4HG2A

The structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
AFRPRYPRALFRWLGEVAPARGDALDCGCGSGQASLGLAEFFERVHAVDPGEAQIRQALRHPRVTYAVAPAEDTGLPPASVDVAIAAQAMHWFDLDRFWAELRRVARPGAVFAAVTYGLTRVDPEVDAVVDRLYHGLLARDWPPERVHVESGYRTLPFPFPELEAPPLEIEERWPMDAFLGYLGTWSAVTAHRRRTGADPLAEIAPALRAAWGTPERPLRVTWPIAIRAGRILPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase type 11
publication title The Structure of a Putative Type II Methyltransferase from Anaeromyxobacter dehalogenans.
rcsb
source organism Anaeromyxobacter dehalogenans
molecule tags Transferase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2560 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hg2A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4hg2A01
1XVAA 4FZVA 1XCJA 3V8VA 4ZTBA 2G70A 3BGIA 3M6XA 4M7RA 1R00A 2GS9A 2HR1A 1WG8A 4IV8A 1I9GA 1G60A 3DUWA 4RTOA 5FA8A 1L3BA 3DULA 3DH0A 3EVDA 4A6EA 2DULA 1NT2A 4HC4A 1Q0TA 1EJ6A 4QVGA 3EGIA 3PT9A 5K0CA 4DA4A 4WVLA 4YMHA 1Z3CA 2PX5A 3GJYA 3KQYA 4BY9E 1NW6A 1QAOA 3A7EA 4BP3A 1WY7A 5KQSA 3HA3A 1DUSA 5DTMA 2Z6QA 3TLJA 4DMGA 5F2OA 3KHKA 4PIPA 3ERCA 4PYNA 3DXZA 5K0LA 2OYRA 3BWYA 2WA1A 1NBIA 3LDGA 1YZHA 3P2EA 3KR9A 1SQGA 2XYVA 1WZNA 5E9WA 5EG5A 3VC1A 3KR1A 4PONA 4YUYA 1YFJA 1KPHA 4HGZA 4YMGA 5ICCA 2QRVA 3C6MA 2PXAA 1XXLA 2P1DA 2OPBA 1FP1D 1P1BA 4MQ4A 5GP1A 2C7RA 4XUCA 2AOUB 3TM5A 2OXTA 5F2NA 4P7JA 4Y30A 4HG2A 3LHDA 3B89A 4OBXA 2P40A 4DQ0A 3KQQA 2R6ZA 2C7PA 2KW5A 4BLWA 1TW2A 1L1EA 1UIRA 5HFJA 1DL5A 2P8JA 5E1DA 3FPGA 4X63A 2BM8A 2VP3A 4M36A 4YUWA 4V0RA 5D1HA 3FPFA 3BKWA 2VS1A 1ZHFA 2BM9A 2PWYA 3FUVA 3M6VA 3Q87B 3AXTA 3BKXA 3C3PA 3ELUA 4MIKA 3BWCA 3IHTA 3T7RA 4A6DA 5K05A 5EMLA 4GF5A 2IH4A 1KHHA 3E7PA 4E33A 4DF3A 4U7TB 3OZTA 5EVJA 2O0LA 2AN3A 5LQKA 5EGSA 1YF3A 4EKGA 2F8LA 3C0KA 3SR4A 4QTUB 1M6EX 4PINA 4U7PB 5GOZA 1O9HA 3ELYA 4C06A 5E1OA 2ZW9A 4ATNA 1SVUA 3CCFA 3P9CA 1KP9A 2I6GA 2IP2A 4RVFA 4E2ZA 1L3IA 2PY6A 5DM4A 3EGEA 2E5WA 2FK7A 3MCTA 1XTPA 3FTCA 2FRXA 2P7IA 2PVCA 3KR2A 4PCAA 5ICGA 2V7EA 5FCDA 1B42A 3M70A 2YQZA 3RW9A 3UWPA 5LQAA 2UYCA 1SUSA 1XDSA 1AQIA 4LWPA 5T67A 2IDJA 2YXEA 5E8JA 3NTVA 3KQPA 2ZIGA 2K4MA 4R8RA 2UYHA 2BR3A 3T7TA 3O4FA 3KQTA 3MCZA 2OO3A 1JSZA 3P9NA 4BLVA 4DM3A 3SXJA 5C9ZA 3GRZA 2NP7A 1BKYA 3SGLA 2Y1WA 3GNLA 2P3QA 4FS8A 4CKEA 2ZWVA 3UJ9A 5EEHA 1X1BA 5FQOA 4PWYA 4CXMA 1I4WA 3H2BA 3HVJA 5FA5A 2ZIEA 4GQBA 3ANXA 4XCXA 1ZG3A 4M38A 3UZUA 1TW3A 4HGYA 1N7IA 3EEOA 3OPNA 3SSOA 1YB2A 1SQFA 4KDRA 3IV6A 2AOWA 1UFKA 1AQJA 3GO4A 3LDFA 2IBTA 3B3GA 4OQEA 1SG9A 5EEGA 3DTNA 4PYJA 2AZTA 3B3FA 3FZGA 4QQKA 5E1MA 3UJAA 2G1PA 1NBHA 3UJ7A 2PX8A 3P71T 5EIWA 2NXNA 4RVDA 2YXDA 2IDKA 4YV2A 2Z6AA 3ID6C 1F3LA 2JJQA 3HM2A 1BHJA 5D1NA 2DPMA 3LX6A 5GIPE 5FWAA 4HTFB 3EPPA 3OE5A 3E23A 3OFJA 5EKXA 3MTEA 1WS6A 4LWOA 4E2WA 3U81A 3BGVA 3UJDA 1ZGAA 2OBFA 1FJXA 5KVAA 2G8NA 1JSXA 2AVDA 4P58A 1KIAA 3G2QA 1QYRA 3GDHA 3TKYA 3NDIA 2AS0A 3GWZA 5DM1A 3P8ZA 1RJGA 2ZBPA 2AOXA 3LL7A 4XUEA 3ME5A 3OU6A 2C7QA 3B7PA 3KPVA 3HVKA 2ONZA 3BWMA 4QDJA 5DLYA 3GCZA 1O54A 3L8DA 2ONYA 2AR0A 3LPMA 4V0QA 1NW5A 4KRGA 5HEKA 5DXAA 2PX2A 4HSGA 1EIZA 3EVCA 3BGDA 3HCCA 3TMAA 5GM2A 3NW9A 2ZVJA 2P3LA 3DXXA 1X1DA 5EZQA 3G5TA 2FYTA 5T64A 3QOWA 3UJBA 5LQCA 3G5LA 3SSMA 2XBMA 2CMGA 4X60A 4NECA 3EVGA 4FR0A 2OB2A 3EVBA 3KQWA 1JG3A 3LKZA 4L7VA 3BWBA 1UWVA 3CJQA 3GRUA 4ER0A 3C3YA 4FT4A 5CUQA 5CM2Z 2O07A 5FADA 5K0EA 5JUWA 5HOQA 3HVHA 3LCUA 3S68A 1NW7A 2LD4A 10MHA 2WK1A 2ZIFA 2YXLA 3C6KA 3FTDA 3P97A 2ZBQA 1NW8A 5EHIA 4OA8A 2NXCA 4X41A 5CD1A 1JG2A 3JWGA 3KPJA 1JTFA 1YFLA 2AN5A 3KKZA 2B2CA 2O57A 3EVFA 4GOND 5FTWA 2B9EA 4WXHA 3THSA 2ORED 4K6MA 3A25A 2QRVB 3A4TA 4RYLA 1NW3A 4AUKA 3GRVA 4CWAA 5IH3A 3PFHA 3T0IA 4RTKA 5CVEA 3T7SA 3HA5A 1RJDA 4RX1A 4RTJA 1T43A 5K0GA 2I7CA 3M6UA 3B3JA 3AWIA 2C7OA 3GXOA 2H11A 2YUIA 1MJFA 2O05A 2I9KA 5ICFA 1X19A 1RJFA 5EMKA 2NXEA 2CL5A 1XDZA 2NNWB 4RVGA 1QANA 5K0JA 1VP3A 3E05A 2YVLA 3ER9A 3ER8A 4Y2HA 3OE4A 4OBWA 1EAMA 1QAQA 3DP7A 4RTPA 3NDJA 5EMJA 2JHPA 1EJ0A 3AJDA 3FPJA 4GBED 5DPMA 1RJEA 5BW5A 3UFBA 5LQNA 3UBTA 3OFKA 4DCMA 3EEYA 1N2XA 2BZGA 2PGXA 4FSXA 4QTTB 3VSEA 2PT9A 4XUDA 1DCTA 4ISCA 2UYOA 1P39A 5FUBA 2PJDA 3PFGA 3NVMB 4KIGA 4FT2A 3CJRA 4GEKA 4OA5A 4R8SA 5K0FA 3PX3A 2QY6A 3R3HA 4AZVA 1QZZA 3O7WA 5EZSA 3NJRA 4GOOD 4PIMA 2QE6A 2EX4A 1VQ1A 7MHTA 5FWDA 3I9FA 3V97A 3A7DA 3EGVA 4QDKA 5B1SA 3HA7A 1KYZA 4Z2YA 4EQZA 1D2HA 2QYOA 3HCEA 3PLAE 4FGZA 3SX0A 2GA9A 3JWJA 5K0BA 4UOEA 5K8VA 2EFJA 3RODA 4B17A 4RTLA 1R18A 3HTXA 1H1DA 2B78A 5FQNA 2I62A 4H0NA 3AY0A 5EIFA 1INLA 1QAMA 3MAGA 5EQJB 3KQSA 5HILA 1G8SA 1VBFA 4R05A 2IH2A 2GAFA 2PXXA 2NXJA 1FBNA 3BZBA 3JWHA 4RVHA 5CVJA 3R6TA 1G55A 1U2ZA 2Q41A 3I64A 4ER7A 4PGHA 1PRYA 1TPYA 3NWBA 1IM8A 1D2CA 4GC9A 3NMUF 1L9KA 4QPNA 5DX1A 1NV9A 3B5IA 4E32A 3TM4A 1ORIA 3ELWA 4YUXA 2OY0A 3PX2A 4X1OA 3DMFA 3RIEA 1Q0SA 1O9GA 3NVKI 4PNEA 3BXOA 5CVDA 3MTIA 2P41A 4CKCA 2BR4A 3DMHA 4POOA 2G71A 5E8RA 2ERCA 3P2KA 4EKIA 1RI5A 2JH9A 2BR5A 1FP2A 5E2BA 5F2KA 3REOA 4RTNA 1RI3A 4RV9A 1JG4A 5DTQA 2PX4A 1EQAA 4LECA 5LQJA 1ZKDA 1XDUA 3R9XB 2AOVA 2H1RA 3G8BA 3OZRA 4C04A 3BT7A 3GRRA 2JH8A 5E9QA 