1V55H

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1v55H00
3ABMH 2EIJH 2OCCH 3ASNH 5IY5H 2EIMH 2EINH 2DYSH 1OCRH 3AG4H 3ASOH 2DYRH 3ABKH 5B3SH 1OCOH 2EILH 2EIKH 3AG2H 3AG3H 2ZXWH 3ABLH 1OCCH 1V54H 5B1AH 5B1BH 1V55H 3X2QH 1OCZH 3AG1H 3WG7H 2Y69H
chains in the Genus database with same CATH superfamily
4MEXF 1R00A 3J7ZI 1VQOI 5GPCA 4MFEA 3BROA 2YU3A 3QQAA 1S7EA 5JFRA 2NS7A 2XAUA 4OWRB 3L09A 4IX7A 1IN4A 2DYSH 5IP6A 2LR8A 1FJLA 3G1MA 3DPUA 2EB7A 1ZH5A 1MMGA 5FD5A 5J40A 2R7XA 4KFCA 1R49A 1J5YA 2F4IA 3E97A 4NQWA 1MDMB 1ZGWA 2JA2A 2ELJA 3JREA 4XM3A 3FXUA 2LSOA 2DQLA 4PFOA 4KISA 1SC7A 4W1UA 3L2QA 4F3QA 2K3FA 2BE5F 2CUFA 5F64A 2BY3A 5HNHA 1TC3C 1FSHA 1PUFA 3GX4X 3WTSC 4CCLA 1HC8A 3HB9A 2E71A 1D8JA 3PUBA 1KQ0A 5EG0A 3PFIA 1YOVB 1VQMI 3H5RA 4N9HA 1TBXA 4M6YA 4OIOF 1RIOH 1X2NA 1FNNA 4Y13A 1TWAJ 3H36A 3C2BA 1JJ6C 4E7KA 3S32A 2DDBA 4Y4RA 2ESNA 3CJTB 1GV5A 2ZMEA 1UMQA 3FMRA 4NBQA 4XLNF 3CUQC 4LG0A 5CLSA 2M7AA 2VC0A 4A3KJ 3G1LA 2CYYA 4M3FA 3RPQA 2CFXA 3BPXA 2XROA 4E7LA 3I64A 3L7WA 1IXRC 3K0LA 2GM4A 4OIPF 4XNFA 3L00A 1Z9CA 4O6JA 4FX0A 2LKPA 1RR7A 2IA0A 3AG3H 4UV8A 1MJ9A 1DPRA 2FBHA 3C2HA 3GF2A 1SMYF 3QP6A 4I7HA 1UHMA 1QZEA 2QQBA 3VODA 3OS1A 1W7PB 3E5XA 2BY0A 2E35A 2DN0A 2EV6A 3BWGA 2LKSA 4M3EA 1ZGJA 2DMTA 4WXHA 2K5CA 1QQIA 1YO5C 3E6DA 4AC0A 1WSUA 3NAUA 3HTUA 3KX2A 4HQMA 1U6GA 1RI7A 2IEKA 4U87A 1VQLI 5J3LA 1A5JA 1L0OC 1OPCA 5FGMA 1GT0C 1X1BA 1ETWA 1OMIA 2RQQA 2CGPA 5BNGA 2O8KA 2VXZA 5DUIA 1EH6A 2BYVE 3FK7A 2NXNB 3KLNA 4UVCA 5M3FJ 2P4WA 3G3ZA 1AU7A 3ABMH 1IC8A 2DA4A 3LSTA 4XRSA 1E0EA 5ILUA 5EEGA 2R7VA 2WA0A 1S9HA 2HVRA 3HGYA 2A05A 2ZCWA 3FXLA 4XLCA 1K6OA 4EQQA 5FO5A 1DGWY 2R7UA 1YS7A 4F92B 2EH3A 4L0ZB 5GAEJ 4OINF 1PP7U 1UG2A 3A03A 4KA4A 1U3EM 2VN2A 3GTQJ 3E0JB 5M5WJ 4HAMA 2R7WA 4KYWA 1RETA 1BC7C 1TNSA 1XMAA 2DJNA 3MKZA 2L9NA 1ETQA 1UHWA 1IZ1A 2DT7B 4M3BA 5C4XJ 4KIBA 5CVRA 4XSXF 3O8HA 4DYQA 5F1RA 1UFMA 2FNPA 3IP4B 5C44J 2XGEA 3EYYA 2M45A 2YPRA 3RKYA 3C18A 3H5AA 5J8CA 4XKVA 2IGMA 2LMDA 4D5CA 3ZMUA 3QWLA 2XUBA 3TW6A 2CUZA 5D8LB 4KDPA 1Y0UA 1ODDA 4RGUA 4I0AA 2MGQA 4MTEA 4ZZDA 2WAQN 2UXNA 2EFWA 1P92A 2RREA 3RYRA 1HSTA 2M8GX 3HRUA 3V8JA 5K5OA 3FZVA 4L9JA 4I01A 2IGKA 4NB5A 2Y0MA 5FLXK 3F23A 3QOPA 4RAFA 3W2VA 4ANJA 5LGNA 3BPVA 1LDJA 2EIKH 1VF9A 5FKLA 3ZOBA 4PSWA 5DM7F 1DP7P 3H35A 4CXFA 1S5LC 4A69C 2EWNA 2GA1A 4GDFA 5ILSA 4HW0A 2EK5A 2XASA 1JUPA 1QZYA 3REOA 4UXNA 5F6FA 3HOUJ 4BHCA 3J7AY 3EUAA 1ZG5A 2F5CA 2EFQA 5IYDJ 2PEXA 1V4RA 2X4HA 3IKVA 3SZPA 2F4OB 2CG4A 3GW2A 4CUGA 1XN7A 2BV6A 1ETOA 4N4NB 2R5ZA 2VONA 2IXSA 3LSMA 3JRBA 1OCOH 2O5RA 1J0RA 3DF8A 2R7SA 4Y15A 3GBGA 2X85A 4AWXB 2DA5A 5FKOA 2DT6A 5DUKA 4XORA 1KONA 1KYWA 3JAMZ 3BG6A 1SFUA 3IRQA 1L3LA 2HDDA 2QSGX 3U1KA 3SJMA 5CJ9A 3AL0C 3F6VA 3D1NI 2KRFA 4G9YA 1FIAA 3HPGA 3QYEA 5M3MJ 1D3YA 3KYDB 5J8FA 1R9TJ 5K5RA 1ETVA 3CDHA 4IHYA 3K7AJ 2GWRA 2NAZA 3HRMA 3J7AO 2Y75A 4OU0A 4BEHB 4I6ZA 5B3SH 1MBFA 4YG2F 1FWZA 3J81K 1HW1A 3WU1B 1SVMA 1H9TA 3CCQI 2R7DA 1T08B 3QU3A 2VC1A 4R8HA 5E79C 1QGPA 2Y2ZA 2V1NA 2QF7A 4E7HA 3GLLA 2HGCA 1R36A 4D1QA 4Y33A 2QEXI 1W1WE 4B3AA 4YELA 2LP0A 4F55A 1P9QC 3MAJA 2ME0A 3OL4A 4ITVA 4BQQA 3KP6A 4BHBA 4BGDA 1FMWA 1I50J 4YIIA 3VSKA 1I6HJ 1YJNI 2WAFA 4DQ2A 2BW3B 3K6GA 5DTDA 1FBSA 3L2WA 3ULQB 2DFIA 2VBXA 2XF5A 4CZZA 2WV1A 4HZFA 4G6QA 4BJTA 4I98B 1YE9A 1MZBA 1K6YA 2G9WA 3TL4X 2OA4A 2HDCA 5ILVA 2ELHA 2L7FP 2LBFB 1UB9A 3WTZA 1VQ4I 2BY2A 3DTIA 4OMZA 3P9IA 2L7KA 2W7NA 2E7XA 3Q3SA 3ESWB 1JKRC 2GLOA 1WZ2A 3PO3J 3GTOJ 1G3SA 2HQRA 1OCZH 1AKHB 1FBQA 3PNYA 4IJAA 1LDDA 2XPVA 3HEFA 3IRRA 2P5VA 1MDMA 2RNGA 1X3UA 5FKKA 1SD7A 3BG5A 3FKJA 3FF5A 4L5IA 2L4AA 4Q47A 2Y48A 3DTEA 1REPC 1YW9A 1FYLA 3ONQA 1G8XA 2OQGA 3CMYA 4CCNA 2DJIA 2CUEA 4A3MJ 5LGUA 2JZYA 4R1HA 4A6EA 1NHAA 5EG0B 2M2EA 3IWFA 3F8MA 5C4JJ 1TT5B 2ZXJA 4M9SA 4YEJA 4DGWB 3F22A 1R5HA 1OISA 3FK6A 1WI9A 3RQ4A 5EYRA 2LDUA 2GA2A 1SFKA 4S05A 2QYOA 3ERED 2UWMA 4BKXA 5EEAA 3FISA 3KZZA 2OF7A 4UNOA 4MLOA 4GXOA 3CC4I 4RB3C 3OV8A 4XN3A 3RPUD 2RVCA 4OAYA 3I4MJ 1IO2A 4ZZLA 1JHHA 2LLKA 1IGNA 5DCFA 3D5SC 2R7FA 4L5JA 5L3CA 1S72I 2VUMJ 3M1CA 3R61A 4RGSA 3VYTB 5JLXA 1FSEA 4IQ4A 3F6OA 3OS2A 2QVOA 3P9CA 3D0SA 2VBYA 2CJJA 4HBLA 2CH0A 1U5TB 5FROA 1CQTA 1D0YA 3BR3A 2HVSA 3H5NA 2IA2A 4M9XA 4ZYHA 2L9VA 2L9RA 2Z2SB 1SFXA 2FQ4A 3L2VA 2DAOA 3V7CA 3H9JA 1KYZA 1YX5A 2V1DA 3F9KA 4HQEA 3S2HJ 1FC3A 3BY6A 3DU5A 2K02A 2JJ7A 4PJJA 4CCOA 5D8KB 3A01A 4FTHA 2ICWG 3E6MA 3FXJA 4B43A 4DJAA 3H0GJ 5E3OA 3JRIA 1WHUA 5CQGA 3G73A 1XPXA 2DBBA 4B44A 2OTJI 4XRFA 1YRNA 2FX0A 5DEQA 4HF0A 3J80K 2LG4A 4G6DA 2ZBKA 2QBYA 3RKWA 2R93J 3FXKA 2FU4A 4EJOA 4JX6A 3K4JA 2I5UA 1I5ZA 3U1DA 1QHGA 1DU0A 3HDDA 2HKOA 3LFKA 1V5GA 3PO2J 1N77A 1HQCA 3W6VA 4IEJA 2MLKA 1WJFA 3HOVJ 3JW4A 4B1RA 2FD5A 3FM5A 1JGGA 1RRJA 2RQPA 2BXYA 2KIQA 2QQ9A 4RAYA 1NH3A 1BC8C 5D5VB 4W97A 4EV0A 3CUQB 3GFJA 3IH4A 4HLXA 5DD4A 3CLOA 2MG4A 3HXLA 1FLIA 2NNNA 3DEWA 3FX3A 3MMYB 4FHTA 3J80Z 2VQCA 3M07A 2QUFA 4DIQA 3K4CA 2XC7A 4YRVA 1M1EB 4ABZA 4LG0B 3OMYA 2N8GA 4A6DA 4A3CJ 1H8AC 1SVOA 3HPHA 1UHSA 2Q2EA 3GUDA 2FQ3A 1R71A 3RIRA 3R0JA 3CCLI 2P5KA 2JA6J 2NVQJ 2NS8A 1YQAA 2LF7A 2VQLA 4MFDA 1TWGJ 1YYVA 5E20A 2EIMH 5HLHA 4LIUA 5FFZA 4HX4A 1IV6A 1T2KA 1IDZA 1ZQ3P 2G0EA 3GWZA 2Z99A 5BPIA 3DQVC 4A5MA 1ZHFA 5IP9J 2GQQA 1XB4A 4BJ6C 3N05A 4HDVA 3HHGA 2OBPA 2W84A 3I59B 4CDGA 1YW7A 2DCEA 3CC2I 4BQNA 1ACIA 4QIWN 1SD4A 3TO7A 5DD8A 3M8FA 4NC6A 3BTJA 4G12A 1W5TA 1OKRA 2H27A 2VOPA 2IA1A 1BI1A 1VNDA 1W5CC 4P5OA 4RDUA 4X6AJ 2OJED 1BIBA 2ZB9A 2QZ8A 1D8KA 5ICFA 2EA4A 2F4MB 4LLNA 3ZQIA 4DBRA 3CF2A 4AIJA 2VIXA 4OMYA 3WGIA 1XGOA 1I39A 3I0TA 2COMA 2YX7A 3MEXA 2IGNA 2R0QC 4HNVA 5GAHJ 2XKOA 4I0BA 1IUYA 1YIOA 5K7ZA 4L0YB 3BJOA 2P6SA 3DPTA 4PZJA 3MKWB 4A5NA 1QVTA 1J75A 2Y0SN 5KAIC 4EEFG 2RN7A 4IXAA 1ZTRA 2QSFX 5TJJA 3RYPA 4RB2C 4Y17A 4ZTJA 1C0WA 2R7OA 3MKLA 1PVEA 3ZP5A 5LHIA 1DUXC 3GTMJ 5JHUA 1DGRM 5KVRA 4EM1A 4HG2A 4I02A 5C3EJ 4FASD 2OC6A 3KP7A 4KUMA 1OCRH 2AS5F 1WH5A 5IT9Z 4MQ9F 3LNQA 2FMLA 2VE9A 3IWZA 4PJ0C 4FX4A 1R7JA 2Z1DA 1WJBA 1NTCA 2B9SA 3OS0A 1NG7A 5IYCJ 4RM2A 3CCYA 1BR2A 3S8PA 3HUGB 1VQ9I 5B1AH 4MGRA 2JA7J 4BEHA 5A2QK 1LNWA 4RM3A 4S04A 4EJVA 