3ZMDA

Crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
148
structure length
148
Chain Sequence
TRWLTDTEQCAWRTHLEVNRLLTHQLEKDLQPFGLTMNDYEILVNLSESEGDRMRMSDLATATMQSKSRLSHQITRMENANLVRRENCESDRRGLFAVLTEHGLETMRKVAPHHVASVRRHFIDLLAPEDLTELDKALKPIAEHLRGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Absc, a Marr Family Transcriptional Regulator from Streptomyces Coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords PUTATIVE TRANSCRIPTIONAL REGULATOR
total genus 54
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zmdA00
5E1WA 3GFIA 1PDNC 1MZBA 4WK8F 2NYXA 2CQKA 4HDVA 4IPAA 3LQRA 3KLOA 1TBXA 4KA4A 2H09A 2Y0MA 3H3UA 1YW8A 3J81Z 3E5QA 1ODDA 1HBXG 1BI2A 3F8MA 3LAJA 1LB2A 1E17A 1ULYA 1KYWA 1R36A 4R1HA 1OYIA 2P6SA 1ZRDA 2ADUA 1XSDA 4KN7X 5DD8A 4JK1X 4KIFA 2VOOA 2E1CA 4JQFA 4KNYA 3IWZA 6PAXA 3D5LA 4P9FA 3RPQA 2UWMA 4KN4X 2A6HF 3KP2A 2ZNZA 2BE5F 1W7PD 2L02A 3WTUC 4XBFA 1J5YA 1HW5A 5DCFA 3WE2A 3L2CA 3R0AA 3Q9SA 4I0AA 4CICA 3LA7A 1RUNA 2R7DA 1PUEE 5ED4A 4LLNA 1VTNC 3HSRA 5LEJA 3G73A 5ICFA 2BYVE 2AXLA 3MEXA 1UB9A 3L09A 2IA2A 2EFOA 4A5MA 3FX3A 1LJ9A 1FP2A 3M8FA 3WGIA 1EH7A 5CVVA 1SFXA 4ESFA 2ELHA 3ABUA 3E97A 2GA1A 1B4AA 3LSTA 3FF5A 4IHSA 4A0YA 1W7PA 2K02A 4EM0B 3F8BA 4HW0A 2M8EA 5ICGA 5D5VB 4RAZA 1SFEA 4M9SA 4LLLA 3JW4A 3MFKA 4M6XA 3RDIA 2P5LC 2XUBA 2D45A 1G3SA 4LLGF 3ECHA 4HZFA 4U7BA 2PFBA 3ZPLA 4LD5A 4L9NA 3BPXA 1P2FA 4M9XA 2FA5A 2K4BA 3WU1B 4EJWA 5FD6A 4L0YB 5BQTA 2CGPA 5LLQA 5ICEA 4MQ9F 2ZBKA 1S7AA 4P5OA 2FU4A 1XSVA 1FLIA 5LGNA 1FYMA 1I5ZA 1ZLKA 3BJAA 3JTGA 5LHIA 3U9GA 3REOA 2VC0A 3TGNA 5J8FA 4PCQA 3T0YA 1MJBA 3EQLF 1J7KA 5K5QA 2L4MA 3FMRA 3RKWA 2ETHA 1W5SA 3M9AA 1H9TA 2PEXA 2Z99A 2V6CA 4M73A 3WTWC 1BM9A 1F4KA 3K2ZA 2JTVA 4UVAA 3JSPA 4OMYA 1DUXC 3SFZA 5LRSA 3R0JA 4ENJA 4MTEA 4DQ2A 3FXRA 1TTYA 5D5WB 1LVAA 2KRFA 4GCVA 3NQOA 3HRTA 3WE3A 2O61A 5D5XB 2OQRA 2QQ9A 4G8XA 2V79A 2X4HA 5D8LB 5JFRA 2BEOA 5HVQC 1LDDA 4A2UA 4OIPF 1ONVA 4LB6B 1QQIA 2BV6A 2VODA 1FZPB 1XSXA 4CO8A 4GGGA 2D1HA 5HDGA 5KVRA 1U5TA 2KJCA 1HQCA 5E8GA 1HKTA 2DW4A 2XHKA 1A04A 2MLGA 5F64A 2NNYA 3RYPA 2ZKZA 3KFWX 2HEOA 1MD0A 5BPDA 5D8KB 3ZMVA 1G4DA 2OBPA 2FOKA 1R1UA 2P7CB 3FZVA 4KUMA 4ETSA 1Y0UA 1K6OA 1YW7A 2RDPA 2XAQA 1ZLJA 4YIFA 3QU3A 4KIBA 1IRFA 3L00A 1O7FA 1XDSA 4EM2A 5BS6A 4MQVA 3V4GA 1DDNA 1ZN2A 2PI0A 3F6OA 3V8LA 4ESBA 4AIHA 3HOSA 4O3MA 3WGHA 1IN8A 3N97A 2MC3A 3ZQ7A 3KP4A 4B8XA 2WTEA 4ON0A 4OOIA 1QGPA 3QAHA 3ZMDA 3V7CA 1OYWA 3ZN0A 4AD9A 3VOEA 1BOAA 2D1VA 4P96A 3IRQA 2XAHA 4ZYHA 4RAYA 2V1UA 2F2EA 2FEZA 1RZ4A 2EV0A 1K79A 2K86A 5LGTA 4G7ZF 1ZHFA 3I71A 4WXHA 2OAZA 2YPRA 3WTTC 4XRFA 1I27A 2LF7A 2HR3A 2QM3A 3J7AO 1C0WA 4ZZLA 2WWYA 4HDUA 4LJZF 1REPC 1U2WA 3NRVA 4LGWA 1TQIA 2A68F 1ZAOA 5L3GA 1DP7P 1RNLA 2LNBA 2DI3A 3ZMZA 2QBYA 1U8RA 1R1VA 2DK8A 3LFKA 1FYLA 2GZWA 4RGRA 1S6LA 1YYVA 2FMYA 4EJTA 3BROA 1R00A 2DQRA 1KU9A 1T6SA 2QYOA 4Q5SF 2QENA 1YQAA 3CJNA 1WKMA 1BIBA 2C6YA 3KP5A 3K69A 4RS8A 3HHHA 2HFHA 4ZYEA 1IN6A 3HRMA 4I7HA 4CXFA 5HDNA 4ZYDA 1XMKA 2STTA 4Q4ZF 2NRAC 2P7VB 3R61A 3C7JA 2HYFA 3KE2A 5LBQA 1SFUA 2L3DA 2UZKA 2FE3A 3M1EA 1FBSA 2E1NA 1JHFA 1JHHA 4BQAA 3L7WA 1NHAA 3VODA 1ON1A 1STZA 2J5PA 4RB3C 2EFNA 2XASA 2OA4A 5E1ZB 4XLNF 1ZG3A 1R22A 2Z5UA 4HBLA 1DPUA 3C18A 4OIQF 3MQ0A 2IPQX 1HKQA 4RB0A 4H0EA 3IHUA 4M74A 4MEXF 4HF2A 1LEBA 5H6RA 3G3ZA 3MWMA 3TOAA 5H20A 2MH9A 5HLIA 2XIGA 4DNCA 2QVOA 1TNSA 5DDGA 1KQ0A 1LQ1A 3M7GA 2RKHA 2VOPA 2YSRA 2CO5A 4M72A 3E5XA 5TJJA 2QLZA 2DBBA 3CUOA 2NAZA 5DCMA 2GXGA 3RKYA 2GXBA 5CVUA 5K5RA 4R8HA 3K1PA 1ZREA 1Z7UA 3KLNA 4EM1A 5BOXA 1J2XA 4K2EA 1T2KA 1W5TA 2YU3A 1G3TA 1HSJA 2A61A 2ZMEB 4FHTA 1B9MA 1KGSA 4KFCA 4EJVA 1IN4A 5HLGA 1USTA 2Q0OA 4L9VA 1FNNA 1J9IA 1ZGAA 1G3YA 4EVIA 3JAMK 1F1ZA 3DPLC 3MZYA 1MDMB 3CUQB 3TO6A 2KIMA 5L3CA 3ROUA 1CF7B 4FX0A 5DCMB 2G9WA 3Q9VA 1ZGJA 1HKSA 1RI7A 3DFGA 5DD4A 1J59A 3GF2A 1O3TA 2ZO4A 1O3SA 4KYWA 1GXPA 4HV5A 3RIRA 4FX4A 4HLXA 4Y13A 3SZPA 3O6BB 2M1BA 3W6JB 3QPTA 4BHCA 5EEHA 2VBZA 4RGSA 3J80K 3O3KA 3TO9A 3E6DA 2PQ8A 5ICCA 3CUQA 3ML6A 5CVIA 2F5DA 4OU0A 2P5KA 3Q5FA 2RNJA 3ERED 5L3DA 2O8XA 2O03A 1G6NA 2IW5A 4PZJA 3DXJF 3K0LA 3ISPA 4AWXB 1FPQA 2Y48A 1D5VA 1Q1HA 4LMYA 1BJAA 1KA8A 2HQRA 5CYVA 2CWEA 2FNPA 2W25A 2ZMEA 4UHTA 4EGYA 2P5VA 1P92A 1AWCA 2HKXA 4YFNF 3GXOA 1LDJA 4BHBA 4U0YA 4IXAA 1OYYA 4IRIA 5LEKA 2DT5A 5EEGA 2R7FA 3S2WA 3TKYA 1OR7A 3KEOA 3HRUA 4EQQA 2E7WA 4HOBA 2XKOA 4PGHA 3I5UA 2RQPA 3SHFA 1IRGA 2O3FA 4N9IA 4G94A 3FMQA 3F21A 2QQBA 1BI3A 4WXDA 4U0WA 2IA1A 3C3WA 3BJOA 4BNCA 2P4WA 1KQ9A 3HIFA 3V8KA 3GX4X 1FOKA 2FXAA 1FT9A 2JPCA 2ACJA 2WC2A 1XD7A 2J5OA 3HSFA 3J80Z 5L3EA 1DPRA 2VBWA 2DU9A 2DAOA 4KT5C 4ZYGA 3EYIA 4Z2YA 2KIFA 4ASNA 3WU0A 4HQEA 3J81K 2E7XA 4R79A 5HS7A 5FO5A 3KP7A 1XGNA 2HQNA 5DEQA 4HX7A 2OZUA 3ZN1A 3CO7C 3I54A 1X3UA 5LHGA 3LAPA 5LRRA 4XSZF 2PMUA 3IKTA 2IA0A 5E8IA 3E3VA 1MDMA 2HZTA 4I02A 1MJAA 1XCVA 2LF8A 3V7RA 1FP1D 5FLXZ 2PBIA 4RGUA 3EETA 2L54A 3M8EA 3V7SA 2Z33A 2W24A 3TOBA 1D8JA 2P8TA 4HX8A 2CG4A 4L0ZB 3R6SA 2P6TA 2YX4A 1V3FA 1BI1A 4JBAA 5CVJA 4IRHA 3IRRA 2H94A 3PFIA 1JXSA 5J6XA 1IZ1A 4P9UA 1O3QA 3CUQC 4QLCU 4ENNA 4LFUA 2BBYA 3LA2A 3SZTA 3P9CA 2W57A 2VE8A 1I1SA 1J0RA 3LA3A 3HTUA 2EA2A 5L3BA 2F5CA 1EH6A 2W84A 4KDPA 2XVCA 5FGMA 3W6KB 3CLOA 2KIUA 2X0LA 2KKOA 1D3YA 1GXQA 3GFLA 4G7HF 1F9NA 2R3SA 2GWRA 3ECOA 1O57A 2G7UA 3EYYA 2HTJA 4L5JA 2COMA 3COAC 2VBXA 3BOQA 2ISYA 1I6XA 4CYDA 3DPTA 3I59A 1U6GA 3F8CA 3R60A 3GVAA 1T38A 5AIQA 4OIRF 2F5FA 2RGVA 3ZP5A 3JAMZ 2STWA 5HDKA 2FMLA 4N0BA 4HAMA 1SD6A 3T8RA 1R7JA 3EUHA 1QPMA 2VONA 1IN7A 3JSOA 2ZFWA 4O5VA 3HTSB 2QWWA 4I01A 2M87A 5JI6A 5HLHA 3GUDA 4P55A 4G9YA 2YR2A 1ZG1A 2M45A 2XAJA 1XDUA 3IWFA 3QPHA 2EJRA 3TDUC 4CZZA 3T5XA 5HOOA 1UFMA 2W85A 1QBJA 2JZYA 3MZHA 4HYEA 3FHZA 2JRTA 3WTYC 2JSCA 2VBYA 4ESJA 4E70A 5D6FA 1LDKB 4RB1A 4RGXA 2PMHA 1ZG5A 3L9FA 2PG4A 3OOPA 1OKRA 5D6EA 1LEAA 3U1DA 1IXSB 2HYGD 3BZ6A 3I64A 4WWCA 2K27A 4OINF 1YIOA 4UV9A 5TRDA 1QO0D 3DEUA 4KMFA 5E1XA 5HS9A 1XGMA 3QP5A 1P4AA 3PQKA 3FWEA 4YFKF 1CGPA 1H9GA 1EV7A 3VEPA 2MBFA 3EDPA 1QZZA 5E18F 1U3EM 1IXCA 3HHGA 5LHHA 1YS6A 1FBQA 2MH2A 4M6YA 2HDCA 1O3RA 3B02A 3GYHX 2ISZA 1WI9A 1FSHA 4FT8A 2A69F 2EFWA 5L3FA 2H27A 1JE8A 4BYYA 3GW2A 2IVMA 2LDUA 4GYIA 3F8NA 3I4PA 5H6QA 4EJUA 2EWNA 2XV4S 3F6VA 3RTRA 2ZJ2A 3P9KA 1KYZA 4I0BA 2HKOA 5AIPA 3IL2A 4CGZA 1FYKA 3K1NA 1Z6TA 3GWZA 1IXRC 3E5UA 1BC8C 3D0SA 2A3SA 2ESNA 2M30A 5DYMA 1Z9CA 3KEQA 1IAWA 4KIGA 1HSTA 1ON2A 1R5HA 3HRSA 5CJ9A 3BY6A 4WXCA 2IRFG 1U5TB 4D0PA 4ENKA 2K7LA 2CYYA 1H0MA 4WF2A 2LKPA 3IC7A 2VT2A 5ILSA 4A6DA 4KMUX 1B59A 1ZH5A 3P7NA 4Y15A 1L3LA 3F22A 4L5IA 3ULQB 4OMZA 2B0LA 4BH9A 5BMZA 2F5EA 3I0TA 4QWQA 4GXOA 3E6MA 5IT3A 4IF4A 4I2OA 4WX9A 2MLKA 5A2QZ 2H6CA 3KZYA 2RN7A 2IP2A 4U0VA 3WTVC 3N4MA 4A0XA 1UHWA 4MEYF 3RYRA 2Z3YA 4MNUA 3CTAA 4M9ZA 1FC3A 4U7DA 3JTHA 2H6BA 3C1DA 4I09A 1KQ8A 4AIKA 2HWVA 2MD5A 2AS5F 4A6EA 1K78A 1T39A 3R4KA 3KP6A 2EA4A 3H92A 3NEUA 4MHGA 3I58A 2PJPA 3E6BA 5KK1A 2OD5A 4NB5A 4YG2F 5E17F 2JT1A 5J8CA 2XGXA 2V1XA 2DLLA 1TQMA 1B9NA 3IKVA 4WCGA 2KJBA 1Z05A 1TNTA 1TQPA 5K1YA 5IT9K 4LK0F 2QBYB 1XB4A 3TO7A 1Z1DA 1IF1A 4PDKA 3H3ZA 5D4SA 1GVJA 1USSA 5ERIA 4BXUA 1P4WA 2NS0A 2YX7A 4KICA 2VN2A 4NQWA 3GO5A 2QUFA 5FB2A 1WRJA 2CSOA 2FBKA 3GFMA 2ZCWA 4YFXF 1WSUA 3E6CC 1LNWA 1ZRFA 1FSEA 1R23A 3T8TA 3ZMUA 1IW7F 4TV7A 4UVBA 4A12A 5FD5A 2EV5A 4HLYA 1MGTA 1SMTA 2IJLA 1HW1A 4RB2C 1JGSA 1WQ2A 4GYGA 2DPDA 3V8JA 2A5YB 4ZH4F 2O0YA 1XGSA 1CF7A 3WTSC 3AAFA 4I98B 3WGGA 1R58A 3HUGA 2VE9A 3DQVC 3QP6A 2LSOA 5CLSA 5BPIA 2FRHA 3HYIA 4L18B 3DKWA 4LG0B 1Z91A 3F72A 5ILVA 3QRFF 1BIAA 2D2WA 1O7LA 4NHJA 3GEZA 3KP3A 1YTYA 3BJ6A 2PN6A 1YW9A 4Q47A 1XN7A 2ZNYA 3F3XA 2PLYA 1MJ9A 2VC1A 1KU7A 5JHUA 2A07F 3FXUA 3PQJA 2GA2A 4IRGA 4HA8A 1QNTA 2XROA 1K78B 2GAUA 2OZ6A 3KZZA 3T1BA 1XCBA 1B1BA 3ZMSA 3LQQA 3SXYA 1YS7A 2EFQA 1GHCA 2WV0A 1SAXA 2DFIA 4OIOF 3BDDA 3B73A 3RI4A 5DV5A 2FSWA 3K9TA 3CDHA 5DUKA 1I1GA 5D5UB 1IN5A 2HGCA 3FM3A 3P9IA 4S04A 2GQQA 1ZYRF 4MGRA 2XAFA 5FLXK 1YLFA 4S05A 2FNAA 1SD5A 4HX4A 1S29A 4LK1F 1BBYA 2NNNA 3FM5A 3KCCA 3VFZA 3OV8A 4EGZA 4HQMA 1E2XA 4O6JA 1TLHB 3CO6C 1YG2A 4HF0A 5K5OA 3BP8A 4EMSA 1T0FA 1YFHA 1SD7A 1T98A 4HF1A 2EK5A 1W7PB 4YIIA 1P4XA 2BGCA 1FY7A 1UHMA 1QZYA 1U78A 1BN5A 4ENMA 1UCRA 3F23A 2G7HA 2JPBA 2OU2A 1FWZA 1EH8A 3RJPA 5JVTA 1R1TA 3QOPA 3I53A 3RPUA 1KU2A 2Z9OA 1MKMA 4G6DA 3FMSA 3WTXC 4M71A 2VXZA 3WODF 2K4JA 3GLXA 3LWFA 4BAYA 4B09A 1RUOA 2A6EF 3TDZC 4A0ZA 1D8KA 4UVCA 3RKXA 5E20A 5FFZA 4XSXF 5DUIA 1F5TA 5IT9Z 4XLPF 1IUYA 2QQAA 4UUVA 3FXQA 1XMAA 1P6RA 1FX7A 2DO7A 4G6QA 1OPCA 2Y75A 1L0OC 1B6AA 2XRNA 2DQLA 1FBUA 5AONA 4LB5A 5JR3A 2UXXA 1TW2A 3DV8A 1J75A 1S3JA 2M5WA 3I59B 5ILUA 1U5TC 4EV0A 1OMIA 2ZXJA 3VB2A 5D4RA 3TQNA 3ELKA 1Z6RA 2HS5A 3O2PE 3GFJA 4BHPA 4AIJA 3K1MA 4F7ZA 3BPVA 3GZ5A 2VT3A 5F6FA 2L4AA 2OQGA 4UNOA 1KU3A 1R5GA 3MCZA 1RIOH 3ABTA 5HS8A 5A2QK 3SQNA 1YO5C 3MAJA 4L9JA 4PGGA 1AOYA 4CHUA 4IVNA 2RV8A 3F8FA 5LGUA 2XAGA 1K7AA 3HSEA 3ZMTA 2O6GE 2RVCA 1ZRCA 4GO1A 2FQ3A 2V9VA 2EV6A 1PP7U 1SMYF 4HV6A 1BI0A 2IT0A 2CFXA 3GZ6A 2DK5A 3WTZA 4IHTA 2FBHA 4UV8A 2HOEA 2QZ8A 2XKPA 3KETA 4U88A 4ZZDA 4G7OF 5F1RA 2ESHA 4A5NA 3QU6A 2GIVA 1S8NA 3HOTA 4EJOA 3WG9A 3DP7A 2EFPA 1V4RA 1S7OA 2UXNA 1XGOA 4LG0A 4UXNA 1W4MA 1ZARA 5FFXA 2HTSA 2CW0F 4Y17A 2Q2EA 1TW3A 2DTRA 4Q48A 4MTDA 1HXDA 1SD4A 1PP8F 1BC7C 3U2RA 1G3WA 2TDXA 5CVRA 2DPUA 4AVPA 4L9TA 1HW2A 4N9HA 2MA3A 4CDGA 2FF4A 4IJAA 2RC4A 1WWXA 2EB7A 3BWGA 3DF8A 2V1DA 2L01A 2FBIA 2Q8KA
chains in the Genus database with same CATH superfamily
2YUSA 5E1WA 3GFIA 1PDNC 1MZBA 4CCKA 4WK8F 2NYXA 1UZCA 2CQKA 4HDVA 2V1NA 4RMNA 4IPAA 2DCEA 2M34A 3LQRA 4BQQA 3RCOA 2VJIA 3KLOA 1TBXA 4KA4A 1SFOJ 2ELKA 2H09A 1U9OA 2Y0MA 3H3UA 1YW8A 3E1SA 2EPFA 3E5QA 1ODDA 1QHHD 2BOLA 3J81Z 1BI2A 2XGCA 3OYGA 1HBXG 2MYSA 3F8MA 3LAJA 1LB2A 1E17A 1ULYA 3FXLA 2F4OB 4A3KJ 1KYWA 1R36A 4R1HA 1OYIA 2P6SA 1ZRDA 2ADUA 1XSDA 3HOWJ 4KN7X 5DD8A 2JQ7A 3TW7A 4JK1X 3H5RA 4KIFA 2VOOA 2E1CA 3LFUA 3LL7A 3DBRB 4A3CJ 2HYJA 4JQFA 3H9JA 3IAS2 4KNYA 3IWZA 3U1KA 6PAXA 5GTHC 3D5LA 3LSGA 3DEWA 4P9FA 3HZJA 4BE2A 3RPQA 2UWMA 2KFDA 4XR6A 4KN4X 3BR2A 2R7ZJ 1A36A 4NDLA 5EZHA 5IYDJ 2A6HF 3KP2A 4NNJA 4AYBA 1VQ6I 4X0GA 3GTQJ 3BG6A 2ZNZA 2E5ZA 2BE5F 4QSHA 1W7PD 4Z6YA 2L02A 3WTUC 4XBFA 1TWCJ 1J5YA 1HW5A 5DCFA 3WE2A 3L2CA 2VPLA 3R0AA 2EZLA 2M7BA 2EH3A 3Q9SA 1MMGA 4I0AA 4CICA 3LA7A 1RUNA 2CW8A 2R7DA 2ZSHB 4S0HB 1PUEE 2DA5A 2V26A 2K9QA 5K7FA 5ED4A 2IGOA 4LLNA 1R5ID 3OYCA 1QPIA 2R7OA 2QSFX 1VTNC 3HSRA 5LEJA 3G73A 3WHCA 1T95A 5ICFA 4ZYAA 2BYVE 2AXLA 2M0MA 4NC8A 1A6QA 3AG3H 3MEXA 4E7LA 1UB9A 3L09A 5E79C 5CQEA 3K4MA 3OIQA 2IA2A 2EFOA 4A5MA 4Y7NJ 3FX3A 3J7ZI 1LJ9A 1FP2A 1PVEA 2ZB9A 3A0HC 3M8FA 3WGIA 1EH7A 3OYLA 5CVVA 5B3SH 1Y8RB 3G1OA 2HDDA 4BKXA 1SFXA 4ESFA 2ELHA 3ABUA 3E97A 5J4VA 2GA1A 2AXTC 1B4AA 2Y69H 3OWTA 3JRIA 4A3IJ 1ZGWA 3LSTA 3FF5A 4IHSA 4A0YA 3IUOA 2E2JJ 5E3OA 1W7PA 1ZK8A 2K02A 3Q0VA 4EM0B 3F8BA 4HW0A 3V42A 1NG6A 2M8EA 3SDBA 5ICGA 1D1CA 3BR6A 3OIPA 4PFPA 5D5VB 1K4SA 1VQKI 4RAZA 1JKOC 1SFEA 4C2UA 2JVGA 2AQEA 3B6AA 4M9SA 4LLLA 5J40A 3L2QA 3JW4A 2P0WA 3MFKA 2FQ4A 1QA6A 3MZ8A 4M6XA 3RDIA 2P5LC 3HUGB 4C2TA 2XUBA 3HEFA 2D45A 3K70C 2CJJA 1G3SA 1IRZA 2XB5A 3M3YJ 3HOUJ 2KISA 3CCVI 2L0KA 4E7SA 4LLGF 3ECHA 4HZFA 5JHFA 4U7BA 2PFBA 3ZPLA 4LD5A 1VI0A 4L9NA 3BPXA 1P2FA 4F91B 4M9XA 3AG1H 2FA5A 2KZGA 2K4BA 3WU1B 2GM4A 4EJWA 5FD6A 2X6YA 4L0YB 5BQTA 2CGPA 5LLQA 4E7KA 3PNVA 1UMQA 2L7MP 3ZQFA 2R0QC 2YS9A 2B7EA 4MQ9F 2ZBKA 1S7AA 3AG2H 4P5OA 5ICEA 3LNQA 2FU4A 3TP3A 5M3FJ 1XSVA 2R7QA 3BLYA 1FLIA 3ZQGA 1AU7A 5LGNA 1FYMA 1I5ZA 1ZLKA 3UR3C 4B1RA 1D1BA 2M0CA 5IYCJ 1YHQI 3BJAA 3JTGA 5LHIA 4LIVA 3OYHA 3U9GA 