5HVQC

Alternative model of the mage-g1 nse-1 complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
238
structure length
236
Chain Sequence
GVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Melanoma-associated antigen G1
publication title Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 72
structure length 236
sequence length 238
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07574 SMC_Nse1 Nse1 non-SMC component of SMC5-6 complex
C PF08746 zf-RING-like RING-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hvqC02
1.10.10.2370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5hvqC01
4ENNA 3VOEA 3SZTA 4HW0A 1K79A 3FX3A 1IF1A 2D45A 4PGHA 4ZYGA 2DAOA 3ZMUA 2X4HA 2YX7A 3IWFA 1F5TA 1HW1A 5K5QA 3LA2A 5BQTA 1FBQA 1J59A 2IRFG 1BIAA 3BPXA 3FXQA 2YU3A 2OA4A 2UZKA 3K69A 4I98B 3LA7A 3RKWA 4CDGA 1KGSA 4GO1A 3F8NA 2IA2A 1ZGAA 1U78A 4KYWA 2LDUA 1DPRA 1HKQA 2ZXJA 1Z91A 3QU6A 1QGPA 2K27A 1ZG5A 5ILSA 1JE8A 3S2WA 4EMSA 2VT2A 3I54A 3T8RA 4ZH4F 4ENKA 4HDVA 3EDPA 2P5KA 1ZAOA 1R1UA 1YQAA 3BDDA 4OIQF 4RB1A 2IVMA 3QAHA 1ODDA 2FNPA 2DQLA 1BI0A 5J6XA 4YIIA 5CVVA 3BJOA 1V3FA 3KP3A 4MNUA 3OOPA 1I5ZA 1FX7A 3I5UA 1ZH5A 4EJOA 1IXRC 2JPCA 1SD6A 1IN4A 3O3KA 3ECOA 5ICFA 5DCMA 3J80Z 3KLNA 2KRFA 3FM5A 2K86A 4RGRA 3U2RA 2VT3A 4ASNA 4A0ZA 3GO5A 2DQRA 1MJBA 4HOBA 3KZYA 5E18F 2P5VA 1EH7A 3E3VA 1J75A 1K78B 5E1ZB 3EETA 4R1HA 3DEUA 5E20A 3JSOA 5K1YA 3C7JA 2JRTA 4UXNA 4ENJA 3H92A 1G6NA 1MJ9A 1HBXG 2IP2A 1JXSA 3DPLC 1R5GA 2M8EA 4HX7A 2PJPA 3LSTA 1I1GA 5ILUA 2DPUA 3ZMTA 4BHCA 5L3BA 4RB2C 3JAMK 4LJZF 3T5XA 3T0YA 4M9ZA 2XV4S 2MLGA 2GAUA 1S8NA 1W7PD 4UVCA 2RC4A 5FO5A 2MH2A 2XAGA 1P2FA 4M9SA 4RGXA 2ZNZA 3HHGA 1PDNC 2WWYA 4Q47A 4QLCU 1GVJA 4HX4A 3L00A 3N97A 2UXNA 1OYIA 2AXLA 3F8MA 2RN7A 1FSHA 1B1BA 2QZ8A 4P5OA 2VE9A 1RI7A 4AIKA 2A6EF 1R5HA 1FBUA 1B9NA 2DU9A 1VTNC 3BROA 4KIFA 3TOAA 4RGSA 3GFLA 2L54A 3ZP5A 5HLGA 3I59B 1FYMA 2QBYB 4I0BA 4ETSA 1ZRDA 1Z1DA 4B8XA 1TBXA 1O7FA 4L5JA 4IJAA 3GW2A 5EEHA 3GX4X 3P9IA 2XKPA 5F1RA 2BE5F 1XCVA 2P6SA 3KP4A 2TDXA 3SHFA 2EFWA 1ULYA 3M8FA 4RAZA 2A6HF 5HS8A 2Z99A 2V1XA 4OMZA 5HDNA 1LNWA 2XASA 4WXDA 1NHAA 3ZMSA 2VBZA 3R6SA 4KFCA 1U5TB 1EH6A 4HQEA 2NYXA 1YIOA 5AIPA 1RUNA 2W57A 1D8KA 3KEQA 4XBFA 5BMZA 4M73A 2NAZA 2A68F 3MZHA 2NRAC 1FC3A 4H0EA 5EEGA 5FGMA 4HF0A 1KU9A 5FB2A 4A6EA 4AD9A 2XRNA 3SQNA 3DKWA 4LB6B 2FBIA 2AS5F 3P9KA 3BPVA 4CZZA 3LAPA 4L5IA 3J7AO 3FXUA 2HQNA 2BBYA 3KCCA 2DW4A 2L4MA 2IA1A 5ICEA 2R7FA 4FT8A 3CO7C 2QWWA 1GXPA 1G4DA 5HDGA 4U88A 3CUQB 2HS5A 2FBHA 3FHZA 2GXGA 1IXCA 1PP8F 3QP5A 4OIRF 2K7LA 4R8HA 5D4SA 5DD4A 2KJCA 4ESBA 2M30A 1RIOH 2LF7A 4ZZDA 4PZJA 3I4PA 3MWMA 3ULQB 4CICA 2QVOA 2HEOA 1WKMA 2F2EA 1XGMA 2XAQA 1AOYA 2MLKA 3WODF 5FLXK 2WV0A 2LKPA 3U1DA 2ZMEA 1F1ZA 2JSCA 2IT0A 2A07F 2RKHA 5E1XA 3KLOA 3C18A 2DK5A 5D6FA 1XGOA 4HA8A 2VONA 4WF2A 4GGGA 2W84A 5CJ9A 3HOTA 3R60A 3TQNA 4L9TA 1SFXA 2OD5A 3JTHA 5J8CA 1O3RA 1LVAA 1J9IA 1TNTA 4Q5SF 2YPRA 1STZA 3TDUC 1U5TC 2EB7A 3I64A 2M45A 1AWCA 3HSEA 2V1UA 3CUOA 3ML6A 3Q9VA 1S7OA 5LHHA 3HRTA 5BS6A 5TRDA 2CSOA 4Q4ZF 1RZ4A 4LGWA 1T6SA 3RJPA 2GIVA 4LLGF 3CLOA 1DP7P 2K4JA 1J7KA 3F22A 2HYGD 2VC0A 2HZTA 1WWXA 4KUMA 4EM1A 3WGHA 2XAFA 2P7CB 3LQRA 5D8KB 1ON1A 1V4RA 4UNOA 2HKOA 3IKTA 1ZHFA 4M72A 3CUQC 3E5XA 2VC1A 3I58A 4JBAA 2OAZA 1R22A 4GCVA 2KIFA 4BHPA 2QQBA 2JT1A 4AIHA 3QPTA 2BGCA 2HR3A 4EJTA 2KIUA 2PMHA 1OR7A 4G94A 3ZMDA 3CO6C 1UFMA 3ZN0A 2O6GE 2XVCA 4U7DA 4PCQA 4EJWA 3AAFA 5LRSA 3GWZA 4EM2A 4XSXF 3WU0A 1Y0UA 3HTUA 4F7ZA 3HSFA 1KU3A 5DCMB 1FY7A 1SAXA 4WK8F 2O03A 3GUDA 2HOEA 2GA1A 3CJNA 2ZFWA 3IRRA 1MDMA 3F3XA 4N0BA 2OZUA 4B09A 3TKYA 3FM3A 3WTVC 4M6YA 2RQPA 4Y13A 4G9YA 3QOPA 4LG0A 4Q48A 3IRQA 2XKOA 3FMQA 2MA3A 2IPQX 3E6CC 3C3WA 1JHHA 1LEAA 3G3ZA 1XB4A 1QO0D 5E8GA 2CO5A 3ZN1A 5D4RA 4I02A 4PGGA 1BJAA 2QLZA 4MQVA 2FBKA 2V79A 1BI3A 1I6XA 3DQVC 1LJ9A 1LQ1A 4P96A 2ADUA 2FEZA 4FX0A 3KP7A 1XSXA 1QZZA 1MJAA 3D5LA 5DYMA 1LDDA 2XAJA 3RTRA 2Q8KA 1H9TA 1HKSA 2GZWA 3MCZA 3HSRA 1IZ1A 1QNTA 1FBSA 1R1TA 4I2OA 1FWZA 2RV8A 2VXZA 1G3YA 2O3FA 3LQQA 1HW2A 5HLHA 1HSTA 2D1VA 3HRUA 2L4AA 3GYHX 2G9WA 1L0OC 2Z9OA 2EWNA 4A0XA 2Z33A 2QQAA 1DPUA 1YLFA 3V7RA 3IWZA 1DUXC 3MFKA 1F4KA 4IPAA 2D1HA 3V4GA 4YFKF 1SMYF 3RDIA 2H27A 1HKTA 3LAJA 4M9XA 3TO6A 3W6KB 4HBLA 3KE2A 3GVAA 5H6RA 1S29A 5HS7A 4HZFA 5LEKA 2F5CA 4AWXB 3WTTC 2CFXA 1BN5A 2W25A 1ZYRF 4WWCA 1YW9A 1SFUA 1LB2A 2DK8A 3NQOA 4LLLA 5A2QK 4A5MA 4KIBA 1D8JA 1QPMA 3DF8A 4IRHA 1T98A 2EK5A 2BYVE 1SD7A 3WTUC 1XMAA 2EV0A 4A0YA 1FNNA 2UXXA 2G7UA 1TW3A 5HS9A 1MKMA 2V6CA 3RYRA 5LGNA 1EH8A 5H6QA 4P9UA 1U8RA 2QQ9A 5IT9K 2W24A 3F72A 3F6OA 1W5TA 3DFGA 4CHUA 3TO9A 3COAC 3IHUA 1J2XA 3PFIA 1YW7A 3WE3A 1TW2A 5D5WB 2PI0A 3RYPA 1G3SA 3BZ6A 3FZVA 4RS8A 1XGNA 4LK0F 2KJBA 3G73A 4L9VA 5F6FA 2UWMA 1BIBA 4MTEA 4KT5C 4O5VA 3T8TA 2JTVA 2P6TA 3TO7A 3QRFF 5JVTA 3SZPA 1XCBA 3H3UA 5CVJA 1FP1D 1O7LA 1Z6RA 4U7BA 5AIQA 3FF5A 4EJUA 4Z2YA 3B02A 4DQ2A 4LLNA 1BBYA 4WCGA 4KN4X 2MBFA 1TQPA 1IN5A 2Q0OA 3WE2A 4ZZLA 4HV5A 4XSZF 2IJLA 1E17A 2H94A 1USTA 1UHWA 2COMA 4P9FA 4IRIA 2ZBKA 2OU2A 1HQCA 4UV8A 1ZRFA 4KMFA 2F5EA 