3ZMDA

Crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
148
structure length
148
Chain Sequence
TRWLTDTEQCAWRTHLEVNRLLTHQLEKDLQPFGLTMNDYEILVNLSESEGDRMRMSDLATATMQSKSRLSHQITRMENANLVRRENCESDRRGLFAVLTEHGLETMRKVAPHHVASVRRHFIDLLAPEDLTELDKALKPIAEHLRGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE TRANSCRIPTIONAL REGULATOR
publication title Crystal Structure of Absc, a Marr Family Transcriptional Regulator from Streptomyces Coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 54
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zmdA00
4BXUA 2KKOA 2KIMA 1BC7C 1YYVA 1P2FA 5DV5A 2HDCA 1B4AA 1J5YA 2PEXA 1Z7UA 5HLGA 1KA8A 1U3EM 4GGGA 3QU3A 1CF7A 4M72A 3HRSA 4N9HA 1J2XA 5D6EA 3OV8A 3LQQA 2HKOA 2FBKA 4L5IA 4WXHA 1YO5C 3K9TA 2KIUA 3HTUA 2FA5A 1ON1A 4LK0F 3RI4A 3SZTA 1EH7A 4IVNA 4Y15A 3HTSB 1DUXC 5D5XB 3KP5A 2B0LA 3NRVA 2A68F 4KIGA 2Q8KA 4I01A 2A3SA 1R5HA 1G3SA 3BPXA 2DQRA 1O7LA 2W57A 2IJLA 1R1UA 3ABUA 5JVTA 3CO6C 3T5XA 2H94A 2XAHA 4EVIA 3ROUA 1KU2A 1IXCA 4MNUA 1WKMA 1RIOH 1IUYA 2PN6A 5DCFA 3MAJA 1OMIA 2ZNZA 2FBIA 4EJUA 1MJBA 5LHIA 2LKPA 2IA2A 1X3UA 3GFMA 4BAYA 5H6RA 4P9FA 5BOXA 2KIFA 1K79A 2F5CA 2V9VA 2GA1A 1HW2A 3CUQC 1R7JA 2DK5A 2XASA 1GVJA 3C1DA 3RKXA 1XGNA 4A6EA 4R79A 2DK8A 2K7LA 3G73A 4HF1A 1IRFA 3EDPA 1KQ8A 5L3DA 4ZYEA 4XSZF 2VXZA 1U5TC 1XB4A 3CLOA 3J81K 2HGCA 3KEOA 1RZ4A 2EV6A 3PQKA 3T1BA 3QPTA 1T2KA 4IHTA 3H3ZA 3IKTA 5BS6A 3GEZA 1LDKB 1K78A 2EFWA 4IRGA 3DXJF 1KU3A 5D6FA 4KICA 1FOKA 4HLXA 1A04A 5D8KB 3QP6A 3ZMVA 2XV4S 5ILVA 1U2WA 5FFZA 1QNTA 1YIOA 5CVRA 4ENMA 1TNTA 2ZFWA 3RPQA 4WF2A 1GXPA 5LEJA 2XIGA 3GF2A 5FO5A 3I59A 4U7BA 4BHBA 4HX7A 2GAUA 5BPDA 2K02A 2HYGD 1LNWA 4EJVA 5D5VB 4WWCA 4M9ZA 4KNYA 2QQ9A 1Z91A 2F5EA 4EMSA 3HIFA 4ON0A 2D2WA 1G3YA 1J59A 3MZYA 3I71A 4LMYA 3BOQA 4HX4A 1R1VA 1U8RA 5F6FA 4KA4A 3WG9A 3S2WA 3IWZA 4KT5C 4Q47A 2A6HF 2HZTA 2ZKZA 4YFKF 5FD6A 2EJRA 1OR7A 4I0AA 4AIHA 2HQRA 2DBBA 4YIIA 3DPLC 4I09A 2WC2A 1PDNC 1IN5A 4IRIA 2DLLA 4L0YB 4I0BA 1TLHB 1B59A 4HA8A 4BH9A 2Z99A 2MH2A 2L4MA 2E7WA 1HKQA 2NS0A 2HKXA 1UHMA 1EV7A 4EM2A 2HYFA 5H20A 1BJAA 4NQWA 4AD9A 3K69A 2H6CA 4HLYA 5DD4A 1QGPA 2VODA 3I4PA 2P8TA 2OU2A 3BZ6A 5LLQA 5AIQA 1ZH5A 3L9FA 2QENA 2OQRA 3LFKA 1IW7F 1MJAA 3QP5A 4WX9A 4RGXA 3M8FA 5E18F 4RAYA 2YR2A 1YS7A 3LA7A 1IN8A 1S6LA 2OAZA 2LDUA 3BJ6A 1BI0A 2O0YA 2PMUA 1XN7A 2CWEA 2ESHA 3FXRA 3H92A 4OINF 4H0EA 3JTHA 2K4JA 4OIOF 5LHGA 2DU9A 5E17F 1FBQA 1MDMB 2XAQA 4RGSA 2OA4A 4ZH4F 3ECOA 3U1DA 1PP8F 2GXBA 5FGMA 3RYRA 1R5GA 2EA2A 2O3FA 3LA3A 5E20A 2HTJA 4I02A 4M74A 3TDUC 4ZZLA 1ZYRF 3I53A 2PQ8A 3WTZA 2R7DA 2ESNA 2L02A 3MCZA 2M45A 2V79A 2DI3A 2ELHA 3IL2A 3H3UA 3PFIA 5LRRA 3DPTA 4L0ZB 1MD0A 1OPCA 1FYKA 3ZMSA 2P6TA 2AXLA 3J80K 1ZHFA 5ICCA 4LG0A 1E17A 1QZYA 3MFKA 1QZZA 3FMQA 2MH9A 4IF4A 1J7KA 2VBWA 3JAMK 3GX4X 3F21A 4GYIA 2D45A 4OMYA 1R1TA 1XCVA 1YW8A 5A2QK 4BYYA 3FX3A 3V4GA 3J81Z 5F1RA 3NQOA 1Q1HA 5BQTA 1I27A 5JHUA 1BOAA 5FFXA 1R36A 3FF5A 3ZQ7A 2EFQA 3E97A 1HBXG 1B9MA 2VT3A 2MLKA 2VN2A 2ISZA 5CVVA 1JHHA 1UB9A 2A69F 3F6OA 3T0YA 4FX0A 4B09A 2FBHA 3ZN1A 4UVAA 3L09A 1ZAOA 1WWXA 2AS5F 1DP7P 1V4RA 3P9IA 3VODA 1H9TA 1W7PB 3R61A 5LHHA 3LQRA 2LF7A 1W4MA 1YW7A 6PAXA 4OOIA 2XKPA 3HRMA 2VC0A 3VB2A 4HOBA 1YTYA 3BROA 4FX4A 1ZN2A 3TO9A 5FD5A 2L4AA 4ETSA 2EWNA 4G7ZF 3AAFA 4WK8F 4P5OA 4L18B 1FBSA 1HW5A 4LGWA 4UVBA 2FXAA 4PGGA 4KFCA 1FX7A 2ZMEA 3E6MA 4RB0A 3J7AO 2W25A 1IN4A 3O3KA 4CYDA 1XMAA 1CF7B 2VBXA 3IC7A 5L3GA 1B6AA 4S04A 2RGVA 1FZPB 4HAMA 3WTTC 5HLIA 5LBQA 3OOPA 1TW3A 2RNJA 1J0RA 1RI7A 1XSXA 1T0FA 1H0MA 4CDGA 2P5LC 3F3XA 2JSCA 4KUMA 1CGPA 4N9IA 3EUHA 5TRDA 2IPQX 1W5SA 2QQAA 5DD8A 2OZUA 5L3BA 2CGPA 3GFLA 2KRFA 2DT5A 4QWQA 4U0WA 2STTA 1ZRFA 2JRTA 2CG4A 1R22A 2IVMA 3WTSC 1L0OC 2PLYA 3TO7A 1P4AA 3HRUA 3ZPLA 2RN7A 4MGRA 3TOBA 1FP2A 2Y48A 1UCRA 1XMKA 3RDIA 4P55A 2X4HA 1HW1A 2XUBA 4ZYHA 5F64A 1SD7A 1LDDA 1SMTA 1ON2A 2FNPA 3WU0A 1Z6TA 5CJ9A 4A2UA 3F6VA 4O5VA 3E3VA 1KGSA 2XAFA 2G7HA 1XCBA 3ZP5A 5JR3A 4UNOA 4HQMA 2FMLA 2RV8A 3V7SA 3HYIA 2VBYA 4U0YA 1RUNA 1XGMA 1KYZA 5ILSA 3FMRA 2ZNYA 4Y17A 1HSTA 1TQPA 3D5LA 3SXYA 3RKYA 4HBLA 1MGTA 5E1XA 2BE5F 1K78B 1C0WA 3ISPA 3MWMA 3CJNA 3J80Z 5FLXK 1FT9A 2VONA 2O6GE 4IHSA 2JZYA 3GW2A 3SQNA 3JAMZ 1DPRA 1JXSA 4RB1A 2CQKA 4L9JA 1O57A 5ED4A 5A2QZ 3KFWX 3WGHA 3I59B 5D4SA 3LWFA 2QBYA 1TTYA 3M1EA 4UXNA 2XVCA 4I98B 5ILUA 1R23A 1MKMA 2VBZA 3JSPA 1KYWA 3CO7C 4ESJA 4KYWA 3KETA 4LD5A 5DUKA 5E1ZB 2QZ8A 1TBXA 5HOOA 4HDUA 2E1CA 1QQIA 1UHWA 4OIQF 1KQ0A 4E70A 4OMZA 4F7ZA 2L3DA 4P9UA 4L9TA 4R1HA 1FP1D 4RS8A 4G94A 1REPC 1YLFA 3QPHA 3U2RA 3P7NA 3I58A 1WRJA 1KQ9A 2HEOA 2RDPA 4U88A 5L3EA 4AWXB 1G3TA 4XSXF 4UVCA 5CLSA 1K6OA 1D5VA 1QO0D 1H9GA 5ICEA 4BHPA 1FLIA 3R0JA 2YX4A 5E8GA 3LAJA 4P96A 2VE8A 1YW9A 2P7CB 2ADUA 2Z33A 1S8NA 3BJAA 3BY6A 2H27A 1W5TA 3FXQA 2QYOA 3DQVC 1Z1DA 2JPBA 1XSDA 1SD6A 2D1HA 2Z9OA 1ZRCA 2RVCA 2KJBA 4ZZDA 2E7XA 4RGUA 2EB7A 4WXDA 1XGOA 3L2CA 5DEQA 3IKVA 5HVQC 5LEKA 4MTEA 3CUQA 2FOKA 3WTWC 3F23A 4KIFA 3RYPA 4M9SA 2MBFA 4EM0B 1BIAA 3PQJA 4EGZA 4WXCA 1PUEE 3EYIA 2YPRA 5J8CA 3FWEA 1HKTA 2GZWA 2FSWA 4EJOA 2IA1A 3HSEA 1U5TA 1Z6RA 3IRRA 3RIRA 4U0VA 3E6DA 4UUVA 2ZXJA 3L00A 3K1NA 4IJAA 2ZCWA 2J5PA 1ULYA 2LF8A 4A5NA 3GLXA 1FYMA 3I0TA 2W84A 4OIPF 2A5YB 4G7HF 2XKOA 2V6CA 4ENJA 3WU1B 3KP4A 2GA2A 4G9YA 2DTRA 5LGNA 3GYHX 3IWFA 2QM3A 2W24A 3TOAA 5KK1A 5D8LB 3HHGA 3IHUA 2Z3YA 5FB2A 2XROA 1F9NA 3RPUA 2L01A 4CO8A 4M71A 1Z05A 5K5RA 3F8FA 3F8MA 3FHZA 2MC3A 2X0LA 4LG0B 1IF1A 2UXXA 1WSUA 2K86A 4UHTA 1FPQA 4HV5A 4L9VA 3CTAA 5K5QA 4HV6A 2OBPA 4ASNA 1B9NA 2ACJA 4PDKA 1G4DA 1XGSA 1ZG3A 3SZPA 4EJWA 1IN6A 5HDGA 2Y0MA 1D8KA 3MZHA 1BI2A 3Q5FA 2KJCA 5FLXZ 2OD5A 4UV8A 1HSJA 4GXOA 3DV8A 1Y0UA 3VFZA 1AWCA 2GIVA 4ZYGA 1XDUA 4HF2A 1YQAA 3W6KB 1IZ1A 1DPUA 2CYYA 5DCMB 1LEAA 4LFUA 3P9KA 5J8FA 3HUGA 3K1MA 2XAJA 3ERED 1RUOA 4GYGA 1I1GA 2E1NA 1T39A 2A07F 1I5ZA 3GXOA 4MEYF 1GXQA 3DEUA 1ZARA 1MZBA 1BI3A 3NEUA 2YX7A 1ZRDA 1IRGA 2K4BA 1BI1A 3BDDA 4KIBA 2IW5A 4XBFA 2H09A 2OQGA 2EFPA 3JW4A 2ZMEB 3SFZA 4M6YA 5TJJA 4A0XA 4HYEA 1OKRA 3GUDA 3MQ0A 1F1ZA 1O7FA 2GXGA 3QAHA 2ZJ2A 1LDJA 5ICFA 2NNYA 4YFNF 2CFXA 2IT0A 3HHHA 3FM3A 2EV5A 3DF8A 2DPUA 2OZ6A 1HQCA 2RKHA 5E8IA 2UZKA 4RAZA 5HS8A 4YG2F 2G7UA 3TO6A 2STWA 4B8XA 1UFMA 1JE8A 2PMHA 1SAXA 4K2EA 4AIKA 2RQPA 3LAPA 1ONVA 1BBYA 3Q9VA 4KMUX 3COAC 2O03A 2ETHA 2JT1A 2DPDA 3W6JB 3F22A 1P6RA 2J5OA 3KE2A 3GVAA 1FSEA 4KN4X 4DQ2A 1E2XA 4MHGA 4Z2YA 1KU9A 5HLHA 2EA4A 3G3ZA 3F8NA 1PP7U 1O3QA 3KP3A 1B1BA 2YSRA 1FNNA 4NB5A 3ZMUA 1GHCA 2VT2A 3EETA 2H6BA 3QOPA 4RB2C 4YIFA 2QWWA 5E1WA 2VOPA 2IP2A 1K7AA 3M7GA 1SFEA 1U78A 3M8EA 2BGCA 4S05A 2JTVA 4HW0A 3I5UA 3O2PE 2F2EA 1DDNA 1XD7A 4LJZF 4ENKA 1BC8C 2L54A 3JTGA 4AIJA 2XHKA 3FXUA 1ZLJA 1O3TA 1TW2A 4A0ZA 2GWRA 4NHJA 4HF0A 4ZYDA 1D3YA 3WODF 3I64A 3ELKA 5CVUA 3FMSA 4Q48A 2UXNA 1HXDA 4G6DA 4XRFA 2ZBKA 4IXAA 2CSOA 2VOOA 4AVPA 2A6EF 3HSFA 2HQNA 1FSHA 1TQMA 4L5JA 1F4KA 5CVJA 3KEQA 2PI0A 3WGGA 2WTEA 1QPMA 3HOSA 1OYIA 1R00A 4EJTA 1LB2A 3GWZA 1I6XA 4BQAA 4IRHA 2M1BA 3BP8A 2QBYB 5EEHA 1U6GA 4WCGA 2HWVA 4CGZA 4LLNA 4U7DA 5CYVA 3F8CA 3TGNA 4JQFA 3ZMTA 2EK5A 2BEOA 3WTYC 2DO7A 2O61A 1LQ1A 4JBAA 4Q4ZF 2DQLA 2R3SA 3T8TA 4CXFA 4A12A 3E5UA 3K2ZA 3KLOA 4YFXF 3FM5A 4GO1A 1SFUA 3O6BB 1F5TA 3ZMDA 2WWYA 1G6NA 1W7PD 1USSA 1T38A 4M9XA 2BYVE 4KDPA 4A5MA 4PCQA 2F5FA 3GZ5A 1SMYF 4DNCA 4BNCA 2P5KA 3GFJA 5JFRA 3ML6A 2IRFG 3KP7A 2FE3A 2M87A 3WTUC 3M9AA 3I54A 2FF4A 3R0AA 4I7HA 4FHTA 2V1DA 3DKWA 3C7JA 5L3CA 3C18A 4G8XA 3MEXA 3SHFA 4EQQA 3VEPA 2M30A 1ZG1A 1FC3A 3C3WA 1S7AA 2DW4A 2NYXA 5D5WB 3HOTA 1S7OA 1JGSA 2FQ3A 1STZA 1T98A 1ZGAA 4CZZA 3E6CC 3WTXC 1ZG5A 3B73A 3QU6A 5AIPA 2HTSA 1T6SA 2M8EA 2YU3A 2QUFA 1BN5A 3R60A 2P4WA 1V3FA 2TDXA 3KCCA 4O6JA 5IT9K 4CICA 3LA2A 3CUQB 2FMYA 3KP6A 1J75A 3GFIA 3TKYA 3CUOA 2D1VA 2HOEA 2Y75A 1USTA 1IXSB 1JHFA 2EFOA 5EEGA 1L3LA 3KZZA 2M5WA 2PBIA 1OYYA 2Q0OA 5BPIA 4HQEA 2W85A 1SD5A 3E5XA 4LB6B 1U5TB 4UV9A 4KMFA 1G3WA 1P92A 3ABTA 2DFIA 1FY7A 3R6SA 4BHCA 2EFNA 2ISYA 2MLGA 2P7VB 1YFHA 1EH6A 3DFGA 2VE9A 2V1XA 2LSOA 1ZGJA 2FEZA 1RNLA 4I2OA 4MTDA 3V8LA 4LLLA 3FZVA 3B02A 1LJ9A 2CO5A 5DUIA 4G6QA 5J6XA 4OU0A 4XLNF 3EYYA 3V8KA 4ESBA 2FU4A 3ULQB 4HZFA 1ZREA 5JI6A 3T8RA 3LSTA 4PGHA 4N0BA 1YG2A 2XRNA 4M6XA 5KVRA 2O8XA 4KN7X 2WV0A 2G9WA 3BPVA 1P4WA 5DYMA 1BM9A 4CHUA 1WQ2A 4M73A 1S3JA 4HDVA 1ODDA 5CVIA 1D8JA 2NAZA 5LGUA 5L3FA 3REOA 1LVAA 1WI9A 2RC4A 4QLCU 3TDZC 1XDSA 2GQQA 3E6BA 1IXRC 2MD5A 2NNNA 4EV0A 1NHAA 4PZJA 4Q5SF 4ENNA 5HS7A 3RKWA 4OIRF 2P6SA 1MDMA 3KLNA 2P5VA 1XSVA 5ICGA 5LGTA 2XGXA 2DAOA 2CW0F 1FBUA 5ERIA 4RGRA 3K1PA 2EV0A 3K0LA 5D5UB 4D0PA 3HRTA 4MEXF 5HS9A 4HX8A 3WE2A 5K1YA 2HR3A 1O3RA 3E5QA 3D0SA 2HFHA 4RB3C 4G7OF 1FYLA 1YS6A 4MQVA 3RJPA 1EH8A 3ZN0A 3WGIA 3KP2A 2BV6A 3R4KA 1AOYA 3P9CA 3HSRA 4TV7A 3GO5A 5AONA 1S29A 3DP7A 2A61A 2F5DA 3EQLF 4LK1F 2XAGA 3BWGA 3ZMZA 2K27A 3CDHA 4L9NA 1SD4A 1MJ9A 4JK1X 3Q9SA 4ESFA 4R8HA 3WTVC 2C6YA 5K5OA 1TNSA 1LEBA 5BMZA 2QVOA 2Z5UA 4O3MA 3KZYA 1KU7A 2PFBA 4EM1A 1Z9CA 1I1SA 4XLPF 2HS5A 4MQ9F 3WE3A 3V7RA 4FT8A 3VOEA 5DCMA 5D4RA 2PJPA 4IPAA 3N4MA 3L7WA 3V8JA 1OYWA 4LLGF 1IAWA 4A6DA 1TQIA 3GZ6A 3F72A 3IRQA 3JSOA 2PG4A 2VC1A 1ZLKA 2COMA 4LB5A 2UWMA 2FRHA 2ZO4A 2LNBA 1W7PA 2QLZA 2IA0A 5LRSA 4A0YA 2FNAA 3F8BA 5H6QA 2Q2EA 2R7FA 1FWZA 1HKSA 1IN7A 3TQNA 5IT3A 2V1UA 1BIBA 4GCVA 2QQBA 4EGYA 2BBYA 1P4XA 4Y13A 1R58A 5IT9Z 3U9GA 1QBJA 2MA3A 3ECHA 3N97A 5DDGA 3BJOA 5HDNA 5HDKA 3RTRA 3QRFF 2JPCA 3V7CA 2NRAC 1VTNC 1J9IA 1SFXA 1O3SA
chains in the Genus database with same CATH superfamily
1WH7A 3H5RA 3HOYJ 3M8JA 2ZC2A 4BXUA 1B72B 2KKOA 2KIMA 1BC7C 1YYVA 3N05A 2R7SA 1P2FA 1VQ9I 1IRZA 5DV5A 2HDCA 1QA6A 1KZHA 3DBHB 3LSIA 2ZXHA 4G12A 1B4AA 1J5YA 4EATA 2PEXA 3S1NJ 5FKMA 2LVSA 1Z7UA 5HLGA 1KA8A 2H1KA 1U3EM 5GTHC 4GGGA 2A05A 3QU3A 1CF7A 3EPZA 2DA2A 3HL2A 4M72A 3CCEI 3HRSA 1FEXA 3RPUD 1GVDA 4N9HA 1J2XA 5D6EA 5K7ZA 3OV8A 3Q0UA 3GTGJ 3LQQA 4HG2A 1X1DA 2UV1A 2HKOA 1QRYA 2M34A 3CZ6A 5IYDJ 1YX5A 2YU9J 3ZQIA 2FBKA 2O5RA 4I76A 4L5IA 4WXHA 3AG4H 1YO5C 3K9TA 4IZZA 3DBLB 2KIUA 1SVLA 3HTUA 2FA5A 3QYFA 4PJLA 1ON1A 4LK0F 3RI4A 3SZTA 1EH7A 1OFCX 1JGGA 4IVNA 2OTLI 4Y15A 1R5ID 4GFBA 1LFBA 2AQEA 3DU5A 3CJTB 3HTSB 2WA0A 5J1RA 4XIDA 1DUXC 2L9SA 1WFXA 2CQNA 3I4NJ 5D5XB 5EGOB 1WVRA 3KP5A 5LFAA 2B0LA 3NRVA 2A68F 3VSLA 2IS1A 3KYDB 4KIGA 4M3DA 2Q8KA 3A03A 2IS6A 4I01A 2A3SA 3A01A 1R5HA 1G3SA 1YX3A 3BPXA 3ZQCA 1MSEC 2DQRA 1O7LA 2W57A 1JJ8C 2ZJRF 2IJLA 1R1UA 3ABUA 4S0HB 5JVTA 3CO6C 3T5XA 2KHMA 1BW5A 2H94A 2XAHA 4ZJZA 2CUEA 1Z3XA 4EVIA 3ROUA 2GM4A 4A3GJ 2CS3A 1KU2A 4LITA 1IXCA 3DU6A 4MNUA 1WKMA 4MFEA 1RIOH 3DEEA 2R7ZJ 4CCJA 3S3NA 3M3YJ 1IUYA 2JRMA 2PN6A 5DCFA 1YHQI 2M4GA 3MAJA 1OMIA 2ZNZA 2FBIA 4EJUA 1MJBA 5LHIA 2LKPA 3TP3A 3GTJJ 2IA2A 1POGA 1X3UA 3NWSA 2CFOA 3GFMA 2ZSHB 2XGEA 2VPLA 1S7EA 2AO9A 5H6RA 4BAYA 1P9QC 4LIVA 4JYKA 2KIFA 2X9DA 4P9FA 5BOXA 2VJJA 1K79A 5E79C 3LMMA 1VQMI 1V5EA 2F5CA 2V9VA 1W0UA 2GA1A 1HW2A 2ZB9A 3CUQC 3OYGA 1OCCH 1R7JA 2DK5A 3CMMA 3BG7A 3BG6A 2XASA 1GVJA 3AG1H 3C1DA 3RKXA 4ZYAA 1WPKA 1XGNA 2HXIA 4A6EA 4R79A 3MKLA 2W00A 2M4KA 2DK8A 2K7LA 2WAEA 2M7BA 3G73A 3ZQHA 3K2AA 4HF1A 5EF6A 1B8IB 3FHNA 3VYUB 1IRFA 3EDPA 3BR2A 1KQ8A 5L3DA 4ZYEA 4XSZF 2VXZA 4YEJA 1U5TC 1XB4A 3V42A 2VJIA 3CLOA 3J81K 2V9PA 1IJWC 4A3EJ 1W5CC 1N25A 2HGCA 2R7RA 1XG1A 3K70D 3KEOA 1RZ4A 5CPRB 2EV6A 3PQKA 1FTZA 1HDPA 3S8PA 3T1BA 3QPTA 1T2KA 4IHTA 3H3ZA 3RQ4A 3IKTA 5BS6A 3GTLJ 3GTPJ 3GEZA 1LDKB 5C3EJ 1K78A 2EFWA 4DW6A 4IRGA 4GDFA 3DXJF 1MBKA 1KU3A 2R7QA 4F52A 5D6FA 4KICA 1FOKA 4PSWA 2K9NA 4HLXA 2L2OA 4L5EA 4PFPA 1A04A 2HOTA 5D8KB 3QP6A 1OCTC 2O9LA 4RLQA 3ZMVA 2XV4S 5ILVA 3IP4B 1U2WA 3JRDA 3I4MJ 