1KQ8A

Solution structure of winged helix protein hfh-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
75
structure length
75
Chain Sequence
YIALITMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HEPATOCYTE NUCLEAR FACTOR 3 FORKHEAD HOMOLOG 1
publication title Structure comparison of two conserved HNF-3/fkh proteins HFH-1 and genesis indicates the existence of folding differences in their complexes with a DNA binding sequence.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 11
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1kq8A00
4HA8A 2LKPA 2XKOA 4LG0A 3R6SA 4P96A 4YFNF 5BMZA 1XCVA 2CQKA 3E5UA 3LA3A 1ZH5A 1UHWA 4N9IA 1KYWA 4OIOF 3LQQA 4R79A 1XGSA 1BC8C 4LG0B 5K5QA 3E6BA 2JPBA 5DV5A 3EYIA 2J5OA 4RAZA 1R5HA 3QRFF 1BI1A 2K7LA 4XBFA 1JXSA 1T2KA 2YPRA 3HYIA 4OIRF 5D8KB 5TRDA 3U1DA 1FSEA 1H0MA 3RI4A 2MA3A 4MQVA 4EQQA 4AIJA 3BY6A 4BH9A 5ICCA 2ZNYA 4XRFA 3IWFA 3LAPA 3JTGA 1LEBA 2OBPA 2L4AA 3ECHA 4HAMA 4P9UA 4FHTA 2ESHA 1F9NA 2EV5A 3RPQA 4U0VA 4KMFA 2Z5UA 1ONVA 2DTRA 3HTUA 1LJ9A 2J5PA 3R0AA 3GFIA 2EFNA 3BJ6A 1CF7A 1UCRA 2MBFA 2R7DA 4L0ZB 5JR3A 4HBLA 4EGYA 1IN5A 2RC4A 1FP2A 3MZHA 2QYOA 4RB1A 1ZGAA 3IKVA 1C0WA 5HLIA 3EDPA 4HDVA 3QP5A 4G7ZF 4L5JA 5LHHA 1OYYA 3SQNA 3SXYA 3BPVA 1IRGA 1YTYA 2PLYA 2XROA 3BROA 2V1DA 2VODA 3JW4A 4EM1A 3T0YA 2ZXJA 2Y75A 1R7JA 1ULYA 4RGRA 5D5VB 2DAOA 5D6FA 3I59B 2L4MA 3WTUC 2DO7A 4MGRA 4PZJA 4EVIA 4HOBA 4MEXF 4L0YB 3AAFA 2K02A 1ZG3A 1U5TA 3ZMZA 3HRTA 2HS5A 2MLGA 4OOIA 1ZARA 1IXSB 3HUGA 4ZYGA 3VB2A 4S04A 1KU3A 2MC3A 1RZ4A 1U5TB 3HTSB 3J7AO 2A61A 3PFIA 1D3YA 3PQKA 4WWCA 4A0ZA 2P7CB 1HXDA 1KQ8A 1IZ1A 3F21A 2FRHA 1S7AA 4CDGA 4LFUA 2F5DA 5D5UB 4KIBA 2M45A 1YS7A 3ZPLA 1LB2A 1WKMA 5K1YA 4LLNA 1SMYF 4I01A 1JE8A 3CO7C 5H6RA 3ZN0A 5LRRA 4NB5A 2VOOA 1J59A 3J81K 3LFKA 1YYVA 2Z33A 2DI3A 4HF0A 2RN7A 5AONA 1KA8A 2PEXA 2P5LC 2KJCA 1L3LA 2Q2EA 1ZLKA 5HDNA 1B59A 4G8XA 4A12A 2KJBA 1U78A 3J81Z 2RQPA 2AXLA 2IP2A 5E1XA 3TO9A 1YW8A 2PG4A 2XV4S 1BIBA 4WXCA 5LRSA 1FBSA 1XMAA 4GO1A 3WG9A 5D5WB 3V4GA 1WWXA 5HLHA 1MGTA 2XVCA 2FBIA 4JQFA 4DQ2A 3WE2A 5L3EA 4PDKA 4G9YA 1R1UA 5JVTA 4WK8F 2A07F 3D0SA 1FSHA 1LDJA 4HF2A 1FP1D 4GGGA 1V3FA 4OMYA 1U2WA 4UVCA 5CVJA 4Y17A 3Q5FA 2KIMA 3KP4A 1F4KA 5CJ9A 1D8JA 5FO5A 2OQGA 4IRIA 2DK8A 1I27A 1XGMA 2V1XA 5FLXK 2HZTA 3RDIA 3HRMA 2QWWA 3GZ6A 2K4JA 4OIQF 1P6RA 3QP6A 1HSTA 2YX7A 3VOEA 2ESNA 2ZMEA 4LGWA 3DQVC 3L2CA 5BQTA 1BI0A 3ULQB 2X0LA 4HW0A 4MHGA 3KP5A 4HLYA 2RDPA 2F5FA 1HKQA 1T98A 5L3GA 1ZG5A 4RB3C 1R36A 1ON2A 3NQOA 2ZMEB 1TW2A 3ZMDA 2IA1A 1QBJA 3GWZA 3SHFA 3K69A 3P7NA 4M9SA 2H94A 5F64A 1YQAA 2XAHA 4KYWA 3FZVA 3ABTA 4HX4A 2UWMA 3LWFA 5HS9A 3N97A 3CTAA 2ZJ2A 2IRFG 2WV0A 1J7KA 3OOPA 3M8FA 4K2EA 5DUKA 1OKRA 3KP2A 3ML6A 3J80Z 2EJRA 4IRGA 2HEOA 5E1WA 4ESJA 2RGVA 3FM3A 4LB5A 2G9WA 5CVVA 3KZYA 5L3FA 2JSCA 5JFRA 1ZREA 1O7LA 2QQ9A 3MWMA 4L5IA 2PQ8A 1WSUA 1EH6A 2IA2A 2L01A 2OAZA 4KT5C 2D45A 2VC1A 1U6GA 3M8EA 2ZNZA 3BP8A 3F22A 1T6SA 2OD5A 2ISYA 1P4WA 2MH2A 3RKYA 2CYYA 4ENKA 2O8XA 5LBQA 1S29A 2QQAA 5TJJA 1SD6A 5HDKA 1IN6A 2VT2A 3DEUA 2P7VB 2PMUA 2BYVE 1B1BA 1Z6TA 1U3EM 3ABUA 1FX7A 2HWVA 1R1VA 3ZP5A 1QO0D 2GA1A 3JSOA 3WTWC 4IRHA 2XAJA 4IF4A 1FWZA 3SZTA 1IXCA 3ZMTA 4BHCA 3LQRA 4HX8A 4O6JA 4KMUX 3M9AA 5HDGA 1O3RA 1LVAA 2M30A 1STZA 2YX4A 4HX7A 5ILSA 2GAUA 2PJPA 4WF2A 3PQJA 5ILUA 1QZZA 2FMLA 4HQEA 1R23A 2L54A 2HFHA 2XIGA 1FC3A 4NHJA 2XASA 3T5XA 4G7OF 3KP3A 2ELHA 4QLCU 4E70A 2QBYB 6PAXA 2FA5A 1EH8A 4EJVA 2CO5A 4L18B 3E5XA 3F72A 5L3CA 4GCVA 3ZN1A 2CFXA 2UXNA 2Y48A 3MQ0A 3DFGA 1G4DA 1K79A 1B9MA 3JAMK 1XB4A 3I4PA 3L09A 2DPDA 1D8KA 5LEKA 5EEGA 4Q5SF 3TKYA 3I5UA 3RPUA 1GHCA 2VBXA 2O3FA 3WGGA 3GX4X 3BZ6A 1SD7A 3JAMZ 1ZG1A 2NRAC 4KNYA 2BV6A 5D6EA 4CO8A 3CUOA 3WTTC 2VBWA 4G6QA 2ZBKA 4UVAA 4PCQA 4U0YA 3HIFA 1R22A 3L7WA 1LDKB 2OQRA 2M8EA 4HDUA 1YS6A 2IPQX 4ENMA 3R60A 3T1BA 5K5RA 4M74A 3W6KB 4HLXA 5E18F 3EYYA 4IPAA 3MEXA 3K1NA 2NYXA 3R61A 4RAYA 2P5KA 4M6XA 5BPIA 4ZZLA 2FMYA 2EA4A 2TDXA 3E97A 1IF1A 5JI6A 4CYDA 5LGTA 1HBXG 5CVIA 4A6DA 4WXHA 2IT0A 3HOTA 1DP7P 4LLLA 4KN7X 4ZZDA 5DUIA 2KKOA 4U7BA 3KE2A 2OZ6A 5E8IA 4MTEA 2V6CA 3EQLF 4UHTA 1YFHA 1QNTA 1G6NA 2VN2A 2OA4A 3CO6C 1PP8F 5BOXA 4FX0A 2F2EA 1T38A 1U5TC 2W84A 3TDUC 1XD7A 4RB0A 3KEOA 1TQIA 1J0RA 1BIAA 4ENNA 1CF7B 2MLKA 4YFXF 5FD5A 3GYHX 2QLZA 4A0XA 2VC0A 3TO7A 2XAGA 5DD4A 2DQLA 3ISPA 1O3SA 3HHHA 1J9IA 1AWCA 2EK5A 2L02A 4P5OA 1ZGJA 4D0PA 2DBBA 2Z3YA 2L3DA 4AVPA 2BBYA 5A2QK 5EEHA 3RKXA 4KIGA 3RTRA 1SD4A 1RUOA 2D1HA 3IL2A 2RNJA 2RVCA 1QZYA 1DDNA 3V7RA 3IC7A 3LAJA 2A3SA 5F6FA 5A2QZ 3GLXA 5L3BA 1Y0UA 3KLNA 1B4AA 2Z99A 4LMYA 2C6YA 4A2UA 4M6YA 3FHZA 1BBYA 2FOKA 2ZCWA 1JHHA 3ERED 3M1EA 4EGZA 2B0LA 3GFMA 1T39A 4IHTA 3H92A 4AD9A 4OU0A 2P8TA 4Q4ZF 2JRTA 3DPTA 3FXRA 2UZKA 4Q47A 2LF7A 2M5WA 4F7ZA 1BI3A 2MH9A 2HTJA 3E5QA 3CUQC 1G3TA 3QOPA 3I58A 5ED4A 3F8MA 2D2WA 5AIQA 1T0FA 3P9CA 5BS6A 2XAFA 4A6EA 1XSVA 4N0BA 3RYRA 2XGXA 3F6VA 1TQMA 2CSOA 4YIFA 3TOBA 2JZYA 5DCMA 1O3TA 3H3UA 1Z91A 3FM5A 3JTHA 1XGOA 1E2XA 4CZZA 1H9TA 4G94A 1KU9A 3DPLC 1YO5C 1MJ9A 1J2XA 2QQBA 3MAJA 1ZAOA 5CYVA 4I02A 2GXBA 1XSXA 4AWXB 1YW7A 2CW0F 1OYIA 1R00A 2FEZA 1XN7A 1FZPB 3EETA 2P4WA 4ZYEA 4HYEA 1Z9CA 2OU2A 4IVNA 1QGPA 1NHAA 5H6QA 2FBHA 3T8RA 2H6BA 3RKWA 4G7HF 2DW4A 2DLLA 3GFLA 1OPCA 1KYZA 3WGHA 4XSZF 3REOA 3E6MA 2A6EF 2XKPA 1K78A 4EJOA 3NEUA 4EMSA 1ZLJA 4Y15A 2V9VA 5FLXZ 4BNCA 1RUNA 4MEYF 3RIRA 1FOKA 1ON1A 3HOSA 2E1NA 3WODF 2CGPA 1W5TA 3WTVC 2AS5F 5CLSA 3K9TA 1K78B 4M9ZA 1BC7C 4IJAA 3C18A 2GXGA 1SMTA 5CVUA 2Y0MA 4M73A 5K5OA 4MTDA 4PGGA 4KN4X 1BJAA 4BYYA 1FYKA 5F1RA 5E8GA 4A0YA 2FNPA 4I7HA 1H9GA 2HYGD 2EWNA 3IKTA 1TTYA 1SD5A 1R1TA 2BE5F 1K6OA 1REPC 1TBXA 3LA7A 4LK0F 3MCZA 4ZYDA 5LEJA 1KU7A 1FY7A 4UXNA 2LDUA 2IA0A 4TV7A 4B09A 1I5ZA 2VONA 5L3DA 2W85A 1I1GA 3E6CC 1BM9A 3T8TA 2K86A 3GW2A 3P9KA 2EB7A 3HSEA 1LEAA 1P4AA 4XSXF 1B9NA 4P9FA 5D8LB 4ASNA 3WTYC 1DUXC 1I1SA 3VEPA 3C3WA 5DDGA 1MDMA 2O0YA 3ZMVA 1YW9A 5HVQC 4L9NA 1J5YA 3DXJF 1DPUA 4IHSA 3BDDA 3WTZA 2EA2A 2YSRA 1LNWA 3GXOA 3GF2A 5ICEA 3ZMUA 2Q8KA 3SZPA 2LSOA 1F1ZA 1MDMB 2QVOA 1G3YA 2DFIA 4N9HA 1W7PD 3FMQA 2M1BA 1Q1HA 2V79A 2COMA 2LNBA 1TQPA 2PBIA 2PN6A 3L00A 1UB9A 1G3SA 3D5LA 4UUVA 3ECOA 1X3UA 4XLPF 1RNLA 2DQRA 1ZRCA 1WI9A 4R8HA 2ETHA 2A6HF 3P9IA 2JPCA 3QPHA 1GVJA 3BPXA 3QU6A 4I98B 4BHBA 5AIPA 4P55A 3TO6A 1KU2A 1IRFA 3DF8A 1EV7A 4MNUA 1ZHFA 2FBKA 5J8CA 2O61A 1B6AA 1VTNC 2W24A 4I09A 3F23A 1HSJA 1IW7F 4YG2F 2G7UA 2QZ8A 4BXUA 3KEQA 4QWQA 2ADUA 5CVRA 4I0AA 1SFUA 4FT8A 1FYLA 3SFZA 4KICA 4WX9A 2H09A 3FF5A 4MQ9F 4BAYA 2HR3A 4M71A 1FPQA 1IAWA 2H27A 3KP7A 2E7WA 3WU1B 2NNNA 2M87A 3Q9VA 3QU3A 1MD0A 1BN5A 1E17A 4WCGA 5ICFA 1IN4A 1TNTA 2K27A 1PUEE 3G3ZA 1RI7A 3F8CA 2GIVA 1EH7A 3B73A 2DU9A 4PGHA 2P6SA 2R7FA 3FXUA 3FXQA 4UNOA 3FMSA 4NQWA 3CDHA 3MFKA 3VFZA 2O03A 1KQ0A 4L9JA 2GA2A 2XRNA 3RJPA 3KETA 5DD8A 3HSRA 1YLFA 2DPUA 3C1DA 3HRSA 4HF1A 2VOPA 4GXOA 1FT9A 2EFPA 2V1UA 5KK1A 2PI0A 1IN7A 2RV8A 3HRUA 4AIKA 2CWEA 3BOQA 2O6GE 2YR2A 2HKXA 1TNSA 2OZUA 4CICA 1FYMA 5LHIA 2E1CA 3JSPA 3KCCA 2NNYA 1IXRC 5H20A 2Z9OA 4KFCA 2QENA 3NRVA 5J8FA 5LGUA 3K1PA 1J75A 3FX3A 3Q9SA 5HS7A 4L9VA 1RIOH 1L0OC 4HQMA 2A68F 1AOYA 2XUBA 1P4XA 3K2ZA 3TGNA 1O7FA 2D1VA 1R5GA 2JT1A 4ESBA 3H3ZA 3F3XA 1FBUA 3V8KA 4DNCA 1O3QA 2VBZA 4UV9A 5LLQA 4XLNF 3FWEA 4KUMA 1S3JA 2ACJA 2G7HA 2FSWA 4S05A 3IRQA 1CGPA 5E20A 1HQCA 1W4MA 1PP7U 3K0LA 2KRFA 5FFXA 3IHUA 2W57A 1TLHB 4KDPA 3G73A 4R1HA 3I59A 5FD6A 3O2PE 5KVRA 1HW5A 2FU4A 2Q0OA 1Z6RA 2P5VA 2CG4A 3VODA 1D5VA 1YIOA 2R3SA 3N4MA 3RYPA 1OMIA 2WTEA 4EM2A 2EFWA 4UV8A 2RKHA 4G6DA 2QUFA 2P6TA 4IXAA 2E7XA 2X4HA 2HTSA 2ISZA 3HSFA 3O6BB 4O3MA 4FX4A 2BEOA 1MJAA 2QM3A 1MZBA 4EV0A 4U7DA 4AIHA 4L9TA 4U88A 4OINF 3L9FA 3MZYA 4RB2C 4OIPF 2FE3A 3BJAA 5LHGA 1JGSA 1DPRA 1S6LA 2HYFA 3QAHA 1FNNA 5J6XA 1Z05A 2FNAA 2VBYA 3I0TA 3I71A 5BPDA 4A5NA 5HS8A 5FB2A 2ZKZA 1S7OA 3ELKA 4EM0B 1OYWA 1HKTA 1BOAA 1XCBA 3GVAA 3F8BA 5FGMA 4RGUA 1QQIA 2IVMA 4LB6B 4ENJA 4ZYHA 5ICGA 2BGCA 2EV6A 5ERIA 4U0WA 5DCMB 4LLGF 2KIFA 4EJTA 4LJZF 3M7GA 1P2FA 3OV8A 2FXAA 1HW1A 1F5TA 3CLOA 3E6DA 3I64A 5DYMA 4KA4A 3CUQA 1PDNC 5LGNA 4BHPA 1IUYA 1V4RA 5IT9K 2UXXA 3DP7A 2DK5A 3BWGA 1I6XA 4RGSA 3LSTA 2H6CA 1SFXA 2VE8A 3KP6A 2ZFWA 3CUQB 1QPMA 4H0EA 1MKMA 3TDZC 3B02A 4EJWA 3GZ5A 4OMZA 5IT9Z 2NAZA 5D5XB 3GO5A 1XDSA 4BQAA 1IN8A 4RS8A 2HQRA 2XHKA 5HOOA 2HOEA 1KQ9A 3IRRA 2A69F 4B8XA 2FQ3A 4WXDA 5JHUA 3TQNA 1GXQA 3QPTA 2ZO4A 1W7PA 3V7SA 3COAC 5IT3A 1LDDA 1HW2A 3C7JA 3I54A 3V7CA 3J80K 2XAQA 3IWZA 4JK1X 3GUDA 3U2RA 1O57A 3HHGA 2DT5A 3EUHA 1OR7A 1JHFA 4HZFA 1W7PB 1FLIA 4HV6A 4Z2YA 3F8FA 2YU3A 2STWA 4CXFA 1SAXA 5ILVA 1Z7UA 2GZWA 1ZN2A 1YG2A 3GFJA 4KIFA 3K1MA 2IW5A 3DV8A 4ESFA 1GXPA 4JBAA 2HQNA 4I2OA 2JTVA 4Y13A 4GYGA 1P92A 5DEQA 1UHMA 1Z1DA 2FF4A 3ROUA 3ZMSA 2EFQA 1S8NA 3KFWX 2A5YB 3I53A 2VT3A 1SFEA 2EFOA 3WGIA 1XDUA 3F6OA 1ODDA 4ETSA 4M72A 3LA2A 4Q48A 3WTXC 1XSDA 2F5EA 4YFKF 5D4RA 5FFZA 2VE9A 3R0JA 4RGXA 3V8LA 1W5SA 1XMKA 2PFBA 2NS0A 2STTA 2VXZA 3ZQ7A 1LQ1A 2LF8A 4UVBA 1WQ2A 3DKWA 2QBYA 2F5CA 1BI2A 1HKSA 4LD5A 3S2WA 3WE3A 1FBQA 3CJNA 1ZRDA 3F8NA 2IJLA 3E3VA 5DCFA 4CGZA 5D4SA 1USTA 4GYIA 2PMHA 5E1ZB 1G3WA 2GQQA 3GEZA 1R58A 2WWYA 3KZZA 2HGCA 4O5VA 5E17F 4I0BA 2HKOA 3V8JA 3KLOA 3R4KA 4HV5A 3U9GA 2KIUA 2K4BA 4M9XA 4CHUA 1WRJA 2W25A 1UFMA 1ZYRF 2MD5A 1K7AA 1A04A 3W6JB 4ZH4F 4EJUA 4LK1F 1XGNA 1U8RA 3FMRA 3BJOA 1TW3A 2GWRA 3WTSC 2HDCA 3TOAA 4YIIA 1KGSA 1MJBA 4A5MA 1ZRFA 1USSA 2WC2A 3WU0A 2EV0A 5HLGA 3O3KA 4ON0A
chains in the Genus database with same CATH superfamily
2L2OA 4HA8A 3K4KA 3FDYA 2LKPA 2XKOA 4LG0A 5C44J 3R6SA 4P96A 2VKHA 2X51A 2BY1A 4YFNF 3HBLA 5BMZA 1XCVA 2VASA 2CQKA 3E5UA 3LA3A 1ZH5A 1UHWA 4N9IA 1FEXA 2L9VA 1KYWA 2DYRH 2AHQA 2Z1DA 4OIOF 3LQQA 4R79A 4N4NB 5F1JA 1XGSA 5C4JJ 1BC8C 4LG0B 4KISA 2QSHX 5K5QA 3E6BA 2JPBA 5DV5A 3JRGA 3EYIA 2IGMA 3LSKA 2J5OA 4RAZA 1R5HA 1RETA 2CQXA 3KPHA 1NK2P 1SVMA 3QRFF 3K6GA 4KJZA 1BR2A 4XMYA 1BI1A 2K7LA 4XBFA 1JXSA 2HQAA 3JRCA 4BJTA 1T2KA 2YPRA 5FJ8J 1DQUA 2ZSIB 3HYIA 4OIRF 5D8KB 5TRDA 1IG7A 2DA3A 3U1DA 2LR8A 3PO2J 4A3CJ 1FSEA 1SFOJ 2DJNA 2L9RA 1H0MA 1MW7A 5M5WJ 3TL4X 3RI4A 2MA3A 4MQVA 4EQQA 4G12A 3IAM2 2CUEA 2ZXIA 4AIJA 2K9QA 3BY6A 3E0JB 4XLAA 1D1BA 3WU2C 4BH9A 5ICCA 2ZNYA 4XRFA 3IWFA 3LAPA 3JTGA 1LEBA 1UG2A 2OBPA 2L4AA 3CCJI 3WHCA 3ECHA 2CS3A 4HAMA 2JSPA 3RPUD 3CMMA 3SDGA 3GTOJ 4P9UA 3DBHB 1T08B 4FHTA 5FKLA 2ESHA 3D5RC 1MIJA 1F9NA 2I10A 3FXOA 2K9LA 2EV5A 5HLTA 3RPQA 4U0VA 4KMFA 2Z5UA 1ONVA 2DTRA 3HTUA 1LJ9A 1WJDA 2BY2A 2J5PA 3R0AA 3GFIA 2EFNA 3BJ6A 1CF7A 1UCRA 2MBFA 2E5NA 2R7DA 4L0ZB 5JR3A 4HBLA 2QKLB 4EGYA 1IN5A 2RC4A 1AKHA 1FP2A 3MZHA 1T56A 2QYOA 2IS4A 4RB1A 3BG6A 1ZGAA 3IKVA 1C0WA 2KRCA 1GUUA 5HLIA 3EDPA 4HDVA 1PUFA 1QHGA 1RKTA 3PUFA 3QP5A 2NVQJ 4G7ZF 4L5JA 5LHHA 1OYYA 3SQNA 3SXYA 2EPFA 2AXTC 3BPVA 1IRGA 3PSFA 1YTYA 2PLYA 4NNJA 2XROA 3HGYA 3BROA 2V1DA 2VODA 3JW4A 4EM1A 3T0YA 3UNGC 2ZXJA 2Y75A 4PJ0C 3FXKA 2KPMA 1R7JA 3K2AA 1TWHJ 1PUFB 1ULYA 3EUKL 2BXZA 4RGRA 5D5VB 2OUMA 2DAOA 3HOWJ 2DFFA 5D6FA 2XF7A 4NDLA 5HODA 3S32A 2F4MB 3I59B 2L4MA 3WTUC 2DO7A 3L1PA 4MGRA 4PZJA 4EVIA 2CUZA 4HOBA 1JJ8C 4MEXF 3TW7A 5E79C 4L0YB 3AAFA 2LREA 2K02A 3BQYA 1ZG3A 4B47A 1U5TA 3ZMZA 3QWLA 4AIDA 1Y39A 1OCZH 3W2WA 4BXFA 3HRTA 2HS5A 2E36A 1N77A 1T95A 3HKZN 3ZXSA 3BTCA 2IS2A 2MLGA 4OOIA 1ZARA 4UUTA 1IXSB 3CMAI 2HPMA 3HUGA 2M0MA 2DT7B 5KAIC 2R7QA 4ZYGA 2KP6A 3VB2A 4S04A 2WBMA 2A5WA 2LKSA 3M1CA 1KU3A 2MC3A 3UR3C 2R5ZB 1RZ4A 1A5JA 1VQOI 2ICWG 1U5TB 3HTSB 1WHUA 3J7AO 4BE1A 2A61A 3PFIA 4HSTA 1D3YA 3PQKA 4WWCA 4A0ZA 2P7CB 2BVLA 1JKRC 1HXDA 1JKQC 4XLEA 1KQ8A 1ETOA 1NTCA 3HUGB 1IZ1A 3BR1A 3F21A 5M5YJ 1DGWY 1V5FA 