1V55H

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1v55H00
5B3SH 1V54H 1OCZH 3ABLH 2EIMH 3AG3H 3AG4H 5IY5H 2DYRH 2Y69H 3ASNH 2OCCH 1OCRH 3X2QH 2EIKH 5B1BH 3WG7H 2EILH 3ASOH 1OCOH 3ABMH 2DYSH 1OCCH 1V55H 5B1AH 2ZXWH 3AG2H 2EINH 2EIJH 3AG1H 3ABKH
chains in the Genus database with same CATH superfamily
2FXAA 2KLOA 2DBBA 2X6XA 4UB6C 3TP3A 1VNDA 1Z91A 2QWWA 3GTGJ 1VZ0A 3CMMA 4DZJA 3IRQA 4RGSA 2R5YA 3L09A 5D5WB 5DUIA 1X2NA 4GCVA 3CUQB 4WWCA 3VSKA 2VODA 5DTDA 2QKMB 2DCEA 3V4GA 4BJTA 4L9JA 1A6QA 2EIJH 3H0DA 1Z7UA 4ANJA 4IZZA 1RRJA 4GGGA 3E0JB 4B43A 2XASA 5DDGA 3JRFA 2Y75A 3HSFA 1Y8QB 3OYEA 2QQ9A 2L4MA 4HQEA 2KRCA 2FOWA 2WV1A 4F3QA 3OIOA 2XHKA 4IEJA 2NVXJ 1I6HJ 4E7ZA 1XG1A 2V1NA 3BPVA 4MFDA 3U1KA 2EFQA 1XGSA 2EQRA 2ZJQF 1YX5A 5FFZA 1EV7A 2EZIA 3KP6A 5D4SA 3E5QA 4N9IA 3CMYA 1XSDA 4HZFA 5CVJA 3TW6A 4II3A 3ERMA 3TGNA 3Q5FA 5FD6A 1A6IA 1H88C 2VOOA 5LEKA 2FX0A 4BQQA 1VTNC 4JQFA 5F1JA 3ZMDA 1FTZA 2Y0SA 2QUFA 1LFUP 2LVSA 2B9SA 5EJCA 2HFHA 1G3TA 4UV9A 1IRFA 4ZYDA 3HPGA 2OCCH 2Y0SN 2VT3A 2PJRB 5HNHA 3E6DA 3ZGKA 2EZHA 4I6ZA 2GXAA 1DP7P 3ECOA 1BI0A 5CQEA 4ENMA 4NB5A 2CW0F 4DOZA 1V5EA 3CLQA 2MLKA 3T8TA 1FBUA 3QPHA 4LG0A 2VPRA 5GTHC 1Y1VJ 5E3OA 2VQHA 3CCJI 3I4NJ 3VYTB 1T0FA 3LFKA 2KQRA 3K4CA 2RV8A 5HDGA 5LGNA 3S1QJ 3CESA 4ENNA 4MO7A 2ZNZA 2DPDA 2W4SA 2E5ZA 4I0BA 2L01A 2LD5A 3DF8A 1JE8A 3DLLF 3WGGA 1MBJA 1QU3A 3KX2A 4A3DJ 1XSXA 2STWA 1SVOA 2PI0A 3LAJA 5IT3A 4IQ4A 1FSEA 3Q9VA 4NQWA 3QAHA 1FOWA 2DAOA 2A07F 1BA5A 2QZ8A 1HBXG 3BQYA 2ELJA 5FLMJ 1IF1A 1FPQA 5L3GA 1SD4A 2EB7A 2JA5J 1KU3A 2FUG2 5JR3A 2Z9OA 4GFBA 2VPLA 2M87A 3VOEA 4A2UA 2LBFB 2LBFA 1MMSA 4ZTJA 1VQOI 2ECBA 5LGUA 5EGOA 3Q9SA 4KN7X 3LSMA 3R0AA 3JRIA 4D5FA 5TISC 2H8RA 2UXXA 4PSWA 1YLFA 3K1PA 3RI4A 4MQVA 1S7EA 4G9YA 1MBKA 3BG6A 1S9HA 3CJNA 4HA8A 1WCMJ 2R4GA 3FMQA 5HS9A 1VFCA 2DXIA 3GEZA 1D1CA 2X6WA 4G6TB 1WZ2A 1HKQA 4DZPA 5D8KB 1ETOA 5DD8A 5J6XA 1F4KA 5JI6A 2QA4I 1ERDA 2GOXB 2DA4A 3RTRA 1WFXA 2FNAA 2GXBA 3DEUA 3E6CC 3U1DA 4UVCA 3ERED 1LVKA 2YUSA 5E20A 1LE8B 1KU2A 1LE8A 4OIOF 1W5CC 4CCMA 3CCVI 4UB8C 1XDUA 3DU5A 3PFYA 2CQ7A 3CCSI 1NHAA 3Q0UA 4NHJA 4ESBA 5JVGF 4RS8A 1M1EB 4LK1F 4YEJA 1ZG5A 4OMZA 4KIBA 3LSHA 2W82A 1RKWA 4BBSJ 4RAGA 3GTLJ 3FXOA 3PIPF 5K1YA 1I1GA 3I4PA 3L2QA 2LKPA 2KP6A 2YPRA 2IGNA 5BPDA 1P92A 5LHHA 4BEHB 4BEHA 4NC7A 2DU9A 2PMUA 4NDLA 2NNYA 4RM2A 1LB2A 3OY9A 2KRHA 1ON1A 3HRUA 3L2UA 1MNDA 2H09A 3H9GA 4LFUA 2R7FA 4CZZA 3BPXA 2L9VA 1S72I 1YJWI 5C44J 1D0YA 1I3AA 3BJ6A 3RPQA 3GTPJ 3HOVJ 2BY0A 2D45A 1X1AA 1X2MA 3H1CA 4C2UA 1A35A 5KAFC 2BEOA 3OSGA 3O3KA 2UXNA 4CSWA 1SFXA 2HR3A 2RQPA 2OAZA 2VC1A 3W6VA 4FX4A 2E34A 4BXFA 1RKTA 2M8GX 2MFZA 4L18B 2CSOA 1TQIA 3COAC 2JPCA 2RC4A 2XAFA 3DEEA 5DCMB 3MD2A 5DCMA 3F23A 3BZKA 5CVIA 3LSIA 2AXLA 5HS8A 2DA6A 1EH7A 3RDIA 1AHDP 3QYEA 5M3MJ 2PN6A 2VT2A 2CH0A 2IP2A 1TW3A 3F72A 3WTWC 1T2KA 2Q8KA 2TRTA 1P4WA 5E3NA 4EJVA 1DU0A 3OYMA 3VPRA 1OJLA 2KZGA 4YIIA 3ULQB 2Z2SB 3BJOA 3QYFA 2Z1DA 1L3LA 2WAQN 3V8KA 3I58A 2R7DA 4KMFA 4I76A 2M8EA 1SD5A 5GAEJ 1Z3XA 1UZCA 2X1CA 3WGHA 1IXCA 3K4MA 3GTMJ 2HOAA 1X3WB 2LF8A 2Y48A 4IL6C 3IHUA 4DYQA 5CPRB 2QSFX 5JLXA 3A2KA 1U8BA 1F36A 1N78A 5K5QA 2B63J 3LSRA 2GIZA 3H9QA 3S16J 4WX9A 3TL4X 1WJFA 3HRMA 3M7GA 2WWYA 4HPQA 2L9SA 3S93A 4BDYA 1QZZA 2KISA 1K78B 1FT9A 1X58A 4HX4A 4BQNA 3MQ0A 3I54A 2HGCA 3BLYA 5JVTA 5IYBJ 1JGGA 2VBWA 2FEZA 2OCEA 2EPFA 2M0MA 5DUKA 3J7ZI 3VWBA 4PFPA 2EWNA 5FROA 1WVRA 1R36A 4RAZA 3P9KA 2O0YA 3V8LA 3H3UA 5L3FA 1JKOC 4UXNA 3ZR8X 3FXKA 1YS7A 1QZEA 1X1PA 2P0WA 2RREA 1XGOA 3HUGB 3HUGA 4PJNA 3U9GA 3OS0A 3CUQC 2ISZA 5FRMA 2ZNYA 2A68F 3GO5A 2M5WA 4RLFA 3BZ6A 4WXHA 3EPZA 3FM5A 3X2QH 4CYCB 4XKCA 4I99C 2ESNA 2QENA 3SQNA 2WB1N 2UV1A 3D0SA 3GFLA 3TOBA 4ZDPA 4BL0B 3MZ8A 3WHCA 4HNTA 3GCMA 2ZXWH 3HC7A 4P9FA 4R1HA 3G6EI 3Q0VA 1Y0NA 4L9TA 2P7VB 1R5GA 2VJ5A 2V6CA 1B8IA 3JREA 3NWTA 4AYBN 4BS9A 3A03A 2X1DA 4KDPA 1X4OA 1MD0A 3CD6I 4C3JJ 3R61A 5GAGJ 2FOKA 3MKLA 3GMEA 3ABMH 3PL8A 2XDVA 3JSOA 1APLC 2IS1A 2L54A 1L0OC 2M0CA 3DPUA 2GWRA 4WXDA 3JRCA 1LUJB 2VB6A 3CZ6A 4HDVA 4BE1A 2E2IJ 2JSPA 5ICFA 4HF0A 1TT0A 3ZN1A 2HTJA 4IXAA 4D0PA 3F21A 2XF7A 1FOXA 3CF5F 1ITYA 5FKOA 3BR3A 3M8FA 3I5UA 2LF7A 3I0TA 1DGWY 3PFIA 4LGWA 4MTEA 2FA5A 2F5EA 4KMUX 3H9JA 2P81A 3WTTC 1BI2A 1G3YA 3JRGA 3L2WA 3E7LA 2PMHA 2OZUA 3KP2A 2P5KA 3OYLA 3ZP5A 1T38A 3V42A 4BHBA 3S15J 1USTA 4YFXF 1YRNB 1YRNA 3KYDB 3BG3A 4UHTA 1FC3A 2KFDA 1MBFA 2L3DA 1Z67A 5GPAA 1NK2P 3KZIC 1MIJA 1N77A 2QQBA 3ZXSA 4Y7NJ 4QSHA 4PJMA 3OYKA 1U0JA 5E8GA 2VJJA 1DUXC 3ABLH 3RPUA 1R22A 3C3WA 2O5RA 3HJEA 1FTTA 5K7ZA 3G1MA 3I53A 3LAPA 3AAFA 5IOYA 4A3JJ 1EJ9A 5FFXA 1STZA 4ZYHA 1IRXA 4FX0A 1XC5A 1K6YA 3AFHA 3CCMI 2ECCA 2G7UA 3GLLA 3O8HA 4GRIA 3WODF 3C2HA 3RIRA 2DK8A 2HYJA 3F8NA 3LSGA 2CV1A 3UNGC 4BE0A 2PX9A 3VYRB 1U8RA 4IF4A 2EV0A 4Y33A 4RDUA 1D0ZA 3D5RC 5FJ8J 4OOIA 5LRRA 3QQAA 1IN6A 3I56I 2H94A 2Z16A 1RZ4A 4FE7A 1RETA 2GM4A 1ETQA 2LY2A 1I3QJ 2COMA 2K9QA 4ASNA 2ZC2A 3BCAA 2BW3B 2BW3A 4U7DA 4A5NA 1D3YA 3ML6A 2XPVA 2E1MC 2Z5UA 4M6XA 5D8LB 2P4WA 1AA7A 1FZPB 3MCZA 2UUZA 1WJ5A 3CP8A 3MN2A 1O3RA 2N8GA 4AVZA 5H2FC 3M8JA 2BY2A 3FXUA 1IUYA 3C1DA 4M3GA 5KK1A 4DBQA 3G71I 4XOTA 1G6NA 2DOAA 2EV6A 4YIFA 2V6EA 4CCKA 5ILVA 2JPBA 4CA0A 5F0CA 2BGCA 5HLHA 3PO3J 4A3KJ 1FX7A 2ZXJA 1TW2A 2UZKA 3GTKJ 4GYGA 2EZLA 1UHSA 1UJ8A 3DKYA 2HTSA 1SFUA 5M5YJ 2DYSH 2IW5A 2VKVA 3CDLA 2E1OA 3NWSA 3VYSB 1RI7A 2O3FA 5F27A 4OIQF 1IXRC 2OJED 5ERIA 5DYMA 3FZVA 3OS2A 2ZCWA 5IP6A 1WRJA 2PBIA 3SZGA 1R49A 1IRZA 3J7YJ 5TRDA 4KIGA 1JTYA 3DKWA 4EM2A 1FLIA 5FLVA 3K4KA 1SAXA 1ZELA 1Z0XA 1TWFJ 3C2GA 3HRSA 2EILH 3CC4I 1UHMA 3JAMZ 2YR2A 1XGNA 2Q1ZB 3B02A 3SEQA 2ZBKA 1U3EM 3A02A 4L5IA 1GT0C 2UWMA 5B1AH 2LC2A 1HKTA 3NARA 4HV5A 2RQQA 1J5YA 3EDPA 3MWMA 3K1MA 4IOCF 2OV7A 3S1RJ 2E7WA 2K9MA 3OS1A 1OCPA 3S3NA 2DT7B 2G9WA 1Z3YA 2FD5A 4CICA 2NVQJ 3F8CA 2FQ3A 2R7WA 1ZR4A 2BHYA 3IAS2 1XD7A 2GA1A 2MC3A 3FM3A 2BY1A 1Y6IA 4XLCA 1T56A 3ZMVA 5DS9A 2DA7A 2BYVE 2ZMEC 2EBIA 4IHVA 2JN6A 1BIBA 2MYSA 2WBMA 3HSEA 4DYCA 1X3UA 3LOCA 4M73A 4S05A 3OYGA 3WU1B 1VQ7I 1JKQC 3C18A 4F92B 1OR7C 3QODA 1IO2A 4G6QA 3J81Z 3UKGA 1JT0A 2MD0A 3B6AA 2IPQX 1H9GA 4CCOA 3SDGA 