1V55H

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1v55H00
1OCOH 2DYRH 2ZXWH 1OCRH 3ASNH 1OCZH 3AG1H 1OCCH 2EIKH 5IY5H 1V55H 3ABMH 3X2QH 5B3SH 2EILH 3AG3H 3ABKH 3WG7H 2EIMH 3ASOH 2Y69H 3AG2H 5B1AH 2OCCH 3AG4H 2EIJH 2EINH 3ABLH 2DYSH 5B1BH 1V54H
chains in the Genus database with same CATH superfamily
3OIOA 2VASA 2L7ZA 1LUJB 2YX4A 2LNBA 3QOPA 4ZH4F 1UCRA 4KFCA 1W5CC 2X1EA 2XHKA 3DPLC 2XB0X 2K9NA 3GFIA 2FOWA 1HF0A 5L3DA 4PJLA 1ULYA 5E3NA 4BEHA 4DYCA 2QLZA 4L5EA 4U0WA 3H9GA 5TGTA 4ZDPA 3K0LA 4HAMA 4BS9A 3S15J 3K4NA 2DA4A 3VEPA 2R5YA 3UR3C 3VSLA 1IC8A 2KZGA 2DODA 5E1ZB 4PJ0C 4HX4A 1JHFA 2ADUA 2AXLA 1UG2A 2FOKA 3BCAA 3CMYA 4HV5A 4BE1A 1O3SA 2UWMA 2M1BA 1TWGJ 3IWFA 3KLOA 4UV8A 3NWSA 3B6CA 1MMGA 2IA1A 2YX7A 3I64A 1BI3A 1OCCH 3TDUC 2XASA 3AL0C 1PDNC 1E2XA 4FHTA 1DGWY 2VQGA 3AG3H 1S9HA 2WA0A 5D8LB 2QUFA 1JUPA 3KFWX 1DGRM 2XF7A 1GHCA 3CCLI 1ZAOA 3M8JA 4PUSA 1VQOI 4EVIA 2VUMJ 3M1CA 4XSZF 1HKTA 2ELHA 1SAUA 2HQ5A 1SFUA 4HQMA 1ON1A 5DM7F 2ZCWA 2Z3YA 3HOWJ 4BY7J 1A36A 4JP0A 3J7ZI 2EH3A 1ZGWA 2HVRA 3GW2A 2HQAA 3HOUJ 3S1RJ 5ICEA 5FKNA 3ERMA 4QPQA 2F4IA 1OCTC 3I4NJ 4IO9F 3HZJA 2R7XA 1MKMA 2NS8A 5CLSA 3PUBA 2GIZA 2P6TA 3F8FA 2V9KA 4XNFA 1RUOA 5C4XJ 4BQQA 4BXXJ 5JVGF 3HPHA 3HB9A 3F6VA 1V5EA 1BR4A 3MKWB 2CQ7A 4M6XA 2EV6A 4LGWA 2V1XA 1SFKA 2LKXA 2NNNA 3PQKA 4LOCA 2R7WA 4E7JA 5FGMA 1OQYA 2DPDA 4GYIA 2WWYA 2N8GA 2RQQA 3ZMVA 2RC4A 2IXSA 3MFKA 1DP3A 1T08B 5DCMB 4DJAA 2MGQA 2NVYJ 2X0LA 5ICGA 3MKYB 2LD5A 3CP2A 2FQ3A 1ZREA 2DA2A 2NVXJ 1IV8A 5DM6F 4ESBA 1B8IB 1IXCA 1X1AA 2LTPA 4LFUA 4KDPA 1X3WB 4MO7A 2EFPA 4OMZA 4FASD 3SDGA 4M3FA 2COMA 4B43A 2WADA 4ETSA 5K7HA 5LEJA 4XQFA 5J1UA 3L2QA 3HSFA 4BBSJ 1RIOH 2FF4A 3BPVA 3P9IA 3GX4X 1G3TA 5BPIA 1VQMI 2W82A 1ZLJA 5J8CA 1K6OA 4CYDA 3M4OJ 5F1RA 3MAJA 1KU7A 3ZQCA 5AIPA 2V1DA 3SJMA 3WE2A 3EUAA 1K79A 3WG9A 4GDFA 2E71A 1FBUA 1VQ8I 3ZP5A 4E7SA 4XLNF 1R22A 2K27A 1TNSA 3I59B 1Z21A 3DKXA 1JGGA 3O2PE 3ZOBA 2YR2A 4RMNA 1CF7A 3HGGA 4E7LA 1X4PA 2OBPA 1IUFA 2IPQX 2M2EA 3QYEA 3L2CA 2NVTJ 4C2TA 3F8BA 3U2RA 1JI8A 2BXZA 5CJ9A 3HXLA 4NB5A 2HI3A 2Z33A 4BQOA 3MEXA 3C2HA 5DEQA 2XUBA 1J5YA 3P7NA 3EUHC 1T8IA 2DJNA 1VQPI 3QU3A 4UV9A 4IPAA 3OIPA 1HW5A 2DK5A 2ICWG 4PJJA 3A4CA 3PQJA 2M7AA 2Z1DA 3BJ6A 3QAHA 1FYKA 3H3ZA 3GFLA 4ESFA 2CQKA 4A3EJ 3KYCB 3RKQA 1HCRA 4N4OB 2HR3A 1HA8A 2ZC2A 2K9LA 2X4HA 4XN0A 3CCUI 1HC8A 4IEJA 2XAFA 3I0TA 1QU3A 2V9VA 3OV8A 5JI6A 2BVLA 3JRDA 3F9KA 4ON0A 1ERDA 3H3UA 4PGGA 1JKOC 1H9GA 3G4SI 2ZXHA 1WJEA 2P7CB 1U9OA 2DT5A 2KJCA 3EDPA 2X85A 1TWFJ 4HG2A 5M3MJ 2IGKA 3LQQA 1O57A 2CQNA 5LD2C 5A2QZ 2QGUA 2ELJA 1TT5B 1TQPA 2HGCA 3HRSA 5E3MA 4LIVA 1Z91A 1I1SA 2VBYA 3REOA 5ERIA 1ZELA 2LMDA 1H8AC 3DBRB 3HC7A 5J47A 1WJBA 4Y52J 2CV2A 3M9AA 4BGDA 4RB0A 5EGOB 4QWQA 4B44A 4C2UA 3KP3A 3PFYA 3EUKL 4IHVA 1R4NB 5ILUA 2LK2A 3T0YA 2ZSHB 2ZFWA 1O7LA 4PJNA 3WHBA 5GAEJ 2YPRA 2BY2A 1UHSA 5HOOA 1D1AA 3KZZA 2JA8J 4CYCB 1CGPA 4W97A 2MC3A 5D5VB 2EA2A 4RB1A 2HKOA 1MBJA 4A3JJ 2JWTA 1W7PB 3QPLA 1FC3A 4NDLA 1YJ9I 5KAIC 3ZMTA 2JVGA 4N0BA 5IT3A 4CGZA 2JPCA 2R7OA 3RCOA 1SFEA 1W4MA 3FXLA 1WSUA 3AG4H 4L0ZB 1V5GA 2NXNB 3PFIA 4IXAA 3ZMSA 4ENKA 1U78A 2AXTC 3MD2A 4MHGA 1X1PA 4XBFA 4CXFA 3HL2A 2GXAA 3IUOA 3N05A 2VONA 4LLLA 5FB2A 3I53A 3HKZN 4HX8A 4XIDA 5KCMA 1U5TC 4XOTA 1MBFA 3TMOA 1A35A 3OS1A 2F5FA 1P4WA 5TISC 1EKEA 5DUIA 5E20A 4BHBA 1UELB 2X48A 3T8RA 2VC0A 1Z1DA 1VF9A 2XAJA 1K78B 4B09A 3QP5A 4HBLA 3CCYA 4AC0A 4XRSA 2DI3A 1ZG3A 2K7LA 1IRZA 3OSFA 3BR6A 4EQQA 2DFIA 3R6SA 2FXAA 2VKDA 3GFMA 5GPCA 5IYCJ 2FE3A 1XSDA 1O3QA 2BW3A 4J00A 1GDTA 2ZXIA 1ETOA 3M1EA 1WQ2A 5EYRA 1GVDA 2PFBA 2KMUA 2R92J 5IT9K 2ZJRF 4BACA 1X2NA 1GXPA 2DOAA 3GTOJ 4FE7A 1V55H 1BW6A 2OV7A 5J4VA 3F22A 5LRRA 4XSXF 3BZ6A 4L18B 3COAC 1VZ0A 2NNYA 2IS1A 4CZCA 3TP3A 3A03A 1TWHJ 4CCJA 3GTLJ 4G8XA 3W6VA 4XKVA 1XD7A 3WU2C 1SEUA 2YSRA 4K2EA 5IP9J 1MNEA 4WCGA 4WXDA 1HW2A 3F8CA 3E3VA 1LQ1A 4RM2A 1ON2A 2BHYA 2XPWA 3V4GA 1Y39A 2K4JA 2HVSA 3OS2A 1REPC 1ONVA 1D0ZA 1MMSA 1K4SA 1P4XA 2ZFUA 2HOSA 2HYJA 4BU2A 3RTRA 3SHFA 5JVTA 1IZ1A 3RQ4A 2UV1A 1FMVA 4DIQA 4YFXF 4RAGA 4XICA 2ZJ2A 1T95A 2UUZA 2M9HA 2H1KA 2LBFA 5K1YA 1LFUP 3V7CA 1BIBA 4II3A 3HUGB 2JTVA 2ZO4A 2HYGD 5BQTA 2EZKA 2R7TA 1O7FA 4BJ6C 1I1GA 1RETA 2H94A 2I5UA 1SVMA 2KFDA 4II2A 4A5NA 2DLLA 4L5JA 4A3LJ 5DYMA 4KYWA 2X9DA 3CF5F 4XN3A 4Z2YA 4D1QA 2P6SA 3SZPA 4DQ2A 3PO2J 2KJBA 1ETVA 4EJVA 4BEHB 3LL7A 3OOUA 2CW0F 1QPIA 2GA1A 4HDVA 2M45A 4YIIA 3H3VK 3IHUA 3H0DA 3VSKA 3ASNH 1EH6A 3PNVA 4A93J 3R61A 3SEQA 3RKXA 4P9FA 3TO6A 3E5XA 3K4KA 2KIFA 1WCMJ 1R4MB 4RGUA 4S04A 1WZ2A 3WG7H 5K5QA 3BDDA 1TWCJ 2ZB9A 3IV5A 4A3IJ 1PUFA 3MKLA 4M3DA 2HQNA 4B47A 2KLOA 1QBJA 4QLCU 3OR1C 2KL4A 2R7QA 5FLMJ 2IEKA 3CCQI 1V5FA 2DYRH 2ZJQF 2HU9A 4C3IJ 2OC6A 2L54A 4OIQF 2O3FA 3A0BC 2A6HF 3O8GA 4PFPA 2BV6A 3MKZA 1DUXC 1I3QJ 2VBZA 4F52A 3HTSB 3PSIA 2KIUA 4UXNA 4O3MA 3KP2A 2BVMA 5J6XA 2EFWA 1X3ZB 2K4BA 2E1MB 4JK1X 3ZN1A 5JLXA 2XAHA 2UZKA 1JT6A 3H35A 3OS0A 3BOQA 2A3SA 4BUPA 3ULQB 1XC5A 2EZHA 4KIGA 2XKPA 2KZVA 2K5CA 1V4RA 5L3FA 2V4JC 1ZTRA 2X1CA 2HDDA 3MCZA 1XN7A 2VI6A 1D8JA 4B3XA 1P2FA 1O3TA 4OIPF 1VNDA 2BY3A 2DFFA 2J5OA 1MZBA 2O6GE 3CJQB 2HVQA 2R7SA 2WY7Q 2H8WA 1LPQA 4Q4ZF 3RDIA 2BXYA 4XKWA 4AIJA 4OAYA 3J81K 2HZTA 1T39A 3DFGA 3KE2A 3L2WA 4YELA 5CVJA 1WJ5A 2E1NA 3HPGA 1XB4A 1YQAA 1WH7A 4LMYA 1F9NA 1OCZH 2MH2A 2A05A 1K4TA 2EB7A 2O0YA 1T33A 3NARA 2O5RA 2QKMB 1ETYA 1RKWA 4MFEA 4EJUA 1Z6RA 1ORKA 2MLGA 3KCCA 2FRHA 2ZMEA 3JRFA 4HX7A 2HDWA 2EIMH 5F27A 4A3GJ 1WPKA 2LKPA 3BQZA 3FDYA 3HKZA 3TW7A 2EWNA 3I5UA 4ESJA 1BOBA 1YIOA 2KRCA 5BNGA 2K86A 1S5LC 4U87A 3LSPA 2D45A 4BKXA 1XTAA 2LREA 2ECBA 2XF6A 1YYVA 2HWVA 3Q9SA 3KETA 3I9V2 3KP4A 1J59A 5F64A 2M8GX 2OUMA 2Y0MA 1WJDA 2F5VA 5GAGJ 4OWRB 1FNNA 2AQEA 3G3ZA 1A6QA 1JUMA 1BC7C 2O03A 3I4PA 3AG2H 3JR9A 4HV6A 3N97A 2NVQJ 4MQ9F 1IDYA 1CF7B 4A3CJ 5KK1A 4U7BA 4YEJA 2KDOA 3DTEA 3GLXA 2QSGX 3W2AA 1ENHA 2JT1A 1XCBA 5LGNA 1IRFA 2F6CA 2RNGA 1S8NA 3OYIA 2W48A 2DQLA 4HNUA 3HGYA 1WJAA 4LLNA 3G1LA 1PP8F 1PUEE 3FWEA 5H2FC 1YJNI 1W1WE 1WHUA 4JOMA 2QBYB 2V79A 4RAYA 1XS9A 1WVRA 4FX0A 2DMPA 4GCVA 5FKKA 4HF1A 4RLFA 3I58A 4XM3A 1E3OC 5JFRA 3IKVA 4CDGA 3LOCA 2FQ4A 