3ERED 1BI1A 3MEXA 4MTDA 3IKVA 5JR3A 1Q1HA 3REOA 3D0SA 6PAXA 4MHGA 2HYFA 2V1DA 1FT9A 2FE3A 2P7VB 1IN8A 4IHSA 5JHUA 1UB9A 2EFQA 2A3SA 4HYEA 1O3TA 4EGYA 5CVRA 2P8TA 5LHIA 1G3TA 2ZMEB 2XGXA 5KVRA 2JZYA 4MEXF 2M5WA 5DEQA 2WC2A 4UVAA 4JQFA 1LDJA 5L3DA 3RPUA 3JAMZ 4FX4A 4BH9A 5CYVA 2ZCWA 5LHGA 2O8XA 1H0MA 3I71A 3VEPA 5CVIA 5H20A 1Z7UA 2VBWA 2CWEA 3BY6A 1E2XA 4GYIA 3ZMVA 2FA5A 2BV6A 4ZYEA 5LLQA 3TGNA 1GXQA 4S05A 3U9GA 5E1WA 1D3YA 5L3GA 1S6LA 3ABUA 4XRFA 2EJRA 3I53A 3KEOA 3Q9SA 2DBBA 3DV8A 5BOXA 2QYOA 5BPDA 3GF2A 3E5QA 1P6RA 5D5UB 3ABTA 3LWFA 3CDHA 5IT3A 1W5SA 2LF8A 2QENA 3PQJA 4K2EA 1XDSA 3ISPA 5ILVA 5L3EA 2A5YB 5HOOA 4AVPA 1LEBA 4CYDA 1YO5C 4HDUA 3K9TA 3RPQA 1TQIA 3CTAA 3KP6A 1T2KA 3HYIA 4KDPA 1ON2A 1R00A 3RKYA 2PN6A 2NNNA 4YG2F 5D5VB 4QWQA 1EV7A 1X3UA 4TV7A 4EJVA 3LA3A 4OMYA 3WU1B 3LFKA 4BXUA 1ZGJA 2J5PA 4IRGA 3KP2A 4MGRA 2ESHA 5CVUA 1IRFA 1R36A 1IUYA 3FMRA 1MD0A 4HLXA 2L01A 4XLPF 4I09A 1O3SA 2D2WA 1FLIA 3RI4A 3GXOA 1KU2A 4KA4A 4L9NA 5ICGA 4OIPF 2IW5A 4UV9A 2DO7A 1CF7B 4UUVA 3HRMA 1QBJA 1FPQA 4IXAA 1MDMB 1T39A 1IAWA 4RB3C 2CYYA 1KYWA 4HV6A 4Y15A 2XIGA 2J5OA 4NHJA 1SMTA 1O57A 3M8EA 4LG0B 4E70A 4L0ZB 2ISYA 3MAJA 5LGUA 2YR2A 2YX4A 4OINF 1KQ0A 4BNCA 4KICA 4AIJA 4M71A 1TQMA 5CLSA 4HAMA 1IRGA 2GWRA 2HTSA 4JK1X 4RAYA 2V9VA 3J80K 4P55A 3KFWX 4U0WA 4KMUX 2RGVA 4KN7X 1YYVA 3FMSA 4YFXF 1ZLKA 4G7OF 3PQKA 4S04A 3EUHA 4G6DA 3K1PA 5D5XB 1Z05A 3B73A 1L3LA 2L3DA 3BWGA 1ZG1A 3QP6A 3KZZA 2H6BA 2QUFA 4ESFA 1KYZA 2OBPA 3GZ5A 3V8LA 1Z6TA 4LB5A 4EM0B 3J81Z 5ED4A 2Z5UA 3IC7A 2DTRA 2O0YA 3L9FA 3NRVA 2PG4A 1CF7A 1IN7A 1S7AA 2XAHA 5FLXZ 1XD7A 1ZG3A 3FWEA 3WG9A 5K5RA 1ZREA 3E6DA 3O6BB 1TTYA 1BM9A 2O61A 1PUEE 2ACJA 1W7PA 2EV5A 2KIMA 1U6GA 1I27A 2JPBA 5HVQC 2PQ8A 1KQ9A 2W85A 2F5FA 1T38A 1R1VA 2E1CA 4WXHA 3GFIA 2G7HA 2GQQA 3P7NA 2NS0A 4G7ZF 3WTZA 3WGIA 2R3SA 3V8JA 3FXRA 1OKRA 3KP5A 1I1SA 4MEYF 1ONVA 3P9CA 3M7GA 4RGUA 5LBQA 1FYLA 2FQ3A 3ZPLA 1G3WA 3DXJF 4R79A 1F9NA 3R61A 5AONA 4HQMA 1YW8A 1XDUA 3GLXA 3TDZC 1FP2A 1KQ8A 1BC8C 1UHMA 2FF4A 1ZARA 2ELHA 1BOAA 1W4MA 1R58A 2OQGA 5DDGA 1JGSA 5D8LB 3ELKA 3IL2A 2CG4A 5E8IA 1U2WA 2FOKA 4MQ9F 1YS7A 1FYKA 4A5NA 2FXAA 1D5VA 2VODA 3T1BA 5J8FA 3W6JB 2FRHA 1K7AA 4BHBA 4O6JA 4I0AA 3E6BA 5L3FA 3SXYA 4OOIA 2ZKZA 2HFHA 1OPCA 2ZO4A 3GEZA 2RNJA 2P5LC 4CO8A 2HDCA 4ESJA 2B0LA 2A61A 2MH9A 1R23A 3WTXC 3L7WA 2MC3A 2RDPA 1J0RA 3F8CA 3M9AA 2K02A 1B6AA 3HHHA 1DDNA 2PFBA 2PBIA 2FNAA 2EV6A 2K4BA 1YTYA 3F8BA 5HDKA 1XSDA 4L18B 3NEUA 2LSOA 4OU0A 4IHTA 4CXFA 2DT5A 5FD6A 2CQKA 5DUKA 4DNCA 4N9IA 1P92A 4G8XA 4YIFA 4A12A 4I01A 1WSUA 3VFZA 4D0PA 2C6YA 2EFPA 2XHKA 2M1BA 2Y48A 1IW7F 2ZNYA 5ICCA 1XN7A 1R7JA 1FOKA 2VBYA 3V7CA 1YG2A 4N9HA 4IVNA 3GFJA 5ERIA 3BJAA 3E97A 5DV5A 2EFNA 2ETHA 5KK1A 1A04A 2Y75A 2Z3YA 1RNLA 2R7DA 3ZQ7A 3OV8A 3TOBA 3ROUA 3MQ0A 4NB5A 2BEOA 3O2PE 2EA4A 3F8FA 3HUGA 2FMLA 5LGTA 1GHCA 3ECHA 1QZYA 2F5DA 2VE8A 1Z9CA 2RVCA 3K1MA 1K78A 4I7HA 2DLLA 1ZN2A 1WRJA 3F23A 4L0YB 3R0AA 4U0YA 4A2UA 5FFZA 5DCFA 3WTWC 4A6DA 3R4KA 2L02A 3BJ6A 1HSJA 4BQAA 4EQQA 1ZLJA 3BP8A 4XLNF 2HQRA 2VN2A 1P4XA 4HF2A 3GFMA 2H6CA 2DFIA 4L9JA 4ENMA 3L09A 2H09A 3I0TA 2OQRA 4EVIA 2VOPA 5LEJA 3GZ6A 2GA2A 3VB2A 4RB0A 2A69F 1OYWA 2ZJ2A 1REPC 5A2QZ 1UCRA 3K0LA 1S3JA 3WGGA 2M87A 3JW4A 2XUBA 4ON0A 2PLYA 3E6MA 3K1NA 2Q2EA 2OZ6A 2XROA 1B9MA 4CGZA 1O3QA 3EYIA 1SD4A 5IT9Z 3N4MA 2E7WA 3MZYA 4KNYA 3JSPA 3EYYA 4M74A 4UHTA 1JHFA 3WTSC 3HOSA 3I59A 5BPIA 3VODA 2QBYA 1FSEA 1FZPB 2E7XA 1H9GA 5F64A 2ISZA 4GXOA 5DD8A 2HTJA 3R0JA 4M6XA 1USSA 3HIFA 3V8KA 1WI9A 1P4WA 2EFOA 2VBXA 3ZMZA 4HF1A 3HTSB 4BAYA 3DPTA 1XSVA 4IF4A 2KKOA 1T0FA 2DI3A 2X0LA 2GXBA 3E5UA 2EA2A 1RUOA 1QQIA 3L2CA 1KA8A 5FD5A 2STTA 2CGPA 1U5TA 4LK1F 3RKXA 3J81K 2P4WA 5HLIA 5JFRA 5LRRA 2MD5A 4WX9A 3Q5FA 2ESNA 4EV0A 1BI2A 2HWVA 4OIOF 4WXCA 4ZYHA 3WTYC 4BYYA 1J5YA 1OYYA 3C1DA 2FU4A 1P4AA 2FMYA 4G6QA 2LNBA 4KIGA 4LFUA 3M1EA 4NQWA 1XGSA 5E17F 3JTGA 2NNYA 3EQLF 2YSRA 4UVBA 4YFNF 1MZBA 2CW0F 1BC7C 1C0WA 4O3MA 4PDKA 3QU3A 3DP7A 1MGTA 4HX8A 5DUIA 4ZYDA 2PEXA 2E1NA 3CUQA 1B4AA 3F6VA 4U0VA 5D6EA 1IXSB 1B59A 2HKXA 1W7PB 3HRSA 2STWA 4Y17A 2HGCA 1HW5A 4EGZA 5K5OA 3BOQA 1OMIA 4GYGA 2FSWA 5TJJA 4LD5A 4HLYA 1ZRCA 1U3EM 2VOOA 1SD5A 4G7HF 5FFXA 2IA0A 2WTEA 1KU7A 3V7SA 1TLHB 1PP7U 1HXDA 3RIRA 4FHTA 1LDKB 5JI6A 3KETA 1WQ2A 2PMUA 1K6OA 3SFZA 1TNSA 4LMYA 3QPHA 2DPDA 3F21A 1YS6A 1XMKA 1CGPA 1YFHA 2QM3A 1SFEA 3H3ZA 2Y0MA 1IN6A 3K2ZA 5L3CA
chains in the Genus database with same CATH superfamily
