4KMFA

Crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
SAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Z-DNA binding mode of a PKR-like protein kinase containing a Z-DNA binding domain (PKZ).
pubmed doi rcsb
source organism Carassius auratus
molecule tags Transferase/dna
molecule keywords Interferon-inducible and double-stranded-dependent eIF-2kina
total genus 21
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kmfA00
1YIOA 2VN2A 2IA0A 4LK1F 4BH9A 4IPAA 3COAC 5ILUA 2DQRA 4WXDA 1SFXA 1P4AA 2CWEA 1BI2A 4A0YA 1HW1A 2RDPA 2FXAA 2RKHA 3GFIA 3KFWX 4G94A 2G9WA 3WGHA 4O5VA 3FM3A 3OOPA 1U3EM 4A5NA 1R00A 3CUQB 3L7WA 1FLIA 1MD0A 4ESFA 4G7OF 2Z99A 3MWMA 2HEOA 3P7NA 5D5UB 1Z6TA 3BWGA 2EFNA 3RKXA 3F72A 1XGOA 3V8KA 4I0AA 1S6LA 4YIFA 4CO8A 1JHHA 1ZLKA 3FMSA 4U7BA 1T6SA 5JI6A 5DCFA 1DDNA 3LSTA 1FZPB 3IHUA 1T38A 1YW8A 2ELHA 1RI7A 2PMUA 4EMSA 1YW7A 4M73A 1IXRC 3RPQA 3JTHA 1EH8A 4ZZDA 3WGIA 2VC0A 3BPVA 1TNTA 1ULYA 4EQQA 4RAYA 1BI0A 5TRDA 4L18B 1UFMA 1TQMA 2O3FA 2X4HA 5K1YA 2GA1A 2PLYA 3I59B 4LJZF 3WODF 1S29A 1I27A 2YU3A 1P4XA 2K27A 2W84A 2JT1A 4G7HF 3KEOA 1JE8A 2FRHA 1FBSA 4UVBA 3WTWC 1TW3A 1B1BA 5FLXZ 3IRQA 3BPXA 3W6JB 5HVQC 3KE2A 1O57A 3E6MA 2VBXA 1JXSA 3BJ6A 5A2QZ 1GHCA 5DD8A 5LGTA 1RNLA 5HLIA 4FHTA 4KDPA 2J5OA 3ZMDA 1O3QA 1USSA 1CGPA 3G73A 4EVIA 5L3GA 3EUHA 3ZPLA 4GYIA 2CYYA 2QVOA 1BBYA 2MD5A 1IN4A 2BGCA 1J0RA 5JHUA 4IVNA 2M30A 3IL2A 3HHGA 4KMFA 4U0WA 3DPTA 4HZFA 1FX7A 5D4SA 2F2EA 5CVRA 2MC3A 1R23A 4IRGA 4I98B 2UZKA 4RB2C 1USTA 1XN7A 5IT9K 3GWZA 1JGSA 2DK5A 3TOAA 4A5MA 4OIPF 2HQNA 1R5HA 4EM2A 1TQPA 1SD6A 3O2PE 2IP2A 1WSUA 4WXHA 5TJJA 1PDNC 1ZGAA 4R79A 1YO5C 2CGPA 1J9IA 1LNWA 1MDMA 4Y17A 3PFIA 4HX4A 4HV5A 2FBHA 3QOPA 1O3RA 2BYVE 3QU6A 1K6OA 2L4AA 3QRFF 3L9FA 1ON2A 3FX3A 4UHTA 4YG2F 2BEOA 4IRHA 3V8LA 4KFCA 5DD4A 2HTJA 4LGWA 3ERED 3KP5A 3WTTC 3JAMZ 2KIMA 4WF2A 4IRIA 1FYLA 3IKVA 1MJ9A 1YYVA 2Q2EA 5E18F 3HOTA 5DUIA 2IVMA 1ZAOA 3R4KA 2K86A 3F23A 4XSZF 4B09A 4R1HA 4HLXA 5HS7A 4RGRA 2QYOA 2VBZA 4CXFA 1MZBA 5ILSA 1BC7C 4L5IA 5ICEA 3F8MA 2HOEA 3J7AO 2O61A 2FBIA 3C1DA 3GF2A 1SFEA 1KU7A 4RGXA 4PGGA 2MLKA 6PAXA 5CLSA 4I2OA 3KZZA 3FWEA 2O6GE 4IHTA 2VONA 4KYWA 2A3SA 2XRNA 4OMYA 3GYHX 3IWFA 3I58A 4LG0A 1ZN2A 2F5DA 2IPQX 5IT3A 5J8CA 4HDUA 4WXCA 2EV5A 3P9CA 4AWXB 1IN5A 3MQ0A 2VOPA 1EV7A 3MCZA 4A0ZA 1D3YA 3U9GA 1O3SA 3P9IA 2UXXA 4M6YA 3KEQA 2L02A 1IN6A 2FU4A 4MGRA 2HKOA 2HWVA 1BIAA 2NNYA 4FT8A 1HXDA 4L0YB 2P7VB 4K2EA 4H0EA 2NNNA 3EETA 3FHZA 2VT3A 2LNBA 1XB4A 2JPBA 5LEJA 3SHFA 5IT9Z 3T8RA 3J80K 2DTRA 2Z33A 2STTA 4BHBA 4M9SA 1R5GA 4KIGA 2P5LC 1XSVA 4ENMA 3F8BA 2F5EA 2M1BA 2CO5A 1QGPA 4UVAA 3T0YA 3KP2A 2ESNA 1GVJA 2A07F 3R6SA 2XASA 3CUOA 4M6XA 1GXPA 4L9TA 1IRGA 4AD9A 5BQTA 2AXLA 5DEQA 3I4PA 2L54A 4FX4A 4NQWA 4CHUA 2D45A 4LG0B 1ZARA 5H20A 4G6DA 4HF1A 3I53A 2PJPA 3QU3A 4HW0A 3EYIA 3L00A 4ZZLA 3WG9A 4LFUA 3TDZC 2EK5A 4Z2YA 1TW2A 3IRRA 4ETSA 2QZ8A 2ESHA 5FGMA 1Z9CA 2VE9A 2OU2A 1PP7U 2OA4A 5D8KB 5CVUA 2WWYA 3SQNA 3GFLA 2RQPA 5D6EA 3GVAA 4HQEA 3N97A 1QO0D 3TOBA 3MFKA 3ZMUA 3T1BA 2LSOA 2DW4A 3F8NA 3CJNA 2K7LA 2GA2A 2VT2A 1R1UA 3E6DA 1OYIA 5D4RA 1U8RA 2MLGA 4QWQA 4D0PA 4UV9A 1QZYA 3L09A 4UNOA 3E5QA 2OZ6A 3QPHA 1Z6RA 2HTSA 3GXOA 4ESJA 4GXOA 3MZYA 5DCMA 2KJBA 1ZGJA 1BI1A 4JBAA 3U2RA 4UXNA 2F5CA 1WWXA 4RB0A 3HHHA 5FD6A 3ABTA 4AIKA 2VE8A 1NHAA 1J7KA 1U6GA 4KN7X 4G7ZF 5HLGA 2FNPA 1KYWA 2A69F 3ULQB 3VOEA 3H92A 4BHPA 1OMIA 1PP8F 1QQIA 4ZYGA 3O6BB 1ZREA 1J2XA 2DLLA 4HQMA 4ZYEA 1T98A 3FF5A 2XVCA 1YQAA 1C0WA 1P2FA 5ICGA 4EGYA 1G3YA 1YS6A 1YTYA 4AIJA 1I1SA 4MEYF 2DBBA 2E1NA 4M71A 4Y15A 1ZG5A 1IZ1A 3GEZA 2ZMEB 3FMQA 3HYIA 1G3WA 4L9NA 4A2UA 2EJRA 2YPRA 2DK8A 3J81Z 1HKSA 4I0BA 2VC1A 4GO1A 3HUGA 5HLHA 2W24A 3ISPA 1HBXG 1XDSA 4IHSA 3V8JA 3BROA 2XROA 3ZMSA 1SAXA 1ONVA 1WRJA 2C6YA 5E8GA 2ZFWA 1XCVA 4XRFA 1FPQA 2R3SA 2CSOA 1RZ4A 1F1ZA 1UB9A 3D0SA 2EA4A 4KN4X 1W7PA 4LK0F 1F9NA 2L01A 1D8KA 1DP7P 2RN7A 2ACJA 5LGNA 3JW4A 1P6RA 1HSTA 1U5TC 1HW5A 1R36A 3R61A 3IC7A 3WTUC 4FX0A 4S05A 2B0LA 3QPTA 2PFBA 4KUMA 1LEAA 2HQRA 2D2WA 4MHGA 3QAHA 2QQBA 3SXYA 1XSDA 1BOAA 2DO7A 1T0FA 1H9GA 1R7JA 3Q9VA 5LBQA 2KJCA 1PUEE 3GZ6A 4BAYA 2DU9A 4EJWA 1WQ2A 4Y13A 2V9VA 2GIVA 3P9KA 1MDMB 1OKRA 4PGHA 5JVTA 1J5YA 3V7RA 4ESBA 5J8FA 2ZNYA 1GXQA 2ZBKA 1W7PD 3EYYA 3MZHA 5ERIA 2ZJ2A 2JTVA 4KMUX 2KIUA 2QWWA 3DF8A 3CUQC 1HKTA 1Z91A 2YX4A 1FC3A 1Z05A 5H6RA 3JSPA 2ISYA 2R7FA 1K78B 2ADUA 4M72A 3S2WA 1IAWA 3ROUA 1TTYA 2P5VA 3QP6A 2O03A 4PZJA 1SMTA 1LJ9A 4CGZA 2YR2A 1UHMA 4I02A 1MGTA 3DP7A 1BJAA 1Z7UA 3WU0A 2GWRA 3LFKA 4KT5C 3V7CA 3W6KB 1B9MA 2ZMEA 4RGSA 4WCGA 1UCRA 5KK1A 1O7LA 2Y75A 4HBLA 3VODA 1WI9A 3RJPA 3LAPA 2XAHA 3DQVC 3IWZA 3ECOA 2P6SA 1D8JA 2RNJA 1UHWA 3E97A 4PDKA 1FYMA 2J5PA 3K1PA 4AIHA 2CW0F 3ZP5A 1CF7A 3E6CC 4P96A 1SD5A 3TGNA 4O3MA 5CVIA 3SZPA 2P5KA 5DV5A 2HZTA 1G4DA 3MEXA 4WWCA 1QNTA 1QPMA 2PG4A 2KIFA 2V1DA 1KU2A 1BI3A 4RB1A 1MKMA 5EEHA 1IXCA 3IKTA 1ZG3A 2K4BA 4ASNA 2P4WA 4BQAA 3TO7A 1XD7A 2WC2A 1FBQA 4CZZA 4PCQA 1D5VA 2QLZA 4XBFA 1DUXC 1B59A 1KU9A 2H6CA 3F21A 2OQGA 2P7CB 3HRTA 2RVCA 1T39A 3EQLF 2P8TA 4NB5A 3V7SA 1ZRFA 1LDDA 1REPC 2VODA 2IA1A 3HTSB 1Q1HA 2G7HA 1EH7A 1SD4A 4L9VA 3RYPA 2OAZA 2ZXJA 5DUKA 2GZWA 1H0MA 3RKYA 4XSXF 5K5OA 3NRVA 4OINF 3EDPA 4MEXF 1OPCA 4P9FA 4LMYA 4I7HA 4F7ZA 4LB6B 1LDJA 5FO5A 1HSJA 2E7XA 2XAQA 3GFMA 4EJOA 4IF4A 3KZYA 2QBYA 4HOBA 4I01A 1LB2A 5HDNA 3T8TA 1E2XA 3KP4A 1HQCA 2AS5F 1V4RA 3GO5A 1S3JA 3PQJA 5EEGA 1XCBA 3R0JA 5E1XA 3C3WA 3FXRA 2EFWA 2HDCA 3HSRA 1G3TA 3WTYC 3C18A 2A61A 3RTRA 5FFXA 1ZRCA 1AWCA 4MQ9F 5FB2A 1V3FA 1FSHA 3TO6A 2W57A 4P55A 2PI0A 3LA2A 4E70A 1LDKB 2EWNA 1CF7B 4LD5A 4M9XA 4YFNF 2STWA 3BY6A 3CO6C 1VTNC 2UXNA 5LRSA 1U5TA 3Q5FA 2FF4A 2R7DA 3KLOA 2JSCA 1XGNA 3KCCA 5E8IA 1KQ9A 2FSWA 2VOOA 2Y48A 4JK1X 2VBWA 1W5TA 3F8CA 4DQ2A 1DPRA 3CUQA 3VB2A 4G8XA 2O8XA 3NEUA 2Z9OA 4A12A 2CQKA 4HF2A 4BYYA 3F22A 5F64A 4KIBA 1S7OA 2ZNZA 1HW2A 2ISZA 5JR3A 4BHCA 1R1VA 1QZZA 3WTZA 3GLXA 1O7FA 1TLHB 2JPCA 2EFPA 2DFIA 2NS0A 2ZCWA 4MTDA 1RUOA 2D1VA 5K5QA 4YFXF 3K1MA 2DI3A 4A6EA 3KP3A 2E7WA 2M5WA 2EFQA 3GZ5A 3M1EA 2OD5A 5D5XB 1ZHFA 3VEPA 2V1UA 3H3ZA 4UV8A 1F4KA 2FQ3A 3WE3A 4KICA 2JRTA 1EH6A 4ZH4F 3U1DA 3REOA 2MA3A 4OIOF 2FMYA 1OR7A 3E5XA 1TNSA 1BIBA 5CYVA 5D6FA 3ZN1A 3KETA 3Q9SA 1S7AA 4MTEA 2XAFA 2GXBA 4ON0A 4G9YA 1R58A 2XHKA 2L4MA 3ML6A 2WV0A 2KKOA 3MAJA 3LA7A 2COMA 2WTEA 1IXSB 3DPLC 4UUVA 4Q5SF 5K5RA 1A04A 1DPUA 2RC4A 2HYGD 2ZKZA 5DDGA 3CLOA 3GX4X 1K79A 3D5LA 2PBIA 2VXZA 3JSOA 3M9AA 5E1ZB 1BC8C 1R1TA 5LHIA 3ZMTA 2H6BA 4LLNA 4L0ZB 2KRFA 2DPUA 1U5TB 4OU0A 2Q0OA 5DYMA 4ENKA 5CVVA 4N0BA 2IA2A 5LRRA 3BOQA 3QP5A 3BZ6A 4DNCA 5HS8A 4HDVA 4MNUA 4YFKF 4XLPF 3HIFA 2H09A 2XAGA 3J81K 4IJAA 1SFUA 1YFHA 1P4WA 1S8NA 1FP2A 4HX7A 2XIGA 5D5VB 3JTGA 3BDDA 2V79A 4CDGA 3M8EA 4WX9A 2NAZA 2GAUA 5H6QA 1LEBA 1BM9A 2EV6A 5CJ9A 5L3CA 4MQVA 3I0TA 1FP1D 4Q4ZF 2RV8A 5LLQA 2PEXA 4RAZA 1AOYA 3HSFA 2O0YA 1YS7A 3ELKA 4XLNF 1G3SA 4IXAA 5JFRA 4RB3C 4P5OA 3GFJA 3TO9A 4ZYHA 2M8EA 4Q48A 2RGVA 1LVAA 3LA3A 3HTUA 1Z1DA 5LHHA 1IF1A 2W25A 4HF0A 1B4AA 1W7PB 3DV8A 1W4MA 4G6QA 4R8HA 1KA8A 4GCVA 2NYXA 3VFZA 5F1RA 4A6DA 5HOOA 3OV8A 4OMZA 1U2WA 5HS9A 1O3TA 1BN5A 2F5FA 4U88A 2FOKA 1H9TA 1FBUA 2BV6A 3CTAA 3HOSA 5LHGA 1XDUA 1I5ZA 5FD5A 2MH2A 4HYEA 2PN6A 2FNAA 3WU1B 2EA2A 5AONA 1IUYA 1XGMA 2P6TA 4N9IA 2NRAC 5BPIA 4CICA 3E6BA 3F6OA 3JAMK 1R22A 2L3DA 3WGGA 1F5TA 1WKMA 3K69A 2OBPA 3H3UA 2FEZA 2MH9A 5CVJA 4P9UA 3BJOA 4RS8A 4M74A 2D1HA 2OZUA 4L9JA 4KIFA 1L0OC 3KP6A 4EJTA 2XAJA 1B9NA 3KP7A 5BS6A 1ODDA 5F6FA 1FYKA 4EGZA 3I71A 4RGUA 2HKXA 3HRMA 3ZMVA 2M87A 4LB5A 4U0YA 3I54A 2HS5A 3BP8A 4EM1A 3K2ZA 1IN8A 3C7JA 3DEUA 1KGSA 3M8FA 1QBJA 1J59A 4A0XA 3N4MA 3M7GA 4M9ZA 5HDKA 1YG2A 2EB7A 3LAJA 3DKWA 1TBXA 1OYWA 1MJAA 4LLGF 4AVPA 2XV4S 4GYGA 3F3XA 1J75A 1SMYF 2IRFG 2ETHA 2LF8A 1IRFA 3B73A 4YIIA 2A68F 1KQ0A 3R60A 2JZYA 5LGUA 1RIOH 3T5XA 3SFZA 3AAFA 3I5UA 3HRUA 3I64A 3TQNA 5D8LB 4Q47A 3V4GA 2BBYA 4S04A 2EV0A 1B6AA 4N9HA 2HYFA 3WTVC 2H27A 1FY7A 2HGCA 1K7AA 3K0LA 1L3LA 2GXGA 2CG4A 4OIRF 5ICCA 2YX7A 4ENJA 4HV6A 4HA8A 3B02A 3RDIA 1KQ8A 3WTSC 1W5SA 2Y0MA 1KU3A 2A6HF 1XSXA 1IN7A 2Z3YA 4EJUA 5ICFA 5HDGA 1TQIA 2QENA 4B8XA 3LQRA 2X0LA 3F8FA 4HAMA 1T2KA 3FMRA 1OYYA 1ZLJA 5A2QK 4QLCU 2VBYA 1ZH5A 4LLLA 3E3VA 3RIRA 2XGXA 2DAOA 3KLNA 3ECHA 3BJAA 2BE5F 1XMKA 2LF7A 4NHJA 3RYRA 2HR3A 3R0AA 4U7DA 4EM0B 2XUBA 2G7UA 4WK8F 1YW9A 2E1CA 4O6JA 2UWMA 5FLXK 2M45A 3RPUA 1I6XA 3PQKA 2Z5UA 5E20A 5KVRA 1ZRDA 4OOIA 2TDXA 2XKPA 2LDUA 1JHFA 3ZN0A 1K78A 2DQLA 4UVCA 2YSRA 1XMAA 3ZMZA 3LWFA 4GGGA 3RKWA 4OIQF 1FSEA 2QQ9A 3SZTA 5ED4A 3DFGA 4I09A 2XKOA 3O3KA 2EFOA 4ENNA 4U0VA 4BNCA 3HSEA 5D5WB 2K02A 5E1WA 3FXUA 1KYZA 2FMLA 3FM5A 3L2CA 1LQ1A 2GQQA 3E5UA 4HLYA 1FOKA 3K1NA 2DT5A 4KNYA 5AIPA 5ILVA 1E17A 3FZVA 3ABUA 1U78A 1FNNA 1ZYRF 5E17F 4EV0A 2FE3A 2QBYB 1FWZA 3RI4A 2PMHA 1XGSA 1RUNA 1X3UA 2MBFA 3GW2A 3K9TA 5L3BA 4HX8A 5FFZA 2OQRA 4JQFA 2V1XA 4TV7A 3TDUC 4L5JA 5J6XA 1MJBA 2IW5A 2QQAA 1ZG1A 1G6NA 2DPDA 1IW7F 5BOXA 2A5YB 3WTXC 2FBKA 4KA4A 2QUFA 4ZYDA 3NQOA 2Q8KA 1HKQA 2PQ8A 2H94A 3WE2A 3TKYA 3FXQA 1P92A 3DXJF 3J80Z 5L3FA 5AIQA 5LEKA 2QM3A 2HFHA 3ZQ7A 2FA5A 2LKPA 1YLFA 5DCMB 4CYDA 1STZA 1ON1A 2IT0A 1I1GA 4EJVA 3F6VA 2ZO4A 2K4JA 5BMZA 2W85A 2IJLA 2V6CA 3G3ZA 3LQQA 3CO7C 5L3DA 2A6EF 1SD7A 3HRSA 2CFXA 1Y0UA 3GUDA 1FT9A 5BPDA 3CDHA 3I59A 4BXUA 5L3EA
chains in the Genus database with same CATH superfamily
2DFEA 1YIOA 2VN2A 2IA0A 1XMXA 2P81A 4LK1F 1JGGA 2LLKA 1X1AA 4BH9A 4IPAA 2E2JJ 3COAC 1VQ9I 3QYBA 5ILUA 2LRDA 3HOXJ 5GTIC 4AYBA 4BE1A 1ZGWA 1BA5A 2DQRA 4WXDA 1SFXA 3G6EI 4QTRA 1P4AA 2CWEA 1BI2A 2VJIA 4PJLA 4A0YA 1HW1A 2RDPA 2GLOA 2FXAA 2RKHA 3GFIA 3HGGA 1D1CA 3O8HA 3KFWX 4G94A 2G9WA 3WGHA 4O5VA 1V54H 3FM3A 3SZGA 2LP0A 1VQ7I 1JKPC 1Z7LA 3OOPA 1U3EM 4A5NA 2CW7A 1R00A 1WJEA 3CUQB 3L7WA 1FLIA 1MD0A 4ESFA 3RQIA 4G7OF 4PJNA 2Z99A 3MWMA 2IGKA 2HEOA 3P7NA 4F93B 5D5UB 4E7SA 3EUHC 2L7KA 1FIAA 1Z6TA 1R4NB 3BWGA 1QVTA 2EFNA 1VQKI 3RKXA 3F72A 1XGOA 3V8KA 4I0AA 1S6LA 3HKZN 4YIFA 4E7KA 4CO8A 1JHHA 1SFKA 1ZLKA 3FMSA 4U7BA 1T6SA 1YE9A 4CH7A 3BZKA 5JI6A 5DCFA 1DDNA 3VWBA 4II3A 1I50J 2B7EA 3LSTA 1FZPB 4J00A 3IHUA 3S17J 2KDZA 1T38A 1YW8A 2ELHA 1RI7A 4BUPA 2PMUA 1OR7C 4EMSA 3HB9A 2XGCA 1GUUA 2X51A 1YW7A 1P7JA 4M73A 5GPCA 1IXRC 3RPQA 3JTHA 3LSJA 4GDFA 1G8XA 1EH8A 4ZZDA 3WGIA 1I3QJ 2VC0A 2R5YB 3BPVA 1BW6A 2WA0A 1TNTA 1ULYA 2HI3A 4IX7A 4EQQA 2XGDA 4BEHA 4B3AA 4RAYA 3ZR8X 3WU2C 3OYKA 4BACA 1BI0A 5TRDA 2OPTA 2FJ1A 1UJ8A 4L18B 2CQQA 2MC4A 1UFMA 1TQMA 2O3FA 2X4HA 1MNMC 5K1YA 2GA1A 2PLYA 5F04A 1VQ4I 3I59B 4EEFG 4LJZF 3MKWB 2MW8A 3WODF 2QSGX 1S29A 3H0DA 1I27A 2YU3A 1P4XA 2K27A 5E3LA 2W84A 2Z2SB 2JT1A 3C2BA 4G7HF 3KEOA 1IV6A 1JE8A 2FRHA 1FBSA 2F6CA 3K4LA 4UVBA 4CCNA 3WTWC 1TW3A 4UB6C 1B1BA 5FLXZ 3IRQA 1UMQA 3BPXA 3W6JB 5HVQC 2K9LA 3S1RJ 3AFHA 3B6AA 3KE2A 1O57A 3E6MA 4DBQA 2HOAA 2VBXA 1JXSA 3BJ6A 3FXLA 2LTPA 3OOUA 5DD8A 5LGTA 1RNLA 3Q0UA 2CUZA 4F52A 1GHCA 5HLIA 4FHTA 4KDPA 2M2EA 2J5OA 1S9HA 3ZMDA 1GT0C 1O3QA 2QSHX 1USSA 1YRNB 1CGPA 3D1NI 4EVIA 3G73A 5L3GA 1ETQA 2JK3A 3EUHA 5GAGJ 2DDAA 3OS0A 4V2GA 4B48A 1BL0A 2VKEA 4OAYA 5HNFA 3CQZJ 3ZPLA 3A1YA 4GYIA 2CYYA 2QVOA 1BBYA 2MD5A 1IN4A 1MBFA 1HDPA 1J0RA 1JT6A 2BGCA 5JHUA 4IVNA 2M30A 3IL2A 3DBRB 3TP0A 3HHGA 4KMFA 2DA6A 1SFOJ 3L2VA 3ZQIA 4U0WA 3DPTA 4HZFA 1FX7A 2PX9A 5D4SA 2F2EA 5CVRA 2HVSA 2MC3A 3G1OA 1Y8QB 3W6VA 1R23A 2V26A 1FIPA 4IRGA 4I98B 1HDDC 3ZQCA 2DMPA 2UZKA 4RB2C 1DP3A 2X6YA 1USTA 5EJCA 1RKWA 1XN7A 5IT9K 3GWZA 3JREA 1Z77A 1H8AC 3BG9A 3C2GA 1JGSA 2DK5A 3TOAA 4A5MA 2Z1DA 2E1OA 1MW7A 4OIPF 2HQNA 1R5HA 2CV2A 3AG3H 1JTXA 1TQPA 1SD6A 3O2PE 4EM2A 