4KMFA

Crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
SAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-inducible and double-stranded-dependent eIF-2kina
publication title Distinct Z-DNA binding mode of a PKR-like protein kinase containing a Z-DNA binding domain (PKZ).
pubmed doi rcsb
source organism Carassius auratus
molecule tags Transferase/dna
total genus 21
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kmfA00
5FLXZ 2OQRA 1OPCA 1AWCA 2CWEA 5H20A 1U5TA 3BOQA 3R6SA 2NNNA 1LJ9A 1OYWA 3HSRA 1S29A 2WWYA 4ESJA 2DPDA 1D3YA 2VC1A 2XASA 1B4AA 2L54A 1KQ0A 1WRJA 2IT0A 3BWGA 1W7PA 2HYGD 2UXNA 4Y15A 5LEJA 2A3SA 3E6BA 1MGTA 2G9WA 1QZYA 1LDKB 3WTYC 2GQQA 4YFNF 1XMAA 1D8KA 4HOBA 4BAYA 3B02A 3RKWA 3G3ZA 1T38A 3KLOA 1JHFA 3AAFA 5KK1A 3JAMK 2ISZA 1USSA 3MWMA 4XLNF 3E6MA 4MQ9F 1H0MA 1WQ2A 4Q48A 5J6XA 3FM5A 4CXFA 2OD5A 1MZBA 2J5OA 3HYIA 3F23A 5BMZA 2KIMA 1H9GA 2MH9A 3F22A 2XGXA 3T0YA 5FB2A 3I59A 4ETSA 2YX7A 5TJJA 2W57A 1SFXA 4XSXF 3WE3A 3CTAA 2UWMA 1T98A 4LLNA 3FXRA 4KICA 1IN4A 3BZ6A 3W6KB 1I1SA 2IA0A 4U0WA 1WKMA 2D45A 1IRFA 4MNUA 4BHCA 3ZMSA 1FSEA 4LMYA 2GA2A 2BEOA 1FT9A 3F8NA 3CDHA 3MAJA 2QQAA 5CVRA 1IN5A 1FLIA 3M9AA 3K69A 2P5LC 2K4BA 1UHWA 4LG0B 1KA8A 1SFEA 4EGZA 2RNJA 1YW8A 4WK8F 5ILVA 3EUHA 4GYIA 4BH9A 4EMSA 2ETHA 3FHZA 2VE8A 2RGVA 1V3FA 4I01A 1LNWA 2HS5A 3WGHA 3J80K 1R1VA 2WC2A 3H3ZA 4IVNA 4UVAA 1QGPA 2LDUA 1HKQA 3CO7C 2FBKA 2FEZA 2RV8A 1YFHA 3BP8A 1ZG1A 4ENNA 1XMKA 2HZTA 2QQ9A 1LB2A 1SD5A 2ZMEB 4NQWA 2E7XA 1DUXC 4A0ZA 1RUOA 1YLFA 3D5LA 1IXSB 1OKRA 3WODF 3F3XA 4RGSA 1HW1A 2L3DA 3FM3A 3MFKA 2M30A 2PMHA 5HLGA 1HSJA 3R61A 4B8XA 4HLYA 2BE5F 1BJAA 1KU7A 4GCVA 1IW7F 5F6FA 1B9NA 3IWZA 4CO8A 2ELHA 1IZ1A 1G4DA 3RKXA 2H27A 2ZXJA 1QO0D 2EV0A 2VN2A 4I0BA 2WTEA 1YQAA 2YU3A 4YFXF 3ML6A 3DKWA 4HDUA 3T1BA 5L3BA 1J59A 1QNTA 4M9XA 3R0JA 4ZH4F 2R7DA 1O3SA 1FX7A 4EVIA 1G6NA 4GGGA 3V4GA 3U9GA 3F8BA 5CJ9A 1ZRDA 3GVAA 3HHGA 1JGSA 2O6GE 3DPLC 3PQKA 3QRFF 1ZREA 4Y13A 4PGHA 2BYVE 2VT3A 1BM9A 2RQPA 1HSTA 2EFQA 2QLZA 2IJLA 1ZH5A 3WTSC 4EJWA 4Z2YA 3WU1B 2KKOA 3I53A 4HV6A 4OIOF 2G7UA 2XAFA 4G7OF 2QQBA 4EM2A 1TNSA 2JPCA 4BQAA 4HQEA 5K1YA 4O6JA 1TQPA 4EM1A 5ILSA 3QP6A 3FWEA 3ZMVA 2V1UA 2VONA 2VBWA 3J80Z 3WTXC 4FX4A 2QUFA 3TKYA 2XVCA 4G7ZF 1FNNA 1FY7A 1RUNA 1IAWA 2A69F 3ABTA 1RNLA 4U7BA 3EYYA 2M5WA 4OIPF 2DAOA 2R3SA 3CUQB 2FNAA 1O3RA 1X3UA 3JSOA 4I0AA 5ICCA 4KA4A 3R60A 4L9JA 4UUVA 2A5YB 2E7WA 2A07F 3RIRA 4RAZA 3FMQA 2P5KA 1KU2A 4KT5C 1Q1HA 3RKYA 4A5MA 1O3QA 2VBZA 2EA2A 2ISYA 1TW2A 5LHHA 1QPMA 3I5UA 5JHUA 3LA7A 1GXQA 3KP3A 4GXOA 4H0EA 4ENJA 3ISPA 1FP1D 4ENMA 3GX4X 3FMSA 1W7PB 3CUOA 4ESFA 4G6DA 3RPUA 2H6CA 3F21A 3GYHX 1OYIA 3DXJF 3WG9A 5D5WB 2RDPA 3RYRA 2KJBA 5LHIA 3E5XA 2UZKA 1I5ZA 3P9CA 2YR2A 1U3EM 1B59A 3V7RA 2Y75A 4EV0A 2DI3A 3RJPA 2MA3A 2V79A 4G94A 6PAXA 3WGIA 2ESHA 3K1NA 1I6XA 3WTUC 3LFKA 1XSXA 1D5VA 5D8LB 2AXLA 4HV5A 1CF7B 1O7FA 2Z99A 2P6TA 1SMYF 2FNPA 2ACJA 2L01A 3LSTA 1ZG5A 5FO5A 3F8CA 4XSZF 3ELKA 1T6SA 5D4SA 3HRMA 2MLGA 3E6CC 1W5TA 4M73A 3GZ5A 2ZBKA 2JSCA 3I0TA 1F4KA 1ZRFA 3GW2A 5BOXA 1BC7C 4L9TA 4IHSA 3KZZA 2H09A 1B6AA 4MEXF 1I27A 2A61A 3P7NA 4ZYGA 1R00A 4EM0B 5TRDA 4WX9A 5H6RA 4U7DA 4KUMA 1WWXA 4IRHA 3C7JA 1TNTA 2B0LA 4MEYF 4ASNA 2HYFA 1W4MA 4EJTA 3O3KA 1G3SA 3K2ZA 1PP8F 2X4HA 4WF2A 1ZAOA 5ICGA 3QPHA 5ICEA 3EETA 2CYYA 1Z91A 2W84A 1IXRC 1EH6A 2HTSA 4LK0F 1YS7A 4DNCA 3HSEA 4CYDA 4HQMA 4N9IA 4IJAA 3TGNA 2RKHA 2H94A 2MLKA 1JXSA 4CICA 2K27A 2DK5A 2GAUA 4MHGA 4HF0A 3MQ0A 3NEUA 5D6EA 4A2UA 4HW0A 3BJ6A 1FYKA 3KP5A 3IL2A 2XAGA 4UVBA 1REPC 1P2FA 2O61A 3T8RA 1ON1A 4HYEA 3B73A 4OIRF 2VODA 3GFJA 3LAPA 2PBIA 2P6SA 2HKXA 3ZN0A 1ZARA 3H3UA 4KIBA 2JTVA 3JSPA 3KP6A 2VXZA 5LRRA 2EK5A 4XRFA 3DP7A 2IW5A 2RVCA 1G3WA 3L2CA 1KQ8A 3SXYA 5D5XB 3M8FA 2F2EA 4ENKA 1RZ4A 4NHJA 5ILUA 1FZPB 3O6BB 2HOEA 1U6GA 1ZGJA 4P9FA 1FBQA 2VOOA 2P5VA 3L09A 4S04A 4M74A 2XKPA 3RTRA 5BQTA 5KVRA 3GXOA 1XDSA 4TV7A 1YW7A 4QWQA 3R4KA 3KP4A 2OBPA 4Q4ZF 1CF7A 2MD5A 5L3CA 4JK1X 2LNBA 3FX3A 4KN4X 2RN7A 5BPIA 2DU9A 4BYYA 1KYZA 3MZHA 5JI6A 3RI4A 2L02A 1BIBA 2E1NA 4NB5A 4UHTA 2IVMA 3V8KA 4L0YB 3MZYA 4M71A 2NRAC 1E2XA 4PCQA 2CG4A 4ON0A 5DV5A 4KDPA 4WXDA 1EV7A 1BI1A 1R7JA 1S7OA 3I54A 1R1UA 2STWA 3DFGA 4HX8A 4RAYA 3JTHA 2EB7A 3HSFA 5D5VB 1XCVA 5CVIA 3E5UA 3TO9A 4MTEA 3BDDA 1QZZA 5K5RA 1BOAA 2KIFA 1H9TA 2EFOA 1JE8A 4LB5A 3KZYA 1E17A 1DPRA 3SQNA 4K2EA 5DD8A 1HBXG 5L3DA 5HDNA 4CHUA 2LF8A 3GZ6A 3QOPA 1XGNA 5HDKA 4IHTA 4DQ2A 1R1TA 2IA1A 1RIOH 2LSOA 4HDVA 1KYWA 3N97A 2O03A 4A0YA 4A6DA 3FMRA 2KIUA 3HTUA 5E1WA 4A0XA 2UXXA 5IT9Z 1RI7A 2ADUA 5L3EA 2FSWA 3NQOA 3IHUA 4OIQF 3FXQA 3TO7A 1XCBA 1J0RA 1YO5C 3L00A 3HOSA 4OMYA 1MD0A 4P55A 2EFNA 2V6CA 5FD6A 5DEQA 3IWFA 1P4WA 2OQGA 2CO5A 3DEUA 4P5OA 3FZVA 2O0YA 3V8LA 3K0LA 3L7WA 1OR7A 4UV9A 1LQ1A 3I64A 1ON2A 2VBYA 3LA2A 3VB2A 1PDNC 2QYOA 4UXNA 3T8TA 3ZMDA 4I02A 1MDMA 2Z5UA 3HOTA 1J7KA 3DV8A 3WE2A 2XAHA 4LGWA 1W5SA 3OV8A 3TOBA 4LFUA 3P9KA 4R1HA 5JR3A 1XGOA 2EV5A 4PZJA 3ZMZA 1K7AA 5FD5A 3SZPA 4AWXB 1K78B 4IRIA 1DDNA 1STZA 3RDIA 1MKMA 1QBJA 1T39A 5J8FA 1UCRA 2QBYB 2ZNZA 3FF5A 2W25A 2M45A 3S2WA 3GLXA 2P4WA 4CGZA 3I71A 2Q8KA 1P4AA 3ROUA 5F64A 2XROA 1KU3A 4I7HA 1XGSA 4L9VA 4BHPA 3L9FA 2FQ3A 4L9NA 5E8GA 2FXAA 1FP2A 2IPQX 1OYYA 4IRGA 1GXPA 5EEGA 3HTSB 2F5CA 3RYPA 4P96A 2V1XA 1FYMA 4EGYA 1Z7UA 3QPTA 1YIOA 3SZTA 5CYVA 3J81Z 4EJVA 2P8TA 1Z6RA 5JVTA 1FBUA 3KP7A 2VC0A 4ZYDA 1GHCA 5DCFA 3J7AO 5DYMA 1IXCA 5E17F 4LJZF 4Q47A 3LQQA 3HRTA 5E8IA 2LKPA 2YSRA 3DQVC 3N4MA 4PGGA 1U8RA 3CLOA 1Z1DA 3ECOA 1BN5A 2PN6A 1FOKA 1J2XA 2HR3A 4HF2A 4RB3C 4HA8A 3ABUA 5F1RA 2EJRA 3P9IA 3REOA 5LGUA 2F5DA 3TDZC 3VFZA 2FF4A 5ERIA 1XSDA 4KMFA 4HBLA 3TO6A 4L5IA 5D8KB 2FMYA 5DCMA 1HW2A 1F9NA 3MEXA 3ZN1A 1O7LA 3COAC 5DD4A 1S6LA 3VEPA 2EFPA 2XAJA 2HWVA 4LLGF 4PDKA 5E18F 3KEQA 4S05A 1ZRCA 4WWCA 2EV6A 3F72A 1TLHB 4M6YA 2OA4A 2GWRA 3QAHA 1CGPA 4N9HA 1TQMA 3HIFA 1FC3A 2FMLA 2RC4A 3G73A 3PFIA 4WXCA 4U88A 4MQVA 2GA1A 2M8EA 2PQ8A 3W6JB 5D4RA 1K78A 3V7SA 4KN7X 5D6FA 1R5GA 2QBYA 2M1BA 1UFMA 2Y0MA 2XV4S 5LGTA 1MJAA 1IUYA 1SFUA 3SHFA 1R5HA 2KJCA 1OMIA 1SD4A 4YFKF 1FBSA 1J9IA 4G8XA 2BBYA 1IF1A 5A2QZ 2D1HA 2GXGA 4RB2C 3C18A 1LDDA 2DPUA 1Z9CA 1BIAA 2HTJA 1HXDA 2XIGA 1TW3A 2DBBA 2CQKA 2DK8A 2XAQA 3RPQA 5LLQA 2A6EF 3F8MA 3K9TA 3ERED 3KLNA 3CUQC 1IRGA 1GVJA 2EFWA 3LAJA 5HS8A 2F5EA 3K1MA 1W7PD 4AIHA 5J8CA 2G7HA 4UVCA 2VBXA 1HKSA 3BPXA 4M9ZA 1UHMA 1PUEE 2QENA 1J5YA 3LA3A 5E1ZB 1L0OC 5K5QA 4R8HA 3NRVA 1P6RA 1U5TC 3C1DA 1QQIA 3HRUA 5FFZA 1I1GA 4LD5A 1LDJA 3E97A 3MCZA 3H92A 4MGRA 1NHAA 2YPRA 4LLLA 1MDMB 3WTVC 2IA2A 3EQLF 1R22A 5IT9K 5L3FA 4N0BA 4UV8A 5FFXA 3CO6C 4I98B 1S8NA 2CGPA 1HW5A 4M9SA 3V8JA 1BI3A 4EJOA 3K1PA 2ZNYA 2OU2A 2JZYA 2R7FA 4D0PA 4RB1A 3GWZA 4YIIA 2J5PA 3WTWC 1J75A 4Q5SF 4G6QA 5E20A 3HHHA 2CFXA 3C3WA 3KE2A 1JHHA 5CLSA 5FGMA 3TOAA 2HDCA 4UNOA 3JW4A 2OZ6A 3BJOA 4A12A 1ZN2A 2VE9A 2MC3A 3PQJA 2GXBA 2FE3A 4KNYA 1FPQA 4JBAA 2QVOA 4E70A 2E1CA 2FBHA 2W24A 2CW0F 2ZFWA 3Q9SA 5LGNA 1ODDA 2XKOA 3WU0A 4P9UA 2NNYA 1KGSA 1HQCA 4Y17A 4I09A 1P4XA 4KFCA 1AOYA 3M1EA 4IPAA 5L3GA 3DPTA 2H6BA 2K4JA 3GF2A 1B1BA 1T2KA 1MJBA 2MH2A 2NAZA 1LEAA 3CJNA 2FU4A 1C0WA 1K6OA 5HVQC 1FSHA 3BROA 2NS0A 1LVAA 1USTA 2Q2EA 3M7GA 3WTZA 2A68F 4KYWA 1O3TA 4O3MA 2L4MA 1ZHFA 2DFIA 5HS7A 5ED4A 4RGUA 3WGGA 1L3LA 2V9VA 3J81K 1G3TA 3I4PA 2PI0A 3M8EA 4WCGA 1R23A 3V7CA 2QWWA 5DCMB 3U2RA 3R0AA 2VT2A 3T5XA 2Z9OA 4OU0A 4JQFA 3JAMZ 5CVUA 1ULYA 4OMZA 4U0YA 4FHTA 4AIKA 4L0ZB 2D1VA 4BHBA 1DPUA 4ZYHA 3BJAA 3EYIA 1IN6A 3ULQB 2PFBA 4BXUA 1V4RA 1SMTA 1YG2A 5CVJA 1YTYA 4HF1A 4GYGA 3ZPLA 3GFLA 3GUDA 4XLPF 5D5UB 1F1ZA 3IKTA 4M72A 4KMUX 4G9YA 1ZYRF 4A5NA 2MBFA 1XD7A 1YYVA 5ICFA 2STTA 2LF7A 2HGCA 5CVVA 3E5QA 4B09A 2P7CB 2QZ8A 4LK1F 1EH7A 4ZYEA 4HX4A 3KP2A 2FRHA 1VTNC 2KRFA 1UB9A 3LQRA 3VODA 4ZZDA 2FA5A 2X0LA 1XGMA 4G7HF 2PLYA 5AIQA 3KEOA 3D0SA 3Q9VA 2V1DA 1HKTA 5HLHA 1TQIA 4ESBA 3F6OA 5JFRA 3ZQ7A 1Z6TA 1BI0A 2DQLA 4CDGA 2A6HF 2DLLA 3WTTC 4FX0A 2D2WA 1KQ9A 5DDGA 1O57A 2VOPA 2JT1A 2C6YA 2PJPA 2K86A 5HOOA 2XHKA 1R36A 1LEBA 3KCCA 1G3YA 2O8XA 4RGXA 1TTYA 2PG4A 1WI9A 2M87A 2OZUA 2DW4A 2XUBA 1FYLA 2Z3YA 2TDXA 2DT5A 1T0FA 2QM3A 4HAMA 2PMUA 2ZCWA 2ESNA 1K79A 4LG0A 2PEXA 2HQNA 1Y0UA 4RGRA 4HZFA 4WXHA 2HFHA 1ZLJA 4AVPA 1U5TB 4OOIA 1F5TA 1D8JA 2Y48A 2K7LA 3F6VA 5LHGA 5A2QK 3FXUA 5LBQA 2ZKZA 5HS9A 3DF8A 1IN8A 3E3VA 3QP5A 3TDUC 1S7AA 3F8FA 1MJ9A 4HLXA 2ZJ2A 1DP7P 4OINF 3GFIA 1SD7A 3ZMUA 4O5VA 2ZMEA 5BPDA 1ONVA 1A04A 2F5FA 1YW9A 4AIJA 4M6XA 4RB0A 4KIFA 1FWZA 1BBYA 2ZO4A 1TBXA 5EEHA 1IN7A 4L18B 1B9MA 3LWFA 1R58A 4GO1A 2FBIA 5FLXK 5LEKA 2HKOA 4AD9A 4MTDA 3U1DA 2JRTA 3IRRA 5AONA 3KETA 2EA4A 4QLCU 2GZWA 4EQQA 4I2OA 1S3JA 4XBFA 5DUKA 2FOKA 4F7ZA 3IRQA 4YIFA 4YG2F 5DUIA 1BC8C 5LRSA 3I59B 3I58A 4RS8A 3JTGA 4HX7A 3SFZA 1XN7A 3VOEA 3TQNA 2NYXA 3ECHA 3ZMTA 3IC7A 2IP2A 1YS6A 2Q0OA 4IXAA 4CZZA 2AS5F 3BPVA 2HQRA 4ZZLA 1ZLKA 1EH8A 2WV0A 1XSVA 5IT3A 2HEOA 1PP7U 2COMA 1U78A 2OAZA 1Z05A 1SD6A 2BV6A 2CSOA 3QU6A 1U2WA 1WSUA 3GO5A 3HRSA 4LB6B 2W85A 5H6QA 3OOPA 1BI2A 1ZGAA 3HUGA 3GEZA 4EJUA 2DO7A 3GFMA 2DTRA 5AIPA 4IF4A 4KIGA 2GIVA 2EWNA 5HLIA 2L4AA 2O3FA 4L5JA 1P92A 2P7VB 3EDPA 2DQRA 4BNCA 1SAXA 4U0VA 5BS6A 1XDUA 2JPBA 3E6DA 3IKVA 2K02A 5HDGA 2IRFG 4A6EA 3O2PE 2Z33A 4R79A 3CUQA 1XB4A 3BY6A 2XRNA 2YX4A 5E1XA 1KU9A 2BGCA 3Q5FA 3ZP5A 4FT8A 5K5OA 1ZG3A 3QU3A 3KFWX
chains in the Genus database with same CATH superfamily
5FLXZ 3K7AJ 3K4CA 4A93J 1LKXA 2OQRA 1OPCA 1W36D 1PYVA 3OYKA 1XX5A 1AWCA 2CWEA 5H20A 1U5TA 3BOQA 3GCMA 3R6SA 2NNNA 1LJ9A 4UUSB 1OYWA 3HSRA 3HOXJ 1S29A 2WWYA 5C4XJ 3PNYA 4ESJA 3LSGA 3OIOA 5BNGA 3PSFA 3M4OJ 3G1LA 4A3LJ 2DPDA 1D3YA 2VC1A 2XASA 1B4AA 1JGGA 2L54A 2E2JJ 4RM2A 1VQ5I 3OMYA 3JCUC 1KQ0A 1RC9A 3BG6A 1WRJA 5JLWA 2IT0A 3BWGA 1W7PA 2HYGD 2BHYA 2UXNA 2EPFA 4Y15A 1HLVA 3HG9A 5B5EC 2F5VA 3Q0VA 5LEJA 2A3SA 3E6BA 1MGTA 2G9WA 1QZYA 1LDKB 3WTYC 3CCRI 1Y8RB 3PIPF 2E5ZA 2GQQA 1VQ7I 4YFNF 1XMAA 1D8KA 2XPUA 2L7ZA 2NS8A 4HOBA 3MD2A 4BAYA 3B02A 3RKWA 2WB1A 3G3ZA 1T38A 5FLVA 3KLOA 1JHFA 3H0GJ 2VJIA 5KK1A 3AAFA 5DTDA 3JAMK 2ISZA 1USSA 2JRMA 2UUZA 2R7SA 3MWMA 3FIWA 2QEXI 2CW7A 4XLNF 3E6MA 4MQ9F 4BE1A 1QRYA 1IJWC 5EYRA 1V54H 2AQFA 1H0MA 2R7XA 1WQ2A 1HF0A 4Q48A 5J6XA 3FM5A 4CXFA 2HVRA 3FXMA 2GBYA 2OD5A 4QPOA 3RZDJ 4BXFA 2DFHA 1MZBA 2J5OA 3HYIA 3F23A 3QYBA 5BMZA 4XLAA 3JRBA 2KIMA 1H9GA 3K4NA 1YIJI 2MH9A 3F22A 4AIDA 2XGXA 3T0YA 3M1CA 3ESWB 5FB2A 3I59A 2LC2A 4ETSA 4BU2A 4ANJA 2YX7A 5TJJA 1EF4A 4MO7A 2W57A 2E35A 3CJQB 3HC7A 1SFXA 4XSXF 3WE3A 2E19A 3CTAA 2Y9ZA 4X1EA 2NVXJ 4HNVA 1PUFB 2UWMA 1T98A 4LLNA 2UV1A 3OYJA 1Z77A 3FXRA 4KICA 5FRMA 1IN4A 5GAGJ 3BZ6A 2LD5A 4AYBN 1FEXA 3W6KB 3OYAA 1I1SA 2IA0A 4U0WA 2VB6A 1WKMA 1R49A 5GP9A 1RKTA 3CCEI 1Y8QB 2D45A 1UJ8A 3GZNB 1IRFA 4MNUA 5FKOA 2DJNA 4BHCA 3ZMSA 3SDBA 1FSEA 4LMYA 1S9HA 2DT7B 2GA2A 3CQZJ 2BEOA 1X3ZB 1Z7LA 1FT9A 3F8NA 9ANTA 3CDHA 3W3CA 3MAJA 4AUXA 2QQAA 3FISA 1IN5A 5CVRA 1FLIA 3LSJA 4XNFA 3TMOA 1WJCA 3M9AA 3K69A 2P5LC 2K4BA 1UHWA 4LG0B 1OFCX 3TW7A 2F6CA 1WH5A 1KA8A 1SFEA 4EGZA 2RNJA 1YW8A 4WK8F 5ILVA 3EUHA 4L5EA 4GYIA 4BH9A 4EMSA 2ETHA 3FHZA 2VE8A 2IS6A 1X1AA 1KONA 2RGVA 4PSWA 1W1WE 3G1MA 1V3FA 3K2AA 5E3LA 3CC4I 4I01A 2XPVA 1LNWA 2HS5A 3WGHA 3QYFA 3J80K 1WJEA 1R1VA 4XORA 2WC2A 4FASD 3S1RJ 3H3ZA 1WJAA 4IVNA 4UVAA 1QGPA 4FTHA 2LDUA 1HKQA 3K4MA 1LUJB 4XLCA 3CO7C 2FBKA 2FEZA 2RV8A 3J7YJ 1YFHA 2DYSH 3BP8A 5B1BH 1ETQA 1ZG1A 4ENNA 1YE9A 1XMKA 2HZTA 2QQ9A 5B66C 1LB2A 1SD5A 1VZ0A 1RKWA 4JX5A 2ZMEB 3K70D 4NQWA 2E7XA 2LOOA 1DUXC 4A0ZA 4UY8I 3S1MJ 3VYRB 1RUOA 2R7UA 1YLFA 3D5LA 1OCPA 1IXSB 1OKRA 4BEHB 2ZJQF 3LOCA 3F3XA 3WODF 3C2BA 4RGSA 3U1KA 