5HVQC

Alternative model of the mage-g1 nse-1 complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
238
structure length
236
Chain Sequence
GVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Melanoma-associated antigen G1
publication title Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 236
sequence length 238
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07574 SMC_Nse1 Nse1 non-SMC component of SMC5-6 complex
C PF08746 zf-RING-like RING-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hvqC02
1.10.10.2370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hvqC01
4BH9A 4PZJA 2DQLA 3H92A 1XSDA 3ELKA 5ICGA 5IT3A 5JVTA 5DD4A 4LG0B 1J75A 1R5HA 3I54A 2EB7A 1SD5A 2NYXA 2FF4A 5ILSA 5JFRA 1B59A 4EQQA 1TQMA 1W7PB 1IUYA 1TNTA 4RB0A 3T8TA 4WXCA 5E1XA 2OU2A 4M71A 2AXLA 2V79A 3QP5A 4U7BA 4IPAA 4OOIA 2ZCWA 2R7FA 4M9ZA 5FD5A 3MZHA 2J5OA 1TW3A 4MTEA 2EFNA 3GUDA 1KQ0A 2L54A 3OOPA 1SMYF 2HKOA 1B1BA 1AWCA 2XAQA 1GVJA 3WU0A 4QLCU 4MHGA 2Z9OA 5TRDA 2KJCA 2GA1A 2L4AA 2X0LA 4N9HA 1J0RA 5DCMB 4CGZA 2QZ8A 3FZVA 4A12A 1XMKA 5CVUA 3IC7A 2M30A 4BNCA 2L01A 1XGSA 1R7JA 2KJBA 1TQIA 1TW2A 4BYYA 1TBXA 2JZYA 5E8GA 2K4BA 3V4GA 3K1NA 4DQ2A 5JI6A 3HHGA 2FNAA 5IT9Z 5K1YA 1XGOA 1MD0A 3GW2A 3HSFA 2VBZA 3RTRA 3F8MA 1MJAA 2RNJA 3F6OA 2Z3YA 4YFKF 2YPRA 5K5RA 4EJWA 3LA7A 2ACJA 3WODF 2VOPA 3BDDA 4ENJA 2P6TA 4HF0A 3CUQC 1BBYA 4LLNA 4N0BA 1Z05A 4HF2A 3ML6A 4CXFA 1IN4A 4B09A 3C18A 5HLIA 4WF2A 5IT9K 3FWEA 3KP3A 5ICEA 2DTRA 1B9MA 1R1TA 2QYOA 3VOEA 3KEQA 5BMZA 3BWGA 3I53A 2RQPA 2EV6A 3L2CA 2GAUA 4HZFA 3ZMZA 1MJ9A 2EFPA 2NNYA 2VT2A 1W7PD 2FNPA 4Q5SF 3V7SA 5HVQC 3E5XA 3TO7A 2ZFWA 2G7UA 1HKTA 1S7AA 1ZLKA 3SXYA 3WTWC 1DDNA 1HSJA 2PQ8A 1BJAA 2Z99A 4CO8A 2V6CA 5FLXZ 4OIQF 2PMUA 5ERIA 3IKTA 2BEOA 1ODDA 4HQMA 4HBLA 4IRHA 1F5TA 3WTYC 1XDUA 4FX0A 1FPQA 1ZN2A 4GYIA 4OU0A 1IXSB 3REOA 2QQAA 1QZZA 1TNSA 1OPCA 1E2XA 1EV7A 1K78A 1KA8A 1P4AA 2FMLA 1XSVA 3HYIA 1STZA 2DAOA 3HIFA 2KIUA 1FYKA 4ESFA 2L4MA 4WCGA 3FX3A 1FBSA 1WSUA 4RS8A 1PUEE 4I0BA 3LSTA 3BOQA 3E6DA 1RUNA 4LB5A 2IJLA 1U5TA 4PCQA 4LLGF 4ZZLA 3HSRA 3IRRA 3ZMTA 1LDJA 5L3DA 2LNBA 3BY6A 4AD9A 1R5GA 1MZBA 2GXGA 1R36A 3HRSA 3ZN0A 1HW2A 5HS8A 1Z6TA 3QU6A 5HDKA 4JK1X 4HLYA 3IRQA 1EH8A 3F22A 4XSZF 1G4DA 1KYWA 2ZBKA 4LFUA 3O6BB 1XGMA 4LD5A 3CLOA 1T2KA 2HYGD 1USSA 5F6FA 2ETHA 3LAPA 3RKWA 1UFMA 4L5IA 3ZMDA 4HLXA 1L0OC 4UV9A 1H0MA 5LRRA 4GO1A 4IVNA 4A0XA 1FYMA 2WTEA 3W6KB 3R61A 5E18F 2XASA 4U7DA 4ZYGA 3WG9A 2VE8A 3C7JA 1ULYA 1O3RA 2O8XA 1IN6A 3K9TA 1J9IA 2ESNA 1IXRC 4UUVA 4EV0A 5BOXA 3L7WA 2X4HA 4HOBA 4OIPF 4R8HA 1HXDA 1ON1A 2MLGA 4ENNA 1WQ2A 3I5UA 4LK1F 2Z33A 5FFXA 1GXPA 3E97A 1K79A 1WWXA 5EEGA 5DDGA 5HDGA 2GWRA 2WV0A 1XCVA 4Q48A 1I6XA 4AWXB 4UV8A 5J6XA 4I98B 1V3FA 3RKYA 1C0WA 4HA8A 4UVBA 4KMUX 3R6SA 4LLLA 1G6NA 2M87A 1L3LA 1G3TA 4CDGA 3V8LA 5TJJA 4ZH4F 3WE3A 1K78B 2PEXA 5J8FA 2PMHA 1HQCA 4L9TA 4I01A 2L3DA 1SAXA 3RPUA 1IN8A 3B73A 2DW4A 1USTA 5D4SA 3IWFA 3FMQA 2IRFG 2CSOA 4MEYF 5EEHA 5CVJA 1I5ZA 5L3GA 2XIGA 2XAFA 4GXOA 1BI3A 3KFWX 2GXBA 2M5WA 2MBFA 4U0VA 3F8BA 1YG2A 1FC3A 3F8FA 4UNOA 2IT0A 2UXNA 1U5TB 1MJBA 2FMYA 2MLKA 4RAYA 4IJAA 5LEKA 1H9TA 2QLZA 1YS6A 4BXUA 1IRFA 1KU3A 2EWNA 3KP6A 1O7LA 1OYWA 3IHUA 2WC2A 3RKXA 4KDPA 1LJ9A 2K27A 2ZXJA 1LNWA 3J7AO 1FBQA 5LLQA 2CWEA 2W84A 2DQRA 3FXQA 4WX9A 1YW7A 4KIFA 1Z7UA 1HBXG 1RIOH 1ZG5A 2H6BA 2ZO4A 3M7GA 3V7RA 2EA2A 4HDVA 3V8KA 4B8XA 4YFXF 2P7VB 2V1XA 1I1SA 1ZGJA 2RGVA 2G9WA 2XKOA 5ILUA 2Y0MA 2P5VA 5E1WA 3D0SA 4UHTA 3CUQA 4A0YA 4RGXA 3SZPA 4XRFA 1KQ9A 1BC8C 3PFIA 4HQEA 2LSOA 3ZMSA 3V8JA 3ZQ7A 3MFKA 3RYRA 3M8FA 1QGPA 2H94A 2QQ9A 3MCZA 2JT1A 2PFBA 2XRNA 1FX7A 1XGNA 4MTDA 2V1DA 1XCBA 2O3FA 2CFXA 1FZPB 4I7HA 3SHFA 1ZARA 4XBFA 4HYEA 2DBBA 2CW0F 4RB2C 1U2WA 3KP7A 3PQJA 5LGNA 4MNUA 3DF8A 2VODA 2TDXA 1HW5A 4A6DA 2A68F 2DPDA 3C1DA 2MA3A 2HR3A 1LDDA 3RPQA 3JTHA 2XAGA 1S6LA 5ED4A 2R3SA 3I0TA 2PI0A 3G3ZA 1F1ZA 2DI3A 3MQ0A 1FLIA 4DNCA 2EFQA 2KIMA 3DPTA 4R79A 5KVRA 1PDNC 1MKMA 4OINF 2M1BA 4U0WA 3CDHA 1KGSA 3WTZA 1OR7A 4HW0A 1DUXC 4L0ZB 1IW7F 1YW8A 4RGSA 4OMZA 2XAHA 4FT8A 3I71A 2K86A 5BPIA 2DPUA 4ZYHA 5E1ZB 3F21A 1I27A 1IF1A 1RUOA 3LFKA 1GXQA 2GA2A 2XROA 1FP1D 3N4MA 5K5QA 4HDUA 2W24A 4EGYA 4L0YB 1E17A 3FXRA 4ASNA 1JXSA 2RDPA 1R00A 2CGPA 2Q2EA 4EVIA 3CO6C 2ZKZA 5HDNA 2XVCA 3ERED 2YX4A 2PJPA 1LB2A 1XMAA 2ADUA 4IXAA 4LK0F 1J5YA 2EV5A 2HQNA 5KK1A 2UXXA 4NB5A 3GF2A 5CJ9A 2OQRA 3GYHX 6PAXA 5FD6A 1D3YA 3BJOA 2NAZA 1HSTA 3KEOA 2QENA 3M9AA 5F1RA 4AIHA 4U88A 3U1DA 3VODA 4ZYDA 1DPRA 2ZJ2A 2W85A 3HRTA 1O3QA 3FM5A 1FOKA 2ELHA 3CUQB 4S05A 1D8JA 4EJUA 2V1UA 3O2PE 5LHHA 4A0ZA 1RZ4A 1KYZA 1B4AA 2XKPA 3WGIA 4AVPA 4UVCA 3J80Z 1YO5C 3ABUA 3JSPA 3WTUC 2Y75A 1LDKB 2FSWA 1G3YA 2MH2A 3T8RA 1BOAA 3R60A 4A5MA 3GFJA 1LEAA 1S8NA 2HKXA 4WXDA 4NQWA 4PGHA 4MGRA 1LQ1A 1MDMA 2LKPA 4G6DA 2VN2A 3WU1B 4HX7A 1ZLJA 1BC7C 5HOOA 4G7OF 4IRGA 1FP2A 3KETA 2YU3A 4WXHA 3S2WA 2VBYA 1AOYA 2E1NA 3FMRA 2IVMA 3GEZA 4L18B 2STTA 2K02A 3OV8A 2D1VA 2HWVA 3ECHA 4EJTA 4RB3C 3KZZA 4PDKA 2Z5UA 3QU3A 2EK5A 2NNNA 3J80K 4ENKA 2HTJA 1T6SA 1R1UA 2XHKA 3FXUA 1ZRFA 3I4PA 