4KMFA

Crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
SAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Z-DNA binding mode of a PKR-like protein kinase containing a Z-DNA binding domain (PKZ).
pubmed doi rcsb
source organism Carassius auratus
molecule tags Transferase/dna
molecule keywords Interferon-inducible and double-stranded-dependent eIF-2kina
total genus 21
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kmfA00
1MJAA 1XN7A 3GYHX 3C18A 3BOQA 2NRAC 2X4HA 1L0OC 5D6FA 1QBJA 5AIPA 1USSA 2M1BA 1UB9A 3ROUA 3NQOA 3KEOA 1IRGA 3JW4A 1QO0D 5BPIA 3ZPLA 3TO7A 5HDKA 2GA1A 3MFKA 2PLYA 3EETA 2GAUA 3FWEA 2IT0A 2FMYA 4MQVA 3GFIA 5HDGA 3FMRA 2JTVA 4OIQF 5H6QA 2P6SA 3FM5A 1ULYA 5EEGA 3ZN1A 2Y0MA 3JSPA 2F2EA 4ZZLA 1V3FA 1F4KA 4H0EA 4IJAA 1SFXA 3R6SA 1Z6RA 2XUBA 5BOXA 2MC3A 2KKOA 1YS7A 1TNSA 5E17F 3TDZC 1Y0UA 4RB3C 2DPUA 1OR7A 2FBIA 1SD5A 3CUQA 2QUFA 2KIFA 3M8FA 3L9FA 1U5TC 1ZG3A 4EJUA 5LEKA 1X3UA 3F23A 3IHUA 1LEBA 5IT9K 3VODA 1T38A 2L3DA 3MZHA 4EM0B 2K4JA 2F5EA 3DF8A 5IT9Z 4A12A 5FLXZ 3FHZA 4B8XA 4Z2YA 4U7BA 1NHAA 5HOOA 1QZYA 2ZXJA 5K5RA 3JTGA 3V8LA 1RUOA 1S6LA 4R1HA 3RTRA 4Q48A 3P9IA 1KYWA 4CZZA 1JXSA 1Z91A 2KJCA 1U8RA 2WTEA 3BJOA 3IC7A 4MEYF 1S29A 3F6VA 1PP7U 3E5UA 3I0TA 3BP8A 1HXDA 3ZN0A 1Z7UA 3QAHA 3IRRA 5FFXA 2ZFWA 3AAFA 2KRFA 2W25A 3RPQA 3FM3A 3FMQA 4N0BA 1U3EM 3E6CC 3DP7A 1SAXA 2FXAA 2IVMA 1H9TA 4ZYHA 4AIJA 4MTEA 4RS8A 1ZH5A 3KE2A 3HOTA 1W7PA 5TRDA 1BOAA 4GYIA 2VT3A 1JHFA 1SD4A 3R61A 2Y48A 4KFCA 4G7HF 5AIQA 3VOEA 2X0LA 3CTAA 4UVBA 3K2ZA 4KICA 1XDSA 2ESHA 4D0PA 1BIBA 5J8FA 3WTXC 4ESFA 2QQBA 2G9WA 1BM9A 4MHGA 2CO5A 2Z5UA 4IXAA 2V79A 3GXOA 5HS9A 2Q0OA 1MJBA 2GQQA 4OU0A 1SMYF 4IPAA 1G3SA 1XSXA 1ONVA 3O6BB 4LK0F 3JAMK 2VXZA 3MAJA 4A0XA 2Z33A 1XCBA 1YLFA 3Q9VA 3W6KB 3C7JA 2C6YA 3GLXA 3D0SA 4I7HA 3IKTA 2E7WA 5E8GA 1ZYRF 3KZYA 4AWXB 1R5HA 1ZAOA 5ICEA 4G7OF 4G6DA 2F5FA 1KU2A 3T8RA 2XKPA 5DYMA 3HRMA 4M72A 1BI1A 1D5VA 4A0ZA 2HOEA 1S3JA 4HX4A 2ZCWA 4TV7A 2O8XA 2NAZA 1LNWA 4KN7X 1YG2A 4L5JA 4ASNA 2FNAA 2LKPA 2PQ8A 2ADUA 3C3WA 1R23A 4U7DA 1WI9A 1MJ9A 4L9NA 3QU3A 1W5TA 2LSOA 1CGPA 5LGNA 3I58A 4GGGA 1G3TA 4UVCA 1Z1DA 3N97A 2L02A 1XMKA 5F6FA 1BBYA 4Y17A 1T98A 3SFZA 4BHBA 2HYFA 4OOIA 1XCVA 3BROA 3FZVA 3CDHA 5K1YA 2PEXA 2HWVA 3LA7A 1OPCA 2CW0F 3E3VA 2CQKA 1IW7F 3GUDA 3EYIA 3V7SA 2XAHA 2HZTA 2HKOA 3L2CA 3K0LA 2E7XA 3VFZA 1E17A 2DK8A 1S7AA 1WRJA 1O7FA 1R58A 2VT2A 1BI0A 4QWQA 2EK5A 4AD9A 2FOKA 1UHWA 4BXUA 2E1CA 3KLOA 1RIOH 5L3BA 1U78A 2CGPA 1R1VA 2ZBKA 3BPXA 5H6RA 5ICCA 1PDNC 1TW2A 3FXRA 3I5UA 4ZH4F 5K5OA 2Z3YA 4L0ZB 2ESNA 5DCFA 3NRVA 4M9XA 3LQRA 1MGTA 5ED4A 4HYEA 3SZPA 2VC1A 3HRUA 1P2FA 1TNTA 4RGUA 4ON0A 1F5TA 2NS0A 3JAMZ 4Q5SF 1XGMA 1YS6A 2HS5A 4ZYDA 2BEOA 4R8HA 4ZYGA 1O3TA 1YO5C 4KNYA 2COMA 1QQIA 3GVAA 3IL2A 1B9NA 2OQRA 3F8CA 1EH8A 4WK8F 4LLGF 3U9GA 1B9MA 1F1ZA 1J7KA 3J7AO 1RUNA 4IHTA 2L01A 3RYPA 4GCVA 4OMYA 1HW5A 2A07F 2Z99A 4I98B 4BAYA 1B4AA 2RQPA 4KT5C 2L4AA 4UNOA 3ZQ7A 5DD8A 3RDIA 2OZ6A 4M74A 4UUVA 4BYYA 1TW3A 5F64A 2A61A 4CDGA 1KU7A 2DFIA 4LD5A 2P6TA 2OU2A 3GWZA 1HQCA 3WU1B 3F72A 3ELKA 4WXHA 2JSCA 2QQ9A 3E97A 5A2QK 3BWGA 1O7LA 2RDPA 4Q47A 3HTUA 2LF7A 1ZGJA 3BPVA 3IWFA 3K1NA 1XMAA 2VE8A 3FXUA 3WE3A 2FBKA 3V8KA 2KIMA 2O61A 4HA8A 4I01A 1ZGAA 4UV8A 2XGXA 3BY6A 3ZMUA 3WGGA 1REPC 2CG4A 5LHHA 2VOPA 2GA2A 4A5MA 1BI3A 4OIOF 3KFWX 3WTUC 5KK1A 5DCMA 2J5PA 4KMUX 1OMIA 1R5GA 4YFNF 2K27A 1BIAA 3IWZA 1KQ0A 4OIRF 1YIOA 4I0BA 5E1XA 3GW2A 3QPTA 4JQFA 4EGZA 4RAZA 4UHTA 2XAQA 1YW7A 1IN7A 3R0JA 5FB2A 2CSOA 4XBFA 1TQIA 1D8JA 4GXOA 1CF7A 1FBUA 3V8JA 4EJWA 3T8TA 3GFLA 2STTA 2JZYA 3DEUA 2RC4A 1CF7B 5CJ9A 1OKRA 2EJRA 2OQGA 1ZLKA 4RAYA 3RI4A 4BNCA 1IN6A 3MZYA 5LGTA 5FLXK 1WSUA 1S7OA 2VBXA 4LLLA 4A0YA 3ZMTA 2ISYA 2VC0A 4O6JA 3IKVA 3WU0A 4HQMA 4ETSA 1FYKA 1WQ2A 4EM2A 4OINF 4JBAA 3WGHA 2GIVA 2IA0A 2KJBA 3R4KA 2QLZA 3MCZA 1IZ1A 4A6DA 4B09A 1QZZA 2EV6A 2WC2A 1MDMA 1R1UA 3JTHA 4N9HA 2J5OA 2ZNZA 4AIKA 2DO7A 1IF1A 3GFJA 1USTA 2A6HF 3FX3A 1OYYA 4P5OA 1P6RA 3F22A 4RB1A 1Z05A 1ZHFA 3CUQC 2NNYA 5DD4A 4CHUA 3I4PA 1J9IA 1B1BA 2O3FA 1KA8A 2BE5F 3TDUC 2M5WA 3I59B 3TQNA 2QZ8A 5ERIA 4EM1A 1VTNC 1FP1D 1C0WA 4HDVA 1BN5A 4L9JA 2NNNA 2OBPA 3FXQA 1DUXC 2W84A 1QNTA 2XIGA 3RPUA 3LSTA 4XSZF 2FQ3A 4BHCA 1JGSA 5DUIA 5L3EA 3ULQB 3BJ6A 1UHMA 3O2PE 3CO7C 2HR3A 1LB2A 5FO5A 1YYVA 4PGHA 1U2WA 1IN5A 4LB5A 2EA4A 3TKYA 1J0RA 5AONA 2A6EF 3PQJA 2IA1A 3ZP5A 2PBIA 1I1GA 5TJJA 1HKTA 5F1RA 1EV7A 3RYRA 4EQQA 5CYVA 2L54A 2DT5A 1SD6A 2EWNA 4HX8A 2DPDA 3L00A 5HLHA 1HW2A 1W7PD 2UXXA 4ESJA 2V6CA 4JK1X 4LJZF 3SHFA 2OZUA 1XD7A 2P5VA 3BZ6A 3HSEA 2M8EA 3WGIA 2H09A 3VEPA 1IXCA 5JR3A 1G4DA 1W4MA 4MNUA 2A69F 5A2QZ 3ERED 1FZPB 1LJ9A 2Q8KA 2VE9A 3L09A 1KQ8A 2PG4A 6PAXA 5IT3A 4QLCU 1FWZA 5LLQA 2DTRA 2HKXA 1O3QA 3F8FA 5HS7A 2JPCA 1HKSA 2D45A 3QP6A 4RGXA 2D1HA 4LB6B 3P9KA 2E1NA 4KIGA 3J80Z 4L5IA 3RKWA 2Y75A 1U6GA 2L4MA 4O5VA 2EFNA 1R00A 3Q9SA 2H27A 3ML6A 3SQNA 5HS8A 2Z9OA 4KDPA 4GO1A 2RNJA 5JVTA 4HF0A 4GYGA 5D5XB 1TLHB 2V1DA 2F5DA 2GXGA 5BQTA 4KUMA 4NQWA 3ZMSA 2DLLA 3RKXA 2H94A 4I0AA 1OYIA 5BS6A 2BYVE 4ZZDA 4HLXA 3ZMVA 3L7WA 3R0AA 4HF2A 3E6BA 3E6MA 3NEUA 2D2WA 4CO8A 2DQLA 1DPUA 1BI2A 4FT8A 1H0MA 5H20A 3I54A 2DK5A 3S2WA 3GZ6A 4MQ9F 1J59A 1D3YA 3B73A 3F21A 1T39A 2HDCA 4Y15A 1QGPA 3D5LA 2XROA 4I2OA 4FX4A 4L9VA 2STWA 3RJPA 2OA4A 4EJVA 1P4WA 1U5TB 2FMLA 2AXLA 3TO6A 2VN2A 3M8EA 2LDUA 4KA4A 1HSTA 1Z6TA 2PI0A 2D1VA 1H9GA 1UCRA 1YFHA 3HHGA 2EA2A 1EH6A 1HW1A 3F8NA 1LQ1A 3K69A 1ZLJA 2NYXA 5E20A 2FE3A 1K7AA 1ZRFA 5LEJA 3HIFA 5DDGA 1LEAA 4HZFA 3J80K 4K2EA 5FFZA 4M73A 4IHSA 4XSXF 4ESBA 2FF4A 2G7UA 1SFUA 2PJPA 2AS5F 4RB0A 2OAZA 3GEZA 2EFPA 4OIPF 1WKMA 3PFIA 3COAC 1J75A 3CJNA 2XV4S 5CVJA 2W57A 2ZMEB 2ELHA 1GXQA 3ISPA 1GHCA 5L3FA 2TDXA 4O3MA 3QU6A 4PCQA 1HKQA 4UV9A 4G8XA 5CVVA 1QPMA 3PQKA 3WTWC 1Q1HA 1IAWA 4I02A 5FGMA 4NHJA 4P9UA 1FY7A 5D8KB 1O3SA 3E5QA 4MGRA 2XAGA 2PMHA 1V4RA 5LHGA 1FLIA 1U5TA 2V1XA 5ICFA 3LQQA 1EH7A 3N4MA 4RGSA 5HVQC 4CYDA 2K7LA 2K86A 4BH9A 4ENMA 1ZRCA 1IXSB 3G73A 1P4AA 4G9YA 1YQAA 4EVIA 3QRFF 1YTYA 3DV8A 2P5LC 4HV6A 2YU3A 2H6BA 4Q4ZF 1FOKA 3I71A 4MEXF 2HGCA 5ILSA 4G7ZF 2RVCA 5LBQA 2IRFG 4LG0B 3H3UA 1HSJA 2FU4A 1MZBA 4BQAA 2MLGA 3KZZA 3GO5A 2YX7A 3E6DA 1KU9A 4U0VA 1LDJA 1I1SA 1IN4A 3M7GA 3T1BA 2CYYA 3OV8A 5HLGA 1FBSA 3T0YA 1GVJA 4P55A 2V1UA 1G6NA 3RIRA 2FNPA 3JSOA 5JI6A 1BC7C 1AOYA 1ZG5A 5HDNA 3U2RA 2YR2A 3LA3A 4PZJA 2ACJA 2FRHA 2K4BA 2FBHA 5DEQA 3DPLC 1FSEA 4BHPA 2FSWA 3TOAA 1K78A 3WODF 3EDPA 3KP4A 3W6JB 3M9AA 1P4XA 4HDUA 1K78B 4XLPF 4HBLA 3GX4X 3KP6A 1XDUA 1IRFA 3DKWA 2ETHA 2M30A 2UZKA 4EJOA 5E8IA 2DBBA 3F8MA 3KEQA 4E70A 1DDNA 3ECHA 3TO9A 1W7PB 3GFMA 1RNLA 1T0FA 4HX7A 5E18F 2MD5A 4HF1A 3FMSA 3WTSC 3T5XA 2VBWA 2A3SA 2JPBA 2LNBA 3SXYA 5CVRA 1TTYA 2RKHA 1K79A 2DI3A 4L18B 1IUYA 4IRHA 5D5WB 3F3XA 1LDKB 2DQRA 2P7VB 5FD5A 3V7CA 1SMTA 3GF2A 1JE8A 2HTSA 5EEHA 4ENKA 4ENJA 1DPRA 4WXCA 1ZRDA 2G7HA 4AVPA 3ZMZA 5D6EA 5D5VB 1ZARA 4HQEA 1FYMA 1FBQA 4RGRA 2QQAA 1FNNA 2MH2A 3ABUA 4WX9A 2KIUA 2MBFA 1R22A 3ZMDA 1GXPA 5DUKA 2GZWA 3BDDA 2RN7A 3CUQB 3TOBA 3I53A 5LGUA 5LRSA 4AIHA 1FSHA 2RGVA 1T2KA 1SFEA 5E1WA 2EFOA 2K02A 1LDDA 4YG2F 3WE2A 2P7CB 4Y13A 3LAJA 4KIFA 2F5CA 1ON1A 4HOBA 4LFUA 2GXBA 4ENNA 3LFKA 5D5UB 5DV5A 1ON2A 3FF5A 3I59A 4HW0A 4CICA 4G94A 3WTYC 2A5YB 1FPQA 1HBXG 3QOPA 1BJAA 1TQPA 3CUOA 4M6YA 1PUEE 1E2XA 2HFHA 1WWXA 1AWCA 1DP7P 4LK1F 4EGYA 1IN8A 4A2UA 3HRTA 5FD6A 2ZO4A 4WXDA 1MD0A 5BMZA 3HUGA 5E1ZB 4KMFA 1FC3A 3KP2A 5CVUA 5JHUA 2BV6A 2JRTA 3SZTA 4PGGA 2HQRA 4U88A 5KVRA 1RZ4A 1ZN2A 4KIBA 4FHTA 2MA3A 2BBYA 3EUHA 1PP8F 4YIIA 4M9ZA 3ECOA 4XRFA 4R79A 3KP3A 4I09A 2IA2A 1RI7A 2P4WA 2Q2EA 4M71A 3RKYA 4S05A 3H92A 3WTTC 2OD5A 4DNCA 3J81K 5D4SA 5D8LB 2W85A 3REOA 2XASA 3EQLF 1I27A 1KU3A 3HOSA 2QVOA 3HSRA 1STZA 2IW5A 3KETA 3GZ5A 3HSFA 1P92A 3WTVC 1YW8A 1ODDA 3DQVC 4EMSA 2VOOA 4IF4A 3Q5FA 2QBYB 3MEXA 3LWFA 2QBYA 3F6OA 2IP2A 2IJLA 2P5KA 3DPTA 3KP5A 3QP5A 4NB5A 5J8CA 2PFBA 2VBYA 4IVNA 2HQNA 2VBZA 4S04A 1S8NA 4F7ZA 4FX0A 1O3RA 2DU9A 2XAJA 5ILVA 3LAPA 2XVCA 2R3SA 2YX4A 3BJAA 3DFGA 4YFKF 3CO6C 3K1MA 2BGCA 2FEZA 1XSVA 3R60A 5BPDA 1T6SA 2V9VA 1YW9A 1UFMA 5DCMB 1KQ9A 1KGSA 2DAOA 3B02A 3HYIA 5D4RA 1Z9CA 2DW4A 3HRSA 1B59A 2WV0A 3DXJF 3MQ0A 2QM3A 4PDKA 4L0YB 2M87A 2ZMEA 5ILUA 4WWCA 4LMYA 3WG9A 2EV0A 3O3KA 4G6QA 3P9CA 2XHKA 1A04A 3V7RA 3K1PA 4HLYA 2MLKA 3K9TA 4M9SA 5L3DA 2CWEA 2IPQX 1LVAA 2PN6A 1XB4A 5JFRA 3HHHA 3TGNA 1I6XA 3LA2A 2VODA 4HAMA 2LF8A 4RB2C 4EV0A 4MTDA 4WF2A 1MDMB 4IRIA 1FP2A 2CFXA 2A68F 1MKMA 1R36A 3J81Z 2R7FA 1TQMA 1IXRC 1D8KA 1B6AA 3C1DA 4ZYEA 5J6XA 1ZREA 1G3WA 4N9IA 2PMUA 1ZG1A 3I64A 2XAFA 2R7DA 1XGOA 3MWMA 2ISZA 4DQ2A 5K5QA 4U0WA 3KCCA 4UVAA 2B0LA 2EFQA 3U1DA 3HTSB 4LGWA 2P8TA 4UXNA 1FYLA 2FA5A 2XRNA 3KLNA 2QYOA 2XKOA 3KP7A 4U0YA 5CLSA 2M45A 2GWRA 3WTZA 3H3ZA 1J2XA 2ZNYA 5L3GA 4LG0A 4IRGA 4A6EA 3EYYA 2QENA 2WWYA 4EJTA 2YSRA 4L9TA 1R7JA 4LLNA 1I5ZA 4CGZA 3VB2A 3ABTA 2W24A 1KYZA 1OYWA 1K6OA 1FT9A 2HEOA 2HYGD 2EV5A 2H6CA 1TBXA 3QPHA 4WCGA 2VONA 1F9NA 2O6GE 4HV5A 4OMZA 1XSDA 2YPRA 1XGNA 4YFXF 1JHHA 5LRRA 4P9FA 5CVIA 3G3ZA 3CLOA 1R1TA 1W5SA 3M1EA 1G3YA 1BC8C 4A5NA 4YIFA 5LHIA 3E5XA 2QWWA 3IRQA 5HLIA 5ICGA 1FX7A 2EB7A 4XLNF 2O03A 1XGSA 2UXNA 2EFWA 4M6XA 2ZJ2A 1J5YA 2O0YA 2JT1A 4KYWA 2UWMA 1L3LA 4KN4X 1SD7A 2ZKZA 3V4GA 4P96A 2MH9A 2RV8A 1O57A 5L3CA 2HTJA 3F8BA 3OOPA 4CXFA 3P7NA
chains in the Genus database with same CATH superfamily
5K7HA 5JLWA 1MJAA 1F36A 2GLOA 1XN7A 2R4GA 3GYHX 1TWCJ 2KQRA 1T08B 1T8IA 3BZCA 3C18A 3OMYA 3BOQA 3K70D 2NRAC 2X4HA 1L0OC 2B7EA 5D6FA 5AIPA 1QBJA 1ENHA 5EZGA 1USSA 2M1BA 4CZCA 4BQQA 1UB9A 3ROUA 3NQOA 2R93J 3KEOA 1IRGA 4LIUA 3HOXJ 3JW4A 1QO0D 5BPIA 3BCBA 4E7KA 3ZPLA 2X85A 3TO7A 5HDKA 2R5YB 2GA1A 3MFKA 2PLYA 3OS1A 4BS9A 3EETA 2GAUA 3GTLJ 2EZHA 3FWEA 1YI2I 1JGGA 4HSTA 1IV8A 2IT0A 2V26A 2FMYA 4MQVA 3GFIA 5HDGA 4BKXA 3FMRA 3DLLF 3AKZA 1UAAA 3FXKA 5JLXA 2JTVA 2IS1A 5JVGF 4ZDOA 1HC8A 2Z16A 4OIQF 1DU0A 5H6QA 3OYJA 4PJJA 1V5EA 1UELB 2P6SA 3FM5A 1ULYA 4PJLA 5EEGA 3ZN1A 3BQYA 2Y0MA 3JSPA 2LY1A 2F2EA 2DA3A 5M5XJ 4ZZLA 1V3FA 1F4KA 4H0EA 4IJAA 2HOAA 1SFXA 4E7HA 3KZIC 1AKHB 3R6SA 1Z6RA 2HOTA 3PFYA 2XUBA 1LFUP 2I5UA 2M34A 2MC3A 2KKOA 5BOXA 3JRHA 1MMSA 1YS7A 1TNSA 5E17F 3TDZC 1ZK8A 1Y0UA 1YHQI 4RB3C 1OCZH 2DPUA 1OR7A 2R7WA 3BR6A 2FBIA 1SD5A 3CUQA 2QUFA 1YE9A 2EILH 2KIQA 2KIFA 3M8FA 3L9FA 3OSGA 1FOXA 1X1BA 4UB8C 3J7AY 4W97A 1U5TC 1ZG3A 2QF7A 2MGQA 3A03A 4EJUA 2D5VA 1LFBA 3MKLA 2CJJA 3KX2A 3CLQA 5LEKA 4BY1J 1X3UA 1Z77A 3F23A 1Z3XA 3IHUA 3CCRI 1LEBA 1YJ9I 3PUFA 5IT9K 3VODA 1T38A 2L3DA 3MZHA 1H89C 4EM0B 2K4JA 3OL4A 2Q2EB 2F5EA 2VKVA 4ABZA 3DF8A 5IT9Z 2NOGA 4A3CJ 4A12A 4FQGA 3DBRB 5IPAA 5FLXZ 3FHZA 4M3DA 4B8XA 3GTKJ 1YX5A 1Z0XA 3IH3A 3CCEI 4Z2YA 2VJ4A 4U7BA 1JKOC 1NHAA 3HEFA 1QZYA 2ZXJA 4H4KC 5HOOA 3V8LA 2Z2SB 5K5RA 3JTGA 3KIOA 1YIJI 1YRNB 5E3MA 1S6LA 4R1HA 3RTRA 4XICA 1RUOA 4Q48A 3P9IA 1KYWA 4CZZA 2DT6A 3HC7A 1WHUA 2HPIA 5CKTA 1JXSA 5J47A 2EBIA 1Z91A 2KJCA 1U8RA 2WTEA 2X6XA 3BJOA 3IC7A 3CD6I 2QSGX 4MEYF 2LP0A 4UUTA 1S29A 3BTLA 3F6VA 3GBGA 2LOOA 1PP7U 2MD0A 3E5UA 3FKIJ 3I0TA 3BP8A 1ERDA 1HXDA 3ZN0A 1ORKA 1Z7UA 1EKEA 3HGYA 3QAHA 3QPLA 1WVRA 3H5AA 3IRRA 5FFXA 5J1YA 2ZFWA 3AAFA 2KRFA 1R49A 3RCOA 2KISA 3OIQA 2W25A 3RPQA 5IOYA 3FM3A 3CESA 3FMQA 4N0BA 1U3EM 1WJDA 2ZB9A 3E6CC 3DP7A 2QCOA 1TZLA 1SAXA 3Q3SA 2FXAA 4V19K 2IVMA 4BDYA 2L7FP 1H9TA 4ZYHA 4ZDLA 4MTEA 4RS8A 4AIJA 1ZH5A 3S15J 2E35A 3KE2A 4NUBA 3HOTA 1W7PA 1ZELA 3IP4B 2HQAA 1LVKA 1ETVA 5TRDA 4A3GJ 1BOAA 4XR6A 3GZNB 2L7ZA 2QQ8A 4GYIA 2HXOA 2VT3A 1JHFA 4IL6C 5J1RA 1SD4A 3R61A 2Y48A 4KFCA 2L9VA 4G7HF 1IUFA 5AIQA 2Y9ZA 3VOEA 4E7ZA 2X0LA 