4HG2A

The structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
AFRPRYPRALFRWLGEVAPARGDALDCGCGSGQASLGLAEFFERVHAVDPGEAQIRQALRHPRVTYAVAPAEDTGLPPASVDVAIAAQAMHWFDLDRFWAELRRVARPGAVFAAVTYGLTRVDPEVDAVVDRLYHGLLARDWPPERVHVESGYRTLPFPFPELEAPPLEIEERWPMDAFLGYLGTWSAVTAHRRRTGADPLAEIAPALRAAWGTPERPLRVTWPIAIRAGRILPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase type 11
publication title The Structure of a Putative Type II Methyltransferase from Anaeromyxobacter dehalogenans.
rcsb
source organism Anaeromyxobacter dehalogenans
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2560 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hg2A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4hg2A01
3BWYA 2ZW9A 4GC9A 1H1DA 3KQOA 4CTKA 2Z6UA 2QE6A 4RTRA 1PJZA 2IPXA 3HP7A 2JG3A 5KS2A 1FP2A 3P9NA 3ER9A 1YF3A 2FHPA 2GAFA 3T0IA 2I9KA 1R18A 4GEKA 4F84A 1BHJA 1JG2A 1XTPA 1NBIA 1D2HA 3B5IA 4E2ZA 2QM3A 3FUVA 5ICCA 5E1OA 1X1BA 4PYQA 3I5UA 5DM0A 3KQWA 2CL5A 2Z6AA 1VP9A 3B3GA 3LBFA 4PCAA 3G2OA 4FR0A 3R9XB 2PJDA 1QANA 2P7IA 5D1NA 1AQIA 3HVIA 4X1OA 3MTIA 3CJQA 3GRUA 3P2IA 4YV1A 2PT9A 3OFKA 3AJDA 10MHA 4RX1A 5U4XA 3HA7A 5LQKA 3BUSA 3G2PA 3ER8A 2CKDA 2VDVE 1M6YA 2ESRA 5EMLA 2I62A 3IYLW 5K0GA 5EMMA 5EVJA 4YUWA 4PYNA 5EG5A 1RJFA 5EMJA 4HSGA 5P8WA 1FP1D 1G38A 3TKAA 3DXZA 4GC5A 5E2BA 5DX1A 4AZTA 5EHGA 4RTJA 2UYQA 4KIGA 2PXAA 4HG2A 2AOUB 2NXJA 3OCJA 4HTFA 3TLJA 2B9EA 3KU1A 3TPZA 3UJBA 5CVDA 2PVCA 3DP7A 3FYDA 1UIRA 5C0OE 4U7TB 3NVMB 5E1BA 3V8VA 1NKVA 1BKYA 5K03A 4HGZA 3L8DA 4P7JA 3SSMA 1FBNA 5CVJA 4GQBA 2AN4A 2ZWVA 4QQNA 3I9FA 4RVHA 1TW2A 2O07A 3FUXA 4L7VA 2EFJA 4K6MA 2AZTA 4PIMA 3HVJA 5E8RA 5K0EA 3SGLA 2NNWB 3KQVA 2ZWAA 3GU3A 3CC8A 3PTAA 3G2QA 5CCXA 1R8XA 4E2WA 1QAMA 3THRA 1XVAA 5K0NA 4ER5A 1AQJA 1XDSA 2EJUA 5EZSA 5EZQA 1EJ0A 5BP7A 5E9WA 4BP3A 1R00A 4R6WA 4E70A 1JG4A 3EPPA 2VP3A 5CCBA 2C7RA 3FTDA 5ICEA 2PLWA 4QPPA 1NW7A 3T7RA 5FHQA 4CXMA 3P9CA 2ZZMA 4DCMA 3DXYA 3G88A 4YUYA 2AVNA 3TRKA 2CMHA 4RSRA 5HOQA 1YUBA 1EQAA 2PWYA 4RTKA 2NYUA 4RTSA 3NVKI 4GOND 3I53A 1D2GA 4ISCA 1RI5A 4X63A 4QVKA 5HEKA 4YUVA 3SM3A 4YUZA 1G60A 4C05A 2JHCA 2P35A 1JG3A 4C07A 3HCAA 3UJ8A 4PYMA 5MHTA 5E8JA 1SQFA 1EIZA 1ZKDA 4WXHA 4POOA 1JQ3A 2PWPA 2Q41A 4AZWA 4HRAA 3DLCA 3TOSA 4IKPA 1Q0TA 3E8SA 3NMUF 2P3LA 4PYKA 3GCZA 2FRXA 3GRZA 1HMYA 1IM8A 1VIDA 4RVGA 5CUQA 3U81A 4YMHA 2QRVB 3CCFA 2YXDA 3DH0A 3ID6C 1G8AA 3NJRA 4YUXA 3G5TA 1KP9A 3I64A 3IHTA 3PS9A 4KIFA 2ZFUA 3A25A 3C0KA 3LDGA 5K0FA 1X1CA 3BGIA 1ZGAA 3WSTA 1KIAA 4ER3A 2AVDA 2VDWA 2XYRA 2AN5A 4UOEA 3OU7A 1NW6A 3KR2A 2FCAA 2IDKA 3PX3A 5BW4A 5DX0A 5JUWA 3JWIA 2GB4A 2E5WA 4OBWA 1QAQA 1SG9A 2PT6A 5HILA 5LQNA 3THSA 2AOTB 1L1EA 3D2LA 3GGDA 3ELUA 4X61A 1Y8CA 3X0DA 2IH5A 5DM1A 3EVZA 4WVLA 3G2MA 5EEGA 2OYRA 3REOA 5CVVA 2WA2A 3DULA 4MQ4A 4P7FA 2G70A 1I9GA 5K01A 4G56A 5K05A 3ELWA 4FSXA 3GNLA 3OU2A 5C9ZA 1NE2A 5FULA 2ZIGA 3AWIA 5GINE 3FTEA 3FZGA 2LD4A 1VQ1A 3OE5A 2XYQA 4F86A 2N47A 5CIYA 1L3IA 4CKEA 2Y1WA 1NV8A 3KPJA 3C3PA 4ER7A 2R6ZA 3O31A 3HEMA 4RV9A 4BLUA 2CWWA 1IXKA 5FADA 5DXJA 2AOXA 4BLVA 2BH2A 1F3LA 2P1DA 4V0QA 4RTOA 3ERCA 4KVZA 3C6MA 3I58A 2YR0A 2XBMA 5F2KA 4KRGA 4GBED 1DUSA 4EVIA 2ZBQA 2C7QA 2Y1XA 4FGZA 5M5BA 2G8NA 3EVAA 5FA5A 3KQMA 4DF3A 3G89A 5EMKA 1DL5A 2XYVA 3TR6A 2P3QA 3LHDA 5EIWA 2AS0A 4PGHA 3UFBA 3PFGA 3G7UA 4FS8A 3UA4A 3BXOA 4E2XA 4PYOA 2P8JA 4PONA 1VBFA 4C08A 3H2BA 5FTWA 2JHPA 2IGTA 4RVDA 1F38A 4DKJA 1U2ZA 1I1NA 4CTJA 4GOLD 2G1PA 2G71A 3AXTA 3B3JA 3OZRA 5LQRA 3MCZA 2I7CA 1JQDA 5HFJA 4CWAA 3DMHA 3IV6A 1I4WA 2H1RA 2PX4A 1KPHA 1KR5A 4QTTB 2PV0A 2ORED 1SUSA 3P9KA 4YMGA 2GPYA 1O54A 1Z3CA 4R05A 7MHTA 3NWEA 1KYWA 3DXXA 3RIEA 3QOWA 1NT2A 3G5LA 4P7KA 3HCDA 1P1BA 1PRYA 2BR5A 3RODA 3UJ6A 1R74A 4EQZA 3EVEA 3TMAA 2UZ4A 1SKMA 3BT7A 2UYHA 2ZLBA 3P8ZA 5FUBA 2KW5A 1OR8A 1L3BA 3HVHA 3R6TA 5DXAA 2UYCA 1BC5A 4Y2HA 2IIPA 2NXEA 3CGGA 3UJCA 1X1AA 2GLUA 5DLYA 2OPBA 5KQRA 5KVAA 4GOMD 3PFHA 1VL5A 3PT9A 1P91A 5T6BA 4NECA 2PX8A 4LECA 5IH3A 3TQSA 1YB2A 5EOVA 5C1IA 5T67A 5HZMA 4QTUB 4LWPA 4CKBA 1XDZA 2O57A 3P2KA 3NDIA 2BM8A 4R8RA 4HC4A 4AX8A 5LQUA 3KR0A 1JTFA 1L9KA 4DZRA 2BR4A 4OBXA 5DT2A 3LECA 4E33A 1ZHFA 1JSXA 2BM9A 3C3YA 4P7GA 2OZVA 1NW5A 2PX2A 2YQZA 1R6AA 4R8SA 4X41A 1JQEA 2B2CA 3MERA 3ORHA 5EPEA 3SMQA 1WY7A 2ZZKA 4PCLA 5GOZA 1XCJA 2P41A 2PBFA 3CKKA 2YXLA 2BR3A 3CVOA 2VS1A 3CJRA 1N7JA 2PKWA 2ZZNA 3GXOA 5GM1A 2AOUA 3KR1A 2OB2A 4XUEA 4C04A 4RWZA 4OQEA 3SSOA 4C06A 5DM2A 5KQSA 4PIPA 1XDUA 1RI3A 5DRTA 4Z2YA 5F2NA 5DPMA 2C7PA 1G55A 4P58A 3PX2A 3M70A 3GIWA 4OQDA 5GP1A 2AOWA 2FYTA 3FUWA 3T7SA 5FWDA 4E2YA 2B78A 4PINA 4U7PB 3HCEA 4GOOD 1JG1A 2PSSA 2O06A 4KDRA 3LPMA 3DTNA 1YZ3A 5DRYA 4OA8A 2ERCA 1YFLA 3B89A 1ORIA 3GRRA 3SVZA 1KPGA 3MHTA 3EGEA 3RW9A 5CD1A 3LDUA 3V97A 3UJ7A 3EMBA 2EG5A 5EIFA 1XJ5A 5DM4A 3E23A 3UWPA 1N7IA 3LKZA 5FHRA 4DCGA 1YZHA 2FPOA 3LCUA 4EKIA 3DOUA 5JR3A 3LL7A 2AR0A 5GWXA 2EX4A 4M37A 3TM4A 3BZBA 3UA3A 5LR6A 3FUUA 3BGDA 3OZTA 5CVUA 2NXCA 5LQAA 1VE3A 2OXTA 3UJ9A 2HV9A 4Y30A 3HNRA 3EEYA 4KW7A 5KYGA 3KPWA 5K0BA 3BWBA 5K0CA 4IV0A 1KPIA 1RJEA 5EGSA 5LQJA 3NW9A 2PX5A 3DMGA 3ME5A 