3ZXSA 5FKLA 4ENNA 3VOEA 3SZTA 1CQTA 4HW0A 1K79A 3HM5A 4RLFA 3FX3A 4XLEA 5EGOB 1IF1A 4DIQA 1R6RA 2D45A 3AL0C 4PGHA 3A4CA 3C2GA 4ZYGA 2DAOA 3ZMUA 1X2NA 2X4HA 2YX7A 5JLXA 4FQGA 4NNJA 3FXMA 3IWFA 4F93B 5IYDJ 5LD2C 2LLKA 2L7MP 1F5TA 2ELKA 2R5YB 1HW1A 3HGYA 5K5QA 3LA2A 5BQTA 1FBQA 3OWTA 5J1RA 4NDLA 2R7ZJ 1J59A 2K9QA 2IRFG 1BIAA 3BPXA 3FXQA 4BQNA 2YU3A 2DTZA 2OA4A 2TRTA 2FX0A 2LY1A 3G6EI 3BG9A 1FJLA 4ZC3A 2I10A 2VI6A 1ORKA 2UZKA 2OTLI 3K69A 4I98B 4C3HJ 1QPIA 3LA7A 4J01A 2WADA 3JRIA 3OS2A 2RQQA 3RKWA 5KCMA 3X2QH 5GAGJ 2E5ZA 4CDGA 2K40A 1KGSA 4GO1A 3F8NA 1RPWA 2IA2A 3FK7A 4BUPA 2NVQJ 2DA1A 3FKJA 1MH3A 1ZGAA 1U78A 1B8IB 3S3MA 4KYWA 2LR8A 2LDUA 1DPRA 5M5WJ 1HKQA 2ZXJA 2DJIA 1Z91A 3QU6A 3DCFA 2GXAA 1QGPA 2LOOA 2K27A 1LFBA 9ANTA 2LRDA 1ZG5A 4B4CA 2KIQA 4XLFA 5ILSA 2V7FA 3S2WA 1JE8A 2Y31A 4Z6YA 4EMSA 2IGKA 2VASA 2VT2A 3I54A 3T8RA 4ZH4F 4Y33A 3JREA 4ENKA 4HDVA 3BZCA 3EDPA 3M07A 4H4KC 1W1WE 3DBHB 2VJ5A 2YUSA 1IDZA 2P5KA 1ZAOA 1R1UA 1YQAA 3BDDA 3BG5A 4OIQF 4RB1A 2IVMA 3QAHA 3BR5A 1ODDA 2FNPA 1E0EA 1ETKA 2DQLA 1BI0A 5J6XA 4YIIA 4HSTA 2BHYA 5CVVA 3BJOA 1V3FA 3KP3A 2CU7A 4MNUA 3OOPA 1IGNA 1I5ZA 1WJDA 5K7FA 2NOJB 1FX7A 3I5UA 1MMAA 1MNEA 1ZH5A 4BACA 4EJOA 1IXRC 2JPCA 1WGXA 2ID3A 1SD6A 4BDYA 1IN4A 3O3KA 3ECOA 2V4JC 4XKCA 5ICFA 5DCMA 3C2BA 1YJ9I 3J80Z 3NWTA 3HUGB 3KLNA 2KRFA 3FM5A 2K86A 4RGRA 2M4KA 1YI2I 3U2RA 2VT3A 3PM1A 3PNTA 4ASNA 1RR8C 4A0ZA 4XN0A 2E71A 3GO5A 4NC6A 2DQRA 1MJBA 4HOBA 2ELJA 2JA8J 3KZYA 3IP4B 1ERDA 5E18F 2P5VA 1EH7A 3E3VA 3DWLE 2DOFA 1MBFA 3FXOA 1K78B 1J75A 1JTYA 1VQNI 4A3BJ 1WJBA 5E1ZB 3EETA 1YJNI 4R1HA 3DEUA 5E20A 3JSOA 2Y30A 2A6TA 3C7JA 2JRTA 2L9SA 3G1LA 4UXNA 4BJTA 5K1YA 3H92A 4ENJA 2XDVA 4BJ6C 1G6NA 1X4PA 1GVDA 2DN0A 1SFOJ 1MJ9A 2R5ZB 2IP2A 1HBXG 1JXSA 3DPLC 1R5GA 2M8EA 2P81A 4GFBA 4HX7A 2PJPA 2X51A 1S9HA 3LSTA 2MGQA 1I1GA 5ILUA 2DPUA 1D1AA 3ZMTA 1B72B 2IS4A 3ZRGA 1FTZA 1A6IA 3OYJA 4F3QA 3PFYA 2BXZA 4BHCA 5L3BA 4RB2C 3JAMK 2DA4A 4LJZF 3T5XA 3QOEA 3T0YA 5CQGA 4M9ZA 2XV4S 2MLGA 1MBHA 2GAUA 2V9PA 1X58A 1S8NA 1W7PD 3FKIJ 4UVCA 4XOTA 1VQPI 2RC4A 2ME6A 3KYCB 2MH2A 5FO5A 3K10A 2XAGA 1P2FA 5FJ8J 1GUUA 4M9SA 4RGXA 3BC8A 3ONQA 3GTGJ 4PJMA 2ZNZA 3HHGA 1PDNC 5M5YJ 2HZDA 2WWYA 1H88C 2HXOA 4BY1J 2E19A 4Q47A 4QLCU 1R71A 2OPTA 1TC3C 2CFOA 1GVJA 4HX4A 4E7KA 2KMUA 2RREA 3L00A 2OUMA 3N97A 2UXNA 1OYIA 1OQYA 1SANA 2AXLA 4XNFA 3F8MA 4A3LJ 2RN7A 1UZCA 2Q2EB 2TCTA 1FSHA 2XB5A 1B1BA 2QZ8A 4P5OA 1Z21A 2VE9A 1RI7A 2ZJPF 4AIKA 2A6EF 1R5HA 2NOGA 1FBUA 1B9NA 2DU9A 3L2WA 3BROA 1VTNC 4KIFA 1E3PA 1MBKA 3TOAA 4FTHA 4RGSA 3GFLA 2WAEA 2L54A 4NC8A 1ZQ3P 3CD6I 2IGMA 4IHYA 1IUFA 2ECBA 2ZSHB 3ZP5A 5HLGA 4DBRA 3SJMA 4E7SA 4A3DJ 3I59B 2VKDA 1FYMA 2JA6J 4CYCB 3CCEI 5J40A 5C44J 2QBYB 3CCSI 1Z3YA 1JT6A 3CLQA 4I0BA 4B3AA 4ETSA 1WHUA 2FUG2 1ZRDA 1Z1DA 4B8XA 3WHBA 1TBXA 1O7FA 1LE8A 4L5JA 4IJAA 4MO7A 3CMMA 1IDYA 2I5UA 3GW2A 2K85A 4G12A 2K9LA 5EEHA 3GX4X 3P9IA 2XKPA 2F4MB 5F1RA 1QVTA 1WI3A 3CJRB 2BE5F 2L7ZA 3ZGKA 1XCVA 2EZHA 2P6SA 1VQLI 3KP4A 2TDXA 3JRHA 3SHFA 2EFWA 2R7TA 2DMUA 2QKMB 1ULYA 3M8FA 4D7NA 2O5RA 3BTJA 4XLHA 1P7JA 2M7BA 1HA8A 4RAZA 2M0MA 2A6HF 3A01B 3IAM2 3CZ6A 5HS8A 5M5XJ 2CQQA 3F9KA 2Z99A 2V1XA 4OMZA 5HDNA 3ZQCA 3CP2A 1LNWA 2XASA 4MLOA 1XS9A 3FIWA 4CCJA 4WXDA 1NHAA 3ZMSA 2VBZA 3B6CA 1MMGA 1U5TB 3R6SA 1SC7A 4KFCA 1T95A 1EH6A 2DA7A 4HQEA 3DEEA 2NYXA 1BJZA 1IO2A 2QKLB 3QYEA 1YIOA 1R49A 5AIPA 3CCLI 1RUNA 1SVOA 3DTEA 2BW3A 2W57A 1D8KA 3KEQA 4XBFA 2BZTA 4A69C 5BMZA 2R92J 4M73A 2EBIA 2NAZA 3L2QA 3H36A 1X1BA 5J4VA 2A68F 4PJ0C 4E7JA 4RA2A 3MZHA 2NRAC 1FC3A 3A0BC 4H0EA 1K83J 5EEGA 4HF0A 1KU9A 5FGMA 3LSHA 4DZPA 5FB2A 5E3NA 4A6EA 3JR9A 3QWLA 5IP6A 1XMXA 4AD9A 2NS7A 4IHWA 2XRNA 3SQNA 3JRFA 2O8KA 3OS0A 2WAQA 3DKWA 4NQWB 4LB6B 1I6HJ 3HKZN 5HODA 5E3LA 1QA6A 2FBIA 2AS5F 2EIKH 3P9KA 4BJ5C 2LBFB 3BPVA 2XAUA 2HVSA 4CZZA 3LAPA 4L5IA 3J7AO 2Y2ZA 3FXUA 2HQNA 3VYUB 3W2WA 4Y3OA 2BBYA 3KCCA 2DW4A 4C3IJ 2Y0SN 2L4MA 4QTRA 2IA1A 2DFHA 3FBIB 1Q1VA 3BQYA 3K4NA 4ZDPA 5ICEA 2R7FA 4FT8A 3JRBA 2QWWA 3CO7C 1GXPA 1G4DA 1OCPA 2DFEA 5HDGA 4U88A 3CUQB 3OYNA 2LD5A 1WJFA 2HS5A 4XN3A 1E3OC 3FDYA 2FBHA 3LSKA 3LSJA 2XC7A 3FHZA 2EINH 3K70C 2GXGA 1YIJI 2ZJRF 1RRJA 1IXCA 4JX6A 1PP8F 3QP5A 4OIRF 1NH3A 2K7LA 2EZLA 3GTQJ 4R8HA 5D4SA 5DD4A 4XIDA 3FXJA 4BE0A 2KJCA 3KIOA 4ESBA 1TWCJ 2M30A 2X6XA 4UUTA 1X3ZB 1RIOH 3E1SA 2LF7A 4ZZDA 1ETOA 4PZJA 2WAFA 4JOMA 5GPAA 3I4PA 1TZLA 1DQUA 3MWMA 3AL0B 3ULQB 4CICA 4RAGA 2QVOA 2ICWG 4PJJA 2HVRA 2OV7A 2HEOA 4PFPA 1WKMA 1H89C 2F2EA 1XGMA 4XKBA 1MMSA 4FETA 2XAQA 1AOYA 2MLKA 2L2OA 3WODF 1TP4A 2GBYA 1ZR4A 2X6WA 4MFEA 4ZDOA 5FLXK 2WV0A 2QSFX 2LKPA 2M4GA 3U1DA 4A3KJ 1W36C 4XM3A 3CESA 2ZMEA 2HDDA 1F1ZA 2JSCA 3ZOBA 1IRZA 2R4GA 2IT0A 2A07F 5F0CA 1DU6A 3AFHA 2RKHA 5E1XA 2R7QA 3F0CA 3KLOA 4B44A 3TMOA 3HOXJ 3BQZA 3C18A 2DK5A 3A2KA 1Z3XA 3LSIA 2HOAA 5D6FA 1XGOA 4HA8A 3K4KA 2VONA 1N75A 4WF2A 4GGGA 3CC7I 2W84A 3ZQHA 2KQRA 2LC2A 5CJ9A 2BHZA 2LG4A 2ZXIA 3HOTA 3R60A 3TQNA 4L9TA 1SFXA 2EQRA 2OD5A 3JTHA 3VYTB 2ME0A 3M4OJ 3TP3A 5J8CA 1O3RA 1LVAA 1J9IA 3JCUC 2JN6A 5KAIC 1TNTA 5KAFC 4Q5SF 1WVRA 2HXIA 4RBOA 1V54H 1STZA 2YPRA 3OMYA 4LIVA 3ASOH 4UB6C 5EDNA 3A1YA 2CW8A 1N77A 5JHFA 3TDUC 3Q0WA 5IOZA 1U5TC 4YEJA 2EB7A 3RZDJ 3GMEA 3I64A 4RM3A 2M45A 3DKYA 1AWCA 2XPWA 4BE2A 1YX5A 3OS1A 2VLAA 1X3WB 2P0WA 2XSDC 3HSEA 2V1UA 1DP3A 3PIPF 1LPQA 2DA2A 3CUOA 1UHSA 2E35A 3ML6A 3Q9VA 1G2HA 1S7OA 4BDZA 5LHHA 3CCQI 3HRTA 5BS6A 5TRDA 3DEWA 1IG7A 2CSOA 2Q1ZB 2K9NA 4Q4ZF 1RZ4A 2IAIA 4LGWA 1T6SA 3PSFA 3FXLA 3RJPA 2F48A 2GIVA 4LLGF 3CLOA 1S72I 1DP7P 2CV0A 3K4CA 2NVTJ 2K4JA 1J7KA 2B7EA 3F22A 1FOXA 2HYGD 1D1CA 2VC0A 2X9DA 4U87A 4BY7J 3LNQA 4L5EA 3CP8A 2R7OA 3HGGA 2HZTA 1WWXA 1HCRA 3HB9A 4KUMA 4IHXA 2IXSA 4EM1A 3WGHA 2XAFA 