2GOXB 3CTAA 4UVBA 1YRNA 4XLAA 3K2ZA 1A36A 1CQTA 4KICA 1XDSA 2V9PA 2ZSIB 2ESHA 4D0PA 3LSMA 1BIBA 5J8FA 3WTXC 4ESFA 2QQBA 1XC5A 4RAFA 3LSRA 2NVXJ 2G9WA 1BM9A 4MHGA 2CO5A 2IEKA 2Z5UA 1ZR2A 4IXAA 2V79A 3GXOA 3GTQJ 5HS9A 1K61A 5LD2C 4Y52J 3CP8A 4BUPA 2Q0OA 3S17J 1U0JA 1MJBA 2GQQA 1HOMA 4BEHA 4OU0A 4F3QA 4X6AJ 2ZSHB 4BEHB 3TBIA 4JX6A 5IP6A 2E71A 2CUJA 1SMYF 2PJRB 1TL8A 1D1BA 4IPAA 1ETXA 1G3SA 1XSXA 4JX4A 1ONVA 3WHBA 3O6BB 4LK0F 3JAMK 2VXZA 5CQGA 3MAJA 4A0XA 2ZMEC 4M3FA 2CW7A 2Z33A 2FOWA 2AO9A 1XCBA 1YLFA 3ONQA 3Q9VA 3W6KB 3C7JA 2C6YA 3HOWJ 3GLXA 3D0SA 4I7HA 3IKTA 4B3AA 2E7WA 1VQ8I 5E8GA 1ZYRF 5GAHJ 3KZYA 3LSGA 4AWXB 1R5HA 1ZAOA 4GDFA 1D5YA 5ICEA 4G7OF 2LTPA 2VJJA 2BY1A 2YUSA 4G6DA 2F5FA 1KU2A 3T8RA 2XKPA 3QOEA 5HNFA 5M5WJ 5DYMA 3HRMA 4M72A 3K2AA 4CCLA 1BI1A 1FOYA 2R7ZJ 1D5VA 2Y30A 3ZQGA 1WPKA 4A0ZA 2HOEA 1S3JA 4HX4A 2ZCWA 4TV7A 4CCJA 3TP3A 1X4OA 2O8XA 2NAZA 3H5NA 3KPHA 1LNWA 4KN7X 4BACA 1YG2A 1NG7A 4L5JA 4ASNA 3ZCOA 2FNAA 2LKPA 3I9V2 4HEA2 1Y8RB 4NC7A 2JMWA 2PQ8A 3SEZA 2ADUA 4QPOA 1RESA 1R23A 3C3WA 3K6GA 5IP9J 1WI9A 4U7DA 1MJ9A 4L9NA 4D1QA 3QU3A 3FKJA 1W5TA 2LSOA 3OYHA 1CGPA 5LGNA 3I58A 4GGGA 2B63J 1G3TA 2R7QA 1XX5A 4IQ4A 2V1NA 5E79C 4UVCA 1Z1DA 3I56I 3A4CA 3CF2A 3N97A 1OJLA 2L02A 1XMKA 4E4HA 2E5NA 5F6FA 3D5RC 2F5VA 1A6IA 1BBYA 4Y17A 1T98A 1HCRA 3SFZA 2K9NA 4BHBA 1MMDA 1H8AC 2BXYA 4S0HB 4MFDA 1X3WB 2EZIA 3LSPA 1GV2A 2HYFA 2VLAA 2BZTA 1GDTA 4OOIA 1XCVA 3BROA 3FZVA 3BR3A 3VPRA 1FIAA 3CDHA 4C9YA 5K1YA 2PEXA 2HWVA 3LA7A 1OPCA 2CW0F 3E3VA 3OIPA 2CQKA 1R5ID 4GRIA 3OOUA 1AA7A 3AG2H 3GUDA 2DMUA 1IW7F 2CRGA 2M0MA 2M7BA 3EYIA 3V7SA 4IZZA 3DU5A 4XRMA 3MKWB 5J4YA 2LKXA 2XAHA 2HZTA 3PO2J 2HKOA 3L2CA 3K0LA 1IRXA 2E7XA 2IGOA 3VFZA 2QA4I 1E17A 2DK8A 1S7AA 1GV5A 3H9QA 1WRJA 1O7FA 1R58A 1MH4A 2VT2A 5J1UA 1BI0A 4QWQA 1E3PA 1MMAA 4ZDPA 3BG3A 2EK5A 1PUFA 2DOEA 3OWTA 4AD9A 2FOKA 3H35A 2DYSH 1UHWA 4BXUA 2E1CA 3KLOA 1W0TA 3RZDJ 2GIZA 1RIOH 5L3BA 3E0JB 3FBNB 3QYFA 1U78A 1R1VA 2ZBKA 3BPXA 2CGPA 3W2AA 5H6RA 5ICCA 4XK4A 1PDNC 3BTJA 4I76A 1TW2A 3ZQQA 3FXRA 4AM3A 3I5UA 2DCEA 4ZH4F 5K5OA 2Z3YA 4L0ZB 1D1AA 2ESNA 5DCFA 3NRVA 4M9XA 1FTZA 3LQRA 1MGTA 5ED4A 4HYEA 3SZPA 2VC1A 5FLVA 3ZQFA 3HRUA 1P2FA 1ETYA 1TNTA 1XG1A 3F9KA 4RGUA 4ON0A 3AG3H 1JUMA 2QGUA 2DODA 4XORA 2VL8A 1F5TA 3G6EI 2NS0A 3JAMZ 4Q5SF 1XGMA 4IHYA 1YS6A 1RR8C 2EPFA 2E5ZA 3K4MA 3ZQCA 4BJ6C 2HS5A 4ZYDA 5GPAA 4II3A 2BEOA 4R8HA 5E3OA 5B66C 4ZYGA 1O3TA 2HDWA 2XRLA 1YO5C 2A5WA 2COMA 1MSFC 4KNYA 4HNUA 1QQIA 1HDPA 2JUCA 3GVAA 4AYBA 3IL2A 2KMUA 5IOZA 1B9NA 2OQRA 5K7ZA 1N75A 2L9RA 3F8CA 1OISA 1EH8A 4WK8F 4C3JJ 1BOBA 4LLGF 2P0WA 2VQCA 3U9GA 1B9MA 1F1ZA 2LMDA 1J7KA 2X6WA 5DTDA 4BXXJ 2W7NA 3J7AO 1RUNA 2E36A 4IHTA 2L01A 4A3KJ 4DZPA 3L1PA 2NXNB 5B1BH 4MO7A 2IS6A 1NH3A 2G0EA 1D0YA 4GCVA 3RYPA 4IQJA 1HW5A 4OMYA 2A07F 2CUZA 2Z99A 3CCSI 1UHSA 4F91B 4I98B 4BAYA 3PUBA 1B4AA 2DTZA 1Y56A 2RQPA 4KT5C 2L4AA 2IAIA 5EZHA 4UNOA 3ESWB 3ZQ7A 2COBA 2JUGA 2ECCA 1BR1A 2OZ6A 4FETA 5DD8A 3QODA 3RDIA 4XLHA 1VFCA 4M74A 4UUVA 4BYYA 1JT0A 1TW3A 5F64A 4ANJA 2A61A 1DGWY 1NTCA 1SVLA 1TWHJ 3C2HA 4CDGA 5FROA 1KU7A 1LUJB 2OTJI 1ITYA 2DFIA 4LD5A 3ZRGA 4J00A 2P6TA 1UG2A 2EIKH 1EA3A 2OV7A 2OU2A 3GWZA 3GTPJ 1HQCA 1T56A 3WU1B 2JVGA 3F72A 4FISA 3ELKA 4WXHA 3VYUB 2JSCA 2QQ9A 4D7NA 2ELJA 3EPZA 3E97A 4BBSJ 5A2QK 3BWGA 1O7LA 2HXIA 2KL4A 2RDPA 1ETQA 2VB6A 4Q47A 1JT6A 2GOMA 4D9JA 3HTUA 4A3JJ 1N25A 1V5GA 2LF7A 1ZGJA 3BPVA 1N77A 3IWFA 3OYBA 3K1NA 3S1QJ 2E1MC 1XMAA 5KAFC 2A05A 3B6AA 2K85A 2MSYA 4BU2A 1IDZA 3OR2C 1TT5B 2VE8A 1W1WE 3FXUA 3W6VA 3WE3A 2FBKA 2MG4A 3PNVA 3V8KA 2KIMA 2O61A 4HA8A 4I01A 1MBKA 1ZGAA 4UV8A 2XGXA 2N8GA 2M3AA 3BY6A 3ZMUA 3WGGA 1W0UA 1QA6A 1VQKI 1REPC 4XLEA 2CG4A 2Y9YA 5LHHA 1OR7C 1BL0A 5LFAA 4A3MJ 2VOPA 2GA2A 4A5MA 1MH3A 1BI3A 3LSKA 3VSKA 2E2IJ 2E34A 2DFFA 4OIOF 5TISC 3I55I 3KFWX 1OCTC 3WTUC 5KK1A 5DCMA 2J5PA 2W82A 3I3LA 3C2GA 4MIMA 4KMUX 2WY7Q 4NDLA 1OMIA 1R5GA 3G71I 5F27A 5CPRB 4MLOA 4YFNF 3FXOA 2K27A 1BIAA 1WJBA 3IWZA 1ZR4A 1KQ0A 4LIVA 4BE0A 4OIRF 1YIOA 4I0BA 1Y39A 5E1XA 5HNHA 3GW2A 1BA5A 2DA5A 1P7IA 3QPTA 4JQFA 4DYCA 3CCMI 5GTHC 4EGZA 4RAZA 4UHTA 1QPIA 2XAQA 3BTCA 1YW7A 1LFPA 3HZJA 1EF4A 1IN7A 4EATA 3R0JA 5FB2A 2CSOA 2X1CA 1ETWA 4XBFA 1TQIA 2DA4A 1D8JA 4YEJA 1IJWC 4GXOA 2DOFA 1CF7A 1FBUA 3V8JA 1TT0A 1GVDA 4EJWA 3T8TA 3GFLA 1WJAA 1FJLA 2STTA 2JZYA 3DEUA 3Q0VA 2RC4A 4D5FA 1Y8QB 4UB6C 1CF7B 5CJ9A 2H8WA 1OKRA 2EJRA 2MC4A 2OQGA 1I3QJ 1ZLKA 4RAYA 1QZEA 3RI4A 2A6TA 4BNCA 1IN6A 2XPUA 5FJ8J 1Q1VA 3MZYA 3DLAA 1U9NA 5B1AH 4YIRX 5LGTA 5FLXK 3K7AJ 2VIXA 4DW6A 2LY9A 3OYCA 2Y69H 3SEQA 4RDUA 2BHYA 5JHFA 1VI0A 3E1SA 1WSUA 1S7OA 4PFPA 2VBXA 4LLLA 2LRDA 4A0YA 3ZMTA 2X6YA 2ISYA 1RC9A 3LFUA 1WJFA 2VC0A 4O6JA 2JRMA 3FHNA 3IKVA 3BZKA 3WU0A 2OC6A 4HQMA 2IS2A 3HG9A 4ETSA 1S72I 4DJAA 3A0HC 4CYCA 2L2OA 4F55A 1FYKA 3A1YA 3CDIA 2QSFX 1WQ2A 4IHWA 4EM2A 2B9SA 3TW7A 1MBEA 1YJNI 4NC6A 4OINF 3PIOF 3DKYA 2ELKA 4JBAA 4PSWA 3RPUD 3WGHA 2R7SA 2GIVA 2VXDA 2E1OA 2IA0A 2KJBA 2JA2A 5EF6A 3R4KA 3EUHC 3OYAA 1I3AA 4AYBN 2QLZA 3OR1C 4XOPA 3MCZA 2EQRA 1IZ1A 4A6DA 4DYQA 4B09A 1QZZA 2EV6A 3PJRA 3OYEA 2WC2A 1MDMA 1X1PA 1R1UA 2DMQA 2HI3A 3JTHA 3U1KA 4BQNA 3DWLE 3KYDB 2LR8A 4N9HA 1H88C 2J5OA 2ZNZA 4AIKA 1P9QC 2DO7A 1OCPA 1IF1A 1DP3A 2WBMA 3GFJA 3JRIA 2V4JC 1SFOJ 1USTA 2A6HF 3FX3A 1Y1VJ 1OYYA 2XB0X 4P5OA 3AL0B 1P6RA 4E7IA 4ZYAA 3F22A 1P7JA 2KZGA 4RB1A 3FISA 4B4CA 1Z05A 2DMNA 1ZHFA 3H0DA 3CUQC 3DKXA 4XKBA 5DD4A 2NNYA 5IYBJ 3DBHB 3CMEI 4FCYA 4CHUA 2JA6J 3I4PA 1J9IA 2HNHA 4KISA 4BE1A 2W00A 2O8KA 2E2JJ 2WB1N 1B1BA 1X2MA 2O3FA 1KA8A 1FOWA 1MMGA 3ABKH 4NBQA 4RBOA 2BE5F 2YU9J 2EIJH 2V9KA 4A3LJ 2JA8J 4LG3A 1POGA 3TDUC 3WU2C 2K9LA 2M5WA 3I59B 3TQNA 1BR2A 1JUSA 4CCOA 1B72B 2QZ8A 5ERIA 4DZJA 4EM1A 1VTNC 1FP1D 3S16J 2F4MB 2ME6A 1WJEA 1XTAA 1C0WA 3JCUC 4HDVA 1BN5A 2CUFA 4L9JA 2NNNA 2OBPA 2XDVA 2M8GX 3CJRB 1T95A 3NWSA 2CH0A 3FXQA 1DUXC 1A5JA 1V5FA 2W84A 4BDZA 5GPCA 1QNTA 1NG6A 2XIGA 3L2WA 2XAUA 3RPUA 5BNGA 3LSTA 4XSZF 5EG0B 2FQ3A 1R71A 4BHCA 3CCYA 1JGSA 5DUIA 4QTRA 5L3EA 3ULQB 2ID6A 3JREA 3HOUJ 3X2QH 3BJ6A 1UHMA 2EZKA 3O2PE 5C44J 1VQ5I 3CO7C 2HR3A 2CV2A 2WAEA 1LB2A 5FO5A 1YYVA 2HZDA 3MVPA 3OS2A 4PGHA 1U2WA 1IN5A 2DOAA 4RMNA 4LB5A 4A69C 2R7RA 2EA4A 3TKYA 3MD2A 1J0RA 5AONA 2A6EF 2WA0A 1DQUA 2IA1A 3PQJA 2VPLA 4M3BA 2PBIA 4ZC3A 4BGDA 3ZP5A 1I1GA 5TJJA 3CC4I 1HKTA 3CJQB 5F1RA 3ABLH 3S2HJ 2OPTA 1DU6A 1EV7A 2DA1A 4I6ZA 4C2MJ 1R4MB 4RLQA 2IXSA 4YELA 3RYRA 2V6EA 4EQQA 5CYVA 2XC7A 2L54A 3DTIA 5EG0A 2DT5A 1SD6A 1PYVA 4F52A 5KNLA 2EWNA 3A2KA 4HX8A 1UMQA 2IGKA 2VKHA 2DPDA 2M0CA 3K10A 3L00A 5HLHA 3JRGA 1HW2A 1JTXA 3I4MJ 3BG9A 2K5CA 1W7PD 3JR9A 2UXXA 2KDOA 4CCKA 2GM4A 5CQEA 1K4TA 1VQOI 4BXFA 4ESJA 2IBDA 2W1OA 1V54H 2V6CA 4JK1X 4XRSA 1FTTA 4LJZF 3SHFA 2OZUA 1XD7A 3G1OA 2P5VA 3CCUI 3BZ6A 1UJ8A 3DEWA 1GLNA 4F93B 3CMYA 1VQ9I 3HSEA 2M8EA 3SDBA 1OCOH 3WGIA 2H09A 4HNTA 3VEPA 1IXCA 4UUSB 5JR3A 1VQ4I 4GFBA 2TRTA 1G4DA 1PUFB 1W4MA 4RM3A 4MNUA 3SJMA 1Z3YA 2A69F 5A2QZ 3ERED 1FZPB 1LJ9A 2Q8KA 2VE9A 4NQWB 4IOCF 3L09A 1KQ8A 2E19A 3ZXSA 2PG4A 6PAXA 3C2BA 2GBYA 5IT3A 4QLCU 1FWZA 5LLQA 2DTRA 2DYRH 1VQMI 1OFCX 2HKXA 1O3QA 4DBQA 3F8FA 5HS7A 2JPCA 2LY2A 1LPQA 4YRVA 1HKSA 2BOLA 3K4BA 3BG6A 2D45A 2Y0SA 2LG4A 3QP6A 4RGXA 2NVUB 2D1HA 4LB6B 3P9KA 2E1NA 1MSEC 4KIGA 4DIQA 3J80Z 4L5IA 1VQ7I 2KDZA 3H9GA 3RKWA 3Q0UA 2Y75A 3HL2A 1U6GA 2KHMA 2L4MA 2L9SA 4O5VA 2EFNA 2RAEA 1R00A 1RKWA 3VSLA 3TEDA 4Z6YA 3Q9SA 1MMNA 2VPRA 2O7OA 1MNEA 1LE8B 2H27A 3ML6A 3SQNA 1V55H 2MFZA 5HS8A 1PVEA 2Z9OA 5M3MJ 4KDPA 5F1JA 4GO1A 2RNJA 5JVTA 2XF7A 3S2DJ 3HKZA 4HF0A 4GYGA 4FTHA 1S5LC 2KRCA 1TLHB 2V1DA 5D5XB 1JJ8C 2F5DA 2GXGA 3KEYA 4X0GA 1ACIA 3BR2A 5BQTA 2M4KA 2KRHA 3RSNA 4KUMA 4NQWA 3ZMSA 2DLLA 3RKXA 2BVLA 2K9QA 3LNQA 1LKXA 2DA2A 2H94A 4I0AA 1OYIA 2FD5A 5BS6A 2BW3B 2CV0A 3HGGA 2BYVE 4ZZDA 4HLXA 3ZMVA 3L7WA 5IYCJ 3R0AA 2LLKA 3E6BA 4JX5A 4HF2A 1FMWA 5B3SH 3OS0A 1JKPC 3E6MA 3NEUA 2D2WA 3JRCA 4CO8A 2X48A 2DQLA 1DPUA 5F0FA 1IC8A 1BI2A 4FT8A 2JN6A 3TMOA 1H0MA 2Q1ZB 5H20A 4XOTA 4UY8I 3I54A 2DK5A 3S2WA 3G1MA 3BR1A 2FQ4A 3QYBA 4XM3A 3GZ6A 4MQ9F 1AHDP 2NOJB 1U8BA 1J59A 1D3YA 1BW6A 3B73A 3F21A 2JA5J 4JP0A 1T39A 1O4XA 3CC7I 3HM5A 2HDCA 3IAS2 4Y15A 1QGPA 3D5LA 2KFDA 1QVTA 2LBFA 5IYDJ 2XROA 3FK7A 4I2OA 4FX4A 3M07A 4L9VA 2STWA 3RJPA 3PNTA 2OA4A 2WAFA 4EJVA 1P4WA 4XRSG 5J40A 4PJ0C 4E7SA 3GTGJ 2NVQJ 1U5TB 4II2A 3QWLA 2FMLA 2AXLA 3TO6A 1R9TJ 3CQZJ 2M2EA 1MNMC 2QKLB 2VN2A 1K4SA 3M8EA 2LDUA 2FJ1A 3PSFA 4KA4A 1FEXA 2O5RA 4P1WA 1HSTA 4RM2A 1Z6TA 4PSXA 2LK2A 3HOYJ 3A01B 2VQHA 2PI0A 5B5EC 3BR0A 2D1VA 1H9GA 3S3OA 1UCRA 1F43A 3TP0A 3O8HA 3S32A 1NK3P 1YFHA 2O9LA 3HHGA 2EA2A 3A02A 1EH6A 1EJ9A 2HYJA 1HW1A 3F8NA 1JI8A 1LQ1A 3CDLA 3H1CA 3K69A 1ZLJA 2NYXA 2LVSA 4ZTFA 5E20A 2FE3A 1K7AA 2CQNA 1GT0C 1J09A 1ZRFA 2WADA 2DMPA 5LEJA 4IKFA 3HIFA 3GTOJ 5DDGA 1LEAA 3DU6A 4HZFA 3J80K 4K2EA 5FFZA 4M73A 4IHSA 3DEEA 3S1MJ 2ICWG 2QKMB 3U21A 4JYKA 4XSXF 4ESBA 1TWGJ 3A0BC 2FF4A 2R5ZA 2G7UA 1QHHD 3MN2A 4LOCA 4OAYA 1SFUA 2PJPA 2VKEA 2M7AA 5GTIC 2AS5F 4RB0A 2OAZA 3GEZA 5EEAA 4U87A 2EFPA 4OIPF 4UUSA 4OWRB 1WKMA 3PFIA 1T0FC 3FXLA 3HPGA 3COAC 1J75A 3CJNA 1K6YA 2ID3A 5C4JJ 4E7LA 2XV4S 2CQQA 5CVJA 2W57A 2ZMEB 2ELHA 1GXQA 3ISPA 3FK6A 3CZ6A 1GHCA 1X58A 5L3FA 2F6CA 4D7MA 2TDXA 3SDGA 4O3MA 5HLTA 4KITB 2M4GA 3QU6A 4W1UA 4PCQA 1HKQA 4UV9A 2DA7A 3OL3A 1A31A 3G4SI 2CQ7A 4G8XA 1X3ZB 5CVVA 1QPMA 3PQKA 3WTWC 1Q1HA 1IAWA 4C30A 3IH2A 4I02A 3VWBA 2WB1A 1K83J 4AC0A 5EGOB 5FGMA 1YITI 2X6OA 1RETA 4NHJA 4P9UA 1FY7A 4DBRA 3OIOA 1G8XA 1WH5A 5D8KB 1O3SA 3E5QA 4MGRA 2DN0A 4IHVA 2P81A 5F0CA 1VQ6I 3BQZA 2XAGA 3BG5A 2HU9A 1TWFJ 3DTEA 3JRFA 2PMHA 4B3XA 2K40A 3FXMA 3S93A 1V4RA 2LKSA 5GAGJ 5LHGA 4BY7J 4XQFA 2FUG2 3OYDA 2ZXIA 3L2QA 1FLIA 3EUAA 1U5TA 2V1XA 4A3FJ 5ICFA 2VJ5A 3LQQA 4J01A 2HPMA 1EH7A 3JRDA 3N4MA 3JRBA 2JSPA 4RGSA 4AVZA 2BVMA 3NWTA 5HVQC 1X19A 3DBLB 2CV1A 4CYDA 2K7LA 1R4NB 1ZTRA 5FKMA 2K86A 3FDYA 4BH9A 4ENMA 3HKZN 1ZRCA 4V2FA 1IXSB 5EGOA 3G73A 1P4AA 4G9YA 1YQAA 4EVIA 2YS9A 3QRFF 1YTYA 3DV8A 2V7FA 2P5LC 4HV6A 2XGCA 2YU3A 2H6BA 1IO2A 4Q4ZF 4RLFA 3BR5A 2XSJC 1FOKA 3I71A 4MEXF 3RZOJ 1X2NA 2R7OA 4XLFA 4QIWN 1MBHA 2BHZA 3CP2A 2HGCA 5ILSA 4XKWA 4G7ZF 2QEXI 2RVCA 5LBQA 2IRFG 4LG0B 3H3UA 1IGNA 1HSJA 3BC8A 1B72A 1FIPA 2FU4A 1MZBA 2OTLI 2ZXHA 4BQAA 2MLGA 3KZZA 3GO5A 4L5EA 2BW3A 2YX7A 3E6DA 5FLMJ 1KU9A 4U0VA 3HBLA 1LDJA 3MKZA 1SAUA 2PJRA 1I1SA 1IN4A 2X1DA 1JKQC 3M7GA 1VF9A 5FKOA 3T1BA 3ZQIA 3J7YJ 1WCMJ 2CYYA 3OV8A 5HLGA 3IH4A 1FBSA 3T0YA 1KZHA 1GVJA 1X1DA 3DPUA 2CFOA 4P55A 4B48A 2V1UA 1G6NA 3RIRA 2FNPA 1I39A 3FXJA 3JSOA 3CF5F 5JI6A 2WAQN 2LFBA 1BC7C 1TP4A 1AOYA 2L7MP 1ZG5A 5HDNA 3U2RA 3VYTB 2YR2A 2E60A 1WFXA 3LA3A 1A35A 4PZJA 2ACJA 2FRHA 2K4BA 1VNDA 2FBHA 5FKNA 4PJNA 3W3CA 5DEQA 3DPLC 5FRNA 2M9HA 1FSEA 4AUXA 4B47A 2F4IA 4BHPA 2RREA 1JTYA 1VZ0A 2FSWA 4NC8A 3TOAA 1K78A 3NARA 3WODF 3OY9A 3EDPA 3KP4A 3W6JB 2R7XA 4C3IJ 3G2BA 4J19A 4PJMA 3M9AA 1P4XA 1YOVB 4HDUA 2BY0A 2LD5A 3ASOH 4XMYA 1K78B 2OCEA 4XLPF 3BT9A 4HBLA 5TGTA 3GX4X 3KP6A 3K4NA 2EH3A 1XDUA 3QPSA 3S1RJ 1IRFA 4KJZA 3DKWA 3GCMA 3UKGA 2ETHA 2M30A 2UZKA 4EJOA 5E8IA 2ZC2A 2DBBA 3F8MA 3A01A 4XKCA 2TCTA 3KEQA 4E70A 1DDNA 2DDAA 3ECHA 2K3PA 3TO9A 5M5YJ 1W7PB 4M6VA 3GFMA 2Y0SN 1RNLA 2X1EA 1MBFA 4F92B 1T0FA 2I8DA 4HX7A 5E3NA 1WZ2A 5E18F 2MD5A 2HQ5A 4HF1A 3FMSA 3NAUA 4KT6A 1DGRM 1HA8A 3PIPF 3WTSC 2CUEA 5KCMA 1E3OC 3T5XA 2VBWA 3ASNH 3CCJI 2A3SA 1OCCH 1R6RA 2JPBA 2LNBA 2WY8Q 2QSHX 4RAGA 3SXYA 5CVRA 2K9MA 2LC2A 2MW8A 2XGDA 3OYLA 1I6HJ 2JQ7A 1VQLI 4XL9A 1TTYA 2RKHA 2LBFB 5J3LA 2VUMJ 3BLYA 1K79A 2DI3A 3P5JA 4L18B 4JOMA 1IUYA 2CMPA 3GTJJ 2AQFA 4CSWA 1W36D 4ZJZA 4IRHA 