4E30A 1G8AA 3DLIA 1V39A 2ZULA 1R6AA 4FSDA 4BLUA 1R74A 2VDUE 1VPTA 2PSSA 4FP9A 1JR4A 3CBGA 4E31A 4RTRA 2GLUA 1KXZA 3FPHA 3UJCA 3F4KA 4PYIA 4YUVA 3PVCA 1JQDA 3ELDA 3KPYA 2HMYB 2ZLBA 3CGGA 1EG2A 2AN4A 2G72A 4ER5A 1RI2A 4C07A 2AOTA 4E2YA 2ZFUA 3CKKA 2IPXA 4HH4A 2OZVA 2NP6A 3P9IA 4HRAA 2FCAA 2QM3A 1YUBA 5CCBA 1YZ3A 4IWNA 4M37A 3NWEA 1KYWA 1P91A 2AOTB 5E9JA 1X1CA 3LKDA 3DLCA 4PYKA 3SMQA 2BH2A 2YR0A 2FK8A 2GH1A 3EVEA 3MHTA 5FHRA 1N7JA 3E8SA 1RI4A 3KU1A 3LBFA 5DRYA 1BOOA 4OX9Y 5GM1A 3UJ8A 3HCFA 3TPZA 3OU7A 5CVVA 5BW4A 4PYLA 3G8AA 3O31A 4YV1A 3HVIA 3LGAA 4EMSA 4YUZA 5LQRA 2PXCA 5CVUA 4GOMD 4O29A 2R3SA 1F38A 2P7HA 3OZSA 3FPEA 5DSTA 5FULA 2NYUA 2PV0A 2XVMA 3LBYA 3P2IA 2PWPA 3CJTA 4OQDA 3M6WA 4R6WA 5DM0A 5KYGA 5EMMA 3TKAA 1FPQA 3R0QA 3LSTA 3PTAA 2ZTHA 4CTJA 5P8WA 1X1AA 4P7GA 2ZWAA 3OU2A 5JR3A 2IBSA 2WA2A 2H00A 3LCVB 3HCBA 2FHPA 4QPPA 2ZZKA 2B25A 2VZ9A 4LG1A 2IH5A 2B3TA 2HWKA 3R24A 2A14A 3K6RA 4MHTA 3FUWA 2ESRA 5LR6A 2PKWA 2HV9A 3OCJA 3GRYA 4KIFA 1JQEA 1HNNA 1OR8A 2ADMA 3LCCA 5K0NA 4F85A 3D2LA 5HIKA 2UYQA 4C05A 2VDWA 5K01A 1NE2A 4BP1A 2V74B 4DKJA 3FTEA 3TQSA 1AV6A 5DX8A 3MB5A 2IIPA 4C08A 2ZZNA 3FYCA 5LSAA 2AOUA 3FRIA 5IKMA 4KWCA 3KR0A 4R6XA 2YTZA 1JTEA 1I1NA 4DZRA 2ZCJA 3PB3A 5KQRA 5KS2A 4P7KA 5MHTA 2HTEA 4CKBA 4EVIA 2JHAA 1SUIA 2JHCA 3DOUA 3PS9A 3QOXA 1JG1A 3FRHA 5DT2A 4F86A 1AF7A 3I58A 2FPOA 4MWZA 5CIYA 2EJUA 4KVZA 1RI1A 1VL5A 5EOVA 1NKVA 1R8YA 3CVOA 4IV0A 1NV8A 3M33A 3G89A 3JWIA 5EC8A 2PLWA 4AZTA 4KDCA 3MERA 4GOLD 4AZSA 1P1CA 3BUSA 3KPUA 5K03A 5C0OE 4E70A 1ZGJA 2AVNA 1VIDA 3GGDA 1ORHA 3MGGA 3HCDA 5E2AA 3G7UA 1XJ5A 2ZBRA 1PJZA 3A26A 4YV0A 3GU3A 1D2GA 4GC5A 4PGGA 5HIMA 1KPGA 4KW7A 1G38A 8MHTA 4QQNA 1R8XA 3FYDA 3AXSA 4AZWA 5EPEA 2PBFA 1L3CA 5GINE 5DTRA 1BC5A 4GUAA 4EK9A 3IYLW 5ICEA 2P3OA 5M5BA 1M6YA 3I53A 4DCGA 4E2XA 5HIIA 4C03A 3GIWA 2EJTA 4C4AA 3KQOA 2CWWA 5BP7A 4PYOA 2UZ4A 5BXYA 3X0DA 3G2OA 1SKMA 2OKCA 4IKPA 1WXXA 4PYMA 3HCAA 2IFTA 3DXYA 3M4XA 3FTFA 5E1BA 5GWXA 5DWQA 5DXJA 2PT6A 3ORHA 5DM2A 2IGTA 2ZZMA 2GPYA 3G88A 4RWZA 3HEMA 1HMYA 4F84A 3A27A 4AX8A 3KQVA 3EMDA 3LDUA 3FUTA 1JQ3A 2EG5A 3Q7EA 1KPIA 1XCLA 5C1IA 3G2PA 2VDVE 3TR6A 1KR5A 3KQMA 5EKUA 5LQUA 3CC8A 3IEIA 3MQ2A 4MTLA 5DX0A 1WXWA 1VE3A 3I5UA 3EVZA 3K0BA 4P7FA 5ERGB 1MHTA 2JG3A 4X61A 5K09A 3EMBA 5CCXA 5U4XA 5T6BA 1M0EA 2Y1XA 2XYRA 4QVKA 3P9KA 5EHGA 3VYWA 3THRA 2YX1A 4JXJA 3KPWA 5DSXA 2Z6UA 4HTFA 2N47A 5DRTA 3FUUA 5G02A 1ZQ9A 2HNKA 1IY9A 2CMHA 2OB1A 3SVZA 3TRKA 3WSTA 1VLMA 2P35A 3LECA 3TOSA 3UA4A 4PCLA 3G2MA 1IXKA 3FUXA 4ER6A 1Y8CA 2O06A 4G56A 4RTSA 3DR5A 4RSRA 5FHQA 3EVAA 3SSNA 5HZMA 3HP7A 1G6Q1 2XYQA 4PYQA 5HIJA 4ER3A 3QV2A 2XVAA 3HNRA 3SM3A 4RTQA 3DMGA 9MHTA 4CTKA 2CKDA 5GIOE 1VP9A 5H02A 3UA3A 2GB4A 4RTMA 3UJ6A 2ZSUA 3VC2A 3TFWA
chains in the Genus database with same CATH superfamily
3KE9A 1WDKA 2KZGA 1PBNA 5KYVA 1QCCA 3N53A 5BNFA 1UJ6A 1JA1A 1KKUA 1NY5A 3W7AA 3NLLA 1QIIA 3L06A 1G8GA 4U2CA 4RS8A 4IRUB 3F8WA 1Z3XA 1A76A 1XNQB 2WAOA 2ORWA 1FFWA 3R9IA 3AYXB 2YN2A 1K7SN 1RC1A 1VI6A 5C18A 3IOCA 1A9RA 1HQCA 2XPWA 1KI4A 3A58B 4ZVPA 1RCUA 1V9SA 3MD0A 1SCQA 1Y7PA 3ENQA 3CO7C 3ELUA 5KYKA 4GMHA 4CT0A 4HPXB 1MAVA 4B6PA 2L2QA 2H5JA 1P80A 3D6HA 2WBLC 3I0NA 3O90A 1WA5A 4HUJA 1U3FA 2HK9A 2CH0A 3RFFA 2M0CA 4MHGA 3HU3A 1ISJA 4NX2A 2FG7C 4AFNA 1R6VA 3KP4A 1TEXA 4LITA 4PBSA 2DKNA 4N76A 1J6UA 4EFLA 4Q4JB 1P2SA 2Y68A 3UJ7A 2GUGA 1Z33A 2XGMA 1VKNA 3NHMA 1N5DA 3CLQA 3E23A 3PNTA 2O3QA 5T7BA 2ZIXA 4FKBA 1MW9X 5CPRB 4ZV4A 4P80A 4H2DA 3TKYA 1MNAA 2I4MA 4HZFA 3MJHA 4Y9RA 1QO0D 1GQFA 3A4IA 1X7XA 5HEKA 2PTGA 1XRNA 4M0UA 3EEFA 2VJMA 3NDRA 1XFAA 4R0MA 1OMIA 1E9EA 4ZZ1A 4PSUA 4HF1A 3RVMA 1T35A 5IYBJ 1YK0A 2YIVX 4AZ3B 2L42A 1N33B 3HQ4O 4XPIB 2A86A 2VNKA 2LYCA 2D2IA 1NY6A 2YZ2A 3O1IC 5EWMA 2BEWA 2GBLA 4R9SA 2C8VA 3OL4A 5FFFA 1T43A 5BS6A 4ETSA 1JXOA 2LKXA 3QWHA 1GKKA 2JHPA 1RAIA 2I80A 4WX9A 3ZWMA 4RA2A 2MINA 5FUBA 3PFGA 1R50A 4NMWA 3WG9A 1U78A 4ENKA 1TX4B 4P98A 3C4VA 3DCFA 2D7CA 2M32A 3IE2A 1ZX1A 2I66A 3INTA 4RTLA 4JC0A 3IIMA 3FDJA 1Z4LA 2ZUEA 2AN9A 3EC1A 4AC0A 4C76A 2VH1A 1RQ7A 3VR4D 5FOXA 2H51A 5FLXA 3ED1A 1TB4A 4DV6B 1JJIA 3A32A 1P92A 1NAIA 1PWYE 2G80A 1LE8B 3ZQHA 2CXXA 2JH9A 2C82A 4G0UA 3IAHA 3RKXA 4HEA1 1C80A 3QM1A 5FEMA 4J4HA 1X80A 1SCIA 1G1AA 2C1ZA 1XK6A 1WO8A 3W4JA 2VJNA 2C2HA 3S3NA 2C8LA 1Y5RA 4YDRA 4MULA 3U4QB 2OG2A 1XBTA 4A36A 3G6WA 1L5MA 5DM0A 2PK3A 3ONEA 4TRJA 5IT9A 4RMHA 2UZ1B 5LXTF 2FMUA 3VR6D 2WHPB 2D45A 3ZX5A 2VXZA 1O96A 3LWZA 4P5PA 1OWMA 2DWPA 4IO0A 1G63A 3V9PA 5HDQA 4JLBA 4OGFA 2WB2A 1TJ4A 4LC9A 5CFRA 3QVXA 5FAKA 1SHUX 4G23A 4AY3A 2CNBA 4BNVA 2R7QA 1YA4A 4KAAA 3JWIA 1CIJA 5EC8A 3UMJA 1HKQA 4Q3BA 3LX4A 1IPEA 5DULA 4V0KA 3W5CA 3OT4A 4AUNA 4D96A 4F4DA 3OF2A 3WE7A 4HWTA 2OAEA 2VP2A 3PC8C 4L75A 4MLCA 1SKMA 4TLCA 1ZXXA 1C4XA 3NEAA 3QWAA 5FUXA 4G5OA 4XYBA 3VPCA 4FR2A 3CC8A 7YASA 3OOUA 3GUDA 2ISSD 2VOEA 2CVQA 2EBUA 3RKWA 1OAAA 3FUXA 5JHGB 2QG9A 3HP7A 4N7JA 4S0ZA 1PD0A 4CW7A 4RACA 1YU9A 2QLTA 3QQAA 1XQVA 1T39A 1G2HA 2E37A 2HR1A 5AVUA 3PIIA 1JDBB 1QYCA 2XCIA 5BWCA 2H3EA 2P77A 2WHXA 4DMCA 1KA9H 1BWSA 4Q47A 3K0HA 3B1ZA 3KYDB 3A1VA 