2ZMEB

Integrated structural and functional model of the human escrt-ii complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
215
structure length
215
Chain Sequence
KNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04157 EAP30 EAP30/Vps36 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zmeB02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zmeB03
1ULYA 3E6CC 5ILUA 2NNNA 3TOAA 4P9UA 3CO7C 3JW4A 3KFWX 2P5VA 3B02A 2XRNA 4Z2YA 1ZLKA 1XMKA 3WTWC 1HBXG 1EH7A 3MCZA 1SAXA 3F8FA 6PAXA 2WTEA 1BC8C 2XGXA 5D5XB 1OYIA 2IT0A 3F6OA 2A5YB 4L18B 4M9SA 3IWFA 3LAJA 3J80K 2DK8A 1YLFA 2ZMEA 1B9MA 4L9NA 5L3FA 3NEUA 2BEOA 1W7PD 2HTSA 3K1PA 2BBYA 2X0LA 1TQMA 3KLOA 5D8KB 2PLYA 3Q5FA 2FNPA 5E18F 4KN7X 2DFIA 5HLHA 1T0FA 3K0LA 1PUEE 4EM2A 3LA2A 4OMYA 2QYOA 5EEGA 1EV7A 2JPCA 4RGSA 5FB2A 3N97A 5L3EA 3KP4A 4JK1X 2A3SA 2E1CA 1OMIA 5F64A 3V8JA 3K1NA 3WGGA 3E3VA 2COMA 1T2KA 1XCVA 1FBSA 1W7PB 3V7SA 3VFZA 4GXOA 4YG2F 1B9NA 3TGNA 2PEXA 1XGMA 3P9CA 2OZUA 1WKMA 2MBFA 5FD5A 2DU9A 4KMUX 1MJAA 2W24A 2LF7A 4BXUA 1D3YA 2EA2A 3KEQA 2FQ3A 4I0AA 4L0ZB 2PMUA 3KETA 4ESFA 3VEPA 2AS5F 3KE2A 5BPIA 3GLXA 2H6BA 2XASA 4WXCA 3RYPA 4RGXA 3FXQA 1XDSA 3F21A 2YX4A 5JI6A 1SFUA 5E8GA 5ILSA 2ISYA 3HRUA 1BBYA 3ZMZA 2P7VB 2XAQA 2QQBA 4YIIA 4F7ZA 4HLYA 3RTRA 3IKVA 1EH6A 2F5FA 4G94A 3TO7A 5LGNA 1KQ8A 4CYDA 1W5SA 3F6VA 5HS9A 5KK1A 2MH9A 5LRRA 4WX9A 4KUMA 3QU3A 5FO5A 3HHHA 5AONA 1MJ9A 4R1HA 1J75A 2RV8A 4AWXB 1YG2A 4WF2A 5L3BA 1IZ1A 5K5QA 2DI3A 1YS6A 2XV4S 1PP8F 3WG9A 2M87A 4ZYHA 2FNAA 1O3RA 2XUBA 1UFMA 5HDNA 3R4KA 1T39A 4ZYGA 1ZRDA 4Q4ZF 3CTAA 2EA4A 2HFHA 2CSOA 4ASNA 1KU9A 2YPRA 5J8FA 3K1MA 1CF7A 3HIFA 3I59A 4S04A 3MWMA 4LG0B 1UCRA 2DAOA 3E6DA 2HWVA 5CVVA 4M73A 4CXFA 3HUGA 4U7BA 2YX7A 2GA1A 2Y0MA 5DUIA 2B0LA 4M6XA 1JHHA 2JT1A 5LLQA 5CVIA 3U1DA 5HDKA 1GVJA 5E1WA 1G3TA 4KYWA 2IRFG 5D5UB 3F23A 4I98B 3R0AA 2O3FA 5H20A 1FYKA 4HDVA 2DK5A 1LNWA 4B8XA 4ENNA 1HKQA 1FT9A 2L01A 4A5MA 3GX4X 3IC7A 2D45A 2RNJA 3MZYA 1G3YA 2VE9A 2IA1A 1LEBA 2AXLA 2KJBA 1U5TB 3KCCA 4BQAA 5DD4A 2XROA 1DPRA 4G8XA 2RGVA 3DPLC 4M6YA 1RZ4A 1U3EM 2WV0A 1VTNC 4IVNA 1ZG1A 3RI4A 2O03A 5EEHA 1EH8A 1P4XA 2JRTA 3F8BA 3RKWA 4O6JA 1Y0UA 4R8HA 4GO1A 2PFBA 1TQIA 2K4JA 1ZH5A 4EJOA 4LGWA 2BGCA 2GXBA 1FLIA 1FPQA 4MEXF 2A07F 5F6FA 3SFZA 3BPVA 4HBLA 5HOOA 2V79A 3GZ6A 4BYYA 3IWZA 2NYXA 4D0PA 2DQLA 1IN5A 2ZCWA 2OAZA 3E5UA 1R1VA 4G7OF 1RUOA 2HGCA 1ZN2A 1LEAA 2QENA 3M8EA 4EM1A 1KA8A 2A6EF 3HTSB 4AVPA 5D8LB 3L00A 2MH2A 3WE3A 1G6NA 2MA3A 2OD5A 3ZMTA 1BI3A 3HSRA 2JSCA 1DUXC 2V6CA 2TDXA 1UB9A 5DCMB 1IF1A 2FE3A 3BY6A 1TNSA 3WTSC 1USSA 3QP6A 2F5CA 2FEZA 4L9JA 2STWA 1IUYA 3GZ5A 2P7CB 4GYGA 4M9ZA 3MAJA 4A6DA 3WE2A 2QBYB 1ZRFA 5FGMA 2H27A 4I09A 2ZNYA 3HOTA 1GXQA 4EJWA 3B73A 2D1VA 2XAJA 3TOBA 2A68F 1AOYA 4RB1A 3QRFF 3KP2A 1BJAA 3F3XA 2VOOA 2XAHA 1SMTA 4FT8A 3W6KB 4JBAA 3F22A 2BV6A 4P55A 4MTEA 3TKYA 5LBQA 2A61A 3JTGA 1YTYA 3JSOA 4Q48A 2E7WA 3GYHX 2H09A 2O0YA 4IPAA 1TBXA 4DNCA 2ESHA 1Z1DA 1MD0A 1YW9A 4KIBA 4I2OA 4CDGA 1FZPB 3EDPA 3ROUA 3E97A 3QPHA 4O5VA 2C6YA 1WWXA 3EYIA 1Q1HA 3EUHA 2K02A 4HYEA 3IL2A 3KEOA 2CO5A 3DPTA 1FOKA 4YFNF 2EFPA 1USTA 2V9VA 3FXRA 3TDZC 1MKMA 1S7OA 4EVIA 1R5GA 2EV6A 3RKYA 4KDPA 1IN7A 1XGNA 4ZYEA 2FXAA 3U9GA 4KA4A 1L3LA 1QZZA 4RGRA 1ZAOA 3E6MA 2RC4A 4PGHA 1RUNA 2P6TA 2EJRA 2JPBA 5A2QZ 5HVQC 2H6CA 2HKXA 1PDNC 3P7NA 3PFIA 4G7HF 1OKRA 2ZXJA 3EETA 4MNUA 5HLIA 5AIQA 1JGSA 2W85A 3FM5A 3KLNA 3HYIA 2W57A 1ZREA 5CVUA 3F8MA 3I71A 2Q0OA 3HRMA 1BN5A 1MJBA 2LNBA 5DCFA 5DUKA 1G3SA 1FBUA 5DV5A 3F8CA 4LLNA 2HKOA 1U78A 2UWMA 4N9IA 4MGRA 3REOA 1YS7A 5CVJA 4YFXF 4A2UA 2RVCA 1O3QA 1HXDA 2M8EA 1F1ZA 4OINF 1KGSA 2MLGA 3ELKA 3I53A 3ABTA 3KZYA 5AIPA 3AAFA 2MC3A 3LQQA 1SFXA 1TTYA 5H6QA 1OYYA 3GF2A 2XAFA 2M1BA 5DEQA 5E20A 1D8JA 3BP8A 4XLPF 3V8LA 2DW4A 2OBPA 3CUOA 1C0WA 1O57A 2P8TA 4I01A 2EFQA 1MDMA 2IVMA 2OA4A 3R60A 1DDNA 1IXRC 2FRHA 2OQGA 3WTUC 4HAMA 4L0YB 3N4MA 4NQWA 3K2ZA 5LEKA 3L9FA 3WGIA 5K5RA 4XSZF 4QWQA 2HTJA 5D5VB 2VBYA 3BROA 1TQPA 1IXCA 1Z6RA 5BPDA 3DXJF 2WC2A 3SHFA 3DF8A 4CZZA 4HX8A 2H94A 1YIOA 2ZBKA 1UHMA 4LB6B 1XMAA 5ERIA 4FX0A 2F5DA 3T1BA 3GO5A 1GHCA 1IN6A 3NQOA 2HYGD 3ML6A 2CW0F 3TO6A 5E8IA 5D4RA 2EFWA 4HV5A 4XRFA 1S7AA 3LA7A 1TW3A 3GVAA 1FNNA 3CUQC 3M7GA 1HSJA 4Q5SF 3E5QA 2PMHA 2QVOA 3T8TA 1XSVA 1LQ1A 3WTVC 3VODA 4IRHA 3PQJA 2Z33A 2QLZA 3KP6A 3H3UA 3H3ZA 3ZP5A 3I0TA 4WXDA 1F5TA 3V8KA 4UV8A 4XSXF 3RIRA 4LLLA 3BPXA 4EGYA 1ONVA 2ZFWA 1WRJA 3GFIA 4UV9A 1T6SA 2BYVE 3JSPA 4KIFA 2Z99A 1SMYF 2BE5F 4OIQF 3HOSA 5E1XA 1F9NA 2KJCA 1IN8A 5BS6A 5LGTA 3CO6C 3C18A 2FMYA 4DQ2A 1FBQA 2J5OA 3LSTA 2HR3A 4ZZDA 5HLGA 1I5ZA 5LRSA 2FOKA 5D6FA 4G7ZF 1H0MA 3LWFA 1XB4A 4G6QA 1BM9A 5DCMA 3MQ0A 5LHIA 3HHGA 2WWYA 1ZARA 3WU0A 2K7LA 4BAYA 3CUQA 1K7AA 1HW2A 1P92A 1K78A 2Z3YA 1S6LA 5BOXA 4MQVA 4NHJA 1FYMA 3RKXA 1ZG5A 3FHZA 1K79A 1P4WA 2FSWA 2VBXA 2EFNA 4ESBA 3ZN1A 1ZGJA 3ZMSA 1JE8A 2FA5A 1R00A 3HTUA 4MEYF 4HQEA 1CGPA 3WTZA 1SFEA 3IKTA 5FFXA 2PJPA 1Z9CA 1LDDA 2VC0A 2O8XA 5D5WB 4M71A 4A5NA 5JFRA 3J7AO 1I1GA 2J5PA 4M9XA 4HZFA 1WSUA 4H0EA 4WK8F 3L09A 2FBHA 3R6SA 1DPUA 2VBZA 3SZPA 4B09A 3WU1B 1S3JA 2HQNA 4IRIA 1ON1A 1SD7A 3RYRA 5LEJA 3DQVC 4RB0A 2NRAC 4L9VA 2KIMA 1R5HA 1FYLA 3MZHA 2VT2A 3DV8A 1HKSA 1OR7A 1UHWA 5ILVA 4BNCA 1HW5A 3ZMVA 2CWEA 3G73A 2YR2A 1BI0A 1REPC 3C3WA 1R23A 1J5YA 4MHGA 4IXAA 1WI9A 1BI1A 3GXOA 4U7DA 4KNYA 3M1EA 4LK1F 1YO5C 3U2RA 1O3TA 1TLHB 4K2EA 2RDPA 4U0WA 1ZHFA 2W25A 1CF7B 3I59B 4HQMA 1XN7A 3IRRA 3MEXA 4EV0A 1U6GA 2G9WA 2CG4A 2O6GE 4L9TA 3FM3A 4UNOA 1MZBA 4LJZF 2CQKA 1PP7U 2QQ9A 1W4MA 2HYFA 1ZRCA 2V1DA 2D2WA 5CVRA 2KIUA 4ENKA 4KFCA 3O6BB 1KQ0A 2Q8KA 2HQRA 1S29A 4FX4A 3QU6A 4UVBA 4R79A 1K6OA 2QWWA 4A0YA 3GWZA 1HKTA 4UXNA 1XDUA 3ULQB 2QQAA 4ZZLA 1Z7UA 2DLLA 5F1RA 4CHUA 2M5WA 5K5OA 5DD8A 4UVCA 5L3CA 2GXGA 2L02A 3H92A 1Z05A 3RDIA 2PI0A 4WWCA 1L0OC 4I7HA 3M8FA 4HLXA 5FLXZ 1Z6TA 3ISPA 3ECOA 1SD6A 3V7CA 1T38A 2EV5A 2VXZA 1D5VA 2GA2A 4AIKA 5HS8A 4AD9A 2M30A 2E7XA 5BQTA 4HF2A 2MLKA 1FP2A 1ODDA 1X3UA 1LVAA 1BIBA 1FC3A 3ZMDA 1BOAA 3O3KA 4MTDA 1QBJA 3OV8A 2ZNZA 3T8RA 1SD5A 5FD6A 3D5LA 4IJAA 3WTYC 2YU3A 1ZLJA 3T0YA 3HRTA 1IXSB 4S05A 2XKOA 2F2EA 1XSDA 5E17F 3EYYA 1W7PA 1FWZA 5JVTA 3VOEA 1OPCA 4UVAA 3QPTA 1ZG3A 4EJTA 3ZPLA 1KYZA 2VT3A 5IT3A 1IW7F 5D4SA 3I64A 1R22A 1KU2A 2VBWA 1U2WA 2K27A 1MGTA 3RJPA 5E1ZB 2OQRA 4KIGA 4KMFA 3DKWA 5FFZA 4IHTA 1LDJA 4M74A 2NAZA 1LB2A 4XBFA 1YW7A 4ENMA 2ZJ2A 2EK5A 3F8NA 5K1YA 4OIPF 3E6BA 4MQ9F 3C1DA 2GWRA 4HX7A 3TO9A 5JR3A 4QLCU 2EV0A 2NNYA 2PG4A 4L5IA 1J59A 4FHTA 1DP7P 3ZQ7A 1KQ9A 3I58A 2GAUA 4HV6A 4U0YA 3L7WA 5BMZA 1I6XA 4Y13A 1BIAA 3ERED 1U5TC 4OOIA 5CJ9A 2L54A 4HF1A 3FXUA 1QZYA 3JAMZ 3L2CA 1H9GA 4A12A 5LHGA 4CGZA 3LFKA 3Q9VA 4EJUA 3PQKA 2GIVA 3CDHA 2OZ6A 4E70A 2XKPA 5H6RA 1SD4A 3IRQA 2EWNA 2VE8A 2O61A 4Y15A 4GCVA 3LQRA 1HW1A 2JZYA 5IT9Z 1A04A 3BJAA 2JTVA 3HSFA 4ETSA 4HOBA 3JTHA 4LG0A 1R1TA 1WQ2A 1V3FA 1JXSA 2YSRA 2Q2EA 2DTRA 1RIOH 4TV7A 4ZH4F 1XSXA 4RGUA 3DFGA 4YIFA 3SXYA 2G7HA 4JQFA 2Z9OA 3OOPA 3BOQA 5CLSA 4LLGF 3M9AA 2DBBA 2HOEA 4KN4X 1G4DA 5JHUA 5HS7A 2FBKA 5J6XA 1YW8A 3KP3A 2R7FA 2A6HF 3BJOA 4N0BA 1ZYRF 4RB3C 2UXNA 3GFMA 1T98A 1P6RA 2QM3A 1O7LA 1U5TA 1XGOA 1R1UA 2D1HA 3RPQA 2IA2A 2MD5A 4RAYA 3R61A 5TJJA 1J0RA 3ZN0A 2KIFA 1J9IA 4CO8A 2G7UA 1I27A 5FLXK 2Y75A 4P5OA 2DT5A 1W5TA 3CJNA 3QP5A 3ECHA 4PZJA 2VC1A 1TW2A 2X4HA 3HSEA 1QPMA 4PDKA 2E1NA 3W6JB 1R36A 5KVRA 2ZMEB 2QUFA 1F4KA 1ON2A 5L3GA 3FMQA 2GQQA 4AIJA 2IJLA 2V1UA 3KZZA 2EFOA 1BC7C 4ESJA 2F5EA 2LDUA 3ZMUA 1FSEA 4A0ZA 4NB5A 5J8CA 3FZVA 1QQIA 4IHSA 2KRFA 2FMLA 2XAGA 1MDMB 3K69A 2XHKA 3DEUA 4LMYA 3T5XA 4OMZA 1RNLA 5LHHA 4AIHA 2VN2A 4G6DA 1KU7A 4L5JA 1KU3A 4BHPA 2ETHA 5A2QK 2FBIA 1TNTA 2Z5UA 1BI2A 4XLNF 4RB2C 3COAC 3MFKA 3J81Z 2HZTA 3BJ6A 4OIRF 1H9TA 1AWCA 3TQNA 4EMSA 2RN7A 4EQQA 2LSOA 1I1SA 1J7KA 1LDKB 3BDDA 1IRGA 3I54A 4IF4A 2UZKA 1YQAA 4U88A 4EM0B 2STTA 2QBYA 4OU0A 4CICA 1IAWA 3GEZA 5L3DA 3SQNA 4BHCA 5CYVA 3I5UA 4GYIA 4I0BA 1B59A 1IRFA 1V4RA 3FX3A 2A69F 1FY7A 3QOPA 2ISZA 2DPUA 3FF5A 5HDGA 2HDCA 1B1BA 4LD5A 4RS8A 2ESNA 2K86A 3GFJA 3WODF 3R0JA 1HQCA 4LFUA 3BWGA 2Y48A 3F72A 5TRDA 2FU4A 4EGZA 3GUDA 2RQPA 4GGGA 4OIOF 3O2PE 3K9TA 4G9YA 2HS5A 2DQRA 2IP2A 2CGPA 2DO7A 2PQ8A 2P6SA 1HSTA 4PCQA 5DDGA 3J80Z 4M72A 2IPQX 4N9HA 3LA3A 3KP5A 4KT5C 3JAMK 3V7RA 4UUVA 2HEOA 3LAPA 1R58A 3I4PA 3GW2A 4LB5A 4P96A 5LGUA 4ENJA 2FF4A 1IN4A 1STZA 2IA0A 2ZO4A 2KKOA 2VODA 3IHUA 2VONA 2ELHA 5IT9K 2QZ8A 3TDUC 1NHAA 3CLOA 2GZWA 2ADUA 1QO0D 2M45A 1E17A 4BH9A 4PGGA 1R7JA 2EB7A 3FMSA 3WTTC 2XIGA 3DP7A 3SZTA 1D8KA 3V4GA 1YFHA 1KYWA 2L4AA 1Z91A 2CYYA 2P5KA 3WTXC 2CFXA 2R7DA 2L4MA 1E2XA 3P9IA 3C7JA 3CUQB 4BHBA 4YFKF 1K78B 2DPDA 5ICFA 4EJVA 1RI7A 2V1XA 1GXPA 1ZGAA 4O3MA 3WGHA 5ED4A 4RAZA 5DYMA 3HRSA 2IW5A 3P9KA 2XVCA 4HW0A 1OYWA 3Q9SA 3QAHA 1O3SA 2LKPA 2LF8A 2OU2A 5D6EA 4I02A 2NS0A 4WXHA 4WCGA 3S2WA 3KP7A 1FX7A 3BZ6A 3RPUA 3VB2A 4Y17A 3NRVA 3FWEA 4HX4A 2W84A 5ICCA 4HF0A 1G3WA 5ICEA 4A6EA 4P9FA 2K4BA 1O7FA 2L3DA 4A0XA 1LJ9A 4ZYDA 1P4AA 4HDUA 3FMRA 1J2XA 2PBIA 4Q47A 1XD7A 4UHTA 1B6AA 1B4AA 1QGPA 3ABUA 3EQLF 4HA8A 3E5XA 2VOPA 4IRGA 2P5LC 4U0VA 1S8NA 1XCBA 1QNTA 1YYVA 2RKHA 2R3SA 3J81K 1P2FA 2UXXA 3GFLA 3G3ZA 4KICA 4ON0A 5ICGA 1XGSA 1JHFA 3D0SA 2ZKZA 1U8RA 1FP1D 1FSHA 4LK0F 2ACJA 2P4WA 2PN6A
chains in the Genus database with same CATH superfamily
1ULYA 1XC5A 2HNHA 4B1RA 3E6CC 5ILUA 1HLVA 2NNNA 3TOAA 2GLOA 4S0HB 4P9UA 2K40A 5FKNA 3CO7C 3SFIA 3JW4A 2W1OA 2JJ7A 3VYUB 2ZSIB 3KFWX 3TW6A 2P5VA 2XGEA 3B02A 2XRNA 1BA5A 4MLOA 1A6QA 1LUJB 4Z2YA 1ZLKA 1XMKA 5IYDJ 3WTWC 4PUSA 1HBXG 2KPMA 1EH7A 2EINH 3MCZA 4NC8A 1W36C 2VPLA 5BNGA 4RM3A 1SAXA 3L1PA 3F8FA 6PAXA 2CFOA 1K4SA 2KZGA 3HM5A 2WTEA 4PJJA 1BC8C 2XGXA 2ZFUA 3BR3A 3S17J 1LFPA 5D5XB 1OYIA 2W82A 1S5LC 1A5JA 2IT0A 3DPUA 2X1EA 3F6OA 2A5YB 2R7XA 2WV1A 4L18B 1HDDC 3P5JA 4M9SA 1WHUA 5K7HA 2E71A 4IHWA 2HYJA 2FJ1A 3IWFA 3LAJA 1S72I 3J80K 2DK8A 1YLFA 2ZMEA 1B9MA 2R7OA 4L9NA 3OYNA 2Y9YA 5L3FA 2OV7A 2KDZA 3ZCOA 4OAZA 3NEUA 1RC9A 1D0ZA 1W7PD 2BEOA 2HTSA 2VJIA 1Z77A 5J4VA 2CUZA 3K1PA 3L2VA 2XF6A 2BBYA 1TP4A 2X0LA 1V5EA 4NDLA 1TQMA 3KLOA 5D8KB 2PLYA 1QHHD 3Q5FA 2W00A 2FNPA 2NOJB 4IO9F 3GLLA 5E18F 4KN7X 1SC7A 3CMYA 3HDDA 2DFIA 5HLHA 1T0FA 3K0LA 1PUEE 3MMYB 4II2A 4XK4A 4EM2A 3LA2A 4OMYA 2QYOA 5EEGA 1XS9A 4ABZA 2PMZN 5IYCJ 1EV7A 2IGMA 2JPCA 2UUZA 4RGSA 3FISA 2QKMB 5FB2A 3N97A 5L3EA 1ZTRA 2ICWG 3HEFA 3KP4A 1IO2A 2B9SA 3LSHA 2XAUA 4JK1X 2A3SA 2E1CA 1OMIA 1Y56A 5F64A 5FKLA 1X3WB 3V8JA 3K1NA 3WGGA 3E0JB 3E3VA 4D5FA 1IV8A 4G6TB 2R7UA 2COMA 3I3LA 1T2KA 1XCVA 1FBSA 1W7PB 2VI6A 3V7SA 3VFZA 5E3MA 4GXOA 5B5EC 4YG2F 1TL8A 3B6AA 1B9NA 2EBIA 2PEXA 3TGNA 1YRNA 1XGMA 3P9CA 2OZUA 1WKMA 4JP0A 2MBFA 5FD5A 5GAHJ 3AL0C 2DU9A 1E3PA 2A05A 4V2FA 2M7BA 4KMUX 3CMMA 1MJAA 2W24A 2LF7A 1PUFA 3PO2J 4BXUA 1D3YA 2EA2A 2F4MB 3KEQA 4CYCB 4QPOA 2FQ3A 2MD0A 4I0AA 1VQ8I 4L0ZB 4KJZA 3MKYB 2GXAA 2PMUA 3H36A 2KLOA 3KETA 4ESFA 2EQRA 3VEPA 2AS5F 1B8IB 5JLWA 3KE2A 5BPIA 2CV2A 2P81A 1PJRA 3GLXA 2H6BA 2XASA 4V2GA 4WXCA 5IYBJ 2WBMA 3RYPA 2QSHX 2XPUA 4RGXA 3FXQA 1XDSA 3F21A 2YX4A 3JREA 1IDZA 5JI6A 5GPAA 4A3KJ 1TC3C 3JRGA 2FOWA 4CCJA 3WHCA 2G0EA 1SFUA 1DQUA 1MBEA 5E8GA 5ILSA 2ISYA 3CC2I 3HRUA 1BBYA 1ETWA 3H9JA 3ZMZA 3HZJA 1D1CA 2P7VB 2XAQA 4D1QA 2QQBA 2E19A 1SVMA 4YIIA 3ZQFA 4F7ZA 3RTRA 4HLYA 4E7KA 3IKVA 3RSNA 2K3PA 4UUSB 3S15J 1EH6A 2F5FA 5EYRA 4G94A 3TO7A 5LGNA 1KQ8A 4CYDA 1W5SA 1UG0A 3F6VA 5HS9A 5KK1A 3ZQHA 1R71A 1K83J 4OWRB 2MH9A 3OYFA 5LRRA 4WX9A 4W1UA 4KUMA 3QU3A 5FO5A 3HHHA 5AONA 4BS9A 1MJ9A 1OLTA 4R1HA 3FK6A 1J75A 2RV8A 4AWXB 1U0JA 4II3A 1YG2A 4WF2A 5L3BA 3KYCB 3FXOA 1IZ1A 