1IRGA

Interferon regulatory factor-2 dna binding domain, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
112
structure length
112
Chain Sequence
b'PVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERFERON REGULATORY FACTOR-2
publication title Solution structure of the IRF-2 DNA-binding domain: a novel subgroup of the winged helix-turn-helix family.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription regulation
total genus 14
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1997-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1irgA00
1TTYA 3KP6A 1USTA 2ZO4A 2MC3A 1HKTA 3V8LA 4GCVA 2Z99A 1BI1A 1FSHA 3HOTA 3PFIA 3FHZA 1RI7A 3KETA 2O03A 1W4MA 2QVOA 4P55A 4YIIA 1UCRA 5D4RA 2P7VB 2XKPA 2GA2A 4LLNA 4AIJA 2OQRA 4ENMA 2ISYA 3RKXA 1FNNA 2PG4A 3I64A 4M74A 1DUXC 4B8XA 1S3JA 5BOXA 4LLLA 1J59A 3FX3A 1I27A 1IAWA 1YS7A 3E6DA 5D6EA 5DCFA 2FBIA 4JBAA 4MGRA 1HSJA 2H94A 1YYVA 2W25A 1K6OA 1E17A 2VONA 1Y0UA 2FQ3A 3WTYC 2VOOA 1FP1D 1G3YA 4IF4A 5LBQA 2J5OA 1LB2A 2JTVA 4ENKA 2P4WA 5KK1A 3T8RA 1HSTA 1QO0D 3Q9SA 5JHUA 1JGSA 4HW0A 3CUQA 4OIRF 1UHWA 3KP2A 1ONVA 3EYYA 2JPCA 4IPAA 4DQ2A 2PMHA 5CYVA 1SAXA 1UHMA 2RGVA 3HRSA 4EV0A 3LQRA 5E20A 3I0TA 4EVIA 3Q5FA 1K7AA 4HLXA 2YX4A 4AWXB 2R7FA 5DYMA 4BHCA 4EJTA 2G7UA 2KJCA 3V7SA 4LJZF 1P4WA 1LNWA 1HW1A 1MKMA 1TW3A 3GWZA 1R1VA 2F2EA 5FLXK 1H0MA 3ERED 1GVJA 5ILUA 4U0YA 2H09A 2L01A 1U5TC 3F6OA 4WCGA 3BP8A 5D5WB 2CSOA 2H6CA 3BJAA 2NRAC 4UNOA 5LRSA 1IN4A 3NQOA 1B9MA 2HS5A 1D8JA 2QYOA 2Y0MA 1D3YA 1ZAOA 2KKOA 4P9FA 4MEYF 1HW2A 3BY6A 3QP5A 4OMZA 2FOKA 3GVAA 4GYIA 1WKMA 1F5TA 3W6JB 2LDUA 1LDJA 4L5IA 1F9NA 1P6RA 3JTHA 3REOA 1R1UA 4ESFA 4IHTA 1T98A 4EM1A 3E5QA 5L3EA 2R3SA 4WWCA 3F72A 4UUVA 2HGCA 1P4AA 1O7FA 2MH9A 1XGSA 2FNAA 1JHFA 2HYFA 2IA1A 2EFWA 4O6JA 3ABUA 2HEOA 3RTRA 1IRGA 1XCVA 2YR2A 1Z91A 2FMYA 3ZP5A 2L4AA 3J80Z 3T1BA 1PP8F 1SD4A 1FBQA 4EMSA 3MZHA 2CG4A 1EH7A 1J0RA 1R23A 3K0LA 1YIOA 5LLQA 1SFEA 3GF2A 1ZLKA 4WXCA 3V7RA 2D1HA 4G94A 4HQMA 3O2PE 2DK8A 3MAJA 4RGSA 4A5MA 2MLGA 2XVCA 3RPUA 2ZBKA 1SFXA 4MNUA 2HYGD 3FM3A 4UVBA 3MEXA 4FT8A 4OOIA 3ROUA 5E8GA 4HBLA 5AONA 1SD5A 2BV6A 3KEQA 1STZA 4HDVA 3ZQ7A 2OD5A 3DFGA 1ZG3A 1BC8C 6PAXA 1ON1A 2LF8A 2FF4A 1IN6A 1WI9A 1BI3A 2V1DA 3U1DA 4Y13A 1GXPA 2K27A 4KDPA 1E2XA 4Y17A 2MD5A 5H6RA 1AOYA 2MH2A 3HHGA 2COMA 3IRRA 2VT2A 3DEUA 5A2QZ 2MBFA 2XAFA 4NQWA 2A69F 4OIPF 3GYHX 1BIBA 5ED4A 1RIOH 3TOAA 1S29A 1ZREA 3WE3A 2ETHA 2PI0A 5DCMA 2STTA 1ULYA 2ELHA 4KICA 3T8TA 1GHCA 3I59A 2EA2A 1SMTA 4CZZA 3ZN0A 2Q2EA 4BNCA 1HKSA 3GEZA 1KU3A 3GXOA 1XGNA 3KZYA 1DPUA 1R5GA 3SQNA 4ZZDA 3BJ6A 1QNTA 2EFQA 3EETA 1J9IA 3T5XA 3WTVC 1FOKA 4LMYA 4LGWA 2V1XA 3RKYA 3COAC 5HS7A 5D6FA 3L2CA 2L02A 1IW7F 4ZZLA 2PLYA 2EFPA 2P5LC 2ESHA 4KT5C 2CWEA 1IUYA 4KMFA 3ZMUA 2DPUA 1KGSA 4BHBA 4EJOA 3R61A 2GQQA 4CXFA 3GZ6A 1ZGJA 2IA0A 3LAJA 2M5WA 4AVPA 4ESJA 2XUBA 3L09A 3FMRA 4N9HA 3D0SA 2H6BA 5H20A 5AIQA 1LEAA 4G7OF 2EJRA 1I1SA 2FA5A 5J8FA 5IT9K 5LEKA 1RUNA 1YG2A 4RAYA 2Y48A 1YO5C 2HR3A 4BXUA 1TQMA 1P92A 3WU0A 2L4MA 4HLYA 3E6MA 1Z9CA 4E70A 2IA2A 2VBYA 3MCZA 1ZGAA 3F21A 5FB2A 1LJ9A 3KEOA 2IRFG 3VEPA 5LRRA 2BYVE 5DV5A 4N9IA 2W57A 3K2ZA 1MJ9A 4MTEA 1X3UA 4KYWA 1L3LA 1YW7A 4M73A 1B59A 4UHTA 2ISZA 1I1GA 3DPLC 2Z9OA 2O61A 2KRFA 3RIRA 4RB1A 5BS6A 1BIAA 3BJOA 1G4DA 5E1ZB 2IVMA 3RYRA 5F6FA 1R7JA 4IVNA 4NB5A 2RKHA 2LSOA 3HIFA 4L9NA 4BQAA 3G73A 3CLOA 2Z5UA 2ADUA 2FRHA 3JTGA 2BBYA 4HYEA 1ZH5A 2FU4A 2M30A 1MJAA 1DP7P 2ESNA 4L9TA 3BPXA 1S6LA 4GXOA 4ENNA 1LDDA 3IKVA 4O3MA 2XV4S 1FSEA 1HXDA 3HTUA 4LG0B 3HUGA 3OOPA 4U0VA 4OIQF 5L3DA 4A0ZA 2VC0A 2K02A 1LQ1A 4YFKF 3F8MA 1HKQA 4PZJA 3VFZA 3F8FA 2UXNA 1G3SA 3CDHA 3ECOA 3H92A 3CJNA 3ELKA 4QWQA 2EWNA 4I2OA 1CF7B 1IN8A 3JSPA 3GO5A 2NNNA 5D5UB 1ZRFA 3GW2A 1K78B 2O8XA 3P7NA 2P5KA 4XSXF 3WGIA 4HOBA 4GO1A 3M9AA 5ICGA 3Q9VA 5JI6A 3I58A 1ZRCA 2OZ6A 2FBHA 2BGCA 2JZYA 3WGGA 2V79A 4EJUA 1XN7A 2PFBA 3M8EA 3R4KA 4CGZA 1O3RA 1QGPA 2VT3A 2P5VA 1IXSB 5KVRA 2ZNYA 5E17F 4DNCA 3IC7A 5CVIA 3ZN1A 2EFNA 1O3SA 3KE2A 3G3ZA 1K79A 3RI4A 4N0BA 3M7GA 3E6CC 4U88A 2D45A 3RYPA 1OMIA 3EQLF 4AD9A 5K5RA 1W7PD 4XSZF 1BC7C 3K1MA 1U2WA 1FBUA 4KN4X 3SZPA 1SD6A 4ON0A 2VOPA 5L3GA 2VE9A 1R1TA 5CJ9A 3V8JA 1OR7A 3KLOA 2FMLA 1GXQA 3D5LA 2ZKZA 2QQAA 2LF7A 3C1DA 2STWA 4KIBA 4A0XA 2CFXA 1YLFA 2Y75A 2G9WA 2CO5A 4F7ZA 1YW9A 2EA4A 3LFKA 3LQQA 2UZKA 2VBXA 4EQQA 3CO6C 1R5HA 3IL2A 2YU3A 3F22A 4L0YB 1OYIA 1ZG5A 3LAPA 3IWFA 2MLKA 2VODA 2UXXA 2YSRA 3KZZA 3J81Z 3CUOA 3HSRA 3R0JA 4L9JA 1L0OC 1P2FA 4UVCA 3P9CA 2EK5A 1R00A 2X4HA 1T6SA 3ZPLA 2R7DA 3ZMDA 4HV6A 3DF8A 3RDIA 1H9TA 2EB7A 3C7JA 3TO9A 2ZFWA 1SFUA 1KU9A 3V7CA 2HKOA 3KP4A 5D5VB 4H0EA 3HYIA 1B6AA 1WSUA 2JRTA 1J7KA 3F23A 1G3WA 2OAZA 1J75A 1QQIA 4IJAA 3DPTA 1W7PA 4L5JA 3GUDA 1ZG1A 5HLIA 1HW5A 1ZRDA 3L9FA 3KFWX 2VXZA 4CDGA 3EYIA 4AIKA 2W24A 4EM2A 4HF2A 4LK0F 2DQLA 1CGPA 1FBSA 2W84A 5F1RA 1JHHA 1KYWA 1KQ8A 1J5YA 1BOAA 5LGNA 3L00A 2AXLA 3H3UA 4BHPA 2RC4A 4I7HA 2OU2A 5E18F 1XDUA 2O3FA 2DAOA 4BH9A 5HDNA 1V3FA 2RNJA 1RUOA 5TRDA 5JFRA 2E1NA 2GA1A 1EH8A 2HTJA 3ECHA 3GX4X 1FYLA 3I53A 4JK1X 2GWRA 4OINF 5ILVA 3L7WA 5DDGA 5BMZA 4LFUA 3LSTA 4HX8A 3PQKA 1SD7A 4KIGA 5HVQC 4LB6B 3RKWA 2XGXA 4JQFA 3JSOA 1AWCA 2IP2A 4L18B 3MWMA 1U5TA 2EV0A 2GIVA 1OKRA 2V1UA 2A6HF 4M9SA 1KQ9A 1T2KA 4IRHA 1WQ2A 2KJBA 1QBJA 5L3BA 3ZMVA 2ZMEB 2JSCA 1EV7A 2RQPA 3KCCA 4PGHA 3KLNA 3HSFA 3T0YA 4IHSA 4AIHA 2YPRA 3O6BB 2EV5A 4I98B 2QLZA 1H9GA 3HRUA 3BWGA 1VTNC 3B73A 5ERIA 2NS0A 1TLHB 1XGOA 3QP6A 5LHGA 3LA7A 1FP2A 2IW5A 5LHIA 3JAMZ 3N4MA 3FZVA 3PQJA 1Z6TA 1Z1DA 3HSEA 5BPDA 4Q5SF 2A5YB 4D0PA 4P96A 2EFOA 4ZYDA 2RDPA 5L3FA 5D5XB 2XAGA 3TQNA 2QZ8A 1JXSA 1B1BA 3DV8A 2WWYA 5E1WA 3E5XA 5FFZA 1G3TA 1KA8A 3R60A 4ASNA 4YIFA 2LKPA 4BAYA 1U3EM 2F5EA 3HOSA 2QUFA 3K1NA 3DXJF 3V4GA 1TBXA 1CF7A 3QU6A 2LNBA 3F6VA 4I01A 5TJJA 1ODDA 5FLXZ 3WTZA 1BI0A 2IT0A 3FMQA 2OA4A 2OQGA 5HS9A 3U9GA 5BQTA 3ZMTA 5CVUA 2OBPA 1BM9A 5DD8A 4RGXA 5HLHA 4KNYA 3W6KB 3E97A 2L3DA 2B0LA 2HKXA 3CUQC 2QENA 3J81K 3GFLA 2XAHA 1HQCA 4R79A 2J5PA 2CGPA 5JVTA 2VC1A 4Q48A 4OIOF 1FT9A 3LA2A 2XIGA 3IKTA 2V9VA 5DD4A 2K86A 3TGNA 2PN6A 4KFCA 5H6QA 5DUKA 4YG2F 4O5VA 3QOPA 4KMUX 1MJBA 4Q4ZF 3V8KA 2FXAA 1U8RA 3VB2A 4PGGA 3P9IA 3J80K 1TW2A 3FWEA 4HQEA 4R1HA 5DCMB 2WTEA 2NNYA 4CYDA 3I54A 3IRQA 2QQBA 1FYKA 1IXRC 3LWFA 1KYZA 2C6YA 3I5UA 4XBFA 4RB3C 2XAQA 2HQNA 2D2WA 4M6XA 3ZMSA 2FBKA 3SHFA 4U0WA 4KUMA 4HZFA 3TO6A 3OV8A 1KU2A 3GFMA 3RPQA 4WK8F 2P6SA 3SFZA 5D8LB 5FD5A 5K5QA 3MQ0A 1O57A 4IRIA 2E7WA 1FPQA 3RJPA 3DQVC 1O3TA 3QPHA 4LK1F 3TO7A 3E6BA 4NHJA 2FSWA 4MHGA 1Q1HA 3IWZA 3QPTA 2O6GE 3F8NA 3C3WA 1I5ZA 2JPBA 4G9YA 5CVVA 1V4RA 1DDNA 3BOQA 5HDKA 4HX7A 1UB9A 4P9UA 4I02A 1KU7A 3FXQA 1FZPB 1Z05A 2NYXA 5F64A 3ML6A 4M71A 5A2QK 5EEGA 2XKOA 2P7CB 5D4SA 1S7AA 2W85A 1TNTA 2BE5F 4HX4A 4IRGA 3N97A 1NHAA 2QBYB 1YW8A 5J8CA 4RB2C 4FX4A 4QLCU 1S8NA 1MDMB 4UV8A 4EJVA 4YFXF 2EV6A 1JE8A 5J6XA 1PUEE 4XLNF 5HDGA 4HA8A 1SMYF 4CO8A 2KIFA 1T0FA 3I71A 3ISPA 3P9KA 4FX0A 2GXGA 2PBIA 4EM0B 3BPVA 3F8CA 4EJWA 3K9TA 3WTTC 1R58A 3B02A 1FX7A 1PDNC 2VBZA 1FC3A 4ZH4F 1G6NA 2O0YA 4TV7A 5E8IA 2CW0F 2F5DA 4HDUA 1WRJA 3JAMK 1USSA 4U7DA 2DLLA 4S05A 5HS8A 2DU9A 3WGHA 3WG9A 4EGZA 3WTWC 1MZBA 3QU3A 3GFJA 2QQ9A 2HWVA 4P5OA 4A6EA 1YS6A 3JW4A 1XGMA 1XMKA 2FE3A 2RVCA 5DUIA 4UXNA 4XLPF 4BYYA 2NAZA 4OU0A 3WE2A 3WTSC 4ENJA 2PJPA 3DKWA 1D8KA 4U7BA 5LGTA 1KQ0A 1BJAA 4G8XA 2BEOA 3U2RA 5BPIA 2DI3A 2ZXJA 4GGGA 4HV5A 1R22A 4L0ZB 1DPRA 4RGRA 1C0WA 3CTAA 2HQRA 5JR3A 1I6XA 4G6QA 3BDDA 4S04A 3HHHA 4LD5A 2DBBA 1ZHFA 5IT9Z 4WX9A 5IT3A 1XMAA 2D1VA 1XSVA 2A61A 4KN7X 2KIMA 2FEZA 2ZMEA 4WF2A 2GAUA 5K1YA 2V6CA 1IZ1A 5CLSA 2QM3A 1REPC 2DFIA 4ZYHA 1ZYRF 4HF0A 3ZMZA 2DW4A 3VODA 4IXAA 2ZJ2A 2PQ8A 4Z2YA 4HF1A 4I09A 1YQAA 3FF5A 4MTDA 3H3ZA 2TDXA 4UV9A 2E7XA 4KA4A 1YTYA 2A6EF 4G6DA 2Q8KA 4ESBA 3FXUA 2FNPA 1QZZA 1XB4A 4Q47A 2Z3YA 5EEHA 1TQPA 3F8BA 2H27A 3ULQB 2XROA 1OYWA 5FGMA 3TDUC 2HFHA 3F3XA 1QZYA 3CUQB 2ZNZA 3GLXA 3K1PA 1T38A 2WC2A 5ICEA 2PEXA 1Z6RA 5AIPA 1D5VA 2M1BA 4I0AA 5E1XA 1HBXG 1S7OA 2MA3A 4M9XA 2Z33A 1LVAA 5HLGA 4R8HA 2XASA 5LEJA 2GZWA 4KIFA 3BROA 2QWWA 3HRTA 2XHKA 5FO5A 2P6TA 4M72A 1UFMA 2AS5F 2DT5A 1OYYA 1FYMA 2G7HA 3MFKA 1XD7A 3AAFA 5LGUA 4HAMA 2WV0A 3WU1B 2K4JA 1Z7UA 4Y15A 4WXDA 2L54A 3C18A 3TDZC 1XDSA 2VBWA 3ABTA 4RS8A 2F5CA 2GXBA 4RAZA 1J2XA 3R0AA 1FLIA 2ZCWA 5FD6A 1B9NA 1O7LA 2DO7A 3E5UA 5D8KB 2DQRA 1FWZA 4LLGF 2IJLA 1RNLA 3WODF 1R36A 4GYGA 1RZ4A 1BBYA 4MQ9F 5K5OA 2HDCA 1LDKB 3QRFF 4M9ZA 2DTRA 1W5SA 1B4AA 5LHHA 2M87A 2CYYA 4LG0A 2CQKA 1XSDA 3M1EA 2OZUA 4G7ZF 3S2WA 1MD0A 1ON2A 3O3KA 4ETSA 2PMUA 4XRFA 3LA3A 3IHUA 2RN7A 1IXCA 3NEUA 1TQIA 3FMSA 1XSXA 3CO7C 2HZTA 4PDKA 2UWMA 4L9VA 1YFHA 2M8EA 3QAHA 3SZTA 2KIUA 2E1CA 1ZLJA 5L3CA 3SXYA 1A04A 1W7PB 2A3SA 1IN7A 4ZYEA 4M6YA 4RGUA 1K78A 2A07F 3MZYA 4A5NA 3GZ5A 4CICA 5ICCA 2HTSA 5FFXA 4A6DA 2K4BA 2QBYA 2RV8A 2X0LA 1QPMA 4RB0A 2P8TA 1MDMA 2VE8A 1U78A 3R6SA 1TNSA 4ZYGA 1P4XA 2VN2A 5DEQA 3TKYA 3KP5A 4K2EA 3M8FA 3J7AO 1ZARA 1LEBA 1F1ZA 3VOEA 1MGTA 1XCBA 1IN5A 4FHTA 1F4KA 3K69A 4A0YA 4UVAA 2XAJA 5HOOA 4I0BA 2K7LA 1IRFA 1BN5A 4MEXF 3WTXC 4WXHA 1WWXA 2A68F 4PCQA 1BI2A 2ACJA 3E3VA 4OMYA 1FY7A 2M45A 3WTUC 3FM5A 3I59B 1U5TB 2YX7A 3DP7A 3BZ6A 4A12A 1PP7U 3HTSB 5ILSA 4LB5A 2Q0OA 2JT1A 5ICFA 2DPDA 3FXRA 1OPCA 3GFIA 2IPQX 4G7HF 4CHUA 3EDPA 1U6GA 2XRNA 4MQVA 3EUHA 5CVJA 1EH6A 4YFNF 3HRMA 4B09A 3I4PA 2DK5A 3NRVA 3KP3A 1ZN2A 4EGYA 2HOEA 1T39A 1IF1A 2F5FA 3TOBA 1W5TA 5CVRA 1O3QA 3KP7A 4A2UA
chains in the Genus database with same CATH superfamily
3H5AA 1TTYA 2EIKH 3D5SC 4LIVA 4KISA 3KP6A 1USTA 5KNLA 1IRXA 2ZO4A 2MC3A 5KCMA 1HKTA 3S14J 3V8LA 3A01A 3JRDA 4GCVA 2CRGA 2Z99A 3DKYA 5FJ8J 3H3VK 1BI1A 3K2AA 1FSHA 3HOTA 3PFIA 1X1CA 4EATA 3LSRA 3FHZA 1RI7A 1FMWA 1VNDA 3KETA 5M5WJ 4HEA2 1P7IA 5GTIC 1WJEA 1NH3A 2GOMA 1W4MA 2O03A 1R49A 4BEHB 2JK3A 2QVOA 4P55A 1UG0A 2KRHA 1G2HA 4YIIA 3PIOF 3VYUB 3BR0A 4A3KJ 1UCRA 5D4RA 2P7VB 2XKPA 3OR1C 2ID6A 4XMYA 3VDXA 2VJ5A 4NUBA 2GA2A 4LLNA 4AIJA 2OQRA 1VQKI 4ENMA 2ISYA 3RKXA 1FNNA 4MIMA 3D5RC 2PG4A 3I64A 3BR5A 2R7VA 2EINH 3LSJA 4M74A 3QODA 1DUXC 1R71A 4B8XA 1S3JA 4UB8C 4LLLA 5BOXA 1J59A 3FX3A 2F48A 1I27A 2KZGA 1IAWA 3J7YJ 3OSGA 1YS7A 3E6DA 3UR3C 3KPHA 3GMEA 4MLOA 5D6EA 5DCFA 2FBIA 4RBOA 1DGWY 4JBAA 4MGRA 1HSJA 2H94A 1YYVA 2M9HA 2W25A 1HA8A 1K6OA 3OYNA 2LMDA 3G1MA 3M8JA 5JLWA 4E7IA 4D5FA 4J00A 1E17A 3TBIA 1W0UA 2VONA 2LY2A 1Y0UA 2FQ3A 2CQ7A 3WTYC 2VOOA 2KFDA 2F4OB 3EPZA 1FP1D 4F91B 1W0TA 1N78A 1G3YA 4IF4A 2N8GA 5LBQA 2J5OA 5TISC 4B3XA 1LB2A 1BR4A 2JTVA 4ITVA 3FK6A 1TC3C 4ENKA 2P4WA 1R4MB 2BY1A 3T8RA 5KK1A 1HSTA 1QO0D 3Q9SA 5JHUA 1JGSA 4HW0A 2BY0A 3CUQA 4FCYA 4OIRF 1UHWA 3HDDA 3IH2A 2L5QA 1B8IA 3KP2A 1ONVA 2FQ4A 2JPCA 3EYYA 4IPAA 4PJNA 4DQ2A 2PMHA 5CYVA 2WA0A 3S2HJ 1WJFA 4CCLA 1UZCA 1SAXA 1ZKGA 2EZIA 1UHMA 2X1CA 2RGVA 3ZXSA 3HRSA 1S9HA 1MBHA 4EV0A 3LQRA 5E20A 3I0TA 4EVIA 3Q5FA 3Q0VA 2BXYA 1ZR4A 5CQEA 1K7AA 4HLXA 1X1AA 2YX4A 2R93J 4C30A 4AWXB 5IP6A 4AVZA 2QSGX 2R7FA 5DYMA 4BHCA 3JRHA 1OQYA 3X2QH 2G7UA 2KJCA 4EJTA 2ZJPF 3PO3J 4BXFA 3V7SA 1YIJI 1ETYA 5K7ZA 4LJZF 1P4WA 3S1MJ 1LNWA 1HW1A 1MKMA 1TW3A 1UHSA 3GWZA 1R1VA 3I9V2 5IYDJ 2F2EA 4DZPA 4A3BJ 3RPUD 1ZK8A 1MH4A 5FLXK 1H0MA 2CJJA 3ERED 1GVJA 4IKFA 5ILUA 5EG0A 4U0YA 2H09A 4AYBN 2L01A 4DYQA 1MSFC 1LKXA 1U5TC 1X2NA 1OISA 3F6OA 3K4NA 4WCGA 1AKHA 3BP8A 1VF9A 3K7AJ 3OMYA 3OYEA 4RAFA 5D5WB 2CSOA 2H6CA 3BJAA 3DTEA 3L2UA 2NRAC 4UNOA 3LSHA 5LRSA 4OAYA 5E3OA 1K4SA 3CDLA 1IN4A 3NQOA 1B9MA 2HS5A 1SFKA 2VXDA 3JREA 1D8JA 3ZQGA 3Q3SA 2QYOA 2WAEA 3MKLA 4XIDA 2DA7A 4FTHA 2XGDA 2Y0MA 1D3YA 1I39A 1ZAOA 2KKOA 4P9FA 4MEYF 1HW2A 1GVDA 3BY6A 