1IRFA

Interferon regulatory factor-2 dna binding domain, nmr, minimized average structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
PVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords INTERFERON REGULATORY FACTOR-2
publication title Solution structure of the IRF-2 DNA-binding domain: a novel subgroup of the winged helix-turn-helix family.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1irfA00
3E6DA 1DUXC 2STTA 1R1VA 1QBJA 2HS5A 3HTSB 4I01A 2DBBA 2CGPA 2P4WA 2P5VA 1R23A 2VC1A 4HDVA 1FBQA 3KCCA 4LB5A 1YW9A 3E3VA 3WTWC 2HKOA 1STZA 2IW5A 3MZYA 3I53A 5E8GA 4LK1F 2GWRA 2QLZA 1WWXA 1FNNA 1U78A 5ILSA 3LA2A 4KNYA 1QPMA 1FX7A 3EYIA 1YW8A 4A6EA 4HYEA 4M6XA 1XSDA 3D0SA 3WGIA 3JTGA 1ZGJA 3ISPA 2FBIA 4DQ2A 1PDNC 3MFKA 5LEJA 2EV0A 1OYYA 4Q48A 5D6FA 1B4AA 2DLLA 5E1WA 5BPIA 2Z33A 3ZPLA 2W24A 3CUOA 2CG4A 3FZVA 2JTVA 2L4AA 3DPTA 4YIIA 1G3YA 1PP8F 3B02A 2KIUA 1SFEA 5JFRA 3E97A 3I59A 2OA4A 1SFUA 3BOQA 3LQRA 4M74A 3CUQC 2RDPA 1SAXA 3K1NA 4L0YB 3R0JA 3KLOA 1SD6A 3FMRA 2M45A 2Q8KA 4UVBA 3V8KA 4S05A 4KMUX 2IRFG 3ML6A 4L9TA 5HDKA 2STWA 1MZBA 1ZRDA 2QQ9A 4AIKA 2MLKA 3O6BB 3QRFF 2X0LA 1ZHFA 5HS9A 2LF8A 3FXRA 3WTTC 1YW7A 4DNCA 4R8HA 2OZUA 5H6QA 5E17F 2G9WA 1CF7B 5D8LB 1MD0A 2XGXA 1MGTA 4KIBA 4PDKA 3GFLA 4HF1A 2JT1A 3HTUA 4HQMA 1W5TA 3TO9A 2FE3A 4IRGA 2EA2A 2F2EA 1P4AA 2YX4A 5ERIA 3TO6A 3GWZA 6PAXA 1FC3A 1KGSA 3T1BA 2ZXJA 5L3GA 5FB2A 5DUKA 1D8KA 4GYGA 3I54A 2BE5F 2DFIA 3M8EA 4OMZA 4XSZF 3EYYA 1T38A 1R5GA 5E8IA 2VT3A 1S6LA 1B59A 1JE8A 4UVAA 3MZHA 1R5HA 3GYHX 2W85A 4OIRF 1RNLA 2IP2A 3NQOA 1QZYA 3IKTA 1XMKA 1UHWA 3IWZA 4L9VA 1P4WA 4MTEA 5LHIA 2QQAA 1ZRFA 4EJOA 3J7AO 3PFIA 5BOXA 3FWEA 2XVCA 3EUHA 3HRSA 1W7PA 4I0BA 1IAWA 1B9NA 5BMZA 4M73A 1HQCA 2KIFA 1ZYRF 1O3TA 3K1PA 3U9GA 5E20A 3B73A 2HR3A 2ZNYA 1J0RA 5CVRA 3F6OA 2G7UA 4CGZA 4YG2F 3S2WA 1FSHA 1ZG3A 5CJ9A 2VOOA 3CDHA 4NHJA 4P9FA 1SD7A 5A2QK 3P7NA 2K02A 4ON0A 4L5JA 2HFHA 3HIFA 2PEXA 3FMSA 5LHHA 4ENKA 3CTAA 3G3ZA 2Z9OA 4L9NA 2RQPA 4LLLA 2V9VA 3D5LA 3GF2A 2VT2A 4Q4ZF 1I27A 5ICEA 2ISYA 1D5VA 2L54A 1G6NA 4MTDA 1SFXA 3L7WA 3ZMVA 4KDPA 2GAUA 3T0YA 5HLGA 2ZMEA 3IC7A 4Y17A 5HOOA 3R4KA 3I71A 4HX4A 5AONA 3MWMA 5LGNA 1BOAA 1Q1HA 3K2ZA 3JSOA 3DV8A 1VTNC 2FSWA 5AIPA 4EJWA 4AWXB 1KA8A 2E1CA 4KFCA 1D3YA 3WGGA 1R1TA 2NAZA 4FX4A 1LNWA 3RYRA 4N9IA 1P2FA 1NHAA 4K2EA 1ZRCA 1I1GA 2LSOA 4PZJA 2Y48A 3TKYA 1X3UA 4BQAA 1UHMA 2XAFA 5DCMA 1K78A 2EK5A 3HRUA 1U5TA 3E6BA 1ZLJA 3F8FA 4LB6B 3T8TA 2HQNA 4G7ZF 3WTVC 3F8MA 4KMFA 1KQ9A 3P9KA 3O2PE 3HUGA 1IUYA 3WE3A 2QBYB 4MEYF 2GA2A 3V7RA 1I1SA 4U0YA 4KIGA 5DEQA 2XAQA 3QU6A 1BIAA 3OV8A 4LD5A 1OMIA 2WV0A 4GCVA 2YPRA 3K69A 4WXCA 3HSEA 2DT5A 1T0FA 4LG0B 3JSPA 2FNAA 2E1NA 4Q47A 4ZYHA 3LWFA 2Z3YA 1AWCA 3BJAA 4A12A 3K9TA 1OYWA 2J5PA 1YLFA 5DYMA 5CLSA 3HHHA 1BC7C 2RNJA 2KJCA 3WTZA 1Z91A 2XIGA 4ASNA 5DUIA 3JTHA 1XGMA 1I5ZA 3GFMA 1BI3A 1W4MA 1UFMA 4Y15A 3GX4X 2FF4A 4JQFA 4FHTA 3R61A 1IN4A 1IXSB 5J8CA 5CVIA 1K79A 2Q0OA 1IZ1A 1T39A 5HDGA 3E5QA 5FLXZ 3RPUA 2FMLA 5ICFA 4HAMA 3IHUA 4P96A 2ADUA 2V1XA 4EM2A 5DV5A 3LQQA 4HX8A 4OU0A 1F1ZA 3TOAA 1LJ9A 2ZNZA 2G7HA 1XGSA 1O57A 4KICA 4LK0F 2IPQX 5L3FA 5HDNA 1S3JA 2HOEA 1XB4A 3HOTA 1LEAA 4MGRA 5CYVA 4WF2A 3IL2A 1KU9A 4M72A 3W6JB 5DD8A 5ICCA 3GZ5A 3EQLF 4CDGA 1J7KA 1RZ4A 1IXCA 3KETA 3H3ZA 1PUEE 1JGSA 3GVAA 3DKWA 4KIFA 2ESHA 2QENA 1WKMA 3LAPA 1EH8A 3AAFA 1EH6A 4F7ZA 1DP7P 1O7LA 1YFHA 2M1BA 1LDDA 2M5WA 1J9IA 2ZO4A 4EVIA 1ULYA 4GYIA 1YS6A 2H6CA 5LEKA 3EETA 1I6XA 5TJJA 1KU7A 4Q5SF 4I0AA 2AXLA 4RB2C 2FXAA 4IRHA 1O7FA 2OBPA 2V1DA 3BWGA 1P92A 1ZH5A 4IF4A 3HSRA 3ZMDA 3KP6A 3F3XA 4U88A 3BJ6A 3KLNA 4OIOF 2MA3A 2CFXA 3I59B 4IHTA 5FD6A 3VOEA 1MDMB 4LFUA 3ZMZA 2EB7A 2A6EF 1OR7A 3L9FA 2IVMA 4LMYA 2P7CB 3GFJA 3IRRA 1USTA 3NRVA 1QQIA 4JK1X 2HYFA 4U7DA 3KE2A 2P6SA 4ZYEA 5BPDA 1TNSA 2HYGD 4UVCA 3WU1B 3ZN1A 4A5MA 3BZ6A 2PN6A 1WSUA 1V4RA 3F8CA 1S8NA 2JSCA 3DXJF 2UZKA 2XAJA 3T5XA 2JZYA 1TQPA 1H0MA 1PP7U 3I64A 2PMHA 2QZ8A 2D2WA 2RGVA 4KUMA 2CSOA 2NNNA 3RI4A 2ZFWA 5K5QA 2KIMA 4R79A 4KYWA 2EV5A 2D45A 1Z6RA 4CZZA 4LLNA 2CO5A 2VXZA 4H0EA 4EM1A 3C7JA 1ZLKA 1FSEA 4WX9A 3V8JA 2GZWA 2K4BA 2OQRA 4I98B 1RUOA 4WWCA 1EV7A 4EGZA 1V3FA 1T2KA 3V8LA 1FLIA 3QAHA 2CYYA 2DPUA 3F8BA 3RPQA 3RKYA 3KZYA 3SZTA 3F23A 1RUNA 2EFWA 1H9GA 5D5WB 2ZKZA 1QZZA 3RKWA 4A2UA 3BJOA 1LDKB 3HSFA 3N97A 3J80Z 1W7PB 4ENMA 4RB0A 4I7HA 2F5FA 5LRRA 4Z2YA 3J81K 1E2XA 2WWYA 2E7WA 5HLIA 2R7FA 1BJAA 1YG2A 2P7VB 4HZFA 2COMA 2BYVE 2VBZA 5CVJA 2FBHA 1F4KA 2GXBA 3ECHA 4HDUA 1GHCA 1IN5A 3TQNA 3DQVC 4OOIA 4S04A 1CF7A 5F6FA 5LBQA 3M8FA 5KK1A 1HSJA 4IXAA 5DD4A 1XCVA 4U0VA 5EEGA 2QYOA 3I58A 1SD4A 2M87A 1HKTA 2L02A 1Z1DA 1J5YA 2HTJA 4UV8A 1BBYA 1W7PD 1UCRA 4MNUA 5FFZA 3SHFA 1ZARA 1MJAA 2V1UA 5BS6A 2ZMEB 3DFGA 3FMQA 4MHGA 4EQQA 2O03A 3LAJA 4CO8A 3RDIA 2K27A 2DPDA 1HKSA 4P9UA 4P55A 2XKOA 3LSTA 5ED4A 1J75A 1L0OC 2P6TA 3LA7A 2B0LA 3WG9A 4P5OA 5F1RA 3H92A 2NYXA 1FYKA 2EFOA 4ETSA 4CICA 4L0ZB 1TLHB 2O3FA 3MAJA 2EV6A 3OOPA 2IA1A 2MD5A 5LGUA 1Z05A 2ACJA 5DCMB 1K78B 5FFXA 2UXNA 2TDXA 2C6YA 2XAGA 1U5TB 1SMYF 4HX7A 2L3DA 5E1ZB 1SMTA 4ZYDA 4U0WA 2A07F 4A0XA 3GEZA 1BN5A 2ZJ2A 2HDCA 2ISZA 3M9AA 4NQWA 3LA3A 2PI0A 2Y0MA 2MLGA 3ELKA 4G6DA 1ODDA 4M9ZA 1BC8C 2FA5A 1TW3A 2YX7A 1S29A 1XGOA 3ZMTA 4HLXA 3BPVA 2P5KA 3O3KA 3GFIA 2IA2A 2VC0A 1USSA 3RYPA 3C3WA 4HV6A 3FM5A 2RVCA 1S7OA 5D5XB 2VBYA 3QU3A 1BIBA 1JHHA 3ZP5A 5JR3A 5E18F 2DO7A 4Y13A 4HBLA 2A68F 2A69F 4MQVA 4CXFA 1ON2A 4UNOA 2PFBA 1MKMA 4AVPA 3KP3A 5DCFA 5L3CA 4BHCA 4XLNF 1JXSA 3Q9SA 2MH2A 2FNPA 3ULQB 5K5OA 2PJPA 2HZTA 5HS8A 3I0TA 1R1UA 4HOBA 1XN7A 3JW4A 3C1DA 2OU2A 4KN7X 3SXYA 3HRMA 1G3SA 2D1VA 3GO5A 1HXDA 2FOKA 2CW0F 4L9JA 2M30A 2HTSA 4B09A 3ERED 3CUQA 1KU2A 3F8NA 4BXUA 2OZ6A 3COAC 4G6QA 2UWMA 3N4MA 4OIPF 1WRJA 3TDZC 4R1HA 2P8TA 3ZQ7A 2PMUA 2QM3A 5J6XA 1ZN2A 2KJBA 4G94A 2YR2A 4A0ZA 4EGYA 1R36A 3P9IA 2ETHA 3FX3A 2AS5F 3J80K 2O6GE 4L18B 1XGNA 1FZPB 1FP1D 1OYIA 4RB1A 1ONVA 1LB2A 3KP7A 2Q2EA 1HBXG 5L3EA 4ENJA 3FHZA 1FOKA 2RKHA 4HA8A 1QNTA 2EFNA 3K0LA 4ZZLA 5ILUA 2A6HF 2W57A 4PGHA 3KP4A 4O5VA 1E17A 2K7LA 1BI2A 3ZMUA 5ICGA 1WQ2A 2IJLA 4LLGF 5K5RA 2A61A 2V6CA 2NRAC 3KFWX 1IRGA 2XHKA 1KQ0A 3G73A 3HYIA 4ZYGA 5D4SA 1O3QA 2EJRA 2O61A 1W5SA 2XRNA 3SZPA 1ZAOA 3RIRA 1OKRA 5ILVA 3WE2A 3E6CC 5CVUA 4AD9A 3REOA 2HEOA 1IF1A 1U3EM 3F22A 3KEOA 4BHPA 3VEPA 2MH9A 2GQQA 4EMSA 2FU4A 1XD7A 1XCBA 1TQIA 3M7GA 4MQ9F 3T8RA 5IT9Z 1MJ9A 3FXQA 2EWNA 5L3DA 3TGNA 3JAMZ 3BROA 4LJZF 5LRSA 4TV7A 1YQAA 2H94A 3HRTA 4UUVA 3I4PA 5LGTA 2R3SA 4BH9A 3E5XA 2EA4A 3E6MA 4RS8A 4N0BA 4HF2A 1Y0UA 3FF5A 2HKXA 3WU0A 1TNTA 1BI1A 1U5TC 2VONA 4G9YA 1H9TA 5F64A 1KYWA 4YFKF 1B9MA 4QWQA 1K7AA 2DW4A 5DDGA 1Z7UA 2GXGA 3HOSA 2VE8A 2HGCA 4RGXA 4IRIA 1AOYA 4XBFA 1LVAA 1XSXA 1TBXA 2W25A 5HLHA 2ZCWA 3CO7C 4ZZDA 1GVJA 5H20A 1R58A 4I02A 1HW1A 3M1EA 3DP7A 2LKPA 3ABTA 5JVTA 2M8EA 3RJPA 3BP8A 1QO0D 3C18A 4XSXF 4G7OF 2XKPA 4BYYA 2A3SA 2H6BA 1LDJA 3EDPA 4GGGA 1MDMA 1R22A 2VOPA 2XV4S 4U7BA 4EV0A 5CVVA 3ZMSA 4ESBA 4A5NA 4HLYA 3R6SA 2CWEA 1F5TA 2FQ3A 4RB3C 3FXUA 4I2OA 3KEQA 3L2CA 4M6YA 2DI3A 5FO5A 2XASA 2FBKA 2CQKA 3U1DA 4A0YA 3VFZA 2IT0A 2XUBA 1FYLA 5L3BA 1J59A 4WXHA 3MQ0A 1YO5C 2RN7A 3WTXC 5H6RA 4KT5C 2J5OA 4EJTA 1TQMA 3W6KB 1F9NA 4UHTA 2LNBA 1XMAA 3F6VA 5JI6A 1GXPA 1JHFA 3GLXA 1GXQA 1K6OA 2GIVA 4RGSA 5D4RA 4QLCU 5LLQA 5FLXK 1FP2A 2QVOA 1FT9A 1T6SA 4FX0A 3KZZA 3QOPA 1IN6A 3PQJA 3R0AA 5D6EA 3RTRA 1XDSA 3L09A 3QPHA 2JRTA 4MEXF 4E70A 1FYMA 2ESNA 1HW5A 4BNCA 4WK8F 5TRDA 2HWVA 4PGGA 3I5UA 4L5IA 4BAYA 2X4HA 1G4DA 1IN7A 2LF7A 2RC4A 3GUDA 2DAOA 1TW2A 2VODA 1LQ1A 3DEUA 2H27A 4LGWA 3DF8A 1YYVA 4ENNA 3HHGA 1HSTA 1FPQA 4RAYA 1L3LA 2K86A 1KYZA 3FM3A 1WI9A 1FWZA 2YSRA 4IVNA 2IA0A 5KVRA 3SQNA 3E5UA 2KRFA 3LFKA 3V4GA 2PQ8A 1Z9CA 1IW7F 2WTEA 2PLYA 2NS0A 3GW2A 3QPTA 3BDDA 2V79A 4OINF 3KP5A 1FBSA 4RAZA 2FMYA 4EM0B 1KQ8A 1SD5A 5IT9K 1ZGAA 3JAMK 3WTUC 2BV6A 2XROA 1FBUA 1C0WA 1MJBA 2O8XA 4IHSA 3U2RA 4I09A 1IN8A 2QQBA 2Y75A 1R00A 4CYDA 5BQTA 1BI0A 3H3UA 4ESFA 2ELHA 2DTRA 3VODA 2RV8A 2Z99A 3QP5A 4OIQF 2DU9A 3CO6C 3ZN0A 2W84A 1YTYA 2OD5A 1J2XA 5J8FA 1OPCA 1EH7A 2K4JA 1BM9A 2FRHA 2R7DA 5FD5A 1U8RA 4M71A 3ABUA 4KN4X 2XAHA 1ZG5A 2BBYA 2WC2A 4YFXF 1HKQA 2Z5UA 4B8XA 1P6RA 1QGPA 4YIFA 1ZREA 4WCGA 4FT8A 4BHBA 2YU3A 1G3WA 3TOBA 1RIOH 4HF0A 2VBWA 1DPUA 4XRFA 2DQLA 3CUQB 4EJUA 2OQGA 3NEUA 5D8KB 2VN2A 2E7XA 3WODF 4G8XA 3ECOA 1XDUA 1TTYA 2UXXA 3P9CA 2BGCA 4WXDA 2FEZA 5HVQC 2NNYA 5D5VB 3QP6A 3BY6A 2F5EA 2PBIA 4JBAA 1U6GA 4O3MA 5AIQA 1REPC 1YS7A 4UV9A 1S7AA 1D8JA 4CHUA 4GO1A 4M9XA 3WTYC 4HV5A 1A04A 3CJNA 2L01A 1YIOA 1CGPA 1IRFA 2DK5A 3Q5FA 1ZG1A 2EFQA 1P4XA 2EFPA 5HS7A 3PQKA 3BPXA 1B1BA 3V7CA 3CLOA 2VBXA 4N9HA 2KKOA 3IKVA 5JHUA 2PG4A 2QBYA 1DPRA 2BEOA 1G3TA 4XLPF 3GXOA 2HQRA 2L4MA 5D5UB 3GZ6A 2DK8A 2JPCA 4UXNA 1B6AA 3K1MA 4KA4A 1LEBA 4LG0A 2LDUA 3KP2A 3J81Z 2MBFA 3WGHA 3DPLC 4EJVA 5IT3A 4A6DA 1DDNA 4YFNF 3F21A 4GXOA 4M9SA 2ZBKA 4OMYA 1IXRC 5E1XA 4O6JA 4ZH4F 2F5CA 3WTSC 1R7JA 5LHGA 3IWFA 1XSVA 2D1HA 5EEHA 1Z6TA 5K1YA 3RKXA 4HW0A 2A5YB 3V7SA 2QUFA 4RGUA 1ON1A 3R60A 4PCQA 4NB5A 3L00A 3SFZA 3TDUC 1FY7A 2QWWA 3IRQA 3Q9VA 3MCZA 1KU3A 1U2WA 2H09A 3ROUA 2F5DA 2MC3A 4IJAA 1HW2A 4HQEA 3MEXA 2O0YA 2VE9A 4AIHA 2DQRA 1RI7A 1T98A 2GA1A 4G7HF 2OAZA 4RGRA 2JPBA 5FGMA 2P5LC 3F72A 3TO7A 4AIJA 4D0PA 1UB9A 4ESJA 4IPAA 3VB2A 1O3SA 1O3RA 5A2QZ
chains in the Genus database with same CATH superfamily
4C30A 3E6DA 2HDDA 1DUXC 3CMYA 2GM4A 2STTA 4L5EA 4Y52J 1R1VA 1QBJA 3GMEA 2HS5A 3HTSB 4I01A 2DBBA 3VWBA 4JYKA 2CGPA 1Z3XA 2P4WA 5BNGA 2P5VA 3CF5F 1R23A 1MSEC 2VC1A 2R7UA 3J7YJ 1OQYA 3QQAA 3UKGA 4HDVA 2JMWA 1JKRC 3W2AA 1FBQA 3KCCA 4RAGA 4LB5A 1YW9A 3E3VA 3WTWC 3LL7A 3CCMI 1B8IA 2JVHA 2HKOA 1OCPA 1STZA 1X4PA 2IW5A 3MZYA 3I53A 5E8GA 4LK1F 3X2QH 2I8DA 2GWRA 5FKKA 2QLZA 4BBSJ 3E0JB 1WWXA 2L0KA 1WJBA 2LK2A 4BKXA 2OV7A 5GAEJ 1VQ5I 4XMYA 2R5ZA 1FNNA 1U78A 3IH2A 1OISA 5ILSA 3LA2A 4F3QA 4KNYA 1QPMA 1FX7A 3TMOA 3EYIA 2R7VA 1YW8A 4A6EA 4F92B 2HNHA 5J4YA 4HYEA 4M3FA 4M6XA 3OL4A 1XSDA 3D0SA 4UUSA 3BR3A 3WGIA 3JTGA 1ZGJA 3ISPA 2FBIA 4DQ2A 1PDNC 1ENHA 2YUSA 2K3PA 3MFKA 3A01B 5LEJA 4A3DJ 2EV0A 2Y69H 4B3XA 1MBFA 1OYYA 3OIOA 4Q48A 4ZTJA 5D6FA 1B4AA 2DLLA 3CCYA 2JA8J 1X3ZB 5E1WA 5BPIA 2Z33A 3ZPLA 2W24A 4AVZA 5J1RA 3CUOA 2ECBA 2CG4A 2M3AA 3FZVA 4B43A 3H5NA 4M3BA 2JTVA 1QHHD 2L4AA 4CCJA 1VI0A 3DPTA 1G3YA 4YIIA 2OC6A 1PP8F 3B02A 2E2JJ 2KIUA 1SFEA 2EZHA 5JFRA 3E97A 3I59A 2LH9A 5IOYA 2OA4A 4CA0A 3DCFA 2L7ZA 3BOQA 3LQRA 4M74A 1SFUA 3CUQC 2RDPA 1SAXA 3K1NA 4L0YB 5FKMA 3R0JA 3HL2A 3DLAA 2LLKA 3KLOA 1SD6A 2YS9A 3FMRA 3HB9A 3FBIB 3PIPF 3G2BA 2M45A 1JUPA 2Q8KA 4UVBA 3V8KA 4S05A 4KMUX 1ITYA 2IRFG 4YELA 4X1EA 4JX5A 1DP3A 3ML6A 4L9TA 1ETYA 5HDKA 4J01A 2STWA 1MZBA 1ZRDA 2QQ9A 3TW6A 2HOAA 2BY1A 3F0CA 4AIKA 2MLKA 4XK4A 4LIVA 1OCOH 3O6BB 3QRFF 2X0LA 4Z6YA 1ZHFA 5HS9A 4A3JJ 2LF8A 2VKHA 1R5ID 3TP3A 3ABKH 3FXRA 3WTTC 1YW7A 4DNCA 3PSFA 2L5QA 4R8HA 2X6WA 2F6CA 2OZUA 5H6QA 5E17F 4XRMA 2BXYA 2G9WA 2DFFA 5D8LB 4DIQA 1MD0A 1CF7B 2M0MA 3G1MA 3RZOJ 4IQ4A 2XGXA 1MGTA 4KIBA 1VQ8I 2PJRB 2HPMA 4PDKA 1OCTC 4DYQA 2IS4A 1G8XA 3GFLA 4HF1A 2AXTC 2JT1A 2V1NA 3EPZA 3HTUA 4HQMA 2AQEA 2M9HA 4HEA2 3CCLI 2LY1A 1W5TA 3TO9A 1PYVA 2FE3A 4IRGA 5F0HA 2EA2A 1ETXA 2F2EA 1P4AA 3HEFA 4A3BJ 2YX4A 3BR1A 5J1UA 4C2UA 1YIJI 3LSJA 1MBHA 5ERIA 3TO6A 5EEAA 1YRNB 3GWZA 6PAXA 1FC3A 2K9LA 1KGSA 2XGDA 1JTXA 3CC4I 4BEHB 3T1BA 2ZXJA 4AIDA 5L3GA 5DUKA 5FB2A 1JKQC 1YOVB 1D8KA 4GYGA 2L7KA 3BZKA 2BE5F 2DFIA 3I54A 3M8EA 3PUBA 4OMZA 5F04A 4XSZF 5KAIC 3FHNA 3DTIA 3EYYA 1A6IA 1T38A 1R5GA 5E8IA 2FJ1A 2VT3A 5DTDA 3K4JA 1MNEA 1S6LA 1B59A 1JE8A 4HG2A 4UVAA 2ZXIA 4PJNA 3MZHA 