3REOA 4IQ4A 2VJ4A 2VC0A 4C2MJ 3OL4A 1QVTA 3RPUD 1Y0NA 3TGNA 2DYSH 5J8FA 3L2UA 4PCQA 3T0YA 1MJBA 3EQLF 1J7KA 5K5QA 4CYCB 2L4MA 2X6OA 5GADJ 5GTIC 3FMRA 3RKWA 1R4MB 2ETHA 1W5SA 3M9AA 4ZTFA 3OYMA 1MBKA 1H9TA 4OAZA 1JKRC 1V55H 1H89C 2HOSA 2NS8A 3ASOH 2PEXA 2Z99A 4E7IA 2V6CA 4XKBA 1IGNA 4M73A 3WTWC 3FK7A 1BM9A 1TWGJ 4XL9A 1F4KA 2ZJQF 3K2ZA 3K4NA 2JTVA 4UVAA 3JSPA 4OMYA 2NVTJ 3BTIA 1DUXC 3H5AA 4E4HA 3SFZA 2GIZA 5LRSA 1ITYA 2EIKH 3R0JA 1VNDA 4ENJA 4MTEA 3K4BA 2M8GX 4DQ2A 5LFAA 4UY8I 2W00A 3FXRA 1MMDA 1XG1A 1TTYA 5D5WB 1LVAA 2KDOA 3C2BA 2KRFA 4GCVA 4XMYA 2GOXB 4PSWA 2E5NA 3NQOA 3C2HA 2MABA 1Z7LA 3HRTA 3WE3A 1LPQA 2O61A 3GZNB 5D5XB 2OQRA 4XOPA 2DA1A 4CH7A 4A3FJ 3UKGA 2QQ9A 5IP6A 4BACA 1BR4A 3CQZJ 4YELA 1AKHA 4G8XA 1B8IB 2V79A 2X4HA 5D8LB 5JFRA 2BEOA 5HVQC 4IO9F 1LDDA 2VKEA 1WHUA 3FXMA 4A2UA 4OIPF 1ONVA 2Y9ZA 2BVMA 4LB6B 3DBHB 3RZDJ 1QQIA 2BV6A 2KT0A 4YEJA 2VODA 1U9NA 4QIWN 1FZPB 1XSXA 4CO8A 2CS3A 1OLTA 1J09A 3VPRA 2E1MB 4HNUA 5FLVA 4FE7A 4II2A 4GGGA 2D1HA 5HDGA 5KVRA 1U5TA 2CV0A 2KJCA 3CMYA 1HQCA 3GMEA 5E8GA 4CSWA 5K7ZA 2L9VA 1LUJB 1HKTA 2DW4A 2XHKA 1A04A 2MLGA 2ZMEC 5F64A 2OF7A 2NNYA 3RYPA 2ZKZA 4CCNA 2WADA 3CZ6A 1AKHB 3KFWX 5FKLA 2HEOA 1MD0A 1DU6A 5BPDA 5D8KB 1JUPA 3OS2A 3ZMVA 1G4DA 2OBPA 3QODA 2FJ1A 3DTEA 2Q2EB 3O8GA 1WJDA 1BJZA 2X51A 2LYCA 3S16J 2F6CA 2FOKA 1P9QC 1R1UA 2G0EA 2XSJC 2R93J 3SFIA 2P7CB 2EZIA 2JMWA 3FZVA 4KUMA 3UNGC 3AL0B 4DZJA 4ETSA 1Y0UA 2MG4A 4DBRA 2DT6A 1K6OA 1YOVB 1EF4A 2I10A 1YW7A 2RDPA 1IV6A 5GPCA 1D0ZA 2XAQA 1ZLJA 4EATA 4YIFA 5GAEJ 1HLVA 3QU3A 4KIBA 1IRFA 2EIJH 3L00A 3JRBA 2CRGA 1O7FA 3CCSI 1XDSA 4EM2A 1ETQA 5BS6A 2EQRA 2XPUA 4MQVA 3V4GA 1DDNA 1ZN2A 2ZFUA 2PI0A 4NUBA 1VF9A 1IRXA 3F6OA 3QYFA 3NWTA 3HG9A 1V5GA 3V8LA 3L2WA 4ESBA 2WB1N 4AIHA 2IS2A 5EGOB 3HOSA 3PNYA 5DTDA 2Y0SN 4O3MA 4IHXA 3WGHA 1IN8A 3N97A 4BJ5C 2MC3A 2WY7Q 3ZQ7A 3KP4A 4B8XA 3EUAA 2WTEA 4ON0A 1Y1VJ 1A5JA 2BW3A 5J1YA 4OOIA 1QGPA 1SFKA 1ZR2A 3QAHA 4GRIA 3ZMDA 2DFFA 3V7CA 1OYWA 3ZN0A 4G6TB 4AD9A 2W4SA 3VOEA 1BOAA 2D1VA 3L2VA 5B1BH 2CQQA 1IV8A 3M8JA 2DDBA 4P96A 3IRQA 1XX5A 1N78A 2X1EA 2XAHA 4ZYHA 4RAYA 2V1UA 2F2EA 2FEZA 1RZ4A 2EV0A 1K79A 1MNDA 2K86A 1IDYA 2LREA 4CZCA 1ORKA 3ZGKA 2CUFA 1NTCA 2LVSA 4D5CA 1MSEC 5LGTA 1WZ2A 1AHDP 4G7ZF 3BQYA 1ZHFA 3I71A 3ZQQA 3HJEA 2MD0A 4WXHA 4DZPA 2OAZA 2BW3B 2V9KA 2YPRA 2XSDC 3WTTC 4XRFA 3K4JA 1I27A 3JR9A 2LF7A 1X58A 2HR3A 5J3LA 5KNLA 2QM3A 3J7AO 1Y6IA 2OJED 3BT9A 4MLOA 2JA7J 2IGMA 4ZZLA 2M9HA 1WI3A 1C0WA 4CCJA 3FDYA 2WWYA 4HDUA 4LJZF 1REPC 1U2WA 3NRVA 4LGWA 1TQIA 2A68F 3LMMA 2B9SA 2KHMA 3CF2A 2VIXA 1SEUA 1ZAOA 2Y0SA 2QKMB 5L3GA 1DP7P 1RNLA 2LNBA 5F1JA 1W36C 2DI3A 3ZMZA 2QBYA 1U8RA 1R1VA 2DK8A 4B43A 3LFKA 1GT0C 2ID3A 1X1PA 1FYLA 2LC2A 3I56I 2GZWA 4JP0A 4RGRA 1S6LA 2E2HJ 1YYVA 2FMYA 4EJTA 3GTKJ 2WAQN 3OYEA 3BROA 1IJWC 1R00A 3I4NJ 2DQRA 1KU9A 1T6SA 1OISA 2QYOA 3M1CA 2DA2A 2ZXIA 5E3NA 2QENA 4Q5SF 1WJEA 1YQAA 3CJNA 1WKMA 3MKWB 5EJCA 1BIBA 4BXXJ 3BQZA 3IH4A 2C6YA 1Y56A 2LOOA 3KP5A 3K69A 3HOYJ 1TWFJ 4RS8A 3CCLI 4XRMA 1X2MA 2DMQA 3HHHA 4Y33A 2HFHA 4ZYEA 1IN6A 3HRMA 4AIDA 5KAIC 5EGOA 4I7HA 4CXFA 1UHSA 3HM5A 5HDNA 4ZYDA 3W2AA 1XMKA 4Q4ZF 2NRAC 2STTA 4C30A 2P7VB 3R61A 3C7JA 2HYFA 3I4MJ 2XPVA 4UUSA 3KE2A 5LBQA 3FXOA 1SFUA 4DYCA 5FKMA 1NG7A 2M4KA 2LFBA 2W48A 5BNGA 2L3DA 5EG0A 3F9KA 4A93J 4PUSA 2WAQA 2UZKA 2FE3A 4AU7A 3RSNA 3M1EA 2DOAA 1FBSA 2E1NA 3IAM2 3DKYA 1JHFA 2VI6A 1JHHA 1VQLI 4BQAA 3OSFA 3L7WA 1NHAA 3VODA 2E2IJ 1ON1A 2LMDA 1STZA 2CUZA 1YE9A 4XQFA 2J5PA 2CV1A 2XF6A 3ZR8X 3CDLA 4RB3C 2EFNA 2VL8A 1X2NA 2XASA 5IP9J 2OA4A 2KMUA 5E1ZB 4XLNF 4B3XA 1IG7A 1ZG3A 2K5CA 3TMOA 1R22A 1WJ5A 2Z5UA 1FOWA 4HBLA 1DPUA 3C18A 4OIQF 3MQ0A 4BE1A 2V6EA 2IPQX 2JJ7A 4M3FA 1HKQA 5C3EJ 4RB0A 4H0EA 1YX3A 3K10A 3TEDA 3S1NJ 3HDDA 3TW6A 3IHUA 4LG3A 4M74A 4MEXF 4HF2A 2TRTA 1LEBA 5H6RA 3G3ZA 3MWMA 5IOYA 1ERDA 4D5FA 5IOZA 3A2KA 5FRMA 4CA0A 3TOAA 5H20A 2MH9A 5HLIA 2XIGA 4XLFA 4DNCA 1QU3A 2QVOA 2VKVA 2R7XA 1RC9A 1TNSA 5DDGA 1KQ0A 1LQ1A 4A3EJ 1A35A 3M7GA 2RKHA 3D1NI 1TT0A 2VOPA 2YSRA 2CO5A 2X85A 4M72A 4IHWA 3CMMA 3E5XA 5TJJA 1GVDA 1Z77A 3PNTA 2QLZA 3H9QA 4IQJA 3EUHC 2DBBA 3CUOA 2NAZA 3QPLA 2WA0A 5DCMA 2GXGA 3RKYA 3PUFA 2GXBA 5CVUA 5K5RA 1BR1A 4R8HA 5GP9A 1OFCX 3K1PA 4V2GA 1B72B 2VQCA 1Z7UA 1ZREA 5IPAA 2W1OA 1YITI 3KLNA 4EM1A 2WAEA 2H8WA 5E3MA 3OL3A 3W3CA 5BOXA 3BG7A 1H88C 1J2XA 4K2EA 5FJ8J 2HI3A 1T2KA 3KEYA 3CJRB 1VQ7I 1W5TA 2XC7A 2X1CA 1W5CC 2YU3A 1G3TA 1JJ8C 1FJLA 1HSJA 2A61A 2ZMEB 4OWRB 4FHTA 3S1RJ 1B9MA 1KGSA 3OYFA 2EBIA 4KFCA 4EJVA 1IN4A 2BHZA 5C4JJ 2VUMJ 2ME6A 5M3MJ 1WH5A 5HLGA 3TBIA 1TWAJ 2X6WA 1USTA 2Q0OA 3NARA 3MD2A 4L9VA 2HXIA 1H8AC 3BR0A 1FNNA 1J9IA 1ZGAA 3ONQA 4PJ0C 3CCRI 1JT6A 3ABMH 1G3YA 4EVIA 3BG3A 3JAMK 1PUFA 1F1ZA 3DPLC 3MZYA 1MDMB 3CUQB 1VQ5I 3TO6A 2IS6A 2KIMA 5L3CA 3JRCA 3MMYB 3S3NA 1P7JA 1MMAA 3ROUA 1G59A 1CF7B 4E7HA 1PJRA 4FX0A 5DCMB 2G9WA 3Q9VA 1ZGJA 1HKSA 1RI7A 3DFGA 5DD4A 1J59A 1JGGA 1E3HA 3GF2A 3HKZA 1O3TA 2ZO4A 4F3QA 1O3SA 3MKYB 2OTJI 2HNHA 1RKTA 3CC4I 3D5SC 3H3VK 4D1QA 4KYWA 2VKHA 2MW8A 1GXPA 1PYVA 1LFBA 4HV5A 4J01A 3RIRA 4FX4A 4HLXA 4Y13A 2CUEA 2XGDA 3SZPA 2OCEA 2VJ5A 1RPWA 3O6BB 2M1BA 4FQGA 4NC7A 3W6JB 3K70D 3H35A 3H0DA 3HGGA 3GTPJ 4W1UA 1YRNA 3QPTA 4BHCA 5EEHA 4A3MJ 2VBZA 4RGSA 3J80K 2Y31A 2B63J 1TZLA 3O3KA 3TO9A 1G2HA 3E6DA 2HQAA 2PQ8A 3BG5A 1WVRA 5ICCA 3CCMI 3CUQA 3ML6A 5CVIA 2DA4A 2F5DA 5J1UA 3TP0A 4DYRA 1DGWY 4OU0A 2P5KA 4V2FA 1CQTA 4B3AA 4AC0A 3Q5FA 2F5VA 3RQ4A 2RNJA 4F92B 1ETWA 3ERED 1XS9A 5L3DA 2O8XA 2O03A 5TGTA 1G6NA 2IW5A 5F27A 2CQ7A 4PZJA 2HU9A 3DXJF 3JRAA 3K0LA 3ISPA 4AWXB 1FPQA 2Y48A 3G4SI 4KISA 1D5VA 1Q1HA 4LMYA 1APLC 1BJAA 2PMZA 1KA8A 2XPWA 2K85A 2HQRA 1POGA 5CYVA 2CWEA 1S72I 2FNPA 2W25A 2ZMEA 4UHTA 5EG0B 4EGYA 1BW5A 2P5VA 1P92A 1AWCA 2RREA 2IBDA 1I3QJ 3CJTB 3Q0UA 2HKXA 2ELJA 4YFNF 3GXOA 1LDJA 4BHBA 4U0YA 4IXAA 1OYYA 4IRIA 5LEKA 2ECBA 2PMZN 1Q1VA 2DT5A 3FBIB 3NAUA 2R7UA 2JUCA 1TC3C 3A01B 3A1YA 1B72A 4XRSG 5EEGA 2R7FA 2A05A 3S2WA 3TKYA 1OR7A 2QQ8A 2MSYA 4G12A 1ZKGA 1UELB 3E0JB 3HRUA 3KEOA 4EQQA 4A3JJ 2E7WA 3ZQCA 4HOBA 2DJIA 2XKOA 4E6KG 4PGHA 1UG0A 1OCZH 3I5UA 4ZJZA 2RQPA 3SHFA 3S1MJ 4NC6A 4DOZA 1IRGA 5EF6A 5LD2C 3MVPA 2IXSA 3JREA 2ZXWH 2O3FA 2IS4A 4XLEA 2DMNA 2ECCA 4Y3OA 4N9IA 4M3GA 4BQOA 3F0CA 4G94A 2JRMA 3FMQA 4BEHB 3F21A 3JRGA 2QQBA 1VQ8I 1BI3A 4WXDA 4U0WA 2IA1A 2WY8Q 3C3WA 3BJOA 4BNCA 3Q0WA 4RM2A 1IC8A 3CD6I 1YJNI 2P4WA 1KQ9A 4PJLA 1D1AA 3HIFA 3DLLF 4BY1J 3V8KA 1LE8B 3GX4X 2FXAA 4I99C 4DJAA 1FOKA 4UB8C 1FT9A 3PIPF 1MW7A 3PUBA 2JPCA 2ACJA 3Q3SA 1BR2A 3J7AY 9ANTA 2WC2A 4P1WA 1XD7A 1E3OC 3LSPA 2J5OA 3ABLH 3HSFA 2BXZA 1LE8A 3J80Z 4XN0A 5F0HA 3EUKL 5L3EA 1U8BA 1DPRA 2VBWA 1DQUA 4A3DJ 2DU9A 2DAOA 4KT5C 3DTIA 1F43A 4HSRA 4ZYGA 3HOZJ 3RKQA 2A6TA 2KPMA 3EYIA 4Z2YA 1V5EA 4RBOA 1X1BA 4U87A 5F0CA 5B1AH 2KIFA 4ASNA 3WU0A 2XRLA 4HQEA 3J81K 2E7XA 4R79A 5HS7A 5FO5A 1GV2A 3KP7A 1XGNA 3E7LA 2HQNA 5DEQA 1T33A 2DOFA 4HX7A 2OZUA 5EDNA 3ZN1A 3CO7C 1F36A 1JKPC 1ZQ3P 3I54A 1T8IA 1RKWA 4FISA 1IO2A 1X3UA 1MBHA 5LHGA 4AM3A 2RQQA 3LAPA 5LRRA 3ZXSA 4XSZF 2PMUA 1MMNA 3HPHA 3IKTA 1HDDC 4XIDA 3WG7H 2IA0A 2ZJPF 5E8IA 3K2AA 2F4IA 3WHBA 1MNMC 1ENHA 4D9JA 4A69C 3E3VA 1MDMA 3IV5A 1SAUA 2HZTA 1FOXA 4I02A 1TWHJ 1XC5A 5E3LA 1MJAA 1OCPA 1XCVA 2LF8A 3V7RA 2E34A 1FP1D 3A4CA 3GTJJ 5FLXZ 2PBIA 3PJRA 1VZ0A 4RGUA 3EETA 3G1LA 3OYBA 2KL4A 2LY1A 4BQNA 1GV5A 4BE0A 2L54A 3M8EA 3V7SA 2Z33A 2W24A 4M6VA 3TOBA 2V9PA 3H1CA 4ZC3A 1D8JA 2P8TA 3A02A 1X1DA 4C3IJ 1K4TA 4XICA 4HNVA 2L5QA 3SZGA 4HX8A 2CG4A 4L0ZB 3JRDA 3R6SA 3ZQIA 4JX4A 2EIMH 2P6TA 2YX4A 4M3BA 1V3FA 2P81A 1BI1A 4JBAA 5CVJA 3S8PA 4IRHA 3IRRA 2D5VA 2H94A 3DEEA 3PFIA 1JXSA 4BGDA 1YJWI 5J6XA 1IZ1A 3SYTA 2O8KA 4P9UA 1O3QA 3CUQC 4QLCU 3HOXJ 4ENNA 3OY9A 4LFUA 4IX7A 3P5JA 3DWLE 2BBYA 2FX0A 3LA2A 2DN0A 3SZTA 3P9CA 3CMAI 2L7FP 5M5WJ 3K4CA 3FBNB 2W57A 2VE8A 1I1SA 1MH4A 1J0RA 3LA3A 2OV7A 3HTUA 4MO7A 2DA6A 1G8XA 2EA2A 4Y52J 3CDIA 5L3BA 2F5CA 4XN3A 4RAGA 4HRIA 1EH6A 2W84A 4KDPA 2JUGA 2XVCA 3I55I 2M2EA 1EKEA 2DMPA 2R7SA 5FGMA 4A3LJ 3HBLA 2JA5J 1FMVA 1DU0A 3W6KB 2XF5A 4IL6C 2DMTA 3CLOA 2LBFB 2KIUA 2X0LA 2KKOA 1BA5A 2M7AA 4DYQA 1D3YA 2JA2A 1UG2A 5KCMA 1GXQA 3GFLA 3OYIA 1OCTC 4RM3A 4G7HF 4XKVA 5FRNA 1F9NA 2OUMA 2R3SA 2PJRB 5EEAA 2GWRA 3ECOA 1O57A 2G7UA 4XNFA 3EYYA 2HTJA 1MBGA 4L5JA 5B5EC 2COMA 2DA7A 3COAC 2VBXA 2NVUB 4FCYA 2COBA 4J00A 3BOQA 2KZVA 2ISYA 2HQ5A 1I6XA 4NQWB 4X1EA 2DOEA 4CYDA 3DPTA 2BY2A 1R6RA 2IS1A 3I59A 2OC6A 2WBMA 4X6AJ 1SVOA 5M5XJ 1U6GA 3F8CA 3R60A 3GVAA 2KQRA 1T0FC 2RNGA 4I76A 1T38A 5AIQA 4OIRF 4PJMA 2F5FA 2RGVA 4EEFG 2HVRA 4GFBA 2AO9A 3ZP5A 4JX5A 5F0FA 3JAMZ 2STWA 5HDKA 2FMLA 1ETOA 5DS9A 4N0BA 4HAMA 1SD6A 1WCMJ 3T8RA 1R7JA 3EUHA 3S93A 4IHVA 2R7RA 3KZIC 1QHGA 1QPMA 2VONA 2X6XA 1IN7A 1N77A 4RLQA 3JSOA 5GAGJ 3VYUB 2ZFWA 4O5VA 2LY9A 3HTSB 2DXIA 2O7OA 2JK3A 2QWWA 1ZELA 4RLFA 4DGWB 2V7FA 4I01A 2M87A 5JI6A 3BTJA 5HLHA 2ME0A 3CJQB 4E7JA 3GUDA 4P55A 4G9YA 5HNHA 1Y1WJ 2YR2A 3D5RC 2NVQJ 2CU7A 2L9SA 1ZG1A 2M45A 2A5WA 2W82A 4FETA 2XAJA 2R7VA 2K40A 3LSMA 1XDUA 3IWFA 4HNTA 4IOAF 2JA8J 4BJ6C 3OMYA 3QPHA 1RR7A 2EJRA 3TDUC 4CZZA 2PJRA 1VQPI 3T5XA 5HOOA 1UFMA 4CCLA 1FOYA 2W85A 4LOCA 1QBJA 4BU2A 2BVLA 1WH7A 2VJJA 1WJCA 2JZYA 2LBFA 3MZHA 3KPHA 4BBSJ 4HYEA 3FHZA 1BOBA 2JRTA 3WTYC 2JSCA 2LLKA 4HEA2 2VBYA 4E70A 3JRHA 4ESJA 5D6FA 1LDKB 4CUGA 1X1AA 4RB1A 4RAFA 1LKXA 2FOWA 4RGXA 1E0EA 1MNEA 2PMHA 3BTLA 1ZG5A 2DMUA 3L9FA 2K9MA 5IP7J 2PG4A 3OOPA 2ZXHA 5KAFC 3SDGA 3OYDA 5GAHJ 1OKRA 5D6EA 1LEAA 3U1DA 1IXSB 2KIQA 3VDXA 2HYGD 2DTZA 3BZ6A 3I64A 4FTHA 2HVSA 4WWCA 3OR2C 2E71A 2K27A 4OINF 1YIOA 4UV9A 5TRDA 2I8DA 3FKJA 1QO0D 3DEUA 3VSLA 4KMFA 5E1XA 5HS9A 1XGMA 3QP5A 1P4AA 3KYDB 3CCQI 3PQKA 3FWEA 4YFKF 1CGPA 4BXFA 1H9GA 1EV7A 1K6YA 3AKZA 1JT0A 4LIUA 3VEPA 3X2QH 3QWLA 2MBFA 3EDPA 3CESA 1QZZA 5E18F 3CCYA 1U3EM 2LRDA 3L1PA 1IXCA 3HHGA 5LHHA 4XLCA 2R5YB 1YX5A 1DGRM 1MBFA 1YS6A 1FBQA 2MH2A 4M6YA 1OR7C 3CP8A 4D7NA 2HDCA 1O3RA 3B02A 3GYHX 2IGNA 3HB9A 2ISZA 1WI9A 1FSHA 1X3WB 4FT8A 2A69F 4AUXA 2EFWA 3OR1C 3G6EI 1WJFA 5L3FA 2H27A 1JE8A 4J19A 4BYYA 3GTGJ 3GW2A 2IVMA 2LDUA 4GYIA 1DP3A 3F8NA 4HPQA 3I4PA 1VQNI 4KITB 5H6QA 4EJUA 4NBQA 2VB6A 3HC7A 2TCTA 2VLAA 2EWNA 2EINH 2XV4S 3F6VA 3RTRA 2H1KA 3PSIA 2ZJ2A 1N25A 2EZHA 3P9KA 1KYZA 3GBGA 3G2BA 4I0BA 2HKOA 5AIPA 2XGEA 1JTXA 3IL2A 4CGZA 1FYKA 3K1NA 5EYRA 1ETXA 1Z6TA 1OCRH 3FXJA 3GWZA 2CQNA 1S9HA 1LFUP 1N75A 3O8HA 1IXRC 1V5FA 3A0BC 3E5UA 1BC8C 3K4KA 1MBEA 3D0SA 2A3SA 1Z3YA 3LSRA 2ESNA 3I9V2 2DDAA 2VASA 2M30A 5DYMA 5FKOA 1MIJA 1Z9CA 3CCEI 3KEQA 1IAWA 1S7EA 1JUMA 1XTAA 4KIGA 1GLNA 2CH0A 3IH2A 1HSTA 1ON2A 4PSXA 5JVGF 1I3AA 1R5HA 3HRSA 5CJ9A 3BY6A 4WXCA 4QPOA 5J47A 2IRFG 4CCMA 1U5TB 2OPTA 4XK4A 4D0PA 2K7LA 4ENKA 2CYYA 1NH3A 1H0MA 1D0YA 1NK3P 2W7NA 3LSKA 4WF2A 3KIOA 2MGQA 2LKPA 3FK6A 2QA4I 3IC7A 1FIPA 2PX9A 3PM1A 5HNFA 1KONA 5KHDA 4L5EA 2VT2A 3S14J 5ILSA 2KDZA 4A6DA 3ABKH 4KMUX 5J4YA 2O9LA 4XKWA 1B59A 1ZH5A 1P7IA 4ZDOA 1AA7A 1E3PA 3P7NA 5K7HA 2LD5A 4Y15A 1ETVA 1L3LA 2QF7A 1Z21A 3F22A 4L5IA 3ULQB 3S1QJ 3H36A 4PFOA 2LKXA 3LSIA 1YIJI 2VQLA 2KP6A 4OMZA 3HPGA 3VSKA 2B0LA 1KZHA 4BH9A 2DT7B 5BMZA 3VYTB 2R4GA 2F5EA 3I0TA 2Z1DA 3WU2C 4QWQA 4GXOA 3E6MA 5IT3A 1VFCA 1QZEA 4IF4A 4I2OA 3AG4H 2JN6A 2VKDA 2E19A 5H2FC 4WX9A 3ZQHA 4F55A 2MLKA 4B44A 2JA6J 5A2QZ 2X9DA 2H6CA 3KZYA 1D5YA 3G71I 2RN7A 2AHQA 4BJTA 1Y8QB 1OCCH 2IP2A 4U0VA 5DM7F 3WTVC 3N4MA 1FMWA 3KYCB 4A0XA 1MSFC 1UHWA 3BZCA 4MEYF 3RYRA 2K9SA 2Z3YA 2NOGA 4MNUA 3CTAA 4M9ZA 1FC3A 4FASD 4U7DA 2QKLB 3JTHA 3HL2A 1U0JA 2BZTA 2H6BA 1MBJA 3C1DA 2OCCH 3L2RA 2E1OA 4I09A 1SVLA 1KQ8A 2ID6A 1JUSA 2HWVA 4AIKA 2MD5A 2AS5F 3M4OJ 3QYBA 2L9NA 4A6EA 1K78A 2Y30A 