5DS9A 1IJWC 3BLYA 1X2NA 2FRHA 1MSFC 4A3LJ 1S7AA 4CDGA 3BR2A 4AVZA 1OCRH 4LFUA 2F5DA 3CZ6A 3BG5A 5D5UB 4LOCA 2GOXB 4KIBA 2M45A 2E5ZA 1YS7A 3ZPLA 4BUPA 3BCAA 1LB2A 1WKMA 3FISA 3E1SA 5K1YA 4LLNA 1SMYF 4I01A 1JE8A 2DDBA 2X1DA 3CO7C 4JP0A 5H6RA 3ZN0A 1YJNI 5LRRA 4NB5A 4RAGA 2ELKA 2VOOA 3MKLA 3BR5A 3OYAA 1J59A 1ITYA 2DJIA 3J81K 2R0QC 1MH3A 3LFKA 1YYVA 2I8DA 2Z33A 1X1BA 2DI3A 1Y1VJ 4HF0A 2M3AA 2RN7A 5AONA 1HF0A 3V42A 5B1AH 1KA8A 2PEXA 4XLHA 2L7FP 2KJCA 2P5LC 1L3LA 2XGEA 3OYGA 3FBIB 2MYSA 4DYCA 2Q2EA 2L7MP 1ZLKA 2IXSA 5HDNA 1B59A 4G8XA 4J00A 4A12A 2KJBA 1U78A 3J81Z 2RQPA 2HOSA 2AXLA 4RA2A 4E7KA 2IP2A 2Y0SA 5E1XA 2LH9A 3TO9A 1YW8A 2X85A 3WHBA 1YOVB 2PG4A 3AL0B 2XV4S 1BIBA 4WXCA 5LRSA 1FBSA 1Z0XA 1XMAA 2R4GA 4GO1A 3WG9A 5D5WB 3V4GA 1VFCA 1WWXA 5HLHA 1BR4A 3H0GJ 1YX5A 1MMSA 3HOYJ 3GTPJ 4KT6A 2H8WA 1MGTA 2XVCA 2E1MC 2FBIA 2A05A 1VF9A 2V4JC 4JQFA 4DQ2A 3RQIA 2WB1A 4HEA2 3WE2A 4HNVA 4PDKA 1Y56A 5L3EA 2DOAA 4G9YA 1R1UA 1X1DA 5JVTA 1XS9A 2F4OB 4A3BJ 4XL9A 1G2HA 4WK8F 3DKXA 2A07F 3D0SA 3K4MA 4YEJA 4E7LA 5F04A 1FSHA 4CA0A 1LDJA 4HF2A 1FP1D 4GGGA 1V3FA 3E7LA 5F0HA 4OMYA 1U2WA 4UVCA 3WG7H 5CVJA 4S0HB 4IQ4A 4Y17A 2PMZA 4P1WA 3Q5FA 2XF6A 3DTKA 2KIMA 3KP4A 5EGOA 2XC7A 2IGKA 2L7KA 1F4KA 4NC8A 5CJ9A 2CV2A 1D8JA 3OL4A 4GDFA 2V26A 5FO5A 2OQGA 2K3FA 3LSIA 5TISC 3VYSB 4IRIA 2DK8A 1I27A 1XGMA 2V1XA 4M3EA 5FLXK 3EUHC 1OR7C 3OYHA 2HZTA 4PJLA 3RDIA 2H1LA 3HRMA 2QA4I 2QWWA 1BW5A 1TP4A 4RAFA 3GZ6A 2K4JA 3TBIA 1P6RA 4D5FA 4OIQF 3QP6A 1HSTA 2YX7A 3VOEA 5EGOB 3CJTB 2ESNA 3S2HJ 1BJZA 2ZMEA 4LGWA 3DQVC 4OAZA 3L2CA 1OJLA 2VIXA 5BQTA 1MNMC 1XPXA 3VSKA 3CDIA 1BI0A 3ULQB 4XRSA 2X0LA 4HW0A 4MHGA 2FOWA 3KP5A 4HLYA 2IEKA 2OC6A 2RDPA 2F5FA 1HKQA 1T98A 2ME6A 5L3GA 4RB3C 1ZG5A 1XX5A 1R36A 4JX4A 1ON2A 3NQOA 4E7SA 2ZMEB 2BXYA 2K85A 1TW2A 2HQ5A 2LC2A 3ZMDA 2IA1A 3S3MA 1QBJA 4DJAA 5FKKA 2K9MA 2R92J 3GWZA 1IO2A 1B72B 1TC3C 1W36C 1NG7A 4XKWA 3SHFA 4ABZA 3DLLF 3K69A 3P7NA 2R7WA 4M9SA 3LSPA 2H94A 5F64A 3GTJJ 1YQAA 2XAHA 4KYWA 3F0CA 3FZVA 3DKYA 3ABTA 4HX4A 2UWMA 3LWFA 5HS9A 3N97A 1GVDA 3CTAA 2ZJ2A 2IRFG 2WV0A 1J7KA 2JN6A 3OOPA 4BQQA 1X3ZB 3M8FA 3CCEI 4K2EA 2ZSHB 5DUKA 3C2BA 1OKRA 3FXLA 3PM1A 5IY5H 2M34A 4AUXA 3K4BA 1WGXA 4W1UA 1WVRA 3KP2A 3ML6A 3DLAA 3J80Z 2EJRA 4IRGA 2HEOA 5E1WA 5EG0A 5K7FA 2F48A 4ESJA 2RGVA 3FM3A 3W6VA 4LB5A 2G9WA 3MD2A 4MO7A 5CVVA 3KZYA 1OQYA 3MMYB 5L3FA 1YI2I 4B3XA 5J1YA 2JSCA 5JFRA 2WY7Q 2EZKA 4F3QA 4YELA 4PJNA 3K70D 1IGNA 1ZREA 3S1MJ 3PIPF 4I6ZA 1YIJI 1O7LA 3FK6A 4PFPA 2QQ9A 3MWMA 4L5IA 2PQ8A 1WSUA 1EH6A 2DN0A 5EG0B 2IA2A 1IV6A 2L01A 2OAZA 4KT5C 4YIRX 3CCVI 2D45A 2VC1A 1U6GA 1HLVA 3OYBA 4BXXJ 2DYSH 1QPIA 3M8EA 2ZNZA 3OSFA 3BP8A 1X1PA 4XKCA 5CKTA 3H9JA 5J4YA 3F22A 1T6SA 2OD5A 1S9HA 2ISYA 2WAQA 1P4WA 3GTLJ 2MH2A 1ZK8A 3RKYA 4M3GA 2CYYA 4ENKA 2JRMA 2O8XA 5LBQA 2X48A 1S29A 2DMNA 2QQAA 5B66C 1E3PA 2N8GA 5TJJA 1SD6A 5HDKA 5IOYA 1IN6A 2VT2A 3DEUA 2P7VB 2PMUA 2BYVE 1HC8A 2M7BA 1B1BA 4XK4A 1Z6TA 3ZRGA 5E3OA 4IOCF 3OOUA 1U3EM 4NBQA 2CU7A 1CQTA 3ABUA 1FX7A 3BCBA 2HWVA 1R1VA 3JRFA 1ZQ3P 3RKQA 3ZP5A 1QO0D 2GA1A 2E2JJ 4IEJA 3JSOA 3WTWC 1TWFJ 4IRHA 2XAJA 4IF4A 3BG7A 4RLQA 2NXNB 1FWZA 3SZTA 1D5YA 1IXCA 3ZMTA 4BHCA 3LQRA 4HSRA 3ZQQA 4N4OB 2JA5J 4HX8A 5J40A 2JVHA 2VI6A 4O6JA 4KMUX 2DODA 3M9AA 1Z77A 5HDGA 1O3RA 1LVAA 3TP0A 2M30A 1STZA 2YX4A 4HX7A 5ILSA 2GAUA 2PJPA 4WF2A 3PQJA 5ILUA 1QZZA 1SAUA 1MH4A 2FMLA 1WCMJ 1UJ8A 4HQEA 1R23A 2L54A 3S8PA 2HFHA 1Z7LA 3BZKA 2XIGA 1FC3A 3H35A 1Y1WJ 2CFOA 4BDYA 4NHJA 2XASA 4IX7A 4M6VA 5EEAA 3FXJA 2VPLA 1RPWA 2F6CA 1WPKA 3J7AY 1G8XA 3T5XA 3CCMI 4G7OF 2R5YA 3KP3A 3DCFA 1A31A 4XLFA 2ELHA 4V2GA 3HG9A 4QLCU 1VZ0A 5EYRA 3U21A 4E70A 2QBYB 6PAXA 2FA5A 1EH8A 4EJVA 5J4VA 1D0ZA 4I76A 3BR3A 3ZQIA 2EIKH 2CO5A 3L2VA 3OY9A 4L18B 3A01B 3E5XA 2DCEA 3F72A 3OYIA 5L3CA 4GCVA 2MABA 2R5YB 1QU3A 3ZN1A 2UXNA 2CFXA 2DOEA 1YX3A 3OMYA 4M3BA 4XKBA 1K4TA 2M4KA 2Y48A 2JA6J 1D0YA 3MQ0A 3DFGA 3I3LA 2FUG2 1G4DA 1K79A 5B1BH 2BW3A 3PUBA 2LKXA 3OS1A 3CCYA 1R6RA 4F55A 1B9MA 2M9HA 3JAMK 1XB4A 3I4PA 3L09A 1U0JA 2DPDA 1D8KA 2K3PA 5LEKA 5EEGA 3I4MJ 4IOAF 4Q5SF 3TKYA 3I5UA 2KT0A 4DBQA 3RPUA 1Z21A 5GAGJ 3DEWA 5EZGA 1GHCA 1QRYA 2Y9ZA 2VBXA 2O3FA 3WGGA 4F92B 4HRIA 5F0CA 2ECBA 3GX4X 1PYVA 3ZCOA 3KEYA 5EDNA 3BZ6A 3LSGA 3BT9A 2HVSA 1SD7A 5F08A 3JAMZ 1ZG1A 2XPUA 3KYDB 2NRAC 2VUMJ 4KNYA 2BV6A 5D6EA 4CO8A 3CUOA 3IH2A 3WTTC 5M3FJ 2VBWA 4G6QA 2CJJA 2ZBKA 5IP6A 2VKEA 4UVAA 3J7ZI 4PCQA 2L9SA 2QCOA 4U0YA 3M8JA 3DU5A 3HIFA 1R22A 3L7WA 1LDKB 2OQRA 2M8EA 4HDUA 1YS6A 2IPQX 4ENMA 4XR6A 1A6QA 3R60A 3HDDA 2MC4A 2LMDA 2CV0A 2R7XA 5EF6A 2CH0A 3T1BA 5K5RA 4M74A 3W6KB 4HLXA 5GTHC 5E18F 2EZHA 3EYYA 2X6OA 1I3AA 4IPAA 3MEXA 1LE8A 3K1NA 2W1OA 1Y8QB 1R9TJ 4ON0A 2DFHA 2NYXA 3IH4A 2BOLA 4M3FA 2DA4A 3R61A 1VNDA 3HOVJ 3BR0A 3HEFA 4RAYA 3CMEI 5IYBJ 1X3WB 2P5KA 4M6XA 2WADA 3OYLA 5BPIA 2Y69H 4ZZLA 5HNFA 2LVSA 2FMYA 2EA4A 1VQKI 3KZIC 4BBSJ 1JGGA 2MFZA 2TDXA 3E97A 1IF1A 1BL0A 3F9KA 5JI6A 3S16J 3BTIA 4CYDA 1LE8B 3KIOA 5LGTA 1HBXG 1ETWA 2VPRA 5CVIA 2Y9YA 2F4IA 5B5EC 4A6DA 1WFXA 3G4SI 4WXHA 3VYTB 1OCCH 5M3MJ 2IT0A 3HOTA 3HB9A 1FIPA 5FLMJ 1LVKA 1WJEA 3MKWB 1DP7P 3HPHA 1MBJA 4LLLA 1TWGJ 3S1QJ 3I56I 4KN7X 4ZZDA 5BNGA 4EATA 5DUIA 2KKOA 2KIQA 4AC0A 1OCPA 2MGQA 3PFYA 4U7BA 4A3JJ 3KE2A 3TW6A 2XRLA 2OZ6A 5E8IA 4MTEA 4H4KC 1EKEA 2LK2A 2V6CA 3EQLF 2R7TA 4UHTA 1YFHA 1QNTA 1G6NA 2VN2A 2XSJC 2OA4A 4Y7NJ 5EZHA 3U1KA 3CO6C 1AA7A 1SANA 1PP8F 5BOXA 3CC4I 5M5XJ 2NOGA 4X6AJ 3S2DJ 2XB5A 2HVRA 1Y6IA 2E19A 3X2QH 2EIJH 1R49A 4FX0A 5IP9J 4C3JJ 4JOMA 1Y0NA 3HM5A 4J19A 2XPVA 3CF5F 5GADJ 2EZLA 2F2EA 2EH3A 1T38A 1U5TC 2V7FA 2W84A 3TDUC 1FTZA 1XD7A 1A36A 4AYBA 4RB0A 3SFIA 3KEOA 1TQIA 3PSIA 1J0RA 1BIAA 5FKOA 4ENNA 1HOMA 3NAUA 1CF7B 2MLKA 4ITVA 4YFXF 1I50J 2KHMA 2M7AA 1TT0A 5FD5A 3GYHX 2QLZA 4A0XA 2VC0A 1AKHB 4B44A 4BY1J 4FE4A 1EJ9A 3TO7A 1RESA 2XAGA 5DD4A 2DQLA 3FIWA 3ISPA 1O3SA 3HHHA 4BBRJ 1J9IA 4CYCA 1HDDC 3FXMA 1AWCA 2EK5A 2L02A 4P5OA 2NVYJ 1ZGJA 4D0PA 3VDXA 1IDYA 3PIOF 2DBBA 4C3HJ 2Z3YA 3K4CA 2L3DA 2BHYA 4AVPA 2BBYA 4Y33A 5EEHA 5A2QK 3S93A 3RKXA 2LTPA 3P5JA 2BY3A 2X6XA 2Y0SN 1P7IA 4KIGA 3RTRA 1SD4A 1RUOA 2DMPA 2D1HA 4CYCB 3IL2A 1FJLA 2RNJA 2B7EA 2RVCA 4Y52J 4ZJZA 1QZYA 1DDNA 2M0CA 4XORA 3S17J 3V7RA 4IQJA 3IC7A 2TCTA 3LAJA 2A3SA 5F6FA 3L2WA 2Z2SB 3CC7I 2WB1N 5A2QZ 1S7EA 3GLXA 5L3BA 1Y0UA 2CV1A 3KLNA 1SC7A 1B4AA 2Z99A 2DOFA 4E4HA 1KZHA 4B48A 4LMYA 2EIMH 2C6YA 3ABKH 3B6CA 5CPRB 4A2UA 3TEDA 2PJRA 4IO9F 4M6YA 2E71A 4KITB 3FHZA 4OAYA 1BBYA 1MBEA 4AU7A 3JRIA 1U9OA 1VQ9I 2FOKA 2ZCWA 1JHHA 3ERED 2KLOA 2R93J 3SJMA 3AL0C 4IHWA 2B63J 2ZFUA 2DA6A 2DMQA 3M1EA 4EGZA 3RZOJ 1D0XA 2B0LA 3GFMA 4XICA 1T39A 2PMZN 4XRSG 4IHTA 4DOZA 5J3LA 4BACA 4BY7J 2COBA 3H92A 4AD9A 2PJRB 4BL0B 4OU0A 2P8TA 4Q4ZF 3AKZA 2JRTA 3DPTA 3FXRA 2UZKA 3ASNH 4Q47A 1TWCJ 4UB6C 2LF7A 1MBGA 4IHYA 4XOPA 1Y8RB 2M5WA 3OR2C 1BI3A 4F7ZA 4HG2A 4Z6YA 2IGOA 1FTTA 3OWTA 1ZELA 2MH9A 2HTJA 5LFAA 1H89C 3E5QA 3CUQC 1G3TA 3AG1H 3QOPA 2JQ7A 4D7MA 3I58A 3F8MA 5ED4A 1WJFA 2D2WA 2LP0A 1P9QC 1T0FA 3P9CA 2XAFA 5AIQA 5BS6A 4A6EA 3A03A 4N0BA 1TT5B 2VKDA 3RYRA 3S1RJ 2QQ8A 2XGXA 3F6VA 1TQMA 2CSOA 2ECCA 4FQGA 4YIFA 4XIDA 3TOBA 4CUGA 2JZYA 5DCMA 1O3TA 3H3UA 1Z91A 3FM5A 4MIMA 3JTHA 1XGOA 1E2XA 4CZZA 1H9TA 4G94A 2CQNA 3QPSA 1WJ5A 1KU9A 3RCOA 3CP8A 2XPWA 3DPLC 1YO5C 1MJ9A 1J2XA 2QQBA 3OYNA 1I3QJ 3PJRA 4JX6A 3MAJA 1ZAOA 2Q2EB 5CYVA 4I02A 5E3MA 1ETKA 1FMWA 3RQ4A 3SYTA 1AHDP 3ASOH 1ETQA 2X1EA 2GXBA 2UV1A 3C2GA 4A3DJ 1N75A 1JUPA 4XLCA 2EINH 4LIUA 3K4JA 1XSXA 1R4NB 1U9NA 4AWXB 4IZZA 2NVXJ 3IV5A 1YW7A 2CW0F 3HKZA 1XTAA 3K4LA 4DYRA 1OYIA 1R00A 2FEZA 1XN7A 2KL4A 1FZPB 3EETA 2P4WA 4ZYEA 2VQHA 3H36A 4HYEA 1UAAA 1Z9CA 2OU2A 2NVTJ 4IVNA 1QGPA 1NHAA 5H6QA 2FBHA 5DM7F 3QQAA 1JJ6C 1ZR2A 3T8RA 1ZTRA 1U8BA 2H6BA 3RKWA 1X2MA 4G7HF 2V1NA 2DW4A 3IUOA 3OL3A 4IL6C 2DLLA 3GFLA 2JJ7A 1E3OC 1OPCA 3ABLH 1KYZA 2QEXI 1A6IA 2DA5A 3PNTA 1LKXA 4F93B 2WAQN 3WGHA 1DGRM 2FQ4A 4XSZF 1VQNI 4CH7A 1V54H 1JT0A 3REOA 3E6MA 2DFEA 2KISA 1VQPI 2A6EF 2XKPA 3HGGA 3ABMH 5KHDA 4EJOA 1K78A 3NEUA 4EMSA 3A1YA 3CCRI 1ZLJA 4Y15A 2V9VA 2XGCA 5IOZA 5FLXZ 4BNCA 3EPZA 1VQMI 1RUNA 2L5QA 4MEYF 3RIRA 3I55I 1FOKA 3BZCA 1ON1A 3HOSA 3SDBA 1OISA 2E1NA 3WODF 3UKGA 2CGPA 1W5TA 3WTVC 2OTJI 2AS5F 4D1QA 5CLSA 3K9TA 1APLC 1K78B 3GTMJ 4BE0A 1ACIA 1ETXA 4M9ZA 1BC7C 3CLQA 4IJAA 5K7HA 2WA0A 2WY8Q 4C2MJ 4F91B 3C18A 2CRGA 2GXGA 1SMTA 5CVUA 2Y0MA 4M73A 3OYEA 5K5OA 4MTDA 4PGGA 2OTLI 3LL7A 1BJAA 4KN4X 4BYYA 3GLLA 4E7IA 5F1RA 1FYKA 1QA6A 2OCEA 2ZXHA 1VQ5I 3HZJA 5E8GA 5JLXA 2L7ZA 4A0YA 2FNPA 2LBFA 4I7HA 3N05A 4RDUA 3OSGA 1H9GA 4FCYA 4HPQA 2IAIA 5JVGF 2HYGD 2EWNA 2ZJQF 3IKTA 1TTYA 1SD5A 3QOEA 4C2UA 1R1TA 2BE5F 5CQEA 1FIAA 4V19K 1K6OA 4G6TB 1REPC 2E1OA 1TBXA 2KDOA 1N25A 4BDZA 2HU9A 1TZLA 3LA7A 2LBFB 3H0DA 4LK0F 3MCZA 5J47A 1Q1VA 4ZYDA 5LEJA 1KU7A 1LUJB 2EQRA 1FY7A 4UXNA 2LDUA 5JHFA 1OCOH 2IA0A 4TV7A 2JA8J 4B09A 1I5ZA 4B3AA 2VONA 1IRZA 2E34A 3RSNA 5L3DA 1DU0A 2W85A 1I1GA 4PUSA 3E6CC 2OF7A 3W2AA 1BM9A 1Z67A 3T8TA 2XDVA 2K86A 3GW2A 3P9KA 3ZGKA 2DXIA 2EB7A 4YRVA 3AG2H 3HSEA 3CCUI 2YU9J 1LEAA 1P4AA 3L2UA 1SVOA 3K10A 2OV7A 4XSXF 3BG3A 3H5RA 1T8IA 1XG1A 3A4CA 1B9NA 4X0GA 4P9FA 1FOXA 5D8LB 4ASNA 3WTYC 4IHXA 4BEHA 2CQ7A 1DUXC 1I1SA 4ZDLA 3FKIJ 3VEPA 1T33A 1JI8A 3C3WA 5DDGA 1MDMA 2HOTA 1MBFA 2O0YA 1MSEC 3ZMVA 1DU6A 2R7RA 1YW9A 5HVQC 4L9NA 1J5YA 3DXJF 3HJEA 1BA5A 4C30A 1DPUA 3KX2A 4IHSA 3BDDA 3HXLA 1MNEA 2ID3A 3DWLE 3WTZA 4QTRA 2LOOA 2EA2A 2YSRA 1LNWA 3GXOA 2JUCA 3GF2A 5ICEA 3ZMUA 3H3VK 4LITA 1P7JA 2Q8KA 4BEHB 2O7OA 1SFKA 2VQCA 3SZPA 4A3KJ 2LSOA 2VJ4A 1QHHD 2QKMB 5IP7J 1F1ZA 2NOJB 1MDMB 2QVOA 1G3YA 2DFIA 4N9HA 2UUZA 4RM2A 3MVPA 1W7PD 3G1OA 3FMQA 2OJED 1SVLA 2M1BA 4E6KG 1BR1A 1Q1HA 2V79A 1ZR4A 2COMA 4NC7A 2LNBA 1TQPA 2PBIA 2PN6A 3L00A 1UB9A 2JVGA 1G3SA 3H9QA 2ZB9A 3NWTA 3D5LA 2W7NA 4UUVA 3ECOA 3FHNA 1ZGWA 1YRNA 1X3UA 3ZQHA 4XLPF 2OPTA 2V6EA 1RNLA 2W48A 3QYEA 2DQRA 3QODA 1ZRCA 1WI9A 4R8HA 2ETHA 2LYCA 2A6HF 3P9IA 2JPCA 4ZYAA 1NH3A 3QPHA 1GVJA 2GLOA 3BPXA 4L5EA 1W0UA 3GTQJ 3QU6A 4I98B 4BHBA 5IPAA 3DU6A 4AM3A 2DA2A 3HC7A 4XQFA 1D1CA 2XAUA 4IKFA 5AIPA 4P55A 3TO6A 2EZIA 2FD5A 3OIOA 1FOYA 1KU2A 1IRFA 5H2FC 3DF8A 4CCNA 1EV7A 4MNUA 3D5SC 1ZHFA 2FBKA 2TRTA 5J8CA 2B9SA 3VPRA 1B6AA 2O61A 1VTNC 1N78A 2W24A 2AO9A 4I09A 3F23A 1HSJA 1POGA 1IW7F 3IP4B 4YG2F 2O8KA 5KNLA 2OCCH 2DA7A 2G7UA 2QZ8A 4BXUA 3KEQA 3CCLI 3VYRB 1W36D 4LIVA 1FOWA 2IGNA 4QWQA 2ADUA 5CVRA 2W82A 4I0AA 1SFUA 4FT8A 1FYLA 3SFZA 4KICA 4WX9A 4D9JA 2H09A 2BW3B 2CMPA 2RNGA 3FF5A 4MQ9F 4BAYA 2HR3A 4PSWA 4M71A 2JUGA 1FPQA 2M4GA 1IAWA 2H27A 1S5LC 3KP7A 2DMUA 3OYKA 4U87A 2E7WA 3WU1B 2NNNA 3G1LA 2M87A 4EEFG 2HVQA 3FK7A 9ANTA 2E2IJ 1QVUA 2D5VA 3Q9VA 3QU3A 1MD0A 4QPOA 1JKPC 4DZPA 3AG4H 1K61A 1BN5A 3M3YJ 5F0FA 3S14J 1E17A 4WCGA 4MLOA 2LY1A 5ICFA 3OS2A 3CC2I 1IN4A 1TNTA 2K27A 2RREA 1PUEE 3G3ZA 1I6HJ 1RI7A 3EUAA 1OLTA 3F8CA 2LLKA 2JA7J 2GIVA 2KQRA 1EH7A 2HI3A 3AFHA 3LMMA 3B73A 4AYBN 2DU9A 4PGHA 2P6SA 2R7FA 3A02A 3FXUA 4D7NA 3FXQA 4UNOA 2DTZA 3FMSA 4NQWA 1MNDA 3CDHA 1DP3A 5K7ZA 3OS0A 3MFKA 3VFZA 2O03A 1KQ0A 4L9JA 2GA2A 2XRNA 3RJPA 3KETA 1LFUP 5TGTA 5DD8A 1ERDA 3HSRA 3VSLA 2LY2A 1YLFA 2HPIA 2DPUA 3DPUA 3C1DA 3HRSA 4XONA 2BY0A 1BOBA 4HF1A 2VOPA 4NQWB 4GXOA 2DA1A 4II2A 4CCOA 1XC5A 2LD5A 1FT9A 3B6AA 2EFPA 3BTLA 1WJAA 2V1UA 2KRHA 3H5NA 5KK1A 3FBNB 1IN7A 2PI0A 1ZKGA 3G2BA 3ZR8X 2RV8A 3HRUA 2WAFA 4AIKA 2CWEA 2L9NA 3BOQA 3G1MA 5JLWA 1F36A 4FTHA 2O6GE 2YR2A 2HKXA 2Y2ZA 2EBIA 3OYJA 1GT0C 1TNSA 2LRDA 2QF7A 2A6TA 2OZUA 4CICA 1FYMA 5LHIA 3HL2A 2HDWA 2E1CA 2WAEA 2IBDA 1WH5A 3ESWB 3JSPA 3J7YJ 3KCCA 2W4SA 2NNYA 1IXRC 5H20A 2Z9OA 1HA8A 1MBKA 5GPAA 2K5CA 3Q0VA 4KFCA 2QENA 