1KA8A

Crystal structure of the phage p4 origin-binding domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
100
structure length
100
Chain Sequence
DADPTFDFIGYLETLPQTSGMYMGNASIIPRNYRKYLYHAYLAYMEANGYRNVLSLKMFGLGLPVMLKEYGLNYEKRHTKQGIQTNLTLKEESYGDWLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords putative P4-specific DNA primase
publication title Phage P4 origin-binding domain structure reveals a mechanism for regulation of DNA-binding activity by homo- and heterodimerization of winged helix proteins.
pubmed doi rcsb
source organism Enterobacteria phage p4
total genus 26
structure length 100
sequence length 100
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2001-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ka8A00
1FWZA 3RTRA 3M8EA 1Z9CA 2FMLA 3T8TA 3WTUC 1FSHA 5ICGA 4U88A 2PN6A 4HF1A 5K5QA 3ABTA 4M72A 2QENA 4G6QA 1RUNA 4G7HF 2AS5F 4KIFA 3QU3A 3REOA 2OU2A 3PQJA 1ZGJA 1MKMA 4OIRF 3ISPA 2FNAA 4Q47A 3JTGA 3R61A 3RYRA 5E17F 4I09A 2EFQA 1GXPA 3F3XA 3E6BA 4HBLA 3T8RA 3FWEA 3ROUA 3EQLF 4I98B 2KRFA 2DLLA 2FBIA 3MZHA 5BMZA 1Z7UA 3I53A 2W24A 1Z6TA 2PI0A 4KYWA 5L3FA 2V1DA 2FMYA 3M8FA 5ED4A 3FZVA 4UHTA 2CO5A 1B6AA 2DTRA 2FE3A 4NQWA 4ENJA 3NRVA 4ESFA 3F8FA 1J75A 5HDKA 3MFKA 3LQRA 4FHTA 1YG2A 5JFRA 3V8LA 3IKVA 2IA2A 2VE8A 1UFMA 2VBYA 4LJZF 3MAJA 4IPAA 2HGCA 3I59A 3U9GA 3I54A 2HTSA 4QLCU 1K6OA 5FB2A 1HW5A 1KU3A 3R4KA 3WTZA 3N4MA 5BQTA 1P4XA 1GXQA 3GUDA 2HR3A 1IRFA 1FOKA 4NHJA 4CO8A 5FD6A 4YIFA 3QPTA 3WODF 3VOEA 4WF2A 2RGVA 3KP2A 3TQNA 4Y13A 1O7FA 2E7XA 4OIQF 1D8KA 2WTEA 1JHHA 5DDGA 1HBXG 3IRQA 5H6RA 2BEOA 4M9XA 2CWEA 2K02A 3KCCA 1QZZA 1OKRA 3JSOA 1SD7A 3LAJA 3FMSA 3KEQA 2L4AA 3J7AO 1IXCA 4HOBA 2OBPA 3FHZA 1OYIA 2FF4A 2P5VA 2W57A 3MWMA 4BHBA 5E1XA 1G3SA 3CUQA 2EFPA 4ON0A 3HSFA 2CSOA 5CJ9A 1ZG3A 3IRRA 2HEOA 2UWMA 1T2KA 4BYYA 4PGHA 5FO5A 3SZPA 3RI4A 3QRFF 3H3ZA 2FRHA 5DCMB 1R5HA 2O61A 2PLYA 3SZTA 1FBSA 2BE5F 1SFUA 5BS6A 4M6YA 3JSPA 3BJ6A 3O6BB 5HS7A 1R58A 1NHAA 4ZH4F 1S7OA 4WWCA 4YFXF 1S3JA 4OIPF 2Z3YA 3FXQA 1L0OC 3BJOA 4OMZA 4Q4ZF 4JBAA 5KVRA 4RB0A 1A04A 1MGTA 4BHCA 3DV8A 1J5YA 1BI0A 2NAZA 3QP5A 3NQOA 1QBJA 2O03A 1FYMA 2ETHA 3WTWC 2HZTA 4P9FA 1KQ9A 1U2WA 2H27A 4CHUA 4YG2F 2H6CA 3HOSA 3J80K 4YFKF 4L9JA 4S05A 2R7FA 2MH2A 4U0WA 2HKXA 4M6XA 4A0YA 5E20A 2NS0A 3DEUA 3D5LA 3GXOA 4K2EA 2KIFA 4LLGF 3BOQA 2F5DA 2ELHA 1TLHB 3T1BA 1HQCA 1H9GA 2WV0A 4EJOA 1USSA 4AWXB 1IW7F 1BC8C 3H92A 2YU3A 1R1TA 2XKPA 2XAGA 4AIJA 4HV6A 3IWZA 1MJAA 3GYHX 3R60A 3QU6A 2EA2A 4M9SA 2PG4A 3RPQA 4KIGA 3P9IA 4FT8A 1O3QA 3IHUA 3GZ5A 1ZGAA 3TDUC 3MCZA 1W4MA 3BWGA 4L9NA 2HS5A 1T39A 2VXZA 3FM3A 3HOTA 3ABUA 1KU9A 2RNJA 4A2UA 2OA4A 4AIKA 2Q8KA 1TBXA 2ISYA 4M74A 2RV8A 4ZYGA 1C0WA 4G7OF 3HRTA 3QP6A 1G4DA 4Z2YA 2KIMA 1F5TA 1SMYF 1Z05A 1SD4A 2K27A 3ECOA 2BGCA 1CGPA 3C1DA 2E1CA 3K0LA 3KP5A 2QQ9A 1E17A 5A2QZ 4EM1A 1ZYRF 5D5UB 3HSEA 3F23A 3SQNA 3DPLC 1PUEE 3ML6A 1FP1D 2XAHA 3J80Z 3TKYA 4EM2A 1J9IA 2XV4S 3WE2A 3ELKA 1U6GA 4KMUX 2HQNA 4PCQA 5LEJA 4CXFA 2QYOA 1IN4A 4GYIA 2CYYA 4A0ZA 1S7AA 1XGOA 3KEOA 5LRSA 3CUQB 3C3WA 4CZZA 4HYEA 2DQRA 1FX7A 5D5XB 1KU2A 4MQ9F 1FLIA 4RB1A 3O2PE 2ZNZA 3GLXA 2RKHA 2IA1A 3J81Z 3HHHA 5DV5A 1ZG5A 4RAZA 1RZ4A 1HSJA 3ZMSA 5D6EA 2FBKA 1F4KA 4MTEA 3P9CA 5DCMA 2HQRA 5ICFA 1TTYA 1TQIA 2XIGA 4BAYA 1ODDA 3F22A 1DDNA 3CUQC 1B9NA 3I71A 5LGUA 5E18F 2D2WA 5D6FA 5LHIA 3Q9VA 1K7AA 2STTA 1XSDA 1RNLA 3FM5A 1ZH5A 3SFZA 4RGRA 2IA0A 1D8JA 4HLYA 2ADUA 5FFZA 2AXLA 2PJPA 3GO5A 2JSCA 4P55A 3E5UA 2A07F 2OZUA 1YO5C 1ZN2A 4L5JA 1T0FA 4RGUA 2P6SA 3JAMK 4UUVA 4Y17A 2DW4A 4I02A 4F7ZA 1O7LA 2VC0A 2E7WA 2Y75A 2Z33A 5IT9Z 4KUMA 4ZYHA 1D3YA 1LEAA 2M5WA 4UVCA 1PP7U 3HRMA 2R3SA 4S04A 2D1VA 3O3KA 2NNNA 1DUXC 5HDGA 2BV6A 4ENKA 2MLGA 2GA2A 3WTTC 4IVNA 5J8CA 4FX0A 3ERED 3F72A 5CVRA 1AWCA 3Q9SA 3GX4X 1BI2A 2K86A 1U3EM 2FSWA 3WG9A 1S8NA 5F1RA 1KQ8A 5LLQA 4OOIA 1MDMB 3TGNA 3F6OA 3HHGA 1IN5A 1MJ9A 2WC2A 1K79A 4AD9A 2YPRA 1J2XA 2FBHA 4EJTA 1S29A 2ACJA 4ZYEA 1HSTA 3TO9A 2JZYA 4YIIA 2WWYA 3KZZA 1XCBA 1ZAOA 2VODA 4LB5A 4D0PA 2GQQA 4ESJA 4EMSA 5CVVA 3BY6A 3BROA 5D5WB 2Z5UA 4Q48A 4U7BA 1KYWA 1KGSA 4BNCA 1STZA 4MGRA 3E6CC 2O3FA 1XDUA 1XGMA 2P5LC 2LF8A 3W6KB 4HX7A 4ZZLA 3KE2A 3ZMDA 4ENMA 4FX4A 3R0AA 1R1VA 2D1HA 3ZQ7A 1SMTA 2IT0A 3ZMVA 2VE9A 2H6BA 5J6XA 4GO1A 2V79A 1UB9A 2YR2A 3HTUA 4P5OA 2IW5A 1FYLA 5E8GA 1IN6A 1WWXA 5KK1A 1D5VA 3LSTA 3CDHA 2J5PA 5BPDA 5FFXA 1ZRCA 3DF8A 3EYYA 3QPHA 4G8XA 2CFXA 1I1GA 3PQKA 3OV8A 4LK0F 3RDIA 1IN8A 1B1BA 2W85A 1KQ0A 3GVAA 1IXRC 3E5XA 1SAXA 5DD8A 3GFJA 3JTHA 4H0EA 3TO6A 3G3ZA 1OR7A 2Q2EA 1FSEA 4DQ2A 4DNCA 5DEQA 2G7UA 3LFKA 5F6FA 2P6TA 3RIRA 1XGSA 5LGTA 1J7KA 1MJBA 4UXNA 5FGMA 2ZKZA 2VN2A 1JE8A 3WU0A 1EH7A 3KP6A 4IRHA 3SXYA 3K1PA 1V3FA 4AVPA 2HOEA 1FBQA 3BPVA 1RIOH 1W5SA 2EV6A 2A6HF 3QOPA 3R6SA 2DU9A 3I5UA 2QVOA 3WTYC 3QAHA 4XBFA 4OINF 4JK1X 1IF1A 1YYVA 4HLXA 5CLSA 2JT1A 2LNBA 5HLGA 4RAYA 3IWFA 4XLPF 1DPUA 2A3SA 4HQEA 2A5YB 1XDSA 4UNOA 3MEXA 1RI7A 2UZKA 5IT3A 4LLNA 3MZYA 3E6MA 2STWA 4IRGA 3V4GA 4EM0B 1Z91A 4I2OA 4CGZA 1ON2A 2W25A 1R00A 2ZJ2A 1LDDA 1U8RA 4A6EA 1G3WA 2QZ8A 5DUIA 1LNWA 5DUKA 3GFIA 2K4BA 3VODA 5ICEA 3EUHA 1DPRA 4A12A 3R0JA 5D4SA 2XRNA 4O6JA 2ISZA 2OD5A 2PMUA 4UVAA 5D8KB 1E2XA 1TNTA 4E70A 3CO6C 1OYWA 2LF7A 4I7HA 1LDJA 2RN7A 4RB3C 4GCVA 1S6LA 4HF2A 4WX9A 4HDVA 1USTA 4KIBA 3L9FA 1R1UA 1QPMA 1HW2A 1EH8A 1P2FA 1ONVA 1JGSA 2CW0F 2XKOA 4LFUA 3TOAA 1U78A 4Q5SF 5D5VB 4EJVA 3RPUA 1MDMA 4L0ZB 5JVTA 3U1DA 2Z99A 4M71A 2CG4A 4JQFA 2XHKA 1XCVA 1FT9A 1FNNA 1Q1HA 4KN4X 1XSVA 2XGXA 4O5VA 5E8IA 4P96A 4ESBA 2J5OA 2YSRA 1KYZA 1IZ1A 3CJNA 5CYVA 1F1ZA 1HKQA 1TNSA 2VC1A 1R7JA 3K1MA 1YW8A 4U0VA 2M8EA 3WTSC 3W6JB 2O6GE 3LA2A 1IN7A 4L9TA 4B09A 4XRFA 2YX7A 2UXXA 5L3DA 3GZ6A 3KP3A 3V7SA 4ASNA 2F5FA 3F8MA 3RKXA 1V4RA 4OMYA 1VTNC 5HS8A 1R22A 1SFXA 1BI3A 3FX3A 1FP2A 2G7HA 3V7CA 2ZMEA 2XVCA 2MA3A 1CF7B 1TW3A 2FNPA 4QWQA 2H09A 4I0BA 4HA8A 1I1SA 1QGPA 4GYGA 3Q5FA 1FZPB 3KETA 1FPQA 5J8FA 3F8NA 5JR3A 3V7RA 1XB4A 3RYPA 4G9YA 2E1NA 3GW2A 3TOBA 1G6NA 4N9IA 2DFIA 3HRUA 3F8CA 4EJUA 2F2EA 1P92A 1WRJA 2OZ6A 4CICA 1ON1A 5K5OA 3K2ZA 1Y0UA 1B59A 1HXDA 3HSRA 1J59A 2XAFA 2EB7A 3SHFA 2EWNA 1K78A 2EK5A 3TO7A 4KICA 1GVJA 3ZMUA 2JPCA 1TQPA 1RUOA 1ZLJA 3LA3A 3ZP5A 1AOYA 2FXAA 2MC3A 1DP7P 1MD0A 1WKMA 3L2CA 3ZN0A 2ESHA 1YS6A 2EV0A 1I6XA 2XAJA 4XSXF 2KJCA 5HOOA 4P9UA 1ZHFA 2DI3A 1ZARA 1IRGA 2L01A 1HW1A 3BJAA 2QWWA 2L4MA 2ZFWA 1FBUA 2NYXA 1BJAA 2QBYB 1PP8F 4G7ZF 3VB2A 2GIVA 3GEZA 3ZMZA 1U5TB 3NEUA 2EA4A 2EV5A 3K69A 4LLLA 4EGYA 2K4JA 2R7DA 1G3YA 3LAPA 2VBXA 3WU1B 2JPBA 1BN5A 5L3BA 5H20A 3H3UA 1R23A 1Z6RA 4U7DA 2HYGD 4LG0B 4LK1F 4EQQA 2GA1A 1YFHA 3IKTA 3GF2A 2DK8A 4MHGA 4KMFA 2IP2A 2GZWA 2FQ3A 3KFWX 4ETSA 4EV0A 2HFHA 1BC7C 2KIUA 4LB6B 1SD6A 1QNTA 2HYFA 2JRTA 3I0TA 2V1UA 5DD4A 4B8XA 5HS9A 2C6YA 1REPC 1JXSA 1T98A 1W7PA 1XSXA 4I01A 3BP8A 2OQRA 1WI9A 2FOKA 1O3TA 4PZJA 2VT2A 1ZLKA 3HUGA 3GFLA 4TV7A 5FD5A 1KU7A 2LSOA 3WGGA 4MNUA 3N97A 4IHSA 2DPDA 2ZCWA 3DKWA 3U2RA 5L3GA 1UHWA 4A5MA 2DQLA 3KP4A 2A69F 3V8JA 1LQ1A 2MBFA 2UXNA 1ZRFA 3GFMA 5E1WA 2P4WA 3C7JA 1ULYA 3B02A 1SFEA 5AIPA 3VFZA 2COMA 6PAXA 3C18A 2IRFG 4MQVA 3FMRA 1Z1DA 4A5NA 3I4PA 1T6SA 3K1NA 4HX4A 1H9TA 4IF4A 1LJ9A 5LHHA 3LA7A 1GHCA 2ZO4A 1O57A 3E6DA 1BM9A 2F5CA 3TDZC 2MD5A 1H0MA 5HLHA 4PDKA 2B0LA 3ECHA 1HKSA 1XN7A 2O0YA 4MTDA 4NB5A 4N9HA 4UV9A 3E97A 3KLNA 3BDDA 2RDPA 3V8KA 3WTVC 3K9TA 4A6DA 1EV7A 2PEXA 1TQMA 4WK8F 4HW0A 3JAMZ 2L02A 3DPTA 2ZMEB 1FC3A 3CLOA 1XMAA 3CTAA 1YLFA 1QZYA 2G9WA 4KN7X 2DAOA 3OOPA 2HTJA 3DQVC 5JI6A 3E5QA 4ENNA 1CF7A 1W5TA 3RKYA 5FLXK 4AIHA 1P6RA 2LDUA 4KDPA 5H6QA 1WQ2A 5ILVA 1YW9A 1B9MA 2BBYA 4CDGA 1X3UA 5K1YA 2IPQX 4IRIA 4N0BA 3PFIA 2CQKA 5ICCA 3EDPA 1F9NA 2XASA 2Y0MA 2V9VA 1K78B 3L7WA 4KT5C 4WXCA 2X4HA 3T5XA 5ILSA 1BIBA 3M7GA 4LMYA 3S2WA 2VONA 2MLKA 1HKTA 5HLIA 4R79A 2F5EA 3LQQA 4CYDA 1LDKB 2XUBA 5ILUA 3DP7A 5CVJA 2PBIA 5EEGA 2MH9A 4KFCA 2RVCA 4LD5A 1R36A 5L3CA 4M9ZA 3M9AA 4M73A 2L3DA 2HDCA 3FXUA 2Z9OA 1LVAA 3BZ6A 1O3RA 2DPUA 2IVMA 5DYMA 5BPIA 2QBYA 1JHFA 2ZNYA 4EVIA 1U5TA 2PMHA 3I64A 3DFGA 2OQGA 2P7CB 4EJWA 4KNYA 3B73A 3EYIA 3FF5A 3E3VA 2KKOA 3L09A 5FLXZ 1IAWA 3T0YA 3RJPA 1I27A 4UV8A 5ERIA 4IXAA 2X0LA 4O3MA 2W84A 4LG0A 2QQBA 3L00A 2PFBA 4Y15A 4MEYF 4EGZA 1YW7A 1UCRA 1QQIA 3F21A 5LHGA 5F64A 1TW2A 4UVBA 1G3TA 4MEXF 4G6DA 3P9KA 4R8HA 2HKOA 2RC4A 1W7PB 4HQMA 5A2QK 3D0SA 1ZG1A 2CGPA 2M1BA 3IC7A 2EFWA 2A68F 2BYVE 4ZZDA 2ZXJA 1XMKA 3FXRA 5D8LB 3WTXC 5TJJA 3HYIA 3GWZA 5D4RA 2Q0OA 5EEHA 1P4AA 2K7LA 1LB2A 2P8TA 1EH6A 4WCGA 1W7PD 1QO0D 4HX8A 4IJAA 1FYKA 1BOAA 2XROA 2DT5A 4KA4A 2DK5A 2VOPA 3HIFA 3COAC 3J81K 4YFNF 2EJRA 4G94A 2VBWA 2HWVA 3DXJF 1T38A 5BOXA 1LEBA 2VT3A 3HTSB 5AONA 5LRRA 1IUYA 3HRSA 3KZYA 1YTYA 1L3LA 1MZBA 2YX4A 1XD7A 3AAFA 1ZRDA 2DO7A 2VOOA 3I59B 4A0XA 4ZYDA 2V1XA 2D45A 2GWRA 3FMQA 5CVUA 4XLNF 4GGGA 3LWFA 2Y48A 5CVIA 4L0YB 2NRAC 3CO7C 1OYYA 1BBYA 3F6VA 1YS7A 1FY7A 4OIOF 2EFOA 2OAZA 5LBQA 5K5RA 3P7NA 3KLOA 3ZMTA 4L9VA 3F8BA 1OPCA 3G73A 2O8XA 4L18B 5E1ZB 5IT9K 1R5GA 2FA5A 1B4AA 5LEKA 2NNYA 1O3SA 1BIAA 2P7VB 1IXSB 2H94A 2QQAA 2KJBA 4XSZF 2P5KA 3RKWA 2GXBA 1SD5A 3BPXA 3I58A 3MQ0A 2GXGA 2PQ8A 4GXOA 1PDNC 1ZREA 2QLZA 3KP7A 3CUOA 4OU0A 3WE3A 2QM3A 3EETA 4L5IA 4HF0A 4BH9A 1YIOA 2ESNA 2XAQA 2M30A 1WSUA 2VBZA 4IHTA 4HDUA 2M87A 4BQAA 1BI1A 4PGGA 5L3EA 4RGXA 2IJLA 3M1EA 2DBBA 3IL2A 4HZFA 2ZBKA 1J0RA 3WGIA 3ULQB 5DCFA 4HAMA 2FEZA 1YQAA 4RB2C 4BHPA 2EFNA 2M45A 4I0AA 2GAUA 4LGWA 1I5ZA 2A6EF 1XGNA 1P4WA 4BXUA 4WXDA 2QUFA 2RQPA 2JTVA 5AIQA 5LGNA 4RS8A 2LKPA 4R1HA 3JW4A 3ZN1A 3WGHA 1OMIA 4RGSA 3VEPA 5JHUA 5HVQC 2FU4A 2V6CA 4HV5A 4U0YA 5HDNA 2L54A 2A61A 1U5TC 5TRDA 1UHMA 1KA8A 3ZPLA 4WXHA 2TDXA
chains in the Genus database with same CATH superfamily
2VKVA 1FWZA 3ZQCA 3RTRA 3H3VK 3DBLB 3M8EA 1Z9CA 2FMLA 3T8TA 3B6CA 3WTUC 1FSHA 5ICGA 4U88A 5F04A 3S2HJ 2PN6A 3BR3A 4HF1A 5K5QA 3ABTA 3LL7A 5JLWA 3TL4X 1FOWA 3MD2A 4CCLA 4M72A 2LFBA 1R9TJ 3I55I 5IPAA 2QENA 4G6QA 1RUNA 4G7HF 2AS5F 4KIFA 3QU3A 2HOAA 3REOA 2OU2A 3PQJA 1X2MA 1ZGJA 2DOEA 2JRMA 1MKMA 4M3FA 4OIRF 2LYCA 4C30A 3ISPA 2FNAA 4Q47A 3JTGA 2ZC2A 3R61A 3RYRA 1RC9A 2EINH 5E17F 4I09A 2EFQA 2Y69H 1VQ7I 1GXPA 2GBYA 2HNHA 3UR3C 3F3XA 2Y31A 1D1BA 3E6BA 2R7TA 4HBLA 3T8RA 2K3PA 1N25A 4Z6YA 3CCMI 3O8GA 5HLTA 3FWEA 3ROUA 1ETKA 3EQLF 4I98B 2KRFA 3WG7H 2MD0A 2DLLA 4JOMA 3I56I 4J01A 1MBEA 2FBIA 3OYBA 3MZHA 5BMZA 2VQCA 5J1UA 3OL4A 3CCQI 2VQGA 2XGCA 1Z7UA 3RPUD 4JP0A 4F91B 3I53A 3G1LA 2W24A 4UUSA 1Z6TA 2PI0A 4KYWA 5L3FA 4ANJA 2HVSA 2V1DA 1Y0NA 2FMYA 4UY8I 2EZKA 2M4GA 1NG7A 1X58A 1GV5A 3CCYA 3M8FA 3HKZN 5ED4A 4Y4RA 3FZVA 4UHTA 2CO5A 2L7MP 1XX5A 1B6AA 3FBNB 2DTRA 2FE3A 2ZXWH 4NQWA 4ENJA 3NRVA 3VWBA 3TEDA 4BU2A 4OAYA 4ESFA 3F8FA 1J75A 5HDKA 1GVDA 1WFXA 3LQRA 4FHTA 1YG2A 5EF6A 3MFKA 5JFRA 3V8LA 3IKVA 2IA2A 2VE8A 1UFMA 2VBYA 4BEHB 3W2AA 1X19A 4LJZF 3A4CA 2M7BA 2HYJA 3MAJA 2Z16A 4IPAA 5M5XJ 2JWTA 4ZDPA 1WCMJ 2CV0A 2HGCA 2R7UA 3I59A 3U9GA 1MBKA 3K2AA 5JVGF 3S16J 3I54A 2WAEA 3W2VA 4F52A 2HTSA 2EZLA 5IP7J 3JRAA 4QLCU 1K6OA 5FB2A 1HW5A 1KU3A 2BXYA 1OCCH 2LP0A 2NVYJ 3KYCB 3R4KA 1FEXA 3WTZA 2E19A 3N4MA 5BQTA 1P4XA 1GXQA 1P7JA 3GUDA 2HR3A 4XKCA 1YOVB 1IRFA 1FOKA 3CCSI 3S15J 2BY0A 4XKBA 4NHJA 2EBIA 4AM3A 2XSJC 4D5CA 1FTZA 2BW3A 4CO8A 3HB9A 3IH2A 4YIFA 4C3HJ 5FD6A 5GPAA 3QPTA 3WODF 1Z7LA 3VOEA 4WF2A 1PUFB 2NVTJ 4BL0B 2RGVA 3KP2A 3TQNA 4Y13A 1HLVA 2X6XA 3FKJA 1O7FA 2E7XA 3PO2J 2ZMEC 1T56A 1ZK8A 4OIQF 2X6OA 1D8KA 4NDLA 1OLTA 2W48A 3CQZJ 1QU3A 2WTEA 1JHHA 5DDGA 1HBXG 1VF9A 3IRQA 5H6RA 4ZYAA 2BEOA 4M9XA 4IHXA 2CWEA 2K02A 3KCCA 1QZZA 3JRGA 1OKRA 3JSOA 1XG1A 3OL3A 1SD7A 3LAJA 3FMSA 1ZTRA 1V55H 3KEQA 2LBFB 1WVRA 3OIQA 4B3XA 2L4AA 