5D5WB 3F3XA 1LDKB 2FX0A 3D1NI 1OQYA 2DQRA 2P7VB 5FD5A 3V7CA 3DCFA 2KT0A 1SMTA 3GF2A 1TC3C 1JE8A 2MYSA 1SEUA 2HTSA 3L2VA 5EEHA 4ENKA 4ENJA 2WAQA 1DPRA 4WXCA 1ZRDA 4FE7A 2G7HA 3BTIA 4AVPA 1M1EB 2F4OB 2VI6A 3ZMZA 5D6EA 2DDBA 3OYMA 1ZQ3P 2XB5A 3GLLA 3G1LA 2E2HJ 3H9JA 4IX7A 4PK4A 5D5VB 1ZARA 2UV1A 4XIDA 1FBQA 2R5YA 4RGRA 4HQEA 1FYMA 2QQAA 1FNNA 2MH2A 3ABUA 3LOCA 4WX9A 2KIUA 2MBFA 1R22A 3ZMDA 1GXPA 2H1KA 3S1NJ 3M4OJ 4C2UA 5DUKA 2GZWA 3BDDA 1VQNI 3IV5A 2RN7A 3CUQB 4V2GA 3TOBA 3I53A 5LGUA 5LRSA 2DFEA 4AIHA 3CC2I 2L0KA 3QQAA 3DTKA 1NK2P 3V42A 1FSHA 2RGVA 1T2KA 1APLC 1SFKA 1SFEA 5E1WA 2MABA 4HNVA 2EFOA 2CU7A 2PMZN 2K02A 1JJ6C 2KP6A 2JJ7A 1LDDA 4YG2F 1WJ5A 3WE2A 3ZOBA 2OUMA 3K4LA 3CMAI 3M8JA 2Y2ZA 2P7CB 9ANTA 4Y13A 4A3IJ 3LSIA 4HRIA 1XPXA 2RQQA 3LAJA 1T33A 1MIJA 2XPVA 4KIFA 3VYRB 2F5CA 4IHXA 1ON1A 4HOBA 4LFUA 2GXBA 1MBJA 4CH7A 4ENNA 3LFKA 1E3HA 2NVTJ 5D5UB 5DV5A 5HODA 1ON2A 3FF5A 3I59A 2CS3A 1FMVA 4HW0A 4CICA 4BJ5C 4G94A 1D0XA 5E3LA 3WTYC 2A5YB 1FPQA 3OYNA 1HBXG 2H8RA 3HDDA 3LSHA 3QOPA 1Z7LA 3TL4X 3M1CA 1BJAA 1TQPA 3CUOA 4M6YA 5DM7F 1Z21A 3S3MA 1MW7A 2DA6A 3LSJA 1PUEE 1E2XA 3GTMJ 2HFHA 1WWXA 2BY2A 2LREA 1WH7A 4HSRA 1AWCA 1DP7P 4LK1F 4EGYA 2AXTC 2I10A 3H3VK 2EIMH 2JVHA 1IN8A 3H0GJ 4A2UA 3HRTA 5FD6A 1Y1WJ 2XPWA 2ZO4A 4WXDA 1MD0A 2VJIA 1W5CC 5BMZA 3HUGA 5E1ZB 3ZGKA 4IOAF 1KONA 1PJRA 4KMFA 2AHQA 1FC3A 3KP2A 4NNJA 5CVUA 1RPWA 5JHUA 2BV6A 2JRTA 3SZTA 4MFEA 3ABMH 1WGXA 2LYCA 2HQRA 4PGGA 1D0ZA 4U88A 5KVRA 1RZ4A 1ZN2A 3PSIA 4KIBA 4Y4RA 1Z67A 4FHTA 2MA3A 2XSDC 2BBYA 3EUHA 1PP8F 2WV1A 4YIIA 5C3EJ 4I99C 4M9ZA 3ECOA 4XRFA 4R79A 1X1AA 3KP3A 4DOZA 2HDDA 4I09A 4XLCA 2JWTA 2ZXWH 2L7KA 4Y3OA 2IA2A 1RI7A 4N4NB 4CUGA 2P4WA 2Q2EA 4M71A 3RKYA 2RNGA 4CCMA 4S05A 3H92A 3WTTC 4XKVA 2OD5A 4DNCA 3I4NJ 3J81K 4ZTJA 2K3FA 1SVOA 5D4SA 1ETOA 1A6QA 5D8LB 4FASD 2W85A 3REOA 2XASA 2CW8A 3EQLF 2HVSA 1I27A 1KU3A 5IP7J 4BJTA 2R7UA 3HOSA 2QVOA 3HSRA 1E0EA 1STZA 2IW5A 3UR3C 3KETA 1WI3A 1SVMA 5F0HA 2W4SA 3LMMA 1AKHA 2EZLA 3GZ5A 5FKKA 3HSFA 3H5RA 4B1RA 4DYRA 1P92A 2F48A 3WTVC 2IS4A 1YW8A 3WG7H 2XGEA 1ODDA 4M3EA 3DQVC 3MKYB 3SFIA 2AQEA 2W48A 4EMSA 2OF7A 5DS9A 2VOOA 3S3NA 1XS9A 2Z1DA 4IF4A 3GMEA 2ZJRF 3Q5FA 2QBYB 4BQOA 3MEXA 3LWFA 3WHCA 2QBYA 1ZGWA 3F6OA 5KAIC 5H2FC 3BG7A 4IEJA 2IP2A 3W2WA 1ETKA 2IJLA 2R7TA 2KPMA 2P5KA 3K4CA 2KZVA 3DPTA 1IG7A 3ZR8X 3KP5A 2XF6A 3QP5A 4QPQA 4NB5A 5J8CA 2PFBA 3OYGA 2BXZA 2VBYA 4A3DJ 4IVNA 4QSHA 4CCNA 1B8IA 4G12A 2HQNA 1U9OA 3ZQHA 2VBZA 5F08A 2XF5A 4S04A 1S8NA 4F7ZA 2ZJPF 4FX0A 3E7LA 1O3RA 4OAZA 2IGNA 2DU9A 4IO9F 2XAJA 4XN3A 5ILVA 1SC7A 3LAPA 2XVCA 2R3SA 2YX4A 3BJAA 3BCAA 3DFGA 1BR4A 4YFKF 2HVQA 1MNDA 3CO6C 3Q0WA 3K1MA 2BGCA 1OCRH 2FEZA 1XSVA 3JRAA 3AFHA 2IGMA 4XN0A 4E6KG 4D5CA 1XMXA 3HOVJ 3K70C 3R60A 5BPDA 1T6SA 4BE2A 3B6CA 2V9VA 1YW9A 5FKLA 1UFMA 5DCMB 1S9HA 1KGSA 1KQ9A 5GADJ 4LITA 2DAOA 2GXAA 3IUOA 4FE4A 4M3GA 3B02A 3KYCB 1HDDC 3HYIA 5D4RA 1Z9CA 2DT7B 2DW4A 3HRSA 1B59A 1QHGA 2WV0A 3DXJF 3MQ0A 2QM3A 3L2RA 4PDKA 4L0YB 1RKTA 2DFHA 2H1LA 2M87A 2ZMEA 5ILUA 4WWCA 4LMYA 1IV6A 3M3YJ 3WG9A 2EV0A 1N78A 3O3KA 5IY5H 1D1CA 4G6QA 3HUGB 3P9CA 2XHKA 3S8PA 1A04A 3V7RA 3MZ8A 3AL0C 3K1PA 3IAM2 2HOSA 4HLYA 3PM1A 2CQXA 2X51A 2MLKA 3AG4H 3OYIA 3KYLA 3K9TA 4M9SA 5L3DA 2DMTA 4B43A 1X1CA 5KHDA 2ZFUA 3PO3J 2CWEA 2IPQX 1LVAA 2PN6A 1XB4A 1UG0A 5JFRA 3HHHA 3LL7A 1Y6IA 3TGNA 1I6XA 3LA2A 4A93J 2VODA 4HAMA 2LF8A 4RB2C 3L2UA 3HXLA 1S7EA 4EV0A 3SYTA 4MTDA 4WF2A 1MDMB 4IRIA 1QVUA 1FP2A 3N05A 2A68F 2CFXA 1MKMA 1R36A 3J81Z 2R7FA 1TQMA 1IXRC 2LH9A 4PUSA 1D8KA 1B6AA 5K7FA 3O8GA 3D5SC 2DXIA 4C3HJ 2VASA 3C1DA 4ZYEA 1RRJA 2X9DA 5J6XA 5DM6F 4PFOA 1ZREA 1BJZA 5C4XJ 1G3WA 4N9IA 4ITVA 2PMUA 1TWAJ 1ZG1A 1YJWI 4Y7NJ 3I64A 2PMZA 1SANA 2XAFA 2R7DA 2HVRA 2R92J 1HLVA 3MMYB 1XGOA 3MWMA 1JKRC 2ISZA 4CYCB 4DQ2A 5K5QA 1X4PA 1QU3A 3OYFA 3RKQA 4U0WA 2KLOA 2R0QC 2ECBA 3UNGC 3KCCA 4UVAA 2B0LA 2EFQA 3U1DA 3HTSB 1AU7A 4LGWA 2P8TA 2NS7A 5EJCA 1VQPI 4UXNA 1FYLA 1GUUA 2FA5A 2XRNA 2ZJQF 3CCLI 3ZQLA 3KLNA 3CMMA 2QYOA 2XKOA 4G6TB 3KP7A 4U0YA 3CJTB 2NVYJ 1RR7A 5CLSA 4CA0A 2M45A 4EEFG 2GWRA 1B8IB 1MBGA 3WTZA 3H3ZA 3QYEA 4BL0B 1J2XA 2ZNYA 5L3GA 3S14J 1IRZA 3PL8A 3HPHA 4LG0A 2OCCH 2VKDA 4IRGA 4A6EA 3EYYA 4N4OB 1ZKGA 2QENA 2EINH 1BW5A 1HF0A 5GP9A 3OYKA 5M3FJ 2WWYA 2PX9A 4EJTA 2BY3A 2YSRA 4L9TA 1R7JA 4LLNA 3ERMA 1IDYA 5EDNA 1I5ZA 4CGZA 3VB2A 3ABTA 2W24A 5J4VA 3SZGA 4E7JA 1G59A 1KYZA 1OYWA 1K6OA 1FT9A 2HEOA 2HYGD 2EV5A 3VYSB 3CCVI 3CCQI 2H6CA 1TBXA 3QPHA 4WCGA 2VONA 1F9NA 5EYRA 3H36A 2O6GE 4HV5A 4OMZA 1UZCA 1XSDA 2YPRA 3EUKL 3K4JA 1XGNA 4YFXF 1JHHA 5LRRA 4P9FA 5CVIA 3TW6A 3G3ZA 1W36C 3CLOA 2R5ZB 2DJIA 1R1TA 1W5SA 3M1EA 5F04A 2JK3A 5FRMA 1G3YA 2VQGA 1BC8C 4A5NA 2K9SA 4YIFA 5LHIA 3E5XA 2Y31A 2QWWA 4BBRJ 3IRQA 2E1MB 4RA2A 3FBIB 5HLIA 3F0CA 5ICGA 1FX7A 3HB9A 2EB7A 2L5QA 4XLNF 4A3BJ 4X1EA 2O03A 1XGSA 2UXNA 2EFWA 4M6XA 1I50J 4HG2A 2ZJ2A 1Y0NA 2VQLA 4B44A 4Y33A 1G2HA 2ME0A 3FIWA 3RQIA 4HPQA 4A3EJ 1LE8A 3PNYA 1J5YA 4XONA 2JA7J 3AG1H 3OSFA 2O0YA 2JT1A 3W2VA 4DGWB 2UUZA 4KYWA 4AU7A 4C2TA 2UWMA 2L9NA 3J7ZI 3RQ4A 1L3LA 4KN4X 3VDXA 2R7VA 1SD7A 3HOZJ 2NS8A 2DJNA 5GAEJ 2ZKZA 1OLTA 1QRYA 3V4GA 4P96A 2MH9A 2RV8A 4AIDA 1O57A 2OJED 1WJCA 3HJEA 4XNFA 2HTJA 1JUPA 5L3CA 3F8BA 3K4KA 3OOPA 4CXFA 3P7NA 1YX3A
chains in the Genus database with same CATH topology
1MJAA 1XN7A 3GYHX 3C18A 3BOQA 2NRAC 2X4HA 1L0OC 5D6FA 1QBJA 5AIPA 1USSA 2M1BA 1UB9A 3ROUA 3NQOA 3KEOA 1IRGA 3JW4A 1QO0D 5BPIA 3ZPLA 3TO7A 5HDKA 2GA1A 3MFKA 2PLYA 3EETA 2GAUA 3FWEA 2IT0A 2FMYA 4MQVA 3GFIA 5HDGA 3FMRA 2JTVA 4OIQF 5H6QA 2P6SA 3FM5A 1ULYA 5EEGA 3ZN1A 2Y0MA 3JSPA 2F2EA 4ZZLA 1V3FA 1F4KA 4H0EA 4IJAA 1SFXA 3R6SA 1Z6RA 2XUBA 5BOXA 2MC3A 2KKOA 1YS7A 1TNSA 5E17F 3TDZC 1Y0UA 4RB3C 2DPUA 1OR7A 2FBIA 1SD5A 3CUQA 2QUFA 2KIFA 3M8FA 3L9FA 1U5TC 1ZG3A 4EJUA 5LEKA 1X3UA 3F23A 3IHUA 1LEBA 5IT9K 3VODA 1T38A 2L3DA 3MZHA 4EM0B 2K4JA 2F5EA 3DF8A 5IT9Z 4A12A 5FLXZ 3FHZA 4B8XA 4Z2YA 4U7BA 1NHAA 5HOOA 1QZYA 2ZXJA 5K5RA 3JTGA 3V8LA 1RUOA 1S6LA 4R1HA 3RTRA 4Q48A 3P9IA 1KYWA 4CZZA 1JXSA 1Z91A 2KJCA 1U8RA 2WTEA 3BJOA 3IC7A 4MEYF 1S29A 3F6VA 1PP7U 3E5UA 3I0TA 3BP8A 1HXDA 3ZN0A 1Z7UA 3QAHA 3IRRA 5FFXA 2ZFWA 3AAFA 2KRFA 2W25A 3RPQA 3FM3A 3FMQA 4N0BA 1U3EM 3E6CC 3DP7A 1SAXA 2FXAA 2IVMA 1H9TA 4ZYHA 4AIJA 4MTEA 4RS8A 1ZH5A 3KE2A 3HOTA 1W7PA 5TRDA 1BOAA 4GYIA 2VT3A 1JHFA 1SD4A 3R61A 2Y48A 4KFCA 4G7HF 5AIQA 3VOEA 2X0LA 3CTAA 4UVBA 3K2ZA 4KICA 1XDSA 2ESHA 4D0PA 1BIBA 5J8FA 3WTXC 4ESFA 2QQBA 2G9WA 1BM9A 4MHGA 2CO5A 2Z5UA 4IXAA 2V79A 3GXOA 5HS9A 2Q0OA 1MJBA 2GQQA 4OU0A 1SMYF 4IPAA 1G3SA 1XSXA 1ONVA 3O6BB 4LK0F 3JAMK 2VXZA 3MAJA 4A0XA 2Z33A 1XCBA 1YLFA 3Q9VA 3W6KB 3C7JA 2C6YA 3GLXA 3D0SA 4I7HA 3IKTA 2E7WA 5E8GA 1ZYRF 3KZYA 4AWXB 1R5HA 1ZAOA 5ICEA 4G7OF 4G6DA 2F5FA 1KU2A 3T8RA 2XKPA 5DYMA 3HRMA 4M72A 1BI1A 1D5VA 4A0ZA 2HOEA 1S3JA 4HX4A 2ZCWA 4TV7A 2O8XA 2NAZA 1LNWA 4KN7X 1YG2A 4L5JA 4ASNA 2FNAA 2LKPA 2PQ8A 2ADUA 3C3WA 1R23A 4U7DA 1WI9A 1MJ9A 4L9NA 3QU3A 1W5TA 2LSOA 1CGPA 5LGNA 3I58A 4GGGA 1G3TA 4UVCA 1Z1DA 3N97A 2L02A 1XMKA 5F6FA 1BBYA 4Y17A 1T98A 3SFZA 4BHBA 2HYFA 4OOIA 1XCVA 3BROA 3FZVA 3CDHA 5K1YA 2PEXA 2HWVA 3LA7A 1OPCA 2CW0F 3E3VA 2CQKA 1IW7F 3GUDA 3EYIA 3V7SA 2XAHA 2HZTA 2HKOA 3L2CA 3K0LA 2E7XA 3VFZA 1E17A 2DK8A 1S7AA 1WRJA 1O7FA 1R58A 2VT2A 1BI0A 4QWQA 2EK5A 4AD9A 2FOKA 1UHWA 4BXUA 2E1CA 3KLOA 1RIOH 5L3BA 1U78A 2CGPA 1R1VA 2ZBKA 3BPXA 5H6RA 5ICCA 1PDNC 1TW2A 3FXRA 3I5UA 4ZH4F 5K5OA 2Z3YA 4L0ZB 2ESNA 5DCFA 3NRVA 4M9XA 3LQRA 1MGTA 5ED4A 4HYEA 3SZPA 2VC1A 3HRUA 1P2FA 1TNTA 4RGUA 4ON0A 1F5TA 2NS0A 3JAMZ 4Q5SF 1XGMA 1YS6A 2HS5A 4ZYDA 2BEOA 4R8HA 4ZYGA 1O3TA 1YO5C 4KNYA 2COMA 1QQIA 3GVAA 3IL2A 1B9NA 2OQRA 3F8CA 1EH8A 4WK8F 4LLGF 3U9GA 1B9MA 1F1ZA 1J7KA 3J7AO 1RUNA 4IHTA 2L01A 3RYPA 4GCVA 4OMYA 1HW5A 2A07F 2Z99A 4I98B 4BAYA 1B4AA 2RQPA 4KT5C 2L4AA 4UNOA 3ZQ7A 5DD8A 3RDIA 2OZ6A 4M74A 4UUVA 4BYYA 1TW3A 5F64A 2A61A 4CDGA 1KU7A 2DFIA 4LD5A 2P6TA 2OU2A 3GWZA 1HQCA 3WU1B 3F72A 3ELKA 4WXHA 2JSCA 2QQ9A 3E97A 5A2QK 3BWGA 1O7LA 2RDPA 4Q47A 3HTUA 2LF7A 1ZGJA 3BPVA 3IWFA 3K1NA 1XMAA 2VE8A 3FXUA 3WE3A 2FBKA 3V8KA 2KIMA 2O61A 4HA8A 4I01A 1ZGAA 4UV8A 2XGXA 3BY6A 3ZMUA 3WGGA 1REPC 2CG4A 5LHHA 2VOPA 2GA2A 4A5MA 1BI3A 4OIOF 3KFWX 3WTUC 5KK1A 5DCMA 2J5PA 4KMUX 1OMIA 1R5GA 4YFNF 2K27A 1BIAA 3IWZA 1KQ0A 4OIRF 1YIOA 4I0BA 5E1XA 3GW2A 3QPTA 4JQFA 4EGZA 4RAZA 4UHTA 2XAQA 1YW7A 1IN7A 3R0JA 5FB2A 2CSOA 4XBFA 1TQIA 1D8JA 4GXOA 1CF7A 1FBUA 3V8JA 4EJWA 3T8TA 3GFLA 2STTA 2JZYA 3DEUA 2RC4A 1CF7B 5CJ9A 1OKRA 2EJRA 2OQGA 1ZLKA 4RAYA 3RI4A 4BNCA 1IN6A 3MZYA 5LGTA 5FLXK 1WSUA 1S7OA 2VBXA 4LLLA 4A0YA 3ZMTA 2ISYA 2VC0A 4O6JA 3IKVA 3WU0A 4HQMA 4ETSA 1FYKA 1WQ2A 4EM2A 4OINF 4JBAA 3WGHA 2GIVA 2IA0A 2KJBA 3R4KA 2QLZA 3MCZA 1IZ1A 4A6DA 4B09A 1QZZA 2EV6A 2WC2A 1MDMA 1R1UA 3JTHA 4N9HA 2J5OA 2ZNZA 4AIKA 2DO7A 1IF1A 3GFJA 1USTA 2A6HF 3FX3A 1OYYA 4P5OA 1P6RA 3F22A 4RB1A 1Z05A 1ZHFA 3CUQC 2NNYA 5DD4A 4CHUA 3I4PA 1J9IA 1B1BA 2O3FA 1KA8A 2BE5F 3TDUC 2M5WA 3I59B 3TQNA 2QZ8A 5ERIA 4EM1A 1VTNC 1FP1D 1C0WA 4HDVA 1BN5A 4L9JA 2NNNA 2OBPA 3FXQA 1DUXC 2W84A 1QNTA 2XIGA 3RPUA 3LSTA 4XSZF 2FQ3A 4BHCA 1JGSA 5DUIA 5L3EA 3ULQB 3BJ6A 1UHMA 3O2PE 3CO7C 2HR3A 1LB2A 5FO5A 1YYVA 4PGHA 1U2WA 1IN5A 4LB5A 2EA4A 3TKYA 1J0RA 5AONA 2A6EF 3PQJA 2IA1A 3ZP5A 2PBIA 1I1GA 5TJJA 1HKTA 5F1RA 1EV7A 3RYRA 4EQQA 5CYVA 2L54A 2DT5A 1SD6A 2EWNA 4HX8A 2DPDA 3L00A 5HLHA 1HW2A 1W7PD 2UXXA 4ESJA 2V6CA 4JK1X 4LJZF 3SHFA 2OZUA 1XD7A 2P5VA 3BZ6A 3HSEA 2M8EA 3WGIA 2H09A 3VEPA 1IXCA 5JR3A 1G4DA 1W4MA 4MNUA 2A69F 5A2QZ 3ERED 1FZPB 1LJ9A 2Q8KA 2VE9A 3L09A 1KQ8A 2PG4A 6PAXA 5IT3A 4QLCU 1FWZA 5LLQA 2DTRA 2HKXA 1O3QA 3F8FA 5HS7A 2JPCA 1HKSA 2D45A 3QP6A 4RGXA 2D1HA 4LB6B 3P9KA 2E1NA 4KIGA 3J80Z 4L5IA 3RKWA 2Y75A 1U6GA 2L4MA 4O5VA 2EFNA 1R00A 3Q9SA 2H27A 3ML6A 3SQNA 5HS8A 2Z9OA 4KDPA 4GO1A 2RNJA 5JVTA 4HF0A 4GYGA 5D5XB 1TLHB 2V1DA 2F5DA 2GXGA 5BQTA 4KUMA 4NQWA 3ZMSA 2DLLA 3RKXA 2H94A 4I0AA 1OYIA 5BS6A 2BYVE 4ZZDA 4HLXA 3ZMVA 3L7WA 3R0AA 4HF2A 3E6BA 3E6MA 3NEUA 2D2WA 4CO8A 2DQLA 1DPUA 1BI2A 4FT8A 1H0MA 5H20A 3I54A 2DK5A 3S2WA 3GZ6A 4MQ9F 1J59A 1D3YA 3B73A 3F21A 1T39A 2HDCA 4Y15A 1QGPA 3D5LA 2XROA 4I2OA 4FX4A 4L9VA 2STWA 3RJPA 2OA4A 4EJVA 1P4WA 1U5TB 2FMLA 2AXLA 3TO6A 2VN2A 3M8EA 2LDUA 4KA4A 1HSTA 1Z6TA 2PI0A 2D1VA 1H9GA 1UCRA 1YFHA 3HHGA 2EA2A 1EH6A 1HW1A 3F8NA 1LQ1A 3K69A 1ZLJA 2NYXA 5E20A 2FE3A 1K7AA 1ZRFA 5LEJA 3HIFA 5DDGA 1LEAA 4HZFA 3J80K 4K2EA 5FFZA 4M73A 4IHSA 4XSXF 4ESBA 2FF4A 2G7UA 1SFUA 2PJPA 2AS5F 4RB0A 2OAZA 3GEZA 2EFPA 4OIPF 1WKMA 3PFIA 3COAC 1J75A 3CJNA 2XV4S 5CVJA 2W57A 2ZMEB 2ELHA 1GXQA 3ISPA 1GHCA 5L3FA 2TDXA 4O3MA 3QU6A 4PCQA 1HKQA 4UV9A 4G8XA 5CVVA 1QPMA 3PQKA 3WTWC 1Q1HA 1IAWA 4I02A 5FGMA 4NHJA 4P9UA 1FY7A 5D8KB 1O3SA 3E5QA 4MGRA 2XAGA 2PMHA 1V4RA 5LHGA 1FLIA 1U5TA 2V1XA 5ICFA 3LQQA 1EH7A 3N4MA 4RGSA 5HVQC 4CYDA 2K7LA 2K86A 4BH9A 4ENMA 1ZRCA 1IXSB 3G73A 1P4AA 4G9YA 1YQAA 4EVIA 3QRFF 1YTYA 3DV8A 2P5LC 4HV6A 2YU3A 2H6BA 4Q4ZF 1FOKA 3I71A 4MEXF 2HGCA 5ILSA 4G7ZF 2RVCA 5LBQA 2IRFG 4LG0B 3H3UA 1HSJA 2FU4A 1MZBA 4BQAA 2MLGA 3KZZA 3GO5A 2YX7A 3E6DA 1KU9A 4U0VA 1LDJA 1I1SA 1IN4A 3M7GA 3T1BA 2CYYA 3OV8A 5HLGA 1FBSA 3T0YA 1GVJA 4P55A 2V1UA 1G6NA 3RIRA 2FNPA 3JSOA 5JI6A 1BC7C 1AOYA 1ZG5A 5HDNA 3U2RA 2YR2A 3LA3A 4PZJA 2ACJA 2FRHA 2K4BA 2FBHA 5DEQA 3DPLC 1FSEA 4BHPA 2FSWA 3TOAA 1K78A 3WODF 3EDPA 3KP4A 3W6JB 3M9AA 1P4XA 4HDUA 1K78B 4XLPF 4HBLA 3GX4X 3KP6A 1XDUA 1IRFA 3DKWA 2ETHA 2M30A 2UZKA 4EJOA 5E8IA 2DBBA 3F8MA 3KEQA 4E70A 1DDNA 3ECHA 3TO9A 1W7PB 3GFMA 1RNLA 1T0FA 4HX7A 5E18F 2MD5A 4HF1A 3FMSA 3WTSC 3T5XA 2VBWA 2A3SA 2JPBA 2LNBA 3SXYA 5CVRA 1TTYA 2RKHA 1K79A 