3TEDA 4AU7A 3FHNA 2IGOA 4OAZA 1F43A 4AIDA 3DPLC 4C30A 1HC8A 2A69F 2ACJA 4N0BA 3CC2I 4Y4RA 2DOEA 1IXSB 3HOSA 3QRFF 3GUDA 2XAQA 4X6AJ 2V26A 1XCVA 2GBYA 3NAUA 4FQGA 1LKXA 1VQ9I 1Z9CA 2O8KA 2CO5A 1J9IA 1K79A 3K70C 2HPMA 4IHXA 4P55A 2V79A 3L00A 1ZHFA 3CCRI 3NQOA 2XB0X 4KISA 5FRNA 2E60A 1J75A 1FOYA 1QHGA 3DP7A 5FKNA 4OMYA 1FYMA 4N4OB 2TDXA 3BQZA 3LQQA 3OIQA 1J7KA 5AONA 3JCUC 1R58A 1ZGAA 2DJIA 4XNFA 1UFMA 3WHBA 2L4AA 2W24A 2VC0A 1FSHA 1ZH5A 2M4GA 3H5NA 2K7LA 4P1WA 5FO5A 4LIVA 3KYCB 4IKFA 3GFMA 1CGPA 2QKLB 3IV5A 2P8TA 4HV6A 4XKVA 3IWFA 1KU9A 5EEHA 1K7AA 2V1UA 1BW5A 4UVAA 3EUKL 1JKRC 2HI3A 2KRFA 3TDZC 4AM3A 2E1NA 4U87A 2CUZA 3DV8A 2MBFA 3IAM2 4RAYA 4PFOA 1HA8A 1ZKGA 3A01B 3A01A 2R3SA 4GXOA 1BC7C 4EMSA 1WJBA 2R7SA 2XV4S 3JR9A 3K6GA 1OQYA 1QPIA 2BV6A 2VN2A 1SMTA 3BG7A 1YOVB 2XGCA 1UELB 3JTHA 1ZQ3P 1VQ6I 2W84A 1ZR2A 1HSTA 3DPTA 4JX5A 3K4BA 5E18F 1GUUA 2QCOA 3EYYA 4CDGA 3HOWJ 5C4XJ 3CUQA 4L9VA 4DGWB 3I9V2 3WTUC 3OL3A 3PNTA 4V2FA 4YFNF 3OV8A 2V1XA 1S5LC 2QGUA 3SZPA 4E7SA 5HDKA 4AIKA 3SYTA 3C7JA 3BR0A 4CYDA 4FCYA 2LYCA 4U88A 2AS5F 2EIMH 4PJ0C 1OPCA 2YSRA 3BR6A 5CKTA 2CQQA 2F2EA 1PDNC 1WSUA 1AWCA 4Q4ZF 2CW7A 1QQIA 4XLNF 4DBRA 2AQEA 4JK1X 4PK4A 4IJAA 1KONA 1UCRA 2DI3A 4HDUA 2K9SA 3OR1C 2L5QA 4IX7A 2AQFA 3BCBA 2NRAC 2K85A 2IS2A 3WE2A 4B8XA 2DDAA 3K4JA 5FKKA 1WKMA 4IHSA 3PO2J 4IO9F 2NOGA 4NC6A 1DDNA 1ETVA 3FWEA 1WJCA 3GZNB 3CQZJ 1G3WA 2M4KA 2O03A 2JQ7A 4CCNA 4LLGF 1KGSA 4U0YA 2PJRA 2K27A 3ZQIA 1JJ8C 1B59A 4XLFA 5LGTA 1YW7A 2XB5A 3BTCA 3CCLI 1MSEC 4IHWA 2YS9A 4IRGA 1X4PA 3T0YA 2QYOA 2V7FA 2WAEA 4E6KG 1BIAA 3BP8A 1HOMA 1G2HA 1ZYRF 4G12A 3IL2A 4KT5C 2EINH 2XGEA 3HOYJ 1OYWA 3QOPA 1C0WA 1MSFC 2DA5A 3F6OA 3ZQGA 1KQ8A 1HF0A 4ZYEA 3FK7A 2QSHX 2CUJA 1X1BA 2VJ4A 3RZOJ 5H6RA 3N4MA 3H35A 4IHYA 1Z6TA 2H6BA 1XTAA 1BJZA 4XIDA 4JX6A 3A1YA 2XRLA 2LDUA 1R9TJ 1RIOH 2B7EA 3FMRA 4LIUA 1IZ1A 2MW8A 1T6SA 5B66C 2JSCA 3TW7A 2K4BA 1SEUA 9ANTA 3VDXA 3OYFA 3HOZJ 2X6YA 3GXOA 1NTCA 3AG1H 4M6YA 1PP7U 1UAAA 4UUVA 2BXYA 2HVSA 1U6GA 2R7QA 1KZHA 1VQKI 5DV5A 5F04A 4M3FA 1XDSA 2FBKA 5HNFA 2JTVA 4DYRA 2DQLA 2VBZA 3HB9A 3DTIA 2OUMA 4EEFG 3BTIA 2FBIA 1YIOA 1QA6A 4LG3A 1ZG1A 5J4YA 5L3EA 3ELKA 4A3CJ 2AHQA 4U7BA 3VYUB 1LDDA 1WI3A 2JA8J 3W3CA 1JT6A 1TQMA 3TP0A 3ABTA 5IP7J 3G4SI 1IC8A 4HX7A 4XN0A 2L9RA 2E1MB 1F5TA 2KIUA 4XMYA 1ODDA 4HQMA 2R5ZB 2R5ZA 3L7WA 4N4NB 3PQKA 1DQUA 4EGYA 2HZTA 3G1LA 1Q1HA 4S0HB 2HXIA 1XMKA 2KT0A 4U0VA 2ZSHB 4KJZA 2F6CA 1P4AA 2O8XA 6PAXA 5JHFA 4E7JA 4ABZA 3IRRA 4B4CA 3IH2A 1P7JA 2BVLA 5KNLA 4F7ZA 1TNSA 1LDJA 1D8JA 2D1HA 4ZDLA 3P7NA 2RNJA 1RUOA 4C2TA 3LSPA 1BR2A 1PUFB 1PUFA 5IT9K 1UHWA 2KIMA 1S3JA 1O3QA 1FOKA 2QSGX 2K9LA 2NNNA 5AIPA 3M1CA 3TOAA 1D0XA 2RAEA 1E17A 4KITB 4BYYA 5ICEA 3SEZA 2X51A 2OZ6A 3PSFA 4M9SA 3VODA 4KN4X 5IOZA 1MMNA 2DODA 5CYVA 3V8JA 1FBSA 1TT5B 4B47A 2Y30A 5EEAA 4XL9A 2HQRA 2V4JC 2X1EA 4FETA 5LD2C 2DA3A 1FYKA 2R7ZJ 4JBAA 1R1VA 1HLVA 4I2OA 3ZQHA 1J09A 3ZCOA 3AG2H 2J5OA 2CUEA 2YX7A 2JWTA 3OWTA 3T5XA 4C9YA 5JFRA 5JLWA 2HVQA 2XUBA 3MVPA 2HVRA 3RQIA 3WTSC 2HU9A 1MMAA 3LSJA 3VEPA 3GBGA 2GIVA 1TWCJ 2M9HA 3FF5A 2JRTA 5LEJA 2JZYA 3LSTA 4BHCA 1BOBA 2IA1A 5D4RA 2WY8Q 5F0FA 4CH7A 4EJOA 3LFUA 3M3YJ 3CCYA 4XKWA 5FGMA 4B3XA 1K4TA 2IS6A 1VQ8I 2E2HJ 2WAQA 5E1WA 3K10A 1B72B 2ZMEB 1KA8A 2ZMEA 1B72A 5B5EC 2ZJ2A 3KEQA 5AIQA 4ON0A 1E2XA 4P96A 5M5WJ 3CDHA 2WC2A 1NH3A 3KCCA 1XB4A 4LB6B 5D5UB 2X0LA 2EFOA 1OFCX 1OR7A 5A2QK 3JRBA 4BXXJ 1NG7A 1BC8C 4HLXA 3K70D 5K7HA 1TBXA 1FBQA 1I39A 1U5TC 4ZC3A 4C2MJ 1Y0UA 1W36C 3ZPLA 3SDBA 3S1MJ 3T8RA 5IYDJ 3E5XA 4P9UA 4J19A 1Z7LA 4I02A 4ZYGA 1YQAA 5HLTA 3K2ZA 3OL4A 3GFIA 3AG3H 2XAUA 1K78A 5CVUA 2DYRH 2GZWA 4XOPA 4QPQA 3TQNA 1TWAJ 4A0YA 1P6RA 4RGUA 4XRSG 3I4MJ 2HKOA 1S6LA 2K40A 2F5VA 3MFKA 1G8XA 3G3ZA 4HBLA 3K1NA 3M8EA 2FE3A 4CGZA 2JA7J 1R1UA 2L02A 1DPUA 3RYRA 1TTYA 1TWGJ 3R60A 3TMOA 1D8KA 2DTZA 3EUAA 1R7JA 2F4OB 1ETKA 2ZJPF 2DTRA 2KIQA 1O3TA 2F5DA 2LTPA 2DLLA 5E1XA 3D5LA 5ILUA 2JA2A 2VE8A 1IGNA 5J40A 2WB1A 1LQ1A 2VOPA 4CYCA 1GHCA 1JUPA 4HLYA 5DD4A 1GXPA 2BZTA 4M3EA 2Z3YA 4XICA 4EGZA 1USSA 2F5CA 1MBGA 4HNUA 1YO5C 5F0HA 2R7UA 1MNMC 3M07A 2K5CA 4FASD 2ZSIB 2E35A 1ZLJA 2FU4A 3HKZA 2WADA 3FXQA 4AYBA 4MIMA 2NVUB 2GOMA 2QM3A 5FLXK 2W1OA 1YI2I 3DEWA 1GDTA 1TL8A 1ZG3A 2ZKZA 3HKZN 2CV2A 4H0EA 1VI0A 2P6SA 3K7AJ 2NAZA 3KEYA 2LNBA 4A3FJ 4WF2A 2CWEA 3HHHA 1ZGWA 1EH8A 4XBFA 1H89C 1ZRDA 2R7XA 1WH7A 1VQNI 3WTXC 2HZDA 4U0WA 1REPC 1LPQA 4XQFA 1WI9A 2K3FA 1CQTA 2X9DA 4EVIA 1XX5A 3QPLA 2JUGA 1FWZA 1MKMA 2CS3A 3IWZA 3DLAA 3ECHA 4JYKA 5BPIA 2I10A 4AUXA 1ULYA 3ROUA 1ZRCA 3HOUJ 5E79C 4PJLA 1MH3A 3AG4H 5M5XJ 2GLOA 3FBNB 4R8HA 4A93J 1QVTA 3BC8A 3CJQB 4XN3A 3HOTA 3IP4B 2WAFA 4D7MA 1BR4A 2OQGA 2PJPA 2VE9A 5K5RA 2XROA 2WV0A 4D9JA 3LMMA 1DGRM 5EZHA 4A6EA 2XRNA 2CQNA 1DPRA 2ISYA 4I7HA 2LY1A 4HNVA 1WJAA 4KFCA 2ZFWA 4YIRX 4HEA2 3SZTA 2L0KA 1UB9A 2XSDC 4ZTFA 5ILSA 4QPOA 2LG4A 4AC0A 4MLOA 4I98B 4ESFA 3CMAI 3FXJA 5BOXA 1T0FC 1RESA 3F8BA 3LA7A 4XLAA 1RR7A 2EK5A 4EATA 3L2CA 3W2VA 1SVMA 3EQLF 4D7NA 2GA2A 4I0AA 4XLEA 2HOEA 2LOOA 3GLXA 5CJ9A 2KDOA 5K7FA 3KP5A 5D5XB 4M9XA 4HG2A 2CV0A 1FYLA 1T8IA 5GADJ 3KIOA 2FBHA 3MMYB 5JHUA 4QLCU 1O57A 2COBA 2VLAA 1ZLKA 5E3MA 4DQ2A 2DDBA 4UUSB 1B4AA 2ETHA 2XAHA 2VI6A 2W25A 2Y0MA 5J47A 4Z2YA 1HW1A 5DEQA 2M7AA 3I64A 4X0GA 1Z05A 1Q1VA 2KL4A 4ZH4F 4AIJA 1R23A 1IUFA 4P5OA 1WHUA 3BG5A 1IV6A 2QLZA 2JUCA 1OCZH 2VASA 4Y17A 5LHIA 3J80K 1IRGA 3IKTA 2OU2A 3DTKA 4Q48A 4ZYAA 3G73A 4XORA 3GZ6A 5E1ZB 2M2EA 3K4LA 3F22A 1XS9A 4RA2A 1GV2A 4ITVA 4R79A 1FIPA 5EEGA 1R4NB 4LITA 1V55H 4FTHA 3SXYA 4NBQA 3GTOJ 1PVEA 1D1AA 3LQRA 4MEYF 3V7CA 1ZTRA 1RR8C 3E5UA 2QBYB 2QBYA 2D1VA 1I6XA 3LNQA 3KZYA 1AOYA 1DP3A 1U9NA 2PG4A 2DT6A 2VBYA 2P5LC 4XM3A 4EJTA 4XLPF 3CP2A 4RB0A 2PQ8A 3E1SA 2EH3A 2HPIA 4UV8A 1FNNA 1AKHB 2LFBA 1AKHA 4PGHA 3FBIB 5FKMA 4YG2F 1MMGA 1JHFA 2IS4A 4M3BA 4CZCA 2JMWA 1JUSA 2HOSA 2CQKA 1IN7A 2XIGA 4H4KC 4O6JA 1ZN2A 4KT6A 2Y9YA 4CUGA 2V9PA 1EH6A 2DA1A 4XLHA 4OIRF 4BH9A 3AKZA 2HXOA 4IHTA 3W2WA 1GVJA 1YX3A 4L9NA 1D5VA 1W7PD 2VUMJ 4RAFA 3ZOBA 1LFBA 3FKJA 3HTUA 1JHHA 2VKDA 3P5JA 1JI8A 5M3FJ 4WXCA 2EV5A 1HW2A 4ENJA 3CDIA 4RM3A 1WH5A 4L0ZB 2MH2A 