1HW1A 2L3DA 1IV6A 3FM3A 3MFKA 3CMEI 2M30A 2PMHA 5HLGA 1HSJA 3R61A 4B8XA 3BCBA 2BE5F 4HLYA 2BW3B 2MSYA 1BJAA 2V26A 4D5CA 1KU7A 4CCKA 3E0JB 4BS9A 1X1DA 3UNGC 4DYRA 4GCVA 3OWTA 1IW7F 4AYBA 3S8PA 2DA2A 3KPHA 5F6FA 1WPKA 2DFEA 1B9NA 1I39A 1W5CC 2WAFA 3IWZA 4CO8A 2ELHA 1IZ1A 1G4DA 3GBGA 1OR7C 2O8KA 3OOUA 1WJFA 3FKJA 1G8XA 3RKXA 2H27A 4P1WA 2ZXJA 2VL8A 1QO0D 5GTIC 2EV0A 3Q0WA 4M3BA 3PM1A 3SEZA 2VN2A 4I0BA 2IAIA 1BL0A 2WTEA 1YQAA 2YU3A 4YFXF 1EJ9A 3M3YJ 5HODA 1ETYA 1X3WB 3ML6A 3L2QA 3DKWA 4DBRA 4BY1J 4HDUA 3T1BA 5L3BA 1J59A 1QNTA 4M9XA 2LBFB 2NXNB 3R0JA 2R7DA 4ZH4F 1O3SA 4UUTA 1FX7A 4EVIA 1G6NA 2VKEA 3BC8A 2BOLA 4GGGA 3PUBA 1FJLA 3V4GA 3U9GA 3F8BA 5CJ9A 1ZRDA 4XRSA 4N4NB 5IP9J 3GVAA 3AFHA 3HHGA 2R7QA 1JGSA 2Y69H 3DPLC 2O6GE 4BGDA 3CCSI 3PQKA 3QRFF 3I55I 3WHCA 1ZREA 2R5YB 4JP0A 4Y13A 4PGHA 2EIKH 2BYVE 1TP4A 2VT3A 1BM9A 2L5QA 2RQPA 1OISA 1HSTA 2EFQA 2KPMA 2QLZA 2IJLA 2R7OA 4PJ0C 1ZH5A 3GTOJ 3DU5A 3WTSC 1Y56A 4EJWA 1RETA 3AL0B 2X51A 4Z2YA 3WU1B 2KKOA 3I53A 3JR9A 2D5VA 4IOCF 4HV6A 2EBIA 4OIOF 1QVUA 2G7UA 4FE4A 4YRVA 1Y1WJ 2XAFA 4G7OF 2QQBA 4XR6A 4EM2A 1Q1VA 4E7LA 4BXXJ 1TNSA 2JVGA 2JPCA 4HPQA 1QA6A 4BQAA 4HQEA 4O6JA 4DZPA 1TQPA 3K4KA 5K1YA 4EM1A 5ILSA 3QP6A 3K6GA 1BR4A 3FWEA 3ZMVA 2V1UA 4ZDLA 2VONA 2VBWA 3J80Z 4QTRA 1JKPC 3LSHA 3WTXC 4FX4A 4NNJA 2QUFA 1PUFA 3TKYA 4CYCA 2XVCA 2OPTA 4PJJA 4G7ZF 1FNNA 5FLMJ 1FY7A 2IBDA 4DIQA 2K9QA 1H89C 1RUNA 2DCEA 4XKBA 3O8HA 1IAWA 4BJ5C 1LFBA 2A69F 3ABTA 2Y31A 3CMAI 1RNLA 3ABKH 4U7BA 1Z0XA 3EYYA 5EGOB 1YJNI 2M5WA 4OIPF 2DAOA 1DQUA 1BW6A 2R3SA 2LMDA 3CUQB 2FNAA 4H4KC 2VQLA 2QSGX 1O3RA 1X3UA 2XC7A 3JSOA 4XKVA 3OYHA 3OYDA 1MMSA 4BDZA 4I0AA 2E1OA 1VFCA 2X1DA 4DGWB 4FQGA 5ICCA 4KA4A 2XB5A 3H5RA 3R60A 4L9JA 4C3HJ 4PFPA 3OYFA 4UUVA 2A5YB 2E7WA 4NBQA 1QZEA 2A07F 2JVHA 4M3FA 2WY8Q 3RIRA 3ZQFA 4RAZA 3OS1A 3RKQA 2OTJI 4F55A 3FMQA 3CCJI 1NK2P 2P5KA 3IUOA 1KU2A 4KT5C 1Q1HA 3A01A 3SZGA 3RKYA 4A5MA 1O3QA 2GXAA 1X1CA 2VBZA 2EA2A 1MMAA 5M5XJ 1IDZA 5F1JA 2ISYA 1TW2A 5LHHA 1QPMA 4RA2A 2ME6A 3A4CA 3I5UA 5JHUA 3LA7A 1GXQA 3KP3A 3CF5F 4RLQA 4GXOA 4H0EA 4ENJA 2DMUA 3B6CA 3ISPA 2BVLA 4BBSJ 1FP1D 4ENMA 3GX4X 3FMSA 4B4CA 1W7PB 3CUOA 4ESFA 3VWBA 4G6DA 1I6HJ 3RPUA 2H6CA 4BKXA 3F21A 3GYHX 4C2MJ 3DCFA 4MFDA 1OYIA 3DXJF 4G6TB 3WG9A 5D5WB 2RDPA 1T08B 2OF7A 2P0WA 3RYRA 4D7MA 2HVSA 4NC7A 2KJBA 5LHIA 3E5XA 5GADJ 2UZKA 3G71I 1GT0C 1E3PA 2CRGA 1I5ZA 3P9CA 2JA5J 2YR2A 4BEHA 1U3EM 2X85A 2PJRB 2KLOA 1B59A 3V7RA 2Y75A 4C9YA 2FD5A 3JRFA 4EV0A 2CQ7A 2DI3A 2IS4A 2KZGA 3RJPA 5J4YA 4XRMA 2MA3A 2V79A 4G94A 2WAQA 4FCYA 6PAXA 3WGIA 2ESHA 2LH9A 3NAUA 3I4MJ 3K1NA 1I6XA 4YEJA 2Z16A 3PL8A 3WTUC 3LFKA 4XOTA 5CQEA 4HRIA 1XSXA 4BQNA 4F3QA 1D5VA 5D8LB 3FXLA 2AXLA 3MN2A 3BTLA 4HV5A 2V9PA 1XMXA 1CF7B 1O7FA 2Z99A 2P6TA 3L2RA 1Z3XA 1X58A 1WJ5A 1SMYF 3OYNA 2FNPA 2ACJA 2L01A 3LSTA 1ZG5A 3IAS2 5FO5A 2IGMA 2R7TA 3F8CA 2AHQA 3ELKA 4XSZF 3H9JA 1T6SA 2L2OA 1ERDA 5D4SA 2HVQA 2R0QC 4OAYA 1W0TA 2DA7A 4QIWN 3CJTB 5DS9A 2LK2A 3HRMA 2MLGA 2LBFA 3E6CC 2XF5A 1W5TA 2LY2A 1EA3A 2O5RA 4M73A 3GZ5A 2ZBKA 3W2AA 2JSCA 3I0TA 4JX6A 3FXJA 1VQ9I 1F4KA 1ZRFA 3GW2A 1AU7A 2W4SA 3LSPA 5BOXA 4AU7A 1BC7C 2K9SA 4CSWA 2COBA 3I3LA 4L9TA 4IHSA 2R5YA 3FDYA 3OYCA 3KZZA 2H09A 1B6AA 4MEXF 3ASOH 1I27A 2A61A 3K10A 3P7NA 2L7FP 1OCCH 1R00A 2LLKA 3D5SC 3E1SA 4EM0B 4ZYGA 4WX9A 5TRDA 2KQRA 5H6RA 5J1UA 4U7DA 1ZQ3P 4KUMA 1LFPA 1WWXA 4IRHA 5J4VA 1VF9A 3C7JA 2DJIA 2DOEA 1TNTA 1U0JA 2B0LA 1FOXA 4MEYF 4KT6A 4ASNA 2HYFA 1W4MA 4BQOA 4Y4RA 2M2EA 3BR2A 3IH4A 4EJTA 3O3KA 1G3SA 2FQ4A 4IQ4A 3K2ZA 2K40A 1PP8F 2QCOA 2X4HA 4WF2A 1ZAOA 2X9DA 3QQAA 5ICGA 1WHUA 2ID3A 3QPHA 3UR3C 5ICEA 2YUSA 2DOFA 5F0FA 3S16J 3EETA 1TT5B 2CYYA 1Z91A 2TRTA 3RCOA 3HDDA 2W84A 3RQ4A 3JRIA 1IXRC 2DOAA 1EH6A 2HTSA 1BR1A 1YS7A 4LK0F 2M34A 4DNCA 2KRCA 3EUKL 3HBLA 1KZHA 3HSEA 4CYDA 4HQMA 4N9IA 2ECCA 1K83J 5E3NA 4IJAA 5IYCJ 3TGNA 5K7ZA 4E7HA 2RKHA 2H94A 3S17J 3FK7A 2MLKA 3ZQIA 3I56I 2QSHX 1WJBA 1JXSA 4DZJA 4CICA 5EJCA 2K27A 2DK5A 3KYCB 2GAUA 4MHGA 4HF0A 3MQ0A 3NEUA 5D6EA 5JLXA 1MNMC 2DYRH 4A2UA 4HW0A 2L7KA 2JSPA 5F0HA 3BJ6A 1FYKA 3KP5A 3IL2A 3ONQA 2XAGA 1FTZA 4PJMA 2M7BA 4UVBA 1P2FA 1REPC 2QSFX 3GTMJ 2K3PA 2ZFUA 3DPUA 2O61A 1EKEA 3GLLA 3T8RA 2K3FA 1ON1A 2M4KA 4HYEA 3B73A 4OIRF 4GDFA 2VODA 3GTLJ 3HOUJ 3C2GA 3GFJA 3LAPA 1YRNB 4M3EA 4A3BJ 4E7KA 2PBIA 2P6SA 3OYIA 4RMNA 2HOSA 2HQ5A 3FHNA 3OL3A 3H1CA 2HKXA 5J1YA 1VNDA 3Q3SA 2WA0A 4I99C 3ZN0A 3W2VA 1ZARA 1MMGA 2RQQA 3H3UA 4KIBA 2JTVA 3JSPA 4CZCA 3KP6A 2VXZA 5FRNA 3CC7I 3CCLI 5LRRA 2EK5A 4XRFA 3ABMH 3DP7A 5EG0A 1YX5A 1DP3A 3HGGA 2IW5A 1OCRH 2MW8A 3OYLA 2RVCA 1FMWA 3DTIA 1G3WA 1Z67A 2XF6A 2HDDA 3L2CA 1YJWI 1KQ8A 3SXYA 1MNDA 5D5XB 3MKLA 4MFEA 2R92J 3CLQA 3BQZA 1FIPA 2A6TA 2PX9A 3M8FA 2F2EA 4ENKA 2IS1A 1UELB 4J19A 1RZ4A 1UG0A 2DT6A 5E3MA 1W36C 1S5LC 2PJRA 1D1BA 4NHJA 3OS2A 4YELA 2H1LA 4BDYA 5ILUA 3IH2A 1FZPB 1P7JA 2QQ8A 3O6BB 2HOEA 5KAFC 1V5FA 3HOYJ 1U6GA 2JA6J 2X6OA 1ZGJA 4P9FA 1FBQA 1MSFC 1TT0A 2VOOA 3BTJA 3PIOF 2P5VA 3L09A 2WV1A 4S04A 4M74A 2ZXHA 2XKPA 3RTRA 1F43A 2CH0A 5BQTA 2XDVA 5KVRA 1WH7A 3GXOA 1XDSA 4TV7A 5DM7F 2CV1A 1YW7A 4QWQA 3R4KA 3KP4A 2OBPA 5H2FC 4Q4ZF 1CF7A 2MD5A 3VSKA 4HNTA 3KX2A 2R7ZJ 5L3CA 4JK1X 2LNBA 3FX3A 5GAEJ 4KN4X 5FKNA 3JRHA 2RN7A 5BPIA 2V1NA 2HDWA 5C3EJ 2DU9A 4BYYA 3CCQI 2E1MC 1KYZA 1Y1VJ 3MZHA 3CESA 5JI6A 3CMYA 5FJ8J 2Y30A 2R7VA 2VQCA 3PUFA 2ZC2A 3HJEA 3RI4A 1DU0A 3ZR8X 2L02A 1BIBA 2E1NA 4NB5A 5DM6F 4UHTA 2IVMA 3V8KA 4A69C 4CYCB 2QKLB 4L0YB 2XGDA 3MZYA 4M71A 4FETA 1R71A 2NRAC 1YITI 1WGXA 1E2XA 2L9SA 4PCQA 2CG4A 4ON0A 5DV5A 4KDPA 4WXDA 1JTXA 1EV7A 2E34A 1UMQA 2DODA 1BI1A 1FOWA 2N8GA 3BT9A 1R7JA 1S7OA 3I54A 1XPXA 1A6QA 2L0KA 1R1UA 2KRHA 2NOJB 2OUMA 3DFGA 2M8GX 2STWA 4Y7NJ 4HX8A 1ITYA 4RAYA 3JTHA 2EB7A 1TL8A 3HSFA 1XS9A 5D5VB 1XCVA 5CVIA 3E5UA 3HKZA 4MTEA 3TO9A 3BDDA 2LKXA 3H35A 1QZZA 2DA1A 5K5RA 1BOAA 1P9QC 2KIFA 1H9TA 2VUMJ 1AA7A 2EFOA 1JE8A 5IY5H 2HOTA 4LB5A 3KZYA 1E17A 3BQYA 2ZXIA 1DPRA 5CQGA 4K2EA 3SQNA 1AKHA 5DD8A 1HBXG 1BA5A 5L3DA 5HDNA 2Y2ZA 3A1YA 1Z3YA 3A01B 4CHUA 2LF8A 3GZ6A 3QOPA 4HSRA 3CJRB 5JHFA 1XGNA 2V6EA 2E5NA 2I10A 2FJ1A 5HDKA 4IHTA 3BR1A 4DQ2A 1R1TA 2IA1A 1RIOH 1XC5A 4NDLA 3D5RC 2LP0A 5KHDA 4ZTJA 2R7RA 2LSOA 2HQAA 2CFOA 1JKOC 4PSXA 4IO9F 4HDVA 3OSGA 1KYWA 1X2NA 2KISA 3BTIA 3N97A 2O03A 4A0YA 3FXKA 1K6YA 1JKQC 4A6DA 3FMRA 2KIUA 3HTUA 3SJMA 4A3EJ 5E1WA 4A0XA 2UXXA 1RPWA 2K9MA 5IT9Z 1RI7A 2ADUA 5EZHA 2FSWA 5FKMA 5L3EA 3NQOA 3IHUA 4OIQF 3FXQA 2HXIA 2E2HJ 2KIQA 1SEUA 2M0CA 3TO7A 1XCBA 1J0RA 1YO5C 4KITB 1IUFA 1WVRA 3RQIA 3L00A 1HA8A 3HOSA 4OMYA 1MD0A 3AG1H 4P55A 2EFNA 2V6CA 4B47A 3DKYA 5FD6A 5DEQA 3IWFA 1P4WA 2JUGA 4CH7A 1A5JA 3BCAA 2OQGA 3A0BC 2CQQA 2CO5A 3QPSA 1YRNA 3DEUA 3WHBA 4P5OA 2XGEA 3MKZA 3I4NJ 3ZQHA 1WJDA 3FZVA 2O0YA 3V8LA 4D1QA 2HPMA 2MGQA 3MMYB 4V19K 3K0LA 3L7WA 1OR7A 2CV2A 4UV9A 4FE7A 1LQ1A 3I64A 4F52A 2IGNA 1MH4A 1ON2A 2OV7A 2VBYA 3LA2A 4JYKA 3VB2A 3HM5A 1PDNC 3K70C 3CD6I 3TP0A 2QYOA 3DEEA 1BR2A 4UXNA 4RAGA 3DLAA 3LMMA 2LR8A 4XOPA 2JUCA 1V5GA 3T8TA 2LY9A 1VQLI 2OTLI 1JTYA 3EUAA 3ZMDA 4I02A 3HXLA 1MIJA 5J47A 1MDMA 2Z5UA 3HOTA 5KAIC 1J7KA 3DV8A 3OS0A 4XLFA 2DDBA 3WE2A 2XAHA 4LGWA 1ETOA 1W5SA 3OV8A 3TOBA 3GTGJ 4LFUA 3P9KA 2X1CA 1VQ6I 5IOZA 4R1HA 4IQJA 3ZCOA 5JR3A 2W48A 1XGOA 2EV5A 2GIZA 4PZJA 2VLAA 3ZMZA 1K7AA 5J1RA 1TC3C 2A05A 1J09A 4G12A 4PFOA 5FD5A 3SZPA 4AWXB 4XQFA 1K78B 3HL2A 4IRIA 1DDNA 1STZA 1IC8A 3RDIA 1MKMA 1QBJA 1T39A 5J8FA 1VQNI 2FX0A 1UCRA 4NC8A 1ZTRA 2M7AA 2QBYB 1MSEC 2ZNZA 1H88C 3FF5A 1RR8C 2W25A 2M45A 3S2WA 3TL4X 1YJ9I 3GLXA 4BJ6C 2P4WA 4CGZA 3BLYA 2GLOA 3I71A 3AG2H 4LIUA 2Q8KA 1P4AA 3ROUA 3QOEA 2VIXA 5F64A 2XROA 1KU3A 4I7HA 1JJ6C 1XGSA 4L9VA 3HB9A 2CV0A 2WAQN 3J7AY 3BR6A 2VXDA 4BHPA 4CCMA 5IPAA 2XPWA 2VQHA 1SAUA 3L9FA 2FQ3A 3BG5A 2GM4A 1HOMA 2Y0SA 4L9NA 2VQGA 5E8GA 2CUJA 1OQYA 2FXAA 3CZ6A 1FP2A 2H1KA 2IPQX 1OYYA 2DN0A 4IRGA 1GXPA 5EEGA 5F0CA 4IKFA 3S1QJ 3HTSB 4DYCA 2F5CA 3ZOBA 2O7OA 1Y0NA 3RYPA 4P96A 2V1XA 3SFIA 1ZR2A 1MMNA 1FYMA 1R4NB 3PJRA 1UZCA 4EGYA 1Z7UA 1K61A 3QPTA 1YIOA 1UG2A 3SZTA 5CYVA 2ZJPF 3J81Z 2LTPA 4B1RA 2K9LA 3G2BA 4EJVA 1A35A 1BJZA 2P8TA 1QU3A 1Z6RA 5JVTA 1FBUA 3KP7A 3CCMI 2VPRA 1JUPA 2VC0A 2R5ZB 2MD0A 4ZYDA 1GHCA 5DCFA 5CPRB 4LG3A 3HPHA 3J7AO 1OJLA 5DYMA 4ABZA 2EIJH 1IXCA 5E17F 1NK3P 5IP6A 2WY7Q 4LJZF 4Q47A 3LQQA 1IRZA 3HRTA 4A3MJ 5E8IA 2LKPA 2YSRA 3CC2I 3DQVC 4CUGA 3KZIC 3N4MA 1JUSA 4PGGA 3HPGA 1ZGWA 1T0FC 3ZQGA 3CDIA 2BVMA 5C44J 3G4SI 1U8RA 3LL7A 1K4TA 3CLOA 4B44A 2ZSHB 3H5NA 5K7FA 1Z1DA 3S3OA 3ECOA 3GTPJ 1BN5A 5TISC 3A02A 4RAFA 3HOZJ 4HNUA 1R4MB 2PN6A 3SDGA 1FOKA 1J2XA 2B9SA 4GRIA 1OLTA 2HR3A 3QWLA 5EG0B 1S72I 3LSRA 4HF2A 4IL6C 4RB3C 4HA8A 3ABUA 5F1RA 4XICA 4XKCA 2EZKA 4BL0B 3JRAA 2CW8A 4UB8C 1GV2A 1LVKA 1TWHJ 3GMEA 2EJRA 4AM3A 4C2UA 4ZDOA 4J00A 3P9IA 3U21A 3JRCA 3REOA 4A3IJ 5LGUA 2F5DA 3PNTA 3TDZC 2OCCH 3LSIA 3VFZA 2FF4A 2QA4I 5ERIA 1XSDA 4KMFA 4HBLA 2HOAA 3OIQA 3TO6A 4L5IA 3GTJJ 3P5JA 5D8KB 2AQEA 2FMYA 4E7IA 5DCMA 1HW2A 2ZMEC 1F9NA 3MEXA 5FROA 3ZN1A 2WAEA 1O7LA 5IYBJ 2WADA 3COAC 2ELKA 2K9NA 3V42A 4D5FA 1ZR4A 3DU6A 5DD4A 3E7LA 4XN0A 1S6LA 3VEPA 2EFPA 2XAJA 3BG9A 1JI8A 2HWVA 4LLGF 1YHQI 4PDKA 5E18F 2W1OA 3KEQA 2EQRA 5M5WJ 4S05A 1ZRCA 4Z6YA 4WWCA 2EV6A 3F72A 2ZB9A 3FK6A 1LPQA 1JT6A 1TLHB 4BQQA 4M6YA 4IHVA 4BUPA 2OA4A 2GWRA 3QAHA 2XRLA 1VQOI 3CMMA 1CGPA 4N9HA 1TQMA 3HIFA 3CF2A 2DA5A 3CCYA 1FC3A 2VJJA 3RSNA 2BY3A 1XG1A 3BR3A 2FMLA 2RC4A 4RDUA 3G73A 3PFIA 4WXCA 4U88A 4V2GA 3L2WA 4MQVA 3PFYA 1APLC 2GA1A 1IRXA 2M8EA 2PQ8A 2NVUB 3W6JB 2M3AA 3O8GA 5D4RA 2NVYJ 1K78A 1X4OA 3V7SA 4KN7X 5D6FA 3D1NI 3DKXA 4CCOA 1RRJA 2B63J 1R5GA 2QBYA 2M1BA 1UFMA 2Y0MA 4XK4A 2EINH 1B8IA 1GUUA 1BW5A 4XIDA 3KYLA 3KIOA 2XV4S 5LGTA 1WI3A 4E7SA 3VSLA 2EZLA 1MW7A 1MJAA 1T33A 1AKHB 1IUYA 3H5AA 4E7ZA 1SFUA 3DBLB 3SHFA 3AL0C 1R5HA 1SVMA 2KJCA 2DMQA 1VI0A 1OMIA 1SD4A 2CMPA 4BACA 1SANA 2IGOA 1FBSA 4YFKF 4F92B 1J9IA 4G8XA 4XONA 4C3IJ 2BBYA 1IF1A 2LY1A 5A2QZ 1FTTA 2D1HA 2GXGA 1NH3A 4RB2C 4BE0A 4CCLA 4M3GA 3C18A 3DTKA 1LDDA 1HCRA 2DPUA 1Z9CA 1HDPA 4QPQA 2OCEA 1BIAA 3L2VA 2HTJA 1HXDA 2Q2EB 2XIGA 1TW3A 1FMVA 2DBBA 1SVLA 1IDYA 1SVOA 2CUFA 4DYQA 2CQKA 2DK8A 1S7EA 2XAQA 1D1CA 3RPQA 2R5ZA 3OR1C 5LLQA 3LSKA 2A6EF 3F8MA 3K9TA 3ERED 3KLNA 3KYDB 2PMZA 3CUQC 1TWGJ 1I3QJ 1Y6IA 1X1BA 3DWLE 1GVJA 1IRGA 2EFWA 2XB0X 3LAJA 4E4HA 5HS8A 3K4JA 4XLHA 5GPAA 2F5EA 3K1MA 1W7PD 3B6AA 4AIHA 5J8CA 3AG3H 3ASNH 1N78A 4BJTA 2G7HA 2E71A 4UVCA 3AKZA 3ZQLA 2FUG2 3I9V2 1NG6A 2VBXA 1HKSA 2X6XA 1G59A 3BPXA 4M9ZA 1UHMA 1PUEE 2WBMA 2F48A 2HNHA 3CP8A 3MVPA 2QENA 1J5YA 2HXOA 3LA3A 4KJZA 5E1ZB 1L0OC 5K5QA 2BY2A 4R8HA 3AG4H 3NRVA 1P6RA 4HG2A 2HYJA 1U5TC 3C1DA 2R7WA 1QQIA 3HRUA 1VQMI 5FFZA 1I1GA 4LD5A 3IAM2 1LDJA 1PJRA 3E97A 4X0GA 3QPLA 3OSFA 5EDNA 2VJ4A 3MCZA 1TWFJ 3BTCA 3HKZN 3H92A 4PJLA 4MGRA 1NHAA 2JK3A 1SFOJ 2R4GA 1JT0A 4II2A 2YPRA 3IRRA 4LLLA 4A3JJ 1MDMB 3WTVC 1ENHA 1VQKI 2XF7A 3C2HA 3K4BA 2IA2A 3OYBA 3W6VA 1HC8A 3EQLF 1R22A 5IT9K 3JREA 5L3FA 1MNEA 4A3DJ 4N0BA 4XKWA 4UV8A 5FFXA 4PK4A 5K7HA 3CO6C 4I98B 4DOZA 1S8NA 2CGPA 4B3XA 1HW5A 3DLLF 4M9SA 3OYMA 1MBEA 2Y9YA 4Y3OA 3V8JA 1O4XA 1VQ8I 1FIAA 1I50J 1D0XA 2DMNA 4F93B 1BI3A 4EJOA 3K1PA 2ZNYA 1MBFA 2DA6A 2OU2A 4D7NA 2A5WA 2X1EA 3EPZA 1UAAA 1ZELA 2JZYA 2R7FA 4D0PA 5FKKA 2H8RA 1MBHA 4RB1A 3GWZA 1GLNA 4YIIA 2DMPA 2J5PA 3WTWC 1J75A 2KDZA 2KHMA 3JRDA 2RREA 4Q5SF 4G6QA 5E20A 3H9GA 2DFFA 3HHHA 4W97A 4EEFG 4EATA 1IGNA 1T95A 2CFXA 4A3CJ 4N4OB 3C3WA 3KE2A 1JHHA 1MBKA 2ELJA 5CLSA 1P7IA 2LREA 4DBQA 5FGMA 4OAZA 3TOAA 2HDCA 1TZLA 1VQPI 2DA3A 4UNOA 3JW4A 1YI2I 2OZ6A 4A3FJ 3BJOA 4A12A 3OYEA 2YS9A 3S2DJ 2X6YA 4OWRB 3A0HC 4B3AA 1ZN2A 