1VQ6I 2HNHA 3NRVA 3BTJA 3ZQCA 1JT6A 1QVTA 2HZDA 3JRDA 1IC8A 5J8FA 5LGUA 3K1PA 1J75A 2HDDA 3FX3A 3Q9SA 1K6YA 1KONA 1W0TA 5HS7A 2KZVA 3OYFA 4L9VA 1R71A 1RIOH 1L0OC 2HYJA 4HQMA 2A68F 3L2RA 1AOYA 2XUBA 1P4XA 2HOAA 3BR6A 3CJQB 3K2ZA 3LSJA 3TGNA 4ZTJA 4XM3A 1O7FA 2JWTA 2ME0A 2D1VA 1R5GA 4A3FJ 2JT1A 4A69C 3Q3SA 2X6WA 2EILH 2JA2A 4ESBA 3H3ZA 2VLAA 4QSHA 1OFCX 3F3XA 1FBUA 1UELB 3V8KA 4DNCA 1O3QA 2VBZA 4I99C 4UV9A 5LLQA 4PSXA 4XLNF 3FWEA 4KUMA 1S3JA 4F52A 4HNTA 1UG0A 2ACJA 2G7HA 2FSWA 4S05A 4RLFA 3IRQA 2XGDA 1K83J 1Z3YA 5E20A 1CGPA 1HQCA 3H9GA 1W4MA 3H5AA 1S72I 3NWSA 3K0LA 2VB6A 2KRFA 1PP7U 2ZC2A 2Q1ZB 5FFXA 1V5GA 3IHUA 2CUJA 2W57A 1TLHB 1ETVA 4KDPA 4BGDA 3G73A 2RQQA 4R1HA 3I59A 4RBOA 5FD6A 5KCMA 3O2PE 5KVRA 1UZCA 1HW5A 2FU4A 2Q0OA 1V5EA 3SEZA 1Z6RA 2AQEA 4XNFA 2P5VA 4M3DA 5GTIC 2CG4A 3VODA 1D5VA 2MSYA 1YIOA 2R3SA 2ELJA 3N4MA 2XB0X 5FROA 3RYPA 1OMIA 2WTEA 4EM2A 2EFWA 4UV8A 1R4MB 3GCMA 2RKHA 4G6DA 2QUFA 2P6TA 2YS9A 3PNVA 4RMNA 4IXAA 4CCLA 2R5ZA 3CESA 2XSDC 2BHZA 1MBHA 1LPQA 2E7XA 2X4HA 2HTSA 3C2HA 5FLVA 2ISZA 3HSFA 2IS6A 2WV1A 3O6BB 4O3MA 4FX4A 2BEOA 1O4XA 1MJAA 2QM3A 1MZBA 4EV0A 1T0FC 4U7DA 3A0BC 4AIHA 3G71I 4L9TA 2K9NA 5C3EJ 3JR9A 4U88A 3S1NJ 4OINF 4FISA 3L9FA 3MZYA 4RB2C 4OIPF 1RKWA 2R7OA 2M2EA 2DDAA 3W2VA 1GLNA 2FE3A 1VI0A 3BJAA 3HOUJ 2YUSA 4B4CA 5LHGA 2R7UA 1JGSA 1DPRA 1S6LA 4XN3A 5LD2C 2HYFA 3QAHA 1FNNA 5GP9A 5J6XA 1YITI 4A3GJ 3JRHA 3QPLA 2VQLA 2VKVA 1Z05A 4W97A 2FNAA 3GBGA 2MD0A 2VBYA 1WH7A 3I0TA 3I71A 5BPDA 1YJWI 4JYKA 3LSHA 4A5NA 1H8AC 3S15J 2HXOA 5HS8A 2QSFX 5FB2A 1VQ4I 2X1CA 2R7SA 2ZKZA 1S7OA 3ELKA 4A93J 4XOTA 4EM0B 3K70C 1OYWA 5B3SH 3CJRB 5GPCA 2LY9A 4CCJA 3CQZJ 4FASD 1TWAJ 1HKTA 2MG4A 1BOAA 1XCBA 3GVAA 4PFOA 1MMGA 3F8BA 2FX0A 4B1RA 5FGMA 4UB8C 4RGUA 1QQIA 3O8GA 4BJ5C 3HPGA 2IVMA 3NARA 1BW6A 3ZOBA 3JREA 1V55H 4LB6B 3CMYA 4ENJA 1MMDA 1ORKA 4ZYHA 5ICGA 3CCSI 5GAEJ 2BGCA 2G0EA 2DMTA 2EV6A 5ERIA 4U0WA 2O9LA 5E3NA 5DCMB 3PL8A 2ID6A 2O5RA 3QYBA 4LLGF 1X4OA 5F27A 2KIFA 2X6YA 4EJTA 4LG3A 4LJZF 1X19A 1NG6A 4DBRA 2CW7A 3M7GA 2ZMEC 3K4NA 1P2FA 2GM4A 3DBRB 3G6EI 3OV8A 4DIQA 2KZGA 4UY8I 2FXAA 1HW1A 3O8HA 1PJRA 3CLOA 3E6DA 2XF5A 3CP2A 5CQGA 1F5TA 1VQ8I 1I39A 3VYUB 2AQFA 3I64A 3LOCA 4DGWB 3PO3J 1YJ9I 4ZTFA 5DYMA 4KA4A 1EF4A 3CUQA 1IUFA 2P0WA 4C9YA 3I9V2 3ZQLA 1PDNC 5GAHJ 5LGNA 4FETA 4BHPA 4V2FA 1IUYA 5IYDJ 2Y31A 3LFUA 1R5ID 5DM6F 1UMQA 1V4RA 5IT9K 2UXXA 3OR1C 4ZDPA 2M8GX 3DP7A 5FKMA 2DK5A 3BWGA 1I6XA 4ZC3A 3HOZJ 4RGSA 3LSTA 2H6CA 1SFXA 2VE8A 3KP6A 2LG4A 2ZFWA 3CUQB 1QPMA 2MW8A 3GMEA 4H0EA 3M4OJ 1MKMA 4DW6A 3TDZC 3B02A 4EJWA 3GZ5A 4J01A 3IH3A 1G59A 4OMZA 5IT9Z 3M07A 3RZDJ 2NAZA 5D5XB 1WJCA 3GO5A 1XDSA 1GDTA 4II3A 3H1CA 4BQAA 1IN8A 4RS8A 3KYCB 2HQRA 5KAFC 2XHKA 1A35A 5HOOA 4XN0A 5DTDA 1K4SA 2HOEA 1KQ9A 2ZXWH 5IYCJ 3IRRA 2A69F 4B8XA 2FQ3A 4WXDA 1B72A 3CD6I 5JHUA 3TQNA 1GXQA 1JUSA 3CCQI 3SEQA 1IRXA 2E1MB 3QPTA 1RRJA 4X1EA 2ZO4A 1W7PA 3V7SA 3COAC 2K9SA 1ETYA 3BG9A 4PK4A 3GTKJ 4XRMA 4ANJA 2QSGX 2F5VA 1MMNA 5IT3A 4A3MJ 1LDDA 1M1EB 2FJ1A 1HW2A 1JTXA 3C7JA 3D1NI 2JK3A 1LFPA 4QIWN 3I54A 3SZGA 4NUBA 3V7CA 3J80K 2XAQA 3IWZA 4JK1X 1RR8C 3GUDA 4Y4RA 3U2RA 1JKOC 1O57A 2NVUB 1ENHA 2DT5A 2RAEA 3HHGA 3EUHA 4BQNA 1OR7A 1X4PA 1JHFA 4HZFA 1W7PB 1FLIA 4HV6A 2L0KA 4Z2YA 3DEEA 2P81A 3F8FA 4C2TA 2YU3A 1VQLI 2STWA 4GRIA 4CXFA 4A3EJ 1SAXA 5ILVA 2NS8A 4BE2A 1Z7UA 2GZWA 2QGUA 1ZN2A 1Z3XA 1YG2A 1WZ2A 1LFBA 3GFJA 4KIFA 3K1MA 4BJ6C 2IW5A 2KFDA 5J1UA 3W3CA 4D5CA 2BZTA 3IAS2 2K40A 3OIQA 4A3IJ 3GTGJ 2PX9A 3DV8A 3PNYA 3LSRA 3AG3H 4ESFA 3MKZA 1GXPA 2CQQA 4JBAA 2HQNA 3BC8A 4I2OA 2JMWA 2JTVA 4B43A 3A2KA 4Y13A 2W00A 4GYGA 1X58A 1P92A 5E3LA 5DEQA 1UHMA 1Z1DA 2FF4A 4RM3A 2CUFA 4MFDA 3ROUA 1J09A 4BQOA 3ZMSA 2EFQA 3ERMA 2H1KA 3L2QA 1B8IA 3ZQGA 1S8NA 3KFWX 3TMOA 3MN2A 4IHVA 2X9DA 4QPQA 2E60A 4NC6A 2NS7A 2A5YB 2VJ5A 3I53A 2E2HJ 2VT3A 3FKJA 3JRBA 1EA3A 1IDZA 4BKXA 1SFEA 2EFOA 1XMXA 2VL8A 4E7HA 3WGIA 1D1AA 1PVEA 1XDUA 3GZNB 3F6OA 1ODDA 2CW8A 3Q0UA 4M72A 4ETSA 3QYFA 1OCTC 3Q0WA 3LA2A 3CDLA 4Q48A 3WTXC 1B8IB 1XSDA 2F5EA 1RC9A 3K7AJ 5FRMA 1GV5A 4ZDOA 1HCRA 1W1WE 4YFKF 5D4RA 2KDZA 2GIZA 5FFZA 2VE9A 3R0JA 1NK3P 4RGXA 3V8LA 1W5SA 1XMKA 1QZEA 2ZJRF 2PFBA 2VQGA 1FMVA 2NS0A 4C3IJ 2STTA 1GV2A 2VXZA 3ZQ7A 2VJJA 5C4XJ 2GXAA 4XKVA 1UHSA 1LQ1A 1VQ7I 3I4NJ 5FRNA 3LNQA 3MKYB 2LF8A 4PJJA 4UVBA 1WQ2A 3DKWA 1SEUA 3ZQFA 4MFEA 3A0HC 2QBYA 4HNUA 2F5CA 3OYMA 1WI3A 1BI2A 1HKSA 1HDPA 4LD5A 1W5CC 5FKNA 3S2WA 3WE3A 1H88C 2GOMA 3CJNA 1FBQA 2VJIA 1ZRDA 3A01A 1YHQI 3F8NA 2R7ZJ 1X1AA 2IJLA 1YRNB 3E3VA 5DCFA 4CGZA 2BVMA 2HXIA 5D4SA 4PJMA 1USTA 4GYIA 2PMHA 5E1ZB 1G3WA 5J1RA 4Y3OA 4FE7A 2GQQA 3LSMA 2KMUA 5HNHA 2LFBA 3GEZA 4E7ZA 4DZJA 1R58A 1E3HA 4CZCA 4CSWA 2WWYA 4GFBA 4DYQA 1YE9A 3KZZA 2V9PA 2HGCA 3VWBA 1E0EA 4O5VA 1AU7A 3KYLA 5E17F 3MZ8A 4I0BA 2HKOA 1JTYA 3V8JA 2IS1A 3KLOA 3R4KA 4HV5A 3U9GA 2KIUA 2K4BA 4M9XA 2I5UA 4CHUA 3DTEA 1F43A 1WRJA 2W25A 3DBLB 1UFMA 1ZYRF 2MD5A 3TP3A 3OYCA 1K7AA 1A04A 3W6JB 1IV8A 2DT6A 2V9KA 4JX5A 3DTIA 3OIPA 4ZH4F 3JCUC 4EJUA 4E7JA 3HOXJ 3BQZA 4LK1F 1XGNA 4UUSA 1U8RA 4CCKA 4BU2A 3FMRA 3S3NA 3BJOA 1TL8A 3CF2A 1TW3A 2GWRA 1WJBA 2VXDA 3JRAA 3WTSC 3S3OA 2R7VA 2HDCA 3TOAA 3ONQA 4OWRB 4YIIA 1JUMA 4CCMA 1X1CA 1KGSA 1RR7A 2E35A 1MJBA 4A5MA 1ZRFA 1USSA 4UUSB 2ZJPF 2WC2A 2GBYA 2H8RA 3OYDA 3WU0A 5EJCA 4BS9A 2EV0A 5HLGA 2Y30A 3O3KA 1XSVA 2Z16A 1MMAA
chains in the Genus database with same CATH topology
4HA8A 2LKPA 2XKOA 4LG0A 3R6SA 4P96A 4YFNF 5BMZA 1XCVA 2CQKA 3E5UA 3LA3A 1ZH5A 1UHWA 4N9IA 1KYWA 4OIOF 3LQQA 4R79A 1XGSA 1BC8C 4LG0B 5K5QA 3E6BA 2JPBA 5DV5A 3EYIA 2J5OA 4RAZA 1R5HA 3QRFF 1BI1A 2K7LA 4XBFA 1JXSA 1T2KA 2YPRA 3HYIA 4OIRF 5D8KB 5TRDA 3U1DA 1FSEA 1H0MA 3RI4A 2MA3A 4MQVA 4EQQA 4AIJA 3BY6A 4BH9A 5ICCA 2ZNYA 4XRFA 3IWFA 3LAPA 3JTGA 1LEBA 2OBPA 2L4AA 3ECHA 4HAMA 4P9UA 4FHTA 2ESHA 1F9NA 2EV5A 3RPQA 4U0VA 4KMFA 2Z5UA 1ONVA 2DTRA 3HTUA 1LJ9A 2J5PA 3R0AA 3GFIA 2EFNA 3BJ6A 1CF7A 1UCRA 2MBFA 2R7DA 4L0ZB 5JR3A 4HBLA 4EGYA 1IN5A 2RC4A 1FP2A 3MZHA 2QYOA 4RB1A 1ZGAA 3IKVA 1C0WA 5HLIA 3EDPA 4HDVA 3QP5A 4G7ZF 4L5JA 5LHHA 1OYYA 3SQNA 3SXYA 3BPVA 1IRGA 1YTYA 2PLYA 2XROA 3BROA 2V1DA 2VODA 3JW4A 4EM1A 3T0YA 2ZXJA 2Y75A 1R7JA 1ULYA 4RGRA 5D5VB 2DAOA 5D6FA 3I59B 2L4MA 3WTUC 2DO7A 4MGRA 4PZJA 4EVIA 4HOBA 4MEXF 4L0YB 3AAFA 2K02A 1ZG3A 1U5TA 3ZMZA 3HRTA 2HS5A 2MLGA 4OOIA 1ZARA 1IXSB 3HUGA 4ZYGA 3VB2A 4S04A 1KU3A 2MC3A 1RZ4A 1U5TB 3HTSB 3J7AO 2A61A 3PFIA 1D3YA 3PQKA 4WWCA 4A0ZA 2P7CB 1HXDA 1KQ8A 1IZ1A 3F21A 2FRHA 1S7AA 4CDGA 4LFUA 2F5DA 5D5UB 4KIBA 2M45A 1YS7A 3ZPLA 1LB2A 1WKMA 5K1YA 4LLNA 1SMYF 4I01A 1JE8A 3CO7C 5H6RA 3ZN0A 5LRRA 4NB5A 2VOOA 1J59A 3J81K 3LFKA 1YYVA 2Z33A 2DI3A 4HF0A 2RN7A 5AONA 1KA8A 2PEXA 2P5LC 2KJCA 1L3LA 2Q2EA 1ZLKA 5HDNA 1B59A 4G8XA 4A12A 2KJBA 1U78A 3J81Z 2RQPA 2AXLA 2IP2A 5E1XA 3TO9A 1YW8A 2PG4A 2XV4S 1BIBA 4WXCA 5LRSA 1FBSA 1XMAA 4GO1A 3WG9A 5D5WB 3V4GA 1WWXA 5HLHA 1MGTA 2XVCA 2FBIA 4JQFA 4DQ2A 3WE2A 5L3EA 4PDKA 4G9YA 1R1UA 5JVTA 4WK8F 2A07F 3D0SA 1FSHA 1LDJA 4HF2A 1FP1D 4GGGA 1V3FA 4OMYA 1U2WA 4UVCA 5CVJA 4Y17A 3Q5FA 2KIMA 3KP4A 1F4KA 5CJ9A 1D8JA 5FO5A 2OQGA 4IRIA 2DK8A 1I27A 1XGMA 2V1XA 5FLXK 2HZTA 3RDIA 3HRMA 2QWWA 3GZ6A 2K4JA 4OIQF 1P6RA 3QP6A 1HSTA 2YX7A 3VOEA 2ESNA 2ZMEA 4LGWA 3DQVC 3L2CA 5BQTA 1BI0A 3ULQB 2X0LA 4HW0A 4MHGA 3KP5A 4HLYA 2RDPA 2F5FA 1HKQA 1T98A 5L3GA 1ZG5A 4RB3C 1R36A 1ON2A 3NQOA 2ZMEB 1TW2A 3ZMDA 2IA1A 1QBJA 3GWZA 3SHFA 3K69A 3P7NA 4M9SA 2H94A 5F64A 1YQAA 2XAHA 4KYWA 3FZVA 3ABTA 4HX4A 2UWMA 3LWFA 5HS9A 3N97A 3CTAA 2ZJ2A 2IRFG 2WV0A 1J7KA 3OOPA 3M8FA 4K2EA 5DUKA 1OKRA 3KP2A 3ML6A 3J80Z 2EJRA 4IRGA 2HEOA 5E1WA 4ESJA 2RGVA 3FM3A 4LB5A 2G9WA 5CVVA 3KZYA 5L3FA 2JSCA 5JFRA 1ZREA 1O7LA 2QQ9A 3MWMA 4L5IA 2PQ8A 1WSUA 1EH6A 2IA2A 2L01A 2OAZA 4KT5C 2D45A 2VC1A 1U6GA 3M8EA 2ZNZA 3BP8A 3F22A 1T6SA 2OD5A 2ISYA 1P4WA 2MH2A 3RKYA 2CYYA 4ENKA 2O8XA 5LBQA 1S29A 2QQAA 5TJJA 1SD6A 5HDKA 1IN6A 2VT2A 3DEUA 2P7VB 2PMUA 2BYVE 1B1BA 1Z6TA 1U3EM 3ABUA 1FX7A 2HWVA 1R1VA 3ZP5A 1QO0D 2GA1A 3JSOA 3WTWC 4IRHA 2XAJA 4IF4A 1FWZA 3SZTA 1IXCA 3ZMTA 4BHCA 3LQRA 4HX8A 4O6JA 4KMUX 3M9AA 5HDGA 1O3RA 1LVAA 2M30A 1STZA 2YX4A 4HX7A 5ILSA 2GAUA 2PJPA 4WF2A 3PQJA 5ILUA 1QZZA 2FMLA 4HQEA 1R23A 2L54A 2HFHA 2XIGA 1FC3A 4NHJA 2XASA 3T5XA 4G7OF 3KP3A 2ELHA 4QLCU 4E70A 2QBYB 6PAXA 2FA5A 1EH8A 4EJVA 2CO5A 4L18B 3E5XA 3F72A 5L3CA 4GCVA 3ZN1A 2CFXA 2UXNA 2Y48A 3MQ0A 3DFGA 1G4DA 1K79A 1B9MA 3JAMK 1XB4A 3I4PA 3L09A 2DPDA 1D8KA 5LEKA 5EEGA 4Q5SF 3TKYA 3I5UA 3RPUA 1GHCA 2VBXA 2O3FA 3WGGA 3GX4X 3BZ6A 1SD7A 3JAMZ 1ZG1A 2NRAC 4KNYA 2BV6A 5D6EA 4CO8A 3CUOA 3WTTC 2VBWA 4G6QA 2ZBKA 4UVAA 4PCQA 4U0YA 3HIFA 1R22A 3L7WA 1LDKB 2OQRA 2M8EA 4HDUA 1YS6A 2IPQX 4ENMA 3R60A 3T1BA 5K5RA 4M74A 3W6KB 4HLXA 5E18F 3EYYA 4IPAA 3MEXA 3K1NA 2NYXA 3R61A 4RAYA 2P5KA 4M6XA 5BPIA 4ZZLA 2FMYA 2EA4A 2TDXA 3E97A 1IF1A 5JI6A 4CYDA 5LGTA 1HBXG 5CVIA 4A6DA 4WXHA 2IT0A 3HOTA 1DP7P 4LLLA 4KN7X 4ZZDA 5DUIA 2KKOA 4U7BA 3KE2A 2OZ6A 5E8IA 4MTEA 2V6CA 3EQLF 4UHTA 1YFHA 1QNTA 1G6NA 2VN2A 2OA4A 3CO6C 1PP8F 5BOXA 4FX0A 2F2EA 1T38A 1U5TC 2W84A 3TDUC 1XD7A 4RB0A 3KEOA 1TQIA 1J0RA 1BIAA 4ENNA 1CF7B 2MLKA 4YFXF 5FD5A 3GYHX 2QLZA 4A0XA 2VC0A 3TO7A 2XAGA 5DD4A 2DQLA 3ISPA 1O3SA 3HHHA 1J9IA 1AWCA 2EK5A 2L02A 4P5OA 1ZGJA 4D0PA 2DBBA 2Z3YA 2L3DA 4AVPA 2BBYA 5A2QK 5EEHA 3RKXA 4KIGA 3RTRA 1SD4A 1RUOA 2D1HA 3IL2A 2RNJA 2RVCA 1QZYA 1DDNA 3V7RA 3IC7A 3LAJA 2A3SA 5F6FA 5A2QZ 3GLXA 5L3BA 1Y0UA 3KLNA 1B4AA 2Z99A 4LMYA 2C6YA 4A2UA 4M6YA 3FHZA 1BBYA 2FOKA 2ZCWA 1JHHA 3ERED 3M1EA 4EGZA 2B0LA 3GFMA 1T39A 4IHTA 3H92A 4AD9A 4OU0A 2P8TA 4Q4ZF 2JRTA 3DPTA 3FXRA 2UZKA 4Q47A 2LF7A 2M5WA 4F7ZA 1BI3A 2MH9A 2HTJA 3E5QA 3CUQC 1G3TA 3QOPA 3I58A 5ED4A 3F8MA 2D2WA 5AIQA 1T0FA 3P9CA 5BS6A 2XAFA 4A6EA 1XSVA 4N0BA 3RYRA 2XGXA 3F6VA 1TQMA 2CSOA 4YIFA 3TOBA 2JZYA 5DCMA 1O3TA 3H3UA 1Z91A 3FM5A 3JTHA 1XGOA 1E2XA 4CZZA 1H9TA 4G94A 1KU9A 3DPLC 1YO5C 1MJ9A 1J2XA 2QQBA 3MAJA 1ZAOA 5CYVA 4I02A 2GXBA 1XSXA 4AWXB 1YW7A 2CW0F 1OYIA 1R00A 2FEZA 1XN7A 1FZPB 3EETA 2P4WA 4ZYEA 4HYEA 1Z9CA 2OU2A 4IVNA 1QGPA 1NHAA 5H6QA 2FBHA 3T8RA 2H6BA 3RKWA 4G7HF 2DW4A 2DLLA 3GFLA 1OPCA 1KYZA 3WGHA 4XSZF 3REOA 3E6MA 2A6EF 2XKPA 1K78A 4EJOA 3NEUA 4EMSA 1ZLJA 4Y15A 2V9VA 5FLXZ 4BNCA 1RUNA 4MEYF 3RIRA 1FOKA 1ON1A 3HOSA 2E1NA 3WODF 2CGPA 1W5TA 3WTVC 2AS5F 5CLSA 3K9TA 1K78B 4M9ZA 1BC7C 4IJAA 3C18A 2GXGA 1SMTA 5CVUA 2Y0MA 4M73A 5K5OA 4MTDA 4PGGA 4KN4X 1BJAA 4BYYA 1FYKA 5F1RA 5E8GA 4A0YA 2FNPA 4I7HA 1H9GA 2HYGD 2EWNA 3IKTA 1TTYA 1SD5A 1R1TA 2BE5F 1K6OA 1REPC 1TBXA 3LA7A 4LK0F 3MCZA 4ZYDA 5LEJA 1KU7A 1FY7A 4UXNA 2LDUA 2IA0A 4TV7A 4B09A 1I5ZA 2VONA 5L3DA 2W85A 1I1GA 3E6CC 1BM9A 3T8TA 2K86A 3GW2A 3P9KA 2EB7A 3HSEA 1LEAA 1P4AA 4XSXF 1B9NA 4P9FA 5D8LB 4ASNA 3WTYC 1DUXC 1I1SA 3VEPA 3C3WA 5DDGA 1MDMA 2O0YA 3ZMVA 1YW9A 5HVQC 4L9NA 1J5YA 3DXJF 1DPUA 4IHSA 3BDDA 3WTZA 2EA2A 2YSRA 1LNWA 3GXOA 3GF2A 5ICEA 3ZMUA 2Q8KA 3SZPA 2LSOA 1F1ZA 1MDMB 2QVOA 1G3YA 2DFIA 4N9HA 1W7PD 3FMQA 2M1BA 1Q1HA 2V79A 2COMA 2LNBA 1TQPA 2PBIA 2PN6A 3L00A 1UB9A 1G3SA 3D5LA 4UUVA 3ECOA 1X3UA 4XLPF 1RNLA 2DQRA 1ZRCA 1WI9A 4R8HA 2ETHA 2A6HF 3P9IA 2JPCA 3QPHA 1GVJA 3BPXA 3QU6A 4I98B 4BHBA 5AIPA 4P55A 3TO6A 1KU2A 1IRFA 3DF8A 1EV7A 4MNUA 1ZHFA 2FBKA 5J8CA 2O61A 1B6AA 1VTNC 2W24A 4I09A 3F23A 1HSJA 1IW7F 4YG2F 2G7UA 2QZ8A 4BXUA 3KEQA 4QWQA 2ADUA 5CVRA 4I0AA 1SFUA 4FT8A 1FYLA 3SFZA 4KICA 4WX9A 2H09A 3FF5A 4MQ9F 4BAYA 2HR3A 4M71A 1FPQA 1IAWA 2H27A 3KP7A 2E7WA 3WU1B 2NNNA 2M87A 3Q9VA 3QU3A 1MD0A 1BN5A 1E17A 4WCGA 5ICFA 1IN4A 1TNTA 2K27A 1PUEE 3G3ZA 1RI7A 3F8CA 2GIVA 1EH7A 3B73A 2DU9A 4PGHA 2P6SA 2R7FA 3FXUA 3FXQA 4UNOA 3FMSA 4NQWA 3CDHA 3MFKA 3VFZA 2O03A 1KQ0A 