1QPMA 1T33A 2EIJH 1RPWA 3O8GA 3HOTA 4NQWB 3KEYA 1XMXA 3PIPF 3MCZA 2FNAA 3HZJA 3EUHA 1S7AA 1F43A 1FT9A 1WCMJ 1LFUP 2Q8KA 4CH7A 2L0KA 3FMSA 3Q0WA 4HPQA 1D5YA 2X6OA 3S1RJ 2KIFA 3UR3C 2JUGA 1R5ID 1B9NA 3LSGA 4ZTFA 4UUSB 3QRFF 2W85A 3WTYC 1UJ8A 2R3SA 3JRAA 1O3RA 1CF7A 2B0LA 2NVTJ 3OY9A 1VQPI 1P6RA 1HCRA 1MBJA 1GXPA 5IT3A 4PJNA 3ZPLA 4DNCA 3CESA 3QAHA 5F1JA 4AYBA 2L5QA 1AOYA 2W24A 3FHZA 3LWFA 4NDLA 1Z77A 3MD2A 2VB6A 2ZMEB 1WJCA 3GYHX 2D45A 3BG3A 1QHHD 4ZYGA 3DPLC 2BY1A 4B8XA 1K78B 1FZPB 2BXZA 3EPZA 4JX5A 2GXBA 3M1EA 2ZO4A 3GFIA 4FCYA 1E3OC 4GRIA 4BE2A 2ZXHA 2STWA 2X6YA 3HSFA 1GUUA 4GO1A 3PIOF 1H88C 2EQRA 2R92J 1R22A 3H3ZA 2K9SA 4XONA 1BI2A 3E5UA 1TQPA 2O7OA 2VT3A 1Z0XA 2K40A 2MABA 2X6XA 5F0HA 2CV2A 2WAQA 2KJBA 5J1RA 3RDIA 4IRGA 2DA7A 2K4JA 2E5NA 3ML6A 1F1ZA 4MEYF 3WG9A 2IT0A 1I1SA 2V4JC 2DDAA 4ZC3A 1ZKGA 3CTAA 5BPDA 2FE3A 4NC7A 1VI0A 1SAUA 1ONVA 2VE8A 4ZH4F 5HODA 2F5FA 1PP8F 2OCCH 2ACJA 2K86A 2HKXA 3KP4A 4A0ZA 1Z91A 2CWEA 2MH9A 4XSZF 1F36A 4I09A 2XIGA 2QENA 3M7GA 5DS9A 2VODA 2RV8A 5LLQA 2STTA 3RKXA 4AM3A 2EZHA 1JT0A 3GTJJ 1MMAA 1EV7A 1ZAOA 1F4KA 2DOEA 4HNTA 3S2DJ 3DP7A 2X51A 1IRXA 4LD5A 1EKEA 4F52A 3GCMA 2GBYA 1TL8A 4XMYA 2FRHA 3ZXSA 2A6HF 4PK4A 1K83J 1RNLA 3BR1A 4C2UA 2A5YB 2PJPA 4B48A 4Q5SF 1BM9A 2H8WA 3K1PA 4RGXA 2MC3A 2UUZA 2KPMA 3TEDA 3LOCA 5J47A 1AA7A 2IAIA 4WCGA 3GXOA 4RAZA 1MIJA 1FMVA 2XGCA 4C2TA 3CMAI 3PNVA 5AONA 2HU9A 3FBIB 3I54A 4XQFA 4I76A 3WTWC 4C3IJ 4BUPA 2W48A 5ICEA 3GFMA 4YIFA 1O3QA 2V1UA 2UV1A 3A0BC 1VTNC 2RDPA 3ASNH 1Z1DA 1OFCX 5FFXA 1A31A 1EJ9A 2WY8Q 1Z67A 2EFPA 2R7ZJ 3H0DA 1MH3A 1MBHA 1FPQA 3ZR8X 5BMZA 1YRNB 2V9KA 1KQ8A 2JVGA 3ABTA 1PJRA 3V42A 3I4NJ 3TDZC 2IS6A 1FOWA 4O3MA 5E17F 4M3GA 3RZDJ 2W1OA 3A2KA 2MC4A 3OSFA 4M6XA 3SXYA 2LOOA 4IHXA 1B59A 4XK4A 5ED4A 3BLYA 4UB8C 3IH3A 5LD2C 1UCRA 4UV9A 3OWTA 2E34A 1T6SA 3BR5A 1XSXA 2WWYA 5L3GA 1MW7A 4EJUA 2HQ5A 1SFEA 1V5FA 3GO5A 1X3ZB 3BCBA 2NYXA 4FE7A 2DO7A 1BL0A 2HS5A 2H1LA 3DBRB 4ZDOA 5H6QA 3T8RA 1FTTA 1HXDA 4XR6A 1ZYRF 1ZLJA 2LREA 3OYEA 2L54A 2KL4A 2ZC2A 4DZPA 1U8BA 2OD5A 3WGGA 1WVRA 2CS3A 1USTA 1VQ7I 4JQFA 4EJTA 4PGGA 2JSCA 3A4CA 1FOKA 4Z2YA 2DA2A 1BI0A 3QU6A 2HYGD 4RA2A 3ERMA 2DA1A 4KMUX 1T95A 5A2QZ 2C6YA 4Q48A 4P9FA 1EH8A 3KEQA 1H89C 1RKWA 2E36A 4XRSG 1KQ9A 3JRDA 3R0AA 4ESJA 3K4MA 2FEZA 4H4KC 4KICA 1YW8A 2VBZA 3QOEA 4BY7J 4AUXA 4C9YA 3PFYA 5J1YA 3S17J 1U5TA 2VBWA 5K7HA 2DXIA 3M4OJ 2XPUA 3WU2C 1D0XA 5IP7J 2GXGA 1GVDA 3KCCA 1NK3P 1ENHA 1T56A 2V6EA 2PMUA 1KU9A 1Z3YA 2KRHA 4A3GJ 4V2FA 1QVUA 1V3FA 2VOOA 3FHNA 1T8IA 2KQRA 3L9FA 3A01B 3OYHA 3A0HC 3CMEI 2DW4A 1F9NA 2OAZA 2FMYA 4FQGA 3SQNA 2JPCA 5DM6F 5JHFA 1R1VA 4CYCB 2JA8J 4BE1A 3FBNB 1WJEA 1WJAA 5HS9A 1HKQA 2CO5A 1NK2P 3S16J 2O61A 3IV5A 3C3WA 4M73A 1TT0A 5E1WA 4ZYEA 2FJ1A 2ZFWA 3VFZA 3KETA 3R4KA 2WTEA 3HBLA 2KIMA 4AIKA 4AYBN 1RESA 3EUHC 3FM3A 3S1MJ 2JT1A 3OR2C 4B09A 4HF2A 1ERDA 3QPHA 4MIMA 3L2CA 1UG0A 3OYJA 1B4AA 1G59A 2BW3A 3ZN0A 4PSXA 2CMPA 1APLC 1S7OA 3WHCA 2HQAA 1JUSA 2V26A 1Z05A 4BU2A 2LD5A 4KITB 2W00A 1TTYA 3I5UA 2KMUA 3S14J 1FIPA 1X4OA 5E18F 1W0UA 3I55I 1BW6A 2XAGA 4UHTA 1JE8A 5L3EA 1ZRCA 3E1SA 1GLNA 2HR3A 1GVJA 3WODF 3CJRB 2HZTA 3BP8A 4NUBA 2KKOA 4PUSA 5LHHA 4Y3OA 1U2WA 2DOAA 4BQOA 1X3WB 2PN6A 2L7MP 4QWQA 1YFHA 2IW5A 2EV0A 1DP3A 1XC5A 1I3AA 5GADJ 1O57A 2GOMA 4HX7A 4G7HF 2A5WA 2FOKA 2M87A 2K9LA 4V19K 3S1QJ 1KU3A 2EV5A 5D4RA 2F2EA 3GVAA 3BCAA 1HKTA 3H92A 3J7YJ 4RLFA 1PDNC 3HHHA 3RJPA 1YJ9I 2VJ5A 1HBXG 4MHGA 2YR2A 2O8XA 1HW2A 3HRTA 4N0BA 2L02A 1FYMA 4BNCA 1OYYA 4HEA2 2O6GE 3I53A 4BE0A 5HLGA 3FXOA 5ICGA 4LOCA 3CP2A 4HSRA 3SDGA 2L7ZA 2Y9YA 1D1CA 4XICA 1H9GA 3VWBA 3WG7H 2HTSA 3I56I 4F91B 2Y69H 4ZJZA 1K78A 3MFKA 1E17A 1Y6IA 1XGSA 2YSRA 4L9TA 4HOBA 2J5OA 4HRIA 5H6RA 1R4NB 2DTZA 3CCSI 2R5YA 2XF7A 2R7QA 4KJZA 3V8KA 5DCMB 1WWXA 3VYSB 4IOCF 2B7EA 4D9JA 2JWTA 4I2OA 2I8DA 1KA8A 3L2UA 3G71I 2VKEA 2M1BA 1AWCA 3SDBA 2P0WA 3EETA 4J19A 4DW6A 2ME6A 4A3BJ 1Y8RB 1T0FC 1R5GA 1IRZA 2QWWA 1HA8A 3O3KA 1W0TA 1B8IB 4IO9F 1F5TA 1R6RA 3HGGA 1I27A 1POGA 3O2PE 3DCFA 4IQJA 3U9GA 2BHZA 3K4KA 4XOTA 3FXQA 3I4PA 3Q0VA 2ZSHB 2X9DA 3BDDA 4PGHA 2NVXJ 4B47A 1FX7A 2K9MA 3CZ6A 5L3DA 3RSNA 3AAFA 2BVLA 2Q1ZB 3S2WA 3NWSA 1GXQA 1BR4A 2XAHA 2RNJA 2LC2A 4BXFA 4A2UA 3K69A 3TO9A 4XL9A 5L3FA 1TQIA 5F04A 3I9V2 3JTHA 4EGYA 3T5XA 4F93B 3F72A 1T98A 4WX9A 2H94A 2E7WA 4HV6A 5HOOA 1BI3A 1BJZA 2OV7A 5DYMA 4MQVA 4EM0B 3ABUA 3JAMK 2Y0SA 4CCKA 3P5JA 2AQEA 2VI6A 1I6XA 2X0LA 3G6EI 3CUOA 3DTKA 2V6CA 2VJJA 1LEBA 3DBLB 1KZHA 4BH9A 4JP0A 3JCUC 1W7PD 2ID3A 2IJLA 3HKZA 4AU7A 2RC4A 4C3HJ 1SAXA 2GOXB 2CQNA 3D5RC 2PFBA 3DFGA 1RUNA 2LY1A 3K9TA 1YS6A 3KIOA 1E2XA 1IDYA 3PSIA 1XD7A 2EPFA 3G4SI 5BOXA 5KAFC 1ZG1A 3WTTC 1LE8A 1JUMA 1OJLA 2F5EA 1WJ5A 3OL3A 4Y52J 1U9NA 3T0YA 1S8NA 1Y1WJ 2IVMA 2VT2A 2H6CA 2K9NA 1STZA 5EGOB 1TW2A 1QRYA 4HDUA 5D5UB 3WHBA 3H9GA 1VQ8I 4GGGA 2MH2A 1YHQI 3I59A 4BS9A 3RZOJ 2KHMA 3PNTA 5LEKA 3H3UA 2P8TA 4RS8A 1RUOA 1EH7A 4G7ZF 3HOZJ 4G8XA 4KIGA 1G3YA 2PBIA 3DLLF 1P7JA 2FF4A 1A35A 3F21A 2VL8A 4A3EJ 2M30A 1FOXA 3F8FA 4JX4A 1MNEA 1JHFA 2VQHA 1QPIA 3O6BB 5FRMA 3HM5A 3UNGC 4EM2A 1HOMA 4NHJA 4A0YA 2KDOA 3MWMA 5EZHA 4MNUA 3ZMZA 3BZKA 4LLLA 3JRCA 3VEPA 4UY8I 1RZ4A 1IF1A 3ZQ7A 4DYRA 1TNTA 4FE4A 4RGRA 3LSPA 1IXSB 3DXJF 3S3OA 1FOYA 2M8EA 4CSWA 2JTVA 2QKMB 4X0GA 4NNJA 4LB5A 4ENMA 2EFNA 4BAYA 1V54H 5FLMJ 4IHTA 3T8TA 1O3TA 3C1DA 1ON2A 1U5TC 5E1ZB 3ZMSA 2PX9A 2XAJA 2V7FA 1G3TA 1FEXA 3OIPA 1MJBA 5FLXZ 1K4SA 3OYMA 2LRDA 5TGTA 1LJ9A 1Z6TA 2VJ4A 2V9VA 1OCTC 2HOEA 1OQYA 3QPSA 2A6EF 2Q2EB 2YU9J 4UUVA 2CW7A 2ECCA 1BOAA 1FY7A 2LNBA 2YS9A 3KYCB 1VQ6I 3RTRA 4A0XA 1YG2A 1DU6A 5F0FA 3WTUC 1Z7UA 2W82A 3LL7A 1TQMA 3SEQA 3W6JB 4LITA 1MMSA 1HW5A 2CW0F 2DA6A 2XB0X 2VPRA 2XDVA 3CO7C 3HOXJ 3CF5F 2HQNA 1V55H 2LYCA 4G94A 2XB5A 1XG1A 2OZ6A 2ZNZA 3MZHA 3W3CA 3QYBA 4GYGA 4AVZA 1XCVA 1MD0A 5AIPA 2DMNA 3B6AA 4E7JA 1CF7B 4CICA 2JVHA 3P9KA 4U7DA 4HV5A 2IGOA 1W4MA 3K4BA 3Q9VA 1NG6A 3TOBA 2JRTA 1ZARA 4ESBA 4M71A 4KN4X 4N4OB 2F5DA 2K85A 3OYNA 3CCRI 2VJIA 5E1XA 3ELKA 4KT6A 3BZ6A 3I71A 3VPRA 3NRVA 1IN6A 3MZYA 3SZTA 1J09A 2D2WA 4O5VA 3JRHA 2L9SA 2Z16A 3LAJA 3N97A 3K1NA 2TCTA 2E2JJ 2FBKA 1IN7A 