2SECE 1YL5A 5CLIA 1XU9A 4U7JA 3GCDA 4MQ4A 1NXPA 2B1GA 3R5XA 1KZ6A 4PPNA 4EYQA 4TL7A 4LHYA 3D0SA 4LY0A 1GARA 2DPUA 3FUVA 3NM5A 1G20A 2VSYA 1B72A 4G5YA 1PLLA 4DBLE 4YRZA 1O9HA 2QTNA 1H4QA 1REQB 2NV6A 3HLTA 1YC5A 1XI2A 2ZRJA 4RBNA 3OZFA 3X1KA 3L09A 2H2DA 3RF6A 3IEUA 4DA9A 3PE6A 5AXCA 5EJGA 3FFXA 5ITSA 4XYEA 4YCMA 3FHJA 3OM1A 2YWBA 3F7MA 1HV8A 1KFKB 3MVPA 2PMCA 4D98A 4P35A 3I54A 2R6R1 4XRMA 1N7IA 4DIFA 1F7UA 3BCSA 2PSHA 2XB5A 5EIWA 1YL7A 3M9WA 2XTJA 1E77A 2EL7A 4IHJF 1FVXA 3ZU3A 3MTDA 1ADJA 2CYBA 4W1UA 4MZDA 1GVJA 2W43A 3EIHA 4I36A 4D9CA 4OWRB 3VDXA 2OUKA 1KQ8A 4XLFA 3T1HB 2KISA 1OUMA 2ODNA 3RI3A 3IRQA 1RUOA 5GTDA 4CYCA 5B6IA 1O3RA 2PMBA 4IXWA 3AVYA 3LW7A 3GFQA 1X2EA 4BO0A 4GSKA 4CMIB 1HZZA 5AICA 1DARA 1NUSA 1NC3A 1VCMA 2A0KA 1X19A 4DBZA 1JU9A 4G8XA 4RHXA 3U9GA 2RGRA 3FXJA 4YIHA 2VAVA 1N2XA 5JBNA 1OIVA 3MIZA 3FFTA 2H0RA 3QXSA 1E2FA 1LLDA 3ZYCA 3G2NA 4IHKA 1EQ2A 4HPWA 5E0KB 3VX4A 1HO3A 2O4CA 1KY3A 3ES9A 4QFBA 3U3RA 2GLOA 3PEFA 2UVQA 3VSBA 3KBBA 3IQFA 5F5LA 3HBAA 1ZXBA 3ONDA 1CUZA 2IZ6A 1DJNA 1HOXA 4RV9A 3W5JA 3HFSA 2NXNB 3G8BA 1XDGA 1PNVA 4MUFA 1TAGA 3A11A 5EHXA 3IH4A 3OJWA 4ACBA 2JJ1A 2DDAA 3J81K 3BILA 4JR1A 4URUR 1R5NA 5K8JB 3P9IA 3TRHA 4N39A 3Q1LA 5E9JA 2C9CA 4P1WA 3JRGA 4KQ1A 1C3XA 1I6MA 1VXOA 4PAOA 1NVTA 4OQYA 3QWLA 2ZJ2A 3HSKA 1G3WA 4DC9A 1VF9A 1QK5A 1N3YA 4C7OA 3QPUA 3E35A 4TMWA 1OR8A 5FPPA 1YYVA 5DX8A 4A16A 2Z9DA 4JSRA 1JNXX 3CM0A 1WW3A 2WDZA 4IIXA 3RYIB 2ZCJA 4UEOA 2AI2A 5HBGA 5A4JA 1K3TA 4I1PA 2KBFA 1NV8A 3K7EA 5DYNA 5HP4A 4IGIA 4DABA 4BE0A 3BXXA 4P5OA 4UUAA 3LSJA 1U8FO 2YMLA 2HV8A 4ZO6A 2C61A 1QS0A 1U2GA 1A7AA 3CCRI 4NJMB 5D2CA 3L7KA 4L78A 5GPBA 4ZYYA 3H9CA 2IGTA 1FS6A 3H6KA 5F21A 3C7CB 1WH5A 1I4EB 2M30A 4JUAA 4O2BA 4INZA 1D0SA 3CRNA 2QPTA 2FOWA 2X1HA 1TJ3A 1Y8CA 2ZVQX 4Q39A 5DK4A 3HJTA 3MYRA 5B7QA 1O4VA 2H6CA 4Q1BA 4W97A 1CUHA 1CYEA 3BGIA 3NV7A 4N3BA 5LA6F 3D31A 1D09A 4L74A 2QG6A 3QHQA 5C8YA 1ZUHA 3VRHA 4JODA 4P34A 5DGDA 3LNTA 4DHWA 3C3EA 3ZQQA 3RTRA 3TQFA 2AO9A 3V33A 3LHDA 3USZA 2KMUA 4QYIA 3RYTC 3ZY2A 4G3XA 3MQ4A 2LY2A 2RH9B 1BMFA 2K9QA 3LOUA 4KGVA 2PGDA 1IJFA 1T1JA 1VNDA 1TUGA 5TQJA 4KISA 5KTOA 4JR2A 3UAOA 1UPXA 3FDFA 3CVJA 3PC7A 3VKVA 2KYRA 4TKVB 4RCVA 2RCNA 2PHZA 1IVSA 3O73A 4KHPB 2FZLA 3GRZA 4LXQA 4YJ3B 5EEHA 2YS9A 3HEBA 4G6TB 4JGBA 3T06B 2OA4A 2M0MA 4NTZA 3SSOA 3EIQA 2ADOA 2JEYA 2RGCA 3JYNA 5J47A 2I3ZA 4IQ8A 3KOYA 1U7PA 3H1BA 5AJXA 2G8NA 1GRVA 1QBGA 4BAZA 3CX6A 4IZIA 5DBIA 3TDMA 2C98A 1IB6A 3SMVA 2V58A 4Z0TA 1U0GA 1E2MA 3WBFA 4PNZA 1WAMA 2GSWA 2YICA 3CEJA 4HWRA 3M2PA 1NOKA 4O4HF 1O03A 2RGGA 4HZIA 1PS8A 1P4GA 1BRTA 3CPEA 3SKYA 2ACWA 4L02A 4HA8A 2C1XA 3SJUA 2HB6A 4BQFA 4PLWA 3N5KA 2NUAA 4RC9A 1THGA 4M76B 3CC2I 4CO8A 3IP1A 5CJ2A 1RJDA 4WCVA 3GP8A 4RGBA 3TLKA 1VP3A 4ZV7A 1NNEA 4M6WA 4MUEA 1RETA 1R71A 2HMWA 1AUVA 3TCNA 5JSUA 2CEAA 3VBEA 3GVAA 1YC2A 4DA7A 3RIHA 2WR8A 1N0IA 4YRCA 3UWKA 3W06A 3S2SA 1JFRA 4IUBS 4HQEA 3FGPA 4GW3A 3UVEA 4B3TB 2J7PD 4BNCA 3UBMA 2Z56A 4JP3A 4P33A 3PYMA 4LYJA 1OISA 4BAUA 1VHLA 1RNLA 1YFZA 1ZYUA 2PRZA 1GGFA 1PRYA 1ZJ4A 3NWBA 1ZM7A 2OBNA 3O74A 1OZFA 5CNKA 3FHTA 1JEQB 4GR5A 4EHKA 5JMWA 3IESA 3D4LA 1V8PA 1X7ZA 1LKXA 3W4KA 1WUJS 1ORDA 4FQ8A 3IMCA 4JZYA 1T9KA 2WWYA 3ZLJA 4XQGA 4CF3A 2DOAA 1Y9AA 2EZ8A 3ECCA 5H20A 4JLJA 1DEXA 1HTWA 5B6JA 2PLYA 2BW0A 4MVYA 1E0KA 3RLFA 2OO7A 2FQXA 3ZUGA 1MG0A 1KMHA 3C6XA 4OHRA 5KYGA 1PN3A 3TBFA 5LU9A 4ZU6X 2IPLA 4XYLA 3D6MA 4OL0A 4HOYA 2DQYA 1QM5A 2BLNA 2POCA 1PJLA 2OWDA 1T8TA 5F2EA 1TT7A 2LDBA 2KZVA 1RLOA 4X6YA 3O8NA 3WOVA 4GP6A 4IRMA 4KUGA 1S2OA 2R96A 1IDOA 1WZUA 2HO4A 1AM4D 5BQOA 5JIBA 2GBPA 1Q7GA 1S6YA 3GBVA 2HCJB 3QY9A 3O0DA 4AZTA 3HUGA 5AKEA 4MW6A 3F97A 4DRXA 3TRDA 2QLLA 4NNJA 1I5RA 3NEPX 2A3NA 4KP7A 3DOFA 4OSPA 4R54A 5CG1A 2ONCA 4PM4A 1UMDA 2BGMA 1VCHA 4MLOA 5ICEA 2QYSA 3AY6A 4H6VA 4YFNF 5BXYA 1OLXA 2OOSA 1PHPA 4DJJA 4QO7A 3K09A 2L0KA 3CLTC 5FOSA 1LEHA 4CKYA 1FLDA 3QKTA 3E61A 4IOAF 1RHKA 3NEYA 4K9RA 3P9QA 4NP6A 3LMKA 2CMHA 1HA3A 4C2TA 4HEA2 3ICVA 2IXTA 4U2GA 2G1UA 1PJQA 4RTQA 1MNQA 3WY9A 4ZYGA 2OG1A 5ESXA 1FC0A 2J5RA 5KYUA 5EL0A 1TMYA 1SC4A 1J25A 4B0PA 1NZJA 4W82A 1VECA 5FAXA 1KRXA 1V0JA 2VPXA 5FFXA 4LBZA 4HH1A 1AQLA 2KQUA 2QPLA 2YV3A 2F48A 4MVJG 4DBVO 4BWFB 4EATA 3GJQA 5COBA 4BMPB 5HCUA 2V6CA 1XEFA 5HOOA 2EFHB 2OESA 4CNQA 1UMKA 4LDJA 4FJ1A 3TN7A 3Q87B 4KC0A 1U3CA 1UBNA 1NLFA 3EG9B 4DJDC 2IPQX 5DCMA 3CSDA 3P2OA 2QQ0A 2O2YA 5JD5A 2I6GA 2NZWA 3VR2D 3TJZA 4RPIA 2P5VA 3GZJA 3DC2A 1UBHS 4WEQA 1JFSA 4N54A 5IDQA 4GKAA 2R87A 2BJWA 4QYSA 4QXRA 2KRFA 1APBA 4U7WA 1LD3A 5LUBA 4MH0R 1A9PA 5FL7A 1VJRA 1ZKMA 4HGYA 3IMEA 1OZGA 1NONA 5JJKA 3L01A 4XR6A 2IUYA 1QGOA 3UGTA 4YJ2F 2ZYRA 5L3SB 4D3ZA 2IUUA 4BFCA 4BV9A 2Z6VA 3TINA 4YJHB 1JWAB 3DTKA 2C00A 4EJUA 2HKXA 4OK6A 2AOXA 3UV3A 4MS1B 2ZCWA 3QJYA 1ZOSA 3MN2A 2K7FA 4X5OA 3BGDA 2BISA 5I7VA 5BN1A 1ONSA 3G7NA 1EINA 2Q5IA 4CKXA 1H23A 3EDCA 1V35A 2OR3A 3W90A 3W3AD 1GAEO 3A3NA 2SNIE 4G9YA 2IS1A 2JVJA 3T9AA 2RAVA 3GJ0A 4GMFA 4YJDA 5DXFA 4J3NA 5ANRB 3JYQA 4OV6B 2VATA 2QNIA 3AVQA 4DYRA 5EP1A 3VI4B 5JO9A 4WBNF 3CUOA 3WGIA 2WM9B 4YR7A 1OHHD 3GTQJ 3DL2A 1Y8RA 1W44A 1UIMA 