2E60A 1R5HA 3GYHX 3RQIA 2KQRA 3IAM2 2W85A 4OIRF 1RNLA 2IP2A 3NQOA 1I6HJ 1QZYA 2BW3B 4H4KC 3IKTA 1XMKA 4N4NB 1UHWA 4QIWN 3IWZA 4L9VA 1P4WA 4MTEA 1JGGA 2DOEA 1BL0A 5LHIA 3KPHA 2QQAA 4BDYA 2KISA 1ZRFA 4EJOA 2DT7B 1JKOC 3J7AO 3PFIA 5BOXA 3FWEA 4BQOA 2M7BA 2X6YA 2XVCA 3ERMA 3SEQA 5DS9A 3EUHA 3H5AA 3HRSA 4Y7NJ 1W7PA 1Y8RB 4I0BA 1IAWA 1B9NA 3BR2A 3OYNA 4YRVA 5BMZA 4M73A 3IH3A 1HQCA 2KIFA 3BC8A 1ZYRF 1O3TA 2ICWG 4RDUA 3CJQB 5IYBJ 3K1PA 3U9GA 3DKYA 3IAS2 5E20A 2L9RA 3B73A 2HR3A 2ZNYA 2X6OA 1J0RA 4BL0B 5CVRA 3F6OA 4XONA 5KNLA 2G7UA 1WJAA 4CGZA 4YG2F 2EIKH 4F52A 2XGCA 2HPIA 4RM3A 1W36D 3S2WA 3TP0A 1FSHA 4BQNA 1YHQI 3CMMA 2WY7Q 1ZG3A 5CJ9A 2VOOA 3CDHA 4NHJA 3H1CA 3HOYJ 3QYFA 4P9FA 1SD7A 2KLOA 3CLQA 5A2QK 2M4KA 1LVKA 3P7NA 2KMUA 2RAEA 3HPHA 4W97A 2K02A 4ON0A 3MN2A 2R5YB 4L5JA 2HFHA 2IGMA 1TWHJ 3HIFA 2PEXA 3ABLH 3LSHA 3FMSA 5IY5H 3C2GA 5LHHA 3OYLA 4ENKA 3CTAA 3G3ZA 2Z9OA 4L9NA 4PJJA 4M3DA 1CQTA 2RQPA 1W5CC 4LLLA 2V9VA 4F93B 3D5LA 3GF2A 2VT2A 4Q4ZF 5EZGA 1I27A 5ICEA 4KISA 5C4XJ 2ISYA 4FCYA 1D5VA 2L54A 4FE7A 1G6NA 4MTDA 1ZGWA 1SFXA 3L7WA 3ZMVA 2F5VA 3BCBA 4KDPA 2R7SA 2GAUA 3W2VA 2EBIA 3T0YA 5HLGA 4BBRJ 1XMXA 2IS2A 3LSKA 3RKQA 2ZMEA 2JK3A 2NXNB 3IC7A 4Y17A 5HOOA 2YU9J 3NWTA 3R4KA 2IS1A 5GTHC 2IGOA 3I71A 4HX4A 4XQFA 5GTIC 2DJNA 5AONA 2ZJPF 4XNFA 2DDAA 3MWMA 5LGNA 3FXOA 1BOAA 2AHQA 2XSJC 1Q1HA 3K2ZA 3JSOA 4C9YA 3TBIA 3DV8A 1VTNC 2FSWA 1TZLA 4HNTA 2E35A 5AIPA 4IHVA 4AYBA 1ZELA 1APLC 2Z16A 4EJWA 4AWXB 1KA8A 2E1CA 4KFCA 1D3YA 1G59A 5E3NA 2R92J 3GTOJ 3HKZA 3WGGA 9ANTA 1R1TA 2NAZA 5F27A 1LNWA 4FX4A 1Z21A 4N9IA 3RYRA 5M3FJ 4A3IJ 2HVRA 3LSMA 1YX5A 1P2FA 1NHAA 4K2EA 1ZRCA 2VKDA 5EG0B 1I1GA 2LSOA 3VYUB 1VQLI 3DTKA 4PZJA 2Y48A 3TKYA 1WJFA 1AKHB 1X3UA 3LSPA 4BQAA 1UHMA 2XAFA 3K4MA 5DCMA 1K78A 1GV5A 2EK5A 1U8BA 3HRUA 1U5TA 4IX7A 3E6BA 1ZLJA 3F8FA 4LB6B 3T8TA 2HQNA 2L2OA 4G7ZF 1W1WE 3WTVC 2W82A 2VIXA 5JVGF 4CYCB 3F8MA 4KMFA 4G6TB 2ZJQF 1KQ9A 3P9KA 4E7LA 5HLTA 2E5NA 1ZTRA 3O2PE 1R6RA 4BXXJ 5FKOA 1IUFA 3HUGA 1NK2P 1RESA 3HGYA 1IUYA 3VYSB 3WE3A 2QBYB 4MEYF 5GAHJ 2GA2A 2AO9A 3V7RA 3RZDJ 1I1SA 3ZQIA 4U0YA 4KIGA 5DEQA 2CRGA 1PVEA 1XG1A 2XAQA 3QU6A 3DBRB 1BIAA 1U0JA 2LVSA 2EZIA 3OV8A 4LD5A 1OMIA 4XLEA 2WV0A 4GCVA 3OYFA 2NVTJ 1ETQA 2XC7A 2YPRA 3K69A 4BXFA 4WXCA 1UELB 3HSEA 2DT5A 1T0FA 4CH7A 3IP4B 5B1AH 5F1JA 1HCRA 4LG0B 4MO7A 4RLQA 2W4SA 3JSPA 2FNAA 3LSIA 2CV0A 3OSGA 3S1RJ 2E1NA 4Q47A 2EINH 4ZYHA 3LWFA 2Z3YA 1JKPC 1IDZA 1AWCA 3BJAA 4A12A 2IGNA 3K9TA 1AU7A 1OYWA 2K85A 2J5PA 2VQGA 1K83J 5EGOB 1U9OA 1QA6A 1S7EA 1YLFA 5DYMA 1LE8A 3JRAA 1Y6IA 3HHHA 2DT6A 5CLSA 2OTJI 2DYSH 3S1NJ 1BC7C 2H1KA 1OJLA 4PUSA 2RNJA 1FJLA 3MKLA 2BVLA 3IH4A 2KJCA 3WTZA 1Z91A 2XIGA 4ASNA 1WH7A 3BLYA 2VJ4A 3RSNA 4P1WA 2JSPA 1NH3A 5DUIA 3OS1A 1D5YA 3JTHA 4E7ZA 1IJWC 1B72A 3OYIA 1XGMA 1I5ZA 3GFMA 1JI8A 4D9JA 4XLAA 3K2AA 1BI3A 1W4MA 3AFHA 4C2TA 1P7JA 3ZRGA 1UFMA 3VYTB 3LMMA 4XR6A 4Y15A 3GX4X 3M4OJ 2FF4A 4JQFA 4BE1A 4FHTA 3R61A 1IN4A 3PNYA 3G1OA 5GAGJ 1IXSB 5J8CA 3H9JA 2KHMA 1WJDA 5CVIA 1K79A 3SZGA 4GRIA 2Q0OA 1IZ1A 2R7XA 1I3QJ 2W00A 1T39A 5HDGA 5K7FA 3E5QA 2HOSA 1WJEA 5FLXZ 3RPUA 2FMLA 2DA1A 5ICFA 1X3WB 4HAMA 1VQKI 3IHUA 4P96A 5HNFA 2ADUA 1EJ9A 3MZ8A 2F48A 4B48A 4D1QA 2V1XA 1SAUA 4EM2A 5DV5A 3LQQA 4HX8A 4OU0A 1UAAA 2XF7A 1F1ZA 3TOAA 1W36C 1LJ9A 2ZNZA 2G7HA 1XGSA 3KYCB 2K40A 1O57A 2GOMA 2LBFA 4KICA 4LK0F 1JT6A 2IPQX 5GPCA 1DQUA 4AYBN 5L3FA 5EJCA 4D7MA 5HDNA 2DYRH 2VKVA 1S3JA 2IS6A 2XB5A 2HVSA 1TC3C 2VQLA 2VLAA 2HOEA 1XB4A 3LSRA 3HOTA 2ECCA 1LEAA 4MGRA 5CYVA 5EYRA 4WF2A 3BR5A 2I10A 3IL2A 1KU9A 1UG2A 1B8IB 2L9NA 4M72A 3W6JB 1D1AA 3FKJA 5DD8A 5ICCA 3OYJA 4AC0A 4C3JJ 2V7FA 2R7OA 3GZ5A 1DGRM 3HC7A 1VQ9I 2OCEA 3EQLF 4CDGA 4A3CJ 3QYBA 4NNJA 1J7KA 1RZ4A 1IXCA 2FOWA 3KETA 4QSHA 5B3SH 3H3ZA 4A3FJ 1PUEE 3EUKL 3OYEA 4PK4A 1JGSA 3GVAA 2WY8Q 2X48A 3DKWA 3OYGA 2Z2SB 2O7OA 4KIFA 2MFZA 3BG6A 2ESHA 2QENA 1WKMA 5FJ8J 1EH8A 3LAPA 4HRIA 3AAFA 1EH6A 2LFBA 4F7ZA 1DP7P 1O7LA 1YFHA 2M1BA 1LDDA 2M5WA 4MFEA 3HBLA 1QRYA 1J9IA 4UUSB 1X1BA 2ZO4A 1T8IA 4M3EA 4EVIA 3LOCA 1W0TA 1ULYA 4GYIA 4FASD 1D1CA 2DFEA 3MMYB 1YS6A 2H6CA 5LEKA 3HG9A 1UHSA 3EETA 1I6XA 5TJJA 2HXIA 1KU7A 4Q5SF 3PO2J 4I0AA 1H8AC 4ABZA 5FKLA 3AL0B 1V5FA 2AXLA 2B9SA 4RB2C 2FXAA 4IRHA 3OR1C 1O7FA 2OBPA 4BUPA 1XTAA 2V1DA 1K6YA 3BWGA 1P92A 5HODA 2DJIA 4IEJA 2DOAA 2E1MB 1ZH5A 1MH4A 3HSRA 4IF4A 3ZMDA 4F91B 2KRHA 3KP6A 4BE2A 1FIPA 2DA7A 3HOWJ 3F3XA 5FRMA 4U88A 4LOCA 1VNDA 4QPOA 4A3MJ 3BJ6A 3KLNA 2CS3A 2I5UA 2MA3A 2CFXA 3I59B 4OIOF 4IHTA 1BW6A 5FD6A 2QKMB 3VOEA 1MDMB 1FOXA 4LFUA 3ZMZA 4E7HA 4HPQA 1J09A 5F08A 2EB7A 2A6EF 3CZ6A 3RCOA 1OR7A 3L9FA 2IVMA 2NS7A 3ASOH 4LMYA 3ASNH 2DCEA 2P7CB 3GFJA 3IV5A 3IRRA 3ZXSA 2DA5A 1USTA 3NRVA 1QQIA 2CUJA 2K5CA 4JK1X 2HYFA 2Y31A 4E7KA 2P81A 4UB8C 4U7DA 1QVUA 3KE2A 2P6SA 3JRGA 1ETVA 4ZYEA 3W3CA 4QPQA 5J47A 3S14J 5BPDA 1TNSA 2HYGD 4UVCA 3QODA 3WU1B 3WU2C 3ZN1A 4BJTA 4Y33A 5C4JJ 1A5JA 4EATA 2CV2A 4A5MA 4NC8A 3BZ6A 1R4MB 2LOOA 2VL8A 1GT0C 2PN6A 1WSUA 4IQJA 1V4RA 3F8CA 1TL8A 1SVOA 1S8NA 3OYAA 2JSCA 3DXJF 5E79C 2UZKA 4NUBA 2XAJA 3OYDA 3T5XA 3QWLA 2JZYA 3OMYA 1TQPA 3HXLA 3UR3C 4S0HB 1H0MA 1PP7U 1Y0NA 3I64A 1ACIA 2PMHA 2QZ8A 3SYTA 2D2WA 2RGVA 2LKXA 3FXKA 2Y9YA 4KUMA 2RNGA 3B6AA 3Q3SA 2CSOA 5IOZA 2NNNA 3S2HJ 3RI4A 2ZFWA 5CPRB 4XKBA 3HZJA 3UNGC 5K5QA 2KIMA 2X51A 4R79A 2EV5A 4NDLA 2D45A 4KYWA 1Z6RA 2M34A 4CZZA 4LLNA 2CO5A 3S17J 2VXZA 4H0EA 3CJRB 5EDNA 2WAEA 4EM1A 1Z67A 3C7JA 2ZSHB 1FSEA 1ZLKA 2WADA 4WX9A 3L2UA 3V8JA 2GZWA 2MYSA 2BVMA 2K4BA 4BY1J 2JVGA 2OQRA 4I98B 4IO9F 4WWCA 1EV7A 1MBGA 1RUOA 1BR1A 4EGZA 2EZKA 4HSRA 1V3FA 2PMZN 1T2KA 3V8LA 1FLIA 3QAHA 2V6EA 3JRDA 2CYYA 1LUJB 1ZKGA 5GADJ 2DPUA 4LITA 3F8BA 2JUCA 3RPQA 2VQCA 4IHYA 3HGGA 3S8PA 3RKYA 2QSHX 1DGWY 3KZYA 3SZTA 4X0GA 3F23A 3PL8A 2WA0A 3K4BA 3GLLA 2NVQJ 3AG3H 1RUNA 2BY2A 2EFWA 2V4JC 2VUMJ 3S2DJ 1H9GA 2JJ7A 5GPAA 5D5WB 2R7TA 2ZKZA 5DM6F 1QZZA 2JUGA 3RKWA 4A2UA 3BJOA 1Z0XA 1LDKB 3HSFA 1JJ6C 3N97A 3GTLJ 3J80Z 1W7PB 1EF4A 4ENMA 3S3OA 4RB0A 4YEJA 4CCKA 3SJMA 2CV1A 5K7ZA 4I7HA 2KT0A 3S1QJ 2F5FA 5LRRA 4Z2YA 2KDOA 3J81K 1E2XA 2WWYA 2LTPA 2WBMA 3DEWA 2E7WA 5HLIA 3L2VA 3CDIA 2BY0A 4X6AJ 3P5JA 2R7FA 1BJAA 1YG2A 2P7VB 4HZFA 2COMA 2BYVE 2VBZA 3FBNB 5CVJA 3AG1H 2IXSA 1SC7A 3U1KA 1I3AA 3ZCOA 2LP0A 2A05A 2CUEA 2FBHA 1F4KA 1YE9A 2WAQA 1QU3A 2GXBA 3ECHA 3FXJA 1QVTA 4HDUA 1GHCA 1IN5A 4II2A 3TQNA 5C3EJ 1VQ4I 3DQVC 2R7ZJ 3ESWB 4OOIA 5J40A 4KJZA 3WHBA 3S3NA 4S04A 3S15J 1CF7A 5F6FA 2IEKA 2EPFA 5LBQA 3M8FA 5KK1A 1HSJA 4XOTA 1F43A 4IXAA 5DD4A 1VFCA 1ZR2A 1XCVA 1WPKA 5JLWA 3VSKA 4U0VA 5EEGA 2QYOA 5DM7F 2LG4A 2O5RA 3I58A 1SD4A 2M87A 3E1SA 2DMUA 1HKTA 1TWFJ 1Y8QB 2L02A 1Z1DA 3MD2A 1AA7A 3KYLA 4J19A 4IOCF 1J5YA 5M5XJ 1N77A 2HTJA 4V2GA 4UV8A 2COBA 2XGEA 4A69C 5IYDJ 1BBYA 2Y0SN 1W7PD 1RC9A 1UCRA 4MNUA 4PSWA 5FROA 5FFZA 1YRNA 2K9SA 3OS2A 2Y30A 2QKLB 4DBRA 3SHFA 4IOAF 1ZARA 1MJAA 2V1UA 5BS6A 1PJRA 4IHXA 3VPRA 1FOYA 2ZMEB 3DFGA 3FMQA 4MHGA 3QPLA 3A1YA 4BDZA 4EQQA 2HOTA 2O03A 3OYCA 3LAJA 2MSYA 4CO8A 1WH5A 3RDIA 2K27A 1Y56A 2EIJH 2DPDA 1HKSA 4I76A 1ZK8A 4P9UA 1ETOA 3CC7I 4P55A 5FKNA 2XKOA 3LSTA 4PJLA 1RETA 2LMDA 5ED4A 1J75A 1L0OC 2XRLA 2P6TA 4ZDLA 5LFAA 3LA7A 4PFOA 3OYMA 2B0LA 3WG9A 4P5OA 1MBKA 5F1RA 1ZR4A 3H92A 2NYXA 1FYKA 1VQ6I 2EFOA 4ETSA 4CICA 2DODA 4L0ZB 3OY9A 1TLHB 2O3FA 3FIWA 3MAJA 2XPWA 2EZLA 5IPAA 3OYBA 2EV6A 3OOPA 2IA1A 4XL9A 2R0QC 2MD5A 5LGUA 3CP2A 4E7JA 3D5SC 1Z05A 2KP6A 2ACJA 5DCMB 1K78B 5FFXA 2BZTA 4E6KG 2UXNA 2TDXA 1IGNA 2C6YA 2XAGA 4UB6C 1YX3A 1U5TB 1SMYF 3Q0WA 3AL0C 1GVDA 4HX7A 2L3DA 5E1ZB 1SMTA 4ZYDA 3O8HA 4U0WA 2A07F 4A0XA 2NOJB 3GEZA 1BN5A 2ZJ2A 2HDCA 1AHDP 2ISZA 2FQ4A 3M9AA 4NQWA 4B44A 2ZJRF 1FTZA 3LA3A 2PI0A 2Y0MA 2L7MP 3BTJA 3CCUI 2MLGA 1FEXA 2E1MC 3ELKA 4G6DA 2O8KA 2OCCH 1ODDA 2K3FA 3HUGB 1S72I 4M9ZA 4JP0A 1BC8C 2FA5A 3PNTA 5IYCJ 3A4CA 1TW3A 2JN6A 2K9MA 1Z77A 2YX7A 5KCMA 1S29A 4CUGA 1XGOA 4LG3A 2DMPA 2XF5A 3ZMTA 4HLXA 3S93A 3BPVA 4NC7A 2P5KA 3O3KA 3GFIA 2IA2A 2VC0A 1USSA 3BR0A 2ELKA 3RYPA 3C3WA 4HV6A 2KPMA 2M4GA 3FM5A 2RVCA 3PM1A 1S7OA 2H8WA 5D5XB 4EEFG 2QEXI 2VBYA 5K7HA 3QU3A 1BIBA 1RKTA 1JHHA 3G6EI 2PX9A 2WV1A 5TISC 3A03A 3ZP5A 5JR3A 1VZ0A 2EQRA 4KT6A 5E18F 2DO7A 4Y13A 3OWTA 4HBLA 4AM3A 3FKIJ 2A68F 4XRSA 1HLVA 1NK3P 2A69F 2M7AA 4MQVA 4CXFA 3HM5A 2L9VA 3KIOA 3I56I 1ON2A 3KX2A 3HOXJ 1LPQA 1LE8B 4UNOA 2PFBA 3K70D 1MKMA 4AVPA 2L7FP 4DYRA 2D5VA 2WAQN 1EA3A 3KP3A 5DCFA 5L3CA 1WFXA 4BHCA 2GBYA 2OJED 4XLNF 2WB1N 1JXSA 2BOLA 3Q9SA 1PUFA 4ZTFA 2MH2A 3M8JA 2FNPA 4PJMA 1Y39A 1FMVA 3ULQB 1IRZA 5K5OA 2PJPA 1B72B 2HZTA 5HS8A 2CUZA 1FTTA 3I0TA 4B1RA 1R1UA 2A6TA 4HOBA 1XN7A 2KRCA 1O4XA 2W1OA 3JW4A 4D5FA 4XICA 3Q0VA 4NBQA 3C1DA 2V9PA 2ELJA 2OU2A 4KN7X 4FETA 2KIQA 3SXYA 3FXLA 3M3YJ 3VYRB 3HRMA 1G3SA 4J00A 4BU2A 2D1VA 3GO5A 5KHDA 1HXDA 2FOKA 2CW0F 4L9JA 2M30A 2MC4A 1A31A 1G2HA 2HTSA 4B09A 2KL4A 1TP4A 2BY3A 5HNHA 3OYHA 1BJZA 2M0CA 4LIUA 4ZYAA 3ERED 1MMSA 3CUQA 3Q0UA 1X2MA 3BR6A 1KU2A 3SDGA 1MW7A 2GIZA 3F8NA 2LD5A 1VQNI 1VQMI 5M5YJ 4HSTA 4BXUA 2OZ6A 2R7QA 3COAC 3AG2H 2R7WA 5IP7J 4G6QA 3EUAA 1LFUP 1S9HA 2UWMA 3FK6A 1FOWA 2QGUA 3N4MA 4OIPF 4MFDA 1WRJA 3BZCA 1OCRH 3C2BA 3VDXA 2LBFB 2EIMH 3BG9A 4XKWA 3TDZC 4R1HA 2P8TA 3ZQ7A 5J4VA 4IL6C 2X1CA 2PMUA 2QM3A 5J6XA 1IV8A 3PNVA 1ZN2A 2KJBA 2VJIA 4G94A 4XRSG 2YR2A 4A0ZA 2LC2A 1I50J 3FK7A 3H0GJ 4EGYA 1R36A 1A36A 3P9IA 2ETHA 3FX3A 4XLHA 2DMQA 1RR8C 2AS5F 3J80K 2O6GE 4L18B 1X2NA 3IUOA 1XGNA 1FZPB 1VQ7I 1Q1VA 5CKTA 2A5WA 2IGKA 3EUHC 4BJ5C 1IRXA 1FP1D 1OYIA 3H35A 3NARA 1WI3A 2ZFUA 4RB1A 1ONVA 3CCVI 1MBJA 3PFYA 4FQGA 4A3KJ 2XPUA 2N8GA 1LB2A 3BTLA 3KP7A 5JLXA 2Q2EA 4F55A 1HBXG 3CDLA 1ETKA 5L3EA 4ENJA 1JUMA 1LFBA 2IAIA 3RPUD 3FHZA 1FOKA 2RKHA 4HA8A 4DZJA 1QNTA 2E71A 2EFNA 1MMNA 3K0LA 4ZZLA 2EILH 2IBDA 1ETWA 5ILUA 1X4OA 3JRCA 4XN3A 3BQZA 1SANA 1T08B 2A6HF 3H9GA 3CCSI 4RAFA 3GTQJ 2DA3A 4DGWB 1NG7A 4BJ6C 2QCOA 5IP6A 2W57A 4PGHA 3KP4A 4O5VA 1E17A 3HJEA 2K7LA 1BI2A 3ZMUA 3PO3J 3SFIA 5ICGA 1QZEA 3HPGA 3U21A 1WQ2A 3E7LA 4XM3A 1RRJA 2IJLA 2CQNA 4LLGF 5K5RA 4CZCA 2A61A 4UY8I 2V6CA 2NRAC 1SEUA 1OFCX 3KFWX 4PSXA 1M1EB 1IRGA 3W6VA 3A2KA 2HI3A 2DA6A 2XHKA 1KQ0A 2PMZA 2QQ8A 2RREA 2XB0X 3HYIA 2F4OB 4ZYGA 3G73A 3OIPA 5D4SA 1XC5A 2X6XA 4DYCA 5B5EC 4BGDA 2R7RA 2EJRA 1O3QA 2O61A 2P0WA 1W5SA 2XRNA 3SZPA 2ZXHA 3JRHA 1ZAOA 3K4NA 3RIRA 2QSGX 5CQGA 1OKRA 5ILVA 1NG6A 3WE2A 3E6CC 5CVUA 4AD9A 3OS0A 3QPSA 3REOA 2R5ZB 1E0EA 2HEOA 1IF1A 1U3EM 3F22A 1LKXA 3KEOA 4DOZA 4BHPA 4ITVA 4CSWA 3BQYA 3VEPA 1MBEA 1U9NA 2ZMEC 2MH9A 2CU7A 2GQQA 3H5RA 2RQQA 2HQAA 1JT0A 1WHUA 4EMSA 2FU4A 2CQ7A 1XD7A 1XCBA 4ZDPA 3WHCA 1TQIA 2CMPA 3M7GA 2FX0A 4MQ9F 3T8RA 5IT9Z 1MJ9A 2QSFX 1YI2I 2JA5J 3S3MA 1HC8A 3FXQA 2EWNA 5L3DA 3TGNA 3JAMZ 3OYKA 2E2HJ 1WJ5A 3BROA 4LJZF 5LRSA 4TV7A 3H0DA 5TGTA 3QYEA 1WVRA 3PSIA 1YQAA 2H94A 3HRTA 1VQPI 1YITI 4UUVA 3K4KA 4FTHA 3I4PA 5LGTA 1JJ8C 2R3SA 3CCQI 4BH9A 3E5XA 1V55H 2EA4A 1X1AA 3E6MA 5IP9J 1H89C 4XIDA 1X58A 3GCMA 3F9KA 1IDYA 2OF7A 2KDZA 4RS8A 4ZDOA 4N0BA 4HF2A 1Y0UA 3FF5A 4IKFA 2W7NA 2HKXA 3WU0A 1TNTA 1BI1A 1KONA 3ZQLA 1U5TC 2LKSA 2VONA 4G9YA 1H9TA 5F64A 3K70C 3DPUA 5FLMJ 3I4MJ 1E3PA 1KYWA 3NAUA 4Y3OA 1R71A 5C44J 4YFKF 1B9MA 5EF6A 4QWQA 3DU6A 2BHZA 1K7AA 5M5WJ 4XKVA 1MMAA 2DA4A 2DW4A 4CCNA 2OTLI 1HDDC 1V5GA 5DDGA 2JA2A 1H88C 2Y0SA 1Z7UA 1IO2A 2GXGA 4XN0A 2DMTA 3HOSA 4RA2A 1OCCH 1WCMJ 2VPLA 3CESA 3G1LA 3L2WA 2VE8A 2HGCA 2MD0A 4RGXA 3K7AJ 4IRIA 4QTRA 1AOYA 3CCRI 2LR8A 2DXIA 4XBFA 1LVAA 1MNDA 1ORKA 1XSXA 2CQXA 3L2QA 1TBXA 1UZCA 2DDBA 5EZHA 2W25A 5HLHA 2X1DA 1D0ZA 2HDWA 3QOEA 2ZCWA 4AUXA 3CO7C 4ZZDA 2KZGA 1D0YA 1GVJA 5H20A 1R58A 4I02A 1T0FC 1HW1A 3ZQQA 3K4LA 3M1EA 1HDPA 