2DI3A 4L18B 1IUYA 4IRHA 5D5WB 3F3XA 1LDKB 2DQRA 2P7VB 5FD5A 3V7CA 1SMTA 3GF2A 1JE8A 2HTSA 5EEHA 4ENKA 4ENJA 1DPRA 4WXCA 1ZRDA 2G7HA 4AVPA 3ZMZA 5D6EA 5D5VB 1ZARA 4HQEA 1FYMA 1FBQA 4RGRA 2QQAA 1FNNA 2MH2A 3ABUA 4WX9A 2KIUA 2MBFA 1R22A 3ZMDA 1GXPA 5DUKA 2GZWA 3BDDA 2RN7A 3CUQB 3TOBA 3I53A 5LGUA 5LRSA 4AIHA 1FSHA 2RGVA 1T2KA 1SFEA 5E1WA 2EFOA 2K02A 1LDDA 4YG2F 3WE2A 2P7CB 4Y13A 3LAJA 4KIFA 2F5CA 1ON1A 4HOBA 4LFUA 2GXBA 4ENNA 3LFKA 5D5UB 5DV5A 1ON2A 3FF5A 3I59A 4HW0A 4CICA 4G94A 3WTYC 2A5YB 1FPQA 1HBXG 3QOPA 1BJAA 1TQPA 3CUOA 4M6YA 1PUEE 1E2XA 2HFHA 1WWXA 1AWCA 1DP7P 4LK1F 4EGYA 1IN8A 4A2UA 3HRTA 5FD6A 2ZO4A 4WXDA 1MD0A 5BMZA 3HUGA 5E1ZB 4KMFA 1FC3A 3KP2A 5CVUA 5JHUA 2BV6A 2JRTA 3SZTA 4PGGA 2HQRA 4U88A 5KVRA 1RZ4A 1ZN2A 4KIBA 4FHTA 2MA3A 2BBYA 3EUHA 1PP8F 4YIIA 4M9ZA 3ECOA 4XRFA 4R79A 3KP3A 4I09A 2IA2A 1RI7A 2P4WA 2Q2EA 4M71A 3RKYA 4S05A 3H92A 3WTTC 2OD5A 4DNCA 3J81K 5D4SA 5D8LB 2W85A 3REOA 2XASA 3EQLF 1I27A 1KU3A 3HOSA 2QVOA 3HSRA 1STZA 2IW5A 3KETA 3GZ5A 3HSFA 1P92A 3WTVC 1YW8A 1ODDA 3DQVC 4EMSA 2VOOA 4IF4A 3Q5FA 2QBYB 3MEXA 3LWFA 2QBYA 3F6OA 2IP2A 2IJLA 2P5KA 3DPTA 3KP5A 3QP5A 4NB5A 5J8CA 2PFBA 2VBYA 4IVNA 2HQNA 2VBZA 4S04A 1S8NA 4F7ZA 4FX0A 1O3RA 2DU9A 2XAJA 5ILVA 3LAPA 2XVCA 2R3SA 2YX4A 3BJAA 3DFGA 4YFKF 3CO6C 3K1MA 2BGCA 2FEZA 1XSVA 3R60A 5BPDA 1T6SA 2V9VA 1YW9A 1UFMA 5DCMB 1KQ9A 1KGSA 2DAOA 3B02A 3HYIA 5D4RA 1Z9CA 2DW4A 3HRSA 1B59A 2WV0A 3DXJF 3MQ0A 2QM3A 4PDKA 4L0YB 2M87A 2ZMEA 5ILUA 4WWCA 4LMYA 3WG9A 2EV0A 3O3KA 4G6QA 3P9CA 2XHKA 1A04A 3V7RA 3K1PA 4HLYA 2MLKA 3K9TA 4M9SA 5L3DA 2CWEA 2IPQX 1LVAA 2PN6A 1XB4A 5JFRA 3HHHA 3TGNA 1I6XA 3LA2A 2VODA 4HAMA 2LF8A 4RB2C 4EV0A 4MTDA 4WF2A 1MDMB 4IRIA 1FP2A 2CFXA 2A68F 1MKMA 1R36A 3J81Z 2R7FA 1TQMA 1IXRC 1D8KA 1B6AA 3C1DA 4ZYEA 5J6XA 1ZREA 1G3WA 4N9IA 2PMUA 1ZG1A 3I64A 2XAFA 2R7DA 1XGOA 3MWMA 2ISZA 4DQ2A 5K5QA 4U0WA 3KCCA 4UVAA 2B0LA 2EFQA 3U1DA 3HTSB 4LGWA 2P8TA 4UXNA 1FYLA 2FA5A 2XRNA 3KLNA 2QYOA 2XKOA 3KP7A 4U0YA 5CLSA 2M45A 2GWRA 3WTZA 3H3ZA 1J2XA 2ZNYA 5L3GA 4LG0A 4IRGA 4A6EA 3EYYA 2QENA 2WWYA 4EJTA 2YSRA 4L9TA 1R7JA 4LLNA 1I5ZA 4CGZA 3VB2A 3ABTA 2W24A 1KYZA 1OYWA 1K6OA 1FT9A 2HEOA 2HYGD 2EV5A 2H6CA 1TBXA 3QPHA 4WCGA 2VONA 1F9NA 2O6GE 4HV5A 4OMZA 1XSDA 2YPRA 1XGNA 4YFXF 1JHHA 5LRRA 4P9FA 5CVIA 3G3ZA 3CLOA 1R1TA 1W5SA 3M1EA 1G3YA 1BC8C 4A5NA 4YIFA 5LHIA 3E5XA 2QWWA 3IRQA 5HLIA 5ICGA 1FX7A 2EB7A 4XLNF 2O03A 1XGSA 2UXNA 2EFWA 4M6XA 2ZJ2A 1J5YA 2O0YA 2JT1A 4KYWA 2UWMA 1L3LA 4KN4X 1SD7A 2ZKZA 3V4GA 4P96A 2MH9A 2RV8A 1O57A 5L3CA 2HTJA 3F8BA 3OOPA 4CXFA 3P7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJA A;  1XN7 A;  3GYH X;  3C18 A;  3BOQ A;  2NRA C;  2X4H A;  1L0O C;  5D6F A;  1QBJ A;  5AIP A;  1USS A;  2M1B A;  1UB9 A;  3ROU A;  3NQO A;  3KEO A;  1IRG A;  3JW4 A;  1QO0 D;  5BPI A;  3ZPL A;  3TO7 A;  5HDK A;  2GA1 A;  3MFK A;  2PLY A;  3EET A;  2GAU A;  3FWE A;  2IT0 A;  2FMY A;  4MQV A;  3GFI A;  5HDG A;  3FMR A;  2JTV A;  4OIQ F;  5H6Q A;  2P6S A;  3FM5 A;  1ULY A;  5EEG A;  3ZN1 A;  2Y0M A;  3JSP A;  2F2E A;  4ZZL A;  1V3F A;  1F4K A;  4H0E A;  4IJA A;  1SFX A;  3R6S A;  1Z6R A;  2XUB A;  5BOX A;  2MC3 A;  2KKO A;  1YS7 A;  1TNS A;  5E17 F;  3TDZ C;  1Y0U A;  4RB3 C;  2DPU A;  1OR7 A;  2FBI A;  1SD5 A;  3CUQ A;  2QUF A;  2KIF A;  3M8F A;  3L9F A;  1U5T C;  1ZG3 A;  4EJU A;  5LEK A;  1X3U A;  3F23 A;  3IHU A;  1LEB A;  5IT9 K;  3VOD A;  1T38 A;  2L3D A;  3MZH A;  4EM0 B;  2K4J A;  2F5E A;  3DF8 A;  5IT9 Z;  4A12 A;  5FLX Z;  3FHZ A;  4B8X A;  4Z2Y A;  4U7B A;  1NHA A;  5HOO A;  1QZY A;  2ZXJ A;  5K5R A;  3JTG A;  3V8L A;  1RUO A;  1S6L A;  4R1H A;  3RTR A;  4Q48 A;  3P9I A;  1KYW A;  4CZZ A;  1JXS A;  1Z91 A;  2KJC A;  1U8R A;  2WTE A;  3BJO A;  3IC7 A;  4MEY F;  1S29 A;  3F6V A;  1PP7 U;  3E5U A;  3I0T A;  3BP8 A;  1HXD A;  3ZN0 A;  1Z7U A;  3QAH A;  3IRR A;  5FFX A;  2ZFW A;  3AAF A;  2KRF A;  2W25 A;  3RPQ A;  3FM3 A;  3FMQ A;  4N0B A;  1U3E M;  3E6C C;  3DP7 A;  1SAX A;  2FXA A;  2IVM A;  1H9T A;  4ZYH A;  4AIJ A;  4MTE A;  4RS8 A;  1ZH5 A;  3KE2 A;  3HOT A;  1W7P A;  5TRD A;  1BOA A;  4GYI A;  2VT3 A;  1JHF A;  1SD4 A;  3R61 A;  2Y48 A;  4KFC A;  4G7H F;  5AIQ A;  3VOE A;  2X0L A;  3CTA A;  4UVB A;  3K2Z A;  4KIC A;  1XDS A;  2ESH A;  4D0P A;  1BIB A;  5J8F A;  3WTX C;  4ESF A;  2QQB A;  2G9W A;  1BM9 A;  4MHG A;  2CO5 A;  2Z5U A;  4IXA A;  2V79 A;  3GXO A;  5HS9 A;  2Q0O A;  1MJB A;  2GQQ A;  4OU0 A;  1SMY F;  4IPA A;  1G3S A;  1XSX A;  1ONV A;  3O6B B;  4LK0 F;  3JAM K;  2VXZ A;  3MAJ A;  4A0X A;  2Z33 A;  1XCB A;  1YLF A;  3Q9V A;  3W6K B;  3C7J A;  2C6Y A;  3GLX A;  3D0S A;  4I7H A;  3IKT A;  2E7W A;  5E8G A;  1ZYR F;  3KZY A;  4AWX B;  1R5H A;  1ZAO A;  5ICE A;  4G7O F;  4G6D A;  2F5F A;  1KU2 A;  3T8R A;  2XKP A;  5DYM A;  3HRM A;  4M72 A;  1BI1 A;  1D5V A;  4A0Z A;  2HOE A;  1S3J A;  4HX4 A;  2ZCW A;  4TV7 A;  2O8X A;  2NAZ A;  1LNW A;  4KN7 X;  1YG2 A;  4L5J A;  4ASN A;  2FNA A;  2LKP A;  2PQ8 A;  2ADU A;  3C3W A;  1R23 A;  4U7D A;  1WI9 A;  1MJ9 A;  4L9N A;  3QU3 A;  1W5T A;  2LSO A;  1CGP A;  5LGN A;  3I58 A;  4GGG A;  1G3T A;  4UVC A;  1Z1D A;  3N97 A;  2L02 A;  1XMK A;  5F6F A;  1BBY A;  4Y17 A;  1T98 A;  3SFZ A;  4BHB A;  2HYF A;  4OOI A;  1XCV A;  3BRO A;  3FZV A;  3CDH A;  5K1Y A;  2PEX A;  2HWV A;  3LA7 A;  1OPC A;  2CW0 F;  3E3V A;  2CQK A;  1IW7 F;  3GUD A;  3EYI A;  3V7S A;  2XAH A;  2HZT A;  2HKO A;  3L2C A;  3K0L A;  2E7X A;  3VFZ A;  1E17 A;  2DK8 A;  1S7A A;  1WRJ A;  1O7F A;  1R58 A;  2VT2 A;  1BI0 A;  4QWQ A;  2EK5 A;  4AD9 A;  2FOK A;  1UHW A;  4BXU A;  2E1C A;  3KLO A;  1RIO H;  5L3B A;  1U78 A;  2CGP A;  1R1V A;  2ZBK A;  3BPX A;  5H6R A;  5ICC A;  1PDN C;  1TW2 A;  3FXR A;  3I5U A;  4ZH4 F;  5K5O A;  2Z3Y A;  4L0Z B;  2ESN A;  5DCF A;  3NRV A;  4M9X A;  3LQR A;  1MGT A;  5ED4 A;  4HYE A;  3SZP A;  2VC1 A;  3HRU A;  1P2F A;  1TNT A;  4RGU A;  4ON0 A;  1F5T A;  2NS0 A;  3JAM Z;  4Q5S F;  1XGM A;  1YS6 A;  2HS5 A;  4ZYD A;  2BEO A;  4R8H A;  4ZYG A;  1O3T A;  1YO5 C;  4KNY A;  2COM A;  1QQI A;  3GVA A;  3IL2 A;  1B9N A;  2OQR A;  3F8C A;  1EH8 A;  4WK8 F;  4LLG F;  3U9G A;  1B9M A;  1F1Z A;  1J7K A;  3J7A O;  1RUN A;  4IHT A;  2L01 A;  3RYP A;  4GCV A;  4OMY A;  1HW5 A;  2A07 F;  2Z99 A;  4I98 B;  4BAY A;  1B4A A;  2RQP A;  4KT5 C;  2L4A A;  4UNO A;  3ZQ7 A;  5DD8 A;  3RDI A;  2OZ6 A;  4M74 A;  4UUV A;  4BYY A;  1TW3 A;  5F64 A;  2A61 A;  4CDG A;  1KU7 A;  2DFI A;  4LD5 A;  2P6T A;  2OU2 A;  3GWZ A;  1HQC A;  3WU1 B;  3F72 A;  3ELK A;  4WXH A;  2JSC A;  2QQ9 A;  3E97 A;  5A2Q K;  3BWG A;  1O7L A;  2RDP A;  4Q47 A;  3HTU A;  2LF7 A;  1ZGJ A;  3BPV A;  3IWF A;  3K1N A;  1XMA A;  2VE8 A;  3FXU A;  3WE3 A;  2FBK A;  3V8K A;  2KIM A;  2O61 A;  4HA8 A;  4I01 A;  1ZGA A;  4UV8 A;  2XGX A;  3BY6 A;  3ZMU A;  3WGG A;  1REP C;  2CG4 A;  5LHH A;  2VOP A;  2GA2 A;  4A5M A;  1BI3 A;  4OIO F;  3KFW X;  3WTU C;  5KK1 A;  5DCM A;  2J5P A;  4KMU X;  1OMI A;  1R5G A;  4YFN F;  2K27 A;  1BIA A;  3IWZ A;  1KQ0 A;  4OIR F;  1YIO A;  4I0B A;  5E1X A;  3GW2 A;  3QPT A;  4JQF A;  4EGZ A;  4RAZ A;  4UHT A;  2XAQ A;  1YW7 A;  1IN7 A;  3R0J A;  5FB2 A;  2CSO A;  4XBF A;  1TQI A;  1D8J A;  4GXO A;  1CF7 A;  1FBU A;  3V8J A;  4EJW A;  3T8T A;  3GFL A;  2STT A;  2JZY A;  3DEU A;  2RC4 A;  1CF7 B;  5CJ9 A;  1OKR A;  2EJR A;  2OQG A;  1ZLK A;  4RAY A;  3RI4 A;  4BNC A;  1IN6 A;  3MZY A;  5LGT A;  5FLX K;  1WSU A;  1S7O A;  2VBX A;  4LLL A;  4A0Y A;  3ZMT A;  2ISY A;  2VC0 A;  4O6J A;  3IKV A;  3WU0 A;  4HQM A;  4ETS A;  1FYK A;  1WQ2 A;  4EM2 A;  4OIN F;  4JBA A;  3WGH A;  2GIV A;  2IA0 A;  2KJB A;  3R4K A;  2QLZ A;  3MCZ A;  1IZ1 A;  4A6D A;  4B09 A;  1QZZ A;  2EV6 A;  2WC2 A;  1MDM A;  1R1U A;  3JTH A;  4N9H A;  2J5O A;  2ZNZ A;  4AIK A;  2DO7 A;  1IF1 A;  3GFJ A;  1UST A;  2A6H F;  3FX3 A;  1OYY A;  4P5O A;  1P6R A;  3F22 A;  4RB1 A;  1Z05 A;  1ZHF A;  3CUQ C;  2NNY A;  5DD4 A;  4CHU A;  3I4P A;  1J9I A;  1B1B A;  2O3F A;  1KA8 A;  2BE5 F;  3TDU C;  2M5W A;  3I59 B;  3TQN A;  2QZ8 A;  5ERI A;  4EM1 A;  1VTN C;  1FP1 D;  1C0W A;  4HDV A;  1BN5 A;  4L9J A;  2NNN A;  2OBP A;  3FXQ A;  1DUX C;  2W84 A;  1QNT A;  2XIG A;  3RPU A;  3LST A;  4XSZ F;  2FQ3 A;  4BHC A;  1JGS A;  5DUI A;  5L3E A;  3ULQ B;  3BJ6 A;  1UHM A;  3O2P E;  3CO7 C;  2HR3 A;  1LB2 A;  5FO5 A;  1YYV A;  4PGH A;  1U2W A;  1IN5 A;  4LB5 A;  2EA4 A;  3TKY A;  1J0R A;  5AON A;  2A6E F;  3PQJ A;  2IA1 A;  3ZP5 A;  2PBI A;  1I1G A;  5TJJ A;  1HKT A;  5F1R A;  1EV7 A;  3RYR A;  4EQQ A;  5CYV A;  2L54 A;  2DT5 A;  1SD6 A;  2EWN A;  4HX8 A;  2DPD A;  3L00 A;  5HLH A;  1HW2 A;  1W7P D;  2UXX A;  4ESJ A;  2V6C A;  4JK1 X;  4LJZ F;  3SHF A;  2OZU A;  1XD7 A;  2P5V A;  3BZ6 A;  3HSE A;  2M8E A;  3WGI A;  2H09 A;  3VEP A;  1IXC A;  5JR3 A;  1G4D A;  1W4M A;  4MNU A;  2A69 F;  5A2Q Z;  3ERE D;  1FZP B;  1LJ9 A;  2Q8K A;  2VE9 A;  3L09 A;  1KQ8 A;  2PG4 A;  6PAX A;  5IT3 A;  4QLC U;  1FWZ A;  5LLQ A;  2DTR A;  2HKX A;  1O3Q A;  3F8F A;  5HS7 A;  2JPC A;  1HKS A;  2D45 A;  3QP6 A;  4RGX A;  2D1H A;  4LB6 B;  3P9K A;  2E1N A;  4KIG A;  3J80 Z;  4L5I A;  3RKW A;  2Y75 A;  1U6G A;  2L4M A;  4O5V A;  2EFN A;  1R00 A;  3Q9S A;  2H27 A;  3ML6 A;  3SQN A;  5HS8 A;  2Z9O A;  4KDP A;  4GO1 A;  2RNJ A;  5JVT A;  4HF0 A;  4GYG A;  5D5X B;  1TLH B;  2V1D A;  2F5D A;  2GXG A;  5BQT A;  4KUM A;  4NQW A;  3ZMS A;  2DLL A;  3RKX A;  2H94 A;  4I0A A;  1OYI A;  5BS6 A;  2BYV E;  4ZZD A;  4HLX A;  3ZMV A;  3L7W A;  3R0A A;  4HF2 A;  3E6B A;  3E6M A;  3NEU A;  2D2W A;  4CO8 A;  2DQL A;  1DPU A;  1BI2 A;  4FT8 A;  1H0M A;  5H20 A;  3I54 A;  2DK5 A;  3S2W A;  3GZ6 A;  4MQ9 F;  1J59 A;  1D3Y A;  3B73 A;  3F21 A;  1T39 A;  2HDC A;  4Y15 A;  1QGP A;  3D5L A;  2XRO A;  4I2O A;  4FX4 A;  4L9V A;  2STW A;  3RJP A;  2OA4 A;  4EJV A;  1P4W A;  1U5T B;  2FML A;  2AXL A;  3TO6 A;  2VN2 A;  3M8E A;  2LDU A;  4KA4 A;  1HST A;  1Z6T A;  2PI0 A;  2D1V A;  1H9G A;  1UCR A;  1YFH A;  3HHG A;  2EA2 A;  1EH6 A;  1HW1 A;  3F8N A;  1LQ1 A;  3K69 A;  1ZLJ A;  2NYX A;  5E20 A;  2FE3 A;  1K7A A;  1ZRF A;  5LEJ A;  3HIF A;  5DDG A;  1LEA A;  4HZF A;  3J80 K;  4K2E A;  5FFZ A;  4M73 A;  4IHS A;  4XSX F;  4ESB A;  2FF4 A;  2G7U A;  1SFU A;  2PJP A;  2AS5 F;  4RB0 A;  2OAZ A;  3GEZ A;  2EFP A;  4OIP F;  1WKM A;  3PFI A;  3COA C;  1J75 A;  3CJN A;  2XV4 S;  5CVJ A;  2W57 A;  2ZME B;  2ELH A;  1GXQ A;  3ISP A;  1GHC A;  5L3F A;  2TDX A;  4O3M A;  3QU6 A;  4PCQ A;  1HKQ A;  4UV9 A;  4G8X A;  5CVV A;  1QPM A;  3PQK A;  3WTW C;  1Q1H A;  1IAW A;  4I02 A;  5FGM A;  4NHJ A;  4P9U A;  1FY7 A;  5D8K B;  1O3S A;  3E5Q A;  4MGR A;  2XAG A;  2PMH A;  1V4R A;  5LHG A;  1FLI A;  1U5T A;  2V1X A;  5ICF A;  3LQQ A;  1EH7 A;  3N4M A;  4RGS A;  5HVQ C;  4CYD A;  2K7L A;  2K86 A;  4BH9 A;  4ENM A;  1ZRC A;  1IXS B;  3G73 A;  1P4A A;  4G9Y A;  1YQA A;  4EVI A;  3QRF F;  1YTY A;  3DV8 A;  2P5L C;  4HV6 A;  2YU3 A;  2H6B A;  4Q4Z F;  1FOK A;  3I71 A;  4MEX F;  2HGC A;  5ILS A;  4G7Z F;  2RVC A;  5LBQ A;  2IRF G;  4LG0 B;  3H3U A;  1HSJ A;  2FU4 A;  1MZB A;  4BQA A;  2MLG A;  3KZZ A;  3GO5 A;  2YX7 A;  3E6D A;  1KU9 A;  4U0V A;  1LDJ A;  1I1S A;  1IN4 A;  3M7G A;  3T1B A;  2CYY A;  3OV8 A;  5HLG A;  1FBS A;  3T0Y A;  1GVJ A;  4P55 A;  2V1U A;  1G6N A;  3RIR A;  2FNP A;  3JSO A;  5JI6 A;  1BC7 C;  1AOY A;  1ZG5 A;  5HDN A;  3U2R A;  2YR2 A;  3LA3 A;  4PZJ A;  2ACJ A;  2FRH A;  2K4B A;  2FBH A;  5DEQ A;  3DPL C;  1FSE A;  4BHP A;  2FSW A;  3TOA