4HG2A

The structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
b'AFRPRYPRALFRWLGEVAPARGDALDCGCGSGQASLGLAEFFERVHAVDPGEAQIRQALRHPRVTYAVAPAEDTGLPPASVDVAIAAQAMHWFDLDRFWAELRRVARPGAVFAAVTYGLTRVDPEVDAVVDRLYHGLLARDWPPERVHVESGYRTLPFPFPELEAPPLEIEERWPMDAFLGYLGTWSAVTAHRRRTGADPLAEIAPALRAAWGTPERPLRVTWPIAIRAGRILPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase type 11
publication title The Structure of a Putative Type II Methyltransferase from Anaeromyxobacter dehalogenans.
rcsb
source organism Anaeromyxobacter dehalogenans
molecule tags Transferase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2560 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hg2A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4hg2A01
3LDGA 1BHJA 5FWAA 5GM2A 2QM3A 3HCFA 3ER8A 5DTRA 5CD1A 5EEGA 3HCAA 5FA8A 2PXCA 5FHRA 5CVVA 3CBGA 4DA4A 4OBXA 2PXXA 3IHTA 2PX4A 2CL5A 2YXDA 3EVDA 5ERGB 3PX3A 5E1MA 2AZTA 3NVKI 1XDSA 2IFTA 3E05A 3O31A 4RTLA 2VP3A 5LSAA 2Q41A 2PT6A 3KQTA 3UWPA 3BWBA 3M4XA 3LBYA 1RJEA 3GCZA 4KRGA 2NNWB 4GUAA 3B3JA 4AZVA 4R6WA 1ORIA 2C7RA 3OE4A 1X1BA 2VDWA 4FSXA 2G70A 1IY9A 4LWPA 1F38A 4QQNA 4AZSA 2B9EA 3T7TA 2IH5A 2JH8A 3KQPA 2XYQA 1G60A 3CC8A 3GXOA 4E2ZA 3OU6A 1X19A 2F8LA 4AUKA 5E1BA 2P3QA 3PB3A 3Q87B 4H0NA 1AF7A 1NE2A 2VDUE 3CKKA 3MB5A 4V0RA 5EQJB 5K03A 5LQNA 1XCLA 4RWZA 2PGXA 1P1BA 2IPXA 3BUSA 3FPJA 3G5LA 4ER3A 1SQFA 1L3CA 1R8YA 4OA5A 1I9GA 1VIDA 3KQMA 4JXJA 1JG3A 1EJ0A 3DR5A 4YUYA 3SM3A 4C05A 2ORED 4BLUA 2G8NA 2EX4A 5DM0A 2AN3A 2PXAA 3UFBA 2ZIGA 2WA1A 2ZBRA 4YMGA 2Z6AA 1X1DA 2P1DA 4OA8A 3FTFA 3TRKA 3GNLA 4DZRA 3I58A 4GF5A 4A6DA 1WG8A 3EVAA 3R0QA 3REOA 3UJDA 2YVLA 1YB2A 3FYDA 3KPVA 5DM4A 5CCXA 2DPMA 1JQEA 3O7WA 2O05A 3FTEA 2GS9A 5HEKA 5EHIA 1BOOA 3A7DA 2ADMA 2VZ9A 4P7KA 4XUDA 1YZHA 2AOUB 5P8WA 3ELYA 1VPTA 4E2WA 3UA4A 3FPHA 1P1CA 2ZVJA 5KQSA 3MTEA 5BXYA 4EKGA 3B7PA 3HCBA 4BP1A 4GOMD 1X1CA 5D1NA 1G38A 5K0EA 2AOTA 2PX5A 5FA5A 3K0BA 4B17A 3ELUA 2ZZKA 5DM2A 4IKPA 4C08A 3UJ6A 4GEKA 3UJCA 2ZIEA 3A26A 5M5BA 2QY6A 3OCJA 4RX1A 5DSTA 2ZZMA 3FPGA 3UJBA 2H1RA 1G6Q1 1NW6A 2AVDA 2JHCA 2ZLBA 5CUQA 5DX8A 5EKXA 2B78A 3TQSA 3BGIA 2H00A 3LCCA 4PYNA 4PYKA 5CVEA 5K0JA 5E9WA 3SSNA 4YUZA 1RI2A 2NXNA 3OZSA 3BWMA 3JWIA 8MHTA 4PWYA 2PKWA 2I6GA 1TPYA 3HVJA 5F2KA 3SVZA 2NP6A 2PLWA 2BH2A 1R18A 4HTFB 4PINA 4BP3A 2HR1A 2B3TA 2ZBQA 2ZBPA 5E8RA 2Y1XA 3HVKA 5HFJA 1JG1A 3KPUA 3R3HA 2KW5A 3SR4A 4FZVA 3PFHA 2GB4A 2C7OA 2QE6A 4EQZA 2IDJA 3PTAA 4M37A 7MHTA 1P39A 2P35A 4DKJA 3V97A 2PT9A 1KPGA 4PCLA 1JSZA 3LBFA 5FQOA 1Y8CA 5FCDA 5T64A 3UZUA 1JQDA 3WSTA 1YF3A 3IV6A 3M33A 3KKZA 3EGIA 3I53A 4YV0A 1NW7A 1WZNA 3QOXA 2B25A 4MHTA 5DRTA 1NW8A 2AOXA 1QANA 5K01A 5LR6A 2JG3A 1QZZA 1EG2A 4RTPA 2QRVB 5GP1A 3P2KA 1RJDA 3VSEA 5GM1A 4C03A 2JJQA 5CM2Z 1KYWA 1ZKDA 3HCCA 5C0OE 3ORHA 5LQAA 4R8SA 2AOWA 1I1NA 5E8JA 5HIJA 3NDIA 2GLUA 4F85A 3HCEA 4HSGA 2AOVA 3KPWA 4CXMA 5ICEA 1R6AA 2I9KA 2ZIFA 1FP2A 3KR1A 4PCAA 1U2ZA 3KPYA 2R6ZA 3NWBA 3R24A 3TPZA 3G89A 4E32A 3KHKA 1IM8A 2OZVA 2PX2A 3LPMA 3HVIA 4NECA 4RVFA 4X60A 2HV9A 4XUEA 1RI3A 4IWNA 4YUWA 3KQVA 1NT2A 2AN5A 3CVOA 5FHQA 3UJ8A 4RVDA 2WA2A 3ME5A 4FT2A 5DTMA 5FADA 4CKEA 5BW4A 5KYGA 2IDKA 4FP9A 4M36A 1EIZA 5EGSA 3TLJA 2XYRA 4P7JA 3SMQA 3KQWA 3EGVA 4FSDA 2OPBA 5MHTA 1T43A 5T67A 5HOQA 3GDHA 4WVLA 5IH3A 3DOUA 3ER9A 1M0EA 3P9NA 5C9ZA 1OR8A 1ZG3A 4HRAA 2FYTA 2IGTA 5DXAA 5E1OA 3X0DA 3EEOA 3HP7A 3M6UA 3P9KA 3THRA 3G5TA 1L1EA 2HNKA 3BKWA 3FTDA 1KPHA 5DLYA 2CMHA 3OFJA 3VC2A 3C6KA 3NW9A 2YXEA 4P58A 3FRIA 3OPNA 4CKCA 3THSA 3OFKA 3DMHA 2HMYB 3FYCA 5DSXA 2GA9A 4DQ0A 3MTIA 4DM3A 1D2GA 3FUUA 4RTQA 1JSXA 3BWCA 3P2EA 1VL5A 3QV2A 4RTNA 3HTXA 1VP9A 2ZW9A 2CWWA 2YX1A 3U81A 4FR0A 5LQCA 3CGGA 3GRZA 3HCDA 1HNNA 1VE3A 4PYJA 2YTZA 3UJAA 4XCXA 2UYQA 3Q7EA 4E31A 5G02A 4YV1A 4QTUB 2ZULA 4ER7A 3MHTA 5H02A 2FK7A 2ZTHA 3BWYA 3I64A 3ERCA 3SSOA 1D2HA 1R8XA 2NXJA 1D2CA 1Q0SA 1WS6A 3ANXA 3FUTA 4OQEA 5DWQA 3LDFA 3RODA 5BW5A 4P7FA 2OB1A 2PWYA 3LX6A 1BKYA 1AV6A 5ICGA 3A7EA 1NKVA 3VYWA 1O9GA 5T6BA 2ZCJA 1VBFA 2HWKA 4L7VA 4YUVA 5EHGA 3DP7A 2WK1A 5GOZA 4MIKA 2UZ4A 2N47A 3ELDA 5KQRA 5JUWA 2ZWAA 1VQ1A 4QVKA 4DF3A 1QAQA 5HIMA 3GIWA 1JG2A 5HZMA 4FT4A 1SUIA 3C3YA 3MERA 4C06A 4E2XA 1FJXA 3SXJA 3UA3A 3GGDA 2C7QA 5DPMA 3LHDA 2CMGA 2AN4A 4ER6A 3CCFA 3JWHA 4GOND 4DMGA 4HGYA 1L3IA 1IXKA 2PJDA 1B42A 3LDUA 4LWOA 5U4XA 3IYLW 3UBTA 4KW7A 4PONA 2O07A 3UJ9A 4HG2A 1KXZA 1AQIA 3D2LA 2EJUA 3EGEA 3G2MA 3OU7A 5FQNA 5ICFA 2VDVE 5GIPE 1I4WA 5B1SA 3KR0A 2AOTB 3TMAA 2P3OA 1O54A 2PSSA 2GAFA 2BM8A 3ELWA 3HEMA 5FUBA 5GINE 3EVBA 4OQDA 4HC4A 3S68A 4AZTA 2CKDA 1H1DA 3HA3A 4PYLA 4PGGA 5EMKA 5KVAA 3OZTA 4E2YA 5E9QA 3SGLA 3JWJA 5K0LA 2P41A 1Q0TA 1KR5A 3HNRA 3P9CA 1QYRA 1MHTA 1N7IA 3KQQA 3QOWA 3FTCA 4RYLA 1NW5A 3DH0A 3LECA 3EEYA 3LSTA 3OE5A 2BM9A 3OU2A 3P2IA 3RW9A 1G55A 1P91A 4BLWA 2V7EA 4E30A 1PRYA 1EJ6A 3MCTA 1RI5A 3HM2A 4ZTBA 2BR3A 2YUIA 3A25A 3HA7A 4AX8A 2IBTA 4QPPA 2I7CA 4Y2HA 1F3LA 2R3SA 1Z3CA 3GRYA 5EKUA 5DT2A 1QAOA 3MAGA 1WXXA 2JHPA 4ATNA 2EJTA 3E7PA 2OYRA 1INLA 1UFKA 1ZGJA 2IBSA 5F2OA 4RTSA 1ZGAA 4RV9A 2OY0A 3EMBA 4GC5A 2NXEA 2NP7A 1FPQA 