1WJ5A 2IP2A 1UG0A 1WSUA 3QPLA 4WXHA 2VJ5A 1PUFB 5TJJA 1MNDA 4XLHA 5K7HA 1PDNC 2QF7A 4BXFA 3S3MA 1ZGAA 3KYCB 4R79A 1YO5C 2CGPA 1J9IA 1LNWA 1MDMA 4Y17A 3PFIA 4HX4A 4HV5A 2FBHA 4UUSB 3QOPA 1O3RA 2WADA 2BYVE 3QU6A 1ZR2A 1PVEA 4BBRJ 1K6OA 2L4AA 3QRFF 2F4IA 2XDVA 3L9FA 4DJAA 1ON2A 2R0QC 3FX3A 3CMYA 1Y1VJ 4B44A 4UHTA 2QQ8A 4YG2F 2JA5J 3BR5A 2BEOA 4IRHA 3H9QA 2M0CA 3V8LA 4KFCA 2F5VA 1QHHD 3MKLA 1P9QC 4JOMA 5DD4A 3S93A 2HTJA 4LGWA 4ZYAA 3A01B 3ERED 5IOYA 3KP5A 3OSFA 2BW3B 3P5JA 1JUPA 2H1LA 3BCAA 3WTTC 3JAMZ 2KIMA 4CUGA 1WGXA 3CJTB 4WF2A 4IRIA 4BQQA 1FYLA 1WZ2A 2Y9YA 3IKVA 1MJ9A 5CKTA 1YYVA 4E7JA 2Q2EA 1T95A 5E18F 3CC2I 1AU7A 3HOTA 5DUIA 2IVMA 1MMAA 1ZAOA 4JP0A 1X3WB 3R4KA 3W2VA 5DM6F 1O4XA 2K86A 1K4SA 4XLAA 3F23A 4XSZF 4B09A 2PMZA 3DU5A 4R1HA 4HLXA 2FOWA 5HS7A 4RGRA 2QYOA 3IH4A 2VBZA 4BJ6C 1YJ9I 2DFFA 3PSIA 4CXFA 1MZBA 1TL8A 5ILSA 1BC7C 4N4NB 4L5IA 2CQXA 3S8PA 5ICEA 3F8MA 2HOEA 3J7AO 3FXKA 2O61A 2FBIA 3CCLI 1JKOC 2QKMB 3OWTA 2H8WA 3CP8A 1JUMA 3TMOA 3GF2A 3C1DA 2GM4A 1SFEA 1D0ZA 1KU7A 3DEWA 3EUKL 4RGXA 3FKJA 4PGGA 2MLKA 3OYBA 4AC0A 6PAXA 3H3VK 4IL6C 1OFCX 3FK7A 5CLSA 2BZTA 2V9KA 5TISC 4YRVA 2DA3A 1FEXA 5EG0B 1A6IA 4I2OA 3KZZA 3DCFA 3FWEA 3U1KA 3G71I 2O6GE 3CCYA 4IHTA 1YI2I 5IY5H 2JRMA 2R7WA 2VONA 4KYWA 2A3SA 2LBFA 3A2KA 1VQ8I 2XRNA 3CC4I 3GYHX 1YHQI 4OMYA 3IWFA 3NWSA 3LSRA 3I58A 4LG0A 1ZN2A 4PJ0C 4XKBA 1XX5A 2F5DA 2IPQX 5IT3A 5J8CA 2KQRA 4JX4A 4HDUA 2Y31A 3M4OJ 4WXCA 2EV5A 3PO3J 3WHBA 3P9CA 2VUMJ 4AWXB 1IN5A 3TW7A 4M6VA 3MQ0A 2WAFA 3LFUA 2VOPA 4JYKA 5DM7F 1EV7A 4RM2A 4FQGA 3MCZA 2B63J 4A0ZA 1D3YA 3U9GA 2X1CA 1O3SA 3P9IA 4FE4A 3AKZA 1LFUP 2UXXA 4M6YA 2M3AA 3VPRA 5FRNA 2W82A 3IV5A 3KEQA 3MKZA 1ETYA 2L02A 4YELA 2W1OA 1IN6A 2FU4A 4MGRA 5KAFC 2HKOA 2XPUA 4MFDA 4II2A 2IGNA 3ZRGA 4A3CJ 2HWVA 3JRAA 1BIAA 1W1WE 2DA2A 2NNYA 1N25A 1I3AA 4FT8A 1HXDA 4L0YB 2P7VB 1E0EA 2LKXA 2E2IJ 5IYBJ 1VQOI 1I39A 4XLCA 2ZXIA 1VQMI 4K2EA 5C44J 1X19A 4H0EA 3HPHA 2GXAA 2NNNA 4HSRA 3EETA 3FHZA 5H2FC 1X4PA 4UUSA 3RKQA 1MBHA 2VT3A 2LNBA 1XB4A 1NK3P 2JPBA 5LEJA 1K6YA 3SHFA 3OS1A 5IT9Z 3CCUI 4EATA 3T8RA 3MKYB 3O8GA 4BY7J 3J80K 3OMYA 2F4MB 2DTRA 1UG2A 2Z33A 2STTA 3LSGA 2DA1A 3K7AJ 3L2QA 5DTDA 3FHNA 2HXIA 4BHBA 4M9SA 4G12A 1R5GA 4KIGA 4P1WA 2P5LC 1XSVA 2PMZN 4ENMA 2DT6A 3DKYA 3F8BA 2F5EA 2M1BA 2CO5A 3K4CA 4OWRB 1QGPA 3NWTA 3I4NJ 2W4SA 2ECBA 5JHFA 4UVAA 1B72B 2V6EA 3T0YA 3KP2A 2ESNA 2ZJRF 1JKRC 4XQFA 2VASA 1GVJA 2A07F 1ITYA 2L7MP 3R6SA 4I99C 2XASA 1ETKA 2E19A 3CUOA 4M6XA 5J1RA 3AG4H 1GXPA 4L9TA 1WI3A 1IRGA 4AD9A 5BQTA 5EGOB 2AXLA 4PJJA 3CCSI 5DEQA 5FLMJ 3I4PA 2L54A 2I10A 4FX4A 4NQWA 4FASD 3FXJA 3L2UA 1LE8A 4CHUA 2D45A 1TWFJ 4LG0B 1ZARA 5H20A 2OV7A 2XC7A 4G6DA 4HF1A 4MIMA 3I53A 5C4XJ 3JRIA 2HQAA 2PJPA 2V7FA 3QU3A 4HW0A 3EYIA 3L00A 3Q0WA 3E7LA 4ZZLA 3WG9A 4LFUA 3TDZC 2EK5A 4Z2YA 4M3BA 3IAS2 2LK2A 1TW2A 3IRRA 1LVKA 5EZHA 4ETSA 1V55H 2QZ8A 3DTIA 3PIPF 4CSWA 5IYCJ 4XL9A 2ESHA 5FGMA 3V42A 2K5CA 3F9KA 1Z9CA 2HXOA 1BJZA 2VE9A 3AL0C 2OU2A 2GBYA 1PP7U 5FRMA 3CZ6A 5J4YA 2OA4A 5D8KB 3FKIJ 1RRJA 3E1SA 5CVUA 1W5CC 1LPQA 2WWYA 3SQNA 3GFLA 2RQPA 5D6EA 3QOEA 4XN0A 2X6WA 3GVAA 4XORA 4ITVA 4HQEA 3N97A 1QO0D 2O5RA 3TOBA 3MFKA 4BY1J 1QRYA 5J1YA 3ZMUA 3T1BA 2LSOA 1HLVA 3PSFA 2DW4A 3F8NA 3CJNA 2K7LA 2L9SA 2GA2A 2ID6A 1X1BA 1WH5A 2IS6A 2XF7A 2BVLA 2VT2A 2XAUA 2R92J 3ZXSA 9ANTA 3CMAI 2R5ZB 5E3MA 1R1UA 3E6DA 3OYGA 4A3BJ 1OYIA 5D4RA 1JJ8C 3BR1A 3FBIB 1U8RA 2M8GX 2MLGA 2WAQA 2LC2A 4QWQA 2XF5A 4D0PA 4UV9A 5IP6A 1QZYA 3L09A 4UNOA 3E5QA 2OZ6A 3QPHA 1Z6RA 4XRMA 3HOVJ 4C3IJ 2HTSA 2KP6A 3GXOA 1WJDA 3HGYA 4GXOA 2CUJA 3MZYA 5DCMA 4ESJA 1MMGA 2KJBA 2M34A 2N8GA 3OYCA 1ZGJA 1BI1A 4JBAA 4BL0B 3U2RA 4UXNA 4UUTA 2F5CA 1WWXA 4RB0A 3HHHA 2XF6A 5FD6A 3K10A 5F27A 2MFZA 3ABTA 4ZJZA 2VE8A 4AIKA 1NHAA 1W36D 5FKOA 1MH4A 1S72I 1J7KA 1U6GA 1Y39A 4KN7X 4G7ZF 2Y69H 5HNHA 2VQHA 3I55I 2LYCA 2KMUA 5HLGA 3LOCA 2FNPA 1M1EB 1KYWA 2QGUA 4ZC3A 2A69F 4A69C 3ULQB 3VOEA 3H92A 1F36A 4BHPA 1OMIA 1PP8F 1T56A 2IS4A 3CCRI 1QQIA 3H0GJ 4ZYGA 1MSFC 1MBJA 4M3EA 3O6BB 2X1EA 1ZREA 1J2XA 2DLLA 4HQMA 4ZYEA 1OQYA 2EZKA 1T98A 3FF5A 5GTHC 2X9DA 2XVCA 1P7IA 1YQAA 3AG2H 1C0WA 4C30A 1P2FA 1WFXA 5ICGA 1LUJB 5FROA 3ZQQA 2O7OA 4Y7NJ 4W1UA 4EGYA 2E71A 2R5YA 1G3YA 1YS6A 3K4BA 4A3EJ 1TC3C 1YTYA 2OCCH 2K9NA 2CW8A 4AIJA 1QHGA 1I1SA 4MEYF 3K6GA 2I8DA 3OYMA 3UR3C 2R7SA 2DBBA 4D5CA 2E1NA 4FETA 4M71A 3FK6A 4Y15A 3CCEI 1ZG5A 3DTEA 4ZDOA 1IZ1A 3GEZA 2ZMEB 3FMQA 1MMNA 1G3WA 3A0HC 3HYIA 4L9NA 4A2UA 4BDZA 1N77A 1Z0XA 2EJRA 2YPRA 1ZK8A 2LFBA 2DK8A 5FKNA 3J81Z 1HKSA 4I0BA 2VC1A 4GO1A 5JLWA 3HUGA 5HLHA 4E7LA 1JI8A 2W24A 3ISPA 2KFDA 1HBXG 1XDSA 4IHSA 3V8JA 3OY9A 3BROA 2XROA 3RCOA 3ZMSA 1DU0A 1SAXA 2R93J 1ONVA 1WRJA 5HODA 2C6YA 2KIQA 5E8GA 1VQ6I 2ZFWA 1GVDA 1XCVA 2KPMA 4XRFA 1FPQA 2R3SA 2CSOA 1RZ4A 2G0EA 1MBEA 1YJWI 1F1ZA 3KEYA 1AKHA 5GAEJ 3K70C 1UB9A 3D0SA 1TT0A 2DMUA 2EA4A 2Q2EB 4KN4X 1W7PA 2AHQA 4LK0F 2JWTA 1BR1A 1F9NA 2R7ZJ 4PFOA 4BJ5C 2EIMH 2NS7A 4FTHA 3GTJJ 4DYCA 2L01A 1ZKGA 1D8KA 2DMTA 1DP7P 2RN7A 2LVSA 5M3FJ 2ACJA 3PJRA 3BT9A 5EG0A 2BOLA 5LGNA 2K85A 3JW4A 1U0JA 1P6RA 1ACIA 2XB5A 1HSTA 1ZQ3P 1AKHB 1GDTA 2XPWA 1U5TC 1D1BA 1HW5A 1R36A 2A6TA 3R61A 4BU2A 3IC7A 3OYDA 3WTUC 4FX0A 4S05A 2B0LA 3QPTA 3U21A 2PFBA 4PFPA 2CS3A 3I56I 4KUMA 4BBSJ 2LMDA 2D5VA 5FLVA 1LEAA 2HQRA 3HZJA 2D2WA 2X85A 3ASOH 3VYRB 1YOVB 4MHGA 3QAHA 2QQBA 3SXYA 4CCOA 1XSDA 1BOAA 2DO7A 1T0FA 1JJ6C 4Y52J 4F3QA 2L7ZA 1H9GA 1R7JA 3HPGA 3Q9VA 2LBFB 5F1JA 3S1MJ 5LBQA 2L9NA 2KJCA 1PUEE 1SANA 3GZ6A 4BAYA 2AXTC 3VYUB 2DU9A 4F55A 5C3EJ 3M1CA 4EJWA 3RZDJ 3A0BC 4ZTJA 2LR8A 4B47A 4KITB 1QA6A 1IUFA 1WQ2A 4Y13A 2Z16A 3OYAA 2V9VA 2GIVA 3P9KA 2L9VA 2EH3A 4ZTFA 1MDMB 2DN0A 2ZB9A 1OKRA 1VF9A 4PGHA 5JVTA 2QA4I 1J5YA 3V7RA 4ESBA 4C9YA 3DLLF 5J8FA 3M3YJ 4ZDLA 2ZNYA 3DU6A 3ZGKA 3SDBA 2ZBKA 1GXQA 1W7PD 2I5UA 3EYYA 3DBHB 4XICA 2JMWA 3J7AY 2VQLA 3MZHA 5ERIA 2ZJ2A 5EZGA 4E7HA 3OYLA 3BC8A 1A31A 2UUZA 4D5FA 2JTVA 1S7EA 1TP4A 5KCMA 4KMUX 4C2TA 5LFAA 4RDUA 1WVRA 1OISA 2KIUA 3ESWB 2QWWA 3CD6I 1YIJI 4Z6YA 1TWGJ 3CUQC 3DF8A 1RR7A 1DGRM 3Q0VA 1G59A 3QQAA 1HKTA 1X1DA 2DA7A 4X0GA 1Z91A 2M0MA 3VSKA 2YX4A 1FC3A 5CQGA 1Z05A 2RNGA 5H6RA 1G2HA 3GTOJ 3IH3A 3JSPA 2KISA 5K7ZA 3OYJA 2ISYA 2R7FA 1K78B 3UKGA 1WJFA 3A03A 2ADUA 4M72A 3S2WA 2YUSA 1IAWA 3ROUA 1TTYA 2P5VA 2FX0A 3QP6A 2O03A 4PZJA 1SMTA 1LJ9A 4QIWN 4D7MA 1A35A 4CGZA 2E5ZA 5FKMA 4IZZA 2YR2A 4NC8A 2HDWA 2K9QA 1UHMA 4I02A 3D5SC 1MGTA 3DP7A 2BY0A 3KYDB 4J01A 1BJAA 1Z7UA 4A3DJ 3WU0A 1WJAA 2GWRA 3LFKA 4KT5C 3VDXA 3V7CA 4IHYA 2CJJA 4AUXA 3W6KB 1HCRA 4CCKA 1B9MA 2ZMEA 3CDIA 3DPUA 4IOAF 3BR2A 4RGSA 4WCGA 1UCRA 5KK1A 1O7LA 2Y75A 4HBLA 3VODA 1WI9A 5IPAA 3RJPA 3RQ4A 3ZQGA 4HSTA 3G4SI 3LAPA 2XAHA 3DQVC 4XOPA 2L5QA 3IWZA 4AYBN 3ECOA 2LREA 2P6SA 4XRSA 2R7TA 1YX5A 5EGOA 2CFOA 2RNJA 4LITA 1D8JA 2XB0X 5F0HA 1UHWA 5EYRA 2H1KA 3H36A 3E97A 2KT0A 4PDKA 5E3NA 1FYMA 2COBA 2J5PA 3K1PA 4AIHA 2CW0F 3JRHA 3ZP5A 1CF7A 3BTIA 5CQEA 3E6CC 3AL0B 4P96A 3K2AA 4MO7A 4XLEA 4NBQA 1SD5A 3CF2A 2IXSA 3TGNA 4O3MA 1FMVA 2WY8Q 5IP9J 5CVIA 4DOZA 2CUFA 2WY7Q 3SZPA 2P5KA 1Z3XA 4XRSG 5DV5A 1Z21A 2HZTA 1G4DA 3MEXA 4WWCA 1QNTA 1T33A 1QPMA 4MLOA 2FUG2 2PG4A 2K3FA 2KIFA 2V1DA 2OTLI 1KU2A 1BI3A 4RB1A 3PIOF 3JRBA 2ZC2A 1MKMA 5EEHA 1IXCA 2LY1A 3IKTA 2MGQA 1ZG3A 2K4BA 2NOJB 4ASNA 3CMEI 3W2AA 2P4WA 4BQAA 3TO7A 3CF5F 4PJMA 2DYSH 4XKVA 1XD7A 4BDYA 3BZCA 2WC2A 1S5LC 3GZNB 4Y4RA 3CCMI 1FBQA 2L9RA 2VXDA 4CZZA 4PCQA 3I3LA 1D5VA 2QLZA 3ASNH 4NDLA 4XBFA 1DUXC 1B59A 5GADJ 1KU9A 2H6CA 3F21A 2OQGA 2WBMA 2JA2A 3E0JB 2P7CB 3S32A 3HRTA 2RVCA 2ELJA 4CCLA 5BNGA 1T39A 3EQLF 5K7FA 2ID3A 2P8TA 4NB5A 3V7SA 2EBIA 1ZRFA 1RKTA 1LDDA 1REPC 5JVGF 2VODA 2EINH 2IA1A 3CLQA 3QPSA 3HTSB 1Q1HA 1EH7A 2G7HA 1SD4A 3M07A 4L9VA 3RYPA 2AQFA 2OAZA 2ZXJA 3DBLB 2GZWA 2X6XA 5DUKA 1H0MA 1IJWC 4RAGA 4B43A 1SAUA 4CYCB 3RKYA 2HDDA 4XSXF 1D0YA 5F0FA 2K9MA 5K5OA 3OIQA 3NRVA 4OINF 1Y6IA 5IOZA 1VQNI 3EDPA 4MEXF 1YRNA 1OPCA 2ECCA 4P9FA 3HOZJ 2W7NA 4LMYA 4XMYA 4I7HA 4F7ZA 4LB6B 1LDJA 1RR8C 1IC8A 3H35A 5FO5A 2HPMA 1HSJA 2E7XA 3JRCA 2XAQA 3GFMA 5GAHJ 1POGA 4EJOA 3I4MJ 2HNHA 4IF4A 3KZYA 2QBYA 4HOBA 3OYEA 4CYCA 2JUCA 2R7VA 3CC7I 2DFHA 3VSLA 4I01A 5B3SH 1LB2A 5HDNA 3T8TA 1E2XA 2LG4A 3S15J 4HNTA 3KP4A 1T08B 2E5NA 1HQCA 3W3CA 2AS5F 1V4RA 3GO5A 5J3LA 1S3JA 3PQJA 2LH9A 5EEGA 1XCBA 3R0JA 3ZQHA 1RPWA 2DOAA 2HPIA 5E1XA 4V19K 2CQ7A 2AO9A 3C3WA 1IG7A 3FXRA 2EFWA 2GOXB 3NAUA 1W36C 3S1NJ 4CZCA 2HDCA 3HSRA 4XK4A 1G3TA 3KX2A 4LIVA 3WTYC 3C18A 3S14J 2A61A 2MABA 3RTRA 5FFXA 1ZRCA 2KLOA 1AWCA 4MQ9F 5FB2A 1V3FA 3GCMA 1ORKA 2A05A 2MYSA 5M5XJ 1FSHA 3OL4A 3LSPA 1SVLA 3TO6A 2W57A 2BY3A 4IHVA 4P55A 2PI0A 3LA2A 4E70A 3DEEA 1LDKB 4CCJA 2EWNA 4E6KG 1UZCA 1CF7B 4LD5A 3HOWJ 3HEFA 1OJLA 2HZDA 4CCMA 4M9XA 4YFNF 1BW5A 1NK2P 2STWA 3BY6A 3CO6C 1VTNC 3HC7A 1QZEA 2UXNA 5LRSA 1U5TA 3Q5FA 4W97A 2FF4A 1KZHA 3K70D 3VYTB 2R7DA 3KLOA 2JSCA 1XGNA 3EPZA 3ABKH 1VFCA 3KCCA 2EZHA 5E8IA 1KQ9A 2FSWA 3OYHA 2Y48A 2JA6J 2VOOA 2VJ4A 4JK1X 2VBWA 1W5TA 3ZCOA 2ZSIB 3F8CA 1IV8A 1AHDP 2JQ7A 1QVUA 3SDGA 4BE2A 2CQNA 3C2HA 4DQ2A 4M3FA 1DPRA 1HA8A 3CUQA 3VB2A 3OYNA 1MNEA 4G8XA 2O8XA 1ETVA 1A6QA 3NEUA 2Z9OA 3BCBA 4A12A 2CQKA 4AU7A 4HF2A 4BYYA 3F22A 5F64A 2XPVA 1VQ5I 4KIBA 1S7OA 1N78A 2ZNZA 1HW2A 2ISZA 1JUSA 5JR3A 4BGDA 3K4NA 4AVZA 4BHCA 1R1VA 1X2NA 1K83J 1QZZA 3MD2A 3WTZA 3GLXA 1O7FA 4GRIA 4NQWB 1XPXA 1LE8B 1TLHB 2JPCA 1FOWA 2DFIA 2EFPA 3ABLH 2BY1A 1K4TA 2NS0A 2ZCWA 2VPRA 2VL8A 4MTDA 1RUOA 2VQGA 2D1VA 2VKHA 3JR9A 1X58A 1ZTRA 3CCVI 3SFIA 5K5QA 5FJ8J 5B66C 2R7QA 1W0TA 3GMEA 1Z67A 2WB1N 4YFXF 4NC6A 4AIDA 4HNUA 4U87A 3NARA 5DS9A 3K1MA 2DI3A 3KP3A 3H5AA 4A6EA 4IHWA 2ME0A 2E7WA 2M5WA 1EA3A 2JSPA 3RSNA 3SJMA 2EFQA 3GZ5A 3M1EA 2OD5A 5HLTA 3HM5A 1NH3A 1BOBA 4G6TB 2DMNA 1ZHFA 4JX5A 4XLFA 3VEPA 3PNYA 5D5XB 4F92B 2HYJA 3G1LA 3H3ZA 2V1UA 4UV8A 1F4KA 3TW6A 1MMSA 2FQ3A 3WE3A 2FQ4A 4IQJA 4KICA 1OCTC 2ELKA 2ZJQF 2JRTA 1EH6A 3HG9A 4ZH4F 2LKSA 2MD0A 3LSIA 3U1DA 2EILH 4DW6A 3REOA 5IYDJ 2MA3A 2M4GA 4OIOF 3BTJA 2FMYA 1OR7A 2JJ7A 3E5XA 4FE7A 1TNSA 1BIBA 5CYVA 5D6FA 1SC7A 1WHUA 2KRHA 3ZN1A 3PO2J 3KETA 3Q9SA 3HBLA 1U9OA 1S7AA 4MTEA 2XAFA 3JCUC 4IOCF 2GXBA 4C2UA 2BXYA 4ON0A 1IRXA 3QYFA 2DA4A 1VQLI 1A36A 3HKZA 4G9YA 1R58A 3IP4B 3OIPA 2OTJI 2XHKA 2L4MA 2DJNA 4XR6A 4HG2A 3ML6A 2NVQJ 2WV0A 2KKOA 4RLQA 3MAJA 3LA7A 2L0KA 3LSKA 1B8IB 3X2QH 2COMA 2WTEA 3TP3A 1XTAA 5J4VA 1IXSB 2UV1A 1Z3YA 3DPLC 3H5RA 1A04A 5K5RA 2KHMA 4DGWB 4UUVA 2RC4A 4Q5SF 2VI6A 1DPUA 2NOGA 3CESA 5KNLA 2QSFX 2HYGD 4D9JA 2ZKZA 5DDGA 3CLOA 2HQ5A 3GX4X 2ZSHB 1K79A 1UELB 4BKXA 4C2MJ 4QPOA 2DYRH 4BJTA 3D5LA 2PBIA 1K61A 1FOXA 5C4JJ 1VNDA 2W48A 2VQCA 2VXZA 4Y33A 2XGEA 3JSOA 4E7IA 3M9AA 5E1ZB 3Q3SA 3GTKJ 1N75A 1BC8C 1R1TA 5LHIA 3ZMTA 2H6BA 1U9NA 3S16J 5M5YJ 3PNTA 4LLNA 2Y0SN 4ABZA 4L0ZB 2KRFA 2DPUA 1U5TB 3OL3A 4OU0A 2Q0OA 4J19A 3WG7H 2VPLA 5DYMA 4ENKA 3A02A 3J7YJ 3LL7A 1RETA 5CVVA 1J09A 1R4MB 3PUBA 3K4JA 1PUFA 4N0BA 2L2OA 3H5NA 2IA2A 4IEJA 1TWCJ 3IUOA 5LRRA 2DT7B 1AA7A 3BOQA 3QP5A 4RM3A 3BZ6A 3VYSB 4DNCA 5HS8A 3ZOBA 4HDVA 2CRGA 4MNUA 2AQEA 4YFKF 4XLPF 1RESA 3EUAA 3HIFA 2H09A 4B4CA 2XAGA 1LFBA 4BS9A 4IJAA 3J81K 1SFUA 3CJRB 1V5GA 2CV1A 4E4HA 1YFHA 3PL8A 1P4WA 1S8NA 5A2QZ 1D0XA 1FP2A 3H9GA 4HX7A 2XIGA 5D5VB 4Y3OA 3JRDA 3BDDA 3JTGA 2V79A 4CDGA 2NS8A 4C3HJ 3GLLA 3M8EA 5E79C 1BR4A 4WX9A 4BQOA 1YJNI 2Q1ZB 2TRTA 4YEJA 3ONQA 2NAZA 2GAUA 4RA2A 5H6QA 3SEZA 1OCRH 4E7ZA 5KHDA 1V5EA 3JRGA 1LEBA 1BM9A 2B9SA 2EV6A 2RAEA 5CJ9A 1EJ9A 5L3CA 2VLAA 4MQVA 3GTLJ 4HEA2 3I0TA 3K4MA 2XSJC 4LIUA 3N05A 1FP1D 4Q4ZF 1R49A 2RV8A 5LLQA 2O8KA 2PEXA 1EF4A 3FIWA 4RAZA 1AOYA 3HSFA 1UHSA 2ZMEC 1XC5A 2QCOA 2O0YA 1YS7A 3ELKA 