4HG2A

The structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
AFRPRYPRALFRWLGEVAPARGDALDCGCGSGQASLGLAEFFERVHAVDPGEAQIRQALRHPRVTYAVAPAEDTGLPPASVDVAIAAQAMHWFDLDRFWAELRRVARPGAVFAAVTYGLTRVDPEVDAVVDRLYHGLLARDWPPERVHVESGYRTLPFPFPELEAPPLEIEERWPMDAFLGYLGTWSAVTAHRRRTGADPLAEIAPALRAAWGTPERPLRVTWPIAIRAGRILPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Putative Type II Methyltransferase from Anaeromyxobacter dehalogenans.
rcsb
source organism Anaeromyxobacter dehalogenans
molecule tags Transferase
molecule keywords Methyltransferase type 11
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2560 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hg2A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4hg2A01
1NW3A 1EIZA 3LHDA 3IHTA 3NJRA 3HA7A 1JQ3A 2OB2A 2AR0A 2OXTA 1QZZA 5C9ZA 3E7PA 3EPPA 3H2BA 3QOXA 5EQJB 3ERCA 4E2ZA 1SKMA 4OBXA 1PRYA 2YUIA 4E32A 2G1PA 4YMGA 2YQZA 5FHQA 5E9QA 4V0RA 4L7VA 4BLVA 3TR6A 4PIPA 3SSMA 3LKZA 1G55A 3OZTA 5DXJA 5DPMA 5IH3A 5LQNA 1KYZA 5BW5A 2Z6QA 1X1BA 4GQBA 3PX3A 3QV2A 3OZRA 5K01A 2O07A 4XUDA 1G8AA 4E31A 2JHPA 1EJ6A 2PT6A 3P8ZA 1Q0SA 4X63A 4PYOA 3B3GA 3OFKA 4IV0A 3FUTA 2Q41A 2O05A 3GU3A 2PKWA 3BGDA 5K0JA 3P2KA 3KPWA 5JR3A 4MIKA 3T7TA 5DT2A 1SVUA 2KW5A 4Y2HA 2YX1A 3AY0A 3B89A 3F4KA 5EEGA 4ZTBA 1NW6A 4BLWA 4CKEA 5EZQA 2Y1XA 1QAMA 2G8NA 5CM2Z 2ZBRA 2EJTA 1KPIA 3TOSA 1RI3A 1F3LA 1ZHFA 3FPHA 4P58A 1BHJA 3CGGA 1NE2A 5CVDA 1JG3A 3OFJA 4QDJA 3KQSA 3GDHA 2B3TA 1DUSA 5E2AA 3EMBA 3OPNA 2AS0A 2FK7A 4CWAA 1WXXA 5GM1A 1ZG3A 4XCXA 5LQKA 3OU6A 3FTEA 2UYOA 3HCFA 3KKZA 4Z2YA 2IGTA 3NTVA 5HILA 4V0QA 3C3YA 1ORHA 2GLUA 4ER7A 2UYHA 2JG3A 2QY6A 3G2QA 4C04A 3TM4A 2BZGA 1TW2A 3UZUA 3EVFA 4AZVA 3DMFA 3TM5A 4H0NA 3U81A 2NYUA 3OCJA 2Z6UA 3AWIA 1IY9A 3I5UA 3MTIA 3SR4A 3VC1A 2YXEA 2AZTA 3FUWA 3RIEA 2P8JA 3GJYA 3KR9A 4CKCA 3WSTA 3LCUA 3HCBA 2QRVB 1WG8A 3OE5A 4GBED 1NT2A 2G72A 2V74B 5EC8A 3OE4A 4FP9A 5HIJA 4AZWA 2IFTA 3EMDA 3HCCA 1AQIA 3MERA 5EPEA 4OX9Y 3CJQA 3EVGA 3GXOA 1P39A 3R6TA 5D1NA 5HZMA 3HCDA 5K8VA 2Y1WA 4GC9A 2IP2A 1RJEA 1NV9A 3BWBA 2ZW9A 3MQ2A 1KHHA 2P3OA 3QOWA 3BZBA 5DX0A 2JH9A 2P7HA 4OBWA 5CCBA 4R6WA 2GS9A 4DA4A 2NP7A 1NW7A 3A27A 3CC8A 5F2KA 2PY6A 4LWOA 5K0EA 1L3IA 1N7JA 4KIFA 5EHIA 3UJ9A 3NMUF 3D2LA 1MJFA 4QQKA 4Y30A 3TLJA 5CVUA 4NECA 4OQEA 2HTEA 2VZ9A 3B3FA 2GB4A 3A26A 4EVIA 3DP7A 4PWYA 2JHAA 1QANA 1R00A 5DM0A 5E9JA 3NVKI 1VIDA 4DQ0A 3I53A 4KVZA 4RTOA 5CVVA 1QAQA 3DXYA 5LQUA 2P3LA 5DM1A 2YTZA 1P1CA 3FTCA 5HIIA 5ICCA 3VYWA 4CKBA 4X60A 1NKVA 2AOTA 1U2ZA 1FP1D 2PBFA 4FS8A 5DXAA 3LDUA 5DX8A 5FWDA 4RYLA 3A7DA 5ICEA 3A25A 5LR6A 3ELDA 2ONZA 2O0LA 2NP6A 1D2GA 4MQ4A 3UJBA 3UJCA 2E5WA 3G2MA 1EQAA 4F86A 2H1RA 4MWZA 1PJZA 3DXZA 2AN4A 3C0KA 4P7KA 5MHTA 1XDSA 1KPGA 2ZTHA 3K0BA 4YUWA 3EEOA 3O31A 1G60A 3KQPA 5M5BA 2IBSA 1VBFA 2VDVE 2PXXA 4B17A 3LDFA 1P1BA 4BY9E 3MTEA 2UYCA 4YV1A 3JWGA 1FPQA 1BOOA 3FUUA 3GGDA 2PX4A 3LX6A 3KQQA 3PFHA 2FCAA 4FZVA 1L9KA 1JTFA 1G6Q1 4BLUA 4C4AA 1NW5A 2O57A 5CD1A 4A6EA 3RW9A 1XXLA 2HNKA 3UWPA 3KHKA 3KQMA 1JG1A 5KQSA 1SUIA 3HVHA 3DH0A 4QTTB 5E1BA 1X1AA 5D1HA 2JH8A 5K03A 2CL5A 2EX4A 1Q0TA 2B25A 4DCGA 2ZZMA 1R8YA 4PYLA 5DTQA 1F38A 4RTMA 1KP9A 3GRVA 3FRHA 5K0LA 3VSEA 2AOXA 2XYRA 2CMGA 2AOWA 3CCFA 3KPUA 3FPEA 4FSDA 5DWQA 5F2NA 3MHTA 1X19A 1XDZA 4E2YA 1SQFA 4GOMD 1EJ0A 2PXAA 3C6KA 4EK9A 3GCZA 2IH2A 3P9CA 3CJTA 3LSTA 4LECA 2O06A 5DRTA 2CKDA 3FYDA 3G2PA 3ID6C 4GEKA 1NBIA 1RI4A 4HTFB 2ZBQA 2OB1A 2P40A 3P9NA 2ERCA 1YFLA 4YV2A 5FA8A 3AJDA 3LPMA 1JQDA 2G71A 4EQZA 1JQEA 4RWZA 5KYGA 3UJ6A 1JTEA 4M7RA 4QTUB 3B7PA 1KYWA 3C3PA 3CBGA 3HA5A 2OYRA 4C07A 4M38A 3I9FA 4DF3A 4YV0A 3HP7A 2YXLA 2H00A 2ZLBA 3UJAA 3DUWA 1XCJA 3DTNA 2B9EA 3ER9A 1TW3A 4HSGA 4RTPA 3KPYA 3R3HA 3KU1A 2QRVA 3OU7A 2PWYA 3P9IA 4GOOD 3G8AA 3I58A 4JXJA 1X1DA 4PGHA 3SGLA 5LQAA 1BC5A 2PLWA 5E1MA 4YUYA 4OA8A 5K0FA 3LCVB 1P91A 3TMAA 4PYQA 2FRXA 5E8RA 4F85A 5C0OE 3R24A 4C08A 3SSOA 2BM8A 3BWCA 4HRAA 5DM2A 3X0DA 1IM8A 2BR3A 2OO3A 2ZSUA 5E8JA 1R6AA 2AOTB 1G38A 3T7SA 1SQGA 2DPMA 4RVFA 4RX1A 5H02A 2ZIGA 4DCMA 3EEYA 1VE3A 4PNEA 3DLCA 3FUVA 2JHCA 4RTQA 2NXNA 1N7IA 5EMJA 4YMHA 1QYRA 3LECA 4PIMA 3Q7EA 1IXKA 5DTRA 1B42A 2NNWB 2YR0A 3LBYA 3M6XA 4G56A 2VDWA 5E9WA 5KVAA 3LBFA 2UZ4A 3NDIA 3BKXA 3PX2A 4E2WA 1KPHA 3CVOA 2B78A 2AN5A 2ZIFA 3GWZA 3PFGA 1SG9A 4HGZA 4P7FA 5EEHA 5EGSA 3ME5A 3SXJA 3GRYA 3UA3A 5E1DA 4ISCA 3JWJA 4KDCA 2OPBA 2YXDA 3FZGA 3LCCA 3NWEA 3FPJA 2BM9A 2NXJA 3BWYA 3PVCA 2G70A 3FUXA 4R8RA 4XUEA 1WZNA 1RJFA 1V39A 3G5TA 3KQYA 3P9KA 5FADA 4E70A 2EFJA 2XYQA 1T43A 1XDUA 4GC5A 3ANXA 1KIAA 3PTAA 2CWWA 3KPVA 5DSXA 2QM3A 3TKYA 3BT7A 4PYKA 2XBMA 3FPGA 3THSA 1D2HA 4OQDA 3T0IA 4C06A 2VS1A 2YVLA 3TFWA 1YZ3A 3AXSA 2ZCJA 4QPPA 3TKAA 1AQJA 2PGXA 1JG4A 4IWNA 4K6MA 4QVKA 4O29A 4RTSA 2ZZKA 4HG2A 5E1OA 5LQJA 1INLA 5EHGA 4QDKA 2HWKA 2OBFA 3DOUA 3M6WA 3SMQA 2QE6A 4PCLA 4EMSA 3LL7A 3DXXA 2DULA 4QPNA 1M6EX 5FQNA 3BUSA 4R8SA 2HR1A 4QVGA 4U7PB 4YUZA 5K09A 3SSNA 4PYNA 4BP1A 4RTNA 2QYOA 2F8LA 1ZKDA 4ER3A 1AV6A 3P71T 4X41A 3K6RA 3B3JA 3ELUA 4IKPA 2I62A 4X1OA 3IYLW 5DTMA 5FQOA 1XJ5A 1HMYA 1XTPA 3A7EA 3KR2A 4LG1A 