2DJNA 3QP5A 4OMZA 2WAQA 2R7WA 2FOKA 2R7SA 3GVAA 4GYIA 1WKMA 1F5TA 3W6JB 3L2RA 4AC0A 2LDUA 1LDJA 4L5IA 4ZDOA 1F9NA 4U87A 1P6RA 2JMWA 3JTHA 2GXAA 3REOA 1R1UA 4ESFA 1RKWA 3RZOJ 4IHTA 1T98A 2DT7B 4EM1A 3OYLA 4G6TB 3E5QA 3HB9A 1DQUA 5L3EA 2R3SA 4WWCA 3F72A 1RKTA 1WH5A 2IGOA 3AL0B 2K3FA 4UUVA 2BY2A 4DGWB 2HGCA 2E1OA 1P4AA 5FKNA 4XKBA 3HG9A 1X4PA 3BG9A 2KRCA 1O7FA 2MH9A 4A69C 3ABKH 1XGSA 1JI8A 2ID3A 2FNAA 1JHFA 4PJMA 2HYFA 3JRAA 2OJED 2AQEA 2IA1A 3WU2C 3HOVJ 2VKDA 4F52A 2W48A 2EFWA 4KT6A 1I3AA 3ZGKA 4O6JA 3ABUA 2HEOA 1VQLI 1D1CA 3RTRA 2EILH 1IRGA 1XCVA 1PYVA 1QVUA 2YR2A 1Z91A 2FMYA 3C2GA 3ZP5A 3SEQA 2LFBA 2R7TA 2L4AA 3J80Z 1PUFA 4RLQA 3T1BA 1PP8F 1SD4A 2WBMA 1S72I 1FBQA 4EMSA 1JJ6C 3MZHA 2CG4A 1MH3A 2X1DA 4PJ0C 1Y0NA 4AM3A 3J7AY 2YS9A 5F0HA 4XRSG 3OIOA 3FKIJ 2LG4A 1EH7A 2DCEA 1J0RA 1R23A 3K0LA 1YIOA 5LLQA 2E2HJ 1SFEA 3GF2A 2DTZA 2IAIA 3E7LA 2VQGA 2DYRH 5GAHJ 1ZLKA 4WXCA 3V7RA 1BA5A 2CQQA 2D1HA 2W00A 1Y8RB 3WHBA 3JCUC 4G94A 2V26A 2Y0SA 4XKCA 4HQMA 3O2PE 1SAUA 2DK8A 4C2TA 3MAJA 4RGSA 4A5MA 4D7NA 2MLGA 2JA6J 2XVCA 4QSHA 3RPUA 3WG7H 2ZBKA 3SDBA 1SFXA 4MNUA 5BNGA 2HYGD 3FM3A 2NVXJ 4UVBA 3MEXA 2XSDC 2PMZA 3AKZA 4FT8A 4OOIA 3ROUA 2L9VA 1D1AA 5E8GA 2D5VA 4HBLA 5AONA 1SD5A 2BV6A 2KDZA 3FXKA 3KEQA 1STZA 3GTOJ 4HDVA 3H35A 2DMTA 3ZQ7A 2OD5A 3DFGA 1ZG3A 3LSIA 1BC8C 6PAXA 2F4MB 2VUMJ 2CUZA 1ON1A 2LF8A 2JN6A 2FF4A 1IN6A 1MNEA 2KPMA 1WI9A 1VFCA 3GTPJ 1SFOJ 2XPUA 1BI3A 1MBKA 2V1DA 2BOLA 2Y9YA 3U1DA 3A0BC 4Y13A 1GXPA 2K27A 4KDPA 4X1EA 1E2XA 1JT6A 2XPWA 4FISA 4II2A 4Y17A 2MD5A 3BG5A 4XONA 4OWRB 2DMNA 5H6RA 2NS8A 4FE4A 1AOYA 2EZLA 1VZ0A 2MH2A 3HHGA 3CCSI 2COMA 3HC7A 1LUJB 3OYAA 3IRRA 2VT2A 3DEUA 5A2QZ 2MBFA 2XAFA 4NQWA 4C2UA 2A69F 4OIPF 3GYHX 5K7FA 3LL7A 1MBJA 2ZB9A 1SANA 1D5YA 3TMOA 1BIBA 3BG3A 2OC6A 3CCRI 5ED4A 1RIOH 3TOAA 1S29A 1ZREA 3WE3A 5EDNA 1B72A 2ETHA 1T95A 4XLHA 2PI0A 5DCMA 5IYCJ 4A3IJ 2STTA 4F55A 1ULYA 2ELHA 2CV2A 1JTXA 2BY3A 4KICA 5F0FA 3T8TA 4BGDA 1GHCA 3I59A 1X1BA 1Y6IA 2EA2A 3QWLA 1SMTA 3HZJA 2IS6A 4CZZA 3ZN0A 2AQFA 2EZKA 2Q2EA 4BNCA 1F36A 1OCTC 1HKSA 3GEZA 1KU3A 3GXOA 2GM4A 4IHYA 3PNTA 4IEJA 1XGNA 3KZYA 2R92J 2YU9J 1DPUA 1R5GA 3SQNA 4A93J 4ZZDA 3BJ6A 1QNTA 2EFQA 3O8HA 3EETA 1J9IA 1X2MA 3T5XA 2BW3A 3WTVC 1A31A 1V5FA 3GTQJ 1FOKA 3TW6A 1UELB 4YRVA 4LMYA 4LGWA 1EKEA 2V1XA 3RKYA 2LKSA 2V6EA 3OYBA 2LREA 3BCAA 2PX9A 3COAC 2ZC2A 5HS7A 2GLOA 1FEXA 5D6FA 3L2CA 5B1BH 2L02A 1R4NB 1IW7F 2FX0A 5IOYA 4ZZLA 2PLYA 2EFPA 3VWBA 4HNUA 5E3NA 3ESWB 2P5LC 3AL0C 1O4XA 4NDLA 2ESHA 2L7KA 3OYKA 2ELKA 4KT5C 3CMEI 2CWEA 2X1EA 9ANTA 3ZR8X 3OYHA 1IUYA 4KMFA 3E0JB 1ACIA 3ZMUA 3MN2A 2DPUA 3CZ6A 1KGSA 4BHBA 4EJOA 1Y39A 3R61A 2GQQA 3CCYA 4B4CA 5GADJ 3GBGA 4CXFA 1ZGJA 3FKJA 2IA0A 3GZ6A 3LAJA 2M5WA 3OL4A 3CESA 4AVPA 3G1LA 3CC7I 4BEHA 3C2HA 4ESJA 2XUBA 3L09A 2RNGA 1R5ID 3FMRA 4BJ6C 4KJZA 4N9HA 1V5GA 4XL9A 4QIWN 1UAAA 1GV5A 3D0SA 3FISA 2H6BA 1T0FC 5F27A 2V9KA 5H20A 1TT0A 5AIQA 2X6OA 1LEAA 5B66C 4G7OF 2EJRA 1I1SA 2FA5A 1POGA 5J8FA 5IT9K 5LEKA 1RUNA 1YG2A 4RAYA 2Y48A 1YO5C 1JGGA 1Z21A 3ABMH 2HR3A 4BXUA 3CCLI 1TQMA 3ASNH 3ZQFA 3KX2A 1P92A 2DODA 4J19A 3U1KA 3WU0A 2CV0A 2L4MA 4AUXA 1BJZA 4HLYA 2DMPA 3E6MA 5IYBJ 1Z9CA 3OYFA 2A05A 2CFOA 4E70A 2IA2A 3S17J 2VBYA 3MCZA 1ZGAA 3F21A 2MD0A 5FB2A 2X51A 4PSWA 1LJ9A 3KEOA 2IRFG 4BE0A 1FJLA 3OYIA 1HCRA 3BTLA 3VEPA 5LRRA 2BYVE 4CUGA 2OPTA 5DV5A 4N9IA 3OSFA 2W57A 3K2ZA 1XTAA 1MJ9A 4MTEA 1X3UA 4KYWA 2M3AA 1L3LA 4E7KA 1YW7A 4BY7J 4M73A 1B59A 4UHTA 2ISZA 1A35A 3CF2A 1I1GA 4CZCA 3DPLC 2Z9OA 2O61A 2CQXA 3SEZA 3UNGC 2R7RA 1VQMI 2KRFA 2E71A 3RIRA 4RB1A 5BS6A 1BIAA 3V42A 2E19A 4BL0B 2KLOA 1X58A 3BJOA 1OR7C 4LITA 3ZQIA 1G4DA 4BY1J 5E1ZB 2IVMA 3M07A 3RYRA 4LOCA 5F6FA 1R7JA 2QEXI 5H2FC 4IVNA 2R7XA 1T33A 4NB5A 2RKHA 4F92B 2LSOA 3JRIA 3HIFA 3BR1A 3PSFA 2HDDA 4L9NA 2R0QC 4BQAA 2R7ZJ 3G73A 3CLOA 5TGTA 2LY9A 2Z5UA 2ADUA 3AG3H 2FRHA 3JTGA 2BBYA 4HYEA 1ZH5A 2FU4A 2M30A 2NS7A 3W2WA 5EYRA 1TP4A 1MJAA 4XLCA 4JX4A 1DP7P 2ME6A 5E3MA 2ESNA 3M1CA 4IHXA 5JVGF 4L9TA 3HOWJ 3BPXA 1S6LA 4GXOA 4GFBA 1QA6A 1Z3XA 4ENNA 2VJ4A 1LDDA 3OR2C 1IO2A 2EZHA 4A3LJ 3IKVA 5F08A 2M0MA 2XV4S 3MMYB 1G59A 4O3MA 1FSEA 3BC8A 1HXDA 4DBQA 3HTUA 3S2DJ 4LG0B 3HUGA 3OOPA 3CDIA 4IHWA 4U0VA 2R7QA 4OIQF 2DT6A 4NC8A 3CCQI 4XK4A 5EJCA 4AU7A 2V4JC 5L3DA 2VJIA 2B63J 4A0ZA 3RKQA 2VC0A 3HBLA 2K02A 1LQ1A 4XR6A 2V7FA 5GP9A 4YFKF 3F8MA 5C44J 5HNFA 1HKQA 5JHFA 4PZJA 3K70D 1BOBA 3VFZA 1BR2A 2GIZA 4E7HA 3S8PA 3F8FA 2QCOA 2UXNA 1G3SA 3CDHA 2VLAA 2DFEA 3ECOA 3BZCA 5LD2C 1ENHA 3H92A 3LSGA 3CJNA 3ELKA 4LIUA 4QWQA 2EWNA 2HNHA 4I2OA 3W2VA 1X1PA 1XMXA 2HXOA 1CF7B 5J40A 2EBIA 1IN8A 2XB5A 3JSPA 1MSEC 3GO5A 2NNNA 1U9NA 5D5UB 1ZRFA 3GW2A 1K78B 2O8XA 3HXLA 3KIOA 3P7NA 2P5KA 4G12A 4XSXF 4PFOA 4DIQA 2MG4A 3WGIA 4HOBA 4GO1A 1HOMA 3LFUA 3M9AA 3CD6I 5ICGA 3Q9VA 5JI6A 3I58A 3C2BA 1ZTRA 1ZRCA 3D1NI 2OZ6A 2AXTC 2FBHA 1YRNB 2BGCA 2KQRA 4I99C 4JOMA 5GPCA 1F43A 1N25A 2JZYA 3WGGA 2V79A 3GCMA 2DA2A 2L0KA 3OIPA 4EJUA 1S7EA 1XN7A 2PFBA 1K4TA 3M8EA 3R4KA 4CGZA 5FLMJ 3K4MA 4XN3A 4ZDLA 4CYCB 2VPRA 1O3RA 4BS9A 1QGPA 3K4JA 2VT3A 4B43A 2P5VA 1IXSB 2QQ8A 5KVRA 2E5NA 2ZNYA 2M34A 3PUBA 1OLTA 4C2MJ 3DBHB 5E17F 4DNCA 1ETQA 3IC7A 5CVIA 3ZN1A 2FJ1A 2EFNA 2OF7A 4Y7NJ 5FKKA 1HDPA 5EF6A 1O3SA 3KE2A 1Y56A 3G3ZA 3M4OJ 2O5RA 5KAIC 1K79A 3RI4A 4IOCF 4N0BA 2H8RA 2JVHA 1Q1VA 3M7GA 4E7ZA 3E6CC 4U88A 3K4KA 2D45A 3RYPA 1OMIA 3EQLF 4B47A 3IH3A 3ZQLA 2FOWA 4AD9A 2L7ZA 5K5RA 1ETOA 3FBIB 2VKEA 1W7PD 4XSZF 1BC7C 4RMNA 2NVYJ 3K1MA 4DYCA 1RRJA 1U2WA 4ZTFA 2NXNB 1Z0XA 1YE9A 3GTJJ 1FBUA 4X0GA 1ETXA 3BR2A 2I5UA 4KN4X 3SZPA 1SD6A 2HQ5A 4ON0A 2VOPA 1QRYA 5L3GA 2VE9A 1R1TA 5CJ9A 2DJIA 3V8JA 4BQQA 1OR7A 3KLOA 3OWTA 1DU0A 2FMLA 3LSKA 3CCVI 1U8BA 4IQ4A 1GXQA 3LMMA 2MC4A 1PVEA 1XS9A 2CH0A 3D5LA 2F4IA 2ZKZA 2ELJA 1WI3A 1QZEA 2LF7A 2QQAA 2X6YA 2Y0SN 3C1DA 2K3PA 2HOSA 2STWA 4RM3A 4KIBA 1MNMC 4A0XA 5KHDA 1ZELA 2CFXA 1YLFA 2Y75A 3F9KA 5F04A 2NVUB 2G9WA 2CUFA 2X48A 2CO5A 4F7ZA 1YW9A 2EA4A 2W4SA 4ZC3A 5B5EC 3LFKA 2DOFA 3LQQA 1WGXA 2UZKA 2VBXA 3BR6A 3AG4H 4EQQA 3CO6C 1R5HA 3IL2A 2YU3A 1TL8A 4QPQA 3F22A 4L0YB 2HVQA 2CS3A 1OYIA 1ZG5A 2VQLA 3LAPA 5E3LA 3IWFA 2MLKA 2VODA 4UUTA 3HOZJ 4UUSB 4F3QA 1RETA 4B1RA 1IC8A 3SZGA 3A01B 2DYSH 2LTPA 2NVTJ 3ERMA 3PJRA 2QGUA 2UXXA 2YSRA 5J4YA 3KZZA 3H5RA 4XORA 4HSTA 5CQGA 3J81Z 1CQTA 3CUOA 2X85A 3HSRA 3R0JA 4L9JA 2DDAA 1L0OC 3FIWA 3HOXJ 2VKVA 1IGNA 4Y52J 1P2FA 3HM5A 4UVCA 3L2VA 3P9CA 2EK5A 4BE2A 1R00A 2X4HA 2DXIA 1T6SA 1VQ8I 2R7DA 3ZMDA 4FASD 3ZPLA 4HV6A 3DF8A 1VI0A 5CKTA 2KT0A 3RDIA 5M3FJ 3DLAA 5J3LA 1H9TA 1YJ9I 3H36A 4DYRA 1BW6A 2EB7A 3C7JA 2BXZA 4XN0A 2QA4I 3TO9A 2ZFWA 1SFUA 1KU9A 2ZXWH 3V7CA 1R6RA 2IXSA 2E35A 3H5NA 2HKOA 3KP4A 3O8GA 2R7UA 1IRZA 5D5VB 2MABA 4H0EA 3HYIA 1B6AA 1WSUA 2JRTA 1J7KA 1W36C 3F23A 1G3WA 2TRTA 1BL0A 2DA4A 5EZGA 2OAZA 2W82A 1MNDA 3S1QJ 1J75A 1QQIA 4IJAA 2HXIA 2JA5J 1LFPA 3DPTA 1W7PA 4L5JA 3GUDA 1ZG1A 5HLIA 5IY5H 4BBRJ 2LRDA 1HW5A 1FIPA 3L9FA 1ZRDA 3H9JA 3DCFA 3KFWX 4HNVA 2BHYA 2VXZA 4CDGA 4DBRA 1JKPC 3EYIA 4AIKA 3HEFA 2Y69H 4AYBA 4CA0A 2DA1A 2R5YB 3MZ8A 2W24A 3SJMA 1B8IB 3GTGJ 3S16J 4EM2A 5KAFC 4HF2A 3ZRGA 4LK0F 3JRGA 2DQLA 1LE8B 2JQ7A 2L2OA 1CGPA 2LC2A 1FBSA 2W84A 4JX5A 5F1RA 1JHHA 1KYWA 1KQ8A 2M0CA 1J5YA 3L2QA 1VQNI 1X3ZB 3U21A 1BOAA 2VJJA 3HJEA 3L00A 5LGNA 1TWAJ 3BZKA 5C3EJ 2NOJB 2AXLA 4I76A 3H3UA 4BHPA 2RC4A 4I7HA 2OU2A 4V19K 3ASOH 3S1NJ 5E18F 3CCMI 1XDUA 2O3FA 1FIAA 3CQZJ 4FQGA 2H1LA 2DAOA 4BH9A 3LOCA 2LK2A 2B9SA 3M3YJ 5HDNA 4XKVA 3AG1H 1V3FA 2RNJA 4XOTA 1RUOA 5TRDA 5JFRA 3FXOA 4L5EA 2E1NA 4Z6YA 2VI6A 3DTKA 2GA1A 4CSWA 2LD5A 1EH8A 3SFIA 2HTJA 3OYDA 3H1CA 3J7ZI 2AO9A 3ECHA 3GX4X 1FYLA 1YHQI 4A3CJ 1W1WE 1GV2A 5F0CA 3I53A 4JK1X 2GWRA 4OINF 5ILVA 3L7WA 2I8DA 5DDGA 3VPRA 5BMZA 4LFUA 1BW5A 3LSTA 4DW6A 4HX8A 3PQKA 1SD7A 2X6XA 3PL8A 4II3A 5HODA 4XM3A 4KIGA 4BKXA 2JSPA 5GTHC 1OFCX 2HI3A 4LB6B 5HVQC 5LFAA 3CMAI 1E3OC 3RKWA 2E2IJ 5J1RA 2XGXA 2A5WA 4JQFA 1DP3A 3JSOA 1AWCA 4LG3A 5IP9J 2IP2A 4L18B 1MMSA 3MWMA 2K9NA 1X4OA 1WZ2A 1U5TA 1JUPA 4V2GA 1Z67A 4E7LA 2EV0A 3S93A 2GIVA 1OKRA 1BR1A 2V1UA 3S32A 3EUHC 2R5ZB 1WJBA 2A6HF 4M9SA 1KQ9A 1T2KA 4IRHA 1WQ2A 4JP0A 5FLVA 2KJBA 4CCJA 5L3BA 1QBJA 3ZMVA 2ZMEB 1S5LC 2O8KA 2JSCA 4D7MA 1EV7A 2RQPA 2WADA 4RM2A 3KCCA 4PGHA 1HC8A 3KLNA 3HSFA 3T0YA 4IHSA 4XQFA 4CCMA 4AIHA 2YPRA 1IV6A 1XPXA 3O6BB 2EV5A 1IUFA 4I98B 2QLZA 1H9GA 2JA7J 3ZQQA 3HRUA 2E1MB 2XGEA 4I6ZA 1U9OA 3BWGA 1VTNC 2M7AA 2H1KA 1NG7A 1JUMA 3OS0A 1LPQA 3B73A 5ERIA 1YX5A 2NS0A 4PUSA 1TLHB 1XGOA 3FXLA 4JYKA 3QP6A 5F1JA 3LA7A 2YUSA 5LHGA 1FP2A 2IW5A 5LHIA 3HL2A 4BACA 2UV1A 3JAMZ 3N4MA 3FZVA 4D1QA 3PQJA 3PSIA 2XDVA 3P5JA 1Y1VJ 1Z6TA 1Z1DA 2A6TA 2JA2A 3HSEA 5BPDA 4Q5SF 2A5YB 4D0PA 4P96A 1QHGA 2EFOA 2HYJA 4ZYDA 2PJRB 2RDPA 3OS2A 5L3FA 5D5XB 4F93B 1PUFB 2XAGA 2MGQA 1Z77A 2QZ8A 3TQNA 1SC7A 1JXSA 1B1BA 4M3DA 1E3PA 2E2JJ 4MFEA 2OCEA 3DV8A 5K7HA 2WWYA 2HOTA 5E1WA 4N4NB 2XPVA 3E5XA 5FFZA 4FETA 1G3TA 1KA8A 3BG6A 1AHDP 3R60A 4ASNA 4YIFA 2LKPA 2CV1A 4BAYA 1U3EM 2F5EA 3HOSA 2QUFA 3K1NA 3DXJF 3PIPF 1QPIA 3V4GA 1TBXA 2ICWG 2L7MP 5EGOB 3HKZN 4CCOA 1CF7A 1U0JA 1QU3A 3QU6A 4HRIA 2P81A 2ZJRF 2Y9ZA 2NVQJ 2LNBA 3F6VA 2HDWA 4I01A 5TJJA 1QHHD 1ODDA 5FLXZ 3S3MA 2TCTA 3WTZA 1BI0A 4Y3OA 2IT0A 3FMQA 2OA4A 3PFYA 3S15J 2OQGA 3BG7A 1PJRA 1MW7A 1WJ5A 1P7JA 2ZJQF 1FMVA 5HS9A 4XLAA 3U9GA 3W2AA 5BQTA 3ZMTA 1OCOH 1LFUP 2KIQA 3SYTA 5CVUA 2OBPA 1BM9A 5DD8A 1YJWI 4RGXA 5HLHA 4KNYA 4B3AA 3CC4I 3W6KB 2Y31A 3E97A 2L3DA 1YRNA 3OOUA 3G2BA 4E6KG 2RREA 4HSRA 1YJNI 2K9LA 2B0LA 2HKXA 3MKWB 1KONA 3CUQC 2NOGA 2QENA 3J81K 4RDUA 3MKZA 4XOPA 4D5CA 3GFLA 2FUG2 2LH9A 2LBFB 2I10A 2XAHA 3A2KA 3I56I 1HQCA 1VQOI 4BDYA 4R79A 4CYCA 3CF5F 4M6VA 5FROA 2J5PA 2CGPA 3NAUA 5JVTA 2VC1A 4Q48A 2IS4A 3HPGA 2ECCA 4OIOF 1FT9A 3LA2A 2XIGA 3IKTA 1E3HA 3K10A 1OCRH 3VYSB 2RAEA 2V9VA 1N75A 4BQNA 5DD4A 3W3CA 2K86A 3TGNA 2PN6A 4KFCA 1DU6A 5H6QA 2WY8Q 5J4VA 1VQ7I 1OJLA 3G6EI 2HZDA 5DUKA 3HPHA 4B44A 4YG2F 3IP4B 4O5VA 3QOPA 4KMUX 4UY8I 1D0ZA 1MJBA 4Q4ZF 3V8KA 2FXAA 1U8RA 3VB2A 4PGGA 3P9IA 3J80K 4P1WA 1WFXA 1TW2A 3FWEA 4CCKA 3H9QA 4HQEA 4R1HA 5DCMB 4MO7A 2WTEA 1IG7A 1FOWA 2NNYA 4CYDA 1T08B 1FTZA 3I54A 3IRQA 2QQBA 1FYKA 4BXXJ 1IXRC 3LWFA 1KYZA 2GOXB 2C6YA 3GTLJ 3I5UA 2MYSA 2DA3A 3CP8A 3I4MJ 4XBFA 4RB3C 2XAQA 2HQNA 2D2WA 4M6XA 3ZMSA 2ZSIB 1JT0A 1JKRC 5J1UA 1VQ6I 3MVPA 2FBKA 2Q2EB 4BBSJ 3SHFA 4U0WA 4KUMA 4HZFA 2K5CA 3TO6A 3OV8A 1KU2A 3A4CA 1WVRA 3GFMA 2ZSHB 3RPQA 4WK8F 2P6SA 2OTLI 3SFZA 5D8LB 1TWGJ 5FD5A 4IQJA 5K5QA 3MQ0A 3S1RJ 1RR8C 2VL8A 1M1EB 3CJQB 1O57A 4IRIA 2E7WA 4DOZA 1RPWA 1FPQA 3RJPA 3VSLA 1NK2P 3DQVC 4HNTA 1O3TA 3DBRB 3QPHA 4LK1F 3RQIA 3TO7A 3E6BA 4NHJA 2FSWA 3CP2A 2K40A 4MHGA 1Q1HA 4GRIA 3IWZA 1YX3A 1TT5B 1GT0C 2ZMEC 3QPTA 5DM6F 3PM1A 2O6GE 2BVMA 3VYTB 3F8NA 3C3WA 4DZJA 1I5ZA 2HPIA 2X6WA 1FOYA 2AHQA 2JPBA 2EPFA 1GDTA 3AFHA 2DFFA 1NG6A 4G9YA 2E1MC 4J01A 5CVVA 4ZYAA 1V4RA 4UUSA 3ONQA 3B6CA 1DDNA 2M4GA 3BOQA 2F5VA 4W1UA 4XLFA 5HDKA 4HX7A 1EA3A 1X3WB 2OTJI 4BQOA 1HF0A 1UB9A 4P9UA 4I02A 1QVTA 3FXQA 4V2FA 4Y33A 1Z05A 1J09A 1KU7A 1FZPB 2NYXA 5C4JJ 2WB1A 4XRMA 3FDYA 5F64A 4IOAF 3ML6A 4M71A 5IOZA 5A2QK 5EEGA 2XKOA 2P7CB 5D4SA 3PO2J 1S7AA 2W85A 3QQAA 3A1YA 5HNHA 5C4XJ 4A3DJ 3K4LA 1TNTA 2BE5F 4HX4A 4IRGA 3N97A 3JRCA 1NHAA 2L7FP 3CCUI 2QBYB 4XRSA 1YW8A 5J8CA 3RSNA 1TWHJ 4RB2C 4PFPA 4FX4A 3UKGA 4QLCU 4IZZA 1S8NA 2JVGA 3BQYA 2IBDA 1MDMB 2QKMB 4UV8A 4EJVA 4NC7A 4YFXF 2DOEA 3GZNB 2EV6A 3E1SA 1JE8A 5J6XA 1PUEE 1DGRM 4XLNF 2VQHA 5HDGA 3BLYA 3DLLF 4HA8A 1SMYF 2RQQA 3JRFA 4CO8A 3QOEA 2LOOA 4UB6C 3TP3A 2KIFA 1T0FA 3I71A 1FTTA 3ISPA 1D1BA 3P9KA 4FE7A 4FX0A 2GXGA 2WAQN 2PBIA 2Z2SB 3G71I 2Y30A 3W6VA 1A36A 2B7EA 