2OBFA 3KQOA 3CJRA 4ISCA 4C4AA 4GC9A 1WY7A 4RTMA 3JWGA 2B2CA 2ZZNA 1R74A 5K0FA 2BR5A 4V0QA 2G71A 3AXTA 4RVGA 3NDJA 1XVAA 2P3LA 3PFGA 2P8JA 1JR4A 3EVGA 2ESRA 4QQKA 3AXSA 3R6TA 3M6VA 3EPPA 4M7RA 5K0NA 4CTJA 3G2QA 4KDRA 1YFJA 1UWVA 3KR9A 3AJDA 4CTKA 3C3PA 3B5IA 3I9FA 3MQ2A 1QAMA 2P7IA 1EQAA 3GU3A 5K8VA 3FPEA 3M70A 5EG5A 2XVMA 5FWDA 5F2NA 1XDZA 2EG5A 4GQBA 4U7TB 2P7HA 4UOEA 3GJYA 3TOSA 4GOLD 2V74B 1ZQ9A 1WXWA 4F84A 3O4FA 3NJRA 1XXLA 3P97A 5EC8A 3K6RA 1NV9A 2XYVA 2UYCA 1XTPA 2IH4A 1N7JA 4QDKA 2PY6A 3KQSA 4M38A 5FULA 2UYHA 3NWEA 4KWCA 2HTEA 1L3BA 3I5UA 3EMDA 1RJFA 3TKYA 4PNEA 5EPEA 4PGHA 1RJGA 2AS0A 2PX8A 2E5WA 2ZFUA 1ZHFA 2Y1WA 3FUWA 2OXTA 4A6EA 1YZ3A 2ZWVA 4QPNA 3DXYA 4QDJA 3KPJA 2C7PA 4R8RA 2UYOA 4GBED 3T7RA 2P40A 3P9IA 5DX1A 1TW2A 3AY0A 2IIPA 2LD4A 5EZSA 2PBFA 3HA5A 2PWPA 3PT9A 4IV8A 3T0IA 4EKIA 10MHA 2DULA 3G2PA 3B3FA 1VLMA 3R9XB 5K09A 5EVJA 2GH1A 4E33A 1SG9A 3P71T 4CWAA 4IV0A 5HILA 3VC1A 1V39A 3PX2A 2BZGA 3TR6A 4F86A 4RTJA 1HMYA 4DCGA 2NYUA 3PLAE 3TKAA 3BT7A 3KQYA 3EVZA 3DUWA 1VP3A 3G2OA 4RSRA 3BGVA 3BKXA 3CJQA 3NTVA 4X1OA 4EMSA 4PYIA 5K0CA 3GRRA 3ID6C 1UIRA 1AQJA 2K4MA 5JR3A 5EOVA 3TM4A 3GRVA 4XUCA 2A14A 5K05A 2G1PA 2O06A 5EIWA 3C6MA 2IH2A 5GWXA 2ONYA 1RI1A 2XVAA 5LQJA 1KHHA 4WXHA 9MHTA 2OKCA 5LQUA 3FZGA 4POOA 4KIFA 5K0GA 2PVCA 2GPYA 3AWIA 1N2XA 3G8AA 3DXXA 2ONZA 1KYZA 5EZQA 1DCTA 3F4KA 3DXZA 3M6XA 4HGZA 5CIYA 2YXLA 2PV0A 3E23A 2OB2A 4OBWA 3KU1A 3NVMB 1ORHA 4EK9A 1KIAA 4DCMA 4YV2A 4LECA 4EVIA 3FPFA 5HIIA 4MWZA 4O29A 1TW3A 3LGAA 2H11A 4MQ4A 5EMMA 5K0BA 1G8AA 2FHPA 2FRXA 4PIMA 3TFWA 2EFJA 3LKDA 3FRHA 1NBIA 4GOOD 4KVZA 5EEHA 1SUSA 1L9KA 4G56A 2QYOA 4C07A 4QTTB 4FGZA 2AOUA 1MJFA 3CJTA 3DULA 3IEIA 4PYMA 1YUBA 2ERCA 3EVFA 3PVCA 4HH4A 1JTFA 2AVNA 5E2AA 1X1AA 1XDUA 3DMFA 3MGGA 4X63A 1NW3A 1DUSA 4E70A 4LG1A 2FPOA 1SQGA 3E8SA 4R6XA 5CVJA 3TM5A 1YFLA 3BZBA 5EMLA 3M6WA 1XJ5A 1SVUA 3B3GA 5CVDA 3KR2A 3NMUF 4KDCA 4PYOA 4YUXA 3SSMA 3DLCA 4KIGA 4C04A 2I62A 1R00A 2BR4A 4R05A 4Z2YA 4K6MA 3UJ7A 5IKMA 4RTRA 3LCVB 5EIFA 1BC5A 1FBNA 3GO4A 2VS1A 4BLVA 2G72A 2O57A 5DX0A 3BGDA 1JG4A 5FTWA 3LKZA 3C0KA 4RTKA 1PJZA 3G8BA 3G88A 4HTFA 5DRYA 5LQKA 3DMGA 1O9HA 5E2BA 3RIEA 1EAMA 2YR0A 1FP1D 5KS2A 3BXOA 5E9JA 3A4TA 5BP7A 3V8VA 4ER5A 4X41A 1M6YA 4PYQA 4U7PB 3FUXA 1G8SA 5CVUA 5D1HA 3T7SA 5CCBA 2AR0A 3LL7A 3FUVA 5DXJA 4RTOA 1JQ3A 1NBHA 1M6EX 3GWZA 3PS9A 3GRUA 3EVCA 1SKMA 3HVHA 2FCAA 1RI4A 4X61A 5E1DA 5DTQA 4QVGA 3G7UA 4MTLA 3H2BA 2QRVA 1JTEA 3EVEA 2O0LA 2XBMA 5DM1A 2FK8A 3LCUA 4Y30A 5C1IA 1KPIA 1NV8A 2Z6QA 3OZRA 2Z6UA 5EMJA 3L8DA 4P7GA 3B89A 4CKBA 2ZSUA 1DL5A 2YQZA 4RVHA 1XCJA 5GIOE 4ER0A 2IP2A 4YMHA 3SX0A 5LQRA 3DLIA 4AZWA 1KP9A 2OO3A 3A27A 2JH9A 5HIKA 3DTNA 4OX9Y 3P8ZA 3MCZA 4PIPA 2NXCA 4BY9E 4FS8A 5ICCA 2JHAA
chains in the Genus database with same CATH superfamily
3HG7A 1FTSA 5FHRA 2VKVA 1SHZA 2YXDA 1G7RA 1WDTA 2DETA 4ZI7A 4HQLA 1RD4A 4OQQA 3OE4A 3WIUA 1MF7A 3M3PA 1XRQA 1J56A 2AEFA 1FTGA 3PDJA 1DHRA 3FYTA 4MTEA 1XWWA 1AGYA 4EJFA 2GKSA 4BHPA 4R2WA 4B4DA 2JFPA 5CAEB 2PR7A 3AESB 1XZBA 3PK0A 3I2FA 4LHSA 2FFBA 2B6HA 2FR1A 4H7HA 3MBIA 3PXUA 5AOVA 1RESA 3WWZA 5FAKA 5EJEA 3FKSD 4UUNA 4D8WA 4CIVA 3DEFA 1GPDG 2FTKE 1L7XA 5FO5A 3HHGA 4DDHA 3AEZA 3OCJA 3QFRA 3AUKA 3K32A 2GXUA 2H1CA 1T5OA 2HQNA 4Q7EA 3GJ5A 1LLFA 1WB4A 4LCJA 4P54A 1QIGA 1OLUB 4WINA 3BMNB 3QVUA 1UG0A 4FLFA 1WW2A 2BW3B 5LNK1 2Z3ZA 2BLLA 3GPLA 2NG1A 4FU0A 3H3UA 3PQKA 1H4QA 2ESHA 3TXAA 1OXVA 5J43A 4JXKA 2Y4OA 5BQXA 2IE8A 2WIDA 1G41A 1U0EA 2ERXA 4JAVC 5JY6A 4UE6A 4H3VA 3IEUA 1Y8RB 4QPJC 4MB0A 4RZQA 4FP9A 3EXIA 4A92A 1H6AA 3CF5F 3HUEA 4KRXA 3F73A 1KMQA 2CFTA 1H9GA 1F20A 3DW1X 3ESYA 4CM4A 4PLFA 1OE0A 3U56A 3WU1B 1FFBA 1NLUA 2QR5A 2XMQA 3UAZA 2CWWA 2E5ZA 1FP4A 4QTUB 2YMQA 4HXEB 5DI3B 1XEWY 2P4HX 4G5HA 1XJWA 3LY7A 2GARA 4M60A 1JTYA 3VYTB 3JD3A 4QOIA 4KQHA 2B7LA 3SN6A 1PK9A 1YVEI 2Y71A 3FMFA 3PNVA 4EYEA 4DTIA 2FW6A 1JGGA 3ZHCA 4GX0A 2ALJA 3E9NA 3V8EA 4DHEA 1NF2A 1EESA 2H2GA 1DV2A 5FNZA 3AEXA 3WLEA 2H3EA 1R9NA 3HPRA 1BCRB 4MLCA 4NCNA 3B13B 5J4VA 4PC1A 3WDMA 3ZKWA 3ZMSA 2WFMA 2OM6A 2XZLA 1ZW6A 1TAGA 3FFBA 5HQ3B 4BV2A 1VJTA 3ZCVA 2O7NA 1FEXA 1JIVA 1WBJB 4CV0A 4MRSA 3CCCA 5DK4A 4C14A 3GFJA 1TO6A 4EKNB 3FCUB 1JW9B 2PL3A 4KDRA 3JRFA 3OMXA 2RGCA 5DNUA 4GP7A 4ALLA 1IBLB 2JHFA 1N7JA 3RUCA 2C58A 1L5ZA 3D7MA 1L5QA 1B0UA 3RC8A 4NZZA 1U9NA 3PYMA 3G1MA 1WX1A 1AKRA 2W4MA 4HLQB 5JU6A 1Q16A 1N5MA 3P71T 2OOSA 4B4UA 3UK0A 5I7EA 4ALNA 3IKJA 2FEXA 1HZJA 4HZUB 1UIRA 4BO3A 1PO7A 1ETVA 4PVDA 4BBSJ 4NK5A 2JAUA 2ONCA 4LGYA 4LHZA 1ADGA 3HYTA 1KS9A 4EUEA 2V7XA 2P5TB 2H08A 1WCYA 3E1GA 2XT6A 4KNYA 4R1LA 3RJTA 1IXYA 3LA8A 3I8OA 5FORA 1T3HA 3R5FA 1J06A 1C9KA 4J3NA 3NXSA 3ZWNA 3B3GA 1IU9A 3ZBQA 2BR4A 3L84A 2NV0A 2CZCA 1LLDA 3E4DA 1JG4A 3L7LA 1MENA 1EAMA 4HWRA 2XNDD 5KS2A 5YASA 3EAFA 2CHGA 3AETB 2OA0A 3W2GA 2FSVA 5DUIA 4XRGA 1V3UA 2YU3A 2A6TA 4M0LA 2J4CA 5IP9J 2FPGA 3ND8A 1Y5IA 3RBAA 4Y30A 1FS5A 2DOFA 4CKBA 2B4QA 1IPFA 1GNVA 2P2GA 1BVUA 3VZQA 4MVJF 1X38A 4AZWA 2H0AA 3HM9A 5FLEX 1LNWA 2OC9A 3T12A 1E79A 2C8KA 5I45A 5BRAA 3ZRGA 3F67A 5ENVA 1NM5A 2XAAA 2AZXA 2FR8C 2NYXA 4MV3A 