2M7BA 4D1QA 3OR2C 4XLNF 3QWLA 1PJRA 1G3SA 4IXAA 3SYTA 5JFRA 4PK4A 4XN3A 4RB3C 1ETXA 1OCZH 3PUFA 4S0HB 2BXZA 4P5OA 3S1QJ 3GFJA 3TO9A 4ZYHA 2JUGA 2M8EA 4Q48A 2RGVA 4N4OB 1ETWA 1LVAA 5M3MJ 3LA3A 4QPQA 4ZDPA 1IRZA 3HTUA 1WJBA 1V5FA 1Z1DA 5LHHA 2V4JC 1IF1A 3CCQI 3TL4X 2W25A 2LD5A 4HF0A 1B4AA 4KJZA 1W7PB 5EF6A 2WAEA 3DV8A 1HF0A 1W4MA 5F08A 4G6QA 4R8HA 4A93J 1KA8A 4GCVA 2ME6A 2NYXA 3VFZA 2CV0A 3OYFA 1Y1WJ 2NVTJ 3OR1C 5F1RA 2O9LA 4A6DA 1Q1VA 1FMWA 2ZFUA 2MG4A 3BR0A 1NG7A 5HOOA 3OV8A 4OMZA 1FTZA 1TT5B 3M8JA 4MFEA 1U2WA 5HS9A 1OLTA 2OUMA 1O3TA 1BN5A 2F5FA 2KZGA 3OYIA 4U88A 2FOKA 3WHCA 4A3GJ 4A3IJ 1H9TA 1FBUA 2BV6A 3CTAA 5J40A 3HOSA 5LHGA 1XDUA 3I9V2 2F48A 4BXXJ 1I5ZA 5FD5A 2MH2A 1TWHJ 4HYEA 2PN6A 2FNAA 2R5ZA 1T8IA 2A5WA 3WU1B 2EA2A 5JLXA 1MMDA 5AONA 1IUYA 3HOYJ 2IS2A 1XGMA 2P6TA 4A3MJ 4B1RA 4F91B 4N9IA 3BG6A 2NRAC 5BPIA 4BEHB 3PNVA 4IO9F 4CICA 3E6BA 2HVRA 3F6OA 3JAMK 1FOYA 1R22A 2L3DA 3WGGA 1F5TA 2DA5A 2H8RA 2R4GA 1WKMA 3K69A 2EIKH 2OBPA 3H3UA 2W00A 2FEZA 1Y56A 2MH9A 3OS2A 4BQNA 5CVJA 3F0CA 3BJOA 4P9UA 3JRFA 4RS8A 3DWLE 4M74A 2EZLA 3BG7A 3PFYA 2FD5A 4X6AJ 2D1HA 1OCOH 2OZUA 4L9JA 4KIFA 4RMNA 1L0OC 3KP6A 1X1CA 4RAFA 4EJTA 3KPHA 1WJCA 5TGTA 3BQYA 2BVMA 2XAJA 1B9NA 3KP7A 5BS6A 1Y0NA 1ODDA 5F6FA 1FYKA 2JVGA 2Y2ZA 4EGZA 3KIOA 3I71A 1E3PA 4RGUA 2HKXA 2XSDC 3HRMA 3ZMVA 1H89C 1GV2A 1D1AA 4I76A 2IEKA 2JN6A 3ZQLA 2M87A 5EEAA 4M3GA 4A3KJ 1I6HJ 4LOCA 4LB5A 3G2BA 2DTZA 1X4OA 1T0FC 3CJQB 4U0YA 1MSEC 3I54A 3UNGC 4XKWA 2E35A 2HS5A 2NVYJ 1SVOA 2X6OA 3BP8A 2NVUB 4EM1A 5KAIC 2OJED 3K2ZA 1IDYA 1IN8A 4DIQA 3C7JA 3DEUA 1KGSA 3M8FA 1QBJA 2JA7J 1J59A 4A0XA 3N4MA 3M7GA 4M9ZA 5HDKA 1YG2A 2BY2A 1LFPA 2EB7A 3LAJA 2BHZA 3DKWA 1TBXA 1OYWA 4UY8I 1MJAA 2CH0A 4LLGF 4AVPA 1D5YA 2XV4S 4XOTA 2YU9J 4GYGA 3F3XA 3G1MA 3S2DJ 2WAQN 1FJLA 1X1PA 2Y0SA 2ICWG 1J75A 1SMYF 1UAAA 2IRFG 3RZOJ 2ETHA 2IGMA 1YX3A 3MVPA 3KYLA 2LF8A 3A4CA 1IRFA 3B73A 4YIIA 2A68F 3J7ZI 1KQ0A 3R60A 1QU3A 2JZYA 5LGUA 1MBGA 1RIOH 2KL4A 3H9JA 3T5XA 4RBOA 2WB1A 2PJRB 1CQTA 3MMYB 2VKVA 1JKQC 2JA8J 2OCEA 3HUGB 3SFZA 5FKLA 3AAFA 2RQQA 3HOUJ 5F0CA 2R7RA 1HOMA 2LOOA 5B1AH 4QSHA 1JTYA 3I5UA 5IP7J 3HRUA 1SVMA 3I64A 1H88C 3TQNA 5D8LB 3L1PA 2DOFA 1X2MA 4Q47A 2K40A 3V4GA 2BBYA 3OIOA 2EV0A 4S04A 1B6AA 4GFBA 2EPFA 2QKLB 1R71A 4HPQA 4N9HA 3LSMA 2HYFA 1MH3A 2KZVA 4YIRX 2K3PA 3WTVC 3S2HJ 4DBRA 2H27A 1NTCA 2IAIA 1FY7A 2HU9A 2HVQA 3BR3A 3GTQJ 1ETOA 2HGCA 1K7AA 3K0LA 1WCMJ 1L3LA 4AM3A 2GXGA 2CG4A 4RLFA 4OIRF 5ICCA 1VI0A 1R9TJ 2YX7A 1QPIA 4HNVA 4ENJA 4HV6A 4HA8A 3B02A 2KDOA 3RDIA 1KQ8A 4DZJA 3WTSC 1W5SA 4B3XA 1ERDA 1JT0A 1VZ0A 2Y0MA 1KU3A 2EZIA 2A6HF 1XSXA 2DMQA 1APLC 1SEUA 1IN7A 2Z3YA 2V9PA 4EJUA 2HOTA 5ICFA 5HDGA 1GV5A 1TQIA 2QENA 4PUSA 5J47A 4B8XA 3LQRA 1DGWY 2X0LA 4H4KC 3F8FA 4HAMA 1F43A 5EDNA 1T2KA 2E60A 4L5EA 1YITI 3S3OA 1E3OC 4IHXA 3FMRA 4IKFA 1OYYA 1WPKA 2DODA 1ZLJA 3HJEA 2EQRA 4QLCU 5A2QK 1BR2A 2VBYA 5B1BH 1ZH5A 2E36A 3KZIC 4LLLA 3E3VA 3BLYA 1IGNA 3RIRA 2XGXA 3DTKA 2DAOA 3KLNA 1XS9A 1IDZA 2PJRA 3OSGA 3L2RA 3ECHA 2E1MC 4PSXA 3BJAA 2BE5F 1XMKA 1X3ZB 2LF7A 2TCTA 4NHJA 3S3NA 3RYRA 3L2WA 2HR3A 2VJJA 3R0AA 2OF7A 4U7DA 1W0UA 3MZ8A 4EM0B 2DXIA 2QEXI 3B6CA 2XUBA 1IO2A 2G7UA 4WK8F 1YW9A 4A3LJ 2CU7A 2E1CA 4O6JA 3W2WA 5B5EC 2UWMA 5FLXK 2M45A 3RPUA 1I6XA 3PQKA 2Z5UA 5E20A 5KVRA 1ZRDA 4OOIA 1DU6A 2TDXA 3BR6A 1B8IA 2XKPA 3FBNB 1R6RA 1OCPA 2R7XA 3K4KA 1U8BA 4A3JJ 2LDUA 2R7UA 1JHFA 3LNQA 1Y8RB 1MBKA 3ZN0A 1K78A 2BHYA 1MIJA 2DQLA 3CMMA 3MN2A 1XG1A 4UVCA 2YSRA 1XMAA 2LY2A 3ZMZA 3LWFA 4GGGA 3RKWA 4OAZA 3ZQFA 1FSEA 3CCJI 4HRIA 4OIQF 5GP9A 2QQ9A 1KONA 3HL2A 1E3HA 3SZTA 5ED4A 3DFGA 3A01A 4I09A 2Y30A 2XKOA 1VQPI 4D7NA 2DOEA 3BTCA 2EFOA 3O3KA 4ENNA 4U0VA 3GTPJ 5GPAA 4BNCA 4NUBA 3BG3A 3IH2A 1GLNA 3HSEA 5D5WB 2DJIA 1ZELA 2K02A 2X1DA 3FXMA 1TZLA 5E1WA 3FXUA 4IQ4A 3QODA 1NG6A 1KYZA 2KRCA 2FMLA 3FM5A 3L2CA 1LQ1A 3CDLA 2GQQA 3E5UA 4JX6A 4HLYA 1FOKA 2E34A 3K1NA 5M5WJ 2DT5A 4KNYA 5AIPA 5ILVA 2VKDA 3LSHA 1E17A 2DCEA 3FZVA 3D5RC 3ABUA 2BW3A 1U78A 2M9HA 1FNNA 1ZYRF 2CMPA 2EIJH 5E17F 2IGOA 4FCYA 4EV0A 4X1EA 3IAM2 2OC6A 2CUEA 2FE3A 3SEQA 2RREA 2QBYB 1FWZA 3LMMA 3RI4A 2PMHA 1XGSA 2L7FP 1RUNA 4NNJA 2YS9A 2ZJPF 3TEDA 1X3UA 2MBFA 3TBIA 2F4OB 3BQZA 3RPUD 3DKXA 3GW2A 4NC7A 5J1UA 3K9TA 5L3BA 1EKEA 4HX8A 2VIXA 4UB8C 5FFZA 3PM1A 2OQRA 4JQFA 2V1XA 2V1NA 4LG3A 2IBDA 4TV7A 3CP2A 4ANJA 3TDUC 2P0WA 4KISA 4L5JA 5FKKA 5J6XA 3H1CA 1MJBA 2IW5A 4PSWA 4FISA 2QQAA 3QYEA 2K9SA 1ZG1A 1G6NA 2GOMA 2DPDA 1IW7F 2DDBA 5BOXA 2A5YB 3ABMH 3ERMA 3WTXC 2E1MB 1WH7A 4A3FJ 2ZXWH 2FBKA 2R7OA 4BE0A 3GBGA 4KA4A 5LD2C 1ZR4A 2QUFA 1ENHA 4ZYDA 4CA0A 1TWAJ 3NQOA 4DZPA 2Q8KA 1OCCH 2X48A 2NVXJ 3AG1H 2LY9A 1A5JA 1HKQA 2XRLA 4XONA 3GTGJ 2PQ8A 2H94A 2JVHA 2MSYA 4XKCA 3WE2A 4XIDA 4KT6A 3TKYA 3FXQA 1P92A 3DXJF 4XNFA 3J80Z 1LKXA 5L3FA 1R5ID 5AIQA 2QM3A 2HFHA 5LEKA 3ZQ7A 2FA5A 2LKPA 1YLFA 5DCMB 2GIZA 3BTLA 4CYDA 5CPRB 4I6ZA 1STZA 1ON1A 2IT0A 1I1GA 2NXNB 2VB6A 3F6VA 2ZO4A 4EJVA 2HOSA 2K4JA 2IS1A 5BMZA 2E2HJ 2ZXHA 1B72A 2W85A 2IJLA 3HDDA 2WV1A 4M3DA 2V6CA 2M4KA 1HC8A 1FTTA 3G3ZA 1RC9A 5E3OA 3LQQA 3FISA 3CO7C 5L3DA 2A6EF 2M7AA 3DLAA 3FXOA 1DQUA 3HXLA 4V2FA 1SD7A 3HRSA 2CFXA 1Y0UA 3GUDA 4XM3A 4DYQA 1PYVA 3BG5A 4DYRA 1FT9A 3FDYA 5BPDA 3CDHA 3I59A 4BXUA 5L3EA 3GTMJ 2Y9ZA 4C3JJ
chains in the Genus database with same CATH topology
1YIOA 2VN2A 2IA0A 4LK1F 4BH9A 4IPAA 3COAC 5ILUA 2DQRA 4WXDA 1SFXA 1P4AA 2CWEA 1BI2A 4A0YA 1HW1A 2RDPA 2FXAA 2RKHA 3GFIA 3KFWX 4G94A 2G9WA 3WGHA 4O5VA 3FM3A 3OOPA 1U3EM 4A5NA 1R00A 3CUQB 3L7WA 1FLIA 1MD0A 4ESFA 4G7OF 2Z99A 3MWMA 2HEOA 3P7NA 5D5UB 1Z6TA 3BWGA 2EFNA 3RKXA 3F72A 1XGOA 3V8KA 4I0AA 1S6LA 4YIFA 4CO8A 1JHHA 1ZLKA 3FMSA 4U7BA 1T6SA 5JI6A 5DCFA 1DDNA 3LSTA 1FZPB 3IHUA 1T38A 1YW8A 2ELHA 1RI7A 2PMUA 4EMSA 1YW7A 4M73A 1IXRC 3RPQA 3JTHA 1EH8A 4ZZDA 3WGIA 2VC0A 3BPVA 1TNTA 1ULYA 4EQQA 4RAYA 1BI0A 5TRDA 4L18B 1UFMA 1TQMA 2O3FA 2X4HA 5K1YA 2GA1A 2PLYA 3I59B 4LJZF 3WODF 1S29A 1I27A 2YU3A 1P4XA 2K27A 2W84A 2JT1A 4G7HF 3KEOA 1JE8A 2FRHA 1FBSA 4UVBA 3WTWC 1TW3A 1B1BA 5FLXZ 3IRQA 3BPXA 3W6JB 5HVQC 3KE2A 1O57A 3E6MA 2VBXA 1JXSA 3BJ6A 5A2QZ 1GHCA 5DD8A 5LGTA 1RNLA 5HLIA 4FHTA 4KDPA 2J5OA 3ZMDA 1O3QA 1USSA 1CGPA 3G73A 4EVIA 5L3GA 3EUHA 3ZPLA 4GYIA 2CYYA 2QVOA 1BBYA 2MD5A 1IN4A 2BGCA 1J0RA 5JHUA 4IVNA 2M30A 3IL2A 3HHGA 4KMFA 4U0WA 3DPTA 4HZFA 1FX7A 5D4SA 2F2EA 5CVRA 2MC3A 1R23A 4IRGA 4I98B 2UZKA 4RB2C 1USTA 1XN7A 5IT9K 3GWZA 1JGSA 2DK5A 3TOAA 4A5MA 4OIPF 2HQNA 1R5HA 4EM2A 1TQPA 1SD6A 3O2PE 2IP2A 1WSUA 4WXHA 5TJJA 1PDNC 1ZGAA 4R79A 1YO5C 2CGPA 1J9IA 1LNWA 1MDMA 4Y17A 3PFIA 4HX4A 4HV5A 2FBHA 3QOPA 1O3RA 2BYVE 3QU6A 1K6OA 2L4AA 3QRFF 3L9FA 1ON2A 3FX3A 4UHTA 4YG2F 2BEOA 4IRHA 3V8LA 4KFCA 5DD4A 2HTJA 4LGWA 3ERED 3KP5A 3WTTC 3JAMZ 2KIMA 4WF2A 4IRIA 1FYLA 3IKVA 1MJ9A 1YYVA 2Q2EA 5E18F 3HOTA 5DUIA 2IVMA 1ZAOA 3R4KA 2K86A 3F23A 4XSZF 4B09A 4R1HA 4HLXA 5HS7A 4RGRA 2QYOA 2VBZA 4CXFA 1MZBA 5ILSA 1BC7C 4L5IA 5ICEA 3F8MA 2HOEA 3J7AO 2O61A 2FBIA 3C1DA 3GF2A 1SFEA 1KU7A 4RGXA 4PGGA 2MLKA 6PAXA 5CLSA 4I2OA 3KZZA 3FWEA 2O6GE 4IHTA 2VONA 4KYWA 2A3SA 2XRNA 4OMYA 3GYHX 3IWFA 3I58A 4LG0A 1ZN2A 2F5DA 2IPQX 5IT3A 5J8CA 4HDUA 4WXCA 2EV5A 3P9CA 4AWXB 1IN5A 3MQ0A 2VOPA 1EV7A 3MCZA 4A0ZA 1D3YA 3U9GA 1O3SA 3P9IA 2UXXA 4M6YA 3KEQA 2L02A 1IN6A 2FU4A 4MGRA 2HKOA 2HWVA 1BIAA 2NNYA 4FT8A 1HXDA 4L0YB 2P7VB 4K2EA 4H0EA 2NNNA 3EETA 3FHZA 2VT3A 2LNBA 1XB4A 2JPBA 5LEJA 3SHFA 5IT9Z 3T8RA 3J80K 2DTRA 2Z33A 2STTA 4BHBA 4M9SA 1R5GA 4KIGA 2P5LC 1XSVA 4ENMA 3F8BA 2F5EA 2M1BA 2CO5A 1QGPA 4UVAA 3T0YA 3KP2A 2ESNA 1GVJA 2A07F 3R6SA 2XASA 3CUOA 4M6XA 1GXPA 4L9TA 1IRGA 4AD9A 5BQTA 2AXLA 5DEQA 3I4PA 2L54A 4FX4A 4NQWA 4CHUA 2D45A 4LG0B 1ZARA 5H20A 4G6DA 4HF1A 3I53A 2PJPA 3QU3A 4HW0A 3EYIA 3L00A 4ZZLA 3WG9A 4LFUA 3TDZC 2EK5A 4Z2YA 1TW2A 3IRRA 4ETSA 2QZ8A 2ESHA 5FGMA 1Z9CA 2VE9A 2OU2A 1PP7U 2OA4A 5D8KB 5CVUA 2WWYA 3SQNA 3GFLA 2RQPA 5D6EA 3GVAA 4HQEA 3N97A 1QO0D 3TOBA 3MFKA 3ZMUA 3T1BA 2LSOA 2DW4A 3F8NA 3CJNA 2K7LA 2GA2A 2VT2A 1R1UA 3E6DA 1OYIA 5D4RA 1U8RA 2MLGA 4QWQA 4D0PA 4UV9A 1QZYA 3L09A 4UNOA 3E5QA 2OZ6A 3QPHA 1Z6RA 2HTSA 3GXOA 4ESJA 4GXOA 3MZYA 5DCMA 2KJBA 1ZGJA 1BI1A 4JBAA 3U2RA 4UXNA 2F5CA 1WWXA 4RB0A 3HHHA 5FD6A 3ABTA 4AIKA 2VE8A 1NHAA 1J7KA 1U6GA 4KN7X 4G7ZF 5HLGA 2FNPA 1KYWA 2A69F 3ULQB 3VOEA 3H92A 4BHPA 1OMIA 1PP8F 1QQIA 4ZYGA 3O6BB 1ZREA 1J2XA 2DLLA 4HQMA 4ZYEA 1T98A 3FF5A 2XVCA 1YQAA 1C0WA 1P2FA 5ICGA 4EGYA 1G3YA 1YS6A 1YTYA 4AIJA 1I1SA 4MEYF 2DBBA 2E1NA 4M71A 4Y15A 1ZG5A 1IZ1A 3GEZA 2ZMEB 3FMQA 3HYIA 1G3WA 4L9NA 4A2UA 2EJRA 2YPRA 2DK8A 3J81Z 1HKSA 4I0BA 2VC1A 4GO1A 3HUGA 5HLHA 2W24A 3ISPA 1HBXG 1XDSA 4IHSA 3V8JA 3BROA 2XROA 3ZMSA 1SAXA 1ONVA 1WRJA 2C6YA 5E8GA 2ZFWA 1XCVA 4XRFA 1FPQA 2R3SA 2CSOA 1RZ4A 1F1ZA 1UB9A 3D0SA 2EA4A 4KN4X 1W7PA 4LK0F 1F9NA 2L01A 1D8KA 1DP7P 2RN7A 2ACJA 5LGNA 3JW4A 1P6RA 1HSTA 1U5TC 1HW5A 1R36A 3R61A 3IC7A 3WTUC 4FX0A 4S05A 2B0LA 3QPTA 2PFBA 4KUMA 1LEAA 2HQRA 2D2WA 4MHGA 3QAHA 2QQBA 3SXYA 1XSDA 1BOAA 2DO7A 1T0FA 1H9GA 1R7JA 3Q9VA 5LBQA 2KJCA 1PUEE 3GZ6A 4BAYA 2DU9A 4EJWA 1WQ2A 4Y13A 2V9VA 2GIVA 3P9KA 1MDMB 1OKRA 4PGHA 5JVTA 1J5YA 3V7RA 4ESBA 5J8FA 2ZNYA 1GXQA 2ZBKA 1W7PD 3EYYA 3MZHA 5ERIA 2ZJ2A 2JTVA 4KMUX 2KIUA 2QWWA 3DF8A 3CUQC 1HKTA 1Z91A 2YX4A 1FC3A 1Z05A 5H6RA 3JSPA 2ISYA 2R7FA 1K78B 2ADUA 4M72A 3S2WA 1IAWA 3ROUA 1TTYA 2P5VA 3QP6A 2O03A 4PZJA 1SMTA 1LJ9A 4CGZA 2YR2A 1UHMA 4I02A 1MGTA 3DP7A 1BJAA 1Z7UA 3WU0A 2GWRA 3LFKA 4KT5C 3V7CA 3W6KB 1B9MA 2ZMEA 4RGSA 4WCGA 1UCRA 5KK1A 1O7LA 2Y75A 4HBLA 3VODA 1WI9A 3RJPA 3LAPA 2XAHA 3DQVC 3IWZA 3ECOA 2P6SA 1D8JA 2RNJA 1UHWA 3E97A 4PDKA 1FYMA 2J5PA 3K1PA 4AIHA 2CW0F 3ZP5A 1CF7A 3E6CC 4P96A 1SD5A 3TGNA 4O3MA 5CVIA 3SZPA 2P5KA 5DV5A 2HZTA 1G4DA 3MEXA 4WWCA 1QNTA 1QPMA 2PG4A 2KIFA 2V1DA 1KU2A 1BI3A 4RB1A 1MKMA 5EEHA 1IXCA 3IKTA 1ZG3A 2K4BA 4ASNA 2P4WA 4BQAA 3TO7A 1XD7A 2WC2A 1FBQA 4CZZA 4PCQA 1D5VA 2QLZA 4XBFA 1DUXC 1B59A 1KU9A 2H6CA 3F21A 2OQGA 2P7CB 3HRTA 2RVCA 1T39A 3EQLF 2P8TA 4NB5A 3V7SA 1ZRFA 1LDDA 1REPC 2VODA 2IA1A 3HTSB 1Q1HA 2G7HA 1EH7A 1SD4A 4L9VA 3RYPA 2OAZA 2ZXJA 5DUKA 2GZWA 1H0MA 3RKYA 4XSXF 5K5OA 3NRVA 4OINF 3EDPA 4MEXF 1OPCA 4P9FA 4LMYA 4I7HA 4F7ZA 4LB6B 1LDJA 5FO5A 1HSJA 2E7XA 2XAQA 3GFMA 4EJOA 4IF4A 3KZYA 2QBYA 4HOBA 4I01A 1LB2A 5HDNA 3T8TA 1E2XA 3KP4A 1HQCA 2AS5F 1V4RA 3GO5A 1S3JA 3PQJA 5EEGA 1XCBA 3R0JA 5E1XA 3C3WA 3FXRA 2EFWA 2HDCA 3HSRA 1G3TA 3WTYC 3C18A 2A61A 3RTRA 5FFXA 1ZRCA 1AWCA 4MQ9F 5FB2A 1V3FA 1FSHA 3TO6A 2W57A 4P55A 2PI0A 3LA2A 4E70A 1LDKB 2EWNA 1CF7B 4LD5A 4M9XA 4YFNF 2STWA 3BY6A 3CO6C 1VTNC 2UXNA 5LRSA 1U5TA 3Q5FA 2FF4A 2R7DA 3KLOA 2JSCA 1XGNA 3KCCA 5E8IA 1KQ9A 2FSWA 2VOOA 2Y48A 4JK1X 2VBWA 1W5TA 3F8CA 4DQ2A 1DPRA 3CUQA 3VB2A 4G8XA 2O8XA 3NEUA 2Z9OA 4A12A 2CQKA 4HF2A 4BYYA 3F22A 5F64A 4KIBA 1S7OA 2ZNZA 1HW2A 2ISZA 5JR3A 4BHCA 1R1VA 1QZZA 3WTZA 3GLXA 1O7FA 1TLHB 2JPCA 2EFPA 2DFIA 2NS0A 2ZCWA 4MTDA 1RUOA 2D1VA 5K5QA 4YFXF 3K1MA 2DI3A 4A6EA 3KP3A 2E7WA 2M5WA 2EFQA 3GZ5A 3M1EA 2OD5A 5D5XB 1ZHFA 3VEPA 2V1UA 3H3ZA 4UV8A 1F4KA 2FQ3A 3WE3A 4KICA 2JRTA 1EH6A 4ZH4F 3U1DA 3REOA 2MA3A 4OIOF 2FMYA 1OR7A 3E5XA 1TNSA 1BIBA 5CYVA 5D6FA 3ZN1A 3KETA 3Q9SA 1S7AA 4MTEA 2XAFA 2GXBA 4ON0A 4G9YA 1R58A 2XHKA 2L4MA 3ML6A 2WV0A 2KKOA 3MAJA 3LA7A 2COMA 2WTEA 1IXSB 3DPLC 4UUVA 4Q5SF 5K5RA 1A04A 1DPUA 2RC4A 2HYGD 2ZKZA 5DDGA 3CLOA 3GX4X 1K79A 3D5LA 2PBIA 2VXZA 3JSOA 3M9AA 5E1ZB 1BC8C 1R1TA 5LHIA 3ZMTA 2H6BA 4LLNA 4L0ZB 2KRFA 2DPUA 1U5TB 4OU0A 2Q0OA 5DYMA 4ENKA 5CVVA 4N0BA 2IA2A 5LRRA 3BOQA 3QP5A 3BZ6A 4DNCA 5HS8A 4HDVA 4MNUA 4YFKF 4XLPF 3HIFA 2H09A 2XAGA 3J81K 4IJAA 1SFUA 1YFHA 1P4WA 1S8NA 1FP2A 4HX7A 2XIGA 5D5VB 3JTGA 3BDDA 