5HIKA 4HGYA 2ONZA 2OKCA 1P39A 3CBGA 4PYJA 3HTXA 2GA9A 2OY0A 4XCXA 3NDJA 2QY6A 4MWZA 5DSXA 2IH2A 3TKYA 3G8BA 2ZSUA 2O0LA 1JSZA 3HCBA 5B1SA 1FPQA 5LSAA 4C03A 1O9GA 2P40A 1RJGA 3LCCA 3MCTA 4PYLA 1WXXA 3T7TA 3S68A 2Z6QA 2HTEA 4QQKA 4EK9A 2XVMA 2DULA 1HNNA 3P71T 4YV0A 2YTZA 3OE4A 5ICGA 2O05A 4ZTBA 3UJAA 2AN3A 3GRYA 4AZSA 1V39A 1SUIA 1SVUA 1G6Q1 3A27A 3ELYA 4LWOA 5ERGB 3VYWA 3SXJA 1BOOA 4HH4A 1JR4A 1QZZA 5DWQA 4E32A 5IKMA 4OX9Y 2F8LA 3EGIA 1N2XA 3HA5A 2ONYA 3KQSA 4RVFA 5GIOE 2AOTA 1AV6A 2PY6A 2XVAA 3KQQA 3AXSA 3KQTA 3LGAA 4MIKA 5E9JA 4V0RA 3TFWA 2JH8A 3HCCA 5EKXA 2C7OA 3M6VA 2BZGA 2G72A 2I6GA 4OA5A 2P3OA 4PWYA 2EJTA 4HTFB 4QVGA 4KWCA 3QV2A 5BW5A 4RTLA 3PB3A 1IY9A 1NV9A 2H11A 3FTFA 1SQGA 4M38A 4QDKA 1EJ6A 3ELDA 2OB1A 3PVCA 5EC8A 3SR4A 1XXLA 4JXJA 5T64A 2ZULA 5E1DA 4C4AA 2V7EA 4DM3A 2HNKA 2VDUE 4RTNA 1RI1A 1RJDA 3KR9A 5BXYA 1MJFA 3O4FA 3GO4A 5HIIA 2NP7A 2OBFA 1D2CA 2HMYB 5CM2Z 2QYOA 5FCDA 4E31A 1FJXA 4E30A 4QDJA 5F2OA 3JWGA 5K0JA 2GH1A 3LCVB 3MAGA 1NW3A 1O9HA 1X19A 2PXXA 3KPUA 4M7RA 5EHIA 1ZQ9A 4FZVA 1ORHA 3FTCA 3K6RA 4CKCA 4R6XA 1DCTA 3E7PA 3UJDA 1P1CA 3FPGA 4IV8A 4RYLA 4F85A 1UWVA 3M4XA 3B7PA 2HWKA 2JHAA 3HCFA 3FRIA 4PGGA 3BWMA 5D1HA 2PGXA 2YUIA 5DTRA 3EVGA 5E9QA 3EEOA 3G8AA 3R0QA 5K8VA 1JTEA 1X1DA 9MHTA 1EG2A 1KHHA 3DLIA 1VLMA 2ZTHA 5DTMA 4EKGA 2HR1A 3EMDA 3FPFA 1QYRA 5EQJB 2YX1A 4O29A 3KQYA 4XUCA 2UYOA 4DMGA 4ER0A 2JH9A 3GJYA 4EMSA 1ZG3A 3A4TA 1WG8A 2WK1A 3DMFA 4RTMA 3Q87B 2IFTA 3SSNA 3Q7EA 3EGVA 5HIMA 4GF5A 1VPTA 1TPYA 4GUAA 2ZCJA 3NWBA 3P97A 3A7EA 5FQOA 2P7HA 2ZIFA 3KKZA 4RTPA 3FRHA 3HM2A 1XCLA 1NBHA 3JWHA 3LDFA 3VC2A 4YV2A 3FPHA 3KPVA 3UBTA 3PLAE 5H02A 3P9IA 3LX6A 5E2AA 1YFJA 2H00A 1M6EX 3KHKA 1B42A 2VZ9A 5K09A 3M33A 2DPMA 5EEHA 5LQCA 3O7WA 2PXCA 2K4MA 1RI4A 2B3TA 1INLA 2NXNA 3JWJA 3M6XA 3E05A 3R3HA 5G02A 1TW3A 4FT4A 3OFJA 2R3SA 3GWZA 5GIPE 3F4KA 3NTVA 5DSTA 5DX8A 1Q0SA 1EAMA 2IBSA 3OU6A 2A14A 1G8SA 3QOXA 4MHTA 5K0LA 4AZVA 3BGVA 1NW8A 3DR5A 3A7DA 3EVBA 3MB5A 5GM2A 2V74B 5DTQA 4PYIA 3GRVA 4BLWA 4ATNA 1QAOA 5EKUA 5FWAA 2YXEA 2CMGA 4X60A 2AOVA 3LBYA 1WXWA 3BKXA 3B3FA 4AUKA 3FYCA 3GDHA 3UZUA 2IDJA 3EVFA 2FK8A 3LSTA 3OZSA 3FUTA 1UFKA 3BKWA 3MGGA 3HVKA 3M6UA 4FSDA 4QPNA 3OPNA 3P2EA 4FT2A 1WS6A 2ZBRA 1MHTA 4KDCA 2NP6A 3EVDA 3DUWA 1L3CA 1WZNA 2OO3A 3CJTA 3K0BA 4H0NA 3AY0A 4MTLA 4B17A 3BWCA 3VC1A 2FK7A 1RI2A 1ZGJA 2ADMA 3HA3A 4XUDA 5CVEA 5FQNA 3FPJA 4A6DA 8MHTA 4BP1A 2B25A 3IEIA 2QRVA 3MTEA 5E1MA 4M36A 3C6KA 3MQ2A 5FA8A 5HIJA 2IH4A 2ZBPA 1T43A 3KPYA 4FP9A 4PNEA 3SX0A 4DQ0A 1KYZA 2GS9A 2JJQA 1KXZA 3A26A 2YVLA 4LG1A 3M6WA 3ANXA 4ER6A 1AF7A 5ICFA 2ZIEA 3TM5A 3VSEA 1R8YA 3KQPA 1VP3A 4IWNA 4A6EA 3LKDA 4RTQA 4BY9E 2IP2A 1M0EA 2WA1A 3EVCA 3FPEA 2ZVJA 2IBTA 4DA4A 3R24A
chains in the Genus database with same CATH superfamily
1UJMA 1EFKA 3SG0A 2JCGA 5B58C 2I9KA 4YVFA 3G9QA 1NVTA 3EPZA 3PGXA 1TNSA 1K8QA 3O82A 4JLSA 3ZMUA 1BA2A 5A4KA 4UD2A 4Z0TA 2R8PA 3SHQA 3A4IA 5C4XJ 1L4FA 4MV7A 3NTXA 3ZDYB 1O97C 4DW8A 3BPVA 1USUA 1J49A 3CCSI 5ILSA 2W8ZA 4BAGA 2BFDB 4H15A 1U1FA 1NRJB 2LNBA 3GGJA 1MBFA 4M55A 2BW3B 1PK8A 4D4JA 3PNSA 1JNXX 3RVNA 2VTVA 3QODA 4LOIA 1PUIA 1ZOLA 1UQRA 3CLUD 3TP0A 1X74A 4JJKA 5LP6F 3R3UA 1O94D 4B6PA 3BREA 4OXYA 4RD6A 1I2ZA 1KTIA 3I2HA 1GL9B 4Z3DA 3J81K 3LH5A 3BZCA 4BGIA 4UUBA 2BT4A 1X1CA 4TT3D 2XYRA 1E8MA 4NOLA 4NE7A 4HNTA 1DOHA 1OLXA 2UYGA 1F5TA 4TN5A 3DEAA 4B3TB 4ZYHA 1Q3TA 4GGOA 2XDWA 5CQEA 4FYPA 4P7FA 5CRIA 1TJ3A 1QYDA 4FCTA 2F1KA 5G41A 3HPGA 4TVSA 4JT2A 2LWIA 4U6SA 1H2WA 2LVBA 2I8DA 3RGGA 1B4DA 1VYHA 1VIMA 4PRKA 1OR7C 4XLLA 4DXHA 1EK0A 1VHDA 2MINA 4P9UA 5BUSA 1VDZA 3ETEA 5LQRA 1A8IA 4L4SA 5JAHA 1UJCA 1FSPA 5F6FA 4KQKA 3Q7QA 1QB8A 1VI0A 2A6EF 4XVCA 5KPDA 1CLUA 3OYJA 5BQ5A 4AO6A 2DA1A 4G3XA 3OE7A 5DEOA 4Q9NA 3NOOA 1QCYA 4P38A 5LDGA 2P5KA 2VC1A 5LMZA 5A5EA 5AKXA 2X8AA 2X5XA 2UZAA 3AP2A 1NDQA 2DWOA 2W1OA 1E1LA 2CUNA 3LRXA 3N5CA 3HPQA 3HDQA 4JVMA 1Z22A 4CUZA 1YW8A 3RQIA 1HYQA 1T91A 5IKEA 4C7KA 1GGEA 5JV5A 4ZT5A 1E0AA 3LDUA 5JR3A 1NK3P 3MZ8A 1YL5A 3KXKA 2WU0A 2EX4A 3VKWA 3HG7A 1FSFA 4KW7A 2I7TA 3MRXA 3BFJA 5K0BA 5I9SA 1R6BX 1HNZB 2FZLA 2O59A 3SXUB 5KOJB 3DMGA 3CVWA 2YOGA 4B3SB 4WOBA 2KMLA 3ADBA 1LU9A 4RZIA 4D3YA 5FR2A 4J3FA 5KNBA 1WXFA 5J3JA 2P27A 1USVA 3OPYA 3L09A 3HA5A 1EHYA 1E94E 1GWNA 2DYSH 4M1WA 1R4NA 3M9XA 1NMQA 4DM3A 4N39A 3WO1A 5KWIA 4ZEVA 4DCPA 1O6CA 3WR5A 4A3IJ 2OQVA 2IYEA 3L02A 1ISHA 3G2KA 3C1DA 3SP1A 3FR8A 4AI6A 1NX9A 2O3TA 3L7DA 3TCXB 2WF7A 1V5EA 3DJFA 2O8VA 4O6JA 3GPLA 2FEXA 2VNHA 4FXOA 3E2MA 3I4FA 3OJCA 1BS2A 1IOLA 3O91A 3PQ2A 1N8NA 4G5XA 4O1MA 3OFNA 5E2AA 2P0YA 2PEZA 3ZDEA 1NUSA 1ODSA 1OKKD 2XGDA 1QGYA 4HB3A 3WXMA 1SG0A 4K9MA 1U7OA 4LJ9A 3LO8A 2XCSB 2VUMJ 1NBME 2Z4SA 1FFSA 2JMWA 2ZAMA 2JFUA 1OBCA 4EA7A 1LI7A 3N2GA 1O3YA 1YO6A 3I9V6 1LW7A 1PFWA 6PFKA 3IDOA 3F49S 4EKNB 1SPBS 2XJ4A 1PR6A 5AH0A 3UXYA 1K9VF 1G1MA 3B5EA 3O3MB 2R1TB 2I4TA 2ZRIA 3E9RA 1NVFA 5HZHA 5FEMA 1Z08A 1JIIA 1GADO 1EVQA 5DNCA 5JMOA 2LYCA 2D8AA 4YI5A 3EXEB 1Y1QA 2PTHA 1MDMB 1IXSB 5FLXZ 3DBLB 1R64A 3AEKB 3LLCA 3PTLA 4ONEA 4NK5A 4K9SA 3R4CA 3B6CA 4P4SB 1TAHA 4D97A 3TSZA 1JSLA 3HGTA 