4HG2A

The structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
AFRPRYPRALFRWLGEVAPARGDALDCGCGSGQASLGLAEFFERVHAVDPGEAQIRQALRHPRVTYAVAPAEDTGLPPASVDVAIAAQAMHWFDLDRFWAELRRVARPGAVFAAVTYGLTRVDPEVDAVVDRLYHGLLARDWPPERVHVESGYRTLPFPFPELEAPPLEIEERWPMDAFLGYLGTWSAVTAHRRRTGADPLAEIAPALRAAWGTPERPLRVTWPIAIRAGRILPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Putative Type II Methyltransferase from Anaeromyxobacter dehalogenans.
rcsb
source organism Anaeromyxobacter dehalogenans
molecule tags Transferase
molecule keywords Methyltransferase type 11
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2560 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hg2A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4hg2A01
3DXXA 3DXYA 5EKXA 3UFBA 4E2XA 1I4WA 1ZQ9A 1SUIA 1X1BA 5C0OE 4EKGA 3WSTA 2PV0A 3TKYA 3BKWA 2HMYB 1XCLA 4CTJA 3UJBA 1QANA 2JH9A 4PGGA 3T7RA 5GM2A 4YV1A 5K05A 2VZ9A 5BW5A 3DMFA 5DM4A 5G02A 1KIAA 2K4MA 2H1RA 5E9JA 4RTPA 2FK8A 3PFGA 2NXEA 2YQZA 4GOMD 5DM2A 5HIMA 5K8VA 3PX3A 3MQ2A 3ORHA 3LX6A 4FT2A 1QAQA 2XVMA 4CKCA 2P7IA 4YMGA 2ZIFA 1D2HA 2I9KA 3CC8A 4KIGA 2XBMA 2I7CA 3BWYA 3EVDA 3KQWA 5EZQA 3EVGA 2AOXA 3ID6C 2G8NA 5EZSA 1G8SA 3DUWA 3DLIA 4X60A 4F84A 5BP7A 1PJZA 2XYRA 1FPQA 8MHTA 3NTVA 2HNKA 1IM8A 2HTEA 3SR4A 3GXOA 2FCAA 4PYIA 1P39A 2G71A 5K01A 4NECA 4PGHA 3P2EA 2P3OA 4IV0A 3P2KA 4KWCA 2I62A 1P91A 3LPMA 3M6VA 3EVBA 2BM8A 4HG2A 3HCFA 3KR1A 4BP1A 1N7IA 4C4AA 4CKBA 3BT7A 2EG5A 2P7HA 5DX0A 2GAFA 5ICEA 3SX0A 2WA1A 3BUSA 2XVAA 2BR4A 3UZUA 1VP3A 2BM9A 4PIPA 5LQRA 4LG1A 1JG4A 1JG1A 4MWZA 2HWKA 2Y1XA 1YB2A 2R3SA 3CBGA 5JR3A 4YMHA 4AUKA 4DCGA 4ER3A 3R3HA 5FCDA 4R05A 4Z2YA 5T6BA 1JQ3A 3FTDA 2PX4A 4HH4A 1G6Q1 3ME5A 2FYTA 4E2ZA 1AQJA 5P8WA 2EJUA 2VDWA 3KPUA 3ER9A 3EEYA 5DXAA 3QOXA 4DQ0A 4BP3A 1RI2A 1OR8A 3GRYA 3GCZA 3DULA 1O9GA 4BLWA 3C3PA 3U81A 3I9FA 4UOEA 3UJ8A 3GGDA 5F2KA 2YX1A 1X19A 2YTZA 3BGDA 2YXEA 2E5WA 1ZHFA 1NW8A 2PJDA 2QE6A 3P9IA 4ZTBA 4QDJA 3DOUA 1ZG3A 3PX2A 4KVZA 2JH8A 2IH5A 2IPXA 1SVUA 1T43A 1NBIA 1RJFA 3EVAA 5IH3A 2GA9A 2C7OA 4WVLA 4C06A 3BWMA 3ER8A 3IHTA 3TFWA 5DT2A 4OQDA 2ZZNA 5D1HA 4E2YA 4EKIA 2PSSA 1WY7A 5JUWA 1ZGJA 3BWBA 3UJCA 4C03A 1JR4A 4P7JA 5EOVA 2GPYA 1M0EA 3DXZA 3L8DA 2ZULA 5CVEA 3OZRA 3KR9A 2N47A 2G1PA 2I6GA 4HTFA 2NNWB 2IGTA 4B17A 1UWVA 1AQIA 2LD4A 2OKCA 3LDGA 4QTUB 1IY9A 1QAOA 4OQEA 1X1AA 1VPTA 4FZVA 5E9QA 1L3BA 1R00A 4X41A 3A25A 2JHAA 4ER6A 3GNLA 2FPOA 3DMHA 5DM1A 4MTLA 3UJDA 3IEIA 3SSNA 5E2BA 1ORHA 3GO4A 4RVFA 3IYLW 5CM2Z 3G2QA 4AZTA 2ZZKA 2ERCA 2ZSUA 2PT9A 2JHPA 2PWYA 1M6YA 2YXDA 3MERA 4QPNA 1I1NA 3UA4A 4PONA 4GC5A 5GM1A 2NXNA 5B1SA 1XDUA 4P7KA 3FTEA 1FJXA 2ZWVA 3G5LA 4KW7A 4EQZA 3LCCA 3M4XA 4YUVA 2C7QA 3NVKI 3AWIA 3R9XB 4RTJA 1KPIA 4A6EA 3B7PA 3P9CA 2FK7A 3FPEA 3GJYA 3H2BA 4HTFB 4BY9E 3LKDA 2NP7A 1G38A 1YZ3A 4OBXA 4YUXA 1YF3A 3MAGA 1RJEA 3FUTA 2AN3A 3PVCA 5ERGB 3EGVA 4OBWA 4LWPA 3IV6A 2ZZMA 3HCDA 5U4XA 5M5BA 5HEKA 3G7UA 1F3LA 4X61A 3RW9A 3E05A 4GC9A 1XJ5A 4GF5A 3MGGA 3ELWA 1L1EA 3SM3A 5FWAA 1EQAA 4RTQA 2H00A 4PNEA 4BLVA 3TM4A 3P9NA 4PWYA 3UJ9A 4POOA 1L3CA 1MJFA 4HRAA 4ER7A 3KHKA 4YV2A 1HNNA 2AN4A 2CMGA 2OBFA 2VDVE 1KYZA 1YUBA 4GUAA 1U2ZA 5EQJB 3OU6A 3JWIA 2VS1A 3AY0A 4R6WA 4DF3A 2AOUA 4QQKA 3I58A 3MTEA 5FULA 2OXTA 2G72A 3LHDA 3FPFA 1BC5A 2V7EA 2OZVA 3SXJA 3NMUF 3EEOA 4PIMA 2DPMA 3QV2A 5DRYA 5E1BA 5EVJA 2GLUA 1TPYA 5T67A 3G88A 1NV9A 3UJ7A 4C05A 5EMJA 5K0CA 3KPYA 3HCCA 2ORED 2PBFA 2KW5A 5GWXA 3LKZA 4PCAA 3UJAA 4RYLA 5ICCA 5K0JA 5KS2A 5EGSA 5FA5A 3PLAE 3SGLA 4DA4A 1Z3CA 2PX2A 3DMGA 3LSTA 4ISCA 3KQPA 5HOQA 3G8BA 2PVCA 4KDCA 3S68A 1H1DA 3VC2A 3EGIA 4OA8A 1RI3A 3E7PA 2PXAA 3GU3A 1QAMA 1TW3A 4QVGA 1EIZA 4YUYA 4R8SA 5K0FA 3HTXA 4X63A 2PGXA 2ZWAA 3EVEA 5EHIA 4AZWA 4QDKA 3M33A 1G60A 3NWBA 4CWAA 3A7DA 1JQEA 4M37A 5K09A 3CJQA 5T64A 4V0RA 2AOUB 4RTMA 5ICGA 3LBFA 3BXOA 3KU1A 5F2NA 5LQJA 3TRKA 5GIPE 1SKMA 4OA5A 2O0LA 3BWCA 3P9KA 3KQYA 3MCZA 2FRXA 2ZBPA 3FPJA 3FUUA 3NW9A 1Y8CA 5CUQA 4GOOD 2PX5A 1UIRA 3AXTA 4HC4A 5KVAA 3B89A 3KQSA 5DWQA 4AX8A 4YUWA 1RI5A 1ORIA 3P2IA 3LDFA 2P41A 3B3GA 3CJTA 3GRVA 2AS0A 1JSXA 5DTMA 1ZGAA 5EMMA 4RVHA 4FSDA 4RV9A 3G2PA 3JWJA 4RTSA 1N7JA 5LQAA 5K0LA 5FHQA 4IKPA 2NYUA 2BR3A 2ZVJA 1NV8A 3HEMA 3T7TA 4ATNA 2ZCJA 10MHA 1BKYA 2GH1A 1QZZA 2O05A 1JTEA 1VBFA 4FT4A 2UYOA 2IH4A 3NVMB 4EVIA 4FR0A 5EIWA 3E23A 1G8AA 3TR6A 1XXLA 3HVKA 2PT6A 1RI1A 1NBHA 1FBNA 2CKDA 3HP7A 5KQSA 3FRHA 4P7GA 2OYRA 4GOND 3CKKA 3M70A 5EEGA 3MB5A 1NW5A 5LQKA 3A7EA 4PYMA 5LQNA 4QVKA 3VSEA 3TQSA 5HIIA 3ELDA 3I64A 3V8VA 3G2MA 3VC1A 2CL5A 4DMGA 3UBTA 1XTPA 3DH0A 2F8LA 3PS9A 3SMQA 9MHTA 4M7RA 5K0NA 5ICFA 5GP1A 3KR2A 4RSRA 4IWNA 3G8AA 1PRYA 1XDSA 3HA3A 1KPHA 3K6RA 3KQVA 2ZBRA 3KQOA 3MCTA 3NJRA 5FTWA 4X1OA 3CCFA 3EVZA 2AOWA 3GRUA 3OFKA 2QY6A 4EMSA 4RX1A 3OU7A 1R8YA 3UWPA 3HM2A 1KPGA 2ZBQA 1RI4A 2ESRA 4A6DA 2OY0A 4C07A 2P1DA 2PLWA 3C3YA 3X0DA 1P1CA 4PYQA 5EMKA 4BLUA 4IV8A 3HNRA 1INLA 1EJ0A 1EG2A 5KYGA 2UYCA 1XDZA 4QPPA 1TW2A 4U7TB 1R74A 2B25A 1L9KA 1NW6A 2HR1A 1HMYA 4FGZA 2AVDA 1WZNA 4XUEA 5DTRA 2Z6UA 3A26A 2GS9A 4HSGA 3E8SA 5K0GA 2CMHA 4MQ4A 4V0QA 1JG2A 5DPMA 