4L9JA 2GA2A 2XRNA 3RJPA 3KETA 5DD8A 3HSRA 1YLFA 2DPUA 3C1DA 3HRSA 4HF1A 2VOPA 4GXOA 1FT9A 2EFPA 2V1UA 5KK1A 2PI0A 1IN7A 2RV8A 3HRUA 4AIKA 2CWEA 3BOQA 2O6GE 2YR2A 2HKXA 1TNSA 2OZUA 4CICA 1FYMA 5LHIA 2E1CA 3JSPA 3KCCA 2NNYA 1IXRC 5H20A 2Z9OA 4KFCA 2QENA 3NRVA 5J8FA 5LGUA 3K1PA 1J75A 3FX3A 3Q9SA 5HS7A 4L9VA 1RIOH 1L0OC 4HQMA 2A68F 1AOYA 2XUBA 1P4XA 3K2ZA 3TGNA 1O7FA 2D1VA 1R5GA 2JT1A 4ESBA 3H3ZA 3F3XA 1FBUA 3V8KA 4DNCA 1O3QA 2VBZA 4UV9A 5LLQA 4XLNF 3FWEA 4KUMA 1S3JA 2ACJA 2G7HA 2FSWA 4S05A 3IRQA 1CGPA 5E20A 1HQCA 1W4MA 1PP7U 3K0LA 2KRFA 5FFXA 3IHUA 2W57A 1TLHB 4KDPA 3G73A 4R1HA 3I59A 5FD6A 3O2PE 5KVRA 1HW5A 2FU4A 2Q0OA 1Z6RA 2P5VA 2CG4A 3VODA 1D5VA 1YIOA 2R3SA 3N4MA 3RYPA 1OMIA 2WTEA 4EM2A 2EFWA 4UV8A 2RKHA 4G6DA 2QUFA 2P6TA 4IXAA 2E7XA 2X4HA 2HTSA 2ISZA 3HSFA 3O6BB 4O3MA 4FX4A 2BEOA 1MJAA 2QM3A 1MZBA 4EV0A 4U7DA 4AIHA 4L9TA 4U88A 4OINF 3L9FA 3MZYA 4RB2C 4OIPF 2FE3A 3BJAA 5LHGA 1JGSA 1DPRA 1S6LA 2HYFA 3QAHA 1FNNA 5J6XA 1Z05A 2FNAA 2VBYA 3I0TA 3I71A 5BPDA 4A5NA 5HS8A 5FB2A 2ZKZA 1S7OA 3ELKA 4EM0B 1OYWA 1HKTA 1BOAA 1XCBA 3GVAA 3F8BA 5FGMA 4RGUA 1QQIA 2IVMA 4LB6B 4ENJA 4ZYHA 5ICGA 2BGCA 2EV6A 5ERIA 4U0WA 5DCMB 4LLGF 2KIFA 4EJTA 4LJZF 3M7GA 1P2FA 3OV8A 2FXAA 1HW1A 1F5TA 3CLOA 3E6DA 3I64A 5DYMA 4KA4A 3CUQA 1PDNC 5LGNA 4BHPA 1IUYA 1V4RA 5IT9K 2UXXA 3DP7A 2DK5A 3BWGA 1I6XA 4RGSA 3LSTA 2H6CA 1SFXA 2VE8A 3KP6A 2ZFWA 3CUQB 1QPMA 4H0EA 1MKMA 3TDZC 3B02A 4EJWA 3GZ5A 4OMZA 5IT9Z 2NAZA 5D5XB 3GO5A 1XDSA 4BQAA 1IN8A 4RS8A 2HQRA 2XHKA 5HOOA 2HOEA 1KQ9A 3IRRA 2A69F 4B8XA 2FQ3A 4WXDA 5JHUA 3TQNA 1GXQA 3QPTA 2ZO4A 1W7PA 3V7SA 3COAC 5IT3A 1LDDA 1HW2A 3C7JA 3I54A 3V7CA 3J80K 2XAQA 3IWZA 4JK1X 3GUDA 3U2RA 1O57A 3HHGA 2DT5A 3EUHA 1OR7A 1JHFA 4HZFA 1W7PB 1FLIA 4HV6A 4Z2YA 3F8FA 2YU3A 2STWA 4CXFA 1SAXA 5ILVA 1Z7UA 2GZWA 1ZN2A 1YG2A 3GFJA 4KIFA 3K1MA 2IW5A 3DV8A 4ESFA 1GXPA 4JBAA 2HQNA 4I2OA 2JTVA 4Y13A 4GYGA 1P92A 5DEQA 1UHMA 1Z1DA 2FF4A 3ROUA 3ZMSA 2EFQA 1S8NA 3KFWX 2A5YB 3I53A 2VT3A 1SFEA 2EFOA 3WGIA 1XDUA 3F6OA 1ODDA 4ETSA 4M72A 3LA2A 4Q48A 3WTXC 1XSDA 2F5EA 4YFKF 5D4RA 5FFZA 2VE9A 3R0JA 4RGXA 3V8LA 1W5SA 1XMKA 2PFBA 2NS0A 2STTA 2VXZA 3ZQ7A 1LQ1A 2LF8A 4UVBA 1WQ2A 3DKWA 2QBYA 2F5CA 1BI2A 1HKSA 4LD5A 3S2WA 3WE3A 1FBQA 3CJNA 1ZRDA 3F8NA 2IJLA 3E3VA 5DCFA 4CGZA 5D4SA 1USTA 4GYIA 2PMHA 5E1ZB 1G3WA 2GQQA 3GEZA 1R58A 2WWYA 3KZZA 2HGCA 4O5VA 5E17F 4I0BA 2HKOA 3V8JA 3KLOA 3R4KA 4HV5A 3U9GA 2KIUA 2K4BA 4M9XA 4CHUA 1WRJA 2W25A 1UFMA 1ZYRF 2MD5A 1K7AA 1A04A 3W6JB 4ZH4F 4EJUA 4LK1F 1XGNA 1U8RA 3FMRA 3BJOA 1TW3A 2GWRA 3WTSC 2HDCA 3TOAA 4YIIA 1KGSA 1MJBA 4A5MA 1ZRFA 1USSA 2WC2A 3WU0A 2EV0A 5HLGA 3O3KA 4ON0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HA8 A;  2LKP A;  2XKO A;  4LG0 A;  3R6S A;  4P96 A;  4YFN F;  5BMZ A;  1XCV A;  2CQK A;  3E5U A;  3LA3 A;  1ZH5 A;  1UHW A;  4N9I A;  1KYW A;  4OIO F;  3LQQ A;  4R79 A;  1XGS A;  1BC8 C;  4LG0 B;  5K5Q A;  3E6B A;  2JPB A;  5DV5 A;  3EYI A;  2J5O A;  4RAZ A;  1R5H A;  3QRF F;  1BI1 A;  2K7L A;  4XBF A;  1JXS A;  1T2K A;  2YPR A;  3HYI A;  4OIR F;  5D8K B;  5TRD A;  3U1D A;  1FSE A;  1H0M A;  3RI4 A;  2MA3 A;  4MQV A;  4EQQ A;  4AIJ A;  3BY6 A;  4BH9 A;  5ICC A;  2ZNY A;  4XRF A;  3IWF A;  3LAP A;  3JTG A;  1LEB A;  2OBP A;  2L4A A;  3ECH A;  4HAM A;  4P9U A;  4FHT A;  2ESH A;  1F9N A;  2EV5 A;  3RPQ A;  4U0V A;  4KMF A;  2Z5U A;  1ONV A;  2DTR A;  3HTU A;  1LJ9 A;  2J5P A;  3R0A A;  3GFI A;  2EFN A;  3BJ6 A;  1CF7 A;  1UCR A;  2MBF A;  2R7D A;  4L0Z B;  5JR3 A;  4HBL A;  4EGY A;  1IN5 A;  2RC4 A;  1FP2 A;  3MZH A;  2QYO A;  4RB1 A;  1ZGA A;  3IKV A;  1C0W A;  5HLI A;  3EDP A;  4HDV A;  3QP5 A;  4G7Z F;  4L5J A;  5LHH A;  1OYY A;  3SQN A;  3SXY A;  3BPV A;  1IRG A;  1YTY A;  2PLY A;  2XRO A;  3BRO A;  2V1D A;  2VOD A;  3JW4 A;  4EM1 A;  3T0Y A;  2ZXJ A;  2Y75 A;  1R7J A;  1ULY A;  4RGR A;  5D5V B;  2DAO A;  5D6F A;  3I59 B;  2L4M A;  3WTU C;  2DO7 A;  4MGR A;  4PZJ A;  4EVI A;  4HOB A;  4MEX F;  4L0Y B;  3AAF A;  2K02 A;  1ZG3 A;  1U5T A;  3ZMZ A;  3HRT A;  2HS5 A;  2MLG A;  4OOI A;  1ZAR A;  1IXS B;  3HUG A;  4ZYG A;  3VB2 A;  4S04 A;  1KU3 A;  2MC3 A;  1RZ4 A;  1U5T B;  3HTS B;  3J7A O;  2A61 A;  3PFI A;  1D3Y A;  3PQK A;  4WWC A;  4A0Z A;  2P7C B;  1HXD A;  1KQ8 A;  1IZ1 A;  3F21 A;  2FRH A;  1S7A A;  4CDG A;  4LFU A;  2F5D A;  5D5U B;  4KIB A;  2M45 A;  1YS7 A;  3ZPL A;  1LB2 A;  1WKM A;  5K1Y A;  4LLN A;  1SMY F;  4I01 A;  1JE8 A;  3CO7 C;  5H6R A;  3ZN0 A;  5LRR A;  4NB5 A;  2VOO A;  1J59 A;  3J81 K;  3LFK A;  1YYV A;  2Z33 A;  2DI3 A;  4HF0 A;  2RN7 A;  5AON A;  1KA8 A;  2PEX A;  2P5L C;  2KJC A;  1L3L A;  2Q2E A;  1ZLK A;  5HDN A;  1B59 A;  4G8X A;  4A12 A;  2KJB A;  1U78 A;  3J81 Z;  2RQP A;  2AXL A;  2IP2 A;  5E1X A;  3TO9 A;  1YW8 A;  2PG4 A;  2XV4 S;  1BIB A;  4WXC A;  5LRS A;  1FBS A;  1XMA A;  4GO1 A;  3WG9 A;  5D5W B;  3V4G A;  1WWX A;  5HLH A;  1MGT A;  2XVC A;  2FBI A;  4JQF A;  4DQ2 A;  3WE2 A;  5L3E A;  4PDK A;  4G9Y A;  1R1U A;  5JVT A;  4WK8 F;  2A07 F;  3D0S A;  1FSH A;  1LDJ A;  4HF2 A;  1FP1 D;  4GGG A;  1V3F A;  4OMY A;  1U2W A;  4UVC A;  5CVJ A;  4Y17 A;  3Q5F A;  2KIM A;  3KP4 A;  1F4K A;  5CJ9 A;  1D8J A;  5FO5 A;  2OQG A;  4IRI A;  2DK8 A;  1I27 A;  1XGM A;  2V1X A;  5FLX K;  2HZT A;  3RDI A;  3HRM A;  2QWW A;  3GZ6 A;  2K4J A;  4OIQ F;  1P6R A;  3QP6 A;  1HST A;  2YX7 A;  3VOE A;  2ESN A;  2ZME A;  4LGW A;  3DQV C;  3L2C A;  5BQT A;  1BI0 A;  3ULQ B;  2X0L A;  4HW0 A;  4MHG A;  3KP5 A;  4HLY A;  2RDP A;  2F5F A;  1HKQ A;  1T98 A;  5L3G A;  1ZG5 A;  4RB3 C;  1R36 A;  1ON2 A;  3NQO A;  2ZME B;  1TW2 A;  3ZMD A;  2IA1 A;  1QBJ A;  3GWZ A;  3SHF A;  3K69 A;  3P7N A;  4M9S A;  2H94 A;  5F64 A;  1YQA A;  2XAH A;  4KYW A;  3FZV A;  3ABT A;  4HX4 A;  2UWM A;  3LWF A;  5HS9 A;  3N97 A;  3CTA A;  2ZJ2 A;  2IRF G;  2WV0 A;  1J7K A;  3OOP A;  3M8F A;  4K2E A;  5DUK A;  1OKR A;  3KP2 A;  3ML6 A;  3J80 Z;  2EJR A;  4IRG A;  2HEO A;  5E1W A;  4ESJ A;  2RGV A;  3FM3 A;  4LB5 A;  2G9W A;  5CVV A;  3KZY A;  5L3F A;  2JSC A;  5JFR A;  1ZRE A;  1O7L A;  2QQ9 A;  3MWM A;  4L5I A;  2PQ8 A;  1WSU A;  1EH6 A;  2IA2 A;  2L01 A;  2OAZ A;  4KT5 C;  2D45 A;  2VC1 A;  1U6G A;  3M8E A;  2ZNZ A;  3BP8 A;  3F22 A;  1T6S A;  2OD5 A;  2ISY A;  1P4W A;  2MH2 A;  3RKY A;  2CYY A;  4ENK A;  2O8X A;  5LBQ A;  1S29 A;  2QQA A;  5TJJ A;  1SD6 A;  5HDK A;  1IN6 A;  2VT2 A;  3DEU A;  2P7V B;  2PMU A;  2BYV E;  1B1B A;  1Z6T A;  1U3E M;  3ABU A;  1FX7 A;  2HWV A;  1R1V A;  3ZP5 A;  1QO0 D;  2GA1 A;  3JSO A;  3WTW C;  4IRH A;  2XAJ A;  4IF4 A;  1FWZ A;  3SZT A;  1IXC A;  3ZMT A;  4BHC A;  3LQR A;  4HX8 A;  4O6J A;  4KMU X;  3M9A A;  5HDG A;  1O3R A;  1LVA A;  2M30 A;  1STZ A;  2YX4 A;  4HX7 A;  5ILS A;  2GAU A;  2PJP A;  4WF2 A;  3PQJ A;  5ILU A;  1QZZ A;  2FML A;  4HQE A;  1R23 A;  2L54 A;  2HFH A;  2XIG A;  1FC3 A;  4NHJ A;  2XAS A;  3T5X A;  4G7O F;  3KP3 A;  2ELH A;  4QLC U;  4E70 A;  2QBY B;  6PAX A;  2FA5 A;  1EH8 A;  4EJV A;  2CO5 A;  4L18 B;  3E5X A;  3F72 A;  5L3C A;  4GCV A;  3ZN1 A;  2CFX A;  2UXN A;  2Y48 A;  3MQ0 A;  3DFG A;  1G4D A;  1K79 A;  1B9M A;  3JAM K;  1XB4 A;  3I4P A;  3L09 A;  2DPD A;  1D8K A;  5LEK A;  5EEG A;  4Q5S F;  3TKY A;  3I5U A;  3RPU A;  1GHC A;  2VBX A;  2O3F A;  3WGG A;  3GX4 X;  3BZ6 A;  1SD7 A;  3JAM Z;  1ZG1 A;  2NRA C;  4KNY A;  2BV6 A;  5D6E A;  4CO8 A;  3CUO A;  3WTT C;  2VBW A;  4G6Q A;  2ZBK A;  4UVA A;  4PCQ A;  4U0Y A;  3HIF A;  1R22 A;  3L7W A;  1LDK B;  2OQR A;  2M8E A;  4HDU A;  1YS6 A;  2IPQ X;  4ENM A;  3R60 A;  3T1B A;  5K5R A;  4M74 A;  3W6K B;  4HLX A;  5E18 F;  3EYY A;  4IPA A;  3MEX A;  3K1N A;  2NYX A;  3R61 A;  4RAY A;  2P5K A;  4M6X A;  5BPI A;  4ZZL A;  2FMY A;  2EA4 A;  2TDX A;  3E97 A;  1IF1 A;  5JI6 A;  4CYD A;  5LGT A;  1HBX G;  5CVI A;  4A6D A;  4WXH A;  2IT0 A;  3HOT A;  1DP7 P;  4LLL A;  4KN7 X;  4ZZD A;  5DUI A;  2KKO A;  4U7B A;  3KE2 A;  2OZ6 A;  5E8I A;  4MTE A;  2V6C A;  3EQL F;  4UHT A;  1YFH A;  1QNT A;  1G6N A;  2VN2 A;  2OA4 A;  3CO6 C;  1PP8 F;  5BOX A;  4FX0 A;  2F2E A;  1T38 A;  1U5T C;  2W84 A;  3TDU C;  1XD7 A;  4RB0 A;  3KEO A;  1TQI A;  1J0R A;  1BIA A;  4ENN A;  1CF7 B;  2MLK A;  4YFX F;  5FD5 A;  3GYH X;  2QLZ A;  4A0X A;  2VC0 A;  3TO7 A;  2XAG A;  5DD4 A;  2DQL A;  3ISP A;  1O3S A;  3HHH A;  1J9I A;  1AWC A;  2EK5 A;  2L02 A;  4P5O A;  1ZGJ A;  4D0P A;  2DBB A;  2Z3Y A;  2L3D A;  4AVP A;  2BBY A;  5A2Q K;  5EEH A;  3RKX A;  4KIG A;  3RTR A;  1SD4 A;  1RUO A;  2D1H A;  3IL2 A;  2RNJ A;  2RVC A;  1QZY A;  1DDN A;  3V7R A;  3IC7 A;  3LAJ A;  2A3S A;  5F6F A;  5A2Q Z;  3GLX A;  5L3B A;  1Y0U A;  3KLN A;  1B4A A;  2Z99 A;  4LMY A;  2C6Y A;  4A2U A;  4M6Y A;  3FHZ A;  1BBY A;  2FOK A;  2ZCW A;  1JHH A;  3ERE D;  3M1E A;  4EGZ A;  2B0L A;  3GFM A;  1T39 A;  4IHT A;  3H92 A;  4AD9 A;  4OU0 A;  2P8T A;  4Q4Z F;  2JRT A;  3DPT A;  3FXR A;  2UZK A;  4Q47 A;  2LF7 A;  2M5W A;  4F7Z A;  1BI3 A;  2MH9 A;  2HTJ A;  3E5Q A;  3CUQ C;  1G3T A;  3QOP A;  3I58 A;  5ED4 A;  3F8M A;  2D2W A;  5AIQ A;  1T0F A;  3P9C A;  5BS6 A;  2XAF A;  4A6E A;  1XSV A;  4N0B A;  3RYR A;  2XGX A;  3F6V A;  1TQM A;  2CSO A;  4YIF A;  3TOB A;  2JZY A;  5DCM A;  1O3T A;  3H3U A;  1Z91 A;  3FM5 A;  3JTH A;  1XGO A;  1E2X A;  4CZZ A;  1H9T A;  4G94 A;  1KU9 A;  3DPL C;  1YO5 C;  1MJ9 A;  1J2X A;  2QQB A;  3MAJ A;  1ZAO A;  5CYV A;  4I02 A;  2GXB A;  1XSX A;  4AWX B;  1YW7 A;  2CW0 F;  1OYI A;  1R00 A;  2FEZ A;  1XN7 A;  1FZP B;  3EET A;  2P4W A;  4ZYE A;  4HYE A;  1Z9C A;  2OU2 A;  4IVN A;  1QGP A;  1NHA A;  5H6Q A;  2FBH A;  3T8R A;  2H6B A;  3RKW A;  4G7H F;  2DW4 A;  2DLL A;  3GFL A;  1OPC A;  1KYZ A;  3WGH A;  4XSZ F;  3REO A;  3E6M A;  2A6E F;  2XKP A;  1K78 A;  4EJO A;  3NEU A;  4EMS A;  1ZLJ A;  4Y15 A;  2V9V A;  5FLX Z;  4BNC A;  1RUN A;  4MEY F;  3RIR A;  1FOK A;  1ON1 A;  3HOS A;  2E1N A;  3WOD F;  2CGP A;  1W5T A;  3WTV C;  2AS5 F;  5CLS A;  3K9T A;  1K78 B;  4M9Z A;  1BC7 C;  4IJA A;  3C18 A;  2GXG A;  1SMT A;  5CVU A;  2Y0M A;  4M73 A;  5K5O A;  4MTD A;  4PGG A;  4KN4 X;  1BJA A;  4BYY A;  1FYK A;  5F1R A;  5E8G A;  4A0Y A;  2FNP A;  4I7H A;  1H9G A;  2HYG D;  2EWN A;  3IKT A;  1TTY A;  1SD5 A;  1R1T A;  2BE5 F;  1K6O A;  1REP C;  1TBX A;  3LA7 A;  4LK0 F;  3MCZ A;  4ZYD A;  5LEJ A;  1KU7 A;  1FY7 A;  4UXN A;  2LDU A;  2IA0 A;  4TV7 A;  4B09 A;  1I5Z A;  2VON A;  5L3D A;  2W85 A;  1I1G A;  3E6C C;  1BM9 A;  3T8T A;  2K86 A;  3GW2 A;  3P9K A;  2EB7 A;  3HSE A;  1LEA A;  1P4A A;  4XSX F;  1B9N A;  4P9F A;  5D8L B;  4ASN A;  3WTY C;  1DUX C;  1I1S A;  3VEP A;  3C3W A;  5DDG A;  1MDM A;  2O0Y A;  3ZMV A;  1YW9 A;  5HVQ C;  4L9N A;  1J5Y A;  3DXJ F;  1DPU A;  4IHS A;  3BDD A;  3WTZ A;  2EA2 A;  2YSR A;  1LNW A;  3GXO A;  3GF2 A;  5ICE A;  3ZMU A;  2Q8K A;  3SZP A;  2LSO A;  1F1Z A;  1MDM B;  2QVO A;  1G3Y A;  2DFI A;  4N9H A;  1W7P D;  3FMQ A;  2M1B A;  1Q1H A;  2V79 A;  2COM A;  2LNB A;  1TQP A;  2PBI A;  2PN6 A;  3L00 A;  1UB9 A;  1G3S A;  3D5L A;  4UUV A;  3ECO A;  1X3U A;  4XLP F;  1RNL A;  2DQR A;  1ZRC A;  1WI9 A;  4R8H A;  2ETH A;  2A6H F;  3P9I A;  2JPC A;  3QPH A;  1GVJ A;  3BPX A;  3QU6 A;  4I98 B;  4BHB A;  5AIP A;  4P55 A;  3TO6 A;  1KU2 A;  1IRF A;  3DF8 A;  1EV7 A;  4MNU A;  1ZHF A;  2FBK A;  5J8C A;  2O61 A;  1B6A A;  1VTN C;  2W24 A;  4I09 A;  3F23 A;  1HSJ A;  1IW7 F;  4YG2 F;  2G7U A;  2QZ8 A;  4BXU A;  3KEQ A;  4QWQ A;  2ADU A;  5CVR A;  4I0A A;  1SFU A;  4FT8 A;  1FYL A;  3SFZ A;  4KIC A;  4WX9 A;  2H09 A;  3FF5 A;  