5K5QA 2DI3A 2LMDA 1YS6A 2IS1A 1X1CA 3DCFA 2XV4S 3QOEA 1PP8F 1GLNA 3WG9A 2KT0A 2M87A 4ZYHA 2X85A 3PSIA 2FNAA 2V7FA 4B44A 3J7AY 1O3RA 2XUBA 1UFMA 5HDNA 1YOVB 1K6YA 1V5FA 2GOXB 5F08A 4IOAF 3R4KA 1T39A 2LVSA 4ZYGA 1WGXA 1ZRDA 4Q4ZF 5GAGJ 2L9RA 3CTAA 5FKMA 2EA4A 1BOBA 3SDGA 3H1CA 2HFHA 2CSOA 3S3NA 2EZIA 4ASNA 3CCVI 1OFCX 1KU9A 2YPRA 1SVLA 4XMYA 3PFYA 5J8FA 2VKEA 4A3JJ 3K1MA 1CF7A 2L7ZA 2R5YA 3HIFA 3I59A 3M07A 4S04A 3MWMA 3UR3C 4LG0B 1VQNI 1UCRA 2DAOA 4X0GA 3E6DA 2HWVA 5CVVA 4M73A 2Q2EB 3HUGA 4CXFA 4U7BA 2YX7A 2GA1A 2Y0MA 4XM3A 5DUIA 2B0LA 4M6XA 1JHHA 4GDFA 3IAS2 2JT1A 5LFAA 5LLQA 5CVIA 3U1DA 5HDKA 1GVJA 3ABLH 1JJ8C 4DZPA 4C2MJ 5E1WA 2K9LA 1G3TA 5J1RA 4KYWA 4N4OB 2ZJRF 1NK2P 3CMAI 4E6KG 2IRFG 5D5UB 3RKQA 3F23A 2IGKA 4I98B 3CZ6A 3R0AA 2O3FA 1I50J 5H20A 2E2IJ 4PJ0C 4BUPA 4F55A 4HDVA 3BCAA 1FYKA 2DK5A 1LNWA 4B8XA 4ENNA 1HKQA 1FT9A 1ETYA 2L01A 4UUTA 4A5MA 3GX4X 1VI0A 2BVMA 3IC7A 3FBNB 3CP2A 3OYMA 2D45A 3TBIA 2RNJA 4HEA2 4XOPA 5EG0B 4IOCF 3MZYA 1G3YA 2MGQA 2ZXHA 1YX3A 2IA1A 3MKZA 2VE9A 1AU7A 4XLFA 1LEBA 2AXLA 2KJBA 1U5TB 3KCCA 3LMMA 3O8HA 1H88C 4BQAA 5DD4A 2NVUB 2XROA 2MABA 1DPRA 2BW3A 4G8XA 2RGVA 5FRMA 4NC6A 3DPLC 1HCRA 3PJRA 2MC4A 1ZR4A 4M6YA 1RZ4A 1U3EM 2WV0A 1VTNC 1JUMA 4IVNA 1ZG1A 1ZR2A 1QA6A 3FXKA 3RI4A 1ETKA 2O03A 5EEHA 1H8AC 1EH8A 3S2HJ 4XN3A 3AG4H 2X6YA 1P4XA 2JRTA 2M4KA 3F8BA 3RKWA 1WH5A 4O6JA 1Y0UA 4R8HA 3G4SI 4GO1A 2DXIA 2PFBA 3CJQB 3VWBA 1XMXA 5M5YJ 4C3IJ 1TQIA 1Y8RB 2K4JA 1ZH5A 3SZGA 4EJOA 5IP7J 4LGWA 2HQ5A 2BGCA 1EF4A 2GXBA 2Y31A 1FLIA 1FPQA 1X4OA 4BEHA 4MEXF 3MKLA 2A07F 5F6FA 3SFZA 1UJ8A 3BPVA 4HBLA 1JUPA 3PNTA 5HOOA 2V79A 3VYSB 3GZ6A 2CW8A 1QHGA 2L2OA 4BYYA 3D5RC 2NYXA 3IWZA 4D0PA 2DQLA 3CCLI 1POGA 1ZKGA 1IN5A 2ZCWA 4B48A 2KHMA 2OAZA 2VPRA 3E5UA 2WA0A 1X2MA 1R1VA 1Z67A 2X48A 4G7OF 5DM7F 3H9GA 1RUOA 2HGCA 2JWTA 4CZCA 2M0CA 3TMOA 4EEFG 1ZN2A 3ZRGA 2LP0A 1LEAA 2RAEA 2QENA 2XDVA 1HC8A 4BU2A 2KISA 3EUHC 2M4GA 3OSGA 1N25A 3M8EA 4EM1A 1KA8A 3PO3J 2A6EF 3HTSB 4AVPA 5D8LB 3L00A 2VASA 2MH2A 5GP9A 2JA6J 1WJFA 3WE3A 2X6OA 4ZDOA 3M4OJ 1G6NA 2MA3A 2OD5A 3ZMTA 1BI3A 2MW8A 2ELJA 2D5VA 3HSRA 3DBLB 3BG6A 2JSCA 1DUXC 2ME0A 2V6CA 2TDXA 1UB9A 3DLLF 2L9NA 5DCMB 2WAQA 1IF1A 1E3OC 2FE3A 3BY6A 3M8JA 1YJ9I 5JLXA 3Q0UA 1TNSA 5C3EJ 5M5WJ 3WTSC 2VQGA 1USSA 3QP6A 3HOYJ 1WFXA 2F5CA 2FEZA 3CMEI 4L9JA 2STWA 1IUYA 3A0HC 1R49A 1X58A 4BE1A 1YITI 3GZ5A 2Z16A 3OYEA 4GYGA 2P7CB 2QGUA 3BQZA 3KEYA 1KZHA 4M9ZA 3MAJA 3NAUA 4A6DA 3WE2A 5B1AH 2KFDA 2QBYB 1ZRFA 2Y0SA 5FGMA 2PJRB 3RZOJ 4B3AA 4I09A 2H27A 2ZNYA 3HOTA 3DTIA 3HPHA 2K9QA 3KZIC 3FIWA 1GXQA 4EJWA 3B73A 2DA5A 2D1VA 1JKOC 2XAJA 3TOBA 1D0XA 2A68F 1FIPA 1XX5A 1TT5B 5C4JJ 2E60A 1AOYA 4RB1A 4CCLA 3OIPA 3QRFF 1TWGJ 3KP2A 1BJAA 3F3XA 2VOOA 2XAHA 1SMTA 4FT8A 3B6CA 3W6KB 3BT9A 4JBAA 4P55A 2BV6A 3F22A 4MTEA 3TKYA 5LBQA 2A61A 3FXMA 4XN0A 4BY1J 3JTGA 4C3HJ 3LOCA 2RQQA 4MIMA 3AG3H 3F0CA 1YTYA 3JSOA 3L2WA 4Q48A 2E7WA 2K5CA 3GYHX 4JYKA 3BZCA 2H09A 2WY8Q 3IV5A 4E7ZA 2IBDA 2O0YA 1TBXA 4IPAA 1X1AA 4DNCA 3GTGJ 2ESHA 2CS3A 1Z1DA 1MD0A 1YW9A 4B4CA 4KIBA 1GV5A 3Q3SA 4CDGA 4I2OA 4E4HA 1RESA 2V1NA 1YX5A 4XQFA 2V9PA 3EDPA 3ROUA 1FZPB 3E97A 3QPHA 4RLQA 4XKWA 5GADJ 4O5VA 3ASOH 2C6YA 3RQ4A 1JTXA 3BCBA 5J47A 1WWXA 3EYIA 1Q1HA 3EUHA 2K02A 4HYEA 3IL2A 3KEOA 1ETOA 4A3FJ 1BW5A 2CO5A 2JN6A 3DPTA 1FOKA 3G2BA 4YFNF 2EFPA 1R9TJ 1USTA 3ESWB 2V9VA 4DZJA 3FXRA 3TDZC 4DIQA 3GTJJ 1WJAA 1MKMA 1S7OA 4EVIA 2IS6A 1R5GA 2ECBA 3SYTA 2EV6A 2LR8A 3OYKA 3RKYA 4KDPA 1IN7A 1XGNA 1YE9A 4ZYEA 2FXAA 3U9GA 4KA4A 3S3MA 2CQNA 1L3LA 1QZZA 4RGRA 1RPWA 2GOMA 4F52A 3FDYA 5M3FJ 1ZAOA 3E6MA 2MFZA 1WJ5A 3A01B 2RC4A 4PGHA 1HA8A 3ZQGA 1RUNA 2P6TA 2DYSH 2EJRA 2JPBA 3A1YA 3I9V2 3RCOA 2Y2ZA 5A2QZ 5HVQC 2HZDA 3FBIB 2H6CA 5FKKA 4YIRX 2HKXA 3K4BA 1PDNC 2O8KA 3GBGA 3P7NA 3PFIA 2MSYA 4G7HF 1OKRA 5K7FA 2QF7A 4IX7A 2ZXJA 3EETA 4MNUA 5HLIA 1BW6A 5C4XJ 5AIQA 4C2TA 3IH2A 1JGSA 2W85A 3PNVA 3FM5A 3E1SA 4PSWA 3BR1A 2E35A 2WB1A 3KLNA 3WU2C 4FE7A 3HYIA 2W57A 3CCSI 3RPUD 2R7WA 3JRCA 1ZREA 5CVUA 2CV0A 3F8MA 3I71A 2Q0OA 2OTJI 1FOYA 3CCQI 1DGWY 4D9JA 2F4OB 4XKCA 3HRMA 1BN5A 1MJBA 1JKPC 2LNBA 3HL2A 1UAAA 5DCFA 5DUKA 4E7LA 1G3SA 4UB8C 3LFUA 1X3ZB 1FBUA 5DV5A 3F8CA 4LLNA 3LSIA 2LY1A 2HKOA 1U78A 2UWMA 2E1MB 4N9IA 1DP3A 4MGRA 3REOA 4BQOA 1YS7A 5JHFA 5CVJA 3MD2A 4YFXF 4A2UA 4P1WA 5IY5H 2N8GA 1ENHA 1TWFJ 2RVCA 1O3QA 4QTRA 4A3EJ 1HXDA 2LY9A 3C2GA 1VQ5I 2M8EA 1IV6A 9ANTA 1F1ZA 4OINF 5E79C 5EJCA 1KGSA 1JKRC 2LYCA 2HVSA 2MLGA 3ELKA 2DA3A 2YS9A 3LL7A 3K70C 2DOAA 4RAFA 1T8IA 4BGDA 3DEEA 3TL4X 1X2NA 3I53A 2E36A 3ABTA 3KZYA 5AIPA 3I4NJ 3AAFA 2MC3A 3H3VK 3LQQA 3ZQIA 2KRCA 2EIMH 1SFXA 1TTYA 5H6QA 1OYYA 2ME6A 1VQ9I 3HGGA 3GF2A 2XAFA 1X1BA 2M1BA 2OF7A 4ANJA 1UHSA 5DEQA 2GIZA 5E20A 4NBQA 2L0KA 1D8JA 3BP8A 4XLPF 3V8LA 4UY8I 1ETQA 2LOOA 2DW4A 2LY2A 2OBPA 2OCCH 3CUOA 1O57A 2LK2A 2P8TA 3SDBA 3JRIA 1C0WA 4I01A 4QSHA 1W0UA 1Z7LA 2DJNA 2DFFA 2Z2SB 3BLYA 1MBKA 2DA2A 1DU0A 5KAFC 3LSMA 2EFQA 1MDMA 2IVMA 2DYRH 2V6EA 2OA4A 3R60A 1DDNA 1F43A 3K2AA 4MO7A 1IXRC 3VYTB 2FRHA 1Y1VJ 3WHBA 2OQGA 3WTUC 3GTPJ 2DA4A 3CQZJ 5FROA 2EH3A 4HAMA 3S1RJ 1I39A 3D5SC 1PYVA 4JX4A 3VDXA 1H89C 4L0YB 3N4MA 4NQWA 4GFBA 3K2ZA 5LEKA 3OS2A 3L9FA 1T95A 3WGIA 5K5RA 2M7AA 2KDOA 1WI3A 2K85A 1APLC 4XSZF 1WJDA 2HTJA 4QWQA 1EKEA 5D5VB 2VBYA 5KNLA 4HNVA 3OY9A 3BROA 1TQPA 2DODA 4ZTFA 2BZTA 1LPQA 1IXCA 1Z6RA 1R4MB 2YU9J 3QYEA 3DLAA 5BPDA 3DXJF 1QPIA 2WC2A 3SHFA 1AKHB 3JCUC 2L7KA 3DF8A 2LBFB 1JJ6C 4CZZA 1VQPI 4HX8A 4RA2A 4Y52J 1B72A 2H94A 2DN0A 1YIOA 2ZBKA 3LSGA 4FE4A 2HPIA 5KAIC 1LKXA 4N4NB 4KT6A 1UHMA 4LB6B 4U87A 2KZVA 5FJ8J 1XMAA 5ERIA 4CCMA 1FEXA 2R93J 4FX0A 2F5DA 3DWLE 3T1BA 3CCEI 3GO5A 1GHCA 1IN6A 3NQOA 2IAIA 3OYJA 1GT0C 2HYGD 2JVGA 3ML6A 2CW0F 1E3HA 3TO6A 2QKLB 5E8IA 4A3MJ 5D4RA 2EFWA 3OYIA 2X1CA 4HV5A 4XRFA 5DM6F 3IAM2 5M3MJ 1JT0A 3KPHA 1S7AA 3LA7A 4HSTA 1Z3XA 1TW3A 2AQFA 3GVAA 1FNNA 3CUQC 3M7GA 4BJTA 4KITB 1JKQC 1HSJA 4Q5SF 3E5QA 1VFCA 2PMHA 2QVOA 4BXXJ 4RMNA 1GVDA 1IC8A 3T8TA 3F9KA 2VJ4A 1J09A 1XSVA 5H2FC 1LQ1A 3E7LA 3WTVC 1VQ4I 3VODA 4IRHA 5FKOA 3PQJA 1TT0A 4ZTJA 4C30A 2FQ4A 2Z33A 1BR2A 3VSLA 2AXTC 1FIAA 2QLZA 3KP6A 3H3UA 3S1MJ 3H3ZA 3ZP5A 1MMAA 3I0TA 5EDNA 2I10A 5FLMJ 2O7OA 2COBA 4WXDA 1V54H 1F5TA 3V8KA 4UV8A 2NXNB 4XSXF 2R7VA 2XSJC 3RIRA 4LLLA 3BPXA 4EGYA 1IG7A 2AQEA 4W97A 1XPXA 1ONVA 2ZFWA 1WRJA 3GFIA 4UV9A 3LSPA 1T6SA 3IH4A 4XLHA 2BYVE 3JSPA 4KIFA 2Z99A 3FKIJ 3GMEA 4AM3A 4UB6C 5HLTA 1SMYF 3TEDA 2BE5F 4C2UA 2NVQJ 1R6RA 4OIQF 2LTPA 3HOSA 2A5WA 5E1XA 1RRJA 3JRBA 3FXLA 1F9NA 1T56A 1W36D 2KJCA 3BG5A 3L2UA 3H35A 4B47A 1IN8A 5BS6A 1MSEC 5LGTA 3CO6C 3ABKH 1P9QC 3D1NI 1FOWA 4XNFA 4ZDLA 3C18A 2FMYA 4XLCA 4Y33A 3NWTA 1X4PA 1K4TA 4DQ2A 1FBQA 2J5OA 1K61A 3DTKA 3LSTA 2HR3A 3GTLJ 4M3FA 4L5EA 4ZZDA 1I3QJ 5HLGA 1I5ZA 5LRSA 3HJEA 2FOKA 5D6FA 1OISA 4G7ZF 2DMUA 2Z1DA 1NG7A 1H0MA 1OR7C 3LWFA 2VXDA 1WPKA 1XB4A 4G6QA 1BM9A 2VKHA 5IOYA 3CDIA 5DCMA 3MQ0A 5LHIA 3HOWJ 4A3BJ 5KCMA 3HHGA 3GZNB 1D5YA 2WWYA 1ZARA 3HKZA 3WU0A 2K7LA 1VZ0A 3EPZA 4BAYA 3DBRB 1YRNB 2BOLA 3CUQA 1K7AA 2ID6A 1QVTA 4PFPA 1HW2A 1P92A 4DBRA 4F3QA 1K78A 2Z3YA 3C2HA 1S6LA 1JGGA 5BOXA 4PK4A 1OCZH 4MQVA 4NHJA 4A3CJ 1PUFB 1FYMA 2H8RA 2XC7A 3RKXA 4C9YA 3JR9A 1ZG5A 4ZDPA 1LE8A 3CJTB 3FHZA 1K79A 1A31A 4FISA 2WAQN 5J3LA 1P4WA 4C3JJ 3K10A 2FSWA 2VBXA 2VB6A 4BJ5C 2XRLA 4BACA 2EFNA 4ESBA 3W6VA 3A03A 4HNUA 3ZN1A 1ACIA 2LRDA 1HOMA 1ZGJA 2XGCA 1HDPA 2JA8J 2Q1ZB 3ZMSA 1JE8A 3K7AJ 3ZR8X 2FA5A 2Y69H 4A3GJ 1R00A 3HTUA 4MEYF 4CSWA 4HQEA 1CGPA 3WTZA 2DMTA 1SFEA 2F4IA 3BG9A 1CQTA 3VPRA 3IKTA 2Y0SN 5FFXA 2PJPA 2UV1A 3S1QJ 3K4NA 1Z9CA 1LDDA 2VC0A 2O8XA 3UNGC 5D5WB 2HOTA 4M71A 4A5NA 5JFRA 3MZ8A 3J7AO 1I1GA 2J5PA 2DMQA 4M9XA 1NG6A 4HZFA 4H0EA 1WSUA 4WK8F 3H5AA 3L09A 2FBHA 2HXOA 3R6SA 4BY7J 1DPUA 2VBZA 3SZPA 4B09A 2E1MC 3SEQA 2V26A 3WU1B 1S3JA 1N78A 4XOTA 2HQNA 3CP8A 5CQEA 2VL8A 2ZXWH 4RM2A 4IRIA 1ON1A 5EGOA 1SD7A 3RYRA 2WAEA 1Y6IA 5LEJA 3DQVC 4RB0A 2NRAC 4L9VA 3FKJA 4BE2A 2KIMA 1R5HA 1TWAJ 2L9VA 3K4LA 1FYLA 3MZHA 1A36A 2GBYA 2VT2A 2OJED 2LKSA 3DV8A 1HKSA 2CU7A 1OR7A 1UHWA 2K9SA 5J4YA 5ILVA 4QPQA 3OYHA 4BNCA 1HW5A 3ZMVA 1IRZA 2CWEA 1AA7A 3G73A 4LIUA 3BTJA 1ETXA 2YR2A 3PNYA 1ZGWA 1BI0A 1REPC 3C3WA 3BG3A 1R23A 1J5YA 4MHGA 1X19A 4IXAA 1WI9A 1BI1A 3GXOA 4U7DA 1YJWI 4KNYA 3M1EA 3QYBA 4LK1F 3QODA 2AHQA 1YO5C 3QPSA 1VQLI 1MH4A 3U2RA 1O3TA 1TLHB 3BR2A 2JSPA 2RDPA 4K2EA 4U0WA 1ZHFA 2BVLA 2W25A 1CF7B 5GTIC 2R5YB 4IZZA 3I59B 1QRYA 4HQMA 4IL6C 2M0MA 1XN7A 3IRRA 2XB0X 3MEXA 4EV0A 1U6GA 2G9WA 2LLKA 2CG4A 4BE0A 3V42A 2O6GE 4L9TA 3FM3A 2LKXA 4UNOA 1MZBA 4FASD 3HUGB 3DKXA 4LJZF 3BTLA 3OYCA 2CQKA 1PP7U 2QQ9A 4IHVA 1W4MA 4DBQA 2HYFA 2DT6A 2HDWA 3U21A 2QQ8A 4CH7A 2R5ZA 1ZRCA 2V1DA 2D2WA 5CVRA 1A35A 2KIUA 4ENKA 4KFCA 3O6BB 1KQ0A 4XL9A 3VYRB 4XONA 2Q8KA 4E7HA 1ETVA 2HQRA 1S29A 2H8WA 3I56I 4FX4A 3QU6A 1SEUA 3K4JA 2EIJH 4UVBA 4R79A 1K6OA 3PM1A 4QIWN 2QWWA 1RKTA 4A0YA 3GWZA 1HKTA 2IXSA 1XDUA 4UXNA 2QQAA 5F0FA 3ULQB 2EIKH 3S93A 4ZZLA 1Z7UA 2DLLA 1I6HJ 5F1RA 4CHUA 3OR2C 2M5WA 4JX6A 5K5OA 3O8GA 5DD8A 4E7JA 4LITA 2A6TA 4UVCA 4XIDA 3PIOF 5L3CA 2JA7J 1JI8A 4LOCA 1IDYA 3PUFA 4EATA 2GXGA 2L02A 2OTLI 1MMGA 3H92A 1Z05A 3RDIA 5LD2C 2PI0A 4WWCA 2WB1N 2HOAA 2EPFA 1NK3P 2CRGA 3SEZA 1L0OC 4I7HA 4IQJA 2CV1A 3M8FA 2BW3B 4HLXA 3S32A 5FLXZ 1Z6TA 1RR8C 3ISPA 2LFBA 3ECOA 3BZKA 1SD6A 3V7CA 2X51A 1T38A 3QQAA 1ERDA 4XRSG 1OCCH 2EV5A 3TP3A 2JA5J 5TGTA 5C44J 2VXZA 3LNQA 4XORA 1R4NB 1D5VA 3UKGA 3BG7A 2GA2A 3KIOA 2FX0A 2O5RA 4AIKA 2L5QA 5HS8A 1MBGA 1Y0NA 2M30A 4AD9A 5IOZA 2E7XA 5BQTA 4HF2A 1ZK8A 2MLKA 4LIVA 2JRMA 3K4KA 1FP2A 1ODDA 3S8PA 1X3UA 3BR5A 3H0GJ 4BEHB 1LVAA 3BTIA 1QU3A 1MW7A 4AU7A 1BIBA 1FC3A 5J40A 3ZMDA 4BQQA 1BOAA 3O3KA 3RQIA 2DOFA 4MTDA 1QBJA 2M3AA 4XICA 5JVGF 3OV8A 3S3OA 2K3FA 2ZNZA 3GTQJ 2R7SA 1U9NA 2R7ZJ 2JQ7A 4GRIA 3T8RA 2R7QA 4XLEA 1SD5A 5FD6A 5HNHA 5FLVA 2VKDA 2TRTA 1G59A 3D5LA 4IJAA 3WTYC 2YU3A 1ZLJA 2DTZA 4HG2A 4M3BA 3T0YA 5IP6A 3HRTA 1ITYA 1IXSB 2RNGA 4S05A 2XKOA 3AG1H 2F2EA 2E2HJ 1XSDA 5E17F 3EYYA 3JRDA 2KRHA 3U1KA 4A69C 2BY2A 1W7PA 1FWZA 3OSFA 5JVTA 1SFOJ 2CUFA 3K4CA 3ZQQA 4I6ZA 3VOEA 1OPCA 3G71I 2HXIA 1QZEA 4UVAA 2ID3A 1ZG3A 3OMYA 3QPTA 4EJTA 3IUOA 3ZPLA 1KYZA 2VT3A 1RKWA 4D7MA 5IT3A 1MNEA 2XF5A 1IW7F 1T0FC 5D4SA 3I64A 1R22A 1X1DA 1KU2A 2NS8A 3K6GA 2VBWA 1R5ID 1U2WA 2K27A 4CYCA 2MYSA 1MGTA 3RJPA 2F6CA 5E1ZB 2OQRA 1I3AA 1A6IA 4KIGA 2R7TA 3ONQA 3C2BA 2V4JC 2M2EA 1FOXA 1VF9A 4AYBA 5E3NA 3DKWA 2WAFA 4FQGA 4KMFA 5FFZA 4IHTA 1LDJA 1B8IA 4M74A 2NAZA 1LB2A 4XBFA 1YW7A 4ENMA 1MBFA 2ZJ2A 2F48A 3BTCA 2EK5A 3F8NA 5K1YA 4NC7A 4BXFA 4OIPF 2BXZA 3E6BA 4MQ9F 1JTYA 3CCRI 3GTMJ 2JMWA 5CQGA 3W2AA 4KISA 3C1DA 2GWRA 4HX7A 3TO9A 5JR3A 2XSDC 4ZJZA 4BJ6C 4QLCU 5EZGA 2EV0A 2NNYA 2PG4A 4L5IA 1J59A 2K9NA 4ZC3A 2CQXA 4FHTA 4Y3OA 1DP7P 3ZQ7A 1KQ9A 3I58A 3CCUI 1D0YA 1OCTC 2ECCA 2GAUA 4UUSA 1MBJA 4HV6A 4U0YA 3W3CA 4ZYAA 3L7WA 5BMZA 1I6XA 4Y13A 4BKXA 1BIAA 3K4MA 3ERED 1U5TC 2ZJPF 4YEJA 4OOIA 3LSRA 5B1BH 2R0QC 2E34A 2ELKA 3PSFA 4D5CA 1SANA 3DBHB 4G12A 5CJ9A 3A2KA 2L54A 2BY3A 2QSFX 3A4CA 2Y9ZA 3ASNH 4HF1A 3FXUA 2ZJQF 1QZYA 4CUGA 3TW7A 3JAMZ 3L2CA 5M5XJ 1H9GA 3G1LA 4A12A 4CCOA 5LHGA 3AKZA 4CGZA 3LFKA 2QCOA 3Q9VA 4EJUA 3PQKA 3J7YJ 3BR6A 2GIVA 2XB5A 3CDHA 2OZ6A 3N05A 2B7EA 1MNMC 4E70A 2XKPA 5H6RA 4DOZA 1SD4A 4IQ4A 3IRQA 2EWNA 4XRMA 1MH3A 2JA2A 2VE8A 1G2HA 3CDLA 2O61A 3CJRB 3KX2A 3HGYA 4GCVA 4Y15A 1V55H 2FUG2 3LQRA 4JOMA 1HW1A 1T08B 2JZYA 3CLQA 5IT9Z 1A04A 4BQNA 5CPRB 3BJAA 2JTVA 2JUCA 3HSFA 2HU9A 2I5UA 2OPTA 2IGOA 4HOBA 4ETSA 2ZB9A 3JTHA 4LG0A 1R1TA 1WQ2A 3CF2A 1V3FA 1JXSA 2YSRA 1MIJA 2Q2EA 2DA6A 2DTRA 1RIOH 3PIPF 3ZQLA 4TV7A 4ZH4F 4BBSJ 