3HCAA 3MCZA 2AN3A 3CKKA 1AF7A 4M37A 2ZIEA 3GNLA 1MHTA 1M0EA 2VDUE 2GH1A 2N47A 4RTLA 4AX8A 2ZWAA 4POOA 5K0CA 1YF3A 2FHPA 2P35A 2XYVA 3I64A 3Q87B 1JG2A 4FR0A 2HMYB 3EVZA 2NXCA 2ZBPA 1DCTA 5BXYA 4KW7A 2AOVA 5FTWA 3M4XA 5K05A 2GAFA 3EGEA 5CUQA 2C7PA 2IDJA 2PXCA 3VC2A 5EMKA 8MHTA 4HH4A 5KQRA 4R6XA 3IV6A 3P97A 1YFJA 5FWAA 2P3QA 3GRZA 3L8DA 4FT2A 4F84A 5GOZA 5JUWA 3FTDA 5LSAA 1I9GA 5ERGB 2B2CA 5EVJA 5IKMA 1G8SA 2ZWVA 1O9GA 2AVNA 2LD4A 2PSSA 1R74A 3JWHA 4FT4A 5EIFA 3HVKA 5U4XA 3B5IA 5LQCA 3G5LA 2BH2A 3V97A 2ESRA 2PWPA 4BP3A 5HIMA 2WA1A 2CMHA 4IV8A 5FHRA 5GM2A 4DZRA 1ZGAA 4KIGA 1YB2A 1ZQ9A 3BGVA 4RVGA 4P7JA 2IIPA 2P1DA 4GOND 2BR5A 2WA2A 5GINE 2ZVJA 4KRGA 3LKDA 3V8VA 2ORED 2I6GA 5P8WA 4PYIA 1RI5A 5T6BA 1R8XA 5B1SA 3P2EA 5CCXA 3NW9A 2IH5A 2ADMA 4DMGA 2PVCA 3NDJA 4RSRA 5C1IA 4CXMA 7MHTA 4ER0A 3LGAA 2K4MA 3O7WA 5DSTA 5FA5A 4ER5A 1RI2A 3DLIA 2AOUA 3M6UA 4QQNA 5DRYA 2I9KA 5EG5A 1D2CA 4P7GA 5T64A 3BGIA 4FGZA 3UFBA 1YUBA 2FPOA 3JWIA 2PX8A 5BW4A 2PX5A 1H1DA 1YZHA 1KR5A 2AOUB 2ZZNA 3MCTA 4PONA 5EOVA 3PB3A 4E2XA 3HVIA 4YUVA 1WY7A 2IPXA 1VPTA 1I4WA 5GWXA 3E8SA 3G88A 4MHTA 4GUAA 2IBTA 1DL5A 1WXWA 3E05A 3EVDA 3G89A 3HEMA 3UJ7A 5GP1A 1L3BA 1L1EA 4KDRA 1ORIA 1R18A 1NV8A 4WVLA 1FP2A 4C03A 1Z3CA 2FYTA 1O9HA 3EVCA 3M6VA 3NWBA 2ZULA 3KQWA 4PCAA 5CIYA 1VQ1A 4OA5A 5K0GA 3REOA 2EJUA 3UJ8A 3TPZA 2P7IA 2JJQA 2NXEA 5CVEA 5DX1A 3BWMA 3S68A 3FTFA 1FJXA 3TRKA 1OR8A 3IEIA 3G7UA 3M33A 3EVAA 4MTLA 3GO4A 1FBNA 4EKGA 5GIPE 1EG2A 2GPYA 2A14A 3SM3A 4YUXA 5GIOE 1NBHA 2ONYA 1VLMA 4GOLD 3GRRA 4PYJA 5K0BA 1XCLA 2IH4A 5DM4A 3G8BA 3A4TA 1X1CA 3R0QA 4U7TB 2C7OA 4KWCA 4RTJA 2XVMA 3ELWA 3KQVA 10MHA 3DULA 1SUSA 2AVDA 2VP3A 5HOQA 3EVEA 2H11A 1Y8CA 4PYMA 2PJDA 3DMHA 4PGGA 1M6YA 2FK8A 3M70A 4A6DA 1BKYA 1TPYA 5FULA 2HV9A 4LWPA 5EKUA 3UJDA 3OU2A 5DLYA 3EGIA 5HEKA 3RODA 5EMLA 3FRIA 3P2IA 4M36A 5KS2A 1ZGJA 3FYCA 4HC4A 3PLAE 4CTKA 3ER8A 2OZVA 2ZFUA 1VL5A 5EKXA 5HFJA 3DMGA 5F2OA 4RTRA 5EIWA 4HGYA 5EZSA 1KXZA 2P41A 1JR4A 1HNNA 4HTFA 3HA3A 5EMMA 5K0NA 1NW8A 4RV9A 5ICGA 3HNRA 5G02A 9MHTA 1EAMA 1XVAA 3DR5A 3ELYA 3BKWA 3O4FA 4R05A 5FCDA 2C7RA 2GA9A 4EKIA 3SVZA 1UIRA 2IDKA 4GF5A 3KR0A 1JSZA 5FUBA 1UFKA 2PT9A 3MGGA 4FSXA 4X61A 3ORHA 1RJDA 2PX2A 2OKCA 4DM3A 4AZSA 1VP3A 3EVBA 4RVHA 1JSXA 2EG5A 3HVJA 3KQTA 1O54A 4UOEA 3E23A 4RTKA 3KR1A 3KQOA 2UYQA 5BP7A 3THRA 3SX0A 2WK1A 3HM2A 1RI1A 5CVJA 3R9XB 3T7RA 2C7QA 3CJRA 1I1NA 1UWVA 3NVMB 3OZSA 2XVAA 3HCEA 3PT9A 5E2BA 4RVDA 3C6MA 3EGVA 3UBTA 2R6ZA 4AUKA 3LDGA 5T67A 3HTXA 3FPFA 1WS6A 2V7EA 3AXTA 4WXHA 2OY0A 1L3CA 2R3SA 2Z6AA 4ER6A 4C05A 2BR4A 4ATNA 5HIKA 5LQRA 3GIWA 4DKJA 1RJGA 3KPJA 4CTJA 1VP9A 4AZTA 3G2OA 3UA4A 3PS9A 3MAGA 1N2XA 3GRUA 3TQSA 4XUCA 3BXOA 3MB5A 5ICFA 1QAOA 4E30A 4PINA 2I7CA 4E33A 2PV0A
chains in the Genus database with same CATH superfamily
1OLSA 1PDVA 4LYYA 4TN1A 1P45A 3QBVA 4YRMA 3DKVA 2FWNA 4D4HA 2XITA 5DBFA 3NJRA 1NXWA 1DIAA 1YVUA 1XTKA 2YRFA 3A32A 3ZK7A 3OZDA 2ZJ0A 1DFIA 3KAQA 4XE5A 5EJ9A 1VJCA 4MVJF 2YFYA 4P4UA 4YNBA 1L4KA 5F5LA 4I5FA 1LX6A 3QOPA 2NLOA 1IOVA 1VB3A 2WQZA 4LKRA 4L72A 1DGRM 2D2XA 4OBXA 3VPFA 4PHCA 4IXAA 5TXGA 2VYQA 1WUIS 2B36A 1R64A 4L7VA 3UB4A 2GOYA 2P2GA 4PIPA 4AWBA 4ZA2A 4BMVA 5AVKA 5ALLA 3D6UA 4RBNA 2FZEA 3IAS1 3ND9A 4BQOA 1T2UA 4FD2A 4R8LA 2XKKA 1X1BA 4OWRB 2DPUA 3QUAA 3RASA 3ZQGA 3ONDA 3GF2A 1CFJA 2AS5F 1VFNA 2NNLD 2NT3A 3BMCB 3KYJB 3BB4A 3I6ZA 4D0SA 3K70B 4JC0A 3N39C 4DFDA 1MV5A 4UUSB 2IXAA 1Q0SA 2VXDA 1GPNA 1Q5PA 4JA2A 3D8UA 1ZZEA 3A1YA 3WK5A 3RADC 4XICA 3SXPA 2A67A 1RE1A 4QBIA 2BMEA 3ADPA 2X13A 1XKLA 3KAKA 4LG0B 3HGGA 1SQSA 4IJMA 2L7FP 3OMLA 2A07F 3RUFA 4QG7A 4L9JA 1W4BA 3U26A 5CFNA 3FX2A 2UUBB 1QFMA 4NONA 3RTBA 2PRKA 1ULSA 2PUVA 3LNQA 4L3WA 4RHFA 1ZHFA 3KWFA 3RHZA 4RHXA 3TOSA 4HSTA 2PMKA 2IHUA 4G1EB 1XK7A 4WK8F 2R1TA 1NE2A 3FXOA 3M1IA 5LVAA 1USTA 3GTQJ 2B3TA 2W43A 2E2JJ 3SNHA 3I55I 4RGVA 4FNOA 3BR5A 1ADGA 1QYIA 3KKPA 2ZI6A 1FJLA 4HRIA 1AGPA 1QHSA 3C6YA 3MMPA 1KJIA 3AG6A 4I1SA 5HILA 4KT5C 1HI9A 1RKTA 3OLXA 3EQLF 4LB6B 4QUDA 4XD7D 3R7FA 4AVPA 1EM8A 1SKUA 5JDIA 3MM4A 2FQ3A 4LGVA 4ZVLA 421PA 1RWNA 5HTOA 3L49A 1QYDA 1T6YA 2QAGC 3MGAA 5EYPB 2ZZNA 4UY8I 3VC1A 2I0FA 3RIEA 1QJ4A 4TL6A 2CNKA 2D1VA 2WWFA 3DDOA 5IC6A 3T5CA 3C2GA 1OYYA 2K9LA 2EF0A 4OQZA 5FKKA 2FJ0A 2JLCA 2JSCA 2RK6A 4EG0A 2G6TA 4BY7J 2VOPA 4FEGA 3H0DA 2GKOA 4BZWA 3M4NA 4DZZA 1SANA 3Q41A 4YLYA 1OU4A 7AT1A 1DGQA 1CVRA 4MUHA 3ZQHA 2FFBA 3FGPA 1VMKA 3KTFA 3VYVA 2L9SA 4YFKF 1V48A 1FT9A 2B8JA 2QHXA 3KFXA 1Z0KA 3PBKA 4NOMA 5EPUA 3SEFA 3FK7A 2O2HA 3WKDA 4EBBA 4UXHA 1XB4A 5K3FB 4DCUA 3F2VA 2P7HA 1MT0A 3VAYA 1GFIA 1TCCA 1P7VA 2P6OA 1NR5A 1JIQA 1TUEA 4MS3B 1N2SA 3OIWA 5FLXA 1NWCA 3JAMA 3CXUA 4QYWA 4K2EA 1W44A 3BFVA 3T3PB 2JJMA 1V7ZA 2KHZA 1XZHA 4RD1A 3FCEA 4F2PA 1NBAA 1LU9A 1ZVMA 1D1BA 4A93J 1L4YA 1A36A 1ZOSA 1QBGA 2QP4A 1NUQA 2QTTA 1JQAA 4GPBA 5TQ2A 1Z75A 3M5PA 3TLEA 1BI2A 3IMGA 4FYKA 4DQ0A 5CM8B 3ZJYA 2D2IA 2PZFA 2VJCA 4XQFA 3HOZJ 2BFBB 5EP3A 4Z54A 1T29A 1W85B 3PDCA 4BO7A 3M9WA 4KSYA 4DAOA 1H2EA 4D4MA 1IRXA 5F12A 1GLGA 1A5ZA 1T8PA 2MOKA 5FWDA 2WPDA 1OXBB 1D6JA 1VLLA 3ELDA 2HLHA 1Z5NA 2MU1A 