4EV0A 5A9SB 2OHHA 2RB4A 3X1MA 4OEHA 1JDJA 1QRRA 5KOJB 4D3XA 4RZXA 4HO1X 4Z7JA 4JLKA 2TMYA 3QBJA 3QI2A 1OREA 1RQNA 3H3XA 4P92A 4UU7A 4ZO7A 3OCUA 1QR6A 2Y76A 2BZ0A 3NI2A 1IB0A 2ZE6A 3CZ5A 3JS5A 2WY2D 1IH8A 3GLFE 1X8JA 1Q0SA 4DREA 5HMLA 1HT1E 1SXQA 3P2KA 3REOA 1ZD5A 1E96A 4MYHA 1GA1A 2NU8A 3FF1A 4EHJA 1JQDA 4RIHA 4NPHA 4RF2A 2CZGA 2JZCA 2AMYA 1XF1A 4IZ6A 3KQLA 4MA0A 3A9TA 5C52B 3PSAA 2WDPA 2EL9A 5JRJA 3PXUA 4RS4A 1ENZA 1ZD3A 1KQ3A 3BR1A 3ABSB 1VL2A 2Q5FA 1QTNA 3DTEA 3ILVA 4BEHA 3Q0EA 4TLLB 4YFKF 4I4LA 4LS3A 1DC6A 1IK4A 4EUHA 4MVJE 2XKKA 2C2ZA 3CCMI 2JGIA 4P4UA 3FOBA 1HRDA 3D3WA 3AILA 3ZV6A 4PTYA 3L8CA 1D1AA 4TKLA 3PHJA 2GZDA 3CUTA 3IURA 2CF6A 3CQZJ 3ABRB 3O4JA 2O61A 4Z51A 3H0EA 4INJA 4Y1EA 3W5BA 1H0MA 1MOPA 4JL6A 1DU4A 1KDRA 1CR1A 4ZVKA 1F8YA 3FG9A 1P8AA 1GNVA 5CEFA 2V7GA 4I1UA 3C16C 3NT5A 5DM7F 3NCHA 3SC2A 3I71A 3L49A 1NVVQ 4LZPA 4A03A 1X8KA 4MTDA 2J0VA 2FV8A 3HHEA 2L54A 4P2BA 2QTBA 2JK1A 1G2IA 2E5LB 1KR5A 4NBQA 2GDZA 1GT6A 2OM6A 1MHTA 1NQUA 2XYRA 1ETXA 4WY2A 5E9AA 2GKOA 4BCBA 1R37A 5IAEA 3Q3SA 1SC6A 3HP1A 5TMDA 2X76A 4CBVA 2QX8A 1C41A 3E7DA 1GLGA 3V8VA 5HKOA 3MWFA 4H0CA 3IQWA 2RONA 3RTEA 1QGUB 2XTMA 4OXIA 3CB2A 2XXBA 1TYAE 3OLXA 5JSYA 4N9QA 1ZN7A 2RHCA 3GPCA 1P1BA 1MEEA 1UG0A 3ESXA 5FR2A 3ZW9A 3VM6A 2J46A 1MVOA 1W5EA 3E3VA 2GCOB 4QRHA 3QTBA 2L4MA 5DSZA 4LWZA 1X1PA 3PR3A 2Q6TA 4HAOA 1WQ3A 4P4TA 4AD8A 1JB1A 2AQ8A 3BR0A 1B3RA 2I3DA 3OX3A 4NRDA 2FZ5A 1JA0A 2XA9A 4QQFA 1JTXA 3QZUA 3COWA 2Y05A 4DSZA 3PR1A 1YA8A 4BLVA 4W8GA 1Q7TA 2EV9A 2P5SA 2P4EA 2AMJA 1GYPA 1G7RA 3TXYA 1BOAA 2YWXA 3LUCA 3NRVA 2ZUCA 2Q1UA 3ZDZB 2R4GA 1GVDA 4E0BA 3CNQS 1OILA 1WS6A 4LWOA 4RVSA 4CL3A 4IIGA 1W4ZA 1YB5A 1IUPA 3LL7A 2VF8A 1F6DA 3ND7A 1IULA 1EH6A 2M8EA 5BQ5A 2QVXX 3ZY3A 2BFOA 2ZO4A 3BZWA 3INYA 3BMOB 4Q9KA 2FPPA 2JBAA 2P3LA 1X1DA 4FDUA 3MVEA 3GFSA 1ENHA 4AF8A 2G88A 3E1GA 4JIMA 4CUGA 5A5FA 3LA6A 2Q7OE 3C1OA 2R7MA 4AWXB 2AWNA 5DZSA 2WU0A 3ET4A 5CLFA 2IZ1A 5TVKA 4AYWA 1N2GA 1MVLA 1PR1A 2PJUA 4PHHA 4UD6A 1ODTC 5AKLA 2XUPA 2WG1A 3A3KA 2NNWB 4RVGA 2GM9A 3HKDB 3Q7IA 1DZIA 3VSEA 1FYEA 5G1NA 2OFFA 1E7SA 3DOHA 2BH9A 1PR3A 3CH5A 1G66A 1CJBA 4Q7KA 4F11A 1VQ1A 3ZZNA 3PRHA 3KK0A 3MLAA 4WOKA 5B7GA 4FASD 3CIOA 4IQ0A 4UVDA 5ESRA 4J1NA 1M2VA 5EIFA 5I45A 3FCUB 4C4PA 2VI5A 2OTJI 1CY1A 2R4QA 1DFHA 4WJKB 5IT9Z 1KS9A 1SVLA 3R4KA 4R5MA 1I2BA 2EATA 5BV0A 3GLHA 4H4CA 5TQ2B 1WMEA 2HBYA 1T9AA 1HYQA 5ERXA 3LVBA 1YGPA 4NPCA 3UMBA 1TTHA 3UCEA 2E18A 2HEGA 4E12A 5DLEA 4G09A 4OQNA 3O8QB 4EVSA 3AM1A 4AECA 3U3KA 1NHAA 2D1TA 1JEYA 1M10A 3TL2A 4RXMA 3VTFA 4F3NA 3PTAA 1W30A 3LA2A 3ML1A 3HDYA 1US8A 2V4MA 2DBZA 1TP4A 1H6CA 3A2KA 1CE8B 1W0UA 3OLZA 1RWPA 1TEZA 3UGQA 2EPFA 1JDSA 1ENOA 3F5FA 5E6RA 1PDNC 1YJAA 2H54A 1ONOA 1FQKA 1V11B 2NIPA 1I1NA 3GNSA 3TAXA 3TL3A 1OA1A 3MMZA 1D07A 2M4GA 2C2KA 2CHQA 3S2HJ 4INPA 1J06A 2PLNA 5AO9A 3N76A 3DOOA 2QCOA 1COWD 4TKUA 4WLFA 2ICWG 1IUFA 2E89A 3AIOA 2GEFA 4FJ2A 3KOUA 3DDUA 1R5BA 4NFYA 4HVAA 2HADA 3IQDB 4IMPA 3QFCA 3QE9Y 4ZEVA 2FBHA 3A2MA 4JEMA 3L7IA 4C03A 1QUFA 5J4HA 2MCFA 3TOVA 5BP7A 4LBVA 3CBQA 4BZQA 4AJNA 3MJEA 4WSOA 2LPMA 5AW9A 3OT1B 5C1IA 3TIFA 5JNLA 1JFFB 1AF4A 3IUNA 1SO8A 1J0XO 1B8PA 4OU4A 4NYJQ 5HZHA 1S3JA 3WO1A 5F12A 4HXGA 2ATEA 2C5AA 1FMLA 1L5NA 3F46A 1DXHA 1OX4B 4LGYA 1MCZA 4JT9A 5LJIA 4NBNA 4BMVA 4NJEB 1DG3A 1Z7BA 3VZRA 3PD7A 4I2OA 2UZ0A 4BYYA 4XJTA 4GL2A 3EGIA 5K3CA 4JYBA 2P69A 4CF7A 1S3SA 3TXXA 3ERCA 4WVFA 4MYUA 4KVGA 2F00A 4DRZA 3MMPA 1B16A 3VZDA 1KO4A 1H9TA 3ZLTA 4PHFA 2JK0A 3TZQA 2VBXA 1T36A 5CYOA 4W7SA 2GN1A 4PFOA 1H22A 3DAPA 4BYGA 4MQ9F 4M83A 1GTL1 4K40A 2I1LA 3ELYA 4RJ2A 5E1OA 1WB4A 3HOSA 5L45A 5JEDA 4WXMA 4DCNA 1KRWA 3KYLA 2V7EA 3TW4A 2OZKA 1KH2A 1XDSA 4MQLA 1HDDC 1XZFA 4KX5A 1E6LA 4OIQF 4KE8A 2M7BA 4BN5A 4W5NA 5H70A 3KFLA 1FQJA 2BKLA 1RFGE 3T1TA 2WJZB 2E2JJ 2ZSJA 1D03A 4YV2A 3M5WA 3FGOA 3ZE6A 2IA0A 2OCPA 3SZOA 2DC1A 1VL1A 4GPD1 4BDSA 5JFOA 3CKMA 4GI3A 3U13A 1SBIA 2IYXA 1U0BB 3O4IA 5E8GA 5KPJA 1D9ZA 1TVEA 3WWDA 2JJ2D 2QLZA 2J3KA 2QT1A 3H5VA 5CXQA 4AIIA 5CITA 2GF9A 4RKEA 3RVOA 1GN8A 3EMVA 4YIFA 4KAFA 3TD2A 3OQPA 4G07A 4DM7A 2CE2X 3AR8A 3IEPA 1D2AA 2CHVA 2GBLC 3U1BA 3ZTYA 2O14A 4FSXA 1A2KC 4ZMSA 1EP9A 5TLSA 2DBQA 8ADHA 2YZNA 1RSZA 3DPLC 4R81A 4X85A 2YVQA 1ODFA 2MW8A 3FGNA 2WWWA 5TPWB 1QGDA 2CZCA 4MRMA 1POWA 1SD5A 2E85A 1SCDA 3ABUA 3RCOA 4R05A 2GK7A 3LUJA 5AKGA 3N07A 5CT9A 3WGTA 4QGGA 1WVIA 3HJGA 2DMPA 2HOAA 2WJ6A 5I8PA 1WKMA 3FR7A 1PEKE 3BEOA 3K72B 4L3OA 2G71A 1OB2A 3BR5A 3WU0A 1JG4A 2BGKA 3L9XA 1GU0A 2K9SA 1V47A 2WJ4A 4CM4B 2DG2A 1ZEJA 3KEQA 4Q7LA 1XLUA 2G72A 4FPXA 1P19A 5C8VA 1DEOA 1JVNA 2LKSA 5TMBA 3CRW1 3P0EA 2I2CA 3MKYB 4GLFA 3ZDXB 2VHQA 3F2VA 3HUUA 1JH9A 3LLMA 1TIBA 4LNHA 4LUCA 2GILA 2TDXA 2C57A 3UHAA 3DO8A 3FNRA 5DSTA 3OZBA 1RBYA 3N2IA 3FMQA 4C3HJ 1KFEB 1R9NA 4Q4LA 4YAGA 5AH0A 4P7GA 3KOWA 1JH8A 3DR3A 1X1TA 3NRJA 1Z6GA 1XQ9A 4FGUA 3IE0A 1CDDA 5I7RA 4WDRA 1YW7A 3D6FA 1XRLA 1YHNA 2CYCA 5IUNC 5I8WA 3O21A 4UFOA 1IJBA 5TMEA 3S1MJ 5IAOA 3ZQCA 1U99A 2BI8A 2FE1A 3GR6A 4J0KA 3PFFA 1WSAA 3I30X 5DM70 5G0UA 4CA0A 1J1ZA 4FGKA 3DWLE 1FPMA 4FK8A 5T41A 5T3UA 2LTAA 2GD0A 3IHKA 2SKEA 