2DK5A 3CJRB 2ZB9A 5E17F 3FIWA 5IPAA 2EA2A 2M3AA 3PM1A 1VQLI 3KLNA 2O9LA 2KMUA 2XPWA 1W7PB 1HW5A 4HSRA 3HGYA 4ZDOA 2H6CA 1NK3P 1I1SA 5F64A 1HDPA 4NC8A 2WTEA 2XKPA 2L7MP 3L2RA 2DPUA 1YHQI 5GTIC 4J01A 4BQOA 4L0YB 4IRHA 2GAUA 2ID6A 1MJ9A 3QWLA 4BBRJ 1V3FA 1SD7A 3H0GJ 2QF7A 5TJJA 2F48A 1PJRA 2ID3A 3RKWA 5GPCA 3OYIA 4BE2A 4A3MJ 1KQ9A 3HM5A 2XPUA 4MFEA 3ZQQA 1N75A 2IT0A 3W2AA 2CG4A 1U9OA 3RCOA 2MSYA 1EA3A 3QU3A 1UMQA 2OTJI 1G3SA 2A3SA 3ZN0A 3OYBA 2RVCA 1K4SA 1W36D 2VXDA 3DBHB 3E97A 5LBQA 4CO8A 1BL0A 3J7AO 3FKIJ 4CXFA 4LLLA 3RKXA 1TC3C 3VFZA 3PJRA 2A05A 3KEOA 2NS7A 4FHTA 4PJJA 3OYHA 1QO0D 2HDCA 1IN8A 3FX3A 2LKXA 1P7IA 3OYAA 4Y13A 2PLYA 2L9NA 3VB2A 1U5TB 1U2WA 1U5TA 2A6EF 3HL2A 1A31A 2FQ4A 3FXMA 3S3MA 2KJCA 3L2VA 3FISA 3I71A 4X1EA 3F0CA 4BDZA 4BY1J 2HDWA 3KFWX 1ACIA 1WGXA 3B6CA 1A04A 3HXLA 2JRMA 2GQQA 3TO6A 2XKOA 1VF9A 1FY7A 1V5GA 3B73A 3H3ZA 2W7NA 2OF7A 3R6SA 3BR2A 4KA4A 3L9FA 4M9ZA 4K2EA 2R7VA 2A6TA 4BNCA 3Q0WA 4G94A 3SHFA 3RKYA 1MMDA 2CFXA 4LD5A 2X85A 2AO9A 4E7LA 2IXSA 3FXRA 5L3BA 3S2DJ 4IOAF 1BJAA 3PQJA 5CQGA 2LMDA 2R7OA 3LSKA 3OOUA 3MZHA 2VIXA 3ZMZA 3TKYA 3K4NA 1YW8A 4L5JA 5CVRA 3MKWB 3OMYA 3S2HJ 3CUOA 3H36A 2E1CA 4HX8A 4CCJA 3V7RA 2QQAA 2GXGA 3DU6A 3ISPA 4XRSA 5J8FA 2R5YB 1FEXA 5LHGA 1E3OC 5DM7F 2ZFUA 4A0XA 1Z77A 2HDDA 3J7AY 1ORKA 2EJRA 2MG4A 1SD6A 1KU7A 1MGTA 4LB5A 1TP4A 3IUOA 2IJLA 3SFZA 3PNVA 3PUBA 2JK3A 2W85A 3G2BA 3GW2A 2DMTA 2CUFA 2XGDA 2JVHA 2XF6A 5GP9A 5J1UA 2R7RA 3E6BA 4G7OF 3L1PA 2DMPA 2D2WA 2EZKA 4MTDA 2VJIA 2CQXA 1POGA 3HIFA 4DJAA 2CFOA 2NOJB 1RPWA 1LEAA 2FRHA 1OCOH 2LSOA 4BY7J 2AXTC 3AL0C 3O8GA 2M30A 2Y2ZA 1T08B 1ZREA 3IKVA 4HF1A 3BG9A 1WPKA 4AWXB 1QZYA 4BJ5C 3ZRGA 2G0EA 1BI3A 1KQ0A 4A3GJ 2ZJRF 2LREA 3MKYB 2NVTJ 2XAGA 2RKHA 3M9AA 4AIHA 3RZDJ 2DO7A 3VSLA 1R00A 3BT9A 3EUHC 4DW6A 2H8WA 2Y31A 2Q0OA 3SJMA 2RDPA 2PMZA 3ASNH 1YG2A 4M74A 2M7BA 2W48A 4GYIA 2FSWA 1K83J 2IEKA 4A69C 1QHHD 2PMZN 3IH3A 4G7ZF 4HRIA 5IT9Z 1HXDA 3DQVC 4PZJA 2B0LA 1R6RA 3TBIA 2STTA 3CO7C 3DTEA 4EV0A 4LG0B 1BBYA 1IJWC 2LRDA 4ETSA 3GWZA 4PCQA 5F08A 4A3BJ 2K4JA 3CMEI 2CYYA 4B09A 4E4HA 4HOBA 4TV7A 1XCBA 3HZJA 3BDDA 3U2RA 2X6OA 4E7IA 2OC6A 2WA0A 1I50J 1BR1A 3C2BA 3RSNA 3I59B 3I59A 4L5EA 2HQ5A 5EZGA 2IVMA 4B44A 4PGGA 4KUMA 1FP1D 1OCCH 1PP8F 2O7OA 1SFKA 4NQWB 1Z6RA 2E19A 3KE2A 4W97A 1GXQA 4QIWN 1Y8RB 1DU6A 2R92J 2XF5A 4FT8A 3WU2C 2FMYA 3WU0A 3MKZA 1CF7A 3WG9A 1CF7B 3HDDA 2O61A 2Y69H 1XPXA 3I55I 1SMYF 3DWLE 1RC9A 4RMNA 5J1YA 2MH9A 5EGOB 2F4IA 4Y3OA 3OYDA 2V9KA 4LJZF 1MNEA 1J2XA 5E8IA 1LJ9A 3QYBA 2Z33A 4I09A 1V4RA 3LL7A 2DJNA 3LA2A 4HSTA 2JVGA 5EYRA 3ABKH 1SFOJ 1T98A 2HWVA 1YYVA 1R5HA 5A2QZ 3ZMSA 1H0MA 1BM9A 4OU0A 3HTSB 4UY8I 2P6TA 3H92A 3OOPA 1MJAA 2LR8A 3A0BC 3TO7A 1IV8A 1E3HA 5J8CA 4G7HF 1K61A 4F55A 3GFJA 2OTLI 4PDKA 4BU2A 1OCTC 2LP0A 3A0HC 5J1RA 1RNLA 2G7HA 1WJDA 2QQ8A 2HNHA 4E7KA 2XC7A 1YJNI 1BOAA 1VQMI 3GF2A 4RB1A 4MQ9F 4M71A 1ONVA 2IAIA 1MZBA 1O7LA 3HEFA 4UVBA 3R0JA 2ADUA 2K02A 4HF2A 4XR6A 1BI1A 4A6DA 2ESHA 4AD9A 4BJ6C 5BS6A 1T39A 4IPAA 1IW7F 4HW0A 5KHDA 2FNPA 1X19A 2HYGD 1XSVA 1HKSA 2FMLA 1MBEA 2DMUA 5IYCJ 1B9NA 4RBOA 2L7KA 1OYYA 2KKOA 3HYIA 1JUMA 2J5PA 1AU7A 1FP2A 1YS6A 1LVAA 4D5CA 2R7TA 3H5RA 1YW9A 2K9NA 1JTXA 3KYLA 3K2AA 1B9MA 4CHUA 3KPHA 2RGVA 3BY6A 3WG7H 5D6EA 2HQNA 3F3XA 4MGRA 2VL8A 3QU6A 2I5UA 3IH4A 1XN7A 1MBHA 1SVLA 2XGXA 5FD5A 1F9NA 1B6AA 4B1RA 2MABA 2LLKA 5FLXZ 2DFIA 5LRSA 2VQGA 1V5FA 4F52A 2FJ1A 3ZMTA 3PIOF 2W57A 2VQLA 1Z1DA 5EF6A 3ZQLA 3ESWB 2HEOA 1YE9A 2ZXHA 5FB2A 5F1RA 3BTJA 3S8PA 5K5OA 4BQAA 2A6HF 1ETXA 4C3HJ 2RN7A 4A3IJ 2EFWA 2R0QC 2CW8A 1I5ZA 1P2FA 1EF4A 3KP7A 2BHZA 1IDYA 1YTYA 2E7XA 3OYCA 3BJAA 2BOLA 3ZQ7A 4S04A 5J3LA 4RB3C 4CCLA 1R71A 5E3LA 1KYZA 1OKRA 1HQCA 2LKSA 4HAMA 2I8DA 3Q3SA 3W6KB 5HDNA 1YIJI 2DQRA 2O6GE 4FISA 4BACA 2E2JJ 3S17J 1SAUA 1I27A 1OYIA 2MLGA 2V9VA 2X48A 3HRTA 1IG7A 3CF2A 3WTVC 1W5SA 1OCRH 4XKBA 3JRDA 5HS7A 1O4XA 2HOTA 3ABUA 2OQRA 3E3VA 5KVRA 4IVNA 5D5VB 4OIPF 4RLQA 3D5SC 4XRMA 3QPSA 4EM1A 4O3MA 2M34A 3DKXA 5ED4A 3HG9A 2Z99A 1FMWA 4G6DA 3ZMUA 1LEBA 3FXLA 2L2OA 1UG0A 2P5VA 2ZXIA 4N9HA 3QOEA 4B48A 4BUPA 4F93B 2CU7A 2DFHA 3HBLA 4BXUA 3MZYA 2VQCA 3ZQFA 2OBPA 5H6QA 4ZZDA 3GYHX 4XSZF 4OINF 2QVOA 3V7SA 3OSFA 1QBJA 1WJEA 5KCMA 5BMZA 3S1NJ 5HOOA 2BY3A 2VBXA 5D6FA 5C4JJ 3CTAA 2TCTA 2NXNB 1B8IB 1W5TA 4B3AA 2VXZA 3PNYA 1O3SA 5BNGA 3EYIA 2DA2A 2IBDA 1IDZA 3UR3C 4V19K 4XONA 3S2WA 1SC7A 3PUFA 4UNOA 4DIQA 5J4VA 2E5NA 2A5YB 3GZ5A 2IA0A 3TDUC 1WQ2A 2MD5A 4XRFA 2L7ZA 3BROA 3NRVA 1GLNA 3BZCA 3OYJA 4Y52J 3CCUI 4II2A 2FF4A 1IAWA 1H8AC 1X1DA 4M6VA 4ENKA 3M4OJ 1BN5A 1ZRFA 2ELHA 5CLSA 3J80Z 1JKPC 3ONQA 2IRFG 5EDNA 4GDFA 4A3EJ 3HPHA 3E6MA 5TGTA 3ZQCA 4KICA 4IQJA 3RPUD 3PSIA 4A0ZA 3LA3A 1TLHB 3G1OA 2CMPA 3M1EA 1XMXA 4JP0A 3EETA 3S14J 1PYVA 5HLGA 1MH4A 1ZK8A 3CCQI 1D1BA 1Z21A 4PSXA 1EKEA 1PUEE 4AVPA 3AL0B 4KNYA 1BW6A 2VKEA 4Q5SF 5L3DA 4NUBA 1N25A 4G8XA 5IY5H 5LFAA 3N97A 2KDZA 1Y1WJ 4JX4A 3GVAA 4UUSA 1VQ5I 1IN5A 2C6YA 3I3LA 3EUHA 1D5YA 2MA3A 1K6OA 1J0RA 2K86A 1JJ6C 1T95A 3D1NI 2EFNA 1B1BA 3BR5A 4XK4A 3JSPA 3KP4A 5F6FA 2K3PA 3S32A 2XAJA 1TQPA 3FDYA 1YITI 4LK0F 2KPMA 1QRYA 2W00A 2ZO4A 5HODA 2H1KA 3DBLB 2KIFA 4RB2C 1E0EA 3KP3A 1E3PA 1WWXA 3P9IA 5KAIC 2PFBA 1X1CA 3BTLA 5IP9J 3FMSA 3DXJF 4Z6YA 3CJTB 2HS5A 3GTJJ 2NS8A 2E71A 2XSJC 3CLOA 4NNJA 1XMAA 1TWHJ 2JJ7A 2P7CB 4Y15A 3F6VA 2R93J 2LY9A 4C3IJ 2IGKA 4A12A 2CGPA 2HYFA 1ENHA 3F9KA 3F8FA 3RJPA 3MAJA 3BWGA 1G59A 2JT1A 4DNCA 3JRAA 1O7FA 4ESJA 1P9QC 4LMYA 3HSRA 1G4DA 4FE4A 1P4XA 1LDKB 2KHMA 1J59A 1R5ID 4YELA 5EG0B 5EG0A 2YU3A 1F1ZA 3IC7A 5DM6F 4A5MA 2JA6J 1YJ9I 1S8NA 4F91B 2ME0A 3R4KA 4I01A 3CCEI 2OD5A 3N05A 2VKHA 3A4CA 2BXZA 3QPTA 5ICGA 2DT5A 4V2GA 2MC4A 2L7FP 1ZGJA 1QNTA 1W0UA 3WTZA 3HOXJ 3OR2C 2H1LA 3T1BA 1S7OA 3P9CA 1FJLA 3FK6A 4E70A 3DCFA 5L3CA 2NS0A 4BAYA 2EIKH 4O5VA 3K0LA 5GAHJ 4KYWA 4BGDA 2M45A 2DFEA 1VQPI 3K9TA 1GV5A 3GTQJ 4ZJZA 1LNWA 1XGMA 4QWQA 3CC7I 1NG6A 4A3LJ 1OLTA 1QGPA 2E36A 2ELKA 4RGRA 2DN0A 1ZAOA 1LFPA 2NVYJ 1ETWA 2YX4A 4BKXA 1R1TA 3QP6A 2MGQA 5C3EJ 3KZZA 3HHGA 1UG2A 3BOQA 2HKXA 2IA2A 3QP5A 1W7PA 3W6JB 2NYXA 4M3DA 2DMQA 4HYEA 4IRIA 3WGIA 3WTYC 3F8MA 3REOA 5CVVA 