3HEFA

Crystal structure of the bacteriophage sf6 terminase small subunit
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gene 1 protein
publication title Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine
pubmed doi rcsb
source organism Enterobacteria phage sf6
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hefA01
4V2FA 4JX6A 4ABZA 3A01A 3HEFA 2TCTA 4A3MJ 1Q1VA 4Y7NJ 4XRSA 4X6AJ 2L9RA 2JK3A 5J1RA 1TWFJ 5F0HA 2E2JJ 2XGCA 3F0CA 3OSGA 3S1RJ 4A3GJ 3A01B 2X6OA 2HOSA 3OIOA 3JRHA 2M34A 5FKKA 2HOTA 1ZTRA 2HQ5A 3SDGA 2ID3A 4M6VA 4DZPA 1VF9A 5J1YA 1B72A 1WGXA 5C44J 1F36A 2L7ZA 4RBOA 3TW6A 2JA6J 2Y0SN 2DA2A 1JT6A 3LSJA 4MFEA 1POGA 1D5YA 5BNGA 1B72B 1WPKA 3CDLA 4AC0A 4JX4A 1ETVA 1PUFA 2O8KA 3BR5A 1IGNA 4M3GA 1BW5A 5M5WJ 2JA7J 4FTHA 1WH7A 1ZQ3P 4A3LJ 1W0TA 3DEWA 2R5ZA 4L5EA 4M3BA 4A69C 3HM5A 2CUEA 2XGDA 2DA1A 4JX5A 5EGOA 1BJZA 1PUFB 4DW6A 3FK6A 5DS9A 3GTPJ 2NVTJ 2Y9ZA 3B6CA 1U8BA 1RETA 2I10A 3FK7A 4D5FA 1JGGA 1XS9A 5EGOB 1DU6A 1FIAA 4JP0A 5M5XJ 4MIMA 5FKLA 4B3AA 3HOWJ 1T33A 4M3EA 3SJMA 5HODA 1JTYA 1NK2P 2LTPA 3HGGA 2X48A 3BG3A 3HOVJ 4QIWN 1A6IA 3BTCA 4G12A 3BG5A 4A3IJ 3PO3J 1GV5A 2CQXA 2WAQN 2R7ZJ 2DA6A 3QPSA 4XIDA 2K9NA 1HCRA 3GTOJ 3K2AA 2YS9A 2ME0A 3G1MA 3Q0UA 5JLWA 4A3JJ 2H1KA 4XRSG 5EZHA 2NOGA 4DYQA 3BR0A 5M5YJ 3W6VA 3HGYA 3HBLA 1OFCX 2TRTA 1LFBA 1RKWA 2HI3A 3ZQIA 5EG0A 4AUXA 1ETWA 2R5YA 1MBKA 2XB0X 5FKNA 1ZGWA 1GV2A 1UMQA 1UG2A 2MSYA 3MVPA 1AKHA 5IYDJ 1Y1VJ 3LOCA 5F04A 2FD5A 2ELKA 2HYJA 3LSRA 2JMWA 4A3EJ 4HNVA 1R9TJ 3JREA 3GTKJ 4IHVA 5DTDA 2CU7A 2L7FP 1AKHB 2NS8A 2XPVA 2L7MP 4MO7A 4IHXA 1RKTA 1TWCJ 3I4NJ 3JR9A 3BTIA 3FISA 5K7HA 4I76A 1U78A 4V2GA 1K83J 2DMPA 1Z77A 2HDDA 5FLMJ 1GDTA 1I6HJ 2QCOA 1QVTA 4J19A 5IYCJ 4BY1J 3UKGA 3O8HA 4A93J 5M3FJ 4W1UA 2YUSA 3ZQGA 2EZIA 2E2HJ 5K7ZA 3WHBA 4LOCA 3CMYA 4FCYA 1XG1A 1BA5A 1G2HA 5IPAA 1IUFA 2MG4A 1MSEC 2HXOA 3ZQLA 3JRAA 2G0EA 1WI3A 3ZOBA 2NVXJ 4B1RA 2VUMJ 3BTLA 1P7IA 1MBJA 3JRIA 4XICA 2XPUA 1WCMJ 4XRMA 2KDZA 2JA8J 3GTMJ 3S15J 3HOXJ 2DMQA 3BQZA 2D5VA 3RZOJ 2DMNA 3LSGA 1GUUA 1DU0A 2IBDA 3HKZN 1WH5A 1SANA 3IH2A 4D7NA 3RZDJ 1JTXA 2OF7A 4FE4A 3PO2J 4IHWA 3GTJJ 1GT0C 2E1OA 2DA4A 4EEFG 3OSFA 3TP0A 2EZKA 1JKOC 1E3OC 3BT9A 1JJ8C 2O7OA 1ZK8A 2HOAA 1MSFC 1ORKA 1AU7A 2EZHA 2VPRA 2EH3A 3JRDA 1MH3A 2PMZN 3GTQJ 2WB1N 1APLC 4BBRJ 2R5ZB 1OCPA 3JRBA 1ZR4A 1JJ6C 3RQIA 1A5JA 3A02A 5C4JJ 1X2MA 3MN2A 2EZLA 2MW8A 1MBHA 4B4CA 3HDDA 3GBGA 2Y9YA 2AHQA 3BG9A 1O4XA 1AHDP 1JUMA 4MLOA 3S1MJ 1ETOA 5F27A 4UUSA 2EBIA 1MBEA 1RR7A 5F1JA 2LLKA 1S7EA 4M3FA 2NVQJ 4D7MA 2DTZA 4DYCA 5FJ8J 1VNDA 3M4OJ 4C3HJ 2DJNA 1HOMA 3NAUA 2M9HA 3TEDA 3HOYJ 1ETXA 2K9SA 3BQYA 1OJLA 2Y2ZA 5EF6A 3O8GA 5F0FA 3IH3A 1YRNA 4JYKA 4M3DA 2LY9A 2ECCA 5C4XJ 1H89C 5E3NA 2VKEA 2XPWA 2WV1A 5EG0B 1HDPA 5IP7J 4DYRA 2R5YB 3A03A 3TW7A 1FTTA 1I50J 5GPCA 1U9OA 1BL0A 2K40A 5J3LA 3MKLA 2DMUA 4QSHA 3D1NI 4RDUA 5F0CA 2W48A 5M3MJ 2FJ1A 1H88C 1IV6A 2LP0A 4W97A 4NDLA 1FEXA 5IP6A 3Q0VA 2FX0A 4C2MJ 5C3EJ 4IEJA 1W0UA 4BKXA 3HOUJ 2CJJA 3S14J 1IRZA 1VFCA 3QQAA 3WHCA 3H0GJ 2GLOA 2GM4A 3ZQFA 2LVSA 1U9NA 5J1UA 3JRFA 5GPAA 5IOZA 5E3OA 2ZB9A 4GFBA 1QRYA 2COBA 2M8GX 1TWHJ 4D5CA 3S2DJ 2JN6A 3C2BA 3G1OA 1NK3P 5FLVA 2DA3A 1IG7A 1F43A 1T56A 2IAIA 2OPTA 3FIWA 1JKQC 1ZKGA 2Y31A 2RAEA 4C3IJ 5F08A 1B8IA 1TWAJ 3HOZJ 3CCYA 1OCTC 1ZR2A 4BXXJ 3JRGA 1NTCA 1P7JA 2CRGA 2DA7A 3NARA 4DZJA 3IV5A 2ECBA 9ANTA 1X2NA 4CYCA 1QVUA 2DN0A 3BR6A 1B8IB 4S0HB 2AO9A 5E3MA 2M0CA 4I6ZA 4Y52J 4A3KJ 3S1QJ 3DCFA 1TC3C 4XK4A 1ITYA 1RPWA 3CQZJ 4MFDA 3Q3SA 4CYCB 2XSDC 1JT0A 1HDDC 4QTRA 2QF7A 4FISA 2IEKA 4X1EA 3QPLA 1IC8A 1BW6A 1H8AC 1K61A 3VPRA 1IDZA 5EZGA 2CUFA 1Z0XA 1ETKA 1JUPA 3IH4A 3I4MJ 4A3CJ 2CQQA 3LNQA 1JKPC 2M2EA 3LSPA 1EF4A 1LE8A 1CQTA 1MBFA 4IHYA 4BBSJ 3Q0WA 2R0QC 1GVDA 1JKRC 1X58A 5GP9A 1TWGJ 2DMTA 2X9DA 2P81A 2LD5A 1QPIA 1LE8B 5FKOA 1HF0A 2KT0A 2LFBA 3E7LA 3L1PA 1I3QJ 1IJWC 5IYBJ 1XC5A 4UUSB 1MH4A 3GTGJ 3GTLJ 2L0KA 1VI0A 2MGQA 4C3JJ 2E19A 1RESA 2JJ7A 3JRCA 5EYRA 1UHSA 1FIPA 2XB5A 2GBYA 3OOUA 2NS7A 3ZQHA 5FKMA 4BY7J 2H8RA 3H3VK 2LKXA 1ETQA 1YRNB 4A3DJ 3M3YJ 2YU9J 2B63J 3ZQCA 2E2IJ 1FTZA 1JUSA 4AYBN 2NVYJ 2VKVA 2FQ4A 2XGEA 1Y1WJ 5IOYA 2R93J 2K9QA 3BR2A 1ENHA 3PM1A 2DA5A 3S2HJ 2ID6A 2EQRA 3S1NJ 4FE7A 2JWTA 3B6AA 3BR3A 3G1LA 1IDYA 1HLVA 5K7FA 2ME6A 2JA5J 5EEAA 1MNMC 1FJLA 3SFIA 2O9LA 1ETYA 2LR8A 2LK2A 3BTJA 5EDNA 3HB9A 3K7AJ 1SFOJ 5IP9J 4UUTA 1LFUP 2VI6A 2R92J 3S16J 3BR1A 3TP3A 2Y30A 3RKQA 3FKIJ 4A3FJ 2XRLA 3S17J 5E3LA 1MBGA 2HXIA 2N8GA 5JLXA 4A3BJ
chains in the Genus database with same CATH superfamily
3A01A 2XAUA 1WJDA 2Y0MA 4X6AJ 4CHUA 4OAZA 1A04A 4NUBA 5J1RA 2MYSA 4M9ZA 3AL0B 3FXOA 5B1BH 4PSWA 1YLFA 1B6AA 1UELB 3F6VA 2QQ9A 4BDZA 3JRHA 4RLQA 2HOTA 5FKKA 3TO9A 3VOEA 1Z7LA 4XMYA 2P0WA 3A4CA 2XIGA 2ZMEB 3E5QA 3K1MA 2EIKH 4M6VA 1BN5A 4DZPA 1VF9A 5J1YA 3P9CA 4F93B 4QPOA 3MZHA 2DYRH 3F3XA 3OS0A 5E18F 2FOWA 1FBSA 1F36A 3OR1C 2JA6J 2M4GA 1IN7A 5HNHA 1BC8C 1VQ7I 2E1CA 2DA2A 5HS8A 1POGA 1A35A 1B72B 3KYDB 1YJWI 3K70C 2XKOA 1OISA 2HTJA 4AC0A 2RQPA 4BL0B 5HLTA 1ETVA 1PUFA 2O8KA 3I3LA 4HBLA 5D5WB 2JA7J 3OL3A 2LF7A 4UXNA 3BPXA 1Y0NA 1W0TA 4EJTA 3DEWA 5LHGA 4M3BA 4FQGA 3HM5A 3FMSA 3KCCA 4B09A 1ZARA 1H9GA 1J5YA 3R0AA 5KVRA 1YQAA 1TQMA 3B73A 2Y9ZA 4KJZA 4A0ZA 2I10A 4E6KG 4D5FA 2ZO4A 1XS9A 3V8JA 1TT0A 2AXTC 5EGOB 1DU6A 1FIAA 2F48A 2KZGA 3CDIA 4MIMA 4B3AA 2BVLA 3H9JA 5M5XJ 5LGTA 2A6EF 1BOBA 3WTSC 1HW2A 1OYWA 1DGWY 2RDPA 5HODA 1SFEA 1NK2P 2LTPA 5FB2A 3BZCA 4BEHB 3HOVJ 2X1EA 1P4XA 1BR4A 3RPUA 5EJCA 5HLHA 3BTCA 1RZ4A 3BG5A 2WAQN 4ZYHA 3OYCA 2V6EA 2R7ZJ 2DA6A 2OBPA 2K7LA 2K9NA 1UCRA 4ZH4F 3WODF 2ME0A 2CW7A 2JUCA 5IT3A 2WAFA 4XM3A 3LA3A 3T1BA 3BR0A 4OIRF 4CCJA 3I59B 2GXAA 2VIXA 2STWA 4EQQA 1OFCX 3FM5A 2TRTA 3HBLA 2HI3A 2GXGA 4BHPA 5EG0A 4L0ZB 3EYYA 1UB9A 3MMYB 2XB0X 1J09A 1ZGWA 3I4PA 1UG2A 2MSYA 4O5VA 4YFNF 1YIJI 5IYDJ 1OCRH 1W7PA 2E60A 4XQFA 4CSWA 2JMWA 1SD5A 3LSRA 4A3EJ 3DKYA 3F72A 1IN5A 1Z1DA 1WHUA 3CJRB 1JHFA 4LB5A 2F5FA 2L7FP 2NS8A 2OUMA 1WFXA 3F6OA 3MKWB 1FMWA 2BHZA 1O7FA 1CF7A 1Z7UA 1E3PA 5GAGJ 2K9MA 5GTHC 3RJPA 3OYHA 2P4WA 2DMPA 2B9SA 1Z6TA 4GYGA 3EUKL 4BY1J 4J19A 4HA8A 5B5EC 1R1UA 3OYBA 2QVOA 4W1UA 2STTA 3OYDA 2YUSA 4WK8F 3ZQGA 2E2HJ 3E5UA 4II2A 2OCEA 1G2HA 1AOYA 2K5CA 1XGNA 2O3FA 1D8JA 3CMEI 1TQPA 2LNBA 2RREA 4MTEA 5GTIC 1MSEC 5FLXK 1WJBA 1GVJA 2HXOA 3JRAA 3W2AA 1RRJA 1WI3A 4PSXA 1OKRA 1V55H 1P7IA 1V54H 5ED4A 3AFHA 2UUZA 3CZ6A 4XRMA 3WTUC 1X3ZB 3S15J 3GTMJ 3HOXJ 2D5VA 1XDUA 1S29A 2ELHA 4I0AA 3HOSA 3HKZN 1SANA 1WI9A 2FBHA 4RB3C 3TMOA 2OF7A 4BQAA 5FFXA 3BWGA 1USSA 4IHWA 1BIAA 2E1OA 5E20A 2EZKA 5BQTA 5D5XB 3BT9A 1JJ8C 3QPTA 3KX2A 1NG7A 2AQFA 3H5RA 1P4WA 2UZKA 1MDMA 3LMMA 5L3CA 4NQWA 3HG9A 2F4MB 3CUOA 2EZHA 1LJ9A 3JRDA 2DBBA 3IKTA 1MH3A 1HQCA 2EK5A 3WU1B 4BE0A 4HF1A 4FT8A 2ISZA 4IVNA 5CVIA 4U0WA 2A69F 3DF8A 3HOTA 2ZNZA 4YELA 4N4NB 1HBXG 3B02A 3ROUA 2D2WA 5C4JJ 2GAUA 2EZLA 1MBHA 4B4CA 4ESFA 3GBGA 1XMAA 2FNAA 1WJEA 2K3PA 2H27A 1YOVB 4YG2F 4N9HA 2AHQA 2K4JA 4BXUA 1JUMA 3CP2A 1T38A 3DLAA 4BNCA 2Z99A 3TBIA 1MBEA 4UUSA 4OMZA 5F1JA 3MKYB 2WB1A 2NVQJ 2DTZA 1WRJA 4IOCF 2QQBA 2P7VB 3M4OJ 3OYNA 3T8RA 1FT9A 2V9VA 2DDBA 1IN8A 1Y8QB 2QEXI 4G6DA 1ETXA 2VN2A 3ZGKA 2DI3A 2RVCA 3O8GA 3HIFA 4IQJA 5F0FA 4BHCA 4JYKA 4M3DA 2LY9A 3E6DA 2B7EA 1G8XA 1R5GA 2MA3A 5L3GA 4MEXF 4BQNA 2R7DA 5HNFA 2D1HA 4OOIA 6PAXA 4DYRA 2Z33A 3I55I 1VQKI 1U9OA 2K40A 4XBFA 4RLFA 4ESBA 4KIFA 4P1WA 4XLFA 1ZGAA 3F8CA 3CF5F 2GOMA 4RDUA 2CS3A 4EMSA 2L3DA 2W48A 3OYKA 2JUGA 3Q9VA 2LP0A 4W97A 1XGOA 4NDLA 1EJ9A 4DIQA 3UNGC 2O8XA 2FX0A 2F5VA 2YSRA 4DGWB 2OD5A 5JI6A 1JE8A 5C3EJ 2YR2A 5CVJA 5H20A 3RQ4A 2HVRA 3GZ6A 1KQ8A 4YRVA 3QQAA 1X19A 4HF2A 2HZTA 4ZZDA 2X1CA 1SMYF 3BG6A 2LVSA 2ICWG 1NH3A 3QPHA 1FYMA 3WU0A 3FHNA 3EUHA 2ESNA 4HOBA 1BI1A 3WTXC 1O7LA 1N75A 4GRIA 1WJFA 2PLYA 1U5TC 1VQ9I 3FXRA 1R23A 3MFKA 2WADA 1T8IA 2LSOA 3CCVI 3ZXSA 3L2VA 1TQIA 5LRSA 2H09A 2OPTA 1ZRFA 1JKQC 2W1OA 4HRIA 2Y31A 2G7UA 4CZZA 3J81Z 4CDGA 3G73A 1VQ8I 4LMYA 4C3IJ 1XSXA 2F4IA 3HC7A 4CYDA 3HL2A 1D1CA 4QWQA 2FMYA 4AD9A 4RM3A 1UFMA 2ZMEA 1ZR2A 3OYGA 3J7AO 1IRGA 1S9HA 5F6FA 3JRGA 4RGUA 2CRGA 3NARA 4I2OA 1QVUA 2DN0A 2H6CA 4KA4A 4BHBA 4I6ZA 3S93A 4GYIA 2MLGA 5F64A 3H5AA 1IF1A 1FSHA 3CQZJ 4MFDA 1N78A 5GADJ 4CYCB 4ON0A 1WJ5A 2MLKA 2JSCA 1JT0A 3ISPA 4I98B 3DLLF 3KLNA 2LMDA 1QPMA 2L4AA 2CFXA 5FRNA 2HFHA 3DKWA 2XAQA 1R58A 2FOKA 4I0BA 3AG4H 3I56I 1K61A 3VPRA 2LBFA 2HVSA 3SFZA 4EVIA 1V5EA 1D1AA 5B3SH 1ETKA 3HHGA 3HPGA 2FXAA 2GWRA 3PSIA 2IGOA 5TGTA 3LNQA 1JKPC 2HOEA 3UR3C 1EF4A 1LE8A 4M71A 1SD4A 4F52A 1T6SA 1OMIA 1KQ9A 1GVDA 3GWZA 4A6EA 1ZG5A 1SFXA 2QM3A 5GP9A 2CG4A 2CV2A 2X9DA 1XD7A 4BEHA 1G6NA 3SXYA 4NHJA 