2Y30A 5FFZA 1QNTA 1WH5A 2LTPA 2MABA 3HEFA 4ITVA 5HODA 1YIOA 3PSFA 2E5ZA 5CVRA 4XRMA 1Y1VJ 4ENMA 3K4BA 1TNTA 2R7UA 4ABZA 2ZFWA 3RPQA 4YELA 4WF2A 3PUBA 1V55H 1GXPA 5LEJA 5IYCJ 1U0JA 2XIGA 3GF2A 1QZEA 5FO5A 3I59A 4U7BA 1H8AC 1G59A 4BHBA 1ITYA 1GLNA 4HX7A 2GAUA 5BPDA 1W36D 5KHDA 2K02A 1Q1VA 2HYGD 1LNWA 4EJVA 5D5VB 4WWCA 4M9ZA 3J7YJ 1Y1WJ 4KNYA 1IGNA 2QQ9A 1Z91A 2F5EA 4EMSA 4IHWA 4XLEA 4IOCF 3HIFA 4ON0A 3CCMI 3CC7I 1FOXA 2ID3A 2D2WA 5EZHA 2KZGA 2WAQN 1G3YA 3CJRB 1J59A 3CQZJ 2ECCA 2LREA 2EBIA 3MZYA 1YRNB 3I71A 4LMYA 3WHCA 3CCVI 4XLAA 3BOQA 4HX4A 1R1VA 4XLCA 5HNFA 1U8RA 3MKYB 5F6FA 4KA4A 2DMUA 3WG9A 2R7WA 3S2WA 3IWZA 5KAIC 3OOUA 3DEWA 4KT5C 4Q47A 2DMNA 3SDBA 4KISA 2A6HF 2HZTA 2ZKZA 4YFKF 2ZJQF 3OY9A 2OUMA 5FD6A 1WJ5A 2EJRA 1OR7A 4I0AA 4AIHA 1ETYA 2HQRA 3GCMA 4C3IJ 2E2HJ 2DBBA 4YIIA 2HOSA 2QSFX 2KL4A 3DPLC 4I09A 2M0CA 2WC2A 1PDNC 1IN5A 4BE1A 3ASNH 2LP0A 1TT5B 1OQYA 4IRIA 2DLLA 4L0YB 1BJZA 4BGDA 2VLAA 4I0BA 1TLHB 1B59A 1WJBA 4HA8A 2K9QA 4BH9A 3SFIA 2Z99A 4FE4A 4RAFA 2MH2A 2L4MA 2E7WA 2E2JJ 1HKQA 2XRLA 3CCJI 2NS0A 2HKXA 1UHMA 4ZDPA 4XORA 1EV7A 4EM2A 2HYFA 2OV7A 2FX0A 4RAGA 1E0EA 5H20A 1A5JA 4B48A 1BJAA 4QIWN 5J4VA 4NQWA 4CSWA 4M3GA 4AD9A 3K69A 2H6CA 2WBMA 4HLYA 5DD4A 2E1OA 1RRJA 1QGPA 2VODA 2KP6A 3I4PA 5E3LA 2P8TA 5EJCA 2OU2A 3H3VK 3BZ6A 2L9VA 4LOCA 4KT6A 4PJNA 1TL8A 5LLQA 3CJQB 3ZGKA 3ERMA 2NS7A 2MSYA 3L9FA 3ASOH 3MZ8A 5AIQA 2QENA 1ZH5A 2OQRA 2LG4A 4CCKA 3LFKA 3JRFA 1IW7F 2H8WA 3MN2A 1RETA 3BTCA 2BY0A 1MJAA 4E6KG 2JA5J 1Y56A 3TMOA 3QP5A 1OISA 4WX9A 4RGXA 1WJEA 3M8FA 2XPWA 5E18F 4RAYA 3BG3A 1WZ2A 2YR2A 3L2QA 1YS7A 3LA7A 3DLLF 1IN8A 2BXYA 1S6LA 2DA1A 2K85A 2OAZA 2LDUA 3BJ6A 1BI0A 2O0YA 3Q0WA 1AHDP 2PMUA 2H8RA 1Y6IA 4D9JA 1XN7A 4J01A 2CWEA 2ESHA 2HVQA 2ID6A 3FXRA 3H92A 4OINF 5JHFA 4H0EA 2LH9A 3W6VA 3LSMA 1YITI 4MFDA 1X19A 3JTHA 2I5UA 2K4JA 3FXLA 4OIOF 3OYJA 5LHGA 4NC8A 2DU9A 5E17F 2LK2A 1FBQA 1MDMB 3CF5F 2XAQA 3ABKH 4RGSA 5DM6F 3OYEA 3HM5A 1VQKI 3ZRGA 3TEDA 1VQ5I 1NTCA 3HOWJ 2OA4A 4ZH4F 3ECOA 3CDLA 4DGWB 3FK7A 3U1DA 1PP8F 2GXBA 5FGMA 3DKXA 4A3CJ 2IEKA 1R5GA 3RYRA 2EA2A 4AIDA 2O3FA 3LA3A 3G2BA 5E20A 2XDVA 1TT0A 2HTJA 2Q1ZB 4I02A 4M74A 3TDUC 4ZZLA 1ZYRF 3I53A 2VQHA 5GPCA 2PQ8A 3WTZA 2R7DA 2ESNA 2L02A 2XPUA 1TWFJ 3MCZA 4AC0A 4A3DJ 2M45A 3LOCA 2V79A 2DI3A 2ELHA 1H88C 3IL2A 3DTKA 3H3UA 3PFIA 5LRRA 3DPTA 4Y33A 2QSGX 4BUPA 3S3OA 4L0ZB 1MD0A 3VDXA 3EUHC 4X6AJ 1OPCA 1FYKA 3ZMSA 2V26A 3LFUA 1R71A 2P6TA 2AXLA 3J80K 1BW6A 1ZHFA 5ICCA 4LG0A 1E17A 1QZYA 3MFKA 3HPHA 1QZZA 3FMQA 2KLOA 2MH9A 4IF4A 1J7KA 1X4OA 2JSPA 1I3AA 2VBWA 3HDDA 3JAMK 3GX4X 3F21A 4GYIA 1JTXA 1S5LC 2LRDA 2D45A 3M1CA 3OIQA 4OMYA 1R1TA 4KITB 1LE8A 1XCVA 2NVTJ 1YW8A 2X51A 5A2QK 4BYYA 2XSJC 3FX3A 3V4GA 3J81Z 5F1RA 2LBFB 3NQOA 1Q1HA 1Y8RB 4BBRJ 5BQTA 1IO2A 1I27A 5JHUA 1S9HA 2CW7A 2DDAA 3OYMA 1BR4A 1XPXA 1Z67A 2L7ZA 5FRMA 2ELKA 1BOAA 1X2MA 5FFXA 1R36A 3FF5A 3LSRA 3ZQ7A 2EFQA 3E97A 1HBXG 1B9MA 2VT3A 4CCMA 3OMYA 5K7FA 2MLKA 4CH7A 2VN2A 3PFYA 2ISZA 4NNJA 3S1RJ 3M4OJ 2KT0A 2DXIA 5FKKA 1E3PA 1UHSA 5CVVA 2NVQJ 3PO3J 1JHHA 1UB9A 2A69F 3F6OA 3AL0B 3S2HJ 2JK3A 3BR6A 4RA2A 2TRTA 2E2IJ 1EA3A 3RSNA 3T0YA 3CCQI 1LFUP 1FOYA 5EDNA 4FX0A 4B09A 4IHYA 1ETWA 2FBHA 3ZN1A 4UVAA 3RZOJ 4C9YA 3L09A 3H35A 1ZAOA 1WWXA 2AS5F 2ME6A 4BEHB 3P5JA 1DP7P 1V4RA 2UUZA 1K6YA 2KRCA 3P9IA 3VODA 2VJ4A 2ME0A 4B3AA 1DQUA 3JRCA 1H9TA 1W7PB 3R61A 5LHHA 4IOAF 3BQZA 3LQRA 5EG0A 2LF7A 2B7EA 1OLTA 4LIUA 1W4MA 1YW7A 2JMWA 1VQPI 2ZJPF 1GUUA 4BXXJ 2MFZA 5J3LA 1Y39A 1EJ9A 2F4OB 6PAXA 1WI3A 4OOIA 4PSXA 3MKZA 4BACA 2OCEA 1Y0NA 2XKPA 2EZHA 3MKWB 3HRMA 2X6OA 2VC0A 2DCEA 2LMDA 4HOBA 2EIMH 1OJLA 3A0BC 3BROA 3VB2A 2E1MB 1YTYA 1DGWY 2H1LA 2DT7B 4A3JJ 4FX4A 1ZN2A 3TO9A 4C2MJ 5FD5A 4DBQA 3HXLA 2L4AA 4ETSA 4UUSA 1MMGA 2EWNA 2FJ1A 1YE9A 4H4KC 3AAFA 4G7ZF 4WK8F 4P5OA 4L18B 3K4CA 1FBSA 4AVZA 1JKPC 1HW5A 4LGWA 3BR0A 4UVBA 4JX6A 2FXAA 3ABMH 4PGGA 4KFCA 1FX7A 2V7FA 2ZMEA 3E6MA 4RB0A 4CCLA 3J7AO 2W25A 4Y3OA 1IN4A 2F5VA 3O3KA 4CYDA 3PUFA 3L2RA 2HQAA 1PVEA 2RAEA 2LKSA 1XMAA 1CF7B 2VBXA 1D0ZA 3IC7A 5L3GA 1B6AA 1T08B 3K4LA 1UG0A 3F0CA 4S04A 2GIZA 2RGVA 2EH3A 4CCOA 1FZPB 4HAMA 1WCMJ 3WTTC 2ECBA 4ZTFA 5HLIA 5LBQA 3OOPA 1TW3A 2R7TA 2RNJA 1J0RA 1RI7A 1TWAJ 1T0FA 1XSXA 1H0MA 3FXJA 4CDGA 1WJFA 4DJAA 2P5LC 2MW8A 3CC2I 2RQQA 3F3XA 1HC8A 2JSCA 3S15J 3TBIA 4KUMA 3JRBA 1CGPA 4N9IA 1QHGA 3EUHA 3IV5A 5TRDA 3D1NI 3QOEA 2IPQX 1W5SA 5EZGA 2HXOA 2R93J 2QQAA 5DD8A 3A2KA 2VKVA 4EEFG 1M1EB 4D7MA 5M3MJ 2WV1A 4E7SA 2OZUA 5L3BA 2CGPA 1V5FA 3GFLA 2XF5A 1K61A 2KRFA 1X2NA 1VFCA 2DT5A 4QWQA 4U0WA 2STTA 1ZRFA 5EYRA 4I6ZA 1IDZA 2X6YA 5IP9J 2JRTA 2XGCA 4JX4A 2EPFA 2CG4A 1OCZH 3VWBA 3K4KA 3I9V2 1R22A 1X3WB 3WHBA 1X1PA 1P7JA 2IVMA 3OR1C 2AHQA 2JN6A 2E34A 5B3SH 3WTSC 1L0OC 3QYEA 3TO7A 3GLLA 1P4AA 3HRUA 5FKOA 2DA4A 3ZQQA 2PLYA 3ZPLA 2RN7A 4MGRA 3TOBA 1FP2A 2Y48A 1UCRA 1XMKA 4E7IA 3RDIA 4P55A 2X4HA 1HW1A 1WJDA 2XUBA 4ZYHA 5F64A 2QQ8A 1SD7A 1LDDA 3FBIB 1SMTA 1ON2A 2FNPA 5FJ8J 3WU0A 1Z6TA 5J4YA 2MG4A 5CJ9A 3GTOJ 4A2UA 3F6VA 4O5VA 5JLXA 1T95A 3E3VA 4CA0A 1D1AA 1I3QJ 5H2FC 2CV0A 1KGSA 2XAFA 2G7HA 4B43A 1XCBA 3W2AA 3ZP5A 4RBOA 2AXTC 2LLKA 2O7OA 4CCNA 5JR3A 4UNOA 2XAUA 2DA6A 4HQMA 2FMLA 5F1JA 2RV8A 3V7SA 2XB0X 3HYIA 3LSKA 4NDLA 2CQXA 4HNTA 1UELB 4HSRA 2VBYA 2L9RA 4U0YA 1RUNA 2YS9A 3SYTA 5E3NA 1XGMA 2GBYA 1KYZA 3D5RC 3F9KA 3AFHA 4XKBA 2VQGA 1W1WE 5ILSA 3A0HC 1ZTRA 2KDZA 1XS9A 3FMRA 1ZGWA 4M3BA 2ZNYA 4P1WA 4Y17A 1HSTA 5GTIC 1TQPA 3QQAA 2Y9ZA 1RKWA 1IUFA 1VF9A 3D5LA 3SXYA 3RKYA 4HBLA 1MGTA 5E1XA 2BE5F 1K78B 1C0WA 3HBLA 3ISPA 3HC7A 3MWMA 3CJNA 2IGOA 3J80Z 5FLXK 3PJRA 2QKMB 1FT9A 2OCCH 2VONA 2VUMJ 2O6GE 2XSDC 2JUGA 4IHSA 3G4SI 2JZYA 3GW2A 2NOGA 2DA3A 3SQNA 4FTHA 4XKVA 3JAMZ 4RMNA 1A6QA 1DPRA 2EZIA 1JXSA 4RB1A 2P0WA 4AYBA 4JOMA 5KNLA 1DU0A 2K9MA 2RNGA 2CQKA 3OYKA 4L9JA 1O57A 5ED4A 2XB5A 5A2QZ 3RCOA 1FMWA 2R4GA 2XF6A 4YIRX 3KFWX 3ONQA 3LL7A 3WGHA 1HLVA 3I59B 5D4SA 4NUBA 3LWFA 2DDBA 3CDIA 2W7NA 1MNMC 4A93J 2QBYA 1X1CA 3L2VA 1TTYA 2IS2A 3M1EA 5FKNA 1NG7A 4UXNA 4V19K 3ESWB 1FIPA 3BG5A 2XVCA 1B8IA 4I98B 2F4IA 1MNDA 3CC4I 5ILUA 1R23A 1MKMA 4NBQA 1Z0XA 4PJJA 2VBZA 1GV2A 4JX5A 3JSPA 1KYWA 2LY1A 2NOJB 3CO7C 4ESJA 4KYWA 3PL8A 3KETA 2K40A 4LD5A 3C2BA 2K5CA 5DUKA 2QZ8A 3DWLE 5E1ZB 4DZPA 1TBXA 2V1NA 1JJ6C 5HOOA 1XMXA 4HDUA 2B63J 1VQ6I 2E1CA 1V54H 1QQIA 1UHWA 1K83J 4OIQF 1KQ0A 4E70A 2MC4A 4OMZA 4F7ZA 2BY2A 2L3DA 4P9UA 1R4MB 3H5NA 4BY7J 4L9TA 2FQ4A 4R1HA 4BE2A 1FP1D 4RS8A 5HLTA 4G94A 1ETKA 4MLOA 1REPC 2NVYJ 1YLFA 1E3OC 1V5GA 3QPHA 3U2RA 1BL0A 2DJNA 2X1CA 5TISC 1F43A 3KX2A 3P7NA 3I58A 3PNYA 1WRJA 1KQ9A 2HQ5A 3DTEA 4D5CA 2HEOA 2RDPA 4U88A 5L3EA 3J7ZI 4AWXB 1G3TA 3OSFA 4XSXF 1FOWA 4UVCA 1VQNI 2HDWA 5CLSA 5DM7F 3FISA 1K6OA 1D5VA 4Z6YA 1HA8A 1QO0D 3I55I 5JLWA 4HNVA 4M6VA 1S72I 5IP6A 1H9GA 5ICEA 4BHPA 1FLIA 1ZKGA 2DODA 3R0JA 2YX4A 5E8GA 2M7AA 3LAJA 4P96A 2W82A 2VE8A 4U87A 4FASD 1K4TA 4DZJA 1JKQC 1T33A 1YW9A 5IOZA 2DOEA 2ADUA 2P7CB 2Z33A 1S8NA 5F0FA 3BJAA 2NVUB 4NQWB 2LR8A 1X4PA 1PUFA 4UY8I 3LSPA 3BY6A 2H27A 1W5TA 3FXQA 3OYLA 2CMPA 2QYOA 3DQVC 2WY7Q 2R5YA 3RZDJ 2PMZA 3S32A 1Z1DA 2JPBA 1XSDA 3CCUI 2HU9A 3K4JA 1SD6A 1HF0A 2D1HA 5LD2C 1MMSA 2Z9OA 4A3FJ 1ZRCA 2L5QA 4ZTJA 2RVCA 2IGKA 1GT0C 2XC7A 2KJBA 4ZZDA 2E7XA 3EUKL 4MO7A 4M3EA 4RGUA 2DN0A 2EB7A 4WXDA 1XGOA 4XKWA 3L2CA 5DEQA 2DFHA 2IXSA 3IKVA 2FUG2 5HVQC 5LEKA 3BCAA 4MTEA 3CUQA 1ZELA 4CYCB 2FOKA 3LSGA 1SVMA 3OYNA 4BDZA 2BXZA 3QPSA 2HZDA 5J40A 3WTWC 3F23A 4KIFA 3K4MA 1ENHA 3RYPA 3HJEA 4M9SA 2LYCA 5M5YJ 2MBFA 4EM0B 1BIAA 3DPUA 2WB1A 3PQJA 4XKCA 4EGZA 4Y7NJ 3NWTA 4WXCA 1PUEE 3EYIA 2YPRA 3G71I 5J8CA 3FWEA 2E19A 1HKTA 4FETA 1ETXA 1T8IA 3ZOBA 2GZWA 4MIMA 5J1UA 2FSWA 4M3FA 4BU2A 3OS0A 1YJNI 4OAZA 4EJOA 3GTQJ 2IA1A 3HSEA 1U5TA 1Z6RA 3IRRA 3RIRA 4U0VA 3E6DA 4UUVA 2ZXJA 2L7MP 1AKHA 3L00A 3CF2A 1Y8QB 3K1NA 3M07A 4IJAA 2ZCWA 2J5PA 2XPVA 3WU2C 1ULYA 2LF8A 4XLFA 4A5NA 3CP8A 2E71A 3BG9A 2DMQA 4FCYA 3GLXA 4W97A 1FYMA 3AL0C 3I0TA 1RESA 2W48A 3SZGA 2W84A 4OIPF 3OYHA 3CESA 2A5YB 2K3PA 3U1KA 1J09A 3ZXSA 4G7HF 2XKOA 3ABLH 3BTLA 4XRSG 2V6CA 4FISA 2WAFA 4ENJA 2Y0SA 4IHVA 1MMNA 4DOZA 3WU1B 3KP4A 2M2EA 5J1YA 1N78A 3OS1A 2GA2A 4G9YA 2DTRA 1R6RA 4DYQA 1JT6A 5LGNA 3JREA 3J7AY 4XQFA 5DS9A 3GYHX 1VQ8I 3IWFA 3JCUC 5FLVA 2OTJI 2QM3A 2W24A 3TOAA 5KK1A 5D8LB 3HHGA 3DTIA 1X1AA 3IHUA 2Z3YA 5FB2A 2XROA 1F9NA 1KONA 2PX9A 3RPUA 2L01A 4CO8A 1JT0A 1HDDC 4G6TB 4M71A 2ZXWH 2KRHA 2EINH 1Z05A 1UZCA 5K5RA 3F8FA 3F8MA 3FHZA 2EZKA 2MC3A 4UUTA 5B1AH 1T56A 2X0LA 3A4CA 2E1MC 5IP7J 2GOMA 4LG0B 3FIWA 1IF1A 3BR5A 2EZLA 2UXXA 3IUOA 4QSHA 5F0CA 1WSUA 2K86A 3TW7A 4UHTA 2BW3B 5E3OA 1FPQA 2DYSH 4AU7A 1FJLA 4HV5A 4L9VA 3FKJA 2CJJA 4AUXA 2DMTA 1TWCJ 2Y31A 3CTAA 2EQRA 3TP0A 1LE8B 4X1EA 5K5QA 4PK4A 2DOAA 1YJ9I 3CLQA 4C30A 4HV6A 2OBPA 4ASNA 3D5SC 2KQRA 3SEZA 1B9NA 3JRAA 5C44J 2ACJA 4PDKA 1G4DA 3HGGA 1XGSA 4DYRA 1ZG3A 3JRGA 3SZPA 4OAYA 4E7KA 2HI3A 2GXAA 1DU6A 4EJWA 1D0YA 1IN6A 5HDGA 3G1LA 3HZJA 2Y0MA 4XOPA 2DYRH 2LD5A 1D8KA 3E7LA 3MZHA 1BI2A 3Q5FA 3Q0VA 2KJCA 2MYSA 3W2VA 5FLXZ 3MD2A 2W1OA 2OD5A 4UV8A 1HSJA 2R0QC 4GXOA 5IYBJ 3DV8A 2HDDA 4Y52J 1Y0UA 1XC5A 2WY8Q 3CCRI 3VFZA 1AWCA 3PO2J 3CCYA 2IGNA 4UB6C 3OYAA 2GIVA 4ZYGA 1XDUA 4HF2A 2COBA 2M3AA 1YQAA 2RREA 1MW7A 1SEUA 3UKGA 2V6EA 3W6KB 1VQ4I 3B6AA 1IZ1A 1DPUA 4XN3A 4HNUA 2CYYA 2O8KA 3LSJA 5DCMB 1LEAA 4LFUA 3FDYA 1A6IA 3P9KA 5J8FA 3HUGA 3K1MA 3MMYB 2XAJA 3ERED 5EG0B 3OYBA 1RUOA 4QPQA 1MH3A 5KCMA 4GYGA 1I1GA 1HCRA 2CUFA 2E1NA 5GADJ 1T39A 4GRIA 4PUSA 1QVTA 4UB8C 4HEA2 5F27A 1XX5A 4IX7A 3B6CA 5HNHA 3PSIA 2L7FP 2A07F 1I5ZA 3GXOA 2VASA 4B44A 2QA4I 4MEYF 5M3FJ 1GXQA 3DEUA 1ZARA 2B9SA 1MZBA 1BI3A 3CD6I 2Q2EB 4CUGA 3NEUA 2IBDA 2KIQA 5C4XJ 2YX7A 2Y9YA 1ZRDA 1IRGA 3K7AJ 3JRIA 3H36A 2EIKH 2OC6A 4XOTA 4AYBN 2K4BA 1CQTA 1BI1A 3FK6A 2X1DA 3BDDA 4KIBA 2CUJA 5KAFC 2IW5A 4XBFA 3A1YA 2H09A 2OQGA 2EFPA 3JW4A 3LSHA 4A3IJ 1WJCA 3GZNB 2ZMEB 3SFZA 1IC8A 4M6YA 5TJJA 1UAAA 3PNTA 5FKLA 1E3HA 3GMEA 4HYEA 1OKRA 4A0XA 4E4HA 1TWHJ 3GUDA 3OS2A 3BZKA 1NK3P 3MQ0A 2JA8J 1F1ZA 1O7FA 4D7NA 1D0XA 2GXGA 3QAHA 2ZJ2A 1LDJA 4XN0A 3VPRA 5ICFA 2NNYA 4YFNF 2CFXA 2IT0A 3HHHA 3FM3A 3BR3A 2EV5A 3OIOA 2JVHA 3IH3A 3DF8A 3DBRB 4D5FA 3BTIA 3OL3A 3JRHA 2DPUA 2OZ6A 4QPOA 1HQCA 2RKHA 2M9HA 2NXNB 5E8IA 2DT6A 2UZKA 4A3KJ 2M8GX 1QPIA 4RAZA 5HS8A 2E35A 4YG2F 2G7UA 3TO6A 5IY5H 3KPHA 2HPMA 3CP2A 1RR8C 2STWA 2PJRA 2L0KA 4B8XA 3O8GA 1UFMA 1JE8A 2X6WA 2PMHA 3S93A 1SAXA 4K2EA 4AIKA 2RQPA 4ZDLA 3LAPA 1ONVA 1BBYA 3K6GA 3Q9VA 4KMUX 3COAC 3S17J 1BR1A 2O03A 3FKIJ 2R7VA 1VQLI 2ETHA 2JT1A 4DBRA 3CMEI 2DFEA 2DPDA 3W6JB 3LNQA 3F22A 1P6RA 2J5OA 1A31A 3KE2A 3GVAA 3OYIA 2NS8A 1FSEA 4KN4X 4C2TA 4DQ2A 1E2XA 4MHGA 4W1UA 3H0GJ 4Z2YA 1KU9A 5HLHA 1ZR2A 2EA4A 2R7OA 5B5EC 4IKFA 3G3ZA 4JP0A 2R5ZA 3F8NA 1PP7U 3BLYA 4BQQA 3A01B 1WGXA 1O3QA 1GV5A 3KP3A 1B1BA 2YSRA 1JUMA 1FNNA 4XMYA 4NB5A 1JUPA 5CQGA 3VYSB 3OYDA 3KYLA 4E7LA 4IHXA 2BHZA 2QSHX 3L2UA 1MH4A 3ZMUA 3QPLA 1B72A 1GHCA 1RPWA 2VT2A 2DA5A 3EETA 2H6BA 1R9TJ 3QOPA 4RB2C 4YIFA 3PIOF 2DA7A 1EKEA 2QWWA 2XF7A 2D5VA 3JR9A 2PMZN 5E1WA 1DP3A 2VOPA 2IP2A 3PNVA 1K7AA 3M7GA 1SFEA 1U78A 1LPQA 3M8EA 2BGCA 3KEYA 4BQOA 4S05A 3OR2C 2JTVA 1SAUA 3IH2A 2BY1A 1Z21A 2BVMA 3I5UA 3O2PE 4HW0A 2F2EA 1AU7A 1DDNA 1ETOA 1XD7A 3KIOA 2Z1DA 2QKLB 4LJZF 2MD0A 4ENKA 2ELJA 1BC8C 2L54A 3JTGA 4AIJA 4IEJA 2XGDA 5GAEJ 2XHKA 2V9KA 2JA7J 2IAIA 3FXUA 1ZLJA 1UMQA 1O3TA 1OR7C 2JWTA 4II2A 2I10A 1ETQA 1TW2A 2QF7A 1JUSA 1MBJA 4A0ZA 2GWRA 1BOBA 3BZCA 3VSKA 4RM2A 4NHJA 4HF0A 2WB1N 4ZYDA 1VZ0A 1D3YA 3TW6A 4DYCA 5GAHJ 3UNGC 3WODF 3G6EI 3I64A 3AG2H 3ELKA 4BXFA 5CVUA 5EGOA 3X2QH 4XM3A 1AA7A 3S14J 3W2WA 3FMSA 4Q48A 2K9SA 1LUJB 2UXNA 2CU7A 2N8GA 1UG2A 4PJMA 1HXDA 4C3HJ 4G6DA 4XRFA 2ZBKA 4IXAA 2CSOA 2VOOA 4AVPA 2A6EF 4PFOA 3HSFA 2HQNA 2KDOA 3E0JB 1FSHA 1ETVA 2DOFA 3CMYA 3IAM2 2CH0A 1TQMA 4L5JA 1F4KA 5CVJA 2F4MB 3KEQA 1OCOH 1MBHA 5CKTA 4XICA 4A3MJ 1VQ7I 2PI0A 3WGGA 2WTEA 1QPMA 3HOSA 1OYIA 1R00A 2OJED 2Y0SN 3HKZA 5M5XJ 4EJTA 2E36A 1MMAA 2EILH 1MMDA 2VKHA 5B1BH 1LB2A 3GWZA 1I6XA 4BQAA 4IRHA 2HOAA 2M1BA 3BP8A 2VQCA 5CQEA 2QBYB 4BS9A 4PJ0C 5EEHA 1A35A 1U6GA 4A3BJ 4IQJA 4WCGA 2HWVA 4CGZA 1MNEA 4LLNA 1YJWI 4U7DA 1IG7A 5CYVA 3F8CA 3TGNA 3NARA 4JQFA 3ZMTA 2EK5A 2BEOA 3WTYC 1G2HA 4II3A 1ZK8A 2DO7A 3CCSI 1Z7LA 2O61A 1LQ1A 4JBAA 1VNDA 4Q4ZF 3CMAI 2DQLA 2VI6A 2R3SA 4RDUA 3T8TA 4CXFA 1LKXA 4A12A 4NC7A 3E5UA 3K2ZA 2VPRA 3KLOA 2CUZA 4YFXF 2OPTA 3FM5A 2CV1A 4GO1A 2BVLA 1SFUA 3O6BB 1F5TA 3IH4A 3ZMDA 2LOOA 3Q3SA 2WWYA 1G6NA 1W7PD 1USSA 2BHYA 2KMUA 1T38A 1FTTA 4M9XA 1D1BA 2ZSIB 2R7XA 2BYVE 2F48A 2P81A 5F04A 5C4JJ 4KDPA 1I6HJ 4A5MA 4PCQA 3HB9A 2DJIA 2F5FA 3GZ5A 1SMYF 2EIJH 4DNCA 4BNCA 2P5KA 3GFJA 2JQ7A 5JFRA 3ML6A 2IRFG 3KP7A 2FE3A 4XK4A 4BY1J 2M87A 3WTUC 3M9AA 2AQFA 5F0HA 3I54A 2FF4A 2LC2A 4BKXA 4IO9F 3R0AA 4I7HA 2FOWA 4FHTA 2V1DA 1Z3YA 4XONA 3DKWA 3C7JA 5L3CA 3C18A 1K4SA 4X0GA 3OIPA 4G8XA 3MEXA 3SHFA 3ZQFA 2R92J 4EQQA 3VEPA 4BQNA 3GBGA 4ZDOA 2M30A 1ZG1A 1IV8A 3IAS2 1FC3A 3H9GA 3C3WA 1S7AA 4BBSJ 2Y69H 5TGTA 1SFOJ 2A6TA 2DW4A 4IL6C 1QU3A 3HOUJ 2NYXA 5D5WB 3HOTA 3C2HA 1NH3A 1S7OA 1JGSA 2FQ3A 1STZA 1T98A 1ZGAA 3SEQA 4CZZA 1PUFB 3E6CC 2KPMA 4A69C 3WTXC 1ZG5A 2VIXA 3B73A 2R5YB 3QU6A 2JA2A 5AIPA 3H5AA 2HTSA 1G8XA 1T6SA 2M8EA 2YU3A 4FQGA 1LFPA 4QTRA 4DIQA 2KZVA 3HOVJ 2X85A 4XLHA 4J19A 1P7IA 2QUFA 1BN5A 5FRNA 2LY9A 3R60A 1OCRH 2P4WA 5GPAA 1V3FA 2TDXA 1HOMA 1W0TA 2IS4A 2JJ7A 3KCCA 4O6JA 2VKDA 4C3JJ 5IT9K 4CICA 3LA2A 3CUQB 2FMYA 2K9LA 1YRNA 3KP6A 2QGUA 5DTDA 4BJ6C 1Z77A 1J75A 1ORKA 3OSGA 3GFIA 4N4NB 3TKYA 2VL8A 3CUOA 2D1VA 2HOEA 2Y75A 3OWTA 1USTA 3KZIC 5IPAA 4N4OB 4J00A 1IXSB 1JHFA 2EFOA 3L1PA 2ZFUA 3EUAA 3FXKA 5EEGA 1L3LA 3KZZA 4F3QA 2M5WA 2PBIA 2LY2A 1OYYA 2Q0OA 2E5NA 5BPIA 5EEAA 3W3CA 4HQEA 2W85A 1SD5A 2DMPA 3E5XA 4I99C 4LB6B 1U5TB 4UV9A 4KMFA 1G3WA 2CRGA 1I50J 3H9JA 1P92A 2X6XA 3ABTA 2DFIA 1FY7A 4LG3A 1AKHB 1GDTA 3R6SA 4BHCA 2EFNA 4B3XA 2ISYA 2MLGA 4AM3A 2P7VB 2ZXIA 1YFHA 3S1QJ 1EH6A 3DFGA 4BDYA 2VE9A 2BOLA 2V1XA 3I3LA 4RM3A 3S2DJ 2LSOA 5E3MA 1ZGJA 2VQLA 1RKTA 2FEZA 1LVKA 1RNLA 4I2OA 4MTDA 3V8LA 4LLLA 2L9NA 3FZVA 3B02A 1LJ9A 2CO5A 5DUIA 2WADA 5F08A 4G6QA 5J6XA 4OU0A 4XLNF 3SJMA 5B66C 3EYYA 3V8KA 4ESBA 1MBFA 2GOXB 4CYCA 2FU4A 3ULQB 2X48A 1U9OA 2F6CA 1OCPA 1FIAA 2L7KA 4HZFA 3ZQGA 3K70C 4C2UA 1ZREA 5JI6A 5K7HA 3T8RA 1BA5A 2I8DA 2X1EA 3LSTA 4PGHA 3G1OA 4N0BA 2W4SA 1YG2A 2XRNA 4M6XA 5KVRA 1O4XA 1TZLA 2QEXI 2O8XA 4KN7X 2WV0A 2G9WA 3BT9A 4BL0B 4NC6A 1RC9A 1SANA 3UR3C 3BPVA 1TP4A 1P4WA 1MBEA 5DYMA 1ZR4A 4BJ5C 4A3LJ 1BM9A 1QVUA 4CHUA 1WQ2A 4M73A 4CZCA 4HSTA 1WHUA 1S3JA 4HDVA 1H89C 1U9NA 1ODDA 5CVIA 3BTJA 2JA6J 3K10A 2NAZA 1D8JA 3S1MJ 4V2GA 2TCTA 5LGUA 5L3FA 3RQIA 1VQOI 2ZMEC 1F36A 1LVAA 3REOA 3CCLI 3GTMJ 1WI9A 2MGQA 2RC4A 4QLCU 3TDZC 1XDSA 2JUCA 2GQQA 3E6BA 1IXRC 4XL9A 4F93B 1MSFC 3HOZJ 3U21A 2NVXJ 1R49A 2MD5A 2NNNA 1W36C 3BQYA 1JKOC 1IV6A 4EV0A 1NHAA 4PZJA 1JKRC 4Q5SF 4ENNA 4F55A 9ANTA 5HS7A 3RKWA 4OIRF 4OWRB 2Z16A 1YIJI 3HGYA 2HVRA 2P6SA 1MDMA 3KLNA 2P5VA 1XSVA 4F92B 5ICGA 2OF7A 5LGTA 1UJ8A 1I39A 2CQQA 2DAOA 2CW0F 2XGXA 1FBUA 5ERIA 1T0FC 1YOVB 1PYVA 4RGRA 3AKZA 3K1PA 2EV0A 3K0LA 3ZCOA 1U8BA 4ANJA 5D5UB 1FMVA 4BE0A 4D0PA 3BC8A 3HRTA 2IGMA 2Z2SB 2CW8A 4MEXF 5HS9A 3PIPF 4HX8A 2E60A 3WE2A 1N77A 5K1YA 2V4JC 2HR3A 1O3RA 3RKQA 3E5QA 2VXDA 2HFHA 3D0SA 3MVPA 4V2FA 4B47A 2HVSA 4RB3C 4G7OF 3HUGB 2QCOA 1YS6A 1FYLA 1A36A 4MQVA 3L2WA 3RJPA 1EH8A 3O8HA 2BW3A 3FXMA 2K3FA 3ZN0A 3WGIA 5GP9A 3KP2A 2BV6A 3R4KA 1AOYA 3P9CA 3HSRA 5JVGF 4TV7A 1DGRM 3GO5A 1MIJA 5AONA 2WAQA 3SDGA 1X58A 1S29A 3DP7A 1PJRA 3K4NA 4HPQA 2A61A 2F5DA 3A02A 3EQLF 4BJTA 4XNFA 4F91B 4LK1F 2XAGA 1X1BA 3H1CA 2YUSA 3BWGA 3HG9A 2VJ5A 3ZMZA 2K27A 1APLC 3CDHA 4L9NA 1SD4A 1IRXA 1MJ9A 4JK1X 3Q9SA 4ESFA 2A5WA 2LFBA 1X3ZB 3AG3H 3HOXJ 2KISA 4R8HA 1JTYA 2ICWG 3DKYA 1D5YA 1D1CA 3WTVC 2C6YA 1RR7A 5K5OA 1TNSA 1LEBA 2BY3A 5BMZA 3HKZN 3QODA 3I56I 1SFKA 4IQ4A 4ZC3A 2BZTA 2LKXA 2KFDA 3QYBA 2G0EA 3OL4A 4B1RA 1R4NB 2QVOA 2LBFA 2Z5UA 1ACIA 4O3MA 1NG6A 3KZYA 1KU7A 2HNHA 2PFBA 3DCFA 3OYFA 4EM1A 4E7ZA 4Y4RA 2FD5A 1Z9CA 1I1SA 3C2GA 4XLPF 4UUSB 3ZQLA 2HS5A 4MQ9F 2DTZA 3WE3A 3H9QA 3V7RA 4FT8A 3VOEA 5DCMA 3WG7H 5D4RA 2PJPA 1EF4A 5FLMJ 4IPAA 1WJAA 1NK2P 2Y2ZA 4YRVA 3BCBA 4RLFA 3N4MA 3L7WA 1SC7A 3V8JA 1OYWA 4D1QA 2VKEA 4LLGF 3FXOA 5FROA 2VB6A 5GAGJ 1IAWA 5J47A 3OYCA 4A6DA 4E7HA 1TQIA 2HYJA 1ZQ3P 2CV2A 3GZ6A 3BR1A 3QWLA 3F72A 4E7JA 3IRQA 3JSOA 2M0MA 2PG4A 2VC1A 3PM1A 4XR6A 4BEHA 1ZLKA 2GLOA 2PJRB 2COMA 3VYTB 4LB5A 2UWMA 2FRHA 4XRSA 2ZO4A 2LNBA 1W7PA 2QLZA 4FE7A 1ERDA 2IA0A 1QHHD 5LRSA 5BNGA 3HPGA 4A0YA 1TWGJ 2FNAA 3GTKJ 3S16J 3G1MA 3F8BA 5H6QA 2Q2EA 2R7FA 3FBNB 1FWZA 1HKSA 1IN7A 3TQNA 5IT3A 3H0DA 2JVGA 3DLAA 1BIBA 5M5WJ 4GCVA 1TC3C 2V1UA 1MBGA 1SVOA 2QQBA 4EGYA 2BBYA 1P4XA 3NAUA 4Y13A 3E1SA 1R58A 3KYCB 3VYRB 1YI2I 3U9GA 1VI0A 1QBJA 2MA3A 3TL4X 2DFFA 5IT9Z 1JI8A 1BR2A 3ECHA 3N97A 3S3MA 5DDGA 3BJOA 4B4CA 1IDYA 5HDNA 1XTAA 5IOYA 5HDKA 3RTRA 2R5ZB 1N75A 3QRFF 2JPCA 3V7CA 2NRAC 3ZR8X 1VTNC 4KJZA 2CQ7A 4HRIA 1J9IA 2HPIA 1SFXA 1O3SA
chains in the Genus database with same CATH topology
4BXUA 2KKOA 2KIMA 1BC7C 1YYVA 1P2FA 5DV5A 2HDCA 1B4AA 1J5YA 2PEXA 1Z7UA 5HLGA 1KA8A 1U3EM 4GGGA 3QU3A 1CF7A 4M72A 3HRSA 4N9HA 1J2XA 5D6EA 3OV8A 3LQQA 2HKOA 2FBKA 4L5IA 4WXHA 1YO5C 3K9TA 2KIUA 3HTUA 2FA5A 1ON1A 4LK0F 3RI4A 3SZTA 1EH7A 4IVNA 4Y15A 3HTSB 1DUXC 5D5XB 3KP5A 2B0LA 3NRVA 2A68F 4KIGA 2Q8KA 4I01A 2A3SA 1R5HA 1G3SA 3BPXA 2DQRA 1O7LA 2W57A 2IJLA 1R1UA 3ABUA 5JVTA 3CO6C 3T5XA 2H94A 2XAHA 4EVIA 3ROUA 1KU2A 1IXCA 4MNUA 1WKMA 1RIOH 1IUYA 2PN6A 5DCFA 3MAJA 1OMIA 2ZNZA 2FBIA 4EJUA 1MJBA 5LHIA 2LKPA 2IA2A 1X3UA 3GFMA 4BAYA 5H6RA 4P9FA 5BOXA 2KIFA 1K79A 2F5CA 2V9VA 2GA1A 1HW2A 3CUQC 1R7JA 2DK5A 2XASA 1GVJA 3C1DA 3RKXA 1XGNA 4A6EA 4R79A 2DK8A 2K7LA 3G73A 4HF1A 1IRFA 3EDPA 1KQ8A 5L3DA 4ZYEA 4XSZF 2VXZA 1U5TC 1XB4A 3CLOA 3J81K 2HGCA 3KEOA 1RZ4A 2EV6A 3PQKA 3T1BA 3QPTA 1T2KA 4IHTA 3H3ZA 3IKTA 5BS6A 3GEZA 1LDKB 1K78A 2EFWA 4IRGA 3DXJF 1KU3A 5D6FA 4KICA 1FOKA 4HLXA 1A04A 5D8KB 3QP6A 3ZMVA 2XV4S 5ILVA 1U2WA 5FFZA 1QNTA 1YIOA 5CVRA 4ENMA 1TNTA 2ZFWA 3RPQA 4WF2A 1GXPA 5LEJA 2XIGA 3GF2A 5FO5A 3I59A 4U7BA 4BHBA 4HX7A 2GAUA 5BPDA 2K02A 2HYGD 1LNWA 4EJVA 5D5VB 4WWCA 4M9ZA 4KNYA 2QQ9A 1Z91A 2F5EA 4EMSA 3HIFA 4ON0A 2D2WA 1G3YA 1J59A 3MZYA 3I71A 4LMYA 3BOQA 4HX4A 1R1VA 1U8RA 5F6FA 4KA4A 3WG9A 3S2WA 3IWZA 4KT5C 4Q47A 2A6HF 2HZTA 2ZKZA 4YFKF 5FD6A 2EJRA 1OR7A 4I0AA 4AIHA 2HQRA 2DBBA 4YIIA 3DPLC 4I09A 2WC2A 1PDNC 1IN5A 4IRIA 2DLLA 4L0YB 4I0BA 1TLHB 1B59A 4HA8A 4BH9A 2Z99A 2MH2A 2L4MA 2E7WA 1HKQA 2NS0A 2HKXA 1UHMA 1EV7A 4EM2A 2HYFA 5H20A 1BJAA 4NQWA 4AD9A 3K69A 2H6CA 4HLYA 5DD4A 1QGPA 2VODA 3I4PA 2P8TA 2OU2A 3BZ6A 5LLQA 5AIQA 1ZH5A 3L9FA 2QENA 2OQRA 3LFKA 1IW7F 1MJAA 3QP5A 4WX9A 4RGXA 3M8FA 5E18F 4RAYA 2YR2A 1YS7A 3LA7A 1IN8A 1S6LA 2OAZA 2LDUA 3BJ6A 1BI0A 2O0YA 2PMUA 1XN7A 2CWEA 2ESHA 3FXRA 3H92A 4OINF 4H0EA 3JTHA 2K4JA 4OIOF 5LHGA 2DU9A 5E17F 1FBQA 1MDMB 2XAQA 4RGSA 2OA4A 4ZH4F 3ECOA 3U1DA 1PP8F 2GXBA 5FGMA 3RYRA 1R5GA 2EA2A 2O3FA 3LA3A 5E20A 2HTJA 4I02A 4M74A 3TDUC 4ZZLA 1ZYRF 3I53A 2PQ8A 3WTZA 2R7DA 2ESNA 2L02A 3MCZA 2M45A 2V79A 2DI3A 2ELHA 3IL2A 3H3UA 3PFIA 5LRRA 3DPTA 4L0ZB 1MD0A 1OPCA 1FYKA 3ZMSA 2P6TA 2AXLA 3J80K 1ZHFA 5ICCA 4LG0A 1E17A 1QZYA 3MFKA 1QZZA 3FMQA 2MH9A 4IF4A 1J7KA 2VBWA 3JAMK 3GX4X 3F21A 4GYIA 2D45A 4OMYA 1R1TA 1XCVA 1YW8A 5A2QK 4BYYA 3FX3A 3V4GA 3J81Z 5F1RA 3NQOA 1Q1HA 5BQTA 1I27A 5JHUA 1BOAA 5FFXA 1R36A 3FF5A 3ZQ7A 2EFQA 3E97A 1HBXG 1B9MA 2VT3A 2MLKA 2VN2A 2ISZA 5CVVA 1JHHA 1UB9A 2A69F 3F6OA 3T0YA 4FX0A 4B09A 2FBHA 3ZN1A 4UVAA 3L09A 1ZAOA 1WWXA 2AS5F 1DP7P 1V4RA 3P9IA 3VODA 1H9TA 1W7PB 3R61A 5LHHA 3LQRA 2LF7A 1W4MA 1YW7A 6PAXA 4OOIA 2XKPA 3HRMA 2VC0A 3VB2A 4HOBA 1YTYA 3BROA 4FX4A 1ZN2A 3TO9A 5FD5A 2L4AA 4ETSA 2EWNA 4G7ZF 3AAFA 4WK8F 4P5OA 4L18B 1FBSA 1HW5A 4LGWA 4UVBA 2FXAA 4PGGA 4KFCA 1FX7A 2ZMEA 3E6MA 4RB0A 3J7AO 2W25A 1IN4A 3O3KA 4CYDA 1XMAA 1CF7B 2VBXA 3IC7A 5L3GA 1B6AA 4S04A 2RGVA 1FZPB 4HAMA 3WTTC 5HLIA 5LBQA 3OOPA 1TW3A 2RNJA 1J0RA 1RI7A 1XSXA 1T0FA 1H0MA 4CDGA 2P5LC 3F3XA 2JSCA 4KUMA 1CGPA 4N9IA 3EUHA 5TRDA 2IPQX 1W5SA 2QQAA 5DD8A 2OZUA 5L3BA 2CGPA 3GFLA 2KRFA 2DT5A 4QWQA 4U0WA 2STTA 1ZRFA 2JRTA 2CG4A 1R22A 2IVMA 3WTSC 1L0OC 2PLYA 3TO7A 1P4AA 3HRUA 3ZPLA 2RN7A 4MGRA 3TOBA 1FP2A 2Y48A 1UCRA 1XMKA 3RDIA 4P55A 2X4HA 1HW1A 2XUBA 4ZYHA 5F64A 1SD7A 1LDDA 1SMTA 1ON2A 2FNPA 3WU0A 1Z6TA 5CJ9A 4A2UA 3F6VA 4O5VA 3E3VA 1KGSA 2XAFA 2G7HA 1XCBA 3ZP5A 5JR3A 4UNOA 4HQMA 2FMLA 2RV8A 3V7SA 3HYIA 2VBYA 4U0YA 1RUNA 1XGMA 1KYZA 5ILSA 3FMRA 2ZNYA 4Y17A 1HSTA 1TQPA 3D5LA 3SXYA 3RKYA 4HBLA 1MGTA 5E1XA 2BE5F 1K78B 1C0WA 3ISPA 3MWMA 3CJNA 3J80Z 5FLXK 1FT9A 2VONA 2O6GE 4IHSA 2JZYA 3GW2A 3SQNA 3JAMZ 1DPRA 1JXSA 4RB1A 2CQKA 4L9JA 1O57A 5ED4A 5A2QZ 3KFWX 3WGHA 3I59B 5D4SA 3LWFA 2QBYA 1TTYA 3M1EA 4UXNA 2XVCA 4I98B 5ILUA 1R23A 1MKMA 2VBZA 3JSPA 1KYWA 3CO7C 4ESJA 4KYWA 3KETA 4LD5A 5DUKA 5E1ZB 2QZ8A 1TBXA 5HOOA 4HDUA 2E1CA 1QQIA 1UHWA 4OIQF 1KQ0A 4E70A 4OMZA 4F7ZA 2L3DA 4P9UA 4L9TA 4R1HA 1FP1D 4RS8A 4G94A 1REPC 1YLFA 3QPHA 3U2RA 3P7NA 3I58A 1WRJA 1KQ9A 2HEOA 2RDPA 4U88A 5L3EA 4AWXB 1G3TA 4XSXF 4UVCA 5CLSA 1K6OA 1D5VA 1QO0D 1H9GA 5ICEA 4BHPA 1FLIA 3R0JA 2YX4A 5E8GA 3LAJA 4P96A 2VE8A 1YW9A 2P7CB 2ADUA 2Z33A 1S8NA 3BJAA 3BY6A 2H27A 1W5TA 3FXQA 2QYOA 3DQVC 1Z1DA 2JPBA 1XSDA 1SD6A 2D1HA 2Z9OA 1ZRCA 2RVCA 2KJBA 4ZZDA 2E7XA 4RGUA 2EB7A 4WXDA 1XGOA 3L2CA 5DEQA 3IKVA 5HVQC 5LEKA 4MTEA 3CUQA 2FOKA 3WTWC 3F23A 4KIFA 3RYPA 4M9SA 2MBFA 4EM0B 1BIAA 3PQJA 4EGZA 4WXCA 1PUEE 3EYIA 2YPRA 5J8CA 3FWEA 1HKTA 2GZWA 2FSWA 4EJOA 2IA1A 3HSEA 1U5TA 1Z6RA 3IRRA 3RIRA 4U0VA 3E6DA 4UUVA 2ZXJA 3L00A 3K1NA 4IJAA 2ZCWA 2J5PA 1ULYA 2LF8A 4A5NA 3GLXA 1FYMA 3I0TA 2W84A 4OIPF 2A5YB 4G7HF 2XKOA 2V6CA 4ENJA 3WU1B 3KP4A 2GA2A 4G9YA 2DTRA 5LGNA 3GYHX 3IWFA 2QM3A 2W24A 3TOAA 5KK1A 5D8LB 3HHGA 3IHUA 2Z3YA 5FB2A 2XROA 1F9NA 3RPUA 2L01A 4CO8A 4M71A 1Z05A 5K5RA 3F8FA 3F8MA 3FHZA 2MC3A 2X0LA 4LG0B 1IF1A 2UXXA 1WSUA 2K86A 4UHTA 1FPQA 4HV5A 4L9VA 3CTAA 5K5QA 4HV6A 2OBPA 4ASNA 1B9NA 2ACJA 4PDKA 1G4DA 1XGSA 1ZG3A 3SZPA 4EJWA 1IN6A 5HDGA 2Y0MA 1D8KA 3MZHA 1BI2A 3Q5FA 2KJCA 5FLXZ 2OD5A 4UV8A 1HSJA 4GXOA 3DV8A 1Y0UA 3VFZA 1AWCA 2GIVA 4ZYGA 1XDUA 4HF2A 1YQAA 3W6KB 1IZ1A 1DPUA 2CYYA 5DCMB 1LEAA 4LFUA 3P9KA 5J8FA 3HUGA 3K1MA 2XAJA 3ERED 1RUOA 4GYGA 1I1GA 2E1NA 1T39A 2A07F 1I5ZA 3GXOA 4MEYF 1GXQA 3DEUA 1ZARA 1MZBA 1BI3A 3NEUA 2YX7A 1ZRDA 1IRGA 2K4BA 1BI1A 3BDDA 4KIBA 2IW5A 4XBFA 2H09A 2OQGA 2EFPA 3JW4A 2ZMEB 3SFZA 4M6YA 5TJJA 4A0XA 4HYEA 1OKRA 3GUDA 3MQ0A 1F1ZA 1O7FA 2GXGA 3QAHA 2ZJ2A 1LDJA 5ICFA 2NNYA 4YFNF 2CFXA 2IT0A 3HHHA 3FM3A 2EV5A 3DF8A 2DPUA 2OZ6A 1HQCA 2RKHA 5E8IA 2UZKA 4RAZA 5HS8A 4YG2F 2G7UA 3TO6A 2STWA 4B8XA 1UFMA 1JE8A 2PMHA 1SAXA 4K2EA 4AIKA 2RQPA 3LAPA 1ONVA 1BBYA 3Q9VA 4KMUX 3COAC 2O03A 2ETHA 2JT1A 2DPDA 3W6JB 3F22A 1P6RA 2J5OA 3KE2A 3GVAA 1FSEA 4KN4X 4DQ2A 1E2XA 4MHGA 4Z2YA 1KU9A 5HLHA 2EA4A 3G3ZA 3F8NA 1PP7U 1O3QA 3KP3A 1B1BA 2YSRA 1FNNA 4NB5A 3ZMUA 1GHCA 2VT2A 3EETA 2H6BA 3QOPA 4RB2C 4YIFA 2QWWA 5E1WA 2VOPA 2IP2A 1K7AA 3M7GA 1SFEA 1U78A 3M8EA 2BGCA 4S05A 2JTVA 4HW0A 3I5UA 3O2PE 2F2EA 1DDNA 1XD7A 4LJZF 4ENKA 1BC8C 2L54A 3JTGA 4AIJA 2XHKA 3FXUA 1ZLJA 1O3TA 1TW2A 4A0ZA 2GWRA 4NHJA 4HF0A 4ZYDA 1D3YA 3WODF 3I64A 3ELKA 5CVUA 3FMSA 4Q48A 