1KDZA 4KLAA 1WKMA 2OJED 2IHTA 1K5GA 2EX0A 3R2JA 1CQXA 1G18A 5HUQA 4PLYA 4WXCA 4MV6A 1N8TA 2VP2A 3DD1A 2BKXA 5TIIA 1XDSA 2HAEA 1KPGA 1SEPA 3ZWQA 3EY4A 2II6A 3MJSA 4MVYA 2R6CA 1J6UA 4HLNA 1FQWA 3AF4A 2M8EA 2PXXA 3Q5GA 4A3GJ 3LDFA 1YJWI 2EBIA 2W85A 1M8GA 2HM7A 1EXNA 3D81A 3N3AC 4JWTA 5BR8B 2UYCA 2NV0A 2CKMA 1Z18A 2RV8A 2QMQA 3UCFA 1PGJA 2PZBA 3ZCXA 4B2IA 3SC4A 1GFWA 1YCDA 2GF9A 4YMWA 5KOHA 1XXLA 5BSEA 4NPCA 3JRGA 2O2DA 3ROPA 1REPC 4EJTA 1XRLA 4FNGA 3SJBA 4AD8A 2ODWA 3JQCA 2D62A 3GLIA 1RYHA 5ABPA 3GOHA 4I14A 2L4MA 1YL6A 5I47A 3C85A 4QQ8A 1XJCA 3GRFA 1OILA 4IGAA 4IS2A 2MYTA 2VJAA 1RE0A 1TQ6A 4R7TA 2Z2IA 5CH8A 5T8KA 1XCVA 3U31A 5A1TA 1U8TA 1RM4A 2HJHA 2VDMB 3UC9A 2P5LC 3WGYA 2JDIA 1EFVB 4AL4A 1OASA 2VQDA 2AFRA 1UR5A 3OM1A 5F2NA 3AUSA 1MJ9A 2BXYA 2QBYA 2JD1A 4LZLA 1RAFA 4BHBA 1QUFA 3AUJB 4RGYA 1JA1A 4LB5A 5HCNA 1GPJA 2H2FA 2X9LA 2HKOA 4IQGA 1CQIB 5MHTA 5DRTA 1W0CA 1J59A 1BHO1 2X8BA 4G2NA 2CEAA 3NZEA 3BMOA 3MRVA 1AGNA 3PJFA 4JVOA 1Y9JA 3FRJA 3QPDA 3MLAA 3V1LA 2QAGB 3DZFA 2F59A 2JGRA 2RGYA 2WJJA 5KYVA 1XZLA 3RTGA 4AQDA 1HNXB 1YTLA 4H1UA 1YQ9A 5HZHA 1XTVA 2X41A 2VCEA 3EOBI 1O94A 1QOQB 2ZS9A 2A0WA 3I9FA 3G9QA 3I0TA 2VP4A 1SCDA 4N8SA 5G4LA 5IAKA 3VVLA 4DF3A 4EJMA 5ALNA 1T91A 3VNSA 5ESXA 1TJYA 1S4QA 3CPJB 4LDNA 4NNPA 4QQFA 3P9IA 1SN7A 2X4IA 2CD9A 4M8IA 3Q4GA 1F4LA 4Q7JB 1L4UA 3T6KA 3ZV6A 2IY9A 1ZDMA 2L17A 4FIDA 3VRHA 2AJDA 3QBJA 4DSTA 1LLFA 1E6EA 5LOVB 4DSAA 1M2VB 5C0OE 4C08A 5JBNA 1U9YA 2XPWA 2BIFA 2W6CX 2UXDB 2BWJA 3GJRA 3OYJA 3NUQA 3UH0A 1AC5A 1GILA 1M2OB 1YLFA 2JCXA 4CMHA 4KXWA 4JR1A 5EJGA 1X1SA 5SY6A 3GP3A 2R6DA 5K8UA 3KQUA 1DCKA 4RX1A 2Q3JA 4B45A 4KXFB 3BSYA 3FUVA 3CURA 4GLOA 3JAMK 1U8BA 4RA6B 2BYTA 5EMJA 3AVWA 1ACLA 3KP6A 3FB1A 4KYVA 3Q7EA 4HYEA 1XDBA 2UAGA 2X77A 3ZU4A 2HWVA 3PC3A 5BN4A 2DB3A 4UJ5A 3CESA 2NO4A 1T9KA 2D54A 5IKOA 3EYAA 4D6YA 5J40A 5CQEA 2RI1A 1J21A 3BKXA 1II0A 3DCNA 2HZBA 3GWZA 4TLEA 3ZS9A 5L6MB 4Q93A 1HE8B 1SOMA 5CXSA 1E2NA 1UMCB 2VDRB 4Y2VA 3FISA 2E34A 2NU8A 2GEUA 3FZGA 3Q7PA 4M3NA 2GAOA 1Z3YA 3RQ4A 2C1XA 4AQ7A 1U0JA 3G85A 3QAHA 4RVOA 2GZ2A 3OIPA 2WSIA 4P1WA 1R0RE 3D3KA 1MJBA 2D1YA 1W49A 3K8OE 3L82B 1UJ5A 4GC5A 3PQ6A 4D5EA 5LXTA 3TKYA 1PX2A 1W9HA 4XLNF 4S1VA 1G19A 1CUXA 4M8SA 5J5VA 2GNPA 5KJCA 3IQZA 1TFRA 4I4NA 2JLWA 1IUPA 1DDGA 2QR2A 4BJ5C 1PZFA 3QW4B 1UKEA 1JHRA 3TUJC 1AK1A 2HYIC 1T2DA 4PDKA 3ZHVA 2CXQA 5JQGB 2ORYA 4JLMA 1ORVA 3JREA 1DJQA 4NEQA 3ED5A 1M54A 3IMKA 4NBUA 3OQMA 2BVLA 3SDZA 4X1YB 1ECJA 4P1ZA 1ZSVA 5KTKA 3D6VA 2EV0A 1M5RA 5F78A 1EVYA 2GGSA 1E2UA 2NTYC 2YMQA 3GA5A 4NC6A 2VWQA 3STWA 1ISFA 3CQ9A 3L8EA 3F49S 4QHSA 2OC4A 3V1UA 4QUIA 5EMNA 2QT0A 1B0UA 3FWZA 1A8QA 5BWCA 5JASA 2VT3A 2WG1A 4F4HA 2QEXI 4GXOA 3HYSA 1MABB 3K0KA 2HGCA 1NXVA 1F8UA 4GMDA 5TMEA 3SYLA 1AUOA 1YJXA 4AUNA 4CMEA 1XTPA 3UVEA 1NNI1 1PQYA 2FUCA 3CCBA 4FFPA 4FFRA 2YN4A 2UZ4A 2IEAA 4BNFA 4E7KA 2RAPA 2GH1A 4XAQA 3EMVA 1U2WA 1KIFA 3OR2C 2EKZA 2FHPA 4LHXA 4EELA 5ARBA 2PCJA 3AR4A 4ZEXA 1ZVKA 2XUPA 5J59A 5JS8A 1QCYA 2ZXHA 1ADCA 1Z0SA 2FPXA 2I3GA 3IIKA 3KO8A 4U7GA 2H5JA 3LSIA 4D9MA 1Q21A 3J7TA 3NASA 4URZR 2FF7A 1G6NA 1UXGA 2GAFA 1I7DA 5EE5B 4KODA 2KB0A 3OPYA 4N01A 2KQRA 3RIXA 2TDXA 2M6RA 2WIBA 3RWMB 4MUGA 5GVSA 4KK3A 3U60B 1KORA 4WKPA 1SWVA 4GOJA 4L5AA 3HBFA 1JALA 2Q8QA 2L82A 4KUMA 5IKXA 5A9SB 3R9WA 4Y6PA 2D8AA 1J0EA 2BZ0A 3GMEA 3EXAA 1OIVA 4JUAA 4RDXA 1ZK8A 2P11A 4COOA 2MYPA 3L06A 4J43A 4Z9AA 4M9SA 1RPNA 5LQCA 2ZGVA 3JQEA 1XIVA 4FYPA 3LHIA 5FWXB 2DYSH 3I32A 2XMGA 2X6TA 1XNRB 2GX6A 3DZBA 3LUDA 1GD1O 5B4UA 1N5JA 1QOPB 1U7OA 1ECBA 5CJ2A 2EWWA 3G0OA 1LFAA 1H66A 1L7QA 5T57A 2QE7A 3E3AA 3GGSA 3TVYA 1O96A 2FFHA 4HQOA 3GEPA 2VPLA 1L5HA 3DOOA 3LBNA 3QXGA 2ZWIA 4BGEA 1E0AA 1R4MB 3D7NA 3DA8A 3B3AA 4FHZA 3MN1A 3ZGNA 1K88A 1M0WA 4LZPA 4HX4A 1FTQA 3O0TA 3W2EA 2DH5A 3WE3A 5AW6A 5JAMA 4ZCSA 1ZWLA 2RHTA 1XZDA 3UGJA 3CZPA 5FRNA 3KB8A 4QQNA 2E7WA 2J0UB 2OV2A 2F1JA 1H94A 5CA0A 3CN9A 1EDOA 1I2MA 4GBMA 4QBFA 1TZLA 1M2GA 4MVWA 3TL4X 1KR5A 4PONA 1S3FA 5ITWA 2P2CA 5JLXA 3LI2A 4BQPA 5KJ1A 4KPEC 3LMKA 3QP9A 1DMRA 1CJBA 4LYGA 3E22A 2W93A 4GX0A 3IT1A 1ZNQO 1NW9B 4PQGA 3D2AA 3JQ7B 2BGIA 4J7XA 4HSEA 1V5FA 3DCFA 1ZRFA 2ACWA 5LLQA 4JHXA 1BRTA 1A4RA 1X1TA 1OV4A 3NWBA 3OQHA 3KQWA 1PBNA 5CIYA 2P6RA 3LSYA 3G2BA 3V1YA 4ZTZB 4X90A 4HF2A 4FCWA 5F0FA 4FPXA 2PNFA 1UB9A 1YZLA 1NI5A 3HI6A 4J6EA 5KYXA 4RZIA 3UJ8A 3L7LA 5T7BA 5HRUA 2UZ0A 4HHEA 1MTZA 4U2BA 2JA2A 2G7UA 1MMGA 2Y1FA 3DM9B 3L0IB 3M33A 3OOJA 1RBZA 1DKPA 3TXYA 1QHYA 1G6HA 1N0VC 5TPWB 4NI5A 3PWTA 4DLXA 1AZLA 3V6MA 1OQYA 3LA7A 3KXPA 5A05A 3VO8A 2P4UA 3IEXA 1LBTA 1EKEA 5EWMA 2IH4A 1GRNA 2ZUFA 4XOIA 1Y3FE 1NOKA 5FI3A 1QU2A 1R1VA 1YZTA 1D2MA 2V98A 2XUQA 1AXRA 3NTLA 4FGJA 2ZJ6A 2ZYVX 4LI0A 2Z57A 5AM5A 3YASA 4ETWA 3T1QA 1GZVA 4PLGA 2H4WA 3AEXA 4DRYA 1QS0B 3IPYA 1SCKA 1SIWA 4DDTA 1TIKA 4CL2A 1P4HA 3GEIA 4FZJA 4I99A 2QV7A 5KQPA 2DBYA 4RKEA 5GTDA 1IC6A 1F6DA 1T8SA 2VYVD 5HEKA 4MFDA 3FRIA 2M8GX 5AONA 3Q1LA 4LVNA 3GLLA 1DBIA 4JYBA 3WL4A 4BYGA 4AG5A 1FSGA 3PRYA 5A2QA 3OOHA 3SZMA 5L9AA 3A6PC 5K45A 3QLUC 2PPVA 5B58T 2QUFA 5J1YA 1MXHA 1QXSA 3A6KA 3L0YA 1SNYA 5EKXA 3ZDRA 7YASA 