4HG2A

The structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
AFRPRYPRALFRWLGEVAPARGDALDCGCGSGQASLGLAEFFERVHAVDPGEAQIRQALRHPRVTYAVAPAEDTGLPPASVDVAIAAQAMHWFDLDRFWAELRRVARPGAVFAAVTYGLTRVDPEVDAVVDRLYHGLLARDWPPERVHVESGYRTLPFPFPELEAPPLEIEERWPMDAFLGYLGTWSAVTAHRRRTGADPLAEIAPALRAAWGTPERPLRVTWPIAIRAGRILPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Putative Type II Methyltransferase from Anaeromyxobacter dehalogenans.
rcsb
source organism Anaeromyxobacter dehalogenans
molecule tags Transferase
molecule keywords Methyltransferase type 11
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2560 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hg2A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4hg2A01
1RI1A 1I9GA 3UJBA 2P7HA 1T43A 2O57A 3MCTA 5FWDA 1FJXA 3BKWA 5HEKA 5KS2A 1NW3A 2YQZA 4GOND 3HA7A 5HILA 1P39A 4RTPA 1X1BA 3G2OA 4DCMA 4EKIA 4LG1A 3CJRA 4KIFA 2K4MA 4X63A 4BP3A 1FP2A 3VC2A 1QAQA 3TFWA 3P9CA 3HVHA 3HVJA 3LBYA 5EMMA 3EVDA 1EAMA 2NYUA 4K6MA 4DMGA 2EJUA 3B89A 3HP7A 5EZSA 2YUIA 3EVGA 4FS8A 2O06A 2O07A 5GIOE 5DXJA 5E2AA 2WA2A 5E2BA 4CWAA 3CVOA 4C05A 4GOLD 3HCEA 3TM4A 3UJ8A 3NDIA 3KKZA 4PYNA 3OZSA 2FCAA 3LBFA 5D1HA 3TPZA 2I6GA 2PXXA 2ESRA 4GC9A 4YUWA 5BP7A 4OX9Y 3FPFA 4P7KA 1YZHA 2HWKA 1ORHA 2IH2A 4X61A 2PX2A 3REOA 3T7RA 4BY9E 3M6VA 2GH1A 5DTRA 3ELDA 3M4XA 4QVGA 3DR5A 4YUZA 2BZGA 3EEYA 5DPMA 5G02A 1DL5A 3LDGA 5E9JA 3TRKA 3BGVA 3GDHA 4P7GA 4YV0A 1KYZA 4HGYA 5C9ZA 5K0LA 1R8YA 4C04A 1XTPA 5BXYA 2G71A 1JG1A 1O54A 1XCLA 5EGSA 2B78A 4BLWA 1L3CA 3BKXA 5T64A 5GM1A 3RIEA 2FK7A 4GF5A 3P9KA 4KRGA 5CD1A 2P3QA 2C7OA 4QVKA 1ORIA 3LDUA 4ISCA 4EVIA 4AZVA 4X1OA 3GRYA 2Y1WA 3FTFA 9MHTA 4E31A 1INLA 1KR5A 3HCAA 2XVMA 4E2ZA 2UZ4A 4ATNA 3FUWA 3OU2A 3P9NA 1QAMA 4RSRA 2JH8A 2FHPA 1NKVA 2IIPA 3A25A 1KPGA 3G88A 3GRVA 4PYIA 4ER0A 1RI3A 2R6ZA 3FUTA 3KQWA 4P58A 5E1BA 5F2KA 3ERCA 2YX1A 3P2KA 3KPYA 3X0DA 3UZUA 5HIKA 3DLCA 1WG8A 5DWQA 1NV8A 1BOOA 3KU1A 3DMHA 3SXJA 1SG9A 2UYQA 2OYRA 5ICGA 2IH4A 4F85A 4E70A 4DCGA 5FHRA 5EIFA 1HMYA 5GM2A 3UJDA 4CTJA 4PYQA 4LECA 3SMQA 5EKXA 3GGDA 3DH0A 4P7JA 1JG3A 3LECA 2CL5A 5C1IA 4RTMA 2OKCA 3GXOA 3TOSA 3DXYA 1NBHA 1IY9A 4A6DA 4GUAA 1N2XA 1M0EA 4R8RA 2CKDA 3C0KA 3R0QA 5GOZA 1VL5A 1JQEA 2AOUA 2FK8A 3HVKA 5K8VA 3KQSA 5E1DA 1F3LA 4OBXA 5DSXA 3T7TA 2JHCA 3AXTA 4PINA 2ZSUA 5LSAA 1N7JA 3EVFA 1ZGAA 3C6MA 3VC1A 2AOVA 3A26A 2QRVA 4C07A 5K0FA 4DKJA 5DTMA 2NNWB 3M6WA 4EKGA 4IKPA 5GP1A 5FUBA 3A27A 3CKKA 3KQVA 1L1EA 1XCJA 2UYCA 2XBMA 2CMHA 1RI4A 3OU7A 3PLAE 2JJQA 5EVJA 3DMGA 4C08A 3R24A 3PB3A 3AWIA 1QYRA 5T67A 3NWEA 5FWAA 3EVAA 3E8SA 5E9WA 3DLIA 5CM2Z 1SQGA 2EFJA 3OPNA 2E5WA 2GLUA 2AOUB 2JHAA 4F84A 1Q0TA 3JWHA 1G6Q1 3OZRA 5LQJA 5LQKA 1X19A 3PX2A 4OQEA 5CUQA 2YXDA 2ZZNA 3BGDA 4GQBA 1D2GA 2GA9A 2GPYA 3B3FA 5K0NA 1P1CA 1U2ZA 5EOVA 1SUIA 4FR0A 4YMHA 3TLJA 5FTWA 1WXWA 2OB2A 3OE5A 2ZLBA 3UJ6A 5KYGA 5MHTA 4YUYA 4PNEA 5HIIA 2G8NA 1O9HA 2PSSA 3ELYA 5DX0A 2QYOA 3FPGA 3MTIA 5FA8A 2NXJA 1VP3A 2IGTA 4PYMA 5HOQA 1RJEA 5FULA 3S68A 1QANA 3MHTA 4RTJA 5DM2A 4BLUA 2B3TA 3NVMB 3KQYA 2ZZKA 3UJAA 3NW9A 2XYRA 4XUDA 4FT4A 3K0BA 1R6AA 3VSEA 2Z6AA 1G60A 1YZ3A 2B2CA 3I53A 5LR6A 3V97A 2BH2A 2XYQA 4QQNA 3P71T 4KWCA 4PWYA 2IP2A 5DLYA 4GC5A 1VIDA 3O4FA 5K05A 3LCUA 3MAGA 5LQUA 3JWJA 1YUBA 3SVZA 1XDSA 2XYVA 5CVEA 3FPEA 4YV2A 3ME5A 3U81A 4OA8A 3EGIA 3EVCA 2O05A 3HM2A 5CVVA 4E32A 3O7WA 3TQSA 3KQMA 1X1CA 2ZBPA 4RX1A 1KPIA 2HNKA 1DCTA 3OZTA 1JTFA 2VDWA 2ZIGA 3CJTA 3HCCA 3DP7A 2VS1A 3A7EA 3I58A 3VYWA 3ER8A 3SSNA 3NVKI 2BM8A 3THSA 4RTKA 3WSTA 3FPHA 5EEGA 3B7PA 2ONZA 2DPMA 3IV6A 3O31A 3TKYA 3GCZA 3SSOA 1JSXA 1NE2A 1IM8A 1UIRA 2P3LA 2ZCJA 3DXZA 3FYDA 5EC8A 4RTNA 2N47A 1HNNA 5HIJA 1D2HA 2PY6A 3EMDA 3ORHA 4WVLA 3SM3A 4EQZA 4QTTB 4BP1A 4MWZA 2Q41A 4GBED 3FZGA 2H00A 5DX1A 2WA1A 1NW7A 2YR0A 4DM3A 1KHHA 1M6YA 4JXJA 2NXEA 3BUSA 1JQ3A 5BW4A 3FPJA 1KXZA 4KVZA 4RTRA 3RODA 2JH9A 5KVAA 1VQ1A 1X1DA 3CJQA 4FSDA 5LQCA 4G56A 1TW3A 2P1DA 1TPYA 1XXLA 2AOTB 3FYCA 5CCBA 4Z2YA 2P41A 3FTDA 1PJZA 3A7DA 1VPTA 3KR1A 4AZTA 4PCAA 5EIWA 3THRA 3KQTA 5T6BA 3ANXA 3ELWA 5CVUA 2YVLA 4L7VA 4Y2HA 1G8SA 2UYOA 4H0NA 4R8SA 5LQNA 1Y8CA 2WK1A 4FP9A 2IPXA 4YUVA 5GIPE 7MHTA 2QRVB 4E2XA 2DULA 3MGGA 4DZRA 3BT7A 3EVEA 4P7FA 3BWBA 5B1SA 3CCFA 2PGXA 3P2IA 5DM4A 5ERGB 1RJFA 4PYJA 3GIWA 2ERCA 2NXCA 1YB2A 3G5LA 4HSGA 3SGLA 4CTKA 1XDZA 4YUXA 2NP7A 5E8JA 4MIKA 3C3YA 4HRAA 3GU3A 1JQDA 3BWCA 4F86A 2AVDA 2ZVJA 1VP9A 1BC5A 1I1NA 1Z3CA 3H2BA 5M5BA 4FSXA 1IXKA 4XUEA 3G8AA 5EEHA 4YMGA 5K09A 5CCXA 2PXCA 5DRYA 3HEMA 3RW9A 2H1RA 3CBGA 3KR9A 2P35A 2R3SA 5FCDA 1G38A 4MQ4A 2OO3A 4LWPA 3LSTA 3OE4A 5DXAA 4IWNA 3FTCA 5GINE 4PYOA 4RTSA 3TM5A 1ZG3A 3GWZA 3DUWA 3P8ZA 2G70A 1G55A 2OY0A 4GEKA 5DX8A 3JWIA 5EMJA 4ER5A 2ZIEA 1WXXA 3HTXA 2HTEA 5FA5A 4OQDA 5DSTA 3GRUA 4R6XA 5EG5A 4YV1A 4Y30A 2I9KA 1KIAA 3KQQA 3G5TA 4C06A 2PT9A 4O29A 3LHDA 3HVIA 2CMGA 2AVNA 1BHJA 3B3JA 3LGAA 4U7TB 2BR4A 4WXHA 1AQIA 2ZZMA 4XUCA 4AZSA 5HIMA 1I4WA 2Y1XA 2FYTA 3LX6A 1YFJA 3LDFA 3SSMA 3FTEA 4KIGA 2VP3A 3MB5A 4RVDA 3L8DA 4X60A 1SQFA 1MHTA 2PX8A 1JTEA 3MERA 3E23A 2O0LA 4M7RA 2B25A 2GB4A 