1W1WE 2D5VA 3NEUA 4OWRB 3FHZA 2PEXA 4RGXA 3TO9A 5FKLA 1SFEA 5HVQC 1U78A 3H3VK 5BQTA 4KIFA 3DFGA 3JRHA 4YFKF 2HQAA 5B3SH 4EQQA 1GVDA 1A36A 2DMNA 5HLIA 1Y39A 2F5FA 1MJBA 3HGGA 4JOMA 4EJWA 2VONA 1JGSA 4OAYA 2YU9J 3O2PE 1IN4A 3KETA 1ZARA 2Y9ZA 2XVCA 2A61A 4BHPA 3RYPA 1H9TA 1OISA 1S7AA 3K69A 4LOCA 4PUSA 3OYNA 1OMIA 3WE3A 2KZVA 1QVUA 3JAMK 4M72A 1JXSA 2Q2EB 2Q2EA 2OPTA 2X4HA 2M1BA 3JTGA 4YRVA 2RNGA 3LWFA 1HCRA 4ZZLA 1FIAA 4GO1A 2A5WA 1QPMA 3GX4X 1TNTA 2EA4A 3H5AA 1Y56A 2DFFA 3SFIA 2BE5F 2ME6A 1MDMB 1MDMA 5LLQA 4MHGA 3OIPA 1YFHA 2CRGA 4WK8F 2LH9A 4E7HA 4XSXF 4EM0B 2QEXI 1SANA 2LK2A 3U21A 1VQ4I 1HSJA 1S29A 1T33A 1ETYA 2DW4A 4D1QA 3O6BB 5DCFA 3RQ4A 2WY7Q 1ON2A 2OA4A 3KLOA 5ICCA 1V54H 4EJUA 2ICWG 2DOFA 4UUTA 2EFPA 3J81K 3DBRB 3JW4A 4Q47A 1KYWA 2BBYA 5B1BH 1X3ZB 2CJJA 4MNUA 1A5JA 1W0TA 2BVMA 2IGMA 2F4MB 3ASOH 3BR1A 4LLNA 4J00A 2KJBA 2V1DA 1W4MA 4WCGA 3S3OA 1FMVA 1MW7A 1TZLA 2H27A 1RUNA 4MEXF 1R4MB 3MEXA 1HDDC 4W1UA 3CO6C 5H20A 4QTRA 3RKQA
chains in the Genus database with same CATH topology
5B3SH 1V54H 1OCZH 3ABLH 2EIMH 3AG3H 3AG4H 5IY5H 2DYRH 2Y69H 3ASNH 2OCCH 1OCRH 3X2QH 2EIKH 5B1BH 3WG7H 2EILH 3ASOH 1OCOH 3ABMH 2DYSH 1OCCH 1V55H 5B1AH 2ZXWH 3AG2H 2EINH 2EIJH 3AG1H 3ABKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3S H;  1V54 H;  1OCZ H;  3ABL H;  2EIM H;  3AG3 H;  3AG4 H;  5IY5 H;  2DYR H;  2Y69 H;  3ASN H;  2OCC H;  1OCR H;  3X2Q H;  2EIK H;  5B1B H;  3WG7 H;  2EIL H;  3ASO H;  1OCO H;  3ABM H;  2DYS H;  1OCC H;  1V55 H;  5B1A H;  2ZXW H;  3AG2 H;  2EIN H;  2EIJ H;  3AG1 H;  3ABK H; 
#chains in the Genus database with same CATH topology
 2FXA A;  2KLO A;  2DBB A;  2X6X A;  4UB6 C;  3TP3 A;  1VND A;  1Z91 A;  2QWW A;  3GTG J;  1VZ0 A;  3CMM A;  4DZJ A;  3IRQ A;  4RGS A;  2R5Y A;  3L09 A;  5D5W B;  5DUI A;  1X2N A;  4GCV A;  3CUQ B;  4WWC A;  3VSK A;  2VOD A;  5DTD A;  2QKM B;  2DCE A;  3V4G A;  4BJT A;  4L9J A;  1A6Q A;  2EIJ H;  3H0D A;  1Z7U A;  4ANJ A;  4IZZ A;  1RRJ A;  4GGG A;  3E0J B;  4B43 A;  2XAS A;  5DDG A;  3JRF A;  2Y75 A;  3HSF A;  1Y8Q B;  3OYE A;  2QQ9 A;  2L4M A;  4HQE A;  2KRC A;  2FOW A;  2WV1 A;  4F3Q A;  3OIO A;  2XHK A;  4IEJ A;  2NVX J;  1I6H J;  4E7Z A;  1XG1 A;  2V1N A;  3BPV A;  4MFD A;  3U1K A;  2EFQ A;  1XGS A;  2EQR A;  2ZJQ F;  1YX5 A;  5FFZ A;  1EV7 A;  2EZI A;  3KP6 A;  5D4S A;  3E5Q A;  4N9I A;  3CMY A;  1XSD A;  4HZF A;  5CVJ A;  3TW6 A;  4II3 A;  3ERM A;  3TGN A;  3Q5F A;  5FD6 A;  1A6I A;  1H88 C;  2VOO A;  5LEK A;  2FX0 A;  4BQQ A;  1VTN C;  4JQF A;  5F1J A;  3ZMD A;  1FTZ A;  2Y0S A;  2QUF A;  1LFU P;  2LVS A;  2B9S A;  5EJC A;  2HFH A;  1G3T A;  4UV9 A;  1IRF A;  4ZYD A;  3HPG A;  2OCC H;  2Y0S N;  2VT3 A;  2PJR B;  5HNH A;  3E6D A;  3ZGK A;  2EZH A;  4I6Z A;  2GXA A;  1DP7 P;  3ECO A;  1BI0 A;  5CQE A;  4ENM A;  4NB5 A;  2CW0 F;  4DOZ A;  1V5E A;  3CLQ A;  2MLK A;  3T8T A;  1FBU A;  3QPH A;  4LG0 A;  2VPR A;  5GTH C;  1Y1V J;  5E3O A;  2VQH A;  3CCJ I;  3I4N J;  3VYT B;  1T0F A;  3LFK A;  2KQR A;  3K4C A;  2RV8 A;  5HDG A;  5LGN A;  3S1Q J;  3CES A;  4ENN A;  4MO7 A;  2ZNZ A;  2DPD A;  2W4S A;  2E5Z A;  4I0B A;  2L01 A;  2LD5 A;  3DF8 A;  1JE8 A;  3DLL F;  3WGG A;  1MBJ A;  1QU3 A;  3KX2 A;  4A3D J;  1XSX A;  2STW A;  1SVO A;  2PI0 A;  3LAJ A;  5IT3 A;  4IQ4 A;  1FSE A;  3Q9V A;  4NQW A;  3QAH A;  1FOW A;  2DAO A;  2A07 F;  1BA5 A;  2QZ8 A;  1HBX G;  3BQY A;  2ELJ A;  5FLM J;  1IF1 A;  1FPQ A;  5L3G A;  1SD4 A;  2EB7 A;  2JA5 J;  1KU3 A;  2FUG 2;  5JR3 A;  2Z9O A;  4GFB A;  2VPL A;  2M87 A;  3VOE A;  4A2U A;  2LBF B;  2LBF A;  1MMS A;  4ZTJ A;  1VQO I;  2ECB A;  5LGU A;  5EGO A;  3Q9S A;  4KN7 X;  3LSM A;  3R0A A;  3JRI A;  4D5F A;  5TIS C;  2H8R A;  2UXX A;  4PSW A;  1YLF A;  3K1P A;  3RI4 A;  4MQV A;  1S7E A;  4G9Y A;  1MBK A;  3BG6 A;  1S9H A;  3CJN A;  4HA8 A;  1WCM J;  2R4G A;  3FMQ A;  5HS9 A;  1VFC A;  2DXI A;  3GEZ A;  1D1C A;  2X6W A;  4G6T B;  1WZ2 A;  1HKQ A;  4DZP A;  5D8K B;  1ETO A;  5DD8 A;  5J6X A;  1F4K A;  5JI6 A;  2QA4 I;  1ERD A;  2GOX B;  2DA4 A;  3RTR A;  1WFX A;  2FNA A;  2GXB A;  3DEU A;  3E6C C;  3U1D A;  4UVC A;  3ERE D;  1LVK A;  2YUS A;  5E20 A;  1LE8 B;  1KU2 A;  1LE8 A;  4OIO F;  1W5C C;  4CCM A;  3CCV I;  4UB8 C;  1XDU A;  3DU5 A;  3PFY A;  2CQ7 A;  3CCS I;  1NHA A;  3Q0U A;  4NHJ A;  4ESB A;  5JVG F;  4RS8 A;  1M1E B;  4LK1 F;  4YEJ A;  1ZG5 A;  4OMZ A;  4KIB A;  3LSH A;  2W82 A;  1RKW A;  4BBS J;  4RAG A;  3GTL J;  3FXO A;  3PIP F;  5K1Y A;  1I1G A;  3I4P A;  3L2Q A;  2LKP A;  2KP6 A;  2YPR A;  2IGN A;  5BPD A;  1P92 A;  5LHH A;  4BEH B;  4BEH A;  4NC7 A;  2DU9 A;  2PMU A;  4NDL A;  2NNY A;  4RM2 A;  1LB2 A;  3OY9 A;  2KRH A;  1ON1 A;  3HRU A;  3L2U A;  1MND A;  2H09 A;  3H9G A;  4LFU A;  2R7F A;  4CZZ A;  3BPX A;  2L9V A;  1S72 I;  1YJW I;  5C44 J;  1D0Y A;  1I3A A;  3BJ6 A;  3RPQ A;  3GTP J;  3HOV J;  2BY0 A;  2D45 A;  1X1A A;  1X2M A;  3H1C A;  4C2U A;  1A35 A;  5KAF C;  2BEO A;  3OSG A;  3O3K A;  2UXN A;  4CSW A;  1SFX A;  2HR3 A;  2RQP A;  2OAZ A;  2VC1 A;  3W6V A;  4FX4 A;  2E34 A;  4BXF A;  1RKT A;  2M8G X;  2MFZ A;  4L18 B;  2CSO A;  1TQI A;  3COA C;  2JPC A;  2RC4 A;  2XAF A;  3DEE A;  5DCM B;  3MD2 A;  5DCM A;  3F23 A;  3BZK A;  5CVI A;  3LSI A;  2AXL A;  5HS8 A;  2DA6 A;  1EH7 A;  3RDI A;  1AHD P;  3QYE A;  5M3M J;  2PN6 A;  2VT2 A;  2CH0 A;  2IP2 A;  1TW3 A;  3F72 A;  3WTW C;  1T2K A;  2Q8K A;  2TRT A;  1P4W A;  5E3N A;  4EJV A;  1DU0 A;  3OYM A;  3VPR A;  1OJL A;  2KZG A;  4YII A;  3ULQ B;  2Z2S B;  3BJO A;  3QYF A;  2Z1D A;  1L3L A;  2WAQ N;  3V8K A;  3I58 A;  2R7D A;  4KMF A;  4I76 A;  2M8E A;  1SD5 A;  5GAE J;  1Z3X A;  1UZC A;  2X1C A;  3WGH A;  1IXC A;  3K4M A;  3GTM J;  2HOA A;  1X3W B;  2LF8 A;  2Y48 A;  4IL6 C;  3IHU A;  4DYQ A;  5CPR B;  2QSF X;  5JLX A;  3A2K A;  1U8B A;  1F36 A;  1N78 A;  5K5Q A;  2B63 J;  3LSR A;  2GIZ A;  3H9Q A;  3S16 J;  4WX9 A;  3TL4 X;  1WJF A;  3HRM A;  3M7G A;  2WWY A;  4HPQ A;  2L9S A;  3S93 A;  4BDY A;  1QZZ A;  2KIS A;  1K78 B;  1FT9 A;  1X58 A;  4HX4 A;  4BQN A;  3MQ0 A;  