1V55H

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
molecule tags Oxidoreductase
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1v55H00
3AG4H 5IY5H 5B3SH 1OCRH 1V55H 2DYSH 3ASOH 5B1BH 3ASNH 3X2QH 2EINH 2EIMH 3ABMH 2EIJH 2ZXWH 3AG3H 3ABKH 2OCCH 3AG2H 2EIKH 3ABLH 2DYRH 1OCZH 1OCOH 1OCCH 1V54H 2Y69H 5B1AH 3AG1H 2EILH 3WG7H
chains in the Genus database with same CATH superfamily
1V3FA 3JTGA 2F5VA 5BMZA 5HODA 1XMKA 4ZZLA 3HPHA 2W82A 4UUSA 2HR3A 1U3EM 2Q0OA 3BG3A 1FMWA 1MH3A 3JRFA 3FWEA 2HFHA 4KT6A 4AUXA 2K40A 2VL8A 2XRLA 1R4MB 1SAXA 3WTVC 5EYRA 4BJ6C 2FOWA 4A3BJ 2DODA 2AHQA 5A2QK 3I54A 3H3VK 1RNLA 1AA7A 2IXSA 1QRYA 1QHGA 4OMYA 4HLXA 4A3EJ 2BW3A 3KYDB 2OPTA 1FPQA 4FTHA 5D5XB 2XGXA 2QQ9A 4IHVA 4UUSB 1RR7A 3I53A 2LK2A 1BI2A 1QA6A 4A3FJ 4X6AJ 2EZLA 5E8IA 2L9RA 1H9GA 2R7UA 2E71A 3K4MA 2P8TA 3TO6A 3H0GJ 4HX7A 2BEOA 1EKEA 5CQEA 2ZFWA 1VQLI 2PI0A 4Y4RA 1ZHFA 3BQYA 2PMHA 2KKOA 5L3DA 1NHAA 1V4RA 2TDXA 1F9NA 4BE0A 2JSPA 2QLZA 1W5TA 1CF7A 4KISA 4JYKA 4L9VA 2XAQA 1YIOA 3HOTA 4HX8A 1W5SA 3WTUC 2D1HA 1RR8C 3ZMDA 3FXRA 1S3JA 2PG4A 2LMDA 2UZKA 3HRTA 4AIJA 1GDTA 3CQZJ 4B1RA 1TT5B 1MBKA 3OYFA 3CCYA 4ZDPA 2X6WA 2YS9A 3CLOA 2HZDA 1X3ZB 2LP0A 1BW5A 1LEBA 1N75A 1ORKA 4L9NA 4NDLA 4ZJZA 4HQMA 2K27A 2DCEA 2IVMA 2H8RA 4ON0A 5EZHA 3E0JB 3SZTA 3KP2A 2EIJH 2IPQX 3H5RA 5ERIA 3ZQFA 4A3LJ 4PJ0C 2H1KA 4Q48A 3TO9A 1VTNC 4BACA 2L54A 1G3SA 4J01A 2STTA 2LVSA 3BQZA 3NWTA 2W85A 3BC8A 4JX6A 1RRJA 2ZKZA 1IN4A 1TQPA 3AAFA 2A05A 3O6BB 1I39A 2MGQA 4M74A 1Q1VA 2HPIA 2HDWA 1NH3A 1F4KA 2NS0A 2EJRA 1FBSA 4ENJA 4OAZA 2B63J 1BW6A 3BTIA 2FBKA 1JT0A 1FT9A 2RDPA 2X1EA 3HBLA 2YU9J 4HLYA 5ICEA 2EZHA 1YJWI 3TEDA 5HS7A 3ZMVA 3LSKA 2QCOA 4M73A 3CCEI 5EG0B 4ABZA 5DD8A 4B3AA 3NEUA 4EJVA 3CDLA 1D5YA 1OR7A 2ACJA 3GXOA 4BQNA 1SFOJ 3E5XA 3OSFA 1J09A 4KFCA 3Q9SA 4QIWN 4Y7NJ 2Y0SN 1QU3A 2R7WA 4BGDA 3H9JA 1W4MA 3U21A 1FTZA 2ZNYA 3HOSA 4HSRA 3BROA 2GA1A 2ICWG 4OOIA 1TBXA 5J1RA 5D8KB 1P2FA 1T0FC 1T08B 5F0FA 1HBXG 2CW0F 3IUOA 3TKYA 2LY9A 3QODA 2JZYA 3R60A 3DPLC 1WWXA 2PMZN 2Q2EB 2V9VA 4CCOA 1IXRC 2EV6A 4I02A 1TWAJ 2JMWA 3HM5A 3REOA 4B3XA 2FRHA 1T0FA 4EV0A 5KVRA 3HUGB 2DMTA 2W84A 2QSHX 3OYAA 3S16J 1UHWA 1POGA 1TW2A 3HDDA 1SANA 1R5HA 2IA1A 1TTYA 3LSGA 2WAQA 4E6KG 1VQ8I 2DBBA 4XM3A 4XRSA 3O8HA 3BR5A 2JA2A 1UMQA 4C2TA 2XV4S 2HDCA 1F43A 1D0ZA 1TWFJ 2BVLA 5IYDJ 2P4WA 1I1SA 5FKOA 1LVKA 3OYMA 3D0SA 5HDGA 3S32A 1ZN2A 2K9MA 1A35A 2A6HF 3K0LA 2ZMEC 1QZYA 3HRMA 2M87A 3E5UA 2CO5A 2XF7A 1FSEA 3DBRB 4G6DA 3IH2A 3HRSA 4DBRA 1I1GA 1MJBA 2E2IJ 1NK3P 2IS1A 1X1AA 3FM3A 1N77A 1MMDA 2RNGA 3KE2A 1G4DA 1XMAA 1UELB 1B59A 4M6XA 2LF8A 2WC2A 1VQKI 2KIQA 4KNYA 1Z6TA 4FE7A 1D3YA 1Z21A 2LY1A 2MA3A 3KCCA 5JVGF 3H5AA 3HHGA 4O6JA 1EF4A 1DQUA 2L7ZA 1JI8A 2DFFA 4UY8I 1Y1VJ 2GOMA 3GVAA 3W6JB 3WGHA 1KA8A 2G7UA 1P92A 1SFXA 4D0PA 2M7BA 1W0TA 1D5VA 5C3EJ 2CG4A 3DXJF 2VJ5A 3PFIA 3QPSA 1FOXA 3KEYA 2M3AA 4PJLA 4LMYA 5D4RA 2LTPA 4L5JA 1IXSB 3RDIA 2WB1N 3D5SC 4A3MJ 1YW9A 3MKZA 3CCSI 4HNVA 3CMYA 2GLOA 1IZ1A 2X51A 4G9YA 1U5TB 1JKQC 1G2HA 1XCVA 2RNJA 2KL4A 2KFDA 2ECBA 4M9SA 4CA0A 2EA2A 4WXCA 1K83J 1ZTRA 2EK5A 3AG3H 5EZGA 3PSFA 4G94A 1GXQA 3BZCA 4R79A 1DPRA 1W36C 2ZBKA 4C3IJ 1P6RA 2BOLA 5J6XA 2GA2A 3IKVA 3LSHA 3ZN1A 4A0YA 1EA3A 2WY7Q 3KP5A 1R4NB 2M2EA 2F5EA 1VQPI 3U9GA 2DK5A 4PSXA 5J1YA 1HSJA 4JBAA 4P96A 1GT0C 2AQFA 2VBWA 3H92A 4IPAA 3Q0WA 4KICA 3E7LA 4QPQA 1MMGA 1WRJA 4F52A 4HEA2 4L9TA 2X6XA 5LGUA 1LFUP 2XAFA 3M1CA 2OZUA 2L7KA 3DP7A 3ZQCA 1BC7C 4OINF 1FC3A 2B7EA 5HNHA 1WJ5A 4BDZA 1YJ9I 4IHTA 2B9SA 5ICFA 4ETSA 3IC7A 4IKFA 1U9NA 1ETQA 3SJMA 2QZ8A 4GO1A 1W1WE 2AXTC 5FFZA 4EJOA 4JQFA 1K6OA 2DMNA 2ELKA 3DQVC 1PUFB 2GXAA 3FXUA 2PQ8A 4Y52J 4BDYA 3HXLA 1MBJA 5EGOB 4C9YA 3WGGA 5J1UA 3B02A 4KUMA 5IP7J 1MSEC 1X3UA 2HPMA 3E6MA 1X2NA 2O03A 1UHSA 1SVOA 3A02A 4RBOA 1MBEA 1H88C 4XRFA 1KYZA 4CDGA 2CV2A 1Z05A 3N97A 2YX7A 3BTLA 1KYWA 4GXOA 2Y9YA 3DLLF 4UVAA 5H2FC 3F8MA 1FJLA 5J8FA 4QSHA 1K4TA 3FBNB 3JAMK 9ANTA 1SFUA 2K4BA 3GLLA 3VYSB 3K7AJ 2O9LA 3BG5A 3R0JA 4HF2A 2XSDC 3VYTB 4FE4A 2CQ7A 2CFOA 2L01A 1UAAA 2FA5A 2ZSHB 3ZQHA 4AYBN 3M7GA 3QOPA 1T98A 3HZJA 4C2UA 3SFIA 1U78A 1MDMA 2NVTJ 2PJPA 2Y2ZA 3GF2A 3PO2J 5M5WJ 3K70D 2L3DA 4I6ZA 3DU6A 4DJAA 3OWTA 1MW7A 2KRHA 2Y0SA 4KN7X 1Y8RB 2P7VB 3R61A 3DBLB 2A3SA 3I9V2 3OY9A 3AG2H 1J59A 4HF0A 3G1LA 3PJRA 3GTGJ 4CYCA 3S3NA 2CW7A 2WY8Q 1A36A 2VXDA 3KFWX 3J7ZI 2JVGA 1JUPA 2DQLA 2E2JJ 1GV5A 5BQTA 3VDXA 3F72A 4RB3C 2ZJQF 2ISYA 3DWLE 3MAJA 4WWCA 2WBMA 5IT3A 1R00A 2YUSA 1UG2A 3GZNB 2R5ZB 4UUTA 4NC6A 3J80K 5HLGA 3OYCA 4S04A 2NRAC 4YFXF 2F5DA 3AL0C 2CSOA 2VQCA 1FIAA 3L9FA 3RKXA 3L1PA 1D1CA 3BR2A 3BG7A 1U0JA 3Q9VA 3CJRB 4MNUA 4RB1A 3J7YJ 4OIQF 4G6TB 5TJJA 3WU0A 2Z33A 2ZNZA 1BC8C 2ZSIB 2PLYA 5HDKA 1FYMA 1OCPA 5AONA 3V8KA 2R7DA 2WV0A 2FBHA 1V55H 1Z7UA 1HDDC 3BCAA 4XBFA 2LC2A 2LD5A 2UUZA 3C7JA 3P9KA 2LKPA 3S1QJ 2M0CA 1G8XA 4V2GA 1NG6A 1OYWA 5HOOA 1SD5A 1ZK8A 4LG0B 4Y17A 3RPQA 1DUXC 3QU3A 3KZIC 3Q0VA 2LG4A 3HOZJ 4MEYF 3WU1B 1T38A 3CDIA 2CJJA 3GWZA 5E18F 3BCBA 2OU2A 1FOYA 4II2A 3CO6C 1ERDA 1QO0D 2KQRA 3WGIA 4C3JJ 1XB4A 5JLWA 1WHUA 2OTJI 4IQ4A 3H9GA 3LSJA 3QYFA 4RMNA 5FRMA 1RUNA 2HXOA 2JA8J 2A61A 5EJCA 3B73A 3GW2A 4M3DA 4YG2F 4Z6YA 3CCJI 3FZVA 2XVCA 4FT8A 4MFEA 2PN6A 5A2QZ 3RI4A 3H5NA 3RYRA 3OS0A 2F4IA 2F2EA 5LRRA 3SQNA 4HDUA 3E5QA 3UNGC 4DGWB 4IF4A 3A01B 2E1CA 1X1BA 5BNGA 2Z2SB 2DT5A 1V54H 1K4SA 4KIBA 5GPAA 1B9MA 1Z7LA 2H09A 2IW5A 4YFNF 3LFUA 1W0UA 4CCLA 4M71A 2HQRA 3WTTC 3X2QH 3PQJA 4HNTA 3LA2A 1MD0A 3VYRB 2DLLA 3ZRGA 2HVRA 2VT2A 3QPTA 1U9OA 2DMQA 5ED4A 1W7PB 3GTPJ 1IRFA 3A4CA 3NQOA 2XGEA 4E7HA 1VF9A 4R8HA 3WE2A 5J8CA 4AU7A 1HC8A 2FQ3A 3OYIA 1K78A 2QBYA 3A01A 5CVIA 1SAUA 4BEHA 3BPVA 2Y69H 4PGGA 3JSOA 4EVIA 1Z3YA 4KITB 1BR1A 2HS5A 2F4MB 3PUBA 4A6EA 3GTOJ 5KNLA 5FRNA 2K5CA 1ETVA 3ABMH 4FHTA 1MMAA 2K86A 3MZYA 2R7QA 4E7SA 1Z6RA 3IAS2 2R4GA 1K7AA 3NWSA 2QBYB 5DS9A 1A6QA 2JRTA 3OL3A 3IKTA 4EMSA 2RQQA 3ABLH 4BEHB 1HSTA 3KETA 2FE3A 1LJ9A 5F27A 2RKHA 4FETA 3KP7A 4IHWA 1E3OC 2R7XA 1B4AA 1HOMA 3CCMI 1FP2A 2DOEA 2FSWA 3C18A 4P1WA 5FB2A 2HI3A 2E2HJ 2K7LA 4RS8A 3DCFA 3P5JA 4FCYA 4PUSA 2KLOA 3OS2A 3IRRA 3HIFA 1BBYA 4KMUX 1JGGA 