1Y8QB 3LMMA 5ERIA 1S3JA 3R6SA 3JRGA 2H1KA 2E1MC 3OR1C 4KIFA 3OYIA 1B72A 3OOUA 3DBHB 2FXAA 3GTKJ 3BQZA 3JSOA 1HLVA 1RKTA 4B4CA 1WFXA 4KNYA 1I1GA 1ZGAA 2CQ7A 2HOSA 4RMNA 2MW8A 5EZGA 1KU2A 4A3FJ 2KJCA 1YJWI 3BT9A 4S0HB 4M6VA 2A68F 2WC2A 2A07F 3LSRA 3CDLA 3CJQB 3PUFA 2X1CA 3PQJA 2W4SA 3WTXC 1K79A 3SFZA 5LGTA 4PFPA 2JSPA 4B3XA 3NQOA 3IHUA 4RLQA 3C7JA 1ZK8A 2ESHA 2LY9A 4M74A 1IRFA 3ZRGA 5HDNA 4QPQA 2HPIA 5D4SA 1FP2A 2Z5UA 2ZXWH 2M0MA 2COBA 2IS1A 1USSA 2AXTC 3G1OA 3GZ5A 4XN0A 2F6CA 1XX5A 4BBRJ 3RPUA 1WQ2A 5K5QA 3S93A 3GZ6A 4ENNA 2E1MB 2WB1A 3FWEA 2HNHA 1R23A 4UUSA 1MBEA 5LRSA 1ZRDA 1GDTA 2P6TA 3W2AA 4BJ5C 4BACA 1JI8A 3ZMVA 3LSJA 3CP8A 1XCBA 4ZDLA 4ENJA 4AIHA 4DBQA 2QKLB 1G2HA 2PMZN 3FMQA 1WJDA 3LQRA 4HLYA 4P1WA 4Z6YA 3AG1H 4PJLA 5HDKA 3CCVI 1TWHJ 1UELB 2WV0A 1Z21A 1BIAA 2BGCA 5HS8A 2JMWA 3BTCA 4TV7A 4KMFA 3HOSA 5J4VA 2M4KA 3GMEA 1SVLA 3I3LA 2YX4A 1YX3A 2HVQA 2KZGA 2WAEA 5KK1A 2DPUA 3DV8A 3K70D 2B63J 3HC7A 3V7SA 3OYAA 5E8IA 1ITYA 2XKPA 1I3QJ 2VKVA 3CMMA 5H2FC 4XLAA 2HZDA 2XV4S 2EBIA 3CO6C 2IPQX 5FRNA 4RAGA 1OCCH 4C2MJ 3CCUI 1T38A 3KFWX 2CV0A 4IHWA 3VOEA 2DA3A 3CC7I 2O03A 1VFCA 1MSFC 2DMPA 4UVAA 3MKYB 2AXLA 1P4AA 2ISYA 2MSYA 3DU6A 4YFNF 3ZMTA 1LEAA 2IS2A 2HPMA 2EINH 1ULYA 5J1UA 2CU7A 5F08A 3QP5A 3IUOA 4U0VA 2ZXIA 4A3DJ 4DZJA 2OZUA 3K1MA 3LSKA 3SYTA 4DYCA 2P7CB 4MTDA 4H0EA 2ISZA 1PUFB 2ADUA 1WI3A 4D0PA 5IOYA 5JVTA 3H3VK 2DODA 3BR6A 3FKIJ 2QGUA 2NS0A 2HWVA 3BJ6A 1P4XA 5GTHC 3KEOA 4GYIA 5E3NA 5HLTA 2VASA 2VQGA 3X2QH 3HSRA 3TP0A 2V9PA 1N25A 5KHDA 2ZMEC 2LVSA 3WE2A 1IN8A 2DI3A 1QO0D 1LVKA 3QPTA 3NEUA 4FT8A 2EFOA 3E3VA 3GTPJ 2Z9OA 2YUSA 1E3HA 1XS9A 5D5WB 4GCVA 4YIRX 2I10A 4PCQA 1LQ1A 2EZLA 3E6CC 4WK8F 1SD5A 3Q5FA 1B9MA 3KLOA 4LJZF 4IF4A 2K3PA 1YLFA 2FBIA 5ICCA 3MZ8A 4A12A 3NWTA 1K7AA 5HVQC 3TO6A 2E60A 2R7TA 1DDNA 2RAEA 5DCMA 5E8GA 3IKTA 3C2GA 1JTXA 4JOMA 1QZZA 1X19A 3ISPA 5F27A 1R58A 1LKXA 3LA7A 3BTIA 1A6IA 3BTLA 4U0YA 1YIJI 3P7NA 1TZLA 1ZR2A 2R4GA 1Y0NA 3PJRA 4F7ZA 1P4WA 4CYDA 2XSDC 3WGHA 1Z3XA 2CQKA 1BW5A 3FDYA 1EF4A 1G6NA 3LSHA 4IHSA 2E1OA 4JK1X 1IRGA 2XGXA 4FETA 3M9AA 5FKNA 4AIDA 2FA5A 2KIUA 3OYKA 2D5VA 4MO7A 4XKCA 1ZG3A 1IXCA 3RCOA 2EZKA 3V8LA 1LFBA 3HJEA 4E7SA 3AFHA 1TWFJ 3HSEA 3KZYA 2PI0A 1OLTA 4LIVA 2WADA 4LLGF 4II2A 3DWLE 4AD9A 1U9OA 2CFOA 2EJRA 1XDSA 3FXRA 2DMUA 2PJRA 1VQKI 4U88A 1VZ0A 3VYRB 2ZJ2A 5FD6A 3T1BA 3ZGKA 2JN6A 3J81Z 1GV2A 2RKHA 3OYCA 2IBDA 2L2OA 2E1NA 4E70A 1T39A 4L18B 3TOAA 2QSHX 1DQUA 2XAFA 2LH9A 5LBQA 1JKPC 4IOAF 1BN5A 1LFPA 2BOLA 2K7LA 4BXUA 2K9QA 4U7BA 3IAM2 3B73A 1LUJB 5HS7A 2FOWA 1V5EA 4L9VA 1TLHB 3K2AA 1TWCJ 4II3A 5GAGJ 1ETYA 2HFHA 4PDKA 2HOAA 4L9NA 3ZN1A 4CHUA 5B1BH 4LFUA 3KYLA 1BR1A 3QYFA 4P55A 1MJAA 2M3AA 1U8RA 5GP9A 5JVGF 2EA2A 2QA4I 2LTPA 2F48A 4QPOA 4WF2A 1X58A 2UXXA 3QODA 2ECBA 5E3LA 2NOJB 4A3JJ 3W6KB 1JKOC 4IKFA 2WY7Q 3TP3A 3CCEI 3LA2A 1J2XA 3E6BA 2F5VA 1HDDC 2HEOA 2HXIA 1FBUA 1ZELA 4M72A 1X1CA 1HKSA 5CKTA 4CYCA 3SEZA 4BQAA 3HYIA 3FXMA 2Q0OA 2XPWA 1O4XA 1MSEC 2IS4A 1YI2I 3F8BA 2DFEA 5GPAA 2R7RA 1IUFA 4EMSA 3WU0A 3Q9SA 4OOIA 3D5LA 4EJWA 1IV8A 2DQRA 1E3PA 2DK8A 3BOQA 1RC9A 1U0JA 3H1CA 5H20A 1JT6A 4J01A 1Y39A 5D5XB 2R5YB 1VQNI 4HSTA 2NOGA 2W57A 5IY5H 4ETSA 1ZREA 2ELKA 4JBAA 4E7ZA 2TDXA 2FSWA 1XMKA 2A6TA 2CQQA 3ZQCA 2Y31A 2BHYA 1PYVA 1LPQA 3Q0UA 4EVIA 3OYFA 5FLVA 4HF1A 4N9IA 5K1YA 1SANA 4U0WA 4QTRA 2DT5A 2OU2A 1A36A 2CQXA 1D0ZA 2X1EA 1MNDA 2PLYA 1JXSA 1S6LA 2V79A 3MQ0A 4OIQF 5HDGA 4LMYA 1R1TA 3RQIA 2LF8A 3BG9A 3JR9A 4IZZA 1K4TA 4GFBA 2QCOA 1FYKA 3F0CA 5JI6A 1X4PA 1WKMA 2DFHA 4XRMA 2PMZA 3A1YA 3BG7A 1B6AA 1XGNA 3ABKH 1YTYA 3BQYA 3TDUC 1WPKA 1BJAA 2KZVA 3SZGA 3OIOA 2G7HA 3K4NA 1WGXA 2WB1N 2XF6A 5K7FA 4CCMA 4DOZA 1W36C 2P81A 2ZKZA 2UZKA 2ZJPF 4A3IJ 4IL6C 2QQ8A 3HL2A 2Y30A 4C30A 3E5QA 3SFIA 3OYDA 3HOYJ 3GFLA 3K4LA 2DFFA 3JTGA 5HLIA 2KISA 1TP4A 5EJCA 4BDYA 2JQ7A 1Y56A 2LBFA 3ABLH 4M3DA 3JSPA 3EYIA 2OPTA 1LE8B 4ENKA 5BQTA 2DMQA 1UZCA 3KE2A 2LKXA 2QQAA 3M8JA 1MH4A 1S29A 2CRGA 5CVIA 3KPHA 4UB6C 3PQKA 4C3JJ 2D1VA 1JKQC 1LDKB 4HX8A 1VQ5I 2NVYJ 1XSDA 1AKHA 3B6CA 1W7PA 3S3MA 1WH7A 5F0CA 2O0YA 1BA5A 5CVJA 1B8IA 2DOFA 2VLAA 1W36D 2VKHA 4FISA 4QSHA 1OR7C 2M4GA 2VPLA 3GTLJ 5EEHA 4G6TB 2O3FA 2LFBA 5DV5A 2M9HA 3LQQA 3TKYA 3COAC 1JGSA 2HTJA 3S15J 5CVVA 1QA6A 2CW8A 3BR2A 2DLLA 2VKDA 1HSJA 2HYFA 4KN7X 2J5PA 5FKMA 4XLFA 3FIWA 3G2BA 4XBFA 1SEUA 5LFAA 3HKZN 3NARA 4ON0A 5E3MA 1K61A 3QPLA 3TW7A 6PAXA 1Z6RA 4AVPA 1CGPA 2HOTA 3R60A 1Q1HA 2K4BA 5EDNA 1ZR4A 3LFUA 4QLCU 1JJ8C 5GTIC 1X1DA 2IP2A 3ZQFA 1KGSA 3PSFA 2ZJRF 2KT0A 2TRTA 2KRCA 2BEOA 1WRJA 2MBFA 1IG7A 2ZJQF 1U78A 2GXAA 1IAWA 2ETHA 2X48A 1OYWA 3TGNA 5J4YA 5LHGA 5LEJA 3K10A 3VDXA 2KP6A 1ORKA 1SD6A 4E6KG 4BDZA 3AG4H 2D1HA 2BVMA 3HTSB 3L1PA 3MN2A 4Q4ZF 1Q1VA 3SHFA 4CO8A 3RI4A 2CSOA 4BXXJ 2MD0A 1XTAA 4CA0A 1X1PA 1X2MA 2G7UA 2ZFUA 4YFKF 1OYIA 2JPBA 3EUKL 2Z33A 1Y1VJ 4UVBA 2BBYA 1TW3A 4IPAA 5BS6A 1Z7LA 1LB2A 4CGZA 4R79A 3V4GA 1MNMC 1D1BA 1O3SA 4NC8A 3VYUB 2L4MA 3U21A 2A69F 2M7BA 2CUJA 2XSJC 3DKYA 5M5XJ 3K2ZA 5EGOA 3OYLA 3AL0B 2H8RA 1HF0A 1MMNA 4CCJA 1MBGA 3F8CA 2ZNYA 4EGZA 1QU3A 1MKMA 5DDGA 1B1BA 2XVCA 1A04A 2GAUA 2GZWA 4PJMA 4OIRF 5J6XA 4OAZA 2XGDA 2QM3A 2O9LA 3EDPA 3CQZJ 2PJRB 3KP2A 4IRHA 4UUTA 3HG9A 2DPDA 4E7IA 2CV1A 3EQLF 2GIZA 5B5EC 5IOZA 2DYRH 4HNUA 2W25A 5JLWA 2HYJA 2V1XA 2X1DA 3CUQA 3AKZA 2XRNA 3LAPA 3H9QA 2A61A 5D6EA 4WXCA 1QNTA 2XAQA 3I58A 5HNFA 4HA8A 3DEEA 2PQ8A 1OR7A 4XIDA 1FTZA 2Z3YA 2FUG2 1B72B 1IN5A 2MYSA 4D5FA 3DLAA 4P96A 3N4MA 1AHDP 4RB0A 2E2HJ 3WTVC 2JK3A 2X6WA 1MBKA 2DTRA 3CCMI 1IJWC 5JR3A 3PM1A 3KZIC 4D7NA 4G7OF 1XGMA 2A3SA 2H09A 3A02A 2E2IJ 3M8EA 4ZYAA 4K2EA 3IH2A 1J59A 3S3NA 3HRSA 3HOWJ 5IYBJ 1HDPA 2OCEA 3ECHA 3CDIA 4Y7NJ 3IL2A 2MD5A 4RB1A 1XDUA 3VB2A 2KFDA 1P2FA 3DKXA 3ZQLA 3LA3A 1ZN2A 1ZLKA 1T0FA 4WWCA 2QBYB 2P7VB 3AG2H 3F8NA 2QLZA 5CVUA 1XSVA 2JUCA 3IC7A 5B66C 2DU9A 4BBSJ 1BOBA 3DEUA 2E19A 2Y9ZA 2KLOA 3GLXA 1D5VA 2VXDA 4BYYA 1BBYA 3ZQHA 3M3YJ 4IVNA 2ZSIB 2ID6A 3U2RA 5EF6A 5CYVA 4XLEA 2AHQA 4X1EA 5CQEA 3VSLA 4E4HA 5KNLA 4RBOA 1G3WA 3BC8A 2JRMA 3GTGJ 3JRFA 2OTLI 1GHCA 3CLQA 2XHKA 4XKBA 1ZRFA 2MA3A 3ECOA 2WBMA 4ESFA 5M5YJ 2DK5A 4EATA 2HDWA 