2QF7A 2VE9A 1A31A 4A3GJ 2MC3A 1D0ZA 2MABA 2KT0A 3M8JA 3PQJA 2GXBA 2VKVA 4B43A 2FE3A 3VDXA 4S0HB 4KNYA 4BBRJ 1FPQA 1K4SA 1POGA 4JBAA 1GVDA 2QVOA 3S3MA 4E70A 4JOMA 2V9KA 2E1CA 2FBHA 2W24A 1LE8A 2JA8J 1N25A 1XTAA 2CW0F 2ZFWA 4V2FA 3Q9SA 1ETVA 3G6EI 5HNFA 3FXOA 2ID6A 5LGNA 1ODDA 2XKOA 3BZCA 4C30A 3WU0A 5E3OA 1DGRM 4BY7J 4P9UA 2NNYA 1KGSA 2XGCA 1HQCA 4Y17A 4I09A 1P4XA 2DMTA 4KFCA 1AOYA 3VPRA 3M1EA 5CKTA 4C3JJ 2F4OB 4IPAA 1E3OC 5L3GA 5IOYA 3DPTA 4IZZA 2M9HA 3H0DA 2NVQJ 2H6BA 3RZOJ 1RR7A 1U9NA 2K4JA 3GF2A 5M3FJ 1B1BA 2E2IJ 1T2KA 1MJBA 3S32A 2MH2A 5FKLA 2NAZA 5GAHJ 1LEAA 3EUHC 3CJNA 2VI6A 2HZDA 3S2HJ 2FU4A 2GOXB 5EEAA 3G1OA 1C0WA 1K6OA 4MLOA 2Z2SB 3SEQA 5HVQC 2F4IA 4C2TA 3HOWJ 3BROA 1FSHA 2NS0A 4Y33A 1LVAA 1USTA 2Q2EA 3M7GA 3WTZA 4XLEA 2IXSA 3F9KA 2MG4A 1D5YA 2A68F 4KYWA 2VPLA 4IX7A 2G0EA 1O3TA 4O3MA 2L4MA 1ZHFA 2DFIA 5HS7A 4RM3A 1A6IA 5ED4A 5M3MJ 4RGUA 3WGGA 1L3LA 1WZ2A 2V9VA 3J81K 1G3TA 1NG7A 3I4PA 2PI0A 3M8EA 4WCGA 3A03A 1R23A 3HEFA 3V7CA 2KDOA 2QWWA 5DCMB 3U2RA 3R0AA 1F36A 2VT2A 1JUMA 3T5XA 2Z9OA 3BR0A 3A2KA 4OU0A 4JQFA 3JAMZ 2Y0SN 1Z21A 5CVUA 1ULYA 4OMZA 2ZSIB 1ZKGA 4U0YA 4FHTA 2BHZA 4AIKA 3W2WA 3PO2J 4L0ZB 2IEKA 2D1VA 4II3A 4BHBA 2TCTA 2XAUA 3H9QA 3ABLH 4JX4A 5KNLA 1DPUA 2ICWG 3TBIA 4ZYHA 3BJAA 2BZTA 3ZQCA 3EYIA 4UUSA 1JJ8C 1IN6A 3ULQB 2PFBA 1MMDA 2CQXA 4BXUA 2X48A 2GOMA 5F08A 1UHSA 1FOYA 3WU2C 1V4RA 1SMTA 1YG2A 1N75A 3IP4B 5CVJA 1YTYA 1VQ4I 2JN6A 1SC7A 4HF1A 4GYGA 3BG7A 1R6RA 3ZPLA 3GFLA 3GUDA 3GTQJ 4IHXA 1ETKA 2EZIA 2LFBA 4XLPF 5GPCA 5D5UB 1I3AA 2H8WA 4ZC3A 3DBRB 1F1ZA 3IKTA 4M72A 2CU7A 4Y52J 4KMUX 1E3HA 4G9YA 1ZYRF 3FKIJ 4A5NA 2ZXWH 3BZKA 2MBFA 1IV8A 1ORKA 3CDLA 1XD7A 1YYVA 5ICFA 2STTA 3FBNB 2LF7A 2HGCA 5CVVA 2DXIA 3E5QA 4RBOA 1OCZH 3QYEA 4B09A 4IOAF 3K4LA 2P7CB 2JJ7A 2QZ8A 4M6VA 4LK1F 2JMWA 1EH7A 4ZYEA 1B72B 4HX4A 3KP2A 2JA2A 2FRHA 2I8DA 4E6KG 1B8IB 2M0MA 4AVZA 1VTNC 2KRFA 4RLFA 5EF6A 2IS2A 2EH3A 4XL9A 1UB9A 1NTCA 2K5CA 4IHYA 3LQRA 2ECBA 2R93J 4QSHA 5M5YJ 3NWTA 5E79C 3VODA 4ZZDA 1QHGA 4X6AJ 2LG4A 4MIMA 2XSDC 1AHDP 2L9VA 3VYUB 2FA5A 2X0LA 5B1AH 1XGMA 4G7HF 2PLYA 5LD2C 3HUGB 5AIQA 2NVTJ 3KEOA 3D0SA 3Q9VA 1R5ID 2E36A 3OYGA 2V1DA 1HKTA 5HLHA 3DEWA 3CP2A 1OCOH 1TQIA 1A36A 3ZQQA 4ESBA 3F6OA 5JFRA 3ZQ7A 1Z6TA 1BI0A 2CQNA 2JA7J 2DQLA 1DU6A 4CDGA 2A6HF 2DLLA 2DTZA 2B7EA 4FX0A 3WTTC 2AXTC 3S14J 2EZHA 2D2WA 1IO2A 4DW6A 1KQ9A 2ME0A 4KISA 5DDGA 1D1AA 1O57A 4CA0A 2VOPA 2JT1A 2C6YA 3NARA 3S93A 2PJPA 5F04A 2K86A 2ZJRF 1T8IA 5HOOA 4LITA 2BXYA 3TW6A 2VASA 2XHKA 1R36A 1N77A 1LEBA 3KCCA 2LYCA 3GTKJ 1G3YA 2KZVA 2O8XA 2HI3A 3H3VK 4RGXA 3CCVI 4ITVA 2W00A 2MC4A 2LRDA 1TTYA 2PG4A 1TWAJ 1WI9A 2K85A 3RPUD 4NUBA 3LNQA 2M87A 2CJJA 2OZUA 2DW4A 3OIPA 5J40A 3LFUA 2XUBA 1FYLA 1QHHD 3S15J 2Z3YA 2TDXA 1D0YA 2DT5A 1T0FA 2QM3A 4HAMA 2OJED 2L7MP 1CQTA 2PMUA 2ZCWA 3TP3A 2ESNA 1K79A 5KCMA 4LG0A 2RAEA 2PEXA 2HQNA 1Y0UA 4RGRA 2XSJC 2EILH 5F27A 1JKRC 4HZFA 2V7FA 2JQ7A 3PNVA 2HFHA 4WXHA 1ZLJA 1X2MA 1YOVB 2L9NA 4AVPA 1U5TB 4OOIA 1F5TA 1LFUP 1D8JA 2Y48A 2K7LA 3F6VA 5LHGA 5A2QK 3FXUA 3FBIB 1ACIA 5LBQA 4UB6C 2ZKZA 3MKWB 2MFZA 3LSMA 5HS9A 3DF8A 1G2HA 4YIRX 1H8AC 1IN8A 4HEA2 4M3DA 4ZYAA 3E3VA 3QP5A 2L9RA 3TDUC 4F91B 1S7AA 4LIVA 3X2QH 3HZJA 3F8FA 1MJ9A 4HLXA 2ZJ2A 1DP7P 3OL4A 4OINF 2EIMH 3L1PA 3GFIA 4I6ZA 2JWTA 1SD7A 3ZXSA 2NS7A 3ZMUA 4LOCA 2I5UA 2Z1DA 4O5VA 2ZMEA 4ZJZA 5BPDA 2YU9J 4ZTFA 1ONVA 1QPIA 4NC6A 1A04A 2F5FA 1V5EA 1YW9A 4AIJA 4M6XA 1DGWY 4RB0A 2KP6A 2AO9A 4D9JA 3S1NJ 4KIFA 1FWZA 2HU9A 4CCNA 2QGUA 1BBYA 1X19A 2ZO4A 2BW3A 3N05A 3DBHB 1TBXA 4U87A 4PJNA 5EEHA 3IH3A 4XMYA 1IN7A 1QVTA 4L18B 1B9MA 2X6WA 4FISA 1ETXA 4W1UA 3SYTA 3LWFA 1R58A 4GO1A 3MZ8A 2FBIA 5FLXK 2E1MB 3HOVJ 2BY1A 5LEKA 2HKOA 3WG7H 4AD9A 4MTDA 4CCJA 5HNHA 1GDTA 2RNGA 2JRTA 2IGKA 3DTEA 5AONA 2BXZA 2EA4A 4HSTA 3U1DA 4QLCU 3KETA 2MYSA 2GZWA 2PMZN 1W0UA 4EQQA 4I2OA 4XN3A 1S3JA 4XBFA 3NWSA 1HDDC 5DUKA 2FOKA 4F7ZA 1V55H 3IRQA 4YIFA 2W7NA 1BOBA 4YG2F 5DUIA 2VKHA 1BC8C 2QKMB 5LRSA 2KFDA 3I59B 3H36A 3I58A 4RS8A 3JTGA 4HX7A 3SFZA 3VYSB 3OR2C 1XN7A 3VOEA 5GTHC 3TQNA 5IP7J 2NYXA 3ECHA 3ZMTA 5C4JJ 1MH3A 3IC7A 2IP2A 1YS6A 2Q0OA 4IXAA 4CZZA 3BG3A 3UKGA 3BPVA 2AS5F 3KEYA 2FOWA 2HQRA 1M1EB 4ZZLA 1ZLKA 1LE8B 1EH8A 2WV0A 1B72A 4IHWA 3IV5A 1XSVA 5IT3A 2HEOA 1PP7U 1MBJA 2COMA 2OAZA 1MBGA 1U78A 1Z05A 1SD6A 2BV6A 2CSOA 2OC6A 3QU6A 1U2WA 1WSUA 5IYDJ 3GO5A 3HRSA 4LB6B 4J01A 2W85A 5H6QA 3OOPA 4DJAA 1X4PA 1ZK8A 3ZGKA 3CCUI 3Q0UA 1BI2A 1ZGAA 2DA4A 3BR5A 4BE2A 3OY9A 1RESA 3HUGA 1GV5A 3GEZA 4EJUA 2DO7A 3GFMA 2DTRA 5AIPA 2NOGA 4IF4A 4KIGA 2GIVA 2VKDA 3ERMA 4I76A 3S3NA 2EWNA 2M4GA 4AC0A 5HLIA 2V4JC 5JVGF 1U9OA 1WFXA 2E60A 2L4AA 1T56A 4A3KJ 2CUEA 2WB1N 2BY0A 2O3FA 4L5JA 1E0EA 1P92A 2P81A 1TWCJ 5EZGA 3F0CA 4XM3A 3QODA 1R9TJ 2P7VB 2CS3A 3EDPA 2DQRA 4BNCA 1SAXA 3MKYB 5J3LA 4U0VA 1IG7A 3VYTB 1Y39A 5BS6A 1XDUA 1X1PA 2JPBA 4XRSG 3JRGA 3E6DA 4IEJA 5B3SH 3IKVA 2KL4A 4ZDPA 2K02A 5HDGA 2F4MB 2IRFG 2KMUA 2O9LA 4B48A 2CUZA 4A6EA 5EGOA 3M07A 4GFBA 1SFKA 3O2PE 3L2UA 2Z33A 5TGTA 2W82A 2Q1ZB 1YX3A 4R79A 2LVSA 3CUQA 1XB4A 3PSIA 1OCTC 2VJ5A 2DDAA 2LKSA 5HLTA 4E7JA 3BY6A 2XRNA 1ETWA 2HPIA 3J7ZI 2YX4A 3PO3J 1WCMJ 4NQWB 5E1XA 1PVEA 1KU9A 4PUSA 2BGCA 3Q5FA 3TEDA 3ZP5A 1U8BA 4FT8A 5K5OA 1ZG3A 3HGYA 3QU3A 5LFAA 3KFWX 3ZRGA
chains in the Genus database with same CATH topology
5FLXZ 2OQRA 1OPCA 1AWCA 2CWEA 5H20A 1U5TA 3BOQA 3R6SA 2NNNA 1LJ9A 1OYWA 3HSRA 1S29A 2WWYA 4ESJA 2DPDA 1D3YA 2VC1A 2XASA 1B4AA 2L54A 1KQ0A 1WRJA 2IT0A 3BWGA 1W7PA 2HYGD 2UXNA 4Y15A 5LEJA 2A3SA 3E6BA 1MGTA 2G9WA 1QZYA 1LDKB 3WTYC 2GQQA 4YFNF 1XMAA 1D8KA 4HOBA 4BAYA 3B02A 3RKWA 3G3ZA 1T38A 3KLOA 1JHFA 3AAFA 5KK1A 3JAMK 2ISZA 1USSA 3MWMA 4XLNF 3E6MA 4MQ9F 1H0MA 1WQ2A 4Q48A 5J6XA 3FM5A 4CXFA 2OD5A 1MZBA 2J5OA 3HYIA 3F23A 5BMZA 2KIMA 1H9GA 2MH9A 3F22A 2XGXA 3T0YA 5FB2A 3I59A 4ETSA 2YX7A 5TJJA 2W57A 1SFXA 4XSXF 3WE3A 3CTAA 2UWMA 1T98A 4LLNA 3FXRA 4KICA 1IN4A 3BZ6A 3W6KB 1I1SA 2IA0A 4U0WA 1WKMA 2D45A 1IRFA 4MNUA 4BHCA 3ZMSA 1FSEA 4LMYA 2GA2A 2BEOA 1FT9A 3F8NA 3CDHA 3MAJA 2QQAA 5CVRA 1IN5A 1FLIA 3M9AA 3K69A 2P5LC 2K4BA 1UHWA 4LG0B 1KA8A 1SFEA 4EGZA 2RNJA 1YW8A 4WK8F 5ILVA 3EUHA 4GYIA 4BH9A 4EMSA 2ETHA 3FHZA 2VE8A 2RGVA 1V3FA 4I01A 1LNWA 2HS5A 3WGHA 3J80K 1R1VA 2WC2A 3H3ZA 4IVNA 4UVAA 1QGPA 2LDUA 1HKQA 3CO7C 2FBKA 2FEZA 2RV8A 1YFHA 3BP8A 1ZG1A 4ENNA 1XMKA 2HZTA 2QQ9A 1LB2A 1SD5A 2ZMEB 4NQWA 2E7XA 1DUXC 4A0ZA 1RUOA 1YLFA 3D5LA 1IXSB 1OKRA 3WODF 3F3XA 4RGSA 1HW1A 2L3DA 3FM3A 3MFKA 2M30A 2PMHA 5HLGA 1HSJA 3R61A 4B8XA 4HLYA 2BE5F 1BJAA 1KU7A 4GCVA 1IW7F 5F6FA 1B9NA 3IWZA 4CO8A 2ELHA 1IZ1A 1G4DA 3RKXA 2H27A 2ZXJA 1QO0D 2EV0A 2VN2A 4I0BA 2WTEA 1YQAA 2YU3A 4YFXF 3ML6A 3DKWA 4HDUA 3T1BA 5L3BA 1J59A 1QNTA 4M9XA 3R0JA 4ZH4F 2R7DA 1O3SA 1FX7A 4EVIA 1G6NA 4GGGA 3V4GA 3U9GA 3F8BA 5CJ9A 1ZRDA 3GVAA 3HHGA 1JGSA 2O6GE 3DPLC 3PQKA 3QRFF 1ZREA 4Y13A 4PGHA 2BYVE 2VT3A 1BM9A 2RQPA 1HSTA 2EFQA 2QLZA 2IJLA 1ZH5A 3WTSC 4EJWA 4Z2YA 3WU1B 2KKOA 3I53A 4HV6A 4OIOF 2G7UA 2XAFA 4G7OF 2QQBA 4EM2A 1TNSA 2JPCA 4BQAA 4HQEA 5K1YA 4O6JA 1TQPA 4EM1A 5ILSA 3QP6A 3FWEA 3ZMVA 2V1UA 2VONA 2VBWA 3J80Z 3WTXC 4FX4A 2QUFA 3TKYA 2XVCA 4G7ZF 1FNNA 1FY7A 1RUNA 1IAWA 2A69F 3ABTA 1RNLA 4U7BA 3EYYA 2M5WA 4OIPF 2DAOA 2R3SA 3CUQB 2FNAA 1O3RA 1X3UA 3JSOA 4I0AA 5ICCA 4KA4A 3R60A 4L9JA 4UUVA 2A5YB 2E7WA 2A07F 3RIRA 4RAZA 3FMQA 2P5KA 1KU2A 4KT5C 1Q1HA 3RKYA 4A5MA 1O3QA 2VBZA 2EA2A 2ISYA 1TW2A 5LHHA 1QPMA 3I5UA 5JHUA 3LA7A 1GXQA 3KP3A 4GXOA 4H0EA 4ENJA 3ISPA 1FP1D 4ENMA 3GX4X 3FMSA 1W7PB 3CUOA 4ESFA 4G6DA 3RPUA 2H6CA 3F21A 3GYHX 1OYIA 3DXJF 3WG9A 5D5WB 2RDPA 3RYRA 2KJBA 5LHIA 3E5XA 2UZKA 1I5ZA 3P9CA 2YR2A 1U3EM 1B59A 3V7RA 2Y75A 4EV0A 2DI3A 3RJPA 2MA3A 2V79A 4G94A 6PAXA 3WGIA 2ESHA 3K1NA 1I6XA 3WTUC 3LFKA 1XSXA 1D5VA 5D8LB 2AXLA 4HV5A 1CF7B 1O7FA 2Z99A 2P6TA 1SMYF 2FNPA 2ACJA 2L01A 3LSTA 1ZG5A 5FO5A 3F8CA 4XSZF 3ELKA 1T6SA 5D4SA 3HRMA 2MLGA 3E6CC 1W5TA 4M73A 3GZ5A 2ZBKA 2JSCA 3I0TA 1F4KA 1ZRFA 3GW2A 5BOXA 1BC7C 4L9TA 4IHSA 3KZZA 2H09A 1B6AA 4MEXF 1I27A 2A61A 3P7NA 4ZYGA 1R00A 4EM0B 5TRDA 4WX9A 5H6RA 4U7DA 4KUMA 1WWXA 4IRHA 3C7JA 1TNTA 2B0LA 4MEYF 4ASNA 2HYFA 1W4MA 4EJTA 3O3KA 1G3SA 3K2ZA 1PP8F 2X4HA 4WF2A 1ZAOA 5ICGA 3QPHA 5ICEA 3EETA 2CYYA 1Z91A 2W84A 1IXRC 1EH6A 2HTSA 4LK0F 1YS7A 4DNCA 3HSEA 4CYDA 4HQMA 4N9IA 4IJAA 3TGNA 2RKHA 2H94A 2MLKA 1JXSA 4CICA 2K27A 2DK5A 2GAUA 4MHGA 4HF0A 3MQ0A 3NEUA 5D6EA 4A2UA 4HW0A 3BJ6A 1FYKA 3KP5A 3IL2A 2XAGA 4UVBA 1REPC 1P2FA 2O61A 3T8RA 1ON1A 4HYEA 3B73A 4OIRF 2VODA 3GFJA 3LAPA 2PBIA 2P6SA 2HKXA 3ZN0A 1ZARA 3H3UA 4KIBA 2JTVA 3JSPA 3KP6A 2VXZA 5LRRA 2EK5A 4XRFA 3DP7A 2IW5A 2RVCA 1G3WA 3L2CA 1KQ8A 3SXYA 5D5XB 3M8FA 2F2EA 4ENKA 1RZ4A 4NHJA 5ILUA 1FZPB 3O6BB 2HOEA 1U6GA 1ZGJA 4P9FA 1FBQA 2VOOA 2P5VA 3L09A 4S04A 4M74A 2XKPA 3RTRA 5BQTA 5KVRA 3GXOA 1XDSA 4TV7A 1YW7A 4QWQA 3R4KA 3KP4A 2OBPA 4Q4ZF 1CF7A 2MD5A 5L3CA 4JK1X 2LNBA 3FX3A 4KN4X 2RN7A 5BPIA 2DU9A 4BYYA 1KYZA 3MZHA 5JI6A 3RI4A 2L02A 1BIBA 2E1NA 4NB5A 4UHTA 2IVMA 3V8KA 4L0YB 3MZYA 4M71A 2NRAC 1E2XA 4PCQA 2CG4A 4ON0A 5DV5A 4KDPA 4WXDA 1EV7A 1BI1A 1R7JA 1S7OA 3I54A 1R1UA 2STWA 3DFGA 4HX8A 4RAYA 3JTHA 2EB7A 3HSFA 5D5VB 1XCVA 5CVIA 3E5UA 3TO9A 4MTEA 3BDDA 1QZZA 5K5RA 1BOAA 2KIFA 1H9TA 2EFOA 1JE8A 4LB5A 3KZYA 1E17A 1DPRA 3SQNA 4K2EA 5DD8A 1HBXG 5L3DA 5HDNA 4CHUA 2LF8A 3GZ6A 3QOPA 1XGNA 5HDKA 4IHTA 4DQ2A 1R1TA 2IA1A 1RIOH 2LSOA 4HDVA 1KYWA 3N97A 2O03A 4A0YA 4A6DA 3FMRA 2KIUA 3HTUA 5E1WA 4A0XA 2UXXA 5IT9Z 1RI7A 2ADUA 5L3EA 2FSWA 3NQOA 3IHUA 4OIQF 3FXQA 3TO7A 1XCBA 1J0RA 1YO5C 3L00A 3HOSA 4OMYA 1MD0A 4P55A 2EFNA 2V6CA 5FD6A 5DEQA 3IWFA 1P4WA 2OQGA 2CO5A 3DEUA 4P5OA 3FZVA 2O0YA 3V8LA 3K0LA 3L7WA 1OR7A 4UV9A 1LQ1A 3I64A 1ON2A 2VBYA 3LA2A 3VB2A 1PDNC 2QYOA 4UXNA 3T8TA 3ZMDA 4I02A 1MDMA 2Z5UA 3HOTA 1J7KA 3DV8A 3WE2A 2XAHA 4LGWA 1W5SA 3OV8A 3TOBA 4LFUA 3P9KA 4R1HA 5JR3A 1XGOA 2EV5A 4PZJA 3ZMZA 1K7AA 5FD5A 3SZPA 4AWXB 1K78B 4IRIA 1DDNA 1STZA 3RDIA 1MKMA 1QBJA 1T39A 5J8FA 1UCRA 2QBYB 2ZNZA 3FF5A 2W25A 2M45A 3S2WA 3GLXA 2P4WA 4CGZA 3I71A 2Q8KA 1P4AA 3ROUA 5F64A 2XROA 1KU3A 4I7HA 1XGSA 4L9VA 4BHPA 3L9FA 2FQ3A 4L9NA 5E8GA 2FXAA 1FP2A 2IPQX 1OYYA 4IRGA 1GXPA 5EEGA 3HTSB 2F5CA 3RYPA 4P96A 2V1XA 1FYMA 4EGYA 1Z7UA 3QPTA 1YIOA 3SZTA 5CYVA 3J81Z 4EJVA 2P8TA 1Z6RA 5JVTA 1FBUA 3KP7A 2VC0A 4ZYDA 1GHCA 5DCFA 3J7AO 5DYMA 1IXCA 5E17F 4LJZF 4Q47A 3LQQA 3HRTA 5E8IA 2LKPA 2YSRA 3DQVC 3N4MA 4PGGA 1U8RA 3CLOA 1Z1DA 3ECOA 1BN5A 2PN6A 1FOKA 1J2XA 2HR3A 4HF2A 4RB3C 4HA8A 3ABUA 5F1RA 2EJRA 3P9IA 3REOA 5LGUA 2F5DA 3TDZC 3VFZA 2FF4A 5ERIA 1XSDA 4KMFA 4HBLA 3TO6A 4L5IA 5D8KB 2FMYA 5DCMA 1HW2A 1F9NA 3MEXA 3ZN1A 1O7LA 3COAC 5DD4A 1S6LA 3VEPA 2EFPA 2XAJA 2HWVA 4LLGF 4PDKA 5E18F 3KEQA 4S05A 1ZRCA 4WWCA 2EV6A 3F72A 1TLHB 4M6YA 2OA4A 2GWRA 3QAHA 1CGPA 4N9HA 1TQMA 3HIFA 1FC3A 2FMLA 2RC4A 3G73A 3PFIA 4WXCA 4U88A 4MQVA 2GA1A 2M8EA 2PQ8A 3W6JB 5D4RA 1K78A 3V7SA 4KN7X 5D6FA 1R5GA 2QBYA 2M1BA 1UFMA 2Y0MA 2XV4S 5LGTA 1MJAA 1IUYA 1SFUA 3SHFA 1R5HA 2KJCA 1OMIA 1SD4A 4YFKF 1FBSA 1J9IA 4G8XA 2BBYA 1IF1A 5A2QZ 2D1HA 2GXGA 4RB2C 3C18A 1LDDA 2DPUA 1Z9CA 1BIAA 2HTJA 1HXDA 2XIGA 1TW3A 2DBBA 2CQKA 2DK8A 2XAQA 3RPQA 5LLQA 2A6EF 3F8MA 3K9TA 3ERED 3KLNA 3CUQC 1IRGA 1GVJA 2EFWA 3LAJA 5HS8A 2F5EA 3K1MA 1W7PD 4AIHA 5J8CA 2G7HA 4UVCA 2VBXA 1HKSA 3BPXA 4M9ZA 1UHMA 1PUEE 2QENA 1J5YA 3LA3A 5E1ZB 1L0OC 5K5QA 4R8HA 3NRVA 1P6RA 1U5TC 3C1DA 1QQIA 3HRUA 5FFZA 1I1GA 4LD5A 1LDJA 3E97A 3MCZA 3H92A 4MGRA 1NHAA 2YPRA 4LLLA 1MDMB 3WTVC 2IA2A 3EQLF 1R22A 5IT9K 5L3FA 4N0BA 4UV8A 5FFXA 3CO6C 4I98B 1S8NA 2CGPA 1HW5A 4M9SA 3V8JA 1BI3A 4EJOA 3K1PA 2ZNYA 2OU2A 2JZYA 2R7FA 4D0PA 4RB1A 3GWZA 4YIIA 2J5PA 3WTWC 1J75A 