1XSXA 3EYIA 3L2UA 1FJLA 4AVPA 4PGHA 1FP1D 2BE5F 3VYUB 2H8RA 2FD5A 2E1OA 2L7FP 2Y0SA 4U0YA 3BWGA 1MNMC 2RAEA 5DS9A 3CUQA 4IKFA 1LDDA 2WTEA 3GTQJ 3ZQGA 4NNJA 2Y31A 2KISA 3PSFA 2EBIA 1G3YA 1JJ8C 3B6AA 3MZHA 2GOXB 1QZYA 2Q1ZB 4M74A 2CFXA 3DU6A 3WTWC 4G7HF 2Z9OA 3JCUC 1BBYA 4Y13A 3B73A 3ELKA 4MGRA 2NVUB 4A2UA 1E3PA 5FKLA 2QCOA 4UHTA 1QVUA 2G7UA 3J7AO 3K69A 5E3LA 3GTMJ 4RGXA 4Q5SF 1R5ID 1YW9A 4UUTA 1IJWC 2VODA 1RR7A 4ZDOA 1G3SA 5LRSA 2EILH 2MYSA 4ENNA 2L01A 4EJTA 2I10A 1JTXA 3BR1A 1IN5A 4EV0A 1ZH5A 5B1AH 3V7SA 3ZGKA 2KKOA 5BS6A 5J1RA 1BM9A 4B4CA 2DDBA 2VJIA 4BH9A 1YTYA 5IT9Z 1OLTA 2P5KA 4AIDA 4D5CA 2EA4A 1WJCA 2W4SA 3BG6A 3FXQA 3IP4B 2ZJPF 1VQLI 3EUHA 2PG4A 5J3LA 5B5EC 2V7FA 4P5OA 2PI0A 2D2WA 1IXSB 5EEHA 1MMAA 4EM0B 4YG2F 1D8KA 1DU0A 2D5VA 2MLKA 1OYYA 3DTKA 4HZFA 5K5OA 4UNOA 4KT6A 4WXHA 2RGVA 1SD5A 3S8PA 2PMZN 2ZMEC 2VN2A 1YIJI 3DTIA 2L9VA 2F4OB 3HOSA 5H20A 4CCNA 3FMSA 4CCOA 2RNJA 3HOTA 5FD5A 3S93A 3ZRGA 2KHMA 1XCVA 3JRHA 3FHNA 3O8HA 4CCMA 1IN4A 2R5ZA 1FZPB 2KP6A 3CMAI 4NQWA 1T38A 2M87A 3FX3A 3RPUD 2A69F 5GP9A 3R60A 4H0EA 1LFPA 1W36D 3PM1A 5IOZA 4LG0A 4OIRF 2V9PA 1FT9A 3EQLF 2IJLA 2L4AA 2PMHA 2QWWA 1B72A 1K61A 3RI4A 1Z3YA 1IGNA 2E2HJ 3GUDA 3ZN0A 1QVTA 4G7OF 1SFOJ 1ZRFA 3LSMA 1QO0D 2B0LA 1G3WA 4KN7X 4V2GA 5M5XJ 1VQKI 4FX4A 2P4WA 2XAGA 2BW3B 4DNCA 3HTUA 5DV5A 3H92A 3CF2A 4MQVA 2KQRA 4CCLA 3S2WA 5IOYA 3WTZA 1MJBA 1P7JA 4F55A 2R7VA 5IYDJ 1UFMA 4XLFA 1VI0A 3DXJF 1Y0UA 4LG3A 4KNYA 2QA4I 3FIWA 4M9ZA 3C2BA 2QQ9A 4LK0F 4M6YA 2DBBA 1KQ0A 1BJZA 5HS7A 5HDGA 3G2BA 1NK3P 4BHCA 1F43A 3J80Z 9ANTA 4PDKA 2K9QA 1D3YA 3GWZA 3GZNB 3K4CA 3MQ0A 4HSTA 2FNPA 3JSOA 2GOMA 4L9NA 2IS2A 3CUQC 5FRMA 1PVEA 3DKWA 4IF4A 4CSWA 2RVCA 1CQTA 1IXRC 4DYRA 4JQFA 5EG0A 2M3AA 2M4GA 4Y4RA 2MFZA 2K02A 3CQZJ 3IL2A 1Y6IA 3QQAA 3VYRB 4XKBA 2KDZA 3HJEA 3RZDJ 2X6OA 1U5TA 1HXDA 4S0HB 2R7ZJ 2LF7A 1ZARA 2KRFA 3ZMDA 1HKSA 3H5NA 3S16J 2XROA 3K4LA 1I6XA 3SFIA 2MH9A 3KX2A 3CO6C 2PLYA 2LBFB 3CDIA 2DW4A 3OYNA 5L3GA 1I5ZA 4H4KC 3HIFA 2H09A 2K9SA 1QZEA 1NHAA 5LGUA 1TW2A 4KIFA 3M8FA 3SEZA 2M8EA 2ETHA 4RA2A 2DYSH 4ASNA 5HLTA 1TLHB 3GBGA 3HOZJ 2WV1A 2E2JJ 2Z2SB 3GTJJ 5HDNA 1IDZA 1K7AA 1UB9A 3FKIJ 2QQAA 2X6WA 2IA2A 5F04A 3W2WA 2STWA 4MTEA 3AFHA 1HSJA 2K9MA 3BROA 4XRSG 2AS5F 3RJPA 3J81Z 2O61A 1OYIA 2V6EA 3HDDA 4LLGF 3QOEA 5FFZA 1LB2A 4HRIA 4IHSA 2H6BA 3JAMK 2CYYA 1XDSA 2CUZA 3CDHA 1YX5A 4JX4A 2E36A 1MMNA 1DQUA 3I4MJ 1PUFB 3E5QA 4DW6A 1WKMA 4GYGA 4BXFA 1SAXA 1D0XA 3F72A 3MVPA 3R4KA 1IG7A 4QSHA 1YRNA 2XGXA 4IX7A 4IOCF 5EDNA 2WAQN 1BW5A 2WC2A 3JRGA 1FIPA 2HXIA 4B1RA 4ZZDA 3G73A 3M07A 4C3JJ 4I99C 2LF8A 2DMTA 2HOAA 2DQRA 3A2KA 5J8FA 2W1OA 1MNDA 4ABZA 3OYDA 1ACIA 2E35A 2HDCA 3H36A 4BJ5C 2GWRA 2LY1A 3CCSI 1BC8C 2H27A 2XAQA 4KT5C 3CJRB 1TNTA 2GBYA 3CJNA 1JGSA 1BL0A 2UXNA 4HF2A 3IRQA 2AHQA 2DT6A 3ABLH 4AVZA 3HM5A 4FISA 2BYVE 4A69C 3Q0UA 2DN0A 3GO5A 1A5JA 3LAJA 4M71A 4OOIA 3GEZA 4G6QA 2W00A 1QHHD 3LA2A 1YI2I 2HQRA 2RREA 2PMZA 3SFZA 3BR2A 2M7BA 4BBRJ 2VQHA 1S72I 1OPCA 1XPXA 2HTSA 2RN7A 2DPUA 2KPMA 1AA7A 4LB5A 1VQNI 2ZBKA 3Q0WA 1YW7A 2M5WA 1STZA 4CHUA 1XGMA 1BI0A 5LFAA 3AL0B 1YG2A 1TL8A 2B7EA 4I0BA 2EPFA 2O8XA 4RAZA 2P8TA 4U7DA 2OF7A 2QSHX 3KYLA 2L7KA 1Z9CA 5HNFA 1FTTA 3BR0A 1ETWA 3RYRA 2OZ6A 3FXKA 5D4RA 1B9MA 3PL8A 2F5DA 2M0CA 4BNCA 4C9YA 1U3EM 2FJ1A 4L9JA 3FMRA 3DP7A 1FOKA 1GT0C 1KU3A 1BIAA 3M7GA 5HODA 2DA5A 3FBIB 1K83J 4F93B 1R49A 3W6JB 2L9SA 1R7JA 2XGEA 4Y33A 1Y8QB 1BI1A 3HG9A 5DD8A 2A6TA 2P0WA 4RB3C 4IQ4A 2WV0A 2XC7A 2ZXWH 3FK7A 4L9TA 4OINF 3EYYA 2YUSA 2ZXJA 4ANJA 1U6GA 3PO3J 4C30A 2CO5A 2C6YA 3S3OA 5EZGA 5D5XB 3FKJA 5D4SA 2K85A 3DU5A 3TQNA 1I3AA 4O6JA 3O6BB 1BR2A 1IO2A 2JK3A 3ZCOA 4R1HA 2LSOA 5IYBJ 2E7XA 2EINH 3DPUA 4D7MA 1VQ4I 3LAPA 5KNLA 1S7EA 2DTRA 2RQPA 3BY6A 3H0GJ 3VWBA 2VQCA 4IHWA 1R71A 3BQYA 3BTLA 3CD6I 1QZZA 5F6FA 1W5TA 1R58A 3GVAA 3LSKA 3QPTA 5HLHA 3OYHA 3J7AY 2EIKH 5FJ8J 3U9GA 2PEXA 4EM1A 5C4JJ 1WGXA 3RYPA 2PN6A 2LRDA 2OQGA 5BPDA 3BTIA 1YX3A 2D1HA 3FISA 3A01B 4A6EA 3LWFA 2BGCA 4UVCA 1VQ5I 5DDGA 1RRJA 2JMWA 2F5EA 5IP7J 1DDNA 4N9HA 3E5UA 4KJZA 1X1DA 1H89C 1IUYA 1MH4A 4HPQA 2E7WA 3LSRA 3JRAA 2CFOA 3HRTA 3QYBA 2OTLI 1N77A 1FWZA 5AONA 2IS6A 2GZWA 2QVOA 1WJFA 4NC7A 4TV7A 3H9QA 1MGTA 4A3FJ 1RR8C 2JZYA 4AWXB 1B4AA 4HA8A 5LHIA 1Q1VA 3OSGA 2VOPA 5M5YJ 4B3AA 4GRIA 4L0YB 1P6RA 4CH7A 1Z05A 2QZ8A 3T1BA 3SYTA 2A07F 4A0XA 2EFNA 2LYCA 1G4DA 2R5YB 3I59A 4IRIA 5CVRA 3WGHA 3ML6A 3D1NI 3HBLA 1EV7A 4ZJZA 5JHFA 1FBQA 1SANA 1VQ9I 4ZYDA 4XMYA 1L0OC 2EK5A 2XSJC 2HS5A 4FCYA 4DYQA 3WU1B 2H1LA 5D6EA 3NQOA 3HYIA 1R6RA 2ZNYA 4XLPF 1MSFC 4Y3OA 5IP6A 3DPTA 2FU4A 2JA2A 1H0MA 4JBAA 4HDUA 1ZQ3P 4M9SA 2XRNA 3K4JA 1R9TJ 1Z77A 3OYGA 5GAHJ 4IZZA 3B02A 2WAQA 4Y15A 1FOWA 5FFXA 3E0JB 4RAFA 1MBGA 4MTDA 1LFBA 1F1ZA 2IS4A 4FT8A 2ZNZA 3F8MA 4NQWB 2HTJA 2Y69H 1JKQC 3KEOA 4A3DJ 3BC8A 1MJAA 1KU9A 1X58A 2B63J 5FLXK 4XLAA 1KQ9A 4LG0B 5B66C 3K70C 5CVIA 3SDBA 4G7ZF 1N75A 4CZZA 4L5IA 1B72B 1XX5A 1QPMA 4J01A 3SXYA 4ENMA 2IT0A 3TDZC 3HOVJ 1NH3A 3K70D 4I0AA 4KISA 1P4AA 2LG4A 2VT3A 5GADJ 1IN6A 1BA5A 3JRIA 1RKTA 4HLXA 1EH7A 3CMEI 1GUUA 2CU7A 2WAEA 3WGGA 3M8EA 3JTGA 1OR7A 2NYXA 4B48A 5ED4A 4LJZF 1UG0A 1IAWA 1XGNA 1XMAA 4N9IA 4ZC3A 5LEKA 3AAFA 5TRDA 4M3EA 1ZG5A 4XORA 4M3BA 1RESA 3DF8A 1J09A 1QNTA 2CW8A 2VJ5A 3ECHA 1Z7LA 3T5XA 2X1DA 1U9NA 5KVRA 3FXUA 3ZQ7A 5ICCA 4WWCA 3LNQA 1LE8A 1G6NA 1ZGJA 3ZQQA 3TEDA 2Y2ZA 2JSCA 1WFXA 2XPUA 2JUGA 3FXMA 5F0CA 5EGOA 1S6LA 3ABMH 5IPAA 4DBRA 3JSPA 1Q1HA 1R23A 1H9TA 1FLIA 2CQXA 2CWEA 3S3MA 4BAYA 3R0JA 3LFKA 2LLKA 1LNWA 2Y30A 4BL0B 4Q48A 1B1BA 2G7HA 4DGWB 5E18F 2R7FA 3Q5FA 1AU7A 3RPUA 5DTDA 4ZYGA 5EG0B 4CCKA 2WAFA 5TJJA 1TP4A 1USTA 4LB6B 3RIRA 4BYYA 1PP7U 1RNLA 3HHGA 3OL3A 4MNUA 1MBKA 1UZCA 1KGSA 4E70A 4NHJA 4X1EA 3WGIA 1PJRA 5CVVA 3GMEA 2XSDC 3RQIA 1TZLA 1U5TB 3C1DA 2Y75A 5ICFA 2M30A 3KEYA 5KAFC 3GFJA 3DKYA 1MDMA 5HS9A 1LVKA 1R5HA 4KIBA 1OJLA 1D5YA 1TTYA 4I09A 2R7UA 5LGTA 1SC7A 2JVHA 3VYSB 2ME6A 2WBMA 1K78A 2Y48A 3UNGC 3K9TA 3IH3A 5GTIC 3TBIA 4IRGA 1YS6A 4BQAA 1QGPA 2P5VA 2EFQA 3A0HC 3S2HJ 2XPVA 4F7ZA 5HDKA 2IP2A 2QQBA 2VPRA 2XGDA 4I02A 2W7NA 3WODF 4IOAF 2ESNA 1ZYRF 3OMYA 4E6KG 3GZ6A 1OFCX 2L02A 