1KQ8A

Solution structure of winged helix protein hfh-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
75
structure length
75
Chain Sequence
YIALITMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE NUCLEAR FACTOR 3 FORKHEAD HOMOLOG 1
publication title Structure comparison of two conserved HNF-3/fkh proteins HFH-1 and genesis indicates the existence of folding differences in their complexes with a DNA binding sequence.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription
total genus 11
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1kq8A00
1LDJA 3ELKA 1B4AA 1KU2A 1ONVA 1Z1DA 4MHGA 1ZAOA 4UXNA 3QOPA 5ERIA 3BZ6A 1KGSA 3BJ6A 3CUQB 3SXYA 4YFNF 3ZPLA 4CGZA 2XAGA 4RB2C 3MZHA 2VBYA 3ZMSA 4G7ZF 1XGOA 1F5TA 5LRRA 1TQIA 5JVTA 4O6JA 1USSA 2ESNA 5D4SA 1XSVA 3GW2A 5HDKA 1Z6RA 5FD6A 2EFPA 2VT3A 4KIBA 3F23A 2VONA 4OINF 4S05A 4MTEA 3RDIA 3EUHA 1ZRDA 2PEXA 4ESFA 1T6SA 5HLHA 3LQRA 3JAMZ 3V8JA 2LSOA 4K2EA 2FF4A 3U9GA 1S6LA 4LG0A 1GHCA 3F8FA 4HW0A 2DTRA 2XV4S 3KETA 2ZO4A 1FY7A 2YSRA 3TOAA 1TW3A 3M8EA 4P5OA 1J9IA 2MLGA 1FSEA 2JT1A 3VEPA 6PAXA 2UXNA 2AXLA 5ILSA 4A2UA 4I2OA 1IRGA 3QU6A 4ESJA 1K79A 2HKXA 3VOEA 2P6SA 1YW9A 5CYVA 4WK8F 3GEZA 4IRHA 1SMTA 1R5GA 3LAJA 2PMHA 3BJOA 2ZMEA 2P5KA 3K1NA 1B1BA 3LSTA 5FO5A 3FMSA 2FNAA 2DU9A 4EJWA 3QP5A 4I09A 3V7SA 5L3FA 2V79A 1XGMA 1E17A 5ILUA 4OIRF 1LEBA 4LLNA 2XGXA 2OAZA 1ZRFA 3DPLC 2EFQA 1W7PD 4EJOA 2F5CA 1EH8A 3HRMA 3FF5A 3DF8A 4R79A 3HSEA 3QPHA 1J0RA 1MKMA 1BI3A 2QQAA 3R4KA 4N9HA 4EQQA 4KIGA 3CO6C 2L4AA 3VFZA 3NEUA 3QAHA 4BXUA 3SHFA 3VB2A 3IC7A 3GWZA 4XSZF 3RI4A 1P6RA 1BM9A 1S29A 2ZCWA 2OA4A 1GVJA 3WU0A 3J80K 4UVAA 4UHTA 2W85A 2L01A 4HX7A 2OBPA 2P7CB 3ML6A 1YLFA 3HSFA 1OYIA 2GQQA 4EJTA 1G3SA 3IL2A 4GO1A 2HDCA 4WXCA 3E5UA 3QP6A 1U5TB 3EYYA 3M9AA 2ACJA 3KLOA 4Q5SF 5D8KB 5E8GA 5LLQA 3NQOA 3ZQ7A 1YW8A 3GVAA 2HS5A 2MLKA 2K86A 3BDDA 3L9FA 1Z7UA 1K78B 4TV7A 2ETHA 5DUIA 3LWFA 2RKHA 2FXAA 1O7FA 5E1ZB 4PGHA 3ZMUA 3I5UA 5HS9A 4KN7X 2X0LA 1TTYA 3B02A 3BPVA 1R23A 3LQQA 2H6CA 2H94A 1T39A 2D2WA 1PDNC 1J5YA 4HV6A 2GWRA 2CW0F 1DPUA 2DO7A 5E18F 1MDMA 1B59A 3MEXA 4UNOA 1YS6A 4P9FA 1ZLKA 3R60A 5TRDA 2QQBA 1WQ2A 5E17F 1W4MA 1MJBA 2V1DA 1OYYA 3K2ZA 5BOXA 3FXQA 1CF7B 3MZYA 5L3BA 4G6QA 4JK1X 3F72A 4OMZA 3U1DA 5ICEA 5EEHA 2JPBA 4ZH4F 3MCZA 4IJAA 1IAWA 5E8IA 2A5YB 1BOAA 5HLGA 1D8JA 3DXJF 4A0ZA 3C7JA 4IPAA 4F7ZA 2ZNZA 1P4AA 2QBYA 2CO5A 3BROA 2F5DA 1J75A 3LA7A 2OD5A 1SFXA 3W6KB 3C18A 2FOKA 2QLZA 4O5VA 3GYHX 3WTXC 5EEGA 2HQRA 4EVIA 3ZMVA 2ZNYA 4UV9A 2IJLA 1RIOH 2K4BA 3RPUA 5LEKA 2EV6A 3GX4X 4DQ2A 5FLXZ 1P4XA 1UHWA 2Z33A 2PI0A 1SFEA 1XMKA 2V6CA 1FSHA 2HGCA 5K5RA 2HFHA 4OU0A 1G3TA 2BEOA 4Y17A 2Y0MA 2QM3A 4UV8A 3OV8A 1BI0A 1HBXG 3KZZA 1O7LA 3J81K 4I7HA 1ZLJA 2RVCA 1AOYA 3LA2A 3BY6A 1IXSB 4BH9A 3Q9SA 3FZVA 4PDKA 2JTVA 1IUYA 3O2PE 3F6VA 4ENNA 1STZA 1W7PA 4BNCA 4OIPF 4HF2A 3R0JA 4D0PA 5DCMB 1P4WA 4Z2YA 3WTVC 3F6OA 2V1UA 1SFUA 3HOTA 3WTWC 1EH7A 4HQMA 3CDHA 5ICCA 1XDSA 3C1DA 2A6HF 1HW1A 2FMYA 4A6DA 5DYMA 5LEJA 3Q9VA 1IN5A 2EV0A 4HA8A 1Z9CA 3REOA 2RV8A 3KEQA 1F4KA 3JTGA 3E6MA 1USTA 2KIFA 3P7NA 5AIQA 1KU7A 2L3DA 2A68F 2FBHA 3I59B 1BC8C 2Z3YA 5HS8A 2RQPA 2DT5A 1J2XA 2RNJA 3RTRA 3PQJA 1JGSA 1FX7A 1ULYA 2FA5A 1FYLA 3TGNA 2LNBA 1SAXA 1UFMA 2NNNA 1ZG5A 5D4RA 2XKPA 4OIQF 1B9MA 4EM2A 1HKSA 3WTSC 4IHTA 1KQ9A 2MC3A 3F8MA 2ISYA 2P7VB 3I58A 2L54A 3K69A 1T0FA 4CO8A 1OPCA 3R6SA 4I0AA 2OZ6A 2DI3A 2G7UA 3WGGA 4IVNA 1JE8A 3E6DA 3COAC 2STTA 3HRUA 3LFKA 2LKPA 4AIJA 1O3SA 3GFJA 4CZZA 3E5QA 2B0LA 5L3CA 3JAMK 3IWZA 3FM3A 4L9NA 2FU4A 3FXRA 3J7AO 3CTAA 2COMA 3JW4A 1MJ9A 4JQFA 4A12A 3RKXA 2DQRA 2Q2EA 4OIOF 3ABUA 3HHHA 1WWXA 2IW5A 2D45A 2HTJA 2ZJ2A 5CVIA 2JZYA 2RDPA 3HSRA 4LMYA 3MAJA 1PP8F 4R8HA 2IT0A 3ROUA 2E7XA 1O3TA 2KJCA 2VC1A 5D6FA 1ZGAA 3SZTA 4EM0B 1QZYA 3T5XA 2GAUA 4RS8A 1IXRC 2HWVA 4M71A 1R5HA 2W24A 4M6YA 5K1YA 1QQIA 3MWMA 2PMUA 4LB5A 4BHBA 3V7RA 2WWYA 1YTYA 2OQGA 2F2EA 3WODF 2KJBA 3TO6A 4ZYGA 1XSXA 5BQTA 1XB4A 1IN4A 2M5WA 1FC3A 5BMZA 1FZPB 3F8NA 2A6EF 1GXPA 2XAQA 5DCFA 5F1RA 4Q48A 5LRSA 3L7WA 5LHIA 3N97A 1IRFA 2M45A 2QZ8A 2Z99A 1TLHB 4ESBA 5FFZA 4Y15A 3BWGA 2E7WA 2CSOA 1R1UA 3L2CA 2EJRA 2MA3A 5F6FA 2XUBA 4IRGA 2VXZA 4FT8A 4G9YA 3CJNA 1BIAA 2DPDA 1FLIA 3O6BB 2MBFA 4IRIA 3MFKA 2EFNA 2HOEA 1TQPA 2IRFG 1FOKA 4I02A 3JSOA 5DDGA 4ETSA 3KEOA 2C6YA 4QWQA 2VE8A 2CGPA 3I4PA 2ZFWA 1ODDA 2M30A 2UWMA 4PGGA 2UXXA 3KP2A 1XGSA 2H6BA 1OYWA 1U8RA 1ON1A 4Y13A 2A61A 1Q1HA 2VE9A 1FBUA 1DP7P 4HV5A 5F64A 2R7FA 2WC2A 2FE3A 1J59A 1QBJA 1ZYRF 4MGRA 4WF2A 1T38A 4UUVA 2PN6A 4I98B 3RYRA 4AWXB 3TO7A 4LD5A 4EJUA 3HRTA 3SQNA 3WGIA 1KU9A 1WI9A 5A2QK 4A0YA 4EV0A 1SMYF 3RYPA 5IT9Z 3HTSB 3F8CA 3SFZA 4CHUA 3GXOA 5J6XA 2HEOA 2J5OA 3FM5A 3HUGA 3ZN0A 4JBAA 3WTUC 5HDNA 3WE3A 2XAJA 5FGMA 1R36A 3KZYA 4G8XA 1HKTA 2PFBA 4G7HF 1MD0A 4A5NA 1QGPA 4O3MA 5FB2A 1G3WA 3I53A 5CVUA 3HIFA 3M1EA 5CVRA 1BIBA 4HLYA 4NHJA 2P8TA 3KFWX 5DD4A 1C0WA 4ENJA 1OR7A 1IN8A 1VTNC 2FEZA 2XAHA 2M87A 1Y0UA 3JSPA 2GA1A 4UVBA 2GZWA 4B8XA 5AONA 1U6GA 3M7GA 2O8XA 1EV7A 4UVCA 2VOOA 3ISPA 2KKOA 3TQNA 5DUKA 3GFMA 4L9JA 4EMSA 4BYYA 2QWWA 1YYVA 1L3LA 2IP2A 3V4GA 2FQ3A 4KMUX 4M9ZA 2HR3A 2BYVE 2J5PA 2V1XA 3GLXA 2RN7A 1I1SA 1SD6A 5D5XB 2W57A 3CUOA 4AIKA 2HKOA 4RGUA 5E20A 5IT3A 5HOOA 3HHGA 3QPTA 3FMRA 2MH9A 3V8KA 4P55A 4BQAA 1PUEE 3KP5A 1K6OA 4M9XA 1HSJA 1S7AA 2WTEA 5FFXA 1LNWA 3KLNA 3PFIA 3WGHA 3TO9A 1XGNA 1R1VA 3IHUA 1ZN2A 1RUNA 2LDUA 1KQ8A 5J8CA 2IVMA 1TNTA 1LEAA 2JRTA 2NNYA 1FNNA 3WTZA 1LJ9A 3IRQA 4WXDA 3ZP5A 2O03A 3FHZA 3GO5A 2ESHA 3O3KA 2A3SA 3WU1B 4L0ZB 1TQMA 2VBZA 2XASA 3GZ5A 2VOPA 5HDGA 1NHAA 1KU3A 4XLNF 5D6EA 4G94A 2Z9OA 2EFWA 3K1PA 4A5MA 4RGSA 4GXOA 4RGXA 2XIGA 2IPQX 1IXCA 3DP7A 3QRFF 3GFLA 1F9NA 4KDPA 1JHFA 3R0AA 3T0YA 1OKRA 3EQLF 3CLOA 1U5TA 4BHCA 2DBBA 2QUFA 2M1BA 1WKMA 1B6AA 3DV8A 5E1WA 3GZ6A 3MQ0A 1O57A 5H20A 3I54A 3N4MA 1EH6A 1S3JA 4HX8A 1BN5A 4P9UA 5K5OA 3RPQA 1K78A 2K02A 4LG0B 2QVOA 2Y48A 2DK8A 3EETA 1CGPA 4OOIA 1D3YA 4AVPA 4N0BA 2HZTA 1R22A 3P9CA 1QO0D 3HRSA 5E1XA 1FYKA 1ZRCA 4MQVA 4YFXF 3WTTC 1Z05A 4HZFA 2QYOA 5BPIA 2GXBA 1SD5A 2A07F 4A0XA 1BBYA 2D1HA 1HW2A 1FT9A 1BI1A 2TDXA 5BPDA 3V7CA 4H0EA 1BJAA 3QU3A 4LK1F 2P6TA 1LB2A 1B9NA 2BBYA 4M72A 3BPXA 4PZJA 4KYWA 4U7BA 2QQ9A 2ZMEB 4M73A 1U2WA 2Z5UA 1X3UA 4KIFA 2K7LA 2HYFA 2HTSA 1CF7A 2BGCA 4HF0A 2OU2A 3ZMDA 2Q0OA 2YPRA 5HS7A 2G9WA 2DPUA 1S8NA 4QLCU 2ISZA 4L18B 4BHPA 1R00A 2GIVA 2PLYA 1XCBA 3BJAA 1XMAA 4LFUA 1AWCA 1TBXA 3L00A 4KN4X 1HW5A 2Q8KA 1XN7A 2OQRA 3K9TA 4ZYEA 4U88A 3F21A 4FX4A 4S04A 3F3XA 1YQAA 2O0YA 5H6QA 2VBWA 5ICFA 3T8TA 4M6XA 3LA3A 3HOSA 2A69F 2RGVA 2UZKA 1S7OA 4GYIA 2YX4A 3HYIA 1Z91A 1HSTA 5D5UB 1I6XA 4GYGA 2MH2A 4CICA 4N9IA 4HAMA 3WE2A 2DAOA 3FX3A 2ZKZA 1FP2A 2DLLA 2EK5A 3ULQB 5TJJA 2P5LC 3IKVA 4FX0A 4ZZLA 2VODA 1XD7A 5CJ9A 3P9KA 1IW7F 1XCVA 2KRFA 5KVRA 1DPRA 1ZG1A 5DCMA 1HXDA 3ZMTA 1H0MA 4I01A 4MEYF 3W6JB 4EM1A 3BP8A 1YW7A 1P2FA 4U0WA 3DFGA 1J7KA 2FBIA 4CDGA 5ILVA 1KA8A 1SD7A 2V9VA 2PG4A 4WXHA 2CG4A 4XSXF 1I1GA 4KNYA 1MDMB 4AIHA 3D0SA 4ZZDA 1U78A 3DEUA 3I59A 3ECHA 1V4RA 1MZBA 4YFKF 5IT9K 4MTDA 1U5TC 1O3RA 1R7JA 3WG9A 4LLLA 1GXQA 3Q5FA 1FPQA 2L4MA 1A04A 1FBQA 3HTUA 1LDKB 1K7AA 3U2RA 5JI6A 1E2XA 2K4JA 1RUOA 2QBYB 5L3EA 2FRHA 4RB3C 3F22A 2JSCA 1YFHA 2NS0A 4KUMA 2EA2A 4G6DA 5K5QA 3KP3A 3G73A 3CO7C 1YIOA 4U0YA 4HQEA 1G4DA 5AIPA 2DQLA 3KP6A 2FBKA 2P5VA 2RC4A 1FP1D 4XLPF 4RB0A 1ZARA 4IXAA 3I64A 2IA2A 3L09A 4OMYA 1IZ1A 1YO5C 2P4WA 2D1VA 3RKWA 1HKQA 4GCVA 3E6BA 1RI7A 1P92A 4EGZA 1I5ZA 4LB6B 4HDUA 3T8RA 4KFCA 4RAYA 4A6EA 4P96A 1YG2A 4E70A 3CUQA 3GF2A 1DDNA 5CLSA 4R1HA 2WV0A 3ABTA 5L3DA 1G3YA 2OZUA 2H09A 1W7PB 3IKTA 3KCCA 2XROA 4NB5A 4XBFA 3NRVA 3H92A 2R7DA 2HYGD 4ASNA 3DPTA 2ZBKA 3TOBA 1UCRA 1WSUA 4LLGF 1IN6A 3TKYA 4DNCA 1U3EM 4I0BA 2E1NA 3F8BA 1F1ZA 5HLIA 2KIUA 2FSWA 5KK1A 1IN7A 2YU3A 3B73A 3C3WA 4ON0A 2BE5F 3J80Z 2IA0A 4MQ9F 1LDDA 5A2QZ 5ICGA 2W25A 1KYWA 2CFXA 2AS5F 2CWEA 1ZHFA 1XDUA 2G7HA 3KE2A 2GXGA 5BS6A 1ZH5A 4RB1A 4CXFA 3PQKA 2MD5A 4YG2F 4KMFA 5FLXK 2VT2A 4WWCA 1ZG3A 4HF1A 3IRRA 4RAZA 4MNUA 4HLXA 1FBSA 2ADUA 4L9TA 2LF7A 3FWEA 5JHUA 2DW4A 2KIMA 3WTYC 1QZZA 5L3GA 1TNSA 2CQKA 3E97A 5DD8A 5DEQA 4LGWA 4L9VA 3RJPA 3V8LA 4HOBA 4M74A 3LAPA 4KICA 2VN2A 5D5WB 3OOPA 1ZGJA 5LHGA 4KA4A 5LGNA 1W5SA 4XRFA 4GGGA 4FHTA 2IA1A 2STWA 1H9GA 2GA2A 5CVVA 3E3VA 5LGUA 4HYEA 2O61A 1MJAA 4WCGA 4IHSA 1WRJA 2VC0A 3SZPA 1YS7A 1Z6TA 3T1BA 3RIRA 4NQWA 4U0VA 4L0YB 2Y75A 2EFOA 4RGRA 1T98A 2PBIA 4Q4ZF 2ELHA 4L5JA 5CVJA 3ECOA 5JFRA 2PJPA 1BC7C 5H6RA 1KYZA 4Q47A 2XVCA 4M9SA 2X4HA 1IF1A 4CYDA 2BV6A 4ZYHA 1QNTA 3KP4A 3EYIA 1RZ4A 2R3SA 5LGTA 2XKOA 2NYXA 1V3FA 1W5TA 3H3ZA 5LHHA 3KP7A 3TDUC 1LQ1A 4HBLA 1XSDA 1KQ0A 3FXUA 4WX9A 3M8FA 1SD4A 1I27A 2W84A 1TW2A 3DKWA 3H3UA 4YIIA 2K27A 2EA4A 3AAFA 4HDVA 2YR2A 4L5IA 5LBQA 2O3FA 1DUXC 3E5XA 4LK0F 2L02A 3DQVC 1R58A 2NRAC 3FMQA 2F5FA 4KT5C 1ON2A 4BAYA 5D8LB 4ENKA 3I71A 3VODA 1PP7U 3S2WA 4ZYDA 1LVAA 4EJVA 4AD9A 2FNPA 4G7OF 2LF8A 3G3ZA 2DK5A 1T2KA 2YX7A 1RNLA 2H27A 2JPCA 3TDZC 5JR3A 1BI2A 3CUQC 3J81Z 3ERED 2PQ8A 4EGYA 5DV5A 1UB9A 4B09A 5J8FA 2NAZA 1G6NA 3GFIA 2DFIA 4ENMA 1FWZA 2EWNA 4MEXF 3BOQA 2FMLA 1JHHA 2O6GE 3K0LA 3D5LA 2VBXA 4YIFA 2ZXJA 1ZREA 3ZN1A 2EV5A 3JTHA 1QPMA 2EB7A 1D8KA 1H9TA 3I0TA 4PCQA 1REPC 1R1TA 4U7DA 2M8EA 2HQNA 5FD5A 5D5VB 1D5VA 3E6CC 1O3QA 2E1CA 2XAFA 4HX4A 1L0OC 2XHKA 2QENA 1JXSA 3EDPA 2CYYA 2F5EA 1UHMA 3R61A 4LJZF 5HVQC 3GUDA 3P9IA 3RKYA 1MGTA 4IF4A 3ZMZA 3K1MA 1FYMA 3IWFA 1HQCA 2XRNA 1OMIA 5ED4A
chains in the Genus database with same CATH superfamily
1LDJA 1R5ID 3ELKA 1B4AA 3IH3A 2JSPA 1T08B 2DDAA 1KU2A 3K4CA 3HUGB 3I4NJ 1ONVA 1Z1DA 4MHGA 1ZAOA 4UXNA 5EGOB 3QOPA 5ERIA 3HG9A 4BEHB 3BZ6A 4A3LJ 4G6TB 1KGSA 3BJ6A 1ETVA 3CUQB 3SXYA 4YFNF 3ZPLA 2EPFA 4CGZA 2JA6J 2XAGA 4RB2C 3MZHA 4XIDA 2LOOA 3OOUA 2VBYA 2DA6A 3ZMSA 5M5WJ 4G7ZF 1A31A 1XGOA 5FRNA 1F5TA 5FKLA 2E5NA 1W0TA 5LRRA 2TCTA 1TQIA 5JVTA 4O6JA 1USSA 3VYTB 1AKHA 2ESNA 3K4BA 1ZR4A 2E1MB 5D4SA 1XSVA 3BG6A 2B63J 3GW2A 2FUG2 3GTMJ 4IHXA 2XDVA 5HDKA 3CZ6A 1Z6RA 5FD6A 2EFPA 3SJMA 2L5QA 2VT3A 4M3BA 4KIBA 2I10A 3F23A 2HVSA 2VONA 4QIWN 4OINF 3OSFA 4S05A 3HL2A 2BZTA 4MTEA 3RDIA 1NK3P 2L2OA 2IGOA 4ZJZA 3EUHA 1ZRDA 4LIUA 1MBJA 2PEXA 1APLC 4ESFA 1T6SA 5HLHA 3LQRA 3JAMZ 1R49A 2BHZA 3V8JA 2WBMA 2LSOA 1RKTA 4K2EA 3P5JA 1N25A 2FF4A 1MBKA 3OYNA 2RREA 1B8IA 3RCOA 3U9GA 1S6LA 2NS7A 4DZPA 4LG0A 1GHCA 2N8GA 2YUSA 3F8FA 2DTRA 4HW0A 3CD6I 4DYCA 2XV4S 3KETA 2ZO4A 4A3DJ 1FY7A 2DA1A 2JVGA 2YSRA 5B1BH 2BW3B 3TOAA 1TW3A 2FD5A 3M8EA 4P5OA 1J9IA 4XLEA 5IYDJ 2ECCA 1FSEA 2MLGA 2JT1A 3VEPA 6PAXA 2B7EA 2UXNA 2AXLA 5ILSA 3FBIB 2QEXI 1OJLA 4A2UA 2GIZA 4I2OA 1IC8A 1IRGA 3QU6A 4ESJA 3D5RC 1YI2I 1K79A 2HKXA 3VOEA 4XICA 2JVHA 2KT0A 2P6SA 5HNFA 1YW9A 5CYVA 4WK8F 2K9SA 3OIPA 4XLCA 2LYCA 3GEZA 4IRHA 1SMTA 2DMTA 2XB5A 1R5GA 2TRTA 4PUSA 3SEZA 2Y9YA 1VF9A 3S16J 3LSRA 3LAJA 1SFOJ 2P81A 3K6GA 2PMHA 3BJOA 2ZMEA 2P5KA 3K1NA 4AM3A 1B1BA 4LOCA 1X4OA 3LSTA 5FO5A 3FMSA 2FNAA 2MG4A 2DU9A 4EJWA 2X6OA 3QP5A 4I09A 3V7SA 2R7XA 4DJAA 5L3FA 2X6YA 1V55H 2DMQA 4UUSB 2V79A 1LUJB 4FQGA 1XGMA 1E17A 1TT0A 1A6QA 5ILUA 1IDZA 4OIRF 4BKXA 1LEBA 4LLNA 2XGXA 1R4MB 2KZGA 3ZQQA 4CCOA 2OAZA 3F9KA 3ASNH 2GOMA 1ZRFA 2LMDA 4C30A 1QA6A 3DPLC 5GTIC 3ZRGA 2EFQA 1W7PD 1QHHD 4EJOA 2F5CA 4C2UA 1EH8A 3HRMA 1YOVB 3FF5A 2KZVA 3DF8A 2F4OB 4R79A 3HSEA 1NH3A 3QPHA 2GXAA 1J0RA 2EIMH 1MKMA 1BI3A 2QQAA 2M4GA 3OYGA 3R4KA 4N9HA 4EQQA 4KIGA 3CO6C 2L4AA 3VFZA 3OR2C 4IOCF 2VPLA 3NEUA 3QAHA 4BXUA 3SHFA 2HQ5A 3IC7A 3GWZA 3VB2A 2QA4I 4PJJA 4XSZF 3ONQA 3RI4A 1P6RA 3O8HA 2A5WA 4XQFA 1BM9A 2W4SA 1S29A 2ZCWA 2AS5F 2OA4A 3C2BA 2HDWA 2COBA 1GVJA 2QKMB 