4M36A 5BW4A 3EPPA 3HVHA 1Q0TA 3D2LA 2PXCA 2WK1A 3R24A 4AZSA 2ADMA 5GOZA 4AZVA 1NW3A 4DCMA 3NDIA 4PCLA 3SSMA 4E30A 1O9HA 3CJRA 5DSTA 3P97A 5CVDA 1F38A 4P58A 4QTTB 2BH2A 5E8RA 3HCAA 5FHRA 5CVJA 4H0NA 1VQ1A 2IP2A 3C6KA 3OFJA 4Y2HA 3RODA 1SUSA 3PFHA 2P8JA 1AV6A 3KKZA 3GRRA 5CVVA 1SG9A 1I9GA 2EJTA 4R6XA 3HVJA 3T7SA 2AR0A 4F86A 2R6ZA 3OPNA 4Y30A 3UJ6A 2QRVA 2YVLA 3FPHA 3BZBA 3RIEA 3DTNA 3LDUA 5LSAA 5E9WA 5EHGA 3ERCA 3FTFA 1YZHA 3A4TA 5F2OA 1DUSA 5E1DA 3LCUA 5MHTA 1VIDA 3THSA 3Q87B 3CVOA 3GWZA 1V39A 2B78A 3LGAA 5FA8A 1WXWA 3SVZA 1R6AA 2AOVA 2Z6QA 2BZGA 3GIWA 3JWGA 2DULA 1DCTA 5FWDA 3THRA 3OE5A 5DTQA 3LL7A 2IBSA 1BHJA 3EGEA 5KQRA 4CTKA 2YXLA 3NWEA 4KDRA 3G5TA 3HA7A 1L3IA 2G70A 3EVCA 4PYNA 2O07A 5EG5A 3Q7EA 4F85A 5CVUA 5CCXA 4GOLD 4O29A 1N2XA 2OPBA 1JSZA 3KPVA 2C7PA 5LR6A 3OE4A 2YR0A 1X1DA 1VP9A 3G89A 3GDHA 3M6XA 1IXKA 2AVNA 1NW7A 3P8ZA 2QRVB 2UYQA 5DRTA 2IDKA 1VE3A 1R18A 4HGYA 1EJ6A 3FPGA 3A27A 3ELUA 2B2CA 2AN5A 4MIKA 5HILA 5C1IA 3T0IA 3TPZA 4E32A 4RVDA 2HV9A 3KQMA 4XUDA 2A14A 5DLYA 3V97A 2JG3A 5DSXA 5E2AA 1JTFA 3I5UA 3FUWA 2IFTA 2P35A 1DL5A 1KR5A 1XCJA 3BGVA 3EVFA 4PYLA 3EMBA 5FQNA 2P3LA 5HIKA 2O06A 3AJDA 1NT2A 3FYCA 5EEHA 4G56A 5HIJA 4C08A 5LQUA 5DX1A 3O7WA 2EX4A 2Y1WA 3NDJA 4PYOA 1SQFA 1KHHA 3B5IA 3C6MA 4RVGA 1EAMA 2IDJA 4FSXA 2QYOA 5IKMA 2IBTA 4XCXA 2PX8A 4YV0A 2NP6A 1KYWA 2ZIGA 1MHTA 5DXJA 1FP1D 3F4KA 4CXMA 3DR5A 2UYHA 1KP9A 4DZRA 1O54A 4PYJA 3KPJA 5CD1A 2PKWA 4FP9A 4WXHA 1D2GA 3FUXA 5HFJA 3MTIA 4E33A 2UZ4A 4PYKA 3TOSA 3LECA 3QOWA 2JJQA 2ZIEA 2ZW9A 3LBYA 3R0QA 2IIPA 4GBED 5EPEA 4E70A 1X1CA 3PTAA 4YUZA 3KPWA 2Q41A 4E31A 4ER0A 3O4FA 1SQGA 2FHPA 2XYVA 3KR0A 3OZSA 3K0BA 4KRGA 5HZMA 5K0EA 4OX9Y 3BGIA 2XYQA 3HVIA 4RTRA 4RWZA 3FTCA 4E2WA 5H02A 1P1BA 3TKAA 2H11A 3KQTA 3AXSA 1WG8A 2OO3A 3CGGA 1WXXA 3FRIA 1D2CA 1NKVA 2GB4A 2OB1A 3DP7A 5E1MA 5EIFA 3LCVB 5FADA 2PY6A 5K0BA 3HA5A 3MHTA 5EKUA 2QM3A 2O57A 3FUVA 5LQCA 1VL5A 4EK9A 1NE2A 4C04A 1JQDA 1AF7A 4P7FA 5EC8A 5FQOA 3BKXA 2P3QA 4LWOA 1Q0SA 2CWWA 2P40A 4XUCA 1G55A 2OB2A 4KIFA 2WA2A 3HCEA 2PWPA 3VYWA 2VP3A 3ELYA 3OZTA 3FZGA 5FUBA 5CIYA 5DM0A 3B3JA 1JG3A 3EMDA 2B9EA 3FYDA 3OU2A 4K6MA 2JHCA 5D1NA 2ONYA 3PB3A 2YUIA 1RJGA 4RTKA 3TMAA 3TM5A 5DX8A 3PT9A 3UA3A 1UFKA 1KXZA 2ZFUA 3G2OA 2AOTA 2AZTA 2PXXA 4PINA 1XVAA 1YFJA 3DLCA 4R8RA 4MHTA 2B3TA 5EMLA 5K03A 5CCBA 3OCJA 3JWHA 5GIOE 4RTOA 3HCBA 2IH2A 3O31A 1M6EX 4RTLA 3SSOA 4FS8A 2ZTHA 3KQQA 7MHTA 3I53A 4M38A 2C7RA 4JXJA 2EFJA 4RTNA 4LECA 5E8JA 3REOA 1FP2A 4GQBA 4DKJA 3TLJA 3M6UA 4CKEA 4L7VA 3P71T 5BXYA 4ER5A 3GRZA 3ANXA 1BOOA 4QQNA 1YFLA 1VLMA 4HGZA 3C0KA 2NXCA 5GINE 1QYRA 3M6WA 2VDUE 4DM3A 1WS6A 2NXJA 2BR5A 2V74B 3R6TA 4GEKA 5E1OA 1R8XA 1RJDA 2ZLBA 2AOTB 1ZKDA 2ONZA 3B3FA 2Z6AA 5C9ZA 4U7PB 1B42A
chains in the Genus database with same CATH superfamily
3L0SA 4JJ7A 3V8JA 1PUEE 2A1UB 4MUAA 4N0DA 4O2BA 4ADSG 4CKWB 5LYJB 4TVOA 5CYGA 2AW3A 3D8BA 3O3NB 3F21A 3GJZA 4I0BA 5DHPA 3WSTA 3G17A 2BFEA 4DGWB 3B6MA 2XBUA 5IYZA 2PG4A 3C18A 2DYKA 3C1UA 4HPJB 4D4LA 3EK2A 1BFDA 3G1LA 2VAPA 3FWYA 2F17A 2JLXA 5D8LB 2F4IA 1SBHA 2PGNA 4ROSA 5ALPA 4MHSA 4E88A 3DFUA 2DBRA 1IHOA 4M1TA 3DO8A 2BM1A 3ELKA 3FFAA 5CA1F 1B1AA 2D5IA 2H5IA 1SZDA 2ZJFA 3ROQA 4II7A 5LP6B 5EE1A 3Q7QA 5NULA 2QG9A 2ZTLA 4XVQA 4ENKA 4AK9A 3E7LA 4XRMA 1ZN9A 4NEHB 2OKGA 3JS5A 1W93A 1N6NA 3M3HA 1PZNA 3NOQA 3MYYA 4P38A 4DHEA 2DETA 4N6NA 5AICA 1FBSA 5AKJA 1FIUA 2WG0A 2AD5A 3Q9UA 4NCJA 1ISJA 1BOBA 1I51A 2IF2A 1AXGA 1TU0A 4LSGA 4DV7B 1AKYA 3N87A 3ENNA 1NJGA 2OGUA 3TUIC 3JW4A 3VSBA 1UL1X 1Z28A 1JE8A 4OXRA 3JAWA 3UR3C 4OFZA 4TQ9A 5REQB 4DQUA 1KSGA 3EX7C 3W5SA 2QJFA 2BHLA 3OE7D 3OCCA 1G2OA 4C7XA 3OO0A 3Q0VA 4UU7A 4DC9A 1XN1A 3FKIJ 2CT8A 2R65A 3IQFA 3S55A 3MWGA 5DGTA 2FFJA 2BEUB 2I62A 3MZ0A 3O91A 5DF1A 4A3GJ 5HK8A 5IT3A 1YBVA 3N3BC 3RSFA 3K94A 1OZ0A 3FYUA 1BN5A 5ALDA 1AA9A 1R0KA 4BVHA 2EU8A 1L6IA 1HDCA 1LNWA 2PSJA 3DB1A 2RI0A 3ZLUA 3ZZ0A 2AFIB 3KSUA 4R2KA 2ZJ6A 2JAWA 3NOVA 3DBLB 2O2IA 2WIGA 3M9WA 3N0WA 5AHWA 3WKCA 3FSGA 3OC6A 3QVOA 5T6BA 1JQ3A 2RKOA 1LPPA 4KTVE 3X1MA 3HKBA 3TE6A 5KAIC 3COPA 2WIFA 5D5UB 5JT1A 1MA3A 1Y3HA 1P19A 3HB9A 4YNBA 3I9V1 3K3PA 3SLKA 3UMCA 1O9GA 1N8TA 3BCUA 3EC1A 1XNRB 4TSFD 1UJ8A 1U94A 5TDHA 4EELA 2DK8A 4UOEA 3F9KA 3C7AA 2P5YA 3TTUA 1IZ1A 4UM9B 3DVLA 4D9JA 4U0VA 1FJLA 1Z1DA 1H1LA 2CLLB 3H6KA 3QKUA 3R6LA 4HH3C 2LH9A 2V7XA 4ZTBA 2OZKA 5CAEA 4BPBA 1P5ZB 4JBWA 2CB9A 2GEJA 3Q3CA 4OHKA 1M2OB 1IQPA 4TS1A 5TQVA 4MUNA 1PNVA 1F4KA 1G21B 3EUKL 1J0BA 1VMKA 3CWCA 3CKLA 2P6UA 3CX8A 2R4UA 4JBHA 3V7UA 5T3YA 1F2VA 4QT4A 1TBXA 5C4XJ 1SCQA 2B2XA 3CINA 1NNUA 3SHQA 1NNSA 4UDNA 1X1EA 5EJEA 3R7NA 5JUWA 3IBSA 2WJYA 2R00C 1F9AA 2G25A 2YC2C 2GPYA 3OAAD 1J8QA 3VR4A 2F6RA 1DTSA 1QDLB 2C1XA 4YFKF 2ES4A 1QHIA 1AOYA 2HTFA 1GNSA 3DS8A 3MWLA 4MPPA 2I2WA 1OZAA 2FMHA 3RC9A 5WRFA 3LSRA 4BFXA 2DUUA 2JPCA 3S1QJ 1K2WA 3QLTA 4HD8A 1UXJA 3R4CA 4V0LA 2GKOA 2ORYA 2HCJB 3JATA 3IOEA 4MWCA 4PW0A 2B94A 4Q01A 4X41A 3LH5A 3JQAA 3FXLA 4KMUX 2WHPA 3GNLA 4LZZA 1BX0A 3S27A 1DO8A 4MUMA 4YP5A 1ZMRA 4OYLA 3ZCOA 2J1LA 1QVZA 3ZCUA 1R4MB 3QOEA 3EC7A 1FWZA 2OLEA 2JRLA 3NWSA 1VLZA 