1T39A 3DPUA 4HSTA 3R4KA 2BY3A 3KP6A 2EA4A 3H92A 2DA3A 3NEUA 3AL0C 4B4CA 4MHGA 3I58A 2FUG2 2PJPA 3E6BA 4YIRX 5KK1A 1R4NB 3CC7I 2UV1A 3A01A 4IZZA 2OD5A 4NB5A 3FHNA 4YG2F 4C3HJ 4XLAA 3S3OA 2NOJB 2Z2SB 1MH3A 2JT1A 1RR8C 5E17F 2EZKA 5J8CA 1OJLA 1TL8A 2XGXA 2V1XA 2DLLA 2X1DA 4AYBN 1TQMA 1B9NA 3IKVA 4WCGA 2KJBA 3U21A 2NXNB 1Z05A 4RA2A 1TNTA 3PSFA 1HOMA 4PJJA 1TQPA 1HC8A 5K1YA 5IT9K 4LK0F 5J1RA 4A3GJ 2QBYB 1XB4A 3MN2A 3TO7A 4XKCA 3SEZA 2GXAA 2LK2A 1SC7A 1Z1DA 1FIAA 3BR3A 4I6ZA 3K7AJ 1IF1A 2RAEA 3W6VA 4PDKA 3H3ZA 5D4SA 1GVJA 4IOCF 1USSA 1ETKA 5B66C 5ERIA 4BXUA 1P4WA 3B6CA 3H5NA 2NS0A 3S3MA 1UAAA 2YX7A 3ASNH 2VN2A 4KICA 4NQWA 3GTOJ 2VPRA 3GO5A 2QUFA 5FB2A 1WRJA 2CSOA 1K61A 3CF5F 3CMEI 2N8GA 2FBKA 3GTLJ 2E60A 3BTCA 3BR1A 2IAIA 2KLOA 3GFMA 2H8RA 2R92J 2ZCWA 4AVZA 1W1WE 1GDTA 4YFXF 1WSUA 3E6CC 2IGKA 1LNWA 3S2HJ 3CCUI 5CPRB 1ZRFA 1FSEA 3DCFA 1FTZA 1R23A 3T8TA 5C44J 1YRNB 3ZMUA 3HOVJ 1YI2I 1IW7F 4BEHA 5C4XJ 4TV7A 4UVBA 4MFDA 4A12A 3HKZN 5FD5A 2EV5A 2BHYA 4HLYA 2M4GA 3HXLA 2HPMA 1MGTA 1SMTA 2IJLA 1HW1A 1LVKA 2JWTA 4RB2C 3LOCA 2OTLI 1TP4A 3RQIA 1JGSA 1WQ2A 4GYGA 2DPDA 3V8JA 3VWBA 2A5YB 4ZH4F 4YRVA 1Z3XA 2O0YA 3HGYA 1XGSA 1CF7A 2HZDA 4ZTJA 3WTSC 2HVQA 2LG4A 3AAFA 2X48A 2UUZA 4I98B 4N4OB 3WGGA 1R58A 2GOMA 3HUGA 1BL0A 2ZC2A 4KT6A 3CLQA 1RETA 2VE9A 1QRYA 3DQVC 3QP6A 4E7ZA 2LSOA 5CLSA 5BPIA 1Y39A 2FRHA 3HYIA 4L18B 1X1CA 1UJ8A 1JI8A 3DKWA 1XPXA 5FKNA 1ACIA 1FEXA 4LG0B 3GLLA 1HA8A 3OYKA 1LFPA 3BCBA 1Z91A 3DBLB 3QQAA 3F72A 5ILVA 3S2DJ 3QRFF 1BIAA 2D2WA 1JTYA 1O7LA 2QGUA 2F48A 2HOTA 4KJZA 3BCAA 3ZCOA 4NHJA 2XB0X 3GEZA 2EILH 1A31A 4QTRA 3KP3A 1VQ9I 3BJ6A 1YTYA 2PN6A 1YW9A 4Q47A 1XN7A 2ZNYA 3DTKA 3F3XA 4B47A 2PLYA 1MJ9A 2VC1A 1KU7A 4XOTA 5JHUA 5FROA 5HLTA 2A07F 4ITVA 3FXUA 1A6IA 1EA3A 2DFEA 1IUFA 2CFOA 2XF7A 4GDFA 3PQJA 2GA2A 3PFYA 4C9YA 2QEXI 2FD5A 4PK4A 4CCOA 3QPSA 4IRGA 2XAUA 3OIOA 4HG2A 1X4PA 2HOAA 3N05A 4F52A 4HA8A 1QNTA 1X19A 2CQXA 2XROA 1R49A 1K78B 2GAUA 3CC2I 2OZ6A 4A3BJ 1IDZA 1HCRA 3JRFA 4II3A 3KZZA 3T1BA 3GCMA 1ZR4A 1SANA 1XCBA 1GUUA 2DODA 1B1BA 3ZMSA 3LQQA 3VYRB 2CV2A 1VQMI 3SXYA 1HDPA 1YS7A 2EFQA 1R9TJ 2E36A 3S32A 2GLOA 1GHCA 5TISC 3C2GA 2WV0A 4Y4RA 2DFIA 1SAXA 4H4KC 4W97A 1EJ9A 2GBYA 4OIOF 3BDDA 1FTTA 3B73A 1V54H 3RI4A 5DV5A 2FSWA 2MC4A 3K9TA 4MFEA 3CDHA 2K9NA 1VQOI 5DUKA 1I1GA 1X3ZB 5D5UB 4XRSA 1IN5A 2HGCA 2DYRH 3FM3A 1D0XA 3P9IA 2HDWA 4S04A 1ZYRF 2GQQA 1WJAA 1W36D 4MGRA 3KYLA 2XAFA 5FLXK 2K3PA 2E1MC 4MIMA 1YLFA 4S05A 4M3DA 2FNAA 1SD5A 4HX4A 1S29A 4LK1F 1BBYA 2NNNA 3FM5A 1W0TA 3KCCA 3VFZA 1K83J 3OV8A 4JOMA 5FLMJ 4EGZA 4HQMA 1E2XA 3JCUC 2R7TA 4O6JA 2BY1A 1TLHB 2MFZA 3CO6C 1YG2A 4HF0A 5F04A 5K5OA 2L7ZA 3BP8A 4EMSA 1T0FA 1YFHA 4D7MA 1SD7A 1T98A 4UB6C 4HF1A 4PJNA 2EK5A 3W2WA 5IY5H 1W7PB 5IYBJ 5DM6F 3J7YJ 3OS0A 4YIIA 4BBRJ 2BXYA 1P4XA 1QVUA 2BGCA 3SEQA 1FY7A 1UHMA 1QZYA 1U78A 1NK2P 1BN5A 4ENMA 5JLWA 1UCRA 3F23A 1S5LC 2G7HA 2JPBA 4FE4A 2OU2A 1FWZA 2K9LA 1EH8A 3RJPA 5JVTA 1R1TA 4UUSB 3QOPA 3I53A 4BL0B 3RPUA 1KU2A 2KRHA 2Z9OA 1MKMA 4G6DA 1WPKA 3FMSA 2R5ZA 3WTXC 1MMSA 3IP4B 3GTMJ 4M71A 4CYCA 2VXZA 2JSPA 3WODF 2ZJRF 2K4JA 2R5ZB 3G1MA 4OAYA 3GLXA 4B48A 3LWFA 4BAYA 4B09A 1RUOA 2A6EF 4UUTA 3TDZC 4A0ZA 1D8KA 1Z0XA 4JX6A 4UVCA 4QPQA 3RKXA 5E20A 5FFZA 4XSXF 3DKXA 4F93B 5DUIA 1F5TA 4BY7J 5IT9Z 4XORA 1SVMA 3PO2J 1WGXA 3OYAA 4XLPF 3RZOJ 1IUYA 2QQAA 3VYSB 1ZTRA 2NS7A 5CKTA 5HODA 4UUVA 3FXQA 1XMAA 4ANJA 1P6RA 1TT5B 2V4JC 1FX7A 1R71A 2DO7A 4G6QA 1OPCA 2Y75A 3BG9A 4BDYA 1Z67A 1L0OC 1B6AA 3TL4X 2XRNA 2DQLA 3ZRGA 2CMPA 2L2OA 1FBUA 4BUPA 2YU9J 1WFXA 1BW6A 4DBQA 5AONA 4LB5A 3S15J 5JR3A 2R5YA 1O4XA 2UXXA 1TW2A 3DV8A 1J75A 1S3JA 2M5WA 2LP0A 3I59B 4ABZA 1JKQC 5ILUA 1U5TC 4EV0A 2WV1A 1OMIA 3QYEA 1T56A 2E35A 2Y9YA 2ZXJA 2L7KA 3FIWA 3VB2A 5D4RA 2LH9A 2VXDA 3TQNA 3ELKA 1Z6RA 2HS5A 4XM3A 3PO3J 2WAFA 2L9RA 4ZDPA 2IEKA 4IKFA 3O2PE 3GFJA 5FKKA 3EPZA 4BHPA 4AIJA 1RRJA 3BR5A 3K1MA 1VQ4I 3KX2A 5GPAA 4F7ZA 1OQYA 2HXOA 2DJNA 1X4OA 2VQGA 4DW6A 3BPVA 2ICWG 2HPIA 3GZ5A 2VT3A 3A03A 3BZKA 3QOEA 2L4AA 5F6FA 3OYJA 2OQGA 2BY0A 3IH3A 4UNOA 1KU3A 1R5GA 2F4MB 2LTPA 1I39A 4LITA 3MCZA 1RIOH 3ABTA 3FXKA 5HS8A 2LR8A 3DU5A 5A2QK 3SQNA 3ERMA 1YO5C 3MAJA 3MKLA 4L9JA 2QCOA 4PGGA 1AOYA 4CHUA 4IVNA 3W2VA 2RV8A 1HF0A 3K4LA 3OOUA 3F8FA 4M3EA 1M1EB 2Q1ZB 5LGUA 3FKIJ 3DLAA 3H0GJ 2XAGA 1K7AA 3LSJA 3HSEA 4JYKA 3ZMTA 2O6GE 1B8IA 2NVYJ 4BS9A 4IHYA 2RVCA 1ZRCA 4GO1A 3H9GA 2FQ3A 2V9VA 2ZSIB 1XMXA 2EV6A 1PP7U 3CP2A 2VQHA 2WB1A 1SMYF 4HV6A 1JJ6C 1BI0A 1ETYA 5M5YJ 2IT0A 3OSGA 2CFXA 3GZ6A 2DK5A 1PUFB 4BDZA 2R7WA 4XONA 3WTZA 4IHTA 1WJBA 2FBHA 2Z16A 4UV8A 3LSHA 2LY2A 3CCJI 2HOEA 2QZ8A 2XKPA 3KETA 4U88A 2I5UA 4ZZDA 2M3AA 4G7OF 2H1LA 5F1RA 3SJMA 3AFHA 3NWSA 2ESHA 4A5NA 2O5RA 3QU6A 5EZGA 2GIVA 1RESA 1S8NA 2CUJA 3HOTA 4EJOA 3WG9A 5CQGA 3DP7A 2EFPA 2Y2ZA 3DU6A 3PIOF 3K6GA 2AQFA 1V4RA 1S7OA 2UXNA 3FISA 3PL8A 1XGOA 3ZOBA 1YJ9I 2KRCA 4LG0A 2DFHA 4UXNA 1W4MA 3ZQLA 1ZARA 3I3LA 5FFXA 2HTSA 3OS1A 2CW0F 4IEJA 4Y17A 2Q2EA 1TW3A 4ZDLA 2DTRA 4Q48A 1I6HJ 4MTDA 1HXDA 1SD4A 3OYNA 3MKZA 4V19K 4N4NB 5F08A 1PP8F 1BC7C 3U2RA 3BC8A 2QSHX 4RDUA 4XLHA 1T08B 2K3FA 5JLXA 1G3WA 1OCOH 3S17J 2CW7A 2TDXA 5CVRA 1W0UA 2DPUA 3M07A 4AVPA 2QSGX 4DIQA 4L9TA 2XDVA 1HW2A 4N9HA 2MA3A 4CDGA 2FF4A 2LKSA 4IJAA 3ESWB 2RC4A 1WWXA 2EB7A 1I50J 3BWGA 2V1DA 3DF8A 2L01A 2NVXJ 4C3JJ 2JVHA 2FBIA 2Q8KA
chains in the Genus database with same CATH topology
5E1WA 3GFIA 1PDNC 1MZBA 4WK8F 2NYXA 2CQKA 4HDVA 4IPAA 3LQRA 3KLOA 1TBXA 4KA4A 2H09A 2Y0MA 3H3UA 1YW8A 3J81Z 3E5QA 1ODDA 1HBXG 1BI2A 3F8MA 3LAJA 1LB2A 1E17A 1ULYA 1KYWA 1R36A 4R1HA 1OYIA 2P6SA 1ZRDA 2ADUA 1XSDA 4KN7X 5DD8A 4JK1X 4KIFA 2VOOA 2E1CA 4JQFA 4KNYA 3IWZA 6PAXA 3D5LA 4P9FA 3RPQA 2UWMA 4KN4X 2A6HF 3KP2A 2ZNZA 2BE5F 1W7PD 2L02A 3WTUC 4XBFA 1J5YA 1HW5A 5DCFA 3WE2A 3L2CA 3R0AA 3Q9SA 4I0AA 4CICA 3LA7A 1RUNA 2R7DA 1PUEE 5ED4A 4LLNA 1VTNC 3HSRA 5LEJA 3G73A 5ICFA 2BYVE 2AXLA 3MEXA 1UB9A 3L09A 2IA2A 2EFOA 4A5MA 3FX3A 1LJ9A 1FP2A 3M8FA 3WGIA 1EH7A 5CVVA 1SFXA 4ESFA 2ELHA 3ABUA 3E97A 2GA1A 1B4AA 3LSTA 3FF5A 4IHSA 4A0YA 1W7PA 2K02A 4EM0B 3F8BA 4HW0A 2M8EA 5ICGA 5D5VB 4RAZA 1SFEA 4M9SA 4LLLA 3JW4A 3MFKA 4M6XA 3RDIA 2P5LC 2XUBA 2D45A 1G3SA 4LLGF 3ECHA 4HZFA 4U7BA 2PFBA 3ZPLA 4LD5A 4L9NA 3BPXA 1P2FA 4M9XA 2FA5A 2K4BA 3WU1B 4EJWA 5FD6A 4L0YB 5BQTA 2CGPA 5LLQA 5ICEA 4MQ9F 2ZBKA 1S7AA 4P5OA 2FU4A 1XSVA 1FLIA 5LGNA 1FYMA 1I5ZA 1ZLKA 3BJAA 3JTGA 5LHIA 3U9GA 3REOA 2VC0A 3TGNA 5J8FA 4PCQA 3T0YA 1MJBA 3EQLF 1J7KA 5K5QA 2L4MA 3FMRA 3RKWA 2ETHA 1W5SA 3M9AA 1H9TA 2PEXA 2Z99A 2V6CA 4M73A 3WTWC 1BM9A 1F4KA 3K2ZA 2JTVA 4UVAA 3JSPA 4OMYA 1DUXC 3SFZA 5LRSA 3R0JA 4ENJA 4MTEA 4DQ2A 3FXRA 1TTYA 5D5WB 1LVAA 2KRFA 4GCVA 3NQOA 3HRTA 3WE3A 2O61A 5D5XB 2OQRA 2QQ9A 4G8XA 2V79A 2X4HA 5D8LB 5JFRA 2BEOA 5HVQC 1LDDA 4A2UA 4OIPF 1ONVA 4LB6B 1QQIA 2BV6A 2VODA 1FZPB 1XSXA 4CO8A 4GGGA 2D1HA 5HDGA 5KVRA 1U5TA 2KJCA 1HQCA 5E8GA 1HKTA 2DW4A 2XHKA 1A04A 2MLGA 5F64A 2NNYA 3RYPA 2ZKZA 3KFWX 2HEOA 1MD0A 5BPDA 5D8KB 3ZMVA 1G4DA 2OBPA 2FOKA 1R1UA 2P7CB 3FZVA 4KUMA 4ETSA 1Y0UA 1K6OA 1YW7A 2RDPA 2XAQA 1ZLJA 4YIFA 3QU3A 4KIBA 1IRFA 3L00A 1O7FA 1XDSA 4EM2A 5BS6A 4MQVA 3V4GA 1DDNA 1ZN2A 2PI0A 3F6OA 3V8LA 4ESBA 4AIHA 3HOSA 4O3MA 3WGHA 1IN8A 3N97A 2MC3A 3ZQ7A 3KP4A 4B8XA 2WTEA 4ON0A 4OOIA 1QGPA 3QAHA 3ZMDA 3V7CA 1OYWA 3ZN0A 4AD9A 3VOEA 1BOAA 2D1VA 4P96A 3IRQA 2XAHA 4ZYHA 4RAYA 2V1UA 2F2EA 2FEZA 1RZ4A 2EV0A 1K79A 2K86A 5LGTA 4G7ZF 1ZHFA 3I71A 4WXHA 2OAZA 2YPRA 3WTTC 4XRFA 1I27A 2LF7A 2HR3A 2QM3A 3J7AO 1C0WA 4ZZLA 2WWYA 4HDUA 4LJZF 1REPC 1U2WA 3NRVA 4LGWA 1TQIA 2A68F 1ZAOA 5L3GA 1DP7P 1RNLA 2LNBA 2DI3A 3ZMZA 2QBYA 1U8RA 1R1VA 2DK8A 3LFKA 1FYLA 2GZWA 4RGRA 1S6LA 1YYVA 2FMYA 4EJTA 3BROA 1R00A 2DQRA 1KU9A 1T6SA 2QYOA 4Q5SF 2QENA 1YQAA 3CJNA 1WKMA 1BIBA 2C6YA 3KP5A 3K69A 4RS8A 3HHHA 2HFHA 4ZYEA 1IN6A 3HRMA 4I7HA 4CXFA 5HDNA 4ZYDA 1XMKA 2STTA 4Q4ZF 2NRAC 2P7VB 3R61A 3C7JA 2HYFA 3KE2A 5LBQA 1SFUA 2L3DA 2UZKA 2FE3A 3M1EA 1FBSA 2E1NA 1JHFA 1JHHA 4BQAA 3L7WA 1NHAA 3VODA 1ON1A 1STZA 2J5PA 4RB3C 2EFNA 2XASA 2OA4A 5E1ZB 4XLNF 1ZG3A 1R22A 2Z5UA 4HBLA 1DPUA 3C18A 4OIQF 3MQ0A 2IPQX 1HKQA 4RB0A 4H0EA 3IHUA 4M74A 4MEXF 4HF2A 1LEBA 5H6RA 3G3ZA 3MWMA 3TOAA 5H20A 2MH9A 5HLIA 2XIGA 4DNCA 2QVOA 1TNSA 5DDGA 1KQ0A 1LQ1A 3M7GA 2RKHA 2VOPA 2YSRA 2CO5A 4M72A 3E5XA 5TJJA 2QLZA 2DBBA 3CUOA 2NAZA 5DCMA 2GXGA 3RKYA 2GXBA 5CVUA 5K5RA 4R8HA 3K1PA 1ZREA 1Z7UA 3KLNA 4EM1A 5BOXA 1J2XA 4K2EA 1T2KA 1W5TA 2YU3A 1G3TA 1HSJA 2A61A 2ZMEB 4FHTA 1B9MA 1KGSA 4KFCA 4EJVA 1IN4A 5HLGA 1USTA 2Q0OA 4L9VA 1FNNA 1J9IA 1ZGAA 1G3YA 4EVIA 3JAMK 1F1ZA 3DPLC 3MZYA 1MDMB 3CUQB 3TO6A 2KIMA 5L3CA 3ROUA 1CF7B 4FX0A 5DCMB 2G9WA 3Q9VA 1ZGJA 1HKSA 1RI7A 3DFGA 5DD4A 1J59A 3GF2A 1O3TA 2ZO4A 1O3SA 4KYWA 1GXPA 4HV5A 3RIRA 4FX4A 4HLXA 4Y13A 3SZPA 3O6BB 2M1BA 3W6JB 3QPTA 4BHCA 5EEHA 2VBZA 4RGSA 3J80K 3O3KA 3TO9A 3E6DA 2PQ8A 5ICCA 3CUQA 3ML6A 5CVIA 2F5DA 4OU0A 2P5KA 3Q5FA 2RNJA 3ERED 5L3DA 2O8XA 2O03A 1G6NA 2IW5A 4PZJA 3DXJF 3K0LA 3ISPA 4AWXB 1FPQA 2Y48A 1D5VA 1Q1HA 4LMYA 1BJAA 1KA8A 2HQRA 5CYVA 2CWEA 2FNPA 2W25A 2ZMEA 4UHTA 4EGYA 2P5VA 1P92A 1AWCA 2HKXA 4YFNF 3GXOA 1LDJA 4BHBA 4U0YA 4IXAA 1OYYA 4IRIA 5LEKA 2DT5A 5EEGA 2R7FA 3S2WA 3TKYA 1OR7A 3KEOA 3HRUA 4EQQA 2E7WA 4HOBA 2XKOA 4PGHA 3I5UA 2RQPA 3SHFA 1IRGA 2O3FA 4N9IA 4G94A 3FMQA 3F21A 2QQBA 1BI3A 4WXDA 4U0WA 2IA1A 3C3WA 3BJOA 4BNCA 2P4WA 1KQ9A 3HIFA 3V8KA 3GX4X 1FOKA 2FXAA 1FT9A 2JPCA 2ACJA 2WC2A 1XD7A 2J5OA 3HSFA 3J80Z 5L3EA 1DPRA 2VBWA 2DU9A 2DAOA 4KT5C 4ZYGA 3EYIA 4Z2YA 2KIFA 4ASNA 3WU0A 4HQEA 3J81K 2E7XA 4R79A 5HS7A 5FO5A 3KP7A 1XGNA 2HQNA 5DEQA 4HX7A 2OZUA 3ZN1A 3CO7C 3I54A 1X3UA 5LHGA 3LAPA 5LRRA 4XSZF 2PMUA 3IKTA 2IA0A 5E8IA 3E3VA 1MDMA 2HZTA 4I02A 1MJAA 1XCVA 2LF8A 3V7RA 1FP1D 5FLXZ 2PBIA 4RGUA 3EETA 2L54A 3M8EA 3V7SA 2Z33A 2W24A 3TOBA 1D8JA 2P8TA 4HX8A 2CG4A 4L0ZB 3R6SA 2P6TA 2YX4A 1V3FA 1BI1A 4JBAA 5CVJA 4IRHA 3IRRA 2H94A 3PFIA 1JXSA 5J6XA 1IZ1A 4P9UA 1O3QA 3CUQC 4QLCU 4ENNA 4LFUA 2BBYA 3LA2A 3SZTA 3P9CA 2W57A 2VE8A 1I1SA 1J0RA 3LA3A 3HTUA 2EA2A 5L3BA 2F5CA 1EH6A 2W84A 4KDPA 2XVCA 5FGMA 3W6KB 3CLOA 2KIUA 2X0LA 2KKOA 1D3YA 1GXQA 3GFLA 4G7HF 1F9NA 2R3SA 2GWRA 3ECOA 1O57A 2G7UA 3EYYA 2HTJA 4L5JA 2COMA 3COAC 2VBXA 3BOQA 2ISYA 1I6XA 4CYDA 3DPTA 3I59A 1U6GA 3F8CA 3R60A 3GVAA 1T38A 5AIQA 4OIRF 2F5FA 2RGVA 3ZP5A 3JAMZ 2STWA 5HDKA 2FMLA 4N0BA 4HAMA 1SD6A 3T8RA 1R7JA 3EUHA 1QPMA 2VONA 1IN7A 3JSOA 2ZFWA 4O5VA 3HTSB 2QWWA 4I01A 2M87A 5JI6A 5HLHA 3GUDA 4P55A 4G9YA 2YR2A 1ZG1A 2M45A 2XAJA 1XDUA 3IWFA 3QPHA 2EJRA 3TDUC 4CZZA 3T5XA 5HOOA 1UFMA 2W85A 1QBJA 2JZYA 3MZHA 4HYEA 3FHZA 2JRTA 3WTYC 2JSCA 2VBYA 4ESJA 4E70A 5D6FA 1LDKB 4RB1A 4RGXA 2PMHA 1ZG5A 3L9FA 2PG4A 3OOPA 1OKRA 5D6EA 1LEAA 3U1DA 1IXSB 2HYGD 3BZ6A 3I64A 4WWCA 2K27A 4OINF 1YIOA 4UV9A 5TRDA 1QO0D 3DEUA 4KMFA 5E1XA 5HS9A 1XGMA 3QP5A 1P4AA 3PQKA 3FWEA 4YFKF 1CGPA 1H9GA 1EV7A 3VEPA 2MBFA 3EDPA 1QZZA 5E18F 1U3EM 1IXCA 3HHGA 5LHHA 1YS6A 1FBQA 2MH2A 4M6YA 2HDCA 1O3RA 3B02A 3GYHX 2ISZA 1WI9A 1FSHA 4FT8A 2A69F 2EFWA 5L3FA 2H27A 1JE8A 4BYYA 3GW2A 2IVMA 2LDUA 4GYIA 3F8NA 3I4PA 5H6QA 4EJUA 2EWNA 2XV4S 3F6VA 3RTRA 2ZJ2A 3P9KA 1KYZA 4I0BA 2HKOA 5AIPA 3IL2A 4CGZA 1FYKA 3K1NA 1Z6TA 3GWZA 1IXRC 3E5UA 1BC8C 3D0SA 2A3SA 2ESNA 2M30A 5DYMA 1Z9CA 3KEQA 1IAWA 4KIGA 1HSTA 1ON2A 1R5HA 3HRSA 5CJ9A 3BY6A 4WXCA 2IRFG 1U5TB 4D0PA 4ENKA 2K7LA 2CYYA 1H0MA 4WF2A 2LKPA 3IC7A 2VT2A 5ILSA 4A6DA 4KMUX 1B59A 1ZH5A 3P7NA 4Y15A 1L3LA 3F22A 4L5IA 3ULQB 4OMZA 2B0LA 4BH9A 5BMZA 2F5EA 3I0TA 4QWQA 4GXOA 3E6MA 5IT3A 4IF4A 4I2OA 4WX9A 2MLKA 5A2QZ 2H6CA 3KZYA 2RN7A 2IP2A 4U0VA 3WTVC 3N4MA 4A0XA 1UHWA 4MEYF 3RYRA 2Z3YA 4MNUA 3CTAA 4M9ZA 1FC3A 4U7DA 