5KHLB 2EZ4A 4IWXA 4NJMB 4Q1EA 2J6IA 1X1PA 1YRNA 5E2IA 4DBRA 5J5CA 3PPXA 2UV1A 4NXNB 3GMIA 3H9EO 2ZMEC 3NT5A 1OF1A 5KQPA 2PGXA 4GEGA 2HCJB 3HRIA 1QVTA 3WYDA 4BNIA 1LFDB 5FOVA 4DLTA 3O4JA 4M3DA 1TEZA 3R0QA 4C7MA 4H7KA 1UB9A 3BK2A 2WAFA 4BYGA 4B85A 5IYCJ 1NSYA 1Z8DA 2FOIA 4BWVA 1PLKA 2FUG2 4DYVA 4TKMA 1KI4A 3I76A 5AQEA 3FKSA 4LHXA 2OP1A 4X66B 1IPHA 4O08A 1LPMA 3GFTA 3K6JA 1ZGHA 1F2VA 1TMGE 5TRDA 3GVCA 4RA6B 1J0CA 4IH9A 5A9SA 5K7SA 3WIVA 2IEAA 2P4EA 3UOWA 5JNRA 2HU9A 4M1KA 4RENA 3LXRA 3DL7A 1BX0A 3OYGA 3C3XA 3Q9LA 1FNDA 1J97A 1GUBA 1F12A 3EUHC 2BMEA 2Y68A 1BMTA 2J9GA 2NZ2A 3QLTA 1DPUA 3WK5A 4MVJI 1XD2A 1Q95A 1B26A 1XALA 4G0OA 4A23A 4N82A 2KBFA 3II6X 2P6OA 1ZY2A 3DT8A 3B2EA 1HY3A 1LBIA 3L2CA 3IUQA 4II7A 2M0CA 5JAZA 2VE8A 3D8BA 1SK8A 1ZNWA 5DT9A 5DLYA 2LVSA 3S6JA 1SIUA 4XONA 3U9GA 3QG5A 4DG9A 4Q47A 3COAC 2JSPA 4LV6A 2Q5FA 3GEHA 5F27A 1KSJA 2Y9MB 3IE0A 3PNBA 5H02A 1I1SA 5EXSA 1T56A 4UVBA 5A7GA 1XN7A 3VYWA 3ADOA 3ORSA 3K9LA 2F5VA 2WK1A 3W2HA 4RHCA 4RDUA 3Q6MA 2ZWAA 5J5AA 1V5WA 3SNKA 4XMYA 3Q0WA 1IY1A 5TISC 3OFVA 3BG3A 1P7WA 2FNPA 3O26A 2O2EA 1YASA 1TCUA 4NC7A 1TB4A 3L7WA 1N7IA 1FL9A 4YJHA 4HF0A 4CCLA 2QD1A 3P2IA 2XKJE 3N86A 2EFYA 1W4CA 1O58A 1WLYA 1OYOA 3TLYA 4YRQA 5HYVA 4LMBA 4FEAA 3P45A 2I3AA 4A9AA 3LQ4A 1E2XA 3CYFA 4RTMA 4C7BA 2BP7B 4OMFG 1NI5A 3DYBA 1R7RA 3LXUX 3R6TA 5H4HA 2VUHB 3MUNA 2EC5A 3T3MB 3TOAA 1DKLA 3M70A 5BMOA 4IHXA 1Y39A 1AQNA 1MO6A 3WTBA 5J1UA 3M7IA 1O96A 2EJBA 3R77A 1CR2A 1DV1A 2W0MA 2JI7A 2BVMA 2X19A 2IWRA 4D3ZA 1Z5WA 3O0TA 2CXOA 3QU7A 2F00A 3H5TA 3JCZA 2R7FA 1NLYA 4HF1A 3GLKA 1UJ2A 2J85A 1H42A 2ICWG 1CUVA 1QYIA 2KYRA 1WFXA 3FY4A 5K5EA 4DIDA 3JQRA 2FI1A 2WB1N 4V3CA 2BY2A 2OECA 4Q05A 5HKKA 1AS2A 1FSFA 1QLJA 2EIHA 4RGQA 5K2OA 4ND2A 4RCZA 3SPXA 4LJ5A 3HVRA 3U7HB 4LECA 3M1LA 1V96A 3QFSA 1Z7EA 1GILA 5DSZA 4V19K 2Y67A 4PK4A 3QKSB 1YUBA 1I5OA 2AVNA 1GUDA 2ZSBA 4RMIA 1UXIA 4DIFA 1AZLA 1XJ5A 4UVDA 3KB2A 1GA6A 2Y0BA 5EGOA 3JQQA 1IRXA 2VJQA 1C0LA 4L4RA 3LP8A 3F0CA 5E7QA 1YS1X 1HEUA 3U1TA 1W2WB 4HDQB 1LI5A 3C74A 3KCNA 2XNDA 3MOIA 3NDPA 1IY8A 3U3RA 3TTVA 3OOPA 4BTLA 1JTEA 2HA5A 3UG7A 4I50B 2QF7A 4MAAA 3OQHA 1P7ZA 2IP2A 1YRQA 2RGEA 2CUNA 2OHVA 2C59A 3Q3IA 3IFSA 5AJWA 2KDOA 4YRGA 1OKRA 3I9JA 1YI0A 2YZNA 2Z95A 3NHMA 2AFVA 2RHHA 4EO7A 1DLJA 1HMPA 1QRTA 2WMYA 3W2WA 2HFJA 1C3OA 4QXAA 3IUOA 2QX4A 1VTKA 1J00A 3M1CA 2HOTA 3N2KB 4EGFA 2P6SA 3H92A 3C7CB 1UZUA 5AVSA 4WXEA 1V9SA 3GDWA 2VE9A 3LGSA 2CJFA 1JG3A 2XAFA 4R41A 2O2JA 2W6QA 4P4GA 3DZBA 1UZLA 4J00A 4X94A 3G0GA 5BURA 2DFFA 4W6ZA 3ILVA 2ODBA 1GA1A 1CUIA 1A97A 4A6XA 2QLNA 5JAMA 3LOQA 3JRDA 3WMFA 2CDAA 1F06A 4IEFB 4EM1A 1Z9CA 4BDYA 4ZDIA 4EA7A 2OGUA 4AJIA 1TT0A 4LG0A 3W7VA 4BQEA 3F97A 3NEAA 3PHLA 4U39A 4UMVA 3IURA 1R6DA 1T8IA 4YWHA 2N1BA 1NDHA 5TDHA 3S28A 3HBAA 2EPFA 2VKTA 2QSJA 4D9KA 2COKA 5LR6A 4WUVA 4K88A 4D81A 2V9PA 3AB8A 4P9NA 3RVJA 4GMKA 4WZBB 1U81A 1ZESA 4BCDA 3DBIA 2O23A 3ZK9A 4ZK2A 4I1PA 5K8JB 4GD3Q 4BLTA 5B6IA 2HIGA 3ETCA 1LZLA 4XM1A 3CD6I 3P9KA 1THMA 3L8ZA 4UB6C 1MB9A 4QFCA 3T7KA 4KTVE 1U4OA 2BKLA 3X1MA 4EF6A 3DU6A 4QT0A 3CJQB 2DCMA 4DRXB 1MAUA 1QFYA 4EI9A 4AZ0B 5FD5A 2X0FA 2ZTHA 1E2JA 2YZMA 5M29A 2ZYAA 5KYWA 1BKYA 3FXJA 1HOXA 3MJDA 1AMUA 5DW3A 5K8CA 2WVGA 1X94A 1ZONA 1BKDR 4PZ9A 2QRLA 4CGYA 5DH9A 3EXFA 1XE3A 5IN5A 5BQ5A 5I9BA 5KNBH 5AKYA 1ZRDA 3WDLA 4XARA 4P33A 1U7TA 2VDVE 2H2AA 3DPIA 2DC1A 4LBYA 1EXWA 5B53A 3JQDA 4W5JA 4RK1A 1M1ZA 1T5IA 1NJ6A 1GVJA 3HNRA 4GCVA 1ZITA 1NAIA 4FDMA 3A3KA 5FDFA 1OA1A 4KO4S 4HDKA 3DTEA 1DBPA 3H0KA 4DSZA 3FFWA 4K03A 4RV9A 1FPQA 2FXAA 3PR2B 4D8TA 5FROA 4KWTA 2ZUUA 3MQ2A 4I6EA 4CMIA 5C1OA 1F8UA 3WMWA 4M74A 4CUZA 4MV4A 5FD6A 2F7SA 3W9BA 4GDFA 2WJIA 5ALSA 4DPMA 3ZD8A 2C5FA 2IX9A 4LXGA 5IS2A 4U0KA 1QR6A 2WABA 2B4YA 3I6QA 2FW8A 4CWAA 4B80A 2ZRJA 2IIQA 1YB6A 2ACVA 3ZZTA 4AN0A 1G5TA 4M55A 2MINA 4O0LA 1MFPA 1TQHA 1AUQA 1U8YA 4RE6A 5CDFE 2H1SA 2DCUA 2WSLA 1XU4A 1HL7A 5C80A 3A14A 4G5RA 1KZ1A 4BKXA 4OBWA 2C4KA 5BSKA 1WA5A 3ADDA 2GKOA 1W36B 1Q5PA 5A5VA 3LGAA 2INGX 2KPMA 3FRHA 3JCUC 1SUSA 4OQ4A 1V6AA 4YDRA 2LRDA 4YH1A 2O8FB 4DR3B 3V7NA 1MBGA 5CVDA 5LWQA 4WFQA 4KQKA 3PA6A 2VT2A 3PENA 3GO4A 4MUNA 3VZRA 3TD6A 2VDJA 2Y1LA 3DMGA 3U49A 5IYZF 3AVOA 3W3AH 1MDBA 2ERYA 3OAAD 5HHTA 4U7PB 1TUEA 1YI8A 3SC2A 2GNPA 5BQPA 4CLOB 3I05A 2Z30A 4HJXA 4REQA 4EMUA 1WUJS 1NONA 3EVEA 3TJMA 1BBYA 1ZM4A 3QOPA 1IJWC 1FX7A 5FLXK 2F64A 5J2TB 1BA2A 1LFAA 3ZE0B 4KFUA 2XKBA 5KNCD 1C8BA 4V1CI 2BSQA 4BXOA 4ZYAA 3DEYX 2PXCA 1K79A 1WTAA 2V5AA 3DKPA 4MJ7A 4DA8A 3OPQA 4Z7JA 5DNYB 3E7DA 3KSMA 2AXPA 4BEVA 2BH9A 3RJPA 5JSHA 4ZOLA 2CBZA 1D6SA 5CYPA 4HDRA 1HLPA 2QRUA 3D3QA 1ACIA 1DELA 2ZBDA 4EGSA 4XWKA 5A2GA 2W6OA 1CEYA 1XCVA 2GEJA 3H13A 2HQ5A 1DAHA 1Y33E 4JXJA 1D1SA 4GBJA 3NYRA 1IHXA 3MIIA 2V9KA 1W4MA 4O2BF 2QRHA 2WF9A 3NS7A 1IV8A 4HZGA 1S1CA 5D8LB 1WJAA 2NO6A 3UJBA 1Z28A 4HUJA 4LSGA 4D9HA 4BU0A 2KLHA 4IO1A 2NVXJ 1UBFA 4LHYA 1XZDA 1K5HA 1JG1A 3CE9A 3WGZA 1LDNA 1DGQA 1PT9A 3MQ4A 3VDMA 2G7HA 2IZOA 2BY4A 3KOYA 4A8JC 4JJ7A 3NV7A 5HDNA 5LM3A 3AUTA 2Q45A 5HNFA 3RSSA 4MZDA 2JJQA 2WWVD 1MDMA 2XWBF 4O4LF 4RMGA 1E89A 3X43A 2BTOA 4P0TA 2J87A 