1HDPA 3WU0A 4XKWA 3J80K 3ABMH 2V26A 4UVAA 2BY1A 3KYLA 1WCMJ 4UHTA 2W85A 4BL0B 2L01A 3FISA 1Y56A 4HX7A 2OBPA 1V5FA 2P7CB 3ML6A 2QSGX 4RLQA 1YLFA 3CC7I 3KEYA 1GLNA 3HSFA 1OYIA 1U9NA 1Y39A 4X1EA 2GQQA 2DT7B 2DXIA 3LSPA 3VYRB 3FKJA 5FROA 4EJTA 5GAGJ 3H0DA 1G3SA 3IL2A 4GO1A 3M1CA 3BR2A 2LBFB 2HDCA 2D5VA 4WXCA 2BOLA 1S9HA 5C44J 2DYSH 3ABKH 3E5UA 3QP6A 3E1SA 1U5TB 5E3LA 3S1QJ 3S32A 3FXKA 3JRCA 3OL3A 3EYYA 1VQ7I 2EZLA 3M9AA 2E5ZA 4ZTFA 2ACJA 3KLOA 4Q5SF 5D8KB 1XG1A 5E8GA 5LLQA 3NQOA 2DA5A 2K9LA 4PK4A 4J01A 5E79C 3JRBA 2MC4A 3ZQ7A 4XKVA 1YW8A 3OYLA 3HB9A 3GVAA 2HS5A 2BHYA 2MLKA 5CKTA 5FKNA 2K86A 5KAFC 3BDDA 3SEQA 2DOAA 3L9FA 3LSHA 1Z7UA 2EILH 5J47A 1K78B 2JJ7A 1VQ9I 2V4JC 4TV7A 2ETHA 5DUIA 3LWFA 2RKHA 4BACA 4PFPA 1K6YA 2FXAA 1O7FA 2OTLI 5E1ZB 3ZQIA 1DQUA 4PGHA 3ZMUA 1ZQ3P 3I5UA 2LK2A 3KYCB 5HS9A 4NDLA 4KN7X 3CESA 1RETA 3BQZA 3F0CA 5HNHA 2Z16A 3RKQA 2EBIA 2AQEA 1TTYA 2X0LA 3B02A 3BPVA 1R23A 3LQQA 4MO7A 1YJNI 2H6CA 2H94A 3L2QA 1T39A 2D2WA 1MNDA 4CYCB 2JUCA 3O8GA 1PDNC 1J5YA 2EIJH 4HV6A 2GWRA 3ZQHA 2CW0F 1DPUA 2DO7A 3OYKA 5E18F 3PIOF 1MDMA 1B59A 1ZR2A 3MEXA 4NNJA 2DFEA 4UNOA 1YS6A 4P9FA 1ITYA 1ZLKA 4ANJA 3R60A 1MNMC 2GLOA 1DU0A 2VJ4A 3TMOA 2HXIA 5TRDA 2RQQA 2VIXA 2QQBA 1WQ2A 2LD5A 5E17F 1W4MA 1MJBA 2V1DA 5FJ8J 1OYYA 1SVOA 3K2ZA 4XLHA 3JRAA 5BOXA 2DT6A 2CUZA 3FXQA 4BJTA 1T56A 2JN6A 3MZYA 5L3BA 1CF7B 3J7YJ 4G6QA 4JK1X 3F72A 4OMZA 3U1DA 5ICEA 5EEHA 2JPBA 4ZH4F 4QSHA 3GTJJ 1JTXA 2H8WA 2IS4A 3BG7A 3MCZA 1Z77A 4V2GA 4IJAA 3OL4A 4PJ0C 4B3AA 5E8IA 1IAWA 3L2RA 2A5YB 3HJEA 1BOAA 5HLGA 1D8JA 3DLAA 2Y9ZA 2VQGA 3DXJF 1MSEC 2XF5A 2DOFA 3C7JA 4A0ZA 4IPAA 4F7ZA 2ZNZA 1P4AA 2QBYA 2CO5A 4HNTA 1X1PA 3BROA 2F5DA 1J75A 1BA5A 3LA7A 4PJNA 3WG7H 2OD5A 1SFXA 2L7KA 3W6KB 3C18A 1T95A 1NK2P 1WJFA 4I76A 3VPRA 2FOKA 1W5CC 2QLZA 2WV1A 4O5VA 3WTXC 3GYHX 2JQ7A 3LL7A 3MN2A 3L2VA 2Y69H 5EEGA 2HQRA 4EVIA 2HPIA 3CJQB 4CCLA 3OIQA 3ZMVA 2ZNYA 4UV9A 2IJLA 3BTCA 1HA8A 1S5LC 1RIOH 2F4MB 2K4BA 3RPUA 5LEKA 2HPMA 1UJ8A 3M07A 2EV6A 3GX4X 1EA3A 4DQ2A 1I3QJ 5FLXZ 1P4XA 1UHWA 3LSGA 2Z33A 2PI0A 1SFEA 2CRGA 1HC8A 5JLXA 2VXDA 1XMKA 4UY8I 2V6CA 1FSHA 2HGCA 5K5RA 2E36A 2HFHA 1WJAA 2LR8A 1G3TA 4OU0A 2BEOA 2ZMEC 4Y17A 2Y0MA 2IBDA 2OV7A 2QM3A 4UV8A 4IOAF 3OV8A 1BI0A 1NG6A 5B3SH 1HBXG 3KZZA 2L9NA 1O7LA 4KITB 3J81K 4I7HA 1ZLJA 1SFKA 1B72A 2RVCA 1TWCJ 1HCRA 4A69C 1AOYA 3LA2A 3BY6A 2VB6A 1H89C 1Y8QB 4BXXJ 3OIOA 1IXSB 5LD2C 3M3YJ 4BH9A 1F43A 3Q9SA 3FZVA 2VJ5A 4PDKA 2JTVA 4RAFA 1IUYA 1P7JA 3BCAA 3O2PE 4JYKA 4FTHA 3CP2A 1X1BA 3F6VA 1MH4A 1K83J 2HI3A 4ENNA 1STZA 1W7PA 2JWTA 2BVLA 4BNCA 1LVKA 3K7AJ 5K7HA 4OIPF 3AL0C 4BJ6C 2B9SA 4HF2A 1GVDA 4E6KG 2Z1DA 1VI0A 1VQ8I 3R0JA 4D0PA 3GCMA 1T8IA 1QHGA 4BJ5C 4X6AJ 1P4WA 4XM3A 5DCMB 2EQRA 4Z2YA 3WTVC 2RNGA 3F6OA 2V1UA 1SFUA 1FIPA 3HOTA 3WTWC 1VQ6I 1BJZA 3OYFA 1EH7A 2O9LA 3JR9A 3BLYA 3W2AA 3I4MJ 4HQMA 2HOTA 3CDHA 5ICCA 1XDSA 4HNUA 3C1DA 4Y52J 2XF6A 4CZCA 2A6HF 1HW1A 2FMYA 2KP6A 4BDZA 4A6DA 5DYMA 1WGXA 2DCEA 5LEJA 3OYCA 3Q9VA 1IN5A 4NBQA 5DS9A 3OYBA 2EV0A 4HA8A 4XK4A 1Z9CA 1IRXA 2VI6A 3REOA 2RV8A 3EUKL 3KEQA 2R0QC 1F4KA 2WAQA 3GMEA 1I50J 2CFOA 3A01A 3JTGA 4BBSJ 3KYDB 1WJBA 3E6MA 3H1CA 2FX0A 1USTA 3S3MA 3G2BA 2KIFA 3P7NA 4AYBA 5AIQA 1KU7A 1OCRH 3CCMI 4C2TA 1Z3YA 2L3DA 2A68F 2FBHA 3I59B 1BC8C 2Z3YA 4LITA 1D1BA 2L7FP 5M5XJ 5HS8A 2RQPA 3HPHA 2DODA 2DT5A 1J2XA 2RNJA 3RTRA 4FE7A 3DEWA 3PQJA 1JGSA 2AXTC 4EATA 4W1UA 3HC7A 4RLFA 3TP0A 1FX7A 2M0CA 3QPLA 1I3AA 1ULYA 3LNQA 2F5VA 2FA5A 1ZK8A 1FYLA 3A0BC 3TGNA 5IYBJ 1DU6A 1ORKA 2LNBA 1JI8A 1SAXA 4F55A 4B3XA 1PUFB 1UFMA 2NNNA 4DGWB 4YIRX 1ZG5A 3W6VA 5D4RA 2XKPA 4OIQF 1B9MA 4EM2A 3OWTA 2ME6A 4MLOA 1HKSA 3WTSC 2KL4A 1TZLA 4IHTA 4S0HB 3PNYA 3EPZA 1DGRM 2ZB9A 1N78A 3DLLF 2M3AA 2CQNA 2XPVA 1KQ9A 2MC3A 2IEKA 4A3CJ 3F8MA 2ZSIB 3A0HC 1UHSA 2QSHX 2ISYA 2P7VB 3I58A 3BG3A 5J3LA 2L54A 3K69A 4FE4A 1CQTA 1E0EA 1T0FA 4CO8A 4XRSG 1OPCA 3R6SA 1RESA 1ETOA 2LRDA 2OZ6A 2DI3A 4I0AA 2G7UA 1P7IA 2BXYA 3WGGA 4IVNA 4XKCA 4BE1A 1JE8A 3E6DA 3COAC 2STTA 3IUOA 3HRUA 4HSRA 1IV6A 1IG7A 4XL9A 3LFKA 1SANA 2LKPA 4AIJA 1O3SA 2IS2A 4MFDA 3GFJA 4CZZA 1VQ4I 3E5QA 1WPKA 2B0LA 5L3CA 3OS0A 3JAMK 1FOWA 3IWZA 3FM3A 2WAFA 2MYSA 1EJ9A 4L9NA 2FU4A 4N4NB 3FXRA 3J7AO 3CTAA 2COMA 3PSFA 1JKRC 3JW4A 3I55I 1MJ9A 4JQFA 4A12A 3RKXA 2DQRA 2Q2EA 3G1OA 4OIOF 3ZQGA 4IHWA 4KT6A 1P9QC 3ABUA 1E3OC 3HHHA 3S14J 1NTCA 1WWXA 2Y30A 2IW5A 3K4JA 2MABA 2OPTA 3DBLB 3IV5A 4GFBA 2XAUA 1QZEA 4HG2A 2D45A 1OCPA 3H0GJ 2HTJA 2ZJ2A 5CVIA 1BR4A 2JZYA 2RDPA 3CCRI 3HSRA 3DCFA 1QPIA 1FEXA 4LMYA 2BXZA 1W36C 3MAJA 1PP8F 4R8HA 2QQ8A 2IT0A 4DIQA 2LTPA 3ROUA 2E7XA 1O3TA 3TW7A 5EG0B 2KJCA 4ITVA 3CC2I 2HVRA 2VC1A 5F1JA 5D6FA 1ZGAA 2ME0A 3SZTA 3H5RA 3W2WA 3HXLA 2E1OA 4EM0B 1QZYA 1JKOC 5C4JJ 3T5XA 2GAUA 2IS1A 4RS8A 3DBHB 1IXRC 3TW6A 2HWVA 2JMWA 4M71A 3JRFA 2OCEA 1VNDA 1R5HA 2W24A 2CQXA 1GT0C 4M6YA 1K4TA 2V6EA 1GV5A 1QQIA 2VASA 5K1YA 3MWMA 2PMUA 4LB5A 1GV2A 4BHBA 4B44A 3V7RA 2WWYA 2H1KA 2XGDA 1YTYA 2W00A 2OQGA 1FMWA 4IQJA 1FOYA 2F2EA 4IL6C 3WODF 4RBOA 5KCMA 4PJMA 2VJJA 5GTHC 2KJBA 1FTZA 3TO6A 4HEA2 5TGTA 4A93J 4ZYGA 1XSXA 5BQTA 4II2A 2R7SA 1XB4A 1IN4A 2M5WA 2XGCA 2WA0A 1FC3A 5BMZA 2KIQA 1YE9A 1FZPB 1R6RA 3F8NA 1Y0NA 2XPUA 3OSGA 2A6EF 1JKQC 3HGGA 1GXPA 2V9PA 4BE2A 2XAQA 2KDOA 4QTRA 3NWSA 5DCFA 5JHFA 3QOEA 4IEJA 5F1RA 3OYAA 4Q48A 3BR0A 3L7WA 4Y7NJ 3CJRB 3MMYB 5LHIA 5LRSA 3N97A 1IRFA 2M45A 4C3IJ 1G59A 3H9GA 2QZ8A 2Z99A 1TLHB 2R7QA 4JOMA 5IP7J 4ESBA 1RRJA 3C2GA 3GTOJ 5FFZA 4Y15A 3BWGA 1WZ2A 2E7WA 2CSOA 4DZJA 5B5EC 1YX5A 1R1UA 3L2CA 2EJRA 2MA3A 4DBQA 1U9OA 5F6FA 3L2WA 2XUBA 4C3HJ 4IRGA 2VXZA 4FT8A 4G9YA 3CJNA 5J1UA 1BIAA 2DPDA 1FLIA 2NVTJ 3O6BB 2MBFA 4IRIA 1LE8A 2HYJA 3MFKA 2EFNA 2KRHA 5GAHJ 2HOEA 1TQPA 2LP0A 3S1MJ 2IRFG 1FOKA 2DFFA 4I02A 3JSOA 5DDGA 4ETSA 1A35A 3DTIA 2WY7Q 3KEOA 2C6YA 1UELB 4QWQA 2VE8A 3QYBA 2CGPA 3I4PA 3CP8A 2ZFWA 4YELA 1OCTC 1WJCA 1ODDA 1ENHA 2H8RA 2M30A 2OJED 4OAZA 2UWMA 1HF0A 4PGGA 1OFCX 2UXXA 3KP2A 1XGSA 2H6BA 1OYWA 1U8RA 1ON1A 5E3OA 4CSWA 4DOZA 4Y13A 2A61A 2XGEA 1Z3XA 1Q1HA 2CQ7A 2X1DA 2VE9A 1FBUA 3OYMA 1DP7P 1SC7A 4HV5A 5F64A 3ABLH 3FDYA 3I9V2 2R7FA 1PJRA 1LPQA 2WC2A 1MBHA 1R9TJ 5K7ZA 2FE3A 1J59A 1QBJA 1ZYRF 4MGRA 4NQWB 2K9MA 4AU7A 3FIWA 4WF2A 1T38A 3MZ8A 1W0UA 1HOMA 2E71A 1XC5A 3Q0UA 2DYRH 4M3EA 1TL8A 3FBNB 1D0YA 4LG3A 4UUVA 5IOYA 1QVUA 1MIJA 4Z6YA 3QYFA 2WADA 2PN6A 1JT6A 2GOXB 4I98B 3RYRA 3TO7A 4LD5A 4AWXB 4EJUA 2NVXJ 3SYTA 3HRTA 3A2KA 2XSJC 3DKXA 3HOXJ 3SQNA 3ASOH 4CCNA 3J7ZI 3WGIA 1KU9A 1WI9A 2E34A 4A0YA 2IGKA 5A2QK 4EV0A 1LFUP 2VLAA 3BR1A 1SMYF 3RYPA 3K4LA 5IT9Z 3HTSB 3F8CA 3SFZA 4CHUA 3GXOA 2M4KA 5J6XA 2EH3A 3K10A 3VYSB 2HEOA 1TWGJ 2MGQA 1OCZH 2J5OA 3FM5A 4F92B 3HUGA 3ZN0A 5FLVA 2Y31A 2XRLA 3JRDA 5EGOA 4JBAA 3WTUC 1MMDA 5HDNA 2IAIA 4BEHA 2XC7A 1VQKI 5GADJ 3WE3A 2XAJA 5FGMA 4AC0A 1R36A 3KZYA 1TC3C 4G8XA 1HKTA 2PFBA 4B4CA 1D0XA 4G7HF 1XPXA 1MD0A 4A5NA 5K7FA 2CV0A 3HOWJ 1UMQA 2R4GA 1QGPA 4QPOA 3OR1C 4CCKA 3G6EI 4O3MA 5FB2A 4X0GA 1XTAA 1G3WA 3I53A 5CVUA 2CMPA 2K9QA 2R5YB 3HIFA 5EF6A 1X4PA 2CH0A 3E7LA 3M1EA 3FHNA 5CVRA 1X2NA 1BIBA 4M3FA 5M3FJ 4HLYA 4NHJA 2P8TA 3BCBA 3KFWX 4ZTJA 3ZGKA 3BTLA 2VKHA 5DD4A 1C0WA 4ENJA 2PJRA 1OR7A 1IN8A 2RAEA 1VTNC 1G2HA 2FEZA 2CUJA 3BR5A 2XAHA 1ACIA 2M87A 5FRMA 2W48A 4HPQA 1X1AA 3Q3SA 1Y0UA 3LSJA 1XS9A 3JSPA 3MKLA 2GA1A 4UVBA 2HZDA 4PJLA 2GZWA 3H3VK 3G4SI 4B8XA 4F3QA 5AONA 1U6GA 3CDLA 3PFYA 2HVQA 2O8XA 1EV7A 3M7GA 4UVCA 4C3JJ 2R5ZB 2ZSHB 1D1AA 4CCJA 2VOOA 2BW3A 3ISPA 2KKOA 4RM2A 3PO2J 3TQNA 5DUKA 3GFMA 4L9JA 5TISC 4EMSA 4BYYA 2QWWA 1YYVA 3B6CA 4MIMA 1L3LA 3ZQLA 4CCMA 2IP2A 5LFAA 3V4GA 2FQ3A 4HRIA 3HM5A 2JK3A 4KMUX 4M9ZA 4NC7A 1POGA 2HR3A 2ZJRF 2BYVE 2J5PA 2V1XA 3GLXA 2RN7A 1I1SA 1X19A 2W1OA 2DA2A 3FXMA 1SD6A 5D5XB 2W57A 4CA0A 2VUMJ 3CUOA 3CCEI 4AIKA 2ELJA 3GTLJ 4XNFA 2HKOA 4RGUA 5E20A 5IT3A 3ZR8X 5HOOA 1IJWC 4GRIA 4JP0A 3HHGA 4IO9F 3QPTA 5F0CA 3FMRA 2MH9A 3V8KA 4B48A 4P55A 3EUHC 4BQAA 2LFBA 5JLWA 1Y8RB 1PUEE 3RZOJ 3KP5A 1K6OA 2NVYJ 3HPGA 4M9XA 3LSKA 2UUZA 3BZKA 1HSJA 1S7AA 1SAUA 1MMNA 2WTEA 5FFXA 3GTKJ 1ETQA 5IPAA 1LNWA 3KLNA 4UUSA 2Y0SA 3PFIA 1N77A 4XRMA 3WGHA 1JJ8C 1M1EB 3TL4X 1FJLA 1YRNA 3TO9A 1XGNA 4J19A 1R1VA 3CC4I 1MNEA 4ZDLA 1TWAJ 2DMPA 3IHUA 4BUPA 1ZN2A 3ZXSA 1D0ZA 1RUNA 3GBGA 1EF4A 2LDUA 5E3MA 3S8PA 1KQ8A 5J8CA 2IVMA 1ETKA 1V54H 4B47A 1TNTA 4A3KJ 1V5EA 3EUAA 4D7NA 4FASD 1LEAA 2JRTA 3AFHA 2NNYA 1FNNA 3WTZA 4YEJA 1LJ9A 3IRQA 4WXDA 4KISA 3BQYA 2O03A 3ZP5A 3FHZA 3AG1H 3GO5A 2X9DA 3H9QA 3S3OA 2ESHA 4IZZA 3GTGJ 3S15J 2JRMA 3O3KA 3ESWB 4F91B 2A3SA 3TBIA 2LKXA 2ZC2A 3WU1B 5EEAA 4L0ZB 1TQMA 1X1CA 2VBZA 2XASA 3GZ5A 2VOPA 3OYIA 5HDGA 1D1CA 1NHAA 2QGUA 2W82A 3K70D 4IKFA 2KISA 1KU3A 1X1DA 4XLNF 5D6EA 4G94A 2Z9OA 2QF7A 2EFWA 1VQPI 3K1PA 4A5MA 4RGSA 2JA8J 2ICWG 3CCLI 4F52A 2O8KA 4GXOA 3DTEA 4RGXA 2R7TA 2XIGA 2IPQX 1IXCA 4XOPA 3HGYA 1MMAA 3S2DJ 3DP7A 3QRFF 3GFLA 3LFUA 4V19K 2EZKA 1F9NA 4RM3A 3OYDA 4KDPA 4BY7J 3CCYA 4IHVA 5IOZA 2F48A 4NUBA 3UNGC 1JHFA 3W2VA 3R0AA 5J4YA 3OYHA 1AKHB 2CQQA 2LBFA 5JVGF 2CS3A 3T0YA 1OKRA 3EQLF 1BR1A 1H88C 5F0FA 4BGDA 5CQEA 3A03A 3CLOA 3CCQI 3CF5F 1WHUA 2Z2SB 3HDDA 1U5TA 4BHCA 1MSFC 1JTYA 2KPMA 2LVSA 3X2QH 2DBBA 2QUFA 2M1BA 1WKMA 1KZHA 5IYCJ 1B6AA 3DV8A 5E1WA 3CF2A 4JX6A 2EIKH 3GZ6A 5KAIC 1QVTA 3MQ0A 1O57A 2G0EA 3S93A 5H20A 3JCUC 3I54A 3N4MA 2IGNA 4BXFA 1EH6A 1S3JA 4HX8A 2AO9A 2ELKA 3BTIA 1WJ5A 1JUPA 1BN5A 1BW6A 4P9UA 2UV1A 3RPQA 5K5OA 2BY0A 3GLLA 1UZCA 1B8IB 2NOGA 5GPCA 1K78A 4AVZA 2K02A 4LG0B 2QVOA 3K4NA 1Z7LA 2Y48A 2DK8A 2X1EA 3EETA 2WAQN 1CGPA 2JA2A 3KZIC 1HDDC 5DTDA 4OOIA 1D3YA 4AVPA 4N0BA 2HZTA 1NG7A 2P0WA 1R22A 3P9CA 1QO0D 4AYBN 2WB1A 1QRYA 3HRSA 5E1XA 1IDYA 1FYKA 1ZRCA 2CUFA 4MQVA 1Z67A 3ERMA 4XR6A 4YFXF 4HSTA 3WTTC 1Z05A 3DU5A 4HZFA 2QYOA 5BPIA 1VQNI 2GXBA 1SD5A 2A07F 4A0XA 1WH5A 1OQYA 1BBYA 2D1HA 3PM1A 2WY8Q 4BQQA 1HW2A 3HKZA 1FT9A 5FKKA 4CYCA 1BI1A 2LH9A 3BG9A 1TWHJ 4E7IA 2CU7A 2XF7A 1ETYA 2TDXA 4N4OB 5BPDA 3V7CA 1VQMI 3S2HJ 4JX4A 4H0EA 1BJAA 3QU3A 2PMZA 4LK1F 1BOBA 1ZTRA 2P6TA 2R92J 1LB2A 1B9NA 2BBYA 3LOCA 4M72A 3BPXA 4PZJA 4KYWA 4DW6A 4U7BA 3RQIA 4IQ4A 3CLQA 2A05A 3G1MA 1WFXA 2QQ9A 2ZMEB 4M73A 2E1MC 1U2WA 4XRSA 2Z5UA 2X48A 1X3UA 4KIFA 2CW7A 1D5YA 2K7LA 2HYFA 2K3FA 2HTSA 4CUGA 1CF7A 2BGCA 1UG0A 3H9JA 4HF0A 1OISA 2OU2A 5DM6F 3DWLE 2F6CA 3ZMDA 2Q0OA 1PYVA 2YPRA 5HS7A 2G9WA 4M6VA 2DPUA 1S8NA 2IGMA 4QLCU 1OCCH 2ISZA 1Q1VA 4L18B 4BHPA 1Y6IA 1R00A 2O5RA 3M8JA 2GIVA 2PLYA 2R7ZJ 1XCBA 3AL0B 3MKWB 3S17J 2EZHA 3BJAA 2R7RA 1XMAA 4LFUA 3KX2A 1AWCA 4C9YA 3JRHA 1Z21A 1RPWA 3AG2H 1TBXA 3IH2A 3L00A 4KN4X 1BL0A 3HOUJ 1PVEA 2K85A 5EZGA 1HW5A 3BG5A 2Q8KA 1XN7A 2OQRA 1RC9A 3K9TA 2NOJB 2ID6A 3AG4H 4CH7A 2L9RA 3Q0WA 2XSDC 4ZYEA 5J1RA 4U88A 3OYEA 3F21A 4FX4A 4E4HA 1EKEA 3PSIA 4S04A 3TEDA 1A6IA 2O7OA 3F3XA 1YQAA 2O0YA 2VPRA 5H6QA 2VBWA 5ICFA 3T8TA 3CJTB 2F4IA 3A1YA 3OMYA 4M6XA 3LA3A 3HOYJ 4D7MA 3HOSA 2A69F 2RGVA 1S7OA 2UZKA 5CQGA 4GYIA 2YX4A 1FOXA 4W97A 2NVUB 3HYIA 2OCCH 4J00A 1Z91A 1J09A 1HSTA 3MKZA 2MW8A 5D5UB 4ZDOA 3Q0VA 1I6XA 4IX7A 5F04A 3NARA 4GYGA 2L9SA 2MH2A 3VYUB 4AIDA 4BDYA 1WJDA 1Y1VJ 3RQ4A 3G71I 4CICA 2H1LA 4HAMA 4N9IA 1V5GA 3WE2A 3W3CA 1U8BA 2DAOA 2DOEA 3FX3A 2E60A 5IP9J 3QYEA 2ZKZA 3SFIA 2HDDA 1SVLA 1FP2A 2DLLA 2EK5A 3ULQB 5TJJA 1MMSA 2P5LC 2AQFA 1IUFA 3DPUA 1X3WB 1F36A 2KLOA 3IKVA 4FX0A 4A3EJ 4ZZLA 2VODA 1XD7A 4NC6A 5CJ9A 3P9KA 3D5SC 1IW7F 1XCVA 2KRFA 3BTJA 3OS2A 3CMEI 2LY1A 5KVRA 4XKBA 1DPRA 3SDGA 1ZG1A 5DCMA 5B66C 5BNGA 1HXDA 4NC8A 2PJRB 2M9HA 3ZMTA 2DA7A 5EDNA 1H0MA 4I01A 2X6XA 4MEYF 3W6JB 4UUTA 2R7UA 4E7KA 4EM1A 1W36D 3BP8A 1GDTA 1MW7A 1YW7A 2VQLA 1P2FA 3IAM2 2W7NA 4U0WA 1FIAA 3DFGA 1J7KA 3FKIJ 2FBIA 3CQZJ 