3I54 A;  2HGC A;  3BLY A;  5JVT A;  5IYB J;  1JGG A;  2VBW A;  2FEZ A;  2OCE A;  2EPF A;  2M0M A;  5DUK A;  3J7Z I;  3VWB A;  4PFP A;  2EWN A;  5FRO A;  1WVR A;  1R36 A;  4RAZ A;  3P9K A;  2O0Y A;  3V8L A;  3H3U A;  5L3F A;  1JKO C;  4UXN A;  3ZR8 X;  3FXK A;  1YS7 A;  1QZE A;  1X1P A;  2P0W A;  2RRE A;  1XGO A;  3HUG B;  3HUG A;  4PJN A;  3U9G A;  3OS0 A;  3CUQ C;  2ISZ A;  5FRM A;  2ZNY A;  2A68 F;  3GO5 A;  2M5W A;  4RLF A;  3BZ6 A;  4WXH A;  3EPZ A;  3FM5 A;  3X2Q H;  4CYC B;  4XKC A;  4I99 C;  2ESN A;  2QEN A;  3SQN A;  2WB1 N;  2UV1 A;  3D0S A;  3GFL A;  3TOB A;  4ZDP A;  4BL0 B;  3MZ8 A;  3WHC A;  4HNT A;  3GCM A;  2ZXW H;  3HC7 A;  4P9F A;  4R1H A;  3G6E I;  3Q0V A;  1Y0N A;  4L9T A;  2P7V B;  1R5G A;  2VJ5 A;  2V6C A;  1B8I A;  3JRE A;  3NWT A;  4AYB N;  4BS9 A;  3A03 A;  2X1D A;  4KDP A;  1X4O A;  1MD0 A;  3CD6 I;  4C3J J;  3R61 A;  5GAG J;  2FOK A;  3MKL A;  3GME A;  3ABM H;  3PL8 A;  2XDV A;  3JSO A;  1APL C;  2IS1 A;  2L54 A;  1L0O C;  2M0C A;  3DPU A;  2GWR A;  4WXD A;  3JRC A;  1LUJ B;  2VB6 A;  3CZ6 A;  4HDV A;  4BE1 A;  2E2I J;  2JSP A;  5ICF A;  4HF0 A;  1TT0 A;  3ZN1 A;  2HTJ A;  4IXA A;  4D0P A;  3F21 A;  2XF7 A;  1FOX A;  3CF5 F;  1ITY A;  5FKO A;  3BR3 A;  3M8F A;  3I5U A;  2LF7 A;  3I0T A;  1DGW Y;  3PFI A;  4LGW A;  4MTE A;  2FA5 A;  2F5E A;  4KMU X;  3H9J A;  2P81 A;  3WTT C;  1BI2 A;  1G3Y A;  3JRG A;  3L2W A;  3E7L A;  2PMH A;  2OZU A;  3KP2 A;  2P5K A;  3OYL A;  3ZP5 A;  1T38 A;  3V42 A;  4BHB A;  3S15 J;  1UST A;  4YFX F;  1YRN B;  1YRN A;  3KYD B;  3BG3 A;  4UHT A;  1FC3 A;  2KFD A;  1MBF A;  2L3D A;  1Z67 A;  5GPA A;  1NK2 P;  3KZI C;  1MIJ A;  1N77 A;  2QQB A;  3ZXS A;  4Y7N J;  4QSH A;  4PJM A;  3OYK A;  1U0J A;  5E8G A;  2VJJ A;  1DUX C;  3ABL H;  3RPU A;  1R22 A;  3C3W A;  2O5R A;  3HJE A;  1FTT A;  5K7Z A;  3G1M A;  3I53 A;  3LAP A;  3AAF A;  5IOY A;  4A3J J;  1EJ9 A;  5FFX A;  1STZ A;  4ZYH A;  1IRX A;  4FX0 A;  1XC5 A;  1K6Y A;  3AFH A;  3CCM I;  2ECC A;  2G7U A;  3GLL A;  3O8H A;  4GRI A;  3WOD F;  3C2H A;  3RIR A;  2DK8 A;  2HYJ A;  3F8N A;  3LSG A;  2CV1 A;  3UNG C;  4BE0 A;  2PX9 A;  3VYR B;  1U8R A;  4IF4 A;  2EV0 A;  4Y33 A;  4RDU A;  1D0Z A;  3D5R C;  5FJ8 J;  4OOI A;  5LRR A;  3QQA A;  1IN6 A;  3I56 I;  2H94 A;  2Z16 A;  1RZ4 A;  4FE7 A;  1RET A;  2GM4 A;  1ETQ A;  2LY2 A;  1I3Q J;  2COM A;  2K9Q A;  4ASN A;  2ZC2 A;  3BCA A;  2BW3 B;  2BW3 A;  4U7D A;  4A5N A;  1D3Y A;  3ML6 A;  2XPV A;  2E1M C;  2Z5U A;  4M6X A;  5D8L B;  2P4W A;  1AA7 A;  1FZP B;  3MCZ A;  2UUZ A;  1WJ5 A;  3CP8 A;  3MN2 A;  1O3R A;  2N8G A;  4AVZ A;  5H2F C;  3M8J A;  2BY2 A;  3FXU A;  1IUY A;  3C1D A;  4M3G A;  5KK1 A;  4DBQ A;  3G71 I;  4XOT A;  1G6N A;  2DOA A;  2EV6 A;  4YIF A;  2V6E A;  4CCK A;  5ILV A;  2JPB A;  4CA0 A;  5F0C A;  2BGC A;  5HLH A;  3PO3 J;  4A3K J;  1FX7 A;  2ZXJ A;  1TW2 A;  2UZK A;  3GTK J;  4GYG A;  2EZL A;  1UHS A;  1UJ8 A;  3DKY A;  2HTS A;  1SFU A;  5M5Y J;  2DYS H;  2IW5 A;  2VKV A;  3CDL A;  2E1O A;  3NWS A;  3VYS B;  1RI7 A;  2O3F A;  5F27 A;  4OIQ F;  1IXR C;  2OJE D;  5ERI A;  5DYM A;  3FZV A;  3OS2 A;  2ZCW A;  5IP6 A;  1WRJ A;  2PBI A;  3SZG A;  1R49 A;  1IRZ A;  3J7Y J;  5TRD A;  4KIG A;  1JTY A;  3DKW A;  4EM2 A;  1FLI A;  5FLV A;  3K4K A;  1SAX A;  1ZEL A;  1Z0X A;  1TWF J;  3C2G A;  3HRS A;  2EIL H;  3CC4 I;  1UHM A;  3JAM Z;  2YR2 A;  1XGN A;  2Q1Z B;  3B02 A;  3SEQ A;  2ZBK A;  1U3E M;  3A02 A;  4L5I A;  1GT0 C;  2UWM A;  5B1A H;  2LC2 A;  1HKT A;  3NAR A;  4HV5 A;  2RQQ A;  1J5Y A;  3EDP A;  3MWM A;  3K1M A;  4IOC F;  2OV7 A;  3S1R J;  2E7W A;  2K9M A;  3OS1 A;  1OCP A;  3S3N A;  2DT7 B;  2G9W A;  1Z3Y A;  2FD5 A;  4CIC A;  2NVQ J;  3F8C A;  2FQ3 A;  2R7W A;  1ZR4 A;  2BHY A;  3IAS 2;  1XD7 A;  2GA1 A;  2MC3 A;  3FM3 A;  2BY1 A;  1Y6I A;  4XLC A;  1T56 A;  3ZMV A;  5DS9 A;  2DA7 A;  2BYV E;  2ZME C;  2EBI A;  4IHV A;  2JN6 A;  1BIB A;  2MYS A;  2WBM A;  3HSE A;  4DYC A;  1X3U A;  3LOC A;  4M73 A;  4S05 A;  3OYG A;  3WU1 B;  1VQ7 I;  1JKQ C;  3C18 A;  4F92 B;  1OR7 C;  3QOD A;  1IO2 A;  4G6Q A;  3J81 Z;  3UKG A;  1JT0 A;  2MD0 A;  3B6A A;  2IPQ X;  1H9G A;  4CCO A;  3SDG A;  3TED A;  4AU7 A;  3FHN A;  2IGO A;  4OAZ A;  1F43 A;  4AID A;  3DPL C;  4C30 A;  1HC8 A;  2A69 F;  2ACJ A;  4N0B A;  3CC2 I;  4Y4R A;  2DOE A;  1IXS B;  3HOS A;  3QRF F;  3GUD A;  2XAQ A;  4X6A J;  2V26 A;  1XCV A;  2GBY A;  3NAU A;  4FQG A;  1LKX A;  1VQ9 I;  1Z9C A;  2O8K A;  2CO5 A;  1J9I A;  1K79 A;  3K70 C;  2HPM A;  4IHX A;  4P55 A;  2V79 A;  3L00 A;  1ZHF A;  3CCR I;  3NQO A;  2XB0 X;  4KIS A;  5FRN A;  2E60 A;  1J75 A;  1FOY A;  1QHG A;  3DP7 A;  5FKN A;  4OMY A;  1FYM A;  4N4O B;  2TDX A;  3BQZ A;  3LQQ A;  3OIQ A;  1J7K A;  5AON A;  3JCU C;  1R58 A;  1ZGA A;  2DJI A;  4XNF A;  1UFM A;  3WHB A;  2L4A A;  2W24 A;  2VC0 A;  1FSH A;  1ZH5 A;  2M4G A;  3H5N A;  2K7L A;  4P1W A;  5FO5 A;  4LIV A;  3KYC B;  4IKF A;  3GFM A;  1CGP A;  2QKL B;  3IV5 A;  2P8T A;  4HV6 A;  4XKV A;  3IWF A;  1KU9 A;  5EEH A;  1K7A A;  2V1U A;  1BW5 A;  4UVA A;  3EUK L;  1JKR C;  2HI3 A;  2KRF A;  3TDZ C;  4AM3 A;  2E1N A;  4U87 A;  2CUZ A;  3DV8 A;  2MBF A;  3IAM 2;  4RAY A;  4PFO A;  1HA8 A;  1ZKG A;  3A01 B;  3A01 A;  2R3S A;  4GXO A;  1BC7 C;  4EMS A;  1WJB A;  2R7S A;  2XV4 S;  3JR9 A;  3K6G A;  1OQY A;  1QPI A;  2BV6 A;  2VN2 A;  1SMT A;  3BG7 A;  1YOV B;  2XGC A;  1UEL B;  3JTH A;  1ZQ3 P;  1VQ6 I;  2W84 A;  1ZR2 A;  1HST A;  3DPT A;  4JX5 A;  3K4B A;  5E18 F;  1GUU A;  2QCO A;  3EYY A;  4CDG A;  3HOW J;  5C4X J;  3CUQ A;  4L9V A;  4DGW B;  3I9V 2;  3WTU C;  3OL3 A;  3PNT A;  4V2F A;  4YFN F;  3OV8 A;  2V1X A;  1S5L C;  2QGU A;  3SZP A;  4E7S A;  5HDK A;  4AIK A;  3SYT A;  3C7J A;  3BR0 A;  4CYD A;  4FCY A;  2LYC A;  4U88 A;  2AS5 F;  2EIM H;  4PJ0 C;  1OPC A;  2YSR A;  3BR6 A;  5CKT A;  2CQQ A;  2F2E A;  1PDN C;  1WSU A;  1AWC A;  4Q4Z F;  2CW7 A;  1QQI A;  4XLN F;  4DBR A;  2AQE A;  4JK1 X;  4PK4 A;  4IJA A;  1KON A;  1UCR A;  2DI3 A;  4HDU A;  2K9S A;  3OR1 C;  2L5Q A;  4IX7 A;  