P92A 1DPUA 2R7RA 3CMYA 1T8IA 3H3VK 2A6HF 3RPQA 2HTSA 4FE7A 4FCYA 2V6CA 4BE1A 2BOLA 1K6YA 3F6OA 3PSIA 1KGSA 1RPWA 2R7ZJ 1I27A 3V8LA 3MKLA 4IEJA 3CTAA 2ZNZA 3BDDA 4PSWA 4CDGA 1S8NA 3RKYA 4J19A 1ACIA 1BI0A 1W1WE 4BEHB 2HKXA 2ZSIB 2ZXIA 4BL0B 5E17F 3WU1B 2R7VA 3HOZJ 4HRIA 1Q1VA 1VQLI 2HQNA 3C2BA 4B47A 1O3SA 3HPHA 3CJTB 3DFGA 4NDLA 4X1EA 1SMYF 2CQKA 1OR7C 3HRUA 5J8FA 3OYEA 4M3FA 4G9YA 3GFJA 4S04A 3FWEA 3V8JA 3GZ6A 1HXDA 2V79A 1Y8QB 3KP6A 5DV5A 2KKOA 3CLOA 4AYBA 1MJBA 2Z1DA 1FPQA 3HOVJ 2F5FA 3CQZJ 4ZDLA 3FXKA 1L0OC 1UHSA 2HI3A 3HIFA 1MBKA 3BG3A 5FRMA 2E2IJ 4ZYGA 4D1QA 1BJZA 5DCFA 1WRJA 3QPSA 4LG0A 4M3BA 3HKZN 3DKXA 3Q9VA 5AIPA 3WHCA 4OU0A 5J1UA 1R4NB 3ZOBA 3BZKA 2JJ7A 4EEFG 2Y75A 5DM6F 3IV5A 2P5LC 4EMSA 1JHHA 1R5GA 5D8KB 1QZEA 4O5VA 1ZGWA 1ZQ3P 2ECBA 4E7JA 2VC1A 3OY9A 4OOIA 2X1EA 5F04A 4D0PA 4HNUA 1R5HA 3ZQHA 4CCLA 2KZVA 2W48A 2DT6A 3QPHA 2NS0A 2CW0F 2LH9A 4EJUA 3SJMA 3K70D 4OWRB 4MHGA 1SVMA 4RB2C 1YJWI 1B72B 4HSTA 3LNQA 5KK1A 1WKMA 1PP7U 2HPMA 4E7KA 2NXNB 1Z05A 3ROUA 2IW5A 2CUJA 2IA1A 3O8GA 5H2FC 1BA5A 5LRSA 3KP4A 4GRIA 3W6KB 4KDPA 3ZQFA 2P6TA 4ZYAA 4HYEA 2CS3A 1OJLA 1JT0A 2XSJC 1ZELA 3DLAA 4MNUA 2EFWA 1DQUA 4HLYA 3GEZA 3RI4A 4KNYA 2BE5F 3PO2J 1UG2A 2JK3A 2DDBA 2LBFA 2JA2A 3O8HA 1RRJA 3HZJA 2CFOA 4KITB 5FKKA 4C2UA 4KT5C 3CP2A 1Y0UA 3HRTA 2KPMA 1D3YA 3LSMA 3HC7A 2RVCA 2L5QA 4R79A 5F1RA 1SFKA 1TWHJ 1JJ8C 5L3DA 3BPVA 5FKOA 1DP3A 3JSOA 5F64A 1MSEC 3ABTA 2NAZA 1ZHFA 5FKLA 3HXLA 1X1PA 2IA0A 4ESJA 3N4MA 3K70C 1HW2A 5TISC 3GFLA 2IPQX 3ISPA 4B48A 4OIQF 1OISA 2E35A 4WXHA 3WTVC 5J6XA 2R7FA 4LG0B 3F0CA 2QENA 2IRFG 4ZJZA 4S0HB 5CKTA 1Z3YA 4WK8F 1E3PA 5L3GA 2PX9A 4RDUA 4CH7A 3GZ5A 2DT5A 1T0FC 2HDCA 3CESA 1TWGJ 3JTHA 2E71A 2XIGA 5E1ZB 2X4HA 3OS1A 5TRDA 4ESFA 2ISYA 2UXXA 2DQRA 1S9HA 2K3PA 4WXDA 3ASNH 3K10A 1G2HA 2M30A 2R7WA 4ZTFA 2X51A 2FQ3A 4PJ0C 1TC3C 3CUOA 3LWFA 2VQHA 4PK4A 1T56A 2DA3A 2Z3YA 5DS9A 2MLKA 1N75A 4BYYA 1AWCA 1VQ9I 1WVRA 2RREA 1D0YA 4C2MJ 1U3EM 2H1LA 1KQ0A 1GXPA 1D1BA 1QZZA 4JX4A 4HX7A 2B7EA 3RPUA 1KU9A 3PQJA 3CMMA 1WHUA 4BBRJ 1U6GA 1VZ0A 2LBFB 3VDXA 2HZTA 3BR2A 2D5VA 2V4JC 1U0JA 1Y8RB 4JX5A 2PFBA 3LQQA 4IO9F 5BPDA 4Y52J 3HSFA 5F0CA 4XK4A 2CGPA 1QHGA 2EQRA 2W85A 3ABMH 2QYOA 2R5ZB 3ZQLA 4BXUA 3N97A 4OIRF 1XGNA 1LFPA 2G7HA 1SEUA 1A35A 1FSEA 1ETOA 4CA0A 1YRNA 2L54A 2H8WA 2R5YB 5GAEJ 2EV6A 2P6SA 3IWFA 2PMUA 3KP2A 2LYCA 3H0DA 1WSUA 2OD5A 3OS2A 4NC6A 1B9MA 3V8KA 1MBJA 1IXCA 1RZ4A 2XPVA 1VQPI 1I3AA 2STWA 1MNEA 3GYHX 3UKGA 3BR5A 4R1HA 4UVBA 5D5UB 1RUOA 3H5NA 1X1BA 3M07A 4LK1F 1VQKI 3HOYJ 3DLLF 1HKTA 1BR4A 1BW6A 1EKEA 2MC4A 4EM2A 4IVNA 4A3CJ 1FLIA 1H88C 3QPTA 3FHNA 2K40A 5IYBJ 2HDWA 2L7MP 4CZCA 4F93B 1RIOH 2K02A 1CQTA 1GDTA 2HYGD 1IV6A 5E1WA 1I1GA 2HXIA 3ZMUA 2E2JJ 1T39A 1VNDA 2OU2A 3HSEA 3TMOA 2HYFA 1DPRA 1FBUA 4XM3A 1TQMA 1FX7A 2ZKZA 5EZHA 5F6FA 4DJAA 3E6BA 2KZGA 3K1PA 3KP5A 4MTDA 1QGPA 2FOKA 1UB9A 3D5LA 4IL6C 1GUUA 2K85A 4BJ6C 1A5JA 3JR9A 3ESWB 1PUFB 4MLOA 1OPCA 3WTXC 3ML6A 5FO5A 2PI0A 1KONA 1UFMA 1QRYA 3PUFA 3H9JA 4ZC3A 1QO0D 1YRNB 1MKMA 3S8PA 4BY7J 3RZDJ 3EPZA 1IZ1A 2E36A 1USTA 1JTYA 3HGYA 3HUGA 4DQ2A 4FISA 1H9GA 3QYFA 1V54H 4F7ZA 1HSJA 3TEDA 2KRCA 1CGPA 2QVOA 5J1RA 1Z1DA 3VYRB 3AG4H 2XVCA 4IQ4A 4EV0A 1SFEA 4NHJA 4YELA 1OFCX 4DBQA 3R0AA 1N77A 1MMAA 1IUYA 1YW7A 5CQGA 2NS8A 4XR6A 4N0BA 3K4BA 3ZP5A 4B4CA 5IT9K 3LQRA 3F22A 1ZLJA 2M3AA 1IGNA 4FX0A 2W82A 3P9KA 3BLYA 4MFDA 1MSFC 5TGTA 4L9NA 3GW2A 1OLTA 4ZYHA 2QQ9A 4CGZA 3C2GA 3LSGA 2BHYA 2CW8A 4Y17A 1ONVA 4HV6A 4CCOA 2VLAA 3RPUD 2BY3A 2EIJH 3RYPA 2IEKA 2XRLA 5ERIA 4XRMA 3DCFA 4AU7A 4KIBA 1FBSA 5GTHC 3I56I 5LBQA 1IV8A 3OV8A 3S2WA 4A3BJ 2AQEA 4AVPA 1FMWA 1FYKA 2P5KA 3ECHA 1WJDA 2YX4A 2XROA 1AKHA 2ZXHA 4M6XA 4KMUX 2FA5A 4YEJA 1OYYA 1R71A 1LEAA 4E7IA 3KYDB 3S1NJ 2X1CA 4BDYA 2JVHA 5B1AH 1PYVA 1K83J 1HQCA 1K78A 5FB2A 1FMVA 3S1QJ 1Q1HA 3C1DA 3QRFF 1YW8A 5DEQA 3GF2A 4MEXF 2IAIA 2RQQA 4GYGA 2HVSA 1T38A 1MMDA 3JRFA 2GXBA 1JKPC 2CRGA 2E1OA 2NVQJ 2KHMA 3HUGB 2IS6A 1ZRFA 4DW6A 4LLLA 4QSHA 1IJWC 1X1AA 3KP7A 2RGVA 4LIVA 3C18A 4MFEA 1DU0A 1XCBA 2DMUA 3HDDA 1ZR2A 1T08B 3LFUA 4U7BA 2IT0A 1V55H 1YX5A 4BS9A 5LGUA 2XB0X 4F91B 2M5WA 4I09A 3TDZC 1YS7A 1IC8A 1Z9CA 1IN7A 3NARA 1OKRA 4V2FA 2EILH 2CFXA 4WXCA 3G73A 2KL4A 2COMA 1RKTA 2ZB9A 5F0HA 1BC7C 1J09A 2MD5A 3JAMK 1YE9A 3FZVA 5F0FA 3LSPA 4XLHA 4AVZA 3CLQA 5L3EA 2EJRA 2XPWA 3BWGA 3WGHA 2KIMA 2WB1N 4RB0A 1XS9A 3HL2A 3ABLH 2CV0A 2HS5A 1S7AA 2EK5A 3KYCB 2DQLA 1ZK8A 3RKWA 1HLVA 2HYJA 3AL0B 3ERED 5D5WB 3COAC 2AXLA 2VB6A 1ZGAA 4U88A 2CUZA 1AKHB 2VODA 1ZARA 3WTUC 5J4YA 2LG4A 5B5EC 2O0YA 2XF7A 4LGWA 4MEYF 4NUBA 3OYIA 2A68F 4MIMA 3OYLA 3Q0VA 4Q48A 3FXMA 3TO7A 1P7IA 4E7SA 1K78B 2H94A 2DW4A 2VBZA 2P7CB 3WODF 3B73A 2LFBA 4XONA 2XGEA 4BJTA 2L3DA 1XSXA 1MMGA 1Z7LA 2ZO4A 2M4GA 1HA8A 3E6DA 1BI1A 3K0LA 4XLFA 3Q9SA 2X48A 1NK3P 2QBYA 2P0WA 3ZQ7A 5IOZA 3IKVA 4CYDA 4K2EA 2W4SA 5HNHA 1GLNA 3DTIA 3TBIA 1NG7A 3GXOA 2E1MB 3LSTA 2L9RA 3LSHA 5E8GA 1FOXA 1M1EB 1UHMA 4ZZDA 2RKHA 4L0YB 3VSLA 4UXNA 1VQ4I 1YJNI 2HVQA 5J40A 3FXUA 1F1ZA 4I01A 1I1SA 2XSDC 3HOXJ 4BKXA 1UMQA 3PIPF 2Y9ZA 2Z5UA 3CCVI 3KP3A 4FQGA 2Y0MA 3H92A 2KMUA 3EUHC 2O03A 4LB5A 3S3OA 4O3MA 3D0SA 1XGSA 5FRNA 3AG2H 1P4WA 1BI2A 4P9UA 2ETHA 2A69F 2OZUA 1WGXA 3HGGA 4HAMA 4XKWA 4C9YA 5JLWA 4G8XA 4DYQA 4X6AJ 3PO3J 3IAM2 2VOOA 2NNNA 2F5EA 2DLLA 2BBYA 1ZR4A 4QTRA 1IF1A 1UZCA 2FMYA 2HGCA 5K1YA 3OSFA 3A02A 2VJJA 5AONA 4EJOA 3ECOA 3I64A 3DEWA 3HPGA 3CCRI 1K6OA 1EH7A 4KN4X 3B6CA 3U1KA 4HBLA 1FZPB 2IP2A 2IBDA 4OMZA 5EYRA 3R4KA 1RETA 5L3BA 4BQOA 4R8HA 2QBYB 4GCVA 3D5SC 2XV4S 3WG7H 5TJJA 1JGGA 2ZJ2A 3HG9A 4QWQA 1BOAA 2BXYA 2E1CA 1YFHA 1NK2P 2BXZA 4IRGA 1A6IA 3X2QH 1IN4A 2M1BA 1AOYA 5LGNA 4MO7A 5FROA 3SFZA 1WZ2A 3WTSC 4A3JJ 1KYZA 3T5XA 2DMTA 1OCZH 1LVAA 4A0ZA 1O7LA 1FOKA 3L09A 5EGOB 1QBJA 2HNHA 1DGWY 4I98B 4HZFA 4M71A 2L4AA 2ISZA 5AIQA 2VN2A 3SYTA 4D7MA 3M8EA 3J7ZI 1AHDP 3TP0A 5EZGA 2IXSA 5KVRA 1LDKB 4G7ZF 4E70A 3I58A 2Y2ZA 2M8GX 1IXRC 1TQPA 1T95A 2A6TA 3BR1A 2OCCH 1G6NA 3IHUA 2F48A 5GAGJ 3MKYB 4Z2YA 3A0HC 2J5OA 5JHUA 3SXYA 1XG1A 2UXNA 2PEXA 4DYCA 3P5JA 2FNAA 2OPTA 4XLCA 3IRRA 4A0XA 1R5ID 3PQKA 4RGXA 1MGTA 1WJFA 3WG9A 1XDSA 3A0BC 4FT8A 3CCUI 2ZSHB 3ABUA 3F8FA 4ASNA 2OTJI 2FXAA 1I6HJ 1ZG3A 1EA3A 1G3YA 3BG5A 4L5JA 3KETA 2GXGA 2WAQN 1ETQA 3GX4X 3KIOA 3OYJA 5E8IA 2K9NA 1OCRH 1RESA 3KCCA 4RLFA 3GTMJ 2VJIA 3KZZA 5D4RA 4C3HJ 3KFWX 4AIHA 3VSKA 4BQNA 2VKDA 2E19A 1HBXG 4GDFA 1B1BA 1LDJA 1MBFA 2VJ5A 3JREA 2CQ7A 1ON1A 1B72A 2GWRA 2ESHA 2IGKA 2OJED 3K9TA 3VYTB 3BC8A 3E97A 3S2DJ 4M9SA 2EFQA 3GCMA 2GXAA 5ED4A 3LSRA 3GTQJ 2WBMA 2QA4I 4LOCA 4A3MJ 3S14J 1MH3A 2Z2SB 3TGNA 4NC7A 1K4SA 3CP8A 1IUFA 3TL4X 4H4KC 3GTOJ 4A69C 5EEGA 2WWYA 1VQ8I 4BQQA 1N25A 1OYIA 1D5YA 3L00A 1WFXA 4WX9A 2OZ6A 4B8XA 4W1UA 3BPXA 5C4XJ 1R1VA 2DOEA 1WWXA 3K6GA 2RAEA 3LSIA 5D5VB 1L3LA 2JA5J 3FXQA 4ANJA 1Y0NA 3QU6A 1APLC 5CVIA 4L18B 2HOSA 2HQRA 3G6EI 6PAXA 3JRAA 2EFOA 3F8MA 1O3TA 2UWMA 1Z3XA 3HKZA 3DU6A 1IRFA 2OBPA 3T8TA 2OA4A 3C3WA 2W1OA 5J47A 1IN5A 2HKOA 3K1NA 3O2PE 4A5NA 3M3YJ 1D5VA 3GTJJ 3M7GA 3G4SI 3GTKJ 2VI6A 5IP9J 3F8NA 5DCMB 1LJ9A 5IT3A 1A36A 4WCGA 3DBHB 5CYVA 4UUTA 2XGCA 4RGUA 2LMDA 2XAUA 2QF7A 3TDUC 2QGUA 2GBYA 3HB9A 5KHDA 3N05A 4E7HA 3CUQB 4A12A 3I5UA 3FMQA 3L2WA 2A61A 3QU3A 3I4NJ 2IS1A 2VQLA 1YS6A 3SFIA 2L9VA 1HDPA 2GQQA 3MN2A 4XKBA 2ACJA 2DOFA 2E34A 3RCOA 3G1LA 2P4WA 4EVIA 4A3EJ 3ZGKA 4UV9A 2HXOA 2MA3A 1FP2A 2K4JA 1YLFA 4XLEA 4UUVA 5IY5H 2R7SA 4Y33A 2DCEA 3NEUA 1TNTA 4AUXA 4YFKF 4BHPA 3RTRA 2YUSA 2Q2EA 1FJLA 3HSRA 3K4NA 3V42A 3AAFA 4A6DA 1F5TA 2R5ZA 1FP1D 1PP8F 2W24A 3MD2A 2L02A 2ICWG 5JVTA 2LY1A 1ORKA 2HWVA 3W6JB 1B59A 2A07F 1S5LC 1U5TB 4Z6YA 5FKMA 2XF5A 5HS9A 2Y30A 4UVAA 2R5YA 1EF4A 4PGHA 1GXQA 2QWWA 3RZOJ 3U9GA 2CV1A 4OAYA 2VKEA 3SHFA 1MBGA 1HDDC 2LK2A 5K7ZA 2DPUA 2NRAC 1N78A 1QZYA 1FWZA 2XB5A 2EIMH 3ABKH 1GVDA 5GAHJ 4L9VA 2PMZN 5K5QA 1X58A 2B63J 2AQFA 3U21A 4PGGA 3IH3A 4AIDA 5GP9A 2HQAA 1JKRC 3CJNA 4Y3OA 4HX4A 1GV5A 5DDGA 5FFZA 4HA8A 3W2WA 1F43A 3MZHA 3LFKA 5HNFA 4BBSJ 2K86A 5FD5A 3KZYA 2EZKA 1HCRA 3AFHA 3HJEA 3KX2A 1X1DA 2WAFA 4HPQA 3GVAA 3L7WA 1HC8A 2CG4A 2V9KA 2LKPA 3I71A 3UR3C 3BTIA 3Q0WA 3ZQCA 1ULYA 2EINH 3BG9A 2DTZA 2UV1A 3C7JA 3JTGA 1G3WA 1FIPA 1KZHA 2ELKA 2TCTA 3I53A 1FIAA 4XICA 4A3DJ 3FDYA 3TW6A 2Q2EB 2VJ4A 3OSGA 4KJZA 3K69A 3ZMVA 2ELHA 4EJTA 2VXDA 1BC8C 4LG3A 1PUFA 1ZAOA 2XUBA 4KIFA 4UB6C 3OYDA 4ETSA 3U2RA 2F2EA 5HLTA 2QQAA 3EETA 4LLGF 1XPXA 1RR7A 4JOMA 2ME0A 4QPOA 2DMPA 1SVOA 3WGGA 3MFKA 4ENKA 1UAAA 2TRTA 2XF6A 4ITVA 3HRSA 2QQ8A 4F92B 1LKXA 3KLNA 5DUKA 1SANA 1ODDA 1OQYA 1S3JA 3Q5FA 3G71I 3JRIA 1EJ9A 3G1MA 4KUMA 3G1OA 4CHUA 3F8BA 4A3FJ 1WJ5A 1VQMI 4LMYA 2K9QA 1A04A 1WCMJ 2LSOA 2E7WA 3BTCA 1BBYA 2DU9A 5DYMA 2LVSA 2W25A 1ZTRA 3CMEI 2O8XA 1C0WA 3M4OJ 1U5TC 3CJQB 2XHKA 5CLSA 2AS5F 4IHXA 3CD6I 3HOUJ 4KICA 4F55A 2X6XA 1BL0A 1LE8B 3BR0A 4ENMA 2O5RA 3HM5A 2LNBA 2V7FA 2HQ5A 3WTYC 1DUXC 5A2QK 1YX3A 1UG0A 2LC2A 3ZPLA 4UHTA 4OINF 3HYIA 4XRSA 4JYKA 1B6AA 1EH8A 1O3RA 4HOBA 2CUEA 5JLXA 5EF6A 1JGSA 2HOTA 4XRSG 1XDUA 2IA2A 4HQMA 5ICGA 2EPFA 2YU9J 1SAUA 4BACA 3DEEA 5JR3A 2QUFA 2GZWA 3HEFA 3OR2C 4O6JA 2GM4A 3KYLA 3LL7A 2V9VA 3BT9A 4U0VA 2JA7J 5B3SH 2QZ8A 1IG7A 3DKYA 4AWXB 5K7HA 1WJAA 1Z77A 4JX6A 1MJ9A 4EJVA 5JVGF 5IOYA 1TWCJ 2IGNA 2ZJQF 2FF4A 2DYRH 1MBEA 2BHZA 1TW2A 3IC7A 2W00A 3KEYA 1VF9A 3MMYB 2M9HA 2MFZA 3GMEA 1J75A 2NVYJ 2Z9OA 3L9FA 4C2TA 2O3FA 4U87A 5H6RA 1NH3A 2W7NA 2ZFUA 4YIRX 3S1MJ 4LD5A 2DYSH 1V4RA 5L3CA 3V4GA 3VOEA 4MGRA 4Q47A 3EUHA 3W2VA 3CZ6A 3L2QA 2BEOA 2DT7B 1F36A 3IH2A 1VQ7I 1FNNA 1YIOA 4MQVA 1WI3A 5GADJ 3RKQA 5F08A 2D1HA 3RIRA 3NWSA 5B1BH 1X3WB 1E3OC 4D5CA 3HTUA 5D4SA 2H1KA 4UVCA 3WTWC 1PJRA 3LAJA 5DM7F 3K4MA 1XN7A 1ZRCA 3DWLE 3OYAA 4G6TB 2L4MA 3IUOA 1G4DA 4A3LJ 1LFBA 2DA5A 2G7UA 1PDNC 2FEZA 3VYUB 3H3UA 2VBWA 5F1JA 3H35A 1IDYA 1W5CC 3FK7A 5DD8A 3QYEA 1K4TA 4OMYA 4EGYA 2QM3A 1XX5A 