3WG7H 4C3IJ 3DP7A 2MGQA 3M07A 2LKPA 3ABTA 1TT0A 5JVTA 2M8EA 3RJPA 3BP8A 1QO0D 2DOFA 3C18A 4XSXF 4G7OF 2XKPA 4BYYA 2A3SA 2H6BA 1BW5A 3PJRA 1LDJA 3EDPA 3S32A 1P9QC 4OAYA 2X85A 4GGGA 1XPXA 2V26A 2DA2A 2OUMA 1MDMA 2Q1ZB 4CCOA 5FRNA 1R4NB 1R22A 2VOPA 2XV4S 3H9QA 1SFKA 4U7BA 3MVPA 1TWAJ 2ZSIB 4EV0A 4C3HJ 5CVVA 2G0EA 3ZMSA 4ESBA 4BACA 1YJ9I 4A5NA 1JUSA 4HLYA 2UUZA 4CCMA 4I6ZA 4V19K 3R6SA 3A01A 2CWEA 1F5TA 4A93J 2FQ3A 3SDBA 4RB3C 2QF7A 3FXUA 4NC6A 4I2OA 1N25A 3GZNB 3KEQA 3L2CA 4M6YA 2DI3A 5FO5A 1YJNI 2XASA 2FBKA 2CQKA 3U1DA 4DZPA 4A0YA 3VFZA 3AKZA 2ID3A 3GTGJ 2IT0A 1MNMC 2XUBA 1FYLA 1GLNA 3DKXA 5L3BA 4WXHA 4BE0A 1J59A 4U87A 3MQ0A 3NWSA 3HDDA 1YO5C 2XAUA 2RN7A 3WTXC 1IC8A 5H6RA 2HVQA 4KT5C 4ZJZA 3ZR8X 2J5OA 4EJTA 1TQMA 2QA4I 1LFPA 4G12A 3W6KB 1F9NA 3TW7A 3VSLA 4UHTA 1Y1VJ 5F0FA 2ZB9A 2LNBA 2VJ5A 1XMAA 3F6VA 5JI6A 4A3LJ 1UMQA 1GXPA 3HOZJ 1JHFA 4W1UA 3GLXA 2UV1A 2W48A 3BTIA 1GXQA 1K6OA 1NTCA 4I99C 4IZZA 1QHGA 2VJJA 2GIVA 4E4HA 4RGSA 5D4RA 4QLCU 5LLQA 5FLXK 3TEDA 3JRBA 1FP2A 3BG5A 2QVOA 2H1LA 2CW7A 1OCZH 1FT9A 2WB1A 1T6SA 4FX0A 3CMAI 3KZZA 3TL4X 3KZIC 3QOPA 1IN6A 3PQJA 1OLTA 1S5LC 1R9TJ 2O9LA 2L9SA 2PJRA 3DBHB 3R0AA 5D6EA 3GTJJ 2JA6J 1W0UA 4BS9A 4FE4A 4KITB 4ANJA 4OWRB 3RTRA 1XDSA 3ZQGA 1V5EA 3DLLF 3L09A 3QPHA 1K4SA 2LY2A 2JRTA 3M1CA 4B47A 4D7NA 4MEXF 4E70A 1FYMA 5GP9A 2ESNA 2E34A 1HW5A 2E5ZA 2JWTA 1JTYA 5E3LA 4BNCA 4WK8F 1EKEA 1A35A 1GV2A 5TRDA 2HWVA 4PGGA 3O8GA 3I5UA 2M2EA 1X1DA 4L5IA 2VKEA 1N78A 4BAYA 1QPIA 2X4HA 1G4DA 1IN7A 2LF7A 4DW6A 4BEHA 2NS8A 1MH3A 2RC4A 1X1CA 3GUDA 2DAOA 1TW2A 2VODA 3HOUJ 1IV6A 1LQ1A 3DEUA 2ME6A 2H27A 1WJCA 4LGWA 3DF8A 3I55I 4ZC3A 1YYVA 2EH3A 3HHGA 4ENNA 1T95A 1HSTA 1FPQA 1ZQ3P 4RAYA 1IG7A 1L3LA 2LYCA 2Y2ZA 2K86A 5FLVA 1KYZA 2VQHA 3FM3A 4UUTA 3V42A 2GXAA 1FIAA 1WI9A 1FWZA 2YSRA 4IVNA 3MKZA 1N75A 2IA0A 4NQWB 5KVRA 3SQNA 3E5UA 3G71I 2KRFA 3LFKA 3CC2I 3V4GA 3OR2C 3LNQA 2PQ8A 1Z9CA 1IW7F 2WTEA 4FISA 3SEZA 4C2MJ 2PLYA 2NS0A 3FISA 2BW3A 2HXOA 2F4IA 3W2WA 3GW2A 3QPTA 3ZQFA 3G4SI 3BDDA 2V79A 4PJ0C 4OINF 3KP5A 1FBSA 1K4TA 4RAZA 1RKWA 2FMYA 5M3MJ 3CCJI 3B6CA 4EM0B 2DN0A 1BOBA 2M8GX 1SD5A 3BG3A 3CP8A 5J1YA 2ME0A 4DJAA 5IT9K 1KQ8A 2ZXWH 2LREA 1ZGAA 1XX5A 3JAMK 1OR7C 3WTUC 3DWLE 2BV6A 2B63J 2XROA 1FBUA 1C0WA 3BG7A 3JRFA 1RPWA 2ID6A 1P7IA 1MJBA 2O8XA 3S1MJ 4IHSA 5B1BH 1BR4A 4Y4RA 3U2RA 4I09A 1BA5A 1IN8A 4XKCA 2QQBA 2NVXJ 1GUUA 2F4MB 2TCTA 2Y75A 1R00A 2H8RA 4GFBA 4CYDA 3RQ4A 4A3EJ 5BQTA 1BI0A 3H3UA 3K10A 3K4CA 4ESFA 4RBOA 1POGA 5J3LA 2ELHA 3KYDB 2DTRA 3H3VK 3VODA 2RV8A 2Z99A 3QP5A 4BY7J 4OIQF 2DU9A 3CO6C 3ZN0A 1Y1WJ 3I4NJ 2W84A 4XOPA 2OD5A 1YTYA 1J2XA 5J8FA 1OPCA 1EH7A 2K4JA 1BM9A 2FRHA 4YIRX 1PUFB 2R7DA 3AG4H 4D5CA 5KAFC 5FD5A 2DFHA 1U8RA 5F0CA 4M71A 3ABUA 5E3MA 4RMNA 4KN4X 2XAHA 3N05A 1ZG5A 2BBYA 3A0BC 4RLFA 2WC2A 1TWGJ 2R5YA 5H2FC 2E2IJ 3D5RC 4YFXF 1HKQA 2Z5UA 4B8XA 4M3GA 1P6RA 4IHWA 4RM2A 3DU5A 1I39A 2VB6A 3FXMA 1QGPA 4YIFA 1ZREA 4WCGA 4FT8A 2VXDA 2XF6A 4BHBA 2YU3A 1G3WA 3TOBA 3DTEA 1RIOH 4HF0A 2VBWA 1HF0A 2NVUB 4XLCA 2XSDC 3H36A 1DPUA 1MSFC 3ZQHA 3BTCA 4XRFA 1V54H 2DQLA 2KZVA 2JRMA 2E36A 2VASA 3GBGA 3CUQB 4HNVA 2CJJA 4EJUA 2OQGA 3NEUA 3A02A 1D0XA 1RR7A 2VN2A 5D8KB 1DU0A 2E7XA 3WODF 1X1PA 4G8XA 2MG4A 2XDVA 3ECOA 1XDUA 1R49A 1TTYA 2UXXA 4OAZA 3P9CA 3L1PA 1YJWI 2BGCA 2DMNA 4WXDA 2FEZA 5HVQC 1VQOI 4M6VA 2NNYA 5D5VB 4V2FA 3QP6A 4XORA 3CQZJ 1VF9A 2NOGA 3BY6A 2F5EA 2PBIA 4JBAA 1U6GA 4CCLA 1UJ8A 2CW8A 4O3MA 1A6QA 1K61A 1T33A 1BR2A 2V9KA 5AIQA 1REPC 1YS7A 5EG0A 4UV9A 3CCEI 1S7AA 1F36A 1D8JA 4CHUA 2R4GA 4GO1A 2GLOA 4MIMA 1AKHA 3LFUA 4M9XA 3WTYC 4HV5A 1A04A 4B4CA 2FUG2 3CJNA 3GTPJ 3OSFA 1SVMA 1Z3YA 2L01A 1YIOA 2ZC2A 1CGPA 2Q2EB 2VI6A 3MKWB 1E3OC 3CMEI 1ERDA 1IRFA 3JREA 4B3AA 2BXZA 2DK5A 4JOMA 3Q5FA 1ZG1A 2R93J 4HNUA 2BHYA 2X9DA 1MMGA 5B66C 2EFQA 1P4XA 2EFPA 4CYCA 2Y9ZA 5HS7A 3PQKA 3BPXA 3OOUA 2LY9A 1B1BA 4JX4A 3V7CA 3CLOA 3J7AY 3PUFA 1UG0A 2VBXA 4N9HA 2KKOA 3IKVA 3ZOBA 5JHUA 3ONQA 2PG4A 2HYJA 3JRIA 3DBLB 2QBYA 1DPRA 2BEOA 2KFDA 3J7ZI 3I9V2 1G3TA 3GTKJ 4XLPF 2FD5A 2WAFA 3BCAA 3GXOA 3K6GA 2HQ5A 2HQRA 1XS9A 2L4MA 4AU7A 1MIJA 1KZHA 4XLFA 5D5UB 3GZ6A 2MABA 2K9NA 2DK8A 3I3LA 2HU9A 2JPCA 3OIQA 4UXNA 1B6AA 3K1MA 3LSGA 2TRTA 3ABMH 4KA4A 1LEBA 1HOMA 3C2HA 4LG0A 2LDUA 2DTZA 3CD6I 3DEEA 3KP2A 3J81Z 2MBFA 3CJTB 3DPLC 3WGHA 4EJVA 5IT3A 4A6DA 4MLOA 1DDNA 3OL3A 4YFNF 3F21A 5LD2C 2Z1DA 4GXOA 1HA8A 2CH0A 4M9SA 4BQQA 2ZBKA 4OMYA 1IXRC 5EGOA 3BT9A 5E1XA 4O6JA 4A3GJ 4ZH4F 2F5CA 4DBQA 3WTSC 1R7JA 5E3OA 5LHGA 3HOVJ 2E1OA 4II3A 3IWFA 1XSVA 2D1HA 5EEHA 2NVYJ 1Z6TA 5K1YA 3RKXA 4HW0A 1WZ2A 2A5YB 3V7SA 2QUFA 1WGXA 1SVLA 2GOXB 3A0HC 4RGUA 3JR9A 1ON1A 1TT5B 3R60A 3ZGKA 4E7SA 4PCQA 4NB5A 3L00A 3SFZA 1FY7A 3TDUC 2QWWA 3IRQA 3Q9VA 1SFOJ 3MKYB 4E7IA 4PFPA 3MCZA 1KU3A 2K9QA 1U2WA 2HZDA 2H09A 1MMDA 3ROUA 2F5DA 2MC3A 2E19A 4IJAA 1HW2A 3CF2A 4HQEA 3MEXA 3KEYA 3HKZN 2X1EA 3PIOF 2LRDA 2CFOA 2AQFA 2CUFA 2O0YA 2VPRA 1E3HA 2VE9A 4AIHA 2DQRA 1T56A 2JA7J 4JX6A 1RI7A 1T98A 1X19A 2CQQA 2XPVA 4N4OB 3S16J 2GA1A 4G7HF 4GDFA 1TWCJ 3JCUC 2OAZA 3GTMJ 4RGRA 2JPBA 5FGMA 3FDYA 2P5LC 1Z7LA 3F72A 3TO7A 3ZQCA 1D1BA 2MW8A 2JQ7A 4AIJA 4D0PA 1UB9A 3D1NI 4ESJA 5JHFA 4IPAA 3VB2A 1DU6A 2B7EA 3L2RA 1O3SA 1O3RA 2OPTA 1FMWA 1GDTA 5A2QZ 5CQEA
chains in the Genus database with same CATH topology
3E6DA 1DUXC 2STTA 1R1VA 1QBJA 2HS5A 3HTSB 4I01A 2DBBA 2CGPA 2P4WA 2P5VA 1R23A 2VC1A 4HDVA 1FBQA 3KCCA 4LB5A 1YW9A 3E3VA 3WTWC 2HKOA 1STZA 2IW5A 3MZYA 3I53A 5E8GA 4LK1F 2GWRA 2QLZA 1WWXA 1FNNA 1U78A 5ILSA 3LA2A 4KNYA 1QPMA 1FX7A 3EYIA 1YW8A 4A6EA 4HYEA 4M6XA 1XSDA 3D0SA 3WGIA 3JTGA 1ZGJA 3ISPA 2FBIA 4DQ2A 1PDNC 3MFKA 5LEJA 2EV0A 1OYYA 4Q48A 5D6FA 1B4AA 2DLLA 5E1WA 5BPIA 2Z33A 3ZPLA 2W24A 3CUOA 2CG4A 3FZVA 2JTVA 2L4AA 3DPTA 4YIIA 1G3YA 1PP8F 3B02A 2KIUA 1SFEA 5JFRA 3E97A 3I59A 2OA4A 1SFUA 3BOQA 3LQRA 4M74A 3CUQC 2RDPA 1SAXA 3K1NA 4L0YB 3R0JA 3KLOA 1SD6A 3FMRA 2M45A 2Q8KA 4UVBA 3V8KA 4S05A 4KMUX 2IRFG 3ML6A 4L9TA 5HDKA 2STWA 1MZBA 1ZRDA 2QQ9A 4AIKA 2MLKA 3O6BB 3QRFF 2X0LA 1ZHFA 5HS9A 2LF8A 3FXRA 3WTTC 1YW7A 4DNCA 4R8HA 2OZUA 5H6QA 5E17F 2G9WA 1CF7B 5D8LB 1MD0A 2XGXA 1MGTA 4KIBA 4PDKA 3GFLA 4HF1A 2JT1A 3HTUA 4HQMA 1W5TA 3TO9A 2FE3A 4IRGA 2EA2A 2F2EA 1P4AA 2YX4A 5ERIA 3TO6A 3GWZA 6PAXA 1FC3A 1KGSA 3T1BA 2ZXJA 5L3GA 5FB2A 5DUKA 1D8KA 4GYGA 3I54A 2BE5F 2DFIA 3M8EA 4OMZA 4XSZF 3EYYA 1T38A 1R5GA 5E8IA 2VT3A 1S6LA 1B59A 1JE8A 4UVAA 3MZHA 1R5HA 3GYHX 2W85A 4OIRF 1RNLA 2IP2A 3NQOA 1QZYA 3IKTA 1XMKA 1UHWA 3IWZA 4L9VA 1P4WA 4MTEA 5LHIA 2QQAA 1ZRFA 4EJOA 3J7AO 3PFIA 5BOXA 3FWEA 2XVCA 3EUHA 3HRSA 1W7PA 4I0BA 1IAWA 1B9NA 5BMZA 4M73A 1HQCA 2KIFA 1ZYRF 1O3TA 3K1PA 3U9GA 5E20A 3B73A 2HR3A 2ZNYA 1J0RA 5CVRA 3F6OA 2G7UA 4CGZA 4YG2F 3S2WA 1FSHA 1ZG3A 5CJ9A 2VOOA 3CDHA 4NHJA 4P9FA 1SD7A 5A2QK 3P7NA 2K02A 4ON0A 4L5JA 2HFHA 3HIFA 2PEXA 3FMSA 5LHHA 4ENKA 3CTAA 3G3ZA 2Z9OA 4L9NA 2RQPA 4LLLA 2V9VA 3D5LA 3GF2A 2VT2A 4Q4ZF 1I27A 5ICEA 2ISYA 1D5VA 2L54A 1G6NA 4MTDA 1SFXA 3L7WA 3ZMVA 4KDPA 2GAUA 3T0YA 5HLGA 2ZMEA 3IC7A 4Y17A 5HOOA 3R4KA 3I71A 4HX4A 5AONA 3MWMA 5LGNA 1BOAA 1Q1HA 3K2ZA 3JSOA 3DV8A 1VTNC 2FSWA 5AIPA 4EJWA 4AWXB 1KA8A 2E1CA 4KFCA 1D3YA 3WGGA 1R1TA 2NAZA 4FX4A 1LNWA 3RYRA 4N9IA 1P2FA 1NHAA 4K2EA 1ZRCA 1I1GA 2LSOA 4PZJA 2Y48A 3TKYA 1X3UA 4BQAA 1UHMA 2XAFA 5DCMA 1K78A 2EK5A 3HRUA 1U5TA 3E6BA 1ZLJA 3F8FA 4LB6B 3T8TA 2HQNA 4G7ZF 3WTVC 3F8MA 4KMFA 1KQ9A 3P9KA 3O2PE 3HUGA 1IUYA 3WE3A 2QBYB 4MEYF 2GA2A 3V7RA 1I1SA 4U0YA 4KIGA 5DEQA 2XAQA 3QU6A 1BIAA 3OV8A 4LD5A 1OMIA 2WV0A 4GCVA 2YPRA 3K69A 4WXCA 3HSEA 2DT5A 1T0FA 4LG0B 3JSPA 2FNAA 2E1NA 4Q47A 4ZYHA 3LWFA 2Z3YA 1AWCA 3BJAA 4A12A 3K9TA 1OYWA 2J5PA 1YLFA 5DYMA 5CLSA 3HHHA 1BC7C 2RNJA 2KJCA 3WTZA 1Z91A 2XIGA 4ASNA 5DUIA 3JTHA 1XGMA 1I5ZA 3GFMA 1BI3A 1W4MA 1UFMA 4Y15A 3GX4X 2FF4A 4JQFA 4FHTA 3R61A 1IN4A 1IXSB 5J8CA 5CVIA 1K79A 2Q0OA 1IZ1A 1T39A 5HDGA 3E5QA 5FLXZ 3RPUA 2FMLA 5ICFA 4HAMA 3IHUA 4P96A 2ADUA 2V1XA 4EM2A 5DV5A 3LQQA 4HX8A 4OU0A 1F1ZA 3TOAA 1LJ9A 2ZNZA 2G7HA 1XGSA 1O57A 4KICA 4LK0F 2IPQX 5L3FA 5HDNA 1S3JA 2HOEA 1XB4A 3HOTA 1LEAA 4MGRA 5CYVA 4WF2A 3IL2A 1KU9A 4M72A 3W6JB 5DD8A 5ICCA 3GZ5A 3EQLF 4CDGA 1J7KA 1RZ4A 1IXCA 3KETA 3H3ZA 1PUEE 1JGSA 3GVAA 3DKWA 4KIFA 2ESHA 2QENA 1WKMA 3LAPA 1EH8A 3AAFA 1EH6A 4F7ZA 1DP7P 1O7LA 1YFHA 2M1BA 1LDDA 2M5WA 1J9IA 2ZO4A 4EVIA 1ULYA 4GYIA 1YS6A 2H6CA 5LEKA 3EETA 1I6XA 5TJJA 1KU7A 4Q5SF 4I0AA 2AXLA 4RB2C 2FXAA 4IRHA 1O7FA 2OBPA 2V1DA 3BWGA 1P92A 1ZH5A 4IF4A 3HSRA 3ZMDA 3KP6A 3F3XA 4U88A 3BJ6A 3KLNA 4OIOF 2MA3A 2CFXA 3I59B 4IHTA 5FD6A 3VOEA 1MDMB 4LFUA 3ZMZA 2EB7A 2A6EF 1OR7A 3L9FA 2IVMA 4LMYA 2P7CB 3GFJA 3IRRA 1USTA 3NRVA 1QQIA 4JK1X 2HYFA 4U7DA 3KE2A 2P6SA 4ZYEA 5BPDA 1TNSA 2HYGD 4UVCA 3WU1B 3ZN1A 4A5MA 3BZ6A 2PN6A 1WSUA 1V4RA 3F8CA 1S8NA 2JSCA 3DXJF 2UZKA 2XAJA 3T5XA 2JZYA 1TQPA 1H0MA 1PP7U 3I64A 2PMHA 2QZ8A 2D2WA 2RGVA 4KUMA 2CSOA 2NNNA 3RI4A 2ZFWA 5K5QA 2KIMA 4R79A 4KYWA 2EV5A 2D45A 1Z6RA 4CZZA 4LLNA 2CO5A 2VXZA 4H0EA 4EM1A 3C7JA 1ZLKA 1FSEA 4WX9A 3V8JA 2GZWA 2K4BA 2OQRA 4I98B 1RUOA 4WWCA 1EV7A 4EGZA 1V3FA 1T2KA 3V8LA 1FLIA 3QAHA 2CYYA 2DPUA 3F8BA 3RPQA 3RKYA 3KZYA 3SZTA 3F23A 1RUNA 2EFWA 1H9GA 5D5WB 2ZKZA 1QZZA 3RKWA 4A2UA 3BJOA 1LDKB 3HSFA 3N97A 3J80Z 1W7PB 4ENMA 4RB0A 4I7HA 2F5FA 5LRRA 4Z2YA 3J81K 1E2XA 2WWYA 2E7WA 5HLIA 2R7FA 1BJAA 1YG2A 2P7VB 4HZFA 2COMA 2BYVE 2VBZA 5CVJA 2FBHA 1F4KA 2GXBA 3ECHA 4HDUA 1GHCA 1IN5A 3TQNA 3DQVC 4OOIA 4S04A 1CF7A 5F6FA 5LBQA 3M8FA 5KK1A 1HSJA 4IXAA 5DD4A 1XCVA 4U0VA 5EEGA 2QYOA 3I58A 1SD4A 2M87A 1HKTA 2L02A 1Z1DA 1J5YA 2HTJA 4UV8A 1BBYA 1W7PD 1UCRA 4MNUA 5FFZA 3SHFA 1ZARA 1MJAA 2V1UA 5BS6A 2ZMEB 3DFGA 3FMQA 4MHGA 4EQQA 2O03A 3LAJA 4CO8A 3RDIA 2K27A 2DPDA 1HKSA 4P9UA 4P55A 2XKOA 3LSTA 5ED4A 1J75A 1L0OC 2P6TA 3LA7A 2B0LA 3WG9A 4P5OA 5F1RA 3H92A 2NYXA 1FYKA 2EFOA 4ETSA 4CICA 4L0ZB 1TLHB 2O3FA 3MAJA 2EV6A 3OOPA 2IA1A 2MD5A 5LGUA 1Z05A 2ACJA 5DCMB 1K78B 5FFXA 2UXNA 2TDXA 2C6YA 2XAGA 1U5TB 1SMYF 4HX7A 2L3DA 5E1ZB 1SMTA 4ZYDA 4U0WA 2A07F 4A0XA 3GEZA 1BN5A 2ZJ2A 2HDCA 2ISZA 3M9AA 4NQWA 3LA3A 2PI0A 2Y0MA 2MLGA 3ELKA 4G6DA 1ODDA 4M9ZA 1BC8C 2FA5A 1TW3A 2YX7A 1S29A 1XGOA 3ZMTA 4HLXA 3BPVA 2P5KA 3O3KA 3GFIA 2IA2A 2VC0A 1USSA 3RYPA 3C3WA 4HV6A 3FM5A 2RVCA 1S7OA 5D5XB 2VBYA 3QU3A 1BIBA 1JHHA 3ZP5A 5JR3A 5E18F 2DO7A 4Y13A 4HBLA 2A68F 2A69F 4MQVA 4CXFA 1ON2A 4UNOA 2PFBA 1MKMA 4AVPA 3KP3A 5DCFA 5L3CA 4BHCA 4XLNF 1JXSA 3Q9SA 2MH2A 2FNPA 3ULQB 5K5OA 2PJPA 2HZTA 5HS8A 3I0TA 1R1UA 4HOBA 1XN7A 3JW4A 3C1DA 2OU2A 4KN7X 3SXYA 3HRMA 1G3SA 2D1VA 3GO5A 1HXDA 2FOKA 2CW0F 4L9JA 2M30A 2HTSA 4B09A 3ERED 3CUQA 1KU2A 3F8NA 4BXUA 2OZ6A 3COAC 4G6QA 2UWMA 3N4MA 4OIPF 1WRJA 3TDZC 4R1HA 2P8TA 3ZQ7A 2PMUA 2QM3A 5J6XA 1ZN2A 2KJBA 4G94A 2YR2A 4A0ZA 4EGYA 1R36A 3P9IA 2ETHA 3FX3A 2AS5F 3J80K 2O6GE 4L18B 1XGNA 1FZPB 1FP1D 1OYIA 4RB1A 1ONVA 1LB2A 3KP7A 2Q2EA 1HBXG 5L3EA 4ENJA 3FHZA 1FOKA 2RKHA 4HA8A 1QNTA 2EFNA 3K0LA 4ZZLA 5ILUA 2A6HF 2W57A 4PGHA 3KP4A 4O5VA 1E17A 2K7LA 1BI2A 3ZMUA 5ICGA 1WQ2A 2IJLA 4LLGF 5K5RA 2A61A 2V6CA 2NRAC 3KFWX 1IRGA 2XHKA 1KQ0A 3G73A 3HYIA 4ZYGA 5D4SA 1O3QA 2EJRA 2O61A 1W5SA 2XRNA 3SZPA 1ZAOA 3RIRA 1OKRA 5ILVA 3WE2A 3E6CC 5CVUA 4AD9A 3REOA 2HEOA 1IF1A 1U3EM 3F22A 3KEOA 4BHPA 3VEPA 2MH9A 2GQQA 4EMSA 2FU4A 1XD7A 1XCBA 1TQIA 3M7GA 4MQ9F 3T8RA 5IT9Z 1MJ9A 3FXQA 2EWNA 5L3DA 3TGNA 3JAMZ 3BROA 4LJZF 5LRSA 4TV7A 1YQAA 2H94A 3HRTA 4UUVA 3I4PA 5LGTA 2R3SA 4BH9A 3E5XA 2EA4A 3E6MA 4RS8A 4N0BA 4HF2A 1Y0UA 3FF5A 2HKXA 3WU0A 1TNTA 1BI1A 1U5TC 2VONA 4G9YA 1H9TA 5F64A 1KYWA 4YFKF 1B9MA 4QWQA 1K7AA 2DW4A 5DDGA 1Z7UA 2GXGA 3HOSA 2VE8A 2HGCA 4RGXA 4IRIA 1AOYA 4XBFA 1LVAA 1XSXA 1TBXA 2W25A 5HLHA 