4MQ9 F;  4BAY A;  2HR3 A;  4M71 A;  1FPQ A;  1IAW A;  2H27 A;  3KP7 A;  2E7W A;  3WU1 B;  2NNN A;  2M87 A;  3Q9V A;  3QU3 A;  1MD0 A;  1BN5 A;  1E17 A;  4WCG A;  5ICF A;  1IN4 A;  1TNT A;  2K27 A;  1PUE E;  3G3Z A;  1RI7 A;  3F8C A;  2GIV A;  1EH7 A;  3B73 A;  2DU9 A;  4PGH A;  2P6S A;  2R7F A;  3FXU A;  3FXQ A;  4UNO A;  3FMS A;  4NQW A;  3CDH A;  3MFK A;  3VFZ A;  2O03 A;  1KQ0 A;  4L9J A;  2GA2 A;  2XRN A;  3RJP A;  3KET A;  5DD8 A;  3HSR A;  1YLF A;  2DPU A;  3C1D A;  3HRS A;  4HF1 A;  2VOP A;  4GXO A;  1FT9 A;  2EFP A;  2V1U A;  5KK1 A;  2PI0 A;  1IN7 A;  2RV8 A;  3HRU A;  4AIK A;  2CWE A;  3BOQ A;  2O6G E;  2YR2 A;  2HKX A;  1TNS A;  2OZU A;  4CIC A;  1FYM A;  5LHI A;  2E1C A;  3JSP A;  3KCC A;  2NNY A;  1IXR C;  5H20 A;  2Z9O A;  4KFC A;  2QEN A;  3NRV A;  5J8F A;  5LGU A;  3K1P A;  1J75 A;  3FX3 A;  3Q9S A;  5HS7 A;  4L9V A;  1RIO H;  1L0O C;  4HQM A;  2A68 F;  1AOY A;  2XUB A;  1P4X A;  3K2Z A;  3TGN A;  1O7F A;  2D1V A;  1R5G A;  2JT1 A;  4ESB A;  3H3Z A;  3F3X A;  1FBU A;  3V8K A;  4DNC A;  1O3Q A;  2VBZ A;  4UV9 A;  5LLQ A;  4XLN F;  3FWE A;  4KUM A;  1S3J A;  2ACJ A;  2G7H A;  2FSW A;  4S05 A;  3IRQ A;  1CGP A;  5E20 A;  1HQC A;  1W4M A;  1PP7 U;  3K0L A;  2KRF A;  5FFX A;  3IHU A;  2W57 A;  1TLH B;  4KDP A;  3G73 A;  4R1H A;  3I59 A;  5FD6 A;  3O2P E;  5KVR A;  1HW5 A;  2FU4 A;  2Q0O A;  1Z6R A;  2P5V A;  2CG4 A;  3VOD A;  1D5V A;  1YIO A;  2R3S A;  3N4M A;  3RYP A;  1OMI A;  2WTE A;  4EM2 A;  2EFW A;  4UV8 A;  2RKH A;  4G6D A;  2QUF A;  2P6T A;  4IXA A;  2E7X A;  2X4H A;  2HTS A;  2ISZ A;  3HSF A;  3O6B B;  4O3M A;  4FX4 A;  2BEO A;  1MJA A;  2QM3 A;  1MZB A;  4EV0 A;  4U7D A;  4AIH A;  4L9T A;  4U88 A;  4OIN F;  3L9F A;  3MZY A;  4RB2 C;  4OIP F;  2FE3 A;  3BJA A;  5LHG A;  1JGS A;  1DPR A;  1S6L A;  2HYF A;  3QAH A;  1FNN A;  5J6X A;  1Z05 A;  2FNA A;  2VBY A;  3I0T A;  3I71 A;  5BPD A;  4A5N A;  5HS8 A;  5FB2 A;  2ZKZ A;  1S7O A;  3ELK A;  4EM0 B;  1OYW A;  1HKT A;  1BOA A;  1XCB A;  3GVA A;  3F8B A;  5FGM A;  4RGU A;  1QQI A;  2IVM A;  4LB6 B;  4ENJ A;  4ZYH A;  5ICG A;  2BGC A;  2EV6 A;  5ERI A;  4U0W A;  5DCM B;  4LLG F;  2KIF A;  4EJT A;  4LJZ F;  3M7G A;  1P2F A;  3OV8 A;  2FXA A;  1HW1 A;  1F5T A;  3CLO A;  3E6D A;  3I64 A;  5DYM A;  4KA4 A;  3CUQ A;  1PDN C;  5LGN A;  4BHP A;  1IUY A;  1V4R A;  5IT9 K;  2UXX A;  3DP7 A;  2DK5 A;  3BWG A;  1I6X A;  4RGS A;  3LST A;  2H6C A;  1SFX A;  2VE8 A;  3KP6 A;  2ZFW A;  3CUQ B;  1QPM A;  4H0E A;  1MKM A;  3TDZ C;  3B02 A;  4EJW A;  3GZ5 A;  4OMZ A;  5IT9 Z;  2NAZ A;  5D5X B;  3GO5 A;  1XDS A;  4BQA A;  1IN8 A;  4RS8 A;  2HQR A;  2XHK A;  5HOO A;  2HOE A;  1KQ9 A;  3IRR A;  2A69 F;  4B8X A;  2FQ3 A;  4WXD A;  5JHU A;  3TQN A;  1GXQ A;  3QPT A;  2ZO4 A;  1W7P A;  3V7S A;  3COA C;  5IT3 A;  1LDD A;  1HW2 A;  3C7J A;  3I54 A;  3V7C A;  3J80 K;  2XAQ A;  3IWZ A;  4JK1 X;  3GUD A;  3U2R A;  1O57 A;  3HHG A;  2DT5 A;  3EUH A;  1OR7 A;  1JHF A;  4HZF A;  1W7P B;  1FLI A;  4HV6 A;  4Z2Y A;  3F8F A;  2YU3 A;  2STW A;  4CXF A;  1SAX A;  5ILV A;  1Z7U A;  2GZW A;  1ZN2 A;  1YG2 A;  3GFJ A;  4KIF A;  3K1M A;  2IW5 A;  3DV8 A;  4ESF A;  1GXP A;  4JBA A;  2HQN A;  4I2O A;  2JTV A;  4Y13 A;  4GYG A;  1P92 A;  5DEQ A;  1UHM A;  1Z1D A;  2FF4 A;  3ROU A;  3ZMS A;  2EFQ A;  1S8N A;  3KFW X;  2A5Y B;  3I53 A;  2VT3 A;  1SFE A;  2EFO A;  3WGI A;  1XDU A;  3F6O A;  1ODD A;  4ETS A;  4M72 A;  3LA2 A;  4Q48 A;  3WTX C;  1XSD A;  2F5E A;  4YFK F;  5D4R A;  5FFZ A;  2VE9 A;  3R0J A;  4RGX A;  3V8L A;  1W5S A;  1XMK A;  2PFB A;  2NS0 A;  2STT A;  2VXZ A;  3ZQ7 A;  1LQ1 A;  2LF8 A;  4UVB A;  1WQ2 A;  3DKW A;  2QBY A;  2F5C A;  1BI2 A;  1HKS A;  4LD5 A;  3S2W A;  3WE3 A;  1FBQ A;  3CJN A;  1ZRD A;  3F8N A;  2IJL A;  3E3V A;  5DCF A;  4CGZ A;  5D4S A;  1UST A;  4GYI A;  2PMH A;  5E1Z B;  1G3W A;  2GQQ A;  3GEZ A;  1R58 A;  2WWY A;  3KZZ A;  2HGC A;  4O5V A;  5E17 F;  4I0B A;  2HKO A;  3V8J A;  3KLO A;  3R4K A;  4HV5 A;  3U9G A;  2KIU A;  2K4B A;  4M9X A;  4CHU A;  1WRJ A;  2W25 A;  1UFM A;  1ZYR F;  2MD5 A;  1K7A A;  1A04 A;  3W6J B;  4ZH4 F;  4EJU A;  4LK1 F;  1XGN A;  1U8R A;  3FMR A;  3BJO A;  1TW3 A;  2GWR A;  3WTS C;  2HDC A;  3TOA A;  4YII A;  1KGS A;  1MJB A;  4A5M A;  1ZRF A;  1USS A;  2WC2 A;  3WU0 A;  2EV0 A;  5HLG A;  3O3K A;  4ON0 A; 
#chains in the Genus database with same CATH topology
 2L2O A;  4HA8 A;  3K4K A;  3FDY A;  2LKP A;  2XKO A;  4LG0 A;  5C44 J;  3R6S A;  4P96 A;  2VKH A;  2X51 A;  2BY1 A;  4YFN F;  3HBL A;  5BMZ A;  1XCV A;  2VAS A;  2CQK A;  3E5U A;  3LA3 A;  1ZH5 A;  1UHW A;  4N9I A;  1FEX A;  2L9V A;  1KYW A;  2DYR H;  2AHQ A;  2Z1D A;  4OIO F;  3LQQ A;  4R79 A;  4N4N B;  5F1J A;  1XGS A;  5C4J J;  1BC8 C;  4LG0 B;  4KIS A;  2QSH X;  5K5Q A;  3E6B A;  2JPB A;  5DV5 A;  3JRG A;  3EYI A;  2IGM A;  3LSK A;  2J5O A;  4RAZ A;  1R5H A;  1RET A;  2CQX A;  3KPH A;  1NK2 P;  1SVM A;  3QRF F;  3K6G A;  4KJZ A;  1BR2 A;  4XMY A;  1BI1 A;  2K7L A;  4XBF A;  1JXS A;  2HQA A;  3JRC A;  4BJT A;  1T2K A;  2YPR A;  5FJ8 J;  1DQU A;  2ZSI B;  3HYI A;  4OIR F;  5D8K B;  5TRD A;  1IG7 A;  2DA3 A;  3U1D A;  2LR8 A;  3PO2 J;  4A3C J;  1FSE A;  1SFO J;  2DJN A;  2L9R A;  1H0M A;  1MW7 A;  5M5W J;  3TL4 X;  3RI4 A;  2MA3 A;  4MQV A;  4EQQ A;  4G12 A;  3IAM 2;  2CUE A;  2ZXI A;  4AIJ A;  2K9Q A;  3BY6 A;  3E0J B;  4XLA A;  1D1B A;  3WU2 C;  4BH9 A;  5ICC A;  2ZNY A;  4XRF A;  3IWF A;  3LAP A;  3JTG A;  1LEB A;  1UG2 A;  2OBP A;  2L4A A;  3CCJ I;  3WHC A;  3ECH A;  2CS3 A;  4HAM A;  2JSP A;  3RPU D;  3CMM A;  3SDG A;  3GTO J;  4P9U A;  3DBH B;  1T08 B;  4FHT A;  5FKL A;  2ESH A;  3D5R C;  1MIJ A;  1F9N A;  2I10 A;  3FXO A;  2K9L A;  2EV5 A;  5HLT A;  3RPQ A;  4U0V A;  4KMF A;  2Z5U A;  1ONV A;  2DTR A;  3HTU A;  1LJ9 A;  1WJD A;  2BY2 A;  2J5P A;  3R0A A;  3GFI A;  2EFN A;  3BJ6 A;  1CF7 A;  1UCR A;  2MBF A;  2E5N A;  2R7D A;  4L0Z B;  5JR3 A;  4HBL A;  2QKL B;  4EGY A;  1IN5 A;  2RC4 A;  1AKH A;  1FP2 A;  3MZH A;  1T56 A;  2QYO A;  2IS4 A;  4RB1 A;  3BG6 A;  1ZGA A;  3IKV A;  1C0W A;  2KRC A;  1GUU A;  5HLI A;  3EDP A;  4HDV A;  1PUF A;  1QHG A;  1RKT A;  3PUF A;  3QP5 A;  2NVQ J;  4G7Z F;  4L5J A;  5LHH A;  1OYY A;  3SQN A;  3SXY A;  2EPF A;  2AXT C;  3BPV A;  1IRG A;  3PSF A;  1YTY A;  2PLY A;  4NNJ A;  2XRO A;  3HGY A;  3BRO A;  2V1D A;  2VOD A;  3JW4 A;  4EM1 A;  3T0Y A;  3UNG C;  2ZXJ A;  2Y75 A;  4PJ0 C;  3FXK A;  2KPM A;  1R7J A;  3K2A A;  1TWH J;  1PUF B;  1ULY A;  3EUK L;  2BXZ A;  4RGR A;  5D5V B;  2OUM A;  2DAO A;  3HOW J;  2DFF A;  5D6F A;  2XF7 A;  4NDL A;  5HOD A;  3S32 A;  2F4M B;  3I59 B;  2L4M A;  3WTU C;  2DO7 A;  3L1P A;  4MGR A;  4PZJ A;  4EVI A;  2CUZ A;  4HOB A;  1JJ8 C;  4MEX F;  3TW7 A;  5E79 C;  4L0Y B;  3AAF A;  2LRE A;  2K02 A;  3BQY A;  1ZG3 A;  4B47 A;  1U5T A;  3ZMZ A;  3QWL A;  4AID A;  1Y39 A;  1OCZ H;  3W2W A;  4BXF A;  3HRT A;  2HS5 A;  2E36 A;  1N77 A;  1T95 A;  3HKZ N;  3ZXS A;  3BTC A;  2IS2 A;  2MLG A;  4OOI A;  1ZAR A;  4UUT A;  1IXS B;  3CMA I;  2HPM A;  3HUG A;  2M0M A;  2DT7 B;  5KAI C;  2R7Q A;  4ZYG A;  2KP6 A;  3VB2 A;  4S04 A;  2WBM A;  2A5W A;  2LKS A;  3M1C A;  1KU3 A;  2MC3 A;  3UR3 C;  2R5Z B;  1RZ4 A;  1A5J A;  1VQO I;  2ICW G;  1U5T B;  3HTS B;  1WHU A;  3J7A O;  4BE1 A;  2A61 A;  3PFI A;  4HST A;  1D3Y A;  3PQK A;  4WWC A;  4A0Z A;  2P7C B;  2BVL A;  1JKR C;  1HXD A;  1JKQ C;  4XLE A;  1KQ8 A;  1ETO A;  1NTC A;  3HUG B;  1IZ1 A;  3BR1 A;  3F21 A;  5M5Y J;  1DGW Y;  1V5F A;  5DS9 A;  1IJW C;  3BLY A;  1X2N A;  2FRH A;  1MSF C;  4A3L J;  1S7A A;  4CDG A;  3BR2 A;  4AVZ A;  1OCR H;  4LFU A;  2F5D A;  3CZ6 A;  3BG5 A;  5D5U B;  4LOC A;  2GOX B;  4KIB A;  2M45 A;  2E5Z A;  1YS7 A;  3ZPL A;  4BUP A;  3BCA A;  1LB2 A;  1WKM A;  3FIS A;  3E1S A;  5K1Y A;  4LLN A;  1SMY F;  4I01 A;  1JE8 A;  2DDB A;  2X1D A;  3CO7 C;  4JP0 A;  5H6R A;  3ZN0 A;  1YJN I;  5LRR A;  4NB5 A;  4RAG A;  2ELK A;  2VOO A;  3MKL A;  3BR5 A;  3OYA A;  1J59 A;  1ITY A;  2DJI A;  3J81 K;  2R0Q C;  1MH3 A;  3LFK A;  1YYV A;  2I8D A;  2Z33 A;  1X1B A;  2DI3 A;  1Y1V J;  4HF0 A;  2M3A A;  2RN7 A;  5AON A;  1HF0 A;  3V42 A;  5B1A H;  1KA8 A;  2PEX A;  4XLH A;  2L7F P;  2KJC A;  2P5L C;  1L3L A;  2XGE A;  3OYG A;  3FBI B;  2MYS A;  4DYC A;  2Q2E A;  2L7M P;  1ZLK A;  2IXS A;  5HDN A;  1B59 A;  4G8X A;  4J00 A;  4A12 A;  2KJB A;  1U78 A;  3J81 Z;  2RQP A;  2HOS A;  2AXL A;  4RA2 A;  4E7K A;  2IP2 A;  2Y0S A;  5E1X A;  2LH9 A;  3TO9 A;  1YW8 A;  2X85 A;  3WHB A;  1YOV B;  2PG4 A;  3AL0 B;  2XV4 S;  1BIB A;  4WXC A;  5LRS A;  1FBS A;  1Z0X A;  1XMA A;  2R4G A;  4GO1 A;  3WG9 A;  5D5W B;  3V4G A;  1VFC A;  1WWX A;  5HLH A;  1BR4 A;  3H0G J;  1YX5 A;  1MMS A;  3HOY J;  3GTP J;  4KT6 A;  2H8W A;  1MGT A;  2XVC A;  2E1M C;  2FBI A;  2A05 A;  1VF9 A;  2V4J C;  4JQF A;  4DQ2 A;  3RQI A;  2WB1 A;  4HEA 2;  3WE2 A;  4HNV A;  4PDK A;  1Y56 A;  5L3E A;  2DOA A;  4G9Y A;  1R1U A;  1X1D A;  5JVT A;  1XS9 A;  2F4O B;  4A3B J;  4XL9 A;  1G2H A;  4WK8 F;  3DKX A;  2A07 F;  3D0S A;  3K4M A;  4YEJ A;  4E7L A;  5F04 A;  1FSH A;  4CA0 A;  1LDJ A;  4HF2 A;  1FP1 D;  4GGG A;  1V3F A;  3E7L A;  5F0H A;  4OMY A;  1U2W A;  4UVC A;  3WG7 H;  5CVJ A;  4S0H B;  4IQ4 A;  4Y17 A;  2PMZ A;  4P1W A;  3Q5F A;  2XF6 A;  3DTK A;  2KIM A;  3KP4 A;  5EGO A;  2XC7 A;  2IGK A;  2L7K A;  1F4K A;  4NC8 A;  5CJ9 A;  2CV2 A;  1D8J A;  3OL4 A;  4GDF A;  2V26 A;  5FO5 A;  2OQG A;  2K3F A;  3LSI A;  5TIS C;  3VYS B;  4IRI A;  2DK8 A;  1I27 A;  1XGM A;  2V1X A;  4M3E A;  5FLX K;  3EUH C;  1OR7 C;  3OYH A;  2HZT A;  4PJL A;  3RDI A;  2H1L A;  3HRM A;  2QA4 I;  2QWW A;  1BW5 A;  1TP4 A;  4RAF A;  3GZ6 A;  2K4J A;  3TBI A;  1P6R A;  4D5F A;  4OIQ F;  3QP6 A;  1HST A;  2YX7 A;  3VOE A;  5EGO B;  3CJT B;  2ESN A;  3S2H J;  1BJZ A;  2ZME A;  4LGW A;  3DQV C;  4OAZ A;  3L2C A;  1OJL A;  2VIX A;  5BQT A;  1MNM C;  1XPX A;  3VSK A;  3CDI A;  1BI0 A;  3ULQ B;  4XRS A;  2X0L A;  4HW0 A;  4MHG A;  2FOW A;  3KP5 A;  4HLY A;  2IEK A;  2OC6 A;  2RDP A;  2F5F A;  1HKQ A;  1T98 A;  2ME6 A;  5L3G A;  4RB3 C;  1ZG5 A;  1XX5 A;  1R36 A;  4JX4 A;  1ON2 A;  3NQO A;  4E7S A;  2ZME B;  2BXY A;  2K85 A;  1TW2 A;  2HQ5 A;  2LC2 A;  3ZMD A;  2IA1 A;  3S3M A;  1QBJ A;  4DJA A;  5FKK A;  2K9M A;  2R92 J;  3GWZ A;  1IO2 A;  1B72 B;  1TC3 C;  1W36 C;  1NG7 A;  4XKW A;  3SHF A;  4ABZ A;  3DLL F;  3K69 A;  3P7N A;  2R7W A;  4M9S A;  3LSP A;  2H94 A;  5F64 A;  3GTJ J;  1YQA A;  2XAH A;  4KYW A;  3F0C A;  3FZV A;  3DKY A;  3ABT A;  4HX4 A;  2UWM A;  3LWF A;  5HS9 A;  3N97 A;  1GVD A;  3CTA A;  2ZJ2 A;  2IRF G;  2WV0 A;  1J7K A;  2JN6 A;  3OOP A;  4BQQ A;  1X3Z B;  3M8F A;  3CCE I;  4K2E A;  2ZSH B;  5DUK A;  3C2B A;  1OKR A;  3FXL A;  3PM1 A;  5IY5 H;  2M34 A;  4AUX A;  3K4B A;  1WGX A;  4W1U A;  1WVR A;  3KP2 A;  3ML6 A;  3DLA A;  3J80 Z;  2EJR A;  4IRG A;  2HEO A;  5E1W A;  5EG0 A;  5K7F A;  2F48 A;  4ESJ A;  2RGV A;  3FM3 A;  3W6V A;  4LB5 A;  2G9W A;  3MD2 A;  4MO7 A;  5CVV A;  3KZY A;  1OQY A;  3MMY B;  5L3F A;  1YI2 I;  4B3X A;  5J1Y A;  2JSC A;  5JFR A;  2WY7 Q;  2EZK A;  4F3Q A;  4YEL A;  4PJN A;  3K70 D;  1IGN A;  1ZRE A;  3S1M J;  3PIP F;  4I6Z A;  1YIJ I;  1O7L A;  3FK6 A;  4PFP A;  2QQ9 A;  3MWM A;  4L5I A;  2PQ8 A;  1WSU A;  1EH6 A;  2DN0 A;  5EG0 B;  2IA2 A;  1IV6 A;  2L01 A;  2OAZ A;  4KT5 C;  4YIR X;  3CCV I;  2D45 A;  2VC1 A;  1U6G A;  1HLV A;  3OYB A;  4BXX J;  2DYS H;  1QPI A;  3M8E A;  2ZNZ A;  3OSF A;  