2IW5A 4KISA 4BJ5C 5KK1A 2KT0A 3PIPF 4PCQA 3ZMVA 3L1PA 1I3QJ 1RI7A 2HEOA 1V5GA 1IJWC 5IYBJ 2QBYA 3GTGJ 2IP2A 1U2WA 4HDUA 2IA0A 5HVQC 3LA2A 1FLIA 3JRCA 1D3YA 1UHSA 1FIPA 2KIFA 1WZ2A 3HRMA 2BBYA 3QP5A 2LKXA 4Y15A 4HAMA 2AS5F 4A3DJ 3OYAA 3W6JB 5L3BA 4N9IA 1FBQA 1KONA 4Q4ZF 4M72A 2EFWA 5HDKA 5E1ZB 3M8JA 4HX4A 3U1DA 3FBNB 4IOAF 3BZKA 2L7KA 2GIVA 4BQOA 3CD6I 4A0YA 4EJOA 4NBQA 1T0FA 2E34A 3BR2A 4PK4A 2YU3A 2DA5A 4AIHA 2ID6A 2PBIA 1SFUA 3ECOA 2L01A 4FE7A 3BR3A 3G1LA 1LQ1A 1IDYA 1DGRM 4HSRA 1UAAA 2OC6A 3LQQA 5LD2C 5K7FA 1HKQA 1TP4A 3PNYA 4CCLA 4EJWA 1FJLA 3BTJA 2LR8A 2GA2A 1ON2A 2LK2A 4XLAA 2OU2A 4A12A 2DT5A 2W00A 4LK1F 3CC2I 3K9TA 2WWYA 3BP8A 3TP3A 3DPUA 5KNLA 2RNJA 3FKIJ 3RKQA 3S17J 2VJ4A 1MBGA 2HXIA 1ZELA 3PNTA 1T2KA 4U88A 2O6GE 4V2FA 5K5RA 2TCTA 4A3MJ 3L7WA 1WJAA 4UB6C 2LC2A 3EUAA 3MCZA 1PP7U 2VQGA 3VYRB 1K78B 3S1RJ 3ERMA 3OYMA 2E1NA 1OR7C 2BXZA 3ULQB 3MEXA 3CCEI 5K5OA 4LIUA 3CMAI 3KPHA 5FGMA 2VKDA 4S04A 2IXSA 4RMNA 1YO5C 1W5SA 2R7VA 1MW7A 5IT9Z 1E0EA 1KU9A 3NRVA 2R7XA 3CC4I 2BGCA 4HLYA 2VC0A 2FNPA 2VBYA 4DJAA 3DPTA 3CDLA 1S3JA 4WXDA 1MMNA 1UJ8A 1FY7A 3AG1H 3IWZA 1E2XA 3DQVC 1BW5A 3GVAA 5M5WJ 4L5IA 1DQUA 2HNHA 4FTHA 1ZQ3P 3RI4A 2BZTA 1BOAA 1XMKA 4L5EA 4EV0A 4JX5A 4E7LA 2VPLA 2XAHA 1YYVA 5GAEJ 4DW6A 1J7KA 2DFIA 5DS9A 2WY8Q 3OR2C 3W2VA 2M0MA 1FP1D 1Y6IA 2B0LA 3FK7A 1K4SA 2BVMA 5TJJA 3DWLE 1LDKB 2MABA 2OV7A 5DD4A 5E79C 3GLLA 4GXOA 4XORA 1VQPI 2KQRA 3ZMSA 3ASOH 4M3EA 2H6BA 1JTYA 3LSMA 5IT9K 2HQNA 1K6YA 5KHDA 4BU2A 2KJBA 2BYVE 1Z3XA 2YPRA 1GV5A 2CQXA 3VSLA 1KU3A 3GTOJ 2DODA 4UVBA 5TISC 4XIDA 3KYCB 4UV8A 2X6XA 3Q0UA 4QPQA 2LYCA 2R4GA 4XRSG 2WY7Q 2NOGA 3TL4X 4DYQA 1K4TA 3R0JA 1KYWA 2Q0OA 3SZGA 4G8XA 4L9VA 1RKWA 1X4PA 1EKEA 3LWFA 1ETWA 5CQGA 1MBKA 1I1GA 1GV2A 2QQAA 4J01A 5E17F 1UMQA 3DKXA 4XN0A 2FD5A 1YE9A 1XMXA 3G6EI 2HYJA 1YX5A 2R7FA 1R9TJ 3GTKJ 4PFPA 4WCGA 3I0TA 2CSOA 2WAQA 2LOOA 5CQEA 4N0BA 1Z05A 1AKHB 2XPVA 1TT5B 3MZ8A 2GXBA 1J2XA 2IA2A 2L7MP 3BY6A 4IHXA 1RKTA 2PMHA 1ZN2A 3I4NJ 5HDGA 2X85A 2QSFX 3MD2A 4V2GA 4L9NA 1K83J 1KGSA 3KZIC 3I53A 3K4NA 2LKSA 1TW2A 1ZLKA 1I6HJ 3M9AA 3O6BB 5IYCJ 3UKGA 3VB2A 2NAZA 3O8HA 3NWSA 4A93J 3VFZA 1FYKA 2W85A 4HNTA 4LG0B 2EZIA 3KP4A 1TNSA 3JW4A 1Q1HA 3BZ6A 3TO6A 2HVQA 4FCYA 1XG1A 1W36D 4XNFA 5IPAA 2MG4A 1G4DA 4CCOA 5ERIA 1LEBA 1REPC 3SEZA 3X2QH 2QKMB 1SD7A 3OWTA 4MQVA 1EH7A 2VXDA 4XICA 1B4AA 1O3TA 3IKVA 3KP5A 2KDZA 4RB0A 4PGHA 3HHHA 5DM6F 4UVCA 4P96A 4PJLA 3KE2A 2LY1A 3BJOA 2QZ8A 3KEYA 4G7ZF 2F2EA 3D0SA 4L5JA 3KIOA 1Y56A 5JHFA 1X1BA 5KCMA 1JTXA 1SD6A 2MH2A 1MMDA 3CUQA 4FE4A 3WE3A 2DTRA 3GTJJ 1UG0A 4RGRA 1E3OC 2CFOA 4Y3OA 5LHHA 4ZDOA 4II3A 2PEXA 3F8NA 3GMEA 4G7HF 4EJVA 1MNDA 2HOAA 3DU6A 2DW4A 3IHUA 2LH9A 2V4JC 5H2FC 4K2EA 4LGWA 3CJNA 4ETSA 1R6RA 2OTLI 5CVUA 3P5JA 4GDFA 1YTYA 4PZJA 5BPDA 1APLC 5BOXA 4BBRJ 1G3YA 3K70D 2R5ZB 4RAFA 1OCPA 3GX4X 3HKZA 3RQIA 1A5JA 3OOPA 5DM7F 3SZPA 3MN2A 2VASA 2UWMA 1QQIA 2ZSHB 3FXQA 4AIDA 3HDDA 3K4BA 4M73A 3QOPA 3BG9A 4TV7A 3WTTC 1WJCA 4ZYEA 2M8EA 2XF7A 3S1MJ 4E7SA 3HSFA 2XAJA 5F27A 2GIZA 2HPMA 1RR7A 1EH6A 4FHTA 1MGTA 1S7EA 3LSKA 4Q47A 4EJUA 2KIUA 1BC7C 2PJPA 2VONA 3F9KA 2CUZA 1SVMA 3KP2A 4BS9A 1HOMA 4B47A 2QWWA 5J40A 4RAGA 4MTDA 3HOYJ 2V79A 3GZNB 2COMA 3BQYA 4M9XA 4MQ9F 2Y2ZA 3QODA 2EIJH 5FLXZ 3IH3A 2JTVA 1P92A 4HW0A 2FBKA 1BJAA 2ECCA 5C4XJ 3DTEA 1H89C 3FXJA 4KT6A 1YX3A 2BHYA 2VBZA 5E3NA 2WV1A 3OYIA 1TBXA 2KP6A 2R5YB 4Y13A 3A03A 4F7ZA 1FTTA 2EINH 2XASA 4LLNA 1G59A 5J3LA 3MKLA 3DU5A 4QSHA 2EB7A 2QENA 1YW7A 2MC4A 1TNTA 2WA0A 3G2BA 1IV6A 2E1MB 4ITVA 1X3UA 3T5XA 4KIGA 2QA4I 1IUYA 1FEXA 4ZYAA 5DV5A 1WVRA 1BI0A 2TDXA 3NWTA 4E4HA 3COAC 2R7OA 5LLQA 4IEJA 2RC4A 3M8EA 4YIRX 4WWCA 1W0UA 3HOUJ 4YFKF 1YS6A 2VC1A 3NQOA 4M9SA 2FE3A 1IRZA 3FKJA 3ESWB 3VSKA 1VFCA 3WHCA 3H0GJ 1YI2I 3P7NA 5EEHA 2CGPA 3FMQA 2GM4A 2VE9A 3ZQFA 1EA3A 1STZA 1U9NA 2FRHA 4XKWA 4LFUA 4F91B 1QNTA 3DTKA 1WQ2A 3V8LA 2M7AA 3TOAA 3VYSB 4HEA2 2M8GX 1TWHJ 4GO1A 2IS2A 4E70A 1S6LA 4IPAA 3SEQA 3WTZA 2L54A 1T98A 5ICFA 3VODA 2DA3A 2GQQA 1IG7A 2JQ7A 2MC3A 4P9FA 1F43A 1G3SA 3FIWA 5ILSA 1ZKGA 1YS7A 2DK5A 2RAEA 3L9FA 1L0OC 5CPRB 2ZNYA 5F08A 3S32A 2ZJRF 2XVCA 2KRCA 1B8IA 5DCMB 1O3QA 3PQKA 2P5LC 4A0XA 1NTCA 4KDPA 2D1VA 2HPIA 3HSEA 4ZJZA 3GW2A 3BR6A 5HDNA 3R4KA 2CQNA 4LIVA 2PQ8A 2AO9A 4A3KJ 3CLOA 2KPMA 3Q5FA 4XLEA 3QYEA 1UHMA 2JVHA 1RPWA 2EJRA 2HTSA 2DQRA 2DJIA 1FNNA 2XSDC 4QTRA 3PJRA 2QF7A 3TOBA 2PFBA 4B44A 4X1EA 1XSVA 1O57A 2IVMA 3QPLA 4HZFA 4QLCU 2XAGA 1H8AC 5FRMA 2X0LA 3F8MA 1IDZA 5GAHJ 1XCBA 5EZGA 1FSEA 3CCRI 3V42A 2M45A 4ZC3A 1J9IA 3IH4A 3I4MJ 4A3CJ 4F92B 2CQQA 2HQRA 4LJZF 1HW1A 3IP4B 1RIOH 4IKFA 3LSPA 1CQTA 1DPUA 2DAOA 4BBSJ 3Q0WA 3CJQB 2VB6A 2VQCA 2JRMA 4NC7A 2GZWA 5JHUA 3HYIA 1JKRC 1X58A 3V7RA 2G9WA 1HKSA 2UXXA 3BOQA 2P81A 1GXPA 1SVOA 3K10A 1HA8A 2IS6A 2KZVA 2Y0SA 4H4KC 4U87A 3E6MA 1QZEA 3FXKA 2LFBA 3DV8A 5D5UB 3CC7I 3PQJA 4XOPA 1L3LA 3K69A 4XLNF 4E7IA 1VI0A 2ZXJA 4C3JJ 2HKOA 3MZYA 3REOA 4H0EA 3HXLA 2XAFA 2JJ7A 2KDOA 3DEUA 2O0YA 2XB5A 4HX8A 4XL9A 1CGPA 4C2UA 2GBYA 4AVPA 4J00A 2VODA 1D5VA 3OOUA 5A2QK 2KRFA 2H8RA 3L00A 4BDYA 3ABLH 1ONVA 3CESA 3FBIB 4XLPF 1ETQA 1FX7A 3F21A 3QP6A 5ICGA 3O2PE 4IZZA 3OIQA 2O03A 4YIIA 5E1WA 2YU9J 1BM9A 1HXDA 2HGCA 3T8TA 4AVZA 3HUGA 4HDVA 3WG9A 1FTZA 1JUSA 1ON1A 4KITB 2XC7A 4AYBN 2NVYJ 4ZYDA 4R1HA 2FQ4A 2DT7B 5ILUA 3MQ0A 1A6QA 2ZCWA 1Y1WJ 2R93J 4UHTA 4D0PA 3PM1A 1YJNI 4KMUX 2UXNA 3PUBA 4P9UA 3AKZA 4I7HA 4ENNA 1MD0A 1FPQA 1UZCA 4A2UA 2EFQA 4I02A 3EUHC 1AA7A 3S1NJ 2DDAA 4RAZA 3K4LA 1P4AA 1XGMA 2DQLA 1ZLJA 3DP7A 1DP7P 1I6XA 2ME6A 2JA5J 4D9JA 3SFIA 2O9LA 4E7KA 5TRDA 3HB9A 4IQ4A 2EA4A 3ZCOA 5FROA 4R79A 1GLNA 1SFOJ 3CF2A 2Q2EB 4ENJA 3ABKH 5LGUA 4C30A 4Y33A 4EGZA 4OWRB 2Y30A 2QLZA 1GDTA 2ZMEC 2N8GA 1ACIA 4BJTA 1B9MA 4IHTA 1X4OA 1Q1VA 4AIJA 4Y7NJ 5DUIA 2ZJ2A 2BE5F 4XRSA 3GFJA 4ENMA 3IUOA 2JK3A 3CO7C 1TWFJ 4I99C 1PP8F 4PUSA 2CUJA 5F0HA 2E2JJ 3F0CA 3I58A 1IXSB 1PVEA 4UV9A 3OSGA 3V7SA 4A3GJ 5CVVA 4KUMA 4DNCA 3A01B 3KP6A 4RS8A 1OCCH 3OIOA 2M34A 1B9NA 2HQ5A 2VJ5A 4HQMA 3H36A 2K3FA 3SDGA 4AM3A 2CYYA 2W25A 4EM1A 2DOAA 2DPDA 5JVGF 1B72A 2DT6A 2EIMH 5HLIA 2NVUB 4BE1A 2PMUA 2XGXA 1LB2A 3TW6A 3PFYA 2Y0SN 3M8FA 3OMYA 4M6XA 3M1EA 4MFEA 4IXAA 3OY9A 1D5YA 3FMRA 1HC8A 5BNGA 3HZJA 1WPKA 2BV6A 2CH0A 4LLGF 1SEUA 2JA2A 4JX4A 5KAIC 3BR5A 5DDGA 4KIBA 3JAMZ 2LF8A 1OYIA 4IJAA 5D4SA 4U0YA 1R49A 2VOPA 4A3LJ 4B3XA 2R5ZA 2A3SA 4CO8A 1LNWA 3HRUA 2CUEA 2XGDA 2DA1A 4XSXF 5EGOA 4CCMA 1PUFB 4UUVA 2XF6A 3BC8A 2NVTJ 3KZZA 1U8BA 1V3FA 1RETA 2EFNA 1OCZH 2VE8A 1JGGA 2ZKZA 2VQLA 2V1DA 2DPUA 4JP0A 4Q5SF 5FKLA 1T33A 1TTYA 1P6RA 3G71I 4PGGA 4PFOA 3VYUB 3HGGA 3BG3A 2V1NA 2M5WA 4HX7A 2W24A 2IJLA 3ML6A 3OYEA 4QIWN 3I9V2 1A6IA 4G12A 4A3IJ 3I59A 3LAPA 2BY1A 3QPSA 1R7JA 4U7DA 1LVAA 3P9KA 2ZFUA 5H6RA 2YS9A 3PL8A 5JLWA 2DCEA 4ESJA 4NC8A 2H1KA 3FF5A 2VLAA 3JAMK 4L0YB 2HR3A 5M5YJ 2R7RA 1JXSA 3VEPA 2Z3YA 5IY5H 1VZ0A 1RUNA 4RGSA 1T0FC 3BJAA 1FZPB 4B8XA 3LL7A 2R5YA 2LY2A 3KETA 5FKNA 5LFAA 1RNLA 3W6KB 3IL2A 3M7GA 4AIKA 3KLOA 1Y1VJ 3LOCA 2OCCH 2ELKA 1Z21A 3VYTB 2M1BA 3JREA 4FETA 1IO2A 1IXRC 3VDXA 1S8NA 2CU7A 2BXYA 1QU3A 3DBRB 3FXUA 3LA7A 1W7PB 3QWLA 4MO7A 2PN6A 2DFFA 3JR9A 3FISA 5L3FA 4I76A 2EV6A 1U78A 2X4HA 3K4JA 2FSWA 5J6XA 4XSZF 3DBHB 3EDPA 1R22A 5BPIA 1Z77A 2HDDA 1EH8A 1JI8A 2KMUA 4EM2A 2QCOA 1QVTA 1NHAA 1CF7B 4F55A 4RB2C 3GCMA 2CV0A 2ZFWA 2ZC2A 2P6TA 3L2CA 2MD0A 2IGKA 2L4MA 2OZUA 3H9GA 3CMYA 1MMSA 5J4YA 3N97A 3F8BA 2BOLA 2CW8A 2QKLB 2V9PA 3ABMH 2XROA 2FU4A 2G0EA 3RKWA 3ZOBA 5D6EA 1VQOI 1D0YA 1XSDA 1VQ5I 2VUMJ 2HDWA 2R7UA 1OQYA 3BTLA 2NXNB 3JCUC 1MBJA 3JRIA 2DK8A 3ZP5A 4CGZA 3JSPA 4OMYA 1ERDA 3FXLA 2VT3A 3H1CA 4RAYA 3BQZA 2DU9A 2DMNA 2CO5A 1GUUA 3LSGA 5J47A 2IBDA 2KIQA 4NNJA 2CV1A 2X6YA 4MGRA 1WH5A 1X3WB 3A0HC 3EPZA 4D7NA 2E7XA 4DBRA 3RZDJ 2A61A 3TQNA 2H8WA 1XPXA 1VQMI 3E3VA 3BLYA 2DLLA 3KYLA 3S3OA 3PO2J 1QZZA 2ADUA 3ABUA 1GT0C 3DBLB 3OSFA 3TP0A 1JKOC 2QSGX 1ZREA 1K79A 3RDIA 3OYLA 1A36A 3I54A 2BY3A 2O7OA 4PJMA 3FZVA 1MSFC 3U9GA 2V9KA 2VPRA 3ZRGA 1FBUA 2PMZN 3G3ZA 3BROA 2M3AA 2ETHA 4XONA 2LG4A 3WGHA 5EEGA 1BR2A 3WTVC 4NQWB 3LQRA 4S05A 1JJ6C 1P9QC 2DOEA 2L9VA 3RYPA 1X2MA 3A1YA 3LFKA 3SQNA 4LITA 2VXZA 2M7BA 2Y9YA 4LD5A 2A5WA 4N4OB 2QYOA 4IX7A 4OU0A 2HDCA 1PYVA 1O4XA 1AHDP 4NB5A 4L18B 2Z16A 3DFGA 4FX0A 3C18A 1X1AA 1KZHA 1SMTA 1FOKA 4M3FA 4U0VA 4D7MA 3EETA 3GYHX 4C3HJ 2DJNA 2IS1A 3NAUA 2VL8A 4A6DA 1J75A 2HYFA 1BR1A 2CMPA 2F5EA 1VQNI 2YX7A 1J59A 1LEAA 2K9SA 5EF6A 2WBMA 2FF4A 3ZQ7A 1UHWA 3E97A 1X1DA 3ZMUA 1VTNC 1MJBA 1LUJB 3QYBA 2VKEA 2HYGD 2VJIA 1BI2A 4G94A 5IP7J 5D4RA 3TW7A 1I50J 1R5HA 2RNGA 1GHCA 1D0XA 3C7JA 2P8TA 1QHGA 4OIQF 1BIBA 1T39A 2F5DA 5M3MJ 2MH9A 3V4GA 