3MC1A 4TS9A 4K2EA 1JI3A 1KYXA 4HUQA 1F60A 1OZFA 5LQMA 4EI2A 2DTRA 4OG2A 2M6SA 4B84A 1PHPA 2W84A 1QIDA 1X3LA 1VPVA 2DP4E 3WGUA 5BRJA 2EERA 4D3FA 5DYWA 3KLNA 2H1HA 3GFPA 4ZVPA 1SVMA 5M3BA 5AXAA 5KTRA 1OTXA 2M32A 4OSOA 1TZBA 3PNKA 1RLMA 3HN2A 4CZCA 2BYTA 3AR8A 1QHXA 1A8PA 4DGSA 5BR4A 3PUXA 3GV0A 5JEDA 3VB2A 3CCFA 4N3AA 3VHQA 4Z4CA 4DMGA 4YDQA 4KGZA 4FMCB 4MQLA 4BGUA 1E77A 3D2LA 3E70C 1P4GA 3KLBA 1AN0A 5F0FA 3D2BA 4GOXA 1XCMA 4ZFNA 4TYQA 5D00A 5LOVF 3H2GA 2Q21A 3KYDB 3BWGA 4LS3A 1J0EA 1G3QA 4F6RB 4B7ZA 2SKCA 2BFBA 2WLSA 2GIVA 1EWTA 1L7OA 4D99A 3K4CA 2JJ8A 4BNZA 3UHFA 2R6CA 4BLQA 1NWCA 1JUSA 2BYVE 2J31A 3W78A 2IP4A 1SCJA 2X8JA 3WGOA 4QEKA 3BJZA 3N7TA 4IOMA 4F97A 5K3BA 4AKEA 1IG3A 4QGBA 1FIUA 1NTRA 4AF6A 4D9EA 1WB9A 4LJSA 3V7UA 4A6EA 4RK6A 3OX4A 4XGNA 1MH3A 2RI6A 2JLSA 4FKZA 4ZVVA 1ES9A 3QA9A 2WV0A 1EX6A 1K4SA 1EWVA 2YDYA 4J2HA 2G04A 3FDIA 1T0BA 4PAGA 1ISSA 1M6HA 4JHLA 3CVXA 4PFKA 5CGQB 4FYPA 5LKAA 1JWBB 2C3YA 4DJTA 3OJCA 3AG1H 4ICIA 3H1FA 4XIFA 2VZ0A 3A01A 4JVNA 3AJRA 1WUIS 1UZNA 2O2ZA 3BFVA 5T41A 1G21E 5E6SA 3D7RA 1LNZA 2G0AA 3SJUA 3OWTA 1GZSA 3WHCA 4NQRA 1D8JA 1FYDA 1ELOA 1EE9A 2QTFA 4RPKA 4TV8F 4D3SA 2EB7A 4Y9DA 1O4XA 1J2UA 4ND1A 3VPBA 4BVKA 1VI2A 5JWHA 1AN9A 2A94A 3MTAA 1MBFA 2JCSA 3OT5A 4ENUA 1HKSA 2CEAA 5AHXA 3WISA 3C8ZA 4NZ9A 2WJAA 3KUUA 4N8EA 1YKSA 1RRKA 3ZDEA 4IXWA 1ESZA 5DGXA 3CO5A 5JNSA 5DS9A 1D1BA 4MIYA 4RCYA 1BI3A 3QYAA 1P0QA 5L3QB 1N1DA 4I0AA 1TRHA 5MF6A 5KNCA 1NVXQ 2FMFA 1XHEA 2VZ8A 2NVUB 2E49A 5IT9K 4BTVA 4BO0A 3JQ7B 1E18A 2XY4A 4MUYA 1U4NA 2R2GA 2ZRLA 4OHMA 1W4ZA 3GXOA 4DV6B 3W6VA 1ZLKA 1RYDA 4W1RA 4HWTA 3W5AA 2WIBA 3CCEI 4QFMA 2E19A 1FRZA 3E15A 1XC5A 2M98A 4W6QA 4TLMB 1YOVA 3O1JC 5DNVA 2D59A 3RUDA 3SSAA 2QZSA 3UJDA 5IPAA 4WK8F 2E89A 5IJZA 1CS4C 4AY2A 2CGPA 2OHGA 2RE8A 3JQAD 3L4SO 4C08A 2QZ8A 2IYFA 1B0ZA 2B78A 2ZSKA 1WUTA 3JRAA 3T4UA 5CVEA 5KEIA 4NX2A 2W83A 3HU3A 4F96A 1RXYA 4ZVKA 3KT3A 2Z8ZA 4RJIA 5HS8A 3RSFA 4ZVQA 3DO5A 4I76A 4RVNA 3QNUA 4OGGA 1AMOA 3TSAA 1VE1A 2ME6A 1V1MA 3CG0A 3KVOA 4H6PA 1T33A 2DHCA 5G53C 1XMOB 3V2UA 2ET6A 5DBFA 3FK6A 5EDNA 4KXQA 2FMLA 3PYLA 3BXFA 4E22A 3PDIA 4GGMX 5ER6A 3P2OA 1QF7A 2Z9BA 5BSEA 4D4IA 1GG5A 2NZYA 4HQRA 4MYTA 1O8CA 4JKYA 4BO5A 5IKOA 1WL8A 2FK7A 3W79A 4EAQA 3Q9SA 5ECDA 5EJFA 5FTKA 4J7CA 4BFUA 4HI0E 3NM5A 4YGYA 3FB4A 4YAKA 1Z39A 1DQSA 4GOND 4XFDA 4DV2B 3NHZA 1Q14A 4EG1A 4OYRA 3WB0A 1BVHA 4NOJA 4ZT2A 1UQUA 3RNLA 4F9EA 3ESAA 3K71B 4N9WA 1N0IA 1UBLS 1NY6A 4JI6B 4RVOA 4N3CA 1L4LA 3S1AB 3MKYB 3OU2A 2OCIA 3OCUA 2D3TA 5CDFA 1V5EA 3AF3A 4NCIA 2EJTA 3TW7A 1NBEA 3WHKA 4A10A 2CD9A 4E5KA 4YBZA 1A71A 3LFKA 5FB2A 4ON0A 1DHTA 2CHVA 1E3LA 3ZHYA 2RJOA 3GTMJ 2Q7XA 4WOKA 3JR3A 4HAZA 2D62A 4X54A 4KGXA 4BU1A 2LDBA 4WJLA 2R7SA 3HJRA 3EQ2A 5AKIA 1D1AA 1AOXA 5J23A 2CFXA 1EB8A 2QVCA 1G3UA 3FX3A 2MSLA 3K5PA 1JKQC 3WK4A 3ZY3A 2WZBA 3QLUC 1QNTA 4Y0NA 5J4LA 1GDDA 4PVCA 4UFPA 1RR6A 3K8ZA 1FCJA 1DLIA 1IC6A 5BN4B 3CN9A 5JCXA 1C8VB 1ZUHA 2ID7A 2PGDA 3QTBA 1XZNA 3VUEA 4NBUA 1TMKA 1H2AS 1J75A 4I2OA 4DXHA 2EQRA 3F1LA 3NFYA 3TB4A 2G40A 2IPMA 4G56A 4E7ZA 2IJLA 4MUFA 3DPSA 1VCIA 2ZIXB 3DUFA 2OG1A 3NC0C 1ORKA 2W8BA 3O4GA 2AWNA 1UQTA 2P2CA 3JYQA 3IEKA 1MQ9A 5C4JJ 1CYDA 1SKYB 1F17A 3H9GA 3HDHA 2HRBA 4K3UA 2FWPA 3JQPA 3NETA 3V9AA 4WKGA 5EJIA 4YIFA 3LOPA 4JJAA 3GJQA 3D6VA 3HQ4O 3AKEA 3FOEC 3LVQE 1DUVG 4FX5A 2HMAA 5TSDA 4NICA 1IVSA 2OD2A 3KB8A 1Z25A 4DZJA 4LRXA 4LJZF 4MROA 4N0MA 3IEMA 2PBZA 5SYAA 2Q3HA 3UGTA 3WRWA 1W7PD 5TIIA 2H16A 3Q8XB 3PFNA 1YB5A 2XWJI 3J80Z 2QL6A 2OPTA 5G40A 4W99A 3HJHA 2YS9A 2CFSA 3FWKA 4CLDA 4OWRB 3EBPA 3KQPA 3O92A 1JT9A 4B7UA 3KEQA 4YACA 2VVTA 3W05A 1E2DA 4ZU1X 1ON1A 4UUBA 2KIUA 3BZCA 3EFBA 3GLUA 3SM3A 3UAVA 4LXIA 2P1DA 3C7KA 3ONQA 3IVCA 2QN3A 2OUKA 3ZI0A 3GELA 1BRMA 2DA4A 4S24A 1LKZA 4UEQA 1SCNE 2GK6A 5M5WJ 3L7YA 4YMSA 4F4UA 1G8PA 2GN9A 4KXVA 1TJPB 4WT7A 5K8LA 3V7WA 4KGDA 2ZBKA 4HNVA 5BPIA 4PWYA 1TPYA 1QPBA 5FH9A 2Z2SB 2AS5F 4NCKA 3QYJA 3HBLA 1ZN7A 5FCDA 5TMBA 1GP2A 3KKZA 4XX0B 3PUIA 5J40A 3QELA 4NU5A 5CYGA 1R9GA 5TT0A 3OL4A 3DMRA 4YO7A 1GHCA 2VRBA 5EZGA 5E0OA 2MC4A 1ZK3A 1O77A 4QXRA 1TJ4A 3T5MA 1J9GA 3D3JA 3CVOA 4FT2A 1BW9B 1ZM3A 1TTTA 5HQJA 2M6LA 5E1OA 3U4IA 3N8DA 4CICA 4P4NA 3CCJI 2VKHA 3DMTA 1U8TA 4L50A 1E64A 1IIRA 1GGKA 2Q1UA 3KVYA 1C0EA 1XDDA 1K4TA 3VPXA 3GJ7A 2GXGA 1JB1A 4D6PA 1E4OA 5KX5B 2V1DA 1JPNA 2VDOB 4EB3A 1T9ZA 2XQKA 4J0EA 2REQB 1WLSA 1Y3AA 2FEKA 1QX3A 1GO2A 2VJMB 2XR1A 4IF6A 3R5SA 4BEBA 1J0RA 4X71A 1OISA 1I2AA 4UUOA 4IRMA 5CFRA 1N2EA 3GL9A 3IQWA 4QDZA 4N5IX 1LDMA 2C5BA 4R9NA 1JAIA 2RCNA 1MVNA 5KSPA 3FMGA 5LVAA 5A7HA 3PO3J 3QOWA 9GPBA 3Q5FA 2NT3A 4G2TA 4YYEA 1IDZA 4LZPA 1KK2A 1QQAA 4EY7A 5JLJA 2PPLA 1KYQA 4AM3A 1G21A 1U02A 4ZC3A 3EIQA 4DC9A 3V48A 2JANA 3P7MA 1TAUA 2ESRA 2VUUA 3AY3A 4J4BA 2X4HA 3ZTYA 4KL8S 3A03A 3WBBA 2D0OB 3E5XA 3PXBA 1VMAA 1V16A 1BCSA 1US8B 2FSFA 2WTEA 1DDNA 4AROA 1C9NA 1W73A 3IP5A 5FF9A 5EP2A 4CMCA 3MM4A 4U2KA 2NS0A 2WYHA 2ZR0A 3OZBA 5C35A 4RD2A 5ECGC 1QYDA 3HJFA 2ZPAA 3CS3A 1GAQA 2R4QA 5KBYA 3F5FA 4XVUA 5LP6B 3OX2A 1IATA 4YJFB 4P35A 4W9RA 5HTKA 4I66A 3EASA 1N2XA 1FRNA 2QW1A 4OFZA 5FNVF 1RXUA 