3BR0A 3J7AO 1IXCA 1Y8RB 4HOBA 2OBPA 1WGXA 3FHZA 2WB1N 1OYIA 2FF4A 2BY3A 2NVUB 1IRXA 3A01A 2P5VA 1AHDP 2W57A 2CQ7A 3MWMA 1QVUA 4BHBA 1W5CC 5E1XA 4H4KC 2LR8A 3OIOA 1G3SA 3CUQA 2EFPA 4ON0A 3HSFA 2CSOA 2JUCA 5CJ9A 1ZG3A 4V2GA 3IRRA 2HEOA 2UWMA 3HPGA 1T2KA 4F93B 3CDLA 4YIRX 5M5YJ 3A1YA 1U0JA 4BYYA 4PGHA 5FO5A 5F1JA 3GLLA 5IYCJ 3SZPA 4NUBA 3RI4A 3QRFF 1GV2A 3H3ZA 2MSYA 2E71A 2FRHA 4QPQA 5DCMB 1X1AA 5LFAA 5C3EJ 2LK2A 1R5HA 4B4CA 1WHUA 2O9LA 2O61A 3NWTA 1WJAA 2M34A 1KZHA 4E4HA 2PLYA 4BDYA 2WAFA 3SZTA 1FBSA 2X6YA 1A5JA 5KHDA 2IGKA 2DDBA 2HXOA 3CD6I 3PL8A 2BE5F 5FKNA 1SFUA 5BS6A 3SEZA 4M6YA 3JSPA 3OYDA 3ZQIA 3BJ6A 3O6BB 5HS7A 4II3A 3HKZA 2A6TA 1R58A 3HBLA 4DIQA 1K61A 1E3OC 1NHAA 2FJ1A 4ZH4F 3H9JA 5K7ZA 1O4XA 3S2DJ 1S7OA 3LSHA 3CCRI 2ID6A 5J1RA 2MG4A 2VL8A 3EPZA 4WWCA 4YFXF 4X1EA 5CQGA 1S3JA 4YELA 1W0UA 4LITA 3C2HA 4OIPF 2Z3YA 3FXQA 1L0OC 2E60A 4RM3A 3OYIA 2QSHX 2XF7A 2DYRH 3BJOA 1WH7A 4OMZA 5GAHJ 4Q4ZF 4JBAA 5KVRA 1LFBA 4RB0A 3QQAA 2XRLA 1A04A 2KRHA 1MGTA 4HG2A 4BHCA 1S9HA 3DV8A 1J5YA 4PJJA 1BI0A 3UNGC 4D5FA 3GTJJ 3WHCA 2QKMB 2W1OA 3B6AA 3BR2A 2NAZA 5EZHA 1IG7A 3QP5A 3NQOA 1RESA 3RKQA 4A3BJ 1QBJA 2O03A 1FYMA 2G0EA 3FXOA 3AFHA 2ETHA 3ABMH 2H1LA 3PUBA 4C3JJ 1LFUP 3WTWC 4DBQA 1FJLA 1MBJA 2HZTA 2Y0SN 2W82A 4P9FA 1AU7A 1PVEA 1I50J 4BQOA 2ME0A 4LIUA 2DA4A 4JX5A 3BCBA 4IOCF 4A3FJ 1KQ9A 1U2WA 2H27A 4XN0A 4CHUA 1MMDA 3IV5A 2ZSIB 4YG2F 3JREA 2D5VA 2L0KA 2RNGA 2H6CA 2DA5A 2AXTC 2XAUA 2K9NA 2KMUA 3J80K 4G6TB 4YFKF 3HOSA 4L9JA 2BVLA 5CKTA 4BBSJ 2XGDA 4S05A 3J7ZI 2R7FA 2AQEA 5F0CA 1VI0A 2MH2A 4U0WA 2HKXA 4BY7J 5EJCA 2L2OA 3M8JA 5EG0B 2LC2A 4M6XA 4A0YA 1ZGWA 5E20A 4X6AJ 2NS0A 3DEUA 3D5LA 3GXOA 3KYLA 1QRYA 4K2EA 4CZCA 2KIFA 4LLGF 4XQFA 2BHYA 1WPKA 3H9GA 2L9SA 3BOQA 2F5DA 2ELHA 1TLHB 4QTRA 3T1BA 1HQCA 3HOUJ 1H9GA 3S14J 2WV0A 4RLQA 5E79C 2VJJA 4W97A 4EJOA 3VSKA 1USSA 1LVKA 3BR1A 2YU9J 4AWXB 1VQ6I 1IW7F 1BC8C 3H92A 4UUSB 2YU3A 1R1TA 2XKPA 2XAGA 3ASOH 3LSRA 4AIJA 4HV6A 3IWZA 1MJAA 3H35A 3GYHX 3R60A 2O8KA 3QU6A 3V42A 4F3QA 2EA2A 4M9SA 3UKGA 2PG4A 3F0CA 1DQUA 3RPQA 2HQ5A 4KIGA 3P9IA 4FT8A 2LY2A 1O3QA 2P0WA 3IHUA 3GZ5A 4FETA 3OY9A 4BDZA 1ZGAA 3TDUC 1EJ9A 3MCZA 3FKIJ 3G4SI 3KYDB 1W4MA 3SZGA 3BWGA 4L9NA 2KFDA 2HS5A 4BEHA 1T39A 1X1CA 2VXZA 3FM3A 3S3NA 3HOTA 1YJWI 3ABUA 1IO2A 1KU9A 4BJTA 4BUPA 1JKOC 2RNJA 1QHHD 2ICWG 1BW6A 4A2UA 2I10A 1X2NA 2OA4A 4AIKA 1JKPC 2Q8KA 2CV1A 5J47A 2PX9A 1T08B 1TBXA 2ISYA 3D5SC 4M74A 2RV8A 4IEJA 4ZYGA 1C0WA 4G7OF 3HRTA 3QP6A 1G4DA 3W6VA 4A3JJ 4Z2YA 4XL9A 3S1QJ 4CCJA 1IRZA 2L7ZA 2BW3B 1A31A 2KIMA 1YJNI 1F5TA 1SMYF 1Z05A 2W7NA 1SD4A 2K27A 3ECOA 2BGCA 3PNVA 1CGPA 1Z0XA 2DFFA 3C1DA 1TWGJ 1HF0A 1R49A 2E1CA 3K0LA 3KP5A 2QQ9A 2WV1A 1D5YA 1E17A 5A2QZ 2IEKA 4EM1A 1UELB 3L2QA 1ZYRF 5D5UB 3ERMA 3LFUA 3GTMJ 3HSEA 4MLOA 4AU7A 3F23A 4XN3A 2CQQA 3SQNA 3DPLC 1D0XA 2OC6A 1PUEE 3ML6A 2K3FA 2QSFX 1FP1D 2MYSA 2XAHA 3J80Z 3TKYA 2H8WA 2E1MB 3CF5F 4EM2A 1J9IA 2XV4S 1ERDA 3AL0B 5C4XJ 2LY9A 2M4KA 3WE2A 2LBFA 3ELKA 2BVMA 1A35A 3LSMA 1U6GA 4KMUX 3VYUB 2HQNA 4PCQA 3BG5A 3FBIB 2W4SA 4DJAA 5LEJA 4CXFA 3M4OJ 1H88C 2X1EA 4AVZA 2QYOA 1IN4A 2RREA 4GYIA 4ZDLA 2Q2EB 2CYYA 4A0ZA 2X85A 3OYCA 2Y9YA 1S7AA 1XGOA 3KEOA 5LRSA 3CUQB 4KT6A 3S1NJ 2CW7A 3C3WA 2OV7A 4HYEA 4CZZA 2DQRA 4C2UA 4B1RA 1FX7A 2KDOA 5D5XB 1KU2A 4MIMA 4MQ9F 1FLIA 4RB1A 2XF6A 4BXFA 3O2PE 2ZNZA 1IC8A 1RETA 2E2HJ 3GLXA 5K7FA 1SVLA 4NC7A 1PJRA 3QYBA 2RKHA 2IA1A 3DLLF 3J81Z 3HHHA 3BTCA 1ETVA 1RKTA 5DV5A 1ZG5A 4D7NA 4RAZA 3H5RA 1RZ4A 3AKZA 5F08A 1HSJA 3ZMSA 5D6EA 3HL2A 1NG6A 1VZ0A 3AL0C 1IV8A 2F6CA 2FBKA 1JKQC 1F4KA 4MTEA 3K4KA 5IP9J 2KRCA 3P9CA 1W1WE 5DCMA 2HQRA 5ICFA 1TTYA 5KAIC 5FKMA 1TQIA 2XIGA 4C2MJ 2R7RA 1MBHA 4BAYA 1ODDA 3F22A 1DDNA 3FIWA 2V6EA 3AG4H 3CUQC 1B9NA 3U21A 3I71A 5LGUA 4CUGA 2ECCA 2ZSHB 3MZ8A 1Z3XA 4PJNA 5E18F 2D2WA 5D6FA 5LHIA 3OYMA 3Q9VA 1S72I 1K7AA 2STTA 1UZCA 1XSDA 1RNLA 3S8PA 3FM5A 1ZH5A 3BZCA 3SFZA 1BOBA 2WA0A 4RGRA 2IA0A 1D8JA 1S7EA 4HLYA 3ZQFA 2ADUA 3BQZA 5HNHA 3L2RA 5FFZA 1Z3YA 1IDYA 2AXLA 4M6VA 2PJPA 1UHSA 1RPWA 2KHMA 3GO5A 2JSCA 4P55A 3E5UA 2A07F 3RZOJ 2OZUA 2N8GA 1YHQI 3GBGA 1YO5C 1ZN2A 4L5JA 1XC5A 1T0FA 3CDIA 4RGUA 2F48A 3FXLA 2P6SA 3JAMK 4UUVA 4Y17A 4EATA 2DW4A 2DMUA 4BE0A 2AHQA 4OAZA 1GDTA 4I02A 4F7ZA 3E1SA 1O7LA 2VC0A 5F0FA 2E7WA 2KISA 2Y75A 2Z33A 5IT9Z 3BLYA 1ITYA 2DFEA 2HXIA 1K6YA 4KUMA 4FASD 4ZYHA 1ETXA 1D3YA 1LEAA 2M5WA 5J1YA 4UVCA 2VKEA 1PP7U 5E3OA 2IAIA 3HRMA 3CCJI 3RZDJ 1IJWC 3DKYA 2R3SA 4S04A 2D1VA 3O3KA 2NNNA 3PFYA 1DUXC 1UG0A 4X0GA 2R7SA 4CCMA 5HDGA 2BV6A 4ENKA 2R7XA 3H9QA 2MLGA 1WH5A 2GA2A 1OJLA 2M0MA 4E7SA 4IVNA 3WTTC 5FROA 1TWAJ 4QPOA 5J8CA 4FX0A 4RAFA 3ERED 3F72A 2WY7Q 5CVRA 1AWCA 3OYAA 3Q9SA 2E2JJ 2DXIA 2XB5A 4XK4A 3GX4X 1BI2A 4PFPA 2VI6A 2Q1ZB 2K86A 2K9MA 1U3EM 5EG0A 4E7JA 1P7IA 3OR2C 2FSWA 3WG9A 1TWFJ 1S8NA 5EEAA 4L5EA 5F1RA 1KQ8A 1IGNA 1DP3A 5LLQA 4OOIA 4A3CJ 1MDMB 3TGNA 3F6OA 3HHGA 1IN5A 2L5QA 2X1CA 1MJ9A 2WC2A 1K79A 2R5ZB 4OWRB 4AD9A 1U9NA 2JA2A 2YUSA 2R5YB 2YPRA 1J2XA 2FBHA 4EJTA 1V54H 1S29A 2ACJA 5EDNA 2IS6A 1K83J 4CCKA 4ZYEA 4AYBN 2GIZA 1HSTA 3TO9A 4XLAA 2JA5J 1JTXA 1WJFA 2JZYA 3DTEA 1K4TA 4YIIA 2WWYA 2E34A 2OPTA 3KZZA 1P9QC 1XCBA 1ZAOA 2VODA 4LB5A 4W1UA 2WADA 1OQYA 4D0PA 2GQQA 5M5WJ 2V9KA 4ESJA 4EMSA 1LUJB 3VDXA 5CVVA 3BY6A 1Y1WJ 2E5ZA 1DU6A 3BROA 5D5WB 2Z5UA 4Q48A 1KYWA 4U7BA 2B7EA 2VKDA 1KGSA 4DW6A 4BNCA 1MMNA 1STZA 4MGRA 3S3MA 2MFZA 3E6CC 2R0QC 2VXDA 2VJ4A 2O3FA 1XDUA 3QPLA 1NTCA 1XGMA 2P5LC 2OTLI 2LF8A 2MW8A 4PUSA 3W6KB 3JR9A 2OF7A 4HX7A 4CSWA 4ZZLA 3LSJA 3KE2A 3ZMDA 4ENMA 2Y2ZA 4FX4A 3L2WA 1HOMA 3R0AA 9ANTA 1Y8QB 1R1VA 2D1HA 4ZC3A 3ZQ7A 1SMTA 2K5CA 2WY8Q 1QA6A 2IT0A 2JA6J 4EEFG 4RDUA 2DA6A 3ZMVA 2VE9A 3BC8A 3OWTA 4A93J 2H6BA 1A6IA 3TW7A 5J6XA 4J19A 4GO1A 3TP3A 2V79A 3KEYA 1UB9A 2YR2A 3HTUA 4P5OA 3BG9A 2VUMJ 1YX5A 1N75A 2IW5A 2L7KA 2OCEA 1FYLA 4DBRA 1JJ6C 3ZXSA 1K4SA 5E8GA 1IN6A 1WWXA 2A05A 5KK1A 1APLC 1NK3P 3I4MJ 1D5VA 1T8IA 3LSTA 3CDHA 2J5PA 5BPDA 3JRFA 5FFXA 1ZRCA 3DF8A 3Q3SA 3EYYA 3QPHA 3SYTA 4G8XA 2CFXA 4BKXA 1I1GA 2VPRA 3PQKA 3OV8A 2E2IJ 4LK0F 3RDIA 1IN8A 2EQRA 3A0HC 3CLQA 1B1BA 2W85A 3CCVI 3BT9A 2IGNA 2KDZA 4UB8C 1KQ0A 3GVAA 1IXRC 3E5XA 1OCOH 1SAXA 5DD8A 4HNVA 4A3DJ 3GFJA 1XMXA 3JTHA 3PUFA 4M3EA 4FE7A 4H0EA 3TO6A 2EILH 2BY1A 3G3ZA 1OR7A 2Q2EA 1FSEA 3DTKA 4DQ2A 4DNCA 5DEQA 2G7UA 3CP8A 3LFKA 2B63J 5F6FA 2P6TA 3RIRA 1XGSA 3CMEI 4IHWA 5LGTA 4PJLA 5TISC 1J7KA 1MJBA 1MMSA 4UXNA 2QSGX 5FGMA 2ZKZA 5GTHC 2VN2A 2YS9A 4YEJA 1JE8A 4U87A 1WJEA 3WU0A 2NVXJ 1SEUA 1EH7A 2BY2A 4IQ4A 5EGOB 3KP6A 2GOMA 4IRHA 3G1MA 3P5JA 3SXYA 2VASA 3K1PA 5IOZA 1V3FA 1JT0A 3L1PA 4AVPA 1AA7A 2HOEA 3K4MA 1FBQA 3BPVA 3ZOBA 1TL8A 2IS1A 1RIOH 1W5SA 2EV6A 2A6HF 3QOPA 3OSGA 3R6SA 4XRSA 2JQ7A 2DU9A 1R4MB 4AYBA 3I5UA 3OYEA 1AKHB 1ZQ3P 2QVOA 3WTYC 2EZHA 3QAHA 3CCUI 4XBFA 1EA3A 4OINF 2HQAA 4JK1X 1IF1A 1YYVA 4HLXA 1JKRC 5CLSA 2OCCH 3FK7A 4XM3A 2JT1A 2LNBA 3DCFA 4RAYA 5HLGA 3IWFA 1H89C 4XLPF 1RR8C 2HDDA 1DPUA 2A3SA 1LPQA 1ETYA 1I6HJ 3IAS2 4HQEA 1FOXA 2A5YB 2OJED 1Q1VA 1XDSA 3E7LA 4UNOA 3MEXA 3A03A 2DMQA 3L2VA 1RI7A 3CF2A 2ME6A 5IT3A 4NC6A 3RQ4A 2UZKA 4LLNA 3I9V2 3MZYA 1ZELA 4CH7A 3ZQGA 4BACA 3E6MA 2STWA 3PNTA 4IRGA 2Y9ZA 3HOWJ 3V4GA 4MO7A 4EM0B 1Z91A 4I2OA 4CGZA 1G59A 1ON2A 2F4IA 2W25A 3ZGKA 3DLAA 1R00A 2NS7A 2ZJ2A 4QIWN 1ETOA 1LDDA 1U8RA 4A6EA 1G3WA 3E0JB 2QZ8A 4ZTJA 3VSLA 1LNWA 3DU5A 5DUKA 5DUIA 3GFIA 2K4BA 2M3AA 3F9KA 5GPCA 2LD5A 3GMEA 3H1CA 3GZNB 3VODA 5ICEA 1DGRM 3BG7A 3A2KA 4MFDA 2DA7A 3LSPA 5EYRA 2CQXA 3EUHA 1DPRA 2VIXA 4A12A 2R7QA 1X4PA 4LOCA 3R0JA 2XRNA 5D4SA 4Y7NJ 4M3GA 4O6JA 2OD5A 2PMUA 2ISZA 1KONA 4UVAA 5D8KB 1E2XA 1TNTA 2CMPA 2R7VA 1ENHA 4E70A 1VQ9I 3CO6C 2X48A 1OYWA 1G8XA 2LF7A 4I7HA 1JUMA 1LDJA 3AG3H 2RN7A 4RB3C 1U9OA 2R7WA 1T0FC 4XOTA 4GCVA 1S6LA 2V7FA 4HF2A 2QGUA 4WX9A 4HDVA 1Y39A 1XS9A 2QF7A 1USTA 3Q0UA 2VQLA 4KIBA 4A3LJ 3L9FA 1R1UA 3NARA 4D1QA 3CC7I 2M9HA 1QPMA 5E3MA 1HW2A 2DCEA 1MBGA 1EH8A 1OCTC 1P2FA 3G1OA 1UJ8A 1E3PA 3ZQLA 4GDFA 1ONVA 5GAEJ 5GADJ 4A3GJ 2WBMA 3QYEA 3WHBA 4BQNA 4IKFA 1JGSA 2CW0F 3PM1A 2XKOA 5IYDJ 4LFUA 3TOAA 1U78A 3FXJA 4Q5SF 5D5VB 4EJVA 3RPUA 4HEA2 3HGGA 2NS8A 1MDMA 3QODA 4L0ZB 2BHZA 1TZLA 2VLAA 3I4NJ 5JVTA 2QA4I 2R5ZA 2R5YA 3J7YJ 3U1DA 1MMGA 2Z99A 4M71A 2XB0X 5M3MJ 2CG4A 2JN6A 4JQFA 2XHKA 4I76A 4CA0A 4XIDA 1VQMI 1XCVA 2MGQA 2E36A 1FT9A 3NAUA 1X1PA 1FNNA 3KPHA 1Q1HA 1X1DA 4KN4X 1XSVA 2XGXA 4O5VA 5E8IA 1RRJA 1H0MA 2DN0A 4P96A 4LIVA 4XNFA 4ESBA 1WJ5A 2J5OA 3EUKL 2YSRA 4AIDA 1KYZA 2VKHA 1IZ1A 2E1OA 5B66C 3GCMA 3CJNA 2R4GA 4A3EJ 5CYVA 1F1ZA 1HKQA 1TNSA 2VC1A 4UB6C 2FD5A 1R7JA 1OFCX 3BTJA 1LE8B 3K1MA 2BXZA 1Z21A 4PFOA 4KISA 1YW8A 2HU9A 5C4JJ 4U0VA 2M8EA 4N4OB 3WTSC 3KZIC 3W6JB 3M1CA 2K40A 2O6GE 3LA2A 1IN7A 4L9TA 4B09A 1N77A 4XRFA 3K6GA 2YX7A 1V5FA 2UXXA 4HRIA 5L3DA 1S5LC 3GZ6A 4Y3OA 2R93J 2X1DA 2W00A 4LG3A 3BR6A 3KP3A 3V7SA 2JMWA 4ASNA 2XC7A 1D1AA 2DDAA 4V19K 4BQQA 3ASNH 2F5FA 3F8MA 3RKXA 1V4RA 4OMYA 3C2BA 1VTNC 1YITI 5HS8A 1R22A 4MFEA 4V2FA 1SFXA 5FKOA 1BI3A 1T95A 3G6EI 3FX3A 1FP2A 5GTIC 2TRTA 3AG2H 4XLFA 2KP6A 1T33A 2H8RA 1FIPA 2G7HA 3V7CA 2ZMEA 1A6QA 2XVCA 1BA5A 2NXNB 2MA3A 1CF7B 1TW3A 3VYTB 2FNPA 4QWQA 2H09A 1PYVA 3ABLH 1UAAA 2X9DA 4I0BA 4HA8A 4AUXA 1I1SA 4RBOA 3QOEA 2KLOA 1IV6A 3MKYB 1QGPA 4GYGA 1LFPA 4IZZA 2EIJH 3Q5FA 1FZPB 3CJQB 3KETA 1FPQA 4QSHA 3DWLE 3CC4I 5J8FA 2KPMA 2ZXIA 2TCTA 3F8NA 5JR3A 3V7RA 3OYNA 1XB4A 3RYPA 4G9YA 1H8AC 1R6RA 1VFCA 5B1AH 2AO9A 2E1NA 3GW2A 3TOBA 2HI3A 1G6NA 4N9IA 2DFIA 3HRUA 3F8CA 4EJUA 2F2EA 1FMVA 1TC3C 1P92A 1POGA 1WRJA 2OZ6A 4CICA 5B3SH 1VQ5I 3OSFA 2LY1A 2KZGA 4E6KG 2CH0A 1VQ4I 5HODA 3KX2A 1ON1A 4XR6A 5K5OA 3K2ZA 2NOGA 1Y0UA 1B59A 3M3YJ 1V5GA 3W2WA 2ZJQF 4ZDOA 1HXDA 3HSRA 4BJ5C 1J59A 3GTOJ 2XAFA 2EB7A 1J09A 3MN2A 3SHFA 2EWNA 3LOCA 1K78A 3G71I 1TP4A 2OTJI 2EK5A 4N4NB 5BNGA 2LH9A 4PSWA 4KICA 3TO7A 3JRDA 1GVJA 3ZMUA 2JPCA 3MKZA 3IUOA 2CJJA 4KJZA 3HOVJ 3H0GJ 1TQPA 4YRVA 1RUOA 3H36A 1SFKA 2E1MC 2E35A 1ZLJA 3LA3A 4KITB 1ZR2A 3ZP5A 3PO3J 2FXAA 2MC3A 2QCOA 2V1NA 1AOYA 1DP7P 2FQ4A 1MD0A 1WKMA 4P1WA 5EGOA 3ZN0A 2ESHA 3L2CA 1YS6A 2EIMH 5IP6A 1I3AA 2EV0A 4II2A 1OR7C 1I6XA 3ESWB 2XAJA 2COBA 2ELJA 4XSXF 2KJCA 1X1BA 5HOOA 1TWHJ 3MKWB 4P9UA 1ZHFA 2DI3A 5K7HA 1VQNI 1ZARA 1IRGA 2L01A 3VYRB 3Q0VA 1B8IB 1HW1A 3BJAA 1AKHA 2LKSA 4IO9F 3K4CA 4E7KA 3ONQA 2QWWA 3BTIA 3LSIA 4E7HA 2L4MA 2ZFWA 2DA1A 3DKXA 1FBUA 4DZJA 3I3LA 2NYXA 1BJAA 2QBYB 5KNLA 4HNTA 1W36D 1PP8F 2Z1DA 4G7ZF 3VB2A 3OS1A 2GIVA 2WAQN 3GEZA 1W36C 3ZMZA 1U5TB 3NEUA 1TWCJ 3FDYA 2EA4A 2JJ7A 2EV5A 3K69A 3OOUA 4XKWA 3IH3A 4LLLA 4EGYA 2K4JA 2R7DA 1G3YA 5DM7F 3LAPA 4DOZA 2EPFA 1YRNB 2HOSA 2VBXA 2F4MB 1SAUA 2K85A 4DZPA 1NH3A 3BR5A 3WU1B 2JPBA 2DT6A 2RAEA 1BN5A 5L3BA 2K9QA 5H20A 3H3UA 2HVRA 5M3FJ 1R23A 3OIPA 3HJEA 1Z6RA 1JUPA 4U7DA 2HYGD 4LG0B 4LK1F 4EQQA 2GA1A 3U1KA 1YFHA 5EZGA 2HVQA 4FQGA 3IKTA 3GF2A 2DK8A 3DTIA 4MHGA 3K4BA 4KMFA 5E3NA 3S93A 1MW7A 3VYSB 2IP2A 2GZWA 2FQ3A 3KFWX 1BR4A 3CJRB 4ETSA 4EV0A 4XICA 2HFHA 3L2UA 1B72B 1E0EA 1BC7C 2DMTA 2LTPA 2KIUA 4LB6B 1MBFA 1SD6A 2FX0A 4Y52J 1QNTA 2HYFA 2JRTA 3I0TA 4GRIA 5FKLA 3ZRGA 2V1UA 5DD4A 5JHFA 2QQ8A 3AG1H 1MSEC 4B8XA 5HS9A 2DOAA 3ZR8X 1D0YA 2EIKH 2K9LA 2C6YA 3JRCA 1REPC 1JXSA 1T98A 1DU0A 3FXMA 4C2TA 1W7PA 1XSXA 3A0BC 4G12A 4I01A 3BP8A 3OYJA 2OQRA 1WI9A 2FOKA 4HPQA 3LSGA 1O3TA 4PZJA 2VT2A 3HDDA 1ZLKA 4DGWB 3HUGA 3CJTB 3EUHC 3GFLA 4TV7A 5FD5A 4E7IA 2PJRA 1KU7A 2LSOA 3WGGA 2DMNA 4MNUA 3N97A 1YI2I 5FLVA 4IHSA 2DPDA 2ZCWA 3DKWA 3U2RA 1M1EB 1LKXA 2BOLA 5L3GA 1UHWA 2XGEA 4A5MA 2DQLA 4JX6A 2DOFA 2RQQA 2M8GX 3KP4A 2A69F 3PSIA 2ELKA 3V8JA 1LQ1A 2MBFA 2UXNA 1ZRFA 3KIOA 1MH4A 3GFMA 5E1WA 1ZR4A 2P4WA 3C7JA 3OYLA 1ULYA 3B02A 4E7ZA 1SFEA 2IS4A 2VJIA 