1FSPA 4PC1A 3HUGB 2E37A 4FDTA 1EFPB 3QU2A 4HGYA 5E2BA 5G0VA 5FPPA 4M9CA 1ADBA 2O8FA 4RV9A 1IZ8A 3PG5A 4C0JA 4C4TA 1YACA 3Q11A 4WE3A 4JB8A 2ZNYA 1AOXA 1JIKA 3MTAA 4IQFA 3R5TA 5FLKA 3OWTA 2CQQA 3L2RA 3FYTA 2JGMA 4R05A 4CNBA 5I01A 3ZLJA 1YZYA 1OVGA 2WZDA 1JSZA 1ZU4A 4GVPA 1ETYA 3F5SA 1YMQA 4LYDA 4DRZA 1VF9A 4ZVRA 3D5RC 3HB9A 1T2NA 3PX7A 1FB5A 1IBSA 1PUJA 3Q3VA 1NNUA 5CA1A 4W99A 4YPVA 2F1HA 2IQ5A 4KQWA 3RTEA 5DGHA 1H05A 1BJTA 2W6OA 5JU6A 1OB2A 1TEHA 1RQRA 2ZYRA 2I7TA 4YFVA 1JDJA 3QRFF 1XV5A 4QJ3A 1O7LA 5KVVA 2G88A 4RTKA 3AM5A 2MTBA 5BT9A 4KJXA 1E3LA 2YDYA 1QGUA 1LKXA 2D1RA 1TD9A 1VL2A 3SIPA 5JNTA 2NU9A 4LTNA 5CMLA 3KDSE 5C4JJ 4XWTA 5ALOA 1JU9A 1KSFX 4J16A 1Y8RA 4IVRA 1VG1A 4CQMD 2O9LA 1WJAA 2PUAA 1BHQ1 3BRWA 2E5FA 4MA4A 3LSMA 4IMRA 2ZMEA 3DEAA 4MUNA 1WUTA 1YB7A 2BKLA 2DYKA 4TUYB 3ZD9A 1D8JA 2YZ7A 2O5CA 1G3YA 1D5WA 1U0OC 3VNBA 4DIMA 2YMMA 1ODLA 3WWEA 2C0QA 4B6SA 5LFAA 3AVYA 5SZJA 3AXTA 2VKHA 2C57A 4PWZA 4TWJA 1EESA 2V9CA 4GPIB 1JSRA 3WB1A 5COBA 3EGDA 1X7HA 1FBTA 3PC8C 4CQLB 2RKWA 3K4JA 4Q4AB 4C6RA 1RYMA 2OD2A 3VU9A 5MF6A 1I33A 2BGRA 2DRIA 4OYRA 4QPJC 5JCOC 2EFQA 2ZSIA 3NT5A 4BMNA 3MB5A 4RXUA 4WGGA 1QQAA 4QGGA 3RUEA 1R0BA 3NAUA 1OC2A 1AQYA 4QDXA 3BT7A 1P1HA 1KYYA 2QD1A 3GJ7A 2Y1OA 4ZAVA 1CC1S 4HJXA 2IITA 2LTPA 3EASA 1YDGA 4RHUA 2G3YA 2PI0A 1FRZA 3GUHA 2DCMA 4UB8C 3N75A 3JZIA 3W1EA 5C2JB 4IEJA 3WO0A 3BCHA 3I9KA 4V2IA 4HEQA 3KU4A 3G82C 3CFYA 1XO1A 1XAGA 4JX4A 3PI7A 2Z9CA 1PRYA 3QMPA 4H7IA 4JYMA 3KEQA 1E9VA 3GUUA 3TLGA 4DQXA 4QFDA 2FZGA 3WLSA 4XKWA 1ODTC 1EGVB 1XZJA 3RBAA 4AZ3B 2BFOA 2MHCA 2XHEA 4CCMA 2X2EA 1TTYA 5AIAA 4EO4A 1TMGE 1W93A 1RCFA 3CVWA 3QV2A 2X6RA 1IQUA 1CZUA 3ZE0B 1GNTA 1YA6A 2EF1A 5AHWA 4PX3A 4RK5A 2IBDA 4XB1A 3AG3H 4U7FA 4LOKA 3HB7A 4RMGA 3DBIA 4YCLA 2CE7A 1H5UA 3O8QA 3ZQ4A 1OAAA 1P8AA 4TSFD 4WKCA 2WLTA 1LTHR 1FSZA 3MT7A 4OQPA 3FNRA 2XD4A 4F8JA 1THTA 2GK4A 4ZVKA 3SSAA 4HNSA 2FMKA 1B26A 4ZRMA 5EQDA 1CRZA 1YA8A 2DH6A 3BFPA 4LDAA 4RL4A 1GNPA 1U1CA 4AIIA 5I3CA 3Q9SA 2FMXA 4PO8A 4ACAA 1RWWA 3FPHA 1D5YA 3QX8A 4QBGB 2Q5IA 8ATCA 1MQSA 2JIRA 3TGWA 3M3HA 2PSDA 1OWMA 1UPCA 3ZUPA 3GDHA 2YFQA 5HF9A 1DUSA 3EMBA 5E3LA 1R0KA 5CM9C 2P9QA 1JDPA 3AO0B 3V7RA 1SIUA 1TQ8A 3D0OA 3N7TA 5FORA 1TTTA 3GAMA 1KEKA 4B3MB 1O6FA 2C1ZA 1X3ZB 1W7PB 3EIXA 3A6LA 1GYQA 4OGKA 4IH4A 4Q9JA 2LBPA 4LFUA 3F9RA 4NV0A 2CWEA 1TW2A 1HZZA 3GBPA 3H19A 1EUCB 4JKIA 3WZLA 5AJXA 3AVVA 4X3PA 1GGEA 2W5UA 4D56A 3PFKA 5HQ3B 3UUEA 1A04A 2YXEA 2H0RA 3FUWA 2FSSA 4G36A 5AJZA 3O75A 1UM9B 2Y31A 2HV8A 1JKIA 2F2TA 5CDFE 5JY6A 3AUKA 1E98A 2YXNA 4UBOA 4MW4A 2IZ5A 4R01A 3DKXA 1KDRA 4B81A 4JLUA 1QTIA 4QIHA 3AFOA 3RUIA 3MJVA 3EMDA 4FFVA 4I4TF 4DR7B 2F8MA 2HQ5A 2XY4A 2VBIA 5D3KA 2YJ4A 3VPAA 5IMSA 4KPFC 1LDJA 3DEIA 2EERA 1YZKA 2KIMA 4E51A 2ZSAA 2DT5A 1RIFA 4Q3LA 2HW8A 3U4AA 2I4NA 2EZIA 1KY4A 5LDGA 2CVHA 2B69A 5AWFC 3R9KA 1H2HA 1XZ8A 1JAXA 2HSZA 1NA5A 1M0TA 2GF2A 1OXSC 1ULYA 2IJGX 2HYJA 2NAFA 2Q45A 3IAEA 2I10A 1JT6A 2C4WA 3A27A 3O2NA 3ONFA 5L95A 5U9CA 4LWOA 5ILUA 4HATA 1ETUA 1A8HA 5J1SB 3KYCA 1WV1A 3QYPA 4PAMA 1YBAA 1ZGBA 2VPWA 4QRHA 5M5YJ 2XKPA 2VKEA 1SOUA 2QTBA 3I3SR 4F4JA 5L7WA 5IN4A 1RS0A 3ML1A 2RAUA 4K6FA 3BMNA 4HVAA 1SELA 2HO5A 4OQEA 4QYIA 3R7LA 4CG1A 5FBHA 2QNBA 1PNVA 1ZH0A 4KUEA 5J9FA 3ETNA 3RK0A 1SUAA 2ON6A 4RS4A 4B6QA 4KHPB 2RCNA 5BNGA 1E77A 5EIOA 1HW1A 3MUNA 4UPEA 3AB8A 3S5UA 2OHVA 4BBPA 3OTGA 3RYIA 2AKYA 2C88A 3BVPA 1XKXA 5HIIA 3V3TA 4X60A 1GXQA 2O8CA 3MB8A 2QROA 1KYXA 4ZOAA 5KQMA 5B5SA 3DPTA 4DJ5X 2VDPB 2R79A 1O6BA 5DX8A 3IB3A 3A25A 3I0MA 1Z0JA 3B52X 3QXSA 4KQKA 4KHZA 1E18A 5BR7A 4KREA 4BL5A 1G20A 4BV9A 3BFKA 5A4KA 3D5LA 3R74A 1U8AA 1LLDA 1LBSA 3M3DA 3HPRA 3ET5A 5ER6A 3RPUA 4FHTA 1F17A 1VQ9I 1T34A 2C7GA 1QP7A 2IS6A 2LDUA 4XYGA 1P4GA 5KDLA 4PRKA 2Z43A 4JLJA 5CLHA 5F5XA 3S40A 3QX3A 5B1BH 1OV6A 1O2DA 2B3DA 4KE7A 1XMQB 4EF6A 4E15A 1WL8A 2P67A 4XQEA 2CLFB 1FPQA 1YJ9I 1NQTA 3FUUA 4GAEA 2VI6A 1T9AA 2Y0BA 1QGPA 4G84A 3S3MA 4BTLA 4C4AA 4AKHA 1WMDA 4F9EA 4NXNB 4L18B 2HNKA 3OIDA 4RS8A 5LXTB 1T36A 4QXAA 3FUCA 4FFMA 2BDEA 1AWCA 4HX2A 1I5EA 2ZAMA 5CK5A 5DP2A 1D2AA 1H1TA 3K7EA 2ERXA 1Y4ZA 1K8QA 2LIPA 4OB6A 1G3RA 3CF4G 1R8YA 5TSDA 3VB2A 2APJA 3JSPA 1E9BA 2K87A 3OETA 3CF5F 3FI9A 4JVMA 4Y1RA 4EFKA 2ZR8A 5ENDA 4YONB 3HU5A 5B57C 2OCIA 2VJOA 2Z3WA 4B09A 4MW9A 3FPEA 1SFUA 1CUUA 1NUPA 1VXRA 3OCZA 1IIBA 4RSMA 4WZAE 2JSPA 1P5JA 4B75A 4EHKA 4EJ0A 4KSCA 4OHFA 2QD3A 1MIOA 4BMOB 2O0MA 2WD8A 4XONA 4NU6A 1DT3A 4C2BA 5K1YA 1BHSA 3TOCA 5DB4A 5DGTA 2VJMB 5AVTA 1MV8A 4BP8A 4F3NA 1A9QA 3G68A 2B7LA 3IB6A 3IILA 2OCDA 5SZHB 4FE3A 5EGNA 1CQIA 1W85A 5EWJA 5TB5A 4LOAA 2ZBFA 1PDWA 2RH9B 3RAPR 3LSHA 1TEZA 3UUFA 4F93B 5CLLA 3WHKA 2XTNA 4COKA 1JV2B 4KZPA 3K31A 3BWEA 1V3QE 3D4NA 2IQIA 4M38A 5JTTA 1RLMA 2WE8A 1LJUA 1N6PA 1BE8A 3ADBA 2AXQA 3VZRA 1PS9A 1ZM2A 3JALB 3G0HA 4KYIB 1JIJA 1R7JA 1RQGA 1V6SA 1SEVA 2MJLA 1XTBA 3ENVA 2Z16A 4I9HA 1OZ0A 3W2GA 4CIYA 1E4VA 2QLMA 2DI3A 4U1RA 4D8TA 4JROA 1BC5A 2UU9B 5K3SA 1Q7EA 5KSWB 2DR3A 4G2TA 5K0FA 1H9AA 2F67A 1SD5A 1SVWA 1ZI8A 3LCVB 1ST2A 4KZKA 3ZJTA 2EV5A 3ND8A 4QWWA 1CUWA 1B8IB 2FJUA 4UNQA 1BN6A 2NVQJ 2QMYA 