1FTTA 1X19A 2OC6A 2KFDA 3H5AA 2P7CB 3LSPA 3LQRA 5D8KB 3HL2A 5E3OA 2JA5J 2JVGA 5GAEJ 5L3CA 3I3LA 1ON1A 2K9SA 2OCEA 1V4RA 4UNOA 2AQFA 4W97A 2B63J 2HKOA 3IKTA 1VQMI 2F6CA 1FMVA 1ZHFA 4AM3A 1D0XA 4ZYAA 4M72A 3CUQC 3E5XA 3W2VA 5HNFA 2VC1A 3I58A 4C9YA 4JBAA 3KX2A 4BQOA 5C4JJ 1D1BA 4JP0A 2W48A 3BR6A 2OAZA 1R22A 4GCVA 2KIFA 4BHPA 2QQBA 4CCKA 2JT1A 1Z0XA 2DJNA 4AIHA 3QPTA 2BGCA 2HR3A 4EJTA 2KIUA 2PMHA 1OR7A 5F27A 5GADJ 4G94A 3ZMDA 2ZB9A 4FISA 1LUJB 3CO6C 1UFMA 3ZN0A 3SDBA 2O6GE 2XVCA 1Y56A 4PCQA 4EJWA 4U7DA 3AAFA 5EZHA 3HOYJ 5LRSA 3GWZA 1UJ8A 4EM2A 3NARA 4XSXF 1OLTA 2X85A 3H0DA 4YELA 3IH4A 3WU0A 1Y0UA 3HTUA 4F7ZA 3HSFA 1KU3A 5EEAA 5DCMB 1FY7A 1SAXA 4WK8F 4HNUA 2YS9A 2O03A 3GUDA 2HOEA 2E1MC 3BR0A 2OCCH 3VYSB 1X4OA 2GA1A 4IQJA 3CJNA 2ZFWA 3BG7A 3IRRA 1MDMA 1OCCH 3F3XA 4N0BA 2OZUA 4B09A 3TKYA 3HG9A 2LH9A 1HDPA 1WJCA 1Y0NA 3GTLJ 3FM3A 1MH4A 3PO2J 3WTVC 3S2DJ 1Y8RB 4M6YA 4OWRB 2RQPA 4Y13A 4G9YA 1Y6IA 4AC0A 3S3OA 3S17J 2Y69H 3QOPA 3BR3A 4Q48A 4LG0A 3IRQA 2XKOA 3FMQA 2MA3A 3EPZA 2IPQX 3E6CC 1VZ0A 2VXDA 1JHHA 1LEAA 2KRHA 3C3WA 3G3ZA 1XB4A 1QO0D 4G6TB 5E8GA 2CO5A 4RLQA 3ZN1A 5D4RA 1T8IA 3I56I 2GLOA 2CUEA 4I02A 4BBRJ 4PGGA 1NG6A 1VF9A 1BJAA 2QLZA 4MQVA 2FBKA 2V79A 1BI3A 1I6XA 1MNMC 3LFUA 3CMAI 3V42A 3DQVC 1LJ9A 1LQ1A 3IH2A 3OL3A 4P96A 1N78A 2VQGA 4BU2A 2ADUA 2FEZA 4MIMA 4FX0A 3KP7A 2VQLA 1XSXA 1QZZA 1ZGWA 1MJAA 3D5LA 5DYMA 2WB1A 2R7XA 1LDDA 2XAJA 3RTRA 4X6AJ 2Q8KA 1MIJA 1HKSA 1H9TA 2KHMA 2GZWA 3HOUJ 3MCZA 3HSRA 1IZ1A 1QNTA 1FBSA 3MKWB 4E7IA 5EJCA 3Q0VA 1AHDP 1R1TA 4I2OA 1FWZA 2E60A 2RV8A 1FIAA 3DBRB 2VXZA 1RC9A 1G3YA 3HPGA 1IV8A 2O3FA 1DGRM 1ZR2A 3LQQA 1HW2A 3OYLA 5HLHA 4IQ4A 4CH7A 1VQOI 1HSTA 4D1QA 2D1VA 3H5RA 2M7AA 3ZQFA 3HRUA 4Y4RA 2L4AA 3WU2C 3RKQA 2IS6A 3GYHX 2G9WA 1F43A 1L0OC 2Z9OA 2VKEA 2L9NA 4PSXA 2EWNA 4I76A 2CV2A 1BW6A 4A0XA 2Z33A 1VQ8I 2QQAA 4BBSJ 1DPUA 3MZ8A 4XRMA 1YLFA 1Y8QB 3V7RA 3IWZA 1DUXC 1JUPA 1UG0A 3N05A 3MFKA 1F4KA 3JRDA 4IPAA 1N25A 2D1HA 3V4GA 3CC2I 4YFKF 1MSEC 1SMYF 2OF7A 2K5CA 3MKLA 3RDIA 2H27A 1HKTA 3LAJA 4M9XA 4B43A 2KPMA 1AKHA 3TO6A 4IL6C 3W6KB 4HBLA 2KZGA 3KE2A 3GVAA 5H6RA 1EKEA 1S29A 3MKZA 2DT6A 3BR2A 5HS7A 1KZHA 4HZFA 3QYFA 4J19A 5LEKA 2F5CA 3G4SI 3VPRA 4AWXB 3WTTC 2CFXA 3HC7A 1JJ8C 1BN5A 1XC5A 2W25A 1ZYRF 3A02A 2L7FP 4WWCA 4IZZA 1YW9A 2WY8Q 1SFUA 1LB2A 4IHVA 2DK8A 3NQOA 2F4IA 1WCMJ 2V1NA 4I6ZA 4LLLA 3CCUI 2FQ4A 2NVYJ 5A2QK 3HKZA 4A5MA 3LSRA 1WJAA 3BR1A 1LE8B 1ETYA 4KIBA 4PFOA 1D8JA 1QPMA 3DF8A 4NBQA 2BOLA 4IRHA 1G8XA 1T98A 2BYVE 1SD7A 2EK5A 2GOMA 3QQAA 3WTUC 1XMAA 2EV0A 4A0YA 1FNNA 4LITA 3S3NA 3ASNH 2UXXA 4F92B 3CDIA 2G7UA 1TW3A 3FHNA 5HS9A 4BE1A 1MKMA 2LVSA 2V6CA 1H8AC 4KITB 3RYRA 2GIZA 5LGNA 1EH8A 5H6QA 4P9UA 2DYRH 1U8RA 2QQ9A 1WZ2A 5IT9K 2W24A 1VQ5I 3F72A 3VSKA 3F6OA 1W5TA 3DFGA 4CHUA 3TO9A 2KT0A 2LTPA 3COAC 3IHUA 2ZFUA 3TBIA 1J2XA 3PFIA 1YW7A 2GOXB 3WE3A 1TW2A 5D5WB 2HOTA 1I39A 2PI0A 3RYPA 2BW3B 2EPFA 1G3SA 3BZ6A 4N4NB 3OYDA 2W82A 3FZVA 4M3DA 4RS8A 4DGWB 1XGNA 4LK0F 2KJBA 4ZTFA 3KPHA 2Y9ZA 3G73A 4L9VA 5F6FA 4FCYA 2UWMA 3LL7A 2VB6A 1BIBA 4M3GA 4MTEA 3U21A 4KT5C 4PSWA 2M2EA 4O5VA 5M3FJ 1QRYA 3T8TA 1NG7A 2JTVA 2P6TA 1JUSA 3TO7A 3QRFF 4V19K 5IOYA 5JVTA 3PJRA 2W4SA 5FKOA 3KYDB 3SZPA 3GTMJ 2JVHA 3I4MJ 2JWTA 1EJ9A 1XCBA 1K6YA 3BCAA 3H3UA 5FKMA 2XF6A 4M6VA 3WG7H 5CVJA 1FP1D 2CQ7A 2NXNB 1O7LA 1Z6RA 3HJEA 4U7BA 5AIQA 1O4XA 3FF5A 4EJUA 2JQ7A 3VDXA 4Z2YA 3B02A 4UY8I 5LFAA 3CF5F 1HDDC 4DQ2A 1A31A 4LLNA 1BBYA 4WCGA 1FMWA 2MBFA 4KN4X 5DM7F 1TQPA 1IN5A 2Q0OA 3WE2A 4ZZLA 4HV5A 3WHCA 4XSZF 4QSHA 4JX5A 2IJLA 4D5CA 1E17A 2H94A 1USTA 1UHWA 2COMA 3BTLA 4P9FA 1R4MB 3FISA 4IRIA 2ZBKA 2OU2A 1HQCA 3H9GA 4UV8A 1ZRFA 3DLAA 4KMFA 2F5EA 1ENHA 5HNHA 2R7WA 3ERED 1BI1A 2IS2A 3S93A 3MEXA 3CMEI 4MTDA 3ZQGA 3IKVA 5JR3A 2HU9A 5CPRB 1TWGJ 5EG0B 1Q1HA 3REOA 3D0SA 6PAXA 2EZKA 1F36A 2ZJQF 4CCNA 4MHGA 2HYFA 2V1DA 1FT9A 2FE3A 2K3PA 2P7VB 4FE4A 1IN8A 4IHSA 4AYBA 1PYVA 4EEFG 2CUZA 5JHUA 2KDOA 4X0GA 5K7ZA 1UB9A 1JKQC 4IO9F 4FASD 1K4SA 2DXIA 5CKTA 1VQ4I 2EFQA 2WBMA 2A3SA 2R7VA 2I8DA 2DMQA 4AIDA 3FK6A 4HYEA 1O3TA 4EGYA 3SYTA 5GP9A 1MBGA 2CJJA 3OYMA 5CVRA 2P8TA 4E4HA 1W0TA 3DU6A 2QEXI 5LHIA 1G3TA 2ZMEB 1GT0C 1Z77A 2XGXA 5KVRA 5IPAA 2JZYA 3SEQA 3GTJJ 1SVMA 3NAUA 3HEFA 4HPQA 4MEXF 4BQQA 2O7OA 4IX7A 5JVGF 2M5WA 2QA4I 5DEQA 3BG6A 2WC2A 5FRNA 1NK2P 1X1AA 2W1OA 4UVAA 2BY1A 3O8HA 4JQFA 1LDJA 4HEA2 5L3DA 2H1LA 1LKXA 2N8GA 1VNDA 3RPUA 4DBQA 3JAMZ 1WFXA 4FX4A 4BH9A 5CYVA 2ZCWA 5LHGA 2O8XA 1U8BA 1Z7LA 3OIQA 1H0MA 3I71A 3VEPA 4E7ZA 2FJ1A 3W6VA 3ESWB 5CVIA 5H20A 2VIXA 1J09A 2UV1A 2DA5A 4BGDA 1Z7UA 2VBWA 2CWEA 2VL8A 3BY6A 4F52A 1E2XA 4GYIA 5DM6F 1AU7A 2HOSA 3JRAA 3ZMVA 1V5FA 2FA5A 2QQ8A 4NUBA 4AU7A 2BV6A 4ZYEA 5LLQA 3TGNA 3GCMA 4B3XA 1GXQA 1MNDA 4S05A 3U9GA 5E1WA 2L7KA 1D3YA 3I55I 5L3GA 1S6LA 3ABUA 2F5VA 3CJTB 2EJRA 4XRFA 1V5GA 3I53A 3PO3J 3KEOA 3Q9SA 4II3A 1YRNA 2DBBA 3DV8A 5BOXA 3OSFA 2QYOA 5BPDA 3GF2A 3CDLA 2JA7J 3LMMA 3UR3C 3E5QA 5EG0A 1LFUP 5FRMA 1JI8A 1X1PA 1POGA 1P6RA 5D5UB 2DMPA 2ZSIB 5CQEA 4XRSG 5GTHC 1I3AA 1OCZH 3ABTA 2CUJA 3LWFA 3CDHA 5IT3A 1W5SA 3C2HA 1RKTA 2LF8A 2QENA 2KL4A 