3IEIA 3A4TA 2Z6UA 4ER3A 5K0CA 5D1NA 3HA5A 1NW8A 4AZWA 4CKCA 1QZZA 8MHTA 3BGIA 1JSZA 4V0QA 3KPWA 5JR3A 5EPEA 4KDRA 1JG2A 3TMAA 3HCFA 3M70A 3HCDA 2BM9A 4AX8A 2AS0A 2OZVA 4R6WA 4RVHA 4RTQA 5K01A 2ZFUA 3G2QA 3G89A 3PS9A 4POOA 1R00A 3MCZA 5E1OA 3OFKA 4M36A 3P9IA 4QTUB 5DM1A 3PFHA 4V0RA 1EJ6A 4ER6A 5K0EA 3AJDA 4AUKA 2ZW9A 1V39A 2PWYA 2PV0A 5KQRA 1F38A 5U4XA 1P91A 2G72A 2Z6QA 1KYWA 3C6KA 3Q87B 2BR5A 4PGGA 5FADA 1BKYA 2GS9A 1KP9A 3KPJA 3GO4A 5K0JA 2A14A 4RVGA 3PVCA 2HV9A 2AOWA 2YTZA 3M33A 5CVDA 3PTAA 4ZTBA 3AXSA 5LQAA 4RWZA 5HFJA 3K6RA 3QV2A 3GRZA 3PFGA 4QPPA 4BLVA 10MHA 2PX4A 3P2EA 3UWPA 3OFJA 2ZWVA 5K03A 1KPHA 1WS6A 4KDCA 5EMKA 4EK9A 2F8LA 1RI2A 1AQJA 4RV9A 5JUWA 3SX0A 2YXEA 5E1MA 2QY6A 5P8WA 2EX4A 4CKBA 5ICEA 4IV0A 3LL7A 3MQ2A 4EMSA 1L9KA 1EG2A 4PIMA 3I5UA 4E33A 2OB1A 2ZIFA 3NTVA 4M37A 2GAFA 2ADMA 2QM3A 3I9FA 3LKZA 1RJDA 3EVZA 5HZMA 3LKDA 3EVBA 2ZWAA 1AF7A 1PRYA 1XDUA 4QPNA 3E7PA 1FPQA 5IH3A 3R3HA 3BZBA 3MTEA 1FBNA 2PVCA 2XVAA 1O9GA 2C7PA 1WZNA 2LD4A 3UJCA 3ELUA 4X41A 1P1BA 1X1AA 1RJGA 2PLWA 3CGGA 5K0BA 4RTOA 2KW5A 2PXAA 2AN3A 3HNRA 4FGZA 4PONA 1TW2A 2PJDA 3KPUA 2PBFA 1YF3A 2PKWA 3ER9A 4RTLA 5E8RA 1MJFA 3QOWA 4UOEA 1YFLA 3UBTA 2ZULA 3G2MA 4C4AA 5ICCA 4DA4A 4GOMD 5FHQA 3B3GA 4PCLA 5EZQA 2ONYA 5EHIA 3P97A 3IHTA 3LCCA 4PYLA 3G7UA 2EJTA 2H11A 2AN4A 2IDJA 2P3OA 1ZGJA 2YXLA 5CVJA 3V8VA 1NBIA 4DF3A 1SUSA 3D2LA 3UA4A 3B5IA 4E2YA 5EHGA 3DMFA 2AZTA 2HMYB 2AOXA 2BR3A 4RYLA 1RI5A 3DTNA 1R74A 1SKMA 3QOXA 3TR6A 4RVFA 2ZTHA 1AV6A 1XVAA 2PWPA 3Q7EA 3PX3A 4FT2A 5DM0A 5FQNA 3T0IA 4A6EA 3M6XA 2JHPA 4B17A 5F2NA 3NMUF 4C03A 3EGVA 2HR1A 4PIPA 2I7CA 1EQAA 3GNLA 1JR4A 1Q0SA 2ORED 4HTFA 4KW7A 5F2OA 5H02A 5E9QA 5EMLA 2AR0A 4QDKA 3G2PA 3KR2A 3UJ7A 2P40A 3GRRA 4HG2A 3DULA 2VDUE 1EJ0A 3FUUA 4PYKA 1D2CA 3FUVA 3GJYA 3NDJA 5C0OE 3FRHA 3KR0A 4MHTA 2NP6A 3UFBA 1H1DA 1QAOA 2C7QA 1G8AA 3C3PA 5LQRA 2IBSA 2EG5A 2CWWA 2UYHA 1R18A 2AOTA 4E30A 1ZQ9A 2I62A 3KQPA 2G1PA 2V74B 3LCVB 2PT6A 5GWXA 3ID6C 2VZ9A 2IBTA 1R8XA 1XJ5A 1VBFA 3BWYA 3DXXA 3NWBA 1SVUA 3IYLW 4MTLA 5DTQA 3TKAA 1NV9A 5FQOA 1VLMA 2OPBA 4OA5A 5KQSA 1M6EX 1VE3A 3R9XB 4HTFB 3HA3A 1EIZA 2JG3A 4NECA 3CC8A 3HCBA 2C7RA 3M6UA 2FPOA 2OBFA 4CXMA 2VDVE 2B9EA 3EEOA 3DOUA 3AY0A 3I64A 4ER7A 1ZKDA 3EMBA 4OBWA 1DUSA 1NW5A 3SR4A 1NW6A 2FRXA 3KPVA 1B42A 4LWOA 3FUXA 4R05A 1UFKA 2ZBQA 5EQJB 4DQ0A 2P7IA 3UA3A 4QQKA 2IDKA 4CKEA 1L3IA 3EPPA 2IH5A 4XCXA 3LPMA 4IV8A 4HC4A 5BW5A 3E05A 5K0GA 3R6TA 3KQOA 4E2WA 1UWVA 3FRIA 5IKMA 1NT2A 3BWMA 2NXNA 2QE6A 5EKUA 2ZBRA 3F4KA 3EGEA 3PT9A 5DT2A 3KHKA 4GOOD 1FP1D 2P8JA 1OR8A 3OCJA 1L3BA 1WY7A 2OXTA 4PGHA 3G8BA 4HH4A 2PX5A 3UJ9A 3JWGA 1ZHFA 2IFTA 1JG4A 5CIYA 4FZVA 4M38A 3NJRA 3OU6A 3T7SA 3BXOA 4QDJA 4HGZA 4U7PB 5DRTA 5ICFA 2AN5A 1N7IA 2V7EA
chains in the Genus database with same CATH superfamily
5JFRA 1LF0A 4A0QA 4TLLB 4NC6A 2WB2A 3A01A 4KA4A 1R5HA 4RFVA 3WTVC 1NVKA 2LCIA 4TWZA 5BYAA 4B3SB 4H7DA 4MW9A 4KKVA 1IMJA 2GESA 1N9ZA 1ULZA 4MVXA 2QQAA 1E1DA 1W4ZA 2XCOA 2D5AA 2O8XA 2RJNA 2ZQYA 4RA9A 1EUYA 1U0NA 2NTYC 2VC2B 5HS9A 3C5HA 4FEYA 4DVGA 1UJ6A 1Z0FA 4WZBB 4D3YA 5GJCA 4DQXA 3LBYA 3VX4A 3DHEA 1EBUA 5FPSA 3IVGA 3LOPA 1WVGA 4QC2A 4KDPA 5EZSA 1UKCA 6Q21A 3S8EA 4IQFA 3V00A 1W1UA 3PGLA 1VI2A 2EDAA 4IDPA 2AYXA 1Z33A 4JQFA 1I3AA 3FISA 3O0DA 3NORA 4PGFA 3V9AA 3TUJC 4ARZA 5JNLA 1UXIA 5HJ2A 3EPKA 1F2DA 5E17F 4DR2B 1BWPA 2XI4A 1YHZA 3MRSA 2WJ4A 4E3WA 4S1TA 2YIMA 4HNAB 3KP1A 4LYEA 2PG3A 3CQ9A 1ENOA 2IH2A 2R7RA 1Q5PA 2ZRCA 1SXJC 3AUAA 3GDGA 3M6VA 3P27A 4MHSA 4U3JB 4YFYA 4BNKA 4BVFA 3VOBA 3SYNA 4H7IA 4MW6A 4D9JA 1L0BA 1F1BA 1PD0A 1TCUA 2DUWA 2YVQA 5DPMA 4D4MA 1A95A 2VQLA 1GPAA 1DC5A 2R4QA 2VT6A 3HGTA 2WM3A 4IPTA 1T9GS 4UBJA 1C3JA 4L5CA 4CCAA 2C6YA 1Q92A 3HB7A 4C7OA 1S9HA 3EVTA 4U0JA 3SXUB 3OLQA 1DTWB 1HT0A 1F1ZA 1JFFB 1JG1A 1XCLA 2DWOA 3STWA 5ALUA 3VAYA 3DAGA 4F3RA 1CHDA 3TSWA 3R9WA 3KP4A 3E27A 1SA0A 3SJZA 4D26A 2HVSA 4MQ6A 1JW9B 3ZWAA 4A27A 1E3JA 1PJCA 4HHEA 1DWUA 4HQ6A 3V8EA 2JTVA 2QZSA 3ED5A 2H17A 4WWHA 3ADOA 4ID9A 1DB3A 1E0EA 4NCXA 3E9YA 4TXLA 2Y1EA 5AIAA 1TQHA 3CINA 1HWYA 1QE0A 4I50F 4NYMQ 2PL3A 5AI0A 1E99A 2GN0A 1N0VC 1TJ4A 4Q7EA 3CKMA 1GA4A 2YMLA 2OO7A 3P2KA 4K86A 2VBXA 5H6RA 1A7UA 1U8EA 4QIWN 2IYYA 2VF5X 4XONA 3JSPA 2R44A 2XGOA 3DLCA 3RUPA 2HXOA 3SM9A 3WGYA 5K5EA 3CF2A 2JBHA 3MBIA 3OZEA 2OYRA 1AXRA 1VCIA 4DMUB 4B45A 1JGSA 1USGA 2XDWA 3GJQA 3PJFA 1UPXA 1E6LA 4FS3A 5JARA 4EPWA 3V8JA 2Z99A 4M3FA 1AK9A 1CT9A 4D2IA 5KQLA 3NBUA 2V58A 4J9VA 5IN4A 3GJTA 2CC2A 1RWOA 2VAVA 5EIXA 1TWCJ 4LA4A 2BZ1A 4X24A 3R0QA 5ECWA 3K1ZA 2NZ2A 4NC8A 4BVLA 3AM3A 4QDOA 2CJWB 3H1TA 3V8PA 2GF9A 5I4KA 2YDXA 4PZZA 4ZRMA 4AY3A 6ADHA 5A6SB 5FJ8J 3UV7A 2C5FA 3GLGB 4KQKA 5K5QA 4AKIA 5GPCA 4EKEA 1H0HA 1USIA 3U9SA 4RHUA 5CB4A 3I37X 2PQ0A 4BB6A 1B76A 3RWOA 3V4PB 3CJQB 2GQQA 1NQWA 4NKRA 4DABA 3CKKA 1ZD4A 2EIHA 5AFSA 5FBRB 4ZOLB 1Y8ZA 1QYWA 2PUFA 4KQ1A 2C8JA 3C7KA 3CLVA 5EJ4A 3DMGA 1S7EA 2P5LC 4LY0A 4GXOA 4WADA 1NOKA 4PQYA 1PJAA 5FWAA 1HDZA 4OLBA 3MWYW 2O4UX 1QRSA 1OH6A 1OKKA 2OR3A 3S8MA 3G1LA 1DMSA 4LHXA 4XZ3A 5EE1A 5BQOA 2QUIA 4BFUA 4D3FA 3U31A 4IHWA 1VMAA 2GBIA 1ULHA 