4KMFA

Crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
b'SAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-inducible and double-stranded-dependent eIF-2kina
publication title Distinct Z-DNA binding mode of a PKR-like protein kinase containing a Z-DNA binding domain (PKZ).
pubmed doi rcsb
source organism Carassius auratus
molecule tags Transferase/dna
total genus 21
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kmfA00
2YX7A 3SFZA 1XSDA 4XRFA 2F5DA 1S6LA 5K5RA 1QPMA 1P2FA 2FNAA 3LAJA 2VBWA 3HTUA 2A6HF 1ZAOA 1O57A 1FSHA 2P7CB 3O3KA 3CTAA 4OU0A 1R58A 4RB1A 5TRDA 2LF8A 4UUVA 2CFXA 3MAJA 1G3WA 1FYLA 1G3TA 1K6OA 2W24A 3GUDA 1YG2A 1KQ9A 3Q9SA 1AWCA 3RDIA 2EFNA 1YIOA 5J8FA 2RN7A 4OIQF 1DUXC 2KJCA 4HF1A 2MD5A 4ENKA 1O3TA 4M9ZA 1SMYF 3T1BA 1MJ9A 4P96A 5DV5A 2LKPA 2DPDA 5ILUA 2MC3A 2MLGA 4OIPF 5L3EA 2QM3A 4Q47A 1ZGJA 4HYEA 2ZFWA 1ZGAA 4M6YA 4A5NA 5ILVA 4TV7A 4RAZA 2PFBA 4O5VA 4L5IA 2ETHA 1IN8A 1BI0A 4P9FA 1F5TA 2AS5F 3KP7A 2KRFA 2BYVE 1IF1A 2RNJA 3KP6A 1XGSA 4HQEA 2DI3A 1ZREA 2H09A 2X0LA 1HKTA 4YIIA 1R23A 2JPCA 2KKOA 4EM1A 3J7AO 1JHHA 5H6RA 2YX4A 5LHGA 3NQOA 3FHZA 3M8EA 3K69A 3GVAA 1LNWA 3N4MA 1YFHA 1WSUA 1I6XA 3CO6C 4Y15A 2RGVA 1E2XA 1UFMA 4M74A 5CLSA 3RPQA 3E6CC 1EH6A 4EJUA 4UXNA 1BN5A 4HA8A 1FP1D 2IA2A 2VN2A 2FXAA 1A04A 4HOBA 5DD8A 3VODA 1BJAA 5JI6A 5E1XA 4IRGA 2A3SA 1J2XA 4BNCA 1BI2A 2P8TA 4EMSA 2A61A 5E8GA 1YW7A 1V3FA 1SD5A 4GCVA 3HOTA 1HQCA 4HV5A 3HTSB 3LQQA 1FZPB 5FFXA 5CVIA 5DEQA 1IXSB 4I09A 2HTSA 4DQ2A 2MH2A 3F6VA 2IA1A 4KN4X 2VBZA 4G6QA 3L09A 4ZYEA 3F3XA 1HW5A 5HS9A 2DLLA 4Z2YA 1XB4A 3BROA 4UVAA 4MTEA 2L3DA 2E1NA 4BHBA 2KJBA 1QZYA 4IRHA 4QWQA 3OOPA 3TQNA 1H9GA 1IRGA 2HKOA 1WQ2A 2LF7A 3D0SA 3KETA 5FLXZ 5F6FA 1CF7A 2DU9A 1F1ZA 3I58A 4LMYA 2M5WA 1IN4A 3M1EA 1B9NA 2GA2A 1ZH5A 3SQNA 3GXOA 3QAHA 5BPDA 1GXQA 1YS7A 1XMAA 2EWNA 4L9JA 3V7SA 2R3SA 3CO7C 3HSRA 2O0YA 1TW2A 3DF8A 1XCVA 3NRVA 1FBQA 1TQMA 2CYYA 4HZFA 2MA3A 1I1SA 3JW4A 1QBJA 2EFWA 1SFXA 5HVQC 3CLOA 4I2OA 4HX7A 3HIFA 3GLXA 3R61A 3V8LA 3OV8A 5FB2A 4LLNA 5LGTA 3ZMVA 3JAMK 5IT9Z 1TNSA 1HBXG 3DKWA 3WTZA 2VODA 3ISPA 5CVRA 3GZ5A 2EFPA 2P6TA 2FBKA 1K7AA 4MEXF 4NB5A 4OIRF 3ZP5A 3ZN0A 5K1YA 3RYRA 4LG0B 4P55A 4MEYF 2EK5A 2HEOA 1CGPA 4M73A 1TNTA 1TBXA 1YTYA 1KU7A 1FYKA 2Z5UA 1RIOH 2E1CA 1HXDA 4O6JA 4G7HF 4XSZF 1FX7A 5AONA 2HYFA 1Y0UA 1R00A 2UZKA 1FPQA 3KZZA 2P5KA 3K9TA 2XASA 2K27A 1KU3A 1J0RA 2M30A 4EGZA 2OZUA 4UV9A 3I59A 4IVNA 2HQNA 2K4JA 3O6BB 2DT5A 3LSTA 4EJOA 2VONA 2EFOA 1XSVA 2EA2A 3G3ZA 5J6XA 3NEUA 2O61A 1J5YA 3AAFA 3KP4A 4FX4A 5D8KB 1LVAA 1REPC 3WG9A 3E3VA 2FMYA 4L9NA 5TJJA 4G8XA 2HZTA 4F7ZA 1Q1HA 3BZ6A 5HLGA 2CW0F 1LEAA 5LHHA 1DPRA 2D1HA 3E97A 1MZBA 2FMLA 3PFIA 4RB0A 3RIRA 3T5XA 4EJVA 4S05A 2M87A 2ZJ2A 3ML6A 1W7PB 3LA3A 2LSOA 4MGRA 3HRTA 3K1PA 1QO0D 5BQTA 2STTA 2BGCA 1I27A 3GW2A 2COMA 4S04A 4A2UA 5E1WA 3V4GA 4CO8A 4HBLA 1T39A 1W5SA 5FGMA 3EUHA 2BV6A 5HLIA 1G3YA 1MDMA 1XMKA 5DUKA 2PLYA 1ODDA 5LHIA 3TDZC 2HOEA 3BJAA 1KQ0A 1W7PD 2Q2EA 4LGWA 2IPQX 4EV0A 4OMZA 1LDDA 1T98A 2GXGA 3GFIA 5CVUA 2EB7A 4B8XA 4N9IA 3CUQB 4ASNA 3FM3A 4EQQA 3MFKA 4KFCA 2EV6A 2QLZA 4KMFA 3F21A 3F8BA 2G7HA 3W6KB 2RKHA 1ZHFA 3G73A 3SZPA 3T8TA 5DYMA 2K86A 1JHFA 1PP8F 5F64A 2ZNZA 4WF2A 2Z9OA 5J8CA 4M9XA 1SD6A 3TKYA 5LRRA 1HKSA 1WI9A 3JSPA 2XKOA 3WE2A 2IT0A 2WV0A 5CVVA 3ECOA 4Q5SF 2XAGA 2KIUA 2XAHA 3GFLA 1B1BA 3BDDA 5LGUA 2QBYA 3O2PE 2P4WA 2IJLA 2OQRA 4A0XA 3IWFA 3V7CA 4AD9A 1BI3A 3COAC 2ISYA 4A0ZA 2QWWA 3ZMTA 4K2EA 1FWZA 2GQQA 3CUQC 1EH7A 4XBFA 1ULYA 3EQLF 3LQRA 5D6EA 2F5CA 2AXLA 3BWGA 1XGNA 1W5TA 3TO6A 4ZYDA 1YQAA 2A69F 1EH8A 2X4HA 4KIFA 1FSEA 1OR7A 3I71A 5IT9K 3MWMA 4CDGA 4U7DA 3KP2A 5L3DA 3FMRA 5E8IA 5KK1A 3WTTC 4AIHA 2GZWA 3E5QA 4A5MA 4MQ9F 3MZYA 3PQKA 3TGNA 2QBYB 4E70A 4UV8A 3WTSC 1ZLJA 2DPUA 1ZN2A 3TOBA 1YO5C 3FXRA 2QUFA 1IXCA 4LJZF 1O3RA 1RUNA 1DPUA 3IC7A 3RYPA 4G7OF 2JZYA 1KYZA 3QRFF 3R0AA 3JSOA 2XAFA 4L5JA 1F4KA 1G3SA 2DK8A 2V79A 3LAPA 5ED4A 2LDUA 3H3UA 2OBPA 4YFNF 1O3QA 4KT5C 3GFJA 2XROA 4ZZDA 1H0MA 1RI7A 4WX9A 4U88A 4Y17A 2PI0A 2NRAC 1SAXA 2FE3A 2W57A 1SD4A 3WU0A 4N0BA 1TW3A 4RGUA 1LEBA 2ZNYA 3FM5A 1TQIA 3MCZA 3ERED 2GXBA 5AIQA 1GXPA 2P5VA 4JQFA 3QU3A 4CHUA 3E6DA 2HGCA 2KIFA 4AWXB 1QNTA 2OQGA 4FX0A 1ZRFA 2QQBA 4IRIA 3WODF 3E6MA 3WTVC 4AVPA 4OMYA 3VB2A 5FFZA 2MLKA 1IZ1A 3L00A 3FZVA 2NNYA 3KFWX 2YPRA 2FBHA 2JPBA 3D5LA 2GIVA 4HF0A 2XV4S 4I0BA 4GYGA 5D5UB 5HDGA 2K7LA 5L3GA 3FX3A 3V8JA 2FNPA 4ZH4F 3HSEA 1QGPA 1OYYA 1YS6A 2XKPA 4LD5A 4B09A 3FF5A 3ZMDA 3ELKA 2ISZA 2CO5A 1R1TA 1FYMA 1ZG1A 3BOQA 5HS7A 4XSXF 4N9HA 3HRMA 1XGOA 2L4AA 4L0ZB 3DPTA 5BPIA 5AIPA 1LDJA 4IPAA 2V1DA 1BOAA 2H94A 2OA4A 5ICEA 3HRUA 2R7FA 4RGSA 4LG0A 1P6RA 2IVMA 1FBSA 1QZZA 3HHGA 2CGPA 5BMZA 2BEOA 1ZG5A 4D0PA 4L9VA 1RNLA 4Q4ZF 3M7GA 6PAXA 3RKWA 5D5WB 5DD4A 2H6CA 1Z7UA 3ZQ7A 4UVCA 2STWA 1BM9A 4BH9A 3L9FA 3DEUA 1RUOA 3HUGA 3CJNA 1MKMA 4KMUX 3T0YA 3QP5A 1K78B 2QQ9A 2JTVA 3RI4A 3L7WA 5ICFA 3QPHA 4XLPF 1NHAA 1XD7A 2OZ6A 3QP6A 4KNYA 3F6OA 3IRQA 5LGNA 1LQ1A 3VFZA 2OU2A 4GXOA 4HLYA 1WWXA 2F5EA 3F22A 3U2RA 4LB6B 1FBUA 1P4XA 2OD5A 5BOXA 3ULQB 2V1XA 2P7VB 4I98B 4ENMA 3DQVC 4ESJA 4A6EA 3F72A 2DW4A 1FNNA 2XHKA 3ABUA 4WWCA 3CDHA 3VOEA 4IHSA 3HYIA 3LA7A 1KA8A 2DK5A 1ZYRF 2NYXA 2JT1A 5DCMB 1STZA 1W7PA 5CYVA 1DDNA 5F1RA 1OYIA 1YLFA 4LFUA 1BBYA 2PQ8A 3ZMSA 5ICGA 2VOOA 4CYDA 4ESFA 5L3BA 4BAYA 2PG4A 1G4DA 4KUMA 4HDVA 2CWEA 2LNBA 4L0YB 1U5TB 4U0YA 2ZMEB 3GYHX 1S7AA 3MEXA 1TLHB 3WGGA 1GHCA 2RDPA 2L4MA 4I02A 3JTGA 3KLOA 3TDUC 1U3EM 1IN6A 2DAOA 1PP7U 5CVJA 2M1BA 3CUQA 3IL2A 1I5ZA 4A12A 3MZHA 4MHGA 1XDUA 3EYIA 1OYWA 1IXRC 1FP2A 5LEJA 1XN7A 2PMHA 1R7JA 2A68F 1G6NA 3ZMZA 3P9IA 4OIOF 3TOAA 3I64A 2IW5A 4L9TA 1BIAA 5IT3A 3R4KA 2FU4A 3HOSA 4Y13A 3IRRA 3BY6A 4UNOA 2MBFA 2H6BA 5JVTA 1V4RA 4M9SA 2Q8KA 3TO9A 4ETSA 2KIMA 2PBIA 1R1UA 4LB5A 4AIKA 3K0LA 4MQVA 3GFMA 4CXFA 5L3FA 1U5TC 4G6DA 4LK1F 5LLQA 4KYWA 1XGMA 1Z6TA 1HKQA 5LBQA 2ELHA 1IRFA 1P4AA 3KE2A 4I7HA 4R8HA 4IXAA 3W6JB 4RS8A 2DFIA 2O8XA 3KLNA 3J81Z 2DBBA 1FOKA 1FT9A 2W85A 1IW7F 5E18F 3GEZA 1ZARA 2FOKA 1C0WA 2TDXA 4U0VA 3E6BA 5A2QZ 2J5PA 1H9TA 1KYWA 3IKTA 1U2WA 4P5OA 5LRSA 2ESNA 1MD0A 3WE3A 2QQAA 5FD5A 1D8KA 3DP7A 4LK0F 3EDPA 2DQLA 3IHUA 2FBIA 3EETA 2A5YB 3P7NA 2F2EA 2FRHA 3LWFA 4HDUA 1BC7C 2HR3A 3C18A 1FLIA 3WTWC 1R22A 2UWMA 2CSOA 3RKXA 1R5GA 2DQRA 2BBYA 4OINF 1AOYA 3FXQA 4HW0A 2JSCA 1D3YA 1MJBA 2L01A 4I01A 2IP2A 1J7KA 1VTNC 3K2ZA 2RV8A 1F9NA 5ERIA 3Q9VA 4FT8A 1R36A 3IKVA 4WCGA 1L0OC 1I1GA 4RB3C 4HLXA 4ZZLA 2ADUA 2P5LC 1Z1DA 4IJAA 3KP3A 2G7UA 4BXUA 4LLGF 2WTEA 2RQPA 2G9WA 4WK8F 1W4MA 4CICA 3F8FA 2WC2A 2J5OA 1UHMA 2VXZA 3FXUA 2QYOA 5BS6A 3U1DA 1OMIA 2L54A 2PN6A 4KIBA 3R0JA 1BC8C 4MTDA 3LFKA 4NHJA 2E7XA 4PZJA 4ENNA 1LDKB 4M71A 5DCFA 2IA0A 4CZZA 4WXDA 4KDPA 2FF4A 3FMSA 4KN7X 1T38A 1UB9A 2DTRA 3SXYA 5E20A 4ZYHA 3EYYA 3ZMUA 3ROUA 3E5XA 4OOIA 5FD6A 2EV0A 2Y75A 2V6CA 2D1VA 3B02A 2HWVA 2VC0A 3P9KA 4HX4A 2UXXA 1P4WA 2L02A 4QLCU 2R7DA 3WTYC 4YFXF 1BI1A 4HAMA 1B59A 1K79A 2FEZA 4BYYA 3V7RA 5K5QA 1USSA 2EA4A 3DV8A 3SZTA 1L3LA 5DUIA 2HYGD 4GO1A 1BIBA 4LLLA 5D4SA 1SFEA 1XDSA 1S7OA 3DPLC 2C6YA 1X3UA 2HQRA 1IN5A 4ESBA 3J80K 4YIFA 3N97A 3H3ZA 3CUOA 2P6SA 1WKMA 5E1ZB 3S2WA 1U8RA 4FHTA 2VE9A 3P9CA 1B9MA 4NQWA 2CG4A 2VBXA 3C3WA 1MGTA 4MNUA 3F8NA 3M9AA 1Z05A 1R5HA 3T8RA 3QU6A 2ZKZA 4A0YA 3I0TA 1K78A 3KZYA 4L18B 2RC4A 5HS8A 3JTHA 4M72A 3HSFA 1SD7A 2Z99A 5ILSA 4HX8A 4JBAA 4GYIA 3WGIA 4EJTA 4CGZA 2HTJA 1UHWA 2UXNA 1XSXA 5D8LB 2XAJA 2CQKA 1PDNC 5ICCA 4BHCA 3RTRA 2OAZA 3HRSA 2FSWA 2V9VA 5D5VB 3J81K 4G7ZF 1U78A 4HF2A 3C7JA 2ESHA 5HDKA 2HS5A 2Q0OA 4EM2A 2ZO4A 4KICA 5DCMA 1E17A 1YW9A 5A2QK 2QZ8A 2FA5A 3K1MA 3GX4X 1QQIA 4AIJA 3BP8A 1GVJA 2ZCWA 4BQAA 1P92A 5K5OA 4PGGA 2BE5F 3BPXA 3RKYA 4ON0A 2XRNA 3SHFA 3QOPA 4HV6A 2QENA 1JE8A 1U5TA 2NS0A 2ZMEA 3H92A 3I5UA 3BJ6A 5DDGA 3KEOA 5HOOA 3BJOA 5KVRA 3E5UA 4Q48A 3RJPA 3VEPA 4U7BA 1CF7B 2D2WA 1SMTA 4EJWA 1B4AA 5D6FA 2WWYA 3FMQA 3V8KA 4PDKA 4RB2C 2A07F 3KEQA 3K1NA 2Y48A 1WRJA 4O3MA 1Z9CA 2V1UA 4WXHA 4PCQA 1J59A 4YFKF 2NAZA 2MH9A 5D4RA 2E7WA 1ZLKA 3WGHA 1ONVA 2W84A 4RGRA 1T2KA 1B6AA 5FO5A 3REOA 1D8JA 3GZ6A 4KIGA 4YG2F 5EEGA 2DO7A 1S3JA 2IRFG 2YR2A 1XCBA 4PGHA 1ZRDA 2RVCA 2GA1A 4R79A 1LB2A 3GO5A 4BHPA 3HHHA 1HW2A 2HDCA 2PJPA 1TTYA 5JFRA 3GF2A 2FQ3A 4ZYGA 2HKXA 2JRTA 1R1VA 1ON1A 1D5VA 3RPUA 1J9IA 3B73A 1S29A 2O03A 3LA2A 2ZXJA 1OPCA 2K4BA 2O6GE 5H20A 1MJAA 4EM0B 1O7FA 1LJ9A 1KU2A 4H0EA 3DXJF 5HLHA 4EGYA 3C1DA 4UVBA 3Q5FA 1T6SA 3J80Z 2O3FA 3R60A 1T0FA 2VT3A 2D45A 2ACJA 4A6DA 5HDNA 2HFHA 3I54A 2XUBA 3WU1B 3QPTA 1Z6RA 4RGXA 2M45A 1KU9A 2W25A 3I59B 1KQ8A 2A6EF 3L2CA 2YSRA 1SFUA 4XLNF 3I53A 1ZG3A 1O3SA 2PMUA 4JK1X 4WXCA 3IWZA 4HQMA 2GAUA 4G9YA 1HSTA 3R6SA 1HW1A 2VT2A 2EV5A 4GGGA 1OKRA 4I0AA 2PEXA 2F5FA 2Y0MA 3ECHA 5JHUA 5LEKA 1J75A 1O7LA 2H27A 3F8MA 2QVOA 2NNNA 3F23A 3KP5A 1EV7A 3BPVA 3PQJA 2B0LA 3ZPLA 2XVCA 4G94A 2ZBKA 2Z3YA 4P9UA 1ZRCA 3DFGA 1USTA 1DP7P 3F8CA 1IN7A 5H6QA 1FC3A 2K02A 3ZN1A 3WTXC 3M8FA 4U0WA 3U9GA 2VOPA 4KA4A 4IHTA 1YYVA 3I4PA 1ON2A 1HSJA 4DNCA 1FY7A 5D5XB 4RAYA 4EVIA 1S8NA 1PUEE 3TO7A 2VBYA 5CJ9A 1KGSA 1IAWA 2GWRA 1UCRA 2YU3A 3FWEA 3MQ0A 1YW8A 4R1HA 2VE8A 2XIGA 1IUYA 4ENJA 2M8EA 5JR3A 1MDMB 3GWZA 5EEHA 1TQPA 3JAMZ 1U6GA 1JGSA 2VC1A 4M6XA 5L3CA 2XGXA 5E17F 3WTUC 2Z33A 5FLXK 2EJRA 3ABTA 3KCCA 1JXSA 1RZ4A 4UHTA 1Z91A 2EFQA 2XAQA 4IF4A
chains in the Genus database with same CATH superfamily
2JA2A 2YX7A 5F08A 2GOMA 3SFZA 1XSDA 2H8RA 4XRFA 2F5DA 1S6LA 5K5RA 3BLYA 1QPMA 2R7ZJ 2LH9A 1P2FA 1Y6IA 2FNAA 3LAJA 2VBWA 3HTUA 2VKHA 4E7LA 1ZAOA 2A6HF 1O57A 2DA5A 4C2MJ 3FBNB 3O3KA 3OIPA 2P7CB 1FSHA 3CTAA 4OU0A 1T0FC 5C4JJ 2HU9A 1OCOH 1R58A 4RB1A 1WZ2A 1ZK8A 3CLQA 5TRDA 2HZDA 3H9JA 1IDZA 3HPHA 2K5CA 2LF8A 3AG2H 2LMDA 1ETVA 2CFXA 4UUVA 3MAJA 1G3WA 3GTKJ 3I56I 2R7OA 1SEUA 3FDYA 5KAIC 1IUFA 1FYLA 1G3TA 1K6OA 2W24A 4XONA 1MMSA 3GUDA 1YG2A 1KQ9A 3Q9SA 1AWCA 3RDIA 2V6EA 3BTIA 2EFNA 1YIOA 2CV1A 5J8FA 1R71A 2RN7A 4OIQF 1DUXC 2KJCA 4HF1A 3DLAA 2GM4A 2R5ZB 2MD5A 4ENKA 3QOEA 1O3TA 4M9ZA 5FKNA 1SMYF 3SYTA 3T1BA 4QPQA 1LPQA 2VJJA 5M5WJ 1MJ9A 4F3QA 4P96A 1KONA 1X1PA 3DKXA 5DV5A 2LKPA 5E3LA 5FRMA 1LVKA 4ZYAA 1WJCA 2DPDA 2Y69H 4JYKA 1MNMC 2TRTA 5ILUA 2MC3A 2MLGA 3HOZJ 2COBA 4OIPF 5L3EA 2EZKA 4CYCB 2XSDC 2W7NA 2B9SA 1MSEC 2QM3A 4Q47A 1ZGJA 4HYEA 1OCTC 4LIVA 4RLQA 1UMQA 2ZFWA 2MABA 1ZGAA 2IGKA 1MBJA 4M6YA 4A5NA 5ILVA 3GTPJ 4TV7A 4RAZA 2FOWA 3A03A 2PFBA 4O5VA 3GTQJ 4L5IA 4XL9A 1MBGA 5EYRA 3ZRGA 2ETHA 2GBYA 3JCUC 4CCNA 2DTZA 1IN8A 1BI0A 1TWGJ 1UZCA 1XX5A 3DBRB 4P9FA 1F5TA 2AS5F 1X1BA 2XF5A 3KP7A 1EJ9A 2KRFA 2ZFUA 3HDDA 2BYVE 1IF1A 4U87A 4ZTFA 2RNJA 3KP6A 2DMQA 4Y3OA 1XGSA 4HQEA 2DI3A 1ZREA 2H09A 4G6TB 4BU2A 3JRAA 1YX3A 3S3MA 3AFHA 2E1MB 4PSXA 4I6ZA 2WAQN 5TISC 2X0LA 2JMWA 1HKTA 5J1RA 3PIPF 3G4SI 4YIIA 5B3SH 3J7AY 1R23A 2JPCA 2M7BA 4BKXA 2KKOA 4EM1A 3J7AO 3SDBA 2DYSH 4PFPA 1JHHA 3QYFA 5H6RA 1K4TA 1I50J 2YX4A 5LHGA 3NQOA 3FHZA 3M8EA 3K69A 2RNGA 3GVAA 1GUUA 1LNWA 1TT5B 3N4MA 1I6XA 2BY0A 1YFHA 3CO6C 1WSUA 1UG2A 1A35A 4Y15A 2RGVA 3HG9A 1E2XA 3VYUB 3LSJA 4ZJZA 1UFMA 2XRLA 4M74A 1O4XA 2G0EA 3PO3J 4DGWB 5CLSA 2LRDA 4YEJA 3RPQA 2KZVA 4IZZA 3S3OA 2HOTA 3FXOA 2GXAA 2ME6A 1V54H 4QPOA 1LE8A 3E6CC 3JRFA 1X4OA 1EH6A 4LIUA 4EJUA 4AM3A 4UXNA 1BN5A 2LOOA 2O7OA 2WY7Q 3HKZN 4HA8A 2LY9A 1FP1D 2IA2A 4HNTA 2VN2A 1T8IA 2FXAA 2VJ5A 5FKOA 3OYMA 1A04A 2XPWA 4XM3A 2CUEA 3OYCA 4HOBA 5DD8A 2IGOA 3PSFA 3VODA 1BJAA 3H9QA 5JI6A 5E1XA 3I4NJ 3ZXSA 3K4JA 4IRGA 1R6RA 4YRVA 2A3SA 1J2XA 4BNCA 4W1UA 1BI2A 2ZJRF 1VQ7I 4KJZA 2P8TA 2F4MB 2EZLA 2A61A 4EMSA 5E8GA 1Q1VA 2FQ4A 1YW7A 1HDDC 3JR9A 1V3FA 1SD5A 1GT0C 1JKOC 4GCVA 