2MFZA 4LK1F 3LSIA 4A3LJ 2R5ZB 4ZYDA 2L01A 3B02A 1ETXA 1P7IA 2E5ZA 3UKGA 3MVPA 3TMOA 4BHPA 4JYKA 3OSGA 4IRIA 3ZQGA 1UAAA 2KDZA 1O7LA 3BJAA 5FB2A 4XOPA 1YITI 4KT5C 2PG4A 3HUGA 2E1CA 3ASOH 2M34A 4LGWA 3TBIA 4A93J 1J7KA 3GEZA 4I99C 1G4DA 1N75A 4LK0F 2NVUB 1FP1D 1MGTA 5CPRB 2BZTA 1IW7F 3ROUA 1J9IA 2GIVA 1EA3A 3CD6I 9ANTA 2IRFG 4BL0B 2L3DA 4LG3A 3OOPA 3ZQQA 3ZCOA 1W5SA 2AO9A 3IAS2 3BZCA 1N78A 2M5WA 1R4MB 2RGVA 3TQNA 4CZCA 3DKWA 2OUMA 2OQRA 1DPUA 1QBJA 5TRDA 2P5LC 1PUEE 5KCMA 4ASNA 2M0CA 4WXDA 5TISC 1ON1A 2EZIA 2EILH 2HI3A 1KU7A 3HIFA 5L3BA 4V2GA 1JTYA 3OIQA 4BY1J 3L2RA 5AIQA 1OCPA 4HYEA 1R1UA 1D1AA 4M9ZA 1ETKA 3KP5A 4J00A 1O7FA 4IHVA 4YFXF 1A6QA 3V7RA 3CJNA 3KP3A 3W2WA 3OYGA 2JA5J 3F3XA 2HXOA 1H0MA 4ZDPA 2K27A 4XLHA 4L5EA 1X1AA 2XRLA 5D6FA 2PMHA 5LRRA 3ZMDA 2NRAC 3E7LA 4XKWA 3CCJI 4LB6B 2LK2A 2MLGA 3PL8A 3WE3A 3S1NJ 4P9UA 3K70C 3GZNB 3RKQA 3OYBA 4D7MA 1SMTA 1MMDA 5FJ8J 5IT9K 3BR0A 2H6BA 2NNYA 4XLPF 5IPAA 1RR8C 1LVAA 2LY2A 1SFOJ 2AQFA
chains in the Genus database with same CATH topology
3ABMH 2EIJH 2OCCH 3ASNH 5IY5H 2EIMH 2EINH 2DYSH 1OCRH 3AG4H 3ASOH 2DYRH 3ABKH 5B3SH 1OCOH 2EILH 2EIKH 3AG2H 3AG3H 2ZXWH 3ABLH 1OCCH 1V54H 5B1AH 5B1BH 1V55H 3X2QH 1OCZH 3AG1H 3WG7H 2Y69H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABM H;  2EIJ H;  2OCC H;  3ASN H;  5IY5 H;  2EIM H;  2EIN H;  2DYS H;  1OCR H;  3AG4 H;  3ASO H;  2DYR H;  3ABK H;  5B3S H;  1OCO H;  2EIL H;  2EIK H;  3AG2 H;  3AG3 H;  2ZXW H;  3ABL H;  1OCC H;  1V54 H;  5B1A H;  5B1B H;  1V55 H;  3X2Q H;  1OCZ H;  3AG1 H;  3WG7 H;  2Y69 H; 
#chains in the Genus database with same CATH topology
 4MEX F;  1R00 A;  3J7Z I;  1VQO I;  5GPC A;  4MFE A;  3BRO A;  2YU3 A;  3QQA A;  1S7E A;  5JFR A;  2NS7 A;  2XAU A;  4OWR B;  3L09 A;  4IX7 A;  1IN4 A;  2DYS H;  5IP6 A;  2LR8 A;  1FJL A;  3G1M A;  3DPU A;  2EB7 A;  1ZH5 A;  1MMG A;  5FD5 A;  5J40 A;  2R7X A;  4KFC A;  1R49 A;  1J5Y A;  2F4I A;  3E97 A;  4NQW A;  1MDM B;  1ZGW A;  2JA2 A;  2ELJ A;  3JRE A;  4XM3 A;  3FXU A;  2LSO A;  2DQL A;  4PFO A;  4KIS A;  1SC7 A;  4W1U A;  3L2Q A;  4F3Q A;  2K3F A;  2BE5 F;  2CUF A;  5F64 A;  2BY3 A;  5HNH A;  1TC3 C;  1FSH A;  1PUF A;  3GX4 X;  3WTS C;  4CCL A;  1HC8 A;  3HB9 A;  2E71 A;  1D8J A;  3PUB A;  1KQ0 A;  5EG0 A;  3PFI A;  1YOV B;  1VQM I;  3H5R A;  4N9H A;  1TBX A;  4M6Y A;  4OIO F;  1RIO H;  1X2N A;  1FNN A;  4Y13 A;  1TWA J;  3H36 A;  3C2B A;  1JJ6 C;  4E7K A;  3S32 A;  2DDB A;  4Y4R A;  2ESN A;  3CJT B;  1GV5 A;  2ZME A;  1UMQ A;  3FMR A;  4NBQ A;  4XLN F;  3CUQ C;  4LG0 A;  5CLS A;  2M7A A;  2VC0 A;  4A3K J;  3G1L A;  2CYY A;  4M3F A;  3RPQ A;  2CFX A;  3BPX A;  2XRO A;  4E7L A;  3I64 A;  3L7W A;  1IXR C;  3K0L A;  2GM4 A;  4OIP F;  4XNF A;  3L00 A;  1Z9C A;  4O6J A;  4FX0 A;  2LKP A;  1RR7 A;  2IA0 A;  3AG3 H;  4UV8 A;  1MJ9 A;  1DPR A;  2FBH A;  3C2H A;  3GF2 A;  1SMY F;  3QP6 A;  4I7H A;  1UHM A;  1QZE A;  2QQB A;  3VOD A;  3OS1 A;  1W7P B;  3E5X A;  2BY0 A;  2E35 A;  2DN0 A;  2EV6 A;  3BWG A;  2LKS A;  4M3E A;  1ZGJ A;  2DMT A;  4WXH A;  2K5C A;  1QQI A;  1YO5 C;  3E6D A;  4AC0 A;  1WSU A;  3NAU A;  3HTU A;  3KX2 A;  4HQM A;  1U6G A;  1RI7 A;  2IEK A;  4U87 A;  1VQL I;  5J3L A;  1A5J A;  1L0O C;  1OPC A;  5FGM A;  1GT0 C;  1X1B A;  1ETW A;  1OMI A;  2RQQ A;  2CGP A;  5BNG A;  2O8K A;  2VXZ A;  5DUI A;  1EH6 A;  2BYV E;  3FK7 A;  2NXN B;  3KLN A;  4UVC A;  5M3F J;  2P4W A;  3G3Z A;  1AU7 A;  3ABM H;  1IC8 A;  2DA4 A;  3LST A;  4XRS A;  1E0E A;  5ILU A;  5EEG A;  2R7V A;  2WA0 A;  1S9H A;  2HVR A;  3HGY A;  2A05 A;  2ZCW A;  3FXL A;  4XLC A;  1K6O A;  4EQQ A;  5FO5 A;  1DGW Y;  2R7U A;  1YS7 A;  4F92 B;  2EH3 A;  4L0Z B;  5GAE J;  4OIN F;  1PP7 U;  1UG2 A;  3A03 A;  4KA4 A;  1U3E M;  2VN2 A;  3GTQ J;  3E0J B;  5M5W J;  4HAM A;  2R7W A;  4KYW A;  1RET A;  1BC7 C;  1TNS A;  1XMA A;  2DJN A;  3MKZ A;  2L9N A;  1ETQ A;  1UHW A;  1IZ1 A;  2DT7 B;  4M3B A;  5C4X J;  4KIB A;  5CVR A;  4XSX F;  3O8H A;  4DYQ A;  5F1R A;  1UFM A;  2FNP A;  3IP4 B;  5C44 J;  2XGE A;  3EYY A;  2M45 A;  2YPR A;  3RKY A;  3C18 A;  3H5A A;  5J8C A;  4XKV A;  2IGM A;  2LMD A;  4D5C A;  3ZMU A;  3QWL A;  2XUB A;  3TW6 A;  2CUZ A;  5D8L B;  4KDP A;  1Y0U A;  1ODD A;  4RGU A;  4I0A A;  2MGQ A;  4MTE A;  4ZZD A;  2WAQ N;  2UXN A;  2EFW A;  1P92 A;  2RRE A;  3RYR A;  1HST A;  2M8G X;  3HRU A;  3V8J A;  5K5O A;  3FZV A;  4L9J A;  4I01 A;  2IGK A;  4NB5 A;  2Y0M A;  5FLX K;  3F23 A;  3QOP A;  4RAF A;  3W2V A;  4ANJ A;  5LGN A;  3BPV A;  1LDJ A;  2EIK H;  1VF9 A;  5FKL A;  3ZOB A;  4PSW A;  5DM7 F;  1DP7 P;  3H35 A;  4CXF A;  1S5L C;  4A69 C;  2EWN A;  2GA1 A;  4GDF A;  5ILS A;  4HW0 A;  2EK5 A;  2XAS A;  1JUP A;  1QZY A;  3REO A;  4UXN A;  5F6F A;  3HOU J;  4BHC A;  3J7A Y;  3EUA A;  1ZG5 A;  2F5C A;  2EFQ A;  5IYD J;  2PEX A;  1V4R A;  2X4H A;  3IKV A;  3SZP A;  2F4O B;  2CG4 A;  3GW2 A;  4CUG A;  1XN7 A;  2BV6 A;  1ETO A;  4N4N B;  2R5Z A;  2VON A;  2IXS A;  3LSM A;  3JRB A;  1OCO H;  2O5R A;  1J0R A;  3DF8 A;  2R7S A;  4Y15 A;  3GBG A;  2X85 A;  4AWX B;  2DA5 A;  5FKO A;  2DT6 A;  5DUK A;  4XOR A;  1KON A;  1KYW A;  3JAM Z;  3BG6 A;  1SFU A;  3IRQ A;  1L3L A;  2HDD A;  2QSG X;  3U1K A;  3SJM A;  5CJ9 A;  3AL0 C;  3F6V A;  3D1N I;  2KRF A;  4G9Y A;  1FIA A;  3HPG A;  3QYE A;  5M3M J;  1D3Y A;  3KYD B;  5J8F A;  1R9T J;  5K5R A;  1ETV A;  3CDH A;  4IHY A;  3K7A J;  2GWR A;  2NAZ A;  3HRM A;  3J7A O;  2Y75 A;  4OU0 A;  4BEH B;  4I6Z A;  5B3S H;  1MBF A;  4YG2 F;  1FWZ A;  3J81 K;  1HW1 A;  3WU1 B;  1SVM A;  1H9T A;  3CCQ I;  2R7D A;  1T08 B;  3QU3 A;  2VC1 A;  4R8H A;  5E79 C;  1QGP A;  2Y2Z A;  2V1N A;  2QF7 A;  4E7H A;  3GLL A;  2HGC A;  1R36 A;  4D1Q A;  4Y33 A;  2QEX I;  1W1W E;  4B3A A;  4YEL A;  2LP0 A;  4F55 A;  1P9Q C;  3MAJ A;  2ME0 A;  3OL4 A;  4ITV A;  4BQQ A;  3KP6 A;  4BHB A;  4BGD A;  1FMW A;  1I50 J;  4YII A;  3VSK A;  1I6H J;  1YJN I;  2WAF A;  4DQ2 A;  2BW3 B;  3K6G A;  5DTD A;  1FBS A;  3L2W A;  3ULQ B;  2DFI A;  2VBX A;  2XF5 A;  4CZZ A;  2WV1 A;  4HZF A;  4G6Q A;  4BJT A;  