4S04A 4Q4ZF 1CF7A 1ZRDA 1QPMA 4EM1A 3JTGA 2F5DA 3KLNA 4FHTA 3TOBA 4CYDA 2BBYA 4HX8A 3NQOA 1FYLA 3KLOA 1QNTA 1BN5A 4XSXF 4RAZA 3RDIA 2A07F 2MD5A 2PN6A 4M9XA 2F2EA 2Y48A 2VBXA 5LBQA 1P92A 3EDPA 4A2UA 1A04A 1ZG1A 1P4WA 2EA4A 4OIRF 2P5KA 5ICFA 3KZYA 3CO7C 4HF1A 1P2FA 3GX4X 2M8EA 2VONA 2H6CA 5DD8A 4M74A 2CO5A 1I1GA 2IA1A 2FU4A 3GWZA 3KP5A 1UB9A 3KP4A 2BYVE 2R7DA 3KE2A 1QQIA 3I59A 1QO0D 3HRMA 5D5XB 3E5QA 3E6BA 3QPTA 4XLPF 4CICA 2QVOA 3QP6A 3BPVA 3GFMA 4HV6A 4KT5C 4WWCA 3HUGA 4A5NA 1GHCA 3ZMUA 1YIOA 1T38A 3U2RA 3HOTA 1JHHA 2QWWA 2HOEA 2XGXA 1IAWA 2FE3A 1SFUA 3EQLF 4FX4A 1DP7P 3LQRA 2F5EA 5AONA 1T98A 1Z6RA 2OQGA 5L3CA 2MC3A 1F4KA 2UZKA 4I0AA 2JPCA 1S7OA 2E7XA 1FSHA 3COAC 1BI2A 2YR2A 4CZZA 1Z9CA 2YX7A 4L5JA 3MAJA 3TKYA 2M45A 2PBIA 3QOPA 1T39A 4HV5A 1J59A 1D5VA 3SZTA 1XDSA 1J7KA 2LF7A 5LGTA 1PP7U 2P5LC 3VB2A 2RN7A 1CF7B 2ZMEA 2VE9A 3K1MA 5H6RA 4F7ZA 3ZMVA 2UWMA 4H0EA 2LF8A 3F6VA 3I64A 4E70A 3MEXA 3DV8A 3P9CA 3BP8A 3BZ6A 1RNLA 2H27A 4I2OA 2O61A 1SFXA 1YQAA 5D5VB 1ON2A 2RVCA 3AAFA 2OZ6A 3GVAA 3HTUA 3VFZA 1ZHFA 4O3MA 3LWFA 3DKWA 3LAJA 3HOSA 4MQVA 1LEBA 5FB2A 4N9IA 1SMTA 2EFWA 3LA3A 4P5OA 3RIRA 5D5WB 1FWZA 4KFCA 2P8TA 4Z2YA 2VC1A 4QWQA 3DPLC 1Q1HA 5FFZA 1PP8F 2W57A 3TO9A 2C6YA 1XD7A 2DLLA 1SFEA 4MQ9F 1XN7A 4P9UA 2CYYA 2FA5A 3I59B 3TDUC 3H3ZA 2FOKA 3F8NA 3GFLA 3DQVC 4GCVA 1S29A 1R22A 3R0AA 2G7HA 3Q5FA 2JSCA 2HDCA 2FXAA 3EETA 5E17F 1U3EM 3MWMA 5ILVA 2P7CB 4Y13A 3SFZA 1OYYA 3DXJF 1REPC 3IKVA 2COMA 3ZN1A 4ZZDA 5AIPA 2MH9A 4BAYA 1IN5A 1ZH5A 2DT5A 5A2QZ 3EYYA 1YS7A 1U78A 1KU9A 4YIFA 1TTYA 3WTXC 3K69A 5D5UB 2FRHA 4M6XA 2E7WA 4LJZF 4D0PA 5BS6A 4XLNF 1UHWA 2A3SA 4GYGA 4L9JA 5DYMA 1Y0UA 3KP2A 5D6FA 3Q9VA 3BJ6A 1W5TA 3E6CC 3HHHA 4RGUA 3E3VA 4OIOF 4GGGA 3CUOA 3L00A 2QQBA 3DEUA 5DUIA 4EJOA 2ZMEB 1FBUA 2AS5F 3WTVC 2IA0A 4BQAA 3DP7A 5HLHA 2ZNZA 4M6YA 5A2QK 1FNNA 1K6OA 4AIJA 4IHSA 5LHIA 5DUKA 1OMIA 5AIQA 2JRTA 3BJAA 5E8IA 3PQKA 4IHTA 2F5CA 3P9KA 2IPQX 4LB6B 1FSEA 3R0JA 3H3UA 1BI1A 3MZYA 1O3SA 4WK8F 3E6MA 3O3KA 3IWZA 5HS7A 4KMFA 2QBYA 3FHZA 2HEOA 1R23A 1IXCA 2A61A 3HRUA 1D8KA 1ZG3A 1Z1DA 4O5VA 2STWA 4KNYA 3F3XA 4YIIA 1B6AA 3M1EA 2DO7A 5H6QA 4YG2F 1ONVA 4P9FA 5L3EA 2O03A 2B0LA 3V7CA 5L3FA 4JBAA 3CJNA 2D45A 3WTSC 3ABTA 5HS9A 3FMSA 3ROUA 1G3WA 4EM2A 5JR3A 2XAJA 5FGMA 2O0YA 4KUMA 5D6EA 2ZNYA 4I02A 2BV6A 3ISPA 5CVVA 2LDUA 1EH6A 2CQKA 2A69F 2OAZA 2PG4A 1K7AA 1ZREA 3FF5A 2JPBA 4G7ZF 2GIVA 1QBJA 1S3JA 1KU2A 3NEUA 4L9NA 2HFHA 4ON0A 2VBWA 1BM9A 1LVAA 4HX4A 4M72A 2HGCA 2CG4A 4ZYEA 1O3TA 1W4MA 4LMYA 5CLSA 3RI4A 4TV7A 1P4XA 5LGUA 1ZAOA 1ZYRF 4EMSA 4LGWA 1T0FA 2A6EF 2F5FA 2IA2A 2E1CA 1QZYA 1WKMA 2DK5A 3WGHA 1P6RA 5CYVA 5LEJA 4KA4A 1ZGAA 4KN7X 4UVAA 1JGSA 1EH7A 4Y17A 2HTSA 3WGGA 4EM0B 1X3UA 1YLFA 3F72A 3K0LA 1IZ1A 1NHAA 3M8EA 3R4KA 2EJRA 4UXNA 3T5XA 3TQNA 4CHUA 1VTNC 2ISZA 2J5PA 2QUFA 5BQTA 4EGZA 3TDZC 2P4WA 5LHGA 1BI0A 2ISYA 1YYVA 2DK8A 3P9IA 2RC4A 2EFOA 1SD4A 2DFIA 1OYIA 3L9FA 3LQQA 2KRFA 4I09A 2Q8KA 3WE2A 1ZRCA 5FLXK 1YFHA 1J2XA 1HKQA 4EJVA 3B02A 3JW4A 2EV0A 2QBYB 4NHJA 4AIKA 3HTSB 2HZTA 5BPDA 3N97A 2D2WA 2VOOA 1W5SA 2K7LA 3L09A 2KKOA 2OD5A 3I58A 3EUHA 4ESJA 2WWYA 4G7HF 4RB1A 3QAHA 2V9VA 2L02A 3BPXA 3VEPA 2FBHA 5E20A 3LA2A 1YW9A 1BIAA 4G94A 3E5UA 2NS0A 5CVIA 2XV4S 3GZ5A 4BHPA 3JAMZ 4JQFA 3RYPA 2W25A 1XSXA 3RJPA 3GLXA 4A6EA 2BGCA 1WI9A 4KIBA 2A6HF 2OZUA 1CGPA 1RI7A 1UCRA 2D1HA 4BHCA 2ESHA 3Q9SA 1KQ8A 3EYIA 3NRVA 2HS5A 3BROA 3T1BA 4IRIA 3J81Z 4ETSA 3GO5A 3ZP5A 3TOAA 1B9NA 2OA4A 4L9VA 2BE5F 4LG0A 1U8RA 2KIFA 4Q47A 1JE8A 1MDMB 4KYWA 3TGNA 3JAMK 4G8XA 1Z91A 3FM3A 2QM3A 2VC0A 1SD7A 1W7PA 2FQ3A 3DFGA 3U9GA 3F8CA 2FBKA 4IF4A 3ECOA 2GZWA 1UHMA 1FT9A 2RV8A 2FBIA 3QRFF 5H20A 2XUBA 2P6SA 3K2ZA 3WTTC 3G73A 1XB4A 3J81K 1WRJA 1G3SA 3P7NA 1JHFA 5DCFA 1V4RA 3C3WA 5D8LB 4M9SA 4OMYA 1O7FA 5L3BA 2FEZA 1MGTA 2PLYA 2DU9A 2HQRA 4M73A 3K1PA 2K4JA 4YFNF 2OBPA 4ESBA 5LRSA 1H9GA 2VXZA 3HSEA 2A5YB 5DCMA 2Q0OA 4G6QA 5DV5A 1U5TC 2JTVA 1IRGA 5DEQA 1KU7A 2YSRA 3W6JB 5F64A 3ZPLA 5J8CA 4KN4X 1OKRA 4HAMA 1YTYA 1R1VA 5D4RA 3IL2A 1FY7A 4G9YA 4RGRA 1O57A 1SD6A 1DPUA 4Y15A 4MEXF 3SQNA 5JHUA 2RKHA 1TQPA 5ICCA 2GQQA 1TLHB 2IW5A 4P55A 3F23A 3GXOA 2O6GE 3QPHA 3GFIA 5HLGA 5K5OA 1R58A 4R1HA 3T0YA 2HYFA 1IN7A 5FO5A 4PGGA 4BHBA 1U6GA 3GZ6A 4U0YA 1BIBA 1F9NA 4ENMA 1HW1A 5CVRA 3ULQB 2H09A 2IP2A 1HKSA 5D8KB 4O6JA 3D5LA 3TO6A 4K2EA 4P96A 2VT3A 4KICA 3KCCA 3JSOA 4KIGA 3CTAA 2NRAC
chains in the Genus database with same CATH superfamily
