4KMFA

Crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
SAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Interferon-inducible and double-stranded-dependent eIF-2kina
publication title Distinct Z-DNA binding mode of a PKR-like protein kinase containing a Z-DNA binding domain (PKZ).
pubmed doi rcsb
source organism Carassius auratus
total genus 21
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kmfA00
1TNSA 1I6XA 3DKWA 4I09A 1DDNA 1LDDA 2ZMEA 5CVRA 1I1SA 1QBJA 1O57A 4RB1A 1PUEE 1J2XA 3GUDA 1AWCA 4DNCA 1WWXA 4LG0B 4HF2A 5ED4A 3RKXA 2NAZA 2QYOA 3FF5A 3RPQA 3V8KA 2Z3YA 3DPTA 3HIFA 5D5XB 4RGXA 4CGZA 2ESNA 1FSHA 4HLXA 4KN4X 3F72A 5D5WB 2D1HA 3HRUA 5CVUA 2XROA 3IWFA 1B9MA 1E2XA 1KQ8A 4L9VA 4EM1A 2VODA 3VEPA 4HOBA 2D1VA 3QP6A 2PBIA 3H92A 3K1MA 4YFNF 2ZJ2A 3W6JB 1YW8A 3CUQB 4MTDA 2R3SA 1Z7UA 4M9ZA 5F1RA 1W5TA 4LG0A 3VFZA 2VOOA 5ICEA 4L0ZB 1S29A 2XKPA 1ZGAA 5K5OA 2XIGA 3QU6A 4EJTA 3M7GA 4A0YA 2VT3A 3E6MA 2CG4A 2W25A 1XCVA 3PQKA 4XLPF 1HXDA 3KP3A 5LGUA 4UNOA 2FEZA 3DFGA 2YSRA 5HS8A 3J80K 2HKOA 5DCMB 2H94A 1GXQA 1IW7F 3CUOA 1HKQA 3SZPA 4L18B 2P4WA 2XAQA 4HX7A 1IF1A 1J59A 4I02A 1KU3A 3BP8A 4XBFA 2LF8A 4RB2C 2XKOA 5HLHA 4RB3C 3MZHA 4LJZF 2JRTA 3HHGA 5AIPA 3F22A 1IXRC 2IA0A 4WCGA 4IJAA 2BE5F 3WGIA 4PGHA 4KMFA 4HQEA 4EGYA 3FXRA 4HYEA 2RQPA 2HYFA 3TO7A 2EA4A 3M8FA 2P5KA 2ESHA 5HLGA 3BJOA 4A5MA 4LMYA 5ILVA 1J75A 1USSA 2IJLA 3E6BA 1T39A 3HUGA 1SAXA 1SMYF 4M72A 4B09A 5DCMA 3HRMA 1FBUA 2A6HF 1HKSA 1R23A 2DBBA 4OOIA 3ML6A 1LB2A 3D5LA 4G9YA 4EQQA 2P8TA 1HW1A 3COAC 3MEXA 1ZG3A 1TBXA 4UV9A 2FNPA 3EYIA 3GXOA 1T6SA 2MH9A 1BC8C 5DDGA 4MEYF 2G7HA 2VBWA 5FLXK 3MFKA 4MQVA 2P6TA 2Q8KA 2HKXA 2GXGA 1IXSB 1U3EM 4ZYGA 2FMLA 3CDHA 2ZNYA 1D3YA 1FC3A 5LRRA 1OMIA 3HSRA 3TQNA 2HFHA 5DYMA 4G94A 2QQBA 5EEHA 4IRHA 2L54A 1XN7A 4YG2F 1ZYRF 2OA4A 3RPUA 3BOQA 5E17F 5AONA 4OIOF 3DEUA 4LB6B 3E6DA 2DI3A 1SD5A 4G6QA 3L09A 5L3GA 1O3QA 1T98A 2ZFWA 4Z2YA 1J7KA 3C3WA 3KP4A 3TDUC 1XMKA 3WTVC 3CO7C 2G7UA 2P5VA 4LD5A 5LHGA 5J8FA 5HDNA 5A2QK 1OYIA 1SFEA 4YIFA 2K02A 2F5FA 1TW3A 4FX0A 5DEQA 3VB2A 1YTYA 4HZFA 3N97A 2OAZA 2FSWA 2MH2A 3DF8A 2ZKZA 5D5UB 1IN7A 3KCCA 3WTYC 5HDGA 3G73A 3DQVC 3F3XA 2CGPA 3KP7A 1YW7A 3WGHA 1XGOA 3I53A 5F64A 3C1DA 3E6CC 3LAPA 1K7AA 1LDJA 2E1CA 1HSJA 3LA3A 1XGMA 1MJAA 2GQQA 5TRDA 4BNCA 2ETHA 2HGCA 4RAZA 3CO6C 3F8FA 4WX9A 3GWZA 4HV5A 4EJOA 3BPVA 3RTRA 2VONA 4AIJA 1HSTA 4GGGA 3ZPLA 1Q1HA 4A5NA 3EUHA 1QZZA 4JQFA 3TO9A 4I2OA 1T0FA 1WSUA 2HDCA 3FXUA 5ICFA 3LQQA 2IA1A 4TV7A 3E5XA 1IRGA 3B73A 4GYGA 2F5DA 4EJVA 5D6FA 4EV0A 2CW0F 2DW4A 1A04A 4HX8A 3IKVA 4YFXF 2HZTA 1P4XA 1JGSA 5LEJA 4IVNA 3KE2A 1PP7U 2M30A 5H20A 3K2ZA 4M6XA 3IHUA 3GFLA 2DPDA 2FA5A 2CO5A 2YX4A 2GIVA 2TDXA 2KKOA 1S7AA 3MQ0A 2GZWA 5F6FA 1FLIA 4CICA 4U0WA 5HS7A 1S8NA 2LSOA 5L3EA 4R1HA 4HF1A 1Z9CA 2X0LA 3LAJA 2W84A 2NNYA 4KIBA 1R36A 3FM5A 1S7OA 4ASNA 2DLLA 4BAYA 4AD9A 3JAMK 1LVAA 4U0VA 2A69F 3ELKA 4EJWA 2VT2A 4P96A 1H0MA 4A2UA 2XUBA 1P4WA 2R7FA 1BI1A 4S04A 3HSFA 4HA8A 4Q47A 1SD6A 2NNNA 5D4RA 3NRVA 4LLNA 4LB5A 1LNWA 2BV6A 5LLQA 2EFNA 1W7PB 1W5SA 2OU2A 1C0WA 2JPCA 2PG4A 1B59A 3AAFA 1USTA 3T8TA 1R00A 2OZUA 3EDPA 3GFIA 1WRJA 2QWWA 4L5IA 3R0AA 1O7LA 2Q2EA 4I01A 5H6RA 4ENMA 3HHHA 2QQAA 3BPXA 1U6GA 5CJ9A 3T8RA 4ETSA 1F1ZA 2L02A 3M8EA 4IRGA 3KP2A 3SHFA 3WTTC 2FBHA 3RKWA 1PDNC 4M6YA 2IA2A 4NHJA 2ZCWA 1XGSA 2CWEA 2QQ9A 2FMYA 4ZYEA 2DK5A 4ZYDA 5ILSA 2L4MA 2VE9A 5BQTA 5L3CA 3BY6A 4E70A 2GXBA 4JBAA 2A61A 4QWQA 1GHCA 3BWGA 1JXSA 1ZRFA 2XAGA 2KJCA 3DV8A 3HSEA 3REOA 1B1BA 1SD4A 1JHHA 3EYYA 1FP2A 1FY7A 5EEGA 4RB0A 3BJAA 1I27A 2E7XA 2P6SA 4ZH4F 3RIRA 4K2EA 3J80Z 5ERIA 4L5JA 2EA2A 1ZRDA 3SXYA 1TQPA 4R8HA 4CYDA 3T5XA 1AOYA 2ISZA 2EFOA 3HYIA 4R79A 4P9FA 2KIUA 2A5YB 2RNJA 1U5TC 4LLGF 3KETA 5K1YA 1OR7A 4G8XA 1EH6A 1BIBA 4FX4A 4OU0A 3KZZA 1FP1D 4HDVA 2FXAA 3IL2A 3M9AA 1G3YA 5BOXA 2Y75A 4M74A 2VC1A 2YX7A 1FYLA 4ENKA 5L3BA 1XDSA 1ZARA 3P9KA 1ZN2A 5FD5A 4OIPF 1FPQA 1P2FA 3CUQA 4KIGA 5AIQA 4BQAA 2D2WA 1IN8A 1IXCA 4UVBA 4M9XA 1KU2A 3TGNA 2EV5A 1MKMA 2DU9A 2PLYA 4HF0A 2R7DA 4A0ZA 2PMUA 1UHWA 5HOOA 2D45A 2HYGD 3WTSC 1XB4A 3KLOA 2ACJA 5E1XA 1ON2A 2ZXJA 3O3KA 2XAJA 3J7AO 1KU7A 3LA2A 1SFXA 1IZ1A 4NB5A 5FLXZ 1B6AA 1TTYA 1BI2A 4CHUA 2K27A 1HQCA 2XHKA 2GAUA 2ZNZA 2A07F 2PN6A 5D5VB 3P7NA 1SMTA 1FYKA 2RV8A 4EM0B 3E97A 3ECHA 4KUMA 1WQ2A 2MC3A 2FE3A 2JTVA 4KDPA 2BGCA 2MBFA 1KGSA 4B8XA 2IP2A 2W57A 3K1NA 2OZ6A 4EVIA 1BBYA 3LQRA 3ROUA 2L4AA 5DD8A 4BHCA 1L0OC 1QZYA 5D4SA 3ZQ7A 2Z5UA 1MGTA 3L9FA 2E1NA 4ON0A 2V1UA 4ZZLA 1RI7A 1L3LA 3I4PA 2Z9OA 3GO5A 3ULQB 2O61A 1Z6TA 2HTJA 3V7RA 3VODA 3ZMUA 3T1BA 4EJUA 4L9TA 5A2QZ 4OMZA 2FU4A 1G3WA 3WTUC 3WG9A 2F5EA 2K7LA 4P55A 3Q5FA 4ENNA 4LLLA 3I58A 3FZVA 2RGVA 1W4MA 2JZYA 4ESJA 2J5PA 1FNNA 2LF7A 2EK5A 4DQ2A 2Z99A 2CYYA 4AIKA 5DD4A 4IHTA 4HDUA 3FX3A 3SZTA 4Y15A 2QLZA 3H3ZA 2EFQA 2GA1A 3U2RA 1QGPA 3TDZC 3J81Z 1SD7A 1YYVA 4HW0A 3FMRA 1HW2A 1HKTA 4XSZF 1K6OA 2PJPA 1ON1A 2WTEA 2P7CB 1G3TA 4XSXF 3DPLC 2V9VA 1EH8A 3R6SA 1ZH5A 2DK8A 1OKRA 4MNUA 2IPQX 2KIFA 4N9IA 4O6JA 4LK0F 1FWZA 1GVJA 1LQ1A 3IC7A 1Y0UA 5FFXA 2DTRA 3EETA 4ZYHA 1XCBA 4OIQF 1FOKA 2W24A 5E8GA 4FT8A 2V6CA 1ONVA 2VBZA 2QVOA 2Y48A 4U7DA 1XSDA 4P9UA 1MD0A 2JSCA 3LWFA 4RGSA 3LA7A 3I0TA 3EQLF 4RAYA 4OIRF 1LDKB 4WWCA 4U0YA 2NRAC 4WF2A 5K5QA 1ZGJA 3ZMTA 2QENA 3BZ6A 3KZYA 3OOPA 1ZREA 2OBPA 1IN6A 1R1UA 3I59B 3RI4A 4WK8F 2H09A 2STWA 4A0XA 2DFIA 3ABUA 4M71A 2QM3A 4AVPA 3QPHA 3K9TA 2IRFG 3GFJA 4PCQA 2VE8A 2BBYA 3GVAA 3L2CA 2H6CA 3JAMZ 3PQJA 2FNAA 2MD5A 3DP7A 4UUVA 1IUYA 4G6DA 3MCZA 4U88A 2M45A 4I98B 3ZMVA 5LGTA 2ISYA 5J8CA 1YQAA 2PFBA 1H9TA 1RIOH 2PI0A 3JTHA 2MLKA 3F23A 2MLGA 1D5VA 4HAMA 1JHFA 5ILUA 4MEXF 1DPRA 5HDKA 1CF7B 1Z1DA 3I59A 3C7JA 4GXOA 5JR3A 1TQMA 3W6KB 2C6YA 1FT9A 4G7ZF 1U8RA 3GZ6A 2UWMA 2M1BA 1KQ0A 2M5WA 1XMAA 2VBXA 4KN7X 4AWXB 5BMZA 1DP7P 1G4DA 3ZN1A 4F7ZA 2FQ3A 2FOKA 3QU3A 4ZZDA 5DUIA 2DT5A 2RKHA 3V7CA 1QQIA 5TJJA 3IWZA 3ISPA 2HR3A 3WTXC 4A6DA 4MQ9F 3WGGA 4AIHA 3Q9SA 1BN5A 3HOTA 4EMSA 1OYYA 5JVTA 5DV5A 1O3RA 2HOEA 2RVCA 4UVAA 3QOPA 3GF2A 1IAWA 1TLHB 3K1PA 4WXHA 3TO6A 3ZN0A 2EV6A 1ZLKA 3F21A 4M73A 3WE3A 2VC0A 2FRHA 2O0YA 2BYVE 4L9JA 2B0LA 1GXPA 3K69A 2PQ8A 5E8IA 3WODF 1KYZA 3HOSA 2RDPA 3F8MA 1U78A 3L00A 3QP5A 4PGGA 4MTEA 2Y0MA 1B4AA 5FB2A 5LBQA 4ENJA 4I7HA 4YIIA 1QPMA 1YIOA 1W7PD 1O3SA 1YS6A 1EH7A 4HBLA 5FD6A 5CVIA 1KYWA 3TOAA 1W7PA 2WV0A 4A6EA 1S6LA 5KVRA 1FBSA 3MAJA 1UB9A 1MDMB 3QRFF 5FGMA 3ABTA 3R61A 3F6OA 5ICCA 3RJPA 4IF4A 3E3VA 3RKYA 3GX4X 2IT0A 2EWNA 2XAFA 1XGNA 5IT9K 2EV0A 1ZG1A 3R0JA 2MA3A 1BC7C 1IRFA 3ERED 3ZMZA 4BHBA 1O7FA 3LFKA 2EB7A 3B02A 4OMYA 2IW5A 3BROA 4UHTA 3Q9VA 1J0RA 3V7SA 2LDUA 3GEZA 3FMQA 1K78B 2O3FA 2RN7A 4I0BA 2XASA 3E5QA 3FXQA 1ZRCA 2ELHA 1J5YA 2ZO4A 4OINF 1ZAOA 4Q4ZF 4G7HF 3VOEA 5CYVA 1XD7A 1KA8A 1MDMA 4H0EA 2HTSA 2COMA 3E5UA 1UHMA 2YU3A 3CJNA 2ZBKA 5CVJA 2EJRA 1D8KA 4IPAA 4UV8A 3BDDA 2PMHA 4L9NA 4GYIA 1QO0D 2J5OA 2NYXA 3F8BA 3BJ6A 3V8JA 1FYMA 1ODDA 2YR2A 3M1EA 2BEOA 4FHTA 4HV6A 3V4GA 2V1DA 4U7BA 2P5LC 1K78A 5DCFA 2LKPA 5JI6A 4GO1A 3KP5A 1LEBA 3QAHA 5E18F 2L3DA 1S3JA 1ZLJA 4N0BA 5JFRA 2XAHA 2DPUA 3L7WA 3RYRA 5FFZA 2OD5A 2V79A 3GZ5A 3KFWX 2XGXA 1Z05A 3ECOA 4Q5SF 5J6XA 3FHZA 4HX4A 4BH9A 2F2EA 3ZP5A 4KA4A 3OV8A 1ULYA 3I64A 2PEXA 2YPRA 4N9HA 3IRQA 1FSEA 2EFPA 2OQRA 4KMUX 1IN5A 2IVMA 3PFIA 1IN4A 2GWRA 4IRIA 5LHIA 5LHHA 2VOPA 2DQRA 4KFCA 1WI9A 3NQOA 1BI3A 3I5UA 2K86A 5CVVA 3C18A 4Y13A 4EGZA 4QLCU 2XVCA 4XRFA 5D8LB 4ESFA 3KP6A 4MGRA 5E1ZB 1T2KA 1LEAA 2CSOA 2HQNA 1FZPB 1O3TA 2NS0A 3CTAA 1R58A 3MZYA 2UZKA 1G3SA 3FM3A 1UCRA 4A12A 2O6GE 2DQLA 2OQGA 4KYWA 1UFMA 1F9NA 1HBXG 3KLNA 5BPDA 2H6BA 5ICGA 1X3UA 1VTNC 2HEOA 1KQ9A 1U5TB 1J9IA 4RGUA 4Q48A 1BI0A 4L0YB 2O8XA 1LJ9A 4RS8A 1DPUA 2VXZA 3TKYA 1YS7A 1FX7A 2V1XA 2W85A 3F6VA 1OPCA 2EFWA 2A68F 2LNBA 3KEQA 5L3FA 1U2WA 4PZJA 2K4BA 3N4MA 4KNYA 3GW2A 4IHSA 1I1GA 1V4RA 2UXNA 2XV4S 2A6EF 3NEUA 4I0AA 1YLFA 3HTUA 1YG2A 5L3DA 2CFXA 4BHPA 4KICA 1R22A 1F4KA 3GFMA 2AS5F 3JW4A 3F8CA 1PP8F 4WXCA 1FBQA 2DO7A 3I54A 1BIAA 3R60A 3V8LA 1MZBA 5LEKA 3WU0A 5CLSA 4UXNA 1U5TA 1SFUA 5KK1A 2QBYB 4O3MA 3K0LA 2KIMA 3T0YA 2QZ8A 1V3FA 3U1DA 1YW9A 1WKMA 3D0SA 1XSXA 1YFHA 3O2PE 4NQWA 4MHGA 3HRSA 4LFUA 3ZMSA 1CGPA 1P4AA 2CQKA 4JK1X 1R5GA 1B9NA 2Q0OA 1R1VA 3ZMDA 1F5TA 2RC4A 5BS6A 5D8KB 1R5HA 3R4KA 1RNLA 5IT3A 3J81K 5FO5A 4WXDA 5DUKA 2KRFA 3IKTA 3WU1B 4O5VA 5E20A 3I71A 2G9WA 3H3UA 1BOAA 1NHAA 4D0PA 4BYYA 5H6QA 2QBYA 3WTWC 1R1TA 3QPTA 3JSOA 1TNTA 3F8NA 4LK1F 1D8JA 1Z6RA 1BJAA 1RUNA 1BM9A 1G6NA 4LGWA 1DUXC 1REPC 4UVCA 4CO8A 1QNTA 2FBKA 1RZ4A 4CDGA 6PAXA 1P6RA 4YFKF 1K79A 2UXXA 1JE8A 5LRSA 3FWEA 2FBIA 4EM2A 2KJBA 2WC2A 3U9GA 2DAOA 3S2WA 2K4JA 1I5ZA 4RGRA 5JHUA 3LSTA 4S05A 1ZG5A 2P7VB 2JT1A 4XLNF 1TW2A 1EV7A 1YO5C 4KIFA 2QUFA 2A3SA 5D6EA 1E17A 2STTA 3RDIA 2GA2A 1P92A 2HS5A 1T38A 4IXAA 2X4HA 4HLYA 3CUQC 5HVQC 2JPBA 5BPIA 1MJ9A 3JTGA 1XDUA 2VBYA 5HS9A 1ZHFA 1TQIA 3GLXA 3SQNA 3CLOA 4HQMA 3P9IA 4BXUA 2Z33A 3G3ZA 3HTSB 3RYPA 2WWYA 2M87A 3WE2A 2ADUA 4Y17A 3DXJF 4PDKA 1MJBA 2HQRA 1Z91A 2H27A 3JSPA 1H9GA 2L01A 1OYWA 2ZMEB 3WTZA 3IRRA 3KEOA 2F5CA 2E7WA 3FMSA 1CF7A 5K5RA 2O03A 5LGNA 4CXFA 3TOBA 2VN2A 4CZZA 2HWVA 2FF4A 2XRNA 1KU9A 4ESBA 3HRTA 3SFZA 2M8EA 5IT9Z 3P9CA 4P5OA 1STZA 3GYHX 3O6BB 3MWMA 5HLIA 5E1WA 1R7JA 4KT5C 4G7OF 1HW5A 1XSVA 4M9SA 1RUOA 2AXLA 4GCVA
chains in the Genus database with same CATH superfamily
1ZK8A 1TNSA 3OOUA 5GTIC 3ZGKA 5FRNA 1I6XA 4XLFA 3DKWA 2OCCH 4I09A 4RLQA 3L2QA 2F5VA 1DDNA 4M3DA 1LDDA 2ZMEA 5CVRA 3BLYA 1QBJA 1I1SA 3H36A 1O57A 2R4GA 5FKMA 4RB1A 4XM3A 1PUEE 1J2XA 3GUDA 1ZR2A 3FXLA 3G1MA 4DNCA 1AWCA 4EATA 2B63J 1XG1A 1WWXA 4LG0B 4HF2A 1PVEA 4OWRB 2JK3A 2DOAA 3RKXA 5ED4A 2NAZA 2QYOA 2M8GX 3FF5A 3RPQA 3MVPA 3V8KA 2Z3YA 3DPTA 1Z3YA 4Y4RA 4DBRA 4A3EJ 3HIFA 5D5XB 4RGXA 3HL2A 2NVXJ 1Y8RB 3W3CA 5J1YA 5EGOA 3TW6A 3OYLA 4RAGA 4CGZA 1BW5A 2ESNA 1S7EA 2ICWG 4A3DJ 3A0BC 1FSHA 2K9LA 1R71A 4HLXA 2OJED 4M3GA 5JLXA 2OCEA 3BZKA 4KN4X 2K85A 4XOPA 5C3EJ 3F72A 5D5WB 2D1HA 3JRHA 3HRUA 1OQYA 5CVUA 2XROA 3M3YJ 3IWFA 1Z7LA 1B9MA 4HSTA 1E2XA 1KQ8A 4L9VA 4EM1A 2VODA 3VEPA 1ORKA 4HOBA 4JX5A 1EKEA 1A36A 1PUFA 1TT5B 2KFDA 1DU0A 2D1VA 1G59A 1TWFJ 2LOOA 3QP6A 2PBIA 4LIVA 1X3ZB 1W5CC 3H92A 3K1MA 4YFNF 3M4OJ 3LSJA 5C4XJ 3A0HC 2ZJ2A 2HDWA 3CP8A 4LG3A 4DOZA 3W6JB 1YW8A 2BVLA 3CUQB 4MTDA 2R3SA 1Z7UA 3SYTA 2H1KA 4RA2A 5JLWA 2MW8A 1YHQI 4M9ZA 3DTKA 1Z77A 5F1RA 2IGOA 1W5TA 2JN6A 1DQUA 4LG0A 3DWLE 3VFZA 5FKLA 1LFUP 3BG6A 2VOOA 5ICEA 3HXLA 5EG0A 3SDBA 4L0ZB 4IOAF 3BCBA 2K9NA 4M3FA 1S29A 3OYGA 2XKPA 1ZGAA 4UUSB 3CCLI 3K4CA 5K5OA 4QSHA 2FJ1A 2JVGA 2XIGA 1V55H 3QU6A 3MKYB 3KYDB 1OCOH 3KZIC 4EJTA 3DKYA 3M7GA 4A0YA 4CYCB 1IRZA 2VT3A 3E6MA 4YEJA 4XKVA 4HNVA 2CG4A 2W25A 1WCMJ 3S17J 4FTHA 3H0DA 1XCVA 3PQKA 4XLPF 1HXDA 1TWCJ 3KP3A 3X2QH 3ZQIA 5LGUA 4UNOA 3HUGB 2FEZA 2R0QC 1Z0XA 1D0ZA 2ZB9A 3A4CA 3DFGA 4XR6A 2YSRA 3CCYA 2Y30A 5HS8A 4J19A 3J80K 2HKOA 5DCMB 4A3FJ 1JI8A 2RQQA 2CW8A 2H94A 1GXQA 2WBMA 1IW7F 3CUOA 1HKQA 2KL4A 1VNDA 3SZPA 2LY1A 3BTCA 4L18B 2P4WA 2XAQA 1WJCA 4HX7A 3PO2J 1IF1A 1J59A 1DGWY 4IHVA 4I02A 2LFBA 1KU3A 3CCVI 1BR2A 3BP8A 4XBFA 2LF8A 4RB2C 1FEXA 2XKOA 4PUSA 5HLHA 3OSFA 4RB3C 3MZHA 4LJZF 1RESA 4MFEA 2CUJA 2VJJA 2JRTA 3HHGA 2BY0A 5AIPA 3BR2A 2Y9YA 3F22A 1IXRC 2IA0A 2XF6A 4WCGA 2E1OA 4IJAA 2BE5F 3FKJA 2PX9A 3QPLA 2X48A 3WGIA 3JRDA 4PGHA 1T0FC 4KMFA 4HQEA 4B3XA 1QU3A 4EGYA 3DTIA 1MSFC 3FXRA 2HXOA 4HYEA 4UUSA 1W36D 1HDDC 2RQPA 2L7MP 3I4NJ 2R7WA 1QPIA 4IL6C 2HYFA 3TO7A 3QODA 2EA4A 3M8FA 2P5KA 2ESHA 2OF7A 5HLGA 1MBJA 3BJOA 4PJNA 4A5MA 4CYCA 4LMYA 4IOCF 1D0YA 3OIQA 4BEHA 5C4JJ 3DTEA 5ILVA 1J75A 1USSA 