5BN1A 2EBUA 3QJYA 1QPGA 3IQEA 1LPNA 1XZ8A 3JRBA 4EGYA 1CY7A 5IZCC 1Z4NA 1YL7A 1RXIA 1VG9B 3FAKA 2CLIB 2JGLA 2FJPA 4KCGA 5I8ZA 4POAA 3EBLA 3KR2A 4KDCA 3EE6A 4FXOA 2EFWA 4M4SA 2JFGA 2E5NA 3HOZJ 5KOJB 1ZFNA 2XZTA 1JA1A 4D98A 3SICE 3TMYA 2OCKA 4ZIRB 5ITZB 3F49S 2GA8A 3IRQA 2COUA 1L5GB 3KE8A 1FYEA 3LYHA 1FJGB 3FAZA 3N7UA 2ZDQA 4L9VA 2ILTA 5I7HA 5IFLA 1CX9B 4O6VA 4RVSA 1X0VA 2WJ6A 2NO1A 1XLUA 2JK3A 1KP9A 2ZIVB 5DLQC 4BY9E 4JBHA 1TEHA 3TQCA 1W47A 2DTZA 1DAIA 3IKLA 2A9FA 1QTQA 2LKSA 3IELA 1W7PA 1VQ7I 1OYYA 1IOWA 2QQAA 2BV6A 4ZICA 2CQQA 1XPUA 4M6YA 1Z2NX 3MKZA 4J49A 3UH1A 2UUBB 1XKQA 4URVR 1EJ9A 1P9LA 3DVQX 2V7FA 2QQEA 3K9CA 2XGMA 4TQ9A 4OMYA 4QL3A 1SCIA 3T4EA 1YL5A 1A2KC 3WQSB 4OATA 4QHYA 2DJ5A 5JCZA 1HTTA 1ETKA 2XTZA 1QIIA 2ZSEA 4TZ6A 2XD9A 2VPXA 2V1UA 2KFDA 3ICQB 2GPJA 4WK6A 5I7VA 2DKFA 1U5TA 2QNRA 4XUDA 2HSEA 1II0A 4F1JA 4K6GA 4DM7A 1J1UA 5J4KA 1YJ5A 3EXAA 1E1LA 4LJYA 4HV6A 2O48X 4GZ6A 2X76A 1K63A 3ZVRA 1OV6A 3OKAA 2HR1A 4Q3KA 5HFJA 4LLGF 3O1LA 3B5JA 2FB9A 4IIHA 3PUJA 4ZCQA 4FUQA 4H31A 3I0TA 2A5GA 4WNIA 2BFFB 2C2KA 1LCIA 3QXXA 1FLAA 3K70B 1E2UA 1WM1A 1BDJA 2XEDA 1G2PA 1Z68A 4RKFA 3SQNA 2FE1A 1I1NA 1VXOA 2A30A 2ZIUB 1P2SA 4HDCA 5JHUA 2CNOA 2JA8J 1NN3A 1D2NA 4Z0PA 1JHQA 2DPUA 3ZHTA 2ZXUA 3N2NA 2W98A 1P2GA 4HRAA 2YUTA 2Q3DA 5ALUA 2BDTA 1KZHA 4NPAA 3WZMA 3WG9A 2R6DA 3CO6C 1LVUA 1YAHA 4D5GA 3E3LA 1Z29A 1Y6FA 3LWDA 4LC1A 2Q2NA 5ETJA 3QQAA 1VP9A 3DHYA 5KYVA 1KI8A 5A0TA 4LOJA 4BJ1A 2Z3VA 3TEFA 3E61A 5TEWA 4IZZA 6CHYA 2P62A 1G2HA 3U1VA 3A7EA 1R22A 3ROZA 3JATB 3OTQA 1BE6A 3ENQA 2V5VA 2II6A 1OZAA 1JUPA 1WD5A 2CLHB 1MQAA 1G0OA 5JHHB 4H17A 4CL2A 3WLRA 4KQWA 1LBSA 1CUXA 4KXYA 1FU4A 4KW7A 3NNDA 1J0BA 1I39A 3AEKA 2YIMA 4KSBA 2H5IA 2YWEA 5K0LA 1DIHA 3B7WA 1HG1A 1X39A 4GUDA 3H9JA 4JLPA 5CNIA 1PJCA 4IAOA 1ENHA 4RHYA 4ZTBA 2Q3JA 2O0KA 1DC3A 4X8HA 4ND6A 3R8XA 4PIVA 4B3TB 1R74A 1O94D 3AI3A 4R51A 1XVAA 4LDJA 2PAAA 2JGFA 4AJEA 4GU5A 2EKQA 4I55F 1NTCA 1OWOA 3PPWA 1T4BA 3THYB 1D6MA 2P7IA 4W7SA 3G9TA 1X87A 3GYGA 1E79D 2ZBVA 1XV5A 2ZRQA 5JC1A 2E2JJ 3C4JA 3TGNA 3CPEA 3WFZA 4GVLA 1A0OA 1ODSA 1QNLA 2IIPA 5G2OA 3ZV7A 1UT8A 4E33A 1VQ9I 3MS2A 4JYMA 9LDTA 2XA1A 1UBMS 3B9QA 3C3DA 2E55A 3WK6A 2GBGA 3GRVA 4GPEA 2A14A 4A2CA 1FDOA 3MWDB 5EP3A 2R1TB 4JWTA 2QHXA 2XVCA 2FGJA 2IPLA 1RPJA 1A9TA 3SY8A 4FSHA 1VIMA 1YE3A 4LF4B 1XCGB 1KYIA 4BFWA 3H9QA 1DOHA 4N5DA 3R75A 4FFNA 4HKTA 4KMRA 4EVIA 5K2MA 5D84A 4KTTE 2V7BA 4QTTB 1FFSA 5C4MA 3WYNA 4G23A 2QZPA 4ZV9A 3MTGA 1JLKA 5E1ZB 4IHWA 4TYYA 3SZ3A 2X1CA 4Y8VA 1U80A 3DKWA 1P0PA 3BN3A 3OUZA 3GT4A 1A9QA 4I8XA 2EIXA 1J49A 1N4AA 1WETA 1SNYA 1M6YA 1CUFA 1MOZA 1KMNA 1W75A 1KOJA 1WZIA 1PFVA 3OX3A 5AVXA 3JQ6A 4KMOA 3BK7A 1GLNA 4F8EA 1REQB 4FZ5A 5JNWA 5TMEA 1YQEA 3JVUA 2QRKA 1VYVA 2GBCA 3WL8A 1Q12A 2IS2A 3MYYA 3HFSA 2FPPA 1QH1B 3RC9A 4HS4A 2X7HA 2Z1MA 1KTIA 4MUBA 5IP6A 1OFTA 9LDBA 3H1TA 2ZJ7A 1YACA 4BMVA 4HCJA 2HCRA 1FDIA 1W5CC 3UK7A 2GJKA 2FJUA 2H1OA 4UUVA 4DANA 2XXAA 2CJWA 3RTGA 5TNXA 2OLJA 4LTMA 4O4HB 1SCUB 4P3KA 3B78A 5SY9A 3H5RA 2BL4A 1ZR4A 3DQQA 1ONBA 4LVCA 4EPRA 4G9YA 4RHUA 1ISRA 2HRCA 5HRAA 3BOSA 3HB9A 3NRJA 5GZ1A 2CXXA 1V6CA 1ZH0A 3QY9A 2XB2A 1T0PA 3HYLA 2Z6AA 3EHEA 3BTCA 3EC1A 5GGYA 3GLHE 3LU1A 3FXMA 2HYDA 4P7BA 2A6PA 4UW9A 1QF6A 4J9VA 4KT5C 4AC9A 4UAVA 5LYJB 1IN5A 4FKMA 1B6AA 1U3EM 4TGLA 3BWMA 3OPXA 3UF0A 1EK1A 3BPXA 4WDRA 1IQUA 2BEUA 4DOZA 3ES9A 3RU3A 4NYJQ 5JAOA 2VQCA 3GPBA 3KL4A 2OV8A 3GTLJ 1YCGA 5E79C 5FADA 3DR3A 2HHJA 1EIZA 5EGSA 2XGGA 3EEFA 2HK6A 5H81A 1M72A 5LLDA 3E7LA 4JBGA 3NRCA 3W6UA 1A5ZA 1P2BA 3DMPA 3P2EA 4B5KA 3CGGA 2O2YA 1UDXA 4O4JA 3L7NA 2F4MB 1FB5A 1CQXA 1T4GA 1O5OA 2IU3A 5HKKD 1QR2A 3U3KA 4ZI3A 1XD9A 3L04A 1RI7A 4KWIA 1Z3XA 4F7WA 3VISA 3LZDA 4BQFA 1PBTA 3K0FA 3I6ZA 5KKNB 3M82A 4MI1A 1CY0A 1U9YA 3S2IA 4QARA 3CKLA 1MMGA 3TAHA 3HCNA 3ZEAA 4KXMA 3RW9A 2ZOSA 1F14A 1TP4A 3DKVA 2I7CA 4IZ6A 2B8TA 5LMUB 2DOKA 2F3TA 2OPHA 2XNCA 1C1DB 5KVRA 3FNIA 2JLWA 5LYYA 4LVOA 4D4KA 2H07A 3IR7A 3PGMA 1L4KA 1O94A 1FDRA 2D1YA 1ZD5A 3HO1A 3GT7A 1NVWQ 5IKEA 3CONA 1XTJA 4IGEA 4IJ6A 5J4HA 3RKYA 2YS7A 5EPEA 1JDZA 5B1HA 4N65A 4EYSA 4C1NA 5FKLA 1ZC4A 4S2UA 5DX1A 4KLRA 2L4AA 3G2PA 1X7YB 3V5NA 1FFEA 1QVAA 3GPDG 3PX2A 4FGKA 2XYGA 3DZHA 1P4AA 3VR3A 3SVLA 5IP7J 1ICIA 1FK8A 5AW4A 4EY5A 4FD2A 4KXFB 2UUCB 3RFCA 3I9MA 1T2FA 4IEIA 1LPSA 3LT2A 4ZCPA 3H99A 2Q3MA 4NU6A 1ANKA 1C4KA 2D7CA 2GERA 3UCEA 3KU1A 3RF6A 1NK3P 3X2QH 4G6QA 2ETVA 5COAA 2PO5A 2KIQA 2CZGA 2R5WA 4PY2A 3IAXA 2Q4DA 4F6LA 4KJZA 5C5EA 3VAZA 1HM5A 4O1IA 1DTSA 3KJHA 4RTRA 1IEXA 4I46A 4KDPA 2OFOA 3IBCA 2Q4TA 2GAUA 1Y7TA 2DA6A 4Y9TA 2C9MA 3Q8KA 4MUAA 3RIXA 2EFQA 1WHTB 2RBEA 3WBFA 3KB1A 4QVGA 4EPYA 1PFWA 3FKIJ 3QKIA 1EHCA 5G4LA 2RDMA 1RYEA 4HF2A 3GJ6A 3G23A 4MRRA 1HZZC 3VPHA 1X3ZB 2W42A 1DP3A 1CJUC 3VR4A 2FG6C 4F4FA 1MTOA 3F8SA 2ZRFA 2RI1A 4Z5XA 2W48A 4EELA 3ZCTA 3CVWA 3GP3A 3G2LA 4Q82A 4MEAA 3M9AA 5JPCA 1NE2A 4PGAA 1KP2A 1U7ZA 2BLNA 4XLAA 2QUJA 2G8NA 3OSFA 3F6BX 2NU8A 2ME0A 1R5NA 4LBVA 1AKUA 3EZNA 1HLGA 1IY2A 1O4VA 3JVDA 2X6TA 1BX3A 2FQQA 2CL7X 3ROPA 3V6LA 2QPTA 3INYA 4V0LA 3PNPA 4UXJA 4V03A 3WHLA 4MW1A 3OYDA 2I2FA 2Q2EA 2C3MA 