4BH9A 3L2WA 4IZZA 3K7AJ 4PZJA 3TMOA 2DQLA 3H92A 1YJWI 2DFHA 1XSDA 3ELKA 5ICGA 2JA5J 5IT3A 4FQGA 5JVTA 1WJDA 4AIDA 5DD4A 4BKXA 4LG0B 2X6OA 1J75A 1R5HA 3I54A 3GLLA 2EB7A 1SD5A 2NYXA 2KQRA 2FF4A 5ILSA 5JFRA 2DT7B 1B59A 3HBLA 4XRMA 5TGTA 4EQQA 1TQMA 2NXNB 4E7ZA 5GPAA 2H1LA 2EH3A 1W7PB 2M34A 3S14J 3BZKA 2JUCA 4BQNA 4FTHA 1WVRA 2VKEA 2WAFA 1IUYA 1TNTA 3CJRB 4RB0A 3T8TA 4WXCA 5E1XA 2VKDA 1S5LC 2OU2A 3OSGA 1SFOJ 1MMSA 1U0JA 2DMNA 3I9V2 2ID3A 4HSRA 4M71A 1HA8A 2AXLA 2V79A 5KCMA 3QP5A 4U7BA 4NNJA 1ZK8A 4IPAA 1Y39A 2X1CA 4OOIA 4ZDPA 2E2HJ 2DA4A 2ZCWA 5KAFC 1NK3P 2R7FA 4M9ZA 5FD5A 3MZHA 2J5OA 1TW3A 4MTEA 3QYBA 2EFNA 4UB8C 5IOYA 1N77A 3GUDA 1KQ0A 4Y33A 2L54A 3OOPA 3PFYA 1SMYF 2HKOA 2KL4A 1B1BA 2X6YA 1AWCA 2XAQA 1GVJA 3DTKA 4D7NA 1BA5A 3WU0A 4QLCU 1X2MA 4MHGA 1KZHA 4A69C 2Z9OA 4XKBA 3OR2C 4XLEA 2KJCA 5TRDA 2GA1A 1LE8B 2L4AA 2CUZA 3I3LA 1R49A 1XTAA 3A01A 3FBIB 5IP9J 3S16J 2X0LA 2IXSA 4N9HA 4I6ZA 1HCRA 3L1PA 1J0RA 5DCMB 4AUXA 4H4KC 4CGZA 2QZ8A 3FZVA 5IY5H 5DM7F 4A12A 1XMKA 5CVUA 3IC7A 4GRIA 1MBFA 2M30A 4BNCA 2L01A 2XAUA 1B8IB 1XGSA 3IP4B 3CP2A 1AA7A 1JI8A 1R7JA 1AKHA 2KJBA 4QIWN 1TQIA 2M7AA 1TW2A 3KEYA 2OTLI 3HOWJ 1VNDA 4BYYA 2R5ZB 1TBXA 2JSPA 2JZYA 2WV1A 5E8GA 1ETOA 2K4BA 3V4GA 3K1NA 4DQ2A 4YELA 3L2UA 1WGXA 4XLAA 5KHDA 5JI6A 3HHGA 2FNAA 1QRYA 4UUSB 2ID6A 2JA6J 1I6HJ 5IT9Z 2LTPA 3RZDJ 1XX5A 2KZGA 4JX6A 5K1YA 1VF9A 1GUUA 1XGOA 4CA0A 5EEAA 2ZB9A 2ZFUA 3SDGA 4C3JJ 1MD0A 3GW2A 4E7KA 3HSFA 4F55A 5J4YA 2VBZA 1IRZA 3RTRA 2IS6A 2XF5A 3F8MA 1MJAA 2RNJA 2HVQA 3F6OA 2Z3YA 4YFKF 3B6CA 2YPRA 4A3FJ 3K4CA 1ETVA 2LH9A 5K5RA 2BW3A 4EJWA 2E1MB 1V54H 2LBFA 3LA7A 4XOTA 4X6AJ 4BEHB 4J01A 2ACJA 3WODF 2VOPA 1MSFC 3BDDA 1JKQC 1D1BA 2GBYA 4ENJA 2PJRB 4DBQA 2P6TA 4HF0A 3CUQC 1BBYA 3H0DA 2W48A 4N0BA 4LLNA 1Z05A 2IGNA 3HOUJ 1X4PA 2FUG2 4HF2A 4BJ5C 3ML6A 1ETWA 4PFOA 4CXFA 1IN4A 4B09A 3C18A 1X1BA 5HLIA 4WF2A 2MD0A 2R5YA 1V5EA 3CCRI 3KYLA 3OIPA 5IT9K 1ZGWA 1X4OA 1T33A 3FWEA 3KP3A 3CJQB 2VASA 5ICEA 2ECBA 2DTRA 1B9MA 1VQ5I 3VPRA 1R1TA 1LFPA 2QYOA 3VOEA 5B1BH 3KEQA 1TWAJ 4HNVA 5BMZA 2VPLA 3BWGA 1WJFA 3I53A 2RQPA 2EILH 2EV6A 3L2CA 2GAUA 4HZFA 3ZMZA 3BTCA 1MJ9A 3EUAA 2EFPA 3BQZA 5JLXA 4B4CA 2R7VA 2NNYA 2VT2A 3OSFA 5M5WJ 3UNGC 1W7PD 4A3GJ 2FNPA 3HGGA 4HPQA 1WI3A 4Q5SF 4DJAA 2FOWA 3V7SA 5HVQC 5LD2C 4GFBA 3E5XA 3TO7A 2ZFWA 5FLVA 3LL7A 2G7UA 1HKTA 2OCCH 1UG0A 1S7AA 4L5EA 1V5FA 2HDWA 3BG6A 1ZLKA 3SXYA 3WTWC 1DDNA 3S2HJ 1HSJA 1WPKA 2PQ8A 1BJAA 1R5ID 2Z99A 4CCMA 1LFBA 4CO8A 3RQIA 2WAEA 3BG7A 2LFBA 1DGRM 2V6CA 5FLXZ 4N4NB 4OIQF 2PMUA 3WHCA 5ERIA 2EZHA 3IKTA 1TZLA 4KJZA 4B43A 2BEOA 1ODDA 4HQMA 1NTCA 1LVKA 4HBLA 4IRHA 1F5TA 3AKZA 3WTYC 1K61A 2MFZA 2M8GX 1XDUA 2JVGA 4FX0A 1FPQA 1ZN2A 2WA0A 3I4MJ 4GYIA 4OU0A 1IXSB 2HOAA 3REOA 2QQAA 3DEWA 3TW6A 3K6GA 1QZZA 1TNSA 1OPCA 1E2XA 1EV7A 1K78A 1KA8A 3ZQLA 4DYRA 2EZKA 1P4AA 3VSLA 2CQ7A 1OR7C 3SJMA 2X6WA 3ZQQA 2FMLA 1XSVA 3HYIA 1STZA 2DAOA 1SANA 3HIFA 2KIUA 1FYKA 3DWLE 2ELKA 3A01B 1D0YA 1FIPA 3K70C 4CCJA 1V5GA 3S15J 4ESFA 2L4MA 2MC4A 1JUMA 4F91B 4WCGA 1X58A 2NS8A 3FX3A 1FBSA 2CUJA 2VQLA 1WSUA 2L9SA 4EEFG 2H8WA 2KDOA 4RS8A 3RCOA 1S72I 1R71A 3I56I 5DS9A 2HQ5A 4I0BA 1PUEE 3LSTA 1M1EB 3BC8A 3BOQA 2BHYA 1BW5A 3E6DA 4RMNA 2I8DA 2QSHX 3OS1A 1RUNA 1VQ4I 4LB5A 2K85A 2IJLA 1U5TA 4PCQA 2Y69H 2N8GA 3VYTB 4LLGF 4ZZLA 3G71I 1JTYA 2L9VA 3HSRA 2HZDA 3IRRA 3ZMTA 1LDJA 3NWTA 2HOSA 5L3DA 4M3GA 2LNBA 3BY6A 4AD9A 3OOUA 1R5GA 1GV2A 2L7MP 2V1NA 1MW7A 1MZBA 2GXGA 3ZQFA 1R36A 3HRSA 3ZN0A 2LYCA 1FJLA 3H35A 1HW2A 5HS8A 2DFFA 3ZXSA 1H89C 1YE9A 1X3WB 1Z6TA 3QU6A 5HDKA 4C2UA 3OYJA 4JK1X 4HLYA 3DTEA 3IRQA 1Z7LA 1EH8A 3F22A 4XSZF 1G4DA 1KYWA 2ZBKA 4LFUA 4IKFA 3O6BB 3S93A 2D5VA 1XGMA 3DU5A 4LD5A 4PJ0C 2VB6A 3CLOA 1T2KA 2GM4A 2HYGD 3PNVA 2LBFB 1USSA 3FXOA 4UB6C 5F6FA 3ABKH 2ETHA 3LAPA 1QZEA 2VKVA 3RKWA 3H9JA 1UFMA 4L5IA 3ZMDA 4HLXA 1FTZA 1L0OC 4UV9A 1H0MA 5LRRA 4GO1A 4IVNA 4A0XA 1FYMA 2WTEA 3W6KB 3R61A 2F4MB 5E18F 2XASA 1SVOA 4RAGA 4U7DA 4ZYGA 2HPIA 4YRVA 3WG9A 3FIWA 2VE8A 4KIGA 1N78A 3C7JA 1ULYA 2E5NA 1O3RA 2O8XA 1IN6A 2JN6A 3K9TA 4XRSA 1POGA 2AHQA 1TL8A 1J9IA 3K4BA 2ESNA 3S32A 1IXRC 2VJ5A 2LLKA 2KHMA 5E79C 1ZKGA 4UUVA 1BL0A 4EV0A 5BOXA 2HI3A 2X4HA 3L7WA 4HOBA 3Q3SA 4R8HA 4E4HA 4OIPF 1HXDA 4MO7A 4BJ6C 1W5CC 4PJLA 4ZDOA 3AG1H 1ON1A 3CMEI 2MLGA 5M3FJ 4LOCA 4ENNA 1WQ2A 3JRCA 3I5UA 3BZCA 3DPUA 4LK1F 2Z33A 1UELB 1OCPA 5F0HA 5FFXA 1GXPA 2XGDA 1Z67A 3E97A 2XPUA 3BCAA 1K79A 4ABZA 1WWXA 5EEGA 4V2FA 2HVSA 5DDGA 3RKQA 4PSWA 4FE7A 4CH7A 5HDGA 1DGWY 2GWRA 2FX0A 3M1CA 2RAEA 2KRCA 2A5WA 2EPFA 2M4KA 3EUKL 2WV0A 5IYCJ 2X85A 1XCVA 4Q48A 1I6XA 4W97A 4AWXB 3HC7A 4UV8A 2V26A 5J6XA 3OIOA 4I98B 1V3FA 3RKYA 3PO2J 1C0WA 4HA8A 4UVBA 2LD5A 4KMUX 2CS3A 4M3BA 1ETXA 3R6SA 3L2RA 4LLLA 5IP6A 1G6NA 2ZXWH 3GMEA 5F1JA 3OS0A 5GP9A 4G6TB 1H8AC 1HC8A 2M87A 1L3LA 1G3TA 4CDGA 3V8LA 5TJJA 4ZH4F 2FQ4A 3WE3A 2DCEA 1K78B 3VYRB 1TWFJ 2PEXA 5J8FA 4FCYA 2PMHA 4C2MJ 1HQCA 1RPWA 4L9TA 3FK7A 4I01A 2L3DA 4IOCF 2ZJQF 4CZCA 1SAXA 5J1RA 3TP0A 3RPUA 3JRDA 4OAZA 3ZOBA 1IN8A 1NG6A 2VQCA 1V55H 3B73A 2DW4A 1USTA 5D4SA 3IWFA 5J47A 4XKCA 3FMQA 1PVEA 3DBLB 2IRFG 3X2QH 5HODA 2CSOA 4MEYF 5EEHA 3LSHA 2H1KA 5CVJA 3QPLA 3LNQA 3IH2A 2NVXJ 1I5ZA 4D1QA 5L3GA 2XIGA 4XLFA 2KP6A 4YIRX 2XAFA 2NVTJ 4GXOA 1BI3A 3HJEA 3KFWX 4XOPA 2GXBA 2M5WA 2MBFA 4U0VA 3KX2A 2L9RA 3F8BA 1YG2A 2KMUA 1FC3A 2DODA 3TBIA 3F8FA 4UNOA 2IT0A 3RSNA 2UXNA 1U5TB 2YS9A 1MJBA 2FMYA 2KRHA 2MLKA 4RAYA 4D9JA 4IJAA 5LEKA 3IAM2 2O7OA 2K9SA 4ANJA 1H9TA 4IHYA 5JVGF 2QLZA 1YS6A 1OCRH 4BXUA 1IRFA 2DFEA 1KU3A 2EWNA 3A0HC 3KP6A 1O7LA 3LSGA 1OYWA 3JRHA 3N05A 3IHUA 2CMPA 2NVUB 3ZRGA 2WC2A 4JP0A 3RKXA 4BGDA 2X6XA 3L2VA 2IGOA 2BY1A 3M8JA 4KDPA 1LJ9A 2K27A 2ZXJA 1LNWA 1R9TJ 3OYMA 3J7AO 1FBQA 5LLQA 5E3OA 