1XSXA 3LSKA 4RGUA 3DFGA 1VQOI 4YIFA 4OAYA 3S14J 2LG4A 2H1KA 1PVEA 3SXYA 5E3LA 1VQ6I 2K9MA 2G7HA 4M3DA 1BL0A 1ZQ3P 3A0BC 2W4SA 2DDAA 1D1AA 3DEWA 4JQFA 2Z9OA 2NOGA 4DW6A 3OOPA 3BOQA 3OL4A 5CLSA 2XF7A 1W1WE 3MKWB 4LLGF 3M9AA 2DBBA 2HOEA 3LSJA 4A3LJ 4KN4X 2PX9A 1G4DA 2QEXI 5JHUA 1W0TA 5HS7A 2FBKA 5J6XA 2IS2A 5F04A 1WVRA 1YW8A 3KP3A 4M3GA 3NWSA 2R7FA 4HPQA 1N77A 1XTAA 5EG0A 2A6HF 3BJOA 4N0BA 2DMPA 1FTTA 1ZYRF 1AHDP 4RB3C 2UXNA 3GFMA 1X1PA 1T98A 3HC7A 1P6RA 3I55I 2QM3A 1O7LA 1U5TA 1XGOA 1HF0A 3HKZN 2BHZA 1R1UA 2D1HA 2JVHA 3RPQA 2IA2A 2MD5A 4RAYA 4AC0A 3R61A 5TJJA 1J0RA 5GAEJ 2MG4A 3ZN0A 4NUBA 5DTDA 4CA0A 2DFEA 4CCKA 2KIFA 4YRVA 1J9IA 4CO8A 2G7UA 1I27A 5IPAA 1SFKA 2EZHA 5FLXK 2Y75A 2ZC2A 4P5OA 3S2DJ 2DT5A 1W5TA 2DDBA 3CJNA 2KIQA 3QP5A 3ECHA 4PJMA 5F27A 1BR1A 3ABMH 4PZJA 2VC1A 1TW2A 4HSRA 2X4HA 3ERMA 3HSEA 2DCEA 1IUFA 2FD5A 1QPMA 4PDKA 3BC8A 2E2JJ 4PJLA 2OCEA 2E1NA 3W6JB 1R36A 3CCYA 2ZMEB 5KVRA 1DU6A 2QUFA 1F4KA 1ON2A 5L3GA 3FMQA 1WJEA 2F5VA 2GQQA 3W2WA 4AIJA 1LVKA 2IJLA 5EZHA 2V1UA 2PMZA 2EFOA 3KZZA 3DU5A 4X6AJ 1BC7C 2EZKA 1U8BA 1N75A 1TWHJ 4ESJA 4RDUA 2F5EA 2LDUA 5CKTA 3ZMUA 1FSEA 4A0ZA 4NB5A 5J8CA 3IH3A 3G1MA 3DU6A 3FZVA 4XKBA 5GTHC 2HDDA 2GM4A 1QQIA 4IHSA 2KRFA 2FMLA 4X1EA 2XAGA 3J7ZI 1NTCA 1MDMB 2CJJA 2BXYA 3K69A 2XHKA 3DEUA 2IS4A 4LMYA 3T5XA 4OMZA 4Z6YA 2CH0A 1RNLA 5LHHA 4HNTA 4NNJA 1M1EB 4AIHA 4M3EA 1UG2A 2VN2A 4B3XA 4HRIA 4G6DA 1KU7A 1V5GA 3PUBA 4FCYA 3FHNA 4L5JA 1KU3A 4XRSA 4BHPA 2ETHA 3K70D 5A2QK 2W48A 2FBIA 4NQWB 3M3YJ 1TNTA 3OL3A 2Z5UA 1BI2A 3S1NJ 4XLNF 2RREA 4BBRJ 1RETA 4RB2C 3COAC 3MFKA 4XKVA 3HOUJ 3OOUA 3J81Z 2DA7A 2HZTA 3BJ6A 4OIRF 1H9TA 2X6XA 3OWTA 3Q0WA 1LFBA 2DJIA 1ZELA 3TQNA 4EMSA 2H1LA 2RN7A 4J00A 1AWCA 4EQQA 2LSOA 4Y7NJ 2CMPA 1I1SA 1J7KA 2NS7A 1LDKB 2IGNA 3BDDA 3ZOBA 1IRGA 1VQKI 2E5ZA 3I54A 4IF4A 3MVPA 4BL0B 4BDZA 2CUJA 3HBLA 2UZKA 2Y30A 2XPVA 1YQAA 1O4XA 2HVRA 3CCJI 4U88A 4D7NA 4RLFA 4AVZA 1B72B 2DOEA 4EM0B 4BDYA 2STTA 2QBYA 4OU0A 3BQYA 2PJRA 2VIXA 4CICA 3VSKA 1IAWA 3GEZA 5L3DA 1GUUA 3SQNA 4BHCA 4DJAA 2DMNA 5CYVA 1MNDA 2E5NA 3EUKL 3I5UA 1YHQI 4GYIA 4I0BA 4B43A 2V9KA 3DTEA 1B59A 1IRFA 1V4RA 1GV2A 1UMQA 3FX3A 2A69F 1FY7A 1OCOH 3QOPA 2ISZA 5E3OA 4YELA 1WCMJ 2DPUA 3FF5A 5HDGA 5KHDA 2R7RA 2HDCA 3ZQCA 1B1BA 2M34A 3G1OA 4LD5A 4RS8A 1MSFC 2ESNA 2K86A 3GFJA 3WODF 4JX5A 3R0JA 1HQCA 2R4GA 4LFUA 3BWGA 3SJMA 3EUAA 5EF6A 2Y48A 3MN2A 1OCPA 3F72A 2WADA 3NARA 1EJ9A 2R92J 5TRDA 2FU4A 4EGZA 3GUDA 2RQPA 2E1OA 4E7SA 1DGRM 4GGGA 5F0HA 1Y1WJ 4OIOF 3O2PE 3K9TA 4I76A 3KYLA 4G9YA 2HS5A 1IGNA 3CC7I 1UELB 2HPMA 2DQRA 2XGDA 2IP2A 2CGPA 2DO7A 3OIQA 1SVOA 2PQ8A 2P6SA 3BR0A 1HSTA 4PCQA 1WZ2A 5DDGA 3J80Z 4M72A 1SAUA 3G6EI 2IPQX 4N9HA 3LA3A 1GDTA 3KP5A 4KT5C 3OYLA 3JAMK 2CQQA 2X1DA 5HODA 3V7RA 4IHXA 3M1CA 4UUVA 1Y8QB 4ITVA 1F36A 3RZDJ 2HEOA 3LAPA 3HOZJ 1R58A 3IP4B 2BY0A 3FXJA 4IHYA 3I4PA 3GW2A 3OR1C 4LB5A 4P96A 1JT6A 4DGWB 1ORKA 5LGUA 3AFHA 2FF4A 1IN4A 2ZO4A 1STZA 2IA0A 5J1YA 2KKOA 4ENJA 3H9QA 2VODA 3OIOA 3OYBA 3IHUA 4MFEA 3HXLA 2VONA 2HVQA 2ELHA 2VKVA 2HOSA 2QZ8A 3TDUC 3A01A 1LFUP 5IT9K 2TCTA 1NHAA 2M8GX 4H4KC 5B66C 3AL0B 3HB9A 3OS1A 3AG2H 3CLOA 2GZWA 2L7FP 2ADUA 1QO0D 2M45A 1E17A 4Y4RA 4BH9A 4PGGA 1MBHA 1R7JA 2EB7A 3FMSA 2JK3A 1IRXA 1XG1A 3WTTC 2XIGA 1Q1VA 3DP7A 3SZTA 2LD5A 1D8KA 2OUMA 3V4GA 1YI2I 1TZLA 1EA3A 1YFHA 3KYDB 1KYWA 3CC4I 2IEKA 2X9DA 1VQ7I 3H5NA 2L4AA 4LG3A 3OYGA 1Z91A 2CYYA 2ZSHB 3HPGA 3L2RA 1S9HA 2P5KA 3WTXC 4V19K 2DFHA 2CFXA 4PJNA 3OYAA 1P7IA 1NH3A 2R7DA 1YJNI 2KP6A 1JUSA 2L4MA 4F93B 1E2XA 3P9IA 1FMVA 3C7JA 3CUQB 3TP0A 2KL4A 3WG7H 1W5CC 4BHBA 1MMNA 4AUXA 4YFKF 1K78B 3H5RA 2DPDA 5ICFA 2VQLA 4EJVA 5DS9A 4J19A 1RI7A 2V1XA 4FTHA 1WJCA 3HOXJ 2XPWA 2VUMJ 4IKFA 2QSGX 4XR6A 1Z3YA 1GXPA 1UZCA 1ZGAA 2AO9A 3HG9A 4IEJA 4PSXA 3WGHA 4O3MA 2I8DA 1LE8B 5ED4A 4F91B 4RBOA 2YUSA 4RAZA 5DYMA 2NVXJ 2HI3A 1MMDA 4FETA 2B63J 3HRSA 2DT7B 2IW5A 3P9KA 2XVCA 4HW0A 1OYWA 1FJLA 4PFOA 3Q9SA 3QAHA 1O3SA 1TWCJ 2LKPA 2LF8A 2OU2A 1Z0XA 2CW7A 5D6EA 2VJJA 4I02A 3OS0A 2NS0A 2EILH 4WXHA 4AYBN 4WCGA 1VNDA 1BR4A 3S2WA 1P7JA 3KP7A 4M6VA 2W7NA 1FX7A 2CUEA 4DYRA 3BZ6A 2NVYJ 2VQHA 3RPUA 1BJZA 3CCMI 5GPCA 3VB2A 2VQCA 4Y17A 2BHYA 3GTKJ 3OYDA 5HNFA 2VJ5A 3NRVA 2O9LA 3Q0VA 3CESA 3FWEA 1WH7A 5FRNA 3JRHA 4HX4A 3S16J 2W84A 3GTOJ 2ZXIA 3JRFA 5ICCA 1E0EA 1S7EA 3DKYA 4HF0A 1Y39A 4J01A 5IP9J 1G3WA 5ICEA 2VLAA 3W2VA 4A6EA 4P9FA 2BY1A 2K4BA 2L9SA 2X6WA 5F0CA 1IJWC 1VQMI 4DYCA 1O7FA 5EGOB 2LH9A 2L3DA 4A0XA 2KQRA 1LJ9A 4XLAA 1KONA 5B3SH 1OQYA 1P4AA 2LC2A 4ZYDA 3A02A 4HDUA 3FMRA 4A3IJ 1QVUA 2M9HA 1RR7A 1J2XA 1T33A 2PBIA 1XD7A 4Q47A 2LREA 4F92B 4UHTA 3QPLA 1B6AA 3GCMA 1B4AA 1QGPA 2ZMEC 3ABUA 3EQLF 2P0WA 4HA8A 4AIDA 3CD6I 4E7IA 3E5XA 2WY7Q 2VOPA 5J1UA 4IRGA 1MMSA 5TISC 3QYFA 1Z21A 3JRAA 4U0VA 3L2QA 3CF5F 2P5LC 1FTZA 4CCNA 2HQAA 2KMUA 1S8NA 1XCBA 1QNTA 2L7MP 1YYVA 5F1JA 2RKHA 3FK7A 4MFDA 2R3SA 3J81K 3I4MJ 2OC6A 1U9OA 2NVTJ 1P2FA 1AKHA 5K7ZA 4RAGA 2LBFA 5EEAA 1G8XA 2UXXA 4I99C 3QWLA 3GFLA 3G3ZA 4KICA 4ON0A 1D1BA 2CQ7A 3H0DA 4A3DJ 1WJBA 2EZLA 5ICGA 1XGSA 3HOVJ 3PL8A 1JHFA 3D0SA 4DYQA 2ZKZA 1OCRH 4A93J 2JUGA 2DA1A 3X2QH 1YIJI 1U8RA 1FP1D 1FSHA 1FMWA 4LK0F 2R5ZB 1OJLA 2QA4I 2ACJA 3ZGKA 2P4WA 2PN6A 3ZXSA
chains in the Genus database with same CATH topology
1ULYA 3E6CC 5ILUA 2NNNA 3TOAA 4P9UA 3CO7C 3JW4A 3KFWX 2P5VA 3B02A 2XRNA 4Z2YA 1ZLKA 1XMKA 3WTWC 1HBXG 1EH7A 3MCZA 1SAXA 3F8FA 6PAXA 2WTEA 1BC8C 2XGXA 5D5XB 1OYIA 2IT0A 3F6OA 2A5YB 4L18B 4M9SA 3IWFA 3LAJA 3J80K 2DK8A 1YLFA 2ZMEA 1B9MA 4L9NA 5L3FA 3NEUA 2BEOA 1W7PD 2HTSA 3K1PA 2BBYA 2X0LA 1TQMA 3KLOA 5D8KB 2PLYA 3Q5FA 2FNPA 5E18F 4KN7X 2DFIA 5HLHA 1T0FA 3K0LA 1PUEE 4EM2A 3LA2A 4OMYA 2QYOA 5EEGA 1EV7A 2JPCA 4RGSA 5FB2A 3N97A 5L3EA 3KP4A 4JK1X 2A3SA 2E1CA 1OMIA 5F64A 3V8JA 3K1NA 3WGGA 3E3VA 2COMA 1T2KA 1XCVA 1FBSA 1W7PB 3V7SA 3VFZA 4GXOA 4YG2F 1B9NA 3TGNA 2PEXA 1XGMA 3P9CA 2OZUA 1WKMA 2MBFA 5FD5A 2DU9A 4KMUX 1MJAA 2W24A 2LF7A 4BXUA 1D3YA 2EA2A 3KEQA 2FQ3A 4I0AA 4L0ZB 2PMUA 3KETA 4ESFA 3VEPA 2AS5F 3KE2A 5BPIA 3GLXA 2H6BA 2XASA 4WXCA 3RYPA 4RGXA 3FXQA 1XDSA 3F21A 2YX4A 5JI6A 1SFUA 5E8GA 5ILSA 2ISYA 3HRUA 1BBYA 3ZMZA 2P7VB 2XAQA 2QQBA 4YIIA 4F7ZA 4HLYA 3RTRA 3IKVA 1EH6A 2F5FA 4G94A 3TO7A 5LGNA 1KQ8A 4CYDA 1W5SA 3F6VA 5HS9A 5KK1A 2MH9A 5LRRA 4WX9A 4KUMA 3QU3A 5FO5A 3HHHA 5AONA 1MJ9A 4R1HA 1J75A 2RV8A 4AWXB 1YG2A 4WF2A 5L3BA 1IZ1A 5K5QA 2DI3A 1YS6A 2XV4S 1PP8F 3WG9A 2M87A 4ZYHA 2FNAA 1O3RA 2XUBA 1UFMA 5HDNA 3R4KA 1T39A 4ZYGA 1ZRDA 4Q4ZF 3CTAA 2EA4A 2HFHA 2CSOA 4ASNA 1KU9A 2YPRA 5J8FA 3K1MA 1CF7A 3HIFA 3I59A 4S04A 3MWMA 4LG0B 1UCRA 2DAOA 3E6DA 2HWVA 5CVVA 4M73A 4CXFA 3HUGA 4U7BA 2YX7A 2GA1A 2Y0MA 5DUIA 2B0LA 4M6XA 1JHHA 2JT1A 5LLQA 5CVIA 3U1DA 5HDKA 1GVJA 5E1WA 1G3TA 4KYWA 2IRFG 5D5UB 3F23A 4I98B 3R0AA 2O3FA 5H20A 1FYKA 4HDVA 2DK5A 1LNWA 4B8XA 4ENNA 1HKQA 1FT9A 2L01A 4A5MA 3GX4X 3IC7A 2D45A 2RNJA 3MZYA 1G3YA 2VE9A 2IA1A 1LEBA 2AXLA 2KJBA 1U5TB 3KCCA 4BQAA 5DD4A 2XROA 1DPRA 4G8XA 2RGVA 3DPLC 4M6YA 1RZ4A 1U3EM 2WV0A 1VTNC 4IVNA 1ZG1A 3RI4A 2O03A 5EEHA 1EH8A 1P4XA 2JRTA 3F8BA 3RKWA 4O6JA 1Y0UA 4R8HA 4GO1A 2PFBA 1TQIA 2K4JA 1ZH5A 4EJOA 4LGWA 2BGCA 2GXBA 1FLIA 1FPQA 4MEXF 2A07F 5F6FA 3SFZA 3BPVA 4HBLA 5HOOA 2V79A 3GZ6A 4BYYA 3IWZA 2NYXA 4D0PA 2DQLA 1IN5A 2ZCWA 2OAZA 3E5UA 1R1VA 4G7OF 1RUOA 2HGCA 1ZN2A 1LEAA 2QENA 3M8EA 4EM1A 1KA8A 2A6EF 3HTSB 4AVPA 5D8LB 3L00A 2MH2A 3WE3A 1G6NA 2MA3A 2OD5A 3ZMTA 1BI3A 3HSRA 2JSCA 1DUXC 2V6CA 2TDXA 1UB9A 5DCMB 1IF1A 2FE3A 3BY6A 1TNSA 3WTSC 1USSA 3QP6A 2F5CA 2FEZA 4L9JA 2STWA 1IUYA 3GZ5A 2P7CB 4GYGA 4M9ZA 3MAJA 4A6DA 3WE2A 2QBYB 1ZRFA 5FGMA 2H27A 4I09A 2ZNYA 3HOTA 1GXQA 4EJWA 3B73A 2D1VA 2XAJA 3TOBA 2A68F 1AOYA 4RB1A 3QRFF 3KP2A 1BJAA 3F3XA 2VOOA 2XAHA 1SMTA 4FT8A 3W6KB 4JBAA 3F22A 2BV6A 4P55A 4MTEA 3TKYA 5LBQA 2A61A 3JTGA 1YTYA 3JSOA 4Q48A 2E7WA 3GYHX 2H09A 2O0YA 4IPAA 1TBXA 4DNCA 2ESHA 1Z1DA 1MD0A 1YW9A 4KIBA 4I2OA 4CDGA 1FZPB 3EDPA 3ROUA 3E97A 3QPHA 4O5VA 2C6YA 1WWXA 3EYIA 1Q1HA 3EUHA 2K02A 4HYEA 3IL2A 3KEOA 2CO5A 3DPTA 1FOKA 4YFNF 2EFPA 1USTA 2V9VA 3FXRA 3TDZC 1MKMA 1S7OA 4EVIA 1R5GA 2EV6A 3RKYA 4KDPA 1IN7A 1XGNA 4ZYEA 2FXAA 3U9GA 4KA4A 1L3LA 1QZZA 4RGRA 1ZAOA 3E6MA 2RC4A 4PGHA 1RUNA 2P6TA 2EJRA 2JPBA 5A2QZ 5HVQC 2H6CA 2HKXA 1PDNC 3P7NA 3PFIA 4G7HF 1OKRA 2ZXJA 3EETA 4MNUA 5HLIA 5AIQA 1JGSA 2W85A 3FM5A 3KLNA 3HYIA 2W57A 1ZREA 5CVUA 3F8MA 3I71A 2Q0OA 3HRMA 1BN5A 1MJBA 2LNBA 5DCFA 5DUKA 1G3SA 1FBUA 5DV5A 3F8CA 4LLNA 2HKOA 1U78A 2UWMA 4N9IA 4MGRA 3REOA 1YS7A 5CVJA 4YFXF 4A2UA 2RVCA 1O3QA 1HXDA 2M8EA 1F1ZA 4OINF 1KGSA 2MLGA 3ELKA 3I53A 3ABTA 3KZYA 5AIPA 3AAFA 2MC3A 3LQQA 1SFXA 1TTYA 5H6QA 1OYYA 3GF2A 2XAFA 2M1BA 5DEQA 5E20A 1D8JA 3BP8A 4XLPF 3V8LA 2DW4A 2OBPA 3CUOA 1C0WA 1O57A 2P8TA 4I01A 2EFQA 1MDMA 2IVMA 2OA4A 3R60A 1DDNA 1IXRC 2FRHA 2OQGA 3WTUC 4HAMA 4L0YB 3N4MA 4NQWA 3K2ZA 5LEKA 3L9FA 3WGIA 5K5RA 4XSZF 4QWQA 2HTJA 5D5VB 2VBYA 3BROA 1TQPA 1IXCA 1Z6RA 5BPDA 3DXJF 2WC2A 3SHFA 3DF8A 4CZZA 4HX8A 2H94A 1YIOA 2ZBKA 1UHMA 4LB6B 1XMAA 5ERIA 4FX0A 2F5DA 3T1BA 3GO5A 1GHCA 1IN6A 3NQOA 2HYGD 3ML6A 2CW0F 3TO6A 5E8IA 5D4RA 2EFWA 4HV5A 4XRFA 1S7AA 3LA7A 1TW3A 3GVAA 1FNNA 3CUQC 3M7GA 1HSJA 4Q5SF 3E5QA 2PMHA 2QVOA 3T8TA 1XSVA 1LQ1A 3WTVC 3VODA 4IRHA 3PQJA 2Z33A 2QLZA 3KP6A 3H3UA 3H3ZA 3ZP5A 3I0TA 4WXDA 1F5TA 3V8KA 4UV8A 4XSXF 3RIRA 4LLLA 3BPXA 4EGYA 1ONVA 2ZFWA 1WRJA 3GFIA 4UV9A 1T6SA 2BYVE 3JSPA 4KIFA 2Z99A 1SMYF 2BE5F 4OIQF 3HOSA 5E1XA 1F9NA 2KJCA 1IN8A 5BS6A 5LGTA 3CO6C 3C18A 2FMYA 4DQ2A 1FBQA 2J5OA 3LSTA 2HR3A 4ZZDA 5HLGA 1I5ZA 5LRSA 2FOKA 5D6FA 4G7ZF 1H0MA 3LWFA 1XB4A 4G6QA 1BM9A 5DCMA 3MQ0A 5LHIA 3HHGA 2WWYA 1ZARA 3WU0A 2K7LA 4BAYA 3CUQA 1K7AA 1HW2A 1P92A 1K78A 2Z3YA 1S6LA 5BOXA 4MQVA 4NHJA 1FYMA 3RKXA 1ZG5A 3FHZA 1K79A 1P4WA 2FSWA 2VBXA 2EFNA 4ESBA 3ZN1A 1ZGJA 3ZMSA 1JE8A 2FA5A 1R00A 3HTUA 4MEYF 4HQEA 1CGPA 3WTZA 1SFEA 3IKTA 5FFXA 2PJPA 1Z9CA 1LDDA 2VC0A 2O8XA 5D5WB 4M71A 4A5NA 5JFRA 3J7AO 1I1GA 2J5PA 4M9XA 4HZFA 1WSUA 4H0EA 4WK8F 3L09A 2FBHA 3R6SA 1DPUA 2VBZA 3SZPA 4B09A 3WU1B 1S3JA 2HQNA 4IRIA 1ON1A 1SD7A 3RYRA 5LEJA 3DQVC 4RB0A 2NRAC 4L9VA 2KIMA 1R5HA 1FYLA 3MZHA 2VT2A 3DV8A 1HKSA 1OR7A 1UHWA 5ILVA 4BNCA 1HW5A 3ZMVA 2CWEA 3G73A 2YR2A 1BI0A 1REPC 3C3WA 1R23A 1J5YA 4MHGA 4IXAA 1WI9A 1BI1A 3GXOA 4U7DA 4KNYA 3M1EA 4LK1F 1YO5C 3U2RA 1O3TA 1TLHB 4K2EA 2RDPA 4U0WA 1ZHFA 2W25A 1CF7B 3I59B 4HQMA 1XN7A 3IRRA 3MEXA 4EV0A 1U6GA 2G9WA 2CG4A 2O6GE 4L9TA 3FM3A 4UNOA 1MZBA 4LJZF 2CQKA 1PP7U 2QQ9A 1W4MA 2HYFA 1ZRCA 2V1DA 2D2WA 5CVRA 2KIUA 4ENKA 4KFCA 3O6BB 1KQ0A 2Q8KA 2HQRA 1S29A 4FX4A 3QU6A 4UVBA 4R79A 1K6OA 2QWWA 4A0YA 3GWZA 1HKTA 4UXNA 1XDUA 3ULQB 2QQAA 4ZZLA 1Z7UA 2DLLA 5F1RA 4CHUA 2M5WA 5K5OA 5DD8A 4UVCA 5L3CA 2GXGA 2L02A 3H92A 1Z05A 3RDIA 2PI0A 4WWCA 1L0OC 4I7HA 3M8FA 4HLXA 5FLXZ 1Z6TA 3ISPA 3ECOA 1SD6A 3V7CA 1T38A 2EV5A 2VXZA 1D5VA 2GA2A 4AIKA 5HS8A 4AD9A 2M30A 2E7XA 5BQTA 4HF2A 2MLKA 1FP2A 1ODDA 1X3UA 1LVAA 1BIBA 1FC3A 3ZMDA 1BOAA 3O3KA 4MTDA 1QBJA 3OV8A 2ZNZA 3T8RA 1SD5A 5FD6A 3D5LA 4IJAA 3WTYC 2YU3A 1ZLJA 3T0YA 3HRTA 1IXSB 4S05A 2XKOA 2F2EA 1XSDA 5E17F 3EYYA 1W7PA 1FWZA 5JVTA 3VOEA 1OPCA 4UVAA 3QPTA 1ZG3A 4EJTA 3ZPLA 1KYZA 2VT3A 5IT3A 1IW7F 5D4SA 3I64A 1R22A 1KU2A 2VBWA 1U2WA 2K27A 1MGTA 3RJPA 5E1ZB 2OQRA 4KIGA 4KMFA 3DKWA 5FFZA 4IHTA 1LDJA 4M74A 2NAZA 1LB2A 4XBFA 1YW7A 4ENMA 2ZJ2A 2EK5A 3F8NA 5K1YA 4OIPF 3E6BA 4MQ9F 3C1DA 2GWRA 4HX7A 3TO9A 5JR3A 4QLCU 2EV0A 2NNYA 2PG4A 4L5IA 1J59A 4FHTA 1DP7P 3ZQ7A 1KQ9A 3I58A 2GAUA 4HV6A 4U0YA 3L7WA 5BMZA 1I6XA 4Y13A 1BIAA 3ERED 1U5TC 4OOIA 5CJ9A 2L54A 4HF1A 3FXUA 1QZYA 3JAMZ 3L2CA 1H9GA 4A12A 5LHGA 4CGZA 3LFKA 3Q9VA 4EJUA 3PQKA 2GIVA 3CDHA 