1TT5B 5AIPA 1MH3A 5DTDA 3VFZA 2COMA 6PAXA 2DA2A 1W0TA 3C18A 1VQLI 1HCRA 2IRFG 1JTYA 4MQVA 3FMRA 2IXSA 1Z1DA 4A5NA 3I4PA 1T6SA 4BY1J 3K1NA 3LSKA 4A69C 4HX4A 1H9TA 4IF4A 3CCLI 2PMZN 4B3AA 1LJ9A 5LHHA 2H1KA 3GTLJ 3LA7A 1GHCA 2DFHA 1ETQA 1O57A 2ZO4A 3ABKH 1OCZH 1R4NB 2GLOA 3E6DA 3WU2C 3A02A 1BM9A 2F5CA 3TDZC 4RLFA 1LE8A 1FTTA 2MD5A 3EUAA 4PDKA 1FOYA 2B0LA 2HPIA 3ECHA 5JLXA 5HLHA 1HKSA 4PJ0C 1FMWA 1XN7A 2O0YA 4MTDA 1OCRH 3S1MJ 4NB5A 3HZJA 4N9HA 2ID3A 4UV9A 3E97A 3SEQA 3KLNA 1OCPA 3BDDA 3SJMA 4FCYA 2RDPA 3V8KA 3WTVC 3K9TA 4A6DA 1EV7A 2PEXA 1TQMA 4WK8F 3OS2A 4HW0A 2V9PA 3JAMZ 2ZJRF 1HDPA 2L02A 3DPTA 2ZMEB 1FC3A 3CLOA 2DJIA 2WAQA 1EKEA 1XMAA 3S32A 3CTAA 1YLFA 5DM6F 1QZYA 2G9WA 4KN7X 2DAOA 2KT0A 3OOPA 1SVMA 1V5EA 2HTJA 1WJDA 3DQVC 3E5QA 2JVHA 5JI6A 4ENNA 1CF7A 3H5NA 4NNJA 1W5TA 3RKYA 5FLXK 3ZCOA 4AIHA 2NVQJ 1P6RA 4E7LA 2EZIA 3GTGJ 2LDUA 4KDPA 1IDZA 2O7OA 5H6QA 3K4NA 3H5AA 4RMNA 5CQEA 2JUGA 1WQ2A 5J3LA 3SDBA 2DT7B 1VNDA 5ILVA 1JUSA 4F55A 2R7OA 3X2QH 1YW9A 1B9MA 2BBYA 4A3KJ 1OISA 4CDGA 2XF5A 2NOJB 3OS0A 1I39A 3RQIA 1X3UA 5K1YA 1EF4A 2IPQX 3TMOA 2OUMA 4IRIA 4N0BA 3DEWA 3PFIA 2LMDA 5LD2C 1G2HA 5DS9A 2CQKA 5ICCA 3EDPA 1MNEA 3FXKA 1F9NA 2CW8A 2XDVA 2Y30A 2XASA 2Y0MA 2CV2A 1BR2A 2EH3A 3CC2I 2V9VA 1K78B 3L7WA 2XPWA 3MVPA 4KT5C 2I8DA 4WXCA 2X4HA 1Y1VJ 3PIPF 4BE1A 2LOOA 3T5XA 5ILSA 1BIBA 3M7GA 2CUFA 2LKXA 4LMYA 3D5RC 3S2WA 2VONA 4BBRJ 4UUTA 2P81A 1BW5A 2HPMA 2MLKA 3BTLA 2L9RA 1HKTA 5HLIA 1D1CA 4R79A 2E5NA 3CP2A 2F5EA 4BS9A 1MNDA 3LQQA 1LDKB 2UUZA 4CYDA 1X3ZB 2XUBA 3TW6A 4B48A 3CMYA 3PJRA 3S1RJ 3LMMA 1ACIA 2DA3A 3S3OA 5ILUA 3DP7A 5CVJA 4CYCB 2JK3A 2PBIA 3BQYA 5EEGA 2IBDA 4XLCA 2MH9A 4KFCA 1BR1A 4IHYA 2RVCA 4LD5A 1R36A 5L3CA 4M9ZA 1QHGA 3SDGA 3M9AA 4M73A 2L3DA 2HDCA 1R5ID 1B8IA 3FXUA 4PJMA 3HXLA 2Z9OA 3CCEI 4IHVA 1LVAA 4XRMA 3BZ6A 2DTZA 1O3RA 2DPUA 2PMZA 2IVMA 1YIJI 1YE9A 5DYMA 5BPIA 2QBYA 2VPLA 1JHFA 2V4JC 2XPUA 1IUFA 2ZNYA 4EVIA 1U5TA 2PMHA 5FJ8J 3I64A 3DFGA 2OQGA 3JCUC 2LG4A 3HGYA 2KZVA 3HEFA 2P7CB 3DBHB 2LREA 4EJWA 4KNYA 1YRNA 4C3IJ 1JGGA 3B73A 3BG3A 2CUZA 5CPRB 4XONA 4DYRA 3FF5A 4RAGA 1GT0C 3EYIA 4XOPA 1Z67A 3E3VA 4M3DA 2KKOA 4GFBA 3DBRB 3L09A 5FLXZ 1IAWA 3T0YA 3QYFA 3RJPA 3JRHA 1I27A 3M07A 4UV8A 5ERIA 4IXAA 2X0LA 3K4LA 5TGTA 4O3MA 1JI8A 2W84A 4LG0A 4BGDA 2QQBA 3L00A 2PFBA 2DJNA 1N78A 2B9SA 2QEXI 5FLMJ 4Y15A 4MEYF 4EGZA 1E3HA 4CCNA 4RA2A 1YW7A 1UCRA 1QQIA 3QPSA 3F21A 3CMMA 5LHGA 1B72A 1SC7A 1YJ9I 3FHNA 5F64A 1F43A 1TW2A 4UVBA 3BG6A 1G3TA 1VQPI 4MEXF 4HSTA 4G6DA 2VJ5A 1GUUA 3OYKA 5KAFC 5B5EC 3P9KA 4R8HA 2HKOA 3OYHA 2RC4A 4IOAF 1W7PB 4HQMA 5A2QK 3D0SA 1ZG1A 2CGPA 2M1BA 3J7AY 1ZKGA 3HUGB 3IC7A 2PJRB 1WI3A 1QZEA 4DYCA 2EFWA 2A68F 2BYVE 4ZZDA 2DYSH 3W3CA 2ZXJA 4A3MJ 2CUJA 1MNMC 5J4YA 2JA7J 1XMKA 3FXRA 1XTAA 1BL0A 1VQOI 5D8LB 3WTXC 3H0DA 1A36A 3RSNA 5TJJA 3JRIA 3HYIA 3GWZA 5D4RA 2CU7A 2R92J 2Q0OA 3O8HA 2V26A 4I99C 5EEHA 1QPIA 2LRDA 3JRBA 3OR1C 1MSFC 2MABA 4FE4A 3VPRA 4ABZA 1P4AA 2K7LA 1LB2A 3BZKA 2P8TA 1EH6A 4WCGA 2AQFA 2M2EA 2GXAA 1I3QJ 5HNFA 2WB1A 1W7PD 1QO0D 4XMYA 4HX8A 4IJAA 1MIJA 1FYKA 4RM2A 1FIAA 1RKWA 2L7FP 2BZTA 1BOAA 2XROA 2DT5A 4KA4A 4DYQA 3HOXJ 2DK5A 5J40A 3DEEA 2L9NA 2VOPA 3HIFA 4IL6C 3COAC 3J81K 4IQJA 4YFNF 2EJRA 4G94A 2VBWA 3GTQJ 4BJ6C 3TP0A 5FRNA 5H2FC 2HWVA 2KIQA 1BJZA 2HZDA 4NQWB 2F5VA 3DXJF 1SANA 1T38A 4IX7A 3IP4B 5IYBJ 4D9JA 5BOXA 4PSXA 1LEBA 2VT3A 3HTSB 3HOYJ 5AONA 1NK2P 5LRRA 1IUYA 2ECBA 2ZB9A 3HRSA 3KZYA 1YTYA 3NWSA 1UMQA 1CQTA 1L3LA 1MZBA 2YX4A 5GP9A 1XD7A 2M7AA 2CS3A 3AAFA 1ZRDA 2A5WA 2DO7A 2FUG2 2VOOA 3I59B 4A0XA 4ZYDA 2L9VA 3K4JA 3GTKJ 1XPXA 2V1XA 4B44A 4JX4A 3FK6A 2QKLB 5B1BH 3G2BA 3IAM2 2D45A 3Q0WA 1DGWY 2CQNA 2GWRA 3FMQA 5CVUA 4XLNF 2O5RA 1WJBA 3LWFA 2Y48A 2DMPA 4GGGA 5CVIA 4L0YB 2CUEA 2NRAC 4CCOA 4HSRA 4XLEA 3D1NI 1MMAA 2KQRA 2FOWA 2CFOA 3CO7C 1OYYA 5C44J 1HDDC 1BBYA 3F6VA 1YS7A 1FY7A 1UG2A 4OIOF 4FISA 4ITVA 3RCOA 2EFOA 2OAZA 2MC4A 4C9YA 5LBQA 3PIOF 5K5RA 3P7NA 2F4OB 4J00A 3KLOA 3K70D 2JA8J 3ZMTA 3K70C 4L9VA 3F8BA 3HC7A 1OPCA 4PK4A 3CESA 3G73A 3OYFA 2XPVA 2O8XA 4L18B 5E1ZB 1PUFA 5IT9K 1R5GA 2FA5A 1HA8A 1ORKA 1B4AA 3DPUA 5LEKA 1SFOJ 3HOZJ 2NNYA 4XRSG 1O3SA 1BIAA 2P7VB 1IXSB 5E3LA 5FKKA 2H94A 4B47A 1VQ8I 2QQAA 2GM4A 3HM5A 4XKVA 2HOTA 1GLNA 2KJBA 4XSZF 2P5KA 2Y0SA 4XLHA 4B43A 3RKWA 2GXBA 1SD5A 3BPXA 1X3WB 1JT6A 3I58A 3C2GA 3K10A 2Z2SB 3ZQQA 3MQ0A 1YX3A 1JJ8C 3FISA 5F27A 3A01B 2GXGA 4I6ZA 2PQ8A 1D0ZA 4GXOA 3N05A 2I5UA 1PDNC 1ZREA 1RR7A 2QLZA 1ETWA 1WZ2A 3KP7A 1Z77A 3CUOA 4OU0A 3QWLA 3WE3A 2JVGA 2X51A 2IGOA 2LVSA 2QM3A 3EETA 3PNYA 4M3BA 1WJCA 4L5IA 4HF0A 2IGMA 4ZTFA 3CZ6A 4BH9A 1YIOA 2ESNA 1QVTA 2HDWA 3CMAI 4XORA 3HPHA 2XAQA 2R7ZJ 2M30A 2VQHA 1U8BA 3TBIA 5J4VA 1WSUA 1Y6IA 2KL4A 2VBZA 4CYCA 5IY5H 4IHTA 4HDUA 2UV1A 2M87A 4BQAA 1BI1A 2GOXB 4PGGA 2ZFUA 5L3EA 4RGXA 5FRMA 5F0HA 3OYGA 2IJLA 3M1EA 5KCMA 1TT0A 2DBBA 3IL2A 3K7AJ 3SFIA 4HZFA 4S0HB 2CRGA 2JSPA 2ZBKA 1J0RA 4Y33A 5GAGJ 3WGIA 3ULQB 1X4OA 5DCFA 4HAMA 4BE2A 2FEZA 1YQAA 4RB2C 4FTHA 4BHPA 2EFNA 2M45A 2XSDC 1VQKI 4I0AA 3S17J 3PSFA 3GTPJ 2GAUA 4LGWA 4ZJZA 2VB6A 2LLKA 1I5ZA 2K9SA 3MKLA 4D7MA 2ZXHA 2A6EF 1XGNA 4NC8A 4AC0A 1P4WA 1R71A 4JYKA 2M0CA 4BXUA 4WXDA 2QUFA 4NBQA 5IOYA 2RQPA 2JTVA 5AIQA 5LGNA 4RS8A 2LKPA 4R1HA 3JW4A 3BCAA 3WGHA 3ZN1A 2IS2A 2X6WA 1OMIA 4RGSA 4BXXJ 3DU6A 3VEPA 5JHUA 5HVQC 4A3IJ 2FU4A 2V6CA 4HV5A 3IH4A 4U0YA 5HDNA 2ZJPF 1HC8A 2L54A 1Y56A 2A61A 1U5TC 5TRDA 1UHMA 3MMYB 1KA8A 4HNUA 1SVOA 3HG9A 3ZPLA 4WXHA 2DODA 2TDXA 4F92B 3LNQA 3OMYA 3ZQHA 1F36A
chains in the Genus database with same CATH topology
1FWZA 3RTRA 3M8EA 1Z9CA 2FMLA 3T8TA 3WTUC 1FSHA 5ICGA 4U88A 2PN6A 4HF1A 5K5QA 3ABTA 4M72A 2QENA 4G6QA 1RUNA 4G7HF 2AS5F 4KIFA 3QU3A 3REOA 2OU2A 3PQJA 1ZGJA 1MKMA 4OIRF 3ISPA 2FNAA 4Q47A 3JTGA 3R61A 3RYRA 5E17F 4I09A 2EFQA 1GXPA 3F3XA 3E6BA 4HBLA 3T8RA 3FWEA 3ROUA 3EQLF 4I98B 2KRFA 2DLLA 2FBIA 3MZHA 5BMZA 1Z7UA 3I53A 2W24A 1Z6TA 2PI0A 4KYWA 5L3FA 2V1DA 2FMYA 3M8FA 5ED4A 3FZVA 4UHTA 2CO5A 1B6AA 2DTRA 2FE3A 4NQWA 4ENJA 3NRVA 4ESFA 3F8FA 1J75A 5HDKA 3MFKA 3LQRA 4FHTA 1YG2A 5JFRA 3V8LA 3IKVA 2IA2A 2VE8A 1UFMA 2VBYA 4LJZF 3MAJA 4IPAA 2HGCA 3I59A 3U9GA 3I54A 2HTSA 4QLCU 1K6OA 5FB2A 1HW5A 1KU3A 3R4KA 3WTZA 3N4MA 5BQTA 1P4XA 1GXQA 3GUDA 2HR3A 1IRFA 1FOKA 4NHJA 4CO8A 5FD6A 4YIFA 3QPTA 3WODF 3VOEA 4WF2A 2RGVA 3KP2A 3TQNA 4Y13A 1O7FA 2E7XA 4OIQF 1D8KA 2WTEA 1JHHA 5DDGA 1HBXG 3IRQA 5H6RA 2BEOA 4M9XA 2CWEA 2K02A 3KCCA 1QZZA 1OKRA 3JSOA 1SD7A 3LAJA 3FMSA 3KEQA 2L4AA 3J7AO 1IXCA 4HOBA 2OBPA 3FHZA 1OYIA 2FF4A 2P5VA 2W57A 3MWMA 4BHBA 5E1XA 1G3SA 3CUQA 2EFPA 4ON0A 3HSFA 2CSOA 5CJ9A 1ZG3A 3IRRA 2HEOA 2UWMA 1T2KA 4BYYA 4PGHA 5FO5A 3SZPA 3RI4A 3QRFF 3H3ZA 2FRHA 5DCMB 1R5HA 2O61A 2PLYA 3SZTA 1FBSA 2BE5F 1SFUA 5BS6A 4M6YA 3JSPA 3BJ6A 3O6BB 5HS7A 1R58A 1NHAA 4ZH4F 1S7OA 4WWCA 4YFXF 1S3JA 4OIPF 2Z3YA 3FXQA 1L0OC 3BJOA 4OMZA 4Q4ZF 4JBAA 5KVRA 4RB0A 1A04A 1MGTA 4BHCA 3DV8A 1J5YA 1BI0A 2NAZA 3QP5A 3NQOA 1QBJA 2O03A 1FYMA 2ETHA 3WTWC 2HZTA 4P9FA 1KQ9A 1U2WA 2H27A 4CHUA 4YG2F 2H6CA 3HOSA 3J80K 4YFKF 4L9JA 4S05A 2R7FA 2MH2A 4U0WA 2HKXA 4M6XA 4A0YA 5E20A 2NS0A 3DEUA 3D5LA 3GXOA 4K2EA 2KIFA 4LLGF 3BOQA 2F5DA 2ELHA 1TLHB 3T1BA 1HQCA 1H9GA 2WV0A 4EJOA 1USSA 4AWXB 1IW7F 1BC8C 3H92A 2YU3A 1R1TA 2XKPA 2XAGA 4AIJA 4HV6A 3IWZA 1MJAA 3GYHX 3R60A 3QU6A 2EA2A 4M9SA 2PG4A 3RPQA 4KIGA 3P9IA 4FT8A 1O3QA 3IHUA 3GZ5A 1ZGAA 3TDUC 3MCZA 1W4MA 3BWGA 4L9NA 2HS5A 1T39A 2VXZA 3FM3A 3HOTA 3ABUA 1KU9A 2RNJA 4A2UA 2OA4A 4AIKA 2Q8KA 1TBXA 2ISYA 4M74A 2RV8A 4ZYGA 1C0WA 4G7OF 3HRTA 3QP6A 1G4DA 4Z2YA 2KIMA 1F5TA 1SMYF 1Z05A 1SD4A 2K27A 3ECOA 2BGCA 1CGPA 3C1DA 2E1CA 3K0LA 3KP5A 2QQ9A 1E17A 5A2QZ 4EM1A 1ZYRF 5D5UB 3HSEA 3F23A 3SQNA 3DPLC 1PUEE 3ML6A 1FP1D 2XAHA 3J80Z 3TKYA 4EM2A 1J9IA 2XV4S 3WE2A 3ELKA 1U6GA 4KMUX 2HQNA 4PCQA 5LEJA 4CXFA 2QYOA 1IN4A 4GYIA 2CYYA 4A0ZA 1S7AA 1XGOA 3KEOA 5LRSA 3CUQB 3C3WA 4CZZA 4HYEA 2DQRA 1FX7A 5D5XB 1KU2A 4MQ9F 1FLIA 4RB1A 3O2PE 2ZNZA 3GLXA 2RKHA 2IA1A 3J81Z 3HHHA 5DV5A 1ZG5A 4RAZA 1RZ4A 1HSJA 3ZMSA 5D6EA 2FBKA 1F4KA 4MTEA 3P9CA 5DCMA 2HQRA 5ICFA 1TTYA 1TQIA 2XIGA 4BAYA 1ODDA 3F22A 1DDNA 3CUQC 1B9NA 3I71A 5LGUA 5E18F 2D2WA 5D6FA 5LHIA 3Q9VA 1K7AA 2STTA 1XSDA 1RNLA 3FM5A 1ZH5A 3SFZA 4RGRA 2IA0A 1D8JA 4HLYA 2ADUA 5FFZA 2AXLA 2PJPA 3GO5A 2JSCA 4P55A 3E5UA 2A07F 2OZUA 1YO5C 1ZN2A 4L5JA 1T0FA 4RGUA 2P6SA 3JAMK 4UUVA 4Y17A 2DW4A 4I02A 4F7ZA 1O7LA 2VC0A 2E7WA 2Y75A 2Z33A 5IT9Z 4KUMA 4ZYHA 1D3YA 1LEAA 2M5WA 4UVCA 1PP7U 3HRMA 2R3SA 4S04A 2D1VA 3O3KA 2NNNA 1DUXC 5HDGA 2BV6A 4ENKA 2MLGA 2GA2A 3WTTC 4IVNA 5J8CA 4FX0A 3ERED 3F72A 5CVRA 1AWCA 3Q9SA 3GX4X 1BI2A 2K86A 1U3EM 2FSWA 3WG9A 1S8NA 5F1RA 1KQ8A 5LLQA 4OOIA 1MDMB 3TGNA 3F6OA 3HHGA 1IN5A 1MJ9A 2WC2A 1K79A 4AD9A 2YPRA 1J2XA 2FBHA 4EJTA 1S29A 2ACJA 4ZYEA 1HSTA 3TO9A 2JZYA 4YIIA 2WWYA 3KZZA 1XCBA 1ZAOA 2VODA 4LB5A 4D0PA 2GQQA 4ESJA 4EMSA 5CVVA 3BY6A 3BROA 5D5WB 2Z5UA 4Q48A 4U7BA 1KYWA 1KGSA 4BNCA 1STZA 4MGRA 3E6CC 2O3FA 1XDUA 1XGMA 2P5LC 2LF8A 3W6KB 4HX7A 4ZZLA 3KE2A 3ZMDA 4ENMA 4FX4A 3R0AA 1R1VA 2D1HA 3ZQ7A 1SMTA 2IT0A 3ZMVA 2VE9A 2H6BA 5J6XA 4GO1A 2V79A 1UB9A 2YR2A 3HTUA 4P5OA 2IW5A 1FYLA 5E8GA 1IN6A 1WWXA 5KK1A 1D5VA 3LSTA 3CDHA 2J5PA 5BPDA 5FFXA 1ZRCA 3DF8A 3EYYA 3QPHA 4G8XA 2CFXA 1I1GA 3PQKA 3OV8A 4LK0F 3RDIA 1IN8A 1B1BA 2W85A 1KQ0A 3GVAA 1IXRC 3E5XA 1SAXA 5DD8A 3GFJA 3JTHA 4H0EA 3TO6A 3G3ZA 1OR7A 2Q2EA 1FSEA 4DQ2A 4DNCA 5DEQA 2G7UA 3LFKA 5F6FA 2P6TA 3RIRA 1XGSA 5LGTA 1J7KA 1MJBA 4UXNA 5FGMA 2ZKZA 2VN2A 1JE8A 3WU0A 1EH7A 3KP6A 4IRHA 3SXYA 3K1PA 1V3FA 4AVPA 2HOEA 1FBQA 3BPVA 1RIOH 1W5SA 2EV6A 2A6HF 3QOPA 3R6SA 2DU9A 3I5UA 2QVOA 3WTYC 3QAHA 4XBFA 4OINF 4JK1X 1IF1A 1YYVA 4HLXA 5CLSA 2JT1A 2LNBA 5HLGA 4RAYA 3IWFA 4XLPF 1DPUA 2A3SA 4HQEA 2A5YB 1XDSA 4UNOA 3MEXA 1RI7A 2UZKA 5IT3A 4LLNA 3MZYA 3E6MA 2STWA 4IRGA 3V4GA 4EM0B 1Z91A 4I2OA 4CGZA 1ON2A 2W25A 1R00A 2ZJ2A 1LDDA 1U8RA 4A6EA 1G3WA 2QZ8A 5DUIA 1LNWA 5DUKA 3GFIA 2K4BA 3VODA 5ICEA 3EUHA 1DPRA 4A12A 3R0JA 5D4SA 2XRNA 4O6JA 2ISZA 2OD5A 2PMUA 4UVAA 5D8KB 1E2XA 1TNTA 4E70A 3CO6C 1OYWA 2LF7A 4I7HA 1LDJA 2RN7A 4RB3C 4GCVA 1S6LA 4HF2A 4WX9A 4HDVA 1USTA 4KIBA 3L9FA 1R1UA 1QPMA 1HW2A 1EH8A 1P2FA 1ONVA 1JGSA 2CW0F 2XKOA 4LFUA 3TOAA 1U78A 4Q5SF 5D5VB 4EJVA 3RPUA 1MDMA 4L0ZB 5JVTA 3U1DA 2Z99A 4M71A 2CG4A 4JQFA 2XHKA 1XCVA 1FT9A 1FNNA 1Q1HA 4KN4X 1XSVA 2XGXA 4O5VA 5E8IA 4P96A 4ESBA 2J5OA 2YSRA 1KYZA 1IZ1A 3CJNA 5CYVA 1F1ZA 1HKQA 1TNSA 2VC1A 1R7JA 3K1MA 1YW8A 4U0VA 2M8EA 3WTSC 3W6JB 2O6GE 3LA2A 1IN7A 4L9TA 4B09A 4XRFA 2YX7A 2UXXA 5L3DA 3GZ6A 3KP3A 3V7SA 4ASNA 2F5FA 3F8MA 3RKXA 1V4RA 4OMYA 1VTNC 5HS8A 1R22A 1SFXA 1BI3A 3FX3A 1FP2A 2G7HA 3V7CA 2ZMEA 2XVCA 2MA3A 1CF7B 1TW3A 2FNPA 4QWQA 2H09A 4I0BA 4HA8A 1I1SA 1QGPA 4GYGA 3Q5FA 1FZPB 3KETA 1FPQA 5J8FA 3F8NA 5JR3A 3V7RA 1XB4A 3RYPA 4G9YA 2E1NA 3GW2A 3TOBA 1G6NA 4N9IA 2DFIA 3HRUA 3F8CA 4EJUA 2F2EA 1P92A 1WRJA 2OZ6A 4CICA 1ON1A 5K5OA 3K2ZA 1Y0UA 1B59A 1HXDA 3HSRA 1J59A 2XAFA 2EB7A 3SHFA 2EWNA 1K78A 2EK5A 3TO7A 4KICA 1GVJA 3ZMUA 2JPCA 1TQPA 1RUOA 1ZLJA 3LA3A 3ZP5A 1AOYA 2FXAA 2MC3A 1DP7P 1MD0A 1WKMA 3L2CA 3ZN0A 2ESHA 1YS6A 2EV0A 1I6XA 2XAJA 4XSXF 2KJCA 5HOOA 4P9UA 1ZHFA 2DI3A 1ZARA 1IRGA 2L01A 1HW1A 3BJAA 2QWWA 2L4MA 2ZFWA 1FBUA 2NYXA 1BJAA 2QBYB 1PP8F 4G7ZF 3VB2A 2GIVA 3GEZA 3ZMZA 1U5TB 3NEUA 2EA4A 2EV5A 3K69A 4LLLA 4EGYA 2K4JA 2R7DA 1G3YA 3LAPA 2VBXA 3WU1B 2JPBA 1BN5A 5L3BA 5H20A 3H3UA 1R23A 1Z6RA 4U7DA 2HYGD 4LG0B 4LK1F 4EQQA 2GA1A 1YFHA 3IKTA 3GF2A 2DK8A 4MHGA 4KMFA 2IP2A 2GZWA 2FQ3A 3KFWX 4ETSA 4EV0A 2HFHA 1BC7C 2KIUA 4LB6B 1SD6A 1QNTA 2HYFA 2JRTA 3I0TA 2V1UA 5DD4A 4B8XA 5HS9A 2C6YA 1REPC 1JXSA 1T98A 1W7PA 1XSXA 4I01A 3BP8A 2OQRA 1WI9A 2FOKA 1O3TA 4PZJA 2VT2A 