3JTHA 2H6BA 3C1DA 4I09A 1KQ8A 4AIKA 2HWVA 2MD5A 2AS5F 4A6EA 1K78A 1T39A 3R4KA 3KP6A 2EA4A 3H92A 3NEUA 4MHGA 3I58A 2PJPA 3E6BA 5KK1A 2OD5A 4NB5A 4YG2F 5E17F 2JT1A 5J8CA 2XGXA 2V1XA 2DLLA 1TQMA 1B9NA 3IKVA 4WCGA 2KJBA 1Z05A 1TNTA 1TQPA 5K1YA 5IT9K 4LK0F 2QBYB 1XB4A 3TO7A 1Z1DA 1IF1A 4PDKA 3H3ZA 5D4SA 1GVJA 1USSA 5ERIA 4BXUA 1P4WA 2NS0A 2YX7A 4KICA 2VN2A 4NQWA 3GO5A 2QUFA 5FB2A 1WRJA 2CSOA 2FBKA 3GFMA 2ZCWA 4YFXF 1WSUA 3E6CC 1LNWA 1ZRFA 1FSEA 1R23A 3T8TA 3ZMUA 1IW7F 4TV7A 4UVBA 4A12A 5FD5A 2EV5A 4HLYA 1MGTA 1SMTA 2IJLA 1HW1A 4RB2C 1JGSA 1WQ2A 4GYGA 2DPDA 3V8JA 2A5YB 4ZH4F 2O0YA 1XGSA 1CF7A 3WTSC 3AAFA 4I98B 3WGGA 1R58A 3HUGA 2VE9A 3DQVC 3QP6A 2LSOA 5CLSA 5BPIA 2FRHA 3HYIA 4L18B 3DKWA 4LG0B 1Z91A 3F72A 5ILVA 3QRFF 1BIAA 2D2WA 1O7LA 4NHJA 3GEZA 3KP3A 1YTYA 3BJ6A 2PN6A 1YW9A 4Q47A 1XN7A 2ZNYA 3F3XA 2PLYA 1MJ9A 2VC1A 1KU7A 5JHUA 2A07F 3FXUA 3PQJA 2GA2A 4IRGA 4HA8A 1QNTA 2XROA 1K78B 2GAUA 2OZ6A 3KZZA 3T1BA 1XCBA 1B1BA 3ZMSA 3LQQA 3SXYA 1YS7A 2EFQA 1GHCA 2WV0A 1SAXA 2DFIA 4OIOF 3BDDA 3B73A 3RI4A 5DV5A 2FSWA 3K9TA 3CDHA 5DUKA 1I1GA 5D5UB 1IN5A 2HGCA 3FM3A 3P9IA 4S04A 2GQQA 1ZYRF 4MGRA 2XAFA 5FLXK 1YLFA 4S05A 2FNAA 1SD5A 4HX4A 1S29A 4LK1F 1BBYA 2NNNA 3FM5A 3KCCA 3VFZA 3OV8A 4EGZA 4HQMA 1E2XA 4O6JA 1TLHB 3CO6C 1YG2A 4HF0A 5K5OA 3BP8A 4EMSA 1T0FA 1YFHA 1SD7A 1T98A 4HF1A 2EK5A 1W7PB 4YIIA 1P4XA 2BGCA 1FY7A 1UHMA 1QZYA 1U78A 1BN5A 4ENMA 1UCRA 3F23A 2G7HA 2JPBA 2OU2A 1FWZA 1EH8A 3RJPA 5JVTA 1R1TA 3QOPA 3I53A 3RPUA 1KU2A 2Z9OA 1MKMA 4G6DA 3FMSA 3WTXC 4M71A 2VXZA 3WODF 2K4JA 3GLXA 3LWFA 4BAYA 4B09A 1RUOA 2A6EF 3TDZC 4A0ZA 1D8KA 4UVCA 3RKXA 5E20A 5FFZA 4XSXF 5DUIA 1F5TA 5IT9Z 4XLPF 1IUYA 2QQAA 4UUVA 3FXQA 1XMAA 1P6RA 1FX7A 2DO7A 4G6QA 1OPCA 2Y75A 1L0OC 1B6AA 2XRNA 2DQLA 1FBUA 5AONA 4LB5A 5JR3A 2UXXA 1TW2A 3DV8A 1J75A 1S3JA 2M5WA 3I59B 5ILUA 1U5TC 4EV0A 1OMIA 2ZXJA 3VB2A 5D4RA 3TQNA 3ELKA 1Z6RA 2HS5A 3O2PE 3GFJA 4BHPA 4AIJA 3K1MA 4F7ZA 3BPVA 3GZ5A 2VT3A 5F6FA 2L4AA 2OQGA 4UNOA 1KU3A 1R5GA 3MCZA 1RIOH 3ABTA 5HS8A 5A2QK 3SQNA 1YO5C 3MAJA 4L9JA 4PGGA 1AOYA 4CHUA 4IVNA 2RV8A 3F8FA 5LGUA 2XAGA 1K7AA 3HSEA 3ZMTA 2O6GE 2RVCA 1ZRCA 4GO1A 2FQ3A 2V9VA 2EV6A 1PP7U 1SMYF 4HV6A 1BI0A 2IT0A 2CFXA 3GZ6A 2DK5A 3WTZA 4IHTA 2FBHA 4UV8A 2HOEA 2QZ8A 2XKPA 3KETA 4U88A 4ZZDA 4G7OF 5F1RA 2ESHA 4A5NA 3QU6A 2GIVA 1S8NA 3HOTA 4EJOA 3WG9A 3DP7A 2EFPA 1V4RA 1S7OA 2UXNA 1XGOA 4LG0A 4UXNA 1W4MA 1ZARA 5FFXA 2HTSA 2CW0F 4Y17A 2Q2EA 1TW3A 2DTRA 4Q48A 4MTDA 1HXDA 1SD4A 1PP8F 1BC7C 3U2RA 1G3WA 2TDXA 5CVRA 2DPUA 4AVPA 4L9TA 1HW2A 4N9HA 2MA3A 4CDGA 2FF4A 4IJAA 2RC4A 1WWXA 2EB7A 3BWGA 3DF8A 2V1DA 2L01A 2FBIA 2Q8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E1W A;  3GFI A;  1PDN C;  1MZB A;  4WK8 F;  2NYX A;  2CQK A;  4HDV A;  4IPA A;  3LQR A;  3KLO A;  1TBX A;  4KA4 A;  2H09 A;  2Y0M A;  3H3U A;  1YW8 A;  3J81 Z;  3E5Q A;  1ODD A;  1HBX G;  1BI2 A;  3F8M A;  3LAJ A;  1LB2 A;  1E17 A;  1ULY A;  1KYW A;  1R36 A;  4R1H A;  1OYI A;  2P6S A;  1ZRD A;  2ADU A;  1XSD A;  4KN7 X;  5DD8 A;  4JK1 X;  4KIF A;  2VOO A;  2E1C A;  4JQF A;  4KNY A;  3IWZ A;  6PAX A;  3D5L A;  4P9F A;  3RPQ A;  2UWM A;  4KN4 X;  2A6H F;  3KP2 A;  2ZNZ A;  2BE5 F;  1W7P D;  2L02 A;  3WTU C;  4XBF A;  1J5Y A;  1HW5 A;  5DCF A;  3WE2 A;  3L2C A;  3R0A A;  3Q9S A;  4I0A A;  4CIC A;  3LA7 A;  1RUN A;  2R7D A;  1PUE E;  5ED4 A;  4LLN A;  1VTN C;  3HSR A;  5LEJ A;  3G73 A;  5ICF A;  2BYV E;  2AXL A;  3MEX A;  1UB9 A;  3L09 A;  2IA2 A;  2EFO A;  4A5M A;  3FX3 A;  1LJ9 A;  1FP2 A;  3M8F A;  3WGI A;  1EH7 A;  5CVV A;  1SFX A;  4ESF A;  2ELH A;  3ABU A;  3E97 A;  2GA1 A;  1B4A A;  3LST A;  3FF5 A;  4IHS A;  4A0Y A;  1W7P A;  2K02 A;  4EM0 B;  3F8B A;  4HW0 A;  2M8E A;  5ICG A;  5D5V B;  4RAZ A;  1SFE A;  4M9S A;  4LLL A;  3JW4 A;  3MFK A;  4M6X A;  3RDI A;  2P5L C;  2XUB A;  2D45 A;  1G3S A;  4LLG F;  3ECH A;  4HZF A;  4U7B A;  2PFB A;  3ZPL A;  4LD5 A;  4L9N A;  3BPX A;  1P2F A;  4M9X A;  2FA5 A;  2K4B A;  3WU1 B;  4EJW A;  5FD6 A;  4L0Y B;  5BQT A;  2CGP A;  5LLQ A;  5ICE A;  4MQ9 F;  2ZBK A;  1S7A A;  4P5O A;  2FU4 A;  1XSV A;  1FLI A;  5LGN A;  1FYM A;  1I5Z A;  1ZLK A;  3BJA A;  3JTG A;  5LHI A;  3U9G A;  3REO A;  2VC0 A;  3TGN A;  5J8F A;  4PCQ A;  3T0Y A;  1MJB A;  3EQL F;  1J7K A;  5K5Q A;  2L4M A;  3FMR A;  3RKW A;  2ETH A;  1W5S A;  3M9A A;  1H9T A;  2PEX A;  2Z99 A;  2V6C A;  4M73 A;  3WTW C;  1BM9 A;  1F4K A;  3K2Z A;  2JTV A;  4UVA A;  3JSP A;  4OMY A;  1DUX C;  3SFZ A;  5LRS A;  3R0J A;  4ENJ A;  4MTE A;  4DQ2 A;  3FXR A;  1TTY A;  5D5W B;  1LVA A;  2KRF A;  4GCV A;  3NQO A;  3HRT A;  3WE3 A;  2O61 A;  5D5X B;  2OQR A;  2QQ9 A;  4G8X A;  2V79 A;  2X4H A;  5D8L B;  5JFR A;  2BEO A;  5HVQ C;  1LDD A;  4A2U A;  4OIP F;  1ONV A;  4LB6 B;  1QQI A;  2BV6 A;  2VOD A;  1FZP B;  1XSX A;  4CO8 A;  4GGG A;  2D1H A;  5HDG A;  5KVR A;  1U5T A;  2KJC A;  1HQC A;  5E8G A;  1HKT A;  2DW4 A;  2XHK A;  1A04 A;  2MLG A;  5F64 A;  2NNY A;  3RYP A;  2ZKZ A;  3KFW X;  2HEO A;  1MD0 A;  5BPD A;  5D8K B;  3ZMV A;  1G4D A;  2OBP A;  2FOK A;  1R1U A;  2P7C B;  3FZV A;  4KUM A;  4ETS A;  1Y0U A;  1K6O A;  1YW7 A;  2RDP A;  2XAQ A;  1ZLJ A;  4YIF A;  3QU3 A;  4KIB A;  1IRF A;  3L00 A;  1O7F A;  1XDS A;  4EM2 A;  5BS6 A;  4MQV A;  3V4G A;  1DDN A;  1ZN2 A;  2PI0 A;  3F6O A;  3V8L A;  4ESB A;  4AIH A;  3HOS A;  4O3M A;  3WGH A;  1IN8 A;  3N97 A;  2MC3 A;  3ZQ7 A;  3KP4 A;  4B8X A;  2WTE A;  4ON0 A;  4OOI A;  1QGP A;  3QAH A;  3ZMD A;  3V7C A;  1OYW A;  3ZN0 A;  4AD9 A;  3VOE A;  1BOA A;  2D1V A;  4P96 A;  3IRQ A;  2XAH A;  4ZYH A;  4RAY A;  2V1U A;  2F2E A;  2FEZ A;  1RZ4 A;  2EV0 A;  1K79 A;  2K86 A;  5LGT A;  4G7Z F;  1ZHF A;  3I71 A;  4WXH A;  2OAZ A;  2YPR A;  3WTT C;  4XRF A;  1I27 A;  2LF7 A;  2HR3 A;  2QM3 A;  3J7A O;  1C0W A;  4ZZL A;  2WWY A;  4HDU A;  4LJZ F;  1REP C;  1U2W A;  3NRV A;  4LGW A;  1TQI A;  2A68 F;  1ZAO A;  5L3G A;  1DP7 P;  1RNL A;  2LNB A;  2DI3 A;  3ZMZ A;  2QBY A;  1U8R A;  1R1V A;  2DK8 A;  3LFK A;  1FYL A;  2GZW A;  4RGR A;  1S6L A;  1YYV A;  2FMY A;  4EJT A;  3BRO A;  1R00 A;  2DQR A;  1KU9 A;  1T6S A;  2QYO A;  4Q5S F;  2QEN A;  1YQA A;  3CJN A;  1WKM A;  1BIB A;  2C6Y A;  3KP5 A;  3K69 A;  4RS8 A;  3HHH A;  2HFH A;  4ZYE A;  1IN6 A;  3HRM A;  4I7H A;  4CXF A;  5HDN A;  4ZYD A;  1XMK A;  2STT A;  4Q4Z F;  2NRA C;  2P7V B;  3R61 A;  3C7J A;  2HYF A;  3KE2 A;  5LBQ A;  1SFU A;  2L3D A;  2UZK A;  2FE3 A;  3M1E A;  1FBS A;  2E1N A;  1JHF A;  1JHH A;  4BQA A;  3L7W A;  1NHA A;  3VOD A;  1ON1 A;  1STZ A;  2J5P A;  4RB3 C;  2EFN A;  2XAS A;  2OA4 A;  5E1Z B;  4XLN F;  1ZG3 A;  1R22 A;  2Z5U A;  4HBL A;  1DPU A;  3C18 A;  4OIQ F;  3MQ0 A;  2IPQ X;  1HKQ A;  4RB0 A;  4H0E A;  3IHU A;  4M74 A;  4MEX F;  4HF2 A;  1LEB A;  5H6R A;  3G3Z A;  3MWM A;  3TOA A;  5H20 A;  2MH9 A;  5HLI A;  2XIG A;  4DNC A;  2QVO A;  1TNS A;  5DDG A;  1KQ0 A;  1LQ1 A;  3M7G A;  2RKH A;  2VOP A;  2YSR A;  2CO5 A;  4M72 A;  3E5X A;  5TJJ A;  2QLZ A;  2DBB A;  3CUO A;  2NAZ A;  5DCM A;  2GXG A;  3RKY A;  2GXB A;  5CVU A;  5K5R A;  4R8H A;  3K1P A;  1ZRE A;  1Z7U A;  3KLN A;  4EM1 A;  5BOX A;  1J2X A;  4K2E A;  1T2K A;  1W5T A;  2YU3 A;  1G3T A;  1HSJ A;  2A61 A;  2ZME B;  4FHT A;  1B9M A;  1KGS A;  4KFC A;  4EJV A;  1IN4 A;  5HLG A;  1UST A;  2Q0O A;  4L9V A;  1FNN A;  1J9I A;  1ZGA A;  1G3Y A;  4EVI A;  3JAM K;  1F1Z A;  3DPL C;  3MZY A;  1MDM B;  3CUQ B;  3TO6 A;  2KIM A;  5L3C A;  3ROU A;  1CF7 B;  4FX0 A;  5DCM B;  2G9W A;  3Q9V A;  1ZGJ A;  1HKS A;  1RI7 A;  3DFG A;  5DD4 A;  1J59 A;  3GF2 A;  1O3T A;  2ZO4 A;  1O3S A;  4KYW A;  1GXP A;  4HV5 A;  3RIR A;  4FX4 A;  4HLX A;  4Y13 A;  3SZP A;  3O6B B;  2M1B A;  3W6J B;  3QPT A;  4BHC A;  5EEH A;  2VBZ A;  4RGS A;  3J80 K;  3O3K A;  3TO9 A;  3E6D A;  2PQ8 A;  5ICC A;  3CUQ A;  3ML6 A;  5CVI A;  2F5D A;  4OU0 A;  2P5K A;  3Q5F A;  2RNJ A;  3ERE D;  5L3D A;  2O8X A;  2O03 A;  1G6N A;  2IW5 A;  4PZJ A;  3DXJ F;  3K0L A;  3ISP A;  4AWX B;  1FPQ A;  2Y48 A;  1D5V A;  1Q1H A;  4LMY A;  1BJA A;  1KA8 A;  2HQR A;  5CYV A;  2CWE A;  2FNP A;  2W25 A;  2ZME A;  4UHT A;  4EGY A;  2P5V A;  1P92 A;  1AWC A;  2HKX A;  4YFN F;  3GXO A;  1LDJ A;  4BHB A;  4U0Y A;  4IXA A;  1OYY A;  4IRI A;  5LEK A;  2DT5 A;  5EEG A;  2R7F A;  3S2W A;  3TKY A;  1OR7 A;  3KEO A;  3HRU A;  4EQQ A;  2E7W A;  4HOB A;  2XKO A;  4PGH A;  3I5U A;  2RQP A;  3SHF A;  1IRG A;  2O3F A;  4N9I A;  4G94 A;  3FMQ A;  3F21 A;  2QQB A;  1BI3 A;  4WXD A;  4U0W A;  2IA1 A;  3C3W A;  3BJO A;  4BNC A;  2P4W A;  1KQ9 A;  3HIF A;  3V8K A;  3GX4 X;  1FOK A;  2FXA A;  1FT9 A;  2JPC A;  2ACJ A;  2WC2 A;  1XD7 A;  2J5O A;  3HSF A;  3J80 Z;  5L3E A;  1DPR A;  2VBW A;  2DU9 A;  2DAO A;  4KT5 C;  4ZYG A;  3EYI A;  4Z2Y A;  2KIF A;  4ASN A;  3WU0 A;  4HQE A;  3J81 K;  2E7X A;  4R79 A;  5HS7 A;  5FO5 A;  3KP7 A;  1XGN A;  2HQN A;  5DEQ A;  4HX7 A;  2OZU A;  3ZN1 A;  3CO7 C;  3I54 A;  1X3U A;  5LHG A;  3LAP A;  5LRR A;  4XSZ F;  2PMU A;  3IKT A;  2IA0 A;  5E8I A;  3E3V A;  1MDM A;  2HZT A;  4I02 A;  1MJA A;  1XCV A;  2LF8 A;  3V7R A;  1FP1 D;  5FLX Z;  2PBI A;  4RGU A;  3EET A;  2L54 A;  3M8E A;  3V7S A;  2Z33 A;  2W24 A;  3TOB A;  1D8J A;  2P8T A;  4HX8 A;  2CG4 A;  4L0Z B;  3R6S A;  2P6T A;  2YX4 A;  1V3F A;  1BI1 A;  4JBA A;  5CVJ A;  4IRH A;  3IRR A;  2H94 A;  3PFI A;  1JXS A;  5J6X A;  1IZ1 A;  4P9U A;  1O3Q A;  3CUQ C;  4QLC U;  4ENN A;  4LFU A;  2BBY A;  3LA2 A;  3SZT A;  3P9C A;  2W57 A;  2VE8 A;  1I1S A;  1J0R A;  3LA3 A;  3HTU A;  2EA2 A;  5L3B A;  2F5C A;  1EH6 A;  2W84 A;  4KDP A;  2XVC A;  5FGM A;  3W6K B;  3CLO A;  2KIU A;  2X0L A;  2KKO A;  1D3Y A;  1GXQ A;  3GFL A;  4G7H F;  1F9N A;  2R3S A;  2GWR A;  3ECO A;  1O57 A;  2G7U A;  3EYY A;  2HTJ A;  4L5J A;  2COM A;  3COA C;  2VBX A;  3BOQ A;  2ISY A;  1I6X A;  4CYD A;  3DPT A;  3I59 A;  1U6G A;  3F8C A;  3R60 A;  3GVA A;  1T38 A;  5AIQ A;  4OIR F;  2F5F A;  2RGV A;  3ZP5 A;  3JAM Z;  2STW A;  5HDK A;  2FML A;  4N0B A;  4HAM A;  1SD6 A;  3T8R A;  1R7J A;  3EUH A;  1QPM A;  2VON A;  1IN7 A;  3JSO A;  2ZFW A;  4O5V A;  3HTS B;  2QWW A;  4I01 A;  2M87 A;  5JI6 A;  5HLH A;  3GUD A;  4P55 A;  4G9Y A;  2YR2 A;  1ZG1 A;  2M45 A;  2XAJ A;  1XDU A;  3IWF A;  3QPH A;  2EJR A;  3TDU C;  4CZZ A;  3T5X A;  5HOO A;  1UFM A;  2W85 A;  1QBJ A;  2JZY A;  3MZH A;  4HYE A;  3FHZ A;  2JRT A;  3WTY C;  2JSC A;  2VBY A;  4ESJ A;  4E70 A;  5D6F A;  1LDK B;  4RB1 A;  4RGX A;  2PMH A;  1ZG5 A;  3L9F A;  2PG4 A;  3OOP A;  1OKR A;  5D6E A;  1LEA A;  3U1D A;  1IXS B;  2HYG D;  3BZ6 A;  3I64 A;  4WWC A;  2K27 A;  4OIN F;  1YIO A;  4UV9 A;  5TRD A;  1QO0 D;  3DEU A;  4KMF A;  5E1X A;  5HS9 A;  1XGM A;  3QP5 A;  1P4A A;  3PQK A;  3FWE A;  4YFK F;  1CGP A;  1H9G A;  1EV7 A;  3VEP A;  2MBF A;  3EDP A;  1QZZ A;  5E18 F;  1U3E M;  1IXC A;  3HHG A;  5LHH A;  1YS6 A;  1FBQ A;  2MH2 A;  4M6Y A;  2HDC A;  1O3R A;  3B02 A;  3GYH X;  2ISZ A;  1WI9 A;  1FSH A;  4FT8 A;  2A69 F;  2EFW A;  5L3F A;  2H27 A;  1JE8 A;  4BYY A;  3GW2 A;  2IVM A;  2LDU A;  4GYI A;  3F8N A;  3I4P A;  5H6Q A;  4EJU A;  2EWN A;  2XV4 S;  3F6V A;  3RTR A;  2ZJ2 A;  3P9K A;  1KYZ A;  4I0B A;  2HKO A;  5AIP A;  3IL2 A;  4CGZ A;  1FYK A;  3K1N A;  1Z6T A;  3GWZ A;  1IXR C;  3E5U A;  1BC8 C;  3D0S A;  2A3S A;  2ESN A;  2M30 A;  5DYM A;  1Z9C A;  3KEQ A;  1IAW A;  4KIG A;  1HST A;  1ON2 A;  1R5H A;  3HRS A;  5CJ9 A;  3BY6 A;  4WXC A;  2IRF G;  1U5T B;  4D0P A;  4ENK A;  2K7L A;  2CYY A;  1H0M A;  4WF2 A;  2LKP A;  3IC7 A;  