2CWEA 2W84A 2DQRA 3FXQA 5F0FA 4WX9A 4BQOA 2VQHA 2CV2A 1YW7A 4KIFA 1GT0C 1Z7UA 4A93J 1HBXG 1RIOH 3LSPA 1ZG5A 5IYBJ 2H6BA 2ZO4A 3M7GA 3KYCB 2K9QA 1UAAA 3V7RA 3FXMA 2EA2A 4HDVA 3S3OA 3V8KA 1MH4A 4B8XA 3O8HA 4YFXF 2Y2ZA 2P7VB 2V1XA 1I1SA 1MBGA 1ZGJA 2RGVA 2G9WA 2XKOA 5ILUA 2Y0MA 1RC9A 2P5VA 1W36D 1DQUA 3OR1C 1TP4A 5E1WA 2X9DA 2QGUA 3D0SA 3MKWB 4UHTA 5EG0A 2XC7A 3CUQA 4A0YA 1E0EA 4RGXA 4XN0A 3SZPA 4XRFA 1KQ9A 2L2OA 4CCLA 2DMUA 4XLCA 1BC8C 3WG7H 3PFIA 4HSTA 3GTQJ 4XNFA 1QA6A 4HQEA 3D5SC 2Z2SB 2LSOA 1OCCH 3ZMSA 3V8JA 3JREA 1UZCA 3ZQ7A 3MFKA 3RYRA 4A3MJ 3M8FA 1WHUA 1QGPA 1G59A 2H94A 2QQ9A 3MCZA 3ONQA 2JT1A 2PFBA 2XRNA 3A2KA 3CMAI 4BE2A 2LMDA 1FTTA 3ZR8X 1FX7A 2K9MA 4IOAF 2IS4A 1XGNA 4MTDA 4E7IA 1VQ9I 2KT0A 2DOFA 2V1DA 2YU9J 1XCBA 2O3FA 3I4NJ 2CFXA 1FZPB 1SAUA 3A02A 2QSGX 1I39A 4I7HA 3SHFA 1RKTA 1ZARA 1VQNI 2ELJA 2K9LA 2XSDC 3PJRA 4IHWA 5EJCA 1MSEC 3J7ZI 4IQJA 1FOWA 3ZQHA 4XBFA 4HYEA 2DBBA 3CCLI 2CW0F 2NOJB 1YJ9I 4RB2C 2V9PA 5B1AH 4M6VA 1U2WA 3KP7A 1JKOC 3CF5F 4LG3A 3PQJA 2EZLA 2GIZA 4M3DA 3CLQA 5LGNA 5HNHA 1VQ7I 4MNUA 2LG4A 2WB1N 5C4XJ 3DF8A 2I10A 1YX5A 1Z0XA 2TDXA 2VODA 4Y3OA 1IV8A 1HW5A 3CMMA 1A36A 2R4GA 3NAUA 4A6DA 3MN2A 2A68F 2DPDA 3C1DA 2MA3A 2HR3A 2WAQN 2ZMEC 1LDDA 5F27A 3RPQA 3JTHA 1WH7A 4DBRA 2XAGA 4AU7A 1S6LA 5ED4A 2R3SA 3I0TA 2PI0A 3G3ZA 1F1ZA 1BW6A 4NC6A 3O8GA 3U1KA 4Y7NJ 2DI3A 4IO9F 3MQ0A 3JRAA 1FLIA 3LMMA 4DW6A 4DNCA 4F3QA 2EFQA 2CQXA 2KIMA 3DPTA 2DN0A 3P5JA 1X1PA 4R79A 5KVRA 1PDNC 1UG2A 1YX3A 2VXDA 1MKMA 4ZTFA 5GAEJ 4A3CJ 4OINF 2M1BA 4U0WA 3CDHA 1I3AA 1KGSA 3WTZA 5M3MJ 1OR7A 2DYRH 5EF6A 4HW0A 1DUXC 1QVUA 1BR4A 4L0ZB 1MBJA 1IW7F 2LKXA 1YW8A 3W2VA 3DU6A 1H88C 2E19A 2ZC2A 1MNMC 4RGSA 4OMZA 2XAHA 3D5RC 4FT8A 2TRTA 3I71A 1BR1A 4BY7J 2K86A 2RQQA 3KYDB 5BPIA 1HLVA 5GPCA 3GTJJ 4ZYHA 2DPUA 4BBSJ 4E7JA 5E1ZB 3F21A 1I27A 3SEQA 1IF1A 3C2HA 3IH3A 1APLC 5BNGA 1RUOA 3LFKA 1Y0NA 1GXQA 2GA2A 2XROA 3BLYA 5IYDJ 4M3EA 1FP1D 4MFEA 3N4MA 1NG7A 5K5QA 4HDUA 2P0WA 1PYVA 2W24A 3DKXA 4EGYA 4DYQA 3CC4I 5B66C 3IAS2 4L0YB 3IUOA 1E17A 3FXRA 4ASNA 1JXSA 2RDPA 3HOVJ 1R00A 2CGPA 2Q2EA 4GDFA 4EVIA 3OYHA 3CO6C 2ZKZA 4CSWA 1JUPA 1NK2P 2V7FA 2E36A 4F93B 5HDNA 2XVCA 3FXKA 2DT6A 4XK4A 2YX4A 2EZIA 3ERED 2PJPA 1LB2A 1VQOI 2QCOA 3M3YJ 3CQZJ 1XMAA 2ADUA 4IXAA 4LK0F 1J5YA 2EV5A 2LVSA 1TT5B 2HQNA 5KK1A 3BR3A 2UXXA 2AXTC 4NB5A 3GF2A 5CJ9A 2OQRA 3CC2I 2HXOA 3E0JB 3GYHX 6PAXA 1GDTA 4Y52J 2CV1A 1ZTRA 5FD6A 2JA8J 1BJZA 1J09A 1D3YA 3BJOA 3CCQI 2NAZA 4B3XA 1HSTA 3G1MA 3KEOA 2L0KA 2QENA 2X1DA 5K7HA 3M9AA 5F1RA 4AIHA 4U88A 3FISA 3U1DA 3VODA 4ZYDA 1DPRA 1TWHJ 2ZJ2A 2W85A 3HRTA 2BHZA 1O3QA 3FM5A 2IS1A 1FOKA 1FOXA 5EG0B 3CUQB 1QVTA 2ELHA 4S05A 1D8JA 4EJUA 2V1UA 3O2PE 2E35A 5LHHA 4QPOA 3UKGA 2QKMB 1RZ4A 4A0ZA 4B44A 1KYZA 2BY2A 1B4AA 2XKPA 4S0HB 3WGIA 2OTJI 3K10A 4AVPA 4UVCA 3J80Z 1YO5C 3ABUA 4OWRB 3JSPA 4DOZA 2Y75A 3WTUC 1LDKB 4UY8I 3E1SA 3MZ8A 2FSWA 1G3YA 2NOGA 3DBHB 2KPMA 2MH2A 3T8RA 1BOAA 3R60A 4A5MA 3W3CA 3GFJA 3M07A 1LEAA 1S8NA 3DBRB 2HKXA 4WXDA 5CKTA 4NQWA 4PGHA 4MGRA 1LQ1A 2QKLB 1QHGA 1D0XA 1MDMA 3LFUA 1A31A 2LKPA 4G6DA 2VN2A 3WU1B 3LSRA 5CPRB 4HX7A 5FKNA 1ZLJA 5FJ8J 1JKPC 1BC7C 5HOOA 4G7OF 4IRGA 3FXJA 1FP2A 1K4SA 3KETA 1A35A 2VI6A 4JYKA 1YHQI 3W6VA 2YU3A 1K4TA 4WXHA 3S2WA 2VBYA 1AOYA 1IUFA 2E1NA 3FMRA 2IVMA 3GEZA 2A6TA 4L18B 2STTA 2VLAA 2K02A 4II3A 2E71A 4RM3A 3OV8A 2LREA 2D1VA 2HDDA 2HWVA 3ECHA 3OYEA 4EJTA 3CCYA 1OJLA 4RB3C 3KZZA 3JRFA 4PDKA 3ZQCA 2Z5UA 3QU3A 4XIDA 2QQ8A 2EK5A 1I50J 2NNNA 2CJJA 3J80K 4ENKA 2MSYA 4XN3A 2HTJA 2FJ1A 1T6SA 1R1UA 3HEFA 2XHKA 3Q0WA 4XKWA 3FXUA 4XKVA 1WJEA 3QPSA 1ZRFA 3I4PA 4S04A 4Q4ZF 1YI2I 1CF7A 1VQKI 1ZRDA 2AQEA 1QPMA 3RPUD 4BY1J 4EM1A 3GTMJ 3LOCA 5KAIC 2CV0A 3JTGA 3PSIA 3CCEI 2L9NA 2F5DA 1GLNA 2WB1A 3KLNA 5EYRA 3ABLH 4FHTA 1IC8A 1MBEA 1W0TA 5EZHA 2EIMH 1YJNI 3TOBA 4CYDA 4CYCA 2WAQA 2BBYA 4HX8A 3VWBA 3NQOA 3MKZA 1FYLA 3KLOA 2ZJRF 2OJED 1QNTA 3JCUC 1AU7A 1BN5A 2JQ7A 1ENHA 1AKHB 2NVYJ 2NVQJ 4XSXF 2EIJH 4BXXJ 5EDNA 2F6CA 2F4OB 4RAZA 3RDIA 2A07F 1UHSA 4P1WA 2MD5A 3TW7A 4W1UA 2PN6A 4M9XA 2E2IJ 2F2EA 2Y48A 2VQGA 1TC3C 2VIXA 2VBXA 3Q0UA 4CCOA 1TT0A 1P92A 3EDPA 5LBQA 2HQAA 5CQEA 4Y4RA 1A04A 2M2EA 4A2UA 1ZG1A 1P4WA 1ZQ3P 1X2NA 2EA4A 1NH3A 4XM3A 4OIRF 4HRIA 1PJRA 2P5KA 2LKSA 1WCMJ 5ICFA 1F36A 3OYCA 3KZYA 3CO7C 4HF1A 5E3MA 1P2FA 5C4JJ 2Q2EB 5FKOA 2WBMA 3GX4X 2JMWA 3K4LA 2Y31A 4PFPA 2ME6A 4JX5A 3F0CA 3OL4A 2R7ZJ 2FD5A 1Y56A 4B47A 2M8EA 4LITA 1MMNA 2VJ4A 2BW3B 2VONA 2H6CA 5DD8A 3SYTA 1MH3A 9ANTA 4M74A 4I99C 2CO5A 1I1GA 1Q1VA 1MNDA 3FKIJ 2IA1A 3GCMA 2FU4A 3GWZA 3KP5A 2VUMJ 3S1NJ 1UB9A 3LSJA 2E34A 3KP4A 2BYVE 2R7DA 3KE2A 1XPXA 3MKYB 4MLOA 1VQ8I 1QQIA 3I59A 1QO0D 3HRMA 3QYEA 3E5QA 5D5XB 3E6BA 3BR1A 5FROA 3K2AA 5FRNA 2UV1A 3QPTA 1IO2A 4XLPF 3C2BA 1Z3XA 2JUGA 2R5YB 2JK3A 1LUJB 2M9HA 1EF4A 3DLAA 2QVOA 4CICA 1SC7A 3BR2A 3QP6A 4RA2A 3BPVA 1YITI 3GFMA 1VI0A 4HV6A 4KT5C 3B6AA 4WWCA 4D5CA 2HVRA 1T8IA 4E6KG 2R7XA 3HUGA 4A5NA 1GHCA 3ZMUA 1YIOA 1T38A 3U2RA 4X0GA 3HOTA 2ICWG 1X3ZB 1JHHA 2QWWA 1ITYA 2HOEA 2XGXA 1IAWA 2DMTA 2FE3A 2X51A 4PUSA 3V42A 1SFUA 1HDDC 3EQLF 4FX4A 2VKHA 1DP7P 