4Z99A 5HNFA 2GYYA 3N05A 1NVAA 2J6CA 5LLDA 3L46A 3W3ZB 1BAPA 4PS1A 1XMIA 3GG2A 1N4DA 3TX6A 1BMFD 3VNBA 3DAFA 2B5VA 3T4XA 1X0XA 3PNLA 4JLPA 4G84A 2G1KA 1VM6A 2HQ5A 2OTJI 3KSDO 2YJ4A 3IESA 4XFDA 5F1PA 3IV5A 4R7GA 1V5GA 2WG1A 3RSLA 1I94B 3GJYA 1YW8A 2WY8Q 2JIDA 4YJHB 1HWYA 3QF7A 4B6QA 5JRDS 1P7CA 4IM7A 3MRXA 4YJ2A 2NP7A 2RSLA 1EUYA 2IPOA 2Y2UA 4OBXA 3ZQ7A 2OO5C 1Y98A 4IOCF 3S1NJ 2Z9CA 4JB8A 2GBFA 1C9YA 1ZM4A 3CRQA 4O4HB 5FNVA 3RREA 3SVTA 2XCTB 4OM8A 3UYLA 1C8VB 5F9MA 1QS0B 4BO2A 4AO7A 1G6HA 3Q9LA 1QMGA 2G9UA 3TD6A 3E81A 3FPKA 1M2FA 3GPBA 1EIWA 1AGXA 1SMKA 2EXXA 1P7WA 3R74A 1ZK1A 2C4NA 1I4LD 1I01A 5EUBA 2GN1A 3O3OB 2FP4A 4U8GA 5JCPA 3U4GA 3ZV4A 2ESNA 2IQIA 3MUOA 3OF2A 4LG3A 1KJZA 3PC2A 4HRAA 4X6XA 4YYEA 4RDUA 1PU2A 2PLFA 4R1PA 1S6LA 3IUPA 3WTZA 4X0EA 4V39A 2HK8A 4Y6GB 1LQTA 1YE3A 2WSYB 3KO8A 2AUNA 2FJ0A 5FUYA 2JJ8A 3SC4A 3TVYA 4RVOA 1K5GA 2NTNA 2YJTD 1ZMOA 4HB4A 2P1ZA 4UB6C 4R3UC 3PIOF 2ZM5A 5I4KA 3LUPA 5CP8A 4N48A 5EXDA 5BPIA 1XYYA 3BSWA 3RC7A 5KJ1A 2ECFA 4V3CA 1KI3A 3S2FA 4AMBA 1JDNA 3PCRB 1YJQA 1II0A 2RGGA 1ZD1A 3K4QA 3SGLA 3WGMA 4AYWA 5C8YB 5KNCD 2FMUA 2JSPA 1HW5A 1MNMC 1H1LB 5BVHB 3JQ9A 1JKJA 3CN7A 1BFKA 4X7PA 1JHRA 5FRDA 2QQBA 1BEEA 4LOAA 2JVIA 5JALA 1XZAA 1YI1A 1W4ZA 3MFKA 2ZWAA 3IT0A 5F35A 3WR5A 2C8LA 3N2GB 3NWBA 3OHSX 3GELA 3PDHA 5B58C 3DO5A 1W88B 4C0WA 4CKBB 2DA7A 4QATA 1V6AA 1V25A 3A32A 3PKJA 3A8TA 2C0QA 4D3FA 3O1JC 1ZBQA 4QFBA 1JDSA 3A04A 3MWDB 4PAMA 4UM5A 4DTCA 5H0IA 2ZBPA 2XMSA 4V1CB 2O8CA 3OCVA 4LXIA 2QN7A 3FDIA 2XMCA 1APLC 2K3FA 3NONA 4LYJA 3UUFA 1KK2A 4JUBA 5ILSA 4CMAA 3DE2X 1PHRA 5B1IA 3BHJA 2P41A 3B3GA 3HVUA 5LXTA 3IQWA 5DTMA 1AB5A 1JSXA 5AD1A 3CD6I 2DQKA 2M4GA 2QBYA 1MOQA 2B8WA 4FSDA 5G0SA 4W5WA 3SIRA 4I2NA 4MUHA 2B1GA 1N0WA 2LF7A 4JC4A 4MA4A 5ALLA 1R4MA 2NYUA 3HTUA 3HEMA 3MGCA 3WYAA 2GAUA 3OL3A 2Q2EB 2F3SA 3E9QA 3G2IA 4HNRA 3ST7A 1RLMA 1P4AA 1BXGB 2PL3A 2O2GA 3MPUA 4LJ9A 2O6GE 4FR0A 5E6UA 2BHZA 5F2EA 3RTDA 3JRCA 3MMXA 4Y2SA 2G1AA 4MJXA 3CGWA 4AF7A 4MR7A 3MCVA 3W7AA 2P0WA 4KXVA 1VECA 3LXXA 4EG0A 5DOVA 4AZ3A 4JZYA 4AO6A 4BVLA 1W1IA 1IDZA 3KE2A 5CA0B 5AJWA 3L7DA 3I56I 2G28A 3GV0A 1H2XA 1V6SA 3K0AA 2KRHA 5FOTA 2QQ0A 1JSCA 1EUQA 3H2KA 4HDSA 4RDHA 2DWCA 3FMSA 5H16A 3ZVLA 2VQ3A 5F98A 4M7RA 1A72A 4CQLA 1CUJA 3SIWA 4DMHA 1UJCA 2R5WA 4OBBA 5AKYA 4ZAWA 3CUQB 3HADA 1ZG5A 1OX4B 1FUYB 1YHQI 1GQSA 4LKOA 5JQWA 3HYSA 3K0EA 1OCZH 1UDWA 3V8MA 4NU8X 4YCSA 4YMVA 2P5UA 5IK2D 2X1MA 3CCFA 4RNCA 4UHCA 1PLKA 2ZR9A 3WG7H 2AX4A 4RX1A 1EM8A 3ZMUA 2EZ8A 3PVSA 3NV9A 1MNQA 4XD2A 4PAOA 3WAGA 3G23A 3B3QA 2E1OA 3VR2D 4D9EA 4RC9A 1UXKA 4YO7A 2G4CA 2NU8B 5FBVB 1J1UA 2FMTA 2EFHB 1W94A 3DCYA 4G6QA 1G5IA 4HJRA 4U4AA 4W63A 1B72A 1DXHA 1NN1A 3DFZA 1U8RA 3DDOA 3VHXB 4PC7A 1QF9A 1VG1A 1WRBA 4F3CA 4QG7A 5CNJA 4L8VA 4DCUA 2AVDA 1W7PA 3PR2B 4L4ZA 4QREA 5JAZA 2QN9A 2CE2X 4OMYA 1RKUA 2O1EA 5JPCA 2ORIA 1OXXK 2V6JA 1LV8A 3HDJA 4X6LA 2D2EA 2VB6A 4X93A 1P81A 4AZSA 3I5XA 1NW3A 4IOLA 1H3NA 4NK4A 4UNIA 3EXHA 4OP1A 3G0IA 1DC6A 4XTCS 1M34A 1YKGA 3B85A 2I8AA 4Q1VA 4XLLA 3VUEA 1R0BA 1VQ1A 1HF3A 1LU9A 2ME6A 2P2NA 3RKXA 3OCYA 5TVKA 3NI2A 5JFGA 4M74A 2DMPA 3BC1A 4PLGA 4P0TA 1PWEA 2O7RA 2QRPA 3EZFA 2G36A 1C1DA 2D1VA 2VIXA 3FDZA 3FN4A 3LRTA 5DNVA 2QP3A 1GPMA 3L0ZA 4DBQA 1O3QA 3OPVA 2P7VB 2BHNA 1I9CA 2HCFA 2Q5OA 1J39A 1DELA 2WMOB 3CWZA 3ZBTA 4D8UA 5AIQA 3EPKA 2RGUA 1EWQA 2WZDA 2V7FA 3Q87B 3PNSA 4HB2A 2XV4S 4EB8A 4D9KA 4Q3BA 3GFJA 4ZKEA 3W3CA 2R66A 3FTPA 3KOZA 3MWDA 3GLHE 3B6JA 4HYTA 1D8KA 2ATCA 4RL4A 4AS2A 4HX4A 1Q2UA 1N2HA 4DEVA 5F6FA 1RBMA 4LRXA 4BY7J 4WDRA 4TTAA 3L43A 2FSWA 2EFYA 2DUJA 2HZDA 1UBRS 4KT5C 1GGVA 2H1KA 2I55A 2J59A 5ADVA 1TWAJ 2GOXB 3GFIA 1G2QA 4H6WA 5EPUA 2LR0A 1PW5A 4DEXA 3AFOA 5HW0A 5D5HA 4B3RB 2O3SA 5G2OA 5H7XA 3CO6C 1GHCA 2I78A 4N5NA 3KK0A 3RT1A 5KTTA 1SXIA 4RAZA 4FUTA 3N2LA 1KK1A 1M3SA 4HSRA 3AZPA 3D6FA 4FWIB 3PXGA 1FMFA 1VHQA 4G36A 1C7ZA 2ZSIA 4JR0A 4DDVA 2YR0A 4A16A 3M6XA 2FLWA 4O6VA 2EB7A 4EG3A 3SS8A 3IUOA 3UKGA 1U99A 5IT0A 3LUCA 1DO2A 1MGOA 2CSUA 4NDZA 5DRTA 1HE1C 3P2MA 1WTCA 3PJDA 3C48A 3P9PA 2GASA 1SXJB 1R18A 4I9GA 3TS1A 4D5GA 2GM4A 5K45A 2J4FA 4KXFB 2Q4BA 3GUZA 3K1NA 3KKQA 4GP6A 4XRRA 3R6GA 3W8NA 4F9FA 1KJ8A 2ZJPF 1CYDA 3JRWA 1OAAA 3M6AA 4CCNA 2JG3A 5AKHA 3CVYA 4DYQA 2MLKA 3ZK8A 5F9HA 1L0BA 3RC1A 4YY3B 4AJLA 3QFHA 1LBIA 1VA4A 4A3FJ 4R7ZA 4UHHA 4L5JA 1ULYA 1J8DA 2EKDA 2SICE 5FROA 2KM1A 1VFPA 3AH8A 3LV8A 3B70A 3R3XA 4FX5A 1L5KA 2BDEA 2P4WA 1D07A 3WGHA 1NT2A 3OYCA 2HFKA 2WTMA 4KQ1A 4C08A 3CESA 3OYAA 1FMVA 2WNSA 4A0YA 4HDKB 1VSTA 4OJQA 4F4HA 4G8CA 1OTXA 1PG0A 2IP1A 4XB1A 1YUMA 2ZTVA 1HEYA 1PL6A 4IKOA 5A7FA 3Q5DA 1OCOH 1JEQA 3AB7A 3MUEA 1JHVA 3ZYZA 3PO3J 1MCZA 1G3TA 5K5OA 1X7GA 5FWYA 4YHHB 2QJWA 3B1YA 1MH3A 3EHDA 2AH5A 2LBPA 3UM9A 1D2GA 4CIYA 2P2SA 5HFJA 1K9SA 3PWZA 4DCTA 1XPRA 4QPJC 1YR6A 2EQRA 4JC5A 4WECA 3N2EA 1HA8A 2L0XA 4KBFA 2J3JA 3DYVA 1L1FA 2OBMA 5EIEA 1X1CA 1RRFA 3WX0A 2B4KA 4ER0A 1XTQA 2C2OA 3O9VA 2ODPA 4DWVA 4RFSB 3R7SA 2QNRA 3KOXA 1OFIA 2EW8A 3FTCA 2RGBA 1HUQA 1UKVY 1F8UA 1ONNA 3MZYA 1QV9A 4BVBA 5KNDD 4W5TA 5B1AH 1RMTA 1WXXA 2YIVX 1SBNE 1YD7A 4A3CJ 1GL3A 2IBMA 2Y27A 