1R4NB 1RS0A 5L3SB 2IYXA 1GXSB 2CCKA 4CL8A 3F23A 3KAKA 5B7GA 3LUCA 3MMZA 1GZ7A 4B31A 3ZHBA 1H2HA 1YF3A 2PKEA 3V2HA 3TNJA 2XVXA 3U4AA 4K0RA 1UM9B 2AOWA 4H3SA 3OCWA 1P1FA 4PCAA 5L3RA 3R6DA 1Z21A 4TXHA 3CZ6A 3SOPA 2R44A 1AK2A 1NT2A 3B6JA 4DBLE 4GO1A 1N2JA 4XB1A 4J1TC 2B4TO 4JV5B 5HOQA 3HCPA 4CMAA 4J6EA 3V4VB 1JX6A 1EZ1A 3GAMA 2JARA 4UVAA 1AA6A 1FP6A 1S2DA 4WCFA 3PXGA 1Y0NA 3A6PC 2OSBA 4JUDX 4BE4A 2NOAA 1CUZA 1GTMA 5FKJA 3LDFA 2OB1A 2J3QA 2J0EA 4INOA 3CF4A 5CPRB 3HKBB 3RK1A 4U2CA 3TEDA 2KBEA 2CMKA 1KQOA 2Y99A 3W3ZB 4UM7A 3HXQA 3AR4A 3VU1A 3SF8A 1AQIA 2C2XA 3ISVA 2A33A 3EOBI 2DH5A 1XMJA 2P3OA 4R9SA 4GYIA 2ZS9A 1CS0A 2NU9A 4YI5A 3MD2A 3LOUA 3KJFA 1LRJA 1CNFA 2P9EA 3O8QB 3V1YA 4KICA 1D03A 3RYHA 4F06A 4AX8A 4FE4A 3VR2A 2G83A 2V6BA 1PLLA 5KTPA 3Q10A 5CK5A 3EMBA 3FMSA 3V4ZA 3BRWA 2QDKA 3TOZA 3OSZA 2JLCA 1FJLA 3THXA 2QX6A 5K0TA 4BEHB 4G5OA 4JL6A 5HIAA 5ENZA 2LREA 1QLWA 4R2MA 5L7YA 3EYYA 2OT3B 2DFDA 2X5NA 4Y2XA 3EA0A 2HTEA 1TX4B 3U48A 3HPHA 2XGDA 1ONOA 1VKZA 3HBFA 3BRSA 1EX7A 4ZV4A 3R41A 4JJ8A 4E07A 2OXTA 3FOFC 2VCEA 1CHNA 4O63O 5IEBA 4B6SA 1G6KA 4QATA 1EE1A 4KXNA 4R1QA 3HKDA 2P6MA 2CYBA 4KXXA 1FLIA 3DUWA 5EJAA 1CC1S 3IVAA 1JGSA 3ZE7A 3QE4A 4EJSB 5L4LA 1VL0A 1XGNA 1QE0A 2A68F 3TLGA 3HU2A 2JGDA 3ESCA 1OPXA 1H85A 3KRTA 2VASA 2FJ0A 4QVIA 4PBSA 2GTHA 4A93J 4ESHA 3D02A 5BYKA 1A9PA 4FYVA 4LE1A 4JEUA 3VRHA 2MCFA 4YG2F 4UM8B 3UFXB 3P9RA 3PI6A 5EMLA 1GZ6A 4WESB 5LGTA 3IUJA 2C4MA 1YAJA 4FN5A 4DUGD 1Z9BA 5CB4F 5AH0A 3C3KA 2WU0A 2IHBA 2MABA 3GLHA 4QTXA 1QORA 4X7PA 1T6XA 3T7SA 4A16A 4ID3A 3JZFA 1UMQA 2ZM6B 2IXEA 1ZINA 1V3VA 3QQPA 4NC6A 3G1WA 2WHPA 1EEXB 4JI3B 4OJKA 3NIWA 3LC2O 1W19A 2PJZA 1FFGA 2KJBA 4NENB 4PHGA 1WP4A 4PIPA 3IOCA 1QCYA 3LSIA 2R7TA 2ZEJA 4OBXA 4ZKDA 4LF7B 4NL4H 3MB8A 4MV8A 3V4PB 4R7GA 4GUAA 2NWQA 4FFRA 4JJGA 2W4IA 4FQ8A 4A2UA 4ENVA 4RPIA 1A8SA 1K78B 1KH1A 4V0RA 1IK4A 4IJUA 1IV6A 4PAMA 2ZKLA 3N6XA 3B6AA 4G07A 2AFIB 2LWIA 1DAGA 3K9WA 3I58A 1RRPA 3DA8A 4UUAA 4KRYA 1VE7A 5HUHA 5DTJA 3SQMA 5LJIA 5ALIA 2HZ7A 4ZVRA 2Q50A 1ESMA 3OOEA 4EJTA 2OCAA 1DWOA 2IYNA 5K5RA 4IDBA 5M5BA 5IRCD 1VG0B 2I1VB 1NW6A 1ZMOA 5DX8A 3NCTA 2WSMA 2WV1A 4QOGA 4LA4A 3QWAA 5IZ4A 4DFDA 2QL5A 5ADVA 5A6SA 5IT3A 3KIPA 4QXMA 2HGSA 3PFHA 2ZB4A 3FMOB 5T64A 3DV9A 3HWSA 4IFIA 5LU8A 3T95A 3DBLA 1JHAA 1EVEA 2PUBA 4PLYA 1EXNA 3V1KA 2V96A 1J2RA 1GNRA 1GTVA 1UMCB 4HFRA 3FLMA 3SS9X 4YHBA 3AJEA 3SMQA 2QR3A 3EGDA 4PFPA 3ND7A 4I08A 1MJ5A 4ALJA 4WA7A 1XD7A 3JX9A 4LGVA 3QVVA 4YAGA 1M66A 1S3JA 3LNQA 4R9UC 3N6VA 2NPFA 2LVBA 1OW3B 3JAMZ 5KKCA 3BHMA 4G37A 2O4CA 3OESA 1MVLA 1F8YA 3AVTA 3L0SA 2DMPA 4M2LA 2GUGA 2ZT7A 3VR5H 5IDXA 3W34A 1QHNA 1ONPA 1NLFA 2D6FA 1A98A 1W9MA 3W5DA 2COEA 2PUHA 1R0XA 1XPXA 1SOVA 1P0MA 4H6VA 5CKTA 5ISMA 5BVGB 3N58A 3DBRA 4XWAA 2PNFA 5FEUA 5D4SA 1E60A 1XLWA 2JK0A 2ZUEA 1W5BA 2R79A 2XUIA 1TK2A 3M2PA 1NYQA 4JT9A 5NLLA 1PRYA 3H6HA 3QEBZ 1DAOA 1AQUA 1LTQA 1UPFA 2I2DA 2B2CA 1Z4KA 1Y1TA 2V3CC 2OC6A 1G42A 4K28A 3UMFA 2ECKA 3U7GA 4RA2A 1U0GA 1K97A 1RWMA 1NQVA 4PX2A 4YT8A 4FVTA 3D6JA 1DSSG 5MFZA 4G0QA 4UU1A 2I8AA 3NWEA 4GW3A 3RT7A 3NCHA 4EQ6B 5C44J 3UENA 2ZFUA 4C0AC 2CLLB 3MFYA 1EG7A 3ZP5A 1F0PA 4JLDA 2J5BA 4XRSG 3E58A 3H87A 5JFRA 3P9IA 3ELBA 3U26A 1EKEA 1JKPC 4NH4A 2GH1A 4LNUA 2DQYA 4WXCA 1WSDA 2ZNYA 2R7LA 2Q3LA 2YHSA 3MGAA 2CUZA 4WLFA 3J7YJ 5E4FA 3K9FC 5AP9A 2X6YA 3DXXA 2FG7C 1GR1A 2WJHA 2QI9C 1MIOA 2CV1A 1KIAA 1BDBA 1KVTA 3TWOA 4EGAA 4PIMA 1Z7YA 1YWGO 5CFMA 3AHIA 3ENKA 3ZDAA 2DSNA 2A86A 3RVOA 3EFEA 2D4AA 2RGBA 2AE2A 4EG6A 2L2QA 4DPKA 1O9HA 1TJ3A 2XNJA 3O4IA 1E3TA 5E9JA 4DUGA 5BUZA 3WKEA 1JHDA 1PZGA 3E3OA 2D2WA 2ZVDA 3A4IA 1S7CA 1JDJA 4FYKA 1HSZA 3TMOA 4PZLA 3QU2A 2I5UA 2AJTA 3ML1A 4QGFA 3SZMA 4G63A 1ZIDA 4ZV7A 2RGAA 1VRCA 3ZHOA 4R81A 1V7QA 3V32A 2GBIA 4L5AA 4C6RA 3GPCA 2ZRNA 4IHJB 4IIJB 4F3CA 4YRBA 1J22A 3BA6A 2HPVA 4CL3A 1W0KA 4HPWA 1MZBA 1H2WA 2J3KA 2LW7A 4BRWA 2XHZA 4MR8B 3AOEC 1TGVA 1M6WA 2NOGA 3I1YA 1CB7A 4B3MB 1BQ4A 4Q15A 4BLUA 1LLQA 4DG8A 6PFKA 1DG9A 4GM4A 1G2QA 2JEZA 5CQEA 4A6DA 5B2EA 2WEKA 3E03A 4D25A 1SC6A 2BBSA 3WYEA 1ZRSA 1X2NA 3Q2OA 4QLBA 3RSGA 3MTEA 1S89A 2KP6A 3TBHA 1X1CA 4Y1RB 4IVQA 4WX2B 1PDWA 4YJ3B 3IEPA 5AHRA 4GWLA 2OKGA 5AVZA 2MYSA 3UMYA 1KFCB 2IA2A 1XDWA 2CFCA 3DZFA 1S9DA 1D0VA 4J16C 4DGQA 1OLSA 5SY6A 4ZYUA 3THWA 3IMEA 2Y2ZA 2GYVA 3EDCA 3KFVA 1CWUA 4AJHA 3GLLA 3K1ZA 5C1DA 1E1KA 4I1IA 3EAGA 2LTAA 3AQIA 2EW8A 3FKJA 2ZS7A 4OKIA 1U0NA 1MGOA 1NU6A 2CC2A 2I9PA 1Z5ZA 1SA0B 3RANA 5LA6A 2Q3EA 1ORDA 4Y9SA 1YHYA 2WKRA 3R9IA 1GG8A 1UPAA 3ZMVA 3WGYA 3D0OA 3ONNA 4EF5A 2L69A 3CX4A 3IIEA 1VTNC 5FBLB 3A3NA 5TJJA 3Q7EA 2E4ZA 3D3WA 4OQEA 1ZWKA 4O8CA 1GGMA 4BLPA 2PSDA 3TW6A 2IOYA 4N5HX 1FYKA 2J9YB 1CUSA 5DPMA 5TLSA 5CT9A 4PWZA 1GEGA 4OAPA 5DBIA 3TLMA 3VO1A 1KXZA 2ZT5A 2GESA 3R7AA 3RRXA 2FSHA 2Q0SA 4EB6A 4E2YA 4FZ3A 3HY6A 3ZD6A 1ZVQA 2HLDD 2R7NA 2NNYA 1XC7A 4M99A 1SC4A 3L7IA 3E9DA 4NYMQ 2M3AA 1XKLA 2L2OA 5A03A 1CQIA 3QMMA 2F4VB 4TQUS 2XCSB 5EG0B 3NJ4A 5CJ2A 2WT8A 5AKJA 2UUAB 1XL1A 1HFEL 4YAWA 3WLNA 5HW0A 3KCQA 1XTPA 2RGRA 1XNHA 4D6XA 3DEUA 2PMHA 2BMFA 1UDAA 3QV1A 5IT5A 3FISA 2WUEA 1FNMA 5J2UF 4NI5A 