3BP8 A;  1X1P A;  4XKC A;  5CKT A;  3H9J A;  5J4Y A;  3F22 A;  1T6S A;  2OD5 A;  1S9H A;  2ISY A;  2WAQ A;  1P4W A;  3GTL J;  2MH2 A;  1ZK8 A;  3RKY A;  4M3G A;  2CYY A;  4ENK A;  2JRM A;  2O8X A;  5LBQ A;  2X48 A;  1S29 A;  2DMN A;  2QQA A;  5B66 C;  1E3P A;  2N8G A;  5TJJ A;  1SD6 A;  5HDK A;  5IOY A;  1IN6 A;  2VT2 A;  3DEU A;  2P7V B;  2PMU A;  2BYV E;  1HC8 A;  2M7B A;  1B1B A;  4XK4 A;  1Z6T A;  3ZRG A;  5E3O A;  4IOC F;  3OOU A;  1U3E M;  4NBQ A;  2CU7 A;  1CQT A;  3ABU A;  1FX7 A;  3BCB A;  2HWV A;  1R1V A;  3JRF A;  1ZQ3 P;  3RKQ A;  3ZP5 A;  1QO0 D;  2GA1 A;  2E2J J;  4IEJ A;  3JSO A;  3WTW C;  1TWF J;  4IRH A;  2XAJ A;  4IF4 A;  3BG7 A;  4RLQ A;  2NXN B;  1FWZ A;  3SZT A;  1D5Y A;  1IXC A;  3ZMT A;  4BHC A;  3LQR A;  4HSR A;  3ZQQ A;  4N4O B;  2JA5 J;  4HX8 A;  5J40 A;  2JVH A;  2VI6 A;  4O6J A;  4KMU X;  2DOD A;  3M9A A;  1Z77 A;  5HDG A;  1O3R A;  1LVA A;  3TP0 A;  2M30 A;  1STZ A;  2YX4 A;  4HX7 A;  5ILS A;  2GAU A;  2PJP A;  4WF2 A;  3PQJ A;  5ILU A;  1QZZ A;  1SAU A;  1MH4 A;  2FML A;  1WCM J;  1UJ8 A;  4HQE A;  1R23 A;  2L54 A;  3S8P A;  2HFH A;  1Z7L A;  3BZK A;  2XIG A;  1FC3 A;  3H35 A;  1Y1W J;  2CFO A;  4BDY A;  4NHJ A;  2XAS A;  4IX7 A;  4M6V A;  5EEA A;  3FXJ A;  2VPL A;  1RPW A;  2F6C A;  1WPK A;  3J7A Y;  1G8X A;  3T5X A;  3CCM I;  4G7O F;  2R5Y A;  3KP3 A;  3DCF A;  1A31 A;  4XLF A;  2ELH A;  4V2G A;  3HG9 A;  4QLC U;  1VZ0 A;  5EYR A;  3U21 A;  4E70 A;  2QBY B;  6PAX A;  2FA5 A;  1EH8 A;  4EJV A;  5J4V A;  1D0Z A;  4I76 A;  3BR3 A;  3ZQI A;  2EIK H;  2CO5 A;  3L2V A;  3OY9 A;  4L18 B;  3A01 B;  3E5X A;  2DCE A;  3F72 A;  3OYI A;  5L3C A;  4GCV A;  2MAB A;  2R5Y B;  1QU3 A;  3ZN1 A;  2UXN A;  2CFX A;  2DOE A;  1YX3 A;  3OMY A;  4M3B A;  4XKB A;  1K4T A;  2M4K A;  2Y48 A;  2JA6 J;  1D0Y A;  3MQ0 A;  3DFG A;  3I3L A;  2FUG 2;  1G4D A;  1K79 A;  5B1B H;  2BW3 A;  3PUB A;  2LKX A;  3OS1 A;  3CCY A;  1R6R A;  4F55 A;  1B9M A;  2M9H A;  3JAM K;  1XB4 A;  3I4P A;  3L09 A;  1U0J A;  2DPD A;  1D8K A;  2K3P A;  5LEK A;  5EEG A;  3I4M J;  4IOA F;  4Q5S F;  3TKY A;  3I5U A;  2KT0 A;  4DBQ A;  3RPU A;  1Z21 A;  5GAG J;  3DEW A;  5EZG A;  1GHC A;  1QRY A;  2Y9Z A;  2VBX A;  2O3F A;  3WGG A;  4F92 B;  4HRI A;  5F0C A;  2ECB A;  3GX4 X;  1PYV A;  3ZCO A;  3KEY A;  5EDN A;  3BZ6 A;  3LSG A;  3BT9 A;  2HVS A;  1SD7 A;  5F08 A;  3JAM Z;  1ZG1 A;  2XPU A;  3KYD B;  2NRA C;  2VUM J;  4KNY A;  2BV6 A;  5D6E A;  4CO8 A;  3CUO A;  3IH2 A;  3WTT C;  5M3F J;  2VBW A;  4G6Q A;  2CJJ A;  2ZBK A;  5IP6 A;  2VKE A;  4UVA A;  3J7Z I;  4PCQ A;  2L9S A;  2QCO A;  4U0Y A;  3M8J A;  3DU5 A;  3HIF A;  1R22 A;  3L7W A;  1LDK B;  2OQR A;  2M8E A;  4HDU A;  1YS6 A;  2IPQ X;  4ENM A;  4XR6 A;  1A6Q A;  3R60 A;  3HDD A;  2MC4 A;  2LMD A;  2CV0 A;  2R7X A;  5EF6 A;  2CH0 A;  3T1B A;  5K5R A;  4M74 A;  3W6K B;  4HLX A;  5GTH C;  5E18 F;  2EZH A;  3EYY A;  2X6O A;  1I3A A;  4IPA A;  3MEX A;  1LE8 A;  3K1N A;  2W1O A;  1Y8Q B;  1R9T J;  4ON0 A;  2DFH A;  2NYX A;  3IH4 A;  2BOL A;  4M3F A;  2DA4 A;  3R61 A;  1VND A;  3HOV J;  3BR0 A;  3HEF A;  4RAY A;  3CME I;  5IYB J;  1X3W B;  2P5K A;  4M6X A;  2WAD A;  3OYL A;  5BPI A;  2Y69 H;  4ZZL A;  5HNF A;  2LVS A;  2FMY A;  2EA4 A;  1VQK I;  3KZI C;  4BBS J;  1JGG A;  2MFZ A;  2TDX A;  3E97 A;  1IF1 A;  1BL0 A;  3F9K A;  5JI6 A;  3S16 J;  3BTI A;  4CYD A;  1LE8 B;  3KIO A;  5LGT A;  1HBX G;  1ETW A;  2VPR A;  5CVI A;  2Y9Y A;  2F4I A;  5B5E C;  4A6D A;  1WFX A;  3G4S I;  4WXH A;  3VYT B;  1OCC H;  5M3M J;  2IT0 A;  3HOT A;  3HB9 A;  1FIP A;  5FLM J;  1LVK A;  1WJE A;  3MKW B;  1DP7 P;  3HPH A;  1MBJ A;  4LLL A;  1TWG J;  3S1Q J;  3I56 I;  4KN7 X;  4ZZD A;  5BNG A;  4EAT A;  5DUI A;  2KKO A;  2KIQ A;  4AC0 A;  1OCP A;  2MGQ A;  3PFY A;  4U7B A;  4A3J J;  3KE2 A;  3TW6 A;  2XRL A;  2OZ6 A;  5E8I A;  4MTE A;  4H4K C;  1EKE A;  2LK2 A;  2V6C A;  3EQL F;  2R7T A;  4UHT A;  1YFH A;  1QNT A;  1G6N A;  2VN2 A;  2XSJ C;  2OA4 A;  4Y7N J;  5EZH A;  3U1K A;  3CO6 C;  1AA7 A;  1SAN A;  1PP8 F;  5BOX A;  3CC4 I;  5M5X J;  2NOG A;  4X6A J;  3S2D J;  2XB5 A;  2HVR A;  1Y6I A;  2E19 A;  3X2Q H;  2EIJ H;  1R49 A;  4FX0 A;  5IP9 J;  4C3J J;  4JOM A;  1Y0N A;  3HM5 A;  4J19 A;  2XPV A;  3CF5 F;  5GAD J;  2EZL A;  2F2E A;  2EH3 A;  1T38 A;  1U5T C;  2V7F A;  2W84 A;  3TDU C;  1FTZ A;  1XD7 A;  1A36 A;  4AYB A;  4RB0 A;  3SFI A;  3KEO A;  1TQI A;  3PSI A;  1J0R A;  1BIA A;  5FKO A;  4ENN A;  1HOM A;  3NAU A;  1CF7 B;  2MLK A;  4ITV A;  4YFX F;  1I50 J;  2KHM A;  2M7A A;  1TT0 A;  5FD5 A;  3GYH X;  2QLZ A;  4A0X A;  2VC0 A;  1AKH B;  4B44 A;  4BY1 J;  4FE4 A;  1EJ9 A;  3TO7 A;  1RES A;  2XAG A;  5DD4 A;  2DQL A;  3FIW A;  3ISP A;  1O3S A;  3HHH A;  4BBR J;  1J9I A;  4CYC A;  1HDD C;  3FXM A;  1AWC A;  2EK5 A;  2L02 A;  4P5O A;  2NVY J;  1ZGJ A;  4D0P A;  3VDX A;  1IDY A;  3PIO F;  2DBB A;  4C3H J;  2Z3Y A;  3K4C A;  2L3D A;  2BHY A;  4AVP A;  2BBY A;  4Y33 A;  5EEH A;  5A2Q K;  3S93 A;  3RKX A;  2LTP A;  3P5J A;  2BY3 A;  2X6X A;  2Y0S N;  1P7I A;  4KIG A;  3RTR A;  1SD4 A;  1RUO A;  2DMP A;  2D1H A;  4CYC B;  3IL2 A;  1FJL A;  2RNJ A;  2B7E A;  2RVC A;  4Y52 J;  4ZJZ A;  1QZY A;  1DDN A;  2M0C A;  4XOR A;  3S17 J;  3V7R A;  4IQJ A;  3IC7 A;  2TCT A;  3LAJ A;  2A3S A;  5F6F A;  3L2W A;  2Z2S B;  3CC7 I;  2WB1 N;  5A2Q Z;  1S7E A;  3GLX A;  5L3B A;  1Y0U A;  2CV1 A;  3KLN A;  1SC7 A;  1B4A A;  2Z99 A;  2DOF A;  4E4H A;  1KZH A;  4B48 A;  4LMY A;  2EIM H;  2C6Y A;  3ABK H;  3B6C A;  5CPR B;  4A2U A;  3TED A;  2PJR A;  4IO9 F;  4M6Y A;  2E71 A;  4KIT B;  3FHZ A;  4OAY A;  1BBY A;  1MBE A;  4AU7 A;  3JRI A;  1U9O A;  1VQ9 I;  2FOK A;  2ZCW A;  1JHH A;  3ERE D;  2KLO A;  2R93 J;  3SJM A;  3AL0 C;  4IHW A;  2B63 J;  2ZFU A;  2DA6 A;  2DMQ A;  3M1E A;  4EGZ A;  3RZO J;  1D0X A;  2B0L A;  3GFM A;  4XIC A;  1T39 A;  2PMZ N;  4XRS G;  4IHT A;  4DOZ A;  5J3L A;  4BAC A;  4BY7 J;  2COB A;  3H92 A;  4AD9 A;  2PJR B;  4BL0 B;  4OU0 A;  2P8T A;  4Q4Z F;  3AKZ A;  2JRT A;  3DPT A;  3FXR A;  2UZK A;  3ASN H;  4Q47 A;  1TWC J;  4UB6 C;  2LF7 A;  1MBG A;  4IHY A;  4XOP A;  1Y8R B;  2M5W A;  3OR2 C;  1BI3 A;  4F7Z A;  4HG2 A;  4Z6Y A;  2IGO A;  1FTT A;  3OWT A;  1ZEL A;  2MH9 A;  2HTJ A;  5LFA A;  1H89 C;  3E5Q A;  3CUQ C;  1G3T A;  3AG1 H;  3QOP A;  2JQ7 A;  4D7M A;  3I58 A;  3F8M A;  5ED4 A;  1WJF A;  2D2W A;  2LP0 A;  1P9Q C;  1T0F A;  3P9C A;  2XAF A;  5AIQ A;  5BS6 A;  4A6E A;  3A03 A;  4N0B A;  1TT5 B;  2VKD A;  3RYR A;  3S1R J;  2QQ8 A;  2XGX A;  3F6V A;  1TQM A;  2CSO A;  2ECC A;  4FQG A;  4YIF A;  4XID A;  3TOB A;  4CUG A;  2JZY A;  5DCM A;  1O3T A;  3H3U A;  1Z91 A;  3FM5 A;  4MIM A;  3JTH A;  1XGO A;  1E2X A;  4CZZ A;  1H9T A;  4G94 A;  2CQN A;  3QPS A;  1WJ5 A;  1KU9 A;  3RCO A;  3CP8 A;  2XPW A;  3DPL C;  1YO5 C;  1MJ9 A;  1J2X A;  2QQB A;  3OYN A;  1I3Q J;  3PJR A;  4JX6 A;  3MAJ A;  1ZAO A;  2Q2E B;  5CYV A;  4I02 A;  5E3M A;  1ETK A;  1FMW A;  3RQ4 A;  3SYT A;  1AHD P;  3ASO H;  1ETQ A;  2X1E A;  2GXB A;  2UV1 A;  3C2G A;  4A3D J;  1N75 A;  1JUP A;  4XLC A;  2EIN H;  4LIU A;  3K4J A;  1XSX A;  1R4N B;  1U9N A;  4AWX B;  4IZZ A;  2NVX J;  3IV5 A;  1YW7 A;  2CW0 F;  3HKZ A;  1XTA A;  3K4L A;  4DYR A;  1OYI A;  1R00 A;  2FEZ A;  1XN7 A;  2KL4 A;  1FZP B;  3EET A;  2P4W A;  4ZYE A;  2VQH A;  3H36 A;  4HYE A;  1UAA A;  1Z9C A;  2OU2 A;  2NVT J;  4IVN A;  1QGP A;  1NHA A;  5H6Q A;  2FBH A;  5DM7 F;  3QQA A;  1JJ6 C;  1ZR2 A;  3T8R A;  1ZTR A;  1U8B A;  2H6B A;  3RKW A;  1X2M A;  4G7H F;  2V1N A;  2DW4 A;  3IUO A;  3OL3 A;  4IL6 C;  2DLL A;  3GFL A;  2JJ7 A;  1E3O C;  1OPC A;  3ABL H;  1KYZ A;  2QEX I;  1A6I A;  2DA5 A;  3PNT A;  1LKX A;  4F93 B;  2WAQ N;  3WGH A;  1DGR M;  2FQ4 A;  4XSZ F;  1VQN I;  4CH7 A;  1V54 H;  1JT0 A;  3REO A;  3E6M A;  2DFE A;  2KIS A;  1VQP I;  2A6E F;  2XKP A;  3HGG A;  3ABM H;  5KHD A;  4EJO A;  1K78 A;  3NEU A;  4EMS A;  3A1Y A;  3CCR I;  1ZLJ A;  4Y15 A;  2V9V A;  2XGC A;  5IOZ A;  5FLX Z;  4BNC A;  3EPZ A;  1VQM I;  1RUN A;  2L5Q A;  4MEY F;  3RIR A;  3I55 I;  1FOK A;  3BZC A;  1ON1 A;  3HOS A;  3SDB A;  1OIS A;  2E1N A;  3WOD F;  3UKG A;  2CGP A;  1W5T A;  3WTV C;  2OTJ I;  2AS5 F;  4D1Q A;  5CLS A;  3K9T A;  1APL C;  1K78 B;  3GTM J;  4BE0 A;  1ACI A;  1ETX A;  4M9Z A;  1BC7 C;  3CLQ A;  4IJA A;  5K7H A;  2WA0 A;  2WY8 Q;  4C2M J;  4F91 B;  3C18 A;  2CRG A;  2GXG A;  1SMT A;  5CVU A;  2Y0M A;  4M73 A;  3OYE A;  5K5O A;  4MTD A;  4PGG A;  2OTL I;  3LL7 A;  1BJA A;  4KN4 X;  4BYY A;  3GLL A;  4E7I A;  5F1R A;  1FYK A;  1QA6 A;  2OCE A;  2ZXH A;  1VQ5 I;  3HZJ A;  5E8G A;  5JLX A;  2L7Z A;  4A0Y A;  2FNP A;  2LBF A;  4I7H A;  3N05 A;  4RDU A;  3OSG A;  1H9G A;  4FCY A;  4HPQ A;  2IAI A;  5JVG F;  2HYG D;  2EWN A;  2ZJQ F;  3IKT A;  1TTY A;  1SD5 A;  3QOE A;  4C2U A;  1R1T A;  2BE5 F;  5CQE A;  1FIA A;  4V19 K;  1K6O A;  4G6T B;  1REP C;  2E1O A;  1TBX A;  2KDO A;  1N25 A;  4BDZ A;  2HU9 A;  1TZL A;  3LA7 A;  2LBF B;  3H0D A;  4LK0 F;  3MCZ A;  5J47 A;  1Q1V A;  4ZYD A;  5LEJ A;  1KU7 A;  1LUJ B;  2EQR A;  1FY7 A;  4UXN A;  2LDU A;  5JHF A;  1OCO H;  2IA0 A;  4TV7 A;  2JA8 J;  4B09 A;  1I5Z A;  4B3A A;  2VON A;  1IRZ A;  2E34 A;  3RSN A;  5L3D A;  1DU0 A;  2W85 A;  1I1G A;  4PUS A;  3E6C C;  2OF7 A;  3W2A A;  1BM9 A;  1Z67 A;  3T8T A;  2XDV A;  2K86 A;  3GW2 A;  3P9K A;  3ZGK A;  2DXI A;  2EB7 A;  4YRV A;  3AG2 H;  3HSE A;  3CCU I;  2YU9 J;  1LEA A;  1P4A A;  3L2U A;  1SVO A;  3K10 A;  2OV7 A;  4XSX F;  3BG3 A;  3H5R A;  1T8I A;  1XG1 A;  3A4C A;  1B9N A;  4X0G A;  4P9F A;  1FOX A;  5D8L B;  4ASN A;  3WTY C;  4IHX A;  4BEH A;  2CQ7 A;  1DUX C;  1I1S A;  4ZDL A;  3FKI J;  3VEP A;  1T33 A;  1JI8 A;  3C3W A;  5DDG A;  1MDM A;  2HOT A;  1MBF A;  2O0Y A;  1MSE C;  3ZMV A;  1DU6 A;  2R7R A;  1YW9 A;  5HVQ C;  4L9N A;  1J5Y A;  3DXJ F;  3HJE A;  1BA5 A;  4C30 A;  1DPU A;  3KX2 A;  4IHS A;  3BDD A;  3HXL A;  1MNE A;  2ID3 A;  3DWL E;  3WTZ A;  4QTR A;  2LOO A;  2EA2 A;  2YSR A;  1LNW A;  3GXO A;  2JUC A;  3GF2 A;  5ICE A;  3ZMU A;  3H3V K;  4LIT A;  1P7J A;  2Q8K A;  4BEH B;  2O7O A;  1SFK A;  2VQC A;  3SZP A;  4A3K J;  2LSO A;  2VJ4 A;  1QHH D;  2QKM B;  5IP7 J;  1F1Z A;  2NOJ B;  1MDM B;  2QVO A;  1G3Y A;  2DFI A;  4N9H A;  2UUZ A;  4RM2 A;  3MVP A;  1W7P D;  3G1O A;  3FMQ A;  2OJE D;  1SVL A;  2M1B A;  4E6K G;  1BR1 A;  1Q1H A;  2V79 A;  1ZR4 A;  2COM A;  4NC7 A;  2LNB A;  1TQP A;  2PBI A;  2PN6 A;  3L00 A;  1UB9 A;  2JVG A;  1G3S A;  3H9Q A;  2ZB9 A;  3NWT A;  3D5L A;  2W7N A;  4UUV A;  3ECO A;  3FHN A;  1ZGW A;  1YRN A;  1X3U A;  3ZQH A;  4XLP F;  2OPT A;  2V6E A;  1RNL A;  2W48 A;  3QYE A;  2DQR A;  3QOD A;  1ZRC A;  1WI9 A;  4R8H A;  2ETH A;  2LYC A;  2A6H F;  3P9I A;  2JPC A;  4ZYA A;  1NH3 A;  3QPH A;  1GVJ A;  2GLO A;  3BPX A;  4L5E A;  1W0U A;  3GTQ J;  3QU6 A;  4I98 B;  4BHB A;  5IPA A;  3DU6 A;  4AM3 A;  2DA2 A;  3HC7 A;  4XQF A;  1D1C A;  2XAU A;  4IKF A;  5AIP A;  4P55 A;  3TO6 A;  2EZI A;  2FD5 A;  3OIO A;  1FOY A;  1KU2 A;  1IRF A;  5H2F C;  3DF8 A;  4CCN A;  1EV7 A;  4MNU A;  3D5S C;  1ZHF A;  2FBK A;  2TRT A;  5J8C A;  2B9S A;  3VPR A;  1B6A A;  2O61 A;  1VTN C;  1N78 A;  2W24 A;  2AO9 A;  4I09 A;  3F23 A;  1HSJ A;  1POG A;  1IW7 F;  3IP4 B;  4YG2 F;  2O8K A;  5KNL A;  2OCC H;  2DA7 A;  2G7U A;  2QZ8 A;  4BXU A;  3KEQ A;  3CCL I;  3VYR B;  1W36 D;  4LIV A;  1FOW A;  2IGN A;  4QWQ A;  2ADU A;  5CVR A;  2W82 A;  4I0A A;  1SFU A;  4FT8 A;  1FYL A;  3SFZ A;  