1KA8A

Crystal structure of the phage p4 origin-binding domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
100
structure length
100
Chain Sequence
DADPTFDFIGYLETLPQTSGMYMGNASIIPRNYRKYLYHAYLAYMEANGYRNVLSLKMFGLGLPVMLKEYGLNYEKRHTKQGIQTNLTLKEESYGDWLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative P4-specific DNA primase
publication title Phage P4 origin-binding domain structure reveals a mechanism for regulation of DNA-binding activity by homo- and heterodimerization of winged helix proteins.
pubmed doi rcsb
source organism Enterobacteria phage p4
molecule tags Transferase
total genus 26
structure length 100
sequence length 100
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2001-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ka8A00
2Q8KA 2RNJA 1U5TA 3TO7A 3WTYC 3GUDA 2VBWA 2XKOA 2VE8A 1FWZA 1QGPA 3TO9A 1Q1HA 2V6CA 4HBLA 2HTJA 4LK0F 4PCQA 1HW1A 4WXHA 1FC3A 3F6OA 2CW0F 3MEXA 1FBQA 1UFMA 3QU3A 4KYWA 1IUYA 2HS5A 1O57A 4R8HA 5BPIA 1YO5C 4B09A 1S29A 4KIFA 4M9XA 4E70A 2MH2A 2DW4A 4OMZA 2CGPA 5L3DA 2ACJA 3EYYA 4MTDA 2L4AA 1YW8A 2PJPA 1IZ1A 2CO5A 2BV6A 5FB2A 4WCGA 1IN8A 2FF4A 1G6NA 2H94A 2QZ8A 1FP1D 2O3FA 5LEKA 2X4HA 1J75A 2VN2A 5K1YA 2RC4A 5BMZA 2P6SA 4AVPA 2ISYA 1H9GA 3T0YA 4ZZDA 5BOXA 2OZUA 2V79A 4HYEA 1ZG1A 2VXZA 2COMA 3PQKA 1SD4A 2JPBA 4UVBA 4ZYHA 1I1SA 2F5FA 2LF7A 2KIUA 4DNCA 4XSXF 2DK5A 4JBAA 2A69F 3EETA 3T8TA 2XROA 3QU6A 2VT2A 1IXSB 1ULYA 4ENJA 1R58A 1KA8A 1XMAA 1F4KA 2RN7A 5ERIA 4CGZA 5ILVA 5H6RA 4P96A 1R22A 2DQLA 4M71A 1Y0UA 4LGWA 5DEQA 1R5HA 3V4GA 4I0BA 1ZRDA 4L5JA 3RKYA 2XAGA 1VTNC 3I53A 2P5VA 5HS7A 2JTVA 1BI0A 1BI2A 1MGTA 5DD8A 4OU0A 4A5NA 3GEZA 1USTA 3F23A 3DEUA 3ERED 1RI7A 2ZMEA 4RAZA 1TQIA 4EJVA 1D3YA 3P9IA 2A07F 2R3SA 4OIPF 3HHHA 2STTA 3J80K 4G9YA 1RIOH 2HEOA 2FMLA 1KU2A 2FE3A 3NEUA 5LEJA 4A12A 1SMTA 2G9WA 2QQBA 2ADUA 3MWMA 5DDGA 4BH9A 2OA4A 1T38A 4FT8A 2O8XA 2KIMA 3GLXA 4HA8A 1XB4A 1CF7A 1YS7A 2Y48A 4M72A 4I09A 3WG9A 3S2WA 3AAFA 3QAHA 2EJRA 2D1VA 1FBSA 3FXUA 5CJ9A 2GIVA 3BJOA 4OIRF 3DFGA 1HSTA 3R61A 4IVNA 1WSUA 5E1WA 4OINF 2IT0A 1FX7A 2FMYA 3NQOA 4HQMA 3FXQA 2JRTA 2F5EA 3BPXA 2HTSA 3DXJF 4EQQA 4NQWA 2BGCA 1XGNA 3MZHA 5H20A 2DLLA 1YTYA 2EB7A 1ZYRF 1XSXA 3QP6A 5JR3A 5DUKA 2O0YA 2R7DA 2QLZA 2ZNYA 4K2EA 3HUGA 4RAYA 1U2WA 4MEYF 5BS6A 2A3SA 3TOAA 4QLCU 2HKOA 4WX9A 3KETA 2R7FA 4L9NA 4I01A 1FBUA 5D5XB 2EV5A 4KN4X 1P4WA 4Q4ZF 2WWYA 2MLGA 4S04A 2VBYA 3EYIA 1XMKA 3J81K 2K02A 1R1VA 5IT3A 2VOOA 1TBXA 4YIFA 2OU2A 1B1BA 2STWA 2LSOA 3QPHA 2L02A 4GYIA 2OQRA 1K7AA 1SD6A 5J6XA 2FSWA 2VC1A 3FZVA 3FXRA 2FU4A 3CTAA 2FQ3A 5JVTA 3ZPLA 1FY7A 1ZG3A 2O61A 2F5DA 4HLYA 4OMYA 3HRUA 2NRAC 2Q2EA 3H3ZA 3GZ5A 1IW7F 2H6BA 1HKQA 1AOYA 4IRGA 5DD4A 5CVIA 2H6CA 2XIGA 3C7JA 1ONVA 4P9UA 2JT1A 2Y75A 2K7LA 1RUOA 1RZ4A 2V1DA 2B0LA 1R7JA 4NB5A 2P5KA 1DP7P 1Z6TA 2D2WA 3WE3A 2ZCWA 3RIRA 2YSRA 4WWCA 2EFQA 1ZRCA 3HSRA 4BAYA 1W4MA 5LHIA 2QWWA 1YG2A 2KKOA 2RVCA 3JSOA 3GYHX 3J7AO 1QQIA 2IA2A 5K5RA 2ZMEB 2DPDA 3FF5A 1J0RA 4ENNA 1IN7A 3ZMDA 4U0WA 1S7AA 1YW7A 2J5OA 4CZZA 2PI0A 4KFCA 5H6QA 3WTSC 3ZMSA 1O3SA 1MJAA 1KQ0A 2V9VA 1QNTA 3KP3A 5ICGA 3K2ZA 3IWFA 1XSDA 4UUVA 2AS5F 2VODA 4O5VA 2OD5A 5LGNA 2WV0A 1CF7B 3WTUC 3R0AA 3MAJA 3ZMTA 2E7WA 4HW0A 4UV9A 4WF2A 3U9GA 3VFZA 1IRFA 1USSA 3ULQB 5HDKA 2FNAA 3KLOA 1ZRFA 4I0AA 1UB9A 2PMUA 4A6EA 3CO6C 4UNOA 3M8FA 2XHKA 4BHPA 4Q47A 2XAJA 2Z5UA 1XCBA 2HOEA 2P4WA 5FD6A 1XCVA 2MBFA 5DUIA 2A68F 2XV4S 2ZO4A 1FLIA 4KT5C 4EJTA 4ZZLA 2ZFWA 5BQTA 3DP7A 3HSEA 5E1XA 2PQ8A 4I98B 1OR7A 4ENMA 4LFUA 3HOTA 3BP8A 1HXDA 1W5SA 1U6GA 3KZZA 3GFLA 1XGMA 4G6QA 3I59A 1U5TC 1LEAA 3H3UA 3VOEA 4ETSA 4HF1A 1LDJA 4L9TA 3U2RA 1L0OC 2NYXA 5LGUA 4IRIA 1OPCA 1IN6A 2M45A 3DQVC 1SD5A 3JAMK 3E5UA 3JTHA 2FA5A 3JSPA 3MCZA 1FPQA 1R1TA 3JW4A 3PFIA 2WC2A 2W84A 1XGOA 4ZYEA 3L9FA 5DCMB 4LB5A 3D0SA 3T8RA 4WK8F 3ZMVA 2CFXA 5D5WB 1Z1DA 5F6FA 1FT9A 5KK1A 1U8RA 4TV7A 1T2KA 1BIBA 5JI6A 3F8BA 3P7NA 1PP7U 3MFKA 1DDNA 1ON1A 2L54A 4RB3C 1BOAA 2H27A 4GCVA 3E6DA 1HSJA 2O03A 4KDPA 2OZ6A 1FYMA 3DPTA 2ESNA 1P6RA 5HLHA 3F72A 1TW3A 4NHJA 4G94A 2VE9A 4RGUA 4RS8A 4AIHA 4XLNF 3KLNA 2DBBA 5A2QK 3RDIA 3K9TA 3IL2A 1LJ9A 4MEXF 3T5XA 2F5CA 5EEHA 5L3EA 3GF2A 1DPRA 1REPC 1SD7A 4HLXA 3RYRA 3W6KB 3MQ0A 3RPQA 5E18F 4GXOA 4I02A 4FX4A 1R00A 1I27A 2XAFA 1FYLA 4HOBA 4F7ZA 1G3WA 5L3GA 4L0YB 1P2FA 3BOQA 1YLFA 1IXRC 4CDGA 1SFEA 2X0LA 2IRFG 1IXCA 3LA7A 3E6MA 4Q5SF 1D8KA 1BIAA 3BROA 1PUEE 4HQEA 2IW5A 3L09A 1ZG5A 3F3XA 4ESBA 3LAJA 1K79A 1ON2A 3FM5A 2YR2A 2HZTA 2PN6A 2OAZA 1XGSA 5FFXA 3RYPA 4KN7X 4U0VA 2XRNA 1KU9A 3ZN0A 1F1ZA 1R5GA 3HHGA 3F21A 2CWEA 2ESHA 1J2XA 2M87A 3RJPA 3COAC 4OOIA 1BI3A 4CHUA 2ZBKA 3KZYA 4LG0A 2GZWA 4UVAA 2Z3YA 1O3QA 3BY6A 3FHZA 4P5OA 1I1GA 3M9AA 4IPAA 3TDUC 2HR3A 1W7PD 3LSTA 5CVRA 2BE5F 2EFNA 2PFBA 2PG4A 3IHUA 2Z99A 2ZKZA 1V3FA 2HDCA 2ELHA 3U1DA 1LVAA 1K6OA 2M1BA 3DPLC 2MC3A 5FLXZ 3BDDA 3CDHA 3I59B 2QBYA 4YIIA 3LQQA 2FBIA 4GO1A 3BJ6A 2GWRA 5F64A 3C18A 2ETHA 5HOOA 2IVMA 1BI1A 5LRRA 5HVQC 2LNBA 4ESFA 1Z7UA 2F2EA 3I64A 4AIJA 4Y17A 4HX7A 1DUXC 2DO7A 3IKTA 2VBXA 1EH7A 1EH8A 2Q0OA 3R60A 3SZPA 4EM1A 1U5TB 1QZZA 4G8XA 2AXLA 3CO7C 3FM3A 2XKPA 2EA4A 1S3JA 5DCFA 3LWFA 1HW2A 1YYVA 2P6TA 3HRMA 3K1PA 3O3KA 4B8XA 5LGTA 1TTYA 2GA2A 1E2XA 2W57A 2PBIA 5LBQA 1KYWA 1LEBA 3WTZA 5JHUA 3QPTA 1F9NA 2A6HF 1O7FA 4BHCA 3L2CA 1UHMA 5CLSA 4ZH4F 1JE8A 3M1EA 2FBHA 3V8JA 1QBJA 4RB0A 1ZH5A 4UHTA 5LHGA 4YFNF 3M7GA 4L9JA 3HRSA 2DK8A 1L3LA 4LLNA 2DFIA 3B73A 3OV8A 2DAOA 5HS9A 3CUQA 1XDSA 1AWCA 1R1UA 1S7OA 2CQKA 3VB2A 1BN5A 2FRHA 2FNPA 3K0LA 4ON0A 3WTVC 3WE2A 3L7WA 3KE2A 1KQ8A 1H0MA 3KCCA 4GGGA 2QQ9A 2RV8A 3WTXC 1HBXG 1HQCA 3ISPA 3GFMA 5IT9Z 1TNSA 5L3FA 1LNWA 1J9IA 1EH6A 2K4BA 5CYVA 4G6DA 2HKXA 5BPDA 1RUNA 4YFKF 4U88A 5D6FA 1ZLJA 2IP2A 3WGGA 4ENKA 1BC8C 4CXFA 3LA3A 2XASA 1YS6A 2GAUA 4AD9A 5DV5A 4XSZF 3W6JB 2VT3A 3ZMUA 1IN5A 3WU0A 3O2PE 3DF8A 4LG0B 2NNNA 3GVAA 4MHGA 4OIQF 6PAXA 3ZQ7A 2UXXA 2EK5A 2IA0A 1KGSA 2HQNA 3E97A 4A0YA 4KICA 5D4RA 2GXBA 2RKHA 2TDXA 1C0WA 1FP2A 2CG4A 5LRSA 2HWVA 1YQAA 3R0JA 2HQRA 4LLGF 3TKYA 1G3YA 3QOPA 3REOA 5AIQA 1EV7A 2QBYB 3HYIA 4M9SA 1Z6RA 3TO6A 3TOBA 2EFOA 2HFHA 2CYYA 4YG2F 4N9HA 1Z9CA 4KUMA 2BEOA 3FMSA 3FWEA 5E8GA 1W5TA 1Z05A 3KEOA 3QP5A 4LK1F 4EV0A 3V7SA 2O6GE 1SMYF 3WODF 3SFZA 3TGNA 4WXDA 1F5TA 1T98A 3I71A 4OIOF 1LB2A 1SFUA 4PDKA 2WTEA 2ZXJA 2BBYA 2BYVE 5E20A 3IKVA 4XRFA 4U7BA 1RNLA 1YW9A 3IRRA 2D1HA 1BM9A 1P4AA 3E6BA 3PQJA 1ZREA 1H9TA 2IJLA 1MKMA 1TLHB 2HYGD 3LFKA 5AONA 2CSOA 1MDMA 3JTGA 1YFHA 2P8TA 3KFWX 1ZHFA 1OYIA 1K78A 3NRVA 1J59A 3QRFF 4HX4A 5LLQA 4HX8A 4RB1A 4AWXB 5L3BA 2HYFA 2KRFA 2LF8A 3IC7A 1XD7A 1BJAA 4P55A 4IXAA 5AIPA 1SFXA 4R79A 3GO5A 4FHTA 3C3WA 4RB2C 1UCRA 4IF4A 4A5MA 4YFXF 4EJWA 3MZYA 2DT5A 2Y0MA 3DKWA 2D45A 4CYDA 4UXNA 1I6XA 2H09A 1BBYA 2IPQX 2FOKA 3CUOA 1MJBA 5LHHA 3O6BB 1T6SA 5FO5A 3E3VA 3CUQB 2YX7A 2L3DA 1O7LA 2P7CB 5D6EA 1HKSA 4KIBA 2UXNA 3LAPA 4RGSA 3I4PA 1UHWA 2P5LC 4JQFA 3N97A 1BC7C 4P9FA 3V8KA 3F8CA 1J7KA 2RDPA 3F22A 4A6DA 3H92A 5HLGA 3Q9SA 2RGVA 4LLLA 4M6YA 1MD0A 5K5QA 3ZP5A 1TQPA 5ICEA 1QPMA 3HSFA 2PMHA 2LDUA 1W7PA 2EV6A 1QO0D 4GYGA 1XN7A 3OOPA 2XGXA 3V7CA 1IN4A 2JSCA 2V1XA 4M74A 3I5UA 1STZA 4BQAA 4A0ZA 3J80Z 3KEQA 3CJNA 4EGZA 4CO8A 5HS8A 3K69A 2VOPA 3F8NA 3GFJA 4Z2YA 1B6AA 2YPRA 2QUFA 2QVOA 2NNYA 2L01A 1ZGAA 4HF0A 4EJOA 4EMSA 3KP5A 4O6JA 1DPUA 3BJAA 1TQMA 2LKPA 1ZARA 4LMYA 2RQPA 3BZ6A 1YIOA 3ROUA 2E1CA 4I2OA 2UWMA 3G3ZA 3I54A 2VBZA 4RGRA 2MLKA 2J5PA 4N9IA 3N4MA 4EVIA 3ZN1A 4UVCA 2KJBA 1FNNA 4XBFA 3F8MA 2DPUA 1T39A 5FFZA 2K4JA 5TRDA 3L00A 2VC0A 5FD5A 4PGHA 4ZYDA 1XSVA 3CLOA 4U7DA 1GHCA 1A04A 2DQRA 1IRGA 4M73A 3E5QA 5CVJA 3FX3A 2YX4A 5D5UB 3KP7A 3SHFA 4L18B 1FOKA 4LD5A 1SAXA 2QQAA 4CICA 4IHTA 5CVUA 2XAHA 2A5YB 1XDUA 1ZN2A 1ODDA 2YU3A 4FX0A 3SQNA 1ZAOA 5E8IA 3B02A 3WGHA 1MDMB 4M6XA 1LQ1A 1S8NA 4EJUA 1WRJA 2UZKA 3J81Z 1K78B 2M30A 3WU1B 1V4RA 2W25A 3K1NA 5D8LB 1NHAA 4WXCA 3ABUA 3HOSA 3BWGA 4MTEA 1TNTA 1IF1A 2FBKA 4I7HA 3IRQA 4G7ZF 1I5ZA 3VEPA 3EUHA 4JK1X 4HDVA 2IA1A 4HAMA 5E17F 2ZNZA 3FMRA 3HTSB 1G3TA 3SZTA 1OMIA 2W85A 2A6EF 1KYZA 4HV6A 5HLIA 2V1UA 2JZYA 1E17A 1IAWA 3DV8A 1GXQA 2VONA 2EFPA 5DYMA 4MQVA 3HIFA 3CUQC 2E7XA 4M9ZA 3EQLF 3WTTC 1GVJA 2MD5A 3R4KA 3R6SA 2DU9A 5EEGA 4BNCA 5FLXK 5K5OA 5J8CA 1O3TA 2GXGA 4UV8A 5E1ZB 2L4MA 1S6LA 3ABTA 4EM2A 1D5VA 4RGXA 2PLYA 3D5LA 5D4SA 4MNUA 2G7UA 2M8EA 3BPVA 3RKXA 1FYKA 4IRHA 1W7PB 4BYYA 2M5WA 2EFWA 1WWXA 5J8FA 4HF2A 4ASNA 3HTUA 5FGMA 2DTRA 1WI9A 3GX4X 4ZYGA 2E1NA 4KMFA 1U3EM 1JHFA 5DCMA 1FZPB 1JHHA 4HDUA 1TW2A 4EM0B 3E5XA 4EGYA 2K27A 3Q5FA 4O3MA 3SXYA 4H0EA 1GXPA 3GWZA 4N0BA 4HZFA 3IWZA 3TQNA 3GW2A 1B9NA 2QM3A 4BHBA 4ESJA 5F1RA 1FSEA 4L9VA 3TDZC 3K1MA 4IJAA 2Z9OA 1OYWA 4D0PA 3HRTA 2ISZA 3WGIA 1Z91A 3GFIA 1JXSA 1WQ2A 3F8FA 4KMUX 5D8KB 2DI3A 1ZGJA 3I58A 4MGRA 1WKMA 2GA1A 4L0ZB 2XAQA 3V8LA 2NS0A 4XLPF 1U78A 1FSHA 4R1HA 4S05A 4Y15A 2FXAA 1G3SA 2EV0A 4BXUA 1KU3A 2EA2A 1HW5A 1R36A 4HV5A 5KVRA 1HKTA 4G7OF 4G7HF 2GQQA 2MH9A 2W24A 1LDKB 5HDNA 4MQ9F 4AIKA 5HDGA 3RI4A 1KU7A 1D8JA 5JFRA 4QWQA 5ED4A 1T0FA 4KA4A 3ZMZA 3P9CA 2FEZA 3RPUA 4DQ2A 5IT9K 4Q48A 5ICCA 1O3RA 2PEXA 1X3UA 2A61A 3JAMZ 2C6YA 4LB6B 2NAZA 1P4XA 2XVCA 5ILSA 1ZLKA 2OBPA 4PZJA 4L5IA 3KP6A 3RTRA 5CVVA 1MZBA 4LJZF 2P7VB 1OYYA 2HGCA 4Y13A 3E6CC 3EDPA 1P92A 4KIGA 4A0XA 1CGPA 4KNYA 1R23A 5TJJA 2Z33A 2XUBA 3G73A 1B4AA 4IHSA 3KP4A 2MA3A 5ICFA 3I0TA 3KP2A 3F6VA 3C1DA 1KQ9A 2QENA 4U0YA 3ECHA 1B9MA 3RKWA 5L3CA 3VODA 2K86A 2KIFA 2JPCA 2EWNA 3ML6A 3GXOA 1PDNC 5A2QZ 2QYOA 3WTWC 3LQRA 3T1BA 1G4DA 2G7HA 3ECOA 5D5VB 2ZJ2A 3Q9VA 5ILUA 2OQGA 1B59A 4A2UA 3V7RA 1QZYA 1JGSA 3GZ6A 3LA2A 4PGGA 1MJ9A 3FMQA 3ELKA 1LDDA 3P9KA 1PP8F 1OKRA 2KJCA 1J5YA 3M8EA
chains in the Genus database with same CATH superfamily
1X2MA 2HXIA 2M3AA 5B66C 2Q8KA 3W2AA 2RNJA 3PJRA 2CQQA 2EQRA 2IS4A 3HB9A 1U5TA 3TO7A 3WTYC 2R93J 4CZCA 3GUDA 2VBWA 1CQTA 2XKOA 2VJJA 2VE8A 1FWZA 1QGPA 2P81A 3TO9A 1WPKA 1Q1HA 3GTLJ 2V6CA 2F48A 4HBLA 3QOEA 2Y9ZA 2HTJA 4LK0F 4PCQA 1HW1A 1G59A 2H8WA 4D1QA 4WXHA 4RAGA 1FC3A 3FDYA 1OCCH 1VFCA 3F6OA 2CW0F 3CC2I 4PK4A 3MEXA 2JJ7A 3HBLA 1FBQA 1UFMA 3OY9A 1N25A 2E5ZA 3QU3A 3LSRA 5EJCA 4KYWA 5F27A 4LIVA 2WAQN 5FKKA 1IUYA 2HS5A 4Z6YA 3H1CA 1O57A 2IGMA 4R8HA 1MMDA 5BPIA 1YO5C 4ZDLA 4B09A 4M3GA 1S29A 5J1RA 4KIFA 4M9XA 4PSXA 3BG3A 4E70A 3EUKL 2HQ5A 4Y4RA 2KL4A 4M6VA 3I4NJ 2MH2A 3FK6A 2L7ZA 2CUJA 2CV2A 2MW8A 2DW4A 2TRTA 3LOCA 4OMZA 2CGPA 2R7SA 5L3DA 2ACJA 3HOWJ 1NG6A 4ZYAA 4QIWN 2DXIA 3EYYA 2V4JC 4AYBA 4MTDA 2L4AA 1SAUA 1YW8A 3IH3A 4J00A 2JWTA 4JYKA 2PJPA 1IZ1A 2CO5A 2BV6A 1KONA 5FB2A 4WCGA 1IN8A 3ASOH 4UUSB 2FF4A 3TEDA 1G6NA 2H94A 2LC2A 2QZ8A 1FP1D 1G2HA 4CSWA 1BOBA 2O3FA 2X4HA 4YEJA 5LEKA 1J75A 2VN2A 5K1YA 1V54H 4ANJA 2RC4A 1PYVA 3QYEA 2ZJQF 3OL4A 5BMZA 2P6SA 4AVPA 2ISYA 3CMEI 1H9GA 3SDGA 3T0YA 4ZZDA 5BOXA 5M5WJ 2OZUA 2V79A 3OWTA 5KAIC 4HYEA 2ZMEC 1ZG1A 3J7YJ 2VXZA 2COMA 3PQKA 1SD4A 2JPBA 4UVBA 3A1YA 4L5EA 4ZYHA 4UY8I 1FOWA 1I1SA 2XC7A 2F5FA 2LF7A 5E8IA 2H8RA 2KIUA 3MN2A 4DNCA 2EZIA 4XSXF 2DK5A 3KYCB 4JBAA 4MIMA 2A69F 3EETA 3T8TA 2XROA 1S72I 3QU6A 2I8DA 2VT2A 1IXSB 1ULYA 2KISA 3P5JA 4ENJA 1R58A 1KA8A 3H9QA 5HLTA 1XMAA 1F4KA 2RN7A 5ERIA 4CGZA 5TGTA 5ILVA 1D1BA 2VIXA 5H6RA 4P96A 1R22A 2DQLA 3NWTA 2XB0X 5FROA 4M71A 2QCOA 3QPLA 1Y1VJ 1Y0UA 3DBRB 3HGGA 4LGWA 3S1RJ 5DEQA 1R5HA 1TWCJ 1W1WE 2HYJA 3V4GA 4I0BA 1R71A 1ZRDA 1FTZA 2LP0A 2ZJPF 4L5JA 3RKYA 2XAGA 1VI0A 1VTNC 3I53A 2P5VA 4Y3OA 5HS7A 4CCKA 3E1SA 2JTVA 1BI2A 1BI0A 1MGTA 4OWRB 5DD8A 4OU0A 3S8PA 4A5NA 1F36A 3GEZA 1USTA 4CH7A 3DEUA 4AU7A 4XL9A 3F23A 3ERED 1RI7A 2ZMEA 4RAZA 1TQIA 3JRBA 1QHGA 2BY2A 3PUFA 5DS9A 3JRIA 4EJVA 4AM3A 4M3EA 1VQMI 1D1AA 