5BOXA 3F9KA 1QU3A 3EYYA 1P9QC 4NQWB 5C4JJ 3IP4B 2MW8A 4ZTJA 1XGMA 2RNJA 3TOAA 2ZXJA 5IPAA 2L01A 1D1AA 3K4LA 1R58A 2DPDA 2R7OA 1W0TA 4LFUA 2XAHA 4KISA 3A4CA 2ZBKA 1SD4A 2X6WA 3U1DA 3GFIA 2JA8J 3DKWA 2I5UA 4IRHA 1AA7A 3AKZA 2XGXA 1W5SA 2D1VA 2HZDA 1B4AA 3HHGA 3TO6A 5LGTA 2FSWA 1E3HA 2DA2A 3J7AO 1D8JA 2L0KA 5E20A 3NWTA 2R92J 3M1EA 1I3QJ 1Z91A 2HR3A 3HOWJ 1R4MB 5CQEA 2MG4A 2X0LA 1SFUA 1ZH5A 2KIQA 4L5EA 4WWCA 1ON2A 4B09A 2DA1A 3CDLA 1U8RA 3OYBA 4IOAF 2WA0A 4GGGA 4Q5SF 3LSKA 1WJCA 3M9AA 1ETXA 1XD7A 3NRVA 4GO1A 3QWLA 1UJ8A 5J8CA 3OMYA 2M45A 1POGA 1MMSA 3FM3A 2LKXA 4GXOA 3ZR8X 1Z21A 1G3SA 2CQQA 1J7KA 3TW7A 2YR2A 4U0YA 5IP6A 2WB1A 5KAFC 3QYBA 4RS8A 4M74A 3J7YJ 2STTA 1P7JA 2K9SA 4P96A 4B44A 4XOPA 5CVUA 1MJAA 4KA4A 4IHWA 1TP4A 4JQFA 3MWMA 1G59A 2RV8A 4PUSA 2ID3A 5FJ8J 4IX7A 2H6CA 4IQJA 4Y7NJ 2QEXI 2OQRA 2VBYA 4G7HF 1YITI 3BROA 2DJNA 3F72A 5HDNA 1S29A 3NAUA 3HRMA 3EDPA 2PJPA 4G94A 3Q0UA 3VWBA 3PSFA 4YFNF 5CVRA 4RM2A 3WGIA 2FRHA 2M4KA 4J01A 1LEBA 4EJWA 2H6BA 2M34A 4HLXA 1X4OA 2DBBA 2JQ7A 1NG6A 5HVQC 2WADA 4NB5A 4RB1A 3CO6C 1FOWA 1MZBA 1YYVA 2Y0SN 4FTHA 5J1YA 3JRDA 2BY1A 3I9V2 5E79C 2CH0A 1VQNI 1JXSA 1U2WA 2QKLB 5DD4A 4ZDPA 2K5CA 1RI7A 1KQ9A 5IYCJ 4HNVA 4A5MA 4U7DA 1ZG1A 2VASA 1R23A 2F6CA 2VKVA 1S7OA 3ZMZA 2JZYA 5IT9Z 3OL4A 3PFIA 3H1CA 4G6QA 3DPUA 4L9TA 2WC2A 1J2XA 2DO7A 1TLHB 3K7AJ 2XDVA 1TT5B 2O8KA 1JKQC 2GAUA 1ZGJA 4XL9A 3LMMA 1UCRA 4DZPA 2YU3A 1KU7A 1JHFA 1STZA 2VIXA 3SEQA 4D5FA 2OV7A 2V1DA 1HW1A 2EZIA 1I39A 3L2VA 4AIKA 5EGOA 1USSA 3ZXSA 3CCEI 3MEXA 3J80K 2A6EF 2M0MA 3FKJA 2EZLA 2P5VA 3P9IA 5C3EJ 4BU2A 2MYSA 2F5DA 2A3SA 4YFXF 5LEKA 3BR6A 3L1PA 4A3IJ 3BJ6A 2FE3A 1S72I 5K5RA 1YHQI 3WE2A 4PFOA 2ZJPF 1R1TA 5LRRA 4I7HA 2K4BA 4M6VA 5EEAA 2CSOA 2V1NA 5FFXA 3ZQIA 3DEUA 3PJRA 2L9NA 2M7AA 3VYSB 5JHFA 1T98A 3OR1C 2XPUA 2DTRA 5BS6A 1VI0A 3F23A 3OL3A 2FD5A 2BY0A 2B0LA 2CQNA 5CVJA 1SFXA 2JVGA 1R36A 1SFOJ 2KT0A 1W36D 4BUPA 2F4IA 3SQNA 3OYKA 2VT2A 3SZGA 3GLLA 1BJAA 1WQ2A 3RQIA 3H5AA 3H9GA 4HEA2 2XGDA 1QHHD 3IRQA 2WV1A 2JTVA 1OCCH 3REOA 3PL8A 2ADUA 2K9MA 3SDGA 5M5YJ 1B9NA 3QAHA 2BW3B 2AO9A 5GPCA 4HQEA 4XLAA 2JSPA 3OYCA 5FD6A 1IRZA 3E1SA 3CC4I 1QQIA 4OAZA 1FTTA 3AL0C 4HF2A 3L2RA 2IGOA 2NVXJ 3RQ4A 1LQ1A 2A05A 2KJBA 4BY1J 4S05A 4UUSA 2ZFWA 4BXXJ 2R7TA 2QKMB 3RYRA 2O6GE 1MNDA 3HTSB 2O61A 2OCEA 3OS0A 1TT0A 2ZXWH 3HHHA 3I0TA 3PNVA 5EEHA 3JAMZ 2VT3A 3M8FA 2IS2A 9ANTA 4WF2A 1CF7A 3GZNB 4BE2A 1ZYRF 4OIOF 2EFNA 3F6VA 3KEOA 5E3LA 1Z6TA 5HS8A 5EG0A 1MDMA 1RUNA 4IJAA 4IPAA 1V3FA 1RKWA 2D2WA 3F8CA 1H9TA 1E17A 2ZNYA 4Q4ZF 2NOJB 2V1UA 2Y48A 3MKZA 1TWFJ 4FX4A 4LITA 1FSHA 3BP8A 2FMLA 2JPCA 1JT6A 3WTTC 3BY6A 3WTZA 1TQIA 1I6XA 3KE2A 1W4MA 4U0WA 4UB8C 2E1MC 1YI2I 1E2XA 3GBGA 3TQNA 4M3DA 2R7UA 1HW5A 2JN6A 1YOVB 5IP7J 1IN6A 4HX8A 2KJCA 3OIQA 2RC4A 5GPAA 1I5ZA 2DAOA 1Y56A 3WHBA 2HVRA 1YQAA 4AC0A 2OAZA 4CCKA 1P4XA 3JSPA 1SMTA 4KFCA 4D9JA 3GWZA 4IKFA 2WAQA 5D6FA 5DTDA 4I76A 1IXSB 3LA7A 1U9OA 1JUSA 2V6EA 2HOEA 1O7FA 4AM3A 1KU3A 1O57A 5DCMA 1SC7A 4EM1A 4CUGA 1X2NA 1Z0XA 3A03A 5KAIC 3QODA 4ON0A 2R7XA 1TL8A 1W7PB 4M9ZA 4UUSB 2OTLI 4CYCB 3C2HA 4CICA 1R49A 2JA6J 4ZDOA 2ZMEA 5D8LB 2FX0A 1JUPA 1WI9A 3GTPJ 4V19K 4I99C 1LB2A 5H6QA 2EA4A 3CUQA 3B02A 1CF7B 4M3GA 4A2UA 3IL2A 3DP7A 1GT0C 5EG0B 1MDMB 4IHYA 1HSTA 1BW5A 2D45A 1MIJA 2UUZA 5FLVA 2XC7A 4ZH4F 1Y6IA 3PFYA 2Y69H 2YS9A 2FJ1A 1LFUP 3A01A 4MQ9F 4IOCF 1Y39A 5M3FJ 3TP3A 2CV2A 2MBFA 1MMNA 3AG1H 1DDNA 1DU6A 3CO7C 3E0JB 3DTEA 4CCMA 4DIQA 1ITYA 2FBIA 1IDZA 3QP5A 3A1YA 1U5TA 3V7SA 4A6EA 4LIUA 2ZCWA 1EH6A 5FLMJ 2EWNA 3I59B 1VQ6I 1JKOC 3GO5A 2ESNA 4B43A 4ENNA 3BQYA 2BYVE 3BOQA 2KRHA 5ICFA 5KCMA 5FLXK 4II3A 4UNOA 3S32A 1S7EA 5ILSA 2JPBA 3H0GJ 3EQLF 1W7PD 3QQAA 3V7RA 2F4MB 4W97A 3CC7I 2PG4A 2E5NA 1RR8C 2CMPA 1D8KA 2KIUA 4IRIA 2COBA 1X19A 5C44J 1SVLA 3MKWB 4HF0A 1AU7A 1BR2A 2NS7A 4AYBN 1FYMA 5K7FA 5EDNA 3W6VA 4QIWN 1OCPA 1SD6A 2PMHA 2ZMEB 2LOOA 1XMXA 4E7LA 3I4PA 2AHQA 4XLNF 1TWAJ 3D1NI 1K7AA 2LF7A 5CPRB 3QPLA 1IRGA 1X1CA 1ZG5A 2B9SA 4IHSA 2P81A 3W2AA 2P7VB 3GLXA 1TBXA 2Y9YA 2J5PA 4XSXF 2MGQA 3E5QA 2DDAA 1PUEE 3OYFA 2LR8A 3BCBA 4PJMA 2DN0A 4XKVA 3I55I 3A01B 3TOBA 4RA2A 2KRFA 4IZZA 1R1UA 2Q1ZB 1FYLA 1IAWA 4G7OF 1LUJB 2QCOA 4KIGA 4LJZF 3OYMA 3MVPA 1X4PA 3BJAA 2LLKA 1TZLA 2OQGA 4LLNA 2YX7A 3R61A 2W57A 4II2A 2L2OA 2VPRA 3CCQI 3IAS2 3PM1A 4XSZF 3OIOA 1MD0A 2X1DA 2DK8A 3CDIA 3EUAA 2LRDA 4HDVA 3KLOA 2WTEA 2PMZA 2DMQA 3BG6A 4XLPF 3I54A 3E5XA 2X85A 3FXLA 1QNTA 2DFIA
chains in the Genus database with same CATH topology
2XRNA 2H27A 1TW3A 2M8EA 4BHBA 3ELKA 2MC3A 5BQTA 1RNLA 3DF8A 1J0RA 2EFPA 4I0AA 4N9HA 2E7XA 4RB3C 4ESBA 4ZYDA 1ZRDA 4RGSA 1FC3A 3MAJA 5ICEA 2M87A 4HW0A 3RKXA 1Z6RA 3SZPA 4M72A 4FHTA 3WE3A 3FMSA 4L5IA 3GUDA 3BJOA 3E6MA 3L2CA 5JI6A 1BIAA 1KQ8A 4M6YA 4Y13A 4BQAA 4IXAA 5FLXZ 4HF1A 3CUQC 3F3XA 4DNCA 2Z33A 4BH9A 2VC0A 1XGOA 4H0EA 2V1XA 1LDDA 1Z7UA 3QOPA 3LAPA 2K27A 4KN7X 3QP6A 2EV0A 5HLHA 3K2ZA 1XSVA 4YG2F 2CYYA 3JW4A 4JBAA 4TV7A 3O6BB 1HKSA 1H0MA 3P9CA 4XBFA 2RDPA 4G6DA 4GYIA 2PBIA 3MQ0A 3HOSA 4L9JA 5K5OA 1KYWA 1SD7A 3HOTA 2VBXA 2FBHA 2GA2A 2PLYA 1R7JA 4NQWA 1KU2A 1J5YA 1BI3A 2XASA 5HDGA 1BIBA 3DV8A 4N9IA 4P9FA 1TTYA 2DI3A 1YTYA 2WV0A 2JRTA 2XAQA 2QLZA 1R00A 1XB4A 2Q8KA 5CVVA 2EV5A 3EYIA 2JSCA 3VEPA 3FHZA 1S6LA 2H09A 3F21A 1KA8A 1FY7A 1ZREA 1IW7F 1J9IA 3WU0A 4XRFA 5HLGA 3R0JA 4PDKA 5LHGA 5DUIA 2Q0OA 3FMRA 5CJ9A 3OOPA 3TO9A 2HEOA 5JFRA 5HDKA 4PZJA 2G9WA 4QLCU 4I0BA 5H20A 4ZYEA 1P2FA 3R60A 5LEJA 5E18F 4AD9A 3T1BA 4BAYA 3LA2A 2MH2A 2CO5A 5ILVA 1JE8A 3O3KA 4EGZA 4UV8A 3T0YA 3IKTA 4RAYA 3DPTA 4KMFA 1IN8A 1SD5A 4YIIA 2XAFA 1YO5C 1K79A 2BV6A 2P8TA 3DPLC 5LHHA 2FU4A 3RJPA 1OYWA 3NQOA 4HDUA 3BZ6A 1LNWA 3FXRA 1XCVA 2DK5A 1T2KA 5D5XB 4PCQA 1XSDA 5E1XA 3J81K 5HOOA 2VE9A 4ENJA 3ZMTA 4LB6B 3MZYA 3GFMA 1QPMA 3DXJF 5L3FA 3FM5A 5A2QZ 2PN6A 1T6SA 1X3UA 4A0YA 4IF4A 4EQQA 3VODA 2YSRA 1J59A 1XMKA 2FNPA 3VB2A 1GVJA 4MTEA 3K1MA 1F9NA 2A5YB 1R22A 2EB7A 3E3VA 3ZMSA 3E5UA 4I02A 4RAZA 5HS7A 5ICCA 1YG2A 4LK0F 4EM0B 2W84A 4P55A 2TDXA 2VONA 4KYWA 1ZLKA 2IJLA 3TKYA 2Z99A 3ZMDA 1BM9A 2XAJA 1REPC 1FBQA 3SZTA 2GIVA 3V7CA 4Y15A 2CWEA 5ILUA 2RN7A 1OR7A 1GHCA 3H3ZA 2XKPA 1G3TA 5FGMA 3FX3A 2VE8A 2VOPA 4BHCA 2NNYA 2XKOA 1DP7P 2R7DA 1NHAA 4RGRA 4L0ZB 2F5CA 4HV5A 4BNCA 5LLQA 4CO8A 3LA3A 2LF8A 3E6CC 2C6YA 5HLIA 3J81Z 4M9XA 4P5OA 1FT9A 3T8RA 1XMAA 2FBKA 2E1NA 2IVMA 1W7PA 3RDIA 1OMIA 4M73A 1BN5A 5LHIA 2MLGA 3ULQB 2K7LA 4AIJA 4OIPF 2BGCA 3IWZA 1O3QA 1F4KA 4CXFA 2HFHA 1P6RA 3MCZA 1ZN2A 2HTJA 2VXZA 2NYXA 2UZKA 2R3SA 2QQBA 4YIFA 4JK1X 5BMZA 1P4AA 2MH9A 3FF5A 1TNSA 1VTNC 3ZN1A 3I59A 1W5TA 5BPIA 2JT1A 2KIFA 5D6EA 3KEQA 1T0FA 3VFZA 3ZN0A 3R6SA 2EA2A 4CZZA 3J80Z 1U78A 1UHWA 3P7NA 3DQVC 2XAGA 1YW9A 2YPRA 1EV7A 4ZZLA 4I2OA 2GA1A 3G3ZA 4IHTA 2LDUA 2PQ8A 3CDHA 1HKQA 2RQPA 1SAXA 1P92A 1DPUA 2A6HF 3RPQA 2HTSA 2V6CA 3F6OA 1KGSA 1I27A 3V8LA 3CTAA 2ZNZA 3BDDA 4CDGA 1S8NA 3RKYA 1BI0A 2HKXA 5E17F 3WU1B 2HQNA 1O3SA 3DFGA 5J8FA 1SMYF 2CQKA 3HRUA 4G9YA 3GFJA 4S04A 3FWEA 3V8JA 3GZ6A 1HXDA 2V79A 3KP6A 5DV5A 2KKOA 3CLOA 1MJBA 1FPQA 2F5FA 1L0OC 3HIFA 4ZYGA 5DCFA 1WRJA 4LG0A 5AIPA 3Q9VA 4OU0A 2Y75A 2P5LC 4EMSA 1JHHA 1R5GA 5D8KB 4O5VA 2VC1A 4OOIA 4D0PA 1R5HA 3QPHA 2NS0A 2CW0F 4EJUA 4MHGA 4RB2C 5KK1A 1WKMA 1PP7U 1Z05A 3ROUA 2IW5A 2IA1A 5LRSA 3KP4A 3W6KB 4KDPA 2P6TA 4HYEA 2EFWA 4MNUA 3RI4A 4HLYA 3GEZA 4KNYA 2BE5F 4KT5C 1Y0UA 3HRTA 1D3YA 2RVCA 4R79A 5F1RA 5L3DA 3BPVA 3JSOA 5F64A 3ABTA 2NAZA 1ZHFA 2IA0A 4ESJA 3N4MA 1HW2A 3GFLA 2IPQX 3ISPA 4OIQF 4WXHA 3WTVC 5J6XA 2R7FA 4LG0B 2QENA 2IRFG 4WK8F 5L3GA 3GZ5A 2DT5A 2HDCA 3JTHA 2XIGA 5E1ZB 2X4HA 5TRDA 4ESFA 2ISYA 2UXXA 2DQRA 4WXDA 2M30A 2FQ3A 3CUOA 3LWFA 2Z3YA 2MLKA 4BYYA 1AWCA 1U3EM 1KQ0A 1GXPA 1QZZA 4HX7A 3RPUA 1KU9A 3PQJA 1U6GA 2HZTA 2PFBA 3LQQA 5BPDA 3HSFA 2CGPA 2W85A 2QYOA 4BXUA 3N97A 4OIRF 1XGNA 2G7HA 1FSEA 2L54A 2EV6A 2P6SA 3IWFA 2PMUA 3KP2A 1WSUA 2OD5A 1B9MA 3V8KA 1IXCA 1RZ4A 2STWA 3GYHX 4R1HA 4UVBA 5D5UB 1RUOA 4LK1F 1HKTA 4EM2A 4IVNA 1FLIA 3QPTA 1RIOH 2K02A 2HYGD 5E1WA 1I1GA 3ZMUA 1T39A 2OU2A 3HSEA 2HYFA 1DPRA 1FBUA 1TQMA 1FX7A 2ZKZA 5F6FA 3E6BA 3K1PA 3KP5A 4MTDA 1QGPA 2FOKA 1UB9A 3D5LA 1OPCA 3WTXC 3ML6A 5FO5A 2PI0A 1UFMA 1QO0D 1MKMA 1IZ1A 1USTA 3HUGA 4DQ2A 1H9GA 4F7ZA 1HSJA 1CGPA 2QVOA 1Z1DA 2XVCA 4EV0A 1SFEA 4NHJA 3R0AA 1IUYA 1YW7A 4N0BA 3ZP5A 5IT9K 3LQRA 3F22A 1ZLJA 4FX0A 3P9KA 4L9NA 3GW2A 4ZYHA 2QQ9A 4CGZA 4Y17A 1ONVA 4HV6A 3RYPA 5ERIA 4KIBA 1FBSA 5LBQA 3OV8A 3S2WA 4AVPA 1FYKA 2P5KA 3ECHA 2YX4A 2XROA 4M6XA 4KMUX 2FA5A 1OYYA 1LEAA 1HQCA 1K78A 5FB2A 1Q1HA 3C1DA 3QRFF 1YW8A 5DEQA 3GF2A 4MEXF 4GYGA 1T38A 2GXBA 1ZRFA 4LLLA 3KP7A 2RGVA 3C18A 1XCBA 4U7BA 2IT0A 5LGUA 2M5WA 4I09A 3TDZC 1YS7A 1Z9CA 1IN7A 1OKRA 2CFXA 4WXCA 3G73A 2COMA 1BC7C 2MD5A 3JAMK 3FZVA 5L3EA 2EJRA 3BWGA 3WGHA 2KIMA 4RB0A 2HS5A 1S7AA 2EK5A 2DQLA 3RKWA 3ERED 5D5WB 3COAC 2AXLA 1ZGAA 4U88A 2VODA 1ZARA 3WTUC 2O0YA 4LGWA 4MEYF 2A68F 4Q48A 3TO7A 1K78B 2H94A 2DW4A 2VBZA 2P7CB 3WODF 3B73A 2L3DA 1XSXA 2ZO4A 3E6DA 1BI1A 3K0LA 3Q9SA 2QBYA 3ZQ7A 3IKVA 4CYDA 4K2EA 3GXOA 3LSTA 5E8GA 1UHMA 4ZZDA 2RKHA 4L0YB 4UXNA 3FXUA 1F1ZA 4I01A 1I1SA 2Z5UA 3KP3A 2Y0MA 3H92A 2O03A 4LB5A 4O3MA 3D0SA 1XGSA 1P4WA 1BI2A 4P9UA 2ETHA 2A69F 2OZUA 4HAMA 4G8XA 2VOOA 2NNNA 2F5EA 2DLLA 2BBYA 1IF1A 2FMYA 2HGCA 5K1YA 5AONA 4EJOA 3ECOA 3I64A 1K6OA 1EH7A 4KN4X 4HBLA 1FZPB 2IP2A 4OMZA 3R4KA 5L3BA 4R8HA 2QBYB 4GCVA 2XV4S 5TJJA 2ZJ2A 4QWQA 1BOAA 2E1CA 1YFHA 4IRGA 1IN4A 2M1BA 1AOYA 5LGNA 3SFZA 3WTSC 1KYZA 3T5XA 1LVAA 4A0ZA 1O7LA 1FOKA 3L09A 1QBJA 4I98B 4M71A 4HZFA 2L4AA 2ISZA 5AIQA 2VN2A 3M8EA 5KVRA 1LDKB 4G7ZF 4E70A 3I58A 1IXRC 1TQPA 1G6NA 3IHUA 4Z2YA 2J5OA 5JHUA 3SXYA 2UXNA 2PEXA 2FNAA 3IRRA 4A0XA 3PQKA 4RGXA 1MGTA 3WG9A 1XDSA 4FT8A 3ABUA 3F8FA 4ASNA 2FXAA 1ZG3A 1G3YA 3KETA 3GX4X 4L5JA 2GXGA 5E8IA 3KCCA 3KZZA 5D4RA 3KFWX 4AIHA 1HBXG 1B1BA 1LDJA 1ON1A 2GWRA 