2WC2A 3IRQA 1P2FA 4JBAA 3DXJF 5K1YA 4E7HA 4BH9A 3N4MA 1R00A 3Q0VA 1HKTA 3E1SA 1DPRA 1MMGA 2NYXA 1TL8A 1BBYA 1EV7A 1WKMA 3EQLF 4WX9A 3J7AY 2JVGA 3CLQA 2CJJA 4FASD 3S14J 4A5NA 3RYRA 3L09A 1SAXA 2GLOA 2I8DA 3FXMA 1VQ6I 2IGMA 4GGGA 5FO5A 3JRFA 4HYEA 3CCQI 1F9NA 1KA8A 5GPAA 1U6GA 5IOZA 1I27A 4GFBA 2Y75A 2KLOA 2W4SA 1ZRCA 2COBA 2F5CA 3GFIA 4D5CA 3S2DJ 2JN6A 4WF2A 3IRRA 3C2BA 3CCMI 1NK3P 3KP7A 1TZLA 2HS5A 5FLVA 4HV6A 4R8HA 3CCLI 3LSHA 2IAIA 4EGYA 3CUQC 4OIPF 1M1EB 4XKBA 3ABTA 1PDNC 3SHFA 1QZYA 1OPCA 1W4MA 3CDHA 2IS4A 2FA5A 3HOZJ 4CICA 1OCTC 1RC9A 1U8RA 4OIOF 1ODDA 1U5TB 2ECBA 4CYCA 9ANTA 4BGDA 1ZG1A 2CW0F 4S0HB 3WU2C 5E3MA 2M0CA 2A6TA 2K02A 3LFUA 4Y4RA 3S2WA 4IRHA 3DCFA 4L9TA 4ANJA 3RKYA 4V19K 2ZJQF 2NS0A 1HDDC 4HV5A 2PJRB 1X1PA 1XX5A 2JZYA 4LG3A 4FISA 2IEKA 1ZH5A 1IC8A 4WXCA 5KAFC 4ZDPA 1YW8A 5D5VB 1S7AA 5BMZA 3D5SC 4CUGA 4O6JA 1WSUA 1FP2A 2FMLA 1YIOA 3ERED 1DDNA 2OZ6A 2C6YA 2VBWA 3DEEA 3AG2H 1SC7A 3O3KA 1F5TA 4JQFA 1F1ZA 2LBFB 4CCKA 1DUXC 2R0QC 1KYZA 1IZ1A 3KP3A 4JK1X 4AU7A 4ENKA 1KU7A 3R6SA 2DMTA 2PG4A 1LDJA 1QPIA 2L5QA 3K1PA 1LE8B 3RPUD 5FKOA 1HF0A 1W1WE 1Y39A 5L3EA 3RPQA 5B1AH 2WV0A 2V1XA 4KN7X 4WXHA 1MH4A 3GTLJ 2L0KA 4HNUA 2EFOA 3G4SI 2MGQA 2ZXIA 3C1DA 1ZAOA 2E19A 2O5RA 2QGUA 3P9IA 2KHMA 4UVAA 1QHHD 4F3QA 1FOYA 2CQ7A 3J80Z 1WWXA 4L9JA 1K7AA 2QBYB 5H6QA 2NS7A 4IHSA 3ZQHA 4BY7J 3OV8A 1E17A 1LPQA 3L2WA 1YRNB 1YJ9I 1W7PD 2ZJPF 3RCOA 1MIJA 1RR8C 1O3RA 3M3YJ 2V6CA 2B63J 1FOWA 2V1UA 2R7SA 2E2IJ 1Y0UA 2HU9A 3CCJI 1IRXA 3OYFA 4Z2YA 1R4NB 2EA2A 3NEUA 4RB1A 2KJCA 3U2RA 2XGEA 3WG7H 4DOZA 3E6BA 2K9QA 2WTEA 4G7OF 3OS2A 2I5UA 3WGIA 3S2HJ 3HJEA 1HSTA 2EQRA 3AAFA 4EM0B 5LGNA 2OAZA 2JWTA 3B6AA 3GFMA 5E1XA 1DP3A 2H94A 3BCAA 3SDBA 1MNMC 1XTAA 3RKXA 3JTHA 3J80K 1ETYA 5EDNA 2AQEA 3LSIA 5HLGA 1RUOA 2M30A 5CKTA 1J0RA 2XUBA 1VQLI 4YEJA 4AYBA 5IP9J 2VKHA 2VI6A 1LFUP 2LDUA 3GFLA 1ZRDA 2MFZA 2W7NA 2R92J 3S16J 1LFPA 1D8KA 2LREA 2XRLA 5E3LA 2W82A 5JLXA 1QA6A 4A3BJ 3RIRA 1K78A 2FEZA 4JX6A 4ABZA 1S72I 1MZBA 2KFDA 3WGGA 3F22A 3HEFA 1D0ZA 1SAUA 4HG2A 3C2HA 2IGNA 1TW3A 2L9RA 3C3WA 3HTSB 1I1SA 2BY0A 2XGCA 4KNYA 1BI3A 2PX9A 1R36A 3H0DA 3CMMA 2X6OA 2RKHA 2HOSA 2G7HA 3K1NA 4EATA 1ZTRA 4P55A 3JSOA 1QGPA 2OQGA 3WTYC 2ID3A 4E7JA 4C9YA 3W3CA 2X1DA 2XKPA 1WGXA 5C44J 2E35A 3BCBA 2KKOA 3TDUC 5B66C 3MAJA 4RBOA 2L7ZA 2K9LA 1JT6A 3LSJA 2A6HF 5HOOA 4CA0A 5D6FA 5A2QZ 1T08B 2OJED 1Z91A 3BG7A 3ZMDA 1IW7F 1IGNA 1ULYA 4M3GA 1B1BA 2EWNA 1S7OA 1WH7A 2A68F 1U0JA 3JTGA 3ZR8X 2IA1A 1MKMA 2JRTA 3WTWC 4A69C 4XKCA 2XHKA 2OQRA 1BJZA 3L2QA 3N05A 2ZBKA 4CZCA 3FK6A 3GTPJ 3ZPLA 3B6CA 4DBQA 5JFRA 2BW3B 3PFIA 3MKZA 3PNVA 2E5ZA 3HOWJ 3SJMA 5FD5A 2Y69H 4UNOA 4UY8I 2QQ8A 2X48A 2LRDA 2DFHA 3QU6A 1FMVA 3PO3J 5CVRA 2RQQA 2NNYA 2F4OB 2FUG2 2P7CB 1HCRA 4KYWA 3K2AA 3G1MA 4A3JJ 3D5LA 3FDYA 4U7BA 4PDKA 1R1VA 5CLSA 3BPVA 5EZHA 3W6VA 3GO5A 4M6YA 4XOTA 2K85A 3HGYA 3KFWX 1Y8RB 1E3HA 4PJNA 3Q9SA 1LFBA 3ZQIA 3K6GA 1JHHA 2J5PA 4AUXA 3LAJA 4RA2A 5DUKA 4B48A 3EYIA 2KISA 3CCUI 3MVPA 1R4MB 1AKHA 1OCOH 3OIPA 3OL4A 5F04A 3QRFF 3QAHA 3K4KA 2V26A 3OS1A 4HNVA 2JT1A 4BXFA 4E7ZA 1C0WA 1MJAA 4IHVA 4RGXA 5DTDA 2MBFA 3MWMA 2K27A 1W5CC 1FOXA 3PIOF 1TWCJ 4G9YA 2HQAA 3BTIA 5ICEA 3QOEA 5K7HA 1LDDA 2RGVA 4MNUA 1R71A 2NOJB 5FD6A 3HSRA 5AIPA 5LHIA 3GXOA 2EILH 1VQ4I 4LG0A 5FLMJ 4ZYGA 3AL0C 3IAM2 1B59A 3E6CC 5M3FJ 1YG2A 3GZ5A 5JR3A 2X51A 5FFZA 4B43A 3WHBA 5K7ZA 4LOCA 2ELJA 1BA5A 1IUFA 3QU3A 4JOMA 4LK0F 3H9QA 3ZQLA 2RN7A 2R7WA 4XLHA 2A5YB 5HS9A 2P5KA 1X1CA 2NVXJ 4B1RA 2VQHA 5E8GA 3S8PA 2DO7A 1S5LC 3F23A 2XPUA 4KMFA 2HZDA 1WCMJ 2YX4A 4GCVA 2JA8J 2E5NA 1G3TA 1YHQI 2M87A 2DMQA 5CJ9A 3I71A 2R3SA 3QYFA 3RZOJ 1DU0A 1U5TA 5J8FA 1TLHB 1OLTA 3FHZA 3VWBA 2L2OA 3IH2A 3TGNA 3SYTA 1QBJA 3K2ZA 5ICCA 4KT5C 4IF4A 2K86A 1IRFA 2DA4A 4EEFG 2FBIA 2V7FA 3GUDA 5DCFA 4X0GA 2PJRA 3A2KA 2XV4S 1V4RA 1FC3A 1ZK8A 2F6CA 2JSPA 3CUQB 1MMAA 4IL6C 1N25A 1ORKA 3PSFA 1AU7A 4P5OA 5F1RA 1OYYA 2O61A 2EH3A 3U1KA 3S3NA 3GTQJ 2WB1N 1IXCA 2KRHA 3HRSA 5HS7A 3BDDA 2E7WA 4HF0A 1FYLA 3HPHA 3JRBA 1ZR4A 1R5ID 2R7TA 3ZQQA 3A02A 2EPFA 4XRFA 3TDZC 3R61A 4FX4A 4C2TA 2L9NA 2MW8A 3KEQA 4CH7A 3K0LA 2AXLA 3FWEA 3J81K 3H92A 1ZG3A 2BY2A 1F4KA 2LKPA 1IV8A 3ZN0A 3CJTB 2IRFG 1ETOA 2P6SA 2JPBA 2NRAC 3A0BC 1V5FA 2Z5UA 3H3UA 2IT0A 2EBIA 2LLKA 3LSTA 2M4KA 2PMZA 2ZXWH 4UB8C 4DYCA 5FJ8J 3J7YJ 1VNDA 3H35A 2K4BA 4YIFA 5L3DA 4RM2A 1Z9CA 1GXQA 3CP8A 1PUEE 2M9HA 2OA4A 2UV1A 3TEDA 1OJLA 1ZHFA 2E1MC 1YRNA 4CXFA 5AONA 3E5XA 3BJ6A 2MD5A 1LKXA 2XPWA 5EG0B 1HDPA 4XKVA 4LLLA 1H0MA 5AIQA 4AWXB 1USTA 5J8CA 3FM3A 5GPCA 2IPQX 1BL0A 3CO6C 2Z9OA 1HW5A 2HKXA 2DMUA 3T0YA 3L2RA 3D1NI 2W57A 4NC6A 5F0CA 3ECHA 2FJ1A 1H88C 4XN3A 3SZTA 3M1CA 4HPQA 3IWFA 3E0JB 5IP6A 5D8KB 3I64A 4ASNA 1JGSA 4I01A 4MHGA 2WAEA 4C2MJ 3F8FA 5DD8A 4BKXA 2XDVA 4YFXF 1W5TA 4CCNA 3TKYA 3HRTA 2XSJC 3CTAA 2DOFA 3KEOA 2A05A 2D45A 1ZYRF 2J5OA 2X6WA 2Q1ZB 2A07F 2ISYA 4G6TB 5J1UA 1O3SA 4BACA 5E3OA 3ZN1A 2ZB9A 1Z67A 2Z1DA 2EFPA 2W84A 1QRYA 1Z3YA 3D5RC 1XDSA 1I39A 3C2GA 1I3AA 3G1OA 2FQ3A 4XR6A 4Y17A 3S3MA 5DCMA 1N77A 5BS6A 4O3MA 4BYYA 1T56A 4D1QA 2NNNA 4HQEA 1TWAJ 5D8LB 3CCYA 2DFEA 4BXXJ 2VT2A 1HSJA 4DZJA 1P7JA 2DA7A 3IV5A 3M07A 4DQ2A 1X2NA 2ESHA 2EV0A 5K5QA 1B8IB 1LVKA 2Q8KA 3L2UA 1H9TA 1XGSA 1KQ0A 3PUFA 4OINF 2QSHX 4Y52J 4XLCA 1KU2A 2CQKA 1A31A 3S1QJ 1PJRA 1ITYA 1FWZA 4XK4A 4ZZLA 1TC3C 2RV8A 4BUPA 2E71A 3ELKA 3GLXA 3Q3SA 1MJ9A 5DYMA 1OR7A 3AG3H 5LEKA 3IAS2 1BW6A 3RSNA 1MDMB 4KFCA 3J7ZI 5LBQA 3GEZA 4I09A 2CUFA 5LEJA 1G3WA 1XCVA 2HWVA 1Z0XA 2KL4A 1JUPA 1NG6A 3TO7A 4ZTFA 3I5UA 1IN4A 2M2EA 3V7CA 1IN6A 1QO0D 1K6OA 2BW3A 1MBFA 4BE2A 4BJ6C 4IHYA 1YITI 5E8IA 4BAYA 1AWCA 1SFKA 2VOOA 5ILVA 1TWGJ 2LD5A 5J4VA 2P5VA 1I5ZA 3HTUA 2ACJA 2VJJA 3E7LA 4IRGA 2L02A 2ZSIB 4KN4X 1YW9A 1XC5A 1Z6RA 2GA1A 2OTJI 4ZDLA 4UUSB 1YFHA 2GOXB 3DTIA 4ZTJA 1RESA 3U21A 4A5MA 4BQQA 3KZYA 5EYRA 3ONQA 1XB4A 1D1BA 5LRRA 5DEQA 2VBXA 4HSTA 3DPLC 5FKMA 3K4CA 3H3VK 2Z2SB 4KICA 4G6QA 3W2WA 4OAYA 3RTRA 3GF2A 3CCSI 3H5NA 2DYSH 2QUFA 3ZQCA 2EV5A 2L9SA 4Q48A 2R7QA 3OYJA 2VKVA 3V8KA 4HLXA 2XF5A 2E36A 1SVLA 3ASNH 5CYVA 4MEYF 5JVTA 1U3EM 1IAWA 5IOYA 3HUGB 4M74A 1ENHA 2XRNA 3H3ZA 4Z6YA 1R1TA 1ZGJA 1HLVA 1W36C 4IRIA 2PI0A 3WE2A 1T95A 2Q2EA 1XN7A 5EEAA 3K4MA 1MNEA 2Y48A 2H1LA 3FX3A 2DXIA 3ZMTA 2CWEA 3R60A 2JPCA 3K7AJ 4UUTA 3IC7A 4PJJA 3ZMZA 4PJ0C 3BR1A 2BEOA 2ZXHA 4LB6B 4A3FJ 2KIMA 4MLOA 4IO9F
chains in the Genus database with same CATH topology
4V2FA 4JX6A 4ABZA 3A01A 3HEFA 2TCTA 4A3MJ 1Q1VA 4Y7NJ 4XRSA 4X6AJ 2L9RA 2JK3A 5J1RA 1TWFJ 5F0HA 2E2JJ 2XGCA 3F0CA 3OSGA 3S1RJ 4A3GJ 3A01B 2X6OA 2HOSA 3OIOA 3JRHA 2M34A 5FKKA 2HOTA 1ZTRA 2HQ5A 3SDGA 2ID3A 4M6VA 4DZPA 1VF9A 5J1YA 1B72A 1WGXA 5C44J 1F36A 2L7ZA 4RBOA 3TW6A 2JA6J 2Y0SN 2DA2A 1JT6A 3LSJA 4MFEA 1POGA 1D5YA 5BNGA 1B72B 1WPKA 3CDLA 4AC0A 4JX4A 1ETVA 1PUFA 2O8KA 3BR5A 1IGNA 4M3GA 1BW5A 5M5WJ 2JA7J 4FTHA 1WH7A 1ZQ3P 4A3LJ 1W0TA 3DEWA 2R5ZA 4L5EA 4M3BA 4A69C 3HM5A 2CUEA 2XGDA 2DA1A 4JX5A 5EGOA 1BJZA 1PUFB 4DW6A 3FK6A 5DS9A 3GTPJ 2NVTJ 2Y9ZA 3B6CA 1U8BA 1RETA 2I10A 3FK7A 4D5FA 1JGGA 1XS9A 5EGOB 1DU6A 1FIAA 4JP0A 5M5XJ 4MIMA 5FKLA 4B3AA 3HOWJ 1T33A 4M3EA 3SJMA 5HODA 1JTYA 1NK2P 2LTPA 3HGGA 2X48A 3BG3A 3HOVJ 4QIWN 1A6IA 3BTCA 4G12A 3BG5A 4A3IJ 3PO3J 1GV5A 2CQXA 2WAQN 2R7ZJ 2DA6A 3QPSA 4XIDA 2K9NA 1HCRA 3GTOJ 3K2AA 2YS9A 2ME0A 3G1MA 3Q0UA 5JLWA 4A3JJ 2H1KA 4XRSG 5EZHA 2NOGA 4DYQA 3BR0A 5M5YJ 3W6VA 3HGYA 3HBLA 1OFCX 2TRTA 1LFBA 1RKWA 2HI3A 3ZQIA 5EG0A 4AUXA 1ETWA 2R5YA 1MBKA 2XB0X 5FKNA 1ZGWA 1GV2A 1UMQA 1UG2A 2MSYA 3MVPA 1AKHA 5IYDJ 1Y1VJ 3LOCA 5F04A 2FD5A 2ELKA 2HYJA 3LSRA 2JMWA 4A3EJ 4HNVA 1R9TJ 3JREA 3GTKJ 4IHVA 5DTDA 2CU7A 2L7FP 1AKHB 2NS8A 2XPVA 2L7MP 4MO7A 4IHXA 1RKTA 1TWCJ 3I4NJ 3JR9A 3BTIA 3FISA 5K7HA 4I76A 1U78A 4V2GA 1K83J 2DMPA 1Z77A 2HDDA 5FLMJ 1GDTA 1I6HJ 2QCOA 1QVTA 4J19A 5IYCJ 4BY1J 3UKGA 3O8HA 4A93J 5M3FJ 4W1UA 2YUSA 3ZQGA 2EZIA 2E2HJ 5K7ZA 3WHBA 4LOCA 3CMYA 4FCYA 1XG1A 1BA5A 1G2HA 5IPAA 1IUFA 2MG4A 1MSEC 2HXOA 3ZQLA 3JRAA 2G0EA 1WI3A 3ZOBA 2NVXJ 4B1RA 2VUMJ 3BTLA 1P7IA 1MBJA 3JRIA 4XICA 2XPUA 1WCMJ 4XRMA 2KDZA 2JA8J 3GTMJ 3S15J 3HOXJ 2DMQA 3BQZA 2D5VA 3RZOJ 2DMNA 3LSGA 1GUUA 1DU0A 2IBDA 3HKZN 1WH5A 1SANA 3IH2A 4D7NA 3RZDJ 1JTXA 2OF7A 4FE4A 3PO2J 4IHWA 3GTJJ 1GT0C 2E1OA 2DA4A 4EEFG 3OSFA 3TP0A 2EZKA 1JKOC 1E3OC 3BT9A 1JJ8C 2O7OA 1ZK8A 2HOAA 1MSFC 1ORKA 1AU7A 2EZHA 2VPRA 2EH3A 3JRDA 1MH3A 2PMZN 3GTQJ 2WB1N 1APLC 4BBRJ 2R5ZB 1OCPA 3JRBA 1ZR4A 1JJ6C 3RQIA 1A5JA 3A02A 5C4JJ 1X2MA 3MN2A 2EZLA 2MW8A 1MBHA 4B4CA 3HDDA 3GBGA 2Y9YA 2AHQA 3BG9A 1O4XA 1AHDP 1JUMA 4MLOA 3S1MJ 1ETOA 5F27A 4UUSA 2EBIA 1MBEA 1RR7A 5F1JA 2LLKA 1S7EA 4M3FA 2NVQJ 4D7MA 2DTZA 4DYCA 5FJ8J 