2OZ6A 4E70A 2XKPA 5H6RA 1SD4A 3IRQA 2EWNA 2VE8A 2O61A 4Y15A 4GCVA 3LQRA 1HW1A 2JZYA 5IT9Z 1A04A 3BJAA 2JTVA 3HSFA 4ETSA 4HOBA 3JTHA 4LG0A 1R1TA 1WQ2A 1V3FA 1JXSA 2YSRA 2Q2EA 2DTRA 1RIOH 4TV7A 4ZH4F 1XSXA 4RGUA 3DFGA 4YIFA 3SXYA 2G7HA 4JQFA 2Z9OA 3OOPA 3BOQA 5CLSA 4LLGF 3M9AA 2DBBA 2HOEA 4KN4X 1G4DA 5JHUA 5HS7A 2FBKA 5J6XA 1YW8A 3KP3A 2R7FA 2A6HF 3BJOA 4N0BA 1ZYRF 4RB3C 2UXNA 3GFMA 1T98A 1P6RA 2QM3A 1O7LA 1U5TA 1XGOA 1R1UA 2D1HA 3RPQA 2IA2A 2MD5A 4RAYA 3R61A 5TJJA 1J0RA 3ZN0A 2KIFA 1J9IA 4CO8A 2G7UA 1I27A 5FLXK 2Y75A 4P5OA 2DT5A 1W5TA 3CJNA 3QP5A 3ECHA 4PZJA 2VC1A 1TW2A 2X4HA 3HSEA 1QPMA 4PDKA 2E1NA 3W6JB 1R36A 5KVRA 2ZMEB 2QUFA 1F4KA 1ON2A 5L3GA 3FMQA 2GQQA 4AIJA 2IJLA 2V1UA 3KZZA 2EFOA 1BC7C 4ESJA 2F5EA 2LDUA 3ZMUA 1FSEA 4A0ZA 4NB5A 5J8CA 3FZVA 1QQIA 4IHSA 2KRFA 2FMLA 2XAGA 1MDMB 3K69A 2XHKA 3DEUA 4LMYA 3T5XA 4OMZA 1RNLA 5LHHA 4AIHA 2VN2A 4G6DA 1KU7A 4L5JA 1KU3A 4BHPA 2ETHA 5A2QK 2FBIA 1TNTA 2Z5UA 1BI2A 4XLNF 4RB2C 3COAC 3MFKA 3J81Z 2HZTA 3BJ6A 4OIRF 1H9TA 1AWCA 3TQNA 4EMSA 2RN7A 4EQQA 2LSOA 1I1SA 1J7KA 1LDKB 3BDDA 1IRGA 3I54A 4IF4A 2UZKA 1YQAA 4U88A 4EM0B 2STTA 2QBYA 4OU0A 4CICA 1IAWA 3GEZA 5L3DA 3SQNA 4BHCA 5CYVA 3I5UA 4GYIA 4I0BA 1B59A 1IRFA 1V4RA 3FX3A 2A69F 1FY7A 3QOPA 2ISZA 2DPUA 3FF5A 5HDGA 2HDCA 1B1BA 4LD5A 4RS8A 2ESNA 2K86A 3GFJA 3WODF 3R0JA 1HQCA 4LFUA 3BWGA 2Y48A 3F72A 5TRDA 2FU4A 4EGZA 3GUDA 2RQPA 4GGGA 4OIOF 3O2PE 3K9TA 4G9YA 2HS5A 2DQRA 2IP2A 2CGPA 2DO7A 2PQ8A 2P6SA 1HSTA 4PCQA 5DDGA 3J80Z 4M72A 2IPQX 4N9HA 3LA3A 3KP5A 4KT5C 3JAMK 3V7RA 4UUVA 2HEOA 3LAPA 1R58A 3I4PA 3GW2A 4LB5A 4P96A 5LGUA 4ENJA 2FF4A 1IN4A 1STZA 2IA0A 2ZO4A 2KKOA 2VODA 3IHUA 2VONA 2ELHA 5IT9K 2QZ8A 3TDUC 1NHAA 3CLOA 2GZWA 2ADUA 1QO0D 2M45A 1E17A 4BH9A 4PGGA 1R7JA 2EB7A 3FMSA 3WTTC 2XIGA 3DP7A 3SZTA 1D8KA 3V4GA 1YFHA 1KYWA 2L4AA 1Z91A 2CYYA 2P5KA 3WTXC 2CFXA 2R7DA 2L4MA 1E2XA 3P9IA 3C7JA 3CUQB 4BHBA 4YFKF 1K78B 2DPDA 5ICFA 4EJVA 1RI7A 2V1XA 1GXPA 1ZGAA 4O3MA 3WGHA 5ED4A 4RAZA 5DYMA 3HRSA 2IW5A 3P9KA 2XVCA 4HW0A 1OYWA 3Q9SA 3QAHA 1O3SA 2LKPA 2LF8A 2OU2A 5D6EA 4I02A 2NS0A 4WXHA 4WCGA 3S2WA 3KP7A 1FX7A 3BZ6A 3RPUA 3VB2A 4Y17A 3NRVA 3FWEA 4HX4A 2W84A 5ICCA 4HF0A 1G3WA 5ICEA 4A6EA 4P9FA 2K4BA 1O7FA 2L3DA 4A0XA 1LJ9A 4ZYDA 1P4AA 4HDUA 3FMRA 1J2XA 2PBIA 4Q47A 1XD7A 4UHTA 1B6AA 1B4AA 1QGPA 3ABUA 3EQLF 4HA8A 3E5XA 2VOPA 4IRGA 2P5LC 4U0VA 1S8NA 1XCBA 1QNTA 1YYVA 2RKHA 2R3SA 3J81K 1P2FA 2UXXA 3GFLA 3G3ZA 4KICA 4ON0A 5ICGA 1XGSA 1JHFA 3D0SA 2ZKZA 1U8RA 1FP1D 1FSHA 4LK0F 2ACJA 2P4WA 2PN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULY A;  3E6C C;  5ILU A;  2NNN A;  3TOA A;  4P9U A;  3CO7 C;  3JW4 A;  3KFW X;  2P5V A;  3B02 A;  2XRN A;  4Z2Y A;  1ZLK A;  1XMK A;  3WTW C;  1HBX G;  1EH7 A;  3MCZ A;  1SAX A;  3F8F A;  6PAX A;  2WTE A;  1BC8 C;  2XGX A;  5D5X B;  1OYI A;  2IT0 A;  3F6O A;  2A5Y B;  4L18 B;  4M9S A;  3IWF A;  3LAJ A;  3J80 K;  2DK8 A;  1YLF A;  2ZME A;  1B9M A;  4L9N A;  5L3F A;  3NEU A;  2BEO A;  1W7P D;  2HTS A;  3K1P A;  2BBY A;  2X0L A;  1TQM A;  3KLO A;  5D8K B;  2PLY A;  3Q5F A;  2FNP A;  5E18 F;  4KN7 X;  2DFI A;  5HLH A;  1T0F A;  3K0L A;  1PUE E;  4EM2 A;  3LA2 A;  4OMY A;  2QYO A;  5EEG A;  1EV7 A;  2JPC A;  4RGS A;  5FB2 A;  3N97 A;  5L3E A;  3KP4 A;  4JK1 X;  2A3S A;  2E1C A;  1OMI A;  5F64 A;  3V8J A;  3K1N A;  3WGG A;  3E3V A;  2COM A;  1T2K A;  1XCV A;  1FBS A;  1W7P B;  3V7S A;  3VFZ A;  4GXO A;  4YG2 F;  1B9N A;  3TGN A;  2PEX A;  1XGM A;  3P9C A;  2OZU A;  1WKM A;  2MBF A;  5FD5 A;  2DU9 A;  4KMU X;  1MJA A;  2W24 A;  2LF7 A;  4BXU A;  1D3Y A;  2EA2 A;  3KEQ A;  2FQ3 A;  4I0A A;  4L0Z B;  2PMU A;  3KET A;  4ESF A;  3VEP A;  2AS5 F;  3KE2 A;  5BPI A;  3GLX A;  2H6B A;  2XAS A;  4WXC A;  3RYP A;  4RGX A;  3FXQ A;  1XDS A;  3F21 A;  2YX4 A;  5JI6 A;  1SFU A;  5E8G A;  5ILS A;  2ISY A;  3HRU A;  1BBY A;  3ZMZ A;  2P7V B;  2XAQ A;  2QQB A;  4YII A;  4F7Z A;  4HLY A;  3RTR A;  3IKV A;  1EH6 A;  2F5F A;  4G94 A;  3TO7 A;  5LGN A;  1KQ8 A;  4CYD A;  1W5S A;  3F6V A;  5HS9 A;  5KK1 A;  2MH9 A;  5LRR A;  4WX9 A;  4KUM A;  3QU3 A;  5FO5 A;  3HHH A;  5AON A;  1MJ9 A;  4R1H A;  1J75 A;  2RV8 A;  4AWX B;  1YG2 A;  4WF2 A;  5L3B A;  1IZ1 A;  5K5Q A;  2DI3 A;  1YS6 A;  2XV4 S;  1PP8 F;  3WG9 A;  2M87 A;  4ZYH A;  2FNA A;  1O3R A;  2XUB A;  1UFM A;  5HDN A;  3R4K A;  1T39 A;  4ZYG A;  1ZRD A;  4Q4Z F;  3CTA A;  2EA4 A;  2HFH A;  2CSO A;  4ASN A;  1KU9 A;  2YPR A;  5J8F A;  3K1M A;  1CF7 A;  3HIF A;  3I59 A;  4S04 A;  3MWM A;  4LG0 B;  1UCR A;  2DAO A;  3E6D A;  2HWV A;  5CVV A;  4M73 A;  4CXF A;  3HUG A;  4U7B A;  2YX7 A;  2GA1 A;  2Y0M A;  5DUI A;  2B0L A;  4M6X A;  1JHH A;  2JT1 A;  5LLQ A;  5CVI A;  3U1D A;  5HDK A;  1GVJ A;  5E1W A;  1G3T A;  4KYW A;  2IRF G;  5D5U B;  3F23 A;  4I98 B;  3R0A A;  2O3F A;  5H20 A;  1FYK A;  4HDV A;  2DK5 A;  1LNW A;  4B8X A;  4ENN A;  1HKQ A;  1FT9 A;  2L01 A;  4A5M A;  3GX4 X;  3IC7 A;  2D45 A;  2RNJ A;  3MZY A;  1G3Y A;  2VE9 A;  2IA1 A;  1LEB A;  2AXL A;  2KJB A;  1U5T B;  3KCC A;  4BQA A;  5DD4 A;  2XRO A;  1DPR A;  4G8X A;  2RGV A;  3DPL C;  4M6Y A;  1RZ4 A;  1U3E M;  2WV0 A;  1VTN C;  4IVN A;  1ZG1 A;  3RI4 A;  2O03 A;  5EEH A;  1EH8 A;  1P4X A;  2JRT A;  3F8B A;  3RKW A;  4O6J A;  1Y0U A;  4R8H A;  4GO1 A;  2PFB A;  1TQI A;  2K4J A;  1ZH5 A;  4EJO A;  4LGW A;  2BGC A;  2GXB A;  1FLI A;  1FPQ A;  4MEX F;  2A07 F;  5F6F A;  3SFZ A;  3BPV A;  4HBL A;  5HOO A;  2V79 A;  3GZ6 A;  4BYY A;  3IWZ A;  2NYX A;  4D0P A;  2DQL A;  1IN5 A;  2ZCW A;  2OAZ A;  3E5U A;  1R1V A;  4G7O F;  1RUO A;  2HGC A;  1ZN2 A;  1LEA A;  2QEN A;  3M8E A;  4EM1 A;  1KA8 A;  2A6E F;  3HTS B;  4AVP A;  5D8L B;  3L00 A;  2MH2 A;  3WE3 A;  1G6N A;  2MA3 A;  2OD5 A;  3ZMT A;  1BI3 A;  3HSR A;  2JSC A;  1DUX C;  2V6C A;  2TDX A;  1UB9 A;  5DCM B;  1IF1 A;  2FE3 A;  3BY6 A;  1TNS A;  3WTS C;  1USS A;  3QP6 A;  2F5C A;  2FEZ A;  4L9J A;  2STW A;  1IUY A;  3GZ5 A;  2P7C B;  4GYG A;  4M9Z A;  3MAJ A;  4A6D A;  3WE2 A;  2QBY B;  1ZRF A;  5FGM A;  2H27 A;  4I09 A;  2ZNY A;  3HOT A;  1GXQ A;  4EJW A;  3B73 A;  2D1V A;  2XAJ A;  3TOB A;  2A68 F;  1AOY A;  4RB1 A;  3QRF F;  3KP2 A;  1BJA A;  3F3X A;  2VOO A;  2XAH A;  1SMT A;  4FT8 A;  3W6K B;  4JBA A;  3F22 A;  2BV6 A;  4P55 A;  4MTE A;  3TKY A;  5LBQ A;  2A61 A;  3JTG A;  1YTY A;  3JSO A;  4Q48 A;  2E7W A;  3GYH X;  2H09 A;  2O0Y A;  4IPA A;  1TBX A;  4DNC A;  2ESH A;  1Z1D A;  1MD0 A;  1YW9 A;  4KIB A;  4I2O A;  4CDG A;  1FZP B;  3EDP A;  3ROU A;  3E97 A;  3QPH A;  4O5V A;  2C6Y A;  1WWX A;  3EYI A;  1Q1H A;  3EUH A;  2K02 A;  4HYE A;  3IL2 A;  3KEO A;  2CO5 A;  3DPT A;  1FOK A;  4YFN F;  2EFP A;  1UST A;  2V9V A;  3FXR A;  3TDZ C;  1MKM A;  1S7O A;  4EVI A;  1R5G A;  2EV6 A;  3RKY A;  4KDP A;  1IN7 A;  1XGN A;  4ZYE A;  2FXA A;  3U9G A;  4KA4 A;  1L3L A;  1QZZ A;  4RGR A;  1ZAO A;  3E6M A;  2RC4 A;  4PGH A;  1RUN A;  2P6T A;  2EJR A;  2JPB A;  5A2Q Z;  5HVQ C;  2H6C A;  2HKX A;  1PDN C;  3P7N A;  3PFI A;  4G7H F;  1OKR A;  2ZXJ A;  3EET A;  4MNU A;  5HLI A;  5AIQ A;  1JGS A;  2W85 A;  3FM5 A;  3KLN A;  3HYI A;  2W57 A;  1ZRE A;  5CVU A;  3F8M A;  3I71 A;  2Q0O A;  3HRM A;  1BN5 A;  1MJB A;  2LNB A;  5DCF A;  5DUK A;  1G3S A;  1FBU A;  5DV5 A;  3F8C A;  4LLN A;  2HKO A;  1U78 A;  2UWM A;  4N9I A;  4MGR A;  3REO A;  1YS7 A;  5CVJ A;  4YFX F;  4A2U A;  2RVC A;  1O3Q A;  1HXD A;  2M8E A;  1F1Z A;  4OIN F;  1KGS A;  2MLG A;  3ELK A;  3I53 A;  3ABT A;  3KZY A;  5AIP A;  3AAF A;  2MC3 A;  3LQQ A;  1SFX A;  1TTY A;  5H6Q A;  1OYY A;  3GF2 A;  2XAF A;  2M1B A;  5DEQ A;  5E20 A;  1D8J A;  3BP8 A;  4XLP F;  3V8L A;  2DW4 A;  2OBP A;  3CUO A;  1C0W A;  1O57 A;  2P8T A;  4I01 A;  2EFQ A;  1MDM A;  2IVM A;  2OA4 A;  3R60 A;  1DDN A;  1IXR C;  2FRH A;  2OQG A;  3WTU C;  4HAM A;  4L0Y B;  3N4M A;  4NQW A;  3K2Z A;  5LEK A;  3L9F A;  3WGI A;  5K5R A;  4XSZ F;  4QWQ A;  2HTJ A;  5D5V B;  2VBY A;  3BRO A;  1TQP A;  1IXC A;  1Z6R A;  5BPD A;  3DXJ F;  2WC2 A;  3SHF A;  3DF8 A;  4CZZ A;  4HX8 A;  2H94 A;  1YIO A;  2ZBK A;  1UHM A;  4LB6 B;  1XMA A;  5ERI A;  4FX0 A;  2F5D A;  3T1B A;  3GO5 A;  1GHC A;  1IN6 A;  3NQO A;  2HYG D;  3ML6 A;  2CW0 F;  3TO6 A;  5E8I A;  5D4R A;  2EFW A;  4HV5 A;  4XRF A;  1S7A A;  3LA7 A;  1TW3 A;  3GVA A;  1FNN A;  3CUQ C;  3M7G A;  1HSJ A;  4Q5S F;  3E5Q A;  2PMH A;  2QVO A;  3T8T A;  1XSV A;  1LQ1 A;  3WTV C;  3VOD A;  4IRH A;  3PQJ A;  2Z33 A;  2QLZ A;  3KP6 A;  3H3U A;  3H3Z A;  3ZP5 A;  3I0T A;  4WXD A;  1F5T A;  3V8K A;  4UV8 A;  4XSX F;  3RIR A;  4LLL A;  3BPX A;  4EGY A;  1ONV A;  2ZFW A;  1WRJ A;  3GFI A;  4UV9 A;  1T6S A;  2BYV E;  3JSP A;  4KIF A;  2Z99 A;  1SMY F;  2BE5 F;  4OIQ F;  3HOS A;  5E1X A;  1F9N A;  2KJC A;  1IN8 A;  5BS6 A;  5LGT A;  3CO6 C;  3C18 A;  2FMY A;  4DQ2 A;  1FBQ A;  2J5O A;  3LST A;  2HR3 A;  4ZZD A;  5HLG A;  1I5Z A;  5LRS A;  2FOK A;  5D6F A;  4G7Z F;  1H0M A;  3LWF A;  1XB4 A;  4G6Q A;  1BM9 A;  5DCM A;  3MQ0 A;  5LHI A;  3HHG A;  2WWY A;  1ZAR A;  3WU0 A;  2K7L A;  4BAY A;  3CUQ A;  1K7A A;  1HW2 A;  1P92 A;  1K78 A;  2Z3Y A;  1S6L A;  5BOX A;  4MQV A;  4NHJ A;  1FYM A;  3RKX A;  1ZG5 A;  3FHZ A;  1K79 A;  1P4W A;  2FSW A;  2VBX A;  2EFN A;  4ESB A;  3ZN1 A;  1ZGJ A;  3ZMS A;  1JE8 A;  2FA5 A;  1R00 A;  3HTU A;  4MEY F;  4HQE A;  1CGP A;  3WTZ A;  1SFE A;  3IKT A;  5FFX A;  2PJP A;  1Z9C A;  1LDD A;  2VC0 A;  2O8X A;  5D5W B;  4M71 A;  4A5N A;  5JFR A;  3J7A O;  1I1G A;  2J5P A;  4M9X A;  4HZF A;  1WSU A;  4H0E A;  4WK8 F;  3L09 A;  2FBH A;  3R6S A;  1DPU A;  2VBZ A;  3SZP A;  4B09 A;  3WU1 B;  1S3J A;  2HQN A;  4IRI A;  1ON1 A;  1SD7 A;  3RYR A;  5LEJ A;  3DQV C;  4RB0 A;  2NRA C;  4L9V A;  2KIM A;  1R5H A;  1FYL A;  3MZH A;  2VT2 A;  3DV8 A;  1HKS A;  1OR7 A;  1UHW A;  5ILV A;  4BNC A;  1HW5 A;  3ZMV A;  2CWE A;  3G73 A;  2YR2 A;  1BI0 A;  1REP C;  3C3W A;  1R23 A;  1J5Y A;  4MHG A;  4IXA A;  1WI9 A;  1BI1 A;  3GXO A;  4U7D A;  4KNY A;  3M1E A;  4LK1 F;  1YO5 C;  3U2R A;  1O3T A;  1TLH B;  4K2E A;  2RDP A;  4U0W A;  1ZHF A;  2W25 A;  1CF7 B;  3I59 B;  4HQM A;  1XN7 A;  3IRR A;  3MEX A;  4EV0 A;  1U6G A;  2G9W A;  2CG4 A;  2O6G E;  4L9T A;  3FM3 A;  4UNO A;  1MZB A;  4LJZ F;  2CQK A;  1PP7 U;  2QQ9 A;  1W4M A;  2HYF A;  1ZRC A;  2V1D A;  2D2W A;  5CVR A;  2KIU A;  4ENK A;  4KFC A;  3O6B B;  1KQ0 A;  2Q8K A;  2HQR A;  1S29 A;  4FX4 A;  3QU6 A;  4UVB A;  4R79 A;  1K6O A;  2QWW A;  4A0Y A;  3GWZ A;  1HKT A;  4UXN A;  1XDU A;  3ULQ B;  2QQA A;  4ZZL A;  1Z7U A;  2DLL A;  5F1R A;  4CHU A;  2M5W A;  5K5O A;  5DD8 A;  4UVC A;  5L3C A;  2GXG A;  2L02 A;  3H92 A;  1Z05 A;  3RDI A;  2PI0 A;  4WWC A;  1L0O C;  4I7H A;  3M8F A;  4HLX A;  5FLX Z;  1Z6T A;  3ISP A;  3ECO A;  1SD6 A;  3V7C A;  1T38 A;  2EV5 A;  2VXZ A;  1D5V A;  2GA2 A;  4AIK A;  5HS8 A;  4AD9 A;  2M30 A;  2E7X A;  5BQT A;  4HF2 A;  2MLK A;  1FP2 A;  1ODD A;  1X3U A;  1LVA A;  1BIB A;  1FC3 A;  3ZMD A;  1BOA A;  3O3K A;  4MTD A;  1QBJ A;  3OV8 A;  2ZNZ A;  3T8R A;  1SD5 A;  5FD6 A;  3D5L A;  4IJA A;  3WTY C;  2YU3 A;  1ZLJ A;  3T0Y A;  3HRT A;  1IXS B;  4S05 A;  2XKO A;  2F2E A;  1XSD A;  5E17 F;  3EYY A;  1W7P A;  1FWZ A;  5JVT A;  3VOE A;  1OPC A;  4UVA A;  3QPT A;  1ZG3 A;  4EJT A;  3ZPL A;  1KYZ A;  2VT3 A;  5IT3 A;  1IW7 F;  5D4S A;  3I64 A;  1R22 A;  1KU2 A;  2VBW A;  1U2W A;  2K27 A;  1MGT A;  3RJP A;  5E1Z B;  2OQR A;  4KIG A;  4KMF A;  3DKW A;  5FFZ A;  4IHT A;  1LDJ A;  4M74 A;  2NAZ A;  1LB2 A;  4XBF A;  1YW7 A;  4ENM