4EM0B 3BPVA 3F8CA 4EJWA 2MSYA 1MMAA 3K9TA 4HG2A 3WTTC 4YELA 1R58A 3B02A 1V54H 3GTKJ 1FX7A 2IGKA 3G1OA 1PDNC 2WV1A 2VBZA 1FC3A 3H0DA 1JJ8C 1AA7A 2KZVA 4ZH4F 4BUPA 2UUZA 1G6NA 2O0YA 5HLTA 3OS1A 4TV7A 5E8IA 4A3GJ 3EUAA 1D0XA 2CW0F 2F5DA 2X9DA 4HDUA 4AIDA 3BCBA 1WRJA 4CH7A 3JAMK 5J47A 1USSA 3QPSA 4BJ5C 3IUOA 4U7DA 2R5YA 2DLLA 4S05A 3IAM2 3NWSA 5HS8A 3ZQCA 4E7SA 4M3EA 2QF7A 1WCMJ 2DU9A 1JTYA 3HGYA 3WGHA 3WG9A 4QTRA 2ZXIA 4EGZA 1ETWA 1LE8A 3WTWC 1MZBA 1VQPI 3QU3A 2EIJH 3GFJA 2QQ9A 2HWVA 1JKQC 4P5OA 2L9NA 2Z1DA 3OYMA 3EUKL 4A6EA 1YS6A 3JW4A 1XGMA 1XMKA 2FE3A 1EJ9A 4M3BA 2RVCA 2DA6A 1OCPA 2OCCH 5DUIA 3RZDJ 2CW7A 4UXNA 4XLPF 1K6YA 2NAZA 4BYYA 4OU0A 2DMQA 3WE2A 3WTSC 2VPLA 4ENJA 2PJPA 3OL3A 3FBNB 3SDGA 2CU7A 3S3OA 5FKLA 3DKWA 1W5CC 1D8KA 2MW8A 1IV8A 5DS9A 4RA2A 2BVLA 4JX6A 1MBFA 4U7BA 2LP0A 5LGTA 1KQ0A 1BJAA 4G8XA 2BEOA 2E60A 3U2RA 5BPIA 3QYBA 2DI3A 2ZXJA 4GGGA 4HV5A 1R22A 4L0ZB 1A6IA 1DPRA 3CJRB 4RGRA 1C0WA 2OV7A 2PMZN 1MBGA 3CTAA 1Y8QB 2DMUA 2HQRA 4PJLA 4B48A 3CC2I 4CCNA 2XF5A 3HUGB 4NNJA 3HOUJ 1K61A 5JR3A 1I6XA 4G6QA 3CJTB 2M2EA 3BDDA 1R9TJ 4M3GA 4S04A 4S0HB 4A3JJ 5E79C 2E5ZA 3HHHA 4LD5A 2LYCA 3FHNA 2XRLA 3HGGA 2DBBA 1ZHFA 5IT9Z 2COBA 1XG1A 4WX9A 1LFBA 2CQNA 2Y2ZA 2KP6A 4W97A 4X6AJ 3FK7A 1UMQA 2R5ZA 3DKXA 5IT3A 1XMAA 2D1VA 1XSVA 2A61A 4KN7X 3CCJI 2KIMA 2K9QA 1HLVA 2FEZA 2ZMEA 2L9RA 2GAUA 4WF2A 1FOXA 2VIXA 5K1YA 4XLEA 3QPLA 1Y1WJ 2V6CA 5FRMA 1IZ1A 5CLSA 2QM3A 1REPC 2H8WA 2Z16A 3L2WA 2DFIA 4ZYHA 3NWTA 5B3SH 1ZYRF 4HF0A 3ZMZA 3L1PA 2DW4A 2K85A 3VODA 5GAGJ 4IXAA 2ZJ2A 2PQ8A 4Z2YA 4HF1A 3AG2H 2EQRA 4I09A 3G4SI 2IGNA 1YQAA 1ETVA 3IAS2 3FF5A 4OAZA 4MTDA 4GDFA 3H3ZA 1SEUA 1ZQ3P 2TDXA 1ZR2A 2CW8A 3MD2A 4E4HA 4UV9A 4E7JA 1A6QA 3DEWA 5J1YA 2E7XA 3KEYA 4KA4A 2R7OA 3BTIA 2A6EF 1WHUA 4G6DA 1YTYA 2Q8KA 1H88C 2PJRA 4ESBA 3FXUA 1T56A 1V55H 2FNPA 2XF6A 1QZZA 1XB4A 4Q47A 1GUUA 3S3NA 2Z3YA 5EEHA 1TQPA 3F8BA 3KZIC 2H27A 3ULQB 2XROA 2JUGA 2KL4A 1OYWA 5FGMA 3TDUC 1I6HJ 1Z3YA 2HFHA 2CUEA 1UJ8A 1WJCA 3F3XA 3K4BA 1QZYA 2KHMA 1EF4A 2HVRA 3CUQB 2ZNZA 3GLXA 3K1PA 3OYCA 5EGOA 1LVKA 2KDOA 2WC2A 5ICEA 1T38A 2PEXA 1H89C 1Z6RA 1K83J 3IV5A 2DN0A 5AIPA 1D5VA 2VKHA 4ZTJA 3TP0A 2M1BA 4I0AA 5E1XA 5JLXA 1IJWC 4RAGA 3LSPA 4IL6C 1S7OA 2MA3A 1HBXG 5FKMA 2VASA 3TW7A 1YI2I 4M9XA 1G8XA 2Z33A 3ZQHA 5IP7J 1WJAA 2W7NA 4A3EJ 1LVAA 5HLGA 4R8HA 1MMGA 2XASA 3H0GJ 5LEJA 3N05A 2GZWA 2BHZA 2HVSA 4KIFA 3FXMA 4D9JA 4NC6A 3BROA 2Q1ZB 1UG2A 2QWWA 1W36D 3HRTA 2XHKA 5FO5A 2P6TA 2LBFA 4M72A 1UFMA 3Q0WA 2WAFA 4YEJA 2AS5F 2DT5A 3K6GA 4PSXA 4ZDPA 1TWCJ 1OYYA 1FYMA 3DU5A 1AU7A 2G7HA 3MFKA 3DBLB 3Q0UA 5EG0B 1WH7A 2IGMA 1XD7A 3AAFA 1AKHB 5LGUA 2QKLB 2M8GX 4HAMA 2QSFX 4ZJZA 2WV0A 3TL4X 3B6AA 2K4JA 3KYDB 1Z7UA 5GAEJ 4KITB 2EH3A 3WU1B 1VQ5I 4Y15A 4WXDA 2P0WA 2L54A 3C18A 3TDZC 1XDSA 2VBWA 1H8AC 1MIJA 1P9QC 3GLLA 1ERDA 3LNQA 3ABTA 4RS8A 2F5CA 2GXBA 2HQAA 4RAZA 5CPRB 5FKOA 1J2XA 3R0AA 1FLIA 1Z7LA 2ZCWA 5DTDA 4EEFG 1B9NA 5FD6A 1O7LA 2LKXA 3A03A 2HOAA 4QPOA 3CLQA 2DO7A 3E5UA 1ETKA 1XC5A 5D8KB 2WY7Q 2DQRA 5M3MJ 1FWZA 4LLGF 2KISA 5EEAA 4A3FJ 2L9SA 2IJLA 1E0EA 1RNLA 1WPKA 3ABLH 3WODF 3I55I 4C9YA 2LY1A 3OYJA 3BT9A 1R36A 2V9PA 2HPMA 2ECBA 4GYGA 1WJDA 1RZ4A 1BBYA 4MQ9F 5K5OA 2HDCA 1JKOC 2ME0A 2ZFUA 2JWTA 1HDDC 1LDKB 3QRFF 4M9ZA 2DTRA 1MBEA 1W5SA 4MFDA 1B4AA 5LHHA 2V1NA 2IEKA 2M87A 3PUFA 4YIRX 3JR9A 2CYYA 2FD5A 1JUSA 4LG0A 1SVMA 2CQKA 1XSDA 3M1EA 3NARA 2DDBA 2OZUA 4G7ZF 3S2WA 1I50J 1OCCH 2K9MA 4C3JJ 1MD0A 1ITYA 2XF7A 1ON2A 3O3KA 4ETSA 5M5XJ 1SVLA 2PMUA 3LA3A 3QYEA 4XRFA 3IHUA 2RN7A 3PNVA 1IXCA 3NEUA 4BDZA 1TQIA 3FMSA 1XSXA 4PK4A 2HZTA 3CO7C 2CMPA 4XICA 4PDKA 1GLNA 1APLC 2UWMA 1IDYA 4L9VA 4IHVA 3DPUA 3RQ4A 1YFHA 1D0YA 3CMMA 2M8EA 3QAHA 3I3LA 3SZTA 2KIUA 1N77A 2JRMA 2DOAA 2E1CA 1ZLJA 4Y4RA 5L3CA 3HOYJ 2O9LA 3SXYA 1A04A 4ABZA 1XX5A 1W7PB 2XC7A 2QSHX 2A3SA 1IN7A 2R4GA 2LR8A 4ZYEA 2K9SA 1A5JA 3OIQA 4PJJA 4M6YA 5GPAA 2OUMA 4RGUA 1K78A 3TEDA 2A07F 3DWLE 3MZYA 4A5NA 3GZ5A 4CICA 4DJAA 3QYFA 5ICCA 3LSMA 2HTSA 5FFXA 4A6DA 2K4BA 2QBYA 2RV8A 3BQZA 3OYGA 2X0LA 3A02A 2HU9A 1MMNA 2VQCA 3BTJA 1QPMA 4RB0A 2P8TA 3GTMJ 1MDMA 1TWFJ 5FRNA 3PNYA 2VE8A 1KZHA 1U78A 3R6SA 1TNSA 4ZYGA 3OY9A 2M7BA 1VQ4I 2E36A 2GBYA 1P4XA 5IPAA 1T8IA 2VN2A 4BJTA 1V5EA 5DEQA 3TKYA 4N4OB 2XGCA 3KP5A 4K2EA 3M8FA 4RLFA 2W1OA 4XNFA 3J7AO 3K4CA 1IDZA 4ANJA 1ZARA 1LEBA 1F1ZA 3BTCA 3VOEA 1RC9A 5DM7F 3JRBA 4BU2A 1MGTA 1XCBA 1IN5A 2XB0X 3A0HC 4FHTA 2WB1N 4IO9F 3DEEA 1X1DA 1F4KA 3K69A 3DU6A 4A0YA 2F6CA 2XAUA 4UVAA 4XKWA 2XAJA 5HOOA 4I0BA 4NQWB 1NK3P 2O7OA 2K7LA 2VB6A 4HPQA 1IRFA 1BN5A 5B1AH 1SVOA 4MEXF 3VSKA 2LVSA 3WTXC 4WXHA 1WWXA 1B72B 2A68F 1RESA 4PCQA 1BI2A 5M5YJ 2ACJA 3E3VA 4OMYA 2EIMH 1FY7A 1ZGWA 2M45A 2BZTA 4IX7A 3WTUC 3FM5A 1VQ9I 3I59B 2CUJA 2DA5A 5EZHA 1U5TB 2YX7A 3DP7A 3K70C 1X19A 2JUCA 2MFZA 3BZ6A 3H9GA 4A12A 1PP7U 2G0EA 3HTSB 5ILSA 1YOVB 2M4KA 4LB5A 2Q0OA 2JT1A 1I3QJ 1ORKA 5ICFA 2DPDA 3FXRA 1OPCA 2JA8J 3GFIA 3ZCOA 2IPQX 4G7HF 2ZXHA 4CHUA 3KYLA 3I4NJ 3EDPA 2LLKA 1U6GA 2XSJC 2XRNA 3CMYA 1RR7A 1NTCA 3IH4A 4MQVA 2JJ7A 3EUHA 5CVJA 2E34A 1EH6A 3VYRB 3RCOA 4YFNF 2DFHA 3F0CA 3HRMA 2IS1A 2BW3B 1YITI 3BR3A 4H4KC 4C3IJ 2KMUA 4B09A 3KYCB 3HKZA 3I4PA 2DK5A 3FXJA 3NRVA 3CCEI 4A3MJ 3KP3A 1ZN2A 3WHCA 3ZOBA 2HOEA 4EGYA 1T39A 2F5FA 1IF1A 2IS2A 1MMDA 3TOBA 1TZLA 1W5TA 4M3FA 4BE1A 4C3HJ 3MKYB 5CVRA 1O3QA 3KP7A 3DTIA 4NBQA 4A2UA 1OCZH
chains in the Genus database with same CATH topology
1TTYA 3KP6A 1USTA 2ZO4A 2MC3A 1HKTA 3V8LA 4GCVA 2Z99A 1BI1A 1FSHA 3HOTA 3PFIA 3FHZA 1RI7A 3KETA 2O03A 1W4MA 2QVOA 4P55A 4YIIA 1UCRA 5D4RA 2P7VB 2XKPA 2GA2A 4LLNA 4AIJA 2OQRA 4ENMA 2ISYA 3RKXA 1FNNA 2PG4A 3I64A 4M74A 1DUXC 4B8XA 1S3JA 5BOXA 4LLLA 1J59A 3FX3A 1I27A 1IAWA 1YS7A 3E6DA 5D6EA 5DCFA 2FBIA 4JBAA 4MGRA 1HSJA 2H94A 1YYVA 2W25A 1K6OA 1E17A 2VONA 1Y0UA 2FQ3A 3WTYC 2VOOA 1FP1D 1G3YA 4IF4A 5LBQA 2J5OA 1LB2A 2JTVA 4ENKA 2P4WA 5KK1A 3T8RA 1HSTA 1QO0D 3Q9SA 5JHUA 1JGSA 4HW0A 3CUQA 4OIRF 1UHWA 3KP2A 1ONVA 3EYYA 2JPCA 4IPAA 4DQ2A 2PMHA 5CYVA 1SAXA 1UHMA 2RGVA 3HRSA 4EV0A 3LQRA 5E20A 3I0TA 4EVIA 3Q5FA 1K7AA 4HLXA 2YX4A 4AWXB 2R7FA 5DYMA 4BHCA 4EJTA 2G7UA 2KJCA 3V7SA 4LJZF 1P4WA 1LNWA 1HW1A 1MKMA 1TW3A 3GWZA 1R1VA 2F2EA 5FLXK 1H0MA 3ERED 1GVJA 5ILUA 4U0YA 2H09A 2L01A 1U5TC 3F6OA 4WCGA 3BP8A 5D5WB 2CSOA 2H6CA 3BJAA 2NRAC 4UNOA 5LRSA 1IN4A 3NQOA 1B9MA 2HS5A 1D8JA 2QYOA 2Y0MA 1D3YA 1ZAOA 2KKOA 4P9FA 4MEYF 1HW2A 3BY6A 3QP5A 4OMZA 2FOKA 3GVAA 4GYIA 1WKMA 1F5TA 3W6JB 2LDUA 1LDJA 4L5IA 1F9NA 1P6RA 3JTHA 3REOA 1R1UA 4ESFA 4IHTA 1T98A 4EM1A 3E5QA 5L3EA 2R3SA 4WWCA 3F72A 4UUVA 2HGCA 1P4AA 1O7FA 2MH9A 1XGSA 2FNAA 1JHFA 2HYFA 2IA1A 2EFWA 4O6JA 3ABUA 2HEOA 3RTRA 1IRGA 1XCVA 2YR2A 1Z91A 2FMYA 3ZP5A 2L4AA 3J80Z 3T1BA 1PP8F 1SD4A 1FBQA 4EMSA 3MZHA 2CG4A 1EH7A 1J0RA 1R23A 3K0LA 1YIOA 5LLQA 1SFEA 3GF2A 1ZLKA 4WXCA 3V7RA 2D1HA 4G94A 4HQMA 3O2PE 2DK8A 3MAJA 4RGSA 4A5MA 2MLGA 2XVCA 3RPUA 2ZBKA 1SFXA 4MNUA 2HYGD 3FM3A 4UVBA 3MEXA 4FT8A 4OOIA 3ROUA 5E8GA 4HBLA 5AONA 1SD5A 2BV6A 3KEQA 1STZA 4HDVA 3ZQ7A 2OD5A 3DFGA 1ZG3A 1BC8C 6PAXA 1ON1A 2LF8A 2FF4A 1IN6A 1WI9A 1BI3A 2V1DA 3U1DA 4Y13A 1GXPA 2K27A 4KDPA 1E2XA 4Y17A 2MD5A 5H6RA 1AOYA 2MH2A 3HHGA 2COMA 3IRRA 2VT2A 3DEUA 5A2QZ 2MBFA 2XAFA 4NQWA 2A69F 4OIPF 3GYHX 1BIBA 5ED4A 1RIOH 3TOAA 1S29A 1ZREA 3WE3A 2ETHA 2PI0A 5DCMA 2STTA 1ULYA 2ELHA 4KICA 3T8TA 1GHCA 3I59A 2EA2A 1SMTA 4CZZA 3ZN0A 2Q2EA 4BNCA 1HKSA 3GEZA 1KU3A 3GXOA 1XGNA 3KZYA 1DPUA 1R5GA 3SQNA 4ZZDA 3BJ6A 1QNTA 2EFQA 3EETA 1J9IA 3T5XA 3WTVC 1FOKA 4LMYA 4LGWA 2V1XA 3RKYA 3COAC 5HS7A 5D6FA 3L2CA 2L02A 1IW7F 4ZZLA 2PLYA 2EFPA 2P5LC 2ESHA 4KT5C 2CWEA 1IUYA 4KMFA 3ZMUA 2DPUA 1KGSA 4BHBA 4EJOA 3R61A 2GQQA 4CXFA 3GZ6A 1ZGJA 2IA0A 3LAJA 2M5WA 4AVPA 4ESJA 2XUBA 3L09A 3FMRA 4N9HA 3D0SA 2H6BA 5H20A 5AIQA 1LEAA 4G7OF 2EJRA 1I1SA 2FA5A 5J8FA 5IT9K 5LEKA 1RUNA 1YG2A 4RAYA 2Y48A 1YO5C 2HR3A 4BXUA 1TQMA 1P92A 3WU0A 2L4MA 4HLYA 3E6MA 1Z9CA 4E70A 2IA2A 2VBYA 3MCZA 1ZGAA 3F21A 5FB2A 1LJ9A 3KEOA 2IRFG 3VEPA 5LRRA 2BYVE 5DV5A 4N9IA 2W57A 3K2ZA 1MJ9A 4MTEA 1X3UA 4KYWA 1L3LA 1YW7A 4M73A 1B59A 4UHTA 2ISZA 1I1GA 3DPLC 2Z9OA 2O61A 2KRFA 3RIRA 4RB1A 5BS6A 1BIAA 3BJOA 1G4DA 5E1ZB 2IVMA 3RYRA 5F6FA 1R7JA 4IVNA 4NB5A 2RKHA 2LSOA 3HIFA 4L9NA 4BQAA 3G73A 3CLOA 2Z5UA 2ADUA 2FRHA 3JTGA 2BBYA 4HYEA 1ZH5A 2FU4A 2M30A 1MJAA 1DP7P 2ESNA 4L9TA 3BPXA 1S6LA 4GXOA 4ENNA 1LDDA 3IKVA 4O3MA 2XV4S 1FSEA 1HXDA 3HTUA 4LG0B 3HUGA 3OOPA 4U0VA 4OIQF 5L3DA 4A0ZA 2VC0A 2K02A 1LQ1A 4YFKF 3F8MA 1HKQA 4PZJA 3VFZA 3F8FA 2UXNA 1G3SA 3CDHA 3ECOA 3H92A 3CJNA 3ELKA 4QWQA 2EWNA 4I2OA 1CF7B 1IN8A 3JSPA 3GO5A 2NNNA 5D5UB 1ZRFA 3GW2A 1K78B 2O8XA 3P7NA 2P5KA 4XSXF 3WGIA 4HOBA 4GO1A 3M9AA 5ICGA 3Q9VA 5JI6A 3I58A 1ZRCA 2OZ6A 2FBHA 2BGCA 2JZYA 3WGGA 2V79A 4EJUA 1XN7A 2PFBA 3M8EA 3R4KA 4CGZA 1O3RA 1QGPA 2VT3A 2P5VA 1IXSB 5KVRA 2ZNYA 5E17F 4DNCA 3IC7A 5CVIA 3ZN1A 2EFNA 1O3SA 3KE2A 3G3ZA 1K79A 3RI4A 4N0BA 3M7GA 3E6CC 4U88A 2D45A 3RYPA 1OMIA 3EQLF 4AD9A 5K5RA 1W7PD 4XSZF 1BC7C 3K1MA 1U2WA 1FBUA 4KN4X 3SZPA 1SD6A 4ON0A 2VOPA 5L3GA 2VE9A 1R1TA 5CJ9A 3V8JA 1OR7A 3KLOA 2FMLA 1GXQA 3D5LA 2ZKZA 2QQAA 2LF7A 3C1DA 2STWA 4KIBA 4A0XA 2CFXA 1YLFA 2Y75A 2G9WA 2CO5A 4F7ZA 1YW9A 2EA4A 3LFKA 3LQQA 2UZKA 2VBXA 4EQQA 3CO6C 1R5HA 3IL2A 2YU3A 3F22A 4L0YB 1OYIA 1ZG5A 3LAPA 3IWFA 2MLKA 2VODA 2UXXA 2YSRA 3KZZA 3J81Z 3CUOA 3HSRA 3R0JA 4L9JA 1L0OC 1P2FA 4UVCA 3P9CA 2EK5A 1R00A 2X4HA 1T6SA 3ZPLA 2R7DA 3ZMDA 4HV6A 3DF8A 3RDIA 1H9TA 2EB7A 3C7JA 3TO9A 2ZFWA 1SFUA 1KU9A 3V7CA 2HKOA 3KP4A 5D5VB 4H0EA 3HYIA 1B6AA 1WSUA 2JRTA 1J7KA 3F23A 1G3WA 2OAZA 1J75A 1QQIA 4IJAA 3DPTA 1W7PA 4L5JA 3GUDA 1ZG1A 5HLIA 1HW5A 1ZRDA 3L9FA 3KFWX 2VXZA 4CDGA 3EYIA 4AIKA 2W24A 4EM2A 4HF2A 4LK0F 2DQLA 1CGPA 1FBSA 2W84A 5F1RA 1JHHA 1KYWA 1KQ8A 1J5YA 1BOAA 5LGNA 3L00A 2AXLA 3H3UA 4BHPA 2RC4A 4I7HA 2OU2A 5E18F 1XDUA 2O3FA 2DAOA 4BH9A 5HDNA 1V3FA 2RNJA 1RUOA 5TRDA 5JFRA 2E1NA 2GA1A 1EH8A 2HTJA 3ECHA 3GX4X 1FYLA 3I53A 4JK1X 2GWRA 4OINF 5ILVA 3L7WA 5DDGA 5BMZA 4LFUA 3LSTA 4HX8A 3PQKA 1SD7A 4KIGA 5HVQC 4LB6B 3RKWA 2XGXA 4JQFA 3JSOA 1AWCA 2IP2A 4L18B 3MWMA 1U5TA 2EV0A 2GIVA 1OKRA 2V1UA 2A6HF 4M9SA 1KQ9A 1T2KA 4IRHA 1WQ2A 2KJBA 1QBJA 5L3BA 3ZMVA 2ZMEB 2JSCA 1EV7A 2RQPA 3KCCA 4PGHA 3KLNA 3HSFA 3T0YA 4IHSA 4AIHA 2YPRA 3O6BB 2EV5A 4I98B 2QLZA 1H9GA 3HRUA 3BWGA 1VTNC 3B73A 5ERIA 2NS0A 1TLHB 1XGOA 3QP6A 5LHGA 3LA7A 1FP2A 2IW5A 5LHIA 3JAMZ 3N4MA 3FZVA 3PQJA 1Z6TA 1Z1DA 3HSEA 5BPDA 4Q5SF 2A5YB 4D0PA 4P96A 2EFOA 4ZYDA 2RDPA 5L3FA 5D5XB 2XAGA 3TQNA 2QZ8A 1JXSA 1B1BA 3DV8A 2WWYA 5E1WA 3E5XA 5FFZA 1G3TA 1KA8A 3R60A 4ASNA 4YIFA 2LKPA 4BAYA 1U3EM 2F5EA 3HOSA 2QUFA 3K1NA 3DXJF 3V4GA 1TBXA 1CF7A 3QU6A 2LNBA 3F6VA 4I01A 5TJJA 1ODDA 5FLXZ 3WTZA 1BI0A 2IT0A 3FMQA 2OA4A 2OQGA 5HS9A 3U9GA 5BQTA 3ZMTA 5CVUA 2OBPA 1BM9A 5DD8A 4RGXA 5HLHA 4KNYA 3W6KB 3E97A 2L3DA 2B0LA 2HKXA 3CUQC 2QENA 3J81K 3GFLA 2XAHA 1HQCA 4R79A 2J5PA 2CGPA 5JVTA 2VC1A 4Q48A 4OIOF 1FT9A 3LA2A 2XIGA 3IKTA 2V9VA 5DD4A 2K86A 3TGNA 2PN6A 4KFCA 5H6QA 5DUKA 4YG2F 4O5VA 3QOPA 4KMUX 1MJBA 4Q4ZF 3V8KA 2FXAA 1U8RA 3VB2A 4PGGA 3P9IA 3J80K 1TW2A 3FWEA 4HQEA 4R1HA 5DCMB 2WTEA 2NNYA 4CYDA 3I54A 3IRQA 2QQBA 1FYKA 1IXRC 3LWFA 1KYZA 2C6YA 3I5UA 4XBFA 4RB3C 2XAQA 2HQNA 2D2WA 4M6XA 3ZMSA 2FBKA 3SHFA 4U0WA 4KUMA 4HZFA 3TO6A 3OV8A 1KU2A 3GFMA 3RPQA 4WK8F 2P6SA 3SFZA 5D8LB 5FD5A 5K5QA 3MQ0A 1O57A 4IRIA 2E7WA 1FPQA 3RJPA 3DQVC 1O3TA 3QPHA 4LK1F 3TO7A 3E6BA 4NHJA 2FSWA 4MHGA 1Q1HA 3IWZA 3QPTA 2O6GE 3F8NA 3C3WA 1I5ZA 2JPBA 4G9YA 5CVVA 1V4RA 1DDNA 3BOQA 5HDKA 4HX7A 1UB9A 4P9UA 4I02A 1KU7A 3FXQA 1FZPB 1Z05A 2NYXA 5F64A 3ML6A 4M71A 5A2QK 5EEGA 2XKOA 2P7CB 5D4SA 1S7AA 2W85A 1TNTA 2BE5F 4HX4A 4IRGA 3N97A 