4Q5SF 4G6QA 5E20A 3HHHA 2CFXA 3C3WA 3KE2A 1JHHA 5CLSA 5FGMA 3TOAA 2HDCA 4UNOA 3JW4A 2OZ6A 3BJOA 4A12A 1ZN2A 2VE9A 2MC3A 3PQJA 2GXBA 2FE3A 4KNYA 1FPQA 4JBAA 2QVOA 4E70A 2E1CA 2FBHA 2W24A 2CW0F 2ZFWA 3Q9SA 5LGNA 1ODDA 2XKOA 3WU0A 4P9UA 2NNYA 1KGSA 1HQCA 4Y17A 4I09A 1P4XA 4KFCA 1AOYA 3M1EA 4IPAA 5L3GA 3DPTA 2H6BA 2K4JA 3GF2A 1B1BA 1T2KA 1MJBA 2MH2A 2NAZA 1LEAA 3CJNA 2FU4A 1C0WA 1K6OA 5HVQC 1FSHA 3BROA 2NS0A 1LVAA 1USTA 2Q2EA 3M7GA 3WTZA 2A68F 4KYWA 1O3TA 4O3MA 2L4MA 1ZHFA 2DFIA 5HS7A 5ED4A 4RGUA 3WGGA 1L3LA 2V9VA 3J81K 1G3TA 3I4PA 2PI0A 3M8EA 4WCGA 1R23A 3V7CA 2QWWA 5DCMB 3U2RA 3R0AA 2VT2A 3T5XA 2Z9OA 4OU0A 4JQFA 3JAMZ 5CVUA 1ULYA 4OMZA 4U0YA 4FHTA 4AIKA 4L0ZB 2D1VA 4BHBA 1DPUA 4ZYHA 3BJAA 3EYIA 1IN6A 3ULQB 2PFBA 4BXUA 1V4RA 1SMTA 1YG2A 5CVJA 1YTYA 4HF1A 4GYGA 3ZPLA 3GFLA 3GUDA 4XLPF 5D5UB 1F1ZA 3IKTA 4M72A 4KMUX 4G9YA 1ZYRF 4A5NA 2MBFA 1XD7A 1YYVA 5ICFA 2STTA 2LF7A 2HGCA 5CVVA 3E5QA 4B09A 2P7CB 2QZ8A 4LK1F 1EH7A 4ZYEA 4HX4A 3KP2A 2FRHA 1VTNC 2KRFA 1UB9A 3LQRA 3VODA 4ZZDA 2FA5A 2X0LA 1XGMA 4G7HF 2PLYA 5AIQA 3KEOA 3D0SA 3Q9VA 2V1DA 1HKTA 5HLHA 1TQIA 4ESBA 3F6OA 5JFRA 3ZQ7A 1Z6TA 1BI0A 2DQLA 4CDGA 2A6HF 2DLLA 3WTTC 4FX0A 2D2WA 1KQ9A 5DDGA 1O57A 2VOPA 2JT1A 2C6YA 2PJPA 2K86A 5HOOA 2XHKA 1R36A 1LEBA 3KCCA 1G3YA 2O8XA 4RGXA 1TTYA 2PG4A 1WI9A 2M87A 2OZUA 2DW4A 2XUBA 1FYLA 2Z3YA 2TDXA 2DT5A 1T0FA 2QM3A 4HAMA 2PMUA 2ZCWA 2ESNA 1K79A 4LG0A 2PEXA 2HQNA 1Y0UA 4RGRA 4HZFA 4WXHA 2HFHA 1ZLJA 4AVPA 1U5TB 4OOIA 1F5TA 1D8JA 2Y48A 2K7LA 3F6VA 5LHGA 5A2QK 3FXUA 5LBQA 2ZKZA 5HS9A 3DF8A 1IN8A 3E3VA 3QP5A 3TDUC 1S7AA 3F8FA 1MJ9A 4HLXA 2ZJ2A 1DP7P 4OINF 3GFIA 1SD7A 3ZMUA 4O5VA 2ZMEA 5BPDA 1ONVA 1A04A 2F5FA 1YW9A 4AIJA 4M6XA 4RB0A 4KIFA 1FWZA 1BBYA 2ZO4A 1TBXA 5EEHA 1IN7A 4L18B 1B9MA 3LWFA 1R58A 4GO1A 2FBIA 5FLXK 5LEKA 2HKOA 4AD9A 4MTDA 3U1DA 2JRTA 3IRRA 5AONA 3KETA 2EA4A 4QLCU 2GZWA 4EQQA 4I2OA 1S3JA 4XBFA 5DUKA 2FOKA 4F7ZA 3IRQA 4YIFA 4YG2F 5DUIA 1BC8C 5LRSA 3I59B 3I58A 4RS8A 3JTGA 4HX7A 3SFZA 1XN7A 3VOEA 3TQNA 2NYXA 3ECHA 3ZMTA 3IC7A 2IP2A 1YS6A 2Q0OA 4IXAA 4CZZA 2AS5F 3BPVA 2HQRA 4ZZLA 1ZLKA 1EH8A 2WV0A 1XSVA 5IT3A 2HEOA 1PP7U 2COMA 1U78A 2OAZA 1Z05A 1SD6A 2BV6A 2CSOA 3QU6A 1U2WA 1WSUA 3GO5A 3HRSA 4LB6B 2W85A 5H6QA 3OOPA 1BI2A 1ZGAA 3HUGA 3GEZA 4EJUA 2DO7A 3GFMA 2DTRA 5AIPA 4IF4A 4KIGA 2GIVA 2EWNA 5HLIA 2L4AA 2O3FA 4L5JA 1P92A 2P7VB 3EDPA 2DQRA 4BNCA 1SAXA 4U0VA 5BS6A 1XDUA 2JPBA 3E6DA 3IKVA 2K02A 5HDGA 2IRFG 4A6EA 3O2PE 2Z33A 4R79A 3CUQA 1XB4A 3BY6A 2XRNA 2YX4A 5E1XA 1KU9A 2BGCA 3Q5FA 3ZP5A 4FT8A 5K5OA 1ZG3A 3QU3A 3KFWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX Z;  2OQR A;  1OPC A;  1AWC A;  2CWE A;  5H20 A;  1U5T A;  3BOQ A;  3R6S A;  2NNN A;  1LJ9 A;  1OYW A;  3HSR A;  1S29 A;  2WWY A;  4ESJ A;  2DPD A;  1D3Y A;  2VC1 A;  2XAS A;  1B4A A;  2L54 A;  1KQ0 A;  1WRJ A;  2IT0 A;  3BWG A;  1W7P A;  2HYG D;  2UXN A;  4Y15 A;  5LEJ A;  2A3S A;  3E6B A;  1MGT A;  2G9W A;  1QZY A;  1LDK B;  3WTY C;  2GQQ A;  4YFN F;  1XMA A;  1D8K A;  4HOB A;  4BAY A;  3B02 A;  3RKW A;  3G3Z A;  1T38 A;  3KLO A;  1JHF A;  3AAF A;  5KK1 A;  3JAM K;  2ISZ A;  1USS A;  3MWM A;  4XLN F;  3E6M A;  4MQ9 F;  1H0M A;  1WQ2 A;  4Q48 A;  5J6X A;  3FM5 A;  4CXF A;  2OD5 A;  1MZB A;  2J5O A;  3HYI A;  3F23 A;  5BMZ A;  2KIM A;  1H9G A;  2MH9 A;  3F22 A;  2XGX A;  3T0Y A;  5FB2 A;  3I59 A;  4ETS A;  2YX7 A;  5TJJ A;  2W57 A;  1SFX A;  4XSX F;  3WE3 A;  3CTA A;  2UWM A;  1T98 A;  4LLN A;  3FXR A;  4KIC A;  1IN4 A;  3BZ6 A;  3W6K B;  1I1S A;  2IA0 A;  4U0W A;  1WKM A;  2D45 A;  1IRF A;  4MNU A;  4BHC A;  3ZMS A;  1FSE A;  4LMY A;  2GA2 A;  2BEO A;  1FT9 A;  3F8N A;  3CDH A;  3MAJ A;  2QQA A;  5CVR A;  1IN5 A;  1FLI A;  3M9A A;  3K69 A;  2P5L C;  2K4B A;  1UHW A;  4LG0 B;  1KA8 A;  1SFE A;  4EGZ A;  2RNJ A;  1YW8 A;  4WK8 F;  5ILV A;  3EUH A;  4GYI A;  4BH9 A;  4EMS A;  2ETH A;  3FHZ A;  2VE8 A;  2RGV A;  1V3F A;  4I01 A;  1LNW A;  2HS5 A;  3WGH A;  3J80 K;  1R1V A;  2WC2 A;  3H3Z A;  4IVN A;  4UVA A;  1QGP A;  2LDU A;  1HKQ A;  3CO7 C;  2FBK A;  2FEZ A;  2RV8 A;  1YFH A;  3BP8 A;  1ZG1 A;  4ENN A;  1XMK A;  2HZT A;  2QQ9 A;  1LB2 A;  1SD5 A;  2ZME B;  4NQW A;  2E7X A;  1DUX C;  4A0Z A;  1RUO A;  1YLF A;  3D5L A;  1IXS B;  1OKR A;  3WOD F;  3F3X A;  4RGS A;  1HW1 A;  2L3D A;  3FM3 A;  3MFK A;  2M30 A;  2PMH A;  5HLG A;  1HSJ A;  3R61 A;  4B8X A;  4HLY A;  2BE5 F;  1BJA A;  1KU7 A;  4GCV A;  1IW7 F;  5F6F A;  1B9N A;  3IWZ A;  4CO8 A;  2ELH A;  1IZ1 A;  1G4D A;  3RKX A;  2H27 A;  2ZXJ A;  1QO0 D;  2EV0 A;  2VN2 A;  4I0B A;  2WTE A;  1YQA A;  2YU3 A;  4YFX F;  3ML6 A;  3DKW A;  4HDU A;  3T1B A;  5L3B A;  1J59 A;  1QNT A;  4M9X A;  3R0J A;  4ZH4 F;  2R7D A;  1O3S A;  1FX7 A;  4EVI A;  1G6N A;  4GGG A;  3V4G A;  3U9G A;  3F8B A;  5CJ9 A;  1ZRD A;  3GVA A;  3HHG A;  1JGS A;  2O6G E;  3DPL C;  3PQK A;  3QRF F;  1ZRE A;  4Y13 A;  4PGH A;  2BYV E;  2VT3 A;  1BM9 A;  2RQP A;  1HST A;  2EFQ A;  2QLZ A;  2IJL A;  1ZH5 A;  3WTS C;  4EJW A;  4Z2Y A;  3WU1 B;  2KKO A;  3I53 A;  4HV6 A;  4OIO F;  2G7U A;  2XAF A;  4G7O F;  2QQB A;  4EM2 A;  1TNS A;  2JPC A;  4BQA A;  4HQE A;  5K1Y A;  4O6J A;  1TQP A;  4EM1 A;  5ILS A;  3QP6 A;  3FWE A;  3ZMV A;  2V1U A;  2VON A;  2VBW A;  3J80 Z;  3WTX C;  4FX4 A;  2QUF A;  3TKY A;  2XVC A;  4G7Z F;  1FNN A;  1FY7 A;  1RUN A;  1IAW A;  2A69 F;  3ABT A;  1RNL A;  4U7B A;  3EYY A;  2M5W A;  4OIP F;  2DAO A;  2R3S A;  3CUQ B;  2FNA A;  1O3R A;  1X3U A;  3JSO A;  4I0A A;  5ICC A;  4KA4 A;  3R60 A;  4L9J A;  4UUV A;  2A5Y B;  2E7W A;  2A07 F;  3RIR A;  4RAZ A;  3FMQ A;  2P5K A;  1KU2 A;  4KT5 C;  1Q1H A;  3RKY A;  4A5M A;  1O3Q A;  2VBZ A;  2EA2 A;  2ISY A;  1TW2 A;  5LHH A;  1QPM A;  3I5U A;  5JHU A;  3LA7 A;  1GXQ A;  3KP3 A;  4GXO A;  4H0E A;  4ENJ A;  3ISP A;  1FP1 D;  4ENM A;  3GX4 X;  3FMS A;  1W7P B;  3CUO A;  4ESF A;  4G6D A;  3RPU A;  2H6C A;  3F21 A;  3GYH X;  1OYI A;  3DXJ F;  3WG9 A;  5D5W B;  2RDP A;  3RYR A;  2KJB A;  5LHI A;  3E5X A;  2UZK A;  1I5Z A;  3P9C A;  2YR2 A;  1U3E M;  1B59 A;  3V7R A;  2Y75 A;  4EV0 A;  2DI3 A;  3RJP A;  2MA3 A;  2V79 A;  4G94 A;  6PAX A;  3WGI A;  2ESH A;  3K1N A;  1I6X A;  3WTU C;  3LFK A;  1XSX A;  1D5V A;  5D8L B;  2AXL A;  4HV5 A;  1CF7 B;  1O7F A;  2Z99 A;  2P6T A;  1SMY F;  2FNP A;  2ACJ A;  2L01 A;  3LST A;  1ZG5 A;  5FO5 A;  3F8C A;  4XSZ F;  3ELK A;  1T6S A;  5D4S A;  3HRM A;  2MLG A;  3E6C C;  1W5T A;  4M73 A;  3GZ5 A;  2ZBK A;  2JSC A;  3I0T A;  1F4K A;  1ZRF A;  3GW2 A;  5BOX A;  1BC7 C;  4L9T A;  4IHS A;  3KZZ A;  2H09 A;  1B6A A;  4MEX F;  1I27 A;  2A61 A;  3P7N A;  4ZYG A;  1R00 A;  4EM0 B;  5TRD A;  4WX9 A;  5H6R A;  4U7D A;  4KUM A;  1WWX A;  4IRH A;  3C7J A;  1TNT A;  2B0L A;  4MEY F;  4ASN A;  2HYF A;  1W4M A;  4EJT A;  3O3K A;  1G3S A;  3K2Z A;  1PP8 F;  2X4H A;  4WF2 A;  1ZAO A;  5ICG A;  3QPH A;  5ICE A;  3EET A;  2CYY A;  1Z91 A;  2W84 A;  1IXR C;  1EH6 A;  2HTS A;  4LK0 F;  1YS7 A;  4DNC A;  3HSE A;  4CYD A;  4HQM A;  4N9I A;  4IJA A;  3TGN A;  2RKH A;  2H94 A;  2MLK A;  1JXS A;  4CIC A;  2K27 A;  2DK5 A;  2GAU A;  4MHG A;  4HF0 A;  3MQ0 A;  3NEU A;  5D6E A;  4A2U A;  4HW0 A;  3BJ6 A;  1FYK A;  3KP5 A;  3IL2 A;  2XAG A;  4UVB A;  1REP C;  1P2F A;  2O61 A;  3T8R A;  1ON1 A;  4HYE A;  3B73 A;  4OIR F;  2VOD A;  3GFJ A;  3LAP A;  2PBI A;  2P6S A;  2HKX A;  3ZN0 A;  1ZAR A;  3H3U A;  4KIB A;  2JTV A;  3JSP A;  3KP6 A;  2VXZ A;  5LRR A;  2EK5 A;  4XRF A;  3DP7 A;  2IW5 A;  2RVC A;  1G3W A;  3L2C A;  1KQ8 A;  3SXY A;  5D5X B;  3M8F A;  2F2E A;  4ENK A;  1RZ4 A;  4NHJ A;  5ILU A;  1FZP B;  3O6B B;  2HOE A;  1U6G A;  1ZGJ A;  4P9F A;  1FBQ A;  2VOO A;  2P5V A;  3L09 A;  4S04 A;  4M74 A;  2XKP A;  3RTR A;  5BQT A;  5KVR A;  3GXO A;  1XDS A;  4TV7 A;  1YW7 A;  4QWQ A;  3R4K A;  3KP4 A;  2OBP A;  4Q4Z F;  1CF7 A;  2MD5 A;  5L3C A;  4JK1 X;  2LNB A;  3FX3 A;  4KN4 X;  2RN7 A;  5BPI A;  2DU9 A;  4BYY A;  1KYZ A;  3MZH A;  5JI6 A;  3RI4 A;  2L02 A;  1BIB A;  2E1N A;  4NB5 A;  4UHT A;  2IVM A;  3V8K A;  4L0Y B;  3MZY A;  4M71 A;  2NRA C;  1E2X A;  4PCQ A;  2CG4 A;  4ON0 A;  5DV5 A;  4KDP A;  4WXD A;  1EV7 A;  1BI1 A;  1R7J A;  1S7O A;  3I54 A;  1R1U A;  2STW A;  3DFG A;  4HX8 A;  4RAY A;  3JTH A;  2EB7 A;  3HSF A;  5D5V B;  1XCV A;  5CVI A;  3E5U A;  3TO9 A;  4MTE A;  3BDD A;  1QZZ A;  5K5R A;  1BOA A;  2KIF A;  1H9T A;  2EFO A;  1JE8 A;  4LB5 A;  3KZY A;  1E17 A;  1DPR A;  3SQN A;  4K2E A;  5DD8 A;  1HBX G;  5L3D A;  5HDN A;  4CHU A;  2LF8 A;  3GZ6 A;  3QOP A;  1XGN A;  5HDK A;  4IHT A;  4DQ2 A;  1R1T A;  2IA1 A;  1RIO H;  2LSO A;  4HDV A;  1KYW A;  3N97 A;  2O03 A;  4A0Y A;  4A6D A;  3FMR A;  2KIU A;  3HTU A;  5E1W A;  4A0X A;  2UXX A;  5IT9 Z;  1RI7 A;  2ADU A;  5L3E A;  2FSW A;  3NQO A;  3IHU A;  4OIQ F;  3FXQ A;  3TO7 A;  1XCB A;  1J0R A;  1YO5 C;  3L00 A;  3HOS A;  4OMY A;  1MD0 A;  4P55 A;  2EFN A;  2V6C A;  5FD6 A;  5DEQ A;  3IWF A;  1P4W A;  2OQG A;  2CO5 A;  3DEU A;  4P5O A;  3FZV A;  2O0Y A;  3V8L A;  3K0L A;  3L7W A;  1OR7 A;  4UV9 A;  1LQ1 A;  3I64 A;  1ON2 A;  2VBY A;  3LA2 A;  3VB2 A;  1PDN C;  2QYO A;  4UXN A;  3T8T A;  3ZMD A;  4I02 A;  1MDM A;  2Z5U A;  3HOT A;  1J7K A;  3DV8 A;  3WE2 A;  2XAH A;  4LGW A;  1W5S A;  3OV8 A;  3TOB A;  4LFU A;  3P9K A;  4R1H A;  5JR3 A;  1XGO A;  2EV5 A;  4PZJ A;  3ZMZ A;  1K7A A;  5FD5 A;  3SZP A;  4AWX B;  1K78 B;  4IRI A;  1DDN A;  1STZ A;  3RDI A;  1MKM A;  1QBJ A;  1T39 A;  5J8F A;  1UCR A;  2QBY B;  2ZNZ A;  3FF5 A;  2W25 A;  2M45 A;  3S2W A;  3GLX A;  2P4W A;  4CGZ A;  3I71 A;  2Q8K A;  1P4A A;  3ROU A;  5F64 A;  2XRO A;  1KU3 A;  4I7H A;  1XGS A;  4L9V A;  4BHP A;  3L9F A;  2FQ3 A;  4L9N A;  5E8G A;  2FXA A;  1FP2 A;  2IPQ X;  1OYY A;  4IRG A;  1GXP A;  5EEG A;  3HTS B;  2F5C A;  3RYP A;  4P96 A;  2V1X A;  1FYM A;  4EGY A;  1Z7U A;  3QPT A;  1YIO A;  3SZT A;  5CYV A;  3J81 Z;  4EJV A;  2P8T A;  1Z6R A;  5JVT A;  1FBU A;  3KP7 A;  2VC0 A;  4ZYD A;  1GHC A;  5DCF A;  3J7A O;  5DYM A;  1IXC A;  5E17 F;  4LJZ F;  4Q47 A;  3LQQ A;  3HRT A;  5E8I A;  2LKP A;  2YSR A;  3DQV C;  3N4M A;  4PGG A;  1U8R A;  3CLO A;  1Z1D A;  3ECO A;  1BN5 A;  2PN6 A;  1FOK A;  1J2X A;  2HR3 A;  4HF2 A;  4RB3 C;  4HA8 A;  3ABU A;  5F1R A;  2EJR A;  3P9I A;  3REO A;  5LGU A;  2F5D A;  3TDZ C;  3VFZ A;  2FF4 A;  5ERI A;  1XSD A;  4KMF A;  4HBL A;  3TO6 A;  4L5I A;  5D8K B;  2FMY A;  5DCM A;  1HW2 A;  1F9N A;  3MEX A;  3ZN1 A;  1O7L A;  3COA C;  5DD4 A;  1S6L A;  3VEP A;  2EFP A;  2XAJ A;  2HWV A;  4LLG F;  4PDK A;  5E18 F;  3KEQ A;  4S05 A;  1ZRC A;  4WWC A;  2EV6 A;  3F72 A;  1TLH B;  4M6Y A;  2OA4 A;  2GWR A;  3QAH A;  1CGP A;  4N9H A;  1TQM A;  3HIF A;  1FC3 A;  2FML A;  2RC4 A;  3G73 A;  3PFI A;  4WXC A;  4U88 A;  4MQV A;  2GA1 A;  2M8E A;  2PQ8 A;  3W6J B;  5D4R A;  1K78 A;  3V7S A;  4KN7 X;  5D6F A;  1R5G A;  2QBY A;  2M1B A;  1UFM A;  2Y0M A;  2XV4 S;  5LGT A;  1MJA A;  1IUY A;  1SFU A;  3SHF A;  1R5H A;  2KJC A;  1OMI A;  1SD4 A;  4YFK F;  1FBS A;  1J9I A;  4G8X A;  2BBY A;  1IF1 A;  5A2Q Z;  2D1H A;  2GXG A;  4RB2 C;  3C18 A;  1LDD A;  2DPU A;  1Z9C A;  1BIA A;  2HTJ A;  1HXD A;  2XIG A;  1TW3 A;  2DBB A;  2CQK A;  2DK8 A;  2XAQ A;  3RPQ A;  5LLQ A;  2A6E F;  3F8M A;  3K9T A;  3ERE D;  3KLN A;  3CUQ C;  1IRG A;  1GVJ A;  2EFW A;  3LAJ A;  5HS8 A;  2F5E A;  3K1M A;  1W7P D;  4AIH A;  5J8C A;  2G7H A;  4UVC A;  2VBX A;  1HKS A;  3BPX A;  4M9Z A;  1UHM A;  1PUE E;  2QEN A;  1J5Y A;  3LA3 A;  5E1Z B;  1L0O C;  5K5Q A;  4R8H