3HEFA

Crystal structure of the bacteriophage sf6 terminase small subunit
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 1 protein
publication title Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Viral protein
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hefA01
5JLWA 4A3JJ 4V2GA 1EF4A 5EDNA 4LOCA 1BL0A 5M5WJ 1LE8B 2EH3A 9ANTA 2VI6A 2R5YB 2XPWA 2M2EA 1CQTA 2NVYJ 4I76A 2DTZA 2FQ4A 3A01B 2O7OA 2X9DA 3NARA 2NS8A 4M6VA 2JA8J 4MLOA 5M3MJ 1ETKA 2VKEA 3HGGA 5IYBJ 2O9LA 2K9NA 2XB5A 3BTIA 4QTRA 5JLXA 1ETVA 5F27A 2HI3A 4D5FA 4JX6A 3JREA 1IC8A 3SFIA 1FIAA 4M3FA 1TWFJ 2N8GA 1HOMA 5C44J 2JA5J 1LE8A 5IOZA 2ID3A 4L5EA 2R5YA 2E19A 2HOTA 2CJJA 3A01A 1IJWC 3S15J 2JWTA 3BTLA 3S14J 2Y30A 4V2FA 5F1JA 1QVTA 5IP7J 2M0CA 5E3MA 4IHVA 2WV1A 1TWCJ 1GT0C 2FD5A 2L0KA 3H0GJ 1D5YA 3BR5A 1RR7A 5EF6A 5FJ8J 2R0QC 1AKHB 4IHYA 2XPUA 3TP3A 5IP9J 1ZR4A 3BTJA 3C2BA 1GV5A 3I4NJ 3S2HJ 3BQZA 1MH4A 2JK3A 1B8IB 2MW8A 1MBJA 2HXOA 3LOCA 3QQAA 5J1RA 2L9RA 1AHDP 2Y2ZA 3VPRA 4D7NA 1P7IA 1JT6A 4C2MJ 3GTGJ 2IBDA 2M8GX 4FISA 2IEKA 2DMUA 3QPLA 3M4OJ 5C4JJ 2K9QA 1AKHA 3W6VA 1OJLA 4DW6A 1I50J 1IDYA 3LNQA 2E2IJ 1FEXA 1I6HJ 4CYCB 2MSYA 2DMTA 4XRMA 1XS9A 3HOYJ 1A5JA 1B8IA 3FKIJ 3RKQA 3B6CA 1G2HA 2XGEA 3IH2A 4A93J 5E3LA 2DA1A 3JRGA 4BY1J 1FTTA 1XC5A 4A69C 2HOSA 2DA3A 2YS9A 2L7ZA 3GTJJ 1TC3C 2LY9A 2XRLA 1DU6A 3S16J 5F0CA 4NDLA 4AYBN 4DYCA 4CYCA 3FIWA 3E7LA 4Y7NJ 4B4CA 2E2JJ 1WGXA 3LSJA 4D5CA 4DYRA 1IUFA 2HDDA 1H8AC 5EZGA 3PO3J 3UKGA 5C4XJ 1E3OC 5FKLA 3PM1A 4RDUA 1UMQA 2DMPA 1FIPA 2EBIA 5DTDA 2CU7A 2JJ7A 4MFEA 2LKXA 2EZLA 5F0HA 2Y31A 1I3QJ 1HF0A 2CRGA 3HKZN 2H1KA 3NAUA 3RQIA 1QRYA 3WHCA 2X48A 3BR1A 1VFCA 3GTLJ 3MN2A 2FX0A 1WCMJ 4AUXA 4W97A 1YRNB 5IPAA 2R7ZJ 3F0CA 2OF7A 2TCTA 2NOGA 3ZQCA 3MKLA 1JKPC 2L7MP 3Q0UA 4UUSB 1H89C 4M3GA 3IV5A 1Z0XA 2LP0A 1UG2A 1APLC 3BR2A 4IHWA 2JN6A 2LD5A 2GM4A 2VKVA 3HM5A 5HODA 2AO9A 1YRNA 1SANA 5GPAA 3GTQJ 3B6AA 1GV2A 2NVQJ 1UHSA 5F04A 2Y0SN 2Y9ZA 1ETYA 4A3EJ 2LTPA 4UUSA 3JRFA 3MVPA 3FISA 5K7ZA 3LSRA 2B63J 1H88C 2LFBA 3BR3A 3IH4A 5GP9A 3OSFA 3HOUJ 4FTHA 3GTKJ 2R93J 1BW5A 1RPWA 5K7FA 2DMQA 2CQQA 3ZOBA 1B72B 2NS7A 3HEFA 1FJLA 1S7EA 2DA2A 1MNMC 1XG1A 4A3KJ 1FTZA 1BW6A 1ZTRA 2FJ1A 4JP0A 3TEDA 2XGCA 1ITYA 1OFCX 3BG5A 5FKKA 4DYQA 2WAQN 1JGGA 1GVDA 4UUTA 1Y1WJ 4A3DJ 2KT0A 2EZHA 1B72A 4DZJA 1HCRA 4M3DA 1HDDC 4XRSG 1WH7A 3TW6A 3BR6A 2HOAA 1U9NA 4A3GJ 3LSPA 4A3LJ 5J1UA 3GTMJ 1MSFC 5FLVA 2NVTJ 1R9TJ 3CDLA 5EZHA 2OPTA 4DZPA 3S1NJ 4IEJA 4FE4A 1JUSA 4S0HB 2DN0A 2QCOA 4JX4A 1LFBA 3Q0VA 1WH5A 3BTCA 3GTOJ 1JKRC 3FK6A 4EEFG 2ECCA 2CUEA 3S17J 2ZB9A 5M5YJ 1W0UA 4FCYA 4A3IJ 2TRTA 4A3MJ 1RKTA 1W0TA 2W48A 3HOWJ 1RKWA 2WB1N 3WHBA 4B3AA 1OCTC 2Y9YA 3FK7A 1GDTA 1MBFA 2G0EA 3SDGA 1K83J 2LVSA 1JTYA 2MGQA 5E3OA 2DA7A 1U8BA 2RAEA 2XSDC 3TP0A 5J1YA 2M9HA 2X6OA 3GBGA 1VNDA 5IYCJ 4D7MA 1MBGA 2PMZN 5M3FJ 2EZKA 4C3JJ 1ETQA 1ENHA 3BT9A 3JRIA 4Y52J 4MFDA 1BJZA 5IP6A 1LFUP 4MIMA 5FKNA 1SFOJ 1IGNA 1BA5A 4QIWN 4B1RA 3BQYA 1HDPA 1NTCA 5GPCA 1JTXA 1NK2P 4MO7A 2NVXJ 2D5VA 2I10A 1HLVA 3BG3A 2LLKA 3RZDJ 2XGDA 1NK3P 2JA7J 1IDZA 4XIDA 3BR0A 3G1OA 2E1OA 4G12A 1ORKA 2XPVA 5F0FA 3PO2J 3ZQIA 3JRHA 2HYJA 5EGOB 1F43A 3Q3SA 1X2MA 1ETOA 4XICA 1MBHA 5EYRA 1MH3A 1DU0A 4QSHA 5F08A 1VI0A 2MG4A 2R5ZB 2LR8A 3A03A 3DCFA 1QVUA 2GBYA 1X2NA 3CMYA 1K61A 1ZQ3P 3SJMA 2HXIA 5FKMA 1WPKA 2GLOA 3I4MJ 3IH3A 1JKOC 4BKXA 3JRAA 2KDZA 3H3VK 4A3CJ 1P7JA 1MBEA 3LSGA 1Y1VJ 5IOYA 1JKQC 1ETWA 3HBLA 1WI3A 1MSEC 5EGOA 4BXXJ 1ZK8A 1JUPA 4XRSA 1JUMA 2ME0A 2R92J 2R5ZA 1OCPA 2CUFA 4JX5A 1QPIA 5K7HA 3G1LA 2VPRA 3M3YJ 2QF7A 4A3BJ 3JRBA 2EZIA 5FLMJ 5J3LA 2DMNA 3A02A 3GTPJ 3BG9A 3HDDA 4GFBA 3S1QJ 1JJ6C 3K2AA 2P81A 5EG0B 4FE7A 5C3EJ 2YU9J 1AU7A 2ELKA 1TWAJ 1ZGWA 1MBKA 1Z77A 1ZR2A 1O4XA 3HB9A 3HOZJ 1F36A 5DS9A 3QPSA 4AC0A 1Q1VA 1ETXA 1JT0A 2HQ5A 2LK2A 3ZQGA 2K40A 4M3BA 2AHQA 1PUFB 5BNGA 2CQXA 4JYKA 1POGA 5FKOA 2JA6J 3S1MJ 5EG0A 1IV6A 4C3HJ 2XB0X 1IRZA 3L1PA 2DA6A 2M34A 1JJ8C 3CQZJ 4IHXA 1RESA 1IG7A 4J19A 5M5XJ 4M3EA 3OSGA 4I6ZA 3ZQFA 2K9SA 3Q0WA 1ZKGA 3HOXJ 2YUSA 1PUFA 3RZOJ 2JMWA 3G1MA 4BBSJ 2O8KA 3HGYA 3OOUA 4X6AJ 4BY7J 3TW7A 1U78A 1VF9A 1GUUA 3JRCA 2H8RA 3HOVJ 3DEWA 3ZQLA 4C3IJ 2IAIA 4BBRJ 3OIOA 3JRDA 4W1UA 1RETA 2E2HJ 2DA4A 1T56A 2EQRA 2L7FP 5IYDJ 2COBA 3S1RJ 2DJNA 2ECBA 2VUMJ 4XK4A 4A3FJ 4ABZA 1U9OA 3K7AJ 1X58A 3O8GA 1A6IA 3JR9A 1TWGJ 4HNVA 3S2DJ 3O8HA 3ZQHA 5E3NA 3CCYA 4X1EA 2ME6A 1T33A 1TWHJ 2ID6A 2DA5A 5EEAA 3D1NI 4RBOA
chains in the Genus database with same CATH superfamily
5JLWA 4KT5C 4AVPA 2DT5A 2UXNA 1AA7A 1E2XA 4LOCA 2QA4I 3GFJA 1LE8B 2EH3A 4U87A 2L9NA 4CUGA 1PJRA 4NC8A 3ZCOA 5J6XA 2NRAC 2PMUA 4U7DA 4ZTFA 3P9IA 2KKOA 2X9DA 1TLHB 3DPTA 3AFHA 3Q9VA 1P9QC 1HKSA 4NBQA 4MLOA 2VKEA 2O9LA 5FRNA 2K4JA 1ERDA 4QTRA 2RQQA 5F27A 1W7PD 2ZJ2A 3SFIA 3ZMVA 1FIAA 4M3FA 1KONA 4KJZA 2ZCWA 3DKXA 3AAFA 4L5EA 3VDXA 5D5WB 2QENA 2CJJA 4LLGF 3H5NA 2YSRA 2P4WA 1IJWC 3S15J 3GMEA 3K70C 1BC7C 4ZDPA 3DKWA 4KUMA 1T8IA 4KNYA 5F1JA 5IP7J 4HV6A 1XTAA 3D5LA 5HS7A 4K2EA 3ZRGA 5E3MA 1TWCJ 1F9NA 2GOXB 1AKHB 3TOAA 3TP3A 1TT5B 2QQBA 3CJQB 3UR3C 4CCLA 1QZEA 4II3A 1ZRCA 1KYWA 1TNSA 1IN5A 2DYRH 3J7AY 5J1RA 5KCMA 2L9RA 4EGYA 1SC7A 4CDGA 1SD6A 1XX5A 1W5CC 3F8CA 3Q9SA 3L00A 3CCLI 3H3UA 2IEKA 1Y0NA 3HXLA 2ZMEC 3QPTA 5C4JJ 4XMYA 3RKXA 1A6QA 4PJ0C 2L54A 3GWZA 1R1VA 2UV1A 1FEXA 3DLLF 1IN7A 2A07F 4CZCA 3MFKA 4V19K 4L5JA 5JHFA 1A5JA 3CP2A 3ZR8X 4GDFA 5AIPA 5H20A 1QHGA 4Y13A 3HYIA 4RAFA 3IWFA 2Q1ZB 4IQJA 3LAPA 4OMYA 4RAYA 3QYEA 1XPXA 1XC5A 1V4RA 2DA3A 2L7ZA 3GTJJ 2LY9A 2J5OA 5ERIA 3TKYA 2DTRA 3KEYA 3UNGC 1UHWA 4LK1F 4Y7NJ 2E2JJ 3S3MA 5HLHA 2H1LA 4NUBA 4PJNA 1IW7F 4KIFA 3MKYB 4M9ZA 3PO3J 3ZMDA 2HQRA 4BH9A 4H0EA 3KLNA 1KZHA 5LD2C 4IL6C 4B3XA 2ZKZA 5L3FA 4RDUA 3CCUI 1MNEA 1G6NA 2F5FA 2VT2A 2CQ7A 2EBIA 2BYVE 4ZDLA 2VE9A 3F21A 1G3WA 1O57A 2W00A 3RDIA 2FNAA 2Y31A 3BROA 3VYUB 4D9JA 2Y0SA 1MIJA 1N25A 2CRGA 2OJED 5A2QZ 4LFUA 2H1KA 2DT7B 3NAUA 3SDBA 3M1CA 4C2TA 3MZHA 4LG0B 3GZNB 3KETA 3MN2A 3IAM2 3DTKA 4XKCA 4W97A 1IO2A 5FROA 3F0CA 1GHCA 4RM2A 1JHFA 4A12A 2LOOA 2L7MP 4BHPA 3T1BA 2E60A 3E6CC 4LLLA 2HKXA 1H89C 1UG2A 2WY8Q 1B9NA 1BI1A 3VYTB 1FOXA 4A5MA 2K86A 4QLCU 2JN6A 2HGCA 1JI8A 5D5UB 4RGSA 2A69F 4A5NA 1H9GA 5L3EA 2FNPA 1DPRA 3K4CA 2HTSA 1SANA 3WTWC 2KQRA 1U6GA 1BN5A 3VSKA 1YX5A 4ENKA 2L5QA 4HZFA 1MMAA 2DK5A 1WQ2A 2AXLA 4MQVA 3BR3A 3KEOA 1IUYA 3IH4A 4IF4A 4AU7A 1TP4A 1S7OA 3FF5A 4IHSA 4DBQA 3QU6A 3DF8A 2K3PA 4BEHB 3FXJA 2YR2A 2DMQA 2CQQA 1WWXA 2CUZA 1FJLA 1MNMC 4RA2A 4A3KJ 4LMYA 2L9VA 2W85A 1BW6A 1ZTRA 5B1BH 2PJRB 3BZ6A 3GLLA 3OYKA 3N97A 5E79C 1LUJB 5DCMB 2W82A 1FSHA 2WB1A 2V26A 4XRFA 4NQWA 5FKKA 4DYQA 2WAQN 4PSWA 3BG6A 1MZBA 1YFHA 4OIRF 2O03A 1C0WA 2KT0A 5DEQA 4A3DJ 5E1ZB 3TL4X 1TBXA 3E3VA 2FQ3A 4M3DA 1IV8A 3E6DA 2E1CA 4A3GJ 2NYXA 4A3LJ 1DGRM 3EYYA 3HKZA 3NEUA 1FBSA 3IUOA 3CC4I 4J00A 4I01A 2F5VA 3WG9A 4C30A 2LMDA 2NVTJ 4XM3A 2VL8A 3QPHA 4EVIA 2MLKA 3CDLA 4PDKA 1SVOA 4F52A 2RN7A 3C1DA 4ENNA 3J7AO 3QYBA 4B8XA 3U1KA 1V5FA 3PIOF 1UHMA 1LFBA 3CCVI 1WSUA 5HNHA 3GTOJ 2Z2SB 3FK6A 4EEFG 2PJPA 3CC2I 1Y8QB 2LY2A 4HG2A 2PFBA 2L4MA 4BQAA 4QPOA 4ZC3A 5M5YJ 4HDUA 4AM3A 4FCYA 1W0TA 5L3DA 5HLTA 4ESBA 1A35A 3RPUA 3FMRA 2ISZA 2F5EA 2G0EA 3OYAA 2O8XA 1LFPA 3AG2H 3K4MA 5FD6A 5J4YA 1OLTA 1JTYA 2MGQA 1YTYA 4F91B 4M71A 1EA3A 5BQTA 1U8BA 1REPC 2GXGA 2RAEA 2EILH 3HIFA 3CCEI 1VNDA 1Z05A 5IYCJ 1WJAA 4S05A 1MBGA 2E36A 2MA3A 3Q5FA 2PMZN 4A2UA 4EJUA 5M3FJ 3RIRA 1R22A 4AIDA 4XR6A 2K85A 4KYWA 3KZYA 1R5GA 2G9WA 3JRIA 5BOXA 4MFDA 4QPQA 5BPDA 1NG7A 3TO6A 1LFUP 1QA6A 2HKOA 2AS5F 3FMSA 3PL8A 1FT9A 2IRFG 4Y15A 2CV2A 1I6XA 2VQGA 1LDJA 5GPCA 2X51A 2A05A 2D5VA 2CQNA 1DP3A 4A6EA 3V7SA 1Z67A 2PQ8A 1QQIA 2XF5A 3BZKA 3WTUC 2E1OA 4EGZA 3FHZA 1X1BA 2WADA 4XLAA 5HVQC 5L3GA 3FMQA 3QP6A 3PO2J 3JRHA 3GFMA 5EGOB 5HLIA 5CKTA 3Q3SA 2LRDA 1OR7A 1XGMA 2BY1A 3ASNH 4ITVA 1LJ9A 1R58A 3LFKA 2FUG2 2LR8A 2BW3A 3DEEA 1LVKA 1QVUA 2LREA 2GBYA 1X2NA 3QWLA 2E35A 3VODA 4ZH4F 4ZDOA 2CSOA 3K4KA 1JKOC 3JRAA 3GZ6A 2X1CA 2IJLA 1ZARA 2DOEA 3LA3A 3K70D 1AWCA 2EWNA 3L2WA 1R49A 2MYSA 5LGNA 1WI3A 2JPBA 1VQ7I 5LGUA 3KZIC 3E6MA 4XRSA 2HWVA 2ME0A 2R92J 3WE3A 2FMLA 3LA2A 1LQ1A 1SVMA 1U5TA 4KICA 1IF1A 2RREA 3DWLE 4Y3OA 3I53A 2IS1A 2VBYA 3JRBA 5FLMJ 3LL7A 3KP5A 4P55A 4HF0A 2LKPA 2P81A 2KIQA 3EETA 3ECOA 2HVSA 4N4OB 3PNYA 4G6DA 1ZRDA 3CJNA 1F36A 2EB7A 4UB8C 2V1NA 1I3AA 1Q1VA 1WJFA 3J7YJ 4TV7A 2Y75A 1TQIA 4XLEA 2DFFA 1X3WB 2KJCA 4IRHA 2QKLB 4KN4X 3GX4X 3E0JB 2VJ4A 3MD2A 1XCBA 1PP7U 3G2BA 1X1DA 4BQNA 1CGPA 5EG0A 2JA6J 2P0WA 4DNCA 4NB5A 2IVMA 3A4CA 4I09A 1YI2I 1OYYA 1O7FA 4U0YA 1KQ9A 1FX7A 1XMXA 4KT6A 3OIQA 1G3YA 1UB9A 4J19A 1PP8F 2VLAA 3LSMA 4M3EA 3J7ZI 