3DEWA 2IJLA 4UY8I 3E6BA 3G6EI 1XTAA 1T39A 2VKVA 3HUGA 1SAXA 1ETYA 1SMYF 2JA8J 2RREA 4M72A 2KZGA 1E3PA 3K4LA 4B09A 5DCMA 4C3HJ 2BY3A 3HRMA 4BQNA 1FBUA 2A6HF 1HKSA 1R23A 2DBBA 2MG4A 1AA7A 2VJ4A 4OOIA 1ZR4A 3FDYA 5IY5H 2F48A 2R7ZJ 3ML6A 1LB2A 2BZTA 5FROA 3D5LA 4G9YA 3KYCB 3CMMA 4EQQA 3P5JA 5J1RA 2P8TA 1HW1A 3COAC 3MEXA 2E5ZA 1ZG3A 1TBXA 5J4YA 4UV9A 2FNPA 3EYIA 3GXOA 5IOYA 5GPAA 1T6SA 1XPXA 2MH9A 1BC8C 2JSPA 5DDGA 3K4JA 4XQFA 4MEYF 1MBEA 3ASNH 1BR4A 2G7HA 2LH9A 2VBWA 3BZCA 5FLXK 3MFKA 4MQVA 2DTZA 2P6TA 5IPAA 2BHYA 2EH3A 2NOJB 2Q8KA 4D7MA 2HKXA 2XB5A 1VQ6I 2GXGA 3HPHA 1IXSB 1U3EM 2DOEA 3CP2A 3NWTA 4ZYGA 2JA7J 2FMLA 2GIZA 5GAHJ 3CDHA 2M0CA 1ZQ3P 2O8KA 2ZNYA 1V54H 1D3YA 1FC3A 3BCAA 5LRRA 5HNHA 3UKGA 1OMIA 3VSKA 4BQQA 3HSRA 3TQNA 4D9JA 3AKZA 1LFPA 3IH4A 1X1CA 2HFHA 1YIJI 5DYMA 5M3MJ 3RPUD 4G94A 2O9LA 2QQBA 5EEHA 4BJ5C 4IRHA 4CCNA 2L54A 3ZQGA 1XN7A 2A5WA 2WAQA 4YG2F 1D0XA 2JVHA 1ZYRF 1X3WB 1WPKA 2VJ5A 2OA4A 3RPUA 3BOQA 5E17F 2M0MA 3I9V2 5AONA 5E3MA 1TL8A 4OIOF 3DEUA 4LB6B 3E6DA 2DI3A 1SD5A 4G6QA 2I8DA 2E2HJ 4A3BJ 3L09A 3OIPA 3C2GA 5J40A 5L3GA 2FUG2 2LK2A 3CF5F 1O3QA 2CUEA 3QQAA 2R7VA 1T98A 2WA0A 1E0EA 2ZFWA 3TEDA 1XX5A 4Z2YA 1J7KA 3C3WA 4NDLA 4B44A 1JUSA 5EEAA 2MFZA 3TP0A 3OYIA 2E2IJ 3KP4A 2HQ5A 3TDUC 2B9SA 1XMKA 2CQXA 4PJLA 3WTVC 3CO7C 2G7UA 2P5VA 2QKMB 2DFEA 4LD5A 4AUXA 2NS7A 5LHGA 5J8FA 3GCMA 5CQGA 4JP0A 1LVKA 5IYDJ 2VPRA 1H88C 5HDNA 5A2QK 1OYIA 1GDTA 1SFEA 3S1NJ 4YIFA 2K02A 1VQPI 1RC9A 2F5FA 1TW3A 4FX0A 1VZ0A 5DEQA 3S1RJ 3GTQJ 3ZQQA 3VB2A 4OAZA 4X6AJ 2QKLB 3BR3A 4CCKA 1YTYA 4HZFA 3N97A 2OAZA 2E1MC 2EZHA 2FSWA 2MH2A 2X1DA 3DF8A 2ZKZA 3W2VA 3WU2C 4NBQA 5D5UB 1IN7A 2BHZA 3KCCA 1ZTRA 2FQ4A 2MABA 4XN3A 3WTYC 5HDGA 1VQ5I 2W48A 2CH0A 3G73A 4XLAA 1SAUA 4IKFA 1WFXA 3WHBA 3DQVC 4IQJA 4V2FA 3F3XA 2CGPA 4JX4A 2K5CA 3KP7A 1HOMA 4XIDA 5J47A 1YW7A 3WGHA 1XGOA 3I53A 1JKRC 3BTLA 1RKWA 1YOVB 5F64A 3OYHA 3CC4I 3C1DA 1TWAJ 5KHDA 2VIXA 1SEUA 3K4MA 3E6CC 3LAPA 4H4KC 3S15J 1K7AA 1LDJA 2E1CA 5CKTA 2VKDA 3IAM2 3HJEA 4DYRA 3D1NI 4V2GA 2L9VA 2L9RA 1HSJA 1R49A 2E34A 3WG7H 3LNQA 1WHUA 1SVMA 3LA3A 1ITYA 3RZOJ 5HLTA 3CLQA 1XGMA 3QPSA 3MKWB 1T8IA 4XMYA 3GTJJ 1MJAA 3A03A 1MBKA 4I99C 3C2HA 2GQQA 2L0KA 5TRDA 4BNCA 1X19A 2ETHA 2HGCA 3DBHB 1NG6A 1S72I 4RAZA 3CCRI 3CO6C 1MNEA 2JMWA 3F8FA 4WX9A 3H5NA 1QRYA 3PNTA 4C2TA 3GWZA 2ZC2A 1OISA 1OCCH 1X4OA 4HV5A 4EJOA 3BPVA 3RTRA 1MMNA 4XK4A 2KRHA 2VONA 4AIJA 1HSTA 2EIJH 3PIOF 4GGGA 3ZPLA 1Q1HA 4A5NA 3EUHA 1QZZA 1VF9A 4JQFA 4N4OB 3TO9A 4I2OA 1T0FA 5IYCJ 5EJCA 1WSUA 4E7JA 2HDCA 2L9NA 1IGNA 3S14J 3K4BA 3FXUA 5ICFA 3LQQA 1ETKA 2HI3A 2W4SA 2QSHX 2IA1A 4TV7A 3E5XA 1IRGA 3B73A 2DYSH 1WJBA 4GYGA 2F5DA 3FXJA 4G6TB 3M8JA 4EJVA 3PSFA 3RKQA 5D6FA 4EV0A 2E36A 1BOBA 2CW0F 1SANA 3G71I 2DW4A 2R7TA 1A04A 4HX8A 2WV1A 3IKVA 5F0HA 4YFXF 4BUPA 1MMGA 2HZTA 1P4XA 4LITA 4BJ6C 1JGSA 5LEJA 4IVNA 3J7YJ 3KE2A 1PP7U 2M30A 2WB1A 5H20A 2DA6A 4W97A 2XGEA 3K2ZA 4M6XA 3IHUA 3GFLA 2DPDA 2FA5A 2CO5A 2YX4A 2XPVA 2GIVA 1OCPA 2TDXA 2R92J 2KKOA 3OL3A 4CA0A 5B5EC 5M5XJ 1S7AA 3MQ0A 1V5GA 1Y1VJ 2GZWA 1MNMC 1QA6A 2NVTJ 4BBSJ 5F6FA 1FLIA 3CC2I 4QPQA 4U0WA 4CICA 5HS7A 2OTLI 1S8NA 2LSOA 3VWBA 5F0CA 4BY7J 5L3EA 4R1HA 4HF1A 1Z9CA 2X0LA 3LAJA 2W84A 2X6XA 3PO3J 1N77A 2NNYA 1ENHA 5K7FA 4MFDA 4KIBA 4UB8C 1T56A 1R36A 1HCRA 3FM5A 3VYUB 2Q2EB 1S7OA 4ASNA 2DLLA 3DEEA 4BAYA 1FIPA 2JUGA 1F43A 4AD9A 3JAMK 1LVAA 3FISA 4U0VA 1ZELA 2A69F 3ELKA 2I5UA 4EJWA 2E19A 2E60A 2VT2A 4P96A 2E1MB 2LY9A 1H0MA 4A2UA 3ERMA 4DBQA 2EZKA 2XUBA 2CFOA 1P4WA 2KDZA 1UMQA 2R7FA 2L7KA 4ZTJA 1BI1A 4S04A 3IP4B 2VB6A 3HSFA 4HA8A 4NC6A 1D5YA 1BW6A 3OS2A 4Q47A 3BR1A 2Y0SA 1SD6A 2XGDA 3DPUA 2NNNA 5D4RA 2KRCA 3NRVA 1M1EB 4LLNA 4LB5A 4G12A 1X1DA 3IUOA 4RM2A 5F04A 2CV1A 1LNWA 2BV6A 1WGXA 2LMDA 5LLQA 2EFNA 1W7PB 2VKEA 1W5SA 2OU2A 5B1BH 2ELKA 2M3AA 1C0WA 1WZ2A 2JPCA 2P0WA 5TGTA 4XLEA 2PG4A 1B59A 1Z3XA 3AAFA 2KLOA 1CQTA 1USTA 5GP9A 3T8TA 1R00A 5IP6A 2DMUA 1JJ8C 5GTHC 2JJ7A 2OZUA 3I56I 3EDPA 3GFIA 1WRJA 2QWWA 3HGYA 4L5IA 3R0AA 1O7LA 2Q2EA 2PMZN 4I01A 5FJ8J 5H6RA 4ENMA 3S16J 3HHHA 2QQAA 3BPXA 3JCUC 3RZDJ 1U6GA 1IDYA 2TRTA 3ABMH 5CJ9A 3T8RA 4CCLA 4ETSA 4NUBA 1F1ZA 3M07A 1NG7A 4A3IJ 2X85A 1JKOC 4XN0A 2L02A 2XSJC 3FK6A 3M8EA 4IRGA 4CH7A 3K4KA 4XKCA 5EF6A 2X1EA 1MMAA 3KP2A 3SHFA 4GRIA 4ZDOA 4W1UA 1ZGWA 3WTTC 2M4GA 2FBHA 1A31A 3RKWA 4CCOA 1PDNC 2XPUA 4B3AA 2HVQA 4M6YA 2VL8A 3EUAA 2IA2A 1QZEA 4NHJA 2ZCWA 3BQYA 1XGSA 2A6TA 2LG4A 2CWEA 2CQNA 2QQ9A 2FMYA 4ZYEA 2DK5A 4ZYDA 2M7AA 1VQNI 5ILSA 1LKXA 2L4MA 3O8HA 2VE9A 2IAIA 3CCUI 1MH4A 1G8XA 3PL8A 5BQTA 3BY6A 5L3CA 3JRAA 4E70A 3NWSA 4A93J 2GXBA 4JBAA 5FKNA 2A61A 4QWQA 2Q1ZB 1U9NA 1WH5A 4XRSA 1GHCA 3BWGA 1JXSA 4KJZA 1ZRFA 2XAGA 3VYTB 2KJCA 5EZGA 3DV8A 3HSEA 3REOA 1B1BA 1SD4A 4HEA2 3CMYA 2DDBA 1JHHA 3EYYA 1FP2A 2N8GA 2NVYJ 2DMPA 1FY7A 2CMPA 1Y8QB 3ESWB 2ZJRF 5EEGA 4RB0A 5GPCA 1H8AC 5F27A 4ABZA 2ZJQF 3BJAA 1I27A 2E7XA 2P6SA 1A6IA 4ZH4F 2IS6A 3RIRA 5J4VA 4OAYA 4K2EA 3J80Z 5ERIA 1FOWA 4L5JA 2GM4A 2EA2A 1ZRDA 3SXYA 1TQPA 4R8HA 4CYDA 2LTPA 3T5XA 3HG9A 2VXDA 2EFOA 2HOAA 2ISZA 1AOYA 2FX0A 3HYIA 1IO2A 2V9PA 4V19K 3HOUJ 4R79A 3UR3C 2L7FP 4P9FA 3TP3A 2KIUA 1ETXA 4A3JJ 2A5YB 2RNJA 4E7KA 3BC8A 4M3EA 1U5TC 2H8WA 4LLGF 3KETA 1FIAA 5K1YA 1OR7A 2IGNA 1EH6A 1BIBA 4G8XA 5K7ZA 4OU0A 3KZZA 4FX4A 1FP1D 4HDVA 2FXAA 4BBRJ 3IL2A 3V42A 4DZPA 1N75A 3M9AA 1G3YA 3K2AA 3OMYA 5BOXA 2DA4A 2Y75A 3CJTB 4M74A 4A3CJ 3I4MJ 3PM1A 4GDFA 3HC7A 4UUTA 2VC1A 5HODA 2IGKA 2YX7A 3MMYB 2W7NA 1FYLA 5GAEJ 3OIOA 2R7RA 3FKIJ 4ENKA 5L3BA 3OS1A 1XDSA 4RDUA 1HC8A 1ZARA 1FOYA 1G2HA 3P9KA 2EBIA 1ZN2A 2DYRH 5FD5A 4OIPF 3OY9A 1LPQA 1FPQA 1W0UA 5LFAA 1P2FA 3S1MJ 3CUQA 4CCJA 4KIGA 5AIQA 4BQAA 3Q0VA 1IN8A 1IXCA 2D2WA 4UVBA 3S1QJ 4M9XA 2WAFA 2V1NA 1KU2A 3TGNA 2EV5A 2HVRA 1MKMA 1X1AA 4A3KJ 4DW6A 1OFCX 2DU9A 2PLYA 4HF0A 2R7DA 4A0ZA 2PMUA 4PFOA 3LSPA 2Y2ZA 1UHWA 2NXNB 5HOOA 2D45A 3BT9A 2HYGD 2FD5A 3WTSC 1XB4A 4I6ZA 2R7SA 3A2KA 2PJRB 3K10A 3LSIA 3KLOA 2ACJA 5E1XA 1U8BA 1JT6A 2CUFA 1YX3A 1P7IA 3UNGC 2LKSA 4YELA 1BJZA 3RQIA 1ON2A 5E3OA 2ZXJA 3S8PA 3O3KA 3G4SI 2XAJA 2QEXI 3J7AO 1KU7A 3LA2A 2MD0A 2DJNA 3A02A 1Y56A 1SFXA 2BY1A 4GFBA 2ID3A 2YUSA 1IZ1A 3ONQA 3IH3A 3LL7A 4DJAA 2IBDA 1I6HJ 4NB5A 5FLXZ 1B6AA 5IP9J 1TTYA 4QIWN 3B6AA 1BI2A 4CHUA 4PSXA 4Y3OA 3ZRGA 2K27A 1HQCA 3CD6I 2XHKA 2GAUA 2ZNZA 2A07F 1A35A 2PN6A 5D5VB 3P7NA 1SMTA 1FYKA 2LYCA 2RV8A 3VDXA 2Y69H 3HOVJ 2VI6A 3GTPJ 3ZQHA 4EM0B 1RKTA 3E97A 3ECHA 4UB6C 3K70D 4FASD 1VQ7I 2M34A 4PFPA 4KUMA 1WQ2A 2MC3A 3MKLA 2FE3A 1VQKI 2JTVA 2HYJA 4KDPA 2BGCA 3ABKH 2MBFA 1KGSA 3CZ6A 4B8XA 2IP2A 3EUKL 2W57A 3K1NA 4Y33A 5JVGF 2OZ6A 4N4NB 4EVIA 3S2HJ 1BBYA 3LQRA 3ROUA 2L4AA 3HBLA 2EIMH 3HOWJ 1WJ5A 5DD8A 4BHCA 2M4KA 4E7LA 3G1LA 1L0OC 1YITI 1ACIA 1QZYA 5D4SA 3ZQ7A 3LMMA 2Z5UA 2XSDC 1WI3A 1MGTA 3L9FA 2E1NA 1MNDA 2KHMA 1IRXA 4ON0A 3ZQCA 3CDLA 1OCTC 2V1UA 4ZZLA 4X1EA 1RI7A 1L3LA 3I4PA 2Z9OA 2O7OA 3GTLJ 3GO5A 3TMOA 3ULQB 2F4OB 1UG2A 2HOTA 2O61A 3LOCA 1Z6TA 2HTJA 3V7RA 3VODA 3ZMUA 3T1BA 4EJUA 4L9TA 2X9DA 5A2QZ 4OMZA 2FU4A 2E35A 3DBLB 2DOFA 1G3WA 5FLMJ 2DA5A 2KDOA 2X51A 3WTUC 3WG9A 2F5EA 2K7LA 4P55A 3Q5FA 1TP4A 4XRMA 4ENNA 2DFFA 2CU7A 4LLLA 2V7FA 2CV2A 5B1AH 3I58A 1W0TA 2OV7A 3FZVA 3ZR8X 2CW7A 1KZHA 2RGVA 1W4MA 2JZYA 3JRFA 4ESJA 1IC8A 2J5PA 1FNNA 2LF7A 2EK5A 2I10A 5E3NA 3CCEI 2XF5A 2HPMA 4DQ2A 3E7LA 1N25A 2XB0X 2Z99A 2CYYA 2ME0A 2DFHA 4AIKA 2JA6J 5DD4A 2YS9A 4IHTA 1R4NB 2F4MB 4HDUA 3FX3A 3SZTA 1TZLA 4Y15A 5FLVA 2QLZA 3MD2A 2AHQA 3H3ZA 2EFQA 2GA1A 3U2RA 1QGPA 1DU6A 4DYQA 4XOTA 2QGUA 2E71A 3TDZC 3J81Z 1SD7A 1Z21A 1YYVA 3KX2A 3OWTA 5B66C 2EINH 4HW0A 1ERDA 3FMRA 1HW2A 3JRIA 1HKTA 4XSZF 1K6OA 2PJPA 1POGA 3PNVA 2QSGX 3GTKJ 1T95A 1ON1A 2WTEA 3TW7A 2CRGA 1VQ8I 1R6RA 1G3TA 2LKXA 2P7CB 4XSXF 3DPLC 2B7EA 1EH8A 2V9VA 3R6SA 1ZH5A 1KONA 2DK8A 4PJMA 1K83J 1MMSA 1OKRA 1SVLA 1APLC 4MNUA 4BDYA 2IPQX 2JUCA 2KIFA 4N9IA 2V4JC 2EIKH 3HM5A 2CQ7A 2QSFX 2IXSA 4O6JA 4LK0F 1FWZA 3L2RA 1GVJA 1LQ1A 1I3AA 3IC7A 1Y0UA 5FFXA 2DTRA 3EETA 5GAGJ 5M5WJ 4ZYHA 1XCBA 2JQ7A 4OIQF 1FOKA 2R93J 4XLHA 4HSRA 1RR7A 2W24A 5E8GA 1BL0A 2XDVA 2VPLA 1FOXA 3H5RA 4FT8A 2V6CA 2ZMEC 3BG9A 1ONVA 1GV2A 1JUMA 1R9TJ 2XPWA 2JRMA 3J7ZI 2VBZA 2QVOA 3VPRA 2Y48A 4U7DA 1XSDA 4P9UA 3OYBA 1MD0A 5BNGA 2JSCA 1ETOA 3ZQFA 3LWFA 2L5QA 4RGSA 4B43A 3LA7A 4ZJZA 3I0TA 4JYKA 3EQLF 4RAYA 3CMEI 4NC8A 1LDKB 4OIRF 3GTOJ 4WWCA 4U0YA 2X1CA 2NRAC 1Z67A 1B8IB 4WF2A 1BA5A 5K5QA 1ZGJA 5CPRB 3ZMTA 2QENA 3BZ6A 4C30A 4BDZA 3KZYA 4XLCA 1E3OC 3JRBA 3F0CA 4BL0B 3OOPA 4BXXJ 4IHYA 1RR8C 1ZREA 2OBPA 4AM3A 4CCMA 4A3MJ 2DJIA 3AFHA 1IN6A 1R1UA 1JKPC 3I59B 3L1PA 1I3QJ 3CJRB 4WK8F 2R7OA 4S0HB 3RI4A 3SFIA 2NVUB 2R7QA 2H09A 3RQ4A 4A0XA 2DFIA 4E7HA 2JA2A 1EJ9A 2STWA 3ABUA 4M71A 2QM3A 1UJ8A 2MYSA 4AVPA 4RM3A 3QPHA 1GT0C 3S3MA 4AYBN 3C2BA 3K9TA 5M5YJ 4CZCA 2IRFG 1MMDA 2LP0A 4B48A 3GFJA 1U0JA 1XMXA 4PCQA 2ZSHB 2VE8A 5FKOA 2BBYA 3GVAA 1VQ9I 1AU7A 2NS8A 3L2CA 4B47A 3BG3A 4J01A 2H6CA 3JAMZ 3PQJA 2FNAA 2MD5A 3DP7A 3BG7A 4UUVA 2O5RA 1IUYA 4G6DA 3MCZA 5J1UA 4U88A 1Y6IA 2M45A 4I98B 4BS9A 3OR2C 4YRVA 1DP3A 4AVZA 5E3LA 3ZMVA 5LGTA 2ISYA 2ZFUA 5J8CA 1JKQC 2PMZA 1B8IA 1YQAA 2PFBA 1H9TA 2HVSA 1I50J 2BOLA 1WJDA 1RIOH 4AU7A 3JTHA 2PI0A 2MLKA 2QA4I 3F23A 2MLGA 3CDIA 1D5VA 2DA1A 4HAMA 1JHFA 5ILUA 3I55I 3DLAA 4MEXF 3PJRA 1DPRA 3CQZJ 5HDKA 2XC7A 1P9QC 2OPTA 1CF7B 1Z1DA 3I59A 3BR6A 3RSNA 2H1LA 2ECBA 2EILH 2DA7A 3C7JA 4GXOA 5JR3A 1TQMA 3W6KB 3MZ8A 2C6YA 2AQFA 1FT9A 1MIJA 4G7ZF 1U8RA 3GZ6A 2UWMA 3CCMI 1U9OA 2M1BA 1KQ0A 1HLVA 4F91B 2M5WA 1XMAA 3JR9A 2VBXA 4KN7X 4AWXB 2GOMA 5BMZA 1DP7P 1G4DA 3ZN1A 4F7ZA 2FQ3A 2QQ8A 3ASOH 2FOKA 3QU3A 4ZZDA 5DUIA 2DT5A 2RKHA 3CCSI 3V7CA 2VQGA 1QQIA 3HOZJ 5TJJA 2G0EA 4ZYAA 1IJWC 3IWZA 3ISPA 2HR3A 2R7XA 3WTXC 1TT0A 4A6DA 4MQ9F 3WGGA 4AIHA 3S32A 4Z6YA 2KP6A 3PUFA 1JUPA 1QVUA 3Q9SA 1V5EA 1BN5A 3HOTA 4EMSA 1SFKA 3MN2A 3HOXJ 1OYYA 5JVTA 3W2WA 5DV5A 1GVDA 2K40A 2E2JJ 1O3RA 2HOEA 2RVCA 3VYSB 4UVAA 3QOPA 3AL0C 3GF2A 3SJMA 1IAWA 1TLHB 3K1PA 4WXHA 3TO6A 5IYBJ 4XL9A 3ZN0A 3U21A 1WJEA 1D1BA 1K6YA 1JTXA 2EV6A 1ZLKA 3F21A 2DN0A 4M73A 4HRIA 3WE3A 3VYRB 2VC0A 2FRHA 2O0YA 4KT6A 2EPFA 2QCOA 2BYVE 4L9JA 1Y1WJ 2B0LA 4IHXA 1GXPA 1XC5A 3K69A 4PSWA 1X58A 2DT7B 1W1WE 3OYCA 1JGGA 1MH3A 2PQ8A 3KPHA 2R7UA 5E8IA 3QYBA 1FTTA 3WODF 1KYZA 4F3QA 4C3IJ 1IV6A 3HOSA 2RDPA 3F8MA 4IX7A 1U78A 4M6VA 4NNJA 3L00A 1TWHJ 3IAS2 3QP5A 4PGGA 4MTEA 2WB1N 2CUZA 3CCQI 2Y0MA 4JOMA 3PNYA 1X1PA 1B4AA 5FB2A 3NAUA 5LBQA 4ENJA 4I7HA 4YIIA 4FE7A 1UG0A 3Q0WA 4RAFA 1QPMA 2DMQA 1YIOA 3DBRB 1W7PD 4E7SA 4JX6A 1O3SA 1YS6A 1EH7A 2DMNA 2W82A 4II3A 4HBLA 3OYEA 2QF7A 5FD6A 5CVIA 1KYWA 3TOAA 1W7PA 5H2FC 2WV0A 4BACA 4A6EA 2JWTA 1S6LA 1FTZA 5DM7F 5KVRA 1JJ6C 5EG0B 1FJLA 3CF2A 1FBSA 3MAJA 4ZC3A 4DYCA 1UB9A 2KPMA 1MDMB 3HKZN 3M1CA 3QRFF 5FGMA 3ABTA 1O4XA 2UV1A 3R61A 2BXYA 3F6OA 2DODA 5ICCA 3PFYA 3RJPA 4IF4A 3E3VA 3RKYA 3GX4X 2IT0A 1EA3A 3DU6A 2EWNA 4KITB 2XAFA 1XGNA 5IT9K 3BTIA 2LVSA 2DT6A 2EV0A 2COBA 1UELB 1H89C 3PIPF 1ZG1A 1WVRA 3H1CA 3HEFA 3H9GA 2MA3A 3R0JA 5EZHA 2KIQA 1BC7C 1IRFA 3ERED 3ZMZA 4BHBA 1O7FA 3LFKA 2EB7A 3B02A 4OMYA 2IW5A 3BROA 4UHTA 3HOYJ 3HZJA 2Y0SN 3Q9VA 3CCJI 4C9YA 1J0RA 2E5NA 3V7SA 2ZJPF 2HNHA 2LDUA 3GEZA 3FMQA 2LBFB 1K78B 2O3FA 3W6VA 5HNFA 3OYKA 5IOZA 1OCZH 4RMNA 2RN7A 3LSKA 2HOSA 4I0BA 2XASA 3E5QA 3BG5A 3FXQA 2CJJA 1ZRCA 2NVQJ 2K9SA 2ELHA 1J5YA 4DGWB 1MW7A 2IS4A 2ZO4A 4CSWA 2GLOA 4OINF 3A1YA 1ETQA 1ZAOA 4Q4ZF 1MSEC 3S2DJ 4AIDA 4G7HF 2RAEA 1VQMI 3VOEA 1UHSA 2OC6A 1TWGJ 2BVMA 3OYNA 1A6QA 2X6WA 3SEZA 4C2UA 5CYVA 4XICA 4NC7A 2EZIA 2LC2A 1XD7A 1KA8A 3A01B 1MDMA 4H0EA 2HTSA 2LLKA 2COMA 4IZZA 3E5UA 1E3HA 1UHMA 2YU3A 4RBOA 2X6YA 