4CDNA 4MUIA 2I71A 1G3RA 3DLPX 1ECCA 5L6LB 1AU9A 2P1RA 3RVKA 1P6XA 2OVBA 1MAAA 5DBEX 3IVAA 5A05A 5KTNA 4UC0A 1C7QA 3B2NA 2GJAA 3G59A 2X2EA 2HXSA 3RFTA 4E1AA 2YS6A 5JMOA 5ERGB 2ZJ8A 1W85B 4RD2A 3P9KA 3WL5A 5CYFA 3KXDA 1YQQA 3HKEB 4WXCA 2R65A 4KN5A 2P35A 1L5SA 1K2WA 1Z4IA 3GMTA 3IBTA 3B73A 3VI3B 3TFWA 4QHYA 2O1WA 1DQYA 1OLUA 3A6GA 1WPRA 4I01A 5DV5A 3CV3A 3ZLUA 2P7CB 3ZJ4A 2BGWA 1SZPA 4E7KA 5K0CA 1I7QB 2PUVA 3E9YA 3GPIA 5I9SA 1ST2A 4U7FA 3ZMSA 3RD5A 4OTZA 3FN4A 5JTUA 1NBIA 3P2EA 4KXLA 3QJGA 2ZU0C 3ZCTA 1AXEA 1FNMA 1SOVA 2YYYA 5HLHA 1FZPB 3W1EA 1K1EA 4CMHA 2C7RA 2AOUB 3ESZA 1U8UA 2P40A 2R5FA 3KYJB 3PFYA 4MV8A 2Q3CA 5DP1A 4GLBA 2B9VA 3RWOA 4A6DA 5HKBA 3RSZA 1JWBB 2VSFA 1WMFA 2DLDA 3NRBA 2A1IA 1BFKA 4G4IA 3ZLVA 3KUXA 2QRJA 2ME0A 5K20A 1FYDA 4YY3B 4FMCF 1LFAA 2X22A 4BFZA 4DR5B 4LF9B 2PFSA 2FY8A 3P9RA 3O4FA 2QSJA 2YOGA 4DZTA 3ACDA 1P2TA 1WQ4A 1DU0A 2ZCVA 4TMKA 3UK1A 3DKWA 3CX4A 1L4EA 4GX1A 3MJDA 2M7AA 5IAGA 5F3RA 1T1EA 4M1YA 3AY7A 4XKWA 1JR3A 4XZ3A 5TF0A 2RGAA 4WN9A 2W48A 1LI7A 3I56I 1HDGO 1T38A 1DO2A 5ALIA 4R8KA 4ZAYA 5M3MJ 1KSGA 3GFBA 5KNBH 3RRJA 3GCZA 1L9XA 2ORVA 3ZOKA 4ZXPA 1ISGA 1X94A 1AUPA 1XELA 2G08A 1JQAA 3P1JA 2HRBA 1O95A 4KJZA 4OPMA 5AQ1A 1WJ5A 3BWBA 4N03A 3QITA 1LX6A 2J32A 4EF5A 1YRAA 3OPXA 2A1UB 2K4BA 4D9MA 4LZOA 4L51A 3RRFA 5EHIA 4UAVA 4HR7A 3EDMA 3EVFA 3IAS6 1RQPA 5HKAA 2P9JA 2NZUG 4EX6A 3NYWA 2Z4RA 5A0FA 1T8PA 3B6JA 3OZAA 4ZHQB 4RTJA 3BX1A 2KLHA 4NMMA 5J58A 3NWOA 3O82A 3FWZA 4M8KA 1HZZC 5FBLB 1QA6A 2J07A 3CCEI 1GTZA 2IGBA 2KT0A 2COEA 5HS9A 1Z77A 3WIUA 5AJVB 1T1RA 3L8GA 4G67A 1Y6JA 4L6IA 3QLTA 4CTOA 1EIWA 3EMKA 1JIUA 1YZTA 1PZHA 2ZAIA 2CD7A 4M1WA 1F48A 3BZBA 3AQIA 3G9QA 4LE0A 4C0SA 2DFPA 2IY7A 2B3DA 4DCUA 1WUIS 2WJ3A 2COBA 4EO9A 3HSYA 1F1BA 1ZIOA 1N0VC 3OZRA 5JTTA 3BCRA 2DBBA 4FSDA 2BYVE 1K08A 4UW9A 1NPYA 4A69C 3DGEC 1HW1A 4KPFC 2GZ1A 2NP6A 4S3MA 4GM0A 3GJ6A 4IWNA 3Q2OA 4HDQB 3ANYB 3TLGA 2FK8A 2B4TO 3K2QA 2EH3A 2AH5A 3TPZA 4AULA 2HWXA 3FVRA 1F06A 2VNIA 1J09A 2P9FA 1FEXA 5F0HA 4L07A 2A84A 2ZG6A 3Q0TA 2H7XA 2MSCB 4E1BA 3FW1A 1N5KA 1Y5NA 3ONWA 4UUSB 2C0PA 1Q1NA 1R5GA 3OQHA 1J33A 3EIFA 3IP8A 2W4IA 1NYTA 1VG1A 2N0SA 4JZKA 1YOVB 3QOEA 2CNOA 2NO4A 2IYFA 2J6IA 4C6TA 3RHTA 1RYBA 5BOSA 4NYMR 4MKZA 5CYVA 5KDLA 2Y48A 2QL6A 4J3JA 3DFFA 2JLCA 2NU6A 5EJIA 1H2AS 3IH3A 4G65A 3R4CA 3WHPA 1ZD2P 3K5IA 4OKIA 4FZ3A 5BQPA 5IYZA 2Z9CA 2X4DA 3AXSA 1IZ7A 4NBSA 4COOA 4PRKA 4XSGA 3CSUA 4KLCA 3ZVLA 3OTHA 3LUGA 5JQGA 3ADOA 3AQ4A 2FJ1A 3C3MA 1XEWX 5JLWA 2LNDA 3A6LA 3VR5D 1U2GC 4JL5A 2FE3A 1KDVA 3ZOBA 1U8BA 4L5CA 2V45A 3FLMA 5KYYA 3CFYA 1KY5A 1JQ3A 4XNFA 2X8BA 3UNXA 2JHFA 2BJHA 2GAOA 2TRTA 1KYVA 5AUNB 4KO8A 5BWLA 2RARA 3IR7A 4MYRA 3NTUA 3I59A 1J7KA 4OOFA 2EWWA 3DZIA 1VLMA 1NLYA 3DE7X 1A35A 2HU7A 1NP6A 5KVVA 3K20A 1RXCA 4R51A 4H35A 1K27A 2Q1YA 3I55I 3STHA 2XDAA 4OBEA 2ZUVA 5E7QA 1K97A 3I2KA 1K6OA 3PNSA 3DUFB 3G1LA 1B4DA 1FMTA 4B9AA 2J30A 4DJFC 2ISCA 2YS7A 2H4WA 1JHVA 3GJTA 4C0XA 1EFKA 4PGFA 1FP1D 4X1EA 1XNJA 2R7OA 4M1EA 5AKJA 4BX8A 1DQPA 2ZUTA 3N2ZB 3A10A 3O8GA 1RAHA 2WD7A 1MDMA 4B6GA 1UM9B 2ELKA 5K1ZA 3GLRA 4K86A 1MOZA 4G86A 3LSYA 1O6GA 3QLVA 3NHLA 2ASVA 3GYHX 3AOGA 3S2DJ 4MKHA 4YELA 1F12A 1GZ4A 5F78A 2HLNA 1ZK3A 3DVAB 2OP0A 4DFDA 4BE9A 5DNWA 2HQNA 5HBRA 2W1OA 5KHOC 3OKAA 4R1HA 1GSAA 2WJIA 5C53B 5G0VA 2H4YA 4MWTA 4PWYA 3OPNA 4F97A 4GWGA 3KP1A 4UEQA 2O03A 2F3SA 1JT6A 4RM3A 4PCVA 3KFXA 4DARA 5HS4A 2JFQA 3HACA 1D04A 3WAKA 3EHEA 1CUGA 4LLGF 1DX9A 4XWWA 1SXJE 1TKCA 1C8LA 2IL1A 1WCWA 5AJYA 4A23A 3WGLA 2VDQB 2A4KA 3KHUA 3OTGA 2GNAA 4JD5A 4C7XA 2WD9A 3KM0A 1FS5A 5CM2Z 3NBMA 5I9LA 1MX1A 3Q7SA 3DEHA 2ZRBA 2ZSBA 5H6QA 4I4TF 1A95A 3G85A 5FTWA 1TTYA 3PLNA 1JUPA 3KZ1E 4KBYA 3OPVA 4KQ6A 1WBBA 1UPCA 3ER8A 3L1VA 5AIPA 4CMBA 4CHUA 3IKTA 3ZHCA 4M3EA 1XTQA 4XUDA 2Y0PA 4XWTA 1ZJJA 3F6EX 1TGYA 1JIIA 3S1QJ 4UQLA 1WDLA 1VRWA 1EU1A 2JS7A 3NBQA 4DVGA 2TMDA 3WGMA 1MD0A 5D5PA 2LD5A 2IOFK 2Y67A 1QHFA 3H35A 1W4LA 1NR1A 4M7OA 2CVFA 3RREA 2V7FA 3SJZA 4HH3C 1BMQA 1Z13A 4MB6A 4GGGA 3IJRA 1YTUA 4AVZA 2CMFA 4QTXA 3TG8A 3I39X 4KQGA 4I81A 1RCFA 2IYWA 3A31A 4C7BA 2P5KA 2VSQA 3QVLA 3Q12A 3PQ6A 4UDNA 1I27A 1GPJA 3E48A 3L0BA 3ZPLA 2RAFA 4GDFA 3HZOA 4YRJA 3HDTA 3GZTB 5LBIA 1LTKA 1M2FA 2W57A 3CGGA 4L2IA 1UP4A 4WJLA 4EUSA 3VPGA 1WW8A 2WF5A 4COKA 1AGXA 4ZI7A 1TIKA 3KP3A 3KJHA 5CJJA 5KVCA 4GKBA 3DXJF 3DEIA 2FHSA 1OCCH 3FMIA 4ZCPA 3EC2A 2PUCA 2RGUA 4L5BA 2A30A 3R77A 5HDNA 4ESOA 3E15A 4XR9A 4FFSA 5KSOA 1DKOA 1BDBA 1NMXA 4N0PA 2B21A 2IVZA 3R6WA 5IP9J 4LDPA 1W96A 3AHEA 5I7EA 3AZQA 4RZSA 5JNUA 2V1XA 4GBGA 3TUIC 3V8EA 2ABWA 3R8CA 3TB6A 5GJCA 1W36D 3I4MJ 3L6RA 3C85A 1WXEA 4JDPA 3HSSA 5THKA 1WMDA 1E3OC 1KZ1A 2AMFA 1X2BA 1ZJ5A 4P1ZA 1IJKA 3U0VA 1B8IA 2D5AA 3SF8B 3FX2A 4GRAA 5HSGA 3D4NA 3GEBA 4GRIA 4DTIA 2IFTA 1GG8A 1DPUA 2PT6A 3OOJA 4D4IA 3EPHA 3BK1A 5DD4A 3K94A 3VB2A 2I54A 3K09C 5L3GA 5DGTA 1QG0A 1K6XA 5T6BA 1WVRA 1UAYA 3RVRA 1OZ0A 2WY8Q 1AQ6A 4YALA 2JI9A 5MN6A 3QBDA 2EP8A 1G8KA 5FHQA 3X1WA 5E7IA 2GEDA 1SWWA 2FF7A 4UUOA 2YC4C 1Q84A 4QPJC 4PGMA 2F67A 2O3SA 2PQMA 1XVAA 3FWYA 2KHMA 2YYZA 3LX8A 3SFTA 1RCTE 5LHGA 1GWNA 5EUBA 4QPOA 1DIHA 