2ESHA 3K9TA 3E97A 4M9SA 2EFQA 5ED4A 3TGNA 5EEGA 2WWYA 1OYIA 3L00A 4WX9A 2OZ6A 4B8XA 3BPXA 1R1VA 5D5VB 1WWXA 1L3LA 3FXQA 3QU6A 5CVIA 4L18B 2HQRA 6PAXA 2EFOA 3F8MA 1O3TA 2UWMA 1IRFA 2OBPA 3T8TA 2OA4A 3C3WA 1IN5A 2HKOA 3K1NA 3O2PE 4A5NA 1D5VA 3M7GA 3F8NA 5DCMB 1LJ9A 5IT3A 4WCGA 5CYVA 4RGUA 3TDUC 3CUQB 4A12A 3I5UA 3FMQA 2A61A 3QU3A 1YS6A 2GQQA 2ACJA 4EVIA 2P4WA 4UV9A 2MA3A 1FP2A 2K4JA 1YLFA 4UUVA 3NEUA 1TNTA 4YFKF 4BHPA 3RTRA 2Q2EA 3HSRA 3AAFA 4A6DA 1F5TA 1FP1D 1PP8F 2W24A 2L02A 5JVTA 2HWVA 3W6JB 1B59A 2A07F 1U5TB 5HS9A 4UVAA 4PGHA 1GXQA 2QWWA 3U9GA 3SHFA 2DPUA 2NRAC 1QZYA 1FWZA 4L9VA 5K5QA 4PGGA 3CJNA 4HX4A 5DDGA 5FFZA 4HA8A 3MZHA 3LFKA 2K86A 5FD5A 3KZYA 3GVAA 3L7WA 2CG4A 2LKPA 3I71A 1ULYA 3C7JA 3JTGA 1G3WA 3I53A 3K69A 3ZMVA 2ELHA 4EJTA 1BC8C 1ZAOA 2XUBA 4KIFA 4ETSA 3U2RA 2F2EA 2QQAA 3EETA 4LLGF 3WGGA 3MFKA 4ENKA 3HRSA 3KLNA 5DUKA 1ODDA 1S3JA 3Q5FA 4KUMA 4CHUA 3F8BA 4LMYA 1A04A 2LSOA 2E7WA 1BBYA 2DU9A 5DYMA 2W25A 2O8XA 1C0WA 1U5TC 2XHKA 5CLSA 2AS5F 4KICA 4ENMA 2LNBA 3WTYC 1DUXC 5A2QK 3ZPLA 4UHTA 4OINF 3HYIA 1B6AA 1EH8A 1O3RA 4HOBA 1JGSA 1XDUA 2IA2A 4HQMA 5ICGA 5JR3A 2QUFA 2GZWA 4O6JA 2V9VA 4U0VA 2QZ8A 4AWXB 1MJ9A 4EJVA 2FF4A 1TW2A 3IC7A 1J75A 2Z9OA 3L9FA 2O3FA 5H6RA 4LD5A 1V4RA 5L3CA 3V4GA 3VOEA 4MGRA 4Q47A 3EUHA 2BEOA 1FNNA 1YIOA 4MQVA 2D1HA 3RIRA 3HTUA 5D4SA 4UVCA 3WTWC 3LAJA 1XN7A 1ZRCA 2L4MA 1G4DA 2G7UA 1PDNC 2FEZA 3H3UA 2VBWA 5DD8A 4OMYA 4EGYA 2QM3A 5BOXA 3EYYA 1XGMA 2RNJA 3TOAA 2ZXJA 2L01A 1R58A 2DPDA 4LFUA 2XAHA 2ZBKA 1SD4A 3U1DA 3GFIA 3DKWA 4IRHA 2XGXA 1W5SA 2D1VA 1B4AA 3HHGA 3TO6A 5LGTA 2FSWA 1D8JA 3J7AO 5E20A 3M1EA 1Z91A 2HR3A 2X0LA 1SFUA 1ZH5A 4WWCA 1U8RA 1ON2A 4B09A 4GGGA 4Q5SF 3M9AA 1XD7A 3NRVA 4GO1A 5J8CA 2M45A 3FM3A 4GXOA 1G3SA 1J7KA 2YR2A 4U0YA 4RS8A 4M74A 2STTA 4P96A 5CVUA 1MJAA 4KA4A 4JQFA 3MWMA 2RV8A 2H6CA 2OQRA 2VBYA 4G7HF 3BROA 3F72A 5HDNA 1S29A 3HRMA 3EDPA 2PJPA 4G94A 4YFNF 5CVRA 3WGIA 2FRHA 1LEBA 4EJWA 2H6BA 4HLXA 2DBBA 5HVQC 3CO6C 4NB5A 4RB1A 1MZBA 1YYVA 1JXSA 1U2WA 5DD4A 1RI7A 1KQ9A 4A5MA 4U7DA 1ZG1A 1R23A 1S7OA 3ZMZA 2JZYA 5IT9Z 3PFIA 4G6QA 4L9TA 2WC2A 1J2XA 2DO7A 1TLHB 2GAUA 1ZGJA 1UCRA 2YU3A 1KU7A 1JHFA 1STZA 2V1DA 1HW1A 4AIKA 1USSA 3MEXA 3J80K 2A6EF 2P5VA 3P9IA 2F5DA 2A3SA 4YFXF 5LEKA 3BJ6A 2FE3A 5K5RA 3WE2A 1R1TA 5LRRA 4I7HA 2K4BA 2CSOA 5FFXA 3DEUA 1T98A 2DTRA 5BS6A 3F23A 2B0LA 5CVJA 1SFXA 1R36A 3SQNA 2VT2A 1BJAA 1WQ2A 3IRQA 2JTVA 3REOA 2ADUA 1B9NA 3QAHA 4HQEA 5FD6A 1QQIA 4HF2A 1LQ1A 2KJBA 4S05A 2ZFWA 2O6GE 3RYRA 3HTSB 2O61A 3HHHA 3I0TA 5EEHA 3JAMZ 2VT3A 3M8FA 4WF2A 1CF7A 1ZYRF 4OIOF 2EFNA 3F6VA 3KEOA 5HS8A 1Z6TA 1MDMA 1RUNA 4IJAA 4IPAA 1V3FA 2D2WA 3F8CA 1H9TA 1E17A 2ZNYA 4Q4ZF 2V1UA 2Y48A 4FX4A 1FSHA 3BP8A 2FMLA 2JPCA 3WTTC 3BY6A 3WTZA 1TQIA 1I6XA 3KE2A 1W4MA 4U0WA 1E2XA 3TQNA 1HW5A 1IN6A 4HX8A 2KJCA 2RC4A 1I5ZA 2DAOA 1YQAA 2OAZA 3JSPA 1P4XA 1SMTA 4KFCA 3GWZA 5D6FA 1IXSB 3LA7A 2HOEA 1O7FA 1KU3A 1O57A 5DCMA 4EM1A 4ON0A 1W7PB 4M9ZA 4CICA 2ZMEA 5D8LB 1WI9A 1LB2A 5H6QA 2EA4A 3CUQA 3B02A 1CF7B 4A2UA 3IL2A 3DP7A 1MDMB 1HSTA 2D45A 4ZH4F 4MQ9F 2MBFA 1DDNA 3CO7C 2FBIA 3QP5A 1U5TA 3V7SA 4A6EA 2ZCWA 1EH6A 2EWNA 3I59B 3GO5A 2ESNA 4ENNA 2BYVE 3BOQA 5ICFA 5FLXK 4UNOA 5ILSA 2JPBA 3EQLF 1W7PD 3V7RA 2PG4A 1D8KA 2KIUA 4IRIA 4HF0A 1FYMA 1SD6A 2PMHA 2ZMEB 3I4PA 4XLNF 1K7AA 2LF7A 1IRGA 1ZG5A 4IHSA 2P7VB 3GLXA 1TBXA 2J5PA 4XSXF 3E5QA 1PUEE 3TOBA 2KRFA 1R1UA 1FYLA 1IAWA 4G7OF 4KIGA 4LJZF 3BJAA 2OQGA 4LLNA 2YX7A 3R61A 2W57A 4XSZF 1MD0A 2DK8A 4HDVA 3KLOA 2WTEA 4XLPF 3I54A 3E5XA 1QNTA 2DFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRN A;  2H27 A;  1TW3 A;  2M8E A;  4BHB A;  3ELK A;  2MC3 A;  5BQT A;  1RNL A;  3DF8 A;  1J0R A;  2EFP A;  4I0A A;  4N9H A;  2E7X A;  4RB3 C;  4ESB A;  4ZYD A;  1ZRD A;  4RGS A;  1FC3 A;  3MAJ A;  5ICE A;  2M87 A;  4HW0 A;  3RKX A;  1Z6R A;  3SZP A;  4M72 A;  4FHT A;  3WE3 A;  3FMS A;  4L5I A;  3GUD A;  3BJO A;  3E6M A;  3L2C A;  5JI6 A;  1BIA A;  1KQ8 A;  4M6Y A;  4Y13 A;  4BQA A;  4IXA A;  5FLX Z;  4HF1 A;  3CUQ C;  3F3X A;  4DNC A;  2Z33 A;  4BH9 A;  2VC0 A;  1XGO A;  4H0E A;  2V1X A;  1LDD A;  1Z7U A;  3QOP A;  3LAP A;  2K27 A;  4KN7 X;  3QP6 A;  2EV0 A;  5HLH A;  3K2Z A;  1XSV A;  4YG2 F;  2CYY A;  3JW4 A;  4JBA A;  4TV7 A;  3O6B B;  1HKS A;  1H0M A;  3P9C A;  4XBF A;  2RDP A;  4G6D A;  4GYI A;  2PBI A;  3MQ0 A;  3HOS A;  4L9J A;  5K5O A;  1KYW A;  1SD7 A;  3HOT A;  2VBX A;  2FBH A;  2GA2 A;  2PLY A;  1R7J A;  4NQW A;  1KU2 A;  1J5Y A;  1BI3 A;  2XAS A;  5HDG A;  1BIB A;  3DV8 A;  4N9I A;  4P9F A;  1TTY A;  2DI3 A;  1YTY A;  2WV0 A;  2JRT A;  2XAQ A;  2QLZ A;  1R00 A;  1XB4 A;  2Q8K A;  5CVV A;  2EV5 A;  3EYI A;  2JSC A;  3VEP A;  3FHZ A;  1S6L A;  2H09 A;  3F21 A;  1KA8 A;  1FY7 A;  1ZRE A;  1IW7 F;  1J9I A;  3WU0 A;  4XRF A;  5HLG A;  3R0J A;  4PDK A;  5LHG A;  5DUI A;  2Q0O A;  3FMR A;  5CJ9 A;  3OOP A;  3TO9 A;  2HEO A;  5JFR A;  5HDK A;  4PZJ A;  2G9W A;  4QLC U;  4I0B A;  5H20 A;  4ZYE A;  1P2F A;  3R60 A;  5LEJ A;  5E18 F;  4AD9 A;  3T1B A;  4BAY A;  3LA2 A;  2MH2 A;  2CO5 A;  5ILV A;  1JE8 A;  3O3K A;  4EGZ A;  4UV8 A;  3T0Y A;  3IKT A;  4RAY A;  3DPT A;  4KMF A;  1IN8 A;  1SD5 A;  4YII A;  2XAF A;  1YO5 C;  1K79 A;  2BV6 A;  2P8T A;  3DPL C;  5LHH A;  2FU4 A;  3RJP A;  1OYW A;  3NQO A;  4HDU A;  3BZ6 A;  1LNW A;  3FXR A;  1XCV A;  2DK5 A;  1T2K A;  5D5X B;  4PCQ A;  1XSD A;  5E1X A;  3J81 K;  5HOO A;  2VE9 A;  4ENJ A;  3ZMT A;  4LB6 B;  3MZY A;  3GFM A;  1QPM A;  3DXJ F;  5L3F A;  3FM5 A;  5A2Q Z;  2PN6 A;  1T6S A;  1X3U A;  4A0Y A;  4IF4 A;  4EQQ A;  3VOD A;  2YSR A;  1J59 A;  1XMK A;  2FNP A;  3VB2 A;  1GVJ A;  4MTE A;  3K1M A;  1F9N A;  2A5Y B;  1R22 A;  2EB7 A;  3E3V A;  3ZMS A;  3E5U A;  4I02 A;  4RAZ A;  5HS7 A;  5ICC A;  1YG2 A;  4LK0 F;  4EM0 B;  2W84 A;  4P55 A;  2TDX A;  2VON A;  4KYW A;  1ZLK A;  2IJL A;  3TKY A;  2Z99 A;  3ZMD A;  1BM9 A;  2XAJ A;  1REP C;  1FBQ A;  3SZT A;  2GIV A;  3V7C A;  4Y15 A;  2CWE A;  5ILU A;  2RN7 A;  1OR7 A;  1GHC A;  3H3Z A;  2XKP A;  1G3T A;  5FGM A;  3FX3 A;  2VE8 A;  2VOP A;  4BHC A;  2NNY A;  2XKO A;  1DP7 P;  2R7D A;  1NHA A;  4RGR A;  4L0Z B;  2F5C A;  4HV5 A;  4BNC A;  5LLQ A;  4CO8 A;  3LA3 A;  2LF8 A;  3E6C C;  2C6Y A;  5HLI A;  3J81 Z;  4M9X A;  4P5O A;  1FT9 A;  3T8R A;  1XMA A;  2FBK A;  2E1N A;  2IVM A;  1W7P A;  3RDI A;  1OMI A;  4M73 A;  1BN5 A;  5LHI A;  2MLG A;  3ULQ B;  2K7L A;  4AIJ A;  4OIP F;  2BGC A;  3IWZ A;  1O3Q A;  1F4K A;  4CXF A;  2HFH A;  1P6R A;  3MCZ A;  1ZN2 A;  2HTJ A;  2VXZ A;  2NYX A;  2UZK A;  2R3S A;  2QQB A;  4YIF A;  4JK1 X;  5BMZ A;  1P4A A;  2MH9 A;  3FF5 A;  1TNS A;  1VTN C;  3ZN1 A;  3I59 A;  1W5T A;  5BPI A;  2JT1 A;  2KIF A;  5D6E A;  3KEQ A;  1T0F A;  3VFZ A;  3ZN0 A;  3R6S A;  2EA2 A;  4CZZ A;  3J80 Z;  1U78 A;  1UHW A;  3P7N A;  3DQV C;  2XAG A;  1YW9 A;  2YPR A;  1EV7 A;  4ZZL A;  4I2O A;  2GA1 A;  3G3Z A;  4IHT A;  2LDU A;  2PQ8 A;  3CDH A;  1HKQ A;  2RQP A;  1SAX A;  1P92 A;  1DPU A;  2A6H F;  3RPQ A;  2HTS A;  2V6C A;  3F6O A;  1KGS A;  1I27 A;  3V8L A;  3CTA A;  2ZNZ A;  3BDD A;  4CDG A;  1S8N A;  3RKY A;  1BI0 A;  2HKX A;  5E17 F;  3WU1 B;  2HQN A;  1O3S A;  3DFG A;  5J8F A;  1SMY F;  2CQK A;  3HRU A;  4G9Y A;  3GFJ A;  4S04 A;  3FWE A;  3V8J A;  3GZ6 A;  1HXD A;  2V79 A;  3KP6 A;  5DV5 A;  2KKO A;  3CLO A;  1MJB A;  1FPQ A;  2F5F A;  1L0O C;  3HIF A;  4ZYG A;  5DCF A;  1WRJ A;  4LG0 A;  5AIP A;  3Q9V A;  4OU0 A;  2Y75 A;  2P5L C;  4EMS A;  1JHH A;  1R5G A;  5D8K B;  4O5V A;  2VC1 A;  4OOI A;  4D0P A;  1R5H A;  3QPH A;  2NS0 A;  2CW0 F;  4EJU A;  4MHG A;  4RB2 C;  5KK1 A;  1WKM A;  1PP7 U;  1Z05 A;  3ROU A;  2IW5 A;  2IA1 A;  5LRS A;  3KP4 A;  3W6K B;  4KDP A;  2P6T A;  4HYE A;  2EFW A;  4MNU A;  3RI4 A;  4HLY A;  3GEZ A;  4KNY A;  2BE5 F;  4KT5 C;  1Y0U A;  3HRT A;  1D3Y A;  2RVC A;  4R79 A;  5F1R A;  5L3D A;  3BPV A;  3JSO A;  5F64 A;  3ABT A;  2NAZ A;  1ZHF A;  2IA0 A;  4ESJ A;  3N4M A;  1HW2 A;  3GFL A;  2IPQ X;  3ISP A;  4OIQ F;  4WXH A;  3WTV C;  5J6X A;  2R7F A;  4LG0 B;  2QEN A;  2IRF G;  4WK8 F;  5L3G A;  3GZ5 A;  2DT5 A;  2HDC A;  3JTH A;  2XIG A;  5E1Z B;  2X4H A;  5TRD A;  4ESF A;  2ISY A;  2UXX A;  2DQR A;  4WXD A;  2M30 A;  2FQ3 A;  3CUO A;  3LWF A;  2Z3Y A;  2MLK A;  4BYY A;  1AWC A;  1U3E M;  1KQ0 A;  1GXP A;  1QZZ A;  4HX7 A;  3RPU A;  1KU9 A;  3PQJ A;  1U6G A;  2HZT A;  2PFB A;  3LQQ A;  5BPD A;  3HSF A;  2CGP A;  2W85 A;  2QYO A;  4BXU A;  3N97 A;  4OIR F;  1XGN A;  2G7H A;  1FSE A;  2L54 A;  2EV6 A;  2P6S A;  3IWF A;  2PMU A;  3KP2 A;  1WSU A;  2OD5 A;  1B9M A;  3V8K A;  1IXC A;  1RZ4 A;  2STW A;  3GYH X;  4R1H A;  4UVB A;  5D5U B;  1RUO A;  4LK1 F;  1HKT A;  4EM2 A;  4IVN A;  1FLI A;  3QPT A;  1RIO H;  2K02 A;  2HYG D;  5E1W A;  1I1G A;  3ZMU A;  1T39 A;  2OU2 A;  3HSE A;  2HYF A;  1DPR A;  1FBU A;  1TQM A;  1FX7 A;  2ZKZ A;  5F6F A;  3E6B A;  3K1P A;  3KP5 A;  4MTD A;  1QGP A;  2FOK A;  1UB9 A;  3D5L A;  1OPC A;  3WTX C;  3ML6 A;  5FO5 A;  2PI0 A;  1UFM A;  1QO0 D;  1MKM A;  1IZ1 A;  1UST A;  3HUG A;  4DQ2 A;  1H9G A;  4F7Z A;  1HSJ A;  1CGP A;  2QVO A;  1Z1D A;  2XVC A;  4EV0 A;  1SFE A;  4NHJ A;  3R0A A;  1IUY A;  1YW7 A;  4N0B A;  3ZP5 A;  5IT9 K;  3LQR A;  3F22 A;  1ZLJ A;  4FX0 A;  3P9K A;  4L9N A;  3GW2 A;  4ZYH A;  2QQ9 A;  4CGZ A;  4Y17 A;  1ONV A;  4HV6 A;  3RYP A;  5ERI A;  4KIB A;  1FBS A;  5LBQ A;  3OV8 A;  3S2W A;  4AVP A;  1FYK A;  2P5K A;  3ECH A;  2YX4 A;  2XRO A;  4M6X A;  4KMU X;  2FA5 A;  1OYY A;  1LEA A;  1HQC A;  1K78 A;  5FB2 A;  1Q1H A;  3C1D A;  3QRF F;  1YW8 A;  5DEQ A;  3GF2 A;  4MEX F;  4GYG A;  1T38 A;  2GXB A;  1ZRF A;  4LLL A;  3KP7 A;  2RGV A;  3C18 A;  1XCB A;  4U7B A;  2IT0 A;  5LGU A;  2M5W A;  4I09 A;  3TDZ C;  1YS7 A;  1Z9C