2V79A 4CDGA 3M8EA 4WX9A 2NAZA 2GAUA 5H6QA 1LEBA 1BM9A 2EV6A 5CJ9A 5L3CA 4MQVA 3I0TA 1FP1D 4Q4ZF 2RV8A 5LLQA 2PEXA 4RAZA 1AOYA 3HSFA 2O0YA 1YS7A 3ELKA 4XLNF 1G3SA 4IXAA 5JFRA 4RB3C 4P5OA 3GFJA 3TO9A 4ZYHA 2M8EA 4Q48A 2RGVA 1LVAA 3LA3A 3HTUA 1Z1DA 5LHHA 1IF1A 2W25A 4HF0A 1B4AA 1W7PB 3DV8A 1W4MA 4G6QA 4R8HA 1KA8A 4GCVA 2NYXA 3VFZA 5F1RA 4A6DA 5HOOA 3OV8A 4OMZA 1U2WA 5HS9A 1O3TA 1BN5A 2F5FA 4U88A 2FOKA 1H9TA 1FBUA 2BV6A 3CTAA 3HOSA 5LHGA 1XDUA 1I5ZA 5FD5A 2MH2A 4HYEA 2PN6A 2FNAA 3WU1B 2EA2A 5AONA 1IUYA 1XGMA 2P6TA 4N9IA 2NRAC 5BPIA 4CICA 3E6BA 3F6OA 3JAMK 1R22A 2L3DA 3WGGA 1F5TA 1WKMA 3K69A 2OBPA 3H3UA 2FEZA 2MH9A 5CVJA 4P9UA 3BJOA 4RS8A 4M74A 2D1HA 2OZUA 4L9JA 4KIFA 1L0OC 3KP6A 4EJTA 2XAJA 1B9NA 3KP7A 5BS6A 1ODDA 5F6FA 1FYKA 4EGZA 3I71A 4RGUA 2HKXA 3HRMA 3ZMVA 2M87A 4LB5A 4U0YA 3I54A 2HS5A 3BP8A 4EM1A 3K2ZA 1IN8A 3C7JA 3DEUA 1KGSA 3M8FA 1QBJA 1J59A 4A0XA 3N4MA 3M7GA 4M9ZA 5HDKA 1YG2A 2EB7A 3LAJA 3DKWA 1TBXA 1OYWA 1MJAA 4LLGF 4AVPA 2XV4S 4GYGA 3F3XA 1J75A 1SMYF 2IRFG 2ETHA 2LF8A 1IRFA 3B73A 4YIIA 2A68F 1KQ0A 3R60A 2JZYA 5LGUA 1RIOH 3T5XA 3SFZA 3AAFA 3I5UA 3HRUA 3I64A 3TQNA 5D8LB 4Q47A 3V4GA 2BBYA 4S04A 2EV0A 1B6AA 4N9HA 2HYFA 3WTVC 2H27A 1FY7A 2HGCA 1K7AA 3K0LA 1L3LA 2GXGA 2CG4A 4OIRF 5ICCA 2YX7A 4ENJA 4HV6A 4HA8A 3B02A 3RDIA 1KQ8A 3WTSC 1W5SA 2Y0MA 1KU3A 2A6HF 1XSXA 1IN7A 2Z3YA 4EJUA 5ICFA 5HDGA 1TQIA 2QENA 4B8XA 3LQRA 2X0LA 3F8FA 4HAMA 1T2KA 3FMRA 1OYYA 1ZLJA 5A2QK 4QLCU 2VBYA 1ZH5A 4LLLA 3E3VA 3RIRA 2XGXA 2DAOA 3KLNA 3ECHA 3BJAA 2BE5F 1XMKA 2LF7A 4NHJA 3RYRA 2HR3A 3R0AA 4U7DA 4EM0B 2XUBA 2G7UA 4WK8F 1YW9A 2E1CA 4O6JA 2UWMA 5FLXK 2M45A 3RPUA 1I6XA 3PQKA 2Z5UA 5E20A 5KVRA 1ZRDA 4OOIA 2TDXA 2XKPA 2LDUA 1JHFA 3ZN0A 1K78A 2DQLA 4UVCA 2YSRA 1XMAA 3ZMZA 3LWFA 4GGGA 3RKWA 4OIQF 1FSEA 2QQ9A 3SZTA 5ED4A 3DFGA 4I09A 2XKOA 3O3KA 2EFOA 4ENNA 4U0VA 4BNCA 3HSEA 5D5WB 2K02A 5E1WA 3FXUA 1KYZA 2FMLA 3FM5A 3L2CA 1LQ1A 2GQQA 3E5UA 4HLYA 1FOKA 3K1NA 2DT5A 4KNYA 5AIPA 5ILVA 1E17A 3FZVA 3ABUA 1U78A 1FNNA 1ZYRF 5E17F 4EV0A 2FE3A 2QBYB 1FWZA 3RI4A 2PMHA 1XGSA 1RUNA 1X3UA 2MBFA 3GW2A 3K9TA 5L3BA 4HX8A 5FFZA 2OQRA 4JQFA 2V1XA 4TV7A 3TDUC 4L5JA 5J6XA 1MJBA 2IW5A 2QQAA 1ZG1A 1G6NA 2DPDA 1IW7F 5BOXA 2A5YB 3WTXC 2FBKA 4KA4A 2QUFA 4ZYDA 3NQOA 2Q8KA 1HKQA 2PQ8A 2H94A 3WE2A 3TKYA 3FXQA 1P92A 3DXJF 3J80Z 5L3FA 5AIQA 5LEKA 2QM3A 2HFHA 3ZQ7A 2FA5A 2LKPA 1YLFA 5DCMB 4CYDA 1STZA 1ON1A 2IT0A 1I1GA 4EJVA 3F6VA 2ZO4A 2K4JA 5BMZA 2W85A 2IJLA 2V6CA 3G3ZA 3LQQA 3CO7C 5L3DA 2A6EF 1SD7A 3HRSA 2CFXA 1Y0UA 3GUDA 1FT9A 5BPDA 3CDHA 3I59A 4BXUA 5L3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIO A;  2VN2 A;  2IA0 A;  4LK1 F;  4BH9 A;  4IPA A;  3COA C;  5ILU A;  2DQR A;  4WXD A;  1SFX A;  1P4A A;  2CWE A;  1BI2 A;  4A0Y A;  1HW1 A;  2RDP A;  2FXA A;  2RKH A;  3GFI A;  3KFW X;  4G94 A;  2G9W A;  3WGH A;  4O5V A;  3FM3 A;  3OOP A;  1U3E M;  4A5N A;  1R00 A;  3CUQ B;  3L7W A;  1FLI A;  1MD0 A;  4ESF A;  4G7O F;  2Z99 A;  3MWM A;  2HEO A;  3P7N A;  5D5U B;  1Z6T A;  3BWG A;  2EFN A;  3RKX A;  3F72 A;  1XGO A;  3V8K A;  4I0A A;  1S6L A;  4YIF A;  4CO8 A;  1JHH A;  1ZLK A;  3FMS A;  4U7B A;  1T6S A;  5JI6 A;  5DCF A;  1DDN A;  3LST A;  1FZP B;  3IHU A;  1T38 A;  1YW8 A;  2ELH A;  1RI7 A;  2PMU A;  4EMS A;  1YW7 A;  4M73 A;  1IXR C;  3RPQ A;  3JTH A;  1EH8 A;  4ZZD A;  3WGI A;  2VC0 A;  3BPV A;  1TNT A;  1ULY A;  4EQQ A;  4RAY A;  1BI0 A;  5TRD A;  4L18 B;  1UFM A;  1TQM A;  2O3F A;  2X4H A;  5K1Y A;  2GA1 A;  2PLY A;  3I59 B;  4LJZ F;  3WOD F;  1S29 A;  1I27 A;  2YU3 A;  1P4X A;  2K27 A;  2W84 A;  2JT1 A;  4G7H F;  3KEO A;  1JE8 A;  2FRH A;  1FBS A;  4UVB A;  3WTW C;  1TW3 A;  1B1B A;  5FLX Z;  3IRQ A;  3BPX A;  3W6J B;  5HVQ C;  3KE2 A;  1O57 A;  3E6M A;  2VBX A;  1JXS A;  3BJ6 A;  5A2Q Z;  1GHC A;  5DD8 A;  5LGT A;  1RNL A;  5HLI A;  4FHT A;  4KDP A;  2J5O A;  3ZMD A;  1O3Q A;  1USS A;  1CGP A;  3G73 A;  4EVI A;  5L3G A;  3EUH A;  3ZPL A;  4GYI A;  2CYY A;  2QVO A;  1BBY A;  2MD5 A;  1IN4 A;  2BGC A;  1J0R A;  5JHU A;  4IVN A;  2M30 A;  3IL2 A;  3HHG A;  4KMF A;  4U0W A;  3DPT A;  4HZF A;  1FX7 A;  5D4S A;  2F2E A;  5CVR A;  2MC3 A;  1R23 A;  4IRG A;  4I98 B;  2UZK A;  4RB2 C;  1UST A;  1XN7 A;  5IT9 K;  3GWZ A;  1JGS A;  2DK5 A;  3TOA A;  4A5M A;  4OIP F;  2HQN A;  1R5H A;  4EM2 A;  1TQP A;  1SD6 A;  3O2P E;  2IP2 A;  1WSU A;  4WXH A;  5TJJ A;  1PDN C;  1ZGA A;  4R79 A;  1YO5 C;  2CGP A;  1J9I A;  1LNW A;  1MDM A;  4Y17 A;  3PFI A;  4HX4 A;  4HV5 A;  2FBH A;  3QOP A;  1O3R A;  2BYV E;  3QU6 A;  1K6O A;  2L4A A;  3QRF F;  3L9F A;  1ON2 A;  3FX3 A;  4UHT A;  4YG2 F;  2BEO A;  4IRH A;  3V8L A;  4KFC A;  5DD4 A;  2HTJ A;  4LGW A;  3ERE D;  3KP5 A;  3WTT C;  3JAM Z;  2KIM A;  4WF2 A;  4IRI A;  1FYL A;  3IKV A;  1MJ9 A;  1YYV A;  2Q2E A;  5E18 F;  3HOT A;  5DUI A;  2IVM A;  1ZAO A;  3R4K A;  2K86 A;  3F23 A;  4XSZ F;  4B09 A;  4R1H A;  4HLX A;  5HS7 A;  4RGR A;  2QYO A;  2VBZ A;  4CXF A;  1MZB A;  5ILS A;  1BC7 C;  4L5I A;  5ICE A;  3F8M A;  2HOE A;  3J7A O;  2O61 A;  2FBI A;  3C1D A;  3GF2 A;  1SFE A;  1KU7 A;  4RGX A;  4PGG A;  2MLK A;  6PAX A;  5CLS A;  4I2O A;  3KZZ A;  3FWE A;  2O6G E;  4IHT A;  2VON A;  4KYW A;  2A3S A;  2XRN A;  4OMY A;  3GYH X;  3IWF A;  3I58 A;  4LG0 A;  1ZN2 A;  2F5D A;  2IPQ X;  5IT3 A;  5J8C A;  4HDU A;  4WXC A;  2EV5 A;  3P9C A;  4AWX B;  1IN5 A;  3MQ0 A;  2VOP A;  1EV7 A;  3MCZ A;  4A0Z A;  1D3Y A;  3U9G A;  1O3S A;  3P9I A;  2UXX A;  4M6Y A;  3KEQ A;  2L02 A;  1IN6 A;  2FU4 A;  4MGR A;  2HKO A;  2HWV A;  1BIA A;  2NNY A;  4FT8 A;  1HXD A;  4L0Y B;  2P7V B;  4K2E A;  4H0E A;  2NNN A;  3EET A;  3FHZ A;  2VT3 A;  2LNB A;  1XB4 A;  2JPB A;  5LEJ A;  3SHF A;  5IT9 Z;  3T8R A;  3J80 K;  2DTR A;  2Z33 A;  2STT A;  4BHB A;  4M9S A;  1R5G A;  4KIG A;  2P5L C;  1XSV A;  4ENM A;  3F8B A;  2F5E A;  2M1B A;  2CO5 A;  1QGP A;  4UVA A;  3T0Y A;  3KP2 A;  2ESN A;  1GVJ A;  2A07 F;  3R6S A;  2XAS A;  3CUO A;  4M6X A;  1GXP A;  4L9T A;  1IRG A;  4AD9 A;  5BQT A;  2AXL A;  5DEQ A;  3I4P A;  2L54 A;  4FX4 A;  4NQW A;  4CHU A;  2D45 A;  4LG0 B;  1ZAR A;  5H20 A;  4G6D A;  4HF1 A;  3I53 A;  2PJP A;  3QU3 A;  4HW0 A;  3EYI A;  3L00 A;  4ZZL A;  3WG9 A;  4LFU A;  3TDZ C;  2EK5 A;  4Z2Y A;  1TW2 A;  3IRR A;  4ETS A;  2QZ8 A;  2ESH A;  5FGM A;  1Z9C A;  2VE9 A;  2OU2 A;  1PP7 U;  2OA4 A;  5D8K B;  5CVU A;  2WWY A;  3SQN A;  3GFL A;  2RQP A;  5D6E A;  3GVA A;  4HQE A;  3N97 A;  1QO0 D;  3TOB A;  3MFK A;  3ZMU A;  3T1B A;  2LSO A;  2DW4 A;  3F8N A;  3CJN A;  2K7L A;  2GA2 A;  2VT2 A;  1R1U A;  3E6D A;  1OYI A;  5D4R A;  1U8R A;  2MLG A;  4QWQ A;  4D0P A;  4UV9 A;  1QZY A;  3L09 A;  4UNO A;  3E5Q A;  2OZ6 A;  3QPH A;  1Z6R A;  2HTS A;  3GXO A;  4ESJ A;  4GXO A;  3MZY A;  5DCM A;  2KJB A;  1ZGJ A;  1BI1 A;  4JBA A;  3U2R A;  4UXN A;  2F5C A;  1WWX A;  4RB0 A;  3HHH A;  5FD6 A;  3ABT A;  4AIK A;  2VE8 A;  1NHA A;  1J7K A;  1U6G A;  4KN7 X;  4G7Z F;  5HLG A;  2FNP A;  1KYW A;  2A69 F;  3ULQ B;  3VOE A;  3H92 A;  4BHP A;  1OMI A;  1PP8 F;  1QQI A;  4ZYG A;  3O6B B;  1ZRE A;  1J2X A;  2DLL A;  4HQM A;  4ZYE A;  1T98 A;  3FF5 A;  2XVC A;  1YQA A;  1C0W A;  1P2F A;  5ICG A;  4EGY A;  1G3Y A;  1YS6 A;  1YTY A;  4AIJ A;  1I1S A;  4MEY F;  2DBB A;  2E1N A;  4M71 A;  4Y15 A;  1ZG5 A;  1IZ1 A;  3GEZ A;  2ZME B;  3FMQ A;  3HYI A;  1G3W A;  4L9N A;  4A2U A;  2EJR A;  2YPR A;  2DK8 A;  3J81 Z;  1HKS A;  4I0B A;  2VC1 A;  4GO1 A;  3HUG A;  5HLH A;  2W24 A;  3ISP A;  1HBX G;  1XDS A;  4IHS A;  3V8J A;  3BRO A;  2XRO A;  3ZMS A;  1SAX A;  1ONV A;  1WRJ A;  2C6Y A;  5E8G A;  2ZFW A;  1XCV A;  4XRF A;  1FPQ A;  2R3S A;  2CSO A;  1RZ4 A;  1F1Z A;  1UB9 A;  3D0S A;  2EA4 A;  4KN4 X;  1W7P A;  4LK0 F;  1F9N A;  2L01 A;  1D8K A;  1DP7 P;  2RN7 A;  2ACJ A;  5LGN A;  3JW4 A;  1P6R A;  1HST A;  1U5T C;  1HW5 A;  1R36 A;  3R61 A;  3IC7 A;  3WTU C;  4FX0 A;  4S05 A;  2B0L A;  3QPT A;  2PFB A;  4KUM A;  1LEA A;  2HQR A;  2D2W A;  4MHG A;  3QAH A;  2QQB A;  3SXY A;  1XSD A;  1BOA A;  2DO7 A;  1T0F A;  1H9G A;  1R7J A;  3Q9V A;  5LBQ A;  2KJC A;  1PUE E;  3GZ6 A;  4BAY A;  2DU9 A;  4EJW A;  1WQ2 A;  4Y13 A;  2V9V A;  2GIV A;  3P9K A;  1MDM B;  1OKR A;  4PGH A;  5JVT A;  1J5Y A;  3V7R A;  4ESB A;  5J8F A;  2ZNY A;  1GXQ A;  2ZBK A;  1W7P D;  3EYY A;  3MZH A;  5ERI A;  2ZJ2 A;  2JTV A;  4KMU X;  2KIU A;  2QWW A;  3DF8 A;  3CUQ C;  1HKT A;  1Z91 A;  2YX4 A;  1FC3 A;  1Z05 A;  5H6R A;  3JSP A;  2ISY A;  2R7F A;  1K78 B;  2ADU A;  4M72 A;  3S2W A;  1IAW A;  3ROU A;  1TTY A;  2P5V A;  3QP6 A;  2O03 A;  4PZJ A;  1SMT A;  1LJ9 A;  4CGZ A;  2YR2 A;  1UHM A;  4I02 A;  1MGT A;  3DP7 A;  1BJA A;  1Z7U A;  3WU0 A;  2GWR A;  3LFK A;  4KT5 C;  3V7C A;  3W6K B;  1B9M A;  2ZME A;  4RGS A;  4WCG A;  1UCR A;  5KK1 A;  1O7L A;  2Y75 A;  4HBL A;  3VOD A;  1WI9 A;  3RJP A;  3LAP A;  2XAH A;  3DQV C;  3IWZ A;  3ECO A;  2P6S A;  1D8J A;  2RNJ A;  1UHW A;  3E97 A;  4PDK A;  1FYM A;  2J5P A;  3K1P A;  4AIH A;  2CW0 F;  3ZP5 A;  1CF7 A;  3E6C C;  4P96 A;  1SD5 A;  3TGN A;  4O3M A;  5CVI A;  3SZP A;  2P5K A;  5DV5 A;  2HZT A;  1G4D A;  3MEX A;  4WWC A;  1QNT A;  1QPM A;  2PG4 A;  2KIF A;  2V1D A;  1KU2 A;  1BI3 A;  4RB1 A;  1MKM A;  5EEH A;  1IXC A;  3IKT A;  1ZG3 A;  2K4B A;  4ASN A;  2P4W A;  4BQA A;  3TO7 A;  1XD7 A;  2WC2 A;  1FBQ A;  4CZZ A;  4PCQ A;  1D5V A;  2QLZ A;  4XBF A;  1DUX C;  1B59 A;  1KU9 A;  2H6C A;  3F21 A;  2OQG A;  2P7C B;  3HRT A;  2RVC A;  1T39 A;  3EQL F;  2P8T A;  4NB5 A;  3V7S A;  1ZRF A;  1LDD A;  1REP C;  2VOD A;  2IA1 A;  3HTS B;  1Q1H A;  2G7H A;  1EH7 A;  1SD4 A;  4L9V A;  3RYP A;  2OAZ A;  2ZXJ A;  5DUK A;  2GZW A;  1H0M A;  3RKY A;  4XSX F;  5K5O A;  3NRV A;  4OIN F;  3EDP A;  4MEX F;  1OPC A;  4P9F A;  4LMY A;  4I7H A;  4F7Z A;  4LB6 B;  1LDJ A;  5FO5 A;  1HSJ A;  2E7X A;  2XAQ A;  3GFM A;  4EJO A;  4IF4 A;  3KZY A;  2QBY A;  4HOB A;  4I01 A;  1LB2 A;  5HDN A;  3T8T A;  1E2X A;  3KP4 A;  1HQC A;  2AS5 F;  1V4R A;  3GO5 A;  1S3J A;  3PQJ A;  5EEG A;  1XCB A;  3R0J A;  5E1X A;  3C3W A;  3FXR A;  2EFW A;  2HDC A;  3HSR A;  1G3T A;  3WTY C;  3C18 A;  2A61 A;  3RTR A;  5FFX A;  1ZRC A;  1AWC A;  4MQ9 F;  5FB2 A;  1V3F A;  1FSH A;  3TO6 A;  2W57 A;  4P55 A;  2PI0 A;  3LA2 A;  4E70 A;  1LDK B;  2EWN A;  1CF7 B;  4LD5 A;  4M9X A;  4YFN F;  2STW A;  3BY6 A;  3CO6 C;  1VTN C;  2UXN A;  5LRS A;  1U5T A;  3Q5F A;  2FF4 A;  2R7D A;  3KLO A;  2JSC A;  1XGN A;  3KCC A;  5E8I A;  1KQ9 A;  2FSW A;  2VOO A;  2Y48 A;  4JK1 X;  2VBW A;  1W5T A;  3F8C A;  4DQ2 A;  1DPR A;  3CUQ A;  3VB2 A;  4G8X A;  2O8X A;  3NEU A;  2Z9O A;  4A12 A;  2CQK A;  4HF2 A;  4BYY A;  3F22 A;  5F64 A;  4KIB A;  1S7O A;  2ZNZ A;  1HW2 A;  2ISZ A;  5JR3 A;  4BHC A;  1R1V A;  1QZZ A;  3WTZ A;  3GLX A;  1O7F A;  1TLH B;  2JPC A;  2EFP A;  2DFI A;  2NS0 A;  2ZCW A;  4MTD A;  1RUO A;  2D1V A;  5K5Q A;  4YFX F;  3K1M A;  2DI3 A;  4A6E A;  3KP3 A;  2E7W A;  2M5W A;  2EFQ A;  3GZ5 A;  3M1E A;  2OD5 A;  5D5X B;  1ZHF A;  3VEP A;  2V1U A;  3H3Z A;  4UV8 A;  1F4K A;  2FQ3 A;  3WE3 A;  4KIC A;  2JRT A;  1EH6 A;  4ZH4 F;  3U1D A;  3REO A;  2MA3 A;  4OIO F;  2FMY A;  1OR7 A;  3E5X A;  1TNS A;  1BIB A;  5CYV A;  5D6F A;  3ZN1 A;  3KET A;  3Q9S A;  1S7A A;  4MTE A;  2XAF A;  2GXB A;  4ON0 A;  4G9Y A;  1R58 A;  2XHK A;  2L4M A;  3ML6 A;  2WV0 A;  2KKO A;  3MAJ A;  3LA7 A;  2COM A;  2WTE A;  1IXS B;  3DPL C;  4UUV A;  4Q5S F;  5K5R A;  1A04 A;  1DPU A;  2RC4 A;  2HYG D;  2ZKZ A;  5DDG A;  3CLO A;  3GX4 X;  1K79 