1VNDA 3M4OJ 4C3HJ 2DJNA 1HOMA 3NAUA 2M9HA 3TEDA 3HOYJ 1ETXA 2K9SA 3BQYA 1OJLA 2Y2ZA 5EF6A 3O8GA 5F0FA 3IH3A 1YRNA 4JYKA 4M3DA 2LY9A 2ECCA 5C4XJ 1H89C 5E3NA 2VKEA 2XPWA 2WV1A 5EG0B 1HDPA 5IP7J 4DYRA 2R5YB 3A03A 3TW7A 1FTTA 1I50J 5GPCA 1U9OA 1BL0A 2K40A 5J3LA 3MKLA 2DMUA 4QSHA 3D1NI 4RDUA 5F0CA 2W48A 5M3MJ 2FJ1A 1H88C 1IV6A 2LP0A 4W97A 4NDLA 1FEXA 5IP6A 3Q0VA 2FX0A 4C2MJ 5C3EJ 4IEJA 1W0UA 4BKXA 3HOUJ 2CJJA 3S14J 1IRZA 1VFCA 3QQAA 3WHCA 3H0GJ 2GLOA 2GM4A 3ZQFA 2LVSA 1U9NA 5J1UA 3JRFA 5GPAA 5IOZA 5E3OA 2ZB9A 4GFBA 1QRYA 2COBA 2M8GX 1TWHJ 4D5CA 3S2DJ 2JN6A 3C2BA 3G1OA 1NK3P 5FLVA 2DA3A 1IG7A 1F43A 1T56A 2IAIA 2OPTA 3FIWA 1JKQC 1ZKGA 2Y31A 2RAEA 4C3IJ 5F08A 1B8IA 1TWAJ 3HOZJ 3CCYA 1OCTC 1ZR2A 4BXXJ 3JRGA 1NTCA 1P7JA 2CRGA 2DA7A 3NARA 4DZJA 3IV5A 2ECBA 9ANTA 1X2NA 4CYCA 1QVUA 2DN0A 3BR6A 1B8IB 4S0HB 2AO9A 5E3MA 2M0CA 4I6ZA 4Y52J 4A3KJ 3S1QJ 3DCFA 1TC3C 4XK4A 1ITYA 1RPWA 3CQZJ 4MFDA 3Q3SA 4CYCB 2XSDC 1JT0A 1HDDC 4QTRA 2QF7A 4FISA 2IEKA 4X1EA 3QPLA 1IC8A 1BW6A 1H8AC 1K61A 3VPRA 1IDZA 5EZGA 2CUFA 1Z0XA 1ETKA 1JUPA 3IH4A 3I4MJ 4A3CJ 2CQQA 3LNQA 1JKPC 2M2EA 3LSPA 1EF4A 1LE8A 1CQTA 1MBFA 4IHYA 4BBSJ 3Q0WA 2R0QC 1GVDA 1JKRC 1X58A 5GP9A 1TWGJ 2DMTA 2X9DA 2P81A 2LD5A 1QPIA 1LE8B 5FKOA 1HF0A 2KT0A 2LFBA 3E7LA 3L1PA 1I3QJ 1IJWC 5IYBJ 1XC5A 4UUSB 1MH4A 3GTGJ 3GTLJ 2L0KA 1VI0A 2MGQA 4C3JJ 2E19A 1RESA 2JJ7A 3JRCA 5EYRA 1UHSA 1FIPA 2XB5A 2GBYA 3OOUA 2NS7A 3ZQHA 5FKMA 4BY7J 2H8RA 3H3VK 2LKXA 1ETQA 1YRNB 4A3DJ 3M3YJ 2YU9J 2B63J 3ZQCA 2E2IJ 1FTZA 1JUSA 4AYBN 2NVYJ 2VKVA 2FQ4A 2XGEA 1Y1WJ 5IOYA 2R93J 2K9QA 3BR2A 1ENHA 3PM1A 2DA5A 3S2HJ 2ID6A 2EQRA 3S1NJ 4FE7A 2JWTA 3B6AA 3BR3A 3G1LA 1IDYA 1HLVA 5K7FA 2ME6A 2JA5J 5EEAA 1MNMC 1FJLA 3SFIA 2O9LA 1ETYA 2LR8A 2LK2A 3BTJA 5EDNA 3HB9A 3K7AJ 1SFOJ 5IP9J 4UUTA 1LFUP 2VI6A 2R92J 3S16J 3BR1A 3TP3A 2Y30A 3RKQA 3FKIJ 4A3FJ 2XRLA 3S17J 5E3LA 1MBGA 2HXIA 2N8GA 5JLXA 4A3BJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2F A;  4JX6 A;  4ABZ A;  3A01 A;  3HEF A;  2TCT A;  4A3M J;  1Q1V A;  4Y7N J;  4XRS A;  4X6A J;  2L9R A;  2JK3 A;  5J1R A;  1TWF J;  5F0H A;  2E2J J;  2XGC A;  3F0C A;  3OSG A;  3S1R J;  4A3G J;  3A01 B;  2X6O A;  2HOS A;  3OIO A;  3JRH A;  2M34 A;  5FKK A;  2HOT A;  1ZTR A;  2HQ5 A;  3SDG A;  2ID3 A;  4M6V A;  4DZP A;  1VF9 A;  5J1Y A;  1B72 A;  1WGX A;  5C44 J;  1F36 A;  2L7Z A;  4RBO A;  3TW6 A;  2JA6 J;  2Y0S N;  2DA2 A;  1JT6 A;  3LSJ A;  4MFE A;  1POG A;  1D5Y A;  5BNG A;  1B72 B;  1WPK A;  3CDL A;  4AC0 A;  4JX4 A;  1ETV A;  1PUF A;  2O8K A;  3BR5 A;  1IGN A;  4M3G A;  1BW5 A;  5M5W J;  2JA7 J;  4FTH A;  1WH7 A;  1ZQ3 P;  4A3L J;  1W0T A;  3DEW A;  2R5Z A;  4L5E A;  4M3B A;  4A69 C;  3HM5 A;  2CUE A;  2XGD A;  2DA1 A;  4JX5 A;  5EGO A;  1BJZ A;  1PUF B;  4DW6 A;  3FK6 A;  5DS9 A;  3GTP J;  2NVT J;  2Y9Z A;  3B6C A;  1U8B A;  1RET A;  2I10 A;  3FK7 A;  4D5F A;  1JGG A;  1XS9 A;  5EGO B;  1DU6 A;  1FIA A;  4JP0 A;  5M5X J;  4MIM A;  5FKL A;  4B3A A;  3HOW J;  1T33 A;  4M3E A;  3SJM A;  5HOD A;  1JTY A;  1NK2 P;  2LTP A;  3HGG A;  2X48 A;  3BG3 A;  3HOV J;  4QIW N;  1A6I A;  3BTC A;  4G12 A;  3BG5 A;  4A3I J;  3PO3 J;  1GV5 A;  2CQX A;  2WAQ N;  2R7Z J;  2DA6 A;  3QPS A;  4XID A;  2K9N A;  1HCR A;  3GTO J;  3K2A A;  2YS9 A;  2ME0 A;  3G1M A;  3Q0U A;  5JLW A;  4A3J J;  2H1K A;  4XRS G;  5EZH A;  2NOG A;  4DYQ A;  3BR0 A;  5M5Y J;  3W6V A;  3HGY A;  3HBL A;  1OFC X;  2TRT A;  1LFB A;  1RKW A;  2HI3 A;  3ZQI A;  5EG0 A;  4AUX A;  1ETW A;  2R5Y A;  1MBK A;  2XB0 X;  5FKN A;  1ZGW A;  1GV2 A;  1UMQ A;  1UG2 A;  2MSY A;  3MVP A;  1AKH A;  5IYD J;  1Y1V J;  3LOC A;  5F04 A;  2FD5 A;  2ELK A;  2HYJ A;  3LSR A;  2JMW A;  4A3E J;  4HNV A;  1R9T J;  3JRE A;  3GTK J;  4IHV A;  5DTD A;  2CU7 A;  2L7F P;  1AKH B;  2NS8 A;  2XPV A;  2L7M P;  4MO7 A;  4IHX A;  1RKT A;  1TWC J;  3I4N J;  3JR9 A;  3BTI A;  3FIS A;  5K7H A;  4I76 A;  1U78 A;  4V2G A;  1K83 J;  2DMP A;  1Z77 A;  2HDD A;  5FLM J;  1GDT A;  1I6H J;  2QCO A;  1QVT A;  4J19 A;  5IYC J;  4BY1 J;  3UKG A;  3O8H A;  4A93 J;  5M3F J;  4W1U A;  2YUS A;  3ZQG A;  2EZI A;  2E2H J;  5K7Z A;  3WHB A;  4LOC A;  3CMY A;  4FCY A;  1XG1 A;  1BA5 A;  1G2H A;  5IPA A;  1IUF A;  2MG4 A;  1MSE C;  2HXO A;  3ZQL A;  3JRA A;  2G0E A;  1WI3 A;  3ZOB A;  2NVX J;  4B1R A;  2VUM J;  3BTL A;  1P7I A;  1MBJ A;  3JRI A;  4XIC A;  2XPU A;  1WCM J;  4XRM A;  2KDZ A;  2JA8 J;  3GTM J;  3S15 J;  3HOX J;  2DMQ A;  3BQZ A;  2D5V A;  3RZO J;  2DMN A;  3LSG A;  1GUU A;  1DU0 A;  2IBD A;  3HKZ N;  1WH5 A;  1SAN A;  3IH2 A;  4D7N A;  3RZD J;  1JTX A;  2OF7 A;  4FE4 A;  3PO2 J;  4IHW A;  3GTJ J;  1GT0 C;  2E1O A;  2DA4 A;  4EEF G;  3OSF A;  3TP0 A;  2EZK A;  1JKO C;  1E3O C;  3BT9 A;  1JJ8 C;  2O7O A;  1ZK8 A;  2HOA A;  1MSF C;  1ORK A;  1AU7 A;  2EZH A;  2VPR A;  2EH3 A;  3JRD A;  1MH3 A;  2PMZ N;  3GTQ J;  2WB1 N;  1APL C;  4BBR J;  2R5Z B;  1OCP A;  3JRB A;  1ZR4 A;  1JJ6 C;  3RQI A;  1A5J A;  3A02 A;  5C4J J;  1X2M A;  3MN2 A;  2EZL A;  2MW8 A;  1MBH A;  4B4C A;  3HDD A;  3GBG A;  2Y9Y A;  2AHQ A;  3BG9 A;  1O4X A;  1AHD P;  1JUM A;  4MLO A;  3S1M J;  1ETO A;  5F27 A;  4UUS A;  2EBI A;  1MBE A;  1RR7 A;  5F1J A;  2LLK A;  1S7E A;  4M3F A;  2NVQ J;  4D7M A;  2DTZ A;  4DYC A;  5FJ8 J;  1VND A;  3M4O J;  4C3H J;  2DJN A;  1HOM A;  3NAU A;  2M9H A;  3TED A;  3HOY J;  1ETX A;  2K9S A;  3BQY A;  1OJL A;  2Y2Z A;  5EF6 A;  3O8G A;  5F0F A;  3IH3 A;  1YRN A;  4JYK A;  4M3D A;  2LY9 A;  2ECC A;  5C4X J;  1H89 C;  5E3N A;  2VKE A;  2XPW A;  2WV1 A;  5EG0 B;  1HDP A;  5IP7 J;  4DYR A;  2R5Y B;  3A03 A;  3TW7 A;  1FTT A;  1I50 J;  5GPC A;  1U9O A;  1BL0 A;  2K40 A;  5J3L A;  3MKL A;  2DMU A;  4QSH A;  3D1N I;  4RDU A;  5F0C A;  2W48 A;  5M3M J;  2FJ1 A;  1H88 C;  1IV6 A;  2LP0 A;  4W97 A;  4NDL A;  1FEX A;  5IP6 A;  3Q0V A;  2FX0 A;  4C2M J;  5C3E J;  4IEJ A;  1W0U A;  4BKX A;  3HOU J;  2CJJ A;  3S14 J;  1IRZ A;  1VFC A;  3QQA A;  3WHC A;  3H0G J;  2GLO A;  2GM4 A;  3ZQF A;  2LVS A;  1U9N A;  5J1U A;  3JRF A;  5GPA A;  5IOZ A;  5E3O A;  2ZB9 A;  4GFB A;  1QRY A;  2COB A;  2M8G X;  1TWH J;  4D5C A;  3S2D J;  2JN6 A;  3C2B A;  3G1O A;  1NK3 P;  5FLV A;  2DA3 A;  1IG7 A;  1F43 A;  1T56 A;  2IAI A;  2OPT A;  3FIW A;  1JKQ C;  1ZKG A;  2Y31 A;  2RAE A;  4C3I J;  5F08 A;  1B8I A;  1TWA J;  3HOZ J;  3CCY A;  1OCT C;  1ZR2 A;  4BXX J;  3JRG A;  1NTC A;  1P7J A;  2CRG A;  2DA7 A;  3NAR A;  4DZJ A;  3IV5 A;  2ECB A;  9ANT A;  1X2N A;  4CYC A;  1QVU A;  2DN0 A;  3BR6 A;  1B8I B;  4S0H B;  2AO9 A;  5E3M A;  2M0C A;  4I6Z A;  4Y52 J;  4A3K J;  3S1Q J;  3DCF A;  1TC3 C;  4XK4 A;  1ITY A;  1RPW A;  3CQZ J;  4MFD A;  3Q3S A;  4CYC B;  2XSD C;  1JT0 A;  1HDD C;  4QTR A;  2QF7 A;  4FIS A;  2IEK A;  4X1E A;  3QPL A;  1IC8 A;  1BW6 A;  1H8A C;  1K61 A;  3VPR A;  1IDZ A;  5EZG A;  2CUF A;  1Z0X A;  1ETK A;  1JUP A;  3IH4 A;  3I4M J;  4A3C J;  2CQQ A;  3LNQ A;  1JKP C;  2M2E A;  3LSP A;  1EF4 A;  1LE8 A;  1CQT A;  1MBF A;  4IHY A;  4BBS J;  3Q0W A;  2R0Q C;  1GVD A;  1JKR C;  1X58 A;  5GP9 A;  1TWG J;  2DMT A;  2X9D A;  2P81 A;  2LD5 A;  1QPI A;  1LE8 B;  5FKO A;  1HF0 A;  2KT0 A;  2LFB A;  3E7L A;  3L1P A;  1I3Q J;  1IJW C;  5IYB J;  1XC5 A;  4UUS B;  1MH4 A;  3GTG J;  3GTL J;  2L0K A;  1VI0 A;  2MGQ A;  4C3J J;  2E19 A;  1RES A;  2JJ7 A;  3JRC A;  5EYR A;  1UHS A;  1FIP A;  2XB5 A;  2GBY A;  3OOU A;  2NS7 A;  3ZQH A;  5FKM A;  4BY7 J;  2H8R A;  3H3V K;  2LKX A;  1ETQ A;  1YRN B;  4A3D J;  3M3Y J;  2YU9 J;  2B63 J;  3ZQC A;  2E2I J;  1FTZ A;  1JUS A;  4AYB N;  2NVY J;  2VKV A;  2FQ4 A;  2XGE A;  1Y1W J;  5IOY A;  2R93 J;  2K9Q A;  3BR2 A;  1ENH A;  3PM1 A;  2DA5 A;  3S2H J;  2ID6 A;  2EQR A;  3S1N J;  4FE7 A;  2JWT A;  3B6A A;  3BR3 A;  3G1L A;  1IDY A;  1HLV A;  5K7F A;  2ME6 A;  2JA5 J;  5EEA A;  1MNM C;  1FJL A;  3SFI A;  2O9L A;  1ETY A;  2LR8 A;  2LK2 A;  3BTJ A;  5EDN A;  3HB9 A;  3K7A J;  1SFO J;  5IP9 J;  4UUT A;  1LFU P;  2VI6 A;  2R92 J;  3S16 J;  3BR1 A;  3TP3 A;  2Y30 A;  3RKQ A;  3FKI J;  4A3F J;  2XRL A;  3S17 J;  5E3L A;  1MBG A;  2HXI A;  2N8G A;  5JLX A;  4A3B J; 
#chains in the Genus database with same CATH topology