2YZGA 3CR7A 3JQFA 4M7WA 5KOYA 2OQRA 3JD3A 3K09C 3MTBA 2IEKA 1GNLA 2WOOA 3T1VA 4ZN6A 5EWLB 3C14C 2BTQB 3DXJF 1AF7A 4OO3A 2BE5F 1D04A 3JAMA 2W2LA 2ZXEA 4U2CA 4UOQA 4WZBB 4F45A 2VJBA 4G0QA 4FFNA 3RV4A 4TTRA 4P4SA 4GMDA 2IOQA 3HRUA 4LITA 2KLHA 4CTMA 4F60A 3AFGA 3L0PA 4YX9A 3LFUA 5CT9A 3PI6A 2R48A 3FZGA 4GE3A 5FUBA 4LLNA 4QKQA 2WVHA 2A6EF 1ZUHA 4CCJA 1AHDP 4D8TA 3I01M 4LDPA 3L4SO 4K6MA 4GMHA 3HL4A 5B30A 1AHIA 1G66A 2Q9AA 3C2QA 4L85A 2PMFA 3BR5A 2J85A 3K73O 2QF7A 1VCMA 2G9VA 4LY6A 3G2OA 3ABMH 4IZOA 1OIWA 2UVDA 4TROA 5F1JA 3WDLA 3M8JA 1QC5B 4MVYA 5EJ9A 1QPIA 1XJCA 4BO3A 2JLWA 1F1BA 3LPLA 4PBRA 4R8RA 3QY9A 5KVRA 1SFRA 2X7XA 4M0FA 5BSRA 3STXA 1Z6RA 3HOTA 1ZIXA 1JHHA 2EJBA 4QC2A 4ZO4A 3HHHA 1FLDA 2GN2A 2C7RA 4HSEA 1N9ZA 5IZCC 3CRRA 4ME6A 2P5TB 4YC7A 5DCLA 4NXNB 1MF7A 2P2CA 4CXFA 4JVOA 1BQEA 1Z4NA 2ZK7A 4NP6A 4CYCA 3L2RA 4I6ZA 1SQSA 1K6IA 1M2NA 2I33A 3FBTA 4LBVA 4QQNA 1KVRA 2PCLA 3BCHA 1O7LA 2BT4A 1LUJB 4EUFA 3K6SB 2DBQA 3E97A 4ARAA 2G07A 1EXMA 2QI9C 1HC8A 3H5RA 1LDEA 4MPJA 3F5DA 3F7TA 1G2IA 3TTXA 4DCPA 1OXUA 1HGXA 4JENA 4HQNA 3WXMA 2X19A 5KHDA 3WTVC 1PGOA 3ZLVA 3D02A 1K89A 3RSHA 4NBQA 4WA8A 1H23A 1OFVA 1RZRA 4LJ8A 1ZKDA 4CCMA 2ONZA 1QS0A 1GZUA 1T4BA 5CDYA 5C9ZA 3C2GA 1VLLA 4I4TB 3DFIA 1GZSA 5DXAA 2VPRA 3QELA 3RFFA 5BQPA 1WXFA 3UFBA 4JBGA 1MDFA 2FOKA 3WNDA 3QPUA 3DTVB 3R0IA 1X1BA 2GKGA 2VJMB 2XLBA 4QNRA 4HVCA 4EPXA 3LA2A 5F1OA 1ZC3A 3WLMA 4BNKA 4HEA1 2QL6A 3ZJUA 4P33A 4EEXA 2A07F 2DP4E 4RQUA 2B4YA 4YV1A 3SQWA 2RG7A 1MVLA 1E63A 5JH7B 5HJ5A 2VKEA 2YZ2A 4URUR 2TDXA 2PN6A 2K4MA 4QWWA 1MD0A 5BNGA 3GOHA 2ZJ4A 3JQ7A 4KXNA 3MOSA 4NDAA 4XQ0A 1P0IA 5K8VA 1UHSA 4BQNA 1NXXA 3DFMA 4FT2A 1BSVA 4GMKA 4TT3D 2XEXA 3S3MA 1T8RA 4FE3A 4XVRA 5HCIA 4LTMA 1SD7A 1QYIA 1I3NA 3VZSA 1WAMA 3JQ8B 1KP2A 1RXCA 3CC8A 1OYYA 1PG2A 7REQB 2LFBA 1X7ZA 5E7QA 1U3TA 3KZCA 2VKHA 3B6AA 4I76A 1UFVA 3TDKA 5DYMA 1ID8A 4HMOA 4BHBA 1ECPA 2WFZA 4X5OA 1RMYA 4B45A 4URXR 2JPDA 3HBFA 2IA2A 3PSIA 2XTJA 3OC0A 5JI2E 1HDPA 3JR7A 1BW6A 2AKYA 4H1HA 2BUAA 1I0LA 1P1FA 1SUAA 3BMNA 1GGHA 1I3KA 1ZGZA 2ZI9A 4BGEA 1FFXB 1C9NA 1SMYF 1W0KA 1EFDN 5EA2A 2VTDA 3LSGA 2YH2A 5A7GA 4ZHQA 2YHIA 1PO7A 1U3DA 4CMBA 5DM70 3A1EA 4F2DA 3IBGA 1ARZA 1QU3A 4AJOA 2NZ2A 5JAQA 3HCFA 4ZAFA 1FYVA 1UOEA 5H82A 5U1PA 5LZ2A 4KACA 1NBEA 1FNNA 1EUCB 1U4NA 2R44A 2XTNA 2H0AA 1TAHA 2X8JB 4Y6OA 5ILVA 4N47A 5MFZA 3TOZA 4NLLA 4G8DA 1OXTA 1CERA 3QU4A 1UK9A 4Q4JB 4TUYA 4L28A 2YVQA 5CJPA 5JS6A 3GLFE 1V1MA 1PYGA 2AXEA 2ZSFA 3S44A 1BA3A 3G13A 3WYGA 5GQSA 2FQ1A 2PMUA 2Q7OE 3U4AA 4UHTA 1OLOA 2H06A 4B0PA 3WBFA 3IQIX 4DG5A 5BMVB 4ZCSA 2ZJ0A 3FOZA 2YY6A 4WFIA 1E1CB 4CEHA 3T61A 1RR8C 4QUDA 1U7WA 4DNOA 5EZ5A 1UBUS 4HAVA 1LKXA 1OXMA 1N6PA 2H8KA 4ZARA 1RZRD 2C9OA 2CQNA 2BMVA 2JFQA 3O4VA 5KJEA 5KPJA 4A5NA 1PG5A 4KO2S 1N5JA 1FS6A 2I7VA 3M1CA 1P3JA 3FZQA 4KAAA 2ZR7A 4M49A 4RA2A 3A1UA 3QPVA 2JDIA 3WWDA 4AJ9A 1BXZA 1MXHA 3VMFA 5J23A 3PPWA 2AEFA 2C2BA 1IY0A 2XUKA 4BLQA 1RJFA 1KAGA 1QP0A 1B8NA 2V7VA 2JFZA 2NYAA 3TW8B 2CQXA 2ETHA 4N39A 4AROA 2ZYRA 3DAOA 2YJ6A 3FCEA 3OUZA 2OTCA 4B85A 1H6CA 4KSBA 1JI8A 1IMJA 5J1TB 4HWTA 4JZKA 1K79A 1KYIA 3KB8A 3DDSA 3WL8A 4AW9A 2NNYA 4DLPA 2N3ZA 3T1BA 1O5IA 3C8ZA 3HE3A 3QEKA 3COSA 1EVQA 3LZ6A 1AQIA 4JBAA 2OKCA 4UMVA 1BS1A 3TR0A 1VPTA 2JCBA 3JQQA 3A3YA 2PQ2A 4IS3A 2J48A 3WB1A 4Z0NA 1FSZA 3IUJA 3AKZA 4UE2A 3L7AA 4O3FA 3K35A 1YS6A 3CCEI 2N1BA 3AONB 4IXDA 4KO8A 4BFVA 2B6HA 1II9A 1NF8A 2EZ9A 4A10A 4BKPA 2L9VA 1WPGA 2QPTA 1PHPA 3ETJA 3EQ6A 1MEEA 2ZYGA 3QVTA 3EOAI 2PRIA 4RKWA 5GONB 6REQA 2HYIC 2X0KA 2ERCA 3WFZA 2XMDA 1ZUNA 4I9HA 2YXDA 1WUIS 4E0BA 2WLTA 4Q4AB 5K6TA 2NXNA 2YZMA 4Q9JA 4HA8A 5F73A 3WTCA 2X4LA 3BR6A 1LDMA 2YYAA 3HSEA 4FYYA 3VVLA 2FE4A 1AGRA 2H1CA 2K4BA 1L5QA 1ACIA 5LA6A 4ZJPA 4E46A 4CGZA 1CV2A 2M9HA 4L5EA 4PV7A 3FAZA 1T9CA 2V79A 5AJTA 4BVJA 1N5OX 2E6KA 1UMQA 3FPEA 5BWLA 3NWJA 4H1VA 3HP1A 3N3AC 5DYNA 3FF5A 4FHFA 4ZQGA 4JQFA 1COWA 1S29A 4B3FX 3L7WA 2AN3A 5IBCA 4KYIB 4UNPA 5KU1A 1CUYA 2BSXA 4US2R 4N82A 4MJLA 1IO2A 4M6VA 3ENKA 3UUEA 1A50B 4OI2A 2AUTA 5EZGA 2OCDA 3F46A 1T4CA 3KYJB 9GPBA 5HK9A 3MMYB 4K2AA 5E3HA 3DMTA 4X20B 4DADA 1GKYA 1F2UB 3C4QA 4KSYA 4ALMA 2JZOA 5CX1A 2HC9A 1NSTA 3CCYA 5EJ5A 1BIBA 1HTTA 2GCOB 4QGGA 3ZR4B 1USGA 4QOFA 3FOWA 1PWXA 3VR1A 1C80A 1H5NA 2BY1A 2BKAA 3KFXA 5A4IS 1NHGA 3O4IA 2ZJAA 3D7NA 3VSKA 3P5BA 1CJTC 3KIOA 1OWLA 4NY1A 4UDYX 3ZU3A 3A31A 2BFNA 3G5AA 4RSGA 2OC6A 3OYJA 1GYPA 1MJHA 2CUTA 3FGNA 3I0NA 3CKMA 2IHUA 1NXWA 1IB0A 1T1RA 3IMFA 4HNGA 1C4KA 4J43A 1BC5A 4RANA 4LGCA 2OZVA 5COQA 1F17A 3B2EA 3EEOA 1LTKA 1FVOA 3B6EA 4JAVC 2NLOA 5EJCA 2XXBA 3PFKA 2EFNA 1M8GA 2I29A 4F7WA 1M1UA 2ZJ2A 1EEHA 1RC0A 1URPA 2CCGA 5EMJA 3LKVA 2CNBA 1O6GA 1D03A 2UVQA 4PZ0A 4QRDA 4UQOA 2ZSJA 2GIZA 5J5VA 1VJRA 4BWGA 1KAOA 3O21A 4UREA 1JV2B 1R6RA 3EQZA 3O92A 2JCSA 2NT4A 4GXNA 5HOQA 1SFKA 1DX9A 2P67A 1T1JA 2XI4A 2Y1GA 3A1CA 1JH8A 3DVQX 3HN2A 2ZUSA 1FJ2A 2ZYAA 3FI0A 3HRIA 5BV1A 3SHFA 3KP1A 4RMNA 4ZTZB 1S2DA 2QMEA 1IYZA 1HI9A 4M3GA 1RFLA 1THGA 5KOJA 3AVYA 4NJOA 2R0QC 1YOVB 1CY4A 2I22A 2NZXA 1YHYA 2O23A 3LLSA 3PR1A 2R7WA 4XGNA 1KDTA 5HDBB 2HKXA 3NBZC 2PNFA 