5J4VA 3BR3A 1TWFJ 4CDGA 5ILVA 1KA8A 1SD7A 2V9VA 2L7MP 2ZXWH 4A3IJ 5DM7F 2ZXHA 2IS6A 2PG4A 1WJEA 3M4OJ 4YRVA 1SEUA 3IAS2 3UKGA 3MD2A 4WXHA 2CG4A 4XSXF 1I1GA 4KNYA 2VKVA 1MDMB 4A3BJ 1ETXA 3I56I 4AIHA 2KRCA 2EZIA 3D0SA 4ZZDA 1U78A 5GPAA 2K5CA 3DEUA 2VKDA 3I59A 4E7LA 1BR2A 2I8DA 3KPHA 4RAGA 3ECHA 1RKWA 1ZKGA 3LSMA 1V4RA 1JUMA 1MZBA 3RPUD 3TP3A 2DTZA 2K3PA 4YFKF 2M7AA 4ZDPA 2LREA 5IT9K 3PL8A 4JX5A 4BE0A 1U0JA 4MTDA 1U5TC 3D1NI 3I3LA 1O3RA 3HEFA 1R7JA 2E2HJ 3GZNB 3PNTA 3WG9A 3FXLA 4LLLA 4A3JJ 1GXQA 3Q5FA 1FPQA 2DJIA 2L4MA 1GUUA 1PUFA 1ZELA 2L7ZA 3VSLA 2E19A 1MMGA 3MVPA 1IV8A 2KHMA 3H5AA 1A04A 2CJJA 1FBQA 4FCYA 2LY2A 3HTUA 1LDKB 1K7AA 3SZGA 2CV2A 3U2RA 5JI6A 3H35A 1E2XA 2KDZA 1FTTA 5F08A 2DDBA 1YRNB 2K4JA 1YITI 1RUOA 2QBYB 4UB6C 4XOTA 5L3EA 2FRHA 2VL8A 2M0MA 4RB3C 1YJWI 3F22A 2JSCA 3A02A 1YFHA 2NS0A 4FISA 2XB0X 4KUMA 2EA2A 4G6DA 5K5QA 3KP3A 3G73A 3CO7C 3PIPF 3CMAI 1YIOA 4U0YA 3DU6A 4HQEA 1G4DA 5AIPA 5KNLA 2R93J 2DQLA 3KP6A 1A36A 2FBKA 2P5VA 1KONA 2VQHA 3FXOA 2RC4A 1FP1D 4XLPF 4RB0A 2CW8A 3RZDJ 4Y3OA 1ZARA 3WHCA 1G8XA 2X6WA 3PUBA 2HNHA 2R7OA 3FK6A 3FK7A 4IXAA 2HXOA 3I64A 2IA2A 2HOAA 3A4CA 3DBRB 3L09A 2K9NA 3IP4B 4OMYA 1IZ1A 1YO5C 2P4WA 3FXJA 3MKYB 2D1VA 3HOVJ 2QSFX 3RKWA 1HKQA 4M3DA 4GCVA 4II3A 1K4SA 3E6BA 1RI7A 1MBFA 1P92A 4EGZA 1I5ZA 2EINH 4LB6B 5FKOA 4HDUA 3BC8A 3T8RA 4KFCA 4RAYA 5M5YJ 4A6EA 1B72B 4ABZA 4P96A 2GBYA 5J40A 1YG2A 4E70A 3CUQA 1WVRA 3GF2A 1DDNA 5CLSA 1O4XA 2E2IJ 2ECBA 4R1HA 2WV0A 1R4NB 2LLKA 3ABTA 2VKEA 1FMVA 3K2AA 4Y33A 4RA2A 4F93B 5L3DA 1G3YA 2OZUA 1WI3A 5EG0A 1LFBA 2H09A 1T0FC 2I5UA 4PFOA 2M7BA 3QODA 5CPRB 2MSYA 1W7PB 3IKTA 2WAEA 3KCCA 5HODA 4XN0A 2XROA 4NB5A 4XBFA 5FLMJ 4U87A 2VQCA 1VQLI 3NRVA 3L2UA 5F27A 5H2FC 2MFZA 2ZXIA 3H92A 2FJ1A 2R7DA 2HYGD 4ASNA 3JRIA 3UR3C 3DPTA 3S3NA 2ZBKA 3TOBA 3ZOBA 1UCRA 4RDUA 4B1RA 1WSUA 4LLGF 4XMYA 1IN6A 2VJIA 2KMUA 4Y4RA 3TKYA 4DNCA 1U3EM 4I0BA 2E1NA 2M34A 2LC2A 3F8BA 1X2MA 1F1ZA 1RR7A 5HLIA 2KIUA 3PUFA 3ZQCA 3VWBA 5F0HA 1UAAA 1HLVA 2FSWA 5KK1A 2ID3A 3WU2C 3OY9A 3CMMA 1IN7A 2YU3A 3B73A 3C3WA 4ON0A 2OF7A 2BE5F 2ZJQF 2DN0A 3A01B 3J80Z 2IA0A 2LKSA 4D1QA 3QPSA 1LKXA 4MQ9F 1LDDA 4V2FA 3H5NA 5GAEJ 4MFEA 4P1WA 1YJ9I 5A2QZ 2YU9J 4E7ZA 5ICGA 1E3PA 5GP9A 3ZQFA 3DEEA 4I6ZA 4XN3A 1TT5B 2W25A 1KYWA 1X58A 2CFXA 2CWEA 1ZHFA 1XDUA 2G7HA 3RSNA 3KE2A 1S72I 2GXGA 5BS6A 1ZH5A 4RB1A 2YS9A 4CXFA 2E35A 3PQKA 2MD5A 1MBEA 3SDBA 1W1WE 4YG2F 3CCSI 1QU3A 4KMFA 2M2EA 4GDFA 5FLXK 2VT2A 2DJNA 4WWCA 1ERDA 1ZG3A 4HF1A 3IRRA 4RAZA 4MNUA 3QQAA 4HLXA 1FBSA 2ADUA 4BS9A 2DA3A 4L9TA 2LF7A 3FWEA 5JHUA 2DW4A 1VFCA 2XPWA 2KIMA 2JUGA 3WTYC 2DMUA 1QZZA 5L3GA 1TP4A 2K40A 2OTJI 1TNSA 2CQKA 4DYRA 3E97A 5DD8A 3CCUI 2CV1A 4G12A 5DEQA 5B1AH 4LGWA 4L9VA 3RJPA 3GTQJ 3V8LA 4HOBA 4M74A 4XONA 3E0JB 2BVMA 3LAPA 3BR6A 2DMNA 2Y0SN 1YHQI 2GM4A 2X51A 1DP3A 4KICA 1A5JA 4FETA 2VN2A 3OOPA 2V1NA 4BQNA 5D5WB 1ZGJA 5LHGA 4KA4A 1S7EA 2IXSA 5LGNA 1W5SA 4XRFA 4GGGA 2E2JJ 1JKPC 1IGNA 1XMXA 2IA1A 4FHTA 2STWA 1Z0XA 3OYJA 1H9GA 5E3NA 2HQAA 3JREA 5FKMA 2GA2A 2KQRA 5CVVA 4A3FJ 4IHYA 3E3VA 3K70C 5LGUA 4HYEA 1T33A 2O61A 1YIJI 1MJAA 2Q1ZB 3G1LA 2Y2ZA 4WCGA 2ZJPF 4XORA 4IHSA 1WRJA 4ZC3A 2VC0A 3SZPA 1Y1WJ 1YS7A 1Z6TA 3T1BA 3RIRA 3AKZA 4NQWA 1JJ6C 4U0VA 4L0YB 5EYRA 2Y75A 2EFOA 4RGRA 1T98A 1VQ5I 2PBIA 4Q4ZF 2ELHA 4L5JA 5CVJA 4L5EA 4XLFA 1IRZA 1I39A 4LIVA 3ECOA 5JFRA 4OAYA 2Q2EB 2R7WA 1BC7C 5H6RA 1KYZA 2AHQA 4Q47A 2PJPA 3VSKA 1DGWY 3HOZJ 2XVCA 9ANTA 5EZHA 5C4XJ 4M9SA 4BU2A 2X4HA 4KJZA 1IF1A 4M3GA 4CYDA 2BV6A 4QPQA 1WH7A 3PNVA 4UB8C 4ZYHA 3J7AY 4PSWA 1QNTA 3KP4A 3EYIA 1RZ4A 5J1YA 1ZGWA 2V9KA 3OS1A 2R3SA 5LGTA 2XKOA 2NYXA 1V3FA 1W5TA 3H3ZA 5LHHA 3KP7A 4XLAA 1VQOI 3TDUC 4A3MJ 5C3EJ 1LQ1A 4HBLA 3B6AA 1XSDA 4H4KC 1KQ0A 4BBRJ 3DTKA 3FXUA 4WX9A 3M8FA 2DFHA 1SD4A 1I27A 2JA7J 4BQOA 5IP6A 2W84A 3U21A 1IO2A 2DA4A 1TW2A 3DKWA 3H3UA 4BY1J 1RR8C 3S1RJ 4YIIA 2K27A 5IY5H 2R5YA 2EA4A 3AAFA 4HDVA 2YR2A 4L5IA 5LBQA 4E7JA 1JGGA 3LMMA 2O3FA 2PX9A 1DUXC 3U1KA 1AU7A 3E5XA 1JUSA 1BW5A 4LK0F 2L02A 3DQVC 1OLTA 1R58A 3CMYA 2NRAC 4RMNA 5KHDA 3FMQA 2F5FA 5M3MJ 4KT5C 1ON2A 3WHBA 3PO3J 1AA7A 4BAYA 1X3ZB 5D8LB 4ENKA 3I71A 3CCJI 2FOWA 4E7SA 4D9JA 5EJCA 2WB1N 3VODA 2HU9A 2OUMA 1PP7U 2X1CA 2X85A 4B43A 3S2WA 4ZYDA 3HZJA 2QKLB 1LVAA 4EJVA 3HBLA 4AD9A 1OCOH 2FNPA 4G7OF 3HKZN 2LF8A 2R5ZA 3G3ZA 3AG3H 4HNVA 2DK5A 4A3GJ 2M8GX 1T2KA 2YX7A 1RNLA 2LG4A 3CCVI 2JPCA 2H27A 1E3HA 3TDZC 5JR3A 1BI2A 3CUQC 2BY2A 3J81Z 3K4KA 2PMZN 3ERED 2PQ8A 4EGYA 2V7FA 5DV5A 2QCOA 4E7HA 4PSXA 2BY3A 1XX5A 2OC6A 2R7VA 1UB9A 3BZCA 4B09A 5J8FA 1JT0A 2NAZA 1G6NA 3GFIA 3JRGA 2DFIA 3NAUA 4ENMA 1FWZA 2EWNA 3QWLA 4D5CA 1LE8B 2MD0A 3K4MA 4MEXF 3BOQA 2FMLA 1JHHA 3NWTA 4ZYAA 4DBRA 5HLTA 2O6GE 3ZCOA 3K0LA 3D5LA 1OR7C 2VBXA 3C2HA 3CDIA 4YIFA 2FQ4A 3DKYA 2ZXJA 1YX3A 2A6TA 1ZREA 1VZ0A 3LSIA 3ZN1A 2L0KA 1I6HJ 1LFPA 3VDXA 2EV5A 1ETWA 1SVMA 4EEFG 3IH4A 3JTHA 1QPMA 4D5FA 2EB7A 1D8KA 4DYQA 1H9TA 2NS8A 1MBGA 3I0TA 4PCQA 2ZFUA 1AHDP 4C2MJ 1H8AC 2LY9A 1REPC 1R1TA 3KIOA 4U7DA 2NVQJ 2M8EA 3S1NJ 2CUEA 2HQNA 5FD5A 5D5VB 1D5VA 3H36A 3E6CC 1O3QA 1MH3A 2E1CA 2XAFA 4HX4A 1L0OC 2L9VA 2XHKA 2QENA 1R71A 3L1PA 1JXSA 3EDPA 2CYYA 2F5EA 4AUXA 2NXNB 1UG2A 1UHMA 3BT9A 3N05A 3R61A 4LJZF 5HVQC 3GUDA 2HOSA 3P9IA 2KFDA 3RKYA 3V42A 1K61A 1MGTA 1N75A 4OWRB 4IF4A 3ZMZA 3K1MA 1FYMA 3GTPJ 3IWFA 3PJRA 1HQCA 2XRNA 1OMIA 5ED4A 2JA5J 4I99C
chains in the Genus database with same CATH topology
1LDJA 3ELKA 1B4AA 1KU2A 1ONVA 1Z1DA 4MHGA 1ZAOA 4UXNA 3QOPA 5ERIA 3BZ6A 1KGSA 3BJ6A 3CUQB 3SXYA 4YFNF 3ZPLA 4CGZA 2XAGA 4RB2C 3MZHA 2VBYA 3ZMSA 4G7ZF 1XGOA 1F5TA 5LRRA 1TQIA 5JVTA 4O6JA 1USSA 2ESNA 5D4SA 1XSVA 3GW2A 5HDKA 1Z6RA 5FD6A 2EFPA 2VT3A 4KIBA 3F23A 2VONA 4OINF 4S05A 4MTEA 3RDIA 3EUHA 1ZRDA 2PEXA 4ESFA 1T6SA 5HLHA 3LQRA 3JAMZ 3V8JA 2LSOA 4K2EA 2FF4A 3U9GA 1S6LA 4LG0A 1GHCA 3F8FA 4HW0A 2DTRA 2XV4S 3KETA 2ZO4A 1FY7A 2YSRA 3TOAA 1TW3A 3M8EA 4P5OA 1J9IA 2MLGA 1FSEA 2JT1A 3VEPA 6PAXA 2UXNA 2AXLA 5ILSA 4A2UA 4I2OA 1IRGA 3QU6A 4ESJA 1K79A 2HKXA 3VOEA 2P6SA 1YW9A 5CYVA 4WK8F 3GEZA 4IRHA 1SMTA 1R5GA 3LAJA 2PMHA 3BJOA 2ZMEA 2P5KA 3K1NA 1B1BA 3LSTA 5FO5A 3FMSA 2FNAA 2DU9A 4EJWA 3QP5A 4I09A 3V7SA 5L3FA 2V79A 1XGMA 1E17A 5ILUA 4OIRF 1LEBA 4LLNA 2XGXA 2OAZA 1ZRFA 3DPLC 2EFQA 1W7PD 4EJOA 2F5CA 1EH8A 3HRMA 3FF5A 3DF8A 4R79A 3HSEA 3QPHA 1J0RA 1MKMA 1BI3A 2QQAA 3R4KA 4N9HA 4EQQA 4KIGA 3CO6C 2L4AA 3VFZA 3NEUA 3QAHA 4BXUA 3SHFA 3VB2A 3IC7A 3GWZA 4XSZF 3RI4A 1P6RA 1BM9A 1S29A 2ZCWA 2OA4A 1GVJA 3WU0A 3J80K 4UVAA 4UHTA 2W85A 2L01A 4HX7A 2OBPA 2P7CB 3ML6A 1YLFA 3HSFA 1OYIA 2GQQA 4EJTA 1G3SA 3IL2A 4GO1A 2HDCA 4WXCA 3E5UA 3QP6A 1U5TB 3EYYA 3M9AA 2ACJA 3KLOA 4Q5SF 5D8KB 5E8GA 5LLQA 3NQOA 3ZQ7A 1YW8A 3GVAA 2HS5A 2MLKA 2K86A 3BDDA 3L9FA 1Z7UA 1K78B 4TV7A 2ETHA 5DUIA 3LWFA 2RKHA 2FXAA 1O7FA 5E1ZB 4PGHA 3ZMUA 3I5UA 5HS9A 4KN7X 2X0LA 1TTYA 3B02A 3BPVA 1R23A 3LQQA 2H6CA 2H94A 1T39A 2D2WA 1PDNC 1J5YA 4HV6A 2GWRA 2CW0F 1DPUA 2DO7A 5E18F 1MDMA 1B59A 3MEXA 4UNOA 1YS6A 4P9FA 1ZLKA 3R60A 5TRDA 2QQBA 1WQ2A 5E17F 1W4MA 1MJBA 2V1DA 1OYYA 3K2ZA 5BOXA 3FXQA 1CF7B 3MZYA 5L3BA 4G6QA 4JK1X 3F72A 4OMZA 3U1DA 5ICEA 5EEHA 2JPBA 4ZH4F 3MCZA 4IJAA 1IAWA 5E8IA 2A5YB 1BOAA 5HLGA 1D8JA 3DXJF 4A0ZA 3C7JA 4IPAA 4F7ZA 2ZNZA 1P4AA 2QBYA 2CO5A 3BROA 2F5DA 1J75A 3LA7A 2OD5A 1SFXA 3W6KB 3C18A 2FOKA 2QLZA 4O5VA 3GYHX 3WTXC 5EEGA 2HQRA 4EVIA 3ZMVA 2ZNYA 4UV9A 2IJLA 1RIOH 2K4BA 3RPUA 5LEKA 2EV6A 3GX4X 4DQ2A 5FLXZ 1P4XA 1UHWA 2Z33A 2PI0A 1SFEA 1XMKA 2V6CA 1FSHA 2HGCA 5K5RA 2HFHA 4OU0A 1G3TA 2BEOA 4Y17A 2Y0MA 2QM3A 4UV8A 3OV8A 1BI0A 1HBXG 3KZZA 1O7LA 3J81K 4I7HA 1ZLJA 2RVCA 1AOYA 3LA2A 3BY6A 1IXSB 4BH9A 3Q9SA 3FZVA 4PDKA 2JTVA 1IUYA 3O2PE 3F6VA 4ENNA 1STZA 1W7PA 4BNCA 4OIPF 4HF2A 3R0JA 4D0PA 5DCMB 1P4WA 4Z2YA 3WTVC 3F6OA 2V1UA 1SFUA 3HOTA 3WTWC 1EH7A 4HQMA 3CDHA 5ICCA 1XDSA 3C1DA 2A6HF 1HW1A 2FMYA 4A6DA 5DYMA 5LEJA 3Q9VA 1IN5A 2EV0A 4HA8A 1Z9CA 3REOA 2RV8A 3KEQA 1F4KA 3JTGA 3E6MA 1USTA 2KIFA 3P7NA 5AIQA 1KU7A 2L3DA 2A68F 2FBHA 3I59B 1BC8C 2Z3YA 5HS8A 2RQPA 2DT5A 1J2XA 2RNJA 3RTRA 3PQJA 1JGSA 1FX7A 1ULYA 2FA5A 1FYLA 3TGNA 2LNBA 1SAXA 1UFMA 2NNNA 1ZG5A 5D4RA 2XKPA 4OIQF 1B9MA 4EM2A 1HKSA 3WTSC 4IHTA 1KQ9A 2MC3A 3F8MA 2ISYA 2P7VB 3I58A 2L54A 3K69A 1T0FA 4CO8A 1OPCA 3R6SA 4I0AA 2OZ6A 2DI3A 2G7UA 3WGGA 4IVNA 1JE8A 3E6DA 3COAC 2STTA 3HRUA 3LFKA 2LKPA 4AIJA 1O3SA 3GFJA 4CZZA 3E5QA 2B0LA 5L3CA 3JAMK 3IWZA 3FM3A 4L9NA 2FU4A 3FXRA 3J7AO 3CTAA 2COMA 3JW4A 1MJ9A 4JQFA 4A12A 3RKXA 2DQRA 2Q2EA 4OIOF 3ABUA 3HHHA 1WWXA 2IW5A 2D45A 2HTJA 2ZJ2A 5CVIA 2JZYA 2RDPA 3HSRA 4LMYA 3MAJA 1PP8F 4R8HA 2IT0A 3ROUA 2E7XA 1O3TA 2KJCA 2VC1A 5D6FA 1ZGAA 3SZTA 4EM0B 1QZYA 3T5XA 2GAUA 4RS8A 1IXRC 2HWVA 4M71A 1R5HA 2W24A 4M6YA 5K1YA 1QQIA 3MWMA 2PMUA 4LB5A 4BHBA 3V7RA 2WWYA 1YTYA 2OQGA 2F2EA 3WODF 2KJBA 3TO6A 4ZYGA 1XSXA 5BQTA 1XB4A 1IN4A 2M5WA 1FC3A 5BMZA 1FZPB 3F8NA 2A6EF 1GXPA 2XAQA 5DCFA 5F1RA 4Q48A 5LRSA 3L7WA 5LHIA 3N97A 1IRFA 2M45A 2QZ8A 2Z99A 1TLHB 4ESBA 5FFZA 4Y15A 3BWGA 2E7WA 2CSOA 1R1UA 3L2CA 2EJRA 2MA3A 5F6FA 2XUBA 4IRGA 2VXZA 4FT8A 4G9YA 3CJNA 1BIAA 2DPDA 1FLIA 3O6BB 2MBFA 4IRIA 3MFKA 2EFNA 2HOEA 1TQPA 2IRFG 1FOKA 4I02A 3JSOA 5DDGA 4ETSA 3KEOA 2C6YA 4QWQA 2VE8A 2CGPA 3I4PA 2ZFWA 1ODDA 2M30A 2UWMA 4PGGA 2UXXA 3KP2A 1XGSA 2H6BA 1OYWA 1U8RA 1ON1A 4Y13A 2A61A 1Q1HA 2VE9A 1FBUA 1DP7P 4HV5A 5F64A 2R7FA 2WC2A 2FE3A 1J59A 1QBJA 1ZYRF 4MGRA 4WF2A 1T38A 4UUVA 2PN6A 4I98B 3RYRA 4AWXB 3TO7A 4LD5A 4EJUA 3HRTA 3SQNA 3WGIA 1KU9A 1WI9A 5A2QK 4A0YA 4EV0A 1SMYF 3RYPA 5IT9Z 3HTSB 3F8CA 3SFZA 4CHUA 3GXOA 5J6XA 2HEOA 2J5OA 3FM5A 3HUGA 3ZN0A 4JBAA 3WTUC 5HDNA 3WE3A 2XAJA 5FGMA 1R36A 3KZYA 4G8XA 1HKTA 2PFBA 4G7HF 1MD0A 4A5NA 1QGPA 4O3MA 5FB2A 1G3WA 3I53A 5CVUA 3HIFA 3M1EA 5CVRA 1BIBA 4HLYA 4NHJA 2P8TA 3KFWX 5DD4A 1C0WA 4ENJA 1OR7A 1IN8A 1VTNC 2FEZA 2XAHA 2M87A 1Y0UA 3JSPA 2GA1A 4UVBA 2GZWA 4B8XA 5AONA 1U6GA 3M7GA 2O8XA 1EV7A 4UVCA 2VOOA 3ISPA 2KKOA 3TQNA 5DUKA 3GFMA 4L9JA 4EMSA 4BYYA 2QWWA 1YYVA 1L3LA 2IP2A 3V4GA 2FQ3A 4KMUX 4M9ZA 2HR3A 2BYVE 2J5PA 2V1XA 3GLXA 2RN7A 1I1SA 1SD6A 5D5XB 2W57A 3CUOA 4AIKA 2HKOA 4RGUA 5E20A 5IT3A 5HOOA 3HHGA 3QPTA 3FMRA 2MH9A 3V8KA 4P55A 4BQAA 1PUEE 3KP5A 1K6OA 4M9XA 1HSJA 1S7AA 2WTEA 5FFXA 1LNWA 3KLNA 3PFIA 3WGHA 3TO9A 1XGNA 1R1VA 3IHUA 1ZN2A 1RUNA 2LDUA 1KQ8A 5J8CA 2IVMA 1TNTA 1LEAA 2JRTA 2NNYA 1FNNA 3WTZA 1LJ9A 3IRQA 4WXDA 3ZP5A 2O03A 3FHZA 3GO5A 2ESHA 3O3KA 2A3SA 3WU1B 4L0ZB 1TQMA 2VBZA 2XASA 3GZ5A 2VOPA 5HDGA 1NHAA 1KU3A 4XLNF 5D6EA 4G94A 2Z9OA 2EFWA 3K1PA 4A5MA 4RGSA 4GXOA 4RGXA 2XIGA 2IPQX 1IXCA 3DP7A 3QRFF 3GFLA 1F9NA 4KDPA 1JHFA 3R0AA 3T0YA 1OKRA 3EQLF 3CLOA 1U5TA 4BHCA 2DBBA 2QUFA 2M1BA 1WKMA 1B6AA 3DV8A 5E1WA 3GZ6A 3MQ0A 1O57A 5H20A 3I54A 3N4MA 1EH6A 1S3JA 4HX8A 1BN5A 4P9UA 5K5OA 3RPQA 1K78A 2K02A 4LG0B 2QVOA 2Y48A 2DK8A 3EETA 1CGPA 4OOIA 1D3YA 4AVPA 4N0BA 2HZTA 1R22A 3P9CA 1QO0D 3HRSA 5E1XA 1FYKA 1ZRCA 4MQVA 4YFXF 3WTTC 1Z05A 4HZFA 2QYOA 5BPIA 2GXBA 1SD5A 2A07F 4A0XA 1BBYA 2D1HA 1HW2A 1FT9A 1BI1A 2TDXA 5BPDA 3V7CA 4H0EA 1BJAA 3QU3A 4LK1F 2P6TA 1LB2A 1B9NA 2BBYA 4M72A 3BPXA 4PZJA 4KYWA 4U7BA 2QQ9A 2ZMEB 4M73A 1U2WA 2Z5UA 1X3UA 4KIFA 2K7LA 2HYFA 2HTSA 1CF7A 2BGCA 4HF0A 2OU2A 3ZMDA 2Q0OA 2YPRA 5HS7A 2G9WA 2DPUA 1S8NA 4QLCU 2ISZA 4L18B 4BHPA 1R00A 2GIVA 2PLYA 1XCBA 3BJAA 1XMAA 4LFUA 1AWCA 1TBXA 3L00A 4KN4X 1HW5A 2Q8KA 1XN7A 2OQRA 3K9TA 4ZYEA 4U88A 3F21A 4FX4A 4S04A 3F3XA 1YQAA 2O0YA 5H6QA 2VBWA 5ICFA 3T8TA 4M6XA 3LA3A 3HOSA 2A69F 2RGVA 2UZKA 1S7OA 4GYIA 2YX4A 3HYIA 1Z91A 1HSTA 5D5UB 1I6XA 4GYGA 2MH2A 4CICA 4N9IA 4HAMA 3WE2A 2DAOA 3FX3A 2ZKZA 1FP2A 2DLLA 2EK5A 3ULQB 5TJJA 2P5LC 3IKVA 4FX0A 4ZZLA 2VODA 1XD7A 5CJ9A 3P9KA 1IW7F 