3HOTA 1HQCA 4HV5A 1DU0A 5GAGJ 3HTSB 3LQQA 2Y0SN 3UNGC 1FZPB 3A02A 4DJAA 1QVTA 5FFXA 5EF6A 5CVIA 2E1MC 1IXSB 3K6GA 5DEQA 3VSKA 2ZXIA 4I09A 1A6QA 4Z6YA 3ZR8X 2HTSA 3CMMA 2MH2A 3DEEA 3ZQFA 4DQ2A 3F6VA 2IA1A 1IRXA 4KN4X 3HOXJ 2VBZA 4G6QA 3ABKH 4CA0A 1WH5A 1PJRA 3L09A 4ZYEA 1VQ8I 3F3XA 1HW5A 5HS9A 1TZLA 4GFBA 2DLLA 4Z2YA 4ABZA 1JUSA 5KCMA 1XB4A 3BROA 4UVAA 2ICWG 4MTEA 2L3DA 2VKVA 1Y1WJ 3Q0UA 1VQ4I 1AKHA 2E1NA 4BHBA 1TWFJ 2KJBA 4V2FA 1QZYA 4IRHA 2NVXJ 2I5UA 3JRGA 4QWQA 3OOPA 2XB0X 3TQNA 1V55H 1H9GA 2QSFX 5HNHA 1JGGA 2E2HJ 1IRGA 2HKOA 1WQ2A 2LF7A 1JKRC 1G2HA 2UUZA 3D0SA 3KETA 5FLXZ 2JA7J 5F6FA 2QQ8A 2CQ7A 4HSTA 2OF7A 1CF7A 2M34A 2DU9A 1F1ZA 3DPUA 3IAM2 3RCOA 3I58A 1ZR4A 4LMYA 2M5WA 1IN4A 4BBSJ 1R4NB 3M1EA 1B9NA 3CCVI 2GA2A 3JRHA 1ZH5A 4UUTA 3SQNA 4RA2A 3GXOA 3QAHA 5BPDA 1AA7A 1GXQA 1YS7A 1XMAA 2EWNA 3OR1C 4L9JA 1YRNB 1QRYA 3V7SA 4DYQA 2R3SA 3CO7C 9ANTA 3HSRA 3X2QH 2O0YA 1TW2A 1SFOJ 1N78A 2DCEA 2X6WA 3DF8A 1WH7A 1XCVA 3KYDB 3LSPA 1X4PA 3NRVA 4KITB 1FBQA 1TQMA 2CYYA 2Z2SB 4HZFA 3L2UA 3W3CA 2MA3A 1I1SA 3JW4A 1ZKGA 4D5CA 2EFWA 1QBJA 1SFXA 3CC7I 2IS1A 3OMYA 5HVQC 3CLOA 4I2OA 2DMPA 4HX7A 3HIFA 3BR6A 2WA0A 2DOEA 1VNDA 3Q3SA 3GLXA 3R61A 3V8LA 4UUSB 4D7MA 2X1EA 1WGXA 3OV8A 2AHQA 5FB2A 4LLNA 5GAEJ 4UB8C 4ANJA 5LGTA 1BW5A 3ZMVA 1ORKA 2ID3A 3JAMK 5IT9Z 1TNSA 1HBXG 3CCLI 3DKWA 1D0YA 3TP3A 4NDLA 3WTZA 2VODA 3ISPA 2VIXA 5CVRA 3GZ5A 2EFPA 3H5NA 4C3JJ 2P6TA 1S72I 2DT6A 2FBKA 2V9PA 1K7AA 2W00A 1Y8RB 4MEXF 2LG4A 5E3NA 2X1CA 4NB5A 5LD2C 5FRNA 4OIRF 3BR1A 1RKTA 3ZP5A 3ZN0A 5K1YA 2EZIA 2E60A 4AVZA 2KRCA 3S1QJ 3RYRA 4LG0B 4P55A 3I9V2 1ETKA 4DZJA 1FOYA 4MEYF 1U9OA 2EK5A 2HEOA 1CGPA 4M73A 1TNTA 3VWBA 1JJ6C 1TBXA 1YTYA 4XR6A 1ITYA 1KU7A 2L7ZA 1FYKA 1FTZA 2Z5UA 1RIOH 2E1CA 1HXDA 4A3IJ 2JA8J 4O6JA 4G7HF 4XSZF 1FX7A 4XN3A 5AONA 2HYFA 1Y0UA 1R00A 3BTJA 2UZKA 1FPQA 3KZZA 2P5KA 1VQOI 1X58A 2DA1A 1AHDP 3K9TA 2XASA 2K27A 1KU3A 3HBLA 4B3AA 2EBIA 5IYCJ 1FJLA 1F43A 1J0RA 1D1BA 1Y0NA 2M30A 3S2DJ 4EGZA 5EEAA 2MD0A 1GV2A 2ID6A 2OZUA 4UV9A 3BR3A 3I59A 4FQGA 4IVNA 2HOSA 2HQNA 2K4JA 2V4JC 3O6BB 4HNVA 1M1EB 2DT5A 2L7MP 1VQKI 4IEJA 3DTKA 3LSTA 2R92J 4EJOA 1YJ9I 5J1YA 4RLFA 4BJTA 2VONA 1KZHA 3J7ZI 3HZJA 2EFOA 3K10A 1XSVA 2EA2A 3G3ZA 3IUOA 2HXIA 2VKDA 2X1DA 5J6XA 3NEUA 2O61A 1J5YA 2CUJA 4MFDA 3AAFA 2R4GA 5EGOA 4A3FJ 3KP4A 4FX4A 5B66C 2BW3B 2H1LA 3M3YJ 5D8KB 3TEDA 1LVAA 4D1QA 1REPC 3WG9A 1T08B 3E3VA 3ASNH 2F6CA 2I10A 2JA5J 2FMYA 4L9NA 3GCMA 1PVEA 3BZCA 2CUZA 1RESA 3PNTA 3I3LA 4MIMA 5TJJA 4G8XA 2HZTA 3FIWA 4F7ZA 1Q1HA 3BZ6A 5HLGA 2LLKA 5J1UA 1K4SA 2CW0F 1LEAA 3U1KA 3DTIA 5LHHA 1P9QC 1DPRA 3IAS2 2D1HA 5DS9A 4J19A 3E97A 3QQAA 1MZBA 2FMLA 2DFEA 3CESA 3PFIA 3BG5A 4W97A 2CW7A 4BGDA 4RB0A 4YELA 3RIRA 4AYBA 1D1CA 4XRSG 2XPVA 1MMNA 2KISA 1YHQI 3T5XA 4EJVA 1FMWA 4F92B 4S05A 2DMNA 5C3EJ 2EH3A 2M87A 2ZJ2A 3ML6A 2R7TA 2VQHA 1A36A 2KFDA 1W7PB 3LA3A 2TCTA 2LSOA 1BW6A 4MGRA 3HRTA 4C3IJ 1FOXA 1FEXA 3HGYA 3K1PA 1QO0D 5BQTA 2STTA 1K6YA 2EIJH 5FLVA 2BGCA 4C3HJ 1I27A 3GW2A 2COMA 4S04A 1LKXA 2ECBA 2AXTC 2O5RA 5FLMJ 4A2UA 5M5YJ 1YX5A 2WB1A 5E1WA 3V4GA 4E7IA 4L5EA 4CO8A 3N05A 3D5RC 4RDUA 4HBLA 1T39A 1WJEA 2HVQA 2CFOA 3OYFA 1UJ8A 1W5SA 2EINH 5EGOB 2E36A 5FGMA 3RSNA 2QSHX 3EUHA 4XLFA 1IRZA 3DEWA 3OYEA 2BV6A 3FXMA 2E2JJ 1MH4A 5HLIA 2CQNA 4ZDLA 1G3YA 1MDMA 1J09A 1XMKA 5DUKA 2PLYA 1H89C 1ODDA 5LHIA 3OYDA 3ZOBA 3TDZC 2HOEA 3BJAA 3OS1A 1KQ0A 1W7PD 2Q2EA 4LGWA 2IPQX 4IHWA 4EV0A 2Y31A 2UV1A 1HOMA 4OMZA 1NK2P 2HOAA 1D0XA 5FKMA 1LDDA 1T98A 2GXGA 3GFIA 1SAUA 3BR0A 5B5EC 5CVUA 3MZ8A 2JK3A 2EB7A 1VZ0A 4B8XA 2GLOA 4N9IA 3CUQB 1YI2I 4ASNA 3FM3A 4EQQA 3MFKA 4KFCA 2JVGA 2EV6A 2BOLA 1UELB 2JVHA 2QLZA 4XLAA 1W0UA 2OTLI 2F4OB 3BCBA 1APLC 4KMFA 3F21A 3F8BA 2G7HA 3S15J 4CCOA 3FKJA 2RKHA 3W6KB 1ZHFA 3G73A 4IOCF 3SZPA 3M07A 2HQAA 3T8TA 2LY1A 3CDIA 5DYMA 2K86A 1JHFA 1PP8F 4RM3A 4BE2A 2DN0A 5F64A 4CUGA 2ZNZA 4WF2A 5J4VA 2MW8A 2Z9OA 3L2VA 5J8CA 4M9XA 2R7UA 1SD6A 3TKYA 5HNFA 5LRRA 1HKSA 1WI9A 3TL4X 3JSPA 3DKYA 2DA3A 2XKOA 3WE2A 2H1KA 1TP4A 1WJAA 2IT0A 2WV0A 2HVRA 2LP0A 2R5ZA 5CVVA 3ECOA 5FKKA 2V7FA 3VYSB 4Q5SF 2F4IA 2XAGA 2KIUA 2XAHA 1SC7A 3FISA 2ELKA 4CH7A 4XLEA 2ME0A 1QHGA 3GFLA 1DU6A 2QEXI 1B1BA 3BQZA 3BDDA 5LGUA 2QBYA 3O2PE 2P4WA 3DLLF 2IJLA 2OQRA 4A0XA 3LMMA 3H9GA 4A3LJ 3NWTA 3CCRI 3IWFA 3V7CA 4NNJA 4AD9A 2ZC2A 1EKEA 1BI3A 3BG9A 4NBQA 3DCFA 4ZDPA 1UAAA 1YJWI 3COAC 5B1AH 2CS3A 1U0JA 3E0JB 2Q1ZB 2ISYA 4A0ZA 1MH3A 2QWWA 3DBHB 3EUKL 3EUAA 3ZMTA 4K2EA 3GTGJ 1ERDA 1FWZA 2GQQA 3CUQC 1EH7A 4XBFA 1ULYA 3HXLA 3EQLF 3LQRA 1SFKA 5D6EA 2F5CA 2AXLA 3BWGA 1XGNA 4M3BA 1W5TA 3TO6A 4ZYDA 4A3BJ 1YQAA 4CCMA 2OTJI 2A69F 1EH8A 2X4HA 4KIFA 1FSEA 4XRMA 1OR7A 3I71A 5IT9K 3MWMA 2BXYA 4F55A 1E3OC 2Y9ZA 2OV7A 1PUFB 2CUFA 1OISA 4HG2A 4CDGA 4U7DA 3KZIC 3KP2A 5L3DA 3FMRA 2LREA 3BCAA 1B72B 2KRHA 5E8IA 4XLHA 4BS9A 5KK1A 3WTTC 3EUHC 4AIHA 1X19A 1W5CC 2GZWA 3E5QA 2E71A 4A5MA 4MQ9F 2XAUA 3MZYA 3JREA 3PQKA 3TGNA 3F9KA 2R0QC 2QBYB 4E70A 4UV8A 1NG6A 4II2A 3WTSC 4XN0A 2AO9A 1ZLJA 2DPUA 2KPMA 1ZN2A 3TOBA 1YO5C 3FXRA 2QUFA 2XC7A 1IXCA 3OSGA 4XNFA 3LOCA 4LJZF 3LL7A 1O3RA 1N77A 1RUNA 5J40A 1DPUA 2ECCA 1WI3A 3IC7A 2AQFA 2L9RA 3OYHA 2X85A 3RYPA 4G7OF 2JZYA 1KYZA 2R7SA 3QRFF 2IGNA 3R0AA 3KPHA 3SZGA 5GTHC 2XAFA 3JSOA 3S1NJ 3LSMA 2ZXWH 4A69C 1QZEA 4L5JA 1F4KA 1G3SA 4F52A 1B8IB 1JTYA 2DK8A 5IYDJ 2VUMJ 1IDYA 2V79A 3LAPA 1RR7A 4JOMA 2RREA 3ZQIA 2LDUA 5ED4A 2NVYJ 3H3UA 5FJ8J 2OBPA 4B47A 5EZHA 2P81A 4YFNF 2WAQA 1O3QA 4BE0A 1QA6A 4KT5C 1WFXA 3GFJA 2XROA 2VQLA 2YU9J 4X1EA 3CJQB 1ENHA 4ZZDA 1H0MA 1RI7A 2BHZA 4WX9A 5E3MA 2BVLA 4U88A 1MBHA 2CW8A 4Y17A 2PI0A 3OIQA 2NRAC 2FX0A 1SAXA 2DDBA 2FE3A 2W57A 3QYEA 1RPWA 3H5AA 1SD4A 3WU0A 2CV2A 4N0BA 1TW3A 3K2AA 4PK4A 4RGUA 3S93A 1LEBA 3PL8A 2ZNYA 3FM5A 4N4OB 4BDYA 1TQIA 3MCZA 5J47A 5DM6F 1WJFA 3ERED 2GXBA 5AIQA 1JKPC 2VPRA 4PJ0C 2VKEA 1GXPA 2P5VA 4JQFA 4DOZA 3QU3A 1HDPA 4CHUA 4CCLA 2OJED 3E6DA 3VYTB 2HGCA 2KIFA 1F36A 4AWXB 1QNTA 2P0WA 2OQGA 4FX0A 1YJNI 1ZRFA 2QQBA 4IRIA 3WODF 1X3WB 3E6MA 3WTVC 4IKFA 1UHSA 4A3CJ 1VF9A 2FJ1A 2DMTA 4AVPA 4OMYA 3VB2A 1MW7A 3FXKA 3A1YA 5FFZA 2MLKA 1IZ1A 2IS6A 3L00A 5KNLA 3FZVA 2K40A 4D9JA 2NNYA 2LFBA 3WU2C 3KFWX 2YPRA 2FBHA 3MKYB 3IH3A 2PJRB 2JPBA 3D5LA 3K4MA 2GIVA 2HQ5A 4IO9F 3CD6I 4Y33A 4HF0A 5CPRB 2NXNB 2DXIA 3S14J 2DA2A 1YRNA 3CCJI 2XV4S 3CCSI 1TT0A 2OCEA 2LC2A 4I0BA 4GYGA 5D5UB 5HDGA 2K7LA 3FHNA 1NG7A 3H36A 3FX3A 2NVUB 4M3EA 5L3GA 3V8JA 2FNPA 4ZH4F 4PFOA 3W2VA 2R7RA 1I3AA 3HSEA 3G2BA 3W6VA 1BA5A 1QGPA 1OYYA 1YS6A 2MFZA 2XKPA 1CQTA 4KT6A 4LD5A 4B09A 1I6HJ 1DGWY 2IGMA 3BTCA 2XF6A 2W48A 3CCMI 3FF5A 4UUSA 3H3VK 1OR7C 3ZMDA 1R49A 1MBEA 3ELKA 3BT9A 2ISZA 2CO5A 1R1TA 4E4HA 2HPMA 5EG0B 1FYMA 1ZG1A 3LSHA 3BOQA 3PM1A 4XSXF 5HS7A 2K3FA 2A05A 4N9HA 3HRMA 3HOVJ 1I3QJ 4PJNA 3QPSA 1XGOA 2L4AA 3ABMH 4L0ZB 3DPTA 4FASD 1AU7A 5BPIA 4QSHA 5F0HA 3F0CA 5AIPA 1LDJA 4IPAA 2V1DA 3CMYA 1BOAA 2H94A 3H1CA 4A3MJ 2OA4A 3A0HC 5ICEA 3HRUA 3K4LA 3KIOA 5IOYA 1XPXA 4NC6A 1SANA 2R7FA 1PYVA 4RGSA 4LG0A 4PUSA 1P6RA 2IVMA 2Y2ZA 1FBSA 1QZZA 1GLNA 3M8JA 1LFBA 2CH0A 3HHGA 2ZJPF 3GTOJ 2CGPA 4F93B 5BMZA 2ZXHA 1IJWC 1JUPA 3MVPA 5FROA 2LBFB 2BEOA 3GLLA 5JHFA 4B1RA 2ZSHB 3LSIA 1ZG5A 4D0PA 3CP2A 5HODA 2XGCA 1X2NA 3J7YJ 3TBIA 4I99C 2M3AA 4L9VA 1RNLA 4Q4ZF 3M7GA 4FETA 3HOWJ 6PAXA 3BG3A 3ZGKA 2CQQA 1JT0A 3RKWA 4NQWB 5D5WB 2KIQA 3S16J 5DD4A 4A3GJ 1YIJI 2H6CA 2OUMA 1Z7UA 3DTEA 3ZQ7A 4DIQA 1NK3P 2R7QA 4UVCA 2STWA 3BG6A 4DYCA 3ZQCA 2BZTA 5H2FC 1BM9A 2JWTA 3GZNB 4BH9A 1GV5A 3L9FA 3DEUA 4BXXJ 1RUOA 3HUGA 2FUG2 3PJRA 3CJNA 1MKMA 4KMUX 1E0EA 3T0YA 3ONQA 4IQ4A 1ETWA 3QP5A 1K78B 2QQ9A 2L2OA 2JTVA 3GTJJ 3RI4A 2LY2A 4C2TA 4RBOA 3PUFA 1ZR2A 2JQ7A 3L7WA 5ICFA 2VLAA 3QPHA 2EIKH 4XLPF 1NHAA 1XD7A 1X3ZB 2V1NA 2BW3A 2OZ6A 3QP6A 4KNYA 2GOXB 3RZOJ 1E3HA 5E3OA 1X2MA 3F6OA 3IRQA 5LGNA 1LQ1A 3VFZA 2OU2A 4GXOA 4HLYA 1WWXA 2F5EA 3F22A 3U2RA 2E5ZA 2R5YB 4LB6B 1FBUA 1P4XA 4OAYA 2OD5A 2X48A 5BOXA 3ULQB 3KYLA 1HF0A 4QIWN 2V1XA 5C44J 2P7VB 1Y56A 4I98B 4ENMA 3SFIA 3DQVC 3WHBA 4ESJA 4A6EA 3W2AA 4IL6C 4B43A 3F72A 3HOYJ 2DW4A 1FNNA 2XHKA 3ABUA 4WWCA 3AKZA 4YIRX 4XORA 1X1CA 3CDHA 1WHUA 3OS0A 3VOEA 4IHSA 3HYIA 3LA7A 1KA8A 2A5WA 2DK5A 2IAIA 1ZYRF 2NYXA 1ETYA 2DJNA 2JT1A 5DCMB 2HYJA 1STZA 1W7PA 5CYVA 1DDNA 1IO2A 2L5QA 4BACA 5F1RA 5TGTA 1OYIA 1YLFA 4LFUA 2JJ7A 1BOBA 3L2WA 3HUGB 4V2GA 3ESWB 1BBYA 2NVTJ 2PQ8A 2N8GA 2X6XA 3ZMSA 4NC7A 3DBLB 5ICGA 2VOOA 1TWHJ 2DT7B 2JUGA 1QU3A 3MMYB 4CYDA 2CU7A 4ESFA 5L3BA 2BY1A 4BAYA 5DTDA 2BY2A 2PG4A 3G1OA 3LFUA 1G4DA 4DBRA 4E7ZA 2KL4A 4XRSA 2M7AA 4KUMA 4HDVA 2CWEA 2LNBA 3S1RJ 1VFCA 4L0YB 1U5TB 4U0YA 1P7JA 2ZMEB 3GYHX 1X1DA 1S7AA 3MEXA 1TLHB 2E5NA 2OC6A 3WGGA 2O8KA 1GHCA 2RDPA 1V5FA 2NS8A 2Z1DA 4BJ6C 2B7EA 2XGDA 1K83J 4C2UA 2L4MA 1U8BA 4I02A 3JTGA 3KLOA 2DA4A 3CQZJ 3TDUC 2QGUA 1U3EM 1TL8A 1IN6A 2K3PA 2DAOA 2L7FP 1PP7U 5CVJA 5F04A 2LKSA 3H35A 2M1BA 2VXDA 3CUQA 3WG7H 3IL2A 3LSKA 2VQCA 5IYBJ 4HNUA 3PIOF 2XPUA 2BY3A 1I5ZA 4A12A 3MZHA 5JLXA 4MHGA 4CZCA 3MKWB 1XDUA 3EYIA 1OYWA 3E7LA 2HDDA 1IXRC 1FP2A 5LEJA 1XN7A 2CQXA 2PMHA 1R7JA 4BQOA 5J3LA 1Z3YA 3BG7A 3JRDA 4AYBN 1SVMA 2WAFA 3C2GA 2A68F 3CJTB 3AG1H 3TW7A 1VQ5I 1G6NA 3ZMZA 3P9IA 1IC8A 3TOAA 4OIOF 3DWLE 2K85A 1OJLA 1A31A 2E1OA 3OWTA 3ZQQA 2LK2A 3I64A 2IW5A 2DYRH 2M0CA 4L9TA 1BIAA 1RRJA 5IT3A 3R4KA 4XIDA 3NWSA 1BL0A 3WHCA 2FU4A 1S7EA 1U9NA 1EF4A 3HOSA 4Y13A 4C30A 3IRRA 2WB1N 3BY6A 4UNOA 2MBFA 4LITA 2H6BA 3AL0B 5JVTA 1Y8QB 3CCYA 1V4RA 4M9SA 3KX2A 2Q8KA 4B4CA 3TO9A 4ETSA 4PSWA 4E7SA 2IBDA 3ERMA 2KIMA 5GP9A 2PBIA 1R1UA 4LB5A 4BBRJ 3CZ6A 4AIKA 2VASA 3K0LA 2R7XA 1BR4A 4MQVA 2HI3A 3GFMA 4CXFA 5L3FA 1U5TC 2ZMEC 4G6DA 3A01B 4LK1F 5LLQA 4KYWA 1XGMA 1Z6TA 3LNQA 1HKQA 4BJ5C 5LBQA 4RAGA 2ELHA 2KDZA 1IRFA 1P4AA 3KE2A 4J00A 2QF7A 3LSGA 4KISA 4N4NB 1MBFA 1RETA 3HB9A 4I7HA 4R8HA 4IXAA 1XMXA 4RS8A 3W6JB 2DFIA 2BXZA 2O8XA 4Y7NJ 3KLNA 3J81Z 1MMDA 2DBBA 3Q0VA 4OAZA 2OPTA 5FKLA 1E3PA 1FOKA 3O8HA 4GRIA 3E1SA 3RPUD 3AG4H 1FT9A 2EILH 2W85A 3G1LA 1IW7F 5E18F 4ZDOA 2MYSA 3GEZA 1ZARA 2FOKA 1C0WA 2TDXA 4U0VA 3E6BA 3VSLA 3Q0WA 2DDAA 2F48A 5A2QZ 2GIZA 3H0GJ 3LSRA 2DA6A 2J5PA 1H9TA 1KYWA 3IKTA 3BTLA 3PNVA 1U2WA 4P5OA 4OWRB 1QHHD 3OYJA 5LRSA 2ESNA 1MD0A 1PUFA 3WE3A 2QQAA 4PJLA 3IH4A 5F1JA 1B72A 4B48A 2ZJQF 2PMZA 4XQFA 5CQGA 5FD5A 1D8KA 4S0HB 5JLWA 2E35A 3DP7A 5K7ZA 4LK0F 3VDXA 4E7KA 1FTTA 4FCYA 3EDPA 4C9YA 2B63J 2DQLA 3IHUA 3UR3C 2FBIA 1VI0A 3AL0C 2KHMA 3EETA 2A5YB 3P7NA 2F2EA 2FRHA 3LWFA 3OYBA 4HDUA 1BC7C 2HR3A 1VQ9I 1ETXA 3C18A 3S32A 1FLIA 4E7JA 2R93J 3WTWC 2DA7A 1YOVB 2IS2A 5E79C 1R22A 5J4YA 1OLTA 2UWMA 2CSOA 3RKXA 1R5GA 2DQRA 4UB6C 3OY9A 2BBYA 4FE4A 3FKIJ 2CJJA 4OINF 1HCRA 1B8IA 1AOYA 1MNEA 3CF2A 3K70D 3FXQA 4HW0A 3OS2A 1D0ZA 2E34A 2Y30A 3B6CA 3MKLA 2JSCA 2XGEA 2M0MA 1BR2A 2M4GA 2ZSIB 1D3YA 1MJBA 2L01A 4I01A 4BQQA 2IP2A 1J7KA 1VTNC 3GTMJ 3K2ZA 2RV8A 4BEHA 1JTXA 1ZELA 1N75A 4M3GA 1F9NA 1OCPA 3ASOH 1Z7LA 5ERIA 5HLTA 3CMEI 3Q9VA 4FT8A 1R36A 3IKVA 2LD5A 3HC7A 4DYRA 4WCGA 1L0OC 1I1GA 4RB3C 4HLXA 4ZZLA 3G71I 4XKCA 1BR1A 2ADUA 1ZGWA 2P5LC 5BNGA 1Z1DA 4IJAA 3PFYA 3KP3A 2G7UA 4BXUA 4LLGF 1XG1A 2WTEA 2RQPA 2G9WA 2LYCA 2WY8Q 4BY7J 4WK8F 5GADJ 3OYNA 2DODA 1W4MA 4CICA 4II3A 3F8FA 2WC2A 2J5OA 2R7WA 3K70C 4MO7A 1UHMA 2VXZA 2QSGX 2BHYA 4QTRA 1DQUA 4XOPA 2IXSA 3FXUA 2QYOA 5BS6A 3U1DA 2XSJC 4G12A 5CKTA 1OMIA 2L54A 2PN6A 3QWLA 3CMAI 4KIBA 3GTLJ 5M3MJ 1FIPA 3R0JA 3SEQA 1BC8C 1WVRA 4MTDA 3LFKA 4NHJA 2E7XA 4PZJA 1ZTRA 2EQRA 4ENNA 2KQRA 1LDKB 2K9MA 2AQEA 1YITI 4IQJA 4M71A 5DCFA 2E2IJ 2IA0A 4CZZA 1T95A 3I4MJ 2QCOA 4WXDA 2VL8A 4KDPA 2PJRA 1OCZH 2FF4A 3FMSA 3CCQI 4KN7X 1T38A 1ACIA 1LUJB 2DOAA 4BEHB 1UB9A 2DTRA 3SXYA 5E20A 