2J6IA 4G37A 1RCFA 4BVAA 3AUAA 4UM7A 3FWEA 5F7JA 2HYJA 4K9LA 1N3IA 2IYTA 3H84A 3IRVA 3ER6A 3NTXA 4TYPA 1R0CA 4DIMA 1OW3B 3ODPA 4L4YA 4JGGA 1D2EA 1R50A 3NJ4A 4ZCIA 1D0VA 5FRNA 2XZDA 2GWHA 4RY8A 4RWEA 2HGZA 3JPYA 5D6OA 5DWQA 2WKWA 4RAQA 3I09A 2HOTA 4YIIA 3NFRA 4H18A 1O95D 2DECA 3Q6NA 1JHDA 4D0NA 2OBLA 3WKAA 1H89C 1F7VA 1F43A 3DMRA 5LZ7A 1LTHR 1S7AA 4LI3X 2DPUA 2CXRA 1C2YA 2BR3A 4EKDA 4ATNA 4FQ8A 1WP9A 4L2IA 4FT4A 5K3OA 2A67A 2HZTA 1US8A 4I6EA 2CJXA 3NUZA 4O2BF 3BH6A 2FSHA 2H9IA 3HVKA 3RJPA 1P9WA 4ZEVA 2F5VA 2IGNA 2P2YA 3CH5A 3HP7A 3GFRA 2O4CA 1DSSG 3H4TA 4IUCS 1R64A 4X0GA 2DQ4A 4NOLA 4LGYA 5BW8A 2XB6A 3TNFA 3DEWA 1T2EA 1Y8AA 1IJEA 1PGNA 1R10A 3AKYA 3GGOA 3HYCA 5DHSA 1ZGBA 4YRZA 5JW6A 3IDOA 3LUFA 1ZIPA 3GEDA 1GTRA 2DCMA 1M76A 2NO4A 4HGQA 3BS4A 3WC4A 2AI3A 3H6GA 1SUEA 1LF5A 1X80A 4WINA 2MINB 3Q41A 2ZWPA 4BYYA 2VJJA 3SDGA 5KWVA 3KNZA 5FLMJ 3SJBA 4TKMA 4Q9LA 2H2DA 2QL7A 3O94A 1E9SA 4LZNA 4M9QA 3O83A 1Q5PA 2IYLD 3T5TA 4ZA2A 4BJTA 4P3OA 1SJ9A 1QK4A 1JEYA 1MO4A 4KO4S 5GP9A 4TTVA 3RU9A 1R5JA 2IX3A 2ESRA 1HSZA 1HZZC 4CU5A 1RVV1 2X0IA 1HNWB 1WD5A 1IWOA 2ATIA 1ZICA 2HADA 2W2TA 3CCLI 1X7YA 4IDDA 3LGSA 3ONWA 4LXGA 4R81A 5LOVF 1RWKA 2AV6A 4LC1A 3BG3A 3VSLA 3QA9A 4DLNA 4NCBA 1E8DA 2H07A 1FLVA 3A4YA 3UATA 5KWJA 5PGMA 2FETA 1Y5NA 2Q50A 2QXYA 3IVAA 3Q85A 2CUFA 4CA0A 1HMYA 1Z2PX 4D3SA 2BGGA 3A9VA 1P77A 3SYLA 3AEZA 4KR6A 1IBMB 1XRLA 1U98A 4XEHA 1ECLA 4D4IA 1X3LA 3HVHA 2WC1A 3E61A 3HU2A 4QNMA 1MW9X 2HUPA 2QRJA 3OOSA 2ODWA 2B98A 4OD0A 1N3YA 4XOIA 2A6PA 2FF5A 3K1PA 1AU7A 2A2ZA 2BFPA 2N46A 4RMGA 5CIQA 1NR1A 1KDZA 2GTIA 3BHNA 3EWAA 3J7TA 4P58A 3TDMA 4B4OA 1GUUA 3BFJA 2PRJA 5E8RA 2LOOA 2C3OA 3PHBE 1D7AA 1NRJB 4O2AF 1SUSA 2XTZA 4KPYA 3VU3A 4G5RA 1J99A 1T0UA 4TL9A 3L2WA 3ET4A 3I52A 1ZJ5A 1YDEA 4J0EA 2B92A 2X8LA 4BCBA 3WHCA 3FPSA 5I51A 3IAEA 3F9IA 1OI2A 1FYDA 3D4LA 3T35A 3LCUA 3GXBA 5CVIA 2NN3C 3G0DA 3IT2A 4UUBA 5EY5B 2C59A 3UGQA 1AOXA 1FBQA 3KJGA 4GW3A 1XCGB 3B60A 3DTVA 2MA3A 1DRUA 2AB0A 2B78A 1OFUA 2GX6A 2H4FA 3LOQA 2PFSA 3NHZA 2HWYA 4LOHA 4HP8A 1YWGO 2QUAA 3KVNA 3LLCA 2WD7B 3HRKA 5K5RA 1MN6A 4YRTA 4JYKA 5HSGA 4PZPA 2AJTA 3V7NA 2DMRA 3KUDA 2AE2A 3GLIE 4ZPXA 3FLMA 2WAMA 1J06A 2ZNYA 1ISGA 3OS1A 3GMSA 2ZTUA 4U8HA 1J1ZA 1EFTA 5DBEX 2L01A 1H3EA 2JS7A 3OWOA 1PGJA 4A0FA 2HOAA 2P7CB 4G8XA 2B7CA 1IY1A 4J8PA 3GNQA 4PC1A 5JCJD 2JA8J 1N5LA 2NGRA 2J3IA 2GAOA 1ZCAA 5I01A 4PC6A 2VXCA 2CW8A 4WTOA 1MJ9A 3JD4A 4X1EA 1BWQA 5TT1A 4EY5A 1KAQA 1P4SA 1EJ6A 2QRGA 2E3JA 3A27A 4HKTA 4F4FA 5IP7J 2QVLA 4UOZA 4QTXA 3DPSA 3EXG2 4E32A 5T7BA 2HPVA 3PQEA 5EHNA 4N8DA 4P9FA 1GPUA 5EG0A 2XD4A 3H5IA 1W5FA 4NOMA 4RCZA 1XX6A 1VI5A 4HEQA 2PD3A 2O2EA 2AXTC 2AI1A 5LYJA 3BR1A 4CKWA 2CFCA 4JFRA 1U5BB 4PYLA 3WODF 4KWHA 4OSOA 4HUTA 2P9HA 1O5TA 3RH0A 1F0KA 2E2WA 3GPCA 2HXIA 3ZZ1A 2PH7A 1ISHA 4O2AB 2HVQA 2FSIA 3G2JA 3TYXA 1SQFA 3X1WA 2X8JA 1V35A 3EPRA 1TM3E 1G21E 2O9LA 1G7TA 3W6ZA 4MV0A 2P6TA 4JB0A 1RWXA 2VK2A 1MHTA 4ND4A 1B8OA 1IC8A 2C96A 2VUHB 3CLUD 4CIXA 1RM0A 3W9BA 4IQ0A 3WQHA 5JD5A 1FXWF 1ZVMA 3HHGA 2PUVA 4B8ZA 3A6ZA 3FOBA 3K5IA 1C0KA 1IIBA 4NYJR 4CG0A 2XPCA 1KO8A 1NC3A 1ISRA 4IL6C 2X8AA 3CLTD 4OXYA 3WYBA 5JAHA 3VSAA 4I98B 4HUJA 1V55H 3DD5A 1Q11A 1Y63A 1ZXBA 2C54A 5K0EA 3JALA 3U2QA 2X6XA 1D5YA 3FG9A 2FPLA 5DM6F 1XU4A 5T8KA 2QZZA 4TMXA 3G0BA 1TQIA 2VT7A 5JAUA 4ENUA 3JD0A 1ZK8A 1B9NA 1POGA 4IG9A 1Y6JA 5CA1B 3IWFA 2E48A 1N0UA 2C1ZA 4IBOA 3GX4X 4M0UA 3DFGA 4J3NA 4BJ6C 3HA5A 4JYMA 5EXSA 4NTZA 4H4KC 3F22A 2D0OB 1RACA 4GGPA 4DBLC 4QEKA 1BM9A 4LY9A 4UTZA 5TC4A 5TQ2B 3KHUA 2QYTA 4MHGA 2XT0A 4L7QA 4R2IA 1E0AA 5F78A 2P3QA 1FNDA 4V38A 1JQLB 1XE3A 3V8NA 2CLHB 3GDFA 1DADA 5KUTA 5H4HA 4TZ6A 1ISSA 2ZB2A 1IZ9A 1QNFA 3CZAA 1DARA 1EK0A 3VO8A 5IM4A 2AFIA 3V2HA 3WVNA 3AP1A 4EUSA 3FMQA 5DEQA 4TVSA 5HBRA 1UPUA 2JGAA 3N07A 3OU2A 4PBTA 4Y1RA 4AJ2A 4ZOAA 1GQYA 5HODA 4HF2A 1WA5A 2C7VA 2ONYA 4A5SA 3EF1A 1L7DA 1JFSA 3RE1A 1KY2A 2WP8J 5K1YA 5LM3A 1M0WA 4AJ4A 1I2AA 3VSCA 3M1EA 2J9XB 2EK5A 3BXEA 1OBCA 4GXQA 4AWBA 4BLOA 1E9VA 1NPYA 4AM3A 3AOEC 3MJFA 3U19A 1YFJA 4MHTA 1KAMA 4RD4A 5C37A 3OCJA 3R4KA 4MRMA 1OAOA 4JLBA 4R9UC 3CMMA 1Z33A 4NJEB 4XM2A 1T8IA 1D0ZA 2VE9A 1G3QA 3DZDA 3TXYA 5KTKA 4FS8A 1KA9H 5C18A 2Z9BA 3KQHA 4LYFA 4JXJA 1T26A 4IQ4A 3I1FA 3KHTA 1Z0FA 2NU7B 3NP9A 1E17A 2EF0A 2RI1A 2XA1A 2XRLA 3FVTA 1PLLA 4CGYA 3ROFA 2ZT8A 1AXEA 1NOKA 2QSJA 5TGTA 5EUCA 2BKVA 3PC6A 3F7NA 4JODA 4HT3B 1EFAA 1BOOA 1ZN8A 2BCJQ 3TP3A 1P8JA 2DFEA 3N0XA 4F1KA 4M2LA 2AMJA 1DX6A 4IO1A 1XZJA 1GNVA 2NVYJ 2GN0A 1BA2A 1T3ZA 3MSXA 4P53A 2DFTA 3ITEA 3ABZA 3QKSB 4U00A 5I9BA 1XC7A 4OB8A 1R5ID 3DD1A 4LXYA 4NUBA 4MP8A 5IJ9B 1PJAA 3HHPA 5FA6A 2OYCA 3ZPLA 2WW8A 1IN6A 3S7TA 5B2FA 3A02A 1OTYA 1UBSB 1RU3A 1NVGA 2Q21A 3FSGD 1F2UA 3NLLA 2PRZA 3H2IA 4NH4A 5IKOA 3UXYA 3W05A 2XUIA 2IXTA 4HLQB 2HMYB 1BMTA 2M9MA 2NXWA 2SECE 3JYPA 3K20A 3RRZA 2JPBA 2DBYA 3ZGNA 4F06A 2LY9A 1QANA 4A8PA 3KOOA 2HCBA 3M8FA 3EUHC 3IHKA 1ZLKA 3EDOA 1QYCA 2BVNA 2EP7A 4QEZA 5E9JA 1Q0ZA 3JTMA 3QG5A 3QUBA 1JVNA 5DJ5A 4Z9FA 3PX3A 1YFHA 3MQ2A 3PJEA 3LX6A 4QNNA 2JIZA 3VPRA 3MT7A 3SJAA 1D2HA 1A7AA 5GJCA 4I02A 2V3CC 2NQTA 3QU6A 3ZXSA 