3MTDA 3G9XA 2WMNB 3IOYA 4BKXA 4J0QA 5I9SA 4QATA 3RF6A 5J5CA 4YMHA 1PYOA 2H1HA 1VA4A 2A88A 4QX6A 1ZYUA 1ERDA 2QZ9A 4KX5A 3W9UA 3ZTTA 5B2ZA 3CQZJ 1PFYA 4KTVE 2OFXA 4LE0A 3MHTA 1JHOA 2IYPA 4V19K 5FEUA 1P9LA 3ZY2A 1BW9A 1Q0UA 1W25A 1N92A 1YV9A 2HS5A 1ZN2A 2P9FA 2ZZKA 2C0QA 1P61B 2RKBA 3NW9A 3SF8B 3BWDD 1MNMC 2P2SA 2QG9A 3AHGA 4YRTA 1OILA 5FNVA 1BRTA 2WG1A 3EA4A 4RLQA 2B2CA 2X15A 5DRYA 3O8OB 3N0WA 1Q3HA 1GKLA 2LIVA 3B7GA 3NC1C 1QZYA 3GTOJ 2CXQA 5HMLA 1WW2A 5JNUA 1WEKA 3O4RA 3L7BA 2GCOB 3PJDA 4R01A 3TVYA 4F1JA 5HE8A 2YJ6A 3L49A 4NXNB 2MSLA 1CB7A 1XP8A 1XGSA 1XMXA 4FD2A 1CNMA 521PA 4F45A 2OZEA 4KV7A 3SCZA 4DS3A 1GY8A 3DTVD 3S1NJ 4CYDA 4HBZA 1X3SA 8AT1A 5AIBA 4EM0B 3SFIA 1E7QA 4ZC3A 3ZDCA 2BM8A 2X14A 1ISRA 3O8CA 1LWNA 4YRBA 4M54A 1V4RA 2GBGA 2IW1A 2NO7A 4WBXC 5ULLA 5ADUS 3UJNA 1B9MA 5IP6A 1DZIA 4ITRC 3VRHA 2CFSA 3GCZA 1IM8A 4O6VA 3N2IA 3SFTA 1ADFA 1DRVA 4JH0A 5EZYF 4LDNA 4BPBA 4IKEA 2YZGA 3G1UA 1QP0A 5M34A 3TL6A 2XQJA 2OMKA 1D2HA 2MA3A 3D6AA 3R7WA 4AZ0B 5G3ZA 4QTTB 3RS9A 3E5UA 4ZVKA 1PL7A 2GD1O 1K0UA 1U94A 3R44A 1G59A 2I0FA 4N3BA 5C4JJ 3H86A 2XGEA 1DBWA 2FFHA 3EFBA 3K9BA 4N6OA 3ZGYA 4DSTA 2JLRA 4MV6A 4ZAZA 3E6MA 5EGOA 5DI9A 2JCYA 1PLLA 3NATA 2A5WA 4FOOA 2GCNA 1Z3XA 4M49A 1WEHA 2DA3A 3AR6A 1K6IA 3FYCA 2QBYB 1YX3A 4UUTA 3AUXA 5FBZA 1KZ9A 2HTJA 3OCCA 2PUVA 4HWPA 2QUAA 3T52A 4F3YA 4YJHA 4W7HA 4YMTA 3TI9A 3THRA 3VTAA 3ROXA 1N5LA 5BN3A 3AR8A 5A6VA 1QIEA 3L1PA 2LRDA 5K1YA 2WHQA 4L7VA 2O8BA 1D3YA 2OUKA 1D0ZA 2SKDA 4D7AA 1QGYA 4O5AA 5CD9A 1STOA 4A1FA 4KFUA 4LOJA 2Z0MA 4DZRA 1UFQA 4UZEA 5B1SA 3SYRA 3CSSA 3HL4A 3GEPA 4P6VF 4WLFA 4A0HA 4UBOA 4ZIRB 3AEKA 2O2XA 4WKOA 4ZH4F 3JW4A 3O3OB 5GP1A 1A35A 1PGJA 2VQFB 4RGQA 4KQGA 2G09A 3DQQA 1KK1A 1V1JA 2J6BA 2ZKIA 3ETGA 3D43A 3FN4A 3BWCA 3QHPA 1P6XA 5IOZA 1U3DA 2C8KA 2AO9A 2IUYA 3QU5A 3K1MA 2OD7A 3EPRA 2X48A 2CYAA 2QMEA 2ZYWX 4IDAA 5TMPA 3HEMA 1JB1A 5JT1A 4ZKEA 2ECFA 1DKMA 5CHEA 3WSVA 5LOVB 1FXWA 1YKSA 4ZVMA 4BX9A 2CNWD 1PSWA 1S3IA 6ABPA 5K6RA 1JWLA 3ZW9A 1TI7A 1YK0A 2O8DA 4AYBA 1ZNZA 1V11A 2ZT5A 4G63A 2I2WA 3BG7A 2XOXA 4TXJA 3F7OA 4ZVVA 3R7BA 2POCA 2Y68A 2BFFB 1XRJA 1L7XA 1QQTA 1KDYA 1DI0A 1O87A 5C18A 2OCEA 1ZH0A 4RZ2A 1AE1A 1KS9A 1OWPA 3IJ5A 3KG2A 2DQKA 3DLTA 1S2DA 1F6DA 4DCPA 1U9ZA 3EDRA 1ES9A 2AFIE 4QFDA 4ZTZB 2VHCA 1GILA 1GSHA 4JX8A 4MB2A 5GAGJ 4X1IA 1GYRA 3OC0A 3Q0WA 4O29A 4YRNA 5J4YA 5DGCA 2FJPA 4J7CA 3T94A 4WXHA 1TJPB 4UXIA 3DDWA 2GOMA 3ESYA 3WIUA 2JFHA 4G24A 3R9KA 3OYJA 3PNTA 3PGMA 1L1QA 2H5IA 2WM8A 5L7WA 1LFUP 4NC7A 2W1OA 1Y9JA 3QMWA 2BV3A 4IW3B 1HT2E 3DEJA 2ZB3A 4UM7A 5ANRB 4FX2A 1TK3A 1YYVA 5BQTA 2BFDA 2PX8A 1WB9A 4BZZA 4ZZ0A 3C6QA 3FHOA 4I19A 4F8EA 4ARZB 3HA5A 1NN5A 2FZLA 3BGIA 3NP9A 2K3FA 3OIQA 1M1ZA 4W1PA 3SYTA 1TTTA 3GCXA 3LNCA 4FFWA 4FJ2A 4K9SA 3I9KA 2AJDA 2OZVA 3KSAC 4C6TA 3QPLA 3CUYA 2ZFUA 3IJEB 2ZWIA 3AILA 1WB6A 3C45A 3LP6A 4TV8B 4CCLA 1G3QA 5C31A 4DMMA 3IHWA 2FBKA 3NOVA 4QEDA 4TGLA 1G41A 2AC7A 4A5NA 4YPFA 1FBUA 3UR3C 1I4DD 1M66A 4HATA 3K30A 3QQPA 4QTUB 3K9TA 4XWTA 4R7GA 2DMTA 4DJEC 4EZEA 6GPBA 4CW7A 1SXJB 2JFQA 2YRFA 2HA6A 2R47A 2EFQA 3I6ZA 4QOEA 3TQHA 2VBWA 1AD2A 1MMDA 3FGNA 4Y0VA 1GV5A 2I33A 3TLEA 1GGJA 1Y5IA 3GGPA 3T34A 2FNPA 1EDBA 1F6WA 2CJXA 2ZOSA 3TO7A 4V02A 4EHFA 2JI6A 2XE4A 5TS2A 2XASA 2JIQA 2O20A 3M89A 3GO4A 5A4JA 2AXQA 3F6YA 4O2BF 4AG3A 2R1TA 4C4RA 1D09A 4Q19A 2ERXA 4QRDA 5J2UF 2PX0A 4ZHSA 2KZGA 4HNVA 2BONA 3GMSA 1MQSA 2BGGA 3I4LA 3K6RA 2OJED 3I59A 3D6HA 2BM0A 2V4ZA 3DMDA 1WO8A 3TO6A 3JRHA 2BKLA 4TLDA 3DFZA 3GD5A 3FIWA 1MFPA 2VIIA 4J0DA 1XT6A 3QYPA 3FPSA 3H04A 1Z6ZA 3EZ2A 2LKCA 2UVDA 3HGQA 2Y75A 3HP1A 2XB2A 4RV9A 5JUWA 1WJCA 2FN8A 2LKDA 3X44A 1KYQA 1E1CB 3H2ZA 2QSHX 3M3YJ 5EIAA 3RT9A 4LHSA 5K7SA 2OEPA 2RHHA 1Y80A 1EG2A 3B9RA 3PRJA 2QM8A 4BNWA 5KPDA 2V3CC 3AZPA 1PG0A 4KU4A 2A6TA 1U0LA 1M6WA 4CMKA 1QM5A 1LBEA 4HLNA 2XEDA 3DT6A 3F6BX 1LI4A 3M4OJ 1J22A 2C4KA 1DO2A 1GNRA 2VATA 3EVZA 1NF8A 2EX0A 3EVBA 1I4TD 1EEHA 2NYRA 1XDUA 1D2MA 2ZSJA 3OJLA 4LYJA 2B69A 2EOAA 5ERXA 3BZBA 1PS9A 2BEWA 2EZTA 2VTKA 1PQUA 4HZGA 5JJKA 1FE8A 2FTKE 4V0KA 5KNDA 1S2MA 4K88A 2D5LA 2LD4A 2WLTA 4KLZA 4OQ4A 2ZSFA 2EGUA 4DZJA 1C7EA 1GZDA 2O5VA 2XNHA 4J0GA 4TXNA 4UU1A 1PBNA 1AZSC 1N2BA 2AN3A 4FGZA 1YGYA 2NO4A 1OI3A 4HGNA 1XN4A 3D59A 2BFPA 4D80A 1E4EA 4OXKA 1R0ZA 5LA6A 3GFVA 4B46A 3C3EA 2NSYA 4UOEA 2ZULA 2PLYA 3T4XA 4JR1A 2VTDA 4AJPA 5E6SB 3EZ6A 1EFKA 5EHIA 2HI3A 3EF1A 5AJVB 5KYWB 2FE3A 2Z33A 3PK0A 3PNKA 4BLSA 3BR3A 1FNCA 1PN3A 2IHBA 1H89C 1CY8A 3IMFA 1GYPA 3QWFA 1NBIA 4KL8S 3CCMI 1K6OA 1JGGA 4XJTA 5SZHB 4EG8A 4DF3A 2UUBB 1Q6YA 5D00A 1UL1X 3KJNA 2J5OA 3BG3A 2BKVA 3CC2I 1OR7A 3GA0A 1OAKA 3L05A 3LC2O 5LRRA 4IOKA 2UZ1A 1ODKA 4F12A 5JFTA 1RYHA 5D6EA 2BHLA 4YMIA 4MIMA 1ILWA 1H3NA 1O95D 3FCYA 3MERA 4HPXB 3IO3A 5LP6F 4DV5B 4G6DA 2Y9ZA 1CJCA 5FQNA 2JBAA 4OLJA 1ZCBA 3VR4D 3JWEA 3L8MA 5G41A 3ZWPA 4PIPA 4X6LA 3WLSA 4BFWA 3RASA 2ZYDA 5AM2A 2ORED 2RGEA 4XWOA 4HTFA 3UMYA 3EETA 4IEJA 4LF4B 4PZ9A 2XNKA 5K3FA 3WK4A 4QBFA 1HT1E 2AR0A 1S8NA 3RRBA 4US1R 1U3UA 2JJ1D 3F6PA 1T56A 2IXSA 2WT4A 2NP6A 2XOKD 5D8KB 1AS2A 1J00A 3ETEA 5CA0B 1NIJA 1LTQA 4W5RA 1GM5A 3E81A 