4CCKA 2DPUA 1JHHA 4N9IA 2ZO4A 2E7WA 2E1MB 2M7AA 5ILSA 1MMNA 1X58A 3QYEA 4G6QA 2EILH 2DOAA 1X4OA 3VYUB 3F22A 3OIQA 2KRFA 3C2HA 2I10A 3ULQB 2DA5A 5EEGA 5DM7F 3FX3A 4RA2A 3V7RA 4XLNF 1I6HJ 3DEWA 3OYLA 4QPOA 2IT0A 4HBLA 4EEFG 3CC7I 5DV5A 3FK6A 4QWQA 3ABKH 5HNFA 2E5ZA 4DBQA 2A07F 4E7LA 1IG7A 1O3TA 3M07A 4L5IA 2VJ4A 4EATA 1LFPA 3A0BC 1E0EA 4KYWA 1N78A 3CF2A 1T39A 1S5LC 3ISPA 4XONA 3UR3C 2R5YB 3HKZA 1T8IA 5TGTA 3GFMA 4JX5A 5LHIA 1XGSA 2QWWA 1CQTA 3MZ8A 1T2KA 1HW1A 3ONQA 3PIOF 2CW8A 3BT9A 4DW6A 4F55A 4ITVA 2ELJA 1AKHA 1STZA 1WFXA 4P9UA 4MO7A 1VQ5I 5CJ9A 2XGCA 1JJ8C 5LGTA 2HVQA 5IP6A 2RQPA 2W57A 2P5KA 4CZCA 3BTCA 4GGGA 1D0YA 4FISA 4LFUA 2ME6A 2XGDA 2R5YA 3KIOA 5K7ZA 2LBFB 3K2AA 1OCRH 4M3BA 3DKYA 3IL2A 4LOCA 1I50J 2QGUA 2QENA 5J3LA 3BG6A 3K4LA 1QNTA 2V4JC 2E1NA 1R1UA 3ZMUA 1RKWA 2QQAA 2CWEA 3N05A 1KU2A 3PUFA 4J00A 1XN7A 1R9TJ 2A69F 1QBJA 3HRUA 1BJAA 2EV0A 1R22A 5L3GA 2OZ6A 3VODA 1OMIA 4YIFA 1O3SA 1SMYF 1IGNA 4IL6C 2IS6A 1P7JA 2XAUA 5M5YJ 2FF4A 5GP9A 3GFLA 2LBFA 3RCOA 3RQ4A 4XN0A 4E4HA 4HA8A 5J4VA 1JHFA 2VQHA 3WU2C 4XRMA 1ACIA 3K4NA 3KZZA 4M6YA 5E1ZB 1YW7A 1OFCX 2E7XA 4L9JA 1YS7A 4GFBA 5CVRA 2IGKA 4RAYA 4C2MJ 3JAMZ 3OYDA 2PEXA 1IRGA 2DTZA 2EH3A 2XB5A 3RPUA 2CV1A 2GQQA 2VQGA 4D5CA 4DIQA 1U2WA 3BY6A 4F7ZA 1S29A 3RZDJ 1ZRDA 2LLKA 3DF8A 4HSTA 1Z67A 2QSFX 2TRTA 4D7NA 4XOPA 4EM1A 1BR2A 4LITA 2IA2A 3KYCB 4B44A 3OYGA 3LQRA 1IDYA 5EF6A 4L18B 3LA7A 1NK2P 5DCMB 1SFKA 4BXXJ 1Z0XA 3ZOBA 2QQBA 3ESWB 2LR8A 1HF0A 3OYBA 3VOEA 4OIRF 1G59A 2MABA 3COAC 5LEJA 4A3JJ 4AIKA 4HZFA 2UXNA 3K9TA 4BJTA 2DO7A 2L2OA 4LJZF 3BJAA 3TDZC 3M3YJ 1MIJA 3CUQA 2KJCA 4RB2C 2R3SA 4IJAA 4EM2A 1E3PA 5K5RA 3M9AA 1TZLA 2RN7A 3FXQA 3CZ6A 2TCTA 1WI9A 3JRCA 3ZPLA 5GAHJ 2ZFUA 4ZTJA 5CKTA 2B0LA 3K4KA 2STWA 5BS6A 4IRHA 2P6TA 2VONA 1U6GA 4LB5A 3FK7A 1H8AC 4DNCA 2HNHA 2ISZA 3CJNA 3OR2C 3VEPA 1LDJA 4RGXA 2IGOA 1HW5A 1WJBA 2JPCA 2P0WA 3FHNA 4RAZA 4BQAA 1S9HA 1JKRC 1T6SA 4BXUA 1P4AA 2V1DA 3CUQB 1FOWA 4WF2A 3RPUD 3HYIA 4N9HA 5HVQC 4RAGA 1YE9A 4LIVA 3FXMA 3WE3A 5JFRA 1QQIA 2Z3YA 4LLNA 2K9SA 3KP3A 1YHQI 2DDBA 3HGGA 1JKPC 4X1EA 4B48A 3K70C 2CU7A 3GMEA 3JREA 2COMA 4PFOA 4EGYA 5IOYA 2ADUA 1X1DA 5LGNA 1OYIA 3TMOA 1FX7A 2DYRH 3LAPA 4ENKA 2Y30A 1F36A 1FWZA 5J40A 1V5GA 2R92J 4RGSA 4EQQA 2YU3A 1B72B 2VC1A 2F5FA 3LFKA 4XRSG 1SEUA 3CC4I 1W7PD 2OF7A 4A6DA 1EV7A 2BY0A 1VNDA 4EM0B 2DT6A 4BAYA 2BV6A 2DFHA 3C2GA 4K2EA 5EEHA 2GWRA 2V6EA 1IF1A 4WX9A 1S7EA 3ZMZA 2XDVA 4XKCA 1UG0A 3H35A 3A03A 1MJ9A 3V7SA 2HDDA 2ESHA 2IA0A 3BTJA 2CS3A 2L5QA 2VUMJ 2A6TA 4RB0A 1IUYA 2EV5A 2L9SA 1SVLA 1X19A 4RGUA 4ZYEA 3PNVA 3M4OJ 1X1PA 2P5VA 2XASA 3ECOA 3QRFF 3GTLJ 2IS2A 4EJWA 5KCMA 1D1BA 5FROA 5C4XJ 5BOXA 5E20A 5DTDA 2K4JA 3U2RA 4EJUA 1TP4A 3T5XA 5JLXA 2IBDA 3I4MJ 3SEQA 1YYVA 2VODA 3PM1A 4UB8C 1VQ4I 4KMFA 2OCCH 3EYYA 3V7CA 1RETA 1TWCJ 4MQ9F 3ROUA 4G7ZF 2VKDA 4A0XA 1YO5C 4WXHA 3ECHA 3EPZA 2OC6A 4AIHA 4DZPA 3CJTB 4BJ5C 1YI2I 1MNEA 5L3CA 3WG7H 2R93J 4HV5A 4P55A 4BBRJ 3KPHA 1ON1A 2L9VA 2O7OA 3E6DA 4YELA 3OS1A 2Y31A 1X4PA 1JXSA 2BY3A 2E36A 3ZMSA 4UUVA 4N0BA 3F23A 3EYIA 4EGZA 2JQ7A 1IRXA 2H6BA 4PJJA 2XIGA 4XK4A 2V9PA 3IAM2 3QP6A 4BH9A 3MMYB 1HDPA 3IV5A 3L2VA 1WZ2A 1XG1A 4BHBA 4L0ZB 4IRGA 1YRNB 2M8EA 2EPFA 2P5LC 1Y56A 3JW4A 2K3FA 3K1NA 2Y0MA 5LHHA 4O3MA 4JOMA 3G3ZA 2V1XA 3C2BA 1TC3C 3R0AA 1CF7B 4IX7A 3NRVA 1YG2A 2NYXA 3G1OA 2HQNA 1S7OA 2OUMA 1DP7P 4CHUA 2X6OA 2ECCA 4UV9A 3S3OA 1TNSA 4GYIA 3SDBA 3MKYB 2FX0A 2X9DA 3ERED 4CCNA 1YRNA 3JR9A 2Z99A 3BJOA 5E1XA 2VE9A 2LKXA 1Z3XA 1LE8B 3N4MA 5KAFC 3PQKA 4B09A 2LRDA 1LDKB 1ZARA 3EUHC 3K6GA 3GFJA 3S1MJ 1BI3A 1Z9CA 4BNCA 2HTJA 1X3WB 1VZ0A 3FHZA 2JUGA 2DN0A 3G71I 1BJZA 4MTEA 3LSTA 1B9NA 1G3TA 4I09A 5B5EC 1XSXA 2DMPA 1YQAA 2D1VA 2LKSA 3CCLI 3TP0A 2DU9A 3E97A 4XR6A 1USTA 1RZ4A 3VWBA 2MBFA 2IAIA 3PFYA 1GHCA 3V8LA 1LE8A 2WV1A 2XKOA 1VQ9I 1OKRA 3CTAA 3HB9A 2X0LA 4LIUA 1QHHD 2BBYA 1HQCA 3GLXA 2VKEA 1J2XA 1WJCA 4U0VA 3S2DJ 1JTYA 5JHUA 3LQQA 2Y9ZA 3VPRA 1DGRM 2A6EF 4B47A 2OJED 1SD7A 2ME0A 4ZYDA 1MMSA 3GZ5A 5J4YA 3J7AO 3IRQA 4II3A 2JA6J 5TRDA 5EG0A 4U7DA 2ZB9A 1RUOA 3ZQ7A 1ZLJA 1ENHA 2L02A 5AIPA 1MZBA 1VI0A 1Y0NA 3P9CA 2D2WA 2L4AA 3WTSC 2WWYA 3SXYA 2WTEA 4ZTFA 3HOWJ 1RC9A 4I99C 3ELKA 3S2WA 5GAEJ 1B8IB 5J47A 5FJ8J 1UB9A 3W2VA 4BXFA 5GAGJ 1VQMI 1LFBA 2DFEA 4IOCF 2DDAA 3LOCA 4Y3OA 4BBSJ 3CMMA 3KLOA 2CV0A 3HOUJ 3F8BA 1UCRA 3PNYA 1REPC 4BE2A 1R23A 1Y39A 4HV6A 4BHPA 3KEQA 1KZHA 4XMYA 3S1NJ 3LNQA 3HC7A 2PFBA 2KDZA 3U1DA 1BR4A 2GXGA 3G73A 2VQLA 5M3FJ 3BDDA 5FKLA 5K5QA 3MKLA 4U7BA 3OYHA 2QF7A 4G8XA 1TW3A 4EJTA 4A5NA 1DGWY 5L3FA 2VLAA 2JTVA 3K1PA 3J81K 2O3FA 2X1DA 2V7FA 3C1DA 3IHUA 5IYCJ 1DPUA 2QQ8A 1ZR2A 2HWVA 4M6VA 5E3OA 2HEOA 1RI7A 3BR1A 4UVCA 1ETKA 5JVTA 1E17A 4I0BA 5ILVA 3J80Z 1ONVA 2VBZA 1K6YA 1W5CC 3ZQQA 3ABUA 1ZGJA 1LUJB 2YPRA 2LF7A 4BHCA 1PYVA 3MEXA 4A93J 3FF5A 4M3EA 4BYYA 2OQRA 2HOTA 1BI0A 4KA4A 3HOYJ 1J9IA 4ANJA 4LB6B 3T0YA 2PX9A 1XTAA 1UZCA 2ID3A 3OYKA 4BUPA 2HYFA 3CF5F 4XL9A 1IN6A 5LHGA 3ABTA 2DA2A 5FLXZ 1BI1A 4DQ2A 4YFKF 4PGHA 2K9NA 2ZJ2A 5LEKA 2FBIA 1RESA 3KLNA 2JA5J 3E1SA 4UHTA 3FXJA 1SMTA 4XLFA 3EUAA 3OV8A 3D5RC 1MGTA 5KK1A 1VQOI 5FLVA 3IP4B 4BY1J 4BS9A 1VQ6I 3RJPA 2A5YB 5CVUA 2IP2A 2NOJB 4MLOA 2VOPA 4A5MA 4RM2A 3HKZN 2O8KA 1L3LA 1YJNI 2CQNA 2ZJPF 3LWFA 5HLHA 2VT3A 1ON2A 1ODDA 3GX4X 2PJRA 3C3WA 3LL7A 1FEXA 2BW3B 4CCJA 4HX4A 1R36A 4NNJA 3HOXJ 2W1OA 4FX0A 2OQGA 3CMEI 5IT9K 2VBXA 3CP8A 2NS8A 3Q3SA 4DYQA 4ZZDA 2O6GE 2ZXWH 4KDPA 4P9FA 2M9HA 1XSDA 4OAYA 2M8GX 4HDVA 1D8KA 3ZR8X 3BWGA 1RPWA 1YFHA 1RIOH 2XAJA 4Q4ZF 1LDDA 3L2QA 3S8PA 3SYTA 5JHFA 5FLMJ 1ZGAA 2NVQJ 4IO9F 2PJRB 3F8CA 3FMSA 1BM9A 3MZHA 1IW7F 3RZOJ 1FBUA 2W7NA 2M4GA 2CUFA 3ZQIA 1IN7A 2CQQA 2WB1A 1MBHA 4AIDA 3WTXC 2MD0A 4M72A 2EINH 4W1UA 4S0HB 5D5UB 2P7CB 1IRZA 1HA8A 2AO9A 1O4XA 1ETOA 2EFOA 5D6EA 4BQOA 3T8TA 3TOBA 5LBQA 2XF6A 3L2WA 3K1MA 4I2OA 2GOXB 1J7KA 1I6XA 1Q1HA 2OBPA 5ICCA 4DYCA 4A3KJ 2JA7J 1FTTA 3QPLA 3HTUA 1TT0A 3TOAA 1GXPA 2UV1A 3FKJA 1RKTA 2XPUA 2E35A 3Q0UA 5DUKA 4F92B 2C6YA 2L4MA 1XPXA 1KU3A 4B4CA 2CMPA 2ZJRF 5K1YA 4OMZA 2XKPA 4UB6C 1O3QA 1P4XA 5IYBJ 5DM6F 1PUFA 1AWCA 1S6LA 3WTWC 1R1VA 2GIZA 4XORA 2HKXA 3KYLA 3VSKA 5BPDA 