3QPUA 1Y42X 4RIGA 3IURA 2RE8A 1KK3A 4K3VA 3OHPA 1P2BA 4FYJA 4Z9YA 4LS3A 1P5RA 2YCLA 4L4XA 2WKSA 3MWGA 4BIIA 5AT1A 4ZMBA 3WRYA 3OA2A 4K8OA 2GYUA 3UFXA 4QPZA 4WINA 3VDRA 2G7HA 2BTQA 4WJLA 2XPCA 1CU1A 2HCFA 5AIPA 4MQEA 1A88A 1GPLA 1AN0A 3KL4A 3DYVA 5JYCA 1Z38A 3ZDQA 4FVTA 3JQ9C 3PX2A 4OJTA 3WG9A 3CVOA 1A9PA 2PKEA 3P2JA 3QE4A 4Y7DA 5B37A 3B36A 2BEWA 1BDIA 2WD7A 3UA3A 4BDTA 4DIBA 3JWJA 4L22A 1S6LA 2OPBA 4WX9A 1GL6A 2P0AA 3W5DA 4BBSJ 3HJTA 1LK5A 3UV3A 4R8RA 2I5PO 3B60A 3HB1A 3EAGA 1RJFA 1XSEA 3P9KA 3HUUA 1TYEB 3PC6A 3ZJ4A 2WY7Q 1ESZA 4OUDA 4QARA 2HMVA 4A0FA 5JVDA 3I4LA 4MB2A 4CXFA 3AH8A 3MJHA 5A62A 4B7ZA 5K3EA 3ZWNA 5G1NA 3LFUA 5JANA 5MN4A 2P9FA 4OQDA 3A36A 3GRPA 4D74A 1NZDA 4DR5B 3LLCA 2LZ0A 5M5WJ 2FZWA 3DV0B 4GWGA 3RVPA 2UUPA 1AQJA 1QGAA 1JG4A 1H4SA 2IYZA 2Q9AA 2OZ6A 1WCIB 4L8VA 2P9HA 4K26A 3KSRA 4QDKA 1MENA 4CLRA 1DDNA 4EF4A 3SNKA 2KT0A 1JECA 3NBUA 5JARA 4XWYA 4B8YA 2HSWA 4YQFA 1JPNA 5FBLB 4DLUA 1JQLB 4O1MA 1SO8A 1SFXA 4BNXA 2XIJA 3O4JA 3OZXA 1XDDA 4DUYB 5C81A 2XCOA 1UBOS 1VRCA 2VDNB 4UNOA 8ABPA 3T1BA 2X8JA 4EUHA 2XA2A 2OFWA 2IZZA 2VT2A 5F64A 1GAEO 4LC1A 3W3AD 1RZVA 4ZVVA 1MH3A 4WBNB 2CNWA 3CF0A 2BEVA 4RTLA 4HBGA 2IDZA 2DA4A 4RMIA 2BZSA 2DHCA 2QN8A 2JASA 3ON5A 5JMOA 5EFOA 3FCOA 4IINA 3G7SA 2NOJB 2UWMA 3P2MA 4NOLA 3FDZA 3CCSI 4K3UA 4OHRA 3MAJA 3RSZA 2Q4OA 1YFKA 2ZBPA 3AT1A 5HFNA 4AY4A 2M9MA 5IJXA 1G17A 4B47A 1UOOA 3CJQB 2QN1A 3AF3A 1TLLA 2GBGA 3PVSA 4U5XA 2M5WA 4YVFA 3P97A 1SBCA 2E55A 2HTFA 2GIZA 1MH4A 1K89A 4V2GA 1NVMB 1O95D 3E7WA 3LRXA 1W4AA 2PRIA 4TMWA 1UL1X 4AO6A 4BVAA 4IDCA 4UUBA 4NP6A 3UQYS 2KMLA 2ZWVA 4BXUA 2DA7A 3E9RA 5D3MA 1I3AA 4XKVA 5K5RA 1PQ4A 4YP1A 1E60A 1G5TA 2GIVA 3WG7H 2P2DA 1Z5OA 1Z4OA 1LDBA 1VYHA 1K6JA 2JFHA 2PYIA 4L15A 1T0FC 1Q7CA 1K5PA 1TQ2A 3AJEA 3HB5X 3JZMA 4ZK2A 1S7CA 3M8EA 2P2NA 5IT4A 3U3XA 3E5XA 4E5PA 3KLBA 2JVHA 4LJKA 3VHXA 2CEKA 1W4RA 2CNLA 2AZMA 3BD8A 4QGFA 4NBRA 4ODIA 2XYHA 5JSFA 1WHUA 2C98A 1MVLA 1TO6A 4DA6A 2Z2XA 2PWBA 2VJJA 2VPPA 1O3TA 3VSAA 1GPWB 4CI9A 1VQPI 2AJCA 4UM9B 2VRWA 3R23A 1Z3XA 1R1DA 2KSQA 3OTQA 3UMVA 5K2OA 3C3KA 2IKQA 1B00A 2TRSB 3K5HA 4DMGA 1X0XA 2WIKA 4LYFA 1LZKA 4UTVA 2KHMA 521PA 2K4MA 3QNWA 4IUYA 4KI7A 4ENJA 1ZHHA 4A36A 3A31A 1J4AA 1X6VA 3D54D 2I22A 2LYCA 4HZIA 3RC1A 3TX2A 3G71I 2R2AA 3QP6A 1U2RA 5IJ0A 1KK2A 3MCWA 4GMHA 3QWBA 5JIBA 1V9CA 3OOYA 5CD9A 1U5BB 1Z0ZA 3NTUA 4QGHA 3BHIA 4QXQA 4NC7A 3MCTA 4WOKA 4A5MA 2H9IA 4NMHA 5EOVA 2DPLA 4E2XA 1UWCA 5J4HA 1XD9A 1CR1A 2WAEA 1WJCA 3ONQA 1NN1A 2I2CA 4KLRA 4BC0A 4EI9A 4HV4A 4XLHA 1LB1B 4FT8A 3JYQA 1KYTA 3H11B 3IEPA 2RHDA 4PZ0A 4MHTA 2OCLA 5TPZD 1E99A 5KKCA 3DO8A 1ZRDA 4OFBA 3VISA 1TOAA 1FYEA 5C4XJ 1USIA 1GL7A 4LXIA 2XWQA 4WK2B 1F5TA 3GRCA 4X97A 1YB4A 3GVIA 1VQ1A 1QHIA 4LZWA 1VCHA 2NPOA 3OUTA 3SP1A 3OTIA 3ZDEA 3EXHC 4N0EA 4HVCA 2OECA 2REQA 1L0OC 1E2LA 1T6XA 1TK2A 3WYGA 1TQ4A 4JP0A 3TAHA 2CLMB 3TRKA 5HKKD 1FJXA 3NEUA 3VFZA 4KA4A 5AKZA 4D0GA 2YHUA 5F5NA 3FHTA 4OF4A 2IYXA 2IP1A 4R3WA 2XT9A 4Z1OA 3W3AA 3B5JA 4B4CA 1LWNA 4JMLA 1MW7A 4UVDA 1CF2O 4G7OF 4A26A 4E21A 2IHNA 4HQMA 1R0WA 2YNMA 4B84A 2FR8C 3V8NA 2WHRA 5B53A 4MUFA 4EVRA 6PFKA 2PH1A 3ESRA 5GAJA 3NS7A 1LPAB 4F3TA 1XZEA 4HNHA 2PJZA 1RHKA 4PTZA 3ZHZA 5BMZA 4MUKA 3I8SA 3L2UA 4E11A 5K7ZA 1WTAA 4OHCA 5HK9A 2JCSA 1L5HB 2RQQA 5JO9A 4M0DA 1BKYA 3F8CA 3BXXA 4NY1A 1XEWY 1ZR4A 3MJTA 5IDVA 3ND5A 4MV7A 4RLFA 3DE1X 1ZGJA 4IG9A 4S0HB 5CT8A 4PRZA 4BFVA 1TE2A 2ZFUA 2BSQA 3IPLA 2ZJ5A 4N03A 4F8YA 4LF9B 1DLIA 3OZ7A 1XGNA 2JA8J 4LHSA 2GSDA 4R8VA 5DULA 2XZOA 3K09C 2X5JO 3MGCA 2IDMA 5B2ZA 2QRNA 4RGUA 3Q98A 3RYHA 1VXOA 3BSWA 1T4GA 2HJSA 3HNPA 5HFAA 2F1IA 1NI3A 3G2HA 4WLOA 3RC9A 1Z36A 1FCJA 4CKBB 3SC2B 5LMZA 3THXA 1R3UA 4RZXA 1S7EA 2KDOA 2WHYA 3KUDA 1I3OA 1YI0A 2O2CA 3L8HA 4NV3A 4O0MA 3ZWDA 4HT3B 2RKOA 3PCXA 4K0KB 1QQ5A 3G5MA 3IRUA 4R98A 5J63A 2G9NA 3V7WA 1TJPB 1D9ZA 2VDLB 1GIAA 2V9ZA 5H83A 2L54A 1JLHA 4KX5A 3AL0C 1J5XA 3AUYA 5J3JA 1ZUNA 3D3JA 3MGGA 1NUSA 3KBBA 4X61A 1Z6GA 3M2TA 2EV6A 1SOAA 2IOQA 2LRDA 4QPOA 2DPYA 5ENZA 2VK2A 4FXOA 5GPAA 1BXRA 2VNHA 2ZJBA 4A73A 1UAGA 3WTCA 2WQ6A 2HF7A 3A1UA 4JGBA 1IHPA 4MWDA 4AECA 2XQVA 4YCNA 5EUQB 1VJ5A 4OKIA 4MRMB 5BP7A 4QUEA 1DJPA 1E3SA 2H1LA 1GXSB 2YJ6A 4CM3A 1SC6A 4MR9A 4YRSA 2WJGA 1E2XA 5IZ4A 2Y0SA 3K4LA 4JBGA 5HBGA 4KQEA 4DHEA 1G2IA 4JR0A 3TB6A 3OZSA 1U0BB 3VJMA 4LMPA 3M3YJ 5KYTA 1T0JB 3EZ6A 3QJYA 2W2LD 3V2UA 2Q9CA 1DXYA 4M55A 1O5IA 3U3JA 2XH8A 4EMUA 2FGKA 2BHLA 3UAXA 4B33A 5AVYA 2JVGA 3KIPA 2R6ZA 2XGOA 3CRVA 4WXPA 3G8CA 4IIFA 1XRJA 3N9IA 1U9IC 4PPQA 4XH9B 5K1ZA 2DBRA 4ZYWA 1R1TA 5KB3A 5F04A 2B98A 3F8WA 4TN5A 2G04A 1I80A 1XLUA 4IMPA 3VNRA 4ER6A 2BR4A 4Q1AA 5B2FA 1G66A 4WHMA 5ER9A 4ENQA 1N57A 5BNIA 4DKJA 2UUAB 4QLCU 1L5OA 4I1UA 1YHQI 3I6BA 5BSWA 3DBHB 2OV4A 2WABA 1C7EA 4YRQA 1MA3A 1GAXA 3GJXC 2Y1CA 2D45A 3IUOA 3O82A 4EW3A 3VU9B 1Q95A 1P9WA 3GFIA 2VBCA 3BTOA 3GLHE 3N6RA 2O0YA 3P9YA 5CKTA 4GWLA 1DEHA 1K6XA 2PG3A 3HA7A 3BAZA 1QYVA 4KE6A 2GR9A 3QWAA 4ZODA 3DVLA 3OJFA 1U5TB 3AVUA 2Y1GA 2IIQA 1SBIA 2HRZA 4M54A 4DGSA 2JKVA 4JP3A 3J7AC 2BP7A 2YFHA 1A9XB 3FLAA 4WJKB 2GA2A 1GHTA 3IDFA 2HH9A 1E17A 1M0SA 1UFQA 3EUFA 