4RVNA 4WGFA 5AMXA 3OV8A 2PZMA 3CR8A 2VXOA 2FEOA 3WHPA 4ZV4A 3HLKA 1YTUA 4M3BA 5DZSA 3G6WA 1NLZA 1KMIY 1MIHA 4CG0A 1N0UA 1ZHOA 2VJMA 4BKQA 3S2FA 1ZOLA 2X41A 1N34B 4XDHA 2XUAA 4ASNA 2H9AA 2H6EA 3E22B 4M4SA 2QKYA 4MTLA 4UDOA 1G8YA 3HU2A 4HX5A 1AK1A 3B3QA 4N5HX 2WUDA 4WW0A 1SR8A 4X97A 3RYTC 4CM1A 3AY3A 2ALJA 4M6WB 4OX9B 5AJYA 4GP6A 1FFXA 5EJ2A 1N6PA 4XFKA 4LK1F 3NHBA 1CZKA 2R87A 3L06A 1SD4A 5D3ZA 1D1QA 1NX9A 1Y1QA 2XAFA 5CVRA 2J30A 2YNMC 5CA0A 4C0SA 1W30A 2NLOA 4C01A 2QMZA 1VKZA 4GVXA 3CJNA 5DEQA 1OCEA 4MKZA 1Z5PA 2R1UA 3LMKA 2QZ4A 3MGBA 4O2LA 1TC3C 1EFUA 4X1KB 1YBMA 1CVIA 5BWMA 1OB2A 3KZZA 821PA 1IQRA 2LH9A 2FN9A 4IWXA 4YAKA 5FLEX 2ID4A 5B30A 2W2MA 3NR2A 4UTZA 5CLFA 5IG2A 3Q0IA 1NP6A 5BUZA 2NU8A 5A71A 5EWLA 3G17A 4NQWB 2NVUA 4LDJA 4KO3S 3D6VA 2IXBA 3F5SA 3IOCA 2CDCA 4E4YA 3RV4A 1JR3E 5EKUA 2M4GA 1E4OA 1FP6A 1G7RA 3CSUA 3SI7A 3H2SA 3VBEA 4UEKA 1JALA 3OCJA 4P55A 3QE2A 5HJ5A 4EJFA 1L7OA 3HNPA 2Q4TA 4GHWA 1ORTA 3GEGA 4X6XA 4D3ZA 1A9XB 3C1TA 2WU3A 3DTKA 3AEUA 4NMMA 4N0DA 2WBLC 3QLTA 1NDHA 1QB8A 3ZQQA 3GARA 2MW8A 3N2KB 3D1VA 4YRFA 2NVYJ 3AVTA 2E21A 3O2SB 3JQFC 4FFNA 4IFBA 3TLCA 2H2FA 1N9GB 1FQWA 3COSA 3FCEA 3NOXA 5AH0A 2X0FA 1Q12A 1EHIA 3R7NA 3RU3A 1HLDA 4MVJH 2B63J 4C78A 2O7NA 4R9SA 2FSGA 3M6LA 4WNCA 1KJJA 2ZCUA 4WOJA 1ISIA 1G3IA 3LQ4A 3QZUA 1FMJA 3ORQA 4FFLA 5E38A 2RH4A 4DOZA 3E2PA 1H1LA 2ASEA 1FOEB 5IAJA 4M1MA 3WK7A 1VHDA 4DMGA 1Y4UA 2OGWA 5A2QA 3HE3A 4EQQA 2NVTJ 1HYQA 3EVGA 4JCCA 4FS8A 3ZQIA 4I4TA 1EQUA 4EVRA 5DXJA 3I01M 3S1AA 3G71I 1VQ7I 2QSGX 1SBNE 2AG0A 2GXQA 1JEQA 2H06A 3BDVA 5CX4A 4CWAA 4YAGA 5B12A 1MUUA 3KUUA 1Z07A 2A69F 4U39A 4ARIA 2HPVA 1IQUA 1LZKA 1RADA 4MUBA 1M72A 3GLTA 4TM8A 3U6BA 4KH0A 4QG7A 3RUEA 1KH3A 5GTDA 2BDUA 5DP1A 1R5NA 2Z6VA 3OYNA 4JJFA 4CEIA 1YS2X 2BFBB 1V5FA 2Y1DA 1QHYA 3C5WP 3JV7A 3BBPA 3KJXA 1T95A 1C8LA 3PKIA 4OAQA 5DCMB 2P0EA 4RSMA 5AHXA 2PL5A 3SR0A 2FOWA 3GVPA 2NMVA 3W2HA 2X1EA 2FA5A 3FWNA 4C5CA 3HDVA 3AO0B 3R3SA 4EQ6A 4P7GA 4XSVA 4BB5A 4EECA 1JT9A 2BCJQ 3REQA 2EA2A 2NW6A 2Y1FA 5FFMA 5DCYA 2DC1A 2M32A 5DVZA 1UBRS 1YQWA 4ZQBA 3TJZA 4OLAA 4QVKA 1VHJA 1XUOA 3LDUA 4ZJYA 2PU7A 4ADSG 3GFLA 1TXGA 2A5FA 3ZQFA 1ZJWA 1OH5A 3LSJA 1WZEA 4XM0A 2HF2A 3DKPA 3DFKA 2XQGA 1KBOA 1BE6A 3FYUA 4ZGGA 2CUEA 1KEWA 1RHQA 3HSRA 2JFNA 1EZZA 4OTZA 4RSRA 3R7SA 2G8LA 3B82A 2IIPA 4WDQA 5LZ4A 3EDMA 1C0KA 3NC0C 5BPFA 1DBPA 1PNVA 2C54A 2WU8A 4YJGA 1C4KA 1RYEA 2BHTA 3L4SO 3QV1A 4LNHA 4NL4H 1B3RA 2W2LA 1P4WA 4MLCA 3BSFA 4P4SA 4RKFA 4QYIB 1D03A 3I34X 4Y4RA 3X3HA 4B79A 5FPHA 4JWKA 1VIYA 4AZ0A 1FWZA 2NS8A 1XL0A 5ICGA 3DLLF 3S15J 1LGYA 1ZRMA 2IYUA 1RKWA 2F2TA 3KTAA 4TXHA 5E3IA 5GADJ 5COAA 2VI5A 3OECA 3H3ZA 1M2GA 1ZX1A 3RYCB 4X84A 2CXPA 3AV0B 2HRRA 4D8TA 1P4XA 4D6XA 1V8DA 1QNTA 1R0CA 3O82A 2JANA 2JDID 5K6AA 2NIPA 2DKNA 2PKXA 3OPYA 2DI3A 1Z2AA 1PL8A 3RS8A 4A03A 2NOGA 1JDUA 3O8DA 2Q5QA 2X5KO 4J4HA 2D3WA 4L4YA 3NB0A 1K7XB 2ECKA 1U28A 3B6IA 2FWPA 1MVNA 5L3DA 1RJ9B 2I3GA 2R751 3BOSA 4K3VA 4ZO4A 3EPZA 1RCUA 4Q4JA 3HXOA 3OFSA 4NARA 3L4JA 4ND6A 4HYEA 1KU9A 4KPUB 5ARDA 1CVLA 3WHBA 4R2IA 3WLKX 1EP3B 1V71A 4CCSA 4CLHA 4HLXA 1FDSA 2QRVA 1KORA 3FCUB 3S99A 1IB0A 1YDEA 3O26A 3IC7A 4C9YA 3QKSA 2RDPA 4QPDA 4R1MA 1C3OB 3ROTA 4KAAA 1BDIA 1KI7A 1PQYA 1QONA 1S01A 3EN0A 3PLNA 4AAYA 4DXHA 5JAMA 1PR2A 4WJLA 3GI1A 3A6ZA 3LYLA 5AHRA 4IHJF 3S7ZA 2R6JA 3F5QA 4K6CA 1MH3A 2HOSA 4DCUA 2AXEA 1YAJA 2D1TA 4PRKA 3LBIA 4EABA 3IAS2 1YJ9I 4GX1A 3A2KA 4GDFA 3HB9A 2WAXA 4F84A 3MK31 4GYWA 1DRWA 2H3EA 5DNWA 4ARUA 4CV2A 1JLHA 1CJTC 4UVEA 3S5UA 2NOAA 4FR0A 4ZDOA 3LE8A 2Z2KA 4ERXA 2VHJA 4IDGA 2LNBA 1J2XA 1I32A 1WXWA 2C2HA 2OB2A 1HKSA 2RAVA 1NHGA 1X86B 2WSBA 2ZLBA 4XICA 4MAFA 4OGWA 2QTHA 3JCUC 4XB6B 5C81A 5LMUB 5FWXB 3LHIA 2JVKA 2R7XA 3WKAA 1LUJB 3GLHE 3HOVJ 1S6YA 1VP3A 3LA6A 3CWZA 2KMUA 4ZQCB 5AVTA 5IPAA 4RTJA 1I6HJ 4BN4A 1VCMA 3TUZC 1H6DA 1XZCA 2PJRB 4JMPA 3WHLA 2IHNA 1G21A 1G1AA 4CMAA 3PR3A 5KNDH 4YWJA 2HA5A 2TCTA 4YFXF 1KR2A 1J0XO 3K16A 5H3HA 4FUQA 1G60A 1P0QA 1YZ3A 2KLBA 2QT9A 2RHOA 2XTMA 3HY6A 3OOYA 4N18A 4PBTA 2ZS7A 4B40A 2BF7A 2IX3A 5EXSA 4TMKA 3MAGA 1MKYA 2FETA 2G04A 2VQ3A 1GTZA 3JWJA 4M6YA 2H5LA 3WO1A 1WJFA 3BTUA 3O9ZA 3I9OA 1GCOA 3KELA 3EGIA 2E35A 3AHCA 5FFXA 3PUKA 4LBWA 1ZNXA 1ZU5A 3RVQA 4IPAA 4CICA 1H9AA 2V8BA 3IRVA 4G5RA 4RX1A 5JS7A 3MWDB 3RQIA 2F1RA 1J8YF 3NHRA 1MRZA 3IAM6 2QMUA 4F9EA 2CUJA 1LU9A 2R7DA 2IOHA 2ZIGA 3FMGA 4IIJF 3PPYA 4UE3S 3CLQA 5BPDA 4LRYA 3SSNA 4J8PA 1ZN7A 1CFZA 2BVLA 1LVUA 2GETA 1JKPC 2EHJA 3EGXA 2MYPA 5E4FA 4D82A 3KZMA 1A8IA 1O7FA 1P4AA 3PUIA 2XRYA 4GOJA 2HEOA 5EERA 1CE8B 3RIYA 2O7OA 5U9CA 4RL6A 3LWZA 5L3BA 1XGMA 1AV7A 3ZWNA 3SE0A 4M3GA 4XKCA 2MSEB 2V1UA 4M1OA 3JASA 2L2QA 1MTOA 2JCVA 4UCQA 3R8FA 2BSQA 3B1JA 5EXTA 2XF2A 3EA0A 1ACLA 3EXFA 3QX8A 3CESA 4FZ3A 4S1OA 5BPIA 1E7RA 2A7QA 3I0TA 3A8TA 1AKRA 4PZYA 4XGNA 2FFRA 4JITA 2H09A 1WZUA 4JLNA 4WVLA 2PX6A 3ZVNA 1SUBA 2V9KA 4MWZA 1ZUWA 1E3EA 1MHPA 1QR6A 1U6GA 2Y2ZA 2WT9A 4G7OF 3WLPA 2PKQP 3CRQA 5L4LA 4DXAA 1OU0A 5IVKA 1KFEB 4L5YA 4HDOB 3R41A 2J5XA 2NT4A 4OJNA 1Y3AA 3SG0A 4G5SA 3FPJA 1F4LA 1JKXA 3BXZA 2Q3BA 4JFAA 4RTRA 1FMLA 1SIUA 2HXGA 