1XCVA 2KRFA 5KVRA 1DPRA 1ZG1A 5DCMA 1HXDA 3ZMTA 1H0MA 4I01A 4MEYF 3W6JB 4EM1A 3BP8A 1YW7A 1P2FA 4U0WA 3DFGA 1J7KA 2FBIA 4CDGA 5ILVA 1KA8A 1SD7A 2V9VA 2PG4A 4WXHA 2CG4A 4XSXF 1I1GA 4KNYA 1MDMB 4AIHA 3D0SA 4ZZDA 1U78A 3DEUA 3I59A 3ECHA 1V4RA 1MZBA 4YFKF 5IT9K 4MTDA 1U5TC 1O3RA 1R7JA 3WG9A 4LLLA 1GXQA 3Q5FA 1FPQA 2L4MA 1A04A 1FBQA 3HTUA 1LDKB 1K7AA 3U2RA 5JI6A 1E2XA 2K4JA 1RUOA 2QBYB 5L3EA 2FRHA 4RB3C 3F22A 2JSCA 1YFHA 2NS0A 4KUMA 2EA2A 4G6DA 5K5QA 3KP3A 3G73A 3CO7C 1YIOA 4U0YA 4HQEA 1G4DA 5AIPA 2DQLA 3KP6A 2FBKA 2P5VA 2RC4A 1FP1D 4XLPF 4RB0A 1ZARA 4IXAA 3I64A 2IA2A 3L09A 4OMYA 1IZ1A 1YO5C 2P4WA 2D1VA 3RKWA 1HKQA 4GCVA 3E6BA 1RI7A 1P92A 4EGZA 1I5ZA 4LB6B 4HDUA 3T8RA 4KFCA 4RAYA 4A6EA 4P96A 1YG2A 4E70A 3CUQA 3GF2A 1DDNA 5CLSA 4R1HA 2WV0A 3ABTA 5L3DA 1G3YA 2OZUA 2H09A 1W7PB 3IKTA 3KCCA 2XROA 4NB5A 4XBFA 3NRVA 3H92A 2R7DA 2HYGD 4ASNA 3DPTA 2ZBKA 3TOBA 1UCRA 1WSUA 4LLGF 1IN6A 3TKYA 4DNCA 1U3EM 4I0BA 2E1NA 3F8BA 1F1ZA 5HLIA 2KIUA 2FSWA 5KK1A 1IN7A 2YU3A 3B73A 3C3WA 4ON0A 2BE5F 3J80Z 2IA0A 4MQ9F 1LDDA 5A2QZ 5ICGA 2W25A 1KYWA 2CFXA 2AS5F 2CWEA 1ZHFA 1XDUA 2G7HA 3KE2A 2GXGA 5BS6A 1ZH5A 4RB1A 4CXFA 3PQKA 2MD5A 4YG2F 4KMFA 5FLXK 2VT2A 4WWCA 1ZG3A 4HF1A 3IRRA 4RAZA 4MNUA 4HLXA 1FBSA 2ADUA 4L9TA 2LF7A 3FWEA 5JHUA 2DW4A 2KIMA 3WTYC 1QZZA 5L3GA 1TNSA 2CQKA 3E97A 5DD8A 5DEQA 4LGWA 4L9VA 3RJPA 3V8LA 4HOBA 4M74A 3LAPA 4KICA 2VN2A 5D5WB 3OOPA 1ZGJA 5LHGA 4KA4A 5LGNA 1W5SA 4XRFA 4GGGA 4FHTA 2IA1A 2STWA 1H9GA 2GA2A 5CVVA 3E3VA 5LGUA 4HYEA 2O61A 1MJAA 4WCGA 4IHSA 1WRJA 2VC0A 3SZPA 1YS7A 1Z6TA 3T1BA 3RIRA 4NQWA 4U0VA 4L0YB 2Y75A 2EFOA 4RGRA 1T98A 2PBIA 4Q4ZF 2ELHA 4L5JA 5CVJA 3ECOA 5JFRA 2PJPA 1BC7C 5H6RA 1KYZA 4Q47A 2XVCA 4M9SA 2X4HA 1IF1A 4CYDA 2BV6A 4ZYHA 1QNTA 3KP4A 3EYIA 1RZ4A 2R3SA 5LGTA 2XKOA 2NYXA 1V3FA 1W5TA 3H3ZA 5LHHA 3KP7A 3TDUC 1LQ1A 4HBLA 1XSDA 1KQ0A 3FXUA 4WX9A 3M8FA 1SD4A 1I27A 2W84A 1TW2A 3DKWA 3H3UA 4YIIA 2K27A 2EA4A 3AAFA 4HDVA 2YR2A 4L5IA 5LBQA 2O3FA 1DUXC 3E5XA 4LK0F 2L02A 3DQVC 1R58A 2NRAC 3FMQA 2F5FA 4KT5C 1ON2A 4BAYA 5D8LB 4ENKA 3I71A 3VODA 1PP7U 3S2WA 4ZYDA 1LVAA 4EJVA 4AD9A 2FNPA 4G7OF 2LF8A 3G3ZA 2DK5A 1T2KA 2YX7A 1RNLA 2H27A 2JPCA 3TDZC 5JR3A 1BI2A 3CUQC 3J81Z 3ERED 2PQ8A 4EGYA 5DV5A 1UB9A 4B09A 5J8FA 2NAZA 1G6NA 3GFIA 2DFIA 4ENMA 1FWZA 2EWNA 4MEXF 3BOQA 2FMLA 1JHHA 2O6GE 3K0LA 3D5LA 2VBXA 4YIFA 2ZXJA 1ZREA 3ZN1A 2EV5A 3JTHA 1QPMA 2EB7A 1D8KA 1H9TA 3I0TA 4PCQA 1REPC 1R1TA 4U7DA 2M8EA 2HQNA 5FD5A 5D5VB 1D5VA 3E6CC 1O3QA 2E1CA 2XAFA 4HX4A 1L0OC 2XHKA 2QENA 1JXSA 3EDPA 2CYYA 2F5EA 1UHMA 3R61A 4LJZF 5HVQC 3GUDA 3P9IA 3RKYA 1MGTA 4IF4A 3ZMZA 3K1MA 1FYMA 3IWFA 1HQCA 2XRNA 1OMIA 5ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LDJ A;  3ELK A;  1B4A A;  1KU2 A;  1ONV A;  1Z1D A;  4MHG A;  1ZAO A;  4UXN A;  3QOP A;  5ERI A;  3BZ6 A;  1KGS A;  3BJ6 A;  3CUQ B;  3SXY A;  4YFN F;  3ZPL A;  4CGZ A;  2XAG A;  4RB2 C;  3MZH A;  2VBY A;  3ZMS A;  4G7Z F;  1XGO A;  1F5T A;  5LRR A;  1TQI A;  5JVT A;  4O6J A;  1USS A;  2ESN A;  5D4S A;  1XSV A;  3GW2 A;  5HDK A;  1Z6R A;  5FD6 A;  2EFP A;  2VT3 A;  4KIB A;  3F23 A;  2VON A;  4OIN F;  4S05 A;  4MTE A;  3RDI A;  3EUH A;  1ZRD A;  2PEX A;  4ESF A;  1T6S A;  5HLH A;  3LQR A;  3JAM Z;  3V8J A;  2LSO A;  4K2E A;  2FF4 A;  3U9G A;  1S6L A;  4LG0 A;  1GHC A;  3F8F A;  4HW0 A;  2DTR A;  2XV4 S;  3KET A;  2ZO4 A;  1FY7 A;  2YSR A;  3TOA A;  1TW3 A;  3M8E A;  4P5O A;  1J9I A;  2MLG A;  1FSE A;  2JT1 A;  3VEP A;  6PAX A;  2UXN A;  2AXL A;  5ILS A;  4A2U A;  4I2O A;  1IRG A;  3QU6 A;  4ESJ A;  1K79 A;  2HKX A;  3VOE A;  2P6S A;  1YW9 A;  5CYV A;  4WK8 F;  3GEZ A;  4IRH A;  1SMT A;  1R5G A;  3LAJ A;  2PMH A;  3BJO A;  2ZME A;  2P5K A;  3K1N A;  1B1B A;  3LST A;  5FO5 A;  3FMS A;  2FNA A;  2DU9 A;  4EJW A;  3QP5 A;  4I09 A;  3V7S A;  5L3F A;  2V79 A;  1XGM A;  1E17 A;  5ILU A;  4OIR F;  1LEB A;  4LLN A;  2XGX A;  2OAZ A;  1ZRF A;  3DPL C;  2EFQ A;  1W7P D;  4EJO A;  2F5C A;  1EH8 A;  3HRM A;  3FF5 A;  3DF8 A;  4R79 A;  3HSE A;  3QPH A;  1J0R A;  1MKM A;  1BI3 A;  2QQA A;  3R4K A;  4N9H A;  4EQQ A;  4KIG A;  3CO6 C;  2L4A A;  3VFZ A;  3NEU A;  3QAH A;  4BXU A;  3SHF A;  3VB2 A;  3IC7 A;  3GWZ A;  4XSZ F;  3RI4 A;  1P6R A;  1BM9 A;  1S29 A;  2ZCW A;  2OA4 A;  1GVJ A;  3WU0 A;  3J80 K;  4UVA A;  4UHT A;  2W85 A;  2L01 A;  4HX7 A;  2OBP A;  2P7C B;  3ML6 A;  1YLF A;  3HSF A;  1OYI A;  2GQQ A;  4EJT A;  1G3S A;  3IL2 A;  4GO1 A;  2HDC A;  4WXC A;  3E5U A;  3QP6 A;  1U5T B;  3EYY A;  3M9A A;  2ACJ A;  3KLO A;  4Q5S F;  5D8K B;  5E8G A;  5LLQ A;  3NQO A;  3ZQ7 A;  1YW8 A;  3GVA A;  2HS5 A;  2MLK A;  2K86 A;  3BDD A;  3L9F A;  1Z7U A;  1K78 B;  4TV7 A;  2ETH A;  5DUI A;  3LWF A;  2RKH A;  2FXA A;  1O7F A;  5E1Z B;  4PGH A;  3ZMU A;  3I5U A;  5HS9 A;  4KN7 X;  2X0L A;  1TTY A;  3B02 A;  3BPV A;  1R23 A;  3LQQ A;  2H6C A;  2H94 A;  1T39 A;  2D2W A;  1PDN C;  1J5Y A;  4HV6 A;  2GWR A;  2CW0 F;  1DPU A;  2DO7 A;  5E18 F;  1MDM A;  1B59 A;  3MEX A;  4UNO A;  1YS6 A;  4P9F A;  1ZLK A;  3R60 A;  5TRD A;  2QQB A;  1WQ2 A;  5E17 F;  1W4M A;  1MJB A;  2V1D A;  1OYY A;  3K2Z A;  5BOX A;  3FXQ A;  1CF7 B;  3MZY A;  5L3B A;  4G6Q A;  4JK1 X;  3F72 A;  4OMZ A;  3U1D A;  5ICE A;  5EEH A;  2JPB A;  4ZH4 F;  3MCZ A;  4IJA A;  1IAW A;  5E8I A;  2A5Y B;  1BOA A;  5HLG A;  1D8J A;  3DXJ F;  4A0Z A;  3C7J A;  4IPA A;  4F7Z A;  2ZNZ A;  1P4A A;  2QBY A;  2CO5 A;  3BRO A;  2F5D A;  1J75 A;  3LA7 A;  2OD5 A;  1SFX A;  3W6K B;  3C18 A;  2FOK A;  2QLZ A;  4O5V A;  3GYH X;  3WTX C;  5EEG A;  2HQR A;  4EVI A;  3ZMV A;  2ZNY A;  4UV9 A;  2IJL A;  1RIO H;  2K4B A;  3RPU A;  5LEK A;  2EV6 A;  3GX4 X;  4DQ2 A;  5FLX Z;  1P4X A;  1UHW A;  2Z33 A;  2PI0 A;  1SFE A;  1XMK A;  2V6C A;  1FSH A;  2HGC A;  5K5R A;  2HFH A;  4OU0 A;  1G3T A;  2BEO A;  4Y17 A;  2Y0M A;  2QM3 A;  4UV8 A;  3OV8 A;  1BI0 A;  1HBX G;  3KZZ A;  1O7L A;  3J81 K;  4I7H A;  1ZLJ A;  2RVC A;  1AOY A;  3LA2 A;  3BY6 A;  1IXS B;  4BH9 A;  3Q9S A;  3FZV A;  4PDK A;  2JTV A;  1IUY A;  3O2P E;  3F6V A;  4ENN A;  1STZ A;  1W7P A;  4BNC A;  4OIP F;  4HF2 A;  3R0J A;  4D0P A;  5DCM B;  1P4W A;  4Z2Y A;  3WTV C;  3F6O A;  2V1U A;  1SFU A;  3HOT A;  3WTW C;  1EH7 A;  4HQM A;  3CDH A;  5ICC A;  1XDS A;  3C1D A;  2A6H F;  1HW1 A;  2FMY A;  4A6D A;  5DYM A;  5LEJ A;  3Q9V A;  1IN5 A;  2EV0 A;  4HA8 A;  1Z9C A;  3REO A;  2RV8 A;  3KEQ A;  1F4K A;  3JTG A;  3E6M A;  1UST A;  2KIF A;  3P7N A;  5AIQ A;  1KU7 A;  2L3D A;  2A68 F;  2FBH A;  3I59 B;  1BC8 C;  2Z3Y A;  5HS8 A;  2RQP A;  2DT5 A;  1J2X A;  2RNJ A;  3RTR A;  3PQJ A;  1JGS A;  1FX7 A;  1ULY A;  2FA5 A;  1FYL A;  3TGN A;  2LNB A;  1SAX A;  1UFM A;  2NNN A;  1ZG5 A;  5D4R A;  2XKP A;  4OIQ F;  1B9M A;  4EM2 A;  1HKS A;  3WTS C;  4IHT A;  1KQ9 A;  2MC3 A;  3F8M A;  2ISY A;  2P7V B;  3I58 A;  2L54 A;  3K69 A;  1T0F A;  4CO8 A;  1OPC A;  3R6S A;  4I0A A;  2OZ6 A;  2DI3 A;  2G7U A;  3WGG A;  4IVN A;  1JE8 A;  3E6D A;  3COA C;  2STT A;  3HRU A;  3LFK A;  2LKP A;  4AIJ A;  1O3S A;  3GFJ A;  4CZZ A;  3E5Q A;  2B0L A;  5L3C A;  3JAM K;  3IWZ A;  3FM3 A;  4L9N A;  2FU4 A;  3FXR A;  3J7A O;  3CTA A;  2COM A;  3JW4 A;  1MJ9 A;  4JQF A;  4A12 A;  3RKX A;  2DQR A;  2Q2E A;  4OIO F;  3ABU A;  3HHH A;  1WWX A;  2IW5 A;  2D45 A;  2HTJ A;  2ZJ2 A;  5CVI A;  2JZY A;  2RDP A;  3HSR A;  4LMY A;  3MAJ A;  1PP8 F;  4R8H A;  2IT0 A;  3ROU A;  2E7X A;  1O3T A;  2KJC A;  2VC1 A;  5D6F A;  1ZGA A;  3SZT A;  4EM0 B;  1QZY A;  3T5X A;  2GAU A;  4RS8 A;  1IXR C;  2HWV A;  4M71 A;  1R5H A;  2W24 A;  4M6Y A;  5K1Y A;  1QQI A;  3MWM A;  2PMU A;  4LB5 A;  4BHB A;  3V7R A;  2WWY A;  1YTY A;  2OQG A;  2F2E A;  3WOD F;  2KJB A;  3TO6 A;  4ZYG A;  1XSX A;  5BQT A;  1XB4 A;  1IN4 A;  2M5W A;  1FC3 A;  5BMZ A;  1FZP B;  3F8N A;  2A6E F;  1GXP A;  2XAQ A;  5DCF A;  5F1R A;  4Q48 A;  5LRS A;  3L7W A;  5LHI A;  3N97 A;  1IRF A;  2M45 A;  2QZ8 A;  2Z99 A;  1TLH B;  4ESB A;  5FFZ A;  4Y15 A;  3BWG A;  2E7W A;  2CSO A;  1R1U A;  3L2C A;  2EJR A;  2MA3 A;  5F6F A;  2XUB A;  4IRG A;  2VXZ A;  4FT8 A;  4G9Y A;  3CJN A;  1BIA A;  2DPD A;  1FLI A;  3O6B B;  2MBF A;  4IRI A;  3MFK A;  2EFN A;  2HOE A;  1TQP A;  2IRF G;  1FOK A;  4I02 A;  3JSO A;  5DDG A;  4ETS A;  3KEO A;  2C6Y A;  4QWQ A;  2VE8 A;  2CGP A;  3I4P A;  2ZFW A;  1ODD A;  2M30 A;  2UWM A;  4PGG A;  2UXX A;  3KP2 A;  1XGS A;  2H6B A;  1OYW A;  1U8R A;  1ON1 A;  4Y13 A;  2A61 A;  1Q1H A;  2VE9 A;  1FBU A;  1DP7 P;  4HV5 A;  5F64 A;  2R7F A;  2WC2 A;  2FE3 A;  1J59 A;  1QBJ A;  1ZYR F;  4MGR A;  4WF2 A;  1T38 A;  4UUV A;  2PN6 A;  4I98 B;  3RYR A;  4AWX B;  3TO7 A;  4LD5 A;  4EJU A;  3HRT A;  3SQN A;  3WGI A;  1KU9 A;  1WI9 A;  5A2Q K;  4A0Y A;  4EV0 A;  1SMY F;  3RYP A;  5IT9 Z;  3HTS B;  3F8C A;  3SFZ A;  4CHU A;  3GXO A;  5J6X A;  2HEO A;  2J5O A;  3FM5 A;  3HUG A;  3ZN0 A;  4JBA A;  3WTU C;  5HDN A;  3WE3 A;  2XAJ A;  5FGM A;  1R36 A;  3KZY A;  4G8X A;  1HKT A;  2PFB A;  4G7H F;  1MD0 A;  4A5N A;  1QGP A;  4O3M A;  5FB2 A;  1G3W A;  3I53 A;  5CVU A;  3HIF A;  3M1E A;  5CVR A;  1BIB A;  4HLY A;  4NHJ A;  2P8T A;  3KFW X;  5DD4 A;  1C0W A;  4ENJ A;  1OR7 A;  1IN8 A;  1VTN C;  2FEZ A;  2XAH A;  2M87 A;  1Y0U A;  3JSP A;  2GA1 A;  4UVB A;  2GZW A;  4B8X A;  5AON A;  1U6G A;  3M7G A;  2O8X A;  1EV7 A;  4UVC A;  2VOO A;  3ISP A;  2KKO A;  3TQN A;  5DUK A;  3GFM A;  4L9J A;  4EMS A;  4BYY A;  2QWW A;  1YYV A;  1L3L A;  2IP2 A;  3V4G A;  2FQ3 A;  4KMU X;  4M9Z A;  2HR3 A;  2BYV E;  2J5P A;  2V1X A;  3GLX A;  2RN7 A;  1I1S A;  1SD6 A;  5D5X B;  2W57 A;  3CUO A;  4AIK A;  2HKO A;  4RGU A;  5E20 A;  5IT3 A;  5HOO A;  3HHG A;  3QPT A;  3FMR A;  2MH9 A;  3V8K A;  4P55 A;  4BQA A;  1PUE E;  3KP5 A;  1K6O A;  4M9X A;  1HSJ A;  1S7A A;  2WTE A;  5FFX A;  1LNW A;  3KLN A;  3PFI A;  3WGH A;  3TO9 A;  1XGN A;  1R1V A;  3IHU A;  1ZN2 A;  1RUN A;  2LDU A;  1KQ8 A;  5J8C A;  2IVM A;  1TNT A;  1LEA A;  2JRT A;  2NNY A;  1FNN A;  3WTZ A;  1LJ9 A;  3IRQ A;  4WXD A;  3ZP5 A;  2O03 A;  3FHZ A;  3GO5 A;  2ESH A;  3O3K A;  2A3S A;  3WU1 B;  4L0Z B;  1TQM A;  2VBZ A;  2XAS A;  3GZ5 A;  2VOP A;  5HDG A;  1NHA A;  1KU3 A;  4XLN F;  5D6E A;  4G94 A;  2Z9O A;  2EFW A;  3K1P A;  4A5M A;  4RGS A;  4GXO A;  4RGX A;  2XIG A;  2IPQ X;  1IXC A;  3DP7 A;  3QRF F;  3GFL A;  1F9N A;  4KDP A;  1JHF A;  3R0A A;  3T0Y A;  1OKR A;  3EQL F;  3CLO A;  1U5T A;  4BHC A;  2DBB A;  2QUF A;  2M1B A;  1WKM A;  1B6A A;  3DV8 A;  5E1W A;  3GZ6 A;  3MQ0 A;  1O57 A;  5H20 A;  3I54 A;  3N4M A;  1EH6 A;  1S3J A;  4HX8 A;  1BN5 A;  4P9U A;  5K5O A;  3RPQ A;  1K78 A;  2K02 A;  4LG0 B;  2QVO A;  2Y48 A;  2DK8 A;  3EET A;  1CGP A;  4OOI A;  1D3Y A;  4AVP A;  4N0B A;  2HZT A;  1R22 A;  3P9C A;  1QO0 D;  3HRS A;  5E1X A;  1FYK A;  1ZRC A;  4MQV A;  4YFX F;  3WTT C;  1Z05 A;  4HZF A;  2QYO A;  5BPI A;  2GXB A;  1SD5 A;  2A07 F;  4A0X A;  1BBY A;  2D1H A;  1HW2 A;  1FT9 A;  1BI1 A;  2TDX A;  5BPD A;  3V7C A;  4H0E A;  1BJA A;  3QU3 A;  4LK1 F;  2P6T A;  1LB2 A;  1B9N A;  2BBY A;  4M72 A;  3BPX A;  4PZJ A;  4KYW A;  4U7B A;  2QQ9 A;  2ZME B;  4M73 A;  1U2W A;  2Z5U A;  1X3U A;  4KIF A;  2K7L A;  2HYF A;  2HTS A;  1CF7 A;  2BGC A;  4HF0 A;  2OU2 A;  3ZMD A;  2Q0O A;  2YPR A;  5HS7 A;  2G9W A;  2DPU A;  1S8N A;  4QLC U;  2ISZ A;  4L18 B;  4BHP A;  1R00 A;  2GIV A;  2PLY A;  1XCB A;  3BJA A;  1XMA A;  4LFU A;  1AWC A;  1TBX A;  3L00 A;  4KN4 X;  1HW5 A;  2Q8K A;  1XN7 A;  2OQR A;  3K9T A;  4ZYE A;  4U88 A;  3F21 A;  4FX4 A;  4S04 A;  3F3X A;  1YQA A;  2O0Y