A;  3D5L A;  2PBI A;  2VXZ A;  3JSO A;  3M9A A;  5E1Z B;  1BC8 C;  1R1T A;  5LHI A;  3ZMT A;  2H6B A;  4LLN A;  4L0Z B;  2KRF A;  2DPU A;  1U5T B;  4OU0 A;  2Q0O A;  5DYM A;  4ENK A;  5CVV A;  4N0B A;  2IA2 A;  5LRR A;  3BOQ A;  3QP5 A;  3BZ6 A;  4DNC A;  5HS8 A;  4HDV A;  4MNU A;  4YFK F;  4XLP F;  3HIF A;  2H09 A;  2XAG A;  3J81 K;  4IJA A;  1SFU A;  1YFH A;  1P4W A;  1S8N A;  1FP2 A;  4HX7 A;  2XIG A;  5D5V B;  3JTG A;  3BDD A;  2V79 A;  4CDG A;  3M8E A;  4WX9 A;  2NAZ A;  2GAU A;  5H6Q A;  1LEB A;  1BM9 A;  2EV6 A;  5CJ9 A;  5L3C A;  4MQV A;  3I0T A;  1FP1 D;  4Q4Z F;  2RV8 A;  5LLQ A;  2PEX A;  4RAZ A;  1AOY A;  3HSF A;  2O0Y A;  1YS7 A;  3ELK A;  4XLN F;  1G3S A;  4IXA A;  5JFR A;  4RB3 C;  4P5O A;  3GFJ A;  3TO9 A;  4ZYH A;  2M8E A;  4Q48 A;  2RGV A;  1LVA A;  3LA3 A;  3HTU A;  1Z1D A;  5LHH A;  1IF1 A;  2W25 A;  4HF0 A;  1B4A A;  1W7P B;  3DV8 A;  1W4M A;  4G6Q A;  4R8H A;  1KA8 A;  4GCV A;  2NYX A;  3VFZ A;  5F1R A;  4A6D A;  5HOO A;  3OV8 A;  4OMZ A;  1U2W A;  5HS9 A;  1O3T A;  1BN5 A;  2F5F A;  4U88 A;  2FOK A;  1H9T A;  1FBU A;  2BV6 A;  3CTA A;  3HOS A;  5LHG A;  1XDU A;  1I5Z A;  5FD5 A;  2MH2 A;  4HYE A;  2PN6 A;  2FNA A;  3WU1 B;  2EA2 A;  5AON A;  1IUY A;  1XGM A;  2P6T A;  4N9I A;  2NRA C;  5BPI A;  4CIC A;  3E6B A;  3F6O A;  3JAM K;  1R22 A;  2L3D A;  3WGG A;  1F5T A;  1WKM A;  3K69 A;  2OBP A;  3H3U A;  2FEZ A;  2MH9 A;  5CVJ A;  4P9U A;  3BJO A;  4RS8 A;  4M74 A;  2D1H A;  2OZU A;  4L9J A;  4KIF A;  1L0O C;  3KP6 A;  4EJT A;  2XAJ A;  1B9N A;  3KP7 A;  5BS6 A;  1ODD A;  5F6F A;  1FYK A;  4EGZ A;  3I71 A;  4RGU A;  2HKX A;  3HRM A;  3ZMV A;  2M87 A;  4LB5 A;  4U0Y A;  3I54 A;  2HS5 A;  3BP8 A;  4EM1 A;  3K2Z A;  1IN8 A;  3C7J A;  3DEU A;  1KGS A;  3M8F A;  1QBJ A;  1J59 A;  4A0X A;  3N4M A;  3M7G A;  4M9Z A;  5HDK A;  1YG2 A;  2EB7 A;  3LAJ A;  3DKW A;  1TBX A;  1OYW A;  1MJA A;  4LLG F;  4AVP A;  2XV4 S;  4GYG A;  3F3X A;  1J75 A;  1SMY F;  2IRF G;  2ETH A;  2LF8 A;  1IRF A;  3B73 A;  4YII A;  2A68 F;  1KQ0 A;  3R60 A;  2JZY A;  5LGU A;  1RIO H;  3T5X A;  3SFZ A;  3AAF A;  3I5U A;  3HRU A;  3I64 A;  3TQN A;  5D8L B;  4Q47 A;  3V4G A;  2BBY A;  4S04 A;  2EV0 A;  1B6A A;  4N9H A;  2HYF A;  3WTV C;  2H27 A;  1FY7 A;  2HGC A;  1K7A A;  3K0L A;  1L3L A;  2GXG A;  2CG4 A;  4OIR F;  5ICC A;  2YX7 A;  4ENJ A;  4HV6 A;  4HA8 A;  3B02 A;  3RDI A;  1KQ8 A;  3WTS C;  1W5S A;  2Y0M A;  1KU3 A;  2A6H F;  1XSX A;  1IN7 A;  2Z3Y A;  4EJU A;  5ICF A;  5HDG A;  1TQI A;  2QEN A;  4B8X A;  3LQR A;  2X0L A;  3F8F A;  4HAM A;  1T2K A;  3FMR A;  1OYY A;  1ZLJ A;  5A2Q K;  4QLC U;  2VBY A;  1ZH5 A;  4LLL A;  3E3V A;  3RIR A;  2XGX A;  2DAO A;  3KLN A;  3ECH A;  3BJA A;  2BE5 F;  1XMK A;  2LF7 A;  4NHJ A;  3RYR A;  2HR3 A;  3R0A A;  4U7D A;  4EM0 B;  2XUB A;  2G7U A;  4WK8 F;  1YW9 A;  2E1C A;  4O6J A;  2UWM A;  5FLX K;  2M45 A;  3RPU A;  1I6X A;  3PQK A;  2Z5U A;  5E20 A;  5KVR A;  1ZRD A;  4OOI A;  2TDX A;  2XKP A;  2LDU A;  1JHF A;  3ZN0 A;  1K78 A;  2DQL A;  4UVC A;  2YSR A;  1XMA A;  3ZMZ A;  3LWF A;  4GGG A;  3RKW A;  4OIQ F;  1FSE A;  2QQ9 A;  3SZT A;  5ED4 A;  3DFG A;  4I09 A;  2XKO A;  3O3K A;  2EFO A;  4ENN A;  4U0V A;  4BNC A;  3HSE A;  5D5W B;  2K02 A;  5E1W A;  3FXU A;  1KYZ A;  2FML A;  3FM5 A;  3L2C A;  1LQ1 A;  2GQQ A;  3E5U A;  4HLY A;  1FOK A;  3K1N A;  2DT5 A;  4KNY A;  5AIP A;  5ILV A;  1E17 A;  3FZV A;  3ABU A;  1U78 A;  1FNN A;  1ZYR F;  5E17 F;  4EV0 A;  2FE3 A;  2QBY B;  1FWZ A;  3RI4 A;  2PMH A;  1XGS A;  1RUN A;  1X3U A;  2MBF A;  3GW2 A;  3K9T A;  5L3B A;  4HX8 A;  5FFZ A;  2OQR A;  4JQF A;  2V1X A;  4TV7 A;  3TDU C;  4L5J A;  5J6X A;  1MJB A;  2IW5 A;  2QQA A;  1ZG1 A;  1G6N A;  2DPD A;  1IW7 F;  5BOX A;  2A5Y B;  3WTX C;  2FBK A;  4KA4 A;  2QUF A;  4ZYD A;  3NQO A;  2Q8K A;  1HKQ A;  2PQ8 A;  2H94 A;  3WE2 A;  3TKY A;  3FXQ A;  1P92 A;  3DXJ F;  3J80 Z;  5L3F A;  5AIQ A;  5LEK A;  2QM3 A;  2HFH A;  3ZQ7 A;  2FA5 A;  2LKP A;  1YLF A;  5DCM B;  4CYD A;  1STZ A;  1ON1 A;  2IT0 A;  1I1G A;  4EJV A;  3F6V A;  2ZO4 A;  2K4J A;  5BMZ A;  2W85 A;  2IJL A;  2V6C A;  3G3Z A;  3LQQ A;  3CO7 C;  5L3D A;  2A6E F;  1SD7 A;  3HRS A;  2CFX A;  1Y0U A;  3GUD A;  1FT9 A;  5BPD A;  3CDH A;  3I59 A;  4BXU A;  5L3E A; 
#chains in the Genus database with same CATH topology
 2DFE A;  1YIO A;  2VN2 A;  2IA0 A;  1XMX A;  2P81 A;  4LK1 F;  1JGG A;  2LLK A;  1X1A A;  4BH9 A;  4IPA A;  2E2J J;  3COA C;  1VQ9 I;  3QYB A;  5ILU A;  2LRD A;  3HOX J;  5GTI C;  4AYB A;  4BE1 A;  1ZGW A;  1BA5 A;  2DQR A;  4WXD A;  1SFX A;  3G6E I;  4QTR A;  1P4A A;  2CWE A;  1BI2 A;  2VJI A;  4PJL A;  4A0Y A;  1HW1 A;  2RDP A;  2GLO A;  2FXA A;  2RKH A;  3GFI A;  3HGG A;  1D1C A;  3O8H A;  3KFW X;  4G94 A;  2G9W A;  3WGH A;  4O5V A;  1V54 H;  3FM3 A;  3SZG A;  2LP0 A;  1VQ7 I;  1JKP C;  1Z7L A;  3OOP A;  1U3E M;  4A5N A;  2CW7 A;  1R00 A;  1WJE A;  3CUQ B;  3L7W A;  1FLI A;  1MD0 A;  4ESF A;  3RQI A;  4G7O F;  4PJN A;  2Z99 A;  3MWM A;  2IGK A;  2HEO A;  3P7N A;  4F93 B;  5D5U B;  4E7S A;  3EUH C;  2L7K A;  1FIA A;  1Z6T A;  1R4N B;  3BWG A;  1QVT A;  2EFN A;  1VQK I;  3RKX A;  3F72 A;  1XGO A;  3V8K A;  4I0A A;  1S6L A;  3HKZ N;  4YIF A;  4E7K A;  4CO8 A;  1JHH A;  1SFK A;  1ZLK A;  3FMS A;  4U7B A;  1T6S A;  1YE9 A;  4CH7 A;  3BZK A;  5JI6 A;  5DCF A;  1DDN A;  3VWB A;  4II3 A;  1I50 J;  2B7E A;  3LST A;  1FZP B;  4J00 A;  3IHU A;  3S17 J;  2KDZ A;  1T38 A;  1YW8 A;  2ELH A;  1RI7 A;  4BUP A;  2PMU A;  1OR7 C;  4EMS A;  3HB9 A;  2XGC A;  1GUU A;  2X51 A;  1YW7 A;  1P7J A;  4M73 A;  5GPC A;  1IXR C;  3RPQ A;  3JTH A;  3LSJ A;  4GDF A;  1G8X A;  1EH8 A;  4ZZD A;  3WGI A;  1I3Q J;  2VC0 A;  2R5Y B;  3BPV A;  1BW6 A;  2WA0 A;  1TNT A;  1ULY A;  2HI3 A;  4IX7 A;  4EQQ A;  2XGD A;  4BEH A;  4B3A A;  4RAY A;  3ZR8 X;  3WU2 C;  3OYK A;  4BAC A;  1BI0 A;  5TRD A;  2OPT A;  2FJ1 A;  1UJ8 A;  4L18 B;  2CQQ A;  2MC4 A;  1UFM A;  1TQM A;  2O3F A;  2X4H A;  1MNM C;  5K1Y A;  2GA1 A;  2PLY A;  5F04 A;  1VQ4 I;  3I59 B;  4EEF G;  4LJZ F;  3MKW B;  2MW8 A;  3WOD F;  2QSG X;  1S29 A;  3H0D A;  1I27 A;  2YU3 A;  1P4X A;  2K27 A;  5E3L A;  2W84 A;  2Z2S B;  2JT1 A;  3C2B A;  4G7H F;  3KEO A;  1IV6 A;  1JE8 A;  2FRH A;  1FBS A;  2F6C A;  3K4L A;  4UVB A;  4CCN A;  3WTW C;  1TW3 A;  4UB6 C;  1B1B A;  5FLX Z;  3IRQ A;  1UMQ A;  3BPX A;  3W6J B;  5HVQ C;  2K9L A;  3S1R J;  3AFH A;  3B6A A;  3KE2 A;  1O57 A;  3E6M A;  4DBQ A;  2HOA A;  2VBX A;  1JXS A;  3BJ6 A;  3FXL A;  2LTP A;  3OOU A;  5DD8 A;  5LGT A;  1RNL A;  3Q0U A;  2CUZ A;  4F52 A;  1GHC A;  5HLI A;  4FHT A;  4KDP A;  2M2E A;  2J5O A;  1S9H A;  3ZMD A;  1GT0 C;  1O3Q A;  2QSH X;  1USS A;  1YRN B;  1CGP A;  3D1N I;  4EVI A;  3G73 A;  5L3G A;  1ETQ A;  2JK3 A;  3EUH A;  5GAG J;  2DDA A;  3OS0 A;  4V2G A;  4B48 A;  1BL0 A;  2VKE A;  4OAY A;  5HNF A;  3CQZ J;  3ZPL A;  3A1Y A;  4GYI A;  2CYY A;  2QVO A;  1BBY A;  2MD5 A;  1IN4 A;  1MBF A;  1HDP A;  1J0R A;  1JT6 A;  2BGC A;  5JHU A;  4IVN A;  2M30 A;  3IL2 A;  3DBR B;  3TP0 A;  3HHG A;  4KMF A;  2DA6 A;  1SFO J;  3L2V A;  3ZQI A;  4U0W A;  3DPT A;  4HZF A;  1FX7 A;  2PX9 A;  5D4S A;  2F2E A;  5CVR A;  2HVS A;  2MC3 A;  3G1O A;  1Y8Q B;  3W6V A;  1R23 A;  2V26 A;  1FIP A;  4IRG A;  4I98 B;  1HDD C;  3ZQC A;  2DMP A;  2UZK A;  4RB2 C;  1DP3 A;  2X6Y A;  1UST A;  5EJC A;  1RKW A;  1XN7 A;  5IT9 K;  3GWZ A;  3JRE A;  1Z77 A;  1H8A C;  3BG9 A;  3C2G A;  1JGS A;  2DK5 A;  3TOA A;  4A5M A;  2Z1D A;  2E1O A;  1MW7 A;  4OIP F;  2HQN A;  1R5H A;  2CV2 A;  3AG3 H;  1JTX A;  1TQP A;  1SD6 A;  3O2P E;  4EM2 A;  1WJ5 A;  2IP2 A;  1UG0 A;  1WSU A;  3QPL A;  4WXH A;  2VJ5 A;  1PUF B;  5TJJ A;  1MND A;  4XLH A;  5K7H A;  1PDN C;  2QF7 A;  4BXF A;  3S3M A;  1ZGA A;  3KYC B;  4R79 A;  1YO5 C;  2CGP A;  1J9I A;  1LNW A;  1MDM A;  4Y17 A;  3PFI A;  4HX4 A;  4HV5 A;  2FBH A;  4UUS B;  3QOP A;  1O3R A;  2WAD A;  2BYV E;  3QU6 A;  1ZR2 A;  1PVE A;  4BBR J;  1K6O A;  2L4A A;  3QRF F;  2F4I A;  2XDV A;  3L9F A;  4DJA A;  1ON2 A;  2R0Q C;  3FX3 A;  3CMY A;  1Y1V J;  4B44 A;  4UHT A;  2QQ8 A;  4YG2 F;  2JA5 J;  3BR5 A;  2BEO A;  4IRH A;  3H9Q A;  2M0C A;  3V8L A;  4KFC A;  2F5V A;  1QHH D;  3MKL A;  1P9Q C;  4JOM A;  5DD4 A;  3S93 A;  2HTJ A;  4LGW A;  4ZYA A;  3A01 B;  3ERE D;  5IOY A;  3KP5 A;  3OSF A;  2BW3 B;  3P5J A;  1JUP A;  2H1L A;  3BCA A;  3WTT C;  3JAM Z;  2KIM A;  4CUG A;  1WGX A;  3CJT B;  4WF2 A;  4IRI A;  4BQQ A;  1FYL A;  1WZ2 A;  2Y9Y A;  3IKV A;  1MJ9 A;  5CKT A;  1YYV A;  4E7J A;  2Q2E A;  1T95 A;  5E18 F;  3CC2 I;  1AU7 A;  3HOT A;  5DUI A;  2IVM A;  1MMA A;  1ZAO A;  4JP0 A;  1X3W B;  3R4K A;  3W2V A;  5DM6 F;  1O4X A;  2K86 A;  1K4S A;  4XLA A;  3F23 A;  4XSZ F;  4B09 A;  2PMZ A;  3DU5 A;  4R1H A;  4HLX A;  2FOW A;  5HS7 A;  4RGR A;  2QYO A;  3IH4 A;  2VBZ A;  4BJ6 C;  1YJ9 I;  2DFF A;  3PSI A;  4CXF A;  1MZB A;  1TL8 A;  5ILS A;  1BC7 C;  4N4N B;  4L5I A;  2CQX A;  3S8P A;  5ICE A;  3F8M A;  2HOE A;  3J7A O;  3FXK A;  2O61 A;  2FBI A;  3CCL I;  1JKO C;  2QKM B;  3OWT A;  2H8W A;  3CP8 A;  1JUM A;  3TMO A;  3GF2 A;  3C1D A;  2GM4 A;  1SFE A;  1D0Z A;  1KU7 A;  3DEW A;  3EUK L;  4RGX A;  3FKJ A;  4PGG A;  2MLK A;  3OYB A;  4AC0 A;  6PAX A;  3H3V K;  4IL6 C;  1OFC X;  3FK7 A;  5CLS A;  2BZT A;  2V9K A;  5TIS C;  4YRV A;  2DA3 A;  1FEX A;  5EG0 B;  1A6I A;  4I2O A;  3KZZ A;  3DCF A;  3FWE A;  3U1K A;  3G71 I;  2O6G E;  3CCY A;  4IHT A;  1YI2 I;  5IY5 H;  2JRM A;  2R7W A;  2VON A;  4KYW A;  2A3S A;  2LBF A;  3A2K A;  1VQ8 I;  2XRN A;  3CC4 I;  3GYH X;  1YHQ I;  4OMY A;  3IWF A;  3NWS A;  3LSR A;  3I58 A;  4LG0 A;  1ZN2 A;  4PJ0 C;  4XKB A;  1XX5 A;  2F5D A;  2IPQ X;  5IT3 A;  5J8C A;  2KQR A;  4JX4 A;  4HDU A;  2Y31 A;  3M4O J;  4WXC A;  2EV5 A;  3PO3 J;  3WHB A;  3P9C A;  2VUM J;  4AWX B;  1IN5 A;  3TW7 A;  4M6V A;  3MQ0 A;  2WAF A;  3LFU A;  2VOP A;  4JYK A;  5DM7 F;  1EV7 A;  4RM2 A;  4FQG A;  3MCZ A;  2B63 J;  4A0Z A;  1D3Y A;  3U9G A;  2X1C A;  1O3S A;  3P9I A;  4FE4 A;  3AKZ A;  1LFU P;  2UXX A;  4M6Y A;  2M3A A;  3VPR A;  5FRN A;  2W82 A;  3IV5 A;  3KEQ A;  3MKZ A;  1ETY A;  2L02 A;  4YEL A;  2W1O A;  1IN6 A;  2FU4 A;  4MGR A;  5KAF C;  2HKO A;  2XPU A;  4MFD A;  4II2 A;  2IGN A;  3ZRG A;  4A3C J;  2HWV A;  3JRA A;  1BIA A;  1W1W E;  2DA2 A;  2NNY A;  1N25 A;  1I3A A;  4FT8 A;  1HXD A;  4L0Y B;  2P7V B;  1E0E A;  2LKX A;  2E2I J;  5IYB J;  1VQO I;  1I39 A;  4XLC A;  2ZXI A;  1VQM I;  4K2E A;  5C44 J;  1X19 A;  4H0E A;  3HPH A;  2GXA A;  2NNN A;  4HSR A;  3EET A;  3FHZ A;  5H2F C;  1X4P A;  4UUS A;  3RKQ A;  1MBH A;  2VT3 A;  2LNB A;  1XB4 A;  1NK3 P;  2JPB A;  5LEJ A;  1K6Y A;  3SHF A;  3OS1 A;  5IT9 Z;  3CCU I;  4EAT A;  3T8R A;  3MKY B;  3O8G A;  4BY7 J;  3J80 K;  3OMY A;  2F4M B;  2DTR A;  1UG2 A;  2Z33 A;  2STT A;  3LSG A;  2DA1 A;  3K7A J;  3L2Q A;  5DTD A;  3FHN A;  2HXI A;  4BHB A;  4M9S A;  4G12 A;  1R5G A;  4KIG A;  4P1W A;  2P5L C;  1XSV A;  2PMZ N;  4ENM A;  2DT6 A;  3DKY A;  3F8B A;  2F5E A;  2M1B A;  2CO5 A;  3K4C A;  4OWR B;  1QGP A;  3NWT A;  3I4N J;  2W4S A;  2ECB A;  5JHF A;  4UVA A;  1B72 B;  2V6E A;  3T0Y A;  3KP2 A;  2ESN A;  2ZJR F;  1JKR C;  4XQF A;  2VAS A;  1GVJ A;  2A07 F;  1ITY A;  2L7M P;  3R6S A;  4I99 C;  2XAS A;  1ETK A;  2E19 A;  3CUO A;  4M6X A;  5J1R A;  3AG4 H;  1GXP A;  4L9T A;  1WI3 A;  1IRG A;  4AD9 A;  5BQT A;  5EGO B;  2AXL A;  4PJJ A;  3CCS I;  5DEQ A;  5FLM J;  3I4P A;  2L54 