A;  3NRV A;  1P6R A;  1U5T C;  3C1D A;  1QQI A;  3HRU A;  5FFZ A;  1I1G A;  4LD5 A;  1LDJ A;  3E97 A;  3MCZ A;  3H92 A;  4MGR A;  1NHA A;  2YPR A;  4LLL A;  1MDM B;  3WTV C;  2IA2 A;  3EQL F;  1R22 A;  5IT9 K;  5L3F A;  4N0B A;  4UV8 A;  5FFX A;  3CO6 C;  4I98 B;  1S8N A;  2CGP A;  1HW5 A;  4M9S A;  3V8J A;  1BI3 A;  4EJO A;  3K1P A;  2ZNY A;  2OU2 A;  2JZY A;  2R7F A;  4D0P A;  4RB1 A;  3GWZ A;  4YII A;  2J5P A;  3WTW C;  1J75 A;  4Q5S F;  4G6Q A;  5E20 A;  3HHH A;  2CFX A;  3C3W A;  3KE2 A;  1JHH A;  5CLS A;  5FGM A;  3TOA A;  2HDC A;  4UNO A;  3JW4 A;  2OZ6 A;  3BJO A;  4A12 A;  1ZN2 A;  2VE9 A;  2MC3 A;  3PQJ A;  2GXB A;  2FE3 A;  4KNY A;  1FPQ A;  4JBA A;  2QVO A;  4E70 A;  2E1C A;  2FBH A;  2W24 A;  2CW0 F;  2ZFW A;  3Q9S A;  5LGN A;  1ODD A;  2XKO A;  3WU0 A;  4P9U A;  2NNY A;  1KGS A;  1HQC A;  4Y17 A;  4I09 A;  1P4X A;  4KFC A;  1AOY A;  3M1E A;  4IPA A;  5L3G A;  3DPT A;  2H6B A;  2K4J A;  3GF2 A;  1B1B A;  1T2K A;  1MJB A;  2MH2 A;  2NAZ A;  1LEA A;  3CJN A;  2FU4 A;  1C0W A;  1K6O A;  5HVQ C;  1FSH A;  3BRO A;  2NS0 A;  1LVA A;  1UST A;  2Q2E A;  3M7G A;  3WTZ A;  2A68 F;  4KYW A;  1O3T A;  4O3M A;  2L4M A;  1ZHF A;  2DFI A;  5HS7 A;  5ED4 A;  4RGU A;  3WGG A;  1L3L A;  2V9V A;  3J81 K;  1G3T A;  3I4P A;  2PI0 A;  3M8E A;  4WCG A;  1R23 A;  3V7C A;  2QWW A;  5DCM B;  3U2R A;  3R0A A;  2VT2 A;  3T5X A;  2Z9O A;  4OU0 A;  4JQF A;  3JAM Z;  5CVU A;  1ULY A;  4OMZ A;  4U0Y A;  4FHT A;  4AIK A;  4L0Z B;  2D1V A;  4BHB A;  1DPU A;  4ZYH A;  3BJA A;  3EYI A;  1IN6 A;  3ULQ B;  2PFB A;  4BXU A;  1V4R A;  1SMT A;  1YG2 A;  5CVJ A;  1YTY A;  4HF1 A;  4GYG A;  3ZPL A;  3GFL A;  3GUD A;  4XLP F;  5D5U B;  1F1Z A;  3IKT A;  4M72 A;  4KMU X;  4G9Y A;  1ZYR F;  4A5N A;  2MBF A;  1XD7 A;  1YYV A;  5ICF A;  2STT A;  2LF7 A;  2HGC A;  5CVV A;  3E5Q A;  4B09 A;  2P7C B;  2QZ8 A;  4LK1 F;  1EH7 A;  4ZYE A;  4HX4 A;  3KP2 A;  2FRH A;  1VTN C;  2KRF A;  1UB9 A;  3LQR A;  3VOD A;  4ZZD A;  2FA5 A;  2X0L A;  1XGM A;  4G7H F;  2PLY A;  5AIQ A;  3KEO A;  3D0S A;  3Q9V A;  2V1D A;  1HKT A;  5HLH A;  1TQI A;  4ESB A;  3F6O A;  5JFR A;  3ZQ7 A;  1Z6T A;  1BI0 A;  2DQL A;  4CDG A;  2A6H F;  2DLL A;  3WTT C;  4FX0 A;  2D2W A;  1KQ9 A;  5DDG A;  1O57 A;  2VOP A;  2JT1 A;  2C6Y A;  2PJP A;  2K86 A;  5HOO A;  2XHK A;  1R36 A;  1LEB A;  3KCC A;  1G3Y A;  2O8X A;  4RGX A;  1TTY A;  2PG4 A;  1WI9 A;  2M87 A;  2OZU A;  2DW4 A;  2XUB A;  1FYL A;  2Z3Y A;  2TDX A;  2DT5 A;  1T0F A;  2QM3 A;  4HAM A;  2PMU A;  2ZCW A;  2ESN A;  1K79 A;  4LG0 A;  2PEX A;  2HQN A;  1Y0U A;  4RGR A;  4HZF A;  4WXH A;  2HFH A;  1ZLJ A;  4AVP A;  1U5T B;  4OOI A;  1F5T A;  1D8J A;  2Y48 A;  2K7L A;  3F6V A;  5LHG A;  5A2Q K;  3FXU A;  5LBQ A;  2ZKZ A;  5HS9 A;  3DF8 A;  1IN8 A;  3E3V A;  3QP5 A;  3TDU C;  1S7A A;  3F8F A;  1MJ9 A;  4HLX A;  2ZJ2 A;  1DP7 P;  4OIN F;  3GFI A;  1SD7 A;  3ZMU A;  4O5V A;  2ZME A;  5BPD A;  1ONV A;  1A04 A;  2F5F A;  1YW9 A;  4AIJ A;  4M6X A;  4RB0 A;  4KIF A;  1FWZ A;  1BBY A;  2ZO4 A;  1TBX A;  5EEH A;  1IN7 A;  4L18 B;  1B9M A;  3LWF A;  1R58 A;  4GO1 A;  2FBI A;  5FLX K;  5LEK A;  2HKO A;  4AD9 A;  4MTD A;  3U1D A;  2JRT A;  3IRR A;  5AON A;  3KET A;  2EA4 A;  4QLC U;  2GZW A;  4EQQ A;  4I2O A;  1S3J A;  4XBF A;  5DUK A;  2FOK A;  4F7Z A;  3IRQ A;  4YIF A;  4YG2 F;  5DUI A;  1BC8 C;  5LRS A;  3I59 B;  3I58 A;  4RS8 A;  3JTG A;  4HX7 A;  3SFZ A;  1XN7 A;  3VOE A;  3TQN A;  2NYX A;  3ECH A;  3ZMT A;  3IC7 A;  2IP2 A;  1YS6 A;  2Q0O A;  4IXA A;  4CZZ A;  2AS5 F;  3BPV A;  2HQR A;  4ZZL A;  1ZLK A;  1EH8 A;  2WV0 A;  1XSV A;  5IT3 A;  2HEO A;  1PP7 U;  2COM A;  1U78 A;  2OAZ A;  1Z05 A;  1SD6 A;  2BV6 A;  2CSO A;  3QU6 A;  1U2W A;  1WSU A;  3GO5 A;  3HRS A;  4LB6 B;  2W85 A;  5H6Q A;  3OOP A;  1BI2 A;  1ZGA A;  3HUG A;  3GEZ A;  4EJU A;  2DO7 A;  3GFM A;  2DTR A;  5AIP A;  4IF4 A;  4KIG A;  2GIV A;  2EWN A;  5HLI A;  2L4A A;  2O3F A;  4L5J A;  1P92 A;  2P7V B;  3EDP A;  2DQR A;  4BNC A;  1SAX A;  4U0V A;  5BS6 A;  1XDU A;  2JPB A;  3E6D A;  3IKV A;  2K02 A;  5HDG A;  2IRF G;  4A6E A;  3O2P E;  2Z33 A;  4R79 A;  3CUQ A;  1XB4 A;  3BY6 A;  2XRN A;  2YX4 A;  5E1X A;  1KU9 A;  2BGC A;  3Q5F A;  3ZP5 A;  4FT8 A;  5K5O A;  1ZG3 A;  3QU3 A;  3KFW X; 
#chains in the Genus database with same CATH topology
 5FLX Z;  3K7A J;  3K4C A;  4A93 J;  1LKX A;  2OQR A;  1OPC A;  1W36 D;  1PYV A;  3OYK A;  1XX5 A;  1AWC A;  2CWE A;  5H20 A;  1U5T A;  3BOQ A;  3GCM A;  3R6S A;  2NNN A;  1LJ9 A;  4UUS B;  1OYW A;  3HSR A;  3HOX J;  1S29 A;  2WWY A;  5C4X J;  3PNY A;  4ESJ A;  3LSG A;  3OIO A;  5BNG A;  3PSF A;  3M4O J;  3G1L A;  4A3L J;  2DPD A;  1D3Y A;  2VC1 A;  2XAS A;  1B4A A;  1JGG A;  2L54 A;  2E2J J;  4RM2 A;  1VQ5 I;  3OMY A;  3JCU C;  1KQ0 A;  1RC9 A;  3BG6 A;  1WRJ A;  5JLW A;  2IT0 A;  3BWG A;  1W7P A;  2HYG D;  2BHY A;  2UXN A;  2EPF A;  4Y15 A;  1HLV A;  3HG9 A;  5B5E C;  2F5V A;  3Q0V A;  5LEJ A;  2A3S A;  3E6B A;  1MGT A;  2G9W A;  1QZY A;  1LDK B;  3WTY C;  3CCR I;  1Y8R B;  3PIP F;  2E5Z A;  2GQQ A;  1VQ7 I;  4YFN F;  1XMA A;  1D8K A;  2XPU A;  2L7Z A;  2NS8 A;  4HOB A;  3MD2 A;  4BAY A;  3B02 A;  3RKW A;  2WB1 A;  3G3Z A;  1T38 A;  5FLV A;  3KLO A;  1JHF A;  3H0G J;  2VJI A;  5KK1 A;  3AAF A;  5DTD A;  3JAM K;  2ISZ A;  1USS A;  2JRM A;  2UUZ A;  2R7S A;  3MWM A;  3FIW A;  2QEX I;  2CW7 A;  4XLN F;  3E6M A;  4MQ9 F;  4BE1 A;  1QRY A;  1IJW C;  5EYR A;  1V54 H;  2AQF A;  1H0M A;  2R7X A;  1WQ2 A;  1HF0 A;  4Q48 A;  5J6X A;  3FM5 A;  4CXF A;  2HVR A;  3FXM A;  2GBY A;  2OD5 A;  4QPO A;  3RZD J;  4BXF A;  2DFH A;  1MZB A;  2J5O A;  3HYI A;  3F23 A;  3QYB A;  5BMZ A;  4XLA A;  3JRB A;  2KIM A;  1H9G A;  3K4N A;  1YIJ I;  2MH9 A;  3F22 A;  4AID A;  2XGX A;  3T0Y A;  3M1C A;  3ESW B;  5FB2 A;  3I59 A;  2LC2 A;  4ETS A;  4BU2 A;  4ANJ A;  2YX7 A;  5TJJ A;  1EF4 A;  4MO7 A;  2W57 A;  2E35 A;  3CJQ B;  3HC7 A;  1SFX A;  4XSX F;  3WE3 A;  2E19 A;  3CTA A;  2Y9Z A;  4X1E A;  2NVX J;  4HNV A;  1PUF B;  2UWM A;  1T98 A;  4LLN A;  2UV1 A;  3OYJ A;  1Z77 A;  3FXR A;  4KIC A;  5FRM A;  1IN4 A;  5GAG J;  3BZ6 A;  2LD5 A;  4AYB N;  1FEX A;  3W6K B;  3OYA A;  1I1S A;  2IA0 A;  4U0W A;  2VB6 A;  1WKM A;  1R49 A;  5GP9 A;  1RKT A;  3CCE I;  1Y8Q B;  2D45 A;  1UJ8 A;  3GZN B;  1IRF A;  4MNU A;  5FKO A;  2DJN A;  4BHC A;  3ZMS A;  3SDB A;  1FSE A;  4LMY A;  1S9H A;  2DT7 B;  2GA2 A;  3CQZ J;  2BEO A;  1X3Z B;  1Z7L A;  1FT9 A;  3F8N A;  9ANT A;  3CDH A;  3W3C A;  3MAJ A;  4AUX A;  2QQA A;  3FIS A;  1IN5 A;  5CVR A;  1FLI A;  3LSJ A;  4XNF A;  3TMO A;  1WJC A;  3M9A A;  3K69 A;  2P5L C;  2K4B A;  1UHW A;  4LG0 B;  1OFC X;  3TW7 A;  2F6C A;  1WH5 A;  1KA8 A;  1SFE A;  4EGZ A;  2RNJ A;  1YW8 A;  4WK8 F;  5ILV A;  3EUH A;  4L5E A;  4GYI A;  4BH9 A;  4EMS A;  2ETH A;  3FHZ A;  2VE8 A;  2IS6 A;  1X1A A;  1KON A;  2RGV A;  4PSW A;  1W1W E;  3G1M A;  1V3F A;  3K2A A;  5E3L A;  3CC4 I;  4I01 A;  2XPV A;  1LNW A;  2HS5 A;  3WGH A;  3QYF A;  3J80 K;  1WJE A;  1R1V A;  4XOR A;  2WC2 A;  4FAS D;  3S1R J;  3H3Z A;  1WJA A;  4IVN A;  4UVA A;  1QGP A;  4FTH A;  2LDU A;  1HKQ A;  3K4M A;  1LUJ B;  4XLC A;  3CO7 C;  2FBK A;  2FEZ A;  2RV8 A;  3J7Y J;  1YFH A;  2DYS H;  3BP8 A;  5B1B H;  1ETQ A;  1ZG1 A;  4ENN A;  1YE9 A;  1XMK A;  2HZT A;  2QQ9 A;  5B66 C;  1LB2 A;  1SD5 A;  1VZ0 A;  1RKW A;  4JX5 A;  2ZME B;  3K70 D;  4NQW A;  2E7X A;  2LOO A;  1DUX C;  4A0Z A;  4UY8 I;  3S1M J;  3VYR B;  1RUO A;  2R7U A;  1YLF A;  3D5L A;  1OCP A;  1IXS B;  1OKR A;  4BEH B;  2ZJQ F;  3LOC A;  3F3X A;  3WOD F;  3C2B A;  4RGS A;  3U1K A;  1HW1 A;  2L3D A;  1IV6 A;  3FM3 A;  3MFK A;  3CME I;  2M30 A;  2PMH A;  5HLG A;  1HSJ A;  3R61 A;  4B8X A;  3BCB A;  2BE5 F;  4HLY A;  2BW3 B;  2MSY A;  1BJA A;  2V26 A;  4D5C A;  1KU7 A;  4CCK A;  3E0J B;  4BS9 A;  1X1D A;  3UNG C;  4DYR A;  4GCV A;  3OWT A;  1IW7 F;  4AYB A;  3S8P A;  2DA2 A;  3KPH A;  5F6F A;  1WPK A;  2DFE A;  1B9N A;  1I39 A;  1W5C C;  2WAF A;  3IWZ A;  4CO8 A;  2ELH A;  1IZ1 A;  1G4D A;  3GBG A;  1OR7 C;  2O8K A;  3OOU A;  1WJF A;  3FKJ A;  1G8X A;  3RKX A;  2H27 A;  4P1W A;  2ZXJ A;  2VL8 A;  1QO0 D;  5GTI C;  2EV0 A;  3Q0W A;  4M3B A;  3PM1 A;  3SEZ A;  2VN2 A;  4I0B A;  2IAI A;  1BL0 A;  2WTE A;  1YQA A;  2YU3 A;  4YFX F;  1EJ9 A;  3M3Y J;  5HOD A;  1ETY A;  1X3W B;  3ML6 A;  3L2Q A;  3DKW A;  4DBR A;  4BY1 J;  4HDU A;  3T1B A;  5L3B A;  1J59 A;  1QNT A;  4M9X A;  2LBF B;  2NXN B;  3R0J A;  2R7D A;  4ZH4 F;  1O3S A;  4UUT A;  1FX7 A;  4EVI A;  1G6N A;  2VKE A;  3BC8 A;  2BOL A;  4GGG A;  3PUB A;  1FJL A;  3V4G A;  3U9G A;  3F8B A;  5CJ9 A;  1ZRD A;  4XRS A;  4N4N B;  5IP9 J;  3GVA A;  3AFH A;  3HHG A;  2R7Q A;  1JGS A;  2Y69 H;  3DPL C;  2O6G E;  4BGD A;  3CCS I;  3PQK A;  3QRF F;  3I55 I;  3WHC A;  1ZRE A;  2R5Y B;  4JP0 A;  4Y13 A;  4PGH A;  2EIK H;  2BYV E;  1TP4 A;  2VT3 A;  1BM9 A;  2L5Q A;  2RQP A;  1OIS A;  1HST A;  2EFQ A;  2KPM A;  2QLZ A;  2IJL A;  2R7O A;  4PJ0 C;  1ZH5 A;  3GTO J;  3DU5 A;  3WTS C;  1Y56 A;  4EJW A;  1RET A;  3AL0 B;  2X51 A;  4Z2Y A;  3WU1 B;  2KKO A;  3I53 A;  3JR9 A;  2D5V A;  4IOC F;  4HV6 A;  2EBI A;  4OIO F;  1QVU A;  2G7U A;  4FE4 A;  4YRV A;  1Y1W J;  2XAF A;  4G7O F;  2QQB A;  4XR6 A;  4EM2 A;  1Q1V A;  4E7L A;  4BXX J;  1TNS A;  2JVG A;  2JPC A;  4HPQ A;  1QA6 A;  4BQA A;  4HQE A;  4O6J A;  4DZP A;  1TQP A;  3K4K A;  5K1Y A;  4EM1 A;  5ILS A;  3QP6 A;  3K6G A;  1BR4 A;  3FWE A;  3ZMV A;  2V1U A;  4ZDL A;  2VON A;  2VBW A;  3J80 Z;  4QTR A;  1JKP C;  3LSH A;  3WTX C;  4FX4 A;  4NNJ A;  2QUF A;  1PUF A;  3TKY A;  4CYC A;  2XVC A;  2OPT A;  4PJJ A;  4G7Z F;  1FNN A;  5FLM J;  1FY7 A;  2IBD A;  4DIQ A;  2K9Q A;  1H89 C;  1RUN A;  2DCE A;  4XKB A;  3O8H A;  1IAW A;  4BJ5 C;  1LFB A;  2A69 F;  3ABT A;  2Y31 A;  3CMA I;  1RNL A;  3ABK H;  4U7B A;  1Z0X A;  3EYY A;  5EGO B;  1YJN I;  2M5W A;  4OIP F;  2DAO A;  1DQU A;  1BW6 A;  2R3S A;  2LMD A;  3CUQ B;  2FNA A;  4H4K C;  2VQL A;  2QSG X;  1O3R A;  1X3U A;  2XC7 A;  3JSO A;  4XKV A;  3OYH A;  3OYD A;  1MMS A;  4BDZ A;  4I0A A;  2E1O A;  1VFC A;  2X1D A;  4DGW B;  4FQG A;  5ICC A;  4KA4 A;  2XB5 A;  3H5R A;  3R60 A;  4L9J A;  4C3H J;  4PFP A;  3OYF A;  4UUV A;  2A5Y B;  2E7W A;  4NBQ A;  1QZE A;  2A07 F;  2JVH A;  4M3F A;  2WY8 Q;  3RIR A;  3ZQF A;  4RAZ A;  3OS1 A;  3RKQ A;  2OTJ I;  4F55 A;  3FMQ A;  3CCJ I;  1NK2 P;  2P5K A;  3IUO A;  1KU2 A;  4KT5 C;  1Q1H A;  3A01 A;  3SZG A;  3RKY A;  4A5M A;  1O3Q A;  2GXA A;  1X1C A;  2VBZ A;  2EA2 A;  1MMA A;  5M5X J;  1IDZ A;  5F1J A;  2ISY A;  1TW2 A;  5LHH A;  1QPM A;  4RA2 A;  2ME6 A;  3A4C A;  3I5U A;  5JHU A;  3LA7 A;  1GXQ A;  3KP3 A;  3CF5 F;  4RLQ A;  4GXO A;  4H0E A;  4ENJ A;  2DMU A;  3B6C A;  3ISP A;  2BVL A;  4BBS J;  1FP1 D;  4ENM A;  3GX4 X;  3FMS A;  4B4C A;  1W7P B;  3CUO A;  4ESF A;  3VWB A;  4G6D A;  1I6H J;  3RPU A;  2H6C A;  4BKX A;  3F21 A;  3GYH X;  4C2M J;  3DCF A;  4MFD A;  1OYI A;  3DXJ F;  4G6T B;  3WG9 A;  5D5W B;  2RDP A;  1T08 B;  2OF7 A;  2P0W A;  3RYR A;  4D7M A;  2HVS A;  4NC7 A;  2KJB A;  5LHI A;  3E5X A;  5GAD J;  2UZK A;  3G71 I;  1GT0 C;  1E3P A;  2CRG A;  1I5Z A;  3P9C A;  2JA5 J;  2YR2 A;  4BEH A;  1U3E M;  2X85 A;  2PJR B;  2KLO A;  1B59 A;  3V7R A;  2Y75 A;  4C9Y A;  2FD5 A;  3JRF A;  4EV0 A;  2CQ7 A;  2DI3 A;  2IS4 A;  2KZG A;  3RJP A;  5J4Y A;  4XRM A;  2MA3 A;  2V79 A;  4G94 A;  2WAQ A;  4FCY A;  6PAX A;  3WGI A;  2ESH A;  2LH9 A;  