3ZQFA 4BE0A 3C7JA 3OOPA 3Q0WA 2YUSA 4BYYA 2JMWA 3OYDA 2QBYA 3I3LA 1R5HA 5ICGA 3HUGB 2HTJA 3HGYA 2VN2A 1RNLA 1V3FA 5GAGJ 2L01A 2KIMA 4R1HA 3BG7A 1MMNA 1RC9A 1ON2A 1GUUA 2CYYA 3DEWA 1ZAOA 1K6OA 2IAIA 3WU1B 4BBRJ 1TNTA 2DA4A 2EQRA 1WJCA 3K9TA 3S1RJ 3ZMTA 3OS1A 3ZXSA 4M73A 1KYZA 2O61A 4ETSA 4CCKA 1U9OA 2Q2EA 3K7AJ 1HKTA 4BNCA 1A6IA 3I4PA 2DDAA 3BZCA 3O8HA 1ZG1A 1TQPA 5FGMA 5E3NA 1ZGJA 4CSWA 2E71A 3V8KA 3J80Z 1T33A 5J40A 4F7ZA 2OTJI 4EQQA 4F55A 5D4SA 1QGPA 1P6RA 4A3JJ 1SVLA 1EKEA 1BR2A 2GAUA 1EF4A 2DOFA 5EDNA 2W24A 1BL0A 2KFDA 1QPMA 1N78A 2P5LC 4IJAA 3HRSA 9ANTA 4XBFA 2M2EA 1CQTA 2NVYJ 2K5CA 4L9NA 2GXAA 2FOKA 5E20A 5TGTA 1ZELA 3DPUA 1K7AA 2JA8J 3CLOA 1ETKA 2VQCA 1S5LC 3SQNA 5IYBJ 2XB5A 5IY5H 3GYHX 1ETVA 2ELJA 3S32A 4ON0A 1L0OC 1A36A 4B48A 3WTVC 1HW1A 5A2QK 4CGZA 2N8GA 3G6EI 4OWRB 2IA1A 2FBKA 2J5PA 3H35A 3IP4B 5IOZA 4X0GA 3RI4A 2HQNA 2R5YA 2DBBA 2E19A 2UUZA 2ZNZA 3A01A 4CCOA 3BTLA 4B09A 4V2FA 2R7XA 1QVTA 1SD4A 2M0CA 2UWMA 3F22A 4IHVA 2WV1A 1LVAA 3S3NA 2FD5A 3BR5A 2R0QC 4IHYA 2XPUA 2KZGA 2WY7Q 3F8FA 2B9SA 2PBIA 4CH7A 2BVMA 2X0LA 3OR1C 1JE8A 3R0JA 1I1SA 1GV5A 2IGNA 2Z33A 1QZYA 3S2HJ 3K1NA 5EEGA 1CF7A 4YEJA 1MH4A 4N9IA 1IN6A 2MW8A 1MBJA 2BXYA 2HXOA 1Z7LA 3I58A 3QQAA 1WVRA 1TW2A 3M8FA 3CMAI 2JSPA 2JVGA 1P4WA 3OMYA 1HSJA 4FQGA 3ROUA 1R6RA 2CH0A 3VPRA 4D7NA 3BP8A 3GTGJ 2IBDA 5TJJA 4KISA 1VQKI 2YPRA 2R7TA 1W7PA 2DMUA 3QPLA 3M4OJ 5H6RA 2M87A 3LQRA 2K9QA 3KFWX 3W6VA 3QODA 4HW0A 4JQFA 4N0BA 3T8RA 3GEZA 4CXFA 1HW5A 3FZVA 1ONVA 2DMTA 4PFPA 3CCMI 2R7UA 1XS9A 3HOYJ 1EH8A 1B8IA 3RKQA 4OMZA 1HBXG 3E5UA 3ULQB 1OCZH 1IZ1A 2QVOA 1G2HA 4ZYGA 1X1CA 3KX2A 1Z1DA 4HQEA 3CUQC 4BQOA 2DA1A 5B66C 4BY1J 2DT6A 1USTA 4JK1X 4J01A 2YS9A 1TC3C 4OIOF 5BMZA 5F0CA 4PSXA 1R4MB 5DYMA 3JTHA 5D5XB 2GIVA 3B02A 4CYCA 3E7LA 2XRNA 4F92B 4L0YB 2OQGA 1NHAA 4DYRA 2LNBA 5CLSA 1H8AC 5EZGA 5DUIA 2FBHA 4XONA 2COMA 4EMSA 5FFXA 1E3OC 4L0ZB 5C4XJ 1MMDA 5FKLA 2E7XA 5LLQA 2VXDA 1Z3XA 2ZXJA 1UMQA 1YW7A 2DMPA 3CCSI 4RAZA 1FIPA 4XSZF 2BEOA 2DLLA 1T0FA 1T08B 2JJ7A 1PDNC 3DQVC 4MFEA 2LKXA 2CV0A 3GLXA 4F93B 4GYGA 1IRXA 2P6TA 2VBXA 1I3QJ 3H5AA 4XKBA 3ONQA 2BY2A 1KQ8A 4BJ6C 3RQIA 2DCEA 4KIGA 3BR1A 3GTLJ 3CTAA 2FX0A 3WTZA 4AUXA 4I7HA 3OYIA 1LEBA 2FU4A 4KA4A 4LB5A 2R7ZJ 3P7NA 3BPVA 1OYIA 2CW8A 3BDDA 1FMVA 2VONA 3ZMUA 4PUSA 4YFXF 3ESWB 3GFLA 2GQQA 3IV5A 2XAHA 2KZVA 1D1BA 4BQQA 2VPLA 2H8WA 3BR2A 2EFOA 2JA2A 4IHWA 2LD5A 2HEOA 2GM4A 1SAXA 4U88A 2M8EA 3BPXA 3LWFA 2DPDA 5LBQA 2AO9A 3HSEA 1YRNA 3EUHA 3CDHA 3LFUA 4P9FA 2NVQJ 2WAQA 4A3EJ 3C18A 4LLNA 1D0XA 1RRJA 3GO5A 1U8RA 2HDCA 3FXMA 2NS0A 2WA0A 1D1AA 1ULYA 3IKVA 3S2WA 2LFBA 5K1YA 1E17A 3GUDA 5JR3A 4HX7A 3M8EA 5GP9A 3HOUJ 1X19A 2X1EA 4FHTA 3RJPA 1YIJI 2ZXWH 1UFMA 1USSA 2R93J 4NQWB 1VQ6I 1AOYA 3VYRB 5LEJA 1RPWA 4EJWA 3D5SC 3CO7C 4YIRX 3GFIA 2XHKA 2OV7A 2DA2A 3MEXA 3ABUA 2V7FA 2L02A 3I59A 5CVJA 1FTZA 2FJ1A 2M0MA 4JP0A 4E7LA 3KP2A 1T38A 3TEDA 2MD5A 1JHHA 4HLYA 4D1QA 1OFCX 1JGGA 1GVDA 2F4OB 1Y1WJ 4IX7A 3HSFA 1W5SA 4Q47A 4XRSG 3TW6A 2OTLI 1K79A 3ABKH 1FC3A 4WXHA 3CCQI 3BLYA 3F8MA 2ZO4A 2KDOA 1Y0UA 5J1UA 3RQ4A 2NXNB 4UY8I 1H0MA 2Z5UA 1WJ5A 2XAFA 4HOBA 3S3OA 3H9GA 5FLVA 2OQRA 3L09A 4OOIA 5EZHA 3R6SA 3WE2A 1D0ZA 2BGCA 2PMZA 2OPTA 2PN6A 1VZ0A 2JRMA 1Z9CA 4Y4RA 3HHHA 4A0ZA 5J8FA 3RPQA 2QEXI 4JX4A 1F5TA 1P2FA 1W5TA 3BTCA 4M6XA 2KLOA 3L2QA 1XDUA 3ERMA 1FMWA 3OYMA 5TISC 4WX9A 3FBNB 1S29A 5KHDA 2OCCH 3GF2A 3RYPA 3T8TA 3HL2A 3RSNA 4AIJA 3DEUA 4A3IJ 2TRTA 2RKHA 4GRIA 4GYIA 1RKWA 3WHBA 3CMEI 1OCTC 2E34A 2Y9YA 4B43A 1GDTA 3M7GA 3WTXC 1MBFA 1O3TA 2HVQA 2KHMA 2KL4A 1F4KA 5H2FC 3R4KA 5LHGA 2NAZA 5E3OA 5LHIA 3AL0B 1G4DA 1OCOH 3TP0A 2VJIA 1D5VA 3GBGA 4O3MA 4WXCA 1OCRH 3W3CA 1FWZA 2CW0F 5DD8A 1KU9A 4XLHA 2EZKA 4LIVA 3QYFA 2ZSIB 4UVCA 2VJJA 1FBQA 2LF8A 5CJ9A 1ETQA 3BT9A 2OD5A 1RR8C 3DU6A 1BJZA 3JAMZ 3K4NA 3K69A 5IP6A 3ZPLA 2W84A 4XNFA 1IGNA 1BA5A 1U2WA 2EA4A 2OA4A 1FLIA 2M5WA 3BQYA 1NTCA 5HOOA 2O6GE 3GZ5A 2STWA 2BW3B 1JTXA 3ABTA 2IA0A 2NVXJ 1RZ4A 3W2WA 3BG3A 2YU3A 1KU2A 3HC7A 2EFWA 3BJAA 3RZDJ 2JA7J 1IDZA 3BR0A 3G1OA 2M7BA 4N4NB 5DCFA 1ODDA 5DM7F 1ORKA 4U0VA 3RKWA 4I0BA 3H92A 1X2MA 4XICA 1MH3A 4LD5A 4QSHA 4YELA 5FFZA 2ADUA 1VI0A 2MG4A 5D5VB 3DCFA 4RB2C 1X3ZB 2K3FA 4FT8A 1Q1HA 1U5TB 4PCQA 3PSFA 1K61A 1U3EM 1ZQ3P 4M6YA 1WPKA 2GLOA 1ZREA 2XC7A 2I8DA 4BS9A 2KDZA 1J75A 1MBEA 3LSGA 1Y1VJ 1HXDA 3ZN1A 2X6WA 1OCCH 1JKQC 1YOVB 3J80K 1ZK8A 4JBAA 1JXSA 1JUMA 2BY3A 3ZMZA 4IRIA 2AQFA 4WXDA 2R7DA 1S8NA 2CUFA 1B59A 3R60A 1XCVA 1HC8A 4ANJA 2ZFUA 2JUGA 5J3LA 3A02A 3BG9A 2BHYA 3K1PA 3LSTA 4GFBA 1BC8C 5EG0B 3EUKL 5HS9A 1AU7A 4FX0A 1ZGWA 1ZR2A 1IXRC 3E5XA 3SXYA 5FO5A 2E1MB 1D1CA 5DS9A 4O5VA 3BC8A 3HG9A 5K5QA 3KZZA 1ETXA 1I1GA 1D0YA 5L3CA 3ZQGA 1O3QA 2HOEA 1GXPA 2AHQA 3WTTC 3OYBA 3OYFA 5HDKA 2QBYB 4RLFA 3DBHB 1SD5A 2Z16A 2QKMB 5L3BA 2XUBA 5FLXZ 1MKMA 4AWXB 3R0AA 3TDUC 3ZQ7A 3H9QA 1HA8A 1IRZA 1VQMI 3BY6A 5AONA 4MEXF 4O6JA 1WHUA 2DA6A 3A1YA 1VQLI 1JJ8C 3CQZJ 3OIPA 2Q8KA 1G3TA 4G8XA 4HF1A 1K78A 2F5CA 2BZTA 3LMMA 1BR4A 1WJEA 5M5XJ 3OSGA 2UXXA 4HNTA 3F6OA 3RZOJ 2DO7A 4WK8F 3DLAA 3G1MA 4BBSJ 3OOUA 5CPRB 2Q2EB 4CZZA 5F1RA 2ZMEA 4CHUA 5BPIA 1XMAA 1X4PA 5CVIA 1VQPI 1U78A 3J81Z 2H8RA 3ZQLA 4C3IJ 1BOAA 1YW9A 3OIOA 2P8TA 1RETA 2E2HJ 3SZGA 1T56A 2EJRA 4XORA 1T95A 2VQHA 5IYDJ 2FRHA 2Z3YA 3F8BA 4XK4A 2HU9A 3FXUA 2H09A 2VOOA 1A04A 2DAOA 2VKHA 3I9V2 4HNVA 3WTSC 2IGOA 3VOEA 1VQOI 3E6BA 2A3SA 2A5YB 3SZTA 2L2OA 2PI0A 4HPQA 5HS8A 1YQAA 3CCYA 2ME6A 2IXSA 3IHUA 1IAWA 2ZXIA 4YFNF 2B0LA 3FDYA 3T0YA 3SYTA 4V2GA 3DV8A 2JRTA 5M5WJ 2OCEA 3I54A 2R5YB 2DDBA 2FXAA 4I76A 3MKZA 2R7SA 3A01B 2O7OA 2X6XA 2LF7A 3LSKA 4M6VA 5M3MJ 3K4LA 2CW7A 4RS8A 5D4RA 2R7WA 3BTIA 1ZYRF 2HI3A 4PJLA 4D5FA 4JX6A 3JREA 5E1XA 1D8JA 5D8KB 5LEKA 3OYLA 2EFNA 2KJBA 2GXBA 2JA5J 4HSRA 1CF7B 1YLFA 3M8JA 3ASOH 1LDDA 2HOTA 2WTEA 1BIBA 5LGTA 4IO9F 2FE3A 3CO6C 3KYDB 3OS2A 2M3AA 2JWTA 1HW2A 3F72A 2Y30A 4E7HA 4BGDA 1FYMA 3WGHA 1W7PB 4RGUA 2VE8A 3OS0A 3MMYB 1XN7A 3H0GJ 3VB2A 5FJ8J 1D5YA 2WAEA 1MGTA 2EV6A 1ZR4A 3CD6I 3OV8A 4BDYA 2DYSH 5B5EC 1WZ2A 3SHFA 3I64A 4DBRA 2CO5A 2FBIA 2I5UA 3ML6A 5DM6F 4C9YA 1SFUA 4A6DA 3T5XA 1W36C 2JK3A 3U9GA 4ZZDA 1B8IB 3LOCA 2ZJPF 2R7FA 1BM9A 2ZJQF 2EINH 3WU0A 1P7IA 1JT6A 3BOQA 5JFRA 2IGKA 1LPQA 2HVRA 1MMSA 4FISA 2O3FA 2Y0MA 3O2PE 3HPHA 2FSWA 2ZXHA 1FYLA 2YX7A 1ZLKA 1OJLA 1XSDA 1I50J 4F3QA 3LNQA 4ZYAA 2RDPA 4CYCB 2XVCA 3JCUC 2MSYA 2DQRA 3MKWB 2PX9A 4DQ2A 4HF2A 2F48A 4KFCA 3HTUA 2XKOA 3FBIB 3G73A 2E1NA 3HRMA 4E7JA 3SZPA 4IXAA 3G3ZA 4A93J 5E3LA 1ZRFA 4KMUX 1NH3A 1FTTA 5F6FA 2A61A 1V54H 1BI2A 3DBRB 2XAQA 1J2XA 1DU6A 3S16J 4NDLA 2LBFA 4AYBN 1IRFA 3FIWA 4EM0B 3OL4A 4N9HA 4CICA 4B4CA 1WGXA 1EJ9A 1IUFA 2HDDA 1X4OA 4KITB 5D6EA 4B47A 4AVZA 4FETA 2IPQX 1BOBA 1Z21A 3DTEA 2AXTC 5KK1A 3BWGA 2KIFA 4BAYA 1LKXA 4L9TA 5GTHC 3F23A 3CCRI 3L9FA 1HF0A 1FZPB 1XB4A 4M9SA 4MQ9F 2E5NA 3FM3A 3A0BC 3HKZN 4AIHA 4HYEA 5GAEJ 5D8LB 1M1EB 2BHZA 3ZMSA 1T39A 2X48A 1LNWA 2M1BA 1WCMJ 4EM2A 1QO0D 1TT0A 2MFZA 2CFOA 3LAJA 1YRNB 5IPAA 3V8JA 3ZN0A 3NQOA 1SMTA 2A68F 2OZUA 2TCTA 3EDPA 1BJAA 1X1AA 2NOGA 2GWRA 3X2QH 3ZQCA 3H9JA 3MKLA 2HZDA 1JKPC 1E3HA 2XGXA 3TDZC 1IXCA 3O6BB 3A2KA 4L5IA 4P5OA 3IC7A 1RI7A 2DW4A 2JUCA 4XOTA 1APLC 1L3LA 1QNTA 3IKTA 1WKMA 2WAFA 1QU3A 1P4AA 2LSOA 2VKVA 3HM5A 2JVHA 5HODA 1DQUA 2MC3A 1YYVA 3TMOA 2VOPA 3ABMH 3E5QA 1GV2A 2HDWA 5F04A 2BV6A 4IOAF 2Y9ZA 1ETYA 3CCJI 1DPUA 2IW5A 4MTEA 4UUSA 5K7ZA 1XGOA 3FISA 4Y17A 3I59B 2HYFA 2QUFA 3TQNA 1OISA 1J7KA 3E1SA 1H88C 2VJ5A 4CA0A 3JAMK 1UZCA 3FM5A 3LSHA 2IS4A 3TOBA 2XF7A 3OSFA 2V1DA 1MNDA 1KA8A 2CWEA 4G6TB 4UVAA 3ELKA 1WI9A 5ICCA 3EUAA 1RUOA 1ZH5A 2E5ZA 1OYWA 5K5RA 4P1WA 1D3YA 2HPIA 2Z99A 3L2UA 5B3SH 2NS7A 2GIZA 3PNTA 3HEFA 4HRIA 4L9VA 1S7EA 1ON1A 2RNJA 2LYCA 3KYLA 4UXNA 3HRUA 3QOEA 3NWSA 1ITYA 1VQ9I 1OKRA 2CUJA 2KIUA 3HSRA 1B1BA 3K2ZA 5HDNA 4IZZA 3BG5A 2FMYA 2ZC2A 1NG6A 2EZHA 2QQAA 3PIPF 4BACA 1B72A 4UUVA 2W1OA 3A0HC 1TW3A 1KQ0A 1X1PA 3C3WA 3DU5A 4XOPA 2K02A 3OR2C 3LSPA 1W1WE 2EIMH 3GTMJ 4PZJA 5LFAA 2BXZA 4BE2A 2Y69H 4E4HA 1R9TJ 1I5ZA 5CQGA 3WTYC 3S1NJ 4IEJA 4ZZLA 4E6KG 1JUSA 2GA1A 2DN0A 4OIPF 4BUPA 3Q0VA 1WH5A 1JKRC 4BHCA 3CF5F 2ECCA 4RB1A 2CUEA 3W2VA 4LIUA 2WC2A 4EJTA 5K5OA 3S17J 3H36A 1W0UA 1RKTA 3HOWJ 1BBYA 4L18B 3I0TA 2ZNYA 3IAS2 2M45A 3SDGA 3WGGA 2P5KA 4HDVA 2LVSA 2XAJA 3IL2A 2Z9OA 1XSVA 1UJ8A 2R7RA 1RIOH 3D0SA 2QSGX 4RB0A 4EJOA 3DPLC 1X3UA 1SEUA 4G9YA 2XSDC 3DFGA 3CC7I 2DK8A 5J1YA 1R00A 2G7UA 2EFQA 2EFPA 2L4AA 5FLXK 1MDMA 4YIFA 4C3JJ 1BR1A 4DGWB 1ENHA 1G59A 1P92A 3JSOA 4Y52J 2XAUA 1YS6A 5BS6A 2KRCA 2QQ8A 5FKNA 5LRSA 3EYIA 4YFKF 2IGMA 4B1RA 3I55I 3KP7A 2OUMA 1HDPA 4LITA 2A5WA 2DODA 1QBJA 1XGSA 3G4SI 