1NK2P 1D3YA 3P9IA 5CQGA 4A3EJ 2A07F 2R3SA 4NNJA 2BVMA 4DZPA 4OIPF 3E0JB 3HHHA 4IQ4A 2STTA 3J80K 4G9YA 1RIOH 2HEOA 2FMLA 1KU2A 2FE3A 1VQKI 1I3QJ 3NEUA 5LEJA 4J01A 4A12A 2R0QC 2NVXJ 1SMTA 2G9WA 2OF7A 4BS9A 4NC7A 1WI3A 1VQ8I 4BBSJ 2VJ5A 2QQBA 2ADUA 3MWMA 5DDGA 4BH9A 2OA4A 1T38A 1A31A 4FT8A 4XLHA 2IS6A 2H1KA 2O8XA 1N78A 2KIMA 1U0JA 3GLXA 4HA8A 4XLAA 1XB4A 1CF7A 1YS7A 2Y48A 1D0XA 4M72A 4A3IJ 2M7AA 3L2WA 4ZTFA 1AKHB 1OCOH 4ZTJA 1RR8C 4I09A 3WG9A 3S2WA 4FTHA 5IYBJ 3AAFA 3QAHA 4XRSG 5K7HA 1SVOA 2EJRA 2D1VA 1FBSA 3FXUA 4E7SA 5CJ9A 2GIVA 3BJOA 2VL8A 2R7WA 4RLQA 1A6QA 3AL0C 5EGOA 5GAGJ 1N75A 4OIRF 4BBRJ 3DBLB 1HSTA 3DFGA 3R61A 4IVNA 2R5ZA 1WSUA 5E1WA 1IJWC 2DTZA 4OINF 4XRMA 2IT0A 1FX7A 5GADJ 3JCUC 2FMYA 3NQOA 4HQMA 4KITB 1ZGWA 1JKPC 3FXQA 2OTLI 4MLOA 2JRTA 2F5EA 2E36A 2QGUA 3BPXA 2HTSA 3DXJF 4EQQA 4NQWA 2BGCA 3TW6A 1XGNA 1VQLI 3MZHA 3GTOJ 1X1CA 4D9JA 2LVSA 2WADA 2HPMA 5H20A 2DLLA 1YTYA 2EB7A 3KYDB 4RA2A 1ZYRF 3W2VA 2FOWA 4NUBA 3VSKA 2CUEA 4F92B 1XSXA 4A3JJ 3QP6A 5JR3A 1MBKA 5DUKA 1FTTA 2O0YA 1FEXA 2MABA 2QLZA 2R7DA 3A03A 2F6CA 2ZNYA 3OSFA 4K2EA 3HUGA 3S1QJ 4RAYA 1U2WA 2ME6A 2LYCA 2E1MB 4MEYF 4RAFA 1VQ9I 2K9SA 5BS6A 3MMYB 2A3SA 2NOGA 4DGWB 5H2FC 3TOAA 4QLCU 1YRNA 1ETVA 2HKOA 4WX9A 3KETA 2R7FA 1FOXA 4L9NA 2EZHA 3CJTB 4E7HA 2COBA 9ANTA 3PIOF 5J1UA 4I01A 5KCMA 1FBUA 3FKJA 2EPFA 5D5XB 2VUMJ 2EV5A 2DMUA 4KN4X 4RM3A 1P4WA 4Q4ZF 2WWYA 4DYQA 2MLGA 4S04A 2VBYA 4XMYA 2NS8A 3BG7A 3EYIA 1XMKA 2BY0A 3J81K 2K02A 1R1VA 5IT3A 2VOOA 3QWLA 1TBXA 3PO2J 2HOAA 3IP4B 2W4SA 4YIFA 2OU2A 1ERDA 1B1BA 2X1EA 2STWA 2LSOA 3QPHA 2L02A 3HM5A 1TZLA 4GYIA 4FCYA 2BZTA 4CCNA 4D5FA 2OQRA 3I4MJ 1K7AA 3PUBA 1SD6A 5J6XA 4E7LA 4PJLA 2FSWA 3CDLA 2VC1A 2O5RA 5KNLA 3FZVA 5J40A 2EILH 3ZCOA 3B6CA 3FXRA 2FU4A 3GMEA 1KZHA 3CTAA 2FQ3A 2WAQA 3H3VK 5JVTA 1MMNA 3PM1A 1FY7A 3ZPLA 1ZG3A 1EKEA 2O61A 4PSWA 2F5DA 4HLYA 5EF6A 4OMYA 3HRUA 1Y1WJ 2NRAC 2I10A 2Q2EA 3H3ZA 3GZ5A 1R5ID 1IW7F 2H6BA 3BTIA 1HKQA 1AOYA 3HOVJ 2KP6A 1MNDA 4G6TB 4IRGA 5DD4A 3S2HJ 2GM4A 5CVIA 2H6CA 2XIGA 3C7JA 1ONVA 4P9UA 3DTKA 1Y0NA 2JT1A 2X9DA 2Y75A 2K7LA 4CUGA 3MVPA 1ZKGA 1RUOA 1R49A 3AKZA 2DFHA 1SFOJ 5C4JJ 1RZ4A 3QODA 2V1DA 2HOTA 3KYLA 3DEWA 3H9JA 3S3NA 2B0LA 1R7JA 3ZRGA 4NB5A 2ZB9A 2JSPA 5GPAA 1Y6IA 2DYSH 3OYCA 2P5KA 1DP7P 4XOTA 1Z6TA 3C2HA 2D2WA 2NVYJ 3WE3A 3WU2C 3DCFA 3OIOA 2ZCWA 5E3LA 3RIRA 3HPHA 2YSRA 3SEQA 4WWCA 3GTKJ 3CJRB 3CMYA 2EFQA 1ZRCA 3HSRA 4BAYA 1W4MA 3I3LA 5LHIA 2QWWA 1YG2A 3ONQA 3H36A 1Z77A 2KKOA 2RVCA 4MFEA 3JSOA 2ID6A 3GYHX 3G2BA 3J7AO 2CW8A 2HI3A 4A3GJ 1QQIA 4IX7A 2IA2A 1EJ9A 1U8BA 4XNFA 1VF9A 2ZMEB 5K5RA 2DPDA 3FF5A 1J0RA 4ENNA 3BR3A 3S1MJ 1IN7A 2BHZA 3ZMDA 4U0WA 1S7AA 1YW7A 2J5OA 4CZZA 2PI0A 3Q0UA 4KFCA 2A6TA 1V5EA 2TCTA 5H6QA 2LH9A 3WTSC 3IAM2 1SEUA 3ZMSA 1O3SA 2DA7A 1MJAA 1KQ0A 2JK3A 3CMAI 2V9VA 1U9NA 2R7XA 1QNTA 3KP3A 4IEJA 5ICGA 3K2ZA 5IYDJ 3IWFA 2VJ4A 1VQ4I 3W6VA 5M3FJ 1XSDA 2K9QA 4UUVA 1Z21A 3CMMA 4IHVA 3JRDA 2AS5F 2VODA 2Z16A 4O5VA 3J7AY 4I99C 3TW7A 2OD5A 5LGNA 2BOLA 2WV0A 1CF7B 1SANA 3WTUC 2L7KA 3R0AA 1V5GA 3MAJA 2EIKH 4Y52J 3SEZA 3S17J 3ZMTA 2E7WA 4AC0A 4BE0A 3OYHA 4HW0A 3OS1A 2VLAA 4GFBA 4UV9A 3RKQA 4WF2A 1DU6A 3U9GA 1X1PA 1Z3XA 4B3XA 2KRHA 3VFZA 1IRFA 1USSA 1MMSA 1A5JA 3ULQB 5HDKA 3A01B 1MH3A 2FNAA 3BG9A 3KLOA 1ZRFA 5E79C 2Y0SN 1W36C 4I0AA 3OS2A 1UB9A 2PMUA 4A6EA 3CO6C 4FE4A 4HSTA 2CUFA 4UNOA 3MD2A 3M8FA 2XHKA 4ITVA 4BHPA 2HNHA 4Q47A 4HRIA 2XAJA 4DBQA 4HPQA 2Z5UA 4PJ0C 1XCBA 1A35A 2B63J 4G12A 2HOEA 2P4WA 3IV5A 5FD6A 1XCVA 2MBFA 5GTIC 3K4JA 2EIMH 5DUIA 2A68F 2LK2A 2XV4S 1ZQ3P 4LIUA 2ZO4A 4JX6A 1FLIA 1Q1VA 3OYKA 1WJFA 2K3PA 4KT5C 4EJTA 4ZZLA 2X6OA 2ZFWA 1LFBA 2DMNA 5BQTA 2O7OA 4LITA 1LFUP 3DP7A 3HSEA 2IAIA 5E1XA 4FQGA 1NH3A 3HUGB 2DOFA 2PQ8A 4I98B 1UMQA 2JA5J 5DM6F 3RSNA 1OR7A 4ENMA 1MW7A 4LFUA 3HOTA 3AL0B 1YRNB 4JP0A 3BP8A 1HXDA 1W5SA 1ZK8A 4DBRA 1U6GA 3JREA 3KZZA 3GFLA 1XGMA 4G6QA 1K6YA 1LFPA 3I59A 3PNVA 1JGGA 1U5TC 2LBFA 3HPGA 5C44J 1LEAA 4XKVA 1DQUA 1TL8A 3CCSI 2LTPA 1IO2A 1TWFJ 3H3UA 3VOEA 4ETSA 5F0FA 4HF1A 3BG6A 2KDZA 1LDJA 1GUUA 2NOJB 1L0OC 2QKLB 4L9TA 3U2RA 3ZGKA 2KZGA 4QPQA 2KRCA 2V9PA 3GBGA 5EYRA 2NYXA 2XGEA 5LGUA 1T08B 2X48A 4IRIA 1NTCA 1E3HA 1OPCA 1IN6A 2M45A 3DQVC 4XN3A 1SD5A 3JAMK 5IP9J 1MBGA 3E5UA 3JTHA 4HG2A 3HOZJ 2FA5A 3JSPA 3CCVI 3C2GA 1RR7A 3MCZA 3LSKA 1IDZA 1FPQA 1R1TA 3JW4A 3PFIA 2WC2A 2W84A 2R7OA 1XGOA 1WJAA 2EIJH 3CCQI 4ZYEA 3L9FA 5DCMB 5GTHC 1PVEA 4LB5A 3D0SA 2W1OA 3T8RA 4WK8F 4XKCA 3ZMVA 4ABZA 2CFXA 5D5WB 2OCCH 2QEXI 1Z1DA 3H5AA 5F6FA 3K4NA 1FT9A 4FETA 4ZJZA 5JLXA 5K7FA 5KK1A 3BR1A 4YIRX 1U8RA 4BY1J 4TV7A 1WZ2A 2Q2EB 3DKYA 1T2KA 1BIBA 5JI6A 4S0HB 3F8BA 3P7NA 5IY5H 2XGCA 1WJBA 2R5YA 1PP7U 3KEYA 3MKLA 3MFKA 2G0EA 1MMAA 1DDNA 1ON1A 2L54A 4RB3C 1X1DA 1BOAA 2H27A 4GCVA 1XPXA 3JRGA 3E6DA 3D1NI 4H4KC 2BY1A 1HSJA 2MG4A 2O03A 1UAAA 5JVGF 3TP3A 2NVQJ 4KDPA 2OZ6A 2CUZA 1FYMA 1W0UA 3DPTA 4GRIA 5E3NA 2LKXA 2XAUA 2ESNA 3L2VA 1ETOA 1P6RA 5HLHA 2GOXB 3F72A 1TW3A 2R7TA 4CCOA 4NHJA 4G94A 2VE9A 3PNTA 4RGUA 4RS8A 2AO9A 4AIHA 2CV1A 4XLNF 2ZSHB 3KLNA 2DBBA 5LFAA 5A2QK 3NARA 3RDIA 3ZXSA 4B47A 2KFDA 3K9TA 3IL2A 1LJ9A 2CH0A 3K70C 1GVDA 3DLAA 4MEXF 5B3SH 4B1RA 2FQ4A 3MZ8A 3T5XA 2F5CA 5EEHA 5L3EA 3GF2A 2WAFA 3LSJA 1HLVA 2IS2A 2Q1ZB 4EEFG 1DPRA 1REPC 1SD7A 3CD6I 4HLXA 2ZSIB 1BR1A 3RYRA 3W6KB 4NC8A 4RM2A 3MQ0A 3RPQA 5E18F 4GXOA 1YJWI 2VKHA 2L9SA 4I02A 4FX4A 5B5EC 1R00A 3HG9A 1I27A 2XAFA 1FYLA 4HOBA 4F7ZA 2BY3A 4P1WA 1G3WA 1JKOC 3ABMH 4X1EA 1TT5B 1BL0A 3LFUA 2PJRA 4KISA 2E1OA 5L3GA 4L0YB 1P2FA 3BOQA 4C2MJ 1YLFA 1IXRC 4QTRA 4CDGA 1SFEA 1JJ8C 1G8XA 1IRZA 2IXSA 2X0LA 2IRFG 3GTPJ 2DCEA 1SFKA 2LREA 1IXCA 1XX5A 2M4GA 3I9V2 4BACA 3LA7A 5GP9A 3E6MA 2IEKA 2ICWG 4Q5SF 1D8KA 1BIAA 4C9YA 3OIPA 5K7ZA 3BROA 3GLLA 1TP4A 4HQEA 2IW5A 1PUEE 3IH2A 3L09A 1ZG5A 1FIPA 1JUMA 3F3XA 4ESBA 2B9SA 1OFCX 2HVQA 2LLKA 5JLWA 3LAJA 1K79A 1ON2A 2X6YA 3LSMA 3FM5A 1K61A 2M4KA 4DIQA 2YR2A 3ABKH 2HZTA 2JQ7A 2PN6A 3U1KA 3G4SI 2OAZA 3G1MA 1XGSA 2V1NA 5FFXA 5CKTA 3RQ4A 1FMVA 3RYPA 4MO7A 4KN7X 4ZC3A 4JX4A 3MKWB 4U0VA 2XRNA 4A93J 4A3FJ 1KU9A 2JVGA 3ZN0A 1F1ZA 1R5GA 3HHGA 3S16J 5HNHA 3F21A 2MYSA 2JA6J 2CWEA 2ESHA 1J2XA 3K4LA 4X0GA 2M87A 3RJPA 2K40A 2QQ8A 3COAC 4OOIA 4XORA 1HDPA 4A3DJ 2BXZA 1BI3A 3A0BC 2V7FA 5EDNA 4CHUA 4CCMA 2VKVA 2ZBKA 3KZYA 4LG0A 3BT9A 2GZWA 4UVAA 4F93B 4XONA 2Z3YA 4XN0A 1O3QA 3BY6A 3FHZA 4P5OA 1I1GA 2M9HA 3M9AA 4IPAA 1WCMJ 4QSHA 3TDUC 2HR3A 1X4PA 1W7PD 5HNFA 3LSTA 2IGNA 2BE5F 2EFNA 2PFBA 2Y0SA 2PG4A 5CVRA 1H88C 3IHUA 2EZLA 2Z99A 1ZTRA 2ZKZA 2JN6A 1V3FA 2K9MA 4XOPA 3SJMA 2GLOA 2HDCA 4B43A 4RDUA 2ELHA 3SYTA 3U1DA 4IHYA 1LVAA 1JUSA 2CQ7A 1K6OA 2M1BA 3DPLC 2MC3A 2X6WA 2XF6A 3IAS2 2BHYA 5FLXZ 3BDDA 3CDHA 2DDBA 3I59B 2ME0A 1QVUA 3FKIJ 2QBYA 2CJJA 4YIIA 4X6AJ 3GTJJ 3LQQA 2FBIA 4GO1A 4E7IA 3BJ6A 2GWRA 5F64A 3S32A 3C18A 4HEA2 3K2AA 1LVKA 3DEEA 2ZC2A 2ETHA 5HOOA 3HDDA 2IVMA 5EG0A 2EH3A 1BI1A 3HZJA 5LRRA 2L9NA 2LNBA 5HVQC 4ESFA 1Z7UA 4BXFA 4YRVA 2F2EA 3C2BA 3BLYA 3OMYA 1H8AC 3I64A 3M07A 4A3KJ 4AIJA 4Y17A 4HX7A 4UB6C 3HGYA 1DUXC 2DO7A 1BA5A 3IKTA 2VBXA 3JRCA 1EH7A 4UUTA 1EH8A 1XTAA 2CU7A 4M3FA 2DODA 2Q0OA 3R60A 5KAFC 3SZPA 1YHQI 4BDYA 1ACIA 3CCLI 2HQAA 3RZDJ 3IUOA 2HDDA 4EM1A 1U5TB 1OCRH 2JRMA 1QZZA 3GTGJ 4G8XA 2AXLA 1JUPA 3CO7C 3K7AJ 1R4MB 2R5YB 2ZFUA 3FM3A 4RLFA 2XKPA 2EA4A 1PJRA 1S3JA 5DCFA 3LWFA 3PIPF 3PSIA 1HW2A 1YYVA 3FXJA 3HOYJ 4IL6C 2P6TA 3HRMA 3K1PA 2OTJI 1WJCA 3O3KA 2ECBA 4B8XA 4DJAA 1ENHA 1ORKA 5LGTA 4I6ZA 1HDDC 1TTYA 2ZXHA 1H89C 3BQYA 2GA2A 1E2XA 2W57A 2PBIA 5LBQA 4HNTA 5F04A 2N8GA 3K6GA 1VQOI 1KYWA 1YI2I 1LEBA 2M34A 3BR6A 3FK7A 3DKXA 2UV1A 3WTZA 5JHUA 2WY8Q 5DTDA 5J4YA 3QPTA 1F9NA 3AG3H 2A6HF 3G1LA 1YITI 1O7FA 2XGDA 4ZDOA 4BHCA 2WAEA 1UHMA 5CLSA 4OAYA 2MC4A 4ZH4F 3L2CA 1JE8A 3HJEA 3M1EA 2FBHA 4JOMA 3V8JA 2MD0A 3OYDA 2L2OA 1YJ9I 1QBJA 4BJ6C 4RB0A 1ZH5A 2QSFX 4UHTA 5LHGA 3VYSB 4YFNF 4CYCA 2OUMA 5FKNA 3M7GA 4L9JA 3FXOA 3HEFA 3SDBA 3HRSA 4BGDA 2DK8A 1L3LA 1QU3A 1EA3A 4C3JJ 4LLNA 2DFIA 2LRDA 3B73A 3OV8A 4V2FA 2DAOA 1MSEC 3BG5A 5HS9A 3CUQA 1XDSA 1AWCA 1NG7A 1R1UA 1D0ZA 3S2DJ 1S7OA 2PJRB 3SZGA 1T56A 2CQKA 2X1CA 3GCMA 4E6KG 1UZCA 2E34A 2LOOA 2EBIA 3VB2A 1BN5A 2FRHA 3BTJA 2PX9A 1K83J 2K9LA 4W1UA 2FNPA 3K0LA 4ON0A 3X2QH 3WTVC 3ERMA 3WE2A 3L7WA 3LSPA 3KE2A 3BTLA 4XLFA 1KQ8A 1H0MA 2AQFA 5IP6A 3KCCA 3OOUA 3FISA 4GGGA 2QQ9A 2RV8A 3WTXC 1HBXG 1OISA 2E35A 1VQ7I 1HQCA 3ISPA 3GFMA 1ETYA 1BR2A 5IT9Z 1TNSA 5L3FA 1LNWA 1J9IA 2KQRA 3BR2A 2R92J 1EH6A 2K4BA 3BR5A 5CYVA 4G6DA 2XPVA 5FLVA 2HKXA 3BQZA 5BPDA 3HXLA 1RUNA 2VQGA 4YFKF 1I3AA 4U88A 2GBYA 1UG0A 4PUSA 5D6FA 1ZLJA 1GT0C 3S3OA 2O8KA 2IP2A 2R7VA 1T33A 3WGGA 1HF0A 4ENKA 1BC8C 2JA8J 1WJEA 4CXFA 1SVLA 5F0CA 3I56I 3LA3A 1BW5A 4DZJA 2XASA 2AHQA 2YS9A 1YS6A 2GAUA 2OJED 3CJQB 5J3LA 4M3DA 4AD9A 2QA4I 5DV5A 4XSZF 1S7EA 2BW3A 2E2JJ 3W6JB 4PFOA 2VT3A 4PJMA 3ZMUA 1B8IA 1IN5A 3WU0A 3LNQA 2VB6A 4KMFA 3O2PE 1ETKA 1VQNI 3W3CA 3DF8A 2M0CA 4A3MJ 4LG0B 4DYRA 2NNNA 4PFPA 3GVAA 4N4OB 3A02A 3O8GA 4MHGA 4OIQF 6PAXA 1WGXA 2WBMA 3LSIA 3ZQ7A 2UXXA 1ETXA 2JUCA 2EK5A 2IA0A 1KGSA 2HQNA 3E97A 4A0YA 4KICA 5D4RA 2GXBA 1V5FA 2RKHA 2TDXA 4NBQA 1UHSA 1C0WA 1FP2A 2CG4A 2DOAA 5LRSA 4PJNA 3K4KA 4D5CA 1Y39A 2HWVA 2DN0A 1YQAA 3CLQA 1YX3A 3R0JA 1IC8A 1Y8QB 2HQRA 4MFDA 4LLGF 3TKYA 5FRNA 1G3YA 3QOPA 3REOA 5AIQA 1OR7C 1X3ZB 1EV7A 2QBYB 3HYIA 3ZQIA 4M9SA 5EGOB 1Z6RA 1MNEA 4FISA 2QSGX 1HA8A 3ASNH 2R5ZB 3TO6A 3TOBA 3ESWB 2EFOA 4DOZA 2HFHA 2CYYA 2WV1A 2VQCA 4YG2F 4N9HA 5EG0B 2E60A 4C30A 2DFEA 1Z9CA 1VQPI 4KUMA 2DYRH 2BEOA 3CCRI 2JMWA 3FMSA 1GDTA 4C3HJ 1POGA 3FWEA 5E8GA 3V42A 4NQWB 5FJ8J 1VQ6I 4BE2A 1W5TA 1P9QC 1Z05A 4E4HA 3KEOA 2L9RA 3QP5A 4LK1F 4EV0A 3V7SA 2O6GE 3KIOA 1SMYF 3CP8A 2P0WA 1F43A 3WODF 4BL0B 3SFZA 3L1PA 3FBNB 3TGNA 4WXDA 1FIAA 1F5TA 3I55I 1T98A 2XSJC 2IBDA 3I71A 4OIOF 1LB2A 1LPQA 4E7KA 1SFUA 3DTIA 4PDKA 2NVTJ 2WTEA 3MKZA 3W2WA 2ZXJA 1UELB 5FKMA 2BBYA 2BYVE 5E20A 3IKVA 4XRFA 4U7BA 1RNLA 1YW9A 5GAHJ 3IRRA 2D1HA 1BM9A 1P4AA 2DT6A 3E6BA 3PQJA 4XKWA 2CRGA 3CCJI 1AHDP 3K4MA 2QF7A 3BCAA 4RBOA 1ZREA 3OYJA 1H9TA 4BDZA 3Q3SA 2IJLA 1MKMA 1TLHB 2V26A 3HKZN 1JT0A 4Y7NJ 2HYGD 4V19K 2HZDA 2CQXA 1WJDA 3BZCA 3LFKA 5AONA 2CSOA 1MDMA 2DJNA 3E7LA 3JTGA 1YFHA 2P8TA 2Y69H 3D5RC 3KFWX 2IS1A 1ZHFA 3G6EI 1OYIA 1K78A 5FLMJ 3NRVA 4XICA 1J59A 3A0HC 4YELA 3L2QA 2A5WA 3H35A 3QRFF 4AUXA 1QVTA 4HX4A 1TWGJ 2ELJA 5LLQA 3FBIB 3SFIA 4HX8A 4RB1A 4B3AA 4IOCF 1OCTC 2CMPA 4AWXB 2HYFA 2KRFA 2LF8A 5L3BA 3IC7A 1XD7A 1BJAA 4P55A 1I6HJ 1AU7A 4IXAA 2NXNB 5AIPA 1SFXA 2GXAA 3TBIA 4R79A 5F1JA 3GO5A 1IV6A 4FHTA 3C3WA 4RB2C 1UCRA 4F55A 5E3OA 1WFXA 2B7EA 2M8GX 4CYCB 3OL3A 3PSFA 4IF4A 4D7MA 4A5MA 4YFXF 4EJWA 3MZYA 1BW6A 2DT5A 2FJ1A 3RPUD 2VASA 2Y0MA 3DKWA 4BUPA 2D45A 1YX5A 4CYDA 4UXNA 1I6XA 5IOYA 2H09A 1BBYA 2IPQX 2FOKA 3CUOA 1MJBA 2JVHA 2L7MP 5LHHA 3O6BB 1T6SA 1U9OA 2VJIA 5FO5A 3CC4I 2XPWA 3E3VA 1RKTA 2DA3A 3CUQB 5J1YA 4IOAF 2YX7A 2L3DA 1O7LA 3Q0WA 3OYEA 2P7CB 3DU6A 3VPRA 5D6EA 3VSLA 1HKSA 1VQ5I 1IV8A 4KIBA 2UXNA 3LAPA 4RGSA 1R9TJ 1O4XA 3I4PA 5IYCJ 1MNMC 3OYBA 1UHWA 2P5LC 4JQFA 3N97A 2WB1N 1BC7C 5M5XJ 3OYNA 2OPTA 4P9FA 1YE9A 1LE8A 3V8KA 1A36A 3F8CA 1J7KA 2L0KA 2RDPA 1FJLA 3CF5F 2NVUB 3F22A 3GTMJ 2LY2A 1D1CA 2Y30A 4A6DA 1ZELA 2DA2A 3AFHA 3H92A 4B4CA 5HLGA 3Q9SA 2DA1A 2RGVA 4LLLA 3UNGC 4M6YA 4HNUA 5KHDA 4I76A 4M3BA 3TP0A 2HVRA 2CQNA 4E7ZA 1MD0A 2KHMA 5K5QA 1X1AA 3ZP5A 1TQPA 2XB5A 5ICEA 1IGNA 4B48A 2DMPA 1QPMA 3HSFA 1MH4A 2PMHA 2LDUA 4IHXA 1W7PA 2FD5A 2D5VA 2MFZA 2EV6A 1QO0D 1S9HA 4GYGA 2PMZN 3K4BA 5B1BH 2ID3A 3WHCA 1MBJA 1XN7A 3FXKA 3OOPA 2ZJRF 5M5YJ 2KLOA 2XGXA 2EZKA 3V7CA 1IN4A 5IPAA 1W36D 1E3PA 2BW3B 3U21A 2L7FP 4A69C 3KPHA 2Z1DA 1B8IB 2JSCA 1E3OC 2V1XA 1DU0A 