5L3EA 2JN6A 2EV5A 4G9YA 2W84A 1QRYA 4IVNA 2ELKA 4F3QA 4A3KJ 4UY8I 1OKRA 1YOVB 2XIGA 4AIHA 3U1DA 2NRAC 2PBIA 4Y7NJ 3CCEI 3IRRA 1HDDC 2E2IJ 1YLFA 1WWXA 5F0HA 5DUKA 1JKPC 5H6QA 5F0FA 2HOTA 3DQVC 3VYTB 4BXUA 3K2ZA 2VPLA 3L7WA 2PJRA 3I55I 1RZ4A 4XONA 5FRNA 3CCJI 1SD7A 3Q0VA 4KUMA 4BE2A 1Y1WJ 1I50J 2ID6A 1MSEC 2LY9A 5D6FA 2OU2A 2V1UA 5HLGA 2Q8KA 1YRNB 1LEBA 4C2MJ 4M72A 2DMQA 3D0SA 1SVOA 5FD6A 3E6CC 4HEA2 1GXQA 1E3HA 2GIVA 4R79A 3NRVA 4G94A 1JE8A 3GZ5A 1HW1A 1W0UA 5E3OA 3HEFA 4XKCA 2DTZA 1MH3A 4I01A 3DV8A 1D0YA 3BZCA 1FIAA 4RS8A 2DFEA 4HW0A 3U21A 4JX5A 2E1CA 1X1BA 1YO5C 3LA3A 3QU6A 4PSWA 3CC4I 4M9XA 3OYFA 1DPUA 1JJ6C 4A5MA 3G1MA 3K6GA 2COBA 2FNAA 2TCTA 3RZOJ 4OAZA 3OYBA 3ASOH 3K1PA 3LMMA 1IRGA 1OR7C 2X6YA 1T56A 3CZ6A 2ESHA 3S1NJ 1BR1A 3KYDB 1AOYA 2F4MB 4LK1F 3KEQA 1Y8RB 1JUSA 1ZGAA 2KIMA 1G2HA 3KPHA 1KYWA 4I76A 2AQFA 2JRTA 3ABTA 3C2GA 2XVCA 1T6SA 2K3FA 4W1UA 1JT0A 1FP2A 4XRMA 3L2RA 2EZLA 2X6XA 3W3CA 1RUNA 2PX9A 5B3SH 2W24A 4RLQA 1IN7A 3ROUA 5E1WA 4NC6A 2DMNA 3IAS2 4EJOA 3BTJA 2XB5A 5FLVA 3CJTB 4ZYHA 4BHPA 4M6VA 5E17F 4RGRA 3H1CA 5KHDA 4O5VA 4I7HA 4PK4A 2PJPA 3LFUA 1T98A 1W36C 3IAM2 2LKSA 3BR5A 3F23A 3K2AA 1W7PD 2HNHA 3CESA 3C18A 3ZQIA 4BQNA 4A6DA 3QYFA 4BY1J 1YFHA 2YU3A 5EEGA 1HDPA 4BDZA 2OZUA 3C3WA 4B8XA 4UUSA 4DOZA 1XSVA 2LVSA 5HLIA 5JR3A 1IF1A 1LKXA 4FETA 3GXOA 2L9NA 4M3GA 2DK8A 1QHGA 3E7LA 2CRGA 2CGPA 3QP6A 4EEFG 2WY8Q 1JTYA 2PQ8A 3DCFA 1I27A 3IC7A 2VLAA 4EM2A 4E7ZA 3E6MA 4XK4A 3CLOA 3FZVA 1VQ7I 2L3DA 4P1WA 4YRVA 1BOAA 1ZKGA 1JHHA 3BR3A 2A5WA 4HQEA 1FYLA 3CUOA 2CMPA 2LR8A 2OCEA 2Y9YA 3WHCA 3DBLB 3FXJA 4AIKA 3U1KA 1S3JA 2DA1A 4HNVA 3P9CA 1AKHA 1BJAA 2MG4A 1EA3A 2VT2A 3KP6A 1QA6A 1HLVA 3VB2A 2L9RA 3LA7A 4KMFA 2LP0A 1S7OA 3S1MJ 2XRLA 4XL9A 3SZTA 4F91B 1OCPA 1TQIA 4HYEA 1TQMA 3S32A 3LSGA 1X3UA 3HOYJ 3PNYA 2LC2A 2Q0OA 3QRFF 3OOPA 5CKTA 5HS8A 4V19K 2FSWA 3BLYA 3QWLA 3BTCA 5D5UB 1YHQI 1FBSA 1SD4A 3DEWA 1AHDP 3EETA 2OTJI 3E97A 4Y17A 2M4KA 2ZSIB 5M5WJ 2KRHA 2FBHA 3DEUA 2DXIA 3WU0A 2E34A 1IRXA 2ISYA 3DEEA 3BZKA 4AU7A 4A0ZA 3WTSC 3DLAA 3VPRA 1UMQA 2L0KA 1F5TA 4QTRA 2E5ZA 3TOBA 5FLXZ 4ZTJA 2FBIA 4RM3A 1XMKA 2DCEA 3LQRA 1ZR2A 2A61A 3TP0A 2HPIA 3S2DJ 2HZDA 2CW7A 2RDPA 2XGCA 2KIQA 1U2WA 3CDLA 2HPMA 4J19A 4IHXA 2JRMA 3K1NA 3QPHA 2IGNA 2CUJA 3P9KA 1KA8A 4ENJA 4RDUA 3GYHX 3MMYB 2XAUA 3E6BA 4DBQA 4HOBA 2VE8A 3TGNA 1MIJA 2FX0A 2CH0A 5CQEA 2VOOA 1XMXA 2QYOA 4HSRA 3PJRA 2FMYA 2D1VA 1Z6TA 2JPBA 1E17A 4ZYAA 4EGZA 3ZQHA 2GXBA 3PUFA 1SMYF 1MBHA 5JLWA 5BMZA 3VDXA 3K1MA 1XG1A 1OYWA 1G8XA 2Q2EA 2DU9A 2R3SA 2IVMA 1YITI 3MZ8A 3TW6A 1R00A 3L9FA 3ERED 2QBYA 3RKYA 1D1CA 1HSTA 2BHZA 2QM3A 2QKLB 2P81A 1TBXA 2IW5A 1VTNC 3DWLE 3C7JA 3BJOA 2W25A 3OYLA 3OYCA 3S17J 1A04A 2JJ7A 4PFOA 2EZIA 1B6AA 3F8NA 5FKOA 5L3CA 1T2KA 2OCCH 2CQQA 2JA5J 3CC2I 5C44J 2TRTA 4FE4A 1DP7P 2Z5UA 1A6IA 3Q9VA 3DLLF 3H5RA 5B1BH 3TKYA 4A12A 1J9IA 1OCOH 1HBXG 2ISZA 3A02A 3JREA 2NS0A 1ODDA 2DDAA 2EJRA 2TDXA 1WI9A 1VQ6I 1LVAA 4P9UA 3E1SA 3L00A 1UAAA 5IY5H 1I39A 1RI7A 5LHGA 1NG7A 3GF2A 2YU9J 1N78A 3GTPJ 2JUCA 3ZQFA 2DMUA 2E1MC 3J7YJ 2QENA 2VKEA 4XRFA 1Y0NA 4EATA 3F21A 1O3RA 2EIJH 1GV5A 2LOOA 3BG5A 3SQNA 3I3LA 1RPWA 1XGSA 3LSTA 3OYKA 3V42A 1IV6A 2O9LA 2W85A 3FHZA 1OCRH 3FMQA 3A1YA 3ECOA 3BPXA 3PIOF 2VL8A 4MEYF 2M0MA 2VC1A 1LE8B 1APLC 1L3LA 4IQJA 3W2VA 1I6HJ 5E79C 5K7ZA 2O7OA 2IGOA 1FYMA 4BJTA 1XDUA 4HNTA 3ONQA 1KQ8A 5E1XA 1B9NA 2OPTA 5LHHA 3WTVC 4MLOA 2ZMEB 4WX9A 3EPZA 1FPQA 4E7IA 1W0TA 2GA2A 4ZTFA 1PYVA 2E60A 4EJWA 5D5WB 2CV0A 4EGYA 2IBDA 2JA7J 3BG3A 1GV2A 2BZTA 4R8HA 4S05A 1ZRCA 4CICA 3DBHB 4IHTA 2MD0A 2NAZA 4GXOA 1U0JA 3I71A 2CJJA 2ECCA 3N4MA 4D5FA 2LH9A 1O4XA 3AKZA 3OY9A 1X2MA 1YS7A 3BG9A 1J2XA 3ABKH 5J4YA 1SD6A 3O3KA 2E19A 2L4MA 3KIOA 4ZYEA 2DOFA 2DA7A 2LFBA 3FK6A 5E8IA 3ISPA 1VFCA 2EV0A 1KONA 1TW3A 3LSJA 2KT0A 5ILVA 4CA0A 1MDMB 1IW7F 2MBFA 4OIOF 2MW8A 1Y56A 3IKTA 4IJAA 2DA3A 4M73A 4AM3A 1DU6A 3S1QJ 2A68F 2O8KA 3QODA 4A0YA 3KP5A 4P96A 3V7RA 1F4KA 1N25A 4AYBN 2ID3A 3MWMA 3QPSA 3ESWB 3F3XA 4KN4X 2QSFX 2Y9ZA 2V26A 1KZHA 3V8JA 1X4OA 3K4BA 3WTUC 1QQIA 1HOMA 1ETXA 1B59A 2E5NA 5C3EJ 1M1EB 3KLNA 2LY2A 2QF7A 4HLYA 2F2EA 1V54H 2OJED 3V8LA 1YW8A 4NC8A 2DAOA 4CO8A 3CCVI 2BEOA 2XV4S 4YIRX 3ZQLA 2ME0A 4UVBA 3L2VA 1GLNA 3NAUA 2B9SA 2VQLA 1KU2A 1Y1VJ 2DO7A 2Z99A 4G12A 5CPRB 1U8BA 2XF5A 5DCMA 2PJRB 1OISA 1U8RA 1X19A 4LIUA 2UXXA 3H5AA 3G1OA 3D5RC 4C3HJ 3GTGJ 3Q3SA 3CUQB 5L3BA 1FTZA 1B8IA 5CYVA 1BI2A 3RSNA 5JHUA 5M3FJ 2CUEA 4LD5A 3ZPLA 2GLOA 2VJJA 3BJAA 5FKMA 2QEXI 1MMDA 4KMUX 3W6KB 4I98B 2MD5A 2G0EA 4IL6C 1ZR4A 2DT7B 2J5PA 2VB6A 1ITYA 2A5YB 3G71I 1IN8A 2Y0SN 1Z7UA 4E7KA 1MW7A 5GPAA 4XLHA 4CUGA 4WK8F 4GO1A 4UVAA 3WE3A 1FSHA 3JTHA 1POGA 5D8KB 3FXRA 3VFZA 2WB1N 2NOJB 1X1CA 4XOPA 2IA0A 3OWTA 3HOXJ 3CCMI 4AD9A 5ILSA 4KA4A 1FOXA 2HXOA 3MZYA 1WRJA 4XLEA 4PCQA 4V2FA 3PIPF 3D5LA 3JRCA 4FTHA 2OA4A 2HEOA 3KZYA 4A3MJ 3LSHA 1J75A 4UUVA 3I56I 3IH2A 4WXCA 1JXSA 1HKQA 3MN2A 1TT0A 1J7KA 1MD0A 4JX6A 1ZG1A 1EJ9A 2A6EF 3NWTA 4G6DA 1T0FA 4BDYA 3S3NA 1V3FA 2CG4A 4IHYA 4N4NB 3PNTA 1JKRC 1R1UA 1LEAA 3J80K 3ZXSA 2NS7A 3GLLA 2L2OA 3L1PA 3CO7C 2R5ZB 1S29A 2CV1A 1SFXA 3GTKJ 1FEXA 1J0RA 2VXZA 2R0QC 5FROA 1FX7A 2K40A 3IWZA 4MEXF 5EJCA 1ZRDA 3KP7A 5E8GA 1P92A 3HSEA 4DZPA 2VIXA 2CS3A 2L7MP 3FM5A 2XKOA 1SMTA 5F08A 3TL4X 4KICA 1R1TA 4UUSB 2MA3A 3ZR8X 2HYFA 3JRBA 1S7AA 3OYJA 1NK2P 4MFDA 1XGOA 2GAUA 4UB8C 4JYKA 3T8TA 1H88C 2IRFG 4Z6YA 5CQGA 2L5QA 1R1VA 4PSXA 2Z16A 2VKHA 3K4MA 2VBXA 2LDUA 2IGMA 4P55A 4D0PA 1TWAJ 2R4GA 2BY0A 2MC4A 2M34A 1SVLA 2DOEA 4G6TB 4D9JA 3HHHA 3VODA 3G6EI 2AO9A 1W5SA 2H6CA 2ZKZA 5LLQA 4MIMA 1DPRA 2JQ7A 3HSRA 2GXGA 3F0CA 3FF5A 3IH4A 4XR6A 5DD4A 4FQGA 2FA5A 1P7IA 4GGGA 4GFBA 5EF6A 1FY7A 4XLCA 3FBNB 3JW4A 1MJ9A 4ZDLA 4EMSA 2X51A 2W57A 3M3YJ 1R36A 2V6CA 4I2OA 2MABA 3I54A 3S14J 2EQRA 2FBKA 5J40A 3BT9A 3AG1H 1AKHB 1WI3A 1UJ8A 3NEUA 4OU0A 4AUXA 4QPOA 3F6OA 5BOXA 5F1JA 1NTCA 2OAZA 4D7NA 1YE9A 3JAMZ 2R7RA 4YFNF 2OQRA 3WTXC 2P5LC 1D5VA 2QQ8A 3LSIA 2OD5A 2F5CA 3OYAA 2JSPA 4WF2A 3WTTC 5HVQC 3ZMUA 3CTAA 3WTYC 4CYCA 1Z67A 4ZZLA 2HFHA 3KZIC 3TO7A 2FEZA 3OIQA 3R0AA 4PZJA 1W7PA 3FM3A 2HKXA 1KYZA 2IAIA 5J1YA 3BP8A 4HF0A 