4FWIB 1TCBA 3ONWA 3N53A 4EKNB 5HTOA 5J8CA 2FLVA 2WB1N 2AOTB 1E5LA 2XCSB 3CC4I 3NYIA 5TXGA 2IZZA 3DMRA 4F9TA 2HJVA 1PBTA 5IT4A 1JJ8C 4L18B 3O8NA 4Q02A 4C5BA 1ZA2A 1ZRFA 3K9NA 3ZE8A 1NVGA 2JGDA 3FVRA 4G09A 2O3SA 1G8SA 3NBFA 4LYYA 2FI1A 1YJCA 1UIMA 2H59A 3I04A 3M0EA 3RTEA 2MJLA 4OXQA 4YXWA 3T9CA 3V9PA 3PJGA 5ALIA 4LXYA 1J49A 2NADA 3P2IA 2X42A 1VLVA 2JB9A 2P11A 4QUKA 4OI1A 2FUG6 3S8PA 2ET6A 3AY6A 3SGLA 3BFXA 4E5SA 2V4MA 2L7FP 3I28A 1NYTA 3O2JA 3GBGA 4G8XA 3R7LA 3ABKH 1VQ5I 1E6WA 3JVDA 3PGKA 4NZOA 1LDJA 2GEJA 2JA2A 4MIKA 1BD3A 1AKNA 4Z0PA 3BWGA 5IYZF 1L5LA 3TIIA 5EPOA 4DN6A 5KQPA 2H07A 3JWPA 2AJTA 4IVNA 2J08A 3IP9A 1T98A 3SP1A 1PR9A 2CUKA 5AJWA 4FNMA 4NYIQ 5ALZA 4JUCA 5DO9A 4EA8A 3IOBA 1PKEA 3HU5A 3MG9A 1P18A 5IDYA 3SQLA 4CIXA 4DT1B 4MAMA 4N12A 5EZYA 1ZICA 2JFWA 4XLPF 1AMOA 2AC4A 4Y1RA 1ZG3A 1C1HA 1XU4A 4UE2A 3RG2A 1WI9A 2ZJ0A 2R6HA 3MGCA 5BPHA 3ZXSA 1VJCA 1WXQA 2IC5A 1G55A 4V1CI 4QL3A 3SWWA 2AX3A 4JOMA 4RD4A 3JQ7B 1B1BA 2HT6A 3WC4A 3HZHA 2JJ1A 3IBFA 4BBRJ 1X9HA 2G76A 3LPAA 4B85A 5DSTA 4QYTA 4MIYA 1SXJE 2CLKB 2QRLA 3WKBA 1NRJB 1V5EA 3E2MA 3JQRA 4MHGA 2L4AA 1L5HB 3CX7A 3LH5A 1HE5A 5K2MA 4J1QA 1IUFA 1Y5RA 1A9TA 4MUHA 4M72A 1I01A 1TVCA 2CMGA 1KFCB 1G64A 2AVNA 3HVIA 2JT1A 3G9ZA 3RTCA 1MCZA 3ZJYA 1JG7A 1MD0A 3E6AA 1F0KA 2D45A 4AM3A 3A6JA 2QGNA 3JZDA 3OZ7A 4OPMA 1W0TA 2BMWA 2EV9A 4AZSA 4I0BA 3OLCX 1E1NA 1IEWA 2ZUCA 3S14J 4FOTA 2I2DA 4M8SA 2ICWG 3QF4B 2J9RA 2FY8A 2Q5FA 2IRFG 5KNLA 4N0BA 1SCKA 3INTA 1UDXA 1UXJA 1WV0A 2YV1A 3L8DA 5F12A 3UENA 4D46A 2O0LA 3B1WA 2X23A 1Q3KA 1DP7P 2I54A 3N76A 5E18F 5HFNA 1Z2NX 2EQ5A 2O3TA 1RMTA 1GJRA 2VQDA 4MR9B 4ZRNA 3V3KA 3DEKA 1O6GA 2FLWA 4KDRA 2WKRA 3ECAA 4AX8A 1N32B 2C96A 2QSJA 2PVSA 3DBVO 4XLAA 3NI2A 3Q2IA 1E17A 1GPUA 2H2DA 4PHCA 1BM9A 3DEIA 3A3NA 3PSAA 4BLTA 2VBYA 2HMSA 3CM0A 3MS4A 3RROA 1TMGE 2B8TA 3CUSA 3QKRA 4KJZA 3RU2A 4P3YA 5DM1A 5TEVA 4M46A 3ICEA 3L8FA 4XGKA 1BAPA 2YW2A 4Z6KA 1IONA 5CQGA 1EVQA 1FLAA 2PS1A 3AYZB 3FJOA 3IAM1 4V39A 3T1YB 4G9GA 4WXPA 5H83A 5U4XA 5JZSA 3H1AA 4XARA 5FR1A 4RD1A 2FH5B 1LJ8A 4WLEA 1MNQA 4XGQA 1ODLA 1ZJZA 3VHRA 5EE0A 3COWA 2MD5A 1Q1VA 1I7PA 4PZPA 5ENZA 2IUUA 1IDYA 4ARAA 5JATA 1I5OA 5JSZB 2XB6A 3CX6A 3ZVMA 3IP5A 4YRKA 1PQPA 3F3KA 1EXWA 2P81A 2BM1A 2H4YA 1E2IA 4JQOA 3S2ZA 3TPFA 4CG1A 1TWGJ 2Y0SN 2HWVA 1H8HD 1VJ1A 4P3NA 4RE6A 4D97A 3PXEA 4RZQA 1IO2A 1APLC 3VPCA 3M4NA 2WUFA 2JFYA 3RS0A 1ULUA 2OFFA 2YXEA 1Y98A 2QY6A 2EX4A 3B73A 2Z04A 2EJCA 2YY6A 4LV5B 1ESNA 1THZA 3ZBQA 1XG1A 3FYUB 3UMRA 3K70B 5DCLA 4NZPA 4BXXJ 1U65A 1IV8A 2B35A 1YITI 3CD6I 3BCRA 3MFYA 5JCOA 2AC2A 2BI4A 5JNTA 4RZSA 5GONB 4NFSA 3NTQA 4C6HA 3DBHB 1K79A 2Q3EA 2ZT8A 3AJ9A 4RACA 4XVQA 5TSDA 4B4KA 4CTOA 4EPYA 1KTIA 1RRPA 4QPZA 1U11A 1B74A 4CMHA 5IAGA 4RY9A 2M6RA 2DMQA 1KY3A 2J3QA 4Q4AB 1YQEA 1MDMB 2IEKA 2PCJA 2PZ8A 3O03A 1GXSB 3G2HA 4WIAA 4A2PA 3SZ3A 3U4DA 4KQXA 4JNCA 4L4XA 4D43A 2ONCA 2WQ7A 1HE4A 3OM1A 4GOKA 3O8GA 4WA8A 4WESA 5KDOA 3KTOA 3T12A 5H20A 2RC4A 1FQKA 2P5VA 3BEOA 4JD5A 1I3QJ 4AYXA 2O2IA 2PA0A 4EJ2A 4J1SA 1FUEA 3E18A 1OC2A 4PCLA 4Q4DA 3VISA 2SCUA 5CAEB 4EW2A 5AM3A 4BAUA 1DG9A 1LTHR 4JN6B 4HEA2 2JGAA 2O9LA 1W4AA 2WKSA 2ZSEA 3G7UA 3ZBTA 1DIOB 1K75A 2CF6A 3LY8A 5I7FA 3RS2A 1U3VA 2YHIA 3V3TA 3DCJA 1B4AA 1MABB 1U0BB 1WD5A 3IUSA 2VEDA 4E5MA 1R7JA 3TN7A 2DETA 3Q7QA 3TW8A 4YLGA 1C4OA 2GIZA 1WAMA 3DV8A 3UAYA 1BH2A 4RVFA 3M07A 1Z1DA 2HF9A 3AU8A 4UVDA 5JD3A 3BPXA 3VAAA 3PVZA 5LKAA 4B17A 1DV2A 2BFFA 2VLBA 4AN0A 3CVYA 2KRFA 3BIFA 1ESEA 2FUNB 3FOWA 4MR7A 2I3DA 4PZDA 3WI7A 1QKJA 3J80A 1B8IA 1K3TA 1KZGB 1M0WA 1ZMXA 2W5UA 3X2SA 2F3SA 4S12A 4DC9A 4WN3A 6PFKA 4LHEA 4RH1A 4S3MA 5CB4F 2P40A 4I4IA 5A4MS 5H7XA 3DOJA 3RC2A 2NUAA 2VDUE 5A04A 1H1TA 5JROA 3PXXA 1FFSA 2NPFA 1ESCA 3QODA 1T9KA 3ZCRA 3Q6MA 4IRIA 4D0SA 3A4CA 4DZTA 3TF5A 3D54D 2AZXA 3UTDA 4BU1A 2AQHA 3F23A 2VDNB 1E6KA 1T1EA 3KQPA 2QV0A 5J2UB 2JFBA 1X80B 2V74B 3GLVA 2AHRA 4LDPA 4ABYA 4GX2A 3MLAA 3IURA 3MXTA 2IBTA 1UK6A 4R5MA 5JI3E 1AA6A 2CZCA 3LLUA 1KO1A 3LX8A 5EFOA 3CCRI 4PJNA 5M29A 3R9XB 3WR5A 3TOBA 3O9VA 2ZYAA 3MM4A 1VSUA 4KQFA 2F17A 3OZIA 4IQJA 5H16A 4EB6B 2QRQA 3V7CA 2C0CA 1R0SA 1O4VA 2FPOA 2CNOA 4UHBA 2W4SA 2ME6A 4WFJA 4BCBA 2IEIA 4KICA 1EAYA 1KZYC 2WJYA 4GT1A 4AJJA 4U00A 4E6PA 2A9PA 3QUQA 4K0RA 5BR8B 2FRXA 2CNWA 2JLYA 3A36A 1L4BA 4W1SA 2FWMX 2KJQA 1JA0A 4IIFA 4YYZA 2PSJA 1IHYA 2IGKA 2QZ8A 3FW1A 1PVDA 2NZVG 4TT8A 3WIVA 4GEGA 3TTXA 1EM6A 1MSFC 2QR5A 4PPYA 3WL5A 2PZFA 3W34A 2DPXA 3E22A 4QT0A 1A5AB 5JO0A 1JAYA 4F04A 4PSXA 2ZDGA 3DDZX 3K9QO 3TLGA 3PQJA 3B13B 4NK5A 4RS4A 1SQ5A 4TV7A 1RPJA 1IVNA 1M9NA 1ZUNB 4HY3A 1EJ2A 3O8QB 2OAEA 2VPPA 3DC2A 5JJLA 4Q4HA 3SNHA 3ZHVA 1VJRA 5DHUA 3GF2A 4FDAA 4KI0A 3SOPA 3CZ9A 5L3QA 1GXQA 1UT5A 3ZCUA 1AGYA 1NMZA 3VO1A 5A5FA 2AX4A 3GBSA 3F9KA 1SFKA 4H7FA 3VR5H 1ON2A 4M3DA 2AN5A 3TB4A 3GUYA 3A1WA 2I1QA 2ACKA 3CBQA 3IA7A 1GUDA 3RFXA 4Q66C 3I4PA 1QFSA 3D5TA 4LQCA 3HLYA 1L2TA 1DBVO 2XV4S 2VBGA 1FJXA 1SBTA 1NW3A 2LK2A 4DJDC 2IW5A 5F23A 2HQ1A 1EIWA 1UKZA 1GCAA 2K4MA 1Y6ZA 2NSJA 3ZZMA 3R4VA 1IYZA 4O8CA 4BKOA 4YMLA 4LN1A 3ULQB 4G07A 1W87A 1KQ3A 3S2IA 4JJIA 5CDFE 3F6CA 1X77A 2SHKA 