2JPCA 2PLYA 2F4MB 1KU7A 4DJAA 4Q5SF 4S04A 2I10A 1HLVA 3KCCA 2VC0A 3COAC 2XGDA 3NWTA 1NK3P 2GZWA 1WRJA 4OAYA 1UG0A 4BL0B 4G12A 1STZA 3EQLF 1BI0A 5CQEA 1YO5C 5F0FA 2ICWG 2L9SA 3ZQIA 3J81K 2HYJA 1F43A 5ILVA 3FKJA 1YG2A 4WWCA 4Z2YA 3VFZA 1MBHA 5EYRA 1DU0A 1R71A 2CGPA 4EATA 4IKFA 1FBUA 2HXIA 4HAMA 1Y8RB 2D2WA 3BJOA 1QHHD 3IH3A 4E7SA 3PUBA 2ACJA 1P7JA 3H1CA 3MQ0A 3K4JA 5IOYA 3GW2A 4BU2A 2H6CA 2X85A 5CYVA 4A0XA 3M07A 1G3SA 2CS3A 4I0AA 3RKYA 1FNNA 2R5ZA 4M9XA 4JX5A 2Q0OA 3TBIA 2XF6A 1QPIA 2EIJH 3AKZA 2LY1A 2VPRA 2HR3A 2MC4A 4DOZA 2C6YA 2VQLA 1W36D 2JQ7A 2Y48A 1SFXA 1JJ6C 3K2AA 2GOMA 1D8KA 4HSTA 4MTDA 4G6QA 2NOJB 2ELKA 2F5DA 1TWAJ 3PSIA 1MBKA 1Z77A 1O4XA 2ESNA 3HB9A 3TGNA 4PK4A 2R7QA 1K78B 3O3KA 4AC0A 2D1VA 2HQ5A 2LK2A 4CCMA 2K40A 2MD0A 3HOTA 1TL8A 4M3BA 4BDZA 4QWQA 5BNGA 2CQXA 3ABLH 4JYKA 1K6YA 4XLPF 2V6EA 1V55H 3FX3A 2QLZA 1EH6A 5HLGA 4ZJZA 1TQMA 5KAFC 2ZMEB 3RCOA 1FP2A 2XB0X 3SEQA 4EM1A 4XKWA 1RESA 1IG7A 4ESFA 1J0RA 3CP8A 3MZ8A 4Z6YA 4I6ZA 1O3SA 3L2CA 3AL0C 1ZKGA 3HOXJ 1PUFA 2PG4A 1G8XA 3OYCA 4PJJA 3I71A 3U1DA 3P9CA 4G7HF 2O8KA 1OPCA 4I02A 5ED4A 2ETHA 2XSJC 4AIKA 2QYOA 4BJ5C 2V1XA 3L7WA 1YIOA 1VQ4I 2HPMA 3JRCA 3AG4H 3CZ6A 4OINF 2FOWA 5E18F 3JRDA 4UB6C 1OR7C 4ASNA 3KIOA 2L7FP 4RMNA 4ZYDA 2COBA 4IVNA 2DJNA 2VUMJ 3K4BA 3CJRB 4PJMA 3CUQA 3H3ZA 4A3FJ 5CVRA 3O8GA 2KRFA 4L9JA 4XSXF 3JR9A 4ESJA 5GTIC 5HNFA 3OY9A 2DJIA 2RC4A 2VXZA 2F2EA 3P5JA 2ID6A 1FPQA 2DA5A 2OAZA 1R4NB 4RBOA 4M74A 1FYKA 3C2HA 2G7HA 5ILSA 3WG7H 3VYSB 3HRTA 3P9KA 3QRFF 3EPZA 2A6HF 2LDUA 1U5TC 2VI6A 2XPWA 5EEHA 5CVVA 2DTZA 2FQ4A 4HEA2 3GCMA 3FWEA 4LJZF 4UV8A 2TDXA 3U21A 2VT3A 3NARA 5IT3A 2NS8A 3RTRA 3HGGA 4HX8A 2K9NA 5FB2A 2XIGA 2QZ8A 2VKDA 2ZFWA 2L7KA 5JLXA 5ICFA 3IRQA 3L2RA 1IC8A 1FOKA 4EV0A 1ZG3A 3CLQA 5JVGF 1FOYA 1TWFJ 2FA5A 1R36A 1HOMA 4WF2A 5C44J 4KN7X 1LE8A 1BI3A 2ID3A 2R7VA 4UNOA 2NNYA 5GADJ 2P5VA 4GGGA 2QM3A 2M7AA 3FXOA 4HBLA 3K10A 2F6CA 3KE2A 5DD4A 3S14J 3JSPA 1K4SA 3GXOA 1LB2A 3PFYA 1XSXA 2ZJRF 1GT0C 2L0KA 4GCVA 1RR7A 2LKSA 5EF6A 2IT0A 1UCRA 3SEZA 2K7LA 2RV8A 4PGGA 5DUKA 5IP9J 3JTGA 3BTJA 2E1MC 3C2BA 5LRRA 3I4NJ 2HYGD 2KRHA 2VBZA 2MABA 2VBWA 4AYBA 3BQZA 2BOLA 3U2RA 1S9HA 2X6YA 4GXOA 4Q4ZF 3DBLB 1YJNI 1YX3A 4MHGA 1AHDP 2Y2ZA 1QZZA 4C2MJ 2M30A 3IWZA 2M8GX 4FASD 4CO8A 1VQ8I 1MJBA 2OU2A 1FP1D 1AKHA 1YJWI 5IT9Z 4DW6A 2LBFB 1IDYA 2E2IJ 3WGIA 4M72A 1I6HJ 4HQMA 1VTNC 4FX4A 1MD0A 3MZYA 4XRMA 2D45A 3PJRA 2OZ6A 2YX4A 1IN8A 5F64A 3FKIJ 2WBMA 3N05A 4I98B 3B6CA 1PYVA 2KPMA 2XGEA 3WU2C 5JI6A 2DOAA 3IH2A 5ILUA 2QSFX 5E8GA 3JRGA 3F6VA 1ZLJA 3V4GA 1V5GA 4A69C 2HOSA 3HOSA 2P6SA 2XRLA 2W4SA 2V9KA 4E7KA 3TO9A 3QU3A 1A31A 4DYCA 3HTSB 1BIAA 3LSJA 1UAAA 4D5CA 4RGRA 4RB3C 3UKGA 3FHNA 4XL9A 4R8HA 2CMPA 3KYCB 4Q48A 3OWTA 1Z6TA 3PM1A 3LA7A 5E8IA 5DTDA 1UELB 2CU7A 3L2VA 2A6EF 2OC6A 1IXSB 3DP7A 2EZLA 4XQFA 1KU3A 2MLGA 1S6LA 5F0HA 2KISA 1J5YA 1HQCA 3ISPA 1Z6RA 4XN0A 1WJDA 1W4MA 1KGSA 2EV0A 4JOMA 3W2AA 1QRYA 3B73A 2P7VB 3NRVA 3WHCA 4NNJA 2CV1A 3VWBA 2F4IA 1VFCA 4CCNA 1R5ID 1VQ5I 2QSHX 4IRGA 1U0JA 2OBPA 4UVBA 3FXRA 2OF7A 2UZKA 1XGNA 2H27A 2JSCA 3H5RA 2GA2A 5E17F 3Q0UA 5FRMA 4UUSB 3VEPA 3F9KA 1Z3YA 5B1AH 4M3GA 1Z0XA 2LP0A 2MH2A 4LG3A 5KNLA 1I39A 3S93A 5EJCA 4LG0A 3AG3H 3QOPA 2MH9A 4KDPA 2WV0A 1DGWY 4HNUA 1XD7A 2XASA 5GPAA 3GTQJ 4PGHA 1TZLA 3B6AA 2ELHA 1UHSA 2Y0SN 2LTPA 3QP5A 2V4JC 3K6GA 3MVPA 4UV9A 3JRFA 2W25A 3BJ6A 3LSRA 1H9TA 2B63J 3RYRA 2R7OA 3MAJA 1S7AA 4HLXA 1Y39A 4XKVA 4XLFA 4LB6B 2ESHA 4ENJA 2H94A 4FTHA 4YRVA 4OIQF 2R3SA 2V9VA 2XKPA 1O3RA 2DU9A 3ZGKA 3GTKJ 1FY7A 2IS6A 3KP3A 1BW5A 1Y56A 2K9MA 3D5RC 1ZN2A 2B7EA 5K7FA 2VC1A 1E3PA 2O0YA 1J09A 3K1MA 3ZOBA 4YIIA 3OYJA 1B72B 4DIQA 1P4XA 3V8LA 1EH7A 2CFXA 3IRRA 1T2KA 1XG1A 2DFIA 4IHTA 1R1UA 5FD5A 1LDKB 1J59A 4ZYEA 3OYEA 1SFEA 6PAXA 2V6CA 2XGCA 2VASA 5D6FA 5H6QA 2LG4A 3RPUD 4ZYHA 1F1ZA 4BXFA 3LQQA 4G94A 3OYHA 1ACIA 3CDIA 4BEHA 2XV4S 4UUTA 1EV7A 4P9UA 4IOCF 2XDVA 4DZJA 1HCRA 3KLOA 1HDDC 1R23A 4U0WA 1WH7A 1ZHFA 2NNNA 3BR6A 2NVUB 1DDNA 2HOAA 4IPAA 1U9NA 3PNVA 3W6KB 4MEYF 1T0FC 2BY0A 4U7BA 3PUFA 2PJRA 2ISYA 1MSFC 4HV5A 2JZYA 3R61A 2HS5A 2VIXA 4OAZA 3KP6A 3KP4A 2KP6A 1SFKA 1Y6IA 5DCMA 2W7NA 4E7IA 4P96A 4DZPA 5JHUA 4E70A 1DP7P 4FE4A 2STTA 4NC7A 1V5EA 4S0HB 1XMKA 2QCOA 2RGVA 1GLNA 3V7CA 4XN3A 4XLNF 4RAGA 2RVCA 2ZSHB 2ZB9A 1B4AA 3DKYA 4A3MJ 1MDMB 2RQPA 2W48A 3GVAA 2WB1N 4G7ZF 1DUXC 4B3AA 3FK7A 4YG2F 2H6BA 1OQYA 1TTYA 2CG4A 3M9AA 2XAGA 3I5UA 1K83J 1MJ9A 3PQJA 1R1TA 4ZTJA 2DA7A 3CF2A 4MGRA 5TRDA 1RUNA 3ZQQA 2M9HA 2LC2A 2X6OA 5LHHA 4RLQA 3EUHC 3W6JB 3ERED 4D7MA 3HPGA 2IP2A 5GAHJ 5HDGA 2EPFA 3HHGA 5AIQA 5KVRA 4ENMA 2X4HA 2DFEA 4AD9A 4RGXA 4MIMA 4A0YA 1PUEE 1SFOJ 2L3DA 4XLCA 1Z91A 5E1WA 4QIWN 1YS7A 4EJVA 2DQLA 3CJTB 3MWMA 3VSLA 4RM3A 1NK2P 1T6SA 3FXLA 4MO7A 1ZGAA 2A6TA 2LLKA 1OMIA 3QAHA 2DFHA 4II2A 3HJEA 5KAIC 4NC6A 4XIDA 4I99C 4IQ4A 5DV5A 4BJTA 2XPVA 1YE9A 2IS2A 1O7LA 3CUOA 1HSTA 3CESA 4E7ZA 3DTIA 1ETOA 2VB6A 3KPHA 2BBYA 5F08A 2R5ZB 2V9PA 3V42A 3A03A 2W57A 4D0PA 2P7CB 1MW7A 4PFOA 3OYGA 3CMYA 3SJMA 3M1EA 5FKMA 3I4MJ 4BKXA 4H4KC 2JTVA 3REOA 3N4MA 2E7WA 3H3VK 2BE5F 2XROA 2VODA 2QWWA 4OU0A 4A3CJ 2EV5A 2LH9A 2QGUA 1ETWA 2DI3A 2EIKH 2IA2A 3ECHA 3HBLA 2WWYA 4GO1A 5EGOA 1MSEC 2DPUA 4BXXJ 2CQKA 1JUPA 5JVTA 2BVLA 1OCPA 1B6AA 2EA2A 2X1DA 3WODF 4MNUA 5K7HA 2FF4A 2D1HA 3G1LA 3M3YJ 2KMUA 2QF7A 2PMHA 1MJAA 1J9IA 2K9LA 4A3BJ 3PQKA 5DDGA 2EZIA 2DMNA 3GTPJ 2QQ9A 3I56I 3HDDA 2JT1A 1T98A 3S1QJ 1YW8A 2R4GA 4KIBA 3LSIA 2PEXA 4FE7A 2HNHA 5C3EJ 2YU9J 2AQEA 4B44A 4G7OF 4HX4A 1VQNI 3MCZA 4UHTA 3HOZJ 1SMYF 3V7RA 3AG1H 3QPSA 4BXUA 1JT0A 3PFIA 2HFHA 1GXQA 4Y33A 1WJBA 1PUFB 2V1UA 1LEAA 3BCBA 1POGA 2Z1DA 3CMMA 5FKOA 1IRGA 1JGSA 3S8PA 3S1MJ 4HA8A 1YHQI 1FOWA 4R79A 1IV6A 1SAUA 1GVJA 4C3HJ 4WCGA 3C2GA 2M4GA 1FSEA 2M4KA 3L1PA 3F3XA 3JW4A 2M34A 1N77A 4CYDA 4IHXA 3F8NA 4BHBA 5CVUA 3DXJF 3G71I 1ZG5A 2K4BA 1MMGA 3ZP5A 2K9SA 1PVEA 2MBFA 1HKQA 3TO7A 2RNGA 1IN4A 3CUQB 3K0LA 4KMFA 4X6AJ 4BY7J 1YJ9I 3FXQA 1S72I 4I2OA 3TW7A 4CCJA 2EK5A 1YITI 5J8CA 1VF9A 4NHJA 1SD7A 2V79A 2HZTA 3HOVJ 5IT9K 1R7JA 4C2UA 1XDSA 4BE1A 4LGWA 4W1UA 1E0EA 3H0DA 3OYNA 2DXIA 5J47A 3SFZA 3BCAA 1I27A 1N75A 2ECBA 1WFXA 3HUGA 2FEZA 3KEQA 5J4VA 3HZJA 3OL3A 4ABZA 3E97A 1K4TA 1X58A 4LK0F 1TWGJ 3FXKA 2K27A 3S2DJ 1B9MA 3ZQHA 2HQAA 2ZBKA 4X1EA 2O5RA 5ICEA 1TWHJ 5EEAA 3D1NI 1S3JA 1Z7UA
chains in the Genus database with same CATH topology
5JLWA 4A3JJ 4V2GA 1EF4A 5EDNA 4LOCA 1BL0A 5M5WJ 1LE8B 2EH3A 9ANTA 2VI6A 2R5YB 2XPWA 2M2EA 1CQTA 2NVYJ 4I76A 2DTZA 2FQ4A 3A01B 2O7OA 2X9DA 3NARA 2NS8A 4M6VA 2JA8J 4MLOA 5M3MJ 1ETKA 2VKEA 3HGGA 5IYBJ 2O9LA 2K9NA 2XB5A 3BTIA 4QTRA 5JLXA 1ETVA 5F27A 2HI3A 4D5FA 4JX6A 3JREA 1IC8A 3SFIA 1FIAA 4M3FA 1TWFJ 2N8GA 1HOMA 5C44J 2JA5J 1LE8A 5IOZA 2ID3A 4L5EA 2R5YA 2E19A 2HOTA 2CJJA 3A01A 1IJWC 3S15J 2JWTA 3BTLA 3S14J 2Y30A 4V2FA 5F1JA 1QVTA 5IP7J 2M0CA 5E3MA 4IHVA 2WV1A 1TWCJ 1GT0C 2FD5A 2L0KA 3H0GJ 1D5YA 3BR5A 1RR7A 5EF6A 5FJ8J 2R0QC 1AKHB 4IHYA 2XPUA 3TP3A 5IP9J 1ZR4A 3BTJA 3C2BA 1GV5A 3I4NJ 3S2HJ 3BQZA 1MH4A 2JK3A 1B8IB 2MW8A 1MBJA 2HXOA 3LOCA 3QQAA 5J1RA 2L9RA 1AHDP 2Y2ZA 3VPRA 4D7NA 1P7IA 1JT6A 4C2MJ 3GTGJ 2IBDA 2M8GX 4FISA 2IEKA 2DMUA 3QPLA 3M4OJ 5C4JJ 2K9QA 1AKHA 3W6VA 1OJLA 4DW6A 1I50J 1IDYA 3LNQA 2E2IJ 1FEXA 1I6HJ 4CYCB 2MSYA 2DMTA 4XRMA 1XS9A 3HOYJ 1A5JA 1B8IA 3FKIJ 3RKQA 3B6CA 1G2HA 2XGEA 3IH2A 4A93J 5E3LA 2DA1A 3JRGA 4BY1J 1FTTA 1XC5A 4A69C 2HOSA 2DA3A 2YS9A 2L7ZA 3GTJJ 1TC3C 2LY9A 2XRLA 1DU6A 3S16J 5F0CA 4NDLA 4AYBN 4DYCA 4CYCA 3FIWA 3E7LA 4Y7NJ 4B4CA 2E2JJ 1WGXA 3LSJA 4D5CA 4DYRA 1IUFA 2HDDA 1H8AC 5EZGA 3PO3J 3UKGA 5C4XJ 1E3OC 5FKLA 3PM1A 4RDUA 1UMQA 2DMPA 1FIPA 2EBIA 5DTDA 2CU7A 2JJ7A 4MFEA 2LKXA 2EZLA 5F0HA 2Y31A 1I3QJ 1HF0A 2CRGA 3HKZN 2H1KA 3NAUA 3RQIA 1QRYA 3WHCA 2X48A 3BR1A 1VFCA 3GTLJ 3MN2A 2FX0A 1WCMJ 4AUXA 4W97A 1YRNB 5IPAA 2R7ZJ 3F0CA 2OF7A 2TCTA 2NOGA 3ZQCA 3MKLA 1JKPC 2L7MP 3Q0UA 4UUSB 1H89C 4M3GA 3IV5A 1Z0XA 2LP0A 1UG2A 1APLC 3BR2A 4IHWA 2JN6A 2LD5A 2GM4A 2VKVA 3HM5A 5HODA 2AO9A 1YRNA 1SANA 5GPAA 3GTQJ 3B6AA 1GV2A 2NVQJ 1UHSA 5F04A 2Y0SN 2Y9ZA 1ETYA 4A3EJ 2LTPA 4UUSA 3JRFA 3MVPA 3FISA 5K7ZA 3LSRA 2B63J 1H88C 2LFBA 3BR3A 3IH4A 5GP9A 3OSFA 3HOUJ 4FTHA 3GTKJ 2R93J 1BW5A 1RPWA 5K7FA 2DMQA 2CQQA 3ZOBA 1B72B 2NS7A 3HEFA 1FJLA 1S7EA 2DA2A 1MNMC 1XG1A 4A3KJ 1FTZA 1BW6A 1ZTRA 2FJ1A 4JP0A 3TEDA 2XGCA 1ITYA 1OFCX 3BG5A 5FKKA 4DYQA 2WAQN 1JGGA 1GVDA 4UUTA 1Y1WJ 4A3DJ 2KT0A 2EZHA 1B72A 4DZJA 1HCRA 4M3DA 1HDDC 4XRSG 1WH7A 3TW6A 3BR6A 2HOAA 1U9NA 4A3GJ 3LSPA 4A3LJ 5J1UA 3GTMJ 1MSFC 5FLVA 2NVTJ 1R9TJ 3CDLA 5EZHA 2OPTA 4DZPA 3S1NJ 4IEJA 4FE4A 1JUSA 4S0HB 2DN0A 2QCOA 4JX4A 1LFBA 3Q0VA 1WH5A 3BTCA 3GTOJ 