3GMEA 3CJNA 2VLAA 3Q3SA 2ZBKA 5CVJA 3ZQLA 2YU9J 1RPWA 4BEHB 2EJRA 1D8KA 4B4CA 4IPAA 4UV8A 3N05A 4LOCA 2XAUA 3AL0B 3BDDA 2PMHA 4L9NA 1QO0D 2J5OA 2NYXA 3F8BA 4GYIA 3BJ6A 3V8JA 1FYMA 1ODDA 2YR2A 2UUZA 3M1EA 2BEOA 4FHTA 1GUUA 2L9SA 4HV6A 3H0GJ 2D5VA 3CJQB 2VKHA 3V4GA 2V1DA 2WY7Q 4PJJA 4U7BA 2LBFA 2P5LC 1K78A 1OLTA 1SVOA 5DCFA 5FKKA 2LKPA 5JI6A 2M2EA 3KP5A 4GO1A 4I76A 3QAHA 1LEBA 5E18F 2L3DA 4ZDLA 1A5JA 1GV5A 3QYFA 1S3JA 1RETA 1ZLJA 4MIMA 4XRSG 4N0BA 5JFRA 4II2A 3SDGA 2XAHA 2VASA 1NTCA 2DPUA 3L7WA 4IQ4A 1AKHB 3RYRA 5FFZA 2OD5A 2V79A 3GZ5A 1ETWA 4D7NA 4IO9F 2LRDA 3KFWX 2XGXA 1Z05A 3ECOA 3EUHC 4BXFA 4Q5SF 5J6XA 3FHZA 1VQOI 4HX4A 3A01A 2AQEA 2V6EA 4BH9A 4D5FA 4PK4A 3RCOA 2F2EA 1YRNB 3ZP5A 1NH3A 4KA4A 3OV8A 1ULYA 2W1OA 3I64A 2PEXA 2YPRA 4N9HA 3IRQA 1FSEA 2EFPA 2OQRA 3CMAI 3GTMJ 4A3LJ 4KMUX 3H9JA 1IN5A 2IVMA 1ZKGA 3PFIA 1IN4A 2HQAA 2GWRA 4IRIA 5LHIA 1UZCA 1WH7A 5LHHA 9ANTA 2VJIA 3O8GA 2VOPA 2DQRA 3G2BA 1N78A 4Y52J 4KFCA 2X6OA 1WI9A 3NQOA 2DA2A 4QPOA 1BI3A 3I5UA 1NK3P 2K86A 3NARA 4XORA 3L2WA 2ZSIB 1T08B 2LD5A 5CVVA 3C18A 3LSGA 4Y13A 1OJLA 4QLCU 5IP7J 2XVCA 4EGZA 4XRFA 5D8LB 4ESFA 2DMTA 1K4TA 2K3FA 3KP6A 3HGGA 4MGRA 5E1ZB 1VQLI 2PJRA 1T2KA 1LEAA 2CSOA 4IEJA 2HQNA 1FZPB 1O3TA 4D1QA 2NS0A 3CTAA 3J7AY 1R58A 2EZLA 2P81A 3MZYA 2UZKA 1G3SA 3FM3A 1T33A 1UCRA 4A12A 5EYRA 3DU5A 3QWLA 3OYDA 2O6GE 2DQLA 1AKHA 4D5CA 4X0GA 3K6GA 2V26A 4MLOA 4DZJA 2TCTA 3AG3H 2OQGA 5GADJ 4KYWA 1F9NA 1UFMA 2Z16A 1HBXG 2HU9A 3KLNA 5BPDA 1YE9A 2H6BA 3EPZA 4RLFA 5ICGA 3GZNB 1R4MB 2LR8A 1X3UA 1YRNA 4HNUA 4HNTA 1VTNC 2HEOA 5LD2C 3WHCA 1KQ9A 1U5TB 1J9IA 4RGUA 1VQ4I 3OYJA 4Q48A 1AHDP 4FQGA 1BI0A 4L0YB 2O8XA 1LJ9A 2F4IA 4RS8A 5EDNA 1DPUA 3OR1C 3KYLA 4KISA 2VXZA 1JTYA 3TKYA 3ZOBA 1YS7A 2CS3A 1FX7A 2V1XA 1XS9A 2W85A 3F6VA 1OPCA 5KAIC 2EFWA 2VQCA 2A68F 1R5ID 2LNBA 3KEQA 5KNLA 4NQWB 5L3FA 1U2WA 4PZJA 2GOXB 2K4BA 4BU2A 3N4MA 4A69C 4KNYA 4C2MJ 3GW2A 3LSRA 4IHSA 1S5LC 1I1GA 2DXIA 1V4RA 2UXNA 2XV4S 2A6EF 3NEUA 4I0AA 4CUGA 4FE4A 1YLFA 4F93B 5DM6F 3HTUA 2BXZA 3BTJA 4BE1A 2Z2SB 1YJWI 1YG2A 5L3DA 2CFXA 4BHPA 4AYBA 2GXAA 3S3OA 1FMWA 1QHGA 3FXKA 4KICA 3OSGA 3FK7A 3E1SA 1X1BA 1R22A 1F4KA 3GFMA 2AS5F 3JW4A 4MO7A 3QOEA 3ABLH 3F8CA 4HPQA 3JRCA 1PP8F 4WXCA 1FBQA 2DO7A 1QHHD 3H9QA 3I54A 1X4PA 1HDPA 1BIAA 3R60A 3V8LA 1V5FA 3HB9A 5F0FA 3AG2H 3IH2A 2VQLA 1MZBA 5LEKA 3WU0A 1YJNI 5CLSA 4UXNA 1U5TA 1SFUA 5KK1A 2QBYB 4QTRA 4ZDPA 1TC3C 4O3MA 3K0LA 3IV5A 1LUJB 2F6CA 2KIMA 3T0YA 4A3GJ 2QZ8A 1X2MA 2MC4A 4XONA 1NK2P 1V3FA 3LFUA 5E79C 3L2VA 3OYMA 1OCRH 1IG7A 3U1DA 2EQRA 2DA3A 1YW9A 3D0SA 1WKMA 1XSXA 1YFHA 3O2PE 3H3VK 4L5EA 4NQWA 4MHGA 3HRSA 3I3LA 2OUMA 4LFUA 3ZMSA 3OS0A 3HDDA 4FETA 2HDDA 3H5AA 1HF0A 1CGPA 4E4HA 1P4AA 2H8RA 2CQKA 4JK1X 2R5YB 1R5GA 1B9NA 2Q0OA 1R1VA 2WAEA 3S93A 1Q1VA 2ID6A 3ZMDA 2Y9ZA 1F5TA 2RC4A 3E0JB 5BS6A 5D8KB 1R5HA 3F9KA 3R4KA 4BGDA 1RNLA 1UAAA 5IT3A 3LSMA 3J81K 1F36A 3GBGA 1WJFA 5FO5A 3FIWA 4DIQA 4ZTFA 4WXDA 2DDAA 4EEFG 2NOGA 2Z1DA 5DUKA 3FXMA 3H35A 2WAQN 1IV8A 2KRFA 2RNGA 1K4SA 3IKTA 4FCYA 3WU1B 4Y7NJ 4J00A 1D1CA 4O5VA 5E20A 2OTJI 1MBHA 3I71A 1WJAA 4AC0A 2G9WA 3H3UA 2VQHA 1BOAA 1NHAA 4XKWA 4B1RA 4P1WA 1IDZA 4D0PA 4BYYA 4U87A 1IUFA 2IGMA 5H6QA 2QBYA 3TBIA 5B3SH 3WTWC 1R1TA 3QPTA 3BR0A 3JSOA 3FBNB 1VI0A 2ELJA 1TNTA 3F8NA 1GLNA 4LK1F 1D8JA 1Z6RA 5TISC 1VFCA 1BJAA 3K7AJ 2JA5J 3MKZA 1RUNA 1BM9A 1G6NA 2HZDA 2WY8Q 4ITVA 2KMUA 4LGWA 4BE0A 2K9QA 3BQZA 4BQOA 1X2NA 1DUXC 2XF7A 2HPIA 1REPC 4UVCA 2BW3B 2L2OA 4CO8A 4BY1J 1QNTA 4F55A 2M7BA 1HA8A 2FBKA 1RZ4A 3QYEA 4CDGA 6PAXA 1P6RA 2R5YA 3U1KA 4YFKF 1K79A 1OR7C 3SZGA 2UXXA 1JE8A 3OYAA 2MSYA 5LRSA 3FWEA 2XRLA 2FBIA 5FRMA 1J09A 4EM2A 2KJBA 2WC2A 3ZCOA 3PSIA 3U9GA 2DAOA 4XKBA 3S2WA 1B72B 2K3PA 3ZXSA 2K4JA 1LE8B 1I5ZA 1DGRM 4RGRA 5CQEA 2VUMJ 2DCEA 5JHUA 3LSTA 2KZVA 2IS2A 4S05A 1ZG5A 1P7JA 2P7VB 2HXIA 3OL4A 2JT1A 3W2AA 4XLNF 2KISA 1TW2A 1YJ9I 1EV7A 5F08A 1YO5C 2IEKA 4KIFA 2LY2A 2QUFA 2A3SA 3L2UA 1S9HA 4E6KG 5D6EA 1E17A 1FMVA 2STTA 3RDIA 4C3JJ 5J3LA 2GA2A 2L7ZA 3VSLA 1P92A 4FISA 2HS5A 5M3FJ 3KIOA 1T38A 2BY2A 4IXAA 1PYVA 3FHNA 4BJTA 3DKXA 2X4HA 1QVTA 4YIRX 2R5ZB 4HLYA 1LFBA 2AXTC 3CUQC 5HVQC 2JPBA 2ME6A 3TL4X 3JREA 3AG1H 5BPIA 2CV0A 1MJ9A 3PUBA 3LSHA 3JTGA 2ZXWH 1XDUA 3D5SC 2VBYA 3G1OA 2ZXIA 5HS9A 4BKXA 5JHFA 1ZHFA 1MBFA 5KAFC 1TQIA 3GLXA 3SQNA 1ETVA 3CLOA 1YX5A 2ECCA 4HQMA 3P9IA 4BXUA 4PJ0C 2WADA 2Z33A 2BW3A 2K9MA 4F92B 3S3NA 3B6CA 4IHWA 3GLLA 3G3ZA 3SEQA 1Y39A 4BE2A 3HKZA 1BR1A 3HTSB 2FOWA 3RYPA 2WWYA 2M87A 3WE2A 3DCFA 3K4NA 2ADUA 4Y17A 1I39A 3DXJF 4PDKA 2CQQA 1MJBA 2HQRA 3GTGJ 1Z91A 2H27A 3CC7I 3JSPA 1D1AA 1W36C 2XGCA 1H9GA 2L01A 1OYWA 2ZMEB 3AG4H 3WTZA 1B72A 3IRRA 4E7IA 1LE8A 1SC7A 3KEOA 5C44J 3FBIB 4ANJA 1MBGA 2F5CA 2E7WA 3FMSA 4LIUA 3D5RC 2M9HA 1CF7A 2Y31A 5K5RA 1EF4A 3OYFA 2O03A 5K7HA 5LGNA 5KCMA 4CXFA 3CESA 1JT0A 3KEYA 3TOBA 1Y0NA 2W00A 2VN2A 4HG2A 4CZZA 5EGOB 2HWVA 4F52A 2ZXHA 3FXOA 2FF4A 5DS9A 5F1JA 1YI2I 2XRNA 2V9KA 2KT0A 2R5ZA 1KU9A 4ESBA 3Q0UA 3K70C 1K61A 2GBYA 3HRTA 2A05A 3SFZA 3HPGA 2LREA 1SFOJ 5DTDA 2M8EA 5IT9Z 3P9CA 4P5OA 3BR5A 1STZA 3GYHX 3O6BB 4XNFA 2KQRA 3MWMA 5E1WA 5HLIA 1R7JA 2MGQA 3JRGA 4KT5C 4E7ZA 1PJRA 3DLLF 1PUFB 4G7OF 1HW5A 1XSVA 4M9SA 4M3BA 1RRJA 2AO9A 1RUOA 2AXLA 4GCVA 2IS1A
chains in the Genus database with same CATH topology
1TNSA 1I6XA 3DKWA 4I09A 1DDNA 1LDDA 2ZMEA 5CVRA 1I1SA 1QBJA 1O57A 4RB1A 1PUEE 1J2XA 3GUDA 1AWCA 4DNCA 1WWXA 4LG0B 4HF2A 5ED4A 3RKXA 2NAZA 2QYOA 3FF5A 3RPQA 3V8KA 2Z3YA 3DPTA 3HIFA 5D5XB 4RGXA 4CGZA 2ESNA 1FSHA 4HLXA 4KN4X 3F72A 5D5WB 2D1HA 3HRUA 5CVUA 2XROA 3IWFA 1B9MA 1E2XA 1KQ8A 4L9VA 4EM1A 2VODA 3VEPA 4HOBA 2D1VA 3QP6A 2PBIA 3H92A 3K1MA 4YFNF 2ZJ2A 3W6JB 1YW8A 3CUQB 4MTDA 2R3SA 1Z7UA 4M9ZA 5F1RA 1W5TA 4LG0A 3VFZA 2VOOA 5ICEA 4L0ZB 1S29A 2XKPA 1ZGAA 5K5OA 2XIGA 3QU6A 4EJTA 3M7GA 4A0YA 2VT3A 3E6MA 2CG4A 2W25A 1XCVA 3PQKA 4XLPF 1HXDA 3KP3A 5LGUA 4UNOA 2FEZA 3DFGA 2YSRA 5HS8A 3J80K 2HKOA 5DCMB 2H94A 1GXQA 1IW7F 3CUOA 1HKQA 3SZPA 4L18B 2P4WA 2XAQA 4HX7A 1IF1A 1J59A 4I02A 1KU3A 3BP8A 4XBFA 2LF8A 4RB2C 2XKOA 5HLHA 4RB3C 3MZHA 4LJZF 2JRTA 3HHGA 5AIPA 3F22A 1IXRC 2IA0A 4WCGA 4IJAA 2BE5F 3WGIA 4PGHA 4KMFA 4HQEA 4EGYA 3FXRA 4HYEA 2RQPA 2HYFA 3TO7A 2EA4A 3M8FA 2P5KA 2ESHA 5HLGA 3BJOA 4A5MA 4LMYA 5ILVA 1J75A 1USSA 2IJLA 3E6BA 1T39A 3HUGA 1SAXA 1SMYF 4M72A 4B09A 5DCMA 3HRMA 1FBUA 2A6HF 1HKSA 1R23A 2DBBA 4OOIA 3ML6A 1LB2A 3D5LA 4G9YA 4EQQA 2P8TA 1HW1A 3COAC 3MEXA 1ZG3A 1TBXA 4UV9A 2FNPA 3EYIA 3GXOA 1T6SA 2MH9A 1BC8C 5DDGA 4MEYF 2G7HA 2VBWA 5FLXK 3MFKA 4MQVA 2P6TA 2Q8KA 2HKXA 2GXGA 1IXSB 1U3EM 4ZYGA 2FMLA 3CDHA 2ZNYA 1D3YA 1FC3A 5LRRA 1OMIA 3HSRA 3TQNA 2HFHA 5DYMA 4G94A 2QQBA 5EEHA 4IRHA 2L54A 1XN7A 4YG2F 1ZYRF 2OA4A 3RPUA 3BOQA 5E17F 5AONA 4OIOF 3DEUA 4LB6B 3E6DA 2DI3A 1SD5A 4G6QA 3L09A 5L3GA 1O3QA 1T98A 2ZFWA 4Z2YA 1J7KA 3C3WA 3KP4A 3TDUC 1XMKA 3WTVC 3CO7C 2G7UA 2P5VA 4LD5A 5LHGA 5J8FA 5HDNA 5A2QK 1OYIA 1SFEA 4YIFA 2K02A 2F5FA 1TW3A 4FX0A 5DEQA 3VB2A 1YTYA 4HZFA 3N97A 2OAZA 2FSWA 2MH2A 3DF8A 2ZKZA 5D5UB 1IN7A 3KCCA 3WTYC 5HDGA 3G73A 3DQVC 3F3XA 2CGPA 3KP7A 1YW7A 3WGHA 1XGOA 3I53A 5F64A 3C1DA 3E6CC 3LAPA 1K7AA 1LDJA 2E1CA 1HSJA 3LA3A 1XGMA 1MJAA 2GQQA 5TRDA 4BNCA 2ETHA 2HGCA 4RAZA 3CO6C 3F8FA 4WX9A 3GWZA 4HV5A 4EJOA 3BPVA 3RTRA 2VONA 4AIJA 1HSTA 4GGGA 3ZPLA 1Q1HA 4A5NA 3EUHA 1QZZA 4JQFA 3TO9A 4I2OA 1T0FA 1WSUA 2HDCA 3FXUA 5ICFA 3LQQA 2IA1A 4TV7A 3E5XA 1IRGA 3B73A 4GYGA 2F5DA 4EJVA 5D6FA 4EV0A 2CW0F 2DW4A 1A04A 4HX8A 3IKVA 4YFXF 2HZTA 1P4XA 1JGSA 5LEJA 4IVNA 3KE2A 1PP7U 2M30A 5H20A 3K2ZA 4M6XA 3IHUA 3GFLA 2DPDA 2FA5A 2CO5A 2YX4A 2GIVA 2TDXA 2KKOA 1S7AA 3MQ0A 2GZWA 5F6FA 1FLIA 4CICA 4U0WA 5HS7A 1S8NA 2LSOA 5L3EA 4R1HA 4HF1A 1Z9CA 2X0LA 3LAJA 2W84A 2NNYA 4KIBA 1R36A 3FM5A 1S7OA 4ASNA 2DLLA 4BAYA 4AD9A 3JAMK 1LVAA 4U0VA 2A69F 3ELKA 4EJWA 2VT2A 4P96A 1H0MA 4A2UA 2XUBA 1P4WA 2R7FA 1BI1A 4S04A 3HSFA 4HA8A 4Q47A 1SD6A 2NNNA 5D4RA 3NRVA 4LLNA 4LB5A 1LNWA 2BV6A 5LLQA 2EFNA 1W7PB 1W5SA 2OU2A 1C0WA 2JPCA 2PG4A 1B59A 3AAFA 1USTA 3T8TA 1R00A 2OZUA 3EDPA 3GFIA 1WRJA 2QWWA 4L5IA 3R0AA 1O7LA 2Q2EA 4I01A 5H6RA 4ENMA 3HHHA 2QQAA 3BPXA 1U6GA 5CJ9A 3T8RA 4ETSA 1F1ZA 2L02A 3M8EA 4IRGA 3KP2A 3SHFA 3WTTC 2FBHA 3RKWA 1PDNC 4M6YA 2IA2A 4NHJA 2ZCWA 1XGSA 2CWEA 2QQ9A 2FMYA 4ZYEA 2DK5A 4ZYDA 5ILSA 2L4MA 2VE9A 5BQTA 5L3CA 3BY6A 4E70A 2GXBA 4JBAA 2A61A 4QWQA 1GHCA 3BWGA 1JXSA 1ZRFA 2XAGA 2KJCA 3DV8A 3HSEA 3REOA 1B1BA 1SD4A 1JHHA 3EYYA 1FP2A 1FY7A 5EEGA 4RB0A 3BJAA 1I27A 2E7XA 2P6SA 4ZH4F 3RIRA 4K2EA 3J80Z 5ERIA 4L5JA 2EA2A 1ZRDA 3SXYA 1TQPA 4R8HA 4CYDA 3T5XA 1AOYA 2ISZA 2EFOA 3HYIA 4R79A 4P9FA 2KIUA 2A5YB 2RNJA 1U5TC 4LLGF 3KETA 5K1YA 1OR7A 4G8XA 1EH6A 1BIBA 4FX4A 4OU0A 3KZZA 1FP1D 4HDVA 2FXAA 3IL2A 3M9AA 1G3YA 5BOXA 2Y75A 4M74A 2VC1A 2YX7A 1FYLA 4ENKA 5L3BA 1XDSA 1ZARA 3P9KA 1ZN2A 5FD5A 4OIPF 1FPQA 1P2FA 3CUQA 4KIGA 5AIQA 4BQAA 2D2WA 1IN8A 1IXCA 4UVBA 4M9XA 1KU2A 3TGNA 2EV5A 1MKMA 2DU9A 2PLYA 4HF0A 2R7DA 4A0ZA 2PMUA 1UHWA 5HOOA 2D45A 2HYGD 3WTSC 1XB4A 3KLOA 2ACJA 5E1XA 1ON2A 2ZXJA 3O3KA 2XAJA 3J7AO 1KU7A 3LA2A 1SFXA 1IZ1A 4NB5A 5FLXZ 1B6AA 1TTYA 1BI2A 4CHUA 2K27A 1HQCA 2XHKA 2GAUA 2ZNZA 2A07F 2PN6A 5D5VB 3P7NA 1SMTA 1FYKA 2RV8A 4EM0B 3E97A 3ECHA 4KUMA 1WQ2A 2MC3A 2FE3A 2JTVA 4KDPA 2BGCA 2MBFA 1KGSA 4B8XA 2IP2A 2W57A 3K1NA 2OZ6A 4EVIA 1BBYA 3LQRA 3ROUA 2L4AA 5DD8A 4BHCA 1L0OC 1QZYA 5D4SA 3ZQ7A 2Z5UA 1MGTA 3L9FA 2E1NA 4ON0A 2V1UA 4ZZLA 1RI7A 1L3LA 3I4PA 2Z9OA 3GO5A 3ULQB 2O61A 1Z6TA 2HTJA 3V7RA 3VODA 3ZMUA 3T1BA 4EJUA 4L9TA 5A2QZ 4OMZA 2FU4A 1G3WA 3WTUC 3WG9A 2F5EA 2K7LA 4P55A 3Q5FA 4ENNA 4LLLA 3I58A 3FZVA 2RGVA 1W4MA 2JZYA 4ESJA 2J5PA 1FNNA 2LF7A 2EK5A 4DQ2A 2Z99A 2CYYA 4AIKA 5DD4A 4IHTA 4HDUA 3FX3A 3SZTA 4Y15A 2QLZA 3H3ZA 2EFQA 2GA1A 3U2RA 1QGPA 3TDZC 3J81Z 1SD7A 1YYVA 4HW0A 3FMRA 1HW2A 1HKTA 4XSZF 1K6OA 2PJPA 1ON1A 2WTEA 2P7CB 1G3TA 4XSXF 3DPLC 2V9VA 1EH8A 3R6SA 1ZH5A 2DK8A 1OKRA 4MNUA 2IPQX 2KIFA 4N9IA 4O6JA 4LK0F 1FWZA 1GVJA 1LQ1A 3IC7A 1Y0UA 5FFXA 2DTRA 3EETA 4ZYHA 1XCBA 4OIQF 1FOKA 2W24A 5E8GA 4FT8A 2V6CA 1ONVA 2VBZA 2QVOA 2Y48A 4U7DA 1XSDA 4P9UA 1MD0A 2JSCA 3LWFA 4RGSA 3LA7A 3I0TA 3EQLF 4RAYA 4OIRF 1LDKB 4WWCA 4U0YA 2NRAC 4WF2A 5K5QA 1ZGJA 3ZMTA 2QENA 3BZ6A 3KZYA 3OOPA 1ZREA 2OBPA 1IN6A 1R1UA 3I59B 3RI4A 4WK8F 2H09A 2STWA 4A0XA 2DFIA 3ABUA 4M71A 2QM3A 4AVPA 3QPHA 3K9TA 2IRFG 3GFJA 4PCQA 2VE8A 2BBYA 3GVAA 3L2CA 2H6CA 3JAMZ 3PQJA 2FNAA 2MD5A 3DP7A 4UUVA 1IUYA 4G6DA 3MCZA 4U88A 2M45A 4I98B 3ZMVA 5LGTA 2ISYA 5J8CA 1YQAA 2PFBA 1H9TA 1RIOH 2PI0A 3JTHA 2MLKA 3F23A 2MLGA 1D5VA 4HAMA 1JHFA 5ILUA 4MEXF 1DPRA 5HDKA 1CF7B 1Z1DA 3I59A 3C7JA 4GXOA 5JR3A 1TQMA 3W6KB 2C6YA 1FT9A 4G7ZF 1U8RA 3GZ6A 2UWMA 2M1BA 1KQ0A 2M5WA 1XMAA 2VBXA 4KN7X 4AWXB 5BMZA 1DP7P 1G4DA 3ZN1A 4F7ZA 2FQ3A 2FOKA 3QU3A 4ZZDA 5DUIA 2DT5A 2RKHA 3V7CA 1QQIA 5TJJA 3IWZA 3ISPA 2HR3A 3WTXC 4A6DA 4MQ9F 3WGGA 4AIHA 3Q9SA 1BN5A 3HOTA 4EMSA 1OYYA 5JVTA 5DV5A 1O3RA 2HOEA 2RVCA 4UVAA 3QOPA 3GF2A 1IAWA 1TLHB 3K1PA 4WXHA 3TO6A 3ZN0A 2EV6A 1ZLKA 3F21A 4M73A 3WE3A 2VC0A 2FRHA 2O0YA 2BYVE 4L9JA 2B0LA 1GXPA 3K69A 2PQ8A 5E8IA 3WODF 1KYZA 3HOSA 2RDPA 3F8MA 1U78A 3L00A 3QP5A 4PGGA 4MTEA 2Y0MA 1B4AA 5FB2A 5LBQA 4ENJA 4I7HA 4YIIA 1QPMA 1YIOA 1W7PD 1O3SA 1YS6A 1EH7A 4HBLA 5FD6A 5CVIA 1KYWA 3TOAA 1W7PA 2WV0A 4A6EA 1S6LA 5KVRA 1FBSA 3MAJA 1UB9A 1MDMB 3QRFF 5FGMA 3ABTA 3R61A 3F6OA 5ICCA 3RJPA 4IF4A 3E3VA 3RKYA 3GX4X 2IT0A 2EWNA 2XAFA 1XGNA 5IT9K 2EV0A 1ZG1A 3R0JA 2MA3A 1BC7C 1IRFA 3ERED 3ZMZA 4BHBA 1O7FA 3LFKA 2EB7A 3B02A 4OMYA 2IW5A 3BROA 4UHTA 3Q9VA 1J0RA 3V7SA 2LDUA 3GEZA 3FMQA 1K78B 2O3FA 2RN7A 4I0BA 2XASA 3E5QA 3FXQA 1ZRCA 2ELHA 1J5YA 2ZO4A 4OINF 1ZAOA 