1UFVA 2ZBVA 1U2GC 1I2AA 3PF8A 4D4IA 5IZCC 1KOJA 2FQQA 2YV5A 2DBRA 1XZGA 2DLNA 2I99A 2LVSA 4TVBA 4F91B 2O07A 4DCOA 4C2MJ 4FHCA 5I47A 1H5QA 1QPIA 4CEHB 5C4IA 4QWWA 3OESA 4X71A 2FPIA 3DF9A 4ZQGA 3E0JB 1W581 5B6PA 1RLUA 4ZDPA 1U6KA 3ORSA 5ALRA 4RFLA 1R50A 3V32A 5HKKD 2ATEA 2ZI3A 4O63O 2FG6C 2NQTA 3ESRA 4UEWA 1X3UA 4F5WA 4ZGWA 1DV1A 2Q1SA 3QU6A 3C8ZA 2ZSAA 4MEJA 2AZ4A 4U8HA 3QFSA 4W8HA 3TKLA 3T5PA 2WYIA 2Q8PA 1RXWA 3UKGA 2EGGA 1AHDP 2HWYA 2ZAGA 3TH5A 4X20A 1I7QB 4COOA 2DHDA 2XSDC 1UBLS 4E1BA 3RDPA 4XRGA 3LDGA 2L9NA 5E9JA 3GFQA 1J8DA 3GRPA 4L95C 1YB6A 1OR7C 2GEDA 5AUQA 3U9LA 3G82C 3L6DA 2HRQA 3PC3A 4OP3A 1K83J 2NN3C 1XRLA 1C0IA 2CCGA 5T64A 3W2FA 3U9GA 1TJNA 4Y7NJ 1TT5A 4YRJA 3WWEA 4KP7A 1ZG1A 4FYJA 1LSOA 5FA6A 4E88A 3KJFA 1ZW6A 4IGEA 5C8YB 3FTFA 3GCGA 1BQEA 3LXUX 2AE1A 4WAUA 3V6MA 3EPHA 4IDCA 1X94A 1L5HA 3HCAA 2XVMA 4LS3A 4M0EA 1TPZA 1NC1A 3IAS1 3EUWA 1XF9A 4KN5A 3ZGZA 4JGGA 4XIIA 2HDHA 3Q1KA 2XAHA 4IQ0A 4JIGA 2JA1A 3WSWA 2OYSA 1OREA 3MJHA 4QWMA 3HOYJ 1V7CA 1WDMA 2HMAA 1IHOA 2R6ZA 3DNFA 3FUTA 1O94C 3A4IA 2WHYA 3KPYA 3LSHA 2XB9A 3QIVA 5K3AA 3PC6A 4L0DA 3UW1A 4DCJA 1QFZA 1HDPA 2OVFA 3CPEA 1ZJYA 3AMVA 2QRZA 4J7AA 3V1LA 2XSZA 3NLLA 4JR2A 1CZHA 1LKZA 2VPQA 4BDSA 3C7CB 4PJ0C 5K8LA 1NUTA 2A94A 4CTJA 2KZVA 4H27A 1KZ6A 2OG2A 2STWA 3T15A 5CBPA 1K1EA 4QQRA 2CL5A 4BDTA 4N7MA 1RNLA 3H4MA 3H5IA 4G67A 4H7EA 1OZHA 1HDDC 1R4ZA 4QBIA 3TL4X 1ZREA 1P4RA 5JBQA 3FGPA 1FQJA 1G8PA 4O3FA 4URYR 5FOSA 4NONA 3F90A 3Q3VA 4MKIA 1Y1LA 3CMEI 4HWSA 3KUXA 1G0OA 3N2GB 5BSEA 2E3JA 1EBBA 5EF6A 3QI2A 4Z9XA 2DTZA 5B3AA 4ALJA 4CE6A 5K9ZA 2IT1A 4BAZA 5L6LB 4HWGA 1NXQA 5HDBB 2E19A 4R1LA 4BC0A 4C6TB 5B64A 3RTAA 3K8OE 1SBIA 3ETLA 2PFGA 3C2HA 1P9NA 2Y2UA 4OLHA 3QBJA 5AT1A 5DIZA 5SYMA 3WA6A 4LXQA 2HA4A 1VPLA 2LPMA 1XZMA 3S44A 4RNCA 1RFLA 3UG6A 4B6PA 4C08A 4EI8A 2L69A 3COPA 3E2IA 4K05A 4Y2JA 3K70D 1FPMA 3BMXA 3EVAA 2KLOA 2LIPA 4HB4A 4XWGA 1CRQA 3PKZA 2BC9A 4OKNA 2FW9A 2JFFA 5E9WA 3NWPA 1I10A 1F0NA 4P32A 2OXIA 2D4HA 1PT5A 2H8GA 4N1AA 5G0UA 3ELBA 5K3BA 3C24A 3GY0A 3KTAB 2NQ8A 3KUKA 5EP4A 4E7HA 1D2GA 2LDBA 3EFHA 1XU9A 3PFYA 3ZXUB 4PDKA 1T29A 4YP1A 4QREA 3CP8A 3JARA 3NDBB 1TZLA 2BSXA 4EJ6A 4EYQA 1RXVA 4EI7A 1C7QA 2JJMA 4LV6A 3OHSX 5DX0A 3ASUA 1Z35A 4K03A 4PZJA 4DNFA 3Q10A 2HU5A 3KO8A 2BXYA 1ZXLA 2JA8J 3EXFB 4MI3A 4TLAA 1QU2A 2H4XA 1E7MA 1P7ZA 2OU2A 2C4WA 2P79A 3NVMB 4N8SA 4D9FA 2G0NA 3FPAA 2PKRA 2ZB7A 5BN4A 2PE5A 1V1MA 2AQEA 1XZ8A 2ZE7A 1H4SA 2IEZA 2QPOA 4Q7MB 3WGZA 1M7HA 3LAJA 1C0PA 2GRJA 2PRIA 1YZGA 3ONDA 1IRZA 3ZWMA 2Z6AA 2OHFA 3DLPX 5LR6A 2VKEA 5F1JA 4KI7A 4QQNA 1P5RA 4HF0A 3K6KA 2B8JA 2JVIA 1K78A 1HTWA 3ZMSA 1NN3A 4N9IA 2Y99A 3L8YA 1EH8A 4G0WA 1B72A 3ME5A 4K6OA 1U7OA 4G1CA 4OA8A 3ZQGA 1VQNI 1DQYA 5G0SA 1FOWA 3FXMA 1LFAA 2EW8A 4U87A 3R7AA 1VE5A 2YWFA 3KQMA 4MV3A 5A05A 4PLCA 1UCRA 1QJCA 2BOLA 2NXNB 1Z2EA 3V4VB 3VR1A 2V7FA 3K31A 4TKUA 5ALHA 2Z5UA 3A7EA 4LMBA 1W46A 3VZPA 1L8QA 4DVJA 1YRHA 1MIOA 4NFYA 2JLXA 3HBAA 1BR2A 3WSTA 1KAGA 3EHDA 5CDSA 5EEGA 2CLEB 5FAXA 2V4JC 1LLUA 1V2GA 4EPVA 4EPTA 1XQXA 2ONZA 2OF7A 2LD5A 2Y9MB 1T1RA 2VZLA 4ERNA 4FISA 2HZTA 4CCJA 5LYJB 5M7EA 4RCZA 1KJIA 1YQDA 1XSDA 1Q7BA 3L8ZA 1G6OA 1XTQA 4PG5A 3JQBC 4PLFA 4F4CA 2P4SA 3RBAA 1PTKA 1RZUA 4EB3A 2CLDX 4A23A 1THTA 2I9PA 3GFSA 3Q5EA 5HIJA 4EL5A 3E82A 1EFRD 4NBTA 1HXDA 4UQLA 1NSYA 4A8PA 1IY0A 1J0DA 2GJSA 5EYPB 3E6DA 5EINA 2CLFB 2H4ZA 3WLMA 4B34A 1OA0A 2JD0A 4B3DA 4LF9B 4N5LA 1WRJA 1H2RS 3KKPA 2PMWB 5KYXB 1DQNA 4ZTFA 3EOBI 4KSYA 1OT3A 1DBIA 3C41J 5KYTA 1JYFA 3W5IA 4IFIA 2DOAA 2W24A 3JTHA 3CCUI 3OYMA 3DD1A 3OHPA 1G2QA 2E6UX 3SIRA 3OEHA 3CZRA 3F9RA 2ECPA 5JD5A 2GYVA 4NK4A 2HDWA 2IDMA 3M2TA 3R4CA 4BEBA 1AKVA 3DGFC 3L7YA 4DLPA 1V5GA 3OOPA 3QOYA 2XZDA 4YCJA 1VE9A 2DYKA 1AJEA 1YH3A 4YUVA 2VPIA 3WGJA 4CMCA 2XQKA 2QRVB 4X1EA 2X8BA 4O6JA 2J59A 2Q5IA 3Q8WA 1CF2O 3KSMA 3RTGA 4WINA 5JSKA 4BX3A 4BHTA 3UK1A 3BXXA 1RJFA 4L8YA 5EJ7A 1G20E 4X7PA 4IZZA 3DKVA 1Y8RB 1SHJA 3IH3A 2B4TO 3L2OB 5ALQA 1JEEA 2DLLA 3AL0C 2RBKA 4B8XA 3H2JA 1QHXA 3RK0A 1T6NA 3QUCA 3CLRC 4YCCA 4KMOA 3ZXXA 2ZUBA 1IXRC 2QRNA 4DV1B 2EL7A 4OOIA 2K87A 1XTZA 2ZVJA 2MBFA 3FB4A 3OT5A 4YAFA 5BVHA 1EHCA 1IXKA 1FYLA 4MS1B 3AOEA 2RK6A 5CCXA 2IYFA 1AN9A 1G3WA 2YZ7A 4MW2A 4OU5A 2IL1A 3EZYA 3QMMA 1TFRA 1WRBA 4EATA 5DXAA 2DFHA 2DX7A 1RKQA 1ESZA 1XMJA 4BEHB 2FZWA 3MT8A 4MR8B 3JRGA 4N03A 2GVDC 3VPFA 3ISVA 1TCAA 4PFOA 2CYCA 1VFCA 3EJWA 2OQIA 3MGKA 4YJFA 3U3RA 1ODFA 2QN3A 1Q17A 2BRUA 1LDGA 1HYHA 2IA5A 2G70A 4BGDA 1Z7EA 2R00C 1T0HB 1CUUA 1QV9A 2UVPA 2Z1MA 3SIWA 5KTOA 1M7BA 5EZGA 4TUYA 1AU7A 1U5TB 2X6OA 3VPHA 4ER5A 5KTKA 5GIPE 1DT3A 4KXYA 2X0KA 1W7AA 1R1TA 3HTUA 1GG5A 1TA0A 1XDWA 1N1MA 4FKZA 4P5OA 3VSLA 2YX7A 2WAEA 2BGNA 3CPHA 3VZRA 5DBOA 3WLOA 1E89A 5JY6A 2C3UA 4QIHA 2OPHA 1SXHA 5F9MA 4DAOA 1C30B 1YDHA 2FPPA 4GP9A 5D01A 3MLBA 4BQNA 5LYJF 3HHGA 2BFBA 1ZOSA 2BOVA 4FDLA 5BYBA 2Y1XA 2X9QA 2WAAA 2X9LA 3OCUA 3LGXA 2VP3A 3I32A 3T3GA 3W4KA 4DMHA 3RARA 4J76A 1JTEA 4RJ2A 1N6OA 1ETYA 4HNTA 3E23A 3M49A 1E8NA 4CLOB 3E9DA 1FTZA 3B5EA 4FJ0A 3VZQA 4LRTB 3QPUA 2RVCA 1E3OC 2IX9A 1R0WA 2ECQA 2BGRA 2FHSA 1MAVA 3PGVA 1LPSA 5FKLA 