4I98 B;  1YE9 A;  1MZB A;  1K6Y A;  2G9W A;  3TL4 X;  2OA4 A;  2HDC A;  5ILV A;  2ELH A;  2L7F P;  2LBF B;  1UB9 A;  3WTZ A;  1VQ4 I;  2BY2 A;  3DTI A;  4OMZ A;  3P9I A;  2L7K A;  2W7N A;  2E7X A;  3Q3S A;  3ESW B;  1JKR C;  2GLO A;  1WZ2 A;  3PO3 J;  3GTO J;  1G3S A;  2HQR A;  1OCZ H;  1AKH B;  1FBQ A;  3PNY A;  4IJA A;  1LDD A;  2XPV A;  3HEF A;  3IRR A;  2P5V A;  1MDM A;  2RNG A;  1X3U A;  5FKK A;  1SD7 A;  3BG5 A;  3FKJ A;  3FF5 A;  4L5I A;  2L4A A;  4Q47 A;  2Y48 A;  3DTE A;  1REP C;  1YW9 A;  1FYL A;  3ONQ A;  1G8X A;  2OQG A;  3CMY A;  4CCN A;  2DJI A;  2CUE A;  4A3M J;  5LGU A;  2JZY A;  4R1H A;  4A6E A;  1NHA A;  5EG0 B;  2M2E A;  3IWF A;  3F8M A;  5C4J J;  1TT5 B;  2ZXJ A;  4M9S A;  4YEJ A;  4DGW B;  3F22 A;  1R5H A;  1OIS A;  3FK6 A;  1WI9 A;  3RQ4 A;  5EYR A;  2LDU A;  2GA2 A;  1SFK A;  4S05 A;  2QYO A;  3ERE D;  2UWM A;  4BKX A;  5EEA A;  3FIS A;  3KZZ A;  2OF7 A;  4UNO A;  4MLO A;  4GXO A;  3CC4 I;  4RB3 C;  3OV8 A;  4XN3 A;  3RPU D;  2RVC A;  4OAY A;  3I4M J;  1IO2 A;  4ZZL A;  1JHH A;  2LLK A;  1IGN A;  5DCF A;  3D5S C;  2R7F A;  4L5J A;  5L3C A;  1S72 I;  2VUM J;  3M1C A;  3R61 A;  4RGS A;  3VYT B;  5JLX A;  1FSE A;  4IQ4 A;  3F6O A;  3OS2 A;  2QVO A;  3P9C A;  3D0S A;  2VBY A;  2CJJ A;  4HBL A;  2CH0 A;  1U5T B;  5FRO A;  1CQT A;  1D0Y A;  3BR3 A;  2HVS A;  3H5N A;  2IA2 A;  4M9X A;  4ZYH A;  2L9V A;  2L9R A;  2Z2S B;  1SFX A;  2FQ4 A;  3L2V A;  2DAO A;  3V7C A;  3H9J A;  1KYZ A;  1YX5 A;  2V1D A;  3F9K A;  4HQE A;  3S2H J;  1FC3 A;  3BY6 A;  3DU5 A;  2K02 A;  2JJ7 A;  4PJJ A;  4CCO A;  5D8K B;  3A01 A;  4FTH A;  2ICW G;  3E6M A;  3FXJ A;  4B43 A;  4DJA A;  3H0G J;  5E3O A;  3JRI A;  1WHU A;  5CQG A;  3G73 A;  1XPX A;  2DBB A;  4B44 A;  2OTJ I;  4XRF A;  1YRN A;  2FX0 A;  5DEQ A;  4HF0 A;  3J80 K;  2LG4 A;  4G6D A;  2ZBK A;  2QBY A;  3RKW A;  2R93 J;  3FXK A;  2FU4 A;  4EJO A;  4JX6 A;  3K4J A;  2I5U A;  1I5Z A;  3U1D A;  1QHG A;  1DU0 A;  3HDD A;  2HKO A;  3LFK A;  1V5G A;  3PO2 J;  1N77 A;  1HQC A;  3W6V A;  4IEJ A;  2MLK A;  1WJF A;  3HOV J;  3JW4 A;  4B1R A;  2FD5 A;  3FM5 A;  1JGG A;  1RRJ A;  2RQP A;  2BXY A;  2KIQ A;  2QQ9 A;  4RAY A;  1NH3 A;  1BC8 C;  5D5V B;  4W97 A;  4EV0 A;  3CUQ B;  3GFJ A;  3IH4 A;  4HLX A;  5DD4 A;  3CLO A;  2MG4 A;  3HXL A;  1FLI A;  2NNN A;  3DEW A;  3FX3 A;  3MMY B;  4FHT A;  3J80 Z;  2VQC A;  3M07 A;  2QUF A;  4DIQ A;  3K4C A;  2XC7 A;  4YRV A;  1M1E B;  4ABZ A;  4LG0 B;  3OMY A;  2N8G A;  4A6D A;  4A3C J;  1H8A C;  1SVO A;  3HPH A;  1UHS A;  2Q2E A;  3GUD A;  2FQ3 A;  1R71 A;  3RIR A;  3R0J A;  3CCL I;  2P5K A;  2JA6 J;  2NVQ J;  2NS8 A;  1YQA A;  2LF7 A;  2VQL A;  4MFD A;  1TWG J;  1YYV A;  5E20 A;  2EIM H;  5HLH A;  4LIU A;  5FFZ A;  4HX4 A;  1IV6 A;  1T2K A;  1IDZ A;  1ZQ3 P;  2G0E A;  3GWZ A;  2Z99 A;  5BPI A;  3DQV C;  4A5M A;  1ZHF A;  5IP9 J;  2GQQ A;  1XB4 A;  4BJ6 C;  3N05 A;  4HDV A;  3HHG A;  2OBP A;  2W84 A;  3I59 B;  4CDG A;  1YW7 A;  2DCE A;  3CC2 I;  4BQN A;  1ACI A;  4QIW N;  1SD4 A;  3TO7 A;  5DD8 A;  3M8F A;  4NC6 A;  3BTJ A;  4G12 A;  1W5T A;  1OKR A;  2H27 A;  2VOP A;  2IA1 A;  1BI1 A;  1VND A;  1W5C C;  4P5O A;  4RDU A;  4X6A J;  2OJE D;  1BIB A;  2ZB9 A;  2QZ8 A;  1D8K A;  5ICF A;  2EA4 A;  2F4M B;  4LLN A;  3ZQI A;  4DBR A;  3CF2 A;  4AIJ A;  2VIX A;  4OMY A;  3WGI A;  1XGO A;  1I39 A;  3I0T A;  2COM A;  2YX7 A;  3MEX A;  2IGN A;  2R0Q C;  4HNV A;  5GAH J;  2XKO A;  4I0B A;  1IUY A;  1YIO A;  5K7Z A;  4L0Y B;  3BJO A;  2P6S A;  3DPT A;  4PZJ A;  3MKW B;  4A5N A;  1QVT A;  1J75 A;  2Y0S N;  5KAI C;  4EEF G;  2RN7 A;  4IXA A;  1ZTR A;  2QSF X;  5TJJ A;  3RYP A;  4RB2 C;  4Y17 A;  4ZTJ A;  1C0W A;  2R7O A;  3MKL A;  1PVE A;  3ZP5 A;  5LHI A;  1DUX C;  3GTM J;  5JHU A;  1DGR M;  5KVR A;  4EM1 A;  4HG2 A;  4I02 A;  5C3E J;  4FAS D;  2OC6 A;  3KP7 A;  4KUM A;  1OCR H;  2AS5 F;  1WH5 A;  5IT9 Z;  4MQ9 F;  3LNQ A;  2FML A;  2VE9 A;  3IWZ A;  4PJ0 C;  4FX4 A;  1R7J A;  2Z1D A;  1WJB A;  1NTC A;  2B9S A;  3OS0 A;  1NG7 A;  5IYC J;  4RM2 A;  3CCY A;  1BR2 A;  3S8P A;  3HUG B;  1VQ9 I;  5B1A H;  4MGR A;  2JA7 J;  4BEH A;  5A2Q K;  1LNW A;  4RM3 A;  4S04 A;  4EJV A;  1QPM A;  1T33 A;  2EIJ H;  1RPW A;  3O8G A;  3HOT A;  4NQW B;  3KEY A;  1XMX A;  3PIP F;  3MCZ A;  2FNA A;  3HZJ A;  3EUH A;  1S7A A;  1F43 A;  1FT9 A;  1WCM J;  1LFU P;  2Q8K A;  4CH7 A;  2L0K A;  3FMS A;  3Q0W A;  4HPQ A;  1D5Y A;  2X6O A;  3S1R J;  2KIF A;  3UR3 C;  2JUG A;  1R5I D;  1B9N A;  3LSG A;  4ZTF A;  4UUS B;  3QRF F;  2W85 A;  3WTY C;  1UJ8 A;  2R3S A;  3JRA A;  1O3R A;  1CF7 A;  2B0L A;  2NVT J;  3OY9 A;  1VQP I;  1P6R A;  1HCR A;  1MBJ A;  1GXP A;  5IT3 A;  4PJN A;  3ZPL A;  4DNC A;  3CES A;  3QAH A;  5F1J A;  4AYB A;  2L5Q A;  1AOY A;  2W24 A;  3FHZ A;  3LWF A;  4NDL A;  1Z77 A;  3MD2 A;  2VB6 A;  2ZME B;  1WJC A;  3GYH X;  2D45 A;  3BG3 A;  1QHH D;  4ZYG A;  3DPL C;  2BY1 A;  4B8X A;  1K78 B;  1FZP B;  2BXZ A;  3EPZ A;  4JX5 A;  2GXB A;  3M1E A;  2ZO4 A;  3GFI A;  4FCY A;  1E3O C;  4GRI A;  4BE2 A;  2ZXH A;  2STW A;  2X6Y A;  3HSF A;  1GUU A;  4GO1 A;  3PIO F;  1H88 C;  2EQR A;  2R92 J;  1R22 A;  3H3Z A;  2K9S A;  4XON A;  1BI2 A;  3E5U A;  1TQP A;  2O7O A;  2VT3 A;  1Z0X A;  2K40 A;  2MAB A;  2X6X A;  5F0H A;  2CV2 A;  2WAQ A;  2KJB A;  5J1R A;  3RDI A;  4IRG A;  2DA7 A;  2K4J A;  2E5N A;  3ML6 A;  1F1Z A;  4MEY F;  3WG9 A;  2IT0 A;  1I1S A;  2V4J C;  2DDA A;  4ZC3 A;  1ZKG A;  3CTA A;  5BPD A;  2FE3 A;  4NC7 A;  1VI0 A;  1SAU A;  1ONV A;  2VE8 A;  4ZH4 F;  5HOD A;  2F5F A;  1PP8 F;  2OCC H;  2ACJ A;  2K86 A;  2HKX A;  3KP4 A;  4A0Z A;  1Z91 A;  2CWE A;  2MH9 A;  4XSZ F;  1F36 A;  4I09 A;  2XIG A;  2QEN A;  3M7G A;  5DS9 A;  2VOD A;  2RV8 A;  5LLQ A;  2STT A;  3RKX A;  4AM3 A;  2EZH A;  1JT0 A;  3GTJ J;  1MMA A;  1EV7 A;  1ZAO A;  1F4K A;  2DOE A;  4HNT A;  3S2D J;  3DP7 A;  2X51 A;  1IRX A;  4LD5 A;  1EKE A;  4F52 A;  3GCM A;  2GBY A;  1TL8 A;  4XMY A;  2FRH A;  3ZXS A;  2A6H F;  4PK4 A;  1K83 J;  1RNL A;  3BR1 A;  4C2U A;  2A5Y B;  2PJP A;  4B48 A;  