1JKRC 3FK6A 4EEFG 2ECCA 2CUEA 3S17J 2ZB9A 5M5YJ 1W0UA 4FCYA 4A3IJ 2TRTA 4A3MJ 1RKTA 1W0TA 2W48A 3HOWJ 1RKWA 2WB1N 3WHBA 4B3AA 1OCTC 2Y9YA 3FK7A 1GDTA 1MBFA 2G0EA 3SDGA 1K83J 2LVSA 1JTYA 2MGQA 5E3OA 2DA7A 1U8BA 2RAEA 2XSDC 3TP0A 5J1YA 2M9HA 2X6OA 3GBGA 1VNDA 5IYCJ 4D7MA 1MBGA 2PMZN 5M3FJ 2EZKA 4C3JJ 1ETQA 1ENHA 3BT9A 3JRIA 4Y52J 4MFDA 1BJZA 5IP6A 1LFUP 4MIMA 5FKNA 1SFOJ 1IGNA 1BA5A 4QIWN 4B1RA 3BQYA 1HDPA 1NTCA 5GPCA 1JTXA 1NK2P 4MO7A 2NVXJ 2D5VA 2I10A 1HLVA 3BG3A 2LLKA 3RZDJ 2XGDA 1NK3P 2JA7J 1IDZA 4XIDA 3BR0A 3G1OA 2E1OA 4G12A 1ORKA 2XPVA 5F0FA 3PO2J 3ZQIA 3JRHA 2HYJA 5EGOB 1F43A 3Q3SA 1X2MA 1ETOA 4XICA 1MBHA 5EYRA 1MH3A 1DU0A 4QSHA 5F08A 1VI0A 2MG4A 2R5ZB 2LR8A 3A03A 3DCFA 1QVUA 2GBYA 1X2NA 3CMYA 1K61A 1ZQ3P 3SJMA 2HXIA 5FKMA 1WPKA 2GLOA 3I4MJ 3IH3A 1JKOC 4BKXA 3JRAA 2KDZA 3H3VK 4A3CJ 1P7JA 1MBEA 3LSGA 1Y1VJ 5IOYA 1JKQC 1ETWA 3HBLA 1WI3A 1MSEC 5EGOA 4BXXJ 1ZK8A 1JUPA 4XRSA 1JUMA 2ME0A 2R92J 2R5ZA 1OCPA 2CUFA 4JX5A 1QPIA 5K7HA 3G1LA 2VPRA 3M3YJ 2QF7A 4A3BJ 3JRBA 2EZIA 5FLMJ 5J3LA 2DMNA 3A02A 3GTPJ 3BG9A 3HDDA 4GFBA 3S1QJ 1JJ6C 3K2AA 2P81A 5EG0B 4FE7A 5C3EJ 2YU9J 1AU7A 2ELKA 1TWAJ 1ZGWA 1MBKA 1Z77A 1ZR2A 1O4XA 3HB9A 3HOZJ 1F36A 5DS9A 3QPSA 4AC0A 1Q1VA 1ETXA 1JT0A 2HQ5A 2LK2A 3ZQGA 2K40A 4M3BA 2AHQA 1PUFB 5BNGA 2CQXA 4JYKA 1POGA 5FKOA 2JA6J 3S1MJ 5EG0A 1IV6A 4C3HJ 2XB0X 1IRZA 3L1PA 2DA6A 2M34A 1JJ8C 3CQZJ 4IHXA 1RESA 1IG7A 4J19A 5M5XJ 4M3EA 3OSGA 4I6ZA 3ZQFA 2K9SA 3Q0WA 1ZKGA 3HOXJ 2YUSA 1PUFA 3RZOJ 2JMWA 3G1MA 4BBSJ 2O8KA 3HGYA 3OOUA 4X6AJ 4BY7J 3TW7A 1U78A 1VF9A 1GUUA 3JRCA 2H8RA 3HOVJ 3DEWA 3ZQLA 4C3IJ 2IAIA 4BBRJ 3OIOA 3JRDA 4W1UA 1RETA 2E2HJ 2DA4A 1T56A 2EQRA 2L7FP 5IYDJ 2COBA 3S1RJ 2DJNA 2ECBA 2VUMJ 4XK4A 4A3FJ 4ABZA 1U9OA 3K7AJ 1X58A 3O8GA 1A6IA 3JR9A 1TWGJ 4HNVA 3S2DJ 3O8HA 3ZQHA 5E3NA 3CCYA 4X1EA 2ME6A 1T33A 1TWHJ 2ID6A 2DA5A 5EEAA 3D1NI 4RBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLW A;  4A3J J;  4V2G A;  1EF4 A;  5EDN A;  4LOC A;  1BL0 A;  5M5W J;  1LE8 B;  2EH3 A;  9ANT A;  2VI6 A;  2R5Y B;  2XPW A;  2M2E A;  1CQT A;  2NVY J;  4I76 A;  2DTZ A;  2FQ4 A;  3A01 B;  2O7O A;  2X9D A;  3NAR A;  2NS8 A;  4M6V A;  2JA8 J;  4MLO A;  5M3M J;  1ETK A;  2VKE A;  3HGG A;  5IYB J;  2O9L A;  2K9N A;  2XB5 A;  3BTI A;  4QTR A;  5JLX A;  1ETV A;  5F27 A;  2HI3 A;  4D5F A;  4JX6 A;  3JRE A;  1IC8 A;  3SFI A;  1FIA A;  4M3F A;  1TWF J;  2N8G A;  1HOM A;  5C44 J;  2JA5 J;  1LE8 A;  5IOZ A;  2ID3 A;  4L5E A;  2R5Y A;  2E19 A;  2HOT A;  2CJJ A;  3A01 A;  1IJW C;  3S15 J;  2JWT A;  3BTL A;  3S14 J;  2Y30 A;  4V2F A;  5F1J A;  1QVT A;  5IP7 J;  2M0C A;  5E3M A;  4IHV A;  2WV1 A;  1TWC J;  1GT0 C;  2FD5 A;  2L0K A;  3H0G J;  1D5Y A;  3BR5 A;  1RR7 A;  5EF6 A;  5FJ8 J;  2R0Q C;  1AKH B;  4IHY A;  2XPU A;  3TP3 A;  5IP9 J;  1ZR4 A;  3BTJ A;  3C2B A;  1GV5 A;  3I4N J;  3S2H J;  3BQZ A;  1MH4 A;  2JK3 A;  1B8I B;  2MW8 A;  1MBJ A;  2HXO A;  3LOC A;  3QQA A;  5J1R A;  2L9R A;  1AHD P;  2Y2Z A;  3VPR A;  4D7N A;  1P7I A;  1JT6 A;  4C2M J;  3GTG J;  2IBD A;  2M8G X;  4FIS A;  2IEK A;  2DMU A;  3QPL A;  3M4O J;  5C4J J;  2K9Q A;  1AKH A;  3W6V A;  1OJL A;  4DW6 A;  1I50 J;  1IDY A;  3LNQ A;  2E2I J;  1FEX A;  1I6H J;  4CYC B;  2MSY A;  2DMT A;  4XRM A;  1XS9 A;  3HOY J;  1A5J A;  1B8I A;  3FKI J;  3RKQ A;  3B6C A;  1G2H A;  2XGE A;  3IH2 A;  4A93 J;  5E3L A;  2DA1 A;  3JRG A;  4BY1 J;  1FTT A;  1XC5 A;  4A69 C;  2HOS A;  2DA3 A;  2YS9 A;  2L7Z A;  3GTJ J;  1TC3 C;  2LY9 A;  2XRL A;  1DU6 A;  3S16 J;  5F0C A;  4NDL A;  4AYB N;  4DYC A;  4CYC A;  3FIW A;  3E7L A;  4Y7N J;  4B4C A;  2E2J J;  1WGX A;  3LSJ A;  4D5C A;  4DYR A;  1IUF A;  2HDD A;  1H8A C;  5EZG A;  3PO3 J;  3UKG A;  5C4X J;  1E3O C;  5FKL A;  3PM1 A;  4RDU A;  1UMQ A;  2DMP A;  1FIP A;  2EBI A;  5DTD A;  2CU7 A;  2JJ7 A;  4MFE A;  2LKX A;  2EZL A;  5F0H A;  2Y31 A;  1I3Q J;  1HF0 A;  2CRG A;  3HKZ N;  2H1K A;  3NAU A;  3RQI A;  1QRY A;  3WHC A;  2X48 A;  3BR1 A;  1VFC A;  3GTL J;  3MN2 A;  2FX0 A;  1WCM J;  4AUX A;  4W97 A;  1YRN B;  5IPA A;  2R7Z J;  3F0C A;  2OF7 A;  2TCT A;  2NOG A;  3ZQC A;  3MKL A;  1JKP C;  2L7M P;  3Q0U A;  4UUS B;  1H89 C;  4M3G A;  3IV5 A;  1Z0X A;  2LP0 A;  1UG2 A;  1APL C;  3BR2 A;  4IHW A;  2JN6 A;  2LD5 A;  2GM4 A;  2VKV A;  3HM5 A;  5HOD A;  2AO9 A;  1YRN A;  1SAN A;  5GPA A;  3GTQ J;  3B6A A;  1GV2 A;  2NVQ J;  1UHS A;  5F04 A;  2Y0S N;  2Y9Z A;  1ETY A;  4A3E J;  2LTP A;  4UUS A;  3JRF A;  3MVP A;  3FIS A;  5K7Z A;  3LSR A;  2B63 J;  1H88 C;  2LFB A;  3BR3 A;  3IH4 A;  5GP9 A;  3OSF A;  3HOU J;  4FTH A;  3GTK J;  2R93 J;  1BW5 A;  1RPW A;  5K7F A;  2DMQ A;  2CQQ A;  3ZOB A;  1B72 B;  2NS7 A;  3HEF A;  1FJL A;  1S7E A;  2DA2 A;  1MNM C;  1XG1 A;  4A3K J;  1FTZ A;  1BW6 A;  1ZTR A;  2FJ1 A;  4JP0 A;  3TED A;  2XGC A;  1ITY A;  1OFC X;  3BG5 A;  5FKK A;  4DYQ A;  2WAQ N;  1JGG A;  1GVD A;  4UUT A;  1Y1W J;  4A3D J;  2KT0 A;  2EZH A;  1B72 A;  4DZJ A;  1HCR A;  4M3D A;  1HDD C;  4XRS G;  1WH7 A;  3TW6 A;  3BR6 A;  2HOA A;  1U9N A;  4A3G J;  3LSP A;  4A3L J;  5J1U A;  3GTM J;  1MSF C;  5FLV A;  2NVT J;  1R9T J;  3CDL A;  5EZH A;  2OPT A;  4DZP A;  3S1N J;  4IEJ A;  4FE4 A;  1JUS A;  4S0H B;  2DN0 A;  2QCO A;  4JX4 A;  1LFB A;  3Q0V A;  1WH5 A;  3BTC A;  3GTO J;  1JKR C;  3FK6 A;  4EEF G;  2ECC A;  2CUE A;  3S17 J;  2ZB9 A;  5M5Y J;  1W0U A;  4FCY A;  4A3I J;  2TRT A;  4A3M J;  1RKT A;  1W0T A;  2W48 A;  3HOW J;  1RKW A;  2WB1 N;  3WHB A;  4B3A A;  1OCT C;  2Y9Y A;  3FK7 A;  1GDT A;  1MBF A;  2G0E A;  3SDG A;  1K83 J;  2LVS A;  1JTY A;  2MGQ A;  5E3O A;  2DA7 A;  1U8B A;  2RAE A;  2XSD C;  3TP0 A;  5J1Y A;  2M9H A;  2X6O A;  3GBG A;  1VND A;  5IYC J;  4D7M A;  1MBG A;  2PMZ N;  5M3F J;  2EZK A;  4C3J J;  1ETQ A;  1ENH A;  3BT9 A;  3JRI A;  4Y52 J;  4MFD A;  1BJZ A;  5IP6 A;  1LFU P;  4MIM A;  5FKN A;  1SFO J;  1IGN A;  1BA5 A;  4QIW N;  4B1R A;  3BQY A;  1HDP A;  1NTC A;  5GPC A;  1JTX A;  1NK2 P;  4MO7 A;  2NVX J;  2D5V A;  2I10 A;  1HLV A;  3BG3 A;  2LLK A;  3RZD J;  2XGD A;  1NK3 P;  2JA7 J;  1IDZ A;  4XID A;  3BR0 A;  3G1O A;  2E1O A;  4G12 A;  1ORK A;  2XPV A;  5F0F A;  3PO2 J;  3ZQI A;  3JRH A;  2HYJ A;  5EGO B;  1F43 A;  3Q3S A;  1X2M A;  1ETO A;  4XIC A;  1MBH A;  5EYR A;  1MH3 A;  1DU0 A;  4QSH A;  5F08 A;  1VI0 A;  2MG4 A;  2R5Z B;  2LR8 A;  3A03 A;  3DCF A;  1QVU A;  2GBY A;  1X2N A;  3CMY A;  1K61 A;  1ZQ3 P;  3SJM A;  2HXI A;  5FKM A;  1WPK A;  2GLO A;  3I4M J;  3IH3 A;  1JKO C;  4BKX A;  3JRA A;  2KDZ A;  3H3V K;  4A3C J;  1P7J A;  1MBE A;  3LSG A;  1Y1V J;  5IOY A;  1JKQ C;  1ETW A;  3HBL A;  1WI3 A;  1MSE C;  5EGO A;  4BXX J;  1ZK8 A;  1JUP A;  4XRS A;  1JUM A;  2ME0 A;  2R92 J;  2R5Z A;  1OCP A;  2CUF A;  4JX5 A;  1QPI A;  5K7H A;  3G1L A;  2VPR A;  3M3Y J;  2QF7 A;  4A3B J;  3JRB A;  2EZI A;  5FLM J;  5J3L A;  2DMN A;  3A02 A;  3GTP J;  3BG9 A;  3HDD A;  4GFB A;  3S1Q J;  1JJ6 C;  3K2A A;  2P81 A;  5EG0 B;  4FE7 A;  5C3E J;  2YU9 J;  1AU7 A;  2ELK A;  1TWA J;  1ZGW A;  1MBK A;  1Z77 A;  1ZR2 A;  1O4X A;  3HB9 A;  3HOZ J;  1F36 A;  5DS9 A;  3QPS A;  4AC0 A;  1Q1V A;  1ETX A;  1JT0 A;  2HQ5 A;  2LK2 A;  3ZQG A;  2K40 A;  4M3B A;  2AHQ A;  1PUF B;  5BNG A;  2CQX A;  4JYK A;  1POG A;  5FKO A;  2JA6 J;  3S1M J;  5EG0 A;  1IV6 A;  4C3H J;  2XB0 X;  1IRZ A;  3L1P A;  2DA6 A;  2M34 A;  1JJ8 C;  3CQZ J;  4IHX A;  1RES A;  1IG7 A;  4J19 A;  5M5X J;  4M3E A;  3OSG A;  4I6Z A;  3ZQF A;  2K9S A;  3Q0W A;  1ZKG A;  3HOX J;  2YUS A;  1PUF A;  3RZO J;  2JMW A;  3G1M A;  4BBS J;  2O8K A;  3HGY A;  3OOU A;  4X6A J;  4BY7 J;  3TW7 A;  1U78 A;  1VF9 A;  1GUU A;  3JRC A;  2H8R A;  3HOV J;  3DEW A;  3ZQL A;  4C3I J;  2IAI A;  4BBR J;  3OIO A;  3JRD A;  4W1U A;  1RET A;  2E2H J;  2DA4 A;  1T56 A;  2EQR A;  2L7F P;  5IYD J;  2COB A;  3S1R J;  2DJN A;  2ECB A;  2VUM J;  4XK4 A;  4A3F J;  4ABZ A;  1U9O A;  3K7A J;  1X58 A;  3O8G A;  1A6I A;  3JR9 A;  1TWG J;  4HNV A;  3S2D J;  3O8H A;  3ZQH A;  5E3N A;  3CCY A;  4X1E A;  2ME6 A;  1T33 A;  1TWH J;  2ID6 A;  2DA5 A;  5EEA A;  3D1N I;  4RBO A; 
#chains in the Genus database with same CATH topology