1ZLKA 3HUGA 3GFLA 4TV7A 5FD5A 1KU7A 2LSOA 3WGGA 4MNUA 3N97A 4IHSA 2DPDA 2ZCWA 3DKWA 3U2RA 5L3GA 1UHWA 4A5MA 2DQLA 3KP4A 2A69F 3V8JA 1LQ1A 2MBFA 2UXNA 1ZRFA 3GFMA 5E1WA 2P4WA 3C7JA 1ULYA 3B02A 1SFEA 5AIPA 3VFZA 2COMA 6PAXA 3C18A 2IRFG 4MQVA 3FMRA 1Z1DA 4A5NA 3I4PA 1T6SA 3K1NA 4HX4A 1H9TA 4IF4A 1LJ9A 5LHHA 3LA7A 1GHCA 2ZO4A 1O57A 3E6DA 1BM9A 2F5CA 3TDZC 2MD5A 1H0MA 5HLHA 4PDKA 2B0LA 3ECHA 1HKSA 1XN7A 2O0YA 4MTDA 4NB5A 4N9HA 4UV9A 3E97A 3KLNA 3BDDA 2RDPA 3V8KA 3WTVC 3K9TA 4A6DA 1EV7A 2PEXA 1TQMA 4WK8F 4HW0A 3JAMZ 2L02A 3DPTA 2ZMEB 1FC3A 3CLOA 1XMAA 3CTAA 1YLFA 1QZYA 2G9WA 4KN7X 2DAOA 3OOPA 2HTJA 3DQVC 5JI6A 3E5QA 4ENNA 1CF7A 1W5TA 3RKYA 5FLXK 4AIHA 1P6RA 2LDUA 4KDPA 5H6QA 1WQ2A 5ILVA 1YW9A 1B9MA 2BBYA 4CDGA 1X3UA 5K1YA 2IPQX 4IRIA 4N0BA 3PFIA 2CQKA 5ICCA 3EDPA 1F9NA 2XASA 2Y0MA 2V9VA 1K78B 3L7WA 4KT5C 4WXCA 2X4HA 3T5XA 5ILSA 1BIBA 3M7GA 4LMYA 3S2WA 2VONA 2MLKA 1HKTA 5HLIA 4R79A 2F5EA 3LQQA 4CYDA 1LDKB 2XUBA 5ILUA 3DP7A 5CVJA 2PBIA 5EEGA 2MH9A 4KFCA 2RVCA 4LD5A 1R36A 5L3CA 4M9ZA 3M9AA 4M73A 2L3DA 2HDCA 3FXUA 2Z9OA 1LVAA 3BZ6A 1O3RA 2DPUA 2IVMA 5DYMA 5BPIA 2QBYA 1JHFA 2ZNYA 4EVIA 1U5TA 2PMHA 3I64A 3DFGA 2OQGA 2P7CB 4EJWA 4KNYA 3B73A 3EYIA 3FF5A 3E3VA 2KKOA 3L09A 5FLXZ 1IAWA 3T0YA 3RJPA 1I27A 4UV8A 5ERIA 4IXAA 2X0LA 4O3MA 2W84A 4LG0A 2QQBA 3L00A 2PFBA 4Y15A 4MEYF 4EGZA 1YW7A 1UCRA 1QQIA 3F21A 5LHGA 5F64A 1TW2A 4UVBA 1G3TA 4MEXF 4G6DA 3P9KA 4R8HA 2HKOA 2RC4A 1W7PB 4HQMA 5A2QK 3D0SA 1ZG1A 2CGPA 2M1BA 3IC7A 2EFWA 2A68F 2BYVE 4ZZDA 2ZXJA 1XMKA 3FXRA 5D8LB 3WTXC 5TJJA 3HYIA 3GWZA 5D4RA 2Q0OA 5EEHA 1P4AA 2K7LA 1LB2A 2P8TA 1EH6A 4WCGA 1W7PD 1QO0D 4HX8A 4IJAA 1FYKA 1BOAA 2XROA 2DT5A 4KA4A 2DK5A 2VOPA 3HIFA 3COAC 3J81K 4YFNF 2EJRA 4G94A 2VBWA 2HWVA 3DXJF 1T38A 5BOXA 1LEBA 2VT3A 3HTSB 5AONA 5LRRA 1IUYA 3HRSA 3KZYA 1YTYA 1L3LA 1MZBA 2YX4A 1XD7A 3AAFA 1ZRDA 2DO7A 2VOOA 3I59B 4A0XA 4ZYDA 2V1XA 2D45A 2GWRA 3FMQA 5CVUA 4XLNF 4GGGA 3LWFA 2Y48A 5CVIA 4L0YB 2NRAC 3CO7C 1OYYA 1BBYA 3F6VA 1YS7A 1FY7A 4OIOF 2EFOA 2OAZA 5LBQA 5K5RA 3P7NA 3KLOA 3ZMTA 4L9VA 3F8BA 1OPCA 3G73A 2O8XA 4L18B 5E1ZB 5IT9K 1R5GA 2FA5A 1B4AA 5LEKA 2NNYA 1O3SA 1BIAA 2P7VB 1IXSB 2H94A 2QQAA 2KJBA 4XSZF 2P5KA 3RKWA 2GXBA 1SD5A 3BPXA 3I58A 3MQ0A 2GXGA 2PQ8A 4GXOA 1PDNC 1ZREA 2QLZA 3KP7A 3CUOA 4OU0A 3WE3A 2QM3A 3EETA 4L5IA 4HF0A 4BH9A 1YIOA 2ESNA 2XAQA 2M30A 1WSUA 2VBZA 4IHTA 4HDUA 2M87A 4BQAA 1BI1A 4PGGA 5L3EA 4RGXA 2IJLA 3M1EA 2DBBA 3IL2A 4HZFA 2ZBKA 1J0RA 3WGIA 3ULQB 5DCFA 4HAMA 2FEZA 1YQAA 4RB2C 4BHPA 2EFNA 2M45A 4I0AA 2GAUA 4LGWA 1I5ZA 2A6EF 1XGNA 1P4WA 4BXUA 4WXDA 2QUFA 2RQPA 2JTVA 5AIQA 5LGNA 4RS8A 2LKPA 4R1HA 3JW4A 3ZN1A 3WGHA 1OMIA 4RGSA 3VEPA 5JHUA 5HVQC 2FU4A 2V6CA 4HV5A 4U0YA 5HDNA 2L54A 2A61A 1U5TC 5TRDA 1UHMA 1KA8A 3ZPLA 4WXHA 2TDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWZ A;  3RTR A;  3M8E A;  1Z9C A;  2FML A;  3T8T A;  3WTU C;  1FSH A;  5ICG A;  4U88 A;  2PN6 A;  4HF1 A;  5K5Q A;  3ABT A;  4M72 A;  2QEN A;  4G6Q A;  1RUN A;  4G7H F;  2AS5 F;  4KIF A;  3QU3 A;  3REO A;  2OU2 A;  3PQJ A;  1ZGJ A;  1MKM A;  4OIR F;  3ISP A;  2FNA A;  4Q47 A;  3JTG A;  3R61 A;  3RYR A;  5E17 F;  4I09 A;  2EFQ A;  1GXP A;  3F3X A;  3E6B A;  4HBL A;  3T8R A;  3FWE A;  3ROU A;  3EQL F;  4I98 B;  2KRF A;  2DLL A;  2FBI A;  3MZH A;  5BMZ A;  1Z7U A;  3I53 A;  2W24 A;  1Z6T A;  2PI0 A;  4KYW A;  5L3F A;  2V1D A;  2FMY A;  3M8F A;  5ED4 A;  3FZV A;  4UHT A;  2CO5 A;  1B6A A;  2DTR A;  2FE3 A;  4NQW A;  4ENJ A;  3NRV A;  4ESF A;  3F8F A;  1J75 A;  5HDK A;  3MFK A;  3LQR A;  4FHT A;  1YG2 A;  5JFR A;  3V8L A;  3IKV A;  2IA2 A;  2VE8 A;  1UFM A;  2VBY A;  4LJZ F;  3MAJ A;  4IPA A;  2HGC A;  3I59 A;  3U9G A;  3I54 A;  2HTS A;  4QLC U;  1K6O A;  5FB2 A;  1HW5 A;  1KU3 A;  3R4K A;  3WTZ A;  3N4M A;  5BQT A;  1P4X A;  1GXQ A;  3GUD A;  2HR3 A;  1IRF A;  1FOK A;  4NHJ A;  4CO8 A;  5FD6 A;  4YIF A;  3QPT A;  3WOD F;  3VOE A;  4WF2 A;  2RGV A;  3KP2 A;  3TQN A;  4Y13 A;  1O7F A;  2E7X A;  4OIQ F;  1D8K A;  2WTE A;  1JHH A;  5DDG A;  1HBX G;  3IRQ A;  5H6R A;  2BEO A;  4M9X A;  2CWE A;  2K02 A;  3KCC A;  1QZZ A;  1OKR A;  3JSO A;  1SD7 A;  3LAJ A;  3FMS A;  3KEQ A;  2L4A A;  3J7A O;  1IXC A;  4HOB A;  2OBP A;  3FHZ A;  1OYI A;  2FF4 A;  2P5V A;  2W57 A;  3MWM A;  4BHB A;  5E1X A;  1G3S A;  3CUQ A;  2EFP A;  4ON0 A;  3HSF A;  2CSO A;  5CJ9 A;  1ZG3 A;  3IRR A;  2HEO A;  2UWM A;  1T2K A;  4BYY A;  4PGH A;  5FO5 A;  3SZP A;  3RI4 A;  3QRF F;  3H3Z A;  2FRH A;  5DCM B;  1R5H A;  2O61 A;  2PLY A;  3SZT A;  1FBS A;  2BE5 F;  1SFU A;  5BS6 A;  4M6Y A;  3JSP A;  3BJ6 A;  3O6B B;  5HS7 A;  1R58 A;  1NHA A;  4ZH4 F;  1S7O A;  4WWC A;  4YFX F;  1S3J A;  4OIP F;  2Z3Y A;  3FXQ A;  1L0O C;  3BJO A;  4OMZ A;  4Q4Z F;  4JBA A;  5KVR A;  4RB0 A;  1A04 A;  1MGT A;  4BHC A;  3DV8 A;  1J5Y A;  1BI0 A;  2NAZ A;  3QP5 A;  3NQO A;  1QBJ A;  2O03 A;  1FYM A;  2ETH A;  3WTW C;  2HZT A;  4P9F A;  1KQ9 A;  1U2W A;  2H27 A;  4CHU A;  4YG2 F;  2H6C A;  3HOS A;  3J80 K;  4YFK F;  4L9J A;  4S05 A;  2R7F A;  2MH2 A;  4U0W A;  2HKX A;  4M6X A;  4A0Y A;  5E20 A;  2NS0 A;  3DEU A;  3D5L A;  3GXO A;  4K2E A;  2KIF A;  4LLG F;  3BOQ A;  2F5D A;  2ELH A;  1TLH B;  3T1B A;  1HQC A;  1H9G A;  2WV0 A;  4EJO A;  1USS A;  4AWX B;  1IW7 F;  1BC8 C;  3H92 A;  2YU3 A;  1R1T A;  2XKP A;  2XAG A;  4AIJ A;  4HV6 A;  3IWZ A;  1MJA A;  3GYH X;  3R60 A;  3QU6 A;  2EA2 A;  4M9S A;  2PG4 A;  3RPQ A;  4KIG A;  3P9I A;  4FT8 A;  1O3Q A;  3IHU A;  3GZ5 A;  1ZGA A;  3TDU C;  3MCZ A;  1W4M A;  3BWG A;  4L9N A;  2HS5 A;  1T39 A;  2VXZ A;  3FM3 A;  3HOT A;  3ABU A;  1KU9 A;  2RNJ A;  4A2U A;  2OA4 A;  4AIK A;  2Q8K A;  1TBX A;  2ISY A;  4M74 A;  2RV8 A;  4ZYG A;  1C0W A;  4G7O F;  3HRT A;  3QP6 A;  1G4D A;  4Z2Y A;  2KIM A;  1F5T A;  1SMY F;  1Z05 A;  1SD4 A;  2K27 A;  3ECO A;  2BGC A;  1CGP A;  3C1D A;  2E1C A;  3K0L A;  3KP5 A;  2QQ9 A;  1E17 A;  5A2Q Z;  4EM1 A;  1ZYR F;  5D5U B;  3HSE A;  3F23 A;  3SQN A;  3DPL C;  1PUE E;  3ML6 A;  1FP1 D;  2XAH A;  3J80 Z;  3TKY A;  4EM2 A;  1J9I A;  2XV4 S;  3WE2 A;  3ELK A;  1U6G A;  4KMU X;  2HQN A;  4PCQ A;  5LEJ A;  4CXF A;  2QYO A;  1IN4 A;  4GYI A;  2CYY A;  4A0Z A;  1S7A A;  1XGO A;  3KEO A;  5LRS A;  3CUQ B;  3C3W A;  4CZZ A;  4HYE A;  2DQR A;  1FX7 A;  5D5X B;  1KU2 A;  4MQ9 F;  1FLI A;  4RB1 A;  3O2P E;  2ZNZ A;  3GLX A;  2RKH A;  2IA1 A;  3J81 Z;  3HHH A;  5DV5 A;  1ZG5 A;  4RAZ A;  1RZ4 A;  1HSJ A;  3ZMS A;  5D6E A;  2FBK A;  1F4K A;  4MTE A;  3P9C A;  5DCM A;  2HQR A;  5ICF A;  1TTY A;  1TQI A;  2XIG A;  4BAY A;  1ODD A;  3F22 A;  1DDN A;  3CUQ C;  1B9N A;  3I71 A;  5LGU A;  5E18 F;  2D2W A;  5D6F A;  5LHI A;  3Q9V A;  1K7A A;  2STT A;  1XSD A;  1RNL A;  3FM5 A;  1ZH5 A;  3SFZ A;  4RGR A;  2IA0 A;  1D8J A;  4HLY A;  2ADU A;  5FFZ A;  2AXL A;  2PJP A;  3GO5 A;  2JSC A;  4P55 A;  3E5U A;  2A07 F;  2OZU A;  1YO5 C;  1ZN2 A;  4L5J A;  1T0F A;  4RGU A;  2P6S A;  3JAM K;  4UUV A;  4Y17 A;  2DW4 A;  4I02 A;  4F7Z A;  1O7L A;  2VC0 A;  2E7W A;  2Y75 A;  2Z33 A;  5IT9 Z;  4KUM A;  4ZYH A;  1D3Y A;  1LEA A;  2M5W A;  4UVC A;  1PP7 U;  3HRM A;  2R3S A;  4S04 A;  2D1V A;  3O3K A;  2NNN A;  1DUX C;  5HDG A;  2BV6 A;  4ENK A;  2MLG A;  2GA2 A;  3WTT C;  4IVN A;  5J8C A;  4FX0 A;  3ERE D;  3F72 A;  5CVR A;  1AWC A;  3Q9S A;  3GX4 X;  1BI2 A;  2K86 A;  1U3E M;  2FSW A;  3WG9 A;  1S8N A;  5F1R A;  1KQ8 A;  5LLQ A;  4OOI A;  1MDM B;  3TGN A;  3F6O A;  3HHG A;  1IN5 A;  1MJ9 A;  2WC2 A;  1K79 A;  4AD9 A;  2YPR A;  1J2X A;  2FBH A;  4EJT A;  1S29 A;  2ACJ A;  4ZYE A;  1HST A;  3TO9 A;  2JZY A;  4YII A;  2WWY A;  3KZZ A;  1XCB A;  1ZAO A;  2VOD A;  4LB5 A;  4D0P A;  2GQQ A;  4ESJ A;  4EMS A;  5CVV A;  3BY6 A;  3BRO A;  5D5W B;  2Z5U A;  4Q48 A;  4U7B A;  1KYW A;  1KGS A;  4BNC A;  1STZ A;  4MGR A;  3E6C C;  2O3F A;  1XDU A;  1XGM A;  2P5L C;  2LF8 A;  3W6K B;  4HX7 A;  4ZZL A;  3KE2 A;  3ZMD A;  4ENM A;  4FX4 A;  3R0A A;  1R1V A;  2D1H A;  3ZQ7 A;  1SMT A;  2IT0 A;  3ZMV A;  2VE9 A;  2H6B A;  5J6X A;  4GO1 A;  2V79 A;  1UB9 A;  2YR2 A;  3HTU A;  4P5O A;  2IW5 A;  1FYL A;  5E8G A;  1IN6 A;  1WWX A;  5KK1 A;  1D5V A;  3LST A;  3CDH A;  2J5P A;  5BPD A;  5FFX A;  1ZRC A;  3DF8 A;  3EYY A;  3QPH A;  4G8X A;  2CFX A;  1I1G A;  3PQK A;  3OV8 A;  4LK0 F;  3RDI A;  1IN8 A;  1B1B A;  2W85 A;  1KQ0 A;  3GVA A;  1IXR C;  3E5X A;  1SAX A;  5DD8 A;  3GFJ A;  3JTH A;  4H0E A;  3TO6 A;  3G3Z A;  1OR7 A;  2Q2E A;  1FSE A;  4DQ2 A;  4DNC A;  5DEQ A;  2G7U A;  3LFK A;  5F6F A;  2P6T A;  3RIR A;  1XGS A;  5LGT A;  1J7K A;  1MJB A;  4UXN A;  5FGM A;  2ZKZ A;  2VN2 A;  1JE8 A;  3WU0 A;  1EH7 A;  3KP6 A;  4IRH A;  3SXY A;  3K1P A;  1V3F A;  4AVP A;  2HOE A;  1FBQ A;  3BPV A;  1RIO H;  1W5S A;  2EV6 A;  2A6H F;  3QOP A;  3R6S A;  2DU9 A;  3I5U A;  2QVO A;  3WTY C;  3QAH A;  4XBF A;  4OIN F;  4JK1 X;  1IF1 A;  1YYV A;  4HLX A;  5CLS A;  2JT1 A;  2LNB A;  5HLG A;  4RAY A;  3IWF A;  4XLP F;  1DPU A;  2A3S A;  4HQE A;  2A5Y B;  1XDS A;  4UNO A;  3MEX A;  1RI7 A;  2UZK A;  5IT3 A;  4LLN A;  3MZY A;  3E6M A;  2STW A;  4IRG A;  3V4G A;  4EM0 B;  1Z91 A;  4I2O A;  4CGZ A;  1ON2 A;  2W25 A;  1R00 A;  2ZJ2 A;  1LDD A;  1U8R A;  4A6E A;  1G3W A;  2QZ8 A;  5DUI A;  1LNW A;  5DUK A;  3GFI A;  2K4B A;  3VOD A;  5ICE A;  3EUH A;  1DPR A;  4A12 A;  3R0J A;  5D4S A;  2XRN A;  4O6J A;  2ISZ A;  2OD5 A;  2PMU A;  4UVA A;  5D8K B;  1E2X A;  1TNT A;  4E70 A;  3CO6 C;  1OYW A;  2LF7 A;  4I7H A;  1LDJ A;  2RN7 A;  4RB3 C;  4GCV A;  1S6L A;  4HF2 A;  4WX9 A;  4HDV A;  1UST A;  4KIB A;  3L9F A;  1R1U A;  1QPM A;  1HW2 A;  1EH8 A;  1P2F A;  1ONV A;  1JGS A;  2CW0 F;  2XKO A;  4LFU A;  3TOA A;  1U78 A;  4Q5S F;  5D5V B;  4EJV A;  3RPU A;  1MDM A;  4L0Z B;  5JVT A;  3U1D A;  2Z99 A;  4M71 A;  2CG4 A;  4JQF A;  2XHK A;  1XCV A;  1FT9 A;  1FNN A;  1Q1H A;  4KN4 X;  1XSV A;  2XGX A;  4O5V A;  5E8I A;  4P96 A;  4ESB A;  2J5O A;  2YSR A;  1KYZ A;  1IZ1 A;  3CJN A;  5CYV A;  1F1Z A;  1HKQ A;  1TNS A;  2VC1 A;  1R7J A;  3K1M A;  1YW8 A;  4U0V A;  2M8E A;  3WTS C;  3W6J B;  2O6G E;  3LA2 A;  1IN7 A;  4L9T A;  4B09 A;  4XRF A;  2YX7 A;  2UXX A;  5L3D A;  3GZ6 A;  3KP3 A;  3V7S A;  4ASN A;  2F5F A;  3F8M A;  3RKX A;  1V4R A;  4OMY A;  1VTN C;  5HS8 A;  1R22 A;  1SFX A;  1BI3 A;  3FX3 A;  1FP2 A;  2G7H A;  3V7C A;  2ZME A;  2XVC A;  2MA3 A;  1CF7 B;  1TW3 A;  2FNP A;  4QWQ A;  2H09 A;  4I0B A;  4HA8 A;  1I1S A;  1QGP A;  4GYG A;  3Q5F A;  1FZP B;  3KET A;  1FPQ A;  5J8F A;  3F8N A;  5JR3 A;  3V7R A;  1XB4 A;  3RYP A;  4G9Y A;  2E1N A;  3GW2 A;  3TOB A;  1G6N A;  4N9I A;  2DFI A;  3HRU A;  3F8C A;  4EJU A;  2F2E A;  1P92 A;  1WRJ A;  2OZ6 A;  4CIC A;  1ON1 A;  5K5O A;  3K2Z A;  1Y0U A;  1B59 A;  1HXD A;  3HSR A;  1J59 A;  2XAF A;  2EB7 A;  3SHF A;  2EWN A;  1K78 A;  2EK5 A;  3TO7 A;  4KIC A;  1GVJ A;  3ZMU A;  2JPC A;  1TQP A;  1RUO A;  1ZLJ A;  3LA3 A;  3ZP5 A;  1AOY A;  2FXA A;  2MC3 A;  1DP7 P;  1MD0 A;  1WKM A;  3L2C A;  3ZN0 A;  2ESH A;  1YS6 A;  2EV0 A;  1I6X A;  2XAJ A;  4XSX F;  2KJC A;  5HOO A;  4P9U A;  1ZHF A;  2DI3 A;  1ZAR A;  1IRG A;  2L01 A;  1HW1 A;  3BJA A;  2QWW A;  2L4M A;  2ZFW A;  1FBU A;  2NYX A;  1BJA A;  2QBY B;  1PP8 F;  4G7Z F;  3VB2 A;  2GIV A;  3GEZ A;  3ZMZ A;  1U5T B;  3NEU A;  2EA4 A;  2EV5 A;  3K69 A;  4LLL A;  4EGY A;  2K4J A;  2R7D A;  1G3Y A;  3LAP A;  2VBX A;  3WU1 B;  2JPB A;  1BN5 A;  5L3B A;  5H20 A;  3H3U A;  1R23 A;  1Z6R A;  4U7D A;  2HYG D;  4LG0 B;  4LK1 F;  4EQQ A;  2GA1 A;  1YFH A;  3IKT A;  3GF2 A;  2DK8 A;  4MHG A;  4KMF