4M74A 3I5UA 4BQNA 1STZA 2KPMA 2XPUA 4BQAA 2YUSA 4A0ZA 2LD5A 3PFYA 3WG7H 3L2RA 1JTXA 5C4XJ 3J80Z 3KEQA 3A4CA 2K5CA 3CJNA 1MIJA 2ELKA 4EGZA 2JA2A 4CO8A 5HS8A 3K69A 2VOPA 3AG1H 3F8NA 3GFJA 4Z2YA 2M0MA 3G71I 3BZKA 2F4OB 3QPSA 1B6AA 1B72A 1LUJB 2VI6A 2YPRA 2MGQA 2R7QA 3ZQGA 2QUFA 3H5RA 1I50J 4Y33A 2QVOA 2NNYA 2L01A 1ZGAA 1Z0XA 4HF0A 3DTEA 4EJOA 4EMSA 3KP5A 1XMXA 4O6JA 1DPUA 3BJAA 1TQMA 2LKPA 3JRAA 1ZARA 3BR0A 2R4GA 4LMYA 2RQPA 1D5YA 1SVMA 3BZ6A 1YIOA 3OIQA 3ROUA 2E1CA 2A05A 4I2OA 2UWMA 3G3ZA 3I54A 2VBZA 3B6AA 4RGRA 2MLKA 2J5PA 2X6XA 3CF2A 4N9IA 2DDAA 2X1DA 2QSHX 2E71A 3N4MA 4EVIA 3ZN1A 4UVCA 2KJBA 1FNNA 4XBFA 1RESA 2QKMB 4IO9F 3F8MA 4AVZA 1IRXA 2DPUA 1T39A 5FRMA 5FFZA 2K4JA 3OYMA 5TRDA 1BR4A 2AXTC 4ZDPA 1P7IA 3L00A 2HDWA 2VC0A 5HODA 5EZGA 5FD5A 1HOMA 2M7BA 4PGHA 4ZYDA 1M1EB 1XSVA 2RAEA 3CLOA 4U7DA 1GHCA 1X3WB 3CP2A 1A04A 2DQRA 1IRGA 4M73A 3NAUA 1X19A 1RETA 3E5QA 1SC7A 5CVJA 3FX3A 1APLC 2YX4A 5D5UB 3KP7A 3SHFA 1PUFA 3S3MA 1JKQC 1FOKA 4L18B 4LD5A 3EUHC 1SAXA 2QQAA 3VYRB 1YIJI 4IHWA 4CICA 4IHTA 3DBHB 5CVUA 2XAHA 1T95A 1UG2A 3FHNA 2VXDA 2V9KA 3OYLA 2W7NA 2A5YB 3CCEI 1XDUA 3CCUI 1ZN2A 2LBFB 3OS0A 1ODDA 2YU3A 4FX0A 4XR6A 1ZAOA 3SQNA 1UJ8A 3B02A 3PNYA 3ABLH 3WGHA 4BQOA 2LY1A 3ZQCA 3QYFA 1R4NB 1EF4A 1MDMB 4BEHA 2E19A 5GPCA 4M6XA 2E2HJ 1A6IA 1LQ1A 1S8NA 4JX5A 4EJUA 1DGWY 1WRJA 3EUAA 1Y8RB 2UZKA 2LFBA 3OR1C 3VYUB 3J81Z 4E7JA 2DJIA 2M30A 1K78B 3WU1B 2ECCA 2LKSA 1V4RA 2W25A 2DA6A 5E3MA 3K1NA 5D8LB 2CV0A 1T8IA 2Z2SB 5J4VA 2M2EA 1NHAA 2XF5A 2DMTA 4WXCA 2OV7A 4HNVA 1Z7LA 3ABUA 3HOSA 2O9LA 1DP3A 1QZEA 3F0CA 5FKOA 3BWGA 4MTEA 1TNTA 2K85A 4XIDA 2VKDA 1IF1A 2FBKA 2DOEA 4I7HA 3HKZA 3IRQA 4G7ZF 4BU2A 3A01A 1I5ZA 2KT0A 4FASD 3LSHA 4XM3A 5B1AH 3VEPA 3K70D 5GAEJ 3EUHA 2VQLA 4KJZA 4JK1X 2IGOA 3MKYB 4HDVA 3GTQJ 1MSFC 2IA1A 4HAMA 3CESA 4FE7A 2FUG2 5E17F 2I5UA 2ZNZA 3HOUJ 1OCPA 3FMRA 3HTSB 1G3TA 3SZTA 4II3A 1MMGA 1OMIA 2W85A 2A6EF 3H0GJ 1HCRA 1KYZA 4HV6A 5HLIA 3OYFA 2KIQA 3ZQFA 3RZOJ 2V1UA 3OYAA 2JZYA 3ZQQA 1ZR4A 3F9KA 1E17A 4N4NB 1IAWA 3DV8A 1GXQA 2VONA 2EFPA 5DYMA 1DGRM 4MQVA 3VDXA 4GDFA 3HIFA 3L2UA 3IH4A 3CUQC 4UB8C 2E7XA 4M9ZA 3EQLF 1RPWA 2K9NA 3WTTC 1GVJA 4DW6A 2CFOA 2MD5A 3R4KA 1LE8B 3D5SC 4F3QA 3FIWA 3K10A 2DU9A 3R6SA 3KX2A 3UKGA 5EEGA 4BNCA 1JI8A 2OC6A 5FLXK 2BVLA 5K5OA 3JRHA 5J8CA 1O3TA 2L5QA 3BCBA 2GXGA 4BXXJ 2K3FA 4UV8A 1X4OA 5E1ZB 2L4MA 1VZ0A 1S6LA 2BXYA 3ABTA 1WH5A 5C3EJ 2NS7A 2UUZA 3VYTB 1IG7A 1OQYA 1ITYA 2R7UA 4EM2A 3VWBA 2VKEA 2KZVA 1D5VA 2F4IA 3ZOBA 4RGXA 2PLYA 4A3LJ 3D5LA 4XK4A 5D4SA 4MNUA 2G7UA 4CCJA 2M8EA 3BPVA 3OSGA 2WB1A 3OYGA 3RKXA 1FYKA 4IRHA 3TL4X 2GIZA 1D0YA 1W7PB 3RCOA 4BYYA 3J7ZI 2M5WA 5EZHA 4IZZA 2EFWA 1WWXA 3AG2H 5F08A 5J8FA 4HF2A 4ASNA 3Q0VA 3HTUA 5FGMA 2DTRA 1WI9A 2JUGA 2XF7A 3LSGA 4ZYGA 2E1NA 3GX4X 3K4CA 1JHFA 5DCMA 1U3EM 1FZPB 1JHHA 1K4SA 4HDUA 1TW2A 4EM0B 3E5XA 4EGYA 2K27A 3Q5FA 4O3MA 3SXYA 4H0EA 1GXPA 1E0EA 3CC7I 3GWZA 5BNGA 4N0BA 4HZFA 3IWZA 3TQNA 3ZQLA 3GW2A 4BKXA 2V6EA 1B9NA 2QM3A 4BHBA 2KMUA 4ESJA 1MBHA 2E5NA 4KT6A 1R6RA 1QHHD 4LG3A 3A2KA 5F1RA 1FSEA 4L9VA 1LKXA 1QPIA 3TDZC 3K1MA 4IJAA 4EATA 1TC3C 2Z9OA 3HC7A 3HOXJ 2ZXIA 4CA0A 1B72B 1OYWA 2PMZA 4D0PA 4C2UA 1OLTA 3HRTA 3WHBA 2ISZA 1RKWA 3PO3J 4AYBN 3WGIA 1WHUA 1Z91A 3S15J 1TT0A 3S14J 3GFIA 1JXSA 3FXMA 2R7ZJ 1WQ2A 1JT6A 3F8FA 5LD2C 4KMUX 2RQQA 2RREA 1Y56A 2HPIA 5D8KB 2DI3A 1ZGJA 4W97A 4C2TA 4CCLA 3I58A 4MGRA 4IKFA 1WKMA 1WVRA 1N77A 1GV5A 1TWHJ 4BQQA 3DU5A 3AG4H 2EINH 4C3IJ 3BTCA 2GA1A 4L0ZB 2XAQA 5M3MJ 1QRYA 1T0FC 4PJJA 3ZR8X 3CQZJ 3OYIA 3H0DA 1RRJA 2ZXWH 2KDOA 1IDYA 5J47A 1JJ6C 3H9GA 3V8LA 2NS0A 2CW7A 1S5LC 4XLPF 1U78A 4IQJA 1FSHA 4R1HA 4S05A 3TMOA 1HC8A 4Y15A 1AA7A 2FXAA 1JKRC 1G3SA 2DA5A 2EV0A 4BXUA 4UUSA 1KU3A 2EA2A 1HW5A 1R36A 4HV5A 5KVRA 3S93A 1HKTA 1FOYA 4G7OF 3EPZA 4G7HF 2Y31A 2GQQA 2MH9A 3G1OA 2W24A 3JR9A 1PUFB 5FKLA 3UR3C 3O8HA 1LDKB 2LR8A 5HDNA 4MQ9F 4AIKA 2IGKA 4RMNA 5HDGA 3RI4A 1K4TA 1KU7A 1D8JA 5JFRA 4QWQA 2Y2ZA 5ED4A 1XG1A 3JRFA 1XS9A 5IP7J 4BJTA 1T0FA 2FX0A 4KA4A 2HU9A 1ETQA 3ZMZA 2HVSA 3M3YJ 3P9CA 2DT7B 3LL7A 2FEZA 3RPUA 3OR2C 3CDIA 4NDLA 1YOVB 5CPRB 4BEHB 3LMMA 4DQ2A 5IT9K 2HXOA 3N05A 2DA4A 4Q48A 1I39A 5ICCA 1O3RA 1Z3YA 2PEXA 3FXLA 4D7NA 2LY9A 1X3UA 2XDVA 2A61A 3RQIA 1OJLA 2OCEA 3JAMZ 2C6YA 4LB6B 1W0TA 2NAZA 3S1NJ 4DYCA 5CQEA 1P4XA 2W48A 2HOSA 1BJZA 4BE1A 1IUFA 2XVCA 5ILSA 1ZLKA 2OBPA 3DLLF 3GZNB 4PZJA 4L5IA 2AQEA 3KP6A 2VQHA 1ZR2A 3CCYA 2CS3A 3CZ6A 3RTRA 5CVVA 1MZBA 1TWAJ 4LJZF 2P7VB 2E2IJ 1OYYA 2HGCA 4QPOA 4F91B 2X51A 2H1LA 4BJ5C 4Y13A 3E6CC 4J19A 4XKBA 3EDPA 1P92A 4KIGA 2MSYA 4A0XA 4A3CJ 1CGPA 4XQFA 2DFFA 3NWSA 2L9VA 2F5VA 3KZIC 4KNYA 1R23A 5TJJA 2R7RA 3M1CA 2Z33A 2RNGA 1NK3P 3H5NA 1XC5A 3M8JA 2XUBA 1Z67A 3G73A 1JTYA 1B4AA 4OAZA 2JA7J 4IHSA 3PL8A 4II2A 2GOMA 3KP4A 2MA3A 1QA6A 4F52A 5ICFA 3I0TA 1V55H 3QQAA 3KP2A 2XSDC 3F6VA 1YJNI 3C1DA 4NC6A 1W5CC 4U87A 1KQ9A 1RC9A 2QENA 4U0YA 3ECHA 1GV2A 1B9MA 2W82A 3RKWA 1X2NA 1X1BA 5L3CA 1OCZH 2WA0A 4AIDA 5EEAA 1AKHA 2F4MB 3VODA 2K86A 2KIFA 2WY7Q 4XRSA 2JPCA 3DPUA 1ETWA 2XRLA 2X85A 5DM7F 2EWNA 3ML6A 3GXOA 2E1MC 2Y9YA 1PDNC 4A3BJ 5A2QZ 3QYBA 4XLCA 5F0HA 1MBFA 2QYOA 3WTWC 1GLNA 2YU9J 2VPRA 4HSRA 4B44A 3M4OJ 3LQRA 1P7JA 4XLEA 1X58A 2DMQA 3HL2A 3T1BA 1G4DA 2G7HA 1WH7A 3ECOA 5D5VB 2ZJ2A 3Q9VA 5ILUA 1FMWA 2VPLA 2OQGA 4LOCA 1B59A 4A2UA 3DWLE 3V7RA 1QZYA 1JGSA 1VNDA 3GZ6A 2W00A 1MBEA 3CCMI 3ZQHA 3LA2A 4PGGA 3BC8A 1WJ5A 2LG4A 1MJ9A 2LMDA 3FMQA 5JHFA 4V2GA 3ELKA 5TISC 4BY7J 1LDDA 3P9KA 5IOZA 1PP8F 1OKRA 2KJCA 1J09A 1J5YA 3M8EA
chains in the Genus database with same CATH topology
2Q8KA 2RNJA 1U5TA 3TO7A 3WTYC 3GUDA 2VBWA 2XKOA 2VE8A 1FWZA 1QGPA 3TO9A 1Q1HA 2V6CA 4HBLA 2HTJA 4LK0F 4PCQA 1HW1A 4WXHA 1FC3A 3F6OA 2CW0F 3MEXA 1FBQA 1UFMA 3QU3A 4KYWA 1IUYA 2HS5A 1O57A 4R8HA 5BPIA 1YO5C 4B09A 1S29A 4KIFA 4M9XA 4E70A 2MH2A 2DW4A 4OMZA 2CGPA 5L3DA 2ACJA 3EYYA 4MTDA 2L4AA 1YW8A 2PJPA 1IZ1A 2CO5A 2BV6A 5FB2A 4WCGA 1IN8A 2FF4A 1G6NA 2H94A 2QZ8A 1FP1D 2O3FA 5LEKA 2X4HA 1J75A 2VN2A 5K1YA 2RC4A 5BMZA 2P6SA 4AVPA 2ISYA 1H9GA 3T0YA 4ZZDA 5BOXA 2OZUA 2V79A 4HYEA 1ZG1A 2VXZA 2COMA 3PQKA 1SD4A 2JPBA 4UVBA 4ZYHA 1I1SA 2F5FA 2LF7A 2KIUA 4DNCA 4XSXF 2DK5A 4JBAA 2A69F 3EETA 3T8TA 2XROA 3QU6A 2VT2A 1IXSB 1ULYA 4ENJA 1R58A 1KA8A 1XMAA 1F4KA 2RN7A 5ERIA 4CGZA 5ILVA 5H6RA 4P96A 1R22A 2DQLA 4M71A 1Y0UA 4LGWA 5DEQA 1R5HA 3V4GA 4I0BA 1ZRDA 4L5JA 3RKYA 2XAGA 1VTNC 3I53A 2P5VA 5HS7A 2JTVA 1BI0A 1BI2A 1MGTA 5DD8A 4OU0A 4A5NA 3GEZA 1USTA 3F23A 3DEUA 3ERED 1RI7A 2ZMEA 4RAZA 1TQIA 4EJVA 1D3YA 3P9IA 2A07F 2R3SA 4OIPF 3HHHA 2STTA 3J80K 4G9YA 1RIOH 2HEOA 2FMLA 1KU2A 2FE3A 3NEUA 5LEJA 4A12A 1SMTA 2G9WA 2QQBA 2ADUA 3MWMA 5DDGA 4BH9A 2OA4A 1T38A 4FT8A 2O8XA 2KIMA 3GLXA 4HA8A 1XB4A 1CF7A 1YS7A 2Y48A 4M72A 4I09A 3WG9A 3S2WA 3AAFA 3QAHA 2EJRA 2D1VA 1FBSA 3FXUA 5CJ9A 2GIVA 3BJOA 4OIRF 3DFGA 1HSTA 3R61A 4IVNA 1WSUA 5E1WA 4OINF 2IT0A 1FX7A 2FMYA 3NQOA 4HQMA 3FXQA 2JRTA 2F5EA 3BPXA 2HTSA 3DXJF 4EQQA 4NQWA 2BGCA 1XGNA 3MZHA 5H20A 2DLLA 1YTYA 2EB7A 1ZYRF 1XSXA 3QP6A 5JR3A 5DUKA 2O0YA 2R7DA 2QLZA 2ZNYA 4K2EA 3HUGA 4RAYA 1U2WA 4MEYF 5BS6A 2A3SA 3TOAA 4QLCU 2HKOA 4WX9A 3KETA 2R7FA 4L9NA 4I01A 1FBUA 5D5XB 2EV5A 4KN4X 1P4WA 4Q4ZF 2WWYA 2MLGA 4S04A 2VBYA 3EYIA 1XMKA 3J81K 2K02A 1R1VA 5IT3A 2VOOA 1TBXA 4YIFA 2OU2A 1B1BA 2STWA 2LSOA 3QPHA 2L02A 4GYIA 2OQRA 1K7AA 1SD6A 5J6XA 2FSWA 2VC1A 3FZVA 3FXRA 2FU4A 3CTAA 2FQ3A 5JVTA 3ZPLA 1FY7A 1ZG3A 2O61A 2F5DA 4HLYA 4OMYA 3HRUA 2NRAC 2Q2EA 3H3ZA 3GZ5A 1IW7F 2H6BA 1HKQA 1AOYA 4IRGA 5DD4A 5CVIA 2H6CA 2XIGA 3C7JA 1ONVA 4P9UA 2JT1A 2Y75A 2K7LA 1RUOA 1RZ4A 2V1DA 2B0LA 1R7JA 4NB5A 2P5KA 1DP7P 1Z6TA 2D2WA 3WE3A 2ZCWA 3RIRA 2YSRA 4WWCA 2EFQA 1ZRCA 3HSRA 4BAYA 1W4MA 5LHIA 2QWWA 1YG2A 2KKOA 2RVCA 3JSOA 3GYHX 3J7AO 1QQIA 2IA2A 5K5RA 2ZMEB 2DPDA 3FF5A 1J0RA 4ENNA 1IN7A 3ZMDA 4U0WA 1S7AA 1YW7A 2J5OA 4CZZA 2PI0A 4KFCA 5H6QA 3WTSC 3ZMSA 1O3SA 1MJAA 1KQ0A 2V9VA 1QNTA 3KP3A 5ICGA 3K2ZA 3IWFA 1XSDA 4UUVA 2AS5F 2VODA 4O5VA 2OD5A 5LGNA 2WV0A 1CF7B 3WTUC 3R0AA 3MAJA 3ZMTA 2E7WA 4HW0A 4UV9A 4WF2A 3U9GA 3VFZA 1IRFA 1USSA 3ULQB 5HDKA 2FNAA 3KLOA 1ZRFA 4I0AA 1UB9A 2PMUA 4A6EA 3CO6C 4UNOA 3M8FA 2XHKA 4BHPA 4Q47A 2XAJA 2Z5UA 1XCBA 2HOEA 2P4WA 5FD6A 1XCVA 2MBFA 5DUIA 2A68F 2XV4S 2ZO4A 1FLIA 4KT5C 4EJTA 4ZZLA 2ZFWA 5BQTA 3DP7A 3HSEA 5E1XA 2PQ8A 4I98B 1OR7A 4ENMA 4LFUA 3HOTA 3BP8A 1HXDA 1W5SA 1U6GA 3KZZA 3GFLA 1XGMA 4G6QA 3I59A 1U5TC 1LEAA 3H3UA 3VOEA 4ETSA 4HF1A 1LDJA 4L9TA 3U2RA 1L0OC 2NYXA 5LGUA 4IRIA 1OPCA 1IN6A 2M45A 3DQVC 1SD5A 3JAMK 3E5UA 3JTHA 2FA5A 3JSPA 3MCZA 1FPQA 1R1TA 3JW4A 3PFIA 2WC2A 2W84A 1XGOA 4ZYEA 3L9FA 5DCMB 4LB5A 3D0SA 3T8RA 4WK8F 3ZMVA 2CFXA 5D5WB 1Z1DA 5F6FA 1FT9A 5KK1A 1U8RA 4TV7A 1T2KA 1BIBA 5JI6A 3F8BA 3P7NA 1PP7U 3MFKA 1DDNA 1ON1A 2L54A 4RB3C 1BOAA 2H27A 4GCVA 3E6DA 1HSJA 2O03A 4KDPA 2OZ6A 1FYMA 3DPTA 2ESNA 1P6RA 5HLHA 3F72A 1TW3A 4NHJA 4G94A 2VE9A 4RGUA 4RS8A 4AIHA 4XLNF 3KLNA 2DBBA 5A2QK 3RDIA 3K9TA 3IL2A 1LJ9A 4MEXF 3T5XA 2F5CA 5EEHA 5L3EA 3GF2A 1DPRA 1REPC 1SD7A 4HLXA 3RYRA 3W6KB 3MQ0A 3RPQA 5E18F 4GXOA 4I02A 4FX4A 1R00A 1I27A 2XAFA 1FYLA 4HOBA 4F7ZA 1G3WA 5L3GA 4L0YB 1P2FA 3BOQA 1YLFA 1IXRC 4CDGA 1SFEA 2X0LA 2IRFG 1IXCA 3LA7A 3E6MA 4Q5SF 1D8KA 1BIAA 3BROA 1PUEE 4HQEA 2IW5A 3L09A 1ZG5A 3F3XA 4ESBA 3LAJA 1K79A 1ON2A 3FM5A 2YR2A 2HZTA 2PN6A 2OAZA 1XGSA 5FFXA 3RYPA 4KN7X 4U0VA 2XRNA 1KU9A 3ZN0A 1F1ZA 1R5GA 3HHGA 3F21A 2CWEA 2ESHA 1J2XA 2M87A 3RJPA 3COAC 4OOIA 1BI3A 4CHUA 2ZBKA 3KZYA 4LG0A 2GZWA 4UVAA 2Z3YA 1O3QA 3BY6A 3FHZA 4P5OA 1I1GA 3M9AA 4IPAA 3TDUC 2HR3A 1W7PD 3LSTA 5CVRA 2BE5F 2EFNA 2PFBA 2PG4A 3IHUA 2Z99A 2ZKZA 1V3FA 2HDCA 2ELHA 3U1DA 1LVAA 1K6OA 2M1BA 3DPLC 2MC3A 5FLXZ 3BDDA 3CDHA 3I59B 2QBYA 4YIIA 3LQQA 2FBIA 4GO1A 3BJ6A 2GWRA 5F64A 3C18A 2ETHA 5HOOA 2IVMA 1BI1A 5LRRA 5HVQC 2LNBA 4ESFA 1Z7UA 2F2EA 3I64A 4AIJA 4Y17A 4HX7A 1DUXC 2DO7A 3IKTA 2VBXA 1EH7A 1EH8A 2Q0OA 3R60A 3SZPA 4EM1A 1U5TB 1QZZA 4G8XA 2AXLA 3CO7C 3FM3A 2XKPA 2EA4A 1S3JA 5DCFA 3LWFA 1HW2A 1YYVA 2P6TA 3HRMA 3K1PA 3O3KA 4B8XA 5LGTA 1TTYA 2GA2A 1E2XA 2W57A 2PBIA 5LBQA 1KYWA 1LEBA 3WTZA 5JHUA 3QPTA 1F9NA 2A6HF 1O7FA 4BHCA 3L2CA 1UHMA 5CLSA 4ZH4F 1JE8A 3M1EA 2FBHA 3V8JA 1QBJA 4RB0A 1ZH5A 4UHTA 5LHGA 4YFNF 3M7GA 4L9JA 3HRSA 2DK8A 1L3LA 4LLNA 2DFIA 3B73A 3OV8A 2DAOA 5HS9A 3CUQA 1XDSA 1AWCA 1R1UA 1S7OA 2CQKA 3VB2A 1BN5A 2FRHA 2FNPA 3K0LA 4ON0A 3WTVC 3WE2A 3L7WA 3KE2A 1KQ8A 1H0MA 3KCCA 4GGGA 2QQ9A 2RV8A 3WTXC 1HBXG 1HQCA 3ISPA 3GFMA 5IT9Z 1TNSA 5L3FA 1LNWA 1J9IA 1EH6A 2K4BA 5CYVA 4G6DA 2HKXA 5BPDA 1RUNA 4YFKF 4U88A 5D6FA 1ZLJA 2IP2A 3WGGA 4ENKA 1BC8C 4CXFA 3LA3A 2XASA 1YS6A 2GAUA 4AD9A 5DV5A 4XSZF 3W6JB 2VT3A 3ZMUA 1IN5A 3WU0A 3O2PE 3DF8A 4LG0B 2NNNA 3GVAA 4MHGA 4OIQF 6PAXA 3ZQ7A 2UXXA 2EK5A 2IA0A 1KGSA 2HQNA 3E97A 4A0YA 4KICA 5D4RA 2GXBA 2RKHA 2TDXA 1C0WA 1FP2A 2CG4A 5LRSA 2HWVA 1YQAA 3R0JA 2HQRA 4LLGF 3TKYA 1G3YA 3QOPA 3REOA 5AIQA 1EV7A 2QBYB 3HYIA 4M9SA 1Z6RA 3TO6A 3TOBA 2EFOA 2HFHA 2CYYA 4YG2F 4N9HA 1Z9CA 4KUMA 2BEOA 3FMSA 3FWEA 5E8GA 1W5TA 1Z05A 3KEOA 3QP5A 4LK1F 4EV0A 3V7SA 2O6GE 1SMYF 3WODF 3SFZA 3TGNA 4WXDA 1F5TA 1T98A 3I71A 4OIOF 1LB2A 1SFUA 4PDKA 2WTEA 2ZXJA 2BBYA 2BYVE 5E20A 3IKVA 4XRFA 4U7BA 1RNLA 1YW9A 3IRRA 2D1HA 1BM9A 1P4AA 3E6BA 3PQJA 1ZREA 1H9TA 2IJLA 1MKMA 1TLHB 2HYGD 3LFKA 5AONA 2CSOA 1MDMA 3JTGA 1YFHA 2P8TA 3KFWX 1ZHFA 1OYIA 1K78A 3NRVA 1J59A 3QRFF 4HX4A 5LLQA 4HX8A 4RB1A 4AWXB 5L3BA 2HYFA 2KRFA 2LF8A 3IC7A 1XD7A 1BJAA 4P55A 4IXAA 5AIPA 1SFXA 4R79A 3GO5A 4FHTA 3C3WA 4RB2C 1UCRA 4IF4A 4A5MA 4YFXF 4EJWA 3MZYA 2DT5A 2Y0MA 3DKWA 2D45A 4CYDA 4UXNA 1I6XA 2H09A 1BBYA 2IPQX 2FOKA 3CUOA 1MJBA 5LHHA 3O6BB 1T6SA 5FO5A 3E3VA 3CUQB 2YX7A 2L3DA 1O7LA 2P7CB 5D6EA 1HKSA 