2AJDA 4MP8A 4E7LA 2EIXA 3D8HA 4PYNA 3K92A 3OD5A 5AOBA 2M6RA 2VF5X 1MJAA 3BA6A 3QVTA 2PXAA 1TADA 2R6FA 3PICA 2VH5R 3T06B 1BQEA 1MXFA 3PHBE 3K9FC 1W0UA 1X7WB 3HKCB 3MELA 1YBFA 1Y3BE 2GZDA 4R01A 2HVSA 1XVAA 3A58B 4YR9A 4ASUD 4D9GA 1VQPI 1O3QA 3HWRA 1R0LA 2J85A 4PBRA 2DBQA 3SM3A 5HK8A 2IV3A 1RYBA 2PX0A 4KU4A 4M3DA 3C2HA 3H2HA 4BVLA 4HRAA 1HOTA 2WU1A 4QSMA 3L8MA 4U88A 3CB2A 3JU3A 2Q27A 3MRTA 4MW2A 1N2OA 1YI0A 3E48A 1XEFA 4UBOA 3LT5A 4PBSA 2WV7A 1V71A 2RDPA 4BAUA 3CX4A 4EUSA 1GZ3A 3G2MA 3LX4A 5KEIA 5I4IA 3L4EA 3KQLA 4YAOA 3QX7A 3E6DA 2A4MA 2FDCA 2OGSA 4I19A 2P0EA 4ZZ3A 1F6WA 2QXTA 3OA2A 3GLFA 2GO7A 4C08A 1DIAA 4PONA 4C2AA 3E53A 1RM0A 3PQ5A 4FEEA 4EG1A 1Y7TA 3OYIA 3ZV4A 1IQPA 1SAYA 1DMSA 1K2WA 3DHWC 2VLIA 1QTRA 4RFSA 5DNVA 2GIZA 3ZZUA 2IDMA 4X92A 4B3BA 3VTFA 2IOYA 1TYEB 4N4NB 1BO6A 2X86A 5IVHA 5FLXA 3R77A 2XF2A 2VP9A 4UVBA 1BIAA 2O61A 2PS9A 1JGTA 2VC2B 3AKZA 3X1DA 4C06A 4L9TA 4RANA 5GV7A 3W6KB 3HRKA 1O6ZA 2VA9A 2XRYA 3AEXA 4M9CA 4ZALA 4PFQA 4EGZA 3ILYA 3GGPA 2IS2A 4L85A 1VQ6I 2W70A 3ZZ0A 4EJ6A 3HCRA 3JVIA 1YI1A 4MQBA 3O0DA 3RRZA 4CG0A 3IMEA 4O5AA 4C0AC 2Z3WA 2FQ4A 4RQAA 1E2KA 5CHYA 2XVMA 4D56A 2DULA 2VJLA 2VPPA 1VHJA 1KQPA 2GKGA 1VF9A 4FZ3A 1I51A 3GUUA 3O1JC 2C7OA 2O0JA 1LCIA 4WESB 2J7KA 1TP4A 6AT1A 1AUOA 1W4LA 4ECAA 4MUMA 2AMLA 4EX7A 5GMOA 1SK9A 1X8KA 5FI0B 1UZCA 4B1RA 2BBYA 2TMKA 4O4LA 2OC4A 4NOMA 4WY5A 5CFRA 1QH0A 3JQAB 3OF3A 2QL6A 4IDEA 1DGQA 4HUJA 3N97A 3P5JA 5A4MS 2ZYIA 2YX1A 3G5AA 5KVRA 4I4CA 2OCXA 3HKBB 5KHOC 4PZYA 5CT8A 5LBIA 1TEZA 3GFRA 4G41A 2LK2A 1YFJA 3O3CA 5EEHA 4HGQA 3RTGA 1UAYA 1INLA 2QWWA 1RHKA 4LFAB 2H2HA 2O6LA 1WZCA 3BR3A 2WJWA 1BQ3A 1KJWA 2YZGA 2ZYHA 3OQ6A 3RUPA 4B83A 2GLOA 4CCOA 3ETJA 1WJ5A 3SVLA 2FUCA 1G66A 4Y3OA 4EZEA 3UAYA 4PYRA 3JRBA 5DI3A 3X43A 2D5LA 2WNHA 2E82A 3JRFA 3IKTA 1PR0A 3C98A 1H4QA 4BYMA 1C9NA 4HGRA 1V7ZA 2IPXA 3U80A 3FXRA 3KWJA 2R92J 2FR1A 4GXQA 4B74A 3UAWA 1QHGA 4EWLA 2OO7A 1RXIA 3TZEA 2I1WA 1E3SA 1H05A 3TTXA 3O8BA 3GCGA 3GVXA 3SZUA 5K0GA 4B73A 1PTKA 2X5NA 3JASA 4YUWA 3ESAA 3IT1A 4N5NA 4YAGA 1UOEA 4FINA 4P5DA 5EHGA 1V1MB 4ZO7A 1DTWA 1XV5A 2VT2A 1FDOA 5CM9C 4QQNA 3OMYA 5E8RA 3T1HB 3OLZA 1YQUA 2RAEA 1L3LA 5M5XJ 1XQWA 2IPLA 1ZA1A 1G4DA 3GJ6A 1JL3A 3I4CA 2XAUA 1QHSA 3KZXA 4D46A 3PHCA 5CDHA 3GMDA 1DKLA 3LQKA 2GPSA 4RZXA 1IJEA 2C1ZA 4XFKA 1Z0DA 2GARA 3WSTA 2AVDA 2VDWA 1DIBA 2XZOA 5B58T 1OFCX 3EPLA 1UBMS 4ARZA 4OXXA 1Y8CA 2QNRA 3TPFA 1HFWA 2CFRA 1RKBA 1C9YA 4YB8A 4HLCA 4BLVA 5D85A 3FOCA 1C7ZA 3ZTWA 1AGXA 5EGOB 1G291 5I8PA 4I4TA 4CUKA 4L5JA 3ZCQA 3C74A 3H2BA 2JHPA 2VDPB 1CUUA 3FCUB 2WY8Q 1YAJA 2AI2A 2CL6X 3VYTB 1OHHD 4QTTB 3HDGA 7MHTA 3UC9A 1NE7A 4GMFA 5HLGA 1EP2B 1R74A 3IIEA 2Z3VA 4FFBB 1QH1B 3IIJA 1YIJI 1QKJA 1ULAA 3JQCA 2NADA 3LCJA 3HJCA 4LK3A 3OTWA 4IJVA 1AB6A 4S1NA 1R9NA 4EF6A 3LVBA 2VUUA 5DXFA 2RVCA 3N8HA 5COQA 1SUDA 3VUFA 3A1EA 2XYGA 3QUTA 2ZVQX 2FYTA 1FYEA 4Y8VA 1P3DA 1QRTA 1Y6QA 3V1TC 4RO0A 5K3DA 1ORIA 1XMVA 1D4AA 3E23A 3HUGA 2VQ6A 1X70A 3RUHA 5BOSB 3JSPA 1CETA 2HSWA 1M2KA 3UJ9A 4QU0A 5CTJA 1IJFA 1F4LA 3EBPA 1LDBA 3PXGA 3CE9A 3N76A 1LDGA 3LZ6A 3V8BA 2N3ZA 3LA7A 4XMYA 5BOVA 3QFRA 5AXAA 2P40A 2XT0A 4WN9A 4RDHA 1SFRA 2QYSA 1RTTA 2F6CA 2QT0A 4PW0A 1EFRA 3DWLE 3RU3A 2C4HA 3GF4A 3I05A 3OMLA 4HLDA 3IE1A 1MOZA 5KQMA 5JAZA 2Z2ZA 1A5ZA 3RUAA 2XB0X 1J5PA 2HA2A 2YKGA 1LS1A 1EFVA 2ID9A 4HI0E 1J75A 4ZOAA 3PJEA 2NYVA 1OU4A 3L0PA 3HUFA 3P2JA 1TQMA 2ID3A 3WGZA 5K7FA 2AW5A 4LXUA 3BK1A 5F98A 1QH9A 1JIQA 1I13A 3LTNC 4YYZA 2PGNA 4G1EB 4DWVA 4ND7A 2OCKA 4F2GA 4QC2A 4Z2AA 2I4RA 1VPTA 2B2NA 2HU5A 1YZNA 3DEKA 4BY1J 4AURA 2FQ3A 3GLGA 4TV9F 2BUCA 4H60A 4M99A 4OI4A 1Z9CA 1VI2A 1KZ1A 4BB0A 1RI7A 2Q8PA 3ZHYA 3GCMA 2IBSA 1FSZA 4Q3BA 1NDUA 3P32A 4AJJA 3SJUA 1KSGA 2OA4A 1HY3A 2ZUBA 3FYCA 1OIVA 1VOTA 2FK8A 4G0XA 3P94A 3M6UA 4HGOA 3D2CA 1WF6A 1V7QA 4ZRDA 3WLTA 5CVTA 1YWGO 4QNNA 5TPWB 1DAHA 1V5IA 1XK7A 4HX9A 1DDOA 1KZGB 1B72A 5DN6A 3R7DA 1TYBE 1UAGA 1K5HA 1EWVA 1X7XB 5IAKA 3OIVA 2ZIEA 2ABWA 1MTOA 5HKLA 4A6EA 1ZCBA 1RDFA 5E4TA 4LSGA 1M2GA 4YCDA 2Q3CA 3X2SA 3B2EA 2DCUA 2FU5C 4U7FA 1SBYA 2PFGA 3N9IA 1NI5A 3GEGA 1J6UA 3IRRA 2H8KA 3G0CA 3IVXA 3DLHA 1IC6A 1UJ5A 2ODNA 3G2PA 3KZMA 1O95C 4O4JF 3BTLA 2DBVO 4HAYA 1YFZA 4KMMA 1N77A 4DAOA 3EZFA 3MQ4A 2FLVA 4V0LA 5G0WA 3EUAA 3CJRB 2YL2A 2B37A 4IDCA 3RROA 3QYPA 2W2VA 4J91A 2H4ZA 1MSEC 1NKVA 1J0BA 4QWWA 1ONBA 4IEJA 2YVUA 4LV5B 1ZLXA 4IYJA 4ZZ0A 2AX4A 1GUZA 3H86A 1LB2A 3BG3A 3CW9A 3I61A 3LXXA 2LOOA 2AUNA 4JA2A 3D7SA 2VDRB 1GQYA 3PRHA 3U3JA 3B6MA 3KKPA 4CDRA 1ZOOA 3AY3A 1T4DA 3DV8A 3OLCX 4QEKA 1QHEA 1USSA 4YRPA 1V0JA 3D4OA 4C6TB 4TYPA 1O95A 4QPJC 1EFDN 3BWDD 5C4JJ 2G0NA 4RAGA 4WOJA 1OVGA 4HOYA 3UAGA 2YMPA 1GSHA 2MSKA 5FTLA 3GJ0A 1IMJA 2JAPA 3FZGA 1N0HA 2ZREA 1N8KA 3WKDA 5HVNA 2Q5LA 4M0DA 1REPC 4C7JA 3ZQLA 3PQ6A 5A5GA 1X9GA 3O2PE 2EIHA 5HXAA 3PPXA 1RIIA 2AFHE 3D5SC 1BR1A 4CM6A 3MFYA 1FNSA 3D5QA 1NFQA 2IUUA 3KUDA 2CWEA 5K3EA 2FZGA 3D7RA 4IV5A 4OIFA 2RH5A 2BKUA 1QLHA 1NT2A 5ENDA 2HXYA 4DA8A 1PO7A 4ZQCB 4CEHB 1BW5A 3NO4A 1XXHA 3R9XA 2Q0SA 1XLVA 4PC3A 4XLCA 4WCVA 3Q4GA 1RWWA 3IO5A 3NATA 1PT7A 1TE2A 3H9JA 4LKOA 1J5YA 3H5IA 