A;  2IP2 A;  2GZW A;  2FQ3 A;  3KFW X;  4ETS A;  4EV0 A;  2HFH A;  1BC7 C;  2KIU A;  4LB6 B;  1SD6 A;  1QNT A;  2HYF A;  2JRT A;  3I0T A;  2V1U A;  5DD4 A;  4B8X A;  5HS9 A;  2C6Y A;  1REP C;  1JXS A;  1T98 A;  1W7P A;  1XSX A;  4I01 A;  3BP8 A;  2OQR A;  1WI9 A;  2FOK A;  1O3T A;  4PZJ A;  2VT2 A;  1ZLK A;  3HUG A;  3GFL A;  4TV7 A;  5FD5 A;  1KU7 A;  2LSO A;  3WGG A;  4MNU A;  3N97 A;  4IHS A;  2DPD A;  2ZCW A;  3DKW A;  3U2R A;  5L3G A;  1UHW A;  4A5M A;  2DQL A;  3KP4 A;  2A69 F;  3V8J A;  1LQ1 A;  2MBF A;  2UXN A;  1ZRF A;  3GFM A;  5E1W A;  2P4W A;  3C7J A;  1ULY A;  3B02 A;  1SFE A;  5AIP A;  3VFZ A;  2COM A;  6PAX A;  3C18 A;  2IRF G;  4MQV A;  3FMR A;  1Z1D A;  4A5N A;  3I4P A;  1T6S A;  3K1N A;  4HX4 A;  1H9T A;  4IF4 A;  1LJ9 A;  5LHH A;  3LA7 A;  1GHC A;  2ZO4 A;  1O57 A;  3E6D A;  1BM9 A;  2F5C A;  3TDZ C;  2MD5 A;  1H0M A;  5HLH A;  4PDK A;  2B0L A;  3ECH A;  1HKS A;  1XN7 A;  2O0Y A;  4MTD A;  4NB5 A;  4N9H A;  4UV9 A;  3E97 A;  3KLN A;  3BDD A;  2RDP A;  3V8K A;  3WTV C;  3K9T A;  4A6D A;  1EV7 A;  2PEX A;  1TQM A;  4WK8 F;  4HW0 A;  3JAM Z;  2L02 A;  3DPT A;  2ZME B;  1FC3 A;  3CLO A;  1XMA A;  3CTA A;  1YLF A;  1QZY A;  2G9W A;  4KN7 X;  2DAO A;  3OOP A;  2HTJ A;  3DQV C;  5JI6 A;  3E5Q A;  4ENN A;  1CF7 A;  1W5T A;  3RKY A;  5FLX K;  4AIH A;  1P6R A;  2LDU A;  4KDP A;  5H6Q A;  1WQ2 A;  5ILV A;  1YW9 A;  1B9M A;  2BBY A;  4CDG A;  1X3U A;  5K1Y A;  2IPQ X;  4IRI A;  4N0B A;  3PFI A;  2CQK A;  5ICC A;  3EDP A;  1F9N A;  2XAS A;  2Y0M A;  2V9V A;  1K78 B;  3L7W A;  4KT5 C;  4WXC A;  2X4H A;  3T5X A;  5ILS A;  1BIB A;  3M7G A;  4LMY A;  3S2W A;  2VON A;  2MLK A;  1HKT A;  5HLI A;  4R79 A;  2F5E A;  3LQQ A;  4CYD A;  1LDK B;  2XUB A;  5ILU A;  3DP7 A;  5CVJ A;  2PBI A;  5EEG A;  2MH9 A;  4KFC A;  2RVC A;  4LD5 A;  1R36 A;  5L3C A;  4M9Z A;  3M9A A;  4M73 A;  2L3D A;  2HDC A;  3FXU A;  2Z9O A;  1LVA A;  3BZ6 A;  1O3R A;  2DPU A;  2IVM A;  5DYM A;  5BPI A;  2QBY A;  1JHF A;  2ZNY A;  4EVI A;  1U5T A;  2PMH A;  3I64 A;  3DFG A;  2OQG A;  2P7C B;  4EJW A;  4KNY A;  3B73 A;  3EYI A;  3FF5 A;  3E3V A;  2KKO A;  3L09 A;  5FLX Z;  1IAW A;  3T0Y A;  3RJP A;  1I27 A;  4UV8 A;  5ERI A;  4IXA A;  2X0L A;  4O3M A;  2W84 A;  4LG0 A;  2QQB A;  3L00 A;  2PFB A;  4Y15 A;  4MEY F;  4EGZ A;  1YW7 A;  1UCR A;  1QQI A;  3F21 A;  5LHG A;  5F64 A;  1TW2 A;  4UVB A;  1G3T A;  4MEX F;  4G6D A;  3P9K A;  4R8H A;  2HKO A;  2RC4 A;  1W7P B;  4HQM A;  5A2Q K;  3D0S A;  1ZG1 A;  2CGP A;  2M1B A;  3IC7 A;  2EFW A;  2A68 F;  2BYV E;  4ZZD A;  2ZXJ A;  1XMK A;  3FXR A;  5D8L B;  3WTX C;  5TJJ A;  3HYI A;  3GWZ A;  5D4R A;  2Q0O A;  5EEH A;  1P4A A;  2K7L A;  1LB2 A;  2P8T A;  1EH6 A;  4WCG A;  1W7P D;  1QO0 D;  4HX8 A;  4IJA A;  1FYK A;  1BOA A;  2XRO A;  2DT5 A;  4KA4 A;  2DK5 A;  2VOP A;  3HIF A;  3COA C;  3J81 K;  4YFN F;  2EJR A;  4G94 A;  2VBW A;  2HWV A;  3DXJ F;  1T38 A;  5BOX A;  1LEB A;  2VT3 A;  3HTS B;  5AON A;  5LRR A;  1IUY A;  3HRS A;  3KZY A;  1YTY A;  1L3L A;  1MZB A;  2YX4 A;  1XD7 A;  3AAF A;  1ZRD A;  2DO7 A;  2VOO A;  3I59 B;  4A0X A;  4ZYD A;  2V1X A;  2D45 A;  2GWR A;  3FMQ A;  5CVU A;  4XLN F;  4GGG A;  3LWF A;  2Y48 A;  5CVI A;  4L0Y B;  2NRA C;  3CO7 C;  1OYY A;  1BBY A;  3F6V A;  1YS7 A;  1FY7 A;  4OIO F;  2EFO A;  2OAZ A;  5LBQ A;  5K5R A;  3P7N A;  3KLO A;  3ZMT A;  4L9V A;  3F8B A;  1OPC A;  3G73 A;  2O8X A;  4L18 B;  5E1Z B;  5IT9 K;  1R5G A;  2FA5 A;  1B4A A;  5LEK A;  2NNY A;  1O3S A;  1BIA A;  2P7V B;  1IXS B;  2H94 A;  2QQA A;  2KJB A;  4XSZ F;  2P5K A;  3RKW A;  2GXB A;  1SD5 A;  3BPX A;  3I58 A;  3MQ0 A;  2GXG A;  2PQ8 A;  4GXO A;  1PDN C;  1ZRE A;  2QLZ A;  3KP7 A;  3CUO A;  4OU0 A;  3WE3 A;  2QM3 A;  3EET A;  4L5I A;  4HF0 A;  4BH9 A;  1YIO A;  2ESN A;  2XAQ A;  2M30 A;  1WSU A;  2VBZ A;  4IHT A;  4HDU A;  2M87 A;  4BQA A;  1BI1 A;  4PGG A;  5L3E A;  4RGX A;  2IJL A;  3M1E A;  2DBB A;  3IL2 A;  4HZF A;  2ZBK A;  1J0R A;  3WGI A;  3ULQ B;  5DCF A;  4HAM A;  2FEZ A;  1YQA A;  4RB2 C;  4BHP A;  2EFN A;  2M45 A;  4I0A A;  2GAU A;  4LGW A;  1I5Z A;  2A6E F;  1XGN A;  1P4W A;  4BXU A;  4WXD A;  2QUF A;  2RQP A;  2JTV A;  5AIQ A;  5LGN A;  4RS8 A;  2LKP A;  4R1H A;  3JW4 A;  3ZN1 A;  3WGH A;  1OMI A;  4RGS A;  3VEP A;  5JHU A;  5HVQ C;  2FU4 A;  2V6C A;  4HV5 A;  4U0Y A;  5HDN A;  2L54 A;  2A61 A;  1U5T C;  5TRD A;  1UHM A;  1KA8 A;  3ZPL A;  4WXH A;  2TDX A; 
#chains in the Genus database with same CATH topology
 2VKV A;  1FWZ A;  3ZQC A;  3RTR A;  3H3V K;  3DBL B;  3M8E A;  1Z9C A;  2FML A;  3T8T A;  3B6C A;  3WTU C;  1FSH A;  5ICG A;  4U88 A;  5F04 A;  3S2H J;  2PN6 A;  3BR3 A;  4HF1 A;  5K5Q A;  3ABT A;  3LL7 A;  5JLW A;  3TL4 X;  1FOW A;  3MD2 A;  4CCL A;  4M72 A;  2LFB A;  1R9T J;  3I55 I;  5IPA A;  2QEN A;  4G6Q A;  1RUN A;  4G7H F;  2AS5 F;  4KIF A;  3QU3 A;  2HOA A;  3REO A;  2OU2 A;  3PQJ A;  1X2M A;  1ZGJ A;  2DOE A;  2JRM A;  1MKM A;  4M3F A;  4OIR F;  2LYC A;  4C30 A;  3ISP A;  2FNA A;  4Q47 A;  3JTG A;  2ZC2 A;  3R61 A;  3RYR A;  1RC9 A;  2EIN H;  5E17 F;  4I09 A;  2EFQ A;  2Y69 H;  1VQ7 I;  1GXP A;  2GBY A;  2HNH A;  3UR3 C;  3F3X A;  2Y31 A;  1D1B A;  3E6B A;  2R7T A;  4HBL A;  3T8R A;  2K3P A;  1N25 A;  4Z6Y A;  3CCM I;  3O8G A;  5HLT A;  3FWE A;  3ROU A;  1ETK A;  3EQL F;  4I98 B;  2KRF A;  3WG7 H;  2MD0 A;  2DLL A;  4JOM A;  3I56 I;  4J01 A;  1MBE A;  2FBI A;  3OYB A;  3MZH A;  5BMZ A;  2VQC A;  5J1U A;  3OL4 A;  3CCQ I;  2VQG A;  2XGC A;  1Z7U A;  3RPU D;  4JP0 A;  4F91 B;  3I53 A;  3G1L A;  2W24 A;  4UUS A;  1Z6T A;  2PI0 A;  4KYW A;  5L3F A;  4ANJ A;  2HVS A;  2V1D A;  1Y0N A;  2FMY A;  4UY8 I;  2EZK A;  2M4G A;  1NG7 A;  1X58 A;  1GV5 A;  3CCY A;  3M8F A;  3HKZ N;  5ED4 A;  4Y4R A;  3FZV A;  4UHT A;  2CO5 A;  2L7M P;  1XX5 A;  1B6A A;  3FBN B;  2DTR A;  2FE3 A;  2ZXW H;  4NQW A;  4ENJ A;  3NRV A;  3VWB A;  3TED A;  4BU2 A;  4OAY A;  4ESF A;  3F8F A;  1J75 A;  5HDK A;  1GVD A;  1WFX A;  3LQR A;  4FHT A;  1YG2 A;  5EF6 A;  3MFK A;  5JFR A;  3V8L A;  3IKV A;  2IA2 A;  2VE8 A;  1UFM A;  2VBY A;  4BEH B;  3W2A A;  1X19 A;  4LJZ F;  3A4C A;  2M7B A;  2HYJ A;  3MAJ A;  2Z16 A;  4IPA A;  5M5X J;  2JWT A;  4ZDP A;  1WCM J;  2CV0 A;  2HGC A;  2R7U A;  3I59 A;  3U9G A;  1MBK A;  3K2A A;  5JVG F;  3S16 J;  3I54 A;  2WAE A;  3W2V A;  4F52 A;  2HTS A;  2EZL A;  5IP7 J;  3JRA A;  4QLC U;  1K6O A;  5FB2 A;  1HW5 A;  1KU3 A;  2BXY A;  1OCC H;  2LP0 A;  2NVY J;  3KYC B;  3R4K A;  1FEX A;  3WTZ A;  2E19 A;  3N4M A;  5BQT A;  1P4X A;  1GXQ A;  1P7J A;  3GUD A;  2HR3 A;  4XKC A;  1YOV B;  1IRF A;  1FOK A;  3CCS I;  3S15 J;  2BY0 A;  4XKB A;  4NHJ A;  2EBI A;  4AM3 A;  2XSJ C;  4D5C A;  1FTZ A;  2BW3 A;  4CO8 A;  3HB9 A;  3IH2 A;  4YIF A;  4C3H J;  5FD6 A;  5GPA A;  3QPT A;  3WOD F;  1Z7L A;  3VOE A;  4WF2 A;  1PUF B;  2NVT J;  4BL0 B;  2RGV A;  3KP2 A;  3TQN A;  4Y13 A;  1HLV A;  2X6X A;  3FKJ A;  1O7F A;  2E7X A;  3PO2 J;  2ZME C;  1T56 A;  1ZK8 A;  4OIQ F;  2X6O A;  1D8K A;  4NDL A;  1OLT A;  2W48 A;  3CQZ J;  1QU3 A;  2WTE A;  1JHH A;  5DDG A;  1HBX G;  1VF9 A;  3IRQ A;  5H6R A;  4ZYA A;  2BEO A;  4M9X A;  4IHX A;  2CWE A;  2K02 A;  3KCC A;  1QZZ A;  3JRG A;  1OKR A;  3JSO A;  1XG1 A;  3OL3 A;  1SD7 A;  3LAJ A;  3FMS A;  1ZTR A;  1V55 H;  3KEQ A;  2LBF B;  1WVR A;  3OIQ A;  4B3X A;  2L4A A;  3BR0 A;  3J7A O;  1IXC A;  1Y8R B;  4HOB A;  2OBP A;  1WGX A;  3FHZ A;  2WB1 N;  1OYI A;  2FF4 A;  2BY3 A;  2NVU B;  1IRX A;  3A01 A;  2P5V A;  1AHD P;  2W57 A;  2CQ7 A;  3MWM A;  1QVU A;  4BHB A;  1W5C C;  5E1X A;  4H4K C;  2LR8 A;  3OIO A;  1G3S A;  3CUQ A;  2EFP A;  4ON0 A;  3HSF A;  2CSO A;  2JUC A;  5CJ9 A;  1ZG3 A;  4V2G A;  3IRR A;  2HEO A;  2UWM A;  3HPG A;  1T2K A;  4F93 B;  3CDL A;  4YIR X;  5M5Y J;  3A1Y A;  1U0J A;  4BYY A;  4PGH A;  5FO5 A;  5F1J A;  3GLL A;  5IYC J;  3SZP A;  4NUB A;  3RI4 A;  3QRF F;  1GV2 A;  3H3Z A;  2MSY A;  2E71 A;  2FRH A;  4QPQ A;  5DCM B;  1X1A A;  5LFA A;  5C3E J;  2LK2 A;  1R5H A;  4B4C A;  1WHU A;  2O9L A;  2O61 A;  3NWT A;  1WJA A;  2M34 A;  1KZH A;  4E4H A;  2PLY A;  4BDY A;  2WAF A;  3SZT A;  1FBS A;  2X6Y A;  1A5J A;  5KHD A;  2IGK A;  2DDB A;  2HXO A;  3CD6 I;  3PL8 A;  2BE5 F;  5FKN A;  1SFU A;  5BS6 A;  3SEZ A;  4M6Y A;  3JSP A;  3OYD A;  3ZQI A;  3BJ6 A;  3O6B B;  5HS7 A;  4II3 A;  3HKZ A;  2A6T A;  1R58 A;  3HBL A;  4DIQ A;  1K61 A;  1E3O C;  1NHA A;  2FJ1 A;  4ZH4 F;  3H9J A;  5K7Z A;  1O4X A;  3S2D J;  1S7O A;  3LSH A;  3CCR I;  2ID6 A;  5J1R A;  2MG4 A;  2VL8 A;  3EPZ A;  4WWC A;  4YFX F;  4X1E A;  5CQG A;  1S3J A;  4YEL A;  1W0U A;  4LIT A;  3C2H A;  4OIP F;  2Z3Y A;  3FXQ A;  1L0O C;  2E60 A;  4RM3 A;  3OYI A;  2QSH X;  2XF7 A;  2DYR H;  3BJO A;  1WH7 A;  4OMZ A;  5GAH J;  4Q4Z F;  4JBA A;  5KVR A;  1LFB A;  4RB0 A;  3QQA A;  2XRL A;  1A04 A;  2KRH A;  1MGT A;  4HG2 A;  4BHC A;  1S9H A;  3DV8 A;  1J5Y A;  4PJJ A;  1BI0 A;  3UNG C;  4D5F A;  3GTJ J;  3WHC A;  2QKM B;  2W1O A;  3B6A A;  3BR2 A;  2NAZ A;  5EZH A;  1IG7 A;  3QP5 A;  3NQO A;  1RES A;  3RKQ A;  4A3B J;  1QBJ A;  2O03 A;  1FYM A;  2G0E A;  3FXO A;  3AFH A;  2ETH A;  3ABM H;  2H1L A;  3PUB A;  4C3J J;  1LFU P;  3WTW C;  4DBQ A;  1FJL A;  1MBJ A;  2HZT A;  2Y0S N;  2W82 A;  4P9F A;  1AU7 A;  1PVE A;  1I50 J;  4BQO A;  2ME0 A;  4LIU A;  2DA4 A;  4JX5 A;  3BCB A;  4IOC F;  4A3F J;  1KQ9 A;  1U2W A;  2H27 A;  4XN0 A;  4CHU A;  1MMD A;  3IV5 A;  2ZSI B;  4YG2 F;  3JRE A;  2D5V A;  2L0K A;  2RNG A;  2H6C A;  2DA5 A;  2AXT C;  2XAU A;  2K9N A;  2KMU A;  3J80 K;  4G6T B;  4YFK F;  3HOS A;  4L9J A;  2BVL A;  5CKT A;  4BBS J;  2XGD A;  4S05 A;  3J7Z I;  2R7F A;  2AQE A;  5F0C A;  1VI0 A;  2MH2 A;  4U0W A;  2HKX A;  4BY7 J;  5EJC A;  2L2O A;  3M8J A;  5EG0 B;  2LC2 A;  4M6X A;  4A0Y A;  1ZGW A;  5E20 A;  4X6A J;  2NS0 A;  3DEU A;  3D5L A;  3GXO A;  3KYL A;  1QRY A;  4K2E A;  4CZC A;  2KIF A;  4LLG F;  4XQF A;  2BHY A;  1WPK A;  3H9G A;  2L9S A;  3BOQ A;  2F5D A;  2ELH A;  1TLH B;  4QTR A;  3T1B A;  1HQC A;  3HOU J;  1H9G A;  3S14 J;  2WV0 A;  4RLQ A;  5E79 C;  2VJJ A;  4W97 A;  4EJO A;  3VSK A;  1USS A;  1LVK A;  3BR1 A;  2YU9 J;  4AWX B;  1VQ6 I;  1IW7 F;  1BC8 C;  3H92 A;  4UUS B;  2YU3 A;  1R1T A;  2XKP A;  2XAG A;  3ASO H;  3LSR A;  4AIJ A;  4HV6 A;  3IWZ A;  1MJA A;  3H35 A;  3GYH X;  3R60 A;  2O8K A;  3QU6 A;  3V42 A;  4F3Q A;  2EA2 A;  4M9S A;  3UKG A;  2PG4 A;  3F0C A;  1DQU A;  3RPQ A;  2HQ5 A;  4KIG A;  3P9I A;  4FT8 A;  2LY2 A;  1O3Q A;  2P0W A;  3IHU A;  3GZ5 A;  4FET A;  3OY9 A;  4BDZ A;  1ZGA A;  3TDU C;  1EJ9 A;  3MCZ A;  3FKI J;  3G4S I;  3KYD B;  1W4M A;  3SZG A;  3BWG A;  4L9N A;  2KFD A;  2HS5 A;  4BEH A;  1T39 A;  1X1C A;  2VXZ A;  3FM3 A;  3S3N A;  3HOT A;  1YJW I;  3ABU A;  1IO2 A;  1KU9 A;  4BJT A;  4BUP A;  1JKO C;  2RNJ A;  1QHH D;  2ICW G;  1BW6 A;  4A2U A;  2I10 A;  1X2N A;  2OA4 A;  4AIK A;  1JKP C;  2Q8K A;  2CV1 A;  5J47 A;  2PX9 A;  1T08 B;  1TBX A;  2ISY A;  3D5S C;  4M74 A;  2RV8 A;  4IEJ A;  4ZYG A;  1C0W A;  4G7O F;  3HRT A;  3QP6 A;  1G4D A;  3W6V A;  4A3J J;  4Z2Y A;  4XL9 A;  3S1Q J;  4CCJ A;  1IRZ A;  2L7Z A;  2BW3 B;  1A31 A;  2KIM A;  1YJN I;  1F5T A;  1SMY F;  1Z05 A;  2W7N A;  1SD4 A;  2K27 A;  3ECO A;  2BGC A;  3PNV A;  1CGP A;  1Z0X A;  2DFF A;  3C1D A;  1TWG J;  1HF0 A;  1R49 A;  2E1C A;  3K0L A;  3KP5 A;  2QQ9 A;  2WV1 A;  1D5Y A;  1E17 A;  5A2Q Z;  2IEK A;  4EM1 A;  1UEL B;  3L2Q A;  1ZYR F;  5D5U B;  3ERM A;  3LFU A;  3GTM J;  3HSE A;  4MLO A;  4AU7 A;  