A;  2I10 A;  4FX4 A;  4NQW A;  4FAS D;  3FXJ A;  3L2U A;  1LE8 A;  4CHU A;  2D45 A;  1TWF J;  4LG0 B;  1ZAR A;  5H20 A;  2OV7 A;  2XC7 A;  4G6D A;  4HF1 A;  4MIM A;  3I53 A;  5C4X J;  3JRI A;  2HQA A;  2PJP A;  2V7F A;  3QU3 A;  4HW0 A;  3EYI A;  3L00 A;  3Q0W A;  3E7L A;  4ZZL A;  3WG9 A;  4LFU A;  3TDZ C;  2EK5 A;  4Z2Y A;  4M3B A;  3IAS 2;  2LK2 A;  1TW2 A;  3IRR A;  1LVK A;  5EZH A;  4ETS A;  1V55 H;  2QZ8 A;  3DTI A;  3PIP F;  4CSW A;  5IYC J;  4XL9 A;  2ESH A;  5FGM A;  3V42 A;  2K5C A;  3F9K A;  1Z9C A;  2HXO A;  1BJZ A;  2VE9 A;  3AL0 C;  2OU2 A;  2GBY A;  1PP7 U;  5FRM A;  3CZ6 A;  5J4Y A;  2OA4 A;  5D8K B;  3FKI J;  1RRJ A;  3E1S A;  5CVU A;  1W5C C;  1LPQ A;  2WWY A;  3SQN A;  3GFL A;  2RQP A;  5D6E A;  3QOE A;  4XN0 A;  2X6W A;  3GVA A;  4XOR A;  4ITV A;  4HQE A;  3N97 A;  1QO0 D;  2O5R A;  3TOB A;  3MFK A;  4BY1 J;  1QRY A;  5J1Y A;  3ZMU A;  3T1B A;  2LSO A;  1HLV A;  3PSF A;  2DW4 A;  3F8N A;  3CJN A;  2K7L A;  2L9S A;  2GA2 A;  2ID6 A;  1X1B A;  1WH5 A;  2IS6 A;  2XF7 A;  2BVL A;  2VT2 A;  2XAU A;  2R92 J;  3ZXS A;  9ANT A;  3CMA I;  2R5Z B;  5E3M A;  1R1U A;  3E6D A;  3OYG A;  4A3B J;  1OYI A;  5D4R A;  1JJ8 C;  3BR1 A;  3FBI B;  1U8R A;  2M8G X;  2MLG A;  2WAQ A;  2LC2 A;  4QWQ A;  2XF5 A;  4D0P A;  4UV9 A;  5IP6 A;  1QZY A;  3L09 A;  4UNO A;  3E5Q A;  2OZ6 A;  3QPH A;  1Z6R A;  4XRM A;  3HOV J;  4C3I J;  2HTS A;  2KP6 A;  3GXO A;  1WJD A;  3HGY A;  4GXO A;  2CUJ A;  3MZY A;  5DCM A;  4ESJ A;  1MMG A;  2KJB A;  2M34 A;  2N8G A;  3OYC A;  1ZGJ A;  1BI1 A;  4JBA A;  4BL0 B;  3U2R A;  4UXN A;  4UUT A;  2F5C A;  1WWX A;  4RB0 A;  3HHH A;  2XF6 A;  5FD6 A;  3K10 A;  5F27 A;  2MFZ A;  3ABT A;  4ZJZ A;  2VE8 A;  4AIK A;  1NHA A;  1W36 D;  5FKO A;  1MH4 A;  1S72 I;  1J7K A;  1U6G A;  1Y39 A;  4KN7 X;  4G7Z F;  2Y69 H;  5HNH A;  2VQH A;  3I55 I;  2LYC A;  2KMU A;  5HLG A;  3LOC A;  2FNP A;  1M1E B;  1KYW A;  2QGU A;  4ZC3 A;  2A69 F;  4A69 C;  3ULQ B;  3VOE A;  3H92 A;  1F36 A;  4BHP A;  1OMI A;  1PP8 F;  1T56 A;  2IS4 A;  3CCR I;  1QQI A;  3H0G J;  4ZYG A;  1MSF C;  1MBJ A;  4M3E A;  3O6B B;  2X1E A;  1ZRE A;  1J2X A;  2DLL A;  4HQM A;  4ZYE A;  1OQY A;  2EZK A;  1T98 A;  3FF5 A;  5GTH C;  2X9D A;  2XVC A;  1P7I A;  1YQA A;  3AG2 H;  1C0W A;  4C30 A;  1P2F A;  1WFX A;  5ICG A;  1LUJ B;  5FRO A;  3ZQQ A;  2O7O A;  4Y7N J;  4W1U A;  4EGY A;  2E71 A;  2R5Y A;  1G3Y A;  1YS6 A;  3K4B A;  4A3E J;  1TC3 C;  1YTY A;  2OCC H;  2K9N A;  2CW8 A;  4AIJ A;  1QHG A;  1I1S A;  4MEY F;  3K6G A;  2I8D A;  3OYM A;  3UR3 C;  2R7S A;  2DBB A;  4D5C A;  2E1N A;  4FET A;  4M71 A;  3FK6 A;  4Y15 A;  3CCE I;  1ZG5 A;  3DTE A;  4ZDO A;  1IZ1 A;  3GEZ A;  2ZME B;  3FMQ A;  1MMN A;  1G3W A;  3A0H C;  3HYI A;  4L9N A;  4A2U A;  4BDZ A;  1N77 A;  1Z0X A;  2EJR A;  2YPR A;  1ZK8 A;  2LFB A;  2DK8 A;  5FKN A;  3J81 Z;  1HKS A;  4I0B A;  2VC1 A;  4GO1 A;  5JLW A;  3HUG A;  5HLH A;  4E7L A;  1JI8 A;  2W24 A;  3ISP A;  2KFD A;  1HBX G;  1XDS A;  4IHS A;  3V8J A;  3OY9 A;  3BRO A;  2XRO A;  3RCO A;  3ZMS A;  1DU0 A;  1SAX A;  2R93 J;  1ONV A;  1WRJ A;  5HOD A;  2C6Y A;  2KIQ A;  5E8G A;  1VQ6 I;  2ZFW A;  1GVD A;  1XCV A;  2KPM A;  4XRF A;  1FPQ A;  2R3S A;  2CSO A;  1RZ4 A;  2G0E A;  1MBE A;  1YJW I;  1F1Z A;  3KEY A;  1AKH A;  5GAE J;  3K70 C;  1UB9 A;  3D0S A;  1TT0 A;  2DMU A;  2EA4 A;  2Q2E B;  4KN4 X;  1W7P A;  2AHQ A;  4LK0 F;  2JWT A;  1BR1 A;  1F9N A;  2R7Z J;  4PFO A;  4BJ5 C;  2EIM H;  2NS7 A;  4FTH A;  3GTJ J;  4DYC A;  2L01 A;  1ZKG A;  1D8K A;  2DMT A;  1DP7 P;  2RN7 A;  2LVS A;  5M3F J;  2ACJ A;  3PJR A;  3BT9 A;  5EG0 A;  2BOL A;  5LGN A;  2K85 A;  3JW4 A;  1U0J A;  1P6R A;  1ACI A;  2XB5 A;  1HST A;  1ZQ3 P;  1AKH B;  1GDT A;  2XPW A;  1U5T C;  1D1B A;  1HW5 A;  1R36 A;  2A6T A;  3R61 A;  4BU2 A;  3IC7 A;  3OYD A;  3WTU C;  4FX0 A;  4S05 A;  2B0L A;  3QPT A;  3U21 A;  2PFB A;  4PFP A;  2CS3 A;  3I56 I;  4KUM A;  4BBS J;  2LMD A;  2D5V A;  5FLV A;  1LEA A;  2HQR A;  3HZJ A;  2D2W A;  2X85 A;  3ASO H;  3VYR B;  1YOV B;  4MHG A;  3QAH A;  2QQB A;  3SXY A;  4CCO A;  1XSD A;  1BOA A;  2DO7 A;  1T0F A;  1JJ6 C;  4Y52 J;  4F3Q A;  2L7Z A;  1H9G A;  1R7J A;  3HPG A;  3Q9V A;  2LBF B;  5F1J A;  3S1M J;  5LBQ A;  2L9N A;  2KJC A;  1PUE E;  1SAN A;  3GZ6 A;  4BAY A;  2AXT C;  3VYU B;  2DU9 A;  4F55 A;  5C3E J;  3M1C A;  4EJW A;  3RZD J;  3A0B C;  4ZTJ A;  2LR8 A;  4B47 A;  4KIT B;  1QA6 A;  1IUF A;  1WQ2 A;  4Y13 A;  2Z16 A;  3OYA A;  2V9V A;  2GIV A;  3P9K A;  2L9V A;  2EH3 A;  4ZTF A;  1MDM B;  2DN0 A;  2ZB9 A;  1OKR A;  1VF9 A;  4PGH A;  5JVT A;  2QA4 I;  1J5Y A;  3V7R A;  4ESB A;  4C9Y A;  3DLL F;  5J8F A;  3M3Y J;  4ZDL A;  2ZNY A;  3DU6 A;  3ZGK A;  3SDB A;  2ZBK A;  1GXQ A;  1W7P D;  2I5U A;  3EYY A;  3DBH B;  4XIC A;  2JMW A;  3J7A Y;  2VQL A;  3MZH A;  5ERI A;  2ZJ2 A;  5EZG A;  4E7H A;  3OYL A;  3BC8 A;  1A31 A;  2UUZ A;  4D5F A;  2JTV A;  1S7E A;  1TP4 A;  5KCM A;  4KMU X;  4C2T A;  5LFA A;  4RDU A;  1WVR A;  1OIS A;  2KIU A;  3ESW B;  2QWW A;  3CD6 I;  1YIJ I;  4Z6Y A;  1TWG J;  3CUQ C;  3DF8 A;  1RR7 A;  1DGR M;  3Q0V A;  1G59 A;  3QQA A;  1HKT A;  1X1D A;  2DA7 A;  4X0G A;  1Z91 A;  2M0M A;  3VSK A;  2YX4 A;  1FC3 A;  5CQG A;  1Z05 A;  2RNG A;  5H6R A;  1G2H A;  3GTO J;  3IH3 A;  3JSP A;  2KIS A;  5K7Z A;  3OYJ A;  2ISY A;  2R7F A;  1K78 B;  3UKG A;  1WJF A;  3A03 A;  2ADU A;  4M72 A;  3S2W A;  2YUS A;  1IAW A;  3ROU A;  1TTY A;  2P5V A;  2FX0 A;  3QP6 A;  2O03 A;  4PZJ A;  1SMT A;  1LJ9 A;  4QIW N;  4D7M A;  1A35 A;  4CGZ A;  2E5Z A;  5FKM A;  4IZZ A;  2YR2 A;  4NC8 A;  2HDW A;  2K9Q A;  1UHM A;  4I02 A;  3D5S C;  1MGT A;  3DP7 A;  2BY0 A;  3KYD B;  4J01 A;  1BJA A;  1Z7U A;  4A3D J;  3WU0 A;  1WJA A;  2GWR A;  3LFK A;  4KT5 C;  3VDX A;  3V7C A;  4IHY A;  2CJJ A;  4AUX A;  3W6K B;  1HCR A;  4CCK A;  1B9M A;  2ZME A;  3CDI A;  3DPU A;  4IOA F;  3BR2 A;  4RGS A;  4WCG A;  1UCR A;  5KK1 A;  1O7L A;  2Y75 A;  4HBL A;  3VOD A;  1WI9 A;  5IPA A;  3RJP A;  3RQ4 A;  3ZQG A;  4HST A;  3G4S I;  3LAP A;  2XAH A;  3DQV C;  4XOP A;  2L5Q A;  3IWZ A;  4AYB N;  3ECO A;  2LRE A;  2P6S A;  4XRS A;  2R7T A;  1YX5 A;  5EGO A;  2CFO A;  2RNJ A;  4LIT A;  1D8J A;  2XB0 X;  5F0H A;  1UHW A;  5EYR A;  2H1K A;  3H36 A;  3E97 A;  2KT0 A;  4PDK A;  5E3N A;  1FYM A;  2COB A;  2J5P A;  3K1P A;  4AIH A;  2CW0 F;  3JRH A;  3ZP5 A;  1CF7 A;  3BTI A;  5CQE A;  3E6C C;  3AL0 B;  4P96 A;  3K2A A;  4MO7 A;  4XLE A;  4NBQ A;  1SD5 A;  3CF2 A;  2IXS A;  3TGN A;  4O3M A;  1FMV A;  2WY8 Q;  5IP9 J;  5CVI A;  4DOZ A;  2CUF A;  2WY7 Q;  3SZP A;  2P5K A;  1Z3X A;  4XRS G;  5DV5 A;  1Z21 A;  2HZT A;  1G4D A;  3MEX A;  4WWC A;  1QNT A;  1T33 A;  1QPM A;  4MLO A;  2FUG 2;  2PG4 A;  2K3F A;  2KIF A;  2V1D A;  2OTL I;  1KU2 A;  1BI3 A;  4RB1 A;  3PIO F;  3JRB A;  2ZC2 A;  1MKM A;  5EEH A;  1IXC A;  2LY1 A;  3IKT A;  2MGQ A;  1ZG3 A;  2K4B A;  2NOJ B;  4ASN A;  3CME I;  3W2A A;  2P4W A;  4BQA A;  3TO7 A;  3CF5 F;  4PJM A;  2DYS H;  4XKV A;  1XD7 A;  4BDY A;  3BZC A;  2WC2 A;  1S5L C;  3GZN B;  4Y4R A;  3CCM I;  1FBQ A;  2L9R A;  2VXD A;  4CZZ A;  4PCQ A;  3I3L A;  1D5V A;  2QLZ A;  3ASN H;  4NDL A;  4XBF A;  1DUX C;  1B59 A;  5GAD J;  1KU9 A;  2H6C A;  3F21 A;  2OQG A;  2WBM A;  2JA2 A;  3E0J B;  2P7C B;  3S32 A;  3HRT A;  2RVC A;  2ELJ A;  4CCL A;  5BNG A;  1T39 A;  3EQL F;  5K7F A;  2ID3 A;  2P8T A;  4NB5 A;  3V7S A;  2EBI A;  1ZRF A;  1RKT A;  1LDD A;  1REP C;  5JVG F;  2VOD A;  2EIN H;  2IA1 A;  3CLQ A;  3QPS A;  3HTS B;  1Q1H A;  1EH7 A;  2G7H A;  1SD4 A;  3M07 A;  4L9V A;  3RYP A;  2AQF A;  2OAZ A;  2ZXJ A;  3DBL B;  2GZW A;  2X6X A;  5DUK A;  1H0M A;  1IJW C;  4RAG A;  4B43 A;  1SAU A;  4CYC B;  3RKY A;  2HDD A;  4XSX F;  1D0Y A;  5F0F A;  2K9M A;  5K5O A;  3OIQ A;  3NRV A;  4OIN F;  1Y6I A;  5IOZ A;  1VQN I;  3EDP A;  4MEX F;  1YRN A;  1OPC A;  2ECC A;  4P9F A;  3HOZ J;  2W7N A;  4LMY A;  4XMY A;  4I7H A;  4F7Z A;  4LB6 B;  1LDJ A;  1RR8 C;  1IC8 A;  3H35 A;  5FO5 A;  2HPM A;  1HSJ A;  2E7X A;  3JRC A;  2XAQ A;  3GFM A;  5GAH J;  1POG A;  4EJO A;  3I4M J;  2HNH A;  4IF4 A;  3KZY A;  2QBY A;  4HOB A;  3OYE A;  4CYC A;  2JUC A;  2R7V A;  3CC7 I;  2DFH A;  3VSL A;  4I01 A;  5B3S H;  1LB2 A;  5HDN A;  3T8T A;  1E2X A;  2LG4 A;  3S15 J;  4HNT A;  3KP4 A;  1T08 B;  2E5N A;  1HQC A;  3W3C A;  2AS5 F;  1V4R A;  3GO5 A;  5J3L A;  1S3J A;  3PQJ A;  2LH9 A;  5EEG A;  1XCB A;  3R0J A;  3ZQH A;  1RPW A;  2DOA A;  2HPI A;  5E1X A;  4V19 K;  2CQ7 A;  2AO9 A;  3C3W A;  1IG7 A;  3FXR A;  2EFW A;  2GOX B;  3NAU A;  1W36 C;  3S1N J;  4CZC A;  2HDC A;  3HSR A;  4XK4 A;  1G3T A;  3KX2 A;  4LIV A;  3WTY C;  3C18 A;  3S14 J;  2A61 A;  2MAB A;  3RTR A;  5FFX A;  1ZRC A;  2KLO A;  1AWC A;  4MQ9 F;  5FB2 A;  1V3F A;  3GCM A;  1ORK A;  2A05 A;  2MYS A;  5M5X J;  1FSH A;  3OL4 A;  3LSP A;  1SVL A;  3TO6 A;  2W57 A;  2BY3 A;  4IHV A;  4P55 A;  2PI0 A;  3LA2 A;  4E70 A;  3DEE A;  1LDK B;  4CCJ A;  2EWN A;  4E6K G;  1UZC A;  1CF7 B;  4LD5 A;  3HOW J;  3HEF A;  1OJL A;  2HZD A;  4CCM A;  4M9X A;  4YFN F;  1BW5 A;  1NK2 P;  2STW A;  3BY6 A;  3CO6 C;  1VTN C;  3HC7 A;  1QZE A;  2UXN A;  5LRS A;  1U5T A;  3Q5F A;  4W97 A;  2FF4 A;  1KZH A;  3K70 D;  3VYT B;  2R7D A;  3KLO A;  2JSC A;  1XGN A;  3EPZ A;  3ABK H;  1VFC A;  3KCC A;  2EZH A;  5E8I A;  1KQ9 A;  2FSW A;  3OYH A;  2Y48 A;  2JA6 J;  2VOO A;  2VJ4 A;  4JK1 X;  2VBW A;  1W5T A;  3ZCO A;  2ZSI B;  3F8C A;  1IV8 A;  1AHD P;  2JQ7 A;  1QVU A;  3SDG A;  4BE2 A;  2CQN A;  3C2H A;  4DQ2 A;  4M3F A;  1DPR A;  1HA8 A;  3CUQ A;  3VB2 A;  3OYN A;  1MNE A;  4G8X A;  2O8X A;  1ETV A;  1A6Q A;  3NEU A;  2Z9O A;  3BCB A;  4A12 A;  2CQK A;  4AU7 A;  4HF2 A;  4BYY A;  3F22 A;  5F64 A;  2XPV A;  1VQ5 I;  4KIB A;  1S7O A;  1N78 A;  2ZNZ A;  1HW2 A;  2ISZ A;  1JUS A;  5JR3 A;  4BGD A;  3K4N A;  4AVZ A;  4BHC A;  1R1V A;  1X2N A;  1K83 J;  1QZZ A;  3MD2 A;  3WTZ A;  3GLX A;  1O7F A;  4GRI A;  4NQW B;  1XPX A;  1LE8 B;  1TLH B;  2JPC A;  1FOW A;  2DFI A;  2EFP A;  3ABL H;  2BY1 A;  1K4T A;  2NS0 A;  2ZCW A;  2VPR A;  2VL8 A;  4MTD A;  1RUO A;  2VQG A;  2D1V A;  2VKH A;  3JR9 A;  1X58 A;  1ZTR A;  3CCV I;  3SFI A;  5K5Q A;  5FJ8 J;  5B66 C;  2R7Q A;  1W0T A;  3GME A;  1Z67 A;  2WB1 N;  4YFX F;  4NC6 A;  4AID A;  4HNU A;  4U87 A;  3NAR A;  5DS9 A;  3K1M A;  2DI3 A;  3KP3 A;  3H5A A;  4A6E A;  4IHW A;  2ME0 A;  2E7W A;  2M5W A;  1EA3 A;  2JSP A;  3RSN A;  3SJM A;  2EFQ A;  3GZ5 A;  3M1E A;  2OD5 A;  5HLT A;  3HM5 A;  1NH3 A;  1BOB A;  4G6T B;  2DMN A;  1ZHF A;  4JX5 A;  4XLF A;  3VEP A;  3PNY A;  5D5X B;  4F92 B;  2HYJ A;  3G1L A;  3H3Z A;  2V1U A;  4UV8 A;  1F4K A;  3TW6 A;  1MMS A;  2FQ3 A;  3WE3 A;  2FQ4 A;  4IQJ A;  4KIC A;  1OCT C;  2ELK A;  2ZJQ F;  2JRT A;  1EH6 A;  3HG9 A;  4ZH4 F;  2LKS A;  2MD0 A;  3LSI A;  3U1D A;  2EIL H;  4DW6 A;  3REO A;  5IYD J;  2MA3 A;  2M4G A;  4OIO F;  3BTJ A;  2FMY A;  1OR7 A;  2JJ7 A;  3E5X A;  4FE7 A;  1TNS A;  1BIB A;  5CYV A;  5D6F A;  1SC7 A;  1WHU A;  2KRH A;  3ZN1 A;  3PO2 J;  3KET A;  3Q9S A;  3HBL A;  1U9O A;  1S7A A;  4MTE A;  2XAF A;  3JCU C;  4IOC F;  2GXB A;  4C2U A;  2BXY A;  4ON0 A;  1IRX A;  3QYF A;  2DA4 A;  1VQL I;  1A36 A;  3HKZ A;  4G9Y A;  1R58 A;  3IP4 B;  3OIP A;  2OTJ I;  2XHK A;  2L4M A;  2DJN A;  4XR6 A;  4HG2 A;  3ML6 A;  2NVQ J;  2WV0 A;  2KKO A;  4RLQ A;  3MAJ A;  3LA7 A;  2L0K A;  3LSK A;  1B8I B;  3X2Q H;  2COM A;  2WTE A;  3TP3 A;  1XTA A;  5J4V A;  