 3A01 A;  2XAU A;  1WJD A;  2Y0M A;  4X6A J;  4CHU A;  4OAZ A;  1A04 A;  4NUB A;  5J1R A;  2MYS A;  4M9Z A;  3AL0 B;  3FXO A;  5B1B H;  4PSW A;  1YLF A;  1B6A A;  1UEL B;  3F6V A;  2QQ9 A;  4BDZ A;  3JRH A;  4RLQ A;  2HOT A;  5FKK A;  3TO9 A;  3VOE A;  1Z7L A;  4XMY A;  2P0W A;  3A4C A;  2XIG A;  2ZME B;  3E5Q A;  3K1M A;  2EIK H;  4M6V A;  1BN5 A;  4DZP A;  1VF9 A;  5J1Y A;  3P9C A;  4F93 B;  4QPO A;  3MZH A;  2DYR H;  3F3X A;  3OS0 A;  5E18 F;  2FOW A;  1FBS A;  1F36 A;  3OR1 C;  2JA6 J;  2M4G A;  1IN7 A;  5HNH A;  1BC8 C;  1VQ7 I;  2E1C A;  2DA2 A;  5HS8 A;  1POG A;  1A35 A;  1B72 B;  3KYD B;  1YJW I;  3K70 C;  2XKO A;  1OIS A;  2HTJ A;  4AC0 A;  2RQP A;  4BL0 B;  5HLT A;  1ETV A;  1PUF A;  2O8K A;  3I3L A;  4HBL A;  5D5W B;  2JA7 J;  3OL3 A;  2LF7 A;  4UXN A;  3BPX A;  1Y0N A;  1W0T A;  4EJT A;  3DEW A;  5LHG A;  4M3B A;  4FQG A;  3HM5 A;  3FMS A;  3KCC A;  4B09 A;  1ZAR A;  1H9G A;  1J5Y A;  3R0A A;  5KVR A;  1YQA A;  1TQM A;  3B73 A;  2Y9Z A;  4KJZ A;  4A0Z A;  2I10 A;  4E6K G;  4D5F A;  2ZO4 A;  1XS9 A;  3V8J A;  1TT0 A;  2AXT C;  5EGO B;  1DU6 A;  1FIA A;  2F48 A;  2KZG A;  3CDI A;  4MIM A;  4B3A A;  2BVL A;  3H9J A;  5M5X J;  5LGT A;  2A6E F;  1BOB A;  3WTS C;  1HW2 A;  1OYW A;  1DGW Y;  2RDP A;  5HOD A;  1SFE A;  1NK2 P;  2LTP A;  5FB2 A;  3BZC A;  4BEH B;  3HOV J;  2X1E A;  1P4X A;  1BR4 A;  3RPU A;  5EJC A;  5HLH A;  3BTC A;  1RZ4 A;  3BG5 A;  2WAQ N;  4ZYH A;  3OYC A;  2V6E A;  2R7Z J;  2DA6 A;  2OBP A;  2K7L A;  2K9N A;  1UCR A;  4ZH4 F;  3WOD F;  2ME0 A;  2CW7 A;  2JUC A;  5IT3 A;  2WAF A;  4XM3 A;  3LA3 A;  3T1B A;  3BR0 A;  4OIR F;  4CCJ A;  3I59 B;  2GXA A;  2VIX A;  2STW A;  4EQQ A;  1OFC X;  3FM5 A;  2TRT A;  3HBL A;  2HI3 A;  2GXG A;  4BHP A;  5EG0 A;  4L0Z B;  3EYY A;  1UB9 A;  3MMY B;  2XB0 X;  1J09 A;  1ZGW A;  3I4P A;  1UG2 A;  2MSY A;  4O5V A;  4YFN F;  1YIJ I;  5IYD J;  1OCR H;  1W7P A;  2E60 A;  4XQF A;  4CSW A;  2JMW A;  1SD5 A;  3LSR A;  4A3E J;  3DKY A;  3F72 A;  1IN5 A;  1Z1D A;  1WHU A;  3CJR B;  1JHF A;  4LB5 A;  2F5F A;  2L7F P;  2NS8 A;  2OUM A;  1WFX A;  3F6O A;  3MKW B;  1FMW A;  2BHZ A;  1O7F A;  1CF7 A;  1Z7U A;  1E3P A;  5GAG J;  2K9M A;  5GTH C;  3RJP A;  3OYH A;  2P4W A;  2DMP A;  2B9S A;  1Z6T A;  4GYG A;  3EUK L;  4BY1 J;  4J19 A;  4HA8 A;  5B5E C;  1R1U A;  3OYB A;  2QVO A;  4W1U A;  2STT A;  3OYD A;  2YUS A;  4WK8 F;  3ZQG A;  2E2H J;  3E5U A;  4II2 A;  2OCE A;  1G2H A;  1AOY A;  2K5C A;  1XGN A;  2O3F A;  1D8J A;  3CME I;  1TQP A;  2LNB A;  2RRE A;  4MTE A;  5GTI C;  1MSE C;  5FLX K;  1WJB A;  1GVJ A;  2HXO A;  3JRA A;  3W2A A;  1RRJ A;  1WI3 A;  4PSX A;  1OKR A;  1V55 H;  1P7I A;  1V54 H;  5ED4 A;  3AFH A;  2UUZ A;  3CZ6 A;  4XRM A;  3WTU C;  1X3Z B;  3S15 J;  3GTM J;  3HOX J;  2D5V A;  1XDU A;  1S29 A;  2ELH A;  4I0A A;  3HOS A;  3HKZ N;  1SAN A;  1WI9 A;  2FBH A;  4RB3 C;  3TMO A;  2OF7 A;  4BQA A;  5FFX A;  3BWG A;  1USS A;  4IHW A;  1BIA A;  2E1O A;  5E20 A;  2EZK A;  5BQT A;  5D5X B;  3BT9 A;  1JJ8 C;  3QPT A;  3KX2 A;  1NG7 A;  2AQF A;  3H5R A;  1P4W A;  2UZK A;  1MDM A;  3LMM A;  5L3C A;  4NQW A;  3HG9 A;  2F4M B;  3CUO A;  2EZH A;  1LJ9 A;  3JRD A;  2DBB A;  3IKT A;  1MH3 A;  1HQC A;  2EK5 A;  3WU1 B;  4BE0 A;  4HF1 A;  4FT8 A;  2ISZ A;  4IVN A;  5CVI A;  4U0W A;  2A69 F;  3DF8 A;  3HOT A;  2ZNZ A;  4YEL A;  4N4N B;  1HBX G;  3B02 A;  3ROU A;  2D2W A;  5C4J J;  2GAU A;  2EZL A;  1MBH A;  4B4C A;  4ESF A;  3GBG A;  1XMA A;  2FNA A;  1WJE A;  2K3P A;  2H27 A;  1YOV B;  4YG2 F;  4N9H A;  2AHQ A;  2K4J A;  4BXU A;  1JUM A;  3CP2 A;  1T38 A;  3DLA A;  4BNC A;  2Z99 A;  3TBI A;  1MBE A;  4UUS A;  4OMZ A;  5F1J A;  3MKY B;  2WB1 A;  2NVQ J;  2DTZ A;  1WRJ A;  4IOC F;  2QQB A;  2P7V B;  3M4O J;  3OYN A;  3T8R A;  1FT9 A;  2V9V A;  2DDB A;  1IN8 A;  1Y8Q B;  2QEX I;  4G6D A;  1ETX A;  2VN2 A;  3ZGK A;  2DI3 A;  2RVC A;  3O8G A;  3HIF A;  4IQJ A;  5F0F A;  4BHC A;  4JYK A;  4M3D A;  2LY9 A;  3E6D A;  2B7E A;  1G8X A;  1R5G A;  2MA3 A;  5L3G A;  4MEX F;  4BQN A;  2R7D A;  5HNF A;  2D1H A;  4OOI A;  6PAX A;  4DYR A;  2Z33 A;  3I55 I;  1VQK I;  1U9O A;  2K40 A;  4XBF A;  4RLF A;  4ESB A;  4KIF A;  4P1W A;  4XLF A;  1ZGA A;  3F8C A;  3CF5 F;  2GOM A;  4RDU A;  2CS3 A;  4EMS A;  2L3D A;  2W48 A;  3OYK A;  2JUG A;  3Q9V A;  2LP0 A;  4W97 A;  1XGO A;  4NDL A;  1EJ9 A;  4DIQ A;  3UNG C;  2O8X A;  2FX0 A;  2F5V A;  2YSR A;  4DGW B;  2OD5 A;  5JI6 A;  1JE8 A;  5C3E J;  2YR2 A;  5CVJ A;  5H20 A;  3RQ4 A;  2HVR A;  3GZ6 A;  1KQ8 A;  4YRV A;  3QQA A;  1X19 A;  4HF2 A;  2HZT A;  4ZZD A;  2X1C A;  1SMY F;  3BG6 A;  2LVS A;  2ICW G;  1NH3 A;  3QPH A;  1FYM A;  3WU0 A;  3FHN A;  3EUH A;  2ESN A;  4HOB A;  1BI1 A;  3WTX C;  1O7L A;  1N75 A;  4GRI A;  1WJF A;  2PLY A;  1U5T C;  1VQ9 I;  3FXR A;  1R23 A;  3MFK A;  2WAD A;  1T8I A;  2LSO A;  3CCV I;  3ZXS A;  3L2V A;  1TQI A;  5LRS A;  2H09 A;  2OPT A;  1ZRF A;  1JKQ C;  2W1O A;  4HRI A;  2Y31 A;  2G7U A;  4CZZ A;  3J81 Z;  4CDG A;  3G73 A;  1VQ8 I;  4LMY A;  4C3I J;  1XSX A;  2F4I A;  3HC7 A;  4CYD A;  3HL2 A;  1D1C A;  4QWQ A;  2FMY A;  4AD9 A;  4RM3 A;  1UFM A;  2ZME A;  1ZR2 A;  3OYG A;  3J7A O;  1IRG A;  1S9H A;  5F6F A;  3JRG A;  4RGU A;  2CRG A;  3NAR A;  4I2O A;  1QVU A;  2DN0 A;  2H6C A;  4KA4 A;  4BHB A;  4I6Z A;  3S93 A;  4GYI A;  2MLG A;  5F64 A;  3H5A A;  1IF1 A;  1FSH A;  3CQZ J;  4MFD A;  1N78 A;  5GAD J;  4CYC B;  4ON0 A;  1WJ5 A;  2MLK A;  2JSC A;  1JT0 A;  3ISP A;  4I98 B;  3DLL F;  3KLN A;  2LMD A;  1QPM A;  2L4A A;  2CFX A;  5FRN A;  2HFH A;  3DKW A;  2XAQ A;  1R58 A;  2FOK A;  4I0B A;  3AG4 H;  3I56 I;  1K61 A;  3VPR A;  2LBF A;  2HVS A;  3SFZ A;  4EVI A;  1V5E A;  1D1A A;  5B3S H;  1ETK A;  3HHG A;  3HPG A;  2FXA A;  2GWR A;  3PSI A;  2IGO A;  5TGT A;  3LNQ A;  1JKP C;  2HOE A;  3UR3 C;  1EF4 A;  1LE8 A;  4M71 A;  1SD4 A;  4F52 A;  1T6S A;  1OMI A;  1KQ9 A;  1GVD A;  3GWZ A;  4A6E A;  1ZG5 A;  1SFX A;  2QM3 A;  5GP9 A;  2CG4 A;  2CV2 A;  2X9D A;  1XD7 A;  4BEH A;  1G6N A;  3SXY A;  4NHJ A;  2IW5 A;  4KIS A;  4BJ5 C;  5KK1 A;  2KT0 A;  3PIP F;  4PCQ A;  3ZMV A;  3L1P A;  1I3Q J;  1RI7 A;  2HEO A;  1V5G A;  1IJW C;  5IYB J;  2QBY A;  3GTG J;  2IP2 A;  1U2W A;  4HDU A;  2IA0 A;  5HVQ C;  3LA2 A;  1FLI A;  3JRC A;  1D3Y A;  1UHS A;  1FIP A;  2KIF A;  1WZ2 A;  3HRM A;  2BBY A;  3QP5 A;  2LKX A;  4Y15 A;  4HAM A;  2AS5 F;  4A3D J;  3OYA A;  3W6J B;  5L3B A;  4N9I A;  1FBQ A;  1KON A;  4Q4Z F;  4M72 A;  2EFW A;  5HDK A;  5E1Z B;  3M8J A;  4HX4 A;  3U1D A;  3FBN B;  4IOA F;  3BZK A;  2L7K A;  2GIV A;  4BQO A;  3CD6 I;  4A0Y A;  4EJO A;  4NBQ A;  1T0F A;  2E34 A;  3BR2 A;  4PK4 A;  2YU3 A;  2DA5 A;  4AIH A;  2ID6 A;  2PBI A;  1SFU A;  3ECO A;  2L01 A;  4FE7 A;  3BR3 A;  3G1L A;  1LQ1 A;  1IDY A;  1DGR M;  4HSR A;  1UAA A;  2OC6 A;  3LQQ A;  5LD2 C;  5K7F A;  1HKQ A;  1TP4 A;  3PNY A;  4CCL A;  4EJW A;  1FJL A;  3BTJ A;  2LR8 A;  2GA2 A;  1ON2 A;  2LK2 A;  4XLA A;  2OU2 A;  4A12 A;  2DT5 A;  2W00 A;  4LK1 F;  3CC2 I;  3K9T A;  2WWY A;  3BP8 A;  3TP3 A;  3DPU A;  5KNL A;  2RNJ A;  3FKI J;  3RKQ A;  3S17 J;  2VJ4 A;  1MBG A;  2HXI A;  1ZEL A;  3PNT A;  1T2K A;  4U88 A;  2O6G E;  4V2F A;  5K5R A;  2TCT A;  4A3M J;  3L7W A;  1WJA A;  4UB6 C;  2LC2 A;  3EUA A;  3MCZ A;  1PP7 U;  2VQG A;  3VYR B;  1K78 B;  3S1R J;  3ERM A;  3OYM A;  2E1N A;  1OR7 C;  2BXZ A;  3ULQ B;  3MEX A;  3CCE I;  5K5O A;  4LIU A;  3CMA I;  3KPH A;  5FGM A;  2VKD A;  4S04 A;  2IXS A;  4RMN A;  1YO5 C;  1W5S A;  2R7V A;  1MW7 A;  5IT9 Z;  1E0E A;  1KU9 A;  3NRV A;  2R7X A;  3CC4 I;  2BGC A;  4HLY A;  2VC0 A;  2FNP A;  2VBY A;  4DJA A;  3DPT A;  3CDL A;  1S3J A;  4WXD A;  1MMN A;  1UJ8 A;  1FY7 A;  3AG1 H;  3IWZ A;  1E2X A;  3DQV C;  1BW5 A;  3GVA A;  5M5W J;  4L5I A;  1DQU A;  2HNH A;  4FTH A;  1ZQ3 P;  3RI4 A;  2BZT A;  1BOA A;  1XMK A;  4L5E A;  4EV0 A;  4JX5 A;  4E7L A;  2VPL A;  2XAH A;  1YYV A;  5GAE J;  4DW6 A;  1J7K A;  2DFI A;  5DS9 A;  2WY8 Q;  3OR2 C;  3W2V A;  2M0M A;  1FP1 D;  1Y6I A;  2B0L A;  3FK7 A;  1K4S A;  2BVM A;  5TJJ A;  3DWL E;  1LDK B;  2MAB A;  2OV7 A;  5DD4 A;  5E79 C;  3GLL A;  4GXO A;  4XOR A;  1VQP I;  2KQR A;  3ZMS A;  3ASO H;  4M3E A;  2H6B A;  1JTY A;  3LSM A;  5IT9 K;  2HQN A;  1K6Y A;  5KHD A;  4BU2 A;  2KJB A;  2BYV E;  1Z3X A;  2YPR A;  1GV5 A;  2CQX A;  3VSL A;  1KU3 A;  3GTO J;  2DOD A;  4UVB A;  5TIS C;  4XID A;  3KYC B;  4UV8 A;  2X6X A;  3Q0U A;  4QPQ A;  2LYC A;  2R4G A;  4XRS G;  2WY7 Q;  2NOG A;  3TL4 X;  4DYQ A;  1K4T A;  3R0J A;  1KYW A;  2Q0O A;  3SZG A;  4G8X A;  4L9V A;  1RKW A;  1X4P A;  1EKE A;  3LWF A;  1ETW A;  5CQG A;  1MBK A;  1I1G A;  1GV2 A;  2QQA A;  4J01 A;  5E17 F;  1UMQ A;  3DKX A;  4XN0 A;  2FD5 A;  1YE9 A;  1XMX A;  3G6E I;  2HYJ A;  1YX5 A;  2R7F A;  1R9T J;  3GTK J;  4PFP A;  4WCG A;  3I0T A;  2CSO A;  2WAQ A;  2LOO A;  5CQE A;  4N0B A;  1Z05 A;  1AKH B;  2XPV A;  1TT5 B;  