3F23 A;  4XN3 A;  2CQQ A;  3SQN A;  3DPL C;  1D0X A;  2OC6 A;  1PUE E;  3ML6 A;  2K3F A;  2QSF X;  1FP1 D;  2MYS A;  2XAH A;  3J80 Z;  3TKY A;  2H8W A;  2E1M B;  3CF5 F;  4EM2 A;  1J9I A;  2XV4 S;  1ERD A;  3AL0 B;  5C4X J;  2LY9 A;  2M4K A;  3WE2 A;  2LBF A;  3ELK A;  2BVM A;  1A35 A;  3LSM A;  1U6G A;  4KMU X;  3VYU B;  2HQN A;  4PCQ A;  3BG5 A;  3FBI B;  2W4S A;  4DJA A;  5LEJ A;  4CXF A;  3M4O J;  1H88 C;  2X1E A;  4AVZ A;  2QYO A;  1IN4 A;  2RRE A;  4GYI A;  4ZDL A;  2Q2E B;  2CYY A;  4A0Z A;  2X85 A;  3OYC A;  2Y9Y A;  1S7A A;  1XGO A;  3KEO A;  5LRS A;  3CUQ B;  4KT6 A;  3S1N J;  2CW7 A;  3C3W A;  2OV7 A;  4HYE A;  4CZZ A;  2DQR A;  4C2U A;  4B1R A;  1FX7 A;  2KDO A;  5D5X B;  1KU2 A;  4MIM A;  4MQ9 F;  1FLI A;  4RB1 A;  2XF6 A;  4BXF A;  3O2P E;  2ZNZ A;  1IC8 A;  1RET A;  2E2H J;  3GLX A;  5K7F A;  1SVL A;  4NC7 A;  1PJR A;  3QYB A;  2RKH A;  2IA1 A;  3DLL F;  3J81 Z;  3HHH A;  3BTC A;  1ETV A;  1RKT A;  5DV5 A;  1ZG5 A;  4D7N A;  4RAZ A;  3H5R A;  1RZ4 A;  3AKZ A;  5F08 A;  1HSJ A;  3ZMS A;  5D6E A;  3HL2 A;  1NG6 A;  1VZ0 A;  3AL0 C;  1IV8 A;  2F6C A;  2FBK A;  1JKQ C;  1F4K A;  4MTE A;  3K4K A;  5IP9 J;  2KRC A;  3P9C A;  1W1W E;  5DCM A;  2HQR A;  5ICF A;  1TTY A;  5KAI C;  5FKM A;  1TQI A;  2XIG A;  4C2M J;  2R7R A;  1MBH A;  4BAY A;  1ODD A;  3F22 A;  1DDN A;  3FIW A;  2V6E A;  3AG4 H;  3CUQ C;  1B9N A;  3U21 A;  3I71 A;  5LGU A;  4CUG A;  2ECC A;  2ZSH B;  3MZ8 A;  1Z3X A;  4PJN A;  5E18 F;  2D2W A;  5D6F A;  5LHI A;  3OYM A;  3Q9V A;  1S72 I;  1K7A A;  2STT A;  1UZC A;  1XSD A;  1RNL A;  3S8P A;  3FM5 A;  1ZH5 A;  3BZC A;  3SFZ A;  1BOB A;  2WA0 A;  4RGR A;  2IA0 A;  1D8J A;  1S7E A;  4HLY A;  3ZQF A;  2ADU A;  3BQZ A;  5HNH A;  3L2R A;  5FFZ A;  1Z3Y A;  1IDY A;  2AXL A;  4M6V A;  2PJP A;  1UHS A;  1RPW A;  2KHM A;  3GO5 A;  2JSC A;  4P55 A;  3E5U A;  2A07 F;  3RZO J;  2OZU A;  2N8G A;  1YHQ I;  3GBG A;  1YO5 C;  1ZN2 A;  4L5J A;  1XC5 A;  1T0F A;  3CDI A;  4RGU A;  2F48 A;  3FXL A;  2P6S A;  3JAM K;  4UUV A;  4Y17 A;  4EAT A;  2DW4 A;  2DMU A;  4BE0 A;  2AHQ A;  4OAZ A;  1GDT A;  4I02 A;  4F7Z A;  3E1S A;  1O7L A;  2VC0 A;  5F0F A;  2E7W A;  2KIS A;  2Y75 A;  2Z33 A;  5IT9 Z;  3BLY A;  1ITY A;  2DFE A;  2HXI A;  1K6Y A;  4KUM A;  4FAS D;  4ZYH A;  1ETX A;  1D3Y A;  1LEA A;  2M5W A;  5J1Y A;  4UVC A;  2VKE A;  1PP7 U;  5E3O A;  2IAI A;  3HRM A;  3CCJ I;  3RZD J;  1IJW C;  3DKY A;  2R3S A;  4S04 A;  2D1V A;  3O3K A;  2NNN A;  3PFY A;  1DUX C;  1UG0 A;  4X0G A;  2R7S A;  4CCM A;  5HDG A;  2BV6 A;  4ENK A;  2R7X A;  3H9Q A;  2MLG A;  1WH5 A;  2GA2 A;  1OJL A;  2M0M A;  4E7S A;  4IVN A;  3WTT C;  5FRO A;  1TWA J;  4QPO A;  5J8C A;  4FX0 A;  4RAF A;  3ERE D;  3F72 A;  2WY7 Q;  5CVR A;  1AWC A;  3OYA A;  3Q9S A;  2E2J J;  2DXI A;  2XB5 A;  4XK4 A;  3GX4 X;  1BI2 A;  4PFP A;  2VI6 A;  2Q1Z B;  2K86 A;  2K9M A;  1U3E M;  5EG0 A;  4E7J A;  1P7I A;  3OR2 C;  2FSW A;  3WG9 A;  1TWF J;  1S8N A;  5EEA A;  4L5E A;  5F1R A;  1KQ8 A;  1IGN A;  1DP3 A;  5LLQ A;  4OOI A;  4A3C J;  1MDM B;  3TGN A;  3F6O A;  3HHG A;  1IN5 A;  2L5Q A;  2X1C A;  1MJ9 A;  2WC2 A;  1K79 A;  2R5Z B;  4OWR B;  4AD9 A;  1U9N A;  2JA2 A;  2YUS A;  2R5Y B;  2YPR A;  1J2X A;  2FBH A;  4EJT A;  1V54 H;  1S29 A;  2ACJ A;  5EDN A;  2IS6 A;  1K83 J;  4CCK A;  4ZYE A;  4AYB N;  2GIZ A;  1HST A;  3TO9 A;  4XLA A;  2JA5 J;  1JTX A;  1WJF A;  2JZY A;  3DTE A;  1K4T A;  4YII A;  2WWY A;  2E34 A;  2OPT A;  3KZZ A;  1P9Q C;  1XCB A;  1ZAO A;  2VOD A;  4LB5 A;  4W1U A;  2WAD A;  1OQY A;  4D0P A;  2GQQ A;  5M5W J;  2V9K A;  4ESJ A;  4EMS A;  1LUJ B;  3VDX A;  5CVV A;  3BY6 A;  1Y1W J;  2E5Z A;  1DU6 A;  3BRO A;  5D5W B;  2Z5U A;  4Q48 A;  1KYW A;  4U7B A;  2B7E A;  2VKD A;  1KGS A;  4DW6 A;  4BNC A;  1MMN A;  1STZ A;  4MGR A;  3S3M A;  2MFZ A;  3E6C C;  2R0Q C;  2VXD A;  2VJ4 A;  2O3F A;  1XDU A;  3QPL A;  1NTC A;  1XGM A;  2P5L C;  2OTL I;  2LF8 A;  2MW8 A;  4PUS A;  3W6K B;  3JR9 A;  2OF7 A;  4HX7 A;  4CSW A;  4ZZL A;  3LSJ A;  3KE2 A;  3ZMD A;  4ENM A;  2Y2Z A;  4FX4 A;  3L2W A;  1HOM A;  3R0A A;  9ANT A;  1Y8Q B;  1R1V A;  2D1H A;  4ZC3 A;  3ZQ7 A;  1SMT A;  2K5C A;  2WY8 Q;  1QA6 A;  2IT0 A;  2JA6 J;  4EEF G;  4RDU A;  2DA6 A;  3ZMV A;  2VE9 A;  3BC8 A;  3OWT A;  4A93 J;  2H6B A;  1A6I A;  3TW7 A;  5J6X A;  4J19 A;  4GO1 A;  3TP3 A;  2V79 A;  3KEY A;  1UB9 A;  2YR2 A;  3HTU A;  4P5O A;  3BG9 A;  2VUM J;  1YX5 A;  1N75 A;  2IW5 A;  2L7K A;  2OCE A;  1FYL A;  4DBR A;  1JJ6 C;  3ZXS A;  1K4S A;  5E8G A;  1IN6 A;  1WWX A;  2A05 A;  5KK1 A;  1APL C;  1NK3 P;  3I4M J;  1D5V A;  1T8I A;  3LST A;  3CDH A;  2J5P A;  5BPD A;  3JRF A;  5FFX A;  1ZRC A;  3DF8 A;  3Q3S A;  3EYY A;  3QPH A;  3SYT A;  4G8X A;  2CFX A;  4BKX A;  1I1G A;  2VPR A;  3PQK A;  3OV8 A;  2E2I J;  4LK0 F;  3RDI A;  1IN8 A;  2EQR A;  3A0H C;  3CLQ A;  1B1B A;  2W85 A;  3CCV I;  3BT9 A;  2IGN A;  2KDZ A;  4UB8 C;  1KQ0 A;  3GVA A;  1IXR C;  3E5X A;  1OCO H;  1SAX A;  5DD8 A;  4HNV A;  4A3D J;  3GFJ A;  1XMX A;  3JTH A;  3PUF A;  4M3E A;  4FE7 A;  4H0E A;  3TO6 A;  2EIL H;  2BY1 A;  3G3Z A;  1OR7 A;  2Q2E A;  1FSE A;  3DTK A;  4DQ2 A;  4DNC A;  5DEQ A;  2G7U A;  3CP8 A;  3LFK A;  2B63 J;  5F6F A;  2P6T A;  3RIR A;  1XGS A;  3CME I;  4IHW A;  5LGT A;  4PJL A;  5TIS C;  1J7K A;  1MJB A;  1MMS A;  4UXN A;  2QSG X;  5FGM A;  2ZKZ A;  5GTH C;  2VN2 A;  2YS9 A;  4YEJ A;  1JE8 A;  4U87 A;  1WJE A;  3WU0 A;  2NVX J;  1SEU A;  1EH7 A;  2BY2 A;  4IQ4 A;  5EGO B;  3KP6 A;  2GOM A;  4IRH A;  3G1M A;  3P5J A;  3SXY A;  2VAS A;  3K1P A;  5IOZ A;  1V3F A;  1JT0 A;  3L1P A;  4AVP A;  1AA7 A;  2HOE A;  3K4M A;  1FBQ A;  3BPV A;  3ZOB A;  1TL8 A;  2IS1 A;  1RIO H;  1W5S A;  2EV6 A;  2A6H F;  3QOP A;  3OSG A;  3R6S A;  4XRS A;  2JQ7 A;  2DU9 A;  1R4M B;  4AYB A;  3I5U A;  3OYE A;  1AKH B;  1ZQ3 P;  2QVO A;  3WTY C;  2EZH A;  3QAH A;  3CCU I;  4XBF A;  1EA3 A;  4OIN F;  2HQA A;  4JK1 X;  1IF1 A;  1YYV A;  4HLX A;  1JKR C;  5CLS A;  2OCC H;  3FK7 A;  4XM3 A;  2JT1 A;  2LNB A;  3DCF A;  4RAY A;  5HLG A;  3IWF A;  1H89 C;  4XLP F;  1RR8 C;  2HDD A;  1DPU A;  2A3S A;  1LPQ A;  1ETY A;  1I6H J;  3IAS 2;  4HQE A;  1FOX A;  2A5Y B;  2OJE D;  1Q1V A;  1XDS A;  3E7L A;  4UNO A;  3MEX A;  3A03 A;  2DMQ A;  3L2V A;  1RI7 A;  3CF2 A;  2ME6 A;  5IT3 A;  4NC6 A;  3RQ4 A;  2UZK A;  4LLN A;  3I9V 2;  3MZY A;  1ZEL A;  4CH7 A;  3ZQG A;  4BAC A;  3E6M A;  2STW A;  3PNT A;  4IRG A;  2Y9Z A;  3HOW J;  3V4G A;  4MO7 A;  4EM0 B;  1Z91 A;  4I2O A;  4CGZ A;  1G59 A;  1ON2 A;  2F4I A;  2W25 A;  3ZGK A;  3DLA A;  1R00 A;  2NS7 A;  2ZJ2 A;  4QIW N;  1ETO A;  1LDD A;  1U8R A;  4A6E A;  1G3W A;  3E0J B;  2QZ8 A;  4ZTJ A;  3VSL A;  1LNW A;  3DU5 A;  5DUK A;  5DUI A;  3GFI A;  2K4B A;  2M3A A;  3F9K A;  5GPC A;  2LD5 A;  3GME A;  3H1C A;  3GZN B;  3VOD A;  5ICE A;  1DGR M;  3BG7 A;  3A2K A;  4MFD A;  2DA7 A;  3LSP A;  5EYR A;  2CQX A;  3EUH A;  1DPR A;  2VIX A;  4A12 A;  2R7Q A;  1X4P A;  4LOC A;  3R0J A;  2XRN A;  5D4S A;  4Y7N J;  4M3G A;  4O6J A;  2OD5 A;  2PMU A;  2ISZ A;  1KON A;  4UVA A;  5D8K B;  1E2X A;  1TNT A;  2CMP A;  2R7V A;  1ENH A;  4E70 A;  1VQ9 I;  3CO6 C;  2X48 A;  1OYW A;  1G8X A;  2LF7 A;  4I7H A;  1JUM A;  1LDJ A;  3AG3 H;  2RN7 A;  4RB3 C;  1U9O A;  2R7W A;  1T0F C;  4XOT A;  4GCV A;  1S6L A;  2V7F A;  4HF2 A;  2QGU A;  4WX9 A;  4HDV A;  1Y39 A;  1XS9 A;  2QF7 A;  1UST A;  3Q0U A;  2VQL A;  4KIB A;  4A3L J;  3L9F A;  1R1U A;  3NAR A;  4D1Q A;  3CC7 I;  2M9H A;  1QPM A;  5E3M A;  1HW2 A;  2DCE A;  1MBG A;  1EH8 A;  1OCT C;  1P2F A;  3G1O A;  1UJ8 A;  1E3P A;  3ZQL A;  4GDF A;  1ONV A;  5GAE J;  5GAD J;  4A3G J;  2WBM A;  3QYE A;  3WHB A;  4BQN A;  4IKF A;  1JGS A;  2CW0 F;  3PM1 A;  2XKO A;  5IYD J;  4LFU A;  3TOA A;  1U78 A;  3FXJ A;  4Q5S F;  5D5V B;  4EJV A;  3RPU A;  4HEA 2;  3HGG A;  2NS8 A;  1MDM A;  3QOD A;  4L0Z B;  2BHZ A;  1TZL A;  2VLA A;  3I4N J;  5JVT A;  2QA4 I;  2R5Z A;  2R5Y A;  3J7Y J;  3U1D A;  1MMG A;  2Z99 A;  4M71 A;  2XB0 X;  5M3M J;  2CG4 A;  2JN6 A;  4JQF A;  2XHK A;  4I76 A;  4CA0 A;  4XID A;  1VQM I;  1XCV A;  2MGQ A;  2E36 A;  1FT9 A;  3NAU A;  1X1P A;  1FNN A;  3KPH A;  1Q1H A;  1X1D A;  4KN4 X;  1XSV A;  2XGX A;  4O5V A;  5E8I A;  1RRJ A;  1H0M A;  2DN0 A;  4P96 A;  4LIV A;  4XNF A;  4ESB A;  1WJ5 A;  2J5O A;  3EUK L;  2YSR A;  4AID A;  1KYZ A;  2VKH A;  1IZ1 A;  2E1O A;  5B66 C;  3GCM A;  3CJN A;  2R4G A;  4A3E J;  5CYV A;  1F1Z A;  1HKQ A;  1TNS A;  2VC1 A;  4UB6 C;  2FD5 A;  1R7J A;  1OFC X;  3BTJ A;  1LE8 B;  3K1M A;  2BXZ A;  1Z21 A;  4PFO A;  4KIS A;  1YW8 A;  2HU9 A;  5C4J J;  4U0V A;  2M8E A;  4N4O B;  3WTS C;  3KZI C;  3W6J B;  3M1C A;  2K40 A;  2O6G E;  3LA2 A;  1IN7 A;  4L9T A;  4B09 A;  1N77 A;  4XRF A;  3K6G A;  2YX7 A;  1V5F A;  2UXX A;  4HRI A;  5L3D A;  1S5L C;  3GZ6 A;  4Y3O A;  2R93 J;  2X1D A;  2W00 A;  4LG3 A;  3BR6 A;  3KP3 A;  3V7S A;  2JMW A;  4ASN A;  2XC7 A;  1D1A A;  2DDA A;  4V19 K;  4BQQ A;  3ASN H;  2F5F A;  3F8M A;  3RKX A;  1V4R A;  4OMY A;  3C2B A;  1VTN C;  1YIT I;  5HS8 A;  1R22 A;  4MFE A;  4V2F A;  1SFX A;  5FKO A;  1BI3 A;  1T95 A;  3G6E I;  3FX3 A;  1FP2 A;  5GTI C;  2TRT A;  3AG2 H;  4XLF A;  2KP6 A;  1T33 A;  2H8R A;  1FIP A;  2G7H A;  3V7C A;  2ZME A;  1A6Q A;  2XVC A;  1BA5 A;  2NXN B;  2MA3 A;  1CF7 B;  1TW3 A;  3VYT B;  2FNP A;  4QWQ A;  2H09 A;  1PYV A;  3ABL H;  1UAA A;  2X9D A;  4I0B A;  4HA8 A;  4AUX A;  1I1S A;  4RBO A;  3QOE A;  2KLO A;  1IV6 A;  3MKY B;  1QGP A;  4GYG A;  1LFP A;  4IZZ A;  2EIJ H;  3Q5F A;  1FZP B;  3CJQ B;  3KET A;  1FPQ A;  4QSH A;  3DWL E;  3CC4 I;  5J8F A;  2KPM A;  2ZXI A;  2TCT A;  3F8N A;  5JR3 A;  3V7R A;  3OYN A;  1XB4 A;  3RYP A;  4G9Y A;  1H8A C;  1R6R A;  1VFC A;  5B1A H;  2AO9 A;  2E1N A;  3GW2 A;  3TOB A;  2HI3 A;  1G6N A;  4N9I A;  2DFI A;  3HRU A;  3F8C A;  4EJU A;  2F2E A;  1FMV A;  1TC3 C;  1P92 A;  1POG A;  1WRJ A;  2OZ6 A;  4CIC A;  5B3S H;  1VQ5 I;  3OSF A;  2LY1 A;  2KZG A;  4E6K G;  2CH0 A;  1VQ4 I;  5HOD A;  3KX2 A;  1ON1 A;  4XR6 A;  5K5O A;  3K2Z A;  2NOG A;  1Y0U A;  1B59 A;  3M3Y J;  1V5G A;  3W2W A;  2ZJQ F;  4ZDO A;  1HXD A;  3HSR A;  4BJ5 C;  1J59 A;  3GTO J;  2XAF A;  2EB7 A;  1J09 A;  3MN2 A;  3SHF A;  2EWN A;  3LOC A;  1K78 A;  3G71 I;  1TP4 A;  2OTJ I;  2EK5 A;  4N4N B;  5BNG A;  2LH9 A;  4PSW A;  4KIC A;  3TO7 A;  3JRD A;  1GVJ A;  3ZMU A;  2JPC A;  3MKZ A;  3IUO A;  2CJJ A;  4KJZ A;  3HOV J;  3H0G J;  1TQP A;  4YRV A;  1RUO A;  3H36 A;  1SFK A;  2E1M C;  2E35 A;  1ZLJ A;  3LA3 A;  4KIT B;  1ZR2 A;  3ZP5 A;  3PO3 J;  2FXA A;  2MC3 A;  2QCO A;  2V1N A;  1AOY A;  1DP7 P;  2FQ4 A;  1MD0 A;  1WKM A;  4P1W A;  5EGO A;  3ZN0 A;  2ESH A;  3L2C A;  1YS6 A;  2EIM H;  5IP6 A;  1I3A A;  2EV0 A;  4II2 A;  1OR7 C;  1I6X A;  3ESW B;  2XAJ A;  2COB A;  2ELJ A;  4XSX F;  2KJC A;  1X1B A;  5HOO A;  1TWH J;  3MKW B;  4P9U A;  1ZHF A;  2DI3 A;  5K7H A;  1VQN I;  1ZAR A;  1IRG A;  2L01 A;  3VYR B;  3Q0V A;  1B8I B;  1HW1 A;  3BJA A;  1AKH A;  2LKS A;  4IO9 F;  3K4C A;  4E7K A;  3ONQ A;  2QWW A;  3BTI A;  3LSI A;  4E7H A;  2L4M A;  2ZFW A;  2DA1 A;  3DKX A;  1FBU A;  4DZJ A;  3I3L A;  2NYX A;  1BJA A;  2QBY B;  5KNL A;  4HNT A;  1W36 D;  1PP8 F;  2Z1D A;  4G7Z F;  3VB2 A;  3OS1 A;  2GIV A;  2WAQ N;  3GEZ A;  1W36 C;  3ZMZ A;  1U5T B;  3NEU A;  1TWC J;  3FDY A;  2EA4 A;  2JJ7 A;  2EV5 A;  3K69 A;  3OOU A;  4XKW A;  3IH3 A;  4LLL A;  4EGY A;  2K4J A;  2R7D A;  1G3Y A;  5DM7 F;  3LAP A;  4DOZ A;  2EPF A;  1YRN