A;  2ZJ2 A;  2EK5 A;  3F8N A;  5K1Y A;  4OIP F;  3E6B A;  4MQ9 F;  3C1D A;  2GWR A;  4HX7 A;  3TO9 A;  5JR3 A;  4QLC U;  2EV0 A;  2NNY A;  2PG4 A;  4L5I A;  1J59 A;  4FHT A;  1DP7 P;  3ZQ7 A;  1KQ9 A;  3I58 A;  2GAU A;  4HV6 A;  4U0Y A;  3L7W A;  5BMZ A;  1I6X A;  4Y13 A;  1BIA A;  3ERE D;  1U5T C;  4OOI A;  5CJ9 A;  2L54 A;  4HF1 A;  3FXU A;  1QZY A;  3JAM Z;  3L2C A;  1H9G A;  4A12 A;  5LHG A;  4CGZ A;  3LFK A;  3Q9V A;  4EJU A;  3PQK A;  2GIV A;  3CDH A;  2OZ6 A;  4E70 A;  2XKP A;  5H6R A;  1SD4 A;  3IRQ A;  2EWN A;  2VE8 A;  2O61 A;  4Y15 A;  4GCV A;  3LQR A;  1HW1 A;  2JZY A;  5IT9 Z;  1A04 A;  3BJA A;  2JTV A;  3HSF A;  4ETS A;  4HOB A;  3JTH A;  4LG0 A;  1R1T A;  1WQ2 A;  1V3F A;  1JXS A;  2YSR A;  2Q2E A;  2DTR A;  1RIO H;  4TV7 A;  4ZH4 F;  1XSX A;  4RGU A;  3DFG A;  4YIF A;  3SXY A;  2G7H A;  4JQF A;  2Z9O A;  3OOP A;  3BOQ A;  5CLS A;  4LLG F;  3M9A A;  2DBB A;  2HOE A;  4KN4 X;  1G4D A;  5JHU A;  5HS7 A;  2FBK A;  5J6X A;  1YW8 A;  3KP3 A;  2R7F A;  2A6H F;  3BJO A;  4N0B A;  1ZYR F;  4RB3 C;  2UXN A;  3GFM A;  1T98 A;  1P6R A;  2QM3 A;  1O7L A;  1U5T A;  1XGO A;  1R1U A;  2D1H A;  3RPQ A;  2IA2 A;  2MD5 A;  4RAY A;  3R61 A;  5TJJ A;  1J0R A;  3ZN0 A;  2KIF A;  1J9I A;  4CO8 A;  2G7U A;  1I27 A;  5FLX K;  2Y75 A;  4P5O A;  2DT5 A;  1W5T A;  3CJN A;  3QP5 A;  3ECH A;  4PZJ A;  2VC1 A;  1TW2 A;  2X4H A;  3HSE A;  1QPM A;  4PDK A;  2E1N A;  3W6J B;  1R36 A;  5KVR A;  2ZME B;  2QUF A;  1F4K A;  1ON2 A;  5L3G A;  3FMQ A;  2GQQ A;  4AIJ A;  2IJL A;  2V1U A;  3KZZ A;  2EFO A;  1BC7 C;  4ESJ A;  2F5E A;  2LDU A;  3ZMU A;  1FSE A;  4A0Z A;  4NB5 A;  5J8C A;  3FZV A;  1QQI A;  4IHS A;  2KRF A;  2FML A;  2XAG A;  1MDM B;  3K69 A;  2XHK A;  3DEU A;  4LMY A;  3T5X A;  4OMZ A;  1RNL A;  5LHH A;  4AIH A;  2VN2 A;  4G6D A;  1KU7 A;  4L5J A;  1KU3 A;  4BHP A;  2ETH A;  5A2Q K;  2FBI A;  1TNT A;  2Z5U A;  1BI2 A;  4XLN F;  4RB2 C;  3COA C;  3MFK A;  3J81 Z;  2HZT A;  3BJ6 A;  4OIR F;  1H9T A;  1AWC A;  3TQN A;  4EMS A;  2RN7 A;  4EQQ A;  2LSO A;  1I1S A;  1J7K A;  1LDK B;  3BDD A;  1IRG A;  3I54 A;  4IF4 A;  2UZK A;  1YQA A;  4U88 A;  4EM0 B;  2STT A;  2QBY A;  4OU0 A;  4CIC A;  1IAW A;  3GEZ A;  5L3D A;  3SQN A;  4BHC A;  5CYV A;  3I5U A;  4GYI A;  4I0B A;  1B59 A;  1IRF A;  1V4R A;  3FX3 A;  2A69 F;  1FY7 A;  3QOP A;  2ISZ A;  2DPU A;  3FF5 A;  5HDG A;  2HDC A;  1B1B A;  4LD5 A;  4RS8 A;  2ESN A;  2K86 A;  3GFJ A;  3WOD F;  3R0J A;  1HQC A;  4LFU A;  3BWG A;  2Y48 A;  3F72 A;  5TRD A;  2FU4 A;  4EGZ A;  3GUD A;  2RQP A;  4GGG A;  4OIO F;  3O2P E;  3K9T A;  4G9Y A;  2HS5 A;  2DQR A;  2IP2 A;  2CGP A;  2DO7 A;  2PQ8 A;  2P6S A;  1HST A;  4PCQ A;  5DDG A;  3J80 Z;  4M72 A;  2IPQ X;  4N9H A;  3LA3 A;  3KP5 A;  4KT5 C;  3JAM K;  3V7R A;  4UUV A;  2HEO A;  3LAP A;  1R58 A;  3I4P A;  3GW2 A;  4LB5 A;  4P96 A;  5LGU A;  4ENJ A;  2FF4 A;  1IN4 A;  1STZ A;  2IA0 A;  2ZO4 A;  2KKO A;  2VOD A;  3IHU A;  2VON A;  2ELH A;  5IT9 K;  2QZ8 A;  3TDU C;  1NHA A;  3CLO A;  2GZW A;  2ADU A;  1QO0 D;  2M45 A;  1E17 A;  4BH9 A;  4PGG A;  1R7J A;  2EB7 A;  3FMS A;  3WTT C;  2XIG A;  3DP7 A;  3SZT A;  1D8K A;  3V4G A;  1YFH A;  1KYW A;  2L4A A;  1Z91 A;  2CYY A;  2P5K A;  3WTX C;  2CFX A;  2R7D A;  2L4M A;  1E2X A;  3P9I A;  3C7J A;  3CUQ B;  4BHB A;  4YFK F;  1K78 B;  2DPD A;  5ICF A;  4EJV A;  1RI7 A;  2V1X A;  1GXP A;  1ZGA A;  4O3M A;  3WGH A;  5ED4 A;  4RAZ A;  5DYM A;  3HRS A;  2IW5 A;  3P9K A;  2XVC A;  4HW0 A;  1OYW A;  3Q9S A;  3QAH A;  1O3S A;  2LKP A;  2LF8 A;  2OU2 A;  5D6E A;  4I02 A;  2NS0 A;  4WXH A;  4WCG A;  3S2W A;  3KP7 A;  1FX7 A;  3BZ6 A;  3RPU A;  3VB2 A;  4Y17 A;  3NRV A;  3FWE A;  4HX4 A;  2W84 A;  5ICC A;  4HF0 A;  1G3W A;  5ICE A;  4A6E A;  4P9F A;  2K4B A;  1O7F A;  2L3D A;  4A0X A;  1LJ9 A;  4ZYD A;  1P4A A;  4HDU A;  3FMR A;  1J2X A;  2PBI A;  4Q47 A;  1XD7 A;  4UHT A;  1B6A A;  1B4A A;  1QGP A;  3ABU A;  3EQL F;  4HA8 A;  3E5X A;  2VOP A;  4IRG A;  2P5L C;  4U0V A;  1S8N A;  1XCB A;  1QNT A;  1YYV A;  2RKH A;  2R3S A;  3J81 K;  1P2F A;  2UXX A;  3GFL A;  3G3Z A;  4KIC A;  4ON0 A;  5ICG A;  1XGS A;  1JHF A;  3D0S A;  2ZKZ A;  1U8R A;  1FP1 D;  1FSH A;  4LK0 F;  2ACJ A;  2P4W A;  2PN6 A; 
#chains in the Genus database with same CATH topology
 1ULY A;  1XC5 A;  2HNH A;  4B1R A;  3E6C C;  5ILU A;  1HLV A;  2NNN A;  3TOA A;  2GLO A;  4S0H B;  4P9U A;  2K40 A;  5FKN A;  3CO7 C;  3SFI A;  3JW4 A;  2W1O A;  2JJ7 A;  3VYU B;  2ZSI B;  3KFW X;  3TW6 A;  2P5V A;  2XGE A;  3B02 A;  2XRN A;  1BA5 A;  4MLO A;  1A6Q A;  1LUJ B;  4Z2Y A;  1ZLK A;  1XMK A;  5IYD J;  3WTW C;  4PUS A;  1HBX G;  2KPM A;  1EH7 A;  2EIN H;  3MCZ A;  4NC8 A;  1W36 C;  2VPL A;  5BNG A;  4RM3 A;  1SAX A;  3L1P A;  3F8F A;  6PAX A;  2CFO A;  1K4S A;  2KZG A;  3HM5 A;  2WTE A;  4PJJ A;  1BC8 C;  2XGX A;  2ZFU A;  3BR3 A;  3S17 J;  1LFP A;  5D5X B;  1OYI A;  2W82 A;  1S5L C;  1A5J A;  2IT0 A;  3DPU A;  2X1E A;  3F6O A;  2A5Y B;  2R7X A;  2WV1 A;  4L18 B;  1HDD C;  3P5J A;  4M9S A;  1WHU A;  5K7H A;  2E71 A;  4IHW A;  2HYJ A;  2FJ1 A;  3IWF A;  3LAJ A;  1S72 I;  3J80 K;  2DK8 A;  1YLF A;  2ZME A;  1B9M A;  2R7O A;  4L9N A;  3OYN A;  2Y9Y A;  5L3F A;  2OV7 A;  2KDZ A;  3ZCO A;  4OAZ A;  3NEU A;  1RC9 A;  1D0Z A;  1W7P D;  2BEO A;  2HTS A;  2VJI A;  1Z77 A;  5J4V A;  2CUZ A;  3K1P A;  3L2V A;  2XF6 A;  2BBY A;  1TP4 A;  2X0L A;  1V5E A;  4NDL A;  1TQM A;  3KLO A;  5D8K B;  2PLY A;  1QHH D;  3Q5F A;  2W00 A;  2FNP A;  2NOJ B;  4IO9 F;  3GLL A;  5E18 F;  4KN7 X;  1SC7 A;  3CMY A;  3HDD A;  2DFI A;  5HLH A;  1T0F A;  3K0L A;  1PUE E;  3MMY B;  4II2 A;  4XK4 A;  4EM2 A;  3LA2 A;  4OMY A;  2QYO A;  5EEG A;  1XS9 A;  4ABZ A;  2PMZ N;  5IYC J;  1EV7 A;  2IGM A;  2JPC A;  2UUZ A;  4RGS A;  3FIS A;  2QKM B;  5FB2 A;  3N97 A;  5L3E A;  1ZTR A;  2ICW G;  3HEF A;  3KP4 A;  1IO2 A;  2B9S A;  3LSH A;  2XAU A;  4JK1 X;  2A3S A;  2E1C A;  1OMI A;  1Y56 A;  5F64 A;  5FKL A;  1X3W B;  3V8J A;  3K1N A;  3WGG A;  3E0J B;  3E3V A;  4D5F A;  1IV8 A;  4G6T B;  2R7U A;  2COM A;  3I3L A;  1T2K A;  1XCV A;  1FBS A;  1W7P B;  2VI6 A;  3V7S A;  3VFZ A;  5E3M A;  4GXO A;  5B5E C;  4YG2 F;  1TL8 A;  3B6A A;  1B9N A;  2EBI A;  2PEX A;  3TGN A;  1YRN A;  1XGM A;  3P9C A;  2OZU A;  1WKM A;  4JP0 A;  2MBF A;  5FD5 A;  5GAH J;  3AL0 C;  2DU9 A;  1E3P A;  2A05 A;  4V2F A;  2M7B A;  4KMU X;  3CMM A;  1MJA A;  2W24 A;  2LF7 A;  1PUF A;  3PO2 J;  4BXU A;  1D3Y A;  2EA2 A;  2F4M B;  3KEQ A;  4CYC B;  4QPO A;  2FQ3 A;  2MD0 A;  4I0A A;  1VQ8 I;  4L0Z B;  4KJZ A;  3MKY B;  2GXA A;  2PMU A;  3H36 A;  2KLO A;  3KET A;  4ESF A;  2EQR A;  3VEP A;  2AS5 F;  1B8I B;  5JLW A;  3KE2 A;  5BPI A;  2CV2 A;  2P81 A;  1PJR A;  3GLX A;  2H6B A;  2XAS A;  4V2G A;  4WXC A;  5IYB J;  2WBM A;  3RYP A;  2QSH X;  2XPU A;  4RGX A;  3FXQ A;  1XDS A;  3F21 A;  2YX4 A;  3JRE A;  1IDZ A;  5JI6 A;  5GPA A;  4A3K J;  1TC3 C;  3JRG A;  2FOW A;  4CCJ A;  3WHC A;  2G0E A;  1SFU A;  1DQU A;  1MBE A;  5E8G A;  5ILS A;  2ISY A;  3CC2 I;  3HRU A;  1BBY A;  1ETW A;  3H9J A;  3ZMZ A;  3HZJ A;  1D1C A;  2P7V B;  2XAQ A;  4D1Q A;  2QQB A;  2E19 A;  1SVM A;  4YII A;  3ZQF A;  4F7Z A;  3RTR A;  4HLY A;  4E7K A;  3IKV A;  3RSN A;  2K3P A;  4UUS B;  3S15 J;  1EH6 A;  2F5F A;  5EYR A;  4G94 A;  3TO7 A;  5LGN A;  1KQ8 A;  4CYD A;  1W5S A;  1UG0 A;  3F6V A;  5HS9 A;  5KK1 A;  3ZQH A;  1R71 A;  1K83 J;  4OWR B;  2MH9 A;  3OYF A;  5LRR A;  4WX9 A;  4W1U A;  4KUM A;  3QU3 A;  5FO5 A;  3HHH A;  5AON A;  4BS9 A;  1MJ9 A;  1OLT A;  4R1H A;  3FK6 A;  1J75 A;  2RV8 A;  4AWX B;  1U0J A;  4II3 A;  1YG2 A;  4WF2 A;  5L3B A;  3KYC B;  3FXO A;  1IZ1 A;  5K5Q A;  2DI3 A;  2LMD A;  1YS6 A;  2IS1 A;  1X1C A;  3DCF A;  2XV4 S;  3QOE A;  1PP8 F;  1GLN A;  3WG9 A;  2KT0 A;  2M87 A;  4ZYH A;  2X85 A;  3PSI A;  2FNA A;  2V7F A;  4B44 A;  3J7A Y;  1O3R A;  2XUB A;  1UFM A;  5HDN A;  1YOV B;  1K6Y A;  1V5F A;  2GOX B;  5F08 A;  4IOA F;  3R4K A;  1T39 A;  2LVS A;  4ZYG A;  1WGX A;  1ZRD A;  4Q4Z F;  5GAG J;  2L9R A;  3CTA A;  5FKM A;  2EA4 A;  1BOB A;  3SDG A;  3H1C A;  2HFH A;  2CSO A;  3S3N A;  2EZI A;  4ASN A;  3CCV I;  1OFC X;  1KU9 A;  2YPR A;  1SVL A;  4XMY A;  3PFY A;  5J8F A;  2VKE A;  4A3J J;  3K1M A;  1CF7 A;  2L7Z A;  2R5Y A;  3HIF A;  3I59 A;  3M07 A;  4S04 A;  3MWM A;  3UR3 C;  4LG0 B;  1VQN I;  1UCR A;  2DAO A;  4X0G A;  3E6D A;  2HWV A;  5CVV A;  4M73 A;  2Q2E B;  3HUG A;  4CXF A;  4U7B A;  2YX7 A;  2GA1 A;  2Y0M A;  4XM3 A;  5DUI A;  2B0L A;  4M6X A;  1JHH A;  4GDF A;  3IAS 2;  2JT1 A;  5LFA A;  5LLQ A;  5CVI A;  3U1D A;  5HDK A;  1GVJ A;  3ABL H;  1JJ8 C;  4DZP A;  4C2M J;  5E1W A;  2K9L A;  1G3T A;  5J1R A;  4KYW A;  4N4O B;  2ZJR F;  1NK2 P;  3CMA I;  4E6K G;  2IRF G;  5D5U B;  3RKQ A;  3F23 A;  2IGK A;  4I98 B;  3CZ6 A;  3R0A A;  2O3F A;  1I50 J;  5H20 A;  2E2I J;  4PJ0 C;  4BUP A;  4F55 A;  4HDV A;  3BCA A;  1FYK A;  2DK5 A;  1LNW A;  4B8X A;  4ENN A;  1HKQ A;  1FT9 A;  1ETY A;  2L01 A;  4UUT A;  4A5M A;  3GX4 X;  1VI0 A;  2BVM A;  3IC7 A;  3FBN B;  3CP2 A;  3OYM A;  2D45 A;  3TBI A;  2RNJ A;  4HEA 2;  4XOP A;  5EG0 B;  4IOC F;  3MZY A;  1G3Y A;  2MGQ A;  2ZXH A;  1YX3 A;  2IA1 A;  3MKZ A;  2VE9 A;  1AU7 A;  4XLF A;  1LEB A;  2AXL A;  2KJB A;  1U5T B;  3KCC A;  3LMM A;  3O8H A;  1H88 C;  4BQA A;  5DD4 A;  2NVU B;  2XRO A;  2MAB A;  1DPR A;  2BW3 A;  4G8X A;  2RGV A;  5FRM A;  4NC6 A;  3DPL C;  1HCR A;  3PJR A;  2MC4 A;  1ZR4 A;  4M6Y A;  1RZ4 A;  1U3E M;  2WV0 A;  1VTN C;  1JUM A;  4IVN A;  1ZG1 A;  1ZR2 A;  1QA6 A;  3FXK A;  3RI4 A;  1ETK A;  2O03 A;  5EEH A;  1H8A C;  1EH8 A;  3S2H J;  4XN3 A;  3AG4 H;  2X6Y A;  1P4X A;  2JRT A;  2M4K A;  3F8B A;  3RKW A;  1WH5 A;  4O6J A;  1Y0U A;  4R8H A;  3G4S I;  4GO1 A;  2DXI A;  2PFB A;  3CJQ B;  3VWB A;  1XMX A;  5M5Y J;  4C3I J;  1TQI A;  1Y8R B;  2K4J A;  1ZH5 A;  3SZG A;  4EJO A;  5IP7 J;  4LGW A;  2HQ5 A;  2BGC A;  1EF4 A;  2GXB A;  2Y31 A;  1FLI A;  1FPQ A;  1X4O A;  4BEH A;  4MEX F;  3MKL A;  2A07 F;  5F6F A;  3SFZ A;  1UJ8 A;  3BPV A;  4HBL A;  1JUP A;  3PNT A;  5HOO A;  2V79 A;  3VYS B;  3GZ6 A;  2CW8 A;  1QHG A;  2L2O A;  4BYY A;  3D5R C;  2NYX A;  3IWZ A;  4D0P A;  2DQL A;  3CCL I;  1POG A;  1ZKG A;  1IN5 A;  2ZCW A;  4B48 A;  2KHM A;  2OAZ A;  2VPR A;  3E5U A;  2WA0 A;  1X2M A;  1R1V A;  1Z67 A;  2X48 A;  4G7O F;  5DM7 F;  3H9G A;  1RUO A;  2HGC A;  2JWT A;  4CZC A;  2M0C A;  3TMO A;  4EEF G;  1ZN2 A;  3ZRG A;  2LP0 A;  1LEA A;  2RAE A;  2QEN A;  2XDV A;  1HC8 A;  4BU2 A;  2KIS A;  3EUH C;  2M4G A;  3OSG A;  1N25 A;  3M8E A;  4EM1 A;  1KA8 A;  3PO3 J;  2A6E F;  3HTS B;  4AVP A;  5D8L B;  3L00 A;  2VAS A;  2MH2 A;  5GP9 A;  2JA6 J;  1WJF A;  3WE3 A;  2X6O A;  4ZDO A;  3M4O J;  1G6N A;  2MA3 A;  2OD5 A;  3ZMT A;  1BI3 A;  2MW8 A;  2ELJ A;  2D5V A;  3HSR A;  3DBL B;  3BG6 A;  2JSC A;  1DUX C;  2ME0 A;  2V6C A;  2TDX A;  1UB9 A;  3DLL F;  2L9N A;  5DCM B;  2WAQ A;  1IF1 A;  1E3O C;  2FE3 A;  3BY6 A;  3M8J A;  1YJ9 I;  5JLX A;  3Q0U A;  1TNS A;  5C3E J;  5M5W J;  3WTS C;  2VQG A;  1USS A;  3QP6 A;  3HOY J;  1WFX A;  2F5C A;  2FEZ A;  3CME I;  4L9J A;  2STW A;  1IUY A;  3A0H C;  1R49 A;  1X58 A;  4BE1 A;  1YIT I;  3GZ5 A;  2Z16 A;  3OYE A;  4GYG A;  2P7C B;  2QGU A;  3BQZ A;  3KEY A;  1KZH A;  4M9Z A;  3MAJ A;  3NAU A;  4A6D A;  3WE2 A;  5B1A H;  2KFD A;  2QBY B;  1ZRF A;  2Y0S A;  5FGM A;  2PJR B;  3RZO J;  4B3A A;  4I09 A;  2H27 A;  2ZNY A;  3HOT