A;  1K78 A;  3WOD F;  3EDP A;  3KP4 A;  3W6J B;  3M9A A;  1P4X A;  4HDU A;  1K78 B;  4XLP F;  4HBL A;  3GX4 X;  3KP6 A;  1XDU A;  1IRF A;  3DKW A;  2ETH A;  2M30 A;  2UZK A;  4EJO A;  5E8I A;  2DBB A;  3F8M A;  3KEQ A;  4E70 A;  1DDN A;  3ECH A;  3TO9 A;  1W7P B;  3GFM A;  1RNL A;  1T0F A;  4HX7 A;  5E18 F;  2MD5 A;  4HF1 A;  3FMS A;  3WTS C;  3T5X A;  2VBW A;  2A3S A;  2JPB A;  2LNB A;  3SXY A;  5CVR A;  1TTY A;  2RKH A;  1K79 A;  2DI3 A;  4L18 B;  1IUY A;  4IRH A;  5D5W B;  3F3X A;  1LDK B;  2DQR A;  2P7V B;  5FD5 A;  3V7C A;  1SMT A;  3GF2 A;  1JE8 A;  2HTS A;  5EEH A;  4ENK A;  4ENJ A;  1DPR A;  4WXC A;  1ZRD A;  2G7H A;  4AVP A;  3ZMZ A;  5D6E A;  5D5V B;  1ZAR A;  4HQE A;  1FYM A;  1FBQ A;  4RGR A;  2QQA A;  1FNN A;  2MH2 A;  3ABU A;  4WX9 A;  2KIU A;  2MBF A;  1R22 A;  3ZMD A;  1GXP A;  5DUK A;  2GZW A;  3BDD A;  2RN7 A;  3CUQ B;  3TOB A;  3I53 A;  5LGU A;  5LRS A;  4AIH A;  1FSH A;  2RGV A;  1T2K A;  1SFE A;  5E1W A;  2EFO A;  2K02 A;  1LDD A;  4YG2 F;  3WE2 A;  2P7C B;  4Y13 A;  3LAJ A;  4KIF A;  2F5C A;  1ON1 A;  4HOB A;  4LFU A;  2GXB A;  4ENN A;  3LFK A;  5D5U B;  5DV5 A;  1ON2 A;  3FF5 A;  3I59 A;  4HW0 A;  4CIC A;  4G94 A;  3WTY C;  2A5Y B;  1FPQ A;  1HBX G;  3QOP A;  1BJA A;  1TQP A;  3CUO A;  4M6Y A;  1PUE E;  1E2X A;  2HFH A;  1WWX A;  1AWC A;  1DP7 P;  4LK1 F;  4EGY A;  1IN8 A;  4A2U A;  3HRT A;  5FD6 A;  2ZO4 A;  4WXD A;  1MD0 A;  5BMZ A;  3HUG A;  5E1Z B;  4KMF A;  1FC3 A;  3KP2 A;  5CVU A;  5JHU A;  2BV6 A;  2JRT A;  3SZT A;  4PGG A;  2HQR A;  4U88 A;  5KVR A;  1RZ4 A;  1ZN2 A;  4KIB A;  4FHT A;  2MA3 A;  2BBY A;  3EUH A;  1PP8 F;  4YII A;  4M9Z A;  3ECO A;  4XRF A;  4R79 A;  3KP3 A;  4I09 A;  2IA2 A;  1RI7 A;  2P4W A;  2Q2E A;  4M71 A;  3RKY A;  4S05 A;  3H92 A;  3WTT C;  2OD5 A;  4DNC A;  3J81 K;  5D4S A;  5D8L B;  2W85 A;  3REO A;  2XAS A;  3EQL F;  1I27 A;  1KU3 A;  3HOS A;  2QVO A;  3HSR A;  1STZ A;  2IW5 A;  3KET A;  3GZ5 A;  3HSF A;  1P92 A;  3WTV C;  1YW8 A;  1ODD A;  3DQV C;  4EMS A;  2VOO A;  4IF4 A;  3Q5F A;  2QBY B;  3MEX A;  3LWF A;  2QBY A;  3F6O A;  2IP2 A;  2IJL A;  2P5K A;  3DPT A;  3KP5 A;  3QP5 A;  4NB5 A;  5J8C A;  2PFB A;  2VBY A;  4IVN A;  2HQN A;  2VBZ A;  4S04 A;  1S8N A;  4F7Z A;  4FX0 A;  1O3R A;  2DU9 A;  2XAJ A;  5ILV A;  3LAP A;  2XVC A;  2R3S A;  2YX4 A;  3BJA A;  3DFG A;  4YFK F;  3CO6 C;  3K1M A;  2BGC A;  2FEZ A;  1XSV A;  3R60 A;  5BPD A;  1T6S A;  2V9V A;  1YW9 A;  1UFM A;  5DCM B;  1KQ9 A;  1KGS A;  2DAO A;  3B02 A;  3HYI A;  5D4R A;  1Z9C A;  2DW4 A;  3HRS A;  1B59 A;  2WV0 A;  3DXJ F;  3MQ0 A;  2QM3 A;  4PDK A;  4L0Y B;  2M87 A;  2ZME A;  5ILU A;  4WWC A;  4LMY A;  3WG9 A;  2EV0 A;  3O3K A;  4G6Q A;  3P9C A;  2XHK A;  1A04 A;  3V7R A;  3K1P A;  4HLY A;  2MLK A;  3K9T A;  4M9S A;  5L3D A;  2CWE A;  2IPQ X;  1LVA A;  2PN6 A;  1XB4 A;  5JFR A;  3HHH A;  3TGN A;  1I6X A;  3LA2 A;  2VOD A;  4HAM A;  2LF8 A;  4RB2 C;  4EV0 A;  4MTD A;  4WF2 A;  1MDM B;  4IRI A;  1FP2 A;  2CFX A;  2A68 F;  1MKM A;  1R36 A;  3J81 Z;  2R7F A;  1TQM A;  1IXR C;  1D8K A;  1B6A A;  3C1D A;  4ZYE A;  5J6X A;  1ZRE A;  1G3W A;  4N9I A;  2PMU A;  1ZG1 A;  3I64 A;  2XAF A;  2R7D A;  1XGO A;  3MWM A;  2ISZ A;  4DQ2 A;  5K5Q A;  4U0W A;  3KCC A;  4UVA A;  2B0L A;  2EFQ A;  3U1D A;  3HTS B;  4LGW A;  2P8T A;  4UXN A;  1FYL A;  2FA5 A;  2XRN A;  3KLN A;  2QYO A;  2XKO A;  3KP7 A;  4U0Y A;  5CLS A;  2M45 A;  2GWR A;  3WTZ A;  3H3Z A;  1J2X A;  2ZNY A;  5L3G A;  4LG0 A;  4IRG A;  4A6E A;  3EYY A;  2QEN A;  2WWY A;  4EJT A;  2YSR A;  4L9T A;  1R7J A;  4LLN A;  1I5Z A;  4CGZ A;  3VB2 A;  3ABT A;  2W24 A;  1KYZ A;  1OYW A;  1K6O A;  1FT9 A;  2HEO A;  2HYG D;  2EV5 A;  2H6C A;  1TBX A;  3QPH A;  4WCG A;  2VON A;  1F9N A;  2O6G E;  4HV5 A;  4OMZ A;  1XSD A;  2YPR A;  1XGN A;  4YFX F;  1JHH A;  5LRR A;  4P9F A;  5CVI A;  3G3Z A;  3CLO A;  1R1T A;  1W5S A;  3M1E A;  1G3Y A;  1BC8 C;  4A5N A;  4YIF A;  5LHI A;  3E5X A;  2QWW A;  3IRQ A;  5HLI A;  5ICG A;  1FX7 A;  2EB7 A;  4XLN F;  2O03 A;  1XGS A;  2UXN A;  2EFW A;  4M6X A;  2ZJ2 A;  1J5Y A;  2O0Y A;  2JT1 A;  4KYW A;  2UWM A;  1L3L A;  4KN4 X;  1SD7 A;  2ZKZ A;  3V4G A;  4P96 A;  2MH9 A;  2RV8 A;  1O57 A;  5L3C A;  2HTJ A;  3F8B A;  3OOP A;  4CXF A;  3P7N A; 
#chains in the Genus database with same CATH topology
 5K7H A;  5JLW A;  1MJA A;  1F36 A;  2GLO A;  1XN7 A;  2R4G A;  3GYH X;  1TWC J;  2KQR A;  1T08 B;  1T8I A;  3BZC A;  3C18 A;  3OMY A;  3BOQ A;  3K70 D;  2NRA C;  2X4H A;  1L0O C;  2B7E A;  5D6F A;  5AIP A;  1QBJ A;  1ENH A;  5EZG A;  1USS A;  2M1B A;  4CZC A;  4BQQ A;  1UB9 A;  3ROU A;  3NQO A;  2R93 J;  3KEO A;  1IRG A;  4LIU A;  3HOX J;  3JW4 A;  1QO0 D;  5BPI A;  3BCB A;  4E7K A;  3ZPL A;  2X85 A;  3TO7 A;  5HDK A;  2R5Y B;  2GA1 A;  3MFK A;  2PLY A;  3OS1 A;  4BS9 A;  3EET A;  2GAU A;  3GTL J;  2EZH A;  3FWE A;  1YI2 I;  1JGG A;  4HST A;  1IV8 A;  2IT0 A;  2V26 A;  2FMY A;  4MQV A;  3GFI A;  5HDG A;  4BKX A;  3FMR A;  3DLL F;  3AKZ A;  1UAA A;  3FXK A;  5JLX A;  2JTV A;  2IS1 A;  5JVG F;  4ZDO A;  1HC8 A;  2Z16 A;  4OIQ F;  1DU0 A;  5H6Q A;  3OYJ A;  4PJJ A;  1V5E A;  1UEL B;  2P6S A;  3FM5 A;  1ULY A;  4PJL A;  5EEG A;  3ZN1 A;  3BQY A;  2Y0M A;  3JSP A;  2LY1 A;  2F2E A;  2DA3 A;  5M5X J;  4ZZL A;  1V3F A;  1F4K A;  4H0E A;  4IJA A;  2HOA A;  1SFX A;  4E7H A;  3KZI C;  1AKH B;  3R6S A;  1Z6R A;  2HOT A;  3PFY A;  2XUB A;  1LFU P;  2I5U A;  2M34 A;  2MC3 A;  2KKO A;  5BOX A;  3JRH A;  1MMS A;  1YS7 A;  1TNS A;  5E17 F;  3TDZ C;  1ZK8 A;  1Y0U A;  1YHQ I;  4RB3 C;  1OCZ H;  2DPU A;  1OR7 A;  2R7W A;  3BR6 A;  2FBI A;  1SD5 A;  3CUQ A;  2QUF A;  1YE9 A;  2EIL H;  2KIQ A;  2KIF A;  3M8F A;  3L9F A;  3OSG A;  1FOX A;  1X1B A;  4UB8 C;  3J7A Y;  4W97 A;  1U5T C;  1ZG3 A;  2QF7 A;  2MGQ A;  3A03 A;  4EJU A;  2D5V A;  1LFB A;  3MKL A;  2CJJ A;  3KX2 A;  3CLQ A;  5LEK A;  4BY1 J;  1X3U A;  1Z77 A;  3F23 A;  1Z3X A;  3IHU A;  3CCR I;  1LEB A;  1YJ9 I;  3PUF A;  5IT9 K;  3VOD A;  1T38 A;  2L3D A;  3MZH A;  1H89 C;  4EM0 B;  2K4J A;  3OL4 A;  2Q2E B;  2F5E A;  2VKV A;  4ABZ A;  3DF8 A;  5IT9 Z;  2NOG A;  4A3C J;  4A12 A;  4FQG A;  3DBR B;  5IPA A;  5FLX Z;  3FHZ A;  4M3D A;  4B8X A;  3GTK J;  1YX5 A;  1Z0X A;  3IH3 A;  3CCE I;  4Z2Y A;  2VJ4 A;  4U7B A;  1JKO C;  1NHA A;  3HEF A;  1QZY A;  2ZXJ A;  4H4K C;  5HOO A;  3V8L A;  2Z2S B;  5K5R A;  3JTG A;  3KIO A;  1YIJ I;  1YRN B;  5E3M A;  1S6L A;  4R1H A;  3RTR A;  4XIC A;  1RUO A;  4Q48 A;  3P9I A;  1KYW A;  4CZZ A;  2DT6 A;  3HC7 A;  1WHU A;  2HPI A;  5CKT A;  1JXS A;  5J47 A;  2EBI A;  1Z91 A;  2KJC A;  1U8R A;  2WTE A;  2X6X A;  3BJO A;  3IC7 A;  3CD6 I;  2QSG X;  4MEY F;  2LP0 A;  4UUT A;  1S29 A;  3BTL A;  3F6V A;  3GBG A;  2LOO A;  1PP7 U;  2MD0 A;  3E5U A;  3FKI J;  3I0T A;  3BP8 A;  1ERD A;  1HXD A;  3ZN0 A;  1ORK A;  1Z7U A;  1EKE A;  3HGY A;  3QAH A;  3QPL A;  1WVR A;  3H5A A;  3IRR A;  5FFX A;  5J1Y A;  2ZFW A;  3AAF A;  2KRF A;  1R49 A;  3RCO A;  2KIS A;  3OIQ A;  2W25 A;  3RPQ A;  5IOY A;  3FM3 A;  3CES A;  3FMQ A;  4N0B A;  1U3E M;  1WJD A;  2ZB9 A;  3E6C C;  3DP7 A;  2QCO A;  1TZL A;  1SAX A;  3Q3S A;  2FXA A;  4V19 K;  2IVM A;  4BDY A;  2L7F P;  1H9T A;  4ZYH A;  4ZDL A;  4MTE A;  4RS8 A;  4AIJ A;  1ZH5 A;  3S15 J;  2E35 A;  3KE2 A;  4NUB A;  3HOT A;  1W7P A;  1ZEL A;  3IP4 B;  2HQA A;  1LVK A;  1ETV A;  5TRD A;  4A3G J;  1BOA A;  4XR6 A;  3GZN B;  2L7Z A;  2QQ8 A;  4GYI A;  2HXO A;  2VT3 A;  1JHF A;  4IL6 C;  5J1R A;  1SD4 A;  3R61 A;  2Y48 A;  4KFC A;  2L9V A;  4G7H F;  1IUF A;  5AIQ A;  2Y9Z A;  3VOE A;  4E7Z A;  2X0L A;  2GOX B;  3CTA A;  4UVB A;  1YRN A;  4XLA A;  3K2Z A;  1A36 A;  1CQT A;  4KIC A;  1XDS A;  2V9P A;  2ZSI B;  2ESH A;  4D0P A;  3LSM A;  1BIB A;  5J8F A;  3WTX C;  4ESF A;  2QQB A;  1XC5 A;  4RAF A;  3LSR A;  2NVX J;  2G9W A;  1BM9 A;  4MHG A;  2CO5 A;  2IEK A;  2Z5U A;  1ZR2 A;  4IXA A;  2V79 A;  3GXO A;  3GTQ J;  5HS9 A;  1K61 A;  5LD2 C;  4Y52 J;  3CP8 A;  4BUP A;  2Q0O A;  3S17 J;  1U0J A;  1MJB A;  2GQQ A;  1HOM A;  4BEH A;  4OU0 A;  4F3Q A;  4X6A J;  2ZSH B;  4BEH B;  3TBI A;  4JX6 A;  5IP6 A;  2E71 A;  2CUJ A;  1SMY F;  2PJR B;  1TL8 A;  1D1B A;  4IPA A;  1ETX A;  1G3S A;  1XSX A;  4JX4 A;  1ONV A;  3WHB A;  3O6B B;  4LK0 F;  3JAM K;  2VXZ A;  5CQG A;  3MAJ A;  4A0X A;  2ZME C;  4M3F A;  2CW7 A;  2Z33 A;  2FOW A;  2AO9 A;  1XCB A;  1YLF A;  3ONQ A;  3Q9V A;  3W6K B;  3C7J A;  2C6Y A;  3HOW J;  3GLX A;  3D0S A;  4I7H A;  3IKT A;  4B3A A;  2E7W A;  1VQ8 I;  5E8G A;  1ZYR F;  5GAH J;  3KZY A;  3LSG A;  4AWX B;  1R5H A;  1ZAO A;  4GDF A;  1D5Y A;  5ICE A;  4G7O F;  2LTP A;  2VJJ A;  2BY1 A;  2YUS A;  4G6D A;  2F5F A;  1KU2 A;  3T8R A;  2XKP A;  3QOE A;  5HNF A;  5M5W J;  5DYM A;  3HRM A;  4M72 A;  3K2A A;  4CCL A;  1BI1 A;  1FOY A;  2R7Z J;  1D5V A;  2Y30 A;  3ZQG A;  1WPK A;  4A0Z A;  2HOE A;  1S3J A;  4HX4 A;  2ZCW A;  4TV7 A;  4CCJ A;  3TP3 A;  1X4O A;  2O8X A;  2NAZ A;  3H5N A;  3KPH A;  1LNW A;  4KN7 X;  4BAC A;  1YG2 A;  1NG7 A;  4L5J A;  4ASN A;  3ZCO A;  2FNA A;  2LKP A;  3I9V 2;  4HEA 2;  1Y8R B;  4NC7 A;  2JMW A;  2PQ8 A;  3SEZ A;  2ADU A;  4QPO A;  1RES A;  1R23 A;  3C3W A;  3K6G A;  5IP9 J;  1WI9 A;  4U7D A;  1MJ9 A;  4L9N A;  4D1Q A;  3QU3 A;  3FKJ A;  1W5T A;  2LSO A;  3OYH A;  1CGP A;  5LGN A;  3I58 A;  4GGG A;  2B63 J;  1G3T A;  2R7Q A;  1XX5 A;  4IQ4 A;  2V1N A;  5E79 C;  4UVC A;  1Z1D A;  3I56 I;  3A4C A;  3CF2 A;  3N97 A;  1OJL A;  2L02 A;  1XMK A;  4E4H A;  2E5N A;  5F6F A;  3D5R C;  2F5V A;  1A6I A;  1BBY A;  4Y17 A;  1T98 A;  1HCR A;  3SFZ A;  2K9N A;  4BHB A;  1MMD A;  1H8A C;  2BXY A;  4S0H B;  4MFD A;  1X3W B;  2EZI A;  3LSP A;  1GV2 A;  2HYF A;  2VLA A;  2BZT A;  1GDT A;  4OOI A;  1XCV A;  3BRO A;  3FZV A;  3BR3 A;  3VPR A;  1FIA A;  3CDH A;  4C9Y A;  5K1Y A;  2PEX A;  2HWV A;  3LA7 A;  1OPC A;  2CW0 F;  3E3V A;  3OIP A;  2CQK A;  1R5I D;  4GRI A;  3OOU A;  1AA7 A;  3AG2 H;  3GUD A;  2DMU A;  1IW7 F;  2CRG A;  2M0M A;  2M7B A;  3EYI A;  3V7S A;  4IZZ A;  3DU5 A;  4XRM A;  3MKW B;  5J4Y A;  2LKX A;  2XAH A;  2HZT A;  3PO2 J;  2HKO A;  3L2C A;  3K0L A;  1IRX A;  2E7X A;  2IGO A;  3VFZ A;  2QA4 I;  1E17 A;  2DK8 A;  1S7A A;  1GV5 A;  3H9Q A;  1WRJ A;  1O7F A;  1R58 A;  1MH4 A;  2VT2 A;  5J1U A;  1BI0 A;  4QWQ A;  1E3P A;  1MMA A;  4ZDP A;  3BG3 A;  2EK5 A;  1PUF A;  2DOE A;  3OWT A;  4AD9 A;  2FOK A;  3H35 A;  2DYS H;  1UHW A;  4BXU A;  2E1C A;  3KLO A;  1W0T A;  3RZD J;  2GIZ A;  1RIO H;  5L3B A;  3E0J B;  3FBN B;  3QYF A;  1U78 A;  1R1V A;  2ZBK A;  3BPX A;  2CGP A;  3W2A A;  5H6R A;  5ICC A;  4XK4 A;  1PDN C;  3BTJ A;  4I76 A;  1TW2 A;  3ZQQ A;  3FXR A;  4AM3 A;  3I5U A;  2DCE A;  4ZH4 F;  5K5O A;  2Z3Y A;  4L0Z B;  1D1A A;  2ESN A;  5DCF A;  3NRV A;  4M9X A;  1FTZ A;  3LQR A;  1MGT A;  5ED4 A;  4HYE A;  3SZP A;  2VC1 A;  5FLV A;  3ZQF A;  3HRU A;  1P2F A;  1ETY A;  1TNT A;  1XG1 A;  3F9K A;  4RGU A;  4ON0 A;  3AG3 H;  1JUM A;  2QGU A;  2DOD A;  4XOR A;  2VL8 A;  1F5T A;  3G6E I;  2NS0 A;  3JAM Z;  4Q5S F;  1XGM A;  4IHY A;  1YS6 A;  1RR8 C;  2EPF A;  2E5Z A;  3K4M A;  3ZQC A;  4BJ6 C;  2HS5 A;  4ZYD A;  5GPA A;  4II3 A;  2BEO A;  4R8H A;  5E3O A;  5B66 C;  4ZYG A;  1O3T A;  2HDW A;  2XRL A;  1YO5 C;  2A5W A;  2COM A;  1MSF C;  4KNY A;  4HNU A;  1QQI A;  1HDP A;  2JUC A;  3GVA A;  4AYB A;  3IL2 A;  2KMU A;  5IOZ A;  1B9N A;  2OQR A;  5K7Z A;  1N75 A;  2L9R A;  3F8C A;  1OIS A;  1EH8 A;  4WK8 