1IXS B;  2UV1 A;  1Z3Y A;  3DPL C;  3H5R A;  1A04 A;  5K5R A;  2KHM A;  4DGW B;  4UUV A;  2RC4 A;  4Q5S F;  2VI6 A;  1DPU A;  2NOG A;  3CES A;  5KNL A;  2QSF X;  2HYG D;  4D9J A;  2ZKZ A;  5DDG A;  3CLO A;  2HQ5 A;  3GX4 X;  2ZSH B;  1K79 A;  1UEL B;  4BKX A;  4C2M J;  4QPO A;  2DYR H;  4BJT A;  3D5L A;  2PBI A;  1K61 A;  1FOX A;  5C4J J;  1VND A;  2W48 A;  2VQC A;  2VXZ A;  4Y33 A;  2XGE A;  3JSO A;  4E7I A;  3M9A A;  5E1Z B;  3Q3S A;  3GTK J;  1N75 A;  1BC8 C;  1R1T A;  5LHI A;  3ZMT A;  2H6B A;  1U9N A;  3S16 J;  5M5Y J;  3PNT A;  4LLN A;  2Y0S N;  4ABZ A;  4L0Z B;  2KRF A;  2DPU A;  1U5T B;  3OL3 A;  4OU0 A;  2Q0O A;  4J19 A;  3WG7 H;  2VPL A;  5DYM A;  4ENK A;  3A02 A;  3J7Y J;  3LL7 A;  1RET A;  5CVV A;  1J09 A;  1R4M B;  3PUB A;  3K4J A;  1PUF A;  4N0B A;  2L2O A;  3H5N A;  2IA2 A;  4IEJ A;  1TWC J;  3IUO A;  5LRR A;  2DT7 B;  1AA7 A;  3BOQ A;  3QP5 A;  4RM3 A;  3BZ6 A;  3VYS B;  4DNC A;  5HS8 A;  3ZOB A;  4HDV A;  2CRG A;  4MNU A;  2AQE A;  4YFK F;  4XLP F;  1RES A;  3EUA A;  3HIF A;  2H09 A;  4B4C A;  2XAG A;  1LFB A;  4BS9 A;  4IJA A;  3J81 K;  1SFU A;  3CJR B;  1V5G A;  2CV1 A;  4E4H A;  1YFH A;  3PL8 A;  1P4W A;  1S8N A;  5A2Q Z;  1D0X A;  1FP2 A;  3H9G A;  4HX7 A;  2XIG A;  5D5V B;  4Y3O A;  3JRD A;  3BDD A;  3JTG A;  2V79 A;  4CDG A;  2NS8 A;  4C3H J;  3GLL A;  3M8E A;  5E79 C;  1BR4 A;  4WX9 A;  4BQO A;  1YJN I;  2Q1Z B;  2TRT A;  4YEJ A;  3ONQ A;  2NAZ A;  2GAU A;  4RA2 A;  5H6Q A;  3SEZ A;  1OCR H;  4E7Z A;  5KHD A;  1V5E A;  3JRG A;  1LEB A;  1BM9 A;  2B9S A;  2EV6 A;  2RAE A;  5CJ9 A;  1EJ9 A;  5L3C A;  2VLA A;  4MQV A;  3GTL J;  4HEA 2;  3I0T A;  3K4M A;  2XSJ C;  4LIU A;  3N05 A;  1FP1 D;  4Q4Z F;  1R49 A;  2RV8 A;  5LLQ A;  2O8K A;  2PEX A;  1EF4 A;  3FIW A;  4RAZ A;  1AOY A;  3HSF A;  1UHS A;  2ZME C;  1XC5 A;  2QCO A;  2O0Y A;  1YS7 A;  3ELK A;  2M7B A;  4D1Q A;  3OR2 C;  4XLN F;  3QWL A;  1PJR A;  1G3S A;  4IXA A;  3SYT A;  5JFR A;  4PK4 A;  4XN3 A;  4RB3 C;  1ETX A;  1OCZ H;  3PUF A;  4S0H B;  2BXZ A;  4P5O A;  3S1Q J;  3GFJ A;  3TO9 A;  4ZYH A;  2JUG A;  2M8E A;  4Q48 A;  2RGV A;  4N4O B;  1ETW A;  1LVA A;  5M3M J;  3LA3 A;  4QPQ A;  4ZDP A;  1IRZ A;  3HTU A;  1WJB A;  1V5F A;  1Z1D A;  5LHH A;  2V4J C;  1IF1 A;  3CCQ I;  3TL4 X;  2W25 A;  2LD5 A;  4HF0 A;  1B4A A;  4KJZ A;  1W7P B;  5EF6 A;  2WAE A;  3DV8 A;  1HF0 A;  1W4M A;  5F08 A;  4G6Q A;  4R8H A;  4A93 J;  1KA8 A;  4GCV A;  2ME6 A;  2NYX A;  3VFZ A;  2CV0 A;  3OYF A;  1Y1W J;  2NVT J;  3OR1 C;  5F1R A;  2O9L A;  4A6D A;  1Q1V A;  1FMW A;  2ZFU A;  2MG4 A;  3BR0 A;  1NG7 A;  5HOO A;  3OV8 A;  4OMZ A;  1FTZ A;  1TT5 B;  3M8J A;  4MFE A;  1U2W A;  5HS9 A;  1OLT A;  2OUM A;  1O3T A;  1BN5 A;  2F5F A;  2KZG A;  3OYI A;  4U88 A;  2FOK A;  3WHC A;  4A3G J;  4A3I J;  1H9T A;  1FBU A;  2BV6 A;  3CTA A;  5J40 A;  3HOS A;  5LHG A;  1XDU A;  3I9V 2;  2F48 A;  4BXX J;  1I5Z A;  5FD5 A;  2MH2 A;  1TWH J;  4HYE A;  2PN6 A;  2FNA A;  2R5Z A;  1T8I A;  2A5W A;  3WU1 B;  2EA2 A;  5JLX A;  1MMD A;  5AON A;  1IUY A;  3HOY J;  2IS2 A;  1XGM A;  2P6T A;  4A3M J;  4B1R A;  4F91 B;  4N9I A;  3BG6 A;  2NRA C;  5BPI A;  4BEH B;  3PNV A;  4IO9 F;  4CIC A;  3E6B A;  2HVR A;  3F6O A;  3JAM K;  1FOY A;  1R22 A;  2L3D A;  3WGG A;  1F5T A;  2DA5 A;  2H8R A;  2R4G A;  1WKM A;  3K69 A;  2EIK H;  2OBP A;  3H3U A;  2W00 A;  2FEZ A;  1Y56 A;  2MH9 A;  3OS2 A;  4BQN A;  5CVJ A;  3F0C A;  3BJO A;  4P9U A;  3JRF A;  4RS8 A;  3DWL E;  4M74 A;  2EZL A;  3BG7 A;  3PFY A;  2FD5 A;  4X6A J;  2D1H A;  1OCO H;  2OZU A;  4L9J A;  4KIF A;  4RMN A;  1L0O C;  3KP6 A;  1X1C A;  4RAF A;  4EJT A;  3KPH A;  1WJC A;  5TGT A;  3BQY A;  2BVM A;  2XAJ A;  1B9N A;  3KP7 A;  5BS6 A;  1Y0N A;  1ODD A;  5F6F A;  1FYK A;  2JVG A;  2Y2Z A;  4EGZ A;  3KIO A;  3I71 A;  1E3P A;  4RGU A;  2HKX A;  2XSD C;  3HRM A;  3ZMV A;  1H89 C;  1GV2 A;  1D1A A;  4I76 A;  2IEK A;  2JN6 A;  3ZQL A;  2M87 A;  5EEA A;  4M3G A;  4A3K J;  1I6H J;  4LOC A;  4LB5 A;  3G2B A;  2DTZ A;  1X4O A;  1T0F C;  3CJQ B;  4U0Y A;  1MSE C;  3I54 A;  3UNG C;  4XKW A;  2E35 A;  2HS5 A;  2NVY J;  1SVO A;  2X6O A;  3BP8 A;  2NVU B;  4EM1 A;  5KAI C;  2OJE D;  3K2Z A;  1IDY A;  1IN8 A;  4DIQ A;  3C7J A;  3DEU A;  1KGS A;  3M8F A;  1QBJ A;  2JA7 J;  1J59 A;  4A0X A;  3N4M A;  3M7G A;  4M9Z A;  5HDK A;  1YG2 A;  2BY2 A;  1LFP A;  2EB7 A;  3LAJ A;  2BHZ A;  3DKW A;  1TBX A;  1OYW A;  4UY8 I;  1MJA A;  2CH0 A;  4LLG F;  4AVP A;  1D5Y A;  2XV4 S;  4XOT A;  2YU9 J;  4GYG A;  3F3X A;  3G1M A;  3S2D J;  2WAQ N;  1FJL A;  1X1P A;  2Y0S A;  2ICW G;  1J75 A;  1SMY F;  1UAA A;  2IRF G;  3RZO J;  2ETH A;  2IGM A;  1YX3 A;  3MVP A;  3KYL A;  2LF8 A;  3A4C A;  1IRF A;  3B73 A;  4YII A;  2A68 F;  3J7Z I;  1KQ0 A;  3R60 A;  1QU3 A;  2JZY A;  5LGU A;  1MBG A;  1RIO H;  2KL4 A;  3H9J A;  3T5X A;  4RBO A;  2WB1 A;  2PJR B;  1CQT A;  3MMY B;  2VKV A;  1JKQ C;  2JA8 J;  2OCE A;  3HUG B;  3SFZ A;  5FKL A;  3AAF A;  2RQQ A;  3HOU J;  5F0C A;  2R7R A;  1HOM A;  2LOO A;  5B1A H;  4QSH A;  1JTY A;  3I5U A;  5IP7 J;  3HRU A;  1SVM A;  3I64 A;  1H88 C;  3TQN A;  5D8L B;  3L1P A;  2DOF A;  1X2M A;  4Q47 A;  2K40 A;  3V4G A;  2BBY A;  3OIO A;  2EV0 A;  4S04 A;  1B6A A;  4GFB A;  2EPF A;  2QKL B;  1R71 A;  4HPQ A;  4N9H A;  3LSM A;  2HYF A;  1MH3 A;  2KZV A;  4YIR X;  2K3P A;  3WTV C;  3S2H J;  4DBR A;  2H27 A;  1NTC A;  2IAI A;  1FY7 A;  2HU9 A;  2HVQ A;  3BR3 A;  3GTQ J;  1ETO A;  2HGC A;  1K7A A;  3K0L A;  1WCM J;  1L3L A;  4AM3 A;  2GXG A;  2CG4 A;  4RLF A;  4OIR F;  5ICC A;  1VI0 A;  1R9T J;  2YX7 A;  1QPI A;  4HNV A;  4ENJ A;  4HV6 A;  4HA8 A;  3B02 A;  2KDO A;  3RDI A;  1KQ8 A;  4DZJ A;  3WTS C;  1W5S A;  4B3X A;  1ERD A;  1JT0 A;  1VZ0 A;  2Y0M A;  1KU3 A;  2EZI A;  2A6H F;  1XSX A;  2DMQ A;  1APL C;  1SEU A;  1IN7 A;  2Z3Y A;  2V9P A;  4EJU A;  2HOT A;  5ICF A;  5HDG A;  1GV5 A;  1TQI A;  2QEN A;  4PUS A;  5J47 A;  4B8X A;  3LQR A;  1DGW Y;  2X0L A;  4H4K C;  3F8F A;  4HAM A;  1F43 A;  5EDN A;  1T2K A;  2E60 A;  4L5E A;  1YIT I;  3S3O A;  1E3O C;  4IHX A;  3FMR A;  4IKF A;  1OYY A;  1WPK A;  2DOD A;  1ZLJ A;  3HJE A;  2EQR A;  4QLC U;  5A2Q K;  1BR2 A;  2VBY A;  5B1B H;  1ZH5 A;  2E36 A;  3KZI C;  4LLL A;  3E3V A;  3BLY A;  1IGN A;  3RIR A;  2XGX A;  3DTK A;  2DAO A;  3KLN A;  1XS9 A;  1IDZ A;  2PJR A;  3OSG A;  3L2R A;  3ECH A;  2E1M C;  4PSX A;  3BJA A;  2BE5 F;  1XMK A;  1X3Z B;  2LF7 A;  2TCT A;  4NHJ A;  3S3N A;  3RYR A;  3L2W A;  2HR3 A;  2VJJ A;  3R0A A;  2OF7 A;  4U7D A;  1W0U A;  3MZ8 A;  4EM0 B;  2DXI A;  2QEX I;  3B6C A;  2XUB A;  1IO2 A;  2G7U A;  4WK8 F;  1YW9 A;  4A3L J;  2CU7 A;  2E1C A;  4O6J A;  3W2W A;  5B5E C;  2UWM A;  5FLX K;  2M45 A;  3RPU A;  1I6X A;  3PQK A;  2Z5U A;  5E20 A;  5KVR A;  1ZRD A;  4OOI A;  1DU6 A;  2TDX A;  3BR6 A;  1B8I A;  2XKP A;  3FBN B;  1R6R A;  1OCP A;  2R7X A;  3K4K A;  1U8B A;  4A3J J;  2LDU A;  2R7U A;  1JHF A;  3LNQ A;  1Y8R B;  1MBK A;  3ZN0 A;  1K78 A;  2BHY A;  1MIJ A;  2DQL A;  3CMM A;  3MN2 A;  1XG1 A;  4UVC A;  2YSR A;  1XMA A;  2LY2 A;  3ZMZ A;  3LWF A;  4GGG A;  3RKW A;  4OAZ A;  3ZQF A;  1FSE A;  3CCJ I;  4HRI A;  4OIQ F;  5GP9 A;  2QQ9 A;  1KON A;  3HL2 A;  1E3H A;  3SZT A;  5ED4 A;  3DFG A;  3A01 A;  4I09 A;  2Y30 A;  2XKO A;  1VQP I;  4D7N A;  2DOE A;  3BTC A;  2EFO A;  3O3K A;  4ENN A;  4U0V A;  3GTP J;  5GPA A;  4BNC A;  4NUB A;  3BG3 A;  3IH2 A;  1GLN A;  3HSE A;  5D5W B;  2DJI A;  1ZEL A;  2K02 A;  2X1D A;  3FXM A;  1TZL A;  5E1W A;  3FXU A;  4IQ4 A;  3QOD A;  1NG6 A;  1KYZ A;  2KRC A;  2FML A;  3FM5 A;  3L2C A;  1LQ1 A;  3CDL A;  2GQQ A;  3E5U A;  4JX6 A;  4HLY A;  1FOK A;  2E34 A;  3K1N A;  5M5W J;  2DT5 A;  4KNY A;  5AIP A;  5ILV A;  2VKD A;  3LSH A;  1E17 A;  2DCE A;  3FZV A;  3D5R C;  3ABU A;  2BW3 A;  1U78 A;  2M9H A;  1FNN A;  1ZYR F;  2CMP A;  2EIJ H;  5E17 F;  2IGO A;  4FCY A;  4EV0 A;  4X1E A;  3IAM 2;  2OC6 A;  2CUE A;  2FE3 A;  3SEQ A;  2RRE A;  2QBY B;  1FWZ A;  3LMM A;  3RI4 A;  2PMH A;  1XGS A;  2L7F P;  1RUN A;  4NNJ A;  2YS9 A;  2ZJP F;  3TED A;  1X3U A;  2MBF A;  3TBI A;  2F4O B;  3BQZ A;  3RPU D;  3DKX A;  3GW2 A;  4NC7 A;  5J1U A;  3K9T A;  5L3B A;  1EKE A;  4HX8 A;  2VIX A;  4UB8 C;  5FFZ A;  3PM1 A;  2OQR A;  4JQF A;  2V1X A;  2V1N A;  4LG3 A;  2IBD A;  4TV7 A;  3CP2 A;  4ANJ A;  3TDU C;  2P0W A;  4KIS A;  4L5J A;  5FKK A;  5J6X A;  3H1C A;  1MJB A;  2IW5 A;  4PSW A;  4FIS A;  2QQA A;  3QYE A;  2K9S A;  1ZG1 A;  1G6N A;  2GOM A;  2DPD A;  1IW7 F;  2DDB A;  5BOX A;  2A5Y B;  3ABM H;  3ERM A;  3WTX C;  2E1M B;  1WH7 A;  4A3F J;  2ZXW H;  2FBK A;  2R7O A;  4BE0 A;  3GBG A;  4KA4 A;  5LD2 C;  1ZR4 A;  2QUF A;  1ENH A;  4ZYD A;  4CA0 A;  1TWA J;  3NQO A;  4DZP A;  2Q8K A;  1OCC H;  2X48 A;  2NVX J;  3AG1 H;  2LY9 A;  1A5J A;  1HKQ A;  2XRL A;  4XON A;  3GTG J;  2PQ8 A;  2H94 A;  2JVH A;  2MSY A;  4XKC A;  3WE2 A;  4XID A;  4KT6 A;  3TKY A;  3FXQ A;  1P92 A;  3DXJ F;  4XNF A;  3J80 Z;  1LKX A;  5L3F A;  1R5I D;  5AIQ A;  2QM3 A;  2HFH A;  5LEK A;  3ZQ7 A;  2FA5 A;  2LKP A;  1YLF A;  5DCM B;  2GIZ A;  3BTL A;  4CYD A;  5CPR B;  4I6Z A;  1STZ A;  1ON1 A;  2IT0 A;  1I1G A;  2NXN B;  2VB6 A;  3F6V A;  2ZO4 A;  4EJV A;  2HOS A;  2K4J A;  2IS1 A;  5BMZ A;  2E2H J;  2ZXH A;  1B72 A;  2W85 A;  2IJL A;  3HDD A;  2WV1 A;  4M3D A;  2V6C A;  2M4K A;  1HC8 A;  1FTT A;  3G3Z A;  1RC9 A;  5E3O A;  3LQQ A;  3FIS A;  3CO7 C;  5L3D A;  2A6E F;  2M7A A;  3DLA A;  3FXO A;  1DQU A;  3HXL A;  4V2F A;  1SD7 A;  3HRS A;  2CFX A;  1Y0U A;  3GUD A;  4XM3 A;  4DYQ A;  1PYV A;  3BG5 A;  4DYR A;  1FT9 A;  3FDY A;  5BPD A;  3CDH A;  3I59 A;  4BXU A;  5L3E A;  3GTM J;  2Y9Z A;  4C3J J; 
#chains in the Genus database with same CATH homology
 1YIO A;  2VN2 A;  2IA0 A;  4LK1 F;  4BH9 A;  4IPA A;  3COA C;  5ILU A;  2DQR A;  4WXD A;  1SFX A;  1P4A A;  2CWE A;  1BI2 A;  4A0Y A;  1HW1 A;  2RDP A;  2FXA A;  2RKH A;  3GFI A;  3KFW X;  4G94 A;  2G9W A;  3WGH A;  4O5V A;  3FM3 A;  3OOP A;  1U3E M;  4A5N A;  1R00 A;  3CUQ B;  3L7W A;  1FLI A;  1MD0 A;  4ESF A;  4G7O F;  2Z99 A;  3MWM A;  2HEO A;  3P7N A;  5D5U B;  1Z6T A;  3BWG A;  2EFN A;  3RKX A;  3F72 A;  1XGO A;  3V8K A;  4I0A A;  1S6L A;  4YIF A;  4CO8 A;  1JHH A;  1ZLK A;  3FMS A;  4U7B A;  1T6S A;  5JI6 A;  5DCF A;  1DDN A;  3LST A;  1FZP B;  3IHU A;  1T38 A;  1YW8 A;  2ELH A;  1RI7 A;  2PMU A;  4EMS A;  1YW7 A;  4M73 A;  1IXR C;  3RPQ A;  3JTH A;  1EH8 A;  4ZZD A;  3WGI A;  2VC0 A;  3BPV A;  1TNT A;  1ULY A;  4EQQ A;  4RAY A;  1BI0 A;  5TRD A;  4L18 B;  1UFM A;  1TQM A;  2O3F A;  2X4H A;  5K1Y A;  2GA1 A;  2PLY A;  3I59 B;  4LJZ F;  3WOD F;  1S29 A;  1I27 A;  2YU3 A;  1P4X A;  2K27 A;  2W84 A;  2JT1 A;  4G7H F;  3KEO A;  1JE8 A;  2FRH A;  1FBS A;  4UVB A;  3WTW C;  1TW3 A;  1B1B A;  5FLX Z;  3IRQ A;  3BPX A;  3W6J B;  5HVQ C;  3KE2 A;  1O57 A;  3E6M A;  2VBX A;  1JXS A;  3BJ6 A;  5A2Q Z;  1GHC A;  5DD8 A;  5LGT A;  1RNL A;  5HLI A;  4FHT A;  4KDP A;  2J5O A;  3ZMD A;  1O3Q A;  1USS A;  1CGP A;  3G73 A;  4EVI A;  5L3G A;  3EUH A;  3ZPL A;  4GYI A;  2CYY A;  2QVO A;  1BBY A;  2MD5 A;  1IN4 A;  2BGC A;  1J0R A;  5JHU A;  4IVN A;  2M30 A;  3IL2 A;  3HHG A;  4KMF A;  4U0W A;  3DPT A;  4HZF A;  1FX7 A;  5D4S A;  2F2E A;  5CVR A;  2MC3 A;  1R23 A;  4IRG A;  4I98 B;  2UZK A;  4RB2 C;  1UST A;  1XN7 A;  5IT9 K;  3GWZ A;  1JGS A;  2DK5 A;  3TOA A;  4A5M A;  4OIP F;  2HQN A;  1R5H A;  4EM2 A;  1TQP A;  1SD6 A;  3O2P E;  2IP2 A;  