2ZCWA 3CO7C 4ZZDA 1GVJA 5H20A 1R58A 4I02A 1HW1A 3M1EA 3DP7A 2LKPA 3ABTA 5JVTA 2M8EA 3RJPA 3BP8A 1QO0D 3C18A 4XSXF 4G7OF 2XKPA 4BYYA 2A3SA 2H6BA 1LDJA 3EDPA 4GGGA 1MDMA 1R22A 2VOPA 2XV4S 4U7BA 4EV0A 5CVVA 3ZMSA 4ESBA 4A5NA 4HLYA 3R6SA 2CWEA 1F5TA 2FQ3A 4RB3C 3FXUA 4I2OA 3KEQA 3L2CA 4M6YA 2DI3A 5FO5A 2XASA 2FBKA 2CQKA 3U1DA 4A0YA 3VFZA 2IT0A 2XUBA 1FYLA 5L3BA 1J59A 4WXHA 3MQ0A 1YO5C 2RN7A 3WTXC 5H6RA 4KT5C 2J5OA 4EJTA 1TQMA 3W6KB 1F9NA 4UHTA 2LNBA 1XMAA 3F6VA 5JI6A 1GXPA 1JHFA 3GLXA 1GXQA 1K6OA 2GIVA 4RGSA 5D4RA 4QLCU 5LLQA 5FLXK 1FP2A 2QVOA 1FT9A 1T6SA 4FX0A 3KZZA 3QOPA 1IN6A 3PQJA 3R0AA 5D6EA 3RTRA 1XDSA 3L09A 3QPHA 2JRTA 4MEXF 4E70A 1FYMA 2ESNA 1HW5A 4BNCA 4WK8F 5TRDA 2HWVA 4PGGA 3I5UA 4L5IA 4BAYA 2X4HA 1G4DA 1IN7A 2LF7A 2RC4A 3GUDA 2DAOA 1TW2A 2VODA 1LQ1A 3DEUA 2H27A 4LGWA 3DF8A 1YYVA 4ENNA 3HHGA 1HSTA 1FPQA 4RAYA 1L3LA 2K86A 1KYZA 3FM3A 1WI9A 1FWZA 2YSRA 4IVNA 2IA0A 5KVRA 3SQNA 3E5UA 2KRFA 3LFKA 3V4GA 2PQ8A 1Z9CA 1IW7F 2WTEA 2PLYA 2NS0A 3GW2A 3QPTA 3BDDA 2V79A 4OINF 3KP5A 1FBSA 4RAZA 2FMYA 4EM0B 1KQ8A 1SD5A 5IT9K 1ZGAA 3JAMK 3WTUC 2BV6A 2XROA 1FBUA 1C0WA 1MJBA 2O8XA 4IHSA 3U2RA 4I09A 1IN8A 2QQBA 2Y75A 1R00A 4CYDA 5BQTA 1BI0A 3H3UA 4ESFA 2ELHA 2DTRA 3VODA 2RV8A 2Z99A 3QP5A 4OIQF 2DU9A 3CO6C 3ZN0A 2W84A 1YTYA 2OD5A 1J2XA 5J8FA 1OPCA 1EH7A 2K4JA 1BM9A 2FRHA 2R7DA 5FD5A 1U8RA 4M71A 3ABUA 4KN4X 2XAHA 1ZG5A 2BBYA 2WC2A 4YFXF 1HKQA 2Z5UA 4B8XA 1P6RA 1QGPA 4YIFA 1ZREA 4WCGA 4FT8A 4BHBA 2YU3A 1G3WA 3TOBA 1RIOH 4HF0A 2VBWA 1DPUA 4XRFA 2DQLA 3CUQB 4EJUA 2OQGA 3NEUA 5D8KB 2VN2A 2E7XA 3WODF 4G8XA 3ECOA 1XDUA 1TTYA 2UXXA 3P9CA 2BGCA 4WXDA 2FEZA 5HVQC 2NNYA 5D5VB 3QP6A 3BY6A 2F5EA 2PBIA 4JBAA 1U6GA 4O3MA 5AIQA 1REPC 1YS7A 4UV9A 1S7AA 1D8JA 4CHUA 4GO1A 4M9XA 3WTYC 4HV5A 1A04A 3CJNA 2L01A 1YIOA 1CGPA 1IRFA 2DK5A 3Q5FA 1ZG1A 2EFQA 1P4XA 2EFPA 5HS7A 3PQKA 3BPXA 1B1BA 3V7CA 3CLOA 2VBXA 4N9HA 2KKOA 3IKVA 5JHUA 2PG4A 2QBYA 1DPRA 2BEOA 1G3TA 4XLPF 3GXOA 2HQRA 2L4MA 5D5UB 3GZ6A 2DK8A 2JPCA 4UXNA 1B6AA 3K1MA 4KA4A 1LEBA 4LG0A 2LDUA 3KP2A 3J81Z 2MBFA 3WGHA 3DPLC 4EJVA 5IT3A 4A6DA 1DDNA 4YFNF 3F21A 4GXOA 4M9SA 2ZBKA 4OMYA 1IXRC 5E1XA 4O6JA 4ZH4F 2F5CA 3WTSC 1R7JA 5LHGA 3IWFA 1XSVA 2D1HA 5EEHA 1Z6TA 5K1YA 3RKXA 4HW0A 2A5YB 3V7SA 2QUFA 4RGUA 1ON1A 3R60A 4PCQA 4NB5A 3L00A 3SFZA 3TDUC 1FY7A 2QWWA 3IRQA 3Q9VA 3MCZA 1KU3A 1U2WA 2H09A 3ROUA 2F5DA 2MC3A 4IJAA 1HW2A 4HQEA 3MEXA 2O0YA 2VE9A 4AIHA 2DQRA 1RI7A 1T98A 2GA1A 4G7HF 2OAZA 4RGRA 2JPBA 5FGMA 2P5LC 3F72A 3TO7A 4AIJA 4D0PA 1UB9A 4ESJA 4IPAA 3VB2A 1O3SA 1O3RA 5A2QZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6D A;  1DUX C;  2STT A;  1R1V A;  1QBJ A;  2HS5 A;  3HTS B;  4I01 A;  2DBB A;  2CGP A;  2P4W A;  2P5V A;  1R23 A;  2VC1 A;  4HDV A;  1FBQ A;  3KCC A;  4LB5 A;  1YW9 A;  3E3V A;  3WTW C;  2HKO A;  1STZ A;  2IW5 A;  3MZY A;  3I53 A;  5E8G A;  4LK1 F;  2GWR A;  2QLZ A;  1WWX A;  1FNN A;  1U78 A;  5ILS A;  3LA2 A;  4KNY A;  1QPM A;  1FX7 A;  3EYI A;  1YW8 A;  4A6E A;  4HYE A;  4M6X A;  1XSD A;  3D0S A;  3WGI A;  3JTG A;  1ZGJ A;  3ISP A;  2FBI A;  4DQ2 A;  1PDN C;  3MFK A;  5LEJ A;  2EV0 A;  1OYY A;  4Q48 A;  5D6F A;  1B4A A;  2DLL A;  5E1W A;  5BPI A;  2Z33 A;  3ZPL A;  2W24 A;  3CUO A;  2CG4 A;  3FZV A;  2JTV A;  2L4A A;  3DPT A;  4YII A;  1G3Y A;  1PP8 F;  3B02 A;  2KIU A;  1SFE A;  5JFR A;  3E97 A;  3I59 A;  2OA4 A;  1SFU A;  3BOQ A;  3LQR A;  4M74 A;  3CUQ C;  2RDP A;  1SAX A;  3K1N A;  4L0Y B;  3R0J A;  3KLO A;  1SD6 A;  3FMR A;  2M45 A;  2Q8K A;  4UVB A;  3V8K A;  4S05 A;  4KMU X;  2IRF G;  3ML6 A;  4L9T A;  5HDK A;  2STW A;  1MZB A;  1ZRD A;  2QQ9 A;  4AIK A;  2MLK A;  3O6B B;  3QRF F;  2X0L A;  1ZHF A;  5HS9 A;  2LF8 A;  3FXR A;  3WTT C;  1YW7 A;  4DNC A;  4R8H A;  2OZU A;  5H6Q A;  5E17 F;  2G9W A;  1CF7 B;  5D8L B;  1MD0 A;  2XGX A;  1MGT A;  4KIB A;  4PDK A;  3GFL A;  4HF1 A;  2JT1 A;  3HTU A;  4HQM A;  1W5T A;  3TO9 A;  2FE3 A;  4IRG A;  2EA2 A;  2F2E A;  1P4A A;  2YX4 A;  5ERI A;  3TO6 A;  3GWZ A;  6PAX A;  1FC3 A;  1KGS A;  3T1B A;  2ZXJ A;  5L3G A;  5FB2 A;  5DUK A;  1D8K A;  4GYG A;  3I54 A;  2BE5 F;  2DFI A;  3M8E A;  4OMZ A;  4XSZ F;  3EYY A;  1T38 A;  1R5G A;  5E8I A;  2VT3 A;  1S6L A;  1B59 A;  1JE8 A;  4UVA A;  3MZH A;  1R5H A;  3GYH X;  2W85 A;  4OIR F;  1RNL A;  2IP2 A;  3NQO A;  1QZY A;  3IKT A;  1XMK A;  1UHW A;  3IWZ A;  4L9V A;  1P4W A;  4MTE A;  5LHI A;  2QQA A;  1ZRF A;  4EJO A;  3J7A O;  3PFI A;  5BOX A;  3FWE A;  2XVC A;  3EUH A;  3HRS A;  1W7P A;  4I0B A;  1IAW A;  1B9N A;  5BMZ A;  4M73 A;  1HQC A;  2KIF A;  1ZYR F;  1O3T A;  3K1P A;  3U9G A;  5E20 A;  3B73 A;  2HR3 A;  2ZNY A;  1J0R A;  5CVR A;  3F6O A;  2G7U A;  4CGZ A;  4YG2 F;  3S2W A;  1FSH A;  1ZG3 A;  5CJ9 A;  2VOO A;  3CDH A;  4NHJ A;  4P9F A;  1SD7 A;  5A2Q K;  3P7N A;  2K02 A;  4ON0 A;  4L5J A;  2HFH A;  3HIF A;  2PEX A;  3FMS A;  5LHH A;  4ENK A;  3CTA A;  3G3Z A;  2Z9O A;  4L9N A;  2RQP A;  4LLL A;  2V9V A;  3D5L A;  3GF2 A;  2VT2 A;  4Q4Z F;  1I27 A;  5ICE A;  2ISY A;  1D5V A;  2L54 A;  1G6N A;  4MTD A;  1SFX A;  3L7W A;  3ZMV A;  4KDP A;  2GAU A;  3T0Y A;  5HLG A;  2ZME A;  3IC7 A;  4Y17 A;  5HOO A;  3R4K A;  3I71 A;  4HX4 A;  5AON A;  3MWM A;  5LGN A;  1BOA A;  1Q1H A;  3K2Z A;  3JSO A;  3DV8 A;  1VTN C;  2FSW A;  5AIP A;  4EJW A;  4AWX B;  1KA8 A;  2E1C A;  4KFC A;  1D3Y A;  3WGG A;  1R1T A;  2NAZ A;  4FX4 A;  1LNW A;  3RYR A;  4N9I A;  1P2F A;  1NHA A;  4K2E A;  1ZRC A;  1I1G A;  2LSO A;  4PZJ A;  2Y48 A;  3TKY A;  1X3U A;  4BQA A;  1UHM A;  2XAF A;  5DCM A;  1K78 A;  2EK5 A;  3HRU A;  1U5T A;  3E6B A;  1ZLJ A;  3F8F A;  4LB6 B;  3T8T A;  2HQN A;  4G7Z F;  3WTV C;  3F8M A;  4KMF A;  1KQ9 A;  3P9K A;  3O2P E;  3HUG A;  1IUY A;  3WE3 A;  2QBY B;  4MEY F;  2GA2 A;  3V7R A;  1I1S A;  4U0Y A;  4KIG A;  5DEQ A;  2XAQ A;  3QU6 A;  1BIA A;  3OV8 A;  4LD5 A;  1OMI A;  2WV0 A;  4GCV A;  2YPR A;  3K69 A;  4WXC A;  3HSE A;  2DT5 A;  1T0F A;  4LG0 B;  3JSP A;  2FNA A;  2E1N A;  4Q47 A;  4ZYH A;  3LWF A;  2Z3Y A;  1AWC A;  3BJA A;  4A12 A;  3K9T A;  1OYW A;  2J5P A;  1YLF A;  5DYM A;  5CLS A;  3HHH A;  1BC7 C;  2RNJ A;  2KJC A;  3WTZ A;  1Z91 A;  2XIG A;  4ASN A;  5DUI A;  3JTH A;  1XGM A;  1I5Z A;  3GFM A;  1BI3 A;  1W4M A;  1UFM A;  4Y15 A;  3GX4 X;  2FF4 A;  4JQF A;  4FHT A;  3R61 A;  1IN4 A;  1IXS B;  5J8C A;  5CVI A;  1K79 A;  2Q0O A;  1IZ1 A;  1T39 A;  5HDG A;  3E5Q A;  5FLX Z;  3RPU A;  2FML A;  5ICF A;  4HAM A;  3IHU A;  4P96 A;  2ADU A;  2V1X A;  4EM2 A;  5DV5 A;  3LQQ A;  4HX8 A;  4OU0 A;  1F1Z A;  3TOA A;  1LJ9 A;  2ZNZ A;  2G7H A;  1XGS A;  1O57 A;  4KIC A;  4LK0 F;  2IPQ X;  5L3F A;  5HDN A;  1S3J A;  2HOE A;  1XB4 A;  3HOT A;  1LEA A;  4MGR A;  5CYV A;  4WF2 A;  3IL2 A;  1KU9 A;  4M72 A;  3W6J B;  5DD8 A;  5ICC A;  3GZ5 A;  3EQL F;  4CDG A;  1J7K A;  1RZ4 A;  1IXC A;  3KET A;  3H3Z A;  1PUE E;  1JGS A;  3GVA A;  3DKW A;  4KIF A;  2ESH A;  2QEN A;  1WKM A;  3LAP A;  1EH8 A;  3AAF A;  1EH6 A;  4F7Z A;  1DP7 P;  1O7L A;  1YFH A;  2M1B A;  1LDD A;  2M5W A;  1J9I A;  2ZO4 A;  4EVI A;  1ULY A;  4GYI A;  1YS6 A;  2H6C A;  5LEK A;  3EET A;  1I6X A;  5TJJ A;  1KU7 A;  4Q5S F;  4I0A A;  2AXL A;  4RB2 C;  2FXA A;  4IRH A;  1O7F A;  2OBP A;  2V1D A;  3BWG A;  1P92 A;  1ZH5 A;  4IF4 A;  3HSR A;  3ZMD A;  3KP6 A;  3F3X A;  4U88 A;  3BJ6 A;  3KLN A;  4OIO F;  2MA3 A;  2CFX A;  3I59 B;  4IHT A;  5FD6 A;  3VOE A;  1MDM B;  4LFU A;  3ZMZ A;  2EB7 A;  2A6E F;  1OR7 A;  3L9F A;  2IVM A;  4LMY A;  2P7C B;  3GFJ A;  3IRR A;  1UST A;  3NRV A;  1QQI A;  4JK1 X;  2HYF A;  4U7D A;  3KE2 A;  2P6S A;  4ZYE A;  5BPD A;  1TNS A;  2HYG D;  4UVC A;  3WU1 B;  3ZN1 A;  4A5M A;  3BZ6 A;  2PN6 A;  1WSU A;  1V4R A;  3F8C A;  1S8N A;  2JSC A;  3DXJ F;  2UZK A;  2XAJ A;  3T5X A;  2JZY A;  1TQP A;  1H0M A;  1PP7 U;  3I64 A;  2PMH A;  2QZ8 A;  2D2W A;  2RGV A;  4KUM A;  2CSO A;  2NNN A;  3RI4 A;  2ZFW A;  5K5Q A;  2KIM A;  4R79 A;  4KYW A;  2EV5 A;  2D45 A;  1Z6R A;  4CZZ A;  4LLN A;  2CO5 A;  2VXZ A;  4H0E A;  4EM1 A;  3C7J A;  1ZLK A;  1FSE A;  4WX9 A;  3V8J A;  2GZW A;  2K4B A;  2OQR A;  4I98 B;  1RUO A;  4WWC A;  1EV7 A;  4EGZ A;  1V3F A;  1T2K A;  3V8L A;  1FLI A;  3QAH A;  2CYY A;  2DPU A;  3F8B A;  3RPQ A;  3RKY A;  3KZY A;  3SZT A;  3F23 A;  1RUN A;  2EFW A;  1H9G A;  5D5W B;  2ZKZ A;  1QZZ A;  3RKW A;  4A2U A;  3BJO A;  1LDK B;  3HSF A;  3N97 A;  3J80 Z;  1W7P B;  4ENM A;  4RB0 A;  4I7H A;  2F5F A;  5LRR A;  4Z2Y A;  3J81 K;  1E2X A;  2WWY A;  2E7W A;  5HLI A;  2R7F A;  1BJA A;  1YG2 A;  2P7V B;  4HZF A;  2COM A;  2BYV E;  2VBZ A;  5CVJ A;  2FBH A;  1F4K A;  2GXB A;  3ECH A;  4HDU A;  1GHC A;  1IN5 A;  3TQN A;  3DQV C;  4OOI A;  4S04 A;  1CF7 A;  5F6F A;  5LBQ A;  3M8F A;  5KK1 A;  1HSJ A;  4IXA A;  5DD4 A;  1XCV A;  4U0V A;  5EEG A;  2QYO A;  3I58 A;  1SD4 A;  2M87 A;  1HKT A;  2L02 A;  1Z1D A;  1J5Y A;  2HTJ A;  4UV8 A;  1BBY A;  1W7P D;  1UCR A;  4MNU A;  5FFZ A;  3SHF A;  1ZAR A;  1MJA A;  2V1U A;  5BS6 A;  2ZME B;  3DFG A;  3FMQ A;  4MHG A;  4EQQ A;  2O03 A;  3LAJ A;  4CO8 A;  3RDI A;  2K27 A;  2DPD A;  1HKS A;  4P9U A;  4P55 A;  2XKO A;  3LST A;  5ED4 A;  1J75 A;  1L0O C;  2P6T A;  3LA7 A;  2B0L A;  3WG9 A;  4P5O A;  5F1R A;  3H92 A;  2NYX A;  1FYK A;  2EFO A;  4ETS A;  4CIC A;  4L0Z B;  1TLH B;  2O3F A;  3MAJ A;  2EV6 A;  3OOP A;  2IA1 A;  2MD5 A;  5LGU A;  1Z05 A;  2ACJ A;  5DCM B;  1K78 B;  5FFX A;  2UXN A;  2TDX A;  2C6Y A;  2XAG A;  1U5T B;  1SMY F;  4HX7 A;  2L3D A;  5E1Z B;  1SMT A;  4ZYD A;  4U0W A;  2A07 F;  4A0X A;  3GEZ A;  1BN5 A;  2ZJ2 A;  2HDC A;  2ISZ A;  3M9A A;  4NQW A;  3LA3 A;  2PI0 A;  2Y0M A;  2MLG A;  3ELK A;  4G6D A;  1ODD A;  4M9Z A;  1BC8 C;  2FA5 A;  1TW3 A;  2YX7 A;  1S29 A;  1XGO A;  3ZMT A;  4HLX A;  3BPV A;  2P5K A;  3O3K A;  3GFI A;  2IA2 A;  2VC0 A;  1USS A;  3RYP A;  3C3W A;  4HV6 A;  3FM5 A;  2RVC A;  1S7O A;  5D5X B;  2VBY A;  3QU3 A;  1BIB A;  1JHH A;  3ZP5 A;  5JR3 A;  5E18 F;  2DO7 A;  4Y13 A;  4HBL A;  2A68 F;  2A69 F;  4MQV A;  4CXF A;  1ON2 A;  4UNO A;  2PFB A;  1MKM A;  4AVP A;  3KP3 A;  5DCF A;  5L3C A;  4BHC A;  4XLN F;  1JXS A;  3Q9S A;  2MH2 A;  2FNP A;  3ULQ B;  5K5O A;  2PJP A;  2HZT A;  5HS8 A;  3I0T A;  1R1U A;  4HOB A;  1XN7 A;  3JW4 A;  3C1D A;  2OU2 A;  4KN7 X;  3SXY A;  3HRM A;  1G3S A;  2D1V A;  3GO5 A;  1HXD A;  2FOK A;  2CW0 F;  4L9J A;  2M30 A;  2HTS A;  4B09 A;  3ERE D;  3CUQ A;  1KU2 A;  3F8N A;  4BXU A;  2OZ6 A;  3COA C;  4G6Q A;  2UWM A;  3N4M A;  4OIP F;  1WRJ A;  3TDZ C;  4R1H A;  2P8T A;  3ZQ7 A;  2PMU A;  2QM3 A;  5J6X A;  1ZN2 A;  2KJB A;  4G94 A;  2YR2 A;  4A0Z A;  4EGY A;  1R36 A;  3P9I A;  2ETH A;  3FX3 A;  2AS5 F;  3J80 K;  2O6G E;  4L18 B;  1XGN A;  1FZP B;  1FP1 D;  1OYI A;  4RB1 A;  1ONV A;  1LB2 A;  3KP7 A;  2Q2E A;  1HBX G;  5L3E A;  4ENJ A;  3FHZ A;  1FOK A;  2RKH A;  4HA8 A;  1QNT A;  2EFN A;  3K0L A;  4ZZL A;  5ILU A;  2A6H F;  2W57 A;  4PGH A;  3KP4 A;  4O5V A;  1E17 A;  2K7L A;  1BI2 A;  3ZMU A;  5ICG A;  1WQ2 A;  2IJL A;  4LLG F;  5K5R A;  2A61 A;  2V6C A;  2NRA C;  3KFW X;  1IRG A;  2XHK A;  1KQ0 A;  3G73 A;  3HYI A;  4ZYG A;  5D4S A;  1O3Q A;  2EJR A;  2O61 A;  1W5S A;  2XRN A;  3SZP A;  1ZAO A;  3RIR A;  1OKR A;  5ILV A;  3WE2 A;  3E6C C;  5CVU A;  4AD9 A;  3REO A;  2HEO A;  1IF1 A;  1U3E M;  3F22 A;  3KEO A;  4BHP A;  3VEP A;  2MH9 A;  2GQQ A;  4EMS A;  2FU4 A;  1XD7 A;  1XCB A;  1TQI A;  3M7G A;  4MQ9 F;  3T8R A;  5IT9 Z;  1MJ9 A;  3FXQ A;  2EWN A;  5L3D A;  3TGN A;  3JAM Z;  3BRO