4DZJA 2NOGA 5AIQA 3K7AJ 1EF4A 5GTHC 4X6AJ 3HRMA 1ZLKA 1FOYA 4RB2C 3OYMA 2ACJA 2FMLA 5LBQA 1LDJA 4Q47A 2CSOA 2EFOA 2R7DA 3OL4A 1F36A 2P7VB 3CLQA 2DA6A 3H9JA 4A3BJ 1MBEA 2CUFA 3L09A 2VKVA 4I6ZA 1LDKB 2BOLA 3BG7A 5CVUA 4BE0A 4UB6C 3E6DA 4LITA 1AWCA 4QIWN 2F48A 5K7FA 2YS9A 5K5RA 3UKGA 3CC7I 3OR2C 3P5JA 3V8KA 4AYBA 4E7HA 2RV8A 5A2QK 3X2QH 3TO9A 2VE9A 2JA6J 4KITB 1OMIA 4NUBA 4RBOA 1P9QC 1R5GA 1GVJA 5H6RA 1ZK8A 3HRUA 1ZN2A 5HNHA 2R93J 3RKWA 4OMYA 2G9WA 1T0FC 2RKHA 2BBYA 2FUG2 2VJ4A 2Q2EB 3CMMA 2DFHA 3TOAA 2GM4A 2MSYA 1FSEA 4YFKF 1HQCA 4ITVA 4NBQA 5DCFA 4U88A 3FXOA 3D5SC 4X0GA 3BCBA 2DJIA 1G59A 4F92B 3OYEA 1USSA 1Z3XA 3VOEA 1RC9A 1ETQA 4IRHA 2I8DA 1YJWI 2STTA 2VBWA 2VXDA 1TC3C 2GQQA 2K3PA 1A31A 4L9VA 4YIFA 1Z0XA 4U0VA 1EH8A 2PMUA 1LJ9A 1NG6A 4E4HA 3SZGA 5EEAA 1ZHFA 1FMWA 3ZMZA 2V1NA 3CCRI 2BY1A 6PAXA 1BN5A 3A01A 1UHWA 3GCMA 5EZHA 2HOEA 4RGSA 2WB1A 1UHMA 3CP8A 1D1BA 1K6YA 3ABUA 1WH5A 1E0EA 3K10A 3HUGA 1ETKA 3RPQA 1C0WA 2XDVA 5FO5A 4PJMA
chains in the Genus database with same CATH topology
1OCOH 2DYRH 2ZXWH 1OCRH 3ASNH 1OCZH 3AG1H 1OCCH 2EIKH 5IY5H 1V55H 3ABMH 3X2QH 5B3SH 2EILH 3AG3H 3ABKH 3WG7H 2EIMH 3ASOH 2Y69H 3AG2H 5B1AH 2OCCH 3AG4H 2EIJH 2EINH 3ABLH 2DYSH 5B1BH 1V54H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO H;  2DYR H;  2ZXW H;  1OCR H;  3ASN H;  1OCZ H;  3AG1 H;  1OCC H;  2EIK H;  5IY5 H;  1V55 H;  3ABM H;  3X2Q H;  5B3S H;  2EIL H;  3AG3 H;  3ABK H;  3WG7 H;  2EIM H;  3ASO H;  2Y69 H;  3AG2 H;  5B1A H;  2OCC H;  3AG4 H;  2EIJ H;  2EIN H;  3ABL H;  2DYS H;  5B1B H;  1V54 H; 
#chains in the Genus database with same CATH topology
 3OIO A;  2VAS A;  2L7Z A;  1LUJ B;  2YX4 A;  2LNB A;  3QOP A;  4ZH4 F;  1UCR A;  4KFC A;  1W5C C;  2X1E A;  2XHK A;  3DPL C;  2XB0 X;  2K9N A;  3GFI A;  2FOW A;  1HF0 A;  5L3D A;  4PJL A;  1ULY A;  5E3N A;  4BEH A;  4DYC A;  2QLZ A;  4L5E A;  4U0W A;  3H9G A;  5TGT A;  4ZDP A;  3K0L A;  4HAM A;  4BS9 A;  3S15 J;  3K4N A;  2DA4 A;  3VEP A;  2R5Y A;  3UR3 C;  3VSL A;  1IC8 A;  2KZG A;  2DOD A;  5E1Z B;  4PJ0 C;  4HX4 A;  1JHF A;  2ADU A;  2AXL A;  1UG2 A;  2FOK A;  3BCA A;  3CMY A;  4HV5 A;  4BE1 A;  1O3S A;  2UWM A;  2M1B A;  1TWG J;  3IWF A;  3KLO A;  4UV8 A;  3NWS A;  3B6C A;  1MMG A;  2IA1 A;  2YX7 A;  3I64 A;  1BI3 A;  1OCC H;  3TDU C;  2XAS A;  3AL0 C;  1PDN C;  1E2X A;  4FHT A;  1DGW Y;  2VQG A;  3AG3 H;  1S9H A;  2WA0 A;  5D8L B;  2QUF A;  1JUP A;  3KFW X;  1DGR M;  2XF7 A;  1GHC A;  3CCL I;  1ZAO A;  3M8J A;  4PUS A;  1VQO I;  4EVI A;  2VUM J;  3M1C A;  4XSZ F;  1HKT A;  2ELH A;  1SAU A;  2HQ5 A;  1SFU A;  4HQM A;  1ON1 A;  5DM7 F;  2ZCW A;  2Z3Y A;  3HOW J;  4BY7 J;  1A36 A;  4JP0 A;  3J7Z I;  2EH3 A;  1ZGW A;  2HVR A;  3GW2 A;  2HQA A;  3HOU J;  3S1R J;  5ICE A;  5FKN A;  3ERM A;  4QPQ A;  2F4I A;  1OCT C;  3I4N J;  4IO9 F;  3HZJ A;  2R7X A;  1MKM A;  2NS8 A;  5CLS A;  3PUB A;  2GIZ A;  2P6T A;  3F8F A;  2V9K A;  4XNF A;  1RUO A;  5C4X J;  4BQQ A;  4BXX J;  5JVG F;  3HPH A;  3HB9 A;  3F6V A;  1V5E A;  1BR4 A;  3MKW B;  2CQ7 A;  4M6X A;  2EV6 A;  4LGW A;  2V1X A;  1SFK A;  2LKX A;  2NNN A;  3PQK A;  4LOC A;  2R7W A;  4E7J A;  5FGM A;  1OQY A;  2DPD A;  4GYI A;  2WWY A;  2N8G A;  2RQQ A;  3ZMV A;  2RC4 A;  2IXS A;  3MFK A;  1DP3 A;  1T08 B;  5DCM B;  4DJA A;  2MGQ A;  2NVY J;  2X0L A;  5ICG A;  3MKY B;  2LD5 A;  3CP2 A;  2FQ3 A;  1ZRE A;  2DA2 A;  2NVX J;  1IV8 A;  5DM6 F;  4ESB A;  1B8I B;  1IXC A;  1X1A A;  2LTP A;  4LFU A;  4KDP A;  1X3W B;  4MO7 A;  2EFP A;  4OMZ A;  4FAS D;  3SDG A;  4M3F A;  2COM A;  4B43 A;  2WAD A;  4ETS A;  5K7H A;  5LEJ A;  4XQF A;  5J1U A;  3L2Q A;  3HSF A;  4BBS J;  1RIO H;  2FF4 A;  3BPV A;  3P9I A;  3GX4 X;  1G3T A;  5BPI A;  1VQM I;  2W82 A;  1ZLJ A;  5J8C A;  1K6O A;  4CYD A;  3M4O J;  5F1R A;  3MAJ A;  1KU7 A;  3ZQC A;  5AIP A;  2V1D A;  3SJM A;  3WE2 A;  3EUA A;  1K79 A;  3WG9 A;  4GDF A;  2E71 A;  1FBU A;  1VQ8 I;  3ZP5 A;  4E7S A;  4XLN F;  1R22 A;  2K27 A;  1TNS A;  3I59 B;  1Z21 A;  3DKX A;  1JGG A;  3O2P E;  3ZOB A;  2YR2 A;  4RMN A;  1CF7 A;  3HGG A;  4E7L A;  1X4P A;  2OBP A;  1IUF A;  2IPQ X;  2M2E A;  3QYE A;  3L2C A;  2NVT J;  4C2T A;  3F8B A;  3U2R A;  1JI8 A;  2BXZ A;  5CJ9 A;  3HXL A;  4NB5 A;  2HI3 A;  2Z33 A;  4BQO A;  3MEX A;  3C2H A;  5DEQ A;  2XUB A;  1J5Y A;  3P7N A;  3EUH C;  1T8I A;  2DJN A;  1VQP I;  3QU3 A;  4UV9 A;  4IPA A;  3OIP A;  1HW5 A;  2DK5 A;  2ICW G;  4PJJ A;  3A4C A;  3PQJ A;  2M7A A;  2Z1D A;  3BJ6 A;  3QAH A;  1FYK A;  3H3Z A;  3GFL A;  4ESF A;  2CQK A;  4A3E J;  3KYC B;  3RKQ A;  1HCR A;  4N4O B;  2HR3 A;  1HA8 A;  2ZC2 A;  2K9L A;  2X4H A;  4XN0 A;  3CCU I;  1HC8 A;  4IEJ A;  2XAF A;  3I0T A;  1QU3 A;  2V9V A;  3OV8 A;  5JI6 A;  2BVL A;  3JRD A;  3F9K A;  4ON0 A;  1ERD A;  3H3U A;  4PGG A;  1JKO C;  1H9G A;  3G4S I;  2ZXH A;  1WJE A;  2P7C B;  1U9O A;  2DT5 A;  2KJC A;  3EDP A;  2X85 A;  1TWF J;  4HG2 A;  5M3M J;  2IGK A;  3LQQ A;  1O57 A;  2CQN A;  5LD2 C;  5A2Q Z;  2QGU A;  2ELJ A;  1TT5 B;  1TQP A;  2HGC A;  3HRS A;  5E3M A;  4LIV A;  1Z91 A;  1I1S A;  2VBY A;  3REO A;  5ERI A;  1ZEL A;  2LMD A;  1H8A C;  3DBR B;  3HC7 A;  5J47 A;  1WJB A;  4Y52 J;  2CV2 A;  3M9A A;  4BGD A;  4RB0 A;  5EGO B;  4QWQ A;  4B44 A;  4C2U A;  3KP3 A;  3PFY A;  3EUK L;  4IHV A;  1R4N B;  5ILU A;  2LK2 A;  3T0Y A;  2ZSH B;  2ZFW A;  1O7L A;  4PJN A;  3WHB A;  5GAE J;  2YPR A;  2BY2 A;  1UHS A;  5HOO A;  1D1A A;  3KZZ A;  2JA8 J;  4CYC B;  1CGP A;  4W97 A;  2MC3 A;  5D5V B;  2EA2 A;  4RB1 A;  2HKO A;  1MBJ A;  4A3J J;  2JWT A;  1W7P B;  3QPL A;  1FC3 A;  4NDL A;  1YJ9 I;  5KAI C;  3ZMT A;  2JVG A;  4N0B A;  5IT3 A;  4CGZ A;  2JPC A;  2R7O A;  3RCO A;  1SFE A;  1W4M A;  3FXL A;  1WSU A;  3AG4 H;  4L0Z B;  1V5G A;  2NXN B;  3PFI A;  4IXA A;  3ZMS A;  4ENK A;  1U78 A;  2AXT C;  3MD2 A;  4MHG A;  1X1P A;  4XBF A;  4CXF A;  3HL2 A;  2GXA A;  3IUO A;  3N05 A;  2VON A;  4LLL A;  5FB2 A;  3I53 A;  3HKZ N;  4HX8 A;  4XID A;  5KCM A;  1U5T C;  4XOT A;  1MBF A;  3TMO A;  1A35 A;  3OS1 A;  2F5F A;  1P4W A;  5TIS C;  