4KIC A;  4WX9 A;  4D9J A;  2H09 A;  2BW3 B;  2CMP A;  2RNG A;  3FF5 A;  4MQ9 F;  4BAY A;  2HR3 A;  4PSW A;  4M71 A;  2JUG A;  1FPQ A;  2M4G A;  1IAW A;  2H27 A;  1S5L C;  3KP7 A;  2DMU A;  3OYK A;  4U87 A;  2E7W A;  3WU1 B;  2NNN A;  3G1L A;  2M87 A;  4EEF G;  2HVQ A;  3FK7 A;  9ANT A;  2E2I J;  1QVU A;  2D5V A;  3Q9V A;  3QU3 A;  1MD0 A;  4QPO A;  1JKP C;  4DZP A;  3AG4 H;  1K61 A;  1BN5 A;  3M3Y J;  5F0F A;  3S14 J;  1E17 A;  4WCG A;  4MLO A;  2LY1 A;  5ICF A;  3OS2 A;  3CC2 I;  1IN4 A;  1TNT A;  2K27 A;  2RRE A;  1PUE E;  3G3Z A;  1I6H J;  1RI7 A;  3EUA A;  1OLT A;  3F8C A;  2LLK A;  2JA7 J;  2GIV A;  2KQR A;  1EH7 A;  2HI3 A;  3AFH A;  3LMM A;  3B73 A;  4AYB N;  2DU9 A;  4PGH A;  2P6S A;  2R7F A;  3A02 A;  3FXU A;  4D7N A;  3FXQ A;  4UNO A;  2DTZ A;  3FMS A;  4NQW A;  1MND A;  3CDH A;  1DP3 A;  5K7Z A;  3OS0 A;  3MFK A;  3VFZ A;  2O03 A;  1KQ0 A;  4L9J A;  2GA2 A;  2XRN A;  3RJP A;  3KET A;  1LFU P;  5TGT A;  5DD8 A;  1ERD A;  3HSR A;  3VSL A;  2LY2 A;  1YLF A;  2HPI A;  2DPU A;  3DPU A;  3C1D A;  3HRS A;  4XON A;  2BY0 A;  1BOB A;  4HF1 A;  2VOP A;  4NQW B;  4GXO A;  2DA1 A;  4II2 A;  4CCO A;  1XC5 A;  2LD5 A;  1FT9 A;  3B6A A;  2EFP A;  3BTL A;  1WJA A;  2V1U A;  2KRH A;  3H5N A;  5KK1 A;  3FBN B;  1IN7 A;  2PI0 A;  1ZKG A;  3G2B A;  3ZR8 X;  2RV8 A;  3HRU A;  2WAF A;  4AIK A;  2CWE A;  2L9N A;  3BOQ A;  3G1M A;  5JLW A;  1F36 A;  4FTH A;  2O6G E;  2YR2 A;  2HKX A;  2Y2Z A;  2EBI A;  3OYJ A;  1GT0 C;  1TNS A;  2LRD A;  2QF7 A;  2A6T A;  2OZU A;  4CIC A;  1FYM A;  5LHI A;  3HL2 A;  2HDW A;  2E1C A;  2WAE A;  2IBD A;  1WH5 A;  3ESW B;  3JSP A;  3J7Y J;  3KCC A;  2W4S A;  2NNY A;  1IXR C;  5H20 A;  2Z9O A;  1HA8 A;  1MBK A;  5GPA A;  2K5C A;  3Q0V A;  4KFC A;  2QEN A;  1VQ6 I;  2HNH A;  3NRV A;  3BTJ A;  3ZQC A;  1JT6 A;  1QVT A;  2HZD A;  3JRD A;  1IC8 A;  5J8F A;  5LGU A;  3K1P A;  1J75 A;  2HDD A;  3FX3 A;  3Q9S A;  1K6Y A;  1KON A;  1W0T A;  5HS7 A;  2KZV A;  3OYF A;  4L9V A;  1R71 A;  1RIO H;  1L0O C;  2HYJ A;  4HQM A;  2A68 F;  3L2R A;  1AOY A;  2XUB A;  1P4X A;  2HOA A;  3BR6 A;  3CJQ B;  3K2Z A;  3LSJ A;  3TGN A;  4ZTJ A;  4XM3 A;  1O7F A;  2JWT A;  2ME0 A;  2D1V A;  1R5G A;  4A3F J;  2JT1 A;  4A69 C;  3Q3S A;  2X6W A;  2EIL H;  2JA2 A;  4ESB A;  3H3Z A;  2VLA A;  4QSH A;  1OFC X;  3F3X A;  1FBU A;  1UEL B;  3V8K A;  4DNC A;  1O3Q A;  2VBZ A;  4I99 C;  4UV9 A;  5LLQ A;  4PSX A;  4XLN F;  3FWE A;  4KUM A;  1S3J A;  4F52 A;  4HNT A;  1UG0 A;  2ACJ A;  2G7H A;  2FSW A;  4S05 A;  4RLF A;  3IRQ A;  2XGD A;  1K83 J;  1Z3Y A;  5E20 A;  1CGP A;  1HQC A;  3H9G A;  1W4M A;  3H5A A;  1S72 I;  3NWS A;  3K0L A;  2VB6 A;  2KRF A;  1PP7 U;  2ZC2 A;  2Q1Z B;  5FFX A;  1V5G A;  3IHU A;  2CUJ A;  2W57 A;  1TLH B;  1ETV A;  4KDP A;  4BGD A;  3G73 A;  2RQQ A;  4R1H A;  3I59 A;  4RBO A;  5FD6 A;  5KCM A;  3O2P E;  5KVR A;  1UZC A;  1HW5 A;  2FU4 A;  2Q0O A;  1V5E A;  3SEZ A;  1Z6R A;  2AQE A;  4XNF A;  2P5V A;  4M3D A;  5GTI C;  2CG4 A;  3VOD A;  1D5V A;  2MSY A;  1YIO A;  2R3S A;  2ELJ A;  3N4M A;  2XB0 X;  5FRO A;  3RYP A;  1OMI A;  2WTE A;  4EM2 A;  2EFW A;  4UV8 A;  1R4M B;  3GCM A;  2RKH A;  4G6D A;  2QUF A;  2P6T A;  2YS9 A;  3PNV A;  4RMN A;  4IXA A;  4CCL A;  2R5Z A;  3CES A;  2XSD C;  2BHZ A;  1MBH A;  1LPQ A;  2E7X A;  2X4H A;  2HTS A;  3C2H A;  5FLV A;  2ISZ A;  3HSF A;  2IS6 A;  2WV1 A;  3O6B B;  4O3M A;  4FX4 A;  2BEO A;  1O4X A;  1MJA A;  2QM3 A;  1MZB A;  4EV0 A;  1T0F C;  4U7D A;  3A0B C;  4AIH A;  3G71 I;  4L9T A;  2K9N A;  5C3E J;  3JR9 A;  4U88 A;  3S1N J;  4OIN F;  4FIS A;  3L9F A;  3MZY A;  4RB2 C;  4OIP F;  1RKW A;  2R7O A;  2M2E A;  2DDA A;  3W2V A;  1GLN A;  2FE3 A;  1VI0 A;  3BJA A;  3HOU J;  2YUS A;  4B4C A;  5LHG A;  2R7U A;  1JGS A;  1DPR A;  1S6L A;  4XN3 A;  5LD2 C;  2HYF A;  3QAH A;  1FNN A;  5GP9 A;  5J6X A;  1YIT I;  4A3G J;  3JRH A;  3QPL A;  2VQL A;  2VKV A;  1Z05 A;  4W97 A;  2FNA A;  3GBG A;  2MD0 A;  2VBY A;  1WH7 A;  3I0T A;  3I71 A;  5BPD A;  1YJW I;  4JYK A;  3LSH A;  4A5N A;  1H8A C;  3S15 J;  2HXO A;  5HS8 A;  2QSF X;  5FB2 A;  1VQ4 I;  2X1C A;  2R7S A;  2ZKZ A;  1S7O A;  3ELK A;  4A93 J;  4XOT A;  4EM0 B;  3K70 C;  1OYW A;  5B3S H;  3CJR B;  5GPC A;  2LY9 A;  4CCJ A;  3CQZ J;  4FAS D;  1TWA J;  1HKT A;  2MG4 A;  1BOA A;  1XCB A;  3GVA A;  4PFO A;  1MMG A;  3F8B A;  2FX0 A;  4B1R A;  5FGM A;  4UB8 C;  4RGU A;  1QQI A;  3O8G A;  4BJ5 C;  3HPG A;  2IVM A;  3NAR A;  1BW6 A;  3ZOB A;  3JRE A;  1V55 H;  4LB6 B;  3CMY A;  4ENJ A;  1MMD A;  1ORK A;  4ZYH A;  5ICG A;  3CCS I;  5GAE J;  2BGC A;  2G0E A;  2DMT A;  2EV6 A;  5ERI A;  4U0W A;  2O9L A;  5E3N A;  5DCM B;  3PL8 A;  2ID6 A;  2O5R A;  3QYB A;  4LLG F;  1X4O A;  5F27 A;  2KIF A;  2X6Y A;  4EJT A;  4LG3 A;  4LJZ F;  1X19 A;  1NG6 A;  4DBR A;  2CW7 A;  3M7G A;  2ZME C;  3K4N A;  1P2F A;  2GM4 A;  3DBR B;  3G6E I;  3OV8 A;  4DIQ A;  2KZG A;  4UY8 I;  2FXA A;  1HW1 A;  3O8H A;  1PJR A;  3CLO A;  3E6D A;  2XF5 A;  3CP2 A;  5CQG A;  1F5T A;  1VQ8 I;  1I39 A;  3VYU B;  2AQF A;  3I64 A;  3LOC A;  4DGW B;  3PO3 J;  1YJ9 I;  4ZTF A;  5DYM A;  4KA4 A;  1EF4 A;  3CUQ A;  1IUF A;  2P0W A;  4C9Y A;  3I9V 2;  3ZQL A;  1PDN C;  5GAH J;  5LGN A;  4FET A;  4BHP A;  4V2F A;  1IUY A;  5IYD J;  2Y31 A;  3LFU A;  1R5I D;  5DM6 F;  1UMQ A;  1V4R A;  5IT9 K;  2UXX A;  3OR1 C;  4ZDP A;  2M8G X;  3DP7 A;  5FKM A;  2DK5 A;  3BWG A;  1I6X A;  4ZC3 A;  3HOZ J;  4RGS A;  3LST A;  2H6C A;  1SFX A;  2VE8 A;  3KP6 A;  2LG4 A;  2ZFW A;  3CUQ B;  1QPM A;  2MW8 A;  3GME A;  4H0E A;  3M4O J;  1MKM A;  4DW6 A;  3TDZ C;  3B02 A;  4EJW A;  3GZ5 A;  4J01 A;  3IH3 A;  1G59 A;  4OMZ A;  5IT9 Z;  3M07 A;  3RZD J;  2NAZ A;  5D5X B;  1WJC A;  3GO5 A;  1XDS A;  1GDT A;  4II3 A;  3H1C A;  4BQA A;  1IN8 A;  4RS8 A;  3KYC B;  2HQR A;  5KAF C;  2XHK A;  1A35 A;  5HOO A;  4XN0 A;  5DTD A;  1K4S A;  2HOE A;  1KQ9 A;  2ZXW H;  5IYC J;  3IRR A;  2A69 F;  4B8X A;  2FQ3 A;  4WXD A;  1B72 A;  3CD6 I;  5JHU A;  3TQN A;  1GXQ A;  1JUS A;  3CCQ I;  3SEQ A;  1IRX A;  2E1M B;  3QPT A;  1RRJ A;  4X1E A;  2ZO4 A;  1W7P A;  3V7S A;  3COA C;  2K9S A;  1ETY A;  3BG9 A;  4PK4 A;  3GTK J;  4XRM A;  4ANJ A;  2QSG X;  2F5V A;  1MMN A;  5IT3 A;  4A3M J;  1LDD A;  1M1E B;  2FJ1 A;  1HW2 A;  1JTX A;  3C7J A;  3D1N I;  2JK3 A;  1LFP A;  4QIW N;  3I54 A;  3SZG A;  4NUB A;  3V7C A;  3J80 K;  2XAQ A;  3IWZ A;  4JK1 X;  1RR8 C;  3GUD A;  4Y4R A;  3U2R A;  1JKO C;  1O57 A;  2NVU B;  1ENH A;  2DT5 A;  2RAE A;  3HHG A;  3EUH A;  4BQN A;  1OR7 A;  1X4P A;  1JHF A;  4HZF A;  1W7P B;  1FLI A;  4HV6 A;  2L0K A;  4Z2Y A;  3DEE A;  2P81 A;  3F8F A;  4C2T A;  2YU3 A;  1VQL I;  2STW A;  4GRI A;  4CXF A;  4A3E J;  1SAX A;  5ILV A;  2NS8 A;  4BE2 A;  1Z7U A;  2GZW A;  2QGU A;  1ZN2 A;  1Z3X A;  1YG2 A;  1WZ2 A;  1LFB A;  3GFJ A;  4KIF A;  3K1M A;  4BJ6 C;  2IW5 A;  2KFD A;  5J1U A;  3W3C A;  4D5C A;  2BZT A;  3IAS 2;  2K40 A;  3OIQ A;  4A3I J;  3GTG J;  2PX9 A;  3DV8 A;  3PNY A;  3LSR A;  3AG3 H;  4ESF A;  3MKZ A;  1GXP A;  2CQQ A;  4JBA A;  2HQN A;  3BC8 A;  4I2O A;  2JMW A;  2JTV A;  4B43 A;  3A2K A;  4Y13 A;  2W00 A;  4GYG A;  1X58 A;  1P92 A;  5E3L A;  5DEQ A;  1UHM A;  1Z1D A;  2FF4 A;  4RM3 A;  2CUF A;  4MFD A;  3ROU A;  1J09 A;  4BQO A;  3ZMS A;  2EFQ A;  3ERM A;  2H1K A;  3L2Q A;  1B8I A;  3ZQG A;  1S8N A;  3KFW X;  3TMO A;  3MN2 A;  4IHV A;  2X9D A;  4QPQ A;  2E60 A;  4NC6 A;  2NS7 A;  2A5Y B;  2VJ5 A;  3I53 A;  2E2H J;  2VT3 A;  3FKJ A;  3JRB A;  1EA3 A;  1IDZ A;  4BKX A;  1SFE A;  2EFO A;  1XMX A;  2VL8 A;  4E7H A;  3WGI A;  1D1A A;  1PVE A;  1XDU A;  3GZN B;  3F6O A;  1ODD A;  2CW8 A;  3Q0U A;  4M72 A;  4ETS A;  3QYF A;  1OCT C;  3Q0W A;  3LA2 A;  3CDL A;  4Q48 A;  3WTX C;  1B8I B;  1XSD A;  2F5E A;  1RC9 A;  3K7A J;  5FRM A;  1GV5 A;  4ZDO A;  1HCR A;  1W1W E;  4YFK F;  5D4R A;  2KDZ A;  2GIZ A;  5FFZ A;  2VE9 A;  3R0J A;  1NK3 P;  4RGX A;  3V8L A;  1W5S A;  1XMK A;  1QZE A;  2ZJR F;  2PFB A;  2VQG A;  1FMV A;  2NS0 A;  4C3I J;  2STT A;  1GV2 A;  2VXZ A;  3ZQ7 A;  2VJJ A;  5C4X J;  2GXA A;  4XKV A;  1UHS A;  1LQ1 A;  1VQ7 I;  3I4N J;  5FRN A;  3LNQ A;  3MKY B;  2LF8 A;  4PJJ A;  4UVB A;  1WQ2 A;  3DKW A;  1SEU A;  3ZQF A;  4MFE A;  3A0H C;  2QBY A;  4HNU A;  2F5C A;  3OYM A;  1WI3 A;  1BI2 A;  1HKS A;  1HDP A;  4LD5 A;  1W5C C;  5FKN A;  3S2W A;  3WE3 A;  1H88 C;  2GOM A;  3CJN A;  1FBQ A;  2VJI A;  1ZRD A;  3A01 A;  1YHQ I;  3F8N A;  2R7Z J;  1X1A A;  2IJL A;  1YRN B;  3E3V A;  5DCF A;  4CGZ A;  2BVM A;  2HXI A;  5D4S A;  4PJM A;  1UST A;  4GYI A;  2PMH A;  5E1Z B;  1G3W A;  5J1R A;  4Y3O A;  4FE7 A;  2GQQ A;  3LSM A;  2KMU A;  5HNH A;  2LFB A;  3GEZ A;  4E7Z A;  4DZJ A;  1R58 A;  1E3H A;  4CZC A;  4CSW A;  2WWY A;  4GFB A;  4DYQ A;  1YE9 A;  3KZZ A;  2V9P A;  2HGC A;  3VWB A;  1E0E A;  4O5V A;  1AU7 A;  3KYL A;  5E17 F;  3MZ8 A;  4I0B A;  2HKO A;  1JTY A;  3V8J A;  2IS1 A;  3KLO A;  3R4K A;  4HV5 A;  3U9G A;  2KIU A;  2K4B A;  4M9X A;  2I5U A;  4CHU A;  3DTE A;  1F43 A;  1WRJ A;  2W25 A;  3DBL B;  1UFM A;  1ZYR F;  2MD5 A;  3TP3 A;  3OYC A;  1K7A A;  1A04 A;  3W6J B;  1IV8 A;  2DT6 A;  2V9K A;  4JX5 A;  3DTI A;  3OIP A;  4ZH4 F;  3JCU C;  4EJU A;  4E7J A;  3HOX J;  3BQZ A;  4LK1 F;  1XGN A;  4UUS A;  1U8R A;  4CCK A;  4BU2 A;  3FMR A;  3S3N A;  3BJO A;  1TL8 A;  3CF2 A;  1TW3 A;  2GWR A;  1WJB A;  2VXD A;  3JRA A;  3WTS C;  3S3O A;  2R7V A;  2HDC A;  3TOA A;  3ONQ A;  4OWR B;  4YII A;  1JUM A;  4CCM A;  1X1C A;  1KGS A;  1RR7 A;  2E35 A;  1MJB A;  4A5M A;  1ZRF A;  1USS A;  4UUS B;  2ZJP F;  2WC2 A;  2GBY A;  2H8R A;  3OYD A;  3WU0 A;  5EJC A;  4BS9 A;  2EV0 A;  5HLG A;  2Y30 A;  3O3K A;  1XSV A;  2Z16 A;  1MMA A; 
#chains in the Genus database with same CATH homology