A;  3DTI A;  3HPH A;  2K9Q A;  3KZI C;  3FIW A;  1GXQ A;  4EJW A;  3B73 A;  2DA5 A;  2D1V A;  1JKO C;  2XAJ A;  3TOB A;  1D0X A;  2A68 F;  1FIP A;  1XX5 A;  1TT5 B;  5C4J J;  2E60 A;  1AOY A;  4RB1 A;  4CCL A;  3OIP A;  3QRF F;  1TWG J;  3KP2 A;  1BJA A;  3F3X A;  2VOO A;  2XAH A;  1SMT A;  4FT8 A;  3B6C A;  3W6K B;  3BT9 A;  4JBA A;  4P55 A;  2BV6 A;  3F22 A;  4MTE A;  3TKY A;  5LBQ A;  2A61 A;  3FXM A;  4XN0 A;  4BY1 J;  3JTG A;  4C3H J;  3LOC A;  2RQQ A;  4MIM A;  3AG3 H;  3F0C A;  1YTY A;  3JSO A;  3L2W A;  4Q48 A;  2E7W A;  2K5C A;  3GYH X;  4JYK A;  3BZC A;  2H09 A;  2WY8 Q;  3IV5 A;  4E7Z A;  2IBD A;  2O0Y A;  1TBX A;  4IPA A;  1X1A A;  4DNC A;  3GTG J;  2ESH A;  2CS3 A;  1Z1D A;  1MD0 A;  1YW9 A;  4B4C A;  4KIB A;  1GV5 A;  3Q3S A;  4CDG A;  4I2O A;  4E4H A;  1RES A;  2V1N A;  1YX5 A;  4XQF A;  2V9P A;  3EDP A;  3ROU A;  1FZP B;  3E97 A;  3QPH A;  4RLQ A;  4XKW A;  5GAD J;  4O5V A;  3ASO H;  2C6Y A;  3RQ4 A;  1JTX A;  3BCB A;  5J47 A;  1WWX A;  3EYI A;  1Q1H A;  3EUH A;  2K02 A;  4HYE A;  3IL2 A;  3KEO A;  1ETO A;  4A3F J;  1BW5 A;  2CO5 A;  2JN6 A;  3DPT A;  1FOK A;  3G2B A;  4YFN F;  2EFP A;  1R9T J;  1UST A;  3ESW B;  2V9V A;  4DZJ A;  3FXR A;  3TDZ C;  4DIQ A;  3GTJ J;  1WJA A;  1MKM A;  1S7O A;  4EVI A;  2IS6 A;  1R5G A;  2ECB A;  3SYT A;  2EV6 A;  2LR8 A;  3OYK A;  3RKY A;  4KDP A;  1IN7 A;  1XGN A;  1YE9 A;  4ZYE A;  2FXA A;  3U9G A;  4KA4 A;  3S3M A;  2CQN A;  1L3L A;  1QZZ A;  4RGR A;  1RPW A;  2GOM A;  4F52 A;  3FDY A;  5M3F J;  1ZAO A;  3E6M A;  2MFZ A;  1WJ5 A;  3A01 B;  2RC4 A;  4PGH A;  1HA8 A;  3ZQG A;  1RUN A;  2P6T A;  2DYS H;  2EJR A;  2JPB A;  3A1Y A;  3I9V 2;  3RCO A;  2Y2Z A;  5A2Q Z;  5HVQ C;  2HZD A;  3FBI B;  2H6C A;  5FKK A;  4YIR X;  2HKX A;  3K4B A;  1PDN C;  2O8K A;  3GBG A;  3P7N A;  3PFI A;  2MSY A;  4G7H F;  1OKR A;  5K7F A;  2QF7 A;  4IX7 A;  2ZXJ A;  3EET A;  4MNU A;  5HLI A;  1BW6 A;  5C4X J;  5AIQ A;  4C2T A;  3IH2 A;  1JGS A;  2W85 A;  3PNV A;  3FM5 A;  3E1S A;  4PSW A;  3BR1 A;  2E35 A;  2WB1 A;  3KLN A;  3WU2 C;  4FE7 A;  3HYI A;  2W57 A;  3CCS I;  3RPU D;  2R7W A;  3JRC A;  1ZRE A;  5CVU A;  2CV0 A;  3F8M A;  3I71 A;  2Q0O A;  2OTJ I;  1FOY A;  3CCQ I;  1DGW Y;  4D9J A;  2F4O B;  4XKC A;  3HRM A;  1BN5 A;  1MJB A;  1JKP C;  2LNB A;  3HL2 A;  1UAA A;  5DCF A;  5DUK A;  4E7L A;  1G3S A;  4UB8 C;  3LFU A;  1X3Z B;  1FBU A;  5DV5 A;  3F8C A;  4LLN A;  3LSI A;  2LY1 A;  2HKO A;  1U78 A;  2UWM A;  2E1M B;  4N9I A;  1DP3 A;  4MGR A;  3REO A;  4BQO A;  1YS7 A;  5JHF A;  5CVJ A;  3MD2 A;  4YFX F;  4A2U A;  4P1W A;  5IY5 H;  2N8G A;  1ENH A;  1TWF J;  2RVC A;  1O3Q A;  4QTR A;  4A3E J;  1HXD A;  2LY9 A;  3C2G A;  1VQ5 I;  2M8E A;  1IV6 A;  9ANT A;  1F1Z A;  4OIN F;  5E79 C;  5EJC A;  1KGS A;  1JKR C;  2LYC A;  2HVS A;  2MLG A;  3ELK A;  2DA3 A;  2YS9 A;  3LL7 A;  3K70 C;  2DOA A;  4RAF A;  1T8I A;  4BGD A;  3DEE A;  3TL4 X;  1X2N A;  3I53 A;  2E36 A;  3ABT A;  3KZY A;  5AIP A;  3I4N J;  3AAF A;  2MC3 A;  3H3V K;  3LQQ A;  3ZQI A;  2KRC A;  2EIM H;  1SFX A;  1TTY A;  5H6Q A;  1OYY A;  2ME6 A;  1VQ9 I;  3HGG A;  3GF2 A;  2XAF A;  1X1B A;  2M1B A;  2OF7 A;  4ANJ A;  1UHS A;  5DEQ A;  2GIZ A;  5E20 A;  4NBQ A;  2L0K A;  1D8J A;  3BP8 A;  4XLP F;  3V8L A;  4UY8 I;  1ETQ A;  2LOO A;  2DW4 A;  2LY2 A;  2OBP A;  2OCC H;  3CUO A;  1O57 A;  2LK2 A;  2P8T A;  3SDB A;  3JRI A;  1C0W A;  4I01 A;  4QSH A;  1W0U A;  1Z7L A;  2DJN A;  2DFF A;  2Z2S B;  3BLY A;  1MBK A;  2DA2 A;  1DU0 A;  5KAF C;  3LSM A;  2EFQ A;  1MDM A;  2IVM A;  2DYR H;  2V6E A;  2OA4 A;  3R60 A;  1DDN A;  1F43 A;  3K2A A;  4MO7 A;  1IXR C;  3VYT B;  2FRH A;  1Y1V J;  3WHB A;  2OQG A;  3WTU C;  3GTP J;  2DA4 A;  3CQZ J;  5FRO A;  2EH3 A;  4HAM A;  3S1R J;  1I39 A;  3D5S C;  1PYV A;  4JX4 A;  3VDX A;  1H89 C;  4L0Y B;  3N4M A;  4NQW A;  4GFB A;  3K2Z A;  5LEK A;  3OS2 A;  3L9F A;  1T95 A;  3WGI A;  5K5R A;  2M7A A;  2KDO A;  1WI3 A;  2K85 A;  1APL C;  4XSZ F;  1WJD A;  2HTJ A;  4QWQ A;  1EKE A;  5D5V B;  2VBY A;  5KNL A;  4HNV A;  3OY9 A;  3BRO A;  1TQP A;  2DOD A;  4ZTF A;  2BZT A;  1LPQ A;  1IXC A;  1Z6R A;  1R4M B;  2YU9 J;  3QYE A;  3DLA A;  5BPD A;  3DXJ F;  1QPI A;  2WC2 A;  3SHF A;  1AKH B;  3JCU C;  2L7K A;  3DF8 A;  2LBF B;  1JJ6 C;  4CZZ A;  1VQP I;  4HX8 A;  4RA2 A;  4Y52 J;  1B72 A;  2H94 A;  2DN0 A;  1YIO A;  2ZBK A;  3LSG A;  4FE4 A;  2HPI A;  5KAI C;  1LKX A;  4N4N B;  4KT6 A;  1UHM A;  4LB6 B;  4U87 A;  2KZV A;  5FJ8 J;  1XMA A;  5ERI A;  4CCM A;  1FEX A;  2R93 J;  4FX0 A;  2F5D A;  3DWL E;  3T1B A;  3CCE I;  3GO5 A;  1GHC A;  1IN6 A;  3NQO A;  2IAI A;  3OYJ A;  1GT0 C;  2HYG D;  2JVG A;  3ML6 A;  2CW0 F;  1E3H A;  3TO6 A;  2QKL B;  5E8I A;  4A3M J;  5D4R A;  2EFW A;  3OYI A;  2X1C A;  4HV5 A;  4XRF A;  5DM6 F;  3IAM 2;  5M3M J;  1JT0 A;  3KPH A;  1S7A A;  3LA7 A;  4HST A;  1Z3X A;  1TW3 A;  2AQF A;  3GVA A;  1FNN A;  3CUQ C;  3M7G A;  4BJT A;  4KIT B;  1JKQ C;  1HSJ A;  4Q5S F;  3E5Q A;  1VFC A;  2PMH A;  2QVO A;  4BXX J;  4RMN A;  1GVD A;  1IC8 A;  3T8T A;  3F9K A;  2VJ4 A;  1J09 A;  1XSV A;  5H2F C;  1LQ1 A;  3E7L A;  3WTV C;  1VQ4 I;  3VOD A;  4IRH A;  5FKO A;  3PQJ A;  1TT0 A;  4ZTJ A;  4C30 A;  2FQ4 A;  2Z33 A;  1BR2 A;  3VSL A;  2AXT C;  1FIA A;  2QLZ A;  3KP6 A;  3H3U A;  3S1M J;  3H3Z A;  3ZP5 A;  1MMA A;  3I0T A;  5EDN A;  2I10 A;  5FLM J;  2O7O A;  2COB A;  4WXD A;  1V54 H;  1F5T A;  3V8K A;  4UV8 A;  2NXN B;  4XSX F;  2R7V A;  2XSJ C;  3RIR A;  4LLL A;  3BPX A;  4EGY A;  1IG7 A;  2AQE A;  4W97 A;  1XPX A;  1ONV A;  2ZFW A;  1WRJ A;  3GFI A;  4UV9 A;  3LSP A;  1T6S A;  3IH4 A;  4XLH A;  2BYV E;  3JSP A;  4KIF A;  2Z99 A;  3FKI J;  3GME A;  4AM3 A;  4UB6 C;  5HLT A;  1SMY F;  3TED A;  2BE5 F;  4C2U A;  2NVQ J;  1R6R A;  4OIQ F;  2LTP A;  3HOS A;  2A5W A;  5E1X A;  1RRJ A;  3JRB A;  3FXL A;  1F9N A;  1T56 A;  1W36 D;  2KJC A;  3BG5 A;  3L2U A;  3H35 A;  4B47 A;  1IN8 A;  5BS6 A;  1MSE C;  5LGT A;  3CO6 C;  3ABK H;  1P9Q C;  3D1N I;  1FOW A;  4XNF A;  4ZDL A;  3C18 A;  2FMY A;  4XLC A;  4Y33 A;  3NWT A;  1X4P A;  1K4T A;  4DQ2 A;  1FBQ A;  2J5O A;  1K61 A;  3DTK A;  3LST A;  2HR3 A;  3GTL J;  4M3F A;  4L5E A;  4ZZD A;  1I3Q J;  5HLG A;  1I5Z A;  5LRS A;  3HJE A;  2FOK A;  5D6F A;  1OIS A;  4G7Z F;  2DMU A;  2Z1D A;  1NG7 A;  1H0M A;  1OR7 C;  3LWF A;  2VXD A;  1WPK A;  1XB4 A;  4G6Q A;  1BM9 A;  2VKH A;  5IOY A;  3CDI A;  5DCM A;  3MQ0 A;  5LHI A;  3HOW J;  4A3B J;  5KCM A;  3HHG A;  3GZN B;  1D5Y A;  2WWY A;  1ZAR A;  3HKZ A;  3WU0 A;  2K7L A;  1VZ0 A;  3EPZ A;  4BAY A;  3DBR B;  1YRN B;  2BOL A;  3CUQ A;  1K7A A;  2ID6 A;  1QVT A;  4PFP A;  1HW2 A;  1P92 A;  4DBR A;  4F3Q A;  1K78 A;  2Z3Y A;  3C2H A;  1S6L A;  1JGG A;  5BOX A;  4PK4 A;  1OCZ H;  4MQV A;  4NHJ A;  4A3C J;  1PUF B;  1FYM A;  2H8R A;  2XC7 A;  3RKX A;  4C9Y A;  3JR9 A;  1ZG5 A;  4ZDP A;  1LE8 A;  3CJT B;  3FHZ A;  1K79 A;  1A31 A;  4FIS A;  2WAQ N;  5J3L A;  1P4W A;  4C3J J;  3K10 A;  2FSW A;  2VBX A;  2VB6 A;  4BJ5 C;  2XRL A;  4BAC A;  2EFN A;  4ESB A;  3W6V A;  3A03 A;  4HNU A;  3ZN1 A;  1ACI A;  2LRD A;  1HOM A;  1ZGJ A;  2XGC A;  1HDP A;  2JA8 J;  2Q1Z B;  3ZMS A;  1JE8 A;  3K7A J;  3ZR8 X;  2FA5 A;  2Y69 H;  4A3G J;  1R00 A;  3HTU A;  4MEY F;  4CSW A;  4HQE A;  1CGP A;  3WTZ A;  2DMT A;  1SFE A;  2F4I A;  3BG9 A;  1CQT A;  3VPR A;  3IKT A;  2Y0S N;  5FFX A;  2PJP A;  2UV1 A;  3S1Q J;  3K4N A;  1Z9C A;  1LDD A;  2VC0 A;  2O8X A;  3UNG C;  5D5W B;  2HOT A;  4M71 A;  4A5N A;  5JFR A;  3MZ8 A;  3J7A O;  1I1G A;  2J5P A;  2DMQ A;  4M9X A;  1NG6 A;  4HZF A;  4H0E A;  1WSU A;  4WK8 F;  3H5A A;  3L09 A;  2FBH A;  2HXO A;  3R6S A;  4BY7 J;  1DPU A;  2VBZ A;  3SZP A;  4B09 A;  2E1M C;  3SEQ A;  2V26 A;  3WU1 B;  1S3J A;  1N78 A;  4XOT A;  2HQN A;  3CP8 A;  5CQE A;  2VL8 A;  2ZXW H;  4RM2 A;  4IRI A;  1ON1 A;  5EGO A;  1SD7 A;  3RYR A;  2WAE A;  1Y6I A;  5LEJ A;  3DQV C;  4RB0 A;  2NRA C;  4L9V A;  3FKJ A;  4BE2 A;  2KIM A;  1R5H A;  1TWA J;  2L9V A;  3K4L A;  1FYL A;  3MZH A;  1A36 A;  2GBY A;  2VT2 A;  2OJE D;  2LKS A;  3DV8 A;  1HKS A;  2CU7 A;  1OR7 A;  1UHW A;  2K9S A;  5J4Y A;  5ILV A;  4QPQ A;  3OYH A;  4BNC A;  1HW5 A;  3ZMV A;  1IRZ A;  2CWE A;  1AA7 A;  3G73 A;  4LIU A;  3BTJ A;  1ETX A;  2YR2 A;  3PNY A;  1ZGW A;  1BI0 A;  1REP C;  3C3W A;  3BG3 A;  1R23 A;  1J5Y A;  4MHG A;  1X19 A;  4IXA A;  1WI9 A;  1BI1 A;  3GXO A;  4U7D A;  1YJW I;  4KNY A;  3M1E A;  3QYB A;  4LK1 F;  3QOD A;  2AHQ A;  1YO5 C;  3QPS A;  1VQL I;  1MH4 A;  3U2R A;  1O3T A;  1TLH B;  3BR2 A;  2JSP A;  2RDP A;  4K2E A;  4U0W A;  1ZHF A;  2BVL A;  2W25 A;  1CF7 B;  5GTI C;  2R5Y B;  4IZZ A;  3I59 B;  1QRY A;  4HQM A;  4IL6 C;  2M0M A;  1XN7 A;  3IRR A;  2XB0 X;  3MEX A;  4EV0 A;  1U6G A;  2G9W A;  2LLK A;  2CG4 A;  4BE0 A;  3V42 A;  2O6G E;  4L9T A;  3FM3 A;  2LKX A;  4UNO A;  1MZB A;  4FAS D;  3HUG B;  3DKX A;  4LJZ F;  3BTL A;  3OYC A;  2CQK A;  1PP7 U;  2QQ9 A;  4IHV A;  1W4M A;  4DBQ A;  2HYF A;  2DT6 A;  2HDW A;  3U21 A;  2QQ8 A;  4CH7 A;  2R5Z A;  1ZRC A;  2V1D A;  2D2W A;  5CVR A;  1A35 A;  2KIU A;  4ENK A;  4KFC A;  3O6B B;  1KQ0 A;  4XL9 A;  3VYR B;  4XON A;  2Q8K A;  4E7H A;  1ETV A;  2HQR A;  1S29 A;  2H8W A;  3I56 I;  4FX4 A;  3QU6 A;  1SEU A;  3K4J A;  2EIJ H;  4UVB A;  4R79 A;  1K6O A;  3PM1 A;  4QIW N;  2QWW A;  1RKT A;  4A0Y A;  3GWZ A;  1HKT A;  2IXS A;  1XDU A;  4UXN A;  2QQA A;  5F0F A;  3ULQ B;  2EIK H;  3S93 A;  4ZZL A;  1Z7U A;  2DLL A;  1I6H J;  5F1R A;  4CHU A;  3OR2 C;  2M5W A;  4JX6 A;  5K5O A;  3O8G A;  5DD8 A;  4E7J A;  4LIT A;  2A6T A;  4UVC A;  4XID A;  3PIO F;  5L3C A;  2JA7 J;  1JI8 A;  4LOC A;  1IDY A;  3PUF A;  4EAT A;  2GXG A;  2L02 A;  2OTL I;  1MMG A;  3H92 A;  1Z05 A;  3RDI A;  5LD2 C;  2PI0 A;  4WWC A;  2WB1 N;  2HOA A;  2EPF A;  1NK3 P;  2CRG A;  3SEZ A;  1L0O C;  4I7H A;  4IQJ A;  2CV1 A;  3M8F A;  2BW3 B;  4HLX A;  3S32 A;  5FLX Z;  1Z6T A;  1RR8 C;  3ISP A;  2LFB A;  3ECO A;  3BZK A;  1SD6 A;  3V7C A;  2X51 A;  1T38 A;  3QQA A;  1ERD A;  4XRS G;  1OCC H;  2EV5 A;  3TP3 A;  2JA5 J;  5TGT A;  5C44 J;  2VXZ A;  3LNQ A;  4XOR A;  1R4N B;  1D5V A;  3UKG A;  3BG7 A;  2GA2 A;  3KIO A;  2FX0 A;  2O5R A;  4AIK A;  2L5Q A;  5HS8 A;  1MBG A;  1Y0N A;  2M30 A;  4AD9 A;  5IOZ A;  2E7X A;  5BQT A;  4HF2 A;  1ZK8 A;  2MLK A;  4LIV A;  2JRM A;  3K4K A;  1FP2 A;  1ODD A;  3S8P A;  1X3U A;  3BR5 A;  3H0G J;  4BEH B;  1LVA A;  3BTI A;  1QU3 A;  1MW7 A;  4AU7 A;  1BIB A;  1FC3 A;  5J40 A;  3ZMD A;  4BQQ A;  1BOA A;  3O3K A;  3RQI A;  2DOF A;  4MTD A;  1QBJ A;  2M3A A;  4XIC A;  5JVG F;  3OV8 A;  3S3O A;  2K3F A;  2ZNZ A;  3GTQ J;  2R7S A;  1U9N A;  2R7Z J;  2JQ7 A;  4GRI A;  3T8R A;  2R7Q A;  4XLE A;  1SD5 A;  5FD6 A;  5HNH A;  5FLV A;  2VKD A;  2TRT A;  1G59 A;  3D5L A;  4IJA A;  3WTY C;  2YU3 A;  1ZLJ A;  2DTZ A;  4HG2 A;  4M3B A;  3T0Y A;  5IP6 A;  3HRT A;  1ITY A;  1IXS B;  2RNG A;  4S05 A;  2XKO A;  3AG1 H;  2F2E A;  2E2H J;  1XSD A;  5E17 F;  3EYY A;  3JRD A;  2KRH A;  3U1K A;  4A69 C;  2BY2 A;  1W7P A;  1FWZ A;  3OSF A;  5JVT A;  1SFO J;  2CUF A;  3K4C A;  3ZQQ A;  4I6Z A;  3VOE A;  1OPC A;  3G71 I;  2HXI A;  1QZE A;  4UVA A;  2ID3 A;  1ZG3 A;  3OMY A;  3QPT A;  4EJT A;  3IUO A;  3ZPL A;  1KYZ A;  2VT3 A;  1RKW A;  4D7M A;  5IT3 A;  1MNE A;  2XF5 A;  1IW7 F;  1T0F C;  5D4S A;  3I64 A;  1R22 A;  1X1D A;  1KU2 A;  2NS8 A;  3K6G A;  2VBW A;  1R5I D;  1U2W A;  2K27 A;  4CYC A;  2MYS A;  