3PQJA 4QPOA 3S14J 2H1KA 4ZDLA 4K2EA 1XDSA 3ISPA 1R5ID 5ILVA 4A93J 3OYKA 4X1EA 2V6EA 5L3EA 2X1DA 1QZEA 2A5YB 2E1MB 1I50J 2M3AA 2HPIA 1IV6A 2IEKA 4AVPA 5HOOA 1OCTC 1LEBA 3GZNB 4BS9A 4FE7A 5F1JA 4CYDA 1YO5C 5TISC 2XSJC 1D0ZA 4D5FA 4DJAA 3K9TA 4ANJA 1U0JA 4HDUA 3RPQA 1TQIA 3CTAA 3KP6A 3ZCOA 1T2KA 2CV1A 1OJLA 4A3EJ 1A6QA 5B5EC 3LSMA 3GTPJ 3HYIA 4KDPA 1ON2A 1R00A 1SAUA 3RKYA 1ETQA 2HPMA 3BLYA 2NS8A 2PN6A 2NNNA 2V9KA 3IAS2 4YG2F 5D5VB 4QWQA 2Z16A 1EV7A 1X3UA 4TV7A 4DOZA 3S2HJ 4EJVA 2XRLA 3LA3A 4V2GA 4OMYA 3WU1B 2W00A 2KLOA 3LFKA 1ZGJA 2J5PA 4BXUA 3SEZA 5F08A 4IRGA 3HBLA 3KP2A 3OR2C 4MGRA 2ESHA 5J1YA 3OYBA 4A3IJ 5CVUA 4ABZA 3OIPA 1YOVB 1IRFA 1R36A 3HOVJ 2UUZA 2EIMH 4XORA 1IUYA 2E5NA 3FMRA 1MD0A 1RR7A 4HLXA 2L01A 4XLPF 4I09A 2E2JJ 1O3SA 1P7IA 2D2WA 2KZVA 3K70D 1FOYA 4CCMA 1FLIA 3RI4A 3GXOA 2VKHA 2DDAA 1KU2A 1D5YA 4GDFA 3S1NJ 2W7NA 3FXKA 4KA4A 4XICA 2AQEA 4L9NA 5ICGA 4OIPF 2IW5A 2DA6A 2DO7A 4UV9A 4A3JJ 1CF7B 2AO9A 3J7AY 2YU9J 4UUVA 3HRMA 3OYEA 1FPQA 4IXAA 1QBJA 3I4NJ 3D5SC 2CQXA 1MDMB 1T39A 4D7MA 4RB3C 1IAWA 2JK3A 2CYYA 3AG2H 1KYWA 2ZMEC 4HV6A 1YITI 4Y15A 4DW6A 4ITVA 2XIGA 3J7ZI 2J5OA 4NHJA 4CUGA 3M1CA 5BNGA 3HDDA 1SMTA 1BW5A 2VJIA 1BOBA 2KP6A 1BL0A 1O57A 2B9SA 3M8EA 2HVQA 4LG0B 1MBEA 4E70A 5E3MA 3S16J 4PUSA 3DU5A 1TL8A 2R7RA 4L0ZB 2LY2A 3RZOJ 2KDZA 2ISYA 3MAJA 5LGUA 2YR2A 1W36D 2ECCA 2YX4A 4OINF 1KQ0A 3HPHA 4BNCA 4A3GJ 3H3VK 4KICA 3HZJA 4AIJA 3PL8A 4M71A 1TQMA 5CLSA 4HAMA 1IRGA 2GWRA 3H9QA 2D5VA 2MW8A 4UB8C 2HTSA 4JK1X 3BTIA 2V9VA 4RAYA 4P55A 3J80K 3KFWX 2WAQN 4KISA 4U0WA 2WV1A 4KMUX 2RGVA 3H0GJ 5B66C 4KN7X 1I3QJ 2AXTC 5M3MJ 1YYVA 2VQHA 2R7UA 3FMSA 1FIPA 1DGWY 1W5CC 2XB0X 4YFXF 1ZLKA 4G7OF 3PQKA 4OAYA 4S04A 3EUHA 4G6DA 2CH0A 4S0HB 2ZXHA 3K1PA 1Z05A 5D5XB 1PUFA 1UMQA 3B73A 1L3LA 2X1EA 2WA0A 2X6OA 2L3DA 3BWGA 3UNGC 3O8GA 3MD2A 3QP6A 1ZG1A 4F91B 2H8WA 3KZZA 1GLNA 1JTXA 3BG3A 2H6BA 3VSLA 4BL0B 2FOWA 2HI3A 2QUFA 4ESFA 1QU3A 1KYZA 1JT0A 2OBPA 3HOWJ 1WPKA 3GZ5A 5GAHJ 2M34A 3V8LA 1Z6TA 4LB5A 4C30A 4EM0B 3J81Z 3GTKJ 5ED4A 2Z5UA 3IC7A 2DTRA 2O0YA 3K6GA 3L9FA 3NRVA 2PG4A 4DZJA 1CF7A 2QSHX 1IN7A 3Q0UA 1X1CA 1S7AA 2XAHA 5FLXZ 5IY5H 4RM2A 1XD7A 3ZQIA 3CCMI 2JMWA 1ZG3A 3FWEA 3WG9A 4DYRA 5K5RA 1ZREA 1SVLA 3E6DA 4BEHA 4W1UA 2DDBA 3O6BB 4HG2A 1TTYA 2DODA 5E79C 3TEDA 1AKHB 1BM9A 2O61A 1PUEE 2EZIA 3PUFA 2ACJA 1BR1A 3IV5A 1W7PA 2EV5A 2KIMA 3EUHC 1U6GA 3LSGA 4ZTJA 1I27A 3B6AA 2JPBA 5HVQC 2PQ8A 1KQ9A 1QHGA 1HC8A 1OR7C 3ABKH 1UELB 2W85A 3K4MA 2F5FA 1T38A 2CW7A 2R93J 1R1VA 1ETXA 1W0UA 1OCOH 2E1CA 4M3BA 4WXHA 3CCVI 3GFIA 2G7HA 2CRGA 2GQQA 3P7NA 2NS0A 4XOPA 2RAEA 5F04A 4G7ZF 4C2TA 3H9JA 3WTZA 3WGIA 2PJRA 2R3SA 3V8JA 3FXRA 1OKRA 3KP5A 1I1SA 4MEYF 3SDGA 3RCOA 1ONVA 3P9CA 3M7GA 1VQ6I 2QGUA 2DOEA 4P1WA 4RGUA 5LBQA 4YRVA 2FQ3A 1FYLA 1G3WA 3H1CA 1OFCX 3A0HC 3ZPLA 3DXJF 3DTKA 3GBGA 1JKPC 3ZR8X 4R79A 1X2MA 3TP0A 3P5JA 1F9NA 2L9RA 3R61A 4XMYA 5AONA 4HQMA 4AVZA 1YW8A 2VJ4A 5J47A 2PMZN 1G59A 2LFBA 4DYCA 2VPRA 1Z67A 1XDUA 3A03A 3GLXA 3TDZC 1FP2A 1KQ8A 1BC8C 2HDWA 1UHMA 2FF4A 4PJLA 1MMDA 1ZARA 2ELHA 2LK2A 1BOAA 4IKFA 1ETWA 1W4MA 1R58A 5KNLA 2OQGA 2M9HA 5DDGA 1JGSA 1MW7A 3CF2A 3L1PA 5D8LB 3ELKA 2ZC2A 2R7SA 3PSIA 3IL2A 3W2AA 2CG4A 2ID6A 2VUMJ 2K3FA 3S1QJ 5E8IA 1K4TA 1U2WA 2FOKA 4MQ9F 1YS7A 1FYKA 4A5NA 2FXAA 3K4BA 1D5VA 2VODA 3T1BA 5J8FA 4RMNA 1EF4A 3QYBA 3W6JB 2FRHA 1K7AA 4BHBA 4O6JA 4I0AA 3E6BA 5L3FA 5EGOA 3SXYA 4OOIA 2ZKZA 2HFHA 1TT0A 1OPCA 2LP0A 2ZO4A 3GEZA 3TW7A 2XGDA 2RNJA 5DS9A 3OSGA 2P5LC 5FKKA 4CO8A 2H8RA 2HDCA 3SZGA 4ESJA 2CQNA 2MYSA 3D5RC 1UG2A 3E0JB 3DLLF 2B0LA 2A61A 2MH9A 3S1RJ 1VQ9I 1R23A 3WTXC 1ACIA 3VWBA 3L7WA 2MC3A 4B47A 2JJ7A 1J0RA 2RDPA 3F8CA 1IJWC 1VQKI 3M9AA 2R5YA 4YIRX 2K02A 5GTIC 1B6AA 5IYBJ 3HHHA 1DDNA 5H2FC 2PFBA 4XONA 1ZTRA 4RAFA 1Y1WJ 2XPUA 2PBIA 2HYJA 1A5JA 2LKSA 1PJRA 2FNAA 2EV6A 2K4BA 2Y9YA 1YTYA 2DOAA 4KT6A 4HNTA 4M3EA 3ZQQA 3F8BA 4DYQA 4Y7NJ 4II2A 1V5EA 2AHQA 5HDKA 1T33A 2QF7A 1EA3A 4E6KG 3PNYA 1XSDA 4L18B 1GV2A 3Q3SA 2JUGA 3GLLA 4MFDA 4BXXJ 5HLTA 2X1CA 3NEUA 3SFIA 1D0YA 2LSOA 4OU0A 4IHTA 2E34A 5EYRA 1B8IA 4CXFA 2DT5A 5FD6A 2CQKA 2OJED 4I99C 2KRCA 4E7HA 2E36A 5DUKA 1SFKA 3BCBA 2Y0SA 4DNCA 1YE9A 1NK3P 1Y1VJ 1TT5B 4N9IA 4A3FJ 2HQAA 1P92A 2JA2A 3J7YJ 3TW6A 4G8XA 5B3SH 4YIFA 2BY2A 4A12A 4I01A 1WSUA 2DA3A 4D0PA 1VFCA 5KHDA 2C6YA 2EFPA 2PX9A 5F0FA 2XHKA 2XF5A 1HLVA 2EILH 1R4NB 2IS1A 1JKRC 2KISA 2M1BA 4OAZA 1OCRH 3CC4I 2Y48A 1T08B 3GTOJ 3OR1C 1IW7F 2ZNYA 4XKVA 5ICCA 1XN7A 1R7JA 1FOKA 1P9QC 2VBYA 3V7CA 1YG2A 3G1MA 3AG1H 4N9HA 4IVNA 3GFJA 3S32A 3OL4A 5ERIA 3BJAA 4IOAF 3ABLH 1XTAA 1K61A 3E97A 3H35A 4LG3A 5F0HA 1NTCA 1T56A 5DV5A 1U9NA 2BY3A 2EFNA 1A04A 1ETVA 2ETHA 2Y75A 2Z3YA 5KK1A 4J00A 1RNLA 2JSPA 2R7DA 3BTCA 4LIUA 3ZQ7A 2E2HJ 3OV8A 1GDTA 4HRIA 3TOBA 2DMNA 3MN2A 3ROUA 3MQ0A 4NB5A 1PVEA 4CZCA 2BEOA 3O2PE 2EA4A 2L5QA 2A05A 3F8FA 3HUGA 3LOCA 4D9JA 3ZQLA 1M1EB 3ABMH 2FMLA 5IP9J 5LGTA 1LFPA 2VQCA 1GHCA 1U9OA 1SEUA 2G0EA 3ECHA 2NVXJ 2BY0A 2XGEA 1DU0A 3QPLA 3M3YJ 1QZYA 4QPQA 1YHQI 2F5DA 2VE8A 1Z9CA 2RVCA 3K1MA 1K78A 2XGCA 4I7HA 3DPUA 2HQ5A 1APLC 1JJ6C 2DLLA 1AA7A 4CCLA 4IOCF 