A;  5H6Q A;  2VBW A;  5ICF A;  3T8T A;  4M6X A;  3LA3 A;  3HOS A;  2A69 F;  2RGV A;  2UZK A;  1S7O A;  4GYI A;  2YX4 A;  3HYI A;  1Z91 A;  1HST A;  5D5U B;  1I6X A;  4GYG A;  2MH2 A;  4CIC A;  4N9I A;  4HAM A;  3WE2 A;  2DAO A;  3FX3 A;  2ZKZ A;  1FP2 A;  2DLL A;  2EK5 A;  3ULQ B;  5TJJ A;  2P5L C;  3IKV A;  4FX0 A;  4ZZL A;  2VOD A;  1XD7 A;  5CJ9 A;  3P9K A;  1IW7 F;  1XCV A;  2KRF A;  5KVR A;  1DPR A;  1ZG1 A;  5DCM A;  1HXD A;  3ZMT A;  1H0M A;  4I01 A;  4MEY F;  3W6J B;  4EM1 A;  3BP8 A;  1YW7 A;  1P2F A;  4U0W A;  3DFG A;  1J7K A;  2FBI A;  4CDG A;  5ILV A;  1KA8 A;  1SD7 A;  2V9V A;  2PG4 A;  4WXH A;  2CG4 A;  4XSX F;  1I1G A;  4KNY A;  1MDM B;  4AIH A;  3D0S A;  4ZZD A;  1U78 A;  3DEU A;  3I59 A;  3ECH A;  1V4R A;  1MZB A;  4YFK F;  5IT9 K;  4MTD A;  1U5T C;  1O3R A;  1R7J A;  3WG9 A;  4LLL A;  1GXQ A;  3Q5F A;  1FPQ A;  2L4M A;  1A04 A;  1FBQ A;  3HTU A;  1LDK B;  1K7A A;  3U2R A;  5JI6 A;  1E2X A;  2K4J A;  1RUO A;  2QBY B;  5L3E A;  2FRH A;  4RB3 C;  3F22 A;  2JSC A;  1YFH A;  2NS0 A;  4KUM A;  2EA2 A;  4G6D A;  5K5Q A;  3KP3 A;  3G73 A;  3CO7 C;  1YIO A;  4U0Y A;  4HQE A;  1G4D A;  5AIP A;  2DQL A;  3KP6 A;  2FBK A;  2P5V A;  2RC4 A;  1FP1 D;  4XLP F;  4RB0 A;  1ZAR A;  4IXA A;  3I64 A;  2IA2 A;  3L09 A;  4OMY A;  1IZ1 A;  1YO5 C;  2P4W A;  2D1V A;  3RKW A;  1HKQ A;  4GCV A;  3E6B A;  1RI7 A;  1P92 A;  4EGZ A;  1I5Z A;  4LB6 B;  4HDU A;  3T8R A;  4KFC A;  4RAY A;  4A6E A;  4P96 A;  1YG2 A;  4E70 A;  3CUQ A;  3GF2 A;  1DDN A;  5CLS A;  4R1H A;  2WV0 A;  3ABT A;  5L3D A;  1G3Y A;  2OZU A;  2H09 A;  1W7P B;  3IKT A;  3KCC A;  2XRO A;  4NB5 A;  4XBF A;  3NRV A;  3H92 A;  2R7D A;  2HYG D;  4ASN A;  3DPT A;  2ZBK A;  3TOB A;  1UCR A;  1WSU A;  4LLG F;  1IN6 A;  3TKY A;  4DNC A;  1U3E M;  4I0B A;  2E1N A;  3F8B A;  1F1Z A;  5HLI A;  2KIU A;  2FSW A;  5KK1 A;  1IN7 A;  2YU3 A;  3B73 A;  3C3W A;  4ON0 A;  2BE5 F;  3J80 Z;  2IA0 A;  4MQ9 F;  1LDD A;  5A2Q Z;  5ICG A;  2W25 A;  1KYW A;  2CFX A;  2AS5 F;  2CWE A;  1ZHF A;  1XDU A;  2G7H A;  3KE2 A;  2GXG A;  5BS6 A;  1ZH5 A;  4RB1 A;  4CXF A;  3PQK A;  2MD5 A;  4YG2 F;  4KMF A;  5FLX K;  2VT2 A;  4WWC A;  1ZG3 A;  4HF1 A;  3IRR A;  4RAZ A;  4MNU A;  4HLX A;  1FBS A;  2ADU A;  4L9T A;  2LF7 A;  3FWE A;  5JHU A;  2DW4 A;  2KIM A;  3WTY C;  1QZZ A;  5L3G A;  1TNS A;  2CQK A;  3E97 A;  5DD8 A;  5DEQ A;  4LGW A;  4L9V A;  3RJP A;  3V8L A;  4HOB A;  4M74 A;  3LAP A;  4KIC A;  2VN2 A;  5D5W B;  3OOP A;  1ZGJ A;  5LHG A;  4KA4 A;  5LGN A;  1W5S A;  4XRF A;  4GGG A;  4FHT A;  2IA1 A;  2STW A;  1H9G A;  2GA2 A;  5CVV A;  3E3V A;  5LGU A;  4HYE A;  2O61 A;  1MJA A;  4WCG A;  4IHS A;  1WRJ A;  2VC0 A;  3SZP A;  1YS7 A;  1Z6T A;  3T1B A;  3RIR A;  4NQW A;  4U0V A;  4L0Y B;  2Y75 A;  2EFO A;  4RGR A;  1T98 A;  2PBI A;  4Q4Z F;  2ELH A;  4L5J A;  5CVJ A;  3ECO A;  5JFR A;  2PJP A;  1BC7 C;  5H6R A;  1KYZ A;  4Q47 A;  2XVC A;  4M9S A;  2X4H A;  1IF1 A;  4CYD A;  2BV6 A;  4ZYH A;  1QNT A;  3KP4 A;  3EYI A;  1RZ4 A;  2R3S A;  5LGT A;  2XKO A;  2NYX A;  1V3F A;  1W5T A;  3H3Z A;  5LHH A;  3KP7 A;  3TDU C;  1LQ1 A;  4HBL A;  1XSD A;  1KQ0 A;  3FXU A;  4WX9 A;  3M8F A;  1SD4 A;  1I27 A;  2W84 A;  1TW2 A;  3DKW A;  3H3U A;  4YII A;  2K27 A;  2EA4 A;  3AAF A;  4HDV A;  2YR2 A;  4L5I A;  5LBQ A;  2O3F A;  1DUX C;  3E5X A;  4LK0 F;  2L02 A;  3DQV C;  1R58 A;  2NRA C;  3FMQ A;  2F5F A;  4KT5 C;  1ON2 A;  4BAY A;  5D8L B;  4ENK A;  3I71 A;  3VOD A;  1PP7 U;  3S2W A;  4ZYD A;  1LVA A;  4EJV A;  4AD9 A;  2FNP A;  4G7O F;  2LF8 A;  3G3Z A;  2DK5 A;  1T2K A;  2YX7 A;  1RNL A;  2H27 A;  2JPC A;  3TDZ C;  5JR3 A;  1BI2 A;  3CUQ C;  3J81 Z;  3ERE D;  2PQ8 A;  4EGY A;  5DV5 A;  1UB9 A;  4B09 A;  5J8F A;  2NAZ A;  1G6N A;  3GFI A;  2DFI A;  4ENM A;  1FWZ A;  2EWN A;  4MEX F;  3BOQ A;  2FML A;  1JHH A;  2O6G E;  3K0L A;  3D5L A;  2VBX A;  4YIF A;  2ZXJ A;  1ZRE A;  3ZN1 A;  2EV5 A;  3JTH A;  1QPM A;  2EB7 A;  1D8K A;  1H9T A;  3I0T A;  4PCQ A;  1REP C;  1R1T A;  4U7D A;  2M8E A;  2HQN A;  5FD5 A;  5D5V B;  1D5V A;  3E6C C;  1O3Q A;  2E1C A;  2XAF A;  4HX4 A;  1L0O C;  2XHK A;  2QEN A;  1JXS A;  3EDP A;  2CYY A;  2F5E A;  1UHM A;  3R61 A;  4LJZ F;  5HVQ C;  3GUD A;  3P9I A;  3RKY A;  1MGT A;  4IF4 A;  3ZMZ A;  3K1M A;  1FYM A;  3IWF A;  1HQC A;  2XRN A;  1OMI A;  5ED4 A; 
#chains in the Genus database with same CATH topology
 1LDJ A;  1R5I D;  3ELK A;  1B4A A;  3IH3 A;  2JSP A;  1T08 B;  2DDA A;  1KU2 A;  3K4C A;  3HUG B;  3I4N J;  1ONV A;  1Z1D A;  4MHG A;  1ZAO A;  4UXN A;  5EGO B;  3QOP A;  5ERI A;  3HG9 A;  4BEH B;  3BZ6 A;  4A3L J;  4G6T B;  1KGS A;  3BJ6 A;  1ETV A;  3CUQ B;  3SXY A;  4YFN F;  3ZPL A;  2EPF A;  4CGZ A;  2JA6 J;  2XAG A;  4RB2 C;  3MZH A;  4XID A;  2LOO A;  3OOU A;  2VBY A;  2DA6 A;  3ZMS A;  5M5W J;  4G7Z F;  1A31 A;  1XGO A;  5FRN A;  1F5T A;  5FKL A;  2E5N A;  1W0T A;  5LRR A;  2TCT A;  1TQI A;  5JVT A;  4O6J A;  1USS A;  3VYT B;  1AKH A;  2ESN A;  3K4B A;  1ZR4 A;  2E1M B;  5D4S A;  1XSV A;  3BG6 A;  2B63 J;  3GW2 A;  2FUG 2;  3GTM J;  4IHX A;  2XDV A;  5HDK A;  3CZ6 A;  1Z6R A;  5FD6 A;  2EFP A;  3SJM A;  2L5Q A;  2VT3 A;  4M3B A;  4KIB A;  2I10 A;  3F23 A;  2HVS A;  2VON A;  4QIW N;  4OIN F;  3OSF A;  4S05 A;  3HL2 A;  2BZT A;  4MTE A;  3RDI A;  1NK3 P;  2L2O A;  2IGO A;  4ZJZ A;  3EUH A;  1ZRD A;  4LIU A;  1MBJ A;  2PEX A;  1APL C;  4ESF A;  1T6S A;  5HLH A;  3LQR A;  3JAM Z;  1R49 A;  2BHZ A;  3V8J A;  2WBM A;  2LSO A;  1RKT A;  4K2E A;  3P5J A;  1N25 A;  2FF4 A;  1MBK A;  3OYN A;  2RRE A;  1B8I A;  3RCO A;  3U9G A;  1S6L A;  2NS7 A;  4DZP A;  4LG0 A;  1GHC A;  2N8G A;  2YUS A;  3F8F A;  2DTR A;  4HW0 A;  3CD6 I;  4DYC A;  2XV4 S;  3KET A;  2ZO4 A;  4A3D J;  1FY7 A;  2DA1 A;  2JVG A;  2YSR A;  5B1B H;  2BW3 B;  3TOA A;  1TW3 A;  2FD5 A;  3M8E A;  4P5O A;  1J9I A;  4XLE A;  5IYD J;  2ECC A;  1FSE A;  2MLG A;  2JT1 A;  3VEP A;  6PAX A;  2B7E A;  2UXN A;  2AXL A;  5ILS A;  3FBI B;  2QEX I;  1OJL A;  4A2U A;  2GIZ A;  4I2O A;  1IC8 A;  1IRG A;  3QU6 A;  4ESJ A;  3D5R C;  1YI2 I;  1K79 A;  2HKX A;  3VOE A;  4XIC A;  2JVH A;  2KT0 A;  2P6S A;  5HNF A;  1YW9 A;  5CYV A;  4WK8 F;  2K9S A;  3OIP A;  4XLC A;  2LYC A;  3GEZ A;  4IRH A;  1SMT A;  2DMT A;  2XB5 A;  1R5G A;  2TRT A;  4PUS A;  3SEZ A;  2Y9Y A;  1VF9 A;  3S16 J;  3LSR A;  3LAJ A;  1SFO J;  2P81 A;  3K6G A;  2PMH A;  3BJO A;  2ZME A;  2P5K A;  3K1N A;  4AM3 A;  1B1B A;  4LOC A;  1X4O A;  3LST A;  5FO5 A;  3FMS A;  2FNA A;  2MG4 A;  2DU9 A;  4EJW A;  2X6O A;  3QP5 A;  4I09 A;  3V7S A;  2R7X A;  4DJA A;  5L3F A;  2X6Y A;  1V55 H;  2DMQ A;  4UUS B;  2V79 A;  1LUJ B;  4FQG A;  1XGM A;  1E17 A;  1TT0 A;  1A6Q A;  5ILU A;  1IDZ A;  4OIR F;  4BKX A;  1LEB A;  4LLN A;  2XGX A;  1R4M B;  2KZG A;  3ZQQ A;  4CCO A;  2OAZ A;  3F9K A;  3ASN H;  2GOM A;  1ZRF A;  2LMD A;  4C30 A;  1QA6 A;  3DPL C;  5GTI C;  3ZRG A;  2EFQ A;  1W7P D;  1QHH D;  4EJO A;  2F5C A;  4C2U A;  1EH8 A;  3HRM A;  1YOV B;  3FF5 A;  2KZV A;  3DF8 A;  2F4O B;  4R79 A;  3HSE A;  1NH3 A;  3QPH A;  2GXA A;  1J0R A;  2EIM H;  1MKM A;  1BI3 A;  2QQA A;  2M4G A;  3OYG A;  3R4K A;  4N9H A;  4EQQ A;  4KIG A;  3CO6 C;  2L4A A;  3VFZ A;  3OR2 C;  4IOC F;  2VPL A;  3NEU A;  3QAH A;  4BXU A;  3SHF A;  2HQ5 A;  3IC7 A;  3GWZ A;  3VB2 A;  2QA4 I;  4PJJ A;  4XSZ F;  3ONQ A;  3RI4 A;  1P6R A;  3O8H A;  2A5W A;  4XQF A;  1BM9 A;  2W4S A;  1S29 A;  2ZCW A;  2AS5 F;  2OA4 A;  3C2B A;  2HDW A;  2COB A;  1GVJ A;  2QKM B;  1HDP A;  3WU0 A;  4XKW A;  3J80 K;  3ABM H;  2V26 A;  4UVA A;  2BY1 A;  3KYL A;  1WCM J;  4UHT A;  2W85 A;  4BL0 B;  2L01 A;  3FIS A;  1Y56 A;  4HX7 A;  2OBP A;  1V5F A;  2P7C B;  3ML6 A;  2QSG X;  4RLQ A;  1YLF A;  3CC7 I;  3KEY A;  1GLN A;  3HSF A;  1OYI A;  1U9N A;  1Y39 A;  4X1E A;  2GQQ A;  2DT7 B;  2DXI A;  3LSP A;  3VYR B;  3FKJ A;  5FRO A;  4EJT A;  5GAG J;  3H0D A;  1G3S A;  3IL2 A;  4GO1 A;  3M1C A;  3BR2 A;  2LBF B;  2HDC A;  2D5V A;  4WXC A;  2BOL A;  1S9H A;  5C44 J;  2DYS H;  3ABK H;  3E5U A;  3QP6 A;  3E1S A;  1U5T B;  5E3L A;  3S1Q J;  3S32 A;  3FXK A;  3JRC A;  3OL3 A;  3EYY A;  1VQ7 I;  2EZL A;  3M9A A;  2E5Z A;  4ZTF A;  2ACJ A;  3KLO A;  4Q5S F;  5D8K B;  1XG1 A;  5E8G A;  5LLQ A;  3NQO A;  2DA5 A;  2K9L A;  4PK4 A;  4J01 A;  5E79 C;  3JRB A;  2MC4 A;  3ZQ7 A;  4XKV A;  1YW8 A;  3OYL A;  3HB9 A;  3GVA A;  2HS5 A;  2BHY A;  2MLK A;  5CKT A;  5FKN A;  2K86 A;  5KAF C;  3BDD A;  3SEQ A;  2DOA A;  3L9F A;  3LSH A;  1Z7U A;  2EIL H;  5J47 A;  1K78 B;  2JJ7 A;  1VQ9 I;  2V4J C;  4TV7 A;  2ETH A;  5DUI A;  3LWF A;  2RKH A;  4BAC A;  4PFP A;  1K6Y A;  2FXA A;  1O7F A;  2OTL I;  5E1Z B;  3ZQI A;  1DQU A;  4PGH A;  3ZMU A;  1ZQ3 P;  3I5U A;  2LK2 A;  3KYC B;  5HS9 A;  4NDL A;  4KN7 X;  3CES A;  1RET A;  3BQZ A;  3F0C A;  5HNH A;  2Z16 A;  3RKQ A;  2EBI A;  2AQE A;  1TTY A;  2X0L A;  3B02 A;  3BPV A;  1R23 A;  3LQQ A;  4MO7 A;  1YJN I;  2H6C A;  2H94 A;  3L2Q A;  1T39 A;  2D2W A;  1MND A;  4CYC B;  2JUC A;  3O8G A;  1PDN C;  1J5Y A;  2EIJ H;  4HV6 A;  2GWR A;  3ZQH A;  2CW0 F;  1DPU A;  2DO7 A;  3OYK A;  5E18 F;  3PIO F;  1MDM A;  1B59 A;  1ZR2 A;  3MEX A;  4NNJ A;  2DFE A;  4UNO A;  1YS6 A;  4P9F A;  1ITY A;  1ZLK A;  4ANJ A;  3R60 A;  1MNM C;  2GLO A;  1DU0 A;  2VJ4 A;  3TMO A;  2HXI A;  5TRD A;  2RQQ A;  2VIX A;  2QQB A;  1WQ2 A;  2LD5 A;  5E17 F;  1W4M A;  1MJB A;  2V1D A;  5FJ8 J;  1OYY A;  1SVO A;  3K2Z A;  4XLH A;  3JRA A;  5BOX A;  2DT6 A;  2CUZ A;  3FXQ A;  4BJT A;  1T56 A;  2JN6 A;  3MZY A;  5L3B A;  1CF7 B;  3J7Y J;  4G6Q A;  4JK1 X;  3F72 A;  4OMZ A;  3U1D A;  5ICE A;  5EEH A;  2JPB A;  4ZH4 F;  4QSH A;  3GTJ J;  1JTX A;  2H8W A;  2IS4 A;  3BG7 A;  3MCZ A;  1Z77 A;  4V2G A;  4IJA A;  3OL4 A;  4PJ0 C;  4B3A A;  5E8I A;  1IAW A;  3L2R A;  2A5Y B;  3HJE A;  1BOA A;  5HLG A;  1D8J A;  3DLA A;  2Y9Z A;  2VQG A;  3DXJ F;  1MSE C;  2XF5 A;  2DOF A;  3C7J A;  4A0Z A;  4IPA A;  4F7Z A;  2ZNZ A;  1P4A A;  2QBY A;  2CO5 A;  4HNT A;  1X1P A;  3BRO A;  2F5D A;  1J75 A;  1BA5 A;  3LA7 A;  4PJN A;  3WG7 H;  2OD5 A;  1SFX A;  2L7K A;  3W6K B;  3C18 A;  1T95 A;  1NK2 P;  1WJF A;  4I76 A;  3VPR A;  2FOK A;  1W5C C;  2QLZ A;  2WV1 A;  4O5V A;  3WTX C;  3GYH X;  2JQ7 A;  3LL7 A;  3MN2 A;  3L2V A;  2Y69 H;  5EEG A;  2HQR A;  4EVI A;  2HPI A;  3CJQ B;  4CCL A;  3OIQ A;  3ZMV A;  2ZNY A;  4UV9 A;  2IJL A;  3BTC A;  1HA8 A;  1S5L C;  1RIO H;  2F4M B;  2K4B A;  3RPU A;  5LEK A;  2HPM A;  1UJ8 A;  3M07 A;  2EV6 A;  3GX4 X;  1EA3 A;  4DQ2 A;  1I3Q J;  5FLX Z;  1P4X A;  1UHW A;  3LSG A;  2Z33 A;  2PI0 A;  1SFE A;  2CRG A;  1HC8 A;  5JLX A;  2VXD A;  1XMK A;  4UY8 I;  2V6C A;  1FSH A;  2HGC A;  5K5R A;  2E36 A;  2HFH A;  1WJA A;  2LR8 A;  1G3T A;  4OU0 A;  2BEO A;  2ZME C;  4Y17 A;  2Y0M A;  2IBD A;  2OV7 A;  2QM3 A;  4UV8 A;  4IOA F;  3OV8 A;  1BI0 A;  1NG6 A;  5B3S H;  1HBX G;  3KZZ A;  2L9N A;  1O7L A;  4KIT B;  3J81 K;  4I7H A;  1ZLJ A;  1SFK A;  1B72 A;  2RVC A;  1TWC J;  1HCR A;  4A69 C;  1AOY A;  3LA2 A;  3BY6 A;  2VB6 A;  1H89 C;  1Y8Q B;  4BXX J;  3OIO A;  1IXS B;  5LD2 C;  3M3Y J;  4BH9 A;  1F43 A;  3Q9S A;  3FZV A;  2VJ5 A;  4PDK A;  2JTV A;  4RAF A;  1IUY A;  1P7J A;  3BCA A;  3O2P E;  4JYK A;  4FTH A;  3CP2 A;  1X1B A;  3F6V A;  1MH4 A;  1K83 J;  2HI3 A;  4ENN A;  1STZ A;  1W7P A;  2JWT A;  2BVL A;  4BNC A;  1LVK A;  3K7A J;  5K7H A;  4OIP F;  3AL0 C;  4BJ6 C;  2B9S A;  4HF2 A;  1GVD A;  4E6K G;  2Z1D A;  1VI0 A;  1VQ8 I;  3R0J A;  4D0P