2VT2 A;  5ILS A;  4A6D A;  4KMU X;  1B59 A;  1ZH5 A;  3P7N A;  4Y15 A;  1L3L A;  3F22 A;  4L5I A;  3ULQ B;  4OMZ A;  2B0L A;  4BH9 A;  5BMZ A;  2F5E A;  3I0T A;  4QWQ A;  4GXO A;  3E6M A;  5IT3 A;  4IF4 A;  4I2O A;  4WX9 A;  2MLK A;  5A2Q Z;  2H6C A;  3KZY A;  2RN7 A;  2IP2 A;  4U0V A;  3WTV C;  3N4M A;  4A0X A;  1UHW A;  4MEY F;  3RYR A;  2Z3Y A;  4MNU A;  3CTA A;  4M9Z A;  1FC3 A;  4U7D A;  3JTH A;  2H6B A;  3C1D A;  4I09 A;  1KQ8 A;  4AIK A;  2HWV A;  2MD5 A;  2AS5 F;  4A6E A;  1K78 A;  1T39 A;  3R4K A;  3KP6 A;  2EA4 A;  3H92 A;  3NEU A;  4MHG A;  3I58 A;  2PJP A;  3E6B A;  5KK1 A;  2OD5 A;  4NB5 A;  4YG2 F;  5E17 F;  2JT1 A;  5J8C A;  2XGX A;  2V1X A;  2DLL A;  1TQM A;  1B9N A;  3IKV A;  4WCG A;  2KJB A;  1Z05 A;  1TNT A;  1TQP A;  5K1Y A;  5IT9 K;  4LK0 F;  2QBY B;  1XB4 A;  3TO7 A;  1Z1D A;  1IF1 A;  4PDK A;  3H3Z A;  5D4S A;  1GVJ A;  1USS A;  5ERI A;  4BXU A;  1P4W A;  2NS0 A;  2YX7 A;  4KIC A;  2VN2 A;  4NQW A;  3GO5 A;  2QUF A;  5FB2 A;  1WRJ A;  2CSO A;  2FBK A;  3GFM A;  2ZCW A;  4YFX F;  1WSU A;  3E6C C;  1LNW A;  1ZRF A;  1FSE A;  1R23 A;  3T8T A;  3ZMU A;  1IW7 F;  4TV7 A;  4UVB A;  4A12 A;  5FD5 A;  2EV5 A;  4HLY A;  1MGT A;  1SMT A;  2IJL A;  1HW1 A;  4RB2 C;  1JGS A;  1WQ2 A;  4GYG A;  2DPD A;  3V8J A;  2A5Y B;  4ZH4 F;  2O0Y A;  1XGS A;  1CF7 A;  3WTS C;  3AAF A;  4I98 B;  3WGG A;  1R58 A;  3HUG A;  2VE9 A;  3DQV C;  3QP6 A;  2LSO A;  5CLS A;  5BPI A;  2FRH A;  3HYI A;  4L18 B;  3DKW A;  4LG0 B;  1Z91 A;  3F72 A;  5ILV A;  3QRF F;  1BIA A;  2D2W A;  1O7L A;  4NHJ A;  3GEZ A;  3KP3 A;  1YTY A;  3BJ6 A;  2PN6 A;  1YW9 A;  4Q47 A;  1XN7 A;  2ZNY A;  3F3X A;  2PLY A;  1MJ9 A;  2VC1 A;  1KU7 A;  5JHU A;  2A07 F;  3FXU A;  3PQJ A;  2GA2 A;  4IRG A;  4HA8 A;  1QNT A;  2XRO A;  1K78 B;  2GAU A;  2OZ6 A;  3KZZ A;  3T1B A;  1XCB A;  1B1B A;  3ZMS A;  3LQQ A;  3SXY A;  1YS7 A;  2EFQ A;  1GHC A;  2WV0 A;  1SAX A;  2DFI A;  4OIO F;  3BDD A;  3B73 A;  3RI4 A;  5DV5 A;  2FSW A;  3K9T A;  3CDH A;  5DUK A;  1I1G A;  5D5U B;  1IN5 A;  2HGC A;  3FM3 A;  3P9I A;  4S04 A;  2GQQ A;  1ZYR F;  4MGR A;  2XAF A;  5FLX K;  1YLF A;  4S05 A;  2FNA A;  1SD5 A;  4HX4 A;  1S29 A;  4LK1 F;  1BBY A;  2NNN A;  3FM5 A;  3KCC A;  3VFZ A;  3OV8 A;  4EGZ A;  4HQM A;  1E2X A;  4O6J A;  1TLH B;  3CO6 C;  1YG2 A;  4HF0 A;  5K5O A;  3BP8 A;  4EMS A;  1T0F A;  1YFH A;  1SD7 A;  1T98 A;  4HF1 A;  2EK5 A;  1W7P B;  4YII A;  1P4X A;  2BGC A;  1FY7 A;  1UHM A;  1QZY A;  1U78 A;  1BN5 A;  4ENM A;  1UCR A;  3F23 A;  2G7H A;  2JPB A;  2OU2 A;  1FWZ A;  1EH8 A;  3RJP A;  5JVT A;  1R1T A;  3QOP A;  3I53 A;  3RPU A;  1KU2 A;  2Z9O A;  1MKM A;  4G6D A;  3FMS A;  3WTX C;  4M71 A;  2VXZ A;  3WOD F;  2K4J A;  3GLX A;  3LWF A;  4BAY A;  4B09 A;  1RUO A;  2A6E F;  3TDZ C;  4A0Z A;  1D8K A;  4UVC A;  3RKX A;  5E20 A;  5FFZ A;  4XSX F;  5DUI A;  1F5T A;  5IT9 Z;  4XLP F;  1IUY A;  2QQA A;  4UUV A;  3FXQ A;  1XMA A;  1P6R A;  1FX7 A;  2DO7 A;  4G6Q A;  1OPC A;  2Y75 A;  1L0O C;  1B6A A;  2XRN A;  2DQL A;  1FBU A;  5AON A;  4LB5 A;  5JR3 A;  2UXX A;  1TW2 A;  3DV8 A;  1J75 A;  1S3J A;  2M5W A;  3I59 B;  5ILU A;  1U5T C;  4EV0 A;  1OMI A;  2ZXJ A;  3VB2 A;  5D4R A;  3TQN A;  3ELK A;  1Z6R A;  2HS5 A;  3O2P E;  3GFJ A;  4BHP A;  4AIJ A;  3K1M A;  4F7Z A;  3BPV A;  3GZ5 A;  2VT3 A;  5F6F A;  2L4A A;  2OQG A;  4UNO A;  1KU3 A;  1R5G A;  3MCZ A;  1RIO H;  3ABT A;  5HS8 A;  5A2Q K;  3SQN A;  1YO5 C;  3MAJ A;  4L9J A;  4PGG A;  1AOY A;  4CHU A;  4IVN A;  2RV8 A;  3F8F A;  5LGU A;  2XAG A;  1K7A A;  3HSE A;  3ZMT A;  2O6G E;  2RVC A;  1ZRC A;  4GO1 A;  2FQ3 A;  2V9V A;  2EV6 A;  1PP7 U;  1SMY F;  4HV6 A;  1BI0 A;  2IT0 A;  2CFX A;  3GZ6 A;  2DK5 A;  3WTZ A;  4IHT A;  2FBH A;  4UV8 A;  2HOE A;  2QZ8 A;  2XKP A;  3KET A;  4U88 A;  4ZZD A;  4G7O F;  5F1R A;  2ESH A;  4A5N A;  3QU6 A;  2GIV A;  1S8N A;  3HOT A;  4EJO A;  3WG9 A;  3DP7 A;  2EFP A;  1V4R A;  1S7O A;  2UXN A;  1XGO A;  4LG0 A;  4UXN A;  1W4M A;  1ZAR A;  5FFX A;  2HTS A;  2CW0 F;  4Y17 A;  2Q2E A;  1TW3 A;  2DTR A;  4Q48 A;  4MTD A;  1HXD A;  1SD4 A;  1PP8 F;  1BC7 C;  3U2R A;  1G3W A;  2TDX A;  5CVR A;  2DPU A;  4AVP A;  4L9T A;  1HW2 A;  4N9H A;  2MA3 A;  4CDG A;  2FF4 A;  4IJA A;  2RC4 A;  1WWX A;  2EB7 A;  3BWG A;  3DF8 A;  2V1D A;  2L01 A;  2FBI A;  2Q8K A; 
#chains in the Genus database with same CATH topology
 2YUS A;  5E1W A;  3GFI A;  1PDN C;  1MZB A;  4CCK A;  4WK8 F;  2NYX A;  1UZC A;  2CQK A;  4HDV A;  2V1N A;  4RMN A;  4IPA A;  2DCE A;  2M34 A;  3LQR A;  4BQQ A;  3RCO A;  2VJI A;  3KLO A;  1TBX A;  4KA4 A;  1SFO J;  2ELK A;  2H09 A;  1U9O A;  2Y0M A;  3H3U A;  1YW8 A;  3E1S A;  2EPF A;  3E5Q A;  1ODD A;  1QHH D;  2BOL A;  3J81 Z;  1BI2 A;  2XGC A;  3OYG A;  1HBX G;  2MYS A;  3F8M A;  3LAJ A;  1LB2 A;  1E17 A;  1ULY A;  3FXL A;  2F4O B;  4A3K J;  1KYW A;  1R36 A;  4R1H A;  1OYI A;  2P6S A;  1ZRD A;  2ADU A;  1XSD A;  3HOW J;  4KN7 X;  5DD8 A;  2JQ7 A;  3TW7 A;  4JK1 X;  3H5R A;  4KIF A;  2VOO A;  2E1C A;  3LFU A;  3LL7 A;  3DBR B;  4A3C J;  2HYJ A;  4JQF A;  3H9J A;  3IAS 2;  4KNY A;  3IWZ A;  3U1K A;  6PAX A;  5GTH C;  3D5L A;  3LSG A;  3DEW A;  4P9F A;  3HZJ A;  4BE2 A;  3RPQ A;  2UWM A;  2KFD A;  4XR6 A;  4KN4 X;  3BR2 A;  2R7Z J;  1A36 A;  4NDL A;  5EZH A;  5IYD J;  2A6H F;  3KP2 A;  4NNJ A;  4AYB A;  1VQ6 I;  4X0G A;  3GTQ J;  3BG6 A;  2ZNZ A;  2E5Z A;  2BE5 F;  4QSH A;  1W7P D;  4Z6Y A;  2L02 A;  3WTU C;  4XBF A;  1TWC J;  1J5Y A;  1HW5 A;  5DCF A;  3WE2 A;  3L2C A;  2VPL A;  3R0A A;  2EZL A;  2M7B A;  2EH3 A;  3Q9S A;  1MMG A;  4I0A A;  4CIC A;  3LA7 A;  1RUN A;  2CW8 A;  2R7D A;  2ZSH B;  4S0H B;  1PUE E;  2DA5 A;  2V26 A;  2K9Q A;  5K7F A;  5ED4 A;  2IGO A;  4LLN A;  1R5I D;  3OYC A;  1QPI A;  2R7O A;  2QSF X;  1VTN C;  3HSR A;  5LEJ A;  3G73 A;  3WHC A;  1T95 A;  5ICF A;  4ZYA A;  2BYV E;  2AXL A;  2M0M A;  4NC8 A;  1A6Q A;  3AG3 H;  3MEX A;  4E7L A;  1UB9 A;  3L09 A;  5E79 C;  5CQE A;  3K4M A;  3OIQ A;  2IA2 A;  2EFO A;  4A5M A;  4Y7N J;  3FX3 A;  3J7Z I;  1LJ9 A;  1FP2 A;  1PVE A;  2ZB9 A;  3A0H C;  3M8F A;  3WGI A;  1EH7 A;  3OYL A;  5CVV A;  5B3S H;  1Y8R B;  3G1O A;  2HDD A;  4BKX A;  1SFX A;  4ESF A;  2ELH A;  3ABU A;  3E97 A;  5J4V A;  2GA1 A;  2AXT C;  1B4A A;  2Y69 H;  3OWT A;  3JRI A;  4A3I J;  1ZGW A;  3LST A;  3FF5 A;  4IHS A;  4A0Y A;  3IUO A;  2E2J J;  5E3O A;  1W7P A;  1ZK8 A;  2K02 A;  3Q0V A;  4EM0 B;  3F8B A;  4HW0 A;  3V42 A;  1NG6 A;  2M8E A;  3SDB A;  5ICG A;  1D1C A;  3BR6 A;  3OIP A;  4PFP A;  5D5V B;  1K4S A;  1VQK I;  4RAZ A;  1JKO C;  1SFE A;  4C2U A;  2JVG A;  2AQE A;  3B6A A;  4M9S A;  4LLL A;  5J40 A;  3L2Q A;  3JW4 A;  2P0W A;  3MFK A;  2FQ4 A;  1QA6 A;  3MZ8 A;  4M6X A;  3RDI A;  2P5L C;  3HUG B;  4C2T A;  2XUB A;  3HEF A;  2D45 A;  3K70 C;  2CJJ A;  1G3S A;  1IRZ A;  2XB5 A;  3M3Y J;  3HOU J;  2KIS A;  3CCV I;  2L0K A;  4E7S A;  4LLG F;  3ECH A;  4HZF A;  5JHF A;  4U7B A;  2PFB A;  3ZPL A;  4LD5 A;  1VI0 A;  4L9N A;  3BPX A;  1P2F A;  4F91 B;  4M9X A;  3AG1 H;  2FA5 A;  2KZG A;  2K4B A;  3WU1 B;  2GM4 A;  4EJW A;  5FD6 A;  2X6Y A;  4L0Y B;  5BQT A;  2CGP A;  5LLQ A;  4E7K A;  3PNV A;  1UMQ A;  2L7M P;  3ZQF A;  2R0Q C;  2YS9 A;  2B7E A;  4MQ9 F;  2ZBK A;  1S7A A;  3AG2 H;  4P5O A;  5ICE A;  3LNQ A;  2FU4 A;  3TP3 A;  5M3F J;  1XSV A;  2R7Q A;  3BLY A;  1FLI A;  3ZQG A;  1AU7 A;  5LGN A;  1FYM A;  1I5Z A;  1ZLK A;  3UR3 C;  4B1R A;  1D1B A;  2M0C A;  5IYC J;  1YHQ I;  3BJA A;  3JTG A;  5LHI A;  4LIV A;  3OYH A;  3U9G A;  3REO A;  4IQ4 A;  2VJ4 A;  2VC0 A;  4C2M J;  3OL4 A;  1QVT A;  3RPU D;  1Y0N A;  3TGN A;  2DYS H;  5J8F A;  3L2U A;  4PCQ A;  3T0Y A;  1MJB A;  3EQL F;  1J7K A;  5K5Q A;  4CYC B;  2L4M A;  2X6O A;  5GAD J;  5GTI C;  3FMR A;  3RKW A;  1R4M B;  2ETH A;  1W5S A;  3M9A A;  4ZTF A;  3OYM A;  1MBK A;  1H9T A;  4OAZ A;  1JKR C;  1V55 H;  1H89 C;  2HOS A;  2NS8 A;  3ASO H;  2PEX A;  2Z99 A;  4E7I A;  2V6C A;  4XKB A;  1IGN A;  4M73 A;  3WTW C;  3FK7 A;  1BM9 A;  1TWG J;  4XL9 A;  1F4K A;  2ZJQ F;  3K2Z A;  3K4N A;  2JTV A;  4UVA A;  3JSP A;  4OMY A;  2NVT J;  3BTI A;  1DUX C;  3H5A A;  4E4H A;  3SFZ A;  2GIZ A;  5LRS A;  1ITY A;  2EIK H;  3R0J A;  1VND A;  4ENJ A;  4MTE A;  3K4B A;  2M8G X;  4DQ2 A;  5LFA A;  4UY8 I;  2W00 A;  3FXR A;  1MMD A;  1XG1 A;  1TTY A;  5D5W B;  1LVA A;  2KDO A;  3C2B A;  2KRF A;  4GCV A;  4XMY A;  2GOX B;  4PSW A;  2E5N A;  3NQO A;  3C2H A;  2MAB A;  1Z7L A;  3HRT A;  3WE3 A;  1LPQ A;  2O61 A;  3GZN B;  5D5X B;  2OQR A;  4XOP A;  2DA1 A;  4CH7 A;  4A3F J;  3UKG A;  2QQ9 A;  5IP6 A;  4BAC A;  1BR4 A;  3CQZ J;  4YEL A;  1AKH A;  4G8X A;  1B8I B;  2V79 A;  2X4H A;  5D8L B;  5JFR A;  2BEO A;  5HVQ C;  4IO9 F;  1LDD A;  2VKE A;  1WHU A;  3FXM A;  4A2U A;  4OIP F;  1ONV A;  2Y9Z A;  2BVM A;  4LB6 B;  3DBH B;  3RZD J;  1QQI A;  2BV6 A;  2KT0 A;  4YEJ A;  2VOD A;  1U9N A;  4QIW N;  1FZP B;  1XSX A;  4CO8 A;  2CS3 A;  1OLT A;  1J09 A;  3VPR A;  2E1M B;  4HNU A;  5FLV A;  4FE7 A;  4II2 A;  4GGG A;  2D1H A;  5HDG A;  5KVR A;  1U5T A;  2CV0 A;  2KJC A;  3CMY A;  1HQC A;  3GME A;  5E8G A;  4CSW A;  5K7Z A;  2L9V A;  1LUJ B;  1HKT A;  2DW4 A;  2XHK A;  1A04 A;  2MLG A;  2ZME C;  5F64 A;  2OF7 A;  2NNY A;  3RYP A;  2ZKZ A;  4CCN A;  2WAD A;  3CZ6 A;  1AKH B;  3KFW X;  5FKL A;  2HEO A;  1MD0 A;  1DU6 A;  5BPD A;  5D8K B;  1JUP A;  3OS2 A;  3ZMV A;  1G4D A;  2OBP A;  3QOD A;  2FJ1 A;  3DTE A;  2Q2E B;  3O8G A;  1WJD A;  1BJZ A;  2X51 A;  2LYC A;  3S16 J;  2F6C A;  2FOK A;  1P9Q C;  1R1U A;  2G0E A;  2XSJ C;  2R93 J;  3SFI A;  2P7C B;  2EZI A;  2JMW A;  3FZV A;  4KUM A;  3UNG C;  3AL0 B;  4DZJ A;  4ETS A;  1Y0U A;  2MG4 A;  4DBR A;  2DT6 A;  1K6O A;  1YOV B;  1EF4 A;  2I10 A;  1YW7 A;  2RDP A;  1IV6 A;  5GPC A;  1D0Z A;  2XAQ A;  1ZLJ A;  4EAT A;  4YIF A;  5GAE J;  1HLV A;  3QU3 A;  4KIB A;  1IRF A;  2EIJ H;  3L00 A;  3JRB A;  2CRG A;  1O7F A;  3CCS I;  1XDS A;  4EM2 A;  1ETQ A;  5BS6 A;  2EQR A;  2XPU A;  4MQV A;  3V4G A;  1DDN A;  1ZN2 A;  2ZFU A;  2PI0 A;  4NUB A;  1VF9 A;  1IRX A;  3F6O A;  3QYF A;  3NWT A;  3HG9 A;  1V5G A;  3V8L A;  3L2W A;  4ESB A;  2WB1 N;  4AIH A;  2IS2 A;  5EGO B;  3HOS A;  3PNY A;  5DTD A;  2Y0S N;  4O3M A;  4IHX A;  3WGH A;  1IN8 A;  3N97 A;  4BJ5 C;  2MC3 A;  2WY7 Q;  3ZQ7 A;  3KP4 A;  4B8X A;  3EUA A;  2WTE A;  4ON0 A;  1Y1V J;  1A5J A;  2BW3 A;  5J1Y A;  4OOI A;  1QGP A;  1SFK A;  1ZR2 A;  3QAH A;  4GRI A;  3ZMD A;  2DFF A;  3V7C A;  1OYW A;  3ZN0 A;  4G6T B;  4AD9 A;  2W4S A;  3VOE A;  1BOA A;  2D1V A;  3L2V A;  5B1B H;  2CQQ A;  1IV8 A;  3M8J A;  2DDB A;  4P96 A;  3IRQ A;  1XX5 A;  1N78 A;  2X1E A;  2XAH A;  4ZYH A;  4RAY A;  2V1U A;  2F2E A;  2FEZ A;  1RZ4 A;  2EV0 A;  1K79 A;  1MND A;  2K86 A;  1IDY A;  2LRE A;  4CZC A;  1ORK A;  3ZGK A;  2CUF A;  1NTC A;  2LVS A;  4D5C A;  1MSE C;  5LGT A;  1WZ2 A;  1AHD P;  4G7Z F;  3BQY A;  1ZHF A;  3I71 A;  3ZQQ A;  3HJE A;  2MD0 A;  4WXH A;  4DZP A;  2OAZ A;  2BW3 B;  2V9K A;  2YPR A;  2XSD C;  3WTT C;  4XRF A;  3K4J A;  1I27 A;  3JR9 A;  2LF7 A;  1X58 A;  2HR3 A;  5J3L A;  5KNL A;  2QM3 A;  3J7A O;  1Y6I A;  2OJE D;  3BT9 A;  4MLO A;  2JA7 J;  2IGM A;  4ZZL A;  2M9H A;  1WI3 A;  1C0W A;  4CCJ A;  3FDY A;  2WWY A;  4HDU A;  4LJZ F;  1REP C;  1U2W A;  3NRV A;  4LGW A;  1TQI A;  2A68 F;  3LMM A;  2B9S A;  2KHM A;  3CF2 A;  2VIX A;  1SEU A;  1ZAO A;  2Y0S A;  2QKM B;  5L3G A;  1DP7 P;  1RNL A;  2LNB A;  5F1J A;  1W36 C;  2DI3 A;  3ZMZ A;  2QBY A;  1U8R A;  1R1V A;  2DK8 A;  4B43 A;  3LFK A;  1GT0 C;  2ID3 A;  1X1P A;  1FYL A;  2LC2 A;  3I56 I;  2GZW A;  4JP0 A;  4RGR A;  1S6L A;  2E2H J;  1YYV A;  2FMY A;  4EJT A;  3GTK J;  2WAQ N;  3OYE A;  3BRO A;  1IJW C;  1R00 A;  3I4N J;  2DQR A;  1KU9 A;  1T6S A;  1OIS A;  2QYO A;  3M1C A;  2DA2 A;  2ZXI A;  5E3N A;  2QEN A;  4Q5S F;  1WJE A;  1YQA A;  3CJN A;  1WKM A;  3MKW B;  5EJC A;  1BIB A;  4BXX J;  3BQZ A;  3IH4 A;  2C6Y A;  1Y56 A;  2LOO A;  3KP5 A;  3K69 A;  3HOY J;  1TWF J;  4RS8 A;  3CCL I;  4XRM A;  1X2M A;  2DMQ A;  3HHH A;  4Y33 A;  2HFH A;  4ZYE A;  1IN6 A;  3HRM A;  4AID A;  5KAI C;  5EGO A;  4I7H A;  4CXF A;  1UHS A;  3HM5 A;  5HDN A;  4ZYD A;  3W2A A;  1XMK A;  4Q4Z F;  2NRA C;  2STT A;  4C30 A;  2P7V B;  3R61 A;  3C7J A;  2HYF A;  3I4M J;  2XPV A;  4UUS A;  3KE2 A;  5LBQ A;  3FXO A;  1SFU A;  4DYC A;  5FKM A;  1NG7 A;  2M4K A;  2LFB A;  2W48 A;  5BNG A;  2L3D A;  5EG0 A;  3F9K A;  4A93 J;  4PUS A;  2WAQ A;  2UZK A;  2FE3 A;  4AU7 A;  3RSN A;  3M1E A;  2DOA A;  1FBS A;  2E1N A;  3IAM 2;  3DKY A;  1JHF A;  2VI6 A;  1JHH A;  1VQL I;  4BQA A;  3OSF A;  3L7W A;  1NHA A;  3VOD A;  2E2I J;  1ON1 A;  2LMD A;  1STZ A;  2CUZ A;  1YE9 A;  4XQF A;  2J5P A;  2CV1 A;  2XF6 A;  3ZR8 X;  3CDL A;  4RB3 C;  2EFN A;  2VL8 A;  1X2N A;  2XAS A;  5IP9 J;  2OA4 A;  2KMU A;  5E1Z B;  4XLN F;  4B3X A;  1IG7 A;  1ZG3 A;  2K5C A;  3TMO A;  1R22 A;  1WJ5 A;  2Z5U A;  1FOW A;  4HBL A;  1DPU A;  3C18 A;  4OIQ F;  3MQ0 A;  4BE1 A;  2V6E A;  2IPQ X;  2JJ7 A;  4M3F A;  1HKQ A;  5C3E J;  4RB0 A;  4H0E A;  1YX3 A;  3K10 A;  3TED A;  3S1N J;  3HDD A;  3TW6 A;  3IHU A;  4LG3 A;  4M74 A;  4MEX F;  4HF2 A;  2TRT A;  1LEB A;  5H6R A;  3G3Z A;  3MWM A;  5IOY A;  1ERD A;  4D5F A;  5IOZ A;  3A2K A;  5FRM A;  4CA0 A;  3TOA A;  5H20 A;  2MH9 A;  5HLI A;  2XIG A;  4XLF A;  4DNC A;  1QU3 A;  2QVO A;  2VKV A;  2R7X A;  1RC9 A;  1TNS A;  5DDG A;  1KQ0 A;  1LQ1 A;  4A3E J;  1A35 A;  3M7G A;  2RKH A;  3D1N I;  1TT0 A;  2VOP A;  2YSR A;  2CO5 A;  2X85 A;  4M72 A;  4IHW A;  3CMM A;  3E5X A;  5TJJ A;  1GVD A;  1Z77 A;  3PNT A;  2QLZ A;  3H9Q A;  4IQJ A;  3EUH C;  2DBB A;  3CUO A;  2NAZ A;  3QPL A;  2WA0 A;  5DCM A;  2GXG A;  3RKY A;  3PUF A;  2GXB A;  5CVU A;  5K5R A;  1BR1 A;  4R8H A;  5GP9 A;  1OFC X;  3K1P A;  4V2G A;  1B72 B;  2VQC A;  1Z7U A;  1ZRE A;  5IPA A;  2W1O A;  1YIT I;  3KLN A;  4EM1 A;  2WAE A;  2H8W A;  5E3M A;  3OL3 A;  3W3C A;  5BOX A;  3BG7 A;  1H88 C;  1J2X A;  4K2E A;  5FJ8 J;  2HI3 A;  1T2K A;  3KEY A;  3CJR B;  1VQ7 I;  1W5T A;  2XC7 A;  2X1C A;  1W5C C;  2YU3 A;  1G3T A;  1JJ8 C;  1FJL A;  1HSJ A;  2A61 A;  2ZME B;  4OWR B;  4FHT A;  3S1R J;  1B9M A;  1KGS A;  3OYF A;  2EBI A;  4KFC A;  4EJV A;  1IN4 A;  2BHZ A;  5C4J J;  2VUM J;  2ME6 A;  5M3M J;  1WH5 A;  5HLG A;  3TBI A;  1TWA J;  2X6W A;  1UST A;  2Q0O A;  3NAR A;  3MD2 A;  4L9V A;  2HXI A;  1H8A C;  3BR0 A;  1FNN A;  1J9I A;  1ZGA A;  3ONQ A;  4PJ0 C;  3CCR I;  1JT6 A;  3ABM H;  1G3Y A;  4EVI A;  3BG3 A;  3JAM K;  1PUF A;  1F1Z A;  3DPL C;  3MZY A;  1MDM B;  3CUQ B;  1VQ5 I;  3TO6 A;  2IS6 A;  2KIM A;  5L3C A;  3JRC A;  3MMY B;  3S3N A;  1P7J A;  1MMA A;  3ROU A;  1G59 A;  1CF7 B;  4E7H A;  1PJR A;  4FX0 A;  5DCM B;  2G9W A;  3Q9V A;  1ZGJ A;  1HKS A;  1RI7 A;  3DFG A;  5DD4 A;  1J59 A;  1JGG A;  1E3H A;  3GF2 A;  3HKZ A;  1O3T A;  2ZO4 A;  4F3Q A;  1O3S A;  3MKY B;  2OTJ I;  2HNH A;  1RKT A;  3CC4 I;  3D5S C;  3H3V K;  4D1Q A;  4KYW A;  2VKH A;  2MW8 A;  1GXP A;  1PYV A;  1LFB A;  4HV5 A;  4J01 A;  3RIR A;  4FX4 A;  4HLX A;  4Y13 A;  2CUE A;  2XGD A;  3SZP A;  2OCE A;  2VJ5 A;  1RPW A;  3O6B B;  2M1B A;  4FQG A;  4NC7 A;  3W6J B;  3K70 D;  3H35 A;  3H0D A;  3HGG A;  3GTP J;  4W1U A;  1YRN A;  3QPT A;  4BHC A;  5EEH A;  4A3M J;  2VBZ A;  4RGS A;  3J80 K;  2Y31 A;  2B63 J;  1TZL A;  3O3K A;  3TO9 A;  1G2H A;  3E6D A;  2HQA A;  2PQ8 A;  3BG5 A;  1WVR A;  5ICC A;  3CCM I;  3CUQ A;  3ML6 A;  5CVI A;  2DA4 A;  2F5D A;  5J1U A;  3TP0 A;  4DYR A;  1DGW Y;  4OU0 A;  2P5K A;  4V2F A;  1CQT A;  4B3A A;  4AC0 A;  3Q5F A;  2F5V A;  3RQ4 A;  2RNJ A;  4F92 B;  1ETW A;  3ERE D;  1XS9 A;  5L3D A;  2O8X A;  2O03 A;  5TGT A;  1G6N A;  2IW5 A;  5F27 A;  2CQ7 A;  4PZJ A;  2HU9 A;  3DXJ F;  3JRA A;  3K0L A;  3ISP A;  4AWX B;  1FPQ A;  2Y48 A;  3G4S I;  4KIS A;  1D5V A;  1Q1H A;  4LMY A;  1APL C;  1BJA A;  2PMZ A;  1KA8 A;  2XPW A;  2K85 A;  2HQR A;  1POG A;  5CYV A;  2CWE A;  1S72 I;  2FNP A;  2W25 A;  2ZME A;  4UHT A;  5EG0 B;  4EGY A;  1BW5 A;  2P5V A;  1P92 A;  1AWC A;  2RRE A;  2IBD A;  1I3Q J;  3CJT B;  3Q0U A;  2HKX A;  2ELJ A;  4YFN F;  3GXO A;  1LDJ A;  4BHB A;  4U0Y A;  4IXA A;  1OYY A;  4IRI A;  5LEK A;  2ECB A;  2PMZ N;  1Q1V A;  2DT5 A;  3FBI B;  3NAU A;  2R7U A;  2JUC A;  1TC3 C;  3A01 B;  3A1Y A;  1B72 A;  4XRS G;  5EEG A;  2R7F A;  2A05 A;  3S2W A;  3TKY A;  1OR7 A;  2QQ8 A;  2MSY A;  4G12 A;  1ZKG A;  1UEL B;  3E0J B;  3HRU A;  3KEO A;  4EQQ A;  4A3J J;  2E7W A;  3ZQC A;  4HOB A;  2DJI A;  2XKO A;  4E6K G;  4PGH A;  1UG0 A;  1OCZ H;  3I5U A;  4ZJZ A;  2RQP A;  3SHF A;  3S1M J;  4NC6 A;  4DOZ A;  1IRG A;  5EF6 A;  5LD2 C;  3MVP A;  2IXS A;  3JRE A;  2ZXW H;  2O3F A;  2IS4 A;  4XLE A;  2DMN A;  2ECC A;  4Y3O A;  4N9I A;  4M3G A;  4BQO A;  3F0C A;  4G94 A;  2JRM A;  3FMQ A;  4BEH B;  3F21 A;  3JRG A;  2QQB A;  1VQ8 I;  1BI3 A;  4WXD A;  4U0W A;  2IA1 A;  2WY8 Q;  3C3W A;  3BJO A;  4BNC A;  3Q0W A;  4RM2 A;  1IC8 A;  3CD6 I;  1YJN I;  2P4W A;  1KQ9 A;  4PJL A;  1D1A A;  3HIF A;  3DLL F;  4BY1 J;  3V8K A;  1LE8 B;  3GX4 X;  2FXA A;  4I99 C;  4DJA A;  1FOK A;  4UB8 C;  1FT9 A;  3PIP F;  1MW7 A;  3PUB A;  2JPC A;  2ACJ A;  3Q3S A;  1BR2 A;  3J7A Y;  9ANT A;  2WC2 A;  4P1W A;  1XD7 A;  1E3O C;  3LSP A;  2J5O A;  3ABL H;  3HSF A;  2BXZ A;  1LE8 A;  3J80 Z;  4XN0 A;  5F0H A;  3EUK L;  5L3E A;  1U8B A;  1DPR A;  2VBW A;  1DQU A;  4A3D J;  2DU9 A;  2DAO A;  4KT5 C;  3DTI A;  1F43 A;  4HSR A;  4ZYG A;  3HOZ J;  3RKQ A;  2A6T A;  2KPM A;  3EYI A;  4Z2Y A;  1V5E A;  4RBO A;  1X1B A;  4U87 A;  5F0C A;  5B1A H;  2KIF A;  4ASN A;  3WU0 A;  2XRL A;  4HQE A;  3J81 K;  2E7X A;  4R79 A;  5HS7 A;  5FO5 A;  1GV2 A;  3KP7 A;  1XGN A;  3E7L A;  2HQN A;  5DEQ A;  1T33 A;  2DOF A;  4HX7 A;  2OZU A;  5EDN A;  3ZN1 A;  3CO7 C;  1F36 A;  1JKP C;  1ZQ3 P;  3I54 A;  1T8I A;  1RKW A;  4FIS A;  1IO2 A;  1X3U A;  1MBH A;  5LHG A;  4AM3 A;  2RQQ A;  3LAP A;  5LRR A;  3ZXS A;  4XSZ F;  2PMU A;  1MMN A;  3HPH A;  3IKT A;  1HDD C;  4XID A;  3WG7 H;  2IA0 A;  2ZJP F;  5E8I A;  3K2A A;  2F4I A;  3WHB A;  1MNM C;  1ENH A;  4D9J A;  4A69 C;  3E3V A;  1MDM A;  3IV5 A;  1SAU A;  2HZT A;  1FOX A;  4I02 A;  1TWH J;  1XC5 A;  5E3L A;  1MJA A;  1OCP A;  1XCV A;  2LF8 A;  3V7R A;  2E34 A;  1FP1 D;  3A4C A;  3GTJ J;  5FLX Z;  2PBI A;  3PJR A;  1VZ0 A;  4RGU A;  3EET A;  3G1L A;  3OYB A;  2KL4 A;  2LY1 A;  4BQN A;  1GV5 A;  4BE0 A;  2L54 A;  3M8E A;  3V7S A;  2Z33 A;  2W24 A;  4M6V A;  3TOB A;  2V9P A;  3H1C A;  4ZC3 A;  1D8J A;  2P8T A;  3A02 A;  1X1D A;  4C3I J;  1K4T A;  4XIC A;  4HNV A;  2L5Q A;  3SZG A;  4HX8 A;  2CG4 A;  4L0Z B;  3JRD A;  3R6S A;  3ZQI A;  4JX4 A;  2EIM H;  2P6T A;  2YX4 A;  4M3B A;  1V3F A;  2P81 A;  1BI1 A;  4JBA A;  5CVJ A;  3S8P A;  4IRH A;  3IRR A;  2D5V A;  2H94 A;  3DEE A;  3PFI A;  1JXS A;  4BGD A;  1YJW I;  5J6X A;  1IZ1 A;  3SYT A;  2O8K A;  4P9U A;  1O3Q A;  3CUQ C;  4QLC U;  3HOX J;  4ENN A;  3OY9 A;  4LFU A;  4IX7 A;  3P5J A;  3DWL E;  2BBY A;  2FX0 A;  3LA2 A;  2DN0 A;  3SZT A;  3P9C A;  3CMA I;  2L7F P;  5M5W J;  3K4C A;  3FBN B;  2W57 A;  2VE8 A;  1I1S A;  1MH4 A;  1J0R A;  3LA3 A;  2OV7 A;  3HTU A;  4MO7 A;  2DA6 A;  1G8X A;  2EA2 A;  4Y52 J;  3CDI A;  5L3B A;  2F5C A;  4XN3 A;  4RAG A;  4HRI A;  1EH6 A;  2W84 A;  4KDP A;  2JUG A;  2XVC A;  3I55 I;  2M2E A;  1EKE A;  2DMP A;  2R7S A;  5FGM A;  4A3L J;  3HBL A;  2JA5 J;  1FMV A;  1DU0 A;  3W6K B;  2XF5 A;  4IL6 C;  2DMT A;  3CLO A;  2LBF B;  2KIU A;  2X0L A;  2KKO A;  1BA5 A;  2M7A A;  4DYQ A;  1D3Y A;  2JA2 A;  1UG2 A;  5KCM A;  1GXQ A;  3GFL A;  3OYI A;  1OCT C;  4RM3 A;  4G7H F;  4XKV A;  5FRN A;  1F9N A;  2OUM A;  2R3S A;  2PJR B;  5EEA A;  2GWR A;  3ECO A;  1O57 A;  2G7U A;  4XNF A;  3EYY A;  2HTJ A;  1MBG A;  4L5J A;  5B5E C;  2COM A;  2DA7 A;  3COA C;  2VBX A;  2NVU B;  4FCY A;  2COB A;  4J00 A;  3BOQ A;  2KZV A;  2ISY A;  2HQ5 A;  1I6X A;  4NQW B;  4X1E A;  2DOE A;  4CYD A;  3DPT A;  2BY2 A;  1R6R A;  2IS1 A;  3I59 A;  2OC6 A;  2WBM A;  4X6A J;  1SVO A;  5M5X J;  1U6G A;  3F8C A;  3R60 A;  3GVA A;  2KQR A;  1T0F C;  2RNG A;  4I76 A;  1T38 A;  5AIQ A;  4OIR F;  4PJM A;  2F5F A;  2RGV A;  4EEF G;  2HVR A;  4GFB A;  2AO9 A;  3ZP5 A;  4JX5 A;  5F0F A;  3JAM Z;  2STW A;  5HDK A;  2FML A;  1ETO A;  5DS9 A;  4N0B A;  4HAM A;  1SD6 A;  1WCM J;  3T8R A;  1R7J A;  3EUH A;  3S93 A;  4IHV A;  2R7R A;  3KZI C;  1QHG A;  1QPM A;  2VON A;  2X6X A;  1IN7 A;  1N77 A;  4RLQ A;  3JSO A;  5GAG J;  3VYU B;  2ZFW A;  4O5V A;  2LY9 A;  3HTS B;  2DXI A;  2O7O A;  2JK3 A;  2QWW A;  1ZEL A;  4RLF A;  4DGW B;  2V7F A;  4I01 A;  2M87 A;  5JI6 A;  3BTJ A;  5HLH A;  2ME0 A;  3CJQ B;  4E7J A;  3GUD A;  4P55 A;  4G9Y A;  5HNH A;  1Y1W J;  2YR2 A;  3D5R C;  2NVQ J;  2CU7 A;  2L9S A;  1ZG1 A;  2M45 A;  2A5W A;  2W82 A;  4FET A;  2XAJ A;  2R7V A;  2K40 A;  3LSM A;  1XDU A;  3IWF A;  4HNT A;  4IOA F;  2JA8 J;  4BJ6 C;  3OMY A;  3QPH A;  1RR7 A;  2EJR A;  3TDU C;  4CZZ A;  2PJR A;  1VQP I;  3T5X A;  5HOO A;  1UFM A;  4CCL A;  1FOY A;  2W85 A;  4LOC A;  1QBJ A;  4BU2 A;  2BVL A;  1WH7 A;  2VJJ A;  1WJC A;  2JZY A;  2LBF A;  3MZH A;  3KPH A;  4BBS J;  4HYE A;  3FHZ A;  1BOB A;  2JRT A;  3WTY C;  2JSC A;  2LLK A;  4HEA 2;  2VBY A;  4E70 A;  3JRH A;  4ESJ A;  5D6F A;  1LDK B;  4CUG A;  1X1A A;  4RB1 A;  4RAF A;  1LKX A;  2FOW A;  4RGX A;  1E0E A;  1MNE A;  2PMH A;  3BTL A;  1ZG5 A;  2DMU A;  3L9F A;  2K9M A;  5IP7 J;  2PG4 A;  3OOP A;  2ZXH A;  5KAF C;  3SDG A;  3OYD A;  5GAH J;  1OKR A;  5D6E A;  1LEA A;  3U1D A;  1IXS B;  2KIQ A;  3VDX A;  2HYG D;  2DTZ A;  3BZ6 A;  3I64 A;  4FTH A;  2HVS A;  4WWC A;  3OR2 C;  2E71 A;  2K27 A;  4OIN F;  1YIO A;  4UV9 A;  5TRD A;  2I8D A;  3FKJ A;  1QO0 D;  3DEU A;  3VSL A;  4KMF A;  5E1X A;  5HS9 A;  1XGM A;  3QP5 A;  1P4A A;  3KYD B;  3CCQ I;  3PQK A;  3FWE A;  4YFK F;  1CGP A;  4BXF A;  1H9G A;  1EV7 A;  1K6Y A;  3AKZ A;  1JT0 A;  4LIU A;  3VEP A;  3X2Q H;  3QWL A;  2MBF A;  3EDP A;  3CES A;  1QZZ A;  5E18 F;  3CCY A;  1U3E M;  2LRD A;  3L1P A;  1IXC A;  3HHG A;  5LHH A;  4XLC A;  2R5Y B;  1YX5 A;  1DGR M;  1MBF A;  1YS6 A;  1FBQ A;  2MH2 A;  4M6Y A;  1OR7 C;  3CP8 A;  4D7N A;  2HDC A;  1O3R A;  3B02 A;  3GYH X;  2IGN A;  3HB9 A;  2ISZ A;  1WI9 A;  1FSH A;  1X3W B;  4FT8 A;  2A69 F;  4AUX A;  2EFW A;  3OR1 C;  3G6E I;  1WJF A;  5L3F A;  2H27 A;  1JE8 A;  4J19 A;  4BYY A;  3GTG J;  3GW2 A;  2IVM A;  2LDU A;  4GYI A;  1DP3 A;  3F8N A;  4HPQ A;  3I4P A;  1VQN I;  4KIT B;  5H6Q A;  4EJU A;  4NBQ A;  2VB6 A;  3HC7 A;  2TCT A;  2VLA A;  2EWN A;  2EIN H;  2XV4 S;  3F6V A;  3RTR A;  2H1K A;  3PSI A;  2ZJ2 A;  1N25 A;  2EZH A;  3P9K A;  1KYZ A;  3GBG A;  3G2B A;  4I0B A;  2HKO A;  5AIP A;  2XGE A;  1JTX A;  3IL2 A;  4CGZ A;  1FYK A;  3K1N A;  5EYR A;  1ETX A;  1Z6T A;  1OCR H;  3FXJ A;  3GWZ A;  2CQN A;  1S9H A;  1LFU P;  1N75 A;  3O8H A;  1IXR C;  1V5F A;  3A0B C;  3E5U A;  1BC8 C;  3K4K A;  1MBE A;  3D0S