1MGT A;  3RJP A;  2F6C A;  5E1Z B;  2OQR A;  1I3A A;  1A6I A;  4KIG A;  2R7T A;  3ONQ A;  3C2B A;  2V4J C;  2M2E A;  1FOX A;  1VF9 A;  4AYB A;  5E3N A;  3DKW A;  2WAF A;  4FQG A;  4KMF A;  5FFZ A;  4IHT A;  1LDJ A;  1B8I A;  4M74 A;  2NAZ A;  1LB2 A;  4XBF A;  1YW7 A;  4ENM A;  1MBF A;  2ZJ2 A;  2F48 A;  3BTC A;  2EK5 A;  3F8N A;  5K1Y A;  4NC7 A;  4BXF A;  4OIP F;  2BXZ A;  3E6B A;  4MQ9 F;  1JTY A;  3CCR I;  3GTM J;  2JMW A;  5CQG A;  3W2A A;  4KIS A;  3C1D A;  2GWR A;  4HX7 A;  3TO9 A;  5JR3 A;  2XSD C;  4ZJZ A;  4BJ6 C;  4QLC U;  5EZG A;  2EV0 A;  2NNY A;  2PG4 A;  4L5I A;  1J59 A;  2K9N A;  4ZC3 A;  2CQX A;  4FHT A;  4Y3O A;  1DP7 P;  3ZQ7 A;  1KQ9 A;  3I58 A;  3CCU I;  1D0Y A;  1OCT C;  2ECC A;  2GAU A;  4UUS A;  1MBJ A;  4HV6 A;  4U0Y A;  3W3C A;  4ZYA A;  3L7W A;  5BMZ A;  1I6X A;  4Y13 A;  4BKX A;  1BIA A;  3K4M A;  3ERE D;  1U5T C;  2ZJP F;  4YEJ A;  4OOI A;  3LSR A;  5B1B H;  2R0Q C;  2E34 A;  2ELK A;  3PSF A;  4D5C A;  1SAN A;  3DBH B;  4G12 A;  5CJ9 A;  3A2K A;  2L54 A;  2BY3 A;  2QSF X;  3A4C A;  2Y9Z A;  3ASN H;  4HF1 A;  3FXU A;  2ZJQ F;  1QZY A;  4CUG A;  3TW7 A;  3JAM Z;  3L2C A;  5M5X J;  1H9G A;  3G1L A;  4A12 A;  4CCO A;  5LHG A;  3AKZ A;  4CGZ A;  3LFK A;  2QCO A;  3Q9V A;  4EJU A;  3PQK A;  3J7Y J;  3BR6 A;  2GIV A;  2XB5 A;  3CDH A;  2OZ6 A;  3N05 A;  2B7E A;  1MNM C;  4E70 A;  2XKP A;  5H6R A;  4DOZ A;  1SD4 A;  4IQ4 A;  3IRQ A;  2EWN A;  4XRM A;  1MH3 A;  2JA2 A;  2VE8 A;  1G2H A;  3CDL A;  2O61 A;  3CJR B;  3KX2 A;  3HGY A;  4GCV A;  4Y15 A;  1V55 H;  2FUG 2;  3LQR A;  4JOM A;  1HW1 A;  1T08 B;  2JZY A;  3CLQ A;  5IT9 Z;  1A04 A;  4BQN A;  5CPR B;  3BJA A;  2JTV A;  2JUC A;  3HSF A;  2HU9 A;  2I5U A;  2OPT A;  2IGO A;  4HOB A;  4ETS A;  2ZB9 A;  3JTH A;  4LG0 A;  1R1T A;  1WQ2 A;  3CF2 A;  1V3F A;  1JXS A;  2YSR A;  1MIJ A;  2Q2E A;  2DA6 A;  2DTR A;  1RIO H;  3PIP F;  3ZQL A;  4TV7 A;  4ZH4 F;  4BBS J;  1XSX A;  3LSK A;  4RGU A;  3DFG A;  1VQO I;  4YIF A;  4OAY A;  3S14 J;  2LG4 A;  2H1K A;  1PVE A;  3SXY A;  5E3L A;  1VQ6 I;  2K9M A;  2G7H A;  4M3D A;  1BL0 A;  1ZQ3 P;  3A0B C;  2W4S A;  2DDA A;  1D1A A;  3DEW A;  4JQF A;  2Z9O A;  2NOG A;  4DW6 A;  3OOP A;  3BOQ A;  3OL4 A;  5CLS A;  2XF7 A;  1W1W E;  3MKW B;  4LLG F;  3M9A A;  2DBB A;  2HOE A;  3LSJ A;  4A3L J;  4KN4 X;  2PX9 A;  1G4D A;  2QEX I;  5JHU A;  1W0T A;  5HS7 A;  2FBK A;  5J6X A;  2IS2 A;  5F04 A;  1WVR A;  1YW8 A;  3KP3 A;  4M3G A;  3NWS A;  2R7F A;  4HPQ A;  1N77 A;  1XTA A;  5EG0 A;  2A6H F;  3BJO A;  4N0B A;  2DMP A;  1FTT A;  1ZYR F;  1AHD P;  4RB3 C;  2UXN A;  3GFM A;  1X1P A;  1T98 A;  3HC7 A;  1P6R A;  3I55 I;  2QM3 A;  1O7L A;  1U5T A;  1XGO A;  1HF0 A;  3HKZ N;  2BHZ A;  1R1U A;  2D1H A;  2JVH A;  3RPQ A;  2IA2 A;  2MD5 A;  4RAY A;  4AC0 A;  3R61 A;  5TJJ A;  1J0R A;  5GAE J;  2MG4 A;  3ZN0 A;  4NUB A;  5DTD A;  4CA0 A;  2DFE A;  4CCK A;  2KIF A;  4YRV A;  1J9I A;  4CO8 A;  2G7U A;  1I27 A;  5IPA A;  1SFK A;  2EZH A;  5FLX K;  2Y75 A;  2ZC2 A;  4P5O A;  3S2D J;  2DT5 A;  1W5T A;  2DDB A;  3CJN A;  2KIQ A;  3QP5 A;  3ECH A;  4PJM A;  5F27 A;  1BR1 A;  3ABM H;  4PZJ A;  2VC1 A;  1TW2 A;  4HSR A;  2X4H A;  3ERM A;  3HSE A;  2DCE A;  1IUF A;  2FD5 A;  1QPM A;  4PDK A;  3BC8 A;  2E2J J;  4PJL A;  2OCE A;  2E1N A;  3W6J B;  1R36 A;  3CCY A;  2ZME B;  5KVR A;  1DU6 A;  2QUF A;  1F4K A;  1ON2 A;  5L3G A;  3FMQ A;  1WJE A;  2F5V A;  2GQQ A;  3W2W A;  4AIJ A;  1LVK A;  2IJL A;  5EZH A;  2V1U A;  2PMZ A;  2EFO A;  3KZZ A;  3DU5 A;  4X6A J;  1BC7 C;  2EZK A;  1U8B A;  1N75 A;  1TWH J;  4ESJ A;  4RDU A;  2F5E A;  2LDU A;  5CKT A;  3ZMU A;  1FSE A;  4A0Z A;  4NB5 A;  5J8C A;  3IH3 A;  3G1M A;  3DU6 A;  3FZV A;  4XKB A;  5GTH C;  2HDD A;  2GM4 A;  1QQI A;  4IHS A;  2KRF A;  2FML A;  4X1E A;  2XAG A;  3J7Z I;  1NTC A;  1MDM B;  2CJJ A;  2BXY A;  3K69 A;  2XHK A;  3DEU A;  2IS4 A;  4LMY A;  3T5X A;  4OMZ A;  4Z6Y A;  2CH0 A;  1RNL A;  5LHH A;  4HNT A;  4NNJ A;  1M1E B;  4AIH A;  4M3E A;  1UG2 A;  2VN2 A;  4B3X A;  4HRI A;  4G6D A;  1KU7 A;  1V5G A;  3PUB A;  4FCY A;  3FHN A;  4L5J A;  1KU3 A;  4XRS A;  4BHP A;  2ETH A;  3K70 D;  5A2Q K;  2W48 A;  2FBI A;  4NQW B;  3M3Y J;  1TNT A;  3OL3 A;  2Z5U A;  1BI2 A;  3S1N J;  4XLN F;  2RRE A;  4BBR J;  1RET A;  4RB2 C;  3COA C;  3MFK A;  4XKV A;  3HOU J;  3OOU A;  3J81 Z;  2DA7 A;  2HZT A;  3BJ6 A;  4OIR F;  1H9T A;  2X6X A;  3OWT A;  3Q0W A;  1LFB A;  2DJI A;  1ZEL A;  3TQN A;  4EMS A;  2H1L A;  2RN7 A;  4J00 A;  1AWC A;  4EQQ A;  2LSO A;  4Y7N J;  2CMP A;  1I1S A;  1J7K A;  2NS7 A;  1LDK B;  2IGN A;  3BDD A;  3ZOB A;  1IRG A;  1VQK I;  2E5Z A;  3I54 A;  4IF4 A;  3MVP A;  4BL0 B;  4BDZ A;  2CUJ A;  3HBL A;  2UZK A;  2Y30 A;  2XPV A;  1YQA A;  1O4X A;  2HVR A;  3CCJ I;  4U88 A;  4D7N A;  4RLF A;  4AVZ A;  1B72 B;  2DOE A;  4EM0 B;  4BDY A;  2STT A;  2QBY A;  4OU0 A;  3BQY A;  2PJR A;  2VIX A;  4CIC A;  3VSK A;  1IAW A;  3GEZ A;  5L3D A;  1GUU A;  3SQN A;  4BHC A;  4DJA A;  2DMN A;  5CYV A;  1MND A;  2E5N A;  3EUK L;  3I5U A;  1YHQ I;  4GYI A;  4I0B A;  4B43 A;  2V9K A;  3DTE A;  1B59 A;  1IRF A;  1V4R A;  1GV2 A;  1UMQ A;  3FX3 A;  2A69 F;  1FY7 A;  1OCO H;  3QOP A;  2ISZ A;  5E3O A;  4YEL A;  1WCM J;  2DPU A;  3FF5 A;  5HDG A;  5KHD A;  2R7R A;  2HDC A;  3ZQC A;  1B1B A;  2M34 A;  3G1O A;  4LD5 A;  4RS8 A;  1MSF C;  2ESN A;  2K86 A;  3GFJ A;  3WOD F;  4JX5 A;  3R0J A;  1HQC A;  2R4G A;  4LFU A;  3BWG A;  3SJM A;  3EUA A;  5EF6 A;  2Y48 A;  3MN2 A;  1OCP A;  3F72 A;  2WAD A;  3NAR A;  1EJ9 A;  2R92 J;  5TRD A;  2FU4 A;  4EGZ A;  3GUD A;  2RQP A;  2E1O A;  4E7S A;  1DGR M;  4GGG A;  5F0H A;  1Y1W J;  4OIO F;  3O2P E;  3K9T A;  4I76 A;  3KYL A;  4G9Y A;  2HS5 A;  1IGN A;  3CC7 I;  1UEL B;  2HPM A;  2DQR A;  2XGD A;  2IP2 A;  2CGP A;  2DO7 A;  3OIQ A;  1SVO A;  2PQ8 A;  2P6S A;  3BR0 A;  1HST A;  4PCQ A;  1WZ2 A;  5DDG A;  3J80 Z;  4M72 A;  1SAU A;  3G6E I;  2IPQ X;  4N9H A;  3LA3 A;  1GDT A;  3KP5 A;  4KT5 C;  3OYL A;  3JAM K;  2CQQ A;  2X1D A;  5HOD A;  3V7R A;  4IHX A;  3M1C A;  4UUV A;  1Y8Q B;  4ITV A;  1F36 A;  3RZD J;  2HEO A;  3LAP A;  3HOZ J;  1R58 A;  3IP4 B;  2BY0 A;  3FXJ A;  4IHY A;  3I4P A;  3GW2 A;  3OR1 C;  4LB5 A;  4P96 A;  1JT6 A;  4DGW B;  1ORK A;  5LGU A;  3AFH A;  2FF4 A;  1IN4 A;  2ZO4 A;  1STZ A;  2IA0 A;  5J1Y A;  2KKO A;  4ENJ A;  3H9Q A;  2VOD A;  3OIO A;  3OYB A;  3IHU A;  4MFE A;  3HXL A;  2VON A;  2HVQ A;  2ELH A;  2VKV A;  2HOS A;  2QZ8 A;  3TDU C;  3A01 A;  1LFU P;  5IT9 K;  2TCT A;  1NHA A;  2M8G X;  4H4K C;  5B66 C;  3AL0 B;  3HB9 A;  3OS1 A;  3AG2 H;  3CLO A;  2GZW A;  2L7F P;  2ADU A;  1QO0 D;  2M45 A;  1E17 A;  4Y4R A;  4BH9 A;  4PGG A;  1MBH A;  1R7J A;  2EB7 A;  3FMS A;  2JK3 A;  1IRX A;  1XG1 A;  3WTT C;  2XIG A;  1Q1V A;  3DP7 A;  3SZT A;  2LD5 A;  1D8K A;  2OUM A;  3V4G A;  1YI2 I;  1TZL A;  1EA3 A;  1YFH A;  3KYD B;  1KYW A;  3CC4 I;  2IEK A;  2X9D A;  1VQ7 I;  3H5N A;  2L4A A;  4LG3 A;  3OYG A;  1Z91 A;  2CYY A;  2ZSH B;  3HPG A;  3L2R A;  1S9H A;  2P5K A;  3WTX C;  4V19 K;  2DFH A;  2CFX A;  4PJN A;  3OYA A;  1P7I A;  1NH3 A;  2R7D A;  1YJN I;  2KP6 A;  1JUS A;  2L4M A;  4F93 B;  1E2X A;  3P9I A;  1FMV A;  3C7J A;  3CUQ B;  3TP0 A;  2KL4 A;  3WG7 H;  1W5C C;  4BHB A;  1MMN A;  4AUX A;  4YFK F;  1K78 B;  3H5R A;  2DPD A;  5ICF A;  2VQL A;  4EJV A;  5DS9 A;  4J19 A;  1RI7 A;  2V1X A;  4FTH A;  1WJC A;  3HOX J;  2XPW A;  2VUM J;  4IKF A;  2QSG X;  4XR6 A;  1Z3Y A;  1GXP A;  1UZC A;  1ZGA A;  2AO9 A;  3HG9 A;  4IEJ A;  4PSX A;  3WGH A;  4O3M A;  2I8D A;  1LE8 B;  5ED4 A;  4F91 B;  4RBO A;  2YUS A;  4RAZ A;  5DYM A;  2NVX J;  2HI3 A;  1MMD A;  4FET A;  2B63 J;  3HRS A;  2DT7 B;  2IW5 A;  3P9K A;  2XVC A;  4HW0 A;  1OYW A;  1FJL A;  4PFO A;  3Q9S A;  3QAH A;  1O3S A;  1TWC J;  2LKP A;  2LF8 A;  2OU2 A;  1Z0X A;  2CW7 A;  5D6E A;  2VJJ A;  4I02 A;  3OS0 A;  2NS0 A;  2EIL H;  4WXH A;  4AYB N;  4WCG A;  1VND A;  1BR4 A;  3S2W A;  1P7J A;  3KP7 A;  4M6V A;  2W7N A;  1FX7 A;  2CUE A;  4DYR A;  3BZ6 A;  2NVY J;  2VQH A;  3RPU A;  1BJZ A;  3CCM I;  5GPC A;  3VB2 A;  2VQC A;  4Y17 A;  2BHY A;  3GTK J;  3OYD A;  5HNF A;  2VJ5 A;  3NRV A;  2O9L A;  3Q0V A;  3CES A;  3FWE A;  1WH7 A;  5FRN A;  3JRH A;  4HX4 A;  3S16 J;  2W84 A;  3GTO J;  2ZXI A;  3JRF A;  5ICC A;  1E0E A;  1S7E A;  3DKY A;  4HF0 A;  1Y39 A;  4J01 A;  5IP9 J;  1G3W A;  5ICE A;  2VLA A;  3W2V A;  4A6E A;  4P9F A;  2BY1 A;  2K4B A;  2L9S A;  2X6W A;  5F0C A;  1IJW C;  1VQM I;  4DYC A;  1O7F A;  5EGO B;  2LH9 A;  2L3D A;  4A0X A;  2KQR A;  1LJ9 A;  4XLA A;  1KON A;  5B3S H;  1OQY A;  1P4A A;  2LC2 A;  4ZYD A;  3A02 A;  4HDU A;  3FMR A;  4A3I J;  1QVU A;  2M9H A;  1RR7 A;  1J2X A;  1T33 A;  2PBI A;  1XD7 A;  4Q47 A;  2LRE A;  4F92 B;  4UHT A;  3QPL A;  1B6A A;  3GCM A;  1B4A A;  1QGP A;  2ZME C;  3ABU A;  3EQL F;  2P0W A;  4HA8 A;  4AID A;  3CD6 I;  4E7I A;  3E5X A;  2WY7 Q;  2VOP A;  5J1U A;  4IRG A;  1MMS A;  5TIS C;  3QYF A;  1Z21 A;  3JRA A;  4U0V A;  3L2Q A;  3CF5 F;  2P5L C;  1FTZ A;  4CCN A;  2HQA A;  2KMU A;  1S8N A;  1XCB A;  1QNT A;  2L7M P;  1YYV A;  5F1J A;  2RKH A;  3FK7 A;  4MFD A;  2R3S A;  3J81 K;  3I4M J;  2OC6 A;  1U9O A;  2NVT J;  1P2F A;  1AKH A;  5K7Z A;  4RAG A;  2LBF A;  5EEA A;  1G8X A;  2UXX A;  4I99 C;  3QWL A;  3GFL A;  3G3Z A;  4KIC A;  4ON0 A;  1D1B A;  2CQ7 A;  3H0D A;  4A3D J;  1WJB A;  2EZL A;  5ICG A;  1XGS A;  3HOV J;  3PL8 A;  1JHF A;  3D0S A;  4DYQ A;  2ZKZ A;  1OCR H;  4A93 J;  2JUG A;  2DA1 A;  3X2Q H;  1YIJ I;  1U8R A;  1FP1 D;  1FSH A;  1FMW A;  4LK0 F;  2R5Z B;  1OJL A;  2QA4 I;  2ACJ A;  3ZGK A;  2P4W A;  2PN6 A;  3ZXS A; 
#chains in the Genus database with same CATH homology
 1ULY A;  3E6C C;  5ILU A;  2NNN A;  3TOA A;  4P9U A;  3CO7 C;  3JW4 A;  3KFW X;  2P5V A;  3B02 A;  2XRN A;  4Z2Y A;  1ZLK A;  1XMK A;  3WTW C;  1HBX G;  1EH7 A;  3MCZ A;  1SAX A;  3F8F A;  6PAX A;  2WTE A;  1BC8 C;  2XGX A;  5D5X B;  1OYI A;  2IT0 A;  3F6O A;  2A5Y B;  4L18 B;  4M9S A;  3IWF A;  3LAJ A;  3J80 K;  2DK8 A;  1YLF A;  2ZME A;  1B9M A;  4L9N A;  5L3F A;  3NEU A;  2BEO A;  1W7P D;  2HTS A;  3K1P A;  2BBY A;  2X0L A;  1TQM A;  3KLO A;  5D8K B;  2PLY A;  3Q5F A;  2FNP A;  5E18 F;  4KN7 X;  2DFI A;  5HLH A;  1T0F A;  3K0L A;  1PUE E;  4EM2 A;  3LA2 A;  4OMY A;  2QYO A;  5EEG A;  1EV7 A;  2JPC A;  4RGS A;  5FB2 A;  3N97 A;  5L3E A;  3KP4 A;  4JK1 X;  2A3S A;  2E1C A;  1OMI A;  5F64 A;  3V8J A;  3K1N A;  3WGG A;  3E3V A;  2COM A;  1T2K A;  1XCV A;  1FBS A;  1W7P B;  3V7S A;  3VFZ A;  4GXO A;  4YG2 F;  1B9N A;  3TGN A;  2PEX A;  1XGM A;  3P9C A;  2OZU A;  1WKM A;  2MBF A;  5FD5 A;  2DU9 A;  4KMU X;  1MJA A;  2W24 A;  2LF7 A;  4BXU A;  1D3Y A;  2EA2 A;  3KEQ A;  2FQ3 A;  4I0A A;  4L0Z B;  2PMU A;  3KET A;  4ESF A;  3VEP A;  2AS5 F;  3KE2 A;  5BPI A;  3GLX A;  2H6B A;  2XAS A;  4WXC A;  3RYP A;  4RGX A;  3FXQ A;  1XDS A;  3F21 A;  2YX4 A;  5JI6 A;  1SFU A;  5E8G A;  5ILS A;  2ISY A;  3HRU A;  1BBY A;  3ZMZ A;  2P7V B;  2XAQ A;  2QQB A;  4YII A;  4F7Z A;  4HLY A;  3RTR A;  3IKV A;  1EH6 A;  2F5F A;  4G94 A;  3TO7 A;  5LGN A;  1KQ8 A;  4CYD A;  1W5S A;  3F6V A;  5HS9 A;  5KK1 A;  2MH9 A;  5LRR A;  4WX9 A;  4KUM A;  3QU3 A;  5FO5 A;  3HHH A;  5AON A;  1MJ9 A;  4R1H A;  1J75 A;  2RV8 A;  4AWX B;  1YG2 A;  4WF2 A;  5L3B A;  1IZ1 A;  5K5Q A;  2DI3 A;  1YS6 A;  2XV4 S;  1PP8 F;  3WG9 A;  2M87 A;  4ZYH A;  2FNA A;  1O3R A;  2XUB A;  1UFM A;  