A;  1IN7 A;  1OKR A;  2CFX A;  4WXC A;  3G73 A;  2COM A;  1BC7 C;  2MD5 A;  3JAM K;  3FZV A;  5L3E A;  2EJR A;  3BWG A;  3WGH A;  2KIM A;  4RB0 A;  2HS5 A;  1S7A A;  2EK5 A;  2DQL A;  3RKW A;  3ERE D;  5D5W B;  3COA C;  2AXL A;  1ZGA A;  4U88 A;  2VOD A;  1ZAR A;  3WTU C;  2O0Y A;  4LGW A;  4MEY F;  2A68 F;  4Q48 A;  3TO7 A;  1K78 B;  2H94 A;  2DW4 A;  2VBZ A;  2P7C B;  3WOD F;  3B73 A;  2L3D A;  1XSX A;  2ZO4 A;  3E6D A;  1BI1 A;  3K0L A;  3Q9S A;  2QBY A;  3ZQ7 A;  3IKV A;  4CYD A;  4K2E A;  3GXO A;  3LST A;  5E8G A;  1UHM A;  4ZZD A;  2RKH A;  4L0Y B;  4UXN A;  3FXU A;  1F1Z A;  4I01 A;  1I1S A;  2Z5U A;  3KP3 A;  2Y0M A;  3H92 A;  2O03 A;  4LB5 A;  4O3M A;  3D0S A;  1XGS A;  1P4W A;  1BI2 A;  4P9U A;  2ETH A;  2A69 F;  2OZU A;  4HAM A;  4G8X A;  2VOO A;  2NNN A;  2F5E A;  2DLL A;  2BBY A;  1IF1 A;  2FMY A;  2HGC A;  5K1Y A;  5AON A;  4EJO A;  3ECO A;  3I64 A;  1K6O A;  1EH7 A;  4KN4 X;  4HBL A;  1FZP B;  2IP2 A;  4OMZ A;  3R4K A;  5L3B A;  4R8H A;  2QBY B;  4GCV A;  2XV4 S;  5TJJ A;  2ZJ2 A;  4QWQ A;  1BOA A;  2E1C A;  1YFH A;  4IRG A;  1IN4 A;  2M1B A;  1AOY A;  5LGN A;  3SFZ A;  3WTS C;  1KYZ A;  3T5X A;  1LVA A;  4A0Z A;  1O7L A;  1FOK A;  3L09 A;  1QBJ A;  4I98 B;  4M71 A;  4HZF A;  2L4A A;  2ISZ A;  5AIQ A;  2VN2 A;  3M8E A;  5KVR A;  1LDK B;  4G7Z F;  4E70 A;  3I58 A;  1IXR C;  1TQP A;  1G6N A;  3IHU A;  4Z2Y A;  2J5O A;  5JHU A;  3SXY A;  2UXN A;  2PEX A;  2FNA A;  3IRR A;  4A0X A;  3PQK A;  4RGX A;  1MGT A;  3WG9 A;  1XDS A;  4FT8 A;  3ABU A;  3F8F A;  4ASN A;  2FXA A;  1ZG3 A;  1G3Y A;  3KET A;  3GX4 X;  4L5J A;  2GXG A;  5E8I A;  3KCC A;  3KZZ A;  5D4R A;  3KFW X;  4AIH A;  1HBX G;  1B1B A;  1LDJ A;  1ON1 A;  2GWR A;  2ESH A;  3K9T A;  3E97 A;  4M9S A;  2EFQ A;  5ED4 A;  3TGN A;  5EEG A;  2WWY A;  1OYI A;  3L00 A;  4WX9 A;  2OZ6 A;  4B8X A;  3BPX A;  1R1V A;  5D5V B;  1WWX A;  1L3L A;  3FXQ A;  3QU6 A;  5CVI A;  4L18 B;  2HQR A;  6PAX A;  2EFO A;  3F8M A;  1O3T A;  2UWM A;  1IRF A;  2OBP A;  3T8T A;  2OA4 A;  3C3W A;  1IN5 A;  2HKO A;  3K1N A;  3O2P E;  4A5N A;  1D5V A;  3M7G A;  3F8N A;  5DCM B;  1LJ9 A;  5IT3 A;  4WCG A;  5CYV A;  4RGU A;  3TDU C;  3CUQ B;  4A12 A;  3I5U A;  3FMQ A;  2A61 A;  3QU3 A;  1YS6 A;  2GQQ A;  2ACJ A;  4EVI A;  2P4W A;  4UV9 A;  2MA3 A;  1FP2 A;  2K4J A;  1YLF A;  4UUV A;  3NEU A;  1TNT A;  4YFK F;  4BHP A;  3RTR A;  2Q2E A;  3HSR A;  3AAF A;  4A6D A;  1F5T A;  1FP1 D;  1PP8 F;  2W24 A;  2L02 A;  5JVT A;  2HWV A;  3W6J B;  1B59 A;  2A07 F;  1U5T B;  5HS9 A;  4UVA A;  4PGH A;  1GXQ A;  2QWW A;  3U9G A;  3SHF A;  2DPU A;  2NRA C;  1QZY A;  1FWZ A;  4L9V A;  5K5Q A;  4PGG A;  3CJN A;  4HX4 A;  5DDG A;  5FFZ A;  4HA8 A;  3MZH A;  3LFK A;  2K86 A;  5FD5 A;  3KZY A;  3GVA A;  3L7W A;  2CG4 A;  2LKP A;  3I71 A;  1ULY A;  3C7J A;  3JTG A;  1G3W A;  3I53 A;  3K69 A;  3ZMV A;  2ELH A;  4EJT A;  1BC8 C;  1ZAO A;  2XUB A;  4KIF A;  4ETS A;  3U2R A;  2F2E A;  2QQA A;  3EET A;  4LLG F;  3WGG A;  3MFK A;  4ENK A;  3HRS A;  3KLN A;  5DUK A;  1ODD A;  1S3J A;  3Q5F A;  4KUM A;  4CHU A;  3F8B A;  4LMY A;  1A04 A;  2LSO A;  2E7W A;  1BBY A;  2DU9 A;  5DYM A;  2W25 A;  2O8X A;  1C0W A;  1U5T C;  2XHK A;  5CLS A;  2AS5 F;  4KIC A;  4ENM A;  2LNB A;  3WTY C;  1DUX C;  5A2Q K;  3ZPL A;  4UHT A;  4OIN F;  3HYI A;  1B6A A;  1EH8 A;  1O3R A;  4HOB A;  1JGS A;  1XDU A;  2IA2 A;  4HQM A;  5ICG A;  5JR3 A;  2QUF A;  2GZW A;  4O6J A;  2V9V A;  4U0V A;  2QZ8 A;  4AWX B;  1MJ9 A;  4EJV A;  2FF4 A;  1TW2 A;  3IC7 A;  1J75 A;  2Z9O A;  3L9F A;  2O3F A;  5H6R A;  4LD5 A;  1V4R A;  5L3C A;  3V4G A;  3VOE A;  4MGR A;  4Q47 A;  3EUH A;  2BEO A;  1FNN A;  1YIO A;  4MQV A;  2D1H A;  3RIR A;  3HTU A;  5D4S A;  4UVC A;  3WTW C;  3LAJ A;  1XN7 A;  1ZRC A;  2L4M A;  1G4D A;  2G7U A;  1PDN C;  2FEZ A;  3H3U A;  2VBW A;  5DD8 A;  4OMY A;  4EGY A;  2QM3 A;  5BOX A;  3EYY A;  1XGM A;  2RNJ A;  3TOA A;  2ZXJ A;  2L01 A;  1R58 A;  2DPD A;  4LFU A;  2XAH A;  2ZBK A;  1SD4 A;  3U1D A;  3GFI A;  3DKW A;  4IRH A;  2XGX A;  1W5S A;  2D1V A;  1B4A A;  3HHG A;  3TO6 A;  5LGT A;  2FSW A;  1D8J A;  3J7A O;  5E20 A;  3M1E A;  1Z91 A;  2HR3 A;  2X0L A;  1SFU A;  1ZH5 A;  4WWC A;  1U8R A;  1ON2 A;  4B09 A;  4GGG A;  4Q5S F;  3M9A A;  1XD7 A;  3NRV A;  4GO1 A;  5J8C A;  2M45 A;  3FM3 A;  4GXO A;  1G3S A;  1J7K A;  2YR2 A;  4U0Y A;  4RS8 A;  4M74 A;  2STT A;  4P96 A;  5CVU A;  1MJA A;  4KA4 A;  4JQF A;  3MWM A;  2RV8 A;  2H6C A;  2OQR A;  2VBY A;  4G7H F;  3BRO A;  3F72 A;  5HDN A;  1S29 A;  3HRM A;  3EDP A;  2PJP A;  4G94 A;  4YFN F;  5CVR A;  3WGI A;  2FRH A;  1LEB A;  4EJW A;  2H6B A;  4HLX A;  2DBB A;  5HVQ C;  3CO6 C;  4NB5 A;  4RB1 A;  1MZB A;  1YYV A;  1JXS A;  1U2W A;  5DD4 A;  1RI7 A;  1KQ9 A;  4A5M A;  4U7D A;  1ZG1 A;  1R23 A;  1S7O A;  3ZMZ A;  2JZY A;  5IT9 Z;  3PFI A;  4G6Q A;  4L9T A;  2WC2 A;  1J2X A;  2DO7 A;  1TLH B;  2GAU A;  1ZGJ A;  1UCR A;  2YU3 A;  1KU7 A;  1JHF A;  1STZ A;  2V1D A;  1HW1 A;  4AIK A;  1USS A;  3MEX A;  3J80 K;  2A6E F;  2P5V A;  3P9I A;  2F5D A;  2A3S A;  4YFX F;  5LEK A;  3BJ6 A;  2FE3 A;  5K5R A;  3WE2 A;  1R1T A;  5LRR A;  4I7H A;  2K4B A;  2CSO A;  5FFX A;  3DEU A;  1T98 A;  2DTR A;  5BS6 A;  3F23 A;  2B0L A;  5CVJ A;  1SFX A;  1R36 A;  3SQN A;  2VT2 A;  1BJA A;  1WQ2 A;  3IRQ A;  2JTV A;  3REO A;  2ADU A;  1B9N A;  3QAH A;  4HQE A;  5FD6 A;  1QQI A;  4HF2 A;  1LQ1 A;  2KJB A;  4S05 A;  2ZFW A;  2O6G E;  3RYR A;  3HTS B;  2O61 A;  3HHH A;  3I0T A;  5EEH A;  3JAM Z;  2VT3 A;  3M8F A;  4WF2 A;  1CF7 A;  1ZYR F;  4OIO F;  2EFN A;  3F6V A;  3KEO A;  5HS8 A;  1Z6T A;  1MDM A;  1RUN A;  4IJA A;  4IPA A;  1V3F A;  2D2W A;  3F8C A;  1H9T A;  1E17 A;  2ZNY A;  4Q4Z F;  2V1U A;  2Y48 A;  4FX4 A;  1FSH A;  3BP8 A;  2FML A;  2JPC A;  3WTT C;  3BY6 A;  3WTZ A;  1TQI A;  1I6X A;  3KE2 A;  1W4M A;  4U0W A;  1E2X A;  3TQN A;  1HW5 A;  1IN6 A;  4HX8 A;  2KJC A;  2RC4 A;  1I5Z A;  2DAO A;  1YQA A;  2OAZ A;  3JSP A;  1P4X A;  1SMT A;  4KFC A;  3GWZ A;  5D6F A;  1IXS B;  3LA7 A;  2HOE A;  1O7F A;  1KU3 A;  1O57 A;  5DCM A;  4EM1 A;  4ON0 A;  1W7P B;  4M9Z A;  4CIC A;  2ZME A;  5D8L B;  1WI9 A;  1LB2 A;  5H6Q A;  2EA4 A;  3CUQ A;  3B02 A;  1CF7 B;  4A2U A;  3IL2 A;  3DP7 A;  1MDM B;  1HST A;  2D45 A;  4ZH4 F;  4MQ9 F;  2MBF A;  1DDN A;  3CO7 C;  2FBI A;  3QP5 A;  1U5T A;  3V7S A;  4A6E A;  2ZCW A;  1EH6 A;  2EWN A;  3I59 B;  3GO5 A;  2ESN A;  4ENN A;  2BYV E;  3BOQ A;  5ICF A;  5FLX K;  4UNO A;  5ILS A;  2JPB A;  3EQL F;  1W7P D;  3V7R A;  2PG4 A;  1D8K A;  2KIU A;  4IRI A;  4HF0 A;  1FYM A;  1SD6 A;  2PMH A;  2ZME B;  3I4P A;  4XLN F;  1K7A A;  2LF7 A;  1IRG A;  1ZG5 A;  4IHS A;  2P7V B;  3GLX A;  1TBX A;  2J5P A;  4XSX F;  3E5Q A;  1PUE E;  3TOB A;  2KRF A;  1R1U A;  1FYL A;  1IAW A;  4G7O F;  4KIG A;  4LJZ F;  3BJA A;  2OQG A;  4LLN A;  2YX7 A;  3R61 A;  2W57 A;  4XSZ F;  1MD0 A;  2DK8 A;  4HDV A;  3KLO A;  2WTE A;  4XLP F;  3I54 A;  3E5X A;  1QNT A;  2DFI A; 
#chains in the Genus database with same CATH topology
 2XRN A;  4BE0 A;  3UNG C;  4HG2 A;  2H27 A;  1TW3 A;  2M8E A;  4FAS D;  4BHB A;  3ELK A;  2BVM A;  2MC3 A;  5BQT A;  1RNL A;  1WH7 A;  3DF8 A;  1J0R A;  2EFP A;  1A6Q A;  1WPK A;  4I0A A;  4N9H A;  2E7X A;  2VKH A;  4XN0 A;  4RB3 C;  1BR1 A;  4ESB A;  4C30 A;  3FIS A;  3FIW A;  4ZYD A;  4RBO A;  1ZRD A;  4RGS A;  3LSJ A;  4XOT A;  1FC3 A;  3MAJ A;  1LE8 A;  5ICE A;  3FBI B;  2M87 A;  4HW0 A;  2NVT J;  3RKX A;  3S17 J;  1Z6R A;  3SZP A;  4M72 A;  3K4K A;  4FHT A;  4G12 A;  1FEX A;  3WE3 A;  2GLO A;  2CQX A;  3FMS A;  4L5I A;  3H5R A;  2QSF X;  5EJC A;  2LKS A;  2E5Z A;  1JI8 A;  3CCS I;  3GUD A;  4DBR A;  2VUM J;  4GFB A;  3BJO A;  3E6M A;  4M3E A;  3L2C A;  5JI6 A;  2O7O A;  1BIA A;  1KQ8 A;  4M6Y A;  1MNM C;  4Y13 A;  1V5E A;  1RC9 A;  2ZME C;  5LD2 C;  4BQA A;  1YIJ I;  4B1R A;  4IXA A;  5FLX Z;  4HF1 A;  4FE4 A;  3CUQ C;  3F3X A;  4DNC A;  3JRB A;  2Z33 A;  3BZC A;  1DGR M;  4DGW B;  3S93 A;  4BH9 A;  4FET A;  2R4G A;  2VC0 A;  1XGO A;  4H0E A;  2V1X A;  1LDD A;  1Z7U A;  2Y31 A;  3QOP A;  3LAP A;  2H8R A;  2K27 A;  3FKI J;  1WJE A;  3OOU A;  3PNT A;  2O9L A;  3CC2 I;  2FOW A;  3OIP A;  4KN7 X;  3FXJ A;  2VL8 A;  2EV0 A;  3QP6 A;  5HLH A;  4J00 A;  1U8B A;  2K9L A;  3K2Z A;  1XSV A;  4YG2 F;  2CYY A;  3JW4 A;  2WY7 Q;  3J7A Y;  4JBA A;  4A3K J;  1ETV A;  4TV7 A;  3O6B B;  1HKS A;  1H0M A;  2DFE A;  3BTJ A;  3OWT A;  4C3I J;  3P9C A;  4XBF A;  2RDP A;  4G6D A;  2CU7 A;  4P1W A;  4GYI A;  2MD0 A;  2ELJ A;  2PBI A;  4PJJ A;  4DOZ A;  3MQ0 A;  3HOS A;  3K2A A;  4L9J A;  1VQO I;  1ZKG A;  5K5O A;  2DA4 A;  1LPQ A;  4XID A;  1MBH A;  1KYW A;  1ETW A;  4F3Q A;  1SD7 A;  3JRH A;  2DXI A;  2DOA A;  2IGM A;  2VBX A;  3HOT A;  1W0U A;  2FBH A;  2GA2 A;  1Y1W J;  2PLY A;  1R7J A;  4NQW A;  1KU2 A;  4XMY A;  3M8J A;  3MZ8 A;  3JRG A;  1J5Y A;  1BI3 A;  2XAS A;  1IRX A;  2M7B A;  3CMA I;  3ZRG A;  5HDG A;  1BIB A;  3KPH A;  3FXO A;  3GTG J;  2PJR A;  1Y1V J;  1UEL B;  1FTZ A;  3DV8 A;  4N9I A;  4P9F A;  4E6K G;  1TTY A;  3CCM I;  2DI3 A;  4DYR A;  3S1R J;  3CF5 F;  2WV0 A;  2JRT A;  1YTY A;  2XAQ A;  2BY2 A;  3EUK L;  2QLZ A;  1R00 A;  1XB4 A;  2Q8K A;  4F52 A;  5CVV A;  4RAG A;  3CF2 A;  4CSW A;  2WY8 Q;  1QVT A;  2EV5 A;  2QSH X;  3EYI A;  2KFD A;  1GV2 A;  2EIK H;  2JSC A;  2HPI A;  3VEP A;  1G8X A;  4BXF A;  3DBL B;  2VQG A;  3ZCO A;  3FHZ A;  5HOD A;  3CCY A;  1S6L A;  2H09 A;  3F21 A;  3M1C A;  1KA8 A;  3BG7 A;  1FY7 A;  1ZRE A;  1IW7 F;  1J9I A;  3WU0 A;  4XRF A;  5HLG A;  2EH3 A;  3R0J A;  4PDK A;  3DTK A;  5LHG A;  1MW7 A;  2E2H J;  5DUI A;  3OYN A;  2Q0O A;  3FMR A;  5CJ9 A;  3OOP A;  3TO9 A;  2HEO A;  5JFR A;  2EBI