1ZN2A 3M8JA 4KJZA 1WRJA 3F23A 3L2RA 5J4YA 4L0YB 3R0AA 4U0YA 4A2UA 2WB1N 3G2BA 5FFZA 5DCFA 3QPSA 3PNVA 1VQ7I 2R5ZA 1YRNB 4RDUA 3PUBA 5GPCA 3WTWC 4A6DA 3R4KA 2MSYA 4C2MJ 2L02A 1GV5A 3BJ6A 1HSJA 4IEJA 4BQAA 3H5NA 2R0QC 2E1OA 1WJEA 3D1NI 1B72A 4EQQA 1ZLJA 3BP8A 2COBA 4XLNF 2GM4A 2HQRA 3JRCA 1WH5A 2VN2A 1Y39A 1RKWA 2VPLA 1P4XA 2HNHA 2QSGX 4HF2A 3GFMA 2H6CA 2DFIA 3IH3A 4L9JA 3KZIC 2JRMA 2LMDA 1ZELA 2A5WA 4ENMA 3L09A 4AUXA 2H09A 1XX5A 2M0CA 1FEXA 1XG1A 3I0TA 4CA0A 5C3EJ 2OQRA 4EVIA 2VOPA 5LEJA 3U1KA 4XR6A 3GZ6A 2O9LA 4C2UA 1MMNA 2GA2A 3VB2A 4RB0A 4V2FA 3CMYA 2A69F 3AKZA 1KONA 1OYWA 2IGNA 3QODA 2ZJ2A 3G71I 1FOWA 5FLMJ 5A2QZ 1REPC 1UCRA 4N4OB 3K0LA 1S3JA 3K4LA 3WGGA 2M87A 3JW4A 2XUBA 3L2VA 4ON0A 1HF0A 2PLYA 3OIOA 2FD5A 3E6MA 3RQIA 1YJWI 3K1NA 2DFFA 3MKYB 2Q2EA 2OZ6A 2V26A 4PJNA 3OYGA 1A36A 2XROA 1B9MA 1WJ5A 4CCOA 1R9TJ 2QCOA 3CCRI 2L0KA 1O3QA 3EYIA 4CGZA 1SD4A 2VJJA 2IBDA 5K7HA 5IT9Z 3CCYA 2L9VA 1RETA 3N4MA 1ZK8A 2E7WA 1WH7A 3W3CA 3MZYA 2DMTA 4KNYA 4BXFA 3JSPA 2WY7Q 1TWFJ 3EYYA 4C3JJ 1QVUA 2MD0A 4M74A 4UHTA 1JHFA 3VYRB 3WTSC 3HOSA 3I59A 4Y52J 3OYIA 5BPIA 4CYCA 4F55A 3VODA 2QBYA 4XLCA 1FSEA 2MABA 1FZPB 3EUAA 2E7XA 1H9GA 2CMPA 5F64A 5EF6A 2ISZA 4GXOA 4QIWN 5DD8A 3RSNA 2HTJA 3R0JA 3AG3H 3DBLB 3NWSA 1ZKGA 4M6XA 1S7EA 1USSA 3HIFA 3V8KA 3G1OA 1WI9A 1P4WA 2EFOA 2DYSH 2BXYA 1BR2A 2VBXA 4XLAA 3ZMZA 4HF1A 3HOZJ 3HTSB 4BAYA 4HSRA 3DPTA 5C4XJ 1XSVA 5B1AH 4IF4A 2CUFA 1RESA 2KKOA 3IUOA 2EH3A 1T0FA 4UUSB 2DI3A 2JUCA 2X0LA 5IP7J 5FLVA 3E7LA 3A01A 1UAAA 2GXBA 5JLWA 3E5UA 4JX4A 2EA2A 3EUKL 1RUOA 1QQIA 3L2CA 3MVPA 3BT9A 1KA8A 5FD5A 1JKOC 2STTA 1TWAJ 2CGPA 1U5TA 3OOUA 4LK1F 3S8PA 2RNGA 3HXLA 3RKXA 3KYLA 1A35A 3J81K 2P4WA 5J3LA 3L2UA 3UKGA 5HLIA 1JUMA 5JFRA 1BA5A 5DTDA 5LRRA 4XL9A 2MD5A 3BZKA 4WX9A 3Q5FA 2ESNA 4EV0A 4XQFA 5J1UA 1BI2A 2HWVA 4OIOF 3RQ4A 2K9MA 2Z1DA 4WXCA 4ZYHA 3WTYC 4BYYA 1J5YA 1PUFB 1OYYA 3C1DA 2FU4A 1P4AA 2LY9A 2FMYA 4G6QA 2ZXWH 2LNBA 4KIGA 4LFUA 3I9V2 5EZGA 1MSFC 4M3FA 1QHHD 3M1EA 4NQWA 1XGSA 2VKVA 3DKXA 3CQZJ 5E17F 2MG4A 3JTGA 2LBFA 2NNYA 3DTIA 3EQLF 1IRXA 1IC8A 4BKXA 2IGOA 2YSRA 4XK4A 2LREA 1T0FC 4UVBA 1BR4A 4NC7A 1MZBA 4YFNF 1JGGA 3K4JA 2CW0F 1BC7C 1C0WA 2PMZA 4GRIA 4O3MA 4PDKA 3QU3A 3CCJI 5FROA 3MMYB 1X1DA 3DP7A 1MGTA 4JYKA 4HX8A 2LYCA 5DUIA 4ZYDA 2CS3A 2PEXA 4LOCA 2E1NA 4A3CJ 2BVLA 3CUQA 2MC4A 2XF7A 4BEHB 2EIJH 4EATA 3RPUD 4XRSA 1B4AA 5FKNA 1TWHJ 4AYBN 3TL4X 4E7LA 3F6VA 4U0VA 3OYAA 2F4OB 5D6EA 1IXSB 4HNVA 1ITYA 2LKXA 1B59A 2HKXA 3PIOF 1W7PB 2E2IJ 2Z2SB 3HRSA 4UUSA 2XPVA 2STWA 4A3MJ 1S5LC 4Y17A 2HGCA 1HW5A 4EGZA 3KEYA 4XKWA 1VI0A 2BVMA 5K5OA 3BOQA 1OMIA 3JRGA 2X48A 3ERMA 4GYGA 1YX3A 2FSWA 5TJJA 2PJRB 1OISA 4LD5A 4HLYA 1ZRCA 1U3EM 2VOOA 3S1MJ 1SD5A 2X6YA 4G7HF 5FFXA 2IA0A 1V55H 2WTEA 1KU7A 3V7SA 1TLHB 2NVUB 1PP7U 1HXDA 3RIRA 4FHTA 4B1RA 1LDKB 5JI6A 4ZJZA 1WQ2A 3KETA 3K7AJ 4B48A 2PMUA 3OYCA 3AG4H 3SFZA 1K6OA 1TNSA 4LMYA 3QPHA 5TGTA 2DCEA 2DPDA 3F21A 3S15J 3OYHA 1YS6A 1XMKA 2DT7B 5B1BH 1CGPA 1YFHA 2QM3A 1MBJA 1SFEA 3CJQB 2M8GX 1HOMA 3K2AA 2MFZA 3H3ZA 1E3HA 1LVKA 3FBNB 3OY9A 3OYFA 1XPXA 5IYCJ 2Y0MA 4PK4A 1IN6A 2OTJI 3K2ZA 3VFZA 4CSWA
chains in the Genus database with same CATH topology
3ZXSA 4ENNA 3VOEA 3SZTA 4HW0A 1K79A 4RLFA 3FX3A 4XLEA 1IF1A 2D45A 1R6RA 4DIQA 3AL0C 4PGHA 3A4CA 3C2GA 4ZYGA 2DAOA 3ZMUA 2X4HA 2YX7A 4NNJA 3IWFA 4F93B 5LD2C 1F5TA 1HW1A 5K5QA 3LA2A 5BQTA 1FBQA 3OWTA 1J59A 2IRFG 1BIAA 3BPXA 3FXQA 4BQNA 2YU3A 2OA4A 2LY1A 4ZC3A 2UZKA 3K69A 4I98B 3LA7A 4J01A 2WADA 3OS2A 2RQQA 3RKWA 5KCMA 2E5ZA 4CDGA 1KGSA 4GO1A 3F8NA 2IA2A 4BUPA 3FKJA 1ZGAA 1U78A 4KYWA 3S3MA 2LDUA 1DPRA 1HKQA 2ZXJA 2DJIA 1Z91A 3QU6A 1QGPA 2LOOA 2K27A 2LRDA 1ZG5A 5ILSA 4XLFA 1JE8A 3S2WA 2V7FA 4EMSA 2VT2A 3I54A 3T8RA 2IGKA 4ZH4F 2VASA 4Y33A 4ENKA 4HDVA 3EDPA 4H4KC 2VJ5A 2P5KA 1ZAOA 1R1UA 1YQAA 3BDDA 4OIQF 4RB1A 2IVMA 3QAHA 1ODDA 2FNPA 1E0EA 2DQLA 1BI0A 5J6XA 4YIIA 4HSTA 5CVVA 3BJOA 1V3FA 3KP3A 4MNUA 3OOPA 1I5ZA 1WJDA 2NOJB 1FX7A 3I5UA 1MMAA 1MNEA 1ZH5A 4BACA 4EJOA 1IXRC 2JPCA 1SD6A 4BDYA 1IN4A 3O3KA 3ECOA 2V4JC 4XKCA 5ICFA 5DCMA 3J80Z 3NWTA 3HUGB 3KLNA 2KRFA 3FM5A 2K86A 4RGRA 2M4KA 3U2RA 2VT3A 3PNTA 4ASNA 4A0ZA 4XN0A 3GO5A 2DQRA 1MJBA 4HOBA 2ELJA 3KZYA 3IP4B 1ERDA 5E18F 2P5VA 1EH7A 3E3VA 1J75A 3DWLE 1K78B 1WJBA 5E1ZB 3EETA 4R1HA 3DEUA 5E20A 3JSOA 2A6TA 5K1YA 3C7JA 2JRTA 4UXNA 2L9SA 4BJTA 4ENJA 3H92A 2XDVA 4BJ6C 1G6NA 1X4PA 1MJ9A 1HBXG 2IP2A 1JXSA 3DPLC 1R5GA 2M8EA 4HX7A 2PJPA 2X51A 1S9HA 3LSTA 1I1GA 5ILUA 2DPUA 3ZMTA 1D1AA 2IS4A 3ZRGA 3OYJA 4F3QA 4BHCA 3PFYA 5L3BA 4RB2C 3JAMK 4LJZF 3T5XA 3QOEA 3T0YA 5CQGA 4M9ZA 2XV4S 2MLGA 2GAUA 1S8NA 1W7PD 4UVCA 4XOTA 2RC4A 5FO5A 2MH2A 3K10A 2XAGA 1P2FA 4M9SA 4RGXA 3BC8A 3ONQA 4PJMA 2ZNZA 3HHGA 1PDNC 2HZDA 2WWYA 4Q47A 4QLCU 2CFOA 1GVJA 4HX4A 4E7KA 2KMUA 2RREA 3L00A 2OUMA 3N97A 2UXNA 1OYIA 2AXLA 4XNFA 3F8MA 2RN7A 2Q2EB 1FSHA 1B1BA 2QZ8A 4P5OA 2VE9A 1Z21A 1RI7A 4AIKA 2A6EF 1R5HA 1FBUA 1B9NA 2DU9A 1VTNC 3BROA 3L2WA 4KIFA 3TOAA 4RGSA 3GFLA 2WAEA 2L54A 4NC8A 2IGMA 2ZSHB 3ZP5A 5HLGA 4DBRA 4E7SA 3I59B 2VKDA 1FYMA 2QBYB 1Z3YA 4I0BA 4ETSA 1ZRDA 