4ZYHA 4A3DJ 3EYYA 1OCCH 3ZMUA 3ROUA 3E5XA 4BY1J 2MG4A 3FBIB 4OOIA 2X6OA 1D1AA 2MSYA 5FD6A 4HSRA 1FIAA 4LG3A 3CCUI 2EV0A 2KDOA 2W4SA 5EDNA 2Y75A 3ZQGA 2V6CA 2D1VA 4ZC3A 3OIOA 3B02A 2HWVA 2VI6A 2VC0A 1R9TJ 3P9KA 2K9NA 4HX4A 1TWCJ 2UXXA 1P4WA 4FE7A 2L02A 4H4KC 3CF5F 4QLCU 3ABLH 1HC8A 1JT6A 3GMEA 5EG0A 1X1AA 1R4MB 2R7DA 1W1WE 1POGA 2DJIA 2JSPA 2NS7A 3OOUA 3WTYC 2H8WA 1ETQA 2WV1A 4YFXF 1BI1A 4HAMA 1B59A 1V5GA 1K79A 2FEZA 3L2QA 4BYYA 1DGRM 2ZB9A 1USSA 3HKZA 3V7RA 2EA4A 2W1OA 3QODA 5K5QA 3DV8A 2V9KA 1XC5A 3S1MJ 3SZTA 3GBGA 1L3LA 3UKGA 3VYRB 5DUIA 2HYGD 4GO1A 3L1PA 1BIBA 4LLLA 3CC2I 5D4SA 3FK7A 1SFEA 2VQGA 3BZKA 1XDSA 1S7OA 3DPLC 2C6YA 2LR8A 2HNHA 3ZQLA 2F5VA 1X3UA 2HQRA 1IN5A 4ESBA 3J80K 1UG0A 1W36D 2VPLA 4YIFA 3N97A 1QVUA 2LBFA 2OCCH 3H3ZA 3CUOA 3NARA 2P6SA 1JI8A 1WKMA 3BR2A 5E1ZB 1N25A 3TP0A 3G6EI 3IH2A 3BC8A 4JX5A 4AIDA 3S2WA 1U8RA 4FHTA 4A3JJ 2WAEA 2VE9A 2NOJB 4M3DA 3CP8A 2Y0SA 3P9CA 4XOTA 1W0TA 3FK6A 3MN2A 3NAUA 1B9MA 4NQWA 2CG4A 3CC4I 4J01A 2VBXA 1Z3XA 3HM5A 1JUMA 4GDFA 1WJDA 3C3WA 1MGTA 3KEYA 4MNUA 3F8NA 3M9AA 2W82A 1Z05A 1EA3A 5F0FA 3SJMA 3SDGA 1IV8A 4V19K 1R5HA 4FTHA 5EJCA 3T8RA 3QU6A 1G8XA 1OFCX 2ZKZA 4A0YA 3I0TA 1K78A 5B1BH 2DFHA 3KZYA 4L18B 2RC4A 5HS8A 3JTHA 4P1WA 4M72A 3IP4B 4NUBA 4RMNA 3OYAA 3OYKA 1W36C 3ZCOA 4ZTJA 3HSFA 1LFUP 1P7IA 1SD7A 2Z99A 5ILSA 5K7HA 4HX8A 3AG3H 4JBAA 4GYIA 1RKWA 3WGIA 4EJTA 2CMPA 4CGZA 1LE8B 4HEA2 2HTJA 3H5RA 1UHWA 2R5YA 1FMVA 3EPZA 2UXNA 1XSXA 1MMGA 5D8LB 2XAJA 2CQKA 1PDNC 4B3XA 2DMUA 5ICCA 2HPIA 4BHCA 5GAHJ 4XLCA 1T33A 4CCJA 3RTRA 3PO2J 1JJ8C 2OAZA 3HRSA 2FSWA 2JRMA 4E7HA 4E6KG 1FOWA 1YE9A 3H0DA 2NOGA 4D5FA 2V9VA 2MGQA 5D5VB 3J81K 5DM7F 2ELJA 2EPFA 4G7ZF 1U78A 4HF2A 3C7JA 2ESHA 2RQQA 5HDKA 2KLOA 4BQNA 2HS5A 3DU5A 4IX7A 2Q0OA 1VQ6I 4EM2A 2ZO4A 4BXFA 4KICA 3S17J 4MLOA 5DCMA 3K7AJ 4IHXA 1E17A 4M3FA 1YW9A 2QA4I 5A2QK 3HL2A 2QZ8A 3KYCB 4F91B 1WPKA 2FA5A 3K1MA 1WCMJ 2YUSA 1R5ID 5M3FJ 3TMOA 3IV5A 3GX4X 1QQIA 3O8GA 4AIJA 3BP8A 4XKWA 1GVJA 2ZCWA 4BQAA 1MSFC 3OR2C 1P92A 5K5OA 2IS4A 2DFFA 1G59A 4PGGA 2BE5F 2YS9A 3BPXA 2KZGA 4DZPA 4XMYA 3RKYA 4ON0A 3S8PA 2XRNA 5C4XJ 3C2BA 3SHFA 3QOPA 4HV6A 1WJBA 2QENA 4Y4RA 2A6TA 3OYIA 1AKHB 2LVSA 1JE8A 1U5TA 2M8GX 1Z67A 2NS0A 2ZMEA 3H92A 3I5UA 5IPAA 3JRBA 5K7FA 1I39A 3BJ6A 2VJIA 5DDGA 2NVQJ 1DP3A 3KEOA 3VPRA 4BUPA 2M2EA 5HOOA 3BJOA 3TW6A 2L9VA 5KVRA 3E5UA 5JVGF 1XS9A 3CDLA 4Q48A 3RJPA 3VEPA 4U7BA 3RKQA 2D2WA 1CF7B 2MC4A 1SMTA 2K9LA 1B4AA 4EJWA 1H8AC 2HXOA 2KMUA 5D6FA 1RR8C 2WWYA 3FMQA 1V5EA 5EZGA 3V8KA 3OYLA 4PDKA 4RB2C 2A07F 3KEQA 3K1NA 2Y48A 1WRJA 4O3MA 2RAEA 1Z9CA 2IEKA 2WBMA 2V1UA 4WXHA 5GPCA 4PCQA 1SVOA 1J59A 4YFKF 2NAZA 2MH9A 5D4RA 2E7WA 1ZLKA 4RM2A 1BJZA 3WGHA 4I76A 4HPQA 1ONVA 2I8DA 3QPLA 2W84A 3JRCA 4RGRA 3HEFA 1B6AA 1T2KA 3JRIA 5FO5A 3REOA 1D8JA 3GZ6A 4KIGA 4YG2F 1Z77A 5EEGA 5IP9J 4XK4A 4JX6A 4D7NA 1WJ5A 3K4KA 2LKXA 2DO7A 4JX4A 1S3JA 3P5JA 5IP7J 2IRFG 4BL0B 3BR5A 2YR2A 1XCBA 4PGHA 2L7KA 1ZRDA 2RVCA 2GA1A 4R79A 1LB2A 2FD5A 2M9HA 3GO5A 3HHHA 4BHPA 1HW2A 2HDCA 1MNDA 1RC9A 1XTAA 2PJPA 1LFPA 1TTYA 2WADA 3OL4A 3GF2A 2FQ3A 2XDVA 5JFRA 1IV6A 1Y1VJ 4ZYGA 4HRIA 2HKXA 2JRTA 1R1VA 1ON1A 1D5VA 3HJEA 4ITVA 3RPUA 5IY5H 2QKLB 2DOFA 1J9IA 1VQMI 1MBKA 5F0CA 4LOCA 2V26A 3B73A 4PJMA 4Y52J 3C2HA 1MIJA 2BVMA 4EATA 1S29A 4B44A 2K9SA 2O03A 2QKMB 3LA2A 3MD2A 4AU7A 4A3EJ 2ZXJA 2X51A 3SEZA 1Z21A 1OPCA 2K4BA 2O6GE 5H20A 1SVLA 3A01A 1MJAA 3QYBA 4EM0B 4EEFG 2L9NA 1O7FA 2XF7A 1LJ9A 3HGGA 1KU2A 3OL3A 1TWAJ 4H0EA 3DXJF 2HVSA 1MMAA 5HLHA 4EGYA 1Y39A 3C1DA 4UVBA 3Q5FA 4DBQA 3W2WA 1T6SA 5GPAA 3J80Z 2JN6A 2O3FA 3R60A 1T0FA 2VT3A 4RAFA 2E19A 1TC3C 2D45A 2ACJA 4A6DA 5IP6A 1S9HA 1IG7A 5HDNA 2HFHA 3I54A 1QPIA 2XUBA 3WU1B 2PX9A 3QPTA 1Z6RA 4RGXA 2JA6J 2M45A 1T56A 1OCRH 1KU9A 2W25A 3I59B 1KQ8A 2A6EF 4X6AJ 3L2CA 2YSRA 2HDWA 1SFUA 4XLNF 5GTIC 3I53A 1ZG3A 1JKQC 2VJ4A 1O3SA 2PMUA 1ETOA 4JK1X 3BQYA 4WXCA 3RQ4A 3IWZA 4HQMA 4UY8I 2GAUA 4G9YA 3MKZA 1HSTA 3R6SA 1HW1A 3RQIA 1GDTA 3OYGA 2VT2A 1D5YA 3CJRB 2EV5A 4GGGA 4BDZA 5F27A 1OKRA 4I0AA 2PEXA 3FXJA 1GVDA 5IOZA 2Z16A 4PJJA 2F5FA 3D5SC 1HA8A 2Y0MA 2D5VA 3ECHA 5JHUA 5LEKA 1J75A 1O7LA 2H27A 1OQYA 3F8MA 2K9QA 3PNYA 2QVOA 2NNNA 3F23A 2CV0A 3A0BC 3KP5A 1EV7A 3BPVA 3A4CA 1IGNA 1H88C 3PQJA 2B0LA 3S3NA 3ZPLA 1VQNI 2XVCA 4X0GA 4G94A 4CSWA 2ZBKA 2Z3YA 4P9UA 1ZRCA 3DFGA 1USTA 3PSIA 1DP7P 4MFEA 3F8CA 5LFAA 4FISA 4XKVA 1IN7A 3HOUJ 3HPGA 5H6QA 4XICA 1FC3A 2K02A 3ZN1A 4AUXA 3WTXC 2KT0A 3K4NA 3M8FA 4U0WA 3U9GA 2VOPA 3V42A 2VB6A 4KA4A 4IOAF 2LTPA 4IHVA 3A2KA 4IHTA 1YYVA 3I4PA 1ON2A 3RZDJ 3M4OJ 4DW6A 1HSJA 2O9LA 3OSFA 5KHDA 1A6IA 4DNCA 2CRGA 1FY7A 2XB5A 5D5XB 5CQEA 1ZQ3P 2M4KA 4RAYA 4EVIA 5M5XJ 1A5JA 4A93J 1S8NA 1PUEE 3TO7A 2VBYA 4M6VA 4NC8A 3PUBA 5CJ9A 1KGSA 3D1NI 2R7VA 1IAWA 3I55I 2L9SA 4A3KJ 1VQPI 5KAFC 2GWRA 3FXLA 3CCEI 1UCRA 2KP6A 2YU3A 2X9DA 3FWEA 4XKBA 3MQ0A 1YW8A 1NH3A 1HLVA 1VQLI 4R1HA 2EIMH 2VE8A 2XIGA 3U21A 1IUYA 4AC0A 4ENJA 3G1MA 2M8EA 3ZQHA 5JR3A 2PMZN 1MDMB 3GWZA 3B6AA 5EEHA 1K61A 1TQPA 3JAMZ 1U6GA 1JGSA 2VC1A 2Y9YA 4BE1A 2JUCA 4M6XA 5L3CA 3K4CA 2L0KA 2XGXA 5E17F 2X6YA 4JP0A 3K4BA 3WTUC 2Z33A 5FLXK 4CCKA 2EJRA 1S5LC 2Q2EB 2EZHA 3ABTA 3KCCA 1JXSA 1Z0XA 1RZ4A 4UHTA 3L2RA 4CYCA 3M1CA 4IHYA 3S2HJ 1Z91A 1NTCA 2EFQA 2XAQA 3DU6A 4IF4A
chains in the Genus database with same CATH topology
2YX7A 3SFZA 1XSDA 4XRFA 2F5DA 1S6LA 5K5RA 1QPMA 1P2FA 2FNAA 3LAJA 2VBWA 3HTUA 2A6HF 1ZAOA 1O57A 1FSHA 2P7CB 3O3KA 3CTAA 4OU0A 1R58A 4RB1A 5TRDA 2LF8A 4UUVA 2CFXA 3MAJA 1G3WA 1FYLA 1G3TA 1K6OA 2W24A 3GUDA 1YG2A 1KQ9A 3Q9SA 1AWCA 3RDIA 2EFNA 1YIOA 5J8FA 2RN7A 4OIQF 1DUXC 2KJCA 4HF1A 2MD5A 4ENKA 1O3TA 4M9ZA 1SMYF 3T1BA 1MJ9A 4P96A 5DV5A 2LKPA 2DPDA 5ILUA 2MC3A 2MLGA 4OIPF 5L3EA 2QM3A 4Q47A 1ZGJA 4HYEA 2ZFWA 1ZGAA 4M6YA 4A5NA 5ILVA 4TV7A 4RAZA 2PFBA 4O5VA 4L5IA 2ETHA 1IN8A 1BI0A 4P9FA 1F5TA 2AS5F 3KP7A 2KRFA 2BYVE 1IF1A 2RNJA 3KP6A 1XGSA 4HQEA 2DI3A 1ZREA 2H09A 2X0LA 1HKTA 4YIIA 1R23A 2JPCA 2KKOA 4EM1A 3J7AO 1JHHA 5H6RA 2YX4A 5LHGA 3NQOA 3FHZA 3M8EA 3K69A 3GVAA 1LNWA 3N4MA 1YFHA 1WSUA 1I6XA 3CO6C 4Y15A 2RGVA 1E2XA 1UFMA 4M74A 5CLSA 3RPQA 3E6CC 1EH6A 4EJUA 4UXNA 1BN5A 4HA8A 1FP1D 2IA2A 2VN2A 2FXAA 1A04A 4HOBA 5DD8A 3VODA 1BJAA 5JI6A 5E1XA 4IRGA 2A3SA 1J2XA 4BNCA 1BI2A 2P8TA 4EMSA 2A61A 5E8GA 1YW7A 1V3FA 1SD5A 4GCVA 3HOTA 1HQCA 4HV5A 3HTSB 3LQQA 1FZPB 5FFXA 5CVIA 5DEQA 1IXSB 4I09A 2HTSA 4DQ2A 2MH2A 3F6VA 2IA1A 4KN4X 2VBZA 4G6QA 3L09A 4ZYEA 3F3XA 1HW5A 5HS9A 2DLLA 4Z2YA 1XB4A 3BROA 4UVAA 4MTEA 2L3DA 2E1NA 4BHBA 2KJBA 1QZYA 4IRHA 4QWQA 3OOPA 3TQNA 1H9GA 1IRGA 2HKOA 1WQ2A 2LF7A 3D0SA 3KETA 5FLXZ 5F6FA 1CF7A 2DU9A 1F1ZA 3I58A 4LMYA 2M5WA 1IN4A 3M1EA 1B9NA 2GA2A 1ZH5A 3SQNA 3GXOA 3QAHA 5BPDA 1GXQA 1YS7A 1XMAA 2EWNA 4L9JA 3V7SA 2R3SA 3CO7C 3HSRA 2O0YA 1TW2A 3DF8A 1XCVA 3NRVA 1FBQA 1TQMA 2CYYA 4HZFA 2MA3A 1I1SA 3JW4A 1QBJA 2EFWA 1SFXA 5HVQC 3CLOA 4I2OA 4HX7A 3HIFA 3GLXA 3R61A 3V8LA 3OV8A 5FB2A 4LLNA 5LGTA 3ZMVA 3JAMK 5IT9Z 1TNSA 1HBXG 3DKWA 3WTZA 2VODA 3ISPA 5CVRA 3GZ5A 2EFPA 2P6TA 2FBKA 1K7AA 4MEXF 4NB5A 4OIRF 3ZP5A 3ZN0A 5K1YA 3RYRA 4LG0B 4P55A 4MEYF 2EK5A 2HEOA 1CGPA 4M73A 1TNTA 1TBXA 1YTYA 1KU7A 1FYKA 2Z5UA 1RIOH 2E1CA 1HXDA 4O6JA 4G7HF 4XSZF 1FX7A 5AONA 2HYFA 1Y0UA 1R00A 2UZKA 1FPQA 3KZZA 2P5KA 3K9TA 2XASA 2K27A 1KU3A 1J0RA 2M30A 4EGZA 2OZUA 4UV9A 3I59A 4IVNA 2HQNA 2K4JA 3O6BB 2DT5A 3LSTA 4EJOA 2VONA 2EFOA 1XSVA 2EA2A 3G3ZA 5J6XA 3NEUA 2O61A 1J5YA 3AAFA 3KP4A 4FX4A 5D8KB 1LVAA 1REPC 3WG9A 3E3VA 2FMYA 4L9NA 5TJJA 4G8XA 2HZTA 4F7ZA 1Q1HA 3BZ6A 5HLGA 2CW0F 1LEAA 5LHHA 1DPRA 2D1HA 3E97A 1MZBA 2FMLA 3PFIA 4RB0A 3RIRA 3T5XA 4EJVA 4S05A 2M87A 2ZJ2A 3ML6A 1W7PB 3LA3A 2LSOA 4MGRA 3HRTA 3K1PA 1QO0D 5BQTA 2STTA 2BGCA 1I27A 3GW2A 2COMA 4S04A 4A2UA 5E1WA 3V4GA 4CO8A 4HBLA 1T39A 1W5SA 5FGMA 3EUHA 2BV6A 5HLIA 1G3YA 1MDMA 1XMKA 5DUKA 2PLYA 1ODDA 5LHIA 3TDZC 2HOEA 3BJAA 1KQ0A 1W7PD 2Q2EA 4LGWA 2IPQX 4EV0A 4OMZA 1LDDA 1T98A 2GXGA 3GFIA 5CVUA 2EB7A 4B8XA 4N9IA 3CUQB 4ASNA 3FM3A 4EQQA 3MFKA 4KFCA 2EV6A 2QLZA 4KMFA 3F21A 3F8BA 2G7HA 3W6KB 2RKHA 1ZHFA 3G73A 3SZPA 3T8TA 5DYMA 2K86A 1JHFA 1PP8F 5F64A 2ZNZA 4WF2A 2Z9OA 5J8CA 4M9XA 1SD6A 3TKYA 5LRRA 1HKSA 1WI9A 3JSPA 2XKOA 3WE2A 2IT0A 2WV0A 5CVVA 3ECOA 4Q5SF 2XAGA 2KIUA 2XAHA 3GFLA 1B1BA 3BDDA 5LGUA 2QBYA 3O2PE 2P4WA 2IJLA 2OQRA 4A0XA 3IWFA 3V7CA 4AD9A 1BI3A 3COAC 2ISYA 4A0ZA 2QWWA 3ZMTA 4K2EA 1FWZA 2GQQA 3CUQC 1EH7A 4XBFA 1ULYA 3EQLF 3LQRA 5D6EA 2F5CA 2AXLA 3BWGA 1XGNA 1W5TA 3TO6A 4ZYDA 1YQAA 2A69F 1EH8A 2X4HA 4KIFA 1FSEA 1OR7A 3I71A 5IT9K 3MWMA 4CDGA 4U7DA 3KP2A 5L3DA 3FMRA 5E8IA 5KK1A 3WTTC 4AIHA 2GZWA 3E5QA 4A5MA 4MQ9F 3MZYA 3PQKA 3TGNA 2QBYB 4E70A 4UV8A 3WTSC 1ZLJA 2DPUA 1ZN2A 3TOBA 1YO5C 3FXRA 2QUFA 1IXCA 4LJZF 1O3RA 1RUNA 1DPUA 3IC7A 3RYPA 4G7OF 2JZYA 1KYZA 3QRFF 3R0AA 3JSOA 2XAFA 4L5JA 1F4KA 1G3SA 2DK8A 2V79A 3LAPA 5ED4A 2LDUA 3H3UA 2OBPA 4YFNF 1O3QA 4KT5C 3GFJA 2XROA 4ZZDA 1H0MA 1RI7A 4WX9A 4U88A 4Y17A 2PI0A 2NRAC 1SAXA 2FE3A 2W57A 1SD4A 3WU0A 4N0BA 1TW3A 4RGUA 1LEBA 2ZNYA 3FM5A 1TQIA 3MCZA 3ERED 2GXBA 5AIQA 1GXPA 2P5VA 4JQFA 3QU3A 4CHUA 3E6DA 2HGCA 2KIFA 4AWXB 1QNTA 2OQGA 4FX0A 1ZRFA 2QQBA 4IRIA 3WODF 3E6MA 3WTVC 4AVPA 4OMYA 3VB2A 5FFZA 2MLKA 1IZ1A 3L00A 3FZVA 2NNYA 3KFWX 2YPRA 2FBHA 2JPBA 3D5LA 2GIVA 4HF0A 2XV4S 4I0BA 4GYGA 5D5UB 5HDGA 2K7LA 5L3GA 3FX3A 3V8JA 2FNPA 4ZH4F 3HSEA 1QGPA 1OYYA 1YS6A 2XKPA 4LD5A 4B09A 3FF5A 3ZMDA 3ELKA 2ISZA 2CO5A 1R1TA 1FYMA 1ZG1A 3BOQA 5HS7A 4XSXF 4N9HA 3HRMA 1XGOA 2L4AA 4L0ZB 3DPTA 5BPIA 5AIPA 1LDJA 4IPAA 2V1DA 1BOAA 2H94A 2OA4A 5ICEA 3HRUA 2R7FA 4RGSA 4LG0A 1P6RA 2IVMA 1FBSA 1QZZA 3HHGA 2CGPA 5BMZA 2BEOA 1ZG5A 4D0PA 4L9VA 1RNLA 4Q4ZF 3M7GA 6PAXA 3RKWA 5D5WB 5DD4A 2H6CA 1Z7UA 3ZQ7A 4UVCA 2STWA 1BM9A 4BH9A 3L9FA 3DEUA 1RUOA 3HUGA 3CJNA 1MKMA 4KMUX 3T0YA 3QP5A 1K78B 2QQ9A 2JTVA 3RI4A 3L7WA 5ICFA 3QPHA 4XLPF 1NHAA 1XD7A 2OZ6A 3QP6A 4KNYA 3F6OA 3IRQA 5LGNA 1LQ1A 3VFZA 2OU2A 4GXOA 4HLYA 1WWXA 2F5EA 3F22A 3U2RA 4LB6B 1FBUA 1P4XA 2OD5A 5BOXA 3ULQB 2V1XA 2P7VB 4I98B 4ENMA 3DQVC 4ESJA 4A6EA 3F72A 2DW4A 1FNNA 2XHKA 3ABUA 4WWCA 3CDHA 3VOEA 4IHSA 3HYIA 3LA7A 1KA8A 2DK5A 1ZYRF 2NYXA 2JT1A 5DCMB 1STZA 1W7PA 5CYVA 1DDNA 5F1RA 1OYIA 1YLFA 4LFUA 1BBYA 2PQ8A 3ZMSA 5ICGA 2VOOA 4CYDA 4ESFA 5L3BA 4BAYA 2PG4A 1G4DA 4KUMA 4HDVA 2CWEA 2LNBA 4L0YB 1U5TB 4U0YA 2ZMEB 3GYHX 1S7AA 3MEXA 1TLHB 3WGGA 1GHCA 2RDPA 2L4MA 4I02A 3JTGA 3KLOA 3TDUC 1U3EM 1IN6A 2DAOA 1PP7U 5CVJA 2M1BA 3CUQA 3IL2A 1I5ZA 4A12A 3MZHA 4MHGA 1XDUA 3EYIA 1OYWA 1IXRC 1FP2A 5LEJA 1XN7A 2PMHA 1R7JA 2A68F 1G6NA 3ZMZA 3P9IA 4OIOF 3TOAA 3I64A 2IW5A 4L9TA 1BIAA 5IT3A 3R4KA 2FU4A 3HOSA 4Y13A 3IRRA 3BY6A 4UNOA 2MBFA 2H6BA 5JVTA 1V4RA 4M9SA 2Q8KA 3TO9A 4ETSA 2KIMA 2PBIA 1R1UA 4LB5A 4AIKA 3K0LA 4MQVA 3GFMA 4CXFA 5L3FA 1U5TC 4G6DA 4LK1F 5LLQA 4KYWA 1XGMA 1Z6TA 1HKQA 5LBQA 2ELHA 1IRFA 1P4AA 3KE2A 4I7HA 4R8HA 4IXAA 3W6JB 4RS8A 2DFIA 2O8XA 3KLNA 3J81Z 2DBBA 1FOKA 1FT9A 2W85A 1IW7F 5E18F 3GEZA 1ZARA 2FOKA 1C0WA 2TDXA 4U0VA 3E6BA 5A2QZ 2J5PA 1H9TA 1KYWA 3IKTA 1U2WA 4P5OA 5LRSA 2ESNA 1MD0A 3WE3A 2QQAA 5FD5A 1D8KA 3DP7A 4LK0F 3EDPA 2DQLA 3IHUA 2FBIA 3EETA 2A5YB 3P7NA 2F2EA 2FRHA 3LWFA 4HDUA 1BC7C 2HR3A 3C18A 1FLIA 3WTWC 1R22A 2UWMA 2CSOA 3RKXA 1R5GA 2DQRA 2BBYA 4OINF 1AOYA 3FXQA 4HW0A 2JSCA 1D3YA 1MJBA 2L01A 4I01A 2IP2A 1J7KA 1VTNC 3K2ZA 2RV8A 1F9NA 5ERIA 3Q9VA 4FT8A 1R36A 3IKVA 4WCGA 1L0OC 1I1GA 4RB3C 4HLXA 4ZZLA 2ADUA 2P5LC 1Z1DA 4IJAA 3KP3A 2G7UA 4BXUA 4LLGF 2WTEA 2RQPA 2G9WA 4WK8F 1W4MA 4CICA 3F8FA 2WC2A 2J5OA 1UHMA 2VXZA 3FXUA 2QYOA 5BS6A 3U1DA 1OMIA 2L54A 2PN6A 4KIBA 3R0JA 1BC8C 4MTDA 3LFKA 4NHJA 2E7XA 4PZJA 4ENNA 1LDKB 4M71A 5DCFA 2IA0A 4CZZA 4WXDA 4KDPA 