2OPTA 1T0FC 5DM6F 3LQRA 2F5EA 5AONA 4XRSG 5M5YJ 1T98A 2XDVA 1Z6RA 2OQGA 1QU3A 5L3CA 3JR9A 3ZQIA 2MC3A 3J7AY 1F4KA 1F43A 3HZJA 1JUSA 2UZKA 2XPVA 1BOBA 5DTDA 3GTGJ 4I0AA 3HKZN 2JPCA 1X1DA 1S7OA 2M0CA 2LC2A 2E7XA 1FSHA 3COAC 4XONA 4XORA 1BI2A 2YR2A 4CZZA 1Z9CA 3ZQGA 2DJNA 2YX7A 4L5JA 3MMYB 3HOZJ 1Y1WJ 3MAJA 1MBHA 2XB0X 2Y0SN 3HB9A 3TKYA 1JJ6C 2ECCA 3OYFA 2M45A 2K3FA 2PBIA 3QOPA 3BCBA 4JX4A 1IG7A 2KIQA 2Y9YA 1N75A 4HV5A 1T39A 1J59A 2W4SA 1D5VA 4UUTA 3SZTA 1XDSA 1J7KA 2LF7A 2BOLA 1FMWA 5LGTA 2K9NA 3S3MA 1E3OC 1PP7U 2P5LC 3VB2A 2BZTA 5J1UA 4EATA 2RN7A 1CF7B 2CUFA 3OS2A 2ZMEA 3FXLA 3J7YJ 4BJTA 2VE9A 3K1MA 5H6RA 2MGQA 3H1CA 4F7ZA 3ZMVA 3NWSA 1IRXA 1WZ2A 4ZDLA 2UWMA 2QEXI 1W1WE 4H0EA 2LF8A 1MMGA 3F6VA 3I64A 4E70A 1LE8A 3MEXA 2BY0A 3DV8A 3P9CA 1W0UA 1RR8C 2LK2A 3BP8A 3G4SI 3CCSI 3BZ6A 1RNLA 3OIQA 2H27A 1K6YA 4I2OA 2O61A 1SFXA 1YQAA 1IGNA 3S1MJ 5D5VB 1ON2A 1MMAA 2W00A 2RVCA 3AAFA 1Y6IA 2OZ6A 3GVAA 3HTUA 3CCJI 3SFIA 3HDDA 2CUEA 3VFZA 3FDYA 1ZHFA 4O3MA 3LWFA 1XC5A 3CMYA 3DKWA 3LAJA 4MIMA 2HU9A 3HOSA 3AG2H 3DTIA 1N25A 4MQVA 1XMXA 1WJAA 3K4KA 1LEBA 3PUFA 5FB2A 4IX7A 1RRJA 3GZNB 3MD2A 1D0ZA 2JA7J 4N9IA 1DU6A 3VDXA 4KT6A 2R5ZA 1SMTA 3TL4X 2EFWA 2L7KA 3LA3A 4BE1A 3EUHC 4FE4A 4P5OA 3RIRA 4UUSA 5D5WB 3KZIC 1FWZA 4KFCA 3BR6A 2P8TA 4Z2YA 2VC1A 3F9KA 4QWQA 3S1QJ 1ACIA 3DPLC 1Q1HA 2E2JJ 1PUFA 5FFZA 3E7LA 1IJWC 5F08A 2K3PA 2MYSA 1PP8F 2W57A 1Y8QB 1OQYA 3TO9A 2C6YA 2M4GA 1MMDA 1XD7A 2IEKA 2XPWA 3FKJA 5GAGJ 4ZJZA 2DLLA 1SFEA 3H0GJ 4MQ9F 1XN7A 2GOXB 3CESA 4P9UA 2DOEA 2L5QA 3OYGA 2CYYA 3H5NA 1OCOH 2FA5A 3I59B 3PUBA 2COBA 4XMYA 3TDUC 3H3ZA 3HPGA 3D1NI 4MFDA 4NC8A 1VQ6I 2DA1A 2PJRA 3QYFA 4DGWB 2JJ7A 2FOKA 3F8NA 3GFLA 4A3LJ 2G0EA 5FKMA 3DQVC 2TCTA 4BXFA 4CUGA 3HPHA 4GCVA 1S29A 1R22A 3R0AA 3AL0B 2G7HA 3Q5FA 2JSCA 3OYAA 2CU7A 2WADA 2HDCA 2FXAA 3EETA 5E17F 1U3EM 2XF7A 4Z6YA 2AO9A 4A3BJ 3MWMA 2DMPA 3CJTB 3DLLF 1T08B 5ILVA 2P7CB 2QF7A 4G12A 5J1YA 1HOMA 4PJNA 4Y13A 4IHVA 3SFZA 3PO3J 1OYYA 3DXJF 1REPC 4QTRA 2KZVA 2COMA 3IKVA 3ZN1A 4ZZDA 5AIPA 2GOMA 2ME0A 2MH9A 1WJCA 4U87A 4BAYA 1I3QJ 2GXAA 1ORKA 4DZJA 4B3AA 1LPQA 1IN5A 3SEZA 4E7HA 1ZH5A 1XS9A 2DA5A 2DT5A 2OC6A 5A2QZ 4LIUA 4XICA 1Z77A 1Z21A 2W7NA 3S3NA 3EYYA 3LSKA 1YS7A 1U78A 4PSXA 1KU9A 5KNLA 4YIFA 1TTYA 3WTXC 1EKEA 2LP0A 2CW7A 3K69A 1QPIA 5D5UB 2FRHA 4M6XA 1U9OA 2E7WA 4LJZF 3S8PA 4D0PA 5BS6A 1RR7A 2EIKH 4XLNF 3GTPJ 5FKKA 1UHWA 1HF0A 4HEA2 2A3SA 4GYGA 4L9JA 5DYMA 3CD6I 2UUZA 1Y0UA 3KPHA 2DA2A 1EJ9A 3KP2A 5D6FA 3Q9VA 1OCZH 1VQPI 3BJ6A 1W5TA 5GAHJ 4M3FA 3E6CC 3HHHA 4RGUA 3E3VA 3HKZA 4JOMA 4OIOF 2ZXIA 4GGGA 2NS7A 3BTIA 3CUOA 3L00A 2QQBA 1DP3A 2BXYA 3DEUA 5DUIA 5E3NA 4PJMA 3OYKA 2OCEA 4EJOA 2DA6A 1SEUA 2L7ZA 2ZMEB 5K7ZA 1FBUA 2CH0A 4QSHA 2AS5F 4X1EA 3WTVC 2Y0SA 2IA0A 1ZR4A 3DP7A 4BQAA 2LR8A 5HLHA 3K4JA 1A5JA 3L2QA 2ZNZA 3BTJA 2B9SA 3W2AA 4I76A 4M6YA 5A2QK 4BL0B 2LOOA 1FNNA 1K6OA 2R7OA 4AIJA 4E7SA 4IHSA 4ZC3A 5LHIA 2ZSHB 4HNUA 5DUKA 5J3LA 1OMIA 4BS9A 5AIQA 2JRTA 4ITVA 3BJAA 5E8IA 2GLOA 3PQKA 4IHTA 2F5CA 3P9KA 1U9NA 2IPQX 4J19A 4LB6B 1FSEA 2X48A 3R0JA 3H3UA 1BI1A 1JTXA 1P7IA 3MZYA 1O3SA 4C2TA 3HG9A 4IL6C 4WK8F 3GTOJ 3E6MA 2XGEA 3A1YA 3H36A 3O3KA 3AG4H 1OFCX 1A6QA 3IWZA 5HS7A 4KMFA 2QBYA 4DZPA 4KITB 4F92B 3FHZA 3BR5A 4RLFA 2HEOA 1R23A 1IXCA 2A61A 2XF6A 3HRUA 1D8KA 1ZG3A 3FBNB 1Z1DA 1SVMA 4O5VA 2STWA 4KNYA 4HNTA 2IGKA 4D5FA 1MIJA 3TP3A 1LFUP 3F3XA 4YIIA 1B6AA 2HYJA 1FIAA 3CDLA 2E1MC 3ASOH 5EGOA 3M1EA 2CW8A 2DMQA 2DO7A 3HOYJ 5H6QA 2MG4A 1PUFB 1SVLA 4YG2F 1ONVA 4P9FA 1YIJI 3LSMA 5L3EA 2O03A 1D5YA 1WFXA 2B0LA 1KONA 2DDBA 3V7CA 5L3FA 1FMVA 2IAIA 4JBAA 3CJNA 2D45A 4RLQA 4ZTJA 2IGMA 3WTSC 2O8KA 5LFAA 2M3AA 3ABTA 5HS9A 5JLWA 3FMSA 3H5RA 2ZSIB 3ROUA 2HOTA 1G8XA 1Z3YA 4E7LA 5CQGA 1G3WA 4EM2A 5B3SH 4IQ4A 5JR3A 2XAJA 5FGMA 2O0YA 4II2A 4KUMA 5D6EA 2MW8A 2ZNYA 4I02A 1RETA 2BV6A 5F0CA 4AYBN 3ISPA 5CVVA 2LDUA 1EH6A 1VZ0A 1QHHD 2CQKA 2A69F 2OAZA 4N4OB 3DKYA 2PG4A 3H9GA 1K7AA 3HXLA 4KISA 1ZREA 3FF5A 1BR2A 2A05A 3CZ6A 2JPBA 3LSIA 4G7ZF 4J00A 2GIVA 3BG5A 1QBJA 1S3JA 1KU2A 3NEUA 4L9NA 4DIQA 2HFHA 3S1RJ 3CCUI 1XG1A 4ON0A 3H3VK 2VBWA 3VYUB 3OWTA 3GTLJ 1BM9A 5H2FC 1LVAA 4HX4A 4M72A 2HGCA 2WY7Q 4XQFA 2O5RA 2CG4A 4ZYEA 2DA3A 1O3TA 1W4MA 4LMYA 5CLSA 1IDZA 3RI4A 1T95A 3DEEA 4TV7A 3G2BA 3S17J 3C2GA 1P4XA 5LGUA 1ZAOA 1ZYRF 2EQRA 5E3LA 4EMSA 2VJJA 4LGWA 1T0FA 2A6EF 3OY9A 2F5FA 2OV7A 2PMZA 2JVHA 2LY9A 2IA2A 3IH4A 2E1CA 1QZYA 1WKMA 2DK5A 3WGHA 3ASNH 3DCFA 3WU2C 2F48A 5C44J 1JJ8C 1P6RA 5FLMJ 4CCNA 5CYVA 5HNFA 5LEJA 2XGCA 4KA4A 1UJ8A 1ZGAA 4KN7X 3PNYA 4UVAA 1VQLI 1JGSA 1EH7A 4Y17A 2HTSA 3WGGA 4RM2A 4C9YA 5IP7J 4EM0B 4AVZA 1OCTC 1JT6A 1X3UA 1WJBA 5FRMA 1EA3A 1YLFA 3F72A 3K0LA 1IZ1A 1NHAA 2OUMA 1B72A 1R4MB 3M8EA 3R4KA 2EJRA 4UXNA 3T5XA 3TQNA 4CHUA 1VTNC 4IHXA 3EPZA 2E1OA 3AG3H 1WJ5A 2DJIA 1DU0A 2ISZA 2J5PA 2QUFA 2R7UA 4C3HJ 5B5EC 3IV5A 5BQTA 4EGZA 2R7RA 2B7EA 2JA2A 4D7MA 3TDZC 3HM5A 2R0QC 2P4WA 4PK4A 5LHGA 4BUPA 1BI0A 2F4IA 2ISYA 3KIOA 3M4OJ 1YYVA 5FKLA 1R4NB 1UMQA 2DK8A 3PL8A 3P9IA 3MVPA 2R93J 2RC4A 2EFOA 3G1OA 1SD4A 2DFIA 1OYIA 3L9FA 3LQQA 1IDYA 2KRFA 4I09A 2Q8KA 