1E6EA 2XAAA 2H8RA 3DEKA 3PE4A 5AMXA 3PLNA 3OYEA 4G5FA 4B6PA 4NG5A 4A2WA 1GNPA 1LDGA 1UOPA 2FPWA 1TJYA 3NYRA 2HSZA 3Q5GA 1Q7CA 1V4VA 1K6JA 3AJEA 3PUWA 4TGLA 3IMKA 3EPHA 2YU9J 1BH6A 1ADBA 3G2LA 2VXYA 3QENA 3OYBA 3FCOA 2X4GA 3WK6A 1DT3A 2P79A 1L7VC 1G3YA 1JECA 5KREA 2EQBA 4NOKA 4QTRA 3ZDYB 4D9IA 4KIBA 1NUQA 4DMCA 1KMNA 3A37A 1ZL2A 3AI7A 1W30A 3STYA 1ZITA 4B6SA 3D8SA 1T08B 1CQPA 1U7HA 2HIAA 4ZC1A 4HYYA 4OB6A 1XGNA 1OQAA 2OZLA 3IOBA 1V3FA 3RS0A 3KJIA 4JBIA 4MV6A 4YUAA 1E5VA 4Y6LA 2DFIA 5EJIA 5EMNA 3ZCXA 4FEEA 3VGPA 4Z1OA 3S8YA 3JR9A 2HA5A 3KXLA 3PPVA 3UFXB 2ZATA 2EGHA 2R1VB 4ER3A 3E5NA 1JLLA 4R05A 4Z2YA 3Q72A 3O1HB 5ALUA 3FKJA 3ME5A 3PWSA 1LSSA 1S4QA 2ME0A 2GD2A 4B81A 1YQUA 4GZ6A 7ABPA 2VPZA 4R3NA 4OHZA 3WHKA 4GR4A 5C8XA 2II6A 2ATXA 1LSJA 3GCZA 1CJBA 5FR2A 3FAKA 1JPUA 3MTDA 1ZVJA 1MQSA 3B9BA 3I9FA 4O25A 3WAKA 4UBOA 4D9MA 3PEWA 5JHGB 1P61B 2HK7A 1MNEA 2J5RA 3BK7A 4R2JA 3LL4A 4FI3C 3U1BA 4OMDA 4QDJA 1YGYA 2MYTA 2FR0A 5TE9A 3WICA 4F46A 2IPXA 1IHXA 4G0MA 4ZIRB 3B1XA 3PYLA 4P5EA 3ESYA 1V6CA 4C06A 3KQUA 3UHJA 4E7JA 2ZS9A 1ICIA 2EF1A 2ZT7A 3IHTA 3OX1A 4WK4B 1FX1A 1AMNA 3GDWA 2C9BA 3BIJA 5MN4A 1C3OB 2GBGA 2GZSA 3IBCA 1XTAA 3IIJA 2MSEB 2R751 3R7AA 4P7JA 4IJWA 5EOVA 3CTPA 3PHJA 3EIWA 5JSZB 2YRWA 4WOCA 3UV3A 3OZRA 3ZGKA 2C8JA 4NYIQ 3TEJA 3IPRA 4A8JB 3WTSC 3HOWJ 2A5FA 5BYAA 2LD4A 3L0DA 1EP1B 2TCTA 3F47A 2XYHA 1Z4PX 3EDCA 3LNQA 1LGYA 3HZRA 4PYRA 3AIMA 2HFJA 1YS1X 3NANA 3EWSA 4LSWA 2LPMA 4L78A 2W8BB 1OCRH 4TS3A 1ZS9A 4MYTA 2HTSA 5B1YA 5BNZA 4P5OA 3J7ZI 2HBQA 3E9MA 1YZLA 2Z04A 2F43A 4ARZB 4B0OA 3OEHD 3WBJA 1WKCA 2YBEA 2GXSA 3F8MA 1P2BA 1QTRA 4P4UA 2QX8A 3UT5B 3WNZA 1DIGA 2JHPA 3HM5A 5FKOA 3ZVMA 2X0RA 4M9CA 3ZY6A 4BNYA 1AJEA 2V6FA 3FPBA 4BEHB 1N2BA 4YEJA 4HWPA 3RVQA 1KKLA 1EGVB 1YJXA 1QK3A 3TQIA 4C5CA 3L8GA 1A0OA 4IIFA 3IH4A 5JI6A 4EI2A 4WWHA 2XDVA 3AEKB 4BUCA 3BZCA 2ZJQF 1UKYA 2BZ1A 4XWAA 5HJ7A 1CFZA 5L6LB 2JIRA 2CLSA 2OA0A 1HE3A 2L9RA 1AQUA 13PKA 3PQDA 5AM4A 3LKDA 1U2EA 3RJMA 1NN5A 1PR2A 1T24A 2COMA 2P2LA 3EA5A 4J2OA 3KWLA 4AP6A 4A8TA 4B7ZA 3EXEB 3OPMA 3PUVA 4KYVA 1B4AA 2OV4A 3DSRA 3MUFA 4OK6A 3V7WA 3AF2A 1IK4A 3ZDXB 3LTNC 4CEHB 1QR2A 1RPNA 2WF9A 3O4RA 2CL6X 1JGGA 1KKUA 1P0CA 1QG0A 1UJ5A 2HEGA 5E7MA 1SCIA 2IOFK 5IZ4A 1I1QB 1I4EB 4WY5A 3MGGA 3AJ9A 4LD5A 1KE1A 3UOAB 4L8LA 1ENZA 2HXGA 2C7GA 2BEVA 4ZVUA 4BLVA 1JT9A 1RJ9B 2P4SA 1MU0A 3KB1A 3MD2A 2I6SA 3MVEA 4IIHA 3Q7PA 1JEDA 4ER7A 1SURA 1IHUA 1WXEA 1EVLA 3FMGA 4BQSA 3CLOA 4HPWA 4PFOA 3CLRD 3WGGA 3WGQA 5EQJB 4YAGA 5SV2A 3OESA 1Y6FA 3I3LA 3QYPA 4KIJA 2EYQA 4P2GA 3L18A 3R5KA 3VHXA 1S8NA 4M9ZA 2WD7A 3PIDA 4JOMA 3MWKA 1HE5A 4MV1A 2GIVA 5CU7A 3UNXA 1QCDA 1WDWB 3ICEA 2AS5F 1IIRA 1FOWA 2ZB4A 1TO1E 1BGVA 5HKBA 3W9SA 1TPYA 3BSYA 3CF6R 4XSVA 5FP0A 2DUWA 4G25A 2EIXA 3S1LA 4C6SA 2O5EA 3BB1A 4EI8A 1XJWA 4MQ9F 1I4DD 6ABPA 3NDBB 3LKZA 6Q21A 1WUTA 5HQ3A 5C7OO 3OM9A 1RBYA 4QXPA 4BV9A 4RJKA 3I01A 1UJ2A 3LSTA 2NS0A 4N9IA 4XN0A 4A3MJ 1KMCA 3I2GA 4PCUA 1Y1TA 1PYOA 4HN4B 2OCGA 2HLNA 2V9ZA 2XSJC 2WILA 4LJKA 4OA8A 1MG0A 2GBCA 1B6AA 4UCWA 5CLSA 1T2UA 1M1XB 4CFYA 1YRNB 4AZWA 5CK5A 3MS2A 3CRVA 4WFQA 4CWAA 4OREX 3A7DA 1QFXA 1T8TA 1TIKA 3ERED 3UIEA 3REFA 4MWEA 1NBWB 3BXOA 3QF4B 4H6PA 4K46A 4ZOEA 5IP5A 5HKAA 2AEMA 2WINI 1ZM7A 2IOYA 1QHHD 2R8BA 3U62A 1I5RA 2LMDA 1JDVA 2E1PA 4DPMA 5JHUA 5JZBA 3R8FA 4L8FA 2VDJA 4IJ5A 4CCAA 2KSQA 3WDMA 1QB7A 1XBTA 5DO9A 2J9FA 3KVVA 1P73A 1WHSA 2W0SA 2VL7A 4O0LA 3ZWMA 4B9AA 1YL6A 1PIWA 4RVHA 5JYDA 1CEEA 1Q14A 2EEPA 2YDYA 9ABPA 3QBDA 4U2EA 1XDBA 2NUPB 4CQNA 3BTSA 1A9PA 3OP1A 4G4GA 4DMFA 3KPHA 3UF0A 1IUNA 3JQRA 3IR6A 1E69A 2XLCA 3EYAA 4WXEA 4EI9A 4M6XA 5C3MA 4P7BA 3ZMDA 1NR7A 1CKEA 5B5EC 3TJRA 3BK1A 4XIYA 4BEHA 2EWWA 5LDHA 1YVRA 4V2FA 3PYMA 2JGDA 1WB9A 4YASA 1RJWA 4D0GA 2IS2A 4FFBB 3SR0A 2WHQA 4QAQA 1KS9A 4X1IA 4L3WA 1CBUA 1CIJA 3O4HA 1VQ6I 2ZRKA 4DYVA 4XQEA 1X2BA 1C29B 2F4VB 4JNKA 4WE3A 1AZWA 4BO7A 4YEDA 1QH9A 1JUPA 4WDQA 2IV7A 1E1LA 2CBXA 2WPDA 4R9RA 2CL5A 5PNTA 1QBGA 3FFTA 1Z6TA 1JG6A 3EXEA 3PS9A 5HE9A 1P92A 3N2YA 5HXAA 2RBGA 3DLLF 5JJLA 4R01A 4YCCA 4TQGA 4PLWA 2VPWA 4MUJA 4QECA 3AUUA 5I5GA 2GM3A 1H69A 2ZXWH 3G02A 3CISA 4JLMA 1WBBA 2EV5A 1PJBA 3D3EA 3W2TA 4AM8A 1UHWA 3IPAA 2WZCA 4FEAA 3IAM1 3MB8A 1FOYA 3EVNA 3I2KA 2FPKA 4EMSA 3GPIA 4MVJF 4D99A 1MQ9A 3D2CA 2A68F 1KFCB 3H2JA 3IBTA 1HRDA 1EINA 4ZMBA 2A9VA 4L75A 1ZXLA 2HA3A 1M72A 1SFUA 2OY0A 2QD4A 3E4DA 3NBMA 4KNWA 4UVIA 1P1CA 4DTIA 3KRTA 4XEUA 3OCUA 1KK3A 1UM9B 1W5CC 1NA5A 1H8HD 2H7VA 4WRRA 1TW2A 3X2SA 2VQCA 5AI6A 4ECAA 3RIMA 1WM1A 2CLDX 3DUFA 1ZJ4A 1II8A 2IJGX 2BW3A 2PDAA 3ND5A 2QJRA 1M7BA 4KPGA 2ARKA 3WIVA 5JQGF 5KO2A 1QZ3A 4K8OA 4MQ4A 1DJPA 4V0QA 4QULA 2X40A 5CDHA 1YDFA 3QM1A 4IQGA 5JAIA 4O4IA 5A3VA 1LPSA 2LY1A 2M2IA 2W2QA 5D5VB 1YONA 3AVQA 1V37A 4W1QA 1D0IA 3R24A 2PMDA 1WJAA 2NZYA 1DIAA 5E6SA 2OUIA 1T6ZA 3LJKA 2AZ4A 1YRYE 3HGMA 2ZJZA 2LLKA 3B78A 1HQDA 4FGJA 4ML3A 4Y3UA 1UR5A 5EIAA 3KP6A 3RFXA 4C7VA 2BEOA 4QZVA 2HKOA 1PF7E 2HRRA 5F76A 3PXCX 1KIFA 2GRUA 3DTKA 2O7NA 2M0MA 2PZGA 3MK31 3PFHA 4TX1A 3ZGLA 2QS9A 3GRRA 1HW2A 5AVKA 3WIUA 2WV9A 4XDZA 5L3QB 4BHCA 3S32A 4ZDIA 1XL0A 4UHKA 