2FF4A 3FMSA 4KN7X 1T38A 1UB9A 2DTRA 3SXYA 5E20A 4ZYHA 3EYYA 3ZMUA 3ROUA 3E5XA 4OOIA 5FD6A 2EV0A 2Y75A 2V6CA 2D1VA 3B02A 2HWVA 2VC0A 3P9KA 4HX4A 2UXXA 1P4WA 2L02A 4QLCU 2R7DA 3WTYC 4YFXF 1BI1A 4HAMA 1B59A 1K79A 2FEZA 4BYYA 3V7RA 5K5QA 1USSA 2EA4A 3DV8A 3SZTA 1L3LA 5DUIA 2HYGD 4GO1A 1BIBA 4LLLA 5D4SA 1SFEA 1XDSA 1S7OA 3DPLC 2C6YA 1X3UA 2HQRA 1IN5A 4ESBA 3J80K 4YIFA 3N97A 3H3ZA 3CUOA 2P6SA 1WKMA 5E1ZB 3S2WA 1U8RA 4FHTA 2VE9A 3P9CA 1B9MA 4NQWA 2CG4A 2VBXA 3C3WA 1MGTA 4MNUA 3F8NA 3M9AA 1Z05A 1R5HA 3T8RA 3QU6A 2ZKZA 4A0YA 3I0TA 1K78A 3KZYA 4L18B 2RC4A 5HS8A 3JTHA 4M72A 3HSFA 1SD7A 2Z99A 5ILSA 4HX8A 4JBAA 4GYIA 3WGIA 4EJTA 4CGZA 2HTJA 1UHWA 2UXNA 1XSXA 5D8LB 2XAJA 2CQKA 1PDNC 5ICCA 4BHCA 3RTRA 2OAZA 3HRSA 2FSWA 2V9VA 5D5VB 3J81K 4G7ZF 1U78A 4HF2A 3C7JA 2ESHA 5HDKA 2HS5A 2Q0OA 4EM2A 2ZO4A 4KICA 5DCMA 1E17A 1YW9A 5A2QK 2QZ8A 2FA5A 3K1MA 3GX4X 1QQIA 4AIJA 3BP8A 1GVJA 2ZCWA 4BQAA 1P92A 5K5OA 4PGGA 2BE5F 3BPXA 3RKYA 4ON0A 2XRNA 3SHFA 3QOPA 4HV6A 2QENA 1JE8A 1U5TA 2NS0A 2ZMEA 3H92A 3I5UA 3BJ6A 5DDGA 3KEOA 5HOOA 3BJOA 5KVRA 3E5UA 4Q48A 3RJPA 3VEPA 4U7BA 1CF7B 2D2WA 1SMTA 4EJWA 1B4AA 5D6FA 2WWYA 3FMQA 3V8KA 4PDKA 4RB2C 2A07F 3KEQA 3K1NA 2Y48A 1WRJA 4O3MA 1Z9CA 2V1UA 4WXHA 4PCQA 1J59A 4YFKF 2NAZA 2MH9A 5D4RA 2E7WA 1ZLKA 3WGHA 1ONVA 2W84A 4RGRA 1T2KA 1B6AA 5FO5A 3REOA 1D8JA 3GZ6A 4KIGA 4YG2F 5EEGA 2DO7A 1S3JA 2IRFG 2YR2A 1XCBA 4PGHA 1ZRDA 2RVCA 2GA1A 4R79A 1LB2A 3GO5A 4BHPA 3HHHA 1HW2A 2HDCA 2PJPA 1TTYA 5JFRA 3GF2A 2FQ3A 4ZYGA 2HKXA 2JRTA 1R1VA 1ON1A 1D5VA 3RPUA 1J9IA 3B73A 1S29A 2O03A 3LA2A 2ZXJA 1OPCA 2K4BA 2O6GE 5H20A 1MJAA 4EM0B 1O7FA 1LJ9A 1KU2A 4H0EA 3DXJF 5HLHA 4EGYA 3C1DA 4UVBA 3Q5FA 1T6SA 3J80Z 2O3FA 3R60A 1T0FA 2VT3A 2D45A 2ACJA 4A6DA 5HDNA 2HFHA 3I54A 2XUBA 3WU1B 3QPTA 1Z6RA 4RGXA 2M45A 1KU9A 2W25A 3I59B 1KQ8A 2A6EF 3L2CA 2YSRA 1SFUA 4XLNF 3I53A 1ZG3A 1O3SA 2PMUA 4JK1X 4WXCA 3IWZA 4HQMA 2GAUA 4G9YA 1HSTA 3R6SA 1HW1A 2VT2A 2EV5A 4GGGA 1OKRA 4I0AA 2PEXA 2F5FA 2Y0MA 3ECHA 5JHUA 5LEKA 1J75A 1O7LA 2H27A 3F8MA 2QVOA 2NNNA 3F23A 3KP5A 1EV7A 3BPVA 3PQJA 2B0LA 3ZPLA 2XVCA 4G94A 2ZBKA 2Z3YA 4P9UA 1ZRCA 3DFGA 1USTA 1DP7P 3F8CA 1IN7A 5H6QA 1FC3A 2K02A 3ZN1A 3WTXC 3M8FA 4U0WA 3U9GA 2VOPA 4KA4A 4IHTA 1YYVA 3I4PA 1ON2A 1HSJA 4DNCA 1FY7A 5D5XB 4RAYA 4EVIA 1S8NA 1PUEE 3TO7A 2VBYA 5CJ9A 1KGSA 1IAWA 2GWRA 1UCRA 2YU3A 3FWEA 3MQ0A 1YW8A 4R1HA 2VE8A 2XIGA 1IUYA 4ENJA 2M8EA 5JR3A 1MDMB 3GWZA 5EEHA 1TQPA 3JAMZ 1U6GA 1JGSA 2VC1A 4M6XA 5L3CA 2XGXA 5E17F 3WTUC 2Z33A 5FLXK 2EJRA 3ABTA 3KCCA 1JXSA 1RZ4A 4UHTA 1Z91A 2EFQA 2XAQA 4IF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YX7 A;  3SFZ A;  1XSD A;  4XRF A;  2F5D A;  1S6L A;  5K5R A;  1QPM A;  1P2F A;  2FNA A;  3LAJ A;  2VBW A;  3HTU A;  2A6H F;  1ZAO A;  1O57 A;  1FSH A;  2P7C B;  3O3K A;  3CTA A;  4OU0 A;  1R58 A;  4RB1 A;  5TRD A;  2LF8 A;  4UUV A;  2CFX A;  3MAJ A;  1G3W A;  1FYL A;  1G3T A;  1K6O A;  2W24 A;  3GUD A;  1YG2 A;  1KQ9 A;  3Q9S A;  1AWC A;  3RDI A;  2EFN A;  1YIO A;  5J8F A;  2RN7 A;  4OIQ F;  1DUX C;  2KJC A;  4HF1 A;  2MD5 A;  4ENK A;  1O3T A;  4M9Z A;  1SMY F;  3T1B A;  1MJ9 A;  4P96 A;  5DV5 A;  2LKP A;  2DPD A;  5ILU A;  2MC3 A;  2MLG A;  4OIP F;  5L3E A;  2QM3 A;  4Q47 A;  1ZGJ A;  4HYE A;  2ZFW A;  1ZGA A;  4M6Y A;  4A5N A;  5ILV A;  4TV7 A;  4RAZ A;  2PFB A;  4O5V A;  4L5I A;  2ETH A;  1IN8 A;  1BI0 A;  4P9F A;  1F5T A;  2AS5 F;  3KP7 A;  2KRF A;  2BYV E;  1IF1 A;  2RNJ A;  3KP6 A;  1XGS A;  4HQE A;  2DI3 A;  1ZRE A;  2H09 A;  2X0L A;  1HKT A;  4YII A;  1R23 A;  2JPC A;  2KKO A;  4EM1 A;  3J7A O;  1JHH A;  5H6R A;  2YX4 A;  5LHG A;  3NQO A;  3FHZ A;  3M8E A;  3K69 A;  3GVA A;  1LNW A;  3N4M A;  1YFH A;  1WSU A;  1I6X A;  3CO6 C;  4Y15 A;  2RGV A;  1E2X A;  1UFM A;  4M74 A;  5CLS A;  3RPQ A;  3E6C C;  1EH6 A;  4EJU A;  4UXN A;  1BN5 A;  4HA8 A;  1FP1 D;  2IA2 A;  2VN2 A;  2FXA A;  1A04 A;  4HOB A;  5DD8 A;  3VOD A;  1BJA A;  5JI6 A;  5E1X A;  4IRG A;  2A3S A;  1J2X A;  4BNC A;  1BI2 A;  2P8T A;  4EMS A;  2A61 A;  5E8G A;  1YW7 A;  1V3F A;  1SD5 A;  4GCV A;  3HOT A;  1HQC A;  4HV5 A;  3HTS B;  3LQQ A;  1FZP B;  5FFX A;  5CVI A;  5DEQ A;  1IXS B;  4I09 A;  2HTS A;  4DQ2 A;  2MH2 A;  3F6V A;  2IA1 A;  4KN4 X;  2VBZ A;  4G6Q A;  3L09 A;  4ZYE A;  3F3X A;  1HW5 A;  5HS9 A;  2DLL A;  4Z2Y A;  1XB4 A;  3BRO A;  4UVA A;  4MTE A;  2L3D A;  2E1N A;  4BHB A;  2KJB A;  1QZY A;  4IRH A;  4QWQ A;  3OOP A;  3TQN A;  1H9G A;  1IRG A;  2HKO A;  1WQ2 A;  2LF7 A;  3D0S A;  3KET A;  5FLX Z;  5F6F A;  1CF7 A;  2DU9 A;  1F1Z A;  3I58 A;  4LMY A;  2M5W A;  1IN4 A;  3M1E A;  1B9N A;  2GA2 A;  1ZH5 A;  3SQN A;  3GXO A;  3QAH A;  5BPD A;  1GXQ A;  1YS7 A;  1XMA A;  2EWN A;  4L9J A;  3V7S A;  2R3S A;  3CO7 C;  3HSR A;  2O0Y A;  1TW2 A;  3DF8 A;  1XCV A;  3NRV A;  1FBQ A;  1TQM A;  2CYY A;  4HZF A;  2MA3 A;  1I1S A;  3JW4 A;  1QBJ A;  2EFW A;  1SFX A;  5HVQ C;  3CLO A;  4I2O A;  4HX7 A;  3HIF A;  3GLX A;  3R61 A;  3V8L A;  3OV8 A;  5FB2 A;  4LLN A;  5LGT A;  3ZMV A;  3JAM K;  5IT9 Z;  1TNS A;  1HBX G;  3DKW A;  3WTZ A;  2VOD A;  3ISP A;  5CVR A;  3GZ5 A;  2EFP A;  2P6T A;  2FBK A;  1K7A A;  4MEX F;  4NB5 A;  4OIR F;  3ZP5 A;  3ZN0 A;  5K1Y A;  3RYR A;  4LG0 B;  4P55 A;  4MEY F;  2EK5 A;  2HEO A;  1CGP A;  4M73 A;  1TNT A;  1TBX A;  1YTY A;  1KU7 A;  1FYK A;  2Z5U A;  1RIO H;  2E1C A;  1HXD A;  4O6J A;  4G7H F;  4XSZ F;  1FX7 A;  5AON A;  2HYF A;  1Y0U A;  1R00 A;  2UZK A;  1FPQ A;  3KZZ A;  2P5K A;  3K9T A;  2XAS A;  2K27 A;  1KU3 A;  1J0R A;  2M30 A;  4EGZ A;  2OZU A;  4UV9 A;  3I59 A;  4IVN A;  2HQN A;  2K4J A;  3O6B B;  2DT5 A;  3LST A;  4EJO A;  2VON A;  2EFO A;  1XSV A;  2EA2 A;  3G3Z A;  5J6X A;  3NEU A;  2O61 A;  1J5Y A;  3AAF A;  3KP4 A;  4FX4 A;  5D8K B;  1LVA A;  1REP C;  3WG9 A;  3E3V A;  2FMY A;  4L9N A;  5TJJ A;  4G8X A;  2HZT A;  4F7Z A;  1Q1H A;  3BZ6 A;  5HLG A;  2CW0 F;  1LEA A;  5LHH A;  1DPR A;  2D1H A;  3E97 A;  1MZB A;  2FML A;  3PFI A;  4RB0 A;  3RIR A;  3T5X A;  4EJV A;  4S05 A;  2M87 A;  2ZJ2 A;  3ML6 A;  1W7P B;  3LA3 A;  2LSO A;  4MGR A;  3HRT A;  3K1P A;  1QO0 D;  5BQT A;  2STT A;  2BGC A;  1I27 A;  3GW2 A;  2COM A;  4S04 A;  4A2U A;  5E1W A;  3V4G A;  4CO8 A;  4HBL A;  1T39 A;  1W5S A;  5FGM A;  3EUH A;  2BV6 A;  5HLI A;  1G3Y A;  1MDM A;  1XMK A;  5DUK A;  2PLY A;  1ODD A;  5LHI A;  3TDZ C;  2HOE A;  3BJA A;  1KQ0 A;  1W7P D;  2Q2E A;  4LGW A;  2IPQ X;  4EV0 A;  4OMZ A;  1LDD A;  1T98 A;  2GXG A;  3GFI A;  5CVU A;  2EB7 A;  4B8X A;  4N9I A;  3CUQ B;  4ASN A;  3FM3 A;  4EQQ A;  3MFK A;  4KFC A;  2EV6 A;  2QLZ A;  4KMF A;  3F21 A;  3F8B A;  2G7H A;  3W6K B;  2RKH A;  1ZHF A;  3G73 A;  3SZP A;  3T8T A;  5DYM A;  2K86 A;  1JHF A;  1PP8 F;  5F64 A;  2ZNZ A;  4WF2 A;  2Z9O A;  5J8C A;  4M9X A;  1SD6 A;  3TKY A;  5LRR A;  1HKS A;  1WI9 A;  3JSP A;  2XKO A;  3WE2 A;  2IT0 A;  2WV0 A;  5CVV A;  3ECO A;  4Q5S F;  2XAG A;  2KIU A;  2XAH A;  3GFL A;  1B1B A;  3BDD A;  5LGU A;  2QBY A;  3O2P E;  2P4W A;  2IJL A;  2OQR A;  4A0X A;  3IWF A;  3V7C A;  4AD9 A;  1BI3 A;  3COA C;  2ISY A;  4A0Z A;  2QWW A;  3ZMT A;  4K2E A;  1FWZ A;  2GQQ A;  3CUQ C;  1EH7 A;  4XBF A;  1ULY A;  3EQL F;  3LQR A;  5D6E A;  2F5C A;  2AXL A;  3BWG A;  1XGN A;  1W5T A;  3TO6 A;  4ZYD A;  1YQA A;  2A69 F;  1EH8 A;  2X4H A;  4KIF A;  1FSE A;  1OR7 A;  3I71 A;  5IT9 K;  3MWM A;  4CDG A;  4U7D A;  3KP2 A;  5L3D A;  3FMR A;  5E8I A;  5KK1 A;  3WTT C;  4AIH A;  2GZW A;  3E5Q A;  4A5M A;  4MQ9 F;  3MZY A;  3PQK A;  3TGN A;  2QBY B;  4E70 A;  4UV8 A;  3WTS C;  1ZLJ A;  2DPU A;  1ZN2 A;  3TOB A;  1YO5 C;  3FXR A;  2QUF A;  1IXC A;  4LJZ F;  1O3R A;  1RUN A;  1DPU A;  3IC7 A;  3RYP A;  4G7O F;  2JZY A;  1KYZ A;  3QRF F;  3R0A A;  3JSO A;  2XAF A;  4L5J A;  1F4K A;  1G3S A;  2DK8 A;  2V79 A;  3LAP A;  5ED4 A;  2LDU A;  3H3U A;  2OBP A;  4YFN F;  1O3Q A;  4KT5 C;  3GFJ A;  2XRO A;  4ZZD A;  1H0M A;  1RI7 A;  4WX9 A;  4U88 A;  4Y17 A;  2PI0 A;  2NRA C;  1SAX A;  2FE3 A;  2W57 A;  1SD4 A;  3WU0 A;  4N0B A;  1TW3 A;  4RGU A;  1LEB A;  2ZNY A;  3FM5 A;  1TQI A;  3MCZ A;  3ERE D;  2GXB A;  5AIQ A;  1GXP A;  2P5V A;  4JQF A;  3QU3 A;  4CHU A;  3E6D A;  2HGC A;  2KIF A;  4AWX B;  1QNT A;  2OQG A;  4FX0 A;  1ZRF A;  2QQB A;  4IRI A;  3WOD F;  3E6M A;  3WTV C;  4AVP A;  4OMY A;  3VB2 A;  5FFZ A;  2MLK A;  1IZ1 A;  3L00 A;  3FZV A;  2NNY A;  3KFW X;  2YPR A;  2FBH A;  2JPB A;  3D5L A;  2GIV A;  4HF0 A;  2XV4 S;  4I0B A;  4GYG A;  5D5U B;  5HDG A;  2K7L A;  5L3G A;  3FX3 A;  3V8J A;  2FNP A;  4ZH4 F;  3HSE A;  1QGP A;  1OYY A;  1YS6 A;  2XKP A;  4LD5 A;  4B09 A;  3FF5 A;  3ZMD A;  3ELK A;  2ISZ A;  2CO5 A;  1R1T A;  1FYM A;  1ZG1 A;  3BOQ A;  5HS7 A;  4XSX F;  4N9H A;  3HRM A;  1XGO A;  2L4A A;  4L0Z B;  3DPT A;  5BPI A;  5AIP A;  1LDJ A;  4IPA A;  2V1D A;  1BOA A;  2H94 A;  2OA4 A;  5ICE A;  3HRU A;  2R7F A;  4RGS A;  4LG0 A;  1P6R A;  2IVM A;  1FBS A;  1QZZ A;  3HHG A;  2CGP A;  5BMZ A;  2BEO A;  1ZG5 A;  4D0P A;  4L9V A;  1RNL A;  4Q4Z F;  3M7G A;  6PAX A;  3RKW A;  5D5W B;  5DD4 A;  2H6C A;  1Z7U A;  3ZQ7 A;  4UVC A;  2STW A;  1BM9 A;  4BH9 A;  3L9F A;  3DEU A;  1RUO A;  3HUG A;  3CJN A;  1MKM A;  4KMU X;  3T0Y A;  3QP5 A;  1K78 B;  2QQ9 A;  2JTV A;  3RI4 A;  3L7W A;  5ICF A;  3QPH A;  4XLP F;  1NHA A;  1XD7 A;  2OZ6 A;  3QP6 A;  4KNY A;  3F6O A;  3IRQ A;  5LGN A;  1LQ1 A;  3VFZ A;  2OU2 A;  4GXO A;  4HLY A;  1WWX A;  2F5E A;  3F22 A;  3U2R A;  4LB6 B;  1FBU A;  1P4X A;  2OD5 A;  5BOX A;  3ULQ B;  2V1X A;  2P7V B;  4I98 B;  4ENM A;  3DQV C;  4ESJ A;  4A6E A;  3F72 A;  2DW4 A;  1FNN A;  2XHK A;  3ABU A;  4WWC A;  3CDH A;  3VOE A;  4IHS A;  3HYI A;  3LA7 A;  1KA8 A;  2DK5 A;  1ZYR F;  2NYX A;  2JT1 A;  5DCM B;  1STZ A;  1W7P A;  5CYV A;  1DDN A;  5F1R A;  1OYI A;  1YLF A;  4LFU A;  1BBY A;  2PQ8 A;  3ZMS A;  5ICG A;  2VOO A;  4CYD A;  4ESF A;  5L3B A;  4BAY A;  2PG4 A;  1G4D A;  4KUM A;  4HDV A;  2CWE A;  2LNB A;  4L0Y B;  1U5T B;  4U0Y A;  2ZME B;  3GYH X;  1S7A A;  3MEX A;  1TLH B;  3WGG A;  1GHC A;  2RDP A;  2L4M A;  4I02 A;  3JTG A;  3KLO A;  3TDU C;  1U3E M;  1IN6 A;  2DAO A;  1PP7 U;  5CVJ A;  2M1B A;  3CUQ A;  3IL2 A;  1I5Z A;  4A12 A;  3MZH A;  4MHG A;  1XDU A;  3EYI A;  1OYW A;  1IXR C;  1FP2 A;  5LEJ A;  1XN7 A;  2PMH A;  1R7J A;  2A68 F;  1G6N A;  3ZMZ A;  3P9I A;  4OIO F;  3TOA A;  3I64 A;  2IW5 A;  4L9T A;  1BIA A;  5IT3 A;  3R4K A;  2FU4 A;  3HOS A;  4Y13 A;  3IRR A;  3BY6 A;  4UNO A;  2MBF A;  2H6B A;  5JVT A;  1V4R A;  4M9S A;  2Q8K A;  3TO9 A;  4ETS A;  2KIM A;  2PBI A;  1R1U A;  4LB5 A;  4AIK A;  3K0L A;  4MQV A;  3GFM A;  4CXF A;  5L3F A;  1U5T C;  4G6D A;  4LK1 F;  5LLQ A;  4KYW A;  1XGM A;  1Z6T A;  1HKQ A;  5LBQ A;  2ELH A;  1IRF A;  1P4A A;  3KE2 A;  4I7H A;  4R8H A;  4IXA A;  3W6J B;  4RS8 A;  2DFI A;  2O8X A;  3KLN A;  3J81 Z;  2DBB A;  1FOK A;  1FT9 A;  2W85 A;  1IW7 F;  5E18 F;  3GEZ A;  1ZAR A;  2FOK A;  1C0W A;  2TDX A;  4U0V A;  3E6B A;  5A2Q Z;  2J5P A;  1H9T A;  1KYW A;  3IKT A;  1U2W A;  4P5O A;  5LRS A;  2ESN A;  1MD0 A;  3WE3 A;  2QQA A;  5FD5 A;  1D8K A;  3DP7 A;  4LK0 F;  3EDP A;  2DQL A;  3IHU A;  2FBI A;  3EET A;  2A5Y B;  3P7N A;  2F2E A;  2FRH A;  3LWF A;  4HDU A;  1BC7 C;  2HR3 A;  3C18 A;  1FLI A;  3WTW C;  1R22 A;  2UWM A;  2CSO A;  3RKX A;  1R5G A;  2DQR A;  2BBY A;  4OIN F;  1AOY A;  3FXQ A;  4HW0 A;  2JSC A;  1D3Y A;  1MJB A;  2L01 A;  4I01 A;  2IP2 A;  1J7K A;  1VTN C;  3K2Z A;  2RV8 A;  1F9N A;  5ERI A;  3Q9V A;  4FT8 A;  1R36 A;  3IKV