A;  5HDK A;  4PZJ A;  1XTA A;  2G9W A;  4QLC U;  2L9S A;  4I0B A;  5H20 A;  1WJB A;  3OYH A;  4NC8 A;  4ZYE A;  1P2F A;  3LOC A;  3R60 A;  5LEJ A;  5E18 F;  1HOM A;  1V5G A;  2A5W A;  4RLQ A;  3FBN B;  2GIZ A;  2K3F A;  2V26 A;  4AD9 A;  3SEZ A;  1XC5 A;  3T1B A;  4BAY A;  3LA2 A;  2MH2 A;  2OC6 A;  2CO5 A;  5ILV A;  1JE8 A;  2JRM A;  3ZQQ A;  3O3K A;  4EGZ A;  4UV8 A;  3T0Y A;  5LFA A;  1A31 A;  3IKT A;  4RAY A;  3DPT A;  4KMF A;  1IN8 A;  1SD5 A;  3K4J A;  4YII A;  2PJR B;  2N8G A;  2XAF A;  1YO5 C;  1K79 A;  2BV6 A;  2P8T A;  3DPL C;  3KZI C;  5LHH A;  2FU4 A;  2KLO A;  3RJP A;  3WU2 C;  1OYW A;  3NQO A;  4HDU A;  3BZ6 A;  1LNW A;  2HOA A;  3FXR A;  1XCV A;  2DK5 A;  1U9N A;  1T2K A;  4DZJ A;  1QVU A;  2ID6 A;  5D5X B;  4PCQ A;  3VPR A;  1XSD A;  5KNL A;  3BTL A;  3H36 A;  5E1X A;  3J81 K;  5IYD J;  3ONQ A;  5HOO A;  2VE9 A;  2WAE A;  4ENJ A;  1B8I A;  2MSY A;  3DBR B;  2OUM A;  2BZT A;  3ZMT A;  2GOM A;  3S3M A;  4LB6 B;  3MZY A;  3GFM A;  1QPM A;  3DXJ F;  5L3F A;  3FM5 A;  2V9P A;  5A2Q Z;  3GTL J;  2VPL A;  2PN6 A;  2F5V A;  1T6S A;  4CCJ A;  1X3U A;  4A0Y A;  4IF4 A;  4KT6 A;  1Z67 A;  3FK6 A;  2NVU B;  4EQQ A;  1X2M A;  3VOD A;  1VFC A;  2BVL A;  1LVK A;  2YSR A;  3A2K A;  1J59 A;  1XMK A;  2FNP A;  3OYG A;  3VB2 A;  1GVJ A;  4MTE A;  1PVE A;  3ERM A;  3K1M A;  3W3C A;  1F9N A;  2A5Y B;  1R22 A;  5E3N A;  1JUM A;  2CJJ A;  2EB7 A;  3E3V A;  1K61 A;  3ZMS A;  3B6A A;  2ECC A;  2DJI A;  4RAF A;  3IH4 A;  3E5U A;  4I02 A;  4RAZ A;  5HS7 A;  5B66 C;  3CCL I;  5ICC A;  2NOG A;  2AXT C;  2Y0S A;  1YG2 A;  4LK0 F;  4EM0 B;  2LD5 A;  4E4H A;  1V5F A;  2W84 A;  4P55 A;  5M3M J;  3L2U A;  1ERD A;  2BW3 A;  4QPQ A;  5GTI C;  4A3G J;  2TDX A;  2VON A;  1ETK A;  4KYW A;  1ZLK A;  2IJL A;  3TKY A;  1QA6 A;  2Z99 A;  3ZMD A;  1BM9 A;  2XAJ A;  4B3A A;  2FQ4 A;  1REP C;  4ABZ A;  1MH4 A;  4PFP A;  5FKN A;  3S2H J;  1B8I B;  1FBQ A;  5E3M A;  3I3L A;  3CCJ I;  4N4O B;  2X6O A;  1R9T J;  2DFH A;  3SZT A;  4CCN A;  3S15 J;  2GIV A;  3V7C A;  4Y15 A;  2CWE A;  4EAT A;  2I10 A;  3G2B A;  4PSX A;  4BGD A;  1IO2 A;  4Y4R A;  3PIO F;  5ILU A;  2RN7 A;  3JRC A;  5J4V A;  1ETY A;  4RMN A;  1OR7 A;  2DA6 A;  3SDB A;  4BJ5 C;  2KIS A;  3Q3S A;  4D7N A;  2CW7 A;  3H3Z A;  2KQR A;  2XKP A;  1GHC A;  2M2E A;  4JP0 A;  1G3T A;  2R7Q A;  3FX3 A;  2VE8 A;  5FGM A;  2HDD A;  2FUG 2;  2VOP A;  3JCU C;  4BHC A;  1H8A C;  1R6R A;  3DU5 A;  2KDZ A;  2JMW A;  2NNY A;  2XKO A;  1DP7 P;  2R7D A;  1NHA A;  4RGR A;  1OCO H;  4L0Z B;  2F5C A;  4HV5 A;  2F4O B;  1YJ9 I;  2DA7 A;  4BNC A;  5LLQ A;  4RM3 A;  4CO8 A;  3LA3 A;  4NBQ A;  2LF8 A;  2QSG X;  4IHV A;  3E6C C;  2C6Y A;  2ME6 A;  2I8D A;  4HSR A;  2LTP A;  4C3J J;  1D1C A;  2LP0 A;  1HF0 A;  4PJL A;  5HLI A;  3J81 Z;  4M9X A;  4V2G A;  4A93 J;  3BCA A;  2R93 J;  3H9Q A;  5J3L A;  2M0C A;  4P5O A;  4XKC A;  1FT9 A;  1O4X A;  1I50 J;  1X3Z B;  5F27 A;  3T8R A;  1XMA A;  2FBK A;  1D0X A;  2E1N A;  2IVM A;  4XN3 A;  1W7P A;  2DMN A;  3RDI A;  1FOY A;  1OMI A;  4CYC A;  2G0E A;  3E7L A;  4M73 A;  3HBL A;  1BN5 A;  5M5W J;  3ASO H;  5LHI A;  2MLG A;  3ULQ B;  5BNG A;  2K7L A;  4AIJ A;  2X6Y A;  4OIP F;  1VQ5 I;  1JTX A;  1T33 A;  2R0Q C;  2BGC A;  2X9D A;  3IWZ A;  1O3Q A;  1F4K A;  1W36 C;  4CXF A;  1H89 C;  1E0E A;  2HFH A;  2RNG A;  1P6R A;  3MCZ A;  1ZN2 A;  2HTJ A;  4E7Z A;  4BDZ A;  3ZQG A;  3RSN A;  4XQF A;  1OCT C;  2VXZ A;  4NNJ A;  2NYX A;  2UZK A;  1QPI A;  2R3S A;  2QQB A;  2DFF A;  4XNF A;  4YIF A;  2L7K A;  2JWT A;  4JK1 X;  2JUC A;  5BMZ A;  1P4A A;  2MH9 A;  3K4C A;  4BEH A;  3FF5 A;  4HNT A;  1TNS A;  4X0G A;  1VTN C;  2DOD A;  3ZN1 A;  3I59 A;  1W5T A;  1ENH A;  2LRE A;  5BPI A;  2KP6 A;  1WH5 A;  2JT1 A;  2KIF A;  3D5R C;  2OF7 A;  2MAB A;  2IS4 A;  5D6E A;  2JUG A;  2L7Z A;  5E3O A;  1NTC A;  3PNY A;  3PUB A;  1JJ6 C;  3KEQ A;  3QOE A;  1T0F A;  3VFZ A;  3ZN0 A;  3AG3 H;  3R6S A;  2GOX B;  4PJN A;  2VQC A;  3S3N A;  3I4M J;  3CJR B;  2CUF A;  2L7F P;  4I6Z A;  2EA2 A;  4CZZ A;  3J80 Z;  4UY8 I;  1U78 A;  1UHW A;  3P7N A;  2EZH A;  1BOB A;  2LY2 A;  3DQV C;  2KDO A;  2XAG A;  1YW9 A;  2E60 A;  2YPR A;  2LY9 A;  3BR3 A;  4YRV A;  1EV7 A;  3S16 J;  4ZZL A;  4XOR A;  2ZJR F;  4I2O A;  1D0Z A;  2GA1 A;  2ZC2 A;  4B3X A;  2HU9 A;  5M5X J;  3G3Z A;  3BQZ A;  4IHT A;  4N4N B;  2LDU A;  2PQ8 A;  3CDH A;  1HKQ A;  2Z16 A;  2RQP A;  1SAX A;  1P92 A;  1DPU A;  2R7R A;  3CMY A;  1T8I A;  3H3V K;  2A6H F;  3RPQ A;  2HTS A;  4FE7 A;  4FCY A;  2V6C A;  4BE1 A;  2BOL A;  1K6Y A;  3F6O A;  3PSI A;  1KGS A;  1RPW A;  2R7Z J;  1I27 A;  3V8L A;  3MKL A;  4IEJ A;  3CTA A;  2ZNZ A;  3BDD A;  4PSW A;  4CDG A;  1S8N A;  3RKY A;  4J19 A;  1ACI A;  1BI0 A;  1W1W E;  4BEH B;  2HKX A;  2ZSI B;  2ZXI A;  4BL0 B;  5E17 F;  3WU1 B;  2R7V A;  3HOZ J;  4HRI A;  1Q1V A;  1VQL I;  2HQN A;  3C2B A;  4B47 A;  1O3S A;  3HPH A;  3CJT B;  3DFG A;  4NDL A;  4X1E A;  1SMY F;  2CQK A;  1OR7 C;  3HRU A;  5J8F A;  3OYE A;  4M3F A;  4G9Y A;  3GFJ A;  4S04 A;  3FWE A;  3V8J A;  3GZ6 A;  1HXD A;  2V79 A;  1Y8Q B;  3KP6 A;  5DV5 A;  2KKO A;  3CLO A;  4AYB A;  1MJB A;  2Z1D A;  1FPQ A;  3HOV J;  2F5F A;  3CQZ J;  4ZDL A;  3FXK A;  1L0O C;  1UHS A;  2HI3 A;  3HIF A;  1MBK A;  3BG3 A;  5FRM A;  2E2I J;  4ZYG A;  4D1Q A;  1BJZ A;  5DCF A;  1WRJ A;  3QPS A;  4LG0 A;  4M3B A;  3HKZ N;  3DKX A;  3Q9V A;  5AIP A;  3WHC A;  4OU0 A;  5J1U A;  1R4N B;  3ZOB A;  3BZK A;  2JJ7 A;  4EEF G;  2Y75 A;  5DM6 F;  3IV5 A;  2P5L C;  4EMS A;  1JHH A;  1R5G A;  5D8K B;  1QZE A;  4O5V A;  1ZGW A;  1ZQ3 P;  2ECB A;  4E7J A;  2VC1 A;  3OY9 A;  4OOI A;  2X1E A;  5F04 A;  4D0P A;  4HNU A;  1R5H A;  3ZQH A;  4CCL A;  2KZV A;  2W48 A;  2DT6 A;  3QPH A;  2NS0 A;  2CW0 F;  2LH9 A;  4EJU A;  3SJM A;  3K70 D;  4OWR B;  4MHG A;  1SVM A;  4RB2 C;  1YJW I;  1B72 B;  4HST A;  3LNQ A;  5KK1 A;  1WKM A;  1PP7 U;  2HPM A;  4E7K A;  2NXN B;  1Z05 A;  3ROU A;  2IW5 A;  2CUJ A;  2IA1 A;  3O8G A;  5H2F C;  1BA5 A;  5LRS A;  3KP4 A;  4GRI A;  3W6K B;  4KDP A;  3ZQF A;  2P6T A;  4ZYA A;  4HYE A;  2CS3 A;  1OJL A;  1JT0 A;  2XSJ C;  1ZEL A;  3DLA A;  4MNU A;  2EFW A;  1DQU A;  4HLY A;  3GEZ A;  3RI4 A;  4KNY A;  2BE5 F;  3PO2 J;  1UG2 A;  2JK3 A;  2DDB A;  2LBF A;  2JA2 A;  3O8H A;  1RRJ A;  3HZJ A;  2CFO A;  4KIT B;  5FKK A;  4C2U A;  4KT5 C;  3CP2 A;  1Y0U A;  3HRT A;  2KPM A;  1D3Y A;  3LSM A;  3HC7 A;  2RVC A;  2L5Q A;  4R79 A;  5F1R A;  1SFK A;  1TWH J;  1JJ8 C;  5L3D A;  3BPV A;  5FKO A;  1DP3 A;  3JSO A;  5F64 A;  1MSE C;  3ABT A;  2NAZ A;  1ZHF A;  5FKL A;  3HXL A;  1X1P A;  2IA0 A;  4ESJ A;  3N4M A;  3K70 C;  1HW2 A;  5TIS C;  3GFL A;  2IPQ X;  3ISP A;  4B48 A;  4OIQ F;  1OIS A;  2E35 A;  4WXH A;  3WTV C;  5J6X A;  2R7F A;  4LG0 B;  3F0C A;  2QEN A;  2IRF G;  4ZJZ A;  4S0H B;  5CKT A;  1Z3Y A;  4WK8 F;  1E3P A;  5L3G A;  2PX9 A;  4RDU A;  4CH7 A;  3GZ5 A;  2DT5 A;  1T0F C;  2HDC A;  3CES A;  1TWG J;  3JTH A;  2E71 A;  2XIG A;  5E1Z B;  2X4H A;  3OS1 A;  5TRD A;  4ESF A;  2ISY A;  2UXX A;  2DQR A;  1S9H A;  2K3P A;  4WXD A;  3ASN H;  3K10 A;  1G2H A;  2M30 A;  2R7W A;  4ZTF A;  2X51 A;  2FQ3 A;  4PJ0 C;  1TC3 C;  3CUO A;  3LWF A;  2VQH A;  4PK4 A;  1T56 A;  2DA3 A;  2Z3Y A;  5DS9 A;  2MLK A;  1N75 A;  4BYY A;  1AWC A;  1VQ9 I;  1WVR A;  2RRE A;  1D0Y A;  4C2M J;  1U3E M;  2H1L A;  1KQ0 A;  1GXP A;  1D1B A;  1QZZ A;  4JX4 A;  4HX7 A;  2B7E A;  3RPU A;  1KU9 A;  3PQJ A;  3CMM A;  1WHU A;  4BBR J;  1U6G A;  1VZ0 A;  2LBF B;  3VDX A;  2HZT A;  3BR2 A;  2D5V A;  2V4J C;  1U0J A;  1Y8R B;  4JX5 A;  2PFB A;  3LQQ A;  4IO9 F;  5BPD A;  4Y52 J;  3HSF A;  5F0C A;  4XK4 A;  2CGP A;  1QHG A;  2EQR A;  2W85 A;  3ABM H;  2QYO A;  2R5Z B;  3ZQL A;  4BXU A;  3N97 A;  4OIR F;  1XGN A;  1LFP A;  2G7H A;  1SEU A;  1A35 A;  1FSE A;  1ETO A;  4CA0 A;  1YRN A;  2L54 A;  2H8W A;  2R5Y B;  5GAE J;  2EV6 A;  2P6S A;  3IWF A;  2PMU A;  3KP2 A;  2LYC A;  3H0D A;  1WSU A;  2OD5 A;  3OS2 A;  4NC6 A;  1B9M A;  3V8K A;  1MBJ A;  1IXC A;  1RZ4 A;  2XPV A;  1VQP I;  1I3A A;  2STW A;  1MNE A;  3GYH X;  3UKG A;  3BR5 A;  4R1H A;  4UVB A;  5D5U B;  1RUO A;  3H5N A;  1X1B A;  3M07 A;  4LK1 F;  1VQK I;  3HOY J;  3DLL F;  1HKT A;  1BR4 A;  1BW6 A;  1EKE A;  2MC4 A;  4EM2 A;  4IVN A;  4A3C J;  1FLI A;  1H88 C;  3QPT A;  3FHN A;  2K40 A;  5IYB J;  2HDW A;  2L7M P;  4CZC A;  4F93 B;  1RIO H;  2K02 A;  1CQT A;  1GDT A;  2HYG D;  1IV6 A;  5E1W A;  1I1G A;  2HXI A;  3ZMU A;  2E2J J;  1T39 A;  1VND A;  2OU2 A;  3HSE A;  3TMO A;  2HYF A;  1DPR A;  1FBU A;  4XM3 A;  1TQM A;  1FX7 A;  2ZKZ A;  5EZH A;  5F6F A;  4DJA A;  3E6B A;  2KZG A;  3K1P A;  3KP5 A;  4MTD A;  1QGP A;  2FOK A;  1UB9 A;  3D5L A;  4IL6 C;  1GUU A;  2K85 A;  4BJ6 C;  1A5J A;  3JR9 A;  3ESW B;  1PUF B;  4MLO A;  1OPC A;  3WTX C;  3ML6 A;  5FO5 A;  2PI0 A;  1KON A;  1UFM A;  1QRY A;  3PUF A;  3H9J A;  4ZC3 A;  1QO0 D;  1YRN B;  1MKM A;  3S8P A;  4BY7 J;  3RZD J;  3EPZ A;  1IZ1 A;  2E36 A;  1UST A;  1JTY A;  3HGY A;  3HUG A;  4DQ2 A;  4FIS A;  1H9G A;  3QYF A;  1V54 H;  4F7Z A;  1HSJ A;  3TED A;  2KRC A;  1CGP A;  2QVO A;  5J1R A;  1Z1D A;  3VYR B;  3AG4 H;  2XVC A;  4IQ4 A;  4EV0 A;  1SFE A;  4NHJ A;  4YEL A;  1OFC X;  4DBQ A;  3R0A A;  1N77 A;  1MMA A;  1IUY A;  1YW7 A;  5CQG A;  2NS8 A;  4XR6 A;  4N0B A;  3K4B A;  3ZP5 A;  4B4C A;  5IT9 K;  3LQR A;  3F22 A;  1ZLJ A;  2M3A A;  1IGN A;  4FX0 A;  2W82 A;  3P9K A;  3BLY A;  4MFD A;  1MSF C;  5TGT A;  4L9N A;  3GW2 A;  1OLT A;  4ZYH A;  2QQ9 A;  4CGZ A;  3C2G A;  3LSG A;  2BHY A;  2CW8 A;  4Y17 A;  1ONV A;  4HV6 A;  4CCO A;  2VLA A;  3RPU D;  2BY3 A;  2EIJ H;  3RYP A;  2IEK A;  2XRL A;  5ERI A;  4XRM A;  3DCF A;  