2FUG2 1Z1DA 4B8XA 1TBXA 1O7FA 4L5JA 4IJAA 3CMMA 3GW2A 5EEHA 2K9LA 3GX4X 3P9IA 2XKPA 5F1RA 3CJRB 2BE5F 3ZGKA 1XCVA 2P6SA 3KP4A 2TDXA 3SHFA 2EFWA 2R7TA 2QKMB 1ULYA 3M8FA 2O5RA 4XLHA 2M7BA 1HA8A 4RAZA 2M0MA 2A6HF 3IAM2 5HS8A 3CZ6A 3F9KA 2Z99A 2V1XA 4OMZA 5HDNA 3CP2A 1LNWA 2XASA 4MLOA 4CCJA 4WXDA 1NHAA 3ZMSA 2VBZA 3R6SA 4KFCA 1U5TB 1MMGA 1T95A 1EH6A 4HQEA 3DEEA 2NYXA 2QKLB 3QYEA 1YIOA 5AIPA 1RUNA 3DTEA 2BW3A 2W57A 1D8KA 3KEQA 4XBFA 5BMZA 4M73A 2NAZA 3L2QA 1X1BA 2A68F 4E7JA 3MZHA 2NRAC 1FC3A 4H0EA 5EEGA 5FGMA 4HF0A 1KU9A 5FB2A 3LSHA 4A6EA 4AD9A 2XRNA 3SQNA 3OS0A 2WAQA 3DKWA 4LB6B 4NQWB 2FBIA 2AS5F 3P9KA 4BJ5C 2LBFB 3BPVA 2XAUA 2HVSA 4CZZA 3LAPA 4L5IA 3J7AO 3FXUA 2HQNA 3VYUB 3W2WA 4Y3OA 2BBYA 3KCCA 2DW4A 2L4MA 2IA1A 3FBIB 3K4NA 4ZDPA 5ICEA 2R7FA 4FT8A 3CO7C 2QWWA 1GXPA 1G4DA 5HDGA 4U88A 3CUQB 3OYNA 1WJFA 2HS5A 4XN3A 3FDYA 2FBHA 3LSKA 2XC7A 3FHZA 3K70C 2GXGA 1IXCA 1PP8F 3QP5A 4OIRF 2K7LA 4R8HA 5D4SA 5DD4A 4BE0A 2KJCA 4ESBA 2M30A 2X6XA 1RIOH 3E1SA 2LF7A 4ZZDA 4PZJA 2WAFA 4JOMA 3I4PA 1TZLA 3MWMA 1DQUA 3AL0B 3ULQB 4CICA 2QVOA 4PJJA 2HVRA 2OV7A 2HEOA 4PFPA 1WKMA 2F2EA 1XGMA 4XKBA 4FETA 2XAQA 1AOYA 2MLKA 2L2OA 3WODF 2X6WA 4ZDOA 5FLXK 2WV0A 2LKPA 3U1DA 2M4GA 1W36C 4XM3A 3CESA 2ZMEA 1F1ZA 2JSCA 2R4GA 2IT0A 2A07F 3AFHA 2RKHA 5E1XA 2R7QA 3KLOA 4B44A 3TMOA 3C18A 2DK5A 3A2KA 1Z3XA 3LSIA 5D6FA 1XGOA 4HA8A 3K4KA 2VONA 1N75A 4WF2A 4GGGA 2W84A 2KQRA 5CJ9A 2LC2A 2LG4A 2ZXIA 3HOTA 3R60A 3TQNA 4L9TA 1SFXA 2OD5A 3JTHA 3VYTB 5J8CA 1O3RA 1LVAA 1J9IA 1TNTA 4Q5SF 2YPRA 1STZA 3OMYA 4LIVA 1N77A 3A1YA 2CW8A 5JHFA 3TDUC 1U5TC 4YEJA 2EB7A 3I64A 4RM3A 2M45A 1AWCA 3DKYA 4BE2A 1YX5A 3OS1A 2VLAA 2P0WA 3HSEA 2V1UA 1DP3A 3CUOA 3ML6A 3Q9VA 1S7OA 4BDZA 5LHHA 3HRTA 5BS6A 5TRDA 2CSOA 2Q1ZB 4Q4ZF 1RZ4A 4LGWA 1T6SA 3PSFA 3RJPA 2GIVA 4LLGF 3CLOA 1DP7P 2CV0A 3K4CA 2K4JA 1J7KA 3F22A 2HYGD 1D1CA 2VC0A 4U87A 3CP8A 2R7OA 2HZTA 1WWXA 4KUMA 2IXSA 4EM1A 3WGHA 2XAFA 1X19A 2OC6A 3H5AA 2P7CB 3LQRA 5D8KB 3HL2A 2JVGA 3I3LA 1ON1A 1V4RA 4UNOA 2AQFA 2HKOA 3IKTA 2F6CA 1FMVA 1ZHFA 1D0XA 4ZYAA 4M72A 3CUQC 3E5XA 3W2VA 5HNFA 2VC1A 3I58A 4C9YA 4JBAA 3KX2A 4BQOA 1D1BA 2OAZA 1R22A 4GCVA 2KIFA 4BHPA 2QQBA 4CCKA 2JT1A 4AIHA 3QPTA 2BGCA 2HR3A 4EJTA 2KIUA 2PMHA 1OR7A 4G94A 3ZMDA 3CO6C 1UFMA 3ZN0A 3SDBA 2O6GE 2XVCA 4U7DA 4PCQA 4EJWA 3AAFA 1Y56A 5LRSA 3GWZA 4EM2A 4XSXF 1OLTA 2X85A 3H0DA 4YELA 3WU0A 1Y0UA 3HTUA 4F7ZA 3HSFA 1KU3A 5DCMB 1FY7A 1SAXA 4WK8F 4HNUA 2O03A 3GUDA 2HOEA 2E1MC 3VYSB 1X4OA 2GA1A 4IQJA 3CJNA 2ZFWA 3IRRA 1MDMA 3BG7A 3F3XA 4N0BA 2OZUA 4B09A 3TKYA 3HG9A 2LH9A 1WJCA 3FM3A 3WTVC 4M6YA 4OWRB 2RQPA 4Y13A 4G9YA 1Y6IA 3S3OA 3QOPA 4LG0A 4Q48A 3IRQA 2XKOA 3FMQA 2MA3A 3EPZA 2IPQX 3E6CC 3C3WA 1VZ0A 1JHHA 1LEAA 2KRHA 2VXDA 3G3ZA 1XB4A 1QO0D 4G6TB 5E8GA 2CO5A 4RLQA 3ZN1A 5D4RA 4I02A 4PGGA 1NG6A 1BJAA 2QLZA 4MQVA 2FBKA 2V79A 1BI3A 1I6XA 3LFUA 3V42A 3DQVC 1LJ9A 1LQ1A 3OL3A 4P96A 1N78A 2VQGA 4BU2A 2ADUA 2FEZA 4FX0A 3KP7A 2VQLA 1XSXA 1QZZA 1MJAA 3D5LA 5DYMA 2WB1A 2R7XA 1LDDA 2XAJA 3RTRA 2Q8KA 1H9TA 1HKSA 2KHMA 2GZWA 3MCZA 3HSRA 1IZ1A 1QNTA 1FBSA 3MKWB 4E7IA 1R1TA 4I2OA 1FWZA 2RV8A 2VXZA 2E60A 1G3YA 3HPGA 2O3FA 1DGRM 3LQQA 1HW2A 3OYLA 5HLHA 4IQ4A 4CH7A 1HSTA 4D1QA 2D1VA 3H5RA 2M7AA 3HRUA 4Y4RA 2L4AA 2IS6A 3GYHX 2G9WA 1L0OC 2Z9OA 2L9NA 4PSXA 2EWNA 2CV2A 4A0XA 2Z33A 2QQAA 1DPUA 1YLFA 3V7RA 3IWZA 1DUXC 1UG0A 3N05A 3MFKA 1F4KA 4IPAA 2D1HA 3V4GA 4YFKF 1SMYF 2K5CA 3RDIA 2H27A 1HKTA 3LAJA 4M9XA 4B43A 2KPMA 3TO6A 3W6KB 4HBLA 3KE2A 3GVAA 5H6RA 1S29A 3MKZA 2DT6A 5HS7A 4HZFA 3QYFA 5LEKA 2F5CA 4AWXB 3WTTC 2CFXA 3HC7A 1BN5A 2W25A 1ZYRF 4WWCA 4IZZA 1YW9A 2WY8Q 1SFUA 1LB2A 2DK8A 3NQOA 2F4IA 2V1NA 4LLLA 5A2QK 3HKZA 4A5MA 1WJAA 4KIBA 4PFOA 1D8JA 1QPMA 3DF8A 2BOLA 4IRHA 1T98A 2EK5A 2BYVE 1SD7A 3WTUC 1G8XA 2GOMA 1XMAA 2EV0A 4A0YA 1FNNA 4LITA 3S3NA 2UXXA 4F92B 2G7UA 1TW3A 3FHNA 5HS9A 4BE1A 1MKMA 2V6CA 4KITB 3RYRA 5LGNA 1EH8A 5H6QA 4P9UA 1U8RA 2QQ9A 5IT9K 2W24A 3F72A 3VSKA 3F6OA 1W5TA 3DFGA 4CHUA 3TO9A 3COAC 3IHUA 2ZFUA 3TBIA 1J2XA 3PFIA 1YW7A 3WE3A 2GOXB 1TW2A 5D5WB 2PI0A 3RYPA 2BW3B 1G3SA 3BZ6A 4N4NB 3OYDA 3FZVA 2W82A 4RS8A 4DGWB 1XGNA 4LK0F 2KJBA 4ZTFA 3G73A 4L9VA 5F6FA 2UWMA 3LL7A 2VB6A 1BIBA 4MTEA 3U21A 4KT5C 4PSWA 4O5VA 3T8TA 1NG7A 2JTVA 2P6TA 3TO7A 3QRFF 5JVTA 3PJRA 2W4SA 3SZPA 2JVHA 1XCBA 1K6YA 3H3UA 3BCAA 2XF6A 5CVJA 1FP1D 1O7LA 1Z6RA 4U7BA 5AIQA 3FF5A 4EJUA 3VDXA 4Z2YA 3B02A 5LFAA 4DQ2A 4LLNA 1BBYA 4WCGA 4KN4X 2MBFA 1FMWA 1TQPA 1IN5A 2Q0OA 3WE2A 4ZZLA 4HV5A 4XSZF 2IJLA 1E17A 2H94A 1USTA 1UHWA 2COMA 4P9FA 4IRIA 2ZBKA 2OU2A 1HQCA 4UV8A 1ZRFA 4KMFA 3DLAA 3H9GA 2F5EA 5HNHA 2R7WA 3ERED 1BI1A 2IS2A 3S93A 3MEXA 4MTDA 3IKVA 5JR3A 2HU9A 5CPRB 1Q1HA 3REOA 3D0SA 6PAXA 4CCNA 4MHGA 2HYFA 2V1DA 1FT9A 2FE3A 2P7VB 2K3PA 1IN8A 4IHSA 4AYBA 1PYVA 5JHUA 2CUZA 2KDOA 4X0GA 1UB9A 4FASD 2DXIA 5CKTA 2EFQA 2WBMA 2A3SA 2R7VA 2I8DA 4HYEA 1O3TA 4EGYA 3SYTA 3OYMA 5CVRA 2P8TA 4E4HA 3DU6A 5LHIA 1G3TA 2ZMEB 2XGXA 5KVRA 2JZYA 3SEQA 4HPQA 4MEXF 4BQQA 4IX7A 2M5WA 5DEQA 3BG6A 2WC2A 5FRNA 1X1AA 2W1OA 4UVAA 4JQFA 1LDJA 4HEA2 5L3DA 1LKXA 3RPUA 4DBQA 3JAMZ 4FX4A 1WFXA 