A;  4LJZ F;  5LRS A;  4TV7 A;  1YQA A;  2H94 A;  3HRT A;  4UUV A;  3I4P A;  5LGT A;  2R3S A;  4BH9 A;  3E5X A;  2EA4 A;  3E6M A;  4RS8 A;  4N0B A;  4HF2 A;  1Y0U A;  3FF5 A;  2HKX A;  3WU0 A;  1TNT A;  1BI1 A;  1U5T C;  2VON A;  4G9Y A;  1H9T A;  5F64 A;  1KYW A;  4YFK F;  1B9M A;  4QWQ A;  1K7A A;  2DW4 A;  5DDG A;  1Z7U A;  2GXG A;  3HOS A;  2VE8 A;  2HGC A;  4RGX A;  4IRI A;  1AOY A;  4XBF A;  1LVA A;  1XSX A;  1TBX A;  2W25 A;  5HLH A;  2ZCW A;  3CO7 C;  4ZZD A;  1GVJ A;  5H20 A;  1R58 A;  4I02 A;  1HW1 A;  3M1E A;  3DP7 A;  2LKP A;  3ABT A;  5JVT A;  2M8E A;  3RJP A;  3BP8 A;  1QO0 D;  3C18 A;  4XSX F;  4G7O F;  2XKP A;  4BYY A;  2A3S A;  2H6B A;  1LDJ A;  3EDP A;  4GGG A;  1MDM A;  1R22 A;  2VOP A;  2XV4 S;  4U7B A;  4EV0 A;  5CVV A;  3ZMS A;  4ESB A;  4A5N A;  4HLY A;  3R6S A;  2CWE A;  1F5T A;  2FQ3 A;  4RB3 C;  3FXU A;  4I2O A;  3KEQ A;  3L2C A;  4M6Y A;  2DI3 A;  5FO5 A;  2XAS A;  2FBK A;  2CQK A;  3U1D A;  4A0Y A;  3VFZ A;  2IT0 A;  2XUB A;  1FYL A;  5L3B A;  1J59 A;  4WXH A;  3MQ0 A;  1YO5 C;  2RN7 A;  3WTX C;  5H6R A;  4KT5 C;  2J5O A;  4EJT A;  1TQM A;  3W6K B;  1F9N A;  4UHT A;  2LNB A;  1XMA A;  3F6V A;  5JI6 A;  1GXP A;  1JHF A;  3GLX A;  1GXQ A;  1K6O A;  2GIV A;  4RGS A;  5D4R A;  4QLC U;  5LLQ A;  5FLX K;  1FP2 A;  2QVO A;  1FT9 A;  1T6S A;  4FX0 A;  3KZZ A;  3QOP A;  1IN6 A;  3PQJ A;  3R0A A;  5D6E A;  3RTR A;  1XDS A;  3L09 A;  3QPH A;  2JRT A;  4MEX F;  4E70 A;  1FYM A;  2ESN A;  1HW5 A;  4BNC A;  4WK8 F;  5TRD A;  2HWV A;  4PGG A;  3I5U A;  4L5I A;  4BAY A;  2X4H A;  1G4D A;  1IN7 A;  2LF7 A;  2RC4 A;  3GUD A;  2DAO A;  1TW2 A;  2VOD A;  1LQ1 A;  3DEU A;  2H27 A;  4LGW A;  3DF8 A;  1YYV A;  4ENN A;  3HHG A;  1HST A;  1FPQ A;  4RAY A;  1L3L A;  2K86 A;  1KYZ A;  3FM3 A;  1WI9 A;  1FWZ A;  2YSR A;  4IVN A;  2IA0 A;  5KVR A;  3SQN A;  3E5U A;  2KRF A;  3LFK A;  3V4G A;  2PQ8 A;  1Z9C A;  1IW7 F;  2WTE A;  2PLY A;  2NS0 A;  3GW2 A;  3QPT A;  3BDD A;  2V79 A;  4OIN F;  3KP5 A;  1FBS A;  4RAZ A;  2FMY A;  4EM0 B;  1KQ8 A;  1SD5 A;  5IT9 K;  1ZGA A;  3JAM K;  3WTU C;  2BV6 A;  2XRO A;  1FBU A;  1C0W A;  1MJB A;  2O8X A;  4IHS A;  3U2R A;  4I09 A;  1IN8 A;  2QQB A;  2Y75 A;  1R00 A;  4CYD A;  5BQT A;  1BI0 A;  3H3U A;  4ESF A;  2ELH A;  2DTR A;  3VOD A;  2RV8 A;  2Z99 A;  3QP5 A;  4OIQ F;  2DU9 A;  3CO6 C;  3ZN0 A;  2W84 A;  1YTY A;  2OD5 A;  1J2X A;  5J8F A;  1OPC A;  1EH7 A;  2K4J A;  1BM9 A;  2FRH A;  2R7D A;  5FD5 A;  1U8R A;  4M71 A;  3ABU A;  4KN4 X;  2XAH A;  1ZG5 A;  2BBY A;  2WC2 A;  4YFX F;  1HKQ A;  2Z5U A;  4B8X A;  1P6R A;  1QGP A;  4YIF A;  1ZRE A;  4WCG A;  4FT8 A;  4BHB A;  2YU3 A;  1G3W A;  3TOB A;  1RIO H;  4HF0 A;  2VBW A;  1DPU A;  4XRF A;  2DQL A;  3CUQ B;  4EJU A;  2OQG A;  3NEU A;  5D8K B;  2VN2 A;  2E7X A;  3WOD F;  4G8X A;  3ECO A;  1XDU A;  1TTY A;  2UXX A;  3P9C A;  2BGC A;  4WXD A;  2FEZ A;  5HVQ C;  2NNY A;  5D5V B;  3QP6 A;  3BY6 A;  2F5E A;  2PBI A;  4JBA A;  1U6G A;  4O3M A;  5AIQ A;  1REP C;  1YS7 A;  4UV9 A;  1S7A A;  1D8J A;  4CHU A;  4GO1 A;  4M9X A;  3WTY C;  4HV5 A;  1A04 A;  3CJN A;  2L01 A;  1YIO A;  1CGP A;  1IRF A;  2DK5 A;  3Q5F A;  1ZG1 A;  2EFQ A;  1P4X A;  2EFP A;  5HS7 A;  3PQK A;  3BPX A;  1B1B A;  3V7C A;  3CLO A;  2VBX A;  4N9H A;  2KKO A;  3IKV A;  5JHU A;  2PG4 A;  2QBY A;  1DPR A;  2BEO A;  1G3T A;  4XLP F;  3GXO A;  2HQR A;  2L4M A;  5D5U B;  3GZ6 A;  2DK8 A;  2JPC A;  4UXN A;  1B6A A;  3K1M A;  4KA4 A;  1LEB A;  4LG0 A;  2LDU A;  3KP2 A;  3J81 Z;  2MBF A;  3WGH A;  3DPL C;  4EJV A;  5IT3 A;  4A6D A;  1DDN A;  4YFN F;  3F21 A;  4GXO A;  4M9S A;  2ZBK A;  4OMY A;  1IXR C;  5E1X A;  4O6J A;  4ZH4 F;  2F5C A;  3WTS C;  1R7J A;  5LHG A;  3IWF A;  1XSV A;  2D1H A;  5EEH A;  1Z6T A;  5K1Y A;  3RKX A;  4HW0 A;  2A5Y B;  3V7S A;  2QUF A;  4RGU A;  1ON1 A;  3R60 A;  4PCQ A;  4NB5 A;  3L00 A;  3SFZ A;  3TDU C;  1FY7 A;  2QWW A;  3IRQ A;  3Q9V A;  3MCZ A;  1KU3 A;  1U2W A;  2H09 A;  3ROU A;  2F5D A;  2MC3 A;  4IJA A;  1HW2 A;  4HQE A;  3MEX A;  2O0Y A;  2VE9 A;  4AIH A;  2DQR A;  1RI7 A;  1T98 A;  2GA1 A;  4G7H F;  2OAZ A;  4RGR A;  2JPB A;  5FGM A;  2P5L C;  3F72 A;  3TO7 A;  4AIJ A;  4D0P A;  1UB9 A;  4ESJ A;  4IPA A;  3VB2 A;  1O3S A;  1O3R A;  5A2Q Z; 
#chains in the Genus database with same CATH topology
 4C30 A;  3E6D A;  2HDD A;  1DUX C;  3CMY A;  2GM4 A;  2STT A;  4L5E A;  4Y52 J;  1R1V A;  1QBJ A;  3GME A;  2HS5 A;  3HTS B;  4I01 A;  2DBB A;  3VWB A;  4JYK A;  2CGP A;  1Z3X A;  2P4W A;  5BNG A;  2P5V A;  3CF5 F;  1R23 A;  1MSE C;  2VC1 A;  2R7U A;  3J7Y J;  1OQY A;  3QQA A;  3UKG A;  4HDV A;  2JMW A;  1JKR C;  3W2A A;  1FBQ A;  3KCC A;  4RAG A;  4LB5 A;  1YW9 A;  3E3V A;  3WTW C;  3LL7 A;  3CCM I;  1B8I A;  2JVH A;  2HKO A;  1OCP A;  1STZ A;  1X4P A;  2IW5 A;  3MZY A;  3I53 A;  5E8G A;  4LK1 F;  3X2Q H;  2I8D A;  2GWR A;  5FKK A;  2QLZ A;  4BBS J;  3E0J B;  1WWX A;  2L0K A;  1WJB A;  2LK2 A;  4BKX A;  2OV7 A;  5GAE J;  1VQ5 I;  4XMY A;  2R5Z A;  1FNN A;  1U78 A;  3IH2 A;  1OIS A;  5ILS A;  3LA2 A;  4F3Q A;  4KNY A;  1QPM A;  1FX7 A;  3TMO A;  3EYI A;  2R7V A;  1YW8 A;  4A6E A;  4F92 B;  2HNH A;  5J4Y A;  4HYE A;  4M3F A;  4M6X A;  3OL4 A;  1XSD A;  3D0S A;  4UUS A;  3BR3 A;  3WGI A;  3JTG A;  1ZGJ A;  3ISP A;  2FBI A;  4DQ2 A;  1PDN C;  1ENH A;  2YUS A;  2K3P A;  3MFK A;  3A01 B;  5LEJ A;  4A3D J;  2EV0 A;  2Y69 H;  4B3X A;  1MBF A;  1OYY A;  3OIO A;  4Q48 A;  4ZTJ A;  5D6F A;  1B4A A;  2DLL A;  3CCY A;  2JA8 J;  1X3Z B;  5E1W A;  5BPI A;  2Z33 A;  3ZPL A;  2W24 A;  4AVZ A;  5J1R A;  3CUO A;  2ECB A;  2CG4 A;  2M3A A;  3FZV A;  4B43 A;  3H5N A;  4M3B A;  2JTV A;  1QHH D;  2L4A A;  4CCJ A;  1VI0 A;  3DPT A;  1G3Y A;  4YII A;  2OC6 A;  1PP8 F;  3B02 A;  2E2J J;  2KIU A;  1SFE A;  2EZH A;  5JFR A;  3E97 A;  3I59 A;  2LH9 A;  5IOY A;  2OA4 A;  4CA0 A;  3DCF A;  2L7Z A;  3BOQ A;  3LQR A;  4M74 A;  1SFU A;  3CUQ C;  2RDP A;  1SAX A;  3K1N A;  4L0Y B;  5FKM A;  3R0J A;  3HL2 A;  3DLA A;  2LLK A;  3KLO A;  1SD6 A;  2YS9 A;  3FMR A;  3HB9 A;  3FBI B;  3PIP F;  3G2B A;  2M45 A;  1JUP A;  2Q8K A;  4UVB A;  3V8K A;  4S05 A;  4KMU X;  1ITY A;  2IRF G;  4YEL A;  4X1E A;  4JX5 A;  1DP3 A;  3ML6 A;  4L9T A;  1ETY A;  5HDK A;  4J01 A;  2STW A;  1MZB A;  1ZRD A;  2QQ9 A;  3TW6 A;  2HOA A;  2BY1 A;  3F0C A;  4AIK A;  2MLK A;  4XK4 A;  4LIV A;  1OCO H;  3O6B B;  3QRF F;  2X0L A;  4Z6Y A;  1ZHF A;  5HS9 A;  4A3J J;  2LF8 A;  2VKH A;  1R5I D;  3TP3 A;  3ABK H;  3FXR A;  3WTT C;  1YW7 A;  4DNC A;  3PSF A;  2L5Q A;  4R8H A;  2X6W A;  2F6C A;  2OZU A;  5H6Q A;  5E17 F;  4XRM A;  2BXY A;  2G9W A;  2DFF A;  5D8L B;  4DIQ A;  1MD0 A;  1CF7 B;  2M0M A;  3G1M A;  3RZO J;  4IQ4 A;  2XGX A;  1MGT A;  4KIB A;  1VQ8 I;  2PJR B;  2HPM A;  4PDK A;  1OCT C;  4DYQ A;  2IS4 A;  1G8X A;  3GFL A;  4HF1 A;  2AXT C;  2JT1 A;  2V1N A;  3EPZ A;  3HTU A;  4HQM A;  2AQE A;  2M9H A;  4HEA 2;  3CCL I;  2LY1 A;  1W5T A;  3TO9 A;  1PYV A;  2FE3 A;  4IRG A;  5F0H A;  2EA2 A;  1ETX A;  2F2E A;  1P4A A;  3HEF A;  4A3B J;  2YX4 A;  3BR1 A;  5J1U A;  4C2U A;  1YIJ I;  3LSJ A;  1MBH A;  5ERI A;  3TO6 A;  5EEA A;  1YRN B;  3GWZ A;  6PAX A;  1FC3 A;  2K9L A;  1KGS A;  2XGD A;  1JTX A;  3CC4 I;  4BEH B;  3T1B A;  2ZXJ A;  4AID A;  5L3G A;  5DUK A;  5FB2 A;  1JKQ C;  1YOV B;  1D8K A;  4GYG A;  2L7K A;  3BZK A;  2BE5 F;  2DFI A;  3I54 A;  3M8E A;  3PUB A;  4OMZ A;  5F04 A;  4XSZ F;  5KAI C;  3FHN A;  3DTI A;  3EYY A;  1A6I A;  1T38 A;  1R5G A;  5E8I A;  2FJ1 A;  2VT3 A;  5DTD A;  3K4J A;  1MNE A;  1S6L A;  1B59 A;  1JE8 A;  4HG2 A;  4UVA A;  2ZXI A;  4PJN A;  3MZH A;  2E60 A;  1R5H A;  3GYH X;  3RQI A;  2KQR A;  3IAM 2;  2W85 A;  4OIR F;  1RNL A;  2IP2 A;  3NQO A;  1I6H J;  1QZY A;  2BW3 B;  4H4K C;  3IKT A;  1XMK A;  4N4N B;  1UHW A;  4QIW N;  3IWZ A;  4L9V A;  1P4W A;  4MTE A;  1JGG A;  2DOE A;  1BL0 A;  5LHI A;  3KPH A;  2QQA A;  4BDY A;  2KIS A;  1ZRF A;  4EJO A;  2DT7 B;  1JKO C;  3J7A O;  3PFI A;  5BOX A;  3FWE A;  4BQO A;  2M7B A;  2X6Y A;  2XVC A;  3ERM A;  3SEQ A;  5DS9 A;  3EUH A;  3H5A A;  3HRS A;  4Y7N J;  1W7P A;  1Y8R B;  4I0B A;  1IAW A;  1B9N A;  3BR2 A;  3OYN A;  4YRV A;  5BMZ A;  4M73 A;  3IH3 A;  1HQC A;  2KIF A;  3BC8 A;  1ZYR F;  1O3T A;  2ICW G;  4RDU A;  3CJQ B;  5IYB J;  3K1P A;  3U9G A;  3DKY A;  3IAS 2;  5E20 A;  2L9R A;  3B73 A;  2HR3 A;  2ZNY A;  2X6O A;  1J0R A;  4BL0 B;  5CVR A;  3F6O A;  4XON A;  5KNL A;  2G7U A;  1WJA A;  4CGZ A;  4YG2 F;  2EIK H;  4F52 A;  2XGC A;  2HPI A;  4RM3 A;  1W36 D;  3S2W A;  3TP0 A;  1FSH A;  4BQN A;  1YHQ I;  3CMM A;  2WY7 Q;  1ZG3 A;  5CJ9 A;  2VOO A;  3CDH A;  4NHJ A;  3H1C A;  3HOY J;  3QYF A;  4P9F A;  1SD7 A;  2KLO A;  3CLQ A;  5A2Q K;  2M4K A;  1LVK A;  3P7N A;  2KMU A;  2RAE A;  3HPH A;  4W97 A;  2K02 A;  4ON0 A;  3MN2 A;  2R5Y B;  4L5J A;  2HFH A;  2IGM A;  1TWH J;  3HIF A;  2PEX A;  3ABL H;  3LSH A;  3FMS A;  5IY5 H;  3C2G A;  5LHH A;  3OYL A;  4ENK A;  3CTA A;  3G3Z A;  2Z9O A;  4L9N A;  4PJJ A;  4M3D A;  1CQT A;  2RQP A;  1W5C C;  4LLL A;  2V9V A;  4F93 B;  3D5L A;  3GF2 A;  2VT2 A;  4Q4Z F;  5EZG A;  1I27 A;  5ICE A;  4KIS A;  5C4X J;  2ISY A;  4FCY A;  1D5V A;  2L54 A;  4FE7 A;  1G6N A;  4MTD A;  1ZGW A;  1SFX A;  3L7W A;  3ZMV A;  2F5V A;  3BCB A;  4KDP A;  2R7S A;  2GAU A;  3W2V A;  2EBI A;  3T0Y A;  5HLG A;  4BBR J;  1XMX A;  2IS2 A;  3LSK A;  3RKQ A;  2ZME A;  2JK3 A;  2NXN B;  3IC7 A;  4Y17 A;  5HOO A;  2YU9 J;  3NWT A;  3R4K A;  2IS1 A;  5GTH C;  2IGO A;  3I71 A;  4HX4 A;  4XQF A;  5GTI C;  2DJN A;  5AON A;  2ZJP F;  4XNF A;  2DDA A;  3MWM A;  5LGN A;  3FXO A;  1BOA A;  2AHQ A;  2XSJ C;  1Q1H A;  3K2Z A;  3JSO A;  4C9Y A;  3TBI A;  3DV8 A;  1VTN C;  2FSW A;  1TZL A;  4HNT A;  2E35 A;  5AIP A;  4IHV A;  4AYB A;  1ZEL A;  1APL C;  2Z16 A;  4EJW A;  4AWX B;  1KA8 A;  2E1C A;  4KFC A;  1D3Y A;  1G59 A;  5E3N A;  2R92 J;  3GTO J;  3HKZ A;  3WGG A;  9ANT A;  1R1T A;  2NAZ A;  5F27 A;  1LNW A;  4FX4 A;  1Z21 A;  4N9I A;  3RYR A;  5M3F J;  4A3I J;  2HVR A;  3LSM A;  1YX5 A;  1P2F A;  1NHA A;  4K2E A;  1ZRC A;  2VKD A;  5EG0 B;  1I1G A;  2LSO A;  3VYU B;  1VQL I;  3DTK A;  4PZJ A;  2Y48 A;  3TKY A;  1WJF A;  1AKH B;  1X3U A;  3LSP A;  4BQA A;  1UHM A;  2XAF A;  3K4M A;  5DCM A;  1K78 A;  1GV5 A;  2EK5 A;  1U8B A;  3HRU A;  1U5T A;  4IX7 A;  3E6B A;  1ZLJ A;  3F8F A;  4LB6 B;  3T8T A;  2HQN A;  2L2O A;  4G7Z F;  1W1W E;  3WTV C;  2W82 A;  2VIX A;  5JVG F;  4CYC B;  3F8M A;  4KMF A;  4G6T B;  2ZJQ F;  1KQ9 A;  3P9K A;  4E7L A;  5HLT A;  2E5N A;  1ZTR A;  3O2P E;  1R6R A;  4BXX J;  5FKO A;  1IUF A;  3HUG A;  1NK2 P;  1RES A;  3HGY A;  1IUY A;  3VYS B;  3WE3 A;  2QBY B;  4MEY F;  5GAH J;  2GA2 A;  2AO9 A;  3V7R A;  3RZD J;  1I1S A;  3ZQI A;  4U0Y A;  4KIG A;  5DEQ A;  2CRG A;  1PVE A;  1XG1 A;  2XAQ A;  3QU6 A;  3DBR B;  1BIA A;  1U0J A;  2LVS A;  2EZI A;  3OV8 A;  4LD5 A;  1OMI A;  4XLE A;  2WV0 A;  4GCV A;  3OYF A;  2NVT J;  1ETQ A;  2XC7 A;  2YPR A;  3K69 A;  4BXF A;  4WXC A;  1UEL B;  3HSE A;  2DT5 A;  1T0F A;  4CH7 A;  3IP4 B;  5B1A H;  5F1J A;  1HCR A;  4LG0 B;  4MO7 A;  4RLQ A;  2W4S A;  3JSP A;  2FNA A;  3LSI A;  2CV0 A;  3OSG A;  3S1R J;  2E1N A;  4Q47 A;  2EIN H;  4ZYH A;  3LWF A;  2Z3Y A;  1JKP C;  1IDZ A;  1AWC A;  3BJA A;  4A12 A;  2IGN A;  3K9T A;  1AU7 A;  1OYW A;  2K85 A;  2J5P A;  2VQG A;  1K83 J;  5EGO B;  1U9O A;  1QA6 A;  1S7E A;  1YLF A;  5DYM A;  1LE8 A;  3JRA A;  1Y6I A;  3HHH