2UXNA 1HXDA 4G6DA 4XRFA 2ZBKA 4IXAA 2CSOA 2VOOA 4AVPA 2A6EF 3HSFA 2HQNA 1FSHA 1TQMA 4L5JA 1F4KA 5CVJA 3KEQA 2PI0A 3WGGA 2WTEA 1QPMA 3HOSA 1OYIA 1R00A 4EJTA 1LB2A 3GWZA 1I6XA 4BQAA 4IRHA 2M1BA 3BP8A 2QBYB 5EEHA 1U6GA 4WCGA 2HWVA 4CGZA 4LLNA 4U7DA 5CYVA 3F8CA 3TGNA 4JQFA 3ZMTA 2EK5A 2BEOA 3WTYC 2DO7A 2O61A 1LQ1A 4JBAA 4Q4ZF 2DQLA 2R3SA 3T8TA 4CXFA 4A12A 3E5UA 3K2ZA 3KLOA 4YFXF 3FM5A 4GO1A 1SFUA 3O6BB 1F5TA 3ZMDA 2WWYA 1G6NA 1W7PD 1USSA 1T38A 4M9XA 2BYVE 4KDPA 4A5MA 4PCQA 2F5FA 3GZ5A 1SMYF 4DNCA 4BNCA 2P5KA 3GFJA 5JFRA 3ML6A 2IRFG 3KP7A 2FE3A 2M87A 3WTUC 3M9AA 3I54A 2FF4A 3R0AA 4I7HA 4FHTA 2V1DA 3DKWA 3C7JA 5L3CA 3C18A 4G8XA 3MEXA 3SHFA 4EQQA 3VEPA 2M30A 1ZG1A 1FC3A 3C3WA 1S7AA 2DW4A 2NYXA 5D5WB 3HOTA 1S7OA 1JGSA 2FQ3A 1STZA 1T98A 1ZGAA 4CZZA 3E6CC 3WTXC 1ZG5A 3B73A 3QU6A 5AIPA 2HTSA 1T6SA 2M8EA 2YU3A 2QUFA 1BN5A 3R60A 2P4WA 1V3FA 2TDXA 3KCCA 4O6JA 5IT9K 4CICA 3LA2A 3CUQB 2FMYA 3KP6A 1J75A 3GFIA 3TKYA 3CUOA 2D1VA 2HOEA 2Y75A 1USTA 1IXSB 1JHFA 2EFOA 5EEGA 1L3LA 3KZZA 2M5WA 2PBIA 1OYYA 2Q0OA 5BPIA 4HQEA 2W85A 1SD5A 3E5XA 4LB6B 1U5TB 4UV9A 4KMFA 1G3WA 1P92A 3ABTA 2DFIA 1FY7A 3R6SA 4BHCA 2EFNA 2ISYA 2MLGA 2P7VB 1YFHA 1EH6A 3DFGA 2VE9A 2V1XA 2LSOA 1ZGJA 2FEZA 1RNLA 4I2OA 4MTDA 3V8LA 4LLLA 3FZVA 3B02A 1LJ9A 2CO5A 5DUIA 4G6QA 5J6XA 4OU0A 4XLNF 3EYYA 3V8KA 4ESBA 2FU4A 3ULQB 4HZFA 1ZREA 5JI6A 3T8RA 3LSTA 4PGHA 4N0BA 1YG2A 2XRNA 4M6XA 5KVRA 2O8XA 4KN7X 2WV0A 2G9WA 3BPVA 1P4WA 5DYMA 1BM9A 4CHUA 1WQ2A 4M73A 1S3JA 4HDVA 1ODDA 5CVIA 1D8JA 2NAZA 5LGUA 5L3FA 3REOA 1LVAA 1WI9A 2RC4A 4QLCU 3TDZC 1XDSA 2GQQA 3E6BA 1IXRC 2MD5A 2NNNA 4EV0A 1NHAA 4PZJA 4Q5SF 4ENNA 5HS7A 3RKWA 4OIRF 2P6SA 1MDMA 3KLNA 2P5VA 1XSVA 5ICGA 5LGTA 2XGXA 2DAOA 2CW0F 1FBUA 5ERIA 4RGRA 3K1PA 2EV0A 3K0LA 5D5UB 4D0PA 3HRTA 4MEXF 5HS9A 4HX8A 3WE2A 5K1YA 2HR3A 1O3RA 3E5QA 3D0SA 2HFHA 4RB3C 4G7OF 1FYLA 1YS6A 4MQVA 3RJPA 1EH8A 3ZN0A 3WGIA 3KP2A 2BV6A 3R4KA 1AOYA 3P9CA 3HSRA 4TV7A 3GO5A 5AONA 1S29A 3DP7A 2A61A 2F5DA 3EQLF 4LK1F 2XAGA 3BWGA 3ZMZA 2K27A 3CDHA 4L9NA 1SD4A 1MJ9A 4JK1X 3Q9SA 4ESFA 4R8HA 3WTVC 2C6YA 5K5OA 1TNSA 1LEBA 5BMZA 2QVOA 2Z5UA 4O3MA 3KZYA 1KU7A 2PFBA 4EM1A 1Z9CA 1I1SA 4XLPF 2HS5A 4MQ9F 3WE3A 3V7RA 4FT8A 3VOEA 5DCMA 5D4RA 2PJPA 4IPAA 3N4MA 3L7WA 3V8JA 1OYWA 4LLGF 1IAWA 4A6DA 1TQIA 3GZ6A 3F72A 3IRQA 3JSOA 2PG4A 2VC1A 1ZLKA 2COMA 4LB5A 2UWMA 2FRHA 2ZO4A 2LNBA 1W7PA 2QLZA 2IA0A 5LRSA 4A0YA 2FNAA 3F8BA 5H6QA 2Q2EA 2R7FA 1FWZA 1HKSA 1IN7A 3TQNA 5IT3A 2V1UA 1BIBA 4GCVA 2QQBA 4EGYA 2BBYA 1P4XA 4Y13A 1R58A 5IT9Z 3U9GA 1QBJA 2MA3A 3ECHA 3N97A 5DDGA 3BJOA 5HDNA 5HDKA 3RTRA 3QRFF 2JPCA 3V7CA 2NRAC 1VTNC 1J9IA 1SFXA 1O3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXU A;  2KKO A;  2KIM A;  1BC7 C;  1YYV A;  1P2F A;  5DV5 A;  2HDC A;  1B4A A;  1J5Y A;  2PEX A;  1Z7U A;  5HLG A;  1KA8 A;  1U3E M;  4GGG A;  3QU3 A;  1CF7 A;  4M72 A;  3HRS A;  4N9H A;  1J2X A;  5D6E A;  3OV8 A;  3LQQ A;  2HKO A;  2FBK A;  4L5I A;  4WXH A;  1YO5 C;  3K9T A;  2KIU A;  3HTU A;  2FA5 A;  1ON1 A;  4LK0 F;  3RI4 A;  3SZT A;  1EH7 A;  4IVN A;  4Y15 A;  3HTS B;  1DUX C;  5D5X B;  3KP5 A;  2B0L A;  3NRV A;  2A68 F;  4KIG A;  2Q8K A;  4I01 A;  2A3S A;  1R5H A;  1G3S A;  3BPX A;  2DQR A;  1O7L A;  2W57 A;  2IJL A;  1R1U A;  3ABU A;  5JVT A;  3CO6 C;  3T5X A;  2H94 A;  2XAH A;  4EVI A;  3ROU A;  1KU2 A;  1IXC A;  4MNU A;  1WKM A;  1RIO H;  1IUY A;  2PN6 A;  5DCF A;  3MAJ A;  1OMI A;  2ZNZ A;  2FBI A;  4EJU A;  1MJB A;  5LHI A;  2LKP A;  2IA2 A;  1X3U A;  3GFM A;  4BAY A;  5H6R A;  4P9F A;  5BOX A;  2KIF A;  1K79 A;  2F5C A;  2V9V A;  2GA1 A;  1HW2 A;  3CUQ C;  1R7J A;  2DK5 A;  2XAS A;  1GVJ A;  3C1D A;  3RKX A;  1XGN A;  4A6E A;  4R79 A;  2DK8 A;  2K7L A;  3G73 A;  4HF1 A;  1IRF A;  3EDP A;  1KQ8 A;  5L3D A;  4ZYE A;  4XSZ F;  2VXZ A;  1U5T C;  1XB4 A;  3CLO A;  3J81 K;  2HGC A;  3KEO A;  1RZ4 A;  2EV6 A;  3PQK A;  3T1B A;  3QPT A;  1T2K A;  4IHT A;  3H3Z A;  3IKT A;  5BS6 A;  3GEZ A;  1LDK B;  1K78 A;  2EFW A;  4IRG A;  3DXJ F;  1KU3 A;  5D6F A;  4KIC A;  1FOK A;  4HLX A;  1A04 A;  5D8K B;  3QP6 A;  3ZMV A;  2XV4 S;  5ILV A;  1U2W A;  5FFZ A;  1QNT A;  1YIO A;  5CVR A;  4ENM A;  1TNT A;  2ZFW A;  3RPQ A;  4WF2 A;  1GXP A;  5LEJ A;  2XIG A;  3GF2 A;  5FO5 A;  3I59 A;  4U7B A;  4BHB A;  4HX7 A;  2GAU A;  5BPD A;  2K02 A;  2HYG D;  1LNW A;  4EJV A;  5D5V B;  4WWC A;  4M9Z A;  4KNY A;  2QQ9 A;  1Z91 A;  2F5E A;  4EMS A;  3HIF A;  4ON0 A;  2D2W A;  1G3Y A;  1J59 A;  3MZY A;  3I71 A;  4LMY A;  3BOQ A;  4HX4 A;  1R1V A;  1U8R A;  5F6F A;  4KA4 A;  3WG9 A;  3S2W A;  3IWZ A;  4KT5 C;  4Q47 A;  2A6H F;  2HZT A;  2ZKZ A;  4YFK F;  5FD6 A;  2EJR A;  1OR7 A;  4I0A A;  4AIH A;  2HQR A;  2DBB A;  4YII A;  3DPL C;  4I09 A;  2WC2 A;  1PDN C;  1IN5 A;  4IRI A;  2DLL A;  4L0Y B;  4I0B A;  1TLH B;  1B59 A;  4HA8 A;  4BH9 A;  2Z99 A;  2MH2 A;  2L4M A;  2E7W A;  1HKQ A;  2NS0 A;  2HKX A;  1UHM A;  1EV7 A;  4EM2 A;  2HYF A;  5H20 A;  1BJA A;  4NQW A;  4AD9 A;  3K69 A;  2H6C A;  4HLY A;  5DD4 A;  1QGP A;  2VOD A;  3I4P A;  2P8T A;  2OU2 A;  3BZ6 A;  5LLQ A;  5AIQ A;  1ZH5 A;  3L9F A;  2QEN A;  2OQR A;  3LFK A;  1IW7 F;  1MJA A;  3QP5 A;  4WX9 A;  4RGX A;  3M8F A;  5E18 F;  4RAY A;  2YR2 A;  1YS7 A;  3LA7 A;  1IN8 A;  1S6L A;  2OAZ A;  2LDU A;  3BJ6 A;  1BI0 A;  2O0Y A;  2PMU A;  1XN7 A;  2CWE A;  2ESH A;  3FXR A;  3H92 A;  4OIN F;  4H0E A;  3JTH A;  2K4J A;  4OIO F;  5LHG A;  2DU9 A;  5E17 F;  1FBQ A;  1MDM B;  2XAQ A;  4RGS A;  2OA4 A;  4ZH4 F;  3ECO A;  3U1D A;  1PP8 F;  2GXB A;  5FGM A;  3RYR A;  1R5G A;  2EA2 A;  2O3F A;  3LA3 A;  5E20 A;  2HTJ A;  4I02 A;  4M74 A;  3TDU C;  4ZZL A;  1ZYR F;  3I53 A;  2PQ8 A;  3WTZ A;  2R7D A;  2ESN A;  2L02 A;  3MCZ A;  2M45 A;  2V79 A;  2DI3 A;  2ELH A;  3IL2 A;  3H3U A;  3PFI A;  5LRR A;  3DPT A;  4L0Z B;  1MD0 A;  1OPC A;  1FYK A;  3ZMS A;  2P6T A;  2AXL A;  3J80 K;  1ZHF A;  5ICC A;  4LG0 A;  1E17 A;  1QZY A;  3MFK A;  1QZZ A;  3FMQ A;  2MH9 A;  4IF4 A;  1J7K A;  2VBW A;  3JAM K;  3GX4 X;  3F21 A;  4GYI A;  2D45 A;  4OMY A;  1R1T A;  1XCV A;  1YW8 A;  5A2Q K;  4BYY A;  3FX3 A;  3V4G A;  3J81 Z;  5F1R A;  3NQO A;  1Q1H A;  5BQT A;  1I27 A;  5JHU A;  1BOA A;  5FFX A;  1R36 A;  3FF5 A;  3ZQ7 A;  2EFQ A;  3E97 A;  1HBX G;  1B9M A;  2VT3 A;  2MLK A;  2VN2 A;  2ISZ A;  5CVV A;  1JHH A;  1UB9 A;  2A69 F;  3F6O A;  3T0Y A;  4FX0 A;  4B09 A;  2FBH A;  3ZN1 A;  4UVA A;  3L09 A;  1ZAO A;  1WWX A;  2AS5 F;  1DP7 P;  1V4R A;  3P9I A;  3VOD A;  1H9T A;  1W7P B;  3R61 A;  5LHH A;  3LQR A;  2LF7 A;  1W4M A;  1YW7 A;  6PAX A;  4OOI A;  2XKP A;  3HRM A;  2VC0 A;  3VB2 A;  4HOB A;  1YTY A;  3BRO A;  4FX4 A;  1ZN2 A;  3TO9 A;  5FD5 A;  2L4A A;  4ETS A;  2EWN A;  4G7Z F;  3AAF A;  4WK8 F;  4P5O A;  4L18 B;  1FBS A;  1HW5 A;  4LGW A;  4UVB A;  2FXA A;  4PGG A;  4KFC A;  1FX7 A;  2ZME A;  3E6M A;  4RB0 A;  3J7A O;  2W25 A;  1IN4 A;  3O3K A;  4CYD A;  1XMA A;  1CF7 B;  2VBX A;  3IC7 A;  5L3G A;  1B6A A;  4S04 A;  2RGV A;  1FZP B;  4HAM A;  3WTT C;  5HLI A;  5LBQ A;  3OOP A;  1TW3 A;  2RNJ A;  1J0R A;  1RI7 A;  1XSX A;  1T0F A;  1H0M A;  4CDG A;  2P5L C;  3F3X A;  2JSC A;  4KUM A;  1CGP A;  4N9I A;  3EUH A;  5TRD A;  2IPQ X;  1W5S A;  2QQA A;  5DD8 A;  2OZU A;  5L3B A;  2CGP A;  3GFL A;  2KRF A;  2DT5 A;  4QWQ A;  4U0W A;  2STT A;  1ZRF A;  2JRT A;  2CG4 A;  1R22 A;  2IVM A;  3WTS C;  1L0O C;  2PLY A;  3TO7 A;  1P4A A;  3HRU A;  3ZPL A;  2RN7 A;  4MGR A;  3TOB A;  1FP2 A;  2Y48 A;  1UCR A;  1XMK A;  3RDI A;  4P55 A;  2X4H A;  1HW1 A;  2XUB A;  4ZYH A;  5F64 A;  1SD7 A;  1LDD A;  1SMT A;  1ON2 A;  2FNP A;  3WU0 A;  1Z6T A;  5CJ9 A;  4A2U A;  3F6V A;  4O5V A;  3E3V A;  1KGS A;  2XAF A;  2G7H A;  1XCB A;  3ZP5 A;  5JR3 A;  4UNO A;  4HQM A;  2FML A;  2RV8 A;  3V7S A;  3HYI A;  2VBY A;  4U0Y A;  1RUN A;  1XGM A;  1KYZ A;  5ILS A;  3FMR A;  2ZNY A;  4Y17 A;  1HST A;  1TQP A;  3D5L A;  3SXY A;  3RKY A;  4HBL A;  1MGT A;  5E1X A;  2BE5 F;  1K78 B;  1C0W A;  3ISP A;  3MWM A;  3CJN A;  3J80 Z;  5FLX K;  1FT9 A;  2VON A;  2O6G E;  4IHS A;  2JZY A;  3GW2 A;  3SQN A;  3JAM Z;  1DPR A;  1JXS A;  4RB1 A;  2CQK A;  4L9J A;  1O57 A;  5ED4 A;  5A2Q Z;  3KFW X;  3WGH A;  3I59 B;  5D4S A;  3LWF A;  2QBY A;  1TTY A;  3M1E A;  4UXN A;  2XVC A;  4I98 B;  5ILU A;  1R23 A;  1MKM A;  2VBZ A;  3JSP A;  1KYW A;  3CO7 C;  4ESJ A;  4KYW A;  3KET A;  4LD5 A;  5DUK A;  5E1Z B;  2QZ8 A;  1TBX A;  5HOO A;  4HDU A;  2E1C A;  1QQI A;  1UHW A;  4OIQ F;  1KQ0 A;  4E70 A;  4OMZ A;  4F7Z A;  2L3D A;  4P9U A;  4L9T A;  4R1H A;  1FP1 D;  4RS8 A;  4G94 A;  1REP C;  1YLF A;  3QPH A;  3U2R A;  3P7N A;  3I58 A;  1WRJ A;  1KQ9 A;  2HEO A;  2RDP A;  4U88 A;  5L3E A;  4AWX B;  1G3T A;  4XSX F;  4UVC A;  5CLS A;  1K6O A;  1D5V A;  1QO0 D;  1H9G A;  5ICE A;  4BHP A;  1FLI A;  3R0J A;  2YX4 A;  5E8G A;  3LAJ A;  4P96 A;  2VE8 A;  1YW9 A;  2P7C B;  2ADU A;  2Z33 A;  1S8N A;  3BJA A;  3BY6 A;  2H27 A;  1W5T A;  3FXQ A;  2QYO A;  3DQV C;  1Z1D A;  2JPB A;  1XSD A;  1SD6 A;  2D1H A;  2Z9O A;  1ZRC A;  2RVC A;  2KJB A;  4ZZD A;  2E7X A;  4RGU A;  2EB7 A;  4WXD A;  1XGO A;  3L2C A;  5DEQ A;  3IKV A;  5HVQ C;  5LEK A;  4MTE A;  3CUQ A;  2FOK A;  3WTW C;  3F23 A;  4KIF A;  3RYP A;  4M9S A;  2MBF A;  4EM0 B;  1BIA A;  3PQJ A;  4EGZ A;  4WXC A;  1PUE E;  3EYI A;  2YPR A;  5J8C A;  3FWE A;  1HKT A;  2GZW A;  2FSW A;  4EJO A;  2IA1 A;  3HSE A;  1U5T A;  1Z6R A;  3IRR A;  3RIR A;  4U0V A;  3E6D A;  4UUV A;  2ZXJ A;  3L00 A;  3K1N A;  4IJA A;  2ZCW A;  2J5P A;  1ULY A;  2LF8 A;  4A5N A;  3GLX A;  1FYM A;  3I0T A;  2W84 A;  4OIP F;  2A5Y B;  4G7H F;  2XKO A;  2V6C A;  4ENJ A;  3WU1 B;  3KP4 A;  2GA2 A;  4G9Y A;  2DTR A;  5LGN A;  3GYH X;  3IWF A;  2QM3 A;  2W24 A;  3TOA A;  5KK1 A;  5D8L B;  3HHG A;  3IHU A;  2Z3Y A;  5FB2 A;  2XRO A;  1F9N A;  3RPU A;  2L01 A;  4CO8 A;  4M71 A;  1Z05 A;  5K5R A;  3F8F A;  3F8M A;  3FHZ A;  2MC3 A;  2X0L A;  4LG0 B;  1IF1 A;  2UXX A;  1WSU A;  2K86 A;  4UHT A;  1FPQ A;  4HV5 A;  4L9V A;  3CTA A;  5K5Q A;  4HV6 A;  2OBP A;  4ASN A;  1B9N A;  2ACJ A;  4PDK A;  1G4D A;  1XGS A;  1ZG3 A;  3SZP A;  4EJW A;  1IN6 A;  5HDG A;  2Y0M A;  1D8K A;  3MZH A;  1BI2 A;  3Q5F A;  2KJC A;  5FLX Z;  2OD5 A;  4UV8 A;  1HSJ A;  4GXO A;  3DV8 A;  1Y0U A;  3VFZ A;  1AWC A;  2GIV A;  4ZYG A;  1XDU A;  4HF2 A;  1YQA A;  3W6K B;  1IZ1 A;  1DPU A;  2CYY A;  5DCM B;  1LEA A;  4LFU A;  3P9K A;  5J8F A;  3HUG A;  3K1M A;  2XAJ A;  3ERE D;  1RUO A;  4GYG A;  1I1G A;  2E1N A;  1T39 A;  2A07 F;  1I5Z A;  3GXO A;  4MEY F;  1GXQ A;  3DEU A;  1ZAR A;  1MZB A;  1BI3 A;  3NEU A;  2YX7 A;  1ZRD A;  1IRG A;  2K4B A;  1BI1 A;  3BDD A;  4KIB A;  2IW5 A;  4XBF A;  2H09 A;  2OQG A;  2EFP A;  3JW4 A;  2ZME B;  3SFZ A;  4M6Y A;  5TJJ A;  4A0X A;  4HYE A;  1OKR A;  3GUD A;  3MQ0 A;  1F1Z A;  1O7F A;  2GXG A;  3QAH A;  2ZJ2 A;  1LDJ A;  5ICF A;  2NNY A;  4YFN F;  2CFX A;  2IT0 A;  3HHH A;  3FM3 A;  2EV5 A;  3DF8 A;  2DPU A;  2OZ6 A;  1HQC A;  2RKH A;  5E8I A;  2UZK A;  4RAZ A;  5HS8 A;  4YG2 F;  2G7U A;  3TO6 A;  2STW A;  4B8X A;  1UFM A;  1JE8 A;  2PMH A;  1SAX A;  4K2E A;  4AIK A;  2RQP A;  3LAP A;  1ONV A;  1BBY A;  3Q9V A;  4KMU X;  3COA C;  2O03 A;  2ETH A;  2JT1 A;  2DPD A;  3W6J B;  3F22 A;  1P6R A;  2J5O A;  3KE2 A;  3GVA A;  1FSE A;  4KN4 X;  4DQ2 A;  1E2X A;  4MHG A;  4Z2Y A;  1KU9 A;  5HLH A;  2EA4 A;  3G3Z A;  3F8N A;  1PP7 U;  1O3Q A;  3KP3 A;  1B1B A;  2YSR A;  1FNN A;  4NB5 A;  3ZMU A;  1GHC A;  2VT2 A;  3EET A;  2H6B A;  3QOP A;  