2HEIA 2DWQA 4X45A 5F2OA 2JFXA 1JDPA 3SVTA 2GPJA 4BZXA 3U56A 4LDZA 1DRKA 4HGZA 1MGPA 2VE9A 4WLUA 3MCAA 3L02A 4AKEA 1SBNE 3TZHA 5JASA 2E4ZA 3KOOA 4D1QA 2CLDX 3I4NJ 1HNZB 4KOEC 4AM8A 3PX7A 3ZR8X 1T6ZA 2DSNA 8LDHA 3U1VA 4Q18A 2H31A 5FRDA 1FXSA 5ALGA 4MR9A 4I6ZA 2F4MB 3DL7A 1X77A 3W1VA 2X9NA 3ZK8A 3VYRB 1SUAA 1ZBDA 2NG1A 1YQ9A 1BEEA 1S5PA 1DADA 2VQFB 4QELA 2MBFA 5KTMA 3ZU2A 2H16A 1N0HA 3NATA 1WXGA 3LCRA 5LBUA 1DZ3A 1NW4A 1PZMA 1XTIA 4EY7A 5KMGB 3A4CA 4I66A 3QFRA 4IXNA 1JE8A 2UVPB 3LBNA 5IVIA 3SCZA 2O4UX 4R2HA 5FFMA 1DDNA 2WHEA 3JZDA 4TUYB 1QWOA 2H1LA 2IXSA 3W5UA 1THMA 3SU8A 3EH2A 3L0PA 1Q0LA 2Q6OA 4YQYA 4ZVQA 2O0HA 1NW7A 2QTFA 4N7BA 2V9CA 1CUAA 4PZJA 2QXTA 2Z95A 1JFVA 5LMUB 2H11A 4N65A 3TECE 3QE3A 4IXMA 4BASA 1TECE 4O4JA 3G1MA 1RJEA 3A3YA 3AW8A 3VH2A 4FN5A 1G8YA 4BHPA 2HA3A 3GJ8A 1HE8B 4YA6A 2RAEA 2GEVA 2JD1A 3DAYA 1P7YA 4RWEA 1B0PA 3JREA 1E2HA 2Q9CA 1R18A 3A6JA 3WTTC 2CHUA 4ZCSA 4H0NA 2X7XA 1FMCA 1P73A 1QAMA 3HU1A 2NXJA 4M0CA 4M9QA 3AVWA 4BQRA 1PKXA 1VHTA 3CF0A 2OZUA 2YQ4A 3E5HA 5IDXA 5I6DA 3LFUA 5FJIA 1EX6A 3DP9A 4GRDA 5EIBD 3MPOA 3R9XB 1FDWA 3COYA 1L8OA 1WULS 1QP4A 2MGQA 4ZQBA 3ABTA 4PAWA 3RYFB 1LU9A 1M6VB 3FE2A 2W8BB 4HWKA 2CXUA 2WHQA 5DRYA 5L95A 1OSNA 2JLSA 4FNAA 3RKYA 4UCWA 2P7HA 3KJNA 3DEUA 3A0RB 4BXFA 3VPXA 3ST7A 1I4LD 2HJHA 3HDJA 4HYEA 4A0XA 5K3OA 4D7NA 4I7EA 4BL5A 4P5EA 1QP7A 3CNEA 1VMDA 2QQ9A 4K2EA 4G1VA 1VLQA 4URZR 1E1DA 2FMTA 3V48A 2QZPA 5EZGA 5FKMA 1V37A 4KT5C 2OC9A 2XAFA 5L9AA 3JZMA 3CC4I 4NZMA 4CDMA 1S7OA 2FEKA 1EI9A 4KMOA 3V3TA 1PJ2A 2YV5A 3JCZA 3OURA 2BXYA 2H2WA 2D54A 2G09A 4XD2A 4ITRC 1ZM3A 4HYQA 3GLIB 2UYYA 1K5DA 3N58A 1TQMA 3DMTC 1T9HA 5EPUA 5F5NA 4WCFB 3TI7A 2R25B 3T99A 3ZHZA 2IXDA 3HN7A 1CKEA 1BJAA 5EFZA 3AONB 3S99A 3SYMA 1JGTA 4R3WA 4OJMX 2A9KA 4PG7A 4P7FA 1XMJA 3S6JA 5KINB 4AJJA 1L5YA 3S3TA 3PEVA 3HRMA 4X54A 3QEMA 3SVZA 1SKBA 4CEIB 4ML3A 3CLUC 2G9QA 2WICA 3I0MA 1N8NA 3E5RA 4RA9A 4TZ6A 1XZMA 3MZ8A 2TMGA 2DA7A 3FKIJ 2EZ9A 4F4JA 2GS9A 2V3CC 5A3JA 3R7BA 2HNAA 1OFCX 2IPOA 2QG4A 4KPGA 2JW5A 3B38A 4BVGA 4QPQA 4BP3A 1NVFA 4CMCA 4ADSG 1UBJS 2PMZA 2HA4A 5ICCA 3U49A 1P4XA 3LAJA 2OXTA 1BW5A 1WD5A 4PZPA 4DQ0A 2R6ZA 4M6VA 4BY1J 3T4UA 1V4NA 3FOZA 1OFTA 2Y1EA 3H86A 3BFXA 1II9A 1FY2A 1YBHA 1JV2B 2JIZD 2O3JA 1DTWA 3RSNA 4BGVA 4RD3A 1ZRHA 3E97A 4K3VA 2AFIE 4BMNA 1C8VB 4K9KA 3LP8A 1BZYA 1IBMB 1X0VA 4HRVA 4PFSA 1KNXA 3F3SA 3W6KB 3TNLA 1EVJA 3FAKA 4QG3A 2XEDA 1B14A 1FSPA 1QP8A 3GEIA 4AS2A 3A37A 4DCTA 1EG7A 3B5JA 2HPIA 1YVUA 1L4HA 3S40A 2IBTA 3OO0A 2QQAA 3NTQA 3P0FA 3DTNA 5JSKA 3HOYJ 1J42A 2DPMA 3FDZA 3EVTA 2WWXA 5AK3A 3PXDA 1YACA 3SWWA 4QWMA 5TRTA 4XDZA 1WQ1R 3ZC3A 3WHCA 4MUHA 4X91A 2HA2A 2MMGA 3DNFA 4Q3OA 5K6TA 1RPTA 4UHTA 2JGLA 1XZQA 5A4FS 3WGHA 2VAMA 4OI1A 4I50B 4E09A 5DCFA 2EWVA 3HBFA 5B57C 2O0MA 4BXUA 1RABA 4GOND 4UDXX 3HJEA 4JVNA 1RHQA 3MD2A 1T4CB 2I5UA 3OKFA 2UXNA 4PRYA 1MJBA 2XXAA 2FI1A 2E4YA 4EJ0A 4BAGA 1GTMA 1QFSA 4ZO4A 1U04A 5LYJF 3AG2H 4MVXA 3UPTA 1M8JA 2F3RA 4U7GA 4AX4A 3W3ZB 3E9NA 1CZHA 3K5PA 2ZUFA 3DW3X 3K05A 4XRRA 3BQ9A 4LDNA 1INLA 3ABKH 1VBFA 1FYWA 2Z3WA 2IH2A 1X8LA 4EGAA 2QRMA 5JPIA 4OO3A 5LMCA 3LP5A 5TQ2A 4OHZA 3OBIA 3FWEA 1KAHA 1QHXA 4DBRA 1OXSC 1SCBA 4L7QA 4O63O 3NDBB 5IJ0B 4RFSA 3I92A 4A8PA 4DZJA 2VLIA 3AR7A 1LK5A 2WMDA 4U3JA 1J8QA 3EVEA 1JAXA 3DJFA 4ENJA 1U31A 1J0AA 5BW4A 4FYIA 4KITB 4IOCF 1M2GA 2JKYA 1SIBE 4ZI5A 2A33A 3LCVB 3FYUB 2IH5A 4LOHA 1O08A 3MGKA 5CM9C 4KIFA 3DBLA 3N6VA 3K2BA 4N7RA 4UB8C 1S0UA 5E7JA 3T52A 3ESWB 5KB3A 3OO1A 1YS1X 3VO8A 1JNYA 4QODA 4PSWA 5BMVF 5E3IA 2H1WA 4Q4AA 3NEJA 3SX2A 3C2QA 4H08A 2W85A 2R6HA 3QKSB 2VYVA 3N97A 1JHUA 4HAXA 2ZYIA 1NBOA 2O3UA 3BUSA 3DTYA 4FZRA 5KNLA 3PC2A 3KG2A 3NBXX 1TQIA 2J87A 3JAWB 3GAZA 1A5AB 2B4QA 3KWFA 4GM1A 3SK0A 5EIAA 3RFCA 4LYYA 3WLKX 4A82A 4AUXA 3K92A 5AW4A 4ZA2A 3K1MA 4ECEA 5LKAA 1PWZA 1GUAA 1TUIA 3SZUA 3SJBA 1T3GA 4G41A 2QGUA 3O3OB 1K98A 4J16A 2XBUA 3VMMA 1DUIA 4JXJA 5AI6A 4D4HA 1RW4A 1Y3HA 5AJTA 2IZ0A 4EY8A 2HRQA 1AB5A 2WUFA 3HL4A 3ZGVA 3F78A 2UV1A 2HUNA 4C4ZA 3NBFA 3RVDA 1YRWA 3PUZA 4EW6A 1L3BA 3ZVKA 3WRXA 4ALIA 3RVSA 2H8KA 2GEKA 4KUMA 4HYYA 4Q4HB 4CV2A 1PEDA 4PZDA 2EINH 3TSZA 3AR3A 1XZAA 4YLYA 4FINA 4YMGA 3KQNA 1CLEA 2BM0A 1GV5A 2JJMA 3PPIA 3OYLA 4EL5A 1FBQA 4JGIA 4AD9A 3BKXA 3QUQA 4BX9A 4NE7A 4FFWA 1DDIA 3QRFF 4FFBB 1VJCA 4U7TB 2BHYA 2W0MA 1FU7A 2XNCA 3QG5A 3KZZA 5K3SA 4QUGA 5K3FA 3KOMA 5CJ9A 2HNBA 2WFMA 3S28A 1DWOA 2VIIA 3HWRA 3TLYA 2HDNB 5F51A 1GSHA 1FTYA 1XR3A 2YFHA 3S2UA 5K0ZA 4MIMA 4LZZA 3W77A 2QNBA 4OLJA 3CX3A 4IQFA 3KALA 1U4SA 2K9NA 4Q34A 5FV4A 2WMOB 1JSLA 3C14C 4BMCA 3ZCRA 1RDFA 2G5TA 2E55A 1T13A 4F92B 1AA7A 5DCLA 5L3QB 2JK3A 1NUAA 4EJMA 3PXAA 1H4VB 4PO9A 1QHSA 1LS1A 3TK1A 3QOWA 3CPHA 3PLRA 1T56A 2RVCA 1E1QA 3P19A 3JQBA 5IP5A 1IRZA 1ZJ6A 1ZGWA 3ISTA 5L4NA 3E6AA 3Q6IA 3OQIB 4Y2QA 4F46A 1FW8A 3A6HA 2ZR9A 3DBRB 2BV3A 5I7HA 4Y1GA 3UB3A 2YH2A 2DO7A 1A88A 1USSA 4D4LA 5REQB 4DLKA 3N86A 2H2HA 1XMQB 3SE7A 5BQTA 3C4QA 3IAM6 3K10A 2NXEA 1TPZA 1PIWA 1WDMA 4V0NA 3TTWA 4KNVA 2OWEA 4WOCA 4PHCA 1CPYA 3ANTA 2EA4A 4WY5A 1Q19A 4TV8A 3RYCB 1KEVA 5E3LA 2BEUB 3ZKWA 1DAGA 2COUA 3E9ZA 