4Q5S F;  1BM9 A;  2H8W A;  3K1P A;  4RGX A;  2MC3 A;  2UUZ A;  2KPM A;  3TED A;  3LOC A;  5J47 A;  1AA7 A;  2IAI A;  4WCG A;  3GXO A;  4RAZ A;  1MIJ A;  1FMV A;  2XGC A;  4C2T A;  3CMA I;  3PNV A;  5AON A;  2HU9 A;  3FBI B;  3I54 A;  4XQF A;  4I76 A;  3WTW C;  4C3I J;  4BUP A;  2W48 A;  5ICE A;  3GFM A;  4YIF A;  1O3Q A;  2V1U A;  2UV1 A;  3A0B C;  1VTN C;  2RDP A;  3ASN H;  1Z1D A;  1OFC X;  5FFX A;  1A31 A;  1EJ9 A;  2WY8 Q;  1Z67 A;  2EFP A;  2R7Z J;  3H0D A;  1MH3 A;  1MBH A;  1FPQ A;  3ZR8 X;  5BMZ A;  1YRN B;  2V9K A;  1KQ8 A;  2JVG A;  3ABT A;  1PJR A;  3V42 A;  3I4N J;  3TDZ C;  2IS6 A;  1FOW A;  4O3M A;  5E17 F;  4M3G A;  3RZD J;  2W1O A;  3A2K A;  2MC4 A;  3OSF A;  4M6X A;  3SXY A;  2LOO A;  4IHX A;  1B59 A;  4XK4 A;  5ED4 A;  3BLY A;  4UB8 C;  3IH3 A;  5LD2 C;  1UCR A;  4UV9 A;  3OWT A;  2E34 A;  1T6S A;  3BR5 A;  1XSX A;  2WWY A;  5L3G A;  1MW7 A;  4EJU A;  2HQ5 A;  1SFE A;  1V5F A;  3GO5 A;  1X3Z B;  3BCB A;  2NYX A;  4FE7 A;  2DO7 A;  1BL0 A;  2HS5 A;  2H1L A;  3DBR B;  4ZDO A;  5H6Q A;  3T8R A;  1FTT A;  1HXD A;  4XR6 A;  1ZYR F;  1ZLJ A;  2LRE A;  3OYE A;  2L54 A;  2KL4 A;  2ZC2 A;  4DZP A;  1U8B A;  2OD5 A;  3WGG A;  1WVR A;  2CS3 A;  1UST A;  1VQ7 I;  4JQF A;  4EJT A;  4PGG A;  2JSC A;  3A4C A;  1FOK A;  4Z2Y A;  2DA2 A;  1BI0 A;  3QU6 A;  2HYG D;  4RA2 A;  3ERM A;  2DA1 A;  4KMU X;  1T95 A;  5A2Q Z;  2C6Y A;  4Q48 A;  4P9F A;  1EH8 A;  3KEQ A;  1H89 C;  1RKW A;  2E36 A;  4XRS G;  1KQ9 A;  3JRD A;  3R0A A;  4ESJ A;  3K4M A;  2FEZ A;  4H4K C;  4KIC A;  1YW8 A;  2VBZ A;  3QOE A;  4BY7 J;  4AUX A;  4C9Y A;  3PFY A;  5J1Y A;  3S17 J;  1U5T A;  2VBW A;  5K7H A;  2DXI A;  3M4O J;  2XPU A;  3WU2 C;  1D0X A;  5IP7 J;  2GXG A;  1GVD A;  3KCC A;  1NK3 P;  1ENH A;  1T56 A;  2V6E A;  2PMU A;  1KU9 A;  1Z3Y A;  2KRH A;  4A3G J;  4V2F A;  1QVU A;  1V3F A;  2VOO A;  3FHN A;  1T8I A;  2KQR A;  3L9F A;  3A01 B;  3OYH A;  3A0H C;  3CME I;  2DW4 A;  1F9N A;  2OAZ A;  2FMY A;  4FQG A;  3SQN A;  2JPC A;  5DM6 F;  5JHF A;  1R1V A;  4CYC B;  2JA8 J;  4BE1 A;  3FBN B;  1WJE A;  1WJA A;  5HS9 A;  1HKQ A;  2CO5 A;  1NK2 P;  3S16 J;  2O61 A;  3IV5 A;  3C3W A;  4M73 A;  1TT0 A;  5E1W A;  4ZYE A;  2FJ1 A;  2ZFW A;  3VFZ A;  3KET A;  3R4K A;  2WTE A;  3HBL A;  2KIM A;  4AIK A;  4AYB N;  1RES A;  3EUH C;  3FM3 A;  3S1M J;  2JT1 A;  3OR2 C;  4B09 A;  4HF2 A;  1ERD A;  3QPH A;  4MIM A;  3L2C A;  1UG0 A;  3OYJ A;  1B4A A;  1G59 A;  2BW3 A;  3ZN0 A;  4PSX A;  2CMP A;  1APL C;  1S7O A;  3WHC A;  2HQA A;  1JUS A;  2V26 A;  1Z05 A;  4BU2 A;  2LD5 A;  4KIT B;  2W00 A;  1TTY A;  3I5U A;  2KMU A;  3S14 J;  1FIP A;  1X4O A;  5E18 F;  1W0U A;  3I55 I;  1BW6 A;  2XAG A;  4UHT A;  1JE8 A;  5L3E A;  1ZRC A;  3E1S A;  1GLN A;  2HR3 A;  1GVJ A;  3WOD F;  3CJR B;  2HZT A;  3BP8 A;  4NUB A;  2KKO A;  4PUS A;  5LHH A;  4Y3O A;  1U2W A;  2DOA A;  4BQO A;  1X3W B;  2PN6 A;  2L7M P;  4QWQ A;  1YFH A;  2IW5 A;  2EV0 A;  1DP3 A;  1XC5 A;  1I3A A;  5GAD J;  1O57 A;  2GOM A;  4HX7 A;  4G7H F;  2A5W A;  2FOK A;  2M87 A;  2K9L A;  4V19 K;  3S1Q J;  1KU3 A;  2EV5 A;  5D4R A;  2F2E A;  3GVA A;  3BCA A;  1HKT A;  3H92 A;  3J7Y J;  4RLF A;  1PDN C;  3HHH A;  3RJP A;  1YJ9 I;  2VJ5 A;  1HBX G;  4MHG A;  2YR2 A;  2O8X A;  1HW2 A;  3HRT A;  4N0B A;  2L02 A;  1FYM A;  4BNC A;  1OYY A;  4HEA 2;  2O6G E;  3I53 A;  4BE0 A;  5HLG A;  3FXO A;  5ICG A;  4LOC A;  3CP2 A;  4HSR A;  3SDG A;  2L7Z A;  2Y9Y A;  1D1C A;  4XIC A;  1H9G A;  3VWB A;  3WG7 H;  2HTS A;  3I56 I;  4F91 B;  2Y69 H;  4ZJZ A;  1K78 A;  3MFK A;  1E17 A;  1Y6I A;  1XGS A;  2YSR A;  4L9T A;  4HOB A;  2J5O A;  4HRI A;  5H6R A;  1R4N B;  2DTZ A;  3CCS I;  2R5Y A;  2XF7 A;  2R7Q A;  4KJZ A;  3V8K A;  5DCM B;  1WWX A;  3VYS B;  4IOC F;  2B7E A;  4D9J A;  2JWT A;  4I2O A;  2I8D A;  1KA8 A;  3L2U A;  3G71 I;  2VKE A;  2M1B A;  1AWC A;  3SDB A;  2P0W A;  3EET A;  4J19 A;  4DW6 A;  2ME6 A;  4A3B J;  1Y8R B;  1T0F C;  1R5G A;  1IRZ A;  2QWW A;  1HA8 A;  3O3K A;  1W0T A;  1B8I B;  4IO9 F;  1F5T A;  1R6R A;  3HGG A;  1I27 A;  1POG A;  3O2P E;  3DCF A;  4IQJ A;  3U9G A;  2BHZ A;  3K4K A;  4XOT A;  3FXQ A;  3I4P A;  3Q0V A;  2ZSH B;  2X9D A;  3BDD A;  4PGH A;  2NVX J;  4B47 A;  1FX7 A;  2K9M A;  3CZ6 A;  5L3D A;  3RSN A;  3AAF A;  2BVL A;  2Q1Z B;  3S2W A;  3NWS A;  1GXQ A;  1BR4 A;  2XAH A;  2RNJ A;  2LC2 A;  4BXF A;  4A2U A;  3K69 A;  3TO9 A;  4XL9 A;  5L3F A;  1TQI A;  5F04 A;  3I9V 2;  3JTH A;  4EGY A;  3T5X A;  4F93 B;  3F72 A;  1T98 A;  4WX9 A;  2H94 A;  2E7W A;  4HV6 A;  5HOO A;  1BI3 A;  1BJZ A;  2OV7 A;  5DYM A;  4MQV A;  4EM0 B;  3ABU A;  3JAM K;  2Y0S A;  4CCK A;  3P5J A;  2AQE A;  2VI6 A;  1I6X A;  2X0L A;  3G6E I;  3CUO A;  3DTK A;  2V6C A;  2VJJ A;  1LEB A;  3DBL B;  1KZH A;  4BH9 A;  4JP0 A;  3JCU C;  1W7P D;  2ID3 A;  2IJL A;  3HKZ A;  4AU7 A;  2RC4 A;  4C3H J;  1SAX A;  2GOX B;  2CQN A;  3D5R C;  2PFB A;  3DFG A;  1RUN A;  2LY1 A;  3K9T A;  1YS6 A;  3KIO A;  1E2X A;  1IDY A;  3PSI A;  1XD7 A;  2EPF A;  3G4S I;  5BOX A;  5KAF C;  1ZG1 A;  3WTT C;  1LE8 A;  1JUM A;  1OJL A;  2F5E A;  1WJ5 A;  3OL3 A;  4Y52 J;  1U9N A;  3T0Y A;  1S8N A;  1Y1W J;  2IVM A;  2VT2 A;  2H6C A;  2K9N A;  1STZ A;  5EGO B;  1TW2 A;  1QRY A;  4HDU A;  5D5U B;  3WHB A;  3H9G A;  1VQ8 I;  4GGG A;  2MH2 A;  1YHQ I;  3I59 A;  4BS9 A;  3RZO J;  2KHM A;  3PNT A;  5LEK A;  3H3U A;  2P8T A;  4RS8 A;  1RUO A;  1EH7 A;  4G7Z F;  3HOZ J;  4G8X A;  4KIG A;  1G3Y A;  2PBI A;  3DLL F;  1P7J A;  2FF4 A;  1A35 A;  3F21 A;  2VL8 A;  4A3E J;  2M30 A;  1FOX A;  3F8F A;  4JX4 A;  1MNE A;  1JHF A;  2VQH A;  1QPI A;  3O6B B;  5FRM A;  3HM5 A;  3UNG C;  4EM2 A;  1HOM A;  4NHJ A;  4A0Y A;  2KDO A;  3MWM A;  5EZH A;  4MNU A;  3ZMZ A;  3BZK A;  4LLL A;  3JRC A;  3VEP A;  4UY8 I;  1RZ4 A;  1IF1 A;  3ZQ7 A;  4DYR A;  1TNT A;  4FE4 A;  4RGR A;  3LSP A;  1IXS B;  3DXJ F;  3S3O A;  1FOY A;  2M8E A;  4CSW A;  2JTV A;  2QKM B;  4X0G A;  4NNJ A;  4LB5 A;  4ENM A;  2EFN A;  4BAY A;  1V54 H;  5FLM J;  4IHT A;  3T8T A;  1O3T A;  3C1D A;  1ON2 A;  1U5T