1NHAA 2QBYB 1YW8A 5J8CA 4RB2C 4FX4A 4QLCU 1S8NA 1MDMB 4UV8A 4EJVA 4YFXF 2EV6A 1JE8A 5J6XA 1PUEE 4XLNF 5HDGA 4HA8A 1SMYF 4CO8A 2KIFA 1T0FA 3I71A 3ISPA 3P9KA 4FX0A 2GXGA 2PBIA 4EM0B 3BPVA 3F8CA 4EJWA 3K9TA 3WTTC 1R58A 3B02A 1FX7A 1PDNC 2VBZA 1FC3A 4ZH4F 1G6NA 2O0YA 4TV7A 5E8IA 2CW0F 2F5DA 4HDUA 1WRJA 3JAMK 1USSA 4U7DA 2DLLA 4S05A 5HS8A 2DU9A 3WGHA 3WG9A 4EGZA 3WTWC 1MZBA 3QU3A 3GFJA 2QQ9A 2HWVA 4P5OA 4A6EA 1YS6A 3JW4A 1XGMA 1XMKA 2FE3A 2RVCA 5DUIA 4UXNA 4XLPF 4BYYA 2NAZA 4OU0A 3WE2A 3WTSC 4ENJA 2PJPA 3DKWA 1D8KA 4U7BA 5LGTA 1KQ0A 1BJAA 4G8XA 2BEOA 3U2RA 5BPIA 2DI3A 2ZXJA 4GGGA 4HV5A 1R22A 4L0ZB 1DPRA 4RGRA 1C0WA 3CTAA 2HQRA 5JR3A 1I6XA 4G6QA 3BDDA 4S04A 3HHHA 4LD5A 2DBBA 1ZHFA 5IT9Z 4WX9A 5IT3A 1XMAA 2D1VA 1XSVA 2A61A 4KN7X 2KIMA 2FEZA 2ZMEA 4WF2A 2GAUA 5K1YA 2V6CA 1IZ1A 5CLSA 2QM3A 1REPC 2DFIA 4ZYHA 1ZYRF 4HF0A 3ZMZA 2DW4A 3VODA 4IXAA 2ZJ2A 2PQ8A 4Z2YA 4HF1A 4I09A 1YQAA 3FF5A 4MTDA 3H3ZA 2TDXA 4UV9A 2E7XA 4KA4A 1YTYA 2A6EF 4G6DA 2Q8KA 4ESBA 3FXUA 2FNPA 1QZZA 1XB4A 4Q47A 2Z3YA 5EEHA 1TQPA 3F8BA 2H27A 3ULQB 2XROA 1OYWA 5FGMA 3TDUC 2HFHA 3F3XA 1QZYA 3CUQB 2ZNZA 3GLXA 3K1PA 1T38A 2WC2A 5ICEA 2PEXA 1Z6RA 5AIPA 1D5VA 2M1BA 4I0AA 5E1XA 1HBXG 1S7OA 2MA3A 4M9XA 2Z33A 1LVAA 5HLGA 4R8HA 2XASA 5LEJA 2GZWA 4KIFA 3BROA 2QWWA 3HRTA 2XHKA 5FO5A 2P6TA 4M72A 1UFMA 2AS5F 2DT5A 1OYYA 1FYMA 2G7HA 3MFKA 1XD7A 3AAFA 5LGUA 4HAMA 2WV0A 3WU1B 2K4JA 1Z7UA 4Y15A 4WXDA 2L54A 3C18A 3TDZC 1XDSA 2VBWA 3ABTA 4RS8A 2F5CA 2GXBA 4RAZA 1J2XA 3R0AA 1FLIA 2ZCWA 5FD6A 1B9NA 1O7LA 2DO7A 3E5UA 5D8KB 2DQRA 1FWZA 4LLGF 2IJLA 1RNLA 3WODF 1R36A 4GYGA 1RZ4A 1BBYA 4MQ9F 5K5OA 2HDCA 1LDKB 3QRFF 4M9ZA 2DTRA 1W5SA 1B4AA 5LHHA 2M87A 2CYYA 4LG0A 2CQKA 1XSDA 3M1EA 2OZUA 4G7ZF 3S2WA 1MD0A 1ON2A 3O3KA 4ETSA 2PMUA 4XRFA 3LA3A 3IHUA 2RN7A 1IXCA 3NEUA 1TQIA 3FMSA 1XSXA 3CO7C 2HZTA 4PDKA 2UWMA 4L9VA 1YFHA 2M8EA 3QAHA 3SZTA 2KIUA 2E1CA 1ZLJA 5L3CA 3SXYA 1A04A 1W7PB 2A3SA 1IN7A 4ZYEA 4M6YA 4RGUA 1K78A 2A07F 3MZYA 4A5NA 3GZ5A 4CICA 5ICCA 2HTSA 5FFXA 4A6DA 2K4BA 2QBYA 2RV8A 2X0LA 1QPMA 4RB0A 2P8TA 1MDMA 2VE8A 1U78A 3R6SA 1TNSA 4ZYGA 1P4XA 2VN2A 5DEQA 3TKYA 3KP5A 4K2EA 3M8FA 3J7AO 1ZARA 1LEBA 1F1ZA 3VOEA 1MGTA 1XCBA 1IN5A 4FHTA 1F4KA 3K69A 4A0YA 4UVAA 2XAJA 5HOOA 4I0BA 2K7LA 1IRFA 1BN5A 4MEXF 3WTXC 4WXHA 1WWXA 2A68F 4PCQA 1BI2A 2ACJA 3E3VA 4OMYA 1FY7A 2M45A 3WTUC 3FM5A 3I59B 1U5TB 2YX7A 3DP7A 3BZ6A 4A12A 1PP7U 3HTSB 5ILSA 4LB5A 2Q0OA 2JT1A 5ICFA 2DPDA 3FXRA 1OPCA 3GFIA 2IPQX 4G7HF 4CHUA 3EDPA 1U6GA 2XRNA 4MQVA 3EUHA 5CVJA 1EH6A 4YFNF 3HRMA 4B09A 3I4PA 2DK5A 3NRVA 3KP3A 1ZN2A 4EGYA 2HOEA 1T39A 1IF1A 2F5FA 3TOBA 1W5TA 5CVRA 1O3QA 3KP7A 4A2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTY A;  3KP6 A;  1UST A;  2ZO4 A;  2MC3 A;  1HKT A;  3V8L A;  4GCV A;  2Z99 A;  1BI1 A;  1FSH A;  3HOT A;  3PFI A;  3FHZ A;  1RI7 A;  3KET A;  2O03 A;  1W4M A;  2QVO A;  4P55 A;  4YII A;  1UCR A;  5D4R A;  2P7V B;  2XKP A;  2GA2 A;  4LLN A;  4AIJ A;  2OQR A;  4ENM A;  2ISY A;  3RKX A;  1FNN A;  2PG4 A;  3I64 A;  4M74 A;  1DUX C;  4B8X A;  1S3J A;  5BOX A;  4LLL A;  1J59 A;  3FX3 A;  1I27 A;  1IAW A;  1YS7 A;  3E6D A;  5D6E A;  5DCF A;  2FBI A;  4JBA A;  4MGR A;  1HSJ A;  2H94 A;  1YYV A;  2W25 A;  1K6O A;  1E17 A;  2VON A;  1Y0U A;  2FQ3 A;  3WTY C;  2VOO A;  1FP1 D;  1G3Y A;  4IF4 A;  5LBQ A;  2J5O A;  1LB2 A;  2JTV A;  4ENK A;  2P4W A;  5KK1 A;  3T8R A;  1HST A;  1QO0 D;  3Q9S A;  5JHU A;  1JGS A;  4HW0 A;  3CUQ A;  4OIR F;  1UHW A;  3KP2 A;  1ONV A;  3EYY A;  2JPC A;  4IPA A;  4DQ2 A;  2PMH A;  5CYV A;  1SAX A;  1UHM A;  2RGV A;  3HRS A;  4EV0 A;  3LQR A;  5E20 A;  3I0T A;  4EVI A;  3Q5F A;  1K7A A;  4HLX A;  2YX4 A;  4AWX B;  2R7F A;  5DYM A;  4BHC A;  4EJT A;  2G7U A;  2KJC A;  3V7S A;  4LJZ F;  1P4W A;  1LNW A;  1HW1 A;  1MKM A;  1TW3 A;  3GWZ A;  1R1V A;  2F2E A;  5FLX K;  1H0M A;  3ERE D;  1GVJ A;  5ILU A;  4U0Y A;  2H09 A;  2L01 A;  1U5T C;  3F6O A;  4WCG A;  3BP8 A;  5D5W B;  2CSO A;  2H6C A;  3BJA A;  2NRA C;  4UNO A;  5LRS A;  1IN4 A;  3NQO A;  1B9M A;  2HS5 A;  1D8J A;  2QYO A;  2Y0M A;  1D3Y A;  1ZAO A;  2KKO A;  4P9F A;  4MEY F;  1HW2 A;  3BY6 A;  3QP5 A;  4OMZ A;  2FOK A;  3GVA A;  4GYI A;  1WKM A;  1F5T A;  3W6J B;  2LDU A;  1LDJ A;  4L5I A;  1F9N A;  1P6R A;  3JTH A;  3REO A;  1R1U A;  4ESF A;  4IHT A;  1T98 A;  4EM1 A;  3E5Q A;  5L3E A;  2R3S A;  4WWC A;  3F72 A;  4UUV A;  2HGC A;  1P4A A;  1O7F A;  2MH9 A;  1XGS A;  2FNA A;  1JHF A;  2HYF A;  2IA1 A;  2EFW A;  4O6J A;  3ABU A;  2HEO A;  3RTR A;  1IRG A;  1XCV A;  2YR2 A;  1Z91 A;  2FMY A;  3ZP5 A;  2L4A A;  3J80 Z;  3T1B A;  1PP8 F;  1SD4 A;  1FBQ A;  4EMS A;  3MZH A;  2CG4 A;  1EH7 A;  1J0R A;  1R23 A;  3K0L A;  1YIO A;  5LLQ A;  1SFE A;  3GF2 A;  1ZLK A;  4WXC A;  3V7R A;  2D1H A;  4G94 A;  4HQM A;  3O2P E;  2DK8 A;  3MAJ A;  4RGS A;  4A5M A;  2MLG A;  2XVC A;  3RPU A;  2ZBK A;  1SFX A;  4MNU A;  2HYG D;  3FM3 A;  4UVB A;  3MEX A;  4FT8 A;  4OOI A;  3ROU A;  5E8G A;  4HBL A;  5AON A;  1SD5 A;  2BV6 A;  3KEQ A;  1STZ A;  4HDV A;  3ZQ7 A;  2OD5 A;  3DFG A;  1ZG3 A;  1BC8 C;  6PAX A;  1ON1 A;  2LF8 A;  2FF4 A;  1IN6 A;  1WI9 A;  1BI3 A;  2V1D A;  3U1D A;  4Y13 A;  1GXP A;  2K27 A;  4KDP A;  1E2X A;  4Y17 A;  2MD5 A;  5H6R A;  1AOY A;  2MH2 A;  3HHG A;  2COM A;  3IRR A;  2VT2 A;  3DEU A;  5A2Q Z;  2MBF A;  2XAF A;  4NQW A;  2A69 F;  4OIP F;  3GYH X;  1BIB A;  5ED4 A;  1RIO H;  3TOA A;  1S29 A;  1ZRE A;  3WE3 A;  2ETH A;  2PI0 A;  5DCM A;  2STT A;  1ULY A;  2ELH A;  4KIC A;  3T8T A;  1GHC A;  3I59 A;  2EA2 A;  1SMT A;  4CZZ A;  3ZN0 A;  2Q2E A;  4BNC A;  1HKS A;  3GEZ A;  1KU3 A;  3GXO A;  1XGN A;  3KZY A;  1DPU A;  1R5G A;  3SQN A;  4ZZD A;  3BJ6 A;  1QNT A;  2EFQ A;  3EET A;  1J9I A;  3T5X A;  3WTV C;  1FOK A;  4LMY A;  4LGW A;  2V1X A;  3RKY A;  3COA C;  5HS7 A;  5D6F A;  3L2C A;  2L02 A;  1IW7 F;  4ZZL A;  2PLY A;  2EFP A;  2P5L C;  2ESH A;  4KT5 C;  2CWE A;  1IUY A;  4KMF A;  3ZMU A;  2DPU A;  1KGS A;  4BHB A;  4EJO A;  3R61 A;  2GQQ A;  4CXF A;  3GZ6 A;  1ZGJ A;  2IA0 A;  3LAJ A;  2M5W A;  4AVP A;  4ESJ A;  2XUB A;  3L09 A;  3FMR A;  4N9H A;  3D0S A;  2H6B A;  5H20 A;  5AIQ A;  1LEA A;  4G7O F;  2EJR A;  1I1S A;  2FA5 A;  5J8F A;  5IT9 K;  5LEK A;  1RUN A;  1YG2 A;  4RAY A;  2Y48 A;  1YO5 C;  2HR3 A;  4BXU A;  1TQM A;  1P92 A;  3WU0 A;  2L4M A;  4HLY A;  3E6M A;  1Z9C A;  4E70 A;  2IA2 A;  2VBY A;  3MCZ A;  1ZGA A;  3F21 A;  5FB2 A;  1LJ9 A;  3KEO A;  2IRF G;  3VEP A;  5LRR A;  2BYV E;  5DV5 A;  4N9I A;  2W57 A;  3K2Z A;  1MJ9 A;  4MTE A;  1X3U A;  4KYW A;  1L3L A;  1YW7 A;  4M73 A;  1B59 A;  4UHT A;  2ISZ A;  1I1G A;  3DPL C;  2Z9O A;  2O61 A;  2KRF A;  3RIR A;  4RB1 A;  5BS6 A;  1BIA A;  3BJO A;  1G4D A;  5E1Z B;  2IVM A;  3RYR A;  5F6F A;  1R7J A;  4IVN A;  4NB5 A;  2RKH A;  2LSO A;  3HIF A;  4L9N A;  4BQA A;  3G73 A;  3CLO A;  2Z5U A;  2ADU A;  2FRH A;  3JTG A;  2BBY A;  4HYE A;  1ZH5 A;  2FU4 A;  2M30 A;  1MJA A;  1DP7 P;  2ESN A;  4L9T A;  3BPX A;  1S6L A;  4GXO A;  4ENN A;  1LDD A;  3IKV A;  4O3M A;  2XV4 S;  1FSE A;  1HXD A;  3HTU A;  4LG0 B;  3HUG A;  3OOP A;  4U0V A;  4OIQ F;  5L3D A;  4A0Z A;  2VC0 A;  2K02 A;  1LQ1 A;  4YFK F;  3F8M A;  1HKQ A;  4PZJ A;  3VFZ A;  3F8F A;  2UXN A;  1G3S A;  3CDH A;  3ECO A;  3H92 A;  3CJN A;  3ELK A;  4QWQ A;  2EWN A;  4I2O A;  1CF7 B;  1IN8 A;  3JSP A;  3GO5 A;  2NNN A;  5D5U B;  1ZRF A;  3GW2 A;  1K78 B;  2O8X A;  3P7N A;  2P5K A;  4XSX F;  3WGI A;  4HOB A;  4GO1 A;  3M9A A;  5ICG A;  3Q9V A;  5JI6 A;  3I58 A;  1ZRC A;  2OZ6 A;  2FBH A;  2BGC A;  2JZY A;  3WGG A;  2V79 A;  4EJU A;  1XN7 A;  2PFB A;  3M8E A;  3R4K A;  4CGZ A;  1O3R A;  1QGP A;  2VT3 A;  2P5V A;  1IXS B;  5KVR A;  2ZNY A;  5E17 F;  4DNC A;  3IC7 A;  5CVI A;  3ZN1 A;  2EFN A;  1O3S A;  3KE2 A;  3G3Z A;  1K79 A;  3RI4 A;  4N0B A;  3M7G A;  3E6C C;  4U88 A;  2D45 A;  3RYP A;  1OMI A;  3EQL F;  4AD9 A;  5K5R A;  1W7P D;  4XSZ F;  1BC7 C;  3K1M A;  1U2W A;  1FBU A;  4KN4 X;  3SZP A;  1SD6 A;  4ON0 A;  2VOP A;  5L3G A;  2VE9 A;  1R1T A;  5CJ9 A;  3V8J A;  1OR7 A;  3KLO A;  2FML A;  1GXQ A;  3D5L A;  2ZKZ A;  2QQA A;  2LF7 A;  3C1D A;  2STW A;  4KIB A;  4A0X A;  2CFX A;  1YLF A;  2Y75 A;  2G9W A;  2CO5 A;  4F7Z A;  1YW9 A;  2EA4 A;  3LFK A;  3LQQ A;  2UZK A;  2VBX A;  4EQQ A;  3CO6 C;  1R5H A;  3IL2 A;  2YU3 A;  3F22 A;  4L0Y B;  1OYI A;  1ZG5 A;  3LAP A;  3IWF A;  2MLK A;  2VOD A;  2UXX A;  2YSR A;  3KZZ A;  3J81 Z;  3CUO A;  3HSR A;  3R0J A;  4L9J A;  1L0O C;  1P2F A;  4UVC A;  3P9C A;  2EK5 A;  1R00 A;  2X4H A;  1T6S A;  3ZPL A;  2R7D A;  3ZMD A;  4HV6 A;  3DF8 A;  3RDI A;  1H9T A;  2EB7 A;  3C7J A;  3TO9 A;  2ZFW A;  1SFU A;  1KU9 A;  3V7C A;  2HKO A;  3KP4 A;  5D5V B;  4H0E A;  3HYI A;  1B6A A;  1WSU A;  2JRT A;  1J7K A;  3F23 A;  1G3W A;  2OAZ A;  1J75 A;  1QQI A;  4IJA A;  3DPT A;  1W7P A;  4L5J A;  3GUD A;  1ZG1 A;  5HLI A;  1HW5 A;  1ZRD A;  3L9F A;  3KFW X;  2VXZ A;  4CDG A;  3EYI A;  4AIK A;  2W24 A;  4EM2 A;  4HF2 A;  4LK0 F;  2DQL A;  1CGP A;  1FBS A;  2W84 A;  5F1R A;  1JHH A;  1KYW A;  1KQ8 A;  1J5Y A;  1BOA A;  5LGN A;  3L00 A;  2AXL A;  3H3U A;  4BHP A;  2RC4 A;  4I7H A;  2OU2 A;  5E18 F;  1XDU A;  2O3F A;  2DAO A;  4BH9 A;  5HDN A;  1V3F A;  2RNJ A;  1RUO A;  5TRD A;  5JFR A;  2E1N A;  2GA1 A;  1EH8 A;  2HTJ A;  3ECH A;  3GX4 X;  1FYL A;  3I53 A;  4JK1 X;  2GWR A;  4OIN F;  5ILV A;  3L7W A;  5DDG A;  5BMZ A;  4LFU A;  3LST A;  4HX8 A;  3PQK A;  1SD7 A;  4KIG A;  5HVQ C;  4LB6 B;  3RKW A;  2XGX A;  4JQF A;  3JSO A;  1AWC A;  2IP2 A;  4L18 B;  3MWM A;  1U5T A;  2EV0 A;  2GIV A;  1OKR A;  2V1U A;  2A6H F;  4M9S A;  1KQ9 A;  1T2K A;  4IRH A;  1WQ2 A;  2KJB A;  1QBJ A;  5L3B A;  3ZMV A;  2ZME B;  2JSC A;  1EV7 A;  2RQP A;  3KCC A;  4PGH A;  3KLN A;  3HSF A;  3T0Y A;  4IHS A;  4AIH A;  2YPR A;  3O6B B;  2EV5 A;  4I98 B;  2QLZ A;  1H9G A;  3HRU A;  3BWG A;  1VTN C;  3B73 A;  5ERI A;  2NS0 A;  1TLH B;  1XGO A;  3QP6 A;  5LHG A;  3LA7 A;  1FP2 A;  2IW5 A;  5LHI A;  3JAM Z;  3N4M A;  3FZV A;  3PQJ A;  1Z6T A;  1Z1D A;  3HSE A;  5BPD A;  4Q5S F;  2A5Y B;  4D0P A;  4P96 A;  2EFO A;  4ZYD A;  2RDP A;  5L3F A;  5D5X B;  2XAG A;  3TQN A;  2QZ8 A;  1JXS A;  1B1B A;  3DV8 A;  2WWY A;  5E1W A;  3E5X A;  5FFZ A;  1G3T A;  1KA8 A;  3R60 A;  4ASN A;  4YIF A;  2LKP A;  4BAY A;  1U3E M;  2F5E A;  3HOS A;  2QUF A;  3K1N A;  3DXJ F;  3V4G A;  1TBX A;  1CF7 A;  3QU6 A;  2LNB A;  3F6V A;  4I01 A;  5TJJ A;  1ODD A;  5FLX Z;  3WTZ A;  1BI0 A;  2IT0 A;  3FMQ A;  2OA4 A;  2OQG A;  5HS9 A;  3U9G A;  5BQT A;  3ZMT A;  5CVU A;  2OBP A;  1BM9 A;  5DD8 A;  4RGX A;  5HLH A;  4KNY A;  3W6K B;  3E97 A;  2L3D A;  2B0L A;  2HKX A;  3CUQ C;  2QEN A;  3J81 K;  3GFL A;  2XAH A;  1HQC A;  4R79 A;  2J5P A;  2CGP A;  5JVT A;  2VC1 A;  4Q48 A;  4OIO F;  1FT9 A;  3LA2 A;  2XIG A;  3IKT A;  2V9V A;  5DD4 A;  2K86 A;  3TGN A;  2PN6 A;  4KFC A;  5H6Q A;  5DUK A;  4YG2 F;  4O5V A;  3QOP A;  4KMU X;  1MJB A;  4Q4Z F;  3V8K A;  2FXA A;  1U8R A;  3VB2 A;  4PGG A;  3P9I A;  3J80 K;  1TW2 A;  3FWE A;  4HQE A;  4R1H A;  5DCM B;  2WTE A;  2NNY A;  4CYD A;  3I54 A;  3IRQ A;  2QQB A;  1FYK A;  1IXR C;  3LWF A;  1KYZ A;  2C6Y A;  3I5U A;  4XBF A;  4RB3 C;  2XAQ A;  2HQN A;  2D2W A;  4M6X A;  3ZMS A;  2FBK A;  3SHF A;  4U0W A;  4KUM A;  4HZF A;  3TO6 A;  3OV8 A;  1KU2 A;  3GFM A;  3RPQ A;  4WK8 F;  2P6S A;  3SFZ A;  5D8L B;  5FD5 A;  5K5Q A;  3MQ0 A;  1O57 A;  4IRI A;  2E7W A;  1FPQ A;  3RJP A;  3DQV C;  1O3T A;  3QPH A;  4LK1 F;  3TO7 