2Q07A 3V7SA 5EQFA 3P2OA 3WSVA 1V55H 4YMUA 1E3WB 5IAEA 2N0SA 3HWWA 1C80A 1IEWA 4MIOA 1LVGA 2Q1TA 4MGYR 4N82A 4CTMA 5MFPA 3JR7A 3QUQA 4ALMA 3OOEA 4NXMB 3QMMA 3OZRA 3VPXA 4EHJA 1X3SA 2JFYA 3W0LB 1NKSA 3DZKA 1MC5A 2MT9A 4JQOA 1U7WA 2OXIA 4B7XA 3F47A 4EHDA 1EJ9A 4EY4A 3CCCA 5CIWA 4R2LA 3QY0A 4PYOA 3WWCA 3B3GA 2FF5A 4XM1A 5BYBA 5K0JA 1J22A 3OKAA 4JC8A 1NG6A 4Z4FA 1I1SA 3T7TA 1AGYA 2KW5A 4BMZA 2AA3A 2PKXA 1XQ1A 1GVDA 2RGEA 1H5QA 2HJRA 2EIKH 3IBCA 1EWKA 3JVEA 5FOWA 2WAFA 2HDNB 1KJ9A 3JVUA 5DIZA 1N4AA 2C94A 2FMIA 5B3LA 2YICA 3H5RA 3HSEA 1JHAA 2QG4A 2ZRCA 4XL9A 4QLOA 4UAUA 5ALVA 3GBSA 4BO5A 1H0KA 4QDJA 3KQSA 4R1LA 3E1KA 2WJ3A 4DIUA 4N3CA 1BU5A 2CZGA 3O93A 2YWGA 4PX2A 1FNCA 3WOVA 1WXXA 1NN0A 4JKYA 4N41A 1PS0A 4XCXA 2WB4A 1BX1A 2DHEA 5FIUA 2W70A 3FF4A 3FTEA 4NKRA 4CXMA 2JEYA 4WKBA 2CLIB 5FFMA 4DV0B 3OOWA 2QSYA 3GGPA 3K5IA 4Q4HA 5E6RA 1UBMS 3G2QA 4L4SA 2ZSIB 5I51A 4OI0A 5KTRA 3RG2A 5LD2B 1QIDA 1KMHA 4KMOA 1SRRA 1TD1A 5I9IA 3DMFA 3U81A 2Z6UA 4BVGA 3BE4A 3K92A 1DC7A 3F67A 1L4NA 5AXCA 1PR4A 3BTIA 4OJKA 3VYUB 2ZJPF 3GJYA 4CKCA 3BRQA 4E2FA 3HCBA 2RMKA 1HNZB 2O5EA 1BFKA 3JSAA 2BEOA 2GTIA 3UBMA 3WAGA 1BCRA 1SWWA 1G0NA 3DM5A 1J8DA 1UXOA 1Q3TA 1W30A 2C97A 4CG0A 5EPEA 1D2RA 4CM9A 4QOSA 1VM6A 2ODAA 3HXPA 2X1CA 1MX5A 3FB4A 3L0OA 3GXOA 5CNKA 4K7JA 5A5DA 3HCDA 1Z8HA 2EV9A 3T8TA 2V7TA 2PSFA 3QLVC 4HDOB 3KCCA 1YQAA 1DPUA 3BZBA 1SXGA 4NYIQ 1BM9A 1D7AA 4R6WA 2QGUA 2W2VA 2ZR7A 5HJ2A 3W5BA 2FAXA 2OO7A 4KMSA 2P2ZA 1A1SA 4V0NA 1JX6A 1VHTA 3AL2A 3SC2A 3T54A 3GLIB 1N7JA 1E0SA 2H2IA 1TPZA 4XKCA 5LRSA 4BLRA 4AY3A 3NMUF 1TX4B 5U1PA 2WMNB 3NC1C 3SEQA 1U6IA 2OXEA 4K9RA 1E3QA 3ORFA 4XQ0A 4A3JJ 3HUTA 1I6LA 3JQ8A 4V24A 1VZ2A 4CEJA 2B1RA 4PWYA 2VSQA 5E9JA 1FZQA 4ZQGA 2OVFA 2XNHA 1RFLA 4I1PA 2A69F 1A5TA 4EG6A 2GCOA 4B74A 3V1TC 3L7JA 1KC3A 2QUIA 3PL8A 4L2IA 1HDYA 2H4JA 1YOVA 4AJOA 4KAAA 4YJHA 3RBZA 3B82A 2G08A 5CH3A 1Z77A 1IJEA 1W2GA 1GTL1 3VYSB 1E92A 3HGTA 4O1IA 4WY2A 3MVPA 2O0LA 4TM8A 3ONWA 3ESQA 2ECBA 2CYCA 1D2GA 3EUEA 3ONNA 3Q5DA 2DWUA 4L8LA 5ELMA 4QHYA 3NUZA 3DXZA 3LWDA 3AK4A 1NYQA 4BIMA 1J39A 4DDKA 4F9TA 1TVEA 4L5BA 4I1IA 5EZGA 2XCUA 4WW0A 4E07A 4ZYEA 2E4AA 1DG3A 1WDWB 2G4VA 1L8AA 3O31A 5ALTA 1C1XA 1QFZA 3JYOA 2XWJI 4AJHA 4DPLA 3KEFA 1E79A 3WLLA 3B6AA 1L0BA 3C7CB 3W8NA 3TZCA 1VTKA 4AIKA 3L8ZA 1BOBA 4P83A 5IUJC 4REMA 1PSDA 4B4WA 4IVNA 4I1VA 1LS1A 1LLCA 3KQQA 3WGQA 4YALA 2C03A 2UXCB 4MMXB 3ZHCA 1I5RA 4MYRA 1X7ZA 4LRXA 3HM9A 3OPQA 3W8RA 4DSOA 1P2TA 1Y1WJ 1IV6A 3WFJA 3FF1A 2IZ6A 1Z7WA 2IXFA 5L3SA 1X1AA 2W00A 3ZCPA 2ZB3A 2H6BA 4HB4A 4KPUB 1U5TA 5I5EA 1FDOA 1BQ4A 2B8WA 2LGJA 1WE2A 1M2FA 2WJIA 4P31A 3OQNA 3OPVA 4FASD 4RO0A 1E89A 3DMRA 5FTNA 5BSUA 3U49A 3FR8A 3HG7A 4GH5A 4QFCA 5IX8A 4JLWA 2ZFWA 4QRIA 3KSDO 3UGKA 1ZI9A 2NSLA 4DR3B 4ESFA 2H9YA 1PU2A 1IDZA 1EJ0A 3C45A 4YWJA 4ZJZA 3JQBC 3UF0A 1RMQA 1G16A 5D2CA 2ONJA 1QVUA 1OAOA 4RIHA 3BJOA 1EK6A 4ENUA 4YT4A 2J3MA 4I55A 3CP8A 1MO4A 2O7QA 3HKZN 1CRWG 1ZRSA 2WMOB 2Z5LA 5DTEA 1IAQA 4Q9LA 3T5XA 1BKDR 3LYHA 5LNK6 1AG9A 1VJRA 2BY2A 4RD6A 4REQB 2QVCA 4WDRA 4CL8A 1KYWA 5HNKA 1GTZA 4FOPA 4AZ0A 4DCTA 1HSJA 3N3BC 4A3LJ 3GN1A 1MKMA 4GM4A 2QXTA 1MF7A 3SXUA 4YV0A 2HU2A 3O1JC 2RC4A 3WGOA 3K0LA 2NVXJ 1Q1EA 3VPRA 2FTKE 3KPYA 4UE6A 2FP3A 5T4HA 3WJAA 1YRNB 3DZIA 3O9MA 4Q66C 4M74A 3DYIA 1A9TA 2QQ8A 1PWYE 3IA7A 3Q6MA 2FW7A 4FBGA 4FFNA 1D0SA 1N9GA 1L5VA 5I4KA 2WPNA 4P5EA 2ATVA 4JI5B 2XXBA 3AHIA 5E8JA 3SLRA 3X0DA 3LRTA 4UM7A 3O2PE 1KYQA 2AOTB 2IX9A 3NM6B 4DYCA 1YE5A 3O92A 4MICA 2I4OA 5DBHX 2DFPA 3H18A 1ITZA 1W1WE 4M3FA 1XTQA 5G0WA 2DQKA 4BMYA 2Q5JA 5CBPB 2QTLA 4I98B 1FP7A 3DJFA 3FVQA 3ZBPA 5LBIA 3ZWMA 1A9YA 3QU6A 1N8SA 3RIMA 5B7QA 5B7NA 3DE6X 1GGHA 3GTPJ 3H6KA 3IPAA 1Z7UA 1J25A 3KVYA 1UBHS 1YJQA 3GT3A 2ZIFA 2Q0OA 1Q0HA 1BWSA 2OESA 4FR2A 4FYMA 3NOOA 1J8YF 1FE8A 4LWZA 4LQ4A 1V7QA 1UXJA 1E1DA 3JRFA 1TC1A 1WZNA 2C77A 3OJEA 1LUJB 4OB8A 4Q16A 4TT8A 4Q9IA 3R7AA 3RB8A 4QO7A 2H8RA 4GZ3A 4C7OB 4DJEC 2XTZA 3OCVA 1KIAA 4MWOA 3PSIA 2V6FA 3FMVA 4M1WA 4HEA1 4DARA 3ECHA 3OSFA 3GF4A 4F5EA 2FZVA 4ME6A 3SYNA 8AT1A 5K7HA 1FUKA 2IODA 1SXJC 3MIZA 1XHEA 3CUQA 1P0CA 1QZXA 3RC2A 3CVUA 1RWOA 2QM7A 4CM5A 4DXAA 1S2DA 2H3EA 3RYPA 2RIRA 4JAVC 5KTTA 3DLAA 3C3WA 3FFBA 4C3IJ 4QLAA 5L6LB 2QX7A 1XHLA 4DJAA 1C0IA 3IP7A 3L1JA 1I4LD 3V2HA 1T5DX 2ECFA 4M1YA 2DLNA 2WF6A 4L07A 1IZ0A 2ECQA 3DXXA 1PNTA 3OIVA 2V9KA 1NI4B 5IM5A 2W6JD 1FNMA 3D1JA 4R8SA 5GAHJ 4M72A 3C8HA 2I6SA 3WK8A 1LKZA 5E8GA 4R9RA 1HFWA 3UJHA 3WDMA 3U6KA 2QM0A 2OZEA 3OTHA 4AC9A 2NNYA 3R5HA 5CYPA 5JS1A 1C4WA 2HSDA 3D43A 3MWDA 1JUSA 4BV2A 4EYOA 3RTAA 1FLIA 1FDIA 2GPWA 3RG8A 4DV5B 1ZINA 5BVHB 1KMIY 4JFAA 1V8ZA 3LC2O 1DADA 2VTBB 3ETCA 1E9EA 3L00A 1KO7A 4NZOA 2OTJI 2W2TA 4FX5A 3DTTA 1GQ2A 2Z6QA 2HU8A 1KBZA 3KE2A 1NTCA 1L2TA 4MGKR 2N9UA 2L7MP 3O1HB 2M45A 2EDCA 4OHUA 5KNDA 1GNRA 1EXWA 4K46A 2JTVA 4IZIA 2EJBA 2D5VA 4R6XA 5CLIA 4ZO7A 5I4BA 1XQWA 4FT2A 5LMNB 1I9GA 2BFMA 3RJMA 3L6EA 4DYHA 1XAIA 3T9AA 2L5QA 3VUEA 4DV3B 2B1IA 1V7PC 2PSSA 3KUUA 1J2JA 2PDAA 4FHGA 4S24A 4OHZA 3F98A 4EABA 4MCJA 2CFCA 1JT0A 1N3YA 4Y0AA 4OL0A 2EW8A 2CMHA 2Y69H 1PUEE 5FHRA 1AK9A 4DNCA 2C2ZA 