 5JLW A;  4KT5 C;  4AVP A;  2DT5 A;  2UXN A;  1AA7 A;  1E2X A;  4LOC A;  2QA4 I;  3GFJ A;  1LE8 B;  2EH3 A;  4U87 A;  2L9N A;  4CUG A;  1PJR A;  4NC8 A;  3ZCO A;  5J6X A;  2NRA C;  2PMU A;  4U7D A;  4ZTF A;  3P9I A;  2KKO A;  2X9D A;  1TLH B;  3DPT A;  3AFH A;  3Q9V A;  1P9Q C;  1HKS A;  4NBQ A;  4MLO A;  2VKE A;  2O9L A;  5FRN A;  2K4J A;  1ERD A;  4QTR A;  2RQQ A;  5F27 A;  1W7P D;  2ZJ2 A;  3SFI A;  3ZMV A;  1FIA A;  4M3F A;  1KON A;  4KJZ A;  2ZCW A;  3DKX A;  3AAF A;  4L5E A;  3VDX A;  5D5W B;  2QEN A;  2CJJ A;  4LLG F;  3H5N A;  2YSR A;  2P4W A;  1IJW C;  3S15 J;  3GME A;  3K70 C;  1BC7 C;  4ZDP A;  3DKW A;  4KUM A;  1T8I A;  4KNY A;  5F1J A;  5IP7 J;  4HV6 A;  1XTA A;  3D5L A;  5HS7 A;  4K2E A;  3ZRG A;  5E3M A;  1TWC J;  1F9N A;  2GOX B;  1AKH B;  3TOA A;  3TP3 A;  1TT5 B;  2QQB A;  3CJQ B;  3UR3 C;  4CCL A;  1QZE A;  4II3 A;  1ZRC A;  1KYW A;  1TNS A;  1IN5 A;  2DYR H;  3J7A Y;  5J1R A;  5KCM A;  2L9R A;  4EGY A;  1SC7 A;  4CDG A;  1SD6 A;  1XX5 A;  1W5C C;  3F8C A;  3Q9S A;  3L00 A;  3CCL I;  3H3U A;  2IEK A;  1Y0N A;  3HXL A;  2ZME C;  3QPT A;  5C4J J;  4XMY A;  3RKX A;  1A6Q A;  4PJ0 C;  2L54 A;  3GWZ A;  1R1V A;  2UV1 A;  1FEX A;  3DLL F;  1IN7 A;  2A07 F;  4CZC A;  3MFK A;  4V19 K;  4L5J A;  5JHF A;  1A5J A;  3CP2 A;  3ZR8 X;  4GDF A;  5AIP A;  5H20 A;  1QHG A;  4Y13 A;  3HYI A;  4RAF A;  3IWF A;  2Q1Z B;  4IQJ A;  3LAP A;  4OMY A;  4RAY A;  3QYE A;  1XPX A;  1XC5 A;  1V4R A;  2DA3 A;  2L7Z A;  3GTJ J;  2LY9 A;  2J5O A;  5ERI A;  3TKY A;  2DTR A;  3KEY A;  3UNG C;  1UHW A;  4LK1 F;  4Y7N J;  2E2J J;  3S3M A;  5HLH A;  2H1L A;  4NUB A;  4PJN A;  1IW7 F;  4KIF A;  3MKY B;  4M9Z A;  3PO3 J;  3ZMD A;  2HQR A;  4BH9 A;  4H0E A;  3KLN A;  1KZH A;  5LD2 C;  4IL6 C;  4B3X A;  2ZKZ A;  5L3F A;  4RDU A;  3CCU I;  1MNE A;  1G6N A;  2F5F A;  2VT2 A;  2CQ7 A;  2EBI A;  2BYV E;  4ZDL A;  2VE9 A;  3F21 A;  1G3W A;  1O57 A;  2W00 A;  3RDI A;  2FNA A;  2Y31 A;  3BRO A;  3VYU B;  4D9J A;  2Y0S A;  1MIJ A;  1N25 A;  2CRG A;  2OJE D;  5A2Q Z;  4LFU A;  2H1K A;  2DT7 B;  3NAU A;  3SDB A;  3M1C A;  4C2T A;  3MZH A;  4LG0 B;  3GZN B;  3KET A;  3MN2 A;  3IAM 2;  3DTK A;  4XKC A;  4W97 A;  1IO2 A;  5FRO A;  3F0C A;  1GHC A;  4RM2 A;  1JHF A;  4A12 A;  2LOO A;  2L7M P;  4BHP A;  3T1B A;  2E60 A;  3E6C C;  4LLL A;  2HKX A;  1H89 C;  1UG2 A;  2WY8 Q;  1B9N A;  1BI1 A;  3VYT B;  1FOX A;  4A5M A;  2K86 A;  4QLC U;  2JN6 A;  2HGC A;  1JI8 A;  5D5U B;  4RGS A;  2A69 F;  4A5N A;  1H9G A;  5L3E A;  2FNP A;  1DPR A;  3K4C A;  2HTS A;  1SAN A;  3WTW C;  2KQR A;  1U6G A;  1BN5 A;  3VSK A;  1YX5 A;  4ENK A;  2L5Q A;  4HZF A;  1MMA A;  2DK5 A;  1WQ2 A;  2AXL A;  4MQV A;  3BR3 A;  3KEO A;  1IUY A;  3IH4 A;  4IF4 A;  4AU7 A;  1TP4 A;  1S7O A;  3FF5 A;  4IHS A;  4DBQ A;  3QU6 A;  3DF8 A;  2K3P A;  4BEH B;  3FXJ A;  2YR2 A;  2DMQ A;  2CQQ A;  1WWX A;  2CUZ A;  1FJL A;  1MNM C;  4RA2 A;  4A3K J;  4LMY A;  2L9V A;  2W85 A;  1BW6 A;  1ZTR A;  5B1B H;  2PJR B;  3BZ6 A;  3GLL A;  3OYK A;  3N97 A;  5E79 C;  1LUJ B;  5DCM B;  2W82 A;  1FSH A;  2WB1 A;  2V26 A;  4XRF A;  4NQW A;  5FKK A;  4DYQ A;  2WAQ N;  4PSW A;  3BG6 A;  1MZB A;  1YFH A;  4OIR F;  2O03 A;  1C0W A;  2KT0 A;  5DEQ A;  4A3D J;  5E1Z B;  3TL4 X;  1TBX A;  3E3V A;  2FQ3 A;  4M3D A;  1IV8 A;  3E6D A;  2E1C A;  4A3G J;  2NYX A;  4A3L J;  1DGR M;  3EYY A;  3HKZ A;  3NEU A;  1FBS A;  3IUO A;  3CC4 I;  4J00 A;  4I01 A;  2F5V A;  3WG9 A;  4C30 A;  2LMD A;  2NVT J;  4XM3 A;  2VL8 A;  3QPH A;  4EVI A;  2MLK A;  3CDL A;  4PDK A;  1SVO A;  4F52 A;  2RN7 A;  3C1D A;  4ENN A;  3J7A O;  3QYB A;  4B8X A;  3U1K A;  1V5F A;  3PIO F;  1UHM A;  1LFB A;  3CCV I;  1WSU A;  5HNH A;  3GTO J;  2Z2S B;  3FK6 A;  4EEF G;  2PJP A;  3CC2 I;  1Y8Q B;  2LY2 A;  4HG2 A;  2PFB A;  2L4M A;  4BQA A;  4QPO A;  4ZC3 A;  5M5Y J;  4HDU A;  4AM3 A;  4FCY A;  1W0T A;  5L3D A;  5HLT A;  4ESB A;  1A35 A;  3RPU A;  3FMR A;  2ISZ A;  2F5E A;  2G0E A;  3OYA A;  2O8X A;  1LFP A;  3AG2 H;  3K4M A;  5FD6 A;  5J4Y A;  1OLT A;  1JTY A;  2MGQ A;  1YTY A;  4F91 B;  4M71 A;  1EA3 A;  5BQT A;  1U8B A;  1REP C;  2GXG A;  2RAE A;  2EIL H;  3HIF A;  3CCE I;  1VND A;  1Z05 A;  5IYC J;  1WJA A;  4S05 A;  1MBG A;  2E36 A;  2MA3 A;  3Q5F A;  2PMZ N;  4A2U A;  4EJU A;  5M3F J;  3RIR A;  1R22 A;  4AID A;  4XR6 A;  2K85 A;  4KYW A;  3KZY A;  1R5G A;  2G9W A;  3JRI A;  5BOX A;  4MFD A;  4QPQ A;  5BPD A;  1NG7 A;  3TO6 A;  1LFU P;  1QA6 A;  2HKO A;  2AS5 F;  3FMS A;  3PL8 A;  1FT9 A;  2IRF G;  4Y15 A;  2CV2 A;  1I6X A;  2VQG A;  1LDJ A;  5GPC A;  2X51 A;  2A05 A;  2D5V A;  2CQN A;  1DP3 A;  4A6E A;  3V7S A;  1Z67 A;  2PQ8 A;  1QQI A;  2XF5 A;  3BZK A;  3WTU C;  2E1O A;  4EGZ A;  3FHZ A;  1X1B A;  2WAD A;  4XLA A;  5HVQ C;  5L3G A;  3FMQ A;  3QP6 A;  3PO2 J;  3JRH A;  3GFM A;  5EGO B;  5HLI A;  5CKT A;  3Q3S A;  2LRD A;  1OR7 A;  1XGM A;  2BY1 A;  3ASN H;  4ITV A;  1LJ9 A;  1R58 A;  3LFK A;  2FUG 2;  2LR8 A;  2BW3 A;  3DEE A;  1LVK A;  1QVU A;  2LRE A;  2GBY A;  1X2N A;  3QWL A;  2E35 A;  3VOD A;  4ZH4 F;  4ZDO A;  2CSO A;  3K4K A;  1JKO C;  3JRA A;  3GZ6 A;  2X1C A;  2IJL A;  1ZAR A;  2DOE A;  3LA3 A;  3K70 D;  1AWC A;  2EWN A;  3L2W A;  1R49 A;  2MYS A;  5LGN A;  1WI3 A;  2JPB A;  1VQ7 I;  5LGU A;  3KZI C;  3E6M A;  4XRS A;  2HWV A;  2ME0 A;  2R92 J;  3WE3 A;  2FML A;  3LA2 A;  1LQ1 A;  1SVM A;  1U5T A;  4KIC A;  1IF1 A;  2RRE A;  3DWL E;  4Y3O A;  3I53 A;  2IS1 A;  2VBY A;  3JRB A;  5FLM J;  3LL7 A;  3KP5 A;  4P55 A;  4HF0 A;  2LKP A;  2P81 A;  2KIQ A;  3EET A;  3ECO A;  2HVS A;  4N4O B;  3PNY A;  4G6D A;  1ZRD A;  3CJN A;  1F36 A;  2EB7 A;  4UB8 C;  2V1N A;  1I3A A;  1Q1V A;  1WJF A;  3J7Y J;  4TV7 A;  2Y75 A;  1TQI A;  4XLE A;  2DFF A;  1X3W B;  2KJC A;  4IRH A;  2QKL B;  4KN4 X;  3GX4 X;  3E0J B;  2VJ4 A;  3MD2 A;  1XCB A;  1PP7 U;  3G2B A;  1X1D A;  4BQN A;  1CGP A;  5EG0 A;  2JA6 J;  2P0W A;  4DNC A;  4NB5 A;  2IVM A;  3A4C A;  4I09 A;  1YI2 I;  1OYY A;  1O7F A;  4U0Y A;  1KQ9 A;  1FX7 A;  1XMX A;  4KT6 A;  3OIQ A;  1G3Y A;  1UB9 A;  4J19 A;  1PP8 F;  2VLA A;  3LSM A;  4M3E A;  3J7Z I;  3ZQF A;  4BE0 A;  3C7J A;  3OOP A;  3Q0W A;  2YUS A;  4BYY A;  2JMW A;  3OYD A;  2QBY A;  3I3L A;  1R5H A;  5ICG A;  3HUG B;  2HTJ A;  3HGY A;  2VN2 A;  1RNL A;  1V3F A;  5GAG J;  2L01 A;  2KIM A;  4R1H A;  3BG7 A;  1MMN A;  1RC9 A;  1ON2 A;  1GUU A;  2CYY A;  3DEW A;  1ZAO A;  1K6O A;  2IAI A;  3WU1 B;  4BBR J;  1TNT A;  2DA4 A;  2EQR A;  1WJC A;  3K9T A;  3S1R J;  3ZMT A;  3OS1 A;  3ZXS A;  4M73 A;  1KYZ A;  2O61 A;  4ETS A;  4CCK A;  1U9O A;  2Q2E A;  3K7A J;  1HKT A;  4BNC A;  1A6I A;  3I4P A;  2DDA A;  3BZC A;  3O8H A;  1ZG1 A;  1TQP A;  5FGM A;  5E3N A;  1ZGJ A;  4CSW A;  2E71 A;  3V8K A;  3J80 Z;  1T33 A;  5J40 A;  4F7Z A;  2OTJ I;  4EQQ A;  4F55 A;  5D4S A;  1QGP A;  1P6R A;  4A3J J;  1SVL A;  1EKE A;  1BR2 A;  2GAU A;  1EF4 A;  2DOF A;  5EDN A;  2W24 A;  1BL0 A;  2KFD A;  1QPM A;  1N78 A;  2P5L C;  4IJA A;  3HRS A;  9ANT A;  4XBF A;  2M2E A;  1CQT A;  2NVY J;  2K5C A;  4L9N A;  2GXA A;  2FOK A;  5E20 A;  5TGT A;  1ZEL A;  3DPU A;  1K7A A;  2JA8 J;  3CLO A;  1ETK A;  2VQC A;  1S5L C;  3SQN A;  5IYB J;  2XB5 A;  5IY5 H;  3GYH X;  1ETV A;  2ELJ A;  3S32 A;  4ON0 A;  1L0O C;  1A36 A;  4B48 A;  3WTV C;  1HW1 A;  5A2Q K;  4CGZ A;  2N8G A;  3G6E I;  4OWR B;  2IA1 A;  2FBK A;  2J5P A;  3H35 A;  3IP4 B;  5IOZ A;  4X0G A;  3RI4 A;  2HQN A;  2R5Y A;  2DBB A;  2E19 A;  2UUZ A;  2ZNZ A;  3A01 A;  4CCO A;  3BTL A;  4B09 A;  4V2F A;  2R7X A;  1QVT A;  1SD4 A;  2M0C A;  2UWM A;  3F22 A;  4IHV A;  2WV1 A;  1LVA A;  3S3N A;  2FD5 A;  3BR5 A;  2R0Q C;  4IHY A;  2XPU A;  2KZG A;  2WY7 Q;  3F8F A;  2B9S A;  2PBI A;  4CH7 A;  2BVM A;  2X0L A;  3OR1 C;  1JE8 A;  3R0J A;  1I1S A;  1GV5 A;  2IGN A;  2Z33 A;  1QZY A;  3S2H J;  3K1N A;  5EEG A;  1CF7 A;  4YEJ A;  1MH4 A;  4N9I A;  1IN6 A;  2MW8 A;  1MBJ A;  2BXY A;  2HXO A;  1Z7L A;  3I58 A;  3QQA A;  1WVR A;  1TW2 A;  3M8F A;  3CMA I;  2JSP A;  2JVG A;  1P4W A;  3OMY A;  1HSJ A;  4FQG A;  3ROU A;  1R6R A;  2CH0 A;  3VPR A;  4D7N A;  3BP8 A;  3GTG J;  2IBD A;  5TJJ A;  4KIS A;  1VQK I;  2YPR A;  2R7T A;  1W7P A;  2DMU A;  3QPL A;  3M4O J;  5H6R A;  2M87 A;  3LQR A;  2K9Q A;  3KFW X;  3W6V A;  3QOD A;  4HW0 A;  4JQF A;  4N0B A;  3T8R A;  3GEZ A;  4CXF A;  1HW5 A;  3FZV A;  1ONV A;  2DMT A;  4PFP A;  3CCM I;  2R7U A;  1XS9 A;  3HOY J;  1EH8 A;  1B8I A;  3RKQ A;  4OMZ A;  1HBX G;  3E5U A;  3ULQ B;  1OCZ H;  1IZ1 A;  2QVO A;  1G2H A;  4ZYG A;  1X1C A;  3KX2 A;  1Z1D A;  4HQE A;  3CUQ C;  4BQO A;  2DA1 A;  5B66 C;  4BY1 J;  2DT6 A;  1UST A;  4JK1 X;  4J01 A;  2YS9 A;  1TC3 C;  4OIO F;  5BMZ A;  5F0C A;  4PSX A;  1R4M B;  5DYM A;  3JTH A;  5D5X B;  2GIV A;  3B02 A;  4CYC A;  3E7L A;  2XRN A;  4F92 B;  4L0Y B;  2OQG A;  1NHA A;  4DYR A;  2LNB A;  5CLS A;  1H8A C;  5EZG A;  5DUI A;  2FBH A;  4XON A;  2COM A;  4EMS A;  5FFX A;  1E3O C;  4L0Z B;  5C4X J;  1MMD A;  5FKL A;  2E7X A;  5LLQ A;  2VXD A;  1Z3X A;  2ZXJ A;  1UMQ A;  1YW7 A;  2DMP A;  3CCS I;  4RAZ A;  1FIP A;  4XSZ F;  2BEO A;  2DLL A;  1T0F A;  1T08 B;  2JJ7 A;  1PDN C;  3DQV C;  4MFE A;  2LKX A;  2CV0 A;  3GLX A;  4F93 B;  4GYG A;  1IRX A;  2P6T A;  2VBX A;  1I3Q J;  3H5A A;  4XKB A;  3ONQ A;  2BY2 A;  1KQ8 A;  4BJ6 C;  3RQI A;  2DCE A;  4KIG A;  3BR1 A;  3GTL J;  3CTA A;  2FX0 A;  3WTZ A;  4AUX A;  4I7H A;  3OYI A;  1LEB A;  2FU4 A;  4KA4 A;  4LB5 A;  2R7Z J;  3P7N A;  3BPV A;  1OYI A;  2CW8 A;  3BDD A;  1FMV A;  2VON A;  3ZMU A;  4PUS A;  4YFX F;  3ESW B;  3GFL A;  2GQQ A;  3IV5 A;  2XAH A;  2KZV A;  1D1B A;  4BQQ A;  2VPL A;  2H8W A;  3BR2 A;  2EFO A;  2JA2 A;  4IHW A;  2LD5 A;  2HEO A;  2GM4 A;  1SAX A;  4U88 A;  2M8E A;  3BPX A;  3LWF A;  2DPD A;  5LBQ A;  2AO9 A;  3HSE A;  1YRN A;  3EUH A;  3CDH A;  3LFU A;  4P9F A;  2NVQ J;  2WAQ A;  4A3E J;  3C18 A;  4LLN A;  1D0X A;  1RRJ A;  3GO5 A;  1U8R A;  2HDC A;  3FXM A;  2NS0 A;  2WA0 A;  1D1A A;  1ULY A;  3IKV A;  3S2W A;  2LFB A;  5K1Y A;  1E17 A;  3GUD A;  5JR3 A;  4HX7 A;  3M8E A;  5GP9 A;  3HOU J;  1X19 A;  2X1E A;  4FHT A;  3RJP A;  1YIJ I;  2ZXW H;  1UFM A;  1USS A;  2R93 J;  4NQW B;  1VQ6 I;  1AOY A;  3VYR B;  5LEJ A;  1RPW A;  4EJW A;  3D5S C;  3CO7 C;  4YIR X;  3GFI A;  2XHK A;  2OV7 A;  2DA2 A;  3MEX A;  3ABU A;  2V7F A;  2L02 A;  3I59 A;  5CVJ A;  1FTZ A;  2FJ1 A;  2M0M A;  4JP0 A;  4E7L A;  3KP2 A;  1T38 A;  3TED A;  2MD5 A;  1JHH A;  4HLY A;  4D1Q A;  1OFC X;  1JGG A;  1GVD A;  2F4O B;  1Y1W J;  4IX7 A;  3HSF A;  1W5S A;  4Q47 A;  4XRS G;  3TW6 A;  2OTL I;  1K79 A;  3ABK H;  1FC3 A;  4WXH A;  3CCQ I;  3BLY A;  3F8M A;  2ZO4 A;  2KDO A;  1Y0U A;  5J1U A;  3RQ4 A;  2NXN B;  4UY8 I;  1H0M A;  2Z5U A;  1WJ5 A;  2XAF A;  4HOB A;  3S3O A;  3H9G A;  5FLV A;  2OQR A;  3L09 A;  4OOI A;  5EZH A;  3R6S A;  3WE2 A;  1D0Z A;  2BGC A;  2PMZ A;  2OPT A;  2PN6 A;  1VZ0 A;  2JRM A;  1Z9C A;  4Y4R A;  3HHH A;  4A0Z A;  5J8F A;  3RPQ A;  2QEX I;  4JX4 A;  1F5T A;  1P2F A;  1W5T A;  3BTC A;  4M6X A;  2KLO A;  3L2Q A;  1XDU A;  3ERM A;  1FMW A;  3OYM A;  5TIS C;  4WX9 A;  3FBN B;  1S29 A;  5KHD A;  2OCC H;  3GF2 A;  3RYP A;  3T8T A;  3HL2 A;  3RSN A;  4AIJ A;  3DEU A;  4A3I J;  2TRT A;  2RKH A;  4GRI A;  4GYI A;  1RKW A;  3WHB A;  3CME I;  1OCT C;  2E34 A;  2Y9Y A;  4B43 A;  1GDT A;  3M7G A;  3WTX C;  1MBF A;  1O3T A;  2HVQ A;  2KHM A;  2KL4 A;  1F4K A;  5H2F C;  3R4K A;  5LHG A;  2NAZ A;  5E3O A;  5LHI A;  3AL0 B;  1G4D A;  1OCO H;  3TP0 A;  2VJI A;  1D5V A;  3GBG A;  4O3M A;  4WXC A;  1OCR H;  3W3C A;  1FWZ A;  2CW0 F;  5DD8 A;  1KU9 A;  4XLH A;  2EZK A;  4LIV A;  3QYF A;  2ZSI B;  4UVC A;  2VJJ A;  1FBQ A;  2LF8 A;  5CJ9 A;  1ETQ A;  3BT9 A;  2OD5 A;  1RR8 C;  3DU6 A;  1BJZ A;  3JAM Z;  3K4N A;  3K69 A;  5IP6 A;  3ZPL A;  2W84 A;  4XNF A;  1IGN A;  1BA5 A;  1U2W A;  2EA4 A;  2OA4 A;  1FLI A;  2M5W A;  3BQY A;  1NTC A;  5HOO A;  2O6G E;  3GZ5 A;  2STW A;  2BW3 B;  1JTX A;  3ABT A;  2IA0 A;  2NVX J;  1RZ4 A;  3W2W A;  3BG3 A;  2YU3 A;  1KU2 A;  3HC7 A;  2EFW A;  3BJA A;  3RZD J;  2JA7 J;  1IDZ A;  3BR0 A;  3G1O A;  2M7B A;  4N4N B;  5DCF A;  1ODD A;  5DM7 F;  1ORK A;  4U0V A;  3RKW A;  4I0B A;  3H92 A;  1X2M A;  4XIC A;  1MH3 A;  4LD5 A;  4QSH A;  4YEL A;  5FFZ A;  2ADU A;  1VI0 A;  2MG4 A;  5D5V B;  3DCF A;  4RB2 C;  1X3Z B;  2K3F A;  4FT8 A;  1Q1H A;  1U5T B;  4PCQ A;  3PSF A;  1K61 A;  1U3E M;  1ZQ3 P;  4M6Y A;  1WPK A;  2GLO A;  1ZRE A;  2XC7 A;  2I8D A;  4BS9 A;  2KDZ A;  1J75 A;  1MBE A;  3LSG A;  1Y1V J;  1HXD A;  3ZN1 A;  2X6W A;  1OCC H;  1JKQ C;  1YOV B;  3J80 K;  1ZK8 A;  4JBA A;  1JXS A;  1JUM A;  2BY3 A;  3ZMZ A;  4IRI A;  2AQF A;  4WXD A;  2R7D A;  1S8N A;  2CUF A;  1B59 A;  3R60 A;  1XCV A;  1HC8 A;  4ANJ A;  2ZFU A;  2JUG A;  5J3L A;  3A02 A;  3BG9 A;  2BHY A;  3K1P A;  3LST A;  4GFB A;  1BC8 C;  5EG0 B;  3EUK L;  5HS9 A;  1AU7 A;  4FX0 A;  1ZGW A;  1ZR2 A;  1IXR C;  3E5X A;  3SXY A;  5FO5 A;  2E1M B;  1D1C A;  5DS9 A;  4O5V A;  3BC8 A;  3HG9 A;  5K5Q A;  3KZZ A;  1ETX A;  1I1G A;  1D0Y A;  5L3C A;  3ZQG A;  1O3Q A;  2HOE A;  1GXP A;  2AHQ A;  3WTT C;  3OYB A;  3OYF A;  5HDK A;  2QBY B;  4RLF A;  3DBH B;  1SD5 A;  2Z16 A;  2QKM B;  5L3B A;  2XUB A;  5FLX Z;  1MKM A;  4AWX B;  3R0A A;  3TDU C;  3ZQ7 A;  3H9Q A;  1HA8 A;  1IRZ A;  1VQM I;  3BY6 A;  5AON A;  4MEX F;  4O6J A;  1WHU A;  2DA6 A;  3A1Y A;  1VQL I;  1JJ8 C;  3CQZ J;  3OIP A;  2Q8K A;  1G3T A;  4G8X A;  4HF1 A;  1K78 A;  2F5C A;  2BZT A;  3LMM A;  1BR4 A;  1WJE A;  5M5X J;  3OSG A;  2UXX A;  4HNT A;  3F6O A;  3RZO J;  2DO7 A;  4WK8 F;  3DLA A;  3G1M A;  4BBS J;  3OOU A;  5CPR B;  2Q2E B;  4CZZ A;  5F1R A;  2ZME A;  4CHU A;  5BPI A;  1XMA A;  1X4P A;  5CVI A;  1VQP I;  1U78 A;  3J81 Z;  2H8R A;  3ZQL A;  4C3I J;  1BOA A;  1YW9 A;  3OIO A;  2P8T A;  1RET A;  2E2H J;  3SZG A;  1T56 A;  2EJR A;  4XOR A;  1T95 A;  2VQH A;  5IYD J;  2FRH A;  2Z3Y A;  3F8B A;  4XK4 A;  2HU9 A;  3FXU A;  2H09 A;  2VOO A;  1A04 A;  2DAO A;  2VKH A;  3I9V 2;  4HNV A;  3WTS C;  2IGO A;  3VOE A;  1VQO I;  3E6B A;  2A3S A;  2A5Y B;  3SZT A;  2L2O A;  2PI0 A;  4HPQ A;  5HS8 A;  1YQA A;  3CCY A;  2ME6 A;  2IXS A;  3IHU A;  1IAW A;  2ZXI A;  4YFN F;  2B0L A;  3FDY A;  3T0Y A;  3SYT A;  4V2G A;  3DV8 A;  2JRT A;  5M5W J;  2OCE A;  3I54 A;  2R5Y B;  2DDB A;  2FXA A;  4I76 A;  3MKZ A;  2R7S A;  3A01 B;  2O7O A;  2X6X A;  2LF7 A;  3LSK A;  4M6V A;  5M3M J;  3K4L A;  2CW7 A;  4RS8 A;  5D4R A;  2R7W A;  3BTI A;  1ZYR F;  2HI3 A;  4PJL A;  4D5F A;  4JX6 A;  3JRE A;  5E1X A;  1D8J A;  5D8K B;  5LEK A;  3OYL A;  2EFN A;  2KJB A;  2GXB A;  2JA5 J;  4HSR A;  1CF7 B;  1YLF A;  3M8J A;  3ASO H;  1LDD A;  2HOT A;  2WTE A;  1BIB A;  5LGT A;  4IO9 F;  2FE3 A;  3CO6 C;  3KYD B;  3OS2 A;  2M3A A;  2JWT A;  1HW2 A;  3F72 A;  2Y30 A;  4E7H A;  4BGD A;  1FYM A;  3WGH A;  1W7P B;  4RGU A;  2VE8 A;  3OS0 A;  3MMY B;  1XN7 A;  3H0G J;  3VB2 A;  5FJ8 J;  1D5Y A;  2WAE A;  1MGT A;  2EV6 A;  1ZR4 A;  3CD6 I;  3OV8 A;  4BDY A;  2DYS H;  5B5E C;  1WZ2 A;  3SHF A;  3I64 A;  4DBR A;  2CO5 A;  2FBI A;  2I5U A;  3ML6 A;  5DM6 F;  4C9Y A;  1SFU A;  4A6D A;  3T5X A;  1W36 C;  2JK3 A;  3U9G A;  4ZZD A;  1B8I B;  3LOC A;  2ZJP F;  2R7F A;  1BM9 A;  2ZJQ F;  2EIN H;  3WU0 A;  1P7I A;  1JT6 A;  3BOQ A;  5JFR A;  2IGK A;  1LPQ A;  2HVR A;  1MMS A;  4FIS A;  2O3F A;  2Y0M A;  3O2P E;  3HPH A;  2FSW A;  2ZXH A;  1FYL A;  2YX7 A;  1ZLK A;  1OJL A;  1XSD A;  1I50 J;  4F3Q A;  3LNQ A;  4ZYA A;  2RDP A;  4CYC B;  2XVC A;  3JCU C;  2MSY A;  2DQR A;  3MKW B;  2PX9 A;  4DQ2 A;  4HF2 A;  2F48 A;  4KFC A;  3HTU A;  2XKO A;  3FBI B;  3G73 A;  2E1N A;  3HRM A;  4E7J A;  3SZP A;  4IXA A;  3G3Z A;  4A93 J;  5E3L A;  1ZRF A;  4KMU X;  1NH3 A;  1FTT A;  5F6F A;  2A61 A;  1V54 H;  1BI2 A;  3DBR B;  2XAQ A;  1J2X A;  1DU6 A;  3S16 J;  4NDL A;  2LBF A;  4AYB N;  1IRF A;  3FIW A;  4EM0 B;  3OL4 A;  4N9H A;  4CIC A;  4B4C A;  1WGX A;  1EJ9 A;  1IUF A;  2HDD A;  1X4O A;  4KIT B;  5D6E A;  4B47 A;  4AVZ A;  4FET A;  2IPQ X;  1BOB A;  1Z21 A;  3DTE A;  2AXT C;  5KK1 A;  3BWG A;  2KIF A;  4BAY A;  1LKX A;  4L9T A;  5GTH C;  3F23 A;  3CCR I;  3L9F A;  1HF0 A;  1FZP B;  1XB4 A;  4M9S A;  4MQ9 F;  2E5N A;  3FM3 A;  3A0B C;  3HKZ N;  4AIH A;  4HYE A;  5GAE J;  5D8L B;  1M1E B;  2BHZ A;  3ZMS A;  1T39 A;  2X48 A;  1LNW A;  2M1B A;  1WCM J;  4EM2 A;  1QO0 D;  1TT0 A;  2MFZ A;  2CFO A;  3LAJ A;  1YRN B;  5IPA A;  3V8J A;  3ZN0 A;  3NQO A;  1SMT A;  2A68 F;  2OZU A;  2TCT A;  3EDP A;  1BJA A;  1X1A A;  2NOG A;  2GWR A;  3X2Q H;  3ZQC A;  3H9J A;  3MKL A;  2HZD A;  1JKP C;  1E3H A;  2XGX A;  3TDZ C;  1IXC A;  3O6B B;  3A2K A;  4L5I A;  4P5O A;  3IC7 A;  1RI7 A;  2DW4 A;  2JUC A;  4XOT A;  1APL C;  1L3L A;  1QNT A;  3IKT A;  1WKM A;  2WAF A;  1QU3 A;  1P4A A;  2LSO A;  2VKV A;  3HM5 A;  2JVH A;  5HOD A;  1DQU A;  2MC3 A;  1YYV A;  3TMO A;  2VOP A;  3ABM H;  3E5Q A;  1GV2 A;  2HDW A;  5F04 A;  2BV6 A;  4IOA F;  2Y9Z A;  1ETY A;  3CCJ I;  1DPU A;  2IW5 A;  4MTE A;  4UUS A;  5K7Z A;  1XGO A;  3FIS A;  4Y17 A;  3I59 B;  2HYF A;  2QUF A;  3TQN A;  1OIS A;  1J7K A;  3E1S A;  1H88 C;  2VJ5 A;  4CA0 A;  3JAM K;  1UZC A;  3FM5 A;  3LSH A;  2IS4 A;  3TOB A;  2XF7 A;  3OSF A;  2V1D A;  1MND A;  1KA8 A;  2CWE A;  4G6T B;  4UVA A;  3ELK A;  1WI9 A;  5ICC A;  3EUA A;  1RUO A;  1ZH5 A;  2E5Z A;  1OYW A;  5K5R A;  4P1W A;  1D3Y A;  2HPI A;  2Z99 A;  3L2U A;  5B3S H;  2NS7 A;  