F;  4C3J J;  1BOB A;  4LLG F;  2P0W A;  2VQC A;  3U9G A;  1B9M A;  1F1Z A;  2LMD A;  1J7K A;  2X6W A;  5DTD A;  4BXX J;  2W7N A;  3J7A O;  1RUN A;  2E36 A;  4IHT A;  2L01 A;  4A3K J;  4DZP A;  3L1P A;  2NXN B;  5B1B H;  4MO7 A;  2IS6 A;  1NH3 A;  2G0E A;  1D0Y A;  4GCV A;  3RYP A;  4IQJ A;  1HW5 A;  4OMY A;  2A07 F;  2CUZ A;  2Z99 A;  3CCS I;  1UHS A;  4F91 B;  4I98 B;  4BAY A;  3PUB A;  1B4A A;  2DTZ A;  1Y56 A;  2RQP A;  4KT5 C;  2L4A A;  2IAI A;  5EZH A;  4UNO A;  3ESW B;  3ZQ7 A;  2COB A;  2JUG A;  2ECC A;  1BR1 A;  2OZ6 A;  4FET A;  5DD8 A;  3QOD A;  3RDI A;  4XLH A;  1VFC A;  4M74 A;  4UUV A;  4BYY A;  1JT0 A;  1TW3 A;  5F64 A;  4ANJ A;  2A61 A;  1DGW Y;  1NTC A;  1SVL A;  1TWH J;  3C2H A;  4CDG A;  5FRO A;  1KU7 A;  1LUJ B;  2OTJ I;  1ITY A;  2DFI A;  4LD5 A;  3ZRG A;  4J00 A;  2P6T A;  1UG2 A;  2EIK H;  1EA3 A;  2OV7 A;  2OU2 A;  3GWZ A;  3GTP J;  1HQC A;  1T56 A;  3WU1 B;  2JVG A;  3F72 A;  4FIS A;  3ELK A;  4WXH A;  3VYU B;  2JSC A;  2QQ9 A;  4D7N A;  2ELJ A;  3EPZ A;  3E97 A;  4BBS J;  5A2Q K;  3BWG A;  1O7L A;  2HXI A;  2KL4 A;  2RDP A;  1ETQ A;  2VB6 A;  4Q47 A;  1JT6 A;  2GOM A;  4D9J A;  3HTU A;  4A3J J;  1N25 A;  1V5G A;  2LF7 A;  1ZGJ A;  3BPV A;  1N77 A;  3IWF A;  3OYB A;  3K1N A;  3S1Q J;  2E1M C;  1XMA A;  5KAF C;  2A05 A;  3B6A A;  2K85 A;  2MSY A;  4BU2 A;  1IDZ A;  3OR2 C;  1TT5 B;  2VE8 A;  1W1W E;  3FXU A;  3W6V A;  3WE3 A;  2FBK A;  2MG4 A;  3PNV A;  3V8K A;  2KIM A;  2O61 A;  4HA8 A;  4I01 A;  1MBK A;  1ZGA A;  4UV8 A;  2XGX A;  2N8G A;  2M3A A;  3BY6 A;  3ZMU A;  3WGG A;  1W0U A;  1QA6 A;  1VQK I;  1REP C;  4XLE A;  2CG4 A;  2Y9Y A;  5LHH A;  1OR7 C;  1BL0 A;  5LFA A;  4A3M J;  2VOP A;  2GA2 A;  4A5M A;  1MH3 A;  1BI3 A;  3LSK A;  3VSK A;  2E2I J;  2E34 A;  2DFF A;  4OIO F;  5TIS C;  3I55 I;  3KFW X;  1OCT C;  3WTU C;  5KK1 A;  5DCM A;  2J5P A;  2W82 A;  3I3L A;  3C2G A;  4MIM A;  4KMU X;  2WY7 Q;  4NDL A;  1OMI A;  1R5G A;  3G71 I;  5F27 A;  5CPR B;  4MLO A;  4YFN F;  3FXO A;  2K27 A;  1BIA A;  1WJB A;  3IWZ A;  1ZR4 A;  1KQ0 A;  4LIV A;  4BE0 A;  4OIR F;  1YIO A;  4I0B A;  1Y39 A;  5E1X A;  5HNH A;  3GW2 A;  1BA5 A;  2DA5 A;  1P7I A;  3QPT A;  4JQF A;  4DYC A;  3CCM I;  5GTH C;  4EGZ A;  4RAZ A;  4UHT A;  1QPI A;  2XAQ A;  3BTC A;  1YW7 A;  1LFP A;  3HZJ A;  1EF4 A;  1IN7 A;  4EAT A;  3R0J A;  5FB2 A;  2CSO A;  2X1C A;  1ETW A;  4XBF A;  1TQI A;  2DA4 A;  1D8J A;  4YEJ A;  1IJW C;  4GXO A;  2DOF A;  1CF7 A;  1FBU A;  3V8J A;  1TT0 A;  1GVD A;  4EJW A;  3T8T A;  3GFL A;  1WJA A;  1FJL A;  2STT A;  2JZY A;  3DEU A;  3Q0V A;  2RC4 A;  4D5F A;  1Y8Q B;  4UB6 C;  1CF7 B;  5CJ9 A;  2H8W A;  1OKR A;  2EJR A;  2MC4 A;  2OQG A;  1I3Q J;  1ZLK A;  4RAY A;  1QZE A;  3RI4 A;  2A6T A;  4BNC A;  1IN6 A;  2XPU A;  5FJ8 J;  1Q1V A;  3MZY A;  3DLA A;  1U9N A;  5B1A H;  4YIR X;  5LGT A;  5FLX K;  3K7A J;  2VIX A;  4DW6 A;  2LY9 A;  3OYC A;  2Y69 H;  3SEQ A;  4RDU A;  2BHY A;  5JHF A;  1VI0 A;  3E1S A;  1WSU A;  1S7O A;  4PFP A;  2VBX A;  4LLL A;  2LRD A;  4A0Y A;  3ZMT A;  2X6Y A;  2ISY A;  1RC9 A;  3LFU A;  1WJF A;  2VC0 A;  4O6J A;  2JRM A;  3FHN A;  3IKV A;  3BZK A;  3WU0 A;  2OC6 A;  4HQM A;  2IS2 A;  3HG9 A;  4ETS A;  1S72 I;  4DJA A;  3A0H C;  4CYC A;  2L2O A;  4F55 A;  1FYK A;  3A1Y A;  3CDI A;  2QSF X;  1WQ2 A;  4IHW A;  4EM2 A;  2B9S A;  3TW7 A;  1MBE A;  1YJN I;  4NC6 A;  4OIN F;  3PIO F;  3DKY A;  2ELK A;  4JBA A;  4PSW A;  3RPU D;  3WGH A;  2R7S A;  2GIV A;  2VXD A;  2E1O A;  2IA0 A;  2KJB A;  2JA2 A;  5EF6 A;  3R4K A;  3EUH C;  3OYA A;  1I3A A;  4AYB N;  2QLZ A;  3OR1 C;  4XOP A;  3MCZ A;  2EQR A;  1IZ1 A;  4A6D A;  4DYQ A;  4B09 A;  1QZZ A;  2EV6 A;  3PJR A;  3OYE A;  2WC2 A;  1MDM A;  1X1P A;  1R1U A;  2DMQ A;  2HI3 A;  3JTH A;  3U1K A;  4BQN A;  3DWL E;  3KYD B;  2LR8 A;  4N9H A;  1H88 C;  2J5O A;  2ZNZ A;  4AIK A;  1P9Q C;  2DO7 A;  1OCP A;  1IF1 A;  1DP3 A;  2WBM A;  3GFJ A;  3JRI A;  2V4J C;  1SFO J;  1UST A;  2A6H F;  3FX3 A;  1Y1V J;  1OYY A;  2XB0 X;  4P5O A;  3AL0 B;  1P6R A;  4E7I A;  4ZYA A;  3F22 A;  1P7J A;  2KZG A;  4RB1 A;  3FIS A;  4B4C A;  1Z05 A;  2DMN A;  1ZHF A;  3H0D A;  3CUQ C;  3DKX A;  4XKB A;  5DD4 A;  2NNY A;  5IYB J;  3DBH B;  3CME I;  4FCY A;  4CHU A;  2JA6 J;  3I4P A;  1J9I A;  2HNH A;  4KIS A;  4BE1 A;  2W00 A;  2O8K A;  2E2J J;  2WB1 N;  1B1B A;  1X2M A;  2O3F A;  1KA8 A;  1FOW A;  1MMG A;  3ABK H;  4NBQ A;  4RBO A;  2BE5 F;  2YU9 J;  2EIJ H;  2V9K A;  4A3L J;  2JA8 J;  4LG3 A;  1POG A;  3TDU C;  3WU2 C;  2K9L A;  2M5W A;  3I59 B;  3TQN A;  1BR2 A;  1JUS A;  4CCO A;  1B72 B;  2QZ8 A;  5ERI A;  4DZJ A;  4EM1 A;  1VTN C;  1FP1 D;  3S16 J;  2F4M B;  2ME6 A;  1WJE A;  1XTA A;  1C0W A;  3JCU C;  4HDV A;  1BN5 A;  2CUF A;  4L9J A;  2NNN A;  2OBP A;  2XDV A;  2M8G X;  3CJR B;  1T95 A;  3NWS A;  2CH0 A;  3FXQ A;  1DUX C;  1A5J A;  1V5F A;  2W84 A;  4BDZ A;  5GPC A;  1QNT A;  1NG6 A;  2XIG A;  3L2W A;  2XAU A;  3RPU A;  5BNG A;  3LST A;  4XSZ F;  5EG0 B;  2FQ3 A;  1R71 A;  4BHC A;  3CCY A;  1JGS A;  5DUI A;  4QTR A;  5L3E A;  3ULQ B;  2ID6 A;  3JRE A;  3HOU J;  3X2Q H;  3BJ6 A;  1UHM A;  2EZK A;  3O2P E;  5C44 J;  1VQ5 I;  3CO7 C;  2HR3 A;  2CV2 A;  2WAE A;  1LB2 A;  5FO5 A;  1YYV A;  2HZD A;  3MVP A;  3OS2 A;  4PGH A;  1U2W A;  1IN5 A;  2DOA A;  4RMN A;  4LB5 A;  4A69 C;  2R7R A;  2EA4 A;  3TKY A;  3MD2 A;  1J0R A;  5AON A;  2A6E F;  2WA0 A;  1DQU A;  2IA1 A;  3PQJ A;  2VPL A;  4M3B A;  2PBI A;  4ZC3 A;  4BGD A;  3ZP5 A;  1I1G A;  5TJJ A;  3CC4 I;  1HKT A;  3CJQ B;  5F1R A;  3ABL H;  3S2H J;  2OPT A;  1DU6 A;  1EV7 A;  2DA1 A;  4I6Z A;  4C2M J;  1R4M B;  4RLQ A;  2IXS A;  4YEL A;  3RYR A;  2V6E A;  4EQQ A;  5CYV A;  2XC7 A;  2L54 A;  3DTI A;  5EG0 A;  2DT5 A;  1SD6 A;  1PYV A;  4F52 A;  5KNL A;  2EWN A;  3A2K A;  4HX8 A;  1UMQ A;  2IGK A;  2VKH A;  2DPD A;  2M0C A;  3K10 A;  3L00 A;  5HLH A;  3JRG A;  1HW2 A;  1JTX A;  3I4M J;  3BG9 A;  2K5C A;  1W7P D;  3JR9 A;  2UXX A;  2KDO A;  4CCK A;  2GM4 A;  5CQE A;  1K4T A;  1VQO I;  4BXF A;  4ESJ A;  2IBD A;  2W1O A;  1V54 H;  2V6C A;  4JK1 X;  4XRS A;  1FTT A;  4LJZ F;  3SHF A;  2OZU A;  1XD7 A;  3G1O A;  2P5V A;  3CCU I;  3BZ6 A;  1UJ8 A;  3DEW A;  1GLN A;  4F93 B;  3CMY A;  1VQ9 I;  3HSE A;  2M8E A;  3SDB A;  1OCO H;  3WGI A;  2H09 A;  4HNT A;  3VEP A;  1IXC A;  4UUS B;  5JR3 A;  1VQ4 I;  4GFB A;  2TRT A;  1G4D A;  1PUF B;  1W4M A;  4RM3 A;  4MNU A;  3SJM A;  1Z3Y A;  2A69 F;  5A2Q Z;  3ERE D;  1FZP B;  1LJ9 A;  2Q8K A;  2VE9 A;  4NQW B;  4IOC F;  3L09 A;  1KQ8 A;  2E19 A;  3ZXS A;  2PG4 A;  6PAX A;  3C2B A;  2GBY A;  5IT3 A;  4QLC U;  1FWZ A;  5LLQ A;  2DTR A;  2DYR H;  1VQM I;  1OFC X;  2HKX A;  1O3Q A;  4DBQ A;  3F8F A;  5HS7 A;  2JPC A;  2LY2 A;  1LPQ A;  4YRV A;  1HKS A;  2BOL A;  3K4B A;  3BG6 A;  2D45 A;  2Y0S A;  2LG4 A;  3QP6 A;  4RGX A;  2NVU B;  2D1H A;  4LB6 B;  3P9K A;  2E1N A;  1MSE C;  4KIG A;  4DIQ A;  3J80 Z;  4L5I A;  1VQ7 I;  2KDZ A;  3H9G A;  3RKW A;  3Q0U A;  2Y75 A;  3HL2 A;  1U6G A;  2KHM A;  2L4M A;  2L9S A;  4O5V A;  2EFN A;  2RAE A;  1R00 A;  1RKW A;  3VSL A;  3TED A;  4Z6Y A;  3Q9S A;  1MMN A;  2VPR A;  2O7O A;  1MNE A;  1LE8 B;  2H27 A;  3ML6 A;  3SQN A;  1V55 H;  2MFZ A;  5HS8 A;  1PVE A;  2Z9O A;  5M3M J;  4KDP A;  5F1J A;  4GO1 A;  2RNJ A;  5JVT A;  2XF7 A;  3S2D J;  3HKZ A;  4HF0 A;  4GYG A;  4FTH A;  1S5L C;  2KRC A;  1TLH B;  2V1D A;  5D5X B;  1JJ8 C;  2F5D A;  2GXG A;  3KEY A;  4X0G A;  1ACI A;  3BR2 A;  5BQT A;  2M4K A;  2KRH A;  3RSN A;  4KUM A;  4NQW A;  3ZMS A;  2DLL A;  3RKX A;  2BVL A;  2K9Q A;  3LNQ A;  1LKX A;  2DA2 A;  2H94 A;  4I0A A;  1OYI A;  2FD5 A;  5BS6 A;  2BW3 B;  2CV0 A;  3HGG A;  2BYV E;  4ZZD A;  4HLX A;  3ZMV A;  3L7W A;  5IYC J;  3R0A A;  2LLK A;  3E6B A;  4JX5 A;  4HF2 A;  1FMW A;  5B3S H;  3OS0 A;  1JKP C;  3E6M A;  3NEU A;  2D2W A;  3JRC A;  4CO8 A;  2X48 A;  2DQL A;  1DPU A;  5F0F A;  1IC8 A;  1BI2 A;  4FT8 A;  2JN6 A;  3TMO A;  1H0M A;  2Q1Z B;  5H20 A;  4XOT A;  4UY8 I;  3I54 A;  2DK5 A;  3S2W A;  3G1M A;  3BR1 A;  2FQ4 A;  3QYB A;  4XM3 A;  3GZ6 A;  4MQ9 F;  1AHD P;  2NOJ B;  1U8B A;  1J59 A;  1D3Y A;  1BW6 A;  3B73 A;  3F21 A;  2JA5 J;  4JP0 A;  1T39 A;  1O4X A;  3CC7 I;  3HM5 A;  2HDC A;  3IAS 2;  4Y15 A;  1QGP A;  3D5L A;  2KFD A;  1QVT A;  2LBF A;  5IYD J;  2XRO A;  3FK7 A;  4I2O A;  4FX4 A;  3M07 A;  4L9V A;  2STW A;  3RJP A;  3PNT A;  2OA4 A;  2WAF A;  4EJV A;  1P4W A;  4XRS G;  5J40 A;  4PJ0 C;  4E7S A;  3GTG J;  2NVQ J;  1U5T B;  4II2 A;  3QWL A;  2FML A;  2AXL A;  3TO6 A;  1R9T J;  3CQZ J;  2M2E A;  1MNM C;  2QKL B;  2VN2 A;  1K4S A;  3M8E A;  2LDU A;  2FJ1 A;  3PSF A;  4KA4 A;  1FEX A;  2O5R A;  4P1W A;  1HST A;  4RM2 A;  1Z6T A;  4PSX A;  2LK2 A;  3HOY J;  3A01 B;  2VQH A;  2PI0 A;  5B5E C;  3BR0 A;  2D1V A;  1H9G A;  3S3O A;  1UCR A;  1F43 A;  3TP0 A;  3O8H A;  3S32 A;  1NK3 P;  1YFH A;  2O9L A;  3HHG A;  2EA2 A;  3A02 A;  1EH6 A;  1EJ9 A;  2HYJ A;  1HW1 A;  3F8N A;  1JI8 A;  1LQ1 A;  3CDL A;  3H1C A;  3K69 A;  1ZLJ A;  2NYX A;  2LVS A;  4ZTF A;  5E20 A;  2FE3 A;  1K7A A;  2CQN A;  1GT0 C;  1J09 A;  1ZRF A;  2WAD A;  2DMP A;  5LEJ A;  4IKF A;  3HIF A;  3GTO J;  5DDG A;  1LEA A;  3DU6 A;  4HZF A;  3J80 K;  4K2E A;  5FFZ A;  4M73 A;  4IHS A;  3DEE A;  3S1M J;  2ICW G;  2QKM B;  3U21 A;  4JYK A;  4XSX F;  4ESB A;  1TWG J;  3A0B C;  2FF4 A;  2R5Z A;  2G7U A;  1QHH D;  3MN2 A;  4LOC A;  4OAY A;  1SFU A;  2PJP A;  2VKE A;  2M7A A;  5GTI C;  2AS5 F;  4RB0 A;  2OAZ A;  3GEZ A;  5EEA A;  4U87 A;  2EFP A;  4OIP F;  4UUS A;  4OWR B;  1WKM A;  3PFI A;  1T0F C;  3FXL A;  3HPG A;  3COA C;  1J75 A;  3CJN A;  1K6Y A;  2ID3 A;  5C4J J;  4E7L A;  2XV4 S;  2CQQ A;  5CVJ A;  2W57 A;  2ZME B;  2ELH A;  1GXQ A;  3ISP A;  3FK6 A;  3CZ6 A;  1GHC A;  1X58 A;  5L3F A;  2F6C A;  4D7M A;  2TDX A;  3SDG A;  4O3M A;  5HLT A;  4KIT B;  2M4G A;  3QU6 A;  4W1U A;  4PCQ A;  1HKQ A;  4UV9 A;  2DA7 A;  3OL3 A;  1A31 A;  3G4S I;  2CQ7 A;  4G8X A;  1X3Z B;  5CVV A;  1QPM A;  3PQK A;  3WTW C;  1Q1H A;  1IAW A;  4C30 A;  3IH2 A;  4I02 A;  3VWB A;  2WB1 A;  1K83 J;  4AC0 A;  5EGO B;  5FGM A;  1YIT I;  2X6O A;  1RET A;  4NHJ A;  4P9U A;  1FY7 A;  4DBR A;  3OIO A;  1G8X A;  1WH5 A;  5D8K B;  1O3S A;  3E5Q A;  4MGR A;  2DN0 A;  4IHV A;  2P81 A;  5F0C A;  1VQ6 I;  3BQZ A;  2XAG A;  3BG5 A;  2HU9 A;  1TWF J;  3DTE A;  3JRF A;  2PMH A;  4B3X A;  2K40 A;  3FXM A;  3S93 A;  1V4R A;  2LKS A;  5GAG J;  5LHG A;  4BY7 J;  4XQF A;  2FUG 2;  3OYD A;  2ZXI A;  3L2Q A;  1FLI A;  3EUA A;  1U5T A;  2V1X A;  4A3F J;  5ICF A;  2VJ5 A;  3LQQ A;  4J01 A;  2HPM A;  1EH7 A;  3JRD A;  3N4M A;  3JRB A;  2JSP A;  4RGS A;  4AVZ A;  2BVM A;  3NWT A;  5HVQ C;  1X19 A;  3DBL B;  2CV1 A;  4CYD A;  2K7L A;  1R4N B;  1ZTR A;  5FKM A;  2K86 A;  3FDY A;  4BH9 A;  4ENM A;  3HKZ N;  1ZRC A;  4V2F A;  1IXS B;  5EGO A;  3G73 A;  1P4A A;  4G9Y A;  1YQA A;  4EVI A;  2YS9 A;  3QRF F;  1YTY A;  3DV8 A;  2V7F A;  2P5L C;  4HV6 A;  2XGC A;  2YU3 A;  2H6B A;  1IO2 A;  4Q4Z F;  4RLF A;  3BR5 A;  2XSJ C;  1FOK A;  3I71 A;  4MEX F;  3RZO J;  1X2N A;  2R7O A;  4XLF A;  4QIW N;  1MBH A;  2BHZ A;  3CP2 A;  2HGC A;  5ILS A;  4XKW A;  4G7Z F;  2QEX I;  2RVC A;  5LBQ A;  2IRF G;  4LG0 B;  3H3U A;  1IGN A;  1HSJ A;  3BC8 A;  1B72 A;  1FIP A;  2FU4 A;  1MZB A;  2OTL I;  2ZXH A;  4BQA A;  2MLG A;  3KZZ A;  3GO5 A;  4L5E A;  2BW3 A;  2YX7 A;  3E6D A;  5FLM J;  1KU9 A;  4U0V A;  3HBL A;  1LDJ A;  3MKZ A;  