1EKE A;  5DUI A;  5E20 A;  4BHB A;  1UEL B;  2X48 A;  3T8R A;  2VC0 A;  1Z1D A;  1VF9 A;  2XAJ A;  1K78 B;  4B09 A;  3QP5 A;  4HBL A;  3CCY A;  4AC0 A;  4XRS A;  2DI3 A;  1ZG3 A;  2K7L A;  1IRZ A;  3OSF A;  3BR6 A;  4EQQ A;  2DFI A;  3R6S A;  2FXA A;  2VKD A;  3GFM A;  5GPC A;  5IYC J;  2FE3 A;  1XSD A;  1O3Q A;  2BW3 A;  4J00 A;  1GDT A;  2ZXI A;  1ETO A;  3M1E A;  1WQ2 A;  5EYR A;  1GVD A;  2PFB A;  2KMU A;  2R92 J;  5IT9 K;  2ZJR F;  4BAC A;  1X2N A;  1GXP A;  2DOA A;  3GTO J;  4FE7 A;  1V55 H;  1BW6 A;  2OV7 A;  5J4V A;  3F22 A;  5LRR A;  4XSX F;  3BZ6 A;  4L18 B;  3COA C;  1VZ0 A;  2NNY A;  2IS1 A;  4CZC A;  3TP3 A;  3A03 A;  1TWH J;  4CCJ A;  3GTL J;  4G8X A;  3W6V A;  4XKV A;  1XD7 A;  3WU2 C;  1SEU A;  2YSR A;  4K2E A;  5IP9 J;  1MNE A;  4WCG A;  4WXD A;  1HW2 A;  3F8C A;  3E3V A;  1LQ1 A;  4RM2 A;  1ON2 A;  2BHY A;  2XPW A;  3V4G A;  1Y39 A;  2K4J A;  2HVS A;  3OS2 A;  1REP C;  1ONV A;  1D0Z A;  1MMS A;  1K4S A;  1P4X A;  2ZFU A;  2HOS A;  2HYJ A;  4BU2 A;  3RTR A;  3SHF A;  5JVT A;  1IZ1 A;  3RQ4 A;  2UV1 A;  1FMV A;  4DIQ A;  4YFX F;  4RAG A;  4XIC A;  2ZJ2 A;  1T95 A;  2UUZ A;  2M9H A;  2H1K A;  2LBF A;  5K1Y A;  1LFU P;  3V7C A;  1BIB A;  4II3 A;  3HUG B;  2JTV A;  2ZO4 A;  2HYG D;  5BQT A;  2EZK A;  2R7T A;  1O7F A;  4BJ6 C;  1I1G A;  1RET A;  2H94 A;  2I5U A;  1SVM A;  2KFD A;  4II2 A;  4A5N A;  2DLL A;  4L5J A;  4A3L J;  5DYM A;  4KYW A;  2X9D A;  3CF5 F;  4XN3 A;  4Z2Y A;  4D1Q A;  2P6S A;  3SZP A;  4DQ2 A;  3PO2 J;  2KJB A;  1ETV A;  4EJV A;  4BEH B;  3LL7 A;  3OOU A;  2CW0 F;  1QPI A;  2GA1 A;  4HDV A;  2M45 A;  4YII A;  3H3V K;  3IHU A;  3H0D A;  3VSK A;  3ASN H;  1EH6 A;  3PNV A;  4A93 J;  3R61 A;  3SEQ A;  3RKX A;  4P9F A;  3TO6 A;  3E5X A;  3K4K A;  2KIF A;  1WCM J;  1R4M B;  4RGU A;  4S04 A;  1WZ2 A;  3WG7 H;  5K5Q A;  3BDD A;  1TWC J;  2ZB9 A;  3IV5 A;  4A3I J;  1PUF A;  3MKL A;  4M3D A;  2HQN A;  4B47 A;  2KLO A;  1QBJ A;  4QLC U;  3OR1 C;  2KL4 A;  2R7Q A;  5FLM J;  2IEK A;  3CCQ I;  1V5F A;  2DYR H;  2ZJQ F;  2HU9 A;  4C3I J;  2OC6 A;  2L54 A;  4OIQ F;  2O3F A;  3A0B C;  2A6H F;  3O8G A;  4PFP A;  2BV6 A;  3MKZ A;  1DUX C;  1I3Q J;  2VBZ A;  4F52 A;  3HTS B;  3PSI A;  2KIU A;  4UXN A;  4O3M A;  3KP2 A;  2BVM A;  5J6X A;  2EFW A;  1X3Z B;  2K4B A;  2E1M B;  4JK1 X;  3ZN1 A;  5JLX A;  2XAH A;  2UZK A;  1JT6 A;  3H35 A;  3OS0 A;  3BOQ A;  2A3S A;  4BUP A;  3ULQ B;  1XC5 A;  2EZH A;  4KIG A;  2XKP A;  2KZV A;  2K5C A;  1V4R A;  5L3F A;  2V4J C;  1ZTR A;  2X1C A;  2HDD A;  3MCZ A;  1XN7 A;  2VI6 A;  1D8J A;  4B3X A;  1P2F A;  1O3T A;  4OIP F;  1VND A;  2BY3 A;  2DFF A;  2J5O A;  1MZB A;  2O6G E;  3CJQ B;  2HVQ A;  2R7S A;  2WY7 Q;  2H8W A;  1LPQ A;  4Q4Z F;  3RDI A;  2BXY A;  4XKW A;  4AIJ A;  4OAY A;  3J81 K;  2HZT A;  1T39 A;  3DFG A;  3KE2 A;  3L2W A;  4YEL A;  5CVJ A;  1WJ5 A;  2E1N A;  3HPG A;  1XB4 A;  1YQA A;  1WH7 A;  4LMY A;  1F9N A;  1OCZ H;  2MH2 A;  2A05 A;  1K4T A;  2EB7 A;  2O0Y A;  1T33 A;  3NAR A;  2O5R A;  2QKM B;  1ETY A;  1RKW A;  4MFE A;  4EJU A;  1Z6R A;  1ORK A;  2MLG A;  3KCC A;  2FRH A;  2ZME A;  3JRF A;  4HX7 A;  2HDW A;  2EIM H;  5F27 A;  4A3G J;  1WPK A;  2LKP A;  3BQZ A;  3FDY A;  3HKZ A;  3TW7 A;  2EWN A;  3I5U A;  4ESJ A;  1BOB A;  1YIO A;  2KRC A;  5BNG A;  2K86 A;  1S5L C;  4U87 A;  3LSP A;  2D45 A;  4BKX A;  1XTA A;  2LRE A;  2ECB A;  2XF6 A;  1YYV A;  2HWV A;  3Q9S A;  3KET A;  3I9V 2;  3KP4 A;  1J59 A;  5F64 A;  2M8G X;  2OUM A;  2Y0M A;  1WJD A;  2F5V A;  5GAG J;  4OWR B;  1FNN A;  2AQE A;  3G3Z A;  1A6Q A;  1JUM A;  1BC7 C;  2O03 A;  3I4P A;  3AG2 H;  3JR9 A;  4HV6 A;  3N97 A;  2NVQ J;  4MQ9 F;  1IDY A;  1CF7 B;  4A3C J;  5KK1 A;  4U7B A;  4YEJ A;  2KDO A;  3DTE A;  3GLX A;  2QSG X;  3W2A A;  1ENH A;  2JT1 A;  1XCB A;  5LGN A;  1IRF A;  2F6C A;  2RNG A;  1S8N A;  3OYI A;  2W48 A;  2DQL A;  4HNU A;  3HGY A;  1WJA A;  4LLN A;  3G1L A;  1PP8 F;  1PUE E;  3FWE A;  5H2F C;  1YJN I;  1W1W E;  1WHU A;  4JOM A;  2QBY B;  2V79 A;  4RAY A;  1XS9 A;  1WVR A;  4FX0 A;  2DMP A;  4GCV A;  5FKK A;  4HF1 A;  4RLF A;  3I58 A;  4XM3 A;  1E3O C;  5JFR A;  3IKV A;  4CDG A;  3LOC A;  2FQ4 A;  1XSX A;  3EYI A;  3L2U A;  1FJL A;  4AVP A;  4PGH A;  1FP1 D;  2BE5 F;  3VYU B;  2H8R A;  2FD5 A;  2E1O A;  2L7F P;  2Y0S A;  4U0Y A;  3BWG A;  1MNM C;  2RAE A;  5DS9 A;  3CUQ A;  4IKF A;  1LDD A;  2WTE A;  3GTQ J;  3ZQG A;  4NNJ A;  2Y31 A;  2KIS A;  3PSF A;  2EBI A;  1G3Y A;  1JJ8 C;  3B6A A;  3MZH A;  2GOX B;  1QZY A;  2Q1Z B;  4M74 A;  2CFX A;  3DU6 A;  3WTW C;  4G7H F;  2Z9O A;  3JCU C;  1BBY A;  4Y13 A;  3B73 A;  3ELK A;  4MGR A;  2NVU B;  4A2U A;  1E3P A;  5FKL A;  2QCO A;  4UHT A;  1QVU A;  2G7U A;  3J7A O;  3K69 A;  5E3L A;  3GTM J;  4RGX A;  4Q5S F;  1R5I D;  1YW9 A;  4UUT A;  1IJW C;  2VOD A;  1RR7 A;  4ZDO A;  1G3S A;  5LRS A;  2EIL H;  2MYS A;  4ENN A;  2L01 A;  4EJT A;  2I10 A;  1JTX A;  3BR1 A;  1IN5 A;  4EV0 A;  1ZH5 A;  5B1A H;  3V7S A;  3ZGK A;  2KKO A;  5BS6 A;  5J1R A;  1BM9 A;  4B4C A;  2DDB A;  2VJI A;  4BH9 A;  1YTY A;  5IT9 Z;  1OLT A;  2P5K A;  4AID A;  4D5C A;  2EA4 A;  1WJC A;  2W4S A;  3BG6 A;  3FXQ A;  3IP4 B;  2ZJP F;  1VQL I;  3EUH A;  2PG4 A;  5J3L A;  5B5E C;  2V7F A;  4P5O A;  2PI0 A;  2D2W A;  1IXS B;  5EEH A;  1MMA A;  4EM0 B;  4YG2 F;  1D8K A;  1DU0 A;  2D5V A;  2MLK A;  1OYY A;  3DTK A;  4HZF A;  5K5O A;  4UNO A;  4KT6 A;  4WXH A;  2RGV A;  1SD5 A;  3S8P A;  2PMZ N;  2ZME C;  2VN2 A;  1YIJ I;  3DTI A;  2L9V A;  2F4O B;  3HOS A;  5H20 A;  4CCN A;  3FMS A;  4CCO A;  2RNJ A;  3HOT A;  5FD5 A;  3S93 A;  3ZRG A;  2KHM A;  1XCV A;  3JRH A;  3FHN A;  3O8H A;  4CCM A;  1IN4 A;  2R5Z A;  1FZP B;  2KP6 A;  3CMA I;  4NQW A;  1T38 A;  2M87 A;  3FX3 A;  3RPU D;  2A69 F;  5GP9 A;  3R60 A;  4H0E A;  1LFP A;  1W36 D;  3PM1 A;  5IOZ A;  4LG0 A;  4OIR F;  2V9P A;  1FT9 A;  3EQL F;  2IJL A;  2L4A A;  2PMH A;  2QWW A;  1B72 A;  1K61 A;  3RI4 A;  1Z3Y A;  1IGN A;  2E2H J;  3GUD A;  3ZN0 A;  1QVT A;  4G7O F;  1SFO J;  1ZRF A;  3LSM A;  1QO0 D;  2B0L A;  1G3W