A;  3E6B A;  4NHJ A;  2FSW A;  4MHG A;  1Q1H A;  3IWZ A;  3QPT A;  2O6G E;  3F8N A;  3C3W A;  1I5Z A;  2JPB A;  4G9Y A;  5CVV A;  1V4R A;  1DDN A;  3BOQ A;  5HDK A;  4HX7 A;  1UB9 A;  4P9U A;  4I02 A;  1KU7 A;  3FXQ A;  1FZP B;  1Z05 A;  2NYX A;  5F64 A;  3ML6 A;  4M71 A;  5A2Q K;  5EEG A;  2XKO A;  2P7C B;  5D4S A;  1S7A A;  2W85 A;  1TNT A;  2BE5 F;  4HX4 A;  4IRG A;  3N97 A;  1NHA A;  2QBY B;  1YW8 A;  5J8C A;  4RB2 C;  4FX4 A;  4QLC U;  1S8N A;  1MDM B;  4UV8 A;  4EJV A;  4YFX F;  2EV6 A;  1JE8 A;  5J6X A;  1PUE E;  4XLN F;  5HDG A;  4HA8 A;  1SMY F;  4CO8 A;  2KIF A;  1T0F A;  3I71 A;  3ISP A;  3P9K A;  4FX0 A;  2GXG A;  2PBI A;  4EM0 B;  3BPV A;  3F8C A;  4EJW A;  3K9T A;  3WTT C;  1R58 A;  3B02 A;  1FX7 A;  1PDN C;  2VBZ A;  1FC3 A;  4ZH4 F;  1G6N A;  2O0Y A;  4TV7 A;  5E8I A;  2CW0 F;  2F5D A;  4HDU A;  1WRJ A;  3JAM K;  1USS A;  4U7D A;  2DLL A;  4S05 A;  5HS8 A;  2DU9 A;  3WGH A;  3WG9 A;  4EGZ A;  3WTW C;  1MZB A;  3QU3 A;  3GFJ A;  2QQ9 A;  2HWV A;  4P5O A;  4A6E A;  1YS6 A;  3JW4 A;  1XGM A;  1XMK A;  2FE3 A;  2RVC A;  5DUI A;  4UXN A;  4XLP F;  4BYY A;  2NAZ A;  4OU0 A;  3WE2 A;  3WTS C;  4ENJ A;  2PJP A;  3DKW A;  1D8K A;  4U7B A;  5LGT A;  1KQ0 A;  1BJA A;  4G8X A;  2BEO A;  3U2R A;  5BPI A;  2DI3 A;  2ZXJ A;  4GGG A;  4HV5 A;  1R22 A;  4L0Z B;  1DPR A;  4RGR A;  1C0W A;  3CTA A;  2HQR A;  5JR3 A;  1I6X A;  4G6Q A;  3BDD A;  4S04 A;  3HHH A;  4LD5 A;  2DBB A;  1ZHF A;  5IT9 Z;  4WX9 A;  5IT3 A;  1XMA A;  2D1V A;  1XSV A;  2A61 A;  4KN7 X;  2KIM A;  2FEZ A;  2ZME A;  4WF2 A;  2GAU A;  5K1Y A;  2V6C A;  1IZ1 A;  5CLS A;  2QM3 A;  1REP C;  2DFI A;  4ZYH A;  1ZYR F;  4HF0 A;  3ZMZ A;  2DW4 A;  3VOD A;  4IXA A;  2ZJ2 A;  2PQ8 A;  4Z2Y A;  4HF1 A;  4I09 A;  1YQA A;  3FF5 A;  4MTD A;  3H3Z A;  2TDX A;  4UV9 A;  2E7X A;  4KA4 A;  1YTY A;  2A6E F;  4G6D A;  2Q8K A;  4ESB A;  3FXU A;  2FNP A;  1QZZ A;  1XB4 A;  4Q47 A;  2Z3Y A;  5EEH A;  1TQP A;  3F8B A;  2H27 A;  3ULQ B;  2XRO A;  1OYW A;  5FGM A;  3TDU C;  2HFH A;  3F3X A;  1QZY A;  3CUQ B;  2ZNZ A;  3GLX A;  3K1P A;  1T38 A;  2WC2 A;  5ICE A;  2PEX A;  1Z6R A;  5AIP A;  1D5V A;  2M1B A;  4I0A A;  5E1X A;  1HBX G;  1S7O A;  2MA3 A;  4M9X A;  2Z33 A;  1LVA A;  5HLG A;  4R8H A;  2XAS A;  5LEJ A;  2GZW A;  4KIF A;  3BRO A;  2QWW A;  3HRT A;  2XHK A;  5FO5 A;  2P6T A;  4M72 A;  1UFM A;  2AS5 F;  2DT5 A;  1OYY A;  1FYM A;  2G7H A;  3MFK A;  1XD7 A;  3AAF A;  5LGU A;  4HAM A;  2WV0 A;  3WU1 B;  2K4J A;  1Z7U A;  4Y15 A;  4WXD A;  2L54 A;  3C18 A;  3TDZ C;  1XDS A;  2VBW A;  3ABT A;  4RS8 A;  2F5C A;  2GXB A;  4RAZ A;  1J2X A;  3R0A A;  1FLI A;  2ZCW A;  5FD6 A;  1B9N A;  1O7L A;  2DO7 A;  3E5U A;  5D8K B;  2DQR A;  1FWZ A;  4LLG F;  2IJL A;  1RNL A;  3WOD F;  1R36 A;  4GYG A;  1RZ4 A;  1BBY A;  4MQ9 F;  5K5O A;  2HDC A;  1LDK B;  3QRF F;  4M9Z A;  2DTR A;  1W5S A;  1B4A A;  5LHH A;  2M87 A;  2CYY A;  4LG0 A;  2CQK A;  1XSD A;  3M1E A;  2OZU A;  4G7Z F;  3S2W A;  1MD0 A;  1ON2 A;  3O3K A;  4ETS A;  2PMU A;  4XRF A;  3LA3 A;  3IHU A;  2RN7 A;  1IXC A;  3NEU A;  1TQI A;  3FMS A;  1XSX A;  3CO7 C;  2HZT A;  4PDK A;  2UWM A;  4L9V A;  1YFH A;  2M8E A;  3QAH A;  3SZT A;  2KIU A;  2E1C A;  1ZLJ A;  5L3C A;  3SXY A;  1A04 A;  1W7P B;  2A3S A;  1IN7 A;  4ZYE A;  4M6Y A;  4RGU A;  1K78 A;  2A07 F;  3MZY A;  4A5N A;  3GZ5 A;  4CIC A;  5ICC A;  2HTS A;  5FFX A;  4A6D A;  2K4B A;  2QBY A;  2RV8 A;  2X0L A;  1QPM A;  4RB0 A;  2P8T A;  1MDM A;  2VE8 A;  1U78 A;  3R6S A;  1TNS A;  4ZYG A;  1P4X A;  2VN2 A;  5DEQ A;  3TKY A;  3KP5 A;  4K2E A;  3M8F A;  3J7A O;  1ZAR A;  1LEB A;  1F1Z A;  3VOE A;  1MGT A;  1XCB A;  1IN5 A;  4FHT A;  1F4K A;  3K69 A;  4A0Y A;  4UVA A;  2XAJ A;  5HOO A;  4I0B A;  2K7L A;  1IRF A;  1BN5 A;  4MEX F;  3WTX C;  4WXH A;  1WWX A;  2A68 F;  4PCQ A;  1BI2 A;  2ACJ A;  3E3V A;  4OMY A;  1FY7 A;  2M45 A;  3WTU C;  3FM5 A;  3I59 B;  1U5T B;  2YX7 A;  3DP7 A;  3BZ6 A;  4A12 A;  1PP7 U;  3HTS B;  5ILS A;  4LB5 A;  2Q0O A;  2JT1 A;  5ICF A;  2DPD A;  3FXR A;  1OPC A;  3GFI A;  2IPQ X;  4G7H F;  4CHU A;  3EDP A;  1U6G A;  2XRN A;  4MQV A;  3EUH A;  5CVJ A;  1EH6 A;  4YFN F;  3HRM A;  4B09 A;  3I4P A;  2DK5 A;  3NRV A;  3KP3 A;  1ZN2 A;  4EGY A;  2HOE A;  1T39 A;  1IF1 A;  2F5F A;  3TOB A;  1W5T A;  5CVR A;  1O3Q A;  3KP7 A;  4A2U A; 
#chains in the Genus database with same CATH topology
 3H5A A;  1TTY A;  2EIK H;  3D5S C;  4LIV A;  4KIS A;  3KP6 A;  1UST A;  5KNL A;  1IRX A;  2ZO4 A;  2MC3 A;  5KCM A;  1HKT A;  3S14 J;  3V8L A;  3A01 A;  3JRD A;  4GCV A;  2CRG A;  2Z99 A;  3DKY A;  5FJ8 J;  3H3V K;  1BI1 A;  3K2A A;  1FSH A;  3HOT A;  3PFI A;  1X1C A;  4EAT A;  3LSR A;  3FHZ A;  1RI7 A;  1FMW A;  1VND A;  3KET A;  5M5W J;  4HEA 2;  1P7I A;  5GTI C;  1WJE A;  1NH3 A;  2GOM A;  1W4M A;  2O03 A;  1R49 A;  4BEH B;  2JK3 A;  2QVO A;  4P55 A;  1UG0 A;  2KRH A;  1G2H A;  4YII A;  3PIO F;  3VYU B;  3BR0 A;  4A3K J;  1UCR A;  5D4R A;  2P7V B;  2XKP A;  3OR1 C;  2ID6 A;  4XMY A;  3VDX A;  2VJ5 A;  4NUB A;  2GA2 A;  4LLN A;  4AIJ A;  2OQR A;  1VQK I;  4ENM A;  2ISY A;  3RKX A;  1FNN A;  4MIM A;  3D5R C;  2PG4 A;  3I64 A;  3BR5 A;  2R7V A;  2EIN H;  3LSJ A;  4M74 A;  3QOD A;  1DUX C;  1R71 A;  4B8X A;  1S3J A;  4UB8 C;  4LLL A;  5BOX A;  1J59 A;  3FX3 A;  2F48 A;  1I27 A;  2KZG A;  1IAW A;  3J7Y J;  3OSG A;  1YS7 A;  3E6D A;  3UR3 C;  3KPH A;  3GME A;  4MLO A;  5D6E A;  5DCF A;  2FBI A;  4RBO A;  1DGW Y;  4JBA A;  4MGR A;  1HSJ A;  2H94 A;  1YYV A;  2M9H A;  2W25 A;  1HA8 A;  1K6O A;  3OYN A;  2LMD A;  3G1M A;  3M8J A;  5JLW A;  4E7I A;  4D5F A;  4J00 A;  1E17 A;  3TBI A;  1W0U A;  2VON A;  2LY2 A;  1Y0U A;  2FQ3 A;  2CQ7 A;  3WTY C;  2VOO A;  2KFD A;  2F4O B;  3EPZ A;  1FP1 D;  4F91 B;  1W0T A;  1N78 A;  1G3Y A;  4IF4 A;  2N8G A;  5LBQ A;  2J5O A;  5TIS C;  4B3X A;  1LB2 A;  1BR4 A;  2JTV A;  4ITV A;  3FK6 A;  1TC3 C;  4ENK A;  2P4W A;  1R4M B;  2BY1 A;  3T8R A;  5KK1 A;  1HST A;  1QO0 D;  3Q9S A;  5JHU A;  1JGS A;  4HW0 A;  2BY0 A;  3CUQ A;  4FCY A;  4OIR F;  1UHW A;  3HDD A;  3IH2 A;  2L5Q A;  1B8I A;  3KP2 A;  1ONV A;  2FQ4 A;  2JPC A;  3EYY A;  4IPA A;  4PJN A;  4DQ2 A;  2PMH A;  5CYV A;  2WA0 A;  3S2H J;  1WJF A;  4CCL A;  1UZC A;  1SAX A;  1ZKG A;  2EZI A;  1UHM A;  2X1C A;  2RGV A;  3ZXS A;  3HRS A;  1S9H A;  1MBH A;  4EV0 A;  3LQR A;  5E20 A;  3I0T A;  4EVI A;  3Q5F A;  3Q0V A;  2BXY A;  1ZR4 A;  5CQE A;  1K7A A;  4HLX A;  1X1A A;  2YX4 A;  2R93 J;  4C30 A;  4AWX B;  5IP6 A;  4AVZ A;  2QSG X;  2R7F A;  5DYM A;  4BHC A;  3JRH A;  1OQY A;  3X2Q H;  2G7U A;  2KJC A;  4EJT A;  2ZJP F;  3PO3 J;  4BXF A;  3V7S A;  1YIJ I;  1ETY A;  5K7Z A;  4LJZ F;  1P4W A;  3S1M J;  1LNW A;  1HW1 A;  1MKM A;  1TW3 A;  1UHS A;  3GWZ A;  1R1V A;  3I9V 2;  5IYD J;  2F2E A;  4DZP A;  4A3B J;  3RPU D;  1ZK8 A;  1MH4 A;  5FLX K;  1H0M A;  2CJJ A;  3ERE D;  1GVJ A;  4IKF A;  5ILU A;  5EG0 A;  4U0Y A;  2H09 A;  4AYB N;  2L01 A;  4DYQ A;  1MSF C;  1LKX A;  1U5T C;  1X2N A;  1OIS A;  3F6O A;  3K4N A;  4WCG A;  1AKH A;  3BP8 A;  1VF9 A;  3K7A J;  3OMY A;  3OYE A;  4RAF A;  5D5W B;  2CSO A;  2H6C A;  3BJA A;  3DTE A;  3L2U A;  2NRA C;  4UNO A;  3LSH A;  5LRS A;  4OAY A;  5E3O A;  1K4S A;  3CDL A;  1IN4 A;  3NQO A;  1B9M A;  2HS5 A;  1SFK A;  2VXD A;  3JRE A;  1D8J A;  3ZQG A;  3Q3S A;  2QYO A;  2WAE A;  3MKL A;  4XID A;  2DA7 A;  4FTH A;  2XGD A;  2Y0M A;  1D3Y A;  1I39 A;  1ZAO A;  2KKO A;  4P9F A;  4MEY F;  1HW2 A;  1GVD A;  3BY6 A;  2DJN A;  3QP5 A;  4OMZ A;  2WAQ A;  2R7W A;  2FOK A;  2R7S A;  3GVA A;  4GYI A;  1WKM A;  1F5T A;  3W6J B;  3L2R A;  4AC0 A;  2LDU A;  1LDJ A;  4L5I A;  4ZDO A;  1F9N A;  4U87 A;  1P6R A;  2JMW A;  3JTH A;  2GXA A;  3REO A;  1R1U A;  4ESF A;  1RKW A;  3RZO J;  4IHT A;  1T98 A;  2DT7 B;  4EM1 A;  3OYL A;  4G6T B;  3E5Q A;  3HB9 A;  1DQU A;  5L3E A;  2R3S A;  4WWC A;  3F72 A;  1RKT A;  1WH5 A;  2IGO A;  3AL0 B;  2K3F A;  4UUV A;  2BY2 A;  4DGW B;  2HGC A;  2E1O A;  1P4A A;  5FKN A;  4XKB A;  3HG9 A;  1X4P A;  3BG9 A;  2KRC A;  1O7F A;  2MH9 A;  4A69 C;  3ABK H;  1XGS A;  1JI8 A;  2ID3 A;  2FNA A;  1JHF A;  4PJM A;  2HYF A;  3JRA A;  2OJE D;  2AQE A;  2IA1 A;  3WU2 C;  3HOV J;  2VKD A;  4F52 A;  2W48 A;  2EFW A;  4KT6 A;  1I3A A;  3ZGK A;  4O6J A;  3ABU A;  2HEO A;  1VQL I;  1D1C A;  3RTR A;  2EIL H;  1IRG A;  1XCV A;  1PYV A;  1QVU A;  2YR2 A;  1Z91 A;  2FMY A;  3C2G A;  3ZP5 A;  3SEQ A;  2LFB A;  2R7T A;  2L4A A;  3J80 Z;  1PUF A;  4RLQ A;  3T1B A;  1PP8 F;  1SD4 A;  2WBM A;  1S72 I;  1FBQ A;  4EMS A;  1JJ6 C;  3MZH A;  2CG4 A;  1MH3 A;  2X1D A;  4PJ0 C;  1Y0N A;  4AM3 A;  3J7A Y;  2YS9 A;  5F0H A;  4XRS G;  3OIO A;  3FKI J;  2LG4 A;  1EH7 A;  2DCE A;  1J0R A;  1R23 A;  3K0L A;  1YIO A;  5LLQ A;  2E2H J;  1SFE A;  3GF2 A;  2DTZ A;  2IAI A;  3E7L A;  2VQG A;  2DYR H;  5GAH J;  1ZLK A;  4WXC A;  3V7R A;  1BA5 A;  2CQQ A;  2D1H A;  2W00 A;  1Y8R B;  3WHB A;  3JCU C;  4G94 A;  2V26 A;  2Y0S A;  4XKC A;  4HQM A;  3O2P E;  1SAU A;  2DK8 A;  4C2T A;  3MAJ A;  4RGS A;  4A5M A;  4D7N A;  2MLG A;  2JA6 J;  2XVC A;  4QSH A;  3RPU A;  3WG7 H;  2ZBK A;  3SDB A;  1SFX A;  4MNU A;  5BNG A;  2HYG D;  3FM3 A;  2NVX J;  4UVB A;  3MEX A;  2XSD C;  2PMZ A;  3AKZ A;  4FT8 A;  4OOI A;  3ROU A;  2L9V A;  1D1A A;  5E8G A;  2D5V A;  4HBL A;  5AON A;  1SD5 A;  2BV6 A;  2KDZ A;  3FXK A;  3KEQ A;  1STZ A;  3GTO J;  4HDV A;  3H35 A;  2DMT A;  3ZQ7 A;  2OD5 A;  3DFG A;  1ZG3 A;  3LSI A;  1BC8 C;  6PAX A;  2F4M B;  2VUM J;  2CUZ A;  1ON1 A;  2LF8 A;  2JN6 A;  2FF4 A;  1IN6 A;  1MNE A;  2KPM A;  1WI9 A;  1VFC A;  3GTP J;  1SFO J;  2XPU A;  1BI3 A;  1MBK A;  2V1D A;  2BOL A;  2Y9Y A;  3U1D A;  3A0B C;  4Y13 A;  1GXP A;  2K27 A;  4KDP A;  4X1E A;  1E2X A;  1JT6 A;  2XPW A;  4FIS A;  4II2 A;  4Y17 A;  2MD5 A;  3BG5 A;  4XON A;  4OWR B;  2DMN A;  5H6R A;  2NS8 A;  4FE4 A;  1AOY A;  2EZL A;  1VZ0 A;  2MH2 A;  3HHG A;  3CCS I;  2COM A;  3HC7 A;  1LUJ B;  3OYA A;  3IRR A;  2VT2 A;  3DEU A;  5A2Q Z;  2MBF A;  2XAF A;  4NQW A;  4C2U A;  2A69 F;  4OIP F;  3GYH X;  5K7F A;  3LL7 A;  1MBJ A;  2ZB9 A;  1SAN A;  1D5Y A;  3TMO A;  1BIB A;  3BG3 A;  2OC6 A;  3CCR I;  5ED4 A;  1RIO H;  3TOA A;  1S29 A;  1ZRE A;  3WE3 A;  5EDN A;  1B72 A;  2ETH A;  1T95 A;  4XLH A;  2PI0 A;  5DCM A;  5IYC J;  4A3I J;  2STT A;  4F55 A;  1ULY A;  2ELH A;  2CV2 A;  1JTX A;  2BY3 A;  4KIC A;  5F0F A;  3T8T A;  4BGD A;  1GHC A;  3I59 A;  1X1B A;  1Y6I A;  2EA2 A;  3QWL A;  1SMT A;  3HZJ A;  2IS6 A;  4CZZ A;  3ZN0 A;  2AQF A;  2EZK A;  2Q2E A;  4BNC A;  1F36 A;  1OCT C;  1HKS A;  3GEZ A;  1KU3 A;  3GXO A;  2GM4 A;  4IHY A;  3PNT A;  4IEJ A;  1XGN A;  3KZY A;  2R92 J;  2YU9 J;  1DPU A;  1R5G A;  3SQN A;  4A93 J;  4ZZD A;  3BJ6 A;  1QNT A;  2EFQ A;  3O8H A;  3EET A;  1J9I A;  1X2M A;  3T5X A;  2BW3 A;  3WTV C;  1A31 A;  1V5F A;  3GTQ J;  1FOK A;  3TW6 A;  1UEL B;  4YRV A;  4LMY A;  4LGW A;  1EKE A;  2V1X A;  3RKY A;  2LKS A;  2V6E A;  3OYB A;  2LRE A;  3BCA A;  2PX9 A;  3COA C;  2ZC2 A;  5HS7 A;  2GLO A;  1FEX A;  5D6F A;  3L2C A;  5B1B H;  2L02 A;  1R4N B;  1IW7 F;  2FX0 A;  5IOY A;  4ZZL A;  2PLY A;  2EFP A;  3VWB A;  4HNU A;  5E3N A;  3ESW B;  2P5L C;  3AL0 C;  1O4X A;  4NDL A;  2ESH A;  2L7K A;  3OYK A;  2ELK A;  4KT5 C;  3CME I;  2CWE A;  2X1E A;  9ANT A;  3ZR8 X;  3OYH A;  1IUY A;  4KMF A;  3E0J B;  1ACI A;  3ZMU A;  3MN2 A;  2DPU A;  3CZ6 A;  1KGS A;  4BHB A;  4EJO A;  1Y39 A;  3R61 A;  2GQQ A;  3CCY A;  4B4C