1SAU A;  2PJR A;  1I1S A;  1IN4 A;  2X1D A;  1JKQ C;  3M7G A;  1VF9 A;  5FKO A;  3T1B A;  3ZQI A;  3J7Y J;  1WCM J;  2CYY A;  3OV8 A;  5HLG A;  3IH4 A;  1FBS A;  3T0Y A;  1KZH A;  1GVJ A;  1X1D A;  3DPU A;  2CFO A;  4P55 A;  4B48 A;  2V1U A;  1G6N A;  3RIR A;  2FNP A;  1I39 A;  3FXJ A;  3JSO A;  3CF5 F;  5JI6 A;  2WAQ N;  2LFB A;  1BC7 C;  1TP4 A;  1AOY A;  2L7M P;  1ZG5 A;  5HDN A;  3U2R A;  3VYT B;  2YR2 A;  2E60 A;  1WFX A;  3LA3 A;  1A35 A;  4PZJ A;  2ACJ A;  2FRH A;  2K4B A;  1VND A;  2FBH A;  5FKN A;  4PJN A;  3W3C A;  5DEQ A;  3DPL C;  5FRN A;  2M9H A;  1FSE A;  4AUX A;  4B47 A;  2F4I A;  4BHP A;  2RRE A;  1JTY A;  1VZ0 A;  2FSW A;  4NC8 A;  3TOA A;  1K78 A;  3NAR A;  3WOD F;  3OY9 A;  3EDP A;  3KP4 A;  3W6J B;  2R7X A;  4C3I J;  3G2B A;  4J19 A;  4PJM A;  3M9A A;  1P4X A;  1YOV B;  4HDU A;  2BY0 A;  2LD5 A;  3ASO H;  4XMY A;  1K78 B;  2OCE A;  4XLP F;  3BT9 A;  4HBL A;  5TGT A;  3GX4 X;  3KP6 A;  3K4N A;  2EH3 A;  1XDU A;  3QPS A;  3S1R J;  1IRF A;  4KJZ A;  3DKW A;  3GCM A;  3UKG A;  2ETH A;  2M30 A;  2UZK A;  4EJO A;  5E8I A;  2ZC2 A;  2DBB A;  3F8M A;  3A01 A;  4XKC A;  2TCT A;  3KEQ A;  4E70 A;  1DDN A;  2DDA A;  3ECH A;  2K3P A;  3TO9 A;  5M5Y J;  1W7P B;  4M6V A;  3GFM A;  2Y0S N;  1RNL A;  2X1E A;  1MBF A;  4F92 B;  1T0F A;  2I8D A;  4HX7 A;  5E3N A;  1WZ2 A;  5E18 F;  2MD5 A;  2HQ5 A;  4HF1 A;  3FMS A;  3NAU A;  4KT6 A;  1DGR M;  1HA8 A;  3PIP F;  3WTS C;  2CUE A;  5KCM A;  1E3O C;  3T5X A;  2VBW A;  3ASN H;  3CCJ I;  2A3S A;  1OCC H;  1R6R A;  2JPB A;  2LNB A;  2WY8 Q;  2QSH X;  4RAG A;  3SXY A;  5CVR A;  2K9M A;  2LC2 A;  2MW8 A;  2XGD A;  3OYL A;  1I6H J;  2JQ7 A;  1VQL I;  4XL9 A;  1TTY A;  2RKH A;  2LBF B;  5J3L A;  2VUM J;  3BLY A;  1K79 A;  2DI3 A;  3P5J A;  4L18 B;  4JOM A;  1IUY A;  2CMP A;  3GTJ J;  2AQF A;  4CSW A;  1W36 D;  4ZJZ A;  4IRH A;  5D5W B;  3F3X A;  1LDK B;  2FX0 A;  3D1N I;  1OQY A;  2DQR A;  2P7V B;  5FD5 A;  3V7C A;  3DCF A;  2KT0 A;  1SMT A;  3GF2 A;  1TC3 C;  1JE8 A;  2MYS A;  1SEU A;  2HTS A;  3L2V A;  5EEH A;  4ENK A;  4ENJ A;  2WAQ A;  1DPR A;  4WXC A;  1ZRD A;  4FE7 A;  2G7H A;  3BTI A;  4AVP A;  1M1E B;  2F4O B;  2VI6 A;  3ZMZ A;  5D6E A;  2DDB A;  3OYM A;  1ZQ3 P;  2XB5 A;  3GLL A;  3G1L A;  2E2H J;  3H9J A;  4IX7 A;  4PK4 A;  5D5V B;  1ZAR A;  2UV1 A;  4XID A;  1FBQ A;  2R5Y A;  4RGR A;  4HQE A;  1FYM A;  2QQA A;  1FNN A;  2MH2 A;  3ABU A;  3LOC A;  4WX9 A;  2KIU A;  2MBF A;  1R22 A;  3ZMD A;  1GXP A;  2H1K A;  3S1N J;  3M4O J;  4C2U A;  5DUK A;  2GZW A;  3BDD A;  1VQN I;  3IV5 A;  2RN7 A;  3CUQ B;  4V2G A;  3TOB A;  3I53 A;  5LGU A;  5LRS A;  2DFE A;  4AIH A;  3CC2 I;  2L0K A;  3QQA A;  3DTK A;  1NK2 P;  3V42 A;  1FSH A;  2RGV A;  1T2K A;  1APL C;  1SFK A;  1SFE A;  5E1W A;  2MAB A;  4HNV A;  2EFO A;  2CU7 A;  2PMZ N;  2K02 A;  1JJ6 C;  2KP6 A;  2JJ7 A;  1LDD A;  4YG2 F;  1WJ5 A;  3WE2 A;  3ZOB A;  2OUM A;  3K4L A;  3CMA I;  3M8J A;  2Y2Z A;  2P7C B;  9ANT A;  4Y13 A;  4A3I J;  3LSI A;  4HRI A;  1XPX A;  2RQQ A;  3LAJ A;  1T33 A;  1MIJ A;  2XPV A;  4KIF A;  3VYR B;  2F5C A;  4IHX A;  1ON1 A;  4HOB A;  4LFU A;  2GXB A;  1MBJ A;  4CH7 A;  4ENN A;  3LFK A;  1E3H A;  2NVT J;  5D5U B;  5DV5 A;  5HOD A;  1ON2 A;  3FF5 A;  3I59 A;  2CS3 A;  1FMV A;  4HW0 A;  4CIC A;  4BJ5 C;  4G94 A;  1D0X A;  5E3L A;  3WTY C;  2A5Y B;  1FPQ A;  3OYN A;  1HBX G;  2H8R A;  3HDD A;  3LSH A;  3QOP A;  1Z7L A;  3TL4 X;  3M1C A;  1BJA A;  1TQP A;  3CUO A;  4M6Y A;  5DM7 F;  1Z21 A;  3S3M A;  1MW7 A;  2DA6 A;  3LSJ A;  1PUE E;  1E2X A;  3GTM J;  2HFH A;  1WWX A;  2BY2 A;  2LRE A;  1WH7 A;  4HSR A;  1AWC A;  1DP7 P;  4LK1 F;  4EGY A;  2AXT C;  2I10 A;  3H3V K;  2EIM H;  2JVH A;  1IN8 A;  3H0G J;  4A2U A;  3HRT A;  5FD6 A;  1Y1W J;  2XPW A;  2ZO4 A;  4WXD A;  1MD0 A;  2VJI A;  1W5C C;  5BMZ A;  3HUG A;  5E1Z B;  3ZGK A;  4IOA F;  1KON A;  1PJR A;  4KMF A;  2AHQ A;  1FC3 A;  3KP2 A;  4NNJ A;  5CVU A;  1RPW A;  5JHU A;  2BV6 A;  2JRT A;  3SZT A;  4MFE A;  3ABM H;  1WGX A;  2LYC A;  2HQR A;  4PGG A;  1D0Z A;  4U88 A;  5KVR A;  1RZ4 A;  1ZN2 A;  3PSI A;  4KIB A;  4Y4R A;  1Z67 A;  4FHT A;  2MA3 A;  2XSD C;  2BBY A;  3EUH A;  1PP8 F;  2WV1 A;  4YII A;  5C3E J;  4I99 C;  4M9Z A;  3ECO A;  4XRF A;  4R79 A;  1X1A A;  3KP3 A;  4DOZ A;  2HDD A;  4I09 A;  4XLC A;  2JWT A;  2ZXW H;  2L7K A;  4Y3O A;  2IA2 A;  1RI7 A;  4N4N B;  4CUG A;  2P4W A;  2Q2E A;  4M71 A;  3RKY A;  2RNG A;  4CCM A;  4S05 A;  3H92 A;  3WTT C;  4XKV A;  2OD5 A;  4DNC A;  3I4N J;  3J81 K;  4ZTJ A;  2K3F A;  1SVO A;  5D4S A;  1ETO A;  1A6Q A;  5D8L B;  4FAS D;  2W85 A;  3REO A;  2XAS A;  2CW8 A;  3EQL F;  2HVS A;  1I27 A;  1KU3 A;  5IP7 J;  4BJT A;  2R7U A;  3HOS A;  2QVO A;  3HSR A;  1E0E A;  1STZ A;  2IW5 A;  3UR3 C;  3KET A;  1WI3 A;  1SVM A;  5F0H A;  2W4S A;  3LMM A;  1AKH A;  2EZL A;  3GZ5 A;  5FKK A;  3HSF A;  3H5R A;  4B1R A;  4DYR A;  1P92 A;  2F48 A;  3WTV C;  2IS4 A;  1YW8 A;  3WG7 H;  2XGE A;  1ODD A;  4M3E A;  3DQV C;  3MKY B;  3SFI A;  2AQE A;  2W48 A;  4EMS A;  2OF7 A;  5DS9 A;  2VOO A;  3S3N A;  1XS9 A;  2Z1D A;  4IF4 A;  3GME A;  2ZJR F;  3Q5F A;  2QBY B;  4BQO A;  3MEX A;  3LWF A;  3WHC A;  2QBY A;  1ZGW A;  3F6O A;  5KAI C;  5H2F C;  3BG7 A;  4IEJ A;  2IP2 A;  3W2W A;  1ETK A;  2IJL A;  2R7T A;  2KPM A;  2P5K A;  3K4C A;  2KZV A;  3DPT A;  1IG7 A;  3ZR8 X;  3KP5 A;  2XF6 A;  3QP5 A;  4QPQ A;  4NB5 A;  5J8C A;  2PFB A;  3OYG A;  2BXZ A;  2VBY A;  4A3D J;  4IVN A;  4QSH A;  4CCN A;  1B8I A;  4G12 A;  2HQN A;  1U9O A;  3ZQH A;  2VBZ A;  5F08 A;  2XF5 A;  4S04 A;  1S8N A;  4F7Z A;  2ZJP F;  4FX0 A;  3E7L A;  1O3R A;  4OAZ A;  2IGN A;  2DU9 A;  4IO9 F;  2XAJ A;  4XN3 A;  5ILV A;  1SC7 A;  3LAP A;  2XVC A;  2R3S A;  2YX4 A;  3BJA A;  3BCA A;  3DFG A;  1BR4 A;  4YFK F;  2HVQ A;  1MND A;  3CO6 C;  3Q0W A;  3K1M A;  2BGC A;  1OCR H;  2FEZ A;  1XSV A;  3JRA A;  3AFH A;  2IGM A;  4XN0 A;  4E6K G;  4D5C A;  1XMX A;  3HOV J;  3K70 C;  3R60 A;  5BPD A;  1T6S A;  4BE2 A;  3B6C A;  2V9V A;  1YW9 A;  5FKL A;  1UFM A;  5DCM B;  1S9H A;  1KGS A;  1KQ9 A;  5GAD J;  4LIT A;  2DAO A;  2GXA A;  3IUO A;  4FE4 A;  4M3G A;  3B02 A;  3KYC B;  1HDD C;  3HYI A;  5D4R A;  1Z9C A;  2DT7 B;  2DW4 A;  3HRS A;  1B59 A;  1QHG A;  2WV0 A;  3DXJ F;  3MQ0 A;  2QM3 A;  3L2R A;  4PDK A;  4L0Y B;  1RKT A;  2DFH A;  2H1L A;  2M87 A;  2ZME A;  5ILU A;  4WWC A;  4LMY A;  1IV6 A;  3M3Y J;  3WG9 A;  2EV0 A;  1N78 A;  3O3K A;  5IY5 H;  1D1C A;  4G6Q A;  3HUG B;  3P9C A;  2XHK A;  3S8P A;  1A04 A;  3V7R A;  3MZ8 A;  3AL0 C;  3K1P A;  3IAM 2;  2HOS A;  4HLY A;  3PM1 A;  2CQX A;  2X51 A;  2MLK A;  3AG4 H;  3OYI A;  3KYL A;  3K9T A;  4M9S A;  5L3D A;  2DMT A;  4B43 A;  1X1C A;  5KHD A;  2ZFU A;  3PO3 J;  2CWE A;  2IPQ X;  1LVA A;  2PN6 A;  1XB4 A;  1UG0 A;  5JFR A;  3HHH A;  3LL7 A;  1Y6I A;  3TGN A;  1I6X A;  3LA2 A;  4A93 J;  2VOD A;  4HAM A;  2LF8 A;  4RB2 C;  3L2U A;  3HXL A;  1S7E A;  4EV0 A;  3SYT A;  4MTD A;  4WF2 A;  1MDM B;  4IRI A;  1QVU A;  1FP2 A;  3N05 A;  2A68 F;  2CFX A;  1MKM A;  1R36 A;  3J81 Z;  2R7F A;  1TQM A;  1IXR C;  2LH9 A;  4PUS A;  1D8K A;  1B6A A;  5K7F A;  3O8G A;  3D5S C;  2DXI A;  4C3H J;  2VAS A;  3C1D A;  4ZYE A;  1RRJ A;  2X9D A;  5J6X A;  5DM6 F;  4PFO A;  1ZRE A;  1BJZ A;  5C4X J;  1G3W A;  4N9I A;  4ITV A;  2PMU A;  1TWA J;  1ZG1 A;  1YJW I;  4Y7N J;  3I64 A;  2PMZ A;  1SAN A;  2XAF A;  2R7D A;  2HVR A;  2R92 J;  1HLV A;  3MMY B;  1XGO A;  3MWM A;  1JKR C;  2ISZ A;  4CYC B;  4DQ2 A;  5K5Q A;  1X4P A;  1QU3 A;  3OYF A;  3RKQ A;  4U0W A;  2KLO A;  2R0Q C;  2ECB A;  3UNG C;  3KCC A;  4UVA A;  2B0L A;  2EFQ A;  3U1D A;  3HTS B;  1AU7 A;  4LGW A;  2P8T A;  2NS7 A;  5EJC A;  1VQP I;  4UXN A;  1FYL A;  1GUU A;  2FA5 A;  2XRN A;  2ZJQ F;  3CCL I;  3ZQL A;  3KLN A;  3CMM A;  2QYO A;  2XKO A;  4G6T B;  3KP7 A;  4U0Y A;  3CJT B;  2NVY J;  1RR7 A;  5CLS A;  4CA0 A;  2M45 A;  4EEF G;  2GWR A;  1B8I B;  1MBG A;  3WTZ A;  3H3Z A;  3QYE A;  4BL0 B;  1J2X A;  2ZNY A;  5L3G A;  3S14 J;  1IRZ A;  3PL8 A;  3HPH A;  4LG0 A;  2OCC H;  2VKD A;  4IRG A;  4A6E A;  3EYY A;  4N4O B;  1ZKG A;  2QEN A;  2EIN H;  1BW5 A;  1HF0 A;  5GP9 A;  3OYK A;  5M3F J;  2WWY A;  2PX9 A;  4EJT A;  2BY3 A;  2YSR A;  4L9T A;  1R7J A;  4LLN A;  3ERM A;  1IDY A;  5EDN A;  1I5Z A;  4CGZ A;  3VB2 A;  3ABT A;  2W24 A;  5J4V A;  3SZG A;  4E7J A;  1G59 A;  1KYZ A;  1OYW A;  1K6O A;  1FT9 A;  2HEO A;  2HYG D;  2EV5 A;  3VYS B;  3CCV I;  3CCQ I;  2H6C A;  1TBX A;  3QPH A;  4WCG A;  2VON A;  1F9N A;  5EYR A;  3H36 A;  2O6G E;  4HV5 A;  4OMZ A;  1UZC A;  1XSD A;  2YPR A;  3EUK L;  3K4J A;  1XGN A;  4YFX F;  1JHH A;  5LRR A;  4P9F A;  5CVI A;  3TW6 A;  3G3Z A;  1W36 C;  3CLO A;  2R5Z B;  2DJI A;  1R1T A;  1W5S A;  3M1E A;  5F04 A;  2JK3 A;  5FRM A;  1G3Y A;  2VQG A;  1BC8 C;  4A5N A;  2K9S A;  4YIF A;  5LHI A;  3E5X A;  2Y31 A;  2QWW A;  4BBR J;  3IRQ A;  2E1M B;  4RA2 A;  3FBI B;  5HLI A;  3F0C A;  5ICG A;  1FX7 A;  3HB9 A;  2EB7 A;  2L5Q A;  4XLN F;  4A3B J;  4X1E A;  2O03 A;  1XGS A;  2UXN A;  2EFW A;  4M6X A;  1I50 J;  4HG2 A;  2ZJ2 A;  1Y0N A;  2VQL A;  4B44 A;  4Y33 A;  1G2H A;  2ME0 A;  3FIW A;  3RQI A;  4HPQ A;  4A3E J;  1LE8 A;  3PNY A;  1J5Y A;  4XON A;  2JA7 J;  3AG1 H;  3OSF A;  2O0Y A;  2JT1 A;  3W2V A;  4DGW B;  2UUZ A;  4KYW A;  4AU7 A;  4C2T A;  2UWM A;  2L9N A;  3J7Z I;  3RQ4 A;  1L3L A;  4KN4 X;  3VDX A;  2R7V A;  1SD7 A;  3HOZ J;  2NS8 A;  2DJN A;  5GAE J;  2ZKZ A;  1OLT A;  1QRY A;  3V4G A;  4P96 A;  2MH9 A;  2RV8 A;  4AID A;  1O57 A;  2OJE D;  1WJC A;  3HJE A;  4XNF A;  2HTJ A;  1JUP A;  5L3C A;  3F8B A;  3K4K A;  3OOP A;  4CXF A;  3P7N A;  1YX3 A; 
#chains in the Genus database with same CATH homology
 1MJA A;  1XN7 A;  3GYH X;  3C18 A;  3BOQ A;  2NRA C;  2X4H A;  1L0O C;  5D6F A;  1QBJ A;  5AIP A;  1USS A;  2M1B A;  1UB9 A;  3ROU A;  3NQO A;  3KEO A;  1IRG A;  3JW4 A;  1QO0 D;  5BPI A;  3ZPL A;  3TO7 A;  5HDK A;  2GA1 A;  3MFK A;  2PLY A;  3EET A;  2GAU A;  3FWE A;  2IT0 A;  2FMY A;  4MQV A;  3GFI A;  5HDG A;  3FMR A;  2JTV A;  4OIQ F;  5H6Q A;  2P6S A;  3FM5 A;  1ULY A;  5EEG A;  3ZN1 A;  2Y0M A;  3JSP A;  2F2E A;  4ZZL A;  1V3F A;  1F4K A;  4H0E A;  4IJA A;  1SFX A;  3R6S A;  1Z6R A;  2XUB A;  5BOX A;  2MC3 A;  2KKO A;  1YS7 A;  1TNS A;  5E17 F;  3TDZ C;  1Y0U A;  4RB3 C;  2DPU A;  1OR7 A;  2FBI A;  1SD5 A;  3CUQ A;  2QUF A;  2KIF A;  3M8F A;  3L9F A;  1U5T C;  1ZG3 A;  4EJU A;  5LEK A;  1X3U A;  3F23 A;  3IHU A;  1LEB A;  5IT9 K;  3VOD A;  1T38 A;  2L3D A;  3MZH A;  4EM0 B;  2K4J A;  2F5E A;  3DF8 A;  5IT9 Z;  4A12 A;  5FLX Z;  3FHZ A;  4B8X A;  4Z2Y A;  4U7B A;  1NHA A;  5HOO A;  1QZY A;  2ZXJ A;  5K5R A;  3JTG A;  3V8L A;  1RUO A;  1S6L A;  4R1H A;  3RTR A;  4Q48 A;  3P9I A;  1KYW A;  4CZZ A;  1JXS A;  1Z91 A;  2KJC A;  1U8R A;  2WTE A;  3BJO A;  3IC7 A;  4MEY F;  1S29 A;  3F6V A;  1PP7 U;  3E5U A;  3I0T A;  3BP8 A;  1HXD A;  3ZN0 A;  1Z7U A;  3QAH A;  3IRR A;  5FFX A;  2ZFW A;  3AAF A;  2KRF A;  2W25 A;  3RPQ A;  3FM3 A;  3FMQ A;  4N0B A;  1U3E M;  3E6C C;  3DP7 A;  1SAX A;  2FXA A;  2IVM A;  1H9T A;  4ZYH A;  4AIJ A;  4MTE A;  4RS8 A;  1ZH5 A;  3KE2 A;  3HOT A;  1W7P A;  5TRD A;  1BOA A;  4GYI A;  2VT3 A;  1JHF A;  1SD4 A;  3R61 A;  2Y48 A;  4KFC A;  4G7H F;  5AIQ A;  3VOE A;  2X0L A;  3CTA A;  4UVB A;  3K2Z A;  4KIC A;  1XDS A;  2ESH A;  4D0P A;  1BIB A;  5J8F A;  3WTX C;  4ESF A;  2QQB A;  2G9W A;  1BM9 A;  4MHG A;  