4Q4ZF 4G7HF 3VOEA 5CYVA 1XD7A 1KA8A 1MDMA 4H0EA 2HTSA 2COMA 3E5UA 1UHMA 2YU3A 3CJNA 2ZBKA 5CVJA 2EJRA 1D8KA 4IPAA 4UV8A 3BDDA 2PMHA 4L9NA 4GYIA 1QO0D 2J5OA 2NYXA 3F8BA 3BJ6A 3V8JA 1FYMA 1ODDA 2YR2A 3M1EA 2BEOA 4FHTA 4HV6A 3V4GA 2V1DA 4U7BA 2P5LC 1K78A 5DCFA 2LKPA 5JI6A 4GO1A 3KP5A 1LEBA 3QAHA 5E18F 2L3DA 1S3JA 1ZLJA 4N0BA 5JFRA 2XAHA 2DPUA 3L7WA 3RYRA 5FFZA 2OD5A 2V79A 3GZ5A 3KFWX 2XGXA 1Z05A 3ECOA 4Q5SF 5J6XA 3FHZA 4HX4A 4BH9A 2F2EA 3ZP5A 4KA4A 3OV8A 1ULYA 3I64A 2PEXA 2YPRA 4N9HA 3IRQA 1FSEA 2EFPA 2OQRA 4KMUX 1IN5A 2IVMA 3PFIA 1IN4A 2GWRA 4IRIA 5LHIA 5LHHA 2VOPA 2DQRA 4KFCA 1WI9A 3NQOA 1BI3A 3I5UA 2K86A 5CVVA 3C18A 4Y13A 4EGZA 4QLCU 2XVCA 4XRFA 5D8LB 4ESFA 3KP6A 4MGRA 5E1ZB 1T2KA 1LEAA 2CSOA 2HQNA 1FZPB 1O3TA 2NS0A 3CTAA 1R58A 3MZYA 2UZKA 1G3SA 3FM3A 1UCRA 4A12A 2O6GE 2DQLA 2OQGA 4KYWA 1UFMA 1F9NA 1HBXG 3KLNA 5BPDA 2H6BA 5ICGA 1X3UA 1VTNC 2HEOA 1KQ9A 1U5TB 1J9IA 4RGUA 4Q48A 1BI0A 4L0YB 2O8XA 1LJ9A 4RS8A 1DPUA 2VXZA 3TKYA 1YS7A 1FX7A 2V1XA 2W85A 3F6VA 1OPCA 2EFWA 2A68F 2LNBA 3KEQA 5L3FA 1U2WA 4PZJA 2K4BA 3N4MA 4KNYA 3GW2A 4IHSA 1I1GA 1V4RA 2UXNA 2XV4S 2A6EF 3NEUA 4I0AA 1YLFA 3HTUA 1YG2A 5L3DA 2CFXA 4BHPA 4KICA 1R22A 1F4KA 3GFMA 2AS5F 3JW4A 3F8CA 1PP8F 4WXCA 1FBQA 2DO7A 3I54A 1BIAA 3R60A 3V8LA 1MZBA 5LEKA 3WU0A 5CLSA 4UXNA 1U5TA 1SFUA 5KK1A 2QBYB 4O3MA 3K0LA 2KIMA 3T0YA 2QZ8A 1V3FA 3U1DA 1YW9A 1WKMA 3D0SA 1XSXA 1YFHA 3O2PE 4NQWA 4MHGA 3HRSA 4LFUA 3ZMSA 1CGPA 1P4AA 2CQKA 4JK1X 1R5GA 1B9NA 2Q0OA 1R1VA 3ZMDA 1F5TA 2RC4A 5BS6A 5D8KB 1R5HA 3R4KA 1RNLA 5IT3A 3J81K 5FO5A 4WXDA 5DUKA 2KRFA 3IKTA 3WU1B 4O5VA 5E20A 3I71A 2G9WA 3H3UA 1BOAA 1NHAA 4D0PA 4BYYA 5H6QA 2QBYA 3WTWC 1R1TA 3QPTA 3JSOA 1TNTA 3F8NA 4LK1F 1D8JA 1Z6RA 1BJAA 1RUNA 1BM9A 1G6NA 4LGWA 1DUXC 1REPC 4UVCA 4CO8A 1QNTA 2FBKA 1RZ4A 4CDGA 6PAXA 1P6RA 4YFKF 1K79A 2UXXA 1JE8A 5LRSA 3FWEA 2FBIA 4EM2A 2KJBA 2WC2A 3U9GA 2DAOA 3S2WA 2K4JA 1I5ZA 4RGRA 5JHUA 3LSTA 4S05A 1ZG5A 2P7VB 2JT1A 4XLNF 1TW2A 1EV7A 1YO5C 4KIFA 2QUFA 2A3SA 5D6EA 1E17A 2STTA 3RDIA 2GA2A 1P92A 2HS5A 1T38A 4IXAA 2X4HA 4HLYA 3CUQC 5HVQC 2JPBA 5BPIA 1MJ9A 3JTGA 1XDUA 2VBYA 5HS9A 1ZHFA 1TQIA 3GLXA 3SQNA 3CLOA 4HQMA 3P9IA 4BXUA 2Z33A 3G3ZA 3HTSB 3RYPA 2WWYA 2M87A 3WE2A 2ADUA 4Y17A 3DXJF 4PDKA 1MJBA 2HQRA 1Z91A 2H27A 3JSPA 1H9GA 2L01A 1OYWA 2ZMEB 3WTZA 3IRRA 3KEOA 2F5CA 2E7WA 3FMSA 1CF7A 5K5RA 2O03A 5LGNA 4CXFA 3TOBA 2VN2A 4CZZA 2HWVA 2FF4A 2XRNA 1KU9A 4ESBA 3HRTA 3SFZA 2M8EA 5IT9Z 3P9CA 4P5OA 1STZA 3GYHX 3O6BB 3MWMA 5HLIA 5E1WA 1R7JA 4KT5C 4G7OF 1HW5A 1XSVA 4M9SA 1RUOA 2AXLA 4GCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNS A;  1I6X A;  3DKW A;  4I09 A;  1DDN A;  1LDD A;  2ZME A;  5CVR A;  1I1S A;  1QBJ A;  1O57 A;  4RB1 A;  1PUE E;  1J2X A;  3GUD A;  1AWC A;  4DNC A;  1WWX A;  4LG0 B;  4HF2 A;  5ED4 A;  3RKX A;  2NAZ A;  2QYO A;  3FF5 A;  3RPQ A;  3V8K A;  2Z3Y A;  3DPT A;  3HIF A;  5D5X B;  4RGX A;  4CGZ A;  2ESN A;  1FSH A;  4HLX A;  4KN4 X;  3F72 A;  5D5W B;  2D1H A;  3HRU A;  5CVU A;  2XRO A;  3IWF A;  1B9M A;  1E2X A;  1KQ8 A;  4L9V A;  4EM1 A;  2VOD A;  3VEP A;  4HOB A;  2D1V A;  3QP6 A;  2PBI A;  3H92 A;  3K1M A;  4YFN F;  2ZJ2 A;  3W6J B;  1YW8 A;  3CUQ B;  4MTD A;  2R3S A;  1Z7U A;  4M9Z A;  5F1R A;  1W5T A;  4LG0 A;  3VFZ A;  2VOO A;  5ICE A;  4L0Z B;  1S29 A;  2XKP A;  1ZGA A;  5K5O A;  2XIG A;  3QU6 A;  4EJT A;  3M7G A;  4A0Y A;  2VT3 A;  3E6M A;  2CG4 A;  2W25 A;  1XCV A;  3PQK A;  4XLP F;  1HXD A;  3KP3 A;  5LGU A;  4UNO A;  2FEZ A;  3DFG A;  2YSR A;  5HS8 A;  3J80 K;  2HKO A;  5DCM B;  2H94 A;  1GXQ A;  1IW7 F;  3CUO A;  1HKQ A;  3SZP A;  4L18 B;  2P4W A;  2XAQ A;  4HX7 A;  1IF1 A;  1J59 A;  4I02 A;  1KU3 A;  3BP8 A;  4XBF A;  2LF8 A;  4RB2 C;  2XKO A;  5HLH A;  4RB3 C;  3MZH A;  4LJZ F;  2JRT A;  3HHG A;  5AIP A;  3F22 A;  1IXR C;  2IA0 A;  4WCG A;  4IJA A;  2BE5 F;  3WGI A;  4PGH A;  4KMF A;  4HQE A;  4EGY A;  3FXR A;  4HYE A;  2RQP A;  2HYF A;  3TO7 A;  2EA4 A;  3M8F A;  2P5K A;  2ESH A;  5HLG A;  3BJO A;  4A5M A;  4LMY A;  5ILV A;  1J75 A;  1USS A;  2IJL A;  3E6B A;  1T39 A;  3HUG A;  1SAX A;  1SMY F;  4M72 A;  4B09 A;  5DCM A;  3HRM A;  1FBU A;  2A6H F;  1HKS A;  1R23 A;  2DBB A;  4OOI A;  3ML6 A;  1LB2 A;  3D5L A;  4G9Y A;  4EQQ A;  2P8T A;  1HW1 A;  3COA C;  3MEX A;  1ZG3 A;  1TBX A;  4UV9 A;  2FNP A;  3EYI A;  3GXO A;  1T6S A;  2MH9 A;  1BC8 C;  5DDG A;  4MEY F;  2G7H A;  2VBW A;  5FLX K;  3MFK A;  4MQV A;  2P6T A;  2Q8K A;  2HKX A;  2GXG A;  1IXS B;  1U3E M;  4ZYG A;  2FML A;  3CDH A;  2ZNY A;  1D3Y A;  1FC3 A;  5LRR A;  1OMI A;  3HSR A;  3TQN A;  2HFH A;  5DYM A;  4G94 A;  2QQB A;  5EEH A;  4IRH A;  2L54 A;  1XN7 A;  4YG2 F;  1ZYR F;  2OA4 A;  3RPU A;  3BOQ A;  5E17 F;  5AON A;  4OIO F;  3DEU A;  4LB6 B;  3E6D A;  2DI3 A;  1SD5 A;  4G6Q A;  3L09 A;  5L3G A;  1O3Q A;  1T98 A;  2ZFW A;  4Z2Y A;  1J7K A;  3C3W A;  3KP4 A;  3TDU C;  1XMK A;  3WTV C;  3CO7 C;  2G7U A;  2P5V A;  4LD5 A;  5LHG A;  5J8F A;  5HDN A;  5A2Q K;  1OYI A;  1SFE A;  4YIF A;  2K02 A;  2F5F A;  1TW3 A;  4FX0 A;  5DEQ A;  3VB2 A;  1YTY A;  4HZF A;  3N97 A;  2OAZ A;  2FSW A;  2MH2 A;  3DF8 A;  2ZKZ A;  5D5U B;  1IN7 A;  3KCC A;  3WTY C;  5HDG A;  3G73 A;  3DQV C;  3F3X A;  2CGP A;  3KP7 A;  1YW7 A;  3WGH A;  1XGO A;  3I53 A;  5F64 A;  3C1D A;  3E6C C;  3LAP A;  1K7A A;  1LDJ A;  2E1C A;  1HSJ A;  3LA3 A;  1XGM A;  1MJA A;  2GQQ A;  5TRD A;  4BNC A;  2ETH A;  2HGC A;  4RAZ A;  3CO6 C;  3F8F A;  4WX9 A;  3GWZ A;  4HV5 A;  4EJO A;  3BPV A;  3RTR A;  2VON A;  4AIJ A;  1HST A;  4GGG A;  3ZPL A;  1Q1H A;  4A5N A;  3EUH A;  1QZZ A;  4JQF A;  3TO9 A;  4I2O A;  1T0F A;  1WSU A;  2HDC A;  3FXU A;  5ICF A;  3LQQ A;  2IA1 A;  4TV7 A;  3E5X A;  1IRG A;  3B73 A;  4GYG A;  2F5D A;  4EJV A;  5D6F A;  4EV0 A;  2CW0 F;  2DW4 A;  1A04 A;  4HX8 A;  3IKV A;  4YFX F;  2HZT A;  1P4X A;  1JGS A;  5LEJ A;  4IVN A;  3KE2 A;  1PP7 U;  2M30 A;  5H20 A;  3K2Z A;  4M6X A;  3IHU A;  3GFL A;  2DPD A;  2FA5 A;  2CO5 A;  2YX4 A;  2GIV A;  2TDX A;  2KKO A;  1S7A A;  3MQ0 A;  2GZW A;  5F6F A;  1FLI A;  4CIC A;  4U0W A;  5HS7 A;  1S8N A;  2LSO A;  5L3E A;  4R1H A;  4HF1 A;  1Z9C A;  2X0L A;  3LAJ A;  2W84 A;  2NNY A;  4KIB A;  1R36 A;  3FM5 A;  1S7O A;  4ASN A;  2DLL A;  4BAY A;  4AD9 A;  3JAM K;  1LVA A;  4U0V A;  2A69 F;  3ELK A;  4EJW A;  2VT2 A;  4P96 A;  1H0M A;  4A2U A;  2XUB A;  1P4W A;  2R7F A;  1BI1 A;  4S04 A;  3HSF A;  4HA8 A;  4Q47 A;  1SD6 A;  2NNN A;  5D4R A;  3NRV A;  4LLN A;  4LB5 A;  1LNW A;  2BV6 A;  5LLQ A;  2EFN A;  1W7P B;  1W5S A;  2OU2 A;  1C0W A;  2JPC A;  2PG4 A;  1B59 A;  3AAF A;  1UST A;  3T8T A;  1R00 A;  2OZU A;  3EDP A;  3GFI A;  1WRJ A;  2QWW A;  4L5I A;  3R0A A;  1O7L A;  2Q2E A;  4I01 A;  5H6R A;  4ENM A;  3HHH A;  2QQA A;  3BPX A;  1U6G A;  5CJ9 A;  3T8R A;  4ETS A;  1F1Z A;  2L02 A;  3M8E A;  4IRG A;  3KP2 A;  3SHF A;  3WTT C;  2FBH A;  3RKW A;  1PDN C;  4M6Y A;  2IA2 A;  4NHJ A;  2ZCW A;  1XGS A;  2CWE A;  2QQ9 A;  2FMY A;  4ZYE A;  2DK5 A;  4ZYD A;  5ILS A;  2L4M A;  2VE9 A;  5BQT A;  5L3C A;  3BY6 A;  4E70 A;  2GXB A;  4JBA A;  2A61 A;  4QWQ A;  1GHC A;  3BWG A;  1JXS A;  1ZRF A;  2XAG A;  2KJC A;  3DV8 A;  3HSE A;  3REO A;  1B1B A;  1SD4 A;  1JHH A;  3EYY A;  1FP2 A;  1FY7 A;  5EEG A;  4RB0 A;  3BJA A;  1I27 A;  2E7X A;  2P6S A;  4ZH4 F;  3RIR A;  4K2E A;  3J80 Z;  5ERI A;  4L5J A;  2EA2 A;  1ZRD A;  3SXY A;  1TQP A;  4R8H A;  4CYD A;  3T5X A;  1AOY A;  2ISZ A;  2EFO A;  3HYI A;  4R79 A;  4P9F A;  2KIU A;  2A5Y B;  2RNJ A;  1U5T C;  4LLG F;  3KET A;  5K1Y A;  1OR7 A;  4G8X A;  1EH6 A;  1BIB A;  4FX4 A;  4OU0 A;  3KZZ A;  1FP1 D;  4HDV A;  2FXA A;  3IL2 A;  3M9A A;  1G3Y A;  5BOX A;  2Y75 A;  4M74 A;  2VC1 A;  2YX7 A;  1FYL A;  4ENK A;  5L3B A;  1XDS A;  1ZAR A;  3P9K A;  1ZN2 A;  5FD5 A;  4OIP F;  1FPQ A;  1P2F A;  3CUQ A;  4KIG A;  5AIQ A;  4BQA A;  2D2W A;  1IN8 A;  1IXC A;  4UVB A;  4M9X A;  1KU2 A;  3TGN A;  2EV5 A;  1MKM A;  2DU9 A;  2PLY A;  4HF0 A;  2R7D A;  4A0Z A;  2PMU A;  1UHW A;  5HOO A;  2D45 A;  2HYG D;  3WTS C;  1XB4 A;  3KLO A;  2ACJ A;  5E1X A;  1ON2 A;  2ZXJ A;  3O3K A;  2XAJ A;  3J7A O;  1KU7 A;  3LA2 A;  1SFX A;  1IZ1 A;  4NB5 A;  5FLX Z;  1B6A A;  1TTY A;  1BI2 A;  4CHU A;  2K27 A;  1HQC A;  2XHK A;  2GAU A;  2ZNZ A;  2A07 F;  2PN6 A;  5D5V B;  3P7N A;  1SMT A;  1FYK A;  2RV8 A;  4EM0 B;  3E97 A;  3ECH A;  4KUM A;  1WQ2 A;  2MC3 A;  2FE3 A;  2JTV A;  4KDP A;  2BGC A;  2MBF A;  1KGS A;  4B8X A;  2IP2 A;  2W57 A;  3K1N A;  2OZ6 A;  4EVI A;  1BBY A;  3LQR A;  3ROU A;  2L4A A;  5DD8 A;  4BHC A;  1L0O C;  1QZY A;  5D4S A;  3ZQ7 A;  2Z5U A;  1MGT A;  3L9F A;  2E1N A;  4ON0 A;  2V1U A;  4ZZL A;  1RI7 A;  1L3L A;  3I4P A;  2Z9O A;  3GO5 A;  3ULQ B;  2O61 A;  1Z6T A;  2HTJ A;  3V7R A;  3VOD A;  3ZMU A;  3T1B A;  4EJU A;  4L9T A;  5A2Q Z;  4OMZ A;  2FU4 A;  1G3W A;  3WTU C;  3WG9 A;  2F5E A;  2K7L A;  4P55 A;  3Q5F A;  4ENN A;  4LLL A;  3I58 A;  3FZV A;  2RGV A;  1W4M A;  2JZY A;  4ESJ A;  2J5P A;  1FNN A;  2LF7 A;  2EK5 A;  4DQ2 A;  2Z99 A;  2CYY A;  4AIK A;  5DD4 A;  4IHT A;  4HDU A;  3FX3 A;  3SZT A;  4Y15 A;  2QLZ A;  3H3Z A;  2EFQ A;  2GA1 A;  3U2R A;  1QGP A;  3TDZ C;  3J81 Z;  1SD7 A;  1YYV A;  4HW0 A;  3FMR A;  1HW2 A;  1HKT A;  4XSZ F;  1K6O A;  2PJP A;  1ON1 A;  2WTE A;  2P7C B;  1G3T A;  4XSX F;  3DPL C;  2V9V A;  1EH8 A;  3R6S A;  1ZH5 A;  2DK8 A;  1OKR A;  4MNU A;  2IPQ X;  2KIF A;  4N9I A;  4O6J A;  4LK0 F;  1FWZ A;  1GVJ A;  1LQ1 A;  3IC7 A;  1Y0U A;  5FFX A;  2DTR A;  3EET A;  4ZYH A;  1XCB A;  4OIQ F;  1FOK A;  2W24 A;  5E8G A;  4FT8 A;  2V6C A;  1ONV A;  2VBZ A;  2QVO A;  2Y48 A;  4U7D A;  1XSD A;  4P9U A;  1MD0 A;  2JSC A;  3LWF A;  4RGS A;  3LA7 A;  3I0T A;  3EQL F;  4RAY A;  4OIR F;  1LDK B;  4WWC A;  4U0Y A;  2NRA C;  4WF2 A;  5K5Q A;  1ZGJ A;  3ZMT A;  2QEN A;  3BZ6 A;  3KZY A;  3OOP A;  1ZRE A;  2OBP A;  1IN6 A;  1R1U A;  3I59 B;  3RI4 A;  4WK8 F;  2H09 A;  2STW A;  4A0X A;  2DFI A;  3ABU A;  4M71 A;  2QM3 A;  4AVP A;  3QPH A;  3K9T A;  2IRF G;  3GFJ A;  4PCQ A;  2VE8 A;  2BBY A;  3GVA A;  3L2C A;  2H6C A;  3JAM Z;  3PQJ A;  2FNA A;  2MD5 A;  3DP7 A;  4UUV A;  1IUY A;  4G6D A;  3MCZ A;  4U88 A;  2M45 A;  4I98 B;  3ZMV A;  5LGT A;  2ISY A;  5J8C A;  1YQA A;  2PFB A;  1H9T A;  1RIO H;  2PI0 A;  3JTH A;  2MLK A;  3F23 A;  2MLG A;  1D5V A;  4HAM A;  1JHF A;  5ILU A;  4MEX F;  1DPR A;  5HDK A;  1CF7 B;  1Z1D A;  3I59 A;  3C7J A;  4GXO A;  5JR3 A;  1TQM A;  3W6K B;  2C6Y A;  1FT9 A;  4G7Z F;  1U8R A;  3GZ6 A;  2UWM A;  2M1B A;  1KQ0 A;  2M5W A;  1XMA A;  2VBX A;  4KN7 X;  4AWX B;  5BMZ A;  1DP7 P;  1G4D A;  3ZN1 A;  4F7Z A;  2FQ3 A;  2FOK A;  3QU3 A;  4ZZD A;  5DUI A;  2DT5 A;  2RKH A;  3V7C A;  1QQI A;  5TJJ A;  3IWZ A;  3ISP A;  2HR3 A;  3WTX C;  4A6D A;  4MQ9 F;  3WGG A;  4AIH A;  3Q9S A;  1BN5 A;  3HOT A;  4EMS A;  1OYY A;  5JVT A;  5DV5 A;  1O3R A;  2HOE A;  2RVC A;  4UVA A;  3QOP A;  3GF2 A;  1IAW A;  1TLH B;  3K1P A;  4WXH A;  3TO6 A;  3ZN0 A;  2EV6 A;  1ZLK A;  3F21 A;  4M73 A;  3WE3 A;  2VC0 A;  2FRH A;  2O0Y A;  2BYV E;  4L9J A;  2B0L A;  1GXP A;  3K69 A;  2PQ8 A;  5E8I A;  3WOD F;  1KYZ A;  3HOS A;  2RDP A;  3F8M A;  1U78 A;  3L00 A;  3QP5 A;  4PGG A;  4MTE A;  2Y0M A;  1B4A A;  5FB2 A;  5LBQ A;  4ENJ A;  4I7H A;  4YII A;  1QPM A;  1YIO A;  1W7P D;  1O3S A;  1YS6 A;  1EH7 A;  4HBL A;  5FD6 A;  5CVI A;  1KYW A;  3TOA A;  1W7P A;  2WV0 A;  4A6E A;  1S6L A;  5KVR A;  1FBS A;  3MAJ A;  1UB9 A;  1MDM B;  3QRF F;  5FGM A;  3ABT