1WKMA 1IXCA 5EGOA 5F08A 5C44J 2F48A 1WPKA 2OTLI 4HRIA 5H6QA 4FASD 2JRMA 1H89C 3HG9A 4CCMA 2VIXA 5D4SA 2PMUA 3CCUI 3M8EA 1I27A 1N25A 2ZXIA 1HKSA 4N4NB 4BE1A 3D5LA 3LSPA 2Y48A 3E6CC 4L5EA 4LD5A 3D1NI 2E5NA 4CICA 2HKOA 3ZN0A 4RAFA 2JVHA 4CGZA 3V4GA 2QVOA 3B6CA 3P9IA 4PFPA 1Y6IA 6PAXA 2HGCA 4AYBA 1FIPA 2BHZA 2JPBA 1ZAOA 2VPRA 1QVUA 4OIPF 2UWMA 4LG3A 4XIDA 2RVCA 2KIFA 3RQIA 1MJAA 1MNMC 1JKOC 4MHGA 1R58A 2DJNA 3R4KA 3HL2A 2GBYA 2XRNA 2HOEA 2HYJA 2F5CA 1YX3A 3TBIA 2VOOA 1J5YA 1LEAA 2A68F 3I64A 1QGPA 5LRSA 4S05A 1G3WA 2DMUA 3RTRA 2R0QC 2EIMH 3A0HC 4XKBA 5E3LA 2EFQA 2F6CA 4PSWA 2KPMA 4XKWA 5D5VB 3Q5FA 1TL8A 2X1CA 4A3DJ 1OCZH 1XX5A 2MH9A 2YSRA 3EETA 4FQGA 1TNTA 3BOQA 1WGXA 3TP3A 4MIMA 2E19A 2Q2EA 1X1CA 1P4WA 4IXAA 4DZJA 1ZR4A 3ERMA 4E7IA 5D6FA 2KIUA 4NUBA 5F64A 3W6KB 3VFZA 2QA4I 1IDZA 4E7ZA 3HUGA 1PVEA 2I5UA 3ZQGA 2KZGA 1SD4A 3F6OA 4LLGF 2VKVA 5CVVA 3GTKJ 1VQNI 3CDHA 1HKQA 1A5JA 4HF1A 1F1ZA 1XGMA 2IS4A 1S7AA 1LQ1A 4XNFA 4M9XA 4J19A 3TDUC 1XS9A 2MC4A 3QAHA 2DYSH 2BGCA 2E1MC 1BIAA 5GTHC 3W6VA 5FKMA 1T56A 4NC7A 5GTIC 3JRBA 3M8JA 3F8NA 3MFKA 2E1OA 3TW6A 4V2FA 1QVTA 4C30A 1B6AA 5K7FA 3S1RJ 4D5FA 2XAGA 1CGPA 5E8GA 4BKXA 3WTZA 4UV8A 2V6CA 4BQQA 1TQIA 1C0WA 2HOAA 1A31A 2VJJA 4IRIA 1T33A 2CUJA 1Y1WJ 2H1LA 4WK8F 3FBIB 2EFNA 4WCGA 3GO5A 1ZH5A 3ASOH 5IT9Z 1IV8A 3HSFA 3OIPA 1XDUA 4AD9A 4BU2A 5LD2C 3S93A 4OWRB 3ZXSA 2CGPA 2HTSA 3G1MA 4TV7A 2NXNB 4Y33A 3JRIA 2LOOA 3GZ6A 3OYJA 2Z1DA 2DW4A 3PNTA 4F91B 3L2CA 1EH8A 3WTYC 1ZKGA 1ZG3A 2FNPA 4YRVA 1ETYA 4MQVA 3SEZA 3IWZA 3HHHA 1FSHA 2KZVA 2VBYA 2WA0A 5K5OA 4M3GA 2V1NA 2F4OB 4Q47A 3SHFA 3OYNA 4IHSA 5HS8A 4MTDA 2RV8A 3GUDA 3O8GA 3CLQA 2E34A 2P81A 1FMVA 5B66C 1YW8A 2K3PA 1U5TA 3PIPF 2RREA 3FMRA 2ID6A 2G9WA 4LK0F 2KJBA 2QKMB 1DU6A 4V19K 2J5PA 2R7TA 2VI6A 3F21A 3TQNA 4E7KA 3SDGA 4ZC3A 5FLXK 2QSGX 2QEXI 4CO8A 5ILUA 2XROA 5DUIA 1JUMA 1P9QC 2I8DA 4B8XA 2MG4A 1K78B 1U5TC 1XMXA 4BL0B 4I7HA 3A2KA 5KAIC 1WVRA 3WHBA 3E6BA 3G2BA 4IEJA 1XD7A 1XCBA 3BJ6A 3DKWA 3EUHA 1PP8F 4IOAF 3CP2A 2EFPA 5FD5A 4XKVA 1FY7A 1TWHJ 1KU7A 1WCMJ 1HLVA 2PMZA 4PCQA 2V26A 1DP3A 3A1YA 1ZQ3P 4UVBA 2GAUA 4ZDLA 2WAQN 5L3EA 1Z1DA 2Z9OA 2XHKA 4D7MA 1ETXA 2DJIA 2BZTA 2LH9A 4AVZA 1D8JA 2MD5A 2XF5A 2MW8A 1D0XA 3EQLF 3J81Z 5M3MJ 5CYVA 4LK1F 3W2AA 3I55I 2CQKA 3LSMA 2L0KA 3L7WA 4YIRX 2CYYA 2HYGD 2FMYA 3T8RA 4G12A 5JI6A 3S15J 4G7HF 4Y15A 4PJMA 4A3GJ 5F1RA 2H94A 4U87A 2DK8A 2OV7A 3J7AY 2EIKH 4OIOF 1A04A 3OSGA 4B43A 2Z5UA 4KJZA 4ENMA 1O57A 4JP0A 1JTXA 2RC4A 2NNNA 5F0CA 3H1CA 2M0MA 2DPDA 1V5EA 1YLFA 3MCZA 1DDNA 1Y0UA 1B1BA 5B3SH 4F93B 1AU7A 2R7FA 3R6SA 1G3YA 2O0YA 1KQ9A 4N4OB 3BPXA 3ZMTA 2W24A 2ZXJA 3LSIA 3LA3A 1FLIA 3M8FA 2VKHA 4ZYHA 1OPCA 3H3ZA 2KP6A 4HAMA 1S72I 3BLYA 2DA7A 2HQAA 4PZJA 1P7IA 2O5RA 1H0MA 1MDMB 2FQ4A 4ZYGA 3EDPA 5DD4A 4XLAA 4YIIA 4GRIA 4NHJA 4NC8A 2NOGA 2E60A 2EFWA 4RLFA 2NNYA 2XC7A 4R1HA 1SD6A 5M5XJ 2D5VA 1GV2A 1HCRA 4O5VA 4FX4A 2IRFG 2L7FP 3KZYA 1MKMA 1LKXA 3B6AA 3GTQJ 3HPGA 2AS5F 3OYEA 3I71A 2DI3A 1AKHB 1IN5A 3OL4A 4CYCB 3GTMJ 3RSNA 2Q8KA 3GFIA 1R5ID 3BP8A 5B1AH 5H20A 3HSRA 3O3KA 1MNDA 3SZPA 2LDUA 1NG7A 3CUOA 3AKZA 5C4JJ 3OR1C 3JRGA 3DEUA 4RM3A 4ESBA 2M5WA 5IOZA 4MGRA 2HXIA 4E7JA 1ITYA 2R5ZA 3MQ0A 5FFXA 3G6EI 1IO2A 4I76A 1OR7C 1WJEA 2GZWA 1YX5A 1ZRFA 1OJLA 3K69A 1Z91A 4ESFA 1EJ9A 5FKNA 1BL0A 3QP5A 2VN2A 3FM5A 2FOKA 3BR6A 3HGYA 5DDGA 2XAHA 3H9QA 2A5WA 1L0OC 1U8RA 2OCEA 3DPTA 3BZKA 3T1BA 1VFCA 2KHMA 2BHYA 3OIOA 4LGWA 4E70A 1ZLKA 1GVDA 3RYPA 1IC8A 2CQXA 1E3HA 2KMUA 2VASA 4OU0A 1FYLA 2EA4A 2IJLA 1ZELA 5GPCA 1XC5A 4LG0A 1IN8A 3EUKL 1KONA 1KQ0A 2BXZA 2CH0A 2DA1A 1YITI 3I4NJ 2CFXA 1JJ6C 2M34A 2VC0A 1AOYA 2MSYA 5H6RA 1QZZA 3CCQI 4H0EA 1XSVA 1LPQA 2GXBA 2VE8A 3I3LA 3QQAA 1SFEA 2LSOA 3BG9A 5E3MA 3P7NA 2J5OA 3MKWB 4IHYA 4XSZF 3F8FA 2KIMA 3F0CA 4W97A 3JRDA 1IUFA 3CJQB 3S3MA 1OLTA 4Q5SF 4HOBA 3V42A 1HXDA 1R6RA 1F5TA 3H36A 3JRHA 1AHDP 1FYKA 2MLGA 3DTKA 4JX4A 5DCMA 2YR2A 4D1QA 2GIVA 4CH7A 3H0DA 2UXXA 2MFZA 3QWLA 1JE8A 4Z2YA 4XLHA 2JN6A 1YOVB 3HJEA 3I4PA 1GUUA 4A2UA 1PDNC 1XDSA 2JJ7A 1QZEA 3K4CA 5FD6A 3SFZA 4PK4A 3DTEA 3F9KA 2BYVE 3DV8A 1JGSA 3V8JA 4GYGA 2CUEA 1W7PA 2DXIA 2YX4A 3I59A 3OOPA 3QPHA 3CUQC 3PL8A 5FKKA 1IAWA 4KIGA 3ZGKA 1OCOH 1ULYA 2FMLA 4DOZA 3BZ6A 1J0RA 2OAZA 3KP4A 3NARA 2JK3A 1KGSA 4BY7J 4M9ZA 2DT7B 2NVUB 2HZTA 2DOFA 4HYEA 3U1KA 3W2WA 3DTIA 1V5FA 2MC3A 3I59B 1WI3A 3FISA 4XLEA 1T95A 2FXAA 1MSFC 3E3VA 3JTHA 3PSIA 1S8NA 4XLCA 4HNUA 4AVPA 2V1UA 5EDNA 3JCUC 1BA5A 3PO3J 2CUZA 2NVYJ 3DLAA 2XSJC 5HS9A 5TISC 2H8WA 1GLNA 3F6VA 5D5WB 3GBGA 3GEZA 4A3IJ 1B72A 4ZDOA 2WAFA 5CVJA 3I5UA 5IY5H 2JSCA 1R1TA 1FBQA 1LVAA 1O7FA 2ZMEB 1ZGWA 1KQ8A 5HDNA 4MFDA 1USSA 5ICGA 1WSUA 1APLC 4KN4X 3FXOA 2QUFA 3RIRA 2X85A 3CCRI 3LSRA 3L09A 5JR3A 2R7ZJ 1VQ7I 2X4HA 4ZH4F 4M3FA 1BOBA 5FGMA 2R7RA 5CPRB 1MBFA 4LLLA 2Q1ZB 4NB5A 2L9NA 2DQRA 1TWGJ 1EH7A 5F04A 3GCMA 1HKTA 1OCCH 5F1JA 1R49A 3TO7A 3CC2I 4H4KC 4KT5C 3JRAA 3NAUA 1ZREA 1I5ZA 3AG4H 4XQFA 2FU4A 2EB7A 2XB0X 2EWNA 1U8BA 2ZMEA 4A12A 3WG9A 4I98B 5EEAA 4XN3A 1E2XA 4GCVA 4AWXB 3CCVI 4A69C 4C3HJ 4GDFA 2G0EA 5AIQA 4QTRA 2COBA 4L0YB 3FKIJ 3G4SI 2GM4A 2D45A 3L2UA 1ETWA 3MVPA 2VB6A 2DA4A 4CUGA 2XPWA 1BIBA 2HQ5A 4I0AA 3TGNA 3CD6I 1Y8QB 5KHDA 5CQGA 3KP6A 3K10A 1BOAA 3JSPA 4F3QA 1X2MA 2O61A 1XGNA 4Y13A 4AC0A 3MN2A 4WXDA 2FEZA 2DA6A 2VPLA 2RAEA 4PJNA 2OA4A 4D9JA 2R7VA 1K79A 3ZP5A 1UFMA 3GTJJ 3BR3A 3GYHX 1OCTC 3W3CA 1YTYA 2M45A 4RLQA 4U0YA 5D8LB 1UJ8A 3WODF 5IP9J 1G6NA 3FXKA 2K02A 2EQRA 2MYSA 2V9KA 4KIFA 3K2ZA 2LNBA 1O7LA 3I58A 1JUSA 1KU9A 4A3CJ 4IVNA 2FD5A 2WAEA 4HG2A 4XOTA 4XLPF 2N8GA 2M1BA 3SZGA 4XICA 5F0HA 3IWFA 4ZYAA 1J75A 2LY2A 2X6YA 3QU6A 2FJ1A 3M1EA 4MEXF 2W00A 4QLCU 2H6CA 4CYDA 4IZZA 2O8XA 1LB2A 2Z16A 5DYMA 2KRCA 3IH3A 4CZZA 2HOSA 1TQMA 1BN5A 4U88A 3MD2A 2W48A 3FMQA 5DEQA 2FNAA 1UHMA 4HW0A 3FIWA 2MLKA 3UKGA 1PP7U 3DKXA 5HLTA 2K85A 2WADA 2V79A 1XGOA 2NS7A 3S14J 4JK1X 1SC7A 4UXNA 2HVSA 2QKLB 3K4BA 2JWTA 1PUEE 4UNOA 3KX2A 3FXLA 1ZRCA 3S17J 3K4JA 2KDOA 2ESNA 2EZIA 4X0GA 2NAZA 3IH4A 1HW2A 1O3RA 2EBIA 1FP1D 4A0ZA 3RKYA 2OD5A 5E3NA 4IQJA 5E17F 5FO5A 3VSLA 1LNWA 3AG1H 5IPAA 4HPQA 3KEOA 3DFGA 2FUG2 2EZKA 1OISA 2JUCA 2PBIA 2QYOA 