4K03A 2XMDA 2BD0A 1T2FA 2P41A 2YXLA 1XGNA 3WHCA 3NUGA 2FH5B 4P58A 1IL0A 1TEVA 3Q3SA 1MX3A 2K9SA 2V1XA 1Y1KE 2OT3B 3K1MA 5ICMA 1CTQA 2YWFA 4UUSA 1ORRA 4CEJA 4HZIA 1W48A 3TM4A 1L7XA 3EGDA 2YOFA 1ONNA 1S5LC 1VLLA 2FXIA 1A5AB 5IJ0B 3IUQA 4QUDA 3PF8A 3HTXA 4FGWA 5JE8A 4C0LA 3HNPA 4TLCA 4AJPA 2P1RA 1M2WA 4K3UA 3FDJA 1E3EA 1DB3A 1FUUA 3MWGA 1RNLA 2IY9A 3UMRA 3ONQA 2EV9A 1XPJA 4JX4A 5EP3A 1OW3B 1YVUA 4F52A 2VH1A 3QLUC 4HDAA 1TKRA 4OATA 4IX7A 1OWLA 2E3JA 4QDKA 4LVCA 3PVCA 4OGWA 3R5KA 2RIRA 3T3GA 4E6PA 2DLNA 4M8SA 1X2EA 2CBZA 4ZYTA 4WXPA 3M9LA 2D5VA 3ND8A 3EGOA 1P7IA 4RGRA 4B40A 3NIGB 4EKGA 3DVAB 2CB9A 1EU1A 5TX7A 4DMGA 3ZS9A 2B36A 4BMCA 3VR4H 3OEEA 1YS9A 3I0TA 4BN5A 2AEFA 2BAGA 1M6NA 1A04A 2JIZD 2HA3A 4P86A 3M5DA 1DIHA 3QLUA 2HRCA 3GCXA 4RAOA 1PJAA 3H97A 4MVJH 4Q01A 1ZN8A 5DTQA 5K0TA 3VPXA 1C7IA 4M76B 1KEEB 1TEHA 2OO3A 1XPXA 4H0NA 4MHGA 3ER6A 1IHDA 3PL8A 3KX2A 4DV6B 2DY1A 3O74A 5EEAA 2FI1A 4RLHA 2CN1A 1TJPB 2CEKA 4GDFA 4NZYA 2RNJA 4YRAA 1Z21A 4J49A 2YUSA 4NBNA 3E6CC 2DT5A 3GEEA 1D2HA 4E2ZA 3KDPA 3U21A 1CQPA 1D7AA 3U26A 3PEUA 5TEVA 3EUKL 3L00A 2LCQA 3PR1A 3JZIA 2E34A 2FUEA 3FF4A 3NX4A 1T1EA 3AILA 2A5FA 4TYNA 5BN4B 2PK3A 3KU1A 1C1XB 1ETXA 5K03A 5GPBA 4B9EA 3JQ8B 4HB2A 4E07A 4AUXA 3QX3A 4CVNA 3PTAA 4RIGA 2EJUA 3I6MA 2GZRA 2J5PA 4CQLA 1EPUA 1XROA 4V2GA 5FBWB 4DCMA 1LJ9A 4L0DA 1Y3IA 4JLPA 2W48A 2KHMA 5JLWA 2HJHA 1H5UA 4YUVA 4QVKA 1D5WA 4Q16A 4HDSB 1ZLJA 3GB9A 3DLCA 4DBRA 3FNHA 3DXFA 3R0IA 2Q3BA 1LVUA 5KOYA 3OQIB 5EJ7A 4ER3A 3T4EA 1E0EA 1H94A 1HYHA 3CZRA 3E9MA 1XFDA 5JSHA 4I1SA 4OH7A 1QC5B 4LJRA 3OZAA 1Y6RA 1H8HA 1BMTA 4MHSA 1RAHA 4WLVA 1H66A 2Q2QA 4RTOA 2D5BA 5A03A 3OYNA 2WTBA 2XCUA 3WYAA 2B8TA 1EIWA 5DCYA 3VJLA 3A2MA 3L0CA 4FS8A 1XPUA 3QG1A 5FNVB 1MAHA 3L41A 3UO8B 1DWPA 3TINA 5JWRA 3LUHA 1T8YA 2BKXA 4CYMA 5AD1A 1JF8A 2IU6A 5UKDA 4JJEA 4MGHA 3PO3J 1COWD 3S2YA 2PSFA 1NBOA 4MRNA 1WQ1R 1SKMA 1DCKA 4KFCA 4GFDA 5FOXA 2GN9A 4XD7A 2XF8A 4TTAA 5BWCA 4X1KB 1RU3A 2I87A 1YW7A 2VVTA 4UPVA 1WA5A 5SV2A 2M45A 1C7RA 1NN1A 1GPMA 3WIEA 4JJ4A 4UBIA 4GM1A 1TI7A 1E96A 2I29A 4M1QA 4D92A 4NZOA 3CTPA 5JY1A 1Z4QA 5FBZA 4XUEA 4F91B 4LJYA 4NX2A 2XDQA 3A6ZA 4RHTA 3S81A 2V0NA 2ZQYA 3IL2A 2ZSBA 4BQFA 2VOPA 2GCOB 2CHGA 5E18F 2LDBA 4IQ4A 4A91A 5SYAA 4H1UA 1E66A 1U5TB 3I56I 3NHYA 3LW8A 1Z5PA 1KMQA 2WJJA 1XZFA 4HDOB 1FSHA 2XCLA 3R5TA 1P31A 2WAAA 5ELXA 1LUJB 1KZ6A 4TRMA 3CP2A 4LG3A 2JI6A 2WIKA 2V9KA 1LBQA 2O8FA 1MNEA 4DC1A 1GDDA 1S29A 1LFUP 3JAMZ 4OHWA 4PRLA 1QLWA 3WB2A 3S2HJ 2HK6A 5DM60 3EQ7A 5DHUA 4YV7A 2VDUE 4G2NA 3SHVA 1UC9A 1V7CA 1SCUA 2VDQB 2WHQA 3KPUA 5CFLA 3ENZA 1Z73A 3L5OA 3KTOA 3RS0A 1H2XA 3ECOA 1E89A 2EG9A 1OOEA 3G8AA 1IULA 1LSUA 1P45A 3RYIA 4MUNA 3SQXA 1PJCA 3BOQA 2RH4A 3WGJA 3T0FA 4CFYA 1G2IA 2HLDD 5BVGA 1NNEA 1QOZA 3C3XA 1WCMJ 1BSVA 4BB6A 3UCXA 3Q88A 3NETA 1P6UA 2Y92A 1NYRA 1B2LA 2B34A 1TU3A 1F8FA 1A88A 2CXHA 4Z8XA 1GIAA 1KK3A 1MABA 4QLCU 3AVXA 4UM8B 5BQPA 1XLWA 2WHRA 3AHDA 4O63O 3IA7A 1S6YA 1QZUA 4Y98A 3SM9A 3PD1A 3RLIA 1WD5A 3MJDA 2ZI9A 4I02A 1RSZA 1O5OA 3ISJA 3QM1A 4PNEA 4LV8B 2MLKA 4Z51A 2I2CA 2DO7A 3PV0A 4W9MC 4JBAA 3K71B 5L7YA 2PJPA 5CVJA 5I4BA 4GWGA 2H0AA 5HHTA 4DWJA 4YCCA 3AMVA 4XFJA 4WZBA 4UUOA 3TOZA 4E11A 2FCRA 2PMFA 3OIQA 3GTKJ 1JFVA 3F3YA 4AJNA 1FFGA 2BKVA 4WEQA 5F5XA 1AVTA 1B1AA 1KI6A 3SLRA 3G0DA 1IQ0A 4UY8I 4PGMA 5EWMA 1G3RA 3NEJA 4IDPA 1PNQA 1QMGA 3JAMA 3WNZA 2IDZA 2JCBA 1CW2B 4ACBA 2JLVA 1MIOB 4REQA 4OH1A 4NZ9A 2B3DA 1M75A 4NCNA 4NVRA 3A6PC 4JP5A 2XMPA 4BRZA 3VJMA 3LJKA 3PA8A 1Z0IA 1DQYA 3NRBA 5AVYA 5CB4A 2IYUA 4IHXA 1ZK8A 4NFLA 4J0JA 2EH3A 3FPAA 2QGNA 1U7TA 4D6YA 4XJTA 4D0RA 3B6EA 2CHVA 3VSAA 3HOUJ 3GRZA 4EM2A 4S04A 4US1R 1HEUA 3U44A 1S2MA 3G1WA 2HEGA 5J4VA 3KZ1E 2I54A 1I5ZA 2YYSA 4FIDA 4JWKA 5EI5A 2YICA 4EATA 3QYFA 2DTRA 5C8ZA 1N92A 3EA0A 2VWPA 3AV3A 5HF6A 4JC8A 3AG1H 4UNNA 4TKUA 4IF4A 4JCOA 4KAXA 1CQWA 3ZXUB 3JVVA 2CSOA 1WH5A 1TMGE 4ARCA 4F3YA 2G6TA 2GYYA 1N2CE 4M8NE 2EOAA 4LYEA 2XNSA 5B64A 3HYLA 4B43A 1Z16A 1TM2A 3RH0A 4GWKA 5D8KB 4QICA 1XD8A 1K92A 1KYWA 3HCPA 2WHXA 5EE9A 1U31A 1OCPA 1GYPA 1YJNI 4YGXB 2ZI7A 3OOHA 2DQYA 3TLCA 2JEZA 3K4CA 3OG9A 2LIVA 1YB2A 3WL7A 3NV7A 1WSBA 4WY2A 1SD4A 2LPMA 1R22A 4MWTA 2E1OA 3RZOJ 5L3SA 4BLRA 2PX2A 4HUQB 3O95A 3ZGKA 1I1HA 4L5YA 3STWA 3IGFA 1MHPA 4K2HA 3FDYA 3VO2A 4MUJA 1F7VA 4YRCA 3HFJA 5FOWA 3N8DA 4S12A 4MS3A 3HCEA 1KU9A 1VFCA 4R2WA 2HXIA 1Z0AA 3QP9A 4K28A 2Y1FA 1MKYA 3HYIA 3GRRA 5AYVA 3L1KA 4GWLA 1H2BA 2VRBA 4HAWA 2FPOA 1YX5A 2EKZA 1IB6A 3QA3E 3L2OB 3CPEA 2C9MA 4Z7NB 4ABTA 5BNGA 4PSKA 4CBVA 5LQJA 4RWEA 3LY8A 3CBGA 1FVFA 2OKCA 1OT5A 5C1PA 2G08A 4EITA 1W35A 4PYLA 1P7PA 2BXYA 4S1WA 1H8EA 1P7VA 2JEYA 5DHPA 1LS6A 1UM9A 4GCVA 2AN3A 2MW8A 1PYVA 3BJAA 3DZBA 5CFOA 4KYIB 3A6HA 5MN4A 1T4BA 3NFYA 3ZCPA 4FYJA 3QV2A 5LNK6 5LEKA 3IQWA 1Q19A 5EWLB 1AGNA 4YIFA 1M33A 2YV2A 5I7RA 2K3FA 4AS2A 3LBHA 2XCOA 2VPRA 2B0CA 4BMZA 3I6YA 1IXYA 1L7DA 3BWMA 2NLOA 3TLEA 5GAJA 2G76A 4L8FA 3CNNA 2PMBA 3OM9A 4URVR 3TOBA 1GN8A 3KQYA 1FLNA 3FJYA 4IQGA 4GUAA 4IR7A 2QL7A 3U3MA 5CX4A 3VV3A 3MWFA 4CIVA 2FMFA 3HU3A 1G9TA 3AJ8A 4LLLA 2ARKA 1D9XA 3GELA 4O4LF 4AD8A 1XSDA 