A;  3GCM A;  1T8I A;  1QHG A;  4BJ5 C;  4X6A J;  1P4W A;  4XM3 A;  5DCM B;  2EQR A;  4Z2Y A;  3WTV C;  2RNG A;  3F6O A;  2V1U A;  1SFU A;  1FIP A;  3HOT A;  3WTW C;  1VQ6 I;  1BJZ A;  3OYF A;  1EH7 A;  2O9L A;  3JR9 A;  3BLY A;  3W2A A;  3I4M J;  4HQM A;  2HOT A;  3CDH A;  5ICC A;  1XDS A;  4HNU A;  3C1D A;  4Y52 J;  2XF6 A;  4CZC A;  2A6H F;  1HW1 A;  2FMY A;  2KP6 A;  4BDZ A;  4A6D A;  5DYM A;  1WGX A;  2DCE A;  5LEJ A;  3OYC A;  3Q9V A;  1IN5 A;  4NBQ A;  5DS9 A;  3OYB A;  2EV0 A;  4HA8 A;  4XK4 A;  1Z9C A;  1IRX A;  2VI6 A;  3REO A;  2RV8 A;  3EUK L;  3KEQ A;  2R0Q C;  1F4K A;  2WAQ A;  3GME A;  1I50 J;  2CFO A;  3A01 A;  3JTG A;  4BBS J;  3KYD B;  1WJB A;  3E6M A;  3H1C A;  2FX0 A;  1UST A;  3S3M A;  3G2B A;  2KIF A;  3P7N A;  4AYB A;  5AIQ A;  1KU7 A;  1OCR H;  3CCM I;  4C2T A;  1Z3Y A;  2L3D A;  2A68 F;  2FBH A;  3I59 B;  1BC8 C;  2Z3Y A;  4LIT A;  1D1B A;  2L7F P;  5M5X J;  5HS8 A;  2RQP A;  3HPH A;  2DOD A;  2DT5 A;  1J2X A;  2RNJ A;  3RTR A;  4FE7 A;  3DEW A;  3PQJ A;  1JGS A;  2AXT C;  4EAT A;  4W1U A;  3HC7 A;  4RLF A;  3TP0 A;  1FX7 A;  2M0C A;  3QPL A;  1I3A A;  1ULY A;  3LNQ A;  2F5V A;  2FA5 A;  1ZK8 A;  1FYL A;  3A0B C;  3TGN A;  5IYB J;  1DU6 A;  1ORK A;  2LNB A;  1JI8 A;  1SAX A;  4F55 A;  4B3X A;  1PUF B;  1UFM A;  2NNN A;  4DGW B;  4YIR X;  1ZG5 A;  3W6V A;  5D4R A;  2XKP A;  4OIQ F;  1B9M A;  4EM2 A;  3OWT A;  2ME6 A;  4MLO A;  1HKS A;  3WTS C;  2KL4 A;  1TZL A;  4IHT A;  4S0H B;  3PNY A;  3EPZ A;  1DGR M;  2ZB9 A;  1N78 A;  3DLL F;  2M3A A;  2CQN A;  2XPV A;  1KQ9 A;  2MC3 A;  2IEK A;  4A3C J;  3F8M A;  2ZSI B;  3A0H C;  1UHS A;  2QSH X;  2ISY A;  2P7V B;  3I58 A;  3BG3 A;  5J3L A;  2L54 A;  3K69 A;  4FE4 A;  1CQT A;  1E0E A;  1T0F A;  4CO8 A;  4XRS G;  1OPC A;  3R6S A;  1RES A;  1ETO A;  2LRD A;  2OZ6 A;  2DI3 A;  4I0A A;  2G7U A;  1P7I A;  2BXY A;  3WGG A;  4IVN A;  4XKC A;  4BE1 A;  1JE8 A;  3E6D A;  3COA C;  2STT A;  3IUO A;  3HRU A;  4HSR A;  1IV6 A;  1IG7 A;  4XL9 A;  3LFK A;  1SAN A;  2LKP A;  4AIJ A;  1O3S A;  2IS2 A;  4MFD A;  3GFJ A;  4CZZ A;  1VQ4 I;  3E5Q A;  1WPK A;  2B0L A;  5L3C A;  3OS0 A;  3JAM K;  1FOW A;  3IWZ A;  3FM3 A;  2WAF A;  2MYS A;  1EJ9 A;  4L9N A;  2FU4 A;  4N4N B;  3FXR A;  3J7A O;  3CTA A;  2COM A;  3PSF A;  1JKR C;  3JW4 A;  3I55 I;  1MJ9 A;  4JQF A;  4A12 A;  3RKX A;  2DQR A;  2Q2E A;  3G1O A;  4OIO F;  3ZQG A;  4IHW A;  4KT6 A;  1P9Q C;  3ABU A;  1E3O C;  3HHH A;  3S14 J;  1NTC A;  1WWX A;  2Y30 A;  2IW5 A;  3K4J A;  2MAB A;  2OPT A;  3DBL B;  3IV5 A;  4GFB A;  2XAU A;  1QZE A;  4HG2 A;  2D45 A;  1OCP A;  3H0G J;  2HTJ A;  2ZJ2 A;  5CVI A;  1BR4 A;  2JZY A;  2RDP A;  3CCR I;  3HSR A;  3DCF A;  1QPI A;  1FEX A;  4LMY A;  2BXZ A;  1W36 C;  3MAJ A;  1PP8 F;  4R8H A;  2QQ8 A;  2IT0 A;  4DIQ A;  2LTP A;  3ROU A;  2E7X A;  1O3T A;  3TW7 A;  5EG0 B;  2KJC A;  4ITV A;  3CC2 I;  2HVR A;  2VC1 A;  5F1J A;  5D6F A;  1ZGA A;  2ME0 A;  3SZT A;  3H5R A;  3W2W A;  3HXL A;  2E1O A;  4EM0 B;  1QZY A;  1JKO C;  5C4J J;  3T5X A;  2GAU A;  2IS1 A;  4RS8 A;  3DBH B;  1IXR C;  3TW6 A;  2HWV A;  2JMW A;  4M71 A;  3JRF A;  2OCE A;  1VND A;  1R5H A;  2W24 A;  2CQX A;  1GT0 C;  4M6Y A;  1K4T A;  2V6E A;  1GV5 A;  1QQI A;  2VAS A;  5K1Y A;  3MWM A;  2PMU A;  4LB5 A;  1GV2 A;  4BHB A;  4B44 A;  3V7R A;  2WWY A;  2H1K A;  2XGD A;  1YTY A;  2W00 A;  2OQG A;  1FMW A;  4IQJ A;  1FOY A;  2F2E A;  4IL6 C;  3WOD F;  4RBO A;  5KCM A;  4PJM A;  2VJJ A;  5GTH C;  2KJB A;  1FTZ A;  3TO6 A;  4HEA 2;  5TGT A;  4A93 J;  4ZYG A;  1XSX A;  5BQT A;  4II2 A;  2R7S A;  1XB4 A;  1IN4 A;  2M5W A;  2XGC A;  2WA0 A;  1FC3 A;  5BMZ A;  2KIQ A;  1YE9 A;  1FZP B;  1R6R A;  3F8N A;  1Y0N A;  2XPU A;  3OSG A;  2A6E F;  1JKQ C;  3HGG A;  1GXP A;  2V9P A;  4BE2 A;  2XAQ A;  2KDO A;  4QTR A;  3NWS A;  5DCF A;  5JHF A;  3QOE A;  4IEJ A;  5F1R A;  3OYA A;  4Q48 A;  3BR0 A;  3L7W A;  4Y7N J;  3CJR B;  3MMY B;  5LHI A;  5LRS A;  3N97 A;  1IRF A;  2M45 A;  4C3I J;  1G59 A;  3H9G A;  2QZ8 A;  2Z99 A;  1TLH B;  2R7Q A;  4JOM A;  5IP7 J;  4ESB A;  1RRJ A;  3C2G A;  3GTO J;  5FFZ A;  4Y15 A;  3BWG A;  1WZ2 A;  2E7W A;  2CSO A;  4DZJ A;  5B5E C;  1YX5 A;  1R1U A;  3L2C A;  2EJR A;  2MA3 A;  4DBQ A;  1U9O A;  5F6F A;  3L2W A;  2XUB A;  4C3H J;  4IRG A;  2VXZ A;  4FT8 A;  4G9Y A;  3CJN A;  5J1U A;  1BIA A;  2DPD A;  1FLI A;  2NVT J;  3O6B B;  2MBF A;  4IRI A;  1LE8 A;  2HYJ A;  3MFK A;  2EFN A;  2KRH A;  5GAH J;  2HOE A;  1TQP A;  2LP0 A;  3S1M J;  2IRF G;  1FOK A;  2DFF A;  4I02 A;  3JSO A;  5DDG A;  4ETS A;  1A35 A;  3DTI A;  2WY7 Q;  3KEO A;  2C6Y A;  1UEL B;  4QWQ A;  2VE8 A;  3QYB A;  2CGP A;  3I4P A;  3CP8 A;  2ZFW A;  4YEL A;  1OCT C;  1WJC A;  1ODD A;  1ENH A;  2H8R A;  2M30 A;  2OJE D;  4OAZ A;  2UWM A;  1HF0 A;  4PGG A;  1OFC X;  2UXX A;  3KP2 A;  1XGS A;  2H6B A;  1OYW A;  1U8R A;  1ON1 A;  5E3O A;  4CSW A;  4DOZ A;  4Y13 A;  2A61 A;  2XGE A;  1Z3X A;  1Q1H A;  2CQ7 A;  2X1D A;  2VE9 A;  1FBU A;  3OYM A;  1DP7 P;  1SC7 A;  4HV5 A;  5F64 A;  3ABL H;  3FDY A;  3I9V 2;  2R7F A;  1PJR A;  1LPQ A;  2WC2 A;  1MBH A;  1R9T J;  5K7Z A;  2FE3 A;  1J59 A;  1QBJ A;  1ZYR F;  4MGR A;  4NQW B;  2K9M A;  4AU7 A;  3FIW A;  4WF2 A;  1T38 A;  3MZ8 A;  1W0U A;  1HOM A;  2E71 A;  1XC5 A;  3Q0U A;  2DYR H;  4M3E A;  1TL8 A;  3FBN B;  1D0Y A;  4LG3 A;  4UUV A;  5IOY A;  1QVU A;  1MIJ A;  4Z6Y A;  3QYF A;  2WAD A;  2PN6 A;  1JT6 A;  2GOX B;  4I98 B;  3RYR A;  3TO7 A;  4LD5 A;  4AWX B;  4EJU A;  2NVX J;  3SYT A;  3HRT A;  3A2K A;  2XSJ C;  3DKX A;  3HOX J;  3SQN A;  3ASO H;  4CCN A;  3J7Z I;  3WGI A;  1KU9 A;  1WI9 A;  2E34 A;  4A0Y A;  2IGK A;  5A2Q K;  4EV0 A;  1LFU P;  2VLA A;  3BR1 A;  1SMY F;  3RYP A;  3K4L A;  5IT9 Z;  3HTS B;  3F8C A;  3SFZ A;  4CHU A;  3GXO A;  2M4K A;  5J6X A;  2EH3 A;  3K10 A;  3VYS B;  2HEO A;  1TWG J;  2MGQ A;  1OCZ H;  2J5O A;  3FM5 A;  4F92 B;  3HUG A;  3ZN0 A;  5FLV A;  2Y31 A;  2XRL A;  3JRD A;  5EGO A;  4JBA A;  3WTU C;  1MMD A;  5HDN A;  2IAI A;  4BEH A;  2XC7 A;  1VQK I;  5GAD J;  3WE3 A;  2XAJ A;  5FGM A;  4AC0 A;  1R36 A;  3KZY A;  1TC3 C;  4G8X A;  1HKT A;  2PFB A;  4B4C A;  1D0X A;  4G7H F;  1XPX A;  1MD0 A;  4A5N A;  5K7F A;  2CV0 A;  3HOW J;  1UMQ A;  2R4G A;  1QGP A;  4QPO A;  3OR1 C;  4CCK A;  3G6E I;  4O3M A;  5FB2 A;  4X0G A;  1XTA A;  1G3W A;  3I53 A;  5CVU A;  2CMP A;  2K9Q A;  2R5Y B;  3HIF A;  5EF6 A;  1X4P A;  2CH0 A;  3E7L A;  3M1E A;  3FHN A;  5CVR A;  1X2N A;  1BIB A;  4M3F A;  5M3F J;  4HLY A;  4NHJ A;  2P8T A;  3BCB A;  3KFW X;  4ZTJ A;  3ZGK A;  3BTL A;  2VKH A;  5DD4 A;  1C0W A;  4ENJ A;  2PJR A;  1OR7 A;  1IN8 A;  2RAE A;  1VTN C;  1G2H A;  2FEZ A;  2CUJ A;  3BR5 A;  2XAH A;  1ACI A;  2M87 A;  5FRM A;  2W48 A;  4HPQ A;  1X1A A;  3Q3S A;  1Y0U A;  3LSJ A;  1XS9 A;  3JSP A;  3MKL A;  2GA1 A;  4UVB A;  2HZD A;  4PJL A;  2GZW A;  3H3V K;  3G4S I;  4B8X A;  4F3Q A;  5AON A;  1U6G A;  3CDL A;  3PFY A;  2HVQ A;  2O8X A;  1EV7 A;  3M7G A;  4UVC A;  4C3J J;  2R5Z B;  2ZSH B;  1D1A A;  4CCJ A;  2VOO A;  2BW3 A;  3ISP A;  2KKO A;  4RM2 A;  3PO2 J;  3TQN A;  5DUK A;  3GFM A;  4L9J A;  5TIS C;  4EMS A;  4BYY A;  2QWW A;  1YYV A;  3B6C A;  4MIM A;  1L3L A;  3ZQL A;  4CCM A;  2IP2 A;  5LFA A;  3V4G A;  2FQ3 A;  4HRI A;  3HM5 A;  2JK3 A;  4KMU X;  4M9Z A;  4NC7 A;  1POG A;  2HR3 A;  2ZJR F;  2BYV E;  2J5P A;  2V1X A;  3GLX A;  2RN7 A;  1I1S A;  1X19 A;  2W1O A;  2DA2 A;  3FXM A;  1SD6 A;  5D5X B;  2W57 A;  4CA0 A;  2VUM J;  3CUO A;  3CCE I;  4AIK A;  2ELJ A;  3GTL J;  4XNF A;  2HKO A;  4RGU A;  5E20 A;  5IT3 A;  3ZR8 X;  5HOO A;  1IJW C;  4GRI A;  4JP0 A;  3HHG A;  4IO9 F;  3QPT A;  5F0C A;  3FMR A;  2MH9 A;  3V8K A;  4B48 A;  4P55 A;  3EUH C;  4BQA A;  2LFB A;  5JLW A;  1Y8R B;  1PUE E;  3RZO J;  3KP5 A;  1K6O A;  2NVY J;  3HPG A;  4M9X A;  3LSK A;  2UUZ A;  3BZK A;  1HSJ A;  1S7A A;  1SAU A;  1MMN A;  2WTE A;  5FFX A;  3GTK J;  1ETQ A;  5IPA A;  1LNW A;  3KLN A;  4UUS A;  2Y0S A;  3PFI A;  1N77 A;  4XRM A;  3WGH A;  1JJ8 C;  1M1E B;  3TL4 X;  1FJL A;  1YRN A;  3TO9 A;  1XGN A;  4J19 A;  1R1V A;  3CC4 I;  1MNE A;  4ZDL A;  1TWA J;  2DMP A;  3IHU A;  4BUP A;  1ZN2 A;  3ZXS A;  1D0Z A;  1RUN A;  3GBG A;  1EF4 A;  2LDU A;  5E3M A;  3S8P A;  1KQ8 A;  5J8C A;  2IVM A;  1ETK A;  1V54 H;  4B47 A;  1TNT A;  4A3K J;  1V5E A;  3EUA A;  4D7N A;  4FAS D;  1LEA A;  2JRT A;  3AFH A;  2NNY A;  1FNN A;  3WTZ A;  4YEJ A;  1LJ9 A;  3IRQ A;  4WXD A;  4KIS A;  3BQY A;  2O03 A;  3ZP5 A;  3FHZ A;  3AG1 H;  3GO5 A;  2X9D A;  3H9Q A;  3S3O A;  2ESH A;  4IZZ A;  3GTG J;  3S15 J;  2JRM A;  3O3K A;  3ESW B;  4F91 B;  2A3S A;  3TBI A;  2LKX A;  2ZC2 A;  3WU1 B;  5EEA A;  4L0Z B;  1TQM A;  1X1C A;  2VBZ A;  2XAS A;  3GZ5 A;  2VOP A;  3OYI A;  5HDG A;  1D1C A;  1NHA A;  2QGU A;  2W82 A;  3K70 D;  4IKF A;  2KIS A;  1KU3 A;  1X1D A;  4XLN F;  5D6E A;  4G94 A;  2Z9O A;  2QF7 A;  2EFW A;  1VQP I;  3K1P A;  4A5M A;  4RGS A;  2JA8 J;  2ICW G;  3CCL I;  4F52 A;  2O8K A;  4GXO A;  3DTE A;  4RGX A;  2R7T A;  2XIG A;  2IPQ X;  1IXC A;  4XOP A;  3HGY A;  1MMA A;  3S2D J;  3DP7 A;  3QRF F;  3GFL A;  3LFU A;  4V19 K;  2EZK A;  1F9N A;  4RM3 A;  3OYD A;  4KDP A;  4BY7 J;  3CCY A;  4IHV A;  5IOZ A;  2F48 A;  4NUB A;  3UNG C;  1JHF A;  3W2V A;  3R0A A;  5J4Y A;  3OYH A;  1AKH B;  2CQQ A;  2LBF A;  5JVG F;  2CS3 A;  3T0Y A;  1OKR A;  3EQL F;  1BR1 A;  1H88 C;  5F0F A;  4BGD A;  5CQE A;  3A03 A;  3CLO A;  3CCQ I;  3CF5 F;  1WHU A;  2Z2S B;  3HDD A;  1U5T A;  4BHC A;  1MSF C;  1JTY A;  2KPM A;  2LVS A;  3X2Q H;  2DBB A;  2QUF A;  2M1B A;  1WKM A;  1KZH A;  5IYC J;  1B6A A;  3DV8 A;  5E1W A;  3CF2 A;  4JX6 A;  2EIK H;  3GZ6 A;  5KAI C;  1QVT A;  3MQ0 A;  1O57 A;  2G0E A;  3S93 A;  5H20 A;  3JCU C;  3I54 A;  3N4M A;  2IGN A;  4BXF A;  1EH6 A;  1S3J A;  4HX8 A;  2AO9 A;  2ELK A;  3BTI A;  1WJ5 A;  1JUP A;  1BN5 A;  1BW6 A;  4P9U A;  2UV1 A;  3RPQ A;  5K5O A;  2BY0 A;  3GLL A;  1UZC A;  1B8I B;  2NOG A;  5GPC A;  1K78 A;  4AVZ A;  2K02 A;  4LG0 B;  2QVO A;  3K4N A;  1Z7L A;  2Y48 A;  2DK8 A;  2X1E A;  3EET A;  2WAQ N;  1CGP A;  2JA2 A;  3KZI C;  1HDD C;  5DTD A;  4OOI A;  1D3Y A;  4AVP A;  4N0B A;  2HZT A;  1NG7 A;  2P0W A;  1R22 A;  3P9C A;  1QO0 D;  4AYB N;  2WB1 A;  1QRY A;  3HRS A;  5E1X A;  1IDY A;  1FYK A;  1ZRC A;  2CUF A;  4MQV A;  1Z67 A;  3ERM A;  4XR6 A;  4YFX F;  4HST A;  3WTT C;  1Z05 A;  3DU5 A;  4HZF A;  2QYO A;  5BPI A;  1VQN I;  2GXB A;  1SD5 A;  2A07 F;  4A0X A;  1WH5 A;  1OQY A;  1BBY A;  2D1H A;  3PM1 A;  2WY8 Q;  4BQQ A;  1HW2 A;  3HKZ A;  1FT9 A;  5FKK A;  4CYC A;  1BI1 A;  2LH9 A;  3BG9 A;  1TWH J;  4E7I A;  2CU7 A;  2XF7 A;  1ETY A;  2TDX A;  4N4O B;  5BPD A;  3V7C A;  1VQM I;  3S2H J;  4JX4 A;  4H0E A;  1BJA A;  3QU3 A;  2PMZ A;  4LK1 F;  1BOB A;  1ZTR A;  2P6T A;  2R92 J;  1LB2 A;  1B9N A;  2BBY A;  3LOC A;  4M72 A;  3BPX A;  4PZJ A;  4KYW A;  4DW6 A;  4U7B A;  3RQI A;  4IQ4 A;  3CLQ A;  2A05 A;  3G1M A;  1WFX A;  2QQ9 A;  2ZME B;  4M73 A;  2E1M C;  1U2W A;  4XRS A;  2Z5U A;  2X48 A;  1X3U A;  4KIF A;  2CW7 A;  1D5Y A;  2K7L A;  2HYF A;  2K3F A;  2HTS A;  4CUG A;  1CF7 A;  2BGC A;  1UG0 A;  3H9J A;  4HF0 A;  1OIS A;  2OU2 A;  5DM6 F;  3DWL E;  2F6C A;  3ZMD A;  2Q0O A;  1PYV A;  2YPR A;  5HS7 A;  2G9W A;  4M6V A;  2DPU A;  1S8N A;  2IGM A;  4QLC U;  1OCC H;  2ISZ A;  1Q1V A;  4L18 B;  4BHP A;  1Y6I A;  1R00 A;  2O5R A;  3M8J A;  2GIV A;  2PLY A;  2R7Z J;  1XCB A;  3AL0 B;  3MKW B;  3S17 J;  2EZH