3DMNA 2I6TA 3ZCVA 4N0PA 5ISMA 3AFHA 2HFJA 4UV8A 4QXMA 4AO7A 4EFLA 4W5RA 1YRLA 5I7UA 1L4BA 3GCXA 4H15A 5GINE 2P5SA 1FSFA 3I5MA 1EUDB 1F20A 1M1NB 5ARDA 5LQDA 4MW2A 3R0AA 3DZHA 3PNQA 4NJEA 3FCSB 2AMJA 4OFXA 1JT2A 2CO5A 2FPPA 3CKYA 4PYIA 3B6CA 3WWOA 4GMKA 2HA6A 4B3IA 4CI0B 2I2AA 5AKIA 2IH5A 2PZKA 4QICA 4BE9A 1JR3A 1D8AA 2B99A 3ZNOA 4V0ME 2X9DA 1PJLA 2XF6A 3PIDA 1PJTA 3ICPA 5EYPA 4E5DA 3DLIA 3WIDA 2JFBA 1JEOA 2AJLI 3KUXA 3N59A 2NM0A 2DT6A 1O97D 4DMHA 3JWIA 4RA9B 2BFFA 3ZH2A 1AVTA 2DLDA 2PX5A 2WV9A 4D7NA 5DEQA 4MLCA 3HKZA 2AK3A 3CCMI 1UWLA 4O4IA 5AVRA 2GFIA 4MTDA 2PD4A 3O7MA 4JJ8A 2GZWA 4B0PA 4EX6A 4A16A 2ZNZA 2QKMB 3G88A 1MC1A 4NSNA 1E1QA 2IBTA 4E1VA 4CEHA 5DP1A 3G89A 2I4MA 1WMBA 2IWHA 3ESWB 1NONA 5GP1A 4JD5A 3U0VA 4IWYA 3TXAA 4FM9A 4JL6A 1Y8QA 5AFSA 5IDWA 3R60A 1V1MA 3GIDA 2Y8EA 4CBVA 3EVCA 4GM1A 4IIJA 2GD2A 2ZULA 3HZHA 4BFCA 4ERNA 5K8IA 4LQCA 4QXPA 4UEQA 1AHIA 4R31A 1R50A 1GG2A 4Q6BA 1SK8A 1YMVA 1YQTA 2H08A 5EJEA 1OR7C 4HH0A 4QDTA 4V1CA 5FNVF 2DF8A 4HEA6 4KO2S 1KQFA 5MDHA 2YWXA 3FTFA 2XBLA 5ILGA 4WOJA 1R0YA 4US1R 4CSWA 3DG9A 3NNDA 5D4RA 1HQCA 4BEHA 5LGUA 3B78A 1Q50A 2KE5A 4OU5A 4TLLB 2QMZA 4U9HS 4UAGA 4CM4B 5FBVB 2N46A 5GIOE 4BMXA 3SHQA 1I39A 1D0IA 5HRAA 2JBAA 1D0XA 2OKGA 1XE3A 2PWZA 4RYDA 3UKJA 3EPHA 2EZLA 4PRLA 1HDGO 4DVJA 1U0EA 3G1TA 3ESBA 1N5DA 4BAYA 5C44J 3A2MA 5GV7A 3HWSA 3T1VA 4NNJA 3W5CA 1R58A 3RO7A 3UEOA 5FULA 1GPYA 4LWPA 1VCIA 3WLKX 2G76A 4KUGA 3FH0A 1DUVG 4AM8A 2R8EA 4BQFA 3DPSA 5JYDA 1Z26A 1QBKC 2F9FA 3FYCA 4HC4A 1ECGA 2YOFA 1T95A 2YYZA 3WNDA 3Q7IA 2PUCA 3NHRA 3SXYA 1CWUA 2R7AA 1JMVA 3A3PA 4IUDS 4EKGA 5C46F 2Z09A 5JHGB 3UK1A 1FVXA 2IUUA 2HXOA 1C1YA 1UJNA 2ENWA 4WPGA 3V55A 4HDRA 4Q9DA 3KEOA 1QIMA 4NQRA 4EUSA 1FU8A 3NHAA 4N65A 1PV4A 3WQSB 1ZN8A 3C3DA 4DWJA 1MEJA 2O2XA 1SUBA 3H1AA 3BORA 3D0QA 4IS3A 1E59A 3KJXA 3O4FA 3O4IA 3KETA 1IUNA 1KRHA 1U98A 4IJAA 5IYCJ 3BT9A 1EXMA 1GAJA 1R10A 2O1EA 1AUQA 2Q9BA 2WY2D 1U8CB 3FYUA 4CM1A 5CVTA 4KQHA 3VA7A 1TRKA 1UFKA 2E9SA 1F4VA 4F52A 1ENYA 2GOXB 4I4LA 4O6VA 4WOBA 1KEWA 2P6NA 4DS3A 2FUG6 1WIWA 3OQ6A 4FFWA 4OL9A 3TW0A 4BNYA 1KU3A 3PD7A 3K0FA 1DFGA 3G4SI 1EMDA 1Y3CE 5CJJA 3KR1A 3UJPA 4QOIA 2EAUA 2QOEA 1X1PA 4XOTA 1UM8A 2EHJA 3L0BA 1T98A 2Q5OA 4HAMA 4IDNA 3MSCA 3QLTA 4NESA 4PLFA 4QXRA 4LJ7A 5C8ZA 4CR7A 3LU1A 1WMFA 2I65A 3BYZA 1KDOA 3LVFO 2JFZA 4RLHA 1OTXA 2EFDB 2GVNA 2JS7A 3CRW1 3L2QA 1DKRA 3MIIA 4M60A 2ZYIA 4J1TA 3RCBA 3RHFA 5AW2A 4CR6A 1K8ZB 3AJ8A 3EUWA 1NLYA 1OBFO 1T39A 2L0XA 3EXIA 1ZTRA 3EGVA 1ZG5A 5F35A 3HRTA 5HNFA 4MA0A 1Z2DA 2QW0X 4R1TA 4NYJR 3H4IA 3AP1A 1T2VA 1X2MA 1Q22A 1JYSA 1U9CA 2B4KA 2FEPA 3EWSA 3GFSA 1YDWA 4WXHA 3LX5A 4IGIA 2HOAA 1NVGA 4L50A 1G5QA 4N0DA 3WHIA 5IWCA 2ZUTA 4DIQA 3FCYA 1KWGA 4ZVTA 3HPGA 1ZP6A 3A9TA 3KE9A 4FLFA 4XM0A 2OA0A 1YBVA 2BGCA 1AQ6A 1SC1A 2Y1EA 3BXGA 3CWCA 3F7MA 1RDFA 3LY9A 3GGCA 5IAGA 2PUGA 2FEMA 3K6JA 4CIBA 5F9HA 1BE0A 1DRUA 2IPNA 2ST1A 2X4LA 3PKZA 1VRVA 4I8XA 2G80A 1T6SA 4A12A 2HWXA 3UPDA 3GJ0A 2E19A 2F6RA 1FTTA 4UEKA 3IHTA 2ENUA 4D9KA 2E1PA 3S55A 2DU9A 2F43B 2JCBA 4TQGA 3CLQA 3QXXA 4P81A 4CQLA 1I4DD 1B9MA 2OG1A 3ERCA 1D0VA 2O54A 1SZJG 1RC1A 3L6CA 2X9VA 4U2GA 3WL3A 5EJ5A 4U87A 3H4VA 4G0VA 4XBFA 1NBOA 1UKZA 1X8LA 3B6JA 3DLTA 2QMHA 3FKSD 3GVPA 4J0HA 3CB4A 4A2CA 2DTZA 5LU9A 3GRAA 3EFOB 2WIDA 2WD9A 1U0NA 1KU0A 3O8NA 4JLSA 4AO8A 5K01A 3QVXA 4UM9D 4LGCA 1VQ4I 1K7SN 4XARA 3LNCA 3WK7A 3K71B 3I61A 4BE0A 3QRWA 3ZYCA 3TTVA 3WGMA 2DAPA 5JROA 1UADA 3U7RA 3HL2A 3O26A 2TCTA 4OU0A 4GM0A 4JP8A 4YRDA 3TUIC 1VCNA 1F8FA 1RESA 1MJNA 1YQUA 3U1KA 3P2KA 5TQ0A 1M83A 4PE5B 1XU4A 4MIKA 5DT2A 4F7ZA 1SVUA 2DCUA 4CLXA 4YRVA 3AY0A 5KVSA 4URFA 3K6KA 1ZUHA 5IXYA 3PEYA 3EWAA 1EFUA 2ECOA 4UCFA 2KI5A 2JAHA 1YI2I 4ZKEA 4O3MA 1PFUA 4DT1B 1H22A 1AT1A 1XI2A 4DQDA 1BHJA 1UJCA 1AKVA 3FBWA 1GUAA 1JFVA 2XB5A 3BA1A 1BXGB 3F78A 3W5HA 1IM2A 4LY9A 1OCEA 2DQSA 4Q1DA 1Z5GA 2ETXA 1L1FA 3VI3B 1QH9A 2W9XA 2MYNA 4RZQA 3EN0A 3ICOA 9LDBA 1EFDN 3N8HA 3T1HB 4Y6OA 5TT0A 2I3DA 1DJOA 4W9NA 5KOIA 1B1BA 1RHMA 1V8FA 3I9V6 5FAKA 1FTZA 4LHWA 3HEAA 2O8EB 4KBFA 3RFFA 1G8YA 2FX3A 2WT4A 2DOAA 4INAA 3K9HA 4ZYGA 4H77A 4PW0A 1J2EA 3TIFA 2AIRA 2G7MC 4W9NC 1RYNA 2UZIR 2A5JA 1E3EA 5SZIA 3RFXA 3WGUA 5BUSA 5HUHA 2IUSA 5A0FA 1BRMA 1T3HA 4RY2A 3TE7A 5AK3A 3CRMA 1DX4A 4ZT6A 3OX3A 4MQ9F 3RS3A 4B7UA 721PA 3O21A 1NYTA 2QUKA 4R83A 4JVSB 3NTXA 1NV9A 2JIPA 1O4XA 2YFKA 1IEQA 3FROA 1HE3A 4HFMA 4CMKA 1PFQA 5CCBA 4YDSA 3NX4A 1ZRMA 5IJ9A 1MDBA 5HDNA 1SFKA 4M2LA 4ZI7F 5B55A 2QTVA 2EBHX 3PL1A 3GEGA 3W5UA 5AI6A 2YU9J 4IHQA 4MR8B 3QPTA 1ECFA 3L43A 2WR8A 3LQ1A 1Z7GA 4CMIA 4EITA 2DFFA 2MDTA 2FPUA 4M83A 4CTOA 4ZCPA 4DN6A 1M9NA 3R61A 4Q4AA 4I76A 4L5EA 1GR0A 1NC1A 2C78A 1C30B 2HTSA 1TM4E 1X0VA 1ETVA 2W6IA 3E9NA 3QM1A 4WV3A 1W0KD 5TT1A 4C76A 5KNCD 2QM8A 1YXMA 5DLDA 1V5GA 3DO6A 3P7MA 1DBVO 2MSEB 5SZKB 5DM1A 1ZD2P 1CHNA 2L7ZA 3AINA 1W1WA 1XP5A 2IXBA 1ZD4A 2PANA 2UXXA 4UB6C 3LH5A 2AOTA 2NSJA 5AXDA 1R4ZA 1O57A 1NPYA 3LDUA 4LXHA 1S96A 2NTJA 4R41A 1EBUA 4EJ2A 1CQTA 5IG2A 5CNMA 2OSBA 3LT1A 4YQZA 3T38A 3A2LA 2ZQZA 1Z62A 4UNRA 1DTEA 4P7KA 2AMLA 2ZRIA 4OQMA 5C7YA 1FOYA 4ZDJA 5IBRA 