1SXGA 2XIGA 2GD0A 3BE6A 4PYIA 3S28A 4X60A 1KYYA 1PS0A 2DRIA 3QVGB 1EDBA 1GHCA 2ODBA 2BEUA 2BYTA 4MTDA 5FFNA 1HDYA 3Q3CA 2DFDA 1RLJA 1E9RA 4MUIA 3MKZA 3JTHA 3P9SA 4IAOA 2J30A 3P0IA 2I2AA 2VDJA 4FP9A 3T1NA 1U6IA 3B3QA 4MQUA 4I55B 2XOKD 2Y6VA 3K5PA 5A5VA 1CUEA 1NJFA 2PL5A 2B7BA 1WJFA 4QUHA 1AU9A 4CDNA 2QLLA 4AM3A 1FC0A 3K94A 4Z4HA 1EK1A 1R9JA 3S70A 4BFLA 4DCOA 1PJTA 1T4CB 4BNGA 1JT2A 4KO4S 2K9QA 4TYYA 1CK4A 1C8LA 3P52A 4PHTA 2W11A 3SQMA 1QQ7A 3F72A 4R8MA 1QFXA 1MH4A 2WY7Q 5DX1A 1C8VB 2JEOA 1ZGZA 1LQ2A 3HVRA 4EDHA 1CRLA 5JEDA 3VAAA 1UHMA 4MYRA 1T8UA 2AQHA 4DA9A 1ODLA 3F8MA 5BORA 1X3LA 2KFDA 5E4JA 4BP3A 4IZHA 2WM9B 4F04A 3TRKA 3IAAA 3EAQA 5G0TA 2LLKA 2XNKA 5CXSA 3NR2A 4XW2A 3H6GA 2DWUA 4POOA 4G1FA 2P8SA 3ONVA 4D4HA 5CMLA 2ZUUA 3WG7H 4RNDB 1RWOA 4X8OA 4HBZA 2BVNA 2CV2A 4OHPA 2ONJA 3EDPA 3S1SA 3L6UA 4XB1A 2I33A 2BEJA 4O02B 5C9ZA 1JFFB 2LC2A 3HBNA 1SG6A 1LWOA 3K4LA 5FADA 2GN2A 2WD7A 4NDLA 2JLCA 2YVKA 4WKGA 1XZPA 4TRNA 2QTLA 4R2IA 4BY7J 3LHFA 4TQGA 1NXPA 4CIDA 4Q3LA 3ZWMA 1XMQB 1IN5A 1G3QA 1FNDA 5LOVA 1MO5A 4EPRA 1AZSC 3UNGC 5BVHB 1YC2A 1NJ2A 4LTMA 5DGHA 5FTKA 3R4VA 1CCWA 1P29A 3IJRA 2BVMA 1YCDA 1K78B 2WIGA 3CGGA 4I4TF 4ZI7B 2KJCA 3TQHA 3C8ZA 3G2HA 1L4UA 3NCTA 4P4TA 1C3OB 2FJUA 5FD8A 2FOXA 2V9PA 2DHQA 4HQFA 2NUTA 1W5AA 3TQRA 3WZLA 4ZO6A 5IUNC 4FN4A 1L4HA 2WTMA 4GOJA 3ADPA 3EIEA 1I6XA 2BHRA 5IABA 2WICA 5BURA 3N0RA 2Q2EB 4MGZR 4OHCA 2CF6A 2Z83A 5ALKA 4ZO4A 3MHTA 4K2EA 4KN7X 1RT9A 5J5CA 4PRZA 3TLYA 3HXMA 4WLUA 2NXCA 1CZUA 4AP5A 3BRWA 2X15A 5J4YA 2E4YA 3UMSA 2L3DA 3EXFB 3DPTA 2X8LA 3C85A 4FXPA 2W2KB 3G02A 1DO8A 4CL2A 3NS7A 4RMIA 2VHQA 2GFQA 3ZWQA 1XCGB 2RI6A 3RRYA 2HWWA 5U1PA 3Q0UA 4CMAA 1JUPA 1XEXA 2X9DA 3ASVA 3RD5A 3G0HA 4U3JB 2F9FA 1QQTA 3FI0A 3A0HC 4U9UA 2I3ZA 3M6IA 2O5CA 2UV8A 3UT5A 2FE4A 2NTYC 5FL7A 4DYRA 3EXIA 2B8JA 3JR9A 2DVMA 3KSAC 2X14A 1YQEA 3UIEA 4FYXA 1RTKA 3BB4A 3W2EA 4E30A 3KBBA 3LO5A 2F5FA 1DQRA 1V4RA 4PPNA 5KYUA 3DDUA 3FRIA 3EE6A 1GGNA 1SUWA 2W42A 1JTEA 3OX1A 2C5EA 1N0IA 1UC4B 2ZTHA 1BH2A 2R1VA 2J87A 1XLUA 3A4TA 2I4LA 4MI9A 1M1YA 1VGRA 3BJRA 4G5RA 3TCKA 3B6IA 4BLPA 3ZS8A 5A06A 4AJHA 4HNHA 3FK7A 3GT0A 1I32A 2WKWA 3I59B 4GL4A 3QJGA 3WS7A 4G9BA 5IYBJ 1SURA 2HU7A 1DXQA 4WXCA 1NW9B 1RKUA 2JFHA 2O9JA 2QM0A 5KVSA 4LBVA 3F6RA 1FRNA 3AF2A 4EEKA 4I9UA 4XM2A 4JZYA 1DKNA 2JA2A 5ALNA 4J9VA 3VNSA 4N6GA 1SUFA 1NVMB 2QD1A 3MINA 1QSGA 3NC4A 1Y4UA 1CQJB 3I45A 1PP8F 4Q93A 4JP1A 4YMUA 3H5OA 2RGBA 1DBWA 1USIA 3DZ8A 3UANA 3AF1A 3T1YB 2H1CA 1QGZA 1P72A 1NQOA 3CZQA 5FV7A 4JXXA 5AI5A 4K9LA 4B3AA 2Q4RA 1VTNC 3FWKA 1K1EA 4OQQA 1CE8A 1EYZA 4DBLC 3FM3A 3CCEI 2DA2A 2PT5A 4J90A 2M0MA 5CYPA 1DTEA 2ECOA 4HK4A 2O3SA 2NXJA 4N8EA 2OEPA 3VU9A 1R0BA 3VHXA 2V8OA 5KTPA 4HY3A 3W5IA 5DHFA 1GAJA 1USKA 4BKQA 3D5RC 1EM8A 1Z36A 3NIBA 3DQZA 4MUEA 3NB0A 4XIFA 5EHNA 3I9KA 5LBTA 2C7RA 3H42B 5FUXA 1NW7A 2LKSA 1XP8A 2HJGA 4ZD6A 2ZYTX 4Q9IA 3SHOA 3KB6A 2J3QA 2ZR0A 1GGJA 4PYMA 4HZGA 2G4CA 2MU1A 3R23A 1PHPA 3NBXX 3VUEA 3G5UA 3C0KA 2ECQA 5J1TB 1JJ8C 2FEKA 3K4KA 1WWXA 4W5HA 3R0AA 5IVDA 4CF4A 3ISTA 5IVKA 1Q15A 1VJ0A 3K6SB 1C3LA 5I7SA 2I7DA 1L4KA 1KO4A 2GTPA 4HWGA 3AK4A 3D4PA 4KN8A 5CVVA 2R85A 1UXHA 2WA2A 5E20A 3BH0A 5EJEA 3OU2A 3UKJA 2VPIA 5A2QK 3LS2A 3JW8A 4TWBA 2H54A 2PGJA 1ZK1A 3MEXA 4IDBA 1K6IA 4DPKA 2Y1XA 4NR0A 1B4AA 4EW6A 2RD2A 2GNPA 2EAUA 3VR3A 4MWOA 4E13A 4RH1A 4DCSA 2ECBA 1NRWA 3ENKA 3D8UA 4MS1B 2HHAA 3EPHA 4DLTA 1GCIA 2DY0A 1UG2A 4C3VA 3KAJA 3NXSA 2QV7A 3STUA 1ENHA 5LLTA 3PC4A 4JR0A 1N5KA 3ZQHA 2G5PA 3GPCA 5D3MA 3GJ8A 3ETNA 2A9RA 1O2DA 4QAJA 4RPJA 4DFDA 1MH1A 2F1RA 5IRCD 5JD6A 2OCAA 3EGXB 5F33A 4EJMA 4GKKB 1R8SA 2R7VA 1N1MA 1TZBA 2DQZA 3RYHA 1BI3A 3Q11A 4W97A 1V3UA 4LB5A 3GHYA 1P81A 1N7JA 2R8YA 5KDLA 3NDRA 1R1DA 2WTNA 1CRPA 2CV1A 4C04A 3I2YX 1SA0A 4FEAA 4UHBA 5DRTA 3DOCA 4W7SA 2IEIA 3D4IA 3OLYA 1SOVA 1QIFA 1IF1A 3RWBA 2R65A 3O3OB 5FKLA 5ERYA 3MLAA 3WLPA 1ZAYA 2Z16A 1OX6A 4FTWA 1XG1A 4UBMA 5T7BA 4RVSA 2CLSA 4HB4A 3OYLA 2IYTA 3S1AB 3UWSA 3V6LA 4PGAA 1C4XA 3UFXA 1Q14A 4KGDA 3U4DA 1XYGA 3UW3A 3GRYA 1QIDA 3DCYA 3SXJA 2QG4A 5CA0F 2QN6A 1YRQA 4CFZA 4B8XA 3AEYA 4RV4A 2HFHA 4DJ5X 1QQIA 2W57A 3F73A 1SHKA 1KYVA 3BQMB 4XIJA 4QJ3A 2DR2A 2QRPA 4BFTA 3VKHA 5EP4A 4B82A 2X6TA 3VKFA 3INNA 1T9CA 2XAJA 3BS4A 2X9GA 1HR0B 3ZZTA 4R1HA 5JG7A 1N1DA 2GBIA 3PHJA 4DEYA 2P9CA 4UEQA 1RD4A 3T7CA 1ACMA 2D74A 4E1VA 4ARBA 2LREA 2UU9B 3SZTA 1LPAB 1WG8A 4ZYUA 2WB1N 3IJEB 5E8GA 1Z9BA 5TR9A 4J3JA 1BN5A 3FRHA 2GN1A 1PUJA 2BZ0A 3RRMA 5H02A 2NZWA 1PFUA 2OESA 4OSPA 3ZGXA 2CFTA 3KAKA 4MWDA 5DX8A 3PM1A 2LBPA 2VPYA 5CYGA 1J99A 4PBTA 4QGGA 2H1WA 1WHUA 1A4IA 2V55B 2NU7A 3L8EA 3RJ5A 4BHBA 1R49A 3G13A 4ALIA 4HEA2 2STTA 3VR4D 5FQNA 3ZCOA 2V5AA 4OOFA 2DAOA 1DRVA 5EG0B 3BQZA 2B4TO 4JL5A 3P9XA 5F04A 2CNOA 5H82A 4DS3A 1QUFA 5CPFA 4U63A 3W8NA 5BY2A 3E3AA 4B71A 5DP2A 1BXZA 3I9V1 3PPWA 1WMBA 3SYRA 3MJRA 1KI2A 3F8SA 4GEKA 2OHJA 4MVJD 1TF5A 1XT6A 3FUVA 1H2FA 4JHLA 2QRZA 5JNVA 2JVGA 1ZEMA 3LLSA 2D0PB 3RSZA 3WE3A 1E3WB 2XKJE 3V48A 1JHFA 5K3BA 2Z30A 3ZJYA 2H8RA 1K8RA 4H1HA 4WCDA 1XZAA 1Z12A 1IXCA 4M7OA 1OIXA 4HA8A 3BTIA 1SXJC 4L6AA 1LQUA 4MEAA 4HH0A 