A;  4KN7 X;  4V2G A;  5M5X J;  1VQK I;  4FX4 A;  2P4W A;  2XAG A;  2BW3 B;  4DNC A;  3HTU A;  5DV5 A;  3H92 A;  3CF2 A;  4MQV A;  2KQR A;  4CCL A;  3S2W A;  5IOY A;  3WTZ A;  1MJB A;  1P7J A;  4F55 A;  2R7V A;  5IYD J;  1UFM A;  4XLF A;  1VI0 A;  3DXJ F;  1Y0U A;  4LG3 A;  4KNY A;  2QA4 I;  3FIW A;  4M9Z A;  3C2B A;  2QQ9 A;  4LK0 F;  4M6Y A;  2DBB A;  1KQ0 A;  1BJZ A;  5HS7 A;  5HDG A;  3G2B A;  1NK3 P;  4BHC A;  1F43 A;  3J80 Z;  9ANT A;  4PDK A;  2K9Q A;  1D3Y A;  3GWZ A;  3GZN B;  3K4C A;  3MQ0 A;  4HST A;  2FNP A;  3JSO A;  2GOM A;  4L9N A;  2IS2 A;  3CUQ C;  5FRM A;  1PVE A;  3DKW A;  4IF4 A;  4CSW A;  2RVC A;  1CQT A;  1IXR C;  4DYR A;  4JQF A;  5EG0 A;  2M3A A;  2M4G A;  4Y4R A;  2MFZ A;  2K02 A;  3CQZ J;  3IL2 A;  1Y6I A;  3QQA A;  3VYR B;  4XKB A;  2KDZ A;  3HJE A;  3RZD J;  2X6O A;  1U5T A;  1HXD A;  4S0H B;  2R7Z J;  2LF7 A;  1ZAR A;  2KRF A;  3ZMD A;  1HKS A;  3H5N A;  3S16 J;  2XRO A;  3K4L A;  1I6X A;  3SFI A;  2MH9 A;  3KX2 A;  3CO6 C;  2PLY A;  2LBF B;  3CDI A;  2DW4 A;  3OYN A;  5L3G A;  1I5Z A;  4H4K C;  3HIF A;  2H09 A;  2K9S A;  1QZE A;  1NHA A;  5LGU A;  1TW2 A;  4KIF A;  3M8F A;  3SEZ A;  2M8E A;  2ETH A;  4RA2 A;  2DYS H;  4ASN A;  5HLT A;  1TLH B;  3GBG A;  3HOZ J;  2WV1 A;  2E2J J;  2Z2S B;  3GTJ J;  5HDN A;  1IDZ A;  1K7A A;  1UB9 A;  3FKI J;  2QQA A;  2X6W A;  2IA2 A;  5F04 A;  3W2W A;  2STW A;  4MTE A;  3AFH A;  1HSJ A;  2K9M A;  3BRO A;  4XRS G;  2AS5 F;  3RJP A;  3J81 Z;  2O61 A;  1OYI A;  2V6E A;  3HDD A;  4LLG F;  3QOE A;  5FFZ A;  1LB2 A;  4HRI A;  4IHS A;  2H6B A;  3JAM K;  2CYY A;  1XDS A;  2CUZ A;  3CDH A;  1YX5 A;  4JX4 A;  2E36 A;  1MMN A;  1DQU A;  3I4M J;  1PUF B;  3E5Q A;  4DW6 A;  1WKM A;  4GYG A;  4BXF A;  1SAX A;  1D0X A;  3F72 A;  3MVP A;  3R4K A;  1IG7 A;  4QSH A;  1YRN A;  2XGX A;  4IX7 A;  4IOC F;  5EDN A;  2WAQ N;  1BW5 A;  2WC2 A;  3JRG A;  1FIP A;  2HXI A;  4B1R A;  4ZZD A;  3G73 A;  3M07 A;  4C3J J;  4I99 C;  2LF8 A;  2DMT A;  2HOA A;  2DQR A;  3A2K A;  5J8F A;  2W1O A;  1MND A;  4ABZ A;  3OYD A;  1ACI A;  2E35 A;  2HDC A;  3H36 A;  4BJ5 C;  2GWR A;  2LY1 A;  3CCS I;  1BC8 C;  2H27 A;  2XAQ A;  4KT5 C;  3CJR B;  1TNT A;  2GBY A;  3CJN A;  1JGS A;  1BL0 A;  2UXN A;  4HF2 A;  3IRQ A;  2AHQ A;  2DT6 A;  3ABL H;  4AVZ A;  3HM5 A;  4FIS A;  2BYV E;  4A69 C;  3Q0U A;  2DN0 A;  3GO5 A;  1A5J A;  3LAJ A;  4M71 A;  4OOI A;  3GEZ A;  4G6Q A;  2W00 A;  1QHH D;  3LA2 A;  1YI2 I;  2HQR A;  2RRE A;  2PMZ A;  3SFZ A;  3BR2 A;  2M7B A;  4BBR J;  2VQH A;  1S72 I;  1OPC A;  1XPX A;  2HTS A;  2RN7 A;  2DPU A;  2KPM A;  1AA7 A;  4LB5 A;  1VQN I;  2ZBK A;  3Q0W A;  1YW7 A;  2M5W A;  1STZ A;  4CHU A;  1XGM A;  1BI0 A;  5LFA A;  3AL0 B;  1YG2 A;  1TL8 A;  2B7E A;  4I0B A;  2EPF A;  2O8X A;  4RAZ A;  2P8T A;  4U7D A;  2OF7 A;  2QSH X;  3KYL A;  2L7K A;  1Z9C A;  5HNF A;  1FTT A;  3BR0 A;  1ETW A;  3RYR A;  2OZ6 A;  3FXK A;  5D4R A;  1B9M A;  3PL8 A;  2F5D A;  2M0C A;  4BNC A;  4C9Y A;  1U3E M;  2FJ1 A;  4L9J A;  3FMR A;  3DP7 A;  1FOK A;  1GT0 C;  1KU3 A;  1BIA A;  3M7G A;  5HOD A;  2DA5 A;  3FBI B;  1K83 J;  4F93 B;  1R49 A;  3W6J B;  2L9S A;  1R7J A;  2XGE A;  4Y33 A;  1Y8Q B;  1BI1 A;  3HG9 A;  5DD8 A;  2A6T A;  2P0W A;  4RB3 C;  4IQ4 A;  2WV0 A;  2XC7 A;  2ZXW H;  3FK7 A;  4L9T A;  4OIN F;  3EYY A;  2YUS A;  2ZXJ A;  4ANJ A;  1U6G A;  3PO3 J;  4C30 A;  2CO5 A;  2C6Y A;  3S3O A;  5EZG A;  5D5X B;  3FKJ A;  5D4S A;  2K85 A;  3DU5 A;  3TQN A;  1I3A A;  4O6J A;  3O6B B;  1BR2 A;  1IO2 A;  2JK3 A;  3ZCO A;  4R1H A;  2LSO A;  5IYB J;  2E7X A;  2EIN H;  3DPU A;  4D7M A;  1VQ4 I;  3LAP A;  5KNL A;  1S7E A;  2DTR A;  2RQP A;  3BY6 A;  3H0G J;  3VWB A;  2VQC A;  4IHW A;  1R71 A;  3BQY A;  3BTL A;  3CD6 I;  1QZZ A;  5F6F A;  1W5T A;  1R58 A;  3GVA A;  3LSK A;  3QPT A;  5HLH A;  3OYH A;  3J7A Y;  2EIK H;  5FJ8 J;  3U9G A;  2PEX A;  4EM1 A;  5C4J J;  1WGX A;  3RYP A;  2PN6 A;  2LRD A;  2OQG A;  5BPD A;  3BTI A;  1YX3 A;  2D1H A;  3FIS A;  3A01 B;  4A6E A;  3LWF A;  2BGC A;  4UVC A;  1VQ5 I;  5DDG A;  1RRJ A;  2JMW A;  2F5E A;  5IP7 J;  1DDN A;  4N9H A;  3E5U A;  4KJZ A;  1X1D A;  1H89 C;  1IUY A;  1MH4 A;  4HPQ A;  2E7W A;  3LSR A;  3JRA A;  2CFO A;  3HRT A;  3QYB A;  2OTL I;  1N77 A;  1FWZ A;  5AON A;  2IS6 A;  2GZW A;  2QVO A;  1WJF A;  4NC7 A;  4TV7 A;  3H9Q A;  1MGT A;  4A3F J;  1RR8 C;  2JZY A;  4AWX B;  1B4A A;  4HA8 A;  5LHI A;  1Q1V A;  3OSG A;  2VOP A;  5M5Y J;  4B3A A;  4GRI A;  4L0Y B;  1P6R A;  4CH7 A;  1Z05 A;  2QZ8 A;  3T1B A;  3SYT A;  2A07 F;  4A0X A;  2EFN A;  2LYC A;  1G4D A;  2R5Y B;  3I59 A;  4IRI A;  5CVR A;  3WGH A;  3ML6 A;  3D1N I;  3HBL A;  1EV7 A;  4ZJZ A;  5JHF A;  1FBQ A;  1SAN A;  1VQ9 I;  4ZYD A;  4XMY A;  1L0O C;  2EK5 A;  2XSJ C;  2HS5 A;  4FCY A;  4DYQ A;  3WU1 B;  2H1L A;  5D6E A;  3NQO A;  3HYI A;  1R6R A;  2ZNY A;  4XLP F;  1MSF C;  4Y3O A;  5IP6 A;  3DPT A;  2FU4 A;  2JA2 A;  1H0M A;  4JBA A;  4HDU A;  1ZQ3 P;  4M9S A;  2XRN A;  3K4J A;  1R9T J;  1Z77 A;  3OYG A;  5GAH J;  4IZZ A;  3B02 A;  2WAQ A;  4Y15 A;  1FOW A;  5FFX A;  3E0J B;  4RAF A;  1MBG A;  4MTD A;  1LFB A;  1F1Z A;  2IS4 A;  4FT8 A;  2ZNZ A;  3F8M A;  4NQW B;  2HTJ A;  2Y69 H;  1JKQ C;  3KEO A;  4A3D J;  3BC8 A;  1MJA A;  1KU9 A;  1X58 A;  2B63 J;  5FLX K;  4XLA A;  1KQ9 A;  4LG0 B;  5B66 C;  3K70 C;  5CVI A;  3SDB A;  4G7Z F;  1N75 A;  4CZZ A;  4L5I A;  1B72 B;  1XX5 A;  1QPM A;  4J01 A;  3SXY A;  4ENM A;  2IT0 A;  3TDZ C;  3HOV J;  1NH3 A;  3K70 D;  4I0A A;  4KIS A;  1P4A A;  2LG4 A;  2VT3 A;  5GAD J;  1IN6 A;  1BA5 A;  3JRI A;  1RKT A;  4HLX A;  1EH7 A;  3CME I;  1GUU A;  2CU7 A;  2WAE A;  3WGG A;  3M8E A;  3JTG A;  1OR7 A;  2NYX A;  4B48 A;  5ED4 A;  4LJZ F;  1UG0 A;  1IAW A;  1XGN A;  1XMA A;  4N9I A;  4ZC3 A;  5LEK A;  3AAF A;  5TRD A;  4M3E A;  1ZG5 A;  4XOR A;  4M3B A;  1RES A;  3DF8 A;  1J09 A;  1QNT A;  2CW8 A;  2VJ5 A;  3ECH A;  1Z7L A;  3T5X A;  2X1D A;  1U9N A;  5KVR A;  3FXU A;  3ZQ7 A;  5ICC A;  4WWC A;  3LNQ A;  1LE8 A;  1G6N A;  1ZGJ A;  3ZQQ A;  3TED A;  2Y2Z