A;  5GAD J;  3GBG A;  4CXF A;  1ZGJ A;  3FKJ A;  2IA0 A;  3GZ6 A;  3LAJ A;  2M5W A;  3OL4 A;  3CES A;  4AVP A;  3G1L A;  3CC7 I;  4BEH A;  3C2H A;  4ESJ A;  2XUB A;  3L09 A;  2RNG A;  1R5I D;  3FMR A;  4BJ6 C;  4KJZ A;  4N9H A;  1V5G A;  4XL9 A;  4QIW N;  1UAA A;  1GV5 A;  3D0S A;  3FIS A;  2H6B A;  1T0F C;  5F27 A;  2V9K A;  5H20 A;  1TT0 A;  5AIQ A;  2X6O A;  1LEA A;  5B66 C;  4G7O F;  2EJR A;  1I1S A;  2FA5 A;  1POG A;  5J8F A;  5IT9 K;  5LEK A;  1RUN A;  1YG2 A;  4RAY A;  2Y48 A;  1YO5 C;  1JGG A;  1Z21 A;  3ABM H;  2HR3 A;  4BXU A;  3CCL I;  1TQM A;  3ASN H;  3ZQF A;  3KX2 A;  1P92 A;  2DOD A;  4J19 A;  3U1K A;  3WU0 A;  2CV0 A;  2L4M A;  4AUX A;  1BJZ A;  4HLY A;  2DMP A;  3E6M A;  5IYB J;  1Z9C A;  3OYF A;  2A05 A;  2CFO A;  4E70 A;  2IA2 A;  3S17 J;  2VBY A;  3MCZ A;  1ZGA A;  3F21 A;  2MD0 A;  5FB2 A;  2X51 A;  4PSW A;  1LJ9 A;  3KEO A;  2IRF G;  4BE0 A;  1FJL A;  3OYI A;  1HCR A;  3BTL A;  3VEP A;  5LRR A;  2BYV E;  4CUG A;  2OPT A;  5DV5 A;  4N9I A;  3OSF A;  2W57 A;  3K2Z A;  1XTA A;  1MJ9 A;  4MTE A;  1X3U A;  4KYW A;  2M3A A;  1L3L A;  4E7K A;  1YW7 A;  4BY7 J;  4M73 A;  1B59 A;  4UHT A;  2ISZ A;  1A35 A;  3CF2 A;  1I1G A;  4CZC A;  3DPL C;  2Z9O A;  2O61 A;  2CQX A;  3SEZ A;  3UNG C;  2R7R A;  1VQM I;  2KRF A;  2E71 A;  3RIR A;  4RB1 A;  5BS6 A;  1BIA A;  3V42 A;  2E19 A;  4BL0 B;  2KLO A;  1X58 A;  3BJO A;  1OR7 C;  4LIT A;  3ZQI A;  1G4D A;  4BY1 J;  5E1Z B;  2IVM A;  3M07 A;  3RYR A;  4LOC A;  5F6F A;  1R7J A;  2QEX I;  5H2F C;  4IVN A;  2R7X A;  1T33 A;  4NB5 A;  2RKH A;  4F92 B;  2LSO A;  3JRI A;  3HIF A;  3BR1 A;  3PSF A;  2HDD A;  4L9N A;  2R0Q C;  4BQA A;  2R7Z J;  3G73 A;  3CLO A;  5TGT A;  2LY9 A;  2Z5U A;  2ADU A;  3AG3 H;  2FRH A;  3JTG A;  2BBY A;  4HYE A;  1ZH5 A;  2FU4 A;  2M30 A;  2NS7 A;  3W2W A;  5EYR A;  1TP4 A;  1MJA A;  4XLC A;  4JX4 A;  1DP7 P;  2ME6 A;  5E3M A;  2ESN A;  3M1C A;  4IHX A;  5JVG F;  4L9T A;  3HOW J;  3BPX A;  1S6L A;  4GXO A;  4GFB A;  1QA6 A;  1Z3X A;  4ENN A;  2VJ4 A;  1LDD A;  3OR2 C;  1IO2 A;  2EZH A;  4A3L J;  3IKV A;  5F08 A;  2M0M A;  2XV4 S;  3MMY B;  1G59 A;  4O3M A;  1FSE A;  3BC8 A;  1HXD A;  4DBQ A;  3HTU A;  3S2D J;  4LG0 B;  3HUG A;  3OOP A;  3CDI A;  4IHW A;  4U0V A;  2R7Q A;  4OIQ F;  2DT6 A;  4NC8 A;  3CCQ I;  4XK4 A;  5EJC A;  4AU7 A;  2V4J C;  5L3D A;  2VJI A;  2B63 J;  4A0Z A;  3RKQ A;  2VC0 A;  3HBL A;  2K02 A;  1LQ1 A;  4XR6 A;  2V7F A;  5GP9 A;  4YFK F;  3F8M A;  5C44 J;  5HNF A;  1HKQ A;  5JHF A;  4PZJ A;  3K70 D;  1BOB A;  3VFZ A;  1BR2 A;  2GIZ A;  4E7H A;  3S8P A;  3F8F A;  2QCO A;  2UXN A;  1G3S A;  3CDH A;  2VLA A;  2DFE A;  3ECO A;  3BZC A;  5LD2 C;  1ENH A;  3H92 A;  3LSG A;  3CJN A;  3ELK A;  4LIU A;  4QWQ A;  2EWN A;  2HNH A;  4I2O A;  3W2V A;  1X1P A;  1XMX A;  2HXO A;  1CF7 B;  5J40 A;  2EBI A;  1IN8 A;  2XB5 A;  3JSP A;  1MSE C;  3GO5 A;  2NNN A;  1U9N A;  5D5U B;  1ZRF A;  3GW2 A;  1K78 B;  2O8X A;  3HXL A;  3KIO A;  3P7N A;  2P5K A;  4G12 A;  4XSX F;  4PFO A;  4DIQ A;  2MG4 A;  3WGI A;  4HOB A;  4GO1 A;  1HOM A;  3LFU A;  3M9A A;  3CD6 I;  5ICG A;  3Q9V A;  5JI6 A;  3I58 A;  3C2B A;  1ZTR A;  1ZRC A;  3D1N I;  2OZ6 A;  2AXT C;  2FBH A;  1YRN B;  2BGC A;  2KQR A;  4I99 C;  4JOM A;  5GPC A;  1F43 A;  1N25 A;  2JZY A;  3WGG A;  2V79 A;  3GCM A;  2DA2 A;  2L0K A;  3OIP A;  4EJU A;  1S7E A;  1XN7 A;  2PFB A;  1K4T A;  3M8E A;  3R4K A;  4CGZ A;  5FLM J;  3K4M A;  4XN3 A;  4ZDL A;  4CYC B;  2VPR A;  1O3R A;  4BS9 A;  1QGP A;  3K4J A;  2VT3 A;  4B43 A;  2P5V A;  1IXS B;  2QQ8 A;  5KVR A;  2E5N A;  2ZNY A;  2M34 A;  3PUB A;  1OLT A;  4C2M J;  3DBH B;  5E17 F;  4DNC A;  1ETQ A;  3IC7 A;  5CVI A;  3ZN1 A;  2FJ1 A;  2EFN A;  2OF7 A;  4Y7N J;  5FKK A;  1HDP A;  5EF6 A;  1O3S A;  3KE2 A;  1Y56 A;  3G3Z A;  3M4O J;  2O5R A;  5KAI C;  1K79 A;  3RI4 A;  4IOC F;  4N0B A;  2H8R A;  2JVH A;  1Q1V A;  3M7G A;  4E7Z A;  3E6C C;  4U88 A;  3K4K A;  2D45 A;  3RYP A;  1OMI A;  3EQL F;  4B47 A;  3IH3 A;  3ZQL A;  2FOW A;  4AD9 A;  2L7Z A;  5K5R A;  1ETO A;  3FBI B;  2VKE A;  1W7P D;  4XSZ F;  1BC7 C;  4RMN A;  2NVY J;  3K1M A;  4DYC A;  1RRJ A;  1U2W A;  4ZTF A;  2NXN B;  1Z0X A;  1YE9 A;  3GTJ J;  1FBU A;  4X0G A;  1ETX A;  3BR2 A;  2I5U A;  4KN4 X;  3SZP A;  1SD6 A;  2HQ5 A;  4ON0 A;  2VOP A;  1QRY A;  5L3G A;  2VE9 A;  1R1T A;  5CJ9 A;  2DJI A;  3V8J A;  4BQQ A;  1OR7 A;  3KLO A;  3OWT A;  1DU0 A;  2FML A;  3LSK A;  3CCV I;  1U8B A;  4IQ4 A;  1GXQ A;  3LMM A;  2MC4 A;  1PVE A;  1XS9 A;  2CH0 A;  3D5L A;  2F4I A;  2ZKZ A;  2ELJ A;  1WI3 A;  1QZE A;  2LF7 A;  2QQA A;  2X6Y A;  2Y0S N;  3C1D A;  2K3P A;  2HOS A;  2STW A;  4RM3 A;  4KIB A;  1MNM C;  4A0X A;  5KHD A;  1ZEL A;  2CFX A;  1YLF A;  2Y75 A;  3F9K A;  5F04 A;  2NVU B;  2G9W A;  2CUF A;  2X48 A;  2CO5 A;  4F7Z A;  1YW9 A;  2EA4 A;  2W4S A;  4ZC3 A;  5B5E C;  3LFK A;  2DOF A;  3LQQ A;  1WGX A;  2UZK A;  2VBX A;  3BR6 A;  3AG4 H;  4EQQ A;  3CO6 C;  1R5H A;  3IL2 A;  2YU3 A;  1TL8 A;  4QPQ A;  3F22 A;  4L0Y B;  2HVQ A;  2CS3 A;  1OYI A;  1ZG5 A;  2VQL A;  3LAP A;  5E3L A;  3IWF A;  2MLK A;  2VOD A;  4UUT A;  3HOZ J;  4UUS B;  4F3Q A;  1RET A;  4B1R A;  1IC8 A;  3SZG A;  3A01 B;  2DYS H;  2LTP A;  2NVT J;  3ERM A;  3PJR A;  2QGU A;  2UXX A;  2YSR A;  5J4Y A;  3KZZ A;  3H5R A;  4XOR A;  4HST A;  5CQG A;  3J81 Z;  1CQT A;  3CUO A;  2X85 A;  3HSR A;  3R0J A;  4L9J A;  2DDA A;  1L0O C;  3FIW A;  3HOX J;  2VKV A;  1IGN A;  4Y52 J;  1P2F A;  3HM5 A;  4UVC A;  3L2V A;  3P9C A;  2EK5 A;  4BE2 A;  1R00 A;  2X4H A;  2DXI A;  1T6S A;  1VQ8 I;  2R7D A;  3ZMD A;  4FAS D;  3ZPL A;  4HV6 A;  3DF8 A;  1VI0 A;  5CKT A;  2KT0 A;  3RDI A;  5M3F J;  3DLA A;  5J3L A;  1H9T A;  1YJ9 I;  3H36 A;  4DYR A;  1BW6 A;  2EB7 A;  3C7J A;  2BXZ A;  4XN0 A;  2QA4 I;  3TO9 A;  2ZFW A;  1SFU A;  1KU9 A;  2ZXW H;  3V7C A;  1R6R A;  2IXS A;  2E35 A;  3H5N A;  2HKO A;  3KP4 A;  3O8G A;  2R7U A;  1IRZ A;  5D5V B;  2MAB A;  4H0E A;  3HYI A;  1B6A A;  1WSU A;  2JRT A;  1J7K A;  1W36 C;  3F23 A;  1G3W A;  2TRT A;  1BL0 A;  2DA4 A;  5EZG A;  2OAZ A;  2W82 A;  1MND A;  3S1Q J;  1J75 A;  1QQI A;  4IJA A;  2HXI A;  2JA5 J;  1LFP A;  3DPT A;  1W7P A;  4L5J A;  3GUD A;  1ZG1 A;  5HLI A;  5IY5 H;  4BBR J;  2LRD A;  1HW5 A;  1FIP A;  3L9F A;  1ZRD A;  3H9J A;  3DCF A;  3KFW X;  4HNV A;  2BHY A;  2VXZ A;  4CDG A;  4DBR A;  1JKP C;  3EYI A;  4AIK A;  3HEF A;  2Y69 H;  4AYB A;  4CA0 A;  2DA1 A;  2R5Y B;  3MZ8 A;  2W24 A;  3SJM A;  1B8I B;  3GTG J;  3S16 J;  4EM2 A;  5KAF C;  4HF2 A;  3ZRG A;  4LK0 F;  3JRG A;  2DQL A;  1LE8 B;  2JQ7 A;  2L2O A;  1CGP A;  2LC2 A;  1FBS A;  2W84 A;  4JX5 A;  5F1R A;  1JHH A;  1KYW A;  1KQ8 A;  2M0C A;  1J5Y A;  3L2Q A;  1VQN I;  1X3Z B;  3U21 A;  1BOA A;  2VJJ A;  3HJE A;  3L00 A;  5LGN A;  1TWA J;  3BZK A;  5C3E J;  2NOJ B;  2AXL A;  4I76 A;  3H3U A;  4BHP A;  2RC4 A;  4I7H A;  2OU2 A;  4V19 K;  3ASO H;  3S1N J;  5E18 F;  3CCM I;  1XDU A;  2O3F A;  1FIA A;  3CQZ J;  4FQG A;  2H1L A;  2DAO A;  4BH9 A;  3LOC A;  2LK2 A;  2B9S A;  3M3Y J;  5HDN A;  4XKV A;  3AG1 H;  1V3F A;  2RNJ A;  4XOT A;  1RUO A;  5TRD A;  5JFR A;  3FXO A;  4L5E A;  2E1N A;  4Z6Y A;  2VI6 A;  3DTK A;  2GA1 A;  4CSW A;  2LD5 A;  1EH8 A;  3SFI A;  2HTJ A;  3OYD A;  3H1C A;  3J7Z I;  2AO9 A;  3ECH A;  3GX4 X;  1FYL A;  1YHQ I;  4A3C J;  1W1W E;  1GV2 A;  5F0C A;  3I53 A;  4JK1 X;  2GWR A;  4OIN F;  5ILV A;  3L7W A;  2I8D A;  5DDG A;  3VPR A;  5BMZ A;  4LFU A;  1BW5 A;  3LST A;  4DW6 A;  4HX8 A;  3PQK A;  1SD7 A;  2X6X A;  3PL8 A;  4II3 A;  5HOD A;  4XM3 A;  4KIG A;  4BKX A;  2JSP A;  5GTH C;  1OFC X;  2HI3 A;  4LB6 B;  5HVQ C;  5LFA A;  3CMA I;  1E3O C;  3RKW A;  2E2I J;  5J1R A;  2XGX A;  2A5W A;  4JQF A;  1DP3 A;  3JSO A;  1AWC A;  4LG3 A;  5IP9 J;  2IP2 A;  4L18 B;  1MMS A;  3MWM A;  2K9N A;  1X4O A;  1WZ2 A;  1U5T A;  1JUP A;  4V2G A;  1Z67 A;  4E7L A;  2EV0 A;  3S93 A;  2GIV A;  1OKR A;  1BR1 A;  2V1U A;  3S32 A;  3EUH C;  2R5Z B;  1WJB A;  2A6H F;  4M9S A;  1KQ9 A;  1T2K A;  4IRH A;  1WQ2 A;  4JP0 A;  5FLV A;  2KJB A;  4CCJ A;  5L3B A;  1QBJ A;  3ZMV A;  2ZME B;  1S5L C;  2O8K A;  2JSC A;  4D7M A;  1EV7 A;  2RQP A;  2WAD A;  4RM2 A;  3KCC A;  4PGH A;  1HC8 A;  3KLN A;  3HSF A;  3T0Y A;  4IHS A;  4XQF A;  4CCM A;  4AIH A;  2YPR A;  1IV6 A;  1XPX A;  3O6B B;  2EV5 A;  1IUF A;  4I98 B;  2QLZ A;  1H9G A;  2JA7 J;  3ZQQ A;  3HRU A;  2E1M B;  2XGE A;  4I6Z A;  1U9O A;  3BWG A;  1VTN C;  2M7A A;  2H1K A;  1NG7 A;  1JUM A;  3OS0 A;  1LPQ A;  3B73 A;  5ERI A;  1YX5 A;  2NS0 A;  4PUS A;  1TLH B;  1XGO A;  3FXL A;  4JYK A;  3QP6 A;  5F1J A;  3LA7 A;  2YUS A;  5LHG A;  1FP2 A;  2IW5 A;  5LHI A;  3HL2 A;  4BAC A;  2UV1 A;  3JAM Z;  3N4M A;  3FZV A;  4D1Q A;  3PQJ A;  3PSI A;  2XDV A;  3P5J A;  1Y1V J;  1Z6T A;  1Z1D A;  2A6T A;  2JA2 A;  3HSE A;  5BPD A;  4Q5S F;  2A5Y B;  4D0P A;  4P96 A;  1QHG A;  2EFO A;  2HYJ A;  4ZYD A;  2PJR B;  2RDP A;  3OS2 A;  5L3F A;  5D5X B;  4F93 B;  1PUF B;  2XAG A;  2MGQ A;  1Z77 A;  2QZ8 A;  3TQN A;  1SC7 A;  1JXS A;  1B1B A;  4M3D A;  1E3P A;  2E2J J;  4MFE A;  2OCE A;  3DV8 A;  5K7H A;  2WWY A;  2HOT A;  5E1W A;  4N4N B;  2XPV A;  3E5X A;  5FFZ A;  4FET A;  1G3T A;  1KA8 A;  3BG6 A;  1AHD P;  3R60 A;  4ASN A;  4YIF A;  2LKP A;  2CV1 A;  4BAY A;  1U3E M;  2F5E A;  3HOS A;  2QUF A;  3K1N A;  3DXJ F;  3PIP F;  1QPI A;  3V4G A;  1TBX A;  2ICW G;  2L7M P;  5EGO B;  3HKZ N;  4CCO A;  1CF7 A;  1U0J A;  1QU3 A;  3QU6 A;  4HRI A;  2P81 A;  2ZJR F;  2Y9Z A;  2NVQ J;  2LNB A;  3F6V A;  2HDW A;  4I01 A;  5TJJ A;  1QHH D;  1ODD A;  5FLX Z;  3S3M A;  2TCT A;  3WTZ A;  1BI0 A;  4Y3O A;  2IT0 A;  3FMQ A;  2OA4 A;  3PFY A;  3S15 J;  2OQG A;  3BG7 A;  1PJR A;  1MW7 A;  1WJ5 A;  1P7J A;  2ZJQ F;  1FMV A;  5HS9 A;  4XLA A;  3U9G A;  3W2A A;  5BQT A;  3ZMT A;  1OCO H;  1LFU P;  2KIQ A;  3SYT A;  5CVU A;  2OBP A;  1BM9 A;  5DD8 A;  1YJW I;  4RGX A;  5HLH A;  4KNY A;  4B3A A;  3CC4 I;  3W6K B;  2Y31 A;  3E97 A;  2L3D A;  1YRN A;  3OOU A;  3G2B A;  4E6K G;  2RRE A;  4HSR A;  1YJN I;  2K9L A;  2B0L A;  2HKX A;  3MKW B;  1KON A;  3CUQ C;  2NOG A;  2QEN A;  3J81 K;  4RDU A;  3MKZ A;  4XOP A;  4D5C A;  3GFL A;  2FUG 2;  2LH9 A;  2LBF B;  2I10 A;  2XAH A;  3A2K A;  3I56 I;  1HQC A;  1VQO I;  4BDY A;  4R79 A;  4CYC A;  3CF5 F;  4M6V A;  5FRO A;  2J5P A;  2CGP A;  3NAU A;  5JVT A;  2VC1 A;  4Q48 A;  2IS4 A;  3HPG A;  2ECC A;  4OIO F;  1FT9 A;  3LA2 A;  2XIG A;  3IKT A;  1E3H A;  3K10 A;  1OCR H;  3VYS B;  2RAE A;  2V9V A;  1N75 A;  4BQN A;  5DD4 A;  3W3C A;  2K86 A;  3TGN A;  2PN6 A;  4KFC A;  1DU6 A;  5H6Q A;  2WY8 Q;  5J4V A;  1VQ7 I;  1OJL A;  3G6E I;  2HZD A;  5DUK A;  3HPH A;  4B44 A;  4YG2 F;  3IP4 B;  4O5V A;  3QOP A;  4KMU X;  4UY8 I;  1D0Z A;  1MJB A;  4Q4Z F;  3V8K A;  2FXA A;  1U8R A;  3VB2 A;  4PGG A;  3P9I A;  3J80 K;  4P1W A;  1WFX A;  1TW2 A;  3FWE A;  4CCK A;  3H9Q A;  4HQE A;  4R1H A;  5DCM B;  4MO7 A;  2WTE A;  1IG7 A;  1FOW A;  2NNY A;  4CYD A;  1T08 B;  1FTZ A;  3I54 A;  3IRQ A;  2QQB A;  1FYK A;  4BXX J;  1IXR C;  3LWF A;  1KYZ A;  2GOX B;  2C6Y A;  3GTL J;  3I5U A;  2MYS A;  2DA3 A;  3CP8 A;  3I4M J;  4XBF A;  4RB3 C;  2XAQ A;  2HQN A;  2D2W A;  4M6X A;  3ZMS A;  2ZSI B;  1JT0 A;  1JKR C;  5J1U A;  1VQ6 I;  3MVP A;  2FBK A;  2Q2E B;  4BBS J;  3SHF A;  4U0W A;  4KUM A;  4HZF A;  2K5C A;  3TO6 A;  3OV8 A;  1KU2 A;  3A4C A;  1WVR A;  3GFM A;  2ZSH B;  3RPQ A;  4WK8 F;  2P6S A;  2OTL I;  3SFZ A;  5D8L B;  1TWG