4D8UA 1DC6A 1YS7A 2EFJA 5B37A 1YUMA 3EN0A 5CXQA 1CG6A 1WHSA 5K51A 1P4AA 4EEFG 1C3EA 2NSDA 2QMHA 1U0FA 1JHPA 5G53C 4G0ZA 5FFXA 1JLLB 1T6ZA 3HDDA 3RSFA 2JHCA 4C07A 2WW8A 3BFKA 2MMCA 3DYBA 2EGHA 1E98A 1KI4A 4RK1A 1E1DA 4KQCA 4LF6B 1L5YA 3CZCA 5FIUA 5ALSA 2XUAA 3N75A 5CXXA 3AR4A 3GQBA 3CLQA 1R27A 1D1CA 3Q5DA 1SXJA 5EE1A 1TOAA 1SQSA 4Q9AA 4LZLA 1YCGA 2ZT5A 4NI5A 1UFQA 1L1EA 3OZEA 1F43A 3ONNA 2D4HA 1A36A 4MSUA 4GUDA 4IH9A 1RKQA 3AHHA 1Y9AA 2GJ4A 4AY4A 3E5QA 4AZ3B 4QSHA 2V9VA 1G42A 2XBMA 3D0SA 4Q3KA 2PA0A 3NTOA 4K6GA 5FT9A 6REQB 4IOCF 4BGEA 3RTDA 4HMQA 1YBMA 4WTOA 1Z0UA 1B6GA 2F5EA 1SCBA 1I01A 4HDRA 3SY8A 1NUPA 4FYMA 4OQLA 1JXAA 5J63A 4M6YA 3I3SR 3CMAI 3BWXA 1HBXG 1LBHA 4YRZA 5EYRA 3F8NA 1Y6JA 1WTAA 3TQSA 2IYQA 2B20A 2MHCA 2DFVA 1TKAA 4RLSA 2L0XA 2VAPA 3D3WB 3WFZA 1UP6A 3CVOA 3HHPA 2PLNA 4I6JA 3VC7A 2Z8XA 3BXFA 1U90A 4DNQA 4TZ0A 3G9ZA 4B3GA 2JIQA 1X7HA 1QTQA 3M82A 2HUNA 3G49A 1SGWA 2GASA 4U7PB 1MOQA 3FI9A 4DDVA 3U6KA 2QQEA 4KVGA 2QRKA 1XWFA 1L5QA 1TM3E 4UC0A 3ZMZA 3DEYX 3CR3C 4CPDA 5CX1B 2CE2X 3RAGA 2F2TA 3WL6A 3L0DA 3RADC 4RGYA 2OY0A 2QY6A 5JLJA 4AMYA 1JBEA 3GDWA 1NUTA 1IRIA 3C5EA 5F5NA 5IDVA 3E22B 2C29D 1U8BA 3DE4X 4GMXA 5TPZD 4MPJA 3H1CA 2QRGA 3LOPA 2PG4A 4MINA 1UZAA 3RAFC 2UZKA 5EUBA 5BV0A 4N7BA 3L7BA 3LU1A 2IL1A 2E5NA 1USGA 1XUOA 4B4UA 3JWGA 4M7RA 4GPD1 2DPDA 4O2AB 3WYBA 3FR7A 1JAXA 3THRA 2R96A 2G82A 1MMGA 2YHBA 4A69C 4LNUA 5AT1A 4RB0A 4EJUA 1NASA 2NX2A 4HRIA 4AYBA 2HDNB 2ZUFA 3CEPB 3RCOA 1UWLA 3OCZA 3PQJA 1VGVA 4UFPA 3BWGA 3Q0IA 1F9NA 1KQNA 3OT5A 3U40A 4Y1EA 1OCCH 2Z5UA 4EO7A 2REXB 2JFXA 3GFBA 3HVKA 4D0GA 3LX8A 5HKKD 4MQVA 3LDHA 2YV1A 4DV3B 5TVGA 4LCJA 1WEHA 4JJFA 3DUFA 5KWSA 3WU2C 2Q46A 3KKQA 4UU0A 2GJAA 2ZJ5A 3P9YA 1T43A 5FBKA 2IIBA 1GQFA 4YAFA 1FIAA 1EZZA 5SZHB 4BKRA 4KQ6A 3UK0A 1XL1A 3V8KA 3URKA 4E5KA 4XTCS 4DA4A 2B63J 3HTSB 1I4LD 2YWBA 3JV7A 4HMPA 2XVZA 3PBKA 2QTBA 1PUFB 2O8EB 1D0ZA 3HOSA 1OASA 2I4OA 1MBEA 4UVEA 3UOAB 3CUVA 1NVWQ 2EL9A 3TIIA 5LB4A 1DDNA 2WLSA 3TE7A 3ZXXA 1QO0D 4KYVA 4F12A 3K1NA 3G3ZA 2NQTA 1I7PA 3I6IA 1XVVA 5DP1A 2QTFA 3D4NA 4HAVA 1QVRA 4OF4A 3S14J 5DOVA 4H7PA 1W2GA 2IK8A 4JB0A 2V1NA 2C8VA 2Z9BA 5BO5A 2AA3A 1ZMXA 1H88C 2DKFA 1X1SA 4LXQA 3GGSA 3UKDA 2DT7B 3DHNA 4EYSA 2CHFA 2HJ9A 1X8XA 2M34A 3E35A 4ZVRA 4RTSA 5EWJA 1UP7A 4KV7A 4JK3A 2EB7A 1VHLA 2X0JA 1HMYA 3U81A 2NPOA 3CUOA 2V7QD 2FZEA 2QXYA 3G5TA 3HVUA 2XAAA 2GSDA 1Z4IA 4C4ZA 4LOLA 2WRZA 1U3DA 2QRQA 3H99A 5CNMA 1YHNA 1LK0A 2YV4A 5CB4F 2FN3A 4UNQA 4BCCA 1UBJS 3TNJA 2IEZA 2VYCA 3L6BA 4MQ4A 1LH0A 2X51A 3VPCA 3BJMA 4I3HA 2FGKA 1J8YF 1W96A 3FKSA 4CR8A 3ERCA 5CJJA 2G04A 2R5WA 2WT9A 4ZVVA 2ZYSA 1MV8A 3HSKA 3H3FA 4RMNA 3TL4X 1KZYC 1B76A 3SEQA 2PUBA 1D8TA 4UNOA 3C15C 3ZCSA 4X65B 1DAGA 2Y0BA 9GPBA 1JMYA 5LL6P 3IUOA 1PK7A 2QU7A 2D59A 3HN7A 4JLAA 3PUVA 4FMDF 3CRQA 3C3JA 4JNKA 4XRSG 4N7RA 1IEXA 3M2TA 4YCNA 3QBDA 3ENVA 4OU0A 3CH5A 3HOVJ 2MYPA 3K53A 2ZJPF 2OYCA 3FFAA 3QU7A 3WDKA 4MB6A 3C7KA 1GSOA 3T5TA 1R6AA 1GL7A 1PBTA 1Q92A 2X4HA 3FNBA 4Y17A 4ESHA 3MFKA 3WBJA 1KIFA 1A9SA 3U4HA 4MKIA 3SJCA 1XNRB 3CEMA 1P62B 4XWKA 5DRYA 1QBKC 4A82A 4EARA 1YVRA 4XL9A 4JBNA 3ED1A 3RG2A 4IVQA 4CKXA 1LJLA 4QFDA 3MQ0A 2FXAA 3JCUC 1LUAA 4R5MA 3N0WA 3NHLA 3K4HA 5EGSA 3A1NA 2PE5A 3VPBA 4X44A 4ND2A 3ILSA 1DWQA 5LSAA 2YCLA 3OTHA 3C3AA 4BDYA 2WAEA 1MNAA 4OUDB 4IVRA 1C8BA 4J0EA 4JI3B 3AETB 4K6HA 4PQYA 4IYRA 3OZFA 2XODA 1PL6A 3LUKA 1MRZA 2ACJA 1EFPA 1FP4B 3GLIA 2EPFA 5H16A 4Q39A 3VYUB 2WJPA 3MS7A 1DC3A 3QI2A 2I5UA 2VQLA 2A3NA 3WB1A 1PTJC 4E88A 2L7FP 1PR9A 5KPJA 2I6UA 2KIMA 4U2GA 1M34A 2PVPA 4OUKX 1JQ5A 1H0SA 4KRYA 1UJ2A 1U80A 4CHUA 2BDEA 2F2EA 3BR2A 4I8XA 2EF0A 3K5WA 2B2XA 3KKNA 1Q20A 2DJIA 4EJVA 1YB6A 4QYXA 221PA 3HM5A 2KE5A 2Q9CA 4YV2A 2RK4A 4BJ5A 1NSYA 5U9CA 1M6EX 3GLHE 2XWPA 3HJAA 1OI4A 3I1YA 1MX9A 3M6XA 5I47A 2F5VA 2CUKA 2RHHA 4JS0A 4NC7A 2WQ7A 1TQ4A 3A7DA 3SYLA 1RRCA 3HO6A 5J2TA 3LBYA 1PTJA 4MP3A 3QOEA 1K4TA 1U94A 1RWNA 1YZFA 4Y9TA 3K1TA 1NBMD 1X13A 1ONPA 2F6RA 2D5AA 2H08A 1YULA 5CXUA 4BE0A 1JVBA 4I50A 2JJ1A 3VRHA 4Q7KA 2AZMA 3COPA 4G5HA 2FWIA 3Q6MA 4G0PA 4CT4B 3KDAA 2ZT8A 1R3DA 2W4IA 2GXSA 1WXIA 2G9VA 1W9HA 1JI8A 2G17A 4ZVOA 4E6KG 2P5UA 2C9CA 1DHTA 4L8WB 5GJWC 2WZDA 5LQMA 2KDOA 2Y0EA 5IEJA 1CR4A 1NHGA 4ND8A 3Q2OA 4KXVA 2AZDA 4EG6A 1E2XA 2B94A 2ZM5A 3DAHA 2A69F 4QFBA 3M07A 4WDQA 3W9BA 3WQSB 3TVYA 4P5EA 2G7HA 2NRAC 1VG0B 3JY6A 1UXJA 2EKBA 4RF4A 3K6KA 4AMZA 2DX7A 2O2IA 3C3WA 1M5RA 4CV0A 4IMJB 2VJKA 2XUBA 4ZC1A 3QWLA 1WQ2A 4UUMA 4MDYA 4RTKA 5KAPA 2XDAA 2MSDB 2CMFA 1ZIXA 2IYVA 2P6UA 4YCSA 1JFSA 1ZBQA 3WGTA 3E7WA 1J2XA 2WYHA 4UE2A 2O8BA 2ZU0C 4LC0A 2I6XA 2BEVA 1FFXA 1RLIA 1LE8A 1GPUA 1S2NA 1O96A 3OWTA 3OQOA 1RYZA 2V1DA 2NUPB 3CO0S 1P9LA 2LXNA 5KX5B 4AP9A 3O31A 1G8JA 3CIOA 4KVZA 1S3IA 2B4RO 4KE9A 1ZMRA 5F4ZA 3VZDA 1F6BA 4ZDPA 3R0ZA 3PFGA 3QX9A 3T1QA 1E5QA 1MBGA 3F97A 4R83A 4R81A 2HPHA 1WV1A 2W6ZA 4O2BB 1JA9A 3FM9A 5CJPA 3GR6A 5ALTA 2IF2A 1B0ZA 4AJ1A 1XMSA 1P9NA 1Z6RA 2JA1A 1EUCB 2OTJI 5G0VA 3AEQB 3IBFA 4ZYWA 3PFHA 3NEAA 3EASA 3RAEC 1ENPA 4TSKA 4Z7JA 5FOQA 5LOVF 3AERB 2IV7A 3FYSA 5GOZA 2NWQA 3AR5A 3WV5A 2PUAA 3KYCA 5CURA 