4KIBA 2UXNA 3LAPA 4RGSA 3I4PA 1UHWA 2P5LC 4JQFA 3N97A 1BC7C 4P9FA 3V8KA 3F8CA 1J7KA 2RDPA 3F22A 4A6DA 3H92A 5HLGA 3Q9SA 2RGVA 4LLLA 4M6YA 1MD0A 5K5QA 3ZP5A 1TQPA 5ICEA 1QPMA 3HSFA 2PMHA 2LDUA 1W7PA 2EV6A 1QO0D 4GYGA 1XN7A 3OOPA 2XGXA 3V7CA 1IN4A 2JSCA 2V1XA 4M74A 3I5UA 1STZA 4BQAA 4A0ZA 3J80Z 3KEQA 3CJNA 4EGZA 4CO8A 5HS8A 3K69A 2VOPA 3F8NA 3GFJA 4Z2YA 1B6AA 2YPRA 2QUFA 2QVOA 2NNYA 2L01A 1ZGAA 4HF0A 4EJOA 4EMSA 3KP5A 4O6JA 1DPUA 3BJAA 1TQMA 2LKPA 1ZARA 4LMYA 2RQPA 3BZ6A 1YIOA 3ROUA 2E1CA 4I2OA 2UWMA 3G3ZA 3I54A 2VBZA 4RGRA 2MLKA 2J5PA 4N9IA 3N4MA 4EVIA 3ZN1A 4UVCA 2KJBA 1FNNA 4XBFA 3F8MA 2DPUA 1T39A 5FFZA 2K4JA 5TRDA 3L00A 2VC0A 5FD5A 4PGHA 4ZYDA 1XSVA 3CLOA 4U7DA 1GHCA 1A04A 2DQRA 1IRGA 4M73A 3E5QA 5CVJA 3FX3A 2YX4A 5D5UB 3KP7A 3SHFA 4L18B 1FOKA 4LD5A 1SAXA 2QQAA 4CICA 4IHTA 5CVUA 2XAHA 2A5YB 1XDUA 1ZN2A 1ODDA 2YU3A 4FX0A 3SQNA 1ZAOA 5E8IA 3B02A 3WGHA 1MDMB 4M6XA 1LQ1A 1S8NA 4EJUA 1WRJA 2UZKA 3J81Z 1K78B 2M30A 3WU1B 1V4RA 2W25A 3K1NA 5D8LB 1NHAA 4WXCA 3ABUA 3HOSA 3BWGA 4MTEA 1TNTA 1IF1A 2FBKA 4I7HA 3IRQA 4G7ZF 1I5ZA 3VEPA 3EUHA 4JK1X 4HDVA 2IA1A 4HAMA 5E17F 2ZNZA 3FMRA 3HTSB 1G3TA 3SZTA 1OMIA 2W85A 2A6EF 1KYZA 4HV6A 5HLIA 2V1UA 2JZYA 1E17A 1IAWA 3DV8A 1GXQA 2VONA 2EFPA 5DYMA 4MQVA 3HIFA 3CUQC 2E7XA 4M9ZA 3EQLF 3WTTC 1GVJA 2MD5A 3R4KA 3R6SA 2DU9A 5EEGA 4BNCA 5FLXK 5K5OA 5J8CA 1O3TA 2GXGA 4UV8A 5E1ZB 2L4MA 1S6LA 3ABTA 4EM2A 1D5VA 4RGXA 2PLYA 3D5LA 5D4SA 4MNUA 2G7UA 2M8EA 3BPVA 3RKXA 1FYKA 4IRHA 1W7PB 4BYYA 2M5WA 2EFWA 1WWXA 5J8FA 4HF2A 4ASNA 3HTUA 5FGMA 2DTRA 1WI9A 3GX4X 4ZYGA 2E1NA 4KMFA 1U3EM 1JHFA 5DCMA 1FZPB 1JHHA 4HDUA 1TW2A 4EM0B 3E5XA 4EGYA 2K27A 3Q5FA 4O3MA 3SXYA 4H0EA 1GXPA 3GWZA 4N0BA 4HZFA 3IWZA 3TQNA 3GW2A 1B9NA 2QM3A 4BHBA 4ESJA 5F1RA 1FSEA 4L9VA 3TDZC 3K1MA 4IJAA 2Z9OA 1OYWA 4D0PA 3HRTA 2ISZA 3WGIA 1Z91A 3GFIA 1JXSA 1WQ2A 3F8FA 4KMUX 5D8KB 2DI3A 1ZGJA 3I58A 4MGRA 1WKMA 2GA1A 4L0ZB 2XAQA 3V8LA 2NS0A 4XLPF 1U78A 1FSHA 4R1HA 4S05A 4Y15A 2FXAA 1G3SA 2EV0A 4BXUA 1KU3A 2EA2A 1HW5A 1R36A 4HV5A 5KVRA 1HKTA 4G7OF 4G7HF 2GQQA 2MH9A 2W24A 1LDKB 5HDNA 4MQ9F 4AIKA 5HDGA 3RI4A 1KU7A 1D8JA 5JFRA 4QWQA 5ED4A 1T0FA 4KA4A 3ZMZA 3P9CA 2FEZA 3RPUA 4DQ2A 5IT9K 4Q48A 5ICCA 1O3RA 2PEXA 1X3UA 2A61A 3JAMZ 2C6YA 4LB6B 2NAZA 1P4XA 2XVCA 5ILSA 1ZLKA 2OBPA 4PZJA 4L5IA 3KP6A 3RTRA 5CVVA 1MZBA 4LJZF 2P7VB 1OYYA 2HGCA 4Y13A 3E6CC 3EDPA 1P92A 4KIGA 4A0XA 1CGPA 4KNYA 1R23A 5TJJA 2Z33A 2XUBA 3G73A 1B4AA 4IHSA 3KP4A 2MA3A 5ICFA 3I0TA 3KP2A 3F6VA 3C1DA 1KQ9A 2QENA 4U0YA 3ECHA 1B9MA 3RKWA 5L3CA 3VODA 2K86A 2KIFA 2JPCA 2EWNA 3ML6A 3GXOA 1PDNC 5A2QZ 2QYOA 3WTWC 3LQRA 3T1BA 1G4DA 2G7HA 3ECOA 5D5VB 2ZJ2A 3Q9VA 5ILUA 2OQGA 1B59A 4A2UA 3V7RA 1QZYA 1JGSA 3GZ6A 3LA2A 4PGGA 1MJ9A 3FMQA 3ELKA 1LDDA 3P9KA 1PP8F 1OKRA 2KJCA 1J5YA 3M8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8K A;  2RNJ A;  1U5T A;  3TO7 A;  3WTY C;  3GUD A;  2VBW A;  2XKO A;  2VE8 A;  1FWZ A;  1QGP A;  3TO9 A;  1Q1H A;  2V6C A;  4HBL A;  2HTJ A;  4LK0 F;  4PCQ A;  1HW1 A;  4WXH A;  1FC3 A;  3F6O A;  2CW0 F;  3MEX A;  1FBQ A;  1UFM A;  3QU3 A;  4KYW A;  1IUY A;  2HS5 A;  1O57 A;  4R8H A;  5BPI A;  1YO5 C;  4B09 A;  1S29 A;  4KIF A;  4M9X A;  4E70 A;  2MH2 A;  2DW4 A;  4OMZ A;  2CGP A;  5L3D A;  2ACJ A;  3EYY A;  4MTD A;  2L4A A;  1YW8 A;  2PJP A;  1IZ1 A;  2CO5 A;  2BV6 A;  5FB2 A;  4WCG A;  1IN8 A;  2FF4 A;  1G6N A;  2H94 A;  2QZ8 A;  1FP1 D;  2O3F A;  5LEK A;  2X4H A;  1J75 A;  2VN2 A;  5K1Y A;  2RC4 A;  5BMZ A;  2P6S A;  4AVP A;  2ISY A;  1H9G A;  3T0Y A;  4ZZD A;  5BOX A;  2OZU A;  2V79 A;  4HYE A;  1ZG1 A;  2VXZ A;  2COM A;  3PQK A;  1SD4 A;  2JPB A;  4UVB A;  4ZYH A;  1I1S A;  2F5F A;  2LF7 A;  2KIU A;  4DNC A;  4XSX F;  2DK5 A;  4JBA A;  2A69 F;  3EET A;  3T8T A;  2XRO A;  3QU6 A;  2VT2 A;  1IXS B;  1ULY A;  4ENJ A;  1R58 A;  1KA8 A;  1XMA A;  1F4K A;  2RN7 A;  5ERI A;  4CGZ A;  5ILV A;  5H6R A;  4P96 A;  1R22 A;  2DQL A;  4M71 A;  1Y0U A;  4LGW A;  5DEQ A;  1R5H A;  3V4G A;  4I0B A;  1ZRD A;  4L5J A;  3RKY A;  2XAG A;  1VTN C;  3I53 A;  2P5V A;  5HS7 A;  2JTV A;  1BI0 A;  1BI2 A;  1MGT A;  5DD8 A;  4OU0 A;  4A5N A;  3GEZ A;  1UST A;  3F23 A;  3DEU A;  3ERE D;  1RI7 A;  2ZME A;  4RAZ A;  1TQI A;  4EJV A;  1D3Y A;  3P9I A;  2A07 F;  2R3S A;  4OIP F;  3HHH A;  2STT A;  3J80 K;  4G9Y A;  1RIO H;  2HEO A;  2FML A;  1KU2 A;  2FE3 A;  3NEU A;  5LEJ A;  4A12 A;  1SMT A;  2G9W A;  2QQB A;  2ADU A;  3MWM A;  5DDG A;  4BH9 A;  2OA4 A;  1T38 A;  4FT8 A;  2O8X A;  2KIM A;  3GLX A;  4HA8 A;  1XB4 A;  1CF7 A;  1YS7 A;  2Y48 A;  4M72 A;  4I09 A;  3WG9 A;  3S2W A;  3AAF A;  3QAH A;  2EJR A;  2D1V A;  1FBS A;  3FXU A;  5CJ9 A;  2GIV A;  3BJO A;  4OIR F;  3DFG A;  1HST A;  3R61 A;  4IVN A;  1WSU A;  5E1W A;  4OIN F;  2IT0 A;  1FX7 A;  2FMY A;  3NQO A;  4HQM A;  3FXQ A;  2JRT A;  2F5E A;  3BPX A;  2HTS A;  3DXJ F;  4EQQ A;  4NQW A;  2BGC A;  1XGN A;  3MZH A;  5H20 A;  2DLL A;  1YTY A;  2EB7 A;  1ZYR F;  1XSX A;  3QP6 A;  5JR3 A;  5DUK A;  2O0Y A;  2R7D A;  2QLZ A;  2ZNY A;  4K2E A;  3HUG A;  4RAY A;  1U2W A;  4MEY F;  5BS6 A;  2A3S A;  3TOA A;  4QLC U;  2HKO A;  4WX9 A;  3KET A;  2R7F A;  4L9N A;  4I01 A;  1FBU A;  5D5X B;  2EV5 A;  4KN4 X;  1P4W A;  4Q4Z F;  2WWY A;  2MLG A;  4S04 A;  2VBY A;  3EYI A;  1XMK A;  3J81 K;  2K02 A;  1R1V A;  5IT3 A;  2VOO A;  1TBX A;  4YIF A;  2OU2 A;  1B1B A;  2STW A;  2LSO A;  3QPH A;  2L02 A;  4GYI A;  2OQR A;  1K7A A;  1SD6 A;  5J6X A;  2FSW A;  2VC1 A;  3FZV A;  3FXR A;  2FU4 A;  3CTA A;  2FQ3 A;  5JVT A;  3ZPL A;  1FY7 A;  1ZG3 A;  2O61 A;  2F5D A;  4HLY A;  4OMY A;  3HRU A;  2NRA C;  2Q2E A;  3H3Z A;  3GZ5 A;  1IW7 F;  2H6B A;  1HKQ A;  1AOY A;  4IRG A;  5DD4 A;  5CVI A;  2H6C A;  2XIG A;  3C7J A;  1ONV A;  4P9U A;  2JT1 A;  2Y75 A;  2K7L A;  1RUO A;  1RZ4 A;  2V1D A;  2B0L A;  1R7J A;  4NB5 A;  2P5K A;  1DP7 P;  1Z6T A;  2D2W A;  3WE3 A;  2ZCW A;  3RIR A;  2YSR A;  4WWC A;  2EFQ A;  1ZRC A;  3HSR A;  4BAY A;  1W4M A;  5LHI A;  2QWW A;  1YG2 A;  2KKO A;  2RVC A;  3JSO A;  3GYH X;  3J7A O;  1QQI A;  2IA2 A;  5K5R A;  2ZME B;  2DPD A;  3FF5 A;  1J0R A;  4ENN A;  1IN7 A;  3ZMD A;  4U0W A;  1S7A A;  1YW7 A;  2J5O A;  4CZZ A;  2PI0 A;  4KFC A;  5H6Q A;  3WTS C;  3ZMS A;  1O3S A;  1MJA A;  1KQ0 A;  2V9V A;  1QNT A;  3KP3 A;  5ICG A;  3K2Z A;  3IWF A;  1XSD A;  4UUV A;  2AS5 F;  2VOD A;  4O5V A;  2OD5 A;  5LGN A;  2WV0 A;  1CF7 B;  3WTU C;  3R0A A;  3MAJ A;  3ZMT A;  2E7W A;  4HW0 A;  4UV9 A;  4WF2 A;  3U9G A;  3VFZ A;  1IRF A;  1USS A;  3ULQ B;  5HDK A;  2FNA A;  3KLO A;  1ZRF A;  4I0A A;  1UB9 A;  2PMU A;  4A6E A;  3CO6 C;  4UNO A;  3M8F A;  2XHK A;  4BHP A;  4Q47 A;  2XAJ A;  2Z5U A;  1XCB A;  2HOE A;  2P4W A;  5FD6 A;  1XCV A;  2MBF A;  5DUI A;  2A68 F;  2XV4 S;  2ZO4 A;  1FLI A;  4KT5 C;  4EJT A;  4ZZL A;  2ZFW A;  5BQT A;  3DP7 A;  3HSE A;  5E1X A;  2PQ8 A;  4I98 B;  1OR7 A;  4ENM A;  4LFU A;  3HOT A;  3BP8 A;  1HXD A;  1W5S A;  1U6G A;  3KZZ A;  3GFL A;  1XGM A;  4G6Q A;  3I59 A;  1U5T C;  1LEA A;  3H3U A;  3VOE A;  4ETS A;  4HF1 A;  1LDJ A;  4L9T A;  3U2R A;  1L0O C;  2NYX A;  5LGU A;  4IRI A;  1OPC A;  1IN6 A;  2M45 A;  3DQV C;  1SD5 A;  3JAM K;  3E5U A;  3JTH A;  2FA5 A;  3JSP A;  3MCZ A;  1FPQ A;  1R1T A;  3JW4 A;  3PFI A;  2WC2 A;  2W84 A;  1XGO A;  4ZYE A;  3L9F A;  5DCM B;  4LB5 A;  3D0S A;  3T8R A;  4WK8 F;  3ZMV A;  2CFX A;  5D5W B;  1Z1D A;  5F6F A;  1FT9 A;  5KK1 A;  1U8R A;  4TV7 A;  1T2K A;  1BIB A;  5JI6 A;  3F8B A;  3P7N A;  1PP7 U;  3MFK A;  1DDN A;  1ON1 A;  2L54 A;  4RB3 C;  1BOA A;  2H27 A;  4GCV A;  3E6D A;  1HSJ A;  2O03 A;  4KDP A;  2OZ6 A;  1FYM A;  3DPT A;  2ESN A;  1P6R A;  5HLH A;  3F72 A;  1TW3 A;  4NHJ A;  4G94 A;  2VE9 A;  4RGU A;  4RS8 A;  4AIH A;  4XLN F;  3KLN A;  2DBB A;  5A2Q K;  3RDI A;  3K9T A;  3IL2 A;  1LJ9 A;  4MEX F;  3T5X A;  2F5C A;  5EEH A;  5L3E A;  3GF2 A;  1DPR A;  1REP C;  1SD7 A;  4HLX A;  3RYR A;  3W6K B;  3MQ0 A;  3RPQ A;  5E18 F;  4GXO A;  4I02 A;  4FX4 A;  1R00 A;  1I27 A;  2XAF A;  1FYL A;  4HOB A;  4F7Z A;  1G3W A;  5L3G A;  4L0Y B;  1P2F A;  3BOQ A;  1YLF A;  1IXR C;  4CDG A;  1SFE A;  2X0L A;  2IRF G;  1IXC A;  3LA7 A;  3E6M A;  4Q5S F;  1D8K A;  1BIA A;  3BRO A;  1PUE E;  4HQE A;  2IW5 A;  3L09 A;  1ZG5 A;  3F3X A;  4ESB A;  3LAJ A;  1K79 A;  1ON2 A;  3FM5 A;  2YR2 A;  2HZT A;  2PN6 A;  2OAZ A;  1XGS A;  5FFX A;  3RYP A;  4KN7 X;  4U0V A;  2XRN A;  1KU9 A;  3ZN0 A;  1F1Z A;  1R5G A;  3HHG A;  3F21 A;  2CWE A;  2ESH A;  1J2X A;  2M87 A;  3RJP A;  3COA C;  4OOI A;  1BI3 A;  4CHU A;  2ZBK A;  3KZY A;  4LG0 A;  2GZW A;  4UVA A;  2Z3Y A;  1O3Q A;  3BY6 A;  3FHZ A;  4P5O A;  1I1G A;  3M9A A;  4IPA A;  3TDU C;  2HR3 A;  1W7P D;  3LST A;  5CVR A;  2BE5 F;  2EFN A;  2PFB A;  2PG4 A;  3IHU A;  2Z99 A;  2ZKZ A;  1V3F A;  2HDC A;  2ELH A;  3U1D A;  1LVA A;  1K6O A;  2M1B A;  3DPL C;  2MC3 A;  5FLX Z;  3BDD A;  3CDH A;  3I59 B;  2QBY A;  4YII A;  3LQQ A;  2FBI A;  4GO1 A;  3BJ6 A;  2GWR A;  5F64 A;  3C18 A;  2ETH A;  5HOO A;  2IVM A;  1BI1 A;  5LRR A;  5HVQ C;  2LNB A;  4ESF A;  1Z7U A;  2F2E A;  3I64 A;  4AIJ A;  4Y17 A;  4HX7 A;  1DUX C;  2DO7 A;  3IKT A;  2VBX A;  1EH7 A;  1EH8 A;  2Q0O A;  3R60 A;  3SZP A;  4EM1 A;  1U5T B;  1QZZ A;  4G8X A;  2AXL A;  3CO7 C;  3FM3 A;  2XKP A;  2EA4 A;  1S3J A;  5DCF A;  3LWF A;  1HW2 A;  1YYV A;  2P6T A;  3HRM A;  3K1P A;  3O3K A;  4B8X A;  5LGT A;  1TTY A;  2GA2 A;  1E2X A;  2W57 A;  2PBI A;  5LBQ A;  1KYW A;  1LEB A;  3WTZ A;  5JHU A;  3QPT A;  1F9N A;  2A6H F;  1O7F A;  4BHC A;  3L2C A;  1UHM A;  5CLS A;  4ZH4 F;  1JE8 A;  3M1E A;  2FBH A;  3V8J A;  1QBJ A;  4RB0 A;  1ZH5 A;  4UHT A;  5LHG A;  4YFN F;  3M7G A;  4L9J A;  3HRS A;  2DK8 A;  1L3L A;  4LLN A;  2DFI A;  3B73 A;  3OV8 A;  2DAO A;  5HS9 A;  3CUQ A;  1XDS A;  1AWC A;  1R1U A;  1S7O A;  2CQK A;  3VB2 A;  1BN5 A;  2FRH A;  2FNP A;  3K0L A;  4ON0 A;  3WTV C;  3WE2 A;  3L7W A;  3KE2 A;  1KQ8 A;  1H0M A;  3KCC A;  4GGG A;  2QQ9 A;  2RV8 A;  3WTX C;  1HBX G;  1HQC A;  3ISP A;  3GFM A;  5IT9 Z;  1TNS A;  5L3F A;  1LNW A;  1J9I A;  1EH6 A;  2K4B A;  5CYV A;  4G6D A;  2HKX A;  5BPD A;  1RUN A;  4YFK F;  4U88 A;  5D6F A;  1ZLJ A;  2IP2 A;  3WGG A;  4ENK A;  1BC8 C;  4CXF A;  3LA3 A;  2XAS A;  1YS6 A;  2GAU A;  4AD9 A;  5DV5 A;  4XSZ F;  3W6J B;  2VT3 A;  3ZMU A;  1IN5 A;  3WU0 A;  3O2P E;  3DF8 A;  4LG0 B;  2NNN A;  3GVA A;  4MHG A;  4OIQ F;  6PAX A;  3ZQ7 A;  2UXX A;  2EK5 A;  2IA0 A;  1KGS A;  2HQN A;  3E97 A;  4A0Y A;  4KIC A;  5D4R A;  2GXB A;  2RKH A;  2TDX A;  1C0W A;  1FP2 A;  2CG4 A;  5LRS A;  2HWV A;  1YQA A;  3R0J A;  2HQR A;  4LLG F;  3TKY A;  1G3Y A;  3QOP A;  3REO A;  5AIQ A;  1EV7 A;  2QBY B;  3HYI A;  4M9S A;  1Z6R A;  3TO6 A;  3TOB A;  2EFO A;  2HFH A;  2CYY A;  4YG2 F;  4N9H A;  1Z9C A;  4KUM A;  2BEO A;  3FMS A;  3FWE A;  5E8G A;  1W5T A;  1Z05 A;  3KEO A;  3QP5 A;  4LK1 F;  4EV0 A;  3V7S A;  2O6G E;  1SMY F;  3WOD F;  3SFZ A;  3TGN A;  4WXD A;  1F5T A;  1T98 A;  3I71 A;  4OIO F;  1LB2 A;  1SFU A;  4PDK A;  2WTE A;  2ZXJ A;  2BBY A;  2BYV E;  5E20 A;  3IKV A;  4XRF A;  4U7B A;  1RNL A;  1YW9 A;  3IRR A;  2D1H A;  1BM9 A;  1P4A A;  3E6B A;  3PQJ A;  1ZRE A;  1H9T A;  2IJL A;  1MKM A;  1TLH B;  2HYG D;  3LFK A;  5AON A;  2CSO A;  1MDM A;  3JTG A;  1YFH A;  2P8T A;  3KFW X;  1ZHF A;  1OYI A;  1K78 A;  3NRV A;  1J59 A;  3QRF F;  4HX4 A;  5LLQ A;  4HX8 A;  4RB1 A;  4AWX B;  5L3B A;  2HYF A;  2KRF A;  2LF8 A;  3IC7 A;  1XD7 A;  1BJA A;  4P55 A;  4IXA A;  5AIP A;  1SFX A;  4R79 A;  3GO5 A;  4FHT A;  3C3W