2I6QA 4FEGA 3B48A 3H1BA 2GSDA 2JIDA 1VHQA 4LYDA 4YJ3F 1NBAA 8ADHA 5IM4F 3FWKA 2D1RA 1CTQA 3HY4A 3JQ9C 1AHHA 1Z6PA 4G5XA 4OOEA 5AJZA 3J7AC 1ZMOA 4ZCLA 2GLTA 2HU7A 2J0QA 4I55A 3GF4A 4UAUA 4EYOA 4YBRA 3K0SA 2D8MA 5FL7D 1ETQA 3SXYA 3B3GA 3P96A 5BQPA 3L6EA 4WJKB 5I48A 4OHVA 3ONNA 1ZNQO 1RKXA 3MSCA 5F51A 1WABA 2X2EA 1RXEA 2C77A 2C57A 2CD7A 1Y56A 2JRLA 1T13A 4NP6A 1T9AA 4CIVA 2ZCWA 3GBVA 3UQYS 1IK4A 2NX2A 5TF0A 3ZGVA 1RRJA 3CNEA 4LDRA 2AZDA 5EWMA 4OQLA 4DLTA 4ES6A 3JSOA 5AJXA 3SS7X 3MHPA 3GRZA 2Q62A 3RUFA 2OP1A 1ETUA 3BF7A 4M71A 3EIXA 1MC5A 4L0MA 2SBTA 3GYBA 1TKBA 1FU8A 3FXAA 4GL4A 4ZVLA 5BVGA 1DX4A 2F8LA 3ETDA 3U3DA 3H1GA 5MDHA 3U4AA 4HAMA 1MGOA 1N2SA 3EDOA 1AXEA 1IHPA 3G85A 3KAJA 4EGYA 5BSHA 2UXCB 2JEOA 1QRYA 4P80A 3MQ2A 2Q1TA 4PO9A 5F1RA 5KB3A 2CY0A 1NVFA 4ESEA 1QV6A 1KP2A 2R8BA 2YFKA 1RPTA 3ZQCA 1QDLB 3FAZA 4HMOA 5CGQB 1I4LD 3LWBA 4AWXB 3FVVA 3IBSA 2WF5A 5KDDA 3EG9A 4IUBS 3LKDA 4H08A 2UXDB 4LTMA 1M34E 4US0R 2B2NA 2GVNA 3ZOKA 1XPRA 4GO1A 1GNQA 3A05A 3E7PA 1OVMA 3LA8A 4O3MA 3FBTA 1PJ4A 3BTJA 2EIJH 2W22A 2WPDA 2WWYA 4KQWA 3QPSA 3PEWA 1M8JA 3AHJA 2DR3A 3JZFA 4CLDA 1KYIA 2PLWA 3SZPA 4QDXA 2Z5VA 3IJRA 4CCNA 1ISJA 3O4IA 4PONA 4XX1A 2Q2EA 1SBCA 3KPUA 3R76A 2PBFA 3N2LA 2CF5A 1JJ7A 5E4YA 2C9OA 3QPVA 5E0OA 2H2GA 1RHUA 2D1VA 3M5DA 4IMRA 1H69A 4BDYA 3CS3A 5I9IA 1QH1A 4OKSA 4ZMSA 2IE0A 4LRWA 3U17A 4W1RA 1ECFA 3F5DA 3OKFA 5KYXA 3SVLA 5FRMA 4GKAA 2CJWA 3TR5A 5IPFA 2Y66A 3RRZA 2QN9A 4MW5A 2B37A 3DMPA 3MCUA 3VGJA 4EG6A 5T3UA 3AFOA 3L8EA 4FYVA 2MOKA 2BI8A 3D0KA 3IFSA 1QZEA 4H77A 4HNSA 3HBMA 4M53A 4NJEA 4IOCF 1U0JA 3B8EA 4PEVA 3GBPA 4JB3A 2YU3A 1U7DA 5ALEA 3C18A 3SHTA 1Z5GA 2WHPB 4LMAA 1WTAA 1JUDA 2RHBA 4MP8A 5EQDA 4OYLA 1RQPA 3C3CA 4I99C 1N2GA 1BFKA 1XO1A 4AWXA 4GRIA 2FOXA 2ZTHA 4FT2A 3UK2A 1DKLA 2KBEA 4KJXA 4R16A 1WMEA 2J4DA 4FR5A 1SNYA 2RGGA 4U2GA 4Z1OA 3FDXA 2O0KA 5DNDA 1T5OA 1I39A 1ZK0A 2J3DA 3QVXA 4HDRB 2VPXA 1O97D 1ZQ1A 3NBYC 3OC6A 4WACA 5K8IA 2C97A 3F6EX 4QA9A 3GRRA 3T3OA 1U63A 3DULA 5BS6A 2CJYA 1DC6A 3GW8A 3E7LA 3D3EA 1D6SA 1I3NA 4ZI7A 4P8RA 1H1DA 3ONEA 3C3PA 1VI6A 4E30A 1NBEA 5T8KC 2I62A 3GHYA 3GUCA 2ODTX 4EO4A 3ABOB 4A7PA 1QLJA 1B8VA 4BEHA 4MR8A 5GWXA 2WKQA 1MOZA 3EMKA 4K6FA 2R66A 5A3JA 5CK5A 1Y3HA 3AF0A 1ZGZA 4M6XA 1GGEA 3EDQA 3IEXA 2DK8A 1YONA 2LCFA 5ARBA 2P90A 1Q16A 2BTOA 4GZ5A 4DLAA 4EJUA 1JEDA 1XGOA 2X85A 1WMAA 2GO1A 4E08A 1JILA 3WLIA 1C1XA 1OXXK 2Z3VA 1G2IA 1WETA 5J3JA 4G26A 5LBUA 3C6ZA 3I64A 3FK6A 1TQPA 1KFJB 1EK2A 4FDTA 4NBNA 1WJDA 1TRKA 4UDYX 3VMMA 2OAQ1 2DERA 4A36A 1E3HA 3NONA 1B42A 4YP9A 5EQJB 3A6KA 4KQ6A 2ZBQA 2IOYA 3ZU4A 3FPKA 4C2AA 4CU2A 4OAPA 4IHAA 1I3KA 3DTIA 2H16A 4JBLA 4QYIA 5J4LA 1JKRC 4E7JA 3FYHA 1U2GA 2ZE5A 5EIEA 3KLPX 2DFDA 1E2GA 3OIOA 2Y0MA 5HNFA 1F2UA 1UJBA 2GPJA 3MOIA 4ZCMA 2R5WA 5KVRA 3E5NA 1EUZA 1GRQA 3DKRA 4FHGA 4K9LA 2L3DA 4NJMB 2WC1A 5B1AH 4ENKA 3RUDA 5HCUA 4AJ2A 3AKDA 3JZAA 4KLAA 2CVOA 2OXTA 3RRXA 4KAXA 1SVIA 3FPBA 4LJ9A 4DYVA 3WTUC 1SCNE 2WJAA 3BMOA 4TPKA 1JG4A 3EHEA 3K8QA 4M1KA 4X8OA 5E9AA 3WQBA 2HIGA 1Z6TA 2G9RA 2NSDA 3Q7SA 5JHGB 2DB3A 3U2RA 3BICA 4N4AA 1CUGA 2CLCX 4IKOA 1XJ0A 4MW1A 3VR0A 3T3IA 5JTTA 1KSJA 1RI1A 3BL8A 4A3IJ 1NT4A 1YB7A 4IXWA 2Y92A 2ORYA 2P7HA 5DWVA 2OA0A 4DSNA 1LPNA 2XTZA 1FIPA 4IIJA 1U8TA 1XZHA 1E2QA 3FK7A 4KAFA 2QU7A 2A1TR 4OY3A 2OCDA 4HJXA 4OKIA 3ZWVA 1P1FA 1U5BB 2W6JD 3KSZO 5T6MA 3A2LA 3SU8A 1Y6IA 5JRJA 2P75A 3D3NA 4R7ZA 5DOZA 3SX2A 4Z4FA 1B00A 1HDGO 4LVCA 3WLTA 3HXMA 2DUMA 1NY5A 3F96A 3HYLA 3P9CA 2CXXA 3PD0A 3K4KA 4JL8A 2AN9A 5A7GA 4AZ3A 3A0UA 4ND5A 1EAMA 1MSEC 3NAUA 3G6EI 2A30A 2N0SA 1R6RA 3B1ZA 4PFJA 3AG6A 2JGNA 3AG3H 2DMNA 3OBIA 1T26A 1XG5A 5H6QA 3ZIDA 1NJ5A 3QQAA 1VIMA 2NO5A 2HZBA 5FI0B 5I9TA 3SAJA 5ITWA 4LB6B 4ESVA 4EO9A 5MF6A 3DBOB 2JKZA 1Q7CA 2NZWA 4JLAA 1HBXG 2PIAA 2B5VA 2PXXA 1JHAA 5NLLA 4P22A 4CKWA 2YKGA 2CT8A 3IEKA 1U0SY 2QNIA 3A6DA 3FPFA 1UZLA 1YZHA 3UHOA 3VPXA 3QU9A 3AI1A 4PG7A 4DMFA 5AI9A 4RH0A 1KEVA 2IA1A 5K5OA 3A1NA 2AG5A 1AUQA 5FOTA 5KAMA 1K92A 4LWQA 3K2IA 1FXUA 3T7EA 1I2BA 1VNDA 1RBMA 2CE7A 16PKA 3A10A 5AK0A 4CT4B 8OHMA 1P5HA 3UNGC 2O8FB 4I4TB 1ZL0A 1KVTA 2K2WA 3DTEA 1W88B 2B6HA 3D6FA 4FGJA 1CUIA 4KUGA 3H42B 3ET4A 1O54A 3NVAA 4PZUA 5F9HA 1L3CA 2F6CA 1KKUA 1LNSA 1DAGA 1Z2CA 2GZAA 1CJBA 3K3PA 4HAXA 1WKMA 2MDTA 4GP7A 4QG3A 5IFKA 4ISCA 4ZXFA 1KSGA 4EVIA 2CUFA 3P2JA 1R5ID 1E1RA 1HV8A 9MHTA 3K0EA 1NMYA 3OLWA 4D6PA 4BVHA 1K9SA 1GLVA 2GOYA 2WJPA 3MTQA 4UNNA 3FXRA 2B1QA 2VAWA 1WDKA 1YDGA 1MMAA 2JCXA 2RHCA 4B6OA 1SKAA 2XJ4A 4JKYA 4IDOA 5KTPA 2QX4A 1PR6A 3U39A 3HI6A 1YXMA 1CYDA 2YWXA 2OSVA 4P38A 3HLTA 3P4XA 4QXOA 4HDMB 1AGXA 1OX5A 4H1UA 3GAZA 2LF8A 2PRYA 5AKLA 1VBKA 3FBNB 1D8JA 2ZIZA 4MEBA 1ORKA 1FYKA 4UUNA 5I7AA 4TT3D 4F85A 2H27A 5E1WA 1Q22A 2M5WA 3SVTA 1QZUA 2GARA 1PW5A 3NHJA 5EIFA 2XMRA 4W5QA 1WF6A 2D5IA 3A4NA 2EP8A 3BB4A 3BZKA 5HHTA 1B93A 2AI2A 1NZDA 1JG3A 2F5VA 1LH0A 1JVSA 2GAIA 3GPLA 3ILHA 1UMBA 2P9EA 3OOEA 1SPBS 3TQCA 4LD5A 5D5HA 1N2XA 5HLTA 3GC6A 1K5PA 4R8RA 1ID8A 2IZ1A 3TDNA 1C4WA 2YMMA 2EHDA 1JQEA 1TIBA 3BE6A 3PRYA 4BN5A 3OQIA 2F9FA 4OBBA 1UZMA 4AKHA 4EY6A 4ENSA 5LOVF 1KO7A 1LPPA 5CNMA 