4BXUA 4Y30A 4G5GA 1DP3A 1M54A 3FMIA 4V0NA 4IPTA 1XVVA 2NO0A 2P91A 4QJBA 4QOIA 4NENB 2OSVA 4UDOA 1MEJA 5J9FA 3ZE8A 3ZQ6A 3ZWKA 5L4SA 2XYPA 2W4MA 2RHRA 2JUCA 4LYGA 4GKVA 2ETXA 1RWVA 3H65A 5IM4F 1XA3A 2WADA 3JCZA 3F5QA 4L5BA 2PO7A 4Y0VA 5CA0F 1JLKA 1WI9A 1L2TA 2YFQA 2K4JA 1TQPA 4QAJA 2GEDA 3JVUA 1GAWA 1E7SA 4LBYA 2ZBVA 4XGQA 5AUPB 1JBKA 2H51A 4PANA 4M3DA 1TP4A 3UWOA 1P2DA 2OGZA 3NX4A 2Z5FA 3CP8A 2K5CA 1H65A 1EYZA 5D3QA 4FETA 3FLEA 1GZ3A 3TRFA 2QVXX 4MWGA 4PZCA 4UJ3A 4JIMA 4XRSG 2KIUA 3NTRA 4AP9A 2DH6A 2A9JA 1UCFA 3T5MA 5BN3A 1D4FA 5DASA 5LR6A 2XTAA 3FMOB 3CVUA 2MR6A 4B47A 3QEMB 4FW8A 3NATA 4Q82A 1TCBA 1ABFA 5BSMA 1U2SA 2LCQA 4ETIA 2VP4A 4L74A 5KSZA 4NC7A 1SU4A 1G3IA 2HHAA 3ZN1A 1DEHA 3H7IA 1QTQA 3VBEA 3UO8B 3FPGA 3I05A 1RTTA 8GPBA 1B0AA 5C1IA 1UMKA 2V03A 5LOVB 1Z6GA 3TPZA 1J5XA 3AHFA 4KLAA 3AWDA 1SEUA 2XE8A 2JJ2A 2XCQA 3UNGC 1FNMA 2XWJI 3BWDD 1FSPA 1XK7A 4R8VA 3PTLA 4A5OA 3HPHA 1LK0A 3Q6MA 5LEKA 2J8ZA 4KQMA 1NBME 1VIAA 2VJMA 5HDNA 2WZBA 1XCVA 3E5HA 5FL3A 5EGOA 2OV8A 1GKLA 4FUQA 1PDNC 1LX7A 1B6TA 2EX4A 4JQSA 4O5OA 4RA9A 3AFIA 3PEFA 5EZ6B 3USES 4AKSA 4YT2A 1DDIA 1KHTA 1AHNA 3KKEA 1G8MA 2X4IA 2HDNB 2PSFA 4CW7A 1U2PA 3RR2A 1RADA 3DZKA 4KICA 2OXFA 4HB3A 2A05A 2PSHA 2WUGA 3PL5A 3PXBA 1PDOA 4JA2A 3L6DA 4RD1A 2FI1A 3UV7A 1E3SA 1V1RB 5CD1A 2IYFA 4PYJA 1QV6A 4XZ3A 5CGQB 2R7LA 4BGDA 2XCSB 4I8DA 4NQWB 4XSXF 1WWXA 1L4FA 3FPAA 3TOSA 1USTA 2ELJA 2L69A 4DQLA 2DQLA 4TS9A 2DOFA 1S3IA 4F1JA 1FW6A 4KWTA 5FI5A 1NWHA 2GN8A 1CG6A 4C6RA 1II8B 2PG3A 1RKQA 1QIMA 2FHPA 5KYTA 1NF2A 2ZI4A 1GXSB 2UUPA 3AUSA 3L6BA 4QU0A 2L4MA 1YHNA 2JHFA 2D7DA 4E2WA 4QU9A 2H59A 5LBUA 4W5NA 1XAHA 5CQEA 4BQIA 4ANFA 3M4OJ 2WHRA 4D7MA 2PQ8A 1TQDA 2OO3A 3BMNB 3ILHA 3FRIA 4FOLA 1O97D 4I5EA 4C0JA 4KN6A 4EGJA 1Z6QA 2PVPA 1EWRA 4OFBA 3U1TA 2JIQA 1QGAA 3B1VA 1LRJA 3IH2A 3IAS6 1IVSA 2DTRA 1ML3A 2FWRA 3HKZN 1CY6A 2R6R1 3FISA 1WQ1R 2YHIB 2VPTA 2HA6A 4P7FA 1D0YA 1KI6A 1Z6PA 3ILXA 3WLHA 2P40A 4XUCA 2PUFA 4ESJA 1QIIA 1RAHA 3QLJA 4G97A 1U28C 1Q50A 2PAAA 3WLJA 4EW6A 3I6BA 1G41A 1GQ2A 2VHXA 3F71A 4H15A 4WZAA 3NS7A 1JIQA 1HLPA 1GLGA 5CIYA 2FUG2 1ZK2A 5DM0A 2JA6J 4CMIA 3K6SA 5CLHA 3EMDA 4HEJA 1OFUX 2NTEA 4HX8A 1XD7A 5CTAA 4A2UA 2YUIA 3CTAA 1XKLA 4I4IA 1YG2A 1NNI1 2EV6A 3KX2A 2F3QA 4G94A 4J0GA 2O8BB 1FLAA 3H05A 2IUSA 4ASNA 2F00A 2OORA 2NV0A 2GPTA 2Z6VA 3GJ6A 4B09A 1Q3KA 2W8BA 4QM6A 1BX3A 1PQ4A 3EUEA 4C4SA 4K0KB 5K03A 4R1SA 2QDKA 3CE9A 4GKJB 2WVJA 4ZYTA 4JX6A 2KZGA 2A4KA 3O31A 4TS4A 3UT5A 5IARA 1IUPA 1P9RA 1PJTA 2PA3A 3KQQA 3CLQA 2ZPTX 1NRWA 2BCGY 5IJAA 4TWIA 1B8IA 5I9SA 4B5LA 2R1TA 1IW7F 5SYAA 4GLBA 2CWEA 3E53A 3MWEA 5AK0A 3JY6A 5EXEA 3QVKA 5JOQA 3RF7A 4A0QA 3PF9A 3I04M 3N8KA 4L3VA 5J5AA 1HEUA 3VR4D 4RJIA 4QU5A 4IX1A 2XY4A 6PAXA 2XAFA 5K3AA 4M9UA 4MA5A 5GINE 5ERIA 3B13B 4BCCA 4HZIA 1J0AA 2XCLA 4NWIA 821PA 1USVA 2NXJA 5J58A 3J7AC 2V74B 4LNUA 4ANJA 5E1OA 3NBFA 4HS4A 1RCTE 1G8PA 1M2WA 3ULKA 4BNFA 1OAOC 3ZI4A 5KNLA 1TZBA 3BDDA 2WDZA 2NVTJ 3DLTA 3K96A 3OBBA 3QLVA 4KQEA 4NFSA 4OAPA 1BZYA 3I4PA 2FF7A 1RRPA 1B3BA 4N4AA 4MITA 5IYDJ 4XQGA 4M22A 2IPAB 2W43A 3T7IA 2H0RA 3AY3A 4MINA 1Z34A 3VFZA 1Y9DA 1RJ9A 1QPGA 1ZRDA 2A1UA 5K7ZA 2IXGA 3L7MA 5EZHA 3I6ZA 4BN5A 1TZKA 4GX1A 4YP7A 4ZJUA 3R3WA 2JBAA 1N3BA 5H2FC 3D54D 3ZKWA 1IV6A 1QRSA 1Z15A 1H66A 4W97A 3VH2A 3UK1A 4NNJA 3H8SA 5DM2A 4WKNA 3HKDA 1GTSA 4R98A 4I6GA 4UCFA 1LDBA 2YICA 2QG6A 4K3UA 2AQFA 3H1AA 2BIFA 1JX6A 1T8SA 2Z4RA 4HDOB 4HN2A 2EZLA 4DIDA 4DG8A 4HAIA 3T8TA 3PSFA 2AMLA 5BORA 4ENQA 5F08A 1SXHA 1V1MB 4ZV9A 4BY1J 4DL9A 1RQ2A 2VQEB 2Y1KA 1MVNA 4LK2A 4HBLA 4I3FA 1Y1QA 1BC8C 1X7XA 2IIQA 3NPMA 4XXHA 5TXGA 1Y0NA 2PTHA 5H81A 3G6EI 5J5CA 3PFBA 4PFJA 4KPEC 4H59A 3ONQA 2IEZA 4G0ZA 2A6HF 3GFSA 3Q8XB 1JYSA 5AM0A 5JMPA 4JELA 4I46A 1ZLYA 4AL4A 4MUBA 3WRXA 1N2SA 5BQ5A 4EPWA 5TV2A 2WWFA 3FYUB 4M98A 3ZWPA 2E9SA 4YRKA 1Y1WJ 3H5AA 1YJCA 5B1DA 1Z21A 3M2PA 2W2MA 4YWHA 4BQRA 5KKCA 1K7CA 4IIJA 1LEHA 4JEMA 2C07A 1MR3F 5E3IA 4UMFA 4BBAA 1G3SA 3RSZA 3IAS2 4WXDA 1D1SA 5LLSA 5TB5A 1O7JA 4JD5A 2WAFA 4GYIA 4MJ3A 2LRDA 1UDRA 2Q07A 1BU5A 3INRA 1A3CA 1NNLA 2QX7A 4GT1A 4EGQA 3IKMB 1ECBA 1GHTA 2EFCB 1XZKA 4BMVA 4CMIB 1JYEA 2PI0A 1U1IA 3OETA 1UAYA 3J81Z 3LHFA 7REQA 4WV3A 4A3LJ 2BELA 3H13A 3MWMA 2QSUA 1BNCA 4PX9A 4QYTA 1PGPA 3OJ0A 5H80A 4JC8A 4NXMB 2GRJA 5IHPA 3WMXA 4U87A 1Z4OA 2Y9PB 1R5BA 4QJ4A 1QMPA 2VDWA 2Z8YA 1J0DA 5IG2A 1O9BA 2RAEA 5GTIC 1RI2A 4KJXA 1K4TA 1AY0A 2DXIA 1TUEA 1Z2AA 4G41A 1G5FA 3A2LA 4M60A 1LVAA 4Q4HB 4X7BA 4XYGA 4D97A 5HVNA 4WLEA 1PWYE 1DTEA 2OQVA 1OXVA 3JQDA 2YTZA 5CFNA 1UBHS 5B1BH 5H70A 2X6WA 8ADHA 3K8OE 4F5YA 1PZFA 2GD0A 2I03A 4J7CA 2PKYX 4EV0A 1MBZA 2JGDB 4HDQB 4FDAA 1EG7A 2A6TA 2VJCA 1U7DA 1SVUA 2D0PB 1N5KA 4J4HA 2G5GX 3GLGA 1XPUA 3JRXA 2B9VA 2PCJA 3MF4A 4ZALA 1JVSA 1B00A 3VNQA 1G19A 1TK2A 1WSWA 3D8UA 2QP4A 2BHYA 1SB8A 2B4TO 4MUIA 4W9MC 3G1WA 3QXCA 4BXOB 1A88A 3MT9A 1ULHA 4EZIA 5JPDA 3V6MA 1W4LA 2VUTA 3HUUA 1VLJA 1YE9A 4I19A 1W0UA 4QPZA 3EA4A 5EWMB 5B5SA 1HLVA 1WOMA 4QWQA 3CRZA 4TV8B 4YS6A 4B17A 3A11A 3ANYB 3R75A 2C0PA 2X9QA 1BW9B 1J33A 1JJBA 2D62A 3K8QA 3Q40A 3QOPA 3KTFA 3D31A 2KB0A 5AJYA 