3U3OA 4TT3D 5TVGA 4H1HA 3LQKA 2EG9A 2IYEA 5BSRA 4MV0A 5HILA 5FB3A 1EDBA 2Z33A 3COZA 2AI3A 4E11A 3KT0A 1QGDA 3DGFC 3A4YA 2P6PA 3ILYA 2VF8A 1OFUX 4FJ1A 3QVLA 2PCJA 3UT5B 5FJ8J 4MIMA 2O0HA 4A3DJ 1TW3A 5IN4A 4BJTA 2NN3C 5ICSA 2ZJ3A 3CNEA 3TIVA 3OKPA 2O1XA 3WC4A 1AXRA 3EB9A 3ZVLA 3KKPA 4AK9A 2I62A 3PKJA 3QUQA 4DDWA 4PHCA 4HLXA 3HG9A 1VYUA 2JRCA 4GSKA 3S1NJ 3DFUA 3HSKA 4IHYA 5EZ5A 1SHJA 4JVOA 2RJNA 5DXJA 2D1VA 1ZD2P 1II9A 1LVHA 4GPD1 1IOVA 4M1TA 3HN7A 1A04A 4W5HA 3AM3A 1NKSA 3H9CA 5B4TA 3ZDCA 1Z63A 5FX2A 4KYTA 1O57A 2BOVA 3GDGA 2UAGA 3DTNA 5FWAA 4TLLB 4JZKA 3UYLA 1P6QA 2P6TA 4XYMA 1RM0A 1YR8A 3D6FA 3T7JA 2R7ZJ 2B8EA 3F7OA 3IAM6 4AUMA 2R97A 3ZYCA 2W2LA 1RJWA 5JVTA 1MO2A 3MOGA 1DX9A 1OOEA 5EQDA 3UW1A 1MJHA 3D2CA 1SB8A 2VDUE 3P0RA 2Z0MA 5DCFA 1ZOLA 2YYAA 1SFKA 4AJJA 3TTUA 2K27A 4G0MA 1X80A 1EUCA 4AO8A 3HDQA 3LUJA 2DH6A 1YA8A 4C4ZA 3AERB 4EBFA 3SIWA 1FMCA 2VXYA 1K3FA 3JPYA 1CG6A 2DLNA 4OL0A 5E7MA 4N0DA 3T7DA 4XM0A 4US2R 1Y7IA 4HNQA 5JJLA 3HPGA 3CIFA 3CDHA 4D5EA 5BSFA 2DPXA 3PUFA 1YTYA 4WGGA 2ZBQA 3JYOA 3FOZA 2GBYA 3A1WA 4TMVA 1SU4A 1WZEA 1D8KA 2QVZX 4R2KA 4X91A 1Z2CA 2AFRA 3K4MA 4R01A 2B25A 4LITA 1Z4PX 4BAGA 1REPC 2RGXA 1DU6A 4TL7A 2RAFA 4ZZLA 1OXTA 3N2GB 2X1VA 4WXPA 1HDPA 2OZVA 1JKJA 2ZSDA 4PLWA 2RONA 2NQ2C 4UHJA 1OWMA 3F8MA 5AI4A 4O2AF 4K9DA 3GDHA 4PX9A 4J1SA 3VPDA 3IPYA 2RQQA 5FOUA 3G5TA 4G7HF 3VC2A 2AX3A 3I61A 3NW9A 3PWTA 4TTAA 2OD5A 1YB4A 1SOWA 3VOBA 3H3JA 2VJ5A 4P9UA 1NRWA 2VNJA 1G8HA 2PX3A 4NB5A 5JD3A 2EP5A 1HFJA 1URPA 1MPXA 5HS9A 2XZDA 3WICA 4OSEA 3LO8A 4JITA 4RZUA 4DS3A 2NX2A 1TT5B 4QNRA 3K92A 4BO6A 3PZRA 1KJIA 2I6UA 1N3IA 5THQA 5AOAA 3BJAA 4BE1A 1J0AA 4C78A 3E0JB 2JGAA 2GYUA 3EXG1 1IXKA 2MD5A 1R9MA 7MDHA 3CX8A 1GGHA 2Q1TA 1RKBA 2C8LA 1Y42X 4M6WA 4FTHA 3GOQA 3HFGA 1PS8A 3ZCXA 3DKKA 1QAOA 1Z5NA 2HLDA 4NFLA 1LV8A 2QUBA 2HKOA 2Q1YA 3SJBA 5E7JA 3TRDA 4PF1A 4B48A 1C0IA 2R7RA 4L07A 2NT4A 4BDTA 3THOA 1D5CA 3IHLA 5E0KB 3E2MA 1DX4A 3MQFA 4O6JA 4IBOA 1L5HA 5E3MA 1I2MA 4NNPA 3NBMA 3PQCA 3EPJA 2DBRA 1BI1A 1KO4A 1ZH2A 3HRKA 4HX9A 3GJXC 4R8RA 5BOSA 1AO0A 5C1PA 4B4KA 3BZKA 1F8XA 4CDMA 2IVFA 2R25B 4TT3A 4UD6A 3GFOA 3H65A 2CSUA 2P2ZA 2PCLA 3IE2A 5LU9A 3V9PA 1UXHA 4KXWA 1FLNA 1AQJA 5F4BA 3FXAA 5AVRA 4RB0A 2J4FA 3I55I 3GR6A 4XGIA 4UMDA 1P7IA 5EYPB 1LVAA 3NVMB 1FMLA 2Z56A 2LTPA 4OSPA 2YPRA 3T54A 2ZYUX 4FGLA 2SHKA 1JTFA 4Q4HB 4WZAB 5A3SA 4LMRA 3SC4A 3IQDB 3E6CC 3IALA 4RTKA 2VH5R 2XT0A 2X4LA 3DV0B 1UELB 4FCCA 2GHIA 3QBJA 4F5EA 2CHEA 4PRZA 4PYQA 3K6SB 4IHVA 4RTOA 3AF1A 1F4PA 2P0WA 4LRQA 2FAXA 1TCVA 3AR3A 3TG2A 1NQXA 4U00A 2PZFA 4L3WA 3A4MA 1RKVA 1GUAA 5LQRA 1POWA 3RFFA 3P8ZA 4ZCMA 1XS9A 5AM1A 1A9SA 1HRDA 1LC0A 3PHJA 5BPHA 1LE8B 2PZMA 4OLJA 3F3XA 3C1OA 2KB0A 3VH4A 4QBKA 1RM4A 2VAXA 3D0RA 2ST1A 5A2QA 4MYUA 5IDQA 3ASVA 4JOQA 1DAKA 2K7FA 2I6QA 4BY1J 2IYWA 1W44A 4J1NA 1TEXA 4YK7A 2M4KA 3CNNA 2FA9A 5COBA 5A6VA 2EBIA 2DPMA 3FX2A 1T1JA 4IL5A 4XB6B 3N53A 4TM7A 3PJDA 2OHIA 5E17F 2ARKA 5C32A 2G08A 2EFEB 3V8QA 4JN6B 4KA4A 5CG2A 4RD1A 3I2GA 2JHCA 1EFVB 2HEIA 2XUKA 3WAGA 3QBVA 3LDAA 3PITA 2X7JA 2Y1EA 3B82A 4QDXA 2NADA 3O8OA 4Q4CA 3EXHA 3WJ2A 1T2AA 4HNTA 1PD1A 1YA6A 3MS7A 3N74A 1FU8A 2X15A 3R3YA 5DGHA 4YMIA 5HA5A 4YCLA 2CLSA 4AT1A 1PAUA 3TUZC 4OFBA 2MSCB 4Q5IA 4AX4A 1FS6A 4AVZA 1B6TA 1P7CA 4IICA 4M36A 2SNIE 3D7KA 1F0NA 1I0IA 3CLTD 4ML3A 1JXOA 4OB7A 3BG9A 1RUNA 3LUGA 1A8UA 5ITWA 3AY7A 2N0SA 2G4CA 2XAQA 5FKOA 3FPCA 4A3EJ 1V8BA 1M74A 4Y7CA 4UV9A 2O9LA 1OBFO 1X77A 5HGJA 2YVKA 1KA9H 4DR1B 1HNNA 3K2ZA 1I6HJ 2O59A 3RSLA 4YAIA 4PW0A 1NQWA 1NASA 3ND9A 3ZC3A 1OTHA 3CO7C 4MHOA 2QUIA 4G0VA 3AZPA 1Y6QA 2IY9A 2G28A 3W5VA 1JFFB 2L19A 5HZMA 3ZHXA 3IP6A 1MMSA 4OHFA 3S1SA 5C3MA 1WRJA 4KOAA 2WD8A 3W0LB 5SYMA 4UJ3A 1JJBA 4WUTA 3H2KA 3QLEA 3RSQA 3MYRA 3GEIA 5LUAA 1DZ3A 1Z4OA 4V0NA 4XWYA 5TEVA 2NXNB 1F2UA 3RS9A 3ZZNA 1FSPA 2HF9A 1RCFA 5BWBA 4FFBA 4ATNA 5ALHA 1W2HA 3EW7A 3HOSA 3B60A 4J0QA 1ZHHA 5EXTA 1PR4A 3EARA 3HNOA 3G2QA 3N2EA 1UFOA 4EGCB 4EOGA 3IR5A 4YMWA 4L73A 5F4ZA 5JJBA 1OCOH 3IVRA 4PQGA 2HU5A 4IXAA 2AQ8A 3WS7A 3ZQFA 4NCAA 4D96A 2AEMA 3NP9A 5JS6A 4PJ0C 2D1TA 5ARBA 2VSXA 5DKFA 4PFSA 1TIKA 3OZWA 4DQDA 1RSZA 3ZK8A 2F3UA 1NJGA 4UMFA 2WV9A 4ZEWA 1FJHA 3RK4A 4MKGA 5L3VA 2AZ4A 2Q1XA 4GX5A 1N57A 4JLJA 3WLJA 1XCOA 1YR3A 5JAUA 3IBSA 2VJAA 3ROQA 4OI4A 4KUEA 2VTBB 2WFLA 3WBJA 2QN2A 4H7EA 2D5CA 2IVZA 2BM1A 3S2EA 4JCCA 2JAHA 2YHIA 3QWBA 4IX1A 1YI2I 1XJCA 4N8SA 3ZCOA 4URZR 3LBNA 1AO3A 5HDGA 3GCGA 3VC7A 4Z4IA 3M5WA 3KZZA 3IGFA 5JQGA 1RRVA 1G1MA 4P84A 2QS9A 1P9QC 1MX9A 4RS8A 1WGXA 3DQVC 1E3JA 4DHWA 1HC8A 5D1HA 4I7HA 2NV6A 1UJ4A 4YRTA 3B1ZA 1HQKA 2L18A 2JBAA 4C5BA 3LA6A 1OBCA 2CUKA 1MV5A 1IQ0A 2IEBA 3SX0A 3AKDA 3T7CA 1G63A 2AGVA 5F64A 3U21A 2R00C 1UF9A 4XLNF 2GNOA 1DFGA 3HN6A 2Z8XA 1Y3DE 4K9MA 4XKJA 2A1UA 1NN5A 2BTEA 1P6RA 4RGUA 2XBLA 4R6WA 4L57A 1KBZA 1UDRA 1C80A 2Z5LA 4WOJA 2PQ8A 3OYEA 3UTDA 3PB3A 1M7GA 2PGLA 3OJWA 3IDZA 5K7HA 1KKLA 5KSYA 4QM7A 2DRIA 4DCCA 4H6WA 5D8DA 3O2SB 1QGPA 1WQ3A 2C2GA 1XMQB 2QQBA 3BIJA 2VJOA 3S3NA 1DKQA 4UDXX 1TNTA 4ENKA 3TFOA 4YRPA 2PX5A 2UZ1A 2HFKA 1ZPDA 3QNWA 5DMHA 1QDLB 1H3EA 2EJRA 5HS6A 5M7EA 