3DBHB 1A6IA 3I56I 3HOVJ 4I01A 2LYCA 2DFIA 5CLSA 1GVJA 2RGVA 3HEFA 2X48A 4YEJA 1EH6A 3RKQA 2M30A 1FZPB 5E79C 1NTCA 1WJDA 2KT0A 3MWMA 3BR0A 2LFBA 3OMYA 4NBQA 3DPUA 3LAJA 4RGRA 1QPIA 5K7HA 1IV6A 2JT1A 1WH7A 3RKWA 2AXLA 1R71A 2NVXJ 2ETHA 2ELHA 4U0WA 2Y75A 5B1BH 1D1AA 1WQ2A 3CO7C 4XSXF 2AQEA 1ZG5A 1FOKA 2L7MP 1I3AA 1YS6A 5F6FA 1I3QJ 3VB2A 4HQEA 4AM3A 2R7SA 2BXYA 5GADJ 2W4SA 1B8IA 5LLQA 1OYYA 3QOEA 4CSWA 3F3XA 1ZG1A 2CRGA 4NQWB 2BE5F 2KISA 3HTSB 1ZYRF 4IHXA 3CESA 5LFAA 3L00A 2IEKA 1SVMA 2BVMA 1Z77A 2XUBA 1QPMA 2DTRA 2HU9A 3DU5A 2IGNA 3H3UA 1OQYA 3WHCA 3CMAI 4ENNA 1M1EB 4RDUA 3FDYA 2K9LA 2DA3A 2XPVA 3ML6A 2IGMA 3AL0B 2ZXHA 2M4KA 5HLIA 1JT6A 5E1WA 4CXFA 2ZCWA 4NQWA 1TLHB 2BY1A 2LREA 3TW7A 1R5GA 2W25A 1IJWC 4G7OF 1K61A 3AFHA 3I0TA 3OOUA 1WH5A 3QYBA 1WJFA 3O2PE 1FNNA 3DEEA 3ASNH 1W36D 3L2RA 4P5OA 2QM3A 3TL4X 2VJIA 1WJAA 3S2HJ 2K9QA 5L3BA 2R7OA 3LMMA 1YIJI 1MH4A 2G7HA 2ZC2A 1DU0A 2P6SA 1PJRA 4DYRA 1H9TA 3ZQLA 4ESJA 2BY2A 1MBGA 3HSEA 5DCFA 4ASNA 5BPIA 2VXZA 2DAOA 4PDKA 2H27A 2MH2A 1R7JA 3ZCOA
chains in the Genus database with same CATH topology
3AG4H 5IY5H 5B3SH 1OCRH 1V55H 2DYSH 3ASOH 5B1BH 3ASNH 3X2QH 2EINH 2EIMH 3ABMH 2EIJH 2ZXWH 3AG3H 3ABKH 2OCCH 3AG2H 2EIKH 3ABLH 2DYRH 1OCZH 1OCOH 1OCCH 1V54H 2Y69H 5B1AH 3AG1H 2EILH 3WG7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG4 H;  5IY5 H;  5B3S H;  1OCR H;  1V55 H;  2DYS H;  3ASO H;  5B1B H;  3ASN H;  3X2Q H;  2EIN H;  2EIM H;  3ABM H;  2EIJ H;  2ZXW H;  3AG3 H;  3ABK H;  2OCC H;  3AG2 H;  2EIK H;  3ABL H;  2DYR H;  1OCZ H;  1OCO H;  1OCC H;  1V54 H;  2Y69 H;  5B1A H;  3AG1 H;  2EIL H;  3WG7 H; 
#chains in the Genus database with same CATH topology
 1V3F A;  3JTG A;  2F5V A;  5BMZ A;  5HOD A;  1XMK A;  4ZZL A;  3HPH A;  2W82 A;  4UUS A;  2HR3 A;  1U3E M;  2Q0O A;  3BG3 A;  1FMW A;  1MH3 A;  3JRF A;  3FWE A;  2HFH A;  4KT6 A;  4AUX A;  2K40 A;  2VL8 A;  2XRL A;  1R4M B;  1SAX A;  3WTV C;  5EYR A;  4BJ6 C;  2FOW A;  4A3B J;  2DOD A;  2AHQ A;  5A2Q K;  3I54 A;  3H3V K;  1RNL A;  1AA7 A;  2IXS A;  1QRY A;  1QHG A;  4OMY A;  4HLX A;  4A3E J;  2BW3 A;  3KYD B;  2OPT A;  1FPQ A;  4FTH A;  5D5X B;  2XGX A;  2QQ9 A;  4IHV A;  4UUS B;  1RR7 A;  3I53 A;  2LK2 A;  1BI2 A;  1QA6 A;  4A3F J;  4X6A J;  2EZL A;  5E8I A;  2L9R A;  1H9G A;  2R7U A;  2E71 A;  3K4M A;  2P8T A;  3TO6 A;  3H0G J;  4HX7 A;  2BEO A;  1EKE A;  5CQE A;  2ZFW A;  1VQL I;  2PI0 A;  4Y4R A;  1ZHF A;  3BQY A;  2PMH A;  2KKO A;  5L3D A;  1NHA A;  1V4R A;  2TDX A;  1F9N A;  4BE0 A;  2JSP A;  2QLZ A;  1W5T A;  1CF7 A;  4KIS A;  4JYK A;  4L9V A;  2XAQ A;  1YIO A;  3HOT A;  4HX8 A;  1W5S A;  3WTU C;  2D1H A;  1RR8 C;  3ZMD A;  3FXR A;  1S3J A;  2PG4 A;  2LMD A;  2UZK A;  3HRT A;  4AIJ A;  1GDT A;  3CQZ J;  4B1R A;  1TT5 B;  1MBK A;  3OYF A;  3CCY A;  4ZDP A;  2X6W A;  2YS9 A;  3CLO A;  2HZD A;  1X3Z B;  2LP0 A;  1BW5 A;  1LEB A;  1N75 A;  1ORK A;  4L9N A;  4NDL A;  4ZJZ A;  4HQM A;  2K27 A;  2DCE A;  2IVM A;  2H8R A;  4ON0 A;  5EZH A;  3E0J B;  3SZT A;  3KP2 A;  2EIJ H;  2IPQ X;  3H5R A;  5ERI A;  3ZQF A;  4A3L J;  4PJ0 C;  2H1K A;  4Q48 A;  3TO9 A;  1VTN C;  4BAC A;  2L54 A;  1G3S A;  4J01 A;  2STT A;  2LVS A;  3BQZ A;  3NWT A;  2W85 A;  3BC8 A;  4JX6 A;  1RRJ A;  2ZKZ A;  1IN4 A;  1TQP A;  3AAF A;  2A05 A;  3O6B B;  1I39 A;  2MGQ A;  4M74 A;  1Q1V A;  2HPI A;  2HDW A;  1NH3 A;  1F4K A;  2NS0 A;  2EJR A;  1FBS A;  4ENJ A;  4OAZ A;  2B63 J;  1BW6 A;  3BTI A;  2FBK A;  1JT0 A;  1FT9 A;  2RDP A;  2X1E A;  3HBL A;  2YU9 J;  4HLY A;  5ICE A;  2EZH A;  1YJW I;  3TED A;  5HS7 A;  3ZMV A;  3LSK A;  2QCO A;  4M73 A;  3CCE I;  5EG0 B;  4ABZ A;  5DD8 A;  4B3A A;  3NEU A;  4EJV A;  3CDL A;  1D5Y A;  1OR7 A;  2ACJ A;  3GXO A;  4BQN A;  1SFO J;  3E5X A;  3OSF A;  1J09 A;  4KFC A;  3Q9S A;  4QIW N;  4Y7N J;  2Y0S N;  1QU3 A;  2R7W A;  4BGD A;  3H9J A;  1W4M A;  3U21 A;  1FTZ A;  2ZNY A;  3HOS A;  4HSR A;  3BRO A;  2GA1 A;  2ICW G;  4OOI A;  1TBX A;  5J1R A;  5D8K B;  1P2F A;  1T0F C;  1T08 B;  5F0F A;  1HBX G;  2CW0 F;  3IUO A;  3TKY A;  2LY9 A;  3QOD A;  2JZY A;  3R60 A;  3DPL C;  1WWX A;  2PMZ N;  2Q2E B;  2V9V A;  4CCO A;  1IXR C;  2EV6 A;  4I02 A;  1TWA J;  2JMW A;  3HM5 A;  3REO A;  4B3X A;  2FRH A;  1T0F A;  4EV0 A;  5KVR A;  3HUG B;  2DMT A;  2W84 A;  2QSH X;  3OYA A;  3S16 J;  1UHW A;  1POG A;  1TW2 A;  3HDD A;  1SAN A;  1R5H A;  2IA1 A;  1TTY A;  3LSG A;  2WAQ A;  4E6K G;  1VQ8 I;  2DBB A;  4XM3 A;  4XRS A;  3O8H A;  3BR5 A;  2JA2 A;  1UMQ A;  4C2T A;  2XV4 S;  2HDC A;  1F43 A;  1D0Z A;  1TWF J;  2BVL A;  5IYD J;  2P4W A;  1I1S A;  5FKO A;  1LVK A;  3OYM A;  3D0S A;  5HDG A;  3S32 A;  1ZN2 A;  2K9M A;  1A35 A;  2A6H F;  3K0L A;  2ZME C;  1QZY A;  3HRM A;  2M87 A;  3E5U A;  2CO5 A;  2XF7 A;  1FSE A;  3DBR B;  4G6D A;  3IH2 A;  3HRS A;  4DBR A;  1I1G A;  1MJB A;  2E2I J;  1NK3 P;  2IS1 A;  1X1A A;  3FM3 A;  1N77 A;  1MMD A;  2RNG A;  3KE2 A;  1G4D A;  1XMA A;  1UEL B;  1B59 A;  4M6X A;  2LF8 A;  2WC2 A;  1VQK I;  2KIQ A;  4KNY A;  1Z6T A;  4FE7 A;  1D3Y A;  1Z21 A;  2LY1 A;  2MA3 A;  3KCC A;  5JVG F;  3H5A A;  3HHG A;  4O6J A;  1EF4 A;  1DQU A;  2L7Z A;  1JI8 A;  2DFF A;  4UY8 I;  1Y1V J;  2GOM A;  3GVA A;  3W6J B;  3WGH A;  1KA8 A;  2G7U A;  1P92 A;  1SFX A;  4D0P A;  2M7B A;  1W0T A;  1D5V A;  5C3E J;  2CG4 A;  3DXJ F;  2VJ5 A;  3PFI A;  3QPS A;  1FOX A;  3KEY A;  2M3A A;  4PJL A;  4LMY A;  5D4R A;  2LTP A;  4L5J A;  1IXS B;  3RDI A;  2WB1 N;  3D5S C;  4A3M J;  1YW9 A;  3MKZ A;  3CCS I;  4HNV A;  3CMY A;  2GLO A;  1IZ1 A;  2X51 A;  4G9Y A;  1U5T B;  1JKQ C;  1G2H A;  1XCV A;  2RNJ A;  2KL4 A;  2KFD A;  2ECB A;  4M9S A;  4CA0 A;  2EA2 A;  4WXC A;  1K83 J;  1ZTR A;  2EK5 A;  3AG3 H;  5EZG A;  3PSF A;  4G94 A;  1GXQ A;  3BZC A;  4R79 A;  1DPR A;  1W36 C;  2ZBK A;  4C3I J;  1P6R A;  2BOL A;  5J6X A;  2GA2 A;  3IKV A;  3LSH A;  3ZN1 A;  4A0Y A;  1EA3 A;  2WY7 Q;  3KP5 A;  1R4N B;  2M2E A;  2F5E A;  1VQP I;  3U9G A;  2DK5 A;  4PSX A;  5J1Y A;  1HSJ A;  4JBA A;  4P96 A;  1GT0 C;  2AQF A;  2VBW A;  3H92 A;  4IPA A;  3Q0W A;  4KIC