A;  2JSC A;  1WFX A;  2XPU A;  2JUG A;  3FXM A;  5F0C A;  5EGO A;  1S6L A;  3ABM H;  5IPA A;  4DBR A;  3JSP A;  1Q1H A;  1R23 A;  1H9T A;  1FLI A;  2CQX A;  2CWE A;  3S3M A;  4BAY A;  3R0J A;  3LFK A;  2LLK A;  1LNW A;  2Y30 A;  4BL0 B;  4Q48 A;  1B1B A;  2G7H A;  4DGW B;  5E18 F;  2R7F A;  3Q5F A;  1AU7 A;  3RPU A;  5DTD A;  4ZYG A;  5EG0 B;  4CCK A;  2WAF A;  5TJJ A;  1TP4 A;  1UST A;  4LB6 B;  3RIR A;  4BYY A;  1PP7 U;  1RNL A;  3HHG A;  3OL3 A;  4MNU A;  1MBK A;  1UZC A;  1KGS A;  4E70 A;  4NHJ A;  4X1E A;  3WGI A;  1PJR A;  5CVV A;  3GME A;  2XSD C;  3RQI A;  1TZL A;  1U5T B;  3C1D A;  2Y75 A;  5ICF A;  2M30 A;  3KEY A;  5KAF C;  3GFJ A;  3DKY A;  1MDM A;  5HS9 A;  1LVK A;  1R5H A;  4KIB A;  1OJL A;  1D5Y A;  1TTY A;  4I09 A;  2R7U A;  5LGT A;  1SC7 A;  2JVH A;  3VYS B;  2ME6 A;  2WBM A;  1K78 A;  2Y48 A;  3UNG C;  3K9T A;  3IH3 A;  5GTI C;  3TBI A;  4IRG A;  1YS6 A;  4BQA A;  1QGP A;  2P5V A;  2EFQ A;  3A0H C;  3S2H J;  2XPV A;  4F7Z A;  5HDK A;  2IP2 A;  2QQB A;  2VPR A;  2XGD A;  4I02 A;  2W7N A;  3WOD F;  4IOA F;  2ESN A;  1ZYR F;  3OMY A;  4E6K G;  3GZ6 A;  1OFC X;  2L02 A;  5L3E A;  2JN6 A;  2EV5 A;  4G9Y A;  2W84 A;  1QRY A;  4IVN A;  2ELK A;  4F3Q A;  4A3K J;  4UY8 I;  1OKR A;  1YOV B;  2XIG A;  4AIH A;  3U1D A;  2NRA C;  2PBI A;  4Y7N J;  3CCE I;  3IRR A;  1HDD C;  2E2I J;  1YLF A;  1WWX A;  5F0H A;  5DUK A;  1JKP C;  5H6Q A;  5F0F A;  2HOT A;  3DQV C;  3VYT B;  4BXU A;  3K2Z A;  2VPL A;  3L7W A;  2PJR A;  3I55 I;  1RZ4 A;  4XON A;  5FRN A;  3CCJ I;  1SD7 A;  3Q0V A;  4KUM A;  4BE2 A;  1Y1W J;  1I50 J;  2ID6 A;  1MSE C;  2LY9 A;  5D6F A;  2OU2 A;  2V1U A;  5HLG A;  2Q8K A;  1YRN B;  1LEB A;  4C2M J;  4M72 A;  2DMQ A;  3D0S A;  1SVO A;  5FD6 A;  3E6C C;  4HEA 2;  1GXQ A;  1E3H A;  2GIV A;  4R79 A;  3NRV A;  4G94 A;  1JE8 A;  3GZ5 A;  1HW1 A;  1W0U A;  5E3O A;  3HEF A;  4XKC A;  2DTZ A;  1MH3 A;  4I01 A;  3DV8 A;  1D0Y A;  3BZC A;  1FIA A;  4RS8 A;  2DFE A;  4HW0 A;  3U21 A;  4JX5 A;  2E1C A;  1X1B A;  1YO5 C;  3LA3 A;  3QU6 A;  4PSW A;  3CC4 I;  4M9X A;  3OYF A;  1DPU A;  1JJ6 C;  4A5M A;  3G1M A;  3K6G A;  2COB A;  2FNA A;  2TCT A;  3RZO J;  4OAZ A;  3OYB A;  3ASO H;  3K1P A;  3LMM A;  1IRG A;  1OR7 C;  2X6Y A;  1T56 A;  3CZ6 A;  2ESH A;  3S1N J;  1BR1 A;  3KYD B;  1AOY A;  2F4M B;  4LK1 F;  3KEQ A;  1Y8R B;  1JUS A;  1ZGA A;  2KIM A;  1G2H A;  3KPH A;  1KYW A;  4I76 A;  2AQF A;  2JRT A;  3ABT A;  3C2G A;  2XVC A;  1T6S A;  2K3F A;  4W1U A;  1JT0 A;  1FP2 A;  4XRM A;  3L2R A;  2EZL A;  2X6X A;  3W3C A;  1RUN A;  2PX9 A;  5B3S H;  2W24 A;  4RLQ A;  1IN7 A;  3ROU A;  5E1W A;  4NC6 A;  2DMN A;  3IAS 2;  4EJO A;  3BTJ A;  2XB5 A;  5FLV A;  3CJT B;  4ZYH A;  4BHP A;  4M6V A;  5E17 F;  4RGR A;  3H1C A;  5KHD A;  4O5V A;  4I7H A;  4PK4 A;  2PJP A;  3LFU A;  1T98 A;  1W36 C;  3IAM 2;  2LKS A;  3BR5 A;  3F23 A;  3K2A A;  1W7P D;  2HNH A;  3CES A;  3C18 A;  3ZQI A;  4BQN A;  4A6D A;  3QYF A;  4BY1 J;  1YFH A;  2YU3 A;  5EEG A;  1HDP A;  4BDZ A;  2OZU A;  3C3W A;  4B8X A;  4UUS A;  4DOZ A;  1XSV A;  2LVS A;  5HLI A;  5JR3 A;  1IF1 A;  1LKX A;  4FET A;  3GXO A;  2L9N A;  4M3G A;  2DK8 A;  1QHG A;  3E7L A;  2CRG A;  2CGP A;  3QP6 A;  4EEF G;  2WY8 Q;  1JTY A;  2PQ8 A;  3DCF A;  1I27 A;  3IC7 A;  2VLA A;  4EM2 A;  4E7Z A;  3E6M A;  4XK4 A;  3CLO A;  3FZV A;  1VQ7 I;  2L3D A;  4P1W A;  4YRV A;  1BOA A;  1ZKG A;  1JHH A;  3BR3 A;  2A5W A;  4HQE A;  1FYL A;  3CUO A;  2CMP A;  2LR8 A;  2OCE A;  2Y9Y A;  3WHC A;  3DBL B;  3FXJ A;  4AIK A;  3U1K A;  1S3J A;  2DA1 A;  4HNV A;  3P9C A;  1AKH A;  1BJA A;  2MG4 A;  1EA3 A;  2VT2 A;  3KP6 A;  1QA6 A;  1HLV A;  3VB2 A;  2L9R A;  3LA7 A;  4KMF A;  2LP0 A;  1S7O A;  3S1M J;  2XRL A;  4XL9 A;  3SZT A;  4F91 B;  1OCP A;  1TQI A;  4HYE A;  1TQM A;  3S32 A;  3LSG A;  1X3U A;  3HOY J;  3PNY A;  2LC2 A;  2Q0O A;  3QRF F;  3OOP A;  5CKT A;  5HS8 A;  4V19 K;  2FSW A;  3BLY A;  3QWL A;  3BTC A;  5D5U B;  1YHQ I;  1FBS A;  1SD4 A;  3DEW A;  1AHD P;  3EET A;  2OTJ I;  3E97 A;  4Y17 A;  2M4K A;  2ZSI B;  5M5W J;  2KRH A;  2FBH A;  3DEU A;  2DXI A;  3WU0 A;  2E34 A;  1IRX A;  2ISY A;  3DEE A;  3BZK A;  4AU7 A;  4A0Z A;  3WTS C;  3DLA A;  3VPR A;  1UMQ A;  2L0K A;  1F5T A;  4QTR A;  2E5Z A;  3TOB A;  5FLX Z;  4ZTJ A;  2FBI A;  4RM3 A;  1XMK A;  2DCE A;  3LQR A;  1ZR2 A;  2A61 A;  3TP0 A;  2HPI A;  3S2D J;  2HZD A;  2CW7 A;  2RDP A;  2XGC A;  2KIQ A;  1U2W A;  3CDL A;  2HPM A;  4J19 A;  4IHX A;  2JRM A;  3K1N A;  3QPH A;  2IGN A;  2CUJ A;  3P9K A;  1KA8 A;  4ENJ A;  4RDU A;  3GYH X;  3MMY B;  2XAU A;  3E6B A;  4DBQ A;  4HOB A;  2VE8 A;  3TGN A;  1MIJ A;  2FX0 A;  2CH0 A;  5CQE A;  2VOO A;  1XMX A;  2QYO A;  4HSR A;  3PJR A;  2FMY A;  2D1V A;  1Z6T A;  2JPB A;  1E17 A;  4ZYA A;  4EGZ A;  3ZQH A;  2GXB A;  3PUF A;  1SMY F;  1MBH A;  5JLW A;  5BMZ A;  3VDX A;  3K1M A;  1XG1 A;  1OYW A;  1G8X A;  2Q2E A;  2DU9 A;  2R3S A;  2IVM A;  1YIT I;  3MZ8 A;  3TW6 A;  1R00 A;  3L9F A;  3ERE D;  2QBY A;  3RKY A;  1D1C A;  1HST A;  2BHZ A;  2QM3 A;  2QKL B;  2P81 A;  1TBX A;  2IW5 A;  1VTN C;  3DWL E;  3C7J A;  3BJO A;  2W25 A;  3OYL A;  3OYC A;  3S17 J;  1A04 A;  2JJ7 A;  4PFO A;  2EZI A;  1B6A A;  3F8N A;  5FKO A;  5L3C A;  1T2K A;  2OCC H;  2CQQ A;  2JA5 J;  3CC2 I;  5C44 J;  2TRT A;  4FE4 A;  1DP7 P;  2Z5U A;  1A6I A;  3Q9V A;  3DLL F;  3H5R A;  5B1B H;  3TKY A;  4A12 A;  1J9I A;  1OCO H;  1HBX G;  2ISZ A;  3A02 A;  3JRE A;  2NS0 A;  1ODD A;  2DDA A;  2EJR A;  2TDX A;  1WI9 A;  1VQ6 I;  1LVA A;  4P9U A;  3E1S A;  3L00 A;  1UAA A;  5IY5 H;  1I39 A;  1RI7 A;  5LHG A;  1NG7 A;  3GF2 A;  2YU9 J;  1N78 A;  3GTP J;  2JUC A;  3ZQF A;  2DMU A;  2E1M C;  3J7Y J;  2QEN A;  2VKE A;  4XRF A;  1Y0N A;  4EAT A;  3F21 A;  1O3R A;  2EIJ H;  1GV5 A;  2LOO A;  3BG5 A;  3SQN A;  3I3L A;  1RPW A;  1XGS A;  3LST A;  3OYK A;  3V42 A;  1IV6 A;  2O9L A;  2W85 A;  3FHZ A;  1OCR H;  3FMQ A;  3A1Y A;  3ECO A;  3BPX A;  3PIO F;  2VL8 A;  4MEY F;  2M0M A;  2VC1 A;  1LE8 B;  1APL C;  1L3L A;  4IQJ A;  3W2V A;  1I6H