A;  3R61 A;  3F6O A;  5ICC A;  3RJP A;  4IF4 A;  3E3V A;  3RKY A;  3GX4 X;  2IT0 A;  2EWN A;  2XAF A;  1XGN A;  5IT9 K;  2EV0 A;  1ZG1 A;  3R0J A;  2MA3 A;  1BC7 C;  1IRF A;  3ERE D;  3ZMZ A;  4BHB A;  1O7F A;  3LFK A;  2EB7 A;  3B02 A;  4OMY A;  2IW5 A;  3BRO A;  4UHT A;  3Q9V A;  1J0R A;  3V7S A;  2LDU A;  3GEZ A;  3FMQ A;  1K78 B;  2O3F A;  2RN7 A;  4I0B A;  2XAS A;  3E5Q A;  3FXQ A;  1ZRC A;  2ELH A;  1J5Y A;  2ZO4 A;  4OIN F;  1ZAO A;  4Q4Z F;  4G7H F;  3VOE A;  5CYV A;  1XD7 A;  1KA8 A;  1MDM A;  4H0E A;  2HTS A;  2COM A;  3E5U A;  1UHM A;  2YU3 A;  3CJN A;  2ZBK A;  5CVJ A;  2EJR A;  1D8K A;  4IPA A;  4UV8 A;  3BDD A;  2PMH A;  4L9N A;  4GYI A;  1QO0 D;  2J5O A;  2NYX A;  3F8B A;  3BJ6 A;  3V8J A;  1FYM A;  1ODD A;  2YR2 A;  3M1E A;  2BEO A;  4FHT A;  4HV6 A;  3V4G A;  2V1D A;  4U7B A;  2P5L C;  1K78 A;  5DCF A;  2LKP A;  5JI6 A;  4GO1 A;  3KP5 A;  1LEB A;  3QAH A;  5E18 F;  2L3D A;  1S3J A;  1ZLJ A;  4N0B A;  5JFR A;  2XAH A;  2DPU A;  3L7W A;  3RYR A;  5FFZ A;  2OD5 A;  2V79 A;  3GZ5 A;  3KFW X;  2XGX A;  1Z05 A;  3ECO A;  4Q5S F;  5J6X A;  3FHZ A;  4HX4 A;  4BH9 A;  2F2E A;  3ZP5 A;  4KA4 A;  3OV8 A;  1ULY A;  3I64 A;  2PEX A;  2YPR A;  4N9H A;  3IRQ A;  1FSE A;  2EFP A;  2OQR A;  4KMU X;  1IN5 A;  2IVM A;  3PFI A;  1IN4 A;  2GWR A;  4IRI A;  5LHI A;  5LHH A;  2VOP A;  2DQR A;  4KFC A;  1WI9 A;  3NQO A;  1BI3 A;  3I5U A;  2K86 A;  5CVV A;  3C18 A;  4Y13 A;  4EGZ A;  4QLC U;  2XVC A;  4XRF A;  5D8L B;  4ESF A;  3KP6 A;  4MGR A;  5E1Z B;  1T2K A;  1LEA A;  2CSO A;  2HQN A;  1FZP B;  1O3T A;  2NS0 A;  3CTA A;  1R58 A;  3MZY A;  2UZK A;  1G3S A;  3FM3 A;  1UCR A;  4A12 A;  2O6G E;  2DQL A;  2OQG A;  4KYW A;  1UFM A;  1F9N A;  1HBX G;  3KLN A;  5BPD A;  2H6B A;  5ICG A;  1X3U A;  1VTN C;  2HEO A;  1KQ9 A;  1U5T B;  1J9I A;  4RGU A;  4Q48 A;  1BI0 A;  4L0Y B;  2O8X A;  1LJ9 A;  4RS8 A;  1DPU A;  2VXZ A;  3TKY A;  1YS7 A;  1FX7 A;  2V1X A;  2W85 A;  3F6V A;  1OPC A;  2EFW A;  2A68 F;  2LNB A;  3KEQ A;  5L3F A;  1U2W A;  4PZJ A;  2K4B A;  3N4M A;  4KNY A;  3GW2 A;  4IHS A;  1I1G A;  1V4R A;  2UXN A;  2XV4 S;  2A6E F;  3NEU A;  4I0A A;  1YLF A;  3HTU A;  1YG2 A;  5L3D A;  2CFX A;  4BHP A;  4KIC A;  1R22 A;  1F4K A;  3GFM A;  2AS5 F;  3JW4 A;  3F8C A;  1PP8 F;  4WXC A;  1FBQ A;  2DO7 A;  3I54 A;  1BIA A;  3R60 A;  3V8L A;  1MZB A;  5LEK A;  3WU0 A;  5CLS A;  4UXN A;  1U5T A;  1SFU A;  5KK1 A;  2QBY B;  4O3M A;  3K0L A;  2KIM A;  3T0Y A;  2QZ8 A;  1V3F A;  3U1D A;  1YW9 A;  1WKM A;  3D0S A;  1XSX A;  1YFH A;  3O2P E;  4NQW A;  4MHG A;  3HRS A;  4LFU A;  3ZMS A;  1CGP A;  1P4A A;  2CQK A;  4JK1 X;  1R5G A;  1B9N A;  2Q0O A;  1R1V A;  3ZMD A;  1F5T A;  2RC4 A;  5BS6 A;  5D8K B;  1R5H A;  3R4K A;  1RNL A;  5IT3 A;  3J81 K;  5FO5 A;  4WXD A;  5DUK A;  2KRF A;  3IKT A;  3WU1 B;  4O5V A;  5E20 A;  3I71 A;  2G9W A;  3H3U A;  1BOA A;  1NHA A;  4D0P A;  4BYY A;  5H6Q A;  2QBY A;  3WTW C;  1R1T A;  3QPT A;  3JSO A;  1TNT A;  3F8N A;  4LK1 F;  1D8J A;  1Z6R A;  1BJA A;  1RUN A;  1BM9 A;  1G6N A;  4LGW A;  1DUX C;  1REP C;  4UVC A;  4CO8 A;  1QNT A;  2FBK A;  1RZ4 A;  4CDG A;  6PAX A;  1P6R A;  4YFK F;  1K79 A;  2UXX A;  1JE8 A;  5LRS A;  3FWE A;  2FBI A;  4EM2 A;  2KJB A;  2WC2 A;  3U9G A;  2DAO A;  3S2W A;  2K4J A;  1I5Z A;  4RGR A;  5JHU A;  3LST A;  4S05 A;  1ZG5 A;  2P7V B;  2JT1 A;  4XLN F;  1TW2 A;  1EV7 A;  1YO5 C;  4KIF A;  2QUF A;  2A3S A;  5D6E A;  1E17 A;  2STT A;  3RDI A;  2GA2 A;  1P92 A;  2HS5 A;  1T38 A;  4IXA A;  2X4H A;  4HLY A;  3CUQ C;  5HVQ C;  2JPB A;  5BPI A;  1MJ9 A;  3JTG A;  1XDU A;  2VBY A;  5HS9 A;  1ZHF A;  1TQI A;  3GLX A;  3SQN A;  3CLO A;  4HQM A;  3P9I A;  4BXU A;  2Z33 A;  3G3Z A;  3HTS B;  3RYP A;  2WWY A;  2M87 A;  3WE2 A;  2ADU A;  4Y17 A;  3DXJ F;  4PDK A;  1MJB A;  2HQR A;  1Z91 A;  2H27 A;  3JSP A;  1H9G A;  2L01 A;  1OYW A;  2ZME B;  3WTZ A;  3IRR A;  3KEO A;  2F5C A;  2E7W A;  3FMS A;  1CF7 A;  5K5R A;  2O03 A;  5LGN A;  4CXF A;  3TOB A;  2VN2 A;  4CZZ A;  2HWV A;  2FF4 A;  2XRN A;  1KU9 A;  4ESB A;  3HRT A;  3SFZ A;  2M8E A;  5IT9 Z;  3P9C A;  4P5O A;  1STZ A;  3GYH X;  3O6B B;  3MWM A;  5HLI A;  5E1W A;  1R7J A;  4KT5 C;  4G7O F;  1HW5 A;  1XSV A;  4M9S A;  1RUO A;  2AXL A;  4GCV A; 
#chains in the Genus database with same CATH topology
 1ZK8 A;  1TNS A;  3OOU A;  5GTI C;  3ZGK A;  5FRN A;  1I6X A;  4XLF A;  3DKW A;  2OCC H;  4I09 A;  4RLQ A;  3L2Q A;  2F5V A;  1DDN A;  4M3D A;  1LDD A;  2ZME A;  5CVR A;  3BLY A;  1QBJ A;  1I1S A;  3H36 A;  1O57 A;  2R4G A;  5FKM A;  4RB1 A;  4XM3 A;  1PUE E;  1J2X A;  3GUD A;  1ZR2 A;  3FXL A;  3G1M A;  4DNC A;  1AWC A;  4EAT A;  2B63 J;  1XG1 A;  1WWX A;  4LG0 B;  4HF2 A;  1PVE A;  4OWR B;  2JK3 A;  2DOA A;  3RKX A;  5ED4 A;  2NAZ A;  2QYO A;  2M8G X;  3FF5 A;  3RPQ A;  3MVP A;  3V8K A;  2Z3Y A;  3DPT A;  1Z3Y A;  4Y4R A;  4DBR A;  4A3E J;  3HIF A;  5D5X B;  4RGX A;  3HL2 A;  2NVX J;  1Y8R B;  3W3C A;  5J1Y A;  5EGO A;  3TW6 A;  3OYL A;  4RAG A;  4CGZ A;  1BW5 A;  2ESN A;  1S7E A;  2ICW G;  4A3D J;  3A0B C;  1FSH A;  2K9L A;  1R71 A;  4HLX A;  2OJE D;  4M3G A;  5JLX A;  2OCE A;  3BZK A;  4KN4 X;  2K85 A;  4XOP A;  5C3E J;  3F72 A;  5D5W B;  2D1H A;  3JRH A;  3HRU A;  1OQY A;  5CVU A;  2XRO A;  3M3Y J;  3IWF A;  1Z7L A;  1B9M A;  4HST A;  1E2X A;  1KQ8 A;  4L9V A;  4EM1 A;  2VOD A;  3VEP A;  1ORK A;  4HOB A;  4JX5 A;  1EKE A;  1A36 A;  1PUF A;  1TT5 B;  2KFD A;  1DU0 A;  2D1V A;  1G59 A;  1TWF J;  2LOO A;  3QP6 A;  2PBI A;  4LIV A;  1X3Z B;  1W5C C;  3H92 A;  3K1M A;  4YFN F;  3M4O J;  3LSJ A;  5C4X J;  3A0H C;  2ZJ2 A;  2HDW A;  3CP8 A;  4LG3 A;  4DOZ A;  3W6J B;  1YW8 A;  2BVL A;  3CUQ B;  4MTD A;  2R3S A;  1Z7U A;  3SYT A;  2H1K A;  4RA2 A;  5JLW A;  2MW8 A;  1YHQ I;  4M9Z A;  3DTK A;  1Z77 A;  5F1R A;  2IGO A;  1W5T A;  2JN6 A;  1DQU A;  4LG0 A;  3DWL E;  3VFZ A;  5FKL A;  1LFU P;  3BG6 A;  2VOO A;  5ICE A;  3HXL A;  5EG0 A;  3SDB A;  4L0Z B;  4IOA F;  3BCB A;  2K9N A;  4M3F A;  1S29 A;  3OYG A;  2XKP A;  1ZGA A;  4UUS B;  3CCL I;  3K4C A;  5K5O A;  4QSH A;  2FJ1 A;  2JVG A;  2XIG A;  1V55 H;  3QU6 A;  3MKY B;  3KYD B;  1OCO H;  3KZI C;  4EJT A;  3DKY A;  3M7G A;  4A0Y A;  4CYC B;  1IRZ A;  2VT3 A;  3E6M A;  4YEJ A;  4XKV A;  4HNV A;  2CG4 A;  2W25 A;  1WCM J;  3S17 J;  4FTH A;  3H0D A;  1XCV A;  3PQK A;  4XLP F;  1HXD A;  1TWC J;  3KP3 A;  3X2Q H;  3ZQI A;  5LGU A;  4UNO A;  3HUG B;  2FEZ A;  2R0Q C;  1Z0X A;  1D0Z A;  2ZB9 A;  3A4C A;  3DFG A;  4XR6 A;  2YSR A;  3CCY A;  2Y30 A;  5HS8 A;  4J19 A;  3J80 K;  2HKO A;  5DCM B;  4A3F J;  1JI8 A;  2RQQ A;  2CW8 A;  2H94 A;  1GXQ A;  2WBM A;  1IW7 F;  3CUO A;  1HKQ A;  2KL4 A;  1VND A;  3SZP A;  2LY1 A;  3BTC A;  4L18 B;  2P4W A;  2XAQ A;  1WJC A;  4HX7 A;  3PO2 J;  1IF1 A;  1J59 A;  1DGW Y;  4IHV A;  4I02 A;  2LFB A;  1KU3 A;  3CCV I;  1BR2 A;  3BP8 A;  4XBF A;  2LF8 A;  4RB2 C;  1FEX A;  2XKO A;  4PUS A;  5HLH A;  3OSF A;  4RB3 C;  3MZH A;  4LJZ F;  1RES A;  4MFE A;  2CUJ A;  2VJJ A;  2JRT A;  3HHG A;  2BY0 A;  5AIP A;  3BR2 A;  2Y9Y A;  3F22 A;  1IXR C;  2IA0 A;  2XF6 A;  4WCG A;  2E1O A;  4IJA A;  2BE5 F;  3FKJ A;  2PX9 A;  3QPL A;  2X48 A;  3WGI A;  3JRD A;  4PGH A;  1T0F C;  4KMF A;  4HQE A;  4B3X A;  1QU3 A;  4EGY A;  3DTI A;  1MSF C;  3FXR A;  2HXO A;  4HYE A;  4UUS A;  1W36 D;  1HDD C;  2RQP A;  2L7M P;  3I4N J;  2R7W A;  1QPI A;  4IL6 C;  2HYF A;  3TO7 A;  3QOD A;  2EA4 A;  3M8F A;  2P5K A;  2ESH A;  2OF7 A;  5HLG A;  1MBJ A;  3BJO A;  4PJN A;  4A5M A;  4CYC A;  4LMY A;  4IOC F;  1D0Y A;  3OIQ A;  4BEH A;  5C4J J;  3DTE A;  5ILV A;  1J75 A;  1USS A;  3DEW A;  2IJL A;  4UY8 I;  3E6B A;  3G6E I;  1XTA A;  1T39 A;  2VKV A;  3HUG A;  1SAX A;  1ETY A;  1SMY F;  2JA8 J;  2RRE A;  4M72 A;  2KZG A;  1E3P A;  3K4L A;  4B09 A;  5DCM A;  4C3H J;  2BY3 A;  3HRM A;  4BQN A;  1FBU A;  2A6H F;  1HKS A;  1R23 A;  2DBB A;  2MG4 A;  1AA7 A;  2VJ4 A;  4OOI A;  1ZR4 A;  3FDY A;  5IY5 H;  2F48 A;  2R7Z J;  3ML6 A;  1LB2 A;  2BZT A;  5FRO A;  3D5L A;  4G9Y A;  3KYC B;  3CMM A;  4EQQ A;  3P5J A;  5J1R A;  2P8T A;  1HW1 A;  3COA C;  3MEX A;  2E5Z A;  1ZG3 A;  1TBX A;  5J4Y A;  4UV9 A;  2FNP A;  3EYI A;  3GXO A;  5IOY A;  5GPA A;  1T6S A;  1XPX A;  2MH9 A;  1BC8 C;  2JSP A;  5DDG A;  3K4J A;  4XQF A;  4MEY F;  1MBE A;  3ASN H;  1BR4 A;  2G7H A;  2LH9 A;  2VBW A;  3BZC A;  5FLX K;  3MFK A;  4MQV A;  2DTZ A;  2P6T A;  5IPA A;  2BHY A;  2EH3 A;  2NOJ B;  2Q8K A;  4D7M A;  2HKX A;  2XB5 A;  1VQ6 I;  2GXG A;  3HPH A;  1IXS B;  1U3E M;  2DOE A;  3CP2 A;  3NWT A;  4ZYG A;  2JA7 J;  2FML A;  2GIZ A;  5GAH J;  3CDH A;  2M0C A;  1ZQ3 P;  2O8K A;  2ZNY A;  1V54 H;  1D3Y A;  1FC3 A;  3BCA A;  5LRR A;  5HNH A;  3UKG A;  1OMI A;  3VSK A;  4BQQ A;  3HSR A;  3TQN A;  4D9J A;  3AKZ A;  1LFP A;  3IH4 A;  1X1C A;  2HFH A;  1YIJ I;  5DYM A;  5M3M J;  3RPU D;  4G94 A;  2O9L A;  2QQB A;  5EEH A;  4BJ5 C;  4IRH A;  4CCN A;  2L54 A;  3ZQG A;  1XN7 A;  2A5W A;  2WAQ A;  4YG2 F;  1D0X A;  2JVH A;  1ZYR F;  1X3W B;  1WPK A;  2VJ5 A;  2OA4 A;  3RPU A;  3BOQ A;  5E17 F;  2M0M A;  3I9V 2;  5AON A;  5E3M A;  1TL8 A;  4OIO F;  3DEU A;  4LB6 B;  3E6D A;  2DI3 A;  1SD5 A;  4G6Q A;  2I8D A;  2E2H J;  4A3B J;  3L09 A;  3OIP A;  3C2G A;  5J40 A;  5L3G A;  2FUG 2;  2LK2 A;  3CF5 F;  1O3Q A;  2CUE A;  3QQA A;  2R7V A;  1T98 A;  2WA0 A;  1E0E A;  2ZFW A;  3TED A;  1XX5 A;  4Z2Y A;  1J7K A;  3C3W A;  4NDL A;  4B44 A;  1JUS A;  5EEA A;  2MFZ A;  3TP0 A;  3OYI A;  2E2I J;  3KP4 A;  2HQ5 A;  3TDU C;  2B9S A;  1XMK A;  2CQX A;  4PJL A;  3WTV C;  3CO7 C;  2G7U A;  2P5V A;  2QKM B;  2DFE A;  4LD5 A;  4AUX A;  2NS7 A;  5LHG A;  5J8F A;  3GCM A;  5CQG A;  4JP0 A;  1LVK A;  5IYD J;  2VPR A;  1H88 C;  5HDN A;  5A2Q K;  1OYI A;  1GDT A;  1SFE A;  3S1N J;  4YIF A;  2K02 A;  1VQP I;  1RC9 A;  2F5F A;  1TW3 A;  4FX0 A;  1VZ0 A;  5DEQ A;  3S1R J;  3GTQ J;  3ZQQ A;  3VB2 A;  4OAZ A;  4X6A J;  2QKL B;  3BR3 A;  4CCK A;  1YTY A;  4HZF A;  3N97 A;  2OAZ A;  2E1M C;  2EZH A;  2FSW A;  2MH2 A;  2X1D A;  3DF8 A;  2ZKZ A;  3W2V A;  3WU2 C;  4NBQ A;  5D5U B;  1IN7 A;  2BHZ A;  3KCC A;  1ZTR A;  2FQ4 A;  2MAB A;  4XN3 A;  3WTY C;  5HDG A;  1VQ5 I;  2W48 A;  2CH0 A;  3G73 A;  4XLA A;  1SAU A;  4IKF A;  1WFX A;  3WHB A;  3DQV C;  4IQJ A;  4V2F A;  3F3X A;  2CGP A;  4JX4 A;  2K5C A;  3KP7 A;  1HOM A;  4XID A;  5J47 A;  1YW7 A;  3WGH A;  1XGO A;  3I53 A;  1JKR C;  3BTL A;  1RKW A;  1YOV B;  5F64 A;  3OYH A;  3CC4 I;  3C1D A;  1TWA J;  5KHD A;  2VIX A;  1SEU A;  3K4M A;  3E6C C;  3LAP A;  4H4K C;  3S15 J;  1K7A A;  1LDJ A;  2E1C A;  5CKT A;  2VKD A;  3IAM 2;  3HJE A;  4DYR A;  3D1N I;  4V2G A;  2L9V A;  2L9R A;  1HSJ A;  1R49 A;  2E34 A;  3WG7 H;  3LNQ A;  1WHU A;  1SVM A;  3LA3 A;  1ITY A;  3RZO J;  5HLT A;  3CLQ A;  1XGM A;  3QPS A;  3MKW B;  1T8I A;  4XMY A;  3GTJ J;  1MJA A;  3A03 A;  1MBK A;  4I99 C;  3C2H A;  2GQQ A;  2L0K A;  5TRD A;  4BNC A;  1X19 A;  2ETH A;  2HGC A;  3DBH B;  1NG6 A;  1S72 I;  4RAZ A;  3CCR I;  3CO6 C;  1MNE A;  2JMW A;  3F8F A;  4WX9 A;  3H5N A;  1QRY A;  3PNT A;  4C2T A;  3GWZ A;  2ZC2 A;  1OIS A;  1OCC H;  1X4O A;  4HV5 A;  4EJO A;  3BPV A;  3RTR A;  1MMN A;  4XK4 A;  2KRH A;  2VON A;  4AIJ A;  1HST A;  2EIJ H;  3PIO F;  4GGG A;  3ZPL A;  1Q1H A;  4A5N A;  3EUH A;  1QZZ A;  1VF9 A;  4JQF A;  4N4O B;  3TO9 A;  4I2O A;  1T0F A;  5IYC J;  5EJC A;  1WSU A;  4E7J A;  2HDC A;  2L9N A;  1IGN A;  3S14 J;  3K4B A;  3FXU