A;  2DT6 A;  5CLS A;  2OTJ I;  2DYS H;  3S1N J;  1BC7 C;  2H1K A;  1OJL A;  4PUS A;  2RNJ A;  1FJL A;  3MKL A;  2BVL A;  3IH4 A;  2KJC A;  3WTZ A;  1Z91 A;  2XIG A;  4ASN A;  1WH7 A;  3BLY A;  2VJ4 A;  3RSN A;  4P1W A;  2JSP A;  1NH3 A;  5DUI A;  3OS1 A;  1D5Y A;  3JTH A;  4E7Z A;  1IJW C;  1B72 A;  3OYI A;  1XGM A;  1I5Z A;  3GFM A;  1JI8 A;  4D9J A;  4XLA A;  3K2A A;  1BI3 A;  1W4M A;  3AFH A;  4C2T A;  1P7J A;  3ZRG A;  1UFM A;  3VYT B;  3LMM A;  4XR6 A;  4Y15 A;  3GX4 X;  3M4O J;  2FF4 A;  4JQF A;  4BE1 A;  4FHT A;  3R61 A;  1IN4 A;  3PNY A;  3G1O A;  5GAG J;  1IXS B;  5J8C A;  3H9J A;  2KHM A;  1WJD A;  5CVI A;  1K79 A;  3SZG A;  4GRI A;  2Q0O A;  1IZ1 A;  2R7X A;  1I3Q J;  2W00 A;  1T39 A;  5HDG A;  5K7F A;  3E5Q A;  2HOS A;  1WJE A;  5FLX Z;  3RPU A;  2FML A;  2DA1 A;  5ICF A;  1X3W B;  4HAM A;  1VQK I;  3IHU A;  4P96 A;  5HNF A;  2ADU A;  1EJ9 A;  3MZ8 A;  2F48 A;  4B48 A;  4D1Q A;  2V1X A;  1SAU A;  4EM2 A;  5DV5 A;  3LQQ A;  4HX8 A;  4OU0 A;  1UAA A;  2XF7 A;  1F1Z A;  3TOA A;  1W36 C;  1LJ9 A;  2ZNZ A;  2G7H A;  1XGS A;  3KYC B;  2K40 A;  1O57 A;  2GOM A;  2LBF A;  4KIC A;  4LK0 F;  1JT6 A;  2IPQ X;  5GPC A;  1DQU A;  4AYB N;  5L3F A;  5EJC A;  4D7M A;  5HDN A;  2DYR H;  2VKV A;  1S3J A;  2IS6 A;  2XB5 A;  2HVS A;  1TC3 C;  2VQL A;  2VLA A;  2HOE A;  1XB4 A;  3LSR A;  3HOT A;  2ECC A;  1LEA A;  4MGR A;  5CYV A;  5EYR A;  4WF2 A;  3BR5 A;  2I10 A;  3IL2 A;  1KU9 A;  1UG2 A;  1B8I B;  2L9N A;  4M72 A;  3W6J B;  1D1A A;  3FKJ A;  5DD8 A;  5ICC A;  3OYJ A;  4AC0 A;  4C3J J;  2V7F A;  2R7O A;  3GZ5 A;  1DGR M;  3HC7 A;  1VQ9 I;  2OCE A;  3EQL F;  4CDG A;  4A3C J;  3QYB A;  4NNJ A;  1J7K A;  1RZ4 A;  1IXC A;  2FOW A;  3KET A;  4QSH A;  5B3S H;  3H3Z A;  4A3F J;  1PUE E;  3EUK L;  3OYE A;  4PK4 A;  1JGS A;  3GVA A;  2WY8 Q;  2X48 A;  3DKW A;  3OYG A;  2Z2S B;  2O7O A;  4KIF A;  2MFZ A;  3BG6 A;  2ESH A;  2QEN A;  1WKM A;  5FJ8 J;  1EH8 A;  3LAP A;  4HRI A;  3AAF A;  1EH6 A;  2LFB A;  4F7Z A;  1DP7 P;  1O7L A;  1YFH A;  2M1B A;  1LDD A;  2M5W A;  4MFE A;  3HBL A;  1QRY A;  1J9I A;  4UUS B;  1X1B A;  2ZO4 A;  1T8I A;  4M3E A;  4EVI A;  3LOC A;  1W0T A;  1ULY A;  4GYI A;  4FAS D;  1D1C A;  2DFE A;  3MMY B;  1YS6 A;  2H6C A;  5LEK A;  3HG9 A;  1UHS A;  3EET A;  1I6X A;  5TJJ A;  2HXI A;  1KU7 A;  4Q5S F;  3PO2 J;  4I0A A;  1H8A C;  4ABZ A;  5FKL A;  3AL0 B;  1V5F A;  2AXL A;  2B9S A;  4RB2 C;  2FXA A;  4IRH A;  3OR1 C;  1O7F A;  2OBP A;  4BUP A;  1XTA A;  2V1D A;  1K6Y A;  3BWG A;  1P92 A;  5HOD A;  2DJI A;  4IEJ A;  2DOA A;  2E1M B;  1ZH5 A;  1MH4 A;  3HSR A;  4IF4 A;  3ZMD A;  4F91 B;  2KRH A;  3KP6 A;  4BE2 A;  1FIP A;  2DA7 A;  3HOW J;  3F3X A;  5FRM A;  4U88 A;  4LOC A;  1VND A;  4QPO A;  4A3M J;  3BJ6 A;  3KLN A;  2CS3 A;  2I5U A;  2MA3 A;  2CFX A;  3I59 B;  4OIO F;  4IHT A;  1BW6 A;  5FD6 A;  2QKM B;  3VOE A;  1MDM B;  1FOX A;  4LFU A;  3ZMZ A;  4E7H A;  4HPQ A;  1J09 A;  5F08 A;  2EB7 A;  2A6E F;  3CZ6 A;  3RCO A;  1OR7 A;  3L9F A;  2IVM A;  2NS7 A;  3ASO H;  4LMY A;  3ASN H;  2DCE A;  2P7C B;  3GFJ A;  3IV5 A;  3IRR A;  3ZXS A;  2DA5 A;  1UST A;  3NRV A;  1QQI A;  2CUJ A;  2K5C A;  4JK1 X;  2HYF A;  2Y31 A;  4E7K A;  2P81 A;  4UB8 C;  4U7D A;  1QVU A;  3KE2 A;  2P6S A;  3JRG A;  1ETV A;  4ZYE A;  3W3C A;  4QPQ A;  5J47 A;  3S14 J;  5BPD A;  1TNS A;  2HYG D;  4UVC A;  3QOD A;  3WU1 B;  3WU2 C;  3ZN1 A;  4BJT A;  4Y33 A;  5C4J J;  1A5J A;  4EAT A;  2CV2 A;  4A5M A;  4NC8 A;  3BZ6 A;  1R4M B;  2LOO A;  2VL8 A;  1GT0 C;  2PN6 A;  1WSU A;  4IQJ A;  1V4R A;  3F8C A;  1TL8 A;  1SVO A;  1S8N A;  3OYA A;  2JSC A;  3DXJ F;  5E79 C;  2UZK A;  4NUB A;  2XAJ A;  3OYD A;  3T5X A;  3QWL A;  2JZY A;  3OMY A;  1TQP A;  3HXL A;  3UR3 C;  4S0H B;  1H0M A;  1PP7 U;  1Y0N A;  3I64 A;  1ACI A;  2PMH A;  2QZ8 A;  3SYT A;  2D2W A;  2RGV A;  2LKX A;  3FXK A;  2Y9Y A;  4KUM A;  2RNG A;  3B6A A;  3Q3S A;  2CSO A;  5IOZ A;  2NNN A;  3S2H J;  3RI4 A;  2ZFW A;  5CPR B;  4XKB A;  3HZJ A;  3UNG C;  5K5Q A;  2KIM A;  2X51 A;  4R79 A;  2EV5 A;  4NDL A;  2D45 A;  4KYW A;  1Z6R A;  2M34 A;  4CZZ A;  4LLN A;  2CO5 A;  3S17 J;  2VXZ A;  4H0E A;  3CJR B;  5EDN A;  2WAE A;  4EM1 A;  1Z67 A;  3C7J A;  2ZSH B;  1FSE A;  1ZLK A;  2WAD A;  4WX9 A;  3L2U A;  3V8J A;  2GZW A;  2MYS A;  2BVM A;  2K4B A;  4BY1 J;  2JVG A;  2OQR A;  4I98 B;  4IO9 F;  4WWC A;  1EV7 A;  1MBG A;  1RUO A;  1BR1 A;  4EGZ A;  2EZK A;  4HSR A;  1V3F A;  2PMZ N;  1T2K A;  3V8L A;  1FLI A;  3QAH A;  2V6E A;  3JRD A;  2CYY A;  1LUJ B;  1ZKG A;  5GAD J;  2DPU A;  4LIT A;  3F8B A;  2JUC A;  3RPQ A;  2VQC A;  4IHY A;  3HGG A;  3S8P A;  3RKY A;  2QSH X;  1DGW Y;  3KZY A;  3SZT A;  4X0G A;  3F23 A;  3PL8 A;  2WA0 A;  3K4B A;  3GLL A;  2NVQ J;  3AG3 H;  1RUN A;  2BY2 A;  2EFW A;  2V4J C;  2VUM J;  3S2D J;  1H9G A;  2JJ7 A;  5GPA A;  5D5W B;  2R7T A;  2ZKZ A;  5DM6 F;  1QZZ A;  2JUG A;  3RKW A;  4A2U A;  3BJO A;  1Z0X A;  1LDK B;  3HSF A;  1JJ6 C;  3N97 A;  3GTL J;  3J80 Z;  1W7P B;  1EF4 A;  4ENM A;  3S3O A;  4RB0 A;  4YEJ A;  4CCK A;  3SJM A;  2CV1 A;  5K7Z A;  4I7H A;  2KT0 A;  3S1Q J;  2F5F A;  5LRR A;  4Z2Y A;  2KDO A;  3J81 K;  1E2X A;  2WWY A;  2LTP A;  2WBM A;  3DEW A;  2E7W A;  5HLI A;  3L2V A;  3CDI A;  2BY0 A;  4X6A J;  3P5J A;  2R7F A;  1BJA A;  1YG2 A;  2P7V B;  4HZF A;  2COM A;  2BYV E;  2VBZ A;  3FBN B;  5CVJ A;  3AG1 H;  2IXS A;  1SC7 A;  3U1K A;  1I3A A;  3ZCO A;  2LP0 A;  2A05 A;  2CUE A;  2FBH A;  1F4K A;  1YE9 A;  2WAQ A;  1QU3 A;  2GXB A;  3ECH A;  3FXJ A;  1QVT A;  4HDU A;  1GHC A;  1IN5 A;  4II2 A;  3TQN A;  5C3E J;  1VQ4 I;  3DQV C;  2R7Z J;  3ESW B;  4OOI A;  5J40 A;  4KJZ A;  3WHB A;  3S3N A;  4S04 A;  3S15 J;  1CF7 A;  5F6F A;  2IEK A;  2EPF A;  5LBQ A;  3M8F A;  5KK1 A;  1HSJ A;  4XOT A;  1F43 A;  4IXA A;  5DD4 A;  1VFC A;  1ZR2 A;  1XCV A;  1WPK A;  5JLW A;  3VSK A;  4U0V A;  5EEG A;  2QYO A;  5DM7 F;  2LG4 A;  2O5R A;  3I58 A;  1SD4 A;  2M87 A;  3E1S A;  2DMU A;  1HKT A;  1TWF J;  1Y8Q B;  2L02 A;  1Z1D A;  3MD2 A;  1AA7 A;  3KYL A;  4J19 A;  4IOC F;  1J5Y A;  5M5X J;  1N77 A;  2HTJ A;  4V2G A;  4UV8 A;  2COB A;  2XGE A;  4A69 C;  5IYD J;  1BBY A;  2Y0S N;  1W7P D;  1RC9 A;  1UCR A;  4MNU A;  4PSW A;  5FRO A;  5FFZ A;  1YRN A;  2K9S A;  3OS2 A;  2Y30 A;  2QKL B;  4DBR A;  3SHF A;  4IOA F;  1ZAR A;  1MJA A;  2V1U A;  5BS6 A;  1PJR A;  4IHX A;  3VPR A;  1FOY A;  2ZME B;  3DFG A;  3FMQ A;  4MHG A;  3QPL A;  3A1Y A;  4BDZ A;  4EQQ A;  2HOT A;  2O03 A;  3OYC A;  3LAJ A;  2MSY A;  4CO8 A;  1WH5 A;  3RDI A;  2K27 A;  1Y56 A;  2EIJ H;  2DPD A;  1HKS A;  4I76 A;  1ZK8 A;  4P9U A;  1ETO A;  3CC7 I;  4P55 A;  5FKN A;  2XKO A;  3LST A;  4PJL A;  1RET A;  2LMD A;  5ED4 A;  1J75 A;  1L0O C;  2XRL A;  2P6T A;  4ZDL A;  5LFA A;  3LA7 A;  4PFO A;  3OYM A;  2B0L A;  3WG9 A;  4P5O A;  1MBK A;  5F1R A;  1ZR4 A;  3H92 A;  2NYX A;  1FYK A;  1VQ6 I;  2EFO A;  4ETS A;  4CIC A;  2DOD A;  4L0Z B;  3OY9 A;  1TLH B;  2O3F A;  3FIW A;  3MAJ A;  2XPW A;  2EZL A;  5IPA A;  3OYB A;  2EV6 A;  3OOP A;  2IA1 A;  4XL9 A;  2R0Q C;  2MD5 A;  5LGU A;  3CP2 A;  4E7J A;  3D5S C;  1Z05 A;  2KP6 A;  2ACJ A;  5DCM B;  1K78 B;  5FFX A;  2BZT A;  4E6K G;  2UXN A;  2TDX A;  1IGN A;  2C6Y A;  2XAG A;  4UB6 C;  1YX3 A;  1U5T B;  1SMY F;  3Q0W A;  3AL0 C;  1GVD A;  4HX7 A;  2L3D A;  5E1Z B;  1SMT A;  4ZYD A;  3O8H A;  4U0W A;  2A07 F;  4A0X A;  2NOJ B;  3GEZ A;  1BN5 A;  2ZJ2 A;  2HDC A;  1AHD P;  2ISZ A;  2FQ4 A;  3M9A A;  4NQW A;  4B44 A;  2ZJR F;  1FTZ A;  3LA3 A;  2PI0 A;  2Y0M A;  2L7M P;  3BTJ A;  3CCU I;  2MLG A;  1FEX A;  2E1M C;  3ELK A;  4G6D A;  2O8K A;  2OCC H;  1ODD A;  2K3F A;  3HUG B;  1S72 I;  4M9Z A;  4JP0 A;  1BC8 C;  2FA5 A;  3PNT A;  5IYC J;  3A4C A;  1TW3 A;  2JN6 A;  2K9M A;  1Z77 A;  2YX7 A;  5KCM A;  1S29 A;  4CUG A;  1XGO A;  4LG3 A;  2DMP A;  2XF5 A;  3ZMT A;  4HLX A;  3S93 A;  3BPV A;  4NC7 A;  2P5K A;  3O3K A;  3GFI A;  2IA2 A;  2VC0 A;  1USS A;  3BR0 A;  2ELK A;  3RYP A;  3C3W A;  4HV6 A;  2KPM A;  2M4G A;  3FM5 A;  2RVC A;  3PM1 A;  1S7O A;  2H8W A;  5D5X B;  4EEF G;  2QEX I;  2VBY A;  5K7H A;  3QU3 A;  1BIB A;  1RKT A;  1JHH A;  3G6E I;  2PX9 A;  2WV1 A;  5TIS C;  3A03 A;  3ZP5 A;  5JR3 A;  1VZ0 A;  2EQR A;  4KT6 A;  5E18 F;  2DO7 A;  4Y13 A;  3OWT A;  4HBL A;  4AM3 A;  3FKI J;  2A68 F;  4XRS A;  1HLV A;  1NK3 P;  2A69 F;  2M7A A;  4MQV A;  4CXF A;  3HM5 A;  2L9V A;  3KIO A;  3I56 I;  1ON2 A;  3KX2 A;  3HOX J;  1LPQ A;  1LE8 B;  4UNO A;  2PFB A;  3K70 D;  1MKM A;  4AVP A;  2L7F P;  4DYR A;  2D5V A;  2WAQ N;  1EA3 A;  3KP3 A;  5DCF A;  5L3C A;  1WFX A;  4BHC A;  2GBY A;  2OJE D;  4XLN F;  2WB1 N;  1JXS A;  2BOL A;  3Q9S A;  1PUF A;  4ZTF A;  2MH2 A;  3M8J A;  2FNP A;  4PJM A;  1Y39 A;  1FMV A;  3ULQ B;  1IRZ A;  5K5O A;  2PJP A;  1B72 B;  2HZT A;  5HS8 A;  2CUZ A;  1FTT A;  3I0T A;  4B1R A;  1R1U A;  2A6T A;  4HOB A;  1XN7 A;  2KRC A;  1O4X A;  2W1O A;  3JW4 A;  4D5F A;  4XIC A;  3Q0V A;  4NBQ A;  3C1D A;  2V9P A;  2ELJ A;  2OU2 A;  4KN7 X;  4FET A;  2KIQ A;  3SXY A;  3FXL A;  3M3Y J;  3VYR B;  3HRM A;  1G3S A;  4J00 A;  4BU2 A;  2D1V A;  3GO5 A;  5KHD A;  1HXD A;  2FOK A;  2CW0 F;  4L9J A;  2M30 A;  2MC4 A;  1A31 A;  1G2H A;  2HTS A;  4B09 A;  2KL4 A;  1TP4 A;  2BY3 A;  5HNH A;  3OYH A;  1BJZ A;  2M0C A;  4LIU A;  4ZYA A;  3ERE D;  1MMS A;  3CUQ A;  3Q0U A;  1X2M A;  3BR6 A;  1KU2 A;  3SDG A;  1MW7 A;  2GIZ A;  3F8N A;  2LD5 A;  1VQN I;  1VQM I;  5M5Y J;  4HST A;  4BXU A;  2OZ6 A;  2R7Q A;  3COA C;  3AG2 H;  2R7W A;  5IP7 J;  4G6Q A;  3EUA A;  1LFU P;  1S9H A;  2UWM A;  3FK6 A;  1FOW A;  2QGU A;  3N4M A;  4OIP F;  4MFD A;  1WRJ A;  3BZC A;  1OCR H;  3C2B A;  3VDX A;  2LBF B;  2EIM H;  3BG9 A;  4XKW A;  3TDZ C;  4R1H A;  2P8T A;  3ZQ7 A;  5J4V A;  4IL6 C;  2X1C A;  2PMU A;  2QM3 A;  5J6X A;  1IV8 A;  3PNV A;  1ZN2 A;  2KJB A;  2VJI A;  4G94 A;  4XRS G;  2YR2 A;  4A0Z A;  2LC2 A;  1I50 J;  3FK7 A;  3H0G J;  4EGY A;  1R36 A;  1A36 A;  3P9I A;  2ETH A;  3FX3 A;  4XLH A;  2DMQ A;  1RR8 C;  2AS5 F;  3J80 K;  2O6G E;  4L18 B;  1X2N A;  3IUO A;  1XGN A;  1FZP B;  1VQ7 I;  1Q1V A;  5CKT A;  2A5W A;  2IGK A;  3EUH C;  4BJ5 C;  1IRX A;  1FP1 D;  1OYI A;  3H35 A;  3NAR A;  1WI3 A;  2ZFU A;  4RB1 A;  1ONV A;  3CCV I;  1MBJ A;  3PFY A;  4FQG A;  4A3K J;  2XPU A;  2N8G A;  1LB2 A;  3BTL A;  3KP7 A;  5JLX A;  2Q2E A;  4F55 A;  1HBX G;  3CDL A;  1ETK A;  5L3E A;  4ENJ A;  1JUM A;  1LFB A;  2IAI A;  3RPU D;  3FHZ A;  1FOK A;  2RKH A;  4HA8 A;  4DZJ A;  1QNT A;  2E71 A;  2EFN A;  1MMN A;  3K0L A;  4ZZL A;  2EIL H;  2IBD A;  1ETW A;  5ILU A;  1X4O A;  3JRC A;  4XN3 A;  3BQZ A;  1SAN A;  1T08 B;  2A6H F;  3H9G A;  3CCS I;  4RAF A;  3GTQ J;  2DA3 A;  4DGW B;  1NG7 A;  4BJ6 C;  2QCO A;  5IP6 A;  2W57 A;  4PGH A;  3KP4 A;  4O5V A;  1E17 A;  3HJE A;  2K7L A;  1BI2 A;  3ZMU A;  3PO3 J;  3SFI A;  5ICG A;  1QZE A;  3HPG A;  3U21 A;  1WQ2 A;  3E7L A;  4XM3 A;  1RRJ A;  2IJL A;  2CQN A;  4LLG F;  5K5R A;  4CZC A;  2A61 A;  4UY8 I;  2V6C A;  2NRA C;  1SEU A;  1OFC X;  3KFW X;  4PSX A;  1M1E B;  1IRG A;  3W6V A;  3A2K A;  2HI3 A;  2DA6 A;  2XHK A;  1KQ0 A;  2PMZ A;  2QQ8 A;  2RRE A;  2XB0 X;  3HYI A;  2F4O B;  4ZYG A;  3G73 A;  3OIP A;  5D4S A;  1XC5 A;  2X6X A;  4DYC A;  5B5E C;  4BGD A;  2R7R A;  2EJR A;  1O3Q A;  2O61 A;  2P0W A;  1W5S A;  2XRN A;  3SZP A;  2ZXH A;  3JRH A;  1ZAO A;  3K4N A;  3RIR A;  2QSG X;  5CQG A;  1OKR A;  5ILV A;  1NG6 A;  3WE2 A;  3E6C