J;  5E79 C;  5K7Z A;  2O7O A;  2IGO A;  1FYM A;  4BJT A;  1XDU A;  4HNT A;  3ONQ A;  1KQ8 A;  5E1X A;  1B9N A;  2OPT A;  5LHH A;  3WTV C;  4MLO A;  2ZME B;  4WX9 A;  3EPZ A;  1FPQ A;  4E7I A;  1W0T A;  2GA2 A;  4ZTF A;  1PYV A;  2E60 A;  4EJW A;  5D5W B;  2CV0 A;  4EGY A;  2IBD A;  2JA7 J;  3BG3 A;  1GV2 A;  2BZT A;  4R8H A;  4S05 A;  1ZRC A;  4CIC A;  3DBH B;  4IHT A;  2MD0 A;  2NAZ A;  4GXO A;  1U0J A;  3I71 A;  2CJJ A;  2ECC A;  3N4M A;  4D5F A;  2LH9 A;  1O4X A;  3AKZ A;  3OY9 A;  1X2M A;  1YS7 A;  3BG9 A;  1J2X A;  3ABK H;  5J4Y A;  1SD6 A;  3O3K A;  2E19 A;  2L4M A;  3KIO A;  4ZYE A;  2DOF A;  2DA7 A;  2LFB A;  3FK6 A;  5E8I A;  3ISP A;  1VFC A;  2EV0 A;  1KON A;  1TW3 A;  3LSJ A;  2KT0 A;  5ILV A;  4CA0 A;  1MDM B;  1IW7 F;  2MBF A;  4OIO F;  2MW8 A;  1Y56 A;  3IKT A;  4IJA A;  2DA3 A;  4M73 A;  4AM3 A;  1DU6 A;  3S1Q J;  2A68 F;  2O8K A;  3QOD A;  4A0Y A;  3KP5 A;  4P96 A;  3V7R A;  1F4K A;  1N25 A;  4AYB N;  2ID3 A;  3MWM A;  3QPS A;  3ESW B;  3F3X A;  4KN4 X;  2QSF X;  2Y9Z A;  2V26 A;  1KZH A;  3V8J A;  1X4O A;  3K4B A;  3WTU C;  1QQI A;  1HOM A;  1ETX A;  1B59 A;  2E5N A;  5C3E J;  1M1E B;  3KLN A;  2LY2 A;  2QF7 A;  4HLY A;  2F2E A;  1V54 H;  2OJE D;  3V8L A;  1YW8 A;  4NC8 A;  2DAO A;  4CO8 A;  3CCV I;  2BEO A;  2XV4 S;  4YIR X;  3ZQL A;  2ME0 A;  4UVB A;  3L2V A;  1GLN A;  3NAU A;  2B9S A;  2VQL A;  1KU2 A;  1Y1V J;  2DO7 A;  2Z99 A;  4G12 A;  5CPR B;  1U8B A;  2XF5 A;  5DCM A;  2PJR B;  1OIS A;  1U8R A;  1X19 A;  4LIU A;  2UXX A;  3H5A A;  3G1O A;  3D5R C;  4C3H J;  3GTG J;  3Q3S A;  3CUQ B;  5L3B A;  1FTZ A;  1B8I A;  5CYV A;  1BI2 A;  3RSN A;  5JHU A;  5M3F J;  2CUE A;  4LD5 A;  3ZPL A;  2GLO A;  2VJJ A;  3BJA A;  5FKM A;  2QEX I;  1MMD A;  4KMU X;  3W6K B;  4I98 B;  2MD5 A;  2G0E A;  4IL6 C;  1ZR4 A;  2DT7 B;  2J5P A;  2VB6 A;  1ITY A;  2A5Y B;  3G71 I;  1IN8 A;  2Y0S N;  1Z7U A;  4E7K A;  1MW7 A;  5GPA A;  4XLH A;  4CUG A;  4WK8 F;  4GO1 A;  4UVA A;  3WE3 A;  1FSH A;  3JTH A;  1POG A;  5D8K B;  3FXR A;  3VFZ A;  2WB1 N;  2NOJ B;  1X1C A;  4XOP A;  2IA0 A;  3OWT A;  3HOX J;  3CCM I;  4AD9 A;  5ILS A;  4KA4 A;  1FOX A;  2HXO A;  3MZY A;  1WRJ A;  4XLE A;  4PCQ A;  4V2F A;  3PIP F;  3D5L A;  3JRC A;  4FTH A;  2OA4 A;  2HEO A;  3KZY A;  4A3M J;  3LSH A;  1J75 A;  4UUV A;  3I56 I;  3IH2 A;  4WXC A;  1JXS A;  1HKQ A;  3MN2 A;  1TT0 A;  1J7K A;  1MD0 A;  4JX6 A;  1ZG1 A;  1EJ9 A;  2A6E F;  3NWT A;  4G6D A;  1T0F A;  4BDY A;  3S3N A;  1V3F A;  2CG4 A;  4IHY A;  4N4N B;  3PNT A;  1JKR C;  1R1U A;  1LEA A;  3J80 K;  3ZXS A;  2NS7 A;  3GLL A;  2L2O A;  3L1P A;  3CO7 C;  2R5Z B;  1S29 A;  2CV1 A;  1SFX A;  3GTK J;  1FEX A;  1J0R A;  2VXZ A;  2R0Q C;  5FRO A;  1FX7 A;  2K40 A;  3IWZ A;  4MEX F;  5EJC A;  1ZRD A;  3KP7 A;  5E8G A;  1P92 A;  3HSE A;  4DZP A;  2VIX A;  2CS3 A;  2L7M P;  3FM5 A;  2XKO A;  1SMT A;  5F08 A;  3TL4 X;  4KIC A;  1R1T A;  4UUS B;  2MA3 A;  3ZR8 X;  2HYF A;  3JRB A;  1S7A A;  3OYJ A;  1NK2 P;  4MFD A;  1XGO A;  2GAU A;  4UB8 C;  4JYK A;  3T8T A;  1H88 C;  2IRF G;  4Z6Y A;  5CQG A;  2L5Q A;  1R1V A;  4PSX A;  2Z16 A;  2VKH A;  3K4M A;  2VBX A;  2LDU A;  2IGM A;  4P55 A;  4D0P A;  1TWA J;  2R4G A;  2BY0 A;  2MC4 A;  2M34 A;  1SVL A;  2DOE A;  4G6T B;  4D9J A;  3HHH A;  3VOD A;  3G6E I;  2AO9 A;  1W5S A;  2H6C A;  2ZKZ A;  5LLQ A;  4MIM A;  1DPR A;  2JQ7 A;  3HSR A;  2GXG A;  3F0C A;  3FF5 A;  3IH4 A;  4XR6 A;  5DD4 A;  4FQG A;  2FA5 A;  1P7I A;  4GGG A;  4GFB A;  5EF6 A;  1FY7 A;  4XLC A;  3FBN B;  3JW4 A;  1MJ9 A;  4ZDL A;  4EMS A;  2X51 A;  2W57 A;  3M3Y J;  1R36 A;  2V6C A;  4I2O A;  2MAB A;  3I54 A;  3S14 J;  2EQR A;  2FBK A;  5J40 A;  3BT9 A;  3AG1 H;  1AKH B;  1WI3 A;  1UJ8 A;  3NEU A;  4OU0 A;  4AUX A;  4QPO A;  3F6O A;  5BOX A;  5F1J A;  1NTC A;  2OAZ A;  4D7N A;  1YE9 A;  3JAM Z;  2R7R A;  4YFN F;  2OQR A;  3WTX C;  2P5L C;  1D5V A;  2QQ8 A;  3LSI A;  2OD5 A;  2F5C A;  3OYA A;  2JSP A;  4WF2 A;  3WTT C;  5HVQ C;  3ZMU A;  3CTA A;  3WTY C;  4CYC A;  1Z67 A;  4ZZL A;  2HFH A;  3KZI C;  3TO7 A;  2FEZ A;  3OIQ A;  3R0A A;  4PZJ A;  1W7P A;  3FM3 A;  2HKX A;  1KYZ A;  2IAI A;  5J1Y A;  3BP8 A;  4HF0 A;  4DZJ A;  2NOG A;  5AIQ A;  3K7A J;  1EF4 A;  5GTH C;  4X6A J;  3HRM A;  1ZLK A;  1FOY A;  4RB2 C;  3OYM A;  2ACJ A;  2FML A;  5LBQ A;  1LDJ A;  4Q47 A;  2CSO A;  2EFO A;  2R7D A;  3OL4 A;  1F36 A;  2P7V B;  3CLQ A;  2DA6 A;  3H9J A;  4A3B J;  1MBE A;  2CUF A;  3L09 A;  2VKV A;  4I6Z A;  1LDK B;  2BOL A;  3BG7 A;  5CVU A;  4BE0 A;  4UB6 C;  3E6D A;  4LIT A;  1AWC A;  4QIW N;  2F48 A;  5K7F A;  2YS9 A;  5K5R A;  3UKG A;  3CC7 I;  3OR2 C;  3P5J A;  3V8K A;  4AYB A;  4E7H A;  2RV8 A;  5A2Q K;  3X2Q H;  3TO9 A;  2VE9 A;  2JA6 J;  4KIT B;  1OMI A;  4NUB A;  4RBO A;  1P9Q C;  1R5G A;  1GVJ A;  5H6R A;  1ZK8 A;  3HRU A;  1ZN2 A;  5HNH A;  2R93 J;  3RKW A;  4OMY A;  2G9W A;  1T0F C;  2RKH A;  2BBY A;  2FUG 2;  2VJ4 A;  2Q2E B;  3CMM A;  2DFH A;  3TOA A;  2GM4 A;  2MSY A;  1FSE A;  4YFK F;  1HQC A;  4ITV A;  4NBQ A;  5DCF A;  4U88 A;  3FXO A;  3D5S C;  4X0G A;  3BCB A;  2DJI A;  1G59 A;  4F92 B;  3OYE A;  1USS A;  1Z3X A;  3VOE A;  1RC9 A;  1ETQ A;  4IRH A;  2I8D A;  1YJW I;  2STT A;  2VBW A;  2VXD A;  1TC3 C;  2GQQ A;  2K3P A;  1A31 A;  4L9V A;  4YIF A;  1Z0X A;  4U0V A;  1EH8 A;  2PMU A;  1LJ9 A;  1NG6 A;  4E4H A;  3SZG A;  5EEA A;  1ZHF A;  1FMW A;  3ZMZ A;  2V1N A;  3CCR I;  2BY1 A;  6PAX A;  1BN5 A;  3A01 A;  1UHW A;  3GCM A;  5EZH A;  2HOE A;  4RGS A;  2WB1 A;  1UHM A;  3CP8 A;  1D1B A;  1K6Y A;  3ABU A;  1WH5 A;  1E0E A;  3K10 A;  3HUG A;  1ETK A;  3RPQ A;  1C0W A;  2XDV A;  5FO5 A;  4PJM A; 
#chains in the Genus database with same CATH homology
 1OCO H;  2DYR H;  2ZXW H;  1OCR H;  3ASN H;  1OCZ H;  3AG1 H;  1OCC H;  2EIK H;  5IY5 H;  1V55 H;  3ABM H;  3X2Q H;  5B3S H;  2EIL H;  3AG3 H;  3ABK H;  3WG7 H;  2EIM H;  3ASO H;  2Y69 H;  3AG2 H;  5B1A H;  2OCC H;  3AG4 H;  2EIJ H;  2EIN H;  3ABL H;  2DYS H;  5B1B H;  1V54 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...