A;  5ICF A;  3LQQ A;  1ETK A;  2HI3 A;  2W4S A;  2QSH X;  2IA1 A;  4TV7 A;  3E5X A;  1IRG A;  3B73 A;  2DYS H;  1WJB A;  4GYG A;  2F5D A;  3FXJ A;  4G6T B;  3M8J A;  4EJV A;  3PSF A;  3RKQ A;  5D6F A;  4EV0 A;  2E36 A;  1BOB A;  2CW0 F;  1SAN A;  3G71 I;  2DW4 A;  2R7T A;  1A04 A;  4HX8 A;  2WV1 A;  3IKV A;  5F0H A;  4YFX F;  4BUP A;  1MMG A;  2HZT A;  1P4X A;  4LIT A;  4BJ6 C;  1JGS A;  5LEJ A;  4IVN A;  3J7Y J;  3KE2 A;  1PP7 U;  2M30 A;  2WB1 A;  5H20 A;  2DA6 A;  4W97 A;  2XGE A;  3K2Z A;  4M6X A;  3IHU A;  3GFL A;  2DPD A;  2FA5 A;  2CO5 A;  2YX4 A;  2XPV A;  2GIV A;  1OCP A;  2TDX A;  2R92 J;  2KKO A;  3OL3 A;  4CA0 A;  5B5E C;  5M5X J;  1S7A A;  3MQ0 A;  1V5G A;  1Y1V J;  2GZW A;  1MNM C;  1QA6 A;  2NVT J;  4BBS J;  5F6F A;  1FLI A;  3CC2 I;  4QPQ A;  4U0W A;  4CIC A;  5HS7 A;  2OTL I;  1S8N A;  2LSO A;  3VWB A;  5F0C A;  4BY7 J;  5L3E A;  4R1H A;  4HF1 A;  1Z9C A;  2X0L A;  3LAJ A;  2W84 A;  2X6X A;  3PO3 J;  1N77 A;  2NNY A;  1ENH A;  5K7F A;  4MFD A;  4KIB A;  4UB8 C;  1T56 A;  1R36 A;  1HCR A;  3FM5 A;  3VYU B;  2Q2E B;  1S7O A;  4ASN A;  2DLL A;  3DEE A;  4BAY A;  1FIP A;  2JUG A;  1F43 A;  4AD9 A;  3JAM K;  1LVA A;  3FIS A;  4U0V A;  1ZEL A;  2A69 F;  3ELK A;  2I5U A;  4EJW A;  2E19 A;  2E60 A;  2VT2 A;  4P96 A;  2E1M B;  2LY9 A;  1H0M A;  4A2U A;  3ERM A;  4DBQ A;  2EZK A;  2XUB A;  2CFO A;  1P4W A;  2KDZ A;  1UMQ A;  2R7F A;  2L7K A;  4ZTJ A;  1BI1 A;  4S04 A;  3IP4 B;  2VB6 A;  3HSF A;  4HA8 A;  4NC6 A;  1D5Y A;  1BW6 A;  3OS2 A;  4Q47 A;  3BR1 A;  2Y0S A;  1SD6 A;  2XGD A;  3DPU A;  2NNN A;  5D4R A;  2KRC A;  3NRV A;  1M1E B;  4LLN A;  4LB5 A;  4G12 A;  1X1D A;  3IUO A;  4RM2 A;  5F04 A;  2CV1 A;  1LNW A;  2BV6 A;  1WGX A;  2LMD A;  5LLQ A;  2EFN A;  1W7P B;  2VKE A;  1W5S A;  2OU2 A;  5B1B H;  2ELK A;  2M3A A;  1C0W A;  1WZ2 A;  2JPC A;  2P0W A;  5TGT A;  4XLE A;  2PG4 A;  1B59 A;  1Z3X A;  3AAF A;  2KLO A;  1CQT A;  1UST A;  5GP9 A;  3T8T A;  1R00 A;  5IP6 A;  2DMU A;  1JJ8 C;  5GTH C;  2JJ7 A;  2OZU A;  3I56 I;  3EDP A;  3GFI A;  1WRJ A;  2QWW A;  3HGY A;  4L5I A;  3R0A A;  1O7L A;  2Q2E A;  2PMZ N;  4I01 A;  5FJ8 J;  5H6R A;  4ENM A;  3S16 J;  3HHH A;  2QQA A;  3BPX A;  3JCU C;  3RZD J;  1U6G A;  1IDY A;  2TRT A;  3ABM H;  5CJ9 A;  3T8R A;  4CCL A;  4ETS A;  4NUB A;  1F1Z A;  3M07 A;  1NG7 A;  4A3I J;  2X85 A;  1JKO C;  4XN0 A;  2L02 A;  2XSJ C;  3FK6 A;  3M8E A;  4IRG A;  4CH7 A;  3K4K A;  4XKC A;  5EF6 A;  2X1E A;  1MMA A;  3KP2 A;  3SHF A;  4GRI A;  4ZDO A;  4W1U A;  1ZGW A;  3WTT C;  2M4G A;  2FBH A;  1A31 A;  3RKW A;  4CCO A;  1PDN C;  2XPU A;  4B3A A;  2HVQ A;  4M6Y A;  2VL8 A;  3EUA A;  2IA2 A;  1QZE A;  4NHJ A;  2ZCW A;  3BQY A;  1XGS A;  2A6T A;  2LG4 A;  2CWE A;  2CQN A;  2QQ9 A;  2FMY A;  4ZYE A;  2DK5 A;  4ZYD A;  2M7A A;  1VQN I;  5ILS A;  1LKX A;  2L4M A;  3O8H A;  2VE9 A;  2IAI A;  3CCU I;  1MH4 A;  1G8X A;  3PL8 A;  5BQT A;  3BY6 A;  5L3C A;  3JRA A;  4E70 A;  3NWS A;  4A93 J;  2GXB A;  4JBA A;  5FKN A;  2A61 A;  4QWQ A;  2Q1Z B;  1U9N A;  1WH5 A;  4XRS A;  1GHC A;  3BWG A;  1JXS A;  4KJZ A;  1ZRF A;  2XAG A;  3VYT B;  2KJC A;  5EZG A;  3DV8 A;  3HSE A;  3REO A;  1B1B A;  1SD4 A;  4HEA 2;  3CMY A;  2DDB A;  1JHH A;  3EYY A;  1FP2 A;  2N8G A;  2NVY J;  2DMP A;  1FY7 A;  2CMP A;  1Y8Q B;  3ESW B;  2ZJR F;  5EEG A;  4RB0 A;  5GPC A;  1H8A C;  5F27 A;  4ABZ A;  2ZJQ F;  3BJA A;  1I27 A;  2E7X A;  2P6S A;  1A6I A;  4ZH4 F;  2IS6 A;  3RIR A;  5J4V A;  4OAY A;  4K2E A;  3J80 Z;  5ERI A;  1FOW A;  4L5J A;  2GM4 A;  2EA2 A;  1ZRD A;  3SXY A;  1TQP A;  4R8H A;  4CYD A;  2LTP A;  3T5X A;  3HG9 A;  2VXD A;  2EFO A;  2HOA A;  2ISZ A;  1AOY A;  2FX0 A;  3HYI A;  1IO2 A;  2V9P A;  4V19 K;  3HOU J;  4R79 A;  3UR3 C;  2L7F P;  4P9F A;  3TP3 A;  2KIU A;  1ETX A;  4A3J J;  2A5Y B;  2RNJ A;  4E7K A;  3BC8 A;  4M3E A;  1U5T C;  2H8W A;  4LLG F;  3KET A;  1FIA A;  5K1Y A;  1OR7 A;  2IGN A;  1EH6 A;  1BIB A;  4G8X A;  5K7Z A;  4OU0 A;  3KZZ A;  4FX4 A;  1FP1 D;  4HDV A;  2FXA A;  4BBR J;  3IL2 A;  3V42 A;  4DZP A;  1N75 A;  3M9A A;  1G3Y A;  3K2A A;  3OMY A;  5BOX A;  2DA4 A;  2Y75 A;  3CJT B;  4M74 A;  4A3C J;  3I4M J;  3PM1 A;  4GDF A;  3HC7 A;  4UUT A;  2VC1 A;  5HOD A;  2IGK A;  2YX7 A;  3MMY B;  2W7N A;  1FYL A;  5GAE J;  3OIO A;  2R7R A;  3FKI J;  4ENK A;  5L3B A;  3OS1 A;  1XDS A;  4RDU A;  1HC8 A;  1ZAR A;  1FOY A;  1G2H A;  3P9K A;  2EBI A;  1ZN2 A;  2DYR H;  5FD5 A;  4OIP F;  3OY9 A;  1LPQ A;  1FPQ A;  1W0U A;  5LFA A;  1P2F A;  3S1M J;  3CUQ A;  4CCJ A;  4KIG A;  5AIQ A;  4BQA A;  3Q0V A;  1IN8 A;  1IXC A;  2D2W A;  4UVB A;  3S1Q J;  4M9X A;  2WAF A;  2V1N A;  1KU2 A;  3TGN A;  2EV5 A;  2HVR A;  1MKM A;  1X1A A;  4A3K J;  4DW6 A;  1OFC X;  2DU9 A;  2PLY A;  4HF0 A;  2R7D A;  4A0Z A;  2PMU A;  4PFO A;  3LSP A;  2Y2Z A;  1UHW A;  2NXN B;  5HOO A;  2D45 A;  3BT9 A;  2HYG D;  2FD5 A;  3WTS C;  1XB4 A;  4I6Z A;  2R7S A;  3A2K A;  2PJR B;  3K10 A;  3LSI A;  3KLO A;  2ACJ A;  5E1X A;  1U8B A;  1JT6 A;  2CUF A;  1YX3 A;  1P7I A;  3UNG C;  2LKS A;  4YEL A;  1BJZ A;  3RQI A;  1ON2 A;  5E3O A;  2ZXJ A;  3S8P A;  3O3K A;  3G4S I;  2XAJ A;  2QEX I;  3J7A O;  1KU7 A;  3LA2 A;  2MD0 A;  2DJN A;  3A02 A;  1Y56 A;  1SFX A;  2BY1 A;  4GFB A;  2ID3 A;  2YUS A;  1IZ1 A;  3ONQ A;  3IH3 A;  3LL7 A;  4DJA A;  2IBD A;  1I6H J;  4NB5 A;  5FLX Z;  1B6A A;  5IP9 J;  1TTY A;  4QIW N;  3B6A A;  1BI2 A;  4CHU A;  4PSX A;  4Y3O A;  3ZRG A;  2K27 A;  1HQC A;  3CD6 I;  2XHK A;  2GAU A;  2ZNZ A;  2A07 F;  1A35 A;  2PN6 A;  5D5V B;  3P7N A;  1SMT A;  1FYK A;  2LYC A;  2RV8 A;  3VDX A;  2Y69 H;  3HOV J;  2VI6 A;  3GTP J;  3ZQH A;  4EM0 B;  1RKT A;  3E97 A;  3ECH A;  4UB6 C;  3K70 D;  4FAS D;  1VQ7 I;  2M34 A;  4PFP A;  4KUM A;  1WQ2 A;  2MC3 A;  3MKL A;  2FE3 A;  1VQK I;  2JTV A;  2HYJ A;  4KDP A;  2BGC A;  3ABK H;  2MBF A;  1KGS A;  3CZ6 A;  4B8X A;  2IP2 A;  3EUK L;  2W57 A;  3K1N A;  4Y33 A;  5JVG F;  2OZ6 A;  4N4N B;  4EVI A;  3S2H J;  1BBY A;  3LQR A;  3ROU A;  2L4A A;  3HBL A;  2EIM H;  3HOW J;  1WJ5 A;  5DD8 A;  4BHC A;  2M4K A;  4E7L A;  3G1L A;  1L0O C;  1YIT I;  1ACI A;  1QZY A;  5D4S A;  3ZQ7 A;  3LMM A;  2Z5U A;  2XSD C;  1WI3 A;  1MGT A;  3L9F A;  2E1N A;  1MND A;  2KHM A;  1IRX A;  4ON0 A;  3ZQC A;  3CDL A;  1OCT C;  2V1U A;  4ZZL A;  4X1E A;  1RI7 A;  1L3L A;  3I4P A;  2Z9O A;  2O7O A;  3GTL J;  3GO5 A;  3TMO A;  3ULQ B;  2F4O B;  1UG2 A;  2HOT A;  2O61 A;  3LOC A;  1Z6T A;  2HTJ A;  3V7R A;  3VOD A;  3ZMU A;  3T1B A;  4EJU A;  4L9T A;  2X9D A;  5A2Q Z;  4OMZ A;  2FU4 A;  2E35 A;  3DBL B;  2DOF A;  1G3W A;  5FLM J;  2DA5 A;  2KDO A;  2X51 A;  3WTU C;  3WG9 A;  2F5E A;  2K7L A;  4P55 A;  3Q5F A;  1TP4 A;  4XRM A;  4ENN A;  2DFF A;  2CU7 A;  4LLL A;  2V7F A;  2CV2 A;  5B1A H;  3I58 A;  1W0T A;  2OV7 A;  3FZV A;  3ZR8 X;  2CW7 A;  1KZH A;  2RGV A;  1W4M A;  2JZY A;  3JRF A;  4ESJ A;  1IC8 A;  2J5P A;  1FNN A;  2LF7 A;  2EK5 A;  2I10 A;  5E3N A;  3CCE I;  2XF5 A;  2HPM A;  4DQ2 A;  3E7L A;  1N25 A;  2XB0 X;  2Z99 A;  2CYY A;  2ME0 A;  2DFH A;  4AIK A;  2JA6 J;  5DD4 A;  2YS9 A;  4IHT A;  1R4N B;  2F4M B;  4HDU A;  3FX3 A;  3SZT A;  1TZL A;  4Y15 A;  5FLV A;  2QLZ A;  3MD2 A;  2AHQ A;  3H3Z A;  2EFQ A;  2GA1 A;  3U2R A;  1QGP A;  1DU6 A;  4DYQ A;  4XOT A;  2QGU A;  2E71 A;  3TDZ C;  3J81 Z;  1SD7 A;  1Z21 A;  1YYV A;  3KX2 A;  3OWT A;  5B66 C;  2EIN H;  4HW0 A;  1ERD A;  3FMR A;  1HW2 A;  3JRI A;  1HKT A;  4XSZ F;  1K6O A;  2PJP A;  1POG A;  3PNV A;  2QSG X;  3GTK J;  1T95 A;  1ON1 A;  2WTE A;  3TW7 A;  2CRG A;  1VQ8 I;  1R6R A;  1G3T A;  2LKX A;  2P7C B;  4XSX F;  3DPL C;  2B7E A;  1EH8 A;  2V9V A;  3R6S A;  1ZH5 A;  1KON A;  2DK8 A;  4PJM A;  1K83 J;  1MMS A;  1OKR A;  1SVL A;  1APL C;  4MNU A;  4BDY A;  2IPQ X;  2JUC A;  2KIF A;  4N9I A;  2V4J C;  2EIK H;  3HM5 A;  2CQ7 A;  2QSF X;  2IXS A;  4O6J A;  4LK0 F;  1FWZ A;  3L2R A;  1GVJ A;  1LQ1 A;  1I3A A;  3IC7 A;  1Y0U A;  5FFX A;  2DTR A;  3EET A;  5GAG J;  5M5W J;  4ZYH A;  1XCB A;  2JQ7 A;  4OIQ F;  1FOK A;  2R93 J;  4XLH A;  4HSR A;  1RR7 A;  2W24 A;  5E8G A;  1BL0 A;  2XDV A;  2VPL A;  1FOX A;  3H5R A;  4FT8 A;  2V6C A;  2ZME C;  3BG9 A;  1ONV A;  1GV2 A;  1JUM A;  1R9T J;  2XPW A;  2JRM A;  3J7Z I;  2VBZ A;  2QVO A;  3VPR A;  2Y48 A;  4U7D A;  1XSD A;  4P9U A;  3OYB A;  1MD0 A;  5BNG A;  2JSC A;  1ETO A;  3ZQF A;  3LWF A;  2L5Q A;  4RGS A;  4B43 A;  3LA7 A;  4ZJZ A;  3I0T A;  4JYK A;  3EQL F;  4RAY A;  3CME I;  4NC8 A;  1LDK B;  4OIR F;  3GTO J;  4WWC A;  4U0Y A;  2X1C A;  2NRA C;  1Z67 A;  1B8I B;  4WF2 A;  1BA5 A;  5K5Q A;  1ZGJ A;  5CPR B;  3ZMT A;  2QEN A;  3BZ6 A;  4C30 A;  4BDZ A;  3KZY A;  4XLC A;  1E3O C;  3JRB A;  3F0C A;  4BL0 B;  3OOP A;  4BXX J;  4IHY A;  1RR8 C;  1ZRE A;  2OBP A;  4AM3 A;  4CCM A;  4A3M J;  2DJI A;  3AFH A;  1IN6 A;  1R1U A;  1JKP C;  3I59 B;  3L1P A;  1I3Q J;  3CJR B;  4WK8 F;  2R7O A;  4S0H B;  3RI4 A;  3SFI A;  2NVU B;  2R7Q A;  2H09 A;  3RQ4 A;  4A0X A;  2DFI A;  4E7H A;  2JA2 A;  1EJ9 A;  2STW A;  3ABU A;  4M71 A;  2QM3 A;  1UJ8 A;  2MYS A;  4AVP A;  4RM3 A;  3QPH A;  1GT0 C;  3S3M A;  4AYB N;  3C2B A;  3K9T A;  5M5Y J;  4CZC A;  2IRF G;  1MMD A;  2LP0 A;  4B48 A;  3GFJ A;  1U0J A;  1XMX A;  4PCQ A;  2ZSH B;  2VE8 A;  5FKO A;  2BBY A;  3GVA A;  1VQ9 I;  1AU7 A;  2NS8 A;  3L2C A;  4B47 A;  3BG3 A;  4J01 A;  2H6C A;  3JAM Z;  3PQJ A;  2FNA A;  2MD5 A;  3DP7 A;  3BG7 A;  4UUV A;  2O5R A;  1IUY A;  4G6D A;  3MCZ A;  5J1U A;  4U88 A;  1Y6I A;  2M45 A;  4I98 B;  4BS9 A;  3OR2 C;  4YRV A;  1DP3 A;  4AVZ A;  5E3L A;  3ZMV A;  5LGT A;  2ISY A;  2ZFU A;  5J8C A;  1JKQ C;  2PMZ A;  1B8I A;  1YQA A;  2PFB A;  1H9T A;  2HVS A;  1I50 J;  2BOL A;  1WJD A;  1RIO H;  4AU7 A;  3JTH A;  2PI0 A;  2MLK A;  2QA4 I;  3F23 A;  2MLG A;  3CDI A;  1D5V A;  2DA1 A;  4HAM A;  1JHF A;  5ILU A;  3I55 I;  3DLA A;  4MEX F;  3PJR A;  1DPR A;  3CQZ J;  5HDK A;  2XC7 A;  1P9Q C;  2OPT A;  1CF7 B;  1Z1D A;  3I59 A;  3BR6 A;  3RSN A;  2H1L A;  2ECB A;  2EIL H;  2DA7 A;  3C7J A;  4GXO A;  5JR3 A;  1TQM A;  3W6K B;  3MZ8 A;  2C6Y A;  2AQF A;  1FT9 A;  1MIJ A;  4G7Z F;  1U8R A;  3GZ6 A;  2UWM A;  3CCM I;  1U9O A;  2M1B A;  1KQ0 A;  1HLV A;  4F91 B;  2M5W A;  1XMA A;  3JR9 A;  2VBX A;  4KN7 X;  4AWX B;  2GOM A;  5BMZ A;  1DP7 P;  1G4D A;  3ZN1 A;  4F7Z A;  2FQ3 A;  2QQ8 A;  3ASO H;  2FOK A;  3QU3 A;  4ZZD A;  5DUI A;  2DT5 A;  2RKH A;  3CCS I;  3V7C A;  2VQG A;  1QQI A;  3HOZ J;  5TJJ A;  2G0E A;  4ZYA A;  1IJW C;  3IWZ A;  3ISP A;  2HR3 A;  2R7X A;  3WTX C;  1TT0 A;  4A6D A;  4MQ9 F;  3WGG A;  4AIH A;  3S32 A;  4Z6Y A;  2KP6 A;  3PUF A;  1JUP A;  1QVU A;  3Q9S A;  1V5E A;  1BN5 A;  3HOT A;  4EMS A;  1SFK A;  3MN2 A;  3HOX J;  1OYY A;  5JVT A;  3W2W A;  5DV5 A;  1GVD A;  2K40 A;  2E2J J;  1O3R A;  2HOE A;  2RVC A;  3VYS B;  4UVA A;  3QOP A;  3AL0 C;  3GF2 A;  3SJM A;  1IAW A;  1TLH B;  3K1P A;  4WXH A;  3TO6 A;  5IYB J;  4XL9 A;  3ZN0 A;  3U21 A;  1WJE A;  1D1B A;  1K6Y A;  1JTX A;  2EV6 A;  1ZLK A;  3F21 A;  2DN0 A;  4M73 A;  4HRI A;  3WE3 A;  3VYR B;  2VC0 A;  2FRH A;  2O0Y A;  4KT6 A;  2EPF A;  2QCO A;  2BYV E;  4L9J A;  1Y1W J;  2B0L A;  4IHX A;  1GXP A;  1XC5 A;  3K69 A;  4PSW A;  1X58 A;  2DT7 B;  1W1W E;  3OYC A;  1JGG A;  1MH3 A;  2PQ8 A;  3KPH A;  2R7U A;  5E8I A;  3QYB A;  1FTT A;  3WOD F;  1KYZ A;  4F3Q A;  4C3I J;  1IV6 A;  3HOS A;  2RDP A;  3F8M A;  4IX7 A;  1U78 A;  4M6V A;  4NNJ A;  3L00 A;  1TWH J;  3IAS 