A;  3E7L A;  4QPQ A;  1MMG A;  1WRJ A;  4F52 A;  4HEA 2;  4L9T A;  2X6X A;  5LGU A;  1LFU P;  2XAF A;  3M1C A;  2OZU A;  2L7K A;  3DP7 A;  3ZQC A;  1BC7 C;  4OIN F;  1FC3 A;  2B7E A;  5HNH A;  1WJ5 A;  4BDZ A;  1YJ9 I;  4IHT A;  2B9S A;  5ICF A;  4ETS A;  3IC7 A;  4IKF A;  1U9N A;  1ETQ A;  3SJM A;  2QZ8 A;  4GO1 A;  1W1W E;  2AXT C;  5FFZ A;  4EJO A;  4JQF A;  1K6O A;  2DMN A;  2ELK A;  3DQV C;  1PUF B;  2GXA A;  3FXU A;  2PQ8 A;  4Y52 J;  4BDY A;  3HXL A;  1MBJ A;  5EGO B;  4C9Y A;  3WGG A;  5J1U A;  3B02 A;  4KUM A;  5IP7 J;  1MSE C;  1X3U A;  2HPM A;  3E6M A;  1X2N A;  2O03 A;  1UHS A;  1SVO A;  3A02 A;  4RBO A;  1MBE A;  1H88 C;  4XRF A;  1KYZ A;  4CDG A;  2CV2 A;  1Z05 A;  3N97 A;  2YX7 A;  3BTL A;  1KYW A;  4GXO A;  2Y9Y A;  3DLL F;  4UVA A;  5H2F C;  3F8M A;  1FJL A;  5J8F A;  4QSH A;  1K4T A;  3FBN B;  3JAM K;  9ANT A;  1SFU A;  2K4B A;  3GLL A;  3VYS B;  3K7A J;  2O9L A;  3BG5 A;  3R0J A;  4HF2 A;  2XSD C;  3VYT B;  4FE4 A;  2CQ7 A;  2CFO A;  2L01 A;  1UAA A;  2FA5 A;  2ZSH B;  3ZQH A;  4AYB N;  3M7G A;  3QOP A;  1T98 A;  3HZJ A;  4C2U A;  3SFI A;  1U78 A;  1MDM A;  2NVT J;  2PJP A;  2Y2Z A;  3GF2 A;  3PO2 J;  5M5W J;  3K70 D;  2L3D A;  4I6Z A;  3DU6 A;  4DJA A;  3OWT A;  1MW7 A;  2KRH A;  2Y0S A;  4KN7 X;  1Y8R B;  2P7V B;  3R61 A;  3DBL B;  2A3S A;  3I9V 2;  3OY9 A;  3AG2 H;  1J59 A;  4HF0 A;  3G1L A;  3PJR A;  3GTG J;  4CYC A;  3S3N A;  2CW7 A;  2WY8 Q;  1A36 A;  2VXD A;  3KFW X;  3J7Z I;  2JVG A;  1JUP A;  2DQL A;  2E2J J;  1GV5 A;  5BQT A;  3VDX A;  3F72 A;  4RB3 C;  2ZJQ F;  2ISY A;  3DWL E;  3MAJ A;  4WWC A;  2WBM A;  5IT3 A;  1R00 A;  2YUS A;  1UG2 A;  3GZN B;  2R5Z B;  4UUT A;  4NC6 A;  3J80 K;  5HLG A;  3OYC A;  4S04 A;  2NRA C;  4YFX F;  2F5D A;  3AL0 C;  2CSO A;  2VQC A;  1FIA A;  3L9F A;  3RKX A;  3L1P A;  1D1C A;  3BR2 A;  3BG7 A;  1U0J A;  3Q9V A;  3CJR B;  4MNU A;  4RB1 A;  3J7Y J;  4OIQ F;  4G6T B;  5TJJ A;  3WU0 A;  2Z33 A;  2ZNZ A;  1BC8 C;  2ZSI B;  2PLY A;  5HDK A;  1FYM A;  1OCP A;  5AON A;  3V8K A;  2R7D A;  2WV0 A;  2FBH A;  1V55 H;  1Z7U A;  1HDD C;  3BCA A;  4XBF A;  2LC2 A;  2LD5 A;  2UUZ A;  3C7J A;  3P9K A;  2LKP A;  3S1Q J;  2M0C A;  1G8X A;  4V2G A;  1NG6 A;  1OYW A;  5HOO A;  1SD5 A;  1ZK8 A;  4LG0 B;  4Y17 A;  3RPQ A;  1DUX C;  3QU3 A;  3KZI C;  3Q0V A;  2LG4 A;  3HOZ J;  4MEY F;  3WU1 B;  1T38 A;  3CDI A;  2CJJ A;  3GWZ A;  5E18 F;  3BCB A;  2OU2 A;  1FOY A;  4II2 A;  3CO6 C;  1ERD A;  1QO0 D;  2KQR A;  3WGI A;  4C3J J;  1XB4 A;  5JLW A;  1WHU A;  2OTJ I;  4IQ4 A;  3H9G A;  3LSJ A;  3QYF A;  4RMN A;  5FRM A;  1RUN A;  2HXO A;  2JA8 J;  2A61 A;  5EJC A;  3B73 A;  3GW2 A;  4M3D A;  4YG2 F;  4Z6Y A;  3CCJ I;  3FZV A;  2XVC A;  4FT8 A;  4MFE A;  2PN6 A;  5A2Q Z;  3RI4 A;  3H5N A;  3RYR A;  3OS0 A;  2F4I A;  2F2E A;  5LRR A;  3SQN A;  4HDU A;  3E5Q A;  3UNG C;  4DGW B;  4IF4 A;  3A01 B;  2E1C A;  1X1B A;  5BNG A;  2Z2S B;  2DT5 A;  1V54 H;  1K4S A;  4KIB A;  5GPA A;  1B9M A;  1Z7L A;  2H09 A;  2IW5 A;  4YFN F;  3LFU A;  1W0U A;  4CCL A;  4M71 A;  2HQR A;  3WTT C;  3X2Q H;  3PQJ A;  4HNT A;  3LA2 A;  1MD0 A;  3VYR B;  2DLL A;  3ZRG A;  2HVR A;  2VT2 A;  3QPT A;  1U9O A;  2DMQ A;  5ED4 A;  1W7P B;  3GTP J;  1IRF A;  3A4C A;  3NQO A;  2XGE A;  4E7H A;  1VF9 A;  4R8H A;  3WE2 A;  5J8C A;  4AU7 A;  1HC8 A;  2FQ3 A;  3OYI A;  1K78 A;  2QBY A;  3A01 A;  5CVI A;  1SAU A;  4BEH A;  3BPV A;  2Y69 H;  4PGG A;  3JSO A;  4EVI A;  1Z3Y A;  4KIT B;  1BR1 A;  2HS5 A;  2F4M B;  3PUB A;  4A6E A;  3GTO J;  5KNL A;  5FRN A;  2K5C A;  1ETV A;  3ABM H;  4FHT A;  1MMA A;  2K86 A;  3MZY A;  2R7Q A;  4E7S A;  1Z6R A;  3IAS 2;  2R4G A;  1K7A A;  3NWS A;  2QBY B;  5DS9 A;  1A6Q A;  2JRT A;  3OL3 A;  3IKT A;  4EMS A;  2RQQ A;  3ABL H;  4BEH B;  1HST A;  3KET A;  2FE3 A;  1LJ9 A;  5F27 A;  2RKH A;  4FET A;  3KP7 A;  4IHW A;  1E3O C;  2R7X A;  1B4A A;  1HOM A;  3CCM I;  1FP2 A;  2DOE A;  2FSW A;  3C18 A;  4P1W A;  5FB2 A;  2HI3 A;  2E2H J;  2K7L A;  4RS8 A;  3DCF A;  3P5J A;  4FCY A;  4PUS A;  2KLO A;  3OS2 A;  3IRR A;  3HIF A;  1BBY A;  4KMU X;  1JGG A;  4CCK A;  2DPU A;  1JHH A;  4N9I A;  2ZO4 A;  2E7W A;  2E1M B;  2M7A A;  5ILS A;  1MMN A;  1X58 A;  3QYE A;  4G6Q A;  2EIL H;  2DOA A;  1X4O A;  3VYU B;  3F22 A;  3OIQ A;  2KRF A;  3C2H A;  2I10 A;  3ULQ B;  2DA5 A;  5EEG A;  5DM7 F;  3FX3 A;  4RA2 A;  3V7R A;  4XLN F;  1I6H J;  3DEW A;  3OYL A;  4QPO A;  2IT0 A;  4HBL A;  4EEF G;  3CC7 I;  5DV5 A;  3FK6 A;  4QWQ A;  3ABK H;  5HNF A;  2E5Z A;  4DBQ A;  2A07 F;  4E7L A;  1IG7 A;  1O3T A;  3M07 A;  4L5I A;  2VJ4 A;  4EAT A;  1LFP A;  3A0B C;  1E0E A;  4KYW A;  1N78 A;  3CF2 A;  1T39 A;  1S5L C;  3ISP A;  4XON A;  3UR3 C;  2R5Y B;  3HKZ A;  1T8I A;  5TGT A;  3GFM A;  4JX5 A;  5LHI A;  1XGS A;  2QWW A;  1CQT A;  3MZ8 A;  1T2K A;  1HW1 A;  3ONQ A;  3PIO F;  2CW8 A;  3BT9 A;  4DW6 A;  4F55 A;  4ITV A;  2ELJ A;  1AKH A;  1STZ A;  1WFX A;  4P9U A;  4MO7 A;  1VQ5 I;  5CJ9 A;  2XGC A;  1JJ8 C;  5LGT A;  2HVQ A;  5IP6 A;  2RQP A;  2W57 A;  2P5K A;  4CZC A;  3BTC A;  4GGG A;  1D0Y A;  4FIS A;  4LFU A;  2ME6 A;  2XGD A;  2R5Y A;  3KIO A;  5K7Z A;  2LBF B;  3K2A A;  1OCR H;  4M3B A;  3DKY A;  3IL2 A;  4LOC A;  1I50 J;  2QGU A;  2QEN A;  5J3L A;  3BG6 A;  3K4L A;  1QNT A;  2V4J C;  2E1N A;  1R1U A;  3ZMU A;  1RKW A;  2QQA A;  2CWE A;  3N05 A;  1KU2 A;  3PUF A;  4J00 A;  1XN7 A;  1R9T J;  2A69 F;  1QBJ A;  3HRU A;  1BJA A;  2EV0 A;  1R22 A;  5L3G A;  2OZ6 A;  3VOD A;  1OMI A;  4YIF A;  1O3S A;  1SMY F;  1IGN A;  4IL6 C;  2IS6 A;  1P7J A;  2XAU A;  5M5Y J;  2FF4 A;  5GP9 A;  3GFL A;  2LBF A;  3RCO A;  3RQ4 A;  4XN0 A;  4E4H A;  4HA8 A;  5J4V A;  1JHF A;  2VQH A;  3WU2 C;  4XRM A;  1ACI A;  3K4N A;  3KZZ A;  4M6Y A;  5E1Z B;  1YW7 A;  1OFC X;  2E7X A;  4L9J A;  1YS7 A;  4GFB A;  5CVR A;  2IGK A;  4RAY A;  4C2M J;  3JAM Z;  3OYD A;  2PEX A;  1IRG A;  2DTZ A;  2EH3 A;  2XB5 A;  3RPU A;  2CV1 A;  2GQQ A;  2VQG A;  4D5C A;  4DIQ A;  1U2W A;  3BY6 A;  4F7Z A;  1S29 A;  3RZD J;  1ZRD A;  2LLK A;  3DF8 A;  4HST A;  1Z67 A;  