2AQF A;  3BCB A;  2NRA C;  2K85 A;  2IS2 A;  3WE2 A;  4B8X A;  2DDA A;  3K4J A;  5FKK A;  1WKM A;  4IHS A;  3PO2 J;  4IO9 F;  2NOG A;  4NC6 A;  1DDN A;  1ETV A;  3FWE A;  1WJC A;  3GZN B;  3CQZ J;  1G3W A;  2M4K A;  2O03 A;  2JQ7 A;  4CCN A;  4LLG F;  1KGS A;  4U0Y A;  2PJR A;  2K27 A;  3ZQI A;  1JJ8 C;  1B59 A;  4XLF A;  5LGT A;  1YW7 A;  2XB5 A;  3BTC A;  3CCL I;  1MSE C;  4IHW A;  2YS9 A;  4IRG A;  1X4P A;  3T0Y A;  2QYO A;  2V7F A;  2WAE A;  4E6K G;  1BIA A;  3BP8 A;  1HOM A;  1G2H A;  1ZYR F;  4G12 A;  3IL2 A;  4KT5 C;  2EIN H;  2XGE A;  3HOY J;  1OYW A;  3QOP A;  1C0W A;  1MSF C;  2DA5 A;  3F6O A;  3ZQG A;  1KQ8 A;  1HF0 A;  4ZYE A;  3FK7 A;  2QSH X;  2CUJ A;  1X1B A;  2VJ4 A;  3RZO J;  5H6R A;  3N4M A;  3H35 A;  4IHY A;  1Z6T A;  2H6B A;  1XTA A;  1BJZ A;  4XID A;  4JX6 A;  3A1Y A;  2XRL A;  2LDU A;  1R9T J;  1RIO H;  2B7E A;  3FMR A;  4LIU A;  1IZ1 A;  2MW8 A;  1T6S A;  5B66 C;  2JSC A;  3TW7 A;  2K4B A;  1SEU A;  9ANT A;  3VDX A;  3OYF A;  3HOZ J;  2X6Y A;  3GXO A;  1NTC A;  3AG1 H;  4M6Y A;  1PP7 U;  1UAA A;  4UUV A;  2BXY A;  2HVS A;  1U6G A;  2R7Q A;  1KZH A;  1VQK I;  5DV5 A;  5F04 A;  4M3F A;  1XDS A;  2FBK A;  5HNF A;  2JTV A;  4DYR A;  2DQL A;  2VBZ A;  3HB9 A;  3DTI A;  2OUM A;  4EEF G;  3BTI A;  2FBI A;  1YIO A;  1QA6 A;  4LG3 A;  1ZG1 A;  5J4Y A;  5L3E A;  3ELK A;  4A3C J;  2AHQ A;  4U7B A;  3VYU B;  1LDD A;  1WI3 A;  2JA8 J;  3W3C A;  1JT6 A;  1TQM A;  3TP0 A;  3ABT A;  5IP7 J;  3G4S I;  1IC8 A;  4HX7 A;  4XN0 A;  2L9R A;  2E1M B;  1F5T A;  2KIU A;  4XMY A;  1ODD A;  4HQM A;  2R5Z B;  2R5Z A;  3L7W A;  4N4N B;  3PQK A;  1DQU A;  4EGY A;  2HZT A;  3G1L A;  1Q1H A;  4S0H B;  2HXI A;  1XMK A;  2KT0 A;  4U0V A;  2ZSH B;  4KJZ A;  2F6C A;  1P4A A;  2O8X A;  6PAX A;  5JHF A;  4E7J A;  4ABZ A;  3IRR A;  4B4C A;  3IH2 A;  1P7J A;  2BVL A;  5KNL A;  4F7Z A;  1TNS A;  1LDJ A;  1D8J A;  2D1H A;  4ZDL A;  3P7N A;  2RNJ A;  1RUO A;  4C2T A;  3LSP A;  1BR2 A;  1PUF B;  1PUF A;  5IT9 K;  1UHW A;  2KIM A;  1S3J A;  1O3Q A;  1FOK A;  2QSG X;  2K9L A;  2NNN A;  5AIP A;  3M1C A;  3TOA A;  1D0X A;  2RAE A;  1E17 A;  4KIT B;  4BYY A;  5ICE A;  3SEZ A;  2X51 A;  2OZ6 A;  3PSF A;  4M9S A;  3VOD A;  4KN4 X;  5IOZ A;  1MMN A;  2DOD A;  5CYV A;  3V8J A;  1FBS A;  1TT5 B;  4B47 A;  2Y30 A;  5EEA A;  4XL9 A;  2HQR A;  2V4J C;  2X1E A;  4FET A;  5LD2 C;  2DA3 A;  1FYK A;  2R7Z J;  4JBA A;  1R1V A;  1HLV A;  4I2O A;  3ZQH A;  1J09 A;  3ZCO A;  3AG2 H;  2J5O A;  2CUE A;  2YX7 A;  2JWT A;  3OWT A;  3T5X A;  4C9Y A;  5JFR A;  5JLW A;  2HVQ A;  2XUB A;  3MVP A;  2HVR A;  3RQI A;  3WTS C;  2HU9 A;  1MMA A;  3LSJ A;  3VEP A;  3GBG A;  2GIV A;  1TWC J;  2M9H A;  3FF5 A;  2JRT A;  5LEJ A;  2JZY A;  3LST A;  4BHC A;  1BOB A;  2IA1 A;  5D4R A;  2WY8 Q;  5F0F A;  4CH7 A;  4EJO A;  3LFU A;  3M3Y J;  3CCY A;  4XKW A;  5FGM A;  4B3X A;  1K4T A;  2IS6 A;  1VQ8 I;  2E2H J;  2WAQ A;  5E1W A;  3K10 A;  1B72 B;  2ZME B;  1KA8 A;  2ZME A;  1B72 A;  5B5E C;  2ZJ2 A;  3KEQ A;  5AIQ A;  4ON0 A;  1E2X A;  4P96 A;  5M5W J;  3CDH A;  2WC2 A;  1NH3 A;  3KCC A;  1XB4 A;  4LB6 B;  5D5U B;  2X0L A;  2EFO A;  1OFC X;  1OR7 A;  5A2Q K;  3JRB A;  4BXX J;  1NG7 A;  1BC8 C;  4HLX A;  3K70 D;  5K7H A;  1TBX A;  1FBQ A;  1I39 A;  1U5T C;  4ZC3 A;  4C2M J;  1Y0U A;  1W36 C;  3ZPL A;  3SDB A;  3S1M J;  3T8R A;  5IYD J;  3E5X A;  4P9U A;  4J19 A;  1Z7L A;  4I02 A;  4ZYG A;  1YQA A;  5HLT A;  3K2Z A;  3OL4 A;  3GFI A;  3AG3 H;  2XAU A;  1K78 A;  5CVU A;  2DYR H;  2GZW A;  4XOP A;  4QPQ A;  3TQN A;  1TWA J;  4A0Y A;  1P6R A;  4RGU A;  4XRS G;  3I4M J;  2HKO A;  1S6L A;  2K40 A;  2F5V A;  3MFK A;  1G8X A;  3G3Z A;  4HBL A;  3K1N A;  3M8E A;  2FE3 A;  4CGZ A;  2JA7 J;  1R1U A;  2L02 A;  1DPU A;  3RYR A;  1TTY A;  1TWG J;  3R60 A;  3TMO A;  1D8K A;  2DTZ A;  3EUA A;  1R7J A;  2F4O B;  1ETK A;  2ZJP F;  2DTR A;  2KIQ A;  1O3T A;  2F5D A;  2LTP A;  2DLL A;  5E1X A;  3D5L A;  5ILU A;  2JA2 A;  2VE8 A;  1IGN A;  5J40 A;  2WB1 A;  1LQ1 A;  2VOP A;  4CYC A;  1GHC A;  1JUP A;  4HLY A;  5DD4 A;  1GXP A;  2BZT A;  4M3E A;  2Z3Y A;  4XIC A;  4EGZ A;  1USS A;  2F5C A;  1MBG A;  4HNU A;  1YO5 C;  5F0H A;  2R7U A;  1MNM C;  3M07 A;  2K5C A;  4FAS D;  2ZSI B;  2E35 A;  1ZLJ A;  2FU4 A;  3HKZ A;  2WAD A;  3FXQ A;  4AYB A;  4MIM A;  2NVU B;  2GOM A;  2QM3 A;  5FLX K;  2W1O A;  1YI2 I;  3DEW A;  1GDT A;  1TL8 A;  1ZG3 A;  2ZKZ A;  3HKZ N;  2CV2 A;  4H0E A;  1VI0 A;  2P6S A;  3K7A J;  2NAZ A;  3KEY A;  2LNB A;  4A3F J;  4WF2 A;  2CWE A;  3HHH A;  1ZGW A;  1EH8 A;  4XBF A;  1H89 C;  1ZRD A;  2R7X A;  1WH7 A;  1VQN I;  3WTX C;  2HZD A;  4U0W A;  1REP C;  1LPQ A;  4XQF A;  1WI9 A;  2K3F A;  1CQT A;  2X9D A;  4EVI A;  1XX5 A;  3QPL A;  2JUG A;  1FWZ A;  1MKM A;  2CS3 A;  3IWZ A;  3DLA A;  3ECH A;  4JYK A;  5BPI A;  2I10 A;  4AUX A;  1ULY A;  3ROU A;  1ZRC A;  3HOU J;  5E79 C;  4PJL A;  1MH3 A;  3AG4 H;  5M5X J;  2GLO A;  3FBN B;  4R8H A;  4A93 J;  1QVT A;  3BC8 A;  3CJQ B;  4XN3 A;  3HOT A;  3IP4 B;  2WAF A;  4D7M A;  1BR4 A;  2OQG A;  2PJP A;  2VE9 A;  5K5R A;  2XRO A;  2WV0 A;  4D9J A;  3LMM A;  1DGR M;  5EZH A;  4A6E A;  2XRN A;  2CQN A;  1DPR A;  2ISY A;  4I7H A;  2LY1 A;  4HNV A;  1WJA A;  4KFC A;  2ZFW A;  4YIR X;  4HEA 2;  3SZT A;  2L0K A;  1UB9 A;  2XSD C;  4ZTF A;  5ILS A;  4QPO A;  2LG4 A;  4AC0 A;  4MLO A;  4I98 B;  4ESF A;  3CMA I;  3FXJ A;  5BOX A;  1T0F C;  1RES A;  3F8B A;  3LA7 A;  4XLA A;  1RR7 A;  2EK5 A;  4EAT A;  3L2C A;  3W2V A;  1SVM A;  3EQL F;  4D7N A;  2GA2 A;  4I0A A;  4XLE A;  2HOE A;  2LOO A;  3GLX A;  5CJ9 A;  2KDO A;  5K7F A;  3KP5 A;  5D5X B;  4M9X A;  4HG2 A;  2CV0 A;  1FYL A;  1T8I A;  5GAD J;  3KIO A;  2FBH A;  3MMY B;  5JHU A;  4QLC U;  1O57 A;  2COB A;  2VLA A;  1ZLK A;  5E3M A;  4DQ2 A;  2DDB A;  4UUS B;  1B4A A;  2ETH A;  2XAH A;  2VI6 A;  2W25 A;  2Y0M A;  5J47 A;  4Z2Y A;  1HW1 A;  5DEQ A;  2M7A A;  3I64 A;  4X0G A;  1Z05 A;  1Q1V A;  2KL4 A;  4ZH4 F;  4AIJ A;  1R23 A;  1IUF A;  4P5O A;  1WHU A;  3BG5 A;  1IV6 A;  2QLZ A;  2JUC A;  1OCZ H;  2VAS A;  4Y17 A;  5LHI A;  3J80 K;  1IRG A;  3IKT A;  2OU2 A;  3DTK A;  4Q48 A;  4ZYA A;  3G73 A;  4XOR A;  3GZ6 A;  5E1Z B;  2M2E A;  3K4L A;  3F22 A;  1XS9 A;  4RA2 A;  1GV2 A;  4ITV A;  4R79 A;  1FIP A;  5EEG A;  1R4N B;  4LIT A;  1V55 H;  4FTH A;  3SXY A;  4NBQ A;  3GTO J;  1PVE A;  1D1A A;  3LQR A;  4MEY F;  3V7C A;  1ZTR A;  1RR8 C;  3E5U A;  2QBY B;  2QBY A;  2D1V A;  1I6X A;  3LNQ A;  3KZY A;  1AOY A;  1DP3 A;  1U9N A;  2PG4 A;  2DT6 A;  2VBY A;  2P5L C;  4XM3 A;  4EJT A;  4XLP F;  3CP2 A;  4RB0 A;  2PQ8 A;  3E1S A;  2EH3 A;  2HPI A;  4UV8 A;  1FNN A;  1AKH B;  2LFB A;  1AKH A;  4PGH A;  3FBI B;  5FKM A;  4YG2 F;  1MMG A;  1JHF A;  2IS4 A;  4M3B A;  4CZC A;  2JMW A;  1JUS A;  2HOS A;  2CQK A;  1IN7 A;  2XIG A;  4H4K C;  4O6J A;  1ZN2 A;  4KT6 A;  2Y9Y A;  4CUG A;  2V9P A;  1EH6 A;  2DA1 A;  4XLH A;  4OIR F;  4BH9 A;  3AKZ A;  2HXO A;  4IHT A;  3W2W A;  1GVJ A;  1YX3 A;  4L9N A;  1D5V A;  1W7P D;  2VUM J;  4RAF A;  3ZOB A;  1LFB A;  3FKJ A;  3HTU A;  1JHH A;  2VKD A;  3P5J A;  1JI8 A;  5M3F J;  4WXC A;  2EV5 A;  1HW2 A;  4ENJ A;  3CDI A;  4RM3 A;  1WH5 A;  4L0Z B;  2MH2 A;  2DK5 A;  3CJR B;  2ZB9 A;  5E17 F;  3FIW A;  5IPA A;  2EA2 A;  2M3A A;  3PM1 A;  1VQL I;  3KLN A;  2O9L A;  2KMU A;  2XPW A;  1W7P B;  1HW5 A;  4HSR A;  3HGY A;  4ZDO A;  2H6C A;  1NK3 P;  1I1S A;  5F64 A;  1HDP A;  4NC8 A;  2WTE A;  2XKP A;  2L7M P;  3L2R A;  2DPU A;  1YHQ I;  5GTI C;  4J01 A;  4BQO A;  4L0Y B;  4IRH A;  2GAU A;  2ID6 A;  1MJ9 A;  3QWL A;  4BBR J;  1V3F A;  1SD7 A;  3H0G J;  2QF7 A;  5TJJ A;  2F48 A;  1PJR A;  2ID3 A;  3RKW A;  5GPC A;  3OYI A;  4BE2 A;  4A3M J;  1KQ9 A;  3HM5 A;  2XPU A;  4MFE A;  3ZQQ A;  1N75 A;  2IT0 A;  3W2A A;  2CG4 A;  1U9O A;  3RCO A;  2MSY A;  1EA3 A;  3QU3 A;  1UMQ A;  2OTJ I;  1G3S A;  2A3S A;  3ZN0 A;  3OYB A;  2RVC A;  1K4S A;  1W36 D;  2VXD A;  3DBH B;  3E97 A;  5LBQ A;  4CO8 A;  1BL0 A;  3J7A O;  3FKI J;  4CXF A;  4LLL A;  3RKX A;  1TC3 C;  3VFZ A;  3PJR A;  2A05 A;  3KEO A;  2NS7 A;  4FHT A;  4PJJ A;  3OYH A;  1QO0 D;  2HDC A;  1IN8 A;  3FX3 A;  2LKX A;  1P7I A;  3OYA A;  4Y13 A;  2PLY A;  2L9N A;  3VB2 A;  1U5T B;  1U2W A;  1U5T A;  2A6E F;  3HL2 A;  1A31 A;  2FQ4 A;  3FXM A;  3S3M A;  2KJC A;  3L2V A;  3FIS A;  3I71 A;  4X1E A;  3F0C A;  4BDZ A;  4BY1 J;  2HDW A;  3KFW X;  1ACI A;  1WGX A;  3B6C A;  1A04 A;  3HXL A;  2JRM A;  2GQQ A;  3TO6 A;  2XKO A;  1VF9 A;  1FY7 A;  1V5G A;  3B73 A;  3H3Z A;  2W7N A;  2OF7 A;  3R6S A;  3BR2 A;  4KA4 A;  3L9F A;  4M9Z A;  4K2E A;  2R7V A;  2A6T A;  4BNC A;  3Q0W A;  4G94 A;  3SHF A;  3RKY A;  1MMD A;  2CFX A;  4LD5 A;  2X85 A;  2AO9 A;  4E7L A;  2IXS A;  3FXR A;  5L3B A;  3S2D J;  4IOA F;  1BJA A;  3PQJ A;  5CQG A;  2LMD A;  2R7O A;  3LSK A;  3OOU A;  3MZH A;  2VIX A;  3ZMZ A;  3TKY A;  3K4N A;  1YW8 A;  4L5J A;  5CVR A;  3MKW B;  3OMY A;  3S2H J;  3CUO A;  3H36 A;  2E1C A;  4HX8 A;  4CCJ A;  3V7R A;  2QQA A;  2GXG A;  3DU6 A;  3ISP A;  4XRS A;  5J8F A;  2R5Y B;  1FEX A;  5LHG A;  1E3O C;  5DM7 F;  2ZFU A;  4A0X A;  1Z77 A;  2HDD A;  3J7A Y;  1ORK A;  2EJR A;  2MG4 A;  1SD6 A;  1KU7 A;  1MGT A;  4LB5 A;  1TP4 A;  3IUO A;  2IJL A;  3SFZ A;  3PNV A;  3PUB A;  2JK3 A;  2W85 A;  3G2B A;  3GW2 A;  2DMT A;  2CUF A;  2XGD A;  2JVH A;  2XF6 A;  5GP9 A;  5J1U A;  2R7R A;  3E6B A;  4G7O F;  3L1P A;  2DMP A;  2D2W A;  2EZK A;  4MTD A;  2VJI A;  2CQX A;  1POG A;  3HIF A;  4DJA A;  2CFO A;  2NOJ B;  1RPW A;  1LEA A;  2FRH A;  1OCO H;  2LSO A;  4BY7 J;  2AXT C;  3AL0 C;  3O8G A;  2M30 A;  2Y2Z A;  1T08 B;  1ZRE A;  3IKV A;  4HF1 A;  3BG9 A;  1WPK A;  4AWX B;  1QZY A;  4BJ5 C;  3ZRG A;  2G0E A;  1BI3 A;  1KQ0 A;  4A3G J;  2ZJR F;  2LRE A;  3MKY B;  2NVT J;  2XAG A;  2RKH A;  3M9A A;  4AIH A;  3RZD J;  2DO7 A;  3VSL A;  1R00 A;  3BT9 A;  3EUH C;  4DW6 A;  2H8W A;  2Y31 A;  2Q0O A;  3SJM A;  2RDP A;  2PMZ A;  3ASN H;  1YG2 A;  4M74 A;  2M7B A;  2W48 A;  4GYI A;  2FSW A;  1K83 J;  2IEK A;  4A69 C;  1QHH D;  2PMZ N;  3IH3 A;  4G7Z F;  4HRI A;  5IT9 Z;  1HXD A;  3DQV C;  4PZJ A;  2B0L A;  1R6R A;  3TBI A;  2STT A;  3CO7 C;  3DTE A;  4EV0 A;  4LG0 B;  1BBY A;  1IJW C;  2LRD A;  4ETS A;  3GWZ A;  4PCQ A;  5F08 A;  4A3B J;  2K4J A;  3CME I;  2CYY A;  4B09 A;  4E4H A;  4HOB A;  4TV7 A;  1XCB A;  3HZJ A;  3BDD A;  3U2R A;  2X6O A;  4E7I A;  2OC6 A;  2WA0 A;  1I50 J;  1BR1 A;  3C2B A;  3RSN A;  3I59 B;  3I59 A;  4L5E A;  2HQ5 A;  5EZG A;  2IVM A;  4B44 A;  4PGG A;  4KUM A;  1FP1 D;  1OCC H;  1PP8 F;  2O7O A;  1SFK A;  4NQW B;  1Z6R A;  2E19 A;  3KE2 A;  4W97 A;  1GXQ A;  4QIW N;  1Y8R B;  1DU6 A;  2R92 J;  2XF5 A;  4FT8 A;  3WU2 C;  2FMY A;  3WU0 A;  3MKZ A;  1CF7 A;  3WG9 A;  1CF7 B;  3HDD A;  2O61 A;  2Y69 H;  1XPX A;  3I55 I;  1SMY F;  3DWL E;  1RC9 A;  4RMN A;  5J1Y A;  2MH9 A;  5EGO B;  2F4I A;  4Y3O A;  3OYD A;  2V9K A;  4LJZ F;  1MNE A;  1J2X A;  5E8I A;  1LJ9 A;  3QYB A;  2Z33 A;  4I09 A;  1V4R A;  3LL7 A;  2DJN A;  3LA2 A;  4HST A;  2JVG A;  5EYR A;  3ABK H;  1SFO J;  1T98 A;  2HWV A;  1YYV A;  1R5H A;  5A2Q Z;  3ZMS A;  1H0M A;  1BM9 A;  4OU0 A;  3HTS B;  4UY8 I;  2P6T A;  3H92 A;  3OOP A;  1MJA A;  2LR8 A;  3A0B C;  3TO7 A;  1IV8 A;  1E3H A;  5J8C A;  4G7H F;  1K61 A;  4F55 A;  3GFJ A;  2OTL I;  4PDK A;  4BU2 A;  1OCT C;  2LP0 A;  3A0H C;  5J1R A;  1RNL A;  2G7H A;  1WJD A;  2QQ8 A;  2HNH A;  4E7K A;  2XC7 A;  1YJN I;  1BOA A;  1VQM I;  3GF2 A;  4RB1 A;  4MQ9 F;  4M71 A;  1ONV A;  2IAI A;  1MZB A;  1O7L A;  3HEF A;  4UVB A;  3R0J A;  2ADU A;  2K02 A;  4HF2 A;  4XR6 A;  1BI1 A;  4A6D A;  2ESH A;  4AD9 A;  4BJ6 C;  5BS6 A;  1T39 A;  4IPA A;  1IW7 F;  4HW0 A;  5KHD A;  2FNP A;  1X19 A;  2HYG D;  1XSV A;  1HKS A;  2FML A;  1MBE A;  2DMU A;  5IYC J;  1B9N A;  4RBO A;  2L7K A;  1OYY A;  2KKO A;  3HYI A;  1JUM A;  2J5P A;  1AU7 A;  1FP2 A;  1YS6 A;  1LVA A;  4D5C A;  2R7T A;  3H5R A;  1YW9 A;  2K9N A;  1JTX A;  3KYL A;  3K2A A;  1B9M A;  4CHU A;  3KPH A;  2RGV A;  3BY6 A;  3WG7 H;  5D6E A;  2HQN A;  3F3X A;  4MGR A;  2VL8 A;  3QU6 A;  2I5U A;  3IH4 