A;  4RB2 C;  1UCR A;  4IF4 A;  4A5M A;  4YFX F;  4EJW A;  3MZY A;  2DT5 A;  2Y0M A;  3DKW A;  2D45 A;  4CYD A;  4UXN A;  1I6X A;  2H09 A;  1BBY A;  2IPQ X;  2FOK A;  3CUO A;  1MJB A;  5LHH A;  3O6B B;  1T6S A;  5FO5 A;  3E3V A;  3CUQ B;  2YX7 A;  2L3D A;  1O7L A;  2P7C B;  5D6E A;  1HKS A;  4KIB A;  2UXN A;  3LAP A;  4RGS A;  3I4P A;  1UHW A;  2P5L C;  4JQF A;  3N97 A;  1BC7 C;  4P9F A;  3V8K A;  3F8C A;  1J7K A;  2RDP A;  3F22 A;  4A6D A;  3H92 A;  5HLG A;  3Q9S A;  2RGV A;  4LLL A;  4M6Y A;  1MD0 A;  5K5Q A;  3ZP5 A;  1TQP A;  5ICE A;  1QPM A;  3HSF A;  2PMH A;  2LDU A;  1W7P A;  2EV6 A;  1QO0 D;  4GYG A;  1XN7 A;  3OOP A;  2XGX A;  3V7C A;  1IN4 A;  2JSC A;  2V1X A;  4M74 A;  3I5U A;  1STZ A;  4BQA A;  4A0Z A;  3J80 Z;  3KEQ A;  3CJN A;  4EGZ A;  4CO8 A;  5HS8 A;  3K69 A;  2VOP A;  3F8N A;  3GFJ A;  4Z2Y A;  1B6A A;  2YPR A;  2QUF A;  2QVO A;  2NNY A;  2L01 A;  1ZGA A;  4HF0 A;  4EJO A;  4EMS A;  3KP5 A;  4O6J A;  1DPU A;  3BJA A;  1TQM A;  2LKP A;  1ZAR A;  4LMY A;  2RQP A;  3BZ6 A;  1YIO A;  3ROU A;  2E1C A;  4I2O A;  2UWM A;  3G3Z A;  3I54 A;  2VBZ A;  4RGR A;  2MLK A;  2J5P A;  4N9I A;  3N4M A;  4EVI A;  3ZN1 A;  4UVC A;  2KJB A;  1FNN A;  4XBF A;  3F8M A;  2DPU A;  1T39 A;  5FFZ A;  2K4J A;  5TRD A;  3L00 A;  2VC0 A;  5FD5 A;  4PGH A;  4ZYD A;  1XSV A;  3CLO A;  4U7D A;  1GHC A;  1A04 A;  2DQR A;  1IRG A;  4M73 A;  3E5Q A;  5CVJ A;  3FX3 A;  2YX4 A;  5D5U B;  3KP7 A;  3SHF A;  4L18 B;  1FOK A;  4LD5 A;  1SAX A;  2QQA A;  4CIC A;  4IHT A;  5CVU A;  2XAH A;  2A5Y B;  1XDU A;  1ZN2 A;  1ODD A;  2YU3 A;  4FX0 A;  3SQN A;  1ZAO A;  5E8I A;  3B02 A;  3WGH A;  1MDM B;  4M6X A;  1LQ1 A;  1S8N A;  4EJU A;  1WRJ A;  2UZK A;  3J81 Z;  1K78 B;  2M30 A;  3WU1 B;  1V4R A;  2W25 A;  3K1N A;  5D8L B;  1NHA A;  4WXC A;  3ABU A;  3HOS A;  3BWG A;  4MTE A;  1TNT A;  1IF1 A;  2FBK A;  4I7H A;  3IRQ A;  4G7Z F;  1I5Z A;  3VEP A;  3EUH A;  4JK1 X;  4HDV A;  2IA1 A;  4HAM A;  5E17 F;  2ZNZ A;  3FMR A;  3HTS B;  1G3T A;  3SZT A;  1OMI A;  2W85 A;  2A6E F;  1KYZ A;  4HV6 A;  5HLI A;  2V1U A;  2JZY A;  1E17 A;  1IAW A;  3DV8 A;  1GXQ A;  2VON A;  2EFP A;  5DYM A;  4MQV A;  3HIF A;  3CUQ C;  2E7X A;  4M9Z A;  3EQL F;  3WTT C;  1GVJ A;  2MD5 A;  3R4K A;  3R6S A;  2DU9 A;  5EEG A;  4BNC A;  5FLX K;  5K5O A;  5J8C A;  1O3T A;  2GXG A;  4UV8 A;  5E1Z B;  2L4M A;  1S6L A;  3ABT A;  4EM2 A;  1D5V A;  4RGX A;  2PLY A;  3D5L A;  5D4S A;  4MNU A;  2G7U A;  2M8E A;  3BPV A;  3RKX A;  1FYK A;  4IRH A;  1W7P B;  4BYY A;  2M5W A;  2EFW A;  1WWX A;  5J8F A;  4HF2 A;  4ASN A;  3HTU A;  5FGM A;  2DTR A;  1WI9 A;  3GX4 X;  4ZYG A;  2E1N A;  4KMF A;  1U3E M;  1JHF A;  5DCM A;  1FZP B;  1JHH A;  4HDU A;  1TW2 A;  4EM0 B;  3E5X A;  4EGY A;  2K27 A;  3Q5F A;  4O3M A;  3SXY A;  4H0E A;  1GXP A;  3GWZ A;  4N0B A;  4HZF A;  3IWZ A;  3TQN A;  3GW2 A;  1B9N A;  2QM3 A;  4BHB A;  4ESJ A;  5F1R A;  1FSE A;  4L9V A;  3TDZ C;  3K1M A;  4IJA A;  2Z9O A;  1OYW A;  4D0P A;  3HRT A;  2ISZ A;  3WGI A;  1Z91 A;  3GFI A;  1JXS A;  1WQ2 A;  3F8F A;  4KMU X;  5D8K B;  2DI3 A;  1ZGJ A;  3I58 A;  4MGR A;  1WKM A;  2GA1 A;  4L0Z B;  2XAQ A;  3V8L A;  2NS0 A;  4XLP F;  1U78 A;  1FSH A;  4R1H A;  4S05 A;  4Y15 A;  2FXA A;  1G3S A;  2EV0 A;  4BXU A;  1KU3 A;  2EA2 A;  1HW5 A;  1R36 A;  4HV5 A;  5KVR A;  1HKT A;  4G7O F;  4G7H F;  2GQQ A;  2MH9 A;  2W24 A;  1LDK B;  5HDN A;  4MQ9 F;  4AIK A;  5HDG A;  3RI4 A;  1KU7 A;  1D8J A;  5JFR A;  4QWQ A;  5ED4 A;  1T0F A;  4KA4 A;  3ZMZ A;  3P9C A;  2FEZ A;  3RPU A;  4DQ2 A;  5IT9 K;  4Q48 A;  5ICC A;  1O3R A;  2PEX A;  1X3U A;  2A61 A;  3JAM Z;  2C6Y A;  4LB6 B;  2NAZ A;  1P4X A;  2XVC A;  5ILS A;  1ZLK A;  2OBP A;  4PZJ A;  4L5I A;  3KP6 A;  3RTR A;  5CVV A;  1MZB A;  4LJZ F;  2P7V B;  1OYY A;  2HGC A;  4Y13 A;  3E6C C;  3EDP A;  1P92 A;  4KIG A;  4A0X A;  1CGP A;  4KNY A;  1R23 A;  5TJJ A;  2Z33 A;  2XUB A;  3G73 A;  1B4A A;  4IHS A;  3KP4 A;  2MA3 A;  5ICF A;  3I0T A;  3KP2 A;  3F6V A;  3C1D A;  1KQ9 A;  2QEN A;  4U0Y A;  3ECH A;  1B9M A;  3RKW A;  5L3C A;  3VOD A;  2K86 A;  2KIF A;  2JPC A;  2EWN A;  3ML6 A;  3GXO A;  1PDN C;  5A2Q Z;  2QYO A;  3WTW C;  3LQR A;  3T1B A;  1G4D A;  2G7H A;  3ECO A;  5D5V B;  2ZJ2 A;  3Q9V A;  5ILU A;  2OQG A;  1B59 A;  4A2U A;  3V7R A;  1QZY A;  1JGS A;  3GZ6 A;  3LA2 A;  4PGG A;  1MJ9 A;  3FMQ A;  3ELK A;  1LDD A;  3P9K A;  1PP8 F;  1OKR A;  2KJC A;  1J5Y A;  3M8E A; 
#chains in the Genus database with same CATH topology
 1X2M A;  2HXI A;  2M3A A;  5B66 C;  2Q8K A;  3W2A A;  2RNJ A;  3PJR A;  2CQQ A;  2EQR A;  2IS4 A;  3HB9 A;  1U5T A;  3TO7 A;  3WTY C;  2R93 J;  4CZC A;  3GUD A;  2VBW A;  1CQT A;  2XKO A;  2VJJ A;  2VE8 A;  1FWZ A;  1QGP A;  2P81 A;  3TO9 A;  1WPK A;  1Q1H A;  3GTL J;  2V6C A;  2F48 A;  4HBL A;  3QOE A;  2Y9Z A;  2HTJ A;  4LK0 F;  4PCQ A;  1HW1 A;  1G59 A;  2H8W A;  4D1Q A;  4WXH A;  4RAG A;  1FC3 A;  3FDY A;  1OCC H;  1VFC A;  3F6O A;  2CW0 F;  3CC2 I;  4PK4 A;  3MEX A;  2JJ7 A;  3HBL A;  1FBQ A;  1UFM A;  3OY9 A;  1N25 A;  2E5Z A;  3QU3 A;  3LSR A;  5EJC A;  4KYW A;  5F27 A;  4LIV A;  2WAQ N;  5FKK A;  1IUY A;  2HS5 A;  4Z6Y A;  3H1C A;  1O57 A;  2IGM A;  4R8H A;  1MMD A;  5BPI A;  1YO5 C;  4ZDL A;  4B09 A;  4M3G A;  1S29 A;  5J1R A;  4KIF A;  4M9X A;  4PSX A;  3BG3 A;  4E70 A;  3EUK L;  2HQ5 A;  4Y4R A;  2KL4 A;  4M6V A;  3I4N J;  2MH2 A;  3FK6 A;  2L7Z A;  2CUJ A;  2CV2 A;  2MW8 A;  2DW4 A;  2TRT A;  3LOC A;  4OMZ A;  2CGP A;  2R7S A;  5L3D A;  2ACJ A;  3HOW J;  1NG6 A;  4ZYA A;  4QIW N;  2DXI A;  3EYY A;  2V4J C;  4AYB A;  4MTD A;  2L4A A;  1SAU A;  1YW8 A;  3IH3 A;  4J00 A;  2JWT A;  4JYK A;  2PJP A;  1IZ1 A;  2CO5 A;  2BV6 A;  1KON A;  5FB2 A;  4WCG A;  1IN8 A;  3ASO H;  4UUS B;  2FF4 A;  3TED A;  1G6N A;  2H94 A;  2LC2 A;  2QZ8 A;  1FP1 D;  1G2H A;  4CSW A;  1BOB A;  2O3F A;  2X4H A;  4YEJ A;  5LEK A;  1J75 A;  2VN2 A;  5K1Y A;  1V54 H;  4ANJ A;  2RC4 A;  1PYV A;  3QYE A;  2ZJQ F;  3OL4 A;  5BMZ A;  2P6S A;  4AVP A;  2ISY A;  3CME I;  1H9G A;  3SDG A;  3T0Y A;  4ZZD A;  5BOX A;  5M5W J;  2OZU A;  2V79 A;  3OWT A;  5KAI C;  4HYE A;  2ZME C;  1ZG1 A;  3J7Y J;  2VXZ A;  2COM A;  3PQK A;  1SD4 A;  2JPB A;  4UVB A;  3A1Y A;  4L5E A;  4ZYH A;  4UY8 I;  1FOW A;  1I1S A;  2XC7 A;  2F5F A;  2LF7 A;  5E8I A;  2H8R A;  2KIU A;  3MN2 A;  4DNC A;  2EZI A;  4XSX F;  2DK5 A;  3KYC B;  4JBA A;  4MIM A;  2A69 F;  3EET A;  3T8T A;  2XRO A;  1S72 I;  3QU6 A;  2I8D A;  2VT2 A;  1IXS B;  1ULY A;  2KIS A;  3P5J A;  4ENJ A;  1R58 A;  1KA8 A;  3H9Q A;  5HLT A;  1XMA A;  1F4K A;  2RN7 A;  5ERI A;  4CGZ A;  5TGT A;  5ILV A;  1D1B A;  2VIX A;  5H6R A;  4P96 A;  1R22 A;  2DQL A;  3NWT A;  2XB0 X;  5FRO A;  4M71 A;  2QCO A;  3QPL A;  1Y1V J;  1Y0U A;  3DBR B;  3HGG A;  4LGW A;  3S1R J;  5DEQ A;  1R5H A;  1TWC J;  1W1W E;  2HYJ A;  3V4G A;  4I0B A;  1R71 A;  1ZRD A;  1FTZ A;  2LP0 A;  2ZJP F;  4L5J A;  3RKY A;  2XAG A;  1VI0 A;  1VTN C;  3I53 A;  2P5V A;  4Y3O A;  5HS7 A;  4CCK A;  3E1S A;  2JTV A;  1BI2 A;  1BI0 A;  1MGT A;  4OWR B;  5DD8 A;  4OU0 A;  3S8P A;  4A5N A;  1F36 A;  3GEZ A;  1UST A;  4CH7 A;  3DEU A;  4AU7 A;  4XL9 A;  3F23 A;  3ERE D;  1RI7 A;  2ZME A;  4RAZ A;  1TQI A;  3JRB A;  1QHG A;  2BY2 A;  3PUF A;  5DS9 A;  3JRI A;  4EJV A;  4AM3 A;  4M3E A;  1VQM I;  1D1A A;  1NK2 P;  1D3Y A;  3P9I A;  5CQG A;  4A3E J;  2A07 F;  2R3S A;  4NNJ A;  2BVM A;  4DZP A;  4OIP F;  3E0J B;  3HHH A;  4IQ4 A;  2STT A;  3J80 K;  4G9Y A;  1RIO H;  2HEO A;  2FML A;  1KU2 A;  2FE3 A;  1VQK I;  1I3Q J;  3NEU A;  5LEJ A;  4J01 A;  4A12 A;  2R0Q C;  2NVX J;  1SMT A;  2G9W A;  2OF7 A;  4BS9 A;  4NC7 A;  1WI3 A;  1VQ8 I;  4BBS J;  2VJ5 A;  2QQB A;  2ADU A;  3MWM A;  5DDG A;  4BH9 A;  2OA4 A;  1T38 A;  1A31 A;  4FT8 A;  4XLH A;  2IS6 A;  2H1K A;  2O8X A;  1N78 A;  2KIM A;  1U0J A;  3GLX A;  4HA8 A;  4XLA A;  1XB4 A;  1CF7 A;  1YS7 A;  2Y48 A;  1D0X A;  4M72 A;  4A3I J;  2M7A A;  3L2W A;  4ZTF A;  1AKH B;  1OCO H;  4ZTJ A;  1RR8 C;  4I09 A;  3WG9 A;  3S2W A;  4FTH A;  5IYB J;  3AAF A;  3QAH A;  4XRS G;  5K7H A;  1SVO A;  2EJR A;  2D1V A;  1FBS A;  3FXU A;  4E7S A;  5CJ9 A;  2GIV A;  3BJO A;  2VL8 A;  2R7W A;  4RLQ A;  1A6Q A;  3AL0 C;  5EGO A;  5GAG J;  1N75 A;  4OIR F;  4BBR J;  3DBL B;  1HST A;  3DFG A;  3R61 A;  4IVN A;  2R5Z A;  1WSU A;  5E1W A;  1IJW C;  2DTZ A;  4OIN F;  4XRM A;  2IT0 A;  1FX7 A;  5GAD J;  3JCU C;  2FMY A;  3NQO A;  4HQM A;  4KIT B;  1ZGW A;  1JKP C;  3FXQ A;  2OTL I;  4MLO A;  2JRT A;  2F5E A;  2E36 A;  2QGU A;  3BPX A;  2HTS A;  3DXJ F;  4EQQ A;  4NQW A;  2BGC A;  3TW6 A;  1XGN A;  1VQL I;  3MZH A;  3GTO J;  1X1C A;  4D9J A;  2LVS A;  2WAD A;  2HPM A;  5H20 A;  2DLL A;  1YTY A;  2EB7 A;  3KYD B;  4RA2 A;  1ZYR F;  3W2V A;  2FOW A;  4NUB A;  3VSK A;  2CUE A;  4F92 B;  1XSX A;  4A3J J;  3QP6 A;  5JR3 A;  1MBK A;  5DUK A;  1FTT A;  2O0Y A;  1FEX A;  2MAB A;  2QLZ A;  2R7D A;  3A03 A;  2F6C A;  2ZNY A;  3OSF A;  4K2E A;  3HUG A;  3S1Q J;  4RAY A;  1U2W A;  2ME6 A;  2LYC A;  2E1M B;  4MEY F;  4RAF A;  1VQ9 I;  2K9S A;  5BS6 A;  3MMY B;  2A3S A;  2NOG A;  4DGW B;  5H2F C;  3TOA A;  4QLC U;  1YRN A;  1ETV A;  2HKO A;  4WX9 A;  3KET A;  2R7F A;  1FOX A;  4L9N A;  2EZH A;  3CJT B;  4E7H A;  2COB A;  9ANT A;  3PIO F;  5J1U A;  4I01 A;  5KCM A;  1FBU A;  3FKJ A;  2EPF A;  5D5X B;  2VUM J;  2EV5 A;  2DMU A;  4KN4 X;  4RM3 A;  1P4W A;  4Q4Z F;  2WWY A;  4DYQ A;  2MLG A;  4S04 A;  2VBY A;  4XMY A;  2NS8 A;  3BG7 A;  3EYI A;  1XMK A;  2BY0 A;  3J81 K;  2K02 A;  1R1V A;  5IT3 A;  2VOO A;  3QWL A;  1TBX A;  3PO2 J;  2HOA A;  3IP4 B;  2W4S A;  4YIF A;  2OU2 A;  1ERD A;  1B1B A;  2X1E A;  2STW A;  2LSO A;  3QPH A;  2L02 A;  3HM5 A;  1TZL A;  4GYI A;  4FCY A;  2BZT A;  4CCN A;  4D5F A;  2OQR A;  3I4M J;  1K7A A;  3PUB A;  1SD6 A;  5J6X A;  4E7L A;  4PJL A;  2FSW A;  3CDL A;  2VC1 A;  2O5R A;  5KNL A;  3FZV A;  5J40 A;  2EIL H;  3ZCO A;  3B6C A;  3FXR A;  2FU4 A;  3GME A;  1KZH A;  3CTA A;  2FQ3 A;  2WAQ A;  3H3V K;  5JVT A;  1MMN A;  3PM1 A;  1FY7 A;  3ZPL A;  1ZG3 A;  1EKE A;  2O61 A;  4PSW A;  2F5D A;  4HLY A;  5EF6 A;  4OMY A;  3HRU A;  1Y1W J;  2NRA C;  2I10 A;  2Q2E A;  3H3Z A;  3GZ5 A;  1R5I D;  1IW7 F;  2H6B A;  3BTI A;  1HKQ A;  1AOY A;  3HOV J;  2KP6 A;  1MND A;  4G6T B;  4IRG A;  5DD4 A;  3S2H J;  2GM4 A;  5CVI A;  2H6C A;  2XIG A;  3C7J A;  1ONV A;  4P9U A;  3DTK A;  1Y0N A;  2JT1 A;  2X9D A;  2Y75 A;  2K7L A;  4CUG A;  3MVP A;  1ZKG A;  1RUO A;  1R49 A;  3AKZ A;  2DFH A;  1SFO J;  5C4J J;  1RZ4 A;  3QOD A;  2V1D A;  2HOT A;  3KYL A;  3DEW A;  3H9J A;  3S3N A;  2B0L A;  1R7J A;  3ZRG A;  4NB5 A;  2ZB9 A;  2JSP A;  5GPA A;  1Y6I A;  2DYS H;  3OYC A;  2P5K A;  1DP7 P;  4XOT A;  1Z6T A;  3C2H A;  2D2W A;  2NVY J;  3WE3 A;  3WU2 C;  3DCF A;  3OIO A;  2ZCW A;  5E3L A;  3RIR A;  3HPH A;  2YSR A;  3SEQ A;  4WWC A;  3GTK J;  3CJR B;  3CMY A;  2EFQ A;  1ZRC A;  3HSR A;  4BAY A;  1W4M A;  3I3L A;  5LHI A;  2QWW A;  1YG2 A;  3ONQ A;  3H36 A;  1Z77 A;  2KKO A;  2RVC A;  4MFE A;  3JSO A;  2ID6 A;  3GYH X;  3G2B A;  3J7A O;  2CW8 A;  2HI3 A;  4A3G J;  1QQI A;  4IX7 A;  2IA2 A;  1EJ9 A;  1U8B A;  4XNF A;  1VF9 A;  2ZME B;  5K5R A;  2DPD A;  3FF5 A;  1J0R A;  4ENN A;  3BR3 A;  3S1M J;  1IN7 A;  2BHZ A;  3ZMD A;  4U0W A;  1S7A A;  1YW7 A;  2J5O A;  4CZZ A;  2PI0 A;  3Q0U A;  4KFC A;  2A6T A;  1V5E A;  2TCT A;  5H6Q A;  2LH9 A;  3WTS C;  3IAM 2;  1SEU A;  3ZMS A;  1O3S A;  2DA7 A;  1MJA A;  1KQ0 A;  2JK3 A;  3CMA I;  