The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
72
|
sequence length |
238
|
structure length |
236
|
Chain Sequence |
GVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding.
pubmed doi rcsb |
source organism |
Homo sapiens
|
molecule tags |
Ligase
|
molecule keywords |
Melanoma-associated antigen G1
|
total genus |
72
|
structure length |
236
|
sequence length |
238
|
ec nomenclature |
ec
2.3.2.27: RING-type E3 ubiquitin transferase. |
pdb deposition date | 2016-01-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
C | PF07574 | SMC_Nse1 | Nse1 non-SMC component of SMC5-6 complex |
C | PF08746 | zf-RING-like | RING-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | ||
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Arc Repressor Mutant, subunit A |