2RGWA 3IUEA 4HXGA 4G09A 4OLAA 4IX1A 3U31A 4E2YA 1RACA 5GV8A 1A1SA 4DDKA 3P2OA 4EW2A 2WWYA 4M71A 5DNYB 1G21A 3L6CA 1ZARA 2HA4A 4FEGA 3F74A 3LSRA 4F4HA 1JT9A 4AJOA 1JZSA 2E1CA 4FD2A 4B46A 3SE0A 4MVJG 4FFOA 4C0XA 1AKMA 5HRUA 3VPDA 3I62A 4E46A 3DNFA 4RQTA 4Q66C 1YQ9A 4RAZA 4E5PA 3WQQA 2QVBA 1JVNA 4PVDA 3RYPA 4AMVA 3EUWA 5E9JA 2ZO4A 3LKBA 1TQIA 2XHZA 2G72A 4OA5A 1TQ6A 3WYFA 3OOPA 1ECJA 3V1MA 1MJFA 4GECA 2Y1DA 1Z88A 3QEJA 4M46A 1AA9A 2VBCA 1MMNA 2HIGA 4UTPA 4WV3A 5EXPA 3I1IA 2R1UA 1TK9A 4I2NA 3EVGA 1D1PA 1ULYA 1ZK4A 2IHTA 3CUTA 2HSZA 5ARBA 3IR6A 2GEKA 4UHFA 1GFWA 1OI7A 3PNBA 5HCIA 2ZRCA 2ISQA 1X9HA 3QF7A 3RIHA 3KHKA 3A4YA 1JEOA 2OOSA 2OWEA 5JALA 2NXNA 3PUIA 1HF0A 1P7YA 2OBPA 1B0PA 3CSSA 4MQEA 1D2NA 4XSXF 1ESMA 1XIVA 2ZDHA 4CF3A 2FDRA 2DFTA 3K1ZA 1WKCA 3QXSA 4ZV4A 2Q7XA 3L9FA 1XJQA 1KI8A 1T24A 4NNJA 1QRSA 2PX6A 3W34A 2FZ5A 1XGSA 4NFHA 5EUMA 2C99A 4KIUA 4AYXA 3NM5A 2E1MC 2WSMA 4QG7A 4FOOA 1QH8B 5L3QB 1TA0A 3RVPA 3PUJA 2PUJA 2BP7B 1QOQB 3IP9A 3WGKA 3QHPA 2PJUA 4X0GA 4TS4A 5F9HA 3HEAA 2B0JA 2CGEA 3K9GA 2BFCB 5BSMA 3MMSA 4GQAA 4YRJA 1LLCA 2I62A 3MWDA 4BNHA 3ZNOA 1JE8A 3H5WA 4YJHB 3J7AC 4A3JJ 1JEDA 3TOAA 3IXMA 4P36A 3H4VA 5DNDA 4I6EA 2GAUA 2FSUA 3DM5A 4DM4A 5IK2A 5CCBA 3QUAA 3F21A 4KREA 1XKTA 3CW8X 3JTMA 2JK1A 4NTZA 1Z29A 1CY4A 3BD8A 2J9XB 3WZMA 3OAAA 4FVTA 3VFDA 3DH0A 4K5QA 3MT8A 3B1VA 2AN5A 2JI9A 5CR9A 5JSQA 4HQMA 4MV4A 1BXRA 3FB1A 3KLBA 3B9BA 2H57A 3CNLA 3KJNA 2FP4B 1XZLA 3VR6A 2CY0A 3PLNA 4FSXA 1HZJA 5C51B 3VMMA 3OQPA 3SIWA 2C2YA 3SZLA 5E3HA 4I99C 2JLBA 4BZQA 3KZOA 3RYFA 3LLUA 3QF4A 4MWGA 4GBED 4RPGA 5EMKA 3K31A 3QFSA 3F8CA 4HQLA 1SKBA 1RABA 3RHFA 2M9HA 2AFIB 1VLZA 2JAUA 2J9FA 3PZRA 1AM4D 2HBQA 3MRVA 2OCDA 5FUMA 3KKEA 4B2YA 3PSHA 3DLLF 4H4CA 3TLXA 1IOWA 3N2KA 3BJEA 1R8JA 3JSAA 5JDCC 3COSA 3IC7A 2FPSA 3TOVA 1NNI1 2Q2OA 5E4FA 2HJWA 3TCNA 4GMHA 4I99A 1NULA 5ANRB 4R2XA 2IPMA 3LSKA 3FZEA 5GAHJ 2A6PA 5IANA 3JVEA 4LF7B 3MT9A 2HX1A 4J0QA 4D79A 1LNSA 2VJBA 5DB4A 2WJYA 3SSOA 1M8PA 3PX2A 1P6QA 1VSBA 2V6FA 2MFZA 4HD8A 1QK5A 4Q4HB 5LA6A 2Q29A 3E4DA 1VJGA 5CLIA 4F1KA 2NMVA 4R9SA 1ZNWA 5E7IA 3L49A 3JAWA 4JX5A 1F17A 2VYFA 4YJFA 1WUIS 5JDCA 1AC5A 4YECA 1MEEA 3DBRB 5A2GA 2V6CA 5FKNA 4XUGB 2NO1A 2DAPA 2BI4A 4QXQA 2Q5QA 1RWPA 1PJ2A 2CJYA 5JD3A 3OP1A 5BSGA 2CRGA 3RPEA 2VJYA 4HX2A 1M73E 1SUCA 4RS4A 1Y5MA 2ISSD 2ZU6A 2WBLC 1VB3A 3BMXA 3GAAA 3RG8A 1ZREA 1E79D 3OUTA 3UYLA 1JHYA 5JH7B 5DTEA 5I8ZA 5D2CA 2A33A 2NOAA 1G5TA 1T2UA 1JHUA 3KTDA 3U4AA 3BY6A 1LDYA 4X45A 1GV1A 5BSRA 3WFIA 5EZ5A 4WLEA 1DQNA 3J7YJ 5EIBD 1FMJA 2OGZA 4C0HA 3KZIC 4UREA 1GXSA 4RTPA 5G4LA 2TSYB 1W47A 3WBKA 4XGRA 3IPAA 3ANLA 3WHPA 1BQ4A 1KU7A 4L0MA 3ESYA 1RAFA 4I36A 4DNOA 3L8CA 1FRFS 5FI1B 3TX6A 1SVWA 2H94A 3DQPA 3SX2A 1LB1B 3FLAA 4IIVA 5C8XA 4MJ3A 4R0MA 4L16A 2X7JA 3O8DA 1TM1E 2HMUA 4QFMA 1NR5A 4U0JA 4CSWA 2DPLA 4YNBA 1FYXA 4L74A 1CJSA 3FPBA 2JZYA 4EAAA 1RHQA 2X1LA 1QO9A 1DT5A 1F4PA 3HLTA 1C29B 3CF6R 4LG1A 2HSDA 2WJ3A 3KQPA 2IWRA 4EYKA 2IP2A 3ABQB 1FU4A 3CE6A 1Z2DA 2BEWA 3Q8LA 1BHJA 1X0VA 3QP5A 4TTSA 3NWOA 2J0UB 4IIJA 4JI8B 1FNNA 3HJTA 2OCEA 2QNIA 1E1KA 5IBPA 1MB9A 4QOGA 1H65A 4RU1A 1DLJA 1JLKA 2CKDA 4ETSA 1Z5GA 2QLBA 3H1EA 2MYUA 3LNTA 4JU9A 2A07F 1UK7A 4NZPA 1FOXA 3B36A 4AKEA 3AQ4A 2QUFA 1BU8A 1XTTA 3BB1A 3ZE2B 1A72A 4QBKA 3K1AB 3ZJUA 3NVAA 1ISRA 1DP3A 4HLXA 3DGEC 4MROA 2OHGA 1Y8QB 1AQLA 2HQ1A 1W0KD 2LW7A 2VFAA 5CFNA 5E9WA 1OLUA 1NPDA 3FYHA 3D6VA 1S7CA 4B34A 2AVNA 4OI2A 4D4KA 3FXUA 1E2IA 4N9IA 3NVKI 2B4QA 3CLHA 1D2GA 3N2YA 4DGWB 4ZYDA 3FB4A 2WIJA 2IIQA 2ZKIA 4Y2VA 2SCUA 4Y1GA 2Z0MA 1FQWA 5HDKA 2CQ7A 5BN5B 1B74A 5F0FA 2P1ZA 4NS4A 4YMTA 1L7OA 4Y9SA 4YELA 3IAM6 3FLEA 3AINA 1F3LA 1PS8A 1YI8A 1NG7A 3AIIA 4KUHA 3OUZA 4ANJA 1KDTA 4LKRA 1A5SB 4PGHA 2P5VA 4PFSA 4XLAA 1M7GA 3BIJA 2Z57A 3D8RA 2JGRA 4WK8F 3GFTA 4LFCB 1E4VA 3IO3A 4R3NA 1ZMBA 4DBQA 3HEFA 1QS0B 4BGDA 2XJ9A 1O58A 1QONA 3TLZA 4CCYB 4XNFA 3A1FA 3PFNA 1U2DC 1XRMA 4ZO9A 2D1VA 2LR0A 4GYWA 2C95A 1KEZA 3TIFA 2DT6A 1DELA 5TQ2A 1VL5A 2YHSA 7AT1A 5C4IA 2IHBA 1GDTA 4FBGA 4QZVA 3KR0A 1VFNA 4FCWA 1A69A 2XCTB 2EP7A 4BNXA 2R7UA 1MG0A 3R5FA 1J4AA 3QKTA 4IOMA 1ZM9A 3WICA 1US8A 2TMYA 1JKPC 3QKRA 4UHKA 1V11B 4BX3A 1D0SA 3O1LA 3OC6A 2GN6A 1SR8A 5JOQA 3K8YA 3SE7A 2BY0A 2X5OA 4JI0B 5CD1A 3O2QB 4P3PA 2B61A 3KUCA 2NG1A 3OM1A 1U2DA 4UUQA 4E4YA 4XSHA 4HEQA 2KWIA 3U4QA 1G8HA 1KOLA 2O0MA 3U3RA 2V7TA 2DE0X 1YDFA 4RNCA 1S8NA 5FKMA 3QOFA 1UK6A 5CAEA 3QELB 4JUAA 2GRAA 2G07A 3N5KA 4AK9A 4IOJA 4YQFA 2XOXA 1QCDA 3UUFA 2XLBA 3U7QA 1N6KA 3KLNA 3IAM1 3S5JA 3FXJA 4OP1A 4XN0A 3L01A 1B6SA 1LV7A 4M9UA 4IM7A 4FD3A 2JANA 4CQMD 3HRHA 3BRQA 1ZVKA 5ARCA 4KQWA 2I7XA 2UZIR 1S2LA 4CM3A 4IV8A 3LFTA 5LNK1 3T54A 5JATA 1XX6A 3VNQA 2KHZA 2HY7A 4DL9A 2FN8A 4XGQA 3HUUA 4BNDA 2BY1A 1QVZA 4I0AA 2WB2A 1NC3A 1J8FA 3FTQA 4QM7A 2X7XA 3LWZA 4I6GA 4MB0A 5IF3A 5IP5A 8ADHA 5CIQA 3WFJA 1H2EA 2RHJA 3SFTA 2B5VA 2PXCA 4XGNA 3H6HA 4FLMA 3LC2O 3L4JA 4AZVA 5B5SA 2C5FA 1JT0A 4YA6A 3BKXA 2HJSA 3OP4A 3OCVA 2A9FA 3N3AC 3F4LA 4D42A 5IJ9B 1C30B 4DIKA 1YE8A 3DZIA 2I71A 2CD9A 5JXIA 2H48A 1EGHA 4GLLA 4CM9D 4XLEA 1S2GA 2QUJA 2ZBDA 3F7TA 4J6EA 4N8SA 