5HDN A;  3R4K A;  1T39 A;  4ZYG A;  1ZRD A;  4Q4Z F;  3CTA A;  2EA4 A;  2HFH A;  2CSO A;  4ASN A;  1KU9 A;  2YPR A;  5J8F A;  3K1M A;  1CF7 A;  3HIF A;  3I59 A;  4S04 A;  3MWM A;  4LG0 B;  1UCR A;  2DAO A;  3E6D A;  2HWV A;  5CVV A;  4M73 A;  4CXF A;  3HUG A;  4U7B A;  2YX7 A;  2GA1 A;  2Y0M A;  5DUI A;  2B0L A;  4M6X A;  1JHH A;  2JT1 A;  5LLQ A;  5CVI A;  3U1D A;  5HDK A;  1GVJ A;  5E1W A;  1G3T A;  4KYW A;  2IRF G;  5D5U B;  3F23 A;  4I98 B;  3R0A A;  2O3F A;  5H20 A;  1FYK A;  4HDV A;  2DK5 A;  1LNW A;  4B8X A;  4ENN A;  1HKQ A;  1FT9 A;  2L01 A;  4A5M A;  3GX4 X;  3IC7 A;  2D45 A;  2RNJ A;  3MZY A;  1G3Y A;  2VE9 A;  2IA1 A;  1LEB A;  2AXL A;  2KJB A;  1U5T B;  3KCC A;  4BQA A;  5DD4 A;  2XRO A;  1DPR A;  4G8X A;  2RGV A;  3DPL C;  4M6Y A;  1RZ4 A;  1U3E M;  2WV0 A;  1VTN C;  4IVN A;  1ZG1 A;  3RI4 A;  2O03 A;  5EEH A;  1EH8 A;  1P4X A;  2JRT A;  3F8B A;  3RKW A;  4O6J A;  1Y0U A;  4R8H A;  4GO1 A;  2PFB A;  1TQI A;  2K4J A;  1ZH5 A;  4EJO A;  4LGW A;  2BGC A;  2GXB A;  1FLI A;  1FPQ A;  4MEX F;  2A07 F;  5F6F A;  3SFZ A;  3BPV A;  4HBL A;  5HOO A;  2V79 A;  3GZ6 A;  4BYY A;  3IWZ A;  2NYX A;  4D0P A;  2DQL A;  1IN5 A;  2ZCW A;  2OAZ A;  3E5U A;  1R1V A;  4G7O F;  1RUO A;  2HGC A;  1ZN2 A;  1LEA A;  2QEN A;  3M8E A;  4EM1 A;  1KA8 A;  2A6E F;  3HTS B;  4AVP A;  5D8L B;  3L00 A;  2MH2 A;  3WE3 A;  1G6N A;  2MA3 A;  2OD5 A;  3ZMT A;  1BI3 A;  3HSR A;  2JSC A;  1DUX C;  2V6C A;  2TDX A;  1UB9 A;  5DCM B;  1IF1 A;  2FE3 A;  3BY6 A;  1TNS A;  3WTS C;  1USS A;  3QP6 A;  2F5C A;  2FEZ A;  4L9J A;  2STW A;  1IUY A;  3GZ5 A;  2P7C B;  4GYG A;  4M9Z A;  3MAJ A;  4A6D A;  3WE2 A;  2QBY B;  1ZRF A;  5FGM A;  2H27 A;  4I09 A;  2ZNY A;  3HOT A;  1GXQ A;  4EJW A;  3B73 A;  2D1V A;  2XAJ A;  3TOB A;  2A68 F;  1AOY A;  4RB1 A;  3QRF F;  3KP2 A;  1BJA A;  3F3X A;  2VOO A;  2XAH A;  1SMT A;  4FT8 A;  3W6K B;  4JBA A;  3F22 A;  2BV6 A;  4P55 A;  4MTE A;  3TKY A;  5LBQ A;  2A61 A;  3JTG A;  1YTY A;  3JSO A;  4Q48 A;  2E7W A;  3GYH X;  2H09 A;  2O0Y A;  4IPA A;  1TBX A;  4DNC A;  2ESH A;  1Z1D A;  1MD0 A;  1YW9 A;  4KIB A;  4I2O A;  4CDG A;  1FZP B;  3EDP A;  3ROU A;  3E97 A;  3QPH A;  4O5V A;  2C6Y A;  1WWX A;  3EYI A;  1Q1H A;  3EUH A;  2K02 A;  4HYE A;  3IL2 A;  3KEO A;  2CO5 A;  3DPT A;  1FOK A;  4YFN F;  2EFP A;  1UST A;  2V9V A;  3FXR A;  3TDZ C;  1MKM A;  1S7O A;  4EVI A;  1R5G A;  2EV6 A;  3RKY A;  4KDP A;  1IN7 A;  1XGN A;  4ZYE A;  2FXA A;  3U9G A;  4KA4 A;  1L3L A;  1QZZ A;  4RGR A;  1ZAO A;  3E6M A;  2RC4 A;  4PGH A;  1RUN A;  2P6T A;  2EJR A;  2JPB A;  5A2Q Z;  5HVQ C;  2H6C A;  2HKX A;  1PDN C;  3P7N A;  3PFI A;  4G7H F;  1OKR A;  2ZXJ A;  3EET A;  4MNU A;  5HLI A;  5AIQ A;  1JGS A;  2W85 A;  3FM5 A;  3KLN A;  3HYI A;  2W57 A;  1ZRE A;  5CVU A;  3F8M A;  3I71 A;  2Q0O A;  3HRM A;  1BN5 A;  1MJB A;  2LNB A;  5DCF A;  5DUK A;  1G3S A;  1FBU A;  5DV5 A;  3F8C A;  4LLN A;  2HKO A;  1U78 A;  2UWM A;  4N9I A;  4MGR A;  3REO A;  1YS7 A;  5CVJ A;  4YFX F;  4A2U A;  2RVC A;  1O3Q A;  1HXD A;  2M8E A;  1F1Z A;  4OIN F;  1KGS A;  2MLG A;  3ELK A;  3I53 A;  3ABT A;  3KZY A;  5AIP A;  3AAF A;  2MC3 A;  3LQQ A;  1SFX A;  1TTY A;  5H6Q A;  1OYY A;  3GF2 A;  2XAF A;  2M1B A;  5DEQ A;  5E20 A;  1D8J A;  3BP8 A;  4XLP F;  3V8L A;  2DW4 A;  2OBP A;  3CUO A;  1C0W A;  1O57 A;  2P8T A;  4I01 A;  2EFQ A;  1MDM A;  2IVM A;  2OA4 A;  3R60 A;  1DDN A;  1IXR C;  2FRH A;  2OQG A;  3WTU C;  4HAM A;  4L0Y B;  3N4M A;  4NQW A;  3K2Z A;  5LEK A;  3L9F A;  3WGI A;  5K5R A;  4XSZ F;  4QWQ A;  2HTJ A;  5D5V B;  2VBY A;  3BRO A;  1TQP A;  1IXC A;  1Z6R A;  5BPD A;  3DXJ F;  2WC2 A;  3SHF A;  3DF8 A;  4CZZ A;  4HX8 A;  2H94 A;  1YIO A;  2ZBK A;  1UHM A;  4LB6 B;  1XMA A;  5ERI A;  4FX0 A;  2F5D A;  3T1B A;  3GO5 A;  1GHC A;  1IN6 A;  3NQO A;  2HYG D;  3ML6 A;  2CW0 F;  3TO6 A;  5E8I A;  5D4R A;  2EFW A;  4HV5 A;  4XRF A;  1S7A A;  3LA7 A;  1TW3 A;  3GVA A;  1FNN A;  3CUQ C;  3M7G A;  1HSJ A;  4Q5S F;  3E5Q A;  2PMH A;  2QVO A;  3T8T A;  1XSV A;  1LQ1 A;  3WTV C;  3VOD A;  4IRH A;  3PQJ A;  2Z33 A;  2QLZ A;  3KP6 A;  3H3U A;  3H3Z A;  3ZP5 A;  3I0T A;  4WXD A;  1F5T A;  3V8K A;  4UV8 A;  4XSX F;  3RIR A;  4LLL A;  3BPX A;  4EGY A;  1ONV A;  2ZFW A;  1WRJ A;  3GFI A;  4UV9 A;  1T6S A;  2BYV E;  3JSP A;  4KIF A;  2Z99 A;  1SMY F;  2BE5 F;  4OIQ F;  3HOS A;  5E1X A;  1F9N A;  2KJC A;  1IN8 A;  5BS6 A;  5LGT A;  3CO6 C;  3C18 A;  2FMY A;  4DQ2 A;  1FBQ A;  2J5O A;  3LST A;  2HR3 A;  4ZZD A;  5HLG A;  1I5Z A;  5LRS A;  2FOK A;  5D6F A;  4G7Z F;  1H0M A;  3LWF A;  1XB4 A;  4G6Q A;  1BM9 A;  5DCM A;  3MQ0 A;  5LHI A;  3HHG A;  2WWY A;  1ZAR A;  3WU0 A;  2K7L A;  4BAY A;  3CUQ A;  1K7A A;  1HW2 A;  1P92 A;  1K78 A;  2Z3Y A;  1S6L A;  5BOX A;  4MQV A;  4NHJ A;  1FYM A;  3RKX A;  1ZG5 A;  3FHZ A;  1K79 A;  1P4W A;  2FSW A;  2VBX A;  2EFN A;  4ESB A;  3ZN1 A;  1ZGJ A;  3ZMS A;  1JE8 A;  2FA5 A;  1R00 A;  3HTU A;  4MEY F;  4HQE A;  1CGP A;  3WTZ A;  1SFE A;  3IKT A;  5FFX A;  2PJP A;  1Z9C A;  1LDD A;  2VC0 A;  2O8X A;  5D5W B;  4M71 A;  4A5N A;  5JFR A;  3J7A O;  1I1G A;  2J5P A;  4M9X A;  4HZF A;  1WSU A;  4H0E A;  4WK8 F;  3L09 A;  2FBH A;  3R6S A;  1DPU A;  2VBZ A;  3SZP A;  4B09 A;  3WU1 B;  1S3J A;  2HQN A;  4IRI A;  1ON1 A;  1SD7 A;  3RYR A;  5LEJ A;  3DQV C;  4RB0 A;  2NRA C;  4L9V A;  2KIM A;  1R5H A;  1FYL A;  3MZH A;  2VT2 A;  3DV8 A;  1HKS A;  1OR7 A;  1UHW A;  5ILV A;  4BNC A;  1HW5 A;  3ZMV A;  2CWE A;  3G73 A;  2YR2 A;  1BI0 A;  1REP C;  3C3W A;  1R23 A;  1J5Y A;  4MHG A;  4IXA A;  1WI9 A;  1BI1 A;  3GXO A;  4U7D A;  4KNY A;  3M1E A;  4LK1 F;  1YO5 C;  3U2R A;  1O3T A;  1TLH B;  4K2E A;  2RDP A;  4U0W A;  1ZHF A;  2W25 A;  1CF7 B;  3I59 B;  4HQM A;  1XN7 A;  3IRR A;  3MEX A;  4EV0 A;  1U6G A;  2G9W A;  2CG4 A;  2O6G E;  4L9T A;  3FM3 A;  4UNO A;  1MZB A;  4LJZ F;  2CQK A;  1PP7 U;  2QQ9 A;  1W4M A;  2HYF A;  1ZRC A;  2V1D A;  2D2W A;  5CVR A;  2KIU A;  4ENK A;  4KFC A;  3O6B B;  1KQ0 A;  2Q8K A;  2HQR A;  1S29 A;  4FX4 A;  3QU6 A;  4UVB A;  4R79 A;  1K6O A;  2QWW A;  4A0Y A;  3GWZ A;  1HKT A;  4UXN A;  1XDU A;  3ULQ B;  2QQA A;  4ZZL A;  1Z7U A;  2DLL A;  5F1R A;  4CHU A;  2M5W A;  5K5O A;  5DD8 A;  4UVC A;  5L3C A;  2GXG A;  2L02 A;  3H92 A;  1Z05 A;  3RDI A;  2PI0 A;  4WWC A;  1L0O C;  4I7H A;  3M8F A;  4HLX A;  5FLX Z;  1Z6T A;  3ISP A;  3ECO A;  1SD6 A;  3V7C A;  1T38 A;  2EV5 A;  2VXZ A;  1D5V A;  2GA2 A;  4AIK A;  5HS8 A;  4AD9 A;  2M30 A;  2E7X A;  5BQT A;  4HF2 A;  2MLK A;  1FP2 A;  1ODD A;  1X3U A;  1LVA A;  1BIB A;  1FC3 A;  3ZMD A;  1BOA A;  3O3K A;  4MTD A;  1QBJ A;  3OV8 A;  2ZNZ A;  3T8R A;  1SD5 A;  5FD6 A;  3D5L A;  4IJA A;  3WTY C;  2YU3 A;  1ZLJ A;  3T0Y A;  3HRT A;  1IXS B;  4S05 A;  2XKO A;  2F2E A;  1XSD A;  5E17 F;  3EYY A;  1W7P A;  1FWZ A;  5JVT A;  3VOE A;  1OPC A;  4UVA A;  3QPT A;  1ZG3 A;  4EJT A;  3ZPL A;  1KYZ A;  2VT3 A;  5IT3 A;  1IW7 F;  5D4S A;  3I64 A;  1R22 A;  1KU2 A;  2VBW A;  1U2W A;  2K27 A;  1MGT A;  3RJP A;  5E1Z B;  2OQR A;  4KIG A;  4KMF A;  3DKW A;  5FFZ A;  4IHT A;  1LDJ A;  4M74 A;  2NAZ A;  1LB2 A;  4XBF A;  1YW7 A;  4ENM A;  2ZJ2 A;  2EK5 A;  3F8N A;  5K1Y A;  4OIP F;  3E6B A;  4MQ9 F;  3C1D A;  2GWR A;  4HX7 A;  3TO9 A;  5JR3 A;  4QLC U;  2EV0 A;  2NNY A;  2PG4 A;  4L5I A;  1J59 A;  4FHT A;  1DP7 P;  3ZQ7 A;  1KQ9 A;  3I58 A;  2GAU A;  4HV6 A;  4U0Y A;  3L7W A;  5BMZ A;  1I6X A;  4Y13 A;  1BIA A;  3ERE D;  1U5T C;  4OOI A;  5CJ9 A;  2L54 A;  4HF1 A;  3FXU A;  1QZY A;  3JAM Z;  3L2C A;  1H9G A;  4A12 A;  5LHG A;  4CGZ A;  3LFK A;  3Q9V A;  4EJU A;  3PQK A;  2GIV A;  3CDH A;  2OZ6 A;  4E70 A;  2XKP A;  5H6R A;  1SD4 A;  3IRQ A;  2EWN A;  2VE8 A;  2O61 A;  4Y15 A;  4GCV A;  3LQR A;  1HW1 A;  2JZY A;  5IT9 Z;  1A04 A;  3BJA A;  2JTV A;  3HSF A;  4ETS A;  4HOB A;  3JTH A;  4LG0 A;  1R1T A;  1WQ2 A;  1V3F A;  1JXS A;  2YSR A;  2Q2E A;  2DTR A;  1RIO H;  4TV7 A;  4ZH4 F;  1XSX A;  4RGU A;  3DFG A;  4YIF A;  3SXY A;  2G7H A;  4JQF A;  2Z9O A;  3OOP A;  3BOQ A;  5CLS A;  4LLG F;  3M9A A;  2DBB A;  2HOE A;  4KN4 X;  1G4D A;  5JHU A;  5HS7 A;  2FBK A;  5J6X A;  1YW8 A;  3KP3 A;  2R7F A;  2A6H F;  3BJO A;  4N0B A;  1ZYR F;  4RB3 C;  2UXN A;  3GFM A;  1T98 A;  1P6R A;  2QM3 A;  1O7L A;  1U5T A;  1XGO A;  1R1U A;  2D1H A;  3RPQ A;  2IA2 A;  2MD5 A;  4RAY A;  3R61 A;  5TJJ A;  1J0R A;  3ZN0 A;  2KIF A;  1J9I A;  4CO8 A;  2G7U A;  1I27 A;  5FLX K;  2Y75 A;  4P5O A;  2DT5 A;  1W5T A;  3CJN A;  3QP5 A;  3ECH A;  4PZJ A;  2VC1 A;  1TW2 A;  2X4H A;  3HSE A;  1QPM A;  4PDK A;  2E1N A;  3W6J B;  1R36 A;  5KVR A;  2ZME B;  2QUF A;  1F4K A;  1ON2 A;  5L3G A;  3FMQ A;  2GQQ A;  4AIJ A;  2IJL A;  2V1U A;  3KZZ A;  2EFO A;  1BC7 C;  4ESJ A;  2F5E A;  2LDU A;  3ZMU A;  1FSE A;  4A0Z A;  4NB5 A;  5J8C A;  3FZV A;  1QQI A;  4IHS A;  2KRF A;  2FML A;  2XAG A;  1MDM B;  3K69 A;  2XHK A;  3DEU A;  4LMY A;  3T5X A;  4OMZ A;  1RNL A;  5LHH A;  4AIH A;  2VN2 A;  4G6D A;  1KU7 A;  4L5J A;  1KU3 A;  4BHP A;  2ETH A;  5A2Q K;  2FBI A;  1TNT A;  2Z5U A;  1BI2 A;  4XLN F;  4RB2 C;  3COA C;  3MFK A;  3J81 Z;  2HZT A;  3BJ6 A;  4OIR F;  1H9T A;  1AWC A;  3TQN A;  4EMS A;  2RN7 A;  4EQQ A;  2LSO A;  1I1S A;  1J7K A;  1LDK B;  3BDD A;  1IRG A;  3I54 A;  4IF4 A;  2UZK A;  1YQA A;  4U88 A;  4EM0 B;  2STT A;  2QBY A;  4OU0 A;  4CIC A;  1IAW A;  3GEZ A;  5L3D A;  3SQN A;  4BHC A;  5CYV A;  3I5U A;  4GYI A;  4I0B A;  1B59 A;  1IRF A;  1V4R A;  3FX3 A;  2A69 F;  1FY7 A;  3QOP A;  2ISZ A;  2DPU A;  3FF5 A;  5HDG A;  2HDC A;  1B1B A;  4LD5 A;  4RS8 A;  2ESN A;  2K86 A;  3GFJ A;  3WOD F;  3R0J A;  1HQC A;  4LFU A;  3BWG A;  2Y48 A;  3F72 A;  5TRD A;  2FU4 A;  4EGZ A;  3GUD A;  2RQP A;  4GGG A;  4OIO F;  3O2P E;  3K9T A;  4G9Y A;  2HS5 A;  2DQR A;  2IP2 A;  2CGP A;  2DO7 A;  2PQ8 A;  2P6S A;  1HST A;  4PCQ A;  5DDG A;  3J80 Z;  4M72 A;  2IPQ X;  4N9H A;  3LA3 A;  3KP5 A;  4KT5 C;  3JAM K;  3V7R A;  4UUV A;  2HEO A;  3LAP A;  1R58 A;  3I4P A;  3GW2 A;  4LB5 A;  4P96 A;  5LGU A;  4ENJ A;  2FF4 A;  1IN4 A;  1STZ A;  2IA0 A;  2ZO4 A;  2KKO A;  2VOD A;  3IHU A;  2VON A;  2ELH A;  5IT9 K;  2QZ8 A;  3TDU C;  1NHA A;  3CLO A;  2GZW A;  2ADU A;  1QO0 D;  2M45 A;  1E17 A;  4BH9 A;  4PGG A;  1R7J A;  2EB7 A;  3FMS A;  3WTT C;  2XIG A;  3DP7 A;  3SZT A;  1D8K A;  3V4G A;  1YFH A;  1KYW A;  2L4A A;  1Z91 A;  2CYY A;  2P5K A;  3WTX C;  2CFX A;  2R7D A;  2L4M A;  1E2X A;  3P9I A;  3C7J A;  3CUQ B;  4BHB A;  4YFK F;  1K78 B;  2DPD A;  5ICF A;  4EJV A;  1RI7 A;  2V1X A;  1GXP A;  1ZGA A;  4O3M A;  3WGH A;  5ED4 A;  4RAZ A;  5DYM A;  3HRS A;  2IW5 A;  3P9K A;  2XVC A;  4HW0 A;  1OYW A;  3Q9S A;  3QAH A;  1O3S A;  2LKP A;  2LF8 A;  2OU2 A;  5D6E A;  4I02 A;  2NS0 A;  4WXH A;  4WCG A;  3S2W A;  3KP7 A;  1FX7 A;  3BZ6 A;  3RPU A;  3VB2 A;  4Y17 A;  3NRV A;  3FWE A;  4HX4 A;  2W84 A;  5ICC A;  4HF0 A;  1G3W A;  5ICE A;  4A6E A;  4P9F A;  2K4B A;  1O7F A;  2L3D A;  4A0X A;  1LJ9 A;  4ZYD A;  1P4A A;  4HDU A;  3FMR A;  1J2X A;  2PBI A;  4Q47 A;  1XD7 A;  4UHT A;  1B6A A;  1B4A A;  1QGP A;  3ABU A;  3EQL F;  4HA8 A;  3E5X A;  2VOP A;  4IRG A;  2P5L C;  4U0V A;  1S8N A;  1XCB A;  1QNT A;  1YYV A;  2RKH A;  2R3S A;  3J81 K;  1P2F A;  2UXX A;  3GFL A;  3G3Z A;  4KIC A;  4ON0 A;  5ICG A;  1XGS A;  1JHF A;  3D0S A;  2ZKZ A;  1U8R A;  1FP1 D;  1FSH A;  4LK0 F;  2ACJ A;  2P4W A;  2PN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...