3MZ8 A;  2GXB A;  1J2X A;  2IA2 A;  2L7M P;  3BY6 A;  4IHX A;  1RKT A;  2PMH A;  1ZN2 A;  3I4N J;  5HDG A;  2X85 A;  2QSF X;  3MD2 A;  4V2G A;  4L9N A;  1K83 J;  1KGS A;  3KZI C;  3I53 A;  3K4N A;  2LKS A;  1TW2 A;  1ZLK A;  1I6H J;  3M9A A;  3O6B B;  5IYC J;  3UKG A;  3VB2 A;  2NAZ A;  3O8H A;  3NWS A;  4A93 J;  3VFZ A;  1FYK A;  2W85 A;  4HNT A;  4LG0 B;  2EZI A;  3KP4 A;  1TNS A;  3JW4 A;  1Q1H A;  3BZ6 A;  3TO6 A;  2HVQ A;  4FCY A;  1XG1 A;  1W36 D;  4XNF A;  5IPA A;  2MG4 A;  1G4D A;  4CCO A;  5ERI A;  1LEB A;  1REP C;  3SEZ A;  3X2Q H;  2QKM B;  1SD7 A;  3OWT A;  4MQV A;  1EH7 A;  2VXD A;  4XIC A;  1B4A A;  1O3T A;  3IKV A;  3KP5 A;  2KDZ A;  4RB0 A;  4PGH A;  3HHH A;  5DM6 F;  4UVC A;  4P96 A;  4PJL A;  3KE2 A;  2LY1 A;  3BJO A;  2QZ8 A;  3KEY A;  4G7Z F;  2F2E A;  3D0S A;  4L5J A;  3KIO A;  1Y56 A;  5JHF A;  1X1B A;  5KCM A;  1JTX A;  1SD6 A;  2MH2 A;  1MMD A;  3CUQ A;  4FE4 A;  3WE3 A;  2DTR A;  3GTJ J;  1UG0 A;  4RGR A;  1E3O C;  2CFO A;  4Y3O A;  5LHH A;  4ZDO A;  4II3 A;  2PEX A;  3F8N A;  3GME A;  4G7H F;  4EJV A;  1MND A;  2HOA A;  3DU6 A;  2DW4 A;  3IHU A;  2LH9 A;  2V4J C;  5H2F C;  4K2E A;  4LGW A;  3CJN A;  4ETS A;  1R6R A;  2OTL I;  5CVU A;  3P5J A;  4GDF A;  1YTY A;  4PZJ A;  5BPD A;  1APL C;  5BOX A;  4BBR J;  1G3Y A;  3K70 D;  2R5Z B;  4RAF A;  1OCP A;  3GX4 X;  3HKZ A;  3RQI A;  1A5J A;  3OOP A;  5DM7 F;  3SZP A;  3MN2 A;  2VAS A;  2UWM A;  1QQI A;  2ZSH B;  3FXQ A;  4AID A;  3HDD A;  3K4B A;  4M73 A;  3QOP A;  3BG9 A;  4TV7 A;  3WTT C;  1WJC A;  4ZYE A;  2M8E A;  2XF7 A;  3S1M J;  4E7S A;  3HSF A;  2XAJ A;  5F27 A;  2GIZ A;  2HPM A;  1RR7 A;  1EH6 A;  4FHT A;  1MGT A;  1S7E A;  3LSK A;  4Q47 A;  4EJU A;  2KIU A;  1BC7 C;  2PJP A;  2VON A;  3F9K A;  2CUZ A;  1SVM A;  3KP2 A;  4BS9 A;  1HOM A;  4B47 A;  2QWW A;  5J40 A;  4RAG A;  4MTD A;  3HOY J;  2V79 A;  3GZN B;  2COM A;  3BQY A;  4M9X A;  4MQ9 F;  2Y2Z A;  3QOD A;  2EIJ H;  5FLX Z;  3IH3 A;  2JTV A;  1P92 A;  4HW0 A;  2FBK A;  1BJA A;  2ECC A;  5C4X J;  3DTE A;  1H89 C;  3FXJ A;  4KT6 A;  1YX3 A;  2BHY A;  2VBZ A;  5E3N A;  2WV1 A;  3OYI A;  1TBX A;  2KP6 A;  2R5Y B;  4Y13 A;  3A03 A;  4F7Z A;  1FTT A;  2EIN H;  2XAS A;  4LLN A;  1G59 A;  5J3L A;  3MKL A;  3DU5 A;  4QSH A;  2EB7 A;  2QEN A;  1YW7 A;  2MC4 A;  1TNT A;  2WA0 A;  3G2B A;  1IV6 A;  2E1M B;  4ITV A;  1X3U A;  3T5X A;  4KIG A;  2QA4 I;  1IUY A;  1FEX A;  4ZYA A;  5DV5 A;  1WVR A;  1BI0 A;  2TDX A;  3NWT A;  4E4H A;  3COA C;  2R7O A;  5LLQ A;  4IEJ A;  2RC4 A;  3M8E A;  4YIR X;  4WWC A;  1W0U A;  3HOU J;  4YFK F;  1YS6 A;  2VC1 A;  3NQO A;  4M9S A;  2FE3 A;  1IRZ A;  3FKJ A;  3ESW B;  3VSK A;  1VFC A;  3WHC A;  3H0G J;  1YI2 I;  3P7N A;  5EEH A;  2CGP A;  3FMQ A;  2GM4 A;  2VE9 A;  3ZQF A;  1EA3 A;  1STZ A;  1U9N A;  2FRH A;  4XKW A;  4LFU A;  4F91 B;  1QNT A;  3DTK A;  1WQ2 A;  3V8L A;  2M7A A;  3TOA A;  3VYS B;  4HEA 2;  2M8G X;  1TWH J;  4GO1 A;  2IS2 A;  4E70 A;  1S6L A;  4IPA A;  3SEQ A;  3WTZ A;  2L54 A;  1T98 A;  5ICF A;  3VOD A;  2DA3 A;  2GQQ A;  1IG7 A;  2JQ7 A;  2MC3 A;  4P9F A;  1F43 A;  1G3S A;  3FIW A;  5ILS A;  1ZKG A;  1YS7 A;  2DK5 A;  2RAE A;  3L9F A;  1L0O C;  5CPR B;  2ZNY A;  5F08 A;  3S32 A;  2ZJR F;  2XVC A;  2KRC A;  1B8I A;  5DCM B;  1O3Q A;  3PQK A;  2P5L C;  4A0X A;  1NTC A;  4KDP A;  2D1V A;  2HPI A;  3HSE A;  4ZJZ A;  3GW2 A;  3BR6 A;  5HDN A;  3R4K A;  2CQN A;  4LIV A;  2PQ8 A;  2AO9 A;  4A3K J;  3CLO A;  2KPM A;  3Q5F A;  4XLE A;  3QYE A;  1UHM A;  2JVH A;  1RPW A;  2EJR A;  2HTS A;  2DQR A;  2DJI A;  1FNN A;  2XSD C;  4QTR A;  3PJR A;  2QF7 A;  3TOB A;  2PFB A;  4B44 A;  4X1E A;  1XSV A;  1O57 A;  2IVM A;  3QPL A;  4HZF A;  4QLC U;  2XAG A;  1H8A C;  5FRM A;  2X0L A;  3F8M A;  1IDZ A;  5GAH J;  1XCB A;  5EZG A;  1FSE A;  3CCR I;  3V42 A;  2M45 A;  4ZC3 A;  1J9I A;  3IH4 A;  3I4M J;  4A3C J;  4F92 B;  2CQQ A;  2HQR A;  4LJZ F;  1HW1 A;  3IP4 B;  1RIO H;  4IKF A;  3LSP A;  1CQT A;  1DPU A;  2DAO A;  4BBS J;  3Q0W A;  3CJQ B;  2VB6 A;  2VQC A;  2JRM A;  4NC7 A;  2GZW A;  5JHU A;  3HYI A;  1JKR C;  1X58 A;  3V7R A;  2G9W A;  1HKS A;  2UXX A;  3BOQ A;  2P81 A;  1GXP A;  1SVO A;  3K10 A;  1HA8 A;  2IS6 A;  2KZV A;  2Y0S A;  4H4K C;  4U87 A;  3E6M A;  1QZE A;  3FXK A;  2LFB A;  3DV8 A;  5D5U B;  3CC7 I;  3PQJ A;  4XOP A;  1L3L A;  3K69 A;  4XLN F;  4E7I A;  1VI0 A;  2ZXJ A;  4C3J J;  2HKO A;  3MZY A;  3REO A;  4H0E A;  3HXL A;  2XAF A;  2JJ7 A;  2KDO A;  3DEU A;  2O0Y A;  2XB5 A;  4HX8 A;  4XL9 A;  1CGP A;  4C2U A;  2GBY A;  4AVP A;  4J00 A;  2VOD A;  1D5V A;  3OOU A;  5A2Q K;  2KRF A;  2H8R A;  3L00 A;  4BDY A;  3ABL H;  1ONV A;  3CES A;  3FBI B;  4XLP F;  1ETQ A;  1FX7 A;  3F21 A;  3QP6 A;  5ICG A;  3O2P E;  4IZZ A;  3OIQ A;  2O03 A;  4YII A;  5E1W A;  2YU9 J;  1BM9 A;  1HXD A;  2HGC A;  3T8T A;  4AVZ A;  3HUG A;  4HDV A;  3WG9 A;  1FTZ A;  1JUS A;  1ON1 A;  4KIT B;  2XC7 A;  4AYB N;  2NVY J;  4ZYD A;  4R1H A;  2FQ4 A;  2DT7 B;  5ILU A;  3MQ0 A;  1A6Q A;  2ZCW A;  1Y1W J;  2R93 J;  4UHT A;  4D0P A;  3PM1 A;  1YJN I;  4KMU X;  2UXN A;  3PUB A;  4P9U A;  3AKZ A;  4I7H A;  4ENN A;  1MD0 A;  1FPQ A;  1UZC A;  4A2U A;  2EFQ A;  4I02 A;  3EUH C;  1AA7 A;  3S1N J;  2DDA A;  4RAZ A;  3K4L A;  1P4A A;  1XGM A;  2DQL A;  1ZLJ A;  3DP7 A;  1DP7 P;  1I6X A;  2ME6 A;  2JA5 J;  4D9J A;  3SFI A;  2O9L A;  4E7K A;  5TRD A;  3HB9 A;  4IQ4 A;  2EA4 A;  3ZCO A;  5FRO A;  4R79 A;  1GLN A;  1SFO J;  3CF2 A;  2Q2E B;  4ENJ A;  3ABK H;  5LGU A;  4C30 A;  4Y33 A;  4EGZ A;  4OWR B;  2Y30 A;  2QLZ A;  1GDT A;  2ZME C;  2N8G A;  1ACI A;  4BJT A;  1B9M A;  4IHT A;  1X4O A;  1Q1V A;  4AIJ A;  4Y7N J;  5DUI A;  2ZJ2 A;  2BE5 F;  4XRS A;  3GFJ A;  4ENM A;  3IUO A;  2JK3 A;  3CO7 C;  1TWF J;  4I99 C;  1PP8 F;  4PUS A;  2CUJ A;  5F0H A;  2E2J J;  3F0C A;  3I58 A;  1IXS B;  1PVE A;  4UV9 A;  3OSG A;  3V7S A;  4A3G J;  5CVV A;  4KUM A;  4DNC A;  3A01 B;  3KP6 A;  4RS8 A;  1OCC H;  3OIO A;  2M34 A;  1B9N A;  2HQ5 A;  2VJ5 A;  4HQM A;  3H36 A;  2K3F A;  3SDG A;  4AM3 A;  2CYY A;  2W25 A;  4EM1 A;  2DOA A;  2DPD A;  5JVG F;  1B72 A;  2DT6 A;  2EIM H;  5HLI A;  2NVU B;  4BE1 A;  2PMU A;  2XGX A;  1LB2 A;  3TW6 A;  3PFY A;  2Y0S N;  3M8F A;  3OMY A;  4M6X A;  3M1E A;  4MFE A;  4IXA A;  3OY9 A;  1D5Y A;  3FMR A;  1HC8 A;  5BNG A;  3HZJ A;  1WPK A;  2BV6 A;  2CH0 A;  4LLG F;  1SEU A;  2JA2 A;  4JX4 A;  5KAI C;  3BR5 A;  5DDG A;  4KIB A;  3JAM Z;  2LF8 A;  1OYI A;  4IJA A;  5D4S A;  4U0Y A;  1R49 A;  2VOP A;  4A3L J;  4B3X A;  2R5Z A;  2A3S A;  4CO8 A;  1LNW A;  3HRU A;  2CUE A;  2XGD A;  2DA1 A;  4XSX F;  5EGO A;  4CCM A;  1PUF B;  4UUV A;  2XF6 A;  3BC8 A;  2NVT J;  3KZZ A;  1U8B A;  1V3F A;  1RET A;  2EFN A;  1OCZ H;  2VE8 A;  1JGG A;  2ZKZ A;  2VQL A;  2V1D A;  2DPU A;  4JP0 A;  4Q5S F;  5FKL A;  1T33 A;  1TTY A;  1P6R A;  3G71 I;  4PGG A;  4PFO A;  3VYU B;  3HGG A;  3BG3 A;  2V1N A;  2M5W A;  4HX7 A;  2W24 A;  2IJL A;  3ML6 A;  3OYE A;  4QIW N;  3I9V 2;  1A6I A;  4G12 A;  4A3I J;  3I59 A;  3LAP A;  2BY1 A;  3QPS A;  1R7J A;  4U7D A;  1LVA A;  3P9K A;  2ZFU A;  5H6R A;  2YS9 A;  3PL8 A;  5JLW A;  2DCE A;  4ESJ A;  4NC8 A;  2H1K A;  3FF5 A;  2VLA A;  3JAM K;  4L0Y B;  2HR3 A;  5M5Y J;  2R7R A;  1JXS A;  3VEP A;  2Z3Y A;  5IY5 H;  1VZ0 A;  1RUN A;  4RGS A;  1T0F C;  3BJA A;  1FZP B;  4B8X A;  3LL7 A;  2R5Y A;  2LY2 A;  3KET A;  5FKN A;  5LFA A;  1RNL A;  3W6K B;  3IL2 A;  3M7G A;  4AIK A;  3KLO A;  1Y1V J;  3LOC A;  2OCC H;  2ELK A;  1Z21 A;  3VYT B;  2M1B A;  3JRE A;  4FET A;  1IO2 A;  1IXR C;  3VDX A;  1S8N A;  2CU7 A;  2BXY A;  1QU3 A;  3DBR B;  3FXU A;  3LA7 A;  1W7P B;  3QWL A;  4MO7 A;  2PN6 A;  2DFF A;  3JR9 A;  3FIS A;  5L3F A;  4I76 A;  2EV6 A;  1U78 A;  2X4H A;  3K4J A;  2FSW A;  5J6X A;  4XSZ F;  3DBH B;  3EDP A;  1R22 A;  5BPI A;  1Z77 A;  2HDD A;  1EH8 A;  1JI8 A;  2KMU A;  4EM2 A;  2QCO A;  1QVT A;  1NHA A;  1CF7 B;  4F55 A;  4RB2 C;  3GCM A;  2CV0 A;  2ZFW A;  2ZC2 A;  2P6T A;  3L2C A;  2MD0 A;  2IGK A;  2L4M A;  2OZU A;  3H9G A;  3CMY A;  1MMS A;  5J4Y A;  3N97 A;  3F8B A;  2BOL A;  2CW8 A;  2QKL B;  2V9P A;  3ABM H;  2XRO A;  2FU4 A;  2G0E A;  3RKW A;  3ZOB A;  5D6E A;  1VQO I;  1D0Y A;  1XSD A;  1VQ5 I;  2VUM J;  2HDW A;  2R7U A;  1OQY A;  3BTL A;  2NXN B;  3JCU C;  1MBJ A;  3JRI A;  2DK8 A;  3ZP5 A;  4CGZ A;  3JSP A;  4OMY A;  1ERD A;  3FXL A;  2VT3 A;  3H1C A;  4RAY A;  3BQZ A;  2DU9 A;  2DMN A;  2CO5 A;  1GUU A;  3LSG A;  5J47 A;  2IBD A;  2KIQ A;  4NNJ A;  2CV1 A;  2X6Y A;  