3HOXJ 3WE2A 4A3JJ 3NARA 4RBOA 1ZRCA 2XRLA 1AHDP 4BQQA 5TISC 5FLXK 1YFHA 1J2XA 1HKQA 4EJVA 3B02A 3JW4A 2IBDA 3OYIA 2KDZA 2R7WA 1FEXA 2EV0A 2YUSA 2QBYB 4NHJA 4AIKA 1O4XA 3BG3A 4IEJA 5EZGA 1GVDA 2E60A 2EINH 1YRNA 2R7TA 3HTSB 3G1LA 2HZTA 5BPDA 3N97A 2D2WA 2DYSH 1X1AA 2VOOA 3QODA 1W5SA 3PNTA 2K7LA 3W2WA 2M7BA 3L09A 5EGOB 2OF7A 4XR6A 2KKOA 3JRBA 2OD5A 3I58A 4OAYA 3EUHA 4B48A 2XB5A 2F5VA 5IPAA 4ESJA 2WWYA 2KFDA 4G7HF 2H8RA 4RB1A 3QAHA 2V9VA 2L02A 3BPXA 3BR0A 3VEPA 4C30A 2FBHA 5E20A 3LA2A 1YW9A 1BIAA 4G94A 3E5UA 5M5XJ 4B1RA 3BQYA 2NS0A 1S7EA 5CVIA 3MKLA 2XV4S 2P81A 3JRIA 2Z1DA 3GZ5A 4PJJA 4BHPA 4JQFA 3JAMZ 3RQ4A 1X19A 2Q1ZB 3RYPA 4A3IJ 2W25A 1W36C 1XSXA 3ZCOA 3RJPA 2DA7A 3GLXA 3BT9A 3QOEA 3FK6A 4A6EA 2ZXHA 2BGCA 1JGGA 1WI9A 4KIBA 2A6HF 2OZUA 1CGPA 1JKRC 1RI7A 1TWCJ 1MNEA 3JRGA 1UCRA 3SDBA 2D1HA 4BHCA 3BG9A 5C3EJ 2ESHA 3Q9SA 1KQ8A 3EYIA 3NRVA 2W1OA 1MBKA 1P7JA 2HS5A 3BROA 1RKWA 3CCVI 3T1BA 4IRIA 5J40A 3J81Z 1VQMI 4ETSA 5GTHC 1A6IA 3VYSB 4BDYA 3GO5A 3ZP5A 3TOAA 3SZGA 1B9NA 2OA4A 4AYBA 2Y30A 4L9VA 2BE5F 2RNGA 3CC7I 4LG0A 1U8RA 4HG2A 2KIFA 4Q47A 4NQWB 1JE8A 1MDMB 1P9QC 4KYWA 4XL9A 2L7FP 2MABA 3TGNA 2KLOA 2CQNA 4BACA 2V4JC 3JAMK 1VFCA 2HPMA 4G8XA 2BY3A 1Z91A 4FETA 3FM3A 3ZGKA 3PM1A 1D1AA 2QM3A 2VC0A 4A3KJ 1SD7A 1W7PA 2FQ3A 1K83J 1ETYA 2R7QA 3DFGA 5JHFA 3CF2A 2DTZA 3U9GA 3U21A 3I55I 3OL3A 1E3HA 3F8CA 2FBKA 4IF4A 2O9LA 1RESA 1HDPA 1GV5A 2GZWA 1UHMA 1FT9A 2WY8Q 3ECOA 2RV8A 2FBIA 3QRFF 3HL2A 3WHBA 1ETKA 5H20A 1ZELA 2XUBA 1S9HA 2HXIA 2P6SA 3K2ZA 3WTTC 3G73A 1XB4A 1ERDA 2QA4I 3J81K 1D1CA 1WRJA 3GBGA 1G3SA 1LKXA 3P7NA 3A03A 4RAFA 1JHFA 5DCFA 1V4RA 3C3WA 5K7FA 4ZYAA 5D8LB 1B72B 1YOVB 4M9SA 4OMYA 1O7FA 2K5CA 5L3BA 3RZOJ 2FEZA 2BVLA 3BTLA 1MGTA 2ZJPF 2PLYA 3OYNA 1WH5A 2DU9A 2HQRA 2RREA 4M73A 3K1PA 2K4JA 2I5UA 4C3IJ 3GTKJ 4YFNF 4F52A 4LIVA 2OBPA 3CP8A 2E5ZA 3ABMH 3H5AA 4BBRJ 4ESBA 4CYCB 4BDZA 5LRSA 3OYBA 3K70D 1Y1VJ 2JRMA 1H9GA 2CRGA 2VXZA 4V19K 4NBQA 3A0BC 3HSEA 2A5YB 5DCMA 1SFKA 2Q0OA 4FISA 4NDLA 2VJIA 1Y8RB 1TWGJ 4G6QA 1B8IA 1U8BA 5DV5A 3H9QA 2XSJC 1U5TC 2JTVA 1OISA 1IRGA 2V6EA 5HLTA 3PSFA 5DEQA 1ZR2A 1KU7A 2YSRA 3W6JB 2AQFA 5F64A 3OMYA 3ZPLA 5J8CA 2KISA 3S2DJ 4KN4X 1OKRA 3K4MA 4NC7A 4HAMA 3ERMA 3VSKA 1YTYA 1R1VA 5D4RA 3IL2A 1FY7A 4G9YA 4RGRA 1O57A 1SD6A 2DOAA 2LY1A 1DPUA 2DXIA 1E3PA 2DDAA 4Y15A 3OYDA 4MEXF 3SQNA 5F04A 2V9KA 5JHUA 4FASD 5GADJ 1YRNB 3ESWB 3UR3C 1X1CA 2RKHA 3PIPF 2Y9ZA 1TQPA 5ICCA 1CQTA 1G2HA 5IOZA 2GQQA 1TLHB 2IW5A 4P55A 4RDUA 4QPQA 1OLTA 2HNHA 3PIOF 3F23A 3GXOA 2O6GE 1R6RA 3QPHA 3GFIA 5HLGA 2R92J 3OYLA 2VL8A 3AFHA 5K5OA 1R58A 4R1HA 3T0YA 1JT0A 2HYFA 2JWTA 3TEDA 4BU2A 3G6EI 1IN7A 2Z16A 5FO5A 4BEHA 4PGGA 4BHBA 1U6GA 2QSFX 3Q0VA 3GZ6A 3QQAA 2PX9A 3QWLA 4U0YA 4XLHA 1BIBA 5J4VA 1F9NA 4AM3A 3CDIA 2VPRA 2BVMA 4A3EJ 4ENMA 1ETQA 1HW1A 2K40A 1FOYA 5CVRA 3A4CA 3K4NA 3ULQB 4YEJA 4CCKA 2H09A 2IP2A 2BXZA 1T56A 2LRDA 4BE0A 2R7SA 3AL0C 4DYCA 3CCMI 2LY2A 1HKSA 5D8KB 4O6JA 3D5LA 3TO6A 4K2EA 3HUGB 4P96A 3HGYA 2M0MA 4NUBA 2VT3A 2PMZN 3FHNA 4KICA 2X1EA 2IS2A 4V2GA 2B63J 2CQQA 2W82A 3KCCA 5GTIC 3JSOA 2CFOA 1IV6A 2EBIA 4A3DJ 4AC0A 3CTAA 2NRAC
chains in the Genus database with same CATH topology
4BH9A 3L2WA 4IZZA 4PZJA 3TMOA 2DQLA 3H92A 1XSDA 3ELKA 5ICGA 5IT3A 5JVTA 1WJDA 5DD4A 4LG0B 1J75A 1R5HA 3I54A 2EB7A 1SD5A 2NYXA 2KQRA 2FF4A 5ILSA 5JFRA 2DT7B 1B59A 5TGTA 4EQQA 1TQMA 4E7ZA 1W7PB 4BQNA 2WAFA 1IUYA 1TNTA 3CJRB 4RB0A 3T8TA 4WXCA 5E1XA 2VKDA 2OU2A 1U0JA 3I9V2 4M71A 4HSRA 1HA8A 2AXLA 2V79A 5KCMA 3QP5A 4U7BA 4NNJA 4IPAA 4OOIA 2X1CA 4ZDPA 2ZCWA 2R7FA 4M9ZA 5FD5A 3MZHA 2J5OA 1TW3A 4MTEA 3QYBA 2EFNA 1N77A 3GUDA 1KQ0A 4Y33A 2L54A 3OOPA 3PFYA 1SMYF 2HKOA 2KL4A 1B1BA 2X6YA 1AWCA 2XAQA 1GVJA 3DTKA 3WU0A 4QLCU 4MHGA 2Z9OA 4XKBA 3OR2C 5TRDA 2KJCA 4XLEA 2GA1A 2L4AA 2CUZA 3I3LA 3FBIB 2X0LA 2IXSA 4N9HA 1J0RA 5DCMB 4CGZA 4H4KC 2QZ8A 3FZVA 4A12A 1XMKA 5CVUA 3IC7A 4GRIA 2M30A 4BNCA 2L01A 2XAUA 1XGSA 3IP4B 3CP2A 1AA7A 1JI8A 1R7JA 2KJBA 1TQIA 2M7AA 1TW2A 3KEYA 4BYYA 1TBXA 2JZYA 5E8GA 2JSPA 2K4BA 3V4GA 3K1NA 4DQ2A 4YELA 3L2UA 4XLAA 5KHDA 5JI6A 3HHGA 2FNAA 5IT9Z 5K1YA 1XGOA 4CA0A 2ZFUA 1MD0A 3GW2A 4E7KA 3HSFA 4F55A 2VBZA 3RTRA 2IS6A 2XF5A 3F8MA 1MJAA 2RNJA 3F6OA 2HVQA 2Z3YA 4YFKF 2YPRA 3K4CA 2LH9A 5K5RA 2BW3A 4EJWA 2E1MB 2LBFA 3LA7A 4XOTA 4BEHB 2ACJA 4J01A 3WODF 2VOPA 3BDDA 1D1BA 4ENJA 2PJRB 4DBQA 2P6TA 4HF0A 3CUQC 1BBYA 4LLNA 4N0BA 3H0DA 1Z05A 2IGNA 1X4PA 4HF2A 2FUG2 4BJ5C 3ML6A 4PFOA 4CXFA 1IN4A 4B09A 3C18A 1X1BA 5HLIA 4WF2A 2MD0A 1V5EA 5IT9K 3OIPA 3KYLA 1X4OA 3FWEA 3KP3A 3CJQB 2VASA 5ICEA 2DTRA 1B9MA 1R1TA 2QYOA 1LFPA 3VOEA 3KEQA 5BMZA 2VPLA 3BWGA 1WJFA 3I53A 2RQPA 2EV6A 3L2CA 2GAUA 4HZFA 3ZMZA 1MJ9A 3EUAA 2EFPA 2R7VA 2NNYA 2VT2A 3UNGC 1W7PD 2FNPA 4HPQA 4Q5SF 4DJAA 3V7SA 5HVQC 5LD2C 3E5XA 3TO7A 2ZFWA 3LL7A 2G7UA 1HKTA 1UG0A 1S7AA 1V5FA 2HDWA 3BG6A 1ZLKA 3SXYA 3WTWC 1DDNA 1HSJA 2PQ8A 1BJAA 2Z99A 4CCMA 4CO8A 2WAEA 3BG7A 1DGRM 2V6CA 5FLXZ 4N4NB 4OIQF 2PMUA 5ERIA 3IKTA 1TZLA 4KJZA 4B43A 2BEOA 1ODDA 4HQMA 4HBLA 4IRHA 1F5TA 1LVKA 3AKZA 3WTYC 2MFZA 1XDUA 4FX0A 2JVGA 1FPQA 1ZN2A 2WA0A 