1WSU A;  4WXH A;  5TJJ A;  1PDN C;  1ZGA A;  4R79 A;  1YO5 C;  2CGP A;  1J9I A;  1LNW A;  1MDM A;  4Y17 A;  3PFI A;  4HX4 A;  4HV5 A;  2FBH A;  3QOP A;  1O3R A;  2BYV E;  3QU6 A;  1K6O A;  2L4A A;  3QRF F;  3L9F A;  1ON2 A;  3FX3 A;  4UHT A;  4YG2 F;  2BEO A;  4IRH A;  3V8L A;  4KFC A;  5DD4 A;  2HTJ A;  4LGW A;  3ERE D;  3KP5 A;  3WTT C;  3JAM Z;  2KIM A;  4WF2 A;  4IRI A;  1FYL A;  3IKV A;  1MJ9 A;  1YYV A;  2Q2E A;  5E18 F;  3HOT A;  5DUI A;  2IVM A;  1ZAO A;  3R4K A;  2K86 A;  3F23 A;  4XSZ F;  4B09 A;  4R1H A;  4HLX A;  5HS7 A;  4RGR A;  2QYO A;  2VBZ A;  4CXF A;  1MZB A;  5ILS A;  1BC7 C;  4L5I A;  5ICE A;  3F8M A;  2HOE A;  3J7A O;  2O61 A;  2FBI A;  3C1D A;  3GF2 A;  1SFE A;  1KU7 A;  4RGX A;  4PGG A;  2MLK A;  6PAX A;  5CLS A;  4I2O A;  3KZZ A;  3FWE A;  2O6G E;  4IHT A;  2VON A;  4KYW A;  2A3S A;  2XRN A;  4OMY A;  3GYH X;  3IWF A;  3I58 A;  4LG0 A;  1ZN2 A;  2F5D A;  2IPQ X;  5IT3 A;  5J8C A;  4HDU A;  4WXC A;  2EV5 A;  3P9C A;  4AWX B;  1IN5 A;  3MQ0 A;  2VOP A;  1EV7 A;  3MCZ A;  4A0Z A;  1D3Y A;  3U9G A;  1O3S A;  3P9I A;  2UXX A;  4M6Y A;  3KEQ A;  2L02 A;  1IN6 A;  2FU4 A;  4MGR A;  2HKO A;  2HWV A;  1BIA A;  2NNY A;  4FT8 A;  1HXD A;  4L0Y B;  2P7V B;  4K2E A;  4H0E A;  2NNN A;  3EET A;  3FHZ A;  2VT3 A;  2LNB A;  1XB4 A;  2JPB A;  5LEJ A;  3SHF A;  5IT9 Z;  3T8R A;  3J80 K;  2DTR A;  2Z33 A;  2STT A;  4BHB A;  4M9S A;  1R5G A;  4KIG A;  2P5L C;  1XSV A;  4ENM A;  3F8B A;  2F5E A;  2M1B A;  2CO5 A;  1QGP A;  4UVA A;  3T0Y A;  3KP2 A;  2ESN A;  1GVJ A;  2A07 F;  3R6S A;  2XAS A;  3CUO A;  4M6X A;  1GXP A;  4L9T A;  1IRG A;  4AD9 A;  5BQT A;  2AXL A;  5DEQ A;  3I4P A;  2L54 A;  4FX4 A;  4NQW A;  4CHU A;  2D45 A;  4LG0 B;  1ZAR A;  5H20 A;  4G6D A;  4HF1 A;  3I53 A;  2PJP A;  3QU3 A;  4HW0 A;  3EYI A;  3L00 A;  4ZZL A;  3WG9 A;  4LFU A;  3TDZ C;  2EK5 A;  4Z2Y A;  1TW2 A;  3IRR A;  4ETS A;  2QZ8 A;  2ESH A;  5FGM A;  1Z9C A;  2VE9 A;  2OU2 A;  1PP7 U;  2OA4 A;  5D8K B;  5CVU A;  2WWY A;  3SQN A;  3GFL A;  2RQP A;  5D6E A;  3GVA A;  4HQE A;  3N97 A;  1QO0 D;  3TOB A;  3MFK A;  3ZMU A;  3T1B A;  2LSO A;  2DW4 A;  3F8N A;  3CJN A;  2K7L A;  2GA2 A;  2VT2 A;  1R1U A;  3E6D A;  1OYI A;  5D4R A;  1U8R A;  2MLG A;  4QWQ A;  4D0P A;  4UV9 A;  1QZY A;  3L09 A;  4UNO A;  3E5Q A;  2OZ6 A;  3QPH A;  1Z6R A;  2HTS A;  3GXO A;  4ESJ A;  4GXO A;  3MZY A;  5DCM A;  2KJB A;  1ZGJ A;  1BI1 A;  4JBA A;  3U2R A;  4UXN A;  2F5C A;  1WWX A;  4RB0 A;  3HHH A;  5FD6 A;  3ABT A;  4AIK A;  2VE8 A;  1NHA A;  1J7K A;  1U6G A;  4KN7 X;  4G7Z F;  5HLG A;  2FNP A;  1KYW A;  2A69 F;  3ULQ B;  3VOE A;  3H92 A;  4BHP A;  1OMI A;  1PP8 F;  1QQI A;  4ZYG A;  3O6B B;  1ZRE A;  1J2X A;  2DLL A;  4HQM A;  4ZYE A;  1T98 A;  3FF5 A;  2XVC A;  1YQA A;  1C0W A;  1P2F A;  5ICG A;  4EGY A;  1G3Y A;  1YS6 A;  1YTY A;  4AIJ A;  1I1S A;  4MEY F;  2DBB A;  2E1N A;  4M71 A;  4Y15 A;  1ZG5 A;  1IZ1 A;  3GEZ A;  2ZME B;  3FMQ A;  3HYI A;  1G3W A;  4L9N A;  4A2U A;  2EJR A;  2YPR A;  2DK8 A;  3J81 Z;  1HKS A;  4I0B A;  2VC1 A;  4GO1 A;  3HUG A;  5HLH A;  2W24 A;  3ISP A;  1HBX G;  1XDS A;  4IHS A;  3V8J A;  3BRO A;  2XRO A;  3ZMS A;  1SAX A;  1ONV A;  1WRJ A;  2C6Y A;  5E8G A;  2ZFW A;  1XCV A;  4XRF A;  1FPQ A;  2R3S A;  2CSO A;  1RZ4 A;  1F1Z A;  1UB9 A;  3D0S A;  2EA4 A;  4KN4 X;  1W7P A;  4LK0 F;  1F9N A;  2L01 A;  1D8K A;  1DP7 P;  2RN7 A;  2ACJ A;  5LGN A;  3JW4 A;  1P6R A;  1HST A;  1U5T C;  1HW5 A;  1R36 A;  3R61 A;  3IC7 A;  3WTU C;  4FX0 A;  4S05 A;  2B0L A;  3QPT A;  2PFB A;  4KUM A;  1LEA A;  2HQR A;  2D2W A;  4MHG A;  3QAH A;  2QQB A;  3SXY A;  1XSD A;  1BOA A;  2DO7 A;  1T0F A;  1H9G A;  1R7J A;  3Q9V A;  5LBQ A;  2KJC A;  1PUE E;  3GZ6 A;  4BAY A;  2DU9 A;  4EJW A;  1WQ2 A;  4Y13 A;  2V9V A;  2GIV A;  3P9K A;  1MDM B;  1OKR A;  4PGH A;  5JVT A;  1J5Y A;  3V7R A;  4ESB A;  5J8F A;  2ZNY A;  1GXQ A;  2ZBK A;  1W7P D;  3EYY A;  3MZH A;  5ERI A;  2ZJ2 A;  2JTV A;  4KMU X;  2KIU A;  2QWW A;  3DF8 A;  3CUQ C;  1HKT A;  1Z91 A;  2YX4 A;  1FC3 A;  1Z05 A;  5H6R A;  3JSP A;  2ISY A;  2R7F A;  1K78 B;  2ADU A;  4M72 A;  3S2W A;  1IAW A;  3ROU A;  1TTY A;  2P5V A;  3QP6 A;  2O03 A;  4PZJ A;  1SMT A;  1LJ9 A;  4CGZ A;  2YR2 A;  1UHM A;  4I02 A;  1MGT A;  3DP7 A;  1BJA A;  1Z7U A;  3WU0 A;  2GWR A;  3LFK A;  4KT5 C;  3V7C A;  3W6K B;  1B9M A;  2ZME A;  4RGS A;  4WCG A;  1UCR A;  5KK1 A;  1O7L A;  2Y75 A;  4HBL A;  3VOD A;  1WI9 A;  3RJP A;  3LAP A;  2XAH A;  3DQV C;  3IWZ A;  3ECO A;  2P6S A;  1D8J A;  2RNJ A;  1UHW A;  3E97 A;  4PDK A;  1FYM A;  2J5P A;  3K1P A;  4AIH A;  2CW0 F;  3ZP5 A;  1CF7 A;  3E6C C;  4P96 A;  1SD5 A;  3TGN A;  4O3M A;  5CVI A;  3SZP A;  2P5K A;  5DV5 A;  2HZT A;  1G4D A;  3MEX A;  4WWC A;  1QNT A;  1QPM A;  2PG4 A;  2KIF A;  2V1D A;  1KU2 A;  1BI3 A;  4RB1 A;  1MKM A;  5EEH A;  1IXC A;  3IKT A;  1ZG3 A;  2K4B A;  4ASN A;  2P4W A;  4BQA A;  3TO7 A;  1XD7 A;  2WC2 A;  1FBQ A;  4CZZ A;  4PCQ A;  1D5V A;  2QLZ A;  4XBF A;  1DUX C;  1B59 A;  1KU9 A;  2H6C A;  3F21 A;  2OQG A;  2P7C B;  3HRT A;  2RVC A;  1T39 A;  3EQL F;  2P8T A;  4NB5 A;  3V7S A;  1ZRF A;  1LDD A;  1REP C;  2VOD A;  2IA1 A;  3HTS B;  1Q1H A;  2G7H A;  1EH7 A;  1SD4 A;  4L9V A;  3RYP A;  2OAZ A;  2ZXJ A;  5DUK A;  2GZW A;  1H0M A;  3RKY A;  4XSX F;  5K5O A;  3NRV A;  4OIN F;  3EDP A;  4MEX F;  1OPC A;  4P9F A;  4LMY A;  4I7H A;  4F7Z A;  4LB6 B;  1LDJ A;  5FO5 A;  1HSJ A;  2E7X A;  2XAQ A;  3GFM A;  4EJO A;  4IF4 A;  3KZY A;  2QBY A;  4HOB A;  4I01 A;  1LB2 A;  5HDN A;  3T8T A;  1E2X A;  3KP4 A;  1HQC A;  2AS5 F;  1V4R A;  3GO5 A;  1S3J A;  3PQJ A;  5EEG A;  1XCB A;  3R0J A;  5E1X A;  3C3W A;  3FXR A;  2EFW A;  2HDC A;  3HSR A;  1G3T A;  3WTY C;  3C18 A;  2A61 A;  3RTR A;  5FFX A;  1ZRC A;  1AWC A;  4MQ9 F;  5FB2 A;  1V3F A;  1FSH A;  3TO6 A;  2W57 A;  4P55 A;  2PI0 A;  3LA2 A;  4E70 A;  1LDK B;  2EWN A;  1CF7 B;  4LD5 A;  4M9X A;  4YFN F;  2STW A;  3BY6 A;  3CO6 C;  1VTN C;  2UXN A;  5LRS A;  1U5T A;  3Q5F A;  2FF4 A;  2R7D A;  3KLO A;  2JSC A;  1XGN A;  3KCC A;  5E8I A;  1KQ9 A;  2FSW A;  2VOO A;  2Y48 A;  4JK1 X;  2VBW A;  1W5T A;  3F8C A;  4DQ2 A;  1DPR A;  3CUQ A;  3VB2 A;  4G8X A;  2O8X A;  3NEU A;  2Z9O A;  4A12 A;  2CQK A;  4HF2 A;  4BYY A;  3F22 A;  5F64 A;  4KIB A;  1S7O A;  2ZNZ A;  1HW2 A;  2ISZ A;  5JR3 A;  4BHC A;  1R1V A;  1QZZ A;  3WTZ A;  3GLX A;  1O7F A;  1TLH B;  2JPC A;  2EFP A;  2DFI A;  2NS0 A;  2ZCW A;  4MTD A;  1RUO A;  2D1V A;  5K5Q A;  4YFX F;  3K1M A;  2DI3 A;  4A6E A;  3KP3 A;  2E7W A;  2M5W A;  2EFQ A;  3GZ5 A;  3M1E A;  2OD5 A;  5D5X B;  1ZHF A;  3VEP A;  2V1U A;  3H3Z A;  4UV8 A;  1F4K A;  2FQ3 A;  3WE3 A;  4KIC A;  2JRT A;  1EH6 A;  4ZH4 F;  3U1D A;  3REO A;  2MA3 A;  4OIO F;  2FMY A;  1OR7 A;  3E5X A;  1TNS A;  1BIB A;  5CYV A;  5D6F A;  3ZN1 A;  3KET A;  3Q9S A;  1S7A A;  4MTE A;  2XAF A;  2GXB A;  4ON0 A;  4G9Y A;  1R58 A;  2XHK A;  2L4M A;  3ML6 A;  2WV0 A;  2KKO A;  3MAJ A;  3LA7 A;  2COM A;  2WTE A;  1IXS B;  3DPL C;  4UUV A;  4Q5S F;  5K5R A;  1A04 A;  1DPU A;  2RC4 A;  2HYG D;  2ZKZ A;  5DDG A;  3CLO A;  3GX4 X;  1K79 A;  3D5L A;  2PBI A;  2VXZ A;  3JSO A;  3M9A A;  5E1Z B;  1BC8 C;  1R1T A;  5LHI A;  3ZMT A;  2H6B A;  4LLN A;  4L0Z B;  2KRF A;  2DPU A;  1U5T B;  4OU0 A;  2Q0O A;  5DYM A;  4ENK A;  5CVV A;  4N0B A;  2IA2 A;  5LRR A;  3BOQ A;  3QP5 A;  3BZ6 A;  4DNC A;  5HS8 A;  4HDV A;  4MNU A;  4YFK F;  4XLP F;  3HIF A;  2H09 A;  2XAG A;  3J81 K;  4IJA A;  1SFU A;  1YFH A;  1P4W A;  1S8N A;  1FP2 A;  4HX7 A;  2XIG A;  5D5V B;  3JTG A;  3BDD A;  2V79 A;  4CDG A;  3M8E A;  4WX9 A;  2NAZ A;  2GAU A;  5H6Q A;  1LEB A;  1BM9 A;  2EV6 A;  5CJ9 A;  5L3C A;  4MQV A;  3I0T A;  1FP1 D;  4Q4Z F;  2RV8 A;  5LLQ A;  2PEX A;  4RAZ A;  1AOY A;  3HSF A;  2O0Y A;  1YS7 A;  3ELK A;  4XLN F;  1G3S A;  4IXA A;  5JFR A;  4RB3 C;  4P5O A;  3GFJ A;  3TO9 A;  4ZYH A;  2M8E A;  4Q48 A;  2RGV A;  1LVA A;  3LA3 A;  3HTU A;  1Z1D A;  5LHH A;  1IF1 A;  2W25 A;  4HF0 A;  1B4A A;  1W7P B;  3DV8 A;  1W4M A;  4G6Q A;  4R8H A;  1KA8 A;  4GCV A;  2NYX A;  3VFZ A;  5F1R A;  4A6D A;  5HOO A;  3OV8 A;  4OMZ A;  1U2W A;  5HS9 A;  1O3T A;  1BN5 A;  2F5F A;  4U88 A;  2FOK A;  1H9T A;  1FBU A;  2BV6 A;  3CTA A;  3HOS A;  5LHG A;  1XDU A;  1I5Z A;  5FD5 A;  2MH2 A;  4HYE A;  2PN6 A;  2FNA A;  3WU1 B;  2EA2 A;  5AON A;  1IUY A;  1XGM A;  2P6T A;  4N9I A;  2NRA C;  5BPI A;  4CIC A;  3E6B A;  3F6O A;  3JAM K;  1R22 A;  2L3D A;  3WGG A;  1F5T A;  1WKM A;  3K69 A;  2OBP A;  3H3U A;  2FEZ A;  2MH9 A;  5CVJ A;  4P9U A;  3BJO A;  4RS8 A;  4M74 A;  2D1H A;  2OZU A;  4L9J A;  4KIF A;  1L0O C;  3KP6 A;  4EJT A;  2XAJ A;  1B9N A;  3KP7 A;  5BS6 A;  1ODD A;  5F6F A;  1FYK A;  4EGZ A;  3I71 A;  4RGU A;  2HKX A;  3HRM A;  3ZMV A;  2M87 A;  4LB5 A;  4U0Y A;  3I54 A;  2HS5 A;  3BP8 A;  4EM1 A;  3K2Z A;  1IN8 A;  3C7J A;  3DEU A;  1KGS A;  3M8F A;  1QBJ A;  1J59 A;  4A0X A;  3N4M A;  3M7G A;  4M9Z A;  5HDK A;  1YG2 A;  2EB7 A;  3LAJ A;  3DKW A;  1TBX A;  1OYW A;  1MJA A;  4LLG F;  4AVP A;  2XV4 S;  4GYG A;  3F3X A;  1J75 A;  1SMY F;  2IRF G;  2ETH A;  2LF8 A;  1IRF A;  3B73 A;  4YII A;  2A68 F;  1KQ0 A;  3R60 A;  2JZY A;  5LGU A;  1RIO H;  3T5X A;  3SFZ A;  3AAF A;  3I5U A;  3HRU A;  3I64 A;  3TQN A;  5D8L B;  4Q47 A;  3V4G A;  2BBY A;  4S04 A;  2EV0 A;  1B6A A;  4N9H A;  2HYF A;  3WTV C;  2H27 A;  1FY7 A;  2HGC A;  1K7A A;  3K0L A;  1L3L A;  2GXG A;  2CG4 A;  4OIR F;  5ICC A;  2YX7 A;  4ENJ A;  4HV6 A;  4HA8 A;  3B02 A;  3RDI A;  1KQ8 A;  3WTS C;  1W5S A;  2Y0M A;  1KU3 A;  2A6H F;  1XSX A;  1IN7 A;  2Z3Y A;  4EJU A;  5ICF A;  5HDG A;  1TQI A;  2QEN A;  4B8X A;  3LQR A;  2X0L A;  3F8F A;  4HAM A;  1T2K A;  3FMR A;  1OYY A;  1ZLJ A;  5A2Q K;  4QLC U;  2VBY A;  1ZH5 A;  4LLL A;  3E3V A;  3RIR A;  2XGX A;  2DAO A;  3KLN A;  3ECH A;  3BJA A;  2BE5 F;  1XMK A;  2LF7 A;  4NHJ A;  3RYR A;  2HR3 A;  3R0A A;  4U7D A;  4EM0 B;  2XUB A;  2G7U A;  4WK8 F;  1YW9 A;  2E1C A;  4O6J A;  2UWM A;  5FLX K;  2M45 A;  3RPU A;  1I6X A;  3PQK A;  2Z5U A;  5E20 A;  5KVR A;  1ZRD A;  4OOI A;  2TDX A;  2XKP A;  2LDU A;  1JHF A;  3ZN0 A;  1K78 A;  2DQL A;  4UVC A;  2YSR A;  1XMA A;  3ZMZ A;  3LWF A;  4GGG A;  3RKW A;  4OIQ F;  1FSE A;  2QQ9 A;  3SZT A;  5ED4 A;  3DFG A;  4I09 A;  2XKO A;  3O3K A;  2EFO A;  4ENN A;  4U0V A;  4BNC A;  3HSE A;  5D5W B;  2K02 A;  5E1W A;  3FXU A;  1KYZ A;  2FML A;  3FM5 A;  3L2C A;  1LQ1 A;  2GQQ A;  3E5U A;  4HLY A;  1FOK A;  3K1N A;  2DT5 A;  4KNY A;  5AIP A;  5ILV A;  1E17 A;  3FZV A;  3ABU A;  1U78 A;  1FNN A;  1ZYR F;  5E17 F;  4EV0 A;  2FE3 A;  2QBY B;  1FWZ A;  3RI4 A;  2PMH A;  1XGS A;  1RUN A;  1X3U A;  2MBF A;  3GW2 A;  3K9T A;  5L3B A;  4HX8 A;  5FFZ A;  2OQR A;  4JQF A;  2V1X A;  4TV7 A;  3TDU C;  4L5J A;  5J6X A;  1MJB A;  2IW5 A;  2QQA A;  1ZG1 A;  1G6N A;  2DPD A;  1IW7 F;  5BOX A;  2A5Y B;  3WTX C;  2FBK A;  4KA4 A;  2QUF A;  4ZYD A;  3NQO A;  2Q8K A;  1HKQ A;  2PQ8 A;  2H94 A;  3WE2 A;  3TKY A;  3FXQ A;  1P92 A;  3DXJ F;  3J80 Z;  5L3F A;  5AIQ A;  5LEK A;  2QM3 A;  2HFH A;  3ZQ7 A;  2FA5 A;  2LKP A;  1YLF A;  5DCM B;  4CYD A;  1STZ A;  1ON1 A;  2IT0 A;  1I1G A;  4EJV A;  3F6V A;  2ZO4 A;  2K4J A;  5BMZ A;  2W85 A;  2IJL A;  2V6C A;  3G3Z A;  3LQQ A;  3CO7 C;  5L3D A;  2A6E F;  1SD7 A;  3HRS A;  2CFX A;  1Y0U A;  3GUD A;  1FT9 A;  5BPD A;  3CDH A;  3I59 A;  4BXU A;  5L3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...