4MGR A;  1WH5 A;  1X3W B;  3A0H C;  3EPZ A;  4D7N A;  2E7X A;  4DBR A;  3RZD J;  2A61 A;  3TQN A;  2H8W A;  1XPX A;  1VQM I;  3E3V A;  3BLY A;  2DLL A;  3KYL A;  3S3O A;  3PO2 J;  1QZZ A;  2ADU A;  3ABU A;  1GT0 C;  3DBL B;  3OSF A;  3TP0 A;  1JKO C;  2QSG X;  1ZRE A;  1K79 A;  3RDI A;  3OYL A;  1A36 A;  3I54 A;  2BY3 A;  2O7O A;  4PJM A;  3FZV A;  1MSF C;  3U9G A;  2V9K A;  2VPR A;  3ZRG A;  1FBU A;  2PMZ N;  3G3Z A;  3BRO A;  2M3A A;  2ETH A;  4XON A;  2LG4 A;  3WGH A;  5EEG A;  1BR2 A;  3WTV C;  4NQW B;  3LQR A;  4S05 A;  1JJ6 C;  1P9Q C;  2DOE A;  2L9V A;  3RYP A;  1X2M A;  3A1Y A;  3LFK A;  3SQN A;  4LIT A;  2VXZ A;  2M7B A;  2Y9Y A;  4LD5 A;  2A5W A;  4N4O B;  2QYO A;  4IX7 A;  4OU0 A;  2HDC A;  1PYV A;  1O4X A;  1AHD P;  4NB5 A;  4L18 B;  2Z16 A;  3DFG A;  4FX0 A;  3C18 A;  1X1A A;  1KZH A;  1SMT A;  1FOK A;  4M3F A;  4U0V A;  4D7M A;  3EET A;  3GYH X;  4C3H J;  2DJN A;  2IS1 A;  3NAU A;  2VL8 A;  4A6D A;  1J75 A;  2HYF A;  1BR1 A;  2CMP A;  2F5E A;  1VQN I;  2YX7 A;  1J59 A;  1LEA A;  2K9S A;  5EF6 A;  2WBM A;  2FF4 A;  3ZQ7 A;  1UHW A;  3E97 A;  1X1D A;  3ZMU A;  1VTN C;  1MJB A;  1LUJ B;  3QYB A;  2VKE A;  2HYG D;  2VJI A;  1BI2 A;  4G94 A;  5IP7 J;  5D4R A;  3TW7 A;  1I50 J;  1R5H A;  2RNG A;  1GHC A;  1D0X A;  3C7J A;  2P8T A;  1QHG A;  4OIQ F;  1BIB A;  1T39 A;  2F5D A;  5M3M J;  2MH9 A;  3V4G A;  2WC2 A;  3IRQ A;  1P2F A;  4JBA A;  3DXJ F;  5K1Y A;  4E7H A;  4BH9 A;  3N4M A;  1R00 A;  3Q0V A;  1HKT A;  3E1S A;  1DPR A;  1MMG A;  2NYX A;  1TL8 A;  1BBY A;  1EV7 A;  1WKM A;  3EQL F;  4WX9 A;  3J7A Y;  2JVG A;  3CLQ A;  2CJJ A;  4FAS D;  3S14 J;  4A5N A;  3RYR A;  3L09 A;  1SAX A;  2GLO A;  2I8D A;  3FXM A;  1VQ6 I;  2IGM A;  4GGG A;  5FO5 A;  3JRF A;  4HYE A;  3CCQ I;  1F9N A;  1KA8 A;  5GPA A;  1U6G A;  5IOZ A;  1I27 A;  4GFB A;  2Y75 A;  2KLO A;  2W4S A;  1ZRC A;  2COB A;  2F5C A;  3GFI A;  4D5C A;  3S2D J;  2JN6 A;  4WF2 A;  3IRR A;  3C2B A;  3CCM I;  1NK3 P;  3KP7 A;  1TZL A;  2HS5 A;  5FLV A;  4HV6 A;  4R8H A;  3CCL I;  3LSH A;  2IAI A;  4EGY A;  3CUQ C;  4OIP F;  1M1E B;  4XKB A;  3ABT A;  1PDN C;  3SHF A;  1QZY A;  1OPC A;  1W4M A;  3CDH A;  2IS4 A;  2FA5 A;  3HOZ J;  4CIC A;  1OCT C;  1RC9 A;  1U8R A;  4OIO F;  1ODD A;  1U5T B;  2ECB A;  4CYC A;  9ANT A;  4BGD A;  1ZG1 A;  2CW0 F;  4S0H B;  3WU2 C;  5E3M A;  2M0C A;  2A6T A;  2K02 A;  3LFU A;  4Y4R A;  3S2W A;  4IRH A;  3DCF A;  4L9T A;  4ANJ A;  3RKY A;  4V19 K;  2ZJQ F;  2NS0 A;  1HDD C;  4HV5 A;  2PJR B;  1X1P A;  1XX5 A;  2JZY A;  4LG3 A;  4FIS A;  2IEK A;  1ZH5 A;  1IC8 A;  4WXC A;  5KAF C;  4ZDP A;  1YW8 A;  5D5V B;  1S7A A;  5BMZ A;  3D5S C;  4CUG A;  4O6J A;  1WSU A;  1FP2 A;  2FML A;  1YIO A;  3ERE D;  1DDN A;  2OZ6 A;  2C6Y A;  2VBW A;  3DEE A;  3AG2 H;  1SC7 A;  3O3K A;  1F5T A;  4JQF A;  1F1Z A;  2LBF B;  4CCK A;  1DUX C;  2R0Q C;  1KYZ A;  1IZ1 A;  3KP3 A;  4JK1 X;  4AU7 A;  4ENK A;  1KU7 A;  3R6S A;  2DMT A;  2PG4 A;  1LDJ A;  1QPI A;  2L5Q A;  3K1P A;  1LE8 B;  3RPU D;  5FKO A;  1HF0 A;  1W1W E;  1Y39 A;  5L3E A;  3RPQ A;  5B1A H;  2WV0 A;  2V1X A;  4KN7 X;  4WXH A;  1MH4 A;  3GTL J;  2L0K A;  4HNU A;  2EFO A;  3G4S I;  2MGQ A;  2ZXI A;  3C1D A;  1ZAO A;  2E19 A;  2O5R A;  2QGU A;  3P9I A;  2KHM A;  4UVA A;  1QHH D;  4F3Q A;  1FOY A;  2CQ7 A;  3J80 Z;  1WWX A;  4L9J A;  1K7A A;  2QBY B;  5H6Q A;  2NS7 A;  4IHS A;  3ZQH A;  4BY7 J;  3OV8 A;  1E17 A;  1LPQ A;  3L2W A;  1YRN B;  1YJ9 I;  1W7P D;  2ZJP F;  3RCO A;  1MIJ A;  1RR8 C;  1O3R A;  3M3Y J;  2V6C A;  2B63 J;  1FOW A;  2V1U A;  2R7S A;  2E2I J;  1Y0U A;  2HU9 A;  3CCJ I;  1IRX A;  3OYF A;  4Z2Y A;  1R4N B;  2EA2 A;  3NEU A;  4RB1 A;  2KJC A;  3U2R A;  2XGE A;  3WG7 H;  4DOZ A;  3E6B A;  2K9Q A;  2WTE A;  4G7O F;  3OS2 A;  2I5U A;  3WGI A;  3S2H J;  3HJE A;  1HST A;  2EQR A;  3AAF A;  4EM0 B;  5LGN A;  2OAZ A;  2JWT A;  3B6A A;  3GFM A;  5E1X A;  1DP3 A;  2H94 A;  3BCA A;  3SDB A;  1MNM C;  1XTA A;  3RKX A;  3JTH A;  3J80 K;  1ETY A;  5EDN A;  2AQE A;  3LSI A;  5HLG A;  1RUO A;  2M30 A;  5CKT A;  1J0R A;  2XUB A;  1VQL I;  4YEJ A;  4AYB A;  5IP9 J;  2VKH A;  2VI6 A;  1LFU P;  2LDU A;  3GFL A;  1ZRD A;  2MFZ A;  2W7N A;  2R92 J;  3S16 J;  1LFP A;  1D8K A;  2LRE A;  2XRL A;  5E3L A;  2W82 A;  5JLX A;  1QA6 A;  4A3B J;  3RIR A;  1K78 A;  2FEZ A;  4JX6 A;  4ABZ A;  1S72 I;  1MZB A;  2KFD A;  3WGG A;  3F22 A;  3HEF A;  1D0Z A;  1SAU A;  4HG2 A;  3C2H A;  2IGN A;  1TW3 A;  2L9R A;  3C3W A;  3HTS B;  1I1S A;  2BY0 A;  2XGC A;  4KNY A;  1BI3 A;  2PX9 A;  1R36 A;  3H0D A;  3CMM A;  2X6O A;  2RKH A;  2HOS A;  2G7H A;  3K1N A;  4EAT A;  1ZTR A;  4P55 A;  3JSO A;  1QGP A;  2OQG A;  3WTY C;  2ID3 A;  4E7J A;  4C9Y A;  3W3C A;  2X1D A;  2XKP A;  1WGX A;  5C44 J;  2E35 A;  3BCB A;  2KKO A;  3TDU C;  5B66 C;  3MAJ A;  4RBO A;  2L7Z A;  2K9L A;  1JT6 A;  3LSJ A;  2A6H F;  5HOO A;  4CA0 A;  5D6F A;  5A2Q Z;  1T08 B;  2OJE D;  1Z91 A;  3BG7 A;  3ZMD A;  1IW7 F;  1IGN A;  1ULY A;  4M3G A;  1B1B A;  2EWN A;  1S7O A;  1WH7 A;  2A68 F;  1U0J A;  3JTG A;  3ZR8 X;  2IA1 A;  1MKM A;  2JRT A;  3WTW C;  4A69 C;  4XKC A;  2XHK A;  2OQR A;  1BJZ A;  3L2Q A;  3N05 A;  2ZBK A;  4CZC A;  3FK6 A;  3GTP J;  3ZPL A;  3B6C A;  4DBQ A;  5JFR A;  2BW3 B;  3PFI A;  3MKZ A;  3PNV A;  2E5Z A;  3HOW J;  3SJM A;  5FD5 A;  2Y69 H;  4UNO A;  4UY8 I;  2QQ8 A;  2X48 A;  2LRD A;  2DFH A;  3QU6 A;  1FMV A;  3PO3 J;  5CVR A;  2RQQ A;  2NNY A;  2F4O B;  2FUG 2;  2P7C B;  1HCR A;  4KYW A;  3K2A A;  3G1M A;  4A3J J;  3D5L A;  3FDY A;  4U7B A;  4PDK A;  1R1V A;  5CLS A;  3BPV A;  5EZH A;  3W6V A;  3GO5 A;  4M6Y A;  4XOT A;  2K85 A;  3HGY A;  3KFW X;  1Y8R B;  1E3H A;  4PJN A;  3Q9S A;  1LFB A;  3ZQI A;  3K6G A;  1JHH A;  2J5P A;  4AUX A;  3LAJ A;  4RA2 A;  5DUK A;  4B48 A;  3EYI A;  2KIS A;  3CCU I;  3MVP A;  1R4M B;  1AKH A;  1OCO H;  3OIP A;  3OL4 A;  5F04 A;  3QRF F;  3QAH A;  3K4K A;  2V26 A;  3OS1 A;  4HNV A;  2JT1 A;  4BXF A;  4E7Z A;  1C0W A;  1MJA A;  4IHV A;  4RGX A;  5DTD A;  2MBF A;  3MWM A;  2K27 A;  1W5C C;  1FOX A;  3PIO F;  1TWC J;  4G9Y A;  2HQA A;  3BTI A;  5ICE A;  3QOE A;  5K7H A;  1LDD A;  2RGV A;  4MNU A;  1R71 A;  2NOJ B;  5FD6 A;  3HSR A;  5AIP A;  5LHI A;  3GXO A;  2EIL H;  1VQ4 I;  4LG0 A;  5FLM J;  4ZYG A;  3AL0 C;  3IAM 2;  1B59 A;  3E6C C;  5M3F J;  1YG2 A;  3GZ5 A;  5JR3 A;  2X51 A;  5FFZ A;  4B43 A;  3WHB A;  5K7Z A;  4LOC A;  2ELJ A;  1BA5 A;  1IUF A;  3QU3 A;  4JOM A;  4LK0 F;  3H9Q A;  3ZQL A;  2RN7 A;  2R7W A;  4XLH A;  2A5Y B;  5HS9 A;  2P5K A;  1X1C A;  2NVX J;  4B1R A;  2VQH A;  5E8G A;  3S8P A;  2DO7 A;  1S5L C;  3F23 A;  2XPU A;  4KMF A;  2HZD A;  1WCM J;  2YX4 A;  4GCV A;  2JA8 J;  2E5N A;  1G3T A;  1YHQ I;  2M87 A;  2DMQ A;  5CJ9 A;  3I71 A;  2R3S A;  3QYF A;  3RZO J;  1DU0 A;  1U5T A;  5J8F A;  1TLH B;  1OLT A;  3FHZ A;  3VWB A;  2L2O A;  3IH2 A;  3TGN A;  3SYT A;  1QBJ A;  3K2Z A;  5ICC A;  4KT5 C;  4IF4 A;  2K86 A;  1IRF A;  2DA4 A;  4EEF G;  2FBI A;  2V7F A;  3GUD A;  5DCF A;  4X0G A;  2PJR A;  3A2K A;  2XV4 S;  1V4R A;  1FC3 A;  1ZK8 A;  2F6C A;  2JSP A;  3CUQ B;  1MMA A;  4IL6 C;  1N25 A;  1ORK A;  3PSF A;  1AU7 A;  4P5O A;  5F1R A;  1OYY A;  2O61 A;  2EH3 A;  3U1K A;  3S3N A;  3GTQ J;  2WB1 N;  1IXC A;  2KRH A;  3HRS A;  5HS7 A;  3BDD A;  2E7W A;  4HF0 A;  1FYL A;  3HPH A;  3JRB A;  1ZR4 A;  1R5I D;  2R7T A;  3ZQQ A;  3A02 A;  2EPF A;  4XRF A;  3TDZ C;  3R61 A;  4FX4 A;  4C2T A;  2L9N A;  2MW8 A;  3KEQ A;  4CH7 A;  3K0L A;  2AXL A;  3FWE A;  3J81 K;  3H92 A;  1ZG3 A;  2BY2 A;  1F4K A;  2LKP A;  1IV8 A;  3ZN0 A;  3CJT B;  2IRF G;  1ETO A;  2P6S A;  2JPB A;  2NRA C;  3A0B C;  1V5F A;  2Z5U A;  3H3U A;  2IT0 A;  2EBI A;  2LLK A;  3LST A;  2M4K A;  2PMZ A;  2ZXW H;  4UB8 C;  4DYC A;  5FJ8 J;  3J7Y J;  1VND A;  3H35 A;  2K4B A;  4YIF A;  5L3D A;  4RM2 A;  1Z9C A;  1GXQ A;  3CP8 A;  1PUE E;  2M9H A;  2OA4 A;  2UV1 A;  3TED A;  1OJL A;  1ZHF A;  2E1M C;  1YRN A;  4CXF A;  5AON A;  3E5X A;  3BJ6 A;  2MD5 A;  1LKX A;  2XPW A;  5EG0 B;  1HDP A;  4XKV A;  4LLL A;  1H0M A;  5AIQ A;  4AWX B;  1UST A;  5J8C A;  3FM3 A;  5GPC A;  2IPQ X;  1BL0 A;  3CO6 C;  2Z9O A;  1HW5 A;  2HKX A;  2DMU A;  3T0Y A;  3L2R A;  3D1N I;  2W57 A;  4NC6 A;  5F0C A;  3ECH A;  2FJ1 A;  1H88 C;  4XN3 A;  3SZT A;  3M1C A;  4HPQ A;  3IWF A;  3E0J B;  5IP6 A;  5D8K B;  3I64 A;  4ASN A;  1JGS A;  4I01 A;  4MHG A;  2WAE A;  4C2M J;  3F8F A;  5DD8 A;  4BKX A;  2XDV A;  4YFX F;  1W5T A;  4CCN A;  3TKY A;  3HRT A;  2XSJ C;  3CTA A;  