3IIKA 3V1KA 1U3UA 2G7ZA 2RSLA 2O5VA 2HYIC 4LHSA 3ZNQA 3OL3A 4CEHA 1EK6A 1HYEA 4JC4A 1R9MA 3CZRA 4YRAA 2IKSA 4ARZA 2M2IA 2XCOA 5KTRA 2I87A 2IYPA 1JBKA 2XAJA 5DX1A 5DCYA 3BMCB 4J29A 1NKTA 2KKOA 3ASOH 5EHNA 2AG1A 3RK0A 3SP1A 4JLMA 4GP9A 1E89A 3OIFA 1QK3A 3AEQB 1E1YA 2VDRB 4PXYA 4D56A 2B35A 1YVEI 4GE3A 4MUMA 3FYTA 4BLUA 2DVMA 4GO1A 4LRXA 3BH7A 2PN1A 4G0YA 2CMKA 1N2BA 1I6LA 5KNDA 3PSIA 1YR2A 1UELB 2YJ5A 4TZTA 2AOTB 2YVKA 4R7ZA 5JCOA 5BUZA 4DUPA 4IJMA 4XICA 1NI4A 821PA 2QZSA 1XYGA 2WLTA 3NV9A 5G4KA 1Y8QB 3CJTA 2WIKA 2AYZA 1OXKB 5P8WA 1VFNA 3EW9A 3IA7A 2NU7B 4I0WB 3N1UA 1CS4C 4RSMA 4OX9B 1HKHA 2VRCA 4DNOA 1CQIB 4DLZA 1BW6A 3BR3A 2X85A 4BTEA 1YE3A 4YACA 5LHIA 4CFZA 4E14A 1N2ZA 4GR4A 4TPKA 5JH7B 1GM5A 5JECA 3RS2A 1U94A 3W6JB 2OOKA 5TS2A 2ZVPX 4BE7B 3WKDA 4ZZIA 2EIJH 3D8NA 2XNSA 4ETMA 4XPZA 3EZ2A 2WWIA 2V79A 4NDNE 1L4BA 1B93A 2XMCA 3ZY6A 3LO8A 2LBFB 2FSHA 3PD1A 4I5GA 4EBBA 3QWIA 1XALA 2FFJA 4FYMA 1C0IA 2DA2A 4QGSA 2F7SA 3OYAA 1E0AA 3BDAA 4H7KA 2DKOA 2EILH 2NACA 4WH0A 5JLXA 4W7HA 3WTVC 4BRSA 3EZFA 5LQUA 1AN9A 2F9LA 1G6KA 2LDXA 4UE2A 2BMWA 3FSJX 3UJPA 4XFJA 2V55B 3MT7A 2QMHA 1UJ8A 2OV1A 2WJAA 2FETA 3UMVA 4M21A 3V8QA 1QBKC 4ZH4F 1GUDA 1QOPB 1M8KA 4AMUA 5KNCD 4KXUA 5JQWA 4FYVA 5HM8A 2DUUA 5AWFC 3D02A 1RLTA 1TQDA 4MVJP 2XD4A 2FMHA 4PYNA 3ZDFA 1GUYA 4CT4B 5DEIA 1D2RA 4RCYA 2XTNA 4CDRA 1CY8A 2PYDA 1DKPA 4U2FA 3T5TA 2H7VA 4XLEA 1CCWA 4PICA 4RXUA 3T7RA 4IHWA 1Q74A 3LPCA 4H6XA 2DI3A 1ZN2A 1X7DA 4JBIA 1M76A 3U7JA 3HGMA 4X20A 2FVYA 4W99A 5HW0A 3VZCA 3V4SA 1ZIDA 1JDUA 2DR0A 1U5CA 2B98A 2QN8A 3MJRA 2UYCA 2VDKB 4KE6A 2J5OA 2PZJA 2NTNA 3VR3D 3PWKA 5KHAA 3SXJA 1SUPA 2WYWA 2JMWA 4O4LB 4DBQA 4G5GA 3WE3A 3HVJA 2CY0A 3K8YA 3LFKA 3UXEA 3EEOA 3ZDBA 2RDPA 2ZS8A 4EG3A 5ENVA 2XV4S 3FCOA 3UOWA 4FLFA 1Q0HA 1ONPA 3TEDA 5H81A 2OZLA 3HBJA 1MPTA 1GFIA 5AOBA 4M3NA 5DOVA 4MB2A 2AS0A 5IXJA 5JWHA 4B3GA 1NMSA 4KRGA 4LJ4A 2XMBA 3S3MA 1I5EA 4KIUA 5IM4F 1YONA 3NG1A 4JUCA 1IN6A 4ZOLA 2A6HF 4A2QA 3BQYA 1O95C 2I1WA 1PF7E 3L0IB 4R1LA 2FWMX 1ISMA 1WH7A 3F90A 4WXHA 2QXYA 1KE2A 5KJ6A 4XCVA 4LRQA 3G5UA 4KPYA 1DP4A 4CG3A 5F7OA 4FOTA 3DT6A 4I5IA 1JE0A 1OVMA 1ZBQA 4MUBA 1GG2A 3QE0A 2EJCA 3SHFA 2D3WA 1RUNA 2LFBA 1AMNA 2NYXA 4RQUA 1PYGA 3HU2A 1CT9A 2GA9A 1V71A 2EFOA 3OESA 3HVUA 2VKQA 4MW2A 3QVWA 3M3HA 1FBNA 1YBAA 1X3LA 2Q21A 3QKIA 3TH5A 5D5UB 5KQMA 4QPNA 1M1YB 4NV3A 4L57A 2P41A 2QN9A 2AE1A 1QFJA 1ETWA 1F6WA 3PBKA 1VL6A 4P4SB 2IT1A 1EFDN 1OYVA 1ZCFA 4QWWA 3T0GA 5E8IA 3R6GA 3FNBA 2Q9BA 3TO5A 2J5QA 1IW7F 4DNPA 1MO4A 3PP8A 3G0BA 1GRCA 3P52A 2JFNA 2NUPA 4PYKA 3RJTA 2C31A 1MORA 2WSLA 1E3JA 3F22A 1CX9B 5CDTA 5KYNA 1BQ3A 1Q57A 1UBLS 4UNSA 4BE4A 1CEXA 4A12A 5A4IS 4UNOA 1CUJA 3ZV4A 5IC5A 4G4GA 1VXRA 1QONA 3VAZA 3T8RA 2O54A 1XA4A 2VAXA 4AK9A 3TO6A 1WJCA 2DH6A 2IHZA 3L0DA 4W1RA 1W93A 5EXPA 3FRIA 1RQLA 3WGZA 4DZRA 1C4WA 1DRWA 3K69A 3I6YA 1Z4NA 3RCBA 3G6EI 5ALDA 3QUAA 4B46A 1THTA 4OQMA 1NRWA 5FBKA 2FUCA 4JX9A 1FDVA 3ILSA 3L4JA 1Z25A 4QUAA 3Q6MA 5M3FJ 3L7MA 2A07F 1EE9A 4ZI2A 4BJTA 3PYLA 5CU7A 6GPBA 1LQUA 4Q4JA 1P5RA 1VE3A 2KWIA 1W34A 5I8ZA 3VYWA 2VPTA 2QF7A 4O5OA 4EPWA 1G291 4PCLA 2QSFX 2Z5UA 2VDMB 1S96A 4NPAA 5ALNA 4YGXB 1JGSA 3B3AA 3E82A 4GKJB 5ED4A 1F8UA 2ZQYA 1XCJA 3CT6A 4E7JA 4BHCA 2QVCA 4WKPA 1FNNA 1W0JA 2I8DA 4D5GA 4JBAA 5A4AA 1YLFA 4EUKA 2XMRA 1EUQA 1Q15A 3B2EA 5TJJA 4WA7A 5EWLB 4AZ3A 1QHEA 4MMYB 3C5HA 4XPIA 2VYNA 1ETYA 4LK1F 2DMNA 3UYKA 3G68A 2Z8XA 1UODA 2VUMJ 3W2FA 1SD4A 2Q45A 5DCWA 2Y1LA 2ENWA 2HJRA 3NT4A 3USCS 4K8OA 3QXJA 3FCCA 3MJFA 4M98A 1MAWA 4AJKA 4V0RA 5A4DA 2JJYA 1Y5LA 5KQLA 1NSTA 1E2DA 3T12A 1I6HJ 3BEDA 4X8HA 2WUGA 1R3DA 1QRTA 4IJ5A 5FNVB 1MIOB 5GAHJ 2Q07A 4RK5A 5EVCA 2X5XA 1ZK0A 1RIFA 3CD6I 5DNYB 3FBIB 2BUAA 3NYRA 3KSAC 1JQ5A 4OMZA 3UMRA 3QLVC 1ATIA 3B5EA 1ZRMA 3TAHA 2HQSA 2ILVA 1NVXQ 1KMCA 4NC8A 3MTJA 4MRRA 3Q10A 3H16A 3TG2A 5BV7A 4FFPA 4KDRA 1UFKA 1LE8A 3K8QA 5EEGA 3H9UA 1KJWA 3BBLA 2PO5A 1R88A 5BY2A 3FWHA 3PRJA 5EIHA 3FD8A 4ND4A 3STWA 4V0OA 3JRCA 3T7IA 2XCRB 1D4AA 3U4QA 1QZUA 3WGQA 1H0KA 5B58C 2P6NA 1SH7A 1T9ZA 2OB2A 3KQWA 1RU3A 2IAIA 4DNXA 1UINA 2UZ1A 1YR7A 5JXHA 1I36A 3BE4A 3R75A 1E2GA 2WHPA 4H3KB 1Q0UA 3R3XA 1RZRA 4M9CA 3TCXB 5BPHA 4BU2A 3JD0A 1A8UA 4Q93A 5JXWA 3ZJVA 4LK0F 2Y1GA 2ARKA 3RAFC 3KT0A 4NDLA 1QHIA 3MIIA 2YXPX 1GL3A 2PIDA 5I5GA 1ZRSA 2FNAA 4WWCA 3TQIA 4HAVA 3PHBE 3C8UA 4GOOD 4A91A 4KN9S 2NVQJ 3ANSA 3R4VA 1BD3A 1C7FA 3KUKA 2VP0A 2E87A 5JAUA 3R0JA 1ODDA 4A93J 1GD1O 1OIWA 2GOYA 3ADKA 3H9EO 3BYZA 4KA4A 1RKBA 4B7AA 1T5OA 4G84A 4C01A 2O2EA 1VA5A 3RUPA 2VQGA 3NVKI 3TZEA 2FSIA 1AS2A 1RM3A 3GB9A 5NULA 3FPSA 1WZIA 3SG0A 5ADVA 3L7JA 5JRZA 1SD1A 3R9WA 4CCYB 1T2KA 5ARDA 3A6EA 4DGQA 5FOWA 1E9SA 3E5MA 2QIPA 2QAGB 1XLVA 2ZQ5A 3MJVA 2C4UA 1Z88A 4X64B 3DLLF 5A06A 1F8GA 3GWGA 4M22A 4ZGWA 4HN4B 2FFRA 3LT0A 1GZVA 1EHIA 4HDSB 5TSDA 3FB1A 4CUZA 3K6RA 3IMFA 4G36A 3GFFA 3KYDA 1AKMA 2R6JA 4XX0B 1YAJA 4G26A 1AA9A 2IF0A 2O6GE 4IGAA 2VZEA 4ISBA 1MC8A 4PZUA 4O33A 4P81A 3P2MA 1VJ5A 1XPRA 4JI8B 2AI1A 4F72A 2H7CA 2Y27A 3AEYA 1CZRA 1REQA 3QTTA 5LZ7A 3OJLA 2QX6A 1EWYA 1IN1A 1GGKA 4U8GA 3PXXA 3DPSA 2CV2A 3E0JB 1S2IA 3ZQ4A 1U9IA 