2ZTHA 1JHFA 1IBCA 4UDOA 3RS5A 2DQLA 3NDRA 4IIJF 5JI3E 1CUVA 3PHIA 2K9NA 3ITEA 1HEUA 1KMQA 2X40A 4A2WA 3DXJF 2RCYA 2V58A 3HRIA 4MW1A 4R69A 3GLIE 1P1BA 1NJFA 1E5XA 1AV7A 5HGXA 2FWPA 2VHUA 2B9SA 1RTTA 5I5GA 3D3NA 4GYJA 1NBME 5CGQB 4DQ2A 2BSXA 1L9KA 1G6Q1 2PK3A 2H2AA 4I0WB 2J1LA 1FNSA 4X0EA 3RSSA 2BP7B 1JGGA 3A8TA 4L9TA 2EARA 1JG1A 3QG5A 4GWKA 5AOBA 3EBPA 4UOZA 4QDZA 3DH0A 1ORTA 4TVBA 2WTUA 3TTYA 3DHEA 1QX3A 1M7HA 2WE7A 2Y67A 4Z99A 1Y7TA 3WJ2A 2IYAA 4RNDB 2H1KA 3HOSA 1W0UA 2QKYA 4FB4A 2WJ4A 2IXDA 2R5FA 3RF6A 1CNFA 1AOYA 3E9MA 5KDDA 2RH4A 1BC8C 3KXIA 1BVHA 3L4BC 3MFKA 1JB9A 3EQ9A 2ACKA 4MJ7A 4EYQA 1I2CA 1Y5NA 2JK3A 4Y4RA 1PFGA 3PHCA 3FF5A 3PENA 4GKVA 3TLMA 1KJNA 1SCQA 4TTRA 1SQFA 4GOMD 2EZUA 3ICVA 4RWEA 1E4YA 5JS7A 2AD5A 5DWVA 2FDRA 2ZB2A 4XGNA 3KP2A 2P1RA 3QP5A 4D0PA 2P81A 1Y9AA 2KLHA 4NJMB 3T7JA 1GGFA 1L7XA 3RVKA 5LQSA 1SQ6A 1HE2A 2MFZA 1U6KA 3NORA 3FPBA 4EZIA 2BMFA 5BRAA 3GB9A 4ZD6A 2G71A 3INGA 3ROGA 3PM1A 1IQ0A 5EHXA 4R68A 4PHGA 1SB8A 4EYEA 3OR1C 2C20A 3B7PA 4UUNA 3PNTA 4ZOLF 5TS2A 3HA5A 3R3SA 4I4TA 2K40A 3KIOA 1E3MA 1W0JA 3R7BA 4PHFA 5DHRA 1YQWA 4EDHA 2CB0A 2QPOA 2ZRGA 4JSRA 4L9SA 3NETA 4UVAA 1TQIA 1EK2A 3N1UA 2JGJA 2Q4DA 3KU1A 4HSGA 2PWYA 4PGHA 4QQKA 5KEIA 3OKFA 3R7WB 5GZ1A 3NDPA 3JD3A 1Y0NA 3JD0A 3ZVLA 2JWTA 1HOTA 2CLEB 1FMVA 2IYLD 5CU7A 1MW9X 3TNFA 4OM8A 2VTKA 3TMAA 2XHKA 3K16A 2O03A 3OOUA 4IOMA 2F4NA 4OK3A 4M1KA 2QVBA 2FMFA 2ESHA 1O87A 1SU8A 1O0SA 3U9SA 4RDIA 3O8GA 1PEAA 4ALJA 3M2PA 4QYMA 4JLVA 1G38A 1AKEA 3WKEA 5J1TB 1RACA 2E49A 1SEUA 1LBIA 2ZIGA 3FMIA 4PVCA 4ZAYA 4AVYA 3PR1A 2E1OA 4DL9A 3PIRA 1G5HA 4EJSA 1TAHA 2B0CA 3NHYA 3CCYA 3O84A 4H1HA 4AW9A 4RD2A 4XIYA 3U37A 3H1CA 4J4HA 2R8YA 3KJNA 2YKGA 3G6EI 2VPXA 5KVAA 2FQQA 3OCXA 3JRXA 1MRSA 2WAAA 3MJEA 4JEHA 4ZQCB 1EX7A 3KZZA 1OZFA 2QS9A 3BN3A 3TAXA 3FTQA 2H17A 2B1JA 2IEGA 4NHEA 4HUTA 1YNOA 2PYDA 1ZMOA 1WBDA 1Y4AE 2IP4A 2BLNA 5IOZA 3ZBTA 1A5JA 4XUEA 4OHMA 3W9UA 4YV7A 2UUOA 5DNDA 3Q8XB 4G1FA 1G21A 5FADA 4PJMA 1J09A 1FOKA 2I54A 1FP6A 2BTQB 3M07A 3U3OA 1JZSA 3RAFC 2LR0A 4R9NA 3GTGJ 5IPAA 1UK6A 2ZSJA 3BFXA 3ESZA 3FYSA 4PYKA 3TG8A 2REXB 1D09A 4BNNA 3G1LA 5EAIA 3UXMA 2YVLA 5JE8A 3M5CA 1Z6TA 4KGXA 5KVQA 1E4EA 4LXQA 2VJ5A 3RWOA 5KZMB 2IYPA 2HWWA 4R1NA 1UKBA 4TS3A 4UKDA 5JBIA 4HG2A 4BKOA 2VF4X 1INLA 1PG2A 1Z8NA 3PCRB 1OISA 3FMPB 5HKBA 5JCJA 1RXIA 1HDRA 1AKWA 3R8CA 3HU1A 2QX8A 4K6HA 3LL7A 3EPKA 3ODGA 3E0JB 4OTZA 4AUXA 2XCIA 2P6UA 2VDOB 4PPYA 5KNCA 1HRKA 3ABLH 3OM9A 5EE0A 5FO0A 3GL9A 2BGJA 5DTDA 2DMUA 5AVXA 1CETA 1U2SA 1KAEA 2AQKA 4WASA 3RS9A 2GO7A 5LBUA 4XYLA 2A57A 2WJYA 3LK7A 1P9NA 1N9KA 3IYLW 3C5VA 2J5XA 5JI2E 4P54A 1U63A 3OJOA 4G4SP 4ND7A 4P3XA 3SR3A 1Q1AA 3HN2A 4DIKA 3WTVC 2PTGA 1DI0A 1QCZA 4M21A 4ZDKA 1SXQA 2OUMA 3HL4A 4HTAA 1RSZA 1SU6A 4QYTA 5K0CA 1XTJA 1GPKA 2YUIA 4F46A 5ALDA 4RJTA 1M10A 1UG0A 4AYWA 3J80K 3IOEA 2O8FB 5IF9A 2PUEA 2VODA 4B7AA 5BQFA 1J2YA 2OAZA 3VGJA 3NG1A 3VI4B 5AIQA 1JQKA 3HLTA 1TUGA 4Q19A 4ZIRB 5TGDA 2I6XA 2YV1A 1U5BA 5C1PA 4K9MA 1N2BA 4G6ZA 4JP2A 4RUKA 4U6QA 4XPIB 2EP7A 3AJ9A 3GPCA 3KBOA 3UW3A 4MULA 3ULQB 3MN2A 3KEMA 4KV9A 3T3OA 1XSVA 2Q3LA 1ZJ6A 1I0IA 2AHRA 2O4UX 5CVRA 2YYSA 4FMDF 3RGGA 4US0R 3EBOA 5K8JB 4IPAA 2B1QA 3P9ZA 3ZQQA 4X6UA 1EFAA 5U4XA 4U0JA 3FNGA 1W5SA 3L7NA 1OU0A 1PJSA 1C81A 2QZPA 2YPRA 2UDPA 4F7WA 3HBMA 5FL3A 2FDCA 4D6XA 3ZKAA 3PWSA 5GM2A 2VSNA 2GHQA 4O4HA 4OBEA 3ZPLA 2EJWA 3CG0A 4IUBS 4M87A 5DK4A 3N28A 4ZQIA 5BQPA 2RK4A 3I23A 4EG1A 4BPBA 1C2TA 3HJCA 3L01A 2BR5A 2PBRA 1XYVA 3OT1B 4GOND 2DUJA 3ITDA 4I0BA 4HNTA 1BN7A 2OLKA 4PSCA 2IYSA 1Q92A 3W4KA 3OPYI 2PVSA 1FTSA 2QTZA 5K3AA 3ISVA 1P1JA 2J09A 1U9ZA 2LKCA 3NW9A 2HJGA 3HWRA 4I4IA 2GVDC 5C1IA 1IULA 1SGWA 4WFIA 1TT0A 1HO3A 3FXJA 3ILXA 1D6SA 2A9RA 2R48A 2XGDA 3F21A 1CJMA 2WHPB 2MSKA 3WNQA 4F71A 4IZHA 1W36B 1PJAA 5ALWA 3UYKA 1CS0A 2Z3YA 4JLDA 2NPIA 4HO1X 1ZM9A 2PX8A 2GEVA 5BW4A 3QVGB 4J29A 4P33A 1WZ2A 2WKPA 2X5NA 2FHSA 3IALA 4QAJA 2DG2A 3RGWS 3SBEA 1UMDA 1G7TA 4RPJA 3MPOA 4WEQA 2A9QA 3QEAZ 2BFFB 1YK1A 3DKRA 1KU9A 2IYFA 1YT5A 1OPCA 3WK6A 3WSWA 1E20A 3NEPX 4Y2PA 2F5EA 2JAWA 4UASA 2A59A 2EFEB 4OAZA 2X42A 2DQZA 1SXJA 2KYRA 3NRVA 2HK9A 3FBGA 4XN3A 5G1PA 3TQFA 3JZDA 3PPWA 1EFRA 5I4IA 4QQRA 1EH6A 1EFTA 5ECGC 2Q0SA 4EJUA 3KYCB 2X3UA 1OWNA 4AS1A 2EB7A 1DSSG 2AF3C 3T1NA 2CQ7A 5J23A 3WNBA 2CW8A 1K78A 3OCYA 4FWIB 2QNRA 5NLLA 4BLPA 4ETMA 4R9SA 2H5LA 1GDTA 4N12A 4MTLA 5FTLA 4GIBA 3SBXA 5IT5A 1MB4A 4DOMA 4ECAA 1ICIA 2IY8A 1NBHA 4J7CA 1V5EA 2REOA 5F1YA 5CLJA 5K0BA 4L4RA 4XMYA 5CYFA 3WB9A 5F2EA 1R66A 3TSZA 3BHMA 3K1JA 2ZJ8A 3AVQA 1QGDA 4YCCA 1FMLA 2HKXA 5L7YA 2GUGA 4C1BA 3AR5A 4HEHA 1B7GO 1RW4A 2AQFA 3CLVA 4NPHA 3WLOA 1PZGA 10MHA 4KQMA 4OUKX 2QI9C 2F43A 1U8XX 3VBEA 1IHUA 1SHUX 1XEXA 3U7HB 1GA1A 1UP4A 2L9NA 3CEHA 4NC9A 2C9CA 2ODPA 1W76A 2ZYDA 3BL8A 4XVCA 4E7HA 2HJWA 4D46A 2DCEA 1JEQB 1K1EA 4KAXA 5EZYF 4BNZA 5KCMA 4NBWA 5KNCH 1RPZA 4ZZLA 4KP7A 4N4AA 3TZBA 1JBEA 1GV2A 3ECCA 3ZDBA 1JRLA 3G2KA 2NUAA 3HQ4O 1V11B 2H7VA 3DVAA 4MWCA 1ZGWA 1GUFA 2JGDB 3I83A 2XEXA 3RRJA 3W04A 3DMGA 4XX1A 2WD7B 2E2IJ 5JQGA 1PT8A 4KK4A 1MBKA 2V1NA 5SYAA 2IGOA 1MJGM 2HRDA 5EZSA