2QSF X;  2TRT A;  4D7N A;  4XOP A;  4EM1 A;  1BR2 A;  4LIT A;  2IA2 A;  3KYC B;  4B44 A;  3OYG A;  3LQR A;  1IDY A;  5EF6 A;  4L18 B;  3LA7 A;  1NK2 P;  5DCM B;  1SFK A;  4BXX J;  1Z0X A;  3ZOB A;  2QQB A;  3ESW B;  2LR8 A;  1HF0 A;  3OYB A;  3VOE A;  4OIR F;  1G59 A;  2MAB A;  3COA C;  5LEJ A;  4A3J J;  4AIK A;  4HZF A;  2UXN A;  3K9T A;  4BJT A;  2DO7 A;  2L2O A;  4LJZ F;  3BJA A;  3TDZ C;  3M3Y J;  1MIJ A;  3CUQ A;  2KJC A;  4RB2 C;  2R3S A;  4IJA A;  4EM2 A;  1E3P A;  5K5R A;  3M9A A;  1TZL A;  2RN7 A;  3FXQ A;  3CZ6 A;  2TCT A;  1WI9 A;  3JRC A;  3ZPL A;  5GAH J;  2ZFU A;  4ZTJ A;  5CKT A;  2B0L A;  3K4K A;  2STW A;  5BS6 A;  4IRH A;  2P6T A;  2VON A;  1U6G A;  4LB5 A;  3FK7 A;  1H8A C;  4DNC A;  2HNH A;  2ISZ A;  3CJN A;  3OR2 C;  3VEP A;  1LDJ A;  4RGX A;  2IGO A;  1HW5 A;  1WJB A;  2JPC A;  2P0W A;  3FHN A;  4RAZ A;  4BQA A;  1S9H A;  1JKR C;  1T6S A;  4BXU A;  1P4A A;  2V1D A;  3CUQ B;  1FOW A;  4WF2 A;  3RPU D;  3HYI A;  4N9H A;  5HVQ C;  4RAG A;  1YE9 A;  4LIV A;  3FXM A;  3WE3 A;  5JFR A;  1QQI A;  2Z3Y A;  4LLN A;  2K9S A;  3KP3 A;  1YHQ I;  2DDB A;  3HGG A;  1JKP C;  4X1E A;  4B48 A;  3K70 C;  2CU7 A;  3GME A;  3JRE A;  2COM A;  4PFO A;  4EGY A;  5IOY A;  2ADU A;  1X1D A;  5LGN A;  1OYI A;  3TMO A;  1FX7 A;  2DYR H;  3LAP A;  4ENK A;  2Y30 A;  1F36 A;  1FWZ A;  5J40 A;  1V5G A;  2R92 J;  4RGS A;  4EQQ A;  2YU3 A;  1B72 B;  2VC1 A;  2F5F A;  3LFK A;  4XRS G;  1SEU A;  3CC4 I;  1W7P D;  2OF7 A;  4A6D A;  1EV7 A;  2BY0 A;  1VND A;  4EM0 B;  2DT6 A;  4BAY A;  2BV6 A;  2DFH A;  3C2G A;  4K2E A;  5EEH A;  2GWR A;  2V6E A;  1IF1 A;  4WX9 A;  1S7E A;  3ZMZ A;  2XDV A;  4XKC A;  1UG0 A;  3H35 A;  3A03 A;  1MJ9 A;  3V7S A;  2HDD A;  2ESH A;  2IA0 A;  3BTJ A;  2CS3 A;  2L5Q A;  2VUM J;  2A6T A;  4RB0 A;  1IUY A;  2EV5 A;  2L9S A;  1SVL A;  1X19 A;  4RGU A;  4ZYE A;  3PNV A;  3M4O J;  1X1P A;  2P5V A;  2XAS A;  3ECO A;  3QRF F;  3GTL J;  2IS2 A;  4EJW A;  5KCM A;  1D1B A;  5FRO A;  5C4X J;  5BOX A;  5E20 A;  5DTD A;  2K4J A;  3U2R A;  4EJU A;  1TP4 A;  3T5X A;  5JLX A;  2IBD A;  3I4M J;  3SEQ A;  1YYV A;  2VOD A;  3PM1 A;  4UB8 C;  1VQ4 I;  4KMF A;  2OCC H;  3EYY A;  3V7C A;  1RET A;  1TWC J;  4MQ9 F;  3ROU A;  4G7Z F;  2VKD A;  4A0X A;  1YO5 C;  4WXH A;  3ECH A;  3EPZ A;  2OC6 A;  4AIH A;  4DZP A;  3CJT B;  4BJ5 C;  1YI2 I;  1MNE A;  5L3C A;  3WG7 H;  2R93 J;  4HV5 A;  4P55 A;  4BBR J;  3KPH A;  1ON1 A;  2L9V A;  2O7O A;  3E6D A;  4YEL A;  3OS1 A;  2Y31 A;  1X4P A;  1JXS A;  2BY3 A;  2E36 A;  3ZMS A;  4UUV A;  4N0B A;  3F23 A;  3EYI A;  4EGZ A;  2JQ7 A;  1IRX A;  2H6B A;  4PJJ A;  2XIG A;  4XK4 A;  2V9P A;  3IAM 2;  3QP6 A;  4BH9 A;  3MMY B;  1HDP A;  3IV5 A;  3L2V A;  1WZ2 A;  1XG1 A;  4BHB A;  4L0Z B;  4IRG A;  1YRN B;  2M8E A;  2EPF A;  2P5L C;  1Y56 A;  3JW4 A;  2K3F A;  3K1N A;  2Y0M A;  5LHH A;  4O3M A;  4JOM A;  3G3Z A;  2V1X A;  3C2B A;  1TC3 C;  3R0A A;  1CF7 B;  4IX7 A;  3NRV A;  1YG2 A;  2NYX A;  3G1O A;  2HQN A;  1S7O A;  2OUM A;  1DP7 P;  4CHU A;  2X6O A;  2ECC A;  4UV9 A;  3S3O A;  1TNS A;  4GYI A;  3SDB A;  3MKY B;  2FX0 A;  2X9D A;  3ERE D;  4CCN A;  1YRN A;  3JR9 A;  2Z99 A;  3BJO A;  5E1X A;  2VE9 A;  2LKX A;  1Z3X A;  1LE8 B;  3N4M A;  5KAF C;  3PQK A;  4B09 A;  2LRD A;  1LDK B;  1ZAR A;  3EUH C;  3K6G A;  3GFJ A;  3S1M J;  1BI3 A;  1Z9C A;  4BNC A;  2HTJ A;  1X3W B;  1VZ0 A;  3FHZ A;  2JUG A;  2DN0 A;  3G71 I;  1BJZ A;  4MTE A;  3LST A;  1B9N A;  1G3T A;  4I09 A;  5B5E C;  1XSX A;  2DMP A;  1YQA A;  2D1V A;  2LKS A;  3CCL I;  3TP0 A;  2DU9 A;  3E97 A;  4XR6 A;  1UST A;  1RZ4 A;  3VWB A;  2MBF A;  2IAI A;  3PFY A;  1GHC A;  3V8L A;  1LE8 A;  2WV1 A;  2XKO A;  1VQ9 I;  1OKR A;  3CTA A;  3HB9 A;  2X0L A;  4LIU A;  1QHH D;  2BBY A;  1HQC A;  3GLX A;  2VKE A;  1J2X A;  1WJC A;  4U0V A;  3S2D J;  1JTY A;  5JHU A;  3LQQ A;  2Y9Z A;  3VPR A;  1DGR M;  2A6E F;  4B47 A;  2OJE D;  1SD7 A;  2ME0 A;  4ZYD A;  1MMS A;  3GZ5 A;  5J4Y A;  3J7A O;  3IRQ A;  4II3 A;  2JA6 J;  5TRD A;  5EG0 A;  4U7D A;  2ZB9 A;  1RUO A;  3ZQ7 A;  1ZLJ A;  1ENH A;  2L02 A;  5AIP A;  1MZB A;  1VI0 A;  1Y0N A;  3P9C A;  2D2W A;  2L4A A;  3WTS C;  2WWY A;  3SXY A;  2WTE A;  4ZTF A;  3HOW J;  1RC9 A;  4I99 C;  3ELK A;  3S2W A;  5GAE J;  1B8I B;  5J47 A;  5FJ8 J;  1UB9 A;  3W2V A;  4BXF A;  5GAG J;  1VQM I;  1LFB A;  2DFE A;  4IOC F;  2DDA A;  3LOC A;  4Y3O A;  4BBS J;  3CMM A;  3KLO A;  2CV0 A;  3HOU J;  3F8B A;  1UCR A;  3PNY A;  1REP C;  4BE2 A;  1R23 A;  1Y39 A;  4HV6 A;  4BHP A;  3KEQ A;  1KZH A;  4XMY A;  3S1N J;  3LNQ A;  3HC7 A;  2PFB A;  2KDZ A;  3U1D A;  1BR4 A;  2GXG A;  3G73 A;  2VQL A;  5M3F J;  3BDD A;  5FKL A;  5K5Q A;  3MKL A;  4U7B A;  3OYH A;  2QF7 A;  4G8X A;  1TW3 A;  4EJT A;  4A5N A;  1DGW Y;  5L3F A;  2VLA A;  2JTV A;  3K1P A;  3J81 K;  2O3F A;  2X1D A;  2V7F A;  3C1D A;  3IHU A;  5IYC J;  1DPU A;  2QQ8 A;  1ZR2 A;  2HWV A;  4M6V A;  5E3O A;  2HEO A;  1RI7 A;  3BR1 A;  4UVC A;  1ETK A;  5JVT A;  1E17 A;  4I0B A;  5ILV A;  3J80 Z;  1ONV A;  2VBZ A;  1K6Y A;  1W5C C;  3ZQQ A;  3ABU A;  1ZGJ A;  1LUJ B;  2YPR A;  2LF7 A;  4BHC A;  1PYV A;  3MEX A;  4A93 J;  3FF5 A;  4M3E A;  4BYY A;  2OQR A;  2HOT A;  1BI0 A;  4KA4 A;  3HOY J;  1J9I A;  4ANJ A;  4LB6 B;  3T0Y A;  2PX9 A;  1XTA A;  1UZC A;  2ID3 A;  3OYK A;  4BUP A;  2HYF A;  3CF5 F;  4XL9 A;  1IN6 A;  5LHG A;  3ABT A;  2DA2 A;  5FLX Z;  1BI1 A;  4DQ2 A;  4YFK F;  4PGH A;  2K9N A;  2ZJ2 A;  5LEK A;  2FBI A;  1RES A;  3KLN A;  2JA5 J;  3E1S A;  4UHT A;  3FXJ A;  1SMT A;  4XLF A;  3EUA A;  3OV8 A;  3D5R C;  1MGT A;  5KK1 A;  1VQO I;  5FLV A;  3IP4 B;  4BY1 J;  4BS9 A;  1VQ6 I;  3RJP A;  2A5Y B;  5CVU A;  2IP2 A;  2NOJ B;  4MLO A;  2VOP A;  4A5M A;  4RM2 A;  3HKZ N;  2O8K A;  1L3L A;  1YJN I;  2CQN A;  2ZJP F;  3LWF A;  5HLH A;  2VT3 A;  1ON2 A;  1ODD A;  3GX4 X;  2PJR A;  3C3W A;  3LL7 A;  1FEX A;  2BW3 B;  4CCJ A;  4HX4 A;  1R36 A;  4NNJ A;  3HOX J;  2W1O A;  4FX0 A;  2OQG A;  3CME I;  5IT9 K;  2VBX A;  3CP8 A;  2NS8 A;  3Q3S A;  4DYQ A;  4ZZD A;  2O6G E;  