2GIZ A;  3PNT A;  3HEF A;  4HRI A;  4L9V A;  1S7E A;  1ON1 A;  2RNJ A;  2LYC A;  3KYL A;  4UXN A;  3HRU A;  3QOE A;  3NWS A;  1ITY A;  1VQ9 I;  1OKR A;  2CUJ A;  2KIU A;  3HSR A;  1B1B A;  3K2Z A;  5HDN A;  4IZZ A;  3BG5 A;  2FMY A;  2ZC2 A;  1NG6 A;  2EZH A;  2QQA A;  3PIP F;  4BAC A;  1B72 A;  4UUV A;  2W1O A;  3A0H C;  1TW3 A;  1KQ0 A;  1X1P A;  3C3W A;  3DU5 A;  4XOP A;  2K02 A;  3OR2 C;  3LSP A;  1W1W E;  2EIM H;  3GTM J;  4PZJ A;  5LFA A;  2BXZ A;  4BE2 A;  2Y69 H;  4E4H A;  1R9T J;  1I5Z A;  5CQG A;  3WTY C;  3S1N J;  4IEJ A;  4ZZL A;  4E6K G;  1JUS A;  2GA1 A;  2DN0 A;  4OIP F;  4BUP A;  3Q0V A;  1WH5 A;  1JKR C;  4BHC A;  3CF5 F;  2ECC A;  4RB1 A;  2CUE A;  3W2V A;  4LIU A;  2WC2 A;  4EJT A;  5K5O A;  3S17 J;  3H36 A;  1W0U A;  1RKT A;  3HOW J;  1BBY A;  4L18 B;  3I0T A;  2ZNY A;  3IAS 2;  2M45 A;  3SDG A;  3WGG A;  2P5K A;  4HDV A;  2LVS A;  2XAJ A;  3IL2 A;  2Z9O A;  1XSV A;  1UJ8 A;  2R7R A;  1RIO H;  3D0S A;  2QSG X;  4RB0 A;  4EJO A;  3DPL C;  1X3U A;  1SEU A;  4G9Y A;  2XSD C;  3DFG A;  3CC7 I;  2DK8 A;  5J1Y A;  1R00 A;  2G7U A;  2EFQ A;  2EFP A;  2L4A A;  5FLX K;  1MDM A;  4YIF A;  4C3J J;  1BR1 A;  4DGW B;  1ENH A;  1G59 A;  1P92 A;  3JSO A;  4Y52 J;  2XAU A;  1YS6 A;  5BS6 A;  2KRC A;  2QQ8 A;  5FKN A;  5LRS A;  3EYI A;  4YFK F;  2IGM A;  4B1R A;  3I55 I;  3KP7 A;  2OUM A;  1HDP A;  4LIT A;  2A5W A;  2DOD A;  1QBJ A;  1XGS A;  3G4S I;  2JPC A;  2PLY A;  2F4M B;  1KU7 A;  4DJA A;  4Q5S F;  4S04 A;  2I10 A;  1HLV A;  3KCC A;  2VC0 A;  3COA C;  2XGD A;  3NWT A;  1NK3 P;  2GZW A;  1WRJ A;  4OAY A;  1UG0 A;  4BL0 B;  4G12 A;  1STZ A;  3EQL F;  1BI0 A;  5CQE A;  1YO5 C;  5F0F A;  2ICW G;  2L9S A;  3ZQI A;  3J81 K;  2HYJ A;  1F43 A;  5ILV A;  3FKJ A;  1YG2 A;  4WWC A;  4Z2Y A;  3VFZ A;  1MBH A;  5EYR A;  1DU0 A;  1R71 A;  2CGP A;  4EAT A;  4IKF A;  1FBU A;  2HXI A;  4HAM A;  1Y8R B;  2D2W A;  3BJO A;  1QHH D;  3IH3 A;  4E7S A;  3PUB A;  2ACJ A;  1P7J A;  3H1C A;  3MQ0 A;  3K4J A;  5IOY A;  3GW2 A;  4BU2 A;  2H6C A;  2X85 A;  5CYV A;  4A0X A;  3M07 A;  1G3S A;  2CS3 A;  4I0A A;  3RKY A;  1FNN A;  2R5Z A;  4M9X A;  4JX5 A;  2Q0O A;  3TBI A;  2XF6 A;  1QPI A;  2EIJ H;  3AKZ A;  2LY1 A;  2VPR A;  2HR3 A;  2MC4 A;  4DOZ A;  2C6Y A;  2VQL A;  1W36 D;  2JQ7 A;  2Y48 A;  1SFX A;  1JJ6 C;  3K2A A;  2GOM A;  1D8K A;  4HST A;  4MTD A;  4G6Q A;  2NOJ B;  2ELK A;  2F5D A;  1TWA J;  3PSI A;  1MBK A;  1Z77 A;  1O4X A;  2ESN A;  3HB9 A;  3TGN A;  4PK4 A;  2R7Q A;  1K78 B;  3O3K A;  4AC0 A;  2D1V A;  2HQ5 A;  2LK2 A;  4CCM A;  2K40 A;  2MD0 A;  3HOT A;  1TL8 A;  4M3B A;  4BDZ A;  4QWQ A;  5BNG A;  2CQX A;  3ABL H;  4JYK A;  1K6Y A;  4XLP F;  2V6E A;  1V55 H;  3FX3 A;  2QLZ A;  1EH6 A;  5HLG A;  4ZJZ A;  1TQM A;  5KAF C;  2ZME B;  3RCO A;  1FP2 A;  2XB0 X;  3SEQ A;  4EM1 A;  4XKW A;  1RES A;  1IG7 A;  4ESF A;  1J0R A;  3CP8 A;  3MZ8 A;  4Z6Y A;  4I6Z A;  1O3S A;  3L2C A;  3AL0 C;  1ZKG A;  3HOX J;  1PUF A;  2PG4 A;  1G8X A;  3OYC A;  4PJJ A;  3I71 A;  3U1D A;  3P9C A;  4G7H F;  2O8K A;  1OPC A;  4I02 A;  5ED4 A;  2ETH A;  2XSJ C;  4AIK A;  2QYO A;  4BJ5 C;  2V1X A;  3L7W A;  1YIO A;  1VQ4 I;  2HPM A;  3JRC A;  3AG4 H;  3CZ6 A;  4OIN F;  2FOW A;  5E18 F;  3JRD A;  4UB6 C;  1OR7 C;  4ASN A;  3KIO A;  2L7F P;  4RMN A;  4ZYD A;  2COB A;  4IVN A;  2DJN A;  2VUM J;  3K4B A;  3CJR B;  4PJM A;  3CUQ A;  3H3Z A;  4A3F J;  5CVR A;  3O8G A;  2KRF A;  4L9J A;  4XSX F;  3JR9 A;  4ESJ A;  5GTI C;  5HNF A;  3OY9 A;  2DJI A;  2RC4 A;  2VXZ A;  2F2E A;  3P5J A;  2ID6 A;  1FPQ A;  2DA5 A;  2OAZ A;  1R4N B;  4RBO A;  4M74 A;  1FYK A;  3C2H A;  2G7H A;  5ILS A;  3WG7 H;  3VYS B;  3HRT A;  3P9K A;  3QRF F;  3EPZ A;  2A6H F;  2LDU A;  1U5T C;  2VI6 A;  2XPW A;  5EEH A;  5CVV A;  2DTZ A;  2FQ4 A;  4HEA 2;  3GCM A;  3FWE A;  4LJZ F;  4UV8 A;  2TDX A;  3U21 A;  2VT3 A;  3NAR A;  5IT3 A;  2NS8 A;  3RTR A;  3HGG A;  4HX8 A;  2K9N A;  5FB2 A;  2XIG A;  2QZ8 A;  2VKD A;  2ZFW A;  2L7K A;  5JLX A;  5ICF A;  3IRQ A;  3L2R A;  1IC8 A;  1FOK A;  4EV0 A;  1ZG3 A;  3CLQ A;  5JVG F;  1FOY A;  1TWF J;  2FA5 A;  1R36 A;  1HOM A;  4WF2 A;  5C44 J;  4KN7 X;  1LE8 A;  1BI3 A;  2ID3 A;  2R7V A;  4UNO A;  2NNY A;  5GAD J;  2P5V A;  4GGG A;  2QM3 A;  2M7A A;  3FXO A;  4HBL A;  3K10 A;  2F6C A;  3KE2 A;  5DD4 A;  3S14 J;  3JSP A;  1K4S A;  3GXO A;  1LB2 A;  3PFY A;  1XSX A;  2ZJR F;  1GT0 C;  2L0K A;  4GCV A;  1RR7 A;  2LKS A;  5EF6 A;  2IT0 A;  1UCR A;  3SEZ A;  2K7L A;  2RV8 A;  4PGG A;  5DUK A;  5IP9 J;  3JTG A;  3BTJ A;  2E1M C;  3C2B A;  5LRR A;  3I4N J;  2HYG D;  2KRH A;  2VBZ A;  2MAB A;  2VBW A;  4AYB A;  3BQZ A;  2BOL A;  3U2R A;  1S9H A;  2X6Y A;  4GXO A;  4Q4Z F;  3DBL B;  1YJN I;  1YX3 A;  4MHG A;  1AHD P;  2Y2Z A;  1QZZ A;  4C2M J;  2M30 A;  3IWZ A;  2M8G X;  4FAS D;  4CO8 A;  1VQ8 I;  1MJB A;  2OU2 A;  1FP1 D;  1AKH A;  1YJW I;  5IT9 Z;  4DW6 A;  2LBF B;  1IDY A;  2E2I J;  3WGI A;  4M72 A;  1I6H J;  4HQM A;  1VTN C;  4FX4 A;  1MD0 A;  3MZY A;  4XRM A;  2D45 A;  3PJR A;  2OZ6 A;  2YX4 A;  1IN8 A;  5F64 A;  3FKI J;  2WBM A;  3N05 A;  4I98 B;  3B6C A;  1PYV A;  2KPM A;  2XGE A;  3WU2 C;  5JI6 A;  2DOA A;  3IH2 A;  5ILU A;  2QSF X;  5E8G A;  3JRG A;  3F6V A;  1ZLJ A;  3V4G A;  1V5G A;  4A69 C;  2HOS A;  3HOS A;  2P6S A;  2XRL A;  2W4S A;  2V9K A;  4E7K A;  3TO9 A;  3QU3 A;  1A31 A;  4DYC A;  3HTS B;  1BIA A;  3LSJ A;  1UAA A;  4D5C A;  4RGR A;  4RB3 C;  3UKG A;  3FHN A;  4XL9 A;  4R8H A;  2CMP A;  3KYC B;  4Q48 A;  3OWT A;  1Z6T A;  3PM1 A;  3LA7 A;  5E8I A;  5DTD A;  1UEL B;  2CU7 A;  3L2V A;  2A6E F;  2OC6 A;  1IXS B;  3DP7 A;  2EZL A;  4XQF A;  1KU3 A;  2MLG A;  1S6L A;  5F0H A;  2KIS A;  1J5Y A;  1HQC A;  3ISP A;  1Z6R A;  4XN0 A;  1WJD A;  1W4M A;  1KGS A;  2EV0 A;  4JOM A;  3W2A A;  1QRY A;  3B73 A;  2P7V B;  3NRV A;  3WHC A;  4NNJ A;  2CV1 A;  3VWB A;  2F4I A;  1VFC A;  4CCN A;  1R5I D;  1VQ5 I;  2QSH X;  4IRG A;  1U0J A;  2OBP A;  4UVB A;  3FXR A;  2OF7 A;  2UZK A;  1XGN A;  2H27 A;  2JSC A;  3H5R A;  2GA2 A;  5E17 F;  3Q0U A;  5FRM A;  4UUS B;  3VEP A;  3F9K A;  1Z3Y A;  5B1A H;  4M3G A;  1Z0X A;  2LP0 A;  2MH2 A;  4LG3 A;  5KNL A;  1I39 A;  3S93 A;  5EJC A;  4LG0 A;  3AG3 H;  3QOP A;  2MH9 A;  4KDP A;  2WV0 A;  1DGW Y;  4HNU A;  1XD7 A;  2XAS A;  5GPA A;  3GTQ J;  4PGH A;  1TZL A;  3B6A A;  2ELH A;  1UHS A;  2Y0S N;  2LTP A;  3QP5 A;  2V4J C;  3K6G A;  3MVP A;  4UV9 A;  3JRF A;  2W25 A;  3BJ6 A;  3LSR A;  1H9T A;  2B63 J;  3RYR A;  2R7O A;  3MAJ A;  1S7A A;  4HLX A;  1Y39 A;  4XKV A;  4XLF A;  4LB6 B;  2ESH A;  4ENJ A;  2H94 A;  4FTH A;  4YRV A;  4OIQ F;  2R3S A;  2V9V A;  2XKP A;  1O3R A;  2DU9 A;  3ZGK A;  3GTK J;  1FY7 A;  2IS6 A;  3KP3 A;  1BW5 A;  1Y56 A;  2K9M A;  3D5R C;  1ZN2 A;  2B7E A;  5K7F A;  2VC1 A;  1E3P A;  2O0Y A;  1J09 A;  3K1M A;  3ZOB A;  4YII A;  3OYJ A;  1B72 B;  4DIQ A;  1P4X A;  3V8L A;  1EH7 A;  2CFX A;  3IRR A;  1T2K A;  1XG1 A;  2DFI A;  4IHT A;  1R1U A;  5FD5 A;  1LDK B;  1J59 A;  4ZYE A;  3OYE A;  1SFE A;  6PAX A;  2V6C A;  2XGC A;  2VAS A;  5D6F A;  5H6Q A;  2LG4 A;  3RPU D;  4ZYH A;  1F1Z A;  4BXF A;  3LQQ A;  4G94 A;  3OYH A;  1ACI A;  3CDI A;  4BEH A;  2XV4 S;  4UUT A;  1EV7 A;  4P9U A;  4IOC F;  2XDV A;  4DZJ A;  1HCR A;  3KLO A;  1HDD C;  1R23 A;  4U0W A;  1WH7 A;  1ZHF A;  2NNN A;  3BR6 A;  2NVU B;  1DDN A;  2HOA A;  4IPA A;  1U9N A;  3PNV A;  3W6K B;  4MEY F;  1T0F C;  2BY0 A;  4U7B A;  3PUF A;  2PJR A;  2ISY A;  1MSF C;  4HV5 A;  2JZY A;  3R61 A;  2HS5 A;  2VIX A;  4OAZ A;  3KP6 A;  3KP4 A;  2KP6 A;  1SFK A;  1Y6I A;  5DCM A;  2W7N A;  4E7I A;  4P96 A;  4DZP A;  5JHU A;  4E70 A;  1DP7 P;  4FE4 A;  2STT A;  4NC7 A;  1V5E A;  4S0H B;  1XMK A;  2QCO A;  2RGV A;  1GLN A;  3V7C A;  4XN3 A;  4XLN F;  4RAG A;  2RVC A;  2ZSH B;  2ZB9 A;  1B4A A;  3DKY A;  4A3M J;  1MDM B;  2RQP A;  2W48 A;  3GVA A;  2WB1 N;  4G7Z F;  1DUX C;  4B3A A;  3FK7 A;  4YG2 F;  2H6B A;  1OQY A;  1TTY A;  2CG4 A;  3M9A A;  2XAG A;  3I5U A;  1K83 J;  1MJ9 A;  3PQJ A;  1R1T A;  4ZTJ A;  2DA7 A;  3CF2 A;  4MGR A;  5TRD A;  1RUN A;  3ZQQ A;  2M9H A;  2LC2 A;  2X6O A;  5LHH A;  4RLQ A;  3EUH C;  3W6J B;  3ERE D;  4D7M A;  3HPG A;  2IP2 A;  5GAH J;  5HDG A;  2EPF A;  3HHG A;  5AIQ A;  5KVR A;  4ENM A;  2X4H A;  2DFE A;  4AD9 A;  4RGX A;  4MIM A;  4A0Y A;  1PUE E;  1SFO J;  2L3D A;  4XLC A;  1Z91 A;  5E1W A;  4QIW N;  1YS7 A;  4EJV A;  2DQL A;  3CJT B;  3MWM A;  3VSL A;  4RM3 A;  1NK2 P;  1T6S A;  3FXL A;  4MO7 A;  1ZGA A;  2A6T A;  2LLK A;  1OMI