4AU7 A;  4KIB A;  1FBS A;  5GTH C;  3I56 I;  5LBQ A;  1IV8 A;  3OV8 A;  3S2W A;  4A3B J;  2AQE A;  4AVP A;  1FMW A;  1FYK A;  2P5K A;  3ECH A;  1WJD A;  2YX4 A;  2XRO A;  1AKH A;  2ZXH A;  4M6X A;  4KMU X;  2FA5 A;  4YEJ A;  1OYY A;  1R71 A;  1LEA A;  4E7I A;  3KYD B;  3S1N J;  2X1C A;  4BDY A;  2JVH A;  5B1A H;  1PYV A;  1K83 J;  1HQC A;  1K78 A;  5FB2 A;  1FMV A;  3S1Q J;  1Q1H A;  3C1D A;  3QRF F;  1YW8 A;  5DEQ A;  3GF2 A;  4MEX F;  2IAI A;  2RQQ A;  4GYG A;  2HVS A;  1T38 A;  1MMD A;  3JRF A;  2GXB A;  1JKP C;  2CRG A;  2E1O A;  2NVQ J;  2KHM A;  3HUG B;  2IS6 A;  1ZRF A;  4DW6 A;  4LLL A;  4QSH A;  1IJW C;  1X1A A;  3KP7 A;  2RGV A;  4LIV A;  3C18 A;  4MFE A;  1DU0 A;  1XCB A;  2DMU A;  3HDD A;  1ZR2 A;  1T08 B;  3LFU A;  4U7B A;  2IT0 A;  1V55 H;  1YX5 A;  4BS9 A;  5LGU A;  2XB0 X;  4F91 B;  2M5W A;  4I09 A;  3TDZ C;  1YS7 A;  1IC8 A;  1Z9C A;  1IN7 A;  3NAR A;  1OKR A;  4V2F A;  2EIL H;  2CFX A;  4WXC A;  3G73 A;  2KL4 A;  2COM A;  1RKT A;  2ZB9 A;  5F0H A;  1BC7 C;  1J09 A;  2MD5 A;  3JAM K;  1YE9 A;  3FZV A;  5F0F A;  3LSP A;  4XLH A;  4AVZ A;  3CLQ A;  5L3E A;  2EJR A;  2XPW A;  3BWG A;  3WGH A;  2KIM A;  2WB1 N;  4RB0 A;  1XS9 A;  3HL2 A;  3ABL H;  2CV0 A;  2HS5 A;  1S7A A;  2EK5 A;  3KYC B;  2DQL A;  1ZK8 A;  3RKW A;  1HLV A;  2HYJ A;  3AL0 B;  3ERE D;  5D5W B;  3COA C;  2AXL A;  2VB6 A;  1ZGA A;  4U88 A;  2CUZ A;  1AKH B;  2VOD A;  1ZAR A;  3WTU C;  5J4Y A;  2LG4 A;  5B5E C;  2O0Y A;  2XF7 A;  4LGW A;  4MEY F;  4NUB A;  3OYI A;  2A68 F;  4MIM A;  3OYL A;  3Q0V A;  4Q48 A;  3FXM A;  3TO7 A;  1P7I A;  4E7S A;  1K78 B;  2H94 A;  2DW4 A;  2VBZ A;  2P7C B;  3WOD F;  3B73 A;  2LFB A;  4XON A;  2XGE A;  4BJT A;  2L3D A;  1XSX A;  1MMG A;  1Z7L A;  2ZO4 A;  2M4G A;  1HA8 A;  3E6D A;  1BI1 A;  3K0L A;  4XLF A;  3Q9S A;  2X48 A;  1NK3 P;  2QBY A;  2P0W A;  3ZQ7 A;  5IOZ A;  3IKV A;  4CYD A;  4K2E A;  2W4S A;  5HNH A;  1GLN A;  3DTI A;  3TBI A;  1NG7 A;  3GXO A;  2E1M B;  3LST A;  2L9R A;  3LSH A;  5E8G A;  1FOX A;  1M1E B;  1UHM A;  4ZZD A;  2RKH A;  4L0Y B;  3VSL A;  4UXN A;  1VQ4 I;  1YJN I;  2HVQ A;  5J40 A;  3FXU A;  1F1Z A;  4I01 A;  1I1S A;  2XSD C;  3HOX J;  4BKX A;  1UMQ A;  3PIP F;  2Y9Z A;  2Z5U A;  3CCV I;  3KP3 A;  4FQG A;  2Y0M A;  3H92 A;  2KMU A;  3EUH C;  2O03 A;  4LB5 A;  3S3O A;  4O3M A;  3D0S A;  1XGS A;  5FRN A;  3AG2 H;  1P4W A;  1BI2 A;  4P9U A;  2ETH A;  2A69 F;  2OZU A;  1WGX A;  3HGG A;  4HAM A;  4XKW A;  4C9Y A;  5JLW A;  4G8X A;  4DYQ A;  4X6A J;  3PO3 J;  3IAM 2;  2VOO A;  2NNN A;  2F5E A;  2DLL A;  2BBY A;  1ZR4 A;  4QTR A;  1IF1 A;  1UZC A;  2FMY A;  2HGC A;  5K1Y A;  3OSF A;  3A02 A;  2VJJ A;  5AON A;  4EJO A;  3ECO A;  3I64 A;  3DEW A;  3HPG A;  3CCR I;  1K6O A;  1EH7 A;  4KN4 X;  3B6C A;  3U1K A;  4HBL A;  1FZP B;  2IP2 A;  2IBD A;  4OMZ A;  5EYR A;  3R4K A;  1RET A;  5L3B A;  4BQO A;  4R8H A;  2QBY B;  4GCV A;  3D5S C;  2XV4 S;  3WG7 H;  5TJJ A;  1JGG A;  2ZJ2 A;  3HG9 A;  4QWQ A;  1BOA A;  2BXY A;  2E1C A;  1YFH A;  1NK2 P;  2BXZ A;  4IRG A;  1A6I A;  3X2Q H;  1IN4 A;  2M1B A;  1AOY A;  5LGN A;  4MO7 A;  5FRO A;  3SFZ A;  1WZ2 A;  3WTS C;  4A3J J;  1KYZ A;  3T5X A;  2DMT A;  1OCZ H;  1LVA A;  4A0Z A;  1O7L A;  1FOK A;  3L09 A;  5EGO B;  1QBJ A;  2HNH A;  1DGW Y;  4I98 B;  4HZF A;  4M71 A;  2L4A A;  2ISZ A;  5AIQ A;  2VN2 A;  3SYT A;  4D7M A;  3M8E A;  3J7Z I;  1AHD P;  3TP0 A;  5EZG A;  2IXS A;  5KVR A;  1LDK B;  4G7Z F;  4E70 A;  3I58 A;  2Y2Z A;  2M8G X;  1IXR C;  1TQP A;  1T95 A;  2A6T A;  3BR1 A;  2OCC H;  1G6N A;  3IHU A;  2F48 A;  5GAG J;  3MKY B;  4Z2Y A;  3A0H C;  2J5O A;  5JHU A;  3SXY A;  1XG1 A;  2UXN A;  2PEX A;  4DYC A;  3P5J A;  2FNA A;  2OPT A;  4XLC A;  3IRR A;  4A0X A;  1R5I D;  3PQK A;  4RGX A;  1MGT A;  1WJF A;  3WG9 A;  1XDS A;  3A0B C;  4FT8 A;  3CCU I;  2ZSH B;  3ABU A;  3F8F A;  4ASN A;  2OTJ I;  2FXA A;  1I6H J;  1ZG3 A;  1EA3 A;  1G3Y A;  3BG5 A;  4L5J A;  3KET A;  2GXG A;  2WAQ N;  1ETQ A;  3GX4 X;  3KIO A;  3OYJ A;  5E8I A;  2K9N A;  1OCR H;  1RES A;  3KCC A;  4RLF A;  3GTM J;  2VJI A;  3KZZ A;  5D4R A;  4C3H J;  3KFW X;  4AIH A;  3VSK A;  4BQN A;  2VKD A;  2E19 A;  1HBX G;  4GDF A;  1B1B A;  1LDJ A;  1MBF A;  2VJ5 A;  3JRE A;  2CQ7 A;  1ON1 A;  1B72 A;  2GWR A;  2ESH A;  2IGK A;  2OJE D;  3K9T A;  3VYT B;  3BC8 A;  3E97 A;  3S2D J;  4M9S A;  2EFQ A;  3GCM A;  2GXA A;  5ED4 A;  3LSR A;  3GTQ J;  2WBM A;  2QA4 I;  4LOC A;  4A3M J;  3S14 J;  1MH3 A;  2Z2S B;  3TGN A;  4NC7 A;  1K4S A;  3CP8 A;  1IUF A;  3TL4 X;  4H4K C;  3GTO J;  4A69 C;  5EEG A;  2WWY A;  1VQ8 I;  4BQQ A;  1N25 A;  1OYI A;  1D5Y A;  3L00 A;  1WFX A;  4WX9 A;  2OZ6 A;  4B8X A;  4W1U A;  3BPX A;  5C4X J;  1R1V A;  2DOE A;  1WWX A;  3K6G A;  2RAE A;  3LSI A;  5D5V B;  1L3L A;  2JA5 J;  3FXQ A;  4ANJ A;  1Y0N A;  3QU6 A;  1APL C;  5CVI A;  4L18 B;  2HOS A;  2HQR A;  3G6E I;  6PAX A;  3JRA A;  2EFO A;  3F8M A;  1O3T A;  2UWM A;  1Z3X A;  3HKZ A;  3DU6 A;  1IRF A;  2OBP A;  3T8T A;  2OA4 A;  3C3W A;  2W1O A;  5J47 A;  1IN5 A;  2HKO A;  3K1N A;  3O2P E;  4A5N A;  3M3Y J;  1D5V A;  3GTJ J;  3M7G A;  3G4S I;  3GTK J;  2VI6 A;  5IP9 J;  3F8N A;  5DCM B;  1LJ9 A;  5IT3 A;  1A36 A;  4WCG A;  3DBH B;  5CYV A;  4UUT A;  2XGC A;  4RGU A;  2LMD A;  2XAU A;  2QF7 A;  3TDU C;  2QGU A;  2GBY A;  3HB9 A;  5KHD A;  3N05 A;  4E7H A;  3CUQ B;  4A12 A;  3I5U A;  3FMQ A;  3L2W A;  2A61 A;  3QU3 A;  3I4N J;  2IS1 A;  2VQL A;  1YS6 A;  3SFI A;  2L9V A;  1HDP A;  2GQQ A;  3MN2 A;  4XKB A;  2ACJ A;  2DOF A;  2E34 A;  3RCO A;  3G1L A;  2P4W A;  4EVI A;  4A3E J;  3ZGK A;  4UV9 A;  2HXO A;  2MA3 A;  1FP2 A;  2K4J A;  1YLF A;  4XLE A;  4UUV A;  5IY5 H;  2R7S A;  4Y33 A;  2DCE A;  3NEU A;  1TNT A;  4AUX A;  4YFK F;  4BHP A;  3RTR A;  2YUS A;  2Q2E A;  1FJL A;  3HSR A;  3K4N A;  3V42 A;  3AAF A;  4A6D A;  1F5T A;  2R5Z A;  1FP1 D;  1PP8 F;  2W24 A;  3MD2 A;  2L02 A;  2ICW G;  5JVT A;  2LY1 A;  1ORK A;  2HWV A;  3W6J B;  1B59 A;  2A07 F;  1S5L C;  1U5T B;  4Z6Y A;  5FKM A;  2XF5 A;  5HS9 A;  2Y30 A;  4UVA A;  2R5Y A;  1EF4 A;  4PGH A;  1GXQ A;  2QWW A;  3RZO J;  3U9G A;  2CV1 A;  4OAY A;  2VKE A;  3SHF A;  1MBG A;  1HDD C;  2LK2 A;  5K7Z A;  2DPU A;  2NRA C;  1N78 A;  1QZY A;  1FWZ A;  2XB5 A;  2EIM H;  3ABK H;  1GVD A;  5GAH J;  4L9V A;  2PMZ N;  5K5Q A;  1X58 A;  2B63 J;  2AQF A;  3U21 A;  4PGG A;  3IH3 A;  4AID A;  5GP9 A;  2HQA A;  1JKR C;  3CJN A;  4Y3O A;  4HX4 A;  1GV5 A;  5DDG A;  5FFZ A;  4HA8 A;  3W2W A;  1F43 A;  3MZH A;  3LFK A;  5HNF A;  4BBS J;  2K86 A;  5FD5 A;  3KZY A;  2EZK A;  1HCR A;  3AFH A;  3HJE A;  3KX2 A;  1X1D A;  2WAF A;  4HPQ A;  3GVA A;  3L7W A;  1HC8 A;  2CG4 A;  2V9K A;  2LKP A;  3I71 A;  3UR3 C;  3BTI A;  3Q0W A;  3ZQC A;  1ULY A;  2EIN H;  3BG9 A;  2DTZ A;  2UV1 A;  3C7J A;  3JTG A;  1G3W A;  1FIP A;  1KZH A;  2ELK A;  2TCT A;  3I53 A;  1FIA A;  4XIC A;  4A3D J;  3FDY A;  3TW6 A;  2Q2E B;  2VJ4 A;  3OSG A;  4KJZ A;  3K69 A;  3ZMV A;  2ELH A;  4EJT A;  2VXD A;  1BC8 C;  4LG3 A;  1PUF A;  1ZAO A;  2XUB A;  4KIF A;  4UB6 C;  3OYD A;  4ETS A;  3U2R A;  2F2E A;  5HLT A;  2QQA A;  3EET A;  4LLG F;  1XPX A;  1RR7 A;  4JOM A;  2ME0 A;  4QPO A;  2DMP A;  1SVO A;  3WGG A;  3MFK A;  4ENK A;  1UAA A;  2TRT A;  2XF6 A;  4ITV A;  3HRS A;  2QQ8 A;  4F92 B;  1LKX A;  3KLN A;  5DUK A;  1SAN A;  1ODD A;  1OQY A;  1S3J A;  3Q5F A;  3G71 I;  3JRI A;  1EJ9 A;  3G1M A;  4KUM A;  3G1O A;  4CHU A;  3F8B A;  4A3F J;  1WJ5 A;  1VQM I;  4LMY A;  2K9Q A;  1A04 A;  1WCM J;  2LSO A;  2E7W A;  3BTC A;  1BBY A;  2DU9 A;  5DYM A;  2LVS A;  2W25 A;  1ZTR A;  3CME I;  2O8X A;  1C0W A;  3M4O J;  1U5T C;  3CJQ B;  2XHK A;  5CLS A;  2AS5 F;  4IHX A;  3CD6 I;  3HOU J;  4KIC A;  4F55 A;  2X6X A;  1BL0 A;  1LE8 B;  3BR0 A;  4ENM A;  2O5R A;  3HM5 A;  2LNB A;  2V7F A;  2HQ5 A;  3WTY C;  1DUX C;  5A2Q K;  1YX3 A;  1UG0 A;  2LC2 A;  3ZPL A;  4UHT A;  4OIN F;  3HYI A;  4XRS A;  4JYK A;  1B6A A;  1EH8 A;  1O3R A;  4HOB A;  2CUE A;  5JLX A;  5EF6 A;  1JGS A;  2HOT A;  4XRS G;  1XDU A;  2IA2 A;  4HQM A;  5ICG A;  2EPF A;  2YU9 J;  1SAU A;  4BAC A;  3DEE A;  5JR3 A;  2QUF A;  2GZW A;  3HEF A;  3OR2 C;  4O6J A;  2GM4 A;  3KYL A;  3LL7 A;  2V9V A;  3BT9 A;  4U0V A;  2JA7 J;  5B3S H;  2QZ8 A;  1IG7 A;  3DKY A;  4AWX B;  5K7H A;  1WJA A;  1Z77 A;  4JX6 A;  1MJ9 A;  4EJV A;  5JVG F;  5IOY A;  1TWC J;  2IGN A;  2ZJQ F;  2FF4 A;  2DYR H;  1MBE A;  2BHZ A;  1TW2 A;  3IC7 A;  2W00 A;  3KEY A;  1VF9 A;  3MMY B;  2M9H A;  2MFZ A;  3GME A;  1J75 A;  2NVY J;  2Z9O A;  3L9F A;  4C2T A;  2O3F A;  4U87 A;  5H6R A;  1NH3 A;  2W7N A;  2ZFU A;  4YIR X;  3S1M J;  4LD5 A;  2DYS H;  1V4R A;  5L3C A;  3V4G A;  3VOE A;  4MGR A;  4Q47 A;  3EUH A;  3W2V A;  3CZ6 A;  3L2Q A;  2BEO A;  2DT7 B;  1F36 A;  3IH2 A;  1VQ7 I;  1FNN A;  1YIO A;  4MQV A;  1WI3 A;  5GAD J;  3RKQ A;  5F08 A;  2D1H A;  3RIR A;  3NWS A;  5B1B H;  1X3W B;  1E3O C;  4D5C A;  3HTU A;  5D4S A;  2H1K A;  4UVC A;  3WTW C;  1PJR A;  3LAJ A;  5DM7 F;  3K4M A;  1XN7 A;  1ZRC A;  3DWL E;  3OYA A;  4G6T B;  2L4M A;  3IUO A;  1G4D A;  4A3L J;  1LFB A;  2DA5 A;  2G7U A;  1PDN C;  2FEZ A;  3VYU B;  3H3U A;  2VBW A;  5F1J A;  3H35 A;  1IDY A;  1W5C C;  3FK7 A;  5DD8 A;  3QYE A;  1K4T A;  4OMY A;  4EGY A;  2QM3 A;  1XX5 A;  5BOX A;  3F9K A;  1QU3 A;  3EYY A;  1P9Q C;  4NQW B;  5C4J J;  3IP4 B;  2MW8 A;  4ZTJ A;  1XGM A;  2RNJ A;  3TOA A;  2ZXJ A;  5IPA A;  2L01 A;  1D1A A;  3K4L A;  1R58 A;  2DPD A;  2R7O A;  1W0T A;  4LFU A;  2XAH A;  4KIS A;  3A4C A;  2ZBK A;  1SD4 A;  2X6W A;  3U1D A;  3GFI A;  2JA8 J;  3DKW A;  2I5U A;  4IRH A;  1AA7 A;  3AKZ A;  2XGX A;  1W5S A;  2D1V A;  2HZD A;  1B4A A;  3HHG A;  3TO6 A;  5LGT A;  2FSW A;  1E3H A;  2DA2 A;  3J7A O;  1D8J A;  2L0K A;  5E20 A;  3NWT A;  2R92 J;  3M1E A;  1I3Q J;  1Z91 A;  2HR3 A;  3HOW J;  1R4M B;  5CQE A;  2MG4 A;  2X0L A;  1SFU A;  1ZH5 A;  2KIQ A;  4L5E A;  4WWC A;  1ON2 A;  4B09 A;  2DA1 A;  3CDL A;  1U8R A;  3OYB A;  4IOA F;  2WA0 A;  4GGG A;  4Q5S F;  3LSK A;  1WJC A;  3M9A A;  1ETX A;  1XD7 A;  3NRV A;  4GO1 A;  3QWL A;  1UJ8 A;  5J8C A;  3OMY A;  2M45 A;  1POG A;  1MMS A;  3FM3 A;  2LKX A;  4GXO A;  3ZR8 X;  1Z21 A;  1G3S A;  2CQQ A;  1J7K A;  3TW7 A;  2YR2 A;  4U0Y A;  5IP6 A;  2WB1 A;  5KAF C;  3QYB A;  4RS8 A;  4M74 A;  3J7Y J;  2STT A;  1P7J A;  2K9S A;  4P96 A;  4B44 A;  4XOP A;  5CVU A;  1MJA A;  4KA4 A;  4IHW A;  1TP4 A;  4JQF A;  3MWM A;  1G59 A;  2RV8 A;  4PUS A;  2ID3 A;  5FJ8 J;  4IX7 A;  2H6C A;  4IQJ A;  4Y7N J;  2QEX I;  2OQR A;  2VBY A;  4G7H F;  1YIT I;  3BRO A;  2DJN A;  3F72 A;  5HDN A;  1S29 A;  3NAU A;  3HRM A;  3EDP A;  2PJP A;  4G94 A;  3Q0U A;  3VWB A;  3PSF A;  4YFN F;  5CVR A;  4RM2 A;  3WGI A;  2FRH A;  2M4K A;  4J01 A;  1LEB A;  4EJW A;  2H6B A;  2M34 A;  4HLX A;  1X4O A;  2DBB A;  2JQ7 A;  1NG6 A;  5HVQ C;  2WAD A;  4NB5 A;  4RB1 A;  3CO6 C;  1FOW A;  1MZB A;  1YYV A;  2Y0S N;  4FTH A;  5J1Y A;  3JRD A;  2BY1 A;  3I9V 2;  5E79 C;  2CH0 A;  1VQN I;  1JXS A;  1U2W A;  2QKL B;  5DD4 A;  4ZDP A;  2K5C A;  1RI7 A;  1KQ9 A;  5IYC J;  4HNV A;  4A5M A;  4U7D A;  1ZG1 A;  2VAS A;  1R23 A;  2F6C A;  2VKV A;  1S7O A;  3ZMZ A;  2JZY A;  5IT9 Z;  3OL4 A;  3PFI A;  3H1C A;  4G6Q A;  3DPU A;  4L9T A;  2WC2 A;  1J2X A;  2DO7 A;  1TLH B;  3K7A J;  2XDV A;  1TT5 B;  2O8K A;  1JKQ C;  2GAU A;  1ZGJ A;  4XL9 A;  3LMM A;  1UCR A;  4DZP A;  2YU3 A;  1KU7 A;  1JHF A;  1STZ A;  2VIX A;  3SEQ A;  4D5F A;  2OV7 A;  2V1D A;  1HW1 A;  2EZI A;  1I39 A;  3L2V A;  4AIK A;  5EGO A;  1USS A;  3ZXS A;  3CCE I;  3MEX A;  3J80 K;  2A6E F;  2M0M A;  3FKJ A;  2EZL A;  2P5V A;  3P9I A;  5C3E J;  4BU2 A;  2MYS A;  2F5D A;  2A3S A;  4YFX F;  5LEK A;  3BR6 A;  3L1P A;  4A3I J;  3BJ6 A;  2FE3 A;  1S72 I;  5K5R A;  1YHQ I;  3WE2 A;  4PFO A;  2ZJP F;  1R1T A;  5LRR A;  4I7H A;  2K4B A;  4M6V A;  5EEA A;  2CSO A;  2V1N A;  5FFX A;  3ZQI A;  3DEU A;  3PJR A;  2L9N A;  2M7A A;  3VYS B;  5JHF A;  1T98 A;  3OR1 C;  2XPU A;  2DTR A;  5BS6 A;  1VI0 A;  3F23 A;  3OL3 A;  2FD5 A;  2BY0 A;  2B0L A;  2CQN A;  5CVJ A;  1SFX A;  2JVG A;  1R36 A;  1SFO J;  2KT0 A;  1W36 D;  4BUP A;  2F4I A;  3SQN A;  3OYK A;  2VT2 A;  3SZG A;  3GLL A;  1BJA A;  1WQ2 A;  3RQI A;  3H5A A;  3H9G A;  4HEA 2;  2XGD A;  1QHH D;  3IRQ A;  2WV1 A;  2JTV A;  1OCC H;  3REO A;  3PL8 A;  2ADU A;  2K9M A;  3SDG A;  5M5Y J;  1B9N A;  3QAH A;  2BW3 B;  2AO9 A;  5GPC A;  4HQE A;  4XLA A;  2JSP A;  3OYC A;  5FD6 A;  1IRZ A;  3E1S A;  3CC4 I;  1QQI A;  4OAZ A;  1FTT A;  3AL0 C;  4HF2 A;  3L2R A;  2IGO A;  2NVX J;  3RQ4 A;  1LQ1 A;  2A05 A;  2KJB A;  4BY1 J;  4S05 A;  4UUS A;  2ZFW A;  4BXX J;  2R7T A;  2QKM B;  3RYR A;  2O6G E;  1MND A;  3HTS B;  2O61 A;  2OCE A;  3OS0 A;  1TT0 A;  2ZXW H;  3HHH A;  3I0T A;  3PNV A;  5EEH A;  3JAM Z;  2VT3 A;  3M8F A;  2IS2 A;  9ANT A;  4WF2 A;  1CF7 A;  3GZN B;  4BE2 A;  1ZYR F;  4OIO F;  2EFN A;  3F6V A;  3KEO A;  5E3L A;  1Z6T A;  5HS8 A;  5EG0 A;  1MDM A;  1RUN A;  4IJA A;  4IPA A;  1V3F A;  1RKW A;  2D2W A;  3F8C A;  1H9T A;  1E17 A;  2ZNY A;  4Q4Z F;  2NOJ B;  2V1U A;  2Y48 A;  3MKZ A;  1TWF J;  4FX4 A;  4LIT A;  1FSH A;  3BP8 A;  2FML A;  2JPC A;  1JT6 A;  3WTT C;  3BY6 A;  3WTZ A;  1TQI A;  1I6X A;  3KE2 A;  1W4M A;  4U0W A;  4UB8 C;  2E1M C;  1YI2 I;  1E2X A;  3GBG A;  3TQN A;  4M3D A;  2R7U A;  1HW5 A;  2JN6 A;  1YOV B;  5IP7 J;  1IN6 A;  4HX8 A;  2KJC A;  3OIQ A;  2RC4 A;  5GPA A;  1I5Z A;  2DAO A;  1Y56 A;  3WHB A;  2HVR A;  1YQA A;  4AC0 A;  2OAZ A;  4CCK A;  1P4X A;  3JSP A;  1SMT A;  4KFC A;  4D9J A;  3GWZ A;  4IKF A;  2WAQ A;  5D6F A;  5DTD A;  4I76 A;  1IXS B;  3LA7 A;  1U9O A;  1JUS A;  2V6E A;  2HOE A;  1O7F A;  4AM3 A;  1KU3 A;  1O57 A;  5DCM A;  1SC7 A;  4EM1 A;  4CUG A;  1X2N A;  1Z0X A;  3A03 A;  5KAI C;  3QOD A;  4ON0 A;  2R7X A;  1TL8 A;  1W7P B;  4M9Z A;  4UUS B;  2OTL I;  4CYC B;  3C2H A;  4CIC A;  1R49 A;  2JA6 J;  4ZDO A;  2ZME A;  5D8L B;  2FX0 A;  1JUP A;  1WI9 A;  3GTP J;  4V19 K;  4I99 C;  1LB2 A;  5H6Q A;  2EA4 A;  3CUQ A;  3B02 A;  1CF7 B;  4M3G A;  4A2U A;  3IL2 A;  3DP7 A;  1GT0 C;  5EG0 B;  1MDM B;  4IHY A;  1HST A;  1BW5 A;  2D45 A;  1MIJ A;  2UUZ A;  5FLV A;  2XC7 A;  4ZH4 F;  1Y6I A;  3PFY A;  2Y69 H;  2YS9 A;  2FJ1 A;  1LFU P;  3A01 A;  4MQ9 F;  4IOC F;  1Y39 A;  5M3F J;  3TP3 A;  2CV2 A;  2MBF A;  1MMN A;  3AG1 H;  1DDN A;  1DU6 A;  3CO7 C;  3E0J B;  3DTE A;  4CCM A;  4DIQ A;  1ITY A;  2FBI A;  1IDZ A;  3QP5 A;  3A1Y A;  1U5T A;  3V7S A;  4A6E A;  4LIU A;  2ZCW A;  1EH6 A;  5FLM J;  2EWN A;  3I59 B;  1VQ6 I;  1JKO C;  3GO5 A;  2ESN A;  4B43 A;  4ENN A;  3BQY A;  2BYV E;  3BOQ A;  2KRH A;  5ICF A;  5KCM A;  5FLX K;  4II3 A;  4UNO A;  3S32 A;  1S7E A;  5ILS A;  2JPB A;  3H0G J;  3EQL F;  1W7P D;  3QQA A;  3V7R A;  2F4M B;  4W97 A;  3CC7 I;  2PG4 A;  2E5N A;  1RR8 C;  2CMP A;  1D8K A;  2KIU A;  4IRI A;  2COB A;  1X19 A;  5C44 J;  1SVL A;  3MKW B;  4HF0 A;  1AU7 A;  1BR2 A;  2NS7 A;  4AYB N;  1FYM A;  5K7F A;  5EDN A;  3W6V A;  4QIW N;  1OCP A;  1SD6 A;  2PMH A;  2ZME B;  2LOO A;  1XMX A;  4E7L A;  3I4P A;  2AHQ A;  4XLN F;  1TWA J;  3D1N I;  1K7A A;  2LF7 A;  5CPR B;  3QPL A;  1IRG A;  1X1C A;  1ZG5 A;  2B9S A;  4IHS A;  2P81 A;  3W2A A;  2P7V B;  3GLX A;  1TBX A;  2Y9Y A;  2J5P A;  4XSX F;  2MGQ A;  3E5Q A;  2DDA A;  1PUE E;  3OYF A;  2LR8 A;  3BCB A;  4PJM A;  2DN0 A;  4XKV A;  3I55 I;  3A01 B;  3TOB A;  4RA2 A;  2KRF A;  4IZZ A;  1R1U A;  2Q1Z B;  1FYL A;  1IAW A;  4G7O F;  1LUJ B;  2QCO A;  4KIG A;  4LJZ F;  3OYM A;  3MVP A;  1X4P A;  3BJA A;  2LLK A;  1TZL A;  2OQG A;  4LLN A;  2YX7 A;  3R61 A;  2W57 A;  4II2 A;  2L2O A;  2VPR A;  3CCQ I;  3IAS 2;  3PM1 A;  4XSZ F;  3OIO A;  1MD0 A;  2X1D A;  2DK8 A;  3CDI A;  3EUA A;  2LRD A;  4HDV A;  3KLO A;  2WTE A;  2PMZ A;  2DMQ A;  3BG6 A;  4XLP F;  3I54 A;  3E5X A;  2X85 A;  3FXL A;  1QNT A;  2DFI A; 
#chains in the Genus database with same CATH homology
 2XRN A;  2H27 A;  1TW3 A;  2M8E A;  4BHB A;  3ELK A;  2MC3 A;  5BQT A;  1RNL A;  3DF8 A;  1J0R A;  2EFP A;  4I0A A;  4N9H A;  2E7X A;  4RB3 C;  4ESB A;  4ZYD A;  1ZRD A;  4RGS A;  1FC3 A;  3MAJ A;  5ICE A;  2M87 A;  4HW0 A;  3RKX A;  1Z6R A;  3SZP A;  4M72 A;  4FHT A;  3WE3 A;  3FMS A;  4L5I A;  3GUD A;  3BJO A;  3E6M A;  3L2C A;  5JI6 A;  1BIA A;  1KQ8 A;  4M6Y A;  4Y13 A;  4BQA A;  4IXA A;  5FLX Z;  4HF1 A;  3CUQ C;  3F3X A;  4DNC A;  2Z33 A;  4BH9 A;  2VC0 A;  1XGO A;  4H0E A;  2V1X A;  1LDD A;  1Z7U A;  3QOP A;  3LAP A;  2K27 A;  4KN7 X;  3QP6 A;  2EV0 A;  5HLH A;  3K2Z A;  1XSV A;  4YG2 F;  2CYY A;  3JW4 A;  4JBA A;  4TV7 A;  3O6B B;  1HKS A;  1H0M A;  3P9C A;  4XBF A;  2RDP A;  4G6D A;  4GYI A;  2PBI A;  3MQ0 A;  3HOS A;  4L9J A;  5K5O A;  1KYW A;  1SD7 A;  3HOT A;  2VBX A;  2FBH A;  2GA2 A;  2PLY A;  1R7J A;  4NQW A;  1KU2 A;  1J5Y A;  1BI3 A;  2XAS A;  5HDG A;  1BIB A;  3DV8 A;  4N9I A;  4P9F A;  1TTY A;  2DI3 A;  1YTY A;  2WV0 A;  2JRT A;  2XAQ A;  2QLZ A;  1R00 A;  1XB4 A;  2Q8K A;  5CVV A;  2EV5 A;  3EYI A;  2JSC A;  3VEP A;  3FHZ A;  1S6L A;  2H09 A;  3F21 A;  1KA8 A;  1FY7 A;  1ZRE A;  1IW7 F;  1J9I A;  3WU0 A;  4XRF A;  5HLG A;  3R0J A;  4PDK A;  5LHG A;  5DUI A;  2Q0O A;  3FMR A;  5CJ9 A;  3OOP A;  3TO9 A;  2HEO A;  5JFR A;  5HDK A;  4PZJ A;  2G9W A;  4QLC U;  4I0B A;  5H20 A;  4ZYE A;  1P2F A;  3R60 A;  5LEJ A;  5E18 F;  4AD9 A;  3T1B A;  4BAY A;  3LA2 A;  2MH2 A;  2CO5 A;  5ILV A;  1JE8 A;  3O3K A;  4EGZ A;  4UV8 A;  3T0Y A;  3IKT A;  4RAY A;  3DPT A;  4KMF A;  1IN8 A;  1SD5 A;  4YII A;  2XAF A;  1YO5 C;  1K79 A;  2BV6 A;  2P8T A;  3DPL C;  5LHH A;  2FU4 A;  3RJP A;  1OYW A;  3NQO A;  4HDU A;  3BZ6 A;  1LNW A;  3FXR A;  1XCV A;  2DK5 A;  1T2K A;  5D5X B;  4PCQ A;  1XSD A;  5E1X A;  3J81 K;  5HOO A;  2VE9 A;  4ENJ A;  3ZMT A;  4LB6 B;  3MZY A;  3GFM A;  1QPM A;  3DXJ F;  5L3F A;  3FM5 A;  5A2Q Z;  2PN6 A;  1T6S A;  1X3U A;  4A0Y A;  4IF4 A;  4EQQ A;  3VOD A;  2YSR A;  1J59 A;  1XMK A;  2FNP A;  3VB2 A;  1GVJ A;  4MTE A;  3K1M A;  1F9N A;  2A5Y B;  1R22 A;  2EB7 A;  3E3V A;  3ZMS A;  3E5U A;  4I02 A;  4RAZ A;  5HS7 A;  5ICC A;  1YG2 A;  4LK0 F;  4EM0 B;  2W84 A;  4P55 A;  2TDX A;  2VON A;  4KYW A;  1ZLK A;  2IJL A;  3TKY A;  2Z99 A;  3ZMD A;  1BM9 A;  2XAJ A;  1REP C;  1FBQ A;  3SZT A;  2GIV A;  3V7C A;  4Y15 A;  2CWE A;  5ILU A;  2RN7 A;  1OR7 A;  1GHC A;  3H3Z A;  2XKP A;  1G3T A;  5FGM A;  3FX3 A;  2VE8 A;  2VOP A;  4BHC A;  2NNY A;  2XKO A;  1DP7 P;  2R7D A;  1NHA A;  4RGR A;  4L0Z B;  2F5C A;  4HV5 A;  4BNC A;  5LLQ A;  4CO8 A;  3LA3 A;  2LF8 A;  3E6C C;  2C6Y A;  5HLI A;  3J81 Z;  4M9X A;  4P5O A;  1FT9 A;  3T8R A;  1XMA A;  2FBK A;  2E1N A;  2IVM A;  1W7P A;  3RDI A;  1OMI A;  4M73 A;  1BN5 A;  5LHI A;  2MLG A;  3ULQ B;  2K7L A;  4AIJ A;  4OIP F;  2BGC A;  3IWZ A;  1O3Q A;  1F4K A;  4CXF A;  2HFH A;  1P6R A;  3MCZ A;  1ZN2 A;  2HTJ A;  2VXZ A;  2NYX A;  2UZK A;  2R3S A;  2QQB A;  4YIF A;  4JK1 X;  5BMZ A;  1P4A A;  2MH9 A;  3FF5 A;  1TNS A;  1VTN C;  3ZN1 A;  3I59 A;  1W5T A;  5BPI A;  2JT1 A;  2KIF A;  5D6E A;  3KEQ A;  1T0F A;  3VFZ A;  3ZN0 A;  3R6S A;  2EA2 A;  4CZZ A;  3J80 Z;  1U78 A;  1UHW A;  3P7N A;  3DQV C;  2XAG A;  1YW9 A;  2YPR A;  1EV7 A;  4ZZL A;  4I2O A;  2GA1 A;  3G3Z A;  4IHT A;  2LDU A;  2PQ8 A;  3CDH A;  1HKQ A;  2RQP A;  1SAX A;  1P92 A;  1DPU A;  2A6H F;  3RPQ A;  2HTS A;  2V6C A;  3F6O A;  1KGS A;  1I27 A;  3V8L A;  3CTA A;  2ZNZ A;  3BDD A;  4CDG A;  1S8N A;  3RKY A;  1BI0 A;  2HKX A;  5E17 F;  3WU1 B;  2HQN A;  1O3S A;  3DFG A;  5J8F A;  1SMY F;  2CQK A;  3HRU A;  4G9Y A;  3GFJ A;  4S04 A;  3FWE A;  3V8J A;  3GZ6 A;  1HXD A;  2V79 A;  3KP6 A;  5DV5 A;  2KKO A;  3CLO A;  1MJB A;  1FPQ A;  2F5F A;  1L0O C;  3HIF A;  4ZYG A;  5DCF A;  1WRJ A;  4LG0 A;  5AIP A;  3Q9V A;  4OU0 A;  2Y75 A;  2P5L C;  4EMS A;  1JHH A;  1R5G A;  5D8K B;  4O5V A;  2VC1 A;  4OOI A;  4D0P A;  1R5H A;  3QPH A;  2NS0 A;  2CW0 F;  4EJU A;  4MHG A;  4RB2 C;  5KK1 A;  1WKM A;  1PP7 U;  1Z05 A;  3ROU A;  2IW5 A;  2IA1 A;  5LRS A;  3KP4 A;  3W6K B;  4KDP A;  2P6T A;  4HYE A;  2EFW A;  4MNU A;  3RI4 A;  4HLY A;  3GEZ A;  4KNY A;  2BE5 F;  4KT5 C;  1Y0U A;  3HRT A;  1D3Y A;  2RVC A;  4R79 A;  5F1R A;  5L3D A;  3BPV A;  3JSO A;  5F64 A;  3ABT A;  2NAZ A;  1ZHF A;  2IA0 A;  4ESJ A;  3N4M A;  1HW2 A;  3GFL A;  2IPQ X;  3ISP A;  4OIQ F;  4WXH A;  3WTV C;  5J6X A;  2R7F A;  4LG0 B;  2QEN A;  2IRF G;  4WK8 F;  5L3G A;  3GZ5 A;  2DT5 A;  2HDC A;  3JTH A;  2XIG A;  5E1Z B;  2X4H A;  5TRD A;  4ESF A;  2ISY A;  2UXX A;  2DQR A;  4WXD A;  2M30 A;  2FQ3 A;  3CUO A;  3LWF A;  2Z3Y A;  2MLK A;  4BYY A;  1AWC A;  1U3E M;  1KQ0 A;  1GXP A;  1QZZ A;  4HX7 A;  3RPU A;  1KU9 A;  3PQJ A;  1U6G A;  2HZT A;  2PFB A;  3LQQ A;  5BPD A;  3HSF A;  2CGP A;  2W85 A;  2QYO A;  4BXU A;  3N97 A;  4OIR F;  1XGN A;  2G7H A;  1FSE A;  2L54 A;  2EV6 A;  2P6S A;  3IWF A;  2PMU A;  3KP2 A;  1WSU A;  2OD5 A;  1B9M A;  3V8K A;  1IXC A;  1RZ4 A;  2STW A;  3GYH X;  4R1H A;  4UVB A;  5D5U B;  1RUO A;  4LK1 F;  1HKT A;  4EM2 A;  4IVN A;  1FLI A;  3QPT A;  1RIO H;  2K02 A;  2HYG D;  5E1W A;  1I1G A;  3ZMU A;  1T39 A;  2OU2 A;  3HSE A;  2HYF A;  1DPR A;  1FBU A;  1TQM A;  1FX7 A;  2ZKZ A;  5F6F A;  3E6B A;  3K1P A;  3KP5 A;  4MTD A;  1QGP A;  2FOK A;  1UB9 A;  3D5L A;  1OPC A;  3WTX C;  3ML6 A;  5FO5 A;  2PI0 A;  1UFM A;  1QO0 D;  1MKM A;  1IZ1 A;  1UST A;  3HUG A;  4DQ2 A;  1H9G A;  4F7Z A;  1HSJ A;  1CGP A;  2QVO A;  1Z1D A;  2XVC A;  4EV0 A;  1SFE A;  4NHJ A;  3R0A A;  1IUY A;  1YW7 A;  4N0B A;  3ZP5 A;  5IT9 K;  3LQR A;  3F22 A;  1ZLJ A;  4FX0 A;  3P9K A;  4L9N A;  3GW2 A;  4ZYH A;  2QQ9 A;  4CGZ A;  4Y17 A;  1ONV A;  4HV6 A;  3RYP A;  5ERI A;  4KIB A;  1FBS A;  5LBQ A;  3OV8 A;  3S2W A;  4AVP A;  1FYK A;  2P5K A;  3ECH A;  2YX4 A;  2XRO A;  4M6X A;  4KMU X;  2FA5 A;  1OYY A;  1LEA A;  1HQC A;  1K78 A;  5FB2 A;  1Q1H A;  3C1D A;  3QRF F;  1YW8 A;  5DEQ A;  3GF2 A;  4MEX F;  4GYG A;  1T38 A;  2GXB A;  1ZRF A;  4LLL A;  3KP7 A;  2RGV A;  3C18 A;  1XCB A;  4U7B A;  2IT0 A;  5LGU A;  2M5W A;  4I09 A;  3TDZ C;  1YS7 A;  1Z9C A;  1IN7 A;  1OKR A;  2CFX A;  4WXC A;  3G73 A;  2COM A;  1BC7 C;  2MD5 A;  3JAM K;  3FZV A;  5L3E A;  2EJR A;  3BWG A;  3WGH A;  2KIM A;  4RB0 A;  2HS5 A;  1S7A A;  2EK5 A;  2DQL A;  3RKW A;  3ERE D;  5D5W B;  3COA C;  2AXL A;  1ZGA A;  4U88 A;  2VOD A;  1ZAR A;  3WTU C;  2O0Y A;  4LGW A;  4MEY F;  2A68 F;  4Q48 A;  3TO7 A;  1K78 B;  2H94 A;  2DW4 A;  2VBZ A;  2P7C B;  3WOD F;  3B73 A;  2L3D A;  1XSX A;  2ZO4 A;  3E6D A;  1BI1 A;  3K0L A;  3Q9S A;  2QBY A;  3ZQ7 A;  3IKV A;  4CYD A;  4K2E A;  3GXO A;  3LST A;  5E8G A;  1UHM A;  4ZZD A;  2RKH A;  4L0Y B;  4UXN A;  3FXU A;  1F1Z A;  4I01 A;  1I1S A;  2Z5U A;  3KP3 A;  2Y0M A;  3H92 A;  2O03 A;  4LB5 A;  4O3M A;  3D0S A;  1XGS A;  1P4W A;  1BI2 A;  4P9U A;  2ETH A;  2A69 F;  2OZU A;  4HAM A;  4G8X A;  2VOO A;  2NNN A;  2F5E A;  2DLL A;  2BBY A;  1IF1 A;  2FMY A;  2HGC A;  5K1Y A;  5AON A;  4EJO A;  3ECO A;  3I64 A;  1K6O A;  1EH7 A;  4KN4 X;  4HBL A;  1FZP B;  2IP2 A;  4OMZ A;  3R4K A;  5L3B A;  4R8H A;  2QBY B;  4GCV A;  2XV4 S;  5TJJ A;  2ZJ2 A;  4QWQ A;  1BOA A;  2E1C A;  1YFH A;  4IRG A;  1IN4 A;  2M1B A;  1AOY A;  5LGN A;  3SFZ A;  3WTS C;  1KYZ A;  3T5X A;  1LVA A;  4A0Z A;  1O7L A;  1FOK A;  3L09 A;  1QBJ A;  4I98 B;  4M71 A;  4HZF A;  2L4A A;  2ISZ A;  5AIQ A;  2VN2 A;  3M8E A;  5KVR A;  1LDK B;  4G7Z F;  4E70 A;  3I58 A;  1IXR C;  1TQP A;  1G6N A;  3IHU A;  4Z2Y A;  2J5O A;  5JHU A;  3SXY A;  2UXN A;  2PEX A;  2FNA A;  3IRR A;  4A0X A;  3PQK A;  4RGX A;  1MGT A;  3WG9 A;  1XDS A;  4FT8 A;  3ABU A;  3F8F A;  4ASN A;  2FXA A;  1ZG3 A;  1G3Y A;  3KET A;  3GX4 X;  4L5J A;  2GXG A;  5E8I A;  3KCC A;  3KZZ A;  5D4R A;  3KFW X;  4AIH A;  1HBX G;  1B1B A;  1LDJ A;  1ON1 A;  2GWR A;  2ESH A;  3K9T A;  3E97 A;  4M9S A;  2EFQ A;  5ED4 A;  3TGN A;  5EEG A;  2WWY A;  1OYI A;  3L00 A;  4WX9 A;  2OZ6 A;  4B8X A;  3BPX A;  1R1V A;  5D5V B;  1WWX A;  1L3L A;  3FXQ A;  3QU6 A;  5CVI A;  4L18 B;  2HQR A;  6PAX A;  2EFO A;  3F8M A;  1O3T A;  2UWM A;  1IRF A;  2OBP A;  3T8T A;  2OA4 A;  3C3W A;  1IN5 A;  2HKO A;  3K1N A;  3O2P E;  4A5N A;  1D5V A;  3M7G A;  3F8N A;  5DCM B;  1LJ9 A;  5IT3 A;  4WCG A;  5CYV A;  4RGU A;  3TDU C;  3CUQ B;  4A12 A;  3I5U A;  3FMQ A;  2A61 A;  3QU3 A;  1YS6 A;  2GQQ A;  2ACJ A;  4EVI A;  2P4W A;  4UV9 A;  2MA3 A;  1FP2 A;  2K4J A;  1YLF A;  4UUV A;  3NEU A;  1TNT A;  4YFK F;  4BHP A;  3RTR A;  2Q2E A;  3HSR A;  3AAF A;  4A6D A;  1F5T A;  1FP1 D;  1PP8 F;  2W24 A;  2L02 A;  5JVT A;  2HWV A;  3W6J B;  1B59 A;  2A07 F;  1U5T B;  5HS9 A;  4UVA A;  4PGH A;  1GXQ A;  2QWW A;  3U9G A;  3SHF A;  2DPU A;  2NRA C;  1QZY A;  1FWZ A;  4L9V A;  5K5Q A;  4PGG A;  3CJN A;  4HX4 A;  5DDG A;  5FFZ A;  4HA8 A;  3MZH A;  3LFK A;  2K86 A;  5FD5 A;  3KZY A;  3GVA A;  3L7W A;  2CG4 A;  2LKP A;  3I71 A;  1ULY A;  3C7J A;  3JTG A;  1G3W A;  3I53 A;  3K69 A;  3ZMV A;  2ELH A;  4EJT A;  1BC8 C;  1ZAO A;  2XUB A;  4KIF A;  4ETS A;  3U2R A;  2F2E A;  2QQA A;  3EET A;  4LLG F;  3WGG A;  3MFK A;  4ENK A;  3HRS A;  3KLN A;  5DUK A;  1ODD A;  1S3J A;  3Q5F A;  4KUM A;  4CHU A;  3F8B A;  4LMY A;  1A04 A;  2LSO A;  2E7W A;  1BBY A;  2DU9 A;  5DYM A;  2W25 A;  2O8X A;  1C0W A;  1U5T C;  2XHK A;  5CLS A;  2AS5 F;  4KIC A;  4ENM A;  2LNB A;  3WTY C;  1DUX C;  5A2Q K;  3ZPL A;  4UHT A;  4OIN F;  3HYI A;  1B6A A;  1EH8 A;  1O3R A;  4HOB A;  1JGS A;  1XDU A;  2IA2 A;  4HQM A;  5ICG A;  5JR3 A;  2QUF A;  2GZW A;  4O6J A;  2V9V A;  4U0V A;  2QZ8 A;  4AWX B;  1MJ9 A;  4EJV A;  2FF4 A;  1TW2 A;  3IC7 A;  1J75 A;  2Z9O A;  3L9F A;  2O3F A;  5H6R A;  4LD5 A;  1V4R A;  5L3C A;  3V4G A;  3VOE A;  4MGR A;  4Q47 A;  3EUH A;  2BEO A;  1FNN A;  1YIO A;  4MQV A;  2D1H A;  3RIR A;  3HTU A;  5D4S A;  4UVC A;  3WTW C;  3LAJ A;  1XN7 A;  1ZRC A;  2L4M A;  1G4D A;  2G7U A;  1PDN C;  2FEZ A;  3H3U A;  2VBW A;  5DD8 A;  4OMY A;  4EGY A;  2QM3 A;  5BOX A;  3EYY A;  1XGM A;  2RNJ A;  3TOA A;  2ZXJ A;  2L01 A;  1R58 A;  2DPD A;  4LFU A;  2XAH A;  2ZBK A;  1SD4 A;  3U1D A;  3GFI A;  3DKW A;  4IRH A;  2XGX A;  1W5S A;  2D1V A;  1B4A A;  3HHG A;  3TO6 A;  5LGT A;  2FSW A;  1D8J A;  3J7A O;  5E20 A;  3M1E A;  1Z91 A;  2HR3 A;  2X0L A;  1SFU A;  1ZH5 A;  4WWC A;  1U8R A;  1ON2 A;  4B09 A;  4GGG A;  4Q5S F;  3M9A A;  1XD7 A;  3NRV A;  4GO1 A;  5J8C A;  2M45 A;  3FM3 A;  4GXO A;  1G3S A;  1J7K A;  2YR2 A;  4U0Y A;  4RS8 A;  4M74 A;  2STT A;  4P96 A;  5CVU A;  1MJA A;  4KA4 A;  4JQF A;  3MWM A;  2RV8 A;  2H6C A;  2OQR A;  2VBY A;  4G7H F;  3BRO A;  3F72 A;  5HDN A;  1S29 A;  3HRM A;  3EDP A;  2PJP A;  4G94 A;  4YFN F;  5CVR A;  3WGI A;  2FRH A;  1LEB A;  4EJW A;  2H6B A;  4HLX A;  2DBB A;  5HVQ C;  3CO6 C;  4NB5 A;  4RB1 A;  1MZB A;  1YYV A;  1JXS A;  1U2W A;  5DD4 A;  1RI7 A;  1KQ9 A;  4A5M A;  4U7D A;  1ZG1 A;  1R23 A;  1S7O A;  3ZMZ A;  2JZY A;  5IT9 Z;  3PFI A;  4G6Q A;  4L9T A;  2WC2 A;  1J2X A;  2DO7 A;  1TLH B;  2GAU A;  1ZGJ A;  1UCR A;  2YU3 A;  1KU7 A;  1JHF A;  1STZ A;  2V1D A;  1HW1 A;  4AIK A;  1USS A;  3MEX A;  3J80 K;  2A6E F;  2P5V A;  3P9I A;  2F5D A;  2A3S A;  4YFX F;  5LEK A;  3BJ6 A;  2FE3 A;  5K5R A;  3WE2 A;  1R1T A;  5LRR A;  4I7H A;  2K4B A;  2CSO A;  5FFX A;  3DEU A;  1T98 A;  2DTR A;  5BS6 A;  3F23 A;  2B0L A;  5CVJ A;  1SFX A;  1R36 A;  3SQN A;  2VT2 A;  1BJA A;  1WQ2 A;  3IRQ A;  2JTV A;  3REO A;  2ADU A;  1B9N A;  3QAH A;  4HQE A;  5FD6 A;  1QQI A;  4HF2 A;  1LQ1 A;  2KJB A;  4S05 A;  2ZFW A;  2O6G E;  3RYR A;  3HTS B;  2O61 A;  3HHH A;  3I0T A;  5EEH A;  3JAM Z;  2VT3 A;  3M8F A;  4WF2 A;  1CF7 A;  1ZYR F;  4OIO F;  2EFN A;  3F6V A;  3KEO A;  5HS8 A;  1Z6T A;  1MDM A;  1RUN A;  4IJA A;  4IPA A;  1V3F A;  2D2W A;  3F8C A;  1H9T A;  1E17 A;  2ZNY A;  4Q4Z F;  2V1U A;  2Y48 A;  4FX4 A;  1FSH A;  3BP8 A;  2FML A;  2JPC A;  3WTT C;  3BY6 A;  3WTZ A;  1TQI A;  1I6X A;  3KE2 A;  1W4M A;  4U0W A;  1E2X A;  3TQN A;  1HW5 A;  1IN6 A;  4HX8 A;  2KJC A;  2RC4 A;  1I5Z A;  2DAO A;  1YQA A;  2OAZ A;  3JSP A;  1P4X A;  1SMT A;  4KFC A;  3GWZ A;  5D6F A;  1IXS B;  3LA7 A;  2HOE A;  1O7F A;  1KU3 A;  1O57 A;  5DCM A;  4EM1 A;  4ON0 A;  1W7P B;  4M9Z A;  4CIC A;  2ZME A;  5D8L B;  1WI9 A;  1LB2 A;  5H6Q A;  2EA4 A;  3CUQ A;  3B02 A;  1CF7 B;  4A2U A;  3IL2 A;  3DP7 A;  1MDM B;  1HST A;  2D45 A;  4ZH4 F;  4MQ9 F;  2MBF A;  1DDN A;  3CO7 C;  2FBI A;  3QP5 A;  1U5T A;  3V7S A;  4A6E A;  2ZCW A;  1EH6 A;  2EWN A;  3I59 B;  3GO5 A;  2ESN A;  4ENN A;  2BYV E;  3BOQ A;  5ICF A;  5FLX K;  4UNO A;  5ILS A;  2JPB A;  3EQL F;  1W7P D;  3V7R A;  2PG4 A;  1D8K A;  2KIU A;  4IRI A;  4HF0 A;  1FYM A;  1SD6 A;  2PMH A;  2ZME B;  3I4P A;  4XLN F;  1K7A A;  2LF7 A;  1IRG A;  1ZG5 A;  4IHS A;  2P7V B;  3GLX A;  1TBX A;  2J5P A;  4XSX F;  3E5Q A;  1PUE E;  3TOB A;  2KRF A;  1R1U A;  1FYL A;  1IAW A;  4G7O F;  4KIG A;  4LJZ F;  3BJA A;  2OQG A;  4LLN A;  2YX7 A;  3R61 A;  2W57 A;  4XSZ F;  1MD0 A;  2DK8 A;  4HDV A;  3KLO A;  2WTE A;  4XLP F;  3I54 A;  3E5X A;  1QNT A;  2DFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...