A;  1XN7 A;  1MBH A;  1SVL A;  2XGX A;  5FD5 A;  1F9N A;  1B6A A;  4B1R A;  2MAB A;  2LLK A;  5FLX Z;  2DFI A;  5LRS A;  2VQG A;  1V5F A;  4F52 A;  2FJ1 A;  3ZMT A;  3PIO F;  2W57 A;  2VQL A;  1Z1D A;  5EF6 A;  3ZQL A;  3ESW B;  2HEO A;  1YE9 A;  2ZXH A;  5FB2 A;  5F1R A;  3BTJ A;  3S8P A;  5K5O A;  4BQA A;  2A6H F;  1ETX A;  4C3H J;  2RN7 A;  4A3I J;  2EFW A;  2R0Q C;  2CW8 A;  1I5Z A;  1P2F A;  1EF4 A;  3KP7 A;  2BHZ A;  1IDY A;  1YTY A;  2E7X A;  3OYC A;  3BJA A;  2BOL A;  3ZQ7 A;  4S04 A;  5J3L A;  4RB3 C;  4CCL A;  1R71 A;  5E3L A;  1KYZ A;  1OKR A;  1HQC A;  2LKS A;  4HAM A;  2I8D A;  3Q3S A;  3W6K B;  5HDN A;  1YIJ I;  2DQR A;  2O6G E;  4FIS A;  4BAC A;  2E2J J;  3S17 J;  1SAU A;  1I27 A;  1OYI A;  2MLG A;  2V9V A;  2X48 A;  3HRT A;  1IG7 A;  3CF2 A;  3WTV C;  1W5S A;  1OCR H;  4XKB A;  3JRD A;  5HS7 A;  1O4X A;  2HOT A;  3ABU A;  2OQR A;  3E3V A;  5KVR A;  4IVN A;  5D5V B;  4OIP F;  4RLQ A;  3D5S C;  4XRM A;  3QPS A;  4EM1 A;  4O3M A;  2M34 A;  3DKX A;  5ED4 A;  3HG9 A;  2Z99 A;  1FMW A;  4G6D A;  3ZMU A;  1LEB A;  3FXL A;  2L2O A;  1UG0 A;  2P5V A;  2ZXI A;  4N9H A;  3QOE A;  4B48 A;  4BUP A;  4F93 B;  2CU7 A;  2DFH A;  3HBL A;  4BXU A;  3MZY A;  2VQC A;  3ZQF A;  2OBP A;  5H6Q A;  4ZZD A;  3GYH X;  4XSZ F;  4OIN F;  2QVO A;  3V7S A;  3OSF A;  1QBJ A;  1WJE A;  5KCM A;  5BMZ A;  3S1N J;  5HOO A;  2BY3 A;  2VBX A;  5D6F A;  5C4J J;  3CTA A;  2TCT A;  2NXN B;  1B8I B;  1W5T A;  4B3A A;  2VXZ A;  3PNY A;  1O3S A;  5BNG A;  3EYI A;  2DA2 A;  2IBD A;  1IDZ A;  3UR3 C;  4V19 K;  4XON A;  3S2W A;  1SC7 A;  3PUF A;  4UNO A;  4DIQ A;  5J4V A;  2E5N A;  2A5Y B;  3GZ5 A;  2IA0 A;  3TDU C;  1WQ2 A;  2MD5 A;  4XRF A;  2L7Z A;  3BRO A;  3NRV A;  1GLN A;  3BZC A;  3OYJ A;  4Y52 J;  3CCU I;  4II2 A;  2FF4 A;  1IAW A;  1H8A C;  1X1D A;  4M6V A;  4ENK A;  3M4O J;  1BN5 A;  1ZRF A;  2ELH A;  5CLS A;  3J80 Z;  1JKP C;  3ONQ A;  2IRF G;  5EDN A;  4GDF A;  4A3E J;  3HPH A;  3E6M A;  5TGT A;  3ZQC A;  4KIC A;  4IQJ A;  3RPU D;  3PSI A;  4A0Z A;  3LA3 A;  1TLH B;  3G1O A;  2CMP A;  3M1E A;  1XMX A;  4JP0 A;  3EET A;  3S14 J;  1PYV A;  5HLG A;  1MH4 A;  1ZK8 A;  3CCQ I;  1D1B A;  1Z21 A;  4PSX A;  1EKE A;  1PUE E;  4AVP A;  3AL0 B;  4KNY A;  1BW6 A;  2VKE A;  4Q5S F;  5L3D A;  4NUB A;  1N25 A;  4G8X A;  5IY5 H;  5LFA A;  3N97 A;  2KDZ A;  1Y1W J;  4JX4 A;  3GVA A;  4UUS A;  1VQ5 I;  1IN5 A;  2C6Y A;  3I3L A;  3EUH A;  1D5Y A;  2MA3 A;  1K6O A;  1J0R A;  2K86 A;  1JJ6 C;  1T95 A;  3D1N I;  2EFN A;  1B1B A;  3BR5 A;  4XK4 A;  3JSP A;  3KP4 A;  5F6F A;  2K3P A;  3S32 A;  2XAJ A;  1TQP A;  3FDY A;  1YIT I;  4LK0 F;  2KPM A;  1QRY A;  2W00 A;  2ZO4 A;  5HOD A;  2H1K A;  3DBL B;  2KIF A;  4RB2 C;  1E0E A;  3KP3 A;  1E3P A;  1WWX A;  3P9I A;  5KAI C;  2PFB A;  1X1C A;  3BTL A;  5IP9 J;  3FMS A;  3DXJ F;  4Z6Y A;  3CJT B;  2HS5 A;  3GTJ J;  2NS8 A;  2E71 A;  2XSJ C;  3CLO A;  4NNJ A;  1XMA A;  1TWH J;  2JJ7 A;  2P7C B;  4Y15 A;  3F6V A;  2R93 J;  2LY9 A;  4C3I J;  2IGK A;  4A12 A;  2CGP A;  2HYF A;  1ENH A;  3F9K A;  3F8F A;  3RJP A;  3MAJ A;  3BWG A;  1G59 A;  2JT1 A;  4DNC A;  3JRA A;  1O7F A;  4ESJ A;  1P9Q C;  4LMY A;  3HSR A;  1G4D A;  4FE4 A;  1P4X A;  1LDK B;  2KHM A;  1J59 A;  1R5I D;  4YEL A;  5EG0 B;  5EG0 A;  2YU3 A;  1F1Z A;  3IC7 A;  5DM6 F;  4A5M A;  2JA6 J;  1YJ9 I;  1S8N A;  4F91 B;  2ME0 A;  3R4K A;  4I01 A;  3CCE I;  2OD5 A;  3N05 A;  2VKH A;  3A4C A;  2BXZ A;  3QPT A;  5ICG A;  2DT5 A;  4V2G A;  2MC4 A;  2L7F P;  1ZGJ A;  1QNT A;  1W0U A;  3WTZ A;  3HOX J;  3OR2 C;  2H1L A;  3T1B A;  1S7O A;  3P9C A;  1FJL A;  3FK6 A;  4E70 A;  3DCF A;  5L3C A;  2NS0 A;  4BAY A;  2EIK H;  4O5V A;  3K0L A;  5GAH J;  4KYW A;  4BGD A;  2M45 A;  2DFE A;  1VQP I;  3K9T A;  1GV5 A;  3GTQ J;  4ZJZ A;  1LNW A;  1XGM A;  4QWQ A;  3CC7 I;  1NG6 A;  4A3L J;  1OLT A;  1QGP A;  2E36 A;  2ELK A;  4RGR A;  2DN0 A;  1ZAO A;  1LFP A;  2NVY J;  1ETW A;  2YX4 A;  4BKX A;  1R1T A;  3QP6 A;  2MGQ A;  5C3E J;  3KZZ A;  3HHG A;  1UG2 A;  3BOQ A;  2HKX A;  2IA2 A;  3QP5 A;  1W7P A;  3W6J B;  2NYX A;  4M3D A;  2DMQ A;  4HYE A;  4IRI A;  3WGI A;  3WTY C;  3F8M A;  3REO A;  5CVV A;  1W1W E;  2D5V A;  3NEU A;  4OWR B;  3FHZ A;  2PEX A;  4RGX A;  3TO9 A;  5FKL A;  1SFE A;  5HVQ C;  1U78 A;  3H3V K;  5BQT A;  4KIF A;  3DFG A;  3JRH A;  4YFK F;  2HQA A;  5B3S H;  4EQQ A;  1GVD A;  1A36 A;  2DMN A;  5HLI A;  1Y39 A;  2F5F A;  1MJB A;  3HGG A;  4JOM A;  4EJW A;  2VON A;  1JGS A;  4OAY A;  2YU9 J;  3O2P E;  1IN4 A;  3KET A;  1ZAR A;  2Y9Z A;  2XVC A;  2A61 A;  4BHP A;  3RYP A;  1H9T A;  1OIS A;  1S7A A;  3K69 A;  4LOC A;  4PUS A;  3OYN A;  1OMI A;  3WE3 A;  2KZV A;  1QVU A;  3JAM K;  4M72 A;  1JXS A;  2Q2E B;  2Q2E A;  2OPT A;  2X4H A;  2M1B A;  3JTG A;  4YRV A;  2RNG A;  3LWF A;  1HCR A;  4ZZL A;  1FIA A;  4GO1 A;  2A5W A;  1QPM A;  3GX4 X;  1TNT A;  2EA4 A;  3H5A A;  1Y56 A;  2DFF A;  3SFI A;  2BE5 F;  2ME6 A;  1MDM B;  1MDM A;  5LLQ A;  4MHG A;  3OIP A;  1YFH A;  2CRG A;  4WK8 F;  2LH9 A;  4E7H A;  4XSX F;  4EM0 B;  2QEX I;  1SAN A;  2LK2 A;  3U21 A;  1VQ4 I;  1HSJ A;  1S29 A;  1T33 A;  1ETY A;  2DW4 A;  4D1Q A;  3O6B B;  5DCF A;  3RQ4 A;  2WY7 Q;  1ON2 A;  2OA4 A;  3KLO A;  5ICC A;  1V54 H;  4EJU A;  2ICW G;  2DOF A;  4UUT A;  2EFP A;  3J81 K;  3DBR B;  3JW4 A;  4Q47 A;  1KYW A;  2BBY A;  5B1B H;  1X3Z B;  2CJJ A;  4MNU A;  1A5J A;  1W0T A;  2BVM A;  2IGM A;  2F4M B;  3ASO H;  3BR1 A;  4LLN A;  4J00 A;  2KJB A;  2V1D A;  1W4M A;  4WCG A;  3S3O A;  1FMV A;  1MW7 A;  1TZL A;  2H27 A;  1RUN A;  4MEX F;  1R4M B;  3MEX A;  1HDD C;  4W1U A;  3CO6 C;  5H20 A;  4QTR A;  3RKQ A; 
#chains in the Genus database with same CATH homology
 5B3S H;  1V54 H;  1OCZ H;  3ABL H;  2EIM H;  3AG3 H;  3AG4 H;  5IY5 H;  2DYR H;  2Y69 H;  3ASN H;  2OCC H;  1OCR H;  3X2Q H;  2EIK H;  5B1B H;  3WG7 H;  2EIL H;  3ASO H;  1OCO H;  3ABM H;  2DYS H;  1OCC H;  1V55 H;  5B1A H;  2ZXW H;  3AG2 H;  2EIN H;  2EIJ H;  3AG1 H;  3ABK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...