B;  2HOS A;  2VBX A;  2F4M B;  1SAU A;  2K85 A;  4DZP A;  1NH3 A;  3BR5 A;  3WU1 B;  2JPB A;  2DT6 A;  2RAE A;  1BN5 A;  5L3B A;  2K9Q A;  5H20 A;  3H3U A;  2HVR A;  5M3F J;  1R23 A;  3OIP A;  3HJE A;  1Z6R A;  1JUP A;  4U7D A;  2HYG D;  4LG0 B;  4LK1 F;  4EQQ A;  2GA1 A;  3U1K A;  1YFH A;  5EZG A;  2HVQ A;  4FQG A;  3IKT A;  3GF2 A;  2DK8 A;  3DTI A;  4MHG A;  3K4B A;  4KMF A;  5E3N A;  3S93 A;  1MW7 A;  3VYS B;  2IP2 A;  2GZW A;  2FQ3 A;  3KFW X;  1BR4 A;  3CJR B;  4ETS A;  4EV0 A;  4XIC A;  2HFH A;  3L2U A;  1B72 B;  1E0E A;  1BC7 C;  2DMT A;  2LTP A;  2KIU A;  4LB6 B;  1MBF A;  1SD6 A;  2FX0 A;  4Y52 J;  1QNT A;  2HYF A;  2JRT A;  3I0T A;  4GRI A;  5FKL A;  3ZRG A;  2V1U A;  5DD4 A;  5JHF A;  2QQ8 A;  3AG1 H;  1MSE C;  4B8X A;  5HS9 A;  2DOA A;  3ZR8 X;  1D0Y A;  2EIK H;  2K9L A;  2C6Y A;  3JRC A;  1REP C;  1JXS A;  1T98 A;  1DU0 A;  3FXM A;  4C2T A;  1W7P A;  1XSX A;  3A0B C;  4G12 A;  4I01 A;  3BP8 A;  3OYJ A;  2OQR A;  1WI9 A;  2FOK A;  4HPQ A;  3LSG A;  1O3T A;  4PZJ A;  2VT2 A;  3HDD A;  1ZLK A;  4DGW B;  3HUG A;  3CJT B;  3EUH C;  3GFL A;  4TV7 A;  5FD5 A;  4E7I A;  2PJR A;  1KU7 A;  2LSO A;  3WGG A;  2DMN A;  4MNU A;  3N97 A;  1YI2 I;  5FLV A;  4IHS A;  2DPD A;  2ZCW A;  3DKW A;  3U2R A;  1M1E B;  1LKX A;  2BOL A;  5L3G A;  1UHW A;  2XGE A;  4A5M A;  2DQL A;  4JX6 A;  2DOF A;  2RQQ A;  2M8G X;  3KP4 A;  2A69 F;  3PSI A;  2ELK A;  3V8J A;  1LQ1 A;  2MBF A;  2UXN A;  1ZRF A;  3KIO A;  1MH4 A;  3GFM A;  5E1W A;  1ZR4 A;  2P4W A;  3C7J A;  3OYL A;  1ULY A;  3B02 A;  4E7Z A;  1SFE A;  2IS4 A;  2VJI A;  1TT5 B;  5AIP A;  1MH3 A;  5DTD A;  3VFZ A;  2COM A;  6PAX A;  2DA2 A;  1W0T A;  3C18 A;  1VQL I;  1HCR A;  2IRF G;  1JTY A;  4MQV A;  3FMR A;  2IXS A;  1Z1D A;  4A5N A;  3I4P A;  1T6S A;  4BY1 J;  3K1N A;  3LSK A;  4A69 C;  4HX4 A;  1H9T A;  4IF4 A;  3CCL I;  2PMZ N;  4B3A A;  1LJ9 A;  5LHH A;  2H1K A;  3GTL J;  3LA7 A;  1GHC A;  2DFH A;  1ETQ A;  1O57 A;  2ZO4 A;  3ABK H;  1OCZ H;  1R4N B;  2GLO A;  3E6D A;  3WU2 C;  3A02 A;  1BM9 A;  2F5C A;  3TDZ C;  4RLF A;  1LE8 A;  1FTT A;  2MD5 A;  3EUA A;  4PDK A;  1FOY A;  2B0L A;  2HPI A;  3ECH A;  5JLX A;  5HLH A;  1HKS A;  4PJ0 C;  1FMW A;  1XN7 A;  2O0Y A;  4MTD A;  1OCR H;  3S1M J;  4NB5 A;  3HZJ A;  4N9H A;  2ID3 A;  4UV9 A;  3E97 A;  3SEQ A;  3KLN A;  1OCP A;  3BDD A;  3SJM A;  4FCY A;  2RDP A;  3V8K A;  3WTV C;  3K9T A;  4A6D A;  1EV7 A;  2PEX A;  1TQM A;  4WK8 F;  3OS2 A;  4HW0 A;  2V9P A;  3JAM Z;  2ZJR F;  1HDP A;  2L02 A;  3DPT A;  2ZME B;  1FC3 A;  3CLO A;  2DJI A;  2WAQ A;  1EKE A;  1XMA A;  3S32 A;  3CTA A;  1YLF A;  5DM6 F;  1QZY A;  2G9W A;  4KN7 X;  2DAO A;  2KT0 A;  3OOP A;  1SVM A;  1V5E A;  2HTJ A;  1WJD A;  3DQV C;  3E5Q A;  2JVH A;  5JI6 A;  4ENN A;  1CF7 A;  3H5N A;  4NNJ A;  1W5T A;  3RKY A;  5FLX K;  3ZCO A;  4AIH A;  2NVQ J;  1P6R A;  4E7L A;  2EZI A;  3GTG J;  2LDU A;  4KDP A;  1IDZ A;  2O7O A;  5H6Q A;  3K4N A;  3H5A A;  4RMN A;  5CQE A;  2JUG A;  1WQ2 A;  5J3L A;  3SDB A;  2DT7 B;  1VND A;  5ILV A;  1JUS A;  4F55 A;  2R7O A;  3X2Q H;  1YW9 A;  1B9M A;  2BBY A;  4A3K J;  1OIS A;  4CDG A;  2XF5 A;  2NOJ B;  3OS0 A;  1I39 A;  3RQI A;  1X3U A;  5K1Y A;  1EF4 A;  2IPQ X;  3TMO A;  2OUM A;  4IRI A;  4N0B A;  3DEW A;  3PFI A;  2LMD A;  5LD2 C;  1G2H A;  5DS9 A;  2CQK A;  5ICC A;  3EDP A;  1MNE A;  3FXK A;  1F9N A;  2CW8 A;  2XDV A;  2Y30 A;  2XAS A;  2Y0M A;  2CV2 A;  1BR2 A;  2EH3 A;  3CC2 I;  2V9V A;  1K78 B;  3L7W A;  2XPW A;  3MVP A;  4KT5 C;  2I8D A;  4WXC A;  2X4H A;  1Y1V J;  3PIP F;  4BE1 A;  2LOO A;  3T5X A;  5ILS A;  1BIB A;  3M7G A;  2CUF A;  2LKX A;  4LMY A;  3D5R C;  3S2W A;  2VON A;  4BBR J;  4UUT A;  2P81 A;  1BW5 A;  2HPM A;  2MLK A;  3BTL A;  2L9R A;  1HKT A;  5HLI A;  1D1C A;  4R79 A;  2E5N A;  3CP2 A;  2F5E A;  4BS9 A;  1MND A;  3LQQ A;  1LDK B;  2UUZ A;  4CYD A;  1X3Z B;  2XUB A;  3TW6 A;  4B48 A;  3CMY A;  3PJR A;  3S1R J;  3LMM A;  1ACI A;  2DA3 A;  3S3O A;  5ILU A;  3DP7 A;  5CVJ A;  4CYC B;  2JK3 A;  2PBI A;  3BQY A;  5EEG A;  2IBD A;  4XLC A;  2MH9 A;  4KFC A;  1BR1 A;  4IHY A;  2RVC A;  4LD5 A;  1R36 A;  5L3C A;  4M9Z A;  1QHG A;  3SDG A;  3M9A A;  4M73 A;  2L3D A;  2HDC A;  1R5I D;  1B8I A;  3FXU A;  4PJM A;  3HXL A;  2Z9O A;  3CCE I;  4IHV A;  1LVA A;  4XRM A;  3BZ6 A;  2DTZ A;  1O3R A;  2DPU A;  2PMZ A;  2IVM A;  1YIJ I;  1YE9 A;  5DYM A;  5BPI A;  2QBY A;  2VPL A;  1JHF A;  2V4J C;  2XPU A;  1IUF A;  2ZNY A;  4EVI A;  1U5T A;  2PMH A;  5FJ8 J;  3I64 A;  3DFG A;  2OQG A;  3JCU C;  2LG4 A;  3HGY A;  2KZV A;  3HEF A;  2P7C B;  3DBH B;  2LRE A;  4EJW A;  4KNY A;  1YRN A;  4C3I J;  1JGG A;  3B73 A;  3BG3 A;  2CUZ A;  5CPR B;  4XON A;  4DYR A;  3FF5 A;  4RAG A;  1GT0 C;  3EYI A;  4XOP A;  1Z67 A;  3E3V A;  4M3D A;  2KKO A;  4GFB A;  3DBR B;  3L09 A;  5FLX Z;  1IAW A;  3T0Y A;  3QYF A;  3RJP A;  3JRH A;  1I27 A;  3M07 A;  4UV8 A;  5ERI A;  4IXA A;  2X0L A;  3K4L A;  5TGT A;  4O3M A;  1JI8 A;  2W84 A;  4LG0 A;  4BGD A;  2QQB A;  3L00 A;  2PFB A;  2DJN A;  1N78 A;  2B9S A;  2QEX I;  5FLM J;  4Y15 A;  4MEY F;  4EGZ A;  1E3H A;  4CCN A;  4RA2 A;  1YW7 A;  1UCR A;  1QQI A;  3QPS A;  3F21 A;  3CMM A;  5LHG A;  1B72 A;  1SC7 A;  1YJ9 I;  3FHN A;  5F64 A;  1F43 A;  1TW2 A;  4UVB A;  3BG6 A;  1G3T A;  1VQP I;  4MEX F;  4HST A;  4G6D A;  2VJ5 A;  1GUU A;  3OYK A;  5KAF C;  5B5E C;  3P9K A;  4R8H A;  2HKO A;  3OYH A;  2RC4 A;  4IOA F;  1W7P B;  4HQM A;  5A2Q K;  3D0S A;  1ZG1 A;  2CGP A;  2M1B A;  3J7A Y;  1ZKG A;  3HUG B;  3IC7 A;  2PJR B;  1WI3 A;  1QZE A;  4DYC A;  2EFW A;  2A68 F;  2BYV E;  4ZZD A;  2DYS H;  3W3C A;  2ZXJ A;  4A3M J;  2CUJ A;  1MNM C;  5J4Y A;  2JA7 J;  1XMK A;  3FXR A;  1XTA A;  1BL0 A;  1VQO I;  5D8L B;  3WTX C;  3H0D A;  1A36 A;  3RSN A;  5TJJ A;  3JRI A;  3HYI A;  3GWZ A;  5D4R A;  2CU7 A;  2R92 J;  2Q0O A;  3O8H A;  2V26 A;  4I99 C;  5EEH A;  1QPI A;  2LRD A;  3JRB A;  3OR1 C;  1MSF C;  2MAB A;  4FE4 A;  3VPR A;  4ABZ A;  1P4A A;  2K7L A;  1LB2 A;  3BZK A;  2P8T A;  1EH6 A;  4WCG A;  2AQF A;  2M2E A;  2GXA A;  1I3Q J;  5HNF A;  2WB1 A;  1W7P D;  1QO0 D;  4XMY A;  4HX8 A;  4IJA A;  1MIJ A;  1FYK A;  4RM2 A;  1FIA A;  1RKW A;  2L7F P;  2BZT A;  1BOA A;  2XRO A;  2DT5 A;  4KA4 A;  4DYQ A;  3HOX J;  2DK5 A;  5J40 A;  3DEE A;  2L9N A;  2VOP A;  3HIF A;  4IL6 C;  3COA C;  3J81 K;  4IQJ A;  4YFN F;  2EJR A;  4G94 A;  2VBW A;  3GTQ J;  4BJ6 C;  3TP0 A;  5FRN A;  5H2F C;  2HWV A;  2KIQ A;  1BJZ A;  2HZD A;  4NQW B;  2F5V A;  3DXJ F;  1SAN A;  1T38 A;  4IX7 A;  3IP4 B;  5IYB J;  4D9J A;  5BOX A;  4PSX A;  1LEB A;  2VT3 A;  3HTS B;  3HOY J;  5AON A;  1NK2 P;  5LRR A;  1IUY A;  2ECB A;  2ZB9 A;  3HRS A;  3KZY A;  1YTY A;  3NWS A;  1UMQ A;  1CQT A;  1L3L A;  1MZB A;  2YX4 A;  5GP9 A;  1XD7 A;  2M7A A;  2CS3 A;  3AAF A;  1ZRD A;  2A5W A;  2DO7 A;  2FUG 2;  2VOO A;  3I59 B;  4A0X A;  4ZYD A;  2L9V A;  3K4J A;  3GTK J;  1XPX A;  2V1X A;  4B44 A;  4JX4 A;  3FK6 A;  2QKL B;  5B1B H;  3G2B A;  3IAM 2;  2D45 A;  3Q0W A;  1DGW Y;  2CQN A;  2GWR A;  3FMQ A;  5CVU A;  4XLN F;  2O5R A;  1WJB A;  3LWF A;  2Y48 A;  2DMP A;  4GGG A;  5CVI A;  4L0Y B;  2CUE A;  2NRA C;  4CCO A;  4HSR A;  4XLE A;  3D1N I;  1MMA A;  2KQR A;  2FOW A;  2CFO A;  3CO7 C;  1OYY A;  5C44 J;  1HDD C;  1BBY A;  3F6V A;  1YS7 A;  1FY7 A;  1UG2 A;  4OIO F;  4FIS A;  4ITV A;  3RCO A;  2EFO A;  2OAZ A;  2MC4 A;  4C9Y A;  5LBQ A;  3PIO F;  5K5R A;  3P7N A;  2F4O B;  4J00 A;  3KLO A;  3K70 D;  2JA8 J;  3ZMT A;  3K70 C;  4L9V A;  3F8B A;  3HC7 A;  1OPC A;  4PK4 A;  3CES A;  3G73 A;  3OYF A;  2XPV A;  2O8X A;  4L18 B;  5E1Z B;  1PUF A;  5IT9 K;  1R5G A;  2FA5 A;  1HA8 A;  1ORK A;  1B4A A;  3DPU A;  5LEK A;  1SFO J;  3HOZ J;  2NNY A;  4XRS G;  1O3S A;  1BIA A;  2P7V B;  1IXS B;  5E3L A;  5FKK A;  2H94 A;  4B47 A;  1VQ8 I;  2QQA A;  2GM4 A;  3HM5 A;  4XKV A;  2HOT A;  1GLN A;  2KJB A;  4XSZ F;  2P5K A;  2Y0S A;  4XLH A;  4B43 A;  3RKW A;  2GXB A;  1SD5 A;  3BPX A;  1X3W B;  1JT6 A;  3I58 A;  3C2G A;  3K10 A;  2Z2S B;  3ZQQ A;  3MQ0 A;  1YX3 A;  1JJ8 C;  3FIS A;  5F27 A;  3A01 B;  2GXG A;  4I6Z A;  2PQ8 A;  1D0Z A;  4GXO A;  3N05 A;  2I5U A;  1PDN C;  1ZRE A;  1RR7 A;  2QLZ A;  1ETW A;  1WZ2 A;  3KP7 A;  1Z77 A;  3CUO A;  4OU0 A;  3QWL A;  3WE3 A;  2JVG A;  2X51 A;  2IGO A;  2LVS A;  2QM3 A;  3EET A;  3PNY A;  4M3B A;  1WJC A;  4L5I A;  4HF0 A;  2IGM A;  4ZTF A;  3CZ6 A;  4BH9 A;  1YIO A;  2ESN A;  1QVT A;  2HDW A;  3CMA I;  4XOR A;  3HPH A;  2XAQ A;  2R7Z J;  2M30 A;  2VQH A;  1U8B A;  3TBI A;  5J4V A;  1WSU A;  1Y6I A;  2KL4 A;  2VBZ A;  4CYC A;  5IY5 H;  4IHT A;  4HDU A;  2UV1 A;  2M87 A;  4BQA A;  1BI1 A;  2GOX B;  4PGG A;  2ZFU A;  5L3E A;  4RGX A;  5FRM A;  5F0H A;  3OYG A;  2IJL A;  3M1E A;  5KCM A;  1TT0 A;  2DBB A;  3IL2 A;  3K7A J;  3SFI A;  4HZF A;  4S0H B;  2CRG A;  2JSP A;  2ZBK A;  1J0R A;  4Y33 A;  5GAG J;  3WGI A;  3ULQ B;  1X4O A;  5DCF A;  4HAM A;  4BE2 A;  2FEZ A;  1YQA A;  4RB2 C;  4FTH A;  4BHP A;  2EFN A;  2M45 A;  2XSD C;  1VQK I;  4I0A A;  3S17 J;  3PSF A;  3GTP J;  2GAU A;  4LGW A;  4ZJZ A;  2VB6 A;  2LLK A;  1I5Z A;  2K9S A;  3MKL A;  4D7M A;  2ZXH A;  2A6E F;  1XGN A;  4NC8 A;  4AC0 A;  1P4W A;  1R71 A;  4JYK A;  2M0C A;  4BXU A;  4WXD A;  2QUF A;  4NBQ A;  5IOY A;  2RQP A;  2JTV A;  5AIQ A;  5LGN A;  4RS8 A;  2LKP A;  4R1H A;  3JW4 A;  3BCA A;  3WGH A;  3ZN1 A;  2IS2 A;  2X6W A;  1OMI A;  4RGS A;  4BXX J;  3DU6 A;  3VEP A;  5JHU A;  5HVQ C;  4A3I J;  2FU4 A;  2V6C A;  4HV5 A;  3IH4 A;  4U0Y A;  5HDN A;  2ZJP F;  1HC8 A;  2L54 A;  1Y56 A;  2A61 A;  1U5T C;  5TRD A;  1UHM A;  3MMY B;  1KA8 A;  4HNU A;  1SVO A;  3HG9 A;  3ZPL A;  4WXH A;  2DOD A;  2TDX A;  4F92 B;  3LNQ A;  3OMY A;  3ZQH A;  1F36 A; 
#chains in the Genus database with same CATH homology