4RB2 C;  4YIF A;  2QWW A;  5E1W A;  2VOP A;  2IP2 A;  1K7A A;  3M7G A;  1SFE A;  1U78 A;  3M8E A;  2BGC A;  4S05 A;  2JTV A;  4HW0 A;  3I5U A;  3O2P E;  2F2E A;  1DDN A;  1XD7 A;  4LJZ F;  4ENK A;  1BC8 C;  2L54 A;  3JTG A;  4AIJ A;  2XHK A;  3FXU A;  1ZLJ A;  1O3T A;  1TW2 A;  4A0Z A;  2GWR A;  4NHJ A;  4HF0 A;  4ZYD A;  1D3Y A;  3WOD F;  3I64 A;  3ELK A;  5CVU A;  3FMS A;  4Q48 A;  2UXN A;  1HXD A;  4G6D A;  4XRF A;  2ZBK A;  4IXA A;  2CSO A;  2VOO A;  4AVP A;  2A6E F;  3HSF A;  2HQN A;  1FSH A;  1TQM A;  4L5J A;  1F4K A;  5CVJ A;  3KEQ A;  2PI0 A;  3WGG A;  2WTE A;  1QPM A;  3HOS A;  1OYI A;  1R00 A;  4EJT A;  1LB2 A;  3GWZ A;  1I6X A;  4BQA A;  4IRH A;  2M1B A;  3BP8 A;  2QBY B;  5EEH A;  1U6G A;  4WCG A;  2HWV A;  4CGZ A;  4LLN A;  4U7D A;  5CYV A;  3F8C A;  3TGN A;  4JQF A;  3ZMT A;  2EK5 A;  2BEO A;  3WTY C;  2DO7 A;  2O61 A;  1LQ1 A;  4JBA A;  4Q4Z F;  2DQL A;  2R3S A;  3T8T A;  4CXF A;  4A12 A;  3E5U A;  3K2Z A;  3KLO A;  4YFX F;  3FM5 A;  4GO1 A;  1SFU A;  3O6B B;  1F5T A;  3ZMD A;  2WWY A;  1G6N A;  1W7P D;  1USS A;  1T38 A;  4M9X A;  2BYV E;  4KDP A;  4A5M A;  4PCQ A;  2F5F A;  3GZ5 A;  1SMY F;  4DNC A;  4BNC A;  2P5K A;  3GFJ A;  5JFR A;  3ML6 A;  2IRF G;  3KP7 A;  2FE3 A;  2M87 A;  3WTU C;  3M9A A;  3I54 A;  2FF4 A;  3R0A A;  4I7H A;  4FHT A;  2V1D A;  3DKW A;  3C7J A;  5L3C A;  3C18 A;  4G8X A;  3MEX A;  3SHF A;  4EQQ A;  3VEP A;  2M30 A;  1ZG1 A;  1FC3 A;  3C3W A;  1S7A A;  2DW4 A;  2NYX A;  5D5W B;  3HOT A;  1S7O A;  1JGS A;  2FQ3 A;  1STZ A;  1T98 A;  1ZGA A;  4CZZ A;  3E6C C;  3WTX C;  1ZG5 A;  3B73 A;  3QU6 A;  5AIP A;  2HTS A;  1T6S A;  2M8E A;  2YU3 A;  2QUF A;  1BN5 A;  3R60 A;  2P4W A;  1V3F A;  2TDX A;  3KCC A;  4O6J A;  5IT9 K;  4CIC A;  3LA2 A;  3CUQ B;  2FMY A;  3KP6 A;  1J75 A;  3GFI A;  3TKY A;  3CUO A;  2D1V A;  2HOE A;  2Y75 A;  1UST A;  1IXS B;  1JHF A;  2EFO A;  5EEG A;  1L3L A;  3KZZ A;  2M5W A;  2PBI A;  1OYY A;  2Q0O A;  5BPI A;  4HQE A;  2W85 A;  1SD5 A;  3E5X A;  4LB6 B;  1U5T B;  4UV9 A;  4KMF A;  1G3W A;  1P92 A;  3ABT A;  2DFI A;  1FY7 A;  3R6S A;  4BHC A;  2EFN A;  2ISY A;  2MLG A;  2P7V B;  1YFH A;  1EH6 A;  3DFG A;  2VE9 A;  2V1X A;  2LSO A;  1ZGJ A;  2FEZ A;  1RNL A;  4I2O A;  4MTD A;  3V8L A;  4LLL A;  3FZV A;  3B02 A;  1LJ9 A;  2CO5 A;  5DUI A;  4G6Q A;  5J6X A;  4OU0 A;  4XLN F;  3EYY A;  3V8K A;  4ESB A;  2FU4 A;  3ULQ B;  4HZF A;  1ZRE A;  5JI6 A;  3T8R A;  3LST A;  4PGH A;  4N0B A;  1YG2 A;  2XRN A;  4M6X A;  5KVR A;  2O8X A;  4KN7 X;  2WV0 A;  2G9W A;  3BPV A;  1P4W A;  5DYM A;  1BM9 A;  4CHU A;  1WQ2 A;  4M73 A;  1S3J A;  4HDV A;  1ODD A;  5CVI A;  1D8J A;  2NAZ A;  5LGU A;  5L3F A;  3REO A;  1LVA A;  1WI9 A;  2RC4 A;  4QLC U;  3TDZ C;  1XDS A;  2GQQ A;  3E6B A;  1IXR C;  2MD5 A;  2NNN A;  4EV0 A;  1NHA A;  4PZJ A;  4Q5S F;  4ENN A;  5HS7 A;  3RKW A;  4OIR F;  2P6S A;  1MDM A;  3KLN A;  2P5V A;  1XSV A;  5ICG A;  5LGT A;  2XGX A;  2DAO A;  2CW0 F;  1FBU A;  5ERI A;  4RGR A;  3K1P A;  2EV0 A;  3K0L A;  5D5U B;  4D0P A;  3HRT A;  4MEX F;  5HS9 A;  4HX8 A;  3WE2 A;  5K1Y A;  2HR3 A;  1O3R A;  3E5Q A;  3D0S A;  2HFH A;  4RB3 C;  4G7O F;  1FYL A;  1YS6 A;  4MQV A;  3RJP A;  1EH8 A;  3ZN0 A;  3WGI A;  3KP2 A;  2BV6 A;  3R4K A;  1AOY A;  3P9C A;  3HSR A;  4TV7 A;  3GO5 A;  5AON A;  1S29 A;  3DP7 A;  2A61 A;  2F5D A;  3EQL F;  4LK1 F;  2XAG A;  3BWG A;  3ZMZ A;  2K27 A;  3CDH A;  4L9N A;  1SD4 A;  1MJ9 A;  4JK1 X;  3Q9S A;  4ESF A;  4R8H A;  3WTV C;  2C6Y A;  5K5O A;  1TNS A;  1LEB A;  5BMZ A;  2QVO A;  2Z5U A;  4O3M A;  3KZY A;  1KU7 A;  2PFB A;  4EM1 A;  1Z9C A;  1I1S A;  4XLP F;  2HS5 A;  4MQ9 F;  3WE3 A;  3V7R A;  4FT8 A;  3VOE A;  5DCM A;  5D4R A;  2PJP A;  4IPA A;  3N4M A;  3L7W A;  3V8J A;  1OYW A;  4LLG F;  1IAW A;  4A6D A;  1TQI A;  3GZ6 A;  3F72 A;  3IRQ A;  3JSO A;  2PG4 A;  2VC1 A;  1ZLK A;  2COM A;  4LB5 A;  2UWM A;  2FRH A;  2ZO4 A;  2LNB A;  1W7P A;  2QLZ A;  2IA0 A;  5LRS A;  4A0Y A;  2FNA A;  3F8B A;  5H6Q A;  2Q2E A;  2R7F A;  1FWZ A;  1HKS A;  1IN7 A;  3TQN A;  5IT3 A;  2V1U A;  1BIB A;  4GCV A;  2QQB A;  4EGY A;  2BBY A;  1P4X A;  4Y13 A;  1R58 A;  5IT9 Z;  3U9G A;  1QBJ A;  2MA3 A;  3ECH A;  3N97 A;  5DDG A;  3BJO A;  5HDN A;  5HDK A;  3RTR A;  3QRF F;  2JPC A;  3V7C A;  2NRA C;  1VTN C;  1J9I A;  1SFX A;  1O3S A; 
#chains in the Genus database with same CATH topology
 1WH7 A;  3H5R A;  3HOY J;  3M8J A;  2ZC2 A;  4BXU A;  1B72 B;  2KKO A;  2KIM A;  1BC7 C;  1YYV A;  3N05 A;  2R7S A;  1P2F A;  1VQ9 I;  1IRZ A;  5DV5 A;  2HDC A;  1QA6 A;  1KZH A;  3DBH B;  3LSI A;  2ZXH A;  4G12 A;  1B4A A;  1J5Y A;  4EAT A;  2PEX A;  3S1N J;  5FKM A;  2LVS A;  1Z7U A;  5HLG A;  1KA8 A;  2H1K A;  1U3E M;  5GTH C;  4GGG A;  2A05 A;  3QU3 A;  1CF7 A;  3EPZ A;  2DA2 A;  3HL2 A;  4M72 A;  3CCE I;  3HRS A;  1FEX A;  3RPU D;  1GVD A;  4N9H A;  1J2X A;  5D6E A;  5K7Z A;  3OV8 A;  3Q0U A;  3GTG J;  3LQQ A;  4HG2 A;  1X1D A;  2UV1 A;  2HKO A;  1QRY A;  2M34 A;  3CZ6 A;  5IYD J;  1YX5 A;  2YU9 J;  3ZQI A;  2FBK A;  2O5R A;  4I76 A;  4L5I A;  4WXH A;  3AG4 H;  1YO5 C;  3K9T A;  4IZZ A;  3DBL B;  2KIU A;  1SVL A;  3HTU A;  2FA5 A;  3QYF A;  4PJL A;  1ON1 A;  4LK0 F;  3RI4 A;  3SZT A;  1EH7 A;  1OFC X;  1JGG A;  4IVN A;  2OTL I;  4Y15 A;  1R5I D;  4GFB A;  1LFB A;  2AQE A;  3DU5 A;  3CJT B;  3HTS B;  2WA0 A;  5J1R A;  4XID A;  1DUX C;  2L9S A;  1WFX A;  2CQN A;  3I4N J;  5D5X B;  5EGO B;  1WVR A;  3KP5 A;  5LFA A;  2B0L A;  3NRV A;  2A68 F;  3VSL A;  2IS1 A;  3KYD B;  4KIG A;  4M3D A;  2Q8K A;  3A03 A;  2IS6 A;  4I01 A;  2A3S A;  3A01 A;  1R5H A;  1G3S A;  1YX3 A;  3BPX A;  3ZQC A;  1MSE C;  2DQR A;  1O7L A;  2W57 A;  1JJ8 C;  2ZJR F;  2IJL A;  1R1U A;  3ABU A;  4S0H B;  5JVT A;  3CO6 C;  3T5X A;  2KHM A;  1BW5 A;  2H94 A;  2XAH A;  4ZJZ A;  2CUE A;  1Z3X A;  4EVI A;  3ROU A;  2GM4 A;  4A3G J;  2CS3 A;  1KU2 A;  4LIT A;  1IXC A;  3DU6 A;  4MNU A;  1WKM A;  4MFE A;  1RIO H;  3DEE A;  2R7Z J;  4CCJ A;  3S3N A;  3M3Y J;  1IUY A;  2JRM A;  2PN6 A;  5DCF A;  1YHQ I;  2M4G A;  3MAJ A;  1OMI A;  2ZNZ A;  2FBI A;  4EJU A;  1MJB A;  5LHI A;  2LKP A;  3TP3 A;  3GTJ J;  2IA2 A;  1POG A;  1X3U A;  3NWS A;  2CFO A;  3GFM A;  2ZSH B;  2XGE A;  2VPL A;  1S7E A;  2AO9 A;  5H6R A;  4BAY A;  1P9Q C;  4LIV A;  4JYK A;  2KIF A;  2X9D A;  4P9F A;  5BOX A;  2VJJ A;  1K79 A;  5E79 C;  3LMM A;  1VQM I;  1V5E A;  2F5C A;  2V9V A;  1W0U A;  2GA1 A;  1HW2 A;  2ZB9 A;  3CUQ C;  3OYG A;  1OCC H;  1R7J A;  2DK5 A;  3CMM A;  3BG7 A;  3BG6 A;  2XAS A;  1GVJ A;  3AG1 H;  3C1D A;  3RKX A;  4ZYA A;  1WPK A;  1XGN A;  2HXI A;  4A6E A;  4R79 A;  3MKL A;  2W00 A;  2M4K A;  2DK8 A;  2K7L A;  2WAE A;  2M7B A;  3G73 A;  3ZQH A;  3K2A A;  4HF1 A;  5EF6 A;  1B8I B;  3FHN A;  3VYU B;  1IRF A;  3EDP A;  3BR2 A;  1KQ8 A;  5L3D A;  4ZYE A;  4XSZ F;  2VXZ A;  4YEJ A;  1U5T C;  1XB4 A;  3V42 A;  2VJI A;  3CLO A;  3J81 K;  2V9P A;  1IJW C;  4A3E J;  1W5C C;  1N25 A;  2HGC A;  2R7R A;  1XG1 A;  3K70 D;  3KEO A;  1RZ4 A;  5CPR B;  2EV6 A;  3PQK A;  1FTZ A;  1HDP A;  3S8P A;  3T1B A;  3QPT A;  1T2K A;  4IHT A;  3H3Z A;  3RQ4 A;  3IKT A;  5BS6 A;  3GTL J;  3GTP J;  3GEZ A;  1LDK B;  5C3E J;  1K78 A;  2EFW A;  4DW6 A;  4IRG A;  4GDF A;  3DXJ F;  1MBK A;  1KU3 A;  2R7Q A;  4F52 A;  5D6F A;  4KIC A;  1FOK A;  4PSW A;  2K9N A;  4HLX A;  2L2O A;  4L5E A;  4PFP A;  1A04 A;  2HOT A;  5D8K B;  3QP6 A;  1OCT C;  2O9L A;  4RLQ A;  3ZMV A;  2XV4 S;  5ILV A;  3IP4 B;  1U2W A;  3JRD A;  3I4M J;  2Y30 A;  5FFZ A;  1QNT A;  1WH5 A;  2LTP A;  2MAB A;  3HEF A;  4ITV A;  5HOD A;  1YIO A;  3PSF A;  2E5Z A;  5CVR A;  4XRM A;  1Y1V J;  4ENM A;  3K4B A;  1TNT A;  2R7U A;  4ABZ A;  2ZFW A;  3RPQ A;  4YEL A;  4WF2 A;  3PUB A;  1V55 H;  1GXP A;  5LEJ A;  5IYC J;  1U0J A;  2XIG A;  3GF2 A;  1QZE A;  5FO5 A;  3I59 A;  4U7B A;  1H8A C;  1G59 A;  4BHB A;  1ITY A;  1GLN A;  4HX7 A;  2GAU A;  5BPD A;  1W36 D;  5KHD A;  2K02 A;  1Q1V A;  2HYG D;  1LNW A;  4EJV A;  5D5V B;  4WWC A;  4M9Z A;  3J7Y J;  1Y1W J;  4KNY A;  1IGN A;  2QQ9 A;  1Z91 A;  2F5E A;  4EMS A;  4IHW A;  4XLE A;  4IOC F;  3HIF A;  4ON0 A;  3CCM I;  3CC7 I;  1FOX A;  2ID3 A;  2D2W A;  5EZH A;  2KZG A;  2WAQ N;  1G3Y A;  3CJR B;  1J59 A;  3CQZ J;  2ECC A;  2LRE A;  2EBI A;  3MZY A;  1YRN B;  3I71 A;  4LMY A;  3WHC A;  3CCV I;  4XLA A;  3BOQ A;  4HX4 A;  1R1V A;  4XLC A;  5HNF A;  1U8R A;  3MKY B;  5F6F A;  4KA4 A;  2DMU A;  3WG9 A;  2R7W A;  3S2W A;  3IWZ A;  5KAI C;  3OOU A;  3DEW A;  4KT5 C;  4Q47 A;  2DMN A;  3SDB A;  4KIS A;  2A6H F;  2HZT A;  2ZKZ A;  4YFK F;  2ZJQ F;  3OY9 A;  2OUM A;  5FD6 A;  1WJ5 A;  2EJR A;  1OR7 A;  4I0A A;  4AIH A;  1ETY A;  2HQR A;  3GCM A;  4C3I J;  2E2H J;  2DBB A;  4YII A;  2HOS A;  2QSF X;  2KL4 A;  3DPL C;  4I09 A;  2M0C A;  2WC2 A;  1PDN C;  1IN5 A;  4BE1 A;  3ASN H;  2LP0 A;  1TT5 B;  1OQY A;  4IRI A;  2DLL A;  4L0Y B;  1BJZ A;  4BGD A;  2VLA A;  4I0B A;  1TLH B;  1B59 A;  1WJB A;  4HA8 A;  2K9Q A;  4BH9 A;  3SFI A;  2Z99 A;  4FE4 A;  4RAF A;  2MH2 A;  2L4M A;  2E7W A;  2E2J J;  1HKQ A;  2XRL A;  3CCJ I;  2NS0 A;  2HKX A;  1UHM A;  4ZDP A;  4XOR A;  1EV7 A;  4EM2 A;  2HYF A;  2OV7 A;  2FX0 A;  4RAG A;  1E0E A;  5H20 A;  1A5J A;  4B48 A;  1BJA A;  4QIW N;  5J4V A;  4NQW A;  4CSW A;  4M3G A;  4AD9 A;  3K69 A;  2H6C A;  2WBM A;  4HLY A;  5DD4 A;  2E1O A;  1RRJ A;  1QGP A;  2VOD A;  2KP6 A;  3I4P A;  5E3L A;  2P8T A;  5EJC A;  2OU2 A;  3H3V K;  3BZ6 A;  2L9V A;  4LOC A;  4KT6 A;  4PJN A;  1TL8 A;  5LLQ A;  3CJQ B;  3ZGK A;  3ERM A;  2NS7 A;  2MSY A;  3L9F A;  3ASO H;  3MZ8 A;  5AIQ A;  2QEN A;  1ZH5 A;  2OQR A;  2LG4 A;  4CCK A;  3LFK A;  3JRF A;  1IW7 F;  2H8W A;  3MN2 A;  1RET A;  3BTC A;  2BY0 A;  1MJA A;  4E6K G;  2JA5 J;  1Y56 A;  3TMO A;  3QP5 A;  1OIS A;  4WX9 A;  4RGX A;  1WJE A;  3M8F A;  2XPW A;  5E18 F;  4RAY A;  3BG3 A;  1WZ2 A;  2YR2 A;  3L2Q A;  1YS7 A;  3LA7 A;  3DLL F;  1IN8 A;  2BXY A;  1S6L A;  2DA1 A;  2K85 A;  2OAZ A;  2LDU A;  3BJ6 A;  1BI0 A;  2O0Y A;  3Q0W A;  1AHD P;  2PMU A;  2H8R A;  1Y6I A;  4D9J A;  1XN7 A;  4J01 A;  2CWE A;  2ESH A;  2HVQ A;  2ID6 A;  3FXR A;  3H92 A;  4OIN F;  5JHF A;  4H0E A;  2LH9 A;  3W6V A;  3LSM A;  1YIT I;  4MFD A;  1X19 A;  3JTH A;  2I5U A;  2K4J A;  3FXL A;  4OIO F;  3OYJ A;  5LHG A;  4NC8 A;  2DU9 A;  5E17 F;  2LK2 A;  1FBQ A;  1MDM B;  3CF5 F;  2XAQ A;  3ABK H;  4RGS A;  5DM6 F;  3OYE A;  3HM5 A;  1VQK I;  3ZRG A;  3TED A;  1VQ5 I;  1NTC A;  3HOW J;  2OA4 A;  4ZH4 F;  3ECO A;  3CDL A;  4DGW B;  3FK7 A;  3U1D A;  1PP8 F;  2GXB A;  5FGM A;  3DKX A;  4A3C J;  2IEK A;  1R5G A;  3RYR A;  2EA2 A;  4AID A;  2O3F A;  3LA3 A;  3G2B A;  5E20 A;  2XDV A;  1TT0 A;  2HTJ A;  2Q1Z B;  4I02 A;  4M74 A;  3TDU C;  4ZZL A;  1ZYR F;  3I53 A;  2VQH A;  5GPC A;  2PQ8 A;  3WTZ A;  2R7D A;  2ESN A;  2L02 A;  2XPU A;  1TWF J;  3MCZ A;  4AC0 A;  4A3D J;  2M45 A;  3LOC A;  2V79 A;  2DI3 A;  2ELH A;  1H88 C;  3IL2 A;  3DTK A;  3H3U A;  3PFI A;  5LRR A;  3DPT A;  4Y33 A;  2QSG X;  4BUP A;  3S3O A;  4L0Z B;  1MD0 A;  3VDX A;  3EUH C;  4X6A J;  1OPC A;  1FYK A;  3ZMS A;  2V26 A;  3LFU A;  1R71 A;  2P6T A;  2AXL A;  3J80 K;  1BW6 A;  1ZHF A;  5ICC A;  4LG0 A;  1E17 A;  1QZY A;  3MFK A;  3HPH A;  1QZZ A;  3FMQ A;  2KLO A;  2MH9 A;  4IF4 A;  1J7K A;  1X4O A;  2JSP A;  1I3A A;  2VBW A;  3HDD A;  3JAM K;  3GX4 X;  3F21 A;  4GYI A;  1JTX A;  1S5L C;  2LRD A;  2D45 A;  3M1C A;  3OIQ A;  4OMY A;  1R1T A;  4KIT B;  1LE8 A;  