 4HA8 A;  2LKP A;  2XKO A;  4LG0 A;  3R6S A;  4P96 A;  4YFN F;  5BMZ A;  1XCV A;  2CQK A;  3E5U A;  3LA3 A;  1ZH5 A;  1UHW A;  4N9I A;  1KYW A;  4OIO F;  3LQQ A;  4R79 A;  1XGS A;  1BC8 C;  4LG0 B;  5K5Q A;  3E6B A;  2JPB A;  5DV5 A;  3EYI A;  2J5O A;  4RAZ A;  1R5H A;  3QRF F;  1BI1 A;  2K7L A;  4XBF A;  1JXS A;  1T2K A;  2YPR A;  3HYI A;  4OIR F;  5D8K B;  5TRD A;  3U1D A;  1FSE A;  1H0M A;  3RI4 A;  2MA3 A;  4MQV A;  4EQQ A;  4AIJ A;  3BY6 A;  4BH9 A;  5ICC A;  2ZNY A;  4XRF A;  3IWF A;  3LAP A;  3JTG A;  1LEB A;  2OBP A;  2L4A A;  3ECH A;  4HAM A;  4P9U A;  4FHT A;  2ESH A;  1F9N A;  2EV5 A;  3RPQ A;  4U0V A;  4KMF A;  2Z5U A;  1ONV A;  2DTR A;  3HTU A;  1LJ9 A;  2J5P A;  3R0A A;  3GFI A;  2EFN A;  3BJ6 A;  1CF7 A;  1UCR A;  2MBF A;  2R7D A;  4L0Z B;  5JR3 A;  4HBL A;  4EGY A;  1IN5 A;  2RC4 A;  1FP2 A;  3MZH A;  2QYO A;  4RB1 A;  1ZGA A;  3IKV A;  1C0W A;  5HLI A;  3EDP A;  4HDV A;  3QP5 A;  4G7Z F;  4L5J A;  5LHH A;  1OYY A;  3SQN A;  3SXY A;  3BPV A;  1IRG A;  1YTY A;  2PLY A;  2XRO A;  3BRO A;  2V1D A;  2VOD A;  3JW4 A;  4EM1 A;  3T0Y A;  2ZXJ A;  2Y75 A;  1R7J A;  1ULY A;  4RGR A;  5D5V B;  2DAO A;  5D6F A;  3I59 B;  2L4M A;  3WTU C;  2DO7 A;  4MGR A;  4PZJ A;  4EVI A;  4HOB A;  4MEX F;  4L0Y B;  3AAF A;  2K02 A;  1ZG3 A;  1U5T A;  3ZMZ A;  3HRT A;  2HS5 A;  2MLG A;  4OOI A;  1ZAR A;  1IXS B;  3HUG A;  4ZYG A;  3VB2 A;  4S04 A;  1KU3 A;  2MC3 A;  1RZ4 A;  1U5T B;  3HTS B;  3J7A O;  2A61 A;  3PFI A;  1D3Y A;  3PQK A;  4WWC A;  4A0Z A;  2P7C B;  1HXD A;  1KQ8 A;  1IZ1 A;  3F21 A;  2FRH A;  1S7A A;  4CDG A;  4LFU A;  2F5D A;  5D5U B;  4KIB A;  2M45 A;  1YS7 A;  3ZPL A;  1LB2 A;  1WKM A;  5K1Y A;  4LLN A;  1SMY F;  4I01 A;  1JE8 A;  3CO7 C;  5H6R A;  3ZN0 A;  5LRR A;  4NB5 A;  2VOO A;  1J59 A;  3J81 K;  3LFK A;  1YYV A;  2Z33 A;  2DI3 A;  4HF0 A;  2RN7 A;  5AON A;  1KA8 A;  2PEX A;  2P5L C;  2KJC A;  1L3L A;  2Q2E A;  1ZLK A;  5HDN A;  1B59 A;  4G8X A;  4A12 A;  2KJB A;  1U78 A;  3J81 Z;  2RQP A;  2AXL A;  2IP2 A;  5E1X A;  3TO9 A;  1YW8 A;  2PG4 A;  2XV4 S;  1BIB A;  4WXC A;  5LRS A;  1FBS A;  1XMA A;  4GO1 A;  3WG9 A;  5D5W B;  3V4G A;  1WWX A;  5HLH A;  1MGT A;  2XVC A;  2FBI A;  4JQF A;  4DQ2 A;  3WE2 A;  5L3E A;  4PDK A;  4G9Y A;  1R1U A;  5JVT A;  4WK8 F;  2A07 F;  3D0S A;  1FSH A;  1LDJ A;  4HF2 A;  1FP1 D;  4GGG A;  1V3F A;  4OMY A;  1U2W A;  4UVC A;  5CVJ A;  4Y17 A;  3Q5F A;  2KIM A;  3KP4 A;  1F4K A;  5CJ9 A;  1D8J A;  5FO5 A;  2OQG A;  4IRI A;  2DK8 A;  1I27 A;  1XGM A;  2V1X A;  5FLX K;  2HZT A;  3RDI A;  3HRM A;  2QWW A;  3GZ6 A;  2K4J A;  4OIQ F;  1P6R A;  3QP6 A;  1HST A;  2YX7 A;  3VOE A;  2ESN A;  2ZME A;  4LGW A;  3DQV C;  3L2C A;  5BQT A;  1BI0 A;  3ULQ B;  2X0L A;  4HW0 A;  4MHG A;  3KP5 A;  4HLY A;  2RDP A;  2F5F A;  1HKQ A;  1T98 A;  5L3G A;  1ZG5 A;  4RB3 C;  1R36 A;  1ON2 A;  3NQO A;  2ZME B;  1TW2 A;  3ZMD A;  2IA1 A;  1QBJ A;  3GWZ A;  3SHF A;  3K69 A;  3P7N A;  4M9S A;  2H94 A;  5F64 A;  1YQA A;  2XAH A;  4KYW A;  3FZV A;  3ABT A;  4HX4 A;  2UWM A;  3LWF A;  5HS9 A;  3N97 A;  3CTA A;  2ZJ2 A;  2IRF G;  2WV0 A;  1J7K A;  3OOP A;  3M8F A;  4K2E A;  5DUK A;  1OKR A;  3KP2 A;  3ML6 A;  3J80 Z;  2EJR A;  4IRG A;  2HEO A;  5E1W A;  4ESJ A;  2RGV A;  3FM3 A;  4LB5 A;  2G9W A;  5CVV A;  3KZY A;  5L3F A;  2JSC A;  5JFR A;  1ZRE A;  1O7L A;  2QQ9 A;  3MWM A;  4L5I A;  2PQ8 A;  1WSU A;  1EH6 A;  2IA2 A;  2L01 A;  2OAZ A;  4KT5 C;  2D45 A;  2VC1 A;  1U6G A;  3M8E A;  2ZNZ A;  3BP8 A;  3F22 A;  1T6S A;  2OD5 A;  2ISY A;  1P4W A;  2MH2 A;  3RKY A;  2CYY A;  4ENK A;  2O8X A;  5LBQ A;  1S29 A;  2QQA A;  5TJJ A;  1SD6 A;  5HDK A;  1IN6 A;  2VT2 A;  3DEU A;  2P7V B;  2PMU A;  2BYV E;  1B1B A;  1Z6T A;  1U3E M;  3ABU A;  1FX7 A;  2HWV A;  1R1V A;  3ZP5 A;  1QO0 D;  2GA1 A;  3JSO A;  3WTW C;  4IRH A;  2XAJ A;  4IF4 A;  1FWZ A;  3SZT A;  1IXC A;  3ZMT A;  4BHC A;  3LQR A;  4HX8 A;  4O6J A;  4KMU X;  3M9A A;  5HDG A;  1O3R A;  1LVA A;  2M30 A;  1STZ A;  2YX4 A;  4HX7 A;  5ILS A;  2GAU A;  2PJP A;  4WF2 A;  3PQJ A;  5ILU A;  1QZZ A;  2FML A;  4HQE A;  1R23 A;  2L54 A;  2HFH A;  2XIG A;  1FC3 A;  4NHJ A;  2XAS A;  3T5X A;  4G7O F;  3KP3 A;  2ELH A;  4QLC U;  4E70 A;  2QBY B;  6PAX A;  2FA5 A;  1EH8 A;  4EJV A;  2CO5 A;  4L18 B;  3E5X A;  3F72 A;  5L3C A;  4GCV A;  3ZN1 A;  2CFX A;  2UXN A;  2Y48 A;  3MQ0 A;  3DFG A;  1G4D A;  1K79 A;  1B9M A;  3JAM K;  1XB4 A;  3I4P A;  3L09 A;  2DPD A;  1D8K A;  5LEK A;  5EEG A;  4Q5S F;  3TKY A;  3I5U A;  3RPU A;  1GHC A;  2VBX A;  2O3F A;  3WGG A;  3GX4 X;  3BZ6 A;  1SD7 A;  3JAM Z;  1ZG1 A;  2NRA C;  4KNY A;  2BV6 A;  5D6E A;  4CO8 A;  3CUO A;  3WTT C;  2VBW A;  4G6Q A;  2ZBK A;  4UVA A;  4PCQ A;  4U0Y A;  3HIF A;  1R22 A;  3L7W A;  1LDK B;  2OQR A;  2M8E A;  4HDU A;  1YS6 A;  2IPQ X;  4ENM A;  3R60 A;  3T1B A;  5K5R A;  4M74 A;  3W6K B;  4HLX A;  5E18 F;  3EYY A;  4IPA A;  3MEX A;  3K1N A;  2NYX A;  3R61 A;  4RAY A;  2P5K A;  4M6X A;  5BPI A;  4ZZL A;  2FMY A;  2EA4 A;  2TDX A;  3E97 A;  1IF1 A;  5JI6 A;  4CYD A;  5LGT A;  1HBX G;  5CVI A;  4A6D A;  4WXH A;  2IT0 A;  3HOT A;  1DP7 P;  4LLL A;  4KN7 X;  4ZZD A;  5DUI A;  2KKO A;  4U7B A;  3KE2 A;  2OZ6 A;  5E8I A;  4MTE A;  2V6C A;  3EQL F;  4UHT A;  1YFH A;  1QNT A;  1G6N A;  2VN2 A;  2OA4 A;  3CO6 C;  1PP8 F;  5BOX A;  4FX0 A;  2F2E A;  1T38 A;  1U5T C;  2W84 A;  3TDU C;  1XD7 A;  4RB0 A;  3KEO A;  1TQI A;  1J0R A;  1BIA A;  4ENN A;  1CF7 B;  2MLK A;  4YFX F;  5FD5 A;  3GYH X;  2QLZ A;  4A0X A;  2VC0 A;  3TO7 A;  2XAG A;  5DD4 A;  2DQL A;  3ISP A;  1O3S A;  3HHH A;  1J9I A;  1AWC A;  2EK5 A;  2L02 A;  4P5O A;  1ZGJ A;  4D0P A;  2DBB A;  2Z3Y A;  2L3D A;  4AVP A;  2BBY A;  5A2Q K;  5EEH A;  3RKX A;  4KIG A;  3RTR A;  1SD4 A;  1RUO A;  2D1H A;  3IL2 A;  2RNJ A;  2RVC A;  1QZY A;  1DDN A;  3V7R A;  3IC7 A;  3LAJ A;  2A3S A;  5F6F A;  5A2Q Z;  3GLX A;  5L3B A;  1Y0U A;  3KLN A;  1B4A A;  2Z99 A;  4LMY A;  2C6Y A;  4A2U A;  4M6Y A;  3FHZ A;  1BBY A;  2FOK A;  2ZCW A;  1JHH A;  3ERE D;  3M1E A;  4EGZ A;  2B0L A;  3GFM A;  1T39 A;  4IHT A;  3H92 A;  4AD9 A;  4OU0 A;  2P8T A;  4Q4Z F;  2JRT A;  3DPT A;  3FXR A;  2UZK A;  4Q47 A;  2LF7 A;  2M5W A;  4F7Z A;  1BI3 A;  2MH9 A;  2HTJ A;  3E5Q A;  3CUQ C;  1G3T A;  3QOP A;  3I58 A;  5ED4 A;  3F8M A;  2D2W A;  5AIQ A;  1T0F A;  3P9C A;  5BS6 A;  2XAF A;  4A6E A;  1XSV A;  4N0B A;  3RYR A;  2XGX A;  3F6V A;  1TQM A;  2CSO A;  4YIF A;  3TOB A;  2JZY A;  5DCM A;  1O3T A;  3H3U A;  1Z91 A;  3FM5 A;  3JTH A;  1XGO A;  1E2X A;  4CZZ A;  1H9T A;  4G94 A;  1KU9 A;  3DPL C;  1YO5 C;  1MJ9 A;  1J2X A;  2QQB A;  3MAJ A;  1ZAO A;  5CYV A;  4I02 A;  2GXB A;  1XSX A;  4AWX B;  1YW7 A;  2CW0 F;  1OYI A;  1R00 A;  2FEZ A;  1XN7 A;  1FZP B;  3EET A;  2P4W A;  4ZYE A;  4HYE A;  1Z9C A;  2OU2 A;  4IVN A;  1QGP A;  1NHA A;  5H6Q A;  2FBH A;  3T8R A;  2H6B A;  3RKW A;  4G7H F;  2DW4 A;  2DLL A;  3GFL A;  1OPC A;  1KYZ A;  3WGH A;  4XSZ F;  3REO A;  3E6M A;  2A6E F;  2XKP A;  1K78 A;  4EJO A;  3NEU A;  4EMS A;  1ZLJ A;  4Y15 A;  2V9V A;  5FLX Z;  4BNC A;  1RUN A;  4MEY F;  3RIR A;  1FOK A;  1ON1 A;  3HOS A;  2E1N A;  3WOD F;  2CGP A;  1W5T A;  3WTV C;  2AS5 F;  5CLS A;  3K9T A;  1K78 B;  4M9Z A;  1BC7 C;  4IJA A;  3C18 A;  2GXG A;  1SMT A;  5CVU A;  2Y0M A;  4M73 A;  5K5O A;  4MTD A;  4PGG A;  4KN4 X;  1BJA A;  4BYY A;  1FYK A;  5F1R A;  5E8G A;  4A0Y A;  2FNP A;  4I7H A;  1H9G A;  2HYG D;  2EWN A;  3IKT A;  1TTY A;  1SD5 A;  1R1T A;  2BE5 F;  1K6O A;  1REP C;  1TBX A;  3LA7 A;  4LK0 F;  3MCZ A;  4ZYD A;  5LEJ A;  1KU7 A;  1FY7 A;  4UXN A;  2LDU A;  2IA0 A;  4TV7 A;  4B09 A;  1I5Z A;  2VON A;  5L3D A;  2W85 A;  1I1G A;  3E6C C;  1BM9 A;  3T8T A;  2K86 A;  3GW2 A;  3P9K A;  2EB7 A;  3HSE A;  1LEA A;  1P4A A;  4XSX F;  1B9N A;  4P9F A;  5D8L B;  4ASN A;  3WTY C;  1DUX C;  1I1S A;  3VEP A;  3C3W A;  5DDG A;  1MDM A;  2O0Y A;  3ZMV A;  1YW9 A;  5HVQ C;  4L9N A;  1J5Y A;  3DXJ F;  1DPU A;  4IHS A;  3BDD A;  3WTZ A;  2EA2 A;  2YSR A;  1LNW A;  3GXO A;  3GF2 A;  5ICE A;  3ZMU A;  2Q8K A;  3SZP A;  2LSO A;  1F1Z A;  1MDM B;  2QVO A;  1G3Y A;  2DFI A;  4N9H A;  1W7P D;  3FMQ A;  2M1B A;  1Q1H A;  2V79 A;  2COM A;  2LNB A;  1TQP A;  2PBI A;  2PN6 A;  3L00 A;  1UB9 A;  1G3S A;  3D5L A;  4UUV A;  3ECO A;  1X3U A;  4XLP F;  1RNL A;  2DQR A;  1ZRC A;  1WI9 A;  4R8H A;  2ETH A;  2A6H F;  3P9I A;  2JPC A;  3QPH A;  1GVJ A;  3BPX A;  3QU6 A;  4I98 B;  4BHB A;  5AIP A;  4P55 A;  3TO6 A;  1KU2 A;  1IRF A;  3DF8 A;  1EV7 A;  4MNU A;  1ZHF A;  2FBK A;  5J8C A;  2O61 A;  1B6A A;  1VTN C;  2W24 A;  4I09 A;  3F23 A;  1HSJ A;  1IW7 F;  4YG2 F;  2G7U A;  2QZ8 A;  4BXU A;  3KEQ A;  4QWQ A;  2ADU A;  5CVR A;  4I0A A;  1SFU A;  4FT8 A;  1FYL A;  3SFZ A;  4KIC A;  4WX9 A;  2H09 A;  3FF5 A;  4MQ9 F;  4BAY A;  2HR3 A;  4M71 A;  1FPQ A;  1IAW A;  2H27 A;  3KP7 A;  2E7W A;  3WU1 B;  2NNN A;  2M87 A;  3Q9V A;  3QU3 A;  1MD0 A;  1BN5 A;  1E17 A;  4WCG A;  5ICF A;  1IN4 A;  1TNT A;  2K27 A;  1PUE E;  3G3Z A;  1RI7 A;  3F8C A;  2GIV A;  1EH7 A;  3B73 A;  2DU9 A;  4PGH A;  2P6S A;  2R7F A;  3FXU A;  3FXQ A;  4UNO A;  3FMS A;  4NQW A;  3CDH A;  3MFK A;  3VFZ A;  2O03 A;  1KQ0 A;  4L9J A;  2GA2 A;  2XRN A;  3RJP A;  3KET A;  5DD8 A;  3HSR A;  1YLF A;  2DPU A;  3C1D A;  3HRS A;  4HF1 A;  2VOP A;  4GXO A;  1FT9 A;  2EFP A;  2V1U A;  5KK1 A;  2PI0 A;  1IN7 A;  2RV8 A;  3HRU A;  4AIK A;  2CWE A;  3BOQ A;  2O6G E;  2YR2 A;  2HKX A;  1TNS A;  2OZU A;  4CIC A;  1FYM A;  5LHI A;  2E1C A;  3JSP A;  3KCC A;  2NNY A;  1IXR C;  5H20 A;  2Z9O A;  4KFC A;  2QEN A;  3NRV A;  5J8F A;  5LGU A;  3K1P A;  1J75 A;  3FX3 A;  3Q9S A;  5HS7 A;  4L9V A;  1RIO H;  1L0O C;  4HQM A;  2A68 F;  1AOY A;  2XUB A;  1P4X A;  3K2Z A;  3TGN A;  1O7F A;  2D1V A;  1R5G A;  2JT1 A;  4ESB A;  3H3Z A;  3F3X A;  1FBU A;  3V8K A;  4DNC A;  1O3Q A;  2VBZ A;  4UV9 A;  5LLQ A;  4XLN F;  3FWE A;  4KUM A;  1S3J A;  2ACJ A;  2G7H A;  2FSW A;  4S05 A;  3IRQ A;  1CGP A;  5E20 A;  1HQC A;  1W4M A;  1PP7 U;  3K0L A;  2KRF A;  5FFX A;  3IHU A;  2W57 A;  1TLH B;  4KDP A;  3G73 A;  4R1H A;  3I59 A;  5FD6 A;  3O2P E;  5KVR A;  1HW5 A;  2FU4 A;  2Q0O A;  1Z6R A;  2P5V A;  2CG4 A;  3VOD A;  1D5V A;  1YIO A;  2R3S A;  3N4M A;  3RYP A;  1OMI A;  2WTE A;  4EM2 A;  2EFW A;  4UV8 A;  2RKH A;  4G6D A;  2QUF A;  2P6T A;  4IXA A;  2E7X A;  2X4H A;  2HTS A;  2ISZ A;  3HSF A;  3O6B B;  4O3M A;  4FX4 A;  2BEO A;  1MJA A;  2QM3 A;  1MZB A;  4EV0 A;  4U7D A;  4AIH A;  4L9T A;  4U88 A;  4OIN F;  3L9F A;  3MZY A;  4RB2 C;  4OIP F;  2FE3 A;  3BJA A;  5LHG A;  1JGS A;  1DPR A;  1S6L A;  2HYF A;  3QAH A;  1FNN A;  5J6X A;  1Z05 A;  2FNA A;  2VBY A;  3I0T A;  3I71 A;  5BPD A;  4A5N A;  5HS8 A;  5FB2 A;  2ZKZ A;  1S7O A;  3ELK A;  4EM0 B;  1OYW A;  1HKT A;  1BOA A;  1XCB A;  3GVA A;  3F8B A;  5FGM A;  4RGU A;  1QQI A;  2IVM A;  4LB6 B;  4ENJ A;  4ZYH A;  5ICG A;  2BGC A;  2EV6 A;  5ERI A;  4U0W A;  5DCM B;  4LLG F;  2KIF A;  4EJT A;  4LJZ F;  3M7G A;  1P2F A;  3OV8 A;  2FXA A;  1HW1 A;  1F5T A;  3CLO A;  3E6D A;  3I64 A;  5DYM A;  4KA4 A;  3CUQ A;  1PDN C;  5LGN A;  4BHP A;  1IUY A;  1V4R A;  5IT9 K;  2UXX A;  3DP7 A;  2DK5 A;  3BWG A;  1I6X A;  4RGS A;  3LST A;  2H6C A;  1SFX A;  2VE8 A;  3KP6 A;  2ZFW A;  3CUQ B;  1QPM A;  4H0E A;  1MKM A;  3TDZ C;  3B02 A;  4EJW A;  3GZ5 A;  4OMZ A;  5IT9 Z;  2NAZ A;  5D5X B;  3GO5 A;  1XDS A;  4BQA A;  1IN8 A;  4RS8 A;  2HQR A;  2XHK A;  5HOO A;  2HOE A;  1KQ9 A;  3IRR A;  2A69 F;  4B8X A;  2FQ3 A;  4WXD A;  5JHU A;  3TQN A;  1GXQ A;  3QPT A;  2ZO4 A;  1W7P A;  3V7S A;  3COA C;  5IT3 A;  1LDD A;  1HW2 A;  3C7J A;  3I54 A;  3V7C A;  3J80 K;  2XAQ A;  3IWZ A;  4JK1 X;  3GUD A;  3U2R A;  1O57 A;  3HHG A;  2DT5 A;  3EUH A;  1OR7 A;  1JHF A;  4HZF A;  1W7P B;  1FLI A;  4HV6 A;  4Z2Y A;  3F8F A;  2YU3 A;  2STW A;  4CXF A;  1SAX A;  5ILV A;  1Z7U A;  2GZW A;  1ZN2 A;  1YG2 A;  3GFJ A;  4KIF A;  3K1M A;  2IW5 A;  3DV8 A;  4ESF A;  1GXP A;  4JBA A;  2HQN A;  4I2O A;  2JTV A;  4Y13 A;  4GYG A;  1P92 A;  5DEQ A;  1UHM A;  1Z1D A;  2FF4 A;  3ROU A;  3ZMS A;  2EFQ A;  1S8N A;  3KFW X;  2A5Y B;  3I53 A;  2VT3 A;  1SFE A;  2EFO A;  3WGI A;  1XDU A;  3F6O A;  1ODD A;  4ETS A;  4M72 A;  3LA2 A;  4Q48 A;  3WTX C;  1XSD A;  2F5E A;  4YFK F;  5D4R A;  5FFZ A;  2VE9 A;  3R0J A;  4RGX A;  3V8L A;  1W5S A;  1XMK A;  2PFB A;  2NS0 A;  2STT A;  2VXZ A;  3ZQ7 A;  1LQ1 A;  2LF8 A;  4UVB A;  1WQ2 A;  3DKW A;  2QBY A;  2F5C A;  1BI2 A;  1HKS A;  4LD5 A;  3S2W A;  3WE3 A;  1FBQ A;  3CJN A;  1ZRD A;  3F8N A;  2IJL A;  3E3V A;  5DCF A;  4CGZ A;  5D4S A;  1UST A;  4GYI A;  2PMH A;  5E1Z B;  1G3W A;  2GQQ A;  3GEZ A;  1R58 A;  2WWY A;  3KZZ A;  2HGC A;  4O5V A;  5E17 F;  4I0B A;  2HKO A;  3V8J A;  3KLO A;  3R4K A;  4HV5 A;  3U9G A;  2KIU A;  2K4B A;  4M9X A;  4CHU A;  1WRJ A;  2W25 A;  1UFM A;  1ZYR F;  2MD5 A;  1K7A A;  1A04 A;  3W6J B;  4ZH4 F;  4EJU A;  4LK1 F;  1XGN A;  1U8R A;  3FMR A;  3BJO A;  1TW3 A;  2GWR A;  3WTS C;  2HDC A;  3TOA A;  4YII A;  1KGS A;  1MJB A;  4A5M A;  1ZRF A;  1USS A;  2WC2 A;  3WU0 A;  2EV0 A;  5HLG A;  3O3K A;  4ON0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...