 1FWZ A;  3RTR A;  3M8E A;  1Z9C A;  2FML A;  3T8T A;  3WTU C;  1FSH A;  5ICG A;  4U88 A;  2PN6 A;  4HF1 A;  5K5Q A;  3ABT A;  4M72 A;  2QEN A;  4G6Q A;  1RUN A;  4G7H F;  2AS5 F;  4KIF A;  3QU3 A;  3REO A;  2OU2 A;  3PQJ A;  1ZGJ A;  1MKM A;  4OIR F;  3ISP A;  2FNA A;  4Q47 A;  3JTG A;  3R61 A;  3RYR A;  5E17 F;  4I09 A;  2EFQ A;  1GXP A;  3F3X A;  3E6B A;  4HBL A;  3T8R A;  3FWE A;  3ROU A;  3EQL F;  4I98 B;  2KRF A;  2DLL A;  2FBI A;  3MZH A;  5BMZ A;  1Z7U A;  3I53 A;  2W24 A;  1Z6T A;  2PI0 A;  4KYW A;  5L3F A;  2V1D A;  2FMY A;  3M8F A;  5ED4 A;  3FZV A;  4UHT A;  2CO5 A;  1B6A A;  2DTR A;  2FE3 A;  4NQW A;  4ENJ A;  3NRV A;  4ESF A;  3F8F A;  1J75 A;  5HDK A;  3MFK A;  3LQR A;  4FHT A;  1YG2 A;  5JFR A;  3V8L A;  3IKV A;  2IA2 A;  2VE8 A;  1UFM A;  2VBY A;  4LJZ F;  3MAJ A;  4IPA A;  2HGC A;  3I59 A;  3U9G A;  3I54 A;  2HTS A;  4QLC U;  1K6O A;  5FB2 A;  1HW5 A;  1KU3 A;  3R4K A;  3WTZ A;  3N4M A;  5BQT A;  1P4X A;  1GXQ A;  3GUD A;  2HR3 A;  1IRF A;  1FOK A;  4NHJ A;  4CO8 A;  5FD6 A;  4YIF A;  3QPT A;  3WOD F;  3VOE A;  4WF2 A;  2RGV A;  3KP2 A;  3TQN A;  4Y13 A;  1O7F A;  2E7X A;  4OIQ F;  1D8K A;  2WTE A;  1JHH A;  5DDG A;  1HBX G;  3IRQ A;  5H6R A;  2BEO A;  4M9X A;  2CWE A;  2K02 A;  3KCC A;  1QZZ A;  1OKR A;  3JSO A;  1SD7 A;  3LAJ A;  3FMS A;  3KEQ A;  2L4A A;  3J7A O;  1IXC A;  4HOB A;  2OBP A;  3FHZ A;  1OYI A;  2FF4 A;  2P5V A;  2W57 A;  3MWM A;  4BHB A;  5E1X A;  1G3S A;  3CUQ A;  2EFP A;  4ON0 A;  3HSF A;  2CSO A;  5CJ9 A;  1ZG3 A;  3IRR A;  2HEO A;  2UWM A;  1T2K A;  4BYY A;  4PGH A;  5FO5 A;  3SZP A;  3RI4 A;  3QRF F;  3H3Z A;  2FRH A;  5DCM B;  1R5H A;  2O61 A;  2PLY A;  3SZT A;  1FBS A;  2BE5 F;  1SFU A;  5BS6 A;  4M6Y A;  3JSP A;  3BJ6 A;  3O6B B;  5HS7 A;  1R58 A;  1NHA A;  4ZH4 F;  1S7O A;  4WWC A;  4YFX F;  1S3J A;  4OIP F;  2Z3Y A;  3FXQ A;  1L0O C;  3BJO A;  4OMZ A;  4Q4Z F;  4JBA A;  5KVR A;  4RB0 A;  1A04 A;  1MGT A;  4BHC A;  3DV8 A;  1J5Y A;  1BI0 A;  2NAZ A;  3QP5 A;  3NQO A;  1QBJ A;  2O03 A;  1FYM A;  2ETH A;  3WTW C;  2HZT A;  4P9F A;  1KQ9 A;  1U2W A;  2H27 A;  4CHU A;  4YG2 F;  2H6C A;  3HOS A;  3J80 K;  4YFK F;  4L9J A;  4S05 A;  2R7F A;  2MH2 A;  4U0W A;  2HKX A;  4M6X A;  4A0Y A;  5E20 A;  2NS0 A;  3DEU A;  3D5L A;  3GXO A;  4K2E A;  2KIF A;  4LLG F;  3BOQ A;  2F5D A;  2ELH A;  1TLH B;  3T1B A;  1HQC A;  1H9G A;  2WV0 A;  4EJO A;  1USS A;  4AWX B;  1IW7 F;  1BC8 C;  3H92 A;  2YU3 A;  1R1T A;  2XKP A;  2XAG A;  4AIJ A;  4HV6 A;  3IWZ A;  1MJA A;  3GYH X;  3R60 A;  3QU6 A;  2EA2 A;  4M9S A;  2PG4 A;  3RPQ A;  4KIG A;  3P9I A;  4FT8 A;  1O3Q A;  3IHU A;  3GZ5 A;  1ZGA A;  3TDU C;  3MCZ A;  1W4M A;  3BWG A;  4L9N A;  2HS5 A;  1T39 A;  2VXZ A;  3FM3 A;  3HOT A;  3ABU A;  1KU9 A;  2RNJ A;  4A2U A;  2OA4 A;  4AIK A;  2Q8K A;  1TBX A;  2ISY A;  4M74 A;  2RV8 A;  4ZYG A;  1C0W A;  4G7O F;  3HRT A;  3QP6 A;  1G4D A;  4Z2Y A;  2KIM A;  1F5T A;  1SMY F;  1Z05 A;  1SD4 A;  2K27 A;  3ECO A;  2BGC A;  1CGP A;  3C1D A;  2E1C A;  3K0L A;  3KP5 A;  2QQ9 A;  1E17 A;  5A2Q Z;  4EM1 A;  1ZYR F;  5D5U B;  3HSE A;  3F23 A;  3SQN A;  3DPL C;  1PUE E;  3ML6 A;  1FP1 D;  2XAH A;  3J80 Z;  3TKY A;  4EM2 A;  1J9I A;  2XV4 S;  3WE2 A;  3ELK A;  1U6G A;  4KMU X;  2HQN A;  4PCQ A;  5LEJ A;  4CXF A;  2QYO A;  1IN4 A;  4GYI A;  2CYY A;  4A0Z A;  1S7A A;  1XGO A;  3KEO A;  5LRS A;  3CUQ B;  3C3W A;  4CZZ A;  4HYE A;  2DQR A;  1FX7 A;  5D5X B;  1KU2 A;  4MQ9 F;  1FLI A;  4RB1 A;  3O2P E;  2ZNZ A;  3GLX A;  2RKH A;  2IA1 A;  3J81 Z;  3HHH A;  5DV5 A;  1ZG5 A;  4RAZ A;  1RZ4 A;  1HSJ A;  3ZMS A;  5D6E A;  2FBK A;  1F4K A;  4MTE A;  3P9C A;  5DCM A;  2HQR A;  5ICF A;  1TTY A;  1TQI A;  2XIG A;  4BAY A;  1ODD A;  3F22 A;  1DDN A;  3CUQ C;  1B9N A;  3I71 A;  5LGU A;  5E18 F;  2D2W A;  5D6F A;  5LHI A;  3Q9V A;  1K7A A;  2STT A;  1XSD A;  1RNL A;  3FM5 A;  1ZH5 A;  3SFZ A;  4RGR A;  2IA0 A;  1D8J A;  4HLY A;  2ADU A;  5FFZ A;  2AXL A;  2PJP A;  3GO5 A;  2JSC A;  4P55 A;  3E5U A;  2A07 F;  2OZU A;  1YO5 C;  1ZN2 A;  4L5J A;  1T0F A;  4RGU A;  2P6S A;  3JAM K;  4UUV A;  4Y17 A;  2DW4 A;  4I02 A;  4F7Z A;  1O7L A;  2VC0 A;  2E7W A;  2Y75 A;  2Z33 A;  5IT9 Z;  4KUM A;  4ZYH A;  1D3Y A;  1LEA A;  2M5W A;  4UVC A;  1PP7 U;  3HRM A;  2R3S A;  4S04 A;  2D1V A;  3O3K A;  2NNN A;  1DUX C;  5HDG A;  2BV6 A;  4ENK A;  2MLG A;  2GA2 A;  3WTT C;  4IVN A;  5J8C A;  4FX0 A;  3ERE D;  3F72 A;  5CVR A;  1AWC A;  3Q9S A;  3GX4 X;  1BI2 A;  2K86 A;  1U3E M;  2FSW A;  3WG9 A;  1S8N A;  5F1R A;  1KQ8 A;  5LLQ A;  4OOI A;  1MDM B;  3TGN A;  3F6O A;  3HHG A;  1IN5 A;  1MJ9 A;  2WC2 A;  1K79 A;  4AD9 A;  2YPR A;  1J2X A;  2FBH A;  4EJT A;  1S29 A;  2ACJ A;  4ZYE A;  1HST A;  3TO9 A;  2JZY A;  4YII A;  2WWY A;  3KZZ A;  1XCB A;  1ZAO A;  2VOD A;  4LB5 A;  4D0P A;  2GQQ A;  4ESJ A;  4EMS A;  5CVV A;  3BY6 A;  3BRO A;  5D5W B;  2Z5U A;  4Q48 A;  4U7B A;  1KYW A;  1KGS A;  4BNC A;  1STZ A;  4MGR A;  3E6C C;  2O3F A;  1XDU A;  1XGM A;  2P5L C;  2LF8 A;  3W6K B;  4HX7 A;  4ZZL A;  3KE2 A;  3ZMD A;  4ENM A;  4FX4 A;  3R0A A;  1R1V A;  2D1H A;  3ZQ7 A;  1SMT A;  2IT0 A;  3ZMV A;  2VE9 A;  2H6B A;  5J6X A;  4GO1 A;  2V79 A;  1UB9 A;  2YR2 A;  3HTU A;  4P5O A;  2IW5 A;  1FYL A;  5E8G A;  1IN6 A;  1WWX A;  5KK1 A;  1D5V A;  3LST A;  3CDH A;  2J5P A;  5BPD A;  5FFX A;  1ZRC A;  3DF8 A;  3EYY A;  3QPH A;  4G8X A;  2CFX A;  1I1G A;  3PQK A;  3OV8 A;  4LK0 F;  3RDI A;  1IN8 A;  1B1B A;  2W85 A;  1KQ0 A;  3GVA A;  1IXR C;  3E5X A;  1SAX A;  5DD8 A;  3GFJ A;  3JTH A;  4H0E A;  3TO6 A;  3G3Z A;  1OR7 A;  2Q2E A;  1FSE A;  4DQ2 A;  4DNC A;  5DEQ A;  2G7U A;  3LFK A;  5F6F A;  2P6T A;  3RIR A;  1XGS A;  5LGT A;  1J7K A;  1MJB A;  4UXN A;  5FGM A;  2ZKZ A;  2VN2 A;  1JE8 A;  3WU0 A;  1EH7 A;  3KP6 A;  4IRH A;  3SXY A;  3K1P A;  1V3F A;  4AVP A;  2HOE A;  1FBQ A;  3BPV A;  1RIO H;  1W5S A;  2EV6 A;  2A6H F;  3QOP A;  3R6S A;  2DU9 A;  3I5U A;  2QVO A;  3WTY C;  3QAH A;  4XBF A;  4OIN F;  4JK1 X;  1IF1 A;  1YYV A;  4HLX A;  5CLS A;  2JT1 A;  2LNB A;  5HLG A;  4RAY A;  3IWF A;  4XLP F;  1DPU A;  2A3S A;  4HQE A;  2A5Y B;  1XDS A;  4UNO A;  3MEX A;  1RI7 A;  2UZK A;  5IT3 A;  4LLN A;  3MZY A;  3E6M A;  2STW A;  4IRG A;  3V4G A;  4EM0 B;  1Z91 A;  4I2O A;  4CGZ A;  1ON2 A;  2W25 A;  1R00 A;  2ZJ2 A;  1LDD A;  1U8R A;  4A6E A;  1G3W A;  2QZ8 A;  5DUI A;  1LNW A;  5DUK A;  3GFI A;  2K4B A;  3VOD A;  5ICE A;  3EUH A;  1DPR A;  4A12 A;  3R0J A;  5D4S A;  2XRN A;  4O6J A;  2ISZ A;  2OD5 A;  2PMU A;  4UVA A;  5D8K B;  1E2X A;  1TNT A;  4E70 A;  3CO6 C;  1OYW A;  2LF7 A;  4I7H A;  1LDJ A;  2RN7 A;  4RB3 C;  4GCV A;  1S6L A;  4HF2 A;  4WX9 A;  4HDV A;  1UST A;  4KIB A;  3L9F A;  1R1U A;  1QPM A;  1HW2 A;  1EH8 A;  1P2F A;  1ONV A;  1JGS A;  2CW0 F;  2XKO A;  4LFU A;  3TOA A;  1U78 A;  4Q5S F;  5D5V B;  4EJV A;  3RPU A;  1MDM A;  4L0Z B;  5JVT A;  3U1D A;  2Z99 A;  4M71 A;  2CG4 A;  4JQF A;  2XHK A;  1XCV A;  1FT9 A;  1FNN A;  1Q1H A;  4KN4 X;  1XSV A;  2XGX A;  4O5V A;  5E8I A;  4P96 A;  4ESB A;  2J5O A;  2YSR A;  1KYZ A;  1IZ1 A;  3CJN A;  5CYV A;  1F1Z A;  1HKQ A;  1TNS A;  2VC1 A;  1R7J A;  3K1M A;  1YW8 A;  4U0V A;  2M8E A;  3WTS C;  3W6J B;  2O6G E;  3LA2 A;  1IN7 A;  4L9T A;  4B09 A;  4XRF A;  2YX7 A;  2UXX A;  5L3D A;  3GZ6 A;  3KP3 A;  3V7S A;  4ASN A;  2F5F A;  3F8M A;  3RKX A;  1V4R A;  4OMY A;  1VTN C;  5HS8 A;  1R22 A;  1SFX A;  1BI3 A;  3FX3 A;  1FP2 A;  2G7H A;  3V7C A;  2ZME A;  2XVC A;  2MA3 A;  1CF7 B;  1TW3 A;  2FNP A;  4QWQ A;  2H09 A;  4I0B A;  4HA8 A;  1I1S A;  1QGP A;  4GYG A;  3Q5F A;  1FZP B;  3KET A;  1FPQ A;  5J8F A;  3F8N A;  5JR3 A;  3V7R A;  1XB4 A;  3RYP A;  4G9Y A;  2E1N A;  3GW2 A;  3TOB A;  1G6N A;  4N9I A;  2DFI A;  3HRU A;  3F8C A;  4EJU A;  2F2E A;  1P92 A;  1WRJ A;  2OZ6 A;  4CIC A;  1ON1 A;  5K5O A;  3K2Z A;  1Y0U A;  1B59 A;  1HXD A;  3HSR A;  1J59 A;  2XAF A;  2EB7 A;  3SHF A;  2EWN A;  1K78 A;  2EK5 A;  3TO7 A;  4KIC A;  1GVJ A;  3ZMU A;  2JPC A;  1TQP A;  1RUO A;  1ZLJ A;  3LA3 A;  3ZP5 A;  1AOY A;  2FXA A;  2MC3 A;  1DP7 P;  1MD0 A;  1WKM A;  3L2C A;  3ZN0 A;  2ESH A;  1YS6 A;  2EV0 A;  1I6X A;  2XAJ A;  4XSX F;  2KJC A;  5HOO A;  4P9U A;  1ZHF A;  2DI3 A;  1ZAR A;  1IRG A;  2L01 A;  1HW1 A;  3BJA A;  2QWW A;  2L4M A;  2ZFW A;  1FBU A;  2NYX A;  1BJA A;  2QBY B;  1PP8 F;  4G7Z F;  3VB2 A;  2GIV A;  3GEZ A;  3ZMZ A;  1U5T B;  3NEU A;  2EA4 A;  2EV5 A;  3K69 A;  4LLL A;  4EGY A;  2K4J A;  2R7D A;  1G3Y A;  3LAP A;  2VBX A;  3WU1 B;  2JPB A;  1BN5 A;  5L3B A;  5H20 A;  3H3U A;  1R23 A;  1Z6R A;  4U7D A;  2HYG D;  4LG0 B;  4LK1 F;  4EQQ A;  2GA1 A;  1YFH A;  3IKT A;  3GF2 A;  2DK8 A;  4MHG A;  4KMF A;  2IP2 A;  2GZW A;  2FQ3 A;  3KFW X;  4ETS A;  4EV0 A;  2HFH A;  1BC7 C;  2KIU A;  4LB6 B;  1SD6 A;  1QNT A;  2HYF A;  2JRT A;  3I0T A;  2V1U A;  5DD4 A;  4B8X A;  5HS9 A;  2C6Y A;  1REP C;  1JXS A;  1T98 A;  1W7P A;  1XSX A;  4I01 A;  3BP8 A;  2OQR A;  1WI9 A;  2FOK A;  1O3T A;  4PZJ A;  2VT2 A;  1ZLK A;  3HUG A;  3GFL A;  4TV7 A;  5FD5 A;  1KU7 A;  2LSO A;  3WGG A;  4MNU A;  3N97 A;  4IHS A;  2DPD A;  2ZCW A;  3DKW A;  3U2R A;  5L3G A;  1UHW A;  4A5M A;  2DQL A;  3KP4 A;  2A69 F;  3V8J A;  1LQ1 A;  2MBF A;  2UXN A;  1ZRF A;  3GFM A;  5E1W A;  2P4W A;  3C7J A;  1ULY A;  3B02 A;  1SFE A;  5AIP A;  3VFZ A;  2COM A;  6PAX A;  3C18 A;  2IRF G;  4MQV A;  3FMR A;  1Z1D A;  4A5N A;  3I4P A;  1T6S A;  3K1N A;  4HX4 A;  1H9T A;  4IF4 A;  1LJ9 A;  5LHH A;  3LA7 A;  1GHC A;  2ZO4 A;  1O57 A;  3E6D A;  1BM9 A;  2F5C A;  3TDZ C;  2MD5 A;  1H0M A;  5HLH A;  4PDK A;  2B0L A;  3ECH A;  1HKS A;  1XN7 A;  2O0Y A;  4MTD A;  4NB5 A;  4N9H A;  4UV9 A;  3E97 A;  3KLN A;  3BDD A;  2RDP A;  3V8K A;  3WTV C;  3K9T A;  4A6D A;  1EV7 A;  2PEX A;  1TQM A;  4WK8 F;  4HW0 A;  3JAM Z;  2L02 A;  3DPT A;  2ZME B;  1FC3 A;  3CLO A;  1XMA A;  3CTA A;  1YLF A;  1QZY A;  2G9W A;  4KN7 X;  2DAO A;  3OOP A;  2HTJ A;  3DQV C;  5JI6 A;  3E5Q A;  4ENN A;  1CF7 A;  1W5T A;  3RKY A;  5FLX K;  4AIH A;  1P6R A;  2LDU A;  4KDP A;  5H6Q A;  1WQ2 A;  5ILV A;  1YW9 A;  1B9M A;  2BBY A;  4CDG A;  1X3U A;  5K1Y A;  2IPQ X;  4IRI A;  4N0B A;  3PFI A;  2CQK A;  5ICC A;  3EDP A;  1F9N A;  2XAS A;  2Y0M A;  2V9V A;  1K78 B;  3L7W A;  4KT5 C;  4WXC A;  2X4H A;  3T5X A;  5ILS A;  1BIB A;  3M7G A;  4LMY A;  3S2W A;  2VON A;  2MLK A;  1HKT A;  5HLI A;  4R79 A;  2F5E A;  3LQQ A;  4CYD A;  1LDK B;  2XUB A;  5ILU A;  3DP7 A;  5CVJ A;  2PBI A;  5EEG A;  2MH9 A;  4KFC A;  2RVC A;  4LD5 A;  1R36 A;  5L3C A;  4M9Z A;  3M9A A;  4M73 A;  2L3D A;  2HDC A;  3FXU A;  2Z9O A;  1LVA A;  3BZ6 A;  1O3R A;  2DPU A;  2IVM A;  5DYM A;  5BPI A;  2QBY A;  1JHF A;  2ZNY A;  4EVI A;  1U5T A;  2PMH A;  3I64 A;  3DFG A;  2OQG A;  2P7C B;  4EJW A;  4KNY A;  3B73 A;  3EYI A;  3FF5 A;  3E3V A;  2KKO A;  3L09 A;  5FLX Z;  1IAW A;  3T0Y A;  3RJP A;  1I27 A;  4UV8 A;  5ERI A;  4IXA A;  2X0L A;  4O3M A;  2W84 A;  4LG0 A;  2QQB A;  3L00 A;  2PFB A;  4Y15 A;  4MEY F;  4EGZ A;  1YW7 A;  1UCR A;  1QQI A;  3F21 A;  5LHG A;  5F64 A;  1TW2 A;  4UVB A;  1G3T A;  4MEX F;  4G6D A;  3P9K A;  4R8H A;  2HKO A;  2RC4 A;  1W7P B;  4HQM A;  5A2Q K;  3D0S A;  1ZG1 A;  2CGP A;  2M1B A;  3IC7 A;  2EFW A;  2A68 F;  2BYV E;  4ZZD A;  2ZXJ A;  1XMK A;  3FXR A;  5D8L B;  3WTX C;  5TJJ A;  3HYI A;  3GWZ A;  5D4R A;  2Q0O A;  5EEH A;  1P4A A;  2K7L A;  1LB2 A;  2P8T A;  1EH6 A;  4WCG A;  1W7P D;  1QO0 D;  4HX8 A;  4IJA A;  1FYK A;  1BOA A;  2XRO A;  2DT5 A;  4KA4 A;  2DK5 A;  2VOP A;  3HIF A;  3COA C;  3J81 K;  4YFN F;  2EJR A;  4G94 A;  2VBW A;  2HWV A;  3DXJ F;  1T38 A;  5BOX A;  1LEB A;  2VT3 A;  3HTS B;  5AON A;  5LRR A;  1IUY A;  3HRS A;  3KZY A;  1YTY A;  1L3L A;  1MZB A;  2YX4 A;  1XD7 A;  3AAF A;  1ZRD A;  2DO7 A;  2VOO A;  3I59 B;  4A0X A;  4ZYD A;  2V1X A;  2D45 A;  2GWR A;  3FMQ A;  5CVU A;  4XLN F;  4GGG A;  3LWF A;  2Y48 A;  5CVI A;  4L0Y B;  2NRA C;  3CO7 C;  1OYY A;  1BBY A;  3F6V A;  1YS7 A;  1FY7 A;  4OIO F;  2EFO A;  2OAZ A;  5LBQ A;  5K5R A;  3P7N A;  3KLO A;  3ZMT A;  4L9V A;  3F8B A;  1OPC A;  3G73 A;  2O8X A;  4L18 B;  5E1Z B;  5IT9 K;  1R5G A;  2FA5 A;  1B4A A;  5LEK A;  2NNY A;  1O3S A;  1BIA A;  2P7V B;  1IXS B;  2H94 A;  2QQA A;  2KJB A;  4XSZ F;  2P5K A;  3RKW A;  2GXB A;  1SD5 A;  3BPX A;  3I58 A;  3MQ0 A;  2GXG A;  2PQ8 A;  4GXO A;  1PDN C;  1ZRE A;  2QLZ A;  3KP7 A;  3CUO A;  4OU0 A;  3WE3 A;  2QM3 A;  3EET A;  4L5I A;  4HF0 A;  4BH9 A;  1YIO A;  2ESN A;  2XAQ A;  2M30 A;  1WSU A;  2VBZ A;  4IHT A;  4HDU A;  2M87 A;  4BQA A;  1BI1 A;  4PGG A;  5L3E A;  4RGX A;  2IJL A;  3M1E A;  2DBB A;  3IL2 A;  4HZF A;  2ZBK A;  1J0R A;  3WGI A;  3ULQ B;  5DCF A;  4HAM A;  2FEZ A;  1YQA A;  4RB2 C;  4BHP A;  2EFN A;  2M45 A;  4I0A A;  2GAU A;  4LGW A;  1I5Z A;  2A6E F;  1XGN A;  1P4W A;  4BXU A;  4WXD A;  2QUF A;  2RQP A;  2JTV A;  5AIQ A;  5LGN A;  4RS8 A;  2LKP A;  4R1H A;  3JW4 A;  3ZN1 A;  3WGH A;  1OMI A;  4RGS A;  3VEP A;  5JHU A;  5HVQ C;  2FU4 A;  2V6C A;  4HV5 A;  4U0Y A;  5HDN A;  2L54 A;  2A61 A;  1U5T C;  5TRD A;  1UHM A;  1KA8 A;  3ZPL A;  4WXH A;  2TDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...