2CO5 A;  2Z5U A;  4IXA A;  2V79 A;  3GXO A;  5HS9 A;  2Q0O A;  1MJB A;  2GQQ A;  4OU0 A;  1SMY F;  4IPA A;  1G3S A;  1XSX A;  1ONV A;  3O6B B;  4LK0 F;  3JAM K;  2VXZ A;  3MAJ A;  4A0X A;  2Z33 A;  1XCB A;  1YLF A;  3Q9V A;  3W6K B;  3C7J A;  2C6Y A;  3GLX A;  3D0S A;  4I7H A;  3IKT A;  2E7W A;  5E8G A;  1ZYR F;  3KZY A;  4AWX B;  1R5H A;  1ZAO A;  5ICE A;  4G7O F;  4G6D A;  2F5F A;  1KU2 A;  3T8R A;  2XKP A;  5DYM A;  3HRM A;  4M72 A;  1BI1 A;  1D5V A;  4A0Z A;  2HOE A;  1S3J A;  4HX4 A;  2ZCW A;  4TV7 A;  2O8X A;  2NAZ A;  1LNW A;  4KN7 X;  1YG2 A;  4L5J A;  4ASN A;  2FNA A;  2LKP A;  2PQ8 A;  2ADU A;  3C3W A;  1R23 A;  4U7D A;  1WI9 A;  1MJ9 A;  4L9N A;  3QU3 A;  1W5T A;  2LSO A;  1CGP A;  5LGN A;  3I58 A;  4GGG A;  1G3T A;  4UVC A;  1Z1D A;  3N97 A;  2L02 A;  1XMK A;  5F6F A;  1BBY A;  4Y17 A;  1T98 A;  3SFZ A;  4BHB A;  2HYF A;  4OOI A;  1XCV A;  3BRO A;  3FZV A;  3CDH A;  5K1Y A;  2PEX A;  2HWV A;  3LA7 A;  1OPC A;  2CW0 F;  3E3V A;  2CQK A;  1IW7 F;  3GUD A;  3EYI A;  3V7S A;  2XAH A;  2HZT A;  2HKO A;  3L2C A;  3K0L A;  2E7X A;  3VFZ A;  1E17 A;  2DK8 A;  1S7A A;  1WRJ A;  1O7F A;  1R58 A;  2VT2 A;  1BI0 A;  4QWQ A;  2EK5 A;  4AD9 A;  2FOK A;  1UHW A;  4BXU A;  2E1C A;  3KLO A;  1RIO H;  5L3B A;  1U78 A;  2CGP A;  1R1V A;  2ZBK A;  3BPX A;  5H6R A;  5ICC A;  1PDN C;  1TW2 A;  3FXR A;  3I5U A;  4ZH4 F;  5K5O A;  2Z3Y A;  4L0Z B;  2ESN A;  5DCF A;  3NRV A;  4M9X A;  3LQR A;  1MGT A;  5ED4 A;  4HYE A;  3SZP A;  2VC1 A;  3HRU A;  1P2F A;  1TNT A;  4RGU A;  4ON0 A;  1F5T A;  2NS0 A;  3JAM Z;  4Q5S F;  1XGM A;  1YS6 A;  2HS5 A;  4ZYD A;  2BEO A;  4R8H A;  4ZYG A;  1O3T A;  1YO5 C;  4KNY A;  2COM A;  1QQI A;  3GVA A;  3IL2 A;  1B9N A;  2OQR A;  3F8C A;  1EH8 A;  4WK8 F;  4LLG F;  3U9G A;  1B9M A;  1F1Z A;  1J7K A;  3J7A O;  1RUN A;  4IHT A;  2L01 A;  3RYP A;  4GCV A;  4OMY A;  1HW5 A;  2A07 F;  2Z99 A;  4I98 B;  4BAY A;  1B4A A;  2RQP A;  4KT5 C;  2L4A A;  4UNO A;  3ZQ7 A;  5DD8 A;  3RDI A;  2OZ6 A;  4M74 A;  4UUV A;  4BYY A;  1TW3 A;  5F64 A;  2A61 A;  4CDG A;  1KU7 A;  2DFI A;  4LD5 A;  2P6T A;  2OU2 A;  3GWZ A;  1HQC A;  3WU1 B;  3F72 A;  3ELK A;  4WXH A;  2JSC A;  2QQ9 A;  3E97 A;  5A2Q K;  3BWG A;  1O7L A;  2RDP A;  4Q47 A;  3HTU A;  2LF7 A;  1ZGJ A;  3BPV A;  3IWF A;  3K1N A;  1XMA A;  2VE8 A;  3FXU A;  3WE3 A;  2FBK A;  3V8K A;  2KIM A;  2O61 A;  4HA8 A;  4I01 A;  1ZGA A;  4UV8 A;  2XGX A;  3BY6 A;  3ZMU A;  3WGG A;  1REP C;  2CG4 A;  5LHH A;  2VOP A;  2GA2 A;  4A5M A;  1BI3 A;  4OIO F;  3KFW X;  3WTU C;  5KK1 A;  5DCM A;  2J5P A;  4KMU X;  1OMI A;  1R5G A;  4YFN F;  2K27 A;  1BIA A;  3IWZ A;  1KQ0 A;  4OIR F;  1YIO A;  4I0B A;  5E1X A;  3GW2 A;  3QPT A;  4JQF A;  4EGZ A;  4RAZ A;  4UHT A;  2XAQ A;  1YW7 A;  1IN7 A;  3R0J A;  5FB2 A;  2CSO A;  4XBF A;  1TQI A;  1D8J A;  4GXO A;  1CF7 A;  1FBU A;  3V8J A;  4EJW A;  3T8T A;  3GFL A;  2STT A;  2JZY A;  3DEU A;  2RC4 A;  1CF7 B;  5CJ9 A;  1OKR A;  2EJR A;  2OQG A;  1ZLK A;  4RAY A;  3RI4 A;  4BNC A;  1IN6 A;  3MZY A;  5LGT A;  5FLX K;  1WSU A;  1S7O A;  2VBX A;  4LLL A;  4A0Y A;  3ZMT A;  2ISY A;  2VC0 A;  4O6J A;  3IKV A;  3WU0 A;  4HQM A;  4ETS A;  1FYK A;  1WQ2 A;  4EM2 A;  4OIN F;  4JBA A;  3WGH A;  2GIV A;  2IA0 A;  2KJB A;  3R4K A;  2QLZ A;  3MCZ A;  1IZ1 A;  4A6D A;  4B09 A;  1QZZ A;  2EV6 A;  2WC2 A;  1MDM A;  1R1U A;  3JTH A;  4N9H A;  2J5O A;  2ZNZ A;  4AIK A;  2DO7 A;  1IF1 A;  3GFJ A;  1UST A;  2A6H F;  3FX3 A;  1OYY A;  4P5O A;  1P6R A;  3F22 A;  4RB1 A;  1Z05 A;  1ZHF A;  3CUQ C;  2NNY A;  5DD4 A;  4CHU A;  3I4P A;  1J9I A;  1B1B A;  2O3F A;  1KA8 A;  2BE5 F;  3TDU C;  2M5W A;  3I59 B;  3TQN A;  2QZ8 A;  5ERI A;  4EM1 A;  1VTN C;  1FP1 D;  1C0W A;  4HDV A;  1BN5 A;  4L9J A;  2NNN A;  2OBP A;  3FXQ A;  1DUX C;  2W84 A;  1QNT A;  2XIG A;  3RPU A;  3LST A;  4XSZ F;  2FQ3 A;  4BHC A;  1JGS A;  5DUI A;  5L3E A;  3ULQ B;  3BJ6 A;  1UHM A;  3O2P E;  3CO7 C;  2HR3 A;  1LB2 A;  5FO5 A;  1YYV A;  4PGH A;  1U2W A;  1IN5 A;  4LB5 A;  2EA4 A;  3TKY A;  1J0R A;  5AON A;  2A6E F;  3PQJ A;  2IA1 A;  3ZP5 A;  2PBI A;  1I1G A;  5TJJ A;  1HKT A;  5F1R A;  1EV7 A;  3RYR A;  4EQQ A;  5CYV A;  2L54 A;  2DT5 A;  1SD6 A;  2EWN A;  4HX8 A;  2DPD A;  3L00 A;  5HLH A;  1HW2 A;  1W7P D;  2UXX A;  4ESJ A;  2V6C A;  4JK1 X;  4LJZ F;  3SHF A;  2OZU A;  1XD7 A;  2P5V A;  3BZ6 A;  3HSE A;  2M8E A;  3WGI A;  2H09 A;  3VEP A;  1IXC A;  5JR3 A;  1G4D A;  1W4M A;  4MNU A;  2A69 F;  5A2Q Z;  3ERE D;  1FZP B;  1LJ9 A;  2Q8K A;  2VE9 A;  3L09 A;  1KQ8 A;  2PG4 A;  6PAX A;  5IT3 A;  4QLC U;  1FWZ A;  5LLQ A;  2DTR A;  2HKX A;  1O3Q A;  3F8F A;  5HS7 A;  2JPC A;  1HKS A;  2D45 A;  3QP6 A;  4RGX A;  2D1H A;  4LB6 B;  3P9K A;  2E1N A;  4KIG A;  3J80 Z;  4L5I A;  3RKW A;  2Y75 A;  1U6G A;  2L4M A;  4O5V A;  2EFN A;  1R00 A;  3Q9S A;  2H27 A;  3ML6 A;  3SQN A;  5HS8 A;  2Z9O A;  4KDP A;  4GO1 A;  2RNJ A;  5JVT A;  4HF0 A;  4GYG A;  5D5X B;  1TLH B;  2V1D A;  2F5D A;  2GXG A;  5BQT A;  4KUM A;  4NQW A;  3ZMS A;  2DLL A;  3RKX A;  2H94 A;  4I0A A;  1OYI A;  5BS6 A;  2BYV E;  4ZZD A;  4HLX A;  3ZMV A;  3L7W A;  3R0A A;  4HF2 A;  3E6B A;  3E6M A;  3NEU A;  2D2W A;  4CO8 A;  2DQL A;  1DPU A;  1BI2 A;  4FT8 A;  1H0M A;  5H20 A;  3I54 A;  2DK5 A;  3S2W A;  3GZ6 A;  4MQ9 F;  1J59 A;  1D3Y A;  3B73 A;  3F21 A;  1T39 A;  2HDC A;  4Y15 A;  1QGP A;  3D5L A;  2XRO A;  4I2O A;  4FX4 A;  4L9V A;  2STW A;  3RJP A;  2OA4 A;  4EJV A;  1P4W A;  1U5T B;  2FML A;  2AXL A;  3TO6 A;  2VN2 A;  3M8E A;  2LDU A;  4KA4 A;  1HST A;  1Z6T A;  2PI0 A;  2D1V A;  1H9G A;  1UCR A;  1YFH A;  3HHG A;  2EA2 A;  1EH6 A;  1HW1 A;  3F8N A;  1LQ1 A;  3K69 A;  1ZLJ A;  2NYX A;  5E20 A;  2FE3 A;  1K7A A;  1ZRF A;  5LEJ A;  3HIF A;  5DDG A;  1LEA A;  4HZF A;  3J80 K;  4K2E A;  5FFZ A;  4M73 A;  4IHS A;  4XSX F;  4ESB A;  2FF4 A;  2G7U A;  1SFU A;  2PJP A;  2AS5 F;  4RB0 A;  2OAZ A;  3GEZ A;  2EFP A;  4OIP F;  1WKM A;  3PFI A;  3COA C;  1J75 A;  3CJN A;  2XV4 S;  5CVJ A;  2W57 A;  2ZME B;  2ELH A;  1GXQ A;  3ISP A;  1GHC A;  5L3F A;  2TDX A;  4O3M A;  3QU6 A;  4PCQ A;  1HKQ A;  4UV9 A;  4G8X A;  5CVV A;  1QPM A;  3PQK A;  3WTW C;  1Q1H A;  1IAW A;  4I02 A;  5FGM A;  4NHJ A;  4P9U A;  1FY7 A;  5D8K B;  1O3S A;  3E5Q A;  4MGR A;  2XAG A;  2PMH A;  1V4R A;  5LHG A;  1FLI A;  1U5T A;  2V1X A;  5ICF A;  3LQQ A;  1EH7 A;  3N4M A;  4RGS A;  5HVQ C;  4CYD A;  2K7L A;  2K86 A;  4BH9 A;  4ENM A;  1ZRC A;  1IXS B;  3G73 A;  1P4A A;  4G9Y A;  1YQA A;  4EVI A;  3QRF F;  1YTY A;  3DV8 A;  2P5L C;  4HV6 A;  2YU3 A;  2H6B A;  4Q4Z F;  1FOK A;  3I71 A;  4MEX F;  2HGC A;  5ILS A;  4G7Z F;  2RVC A;  5LBQ A;  2IRF G;  4LG0 B;  3H3U A;  1HSJ A;  2FU4 A;  1MZB A;  4BQA A;  2MLG A;  3KZZ A;  3GO5 A;  2YX7 A;  3E6D A;  1KU9 A;  4U0V A;  1LDJ A;  1I1S A;  1IN4 A;  3M7G A;  3T1B A;  2CYY A;  3OV8 A;  5HLG A;  1FBS A;  3T0Y A;  1GVJ A;  4P55 A;  2V1U A;  1G6N A;  3RIR A;  2FNP A;  3JSO A;  5JI6 A;  1BC7 C;  1AOY A;  1ZG5 A;  5HDN A;  3U2R A;  2YR2 A;  3LA3 A;  4PZJ A;  2ACJ A;  2FRH A;  2K4B A;  2FBH A;  5DEQ A;  3DPL C;  1FSE A;  4BHP A;  2FSW A;  3TOA A;  1K78 A;  3WOD F;  3EDP A;  3KP4 A;  3W6J B;  3M9A A;  1P4X A;  4HDU A;  1K78 B;  4XLP F;  4HBL A;  3GX4 X;  3KP6 A;  1XDU A;  1IRF A;  3DKW A;  2ETH A;  2M30 A;  2UZK A;  4EJO A;  5E8I A;  2DBB A;  3F8M A;  3KEQ A;  4E70 A;  1DDN A;  3ECH A;  3TO9 A;  1W7P B;  3GFM A;  1RNL A;  1T0F A;  4HX7 A;  5E18 F;  2MD5 A;  4HF1 A;  3FMS A;  3WTS C;  3T5X A;  2VBW A;  2A3S A;  2JPB A;  2LNB A;  3SXY A;  5CVR A;  1TTY A;  2RKH A;  1K79 A;  2DI3 A;  4L18 B;  1IUY A;  4IRH A;  5D5W B;  3F3X A;  1LDK B;  2DQR A;  2P7V B;  5FD5 A;  3V7C A;  1SMT A;  3GF2 A;  1JE8 A;  2HTS A;  5EEH A;  4ENK A;  4ENJ A;  1DPR A;  4WXC A;  1ZRD A;  2G7H A;  4AVP A;  3ZMZ A;  5D6E A;  5D5V B;  1ZAR A;  4HQE A;  1FYM A;  1FBQ A;  4RGR A;  2QQA A;  1FNN A;  2MH2 A;  3ABU A;  4WX9 A;  2KIU A;  2MBF A;  1R22 A;  3ZMD A;  1GXP A;  5DUK A;  2GZW A;  3BDD A;  2RN7 A;  3CUQ B;  3TOB A;  3I53 A;  5LGU A;  5LRS A;  4AIH A;  1FSH A;  2RGV A;  1T2K A;  1SFE A;  5E1W A;  2EFO A;  2K02 A;  1LDD A;  4YG2 F;  3WE2 A;  2P7C B;  4Y13 A;  3LAJ A;  4KIF A;  2F5C A;  1ON1 A;  4HOB A;  4LFU A;  2GXB A;  4ENN A;  3LFK A;  5D5U B;  5DV5 A;  1ON2 A;  3FF5 A;  3I59 A;  4HW0 A;  4CIC A;  4G94 A;  3WTY C;  2A5Y B;  1FPQ A;  1HBX G;  3QOP A;  1BJA A;  1TQP A;  3CUO A;  4M6Y A;  1PUE E;  1E2X A;  2HFH A;  1WWX A;  1AWC A;  1DP7 P;  4LK1 F;  4EGY A;  1IN8 A;  4A2U A;  3HRT A;  5FD6 A;  2ZO4 A;  4WXD A;  1MD0 A;  5BMZ A;  3HUG A;  5E1Z B;  4KMF A;  1FC3 A;  3KP2 A;  5CVU A;  5JHU A;  2BV6 A;  2JRT A;  3SZT A;  4PGG A;  2HQR A;  4U88 A;  5KVR A;  1RZ4 A;  1ZN2 A;  4KIB A;  4FHT A;  2MA3 A;  2BBY A;  3EUH A;  1PP8 F;  4YII A;  4M9Z A;  3ECO A;  4XRF A;  4R79 A;  3KP3 A;  4I09 A;  2IA2 A;  1RI7 A;  2P4W A;  2Q2E A;  4M71 A;  3RKY A;  4S05 A;  3H92 A;  3WTT C;  2OD5 A;  4DNC A;  3J81 K;  5D4S A;  5D8L B;  2W85 A;  3REO A;  2XAS A;  3EQL F;  1I27 A;  1KU3 A;  3HOS A;  2QVO A;  3HSR A;  1STZ A;  2IW5 A;  3KET A;  3GZ5 A;  3HSF A;  1P92 A;  3WTV C;  1YW8 A;  1ODD A;  3DQV C;  4EMS A;  2VOO A;  4IF4 A;  3Q5F A;  2QBY B;  3MEX A;  3LWF A;  2QBY A;  3F6O A;  2IP2 A;  2IJL A;  2P5K A;  3DPT A;  3KP5 A;  3QP5 A;  4NB5 A;  5J8C A;  2PFB A;  2VBY A;  4IVN A;  2HQN A;  2VBZ A;  4S04 A;  1S8N A;  4F7Z A;  4FX0 A;  1O3R A;  2DU9 A;  2XAJ A;  5ILV A;  3LAP A;  2XVC A;  2R3S A;  2YX4 A;  3BJA A;  3DFG A;  4YFK F;  3CO6 C;  3K1M A;  2BGC A;  2FEZ A;  1XSV A;  3R60 A;  5BPD A;  1T6S A;  2V9V A;  1YW9 A;  1UFM A;  5DCM B;  1KQ9 A;  1KGS A;  2DAO A;  3B02 A;  3HYI A;  5D4R A;  1Z9C A;  2DW4 A;  3HRS A;  1B59 A;  2WV0 A;  3DXJ F;  3MQ0 A;  2QM3 A;  4PDK A;  4L0Y B;  2M87 A;  2ZME A;  5ILU A;  4WWC A;  4LMY A;  3WG9 A;  2EV0 A;  3O3K A;  4G6Q A;  3P9C A;  2XHK A;  1A04 A;  3V7R A;  3K1P A;  4HLY A;  2MLK A;  3K9T A;  4M9S A;  5L3D A;  2CWE A;  2IPQ X;  1LVA A;  2PN6 A;  1XB4 A;  5JFR A;  3HHH A;  3TGN A;  1I6X A;  3LA2 A;  2VOD A;  4HAM A;  2LF8 A;  4RB2 C;  4EV0 A;  4MTD A;  4WF2 A;  1MDM B;  4IRI A;  1FP2 A;  2CFX A;  2A68 F;  1MKM A;  1R36 A;  3J81 Z;  2R7F A;  1TQM A;  1IXR C;  1D8K A;  1B6A A;  3C1D A;  4ZYE A;  5J6X A;  1ZRE A;  1G3W A;  4N9I A;  2PMU A;  1ZG1 A;  3I64 A;  2XAF A;  2R7D A;  1XGO A;  3MWM A;  2ISZ A;  4DQ2 A;  5K5Q A;  4U0W A;  3KCC A;  4UVA A;  2B0L A;  2EFQ A;  3U1D A;  3HTS B;  4LGW A;  2P8T A;  4UXN A;  1FYL A;  2FA5 A;  2XRN A;  3KLN A;  2QYO A;  2XKO A;  3KP7 A;  4U0Y A;  5CLS A;  2M45 A;  2GWR A;  3WTZ A;  3H3Z A;  1J2X A;  2ZNY A;  5L3G A;  4LG0 A;  4IRG A;  4A6E A;  3EYY A;  2QEN A;  2WWY A;  4EJT A;  2YSR A;  4L9T A;  1R7J A;  4LLN A;  1I5Z A;  4CGZ A;  3VB2 A;  3ABT A;  2W24 A;  1KYZ A;  1OYW A;  1K6O A;  1FT9 A;  2HEO A;  2HYG D;  2EV5 A;  2H6C A;  1TBX A;  3QPH A;  4WCG A;  2VON A;  1F9N A;  2O6G E;  4HV5 A;  4OMZ A;  1XSD A;  2YPR A;  1XGN A;  4YFX F;  1JHH A;  5LRR A;  4P9F A;  5CVI A;  3G3Z A;  3CLO A;  1R1T A;  1W5S A;  3M1E A;  1G3Y A;  1BC8 C;  4A5N A;  4YIF A;  5LHI A;  3E5X A;  2QWW A;  3IRQ A;  5HLI A;  5ICG A;  1FX7 A;  2EB7 A;  4XLN F;  2O03 A;  1XGS A;  2UXN A;  2EFW A;  4M6X A;  2ZJ2 A;  1J5Y A;  2O0Y A;  2JT1 A;  4KYW A;  2UWM A;  1L3L A;  4KN4 X;  1SD7 A;  2ZKZ A;  3V4G A;  4P96 A;  2MH9 A;  2RV8 A;  1O57 A;  5L3C A;  2HTJ A;  3F8B A;  3OOP A;  4CXF A;  3P7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...