1XCV A;  2NVT J;  1YW8 A;  2X51 A;  5A2Q K;  4BYY A;  2XSJ C;  3FX3 A;  3V4G A;  3J81 Z;  5F1R A;  2LBF B;  3NQO A;  1Q1H A;  1Y8R B;  4BBR J;  5BQT A;  1IO2 A;  1I27 A;  5JHU A;  1S9H A;  2CW7 A;  2DDA A;  3OYM A;  1BR4 A;  1XPX A;  1Z67 A;  2L7Z A;  5FRM A;  2ELK A;  1BOA A;  1X2M A;  5FFX A;  1R36 A;  3FF5 A;  3LSR A;  3ZQ7 A;  2EFQ A;  3E97 A;  1HBX G;  1B9M A;  2VT3 A;  4CCM A;  3OMY A;  5K7F A;  2MLK A;  4CH7 A;  2VN2 A;  3PFY A;  2ISZ A;  4NNJ A;  3S1R J;  3M4O J;  2KT0 A;  2DXI A;  5FKK A;  1E3P A;  1UHS A;  5CVV A;  2NVQ J;  3PO3 J;  1JHH A;  1UB9 A;  2A69 F;  3F6O A;  3AL0 B;  3S2H J;  2JK3 A;  3BR6 A;  4RA2 A;  2TRT A;  2E2I J;  1EA3 A;  3RSN A;  3T0Y A;  3CCQ I;  1LFU P;  1FOY A;  5EDN A;  4FX0 A;  4B09 A;  4IHY A;  1ETW A;  2FBH A;  3ZN1 A;  4UVA A;  3RZO J;  4C9Y A;  3L09 A;  3H35 A;  1ZAO A;  1WWX A;  2AS5 F;  2ME6 A;  4BEH B;  3P5J A;  1DP7 P;  1V4R A;  2UUZ A;  1K6Y A;  2KRC A;  3P9I A;  3VOD A;  2VJ4 A;  2ME0 A;  4B3A A;  1DQU A;  3JRC A;  1H9T A;  1W7P B;  3R61 A;  5LHH A;  4IOA F;  3BQZ A;  3LQR A;  5EG0 A;  2LF7 A;  2B7E A;  1OLT A;  4LIU A;  1W4M A;  1YW7 A;  2JMW A;  1VQP I;  2ZJP F;  1GUU A;  4BXX J;  2MFZ A;  5J3L A;  1Y39 A;  1EJ9 A;  2F4O B;  6PAX A;  1WI3 A;  4OOI A;  4PSX A;  3MKZ A;  4BAC A;  2OCE A;  1Y0N A;  2XKP A;  2EZH A;  3MKW B;  3HRM A;  2X6O A;  2VC0 A;  2DCE A;  2LMD A;  4HOB A;  2EIM H;  1OJL A;  3A0B C;  3BRO A;  3VB2 A;  2E1M B;  1YTY A;  1DGW Y;  2H1L A;  2DT7 B;  4A3J J;  4FX4 A;  1ZN2 A;  3TO9 A;  4C2M J;  5FD5 A;  4DBQ A;  3HXL A;  2L4A A;  4ETS A;  4UUS A;  1MMG A;  2EWN A;  2FJ1 A;  1YE9 A;  4H4K C;  3AAF A;  4G7Z F;  4WK8 F;  4P5O A;  4L18 B;  3K4C A;  1FBS A;  4AVZ A;  1JKP C;  1HW5 A;  4LGW A;  3BR0 A;  4UVB A;  4JX6 A;  2FXA A;  3ABM H;  4PGG A;  4KFC A;  1FX7 A;  2V7F A;  2ZME A;  3E6M A;  4RB0 A;  4CCL A;  3J7A O;  2W25 A;  4Y3O A;  1IN4 A;  2F5V A;  3O3K A;  4CYD A;  3PUF A;  3L2R A;  2HQA A;  1PVE A;  2RAE A;  2LKS A;  1XMA A;  1CF7 B;  2VBX A;  1D0Z A;  3IC7 A;  5L3G A;  1B6A A;  1T08 B;  3K4L A;  1UG0 A;  3F0C A;  4S04 A;  2GIZ A;  2RGV A;  2EH3 A;  4CCO A;  1FZP B;  4HAM A;  1WCM J;  3WTT C;  2ECB A;  4ZTF A;  5HLI A;  5LBQ A;  3OOP A;  1TW3 A;  2R7T A;  2RNJ A;  1J0R A;  1RI7 A;  1TWA J;  1T0F A;  1XSX A;  1H0M A;  3FXJ A;  4CDG A;  1WJF A;  4DJA A;  2P5L C;  2MW8 A;  3CC2 I;  2RQQ A;  3F3X A;  1HC8 A;  2JSC A;  3S15 J;  3TBI A;  4KUM A;  3JRB A;  1CGP A;  4N9I A;  1QHG A;  3EUH A;  3IV5 A;  5TRD A;  3D1N I;  3QOE A;  2IPQ X;  1W5S A;  5EZG A;  2HXO A;  2R93 J;  2QQA A;  5DD8 A;  3A2K A;  2VKV A;  4EEF G;  1M1E B;  4D7M A;  5M3M J;  2WV1 A;  4E7S A;  2OZU A;  5L3B A;  2CGP A;  1V5F A;  3GFL A;  2XF5 A;  1K61 A;  2KRF A;  1X2N A;  1VFC A;  2DT5 A;  4QWQ A;  4U0W A;  2STT A;  1ZRF A;  5EYR A;  4I6Z A;  1IDZ A;  2X6Y A;  5IP9 J;  2JRT A;  2XGC A;  4JX4 A;  2EPF A;  2CG4 A;  1OCZ H;  3VWB A;  3K4K A;  3I9V 2;  1R22 A;  1X3W B;  3WHB A;  1X1P A;  1P7J A;  2IVM A;  3OR1 C;  2AHQ A;  2JN6 A;  2E34 A;  5B3S H;  3WTS C;  1L0O C;  3QYE A;  3TO7 A;  3GLL A;  1P4A A;  3HRU A;  5FKO A;  2DA4 A;  3ZQQ A;  2PLY A;  3ZPL A;  2RN7 A;  4MGR A;  3TOB A;  1FP2 A;  2Y48 A;  1UCR A;  1XMK A;  4E7I A;  3RDI A;  4P55 A;  2X4H A;  1HW1 A;  1WJD A;  2XUB A;  4ZYH A;  5F64 A;  2QQ8 A;  1SD7 A;  1LDD A;  3FBI B;  1SMT A;  1ON2 A;  2FNP A;  5FJ8 J;  3WU0 A;  1Z6T A;  5J4Y A;  2MG4 A;  5CJ9 A;  3GTO J;  4A2U A;  3F6V A;  4O5V A;  5JLX A;  1T95 A;  3E3V A;  4CA0 A;  1D1A A;  1I3Q J;  5H2F C;  2CV0 A;  1KGS A;  2XAF A;  2G7H A;  4B43 A;  1XCB A;  3W2A A;  3ZP5 A;  4RBO A;  2AXT C;  2LLK A;  2O7O A;  4CCN A;  5JR3 A;  4UNO A;  2XAU A;  2DA6 A;  4HQM A;  2FML A;  5F1J A;  2RV8 A;  3V7S A;  2XB0 X;  3HYI A;  3LSK A;  4NDL A;  2CQX A;  4HNT A;  1UEL B;  4HSR A;  2VBY A;  2L9R A;  4U0Y A;  1RUN A;  2YS9 A;  3SYT A;  5E3N A;  1XGM A;  2GBY A;  1KYZ A;  3D5R C;  3F9K A;  3AFH A;  4XKB A;  2VQG A;  1W1W E;  5ILS A;  3A0H C;  1ZTR A;  2KDZ A;  1XS9 A;  3FMR A;  1ZGW A;  4M3B A;  2ZNY A;  4P1W A;  4Y17 A;  1HST A;  5GTI C;  1TQP A;  3QQA A;  2Y9Z A;  1RKW A;  1IUF A;  1VF9 A;  3D5L A;  3SXY A;  3RKY A;  4HBL A;  1MGT A;  5E1X A;  2BE5 F;  1K78 B;  1C0W A;  3HBL A;  3ISP A;  3HC7 A;  3MWM A;  3CJN A;  2IGO A;  3J80 Z;  5FLX K;  3PJR A;  2QKM B;  1FT9 A;  2OCC H;  2VON A;  2VUM J;  2O6G E;  2XSD C;  2JUG A;  4IHS A;  3G4S I;  2JZY A;  3GW2 A;  2NOG A;  2DA3 A;  3SQN A;  4FTH A;  4XKV A;  3JAM Z;  4RMN A;  1A6Q A;  1DPR A;  2EZI A;  1JXS A;  4RB1 A;  2P0W A;  4AYB A;  4JOM A;  5KNL A;  1DU0 A;  2K9M A;  2RNG A;  2CQK A;  3OYK A;  4L9J A;  1O57 A;  5ED4 A;  2XB5 A;  5A2Q Z;  3RCO A;  1FMW A;  2R4G A;  2XF6 A;  4YIR X;  3KFW X;  3ONQ A;  3LL7 A;  3WGH A;  1HLV A;  3I59 B;  5D4S A;  4NUB A;  3LWF A;  2DDB A;  3CDI A;  2W7N A;  1MNM C;  4A93 J;  2QBY A;  1X1C A;  3L2V A;  1TTY A;  2IS2 A;  3M1E A;  5FKN A;  1NG7 A;  4UXN A;  4V19 K;  3ESW B;  1FIP A;  3BG5 A;  2XVC A;  1B8I A;  4I98 B;  2F4I A;  1MND A;  3CC4 I;  5ILU A;  1R23 A;  1MKM A;  4NBQ A;  1Z0X A;  4PJJ A;  2VBZ A;  1GV2 A;  4JX5 A;  3JSP A;  1KYW A;  2LY1 A;  2NOJ B;  3CO7 C;  4ESJ A;  4KYW A;  3PL8 A;  3KET A;  2K40 A;  4LD5 A;  3C2B A;  2K5C A;  5DUK A;  2QZ8 A;  3DWL E;  5E1Z B;  4DZP A;  1TBX A;  2V1N A;  1JJ6 C;  5HOO A;  1XMX A;  4HDU A;  2B63 J;  1VQ6 I;  2E1C A;  1V54 H;  1QQI A;  1UHW A;  1K83 J;  4OIQ F;  1KQ0 A;  4E70 A;  2MC4 A;  4OMZ A;  4F7Z A;  2BY2 A;  2L3D A;  4P9U A;  1R4M B;  3H5N A;  4BY7 J;  4L9T A;  2FQ4 A;  4R1H A;  4BE2 A;  1FP1 D;  4RS8 A;  5HLT A;  4G94 A;  1ETK A;  4MLO A;  1REP C;  2NVY J;  1YLF A;  1E3O C;  1V5G A;  3QPH A;  3U2R A;  1BL0 A;  2DJN A;  2X1C A;  5TIS C;  1F43 A;  3KX2 A;  3P7N A;  3I58 A;  3PNY A;  1WRJ A;  1KQ9 A;  2HQ5 A;  3DTE A;  4D5C A;  2HEO A;  2RDP A;  4U88 A;  5L3E A;  3J7Z I;  4AWX B;  1G3T A;  3OSF A;  4XSX F;  1FOW A;  4UVC A;  1VQN I;  2HDW A;  5CLS A;  5DM7 F;  3FIS A;  1K6O A;  1D5V A;  4Z6Y A;  1HA8 A;  1QO0 D;  3I55 I;  5JLW A;  4HNV A;  4M6V A;  1S72 I;  5IP6 A;  1H9G A;  5ICE A;  4BHP A;  1FLI A;  1ZKG A;  2DOD A;  3R0J A;  2YX4 A;  5E8G A;  2M7A A;  3LAJ A;  4P96 A;  2W82 A;  2VE8 A;  4U87 A;  4FAS D;  1K4T A;  4DZJ A;  1JKQ C;  1T33 A;  1YW9 A;  5IOZ A;  2DOE A;  2ADU A;  2P7C B;  2Z33 A;  1S8N A;  5F0F A;  3BJA A;  2NVU B;  4NQW B;  2LR8 A;  1X4P A;  1PUF A;  4UY8 I;  3LSP A;  3BY6 A;  2H27 A;  1W5T A;  3FXQ A;  3OYL A;  2CMP A;  2QYO A;  3DQV C;  2WY7 Q;  2R5Y A;  3RZD J;  2PMZ A;  3S32 A;  1Z1D A;  2JPB A;  1XSD A;  3CCU I;  2HU9 A;  3K4J A;  1SD6 A;  1HF0 A;  2D1H A;  5LD2 C;  1MMS A;  2Z9O A;  4A3F J;  1ZRC A;  2L5Q A;  4ZTJ A;  2RVC A;  2IGK A;  1GT0 C;  2XC7 A;  2KJB A;  4ZZD A;  2E7X A;  3EUK L;  4MO7 A;  4M3E A;  4RGU A;  2DN0 A;  2EB7 A;  4WXD A;  1XGO A;  4XKW A;  3L2C A;  5DEQ A;  2DFH A;  2IXS A;  3IKV A;  2FUG 2;  5HVQ C;  5LEK A;  3BCA A;  4MTE A;  3CUQ A;  1ZEL A;  4CYC B;  2FOK A;  3LSG A;  1SVM A;  3OYN A;  4BDZ A;  2BXZ A;  3QPS A;  2HZD A;  5J40 A;  3WTW C;  3F23 A;  4KIF A;  3K4M A;  1ENH A;  3RYP A;  3HJE A;  4M9S A;  2LYC A;  5M5Y J;  2MBF A;  4EM0 B;  1BIA A;  3DPU A;  2WB1 A;  3PQJ A;  4XKC A;  4EGZ A;  4Y7N J;  3NWT A;  4WXC A;  1PUE E;  3EYI A;  2YPR A;  3G71 I;  5J8C A;  3FWE A;  2E19 A;  1HKT A;  4FET A;  1ETX A;  1T8I A;  3ZOB A;  2GZW A;  4MIM A;  5J1U A;  2FSW A;  4M3F A;  4BU2 A;  3OS0 A;  1YJN I;  4OAZ A;  4EJO A;  3GTQ J;  2IA1 A;  3HSE A;  1U5T A;  1Z6R A;  3IRR A;  3RIR A;  4U0V A;  3E6D A;  4UUV A;  2ZXJ A;  2L7M P;  1AKH A;  3L00 A;  3CF2 A;  1Y8Q B;  3K1N A;  3M07 A;  4IJA A;  2ZCW A;  2J5P A;  2XPV A;  3WU2 C;  1ULY A;  2LF8 A;  4XLF A;  4A5N A;  3CP8 A;  2E71 A;  3BG9 A;  2DMQ A;  4FCY A;  3GLX A;  4W97 A;  1FYM A;  3AL0 C;  3I0T A;  1RES A;  2W48 A;  3SZG A;  2W84 A;  4OIP F;  3OYH A;  3CES A;  2A5Y B;  2K3P A;  3U1K A;  1J09 A;  3ZXS A;  4G7H F;  2XKO A;  3ABL H;  3BTL A;  4XRS G;  2V6C A;  4FIS A;  2WAF A;  4ENJ A;  2Y0S A;  4IHV A;  1MMN A;  4DOZ A;  3WU1 B;  3KP4 A;  2M2E A;  5J1Y A;  1N78 A;  3OS1 A;  2GA2 A;  4G9Y A;  2DTR A;  1R6R A;  4DYQ A;  1JT6 A;  5LGN A;  3JRE A;  3J7A Y;  4XQF A;  5DS9 A;  3GYH X;  1VQ8 I;  3IWF A;  3JCU C;  5FLV A;  2OTJ I;  2QM3 A;  2W24 A;  3TOA A;  5KK1 A;  5D8L B;  3HHG A;  3DTI A;  1X1A A;  3IHU A;  2Z3Y A;  5FB2 A;  2XRO A;  1F9N A;  1KON A;  2PX9 A;  3RPU A;  2L01 A;  4CO8 A;  1JT0 A;  1HDD C;  4G6T B;  4M71 A;  2ZXW H;  2KRH A;  2EIN H;  1Z05 A;  1UZC A;  5K5R A;  3F8F A;  3F8M A;  3FHZ A;  2EZK A;  2MC3 A;  4UUT A;  5B1A H;  1T56 A;  2X0L A;  3A4C A;  2E1M C;  5IP7 J;  2GOM A;  4LG0 B;  3FIW A;  1IF1 A;  3BR5 A;  2EZL A;  2UXX A;  3IUO A;  4QSH A;  5F0C A;  1WSU A;  2K86 A;  3TW7 A;  4UHT A;  2BW3 B;  5E3O A;  1FPQ A;  2DYS H;  4AU7 A;  1FJL A;  4HV5 A;  4L9V A;  3FKJ A;  2CJJ A;  4AUX A;  2DMT A;  1TWC J;  2Y31 A;  3CTA A;  2EQR A;  3TP0 A;  1LE8 B;  4X1E A;  5K5Q A;  4PK4 A;  2DOA A;  1YJ9 I;  3CLQ A;  4C30 A;  4HV6 A;  2OBP A;  4ASN A;  3D5S C;  2KQR A;  3SEZ A;  1B9N A;  3JRA A;  5C44 J;  2ACJ A;  4PDK A;  1G4D A;  3HGG A;  1XGS A;  4DYR A;  1ZG3 A;  3JRG A;  3SZP A;  4OAY A;  4E7K A;  2HI3 A;  2GXA A;  1DU6 A;  4EJW A;  1D0Y A;  1IN6 A;  5HDG A;  3G1L A;  3HZJ A;  2Y0M A;  4XOP A;  2DYR H;  2LD5 A;  1D8K A;  3E7L A;  3MZH A;  1BI2 A;  3Q5F A;  3Q0V A;  2KJC A;  2MYS A;  3W2V A;  5FLX Z;  3MD2 A;  2W1O A;  2OD5 A;  4UV8 A;  1HSJ A;  2R0Q C;  4GXO A;  5IYB J;  3DV8 A;  2HDD A;  4Y52 J;  1Y0U A;  1XC5 A;  2WY8 Q;  3CCR I;  3VFZ A;  1AWC A;  3PO2 J;  3CCY A;  2IGN A;  4UB6 C;  3OYA A;  2GIV A;  4ZYG A;  1XDU A;  4HF2 A;  2COB A;  2M3A A;  1YQA A;  2RRE A;  1MW7 A;  1SEU A;  3UKG A;  2V6E A;  3W6K B;  1VQ4 I;  3B6A A;  1IZ1 A;  1DPU A;  4XN3 A;  4HNU A;  2CYY A;  2O8K A;  3LSJ A;  5DCM B;  1LEA A;  4LFU A;  3FDY A;  1A6I A;  3P9K A;  5J8F A;  3HUG A;  3K1M A;  3MMY B;  2XAJ A;  3ERE D;  5EG0 B;  3OYB A;  1RUO A;  4QPQ A;  1MH3 A;  5KCM A;  4GYG A;  1I1G A;  1HCR A;  2CUF A;  2E1N A;  5GAD J;  1T39 A;  4GRI A;  4PUS A;  1QVT A;  4UB8 C;  4HEA 2;  5F27 A;  1XX5 A;  4IX7 A;  3B6C A;  5HNH A;  3PSI A;  2L7F P;  2A07 F;  1I5Z A;  3GXO A;  2VAS A;  4B44 A;  2QA4 I;  4MEY F;  5M3F J;  1GXQ A;  3DEU A;  1ZAR A;  2B9S A;  1MZB A;  1BI3 A;  3CD6 I;  2Q2E B;  4CUG A;  3NEU A;  2IBD A;  2KIQ A;  5C4X J;  2YX7 A;  2Y9Y A;  1ZRD A;  1IRG A;  3K7A J;  3JRI A;  3H36 A;  2EIK H;  2OC6 A;  4XOT A;  4AYB N;  2K4B A;  1CQT A;  1BI1 A;  3FK6 A;  2X1D A;  3BDD A;  4KIB A;  2CUJ A;  5KAF C;  2IW5 A;  4XBF A;  3A1Y A;  2H09 A;  2OQG A;  2EFP A;  3JW4 A;  3LSH A;  4A3I J;  1WJC A;  3GZN B;  2ZME B;  3SFZ A;  1IC8 A;  4M6Y A;  5TJJ A;  1UAA A;  3PNT A;  5FKL A;  1E3H A;  3GME A;  4HYE A;  1OKR A;  4A0X A;  4E4H A;  1TWH J;  3GUD A;  3OS2 A;  3BZK A;  1NK3 P;  3MQ0 A;  2JA8 J;  1F1Z A;  1O7F A;  4D7N A;  1D0X A;  2GXG A;  3QAH A;  2ZJ2 A;  1LDJ A;  4XN0 A;  3VPR A;  5ICF A;  2NNY A;  4YFN F;  2CFX A;  2IT0 A;  3HHH A;  3FM3 A;  3BR3 A;  2EV5 A;  3OIO A;  2JVH A;  3IH3 A;  3DF8 A;  3DBR B;  4D5F A;  3BTI A;  3OL3 A;  3JRH A;  2DPU A;  2OZ6 A;  4QPO A;  1HQC A;  2RKH A;  2M9H A;  2NXN B;  5E8I A;  2DT6 A;  2UZK A;  4A3K J;  2M8G X;  1QPI A;  4RAZ A;  5HS8 A;  2E35 A;  4YG2 F;  2G7U A;  3TO6 A;  5IY5 H;  3KPH A;  2HPM A;  3CP2 A;  1RR8 C;  2STW A;  2PJR A;  2L0K A;  4B8X A;  3O8G A;  1UFM A;  1JE8 A;  2X6W A;  2PMH A;  3S93 A;  1SAX A;  4K2E A;  4AIK A;  2RQP A;  4ZDL A;  3LAP A;  1ONV A;  1BBY A;  