2V9V A;  1U9N A;  2R7X A;  1QNT A;  3KP3 A;  4IEJ A;  5ICG A;  3K2Z A;  5IYD J;  3IWF A;  2VJ4 A;  1VQ4 I;  3W6V A;  5M3F J;  1XSD A;  2K9Q A;  4UUV A;  1Z21 A;  3CMM A;  4IHV A;  3JRD A;  2AS5 F;  2VOD A;  2Z16 A;  4O5V A;  3J7A Y;  4I99 C;  3TW7 A;  2OD5 A;  5LGN A;  2BOL A;  2WV0 A;  1CF7 B;  1SAN A;  3WTU C;  2L7K A;  3R0A A;  1V5G A;  3MAJ A;  2EIK H;  4Y52 J;  3SEZ A;  3S17 J;  3ZMT A;  2E7W A;  4AC0 A;  4BE0 A;  3OYH A;  4HW0 A;  3OS1 A;  2VLA A;  4GFB A;  4UV9 A;  3RKQ A;  4WF2 A;  1DU6 A;  3U9G A;  1X1P A;  1Z3X A;  4B3X A;  2KRH A;  3VFZ A;  1IRF A;  1USS A;  1MMS A;  1A5J A;  3ULQ B;  5HDK A;  3A01 B;  1MH3 A;  2FNA A;  3BG9 A;  3KLO A;  1ZRF A;  5E79 C;  2Y0S N;  1W36 C;  4I0A A;  3OS2 A;  1UB9 A;  2PMU A;  4A6E A;  3CO6 C;  4FE4 A;  4HST A;  2CUF A;  4UNO A;  3MD2 A;  3M8F A;  2XHK A;  4ITV A;  4BHP A;  2HNH A;  4Q47 A;  4HRI A;  2XAJ A;  4DBQ A;  4HPQ A;  2Z5U A;  4PJ0 C;  1XCB A;  1A35 A;  2B63 J;  4G12 A;  2HOE A;  2P4W A;  3IV5 A;  5FD6 A;  1XCV A;  2MBF A;  5GTI C;  3K4J A;  2EIM H;  5DUI A;  2A68 F;  2LK2 A;  2XV4 S;  1ZQ3 P;  4LIU A;  2ZO4 A;  4JX6 A;  1FLI A;  1Q1V A;  3OYK A;  1WJF A;  2K3P A;  4KT5 C;  4EJT A;  4ZZL A;  2X6O A;  2ZFW A;  1LFB A;  2DMN A;  5BQT A;  2O7O A;  4LIT A;  1LFU P;  3DP7 A;  3HSE A;  2IAI A;  5E1X A;  4FQG A;  1NH3 A;  3HUG B;  2DOF A;  2PQ8 A;  4I98 B;  1UMQ A;  2JA5 J;  5DM6 F;  3RSN A;  1OR7 A;  4ENM A;  1MW7 A;  4LFU A;  3HOT A;  3AL0 B;  1YRN B;  4JP0 A;  3BP8 A;  1HXD A;  1W5S A;  1ZK8 A;  4DBR A;  1U6G A;  3JRE A;  3KZZ A;  3GFL A;  1XGM A;  4G6Q A;  1K6Y A;  1LFP A;  3I59 A;  3PNV A;  1JGG A;  1U5T C;  2LBF A;  3HPG A;  5C44 J;  1LEA A;  4XKV A;  1DQU A;  1TL8 A;  3CCS I;  2LTP A;  1IO2 A;  1TWF J;  3H3U A;  3VOE A;  4ETS A;  5F0F A;  4HF1 A;  3BG6 A;  2KDZ A;  1LDJ A;  1GUU A;  2NOJ B;  1L0O C;  2QKL B;  4L9T A;  3U2R A;  3ZGK A;  2KZG A;  4QPQ A;  2KRC A;  2V9P A;  3GBG A;  5EYR A;  2NYX A;  2XGE A;  5LGU A;  1T08 B;  2X48 A;  4IRI A;  1NTC A;  1E3H A;  1OPC A;  1IN6 A;  2M45 A;  3DQV C;  4XN3 A;  1SD5 A;  3JAM K;  5IP9 J;  1MBG A;  3E5U A;  3JTH A;  4HG2 A;  3HOZ J;  2FA5 A;  3JSP A;  3CCV I;  3C2G A;  1RR7 A;  3MCZ A;  3LSK A;  1IDZ A;  1FPQ A;  1R1T A;  3JW4 A;  3PFI A;  2WC2 A;  2W84 A;  2R7O A;  1XGO A;  1WJA A;  2EIJ H;  3CCQ I;  4ZYE A;  3L9F A;  5DCM B;  5GTH C;  1PVE A;  4LB5 A;  3D0S A;  2W1O A;  3T8R A;  4WK8 F;  4XKC A;  3ZMV A;  4ABZ A;  2CFX A;  5D5W B;  2OCC H;  2QEX I;  1Z1D A;  3H5A A;  5F6F A;  3K4N A;  1FT9 A;  4FET A;  4ZJZ A;  5JLX A;  5K7F A;  5KK1 A;  3BR1 A;  4YIR X;  1U8R A;  4BY1 J;  4TV7 A;  1WZ2 A;  2Q2E B;  3DKY A;  1T2K A;  1BIB A;  5JI6 A;  4S0H B;  3F8B A;  3P7N A;  5IY5 H;  2XGC A;  1WJB A;  2R5Y A;  1PP7 U;  3KEY A;  3MKL A;  3MFK A;  2G0E A;  1MMA A;  1DDN A;  1ON1 A;  2L54 A;  4RB3 C;  1X1D A;  1BOA A;  2H27 A;  4GCV A;  1XPX A;  3JRG A;  3E6D A;  3D1N I;  4H4K C;  2BY1 A;  1HSJ A;  2MG4 A;  2O03 A;  1UAA A;  5JVG F;  3TP3 A;  2NVQ J;  4KDP A;  2OZ6 A;  2CUZ A;  1FYM A;  1W0U A;  3DPT A;  4GRI A;  5E3N A;  2LKX A;  2XAU A;  2ESN A;  3L2V A;  1ETO A;  1P6R A;  5HLH A;  2GOX B;  3F72 A;  1TW3 A;  2R7T A;  4CCO A;  4NHJ A;  4G94 A;  2VE9 A;  3PNT A;  4RGU A;  4RS8 A;  2AO9 A;  4AIH A;  2CV1 A;  4XLN F;  2ZSH B;  3KLN A;  2DBB A;  5LFA A;  5A2Q K;  3NAR A;  3RDI A;  3ZXS A;  4B47 A;  2KFD A;  3K9T A;  3IL2 A;  1LJ9 A;  2CH0 A;  3K70 C;  1GVD A;  3DLA A;  4MEX F;  5B3S H;  4B1R A;  2FQ4 A;  3MZ8 A;  3T5X A;  2F5C A;  5EEH A;  5L3E A;  3GF2 A;  2WAF A;  3LSJ A;  1HLV A;  2IS2 A;  2Q1Z B;  4EEF G;  1DPR A;  1REP C;  1SD7 A;  3CD6 I;  4HLX A;  2ZSI B;  1BR1 A;  3RYR A;  3W6K B;  4NC8 A;  4RM2 A;  3MQ0 A;  3RPQ A;  5E18 F;  4GXO A;  1YJW I;  2VKH A;  2L9S A;  4I02 A;  4FX4 A;  5B5E C;  1R00 A;  3HG9 A;  1I27 A;  2XAF A;  1FYL A;  4HOB A;  4F7Z A;  2BY3 A;  4P1W A;  1G3W A;  1JKO C;  3ABM H;  4X1E A;  1TT5 B;  1BL0 A;  3LFU A;  2PJR A;  4KIS A;  2E1O A;  5L3G A;  4L0Y B;  1P2F A;  3BOQ A;  4C2M J;  1YLF A;  1IXR C;  4QTR A;  4CDG A;  1SFE A;  1JJ8 C;  1G8X A;  1IRZ A;  2IXS A;  2X0L A;  2IRF G;  3GTP J;  2DCE A;  1SFK A;  2LRE A;  1IXC A;  1XX5 A;  2M4G A;  3I9V 2;  4BAC A;  3LA7 A;  5GP9 A;  3E6M A;  2IEK A;  2ICW G;  4Q5S F;  1D8K A;  1BIA A;  4C9Y A;  3OIP A;  5K7Z A;  3BRO A;  3GLL A;  1TP4 A;  4HQE A;  2IW5 A;  1PUE E;  3IH2 A;  3L09 A;  1ZG5 A;  1FIP A;  1JUM A;  3F3X A;  4ESB A;  2B9S A;  1OFC X;  2HVQ A;  2LLK A;  5JLW A;  3LAJ A;  1K79 A;  1ON2 A;  2X6Y A;  3LSM A;  3FM5 A;  1K61 A;  2M4K A;  4DIQ A;  2YR2 A;  3ABK H;  2HZT A;  2JQ7 A;  2PN6 A;  3U1K A;  3G4S I;  2OAZ A;  3G1M A;  1XGS A;  2V1N A;  5FFX A;  5CKT A;  3RQ4 A;  1FMV A;  3RYP A;  4MO7 A;  4KN7 X;  4ZC3 A;  4JX4 A;  3MKW B;  4U0V A;  2XRN A;  4A93 J;  4A3F J;  1KU9 A;  2JVG A;  3ZN0 A;  1F1Z A;  1R5G A;  3HHG A;  3S16 J;  5HNH A;  3F21 A;  2MYS A;  2JA6 J;  2CWE A;  2ESH A;  1J2X A;  3K4L A;  4X0G A;  2M87 A;  3RJP A;  2K40 A;  2QQ8 A;  3COA C;  4OOI A;  4XOR A;  1HDP A;  4A3D J;  2BXZ A;  1BI3 A;  3A0B C;  2V7F A;  5EDN A;  4CHU A;  4CCM A;  2VKV A;  2ZBK A;  3KZY A;  4LG0 A;  3BT9 A;  2GZW A;  4UVA A;  4F93 B;  4XON A;  2Z3Y A;  4XN0 A;  1O3Q A;  3BY6 A;  3FHZ A;  4P5O A;  1I1G A;  2M9H A;  3M9A A;  4IPA A;  1WCM J;  4QSH A;  3TDU C;  2HR3 A;  1X4P A;  1W7P D;  5HNF A;  3LST A;  2IGN A;  2BE5 F;  2EFN A;  2PFB A;  2Y0S A;  2PG4 A;  5CVR A;  1H88 C;  3IHU A;  2EZL A;  2Z99 A;  1ZTR A;  2ZKZ A;  2JN6 A;  1V3F A;  2K9M A;  4XOP A;  3SJM A;  2GLO A;  2HDC A;  4B43 A;  4RDU A;  2ELH A;  3SYT A;  3U1D A;  4IHY A;  1LVA A;  1JUS A;  2CQ7 A;  1K6O A;  2M1B A;  3DPL C;  2MC3 A;  2X6W A;  2XF6 A;  3IAS 2;  2BHY A;  5FLX Z;  3BDD A;  3CDH A;  2DDB A;  3I59 B;  2ME0 A;  1QVU A;  3FKI J;  2QBY A;  2CJJ A;  4YII A;  4X6A J;  3GTJ J;  3LQQ A;  2FBI A;  4GO1 A;  4E7I A;  3BJ6 A;  2GWR A;  5F64 A;  3S32 A;  3C18 A;  4HEA 2;  3K2A A;  1LVK A;  3DEE A;  2ZC2 A;  2ETH A;  5HOO A;  3HDD A;  2IVM A;  5EG0 A;  2EH3 A;  1BI1 A;  3HZJ A;  5LRR A;  2L9N A;  2LNB A;  5HVQ C;  4ESF A;  1Z7U A;  4BXF A;  4YRV A;  2F2E A;  3C2B A;  3BLY A;  3OMY A;  1H8A C;  3I64 A;  3M07 A;  4A3K J;  4AIJ A;  4Y17 A;  4HX7 A;  4UB6 C;  3HGY A;  1DUX C;  2DO7 A;  1BA5 A;  3IKT A;  2VBX A;  3JRC A;  1EH7 A;  4UUT A;  1EH8 A;  1XTA A;  2CU7 A;  4M3F A;  2DOD A;  2Q0O A;  3R60 A;  5KAF C;  3SZP A;  1YHQ I;  4BDY A;  1ACI A;  3CCL I;  2HQA A;  3RZD J;  3IUO A;  2HDD A;  4EM1 A;  1U5T B;  1OCR H;  2JRM A;  1QZZ A;  3GTG J;  4G8X A;  2AXL A;  1JUP A;  3CO7 C;  3K7A J;  1R4M B;  2R5Y B;  2ZFU A;  3FM3 A;  4RLF A;  2XKP A;  2EA4 A;  1PJR A;  1S3J A;  5DCF A;  3LWF A;  3PIP F;  3PSI A;  1HW2 A;  1YYV A;  3FXJ A;  3HOY J;  4IL6 C;  2P6T A;  3HRM A;  3K1P A;  2OTJ I;  1WJC A;  3O3K A;  2ECB A;  4B8X A;  4DJA A;  1ENH A;  1ORK A;  5LGT A;  4I6Z A;  1HDD C;  1TTY A;  2ZXH A;  1H89 C;  3BQY A;  2GA2 A;  1E2X A;  2W57 A;  2PBI A;  5LBQ A;  4HNT A;  5F04 A;  2N8G A;  3K6G A;  1VQO I;  1KYW A;  1YI2 I;  1LEB A;  2M34 A;  3BR6 A;  3FK7 A;  3DKX A;  2UV1 A;  3WTZ A;  5JHU A;  2WY8 Q;  5DTD A;  5J4Y A;  3QPT A;  1F9N A;  3AG3 H;  2A6H F;  3G1L A;  1YIT I;  1O7F A;  2XGD A;  4ZDO A;  4BHC A;  2WAE A;  1UHM A;  5CLS A;  4OAY A;  2MC4 A;  4ZH4 F;  3L2C A;  1JE8 A;  3HJE A;  3M1E A;  2FBH A;  4JOM A;  3V8J A;  2MD0 A;  3OYD A;  2L2O A;  1YJ9 I;  1QBJ A;  4BJ6 C;  4RB0 A;  1ZH5 A;  2QSF X;  4UHT A;  5LHG A;  3VYS B;  4YFN F;  4CYC A;  2OUM A;  5FKN A;  3M7G A;  4L9J A;  3FXO A;  3HEF A;  3SDB A;  3HRS A;  4BGD A;  2DK8 A;  1L3L A;  1QU3 A;  1EA3 A;  4C3J J;  4LLN A;  2DFI A;  2LRD A;  3B73 A;  3OV8 A;  4V2F A;  2DAO A;  1MSE C;  3BG5 A;  5HS9 A;  3CUQ A;  1XDS A;  1AWC A;  1NG7 A;  1R1U A;  1D0Z A;  3S2D J;  1S7O A;  2PJR B;  3SZG A;  1T56 A;  2CQK A;  2X1C A;  3GCM A;  4E6K G;  1UZC A;  2E34 A;  2LOO A;  2EBI A;  3VB2 A;  1BN5 A;  2FRH A;  3BTJ A;  2PX9 A;  1K83 J;  2K9L A;  4W1U A;  2FNP A;  3K0L A;  4ON0 A;  3X2Q H;  3WTV C;  3ERM A;  3WE2 A;  3L7W A;  3LSP A;  3KE2 A;  3BTL A;  4XLF A;  1KQ8 A;  1H0M A;  2AQF A;  5IP6 A;  3KCC A;  3OOU A;  3FIS A;  4GGG A;  2QQ9 A;  2RV8 A;  3WTX C;  1HBX G;  1OIS A;  2E35 A;  1VQ7 I;  1HQC A;  3ISP A;  3GFM A;  1ETY A;  1BR2 A;  5IT9 Z;  1TNS A;  5L3F A;  1LNW A;  1J9I A;  2KQR A;  3BR2 A;  2R92 J;  1EH6 A;  2K4B A;  3BR5 A;  5CYV A;  4G6D A;  2XPV A;  5FLV A;  2HKX A;  3BQZ A;  5BPD A;  3HXL A;  1RUN A;  2VQG A;  4YFK F;  1I3A A;  4U88 A;  2GBY A;  1UG0 A;  4PUS A;  5D6F A;  1ZLJ A;  1GT0 C;  3S3O A;  2O8K A;  2IP2 A;  2R7V A;  1T33 A;  3WGG A;  1HF0 A;  4ENK A;  1BC8 C;  2JA8 J;  1WJE A;  4CXF A;  1SVL A;  5F0C A;  3I56 I;  3LA3 A;  1BW5 A;  4DZJ A;  2XAS A;  2AHQ A;  2YS9 A;  1YS6 A;  2GAU A;  2OJE D;  3CJQ B;  5J3L A;  4M3D A;  4AD9 A;  2QA4 I;  5DV5 A;  4XSZ F;  1S7E A;  2BW3 A;  2E2J J;  3W6J B;  4PFO A;  2VT3 A;  4PJM A;  3ZMU A;  1B8I A;  1IN5 A;  3WU0 A;  3LNQ A;  2VB6 A;  4KMF A;  3O2P E;  1ETK A;  1VQN I;  3W3C A;  3DF8 A;  2M0C A;  4A3M J;  4LG0 B;  4DYR A;  2NNN A;  4PFP A;  3GVA A;  4N4O B;  3A02 A;  3O8G A;  4MHG A;  4OIQ F;  6PAX A;  1WGX A;  2WBM A;  3LSI A;  3ZQ7 A;  2UXX A;  1ETX A;  2JUC A;  2EK5 A;  2IA0 A;  1KGS A;  2HQN A;  3E97 A;  4A0Y A;  4KIC A;  5D4R A;  2GXB A;  1V5F A;  2RKH A;  2TDX A;  4NBQ A;  1UHS A;  1C0W A;  1FP2 A;  2CG4 A;  2DOA A;  5LRS A;  4PJN A;  3K4K A;  4D5C A;  1Y39 A;  2HWV A;  2DN0 A;  1YQA A;  3CLQ A;  1YX3 A;  3R0J A;  1IC8 A;  1Y8Q B;  2HQR A;  4MFD A;  4LLG F;  3TKY A;  5FRN A;  1G3Y A;  3QOP A;  3REO A;  5AIQ A;  1OR7 C;  1X3Z B;  1EV7 A;  2QBY B;  3HYI A;  3ZQI A;  4M9S A;  5EGO B;  1Z6R A;  1MNE A;  4FIS A;  2QSG X;  1HA8 A;  3ASN H;  2R5Z B;  3TO6 A;  3TOB A;  3ESW B;  2EFO A;  4DOZ A;  2HFH A;  2CYY A;  2WV1 A;  2VQC A;  4YG2 F;  4N9H A;  5EG0 B;  2E60 A;  4C30 A;  2DFE A;  1Z9C A;  1VQP I;  4KUM A;  2DYR H;  2BEO A;  3CCR I;  2JMW A;  3FMS A;  1GDT A;  4C3H J;  1POG A;  3FWE A;  5E8G A;  3V42 A;  4NQW B;  5FJ8 J;  1VQ6 I;  4BE2 A;  1W5T A;  1P9Q C;  1Z05 A;  4E4H A;  3KEO A;  2L9R A;  3QP5 A;  4LK1 F;  4EV0 A;  3V7S A;  2O6G E;  3KIO A;  1SMY F;  3CP8 A;  2P0W A;  1F43 A;  3WOD F;  4BL0 B;  3SFZ A;  3L1P A;  3FBN B;  3TGN A;  4WXD A;  1FIA A;  1F5T A;  3I55 I;  1T98 A;  2XSJ C;  2IBD A;  3I71 A;  4OIO F;  1LB2 A;  1LPQ A;  4E7K A;  1SFU A;  3DTI A;  4PDK A;  2NVT J;  2WTE A;  3MKZ A;  3W2W A;  2ZXJ A;  1UEL B;  5FKM A;  2BBY A;  2BYV E;  5E20 A;  3IKV A;  4XRF A;  4U7B A;  1RNL A;  1YW9 A;  5GAH J;  3IRR A;  2D1H A;  1BM9 A;  1P4A A;  2DT6 A;  3E6B A;  3PQJ A;  4XKW A;  2CRG A;  3CCJ I;  1AHD P;  3K4M A;  2QF7 A;  3BCA A;  4RBO A;  1ZRE A;  3OYJ A;  1H9T A;  4BDZ A;  3Q3S A;  2IJL A;  1MKM A;  1TLH B;  2V26 A;  3HKZ N;  1JT0 A;  4Y7N J;  2HYG D;  4V19 K;  2HZD A;  2CQX A;  1WJD A;  3BZC A;  3LFK A;  5AON A;  2CSO A;  1MDM A;  2DJN A;  3E7L A;  3JTG A;  1YFH A;  2P8T A;  2Y69 H;  3D5R C;  3KFW X;  2IS1 A;  1ZHF A;  3G6E I;  1OYI A;  1K78 A;  5FLM J;  3NRV A;  4XIC A;  1J59 A;  3A0H C;  4YEL A;  3L2Q A;  2A5W A;  3H35 A;  3QRF F;  4AUX A;  1QVT A;  4HX4 A;  1TWG J;  2ELJ A;  5LLQ A;  3FBI B;  3SFI A;  4HX8 A;  4RB1 A;  4B3A A;  4IOC F;  1OCT C;  2CMP A;  4AWX B;  2HYF A;  2KRF A;  2LF8 A;  5L3B A;  3IC7 A;  1XD7 A;  1BJA A;  4P55 A;  1I6H J;  1AU7 A;  4IXA A;  2NXN B;  5AIP A;  1SFX A;  2GXA A;  3TBI A;  4R79 A;  5F1J A;  3GO5 A;  1IV6 A;  4FHT A;  3C3W A;  4RB2 C;  1UCR A;  4F55 A;  5E3O A;  1WFX A;  2B7E A;  2M8G X;  4CYC B;  3OL3 A;  