A;  4WCG A;  1L0O C;  1I1G A;  4RB3 C;  4HLX A;  4ZZL A;  2ADU A;  2P5L C;  1Z1D A;  4IJA A;  3KP3 A;  2G7U A;  4BXU A;  4LLG F;  2WTE A;  2RQP A;  2G9W A;  4WK8 F;  1W4M A;  4CIC A;  3F8F A;  2WC2 A;  2J5O A;  1UHM A;  2VXZ A;  3FXU A;  2QYO A;  5BS6 A;  3U1D A;  1OMI A;  2L54 A;  2PN6 A;  4KIB A;  3R0J A;  1BC8 C;  4MTD A;  3LFK A;  4NHJ A;  2E7X A;  4PZJ A;  4ENN A;  1LDK B;  4M71 A;  5DCF A;  2IA0 A;  4CZZ A;  4WXD A;  4KDP A;  2FF4 A;  3FMS A;  4KN7 X;  1T38 A;  1UB9 A;  2DTR A;  3SXY A;  5E20 A;  4ZYH A;  3EYY A;  3ZMU A;  3ROU A;  3E5X A;  4OOI A;  5FD6 A;  2EV0 A;  2Y75 A;  2V6C A;  2D1V A;  3B02 A;  2HWV A;  2VC0 A;  3P9K A;  4HX4 A;  2UXX A;  1P4W A;  2L02 A;  4QLC U;  2R7D A;  3WTY C;  4YFX F;  1BI1 A;  4HAM A;  1B59 A;  1K79 A;  2FEZ A;  4BYY A;  3V7R A;  5K5Q A;  1USS A;  2EA4 A;  3DV8 A;  3SZT A;  1L3L A;  5DUI A;  2HYG D;  4GO1 A;  1BIB A;  4LLL A;  5D4S A;  1SFE A;  1XDS A;  1S7O A;  3DPL C;  2C6Y A;  1X3U A;  2HQR A;  1IN5 A;  4ESB A;  3J80 K;  4YIF A;  3N97 A;  3H3Z A;  3CUO A;  2P6S A;  1WKM A;  5E1Z B;  3S2W A;  1U8R A;  4FHT A;  2VE9 A;  3P9C A;  1B9M A;  4NQW A;  2CG4 A;  2VBX A;  3C3W A;  1MGT A;  4MNU A;  3F8N A;  3M9A A;  1Z05 A;  1R5H A;  3T8R A;  3QU6 A;  2ZKZ A;  4A0Y A;  3I0T A;  1K78 A;  3KZY A;  4L18 B;  2RC4 A;  5HS8 A;  3JTH A;  4M72 A;  3HSF A;  1SD7 A;  2Z99 A;  5ILS A;  4HX8 A;  4JBA A;  4GYI A;  3WGI A;  4EJT A;  4CGZ A;  2HTJ A;  1UHW A;  2UXN A;  1XSX A;  5D8L B;  2XAJ A;  2CQK A;  1PDN C;  5ICC A;  4BHC A;  3RTR A;  2OAZ A;  3HRS A;  2FSW A;  2V9V A;  5D5V B;  3J81 K;  4G7Z F;  1U78 A;  4HF2 A;  3C7J A;  2ESH A;  5HDK A;  2HS5 A;  2Q0O A;  4EM2 A;  2ZO4 A;  4KIC A;  5DCM A;  1E17 A;  1YW9 A;  5A2Q K;  2QZ8 A;  2FA5 A;  3K1M A;  3GX4 X;  1QQI A;  4AIJ A;  3BP8 A;  1GVJ A;  2ZCW A;  4BQA A;  1P92 A;  5K5O A;  4PGG A;  2BE5 F;  3BPX A;  3RKY A;  4ON0 A;  2XRN A;  3SHF A;  3QOP A;  4HV6 A;  2QEN A;  1JE8 A;  1U5T A;  2NS0 A;  2ZME A;  3H92 A;  3I5U A;  3BJ6 A;  5DDG A;  3KEO A;  5HOO A;  3BJO A;  5KVR A;  3E5U A;  4Q48 A;  3RJP A;  3VEP A;  4U7B A;  1CF7 B;  2D2W A;  1SMT A;  4EJW A;  1B4A A;  5D6F A;  2WWY A;  3FMQ A;  3V8K A;  4PDK A;  4RB2 C;  2A07 F;  3KEQ A;  3K1N A;  2Y48 A;  1WRJ A;  4O3M A;  1Z9C A;  2V1U A;  4WXH A;  4PCQ A;  1J59 A;  4YFK F;  2NAZ A;  2MH9 A;  5D4R A;  2E7W A;  1ZLK A;  3WGH A;  1ONV A;  2W84 A;  4RGR A;  1T2K A;  1B6A A;  5FO5 A;  3REO A;  1D8J A;  3GZ6 A;  4KIG A;  4YG2 F;  5EEG A;  2DO7 A;  1S3J A;  2IRF G;  2YR2 A;  1XCB A;  4PGH A;  1ZRD A;  2RVC A;  2GA1 A;  4R79 A;  1LB2 A;  3GO5 A;  4BHP A;  3HHH A;  1HW2 A;  2HDC A;  2PJP A;  1TTY A;  5JFR A;  3GF2 A;  2FQ3 A;  4ZYG A;  2HKX A;  2JRT A;  1R1V A;  1ON1 A;  1D5V A;  3RPU A;  1J9I A;  3B73 A;  1S29 A;  2O03 A;  3LA2 A;  2ZXJ A;  1OPC A;  2K4B A;  2O6G E;  5H20 A;  1MJA A;  4EM0 B;  1O7F A;  1LJ9 A;  1KU2 A;  4H0E A;  3DXJ F;  5HLH A;  4EGY A;  3C1D A;  4UVB A;  3Q5F A;  1T6S A;  3J80 Z;  2O3F A;  3R60 A;  1T0F A;  2VT3 A;  2D45 A;  2ACJ A;  4A6D A;  5HDN A;  2HFH A;  3I54 A;  2XUB A;  3WU1 B;  3QPT A;  1Z6R A;  4RGX A;  2M45 A;  1KU9 A;  2W25 A;  3I59 B;  1KQ8 A;  2A6E F;  3L2C A;  2YSR A;  1SFU A;  4XLN F;  3I53 A;  1ZG3 A;  1O3S A;  2PMU A;  4JK1 X;  4WXC A;  3IWZ A;  4HQM A;  2GAU A;  4G9Y A;  1HST A;  3R6S A;  1HW1 A;  2VT2 A;  2EV5 A;  4GGG A;  1OKR A;  4I0A A;  2PEX A;  2F5F A;  2Y0M A;  3ECH A;  5JHU A;  5LEK A;  1J75 A;  1O7L A;  2H27 A;  3F8M A;  2QVO A;  2NNN A;  3F23 A;  3KP5 A;  1EV7 A;  3BPV A;  3PQJ A;  2B0L A;  3ZPL A;  2XVC A;  4G94 A;  2ZBK A;  2Z3Y A;  4P9U A;  1ZRC A;  3DFG A;  1UST A;  1DP7 P;  3F8C A;  1IN7 A;  5H6Q A;  1FC3 A;  2K02 A;  3ZN1 A;  3WTX C;  3M8F A;  4U0W A;  3U9G A;  2VOP A;  4KA4 A;  4IHT A;  1YYV A;  3I4P A;  1ON2 A;  1HSJ A;  4DNC A;  1FY7 A;  5D5X B;  4RAY A;  4EVI A;  1S8N A;  1PUE E;  3TO7 A;  2VBY A;  5CJ9 A;  1KGS A;  1IAW A;  2GWR A;  1UCR A;  2YU3 A;  3FWE A;  3MQ0 A;  1YW8 A;  4R1H A;  2VE8 A;  2XIG A;  1IUY A;  4ENJ A;  2M8E A;  5JR3 A;  1MDM B;  3GWZ A;  5EEH A;  1TQP A;  3JAM Z;  1U6G A;  1JGS A;  2VC1 A;  4M6X A;  5L3C A;  2XGX A;  5E17 F;  3WTU C;  2Z33 A;  5FLX K;  2EJR A;  3ABT A;  3KCC A;  1JXS A;  1RZ4 A;  4UHT A;  1Z91 A;  2EFQ A;  2XAQ A;  4IF4 A; 
#chains in the Genus database with same CATH topology
 2JA2 A;  2YX7 A;  5F08 A;  2GOM A;  3SFZ A;  1XSD A;  2H8R A;  4XRF A;  2F5D A;  1S6L A;  5K5R A;  3BLY A;  1QPM A;  2R7Z J;  2LH9 A;  1P2F A;  1Y6I A;  2FNA A;  3LAJ A;  2VBW A;  3HTU A;  2VKH A;  4E7L A;  1ZAO A;  2A6H F;  1O57 A;  2DA5 A;  4C2M J;  3FBN B;  3O3K A;  3OIP A;  2P7C B;  1FSH A;  3CTA A;  4OU0 A;  1T0F C;  5C4J J;  2HU9 A;  1OCO H;  1R58 A;  4RB1 A;  1WZ2 A;  1ZK8 A;  3CLQ A;  5TRD A;  2HZD A;  3H9J A;  1IDZ A;  3HPH A;  2K5C A;  2LF8 A;  3AG2 H;  2LMD A;  1ETV A;  2CFX A;  4UUV A;  3MAJ A;  1G3W A;  3GTK J;  3I56 I;  2R7O A;  1SEU A;  3FDY A;  5KAI C;  1IUF A;  1FYL A;  1G3T A;  1K6O A;  2W24 A;  4XON A;  1MMS A;  3GUD A;  1YG2 A;  1KQ9 A;  3Q9S A;  1AWC A;  3RDI A;  2V6E A;  3BTI A;  2EFN A;  1YIO A;  2CV1 A;  5J8F A;  1R71 A;  2RN7 A;  4OIQ F;  1DUX C;  2KJC A;  4HF1 A;  3DLA A;  2GM4 A;  2R5Z B;  2MD5 A;  4ENK A;  3QOE A;  1O3T A;  4M9Z A;  5FKN A;  1SMY F;  3SYT A;  3T1B A;  4QPQ A;  1LPQ A;  2VJJ A;  5M5W J;  1MJ9 A;  4F3Q A;  4P96 A;  1KON A;  1X1P A;  3DKX A;  5DV5 A;  2LKP A;  5E3L A;  5FRM A;  1LVK A;  4ZYA A;  1WJC A;  2DPD A;  2Y69 H;  4JYK A;  1MNM C;  2TRT A;  5ILU A;  2MC3 A;  2MLG A;  3HOZ J;  2COB A;  4OIP F;  5L3E A;  2EZK A;  4CYC B;  2XSD C;  2W7N A;  2B9S A;  1MSE C;  2QM3 A;  4Q47 A;  1ZGJ A;  4HYE A;  1OCT C;  4LIV A;  4RLQ A;  1UMQ A;  2ZFW A;  2MAB A;  1ZGA A;  2IGK A;  1MBJ A;  4M6Y A;  4A5N A;  5ILV A;  3GTP J;  4TV7 A;  4RAZ A;  2FOW A;  3A03 A;  2PFB A;  4O5V A;  3GTQ J;  4L5I A;  4XL9 A;  1MBG A;  5EYR A;  3ZRG A;  2ETH A;  2GBY A;  3JCU C;  4CCN A;  2DTZ A;  1IN8 A;  1BI0 A;  1TWG J;  1UZC A;  1XX5 A;  3DBR B;  4P9F A;  1F5T A;  2AS5 F;  1X1B A;  2XF5 A;  3KP7 A;  1EJ9 A;  2KRF A;  2ZFU A;  3HDD A;  2BYV E;  1IF1 A;  4U87 A;  4ZTF A;  2RNJ A;  3KP6 A;  2DMQ A;  4Y3O A;  1XGS A;  4HQE A;  2DI3 A;  1ZRE A;  2H09 A;  4G6T B;  4BU2 A;  3JRA A;  1YX3 A;  3S3M A;  3AFH A;  2E1M B;  4PSX A;  4I6Z A;  2WAQ N;  5TIS C;  2X0L A;  2JMW A;  1HKT A;  5J1R A;  3PIP F;  3G4S I;  4YII A;  5B3S H;  3J7A Y;  1R23 A;  2JPC A;  2M7B A;  4BKX A;  2KKO A;  4EM1 A;  3J7A O;  3SDB A;  2DYS H;  4PFP A;  1JHH A;  3QYF A;  5H6R A;  1K4T A;  1I50 J;  2YX4 A;  5LHG A;  3NQO A;  3FHZ A;  3M8E A;  3K69 A;  2RNG A;  3GVA A;  1GUU A;  1LNW A;  1TT5 B;  3N4M A;  1I6X A;  2BY0 A;  1YFH A;  3CO6 C;  1WSU A;  1UG2 A;  1A35 A;  4Y15 A;  2RGV A;  3HG9 A;  1E2X A;  3VYU B;  3LSJ A;  4ZJZ A;  1UFM A;  2XRL A;  4M74 A;  1O4X A;  2G0E A;  3PO3 J;  4DGW B;  5CLS A;  2LRD A;  4YEJ A;  3RPQ A;  2KZV A;  4IZZ A;  3S3O A;  2HOT A;  3FXO A;  2GXA A;  2ME6 A;  1V54 H;  4QPO A;  1LE8 A;  3E6C C;  3JRF A;  1X4O A;  1EH6 A;  4LIU A;  4EJU A;  4AM3 A;  4UXN A;  1BN5 A;  2LOO A;  2O7O A;  2WY7 Q;  3HKZ N;  4HA8 A;  2LY9 A;  1FP1 D;  2IA2 A;  4HNT A;  2VN2 A;  1T8I A;  2FXA A;  2VJ5 A;  5FKO A;  3OYM A;  1A04 A;  2XPW A;  4XM3 A;  2CUE A;  3OYC A;  4HOB A;  5DD8 A;  2IGO A;  3PSF A;  3VOD A;  1BJA A;  3H9Q A;  5JI6 A;  5E1X A;  3I4N J;  3ZXS A;  3K4J A;  4IRG A;  1R6R A;  4YRV A;  2A3S A;  1J2X A;  4BNC A;  4W1U A;  1BI2 A;  2ZJR F;  1VQ7 I;  4KJZ A;  2P8T A;  2F4M B;  2EZL A;  2A61 A;  4EMS A;  5E8G A;  1Q1V A;  2FQ4 A;  1YW7 A;  1HDD C;  3JR9 A;  1V3F A;  1SD5 A;  1GT0 C;  1JKO C;  4GCV A;  3HOT A;  1HQC A;  4HV5 A;  1DU0 A;  5GAG J;  3HTS B;  3LQQ A;  2Y0S N;  3UNG C;  1FZP B;  3A02 A;  4DJA A;  1QVT A;  5FFX A;  5EF6 A;  5CVI A;  2E1M C;  1IXS B;  3K6G A;  5DEQ A;  3VSK A;  2ZXI A;  4I09 A;  1A6Q A;  4Z6Y A;  3ZR8 X;  2HTS A;  3CMM A;  2MH2 A;  3DEE A;  3ZQF A;  4DQ2 A;  3F6V A;  2IA1 A;  1IRX A;  4KN4 X;  3HOX J;  2VBZ A;  4G6Q A;  3ABK H;  4CA0 A;  1WH5 A;  1PJR A;  3L09 A;  4ZYE A;  1VQ8 I;  3F3X A;  1HW5 A;  5HS9 A;  1TZL A;  4GFB A;  2DLL A;  4Z2Y A;  4ABZ A;  1JUS A;  5KCM A;  1XB4 A;  3BRO A;  4UVA A;  2ICW G;  4MTE A;  2L3D A;  2VKV A;  1Y1W J;  3Q0U A;  1VQ4 I;  1AKH A;  2E1N A;  4BHB A;  1TWF J;  2KJB A;  4V2F A;  1QZY A;  4IRH A;  2NVX J;  2I5U A;  3JRG A;  4QWQ A;  3OOP A;  2XB0 X;  3TQN A;  1V55 H;  1H9G A;  2QSF X;  5HNH A;  1JGG A;  2E2H J;  1IRG A;  2HKO A;  1WQ2 A;  2LF7 A;  1JKR C;  1G2H A;  2UUZ A;  3D0S A;  3KET A;  5FLX Z;  2JA7 J;  5F6F A;  2QQ8 A;  2CQ7 A;  4HST A;  2OF7 A;  1CF7 A;  2M34 A;  2DU9 A;  1F1Z A;  3DPU A;  3IAM 2;  3RCO A;  3I58 A;  1ZR4 A;  4LMY A;  2M5W A;  1IN4 A;  4BBS J;  1R4N B;  3M1E A;  1B9N A;  3CCV I;  2GA2 A;  3JRH A;  1ZH5 A;  4UUT A;  3SQN A;  4RA2 A;  3GXO A;  3QAH A;  5BPD A;  1AA7 A;  1GXQ A;  1YS7 A;  1XMA A;  2EWN A;  3OR1 C;  4L9J A;  1YRN B;  1QRY A;  3V7S A;  4DYQ A;  2R3S A;  3CO7 C;  9ANT A;  3HSR A;  3X2Q H;  2O0Y A;  1TW2 A;  1SFO J;  1N78 A;  2DCE A;  2X6W A;  3DF8 A;  1WH7 A;  1XCV A;  3KYD B;  3LSP A;  1X4P A;  3NRV A;  4KIT B;  1FBQ A;  1TQM A;  2CYY A;  2Z2S B;  4HZF A;  3L2U A;  3W3C A;  2MA3 A;  1I1S A;  3JW4 A;  1ZKG A;  4D5C A;  2EFW A;  1QBJ A;  1SFX A;  3CC7 I;  2IS1 A;  3OMY A;  5HVQ C;  3CLO A;  4I2O A;  2DMP A;  4HX7 A;  3HIF A;  3BR6 A;  2WA0 A;  2DOE A;  1VND A;  3Q3S A;  3GLX A;  3R61 A;  3V8L A;  4UUS B;  4D7M A;  2X1E A;  1WGX A;  3OV8 A;  2AHQ A;  5FB2 A;  4LLN A;  5GAE J;  4UB8 C;  4ANJ A;  5LGT A;  1BW5 A;  3ZMV A;  1ORK A;  2ID3 A;  3JAM K;  5IT9 Z;  1TNS A;  1HBX G;  3CCL I;  3DKW A;  1D0Y A;  3TP3 A;  4NDL A;  3WTZ A;  2VOD A;  3ISP A;  2VIX A;  5CVR A;  3GZ5 A;  2EFP A;  3H5N A;  4C3J J;  2P6T A;  1S72 I;  2DT6 A;  2FBK A;  2V9P A;  1K7A A;  2W00 A;  1Y8R B;  4MEX F;  2LG4 A;  5E3N A;  2X1C A;  4NB5 A;  5LD2 C;  5FRN A;  4OIR F;  3BR1 A;  1RKT A;  3ZP5 A;  3ZN0 A;  5K1Y A;  2EZI A;  2E60 A;  4AVZ A;  2KRC A;  3S1Q J;  3RYR A;  4LG0 B;  4P55 A;  3I9V 2;  1ETK A;  4DZJ A;  1FOY A;  4MEY F;  1U9O A;  2EK5 A;  2HEO A;  1CGP A;  4M73 A;  1TNT A;  3VWB A;  1JJ6 C;  1TBX A;  1YTY A;  4XR6 A;  1ITY A;  1KU7 A;  2L7Z A;  1FYK A;  1FTZ A;  2Z5U A;  1RIO H;  2E1C A;  1HXD A;  4A3I J;  2JA8 J;  4O6J A;  4G7H F;  4XSZ F;  1FX7 A;  4XN3 A;  5AON A;  2HYF A;  1Y0U A;  1R00 A;  3BTJ A;  2UZK A;  1FPQ A;  3KZZ A;  2P5K A;  1VQO I;  1X58 A;  2DA1 A;  1AHD P;  3K9T A;  2XAS A;  2K27 A;  1KU3 A;  3HBL A;  4B3A A;  2EBI A;  5IYC J;  1FJL A;  1F43 A;  1J0R A;  1D1B A;  1Y0N A;  2M30 A;  3S2D J;  4EGZ A;  5EEA A;  2MD0 A;  1GV2 A;  2ID6 A;  2OZU A;  4UV9 A;  3BR3 A;  3I59 A;  4FQG A;  4IVN A;  2HOS A;  2HQN A;  2K4J A;  2V4J C;  3O6B B;  4HNV A;  1M1E B;  2DT5 A;  2L7M P;  1VQK I;  4IEJ A;  3DTK A;  3LST A;  2R92 J;  4EJO A;  1YJ9 I;  5J1Y A;  4RLF A;  4BJT A;  2VON A;  1KZH A;  3J7Z I;  3HZJ A;  2EFO A;  3K10 A;  1XSV A;  2EA2 A;  3G3Z A;  3IUO A;  2HXI A;  2VKD A;  2X1D A;  5J6X A;  3NEU A;  2O61 A;  1J5Y A;  2CUJ A;  4MFD A;  3AAF A;  2R4G A;  5EGO A;  4A3F J;  3KP4 A;  4FX4 A;  5B66 C;  2BW3 B;  2H1L A;  3M3Y J;  5D8K B;  3TED A;  1LVA A;  4D1Q A;  1REP C;  3WG9 A;  1T08 B;  3E3V A;  3ASN H;  2F6C A;  2I10 A;  2JA5 J;  2FMY A;  4L9N A;  3GCM A;  1PVE A;  3BZC A;  2CUZ A;  1RES A;  3PNT A;  3I3L A;  4MIM A;  5TJJ A;  4G8X A;  2HZT A;  3FIW A;  4F7Z A;  1Q1H A;  3BZ6 A;  5HLG A;  2LLK A;  5J1U A;  1K4S A;  2CW0 F;  1LEA A;  3U1K A;  3DTI