J;  5FD5 A;  4IQJ A;  5K5Q A;  3MQ0 A;  3S1R J;  1RR8 C;  2VL8 A;  1M1E B;  3CJQ B;  1O57 A;  4IRI A;  2E7W A;  4DOZ A;  1RPW A;  1FPQ A;  3RJP A;  3VSL A;  1NK2 P;  3DQV C;  4HNT A;  1O3T A;  3DBR B;  3QPH A;  4LK1 F;  3RQI A;  3TO7 A;  3E6B A;  4NHJ A;  2FSW A;  3CP2 A;  2K40 A;  4MHG A;  1Q1H A;  4GRI A;  3IWZ A;  1YX3 A;  1TT5 B;  1GT0 C;  2ZME C;  3QPT A;  5DM6 F;  3PM1 A;  2O6G E;  2BVM A;  3VYT B;  3F8N A;  3C3W A;  4DZJ A;  1I5Z A;  2HPI A;  2X6W A;  1FOY A;  2AHQ A;  2JPB A;  2EPF A;  1GDT A;  3AFH A;  2DFF A;  1NG6 A;  4G9Y A;  2E1M C;  4J01 A;  5CVV A;  4ZYA A;  1V4R A;  4UUS A;  3ONQ A;  3B6C A;  1DDN A;  2M4G A;  3BOQ A;  2F5V A;  4W1U A;  4XLF A;  5HDK A;  4HX7 A;  1EA3 A;  1X3W B;  2OTJ I;  4BQO A;  1HF0 A;  1UB9 A;  4P9U A;  4I02 A;  1QVT A;  3FXQ A;  4V2F A;  4Y33 A;  1Z05 A;  1J09 A;  1KU7 A;  1FZP B;  2NYX A;  5C4J J;  2WB1 A;  4XRM A;  3FDY A;  5F64 A;  4IOA F;  3ML6 A;  4M71 A;  5IOZ A;  5A2Q K;  5EEG A;  2XKO A;  2P7C B;  5D4S A;  3PO2 J;  1S7A A;  2W85 A;  3QQA A;  3A1Y A;  5HNH A;  5C4X J;  4A3D J;  3K4L A;  1TNT A;  2BE5 F;  4HX4 A;  4IRG A;  3N97 A;  3JRC A;  1NHA A;  2L7F P;  3CCU I;  2QBY B;  4XRS A;  1YW8 A;  5J8C A;  3RSN A;  1TWH J;  4RB2 C;  4PFP A;  4FX4 A;  3UKG A;  4QLC U;  4IZZ A;  1S8N A;  2JVG A;  3BQY A;  2IBD A;  1MDM B;  2QKM B;  4UV8 A;  4EJV A;  4NC7 A;  4YFX F;  2DOE A;  3GZN B;  2EV6 A;  3E1S A;  1JE8 A;  5J6X A;  1PUE E;  1DGR M;  4XLN F;  2VQH A;  5HDG A;  3BLY A;  3DLL F;  4HA8 A;  1SMY F;  2RQQ A;  3JRF A;  4CO8 A;  3QOE A;  2LOO A;  4UB6 C;  3TP3 A;  2KIF A;  1T0F A;  3I71 A;  1FTT A;  3ISP A;  1D1B A;  3P9K A;  4FE7 A;  4FX0 A;  2GXG A;  2WAQ N;  2PBI A;  2Z2S B;  3G71 I;  2Y30 A;  3W6V A;  1A36 A;  2B7E A;  4EM0 B;  3BPV A;  3F8C A;  4EJW A;  2MSY A;  1MMA A;  3K9T A;  4HG2 A;  3WTT C;  4YEL A;  1R58 A;  3B02 A;  1V54 H;  3GTK J;  1FX7 A;  2IGK A;  3G1O A;  1PDN C;  2WV1 A;  2VBZ A;  1FC3 A;  3H0D A;  1JJ8 C;  1AA7 A;  2KZV A;  4ZH4 F;  4BUP A;  2UUZ A;  1G6N A;  2O0Y A;  5HLT A;  3OS1 A;  4TV7 A;  5E8I A;  4A3G J;  3EUA A;  1D0X A;  2CW0 F;  2F5D A;  2X9D A;  4HDU A;  4AID A;  3BCB A;  1WRJ A;  4CH7 A;  3JAM K;  5J47 A;  1USS A;  3QPS A;  4BJ5 C;  3IUO A;  4U7D A;  2R5Y A;  2DLL A;  4S05 A;  3IAM 2;  3NWS A;  5HS8 A;  3ZQC A;  4E7S A;  4M3E A;  2QF7 A;  1WCM J;  2DU9 A;  1JTY A;  3HGY A;  3WGH A;  3WG9 A;  4QTR A;  2ZXI A;  4EGZ A;  1ETW A;  1LE8 A;  3WTW C;  1MZB A;  1VQP I;  3QU3 A;  2EIJ H;  3GFJ A;  2QQ9 A;  2HWV A;  1JKQ C;  4P5O A;  2L9N A;  2Z1D A;  3OYM A;  3EUK L;  4A6E A;  1YS6 A;  3JW4 A;  1XGM A;  1XMK A;  2FE3 A;  1EJ9 A;  4M3B A;  2RVC A;  2DA6 A;  1OCP A;  2OCC H;  5DUI A;  3RZD J;  2CW7 A;  4UXN A;  4XLP F;  1K6Y A;  2NAZ A;  4BYY A;  4OU0 A;  2DMQ A;  3WE2 A;  3WTS C;  2VPL A;  4ENJ A;  2PJP A;  3OL3 A;  3FBN B;  3SDG A;  2CU7 A;  3S3O A;  5FKL A;  3DKW A;  1W5C C;  1D8K A;  2MW8 A;  1IV8 A;  5DS9 A;  4RA2 A;  2BVL A;  4JX6 A;  1MBF A;  4U7B A;  2LP0 A;  5LGT A;  1KQ0 A;  1BJA A;  4G8X A;  2BEO A;  2E60 A;  3U2R A;  5BPI A;  3QYB A;  2DI3 A;  2ZXJ A;  4GGG A;  4HV5 A;  1R22 A;  4L0Z B;  1A6I A;  1DPR A;  3CJR B;  4RGR A;  1C0W A;  2OV7 A;  2PMZ N;  1MBG A;  3CTA A;  1Y8Q B;  2DMU A;  2HQR A;  4PJL A;  4B48 A;  3CC2 I;  4CCN A;  2XF5 A;  3HUG B;  4NNJ A;  3HOU J;  1K61 A;  5JR3 A;  1I6X A;  4G6Q A;  3CJT B;  2M2E A;  3BDD A;  1R9T J;  4M3G A;  4S04 A;  4S0H B;  4A3J J;  5E79 C;  2E5Z A;  3HHH A;  4LD5 A;  2LYC A;  3FHN A;  2XRL A;  3HGG A;  2DBB A;  1ZHF A;  5IT9 Z;  2COB A;  1XG1 A;  4WX9 A;  1LFB A;  2CQN A;  2Y2Z A;  2KP6 A;  4W97 A;  4X6A J;  3FK7 A;  1UMQ A;  2R5Z A;  3DKX A;  5IT3 A;  1XMA A;  2D1V A;  1XSV A;  2A61 A;  4KN7 X;  3CCJ I;  2KIM A;  2K9Q A;  1HLV A;  2FEZ A;  2ZME A;  2L9R A;  2GAU A;  4WF2 A;  1FOX A;  2VIX A;  5K1Y A;  4XLE A;  3QPL A;  1Y1W J;  2V6C A;  5FRM A;  1IZ1 A;  5CLS A;  2QM3 A;  1REP C;  2H8W A;  2Z16 A;  3L2W A;  2DFI A;  4ZYH A;  3NWT A;  5B3S H;  1ZYR F;  4HF0 A;  3ZMZ A;  3L1P A;  2DW4 A;  2K85 A;  3VOD A;  5GAG J;  4IXA A;  2ZJ2 A;  2PQ8 A;  4Z2Y A;  4HF1 A;  3AG2 H;  2EQR A;  4I09 A;  3G4S I;  2IGN A;  1YQA A;  1ETV A;  3IAS 2;  3FF5 A;  4OAZ A;  4MTD A;  4GDF A;  3H3Z A;  1SEU A;  1ZQ3 P;  2TDX A;  1ZR2 A;  2CW8 A;  3MD2 A;  4E4H A;  4UV9 A;  4E7J A;  1A6Q A;  3DEW A;  5J1Y A;  2E7X A;  3KEY A;  4KA4 A;  2R7O A;  3BTI A;  2A6E F;  1WHU A;  4G6D A;  1YTY A;  2Q8K A;  1H88 C;  2PJR A;  4ESB A;  3FXU A;  1T56 A;  1V55 H;  2FNP A;  2XF6 A;  1QZZ A;  1XB4 A;  4Q47 A;  1GUU A;  3S3N A;  2Z3Y A;  5EEH A;  1TQP A;  3F8B A;  3KZI C;  2H27 A;  3ULQ B;  2XRO A;  2JUG A;  2KL4 A;  1OYW A;  5FGM A;  3TDU C;  1I6H J;  1Z3Y A;  2HFH A;  2CUE A;  1UJ8 A;  1WJC A;  3F3X A;  3K4B A;  1QZY A;  2KHM A;  1EF4 A;  2HVR A;  3CUQ B;  2ZNZ A;  3GLX A;  3K1P A;  3OYC A;  5EGO A;  1LVK A;  2KDO A;  2WC2 A;  5ICE A;  1T38 A;  2PEX A;  1H89 C;  1Z6R A;  1K83 J;  3IV5 A;  2DN0 A;  5AIP A;  1D5V A;  2VKH A;  4ZTJ A;  3TP0 A;  2M1B A;  4I0A A;  5E1X A;  5JLX A;  1IJW C;  4RAG A;  3LSP A;  4IL6 C;  1S7O A;  2MA3 A;  1HBX G;  5FKM A;  2VAS A;  3TW7 A;  1YI2 I;  4M9X A;  1G8X A;  2Z33 A;  3ZQH A;  5IP7 J;  1WJA A;  2W7N A;  4A3E J;  1LVA A;  5HLG A;  4R8H A;  1MMG A;  2XAS A;  3H0G J;  5LEJ A;  3N05 A;  2GZW A;  2BHZ A;  2HVS A;  4KIF A;  3FXM A;  4D9J A;  4NC6 A;  3BRO A;  2Q1Z B;  1UG2 A;  2QWW A;  1W36 D;  3HRT A;  2XHK A;  5FO5 A;  2P6T A;  2LBF A;  4M72 A;  1UFM A;  3Q0W A;  2WAF A;  4YEJ A;  2AS5 F;  2DT5 A;  3K6G A;  4PSX A;  4ZDP A;  1TWC J;  1OYY A;  1FYM A;  3DU5 A;  1AU7 A;  2G7H A;  3MFK A;  3DBL B;  3Q0U A;  5EG0 B;  1WH7 A;  2IGM A;  1XD7 A;  3AAF A;  1AKH B;  5LGU A;  2QKL B;  2M8G X;  4HAM A;  2QSF X;  4ZJZ A;  2WV0 A;  3TL4 X;  3B6A A;  2K4J A;  3KYD B;  1Z7U A;  5GAE J;  4KIT B;  2EH3 A;  3WU1 B;  1VQ5 I;  4Y15 A;  4WXD A;  2P0W A;  2L54 A;  3C18 A;  3TDZ C;  1XDS A;  2VBW A;  1H8A C;  1MIJ A;  1P9Q C;  3GLL A;  1ERD A;  3LNQ A;  3ABT A;  4RS8 A;  2F5C A;  2GXB A;  2HQA A;  4RAZ A;  5CPR B;  5FKO A;  1J2X A;  3R0A A;  1FLI A;  1Z7L A;  2ZCW A;  5DTD A;  4EEF G;  1B9N A;  5FD6 A;  1O7L A;  2LKX A;  3A03 A;  2HOA A;  4QPO A;  3CLQ A;  2DO7 A;  3E5U A;  1ETK A;  1XC5 A;  5D8K B;  2WY7 Q;  2DQR A;  5M3M J;  1FWZ A;  4LLG F;  2KIS A;  5EEA A;  4A3F J;  2L9S A;  2IJL A;  1E0E A;  1RNL A;  1WPK A;  3ABL H;  3WOD F;  3I55 I;  4C9Y A;  2LY1 A;  3OYJ A;  3BT9 A;  1R36 A;  2V9P A;  2HPM A;  2ECB A;  4GYG A;  1WJD A;  1RZ4 A;  1BBY A;  4MQ9 F;  5K5O A;  2HDC A;  1JKO C;  2ME0 A;  2ZFU A;  2JWT A;  1HDD C;  1LDK B;  3QRF F;  4M9Z A;  2DTR A;  1MBE A;  1W5S A;  4MFD A;  1B4A A;  5LHH A;  2V1N A;  2IEK A;  2M87 A;  3PUF A;  4YIR X;  3JR9 A;  2CYY A;  2FD5 A;  1JUS A;  4LG0 A;  1SVM A;  2CQK A;  1XSD A;  3M1E A;  3NAR A;  2DDB A;  2OZU A;  4G7Z F;  3S2W A;  1I50 J;  1OCC H;  2K9M A;  4C3J J;  1MD0 A;  1ITY A;  2XF7 A;  1ON2 A;  3O3K A;  4ETS A;  5M5X J;  1SVL A;  2PMU A;  3LA3 A;  3QYE A;  4XRF A;  3IHU A;  2RN7 A;  3PNV A;  1IXC A;  3NEU A;  4BDZ A;  1TQI A;  3FMS A;  1XSX A;  4PK4 A;  2HZT A;  3CO7 C;  2CMP A;  4XIC A;  4PDK A;  1GLN A;  1APL C;  2UWM A;  1IDY A;  4L9V A;  4IHV A;  3DPU A;  3RQ4 A;  1YFH A;  1D0Y A;  3CMM A;  2M8E A;  3QAH A;  3I3L A;  3SZT A;  2KIU A;  1N77 A;  2JRM A;  2DOA A;  2E1C A;  1ZLJ A;  4Y4R A;  5L3C A;  3HOY J;  2O9L A;  3SXY A;  1A04 A;  4ABZ A;  1XX5 A;  1W7P B;  2XC7 A;  2QSH X;  2A3S A;  1IN7 A;  2R4G A;  2LR8 A;  4ZYE A;  2K9S A;  1A5J A;  3OIQ A;  4PJJ A;  4M6Y A;  5GPA A;  2OUM A;  4RGU A;  1K78 A;  3TED A;  2A07 F;  3DWL E;  3MZY A;  4A5N A;  3GZ5 A;  4CIC A;  4DJA A;  3QYF A;  5ICC A;  3LSM A;  2HTS A;  5FFX A;  4A6D A;  2K4B A;  2QBY A;  2RV8 A;  3BQZ A;  3OYG A;  2X0L A;  3A02 A;  2HU9 A;  1MMN A;  2VQC A;  3BTJ A;  1QPM A;  4RB0 A;  2P8T A;  3GTM J;  1MDM A;  1TWF J;  5FRN A;  3PNY A;  2VE8 A;  1KZH A;  1U78 A;  3R6S A;  1TNS A;  4ZYG A;  3OY9 A;  2M7B A;  1VQ4 I;  2E36 A;  2GBY A;  1P4X A;  5IPA A;  1T8I A;  2VN2 A;  4BJT A;  1V5E A;  5DEQ A;  3TKY A;  4N4O B;  2XGC A;  3KP5 A;  4K2E A;  3M8F A;  4RLF A;  2W1O A;  4XNF A;  3J7A O;  3K4C A;  1IDZ A;  4ANJ A;  1ZAR A;  1LEB A;  1F1Z A;  3BTC A;  3VOE A;  1RC9 A;  5DM7 F;  3JRB A;  4BU2 A;  1MGT A;  1XCB A;  1IN5 A;  2XB0 X;  3A0H C;  4FHT A;  2WB1 N;  4IO9 F;  3DEE A;  1X1D A;  1F4K A;  3K69 A;  3DU6 A;  4A0Y A;  2F6C A;  2XAU A;  4UVA A;  4XKW A;  2XAJ A;  5HOO A;  4I0B A;  4NQW B;  1NK3 P;  2O7O A;  2K7L A;  2VB6 A;  4HPQ A;  1IRF A;  1BN5 A;  5B1A H;  1SVO A;  4MEX F;  3VSK A;  2LVS A;  3WTX C;  4WXH A;  1WWX A;  1B72 B;  2A68 F;  1RES A;  4PCQ A;  1BI2 A;  5M5Y J;  2ACJ A;  3E3V A;  4OMY A;  2EIM H;  1FY7 A;  1ZGW A;  2M45 A;  2BZT A;  4IX7 A;  3WTU C;  3FM5 A;  1VQ9 I;  3I59 B;  2CUJ A;  2DA5 A;  5EZH A;  1U5T B;  2YX7 A;  3DP7 A;  3K70 C;  1X19 A;  2JUC A;  2MFZ A;  3BZ6 A;  3H9G A;  4A12 A;  1PP7 U;  2G0E A;  3HTS B;  5ILS A;  1YOV B;  2M4K A;  4LB5 A;  2Q0O A;  2JT1 A;  1I3Q J;  1ORK A;  5ICF A;  2DPD A;  3FXR A;  1OPC A;  2JA8 J;  3GFI A;  3ZCO A;  2IPQ X;  4G7H F;  2ZXH A;  4CHU A;  3KYL A;  3I4N J;  3EDP A;  2LLK A;  1U6G A;  2XSJ C;  2XRN A;  3CMY A;  1RR7 A;  1NTC A;  3IH4 A;  4MQV A;  2JJ7 A;  3EUH A;  5CVJ A;  2E34 A;  1EH6 A;  3VYR B;  3RCO A;  4YFN F;  2DFH A;  3F0C A;  3HRM A;  2IS1 A;  2BW3 B;  1YIT I;  3BR3 A;  4H4K C;  4C3I J;  2KMU A;  4B09 A;  3KYC B;  3HKZ A;  3I4P A;  2DK5 A;  3FXJ A;  3NRV A;  3CCE I;  4A3M J;  3KP3 A;  1ZN2 A;  3WHC A;  3ZOB A;  2HOE A;  4EGY A;  1T39 A;  2F5F A;  1IF1 A;  2IS2 A;  1MMD A;  3TOB A;  1TZL A;  1W5T A;  4M3F A;  4BE1 A;  4C3H J;  3MKY B;  5CVR A;  1O3Q A;  3KP7 A;  3DTI A;  4NBQ A;  4A2U A;  1OCZ H; 
#chains in the Genus database with same CATH homology