C;  5CVU A;  4AD9 A;  3OS0 A;  3QPS A;  3REO A;  2R5Z B;  1E0E A;  2HEO A;  1IF1 A;  1U3E M;  3F22 A;  1LKX A;  3KEO A;  4DOZ A;  4BHP A;  4ITV A;  4CSW A;  3BQY A;  3VEP A;  1MBE A;  1U9N A;  2ZME C;  2MH9 A;  2CU7 A;  2GQQ A;  3H5R A;  2RQQ A;  2HQA A;  1JT0 A;  1WHU A;  4EMS A;  2FU4 A;  2CQ7 A;  1XD7 A;  1XCB A;  4ZDP A;  3WHC A;  1TQI A;  2CMP A;  3M7G A;  2FX0 A;  4MQ9 F;  3T8R A;  5IT9 Z;  1MJ9 A;  2QSF X;  1YI2 I;  2JA5 J;  3S3M A;  1HC8 A;  3FXQ A;  2EWN A;  5L3D A;  3TGN A;  3JAM Z;  3OYK A;  2E2H J;  1WJ5 A;  3BRO A;  4LJZ F;  5LRS A;  4TV7 A;  3H0D A;  5TGT A;  3QYE A;  1WVR A;  3PSI A;  1YQA A;  2H94 A;  3HRT A;  1VQP I;  1YIT I;  4UUV A;  3K4K A;  4FTH A;  3I4P A;  5LGT A;  1JJ8 C;  2R3S A;  3CCQ I;  4BH9 A;  3E5X A;  1V55 H;  2EA4 A;  1X1A A;  3E6M A;  5IP9 J;  1H89 C;  4XID A;  1X58 A;  3GCM A;  3F9K A;  1IDY A;  2OF7 A;  2KDZ A;  4RS8 A;  4ZDO A;  4N0B A;  4HF2 A;  1Y0U A;  3FF5 A;  4IKF A;  2W7N A;  2HKX A;  3WU0 A;  1TNT A;  1BI1 A;  1KON A;  3ZQL A;  1U5T C;  2LKS A;  2VON A;  4G9Y A;  1H9T A;  5F64 A;  3K70 C;  3DPU A;  5FLM J;  3I4M J;  1E3P A;  1KYW A;  3NAU A;  4Y3O A;  1R71 A;  5C44 J;  4YFK F;  1B9M A;  5EF6 A;  4QWQ A;  3DU6 A;  2BHZ A;  1K7A A;  5M5W J;  4XKV A;  1MMA A;  2DA4 A;  2DW4 A;  4CCN A;  2OTL I;  1HDD C;  1V5G A;  5DDG A;  2JA2 A;  1H88 C;  2Y0S A;  1Z7U A;  1IO2 A;  2GXG A;  4XN0 A;  2DMT A;  3HOS A;  4RA2 A;  1OCC H;  1WCM J;  2VPL A;  3CES A;  3G1L A;  3L2W A;  2VE8 A;  2HGC A;  2MD0 A;  4RGX A;  3K7A J;  4IRI A;  4QTR A;  1AOY A;  3CCR I;  2LR8 A;  2DXI A;  4XBF A;  1LVA A;  1MND A;  1ORK A;  1XSX A;  2CQX A;  3L2Q A;  1TBX A;  1UZC A;  2DDB A;  5EZH A;  2W25 A;  5HLH A;  2X1D A;  1D0Z A;  2HDW A;  3QOE A;  2ZCW A;  4AUX A;  3CO7 C;  4ZZD A;  2KZG A;  1D0Y A;  1GVJ A;  5H20 A;  1R58 A;  4I02 A;  1T0F C;  1HW1 A;  3ZQQ A;  3K4L A;  3M1E A;  1HDP A;  3WG7 H;  4C3I J;  3DP7 A;  2MGQ A;  3M07 A;  2LKP A;  3ABT A;  1TT0 A;  5JVT A;  2M8E A;  3RJP A;  3BP8 A;  1QO0 D;  2DOF A;  3C18 A;  4XSX F;  4G7O F;  2XKP A;  4BYY A;  2A3S A;  2H6B A;  1BW5 A;  3PJR A;  1LDJ A;  3EDP A;  3S32 A;  1P9Q C;  4OAY A;  2X85 A;  4GGG A;  1XPX A;  2V26 A;  2DA2 A;  2OUM A;  1MDM A;  2Q1Z B;  4CCO A;  5FRN A;  1R4N B;  1R22 A;  2VOP A;  2XV4 S;  3H9Q A;  1SFK A;  4U7B A;  3MVP A;  1TWA J;  2ZSI B;  4EV0 A;  4C3H J;  5CVV A;  2G0E A;  3ZMS A;  4ESB A;  4BAC A;  1YJ9 I;  4A5N A;  1JUS A;  4HLY A;  2UUZ A;  4CCM A;  4I6Z A;  4V19 K;  3R6S A;  3A01 A;  2CWE A;  1F5T A;  4A93 J;  2FQ3 A;  3SDB A;  4RB3 C;  2QF7 A;  3FXU A;  4NC6 A;  4I2O A;  1N25 A;  3GZN B;  3KEQ A;  3L2C A;  4M6Y A;  2DI3 A;  5FO5 A;  1YJN I;  2XAS A;  2FBK A;  2CQK A;  3U1D A;  4DZP A;  4A0Y A;  3VFZ A;  3AKZ A;  2ID3 A;  3GTG J;  2IT0 A;  1MNM C;  2XUB A;  1FYL A;  1GLN A;  3DKX A;  5L3B A;  4WXH A;  4BE0 A;  1J59 A;  4U87 A;  3MQ0 A;  3NWS A;  3HDD A;  1YO5 C;  2XAU A;  2RN7 A;  3WTX C;  1IC8 A;  5H6R A;  2HVQ A;  4KT5 C;  4ZJZ A;  3ZR8 X;  2J5O A;  4EJT A;  1TQM A;  2QA4 I;  1LFP A;  4G12 A;  3W6K B;  1F9N A;  3TW7 A;  3VSL A;  4UHT A;  1Y1V J;  5F0F A;  2ZB9 A;  2LNB A;  2VJ5 A;  1XMA A;  3F6V A;  5JI6 A;  4A3L J;  1UMQ A;  1GXP A;  3HOZ J;  1JHF A;  4W1U A;  3GLX A;  2UV1 A;  2W48 A;  3BTI A;  1GXQ A;  1K6O A;  1NTC A;  4I99 C;  4IZZ A;  1QHG A;  2VJJ A;  2GIV A;  4E4H A;  4RGS A;  5D4R A;  4QLC U;  5LLQ A;  5FLX K;  3TED A;  3JRB A;  1FP2 A;  3BG5 A;  2QVO A;  2H1L A;  2CW7 A;  1OCZ H;  1FT9 A;  2WB1 A;  1T6S A;  4FX0 A;  3CMA I;  3KZZ A;  3TL4 X;  3KZI C;  3QOP A;  1IN6 A;  3PQJ A;  1OLT A;  1S5L C;  1R9T J;  2O9L A;  2L9S A;  2PJR A;  3DBH B;  3R0A A;  5D6E A;  3GTJ J;  2JA6 J;  1W0U A;  4BS9 A;  4FE4 A;  4KIT B;  4ANJ A;  4OWR B;  3RTR A;  1XDS A;  3ZQG A;  1V5E A;  3DLL F;  3L09 A;  3QPH A;  1K4S A;  2LY2 A;  2JRT A;  3M1C A;  4B47 A;  4D7N A;  4MEX F;  4E70 A;  1FYM A;  5GP9 A;  2ESN A;  2E34 A;  1HW5 A;  2E5Z A;  2JWT A;  1JTY A;  5E3L A;  4BNC A;  4WK8 F;  1EKE A;  1A35 A;  1GV2 A;  5TRD A;  2HWV A;  4PGG A;  3O8G A;  3I5U A;  2M2E A;  1X1D A;  4L5I A;  2VKE A;  1N78 A;  4BAY A;  1QPI A;  2X4H A;  1G4D A;  1IN7 A;  2LF7 A;  4DW6 A;  4BEH A;  2NS8 A;  1MH3 A;  2RC4 A;  1X1C A;  3GUD A;  2DAO A;  1TW2 A;  2VOD A;  3HOU J;  1IV6 A;  1LQ1 A;  3DEU A;  2ME6 A;  2H27 A;  1WJC A;  4LGW A;  3DF8 A;  3I55 I;  4ZC3 A;  1YYV A;  2EH3 A;  3HHG A;  4ENN A;  1T95 A;  1HST A;  1FPQ A;  1ZQ3 P;  4RAY A;  1IG7 A;  1L3L A;  2LYC A;  2Y2Z A;  2K86 A;  5FLV A;  1KYZ A;  2VQH A;  3FM3 A;  4UUT A;  3V42 A;  2GXA A;  1FIA A;  1WI9 A;  1FWZ A;  2YSR A;  4IVN A;  3MKZ A;  1N75 A;  2IA0 A;  4NQW B;  5KVR A;  3SQN A;  3E5U A;  3G71 I;  2KRF A;  3LFK A;  3CC2 I;  3V4G A;  3OR2 C;  3LNQ A;  2PQ8 A;  1Z9C A;  1IW7 F;  2WTE A;  4FIS A;  3SEZ A;  4C2M J;  2PLY A;  2NS0 A;  3FIS A;  2BW3 A;  2HXO A;  2F4I A;  3W2W A;  3GW2 A;  3QPT A;  3ZQF A;  3G4S I;  3BDD A;  2V79 A;  4PJ0 C;  4OIN F;  3KP5 A;  1FBS A;  1K4T A;  4RAZ A;  1RKW A;  2FMY A;  5M3M J;  3CCJ I;  3B6C A;  4EM0 B;  2DN0 A;  1BOB A;  2M8G X;  1SD5 A;  3BG3 A;  3CP8 A;  5J1Y A;  2ME0 A;  4DJA A;  5IT9 K;  1KQ8 A;  2ZXW H;  2LRE A;  1ZGA A;  1XX5 A;  3JAM K;  1OR7 C;  3WTU C;  3DWL E;  2BV6 A;  2B63 J;  2XRO A;  1FBU A;  1C0W A;  3BG7 A;  3JRF A;  1RPW A;  2ID6 A;  1P7I A;  1MJB A;  2O8X A;  3S1M J;  4IHS A;  5B1B H;  1BR4 A;  4Y4R A;  3U2R A;  4I09 A;  1BA5 A;  1IN8 A;  4XKC A;  2QQB A;  2NVX J;  1GUU A;  2F4M B;  2TCT A;  2Y75 A;  1R00 A;  2H8R A;  4GFB A;  4CYD A;  3RQ4 A;  4A3E J;  5BQT A;  1BI0 A;  3H3U A;  3K10 A;  3K4C A;  4ESF A;  4RBO A;  1POG A;  5J3L A;  2ELH A;  3KYD B;  2DTR A;  3H3V K;  3VOD A;  2RV8 A;  2Z99 A;  3QP5 A;  4BY7 J;  4OIQ F;  2DU9 A;  3CO6 C;  3ZN0 A;  1Y1W J;  3I4N J;  2W84 A;  4XOP A;  2OD5 A;  1YTY A;  1J2X A;  5J8F A;  1OPC A;  1EH7 A;  2K4J A;  1BM9 A;  2FRH A;  4YIR X;  1PUF B;  2R7D A;  3AG4 H;  4D5C A;  5KAF C;  5FD5 A;  2DFH A;  1U8R A;  5F0C A;  4M71 A;  3ABU A;  5E3M A;  4RMN A;  4KN4 X;  2XAH A;  3N05 A;  1ZG5 A;  2BBY A;  3A0B C;  4RLF A;  2WC2 A;  1TWG J;  2R5Y A;  5H2F C;  2E2I J;  3D5R C;  4YFX F;  1HKQ A;  2Z5U A;  4B8X A;  4M3G A;  1P6R A;  4IHW A;  4RM2 A;  3DU5 A;  1I39 A;  2VB6 A;  3FXM A;  1QGP A;  4YIF A;  1ZRE A;  4WCG A;  4FT8 A;  2VXD A;  2XF6 A;  4BHB A;  2YU3 A;  1G3W A;  3TOB A;  3DTE A;  1RIO H;  4HF0 A;  2VBW A;  1HF0 A;  2NVU B;  4XLC A;  2XSD C;  3H36 A;  1DPU A;  1MSF C;  3ZQH A;  3BTC A;  4XRF A;  1V54 H;  2DQL A;  2KZV A;  2JRM A;  2E36 A;  2VAS A;  3GBG A;  3CUQ B;  4HNV A;  2CJJ A;  4EJU A;  2OQG A;  3NEU A;  3A02 A;  1D0X A;  1RR7 A;  2VN2 A;  5D8K B;  1DU0 A;  2E7X A;  3WOD F;  1X1P A;  4G8X A;  2MG4 A;  2XDV A;  3ECO A;  1XDU A;  1R49 A;  1TTY A;  2UXX A;  4OAZ A;  3P9C A;  3L1P A;  1YJW I;  2BGC A;  2DMN A;  4WXD A;  2FEZ A;  5HVQ C;  1VQO I;  4M6V A;  2NNY A;  5D5V B;  4V2F A;  3QP6 A;  4XOR A;  3CQZ J;  1VF9 A;  2NOG A;  3BY6 A;  2F5E A;  2PBI A;  4JBA A;  1U6G A;  4CCL A;  1UJ8 A;  2CW8 A;  4O3M A;  1A6Q A;  1K61 A;  1T33 A;  1BR2 A;  2V9K A;  5AIQ A;  1REP C;  1YS7 A;  5EG0 A;  4UV9 A;  3CCE I;  1S7A A;  1F36 A;  1D8J A;  4CHU A;  2R4G A;  4GO1 A;  2GLO A;  4MIM A;  1AKH A;  3LFU A;  4M9X A;  3WTY C;  4HV5 A;  1A04 A;  4B4C A;  2FUG 2;  3CJN A;  3GTP J;  3OSF A;  1SVM A;  1Z3Y A;  2L01 A;  1YIO A;  2ZC2 A;  1CGP A;  2Q2E B;  2VI6 A;  3MKW B;  1E3O C;  3CME I;  1ERD A;  1IRF A;  3JRE A;  4B3A A;  2BXZ A;  2DK5 A;  4JOM A;  3Q5F A;  1ZG1 A;  2R93 J;  4HNU A;  2BHY A;  2X9D A;  1MMG A;  5B66 C;  2EFQ A;  1P4X A;  2EFP A;  4CYC A;  2Y9Z A;  5HS7 A;  3PQK A;  3BPX A;  3OOU A;  2LY9 A;  1B1B A;  4JX4 A;  3V7C A;  3CLO A;  3J7A Y;  3PUF A;  1UG0 A;  2VBX A;  4N9H A;  2KKO A;  3IKV A;  3ZOB A;  5JHU A;  3ONQ A;  2PG4 A;  2HYJ A;  3JRI A;  3DBL B;  2QBY A;  1DPR A;  2BEO A;  2KFD A;  3J7Z I;  3I9V 2;  1G3T A;  3GTK J;  4XLP F;  2FD5 A;  2WAF A;  3BCA A;  3GXO A;  3K6G A;  2HQ5 A;  2HQR A;  1XS9 A;  2L4M A;  4AU7 A;  1MIJ A;  1KZH A;  4XLF A;  5D5U B;  3GZ6 A;  2MAB A;  2K9N A;  2DK8 A;  3I3L A;  2HU9 A;  2JPC A;  3OIQ A;  4UXN A;  1B6A A;  3K1M A;  3LSG A;  2TRT A;  3ABM H;  4KA4 A;  1LEB A;  1HOM A;  3C2H A;  4LG0 A;  2LDU A;  2DTZ A;  3CD6 I;  3DEE A;  3KP2 A;  3J81 Z;  2MBF A;  3CJT B;  3DPL C;  3WGH A;  4EJV A;  5IT3 A;  4A6D A;  4MLO A;  1DDN A;  3OL3 A;  4YFN F;  3F21 A;  5LD2 C;  2Z1D A;  4GXO A;  1HA8 A;  2CH0 A;  4M9S A;  4BQQ A;  2ZBK A;  4OMY A;  1IXR C;  5EGO A;  3BT9 A;  5E1X A;  4O6J A;  4A3G J;  4ZH4 F;  2F5C A;  4DBQ A;  3WTS C;  1R7J A;  5E3O A;  5LHG A;  3HOV J;  2E1O A;  4II3 A;  3IWF A;  1XSV A;  2D1H A;  5EEH A;  2NVY J;  1Z6T A;  5K1Y A;  3RKX A;  4HW0 A;  1WZ2 A;  2A5Y B;  3V7S A;  2QUF A;  1WGX A;  1SVL A;  2GOX B;  3A0H C;  4RGU A;  3JR9 A;  1ON1 A;  1TT5 B;  3R60 A;  3ZGK A;  4E7S A;  4PCQ A;  4NB5 A;  3L00 A;  3SFZ A;  1FY7 A;  3TDU C;  2QWW A;  3IRQ A;  3Q9V A;  1SFO J;  3MKY B;  4E7I A;  4PFP A;  3MCZ A;  1KU3 A;  2K9Q A;  1U2W A;  2HZD A;  2H09 A;  1MMD A;  3ROU A;  2F5D A;  2MC3 A;  2E19 A;  4IJA A;  1HW2 A;  3CF2 A;  4HQE A;  3MEX A;  3KEY A;  3HKZ N;  2X1E A;  3PIO F;  2LRD A;  2CFO A;  2AQF A;  2CUF A;  2O0Y A;  2VPR A;  1E3H A;  2VE9 A;  4AIH A;  2DQR A;  1T56 A;  2JA7 J;  4JX6 A;  1RI7 A;  1T98 A;  1X19 A;  2CQQ A;  2XPV A;  4N4O B;  3S16 J;  2GA1 A;  4G7H F;  4GDF A;  1TWC J;  3JCU C;  2OAZ A;  3GTM J;  4RGR A;  2JPB A;  5FGM A;  3FDY A;  2P5L C;  1Z7L A;  3F72 A;  3TO7 A;  3ZQC A;  1D1B A;  2MW8 A;  2JQ7 A;  4AIJ A;  4D0P A;  1UB9 A;  3D1N I;  4ESJ A;  5JHF A;  4IPA A;  3VB2 A;  1DU6 A;  2B7E A;  3L2R A;  1O3S A;  1O3R A;  2OPT A;  1FMW A;  1GDT A;  5A2Q Z;  5CQE A; 
#chains in the Genus database with same CATH homology
 3E6D A;  1DUX C;  2STT A;  1R1V A;  1QBJ A;  2HS5 A;  3HTS B;  4I01 A;  2DBB A;  2CGP A;  2P4W A;  2P5V A;  1R23 A;  2VC1 A;  4HDV A;  1FBQ A;  3KCC A;  4LB5 A;  1YW9 A;  3E3V A;  3WTW C;  2HKO A;  1STZ A;  2IW5 A;  3MZY A;  3I53 A;  5E8G A;  4LK1 F;  2GWR A;  2QLZ A;  1WWX A;  1FNN A;  1U78 A;  5ILS A;  3LA2 A;  4KNY A;  1QPM A;  1FX7 A;  3EYI A;  1YW8 A;  4A6E A;  4HYE A;  4M6X A;  1XSD A;  3D0S A;  3WGI A;  3JTG A;  1ZGJ A;  3ISP A;  2FBI A;  4DQ2 A;  1PDN C;  3MFK A;  5LEJ A;  2EV0 A;  1OYY A;  4Q48 A;  5D6F A;  1B4A A;  2DLL A;  5E1W A;  5BPI A;  2Z33 A;  3ZPL A;  2W24 A;  3CUO A;  2CG4 A;  3FZV A;  2JTV A;  2L4A A;  3DPT A;  4YII A;  1G3Y A;  1PP8 F;  3B02 A;  2KIU A;  1SFE A;  5JFR A;  3E97 A;  3I59 A;  2OA4 A;  1SFU A;  3BOQ A;  3LQR A;  4M74 A;  3CUQ C;  2RDP A;  1SAX A;  3K1N A;  4L0Y B;  3R0J A;  3KLO A;  1SD6 A;  3FMR A;  2M45 A;  2Q8K A;  4UVB A;  3V8K A;  4S05 A;  4KMU X;  2IRF G;  3ML6 A;  4L9T A;  5HDK A;  2STW A;  1MZB A;  1ZRD A;  2QQ9 A;  4AIK A;  2MLK A;  3O6B B;  3QRF F;  2X0L A;  1ZHF A;  5HS9 A;  2LF8 A;  3FXR A;  3WTT C;  1YW7 A;  4DNC A;  4R8H A;  2OZU A;  5H6Q A;  5E17 F;  2G9W A;  1CF7 B;  5D8L B;  1MD0 A;  2XGX A;  1MGT A;  4KIB A;  4PDK A;  3GFL A;  4HF1 A;  2JT1 A;  3HTU A;  4HQM A;  1W5T A;  3TO9 A;  2FE3 A;  4IRG A;  2EA2 A;  2F2E A;  1P4A A;  2YX4 A;  5ERI A;  3TO6 A;  3GWZ A;  6PAX A;  1FC3 A;  1KGS A;  3T1B A;  2ZXJ A;  5L3G A;  5FB2 A;  5DUK A;  1D8K A;  4GYG A;  3I54 A;  2BE5 F;  2DFI A;  3M8E A;  4OMZ A;  4XSZ F;  3EYY A;  1T38 A;  1R5G A;  5E8I A;  2VT3 A;  1S6L A;  1B59 A;  1JE8 A;  4UVA A;  3MZH A;  1R5H A;  3GYH X;  2W85 A;  4OIR F;  1RNL A;  2IP2 A;  3NQO A;  1QZY A;  3IKT A;  1XMK A;  1UHW