4H3HB 5IASA 3AETB 4URFA 4LAFA 1QGYA 2J9XB 1BSVA 4LCBA 3QVVA 3LQRA 4RHEA 3RSHA 2GPYA 3AVVA 3PGXA 4BHTA 2CUZA 5CLHA 4EGCB 2J48A 5GONB 4DG9A 3JQ8B 621PA 4ARBA 3D8SA 2VT2A 4MWBA 1T4MA 1B15A 4FI3C 1RZVA 4ESEA 2J5BA 4BJ6A 1R12A 3IDZA 1CVRA 3N2KB 4KQHA 3NX4A 1O57A 3URKA 4OXNA 3PYXA 4G6DA 1JHPA 3SJMA 1F43A 4YREA 1C7JA 5L3DA 4IVQA 4UAUA 4UTOA 4W9MC 2GZHA 2XMZA 4NI5A 3GHHA 3H9GA 4EY3A 1G2QA 3ECOA 3EN0A 4TMTA 3ANNA 4CMIA 3A9CA 4CM9D 3O6VA 3GOQA 1WTAA 2Y1DA 4M36A 1OFUA 3X1DA 5K8UA 1R1TA 3L04A 2Q50A 3AL0C 3FCXA 4YXFA 3BWCA 1IEQA 2L02A 3H0DA 2ZE8A 1NC1A 1KHHA 4CV1A 4FXPA 1HGXA 3GLKA 3DDWA 3OQBA 4C06A 2RK4A 4HFNA 3D8RA 4NG4A 2BVMA 1W7PB 1ULTA 1K8YB 1FRQA 3M70A 5FCDA 1HW5A 3UWPA 4F2DA 4P82A 5BN3B 4EA9A 4PO1A 3LV8A 3U2RA 3PJFA 1V5IA 2O0YA 1X8XA 4RJKA 4F91B 1SZDA 4QT0A 1XLWA 5DUIA 4UZFA 1M67A 5CIQA 2EKZA 1YSCA 1XIVA 2WM3A 3GTJJ 1H9GA 1YUMA 1O3YA 3AU9A 2NXNA 3IODA 1ADBA 4KBGA 4NG5A 3MD9A 2NO5A 4CLOB 1GCAA 3RV3A 4FLEA 1F6BA 5BSMA 3R8FA 3V8MA 1QZYA 2O2ZA 2YVUA 3AG6A 1LFBA 3JAMK 3AUXA 2HTFA 1PL7A 4R41A 4NE9A 4K6HA 4BBSJ 4F7DA 2WAQA 5GM2A 5D87A 1C2TA 4Q6BA 2CDNA 4LLNA 4JEHA 3GF4A 3BSFA 3T7JA 3N7AA 1XTUA 3T1NA 3HVRA 4Y6PA 3L9FA 5JBIA 1ZVQA 4G0QA 3OIPA 2CUTA 3LJKA 4DNQA 4FMPA 2OD2A 4FMDF 2P6OA 5CEEA 2WBMA 2ZJFA 1YVPA 4Y6OA 4OLBA 3F8SA 4AMZA 4HB3A 3PENA 3TQCA 3RYIA 3UKGA 5ICFA 3H2YA 1Y6ZA 3GEHA 4N9HA 2XIJA 4PSDA 2Q4TA 4CF6A 3M8EA 5F3WB 2AXNA 2IEAA 3BL8A 3R3HA 3KD2A 3FYSA 2QHXA 3BQMB 2JGFA 1UKEA 4FC7A 3C98A 2ONJA 3C45A 3JYOA 1GR0A 2UUBB 2I22A 4YK7A 2E2HJ 3JWHA 4NJMA 2AJ8A 4DY6A 5IPAA 1NATA 1CF4A 4DL9A 3VU9B 3PV0A 2AMVA 1JKXA 2A59A 2EYQA 3LDAA 2ZI6A 1O5OA 4MGEA 4PO3X 1O3QA 2P9YA 1M2JA 4M6YA 2WNIA 3ISJA 3GRRA 3L0SA 1AZTA 1IUOA 1HNWB 5B3KA 3OYGA 2XIGA 3RG2A 3QPAA 3CB4A 4LFUA 1KK2A 4XVRA 5KWVA 3T7DA 1NBAA 3WR5A 1WZEA 5BPDA 3EA4A 3F49S 1RMQA 2FPRA 4IF4A 4AQYB 1Z05A 3HMQA 5T3YA 3VVBA 2NYUA 3EEIA 3WKCA 4DUGA 1XGKA 4UMFA 1Y3CE 3FTNA 2JGRA 3C1TA 3QXCA 1E1LA 4ND6A 1XN7A 5B58T 4B74A 2GXBA 4FZ5A 2B9SA 3U3JA 5AUPB 1VLLA 1Z4KA 4KFCA 3KLMX 3X2EA 1Z7EA 3COVA 3ZJTA 3AR6A 2DUWA 2XB6A 1YS2X 1TA4A 2VEOA 1CD5A 2VJOA 4F0JA 4EHAA 2CFOA 3MW8A 5KAMA 2DAOA 4TKVA 4C7JA 2JFVA 4TTQA 4B33A 1DKMA 5AOCA 4MR8B 1AKUA 4EGSA 4H1TA 3RTBA 4YJ3A 3DXYA 4F60A 3EZYA 2F90A 3PDJA 4CH7A 2V9PA 4Y7DA 3KL4A 2ON6A 2AXQA 4JP5A 3LUFA 2E1MB 1DWPA 1M75A 2B6NA 3OUTA 4RE5A 1KAEA 1K6JA 4MB0A 3ENZA 2JGJA 1OBVA 1XX6A 1FFBA 2O8FB 4HNRA 4YCCA 3IUOA 1SU8A 4Z1OA 1OIXA 4JNKA 3MB8A 5AI8A 3N3BC 3WQRA 3FNGA 1E3WB 2GMWA 1A4XA 5ALPA 3ZXSA 4FZVA 1FNSA 2RNGA 4X66B 2EEZA 2BY2A 3KOZA 4M9UA 5JANA 1LLUA 2NVWA 3URMA 1Z3CA 2B6HA 2GPAA 3A7EA 3RAJA 5E9WA 3VC1A 1Q3HA 5JMPA 5KAIC 3QE2A 3U21A 3L79A 1VE5A 2FW8A 1HURA 2VP3A 3L7CA 4YDQA 5ALHA 1AOYA 1M8PA 2CJJA 4OAZA 2OO5A 5BSHA 3PC3A 4PN3A 1VPVA 2QMEA 4R8MA 4OHVA 1HOTA 5GOZA 2WSIA 2XLCA 3PNLA 4DV3B 2K7LA 2WJVA 1AGYA 4QBGB 2ZAMA 1PV4A 1NNSA 2XC7A 1WP4A 2HRCA 4U0YA 3C2HA 2VDLB 1DFGA 1G16A 4P3NA 3G0DA 5G3YA 3TEMA 1PJRA 1M2KA 2YNMD 5F98A 1SCKA 2DM6A 1JLMA 2PS1A 3GBSA 1JEQA 4QQKA 5E1MA 1U7UA 3M9XA 2FOKA 2PGJA 3OR2C 5BOXA 1FIAA 3OFJA 4C3OB 2GM4A 4RPCA 4Z9XA 3GDHA 3GWZA 3GUUA 3DM5A 4JBLA 2PX2A 3RK1A 1CWUA 3QMMA 3GLGE 4A3MJ 1JQBA 3PZRA 5ALLA 1D1BA 1SIOA 1UWCA 3U4CA 4FR0A 4LYHA 3KT8A 5CHYA 2MYNA 2AJDA 4HLQB 3CS3A 3H5NA 2G9WA 3O8CA 1VTNC 3CR3C 4FBGA 5B7PA 1ERDA 3STUA 2OV6A 2RK6A 3H8VA 4E5YA 3O84A 3I3SR 3QVOA 3RIMA 4QKQA 3DPIA 3UMYA 4Q9DA 4JI6B 4ZZDA 5DHUA 2LKPA 2WIBA 5ECWA 4Q82A 2QMYA 1BXRB 3MJSA 4MW4A 4WKGA 1O97D 1RAEA 3BR6A 1E2IA 3O8OB 3LH5A 5DNCA 3L2UA 3THYB 2W6QA 3OS2A 4FYPA 4MVJF 4Z0NA 4UOEA 5GV8A 3KQHA 3IH2A 1ODLA 4LIUA 4ZDJA 2P75A 3FOAA 5T8KA 2WFLB 3MWGA 3AUFA 4ZJUA 3PWTA 1AK9A 5CFNA 1B6TA 4WZAE 5ES4B 5DDGA 1NXOA 4LDQA 5EUMA 2J5XA 5LFAA 5YASA 1NF3A 4GUDA 4BFSA 2QEQA 3Q7PA 3Q2IA 1JQJC 3VNSA 2MDTA 4XASA 3AJEA 3REGA 1I14A 1IV8A 2OE2A 4LXUA 3BTJA 2P2NA 3ZWWA 1ZMTA 1Z0KA 3DTVD 2I2XB 1CIPA 4Y6QA 3KEYA 1JKOC 3G3ZA 2PKYX 3ZE2B 1KOJA 2H06A 2XAUA 3F47A 2EKLA 4RK1A 4R2JA 5ALFA 5AUOB 1NVDA 2FE4A 4HHEA 2OCCH 2QTAA 4IRIA 3NBZC 4XM0A 4EGZA 2DTXA 2ZUUA 3HB0A 1VGQA 1DUVG 2XBLA 2LE0A 2Z5GA 1OCRH 5JJCA 1ZKGA 3G8DA 5EF6A 4E46A 2W2OA 1PUIA 1QRAA 5FLMJ 1FWZA 2LUOA 3HIFA 2HH9A 3EG9A 2VL8A 2E1NA 2A9VA 1KBOA 4JJ6A 1ULBA 3R3VA 4UMVA 4CXFA 2R1UA 4R1OA 4UBNA 3Q98A 5C7YA 4EKEA 4DCGA 3ZGYA 1P6QA 3TZLA 3E5XA 5G1PA 2EV5A 1HH4A 3O4GA 2Q3MA 4QNNA 4TL6A 3FTFA 1ZG1A 1X9IA 1JAHA 5DWQA 1XC7A 3AYZB 1P7CA 5FI1B 4QREA 4CL0A 4YT4A 4EFDA 2RG1A 1RBMA 2R7VA 1M0EA 1T1IA 5L3SA 4E03A 4F6CA 1VMEA 3BH6A 4YJHA 2G9ZA 5CKTA 2BY1A 2IA2A 4J16C 3ZRGA 1W7AA 4MRPA 3DLHA 3UA3A 4MS1A 1BD4A 1I7SB 4DDVA 4OM7A 1OBCA 1SPBS 3K9LA 5K7ZA 3SR0A 4ZREA 4TM8A 3KZIC 4EGQA 4HYTA 3I52A 5U9CA 3QVSA 1GLNA 3WRXC 4DEXA 3O9ZA 4M0MA 1XRMA 5C2JB 2VDWB 2BGJA 3K70D 3ZLBA 3OA0A 2JLUA 4WL0A 2ZT6A 3T4EA 2WINI 2FN8A 3F96A 3T8YA 4Z3OA 3HXPA 1OKRA 3DBIA 4BH9A 3GMDA 4QXOA 2HQ5A 3AG1H 4UM5A 1KVUA 5K8IA 4E22A 4BCCA 5A9SA 2X7JA 2ST1A 1SRRA 4X7MA 2WB1N 3VWBA 2WM8A 1Y89A 5KOJA 4RQBA 5IVHA 1GNSA 1ZRCA 2WLSA 1E7WA 1YZKA 1JHRA 2XXJA 3GUYA 3EARA 3DM9B 4Z7QB 5JC1A 4ZVOA 2I03A 3KYBA 2G7MC 1P75A 4MQ5A 4ESJA 2G9RA