A;  5LHH A;  1P9Q C;  1DPR A;  3IAS 2;  2D1H A;  5DS9 A;  4J19 A;  3E97 A;  3QQA A;  1MZB A;  2FML A;  2DFE A;  3CES A;  3PFI A;  3BG5 A;  4W97 A;  2CW7 A;  4BGD A;  4RB0 A;  4YEL A;  3RIR A;  4AYB A;  1D1C A;  4XRS G;  2XPV A;  1MMN A;  2KIS A;  1YHQ I;  3T5X A;  4EJV A;  1FMW A;  4F92 B;  4S05 A;  2DMN A;  5C3E J;  2EH3 A;  2M87 A;  2ZJ2 A;  3ML6 A;  2R7T A;  2VQH A;  1A36 A;  2KFD A;  1W7P B;  3LA3 A;  2TCT A;  2LSO A;  1BW6 A;  4MGR A;  3HRT A;  4C3I J;  1FOX A;  1FEX A;  3HGY A;  3K1P A;  1QO0 D;  5BQT A;  2STT A;  1K6Y A;  2EIJ H;  5FLV A;  2BGC A;  4C3H J;  1I27 A;  3GW2 A;  2COM A;  4S04 A;  1LKX A;  2ECB A;  2AXT C;  2O5R A;  5FLM J;  4A2U A;  5M5Y J;  1YX5 A;  2WB1 A;  5E1W A;  3V4G A;  4E7I A;  4L5E A;  4CO8 A;  3N05 A;  3D5R C;  4RDU A;  4HBL A;  1T39 A;  1WJE A;  2HVQ A;  2CFO A;  3OYF A;  1UJ8 A;  1W5S A;  2EIN H;  5EGO B;  2E36 A;  5FGM A;  3RSN A;  2QSH X;  3EUH A;  4XLF A;  1IRZ A;  3DEW A;  3OYE A;  2BV6 A;  3FXM A;  2E2J J;  1MH4 A;  5HLI A;  2CQN A;  4ZDL A;  1G3Y A;  1MDM A;  1J09 A;  1XMK A;  5DUK A;  2PLY A;  1H89 C;  1ODD A;  5LHI A;  3OYD A;  3ZOB A;  3TDZ C;  2HOE A;  3BJA A;  3OS1 A;  1KQ0 A;  1W7P D;  2Q2E A;  4LGW A;  2IPQ X;  4IHW A;  4EV0 A;  2Y31 A;  2UV1 A;  1HOM A;  4OMZ A;  1NK2 P;  2HOA A;  1D0X A;  5FKM A;  1LDD A;  1T98 A;  2GXG A;  3GFI A;  1SAU A;  3BR0 A;  5B5E C;  5CVU A;  3MZ8 A;  2JK3 A;  2EB7 A;  1VZ0 A;  4B8X A;  2GLO A;  4N9I A;  3CUQ B;  1YI2 I;  4ASN A;  3FM3 A;  4EQQ A;  3MFK A;  4KFC A;  2JVG A;  2EV6 A;  2BOL A;  1UEL B;  2JVH A;  2QLZ A;  4XLA A;  1W0U A;  2OTL I;  2F4O B;  3BCB A;  1APL C;  4KMF A;  3F21 A;  3F8B A;  2G7H A;  3S15 J;  4CCO A;  3FKJ A;  2RKH A;  3W6K B;  1ZHF A;  3G73 A;  4IOC F;  3SZP A;  3M07 A;  2HQA A;  3T8T A;  2LY1 A;  3CDI A;  5DYM A;  2K86 A;  1JHF A;  1PP8 F;  4RM3 A;  4BE2 A;  2DN0 A;  5F64 A;  4CUG A;  2ZNZ A;  4WF2 A;  5J4V A;  2MW8 A;  2Z9O A;  3L2V A;  5J8C A;  4M9X A;  2R7U A;  1SD6 A;  3TKY A;  5HNF A;  5LRR A;  1HKS A;  1WI9 A;  3TL4 X;  3JSP A;  3DKY A;  2DA3 A;  2XKO A;  3WE2 A;  2H1K A;  1TP4 A;  1WJA A;  2IT0 A;  2WV0 A;  2HVR A;  2LP0 A;  2R5Z A;  5CVV A;  3ECO A;  5FKK A;  2V7F A;  3VYS B;  4Q5S F;  2F4I A;  2XAG A;  2KIU A;  2XAH A;  1SC7 A;  3FIS A;  2ELK A;  4CH7 A;  4XLE A;  2ME0 A;  1QHG A;  3GFL A;  1DU6 A;  2QEX I;  1B1B A;  3BQZ A;  3BDD A;  5LGU A;  2QBY A;  3O2P E;  2P4W A;  3DLL F;  2IJL A;  2OQR A;  4A0X A;  3LMM A;  3H9G A;  4A3L J;  3NWT A;  3CCR I;  3IWF A;  3V7C A;  4NNJ A;  4AD9 A;  2ZC2 A;  1EKE A;  1BI3 A;  3BG9 A;  4NBQ A;  3DCF A;  4ZDP A;  1UAA A;  1YJW I;  3COA C;  5B1A H;  2CS3 A;  1U0J A;  3E0J B;  2Q1Z B;  2ISY A;  4A0Z A;  1MH3 A;  2QWW A;  3DBH B;  3EUK L;  3EUA A;  3ZMT A;  4K2E A;  3GTG J;  1ERD A;  1FWZ A;  2GQQ A;  3CUQ C;  1EH7 A;  4XBF A;  1ULY A;  3HXL A;  3EQL F;  3LQR A;  1SFK A;  5D6E A;  2F5C A;  2AXL A;  3BWG A;  1XGN A;  4M3B A;  1W5T A;  3TO6 A;  4ZYD A;  4A3B J;  1YQA A;  4CCM A;  2OTJ I;  2A69 F;  1EH8 A;  2X4H A;  4KIF A;  1FSE A;  4XRM A;  1OR7 A;  3I71 A;  5IT9 K;  3MWM A;  2BXY A;  4F55 A;  1E3O C;  2Y9Z A;  2OV7 A;  1PUF B;  2CUF A;  1OIS A;  4HG2 A;  4CDG A;  4U7D A;  3KZI C;  3KP2 A;  5L3D A;  3FMR A;  2LRE A;  3BCA A;  1B72 B;  2KRH A;  5E8I A;  4XLH A;  4BS9 A;  5KK1 A;  3WTT C;  3EUH C;  4AIH A;  1X19 A;  1W5C C;  2GZW A;  3E5Q A;  2E71 A;  4A5M A;  4MQ9 F;  2XAU A;  3MZY A;  3JRE A;  3PQK A;  3TGN A;  3F9K A;  2R0Q C;  2QBY B;  4E70 A;  4UV8 A;  1NG6 A;  4II2 A;  3WTS C;  4XN0 A;  2AO9 A;  1ZLJ A;  2DPU A;  2KPM A;  1ZN2 A;  3TOB A;  1YO5 C;  3FXR A;  2QUF A;  2XC7 A;  1IXC A;  3OSG A;  4XNF A;  3LOC A;  4LJZ F;  3LL7 A;  1O3R A;  1N77 A;  1RUN A;  5J40 A;  1DPU A;  2ECC A;  1WI3 A;  3IC7 A;  2AQF A;  2L9R A;  3OYH A;  2X85 A;  3RYP A;  4G7O F;  2JZY A;  1KYZ A;  2R7S A;  3QRF F;  2IGN A;  3R0A A;  3KPH A;  3SZG A;  5GTH C;  2XAF A;  3JSO A;  3S1N J;  3LSM A;  2ZXW H;  4A69 C;  1QZE A;  4L5J A;  1F4K A;  1G3S A;  4F52 A;  1B8I B;  1JTY A;  2DK8 A;  5IYD J;  2VUM J;  1IDY A;  2V79 A;  3LAP A;  1RR7 A;  4JOM A;  2RRE A;  3ZQI A;  2LDU A;  5ED4 A;  2NVY J;  3H3U A;  5FJ8 J;  2OBP A;  4B47 A;  5EZH A;  2P81 A;  4YFN F;  2WAQ A;  1O3Q A;  4BE0 A;  1QA6 A;  4KT5 C;  1WFX A;  3GFJ A;  2XRO A;  2VQL A;  2YU9 J;  4X1E A;  3CJQ B;  1ENH A;  4ZZD A;  1H0M A;  1RI7 A;  2BHZ A;  4WX9 A;  5E3M A;  2BVL A;  4U88 A;  1MBH A;  2CW8 A;  4Y17 A;  2PI0 A;  3OIQ A;  2NRA C;  2FX0 A;  1SAX A;  2DDB A;  2FE3 A;  2W57 A;  3QYE A;  1RPW A;  3H5A A;  1SD4 A;  3WU0 A;  2CV2 A;  4N0B A;  1TW3 A;  3K2A A;  4PK4 A;  4RGU A;  3S93 A;  1LEB A;  3PL8 A;  2ZNY A;  3FM5 A;  4N4O B;  4BDY A;  1TQI A;  3MCZ A;  5J47 A;  5DM6 F;  1WJF A;  3ERE D;  2GXB A;  5AIQ A;  1JKP C;  2VPR A;  4PJ0 C;  2VKE A;  1GXP A;  2P5V A;  4JQF A;  4DOZ A;  3QU3 A;  1HDP A;  4CHU A;  4CCL A;  2OJE D;  3E6D A;  3VYT B;  2HGC A;  2KIF A;  1F36 A;  4AWX B;  1QNT A;  2P0W A;  2OQG A;  4FX0 A;  1YJN I;  1ZRF A;  2QQB A;  4IRI A;  3WOD F;  1X3W B;  3E6M A;  3WTV C;  4IKF A;  1UHS A;  4A3C J;  1VF9 A;  2FJ1 A;  2DMT A;  4AVP A;  4OMY A;  3VB2 A;  1MW7 A;  3FXK A;  3A1Y A;  5FFZ A;  2MLK A;  1IZ1 A;  2IS6 A;  3L00 A;  5KNL A;  3FZV A;  2K40 A;  4D9J A;  2NNY A;  2LFB A;  3WU2 C;  3KFW X;  2YPR A;  2FBH A;  3MKY B;  3IH3 A;  2PJR B;  2JPB A;  3D5L A;  3K4M A;  2GIV A;  2HQ5 A;  4IO9 F;  3CD6 I;  4Y33 A;  4HF0 A;  5CPR B;  2NXN B;  2DXI A;  3S14 J;  2DA2 A;  1YRN A;  3CCJ I;  2XV4 S;  3CCS I;  1TT0 A;  2OCE A;  2LC2 A;  4I0B A;  4GYG A;  5D5U B;  5HDG A;  2K7L A;  3FHN A;  1NG7 A;  3H36 A;  3FX3 A;  2NVU B;  4M3E A;  5L3G A;  3V8J A;  2FNP A;  4ZH4 F;  4PFO A;  3W2V A;  2R7R A;  1I3A A;  3HSE A;  3G2B A;  3W6V A;  1BA5 A;  1QGP A;  1OYY A;  1YS6 A;  2MFZ A;  2XKP A;  1CQT A;  4KT6 A;  4LD5 A;  4B09 A;  1I6H J;  1DGW Y;  2IGM A;  3BTC A;  2XF6 A;  2W48 A;  3CCM I;  3FF5 A;  4UUS A;  3H3V K;  1OR7 C;  3ZMD A;  1R49 A;  1MBE A;  3ELK A;  3BT9 A;  2ISZ A;  2CO5 A;  1R1T A;  4E4H A;  2HPM A;  5EG0 B;  1FYM A;  1ZG1 A;  3LSH A;  3BOQ A;  3PM1 A;  4XSX F;  5HS7 A;  2K3F A;  2A05 A;  4N9H A;  3HRM A;  3HOV J;  1I3Q J;  4PJN A;  3QPS A;  1XGO A;  2L4A A;  3ABM H;  4L0Z B;  3DPT A;  4FAS D;  1AU7 A;  5BPI A;  4QSH A;  5F0H A;  3F0C A;  5AIP A;  1LDJ A;  4IPA A;  2V1D A;  3CMY A;  1BOA A;  2H94 A;  3H1C A;  4A3M J;  2OA4 A;  3A0H C;  5ICE A;  3HRU A;  3K4L A;  3KIO A;  5IOY A;  1XPX A;  4NC6 A;  1SAN A;  2R7F A;  1PYV A;  4RGS A;  4LG0 A;  4PUS A;  1P6R A;  2IVM A;  2Y2Z A;  1FBS A;  1QZZ A;  1GLN A;  3M8J A;  1LFB A;  2CH0 A;  3HHG A;  2ZJP F;  3GTO J;  2CGP A;  4F93 B;  5BMZ A;  2ZXH A;  1IJW C;  1JUP A;  3MVP A;  5FRO A;  2LBF B;  2BEO A;  3GLL A;  5JHF A;  4B1R A;  2ZSH B;  3LSI A;  1ZG5 A;  4D0P A;  3CP2 A;  5HOD A;  2XGC A;  1X2N A;  3J7Y J;  3TBI A;  4I99 C;  2M3A A;  4L9V A;  1RNL A;  4Q4Z F;  3M7G A;  4FET A;  3HOW J;  6PAX A;  3BG3 A;  3ZGK A;  2CQQ A;  1JT0 A;  3RKW A;  4NQW B;  5D5W B;  2KIQ A;  3S16 J;  5DD4 A;  4A3G J;  1YIJ I;  2H6C A;  2OUM A;  1Z7U A;  3DTE A;  3ZQ7 A;  4DIQ A;  1NK3 P;  2R7Q A;  4UVC A;  2STW A;  3BG6 A;  4DYC A;  3ZQC A;  2BZT A;  5H2F C;  1BM9 A;  2JWT A;  3GZN B;  4BH9 A;  1GV5 A;  3L9F A;  3DEU A;  4BXX J;  1RUO A;  3HUG A;  2FUG 2;  3PJR A;  3CJN A;  1MKM A;  4KMU X;  1E0E A;  3T0Y A;  3ONQ A;  4IQ4 A;  1ETW A;  3QP5 A;  1K78 B;  2QQ9 A;  2L2O A;  2JTV A;  3GTJ J;  3RI4 A;  2LY2 A;  4C2T A;  4RBO A;  3PUF A;  1ZR2 A;  2JQ7 A;  3L7W A;  5ICF A;  2VLA A;  3QPH A;  2EIK H;  4XLP F;  1NHA A;  1XD7 A;  1X3Z B;  2V1N A;  2BW3 A;  2OZ6 A;  3QP6 A;  4KNY A;  2GOX B;  3RZO J;  1E3H A;  5E3O A;  1X2M A;  3F6O A;  3IRQ A;  5LGN A;  1LQ1 A;  3VFZ A;  2OU2 A;  4GXO A;  4HLY A;  1WWX A;  2F5E A;  3F22 A;  3U2R A;  2E5Z A;  2R5Y B;  4LB6 B;  1FBU A;  1P4X A;  4OAY A;  2OD5 A;  2X48 A;  5BOX A;  3ULQ B;  3KYL A;  1HF0 A;  4QIW N;  2V1X A;  5C44 J;  2P7V B;  1Y56 A;  4I98 B;  4ENM A;  3SFI A;  3DQV C;  3WHB A;  4ESJ A;  4A6E A;  3W2A A;  4IL6 C;  4B43 A;  3F72 A;  3HOY J;  2DW4 A;  1FNN A;  2XHK A;  3ABU A;  4WWC A;  3AKZ A;  4YIR X;  4XOR A;  1X1C A;  3CDH A;  1WHU A;  3OS0 A;  3VOE A;  4IHS A;  3HYI A;  3LA7 A;  1KA8 A;  2A5W A;  2DK5 A;  2IAI A;  1ZYR F;  2NYX A;  1ETY A;  2DJN A;  2JT1 A;  5DCM B;  2HYJ A;  1STZ A;  1W7P A;  5CYV A;  1DDN A;  1IO2 A;  2L5Q A;  4BAC A;  5F1R A;  5TGT A;  1OYI A;  1YLF A;  4LFU A;  2JJ7 A;  1BOB A;  3L2W A;  3HUG B;  4V2G A;  3ESW B;  1BBY A;  2NVT J;  2PQ8 A;  2N8G A;  2X6X A;  3ZMS A;  4NC7 A;  3DBL B;  5ICG A;  2VOO A;  1TWH J;  2DT7 B;  2JUG A;  1QU3 A;  3MMY B;  4CYD A;  2CU7 A;  4ESF A;  5L3B A;  2BY1 A;  4BAY A;  5DTD A;  2BY2 A;  2PG4 A;  3G1O A;  3LFU A;  1G4D A;  4DBR A;  4E7Z A;  2KL4 A;  4XRS A;  2M7A A;  4KUM A;  4HDV A;  2CWE A;  2LNB A;  3S1R J;  1VFC A;  4L0Y B;  1U5T B;  4U0Y A;  1P7J A;  2ZME B;  3GYH X;  1X1D A;  1S7A A;  3MEX A;  1TLH B;  2E5N A;  2OC6 A;  3WGG A;  2O8K A;  1GHC A;  2RDP A;  1V5F A;  2NS8 A;  2Z1D A;  4BJ6 C;  2B7E A;  2XGD A;  1K83 J;  4C2U A;  2L4M A;  1U8B A;  4I02 A;  3JTG A;  3KLO A;  2DA4 A;  3CQZ J;  3TDU C;  2QGU A;  1U3E M;  1TL8 A;  1IN6 A;  2K3P A;  2DAO A;  2L7F P;  1PP7 U;  5CVJ A;  5F04 A;  2LKS A;  3H35 A;  2M1B A;  2VXD A;  3CUQ A;  3WG7 H;  3IL2 A;  3LSK A;  2VQC A;  5IYB J;  4HNU A;  3PIO F;  2XPU A;  2BY3 A;  1I5Z A;  4A12 A;  3MZH A;  5JLX A;  4MHG A;  4CZC A;  3MKW B;  1XDU A;  3EYI A;  1OYW A;  3E7L A;  2HDD A;  1IXR C;  1FP2 A;  5LEJ A;  1XN7 A;  2CQX A;  2PMH A;  1R7J A;  4BQO A;  5J3L A;  1Z3Y A;  3BG7 A;  3JRD A;  4AYB N;  1SVM A;  2WAF A;  3C2G A;  2A68 F;  3CJT B;  3AG1 H;  3TW7 A;  1VQ5 I;  1G6N A;  3ZMZ A;  3P9I A;  1IC8 A;  3TOA A;  4OIO F;  3DWL E;  2K85 A;  1OJL A;  1A31 A;  2E1O A;  3OWT A;  3ZQQ A;  2LK2 A;  3I64 A;  2IW5 A;  2DYR H;  2M0C A;  4L9T A;  1BIA A;  1RRJ A;  5IT3 A;  3R4K A;  4XID A;  3NWS A;  1BL0 A;  3WHC A;  2FU4 A;  1S7E A;  1U9N A;  1EF4 A;  3HOS A;  4Y13 A;  4C30 A;  3IRR A;  2WB1 N;  3BY6 A;  4UNO A;  2MBF A;  4LIT A;  2H6B A;  3AL0 B;  5JVT A;  1Y8Q B;  3CCY A;  1V4R A;  4M9S A;  3KX2 A;  2Q8K A;  4B4C A;  3TO9 A;  4ETS A;  4PSW A;  4E7S A;  2IBD A;  3ERM A;  2KIM A;  5GP9 A;  2PBI A;  1R1U A;  4LB5 A;  4BBR J;  3CZ6 A;  4AIK A;  2VAS A;  3K0L A;  2R7X A;  1BR4 A;  4MQV A;  2HI3 A;  3GFM A;  4CXF A;  5L3F A;  1U5T C;  2ZME C;  4G6D A;  3A01 B;  4LK1 F;  5LLQ A;  4KYW A;  1XGM A;  1Z6T A;  3LNQ A;  1HKQ A;  4BJ5 C;  5LBQ A;  4RAG A;  2ELH A;  2KDZ A;  1IRF A;  1P4A A;  3KE2 A;  4J00 A;  2QF7 A;  3LSG A;  4KIS A;  4N4N B;  1MBF A;  1RET A;  3HB9 A;  4I7H A;  4R8H A;  4IXA A;  1XMX A;  4RS8 A;  3W6J B;  2DFI A;  2BXZ A;  2O8X A;  4Y7N J;  3KLN A;  3J81 Z;  1MMD A;  2DBB A;  3Q0V A;  4OAZ A;  2OPT A;  5FKL A;  1E3P A;  1FOK A;  3O8H A;  4GRI A;  3E1S A;  3RPU D;  3AG4 H;  1FT9 A;  2EIL H;  2W85 A;  3G1L A;  1IW7 F;  5E18 F;  4ZDO A;  2MYS A;  3GEZ A;  1ZAR A;  2FOK A;  1C0W A;  2TDX A;  4U0V A;  3E6B A;  3VSL A;  3Q0W A;  2DDA A;  2F48 A;  5A2Q Z;  2GIZ A;  3H0G J;  3LSR A;  2DA6 A;  2J5P A;  1H9T A;  1KYW A;  3IKT A;  3BTL A;  3PNV A;  1U2W A;  4P5O A;  4OWR B;  1QHH D;  3OYJ A;  5LRS A;  2ESN A;  1MD0 A;  1PUF A;  3WE3 A;  2QQA A;  4PJL A;  3IH4 A;  5F1J A;  1B72 A;  4B48 A;  2ZJQ F;  2PMZ A;  4XQF A;  5CQG A;  5FD5 A;  1D8K A;  4S0H B;  5JLW A;  2E35 A;  3DP7 A;  5K7Z A;  4LK0 F;  3VDX A;  4E7K A;  1FTT A;  4FCY A;  3EDP A;  4C9Y A;  2B63 J;  2DQL A;  3IHU A;  