3K6G A;  3Q9V A;  4KMU X;  3COA C;  3S17 J;  1BR1 A;  2O03 A;  3FKI J;  2R7V A;  1VQL I;  2ETH A;  2JT1 A;  4DBR A;  3CME I;  2DFE A;  2DPD A;  3W6J B;  3LNQ A;  3F22 A;  1P6R A;  2J5O A;  1A31 A;  3KE2 A;  3GVA A;  3OYI A;  2NS8 A;  1FSE A;  4KN4 X;  4C2T A;  4DQ2 A;  1E2X A;  4MHG A;  4W1U A;  3H0G J;  4Z2Y A;  1KU9 A;  5HLH A;  1ZR2 A;  2EA4 A;  2R7O A;  5B5E C;  4IKF A;  3G3Z A;  4JP0 A;  2R5Z A;  3F8N A;  1PP7 U;  3BLY A;  4BQQ A;  3A01 B;  1WGX A;  1O3Q A;  1GV5 A;  3KP3 A;  1B1B A;  2YSR A;  1JUM A;  1FNN A;  4XMY A;  4NB5 A;  1JUP A;  5CQG A;  3VYS B;  3OYD A;  3KYL A;  4E7L A;  4IHX A;  2BHZ A;  2QSH X;  3L2U A;  1MH4 A;  3ZMU A;  3QPL A;  1B72 A;  1GHC A;  1RPW A;  2VT2 A;  2DA5 A;  3EET A;  2H6B A;  1R9T J;  3QOP A;  4RB2 C;  4YIF A;  3PIO F;  2DA7 A;  1EKE A;  2QWW A;  2XF7 A;  2D5V A;  3JR9 A;  2PMZ N;  5E1W A;  1DP3 A;  2VOP A;  2IP2 A;  3PNV A;  1K7A A;  3M7G A;  1SFE A;  1U78 A;  1LPQ A;  3M8E A;  2BGC A;  3KEY A;  4BQO A;  4S05 A;  3OR2 C;  2JTV A;  1SAU A;  3IH2 A;  2BY1 A;  1Z21 A;  2BVM A;  3I5U A;  3O2P E;  4HW0 A;  2F2E A;  1AU7 A;  1DDN A;  1ETO A;  1XD7 A;  3KIO A;  2Z1D A;  2QKL B;  4LJZ F;  2MD0 A;  4ENK A;  2ELJ A;  1BC8 C;  2L54 A;  3JTG A;  4AIJ A;  4IEJ A;  2XGD A;  5GAE J;  2XHK A;  2V9K A;  2JA7 J;  2IAI A;  3FXU A;  1ZLJ A;  1UMQ A;  1O3T A;  1OR7 C;  2JWT A;  4II2 A;  2I10 A;  1ETQ A;  1TW2 A;  2QF7 A;  1JUS A;  1MBJ A;  4A0Z A;  2GWR A;  1BOB A;  3BZC A;  3VSK A;  4RM2 A;  4NHJ A;  4HF0 A;  2WB1 N;  4ZYD A;  1VZ0 A;  1D3Y A;  3TW6 A;  4DYC A;  5GAH J;  3UNG C;  3WOD F;  3G6E I;  3I64 A;  3AG2 H;  3ELK A;  4BXF A;  5CVU A;  5EGO A;  3X2Q H;  4XM3 A;  1AA7 A;  3S14 J;  3W2W A;  3FMS A;  4Q48 A;  2K9S A;  1LUJ B;  2UXN A;  2CU7 A;  2N8G A;  1UG2 A;  4PJM A;  1HXD A;  4C3H J;  4G6D A;  4XRF A;  2ZBK A;  4IXA A;  2CSO A;  2VOO A;  4AVP A;  2A6E F;  4PFO A;  3HSF A;  2HQN A;  2KDO A;  3E0J B;  1FSH A;  1ETV A;  2DOF A;  3CMY A;  3IAM 2;  2CH0 A;  1TQM A;  4L5J A;  1F4K A;  5CVJ A;  2F4M B;  3KEQ A;  1OCO H;  1MBH A;  5CKT A;  4XIC A;  4A3M J;  1VQ7 I;  2PI0 A;  3WGG A;  2WTE A;  1QPM A;  3HOS A;  1OYI A;  1R00 A;  2OJE D;  2Y0S N;  3HKZ A;  5M5X J;  4EJT A;  2E36 A;  1MMA A;  2EIL H;  1MMD A;  2VKH A;  5B1B H;  1LB2 A;  3GWZ A;  1I6X A;  4BQA A;  4IRH A;  2HOA A;  2M1B A;  3BP8 A;  2VQC A;  5CQE A;  2QBY B;  4BS9 A;  4PJ0 C;  5EEH A;  1A35 A;  1U6G A;  4A3B J;  4IQJ A;  4WCG A;  2HWV A;  4CGZ A;  1MNE A;  4LLN A;  1YJW I;  4U7D A;  1IG7 A;  5CYV A;  3F8C A;  3TGN A;  3NAR A;  4JQF A;  3ZMT A;  2EK5 A;  2BEO A;  3WTY C;  1G2H A;  4II3 A;  1ZK8 A;  2DO7 A;  3CCS I;  1Z7L A;  2O61 A;  1LQ1 A;  4JBA A;  1VND A;  4Q4Z F;  3CMA I;  2DQL A;  2VI6 A;  2R3S A;  4RDU A;  3T8T A;  4CXF A;  1LKX A;  4A12 A;  4NC7 A;  3E5U A;  3K2Z A;  2VPR A;  3KLO A;  2CUZ A;  4YFX F;  2OPT A;  3FM5 A;  2CV1 A;  4GO1 A;  2BVL A;  1SFU A;  3O6B B;  1F5T A;  3IH4 A;  3ZMD A;  2LOO A;  3Q3S A;  2WWY A;  1G6N A;  1W7P D;  1USS A;  2BHY A;  2KMU A;  1T38 A;  1FTT A;  4M9X A;  1D1B A;  2ZSI B;  2R7X A;  2BYV E;  2F48 A;  2P81 A;  5F04 A;  5C4J J;  4KDP A;  1I6H J;  4A5M A;  4PCQ A;  3HB9 A;  2DJI A;  2F5F A;  3GZ5 A;  1SMY F;  2EIJ H;  4DNC A;  4BNC A;  2P5K A;  3GFJ A;  2JQ7 A;  5JFR A;  3ML6 A;  2IRF G;  3KP7 A;  2FE3 A;  4XK4 A;  4BY1 J;  2M87 A;  3WTU C;  3M9A A;  2AQF A;  5F0H A;  3I54 A;  2FF4 A;  2LC2 A;  4BKX A;  4IO9 F;  3R0A A;  4I7H A;  2FOW A;  4FHT A;  2V1D A;  1Z3Y A;  4XON A;  3DKW A;  3C7J A;  5L3C A;  3C18 A;  1K4S A;  4X0G A;  3OIP A;  4G8X A;  3MEX A;  3SHF A;  3ZQF A;  2R92 J;  4EQQ A;  3VEP A;  4BQN A;  3GBG A;  4ZDO A;  2M30 A;  1ZG1 A;  1IV8 A;  3IAS 2;  1FC3 A;  3H9G A;  3C3W A;  1S7A A;  4BBS J;  2Y69 H;  5TGT A;  1SFO J;  2A6T A;  2DW4 A;  4IL6 C;  1QU3 A;  3HOU J;  2NYX A;  5D5W B;  3HOT A;  3C2H A;  1NH3 A;  1S7O A;  1JGS A;  2FQ3 A;  1STZ A;  1T98 A;  1ZGA A;  3SEQ A;  4CZZ A;  1PUF B;  3E6C C;  2KPM A;  4A69 C;  3WTX C;  1ZG5 A;  2VIX A;  3B73 A;  2R5Y B;  3QU6 A;  2JA2 A;  5AIP A;  3H5A A;  2HTS A;  1G8X A;  1T6S A;  2M8E A;  2YU3 A;  4FQG A;  1LFP A;  4QTR A;  4DIQ A;  2KZV A;  3HOV J;  2X85 A;  4XLH A;  4J19 A;  1P7I A;  2QUF A;  1BN5 A;  5FRN A;  2LY9 A;  3R60 A;  1OCR H;  2P4W A;  5GPA A;  1V3F A;  2TDX A;  1HOM A;  1W0T A;  2IS4 A;  2JJ7 A;  3KCC A;  4O6J A;  2VKD A;  4C3J J;  5IT9 K;  4CIC A;  3LA2 A;  3CUQ B;  2FMY A;  2K9L A;  1YRN A;  3KP6 A;  2QGU A;  5DTD A;  4BJ6 C;  1Z77 A;  1J75 A;  1ORK A;  3OSG A;  3GFI A;  4N4N B;  3TKY A;  2VL8 A;  3CUO A;  2D1V A;  2HOE A;  2Y75 A;  3OWT A;  1UST A;  3KZI C;  5IPA A;  4N4O B;  4J00 A;  1IXS B;  1JHF A;  2EFO A;  3L1P A;  2ZFU A;  3EUA A;  3FXK A;  5EEG A;  1L3L A;  3KZZ A;  4F3Q A;  2M5W A;  2PBI A;  2LY2 A;  1OYY A;  2Q0O A;  2E5N A;  5BPI A;  5EEA A;  3W3C A;  4HQE A;  2W85 A;  1SD5 A;  2DMP A;  3E5X A;  4I99 C;  4LB6 B;  1U5T B;  4UV9 A;  4KMF A;  1G3W A;  2CRG A;  1I50 J;  3H9J A;  1P92 A;  2X6X A;  3ABT A;  2DFI A;  1FY7 A;  4LG3 A;  1AKH B;  1GDT A;  3R6S A;  4BHC A;  2EFN A;  4B3X A;  2ISY A;  2MLG A;  4AM3 A;  2P7V B;  2ZXI A;  1YFH A;  3S1Q J;  1EH6 A;  3DFG A;  4BDY A;  2VE9 A;  2BOL A;  2V1X A;  3I3L A;  4RM3 A;  3S2D J;  2LSO A;  5E3M A;  1ZGJ A;  2VQL A;  1RKT A;  2FEZ A;  1LVK A;  1RNL A;  4I2O A;  4MTD A;  3V8L A;  4LLL A;  2L9N A;  3FZV A;  3B02 A;  1LJ9 A;  2CO5 A;  5DUI A;  2WAD A;  5F08 A;  4G6Q A;  5J6X A;  4OU0 A;  4XLN F;  3SJM A;  5B66 C;  3EYY A;  3V8K A;  4ESB A;  1MBF A;  2GOX B;  4CYC A;  2FU4 A;  3ULQ B;  2X48 A;  1U9O A;  2F6C A;  1OCP A;  1FIA A;  2L7K A;  4HZF A;  3ZQG A;  3K70 C;  4C2U A;  1ZRE A;  5JI6 A;  5K7H A;  3T8R A;  1BA5 A;  2I8D A;  2X1E A;  3LST A;  4PGH A;  3G1O A;  4N0B A;  2W4S A;  1YG2 A;  2XRN A;  4M6X A;  5KVR A;  1O4X A;  1TZL A;  2QEX I;  2O8X A;  4KN7 X;  2WV0 A;  2G9W A;  3BT9 A;  4BL0 B;  4NC6 A;  1RC9 A;  1SAN A;  3UR3 C;  3BPV A;  1TP4 A;  1P4W A;  1MBE A;  5DYM A;  1ZR4 A;  4BJ5 C;  4A3L J;  1BM9 A;  1QVU A;  4CHU A;  1WQ2 A;  4M73 A;  4CZC A;  4HST A;  1WHU A;  1S3J A;  4HDV A;  1H89 C;  1U9N A;  1ODD A;  5CVI A;  3BTJ A;  2JA6 J;  3K10 A;  2NAZ A;  1D8J A;  3S1M J;  4V2G A;  2TCT A;  5LGU A;  5L3F A;  3RQI A;  1VQO I;  2ZME C;  1F36 A;  1LVA A;  3REO A;  3CCL I;  3GTM J;  1WI9 A;  2MGQ A;  2RC4 A;  4QLC U;  3TDZ C;  1XDS A;  2JUC A;  2GQQ A;  3E6B A;  1IXR C;  4XL9 A;  4F93 B;  1MSF C;  3HOZ J;  3U21 A;  2NVX J;  1R49 A;  2MD5 A;  2NNN A;  1W36 C;  3BQY A;  1JKO C;  1IV6 A;  4EV0 A;  1NHA A;  4PZJ A;  1JKR C;  4Q5S F;  4ENN A;  4F55 A;  9ANT A;  5HS7 A;  3RKW A;  4OIR F;  4OWR B;  2Z16 A;  1YIJ I;  3HGY A;  2HVR A;  2P6S A;  1MDM A;  3KLN A;  2P5V A;  1XSV A;  4F92 B;  5ICG A;  2OF7 A;  5LGT A;  1UJ8 A;  1I39 A;  2CQQ A;  2DAO A;  2CW0 F;  2XGX A;  1FBU A;  5ERI A;  1T0F C;  1YOV B;  1PYV A;  4RGR A;  3AKZ A;  3K1P A;  2EV0 A;  3K0L A;  3ZCO A;  1U8B A;  4ANJ A;  5D5U B;  1FMV A;  4BE0 A;  4D0P A;  3BC8 A;  3HRT A;  2IGM A;  2Z2S B;  2CW8 A;  4MEX F;  5HS9 A;  3PIP F;  4HX8 A;  2E60 A;  3WE2 A;  1N77 A;  5K1Y A;  2V4J C;  2HR3 A;  1O3R A;  3RKQ A;  3E5Q A;  2VXD A;  2HFH A;  3D0S A;  3MVP A;  4V2F A;  4B47 A;  2HVS A;  4RB3 C;  4G7O F;  3HUG B;  2QCO A;  1YS6 A;  1FYL A;  1A36 A;  4MQV A;  3L2W A;  3RJP A;  1EH8 A;  3O8H A;  2BW3 A;  3FXM A;  2K3F A;  3ZN0 A;  3WGI A;  5GP9 A;  3KP2 A;  2BV6 A;  3R4K A;  1AOY A;  3P9C A;  3HSR A;  5JVG F;  4TV7 A;  1DGR M;  3GO5 A;  1MIJ A;  5AON A;  2WAQ A;  3SDG A;  1X58 A;  1S29 A;  3DP7 A;  1PJR A;  3K4N A;  4HPQ A;  2A61 A;  2F5D A;  3A02 A;  3EQL F;  4BJT A;  4XNF A;  4F91 B;  4LK1 F;  2XAG A;  1X1B A;  3H1C A;  2YUS A;  3BWG A;  3HG9 A;  2VJ5 A;  3ZMZ A;  2K27 A;  1APL C;  3CDH A;  4L9N A;  1SD4 A;  1IRX A;  1MJ9 A;  4JK1 X;  3Q9S A;  4ESF A;  2A5W A;  2LFB A;  1X3Z B;  3AG3 H;  3HOX J;  2KIS A;  4R8H A;  1JTY A;  2ICW G;  3DKY A;  1D5Y A;  1D1C A;  3WTV C;  2C6Y A;  1RR7 A;  5K5O A;  1TNS A;  1LEB A;  2BY3 A;  5BMZ A;  3HKZ N;  3QOD A;  3I56 I;  1SFK A;  4IQ4 A;  4ZC3 A;  2BZT A;  2LKX A;  2KFD A;  3QYB A;  2G0E A;  3OL4 A;  4B1R A;  1R4N B;  2QVO A;  2LBF A;  2Z5U A;  1ACI A;  4O3M A;  1NG6 A;  3KZY A;  1KU7 A;  2HNH A;  2PFB A;  3DCF A;  3OYF A;  4EM1 A;  4E7Z A;  4Y4R A;  2FD5 A;  1Z9C A;  1I1S A;  3C2G A;  4XLP F;  4UUS B;  3ZQL A;  2HS5 A;  4MQ9 F;  2DTZ A;  3WE3 A;  3H9Q A;  3V7R A;  4FT8 A;  3VOE A;  5DCM A;  3WG7 H;  5D4R A;  2PJP A;  1EF4 A;  5FLM J;  4IPA A;  1WJA A;  1NK2 P;  2Y2Z A;  4YRV A;  3BCB A;  4RLF A;  3N4M A;  3L7W A;  1SC7 A;  3V8J A;  1OYW A;  4D1Q A;  2VKE A;  4LLG F;  3FXO A;  5FRO A;  2VB6 A;  5GAG J;  1IAW A;  5J47 A;  3OYC A;  4A6D A;  4E7H A;  1TQI A;  2HYJ A;  1ZQ3 P;  2CV2 A;  3GZ6 A;  3BR1 A;  3QWL A;  3F72 A;  4E7J A;  3IRQ A;  3JSO A;  2M0M A;  2PG4 A;  2VC1 A;  3PM1 A;  4XR6 A;  4BEH A;  1ZLK A;  2GLO A;  2PJR B;  2COM A;  3VYT B;  4LB5 A;  2UWM A;  2FRH A;  4XRS A;  2ZO4 A;  2LNB A;  1W7P A;  2QLZ A;  4FE7 A;  1ERD A;  2IA0 A;  1QHH D;  5LRS A;  5BNG A;  3HPG A;  4A0Y A;  1TWG J;  2FNA A;  3GTK J;  3S16 J;  3G1M A;  3F8B A;  5H6Q A;  2Q2E A;  2R7F A;  3FBN B;  1FWZ A;  1HKS A;  1IN7 A;  3TQN A;  5IT3 A;  3H0D A;  2JVG A;  3DLA A;  1BIB A;  5M5W J;  4GCV A;  1TC3 C;  2V1U A;  1MBG A;  1SVO A;  2QQB A;  4EGY A;  2BBY A;  1P4X A;  3NAU A;  4Y13 A;  3E1S A;  1R58 A;  3KYC B;  3VYR B;  1YI2 I;  3U9G A;  1VI0 A;  1QBJ A;  2MA3 A;  3TL4 X;  2DFF A;  5IT9 Z;  1JI8 A;  1BR2 A;  3ECH A;  3N97 A;  3S3M A;  5DDG A;  3BJO A;  4B4C A;  1IDY A;  5HDN A;  1XTA A;  5IOY A;  5HDK A;  3RTR A;  2R5Z B;  1N75 A;  3QRF F;  2JPC A;  3V7C A;  2NRA C;  3ZR8 X;  1VTN C;  4KJZ A;  2CQ7 A;  4HRI A;  1J9I A;  2HPI A;  1SFX A;  1O3S A; 
#chains in the Genus database with same CATH homology