2X9QA 2D3TA 2NSYA 2JIOA 3TMKA 2ZSAA 2J7PA 1FX1A 4UU1A 3ICCA 1VYUA 1E5XA 1GUDA 2A3SA 1ZA2A 3DFUA 3BDDA 4S1TA 4DZTA 1CQIA 3KYDB 3HVIA 2H2FA 3OICA 4TWRA 1XKQA 4K87A 1CY6A 3AGPA 1MDFA 4DRXA 1WVGA 5LQKA 4MRRA 3MQFA 4JBHA 4UVGA 2JGDB 2KIFA 1E32A 5AVVA 3THYB 3NBKA 3NC0C 4DLBA 1XU9A 4KUGA 4ZOLB 1KIMA 5HMLA 3VR0A 2VIIA 3TTYA 3ZYZA 4BVGA 4XDGA 5DUIA 1HFKA 2CXRA 2AZTA 5EKSA 3S3MA 3BMNA 3NALA 2QGFA 3QPSA 2VHCA 5E4YA 4KVFA 3PQ4A 1T3HA 1EQAA 4EJ2A 1KNQA 4NESA 5DDIP 1OLSB 2IP4A 3INRA 4NYMR 2OZLA 1YACA 2QJWA 3OOEA 1HSOA 4RF3A 3NMUF 4MW1A 4JBXA 3CCFA 2O0YA 4WH0A 2BI8A 5FORA 5GZ1A 3DW3X 5SY4A 4MCIA 4D26A 4DT1A 4OM7A 3CP8A 3WQRA 1VSTA 3RVBA 3PSAA 2XZTA 3GX1A 4JV5B 5K5RA 4DLUA 1CDOA 1G3IA 4RGXA 2L0KA 5I7FA 5KJFA 3G79A 2R1ZA 5THXA 3DHEA 2ZBVA 4K9PA 1M10A 1FMWA 2P3SA 1OX4A 4EJFA 4JX6A 3RE1A 3O4HA 3UR3C 1DJLA 4WCFC 1BE1A 4BE7B 1ULHA 4E1AA 2VDMB 1XI2A 4W9RA 1N0VC 2G71A 3DMHA 2ENWA 4ZP1A 2KRHA 4YMGA 5DYTA 3K0LA 1Q3KA 1KZ9A 1SCQA 1G41A 4G97A 2YZ2A 4E21A 3E6MA 4AWXB 1QORA 3TDZC 4G24A 4BHPA 2ZPAA 4E7SA 1EH6A 3I2JA 3VDXA 2L2OA 4UU7A 2WOJA 3HP4A 4BXXJ 1D8KA 1O6FA 5EHXA 2QW0X 1I7NA 3M1AA 2BM8A 1XMAA 1BE0A 5H2FC 4KPFC 3ZZMA 2YHAA 4W99A 2D3WA 1RPJA 3C2QA 2Y1EA 4WCFA 5B3KA 1ZUD1 2CLDX 3ZYCA 2JLRA 1P6XA 2DCEA 1CP2A 2KM1A 1FDRA 3COYA 1J24A 2M8GX 1N9KA 4WUVA 1V9CA 3K70D 7REQB 4B7AA 3MILA 2OO5C 4WADA 3AL3A 1P0MA 3CUSA 1GRRA 3RM3A 1E9DA 3KPWA 4EECA 5KBYA 3ME5A 1Z6ZA 2ONZA 1P39A 2JJ2D 3I8SA 1FS4A 4V3CA 4RADA 1E4YA 5AVRA 3RIYA 1ZL2A 3IUSA 5AW9A 5KYNA 3VA7A 4YV0A 3U3OA 4V0MA 4UV8A 3ET4A 4HSTA 3E3NA 1QZZA 3AOEA 4W5WA 4Z4CA 3FOAA 2PKYX 4DQKA 4HYEA 1XLTC 2GQ0A 4JUIA 4O8CA 1IDOA 6LDHA 3KVYA 4DLKA 1UBHS 1NXWA 1T29A 2OO5A 3B53X 4BNIA 3R1IA 2PKEA 2CK3A 5J4LA 4YO7A 2VN8A 5HODA 4NHEA 4HNAA 2BM0A 3BTVA 5K2OA 3WTXC 3K2QA 1ZG3A 3PCRB 2VBIA 3DMFA 2PZBA 3TUJC 4GI5A 1EH5A 4B7UA 5G40A 1Z2PX 3TXYA 4WE3A 1NU6A 2Y3IA 4G4SP 1DU0A 5F7OA 1Y4SA 3DZDA 3AEZA 1XLTA 1D6MA 2Y77A 1YS4A 3P1JA 5A9RA 1EDZA 1XYYA 3RFUA 1OA0A 1G59A 3L7KA 3ZOBA 3GLFE 3RRBA 1WPKA 4B81A 1OPCA 3CINA 4GI7A 3QVWA 4N0QA 4Q37A 5CVIA 3KFXA 1SKYE 2FK7A 2ZJ0A 2YFQA 3C4VA 4HAMA 2YJZA 3MTEA 3BXGA 1NQVA 5LFAA 4GC9A 2QTAA 1SBZA 3U48A 5J2TF 1VECA 3S17J 3KT0A 3NWPA 3QVJA 4LJ5A 5CPBA 1H0HA 4BVBA 4ZCTA 4D96A 1LNZA 2WWRA 5IYDJ 4I50F 3H13A 1GO2A 3AJDA 1EP3B 3RYRA 2MH9A 4F7WA 2R4UA 4IXTA 4UHEA 3A1SA 4M3BA 2VNAA 1RAEA 3NT2A 4CU2A 2X4GA 3OZGA 5AQEA 4QPCA 2VK2A 2NU8B 4UZSA 3V3TA 3GH1A 1PWZA 1GPDG 3WK7A 4XVUA 2NNWB 1OC2A 3G2QA 2A84A 3GLTA 2PEXA 3LD9A 4YRVA 2W8BA 3WYNA 4F6LA 1F6DA 2QQAA 1IN8A 4OQMA 5F1OA 4EEXA 4YUYA 4XSGA 1AV7A 1FW6A 1KY5A 3EW9A 2JVHA 3BC1A 1XC5A 3KIPA 3HTUA 2GEDA 5JDIC 2H65A 3GGCA 5K7ZA 1G63A 4BNUA 3OETA 2OTLI 3DAOA 2AC2A 5K5QA 1QR6A 3I76A 1TUIA 2FOIA 3GUDA 1NW6A 1QE3A 2O5RA 3CVVA 4RAQA 1DAIA 3SQOA 1E1YA 1QHHA 2PYZA 2VSQA 4O4HA 4ARVA 5EPUA 1NM5C 5EVCA 2Y1WA 3C8MA 1NYTA 1E20A 4MQFA 5REQA 1I4OA 2QTCA 5F2KA 4DYDA 4IHSA 1DIOB 5IASA 2GPAA 2O8XA 2LY2A 3U7JA 3FCEA 2JZNA 5TT1A 5HTKA 1MENA 5JDIA 1U2ZA 1PV1A 2DQKA 1JJVA 1V4NA 2XPWA 1CUFA 2MOKA 4Y1FA 1GZ6A 4IPAA 1MFZA 3P45A 2Y69H 2WHPB 1AB5A 2FJPA 4JC5A 1OBHA 4B84A 3OL4A 3DFZA 4IPTA 4XKCA 4JASB 2KZVA 2Y9MB 4R7GA 2OPBA 5THKA 3W2AA 1TZCA 2XRFA 1M2VB 1Z0XA 1NM5A 3WWPA 3MIIA 3GZ4A 1LFAA 2R6GA 1O08A 4JROA 2ADFA 2FV8A 2W9XA 2L17A 2HNBA 1MMFB 2VI5A 3FPSA 5KQSA 4WBXC 1KORA 3AUSA 1PP7U 1Y1RA 4G1CA 1D4ZA 1YFLA 4PSUA 3K0AB 3NQOA 4F96A 5L53A 4YBRA 2ZWMA 4BQOA 2XXJA 3ZCRA 4D3SA 3EEBA 4ESVA 2QSJA 3RPUA 3IDAA 4A3MJ 1I2MA 3ZV5A 3FISA 1HQCA 4R1SA 2WJGA 3BCRA 2IYSA 1UG0A 2BF7A 4F46A 1N9GA 5IJXA 4NL4H 1B73A 4ZU3A 1W25A 3IUNA 3K1PA 1Y0BA 1NXTA 1X7GA 4K9OA 1N6NA 3Q9LA 5AW4A 2VTBA 2ZJQF 5I7EA 4GGMX 1J2UA 2E0IA 4QVGA 4IO9F 4REMA 2H11A 5G1NA 4TM7A 1BRMA 5DD8A 2XWJI 2B4YA 3DS8A 3QEKA 2GH1A 1RBZA 4RM3A 1ZYUA 1DWOA 1DAPA 1Y33E 4QDUA 4DXAA 4PGGA 2ZSIB 4CLRA 4GICA 1SCAA 2FGJA 3E4CA 2XB4A 2QPTA 2L4MA 2QRJA 4DV1B 4E7KA 4BPRA 1IRXA 1N32B 4AVPA 4GFBA 2GOMA 1JHDA 3C41J 1WEKA 4FJ1A 3RBZA 3T6KA 4QIHA 4CMHA 5J47A 1TM7E 3NWBA 3VX3A 4CQJA 2R97A 3KP4A 4FZJA 3RT1A 3ESDA 4BV2A 3CX7A 1V26A 4LRYA 3B78A 1IHYA 4QREA 1C1DA 3FBIB 5KJ1A 3URMA 4EFNA 3LIIA 1C14A 5AONA 2H63A 2MBFA 5GIPE 1R0WA 5D6NA 3BROA 2XI4A 3FY4A 1M8FA 1RC9A 1G8SA 4WRRA 2FNPA 1LFBA 3LHIA 5IC5A 4X7MA 4XGKA 3L84A 4HOBA 1ECGA 3FD8A 4KPEC 1P5HA 2AXPA 1MV5A 1BGVA 4JB3A 1CJUC 2VK8A 4L2IA 2W4QA 2GA2A 4O25A 1OFHA 4XX0A 4DW6A 5EP2A 1GFIA 5K3CA 4M2LA 3FZQA 3LP8A 4XYGA 4JQZA 4GIBA 2Z2SB 3EFOB 2IEGA 2IEBA 2JC3A 5TSDA 3PDIB 5FX2A 3KQWA 3I42A 1UT5A 1Q21A 3JD0A 1L1FA 2YV5A 3HDTA 1J0DA 4WKOA 4YRLA 4RA9B 3FXLA 4RJJA 2FEWB 4BC1A 1ZHHA 5AXDA 1ZI9A 2PFKA 3RT9A 3OOJA 1UBLS 1E1MA 1HX7A 4RGQA 4HTFA 1ZJWA 2UXDB 5IKPA 1C7JA 2NO5A 4AUNA 6YASA 4IQ8A 2O3FA 2O07A 1KVUA 2D1HA 1IOZA 1MC1A 3OJEA 2IXAA 2K87A 3PXBA 4JJ6A 3I0ZA 3K4QA 3WRYA 4CGZA 4E5UA 1BEUB 4U00A 2P2GA 2O52A 3OJOA 1ZKDA 3BR0A 1P3Y1 2B5WA 2QN8A 2EW1A 1MQAA 1QVAA 2ZM6B 1SVOA 3YASA 2V8BA 1P2UA 4PLYA 3C3CA 5AVWA 4YCAA 1NI4A 1Q0ZA 4IDGA 2GIVA 3DT6A 2AKAB 5C7IO 2J3IA 2PRZA 3F22A 3CN7A 3I6QA 1YE3A 1MMAA 2YOHA 1WU8A 3BHJA 1FPMA 4QASA 2JDID 2N75A 3AFIA 2CWWA 4AWAA