A;  2A3S A;  1Z3Y A;  3LSR A;  2ESN A;  3I9V 2;  2DDA A;  2VAS A;  2M30 A;  5DYM A;  5FKO A;  1MIJ A;  1Z9C A;  3CCE I;  3KEQ A;  1IAW A;  1S7E A;  1JUM A;  1XTA A;  4KIG A;  1GLN A;  2CH0 A;  3IH2 A;  1HST A;  1ON2 A;  4PSX A;  5JVG F;  1I3A A;  1R5H A;  3HRS A;  5CJ9 A;  3BY6 A;  4WXC A;  4QPO A;  5J47 A;  2IRF G;  4CCM A;  1U5T B;  2OPT A;  4XK4 A;  4D0P A;  2K7L A;  4ENK A;  2CYY A;  1NH3 A;  1H0M A;  1D0Y A;  1NK3 P;  2W7N A;  3LSK A;  4WF2 A;  3KIO A;  2MGQ A;  2LKP A;  3FK6 A;  2QA4 I;  3IC7 A;  1FIP A;  2PX9 A;  3PM1 A;  5HNF A;  1KON A;  5KHD A;  4L5E A;  2VT2 A;  3S14 J;  5ILS A;  2KDZ A;  4A6D A;  3ABK H;  4KMU X;  5J4Y A;  2O9L A;  4XKW A;  1B59 A;  1ZH5 A;  1P7I A;  4ZDO A;  1AA7 A;  1E3P A;  3P7N A;  5K7H A;  2LD5 A;  4Y15 A;  1ETV A;  1L3L A;  2QF7 A;  1Z21 A;  3F22 A;  4L5I A;  3ULQ B;  3S1Q J;  3H36 A;  4PFO A;  2LKX A;  3LSI A;  1YIJ I;  2VQL A;  2KP6 A;  4OMZ A;  3HPG A;  3VSK A;  2B0L A;  1KZH A;  4BH9 A;  2DT7 B;  5BMZ A;  3VYT B;  2R4G A;  2F5E A;  3I0T A;  2Z1D A;  3WU2 C;  4QWQ A;  4GXO A;  3E6M A;  5IT3 A;  1VFC A;  1QZE A;  4IF4 A;  4I2O A;  3AG4 H;  2JN6 A;  2VKD A;  2E19 A;  5H2F C;  4WX9 A;  3ZQH A;  4F55 A;  2MLK A;  4B44 A;  2JA6 J;  5A2Q Z;  2X9D A;  2H6C A;  3KZY A;  1D5Y A;  3G71 I;  2RN7 A;  2AHQ A;  4BJT A;  1Y8Q B;  1OCC H;  2IP2 A;  4U0V A;  5DM7 F;  3WTV C;  3N4M A;  1FMW A;  3KYC B;  4A0X A;  1MSF C;  1UHW A;  3BZC A;  4MEY F;  3RYR A;  2K9S A;  2Z3Y A;  2NOG A;  4MNU A;  3CTA A;  4M9Z A;  1FC3 A;  4FAS D;  4U7D A;  2QKL B;  3JTH A;  3HL2 A;  1U0J A;  2BZT A;  2H6B A;  1MBJ A;  3C1D A;  2OCC H;  3L2R A;  2E1O A;  4I09 A;  1SVL A;  1KQ8 A;  2ID6 A;  1JUS A;  2HWV A;  4AIK A;  2MD5 A;  2AS5 F;  3M4O J;  3QYB A;  2L9N A;  4A6E A;  1K78 A;  2Y30 A;  1T39 A;  3DPU A;  4HST A;  3R4K A;  2BY3 A;  3KP6 A;  2EA4 A;  3H92 A;  2DA3 A;  3NEU A;  3AL0 C;  4B4C A;  4MHG A;  3I58 A;  2FUG 2;  2PJP A;  3E6B A;  4YIR X;  5KK1 A;  1R4N B;  3CC7 I;  2UV1 A;  3A01 A;  4IZZ A;  2OD5 A;  4NB5 A;  3FHN A;  4YG2 F;  4C3H J;  4XLA A;  3S3O A;  2NOJ B;  2Z2S B;  1MH3 A;  2JT1 A;  1RR8 C;  5E17 F;  2EZK A;  5J8C A;  1OJL A;  1TL8 A;  2XGX A;  2V1X A;  2DLL A;  2X1D A;  4AYB N;  1TQM A;  1B9N A;  3IKV A;  4WCG A;  2KJB A;  3U21 A;  2NXN B;  1Z05 A;  4RA2 A;  1TNT A;  3PSF A;  1HOM A;  4PJJ A;  1TQP A;  1HC8 A;  5K1Y A;  5IT9 K;  4LK0 F;  5J1R A;  4A3G J;  2QBY B;  1XB4 A;  3MN2 A;  3TO7 A;  4XKC A;  3SEZ A;  2GXA A;  2LK2 A;  1SC7 A;  1Z1D A;  1FIA A;  3BR3 A;  4I6Z A;  3K7A J;  1IF1 A;  2RAE A;  3W6V A;  4PDK A;  3H3Z A;  5D4S A;  1GVJ A;  4IOC F;  1USS A;  1ETK A;  5B66 C;  5ERI A;  4BXU A;  1P4W A;  3B6C A;  3H5N A;  2NS0 A;  3S3M A;  1UAA A;  2YX7 A;  3ASN H;  2VN2 A;  4KIC A;  4NQW A;  3GTO J;  2VPR A;  3GO5 A;  2QUF A;  5FB2 A;  1WRJ A;  2CSO A;  1K61 A;  3CF5 F;  3CME I;  2N8G A;  2FBK A;  3GTL J;  2E60 A;  3BTC A;  3BR1 A;  2IAI A;  2KLO A;  3GFM A;  2H8R A;  2R92 J;  2ZCW A;  4AVZ A;  1W1W E;  1GDT A;  4YFX F;  1WSU A;  3E6C C;  2IGK A;  1LNW A;  3S2H J;  3CCU I;  5CPR B;  1ZRF A;  1FSE A;  3DCF A;  1FTZ A;  1R23 A;  3T8T A;  5C44 J;  1YRN B;  3ZMU A;  3HOV J;  1YI2 I;  1IW7 F;  4BEH A;  5C4X J;  4TV7 A;  4UVB A;  4MFD A;  4A12 A;  3HKZ N;  5FD5 A;  2EV5 A;  2BHY A;  4HLY A;  2M4G A;  3HXL A;  2HPM A;  1MGT A;  1SMT A;  2IJL A;  1HW1 A;  1LVK A;  2JWT A;  4RB2 C;  3LOC A;  2OTL I;  1TP4 A;  3RQI A;  1JGS A;  1WQ2 A;  4GYG A;  2DPD A;  3V8J A;  3VWB A;  2A5Y B;  4ZH4 F;  4YRV A;  1Z3X A;  2O0Y A;  3HGY A;  1XGS A;  1CF7 A;  2HZD A;  4ZTJ A;  3WTS C;  2HVQ A;  2LG4 A;  3AAF A;  2X48 A;  2UUZ A;  4I98 B;  4N4O B;  3WGG A;  1R58 A;  2GOM A;  3HUG A;  1BL0 A;  2ZC2 A;  4KT6 A;  3CLQ A;  1RET A;  2VE9 A;  1QRY A;  3DQV C;  3QP6 A;  4E7Z A;  2LSO A;  5CLS A;  5BPI A;  1Y39 A;  2FRH A;  3HYI A;  4L18 B;  1X1C A;  1UJ8 A;  1JI8 A;  3DKW A;  1XPX A;  5FKN A;  1ACI A;  1FEX A;  4LG0 B;  3GLL A;  1HA8 A;  3OYK A;  1LFP A;  3BCB A;  1Z91 A;  3DBL B;  3QQA A;  3F72 A;  5ILV A;  3S2D J;  3QRF F;  1BIA A;  2D2W A;  1JTY A;  1O7L A;  2QGU A;  2F48 A;  2HOT A;  4KJZ A;  3BCA A;  3ZCO A;  4NHJ A;  2XB0 X;  3GEZ A;  2EIL H;  1A31 A;  4QTR A;  3KP3 A;  1VQ9 I;  3BJ6 A;  1YTY A;  2PN6 A;  1YW9 A;  4Q47 A;  1XN7 A;  2ZNY A;  3DTK A;  3F3X A;  4B47 A;  2PLY A;  1MJ9 A;  2VC1 A;  1KU7 A;  4XOT A;  5JHU A;  5FRO A;  5HLT A;  2A07 F;  4ITV A;  3FXU A;  1A6I A;  1EA3 A;  2DFE A;  1IUF A;  2CFO A;  2XF7 A;  4GDF A;  3PQJ A;  2GA2 A;  3PFY A;  4C9Y A;  2QEX I;  2FD5 A;  4PK4 A;  4CCO A;  3QPS A;  4IRG A;  2XAU A;  3OIO A;  4HG2 A;  1X4P A;  2HOA A;  3N05 A;  4F52 A;  4HA8 A;  1QNT A;  1X19 A;  2CQX A;  2XRO A;  1R49 A;  1K78 B;  2GAU A;  3CC2 I;  2OZ6 A;  4A3B J;  1IDZ A;  1HCR A;  3JRF A;  4II3 A;  3KZZ A;  3T1B A;  3GCM A;  1ZR4 A;  1SAN A;  1XCB A;  1GUU A;  2DOD A;  1B1B A;  3ZMS A;  3LQQ A;  3VYR B;  2CV2 A;  1VQM I;  3SXY A;  1HDP A;  1YS7 A;  2EFQ A;  1R9T J;  2E36 A;  3S32 A;  2GLO A;  1GHC A;  5TIS C;  3C2G A;  2WV0 A;  4Y4R A;  2DFI A;  1SAX A;  4H4K C;  4W97 A;  1EJ9 A;  2GBY A;  4OIO F;  3BDD A;  1FTT A;  3B73 A;  1V54 H;  3RI4 A;  5DV5 A;  2FSW A;  2MC4 A;  3K9T A;  4MFE A;  3CDH A;  2K9N A;  1VQO I;  5DUK A;  1I1G A;  1X3Z B;  5D5U B;  4XRS A;  1IN5 A;  2HGC A;  2DYR H;  3FM3 A;  1D0X A;  3P9I A;  2HDW A;  4S04 A;  1ZYR F;  2GQQ A;  1WJA A;  1W36 D;  4MGR A;  3KYL A;  2XAF A;  5FLX K;  2K3P A;  2E1M C;  4MIM A;  1YLF A;  4S05 A;  4M3D A;  2FNA A;  1SD5 A;  4HX4 A;  1S29 A;  4LK1 F;  1BBY A;  2NNN A;  3FM5 A;  1W0T A;  3KCC A;  3VFZ A;  1K83 J;  3OV8 A;  4JOM A;  5FLM J;  4EGZ A;  4HQM A;  1E2X A;  3JCU C;  2R7T A;  4O6J A;  2BY1 A;  1TLH B;  2MFZ A;  3CO6 C;  1YG2 A;  4HF0 A;  5F04 A;  5K5O A;  2L7Z A;  3BP8 A;  4EMS A;  1T0F A;  1YFH A;  4D7M A;  1SD7 A;  1T98 A;  4UB6 C;  4HF1 A;  4PJN A;  2EK5 A;  3W2W A;  5IY5 H;  1W7P B;  5IYB J;  5DM6 F;  3J7Y J;  3OS0 A;  4YII A;  4BBR J;  2BXY A;  1P4X A;  1QVU A;  2BGC A;  3SEQ A;  1FY7 A;  1UHM A;  1QZY A;  1U78 A;  1NK2 P;  1BN5 A;  4ENM A;  5JLW A;  1UCR A;  3F23 A;  1S5L C;  2G7H A;  2JPB A;  4FE4 A;  2OU2 A;  1FWZ A;  2K9L A;  1EH8 A;  3RJP A;  5JVT A;  1R1T A;  4UUS B;  3QOP A;  3I53 A;  4BL0 B;  3RPU A;  1KU2 A;  2KRH A;  2Z9O A;  1MKM A;  4G6D A;  1WPK A;  3FMS A;  2R5Z A;  3WTX C;  1MMS A;  3IP4 B;  3GTM J;  4M71 A;  4CYC A;  2VXZ A;  2JSP A;  3WOD F;  2ZJR F;  2K4J A;  2R5Z B;  3G1M A;  4OAY A;  3GLX A;  4B48 A;  3LWF A;  4BAY A;  4B09 A;  1RUO A;  2A6E F;  4UUT A;  3TDZ C;  4A0Z A;  1D8K A;  1Z0X A;  4JX6 A;  4UVC A;  4QPQ A;  3RKX A;  5E20 A;  5FFZ A;  4XSX F;  3DKX A;  4F93 B;  5DUI A;  1F5T A;  4BY7 J;  5IT9 Z;  4XOR A;  1SVM A;  3PO2 J;  1WGX A;  3OYA A;  4XLP F;  3RZO J;  1IUY A;  2QQA A;  3VYS B;  1ZTR A;  2NS7 A;  5CKT A;  5HOD A;  4UUV A;  3FXQ A;  1XMA A;  4ANJ A;  1P6R A;  1TT5 B;  2V4J C;  1FX7 A;  1R71 A;  2DO7 A;  4G6Q A;  1OPC A;  2Y75 A;  3BG9 A;  4BDY A;  1Z67 A;  1L0O C;  1B6A A;  3TL4 X;  2XRN A;  2DQL A;  3ZRG A;  2CMP A;  2L2O A;  1FBU A;  4BUP A;  2YU9 J;  1WFX A;  1BW6 A;  4DBQ A;  5AON A;  4LB5 A;  3S15 J;  5JR3 A;  2R5Y A;  1O4X A;  2UXX A;  1TW2 A;  3DV8 A;  1J75 A;  1S3J A;  2M5W A;  2LP0 A;  3I59 B;  4ABZ A;  1JKQ C;  5ILU A;  1U5T C;  4EV0 A;  2WV1 A;  1OMI A;  3QYE A;  1T56 A;  2E35 A;  2Y9Y A;  2ZXJ A;  2L7K A;  3FIW A;  3VB2 A;  5D4R A;  2LH9 A;  2VXD A;  3TQN A;  3ELK A;  1Z6R A;  2HS5 A;  4XM3 A;  3PO3 J;  2WAF A;  2L9R A;  4ZDP A;  2IEK A;  4IKF A;  3O2P E;  3GFJ A;  5FKK A;  3EPZ A;  4BHP A;  4AIJ A;  1RRJ A;  3BR5 A;  3K1M A;  1VQ4 I;  3KX2 A;  5GPA A;  4F7Z A;  1OQY A;  2HXO A;  2DJN A;  1X4O A;  2VQG A;  4DW6 A;  3BPV A;  2ICW G;  2HPI A;  3GZ5 A;  2VT3 A;  3A03 A;  3BZK A;  3QOE A;  2L4A A;  5F6F A;  3OYJ A;  2OQG A;  2BY0 A;  3IH3 A;  4UNO A;  1KU3 A;  1R5G A;  2F4M B;  2LTP A;  1I39 A;  4LIT A;  3MCZ A;  1RIO H;  3ABT A;  3FXK A;  5HS8 A;  2LR8 A;  3DU5 A;  5A2Q K;  3SQN A;  3ERM A;  1YO5 C;  3MAJ A;  3MKL A;  4L9J A;  2QCO A;  4PGG A;  1AOY A;  4CHU A;  4IVN A;  3W2V A;  2RV8 A;  1HF0 A;  3K4L A;  3OOU A;  3F8F A;  4M3E A;  1M1E B;  2Q1Z B;  5LGU A;  3FKI J;  3DLA A;  3H0G J;  2XAG A;  1K7A A;  3LSJ A;  3HSE A;  4JYK A;  3ZMT A;  2O6G E;  1B8I A;  2NVY J;  4BS9 A;  4IHY A;  2RVC A;  1ZRC A;  4GO1 A;  3H9G A;  2FQ3 A;  2V9V A;  2ZSI B;  1XMX A;  2EV6 A;  1PP7 U;  3CP2 A;  2VQH A;  2WB1 A;  1SMY F;  4HV6 A;  1JJ6 C;  1BI0 A;  1ETY A;  5M5Y J;  2IT0 A;  3OSG A;  2CFX A;  3GZ6 A;  2DK5 A;  1PUF B;  4BDZ A;  2R7W A;  4XON A;  3WTZ A;  4IHT A;  1WJB A;  2FBH A;  2Z16 A;  4UV8 A;  3LSH A;  2LY2 A;  3CCJ I;  2HOE A;  2QZ8 A;  2XKP A;  3KET A;  4U88 A;  2I5U A;  4ZZD A;  2M3A A;  4G7O F;  2H1L A;  5F1R A;  3SJM A;  3AFH A;  3NWS A;  2ESH A;  4A5N A;  2O5R A;  3QU6 A;  5EZG A;  2GIV A;  1RES A;  1S8N A;  2CUJ A;  3HOT A;  4EJO A;  3WG9 A;  5CQG A;  3DP7 A;  2EFP A;  2Y2Z A;  3DU6 A;  3PIO F;  3K6G A;  2AQF A;  1V4R A;  1S7O A;  2UXN A;  3FIS A;  3PL8 A;  1XGO A;  3ZOB A;  1YJ9 I;  2KRC A;  4LG0 A;  2DFH A;  4UXN A;  1W4M A;  3ZQL A;  1ZAR A;  3I3L A;  5FFX A;  2HTS A;  3OS1 A;  2CW0 F;  4IEJ A;  4Y17 A;  2Q2E A;  1TW3 A;  4ZDL A;  2DTR A;  4Q48 A;  1I6H J;  4MTD A;  1HXD A;  1SD4 A;  3OYN A;  3MKZ A;  4V19 K;  4N4N B;  5F08 A;  1PP8 F;  1BC7 C;  3U2R A;  3BC8 A;  2QSH X;  4RDU A;  4XLH A;  1T08 B;  2K3F A;  5JLX A;  1G3W A;  1OCO H;  3S17 J;  2CW7 A;  2TDX A;  5CVR A;  1W0U A;  2DPU A;  3M07 A;  4AVP A;  2QSG X;  4DIQ A;  4L9T A;  2XDV A;  1HW2 A;  4N9H A;  2MA3 A;  4CDG A;  2FF4 A;  2LKS A;  4IJA A;  3ESW B;  2RC4 A;  1WWX A;  2EB7 A;  1I50 J;  3BWG A;  2V1D A;  3DF8 A;  2L01 A;  2NVX J;  4C3J J;  2JVH A;  2FBI A;  2Q8K A; 
#chains in the Genus database with same CATH homology