 1TTY A;  3KP6 A;  1UST A;  2ZO4 A;  2MC3 A;  1HKT A;  3V8L A;  4GCV A;  2Z99 A;  1BI1 A;  1FSH A;  3HOT A;  3PFI A;  3FHZ A;  1RI7 A;  3KET A;  2O03 A;  1W4M A;  2QVO A;  4P55 A;  4YII A;  1UCR A;  5D4R A;  2P7V B;  2XKP A;  2GA2 A;  4LLN A;  4AIJ A;  2OQR A;  4ENM A;  2ISY A;  3RKX A;  1FNN A;  2PG4 A;  3I64 A;  4M74 A;  1DUX C;  4B8X A;  1S3J A;  5BOX A;  4LLL A;  1J59 A;  3FX3 A;  1I27 A;  1IAW A;  1YS7 A;  3E6D A;  5D6E A;  5DCF A;  2FBI A;  4JBA A;  4MGR A;  1HSJ A;  2H94 A;  1YYV A;  2W25 A;  1K6O A;  1E17 A;  2VON A;  1Y0U A;  2FQ3 A;  3WTY C;  2VOO A;  1FP1 D;  1G3Y A;  4IF4 A;  5LBQ A;  2J5O A;  1LB2 A;  2JTV A;  4ENK A;  2P4W A;  5KK1 A;  3T8R A;  1HST A;  1QO0 D;  3Q9S A;  5JHU A;  1JGS A;  4HW0 A;  3CUQ A;  4OIR F;  1UHW A;  3KP2 A;  1ONV A;  3EYY A;  2JPC A;  4IPA A;  4DQ2 A;  2PMH A;  5CYV A;  1SAX A;  1UHM A;  2RGV A;  3HRS A;  4EV0 A;  3LQR A;  5E20 A;  3I0T A;  4EVI A;  3Q5F A;  1K7A A;  4HLX A;  2YX4 A;  4AWX B;  2R7F A;  5DYM A;  4BHC A;  4EJT A;  2G7U A;  2KJC A;  3V7S A;  4LJZ F;  1P4W A;  1LNW A;  1HW1 A;  1MKM A;  1TW3 A;  3GWZ A;  1R1V A;  2F2E A;  5FLX K;  1H0M A;  3ERE D;  1GVJ A;  5ILU A;  4U0Y A;  2H09 A;  2L01 A;  1U5T C;  3F6O A;  4WCG A;  3BP8 A;  5D5W B;  2CSO A;  2H6C A;  3BJA A;  2NRA C;  4UNO A;  5LRS A;  1IN4 A;  3NQO A;  1B9M A;  2HS5 A;  1D8J A;  2QYO A;  2Y0M A;  1D3Y A;  1ZAO A;  2KKO A;  4P9F A;  4MEY F;  1HW2 A;  3BY6 A;  3QP5 A;  4OMZ A;  2FOK A;  3GVA A;  4GYI A;  1WKM A;  1F5T A;  3W6J B;  2LDU A;  1LDJ A;  4L5I A;  1F9N A;  1P6R A;  3JTH A;  3REO A;  1R1U A;  4ESF A;  4IHT A;  1T98 A;  4EM1 A;  3E5Q A;  5L3E A;  2R3S A;  4WWC A;  3F72 A;  4UUV A;  2HGC A;  1P4A A;  1O7F A;  2MH9 A;  1XGS A;  2FNA A;  1JHF A;  2HYF A;  2IA1 A;  2EFW A;  4O6J A;  3ABU A;  2HEO A;  3RTR A;  1IRG A;  1XCV A;  2YR2 A;  1Z91 A;  2FMY A;  3ZP5 A;  2L4A A;  3J80 Z;  3T1B A;  1PP8 F;  1SD4 A;  1FBQ A;  4EMS A;  3MZH A;  2CG4 A;  1EH7 A;  1J0R A;  1R23 A;  3K0L A;  1YIO A;  5LLQ A;  1SFE A;  3GF2 A;  1ZLK A;  4WXC A;  3V7R A;  2D1H A;  4G94 A;  4HQM A;  3O2P E;  2DK8 A;  3MAJ A;  4RGS A;  4A5M A;  2MLG A;  2XVC A;  3RPU A;  2ZBK A;  1SFX A;  4MNU A;  2HYG D;  3FM3 A;  4UVB A;  3MEX A;  4FT8 A;  4OOI A;  3ROU A;  5E8G A;  4HBL A;  5AON A;  1SD5 A;  2BV6 A;  3KEQ A;  1STZ A;  4HDV A;  3ZQ7 A;  2OD5 A;  3DFG A;  1ZG3 A;  1BC8 C;  6PAX A;  1ON1 A;  2LF8 A;  2FF4 A;  1IN6 A;  1WI9 A;  1BI3 A;  2V1D A;  3U1D A;  4Y13 A;  1GXP A;  2K27 A;  4KDP A;  1E2X A;  4Y17 A;  2MD5 A;  5H6R A;  1AOY A;  2MH2 A;  3HHG A;  2COM A;  3IRR A;  2VT2 A;  3DEU A;  5A2Q Z;  2MBF A;  2XAF A;  4NQW A;  2A69 F;  4OIP F;  3GYH X;  1BIB A;  5ED4 A;  1RIO H;  3TOA A;  1S29 A;  1ZRE A;  3WE3 A;  2ETH A;  2PI0 A;  5DCM A;  2STT A;  1ULY A;  2ELH A;  4KIC A;  3T8T A;  1GHC A;  3I59 A;  2EA2 A;  1SMT A;  4CZZ A;  3ZN0 A;  2Q2E A;  4BNC A;  1HKS A;  3GEZ A;  1KU3 A;  3GXO A;  1XGN A;  3KZY A;  1DPU A;  1R5G A;  3SQN A;  4ZZD A;  3BJ6 A;  1QNT A;  2EFQ A;  3EET A;  1J9I A;  3T5X A;  3WTV C;  1FOK A;  4LMY A;  4LGW A;  2V1X A;  3RKY A;  3COA C;  5HS7 A;  5D6F A;  3L2C A;  2L02 A;  1IW7 F;  4ZZL A;  2PLY A;  2EFP A;  2P5L C;  2ESH A;  4KT5 C;  2CWE A;  1IUY A;  4KMF A;  3ZMU A;  2DPU A;  1KGS A;  4BHB A;  4EJO A;  3R61 A;  2GQQ A;  4CXF A;  3GZ6 A;  1ZGJ A;  2IA0 A;  3LAJ A;  2M5W A;  4AVP A;  4ESJ A;  2XUB A;  3L09 A;  3FMR A;  4N9H A;  3D0S A;  2H6B A;  5H20 A;  5AIQ A;  1LEA A;  4G7O F;  2EJR A;  1I1S A;  2FA5 A;  5J8F A;  5IT9 K;  5LEK A;  1RUN A;  1YG2 A;  4RAY A;  2Y48 A;  1YO5 C;  2HR3 A;  4BXU A;  1TQM A;  1P92 A;  3WU0 A;  2L4M A;  4HLY A;  3E6M A;  1Z9C A;  4E70 A;  2IA2 A;  2VBY A;  3MCZ A;  1ZGA A;  3F21 A;  5FB2 A;  1LJ9 A;  3KEO A;  2IRF G;  3VEP A;  5LRR A;  2BYV E;  5DV5 A;  4N9I A;  2W57 A;  3K2Z A;  1MJ9 A;  4MTE A;  1X3U A;  4KYW A;  1L3L A;  1YW7 A;  4M73 A;  1B59 A;  4UHT A;  2ISZ A;  1I1G A;  3DPL C;  2Z9O A;  2O61 A;  2KRF A;  3RIR A;  4RB1 A;  5BS6 A;  1BIA A;  3BJO A;  1G4D A;  5E1Z B;  2IVM A;  3RYR A;  5F6F A;  1R7J A;  4IVN A;  4NB5 A;  2RKH A;  2LSO A;  3HIF A;  4L9N A;  4BQA A;  3G73 A;  3CLO A;  2Z5U A;  2ADU A;  2FRH A;  3JTG A;  2BBY A;  4HYE A;  1ZH5 A;  2FU4 A;  2M30 A;  1MJA A;  1DP7 P;  2ESN A;  4L9T A;  3BPX A;  1S6L A;  4GXO A;  4ENN A;  1LDD A;  3IKV A;  4O3M A;  2XV4 S;  1FSE A;  1HXD A;  3HTU A;  4LG0 B;  3HUG A;  3OOP A;  4U0V A;  4OIQ F;  5L3D A;  4A0Z A;  2VC0 A;  2K02 A;  1LQ1 A;  4YFK F;  3F8M A;  1HKQ A;  4PZJ A;  3VFZ A;  3F8F A;  2UXN A;  1G3S A;  3CDH A;  3ECO A;  3H92 A;  3CJN A;  3ELK A;  4QWQ A;  2EWN A;  4I2O A;  1CF7 B;  1IN8 A;  3JSP A;  3GO5 A;  2NNN A;  5D5U B;  1ZRF A;  3GW2 A;  1K78 B;  2O8X A;  3P7N A;  2P5K A;  4XSX F;  3WGI A;  4HOB A;  4GO1 A;  3M9A A;  5ICG A;  3Q9V A;  5JI6 A;  3I58 A;  1ZRC A;  2OZ6 A;  2FBH A;  2BGC A;  2JZY A;  3WGG A;  2V79 A;  4EJU A;  1XN7 A;  2PFB A;  3M8E A;  3R4K A;  4CGZ A;  1O3R A;  1QGP A;  2VT3 A;  2P5V A;  1IXS B;  5KVR A;  2ZNY A;  5E17 F;  4DNC A;  3IC7 A;  5CVI A;  3ZN1 A;  2EFN A;  1O3S A;  3KE2 A;  3G3Z A;  1K79 A;  3RI4 A;  4N0B A;  3M7G A;  3E6C C;  4U88 A;  2D45 A;  3RYP A;  1OMI A;  3EQL F;  4AD9 A;  5K5R A;  1W7P D;  4XSZ F;  1BC7 C;  3K1M A;  1U2W A;  1FBU A;  4KN4 X;  3SZP A;  1SD6 A;  4ON0 A;  2VOP A;  5L3G A;  2VE9 A;  1R1T A;  5CJ9 A;  3V8J A;  1OR7 A;  3KLO A;  2FML A;  1GXQ A;  3D5L A;  2ZKZ A;  2QQA A;  2LF7 A;  3C1D A;  2STW A;  4KIB A;  4A0X A;  2CFX A;  1YLF A;  2Y75 A;  2G9W A;  2CO5 A;  4F7Z A;  1YW9 A;  2EA4 A;  3LFK A;  3LQQ A;  2UZK A;  2VBX A;  4EQQ A;  3CO6 C;  1R5H A;  3IL2 A;  2YU3 A;  3F22 A;  4L0Y B;  1OYI A;  1ZG5 A;  3LAP A;  3IWF A;  2MLK A;  2VOD A;  2UXX A;  2YSR A;  3KZZ A;  3J81 Z;  3CUO A;  3HSR A;  3R0J A;  4L9J A;  1L0O C;  1P2F A;  4UVC A;  3P9C A;  2EK5 A;  1R00 A;  2X4H A;  1T6S A;  3ZPL A;  2R7D A;  3ZMD A;  4HV6 A;  3DF8 A;  3RDI A;  1H9T A;  2EB7 A;  3C7J A;  3TO9 A;  2ZFW A;  1SFU A;  1KU9 A;  3V7C A;  2HKO A;  3KP4 A;  5D5V B;  4H0E A;  3HYI A;  1B6A A;  1WSU A;  2JRT A;  1J7K A;  3F23 A;  1G3W A;  2OAZ A;  1J75 A;  1QQI A;  4IJA A;  3DPT A;  1W7P A;  4L5J A;  3GUD A;  1ZG1 A;  5HLI A;  1HW5 A;  1ZRD A;  3L9F A;  3KFW X;  2VXZ A;  4CDG A;  3EYI A;  4AIK A;  2W24 A;  4EM2 A;  4HF2 A;  4LK0 F;  2DQL A;  1CGP A;  1FBS A;  2W84 A;  5F1R A;  1JHH A;  1KYW A;  1KQ8 A;  1J5Y A;  1BOA A;  5LGN A;  3L00 A;  2AXL A;  3H3U A;  4BHP A;  2RC4 A;  4I7H A;  2OU2 A;  5E18 F;  1XDU A;  2O3F A;  2DAO A;  4BH9 A;  5HDN A;  1V3F A;  2RNJ A;  1RUO A;  5TRD A;  5JFR A;  2E1N A;  2GA1 A;  1EH8 A;  2HTJ A;  3ECH A;  3GX4 X;  1FYL A;  3I53 A;  4JK1 X;  2GWR A;  4OIN F;  5ILV A;  3L7W A;  5DDG A;  5BMZ A;  4LFU A;  3LST A;  4HX8 A;  3PQK A;  1SD7 A;  4KIG A;  5HVQ C;  4LB6 B;  3RKW A;  2XGX A;  4JQF A;  3JSO A;  1AWC A;  2IP2 A;  4L18 B;  3MWM A;  1U5T A;  2EV0 A;  2GIV A;  1OKR A;  2V1U A;  2A6H F;  4M9S A;  1KQ9 A;  1T2K A;  4IRH A;  1WQ2 A;  2KJB A;  1QBJ A;  5L3B A;  3ZMV A;  2ZME B;  2JSC A;  1EV7 A;  2RQP A;  3KCC A;  4PGH A;  3KLN A;  3HSF A;  3T0Y A;  4IHS A;  4AIH A;  2YPR A;  3O6B B;  2EV5 A;  4I98 B;  2QLZ A;  1H9G A;  3HRU A;  3BWG A;  1VTN C;  3B73 A;  5ERI A;  2NS0 A;  1TLH B;  1XGO A;  3QP6 A;  5LHG A;  3LA7 A;  1FP2 A;  2IW5 A;  5LHI A;  3JAM Z;  3N4M A;  3FZV A;  3PQJ A;  1Z6T A;  1Z1D A;  3HSE A;  5BPD A;  4Q5S F;  2A5Y B;  4D0P A;  4P96 A;  2EFO A;  4ZYD A;  2RDP A;  5L3F A;  5D5X B;  2XAG A;  3TQN A;  2QZ8 A;  1JXS A;  1B1B A;  3DV8 A;  2WWY A;  5E1W A;  3E5X A;  5FFZ A;  1G3T A;  1KA8 A;  3R60 A;  4ASN A;  4YIF A;  2LKP A;  4BAY A;  1U3E M;  2F5E A;  3HOS A;  2QUF A;  3K1N A;  3DXJ F;  3V4G A;  1TBX A;  1CF7 A;  3QU6 A;  2LNB A;  3F6V A;  4I01 A;  5TJJ A;  1ODD A;  5FLX Z;  3WTZ A;  1BI0 A;  2IT0 A;  3FMQ A;  2OA4 A;  2OQG A;  5HS9 A;  3U9G A;  5BQT A;  3ZMT A;  5CVU A;  2OBP A;  1BM9 A;  5DD8 A;  4RGX A;  5HLH A;  4KNY A;  3W6K B;  3E97 A;  2L3D A;  2B0L A;  2HKX A;  3CUQ C;  2QEN A;  3J81 K;  3GFL A;  2XAH A;  1HQC A;  4R79 A;  2J5P A;  2CGP A;  5JVT A;  2VC1 A;  4Q48 A;  4OIO F;  1FT9 A;  3LA2 A;  2XIG A;  3IKT A;  2V9V A;  5DD4 A;  2K86 A;  3TGN A;  2PN6 A;  4KFC A;  5H6Q A;  5DUK A;  4YG2 F;  4O5V A;  3QOP A;  4KMU X;  1MJB A;  4Q4Z F;  3V8K A;  2FXA A;  1U8R A;  3VB2 A;  4PGG A;  3P9I A;  3J80 K;  1TW2 A;  3FWE A;  4HQE A;  4R1H A;  5DCM B;  2WTE A;  2NNY A;  4CYD A;  3I54 A;  3IRQ A;  2QQB A;  1FYK A;  1IXR C;  3LWF A;  1KYZ A;  2C6Y A;  3I5U A;  4XBF A;  4RB3 C;  2XAQ A;  2HQN A;  2D2W A;  4M6X A;  3ZMS A;  2FBK A;  3SHF A;  4U0W A;  4KUM A;  4HZF A;  3TO6 A;  3OV8 A;  1KU2 A;  3GFM A;  3RPQ A;  4WK8 F;  2P6S A;  3SFZ A;  5D8L B;  5FD5 A;  5K5Q A;  3MQ0 A;  1O57 A;  4IRI A;  2E7W A;  1FPQ A;  3RJP A;  3DQV C;  1O3T A;  3QPH A;  4LK1 F;  3TO7 A;  3E6B A;  4NHJ A;  2FSW A;  4MHG A;  1Q1H A;  3IWZ A;  3QPT A;  2O6G E;  3F8N A;  3C3W A;  1I5Z A;  2JPB A;  4G9Y A;  5CVV A;  1V4R A;  1DDN A;  3BOQ A;  5HDK A;  4HX7 A;  1UB9 A;  4P9U A;  4I02 A;  1KU7 A;  3FXQ A;  1FZP B;  1Z05 A;  2NYX A;  5F64 A;  3ML6 A;  4M71 A;  5A2Q K;  5EEG A;  2XKO A;  2P7C B;  5D4S A;  1S7A A;  2W85 A;  1TNT A;  2BE5 F;  4HX4 A;  4IRG A;  3N97 A;  1NHA A;  2QBY B;  1YW8 A;  5J8C A;  4RB2 C;  4FX4 A;  4QLC U;  1S8N A;  1MDM B;  4UV8 A;  4EJV A;  4YFX F;  2EV6 A;  1JE8 A;  5J6X A;  1PUE E;  4XLN F;  5HDG A;  4HA8 A;  1SMY F;  4CO8 A;  2KIF A;  1T0F A;  3I71 A;  3ISP A;  3P9K A;  4FX0 A;  2GXG A;  2PBI A;  4EM0 B;  3BPV A;  3F8C A;  4EJW A;  3K9T A;  3WTT C;  1R58 A;  3B02 A;  1FX7 A;  1PDN C;  2VBZ A;  1FC3 A;  4ZH4 F;  1G6N A;  2O0Y A;  4TV7 A;  5E8I A;  2CW0 F;  2F5D A;  4HDU A;  1WRJ A;  3JAM K;  1USS A;  4U7D A;  2DLL A;  4S05 A;  5HS8 A;  2DU9 A;  3WGH A;  3WG9 A;  4EGZ A;  3WTW C;  1MZB A;  3QU3 A;  3GFJ A;  2QQ9 A;  2HWV A;  4P5O A;  4A6E A;  1YS6 A;  3JW4 A;  1XGM A;  1XMK A;  2FE3 A;  2RVC A;  5DUI A;  4UXN A;  4XLP F;  4BYY A;  2NAZ A;  4OU0 A;  3WE2 A;  3WTS C;  4ENJ A;  2PJP A;  3DKW A;  1D8K A;  4U7B A;  5LGT A;  1KQ0 A;  1BJA A;  4G8X A;  2BEO A;  3U2R A;  5BPI A;  2DI3 A;  2ZXJ A;  4GGG A;  4HV5 A;  1R22 A;  4L0Z B;  1DPR A;  4RGR A;  1C0W A;  3CTA A;  2HQR A;  5JR3 A;  1I6X A;  4G6Q A;  3BDD A;  4S04 A;  3HHH A;  4LD5 A;  2DBB A;  1ZHF A;  5IT9 Z;  4WX9 A;  5IT3 A;  1XMA A;  2D1V A;  1XSV A;  2A61 A;  4KN7 X;  2KIM A;  2FEZ A;  2ZME A;  4WF2 A;  2GAU A;  5K1Y A;  2V6C A;  1IZ1 A;  5CLS A;  2QM3 A;  1REP C;  2DFI A;  4ZYH A;  1ZYR F;  4HF0 A;  3ZMZ A;  2DW4 A;  3VOD A;  4IXA A;  2ZJ2 A;  2PQ8 A;  4Z2Y A;  4HF1 A;  4I09 A;  1YQA A;  3FF5 A;  4MTD A;  3H3Z A;  2TDX A;  4UV9 A;  2E7X A;  4KA4 A;  1YTY A;  2A6E F;  4G6D A;  2Q8K A;  4ESB A;  3FXU A;  2FNP A;  1QZZ A;  1XB4 A;  4Q47 A;  2Z3Y A;  5EEH A;  1TQP A;  3F8B A;  2H27 A;  3ULQ B;  2XRO A;  1OYW A;  5FGM A;  3TDU C;  2HFH A;  3F3X A;  1QZY A;  3CUQ B;  2ZNZ A;  3GLX A;  3K1P A;  1T38 A;  2WC2 A;  5ICE A;  2PEX A;  1Z6R A;  5AIP A;  1D5V A;  2M1B A;  4I0A A;  5E1X A;  1HBX G;  1S7O A;  2MA3 A;  4M9X A;  2Z33 A;  1LVA A;  5HLG A;  4R8H A;  2XAS A;  5LEJ A;  2GZW A;  4KIF A;  3BRO A;  2QWW A;  3HRT A;  2XHK A;  5FO5 A;  2P6T A;  4M72 A;  1UFM A;  2AS5 F;  2DT5 A;  1OYY A;  1FYM A;  2G7H A;  3MFK A;  1XD7 A;  3AAF A;  5LGU A;  4HAM A;  2WV0 A;  3WU1 B;  2K4J A;  1Z7U A;  4Y15 A;  4WXD A;  2L54 A;  3C18 A;  3TDZ C;  1XDS A;  2VBW A;  3ABT A;  4RS8 A;  2F5C A;  2GXB A;  4RAZ A;  1J2X A;  3R0A A;  1FLI A;  2ZCW A;  5FD6 A;  1B9N A;  1O7L A;  2DO7 A;  3E5U A;  5D8K B;  2DQR A;  1FWZ A;  4LLG F;  2IJL A;  1RNL A;  3WOD F;  1R36 A;  4GYG A;  1RZ4 A;  1BBY A;  4MQ9 F;  5K5O A;  2HDC A;  1LDK B;  3QRF F;  4M9Z A;  2DTR A;  1W5S A;  1B4A A;  5LHH A;  2M87 A;  2CYY A;  4LG0 A;  2CQK A;  1XSD A;  3M1E A;  2OZU A;  4G7Z F;  3S2W A;  1MD0 A;  1ON2 A;  3O3K A;  4ETS A;  2PMU A;  4XRF A;  3LA3 A;  3IHU A;  2RN7 A;  1IXC A;  3NEU A;  1TQI A;  3FMS A;  1XSX A;  3CO7 C;  2HZT A;  4PDK A;  2UWM A;  4L9V A;  1YFH A;  2M8E A;  3QAH A;  3SZT A;  2KIU A;  2E1C A;  1ZLJ A;  5L3C A;  3SXY A;  1A04 A;  1W7P B;  2A3S A;  1IN7 A;  4ZYE A;  4M6Y A;  4RGU A;  1K78 A;  2A07 F;  3MZY A;  4A5N A;  3GZ5 A;  4CIC A;  5ICC A;  2HTS A;  5FFX A;  4A6D A;  2K4B A;  2QBY A;  2RV8 A;  2X0L A;  1QPM A;  4RB0 A;  2P8T A;  1MDM A;  2VE8 A;  1U78 A;  3R6S A;  1TNS A;  4ZYG A;  1P4X A;  2VN2 A;  5DEQ A;  3TKY A;  3KP5 A;  4K2E A;  3M8F A;  3J7A O;  1ZAR A;  1LEB A;  1F1Z A;  3VOE A;  1MGT A;  1XCB A;  1IN5 A;  4FHT A;  1F4K A;  3K69 A;  4A0Y A;  4UVA A;  2XAJ A;  5HOO A;  4I0B A;  2K7L A;  1IRF A;  1BN5 A;  4MEX F;  3WTX C;  4WXH A;  1WWX A;  2A68 F;  4PCQ A;  1BI2 A;  2ACJ A;  3E3V A;  4OMY A;  1FY7 A;  2M45 A;  3WTU C;  3FM5 A;  3I59 B;  1U5T B;  2YX7 A;  3DP7 A;  3BZ6 A;  4A12 A;  1PP7 U;  3HTS B;  5ILS A;  4LB5 A;  2Q0O A;  2JT1 A;  5ICF A;  2DPD A;  3FXR A;  1OPC A;  3GFI A;  2IPQ X;  4G7H F;  4CHU A;  3EDP A;  1U6G A;  2XRN A;  4MQV A;  3EUH A;  5CVJ A;  1EH6 A;  4YFN F;  3HRM A;  4B09 A;  3I4P A;  2DK5 A;  3NRV A;  3KP3 A;  1ZN2 A;  4EGY A;  2HOE A;  1T39 A;  1IF1 A;  2F5F A;  3TOB A;  1W5T A;  5CVR A;  1O3Q A;  3KP7 A;  4A2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...