3NAU A;  3I4M J;  3K1N A;  1I6X A;  4YEJ A;  2Z16 A;  3PL8 A;  3WTU C;  3LFK A;  4XOT A;  5CQE A;  4HRI A;  1XSX A;  4BQN A;  4F3Q A;  1D5V A;  5D8L B;  3FXL A;  2AXL A;  3MN2 A;  3BTL A;  4HV5 A;  2V9P A;  1XMX A;  1CF7 B;  1O7F A;  2Z99 A;  2P6T A;  3L2R A;  1Z3X A;  1X58 A;  1WJ5 A;  1SMY F;  3OYN A;  2FNP A;  2ACJ A;  2L01 A;  3LST A;  1ZG5 A;  3IAS 2;  5FO5 A;  2IGM A;  2R7T A;  3F8C A;  2AHQ A;  3ELK A;  4XSZ F;  3H9J A;  1T6S A;  2L2O A;  1ERD A;  5D4S A;  2HVQ A;  2R0Q C;  4OAY A;  1W0T A;  2DA7 A;  4QIW N;  3CJT B;  5DS9 A;  2LK2 A;  3HRM A;  2MLG A;  2LBF A;  3E6C C;  2XF5 A;  1W5T A;  2LY2 A;  1EA3 A;  2O5R A;  4M73 A;  3GZ5 A;  2ZBK A;  3W2A A;  2JSC A;  3I0T A;  4JX6 A;  3FXJ A;  1VQ9 I;  1F4K A;  1ZRF A;  3GW2 A;  1AU7 A;  2W4S A;  3LSP A;  5BOX A;  4AU7 A;  1BC7 C;  2K9S A;  4CSW A;  2COB A;  3I3L A;  4L9T A;  4IHS A;  2R5Y A;  3FDY A;  3OYC A;  3KZZ A;  2H09 A;  1B6A A;  4MEX F;  3ASO H;  1I27 A;  2A61 A;  3K10 A;  3P7N A;  2L7F P;  1OCC H;  1R00 A;  2LLK A;  3D5S C;  3E1S A;  4EM0 B;  4ZYG A;  4WX9 A;  5TRD A;  2KQR A;  5H6R A;  5J1U A;  4U7D A;  1ZQ3 P;  4KUM A;  1LFP A;  1WWX A;  4IRH A;  5J4V A;  1VF9 A;  3C7J A;  2DJI A;  2DOE A;  1TNT A;  1U0J A;  2B0L A;  1FOX A;  4MEY F;  4KT6 A;  4ASN A;  2HYF A;  1W4M A;  4BQO A;  4Y4R A;  2M2E A;  3BR2 A;  3IH4 A;  4EJT A;  3O3K A;  1G3S A;  2FQ4 A;  4IQ4 A;  3K2Z A;  2K40 A;  1PP8 F;  2QCO A;  2X4H A;  4WF2 A;  1ZAO A;  2X9D A;  3QQA A;  5ICG A;  1WHU A;  2ID3 A;  3QPH A;  3UR3 C;  5ICE A;  2YUS A;  2DOF A;  5F0F A;  3S16 J;  3EET A;  1TT5 B;  2CYY A;  1Z91 A;  2TRT A;  3RCO A;  3HDD A;  2W84 A;  3RQ4 A;  3JRI A;  1IXR C;  2DOA A;  1EH6 A;  2HTS A;  1BR1 A;  1YS7 A;  4LK0 F;  2M34 A;  4DNC A;  2KRC A;  3EUK L;  3HBL A;  1KZH A;  3HSE A;  4CYD A;  4HQM A;  4N9I A;  2ECC A;  1K83 J;  5E3N A;  4IJA A;  5IYC J;  3TGN A;  5K7Z A;  4E7H A;  2RKH A;  2H94 A;  3S17 J;  3FK7 A;  2MLK A;  3ZQI A;  3I56 I;  2QSH X;  1WJB A;  1JXS A;  4DZJ A;  4CIC A;  5EJC A;  2K27 A;  2DK5 A;  3KYC B;  2GAU A;  4MHG A;  4HF0 A;  3MQ0 A;  3NEU A;  5D6E A;  5JLX A;  1MNM C;  2DYR H;  4A2U A;  4HW0 A;  2L7K A;  2JSP A;  5F0H A;  3BJ6 A;  1FYK A;  3KP5 A;  3IL2 A;  3ONQ A;  2XAG A;  1FTZ A;  4PJM A;  2M7B A;  4UVB A;  1P2F A;  1REP C;  2QSF X;  3GTM J;  2K3P A;  2ZFU A;  3DPU A;  2O61 A;  1EKE A;  3GLL A;  3T8R A;  2K3F A;  1ON1 A;  2M4K A;  4HYE A;  3B73 A;  4OIR F;  4GDF A;  2VOD A;  3GTL J;  3HOU J;  3C2G A;  3GFJ A;  3LAP A;  1YRN B;  4M3E A;  4A3B J;  4E7K A;  2PBI A;  2P6S A;  3OYI A;  4RMN A;  2HOS A;  2HQ5 A;  3FHN A;  3OL3 A;  3H1C A;  2HKX A;  5J1Y A;  1VND A;  3Q3S A;  2WA0 A;  4I99 C;  3ZN0 A;  3W2V A;  1ZAR A;  1MMG A;  2RQQ A;  3H3U A;  4KIB A;  2JTV A;  3JSP A;  4CZC A;  3KP6 A;  2VXZ A;  5FRN A;  3CC7 I;  3CCL I;  5LRR A;  2EK5 A;  4XRF A;  3ABM H;  3DP7 A;  5EG0 A;  1YX5 A;  1DP3 A;  3HGG A;  2IW5 A;  1OCR H;  2MW8 A;  3OYL A;  2RVC A;  1FMW A;  3DTI A;  1G3W A;  1Z67 A;  2XF6 A;  2HDD A;  3L2C A;  1YJW I;  1KQ8 A;  3SXY A;  1MND A;  5D5X B;  3MKL A;  4MFE A;  2R92 J;  3CLQ A;  3BQZ A;  1FIP A;  2A6T A;  2PX9 A;  3M8F A;  2F2E A;  4ENK A;  2IS1 A;  1UEL B;  4J19 A;  1RZ4 A;  1UG0 A;  2DT6 A;  5E3M A;  1W36 C;  1S5L C;  2PJR A;  1D1B A;  4NHJ A;  3OS2 A;  4YEL A;  2H1L A;  4BDY A;  5ILU A;  3IH2 A;  1FZP B;  1P7J A;  2QQ8 A;  3O6B B;  2HOE A;  5KAF C;  1V5F A;  3HOY J;  1U6G A;  2JA6 J;  2X6O A;  1ZGJ A;  4P9F A;  1FBQ A;  1MSF C;  1TT0 A;  2VOO A;  3BTJ A;  3PIO F;  2P5V A;  3L09 A;  2WV1 A;  4S04 A;  4M74 A;  2ZXH A;  2XKP A;  3RTR A;  1F43 A;  2CH0 A;  5BQT A;  2XDV A;  5KVR A;  1WH7 A;  3GXO A;  1XDS A;  4TV7 A;  5DM7 F;  2CV1 A;  1YW7 A;  4QWQ A;  3R4K A;  3KP4 A;  2OBP A;  5H2F C;  4Q4Z F;  1CF7 A;  2MD5 A;  3VSK A;  4HNT A;  3KX2 A;  2R7Z J;  5L3C A;  4JK1 X;  2LNB A;  3FX3 A;  5GAE J;  4KN4 X;  5FKN A;  3JRH A;  2RN7 A;  5BPI A;  2V1N A;  2HDW A;  5C3E J;  2DU9 A;  4BYY A;  3CCQ I;  2E1M C;  1KYZ A;  1Y1V J;  3MZH A;  3CES A;  5JI6 A;  3CMY A;  5FJ8 J;  2Y30 A;  2R7V A;  2VQC A;  3PUF A;  2ZC2 A;  3HJE A;  3RI4 A;  1DU0 A;  3ZR8 X;  2L02 A;  1BIB A;  2E1N A;  4NB5 A;  5DM6 F;  4UHT A;  2IVM A;  3V8K A;  4A69 C;  4CYC B;  2QKL B;  4L0Y B;  2XGD A;  3MZY A;  4M71 A;  4FET A;  1R71 A;  2NRA C;  1YIT I;  1WGX A;  1E2X A;  2L9S A;  4PCQ A;  2CG4 A;  4ON0 A;  5DV5 A;  4KDP A;  4WXD A;  1JTX A;  1EV7 A;  2E34 A;  1UMQ A;  2DOD A;  1BI1 A;  1FOW A;  2N8G A;  3BT9 A;  1R7J A;  1S7O A;  3I54 A;  1XPX A;  1A6Q A;  2L0K A;  1R1U A;  2KRH A;  2NOJ B;  2OUM A;  3DFG A;  2M8G X;  2STW A;  4Y7N J;  4HX8 A;  1ITY A;  4RAY A;  3JTH A;  2EB7 A;  1TL8 A;  3HSF A;  1XS9 A;  5D5V B;  1XCV A;  5CVI A;  3E5U A;  3HKZ A;  4MTE A;  3TO9 A;  3BDD A;  2LKX A;  3H35 A;  1QZZ A;  2DA1 A;  5K5R A;  1BOA A;  1P9Q C;  2KIF A;  1H9T A;  2VUM J;  1AA7 A;  2EFO A;  1JE8 A;  5IY5 H;  2HOT A;  4LB5 A;  3KZY A;  1E17 A;  3BQY A;  2ZXI A;  1DPR A;  5CQG A;  4K2E A;  3SQN A;  1AKH A;  5DD8 A;  1HBX G;  1BA5 A;  5L3D A;  5HDN A;  2Y2Z A;  3A1Y A;  1Z3Y A;  3A01 B;  4CHU A;  2LF8 A;  3GZ6 A;  3QOP A;  4HSR A;  3CJR B;  5JHF A;  1XGN A;  2V6E A;  2E5N A;  2I10 A;  2FJ1 A;  5HDK A;  4IHT A;  3BR1 A;  4DQ2 A;  1R1T A;  2IA1 A;  1RIO H;  1XC5 A;  4NDL A;  3D5R C;  2LP0 A;  5KHD A;  4ZTJ A;  2R7R A;  2LSO A;  2HQA A;  2CFO A;  1JKO C;  4PSX A;  4IO9 F;  4HDV A;  3OSG A;  1KYW A;  1X2N A;  2KIS A;  3BTI A;  3N97 A;  2O03 A;  4A0Y A;  3FXK A;  1K6Y A;  1JKQ C;  4A6D A;  3FMR A;  2KIU A;  3HTU A;  3SJM A;  4A3E J;  5E1W A;  4A0X A;  2UXX A;  1RPW A;  2K9M A;  5IT9 Z;  1RI7 A;  2ADU A;  5EZH A;  2FSW A;  5FKM A;  5L3E A;  3NQO A;  3IHU A;  4OIQ F;  3FXQ A;  2HXI A;  2E2H J;  2KIQ A;  1SEU A;  2M0C A;  3TO7 A;  1XCB A;  1J0R A;  1YO5 C;  4KIT B;  1IUF A;  1WVR A;  3RQI A;  3L00 A;  1HA8 A;  3HOS A;  4OMY A;  1MD0 A;  3AG1 H;  4P55 A;  2EFN A;  2V6C A;  4B47 A;  3DKY A;  5FD6 A;  5DEQ A;  3IWF A;  1P4W A;  2JUG A;  4CH7 A;  1A5J A;  3BCA A;  2OQG A;  3A0B C;  2CQQ A;  2CO5 A;  3QPS A;  1YRN A;  3DEU A;  3WHB A;  4P5O A;  2XGE A;  3MKZ A;  3I4N J;  3ZQH A;  1WJD A;  3FZV A;  2O0Y A;  3V8L A;  4D1Q A;  2HPM A;  2MGQ A;  3MMY B;  4V19 K;  3K0L A;  3L7W A;  1OR7 A;  2CV2 A;  4UV9 A;  4FE7 A;  1LQ1 A;  3I64 A;  4F52 A;  2IGN A;  1MH4 A;  1ON2 A;  2OV7 A;  2VBY A;  3LA2 A;  4JYK A;  3VB2 A;  3HM5 A;  1PDN C;  3K70 C;  3CD6 I;  3TP0 A;  2QYO A;  3DEE A;  1BR2 A;  4UXN A;  4RAG A;  3DLA A;  3LMM A;  2LR8 A;  4XOP A;  2JUC A;  1V5G A;  3T8T A;  2LY9 A;  1VQL I;  2OTL I;  1JTY A;  3EUA A;  3ZMD A;  4I02 A;  3HXL A;  1MIJ A;  5J47 A;  1MDM A;  2Z5U A;  3HOT A;  5KAI C;  1J7K A;  3DV8 A;  3OS0 A;  4XLF A;  2DDB A;  3WE2 A;  2XAH A;  4LGW A;  1ETO A;  1W5S A;  3OV8 A;  3TOB A;  3GTG J;  4LFU A;  3P9K A;  2X1C A;  1VQ6 I;  5IOZ A;  4R1H A;  4IQJ A;  3ZCO A;  5JR3 A;  2W48 A;  1XGO A;  2EV5 A;  2GIZ A;  4PZJ A;  2VLA A;  3ZMZ A;  1K7A A;  5J1R A;  1TC3 C;  2A05 A;  1J09 A;  4G12 A;  4PFO A;  5FD5 A;  3SZP A;  4AWX B;  4XQF A;  1K78 B;  3HL2 A;  4IRI A;  1DDN A;  1STZ A;  1IC8 A;  3RDI A;  1MKM A;  1QBJ A;  1T39 A;  5J8F A;  1VQN I;  2FX0 A;  1UCR A;  4NC8 A;  1ZTR A;  2M7A A;  2QBY B;  1MSE C;  2ZNZ A;  1H88 C;  3FF5 A;  1RR8 C;  2W25 A;  2M45 A;  3S2W A;  3TL4 X;  1YJ9 I;  3GLX A;  4BJ6 C;  2P4W A;  4CGZ A;  3BLY A;  2GLO A;  3I71 A;  3AG2 H;  4LIU A;  2Q8K A;  1P4A A;  3ROU A;  3QOE A;  2VIX A;  5F64 A;  2XRO A;  1KU3 A;  4I7H A;  1JJ6 C;  1XGS A;  4L9V A;  3HB9 A;  2CV0 A;  2WAQ N;  3J7A Y;  3BR6 A;  2VXD A;  4BHP A;  4CCM A;  5IPA A;  2XPW A;  2VQH A;  1SAU A;  3L9F A;  2FQ3 A;  3BG5 A;  2GM4 A;  1HOM A;  2Y0S A;  4L9N A;  2VQG A;  5E8G A;  2CUJ A;  1OQY A;  2FXA A;  3CZ6 A;  1FP2 A;  2H1K A;  2IPQ X;  1OYY A;  2DN0 A;  4IRG A;  1GXP A;  5EEG A;  5F0C A;  4IKF A;  3S1Q J;  3HTS B;  4DYC A;  2F5C A;  3ZOB A;  2O7O A;  1Y0N A;  3RYP A;  4P96 A;  2V1X A;  3SFI A;  1ZR2 A;  1MMN A;  1FYM A;  1R4N B;  3PJR A;  1UZC A;  4EGY A;  1Z7U A;  1K61 A;  3QPT A;  1YIO A;  1UG2 A;  3SZT A;  5CYV A;  2ZJP F;  3J81 Z;  2LTP A;  4B1R A;  2K9L A;  3G2B A;  4EJV A;  1A35 A;  1BJZ A;  2P8T A;  1QU3 A;  1Z6R A;  5JVT A;  1FBU A;  3KP7 A;  3CCM I;  2VPR A;  1JUP A;  2VC0 A;  2R5Z B;  2MD0 A;  4ZYD A;  1GHC A;  5DCF A;  5CPR B;  4LG3 A;  3HPH A;  3J7A O;  1OJL A;  5DYM A;  4ABZ A;  2EIJ H;  1IXC A;  5E17 F;  1NK3 P;  5IP6 A;  2WY7 Q;  4LJZ F;  4Q47 A;  3LQQ A;  1IRZ A;  3HRT A;  4A3M J;  5E8I A;  2LKP A;  2YSR A;  3CC2 I;  3DQV C;  4CUG A;  3KZI C;  3N4M A;  1JUS A;  4PGG A;  3HPG A;  1ZGW A;  1T0F C;  3ZQG A;  3CDI A;  2BVM A;  5C44 J;  3G4S I;  1U8R A;  3LL7 A;  1K4T A;  3CLO A;  4B44 A;  2ZSH B;  3H5N A;  5K7F A;  1Z1D A;  3S3O A;  3ECO A;  3GTP J;  1BN5 A;  5TIS C;  3A02 A;  4RAF A;  3HOZ J;  4HNU A;  1R4M B;  2PN6 A;  3SDG A;  1FOK A;  1J2X A;  2B9S A;  4GRI A;  1OLT A;  2HR3 A;  3QWL A;  5EG0 B;  1S72 I;  3LSR A;  4HF2 A;  4IL6 C;  4RB3 C;  4HA8 A;  3ABU A;  5F1R A;  4XIC A;  4XKC A;  2EZK A;  4BL0 B;  3JRA A;  2CW8 A;  4UB8 C;  1GV2 A;  1LVK A;  1TWH J;  3GME A;  2EJR A;  4AM3 A;  4C2U A;  4ZDO A;  4J00 A;  3P9I A;  3U21 A;  3JRC A;  3REO A;  4A3I J;  5LGU A;  2F5D A;  3PNT A;  3TDZ C;  2OCC H;  3LSI A;  3VFZ A;  2FF4 A;  2QA4 I;  5ERI A;  1XSD A;  4KMF A;  4HBL A;  2HOA A;  3OIQ A;  3TO6 A;  4L5I A;  3GTJ J;  3P5J A;  5D8K B;  2AQE A;  2FMY A;  4E7I A;  5DCM A;  1HW2 A;  2ZME C;  1F9N A;  3MEX A;  5FRO A;  3ZN1 A;  2WAE A;  1O7L A;  5IYB J;  2WAD A;  3COA C;  2ELK A;  2K9N A;  3V42 A;  4D5F A;  1ZR4 A;  3DU6 A;  5DD4 A;  3E7L A;  4XN0 A;  1S6L A;  3VEP A;  2EFP A;  2XAJ A;  3BG9 A;  1JI8 A;  2HWV A;  4LLG F;  1YHQ I;  4PDK A;  5E18 F;  2W1O A;  3KEQ A;  2EQR A;  5M5W J;  4S05 A;  1ZRC A;  4Z6Y A;  4WWC A;  2EV6 A;  3F72 A;  2ZB9 A;  3FK6 A;  1LPQ A;  1JT6 A;  1TLH B;  4BQQ A;  4M6Y A;  4IHV A;  4BUP A;  2OA4 A;  2GWR A;  3QAH A;  2XRL A;  1VQO I;  3CMM A;  1CGP A;  4N9H A;  1TQM A;  3HIF A;  3CF2 A;  2DA5 A;  3CCY A;  1FC3 A;  2VJJ A;  3RSN A;  2BY3 A;  1XG1 A;  3BR3 A;  2FML A;  2RC4 A;  4RDU A;  3G73 A;  3PFI A;  4WXC A;  4U88 A;  4V2G A;  3L2W A;  4MQV A;  3PFY A;  1APL C;  2GA1 A;  1IRX A;  2M8E A;  2PQ8 A;  2NVU B;  3W6J B;  2M3A A;  3O8G A;  5D4R A;  2NVY J;  1K78 A;  1X4O A;  3V7S A;  4KN7 X;  5D6F A;  3D1N I;  3DKX A;  4CCO A;  1RRJ A;  2B63 J;  1R5G A;  2QBY A;  2M1B A;  1UFM A;  2Y0M A;  4XK4 A;  2EIN H;  1B8I A;  1GUU A;  1BW5 A;  4XID A;  3KYL A;  3KIO A;  2XV4 S;  5LGT A;  1WI3 A;  4E7S A;  3VSL A;  2EZL A;  1MW7 A;  1MJA A;  1T33 A;  1AKH B;  1IUY A;  3H5A A;  4E7Z A;  1SFU A;  3DBL B;  3SHF A;  3AL0 C;  1R5H A;  1SVM A;  2KJC A;  2DMQ A;  1VI0 A;  1OMI A;  1SD4 A;  2CMP A;  4BAC A;  1SAN A;  2IGO A;  1FBS A;  4YFK F;  4F92 B;  1J9I A;  4G8X A;  4XON A;  4C3I J;  2BBY A;  1IF1 A;  2LY1 A;  5A2Q Z;  1FTT A;  2D1H A;  2GXG A;  1NH3 A;  4RB2 C;  4BE0 A;  4CCL A;  4M3G A;  3C18 A;  3DTK A;  1LDD A;  1HCR A;  2DPU A;  1Z9C A;  1HDP A;  4QPQ A;  2OCE A;  1BIA A;  3L2V A;  2HTJ A;  1HXD A;  2Q2E B;  2XIG A;  1TW3 A;  1FMV A;  2DBB A;  1SVL A;  1IDY A;  1SVO A;  2CUF A;  4DYQ A;  2CQK A;  2DK8 A;  1S7E A;  2XAQ A;  1D1C A;  3RPQ A;  2R5Z A;  3OR1 C;  5LLQ A;  3LSK A;  2A6E F;  3F8M A;  3K9T A;  3ERE D;  3KLN A;  3KYD B;  2PMZ A;  3CUQ C;  1TWG J;  1I3Q J;  1Y6I A;  1X1B A;  3DWL E;  1GVJ A;  1IRG A;  2EFW A;  2XB0 X;  3LAJ A;  4E4H A;  5HS8 A;  3K4J A;  4XLH A;  5GPA A;  2F5E A;  3K1M A;  