4GYIA 4OU0A 1IXSB 3REOA 2QQAA 3K6GA 1QZZA 1TNSA 1OPCA 1E2XA 1EV7A 1K78A 1KA8A 1P4AA 3VSLA 1OR7C 2X6WA 3ZQQA 2FMLA 1XSVA 3HYIA 1STZA 2DAOA 3HIFA 2KIUA 1FYKA 3DWLE 1D0YA 3K70C 4CCJA 1V5GA 4ESFA 2L4MA 2MC4A 4F91B 4WCGA 3FX3A 1FBSA 2CUJA 2VQLA 1WSUA 2L9SA 2KDOA 4RS8A 3RCOA 1PUEE 4I0BA 3LSTA 3BOQA 3BC8A 3E6DA 4RMNA 2I8DA 3OS1A 1RUNA 4LB5A 2IJLA 1U5TA 4PCQA 3VYTB 4LLGF 4ZZLA 3HSRA 3IRRA 2HZDA 3ZMTA 1LDJA 3NWTA 5L3DA 2LNBA 3BY6A 4AD9A 3OOUA 1R5GA 2V1NA 1MW7A 1MZBA 2GXGA 1R36A 3HRSA 3ZN0A 2LYCA 3H35A 1HW2A 5HS8A 3ZXSA 1YE9A 1Z6TA 3QU6A 5HDKA 4C2UA 3OYJA 4JK1X 4HLYA 3DTEA 3IRQA 1Z7LA 1EH8A 3F22A 4XSZF 1G4DA 1KYWA 2ZBKA 4LFUA 4IKFA 3O6BB 3S93A 1XGMA 3DU5A 4LD5A 3CLOA 2VB6A 1T2KA 2HYGD 3PNVA 2LBFB 1USSA 5F6FA 2ETHA 3LAPA 3RKWA 3H9JA 1UFMA 4L5IA 3ZMDA 4HLXA 1L0OC 4UV9A 1H0MA 5LRRA 4GO1A 4IVNA 4A0XA 1FYMA 2WTEA 3W6KB 3R61A 5E18F 2XASA 4U7DA 4ZYGA 2HPIA 4YRVA 3WG9A 2VE8A 1N78A 3C7JA 1ULYA 1O3RA 2E5NA 2O8XA 1IN6A 3K9TA 1J9IA 3K4BA 2ESNA 3S32A 1IXRC 2VJ5A 2KHMA 4UUVA 4EV0A 5BOXA 3L7WA 2X4HA 4HOBA 4OIPF 4R8HA 4E4HA 1HXDA 4BJ6C 4PJLA 4ZDOA 1ON1A 2MLGA 4ENNA 1WQ2A 3I5UA 3DPUA 4LK1F 2Z33A 1UELB 5FFXA 1GXPA 3E97A 3BCAA 1K79A 2HVSA 1WWXA 5EEGA 5DDGA 4PSWA 4CH7A 5HDGA 1DGWY 2GWRA 3M1CA 2KRCA 2A5WA 2M4KA 3EUKL 2WV0A 2X85A 1XCVA 4Q48A 1I6XA 4AWXB 4UV8A 3HC7A 2V26A 5J6XA 4I98B 1V3FA 3RKYA 1C0WA 4HA8A 4UVBA 4KMUX 2CS3A 3R6SA 3L2RA 4LLLA 1G6NA 3OS0A 4G6TB 2M87A 1L3LA 1G3TA 4CDGA 3V8LA 5TJJA 4ZH4F 3WE3A 2DCEA 1K78B 3VYRB 2PEXA 5J8FA 2PMHA 1HQCA 4L9TA 4I01A 2L3DA 4CZCA 1SAXA 3RPUA 4OAZA 1IN8A 1NG6A 2VQCA 3B73A 2DW4A 1USTA 5D4SA 3IWFA 4XKCA 3FMQA 2IRFG 2CSOA 4MEYF 5EEHA 3LSHA 5CVJA 1I5ZA 4D1QA 5L3GA 2XIGA 4XLFA 2KP6A 2XAFA 4GXOA 1BI3A 3KFWX 2GXBA 4XOPA 2M5WA 2MBFA 4U0VA 3KX2A 3F8BA 1YG2A 2KMUA 1FC3A 3TBIA 3F8FA 4UNOA 2IT0A 3RSNA 2UXNA 1U5TB 1MJBA 2FMYA 2MLKA 2KRHA 4RAYA 4D9JA 4IJAA 5LEKA 3IAM2 4ANJA 1H9TA 2QLZA 1YS6A 4BXUA 1IRFA 1KU3A 2EWNA 3KP6A 1O7LA 3LSGA 1OYWA 3N05A 3IHUA 2CMPA 3ZRGA 2WC2A 3RKXA 4BGDA 2X6XA 3L2VA 2IGOA 3M8JA 4KDPA 1LJ9A 2K27A 2ZXJA 1LNWA 3OYMA 3J7AO 1FBQA 5LLQA 2CWEA 2W84A 2DQRA 3FXQA 4WX9A 2CV2A 4BQOA 2VQHA 1YW7A 4KIFA 1Z7UA 1HBXG 1RIOH 1ZG5A 2H6BA 2ZO4A 3M7GA 1UAAA 3V7RA 2EA2A 4HDVA 3S3OA 3V8KA 4B8XA 4YFXF 2P7VB 2V1XA 1I1SA 1ZGJA 2RGVA 2G9WA 2XKOA 5ILUA 2Y0MA 2P5VA 1W36D 1DQUA 3OR1C 5E1WA 3D0SA 3MKWB 4UHTA 2XC7A 3CUQA 4A0YA 1E0EA 4RGXA 4XN0A 3SZPA 4XRFA 1KQ9A 2L2OA 4CCLA 4XLCA 1BC8C 3PFIA 4HSTA 4XNFA 4HQEA 3D5SC 2Z2SB 2LSOA 3ZMSA 3V8JA 3ZQ7A 3MFKA 3RYRA 3M8FA 1QGPA 1G59A 2H94A 2QQ9A 3MCZA 3ONQA 2JT1A 2PFBA 2XRNA 3A2KA 4BE2A 3ZR8X 1FX7A 2K9MA 2IS4A 1XGNA 4MTDA 4E7IA 2V1DA 1XCBA 2O3FA 2CFXA 1FZPB 1SAUA 4I7HA 3SHFA 1ZARA 2ELJA 2K9LA 3PJRA 4IQJA 4XBFA 4HYEA 2DBBA 2CW0F 2NOJB 4RB2C 1U2WA 3KP7A 4LG3A 3PQJA 5LGNA 5HNHA 4MNUA 2LG4A 3DF8A 2VODA 2TDXA 1YX5A 4Y3OA 1HW5A 3CMMA 2R4GA 4A6DA 2A68F 2DPDA 3C1DA 2MA3A 2HR3A 1LDDA 3RPQA 3JTHA 4DBRA 2XAGA 4AU7A 1S6LA 5ED4A 2R3SA 3I0TA 2PI0A 3G3ZA 1F1ZA 2DI3A 3MQ0A 1FLIA 3LMMA 4DNCA 4F3QA 2EFQA 2KIMA 3DPTA 4R79A 5KVRA 1PDNC 1YX3A 2VXDA 1MKMA 4ZTFA 4OINF 2M1BA 4U0WA 3CDHA 1KGSA 3WTZA 1OR7A 4HW0A 1DUXC 4L0ZB 1BR4A 1IW7F 1YW8A 3W2VA 3DU6A 4RGSA 4OMZA 2XAHA 4FT8A 3D5RC 3I71A 1BR1A 2K86A 2RQQA 5BPIA 2DPUA 4ZYHA 4E7JA 5E1ZB 3F21A 1I27A 1IF1A 3SEQA 3C2HA 1RUOA 3LFKA 1GXQA 2GA2A 2XROA 3BLYA 1FP1D 3N4MA 1NG7A 5K5QA 4HDUA 2P0WA 2W24A 4EGYA 1PYVA 3DKXA 4L0YB 1E17A 3IAS2 3IUOA 3FXRA 4ASNA 1JXSA 2RDPA 1R00A 2CGPA 2Q2EA 4EVIA 3CO6C 3OYHA 2ZKZA 4CSWA 2V7FA 4F93B 5HDNA 2XVCA 2DT6A 3ERED 2YX4A 2PJPA 1LB2A 1XMAA 2ADUA 4IXAA 4LK0F 1J5YA 2EV5A 2HQNA 5KK1A 2UXXA 4NB5A 3GF2A 5CJ9A 2OQRA 3E0JB 3GYHX 6PAXA 2CV1A 5FD6A 1J09A 1D3YA 3BJOA 2NAZA 4B3XA 1HSTA 3KEOA 2QENA 2X1DA 3M9AA 5F1RA 4AIHA 4U88A 3U1DA 3VODA 4ZYDA 1DPRA 2ZJ2A 2W85A 3HRTA 1O3QA 3FM5A 2IS1A 1FOKA 2ELHA 3CUQB 4S05A 1D8JA 4EJUA 2V1UA 3O2PE 5LHHA 4QPOA 4A0ZA 1RZ4A 2QKMB 4B44A 1KYZA 1B4AA 2XKPA 3WGIA 3K10A 4AVPA 4UVCA 3J80Z 1YO5C 3ABUA 4OWRB 3JSPA 3WTUC 2Y75A 4DOZA 1LDKB 3E1SA 2FSWA 1G3YA 2MH2A 2KPMA 3T8RA 1BOAA 3R60A 4A5MA 3W3CA 3GFJA 1LEAA 1S8NA 2HKXA 4WXDA 5CKTA 4NQWA 4PGHA 4MGRA 1LQ1A 1MDMA 1QHGA 1D0XA 2QKLB 3LFUA 2LKPA 4G6DA 2VN2A 3WU1B 5CPRB 4HX7A 1ZLJA 1BC7C 5HOOA 4G7OF 4IRGA 1FP2A 3KETA 2YU3A 4WXHA 3S2WA 2VBYA 1AOYA 2E1NA 3FMRA 2IVMA 3GEZA 2A6TA 4L18B 2STTA 2VLAA 2K02A 4II3A 4RM3A 3OV8A 2LREA 2D1VA 2HWVA 3ECHA 3OYEA 4EJTA 4RB3C 3KZZA 4PDKA 2Z5UA 3QU3A 2EK5A 2NNNA 3J80K 4ENKA 4XN3A 2HTJA 1T6SA 1R1UA 2XHKA 4XKWA 3FXUA 4XKVA 1WJEA 1ZRFA 3I4PA 4S04A 4Q4ZF 1CF7A 1ZRDA 2AQEA 1QPMA 3RPUD 4EM1A 2CV0A 3JTGA 3PSIA 2L9NA 2F5DA 1GLNA 2WB1A 3KLNA 4FHTA 3TOBA 4CYDA 2WAQA 2BBYA 4HX8A 3VWBA 3NQOA 3MKZA 1FYLA 3KLOA 1QNTA 1BN5A 4XSXF 2F6CA 4RAZA 3RDIA 2A07F 4P1WA 2MD5A 2PN6A 4M9XA 2F2EA 2Y48A 2VQGA 2VIXA 2VBXA 4CCOA 5LBQA 1P92A 3EDPA 1TT0A 2HQAA 5CQEA 4A2UA 1A04A 1ZG1A 4Y4RA 1P4WA 2EA4A 4XM3A 4OIRF 4HRIA 1PJRA 2P5KA 5ICFA 3OYCA 3KZYA 3CO7C 4HF1A 1P2FA 2Q2EB 3GX4X 2WBMA 3K4LA 4PFPA 3OL4A 1Y56A 4B47A 2M8EA 4LITA 1MMNA 2VJ4A 2BW3B 2VONA 2H6CA 5DD8A 3SYTA 4M74A 2CO5A 1I1GA 1MNDA 2IA1A 2FU4A 3GWZA 