 5E1W A;  3GFI A;  1PDN C;  1MZB A;  4WK8 F;  2NYX A;  2CQK A;  4HDV A;  4IPA A;  3LQR A;  3KLO A;  1TBX A;  4KA4 A;  2H09 A;  2Y0M A;  3H3U A;  1YW8 A;  3J81 Z;  3E5Q A;  1ODD A;  1HBX G;  1BI2 A;  3F8M A;  3LAJ A;  1LB2 A;  1E17 A;  1ULY A;  1KYW A;  1R36 A;  4R1H A;  1OYI A;  2P6S A;  1ZRD A;  2ADU A;  1XSD A;  4KN7 X;  5DD8 A;  4JK1 X;  4KIF A;  2VOO A;  2E1C A;  4JQF A;  4KNY A;  3IWZ A;  6PAX A;  3D5L A;  4P9F A;  3RPQ A;  2UWM A;  4KN4 X;  2A6H F;  3KP2 A;  2ZNZ A;  2BE5 F;  1W7P D;  2L02 A;  3WTU C;  4XBF A;  1J5Y A;  1HW5 A;  5DCF A;  3WE2 A;  3L2C A;  3R0A A;  3Q9S A;  4I0A A;  4CIC A;  3LA7 A;  1RUN A;  2R7D A;  1PUE E;  5ED4 A;  4LLN A;  1VTN C;  3HSR A;  5LEJ A;  3G73 A;  5ICF A;  2BYV E;  2AXL A;  3MEX A;  1UB9 A;  3L09 A;  2IA2 A;  2EFO A;  4A5M A;  3FX3 A;  1LJ9 A;  1FP2 A;  3M8F A;  3WGI A;  1EH7 A;  5CVV A;  1SFX A;  4ESF A;  2ELH A;  3ABU A;  3E97 A;  2GA1 A;  1B4A A;  3LST A;  3FF5 A;  4IHS A;  4A0Y A;  1W7P A;  2K02 A;  4EM0 B;  3F8B A;  4HW0 A;  2M8E A;  5ICG A;  5D5V B;  4RAZ A;  1SFE A;  4M9S A;  4LLL A;  3JW4 A;  3MFK A;  4M6X A;  3RDI A;  2P5L C;  2XUB A;  2D45 A;  1G3S A;  4LLG F;  3ECH A;  4HZF A;  4U7B A;  2PFB A;  3ZPL A;  4LD5 A;  4L9N A;  3BPX A;  1P2F A;  4M9X A;  2FA5 A;  2K4B A;  3WU1 B;  4EJW A;  5FD6 A;  4L0Y B;  5BQT A;  2CGP A;  5LLQ A;  5ICE A;  4MQ9 F;  2ZBK A;  1S7A A;  4P5O A;  2FU4 A;  1XSV A;  1FLI A;  5LGN A;  1FYM A;  1I5Z A;  1ZLK A;  3BJA A;  3JTG A;  5LHI A;  3U9G A;  3REO A;  2VC0 A;  3TGN A;  5J8F A;  4PCQ A;  3T0Y A;  1MJB A;  3EQL F;  1J7K A;  5K5Q A;  2L4M A;  3FMR A;  3RKW A;  2ETH A;  1W5S A;  3M9A A;  1H9T A;  2PEX A;  2Z99 A;  2V6C A;  4M73 A;  3WTW C;  1BM9 A;  1F4K A;  3K2Z A;  2JTV A;  4UVA A;  3JSP A;  4OMY A;  1DUX C;  3SFZ A;  5LRS A;  3R0J A;  4ENJ A;  4MTE A;  4DQ2 A;  3FXR A;  1TTY A;  5D5W B;  1LVA A;  2KRF A;  4GCV A;  3NQO A;  3HRT A;  3WE3 A;  2O61 A;  5D5X B;  2OQR A;  2QQ9 A;  4G8X A;  2V79 A;  2X4H A;  5D8L B;  5JFR A;  2BEO A;  5HVQ C;  1LDD A;  4A2U A;  4OIP F;  1ONV A;  4LB6 B;  1QQI A;  2BV6 A;  2VOD A;  1FZP B;  1XSX A;  4CO8 A;  4GGG A;  2D1H A;  5HDG A;  5KVR A;  1U5T A;  2KJC A;  1HQC A;  5E8G A;  1HKT A;  2DW4 A;  2XHK A;  1A04 A;  2MLG A;  5F64 A;  2NNY A;  3RYP A;  2ZKZ A;  3KFW X;  2HEO A;  1MD0 A;  5BPD A;  5D8K B;  3ZMV A;  1G4D A;  2OBP A;  2FOK A;  1R1U A;  2P7C B;  3FZV A;  4KUM A;  4ETS A;  1Y0U A;  1K6O A;  1YW7 A;  2RDP A;  2XAQ A;  1ZLJ A;  4YIF A;  3QU3 A;  4KIB A;  1IRF A;  3L00 A;  1O7F A;  1XDS A;  4EM2 A;  5BS6 A;  4MQV A;  3V4G A;  1DDN A;  1ZN2 A;  2PI0 A;  3F6O A;  3V8L A;  4ESB A;  4AIH A;  3HOS A;  4O3M A;  3WGH A;  1IN8 A;  3N97 A;  2MC3 A;  3ZQ7 A;  3KP4 A;  4B8X A;  2WTE A;  4ON0 A;  4OOI A;  1QGP A;  3QAH A;  3ZMD A;  3V7C A;  1OYW A;  3ZN0 A;  4AD9 A;  3VOE A;  1BOA A;  2D1V A;  4P96 A;  3IRQ A;  2XAH A;  4ZYH A;  4RAY A;  2V1U A;  2F2E A;  2FEZ A;  1RZ4 A;  2EV0 A;  1K79 A;  2K86 A;  5LGT A;  4G7Z F;  1ZHF A;  3I71 A;  4WXH A;  2OAZ A;  2YPR A;  3WTT C;  4XRF A;  1I27 A;  2LF7 A;  2HR3 A;  2QM3 A;  3J7A O;  1C0W A;  4ZZL A;  2WWY A;  4HDU A;  4LJZ F;  1REP C;  1U2W A;  3NRV A;  4LGW A;  1TQI A;  2A68 F;  1ZAO A;  5L3G A;  1DP7 P;  1RNL A;  2LNB A;  2DI3 A;  3ZMZ A;  2QBY A;  1U8R A;  1R1V A;  2DK8 A;  3LFK A;  1FYL A;  2GZW A;  4RGR A;  1S6L A;  1YYV A;  2FMY A;  4EJT A;  3BRO A;  1R00 A;  2DQR A;  1KU9 A;  1T6S A;  2QYO A;  4Q5S F;  2QEN A;  1YQA A;  3CJN A;  1WKM A;  1BIB A;  2C6Y A;  3KP5 A;  3K69 A;  4RS8 A;  3HHH A;  2HFH A;  4ZYE A;  1IN6 A;  3HRM A;  4I7H A;  4CXF A;  5HDN A;  4ZYD A;  1XMK A;  2STT A;  4Q4Z F;  2NRA C;  2P7V B;  3R61 A;  3C7J A;  2HYF A;  3KE2 A;  5LBQ A;  1SFU A;  2L3D A;  2UZK A;  2FE3 A;  3M1E A;  1FBS A;  2E1N A;  1JHF A;  1JHH A;  4BQA A;  3L7W A;  1NHA A;  3VOD A;  1ON1 A;  1STZ A;  2J5P A;  4RB3 C;  2EFN A;  2XAS A;  2OA4 A;  5E1Z B;  4XLN F;  1ZG3 A;  1R22 A;  2Z5U A;  4HBL A;  1DPU A;  3C18 A;  4OIQ F;  3MQ0 A;  2IPQ X;  1HKQ A;  4RB0 A;  4H0E A;  3IHU A;  4M74 A;  4MEX F;  4HF2 A;  1LEB A;  5H6R A;  3G3Z A;  3MWM A;  3TOA A;  5H20 A;  2MH9 A;  5HLI A;  2XIG A;  4DNC A;  2QVO A;  1TNS A;  5DDG A;  1KQ0 A;  1LQ1 A;  3M7G A;  2RKH A;  2VOP A;  2YSR A;  2CO5 A;  4M72 A;  3E5X A;  5TJJ A;  2QLZ A;  2DBB A;  3CUO A;  2NAZ A;  5DCM A;  2GXG A;  3RKY A;  2GXB A;  5CVU A;  5K5R A;  4R8H A;  3K1P A;  1ZRE A;  1Z7U A;  3KLN A;  4EM1 A;  5BOX A;  1J2X A;  4K2E A;  1T2K A;  1W5T A;  2YU3 A;  1G3T A;  1HSJ A;  2A61 A;  2ZME B;  4FHT A;  1B9M A;  1KGS A;  4KFC A;  4EJV A;  1IN4 A;  5HLG A;  1UST A;  2Q0O A;  4L9V A;  1FNN A;  1J9I A;  1ZGA A;  1G3Y A;  4EVI A;  3JAM K;  1F1Z A;  3DPL C;  3MZY A;  1MDM B;  3CUQ B;  3TO6 A;  2KIM A;  5L3C A;  3ROU A;  1CF7 B;  4FX0 A;  5DCM B;  2G9W A;  3Q9V A;  1ZGJ A;  1HKS A;  1RI7 A;  3DFG A;  5DD4 A;  1J59 A;  3GF2 A;  1O3T A;  2ZO4 A;  1O3S A;  4KYW A;  1GXP A;  4HV5 A;  3RIR A;  4FX4 A;  4HLX A;  4Y13 A;  3SZP A;  3O6B B;  2M1B A;  3W6J B;  3QPT A;  4BHC A;  5EEH A;  2VBZ A;  4RGS A;  3J80 K;  3O3K A;  3TO9 A;  3E6D A;  2PQ8 A;  5ICC A;  3CUQ A;  3ML6 A;  5CVI A;  2F5D A;  4OU0 A;  2P5K A;  3Q5F A;  2RNJ A;  3ERE D;  5L3D A;  2O8X A;  2O03 A;  1G6N A;  2IW5 A;  4PZJ A;  3DXJ F;  3K0L A;  3ISP A;  4AWX B;  1FPQ A;  2Y48 A;  1D5V A;  1Q1H A;  4LMY A;  1BJA A;  1KA8 A;  2HQR A;  5CYV A;  2CWE A;  2FNP A;  2W25 A;  2ZME A;  4UHT A;  4EGY A;  2P5V A;  1P92 A;  1AWC A;  2HKX A;  4YFN F;  3GXO A;  1LDJ A;  4BHB A;  4U0Y A;  4IXA A;  1OYY A;  4IRI A;  5LEK A;  2DT5 A;  5EEG A;  2R7F A;  3S2W A;  3TKY A;  1OR7 A;  3KEO A;  3HRU A;  4EQQ A;  2E7W A;  4HOB A;  2XKO A;  4PGH A;  3I5U A;  2RQP A;  3SHF A;  1IRG A;  2O3F A;  4N9I A;  4G94 A;  3FMQ A;  3F21 A;  2QQB A;  1BI3 A;  4WXD A;  4U0W A;  2IA1 A;  3C3W A;  3BJO A;  4BNC A;  2P4W A;  1KQ9 A;  3HIF A;  3V8K A;  3GX4 X;  1FOK A;  2FXA A;  1FT9 A;  2JPC A;  2ACJ A;  2WC2 A;  1XD7 A;  2J5O A;  3HSF A;  3J80 Z;  5L3E A;  1DPR A;  2VBW A;  2DU9 A;  2DAO A;  4KT5 C;  4ZYG A;  3EYI A;  4Z2Y A;  2KIF A;  4ASN A;  3WU0 A;  4HQE A;  3J81 K;  2E7X A;  4R79 A;  5HS7 A;  5FO5 A;  3KP7 A;  1XGN A;  2HQN A;  5DEQ A;  4HX7 A;  2OZU A;  3ZN1 A;  3CO7 C;  3I54 A;  1X3U A;  5LHG A;  3LAP A;  5LRR A;  4XSZ F;  2PMU A;  3IKT A;  2IA0 A;  5E8I A;  3E3V A;  1MDM A;  2HZT A;  4I02 A;  1MJA A;  1XCV A;  2LF8 A;  3V7R A;  1FP1 D;  5FLX Z;  2PBI A;  4RGU A;  3EET A;  2L54 A;  3M8E A;  3V7S A;  2Z33 A;  2W24 A;  3TOB A;  1D8J A;  2P8T A;  4HX8 A;  2CG4 A;  4L0Z B;  3R6S A;  2P6T A;  2YX4 A;  1V3F A;  1BI1 A;  4JBA A;  5CVJ A;  4IRH A;  3IRR A;  2H94 A;  3PFI A;  1JXS A;  5J6X A;  1IZ1 A;  4P9U A;  1O3Q A;  3CUQ C;  4QLC U;  4ENN A;  4LFU A;  2BBY A;  3LA2 A;  3SZT A;  3P9C A;  2W57 A;  2VE8 A;  1I1S A;  1J0R A;  3LA3 A;  3HTU A;  2EA2 A;  5L3B A;  2F5C A;  1EH6 A;  2W84 A;  4KDP A;  2XVC A;  5FGM A;  3W6K B;  3CLO A;  2KIU A;  2X0L A;  2KKO A;  1D3Y A;  1GXQ A;  3GFL A;  4G7H F;  1F9N A;  2R3S A;  2GWR A;  3ECO A;  1O57 A;  2G7U A;  3EYY A;  2HTJ A;  4L5J A;  2COM A;  3COA C;  2VBX A;  3BOQ A;  2ISY A;  1I6X A;  4CYD A;  3DPT A;  3I59 A;  1U6G A;  3F8C A;  3R60 A;  3GVA A;  1T38 A;  5AIQ A;  4OIR F;  2F5F A;  2RGV A;  3ZP5 A;  3JAM Z;  2STW A;  5HDK A;  2FML A;  4N0B A;  4HAM A;  1SD6 A;  3T8R A;  1R7J A;  3EUH A;  1QPM A;  2VON A;  1IN7 A;  3JSO A;  2ZFW A;  4O5V A;  3HTS B;  2QWW A;  4I01 A;  2M87 A;  5JI6 A;  5HLH A;  3GUD A;  4P55 A;  4G9Y A;  2YR2 A;  1ZG1 A;  2M45 A;  2XAJ A;  1XDU A;  3IWF A;  3QPH A;  2EJR A;  3TDU C;  4CZZ A;  3T5X A;  5HOO A;  1UFM A;  2W85 A;  1QBJ A;  2JZY A;  3MZH A;  4HYE A;  3FHZ A;  2JRT A;  3WTY C;  2JSC A;  2VBY A;  4ESJ A;  4E70 A;  5D6F A;  1LDK B;  4RB1 A;  4RGX A;  2PMH A;  1ZG5 A;  3L9F A;  2PG4 A;  3OOP A;  1OKR A;  5D6E A;  1LEA A;  3U1D A;  1IXS B;  2HYG D;  3BZ6 A;  3I64 A;  4WWC A;  2K27 A;  4OIN F;  1YIO A;  4UV9 A;  5TRD A;  1QO0 D;  3DEU A;  4KMF A;  5E1X A;  5HS9 A;  1XGM A;  3QP5 A;  1P4A A;  3PQK A;  3FWE A;  4YFK F;  1CGP A;  1H9G A;  1EV7 A;  3VEP A;  2MBF A;  3EDP A;  1QZZ A;  5E18 F;  1U3E M;  1IXC A;  3HHG A;  5LHH A;  1YS6 A;  1FBQ A;  2MH2 A;  4M6Y A;  2HDC A;  1O3R A;  3B02 A;  3GYH X;  2ISZ A;  1WI9 A;  1FSH A;  4FT8 A;  2A69 F;  2EFW A;  5L3F A;  2H27 A;  1JE8 A;  4BYY A;  3GW2 A;  2IVM A;  2LDU A;  4GYI A;  3F8N A;  3I4P A;  5H6Q A;  4EJU A;  2EWN A;  2XV4 S;  3F6V A;  3RTR A;  2ZJ2 A;  3P9K A;  1KYZ A;  4I0B A;  2HKO A;  5AIP A;  3IL2 A;  4CGZ A;  1FYK A;  3K1N A;  1Z6T A;  3GWZ A;  1IXR C;  3E5U A;  1BC8 C;  3D0S A;  2A3S A;  2ESN A;  2M30 A;  5DYM A;  1Z9C A;  3KEQ A;  1IAW A;  4KIG A;  1HST A;  1ON2 A;  1R5H A;  3HRS A;  5CJ9 A;  3BY6 A;  4WXC A;  2IRF G;  1U5T B;  4D0P A;  4ENK A;  2K7L A;  2CYY A;  1H0M A;  4WF2 A;  2LKP A;  3IC7 A;  2VT2 A;  5ILS A;  4A6D A;  4KMU X;  1B59 A;  1ZH5 A;  3P7N A;  4Y15 A;  1L3L A;  3F22 A;  4L5I A;  3ULQ B;  4OMZ A;  2B0L A;  4BH9 A;  5BMZ A;  2F5E A;  3I0T A;  4QWQ A;  4GXO A;  3E6M A;  5IT3 A;  4IF4 A;  4I2O A;  4WX9 A;  2MLK A;  5A2Q Z;  2H6C A;  3KZY A;  2RN7 A;  2IP2 A;  4U0V A;  3WTV C;  3N4M A;  4A0X A;  1UHW A;  4MEY F;  3RYR A;  2Z3Y A;  4MNU A;  3CTA A;  4M9Z A;  1FC3 A;  4U7D A;  3JTH A;  2H6B A;  3C1D A;  4I09 A;  1KQ8 A;  4AIK A;  2HWV A;  2MD5 A;  2AS5 F;  4A6E A;  1K78 A;  1T39 A;  3R4K A;  3KP6 A;  2EA4 A;  3H92 A;  3NEU A;  4MHG A;  3I58 A;  2PJP A;  3E6B A;  5KK1 A;  2OD5 A;  4NB5 A;  4YG2 F;  5E17 F;  2JT1 A;  5J8C A;  2XGX A;  2V1X A;  2DLL A;  1TQM A;  1B9N A;  3IKV A;  4WCG A;  2KJB A;  1Z05 A;  1TNT A;  1TQP A;  5K1Y A;  5IT9 K;  4LK0 F;  2QBY B;  1XB4 A;  3TO7 A;  1Z1D A;  1IF1 A;  4PDK A;  3H3Z A;  5D4S A;  1GVJ A;  1USS A;  5ERI A;  4BXU A;  1P4W A;  2NS0 A;  2YX7 A;  4KIC A;  2VN2 A;  4NQW A;  3GO5 A;  2QUF A;  5FB2 A;  1WRJ A;  2CSO A;  2FBK A;  3GFM A;  2ZCW A;  4YFX F;  1WSU A;  3E6C C;  1LNW A;  1ZRF A;  1FSE A;  1R23 A;  3T8T A;  3ZMU A;  1IW7 F;  4TV7 A;  4UVB A;  4A12 A;  5FD5 A;  2EV5 A;  4HLY A;  1MGT A;  1SMT A;  2IJL A;  1HW1 A;  4RB2 C;  1JGS A;  1WQ2 A;  4GYG A;  2DPD A;  3V8J A;  2A5Y B;  4ZH4 F;  2O0Y A;  1XGS A;  1CF7 A;  3WTS C;  3AAF A;  4I98 B;  3WGG A;  1R58 A;  3HUG A;  2VE9 A;  3DQV C;  3QP6 A;  2LSO A;  5CLS A;  5BPI A;  2FRH A;  3HYI A;  4L18 B;  3DKW A;  4LG0 B;  1Z91 A;  3F72 A;  5ILV A;  3QRF F;  1BIA A;  2D2W A;  1O7L A;  4NHJ A;  3GEZ A;  3KP3 A;  1YTY A;  3BJ6 A;  2PN6 A;  1YW9 A;  4Q47 A;  1XN7 A;  2ZNY A;  3F3X A;  2PLY A;  1MJ9 A;  2VC1 A;  1KU7 A;  5JHU A;  2A07 F;  3FXU A;  3PQJ A;  2GA2 A;  4IRG A;  4HA8 A;  1QNT A;  2XRO A;  1K78 B;  2GAU A;  2OZ6 A;  3KZZ A;  3T1B A;  1XCB A;  1B1B A;  3ZMS A;  3LQQ A;  3SXY A;  1YS7 A;  2EFQ A;  1GHC A;  2WV0 A;  1SAX A;  2DFI A;  4OIO F;  3BDD A;  3B73 A;  3RI4 A;  5DV5 A;  2FSW A;  3K9T A;  3CDH A;  5DUK A;  1I1G A;  5D5U B;  1IN5 A;  2HGC A;  3FM3 A;  3P9I A;  4S04 A;  2GQQ A;  1ZYR F;  4MGR A;  2XAF A;  5FLX K;  1YLF A;  4S05 A;  2FNA A;  1SD5 A;  4HX4 A;  1S29 A;  4LK1 F;  1BBY A;  2NNN A;  3FM5 A;  3KCC A;  3VFZ A;  3OV8 A;  4EGZ A;  4HQM A;  1E2X A;  4O6J A;  1TLH B;  3CO6 C;  1YG2 A;  4HF0 A;  5K5O A;  3BP8 A;  4EMS A;  1T0F A;  1YFH A;  1SD7 A;  1T98 A;  4HF1 A;  2EK5 A;  1W7P B;  4YII A;  1P4X A;  2BGC A;  1FY7 A;  1UHM A;  1QZY A;  1U78 A;  1BN5 A;  4ENM A;  1UCR A;  3F23 A;  2G7H A;  2JPB A;  2OU2 A;  1FWZ A;  1EH8 A;  3RJP A;  5JVT A;  1R1T A;  3QOP A;  3I53 A;  3RPU A;  1KU2 A;  2Z9O A;  1MKM A;  4G6D A;  3FMS A;  3WTX C;  4M71 A;  2VXZ A;  3WOD F;  2K4J A;  3GLX A;  3LWF A;  4BAY A;  4B09 A;  1RUO A;  2A6E F;  3TDZ C;  4A0Z A;  1D8K A;  4UVC A;  3RKX A;  5E20 A;  5FFZ A;  4XSX F;  5DUI A;  1F5T A;  5IT9 Z;  4XLP F;  1IUY A;  2QQA A;  4UUV A;  3FXQ A;  1XMA A;  1P6R A;  1FX7 A;  2DO7 A;  4G6Q A;  1OPC A;  2Y75 A;  1L0O C;  1B6A A;  2XRN A;  2DQL A;  1FBU A;  5AON A;  4LB5 A;  5JR3 A;  2UXX A;  1TW2 A;  3DV8 A;  1J75 A;  1S3J A;  2M5W A;  3I59 B;  5ILU A;  1U5T C;  4EV0 A;  1OMI A;  2ZXJ A;  3VB2 A;  5D4R A;  3TQN A;  3ELK A;  1Z6R A;  2HS5 A;  3O2P E;  3GFJ A;  4BHP A;  4AIJ A;  3K1M A;  4F7Z A;  3BPV A;  3GZ5 A;  2VT3 A;  5F6F A;  2L4A A;  2OQG A;  4UNO A;  1KU3 A;  1R5G A;  3MCZ A;  1RIO H;  3ABT A;  5HS8 A;  5A2Q K;  3SQN A;  1YO5 C;  3MAJ A;  4L9J A;  4PGG A;  1AOY A;  4CHU A;  4IVN A;  2RV8 A;  3F8F A;  5LGU A;  2XAG A;  1K7A A;  3HSE A;  3ZMT A;  2O6G E;  2RVC A;  1ZRC A;  4GO1 A;  2FQ3 A;  2V9V A;  2EV6 A;  1PP7 U;  1SMY F;  4HV6 A;  1BI0 A;  2IT0 A;  2CFX A;  3GZ6 A;  2DK5 A;  3WTZ A;  4IHT A;  2FBH A;  4UV8 A;  2HOE A;  2QZ8 A;  2XKP A;  3KET A;  4U88 A;  4ZZD A;  4G7O F;  5F1R A;  2ESH A;  4A5N A;  3QU6 A;  2GIV A;  1S8N A;  3HOT A;  4EJO A;  3WG9 A;  3DP7 A;  2EFP A;  1V4R A;  1S7O A;  2UXN A;  1XGO A;  4LG0 A;  4UXN A;  1W4M A;  1ZAR A;  5FFX A;  2HTS A;  2CW0 F;  4Y17 A;  2Q2E A;  1TW3 A;  2DTR A;  4Q48 A;  4MTD A;  1HXD A;  1SD4 A;  1PP8 F;  1BC7 C;  3U2R A;  1G3W A;  2TDX A;  5CVR A;  2DPU A;  4AVP A;  4L9T A;  1HW2 A;  4N9H A;  2MA3 A;  4CDG A;  2FF4 A;  4IJA A;  2RC4 A;  1WWX A;  2EB7 A;  3BWG A;  3DF8 A;  2V1D A;  2L01 A;  2FBI A;  2Q8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...