2ZXW H;  4KDP A;  4P9F A;  2M9H A;  1XSD A;  4OAY A;  2M8G X;  4HDV A;  1D8K A;  3ZR8 X;  3BWG A;  1RPW A;  1YFH A;  1RIO H;  2XAJ A;  4Q4Z F;  1LDD A;  3L2Q A;  3S8P A;  3SYT A;  5JHF A;  5FLM J;  1ZGA A;  2NVQ J;  4IO9 F;  2PJR B;  3F8C A;  3FMS A;  1BM9 A;  3MZH A;  1IW7 F;  3RZO J;  1FBU A;  2W7N A;  2M4G A;  2CUF A;  3ZQI A;  1IN7 A;  2CQQ A;  2WB1 A;  1MBH A;  4AID A;  3WTX C;  2MD0 A;  4M72 A;  2EIN H;  4W1U A;  4S0H B;  5D5U B;  2P7C B;  1IRZ A;  1HA8 A;  2AO9 A;  1O4X A;  1ETO A;  2EFO A;  5D6E A;  4BQO A;  3T8T A;  3TOB A;  5LBQ A;  2XF6 A;  3L2W A;  3K1M A;  4I2O A;  2GOX B;  1J7K A;  1I6X A;  1Q1H A;  2OBP A;  5ICC A;  4DYC A;  4A3K J;  2JA7 J;  1FTT A;  3QPL A;  3HTU A;  1TT0 A;  3TOA A;  1GXP A;  2UV1 A;  3FKJ A;  1RKT A;  2XPU A;  2E35 A;  3Q0U A;  5DUK A;  4F92 B;  2C6Y A;  2L4M A;  1XPX A;  1KU3 A;  4B4C A;  2CMP A;  2ZJR F;  5K1Y A;  4OMZ A;  2XKP A;  4UB6 C;  1O3Q A;  1P4X A;  5IYB J;  5DM6 F;  1PUF A;  1AWC A;  1S6L A;  3WTW C;  1R1V A;  2GIZ A;  4XOR A;  2HKX A;  3KYL A;  3VSK A;  5BPD A;  1WKM A;  1IXC A;  5EGO A;  5F08 A;  5C44 J;  2F48 A;  1WPK A;  2OTL I;  4HRI A;  5H6Q A;  4FAS D;  2JRM A;  1H89 C;  3HG9 A;  4CCM A;  2VIX A;  5D4S A;  2PMU A;  3CCU I;  3M8E A;  1I27 A;  1N25 A;  2ZXI A;  1HKS A;  4N4N B;  4BE1 A;  3D5L A;  3LSP A;  2Y48 A;  3E6C C;  4L5E A;  4LD5 A;  3D1N I;  2E5N A;  4CIC A;  2HKO A;  3ZN0 A;  4RAF A;  2JVH A;  4CGZ A;  3V4G A;  2QVO A;  3B6C A;  3P9I A;  4PFP A;  1Y6I A;  6PAX A;  2HGC A;  4AYB A;  1FIP A;  2BHZ A;  2JPB A;  1ZAO A;  2VPR A;  1QVU A;  4OIP F;  2UWM A;  4LG3 A;  4XID A;  2RVC A;  2KIF A;  3RQI A;  1MJA A;  1MNM C;  1JKO C;  4MHG A;  1R58 A;  2DJN A;  3R4K A;  3HL2 A;  2GBY A;  2XRN A;  2HOE A;  2HYJ A;  2F5C A;  1YX3 A;  3TBI A;  2VOO A;  1J5Y A;  1LEA A;  2A68 F;  3I64 A;  1QGP A;  5LRS A;  4S05 A;  1G3W A;  2DMU A;  3RTR A;  2R0Q C;  2EIM H;  3A0H C;  4XKB A;  5E3L A;  2EFQ A;  2F6C A;  4PSW A;  2KPM A;  4XKW A;  5D5V B;  3Q5F A;  1TL8 A;  2X1C A;  4A3D J;  1OCZ H;  1XX5 A;  2MH9 A;  2YSR A;  3EET A;  4FQG A;  1TNT A;  3BOQ A;  1WGX A;  3TP3 A;  4MIM A;  2E19 A;  2Q2E A;  1X1C A;  1P4W A;  4IXA A;  4DZJ A;  1ZR4 A;  3ERM A;  4E7I A;  5D6F A;  2KIU A;  4NUB A;  5F64 A;  3W6K B;  3VFZ A;  2QA4 I;  1IDZ A;  4E7Z A;  3HUG A;  1PVE A;  2I5U A;  3ZQG A;  2KZG A;  1SD4 A;  3F6O A;  4LLG F;  2VKV A;  5CVV A;  3GTK J;  1VQN I;  3CDH A;  1HKQ A;  1A5J A;  4HF1 A;  1F1Z A;  1XGM A;  2IS4 A;  1S7A A;  1LQ1 A;  4XNF A;  4M9X A;  4J19 A;  3TDU C;  1XS9 A;  2MC4 A;  3QAH A;  2DYS H;  2BGC A;  2E1M C;  1BIA A;  5GTH C;  3W6V A;  5FKM A;  1T56 A;  4NC7 A;  5GTI C;  3JRB A;  3M8J A;  3F8N A;  3MFK A;  2E1O A;  3TW6 A;  4V2F A;  1QVT A;  4C30 A;  1B6A A;  5K7F A;  3S1R J;  4D5F A;  2XAG A;  1CGP A;  5E8G A;  4BKX A;  3WTZ A;  4UV8 A;  2V6C A;  4BQQ A;  1TQI A;  1C0W A;  2HOA A;  1A31 A;  2VJJ A;  4IRI A;  1T33 A;  2CUJ A;  1Y1W J;  2H1L A;  4WK8 F;  3FBI B;  2EFN A;  4WCG A;  3GO5 A;  1ZH5 A;  3ASO H;  5IT9 Z;  1IV8 A;  3HSF A;  3OIP A;  1XDU A;  4AD9 A;  4BU2 A;  5LD2 C;  3S93 A;  4OWR B;  3ZXS A;  2CGP A;  2HTS A;  3G1M A;  4TV7 A;  2NXN B;  4Y33 A;  3JRI A;  2LOO A;  3GZ6 A;  3OYJ A;  2Z1D A;  2DW4 A;  3PNT A;  4F91 B;  3L2C A;  1EH8 A;  3WTY C;  1ZKG A;  1ZG3 A;  2FNP A;  4YRV A;  1ETY A;  4MQV A;  3SEZ A;  3IWZ A;  3HHH A;  1FSH A;  2KZV A;  2VBY A;  2WA0 A;  5K5O A;  4M3G A;  2V1N A;  2F4O B;  4Q47 A;  3SHF A;  3OYN A;  4IHS A;  5HS8 A;  4MTD A;  2RV8 A;  3GUD A;  3O8G A;  3CLQ A;  2E34 A;  2P81 A;  1FMV A;  5B66 C;  1YW8 A;  2K3P A;  1U5T A;  3PIP F;  2RRE A;  3FMR A;  2ID6 A;  2G9W A;  4LK0 F;  2KJB A;  2QKM B;  1DU6 A;  4V19 K;  2J5P A;  2R7T A;  2VI6 A;  3F21 A;  3TQN A;  4E7K A;  3SDG A;  4ZC3 A;  5FLX K;  2QSG X;  2QEX I;  4CO8 A;  5ILU A;  2XRO A;  5DUI A;  1JUM A;  1P9Q C;  2I8D A;  4B8X A;  2MG4 A;  1K78 B;  1U5T C;  1XMX A;  4BL0 B;  4I7H A;  3A2K A;  5KAI C;  1WVR A;  3WHB A;  3E6B A;  3G2B A;  4IEJ A;  1XD7 A;  1XCB A;  3BJ6 A;  3DKW A;  3EUH A;  1PP8 F;  4IOA F;  3CP2 A;  2EFP A;  5FD5 A;  4XKV A;  1FY7 A;  1TWH J;  1KU7 A;  1WCM J;  1HLV A;  2PMZ A;  4PCQ A;  2V26 A;  1DP3 A;  3A1Y A;  1ZQ3 P;  4UVB A;  2GAU A;  4ZDL A;  2WAQ N;  5L3E A;  1Z1D A;  2Z9O A;  2XHK A;  4D7M A;  1ETX A;  2DJI A;  2BZT A;  2LH9 A;  4AVZ A;  1D8J A;  2MD5 A;  2XF5 A;  2MW8 A;  1D0X A;  3EQL F;  3J81 Z;  5M3M J;  5CYV A;  4LK1 F;  3W2A A;  3I55 I;  2CQK A;  3LSM A;  2L0K A;  3L7W A;  4YIR X;  2CYY A;  2HYG D;  2FMY A;  3T8R A;  4G12 A;  5JI6 A;  3S15 J;  4G7H F;  4Y15 A;  4PJM A;  4A3G J;  5F1R A;  2H94 A;  4U87 A;  2DK8 A;  2OV7 A;  3J7A Y;  2EIK H;  4OIO F;  1A04 A;  3OSG A;  4B43 A;  2Z5U A;  4KJZ A;  4ENM A;  1O57 A;  4JP0 A;  1JTX A;  2RC4 A;  2NNN A;  5F0C A;  3H1C A;  2M0M A;  2DPD A;  1V5E A;  1YLF A;  3MCZ A;  1DDN A;  1Y0U A;  1B1B A;  5B3S H;  4F93 B;  1AU7 A;  2R7F A;  3R6S A;  1G3Y A;  2O0Y A;  1KQ9 A;  4N4O B;  3BPX A;  3ZMT A;  2W24 A;  2ZXJ A;  3LSI A;  3LA3 A;  1FLI A;  3M8F A;  2VKH A;  4ZYH A;  1OPC A;  3H3Z A;  2KP6 A;  4HAM A;  1S72 I;  3BLY A;  2DA7 A;  2HQA A;  4PZJ A;  1P7I A;  2O5R A;  1H0M A;  1MDM B;  2FQ4 A;  4ZYG A;  3EDP A;  5DD4 A;  4XLA A;  4YII A;  4GRI A;  4NHJ A;  4NC8 A;  2NOG A;  2E60 A;  2EFW A;  4RLF A;  2NNY A;  2XC7 A;  4R1H A;  1SD6 A;  5M5X J;  2D5V A;  1GV2 A;  1HCR A;  4O5V A;  4FX4 A;  2IRF G;  2L7F P;  3KZY A;  1MKM A;  1LKX A;  3B6A A;  3GTQ J;  3HPG A;  2AS5 F;  3OYE A;  3I71 A;  2DI3 A;  1AKH B;  1IN5 A;  3OL4 A;  4CYC B;  3GTM J;  3RSN A;  2Q8K A;  3GFI A;  1R5I D;  3BP8 A;  5B1A H;  5H20 A;  3HSR A;  3O3K A;  1MND A;  3SZP A;  2LDU A;  1NG7 A;  3CUO A;  3AKZ A;  5C4J J;  3OR1 C;  3JRG A;  3DEU A;  4RM3 A;  4ESB A;  2M5W A;  5IOZ A;  4MGR A;  2HXI A;  4E7J A;  1ITY A;  2R5Z A;  3MQ0 A;  5FFX A;  3G6E I;  1IO2 A;  4I76 A;  1OR7 C;  1WJE A;  2GZW A;  1YX5 A;  1ZRF A;  1OJL A;  3K69 A;  1Z91 A;  4ESF A;  1EJ9 A;  5FKN A;  1BL0 A;  3QP5 A;  2VN2 A;  3FM5 A;  2FOK A;  3BR6 A;  3HGY A;  5DDG A;  2XAH A;  3H9Q A;  2A5W A;  1L0O