 4BXU A;  2KKO A;  2KIM A;  1BC7 C;  1YYV A;  1P2F A;  5DV5 A;  2HDC A;  1B4A A;  1J5Y A;  2PEX A;  1Z7U A;  5HLG A;  1KA8 A;  1U3E M;  4GGG A;  3QU3 A;  1CF7 A;  4M72 A;  3HRS A;  4N9H A;  1J2X A;  5D6E A;  3OV8 A;  3LQQ A;  2HKO A;  2FBK A;  4L5I A;  4WXH A;  1YO5 C;  3K9T A;  2KIU A;  3HTU A;  2FA5 A;  1ON1 A;  4LK0 F;  3RI4 A;  3SZT A;  1EH7 A;  4IVN A;  4Y15 A;  3HTS B;  1DUX C;  5D5X B;  3KP5 A;  2B0L A;  3NRV A;  2A68 F;  4KIG A;  2Q8K A;  4I01 A;  2A3S A;  1R5H A;  1G3S A;  3BPX A;  2DQR A;  1O7L A;  2W57 A;  2IJL A;  1R1U A;  3ABU A;  5JVT A;  3CO6 C;  3T5X A;  2H94 A;  2XAH A;  4EVI A;  3ROU A;  1KU2 A;  1IXC A;  4MNU A;  1WKM A;  1RIO H;  1IUY A;  2PN6 A;  5DCF A;  3MAJ A;  1OMI A;  2ZNZ A;  2FBI A;  4EJU A;  1MJB A;  5LHI A;  2LKP A;  2IA2 A;  1X3U A;  3GFM A;  4BAY A;  5H6R A;  4P9F A;  5BOX A;  2KIF A;  1K79 A;  2F5C A;  2V9V A;  2GA1 A;  1HW2 A;  3CUQ C;  1R7J A;  2DK5 A;  2XAS A;  1GVJ A;  3C1D A;  3RKX A;  1XGN A;  4A6E A;  4R79 A;  2DK8 A;  2K7L A;  3G73 A;  4HF1 A;  1IRF A;  3EDP A;  1KQ8 A;  5L3D A;  4ZYE A;  4XSZ F;  2VXZ A;  1U5T C;  1XB4 A;  3CLO A;  3J81 K;  2HGC A;  3KEO A;  1RZ4 A;  2EV6 A;  3PQK A;  3T1B A;  3QPT A;  1T2K A;  4IHT A;  3H3Z A;  3IKT A;  5BS6 A;  3GEZ A;  1LDK B;  1K78 A;  2EFW A;  4IRG A;  3DXJ F;  1KU3 A;  5D6F A;  4KIC A;  1FOK A;  4HLX A;  1A04 A;  5D8K B;  3QP6 A;  3ZMV A;  2XV4 S;  5ILV A;  1U2W A;  5FFZ A;  1QNT A;  1YIO A;  5CVR A;  4ENM A;  1TNT A;  2ZFW A;  3RPQ A;  4WF2 A;  1GXP A;  5LEJ A;  2XIG A;  3GF2 A;  5FO5 A;  3I59 A;  4U7B A;  4BHB A;  4HX7 A;  2GAU A;  5BPD A;  2K02 A;  2HYG D;  1LNW A;  4EJV A;  5D5V B;  4WWC A;  4M9Z A;  4KNY A;  2QQ9 A;  1Z91 A;  2F5E A;  4EMS A;  3HIF A;  4ON0 A;  2D2W A;  1G3Y A;  1J59 A;  3MZY A;  3I71 A;  4LMY A;  3BOQ A;  4HX4 A;  1R1V A;  1U8R A;  5F6F A;  4KA4 A;  3WG9 A;  3S2W A;  3IWZ A;  4KT5 C;  4Q47 A;  2A6H F;  2HZT A;  2ZKZ A;  4YFK F;  5FD6 A;  2EJR A;  1OR7 A;  4I0A A;  4AIH A;  2HQR A;  2DBB A;  4YII A;  3DPL C;  4I09 A;  2WC2 A;  1PDN C;  1IN5 A;  4IRI A;  2DLL A;  4L0Y B;  4I0B A;  1TLH B;  1B59 A;  4HA8 A;  4BH9 A;  2Z99 A;  2MH2 A;  2L4M A;  2E7W A;  1HKQ A;  2NS0 A;  2HKX A;  1UHM A;  1EV7 A;  4EM2 A;  2HYF A;  5H20 A;  1BJA A;  4NQW A;  4AD9 A;  3K69 A;  2H6C A;  4HLY A;  5DD4 A;  1QGP A;  2VOD A;  3I4P A;  2P8T A;  2OU2 A;  3BZ6 A;  5LLQ A;  5AIQ A;  1ZH5 A;  3L9F A;  2QEN A;  2OQR A;  3LFK A;  1IW7 F;  1MJA A;  3QP5 A;  4WX9 A;  4RGX A;  3M8F A;  5E18 F;  4RAY A;  2YR2 A;  1YS7 A;  3LA7 A;  1IN8 A;  1S6L A;  2OAZ A;  2LDU A;  3BJ6 A;  1BI0 A;  2O0Y A;  2PMU A;  1XN7 A;  2CWE A;  2ESH A;  3FXR A;  3H92 A;  4OIN F;  4H0E A;  3JTH A;  2K4J A;  4OIO F;  5LHG A;  2DU9 A;  5E17 F;  1FBQ A;  1MDM B;  2XAQ A;  4RGS A;  2OA4 A;  4ZH4 F;  3ECO A;  3U1D A;  1PP8 F;  2GXB A;  5FGM A;  3RYR A;  1R5G A;  2EA2 A;  2O3F A;  3LA3 A;  5E20 A;  2HTJ A;  4I02 A;  4M74 A;  3TDU C;  4ZZL A;  1ZYR F;  3I53 A;  2PQ8 A;  3WTZ A;  2R7D A;  2ESN A;  2L02 A;  3MCZ A;  2M45 A;  2V79 A;  2DI3 A;  2ELH A;  3IL2 A;  3H3U A;  3PFI A;  5LRR A;  3DPT A;  4L0Z B;  1MD0 A;  1OPC A;  1FYK A;  3ZMS A;  2P6T A;  2AXL A;  3J80 K;  1ZHF A;  5ICC A;  4LG0 A;  1E17 A;  1QZY A;  3MFK A;  1QZZ A;  3FMQ A;  2MH9 A;  4IF4 A;  1J7K A;  2VBW A;  3JAM K;  3GX4 X;  3F21 A;  4GYI A;  2D45 A;  4OMY A;  1R1T A;  1XCV A;  1YW8 A;  5A2Q K;  4BYY A;  3FX3 A;  3V4G A;  3J81 Z;  5F1R A;  3NQO A;  1Q1H A;  5BQT A;  1I27 A;  5JHU A;  1BOA A;  5FFX A;  1R36 A;  3FF5 A;  3ZQ7 A;  2EFQ A;  3E97 A;  1HBX G;  1B9M A;  2VT3 A;  2MLK A;  2VN2 A;  2ISZ A;  5CVV A;  1JHH A;  1UB9 A;  2A69 F;  3F6O A;  3T0Y A;  4FX0 A;  4B09 A;  2FBH A;  3ZN1 A;  4UVA A;  3L09 A;  1ZAO A;  1WWX A;  2AS5 F;  1DP7 P;  1V4R A;  3P9I A;  3VOD A;  1H9T A;  1W7P B;  3R61 A;  5LHH A;  3LQR A;  2LF7 A;  1W4M A;  1YW7 A;  6PAX A;  4OOI A;  2XKP A;  3HRM A;  2VC0 A;  3VB2 A;  4HOB A;  1YTY A;  3BRO A;  4FX4 A;  1ZN2 A;  3TO9 A;  5FD5 A;  2L4A A;  4ETS A;  2EWN A;  4G7Z F;  3AAF A;  4WK8 F;  4P5O A;  4L18 B;  1FBS A;  1HW5 A;  4LGW A;  4UVB A;  2FXA A;  4PGG A;  4KFC A;  1FX7 A;  2ZME A;  3E6M A;  4RB0 A;  3J7A O;  2W25 A;  1IN4 A;  3O3K A;  4CYD A;  1XMA A;  1CF7 B;  2VBX A;  3IC7 A;  5L3G A;  1B6A A;  4S04 A;  2RGV A;  1FZP B;  4HAM A;  3WTT C;  5HLI A;  5LBQ A;  3OOP A;  1TW3 A;  2RNJ A;  1J0R A;  1RI7 A;  1XSX A;  1T0F A;  1H0M A;  4CDG A;  2P5L C;  3F3X A;  2JSC A;  4KUM A;  1CGP A;  4N9I A;  3EUH A;  5TRD A;  2IPQ X;  1W5S A;  2QQA A;  5DD8 A;  2OZU A;  5L3B A;  2CGP A;  3GFL A;  2KRF A;  2DT5 A;  4QWQ A;  4U0W A;  2STT A;  1ZRF A;  2JRT A;  2CG4 A;  1R22 A;  2IVM A;  3WTS C;  1L0O C;  2PLY A;  3TO7 A;  1P4A A;  3HRU A;  3ZPL A;  2RN7 A;  4MGR A;  3TOB A;  1FP2 A;  2Y48 A;  1UCR A;  1XMK A;  3RDI A;  4P55 A;  2X4H A;  1HW1 A;  2XUB A;  4ZYH A;  5F64 A;  1SD7 A;  1LDD A;  1SMT A;  1ON2 A;  2FNP A;  3WU0 A;  1Z6T A;  5CJ9 A;  4A2U A;  3F6V A;  4O5V A;  3E3V A;  1KGS A;  2XAF A;  2G7H A;  1XCB A;  3ZP5 A;  5JR3 A;  4UNO A;  4HQM A;  2FML A;  2RV8 A;  3V7S A;  3HYI A;  2VBY A;  4U0Y A;  1RUN A;  1XGM A;  1KYZ A;  5ILS A;  3FMR A;  2ZNY A;  4Y17 A;  1HST A;  1TQP A;  3D5L A;  3SXY A;  3RKY A;  4HBL A;  1MGT A;  5E1X A;  2BE5 F;  1K78 B;  1C0W A;  3ISP A;  3MWM A;  3CJN A;  3J80 Z;  5FLX K;  1FT9 A;  2VON A;  2O6G E;  4IHS A;  2JZY A;  3GW2 A;  3SQN A;  3JAM Z;  1DPR A;  1JXS A;  4RB1 A;  2CQK A;  4L9J A;  1O57 A;  5ED4 A;  5A2Q Z;  3KFW X;  3WGH A;  3I59 B;  5D4S A;  3LWF A;  2QBY A;  1TTY A;  3M1E A;  4UXN A;  2XVC A;  4I98 B;  5ILU A;  1R23 A;  1MKM A;  2VBZ A;  3JSP A;  1KYW A;  3CO7 C;  4ESJ A;  4KYW A;  3KET A;  4LD5 A;  5DUK A;  5E1Z B;  2QZ8 A;  1TBX A;  5HOO A;  4HDU A;  2E1C A;  1QQI A;  1UHW A;  4OIQ F;  1KQ0 A;  4E70 A;  4OMZ A;  4F7Z A;  2L3D A;  4P9U A;  4L9T A;  4R1H A;  1FP1 D;  4RS8 A;  4G94 A;  1REP C;  1YLF A;  3QPH A;  3U2R A;  3P7N A;  3I58 A;  1WRJ A;  1KQ9 A;  2HEO A;  2RDP A;  4U88 A;  5L3E A;  4AWX B;  1G3T A;  4XSX F;  4UVC A;  5CLS A;  1K6O A;  1D5V A;  1QO0 D;  1H9G A;  5ICE A;  4BHP A;  1FLI A;  3R0J A;  2YX4 A;  5E8G A;  3LAJ A;  4P96 A;  2VE8 A;  1YW9 A;  2P7C B;  2ADU A;  2Z33 A;  1S8N A;  3BJA A;  3BY6 A;  2H27 A;  1W5T A;  3FXQ A;  2QYO A;  3DQV C;  1Z1D A;  2JPB A;  1XSD A;  1SD6 A;  2D1H A;  2Z9O A;  1ZRC A;  2RVC A;  2KJB A;  4ZZD A;  2E7X A;  4RGU A;  2EB7 A;  4WXD A;  1XGO A;  3L2C A;  5DEQ A;  3IKV A;  5HVQ C;  5LEK A;  4MTE A;  3CUQ A;  2FOK A;  3WTW C;  3F23 A;  4KIF A;  3RYP A;  4M9S A;  2MBF A;  4EM0 B;  1BIA A;  3PQJ A;  4EGZ A;  4WXC A;  1PUE E;  3EYI A;  2YPR A;  5J8C A;  3FWE A;  1HKT A;  2GZW A;  2FSW A;  4EJO A;  2IA1 A;  3HSE A;  1U5T A;  1Z6R A;  3IRR A;  3RIR A;  4U0V A;  3E6D A;  4UUV A;  2ZXJ A;  3L00 A;  3K1N A;  4IJA A;  2ZCW A;  2J5P A;  1ULY A;  2LF8 A;  4A5N A;  3GLX A;  1FYM A;  3I0T A;  2W84 A;  4OIP F;  2A5Y B;  4G7H F;  2XKO A;  2V6C A;  4ENJ A;  3WU1 B;  3KP4 A;  2GA2 A;  4G9Y A;  2DTR A;  5LGN A;  3GYH X;  3IWF A;  2QM3 A;  2W24 A;  3TOA A;  5KK1 A;  5D8L B;  3HHG A;  3IHU A;  2Z3Y A;  5FB2 A;  2XRO A;  1F9N A;  3RPU A;  2L01 A;  4CO8 A;  4M71 A;  1Z05 A;  5K5R A;  3F8F A;  3F8M A;  3FHZ A;  2MC3 A;  2X0L A;  4LG0 B;  1IF1 A;  2UXX A;  1WSU A;  2K86 A;  4UHT A;  1FPQ A;  4HV5 A;  4L9V A;  3CTA A;  5K5Q A;  4HV6 A;  2OBP A;  4ASN A;  1B9N A;  2ACJ A;  4PDK A;  1G4D A;  1XGS A;  1ZG3 A;  3SZP A;  4EJW A;  1IN6 A;  5HDG A;  2Y0M A;  1D8K A;  3MZH A;  1BI2 A;  3Q5F A;  2KJC A;  5FLX Z;  2OD5 A;  4UV8 A;  1HSJ A;  4GXO A;  3DV8 A;  1Y0U A;  3VFZ A;  1AWC A;  2GIV A;  4ZYG A;  1XDU A;  4HF2 A;  1YQA A;  3W6K B;  1IZ1 A;  1DPU A;  2CYY A;  5DCM B;  1LEA A;  4LFU A;  3P9K A;  5J8F A;  3HUG A;  3K1M A;  2XAJ A;  3ERE D;  1RUO A;  4GYG A;  1I1G A;  2E1N A;  1T39 A;  2A07 F;  1I5Z A;  3GXO A;  4MEY F;  1GXQ A;  3DEU A;  1ZAR A;  1MZB A;  1BI3 A;  3NEU A;  2YX7 A;  1ZRD A;  1IRG A;  2K4B A;  1BI1 A;  3BDD A;  4KIB A;  2IW5 A;  4XBF A;  2H09 A;  2OQG A;  2EFP A;  3JW4 A;  2ZME B;  3SFZ A;  4M6Y A;  5TJJ A;  4A0X A;  4HYE A;  1OKR A;  3GUD A;  3MQ0 A;  1F1Z A;  1O7F A;  2GXG A;  3QAH A;  2ZJ2 A;  1LDJ A;  5ICF A;  2NNY A;  4YFN F;  2CFX A;  2IT0 A;  3HHH A;  3FM3 A;  2EV5 A;  3DF8 A;  2DPU A;  2OZ6 A;  1HQC A;  2RKH A;  5E8I A;  2UZK A;  4RAZ A;  5HS8 A;  4YG2 F;  2G7U A;  3TO6 A;  2STW A;  4B8X A;  1UFM A;  1JE8 A;  2PMH A;  1SAX A;  4K2E A;  4AIK A;  2RQP A;  3LAP A;  1ONV A;  1BBY A;  3Q9V A;  4KMU X;  3COA C;  2O03 A;  2ETH A;  2JT1 A;  2DPD A;  3W6J B;  3F22 A;  1P6R A;  2J5O A;  3KE2 A;  3GVA A;  1FSE A;  4KN4 X;  4DQ2 A;  1E2X A;  4MHG A;  4Z2Y A;  1KU9 A;  5HLH A;  2EA4 A;  3G3Z A;  3F8N A;  1PP7 U;  1O3Q A;  3KP3 A;  1B1B A;  2YSR A;  1FNN A;  4NB5 A;  3ZMU A;  1GHC A;  2VT2 A;  3EET A;  2H6B A;  3QOP A;  4RB2 C;  4YIF A;  2QWW A;  5E1W A;  2VOP A;  2IP2 A;  1K7A A;  3M7G A;  1SFE A;  1U78 A;  3M8E A;  2BGC A;  4S05 A;  2JTV A;  4HW0 A;  3I5U A;  3O2P E;  2F2E A;  1DDN A;  1XD7 A;  4LJZ F;  4ENK A;  1BC8 C;  2L54 A;  3JTG A;  4AIJ A;  2XHK A;  3FXU A;  1ZLJ A;  1O3T A;  1TW2 A;  4A0Z A;  2GWR A;  4NHJ A;  4HF0 A;  4ZYD A;  1D3Y A;  3WOD F;  3I64 A;  3ELK A;  5CVU A;  3FMS A;  4Q48 A;  2UXN A;  1HXD A;  4G6D A;  4XRF A;  2ZBK A;  4IXA A;  2CSO A;  2VOO A;  4AVP A;  2A6E F;  3HSF A;  2HQN A;  1FSH A;  1TQM A;  4L5J A;  1F4K A;  5CVJ A;  3KEQ A;  2PI0 A;  3WGG A;  2WTE A;  1QPM A;  3HOS A;  1OYI A;  1R00 A;  4EJT A;  1LB2 A;  3GWZ A;  1I6X A;  4BQA A;  4IRH A;  2M1B A;  3BP8 A;  2QBY B;  5EEH A;  1U6G A;  4WCG A;  2HWV A;  4CGZ A;  4LLN A;  4U7D A;  5CYV A;  3F8C A;  3TGN A;  4JQF A;  3ZMT A;  2EK5 A;  2BEO A;  3WTY C;  2DO7 A;  2O61 A;  1LQ1 A;  4JBA A;  4Q4Z F;  2DQL A;  2R3S A;  3T8T A;  4CXF A;  4A12 A;  3E5U A;  3K2Z A;  3KLO A;  4YFX F;  3FM5 A;  4GO1 A;  1SFU A;  3O6B B;  1F5T A;  3ZMD A;  2WWY A;  1G6N A;  1W7P D;  1USS A;  1T38 A;  4M9X A;  2BYV E;  4KDP A;  4A5M A;  4PCQ A;  2F5F A;  3GZ5 A;  1SMY F;  4DNC A;  4BNC A;  2P5K A;  3GFJ A;  5JFR A;  3ML6 A;  2IRF G;  3KP7 A;  2FE3 A;  2M87 A;  3WTU C;  3M9A A;  3I54 A;  2FF4 A;  3R0A A;  4I7H A;  4FHT A;  2V1D A;  3DKW A;  3C7J A;  5L3C A;  3C18 A;  4G8X A;  3MEX A;  3SHF A;  4EQQ A;  3VEP A;  2M30 A;  1ZG1 A;  1FC3 A;  3C3W A;  1S7A A;  2DW4 A;  2NYX A;  5D5W B;  3HOT A;  1S7O A;  1JGS A;  2FQ3 A;  1STZ A;  1T98 A;  1ZGA A;  4CZZ A;  3E6C C;  3WTX C;  1ZG5 A;  3B73 A;  3QU6 A;  5AIP A;  2HTS A;  1T6S A;  2M8E A;  2YU3 A;  2QUF A;  1BN5 A;  3R60 A;  2P4W A;  1V3F A;  2TDX A;  3KCC A;  4O6J A;  5IT9 K;  4CIC A;  3LA2 A;  3CUQ B;  2FMY A;  3KP6 A;  1J75 A;  3GFI A;  3TKY A;  3CUO A;  2D1V A;  2HOE A;  2Y75 A;  1UST A;  1IXS B;  1JHF A;  2EFO A;  5EEG A;  1L3L A;  3KZZ A;  2M5W A;  2PBI A;  1OYY A;  2Q0O A;  5BPI A;  4HQE A;  2W85 A;  1SD5 A;  3E5X A;  4LB6 B;  1U5T B;  4UV9 A;  4KMF A;  1G3W A;  1P92 A;  3ABT A;  2DFI A;  1FY7 A;  3R6S A;  4BHC A;  2EFN A;  2ISY A;  2MLG A;  2P7V B;  1YFH A;  1EH6 A;  3DFG A;  2VE9 A;  2V1X A;  2LSO A;  1ZGJ A;  2FEZ A;  1RNL A;  4I2O A;  4MTD A;  3V8L A;  4LLL A;  3FZV A;  3B02 A;  1LJ9 A;  2CO5 A;  5DUI A;  4G6Q A;  5J6X A;  4OU0 A;  4XLN F;  3EYY A;  3V8K A;  4ESB A;  2FU4 A;  3ULQ B;  4HZF A;  1ZRE A;  5JI6 A;  3T8R A;  3LST A;  4PGH A;  4N0B A;  1YG2 A;  2XRN A;  4M6X A;  5KVR A;  2O8X A;  4KN7 X;  2WV0 A;  2G9W A;  3BPV A;  1P4W A;  5DYM A;  1BM9 A;  4CHU A;  1WQ2 A;  4M73 A;  1S3J A;  4HDV A;  1ODD A;  5CVI A;  1D8J A;  2NAZ A;  5LGU A;  5L3F A;  3REO A;  1LVA A;  1WI9 A;  2RC4 A;  4QLC U;  3TDZ C;  1XDS A;  2GQQ A;  3E6B A;  1IXR C;  2MD5 A;  2NNN A;  4EV0 A;  1NHA A;  4PZJ A;  4Q5S F;  4ENN A;  5HS7 A;  3RKW A;  4OIR F;  2P6S A;  1MDM A;  3KLN A;  2P5V A;  1XSV A;  5ICG A;  5LGT A;  2XGX A;  2DAO A;  2CW0 F;  1FBU A;  5ERI A;  4RGR A;  3K1P A;  2EV0 A;  3K0L A;  5D5U B;  4D0P A;  3HRT A;  4MEX F;  5HS9 A;  4HX8 A;  3WE2 A;  5K1Y A;  2HR3 A;  1O3R A;  3E5Q A;  3D0S A;  2HFH A;  4RB3 C;  4G7O F;  1FYL A;  1YS6 A;  4MQV A;  3RJP A;  1EH8 A;  3ZN0 A;  3WGI A;  3KP2 A;  2BV6 A;  3R4K A;  1AOY A;  3P9C A;  3HSR A;  4TV7 A;  3GO5 A;  5AON A;  1S29 A;  3DP7 A;  2A61 A;  2F5D A;  3EQL F;  4LK1 F;  2XAG A;  3BWG A;  3ZMZ A;  2K27 A;  3CDH A;  4L9N A;  1SD4 A;  1MJ9 A;  4JK1 X;  3Q9S A;  4ESF A;  4R8H A;  3WTV C;  2C6Y A;  5K5O A;  1TNS A;  1LEB A;  5BMZ A;  2QVO A;  2Z5U A;  4O3M A;  3KZY A;  1KU7 A;  2PFB A;  4EM1 A;  1Z9C A;  1I1S A;  4XLP F;  2HS5 A;  4MQ9 F;  3WE3 A;  3V7R A;  4FT8 A;  3VOE A;  5DCM A;  5D4R A;  2PJP A;  4IPA A;  3N4M A;  3L7W A;  3V8J A;  1OYW A;  4LLG F;  1IAW A;  4A6D A;  1TQI A;  3GZ6 A;  3F72 A;  3IRQ A;  3JSO A;  2PG4 A;  2VC1 A;  1ZLK A;  2COM A;  4LB5 A;  2UWM A;  2FRH A;  2ZO4 A;  2LNB A;  1W7P A;  2QLZ A;  2IA0 A;  5LRS A;  4A0Y A;  2FNA A;  3F8B A;  5H6Q A;  2Q2E A;  2R7F A;  1FWZ A;  1HKS A;  1IN7 A;  3TQN A;  5IT3 A;  2V1U A;  1BIB A;  4GCV A;  2QQB A;  4EGY A;  2BBY A;  1P4X A;  4Y13 A;  1R58 A;  5IT9 Z;  3U9G A;  1QBJ A;  2MA3 A;  3ECH A;  3N97 A;  5DDG A;  3BJO A;  5HDN A;  5HDK A;  3RTR A;  3QRF F;  2JPC A;  3V7C A;  2NRA C;  1VTN C;  1J9I A;  1SFX A;  1O3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...