3PSF A;  4IF4 A;  4D7M A;  4A5M A;  4YFX F;  4EJW A;  3MZY A;  1BW6 A;  2DT5 A;  2FJ1 A;  3RPU D;  2VAS A;  2Y0M A;  3DKW A;  4BUP A;  2D45 A;  1YX5 A;  4CYD A;  4UXN A;  1I6X A;  5IOY A;  2H09 A;  1BBY A;  2IPQ X;  2FOK A;  3CUO A;  1MJB A;  2JVH A;  2L7M P;  5LHH A;  3O6B B;  1T6S A;  1U9O A;  2VJI A;  5FO5 A;  3CC4 I;  2XPW A;  3E3V A;  1RKT A;  2DA3 A;  3CUQ B;  5J1Y A;  4IOA F;  2YX7 A;  2L3D A;  1O7L A;  3Q0W A;  3OYE A;  2P7C B;  3DU6 A;  3VPR A;  5D6E A;  3VSL A;  1HKS A;  1VQ5 I;  1IV8 A;  4KIB A;  2UXN A;  3LAP A;  4RGS A;  1R9T J;  1O4X A;  3I4P A;  5IYC J;  1MNM C;  3OYB A;  1UHW A;  2P5L C;  4JQF A;  3N97 A;  2WB1 N;  1BC7 C;  5M5X J;  3OYN A;  2OPT A;  4P9F A;  1YE9 A;  1LE8 A;  3V8K A;  1A36 A;  3F8C A;  1J7K A;  2L0K A;  2RDP A;  1FJL A;  3CF5 F;  2NVU B;  3F22 A;  3GTM J;  2LY2 A;  1D1C A;  2Y30 A;  4A6D A;  1ZEL A;  2DA2 A;  3AFH A;  3H92 A;  4B4C A;  5HLG A;  3Q9S A;  2DA1 A;  2RGV A;  4LLL A;  3UNG C;  4M6Y A;  4HNU A;  5KHD A;  4I76 A;  4M3B A;  3TP0 A;  2HVR A;  2CQN A;  4E7Z A;  1MD0 A;  2KHM A;  5K5Q A;  1X1A A;  3ZP5 A;  1TQP A;  2XB5 A;  5ICE A;  1IGN A;  4B48 A;  2DMP A;  1QPM A;  3HSF A;  1MH4 A;  2PMH A;  2LDU A;  4IHX A;  1W7P A;  2FD5 A;  2D5V A;  2MFZ A;  2EV6 A;  1QO0 D;  1S9H A;  4GYG A;  2PMZ N;  3K4B A;  5B1B H;  2ID3 A;  3WHC A;  1MBJ A;  1XN7 A;  3FXK A;  3OOP A;  2ZJR F;  5M5Y J;  2KLO A;  2XGX A;  2EZK A;  3V7C A;  1IN4 A;  5IPA A;  1W36 D;  1E3P A;  2BW3 B;  3U21 A;  2L7F P;  4A69 C;  3KPH A;  2Z1D A;  1B8I B;  2JSC A;  1E3O C;  2V1X A;  1DU0 A;  4M74 A;  3I5U A;  4BQN A;  1STZ A;  2KPM A;  2XPU A;  4BQA A;  2YUS A;  4A0Z A;  2LD5 A;  3PFY A;  3WG7 H;  3L2R A;  1JTX A;  5C4X J;  3J80 Z;  3KEQ A;  3A4C A;  2K5C A;  3CJN A;  1MIJ A;  2ELK A;  4EGZ A;  2JA2 A;  4CO8 A;  5HS8 A;  3K69 A;  2VOP A;  3AG1 H;  3F8N A;  3GFJ A;  4Z2Y A;  2M0M A;  3G71 I;  3BZK A;  2F4O B;  3QPS A;  1B6A A;  1B72 A;  1LUJ B;  2VI6 A;  2YPR A;  2MGQ A;  2R7Q A;  3ZQG A;  2QUF A;  3H5R A;  1I50 J;  4Y33 A;  2QVO A;  2NNY A;  2L01 A;  1ZGA A;  1Z0X A;  4HF0 A;  3DTE A;  4EJO A;  4EMS A;  3KP5 A;  1XMX A;  4O6J A;  1DPU A;  3BJA A;  1TQM A;  2LKP A;  3JRA A;  1ZAR A;  3BR0 A;  2R4G A;  4LMY A;  2RQP A;  1D5Y A;  1SVM A;  3BZ6 A;  1YIO A;  3OIQ A;  3ROU A;  2E1C A;  2A05 A;  4I2O A;  2UWM A;  3G3Z A;  3I54 A;  2VBZ A;  3B6A A;  4RGR A;  2MLK A;  2J5P A;  2X6X A;  3CF2 A;  4N9I A;  2DDA A;  2X1D A;  2QSH X;  2E71 A;  3N4M A;  4EVI A;  3ZN1 A;  4UVC A;  2KJB A;  1FNN A;  4XBF A;  1RES A;  2QKM B;  4IO9 F;  3F8M A;  4AVZ A;  1IRX A;  2DPU A;  1T39 A;  5FRM A;  5FFZ A;  2K4J A;  3OYM A;  5TRD A;  1BR4 A;  2AXT C;  4ZDP A;  1P7I A;  3L00 A;  2HDW A;  2VC0 A;  5HOD A;  5EZG A;  5FD5 A;  1HOM A;  2M7B A;  4PGH A;  4ZYD A;  1M1E B;  1XSV A;  2RAE A;  3CLO A;  4U7D A;  1GHC A;  1X3W B;  3CP2 A;  1A04 A;  2DQR A;  1IRG A;  4M73 A;  3NAU A;  1X19 A;  1RET A;  3E5Q A;  1SC7 A;  5CVJ A;  3FX3 A;  1APL C;  2YX4 A;  5D5U B;  3KP7 A;  3SHF A;  1PUF A;  3S3M A;  1JKQ C;  1FOK A;  4L18 B;  4LD5 A;  3EUH C;  1SAX A;  2QQA A;  3VYR B;  1YIJ I;  4IHW A;  4CIC A;  4IHT A;  3DBH B;  5CVU A;  2XAH A;  1T95 A;  1UG2 A;  3FHN A;  2VXD A;  2V9K A;  3OYL A;  2W7N A;  2A5Y B;  3CCE I;  1XDU A;  3CCU I;  1ZN2 A;  2LBF B;  3OS0 A;  1ODD A;  2YU3 A;  4FX0 A;  4XR6 A;  1ZAO A;  3SQN A;  1UJ8 A;  3B02 A;  3PNY A;  3ABL H;  3WGH A;  4BQO A;  2LY1 A;  3ZQC A;  3QYF A;  1R4N B;  1EF4 A;  1MDM B;  4BEH A;  2E19 A;  5GPC A;  4M6X A;  2E2H J;  1A6I A;  1LQ1 A;  1S8N A;  4JX5 A;  4EJU A;  1DGW Y;  1WRJ A;  3EUA A;  1Y8R B;  2UZK A;  2LFB A;  3OR1 C;  3VYU B;  3J81 Z;  4E7J A;  2DJI A;  2M30 A;  1K78 B;  3WU1 B;  2ECC A;  2LKS A;  1V4R A;  2W25 A;  2DA6 A;  5E3M A;  3K1N A;  5D8L B;  2CV0 A;  1T8I A;  2Z2S B;  5J4V A;  2M2E A;  1NHA A;  2XF5 A;  2DMT A;  4WXC A;  2OV7 A;  4HNV A;  1Z7L A;  3ABU A;  3HOS A;  2O9L A;  1DP3 A;  1QZE A;  3F0C A;  5FKO A;  3BWG A;  4MTE A;  1TNT A;  2K85 A;  4XID A;  2VKD A;  1IF1 A;  2FBK A;  2DOE A;  4I7H A;  3HKZ A;  3IRQ A;  4G7Z F;  4BU2 A;  3A01 A;  1I5Z A;  2KT0 A;  4FAS D;  3LSH A;  4XM3 A;  5B1A H;  3VEP A;  3K70 D;  5GAE J;  3EUH A;  2VQL A;  4KJZ A;  4JK1 X;  2IGO A;  3MKY B;  4HDV A;  3GTQ J;  1MSF C;  2IA1 A;  4HAM A;  3CES A;  4FE7 A;  2FUG 2;  5E17 F;  2I5U A;  2ZNZ A;  3HOU J;  1OCP A;  3FMR A;  3HTS B;  1G3T A;  3SZT A;  4II3 A;  1MMG A;  1OMI A;  2W85 A;  2A6E F;  3H0G J;  1HCR A;  1KYZ A;  4HV6 A;  5HLI A;  3OYF A;  2KIQ A;  3ZQF A;  3RZO J;  2V1U A;  3OYA A;  2JZY A;  3ZQQ A;  1ZR4 A;  3F9K A;  1E17 A;  4N4N B;  1IAW A;  3DV8 A;  1GXQ A;  2VON A;  2EFP A;  5DYM A;  1DGR M;  4MQV A;  3VDX A;  4GDF A;  3HIF A;  3L2U A;  3IH4 A;  3CUQ C;  4UB8 C;  2E7X A;  4M9Z A;  3EQL F;  1RPW A;  2K9N A;  3WTT C;  1GVJ A;  4DW6 A;  2CFO A;  2MD5 A;  3R4K A;  1LE8 B;  3D5S C;  4F3Q A;  3FIW A;  3K10 A;  2DU9 A;  3R6S A;  3KX2 A;  3UKG A;  5EEG A;  4BNC A;  1JI8 A;  2OC6 A;  5FLX K;  2BVL A;  5K5O A;  3JRH A;  5J8C A;  1O3T A;  2L5Q A;  3BCB A;  2GXG A;  4BXX J;  2K3F A;  4UV8 A;  1X4O A;  5E1Z B;  2L4M A;  1VZ0 A;  1S6L A;  2BXY A;  3ABT A;  1WH5 A;  5C3E J;  2NS7 A;  2UUZ A;  3VYT B;  1IG7 A;  1OQY A;  1ITY A;  2R7U A;  4EM2 A;  3VWB A;  2VKE A;  2KZV A;  1D5V A;  2F4I A;  3ZOB A;  4RGX A;  2PLY A;  4A3L J;  3D5L A;  4XK4 A;  5D4S A;  4MNU A;  2G7U A;  4CCJ A;  2M8E A;  3BPV A;  3OSG A;  2WB1 A;  3OYG A;  3RKX A;  1FYK A;  4IRH A;  3TL4 X;  2GIZ A;  1D0Y A;  1W7P B;  3RCO A;  4BYY A;  3J7Z I;  2M5W A;  5EZH A;  4IZZ A;  2EFW A;  1WWX A;  3AG2 H;  5F08 A;  5J8F A;  4HF2 A;  4ASN A;  3Q0V A;  3HTU A;  5FGM A;  2DTR A;  1WI9 A;  2JUG A;  2XF7 A;  3LSG A;  4ZYG A;  2E1N A;  3GX4 X;  3K4C A;  1JHF A;  5DCM A;  1U3E M;  1FZP B;  1JHH A;  1K4S A;  4HDU A;  1TW2 A;  4EM0 B;  3E5X A;  4EGY A;  2K27 A;  3Q5F A;  4O3M A;  3SXY A;  4H0E A;  1GXP A;  1E0E A;  3CC7 I;  3GWZ A;  5BNG A;  4N0B A;  4HZF A;  3IWZ A;  3TQN A;  3ZQL A;  3GW2 A;  4BKX A;  2V6E A;  1B9N A;  2QM3 A;  4BHB A;  2KMU A;  4ESJ A;  1MBH A;  2E5N A;  4KT6 A;  1R6R A;  1QHH D;  4LG3 A;  3A2K A;  5F1R A;  1FSE A;  4L9V A;  1LKX A;  1QPI A;  3TDZ C;  3K1M A;  4IJA A;  4EAT A;  1TC3 C;  2Z9O A;  3HC7 A;  3HOX J;  2ZXI A;  4CA0 A;  1B72 B;  1OYW A;  2PMZ A;  4D0P A;  4C2U A;  1OLT A;  3HRT A;  3WHB A;  2ISZ A;  1RKW A;  3PO3 J;  4AYB N;  3WGI A;  1WHU A;  1Z91 A;  3S15 J;  1TT0 A;  3S14 J;  3GFI A;  1JXS A;  3FXM A;  2R7Z J;  1WQ2 A;  1JT6 A;  3F8F A;  5LD2 C;  4KMU X;  2RQQ A;  2RRE A;  1Y56 A;  2HPI A;  5D8K B;  2DI3 A;  1ZGJ A;  4W97 A;  4C2T A;  4CCL A;  3I58 A;  4MGR A;  4IKF A;  1WKM A;  1WVR A;  1N77 A;  1GV5 A;  1TWH J;  4BQQ A;  3DU5 A;  3AG4 H;  2EIN H;  4C3I J;  3BTC A;  2GA1 A;  4L0Z B;  2XAQ A;  5M3M J;  1QRY A;  1T0F C;  4PJJ A;  3ZR8 X;  3CQZ J;  3OYI A;  3H0D A;  1RRJ A;  2ZXW H;  2KDO A;  1IDY A;  5J47 A;  1JJ6 C;  3H9G A;  3V8L A;  2NS0 A;  2CW7 A;  1S5L C;  4XLP F;  1U78 A;  4IQJ A;  1FSH A;  4R1H A;  4S05 A;  3TMO A;  1HC8 A;  4Y15 A;  1AA7 A;  2FXA A;  1JKR C;  1G3S A;  2DA5 A;  2EV0 A;  4BXU A;  4UUS A;  1KU3 A;  2EA2 A;  1HW5 A;  1R36 A;  4HV5 A;  5KVR A;  3S93 A;  1HKT A;  1FOY A;  4G7O F;  3EPZ A;  4G7H F;  2Y31 A;  2GQQ A;  2MH9 A;  3G1O A;  2W24 A;  3JR9 A;  1PUF B;  5FKL A;  3UR3 C;  3O8H A;  1LDK B;  2LR8 A;  5HDN A;  4MQ9 F;  4AIK A;  2IGK A;  4RMN A;  5HDG A;  3RI4 A;  1K4T A;  1KU7 A;  1D8J A;  5JFR A;  4QWQ A;  2Y2Z A;  5ED4 A;  1XG1 A;  3JRF A;  1XS9 A;  5IP7 J;  4BJT A;  1T0F A;  2FX0 A;  4KA4 A;  2HU9 A;  1ETQ A;  3ZMZ A;  2HVS A;  3M3Y J;  3P9C A;  2DT7 B;  3LL7 A;  2FEZ A;  3RPU A;  3OR2 C;  3CDI A;  4NDL A;  1YOV B;  5CPR B;  4BEH B;  3LMM A;  4DQ2 A;  5IT9 K;  2HXO A;  3N05 A;  2DA4 A;  4Q48 A;  1I39 A;  5ICC A;  1O3R A;  1Z3Y A;  2PEX A;  3FXL A;  4D7N A;  2LY9 A;  1X3U A;  2XDV A;  2A61 A;  3RQI A;  1OJL A;  2OCE A;  3JAM Z;  2C6Y A;  4LB6 B;  1W0T A;  2NAZ A;  3S1N J;  4DYC A;  5CQE A;  1P4X A;  2W48 A;  2HOS A;  1BJZ A;  4BE1 A;  1IUF A;  2XVC A;  5ILS A;  1ZLK A;  2OBP A;  3DLL F;  3GZN B;  4PZJ A;  4L5I A;  2AQE A;  3KP6 A;  2VQH A;  1ZR2 A;  3CCY A;  2CS3 A;  3CZ6 A;  3RTR A;  5CVV A;  1MZB A;  1TWA J;  4LJZ F;  2P7V B;  2E2I J;  1OYY A;  2HGC A;  4QPO A;  4F91 B;  2X51 A;  2H1L A;  4BJ5 C;  4Y13 A;  3E6C C;  4J19 A;  4XKB A;  3EDP A;  1P92 A;  4KIG A;  2MSY A;  4A0X A;  4A3C J;  1CGP A;  4XQF A;  2DFF A;  3NWS A;  2L9V A;  2F5V A;  3KZI C;  4KNY A;  1R23 A;  5TJJ A;  2R7R A;  3M1C A;  2Z33 A;  2RNG A;  1NK3 P;  3H5N A;  1XC5 A;  3M8J A;  2XUB A;  1Z67 A;  3G73 A;  1JTY A;  1B4A A;  4OAZ A;  2JA7 J;  4IHS A;  3PL8 A;  4II2 A;  2GOM A;  3KP4 A;  2MA3 A;  1QA6 A;  4F52 A;  5ICF A;  3I0T A;  1V55 H;  3QQA A;  3KP2 A;  2XSD C;  3F6V A;  1YJN I;  3C1D A;  4NC6 A;  1W5C C;  4U87 A;  1KQ9 A;  1RC9 A;  2QEN A;  4U0Y A;  3ECH A;  1GV2 A;  1B9M A;  2W82 A;  3RKW A;  1X2N A;  1X1B A;  5L3C A;  1OCZ H;  2WA0 A;  4AID A;  5EEA A;  1AKH A;  2F4M B;  3VOD A;  2K86 A;  2KIF A;  2WY7 Q;  4XRS A;  2JPC A;  3DPU A;  1ETW A;  2XRL A;  2X85 A;  5DM7 F;  2EWN A;  3ML6 A;  3GXO A;  2E1M C;  2Y9Y A;  1PDN C;  4A3B J;  5A2Q Z;  3QYB A;  4XLC A;  5F0H A;  1MBF A;  2QYO A;  3WTW C;  1GLN A;  2YU9 J;  2VPR A;  4HSR A;  4B44 A;  3M4O J;  3LQR A;  1P7J A;  4XLE A;  1X58 A;  2DMQ A;  3HL2 A;  3T1B A;  1G4D A;  2G7H A;  1WH7 A;  3ECO A;  5D5V B;  2ZJ2 A;  3Q9V A;  5ILU A;  1FMW A;  2VPL A;  2OQG A;  4LOC A;  1B59 A;  4A2U A;  3DWL E;  3V7R A;  1QZY A;  1JGS A;  1VND A;  3GZ6 A;  2W00 A;  1MBE A;  3CCM I;  3ZQH A;  3LA2 A;  4PGG A;  3BC8 A;  1WJ5 A;  2LG4 A;  1MJ9 A;  2LMD A;  3FMQ A;  5JHF A;  4V2G A;  3ELK A;  5TIS C;  4BY7 J;  1LDD A;  3P9K A;  5IOZ A;  1PP8 F;  1OKR A;  2KJC A;  1J09 A;  1J5Y A;  3M8E A; 
#chains in the Genus database with same CATH homology
 2Q8K A;  2RNJ A;  1U5T A;  3TO7 A;  3WTY C;  3GUD A;  2VBW A;  2XKO A;  2VE8 A;  1FWZ A;  1QGP A;  3TO9 A;  1Q1H A;  2V6C A;  4HBL A;  2HTJ A;  4LK0 F;  4PCQ A;  1HW1 A;  4WXH A;  1FC3 A;  3F6O A;  2CW0 F;  3MEX A;  1FBQ A;  1UFM A;  3QU3 A;  4KYW A;  1IUY A;  2HS5 A;  1O57 A;  4R8H A;  5BPI A;  1YO5 C;  4B09 A;  1S29 A;  4KIF A;  4M9X A;  4E70 A;  2MH2 A;  2DW4 A;  4OMZ A;  2CGP A;  5L3D A;  2ACJ A;  3EYY A;  4MTD A;  2L4A A;  1YW8 A;  2PJP A;  1IZ1 A;  2CO5 A;  2BV6 A;  5FB2 A;  4WCG A;  1IN8 A;  2FF4 A;  1G6N A;  2H94 A;  2QZ8 A;  1FP1 D;  2O3F A;  5LEK A;  2X4H A;  1J75 A;  2VN2 A;  5K1Y A;  2RC4 A;  5BMZ A;  2P6S A;  4AVP A;  2ISY A;  1H9G A;  3T0Y A;  4ZZD A;  5BOX A;  2OZU A;  2V79 A;  4HYE A;  1ZG1 A;  2VXZ A;  2COM A;  3PQK A;  1SD4 A;  2JPB A;  4UVB A;  4ZYH A;  1I1S A;  2F5F A;  2LF7 A;  2KIU A;  4DNC A;  4XSX F;  2DK5 A;  4JBA A;  2A69 F;  3EET A;  3T8T A;  2XRO A;  3QU6 A;  2VT2 A;  1IXS B;  1ULY A;  4ENJ A;  1R58 A;  1KA8 A;  1XMA A;  1F4K A;  2RN7 A;  5ERI A;  4CGZ A;  5ILV A;  5H6R A;  4P96 A;  1R22 A;  2DQL A;  4M71 A;  1Y0U A;  4LGW A;  5DEQ A;  1R5H A;  3V4G A;  4I0B A;  1ZRD A;  4L5J A;  3RKY A;  2XAG A;  1VTN C;  3I53 A;  2P5V A;  5HS7 A;  2JTV A;  1BI0 A;  1BI2 A;  1MGT A;  5DD8 A;  4OU0 A;  4A5N A;  3GEZ A;  1UST A;  3F23 A;  3DEU A;  3ERE D;  1RI7 A;  2ZME A;  4RAZ A;  1TQI A;  4EJV A;  1D3Y A;  3P9I A;  2A07 F;  2R3S A;  4OIP F;  3HHH A;  2STT A;  3J80 K;  4G9Y A;  1RIO H;  2HEO A;  2FML A;  1KU2 A;  2FE3 A;  3NEU A;  5LEJ A;  4A12 A;  1SMT A;  2G9W A;  2QQB A;  2ADU A;  3MWM A;  5DDG A;  4BH9 A;  2OA4 A;  1T38 A;  4FT8 A;  2O8X A;  2KIM A;  3GLX A;  4HA8 A;  1XB4 A;  1CF7 A;  1YS7 A;  2Y48 A;  4M72 A;  4I09 A;  3WG9 A;  3S2W A;  3AAF A;  3QAH A;  2EJR A;  2D1V A;  1FBS A;  3FXU A;  5CJ9 A;  2GIV A;  3BJO A;  4OIR F;  3DFG A;  1HST A;  3R61 A;  4IVN A;  1WSU A;  5E1W A;  4OIN F;  2IT0 A;  1FX7 A;  2FMY A;  3NQO A;  4HQM A;  3FXQ A;  2JRT A;  2F5E A;  3BPX A;  2HTS A;  3DXJ F;  4EQQ A;  4NQW A;  2BGC A;  1XGN A;  3MZH A;  5H20 A;  2DLL A;  1YTY A;  2EB7 A;  1ZYR F;  1XSX A;  3QP6 A;  5JR3 A;  5DUK A;  2O0Y A;  2R7D A;  2QLZ A;  2ZNY A;  4K2E A;  3HUG A;  4RAY A;  1U2W A;  4MEY F;  5BS6 A;  2A3S A;  3TOA A;  4QLC U;  2HKO A;  4WX9 A;  3KET A;  2R7F A;  4L9N A;  4I01 A;  1FBU A;  5D5X B;  2EV5 A;  4KN4 X;  1P4W A;  4Q4Z F;  2WWY A;  2MLG A;  4S04 A;  2VBY A;  3EYI A;  1XMK A;  3J81 K;  2K02 A;  1R1V A;  5IT3 A;  2VOO A;  1TBX A;  4YIF A;  2OU2 A;  1B1B A;  2STW A;  2LSO A;  3QPH A;  2L02 A;  4GYI A;  2OQR A;  1K7A A;  1SD6 A;  5J6X A;  2FSW A;  2VC1 A;  3FZV A;  3FXR A;  2FU4 A;  3CTA A;  2FQ3 A;  5JVT A;  3ZPL A;  1FY7 A;  1ZG3 A;  2O61 A;  2F5D A;  4HLY A;  4OMY A;  3HRU A;  2NRA C;  2Q2E A;  3H3Z A;  3GZ5 A;  1IW7 F;  2H6B A;  1HKQ A;  1AOY A;  4IRG A;  5DD4 A;  5CVI A;  2H6C A;  2XIG A;  3C7J A;  1ONV A;  4P9U A;  2JT1 A;  2Y75 A;  2K7L A;  1RUO A;  1RZ4 A;  2V1D A;  2B0L A;  1R7J A;  4NB5 A;  2P5K A;  1DP7 P;  1Z6T A;  2D2W A;  3WE3 A;  2ZCW A;  3RIR A;  2YSR A;  4WWC A;  2EFQ A;  1ZRC A;  3HSR A;  4BAY A;  1W4M A;  5LHI A;  2QWW A;  1YG2 A;  2KKO A;  2RVC A;  3JSO A;  3GYH X;  3J7A O;  1QQI A;  2IA2 A;  5K5R A;  2ZME B;  2DPD A;  3FF5 A;  1J0R A;  4ENN A;  1IN7 A;  3ZMD A;  4U0W A;  1S7A A;  1YW7 A;  2J5O A;  4CZZ A;  2PI0 A;  4KFC A;  5H6Q A;  3WTS C;  3ZMS A;  1O3S A;  1MJA A;  1KQ0 A;  2V9V A;  1QNT A;  3KP3 A;  5ICG A;  3K2Z A;  3IWF A;  1XSD A;  4UUV A;  2AS5 F;  2VOD A;  4O5V A;  2OD5 A;  5LGN A;  2WV0 A;  1CF7 B;  3WTU C;  3R0A A;  3MAJ A;  3ZMT A;  2E7W A;  4HW0 A;  4UV9 A;  4WF2 A;  3U9G A;  3VFZ A;  1IRF A;  1USS A;  3ULQ B;  5HDK A;  2FNA A;  3KLO A;  1ZRF A;  4I0A A;  1UB9 A;  2PMU A;  4A6E A;  3CO6 C;  4UNO A;  3M8F A;  2XHK A;  4BHP A;  4Q47 A;  2XAJ A;  2Z5U A;  1XCB A;  2HOE A;  2P4W A;  5FD6 A;  1XCV A;  2MBF A;  5DUI A;  2A68 F;  2XV4 S;  2ZO4 A;  1FLI A;  4KT5 C;  4EJT A;  4ZZL A;  2ZFW A;  5BQT A;  3DP7 A;  3HSE A;  5E1X A;  2PQ8 A;  4I98 B;  1OR7 A;  4ENM A;  4LFU A;  3HOT A;  3BP8 A;  1HXD A;  1W5S A;  1U6G A;  3KZZ A;  3GFL A;  1XGM A;  4G6Q A;  3I59 A;  1U5T C;  1LEA A;  3H3U A;  3VOE A;  4ETS A;  4HF1 A;  1LDJ A;  4L9T A;  3U2R A;  1L0O C;  2NYX A;  5LGU A;  4IRI A;  1OPC A;  1IN6 A;  2M45 A;  3DQV C;  1SD5 A;  3JAM K;  3E5U A;  3JTH A;  2FA5 A;  3JSP A;  3MCZ A;  1FPQ A;  1R1T A;  3JW4 A;  3PFI A;  2WC2 A;  2W84 A;  1XGO A;  4ZYE A;  3L9F A;  5DCM B;  4LB5 A;  3D0S A;  3T8R A;  4WK8 F;  3ZMV A;  2CFX A;  5D5W B;  1Z1D A;  5F6F A;  1FT9 A;  5KK1 A;  1U8R A;  4TV7 A;  1T2K A;  1BIB A;  5JI6 A;  3F8B A;  3P7N A;  1PP7 U;  3MFK A;  1DDN A;  1ON1 A;  2L54 A;  4RB3 C;  1BOA A;  2H27 A;  4GCV A;  3E6D A;  1HSJ A;  2O03 A;  4KDP A;  2OZ6 A;  1FYM A;  3DPT A;  2ESN A;  1P6R A;  5HLH A;  3F72 A;  1TW3 A;  4NHJ A;  4G94 A;  2VE9 A;  4RGU A;  4RS8 A;  4AIH A;  4XLN F;  3KLN A;  2DBB A;  5A2Q K;  3RDI A;  3K9T A;  3IL2 A;  1LJ9 A;  4MEX F;  3T5X A;  2F5C A;  5EEH A;  5L3E A;  3GF2 A;  1DPR A;  1REP C;  1SD7 A;  4HLX A;  3RYR A;  3W6K B;  3MQ0 A;  3RPQ A;  5E18 F;  4GXO A;  4I02 A;  4FX4 A;  1R00 A;  1I27 A;  2XAF A;  1FYL A;  4HOB A;  4F7Z A;  1G3W A;  5L3G A;  4L0Y B;  1P2F A;  3BOQ A;  1YLF A;  1IXR C;  4CDG A;  1SFE A;  2X0L A;  2IRF G;  1IXC A;  3LA7 A;  3E6M A;  4Q5S F;  1D8K A;  1BIA A;  3BRO A;  1PUE E;  4HQE A;  2IW5 A;  3L09 A;  1ZG5 A;  3F3X A;  4ESB A;  3LAJ A;  1K79 A;  1ON2 A;  3FM5 A;  2YR2 A;  2HZT A;  2PN6 A;  2OAZ A;  1XGS A;  5FFX A;  3RYP A;  4KN7 X;  4U0V A;  2XRN A;  1KU9 A;  3ZN0 A;  1F1Z A;  1R5G A;  3HHG A;  3F21 A;  2CWE A;  2ESH A;  1J2X A;  2M87 A;  3RJP A;  3COA C;  4OOI A;  1BI3 A;  4CHU A;  2ZBK A;  3KZY A;  4LG0 A;  2GZW A;  4UVA A;  2Z3Y A;  1O3Q A;  3BY6 A;  3FHZ A;  4P5O A;  1I1G A;  3M9A A;  4IPA A;  3TDU C;  2HR3 A;  1W7P D;  3LST A;  5CVR A;  2BE5 F;  2EFN A;  2PFB A;  2PG4 A;  3IHU A;  2Z99 A;  2ZKZ A;  1V3F A;  2HDC A;  2ELH A;  3U1D A;  1LVA A;  1K6O A;  2M1B A;  3DPL C;  2MC3 A;  5FLX Z;  3BDD A;  3CDH A;  3I59 B;  2QBY A;  4YII A;  3LQQ A;  2FBI A;  4GO1 A;  3BJ6 A;  2GWR A;  5F64 A;  3C18 A;  2ETH A;  5HOO A;  2IVM A;  1BI1 A;  5LRR A;  5HVQ C;  2LNB A;  4ESF A;  1Z7U A;  2F2E A;  3I64 A;  4AIJ A;  4Y17 A;  4HX7 A;  1DUX C;  2DO7 A;  3IKT A;  2VBX A;  1EH7 A;  1EH8 A;  2Q0O A;  3R60 A;  3SZP A;  4EM1 A;  1U5T B;  1QZZ A;  4G8X A;  2AXL A;  3CO7 C;  3FM3 A;  2XKP A;  2EA4 A;  1S3J A;  5DCF A;  3LWF A;  1HW2 A;  1YYV A;  2P6T A;  3HRM A;  3K1P A;  3O3K A;  4B8X A;  5LGT A;  1TTY A;  2GA2 A;  1E2X A;  2W57 A;  2PBI A;  5LBQ A;  1KYW A;  1LEB A;  3WTZ A;  5JHU A;  3QPT A;  1F9N A;  2A6H F;  1O7F A;  4BHC A;  3L2C A;  1UHM A;  5CLS A;  4ZH4 F;  1JE8 A;  3M1E A;  2FBH A;  3V8J A;  1QBJ A;  4RB0 A;  1ZH5 A;  4UHT A;  5LHG A;  4YFN F;  3M7G A;  4L9J A;  3HRS A;  2DK8 A;  1L3L A;  4LLN A;  2DFI A;  3B73 A;  3OV8 A;  2DAO A;  5HS9 A;  3CUQ A;  1XDS A;  1AWC A;  1R1U A;  1S7O A;  2CQK A;  3VB2 A;  1BN5 A;  2FRH A;  2FNP A;  3K0L A;  4ON0 A;  3WTV C;  3WE2 A;  3L7W A;  3KE2 A;  1KQ8 A;  1H0M A;  3KCC A;  4GGG A;  2QQ9 A;  2RV8 A;  3WTX C;  1HBX G;  1HQC A;  3ISP A;  3GFM A;  5IT9 Z;  1TNS A;  5L3F A;  1LNW A;  1J9I A;  1EH6 A;  2K4B A;  5CYV A;  4G6D A;  2HKX A;  5BPD A;  1RUN A;  4YFK F;  4U88 A;  5D6F A;  1ZLJ A;  2IP2 A;  3WGG A;  4ENK A;  1BC8 C;  4CXF A;  3LA3 A;  2XAS A;  1YS6 A;  2GAU A;  4AD9 A;  5DV5 A;  4XSZ F;  3W6J B;  2VT3 A;  3ZMU A;  1IN5 A;  3WU0 A;  3O2P E;  3DF8 A;  4LG0 B;  2NNN A;  3GVA A;  4MHG A;  4OIQ F;  6PAX A;  3ZQ7 A;  2UXX A;  2EK5 A;  2IA0 A;  1KGS A;  2HQN A;  3E97 A;  4A0Y A;  4KIC A;  5D4R A;  2GXB A;  2RKH A;  2TDX A;  1C0W A;  1FP2 A;  2CG4 A;  5LRS A;  2HWV A;  1YQA A;  3R0J A;  2HQR A;  4LLG F;  3TKY A;  1G3Y A;  3QOP A;  3REO A;  5AIQ A;  1EV7 A;  2QBY B;  3HYI A;  4M9S A;  1Z6R A;  3TO6 A;  3TOB A;  2EFO A;  2HFH A;  2CYY A;  4YG2 F;  4N9H A;  1Z9C A;  4KUM A;  2BEO A;  3FMS A;  3FWE A;  5E8G A;  1W5T A;  1Z05 A;  3KEO A;  3QP5 A;  4LK1 F;  4EV0 A;  3V7S A;  2O6G E;  1SMY F;  3WOD F;  3SFZ A;  3TGN A;  4WXD A;  1F5T A;  1T98 A;  3I71 A;  4OIO F;  1LB2 A;  1SFU A;  4PDK A;  2WTE A;  2ZXJ A;  2BBY A;  2BYV E;  5E20 A;  3IKV A;  4XRF A;  4U7B A;  1RNL A;  1YW9 A;  3IRR A;  2D1H A;  1BM9 A;  1P4A A;  3E6B A;  3PQJ A;  1ZRE A;  1H9T A;  2IJL A;  1MKM A;  1TLH B;  2HYG D;  3LFK A;  5AON A;  2CSO A;  1MDM A;  3JTG A;  1YFH A;  2P8T A;  3KFW X;  1ZHF A;  1OYI A;  1K78 A;  3NRV A;  1J59 A;  3QRF F;  4HX4 A;  5LLQ A;  4HX8 A;  4RB1 A;  4AWX B;  5L3B A;  2HYF A;  2KRF A;  2LF8 A;  3IC7 A;  1XD7 A;  1BJA A;  4P55 A;  4IXA A;  5AIP A;  1SFX A;  4R79 A;  3GO5 A;  4FHT A;  3C3W A;  4RB2 C;  1UCR A;  4IF4 A;  4A5M A;  4YFX F;  4EJW A;  3MZY A;  2DT5 A;  2Y0M A;  3DKW A;  2D45 A;  4CYD A;  4UXN A;  1I6X A;  2H09 A;  1BBY A;  2IPQ X;  2FOK A;  3CUO A;  1MJB A;  5LHH A;  3O6B B;  1T6S A;  5FO5 A;  3E3V A;  3CUQ B;  2YX7 A;  2L3D A;  1O7L A;  2P7C B;  5D6E A;  1HKS A;  4KIB A;  2UXN A;  3LAP A;  4RGS A;  3I4P A;  1UHW A;  2P5L C;  4JQF A;  3N97 A;  1BC7 C;  4P9F A;  3V8K A;  3F8C A;  1J7K A;  2RDP A;  3F22 A;  4A6D A;  3H92 A;  5HLG A;  3Q9S A;  2RGV A;  4LLL A;  4M6Y A;  1MD0 A;  5K5Q A;  3ZP5 A;  1TQP A;  5ICE A;  1QPM A;  3HSF A;  2PMH A;  2LDU A;  1W7P A;  2EV6 A;  1QO0 D;  4GYG A;  1XN7 A;  3OOP A;  2XGX A;  3V7C A;  1IN4 A;  2JSC A;  2V1X A;  4M74 A;  3I5U A;  1STZ A;  4BQA A;  4A0Z A;  3J80 Z;  3KEQ A;  3CJN A;  4EGZ A;  4CO8 A;  5HS8 A;  3K69 A;  2VOP A;  3F8N A;  3GFJ A;  4Z2Y A;  1B6A A;  2YPR A;  2QUF A;  2QVO A;  2NNY A;  2L01 A;  1ZGA A;  4HF0 A;  4EJO A;  4EMS A;  3KP5 A;  4O6J A;  1DPU A;  3BJA A;  1TQM A;  2LKP A;  1ZAR A;  4LMY A;  2RQP A;  3BZ6 A;  1YIO A;  3ROU A;  2E1C A;  4I2O A;  2UWM A;  3G3Z A;  3I54 A;  2VBZ A;  4RGR A;  2MLK A;  2J5P A;  4N9I A;  3N4M A;  4EVI A;  3ZN1 A;  4UVC A;  2KJB A;  1FNN A;  4XBF A;  3F8M A;  2DPU A;  1T39 A;  5FFZ A;  2K4J A;  5TRD A;  3L00 A;  2VC0 A;  5FD5 A;  4PGH A;  4ZYD A;  1XSV A;  3CLO A;  4U7D A;  1GHC A;  1A04 A;  2DQR A;  1IRG A;  4M73 A;  3E5Q A;  5CVJ A;  3FX3 A;  2YX4 A;  5D5U B;  3KP7 A;  3SHF A;  4L18 B;  1FOK A;  4LD5 A;  1SAX A;  2QQA A;  4CIC A;  4IHT A;  5CVU A;  2XAH A;  2A5Y B;  1XDU A;  1ZN2 A;  1ODD A;  2YU3 A;  4FX0 A;  3SQN A;  1ZAO A;  5E8I A;  3B02 A;  3WGH A;  1MDM B;  4M6X A;  1LQ1 A;  1S8N A;  4EJU A;  1WRJ A;  2UZK A;  3J81 Z;  1K78 B;  2M30 A;  3WU1 B;  1V4R A;  2W25 A;  3K1N A;  5D8L B;  1NHA A;  4WXC A;  3ABU A;  3HOS A;  3BWG A;  4MTE A;  1TNT A;  1IF1 A;  2FBK A;  4I7H A;  3IRQ A;  4G7Z F;  1I5Z A;  3VEP A;  3EUH A;  4JK1 X;  4HDV A;  2IA1 A;  4HAM A;  5E17 F;  2ZNZ A;  3FMR A;  3HTS B;  1G3T A;  3SZT A;  1OMI A;  2W85 A;  2A6E F;  1KYZ A;  4HV6 A;  5HLI A;  2V1U A;  2JZY A;  1E17 A;  1IAW A;  3DV8 A;  1GXQ A;  2VON A;  2EFP A;  5DYM A;  4MQV A;  3HIF A;  3CUQ C;  2E7X A;  4M9Z A;  3EQL F;  3WTT C;  1GVJ A;  2MD5 A;  3R4K A;  3R6S A;  2DU9 A;  5EEG A;  4BNC A;  5FLX K;  5K5O A;  5J8C A;  1O3T A;  2GXG A;  4UV8 A;  5E1Z B;  2L4M A;  1S6L A;  3ABT A;  4EM2 A;  1D5V A;  4RGX A;  2PLY A;  3D5L A;  5D4S A;  4MNU A;  2G7U A;  2M8E A;  3BPV A;  3RKX A;  1FYK A;  4IRH A;  1W7P B;  4BYY A;  2M5W A;  2EFW A;  1WWX A;  5J8F A;  4HF2 A;  4ASN A;  3HTU A;  5FGM A;  2DTR A;  1WI9 A;  3GX4 X;  4ZYG A;  2E1N A;  4KMF A;  1U3E M;  1JHF A;  5DCM A;  1FZP B;  1JHH A;  4HDU A;  1TW2 A;  4EM0 B;  3E5X A;  4EGY A;  2K27 A;  3Q5F A;  4O3M A;  3SXY A;  4H0E A;  1GXP A;  3GWZ A;  4N0B A;  4HZF A;  3IWZ A;  3TQN A;  3GW2 A;  1B9N A;  2QM3 A;  4BHB A;  4ESJ A;  5F1R A;  1FSE A;  4L9V A;  3TDZ C;  3K1M A;  4IJA A;  2Z9O A;  1OYW A;  4D0P A;  3HRT A;  2ISZ A;  3WGI A;  1Z91 A;  3GFI A;  1JXS A;  1WQ2 A;  3F8F A;  4KMU X;  5D8K B;  2DI3 A;  1ZGJ A;  3I58 A;  4MGR A;  1WKM A;  2GA1 A;  4L0Z B;  2XAQ A;  3V8L A;  2NS0 A;  4XLP F;  1U78 A;  1FSH A;  4R1H A;  4S05 A;  4Y15 A;  2FXA A;  1G3S A;  2EV0 A;  4BXU A;  1KU3 A;  2EA2 A;  1HW5 A;  1R36 A;  4HV5 A;  5KVR A;  1HKT A;  4G7O F;  4G7H F;  2GQQ A;  2MH9 A;  2W24 A;  1LDK B;  5HDN A;  4MQ9 F;  4AIK A;  5HDG A;  3RI4 A;  1KU7 A;  1D8J A;  5JFR A;  4QWQ A;  5ED4 A;  1T0F A;  4KA4 A;  3ZMZ A;  3P9C A;  2FEZ A;  3RPU A;  4DQ2 A;  5IT9 K;  4Q48 A;  5ICC A;  1O3R A;  2PEX A;  1X3U A;  2A61 A;  3JAM Z;  2C6Y A;  4LB6 B;  2NAZ A;  1P4X A;  2XVC A;  5ILS A;  1ZLK A;  2OBP A;  4PZJ A;  4L5I A;  3KP6 A;  3RTR A;  5CVV A;  1MZB A;  4LJZ F;  2P7V B;  1OYY A;  2HGC A;  4Y13 A;  3E6C C;  3EDP A;  1P92 A;  4KIG A;  4A0X A;  1CGP A;  4KNY A;  1R23 A;  5TJJ A;  2Z33 A;  2XUB A;  3G73 A;  1B4A A;  4IHS A;  3KP4 A;  2MA3 A;  5ICF A;  3I0T A;  3KP2 A;  3F6V A;  3C1D A;  1KQ9 A;  2QEN A;  4U0Y A;  3ECH A;  1B9M A;  3RKW A;  5L3C A;  3VOD A;  2K86 A;  2KIF A;  2JPC A;  2EWN A;  3ML6 A;  3GXO A;  1PDN C;  5A2Q Z;  2QYO A;  3WTW C;  3LQR A;  3T1B A;  1G4D A;  2G7H A;  3ECO A;  5D5V B;  2ZJ2 A;  3Q9V A;  5ILU A;  2OQG A;  1B59 A;  4A2U A;  3V7R A;  1QZY A;  1JGS A;  3GZ6 A;  3LA2 A;  4PGG A;  1MJ9 A;  3FMQ A;  3ELK A;  1LDD A;  3P9K A;  1PP8 F;  1OKR A;  2KJC A;  1J5Y A;  3M8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...