C;  5E1Z B;  3ZMS A;  2PX9 A;  2XAJ A;  2V7F A;  1G3T A;  1FEX A;  3OIP A;  1MJB A;  5FLX Z;  1K4S A;  3OYM A;  2LRD A;  5TGT A;  1LJ9 A;  1Z6T A;  2VJ4 A;  2V9V A;  1OCT C;  2HOE A;  1OQY A;  3QPS A;  2A6E F;  2Q2E B;  2YU9 J;  4UUV A;  2CW7 A;  2ECC A;  1BOA A;  1FY7 A;  2LNB A;  2YS9 A;  3KYC B;  1VQ6 I;  3RTR A;  4A0X A;  1YG2 A;  1DU6 A;  5F0F A;  3WTU C;  1Z7U A;  2W82 A;  3LL7 A;  1TQM A;  3SEQ A;  3W6J B;  4LIT A;  1MMS A;  1HW5 A;  2CW0 F;  2DA6 A;  2XB0 X;  2VPR A;  2XDV A;  3CO7 C;  3HOX J;  3CF5 F;  2HQN A;  1V55 H;  2LYC A;  4G94 A;  2XB5 A;  1XG1 A;  2OZ6 A;  2ZNZ A;  3MZH A;  3W3C A;  3QYB A;  4GYG A;  4AVZ A;  1XCV A;  1MD0 A;  5AIP A;  2DMN A;  3B6A A;  4E7J A;  1CF7 B;  4CIC A;  2JVH A;  3P9K A;  4U7D A;  4HV5 A;  2IGO A;  1W4M A;  3K4B A;  3Q9V A;  1NG6 A;  3TOB A;  2JRT A;  1ZAR A;  4ESB A;  4M71 A;  4KN4 X;  4N4O B;  2F5D A;  2K85 A;  3OYN A;  3CCR I;  2VJI A;  5E1X A;  3ELK A;  4KT6 A;  3BZ6 A;  3I71 A;  3VPR A;  3NRV A;  1IN6 A;  3MZY A;  3SZT A;  1J09 A;  2D2W A;  4O5V A;  3JRH A;  2L9S A;  2Z16 A;  3LAJ A;  3N97 A;  3K1N A;  2TCT A;  2E2J J;  2FBK A;  1IN7 A;  1Y8Q B;  3LMM A;  5ERI A;  1S3J A;  3R6S A;  3JRG A;  2H1K A;  2E1M C;  3OR1 C;  4KIF A;  3OYI A;  1B72 A;  3OOU A;  3DBH B;  2FXA A;  3GTK J;  3BQZ A;  3JSO A;  1HLV A;  1RKT A;  4B4C A;  1WFX A;  4KNY A;  1I1G A;  1ZGA A;  2CQ7 A;  2HOS A;  4RMN A;  2MW8 A;  5EZG A;  1KU2 A;  4A3F J;  2KJC A;  1YJW I;  3BT9 A;  4S0H B;  4M6V A;  2A68 F;  2WC2 A;  2A07 F;  3LSR A;  3CDL A;  3CJQ B;  3PUF A;  2X1C A;  3PQJ A;  2W4S A;  3WTX C;  1K79 A;  3SFZ A;  5LGT A;  4PFP A;  2JSP A;  4B3X A;  3NQO A;  3IHU A;  4RLQ A;  3C7J A;  1ZK8 A;  2ESH A;  2LY9 A;  4M74 A;  1IRF A;  3ZRG A;  5HDN A;  4QPQ A;  2HPI A;  5D4S A;  1FP2 A;  2Z5U A;  2ZXW H;  2M0M A;  2COB A;  2IS1 A;  1USS A;  2AXT C;  3G1O A;  3GZ5 A;  4XN0 A;  2F6C A;  1XX5 A;  4BBR J;  3RPU A;  1WQ2 A;  5K5Q A;  3S93 A;  3GZ6 A;  4ENN A;  2E1M B;  2WB1 A;  3FWE A;  2HNH A;  1R23 A;  4UUS A;  1MBE A;  5LRS A;  1ZRD A;  1GDT A;  2P6T A;  3W2A A;  4BJ5 C;  4BAC A;  1JI8 A;  3ZMV A;  3LSJ A;  3CP8 A;  1XCB A;  4ZDL A;  4ENJ A;  4AIH A;  4DBQ A;  2QKL B;  1G2H A;  2PMZ N;  3FMQ A;  1WJD A;  3LQR A;  4HLY A;  4P1W A;  4Z6Y A;  3AG1 H;  4PJL A;  5HDK A;  3CCV I;  1TWH J;  1UEL B;  2WV0 A;  1Z21 A;  1BIA A;  2BGC A;  5HS8 A;  2JMW A;  3BTC A;  4TV7 A;  4KMF A;  3HOS A;  5J4V A;  2M4K A;  3GME A;  1SVL A;  3I3L A;  2YX4 A;  1YX3 A;  2HVQ A;  2KZG A;  2WAE A;  5KK1 A;  2DPU A;  3DV8 A;  3K70 D;  2B63 J;  3HC7 A;  3V7S A;  3OYA A;  5E8I A;  1ITY A;  2XKP A;  1I3Q J;  2VKV A;  3CMM A;  5H2F C;  4XLA A;  2HZD A;  2XV4 S;  2EBI A;  3CO6 C;  2IPQ X;  5FRN A;  4RAG A;  1OCC H;  4C2M J;  3CCU I;  1T38 A;  3KFW X;  2CV0 A;  4IHW A;  3VOE A;  2DA3 A;  3CC7 I;  2O03 A;  1VFC A;  1MSF C;  2DMP A;  4UVA A;  3MKY B;  2AXL A;  1P4A A;  2ISY A;  2MSY A;  3DU6 A;  4YFN F;  3ZMT A;  1LEA A;  2IS2 A;  2HPM A;  2EIN H;  1ULY A;  5J1U A;  2CU7 A;  5F08 A;  3QP5 A;  3IUO A;  4U0V A;  2ZXI A;  4A3D J;  4DZJ A;  2OZU A;  3K1M A;  3LSK A;  3SYT A;  4DYC A;  2P7C B;  4MTD A;  4H0E A;  2ISZ A;  1PUF B;  2ADU A;  1WI3 A;  4D0P A;  5IOY A;  5JVT A;  3H3V K;  2DOD A;  3BR6 A;  3FKI J;  2QGU A;  2NS0 A;  2HWV A;  3BJ6 A;  1P4X A;  5GTH C;  3KEO A;  4GYI A;  5E3N A;  5HLT A;  2VAS A;  2VQG A;  3X2Q H;  3HSR A;  3TP0 A;  2V9P A;  1N25 A;  5KHD A;  2ZME C;  2LVS A;  3WE2 A;  1IN8 A;  2DI3 A;  1QO0 D;  1LVK A;  3QPT A;  3NEU A;  4FT8 A;  2EFO A;  3E3V A;  3GTP J;  2Z9O A;  2YUS A;  1E3H A;  1XS9 A;  5D5W B;  4GCV A;  4YIR X;  2I10 A;  4PCQ A;  1LQ1 A;  2EZL A;  3E6C C;  4WK8 F;  1SD5 A;  3Q5F A;  1B9M A;  3KLO A;  4LJZ F;  4IF4 A;  2K3P A;  1YLF A;  2FBI A;  5ICC A;  3MZ8 A;  4A12 A;  3NWT A;  1K7A A;  5HVQ C;  3TO6 A;  2E60 A;  2R7T A;  1DDN A;  2RAE A;  5DCM A;  5E8G A;  3IKT A;  3C2G A;  1JTX A;  4JOM A;  1QZZ A;  1X19 A;  3ISP A;  5F27 A;  1R58 A;  1LKX A;  3LA7 A;  3BTI A;  1A6I A;  3BTL A;  4U0Y A;  1YIJ I;  3P7N A;  1TZL A;  1ZR2 A;  2R4G A;  1Y0N A;  3PJR A;  4F7Z A;  1P4W A;  4CYD A;  2XSD C;  3WGH A;  1Z3X A;  2CQK A;  1BW5 A;  3FDY A;  1EF4 A;  1G6N A;  3LSH A;  4IHS A;  2E1O A;  4JK1 X;  1IRG A;  2XGX A;  4FET A;  3M9A A;  5FKN A;  4AID A;  2FA5 A;  2KIU A;  3OYK A;  2D5V A;  4MO7 A;  4XKC A;  1ZG3 A;  1IXC A;  3RCO A;  2EZK A;  3V8L A;  1LFB A;  3HJE A;  4E7S A;  3AFH A;  1TWF J;  3HSE A;  3KZY A;  2PI0 A;  1OLT A;  4LIV A;  2WAD A;  4LLG F;  4II2 A;  3DWL E;  4AD9 A;  1U9O A;  2CFO A;  2EJR A;  1XDS A;  3FXR A;  2DMU A;  2PJR A;  1VQK I;  4U88 A;  1VZ0 A;  3VYR B;  2ZJ2 A;  5FD6 A;  3T1B A;  3ZGK A;  2JN6 A;  3J81 Z;  1GV2 A;  2RKH A;  3OYC A;  2IBD A;  2L2O A;  2E1N A;  4E70 A;  1T39 A;  4L18 B;  3TOA A;  2QSH X;  1DQU A;  2XAF A;  2LH9 A;  5LBQ A;  1JKP C;  4IOA F;  1BN5 A;  1LFP A;  2BOL A;  2K7L A;  4BXU A;  2K9Q A;  4U7B A;  3IAM 2;  3B73 A;  1LUJ B;  5HS7 A;  2FOW A;  1V5E A;  4L9V A;  1TLH B;  3K2A A;  1TWC J;  4II3 A;  5GAG J;  1ETY A;  2HFH A;  4PDK A;  2HOA A;  4L9N A;  3ZN1 A;  4CHU A;  5B1B H;  4LFU A;  3KYL A;  1BR1 A;  3QYF A;  4P55 A;  1MJA A;  2M3A A;  1U8R A;  5GP9 A;  5JVG F;  2EA2 A;  2QA4 I;  2LTP A;  2F48 A;  4QPO A;  4WF2 A;  1X58 A;  2UXX A;  3QOD A;  2ECB A;  5E3L A;  2NOJ B;  4A3J J;  3W6K B;  1JKO C;  4IKF A;  2WY7 Q;  3TP3 A;  3CCE I;  3LA2 A;  1J2X A;  3E6B A;  2F5V A;  1HDD C;  2HEO A;  2HXI A;  1FBU A;  1ZEL A;  4M72 A;  1X1C A;  1HKS A;  5CKT A;  4CYC A;  3SEZ A;  4BQA A;  3HYI A;  3FXM A;  2Q0O A;  2XPW A;  1O4X A;  1MSE C;  2IS4 A;  1YI2 I;  3F8B A;  2DFE A;  5GPA A;  2R7R A;  1IUF A;  4EMS A;  3WU0 A;  3Q9S A;  4OOI A;  3D5L A;  4EJW A;  1IV8 A;  2DQR A;  1E3P A;  2DK8 A;  3BOQ A;  1RC9 A;  1U0J A;  3H1C A;  5H20 A;  1JT6 A;  4J01 A;  1Y39 A;  5D5X B;  2R5Y B;  1VQN I;  4HST A;  2NOG A;  2W57 A;  5IY5 H;  4ETS A;  1ZRE A;  2ELK A;  4JBA A;  4E7Z A;  2TDX A;  2FSW A;  1XMK A;  2A6T A;  2CQQ A;  3ZQC A;  2Y31 A;  2BHY A;  1PYV A;  1LPQ A;  3Q0U A;  4EVI A;  3OYF A;  5FLV