C;  1U8R A;  2OCE A;  3DPT A;  3BZK A;  3T1B A;  1VFC A;  2KHM A;  2BHY A;  3OIO A;  4LGW A;  4E70 A;  1ZLK A;  1GVD A;  3RYP A;  1IC8 A;  2CQX A;  1E3H A;  2KMU A;  2VAS A;  4OU0 A;  1FYL A;  2EA4 A;  2IJL A;  1ZEL A;  5GPC A;  1XC5 A;  4LG0 A;  1IN8 A;  3EUK L;  1KON A;  1KQ0 A;  2BXZ A;  2CH0 A;  2DA1 A;  1YIT I;  3I4N J;  2CFX A;  1JJ6 C;  2M34 A;  2VC0 A;  1AOY A;  2MSY A;  5H6R A;  1QZZ A;  3CCQ I;  4H0E A;  1XSV A;  1LPQ A;  2GXB A;  2VE8 A;  3I3L A;  3QQA A;  1SFE A;  2LSO A;  3BG9 A;  5E3M A;  3P7N A;  2J5O A;  3MKW B;  4IHY A;  4XSZ F;  3F8F A;  2KIM A;  3F0C A;  4W97 A;  3JRD A;  1IUF A;  3CJQ B;  3S3M A;  1OLT A;  4Q5S F;  4HOB A;  3V42 A;  1HXD A;  1R6R A;  1F5T A;  3H36 A;  3JRH A;  1AHD P;  1FYK A;  2MLG A;  3DTK A;  4JX4 A;  5DCM A;  2YR2 A;  4D1Q A;  2GIV A;  4CH7 A;  3H0D A;  2UXX A;  2MFZ A;  3QWL A;  1JE8 A;  4Z2Y A;  4XLH A;  2JN6 A;  1YOV B;  3HJE A;  3I4P A;  1GUU A;  4A2U A;  1PDN C;  1XDS A;  2JJ7 A;  1QZE A;  3K4C A;  5FD6 A;  3SFZ A;  4PK4 A;  3DTE A;  3F9K A;  2BYV E;  3DV8 A;  1JGS A;  3V8J A;  4GYG A;  2CUE A;  1W7P A;  2DXI A;  2YX4 A;  3I59 A;  3OOP A;  3QPH A;  3CUQ C;  3PL8 A;  5FKK A;  1IAW A;  4KIG A;  3ZGK A;  1OCO H;  1ULY A;  2FML A;  4DOZ A;  3BZ6 A;  1J0R A;  2OAZ A;  3KP4 A;  3NAR A;  2JK3 A;  1KGS A;  4BY7 J;  4M9Z A;  2DT7 B;  2NVU B;  2HZT A;  2DOF A;  4HYE A;  3U1K A;  3W2W A;  3DTI A;  1V5F A;  2MC3 A;  3I59 B;  1WI3 A;  3FIS A;  4XLE A;  1T95 A;  2FXA A;  1MSF C;  3E3V A;  3JTH A;  3PSI A;  1S8N A;  4XLC A;  4HNU A;  4AVP A;  2V1U A;  5EDN A;  3JCU C;  1BA5 A;  3PO3 J;  2CUZ A;  2NVY J;  3DLA A;  2XSJ C;  5HS9 A;  5TIS C;  2H8W A;  1GLN A;  3F6V A;  5D5W B;  3GBG A;  3GEZ A;  4A3I J;  1B72 A;  4ZDO A;  2WAF A;  5CVJ A;  3I5U A;  5IY5 H;  2JSC A;  1R1T A;  1FBQ A;  1LVA A;  1O7F A;  2ZME B;  1ZGW A;  1KQ8 A;  5HDN A;  4MFD A;  1USS A;  5ICG A;  1WSU A;  1APL C;  4KN4 X;  3FXO A;  2QUF A;  3RIR A;  2X85 A;  3CCR I;  3LSR A;  3L09 A;  5JR3 A;  2R7Z J;  1VQ7 I;  2X4H A;  4ZH4 F;  4M3F A;  1BOB A;  5FGM A;  2R7R A;  5CPR B;  1MBF A;  4LLL A;  2Q1Z B;  4NB5 A;  2L9N A;  2DQR A;  1TWG J;  1EH7 A;  5F04 A;  3GCM A;  1HKT A;  1OCC H;  5F1J A;  1R49 A;  3TO7 A;  3CC2 I;  4H4K C;  4KT5 C;  3JRA A;  3NAU A;  1ZRE A;  1I5Z A;  3AG4 H;  4XQF A;  2FU4 A;  2EB7 A;  2XB0 X;  2EWN A;  1U8B A;  2ZME A;  4A12 A;  3WG9 A;  4I98 B;  5EEA A;  4XN3 A;  1E2X A;  4GCV A;  4AWX B;  3CCV I;  4A69 C;  4C3H J;  4GDF A;  2G0E A;  5AIQ A;  4QTR A;  2COB A;  4L0Y B;  3FKI J;  3G4S I;  2GM4 A;  2D45 A;  3L2U A;  1ETW A;  3MVP A;  2VB6 A;  2DA4 A;  4CUG A;  2XPW A;  1BIB A;  2HQ5 A;  4I0A A;  3TGN A;  3CD6 I;  1Y8Q B;  5KHD A;  5CQG A;  3KP6 A;  3K10 A;  1BOA A;  3JSP A;  4F3Q A;  1X2M A;  2O61 A;  1XGN A;  4Y13 A;  4AC0 A;  3MN2 A;  4WXD A;  2FEZ A;  2DA6 A;  2VPL A;  2RAE A;  4PJN A;  2OA4 A;  4D9J A;  2R7V A;  1K79 A;  3ZP5 A;  1UFM A;  3GTJ J;  3BR3 A;  3GYH X;  1OCT C;  3W3C A;  1YTY A;  2M45 A;  4RLQ A;  4U0Y A;  5D8L B;  1UJ8 A;  3WOD F;  5IP9 J;  1G6N A;  3FXK A;  2K02 A;  2EQR A;  2MYS A;  2V9K A;  4KIF A;  3K2Z A;  2LNB A;  1O7L A;  3I58 A;  1JUS A;  1KU9 A;  4A3C J;  4IVN A;  2FD5 A;  2WAE A;  4HG2 A;  4XOT A;  4XLP F;  2N8G A;  2M1B A;  3SZG A;  4XIC A;  5F0H A;  3IWF A;  4ZYA A;  1J75 A;  2LY2 A;  2X6Y A;  3QU6 A;  2FJ1 A;  3M1E A;  4MEX F;  2W00 A;  4QLC U;  2H6C A;  4CYD A;  4IZZ A;  2O8X A;  1LB2 A;  2Z16 A;  5DYM A;  2KRC A;  3IH3 A;  4CZZ A;  2HOS A;  1TQM A;  1BN5 A;  4U88 A;  3MD2 A;  2W48 A;  3FMQ A;  5DEQ A;  2FNA A;  1UHM A;  4HW0 A;  3FIW A;  2MLK A;  3UKG A;  1PP7 U;  3DKX A;  5HLT A;  2K85 A;  2WAD A;  2V79 A;  1XGO A;  2NS7 A;  3S14 J;  4JK1 X;  1SC7 A;  4UXN A;  2HVS A;  2QKL B;  3K4B A;  2JWT A;  1PUE E;  4UNO A;  3KX2 A;  3FXL A;  1ZRC A;  3S17 J;  3K4J A;  2KDO A;  2ESN A;  2EZI A;  4X0G A;  2NAZ A;  3IH4 A;  1HW2 A;  1O3R A;  2EBI A;  1FP1 D;  4A0Z A;  3RKY A;  2OD5 A;  5E3N A;  4IQJ A;  5E17 F;  5FO5 A;  3VSL A;  1LNW A;  3AG1 H;  5IPA A;  4HPQ A;  3KEO A;  3DFG A;  2FUG 2;  2EZK A;  1OIS A;  2JUC A;  2PBI A;  2QYO A;  3DBH B;  1A6I A;  3I56 I;  3HOV J;  4I01 A;  2LYC A;  2DFI A;  5CLS A;  1GVJ A;  2RGV A;  3HEF A;  2X48 A;  4YEJ A;  1EH6 A;  3RKQ A;  2M30 A;  1FZP B;  5E79 C;  1NTC A;  1WJD A;  2KT0 A;  3MWM A;  3BR0 A;  2LFB A;  3OMY A;  4NBQ A;  3DPU A;  3LAJ A;  4RGR A;  1QPI A;  5K7H A;  1IV6 A;  2JT1 A;  1WH7 A;  3RKW A;  2AXL A;  1R71 A;  2NVX J;  2ETH A;  2ELH A;  4U0W A;  2Y75 A;  5B1B H;  1D1A A;  1WQ2 A;  3CO7 C;  4XSX F;  2AQE A;  1ZG5 A;  1FOK A;  2L7M P;  1I3A A;  1YS6 A;  5F6F A;  1I3Q J;  3VB2 A;  4HQE A;  4AM3 A;  2R7S A;  2BXY A;  5GAD J;  2W4S A;  1B8I A;  5LLQ A;  1OYY A;  3QOE A;  4CSW A;  3F3X A;  1ZG1 A;  2CRG A;  4NQW B;  2BE5 F;  2KIS A;  3HTS B;  1ZYR F;  4IHX A;  3CES A;  5LFA A;  3L00 A;  2IEK A;  1SVM A;  2BVM A;  1Z77 A;  2XUB A;  1QPM A;  2DTR A;  2HU9 A;  3DU5 A;  2IGN A;  3H3U A;  1OQY A;  3WHC A;  3CMA I;  4ENN A;  1M1E B;  4RDU A;  3FDY A;  2K9L A;  2DA3 A;  2XPV A;  3ML6 A;  2IGM A;  3AL0 B;  2ZXH A;  2M4K A;  5HLI A;  1JT6 A;  5E1W A;  4CXF A;  2ZCW A;  4NQW A;  1TLH B;  2BY1 A;  2LRE A;  3TW7 A;  1R5G A;  2W25 A;  1IJW C;  4G7O F;  1K61 A;  3AFH A;  3I0T A;  3OOU A;  1WH5 A;  3QYB A;  1WJF A;  3O2P E;  1FNN A;  3DEE A;  3ASN H;  1W36 D;  3L2R A;  4P5O A;  2QM3 A;  3TL4 X;  2VJI A;  1WJA A;  3S2H J;  2K9Q A;  5L3B A;  2R7O A;  3LMM A;  1YIJ I;  1MH4 A;  2G7H A;  2ZC2 A;  1DU0 A;  2P6S A;  1PJR A;  4DYR A;  1H9T A;  3ZQL A;  4ESJ A;  2BY2 A;  1MBG A;  3HSE A;  5DCF A;  4ASN A;  5BPI A;  2VXZ A;  2DAO A;  4PDK A;  2H27 A;  2MH2 A;  1R7J A;  3ZCO A; 
#chains in the Genus database with same CATH homology
 3AG4 H;  5IY5 H;  5B3S H;  1OCR H;  1V55 H;  2DYS H;  3ASO H;  5B1B H;  3ASN H;  3X2Q H;  2EIN H;  2EIM H;  3ABM H;  2EIJ H;  2ZXW H;  3AG3 H;  3ABK H;  2OCC H;  3AG2 H;  2EIK H;  3ABL H;  2DYR H;  1OCZ H;  1OCO H;  1OCC H;  1V54 H;  2Y69 H;  5B1A H;  3AG1 H;  2EIL H;  3WG7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...