4E15A 4CJXA 4RVOA 1U3EM 5C8YA 5AVUA 3QLUA 5ESDA 5DTMA 4UARA 4C0WA 4K5QA 5KCZA 1TJ5A 1XQ1A 1Z7UA 3SQOA 1MX5A 3GJZA 4V2FA 3K6GA 1E2LA 2FFQA 5EUCA 2V1NA 4OMFG 1QYRA 1V9CA 5J1SB 5AVOA 2BAGA 3L2QA 2C84A 2KHMA 1K8ZB 1OX6A 4GZLA 3Q0TA 4RDCA 1EFVA 5IULC 2EFJA 2E1PA 4MW7A 1PT7A 2EV5A 2ADUA 2LREA 1BFDA 1DKNA 3L2CA 4KWHA 5D5PA 4QTXA 1KA8A 4HDKB 1AUVA 5LQJA 3PI7A 2E89A 2J1LA 2F90A 2QX6A 3C48A 5HYVA 4GQBA 5DBHX 4YPOA 5DCWA 2DF8A 3K0AB 4KE9A 3VNQA 4DYQA 2C2ZA 4F56A 3OX1A 1XXHE 3LX5A 2G9QA 2A5DA 2Q0QA 4PTZA 4OQFA 2RAFA 4JELA 3IVRA 4P33A 3MTIA 5JC8A 4WXRA 5TLSA 3WA7A 1SBQA 2PLAA 3HHPA 2A6EF 1QOQB 4UBIA 2F3PA 2HLHA 2O61A 3UV6A 1U78A 3ASVA 1FL9A 1OXTA 3L7IA 3ZHSA 1HDIA 4BVBA 2FSHA 1TP4A 1V8ZA 3BJEA 3S3OA 4B0PA 3MUFA 3BZWA 1GZSA 2ETXA 2I8DA 1EM8B 1TZ2A 3DCYA 4B48A 1ZA1A 3HQ4O 3OTGA 4FGSA 4TQAA 3CDLA 2VOPA 3RANA 3OIWA 2BH2A 1ULAA 1ZELA 4ENMA 3BRWA 2Z2JA 4C3OB 3IL2A 2PJUA 3C8HA 3HRUA 3WAKA 3D0RA 3LCUA 1Y3DE 3PI6A 1AM4D 2G9NA 1QU3A 1BNCA 3HDJA 3QKIA 1Y82A 3MJCA 4YIIA 4G7HF 2FP3A 1CQPA 1EFCA 4R84A 3WLEA 1N6KA 4G5YA 2GLOA 2IQIA 2RGYA 1TUBA 5K5RA 1RR8C 4IHYA 1POWA 2ZBPA 2CXHA 3E97A 1U2QA 2ERYA 1AXGA 2JAXA 2OCGA 3AFGA 2PG4A 1BEEA 1W0CA 2ZP1A 2EYUA 3UW3A 4M1WA 3TG8A 3VXKA 1X9GA 1BL0A 1M2FA 2YUTA 3D0SA 2R7TA 4HGOA 4EUSA 1QOZA 3UHPA 3FPCA 2R8ZA 4Z4EA 2WOJA 3D8BA 4RXMA 3A1SA 1L4HA 3KTDA 2IZ7A 3WICA 5FPYA 1XLTC 3PUJA 4G0OA 4TTAA 5T57A 5BYKA 3PIDA 4K46A 2EZLA 2YNMD 5TPZD 3RDIA 1NVVQ 1P5ZB 2NGRA 4I55B 3KZYA 2GZDA 4DUGD 2E1NA 2EJRA 1S4MA 1W0JA 1T5HX 2QQ5A 1LY1A 4G5GA 3SM3A 4D9HA 3ORHA 3ZK7A 4DG5A 3N75A 1P92A 3U19A 1IU9A 4MRPA 1NVAA 2O3QA 2ZVDA 4GBED 1KU7A 4F4IA 2MYTA 1J1UA 3GGCA 2XLCA 4LX0A 4IIXA 4RV4A 4HLUC 1Z0XA 1UFOA 2WFZA 4RA9B 3S2EA 1H0SA 3LQRA 2A0WA 1UKVY 1YJBA 1DQUA 1AGNA 2AXTC 1HG0A 2H0QA 2LE0A 4DR5B 3GLRA 3HJNA 2PAFA 2WY7Q 3RVBA 3Q8MA 1TW3A 1X8LA 3AFMA 1VMEA 3M1YA 5JCPA 4FFRA 1U5TA 4BDZA 3QBTA 3ZCPA 3HMKA 3OQ6A 1TTYA 5FO5A 1Q1BA 2J6IA 2AFIB 5LDHA 4OI4A 4Z3KA 4KLCA 1V43A 1RTTA 1Y8CA 3ACBA 4MYDA 5REQB 2JATA 4PK4A 4HDAA 3H1FA 5IT5A 1PNTA 3DO8A 1CCWA 3OA0A 5TR9A 3CIFA 3CU5A 3MB8A 3R3YA 1FSHA 1P3Y1 2ZITA 4NU6A 5KYKA 3KEOA 4FDUA 3W2EA 4RIFA 3KQKA 1NBMA 1FFWA 3FR8A 5C52B 1O6BA 3CCJI 3B6JA 2E7XA 1Q95A 3MYYA 4DDKA 2UZ3A 1P9OA 3PU6A 2HWXA 1HI9A 3I55I 4URHA 4DCNA 2VUMJ 2WYHA 3BIXA 3KV3O 3MNFA 4IL6C 2GK3A 1W44A 3N7AA 4IHXA 1CYEA 1JDVA 3NBXX 3GLFB 2ISQA 2AK3A 3A06A 4OL9A 4UHCA 1GUBA 3UGKA 3NXSA 1R6DA 2G0TA 3BCUA 5FFFA 2IKSA 2MWMA 4BO4A 5L3SA 5IVHA 2FEMA 1JUSA 1H3EA 3FXLA 1I30A 1FTNA 1Z4JA 4EUEA 2QMYA 1SIOA 1JNYA 1YRQA 5IT9K 3DE0X 3W05A 2AA3A 1OYWA 3WB1A 4BEVA 2CW8A 2A9QA 4RNDB 4ENPA 2R7NA 4XCVA 4EHNA 2R86A 3MKZA 1XZFA 3AR5A 4HDMA 5TPZA 1JH9A 2EFHB 2W00A 3H6GA 4WOPA 4PLVA 1TFUA 4RHEA 3UNXA 2ATVA 2WVHA 3GRUA 3MMPA 1R15A 2WU4A 3R2JA 4BRUA 2ZIVB 1VQ8I 3E8XA 1ODIA 4MW4A 5BO5A 2I9KA 3G5TA 1HA8A 2FN7A 4AJNA 2GZHA 3NNDA 2DQ4A 4LRSB 5HGJA 1C7RA 1K68A 2YYYA 1LDYA 5TVGA 2FNAA 5HDKA 2FOLA 1XQ9A 3F98A 5JSUA 3EG5A 3BCHA 4MV9A 2GF0A 4MVYA 4B76A 2FSPA 3VI4B 4HSEA 4AJEA 3LX6A 1QHSA 4L9NA 2QROA 2QWXA 5YASA 4GKBA 4IZIA 3G0OA 5ALDA 1BI1A 2QUZA 2VJAA 1OLSB 1R4NA 4MVJE 4GOXA 1O0CA 2QVGA 5C80A 1XJWA 3F5FA 4ZALA 4UVHA 2R7FA 3OS1A 5JFOA 4PLGA 3WISA 4A3CJ 2SKCA 5C7IO 5B4UA 5LHIA 1GZVA 3HCFA 2L54A 2PMEA 4LITA 1H2FA 1PYGA 2TMDA 4FE7A 2PZLA 3S32A 1CB0A 1FSZA 1LLCA 3G89A 2WHEA 3IR6A 3Q98A 1AUOA 3QU2A 4G01B 3CT4A 4JXKA 2W98A 1CQZA 5HUQA 4P0PB 4N3NA 4R98A 2CZQA 3DDCA 5J2TA 3OFKA 5DNEA 3AERB 3ZE9A 1F60A 5K8UA 3L9FA 1Q7TA 1J8VA 3W6JB 1JA1A 1WQ3A 4EAQA 3KKMA 5CFLA 1X70A 5AVSA 4KMUX 1F5TA 4GZ3A 1XELA 1O4XA 2A86A 2W8BA 4IOMA 5HKLA 2ID9A 4WNIA 3ZDEA 3VKHA 1E1KA 6YASA 1DX9A 2PVPA 3WJ1A 2DG2A 3LOCA 1G21B 4JASB 3I76A 1ACIA 1YVEI 1SU4A 2V6IA 3ANYB 4M88A 3G1WA 3GW2A 3RSNA 1CEQA 1FVOA 1KP9A 1B1CA 1XHFA 2QE7A 1EX1A 2YJGA 3BMCA 1H4TA 2F64A 2C31A 2M6KA 5IJ9B 3MWEA 1XP5A 4OYRA 2X0NA 1QWOA 3AXSA 3W5VA 3OEWA 4XYBA 4CA0A 1CUFA 1T5TA 2V7WA 4QNNA 1NYRA 1HSOA 1KQPA 1QIIA 5LFAA 1U0TA 2B98A 2N9UA 1EDDA 4S35A 3L7NA 1WLYA 3MTBA 1A7KA 3HVUA 4PZ0A 4AIRA 2C3PA 4IHTA 1CU1A 2R84A 2ZGVA 1IUYA 1LJUA 3NASA 4KDCA 1Y1WJ 5EMKA 1SU7A 2BGIA 4D7NA 2BMEA 5KPJA 3NV7A 4IHKA 4PQGA 2LXNA 1XPXA 5FGMA 3F8TA 3ROZA 4G1EB 4BE9A 4Z54A 1PTJA 4D9NA 3JYLA 3I8XA 4PIMA 5CU7A 4E33A 7YASA 1U99A 3HYTA 1D9XA 4MRAA 4O4IB 1L4EA 4N9WA 3GA5A 3FHTA 1MRNA 1GPH1 1YJ5A 4QPJC 4D4LA 4ARCA 1L5FA 3PD1A 4O2BA 2Y4NA 3CTAA 1XVTA 2QIPA 1ZM7A 2YU9J 2X0JA 5JAQA 2RIPA 3IXQA 4JUIA 3QJYA 1V6CA 2I6SA 2XRMA 2P68A 3RM3A 3BB1A 1RC1A 3NNSA 2YHIB 3DV9A 5JJBA 2ZAYA 5DUIA 4L9AA 1WZNA 4YECA 3VO8A 4DLRA 3FSGD 3M1LA 4N7RA 3UJCA 1X1AA 4OMZA 4S1VA 2IITA 2X5NA 1TO1E 3P0EA 4RDIA 4BZWA 3HNRA 2OCIA 4M86A 4XIFA 4DB2A 4G12A 4DNCA 4HLCA 4IBOA 5MGNA 2WG2A 3W8EA 3OIVA 3KJQA 2ZYGA 4F4JA 3HJGA 2CVFA 3N87A 3ESZA 4BV2A 5B5EC 3IT3A 3RRMA 2IE8A 3M5CA 5TNXA 3IULA 1U9OA 3VPGA 4E14A 3TQNA 1RD4A 2HPIA 3VHXA 3ZE2B 3DDNA 1L4MA 3GRFA 2Z16A 4JQCA 5CNIA 4AU1A 1J6UA 4D41A 4IO9F 4XD7A 3VZDA 1CJVC 4HFNA 3ZJ5A 4C5AA 5C7YA 3ZDBA 1CEYA 3TTUA 3GFTA 2XNJA 1U7ZA 3MQ4A 4K9DA 1FMTA 4J01A 1LFPA 5A7HA 3U13A 3HSSA 1CQXA 1QNFA 1XNJA 4BNZA 3AG1H 1CUDA