3KP5A 1UB9A 3KP4A 2BYVE 2R7DA 3KE2A 3MKYB 4MLOA 1QQIA 3I59A 1QO0D 3HRMA 5D5XB 3E5QA 3QYEA 3E6BA 5FROA 5FRNA 2UV1A 3QPTA 4XLPF 1Z3XA 2JUGA 4CICA 2QVOA 3DLAA 3QP6A 3BPVA 3GFMA 4HV6A 4KT5C 4WWCA 2HVRA 4E6KG 2R7XA 3HUGA 4A5NA 1GHCA 3ZMUA 1YIOA 1T38A 3U2RA 4X0GA 3HOTA 1JHHA 2QWWA 2HOEA 2XGXA 1IAWA 2FE3A 2X51A 4PUSA 1SFUA 3V42A 3EQLF 4FX4A 2VKHA 1DP7P 1T0FC 3LQRA 2F5EA 5AONA 1T98A 2XDVA 1Z6RA 2OQGA 1QU3A 5L3CA 2MC3A 3J7AY 1F4KA 2UZKA 1BOBA 4I0AA 2JPCA 1X1DA 1S7OA 2LC2A 2E7XA 1FSHA 3COAC 4XONA 4XORA 1BI2A 2YR2A 4CZZA 1Z9CA 2YX7A 4L5JA 3MMYB 3MAJA 3TKYA 3OYFA 2M45A 2PBIA 3QOPA 3BCBA 1T39A 1N75A 4HV5A 1J59A 2W4SA 1D5VA 3SZTA 1XDSA 1J7KA 2LF7A 2BOLA 1FMWA 5LGTA 3S3MA 1PP7U 2P5LC 3VB2A 4EATA 2RN7A 1CF7B 3OS2A 2ZMEA 4BJTA 2VE9A 3K1MA 5H6RA 4F7ZA 3ZMVA 3NWSA 1IRXA 4ZDLA 2UWMA 4H0EA 2LF8A 3F6VA 3I64A 1MMGA 4E70A 3MEXA 3DV8A 3P9CA 3BP8A 3BZ6A 1RNLA 3OIQA 2H27A 1K6YA 4I2OA 2O61A 1SFXA 1YQAA 5D5VB 1ON2A 1MMAA 2W00A 2RVCA 3AAFA 2OZ6A 1Y6IA 3GVAA 3HTUA 3VFZA 3FDYA 1ZHFA 4O3MA 3LWFA 3DKWA 3LAJA 2HU9A 3HOSA 4MQVA 3DTIA 1WJAA 3K4KA 1LEBA 5FB2A 4IX7A 3MD2A 1D0ZA 4N9IA 3VDXA 4KT6A 1SMTA 3TL4X 2EFWA 3LA3A 2L7KA 4BE1A 3EUHC 4P5OA 3RIRA 5D5WB 1FWZA 4KFCA 2P8TA 4Z2YA 2VC1A 3F9KA 4QWQA 3DPLC 1Q1HA 5FFZA 2K3PA 2MYSA 1PP8F 2W57A 3TO9A 2C6YA 2M4GA 1MMDA 1XD7A 3FKJA 4ZJZA 2DLLA 1SFEA 4MQ9F 1XN7A 2GOXB 3CESA 4P9UA 2L5QA 3OYGA 2CYYA 3H5NA 2FA5A 3I59B 3PUBA 4XMYA 3TDUC 3H3ZA 3HPGA 4NC8A 2PJRA 3QYFA 4DGWB 2FOKA 3F8NA 3GFLA 3DQVC 4BXFA 4CUGA 4GCVA 3HPHA 1S29A 1R22A 3R0AA 3AL0B 2G7HA 3Q5FA 2JSCA 3OYAA 2WADA 2HDCA 2FXAA 3EETA 5E17F 1U3EM 2XF7A 3MWMA 5ILVA 2P7CB 4Y13A 4PJNA 3SFZA 1OYYA 3DXJF 1REPC 3IKVA 2COMA 2KZVA 3ZN1A 4ZZDA 5AIPA 2GOMA 2MH9A 1WJCA 4U87A 4BAYA 1IN5A 3SEZA 4E7HA 1ZH5A 2DT5A 2OC6A 5A2QZ 4LIUA 1Z21A 2W7NA 3S3NA 3EYYA 3LSKA 1YS7A 1U78A 4PSXA 1KU9A 5KNLA 4YIFA 1TTYA 3WTXC 3K69A 2CW7A 5D5UB 2FRHA 4M6XA 2E7WA 4LJZF 3S8PA 4D0PA 5BS6A 4XLNF 1UHWA 4HEA2 2A3SA 4GYGA 4L9JA 5DYMA 2UUZA 1Y0UA 3KP2A 5D6FA 3Q9VA 3BJ6A 1W5TA 3E6CC 3HHHA 4RGUA 3E3VA 3HKZA 4JOMA 4OIOF 2ZXIA 4GGGA 3CUOA 3L00A 2QQBA 1DP3A 3DEUA 5DUIA 4PJMA 3OYKA 4EJOA 2ZMEB 1FBUA 2AS5F 2CH0A 3WTVC 2Y0SA 2IA0A 4BQAA 3DP7A 5HLHA 3K4JA 3L2QA 2ZNZA 3W2AA 4M6YA 5A2QK 4BL0B 2LOOA 1FNNA 1K6OA 2R7OA 4AIJA 4E7SA 4IHSA 4ZC3A 5LHIA 2ZSHB 4HNUA 5DUKA 1OMIA 4BS9A 5AIQA 2JRTA 4ITVA 3BJAA 5E8IA 3PQKA 4IHTA 2F5CA 3P9KA 2IPQX 4LB6B 1FSEA 3R0JA 3H3UA 1BI1A 3MZYA 1O3SA 4C2TA 3HG9A 4WK8F 3E6MA 3A1YA 3O3KA 3IWZA 5HS7A 4KMFA 2QBYA 4KITB 4F92B 3FHZA 4RLFA 2HEOA 1R23A 1IXCA 2A61A 2XF6A 3HRUA 1D8KA 1ZG3A 3FBNB 1Z1DA 4O5VA 2STWA 4KNYA 4HNTA 2IGKA 3F3XA 4YIIA 1B6AA 2E1MC 3M1EA 2CW8A 2DO7A 5H6QA 4YG2F 1ONVA 4P9FA 3LSMA 5L3EA 2O03A 1WFXA 2B0LA 1KONA 3V7CA 5L3FA 1FMVA 4JBAA 3CJNA 2D45A 4RLQA 4ZTJA 2IGMA 3WTSC 5LFAA 2M3AA 3ABTA 5HS9A 3FMSA 3H5RA 2ZSIB 3ROUA 1G8XA 1Z3YA 4E7LA 5CQGA 1G3WA 4EM2A 5JR3A 4IQ4A 2XAJA 5FGMA 2O0YA 4II2A 4KUMA 5D6EA 2ZNYA 4I02A 2BV6A 3ISPA 5CVVA 2LDUA 1EH6A 1VZ0A 2CQKA 1QHHD 2A69F 2OAZA 4N4OB 3DKYA 2PG4A 1K7AA 3H9GA 3HXLA 4KISA 1ZREA 3FF5A 1BR2A 3CZ6A 2JPBA 3LSIA 4G7ZF 4J00A 2GIVA 1QBJA 1S3JA 1KU2A 3NEUA 4L9NA 4DIQA 2HFHA 4ON0A 2VBWA 3VYUB 3OWTA 1BM9A 1LVAA 4HX4A 4M72A 2HGCA 2WY7Q 4XQFA 2O5RA 2CG4A 4ZYEA 1O3TA 1W4MA 4LMYA 5CLSA 3RI4A 1T95A 3DEEA 4TV7A 3G2BA 3C2GA 1P4XA 5LGUA 1ZAOA 1ZYRF 4EMSA 2VJJA 4LGWA 1T0FA 2A6EF 3OY9A 2F5FA 2OV7A 2PMZA 2JVHA 2IA2A 2E1CA 1QZYA 1WKMA 2DK5A 3WGHA 1P6RA 4CCNA 5CYVA 5HNFA 5LEJA 4KA4A 1ZGAA 4KN7X 3PNYA 4UVAA 1JGSA 1EH7A 4Y17A 2HTSA 3WGGA 4RM2A 4C9YA 4EM0B 4AVZA 1X3UA 1WJBA 5FRMA 1YLFA 1EA3A 3F72A 3K0LA 1IZ1A 1NHAA 2OUMA 3M8EA 3R4KA 2EJRA 4UXNA 3T5XA 3TQNA 4CHUA 1VTNC 3EPZA 1WJ5A 2DJIA 2ISZA 2J5PA 2QUFA 2R7UA 5BQTA 4EGZA 2R7RA 2JA2A 3TDZC 2P4WA 4PK4A 5LHGA 4BUPA 1BI0A 2F4IA 2ISYA 1YYVA 2DK8A 3PL8A 3P9IA 2RC4A 2EFOA 1SD4A 2DFIA 1OYIA 3L9FA 3LQQA 2KRFA 4I09A 2Q8KA 3WE2A 1ZRCA 4BQQA 5FLXK 1YFHA 1J2XA 1HKQA 4EJVA 3B02A 3JW4A 2R7WA 3OYIA 2EV0A 2QBYB 4NHJA 4AIKA 2E60A 2R7TA 3HTSB 2HZTA 5BPDA 3N97A 2D2WA 1X1AA 2VOOA 3QODA 1W5SA 3PNTA 2K7LA 3W2WA 3L09A 2M7BA 4XR6A 2KKOA 2OD5A 3I58A 4OAYA 3EUHA 4B48A 2F5VA 4ESJA 2WWYA 4G7HF 4RB1A 3QAHA 2V9VA 2L02A 3BPXA 3VEPA 4C30A 2FBHA 5E20A 3LA2A 1YW9A 1BIAA 4G94A 3E5UA 2NS0A 5CVIA 2XV4S 2Z1DA 3GZ5A 4BHPA 3JAMZ 4JQFA 4PJJA 3RQ4A 1X19A 3RYPA 2Q1ZB 2W25A 1W36C 1XSXA 3ZCOA 3RJPA 3GLXA 3QOEA 4A6EA 2ZXHA 2BGCA 1WI9A 4KIBA 2A6HF 2OZUA 1CGPA 1RI7A 1MNEA 1UCRA 3SDBA 2D1HA 4BHCA 2ESHA 3Q9SA 1KQ8A 3EYIA 3NRVA 2W1OA 2HS5A 3BROA 3T1BA 4IRIA 3J81Z 4ETSA 3VYSB 4BDYA 3GO5A 3ZP5A 3TOAA 3SZGA 1B9NA 2OA4A 4AYBA 4L9VA 2BE5F 2RNGA 4LG0A 1U8RA 4HG2A 2KIFA 4Q47A 4NQWB 1JE8A 1MDMB 4KYWA 1P9QC 4XL9A 2MABA 3TGNA 2KLOA 4BACA 2V4JC 3JAMK 2HPMA 4G8XA 1Z91A 4FETA 3FM3A 3ZGKA 2QM3A 1D1AA 2VC0A 1SD7A 1W7PA 2FQ3A 3DFGA 2R7QA 5JHFA 3CF2A 3U9GA 3U21A 3OL3A 3F8CA 2FBKA 4IF4A 3ECOA 2GZWA 1UHMA 1FT9A 2WY8Q 2RV8A 2FBIA 3QRFF 3HL2A 5H20A 1ZELA 2XUBA 2P6SA 1S9HA 3K2ZA 3WTTC 3G73A 1XB4A 1ERDA 3J81K 1D1CA 1WRJA 3GBGA 1G3SA 1LKXA 3P7NA 1JHFA 5DCFA 1V4RA 3C3WA 5D8LB 4ZYAA 4M9SA 4OMYA 1O7FA 5L3BA 2K5CA