1RI2A 4TXMA 2H29A 4L3VA 2CVPA 1B0AA 4CCYA 2ZJ8A 5TPWB 4JENA 1OQAA 2VJ4A 2JFBA 4L2IA 3I2YX 4GM0A 2GXAA 4RW0A 1F1JA 1N8SA 4DKJA 4AY4A 1KU2A 3H8VA 3FH0A 1VMDA 3CWCA 4GECA 3SZGA 3H8WA 1QB8A 4QU0A 4S0HB 2IS4A 2R2AA 2PYZA 2O8XA 2WHQA 3ICVA 2KLOA 4ZODA 1XX5A 2MYPA 5D3KA 3V7SA 5FR1A 4U8GA 5ALEA 5CX1A 2FZLA 4ACAA 4CM5A 2B6NA 1B14A 3TLJA 4CR6A 2AV6A 1UEIA 1XAGA 3ER9A 2VBWA 3BXGA 2HO5A 1QQ5A 1KU3A 3L01A 1Q77A 3KD2A 2QD2A 3PEEA 3S3OA 2QIPA 3OA2A 1BGWA 3ZMUA 3VR3D 1KDYA 1ZDMA 2JH3A 4XOTA 1I1QB 1ZIYA 4OLFA 1OH5A 4A0YA 2ZBEA 3LX6A 1WI3A 2WU4A 5F1JA 2Q6VA 2WZDA 2Y92A 1CF7A 4O3MA 5ULLA 2NTYC 2ENWA 3GFMA 2E4UA 3DO6A 5HOOA 2YY5A 3LHDA 2EV5A 5A1JA 1N6KA 3PJRA 2J5OA 3ITNA 5KINB 1TDJA 1ICEA 5B1SA 1QRUA 2OOKA 3QY0A 1FFXA 4MS4A 1VLZA 4EJSC 4NJEB 5H3LA 1IDYA 5IEJA 4NNOA 4ZGGA 5G4KB 1QZXA 2ZAOA 3TPCA 3AUXA 1Z37A 4Z0NA 2HC9A 5EKSA 1P5JA 1M5TA 5CIWA 2E21A 1N2GA 2VPYA 2XF8A 4K6OA 4F3YA 1D2MA 3EG5A 4HZIA 1QRYA 3I9FA 2FU4A 3VWBA 3KOXA 1DG1G 5CH5A 4CIAA 5AKGA 1TLTA 4GYGA 2GN4A 2GM4A 3NEPX 3I28A 4CGZA 2HYIC 5GPCA 3LBHA 3ZN2A 3KEFA 3S40A 3D6UA 3VR4D 1GAEO 4EM0B 1SH7A 3L4BC 5KU1A 1MORA 2O2XA 4AF7A 1FSEA 4ASUA 2HOAA 2ZREA 5FTJA 2L9SA 1N0UA 2O54A 1L4GA 2XB6A 4ZO7A 1KI6A 1UXGA 2GPWA 1FMWA 2G5PA 1LSJA 2OCDA 1Q7BA 4IJAA 4UXIA 3ILHA 5ILOA 1JTXA 1K6YA 2D7DA 2GDZA 1CJMA 4DG5A 4N3GA 1CY2A 2VIIA 4BYYA 3A6FA 3PIPF 3GF2A 2VPWA 3LQ2A 3UIEA 1WPRA 9ATCA 1K2WA 4F1WA 4QKQA 2K6GA 2CHQA 2OU2A 4MGHA 3V8LA 5B36A 2ZWIA 2HA3A 3BR2A 1I4TD 2Z3WA 1PUFB 2VG8A 5I7UA 3RTRA 2QYOA 1JZQA 5F51A 1RRCA 2GSDA 3UWDA 1NX9A 1XKTA 1M1YE 2OO5C 1PSZA 1Z12A 2Z2ZA 5BQFA 2AMFA 2DZDA 2UVQA 2AZDA 4LY9A 2V0GA 4G12A 1ZELA 3GEGA 5BPFA 2AYZA 4JJKA 5I4IA 4NOMA 4PLPA 3ANLA 2ZRIA 4WFKA 4OHUA 2IPOA 3HA2A 4FCYA 2J09A 3VZDA 1MKYA 4CM9A 4JJEA 4OTZA 3FN4A 4OJMX 4XDZA 1UBSB 2W2KB 2X86A 3CBGA 2IWHA 4RMHA 3TMKA 1BMDA 1DIBA 3AL2A 1RJEA 3QXSA 4KRGA 3NARA 4E3WA 4KQ9A 3CEAA 3PO2J 2AJCA 1T4MA 2Q3FA 1POGA 1KOLA 3IR6A 2DA7A 4G6DA 4PZPA 2GZ2A 4YAFA 1QMPA 3MRVA 5FPSA 4OM7A 1K5GA 1BR4A 1JG6A 2JIOA 1TC1A 4HLNA 3RKRA 5ILQA 1R66A 2EKDA 2VZ9A 2P9QA 1LDGA 3H3FA 2AXNA 1VZ0A 2ZI3A 4GOMD 4E4YA 3L1JA 2VJLA 2ROQA 1IUNA 1CZHA 1WRBA 3KQLA 4KK4A 4PG5A 4F3TA 5K0ZA 1U5AA 3WRXA 1Z4JA 4U5XA 3VR2D 4CF5A 2PUFA 3CSSA 2BELA 3I92A 4N6NA 1T3GA 1YJBA 3UXEA 3BRWD 5BV2P 1Y8ZA 1YQGA 1W36C 1KFJB 5FOXA 1VPDA 3ZXUB 4C03A 4B6EA 3AF2A 3STXA 1J9IA 1QIEA 4F46A 2I4LA 2Q9AA 3D8RA 4C7JA 3X1YA 4Y7NJ 2FN3A 1UOQA 3N8GA 3FXOA 1M1NA 2W4QA 4ZYVA 4L9AA 2A69F 2FQXA 4FEGA 3EDRA 1M8FA 1ILWA 4KX3A 1W59A 5FLVA 4KHPB 2NTJA 2GA9A 4HAWA 1T1IA 4LK0F 3MCUA 2DQRA 2PT5A 4TLAA 4CFSA 2CVHA 4EYQA 3M1IA 3UJAA 2IF2A 3BHJA 3JWEA 3E3MA 1MJ9A 2FOKA 3BIOA 4EHBA 3HY4A 2Z8YM 3CLKA 1I7SB 1GNTA 4W9MC 4N47A 3DD5A 3F71A 4RIFA 4FHFA 3V4SA 3GCMA 1Z7BA 3BF7A 2PTHA 1ZG5A 2JFZA 5AVWA 3LE8A 1UKCA 2XE7A 2KWIA 5CLLA 4LB5A 4ZXFA 3M49A 5CHEA 1Z4QA 1YZKA 4HC4A 1O7FA 1E7RA 1ZGWA 4ZEXA 4DQKA 4RKWA 1OWLA 1UIMA 1CUHA 3EEYA 3U16A 2L7KA 3WLKX 5GONA 4J7AA 1XUOA 2FPIB 3LSJA 2YWCA 2BJVA 1Q7RA 3R5TA 1L7MA 2JA1A 2JNWA 3OOJA 2ZPUA 3BWEA 4K9SA 1VBKA 1QAMA 3M1EA 3JZAA 2QR2A 2P7HA 1L5YA 3NJRA 5LBUA 1D1PA 3PC7A 1H1LA 3RKQA 4PSXA 5H80A 5JCOA 5LHGA 4U9UA 2B0LA 3WU2C 1XX6A 3T9BA 3EA4A 3ROMA 2N75A 3AI1A 1EQ2A 4IDCA 3VYRB 2IU0A 3S2YA 2WNSA 3O9ZA 5J1SB 4LLLA 3GAFA 4WKCA 3GROA 3OOYA 2YXBA 5CA0F 3MWKA 2RIPA 2GAOA 3FK7A 2YJGA 1BOBA 3TIGA 2CE7A 2XF2A 4PG4A 2P0AA 1GRQA 4ZRDA 1U31A 5F3WB 1TYBE 2F8TA 2EV9A 3C6MA 1AB6A 3CZRA 4LZZA 4PG8A 1UJ6A 2PSEA 2AC2A 4C3ZA 4M7OA 2BFDA 4BFTA 3FHOA 1VL6A 2R6GA 3F0TA 5AK4A 5J63A 4XLTA 3WB9A 4DSAA 5JH7B 2XODA 3G2BA 3ONWA 5BN5B 4XLFA 5TT1A 4KZKA 3LAWA 2YV1A 3B52X 1P29A 1DUSA 1NVKA 3DEHA 4YAJA 2WAYA 3T3IA 1RWWA 5FUXA 2VHQA 2XUZA 4Q19A 1MLDA 1QGYA 2GVDC 3UT0A 1CUGA 1PNVA 3HP1A 1TVEA 1GTRA 1WP9A 2LP0A 1SFEA 3HMQA 2BN4A 2EK5A 4N5MA 4DR2B 1S7AA 2DUJA 5JVDB 1Y63A 3A9UA 2QJFA 1OSNA 3W6ZA 1RE1A 3HGMA 5T4FA 3R20A 4XB2A 2ZRPA 2BXZA 4DT1A 1U04A 5JATA 3LDGA 4BKUA 4NCBA 2PM8A 1GKKA 3KJIA 2RH4A 4U0JA 1ENYA 1RXWA 1V8FA 3M34A 3AQ4A 2VP9A 2RKBA 2HAEA 1ML4A 3KUKA 1FP4B 4FSXA 3SLKA 4U3JA 5ALTA 2CW5A 1ENOA 1P75A 4AN1A 4JUFA 1XO1A 3KSZO 4QOFA 4FYJA 1ONVA 1Q17A 4OIQF 4XM2A 1X2MA 3DB2A 1W2GA 4XKBA 2FF7A 2QP9X 2VSNA 4COKA 4AMUA 3FPAA 4TRNA 3TS1A 4XR4A 3Q41A 3O9VA 3MNFA 5J9FA 5K3EA 2GJ4A 3PRYA 1M34E 3TQSA 1QKJA 2G9ZA 3ONVA 4BWGA 3ZCPA 2JFVA 2OZLA 5L7TA 3BGWA 1WJDA 1GLGA 4BUCA 4L4YA 3R8FA 3D5LA 3GJSA 3AHHA 1AKNA 1CHDA 4TV9F 2MT9A 5FBRB 1E2HA 1NMQA 4YDSA 5B1BH 3Q40A 1LJLA 2I65A 2PGAA 4WNAB 5JRDS 1VIVA 2VEDA 4QXQA 5LZ8A 3DE1X 1NI4A 5FTLA 4D9IA 3S1QJ 1P9OA 3KHKA 3BRQA 1AY0A 4YFVA 2PQ2A 3DLBA 4KQXA 3SZRA 5B66C 4M53A 3W5JA 5EERA 2C88A 4HOYA 3RS3A 2H4XA 4P58A 4BN5A 5G0SA 1EWKA 3QHQA 1AU7A 4FHTA 5TQVA 5JNTA 2AQEA 1EWRA 1MW9X 1TFRA 4XCXA 3DEEA 4HLDA 1B76A 4WKNA 4X6YA 1T9KA 4LMYA 5DWQA 1I24A 5F1PA 1T4CA 1BEUB 1DIAA 3U6BA 4C4PA 1PJ8A 1N32B 1R49A 3VJMA 2P91A 5KYUB 3A6GA 3RZDJ 2Q1WA 1DJLA 1U6GA 1M0SA 4IO0A 1LNSA 1GLVA 4N0PA 3FROA 2ZYGA 2Q9CA 2HXIA 4E5UA 1YZFA 3UAXA 3ASZA 2DFLA 2CLDX 2XECA 2GZDA 4XRRA 1CUBA 3L93A 4PGGA 4GYWA 5DGIA 1UCRA 3RV4A 2H1LA 4F5ZA 1QPZA 5IYBJ 1WJGA