2;  3QP5 A;  4PGG A;  4MTE A;  2WB1 N;  2CUZ A;  3CCQ I;  2Y0M A;  4JOM A;  3PNY A;  1X1P A;  1B4A A;  5FB2 A;  3NAU A;  5LBQ A;  4ENJ A;  4I7H A;  4YII A;  4FE7 A;  1UG0 A;  3Q0W A;  4RAF A;  1QPM A;  2DMQ A;  1YIO A;  3DBR B;  1W7P D;  4E7S A;  4JX6 A;  1O3S A;  1YS6 A;  1EH7 A;  2DMN A;  2W82 A;  4II3 A;  4HBL A;  3OYE A;  2QF7 A;  5FD6 A;  5CVI A;  1KYW A;  3TOA A;  1W7P A;  5H2F C;  2WV0 A;  4BAC A;  4A6E A;  2JWT A;  1S6L A;  1FTZ A;  5DM7 F;  5KVR A;  1JJ6 C;  5EG0 B;  1FJL A;  3CF2 A;  1FBS A;  3MAJ A;  4ZC3 A;  4DYC A;  1UB9 A;  2KPM A;  1MDM B;  3HKZ N;  3M1C A;  3QRF F;  5FGM A;  3ABT A;  1O4X A;  2UV1 A;  3R61 A;  2BXY A;  3F6O A;  2DOD A;  5ICC A;  3PFY A;  3RJP A;  4IF4 A;  3E3V A;  3RKY A;  3GX4 X;  2IT0 A;  1EA3 A;  3DU6 A;  2EWN A;  4KIT B;  2XAF A;  1XGN A;  5IT9 K;  3BTI A;  2LVS A;  2DT6 A;  2EV0 A;  2COB A;  1UEL B;  1H89 C;  3PIP F;  1ZG1 A;  1WVR A;  3H1C A;  3HEF A;  3H9G A;  2MA3 A;  3R0J A;  5EZH A;  2KIQ A;  1BC7 C;  1IRF A;  3ERE D;  3ZMZ A;  4BHB A;  1O7F A;  3LFK A;  2EB7 A;  3B02 A;  4OMY A;  2IW5 A;  3BRO A;  4UHT A;  3HOY J;  3HZJ A;  2Y0S N;  3Q9V A;  3CCJ I;  4C9Y A;  1J0R A;  2E5N A;  3V7S A;  2ZJP F;  2HNH A;  2LDU A;  3GEZ A;  3FMQ A;  2LBF B;  1K78 B;  2O3F A;  3W6V A;  5HNF A;  3OYK A;  5IOZ A;  1OCZ H;  4RMN A;  2RN7 A;  3LSK A;  2HOS A;  4I0B A;  2XAS A;  3E5Q A;  3BG5 A;  3FXQ A;  2CJJ A;  1ZRC A;  2NVQ J;  2K9S A;  2ELH A;  1J5Y A;  4DGW B;  1MW7 A;  2IS4 A;  2ZO4 A;  4CSW A;  2GLO A;  4OIN F;  3A1Y A;  1ETQ A;  1ZAO A;  4Q4Z F;  1MSE C;  3S2D J;  4AID A;  4G7H F;  2RAE A;  1VQM I;  3VOE A;  1UHS A;  2OC6 A;  1TWG J;  2BVM A;  3OYN A;  1A6Q A;  2X6W A;  3SEZ A;  4C2U A;  5CYV A;  4XIC A;  4NC7 A;  2EZI A;  2LC2 A;  1XD7 A;  1KA8 A;  3A01 B;  1MDM A;  4H0E A;  2HTS A;  2LLK A;  2COM A;  4IZZ A;  3E5U A;  1E3H A;  1UHM A;  2YU3 A;  4RBO A;  2X6Y A;  3GME A;  3CJN A;  2VLA A;  3Q3S A;  2ZBK A;  5CVJ A;  3ZQL A;  2YU9 J;  1RPW A;  4BEH B;  2EJR A;  1D8K A;  4B4C A;  4IPA A;  4UV8 A;  3N05 A;  4LOC A;  2XAU A;  3AL0 B;  3BDD A;  2PMH A;  4L9N A;  1QO0 D;  2J5O A;  2NYX A;  3F8B A;  4GYI A;  3BJ6 A;  3V8J A;  1FYM A;  1ODD A;  2YR2 A;  2UUZ A;  3M1E A;  2BEO A;  4FHT A;  1GUU A;  2L9S A;  4HV6 A;  3H0G J;  2D5V A;  3CJQ B;  2VKH A;  3V4G A;  2V1D A;  2WY7 Q;  4PJJ A;  4U7B A;  2LBF A;  2P5L C;  1K78 A;  1OLT A;  1SVO A;  5DCF A;  5FKK A;  2LKP A;  5JI6 A;  2M2E A;  3KP5 A;  4GO1 A;  4I76 A;  3QAH A;  1LEB A;  5E18 F;  2L3D A;  4ZDL A;  1A5J A;  1GV5 A;  3QYF A;  1S3J A;  1RET A;  1ZLJ A;  4MIM A;  4XRS G;  4N0B A;  5JFR A;  4II2 A;  3SDG A;  2XAH A;  2VAS A;  1NTC A;  2DPU A;  3L7W A;  4IQ4 A;  1AKH B;  3RYR A;  5FFZ A;  2OD5 A;  2V79 A;  3GZ5 A;  1ETW A;  4D7N A;  4IO9 F;  2LRD A;  3KFW X;  2XGX A;  1Z05 A;  3ECO A;  3EUH C;  4BXF A;  4Q5S F;  5J6X A;  3FHZ A;  1VQO I;  4HX4 A;  3A01 A;  2AQE A;  2V6E A;  4BH9 A;  4D5F A;  4PK4 A;  3RCO A;  2F2E A;  1YRN B;  3ZP5 A;  1NH3 A;  4KA4 A;  3OV8 A;  1ULY A;  2W1O A;  3I64 A;  2PEX A;  2YPR A;  4N9H A;  3IRQ A;  1FSE A;  2EFP A;  2OQR A;  3CMA I;  3GTM J;  4A3L J;  4KMU X;  3H9J A;  1IN5 A;  2IVM A;  1ZKG A;  3PFI A;  1IN4 A;  2HQA A;  2GWR A;  4IRI A;  5LHI A;  1UZC A;  1WH7 A;  5LHH A;  9ANT A;  2VJI A;  3O8G A;  2VOP A;  2DQR A;  3G2B A;  1N78 A;  4Y52 J;  4KFC A;  2X6O A;  1WI9 A;  3NQO A;  2DA2 A;  4QPO A;  1BI3 A;  3I5U A;  1NK3 P;  2K86 A;  3NAR A;  4XOR A;  3L2W A;  2ZSI B;  1T08 B;  2LD5 A;  5CVV A;  3C18 A;  3LSG A;  4Y13 A;  1OJL A;  4QLC U;  5IP7 J;  2XVC A;  4EGZ A;  4XRF A;  5D8L B;  4ESF A;  2DMT A;  1K4T A;  2K3F A;  3KP6 A;  3HGG A;  4MGR A;  5E1Z B;  1VQL I;  2PJR A;  1T2K A;  1LEA A;  2CSO A;  4IEJ A;  2HQN A;  1FZP B;  1O3T A;  4D1Q A;  2NS0 A;  3CTA A;  3J7A Y;  1R58 A;  2EZL A;  2P81 A;  3MZY A;  2UZK A;  1G3S A;  3FM3 A;  1T33 A;  1UCR A;  4A12 A;  5EYR A;  3DU5 A;  3QWL A;  3OYD A;  2O6G E;  2DQL A;  1AKH A;  4D5C A;  4X0G A;  3K6G A;  2V26 A;  4MLO A;  4DZJ A;  2TCT A;  3AG3 H;  2OQG A;  5GAD J;  4KYW A;  1F9N A;  1UFM A;  2Z16 A;  1HBX G;  2HU9 A;  3KLN A;  5BPD A;  1YE9 A;  2H6B A;  3EPZ A;  4RLF A;  5ICG A;  3GZN B;  1R4M B;  2LR8 A;  1X3U A;  1YRN A;  4HNU A;  4HNT A;  1VTN C;  2HEO A;  5LD2 C;  3WHC A;  1KQ9 A;  1U5T B;  1J9I A;  4RGU A;  1VQ4 I;  3OYJ A;  4Q48 A;  1AHD P;  4FQG A;  1BI0 A;  4L0Y B;  2O8X A;  1LJ9 A;  2F4I A;  4RS8 A;  5EDN A;  1DPU A;  3OR1 C;  3KYL A;  4KIS A;  2VXZ A;  1JTY A;  3TKY A;  3ZOB A;  1YS7 A;  2CS3 A;  1FX7 A;  2V1X A;  1XS9 A;  2W85 A;  3F6V A;  1OPC A;  5KAI C;  2EFW A;  2VQC A;  2A68 F;  1R5I D;  2LNB A;  3KEQ A;  5KNL A;  4NQW B;  5L3F A;  1U2W A;  4PZJ A;  2GOX B;  2K4B A;  4BU2 A;  3N4M A;  4A69 C;  4KNY A;  4C2M J;  3GW2 A;  3LSR A;  4IHS A;  1S5L C;  1I1G A;  2DXI A;  1V4R A;  2UXN A;  2XV4 S;  2A6E F;  3NEU A;  4I0A A;  4CUG A;  4FE4 A;  1YLF A;  4F93 B;  5DM6 F;  3HTU A;  2BXZ A;  3BTJ A;  4BE1 A;  2Z2S B;  1YJW I;  1YG2 A;  5L3D A;  2CFX A;  4BHP A;  4AYB A;  2GXA A;  3S3O A;  1FMW A;  1QHG A;  3FXK A;  4KIC A;  3OSG A;  3FK7 A;  3E1S A;  1X1B A;  1R22 A;  1F4K A;  3GFM A;  2AS5 F;  3JW4 A;  4MO7 A;  3QOE A;  3ABL H;  3F8C A;  4HPQ A;  3JRC A;  1PP8 F;  4WXC A;  1FBQ A;  2DO7 A;  1QHH D;  3H9Q A;  3I54 A;  1X4P A;  1HDP A;  1BIA A;  3R60 A;  3V8L A;  1V5F A;  3HB9 A;  5F0F A;  3AG2 H;  3IH2 A;  2VQL A;  1MZB A;  5LEK A;  3WU0 A;  1YJN I;  5CLS A;  4UXN A;  1U5T A;  1SFU A;  5KK1 A;  2QBY B;  4QTR A;  4ZDP A;  1TC3 C;  4O3M A;  3K0L A;  3IV5 A;  1LUJ B;  2F6C A;  2KIM A;  3T0Y A;  4A3G J;  2QZ8 A;  1X2M A;  2MC4 A;  4XON A;  1NK2 P;  1V3F A;  3LFU A;  5E79 C;  3L2V A;  3OYM A;  1OCR H;  1IG7 A;  3U1D A;  2EQR A;  2DA3 A;  1YW9 A;  3D0S A;  1WKM A;  1XSX A;  1YFH A;  3O2P E;  3H3V K;  4L5E A;  4NQW A;  4MHG A;  3HRS A;  3I3L A;  2OUM A;  4LFU A;  3ZMS A;  3OS0 A;  3HDD A;  4FET A;  2HDD A;  3H5A A;  1HF0 A;  1CGP A;  4E4H A;  1P4A A;  2H8R A;  2CQK A;  4JK1 X;  2R5Y B;  1R5G A;  1B9N A;  2Q0O A;  1R1V A;  2WAE A;  3S93 A;  1Q1V A;  2ID6 A;  3ZMD A;  2Y9Z A;  1F5T A;  2RC4 A;  3E0J B;  5BS6 A;  5D8K B;  1R5H A;  3F9K A;  3R4K A;  4BGD A;  1RNL A;  1UAA A;  5IT3 A;  3LSM A;  3J81 K;  1F36 A;  3GBG A;  1WJF A;  5FO5 A;  3FIW A;  4DIQ A;  4ZTF A;  4WXD A;  2DDA A;  4EEF G;  2NOG A;  2Z1D A;  5DUK A;  3FXM A;  3H35 A;  2WAQ N;  1IV8 A;  2KRF A;  2RNG A;  1K4S A;  3IKT A;  4FCY A;  3WU1 B;  4Y7N J;  4J00 A;  1D1C A;  4O5V A;  5E20 A;  2OTJ I;  1MBH A;  3I71 A;  1WJA A;  4AC0 A;  2G9W A;  3H3U A;  2VQH A;  1BOA A;  1NHA A;  4XKW A;  4B1R A;  4P1W A;  1IDZ A;  4D0P A;  4BYY A;  4U87 A;  1IUF A;  2IGM A;  5H6Q A;  2QBY A;  3TBI A;  5B3S H;  3WTW C;  1R1T A;  3QPT A;  3BR0 A;  3JSO A;  3FBN B;  1VI0 A;  2ELJ A;  1TNT A;  3F8N A;  1GLN A;  4LK1 F;  1D8J A;  1Z6R A;  5TIS C;  1VFC A;  1BJA A;  3K7A J;  2JA5 J;  3MKZ A;  1RUN A;  1BM9 A;  1G6N A;  2HZD A;  2WY8 Q;  4ITV A;  2KMU A;  4LGW A;  4BE0 A;  2K9Q A;  3BQZ A;  4BQO A;  1X2N A;  1DUX C;  2XF7 A;  2HPI A;  1REP C;  4UVC A;  2BW3 B;  2L2O A;  4CO8 A;  4BY1 J;  1QNT A;  4F55 A;  2M7B A;  1HA8 A;  2FBK A;  1RZ4 A;  3QYE A;  4CDG A;  6PAX A;  1P6R A;  2R5Y A;  3U1K A;  4YFK F;  1K79 A;  1OR7 C;  3SZG A;  2UXX A;  1JE8 A;  3OYA A;  2MSY A;  5LRS A;  3FWE A;  2XRL A;  2FBI A;  5FRM A;  1J09 A;  4EM2 A;  2KJB A;  2WC2 A;  3ZCO A;  3PSI A;  3U9G A;  2DAO A;  4XKB A;  3S2W A;  1B72 B;  2K3P A;  3ZXS A;  2K4J A;  1LE8 B;  1I5Z A;  1DGR M;  4RGR A;  5CQE A;  2VUM J;  2DCE A;  5JHU A;  3LST A;  2KZV A;  2IS2 A;  4S05 A;  1ZG5 A;  1P7J A;  2P7V B;  2HXI A;  3OL4 A;  2JT1 A;  3W2A A;  4XLN F;  2KIS A;  1TW2 A;  1YJ9 I;  1EV7 A;  5F08 A;  1YO5 C;  2IEK A;  4KIF A;  2LY2 A;  2QUF A;  2A3S A;  3L2U A;  1S9H A;  4E6K G;  5D6E A;  1E17 A;  1FMV A;  2STT A;  3RDI A;  4C3J J;  5J3L A;  2GA2 A;  2L7Z A;  3VSL A;  1P92 A;  4FIS A;  2HS5 A;  5M3F J;  3KIO A;  1T38 A;  2BY2 A;  4IXA A;  1PYV A;  3FHN A;  4BJT A;  3DKX A;  2X4H A;  1QVT A;  4YIR X;  2R5Z B;  4HLY A;  1LFB A;  2AXT C;  3CUQ C;  5HVQ C;  2JPB A;  2ME6 A;  3TL4 X;  3JRE A;  3AG1 H;  5BPI A;  2CV0 A;  1MJ9 A;  3PUB A;  3LSH A;  3JTG A;  2ZXW H;  1XDU A;  3D5S C;  2VBY A;  3G1O A;  2ZXI A;  5HS9 A;  4BKX A;  5JHF A;  1ZHF A;  1MBF A;  5KAF C;  1TQI A;  3GLX A;  3SQN A;  1ETV A;  3CLO A;  1YX5 A;  2ECC A;  4HQM A;  3P9I A;  4BXU A;  4PJ0 C;  2WAD A;  2Z33 A;  2BW3 A;  2K9M A;  4F92 B;  3S3N A;  3B6C A;  4IHW A;  3GLL A;  3G3Z A;  3SEQ A;  1Y39 A;  4BE2 A;  3HKZ A;  1BR1 A;  3HTS B;  2FOW A;  3RYP A;  2WWY A;  2M87 A;  3WE2 A;  3DCF A;  3K4N A;  2ADU A;  4Y17 A;  1I39 A;  3DXJ F;  4PDK A;  2CQQ A;  1MJB A;  2HQR A;  3GTG J;  1Z91 A;  2H27 A;  3CC7 I;  3JSP A;  1D1A A;  1W36 C;  2XGC A;  1H9G A;  2L01 A;  1OYW A;  2ZME B;  3AG4 H;  3WTZ A;  1B72 A;  3IRR A;  4E7I A;  1LE8 A;  1SC7 A;  3KEO A;  5C44 J;  3FBI B;  4ANJ A;  1MBG A;  2F5C A;  2E7W A;  3FMS A;  4LIU A;  3D5R C;  2M9H A;  1CF7 A;  2Y31 A;  5K5R A;  1EF4 A;  3OYF A;  2O03 A;  5K7H A;  5LGN A;  5KCM A;  4CXF A;  3CES A;  1JT0 A;  3KEY A;  3TOB A;  1Y0N A;  2W00 A;  2VN2 A;  4HG2 A;  4CZZ A;  5EGO B;  2HWV A;  4F52 A;  2ZXH A;  3FXO A;  2FF4 A;  5DS9 A;  5F1J A;  1YI2 I;  2XRN A;  2V9K A;  2KT0 A;  2R5Z A;  1KU9 A;  4ESB A;  3Q0U A;  3K70 C;  1K61 A;  2GBY A;  3HRT A;  2A05 A;  3SFZ A;  3HPG A;  2LRE A;  1SFO J;  5DTD A;  2M8E A;  5IT9 Z;  3P9C A;  4P5O A;  3BR5 A;  1STZ A;  3GYH X;  3O6B B;  4XNF A;  2KQR A;  3MWM A;  5E1W A;  5HLI A;  1R7J A;  2MGQ A;  3JRG A;  4KT5 C;  4E7Z A;  1PJR A;  3DLL F;  1PUF B;  4G7O F;  1HW5 A;  1XSV A;  4M9S A;  4M3B A;  1RRJ A;  2AO9 A;  1RUO A;  2AXL A;  4GCV A;  2IS1 A; 
#chains in the Genus database with same CATH homology
 1TNS A;  1I6X A;  3DKW A;  4I09 A;  1DDN A;  1LDD A;  2ZME A;  5CVR A;  1I1S A;  1QBJ A;  1O57 A;  4RB1 A;  1PUE E;  1J2X A;  3GUD A;  1AWC A;  4DNC A;  1WWX A;  4LG0 B;  4HF2 A;  5ED4 A;  3RKX A;  2NAZ A;  2QYO A;  3FF5 A;  3RPQ A;  3V8K A;  2Z3Y A;  3DPT A;  3HIF A;  5D5X B;  4RGX A;  4CGZ A;  2ESN A;  1FSH A;  4HLX A;  4KN4 X;  3F72 A;  5D5W B;  2D1H A;  3HRU A;  5CVU A;  2XRO A;  3IWF A;  1B9M A;  1E2X A;  1KQ8 A;  4L9V A;  4EM1 A;  2VOD A;  3VEP A;  4HOB A;  2D1V A;  3QP6 A;  2PBI A;  3H92 A;  3K1M A;  4YFN F;  2ZJ2 A;  3W6J B;  1YW8 A;  3CUQ B;  4MTD A;  2R3S A;  1Z7U A;  4M9Z A;  5F1R A;  1W5T A;  4LG0 A;  3VFZ A;  2VOO A;  5ICE A;  4L0Z B;  1S29 A;  2XKP A;  1ZGA A;  5K5O A;  2XIG A;  3QU6 A;  4EJT A;  3M7G A;  4A0Y A;  2VT3 A;  3E6M A;  2CG4 A;  2W25 A;  1XCV A;  3PQK A;  4XLP F;  1HXD A;  3KP3 A;  5LGU A;  4UNO A;  2FEZ A;  3DFG A;  2YSR A;  5HS8 A;  3J80 K;  2HKO A;  5DCM B;  2H94 A;  1GXQ A;  1IW7 F;  3CUO A;  1HKQ A;  3SZP A;  4L18 B;  2P4W A;  2XAQ A;  4HX7 A;  1IF1 A;  1J59 A;  4I02 A;  1KU3 A;  3BP8 A;  4XBF A;  2LF8 A;  4RB2 C;  2XKO A;  5HLH A;  4RB3 C;  3MZH A;  4LJZ F;  2JRT A;  3HHG A;  5AIP A;  3F22 A;  1IXR C;  2IA0 A;  4WCG A;  4IJA A;  2BE5 F;  3WGI A;  4PGH A;  4KMF A;  4HQE A;  4EGY A;  3FXR A;  4HYE A;  2RQP A;  2HYF A;  3TO7 A;  2EA4 A;  3M8F A;  2P5K A;  2ESH A;  5HLG A;  3BJO A;  4A5M A;  4LMY A;  5ILV A;  1J75 A;  1USS A;  2IJL A;  3E6B A;  1T39 A;  3HUG A;  1SAX A;  1SMY F;  4M72 A;  4B09 A;  5DCM A;  3HRM A;  1FBU A;  2A6H F;  1HKS A;  1R23 A;  2DBB A;  4OOI A;  3ML6 A;  1LB2 A;  3D5L A;  4G9Y A;  4EQQ A;  2P8T A;  1HW1 A;  3COA C;  3MEX A;  1ZG3 A;  1TBX A;  4UV9 A;  2FNP A;  3EYI A;  3GXO A;  1T6S