4BH9A 5CYVA 2ZCWA 5LHGA 2O8XA 1Z7LA 3OIQA 1H0MA 3I71A 3VEPA 4E7ZA 5CVIA 5H20A 2VIXA 1J09A 2UV1A 4BGDA 1Z7UA 2VBWA 2CWEA 2VL8A 3BY6A 4F52A 1E2XA 4GYIA 3ZMVA 2FA5A 1V5FA 4NUBA 4AU7A 2BV6A 4ZYEA 5LLQA 3TGNA 4B3XA 1GXQA 1MNDA 4S05A 3U9GA 5E1WA 2L7KA 1D3YA 5L3GA 1S6LA 3ABUA 4XRFA 2F5VA 2EJRA 1V5GA 3I53A 3KEOA 3Q9SA 4II3A 2DBBA 3DV8A 5BOXA 2QYOA 5BPDA 3GF2A 3LMMA 3UR3C 3E5QA 5FRMA 1JI8A 1P6RA 5D5UB 2ZSIB 5CQEA 3ABTA 2CUJA 3LWFA 3CDHA 5IT3A 1W5SA 3C2HA 2LF8A 2QENA 3PQJA 2KL4A 4QPOA 4ZDLA 4K2EA 1XDSA 3ISPA 5ILVA 3OYKA 2V6EA 5L3EA 2X1DA 2A5YB 2E1MB 2HPIA 2M3AA 5HOOA 4AVPA 1LEBA 4BS9A 4CYDA 1YO5C 2XSJC 1D0ZA 4DJAA 4HDUA 3K9TA 1U0JA 4ANJA 3RPQA 1TQIA 3CTAA 3KP6A 3ZCOA 1T2KA 2CV1A 3LSMA 3HYIA 4KDPA 1ON2A 1R00A 1SAUA 3RKYA 2HPMA 3BLYA 2PN6A 2NNNA 2V9KA 4YG2F 5D5VB 3IAS2 4QWQA 2Z16A 1EV7A 1X3UA 4TV7A 4DOZA 4EJVA 3LA3A 4OMYA 3WU1B 3LFKA 2KLOA 2W00A 4BXUA 1ZGJA 2J5PA 3SEZA 4IRGA 3KP2A 4MGRA 3OR2C 2ESHA 3OYBA 5CVUA 3OIPA 1IRFA 1R36A 2UUZA 1IUYA 4XORA 2E5NA 3FMRA 1MD0A 4HLXA 2L01A 4XLPF 4I09A 1O3SA 2D2WA 2KZVA 3K70D 4CCMA 1FLIA 3RI4A 3GXOA 2VKHA 1KU2A 4KA4A 2W7NA 4L9NA 5ICGA 2AQEA 4OIPF 2IW5A 4UV9A 2DO7A 1CF7B 3J7AY 4UUVA 3HRMA 1QBJA 1FPQA 4IXAA 3OYEA 3D5SC 1MDMB 1T39A 1IAWA 4RB3C 2CYYA 1KYWA 4HV6A 4Y15A 4ITVA 2XIGA 2J5OA 4NHJA 4CUGA 3M1CA 1SMTA 2VJIA 1BOBA 2KP6A 1O57A 3M8EA 2HVQA 4LG0B 4E70A 4PUSA 3DU5A 2R7RA 4L0ZB 2LY2A 2ISYA 3MAJA 5LGUA 2YR2A 1W36D 2YX4A 4OINF 1KQ0A 3HPHA 4BNCA 4KICA 4AIJA 3PL8A 4M71A 1TQMA 5CLSA 4HAMA 1IRGA 2GWRA 3H9QA 2HTSA 4JK1X 4RAYA 2V9VA 3J80K 4P55A 3KFWX 4KISA 4U0WA 4KMUX 2RGVA 4KN7X 1YYVA 2VQHA 2R7UA 3FMSA 1DGWY 4YFXF 1ZLKA 4G7OF 3PQKA 4OAYA 4S04A 3EUHA 4G6DA 2CH0A 3K1PA 5D5XB 1Z05A 2ZXHA 3B73A 1L3LA 2X1EA 2WA0A 2L3DA 3BWGA 3UNGC 1ZG1A 3MD2A 3QP6A 4F91B 3KZZA 1GLNA 2H6BA 3VSLA 4BL0B 2QUFA 4ESFA 1QU3A 1KYZA 2OBPA 3GZ5A 3V8LA 1Z6TA 4LB5A 4C30A 4EM0B 3J81Z 5ED4A 2Z5UA 3IC7A 2DTRA 2O0YA 3K6GA 3L9FA 3NRVA 2PG4A 1CF7A 1IN7A 1X1CA 1S7AA 2XAHA 5FLXZ 4RM2A 1XD7A 1ZG3A 3FWEA 3WG9A 5K5RA 1ZREA 3E6DA 4BEHA 3O6BB 4HG2A 1TTYA 1BM9A 2O61A 1PUEE 2ACJA 1BR1A 1W7PA 2EV5A 2KIMA 3EUHC 1U6GA 3LSGA 4ZTJA 1I27A 2JPBA 5HVQC 2PQ8A 1KQ9A 1QHGA 1OR7C 2W85A 1UELB 3K4MA 2F5FA 1T38A 2CW7A 1R1VA 2E1CA 4WXHA 3GFIA 2G7HA 2GQQA 3P7NA 2NS0A 4XOPA 4G7ZF 4C2TA 3H9JA 3WTZA 3WGIA 2PJRA 2R3SA 3V8JA 3FXRA 1OKRA 3KP5A 1I1SA 4MEYF 3RCOA 1ONVA 3P9CA 3M7GA 4P1WA 4RGUA 5LBQA 1FYLA 2FQ3A 3ZPLA 1G3WA 4YRVA 3DXJF 3DTKA 3GBGA 3ZR8X 4R79A 1F9NA 3R61A 4XMYA 5AONA 4HQMA 4AVZA 1YW8A 2VJ4A 1G59A 1XDUA 3GLXA 3TDZC 1FP2A 1KQ8A 1BC8C 2HDWA 1UHMA 2FF4A 4PJLA 1MMDA 1ZARA 2ELHA 1BOAA 4IKFA 1W4MA 1R58A 5KNLA 2OQGA 5DDGA 1JGSA 1MW7A 3CF2A 5D8LB 3ELKA 2R7SA 3PSIA 3IL2A 3W2AA 2CG4A 5E8IA 1U2WA 2FOKA 4MQ9F 1YS7A 1FYKA 4A5NA 2FXAA 3K4BA 1D5VA 2VODA 3T1BA 5J8FA 4RMNA 3QYBA 3W6JB 2FRHA 1K7AA 4BHBA 4O6JA 4I0AA 3E6BA 5L3FA 3SXYA 4OOIA 2ZKZA 2HFHA 1TT0A 1OPCA 2ZO4A 3GEZA 2RNJA 2P5LC 4CO8A 2HDCA 3SZGA 4ESJA 2MYSA 3D5RC 3E0JB 2B0LA 2A61A 2MH9A 1R23A 3WTXC 3VWBA 3L7WA 2MC3A 4B47A 2RDPA 1J0RA 3F8CA 3M9AA 2K02A 1B6AA 3HHHA 1DDNA 2PFBA 4XONA 2PBIA 2FNAA 1PJRA 2EV6A 2K4BA 1YTYA 2DOAA 4KT6A 4HNTA 3ZQQA 3F8BA 4II2A 5HDKA 1V5EA 4E6KG 1EA3A 1XSDA 3PNYA 4L18B 2JUGA 5HLTA 2X1CA 3NEUA 1D0YA 2LSOA 4OU0A 4IHTA 4CXFA 2DT5A 5FD6A 2CQKA 2KRCA 4E7HA 5DUKA 4DNCA 1SFKA 2Y0SA 3BCBA 1YE9A 4N9IA 2HQAA 1P92A 2JA2A 4G8XA 4YIFA 4A12A 4I01A 1WSUA 3VFZA 4D0PA 5KHDA 2C6YA 2EFPA 2XHKA 2XF5A 2IS1A 2M1BA 4OAZA 2Y48A 3OR1C 1IW7F 2ZNYA 4XKVA 5ICCA 1XN7A 1R7JA 1FOKA 1P9QC 2VBYA 3V7CA 1YG2A 4N9HA 4IVNA 3GFJA 3S32A 3OL4A 5ERIA 3BJAA 3E97A 3H35A 4LG3A 5DV5A 2EFNA 2ETHA 5KK1A 1A04A 2Y75A 2Z3YA 4J00A 1RNLA 2R7DA 2JSPA 4LIUA 3ZQ7A 3OV8A 4HRIA 3TOBA 3ROUA 3MQ0A 4NB5A 4CZCA 2BEOA 3O2PE 2EA4A 2L5QA 3F8FA 3HUGA 4D9JA 2FMLA 5LGTA 1LFPA 2VQCA 1GHCA 3ECHA 1QZYA 4QPQA 2F5DA 2VE8A 1Z9CA 2RVCA 3K1MA 1K78A 4I7HA 3DPUA 2DLLA 1AA7A 4CCLA 1ZN2A 3M8JA 4KJZA 1WRJA 3F23A 3L2RA 4L0YB 3R0AA 4U0YA 4A2UA 5FFZA 3G2BA 5DCFA 3PNVA 3PUBA 3WTWC 4A6DA 3R4KA 2L02A 3BJ6A 1HSJA 4BQAA 3H5NA 1WJEA 4EQQA 1ZLJA 3BP8A 4XLNF 2HQRA 2VN2A 2VPLA 1P4XA 2HNHA 4HF2A 3GFMA 2H6CA 2DFIA 4L9JA 1ZELA 2A5WA 4ENMA 3L09A 2H09A 3I0TA 4CA0A 2OQRA 4EVIA 2VOPA 5LEJA 4XR6A 3GZ6A 4C2UA 1MMNA 2GA2A 3VB2A 4RB0A 2A69F 3AKZA 1KONA 1OYWA 2IGNA 3QODA 2ZJ2A 1REPC 5A2QZ 1UCRA 4N4OB 3K0LA 1S3JA 3K4LA 3WGGA 2M87A 3JW4A 2XUBA 3L2VA 4ON0A 2PLYA 3E6MA 3K1NA 3MKYB 2Q2EA 2OZ6A 2V26A 4PJNA 3OYGA 2XROA 1B9MA 1WJ5A 4CCOA 4CGZA 1O3QA 3EYIA 1SD4A 2VJJA 5IT9Z 3N4MA 2E7WA 3W3CA 3MZYA 4KNYA 4BXFA 3JSPA 2WY7Q 3EYYA 2MD0A 4M74A 4UHTA 1JHFA 3WTSC 3HOSA 3VYRB 3I59A 3OYIA 5BPIA 4F55A 3VODA 2QBYA 4XLCA 1FSEA 2MABA 1FZPB 3EUAA 2E7XA 1H9GA 5F64A 2CMPA 2ISZA 4GXOA 5DD8A 3RSNA 2HTJA 3R0JA 3NWSA 4M6XA 1USSA 3HIFA 3V8KA 1WI9A 1P4WA 2EFOA 1BR2A 2VBXA 3ZMZA 4XLAA 4HF1A 3HTSB 4BAYA 4HSRA 3DPTA 1XSVA 4IF4A 2KKOA 3IUOA 1T0FA 2DI3A 2X0LA 1UAAA 2GXBA 3E5UA 2EA2A 1RUOA 3EUKL 1QQIA 3L2CA 1KA8A 5FD5A 2STTA 2CGPA 1U5TA 3OOUA 4LK1F 3S8PA 2RNGA 3RKXA 3HXLA 3KYLA 3J81K 2P4WA 3L2UA 5HLIA 5JFRA 5LRRA 4XL9A 2MD5A 4WX9A 3Q5FA 2ESNA 4EV0A 4XQFA 1BI2A