3UR3 C;  2FBI A;  1VI0 A;  3AL0 C;  2KHM A;  3EET A;  2A5Y B;  3P7N A;  2F2E A;  2FRH A;  3LWF A;  3OYB A;  4HDU A;  1BC7 C;  2HR3 A;  1VQ9 I;  1ETX A;  3C18 A;  3S32 A;  1FLI A;  4E7J A;  2R93 J;  3WTW C;  2DA7 A;  1YOV B;  2IS2 A;  5E79 C;  1R22 A;  5J4Y A;  1OLT A;  2UWM A;  2CSO A;  3RKX A;  1R5G A;  2DQR A;  4UB6 C;  3OY9 A;  2BBY A;  4FE4 A;  3FKI J;  2CJJ A;  4OIN F;  1HCR A;  1B8I A;  1AOY A;  1MNE A;  3CF2 A;  3K70 D;  3FXQ A;  4HW0 A;  3OS2 A;  1D0Z A;  2E34 A;  2Y30 A;  3B6C A;  3MKL A;  2JSC A;  2XGE A;  2M0M A;  1BR2 A;  2M4G A;  2ZSI B;  1D3Y A;  1MJB A;  2L01 A;  4I01 A;  4BQQ A;  2IP2 A;  1J7K A;  1VTN C;  3GTM J;  3K2Z A;  2RV8 A;  4BEH A;  1JTX A;  1ZEL A;  1N75 A;  4M3G A;  1F9N A;  1OCP A;  3ASO H;  1Z7L A;  5ERI A;  5HLT A;  3CME I;  3Q9V A;  4FT8 A;  1R36 A;  3IKV A;  2LD5 A;  3HC7 A;  4DYR A;  4WCG A;  1L0O C;  1I1G A;  4RB3 C;  4HLX A;  4ZZL A;  3G71 I;  4XKC A;  1BR1 A;  2ADU A;  1ZGW A;  2P5L C;  5BNG A;  1Z1D A;  4IJA A;  3PFY A;  3KP3 A;  2G7U A;  4BXU A;  4LLG F;  1XG1 A;  2WTE A;  2RQP A;  2G9W A;  2LYC A;  2WY8 Q;  4BY7 J;  4WK8 F;  5GAD J;  3OYN A;  2DOD A;  1W4M A;  4CIC A;  4II3 A;  3F8F A;  2WC2 A;  2J5O A;  2R7W A;  3K70 C;  4MO7 A;  1UHM A;  2VXZ A;  2QSG X;  2BHY A;  4QTR A;  1DQU A;  4XOP A;  2IXS A;  3FXU A;  2QYO A;  5BS6 A;  3U1D A;  2XSJ C;  4G12 A;  5CKT A;  1OMI A;  2L54 A;  2PN6 A;  3QWL A;  3CMA I;  4KIB A;  3GTL J;  5M3M J;  1FIP A;  3R0J A;  3SEQ A;  1BC8 C;  1WVR A;  4MTD A;  3LFK A;  4NHJ A;  2E7X A;  4PZJ A;  1ZTR A;  2EQR A;  4ENN A;  2KQR A;  1LDK B;  2K9M A;  2AQE A;  1YIT I;  4IQJ A;  4M71 A;  5DCF A;  2E2I J;  2IA0 A;  4CZZ A;  1T95 A;  3I4M J;  2QCO A;  4WXD A;  2VL8 A;  4KDP A;  2PJR A;  1OCZ H;  2FF4 A;  3FMS A;  3CCQ I;  4KN7 X;  1T38 A;  1ACI A;  1LUJ B;  2DOA A;  4BEH B;  1UB9 A;  2DTR A;  3SXY A;  5E20 A;  4ZYH A;  4A3D J;  3EYY A;  1OCC H;  3ZMU A;  3ROU A;  3E5X A;  4BY1 J;  2MG4 A;  3FBI B;  4OOI A;  2X6O A;  1D1A A;  2MSY A;  5FD6 A;  4HSR A;  1FIA A;  4LG3 A;  3CCU I;  2EV0 A;  2KDO A;  2W4S A;  5EDN A;  2Y75 A;  3ZQG A;  2V6C A;  2D1V A;  4ZC3 A;  3OIO A;  3B02 A;  2HWV A;  2VI6 A;  2VC0 A;  1R9T J;  3P9K A;  2K9N A;  4HX4 A;  1TWC J;  2UXX A;  1P4W A;  4FE7 A;  2L02 A;  4H4K C;  3CF5 F;  4QLC U;  3ABL H;  1HC8 A;  1JT6 A;  3GME A;  5EG0 A;  1X1A A;  1R4M B;  2R7D A;  1W1W E;  1POG A;  2DJI A;  2JSP A;  2NS7 A;  3OOU A;  3WTY C;  2H8W A;  1ETQ A;  2WV1 A;  4YFX F;  1BI1 A;  4HAM A;  1B59 A;  1V5G A;  1K79 A;  2FEZ A;  3L2Q A;  4BYY A;  1DGR M;  2ZB9 A;  1USS A;  3HKZ A;  3V7R A;  2EA4 A;  2W1O A;  3QOD A;  5K5Q A;  3DV8 A;  2V9K A;  1XC5 A;  3S1M J;  3SZT A;  3GBG A;  1L3L A;  3UKG A;  3VYR B;  5DUI A;  2HYG D;  4GO1 A;  3L1P A;  1BIB A;  4LLL A;  3CC2 I;  5D4S A;  3FK7 A;  1SFE A;  2VQG A;  3BZK A;  1XDS A;  1S7O A;  3DPL C;  2C6Y A;  2LR8 A;  2HNH A;  3ZQL A;  2F5V A;  1X3U A;  2HQR A;  1IN5 A;  4ESB A;  3J80 K;  1UG0 A;  1W36 D;  2VPL A;  4YIF A;  3N97 A;  1QVU A;  2LBF A;  2OCC H;  3H3Z A;  3CUO A;  3NAR A;  2P6S A;  1JI8 A;  1WKM A;  3BR2 A;  5E1Z B;  1N25 A;  3TP0 A;  3G6E I;  3IH2 A;  3BC8 A;  4JX5 A;  4AID A;  3S2W A;  1U8R A;  4FHT A;  4A3J J;  2WAE A;  2VE9 A;  2NOJ B;  4M3D A;  3CP8 A;  2Y0S A;  3P9C A;  4XOT A;  1W0T A;  3FK6 A;  3MN2 A;  3NAU A;  1B9M A;  4NQW A;  2CG4 A;  3CC4 I;  4J01 A;  2VBX A;  1Z3X A;  3HM5 A;  1JUM A;  4GDF A;  1WJD A;  3C3W A;  1MGT A;  3KEY A;  4MNU A;  3F8N A;  3M9A A;  2W82 A;  1Z05 A;  1EA3 A;  5F0F A;  3SJM A;  3SDG A;  1IV8 A;  4V19 K;  1R5H A;  4FTH A;  5EJC A;  3T8R A;  3QU6 A;  1G8X A;  1OFC X;  2ZKZ A;  4A0Y A;  3I0T A;  1K78 A;  5B1B H;  2DFH A;  3KZY A;  4L18 B;  2RC4 A;  5HS8 A;  3JTH A;  4P1W A;  4M72 A;  3IP4 B;  4NUB A;  4RMN A;  3OYA A;  3OYK A;  1W36 C;  3ZCO A;  4ZTJ A;  3HSF A;  1LFU P;  1P7I A;  1SD7 A;  2Z99 A;  5ILS A;  5K7H A;  4HX8 A;  3AG3 H;  4JBA A;  4GYI A;  1RKW A;  3WGI A;  4EJT A;  2CMP A;  4CGZ A;  1LE8 B;  4HEA 2;  2HTJ A;  3H5R A;  1UHW A;  2R5Y A;  1FMV A;  3EPZ A;  2UXN A;  1XSX A;  1MMG A;  5D8L B;  2XAJ A;  2CQK A;  1PDN C;  4B3X A;  2DMU A;  5ICC A;  2HPI A;  4BHC A;  5GAH J;  4XLC A;  1T33 A;  4CCJ A;  3RTR A;  3PO2 J;  1JJ8 C;  2OAZ A;  3HRS A;  2FSW A;  2JRM A;  4E7H A;  4E6K G;  1FOW A;  1YE9 A;  3H0D A;  2NOG A;  4D5F A;  2V9V A;  2MGQ A;  5D5V B;  3J81 K;  5DM7 F;  2ELJ A;  2EPF A;  4G7Z F;  1U78 A;  4HF2 A;  3C7J A;  2ESH A;  2RQQ A;  5HDK A;  2KLO A;  4BQN A;  2HS5 A;  3DU5 A;  4IX7 A;  2Q0O A;  1VQ6 I;  4EM2 A;  2ZO4 A;  4BXF A;  4KIC A;  3S17 J;  4MLO A;  5DCM A;  3K7A J;  4IHX A;  1E17 A;  4M3F A;  1YW9 A;  2QA4 I;  5A2Q K;  3HL2 A;  2QZ8 A;  3KYC B;  4F91 B;  1WPK A;  2FA5 A;  3K1M A;  1WCM J;  2YUS A;  1R5I D;  5M3F J;  3TMO A;  3IV5 A;  3GX4 X;  1QQI A;  3O8G A;  4AIJ A;  3BP8 A;  4XKW A;  1GVJ A;  2ZCW A;  4BQA A;  1MSF C;  3OR2 C;  1P92 A;  5K5O A;  2IS4 A;  2DFF A;  1G59 A;  4PGG A;  2BE5 F;  2YS9 A;  3BPX A;  2KZG A;  4DZP A;  4XMY A;  3RKY A;  4ON0 A;  3S8P A;  2XRN A;  5C4X J;  3C2B A;  3SHF A;  3QOP A;  4HV6 A;  1WJB A;  2QEN A;  4Y4R A;  2A6T A;  3OYI A;  1AKH B;  2LVS A;  1JE8 A;  1U5T A;  2M8G X;  1Z67 A;  2NS0 A;  2ZME A;  3H92 A;  3I5U A;  5IPA A;  3JRB A;  5K7F A;  1I39 A;  3BJ6 A;  2VJI A;  5DDG A;  2NVQ J;  1DP3 A;  3KEO A;  3VPR A;  4BUP A;  2M2E A;  5HOO A;  3BJO A;  3TW6 A;  2L9V A;  5KVR A;  3E5U A;  5JVG F;  1XS9 A;  3CDL A;  4Q48 A;  3RJP A;  3VEP A;  4U7B A;  3RKQ A;  2D2W A;  1CF7 B;  2MC4 A;  1SMT A;  2K9L A;  1B4A A;  4EJW A;  1H8A C;  2HXO A;  2KMU A;  5D6F A;  1RR8 C;  2WWY A;  3FMQ A;  1V5E A;  5EZG A;  3V8K A;  3OYL A;  4PDK A;  4RB2 C;  2A07 F;  3KEQ A;  3K1N A;  2Y48 A;  1WRJ A;  4O3M A;  2RAE A;  1Z9C A;  2IEK A;  2WBM A;  2V1U A;  4WXH A;  5GPC A;  4PCQ A;  1SVO A;  1J59 A;  4YFK F;  2NAZ A;  2MH9 A;  5D4R A;  2E7W A;  1ZLK A;  4RM2 A;  1BJZ A;  3WGH A;  4I76 A;  4HPQ A;  1ONV A;  2I8D A;  3QPL A;  2W84 A;  3JRC A;  4RGR A;  3HEF A;  1B6A A;  1T2K A;  3JRI A;  5FO5 A;  3REO A;  1D8J A;  3GZ6 A;  4KIG A;  4YG2 F;  1Z77 A;  5EEG A;  5IP9 J;  4XK4 A;  4JX6 A;  4D7N A;  1WJ5 A;  3K4K A;  2LKX A;  2DO7 A;  4JX4 A;  1S3J A;  3P5J A;  5IP7 J;  2IRF G;  4BL0 B;  3BR5 A;  2YR2 A;  1XCB A;  4PGH A;  2L7K A;  1ZRD A;  2RVC A;  2GA1 A;  4R79 A;  1LB2 A;  2FD5 A;  2M9H A;  3GO5 A;  3HHH A;  4BHP A;  1HW2 A;  2HDC A;  1MND A;  1RC9 A;  1XTA A;  2PJP A;  1LFP A;  1TTY A;  2WAD A;  3OL4 A;  3GF2 A;  2FQ3 A;  2XDV A;  5JFR A;  1IV6 A;  1Y1V J;  4ZYG A;  4HRI A;  2HKX A;  2JRT A;  1R1V A;  1ON1 A;  1D5V A;  3HJE A;  4ITV A;  3RPU A;  5IY5 H;  2QKL B;  2DOF A;  1J9I A;  1VQM I;  1MBK A;  5F0C A;  4LOC A;  2V26 A;  3B73 A;  4PJM A;  4Y52 J;  3C2H A;  1MIJ A;  2BVM A;  4EAT A;  1S29 A;  4B44 A;  2K9S A;  2O03 A;  2QKM B;  3LA2 A;  3MD2 A;  4AU7 A;  4A3E J;  2ZXJ A;  2X51 A;  3SEZ A;  1Z21 A;  1OPC A;  2K4B A;  2O6G E;  5H20 A;  1SVL A;  3A01 A;  1MJA A;  3QYB A;  4EM0 B;  4EEF G;  2L9N A;  1O7F A;  2XF7 A;  1LJ9 A;  3HGG A;  1KU2 A;  3OL3 A;  1TWA J;  4H0E A;  3DXJ F;  2HVS A;  1MMA A;  5HLH A;  4EGY A;  1Y39 A;  3C1D A;  4UVB A;  3Q5F A;  4DBQ A;  3W2W A;  1T6S A;  5GPA A;  3J80 Z;  2JN6 A;  2O3F A;  3R60 A;  1T0F A;  2VT3 A;  4RAF A;  2E19 A;  1TC3 C;  2D45 A;  2ACJ A;  4A6D A;  5IP6 A;  1S9H A;  1IG7 A;  5HDN A;  2HFH A;  3I54 A;  1QPI A;  2XUB A;  3WU1 B;  2PX9 A;  3QPT A;  1Z6R A;  4RGX A;  2JA6 J;  2M45 A;  1T56 A;  1OCR H;  1KU9 A;  2W25 A;  3I59 B;  1KQ8 A;  2A6E F;  4X6A J;  3L2C A;  2YSR A;  2HDW A;  1SFU A;  4XLN F;  5GTI C;  3I53 A;  1ZG3 A;  1JKQ C;  2VJ4 A;  1O3S A;  2PMU A;  1ETO A;  4JK1 X;  3BQY A;  4WXC A;  3RQ4 A;  3IWZ A;  4HQM A;  4UY8 I;  2GAU A;  4G9Y A;  3MKZ A;  1HST A;  3R6S A;  1HW1 A;  3RQI A;  1GDT A;  3OYG A;  2VT2 A;  1D5Y A;  3CJR B;  2EV5 A;  4GGG A;  4BDZ A;  5F27 A;  1OKR A;  4I0A A;  2PEX A;  3FXJ A;  1GVD A;  5IOZ A;  2Z16 A;  4PJJ A;  2F5F A;  3D5S C;  1HA8 A;  2Y0M A;  2D5V A;  3ECH A;  5JHU A;  5LEK A;  1J75 A;  1O7L A;  2H27 A;  1OQY A;  3F8M A;  2K9Q A;  3PNY A;  2QVO A;  2NNN A;  3F23 A;  2CV0 A;  3A0B C;  3KP5 A;  1EV7 A;  3BPV A;  3A4C A;  1IGN A;  1H88 C;  3PQJ A;  2B0L A;  3S3N A;  3ZPL A;  1VQN I;  2XVC A;  4X0G A;  4G94 A;  4CSW A;  2ZBK A;  2Z3Y A;  4P9U A;  1ZRC A;  3DFG A;  1UST A;  3PSI A;  1DP7 P;  4MFE A;  3F8C A;  5LFA A;  4FIS A;  4XKV A;  1IN7 A;  3HOU J;  3HPG A;  5H6Q A;  4XIC A;  1FC3 A;  2K02 A;  3ZN1 A;  4AUX A;  3WTX C;  2KT0 A;  3K4N A;  3M8F A;  4U0W A;  3U9G A;  2VOP A;  3V42 A;  2VB6 A;  4KA4 A;  4IOA F;  2LTP A;  4IHV A;  3A2K A;  4IHT A;  1YYV A;  3I4P A;  1ON2 A;  3RZD J;  3M4O J;  4DW6 A;  1HSJ A;  2O9L A;  3OSF A;  5KHD A;  1A6I A;  4DNC A;  2CRG A;  1FY7 A;  2XB5 A;  5D5X B;  5CQE A;  1ZQ3 P;  2M4K A;  4RAY A;  4EVI A;  5M5X J;  1A5J A;  4A93 J;  1S8N A;  1PUE E;  3TO7 A;  2VBY A;  4M6V A;  4NC8 A;  3PUB A;  5CJ9 A;  1KGS A;  3D1N I;  2R7V A;  1IAW A;  3I55 I;  2L9S A;  4A3K J;  1VQP I;  5KAF C;  2GWR A;  3FXL A;  3CCE I;  1UCR A;  2KP6 A;  2YU3 A;  2X9D A;  3FWE A;  4XKB A;  3MQ0 A;  1YW8 A;  1NH3 A;  1HLV A;  1VQL I;  4R1H A;  2EIM H;  2VE8 A;  2XIG A;  3U21 A;  1IUY A;  4AC0 A;  4ENJ A;  3G1M A;  2M8E A;  3ZQH A;  5JR3 A;  2PMZ N;  1MDM B;  3GWZ A;  3B6A A;  5EEH A;  1K61 A;  1TQP A;  3JAM Z;  1U6G A;  1JGS A;  2VC1 A;  2Y9Y A;  4BE1 A;  2JUC A;  4M6X A;  5L3C A;  3K4C A;  2L0K A;  2XGX A;  5E17 F;  2X6Y A;  4JP0 A;  3K4B A;  3WTU C;  2Z33 A;  5FLX K;  4CCK A;  2EJR A;  1S5L C;  2Q2E B;  2EZH A;  3ABT A;  3KCC A;  1JXS A;  1Z0X A;  1RZ4 A;  4UHT A;  3L2R A;  4CYC A;  3M1C A;  4IHY A;  3S2H J;  1Z91 A;  1NTC A;  2EFQ A;  2XAQ A;  3DU6 A;  4IF4 A; 
#chains in the Genus database with same CATH homology
 2YX7 A;  3SFZ A;  1XSD A;  4XRF A;  2F5D A;  1S6L A;  5K5R A;  1QPM A;  1P2F A;  2FNA A;  3LAJ A;  2VBW A;  3HTU A;  2A6H F;  1ZAO A;  1O57 A;  1FSH A;  2P7C B;  3O3K A;  3CTA A;  4OU0 A;  1R58 A;  4RB1 A;  5TRD A;  2LF8 A;  4UUV A;  2CFX A;  3MAJ A;  1G3W A;  1FYL A;  1G3T A;  1K6O A;  2W24 A;  3GUD A;  1YG2 A;  1KQ9 A;  3Q9S A;  1AWC A;  3RDI A;  2EFN A;  1YIO A;  5J8F A;  2RN7 A;  4OIQ F;  1DUX C;  2KJC A;  4HF1 A;  2MD5 A;  4ENK A;  1O3T A;  4M9Z A;  1SMY F;  3T1B A;  1MJ9 A;  4P96 A;  5DV5 A;  2LKP A;  2DPD A;  5ILU A;  2MC3 A;  2MLG A;  4OIP F;  5L3E A;  2QM3 A;  4Q47 A;  1ZGJ A;  4HYE A;  2ZFW A;  1ZGA A;  4M6Y A;  4A5N A;  5ILV A;  4TV7 A;  4RAZ A;  2PFB A;  4O5V A;  4L5I A;  2ETH A;  1IN8 A;  1BI0 A;  4P9F A;  1F5T A;  2AS5 F;  3KP7 A;  2KRF A;  2BYV E;  1IF1 A;  2RNJ A;  3KP6 A;  1XGS A;  4HQE A;  2DI3 A;  1ZRE A;  2H09 A;  2X0L A;  1HKT A;  4YII A;  1R23 A;  2JPC A;  2KKO A;  4EM1 A;  3J7A O;  1JHH A;  5H6R A;  2YX4 A;  5LHG A;  3NQO A;  3FHZ A;  3M8E A;  3K69 A;  3GVA A;  1LNW A;  3N4M A;  1YFH A;  1WSU A;  1I6X A;  3CO6 C;  4Y15 A;  2RGV A;  1E2X A;  1UFM A;  4M74 A;  5CLS A;  3RPQ A;  3E6C C;  1EH6 A;  4EJU A;  4UXN A;  1BN5 A;  4HA8 A;  1FP1 D;  2IA2 A;  2VN2 A;  2FXA A;  1A04 A;  4HOB A;  5DD8 A;  3VOD A;  1BJA A;  5JI6 A;  5E1X A;  4IRG A;  2A3S A;  1J2X A;  4BNC A;  1BI2 A;  2P8T A;  4EMS A;  2A61 A;  5E8G A;  1YW7 A;  1V3F A;  1SD5 A;  4GCV A;  3HOT A;  1HQC A;  4HV5 A;  3HTS B;  3LQQ A;  1FZP B;  5FFX A;  5CVI A;  5DEQ A;  1IXS B;  4I09 A;  2HTS A;  4DQ2 A;  2MH2 A;  3F6V A;  2IA1 A;  4KN4 X;  2VBZ A;  4G6Q A;  3L09 A;  4ZYE A;  3F3X A;  1HW5 A;  5HS9 A;  2DLL A;  4Z2Y A;  1XB4 A;  3BRO A;  4UVA A;  4MTE A;  