A;  2MH9 A;  1BC8 C;  5DDG A;  4MEY F;  2G7H A;  2VBW A;  5FLX K;  3MFK A;  4MQV A;  2P6T A;  2Q8K A;  2HKX A;  2GXG A;  1IXS B;  1U3E M;  4ZYG A;  2FML A;  3CDH A;  2ZNY A;  1D3Y A;  1FC3 A;  5LRR A;  1OMI A;  3HSR A;  3TQN A;  2HFH A;  5DYM A;  4G94 A;  2QQB A;  5EEH A;  4IRH A;  2L54 A;  1XN7 A;  4YG2 F;  1ZYR F;  2OA4 A;  3RPU A;  3BOQ A;  5E17 F;  5AON A;  4OIO F;  3DEU A;  4LB6 B;  3E6D A;  2DI3 A;  1SD5 A;  4G6Q A;  3L09 A;  5L3G A;  1O3Q A;  1T98 A;  2ZFW A;  4Z2Y A;  1J7K A;  3C3W A;  3KP4 A;  3TDU C;  1XMK A;  3WTV C;  3CO7 C;  2G7U A;  2P5V A;  4LD5 A;  5LHG A;  5J8F A;  5HDN A;  5A2Q K;  1OYI A;  1SFE A;  4YIF A;  2K02 A;  2F5F A;  1TW3 A;  4FX0 A;  5DEQ A;  3VB2 A;  1YTY A;  4HZF A;  3N97 A;  2OAZ A;  2FSW A;  2MH2 A;  3DF8 A;  2ZKZ A;  5D5U B;  1IN7 A;  3KCC A;  3WTY C;  5HDG A;  3G73 A;  3DQV C;  3F3X A;  2CGP A;  3KP7 A;  1YW7 A;  3WGH A;  1XGO A;  3I53 A;  5F64 A;  3C1D A;  3E6C C;  3LAP A;  1K7A A;  1LDJ A;  2E1C A;  1HSJ A;  3LA3 A;  1XGM A;  1MJA A;  2GQQ A;  5TRD A;  4BNC A;  2ETH A;  2HGC A;  4RAZ A;  3CO6 C;  3F8F A;  4WX9 A;  3GWZ A;  4HV5 A;  4EJO A;  3BPV A;  3RTR A;  2VON A;  4AIJ A;  1HST A;  4GGG A;  3ZPL A;  1Q1H A;  4A5N A;  3EUH A;  1QZZ A;  4JQF A;  3TO9 A;  4I2O A;  1T0F A;  1WSU A;  2HDC A;  3FXU A;  5ICF A;  3LQQ A;  2IA1 A;  4TV7 A;  3E5X A;  1IRG A;  3B73 A;  4GYG A;  2F5D A;  4EJV A;  5D6F A;  4EV0 A;  2CW0 F;  2DW4 A;  1A04 A;  4HX8 A;  3IKV A;  4YFX F;  2HZT A;  1P4X A;  1JGS A;  5LEJ A;  4IVN A;  3KE2 A;  1PP7 U;  2M30 A;  5H20 A;  3K2Z A;  4M6X A;  3IHU A;  3GFL A;  2DPD A;  2FA5 A;  2CO5 A;  2YX4 A;  2GIV A;  2TDX A;  2KKO A;  1S7A A;  3MQ0 A;  2GZW A;  5F6F A;  1FLI A;  4CIC A;  4U0W A;  5HS7 A;  1S8N A;  2LSO A;  5L3E A;  4R1H A;  4HF1 A;  1Z9C A;  2X0L A;  3LAJ A;  2W84 A;  2NNY A;  4KIB A;  1R36 A;  3FM5 A;  1S7O A;  4ASN A;  2DLL A;  4BAY A;  4AD9 A;  3JAM K;  1LVA A;  4U0V A;  2A69 F;  3ELK A;  4EJW A;  2VT2 A;  4P96 A;  1H0M A;  4A2U A;  2XUB A;  1P4W A;  2R7F A;  1BI1 A;  4S04 A;  3HSF A;  4HA8 A;  4Q47 A;  1SD6 A;  2NNN A;  5D4R A;  3NRV A;  4LLN A;  4LB5 A;  1LNW A;  2BV6 A;  5LLQ A;  2EFN A;  1W7P B;  1W5S A;  2OU2 A;  1C0W A;  2JPC A;  2PG4 A;  1B59 A;  3AAF A;  1UST A;  3T8T A;  1R00 A;  2OZU A;  3EDP A;  3GFI A;  1WRJ A;  2QWW A;  4L5I A;  3R0A A;  1O7L A;  2Q2E A;  4I01 A;  5H6R A;  4ENM A;  3HHH A;  2QQA A;  3BPX A;  1U6G A;  5CJ9 A;  3T8R A;  4ETS A;  1F1Z A;  2L02 A;  3M8E A;  4IRG A;  3KP2 A;  3SHF A;  3WTT C;  2FBH A;  3RKW A;  1PDN C;  4M6Y A;  2IA2 A;  4NHJ A;  2ZCW A;  1XGS A;  2CWE A;  2QQ9 A;  2FMY A;  4ZYE A;  2DK5 A;  4ZYD A;  5ILS A;  2L4M A;  2VE9 A;  5BQT A;  5L3C A;  3BY6 A;  4E70 A;  2GXB A;  4JBA A;  2A61 A;  4QWQ A;  1GHC A;  3BWG A;  1JXS A;  1ZRF A;  2XAG A;  2KJC A;  3DV8 A;  3HSE A;  3REO A;  1B1B A;  1SD4 A;  1JHH A;  3EYY A;  1FP2 A;  1FY7 A;  5EEG A;  4RB0 A;  3BJA A;  1I27 A;  2E7X A;  2P6S A;  4ZH4 F;  3RIR A;  4K2E A;  3J80 Z;  5ERI A;  4L5J A;  2EA2 A;  1ZRD A;  3SXY A;  1TQP A;  4R8H A;  4CYD A;  3T5X A;  1AOY A;  2ISZ A;  2EFO A;  3HYI A;  4R79 A;  4P9F A;  2KIU A;  2A5Y B;  2RNJ A;  1U5T C;  4LLG F;  3KET A;  5K1Y A;  1OR7 A;  4G8X A;  1EH6 A;  1BIB A;  4FX4 A;  4OU0 A;  3KZZ A;  1FP1 D;  4HDV A;  2FXA A;  3IL2 A;  3M9A A;  1G3Y A;  5BOX A;  2Y75 A;  4M74 A;  2VC1 A;  2YX7 A;  1FYL A;  4ENK A;  5L3B A;  1XDS A;  1ZAR A;  3P9K A;  1ZN2 A;  5FD5 A;  4OIP F;  1FPQ A;  1P2F A;  3CUQ A;  4KIG A;  5AIQ A;  4BQA A;  2D2W A;  1IN8 A;  1IXC A;  4UVB A;  4M9X A;  1KU2 A;  3TGN A;  2EV5 A;  1MKM A;  2DU9 A;  2PLY A;  4HF0 A;  2R7D A;  4A0Z A;  2PMU A;  1UHW A;  5HOO A;  2D45 A;  2HYG D;  3WTS C;  1XB4 A;  3KLO A;  2ACJ A;  5E1X A;  1ON2 A;  2ZXJ A;  3O3K A;  2XAJ A;  3J7A O;  1KU7 A;  3LA2 A;  1SFX A;  1IZ1 A;  4NB5 A;  5FLX Z;  1B6A A;  1TTY A;  1BI2 A;  4CHU A;  2K27 A;  1HQC A;  2XHK A;  2GAU A;  2ZNZ A;  2A07 F;  2PN6 A;  5D5V B;  3P7N A;  1SMT A;  1FYK A;  2RV8 A;  4EM0 B;  3E97 A;  3ECH A;  4KUM A;  1WQ2 A;  2MC3 A;  2FE3 A;  2JTV A;  4KDP A;  2BGC A;  2MBF A;  1KGS A;  4B8X A;  2IP2 A;  2W57 A;  3K1N A;  2OZ6 A;  4EVI A;  1BBY A;  3LQR A;  3ROU A;  2L4A A;  5DD8 A;  4BHC A;  1L0O C;  1QZY A;  5D4S A;  3ZQ7 A;  2Z5U A;  1MGT A;  3L9F A;  2E1N A;  4ON0 A;  2V1U A;  4ZZL A;  1RI7 A;  1L3L A;  3I4P A;  2Z9O A;  3GO5 A;  3ULQ B;  2O61 A;  1Z6T A;  2HTJ A;  3V7R A;  3VOD A;  3ZMU A;  3T1B A;  4EJU A;  4L9T A;  5A2Q Z;  4OMZ A;  2FU4 A;  1G3W A;  3WTU C;  3WG9 A;  2F5E A;  2K7L A;  4P55 A;  3Q5F A;  4ENN A;  4LLL A;  3I58 A;  3FZV A;  2RGV A;  1W4M A;  2JZY A;  4ESJ A;  2J5P A;  1FNN A;  2LF7 A;  2EK5 A;  4DQ2 A;  2Z99 A;  2CYY A;  4AIK A;  5DD4 A;  4IHT A;  4HDU A;  3FX3 A;  3SZT A;  4Y15 A;  2QLZ A;  3H3Z A;  2EFQ A;  2GA1 A;  3U2R A;  1QGP A;  3TDZ C;  3J81 Z;  1SD7 A;  1YYV A;  4HW0 A;  3FMR A;  1HW2 A;  1HKT A;  4XSZ F;  1K6O A;  2PJP A;  1ON1 A;  2WTE A;  2P7C B;  1G3T A;  4XSX F;  3DPL C;  2V9V A;  1EH8 A;  3R6S A;  1ZH5 A;  2DK8 A;  1OKR A;  4MNU A;  2IPQ X;  2KIF A;  4N9I A;  4O6J A;  4LK0 F;  1FWZ A;  1GVJ A;  1LQ1 A;  3IC7 A;  1Y0U A;  5FFX A;  2DTR A;  3EET A;  4ZYH A;  1XCB A;  4OIQ F;  1FOK A;  2W24 A;  5E8G A;  4FT8 A;  2V6C A;  1ONV A;  2VBZ A;  2QVO A;  2Y48 A;  4U7D A;  1XSD A;  4P9U A;  1MD0 A;  2JSC A;  3LWF A;  4RGS A;  3LA7 A;  3I0T A;  3EQL F;  4RAY A;  4OIR F;  1LDK B;  4WWC A;  4U0Y A;  2NRA C;  4WF2 A;  5K5Q A;  1ZGJ A;  3ZMT A;  2QEN A;  3BZ6 A;  3KZY A;  3OOP A;  1ZRE A;  2OBP A;  1IN6 A;  1R1U A;  3I59 B;  3RI4 A;  4WK8 F;  2H09 A;  2STW A;  4A0X A;  2DFI A;  3ABU A;  4M71 A;  2QM3 A;  4AVP A;  3QPH A;  3K9T A;  2IRF G;  3GFJ A;  4PCQ A;  2VE8 A;  2BBY A;  3GVA A;  3L2C A;  2H6C A;  3JAM Z;  3PQJ A;  2FNA A;  2MD5 A;  3DP7 A;  4UUV A;  1IUY A;  4G6D A;  3MCZ A;  4U88 A;  2M45 A;  4I98 B;  3ZMV A;  5LGT A;  2ISY A;  5J8C A;  1YQA A;  2PFB A;  1H9T A;  1RIO H;  2PI0 A;  3JTH A;  2MLK A;  3F23 A;  2MLG A;  1D5V A;  4HAM A;  1JHF A;  5ILU A;  4MEX F;  1DPR A;  5HDK A;  1CF7 B;  1Z1D A;  3I59 A;  3C7J A;  4GXO A;  5JR3 A;  1TQM A;  3W6K B;  2C6Y A;  1FT9 A;  4G7Z F;  1U8R A;  3GZ6 A;  2UWM A;  2M1B A;  1KQ0 A;  2M5W A;  1XMA A;  2VBX A;  4KN7 X;  4AWX B;  5BMZ A;  1DP7 P;  1G4D A;  3ZN1 A;  4F7Z A;  2FQ3 A;  2FOK A;  3QU3 A;  4ZZD A;  5DUI A;  2DT5 A;  2RKH A;  3V7C A;  1QQI A;  5TJJ A;  3IWZ A;  3ISP A;  2HR3 A;  3WTX C;  4A6D A;  4MQ9 F;  3WGG A;  4AIH A;  3Q9S A;  1BN5 A;  3HOT A;  4EMS A;  1OYY A;  5JVT A;  5DV5 A;  1O3R A;  2HOE A;  2RVC A;  4UVA A;  3QOP A;  3GF2 A;  1IAW A;  1TLH B;  3K1P A;  4WXH A;  3TO6 A;  3ZN0 A;  2EV6 A;  1ZLK A;  3F21 A;  4M73 A;  3WE3 A;  2VC0 A;  2FRH A;  2O0Y A;  2BYV E;  4L9J A;  2B0L A;  1GXP A;  3K69 A;  2PQ8 A;  5E8I A;  3WOD F;  1KYZ A;  3HOS A;  2RDP A;  3F8M A;  1U78 A;  3L00 A;  3QP5 A;  4PGG A;  4MTE A;  2Y0M A;  1B4A A;  5FB2 A;  5LBQ A;  4ENJ A;  4I7H A;  4YII A;  1QPM A;  1YIO A;  1W7P D;  1O3S A;  1YS6 A;  1EH7 A;  4HBL A;  5FD6 A;  5CVI A;  1KYW A;  3TOA A;  1W7P A;  2WV0 A;  4A6E A;  1S6L A;  5KVR A;  1FBS A;  3MAJ A;  1UB9 A;  1MDM B;  3QRF F;  5FGM A;  3ABT A;  3R61 A;  3F6O A;  5ICC A;  3RJP A;  4IF4 A;  3E3V A;  3RKY A;  3GX4 X;  2IT0 A;  2EWN A;  2XAF A;  1XGN A;  5IT9 K;  2EV0 A;  1ZG1 A;  3R0J A;  2MA3 A;  1BC7 C;  1IRF A;  3ERE D;  3ZMZ A;  4BHB A;  1O7F A;  3LFK A;  2EB7 A;  3B02 A;  4OMY A;  2IW5 A;  3BRO A;  4UHT A;  3Q9V A;  1J0R A;  3V7S A;  2LDU A;  3GEZ A;  3FMQ A;  1K78 B;  2O3F A;  2RN7 A;  4I0B A;  2XAS A;  3E5Q A;  3FXQ A;  1ZRC A;  2ELH A;  1J5Y A;  2ZO4 A;  4OIN F;  1ZAO A;  4Q4Z F;  4G7H F;  3VOE A;  5CYV A;  1XD7 A;  1KA8 A;  1MDM A;  4H0E A;  2HTS A;  2COM A;  3E5U A;  1UHM A;  2YU3 A;  3CJN A;  2ZBK A;  5CVJ A;  2EJR A;  1D8K A;  4IPA A;  4UV8 A;  3BDD A;  2PMH A;  4L9N A;  4GYI A;  1QO0 D;  2J5O A;  2NYX A;  3F8B A;  3BJ6 A;  3V8J A;  1FYM A;  1ODD A;  2YR2 A;  3M1E A;  2BEO A;  4FHT A;  4HV6 A;  3V4G A;  2V1D A;  4U7B A;  2P5L C;  1K78 A;  5DCF A;  2LKP A;  5JI6 A;  4GO1 A;  3KP5 A;  1LEB A;  3QAH A;  5E18 F;  2L3D A;  1S3J A;  1ZLJ A;  4N0B A;  5JFR A;  2XAH A;  2DPU A;  3L7W A;  3RYR A;  5FFZ A;  2OD5 A;  2V79 A;  3GZ5 A;  3KFW X;  2XGX A;  1Z05 A;  3ECO A;  4Q5S F;  5J6X A;  3FHZ A;  4HX4 A;  4BH9 A;  2F2E A;  3ZP5 A;  4KA4 A;  3OV8 A;  1ULY A;  3I64 A;  2PEX A;  2YPR A;  4N9H A;  3IRQ A;  1FSE A;  2EFP A;  2OQR A;  4KMU X;  1IN5 A;  2IVM A;  3PFI A;  1IN4 A;  2GWR A;  4IRI A;  5LHI A;  5LHH A;  2VOP A;  2DQR A;  4KFC A;  1WI9 A;  3NQO A;  1BI3 A;  3I5U A;  2K86 A;  5CVV A;  3C18 A;  4Y13 A;  4EGZ A;  4QLC U;  2XVC A;  4XRF A;  5D8L B;  4ESF A;  3KP6 A;  4MGR A;  5E1Z B;  1T2K A;  1LEA A;  2CSO A;  2HQN A;  1FZP B;  1O3T A;  2NS0 A;  3CTA A;  1R58 A;  3MZY A;  2UZK A;  1G3S A;  3FM3 A;  1UCR A;  4A12 A;  2O6G E;  2DQL A;  2OQG A;  4KYW A;  1UFM A;  1F9N A;  1HBX G;  3KLN A;  5BPD A;  2H6B A;  5ICG A;  1X3U A;  1VTN C;  2HEO A;  1KQ9 A;  1U5T B;  1J9I A;  4RGU A;  4Q48 A;  1BI0 A;  4L0Y B;  2O8X A;  1LJ9 A;  4RS8 A;  1DPU A;  2VXZ A;  3TKY A;  1YS7 A;  1FX7 A;  2V1X A;  2W85 A;  3F6V A;  1OPC A;  2EFW A;  2A68 F;  2LNB A;  3KEQ A;  5L3F A;  1U2W A;  4PZJ A;  2K4B A;  3N4M A;  4KNY A;  3GW2 A;  4IHS A;  1I1G A;  1V4R A;  2UXN A;  2XV4 S;  2A6E F;  3NEU A;  4I0A A;  1YLF A;  3HTU A;  1YG2 A;  5L3D A;  2CFX A;  4BHP A;  4KIC A;  1R22 A;  1F4K A;  3GFM A;  2AS5 F;  3JW4 A;  3F8C A;  1PP8 F;  4WXC A;  1FBQ A;  2DO7 A;  3I54 A;  1BIA A;  3R60 A;  3V8L A;  1MZB A;  5LEK A;  3WU0 A;  5CLS A;  4UXN A;  1U5T A;  1SFU A;  5KK1 A;  2QBY B;  4O3M A;  3K0L A;  2KIM A;  3T0Y A;  2QZ8 A;  1V3F A;  3U1D A;  1YW9 A;  1WKM A;  3D0S A;  1XSX A;  1YFH A;  3O2P E;  4NQW A;  4MHG A;  3HRS A;  4LFU A;  3ZMS A;  1CGP A;  1P4A A;  2CQK A;  4JK1 X;  1R5G A;  1B9N A;  2Q0O A;  1R1V A;  3ZMD A;  1F5T A;  2RC4 A;  5BS6 A;  5D8K B;  1R5H A;  3R4K A;  1RNL A;  5IT3 A;  3J81 K;  5FO5 A;  4WXD A;  5DUK A;  2KRF A;  3IKT A;  3WU1 B;  4O5V A;  5E20 A;  3I71 A;  2G9W A;  3H3U A;  1BOA A;  1NHA A;  4D0P A;  4BYY A;  5H6Q A;  2QBY A;  3WTW C;  1R1T A;  3QPT A;  3JSO A;  1TNT A;  3F8N A;  4LK1 F;  1D8J A;  1Z6R A;  1BJA A;  1RUN A;  1BM9 A;  1G6N A;  4LGW A;  1DUX C;  1REP C;  4UVC A;  4CO8 A;  1QNT A;  2FBK A;  1RZ4 A;  4CDG A;  6PAX A;  1P6R A;  4YFK F;  1K79 A;  2UXX A;  1JE8 A;  5LRS A;  3FWE A;  2FBI A;  4EM2 A;  2KJB A;  2WC2 A;  3U9G A;  2DAO A;  3S2W A;  2K4J A;  1I5Z A;  4RGR A;  5JHU A;  3LST A;  4S05 A;  1ZG5 A;  2P7V B;  2JT1 A;  4XLN F;  1TW2 A;  1EV7 A;  1YO5 C;  4KIF A;  2QUF A;  2A3S A;  5D6E A;  1E17 A;  2STT A;  3RDI A;  2GA2 A;  1P92 A;  2HS5 A;  1T38 A;  4IXA A;  2X4H A;  4HLY A;  3CUQ C;  5HVQ C;  2JPB A;  5BPI A;  1MJ9 A;  3JTG A;  1XDU A;  2VBY A;  5HS9 A;  1ZHF A;  1TQI A;  3GLX A;  3SQN A;  3CLO A;  4HQM A;  3P9I A;  4BXU A;  2Z33 A;  3G3Z A;  3HTS B;  3RYP A;  2WWY A;  2M87 A;  3WE2 A;  2ADU A;  4Y17 A;  3DXJ F;  4PDK A;  1MJB A;  2HQR A;  1Z91 A;  2H27 A;  3JSP A;  1H9G A;  2L01 A;  1OYW A;  2ZME B;  3WTZ A;  3IRR A;  3KEO A;  2F5C A;  2E7W A;  3FMS A;  1CF7 A;  5K5R A;  2O03 A;  5LGN A;  4CXF A;  3TOB A;  2VN2 A;  4CZZ A;  2HWV A;  2FF4 A;  2XRN A;  1KU9 A;  4ESB A;  3HRT A;  3SFZ A;  2M8E A;  5IT9 Z;  3P9C A;  4P5O A;  1STZ A;  3GYH X;  3O6B B;  3MWM A;  5HLI A;  5E1W A;  1R7J A;  4KT5 C;  4G7O F;  1HW5 A;  1XSV A;  4M9S A;  1RUO A;  2AXL A;  4GCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...