1M6VB 3B12A 3K9NA 4LJ5A 3H5LA 5DM1A 4E7IA 4MTLA 3JCUC 1L7OA 1HY3A 2YNMC 1TQMA 1KETA 3N6VA 3ONEA 4PFQA 4KMFA 5F23A 2DR2A 1J07A 3VR2A 2HA4A 3G2QA 1DU4A 4L1KA 5T57A 2F8TA 1VPDA 1POXA 5DYWA 4MQEA 4O1IA 2COKA 3GLKA 1ZELA 3KG2A 4GC5A 1MO3A 2AA3A 3BE4A 2GWRA 1XDUA 5J47A 5LGUA 2A30A 2R7AA 2WU3A 3TXXA 3UHAA 3OX4A 5KTMA 4KGVA 4TRNA 3T1YB 4KE7A 3TXAA 3B1WA 3N7TA 2EFDB 3ND6A 3TTTA 1K7XB 4WBXC 1B6SA 1SBTA 2GBYA 4WASA 1EP2B 1F60A 1W48A 3MVPA 1DU0A 3F8SA 4Y17A 2CFSA 3SU8A 3I9V6 4NQRA 1RWPA 2E60A 3LQ2A 5AM1A 5A71A 3ZGOA 1G38A 1ADJA 3RHFA 3SC6A 5AYVA 4EM0B 1E59A 1CD5A 2Q3MA 3L8HA 4I5FA 5M3FJ 5DCWA 1W6RA 3A70A 2PMHA 1QOZA 5HF5A 2BY2A 4OLBA 1DG3A 1VKHA 3E05A 3LZDA 3S17J 1XZFA 4CTOA 2KJCA 3D8NA 1DEAA 4ZVPA 1NDUA 3D8TA 2QMZA 4F3KA 5K4AA 2HF8A 4QASA 1DOZA 2R6CA 2P9YA 3TM4A 2QQ9A 4BU0A 1WMBA 4EG4A 3SQXA 3VPGA 1RKVA 3ADDA 3LU1A 1RXSA 1I5EA 1GM5A 4E11A 2EPFA 2QTZA 4FYJA 4ZVVA 5KOJB 2HSWA 1R6UA 3INYA 2AN4A 1H0MA 1S9DA 3NTQA 2J3MA 1DJMA 2G0AA 3OQOA 4H1UA 4DILA 1N6OA 3NG1A 1L5SA 3FNIA 2VS1A 5JDIC 2L42A 2GBLA 2DDBA 2NVOA 4AKHA 3DHWC 2DMQA 2IZ0A 1ZNQO 2JI7A 3NMUF 5B6JA 3DMPA 1PVOA 2ZYSA 3CA8A 1EFHA 5EVJA 2JD1A 3NTUA 3OIGA 4ENVA 4JSTA 3WISA 1ZUWA 5CB8A 2Q1SA 1W9HA 3MLAA 3RVOA 2RARA 3W3AH 1LD3A 2RD2A 1LE8B 2ZNZA 2HUNA 2HIGA 2W83A 1XG5A 3FIUA 1W34A 2IHZA 3M6FA 4H3SA 4L51A 5FTNA 2PX2A 3RUCA 5LLTA 4HDRA 2P4QA 2PVCA 4KDCA 1VOTA 4RVCA 3EH1A 5HGXA 5DCMA 2PXAA 1ESNA 2LCIA 2X1VA 1EFCA 1PTJC 1EIZA 2CHQA 4QVGA 2IUFA 2Z43A 5KOHB 4R83A 1U8UA 1T2AA 3EVEA 2MSKA 4L2IB 4PZJA 1UBJS 1OYVA 3AYXB 2L17A 3DOCA 4C4YA 4DREA 3H3JA 4KKXB 4G26A 1EI9A 1XD2B 1ZK4A 3L06A 2FF4A 4JHXA 3AJRA 3KU1A 4GXOA 3MMSA 2PTGA 5FLXZ 1LDNA 1T4MA 4PQFA 1FX7A 4RAFA 1Z88A 3BMOA 1CS0A 3V7SA 3VAAA 1L8OA 1LS6A 4MLPA 3VHQA 3HXQA 2IRWA 4MB2A 2QBYB 1KBOA 3TG8A 3ULQB 1BYIA 1PFQA 1YQGA 3D2BA 4GLOA 3IUQA 2I2CA 4BLPA 1JPJA 2BCEA 1ORIA 2CNWA 2J5OA 4U7BA 2YVAA 3KLNA 3AG3H 1UBMS 1X74A 3KKMA 2PT5A 2QZ8A 2UUOA 1Q1EA 3OTIA 4N4NB 4JVMA 3P9XA 2XVXA 4L5AA 3W6NA 1YDHA 1H2ZA 4RPCA 4EB3A 2XDYA 1MJGM 5LBQA 1PLJA 2OCAA 3R20A 4JMLA 4LYYA 1SB9A 2YWEA 1HDEA 4MRPA 4TT8A 2EA4A 3CCSI 2BPOA 5AVWA 1S3JA 1MMAA 1RWMA 1IG0A 1XRPA 2WU0A 2ZSKA 2CXTA 2QCOA 1GZ6A 4Z8YA 2QDXA 4W9NC 3NVMB 3TR6A 3PZBA 1KTVA 1YJBA 2B69A 4BEWA 3VYSB 4I0AA 4M8LA 1GZ5A 2Q2EA 3R60A 2C04A 2CKDA 4RH3A 1XF9A 2GEVA 4UAUA 5EJGA 2XPWA 1IPHA 1EFVA 2XC7A 1EXWA 1XO1A 1SG6A 2JH3A 3ESBA 2Z1NA 2RQPA 4MVWA 1XDDA 2IWHA 1GU7A 4TVBA 4ZVLA 3V5NA 2MC4A 1KAHA 2PUGA 4IRXA 4Q03A 1J2YA 1DFGA 3COAC 4C3HJ 3DU6A 1E1YA 1O08A 1RQPA 3OFVA 3PQCA 5AK3A 3TLBA 2W82A 3UYKA 4J76A 4H7EA 3ZZTA 4TXLA 4HI0E 3D6VA 1HDRA 4KH1A 4DT1A 3R9WA 4MLDA 4CCOA 2R5NA 1D3AA 1UT6A 2DPDA 2OD2A 3MS7A 4BLTA 2D2WA 1A5SB 4HDNB 2I8DA 1TC1A 2GYWA 1WD7A 1ZGGA 2VIIA 3HRTA 4O0MA 5CYFA 4GAEA 5FUVA 2Z9OA 5EE0A 3F5SA 4ZVRA 3WLKX 3P9SA 1W1WA 1XN7A 3V7YA 1SA0B 4EKEA 3F72A 3QE4A 3DE4X 3CU5A 3EMVA 3D6TB 1R0SA 1KJJA 3GLTA 2RH8A 1KQ8A 1E99A 5KYGA 1JGTA 4MKFA 1RRKA 1YBFA 1JTYA 3TOBA 1R71A 1UQUA 2E7ZA 4P31A 4CR8A 1NW6A 3DKYA 3CH7A 1PTKA 1JE0A 1S2MA 1ZD4A 1XKXA 3PQ4A 4OFWA 1CULC 1FUUA 2O9JA 3QE9Y 1IBLB 3L92A 3P0JA 5I7OA 3RYFA 4AULA 2AFHA 3FB1A 1B72B 4CUKA 5BO5A 2DG2A 5CG2A 5D5QA 3I9MA 2BBSA 3TMKA 2DTEA 1Q0TA 4CQMA 2BYTA 1AGPA 1QFMA 5IXYA 4YIKA 1GPBA 4DMMA 1XZ8A 3BGWA 4U5XA 1TA4A 2PZJA 2FQWA 1K8RA 2FLVA 3GO5A 2WBMA 3K9CA 4HNHA 4U5QA 5DSTA 4OUKX 2XUFA 3NHLA 5TQ0B 4C0BA 2HYGD 1K92A 4JK1X 3AIIA 4HDRB 4RLHA 3EIHA 5ALKA 4K3VA 5IDWA 5LPNA 4CKYA 4A9AA 1G3RA 3AETB 4WUTA 4PM4A 2VHTA 1D1BA 2OV3A 1JZQA 1XG1A 3HOXJ 5FYQA 1XJQA 1GSIA 1RWQA 1X9HA 1V3VA 3SF0A 1JW9B 4KO1S 3T5CA 5F12A 4ZT3A 2IA0A 1T13A 4DRYA 1YZHA 4DIEA 4YCNA 3QA3E 1G5PA 1TYAE 1D5WA 2GXQA 4BLRA 2M1ZA 4D98A 1R5GA 1Q7TA 3AKDA 3N2ZB 1IGNA 1JNXX 2EBFX 2W2NA 3HU5A 1XMSA 2JAHA 2H17A 3SBOA 3X2QH 2YNMA 1R6AA 3DF7A 4L9RA 1QF6A 3GI1A 2H2IA 1J2TA 1DUXC 2BZGA 3ANMA 3EWNA 1T0HB 4Z5XA 2R2GA 4M0KA 4A15A 2E5LB 4TQAA 3MSCA 1C50A 3DV9A 2JBAB 1T9BA 4E5YA 4EHDA 1T3LA 1QO7A 3NP7A 1WPQA 2A78A 3EDQA 3I0MA 4WCFA 3RNOA 5GGXA 3DEYX 4K9DA 2Q6LA 4R51A 3MTJA 3OEEA 2WD8A 2O7VA 4LX8A 3VKVA 4Y18A 1L7AA 5D85A 4YMIA 1P5HA 2P90A 3F3YA 4MGKR 3A4CA 2ZU6A 4CLXA 5I47A 4BAUA 1X7XB 1CPYA 4NATA 1VE3A 1DX4A 1YB5A 4PSKA 5TJ9A 4C6TA 2XA2A 3OEWA 1U11A 1MRZA 1Z2DA 4QYSA 3WKEA 4PN7A 1M2JA 3IVXA 4LDQA 2FW8A 3Q7TA 1ZLJA 1ODSA 2I1WA 3QPLA 1L5HA 2X85A 1FFSA 3H9GA 3I5UA 1T5HX 4B7AA 4DLZA 4AY6A 3K9HA 2Q2QA 5JDCC 1K06A 5GJVC 4ND8A 3RARA 3BGVA 2WHYA 3O6BB 3FNFA 3R3UA 4L72A 4CIDA 4IP0A 4F7ZA 5KVQA 4G56A 2RH5A 5L3EA 1VJ1A 3ZJ5A 4MV7A 4EHNA 5C4MA 2Z2SB 5FEUA 1NG9A 4OYYA 4XORA 2NIPA 1KMHB 2OFOA 3L6CA 3PR3A 4Q1DA 4WOJA 4Y6QA 5FB3A 3U7QB 5L53A 2I6UA 4Z4CA 2QYOA 3OYNA 4YV0A 5HYVA 5JZSA 1M7HA 2C99A 3FM9A 4U7GA 3BWEA 2GK3A 2M34A 3OZFA 1IK6A 2JFFA 3D5EA 5EJ2A 1WIWA 4OAOA 3WK7A 4OLFA 4UM8B 3IAFA 3FUXA 3U1DA 2HU9A 4IXNA 2OGWA 4B3SB 1XRQA 4JJAA 1S2GA 1XVUA 1ZOLA 3U0VA 3AHIA 4M0PA 2C2YA 3ED1A 2VDWB 4GBED 2E1MC 2SKDA 3R0QA 2XWQA 3TNLA 3OTWA 1U1GA 4BJ3A 4D4KA 3W4JA 4K9SA 4O4IF 3JQBA 3U3RA 1QVUA 2BD0A 3DBOB 1JZTA 3E6DA 2VUSA 3K0BA 2WY2D 4F4JA 5BMVF 5K8IA 2FEMA 3RFTA 1V3UA 2O8FA 1QG4A 2P3SA