A;  3QAH A;  2DFH A;  4II2 A;  3HJE A;  5KAI C;  4NC6 A;  4XID A;  4I99 C;  4IQ4 A;  5DV5 A;  4BJT A;  2XPV A;  1YE9 A;  2IS2 A;  1O7L A;  3CUO A;  1HST A;  3CES A;  4E7Z A;  3DTI A;  1ETO A;  2VB6 A;  3KPH A;  2BBY A;  5F08 A;  2R5Z B;  2V9P A;  3V42 A;  3A03 A;  2W57 A;  4D0P A;  2P7C B;  1MW7 A;  4PFO A;  3OYG A;  3CMY A;  3SJM A;  3M1E A;  5FKM A;  3I4M J;  4BKX A;  4H4K C;  2JTV A;  3REO A;  3N4M A;  2E7W A;  3H3V K;  2BE5 F;  2XRO A;  2VOD A;  2QWW A;  4OU0 A;  4A3C J;  2EV5 A;  2LH9 A;  2QGU A;  1ETW A;  2DI3 A;  2EIK H;  2IA2 A;  3ECH A;  3HBL A;  2WWY A;  4GO1 A;  5EGO A;  1MSE C;  2DPU A;  4BXX J;  2CQK A;  1JUP A;  5JVT A;  2BVL A;  1OCP A;  1B6A A;  2EA2 A;  2X1D A;  3WOD F;  4MNU A;  5K7H A;  2FF4 A;  2D1H A;  3G1L A;  3M3Y J;  2KMU A;  2QF7 A;  2PMH A;  1MJA A;  1J9I A;  2K9L A;  4A3B J;  3PQK A;  5DDG A;  2EZI A;  2DMN A;  3GTP J;  2QQ9 A;  3I56 I;  3HDD A;  2JT1 A;  1T98 A;  3S1Q J;  1YW8 A;  2R4G A;  4KIB A;  3LSI A;  2PEX A;  4FE7 A;  2HNH A;  5C3E J;  2YU9 J;  2AQE A;  4B44 A;  4G7O F;  4HX4 A;  1VQN I;  3MCZ A;  4UHT A;  3HOZ J;  1SMY F;  3V7R A;  3AG1 H;  3QPS A;  4BXU A;  1JT0 A;  3PFI A;  2HFH A;  1GXQ A;  4Y33 A;  1WJB A;  1PUF B;  2V1U A;  1LEA A;  3BCB A;  1POG A;  2Z1D A;  3CMM A;  5FKO A;  1IRG A;  1JGS A;  3S8P A;  3S1M J;  4HA8 A;  1YHQ I;  1FOW A;  4R79 A;  1IV6 A;  1SAU A;  1GVJ A;  4C3H J;  4WCG A;  3C2G A;  2M4G A;  1FSE A;  2M4K A;  3L1P A;  3F3X A;  3JW4 A;  2M34 A;  1N77 A;  4CYD A;  4IHX A;  3F8N A;  4BHB A;  5CVU A;  3DXJ F;  3G71 I;  1ZG5 A;  2K4B A;  1MMG A;  3ZP5 A;  2K9S A;  1PVE A;  2MBF A;  1HKQ A;  3TO7 A;  2RNG A;  1IN4 A;  3CUQ B;  3K0L A;  4KMF A;  4X6A J;  4BY7 J;  1YJ9 I;  3FXQ A;  1S72 I;  4I2O A;  3TW7 A;  4CCJ A;  2EK5 A;  1YIT I;  5J8C A;  1VF9 A;  4NHJ A;  1SD7 A;  2V79 A;  2HZT A;  3HOV J;  5IT9 K;  1R7J A;  4C2U A;  1XDS A;  4BE1 A;  4LGW A;  4W1U A;  1E0E A;  3H0D A;  3OYN A;  2DXI A;  5J47 A;  3SFZ A;  3BCA A;  1I27 A;  1N75 A;  2ECB A;  1WFX A;  3HUG A;  2FEZ A;  3KEQ A;  5J4V A;  3HZJ A;  3OL3 A;  4ABZ A;  3E97 A;  1K4T A;  1X58 A;  4LK0 F;  1TWG J;  3FXK A;  2K27 A;  3S2D J;  1B9M A;  3ZQH A;  2HQA A;  2ZBK A;  4X1E A;  2O5R A;  5ICE A;  1TWH J;  5EEA A;  3D1N I;  1S3J A;  1Z7U A; 
#chains in the Genus database with same CATH homology
 5JLW A;  4A3J J;  4V2G A;  1EF4 A;  5EDN A;  4LOC A;  1BL0 A;  5M5W J;  1LE8 B;  2EH3 A;  9ANT A;  2VI6 A;  2R5Y B;  2XPW A;  2M2E A;  1CQT A;  2NVY J;  4I76 A;  2DTZ A;  2FQ4 A;  3A01 B;  2O7O A;  2X9D A;  3NAR A;  2NS8 A;  4M6V A;  2JA8 J;  4MLO A;  5M3M J;  1ETK A;  2VKE A;  3HGG A;  5IYB J;  2O9L A;  2K9N A;  2XB5 A;  3BTI A;  4QTR A;  5JLX A;  1ETV A;  5F27 A;  2HI3 A;  4D5F A;  4JX6 A;  3JRE A;  1IC8 A;  3SFI A;  1FIA A;  4M3F A;  1TWF J;  2N8G A;  1HOM A;  5C44 J;  2JA5 J;  1LE8 A;  5IOZ A;  2ID3 A;  4L5E A;  2R5Y A;  2E19 A;  2HOT A;  2CJJ A;  3A01 A;  1IJW C;  3S15 J;  2JWT A;  3BTL A;  3S14 J;  2Y30 A;  4V2F A;  5F1J A;  1QVT A;  5IP7 J;  2M0C A;  5E3M A;  4IHV A;  2WV1 A;  1TWC J;  1GT0 C;  2FD5 A;  2L0K A;  3H0G J;  1D5Y A;  3BR5 A;  1RR7 A;  5EF6 A;  5FJ8 J;  2R0Q C;  1AKH B;  4IHY A;  2XPU A;  3TP3 A;  5IP9 J;  1ZR4 A;  3BTJ A;  3C2B A;  1GV5 A;  3I4N J;  3S2H J;  3BQZ A;  1MH4 A;  2JK3 A;  1B8I B;  2MW8 A;  1MBJ A;  2HXO A;  3LOC A;  3QQA A;  5J1R A;  2L9R A;  1AHD P;  2Y2Z A;  3VPR A;  4D7N A;  1P7I A;  1JT6 A;  4C2M J;  3GTG J;  2IBD A;  2M8G X;  4FIS A;  2IEK A;  2DMU A;  3QPL A;  3M4O J;  5C4J J;  2K9Q A;  1AKH A;  3W6V A;  1OJL A;  4DW6 A;  1I50 J;  1IDY A;  3LNQ A;  2E2I J;  1FEX A;  1I6H J;  4CYC B;  2MSY A;  2DMT A;  4XRM A;  1XS9 A;  3HOY J;  1A5J A;  1B8I A;  3FKI J;  3RKQ A;  3B6C A;  1G2H A;  2XGE A;  3IH2 A;  4A93 J;  5E3L A;  2DA1 A;  3JRG A;  4BY1 J;  1FTT A;  1XC5 A;  4A69 C;  2HOS A;  2DA3 A;  2YS9 A;  2L7Z A;  3GTJ J;  1TC3 C;  2LY9 A;  2XRL A;  1DU6 A;  3S16 J;  5F0C A;  4NDL A;  4AYB N;  4DYC A;  4CYC A;  3FIW A;  3E7L A;  4Y7N J;  4B4C A;  2E2J J;  1WGX A;  3LSJ A;  4D5C A;  4DYR A;  1IUF A;  2HDD A;  1H8A C;  5EZG A;  3PO3 J;  3UKG A;  5C4X J;  1E3O C;  5FKL A;  3PM1 A;  4RDU A;  1UMQ A;  2DMP A;  1FIP A;  2EBI A;  5DTD A;  2CU7 A;  2JJ7 A;  4MFE A;  2LKX A;  2EZL A;  5F0H A;  2Y31 A;  1I3Q J;  1HF0 A;  2CRG A;  3HKZ N;  2H1K A;  3NAU A;  3RQI A;  1QRY A;  3WHC A;  2X48 A;  3BR1 A;  1VFC A;  3GTL J;  3MN2 A;  2FX0 A;  1WCM J;  4AUX A;  4W97 A;  1YRN B;  5IPA A;  2R7Z J;  3F0C A;  2OF7 A;  2TCT A;  2NOG A;  3ZQC A;  3MKL A;  1JKP C;  2L7M P;  3Q0U A;  4UUS B;  1H89 C;  4M3G A;  3IV5 A;  1Z0X A;  2LP0 A;  1UG2 A;  1APL C;  3BR2 A;  4IHW A;  2JN6 A;  2LD5 A;  2GM4 A;  2VKV A;  3HM5 A;  5HOD A;  2AO9 A;  1YRN A;  1SAN A;  5GPA A;  3GTQ J;  3B6A A;  1GV2 A;  2NVQ J;  1UHS A;  5F04 A;  2Y0S N;  2Y9Z A;  1ETY A;  4A3E J;  2LTP A;  4UUS A;  3JRF A;  3MVP A;  3FIS A;  5K7Z A;  3LSR A;  2B63 J;  1H88 C;  2LFB A;  3BR3 A;  3IH4 A;  5GP9 A;  3OSF A;  3HOU J;  4FTH A;  3GTK J;  2R93 J;  1BW5 A;  1RPW A;  5K7F A;  2DMQ A;  2CQQ A;  3ZOB A;  1B72 B;  2NS7 A;  3HEF A;  1FJL A;  1S7E A;  2DA2 A;  1MNM C;  1XG1 A;  4A3K J;  1FTZ A;  1BW6 A;  1ZTR A;  2FJ1 A;  4JP0 A;  3TED A;  2XGC A;  1ITY A;  1OFC X;  3BG5 A;  5FKK A;  4DYQ A;  2WAQ N;  1JGG A;  1GVD A;  4UUT A;  1Y1W J;  4A3D J;  2KT0 A;  2EZH A;  1B72 A;  4DZJ A;  1HCR A;  4M3D A;  1HDD C;  4XRS G;  1WH7 A;  3TW6 A;  3BR6 A;  2HOA A;  1U9N A;  4A3G J;  3LSP A;  4A3L J;  5J1U A;  3GTM J;  1MSF C;  5FLV A;  2NVT J;  1R9T J;  3CDL A;  5EZH A;  2OPT A;  4DZP A;  3S1N J;  4IEJ A;  4FE4 A;  1JUS A;  4S0H B;  2DN0 A;  2QCO A;  4JX4 A;  1LFB A;  3Q0V A;  1WH5 A;  3BTC A;  3GTO J;  1JKR C;  3FK6 A;  4EEF G;  2ECC A;  2CUE A;  3S17 J;  2ZB9 A;  5M5Y J;  1W0U A;  4FCY A;  4A3I J;  2TRT A;  4A3M J;  1RKT A;  1W0T A;  2W48 A;  3HOW J;  1RKW A;  2WB1 N;  3WHB A;  4B3A A;  1OCT C;  2Y9Y A;  3FK7 A;  1GDT A;  1MBF A;  2G0E A;  3SDG A;  1K83 J;  2LVS A;  1JTY A;  2MGQ A;  5E3O A;  2DA7 A;  1U8B A;  2RAE A;  2XSD C;  3TP0 A;  5J1Y A;  2M9H A;  2X6O A;  3GBG A;  1VND A;  5IYC J;  4D7M A;  1MBG A;  2PMZ N;  5M3F J;  2EZK A;  4C3J J;  1ETQ A;  1ENH A;  3BT9 A;  3JRI A;  4Y52 J;  4MFD A;  1BJZ A;  5IP6 A;  1LFU P;  4MIM A;  5FKN A;  1SFO J;  1IGN A;  1BA5 A;  4QIW N;  4B1R A;  3BQY A;  1HDP A;  1NTC A;  5GPC A;  1JTX A;  1NK2 P;  4MO7 A;  2NVX J;  2D5V A;  2I10 A;  1HLV A;  3BG3 A;  2LLK A;  3RZD J;  2XGD A;  1NK3 P;  2JA7 J;  1IDZ A;  4XID A;  3BR0 A;  3G1O A;  2E1O A;  4G12 A;  1ORK A;  2XPV A;  5F0F A;  3PO2 J;  3ZQI A;  3JRH A;  2HYJ A;  5EGO B;  1F43 A;  3Q3S A;  1X2M A;  1ETO A;  4XIC A;  1MBH A;  5EYR A;  1MH3 A;  1DU0 A;  4QSH A;  5F08 A;  1VI0 A;  2MG4 A;  2R5Z B;  2LR8 A;  3A03 A;  3DCF A;  1QVU A;  2GBY A;  1X2N A;  3CMY A;  1K61 A;  1ZQ3 P;  3SJM A;  2HXI A;  5FKM A;  1WPK A;  2GLO A;  3I4M J;  3IH3 A;  1JKO C;  4BKX A;  3JRA A;  2KDZ A;  3H3V K;  4A3C J;  1P7J A;  1MBE A;  3LSG A;  1Y1V J;  5IOY A;  1JKQ C;  1ETW A;  3HBL A;  1WI3 A;  1MSE C;  5EGO A;  4BXX J;  1ZK8 A;  1JUP A;  4XRS A;  1JUM A;  2ME0 A;  2R92 J;  2R5Z A;  1OCP A;  2CUF A;  4JX5 A;  1QPI A;  5K7H A;  3G1L A;  2VPR A;  3M3Y J;  2QF7 A;  4A3B J;  3JRB A;  2EZI A;  5FLM J;  5J3L A;  2DMN A;  3A02 A;  3GTP J;  3BG9 A;  3HDD A;  4GFB A;  3S1Q J;  1JJ6 C;  3K2A A;  2P81 A;  5EG0 B;  4FE7 A;  5C3E J;  2YU9 J;  1AU7 A;  2ELK A;  1TWA J;  1ZGW A;  1MBK A;  1Z77 A;  1ZR2 A;  1O4X A;  3HB9 A;  3HOZ J;  1F36 A;  5DS9 A;  3QPS A;  4AC0 A;  1Q1V A;  1ETX A;  1JT0 A;  2HQ5 A;  2LK2 A;  3ZQG A;  2K40 A;  4M3B A;  2AHQ A;  1PUF B;  5BNG A;  2CQX A;  4JYK A;  1POG A;  5FKO A;  2JA6 J;  3S1M J;  5EG0 A;  1IV6 A;  4C3H J;  2XB0 X;  1IRZ A;  3L1P A;  2DA6 A;  2M34 A;  1JJ8 C;  3CQZ J;  4IHX A;  1RES A;  1IG7 A;  4J19 A;  5M5X J;  4M3E A;  3OSG A;  4I6Z A;  3ZQF A;  2K9S A;  3Q0W A;  1ZKG A;  3HOX J;  2YUS A;  1PUF A;  3RZO J;  2JMW A;  3G1M A;  4BBS J;  2O8K A;  3HGY A;  3OOU A;  4X6A J;  4BY7 J;  3TW7 A;  1U78 A;  1VF9 A;  1GUU A;  3JRC A;  2H8R A;  3HOV J;  3DEW A;  3ZQL A;  4C3I J;  2IAI A;  4BBR J;  3OIO A;  3JRD A;  4W1U A;  1RET A;  2E2H J;  2DA4 A;  1T56 A;  2EQR A;  2L7F P;  5IYD J;  2COB A;  3S1R J;  2DJN A;  2ECB A;  2VUM J;  4XK4 A;  4A3F J;  4ABZ A;  1U9O A;  3K7A J;  1X58 A;  3O8G A;  1A6I A;  3JR9 A;  1TWG J;  4HNV A;  3S2D J;  3O8H A;  3ZQH A;  5E3N A;  3CCY A;  4X1E A;  2ME6 A;  1T33 A;  1TWH J;  2ID6 A;  2DA5 A;  5EEA A;  3D1N I;  4RBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...