A;  4HF1 A;  4N9I A;  5K1Y A;  1SAN A;  4U0W A;  4QTR A;  2DT5 A;  2OU2 A;  1A36 A;  2CQX A;  1D0Z A;  2X1E A;  1MND A;  2PLY A;  1JXS A;  1S6L A;  2V79 A;  3MQ0 A;  4OIQ F;  5HDG A;  4LMY A;  1R1T A;  3RQI A;  2LF8 A;  3BG9 A;  3JR9 A;  4IZZ A;  1K4T A;  4GFB A;  2QCO A;  1FYK A;  3F0C A;  5JI6 A;  1X4P A;  1WKM A;  2DFH A;  4XRM A;  2PMZ A;  3A1Y A;  3BG7 A;  1B6A A;  1XGN A;  3ABK H;  1YTY A;  3BQY A;  3TDU C;  1WPK A;  1BJA A;  2KZV A;  3SZG A;  3OIO A;  2G7H A;  3K4N A;  1WGX A;  2WB1 N;  2XF6 A;  5K7F A;  4CCM A;  4DOZ A;  1W36 C;  2P81 A;  2ZKZ A;  2UZK A;  2ZJP F;  4A3I J;  4IL6 C;  2QQ8 A;  3HL2 A;  2Y30 A;  4C30 A;  3E5Q A;  3SFI A;  3OYD A;  3HOY J;  3GFL A;  3K4L A;  2DFF A;  3JTG A;  5HLI A;  2KIS A;  1TP4 A;  5EJC A;  4BDY A;  2JQ7 A;  1Y56 A;  2LBF A;  3ABL H;  4M3D A;  3JSP A;  3EYI A;  2OPT A;  1LE8 B;  4ENK A;  5BQT A;  2DMQ A;  1UZC A;  3KE2 A;  2LKX A;  2QQA A;  3M8J A;  1MH4 A;  1S29 A;  2CRG A;  5CVI A;  3KPH A;  4UB6 C;  3PQK A;  4C3J J;  2D1V A;  1JKQ C;  1LDK B;  4HX8 A;  1VQ5 I;  2NVY J;  1XSD A;  1AKH A;  3B6C A;  1W7P A;  3S3M A;  1WH7 A;  5F0C A;  2O0Y A;  1BA5 A;  5CVJ A;  1B8I A;  2DOF A;  2VLA A;  1W36 D;  2VKH A;  4FIS A;  4QSH A;  1OR7 C;  2M4G A;  2VPL A;  3GTL J;  5EEH A;  4G6T B;  2O3F A;  2LFB A;  5DV5 A;  2M9H A;  3LQQ A;  3TKY A;  3COA C;  1JGS A;  2HTJ A;  3S15 J;  5CVV A;  1QA6 A;  2CW8 A;  3BR2 A;  2DLL A;  2VKD A;  1HSJ A;  2HYF A;  4KN7 X;  2J5P A;  5FKM A;  4XLF A;  3FIW A;  3G2B A;  4XBF A;  1SEU A;  5LFA A;  3HKZ N;  3NAR A;  4ON0 A;  5E3M A;  1K61 A;  3QPL A;  3TW7 A;  6PAX A;  1Z6R A;  4AVP A;  1CGP A;  2HOT A;  3R60 A;  1Q1H A;  2K4B A;  5EDN A;  1ZR4 A;  3LFU A;  4QLC U;  1JJ8 C;  5GTI C;  1X1D A;  2IP2 A;  3ZQF A;  1KGS A;  3PSF A;  2ZJR F;  2KT0 A;  2TRT A;  2KRC A;  2BEO A;  1WRJ A;  2MBF A;  1IG7 A;  2ZJQ F;  1U78 A;  2GXA A;  1IAW A;  2ETH A;  2X48 A;  1OYW A;  3TGN A;  5J4Y A;  5LHG A;  5LEJ A;  3K10 A;  3VDX A;  2KP6 A;  1ORK A;  1SD6 A;  4E6K G;  4BDZ A;  3AG4 H;  2D1H A;  2BVM A;  3HTS B;  3L1P A;  3MN2 A;  4Q4Z F;  1Q1V A;  3SHF A;  4CO8 A;  3RI4 A;  2CSO A;  4BXX J;  2MD0 A;  1XTA A;  4CA0 A;  1X1P A;  1X2M A;  2G7U A;  2ZFU A;  4YFK F;  1OYI A;  2JPB A;  3EUK L;  2Z33 A;  1Y1V J;  4UVB A;  2BBY A;  1TW3 A;  4IPA A;  5BS6 A;  1Z7L A;  1LB2 A;  4CGZ A;  4R79 A;  3V4G A;  1MNM C;  1D1B A;  1O3S A;  4NC8 A;  3VYU B;  2L4M A;  3U21 A;  2A69 F;  2M7B A;  2CUJ A;  2XSJ C;  3DKY A;  5M5X J;  3K2Z A;  5EGO A;  3OYL A;  3AL0 B;  2H8R A;  1HF0 A;  1MMN A;  4CCJ A;  1MBG A;  3F8C A;  2ZNY A;  4EGZ A;  1QU3 A;  1MKM A;  5DDG A;  1B1B A;  2XVC A;  1A04 A;  2GAU A;  2GZW A;  4PJM A;  4OIR F;  5J6X A;  4OAZ A;  2XGD A;  2QM3 A;  2O9L A;  3EDP A;  3CQZ J;  2PJR B;  3KP2 A;  4IRH A;  4UUT A;  3HG9 A;  2DPD A;  4E7I A;  2CV1 A;  3EQL F;  2GIZ A;  5B5E C;  5IOZ A;  2DYR H;  4HNU A;  2W25 A;  5JLW A;  2HYJ A;  2V1X A;  2X1D A;  3CUQ A;  3AKZ A;  2XRN A;  3LAP A;  3H9Q A;  2A61 A;  5D6E A;  4WXC A;  1QNT A;  2XAQ A;  3I58 A;  5HNF A;  4HA8 A;  3DEE A;  2PQ8 A;  1OR7 A;  4XID A;  1FTZ A;  2Z3Y A;  2FUG 2;  1B72 B;  1IN5 A;  2MYS A;  4D5F A;  3DLA A;  4P96 A;  3N4M A;  1AHD P;  4RB0 A;  2E2H J;  3WTV C;  2JK3 A;  2X6W A;  1MBK A;  2DTR A;  3CCM I;  1IJW C;  5JR3 A;  3PM1 A;  3KZI C;  4D7N A;  4G7O F;  1XGM A;  2A3S A;  2H09 A;  3A02 A;  2E2I J;  3M8E A;  4ZYA A;  4K2E A;  3IH2 A;  1J59 A;  3S3N A;  3HRS A;  3HOW J;  5IYB J;  1HDP A;  2OCE A;  3ECH A;  3CDI A;  4Y7N J;  3IL2 A;  2MD5 A;  4RB1 A;  1XDU A;  3VB2 A;  2KFD A;  1P2F A;  3DKX A;  3ZQL A;  3LA3 A;  1ZN2 A;  1ZLK A;  1T0F A;  4WWC A;  2QBY B;  2P7V B;  3AG2 H;  3F8N A;  2QLZ A;  5CVU A;  1XSV A;  2JUC A;  3IC7 A;  5B66 C;  2DU9 A;  4BBS J;  1BOB A;  3DEU A;  2E19 A;  2Y9Z A;  2KLO A;  3GLX A;  1D5V A;  2VXD A;  4BYY A;  1BBY A;  3ZQH A;  3M3Y J;  4IVN A;  2ZSI B;  2ID6 A;  3U2R A;  5EF6 A;  5CYV A;  4XLE A;  2AHQ A;  4X1E A;  5CQE A;  3VSL A;  4E4H A;  5KNL A;  4RBO A;  1G3W A;  3BC8 A;  2JRM A;  3GTG J;  3JRF A;  2OTL I;  1GHC A;  3CLQ A;  2XHK A;  4XKB A;  1ZRF A;  2MA3 A;  3ECO A;  2WBM A;  4ESF A;  5M5Y J;  2DK5 A;  4EAT A;  2HDW A;  2MFZ A;  4LK1 F;  3LSI A;  4A3L J;  2R5Z B;  4ZYD A;  2L01 A;  3B02 A;  1ETX A;  1P7I A;  2E5Z A;  3UKG A;  3MVP A;  3TMO A;  4BHP A;  4JYK A;  3OSG A;  4IRI A;  3ZQG A;  1UAA A;  2KDZ A;  1O7L A;  3BJA A;  5FB2 A;  4XOP A;  1YIT I;  4KT5 C;  2PG4 A;  3HUG A;  2E1C A;  3ASO H;  2M34 A;  4LGW A;  3TBI A;  4A93 J;  1J7K A;  3GEZ A;  4I99 C;  1G4D A;  1N75 A;  4LK0 F;  2NVU B;  1FP1 D;  1MGT A;  5CPR B;  2BZT A;  1IW7 F;  3ROU A;  1J9I A;  2GIV A;  1EA3 A;  3CD6 I;  9ANT A;  2IRF G;  4BL0 B;  2L3D A;  4LG3 A;  3OOP A;  3ZQQ A;  3ZCO A;  1W5S A;  2AO9 A;  3IAS 2;  3BZC A;  1N78 A;  2M5W A;  1R4M B;  2RGV A;  3TQN A;  4CZC A;  3DKW A;  2OUM A;  2OQR A;  1DPU A;  1QBJ A;  5TRD A;  2P5L C;  1PUE E;  5KCM A;  4ASN A;  2M0C A;  4WXD A;  5TIS C;  1ON1 A;  2EZI A;  2EIL H;  2HI3 A;  1KU7 A;  3HIF A;  5L3B A;  4V2G A;  1JTY A;  3OIQ A;  4BY1 J;  3L2R A;  5AIQ A;  1OCP A;  4HYE A;  1R1U A;  1D1A A;  4M9Z A;  1ETK A;  3KP5 A;  4J00 A;  1O7F A;  4IHV A;  4YFX F;  1A6Q A;  3V7R A;  3CJN A;  3KP3 A;  3W2W A;  3OYG A;  2JA5 J;  3F3X A;  2HXO A;  1H0M A;  4ZDP A;  2K27 A;  4XLH A;  4L5E A;  1X1A A;  2XRL A;  5D6F A;  2PMH A;  5LRR A;  3ZMD A;  2NRA C;  3E7L A;  4XKW A;  3CCJ I;  4LB6 B;  2LK2 A;  2MLG A;  3PL8 A;  3WE3 A;  3S1N J;  4P9U A;  3K70 C;  3GZN B;  3RKQ A;  3OYB A;  4D7M A;  1SMT A;  1MMD A;  5FJ8 J;  5IT9 K;  3BR0 A;  2H6B A;  2NNY A;  4XLP F;  5IPA A;  1RR8 C;  1LVA A;  2LY2 A;  1SFO J;  2AQF A; 
#chains in the Genus database with same CATH homology
 3ABM H;  2EIJ H;  2OCC H;  3ASN H;  5IY5 H;  2EIM H;  2EIN H;  2DYS H;  1OCR H;  3AG4 H;  3ASO H;  2DYR H;  3ABK H;  5B3S H;  1OCO H;  2EIL H;  2EIK H;  3AG2 H;  3AG3 H;  2ZXW H;  3ABL H;  1OCC H;  1V54 H;  5B1A H;  5B1B H;  1V55 H;  3X2Q H;  1OCZ H;  3AG1 H;  3WG7 H;  2Y69 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...