2L3D A;  2E1N A;  4BHB A;  2KJB A;  1QZY A;  4IRH A;  4QWQ A;  3OOP A;  3TQN A;  1H9G A;  1IRG A;  2HKO A;  1WQ2 A;  2LF7 A;  3D0S A;  3KET A;  5FLX Z;  5F6F A;  1CF7 A;  2DU9 A;  1F1Z A;  3I58 A;  4LMY A;  2M5W A;  1IN4 A;  3M1E A;  1B9N A;  2GA2 A;  1ZH5 A;  3SQN A;  3GXO A;  3QAH A;  5BPD A;  1GXQ A;  1YS7 A;  1XMA A;  2EWN A;  4L9J A;  3V7S A;  2R3S A;  3CO7 C;  3HSR A;  2O0Y A;  1TW2 A;  3DF8 A;  1XCV A;  3NRV A;  1FBQ A;  1TQM A;  2CYY A;  4HZF A;  2MA3 A;  1I1S A;  3JW4 A;  1QBJ A;  2EFW A;  1SFX A;  5HVQ C;  3CLO A;  4I2O A;  4HX7 A;  3HIF A;  3GLX A;  3R61 A;  3V8L A;  3OV8 A;  5FB2 A;  4LLN A;  5LGT A;  3ZMV A;  3JAM K;  5IT9 Z;  1TNS A;  1HBX G;  3DKW A;  3WTZ A;  2VOD A;  3ISP A;  5CVR A;  3GZ5 A;  2EFP A;  2P6T A;  2FBK A;  1K7A A;  4MEX F;  4NB5 A;  4OIR F;  3ZP5 A;  3ZN0 A;  5K1Y A;  3RYR A;  4LG0 B;  4P55 A;  4MEY F;  2EK5 A;  2HEO A;  1CGP A;  4M73 A;  1TNT A;  1TBX A;  1YTY A;  1KU7 A;  1FYK A;  2Z5U A;  1RIO H;  2E1C A;  1HXD A;  4O6J A;  4G7H F;  4XSZ F;  1FX7 A;  5AON A;  2HYF A;  1Y0U A;  1R00 A;  2UZK A;  1FPQ A;  3KZZ A;  2P5K A;  3K9T A;  2XAS A;  2K27 A;  1KU3 A;  1J0R A;  2M30 A;  4EGZ A;  2OZU A;  4UV9 A;  3I59 A;  4IVN A;  2HQN A;  2K4J A;  3O6B B;  2DT5 A;  3LST A;  4EJO A;  2VON A;  2EFO A;  1XSV A;  2EA2 A;  3G3Z A;  5J6X A;  3NEU A;  2O61 A;  1J5Y A;  3AAF A;  3KP4 A;  4FX4 A;  5D8K B;  1LVA A;  1REP C;  3WG9 A;  3E3V A;  2FMY A;  4L9N A;  5TJJ A;  4G8X A;  2HZT A;  4F7Z A;  1Q1H A;  3BZ6 A;  5HLG A;  2CW0 F;  1LEA A;  5LHH A;  1DPR A;  2D1H A;  3E97 A;  1MZB A;  2FML A;  3PFI A;  4RB0 A;  3RIR A;  3T5X A;  4EJV A;  4S05 A;  2M87 A;  2ZJ2 A;  3ML6 A;  1W7P B;  3LA3 A;  2LSO A;  4MGR A;  3HRT A;  3K1P A;  1QO0 D;  5BQT A;  2STT A;  2BGC A;  1I27 A;  3GW2 A;  2COM A;  4S04 A;  4A2U A;  5E1W A;  3V4G A;  4CO8 A;  4HBL A;  1T39 A;  1W5S A;  5FGM A;  3EUH A;  2BV6 A;  5HLI A;  1G3Y A;  1MDM A;  1XMK A;  5DUK A;  2PLY A;  1ODD A;  5LHI A;  3TDZ C;  2HOE A;  3BJA A;  1KQ0 A;  1W7P D;  2Q2E A;  4LGW A;  2IPQ X;  4EV0 A;  4OMZ A;  1LDD A;  1T98 A;  2GXG A;  3GFI A;  5CVU A;  2EB7 A;  4B8X A;  4N9I A;  3CUQ B;  4ASN A;  3FM3 A;  4EQQ A;  3MFK A;  4KFC A;  2EV6 A;  2QLZ A;  4KMF A;  3F21 A;  3F8B A;  2G7H A;  3W6K B;  2RKH A;  1ZHF A;  3G73 A;  3SZP A;  3T8T A;  5DYM A;  2K86 A;  1JHF A;  1PP8 F;  5F64 A;  2ZNZ A;  4WF2 A;  2Z9O A;  5J8C A;  4M9X A;  1SD6 A;  3TKY A;  5LRR A;  1HKS A;  1WI9 A;  3JSP A;  2XKO A;  3WE2 A;  2IT0 A;  2WV0 A;  5CVV A;  3ECO A;  4Q5S F;  2XAG A;  2KIU A;  2XAH A;  3GFL A;  1B1B A;  3BDD A;  5LGU A;  2QBY A;  3O2P E;  2P4W A;  2IJL A;  2OQR A;  4A0X A;  3IWF A;  3V7C A;  4AD9 A;  1BI3 A;  3COA C;  2ISY A;  4A0Z A;  2QWW A;  3ZMT A;  4K2E A;  1FWZ A;  2GQQ A;  3CUQ C;  1EH7 A;  4XBF A;  1ULY A;  3EQL F;  3LQR A;  5D6E A;  2F5C A;  2AXL A;  3BWG A;  1XGN A;  1W5T A;  3TO6 A;  4ZYD A;  1YQA A;  2A69 F;  1EH8 A;  2X4H A;  4KIF A;  1FSE A;  1OR7 A;  3I71 A;  5IT9 K;  3MWM A;  4CDG A;  4U7D A;  3KP2 A;  5L3D A;  3FMR A;  5E8I A;  5KK1 A;  3WTT C;  4AIH A;  2GZW A;  3E5Q A;  4A5M A;  4MQ9 F;  3MZY A;  3PQK A;  3TGN A;  2QBY B;  4E70 A;  4UV8 A;  3WTS C;  1ZLJ A;  2DPU A;  1ZN2 A;  3TOB A;  1YO5 C;  3FXR A;  2QUF A;  1IXC A;  4LJZ F;  1O3R A;  1RUN A;  1DPU A;  3IC7 A;  3RYP A;  4G7O F;  2JZY A;  1KYZ A;  3QRF F;  3R0A A;  3JSO A;  2XAF A;  4L5J A;  1F4K A;  1G3S A;  2DK8 A;  2V79 A;  3LAP A;  5ED4 A;  2LDU A;  3H3U A;  2OBP A;  4YFN F;  1O3Q A;  4KT5 C;  3GFJ A;  2XRO A;  4ZZD A;  1H0M A;  1RI7 A;  4WX9 A;  4U88 A;  4Y17 A;  2PI0 A;  2NRA C;  1SAX A;  2FE3 A;  2W57 A;  1SD4 A;  3WU0 A;  4N0B A;  1TW3 A;  4RGU A;  1LEB A;  2ZNY A;  3FM5 A;  1TQI A;  3MCZ A;  3ERE D;  2GXB A;  5AIQ A;  1GXP A;  2P5V A;  4JQF A;  3QU3 A;  4CHU A;  3E6D A;  2HGC A;  2KIF A;  4AWX B;  1QNT A;  2OQG A;  4FX0 A;  1ZRF A;  2QQB A;  4IRI A;  3WOD F;  3E6M A;  3WTV C;  4AVP A;  4OMY A;  3VB2 A;  5FFZ A;  2MLK A;  1IZ1 A;  3L00 A;  3FZV A;  2NNY A;  3KFW X;  2YPR A;  2FBH A;  2JPB A;  3D5L A;  2GIV A;  4HF0 A;  2XV4 S;  4I0B A;  4GYG A;  5D5U B;  5HDG A;  2K7L A;  5L3G A;  3FX3 A;  3V8J A;  2FNP A;  4ZH4 F;  3HSE A;  1QGP A;  1OYY A;  1YS6 A;  2XKP A;  4LD5 A;  4B09 A;  3FF5 A;  3ZMD A;  3ELK A;  2ISZ A;  2CO5 A;  1R1T A;  1FYM A;  1ZG1 A;  3BOQ A;  5HS7 A;  4XSX F;  4N9H A;  3HRM A;  1XGO A;  2L4A A;  4L0Z B;  3DPT A;  5BPI A;  5AIP A;  1LDJ A;  4IPA A;  2V1D A;  1BOA A;  2H94 A;  2OA4 A;  5ICE A;  3HRU A;  2R7F A;  4RGS A;  4LG0 A;  1P6R A;  2IVM A;  1FBS A;  1QZZ A;  3HHG A;  2CGP A;  5BMZ A;  2BEO A;  1ZG5 A;  4D0P A;  4L9V A;  1RNL A;  4Q4Z F;  3M7G A;  6PAX A;  3RKW A;  5D5W B;  5DD4 A;  2H6C A;  1Z7U A;  3ZQ7 A;  4UVC A;  2STW A;  1BM9 A;  4BH9 A;  3L9F A;  3DEU A;  1RUO A;  3HUG A;  3CJN A;  1MKM A;  4KMU X;  3T0Y A;  3QP5 A;  1K78 B;  2QQ9 A;  2JTV A;  3RI4 A;  3L7W A;  5ICF A;  3QPH A;  4XLP F;  1NHA A;  1XD7 A;  2OZ6 A;  3QP6 A;  4KNY A;  3F6O A;  3IRQ A;  5LGN A;  1LQ1 A;  3VFZ A;  2OU2 A;  4GXO A;  4HLY A;  1WWX A;  2F5E A;  3F22 A;  3U2R A;  4LB6 B;  1FBU A;  1P4X A;  2OD5 A;  5BOX A;  3ULQ B;  2V1X A;  2P7V B;  4I98 B;  4ENM A;  3DQV C;  4ESJ A;  4A6E A;  3F72 A;  2DW4 A;  1FNN A;  2XHK A;  3ABU A;  4WWC A;  3CDH A;  3VOE A;  4IHS A;  3HYI A;  3LA7 A;  1KA8 A;  2DK5 A;  1ZYR F;  2NYX A;  2JT1 A;  5DCM B;  1STZ A;  1W7P A;  5CYV A;  1DDN A;  5F1R A;  1OYI A;  1YLF A;  4LFU A;  1BBY A;  2PQ8 A;  3ZMS A;  5ICG A;  2VOO A;  4CYD A;  4ESF A;  5L3B A;  4BAY A;  2PG4 A;  1G4D A;  4KUM A;  4HDV A;  2CWE A;  2LNB A;  4L0Y B;  1U5T B;  4U0Y A;  2ZME B;  3GYH X;  1S7A A;  3MEX A;  1TLH B;  3WGG A;  1GHC A;  2RDP A;  2L4M A;  4I02 A;  3JTG A;  3KLO A;  3TDU C;  1U3E M;  1IN6 A;  2DAO A;  1PP7 U;  5CVJ A;  2M1B A;  3CUQ A;  3IL2 A;  1I5Z A;  4A12 A;  3MZH A;  4MHG A;  1XDU A;  3EYI A;  1OYW A;  1IXR C;  1FP2 A;  5LEJ A;  1XN7 A;  2PMH A;  1R7J A;  2A68 F;  1G6N A;  3ZMZ A;  3P9I A;  4OIO F;  3TOA A;  3I64 A;  2IW5 A;  4L9T A;  1BIA A;  5IT3 A;  3R4K A;  2FU4 A;  3HOS A;  4Y13 A;  3IRR A;  3BY6 A;  4UNO A;  2MBF A;  2H6B A;  5JVT A;  1V4R A;  4M9S A;  2Q8K A;  3TO9 A;  4ETS A;  2KIM A;  2PBI A;  1R1U A;  4LB5 A;  4AIK A;  3K0L A;  4MQV A;  3GFM A;  4CXF A;  5L3F A;  1U5T C;  4G6D A;  4LK1 F;  5LLQ A;  4KYW A;  1XGM A;  1Z6T A;  1HKQ A;  5LBQ A;  2ELH A;  1IRF A;  1P4A A;  3KE2 A;  4I7H A;  4R8H A;  4IXA A;  3W6J B;  4RS8 A;  2DFI A;  2O8X A;  3KLN A;  3J81 Z;  2DBB A;  1FOK A;  1FT9 A;  2W85 A;  1IW7 F;  5E18 F;  3GEZ A;  1ZAR A;  2FOK A;  1C0W A;  2TDX A;  4U0V A;  3E6B A;  5A2Q Z;  2J5P A;  1H9T A;  1KYW A;  3IKT A;  1U2W A;  4P5O A;  5LRS A;  2ESN A;  1MD0 A;  3WE3 A;  2QQA A;  5FD5 A;  1D8K A;  3DP7 A;  4LK0 F;  3EDP A;  2DQL A;  3IHU A;  2FBI A;  3EET A;  2A5Y B;  3P7N A;  2F2E A;  2FRH A;  3LWF A;  4HDU A;  1BC7 C;  2HR3 A;  3C18 A;  1FLI A;  3WTW C;  1R22 A;  2UWM A;  2CSO A;  3RKX A;  1R5G A;  2DQR A;  2BBY A;  4OIN F;  1AOY A;  3FXQ A;  4HW0 A;  2JSC A;  1D3Y A;  1MJB A;  2L01 A;  4I01 A;  2IP2 A;  1J7K A;  1VTN C;  3K2Z A;  2RV8 A;  1F9N A;  5ERI A;  3Q9V A;  4FT8 A;  1R36 A;  3IKV A;  4WCG A;  1L0O C;  1I1G A;  4RB3 C;  4HLX A;  4ZZL A;  2ADU A;  2P5L C;  1Z1D A;  4IJA A;  3KP3 A;  2G7U A;  4BXU A;  4LLG F;  2WTE A;  2RQP A;  2G9W A;  4WK8 F;  1W4M A;  4CIC A;  3F8F A;  2WC2 A;  2J5O A;  1UHM A;  2VXZ A;  3FXU A;  2QYO A;  5BS6 A;  3U1D A;  1OMI A;  2L54 A;  2PN6 A;  4KIB A;  3R0J A;  1BC8 C;  4MTD A;  3LFK A;  4NHJ A;  2E7X A;  4PZJ A;  4ENN A;  1LDK B;  4M71 A;  5DCF A;  2IA0 A;  4CZZ A;  4WXD A;  4KDP A;  2FF4 A;  3FMS A;  4KN7 X;  1T38 A;  1UB9 A;  2DTR A;  3SXY A;  5E20 A;  4ZYH A;  3EYY A;  3ZMU A;  3ROU A;  3E5X A;  4OOI A;  5FD6 A;  2EV0 A;  2Y75 A;  2V6C A;  2D1V A;  3B02 A;  2HWV A;  2VC0 A;  3P9K A;  4HX4 A;  2UXX A;  1P4W A;  2L02 A;  4QLC U;  2R7D A;  3WTY C;  4YFX F;  1BI1 A;  4HAM A;  1B59 A;  1K79 A;  2FEZ A;  4BYY A;  3V7R A;  5K5Q A;  1USS A;  2EA4 A;  3DV8 A;  3SZT A;  1L3L A;  5DUI A;  2HYG D;  4GO1 A;  1BIB A;  4LLL A;  5D4S A;  1SFE A;  1XDS A;  1S7O A;  3DPL C;  2C6Y A;  1X3U A;  2HQR A;  1IN5 A;  4ESB A;  3J80 K;  4YIF A;  3N97 A;  3H3Z A;  3CUO A;  2P6S A;  1WKM A;  5E1Z B;  3S2W A;  1U8R A;  4FHT A;  2VE9 A;  3P9C A;  1B9M A;  4NQW A;  2CG4 A;  2VBX A;  3C3W A;  1MGT A;  4MNU A;  3F8N A;  3M9A A;  1Z05 A;  1R5H A;  3T8R A;  3QU6 A;  2ZKZ A;  4A0Y A;  3I0T A;  1K78 A;  3KZY A;  4L18 B;  2RC4 A;  5HS8 A;  3JTH A;  4M72 A;  3HSF A;  1SD7 A;  2Z99 A;  5ILS A;  4HX8 A;  4JBA A;  4GYI A;  3WGI A;  4EJT A;  4CGZ A;  2HTJ A;  1UHW A;  2UXN A;  1XSX A;  5D8L B;  2XAJ A;  2CQK A;  1PDN C;  5ICC A;  4BHC A;  3RTR A;  2OAZ A;  3HRS A;  2FSW A;  2V9V A;  5D5V B;  3J81 K;  4G7Z F;  1U78 A;  4HF2 A;  3C7J A;  2ESH A;  5HDK A;  2HS5 A;  2Q0O A;  4EM2 A;  2ZO4 A;  4KIC A;  5DCM A;  1E17 A;  1YW9 A;  5A2Q K;  2QZ8 A;  2FA5 A;  3K1M A;  3GX4 X;  1QQI A;  4AIJ A;  3BP8 A;  1GVJ A;  2ZCW A;  4BQA A;  1P92 A;  5K5O A;  4PGG A;  2BE5 F;  3BPX A;  3RKY A;  4ON0 A;  2XRN A;  3SHF A;  3QOP A;  4HV6 A;  2QEN A;  1JE8 A;  1U5T A;  2NS0 A;  2ZME A;  3H92 A;  3I5U A;  3BJ6 A;  5DDG A;  3KEO A;  5HOO A;  3BJO A;  5KVR A;  3E5U A;  4Q48 A;  3RJP A;  3VEP A;  4U7B A;  1CF7 B;  2D2W A;  1SMT A;  4EJW A;  1B4A A;  5D6F A;  2WWY A;  3FMQ A;  3V8K A;  4PDK A;  4RB2 C;  2A07 F;  3KEQ A;  3K1N A;  2Y48 A;  1WRJ A;  4O3M A;  1Z9C A;  2V1U A;  4WXH A;  4PCQ A;  1J59 A;  4YFK F;  2NAZ A;  2MH9 A;  5D4R A;  2E7W A;  1ZLK A;  3WGH A;  1ONV A;  2W84 A;  4RGR A;  1T2K A;  1B6A A;  5FO5 A;  3REO A;  1D8J A;  3GZ6 A;  4KIG A;  4YG2 F;  5EEG A;  2DO7 A;  1S3J A;  2IRF G;  2YR2 A;  1XCB A;  4PGH A;  1ZRD A;  2RVC A;  2GA1 A;  4R79 A;  1LB2 A;  3GO5 A;  4BHP A;  3HHH A;  1HW2 A;  2HDC A;  2PJP A;  1TTY A;  5JFR A;  3GF2 A;  2FQ3 A;  4ZYG A;  2HKX A;  2JRT A;  1R1V A;  1ON1 A;  1D5V A;  3RPU A;  1J9I A;  3B73 A;  1S29 A;  2O03 A;  3LA2 A;  2ZXJ A;  1OPC A;  2K4B A;  2O6G E;  5H20 A;  1MJA A;  4EM0 B;  1O7F A;  1LJ9 A;  1KU2 A;  4H0E A;  3DXJ F;  5HLH A;  4EGY A;  3C1D A;  4UVB A;  3Q5F A;  1T6S A;  3J80 Z;  2O3F A;  3R60 A;  1T0F A;  2VT3 A;  2D45 A;  2ACJ A;  4A6D A;  5HDN A;  2HFH A;  3I54 A;  2XUB A;  3WU1 B;  3QPT A;  1Z6R A;  4RGX A;  2M45 A;  1KU9 A;  2W25 A;  3I59 B;  1KQ8 A;  2A6E F;  3L2C A;  2YSR A;  1SFU A;  4XLN F;  3I53 A;  1ZG3 A;  1O3S A;  2PMU A;  4JK1 X;  4WXC A;  3IWZ A;  4HQM A;  2GAU A;  4G9Y A;  1HST A;  3R6S A;  1HW1 A;  2VT2 A;  2EV5 A;  4GGG A;  1OKR A;  4I0A A;  2PEX A;  2F5F A;  2Y0M A;  3ECH A;  5JHU A;  5LEK A;  1J75 A;  1O7L A;  2H27 A;  3F8M A;  2QVO A;  2NNN A;  3F23 A;  3KP5 A;  1EV7 A;  3BPV A;  3PQJ A;  2B0L A;  3ZPL A;  2XVC A;  4G94 A;  2ZBK A;  2Z3Y A;  4P9U A;  1ZRC A;  3DFG A;  1UST A;  1DP7 P;  3F8C A;  1IN7 A;  5H6Q A;  1FC3 A;  2K02 A;  3ZN1 A;  3WTX C;  3M8F A;  4U0W A;  3U9G A;  2VOP A;  4KA4 A;  4IHT A;  1YYV A;  3I4P A;  1ON2 A;  1HSJ A;  4DNC A;  1FY7 A;  5D5X B;  4RAY A;  4EVI A;  1S8N A;  1PUE E;  3TO7 A;  2VBY A;  5CJ9 A;  1KGS A;  1IAW A;  2GWR A;  1UCR A;  2YU3 A;  3FWE A;  3MQ0 A;  1YW8 A;  4R1H A;  2VE8 A;  2XIG A;  1IUY A;  4ENJ A;  2M8E A;  5JR3 A;  1MDM B;  3GWZ A;  5EEH A;  1TQP A;  3JAM Z;  1U6G A;  1JGS A;  2VC1 A;  4M6X A;  5L3C A;  2XGX A;  5E17 F;  3WTU C;  2Z33 A;  5FLX K;  2EJR A;  3ABT A;  3KCC A;  1JXS A;  1RZ4 A;  4UHT A;  1Z91 A;  2EFQ A;  2XAQ A;  4IF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...