A;  3BJA A;  2R7R A;  1XMA A;  4LFU A;  3KX2 A;  1AWC A;  4C9Y A;  3JRH A;  1Z21 A;  1RPW A;  3AG2 H;  1TBX A;  3IH2 A;  3L00 A;  4KN4 X;  1BL0 A;  3HOU J;  1PVE A;  2K85 A;  5EZG A;  1HW5 A;  3BG5 A;  2Q8K A;  1XN7 A;  2OQR A;  1RC9 A;  3K9T A;  2NOJ B;  2ID6 A;  3AG4 H;  4CH7 A;  2L9R A;  3Q0W A;  2XSD C;  4ZYE A;  5J1R A;  4U88 A;  3OYE A;  3F21 A;  4FX4 A;  4E4H A;  1EKE A;  3PSI A;  4S04 A;  3TED A;  1A6I A;  2O7O A;  3F3X A;  1YQA A;  2O0Y A;  2VPR A;  5H6Q A;  2VBW A;  5ICF A;  3T8T A;  3CJT B;  2F4I A;  3A1Y A;  3OMY A;  4M6X A;  3LA3 A;  3HOY J;  4D7M A;  3HOS A;  2A69 F;  2RGV A;  1S7O A;  2UZK A;  5CQG A;  4GYI A;  2YX4 A;  1FOX A;  4W97 A;  2NVU B;  3HYI A;  2OCC H;  4J00 A;  1Z91 A;  1J09 A;  1HST A;  3MKZ A;  2MW8 A;  5D5U B;  4ZDO A;  3Q0V A;  1I6X A;  4IX7 A;  5F04 A;  3NAR A;  4GYG A;  2L9S A;  2MH2 A;  3VYU B;  4AID A;  4BDY A;  1WJD A;  1Y1V J;  3RQ4 A;  3G71 I;  4CIC A;  2H1L A;  4HAM A;  4N9I A;  1V5G A;  3WE2 A;  3W3C A;  1U8B A;  2DAO A;  2DOE A;  3FX3 A;  2E60 A;  5IP9 J;  3QYE A;  2ZKZ A;  3SFI A;  2HDD A;  1SVL A;  1FP2 A;  2DLL A;  2EK5 A;  3ULQ B;  5TJJ A;  1MMS A;  2P5L C;  2AQF A;  1IUF A;  3DPU A;  1X3W B;  1F36 A;  2KLO A;  3IKV A;  4FX0 A;  4A3E J;  4ZZL A;  2VOD A;  1XD7 A;  4NC6 A;  5CJ9 A;  3P9K A;  3D5S C;  1IW7 F;  1XCV A;  2KRF A;  3BTJ A;  3OS2 A;  3CME I;  2LY1 A;  5KVR A;  4XKB A;  1DPR A;  3SDG A;  1ZG1 A;  5DCM A;  5B66 C;  5BNG A;  1HXD A;  4NC8 A;  2PJR B;  2M9H A;  3ZMT A;  2DA7 A;  5EDN A;  1H0M A;  4I01 A;  2X6X A;  4MEY F;  3W6J B;  4UUT A;  2R7U A;  4E7K A;  4EM1 A;  1W36 D;  3BP8 A;  1GDT A;  1MW7 A;  1YW7 A;  2VQL A;  1P2F A;  3IAM 2;  2W7N A;  4U0W A;  1FIA A;  3DFG A;  1J7K A;  3FKI J;  2FBI A;  3CQZ J;  5J4V A;  3BR3 A;  1TWF J;  4CDG A;  5ILV A;  1KA8 A;  1SD7 A;  2V9V A;  2L7M P;  2ZXW H;  4A3I J;  5DM7 F;  2ZXH A;  2IS6 A;  2PG4 A;  1WJE A;  3M4O J;  4YRV A;  1SEU A;  3IAS 2;  3UKG A;  3MD2 A;  4WXH A;  2CG4 A;  4XSX F;  1I1G A;  4KNY A;  2VKV A;  1MDM B;  4A3B J;  1ETX A;  3I56 I;  4AIH A;  2KRC A;  2EZI A;  3D0S A;  4ZZD A;  1U78 A;  5GPA A;  2K5C A;  3DEU A;  2VKD A;  3I59 A;  4E7L A;  1BR2 A;  2I8D A;  3KPH A;  4RAG A;  3ECH A;  1RKW A;  1ZKG A;  3LSM A;  1V4R A;  1JUM A;  1MZB A;  3RPU D;  3TP3 A;  2DTZ A;  2K3P A;  4YFK F;  2M7A A;  4ZDP A;  2LRE A;  5IT9 K;  3PL8 A;  4JX5 A;  4BE0 A;  1U0J A;  4MTD A;  1U5T C;  3D1N I;  3I3L A;  1O3R A;  3HEF A;  1R7J A;  2E2H J;  3GZN B;  3PNT A;  3WG9 A;  3FXL A;  4LLL A;  4A3J J;  1GXQ A;  3Q5F A;  1FPQ A;  2DJI A;  2L4M A;  1GUU A;  1PUF A;  1ZEL A;  2L7Z A;  3VSL A;  2E19 A;  1MMG A;  3MVP A;  1IV8 A;  2KHM A;  3H5A A;  1A04 A;  2CJJ A;  1FBQ A;  4FCY A;  2LY2 A;  3HTU A;  1LDK B;  1K7A A;  3SZG A;  2CV2 A;  3U2R A;  5JI6 A;  3H35 A;  1E2X A;  2KDZ A;  1FTT A;  5F08 A;  2DDB A;  1YRN B;  2K4J A;  1YIT I;  1RUO A;  2QBY B;  4UB6 C;  4XOT A;  5L3E A;  2FRH A;  2VL8 A;  2M0M A;  4RB3 C;  1YJW I;  3F22 A;  2JSC A;  3A02 A;  1YFH A;  2NS0 A;  4FIS A;  2XB0 X;  4KUM A;  2EA2 A;  4G6D A;  5K5Q A;  3KP3 A;  3G73 A;  3CO7 C;  3PIP F;  3CMA I;  1YIO A;  4U0Y A;  3DU6 A;  4HQE A;  1G4D A;  5AIP A;  5KNL A;  2R93 J;  2DQL A;  3KP6 A;  1A36 A;  2FBK A;  2P5V A;  1KON A;  2VQH A;  3FXO A;  2RC4 A;  1FP1 D;  4XLP F;  4RB0 A;  2CW8 A;  3RZD J;  4Y3O A;  1ZAR A;  3WHC A;  1G8X A;  2X6W A;  3PUB A;  2HNH A;  2R7O A;  3FK6 A;  3FK7 A;  4IXA A;  2HXO A;  3I64 A;  2IA2 A;  2HOA A;  3A4C A;  3DBR B;  3L09 A;  2K9N A;  3IP4 B;  4OMY A;  1IZ1 A;  1YO5 C;  2P4W A;  3FXJ A;  3MKY B;  2D1V A;  3HOV J;  2QSF X;  3RKW A;  1HKQ A;  4M3D A;  4GCV A;  4II3 A;  1K4S A;  3E6B A;  1RI7 A;  1MBF A;  1P92 A;  4EGZ A;  1I5Z A;  2EIN H;  4LB6 B;  5FKO A;  4HDU A;  3BC8 A;  3T8R A;  4KFC A;  4RAY A;  5M5Y J;  4A6E A;  1B72 B;  4ABZ A;  4P96 A;  2GBY A;  5J40 A;  1YG2 A;  4E70 A;  3CUQ A;  1WVR A;  3GF2 A;  1DDN A;  5CLS A;  1O4X A;  2E2I J;  2ECB A;  4R1H A;  2WV0 A;  1R4N B;  2LLK A;  3ABT A;  2VKE A;  1FMV A;  3K2A A;  4Y33 A;  4RA2 A;  4F93 B;  5L3D A;  1G3Y A;  2OZU A;  1WI3 A;  5EG0 A;  1LFB A;  2H09 A;  1T0F C;  2I5U A;  4PFO A;  2M7B A;  3QOD A;  5CPR B;  2MSY A;  1W7P B;  3IKT A;  2WAE A;  3KCC A;  5HOD A;  4XN0 A;  2XRO A;  4NB5 A;  4XBF A;  5FLM J;  4U87 A;  2VQC A;  1VQL I;  3NRV A;  3L2U A;  5F27 A;  5H2F C;  2MFZ A;  2ZXI A;  3H92 A;  2FJ1 A;  2R7D A;  2HYG D;  4ASN A;  3JRI A;  3UR3 C;  3DPT A;  3S3N A;  2ZBK A;  3TOB A;  3ZOB A;  1UCR A;  4RDU A;  4B1R A;  1WSU A;  4LLG F;  4XMY A;  1IN6 A;  2VJI A;  2KMU A;  4Y4R A;  3TKY A;  4DNC A;  1U3E M;  4I0B A;  2E1N A;  2M34 A;  2LC2 A;  3F8B A;  1X2M A;  1F1Z A;  1RR7 A;  5HLI A;  2KIU A;  3PUF A;  3ZQC A;  3VWB A;  5F0H A;  1UAA A;  1HLV A;  2FSW A;  5KK1 A;  2ID3 A;  3WU2 C;  3OY9 A;  3CMM A;  1IN7 A;  2YU3 A;  3B73 A;  3C3W A;  4ON0 A;  2OF7 A;  2BE5 F;  2ZJQ F;  2DN0 A;  3A01 B;  3J80 Z;  2IA0 A;  2LKS A;  4D1Q A;  3QPS A;  1LKX A;  4MQ9 F;  1LDD A;  4V2F A;  3H5N A;  5GAE J;  4MFE A;  4P1W A;  1YJ9 I;  5A2Q Z;  2YU9 J;  4E7Z A;  5ICG A;  1E3P A;  5GP9 A;  3ZQF A;  3DEE A;  4I6Z A;  4XN3 A;  1TT5 B;  2W25 A;  1KYW A;  1X58 A;  2CFX A;  2CWE A;  1ZHF A;  1XDU A;  2G7H A;  3RSN A;  3KE2 A;  1S72 I;  2GXG A;  5BS6 A;  1ZH5 A;  4RB1 A;  2YS9 A;  4CXF A;  2E35 A;  3PQK A;  2MD5 A;  1MBE A;  3SDB A;  1W1W E;  4YG2 F;  3CCS I;  1QU3 A;  4KMF A;  2M2E A;  4GDF A;  5FLX K;  2VT2 A;  2DJN A;  4WWC A;  1ERD A;  1ZG3 A;  4HF1 A;  3IRR A;  4RAZ A;  4MNU A;  3QQA A;  4HLX A;  1FBS A;  2ADU A;  4BS9 A;  2DA3 A;  4L9T A;  2LF7 A;  3FWE A;  5JHU A;  2DW4 A;  1VFC A;  2XPW A;  2KIM A;  2JUG A;  3WTY C;  2DMU A;  1QZZ A;  5L3G A;  1TP4 A;  2K40 A;  2OTJ I;  1TNS A;  2CQK A;  4DYR A;  3E97 A;  5DD8 A;  3CCU I;  2CV1 A;  4G12 A;  5DEQ A;  5B1A H;  4LGW A;  4L9V A;  3RJP A;  3GTQ J;  3V8L A;  4HOB A;  4M74 A;  4XON A;  3E0J B;  2BVM A;  3LAP A;  3BR6 A;  2DMN A;  2Y0S N;  1YHQ I;  2GM4 A;  2X51 A;  1DP3 A;  4KIC A;  1A5J A;  4FET A;  2VN2 A;  3OOP A;  2V1N A;  4BQN A;  5D5W B;  1ZGJ A;  5LHG A;  4KA4 A;  1S7E A;  2IXS A;  5LGN A;  1W5S A;  4XRF A;  4GGG A;  2E2J J;  1JKP C;  1IGN A;  1XMX A;  2IA1 A;  4FHT A;  2STW A;  1Z0X A;  3OYJ A;  1H9G A;  5E3N A;  2HQA A;  3JRE A;  5FKM A;  2GA2 A;  2KQR A;  5CVV A;  4A3F J;  4IHY A;  3E3V A;  3K70 C;  5LGU A;  4HYE A;  1T33 A;  2O61 A;  1YIJ I;  1MJA A;  2Q1Z B;  3G1L A;  2Y2Z A;  4WCG A;  2ZJP F;  4XOR A;  4IHS A;  1WRJ A;  4ZC3 A;  2VC0 A;  3SZP A;  1Y1W J;  1YS7 A;  1Z6T A;  3T1B A;  3RIR A;  3AKZ A;  4NQW A;  1JJ6 C;  4U0V A;  4L0Y B;  5EYR A;  2Y75 A;  2EFO A;  4RGR A;  1T98 A;  1VQ5 I;  2PBI A;  4Q4Z F;  2ELH A;  4L5J A;  5CVJ A;  4L5E A;  4XLF A;  1IRZ A;  1I39 A;  4LIV A;  3ECO A;  5JFR A;  4OAY A;  2Q2E B;  2R7W A;  1BC7 C;  5H6R A;  1KYZ A;  2AHQ A;  4Q47 A;  2PJP A;  3VSK A;  1DGW Y;  3HOZ J;  2XVC A;  9ANT A;  5EZH A;  5C4X J;  4M9S A;  4BU2 A;  2X4H A;  4KJZ A;  1IF1 A;  4M3G A;  4CYD A;  2BV6 A;  4QPQ A;  1WH7 A;  3PNV A;  4UB8 C;  4ZYH A;  3J7A Y;  4PSW A;  1QNT A;  3KP4 A;  3EYI A;  1RZ4 A;  5J1Y A;  1ZGW A;  2V9K A;  3OS1 A;  2R3S A;  5LGT A;  2XKO A;  2NYX A;  1V3F A;  1W5T A;  3H3Z A;  5LHH A;  3KP7 A;  4XLA A;  1VQO I;  3TDU C;  4A3M J;  5C3E J;  1LQ1 A;  4HBL A;  3B6A A;  1XSD A;  4H4K C;  1KQ0 A;  4BBR J;  3DTK A;  3FXU A;  4WX9 A;  3M8F A;  2DFH A;  1SD4 A;  1I27 A;  2JA7 J;  4BQO A;  5IP6 A;  2W84 A;  3U21 A;  1IO2 A;  2DA4 A;  1TW2 A;  3DKW A;  3H3U A;  4BY1 J;  1RR8 C;  3S1R J;  4YII A;  2K27 A;  5IY5 H;  2R5Y A;  2EA4 A;  3AAF A;  4HDV A;  2YR2 A;  4L5I A;  5LBQ A;  4E7J A;  1JGG A;  3LMM A;  2O3F A;  2PX9 A;  1DUX C;  3U1K A;  1AU7 A;  3E5X A;  1JUS A;  1BW5 A;  4LK0 F;  2L02 A;  3DQV C;  1OLT A;  1R58 A;  3CMY A;  2NRA C;  4RMN A;  5KHD A;  3FMQ A;  2F5F A;  5M3M J;  4KT5 C;  1ON2 A;  3WHB A;  3PO3 J;  1AA7 A;  4BAY A;  1X3Z B;  5D8L B;  4ENK A;  3I71 A;  3CCJ I;  2FOW A;  4E7S A;  4D9J A;  5EJC A;  2WB1 N;  3VOD A;  2HU9 A;  2OUM A;  1PP7 U;  2X1C A;  2X85 A;  4B43 A;  3S2W A;  4ZYD A;  3HZJ A;  2QKL B;  1LVA A;  4EJV A;  3HBL A;  4AD9 A;  1OCO H;  2FNP A;  4G7O F;  3HKZ N;  2LF8 A;  2R5Z A;  3G3Z A;  3AG3 H;  4HNV A;  2DK5 A;  4A3G J;  2M8G X;  1T2K A;  2YX7 A;  1RNL A;  2LG4 A;  3CCV I;  2JPC A;  2H27 A;  1E3H A;  3TDZ C;  5JR3 A;  1BI2 A;  3CUQ C;  2BY2 A;  3J81 Z;  3K4K A;  2PMZ N;  3ERE D;  2PQ8 A;  4EGY A;  2V7F A;  5DV5 A;  2QCO A;  4E7H A;  4PSX A;  2BY3 A;  1XX5 A;  2OC6 A;  2R7V A;  1UB9 A;  3BZC A;  4B09 A;  5J8F A;  1JT0 A;  2NAZ A;  1G6N A;  3GFI A;  3JRG A;  2DFI A;  3NAU A;  4ENM A;  1FWZ A;  2EWN A;  3QWL A;  4D5C A;  1LE8 B;  2MD0 A;  3K4M A;  4MEX F;  3BOQ A;  2FML A;  1JHH A;  3NWT A;  4ZYA A;  4DBR A;  5HLT A;  2O6G E;  3ZCO A;  3K0L A;  3D5L A;  1OR7 C;  2VBX A;  3C2H A;  3CDI A;  4YIF A;  2FQ4 A;  3DKY A;  2ZXJ A;  1YX3 A;  2A6T A;  1ZRE A;  1VZ0 A;  3LSI A;  3ZN1 A;  2L0K A;  1I6H J;  1LFP A;  3VDX A;  2EV5 A;  1ETW A;  1SVM A;  4EEF G;  3IH4 A;  3JTH A;  1QPM A;  4D5F A;  2EB7 A;  1D8K A;  4DYQ A;  1H9T A;  2NS8 A;  1MBG A;  3I0T A;  4PCQ A;  2ZFU A;  1AHD P;  4C2M J;  1H8A C;  2LY9 A;  1REP C;  1R1T A;  3KIO A;  4U7D A;  2NVQ J;  2M8E A;  3S1N J;  2CUE A;  2HQN A;  5FD5 A;  5D5V B;  1D5V A;  3H36 A;  3E6C C;  1O3Q A;  1MH3 A;  2E1C A;  2XAF A;  4HX4 A;  1L0O C;  2L9V A;  2XHK A;  2QEN A;  1R71 A;  3L1P A;  1JXS A;  3EDP A;  2CYY A;  2F5E A;  4AUX A;  2NXN B;  1UG2 A;  1UHM A;  3BT9 A;  3N05 A;  3R61 A;  4LJZ F;  5HVQ C;  3GUD A;  2HOS A;  3P9I A;  2KFD A;  3RKY A;  3V42 A;  1K61 A;  1MGT A;  1N75 A;  4OWR B;  4IF4 A;  3ZMZ A;  3K1M A;  1FYM A;  3GTP J;  3IWF A;  3PJR A;  1HQC A;  2XRN A;  1OMI A;  5ED4 A;  2JA5 J;  4I99 C; 
#chains in the Genus database with same CATH homology