1W7P D;  3B6A A;  4AIH A;  5J8C A;  3AG3 H;  3ASN H;  1N78 A;  4BJT A;  2G7H A;  2E71 A;  4UVC A;  3AKZ A;  3ZQL A;  2FUG 2;  3I9V 2;  1NG6 A;  2VBX A;  1HKS A;  2X6X A;  1G59 A;  3BPX A;  4M9Z A;  1UHM A;  1PUE E;  2WBM A;  2F48 A;  2HNH A;  3CP8 A;  3MVP A;  2QEN A;  1J5Y A;  2HXO A;  3LA3 A;  4KJZ A;  5E1Z B;  1L0O C;  5K5Q A;  2BY2 A;  4R8H A;  3AG4 H;  3NRV A;  1P6R A;  4HG2 A;  2HYJ A;  1U5T C;  3C1D A;  2R7W A;  1QQI A;  3HRU A;  1VQM I;  5FFZ A;  1I1G A;  4LD5 A;  3IAM 2;  1LDJ A;  1PJR A;  3E97 A;  4X0G A;  3QPL A;  3OSF A;  5EDN A;  2VJ4 A;  3MCZ A;  1TWF J;  3BTC A;  3HKZ N;  3H92 A;  4PJL A;  4MGR A;  1NHA A;  2JK3 A;  1SFO J;  2R4G A;  1JT0 A;  4II2 A;  2YPR A;  3IRR A;  4LLL A;  4A3J J;  1MDM B;  3WTV C;  1ENH A;  1VQK I;  2XF7 A;  3C2H A;  3K4B A;  2IA2 A;  3OYB A;  3W6V A;  1HC8 A;  3EQL F;  1R22 A;  5IT9 K;  3JRE A;  5L3F A;  1MNE A;  4A3D J;  4N0B A;  4XKW A;  4UV8 A;  5FFX A;  4PK4 A;  5K7H A;  3CO6 C;  4I98 B;  4DOZ A;  1S8N A;  2CGP A;  4B3X A;  1HW5 A;  3DLL F;  4M9S A;  3OYM A;  1MBE A;  2Y9Y A;  4Y3O A;  3V8J A;  1O4X A;  1VQ8 I;  1FIA A;  1I50 J;  1D0X A;  2DMN A;  4F93 B;  1BI3 A;  4EJO A;  3K1P A;  2ZNY A;  1MBF A;  2DA6 A;  2OU2 A;  4D7N A;  2A5W A;  2X1E A;  3EPZ A;  1UAA A;  1ZEL A;  2JZY A;  2R7F A;  4D0P A;  5FKK A;  2H8R A;  1MBH A;  4RB1 A;  3GWZ A;  1GLN A;  4YII A;  2DMP A;  2J5P A;  3WTW C;  1J75 A;  2KDZ A;  2KHM A;  3JRD A;  2RRE A;  4Q5S F;  4G6Q A;  5E20 A;  3H9G A;  2DFF A;  3HHH A;  4W97 A;  4EEF G;  4EAT A;  1IGN A;  1T95 A;  2CFX A;  4A3C J;  4N4O B;  3C3W A;  3KE2 A;  1JHH A;  1MBK A;  2ELJ A;  5CLS A;  1P7I A;  2LRE A;  4DBQ A;  5FGM A;  4OAZ A;  3TOA A;  2HDC A;  1TZL A;  1VQP I;  2DA3 A;  4UNO A;  3JW4 A;  1YI2 I;  2OZ6 A;  4A3F J;  3BJO A;  4A12 A;  3OYE A;  2YS9 A;  3S2D J;  2X6Y A;  4OWR B;  3A0H C;  4B3A A;  1ZN2 A;  2QF7 A;  2VE9 A;  1A31 A;  4A3G J;  2MC3 A;  1D0Z A;  2MAB A;  2KT0 A;  3M8J A;  3PQJ A;  2GXB A;  2VKV A;  4B43 A;  2FE3 A;  3VDX A;  4S0H B;  4KNY A;  4BBR J;  1FPQ A;  1K4S A;  1POG A;  4JBA A;  1GVD A;  2QVO A;  3S3M A;  4E70 A;  4JOM A;  2V9K A;  2E1C A;  2FBH A;  2W24 A;  1LE8 A;  2JA8 J;  1N25 A;  1XTA A;  2CW0 F;  2ZFW A;  4V2F A;  3Q9S A;  1ETV A;  3G6E I;  5HNF A;  3FXO A;  2ID6 A;  5LGN A;  1ODD A;  2XKO A;  3BZC A;  4C30 A;  3WU0 A;  5E3O A;  1DGR M;  4BY7 J;  4P9U A;  2NNY A;  1KGS A;  2XGC A;  1HQC A;  4Y17 A;  4I09 A;  1P4X A;  2DMT A;  4KFC A;  1AOY A;  3VPR A;  3M1E A;  5CKT A;  4C3J J;  2F4O B;  4IPA A;  1E3O C;  5L3G A;  5IOY A;  3DPT A;  4IZZ A;  2M9H A;  3H0D A;  2NVQ J;  2H6B A;  3RZO J;  1RR7 A;  1U9N A;  2K4J A;  3GF2 A;  5M3F J;  1B1B A;  2E2I J;  1T2K A;  1MJB A;  3S32 A;  2MH2 A;  5FKL A;  2NAZ A;  5GAH J;  1LEA A;  3EUH C;  3CJN A;  2VI6 A;  2HZD A;  3S2H J;  2FU4 A;  2GOX B;  5EEA A;  3G1O A;  1C0W A;  1K6O A;  4MLO A;  2Z2S B;  3SEQ A;  5HVQ C;  2F4I A;  4C2T A;  3HOW J;  3BRO A;  1FSH A;  2NS0 A;  4Y33 A;  1LVA A;  1UST A;  2Q2E A;  3M7G A;  3WTZ A;  4XLE A;  2IXS A;  3F9K A;  2MG4 A;  1D5Y A;  2A68 F;  4KYW A;  2VPL A;  4IX7 A;  2G0E A;  1O3T A;  4O3M A;  2L4M A;  1ZHF A;  2DFI A;  5HS7 A;  4RM3 A;  1A6I A;  5ED4 A;  5M3M J;  4RGU A;  3WGG A;  1L3L A;  1WZ2 A;  2V9V A;  3J81 K;  1G3T A;  1NG7 A;  3I4P A;  2PI0 A;  3M8E A;  4WCG A;  3A03 A;  1R23 A;  3HEF A;  3V7C A;  2KDO A;  2QWW A;  5DCM B;  3U2R A;  3R0A A;  1F36 A;  2VT2 A;  1JUM A;  3T5X A;  2Z9O A;  3BR0 A;  3A2K A;  4OU0 A;  4JQF A;  3JAM Z;  2Y0S N;  1Z21 A;  5CVU A;  1ULY A;  4OMZ A;  2ZSI B;  1ZKG A;  4U0Y A;  4FHT A;  2BHZ A;  4AIK A;  3W2W A;  3PO2 J;  4L0Z B;  2IEK A;  2D1V A;  4II3 A;  4BHB A;  2TCT A;  2XAU A;  3H9Q A;  3ABL H;  4JX4 A;  5KNL A;  1DPU A;  2ICW G;  3TBI A;  4ZYH A;  3BJA A;  2BZT A;  3ZQC A;  3EYI A;  4UUS A;  1JJ8 C;  1IN6 A;  3ULQ B;  2PFB A;  1MMD A;  2CQX A;  4BXU A;  2X48 A;  2GOM A;  5F08 A;  1UHS A;  1FOY A;  3WU2 C;  1V4R A;  1SMT A;  1YG2 A;  1N75 A;  3IP4 B;  5CVJ A;  1YTY A;  1VQ4 I;  2JN6 A;  1SC7 A;  4HF1 A;  4GYG A;  3BG7 A;  1R6R A;  3ZPL A;  3GFL A;  3GUD A;  3GTQ J;  4IHX A;  1ETK A;  2EZI A;  2LFB A;  4XLP F;  5GPC A;  5D5U B;  1I3A A;  2H8W A;  4ZC3 A;  3DBR B;  1F1Z A;  3IKT A;  4M72 A;  2CU7 A;  4Y52 J;  4KMU X;  1E3H A;  4G9Y A;  1ZYR F;  3FKI J;  4A5N A;  2ZXW H;  3BZK A;  2MBF A;  1IV8 A;  1ORK A;  3CDL A;  1XD7 A;  1YYV A;  5ICF A;  2STT A;  3FBN B;  2LF7 A;  2HGC A;  5CVV A;  2DXI A;  3E5Q A;  4RBO A;  1OCZ H;  3QYE A;  4B09 A;  4IOA F;  3K4L A;  2P7C B;  2JJ7 A;  2QZ8 A;  4M6V A;  4LK1 F;  2JMW A;  1EH7 A;  4ZYE A;  1B72 B;  4HX4 A;  3KP2 A;  2JA2 A;  2FRH A;  2I8D A;  4E6K G;  1B8I B;  2M0M A;  4AVZ A;  1VTN C;  2KRF A;  4RLF A;  5EF6 A;  2IS2 A;  2EH3 A;  4XL9 A;  1UB9 A;  1NTC A;  2K5C A;  4IHY A;  3LQR A;  2ECB A;  2R93 J;  4QSH A;  5M5Y J;  3NWT A;  5E79 C;  3VOD A;  4ZZD A;  1QHG A;  4X6A J;  2LG4 A;  4MIM A;  2XSD C;  1AHD P;  2L9V A;  3VYU B;  2FA5 A;  2X0L A;  5B1A H;  1XGM A;  4G7H F;  2PLY A;  5LD2 C;  3HUG B;  5AIQ A;  2NVT J;  3KEO A;  3D0S A;  3Q9V A;  1R5I D;  2E36 A;  3OYG A;  2V1D A;  1HKT A;  5HLH A;  3DEW A;  3CP2 A;  1OCO H;  1TQI A;  1A36 A;  3ZQQ A;  4ESB A;  3F6O A;  5JFR A;  3ZQ7 A;  1Z6T A;  1BI0 A;  2CQN A;  2JA7 J;  2DQL A;  1DU6 A;  4CDG A;  2A6H F;  2DLL A;  2DTZ A;  2B7E A;  4FX0 A;  3WTT C;  2AXT C;  3S14 J;  2EZH A;  2D2W A;  1IO2 A;  4DW6 A;  1KQ9 A;  2ME0 A;  4KIS A;  5DDG A;  1D1A A;  1O57 A;  4CA0 A;  2VOP A;  2JT1 A;  2C6Y A;  3NAR A;  3S93 A;  2PJP A;  5F04 A;  2K86 A;  2ZJR F;  1T8I A;  5HOO A;  4LIT A;  2BXY A;  3TW6 A;  2VAS A;  2XHK A;  1R36 A;  1N77 A;  1LEB A;  3KCC A;  2LYC A;  3GTK J;  1G3Y A;  2KZV A;  2O8X A;  2HI3 A;  3H3V K;  4RGX A;  3CCV I;  4ITV A;  2W00 A;  2MC4 A;  2LRD A;  1TTY A;  2PG4 A;  1TWA J;  1WI9 A;  2K85 A;  3RPU D;  4NUB A;  3LNQ A;  2M87 A;  2CJJ A;  2OZU A;  2DW4 A;  3OIP A;  5J40 A;  3LFU A;  2XUB A;  1FYL A;  1QHH D;  3S15 J;  2Z3Y A;  2TDX A;  1D0Y A;  2DT5 A;  1T0F A;  2QM3 A;  4HAM A;  2OJE D;  2L7M P;  1CQT A;  2PMU A;  2ZCW A;  3TP3 A;  2ESN A;  1K79 A;  5KCM A;  4LG0 A;  2RAE A;  2PEX A;  2HQN A;  1Y0U A;  4RGR A;  2XSJ C;  2EIL H;  5F27 A;  1JKR C;  4HZF A;  2V7F A;  2JQ7 A;  3PNV A;  2HFH A;  4WXH A;  1ZLJ A;  1X2M A;  1YOV B;  2L9N A;  4AVP A;  1U5T B;  4OOI A;  1F5T A;  1LFU P;  1D8J A;  2Y48 A;  2K7L A;  3F6V A;  5LHG A;  5A2Q K;  3FXU A;  3FBI B;  1ACI A;  5LBQ A;  4UB6 C;  2ZKZ A;  3MKW B;  2MFZ A;  3LSM A;  5HS9 A;  3DF8 A;  1G2H A;  4YIR X;  1H8A C;  1IN8 A;  4HEA 2;  4M3D A;  4ZYA A;  3E3V A;  3QP5 A;  2L9R A;  3TDU C;  4F91 B;  1S7A A;  4LIV A;  3X2Q H;  3HZJ A;  3F8F A;  1MJ9 A;  4HLX A;  2ZJ2 A;  1DP7 P;  3OL4 A;  4OIN F;  2EIM H;  3L1P A;  3GFI A;  4I6Z A;  2JWT A;  1SD7 A;  3ZXS A;  2NS7 A;  3ZMU A;  4LOC A;  2I5U A;  2Z1D A;  4O5V A;  2ZME A;  4ZJZ A;  5BPD A;  2YU9 J;  4ZTF A;  1ONV A;  1QPI A;  4NC6 A;  1A04 A;  2F5F A;  1V5E A;  1YW9 A;  4AIJ A;  4M6X A;  1DGW Y;  4RB0 A;  2KP6 A;  2AO9 A;  4D9J A;  3S1N J;  4KIF A;  1FWZ A;  2HU9 A;  4CCN A;  2QGU A;  1BBY A;  1X19 A;  2ZO4 A;  2BW3 A;  3N05 A;  3DBH B;  1TBX A;  4U87 A;  4PJN A;  5EEH A;  3IH3 A;  4XMY A;  1IN7 A;  1QVT A;  4L18 B;  1B9M A;  2X6W A;  4FIS A;  1ETX A;  4W1U A;  3SYT A;  3LWF A;  1R58 A;  4GO1 A;  3MZ8 A;  2FBI A;  5FLX K;  2E1M B;  3HOV J;  2BY1 A;  5LEK A;  2HKO A;  3WG7 H;  4AD9 A;  4MTD A;  4CCJ A;  5HNH A;  1GDT A;  2RNG A;  2JRT A;  2IGK A;  3DTE A;  5AON A;  2BXZ A;  2EA4 A;  4HST A;  3U1D A;  4QLC U;  3KET A;  2MYS A;  2GZW A;  2PMZ N;  1W0U A;  4EQQ A;  4I2O A;  4XN3 A;  1S3J A;  4XBF A;  3NWS A;  1HDD C;  5DUK A;  2FOK A;  4F7Z A;  1V55 H;  3IRQ A;  4YIF A;  2W7N A;  1BOB A;  4YG2 F;  5DUI A;  2VKH A;  1BC8 C;  2QKM B;  5LRS A;  2KFD A;  3I59 B;  3H36 A;  3I58 A;  4RS8 A;  3JTG A;  4HX7 A;  3SFZ A;  3VYS B;  3OR2 C;  1XN7 A;  3VOE A;  5GTH C;  3TQN A;  5IP7 J;  2NYX A;  3ECH A;  3ZMT A;  5C4J J;  1MH3 A;  3IC7 A;  2IP2 A;  1YS6 A;  2Q0O A;  4IXA A;  4CZZ A;  3BG3 A;  3UKG A;  3BPV A;  2AS5 F;  3KEY A;  2FOW A;  2HQR A;  1M1E B;  4ZZL A;  1ZLK A;  1LE8 B;  1EH8 A;  2WV0 A;  1B72 A;  4IHW A;  3IV5 A;  1XSV A;  5IT3 A;  2HEO A;  1PP7 U;  1MBJ A;  2COM A;  2OAZ A;  1MBG A;  1U78 A;  1Z05 A;  1SD6 A;  2BV6 A;  2CSO A;  2OC6 A;  3QU6 A;  1U2W A;  1WSU A;  5IYD J;  3GO5 A;  3HRS A;  4LB6 B;  4J01 A;  2W85 A;  5H6Q A;  3OOP A;  4DJA A;  1X4P A;  1ZK8 A;  3ZGK A;  3CCU I;  3Q0U A;  1BI2 A;  1ZGA A;  2DA4 A;  3BR5 A;  4BE2 A;  3OY9 A;  1RES A;  3HUG A;  1GV5 A;  3GEZ A;  4EJU A;  2DO7 A;  3GFM A;  2DTR A;  5AIP A;  2NOG A;  4IF4 A;  4KIG A;  2GIV A;  2VKD A;  3ERM A;  4I76 A;  3S3N A;  2EWN A;  2M4G A;  4AC0 A;  5HLI A;  2V4J C;  5JVG F;  1U9O A;  1WFX A;  2E60 A;  2L4A A;  1T56 A;  4A3K J;  2CUE A;  2WB1 N;  2BY0 A;  2O3F A;  4L5J A;  1E0E A;  1P92 A;  2P81 A;  1TWC J;  5EZG A;  3F0C A;  4XM3 A;  3QOD A;  1R9T J;  2P7V B;  2CS3 A;  3EDP A;  2DQR A;  4BNC A;  1SAX A;  3MKY B;  5J3L A;  4U0V A;  1IG7 A;  3VYT B;  1Y39 A;  5BS6 A;  1XDU A;  1X1P A;  2JPB A;  4XRS G;  3JRG A;  3E6D A;  4IEJ A;  5B3S H;  3IKV A;  2KL4 A;  4ZDP A;  2K02 A;  5HDG A;  2F4M B;  2IRF G;  2KMU A;  2O9L A;  4B48 A;  2CUZ A;  4A6E A;  5EGO A;  3M07 A;  4GFB A;  1SFK A;  3O2P E;  3L2U A;  2Z33 A;  5TGT A;  2W82 A;  2Q1Z B;  1YX3 A;  4R79 A;  2LVS A;  3CUQ A;  1XB4 A;  3PSI A;  1OCT C;  2VJ5 A;  2DDA A;  2LKS A;  5HLT A;  4E7J A;  3BY6 A;  2XRN A;  1ETW A;  2HPI A;  3J7Z I;  2YX4 A;  3PO3 J;  1WCM J;  4NQW B;  5E1X A;  1PVE A;  1KU9 A;  4PUS A;  2BGC A;  3Q5F A;  3TED A;  3ZP5 A;  1U8B A;  4FT8 A;  5K5O A;  1ZG3 A;  3HGY A;  3QU3 A;  5LFA A;  3KFW X;  3ZRG A; 
#chains in the Genus database with same CATH homology
 5FLX Z;  2OQR A;  1OPC A;  1AWC A;  2CWE A;  5H20 A;  1U5T A;  3BOQ A;  3R6S A;  2NNN A;  1LJ9 A;  1OYW A;  3HSR A;  1S29 A;  2WWY A;  4ESJ A;  2DPD A;  1D3Y A;  2VC1 A;  2XAS A;  1B4A A;  2L54 A;  1KQ0 A;  1WRJ A;  2IT0 A;  3BWG A;  1W7P A;  2HYG D;  2UXN A;  4Y15 A;  5LEJ A;  2A3S A;  3E6B A;  1MGT A;  2G9W A;  1QZY A;  1LDK B;  3WTY C;  2GQQ A;  4YFN F;  1XMA A;  1D8K A;  4HOB A;  4BAY A;  3B02 A;  3RKW A;  3G3Z A;  1T38 A;  3KLO A;  1JHF A;  3AAF A;  5KK1 A;  3JAM K;  2ISZ A;  1USS A;  3MWM A;  4XLN F;  3E6M A;  4MQ9 F;  1H0M A;  1WQ2 A;  4Q48 A;  5J6X A;  3FM5 A;  4CXF A;  2OD5 A;  1MZB A;  2J5O A;  3HYI A;  3F23 A;  5BMZ A;  2KIM A;  1H9G A;  2MH9 A;  3F22 A;  2XGX A;  3T0Y A;  5FB2 A;  3I59 A;  4ETS A;  2YX7 A;  5TJJ A;  2W57 A;  1SFX A;  4XSX F;  3WE3 A;  3CTA A;  2UWM A;  1T98 A;  4LLN A;  3FXR A;  4KIC A;  1IN4 A;  3BZ6 A;  3W6K B;  1I1S A;  2IA0 A;  4U0W A;  1WKM A;  2D45 A;  1IRF A;  4MNU A;  4BHC A;  3ZMS A;  1FSE A;  4LMY A;  2GA2 A;  2BEO A;  1FT9 A;  3F8N A;  3CDH A;  3MAJ A;  2QQA A;  5CVR A;  1IN5 A;  1FLI A;  3M9A A;  3K69 A;  2P5L C;  2K4B A;  1UHW A;  4LG0 B;  1KA8 A;  1SFE A;  4EGZ A;  2RNJ A;  1YW8 A;  4WK8 F;  5ILV A;  3EUH A;  4GYI A;  4BH9 A;  4EMS A;  2ETH A;  3FHZ A;  2VE8 A;  2RGV A;  1V3F A;  4I01 A;  1LNW A;  2HS5 A;  3WGH A;  3J80 K;  1R1V A;  2WC2 A;  3H3Z A;  4IVN A;  4UVA A;  1QGP A;  2LDU A;  1HKQ A;  3CO7 C;  2FBK A;  2FEZ A;  2RV8 A;  1YFH A;  3BP8 A;  1ZG1 A;  4ENN A;  1XMK A;  2HZT A;  2QQ9 A;  1LB2 A;  1SD5 A;  2ZME B;  4NQW A;  2E7X A;  1DUX C;  4A0Z A;  1RUO A;  1YLF A;  3D5L A;  1IXS B;  1OKR A;  3WOD F;  3F3X A;  4RGS A;  1HW1 A;  2L3D A;  3FM3 A;  3MFK A;  2M30 A;  2PMH A;  5HLG A;  1HSJ A;  3R61 A;  4B8X A;  4HLY A;  2BE5 F;  1BJA A;  1KU7 A;  4GCV A;  1IW7 F;  5F6F A;  1B9N A;  3IWZ A;  4CO8 A;  2ELH A;  1IZ1 A;  1G4D A;  3RKX A;  2H27 A;  2ZXJ A;  1QO0 D;  2EV0 A;  2VN2 A;  4I0B A;  2WTE A;  1YQA A;  2YU3 A;  4YFX F;  3ML6 A;  3DKW A;  4HDU A;  3T1B A;  5L3B A;  1J59 A;  1QNT A;  4M9X A;  3R0J A;  4ZH4 F;  2R7D A;  1O3S A;  1FX7 A;  4EVI A;  1G6N A;  4GGG A;  3V4G A;  3U9G A;  3F8B A;  5CJ9 A;  1ZRD A;  3GVA A;  3HHG A;  1JGS A;  2O6G E;  3DPL C;  3PQK A;  3QRF F;  1ZRE A;  4Y13 A;  4PGH A;  2BYV E;  2VT3 A;  1BM9 A;  2RQP A;  1HST A;  2EFQ A;  2QLZ A;  2IJL A;  1ZH5 A;  3WTS C;  4EJW A;  4Z2Y A;  3WU1 B;  2KKO A;  3I53 A;  4HV6 A;  4OIO F;  2G7U A;  2XAF A;  4G7O F;  2QQB A;  4EM2 A;  1TNS A;  2JPC A;  4BQA A;  4HQE A;  5K1Y A;  4O6J A;  1TQP A;  4EM1 A;  5ILS A;  3QP6 A;  3FWE A;  3ZMV A;  2V1U A;  2VON A;  2VBW A;  3J80 Z;  3WTX C;  4FX4 A;  2QUF A;  3TKY A;  2XVC A;  4G7Z F;  1FNN A;  1FY7 A;  1RUN A;  1IAW A;  2A69 F;  3ABT A;  1RNL A;  4U7B A;  3EYY A;  2M5W A;  4OIP F;  2DAO A;  2R3S A;  3CUQ B;  2FNA A;  1O3R A;  1X3U A;  3JSO A;  4I0A A;  5ICC A;  4KA4 A;  3R60 A;  4L9J A;  4UUV A;  2A5Y B;  2E7W A;  2A07 F;  3RIR A;  4RAZ A;  3FMQ A;  2P5K A;  1KU2 A;  4KT5 C;  1Q1H A;  3RKY A;  4A5M A;  1O3Q A;  2VBZ A;  2EA2 A;  2ISY A;  1TW2 A;  5LHH A;  1QPM A;  3I5U A;  5JHU A;  3LA7 A;  1GXQ A;  3KP3 A;  4GXO A;  4H0E A;  4ENJ A;  3ISP A;  1FP1 D;  4ENM A;  3GX4 X;  3FMS A;  1W7P B;  3CUO A;  4ESF A;  4G6D A;  3RPU A;  2H6C A;  3F21 A;  3GYH X;  1OYI A;  3DXJ F;  3WG9 A;  5D5W B;  2RDP A;  3RYR A;  2KJB A;  5LHI A;  3E5X A;  2UZK A;  1I5Z A;  3P9C A;  2YR2 A;  1U3E M;  1B59 A;  3V7R A;  2Y75 A;  4EV0 A;  2DI3 A;  3RJP A;  2MA3 A;  2V79 A;  4G94 A;  6PAX A;  3WGI A;  2ESH A;  3K1N A;  1I6X A;  3WTU C;  3LFK A;  1XSX A;  1D5V A;  5D8L B;  2AXL A;  4HV5 A;  1CF7 B;  1O7F A;  2Z99 A;  2P6T A;  1SMY F;  2FNP A;  2ACJ A;  2L01 A;  3LST A;  1ZG5 A;  5FO5 A;  3F8C A;  4XSZ F;  3ELK A;  1T6S A;  5D4S A;  3HRM A;  2MLG A;  3E6C C;  1W5T A;  4M73 A;  3GZ5 A;  2ZBK A;  2JSC A;  3I0T A;  1F4K A;  1ZRF A;  3GW2 A;  5BOX A;  1BC7 C;  4L9T A;  4IHS A;  3KZZ A;  2H09 A;  1B6A A;  4MEX F;  1I27 A;  2A61 A;  3P7N A;  4ZYG A;  1R00 A;  4EM0 B;  5TRD A;  4WX9 A;  5H6R A;  4U7D A;  4KUM A;  1WWX A;  4IRH A;  3C7J A;  1TNT A;  2B0L A;  4MEY F;  4ASN A;  2HYF A;  1W4M A;  4EJT A;  3O3K A;  1G3S A;  3K2Z A;  1PP8 F;  2X4H A;  4WF2 A;  1ZAO A;  5ICG A;  3QPH A;  5ICE A;  3EET A;  2CYY A;  1Z91 A;  2W84 A;  1IXR C;  1EH6 A;  2HTS A;  4LK0 F;  1YS7 A;  4DNC A;  3HSE A;  4CYD A;  4HQM A;  4N9I A;  4IJA A;  3TGN A;  2RKH A;  2H94 A;  2MLK A;  1JXS A;  4CIC A;  2K27 A;  2DK5 A;  2GAU A;  4MHG A;  4HF0 A;  3MQ0 A;  3NEU A;  5D6E A;  4A2U A;  4HW0 A;  3BJ6 A;  1FYK A;  3KP5 A;  3IL2 A;  2XAG A;  4UVB A;  1REP C;  1P2F A;  2O61 A;  3T8R A;  1ON1 A;  4HYE A;  3B73 A;  4OIR F;  2VOD A;  3GFJ A;  3LAP A;  2PBI A;  2P6S A;  2HKX A;  3ZN0 A;  1ZAR A;  3H3U A;  4KIB A;  2JTV A;  3JSP A;  3KP6 A;  2VXZ A;  5LRR A;  2EK5 A;  4XRF A;  3DP7 A;  2IW5 A;  2RVC A;  1G3W A;  3L2C A;  1KQ8 A;  3SXY A;  5D5X B;  3M8F A;  2F2E A;  4ENK A;  1RZ4 A;  4NHJ A;  5ILU A;  1FZP B;  3O6B B;  2HOE A;  1U6G A;  1ZGJ A;  4P9F A;  1FBQ A;  2VOO A;  2P5V A;  3L09 A;  4S04 A;  4M74 A;  2XKP A;  3RTR A;  5BQT A;  5KVR A;  3GXO A;  1XDS A;  4TV7 A;  1YW7 A;  4QWQ A;  3R4K A;  3KP4 A;  2OBP A;  4Q4Z F;  1CF7 A;  2MD5 A;  5L3C A;  4JK1 X;  2LNB A;  3FX3 A;  4KN4 X;  2RN7 A;  5BPI A;  2DU9 A;  4BYY A;  1KYZ A;  3MZH A;  5JI6 A;  3RI4 A;  2L02 A;  1BIB A;  2E1N A;  4NB5 A;  4UHT A;  2IVM A;  3V8K A;  4L0Y B;  3MZY A;  4M71 A;  2NRA C;  1E2X A;  4PCQ A;  2CG4 A;  4ON0 A;  5DV5 A;  4KDP A;  4WXD A;  1EV7 A;  1BI1 A;  1R7J A;  1S7O A;  3I54 A;  1R1U A;  2STW A;  3DFG A;  4HX8 A;  4RAY A;  3JTH A;  2EB7 A;  3HSF A;  5D5V B;  1XCV A;  5CVI A;  3E5U A;  3TO9 A;  4MTE A;  3BDD A;  1QZZ A;  5K5R A;  1BOA A;  2KIF A;  1H9T A;  2EFO A;  1JE8 A;  4LB5 A;  3KZY A;  1E17 A;  1DPR A;  3SQN A;  4K2E A;  5DD8 A;  1HBX G;  5L3D A;  5HDN A;  4CHU A;  2LF8 A;  3GZ6 A;  3QOP A;  1XGN A;  5HDK A;  4IHT A;  4DQ2 A;  1R1T A;  2IA1 A;  1RIO H;  2LSO A;  4HDV A;  1KYW A;  3N97 A;  2O03 A;  4A0Y A;  4A6D A;  3FMR A;  2KIU A;  3HTU A;  5E1W A;  4A0X A;  2UXX A;  5IT9 Z;  1RI7 A;  2ADU A;  5L3E A;  2FSW A;  3NQO A;  3IHU A;  4OIQ F;  3FXQ A;  3TO7 A;  1XCB A;  1J0R A;  1YO5 C;  3L00 A;  3HOS A;  4OMY A;  1MD0 A;  4P55 A;  2EFN A;  2V6C A;  5FD6 A;  5DEQ A;  3IWF A;  1P4W A;  2OQG A;  2CO5 A;  3DEU A;  4P5O A;  3FZV A;  2O0Y A;  3V8L A;  3K0L A;  3L7W A;  1OR7 A;  4UV9 A;  1LQ1 A;  3I64 A;  1ON2 A;  2VBY A;  3LA2 A;  3VB2 A;  1PDN C;  2QYO A;  4UXN A;  3T8T A;  3ZMD A;  4I02 A;  1MDM A;  2Z5U A;  3HOT A;  1J7K A;  3DV8 A;  3WE2 A;  2XAH A;  4LGW A;  1W5S A;  3OV8 A;  3TOB A;  4LFU A;  3P9K A;  4R1H A;  5JR3 A;  1XGO A;  2EV5 A;  4PZJ A;  3ZMZ A;  1K7A A;  5FD5 A;  3SZP A;  4AWX B;  1K78 B;  4IRI A;  1DDN A;  1STZ A;  3RDI A;  1MKM A;  1QBJ A;  1T39 A;  5J8F A;  1UCR A;  2QBY B;  2ZNZ A;  3FF5 A;  2W25 A;  2M45 A;  3S2W A;  3GLX A;  2P4W A;  4CGZ A;  3I71 A;  2Q8K A;  1P4A A;  3ROU A;  5F64 A;  2XRO A;  1KU3 A;  4I7H A;  1XGS A;  4L9V A;  4BHP A;  3L9F A;  2FQ3 A;  4L9N A;  5E8G A;  2FXA A;  1FP2 A;  2IPQ X;  1OYY A;  4IRG A;  1GXP A;  5EEG A;  3HTS B;  2F5C A;  3RYP A;  4P96 A;  2V1X A;  1FYM A;  4EGY A;  1Z7U A;  3QPT A;  1YIO A;  3SZT A;  5CYV A;  3J81 Z;  4EJV A;  2P8T A;  1Z6R A;  5JVT A;  1FBU A;  3KP7 A;  2VC0 A;  4ZYD A;  1GHC A;  5DCF A;  3J7A O;  5DYM A;  1IXC A;  5E17 F;  4LJZ F;  4Q47 A;  3LQQ A;  3HRT A;  5E8I A;  2LKP A;  2YSR A;  3DQV C;  3N4M A;  4PGG A;  1U8R A;  3CLO A;  1Z1D A;  3ECO A;  1BN5 A;  2PN6 A;  1FOK A;  1J2X A;  2HR3 A;  4HF2 A;  4RB3 C;  4HA8 A;  3ABU A;  5F1R A;  2EJR A;  3P9I A;  3REO A;  5LGU A;  2F5D A;  3TDZ C;  3VFZ A;  2FF4 A;  5ERI A;  1XSD A;  4KMF A;  4HBL A;  3TO6 A;  4L5I A;  5D8K B;  2FMY A;  5DCM A;  1HW2 A;  1F9N A;  3MEX A;  3ZN1 A;  1O7L A;  3COA C;  5DD4 A;  1S6L A;  3VEP A;  2EFP A;  2XAJ A;  2HWV A;  4LLG F;  4PDK A;  5E18 F;  3KEQ A;  4S05 A;  1ZRC A;  4WWC A;  2EV6 A;  3F72 A;  1TLH B;  4M6Y A;  2OA4 A;  2GWR A;  3QAH A;  1CGP A;  4N9H A;  1TQM A;  3HIF A;  1FC3 A;  2FML A;  2RC4 A;  3G73 A;  3PFI A;  4WXC A;  4U88 A;  4MQV A;  2GA1 A;  2M8E A;  2PQ8 A;  3W6J B;  5D4R A;  1K78 A;  3V7S A;  4KN7 X;  5D6F A;  1R5G A;  2QBY A;  2M1B A;  1UFM A;  2Y0M A;  2XV4 S;  5LGT A;  1MJA A;  1IUY A;  1SFU A;  3SHF A;  1R5H A;  2KJC A;  1OMI A;  1SD4 A;  4YFK F;  1FBS A;  1J9I A;  4G8X A;  2BBY A;  1IF1 A;  5A2Q Z;  2D1H A;  2GXG A;  4RB2 C;  3C18 A;  1LDD A;  2DPU A;  1Z9C A;  1BIA A;  2HTJ A;  1HXD A;  2XIG A;  1TW3 A;  2DBB A;  2CQK A;  2DK8 A;  2XAQ A;  3RPQ A;  5LLQ A;  2A6E F;  3F8M A;  3K9T A;  3ERE D;  3KLN A;  3CUQ C;  1IRG A;  1GVJ A;  2EFW A;  3LAJ A;  5HS8 A;  2F5E A;  3K1M A;  1W7P D;  4AIH A;  5J8C A;  2G7H A;  4UVC A;  2VBX A;  1HKS A;  3BPX A;  4M9Z A;  1UHM A;  1PUE E;  2QEN A;  1J5Y A;  3LA3 A;  5E1Z B;  1L0O C;  5K5Q A;  4R8H A;  3NRV A;  1P6R A;  1U5T C;  3C1D A;  1QQI A;  3HRU A;  5FFZ A;  1I1G A;  4LD5 A;  1LDJ A;  3E97 A;  3MCZ A;  3H92 A;  4MGR A;  1NHA A;  2YPR A;  4LLL A;  1MDM B;  3WTV C;  2IA2 A;  3EQL F;  1R22 A;  5IT9 K;  5L3F A;  4N0B A;  4UV8 A;  5FFX A;  3CO6 C;  4I98 B;  1S8N A;  2CGP A;  1HW5 A;  4M9S A;  3V8J A;  1BI3 A;  4EJO A;  3K1P A;  2ZNY A;  2OU2 A;  2JZY A;  2R7F A;  4D0P A;  4RB1 A;  3GWZ A;  4YII A;  2J5P A;  3WTW C;  1J75 A;  4Q5S F;  4G6Q A;  5E20 A;  3HHH A;  2CFX A;  3C3W A;  3KE2 A;  1JHH A;  5CLS A;  5FGM A;  3TOA A;  2HDC A;  4UNO A;  3JW4 A;  2OZ6 A;  3BJO A;  4A12 A;  1ZN2 A;  2VE9 A;  2MC3 A;  3PQJ A;  2GXB A;  2FE3 A;  4KNY A;  1FPQ A;  4JBA A;  2QVO A;  4E70 A;  2E1C A;  2FBH A;  2W24 A;  2CW0 F;  2ZFW A;  3Q9S A;  5LGN A;  1ODD A;  2XKO A;  3WU0 A;  4P9U A;  2NNY A;  1KGS A;  1HQC A;  4Y17 A;  4I09 A;  1P4X A;  4KFC A;  1AOY A;  3M1E A;  4IPA A;  5L3G A;  3DPT A;  2H6B A;  2K4J A;  3GF2 A;  1B1B A;  1T2K A;  1MJB A;  2MH2 A;  2NAZ A;  1LEA A;  3CJN A;  2FU4 A;  1C0W A;  1K6O A;  5HVQ C;  1FSH A;  3BRO A;  2NS0 A;  1LVA A;  1UST A;  2Q2E A;  3M7G A;  3WTZ A;  2A68 F;  4KYW A;  1O3T A;  4O3M A;  2L4M A;  1ZHF A;  2DFI A;  5HS7 A;  5ED4 A;  4RGU A;  3WGG A;  1L3L A;  2V9V A;  3J81 K;  1G3T A;  3I4P A;  2PI0 A;  3M8E A;  4WCG A;  1R23 A;  3V7C A;  2QWW A;  5DCM B;  3U2R A;  3R0A A;  2VT2 A;  3T5X A;  2Z9O A;  4OU0 A;  4JQF A;  3JAM Z;  5CVU A;  1ULY A;  4OMZ A;  4U0Y A;  4FHT A;  4AIK A;  4L0Z B;  2D1V A;  4BHB A;  1DPU A;  4ZYH A;  3BJA A;  3EYI A;  1IN6 A;  3ULQ B;  2PFB A;  4BXU A;  1V4R A;  1SMT A;  1YG2 A;  5CVJ A;  1YTY A;  4HF1 A;  4GYG A;  3ZPL A;  3GFL A;  3GUD A;  4XLP F;  5D5U B;  1F1Z A;  3IKT A;  4M72 A;  4KMU X;  4G9Y A;  1ZYR F;  4A5N A;  2MBF A;  1XD7 A;  1YYV A;  5ICF A;  2STT A;  2LF7 A;  2HGC A;  5CVV A;  3E5Q A;  4B09 A;  2P7C B;  2QZ8 A;  4LK1 F;  1EH7 A;  4ZYE A;  4HX4 A;  3KP2 A;  2FRH A;  1VTN C;  2KRF A;  1UB9 A;  3LQR A;  3VOD A;  4ZZD A;  2FA5 A;  2X0L A;  1XGM A;  4G7H F;  2PLY A;  5AIQ A;  3KEO A;  3D0S A;  3Q9V A;  2V1D A;  1HKT A;  5HLH A;  1TQI A;  4ESB A;  3F6O A;  5JFR A;  3ZQ7 A;  1Z6T A;  1BI0 A;  2DQL A;  4CDG A;  2A6H F;  2DLL A;  3WTT C;  4FX0 A;  2D2W A;  1KQ9 A;  5DDG A;  1O57 A;  2VOP A;  2JT1 A;  2C6Y A;  2PJP A;  2K86 A;  5HOO A;  2XHK A;  1R36 A;  1LEB A;  3KCC A;  1G3Y A;  2O8X A;  4RGX A;  1TTY A;  2PG4 A;  1WI9 A;  2M87 A;  2OZU A;  2DW4 A;  2XUB A;  1FYL A;  2Z3Y A;  2TDX A;  2DT5 A;  1T0F A;  2QM3 A;  4HAM A;  2PMU A;  2ZCW A;  2ESN A;  1K79 A;  4LG0 A;  2PEX A;  2HQN A;  1Y0U A;  4RGR A;  4HZF A;  4WXH A;  2HFH A;  1ZLJ A;  4AVP A;  1U5T B;  4OOI A;  1F5T A;  1D8J A;  2Y48 A;  2K7L A;  3F6V A;  5LHG A;  5A2Q K;  3FXU A;  5LBQ A;  2ZKZ A;  5HS9 A;  3DF8 A;  1IN8 A;  3E3V A;  3QP5 A;  3TDU C;  1S7A A;  3F8F A;  1MJ9 A;  4HLX A;  2ZJ2 A;  1DP7 P;  4OIN F;  3GFI A;  1SD7 A;  3ZMU A;  4O5V A;  2ZME A;  5BPD A;  1ONV A;  1A04 A;  2F5F A;  1YW9 A;  4AIJ A;  4M6X A;  4RB0 A;  4KIF A;  1FWZ A;  1BBY A;  2ZO4 A;  1TBX A;  5EEH A;  1IN7 A;  4L18 B;  1B9M A;  3LWF A;  1R58 A;  4GO1 A;  2FBI A;  5FLX K;  5LEK A;  2HKO A;  4AD9 A;  4MTD A;  3U1D A;  2JRT A;  3IRR A;  5AON A;  3KET A;  2EA4 A;  4QLC U;  2GZW A;  4EQQ A;  4I2O A;  1S3J A;  4XBF A;  5DUK A;  2FOK A;  4F7Z A;  3IRQ A;  4YIF A;  4YG2 F;  5DUI A;  1BC8 C;  5LRS A;  3I59 B;  3I58 A;  4RS8 A;  3JTG A;  4HX7 A;  3SFZ A;  1XN7 A;  3VOE A;  3TQN A;  2NYX A;  3ECH A;  3ZMT A;  3IC7 A;  2IP2 A;  1YS6 A;  2Q0O A;  4IXA A;  4CZZ A;  2AS5 F;  3BPV A;  2HQR A;  4ZZL A;  1ZLK A;  1EH8 A;  2WV0 A;  1XSV A;  5IT3 A;  2HEO A;  1PP7 U;  2COM A;  1U78 A;  2OAZ A;  1Z05 A;  1SD6 A;  2BV6 A;  2CSO A;  3QU6 A;  1U2W A;  1WSU A;  3GO5 A;  3HRS A;  4LB6 B;  2W85 A;  5H6Q A;  3OOP A;  1BI2 A;  1ZGA A;  3HUG A;  3GEZ A;  4EJU A;  2DO7 A;  3GFM A;  2DTR A;  5AIP A;  4IF4 A;  4KIG A;  2GIV A;  2EWN A;  5HLI A;  2L4A A;  2O3F A;  4L5J A;  1P92 A;  2P7V B;  3EDP A;  2DQR A;  4BNC A;  1SAX A;  4U0V A;  5BS6 A;  1XDU A;  2JPB A;  3E6D A;  3IKV A;  2K02 A;  5HDG A;  2IRF G;  4A6E A;  3O2P E;  2Z33 A;  4R79 A;  3CUQ A;  1XB4 A;  3BY6 A;  2XRN A;  2YX4 A;  5E1X A;  1KU9 A;  2BGC A;  3Q5F A;  3ZP5 A;  4FT8 A;  5K5O A;  1ZG3 A;  3QU3 A;  3KFW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...