A;  3IWZ A;  4L9V A;  1P4W A;  4MTE A;  5LHI A;  2QQA A;  1ZRF A;  4EJO A;  3J7A O;  3PFI A;  5BOX A;  3FWE A;  2XVC A;  3EUH A;  3HRS A;  1W7P A;  4I0B A;  1IAW A;  1B9N A;  5BMZ A;  4M73 A;  1HQC A;  2KIF A;  1ZYR F;  1O3T A;  3K1P A;  3U9G A;  5E20 A;  3B73 A;  2HR3 A;  2ZNY A;  1J0R A;  5CVR A;  3F6O A;  2G7U A;  4CGZ A;  4YG2 F;  3S2W A;  1FSH A;  1ZG3 A;  5CJ9 A;  2VOO A;  3CDH A;  4NHJ A;  4P9F A;  1SD7 A;  5A2Q K;  3P7N A;  2K02 A;  4ON0 A;  4L5J A;  2HFH A;  3HIF A;  2PEX A;  3FMS A;  5LHH A;  4ENK A;  3CTA A;  3G3Z A;  2Z9O A;  4L9N A;  2RQP A;  4LLL A;  2V9V A;  3D5L A;  3GF2 A;  2VT2 A;  4Q4Z F;  1I27 A;  5ICE A;  2ISY A;  1D5V A;  2L54 A;  1G6N A;  4MTD A;  1SFX A;  3L7W A;  3ZMV A;  4KDP A;  2GAU A;  3T0Y A;  5HLG A;  2ZME A;  3IC7 A;  4Y17 A;  5HOO A;  3R4K A;  3I71 A;  4HX4 A;  5AON A;  3MWM A;  5LGN A;  1BOA A;  1Q1H A;  3K2Z A;  3JSO A;  3DV8 A;  1VTN C;  2FSW A;  5AIP A;  4EJW A;  4AWX B;  1KA8 A;  2E1C A;  4KFC A;  1D3Y A;  3WGG A;  1R1T A;  2NAZ A;  4FX4 A;  1LNW A;  3RYR A;  4N9I A;  1P2F A;  1NHA A;  4K2E A;  1ZRC A;  1I1G A;  2LSO A;  4PZJ A;  2Y48 A;  3TKY A;  1X3U A;  4BQA A;  1UHM A;  2XAF A;  5DCM A;  1K78 A;  2EK5 A;  3HRU A;  1U5T A;  3E6B A;  1ZLJ A;  3F8F A;  4LB6 B;  3T8T A;  2HQN A;  4G7Z F;  3WTV C;  3F8M A;  4KMF A;  1KQ9 A;  3P9K A;  3O2P E;  3HUG A;  1IUY A;  3WE3 A;  2QBY B;  4MEY F;  2GA2 A;  3V7R A;  1I1S A;  4U0Y A;  4KIG A;  5DEQ A;  2XAQ A;  3QU6 A;  1BIA A;  3OV8 A;  4LD5 A;  1OMI A;  2WV0 A;  4GCV A;  2YPR A;  3K69 A;  4WXC A;  3HSE A;  2DT5 A;  1T0F A;  4LG0 B;  3JSP A;  2FNA A;  2E1N A;  4Q47 A;  4ZYH A;  3LWF A;  2Z3Y A;  1AWC A;  3BJA A;  4A12 A;  3K9T A;  1OYW A;  2J5P A;  1YLF A;  5DYM A;  5CLS A;  3HHH A;  1BC7 C;  2RNJ A;  2KJC A;  3WTZ A;  1Z91 A;  2XIG A;  4ASN A;  5DUI A;  3JTH A;  1XGM A;  1I5Z A;  3GFM A;  1BI3 A;  1W4M A;  1UFM A;  4Y15 A;  3GX4 X;  2FF4 A;  4JQF A;  4FHT A;  3R61 A;  1IN4 A;  1IXS B;  5J8C A;  5CVI A;  1K79 A;  2Q0O A;  1IZ1 A;  1T39 A;  5HDG A;  3E5Q A;  5FLX Z;  3RPU A;  2FML A;  5ICF A;  4HAM A;  3IHU A;  4P96 A;  2ADU A;  2V1X A;  4EM2 A;  5DV5 A;  3LQQ A;  4HX8 A;  4OU0 A;  1F1Z A;  3TOA A;  1LJ9 A;  2ZNZ A;  2G7H A;  1XGS A;  1O57 A;  4KIC A;  4LK0 F;  2IPQ X;  5L3F A;  5HDN A;  1S3J A;  2HOE A;  1XB4 A;  3HOT A;  1LEA A;  4MGR A;  5CYV A;  4WF2 A;  3IL2 A;  1KU9 A;  4M72 A;  3W6J B;  5DD8 A;  5ICC A;  3GZ5 A;  3EQL F;  4CDG A;  1J7K A;  1RZ4 A;  1IXC A;  3KET A;  3H3Z A;  1PUE E;  1JGS A;  3GVA A;  3DKW A;  4KIF A;  2ESH A;  2QEN A;  1WKM A;  3LAP A;  1EH8 A;  3AAF A;  1EH6 A;  4F7Z A;  1DP7 P;  1O7L A;  1YFH A;  2M1B A;  1LDD A;  2M5W A;  1J9I A;  2ZO4 A;  4EVI A;  1ULY A;  4GYI A;  1YS6 A;  2H6C A;  5LEK A;  3EET A;  1I6X A;  5TJJ A;  1KU7 A;  4Q5S F;  4I0A A;  2AXL A;  4RB2 C;  2FXA A;  4IRH A;  1O7F A;  2OBP A;  2V1D A;  3BWG A;  1P92 A;  1ZH5 A;  4IF4 A;  3HSR A;  3ZMD A;  3KP6 A;  3F3X A;  4U88 A;  3BJ6 A;  3KLN A;  4OIO F;  2MA3 A;  2CFX A;  3I59 B;  4IHT A;  5FD6 A;  3VOE A;  1MDM B;  4LFU A;  3ZMZ A;  2EB7 A;  2A6E F;  1OR7 A;  3L9F A;  2IVM A;  4LMY A;  2P7C B;  3GFJ A;  3IRR A;  1UST A;  3NRV A;  1QQI A;  4JK1 X;  2HYF A;  4U7D A;  3KE2 A;  2P6S A;  4ZYE A;  5BPD A;  1TNS A;  2HYG D;  4UVC A;  3WU1 B;  3ZN1 A;  4A5M A;  3BZ6 A;  2PN6 A;  1WSU A;  1V4R A;  3F8C A;  1S8N A;  2JSC A;  3DXJ F;  2UZK A;  2XAJ A;  3T5X A;  2JZY A;  1TQP A;  1H0M A;  1PP7 U;  3I64 A;  2PMH A;  2QZ8 A;  2D2W A;  2RGV A;  4KUM A;  2CSO A;  2NNN A;  3RI4 A;  2ZFW A;  5K5Q A;  2KIM A;  4R79 A;  4KYW A;  2EV5 A;  2D45 A;  1Z6R A;  4CZZ A;  4LLN A;  2CO5 A;  2VXZ A;  4H0E A;  4EM1 A;  3C7J A;  1ZLK A;  1FSE A;  4WX9 A;  3V8J A;  2GZW A;  2K4B A;  2OQR A;  4I98 B;  1RUO A;  4WWC A;  1EV7 A;  4EGZ A;  1V3F A;  1T2K A;  3V8L A;  1FLI A;  3QAH A;  2CYY A;  2DPU A;  3F8B A;  3RPQ A;  3RKY A;  3KZY A;  3SZT A;  3F23 A;  1RUN A;  2EFW A;  1H9G A;  5D5W B;  2ZKZ A;  1QZZ A;  3RKW A;  4A2U A;  3BJO A;  1LDK B;  3HSF A;  3N97 A;  3J80 Z;  1W7P B;  4ENM A;  4RB0 A;  4I7H A;  2F5F A;  5LRR A;  4Z2Y A;  3J81 K;  1E2X A;  2WWY A;  2E7W A;  5HLI A;  2R7F A;  1BJA A;  1YG2 A;  2P7V B;  4HZF A;  2COM A;  2BYV E;  2VBZ A;  5CVJ A;  2FBH A;  1F4K A;  2GXB A;  3ECH A;  4HDU A;  1GHC A;  1IN5 A;  3TQN A;  3DQV C;  4OOI A;  4S04 A;  1CF7 A;  5F6F A;  5LBQ A;  3M8F A;  5KK1 A;  1HSJ A;  4IXA A;  5DD4 A;  1XCV A;  4U0V A;  5EEG A;  2QYO A;  3I58 A;  1SD4 A;  2M87 A;  1HKT A;  2L02 A;  1Z1D A;  1J5Y A;  2HTJ A;  4UV8 A;  1BBY A;  1W7P D;  1UCR A;  4MNU A;  5FFZ A;  3SHF A;  1ZAR A;  1MJA A;  2V1U A;  5BS6 A;  2ZME B;  3DFG A;  3FMQ A;  4MHG A;  4EQQ A;  2O03 A;  3LAJ A;  4CO8 A;  3RDI A;  2K27 A;  2DPD A;  1HKS A;  4P9U A;  4P55 A;  2XKO A;  3LST A;  5ED4 A;  1J75 A;  1L0O C;  2P6T A;  3LA7 A;  2B0L A;  3WG9 A;  4P5O A;  5F1R A;  3H92 A;  2NYX A;  1FYK A;  2EFO A;  4ETS A;  4CIC A;  4L0Z B;  1TLH B;  2O3F A;  3MAJ A;  2EV6 A;  3OOP A;  2IA1 A;  2MD5 A;  5LGU A;  1Z05 A;  2ACJ A;  5DCM B;  1K78 B;  5FFX A;  2UXN A;  2TDX A;  2C6Y A;  2XAG A;  1U5T B;  1SMY F;  4HX7 A;  2L3D A;  5E1Z B;  1SMT A;  4ZYD A;  4U0W A;  2A07 F;  4A0X A;  3GEZ A;  1BN5 A;  2ZJ2 A;  2HDC A;  2ISZ A;  3M9A A;  4NQW A;  3LA3 A;  2PI0 A;  2Y0M A;  2MLG A;  3ELK A;  4G6D A;  1ODD A;  4M9Z A;  1BC8 C;  2FA5 A;  1TW3 A;  2YX7 A;  1S29 A;  1XGO A;  3ZMT A;  4HLX A;  3BPV A;  2P5K A;  3O3K A;  3GFI A;  2IA2 A;  2VC0 A;  1USS A;  3RYP A;  3C3W A;  4HV6 A;  3FM5 A;  2RVC A;  1S7O A;  5D5X B;  2VBY A;  3QU3 A;  1BIB A;  1JHH A;  3ZP5 A;  5JR3 A;  5E18 F;  2DO7 A;  4Y13 A;  4HBL A;  2A68 F;  2A69 F;  4MQV A;  4CXF A;  1ON2 A;  4UNO A;  2PFB A;  1MKM A;  4AVP A;  3KP3 A;  5DCF A;  5L3C A;  4BHC A;  4XLN F;  1JXS A;  3Q9S A;  2MH2 A;  2FNP A;  3ULQ B;  5K5O A;  2PJP A;  2HZT A;  5HS8 A;  3I0T A;  1R1U A;  4HOB A;  1XN7 A;  3JW4 A;  3C1D A;  2OU2 A;  4KN7 X;  3SXY A;  3HRM A;  1G3S A;  2D1V A;  3GO5 A;  1HXD A;  2FOK A;  2CW0 F;  4L9J A;  2M30 A;  2HTS A;  4B09 A;  3ERE D;  3CUQ A;  1KU2 A;  3F8N A;  4BXU A;  2OZ6 A;  3COA C;  4G6Q A;  2UWM A;  3N4M A;  4OIP F;  1WRJ A;  3TDZ C;  4R1H A;  2P8T A;  3ZQ7 A;  2PMU A;  2QM3 A;  5J6X A;  1ZN2 A;  2KJB A;  4G94 A;  2YR2 A;  4A0Z A;  4EGY A;  1R36 A;  3P9I A;  2ETH A;  3FX3 A;  2AS5 F;  3J80 K;  2O6G E;  4L18 B;  1XGN A;  1FZP B;  1FP1 D;  1OYI A;  4RB1 A;  1ONV A;  1LB2 A;  3KP7 A;  2Q2E A;  1HBX G;  5L3E A;  4ENJ A;  3FHZ A;  1FOK A;  2RKH A;  4HA8 A;  1QNT A;  2EFN A;  3K0L A;  4ZZL A;  5ILU A;  2A6H F;  2W57 A;  4PGH A;  3KP4 A;  4O5V A;  1E17 A;  2K7L A;  1BI2 A;  3ZMU A;  5ICG A;  1WQ2 A;  2IJL A;  4LLG F;  5K5R A;  2A61 A;  2V6C A;  2NRA C;  3KFW X;  1IRG A;  2XHK A;  1KQ0 A;  3G73 A;  3HYI A;  4ZYG A;  5D4S A;  1O3Q A;  2EJR A;  2O61 A;  1W5S A;  2XRN A;  3SZP A;  1ZAO A;  3RIR A;  1OKR A;  5ILV A;  3WE2 A;  3E6C C;  5CVU A;  4AD9 A;  3REO A;  2HEO A;  1IF1 A;  1U3E M;  3F22 A;  3KEO A;  4BHP A;  3VEP A;  2MH9 A;  2GQQ A;  4EMS A;  2FU4 A;  1XD7 A;  1XCB A;  1TQI A;  3M7G A;  4MQ9 F;  3T8R A;  5IT9 Z;  1MJ9 A;  3FXQ A;  2EWN A;  5L3D A;  3TGN A;  3JAM Z;  3BRO A;  4LJZ F;  5LRS A;  4TV7 A;  1YQA A;  2H94 A;  3HRT A;  4UUV A;  3I4P A;  5LGT A;  2R3S A;  4BH9 A;  3E5X A;  2EA4 A;  3E6M A;  4RS8 A;  4N0B A;  4HF2 A;  1Y0U A;  3FF5 A;  2HKX A;  3WU0 A;  1TNT A;  1BI1 A;  1U5T C;  2VON A;  4G9Y A;  1H9T A;  5F64 A;  1KYW A;  4YFK F;  1B9M A;  4QWQ A;  1K7A A;  2DW4 A;  5DDG A;  1Z7U A;  2GXG A;  3HOS A;  2VE8 A;  2HGC A;  4RGX A;  4IRI A;  1AOY A;  4XBF A;  1LVA A;  1XSX A;  1TBX A;  2W25 A;  5HLH A;  2ZCW A;  3CO7 C;  4ZZD A;  1GVJ A;  5H20 A;  1R58 A;  4I02 A;  1HW1 A;  3M1E A;  3DP7 A;  2LKP A;  3ABT A;  5JVT A;  2M8E A;  3RJP A;  3BP8 A;  1QO0 D;  3C18 A;  4XSX F;  4G7O F;  2XKP A;  4BYY A;  2A3S A;  2H6B A;  1LDJ A;  3EDP A;  4GGG A;  1MDM A;  1R22 A;  2VOP A;  2XV4 S;  4U7B A;  4EV0 A;  5CVV A;  3ZMS A;  4ESB A;  4A5N A;  4HLY A;  3R6S A;  2CWE A;  1F5T A;  2FQ3 A;  4RB3 C;  3FXU A;  4I2O A;  3KEQ A;  3L2C A;  4M6Y A;  2DI3 A;  5FO5 A;  2XAS A;  2FBK A;  2CQK A;  3U1D A;  4A0Y A;  3VFZ A;  2IT0 A;  2XUB A;  1FYL A;  5L3B A;  1J59 A;  4WXH A;  3MQ0 A;  1YO5 C;  2RN7 A;  3WTX C;  5H6R A;  4KT5 C;  2J5O A;  4EJT A;  1TQM A;  3W6K B;  1F9N A;  4UHT A;  2LNB A;  1XMA A;  3F6V A;  5JI6 A;  1GXP A;  1JHF A;  3GLX A;  1GXQ A;  1K6O A;  2GIV A;  4RGS A;  5D4R A;  4QLC U;  5LLQ A;  5FLX K;  1FP2 A;  2QVO A;  1FT9 A;  1T6S A;  4FX0 A;  3KZZ A;  3QOP A;  1IN6 A;  3PQJ A;  3R0A A;  5D6E A;  3RTR A;  1XDS A;  3L09 A;  3QPH A;  2JRT A;  4MEX F;  4E70 A;  1FYM A;  2ESN A;  1HW5 A;  4BNC A;  4WK8 F;  5TRD A;  2HWV A;  4PGG A;  3I5U A;  4L5I A;  4BAY A;  2X4H A;  1G4D A;  1IN7 A;  2LF7 A;  2RC4 A;  3GUD A;  2DAO A;  1TW2 A;  2VOD A;  1LQ1 A;  3DEU A;  2H27 A;  4LGW A;  3DF8 A;  1YYV A;  4ENN A;  3HHG A;  1HST A;  1FPQ A;  4RAY A;  1L3L A;  2K86 A;  1KYZ A;  3FM3 A;  1WI9 A;  1FWZ A;  2YSR A;  4IVN A;  2IA0 A;  5KVR A;  3SQN A;  3E5U A;  2KRF A;  3LFK A;  3V4G A;  2PQ8 A;  1Z9C A;  1IW7 F;  2WTE A;  2PLY A;  2NS0 A;  3GW2 A;  3QPT A;  3BDD A;  2V79 A;  4OIN F;  3KP5 A;  1FBS A;  4RAZ A;  2FMY A;  4EM0 B;  1KQ8 A;  1SD5 A;  5IT9 K;  1ZGA A;  3JAM K;  3WTU C;  2BV6 A;  2XRO A;  1FBU A;  1C0W A;  1MJB A;  2O8X A;  4IHS A;  3U2R A;  4I09 A;  1IN8 A;  2QQB A;  2Y75 A;  1R00 A;  4CYD A;  5BQT A;  1BI0 A;  3H3U A;  4ESF A;  2ELH A;  2DTR A;  3VOD A;  2RV8 A;  2Z99 A;  3QP5 A;  4OIQ F;  2DU9 A;  3CO6 C;  3ZN0 A;  2W84 A;  1YTY A;  2OD5 A;  1J2X A;  5J8F A;  1OPC A;  1EH7 A;  2K4J A;  1BM9 A;  2FRH A;  2R7D A;  5FD5 A;  1U8R A;  4M71 A;  3ABU A;  4KN4 X;  2XAH A;  1ZG5 A;  2BBY A;  2WC2 A;  4YFX F;  1HKQ A;  2Z5U A;  4B8X A;  1P6R A;  1QGP A;  4YIF A;  1ZRE A;  4WCG A;  4FT8 A;  4BHB A;  2YU3 A;  1G3W A;  3TOB A;  1RIO H;  4HF0 A;  2VBW A;  1DPU A;  4XRF A;  2DQL A;  3CUQ B;  4EJU A;  2OQG A;  3NEU A;  5D8K B;  2VN2 A;  2E7X A;  3WOD F;  4G8X A;  3ECO A;  1XDU A;  1TTY A;  2UXX A;  3P9C A;  2BGC A;  4WXD A;  2FEZ A;  5HVQ C;  2NNY A;  5D5V B;  3QP6 A;  3BY6 A;  2F5E A;  2PBI A;  4JBA A;  1U6G A;  4O3M A;  5AIQ A;  1REP C;  1YS7 A;  4UV9 A;  1S7A A;  1D8J A;  4CHU A;  4GO1 A;  4M9X A;  3WTY C;  4HV5 A;  1A04 A;  3CJN A;  2L01 A;  1YIO A;  1CGP A;  1IRF A;  2DK5 A;  3Q5F A;  1ZG1 A;  2EFQ A;  1P4X A;  2EFP A;  5HS7 A;  3PQK A;  3BPX A;  1B1B A;  3V7C A;  3CLO A;  2VBX A;  4N9H A;  2KKO A;  3IKV A;  5JHU A;  2PG4 A;  2QBY A;  1DPR A;  2BEO A;  1G3T A;  4XLP F;  3GXO A;  2HQR A;  2L4M A;  5D5U B;  3GZ6 A;  2DK8 A;  2JPC A;  4UXN A;  1B6A A;  3K1M A;  4KA4 A;  1LEB A;  4LG0 A;  2LDU A;  3KP2 A;  3J81 Z;  2MBF A;  3WGH A;  3DPL C;  4EJV A;  5IT3 A;  4A6D A;  1DDN A;  4YFN F;  3F21 A;  4GXO A;  4M9S A;  2ZBK A;  4OMY A;  1IXR C;  5E1X A;  4O6J A;  4ZH4 F;  2F5C A;  3WTS C;  1R7J A;  5LHG A;  3IWF A;  1XSV A;  2D1H A;  5EEH A;  1Z6T A;  5K1Y A;  3RKX A;  4HW0 A;  2A5Y B;  3V7S A;  2QUF A;  4RGU A;  1ON1 A;  3R60 A;  4PCQ A;  4NB5 A;  3L00 A;  3SFZ A;  3TDU C;  1FY7 A;  2QWW A;  3IRQ A;  3Q9V A;  3MCZ A;  1KU3 A;  1U2W A;  2H09 A;  3ROU A;  2F5D A;  2MC3 A;  4IJA A;  1HW2 A;  4HQE A;  3MEX A;  2O0Y A;  2VE9 A;  4AIH A;  2DQR A;  1RI7 A;  1T98 A;  2GA1 A;  4G7H F;  2OAZ A;  4RGR A;  2JPB A;  5FGM A;  2P5L C;  3F72 A;  3TO7 A;  4AIJ A;  4D0P A;  1UB9 A;  4ESJ A;  4IPA A;  3VB2 A;  1O3S A;  1O3R A;  5A2Q Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...