 1LDJ A;  3ELK A;  1B4A A;  1KU2 A;  1ONV A;  1Z1D A;  4MHG A;  1ZAO A;  4UXN A;  3QOP A;  5ERI A;  3BZ6 A;  1KGS A;  3BJ6 A;  3CUQ B;  3SXY A;  4YFN F;  3ZPL A;  4CGZ A;  2XAG A;  4RB2 C;  3MZH A;  2VBY A;  3ZMS A;  4G7Z F;  1XGO A;  1F5T A;  5LRR A;  1TQI A;  5JVT A;  4O6J A;  1USS A;  2ESN A;  5D4S A;  1XSV A;  3GW2 A;  5HDK A;  1Z6R A;  5FD6 A;  2EFP A;  2VT3 A;  4KIB A;  3F23 A;  2VON A;  4OIN F;  4S05 A;  4MTE A;  3RDI A;  3EUH A;  1ZRD A;  2PEX A;  4ESF A;  1T6S A;  5HLH A;  3LQR A;  3JAM Z;  3V8J A;  2LSO A;  4K2E A;  2FF4 A;  3U9G A;  1S6L A;  4LG0 A;  1GHC A;  3F8F A;  4HW0 A;  2DTR A;  2XV4 S;  3KET A;  2ZO4 A;  1FY7 A;  2YSR A;  3TOA A;  1TW3 A;  3M8E A;  4P5O A;  1J9I A;  2MLG A;  1FSE A;  2JT1 A;  3VEP A;  6PAX A;  2UXN A;  2AXL A;  5ILS A;  4A2U A;  4I2O A;  1IRG A;  3QU6 A;  4ESJ A;  1K79 A;  2HKX A;  3VOE A;  2P6S A;  1YW9 A;  5CYV A;  4WK8 F;  3GEZ A;  4IRH A;  1SMT A;  1R5G A;  3LAJ A;  2PMH A;  3BJO A;  2ZME A;  2P5K A;  3K1N A;  1B1B A;  3LST A;  5FO5 A;  3FMS A;  2FNA A;  2DU9 A;  4EJW A;  3QP5 A;  4I09 A;  3V7S A;  5L3F A;  2V79 A;  1XGM A;  1E17 A;  5ILU A;  4OIR F;  1LEB A;  4LLN A;  2XGX A;  2OAZ A;  1ZRF A;  3DPL C;  2EFQ A;  1W7P D;  4EJO A;  2F5C A;  1EH8 A;  3HRM A;  3FF5 A;  3DF8 A;  4R79 A;  3HSE A;  3QPH A;  1J0R A;  1MKM A;  1BI3 A;  2QQA A;  3R4K A;  4N9H A;  4EQQ A;  4KIG A;  3CO6 C;  2L4A A;  3VFZ A;  3NEU A;  3QAH A;  4BXU A;  3SHF A;  3VB2 A;  3IC7 A;  3GWZ A;  4XSZ F;  3RI4 A;  1P6R A;  1BM9 A;  1S29 A;  2ZCW A;  2OA4 A;  1GVJ A;  3WU0 A;  3J80 K;  4UVA A;  4UHT A;  2W85 A;  2L01 A;  4HX7 A;  2OBP A;  2P7C B;  3ML6 A;  1YLF A;  3HSF A;  1OYI A;  2GQQ A;  4EJT A;  1G3S A;  3IL2 A;  4GO1 A;  2HDC A;  4WXC A;  3E5U A;  3QP6 A;  1U5T B;  3EYY A;  3M9A A;  2ACJ A;  3KLO A;  4Q5S F;  5D8K B;  5E8G A;  5LLQ A;  3NQO A;  3ZQ7 A;  1YW8 A;  3GVA A;  2HS5 A;  2MLK A;  2K86 A;  3BDD A;  3L9F A;  1Z7U A;  1K78 B;  4TV7 A;  2ETH A;  5DUI A;  3LWF A;  2RKH A;  2FXA A;  1O7F A;  5E1Z B;  4PGH A;  3ZMU A;  3I5U A;  5HS9 A;  4KN7 X;  2X0L A;  1TTY A;  3B02 A;  3BPV A;  1R23 A;  3LQQ A;  2H6C A;  2H94 A;  1T39 A;  2D2W A;  1PDN C;  1J5Y A;  4HV6 A;  2GWR A;  2CW0 F;  1DPU A;  2DO7 A;  5E18 F;  1MDM A;  1B59 A;  3MEX A;  4UNO A;  1YS6 A;  4P9F A;  1ZLK A;  3R60 A;  5TRD A;  2QQB A;  1WQ2 A;  5E17 F;  1W4M A;  1MJB A;  2V1D A;  1OYY A;  3K2Z A;  5BOX A;  3FXQ A;  1CF7 B;  3MZY A;  5L3B A;  4G6Q A;  4JK1 X;  3F72 A;  4OMZ A;  3U1D A;  5ICE A;  5EEH A;  2JPB A;  4ZH4 F;  3MCZ A;  4IJA A;  1IAW A;  5E8I A;  2A5Y B;  1BOA A;  5HLG A;  1D8J A;  3DXJ F;  4A0Z A;  3C7J A;  4IPA A;  4F7Z A;  2ZNZ A;  1P4A A;  2QBY A;  2CO5 A;  3BRO A;  2F5D A;  1J75 A;  3LA7 A;  2OD5 A;  1SFX A;  3W6K B;  3C18 A;  2FOK A;  2QLZ A;  4O5V A;  3GYH X;  3WTX C;  5EEG A;  2HQR A;  4EVI A;  3ZMV A;  2ZNY A;  4UV9 A;  2IJL A;  1RIO H;  2K4B A;  3RPU A;  5LEK A;  2EV6 A;  3GX4 X;  4DQ2 A;  5FLX Z;  1P4X A;  1UHW A;  2Z33 A;  2PI0 A;  1SFE A;  1XMK A;  2V6C A;  1FSH A;  2HGC A;  5K5R A;  2HFH A;  4OU0 A;  1G3T A;  2BEO A;  4Y17 A;  2Y0M A;  2QM3 A;  4UV8 A;  3OV8 A;  1BI0 A;  1HBX G;  3KZZ A;  1O7L A;  3J81 K;  4I7H A;  1ZLJ A;  2RVC A;  1AOY A;  3LA2 A;  3BY6 A;  1IXS B;  4BH9 A;  3Q9S A;  3FZV A;  4PDK A;  2JTV A;  1IUY A;  3O2P E;  3F6V A;  4ENN A;  1STZ A;  1W7P A;  4BNC A;  4OIP F;  4HF2 A;  3R0J A;  4D0P A;  5DCM B;  1P4W A;  4Z2Y A;  3WTV C;  3F6O A;  2V1U A;  1SFU A;  3HOT A;  3WTW C;  1EH7 A;  4HQM A;  3CDH A;  5ICC A;  1XDS A;  3C1D A;  2A6H F;  1HW1 A;  2FMY A;  4A6D A;  5DYM A;  5LEJ A;  3Q9V A;  1IN5 A;  2EV0 A;  4HA8 A;  1Z9C A;  3REO A;  2RV8 A;  3KEQ A;  1F4K A;  3JTG A;  3E6M A;  1UST A;  2KIF A;  3P7N A;  5AIQ A;  1KU7 A;  2L3D A;  2A68 F;  2FBH A;  3I59 B;  1BC8 C;  2Z3Y A;  5HS8 A;  2RQP A;  2DT5 A;  1J2X A;  2RNJ A;  3RTR A;  3PQJ A;  1JGS A;  1FX7 A;  1ULY A;  2FA5 A;  1FYL A;  3TGN A;  2LNB A;  1SAX A;  1UFM A;  2NNN A;  1ZG5 A;  5D4R A;  2XKP A;  4OIQ F;  1B9M A;  4EM2 A;  1HKS A;  3WTS C;  4IHT A;  1KQ9 A;  2MC3 A;  3F8M A;  2ISY A;  2P7V B;  3I58 A;  2L54 A;  3K69 A;  1T0F A;  4CO8 A;  1OPC A;  3R6S A;  4I0A A;  2OZ6 A;  2DI3 A;  2G7U A;  3WGG A;  4IVN A;  1JE8 A;  3E6D A;  3COA C;  2STT A;  3HRU A;  3LFK A;  2LKP A;  4AIJ A;  1O3S A;  3GFJ A;  4CZZ A;  3E5Q A;  2B0L A;  5L3C A;  3JAM K;  3IWZ A;  3FM3 A;  4L9N A;  2FU4 A;  3FXR A;  3J7A O;  3CTA A;  2COM A;  3JW4 A;  1MJ9 A;  4JQF A;  4A12 A;  3RKX A;  2DQR A;  2Q2E A;  4OIO F;  3ABU A;  3HHH A;  1WWX A;  2IW5 A;  2D45 A;  2HTJ A;  2ZJ2 A;  5CVI A;  2JZY A;  2RDP A;  3HSR A;  4LMY A;  3MAJ A;  1PP8 F;  4R8H A;  2IT0 A;  3ROU A;  2E7X A;  1O3T A;  2KJC A;  2VC1 A;  5D6F A;  1ZGA A;  3SZT A;  4EM0 B;  1QZY A;  3T5X A;  2GAU A;  4RS8 A;  1IXR C;  2HWV A;  4M71 A;  1R5H A;  2W24 A;  4M6Y A;  5K1Y A;  1QQI A;  3MWM A;  2PMU A;  4LB5 A;  4BHB A;  3V7R A;  2WWY A;  1YTY A;  2OQG A;  2F2E A;  3WOD F;  2KJB A;  3TO6 A;  4ZYG A;  1XSX A;  5BQT A;  1XB4 A;  1IN4 A;  2M5W A;  1FC3 A;  5BMZ A;  1FZP B;  3F8N A;  2A6E F;  1GXP A;  2XAQ A;  5DCF A;  5F1R A;  4Q48 A;  5LRS A;  3L7W A;  5LHI A;  3N97 A;  1IRF A;  2M45 A;  2QZ8 A;  2Z99 A;  1TLH B;  4ESB A;  5FFZ A;  4Y15 A;  3BWG A;  2E7W A;  2CSO A;  1R1U A;  3L2C A;  2EJR A;  2MA3 A;  5F6F A;  2XUB A;  4IRG A;  2VXZ A;  4FT8 A;  4G9Y A;  3CJN A;  1BIA A;  2DPD A;  1FLI A;  3O6B B;  2MBF A;  4IRI A;  3MFK A;  2EFN A;  2HOE A;  1TQP A;  2IRF G;  1FOK A;  4I02 A;  3JSO A;  5DDG A;  4ETS A;  3KEO A;  2C6Y A;  4QWQ A;  2VE8 A;  2CGP A;  3I4P A;  2ZFW A;  1ODD A;  2M30 A;  2UWM A;  4PGG A;  2UXX A;  3KP2 A;  1XGS A;  2H6B A;  1OYW A;  1U8R A;  1ON1 A;  4Y13 A;  2A61 A;  1Q1H A;  2VE9 A;  1FBU A;  1DP7 P;  4HV5 A;  5F64 A;  2R7F A;  2WC2 A;  2FE3 A;  1J59 A;  1QBJ A;  1ZYR F;  4MGR A;  4WF2 A;  1T38 A;  4UUV A;  2PN6 A;  4I98 B;  3RYR A;  4AWX B;  3TO7 A;  4LD5 A;  4EJU A;  3HRT A;  3SQN A;  3WGI A;  1KU9 A;  1WI9 A;  5A2Q K;  4A0Y A;  4EV0 A;  1SMY F;  3RYP A;  5IT9 Z;  3HTS B;  3F8C A;  3SFZ A;  4CHU A;  3GXO A;  5J6X A;  2HEO A;  2J5O A;  3FM5 A;  3HUG A;  3ZN0 A;  4JBA A;  3WTU C;  5HDN A;  3WE3 A;  2XAJ A;  5FGM A;  1R36 A;  3KZY A;  4G8X A;  1HKT A;  2PFB A;  4G7H F;  1MD0 A;  4A5N A;  1QGP A;  4O3M A;  5FB2 A;  1G3W A;  3I53 A;  5CVU A;  3HIF A;  3M1E A;  5CVR A;  1BIB A;  4HLY A;  4NHJ A;  2P8T A;  3KFW X;  5DD4 A;  1C0W A;  4ENJ A;  1OR7 A;  1IN8 A;  1VTN C;  2FEZ A;  2XAH A;  2M87 A;  1Y0U A;  3JSP A;  2GA1 A;  4UVB A;  2GZW A;  4B8X A;  5AON A;  1U6G A;  3M7G A;  2O8X A;  1EV7 A;  4UVC A;  2VOO A;  3ISP A;  2KKO A;  3TQN A;  5DUK A;  3GFM A;  4L9J A;  4EMS A;  4BYY A;  2QWW A;  1YYV A;  1L3L A;  2IP2 A;  3V4G A;  2FQ3 A;  4KMU X;  4M9Z A;  2HR3 A;  2BYV E;  2J5P A;  2V1X A;  3GLX A;  2RN7 A;  1I1S A;  1SD6 A;  5D5X B;  2W57 A;  3CUO A;  4AIK A;  2HKO A;  4RGU A;  5E20 A;  5IT3 A;  5HOO A;  3HHG A;  3QPT A;  3FMR A;  2MH9 A;  3V8K A;  4P55 A;  4BQA A;  1PUE E;  3KP5 A;  1K6O A;  4M9X A;  1HSJ A;  1S7A A;  2WTE A;  5FFX A;  1LNW A;  3KLN A;  3PFI A;  3WGH A;  3TO9 A;  1XGN A;  1R1V A;  3IHU A;  1ZN2 A;  1RUN A;  2LDU A;  1KQ8 A;  5J8C A;  2IVM A;  1TNT A;  1LEA A;  2JRT A;  2NNY A;  1FNN A;  3WTZ A;  1LJ9 A;  3IRQ A;  4WXD A;  3ZP5 A;  2O03 A;  3FHZ A;  3GO5 A;  2ESH A;  3O3K A;  2A3S A;  3WU1 B;  4L0Z B;  1TQM A;  2VBZ A;  2XAS A;  3GZ5 A;  2VOP A;  5HDG A;  1NHA A;  1KU3 A;  4XLN F;  5D6E A;  4G94 A;  2Z9O A;  2EFW A;  3K1P A;  4A5M A;  4RGS A;  4GXO A;  4RGX A;  2XIG A;  2IPQ X;  1IXC A;  3DP7 A;  3QRF F;  3GFL A;  1F9N A;  4KDP A;  1JHF A;  3R0A A;  3T0Y A;  1OKR A;  3EQL F;  3CLO A;  1U5T A;  4BHC A;  2DBB A;  2QUF A;  2M1B A;  1WKM A;  1B6A A;  3DV8 A;  5E1W A;  3GZ6 A;  3MQ0 A;  1O57 A;  5H20 A;  3I54 A;  3N4M A;  1EH6 A;  1S3J A;  4HX8 A;  1BN5 A;  4P9U A;  5K5O A;  3RPQ A;  1K78 A;  2K02 A;  4LG0 B;  2QVO A;  2Y48 A;  2DK8 A;  3EET A;  1CGP A;  4OOI A;  1D3Y A;  4AVP A;  4N0B A;  2HZT A;  1R22 A;  3P9C A;  1QO0 D;  3HRS A;  5E1X A;  1FYK A;  1ZRC A;  4MQV A;  4YFX F;  3WTT C;  1Z05 A;  4HZF A;  2QYO A;  5BPI A;  2GXB A;  1SD5 A;  2A07 F;  4A0X A;  1BBY A;  2D1H A;  1HW2 A;  1FT9 A;  1BI1 A;  2TDX A;  5BPD A;  3V7C A;  4H0E A;  1BJA A;  3QU3 A;  4LK1 F;  2P6T A;  1LB2 A;  1B9N A;  2BBY A;  4M72 A;  3BPX A;  4PZJ A;  4KYW A;  4U7B A;  2QQ9 A;  2ZME B;  4M73 A;  1U2W A;  2Z5U A;  1X3U A;  4KIF A;  2K7L A;  2HYF A;  2HTS A;  1CF7 A;  2BGC A;  4HF0 A;  2OU2 A;  3ZMD A;  2Q0O A;  2YPR A;  5HS7 A;  2G9W A;  2DPU A;  1S8N A;  4QLC U;  2ISZ A;  4L18 B;  4BHP A;  1R00 A;  2GIV A;  2PLY A;  1XCB A;  3BJA A;  1XMA A;  4LFU A;  1AWC A;  1TBX A;  3L00 A;  4KN4 X;  1HW5 A;  2Q8K A;  1XN7 A;  2OQR A;  3K9T A;  4ZYE A;  4U88 A;  3F21 A;  4FX4 A;  4S04 A;  3F3X A;  1YQA A;  2O0Y A;  5H6Q A;  2VBW A;  5ICF A;  3T8T A;  4M6X A;  3LA3 A;  3HOS A;  2A69 F;  2RGV A;  2UZK A;  1S7O A;  4GYI A;  2YX4 A;  3HYI A;  1Z91 A;  1HST A;  5D5U B;  1I6X A;  4GYG A;  2MH2 A;  4CIC A;  4N9I A;  4HAM A;  3WE2 A;  2DAO A;  3FX3 A;  2ZKZ A;  1FP2 A;  2DLL A;  2EK5 A;  3ULQ B;  5TJJ A;  2P5L C;  3IKV A;  4FX0 A;  4ZZL A;  2VOD A;  1XD7 A;  5CJ9 A;  3P9K A;  1IW7 F;  1XCV A;  2KRF A;  5KVR A;  1DPR A;  1ZG1 A;  5DCM A;  1HXD A;  3ZMT A;  1H0M A;  4I01 A;  4MEY F;  3W6J B;  4EM1 A;  3BP8 A;  1YW7 A;  1P2F A;  4U0W A;  3DFG A;  1J7K A;  2FBI A;  4CDG A;  5ILV A;  1KA8 A;  1SD7 A;  2V9V A;  2PG4 A;  4WXH A;  2CG4 A;  4XSX F;  1I1G A;  4KNY A;  1MDM B;  4AIH A;  3D0S A;  4ZZD A;  1U78 A;  3DEU A;  3I59 A;  3ECH A;  1V4R A;  1MZB A;  4YFK F;  5IT9 K;  4MTD A;  1U5T C;  1O3R A;  1R7J A;  3WG9 A;  4LLL A;  1GXQ A;  3Q5F A;  1FPQ A;  2L4M A;  1A04 A;  1FBQ A;  3HTU A;  1LDK B;  1K7A A;  3U2R A;  5JI6 A;  1E2X A;  2K4J A;  1RUO A;  2QBY B;  5L3E A;  2FRH A;  4RB3 C;  3F22 A;  2JSC A;  1YFH A;  2NS0 A;  4KUM A;  2EA2 A;  4G6D A;  5K5Q A;  3KP3 A;  3G73 A;  3CO7 C;  1YIO A;  4U0Y A;  4HQE A;  1G4D A;  5AIP A;  2DQL A;  3KP6 A;  2FBK A;  2P5V A;  2RC4 A;  1FP1 D;  4XLP F;  4RB0 A;  1ZAR A;  4IXA A;  3I64 A;  2IA2 A;  3L09 A;  4OMY A;  1IZ1 A;  1YO5 C;  2P4W A;  2D1V A;  3RKW A;  1HKQ A;  4GCV A;  3E6B A;  1RI7 A;  1P92 A;  4EGZ A;  1I5Z A;  4LB6 B;  4HDU A;  3T8R A;  4KFC A;  4RAY A;  4A6E A;  4P96 A;  1YG2 A;  4E70 A;  3CUQ A;  3GF2 A;  1DDN A;  5CLS A;  4R1H A;  2WV0 A;  3ABT A;  5L3D A;  1G3Y A;  2OZU A;  2H09 A;  1W7P B;  3IKT A;  3KCC A;  2XRO A;  4NB5 A;  4XBF A;  3NRV A;  3H92 A;  2R7D A;  2HYG D;  4ASN A;  3DPT A;  2ZBK A;  3TOB A;  1UCR A;  1WSU A;  4LLG F;  1IN6 A;  3TKY A;  4DNC A;  1U3E M;  4I0B A;  2E1N A;  3F8B A;  1F1Z A;  5HLI A;  2KIU A;  2FSW A;  5KK1 A;  1IN7 A;  2YU3 A;  3B73 A;  3C3W A;  4ON0 A;  2BE5 F;  3J80 Z;  2IA0 A;  4MQ9 F;  1LDD A;  5A2Q Z;  5ICG A;  2W25 A;  1KYW A;  2CFX A;  2AS5 F;  2CWE A;  1ZHF A;  1XDU A;  2G7H A;  3KE2 A;  2GXG A;  5BS6 A;  1ZH5 A;  4RB1 A;  4CXF A;  3PQK A;  2MD5 A;  4YG2 F;  4KMF A;  5FLX K;  2VT2 A;  4WWC A;  1ZG3 A;  4HF1 A;  3IRR A;  4RAZ A;  4MNU A;  4HLX A;  1FBS A;  2ADU A;  4L9T A;  2LF7 A;  3FWE A;  5JHU A;  2DW4 A;  2KIM A;  3WTY C;  1QZZ A;  5L3G A;  1TNS A;  2CQK A;  3E97 A;  5DD8 A;  5DEQ A;  4LGW A;  4L9V A;  3RJP A;  3V8L A;  4HOB A;  4M74 A;  3LAP A;  4KIC A;  2VN2 A;  5D5W B;  3OOP A;  1ZGJ A;  5LHG A;  4KA4 A;  5LGN A;  1W5S A;  4XRF A;  4GGG A;  4FHT A;  2IA1 A;  2STW A;  1H9G A;  2GA2 A;  5CVV A;  3E3V A;  5LGU A;  4HYE A;  2O61 A;  1MJA A;  4WCG A;  4IHS A;  1WRJ A;  2VC0 A;  3SZP A;  1YS7 A;  1Z6T A;  3T1B A;  3RIR A;  4NQW A;  4U0V A;  4L0Y B;  2Y75 A;  2EFO A;  4RGR A;  1T98 A;  2PBI A;  4Q4Z F;  2ELH A;  4L5J A;  5CVJ A;  3ECO A;  5JFR A;  2PJP A;  1BC7 C;  5H6R A;  1KYZ A;  4Q47 A;  2XVC A;  4M9S A;  2X4H A;  1IF1 A;  4CYD A;  2BV6 A;  4ZYH A;  1QNT A;  3KP4 A;  3EYI A;  1RZ4 A;  2R3S A;  5LGT A;  2XKO A;  2NYX A;  1V3F A;  1W5T A;  3H3Z A;  5LHH A;  3KP7 A;  3TDU C;  1LQ1 A;  4HBL A;  1XSD A;  1KQ0 A;  3FXU A;  4WX9 A;  3M8F A;  1SD4 A;  1I27 A;  2W84 A;  1TW2 A;  3DKW A;  3H3U A;  4YII A;  2K27 A;  2EA4 A;  3AAF A;  4HDV A;  2YR2 A;  4L5I A;  5LBQ A;  2O3F A;  1DUX C;  3E5X A;  4LK0 F;  2L02 A;  3DQV C;  1R58 A;  2NRA C;  3FMQ A;  2F5F A;  4KT5 C;  1ON2 A;  4BAY A;  5D8L B;  4ENK A;  3I71 A;  3VOD A;  1PP7 U;  3S2W A;  4ZYD A;  1LVA A;  4EJV A;  4AD9 A;  2FNP A;  4G7O F;  2LF8 A;  3G3Z A;  2DK5 A;  1T2K A;  2YX7 A;  1RNL A;  2H27 A;  2JPC A;  3TDZ C;  5JR3 A;  1BI2 A;  3CUQ C;  3J81 Z;  3ERE D;  2PQ8 A;  4EGY A;  5DV5 A;  1UB9 A;  4B09 A;  5J8F A;  2NAZ A;  1G6N A;  3GFI A;  2DFI A;  4ENM A;  1FWZ A;  2EWN A;  4MEX F;  3BOQ A;  2FML A;  1JHH A;  2O6G E;  3K0L A;  3D5L A;  2VBX A;  4YIF A;  2ZXJ A;  1ZRE A;  3ZN1 A;  2EV5 A;  3JTH A;  1QPM A;  2EB7 A;  1D8K A;  1H9T A;  3I0T A;  4PCQ A;  1REP C;  1R1T A;  4U7D A;  2M8E A;  2HQN A;  5FD5 A;  5D5V B;  1D5V A;  3E6C C;  1O3Q A;  2E1C A;  2XAF A;  4HX4 A;  1L0O C;  2XHK A;  2QEN A;  1JXS A;  3EDP A;  2CYY A;  2F5E A;  1UHM A;  3R61 A;  4LJZ F;  5HVQ C;  3GUD A;  3P9I A;  3RKY A;  1MGT A;  4IF4 A;  3ZMZ A;  3K1M A;  1FYM A;  3IWF A;  1HQC A;  2XRN A;  1OMI A;  5ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...