2DOF A;  3KEO A;  2A05 A;  2D45 A;  1ZYR F;  2J5O A;  2X6W A;  2Q1Z B;  2A07 F;  2ISY A;  4G6T B;  5J1U A;  1O3S A;  4BAC A;  5E3O A;  3ZN1 A;  2ZB9 A;  1Z67 A;  2Z1D A;  2EFP A;  2W84 A;  1QRY A;  1Z3Y A;  3D5R C;  1XDS A;  1I39 A;  3C2G A;  1I3A A;  3G1O A;  2FQ3 A;  4XR6 A;  4Y17 A;  3S3M A;  5DCM A;  1N77 A;  5BS6 A;  4O3M A;  4BYY A;  1T56 A;  4D1Q A;  2NNN A;  4HQE A;  1TWA J;  5D8L B;  3CCY A;  2DFE A;  4BXX J;  2VT2 A;  1HSJ A;  4DZJ A;  1P7J A;  2DA7 A;  3IV5 A;  3M07 A;  4DQ2 A;  1X2N A;  2ESH A;  2EV0 A;  5K5Q A;  1B8I B;  1LVK A;  2Q8K A;  3L2U A;  1H9T A;  1XGS A;  1KQ0 A;  3PUF A;  4OIN F;  2QSH X;  4Y52 J;  4XLC A;  1KU2 A;  2CQK A;  1A31 A;  3S1Q J;  1PJR A;  1ITY A;  1FWZ A;  4XK4 A;  4ZZL A;  1TC3 C;  2RV8 A;  4BUP A;  2E71 A;  3ELK A;  3GLX A;  3Q3S A;  1MJ9 A;  5DYM A;  1OR7 A;  3AG3 H;  5LEK A;  3IAS 2;  1BW6 A;  3RSN A;  1MDM B;  4KFC A;  3J7Z I;  5LBQ A;  3GEZ A;  4I09 A;  2CUF A;  5LEJ A;  1G3W A;  1XCV A;  2HWV A;  1Z0X A;  2KL4 A;  1JUP A;  1NG6 A;  3TO7 A;  4ZTF A;  3I5U A;  1IN4 A;  2M2E A;  3V7C A;  1IN6 A;  1QO0 D;  1K6O A;  2BW3 A;  1MBF A;  4BE2 A;  4BJ6 C;  4IHY A;  1YIT I;  5E8I A;  4BAY A;  1AWC A;  1SFK A;  2VOO A;  5ILV A;  1TWG J;  2LD5 A;  5J4V A;  2P5V A;  1I5Z A;  3HTU A;  2ACJ A;  2VJJ A;  3E7L A;  4IRG A;  2L02 A;  2ZSI B;  4KN4 X;  1YW9 A;  1XC5 A;  1Z6R A;  2GA1 A;  2OTJ I;  4ZDL A;  4UUS B;  1YFH A;  2GOX B;  3DTI A;  4ZTJ A;  1RES A;  3U21 A;  4A5M A;  4BQQ A;  3KZY A;  5EYR A;  3ONQ A;  1XB4 A;  1D1B A;  5LRR A;  5DEQ A;  2VBX A;  4HST A;  3DPL C;  5FKM A;  3K4C A;  3H3V K;  2Z2S B;  4KIC A;  4G6Q A;  3W2W A;  4OAY A;  3RTR A;  3GF2 A;  3CCS I;  3H5N A;  2DYS H;  2QUF A;  3ZQC A;  2EV5 A;  2L9S A;  4Q48 A;  2R7Q A;  3OYJ A;  2VKV A;  3V8K A;  4HLX A;  2XF5 A;  2E36 A;  1SVL A;  3ASN H;  5CYV A;  4MEY F;  5JVT A;  1U3E M;  1IAW A;  5IOY A;  3HUG B;  4M74 A;  1ENH A;  2XRN A;  3H3Z A;  4Z6Y A;  1R1T A;  1ZGJ A;  1HLV A;  1W36 C;  4IRI A;  2PI0 A;  3WE2 A;  1T95 A;  2Q2E A;  1XN7 A;  5EEA A;  3K4M A;  1MNE A;  2Y48 A;  2H1L A;  3FX3 A;  2DXI A;  3ZMT A;  2CWE A;  3R60 A;  2JPC A;  3K7A J;  4UUT A;  3IC7 A;  4PJJ A;  3ZMZ A;  4PJ0 C;  3BR1 A;  2BEO A;  2ZXH A;  4LB6 B;  4A3F J;  2KIM A;  4MLO A;  4IO9 F; 
#chains in the Genus database with same CATH homology
 4V2F A;  4JX6 A;  4ABZ A;  3A01 A;  3HEF A;  2TCT A;  4A3M J;  1Q1V A;  4Y7N J;  4XRS A;  4X6A J;  2L9R A;  2JK3 A;  5J1R A;  1TWF J;  5F0H A;  2E2J J;  2XGC A;  3F0C A;  3OSG A;  3S1R J;  4A3G J;  3A01 B;  2X6O A;  2HOS A;  3OIO A;  3JRH A;  2M34 A;  5FKK A;  2HOT A;  1ZTR A;  2HQ5 A;  3SDG A;  2ID3 A;  4M6V A;  4DZP A;  1VF9 A;  5J1Y A;  1B72 A;  1WGX A;  5C44 J;  1F36 A;  2L7Z A;  4RBO A;  3TW6 A;  2JA6 J;  2Y0S N;  2DA2 A;  1JT6 A;  3LSJ A;  4MFE A;  1POG A;  1D5Y A;  5BNG A;  1B72 B;  1WPK A;  3CDL A;  4AC0 A;  4JX4 A;  1ETV A;  1PUF A;  2O8K A;  3BR5 A;  1IGN A;  4M3G A;  1BW5 A;  5M5W J;  2JA7 J;  4FTH A;  1WH7 A;  1ZQ3 P;  4A3L J;  1W0T A;  3DEW A;  2R5Z A;  4L5E A;  4M3B A;  4A69 C;  3HM5 A;  2CUE A;  2XGD A;  2DA1 A;  4JX5 A;  5EGO A;  1BJZ A;  1PUF B;  4DW6 A;  3FK6 A;  5DS9 A;  3GTP J;  2NVT J;  2Y9Z A;  3B6C A;  1U8B A;  1RET A;  2I10 A;  3FK7 A;  4D5F A;  1JGG A;  1XS9 A;  5EGO B;  1DU6 A;  1FIA A;  4JP0 A;  5M5X J;  4MIM A;  5FKL A;  4B3A A;  3HOW J;  1T33 A;  4M3E A;  3SJM A;  5HOD A;  1JTY A;  1NK2 P;  2LTP A;  3HGG A;  2X48 A;  3BG3 A;  3HOV J;  4QIW N;  1A6I A;  3BTC A;  4G12 A;  3BG5 A;  4A3I J;  3PO3 J;  1GV5 A;  2CQX A;  2WAQ N;  2R7Z J;  2DA6 A;  3QPS A;  4XID A;  2K9N A;  1HCR A;  3GTO J;  3K2A A;  2YS9 A;  2ME0 A;  3G1M A;  3Q0U A;  5JLW A;  4A3J J;  2H1K A;  4XRS G;  5EZH A;  2NOG A;  4DYQ A;  3BR0 A;  5M5Y J;  3W6V A;  3HGY A;  3HBL A;  1OFC X;  2TRT A;  1LFB A;  1RKW A;  2HI3 A;  3ZQI A;  5EG0 A;  4AUX A;  1ETW A;  2R5Y A;  1MBK A;  2XB0 X;  5FKN A;  1ZGW A;  1GV2 A;  1UMQ A;  1UG2 A;  2MSY A;  3MVP A;  1AKH A;  5IYD J;  1Y1V J;  3LOC A;  5F04 A;  2FD5 A;  2ELK A;  2HYJ A;  3LSR A;  2JMW A;  4A3E J;  4HNV A;  1R9T J;  3JRE A;  3GTK J;  4IHV A;  5DTD A;  2CU7 A;  2L7F P;  1AKH B;  2NS8 A;  2XPV A;  2L7M P;  4MO7 A;  4IHX A;  1RKT A;  1TWC J;  3I4N J;  3JR9 A;  3BTI A;  3FIS A;  5K7H A;  4I76 A;  1U78 A;  4V2G A;  1K83 J;  2DMP A;  1Z77 A;  2HDD A;  5FLM J;  1GDT A;  1I6H J;  2QCO A;  1QVT A;  4J19 A;  5IYC J;  4BY1 J;  3UKG A;  3O8H A;  4A93 J;  5M3F J;  4W1U A;  2YUS A;  3ZQG A;  2EZI A;  2E2H J;  5K7Z A;  3WHB A;  4LOC A;  3CMY A;  4FCY A;  1XG1 A;  1BA5 A;  1G2H A;  5IPA A;  1IUF A;  2MG4 A;  1MSE C;  2HXO A;  3ZQL A;  3JRA A;  2G0E A;  1WI3 A;  3ZOB A;  2NVX J;  4B1R A;  2VUM J;  3BTL A;  1P7I A;  1MBJ A;  3JRI A;  4XIC A;  2XPU A;  1WCM J;  4XRM A;  2KDZ A;  2JA8 J;  3GTM J;  3S15 J;  3HOX J;  2DMQ A;  3BQZ A;  2D5V A;  3RZO J;  2DMN A;  3LSG A;  1GUU A;  1DU0 A;  2IBD A;  3HKZ N;  1WH5 A;  1SAN A;  3IH2 A;  4D7N A;  3RZD J;  1JTX A;  2OF7 A;  4FE4 A;  3PO2 J;  4IHW A;  3GTJ J;  1GT0 C;  2E1O A;  2DA4 A;  4EEF G;  3OSF A;  3TP0 A;  2EZK A;  1JKO C;  1E3O C;  3BT9 A;  1JJ8 C;  2O7O A;  1ZK8 A;  2HOA A;  1MSF C;  1ORK A;  1AU7 A;  2EZH A;  2VPR A;  2EH3 A;  3JRD A;  1MH3 A;  2PMZ N;  3GTQ J;  2WB1 N;  1APL C;  4BBR J;  2R5Z B;  1OCP A;  3JRB A;  1ZR4 A;  1JJ6 C;  3RQI A;  1A5J A;  3A02 A;  5C4J J;  1X2M A;  3MN2 A;  2EZL A;  2MW8 A;  1MBH A;  4B4C A;  3HDD A;  3GBG A;  2Y9Y A;  2AHQ A;  3BG9 A;  1O4X A;  1AHD P;  1JUM A;  4MLO A;  3S1M J;  1ETO A;  5F27 A;  4UUS A;  2EBI A;  1MBE A;  1RR7 A;  5F1J A;  2LLK A;  1S7E A;  4M3F A;  2NVQ J;  4D7M A;  2DTZ A;  4DYC A;  5FJ8 J;  1VND A;  3M4O J;  4C3H J;  2DJN A;  1HOM A;  3NAU A;  2M9H A;  3TED A;  3HOY J;  1ETX A;  2K9S A;  3BQY A;  1OJL A;  2Y2Z A;  5EF6 A;  3O8G A;  5F0F A;  3IH3 A;  1YRN A;  4JYK A;  4M3D A;  2LY9 A;  2ECC A;  5C4X J;  1H89 C;  5E3N A;  2VKE A;  2XPW A;  2WV1 A;  5EG0 B;  1HDP A;  5IP7 J;  4DYR A;  2R5Y B;  3A03 A;  3TW7 A;  1FTT A;  1I50 J;  5GPC A;  1U9O A;  1BL0 A;  2K40 A;  5J3L A;  3MKL A;  2DMU A;  4QSH A;  3D1N I;  4RDU A;  5F0C A;  2W48 A;  5M3M J;  2FJ1 A;  1H88 C;  1IV6 A;  2LP0 A;  4W97 A;  4NDL A;  1FEX A;  5IP6 A;  3Q0V A;  2FX0 A;  4C2M J;  5C3E J;  4IEJ A;  1W0U A;  4BKX A;  3HOU J;  2CJJ A;  3S14 J;  1IRZ A;  1VFC A;  3QQA A;  3WHC A;  3H0G J;  2GLO A;  2GM4 A;  3ZQF A;  2LVS A;  1U9N A;  5J1U A;  3JRF A;  5GPA A;  5IOZ A;  5E3O A;  2ZB9 A;  4GFB A;  1QRY A;  2COB A;  2M8G X;  1TWH J;  4D5C A;  3S2D J;  2JN6 A;  3C2B A;  3G1O A;  1NK3 P;  5FLV A;  2DA3 A;  1IG7 A;  1F43 A;  1T56 A;  2IAI A;  2OPT A;  3FIW A;  1JKQ C;  1ZKG A;  2Y31 A;  2RAE A;  4C3I J;  5F08 A;  1B8I A;  1TWA J;  3HOZ J;  3CCY A;  1OCT C;  1ZR2 A;  4BXX J;  3JRG A;  1NTC A;  1P7J A;  2CRG A;  2DA7 A;  3NAR A;  4DZJ A;  3IV5 A;  2ECB A;  9ANT A;  1X2N A;  4CYC A;  1QVU A;  2DN0 A;  3BR6 A;  1B8I B;  4S0H B;  2AO9 A;  5E3M A;  2M0C A;  4I6Z A;  4Y52 J;  4A3K J;  3S1Q J;  3DCF A;  1TC3 C;  4XK4 A;  1ITY A;  1RPW A;  3CQZ J;  4MFD A;  3Q3S A;  4CYC B;  2XSD C;  1JT0 A;  1HDD C;  4QTR A;  2QF7 A;  4FIS A;  2IEK A;  4X1E A;  3QPL A;  1IC8 A;  1BW6 A;  1H8A C;  1K61 A;  3VPR A;  1IDZ A;  5EZG A;  2CUF A;  1Z0X A;  1ETK A;  1JUP A;  3IH4 A;  3I4M J;  4A3C J;  2CQQ A;  3LNQ A;  1JKP C;  2M2E A;  3LSP A;  1EF4 A;  1LE8 A;  1CQT A;  1MBF A;  4IHY A;  4BBS J;  3Q0W A;  2R0Q C;  1GVD A;  1JKR C;  1X58 A;  5GP9 A;  1TWG J;  2DMT A;  2X9D A;  2P81 A;  2LD5 A;  1QPI A;  1LE8 B;  5FKO A;  1HF0 A;  2KT0 A;  2LFB A;  3E7L A;  3L1P A;  1I3Q J;  1IJW C;  5IYB J;  1XC5 A;  4UUS B;  1MH4 A;  3GTG J;  3GTL J;  2L0K A;  1VI0 A;  2MGQ A;  4C3J J;  2E19 A;  1RES A;  2JJ7 A;  3JRC A;  5EYR A;  1UHS A;  1FIP A;  2XB5 A;  2GBY A;  3OOU A;  2NS7 A;  3ZQH A;  5FKM A;  4BY7 J;  2H8R A;  3H3V K;  2LKX A;  1ETQ A;  1YRN B;  4A3D J;  3M3Y J;  2YU9 J;  2B63 J;  3ZQC A;  2E2I J;  1FTZ A;  1JUS A;  4AYB N;  2NVY J;  2VKV A;  2FQ4 A;  2XGE A;  1Y1W J;  5IOY A;  2R93 J;  2K9Q A;  3BR2 A;  1ENH A;  3PM1 A;  2DA5 A;  3S2H J;  2ID6 A;  2EQR A;  3S1N J;  4FE7 A;  2JWT A;  3B6A A;  3BR3 A;  3G1L A;  1IDY A;  1HLV A;  5K7F A;  2ME6 A;  2JA5 J;  5EEA A;  1MNM C;  1FJL A;  3SFI A;  2O9L A;  1ETY A;  2LR8 A;  2LK2 A;  3BTJ A;  5EDN A;  3HB9 A;  3K7A J;  1SFO J;  5IP9 J;  4UUT A;  1LFU P;  2VI6 A;  2R92 J;  3S16 J;  3BR1 A;  3TP3 A;  2Y30 A;  3RKQ A;  3FKI J;  4A3F J;  2XRL A;  3S17 J;  5E3L A;  1MBG A;  2HXI A;  2N8G A;  5JLX A;  4A3B J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...