1IRGA

Interferon regulatory factor-2 dna binding domain, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
112
structure length
112
Chain Sequence
PVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords INTERFERON REGULATORY FACTOR-2
publication title Solution structure of the IRF-2 DNA-binding domain: a novel subgroup of the winged helix-turn-helix family.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1997-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1irgA00
1H9TA 4Z2YA 2A3SA 1Z1DA 1SAXA 2D1HA 1BI1A 1K79A 3KFWX 4AD9A 5D5VB 4ENKA 3J80K 3G3ZA 1ZG5A 1J59A 2M5WA 4UVBA 5K5RA 1L3LA 1R58A 2KIUA 3ERED 1O3RA 1OYYA 4A5MA 4M9XA 3MQ0A 3I53A 2GZWA 1KU9A 2DTRA 3VOEA 4PCQA 1ZN2A 2LSOA 2O03A 3PFIA 2CWEA 3JTGA 4UUVA 1BOAA 3JAMZ 1BBYA 2ZCWA 2FOKA 1TTYA 1I6XA 2GXBA 3CDHA 4ENMA 3QAHA 4BXUA 3QRFF 1S6LA 2VN2A 3BY6A 1U3EM 3ROUA 4M6YA 1P2FA 4L5IA 2C6YA 1WI9A 2EV5A 4WX9A 4JK1X 3ZQ7A 3IC7A 2XAHA 3GYHX 2DBBA 4EGYA 1ZHFA 2DPDA 1LNWA 1KA8A 2IRFG 2H6BA 5LBQA 1R1VA 2M1BA 2FBIA 1KU7A 3QP6A 4Q4ZF 4EJTA 3K69A 1XCVA 4I0BA 2EFQA 2O3FA 4BHCA 2FF4A 3P7NA 2L4AA 1ZAOA 2KRFA 3ECOA 1XGOA 1LVAA 4ZZLA 4HX8A 3C3WA 2ESNA 3KP4A 1R5GA 2FXAA 2VODA 2V9VA 3BJ6A 3FX3A 2OZUA 3FF5A 1XB4A 2FSWA 3ISPA 1OPCA 1IF1A 4BHPA 3H3ZA 2R7DA 3TO6A 3F8MA 3TQNA 3J81Z 1HKTA 2ZFWA 5TJJA 2HKOA 3BJOA 1C0WA 3RPQA 1P92A 3I58A 3LSTA 1QZZA 1Z9CA 2V1UA 1X3UA 2F5FA 4UVCA 4UNOA 4XLPF 3HRMA 2DT5A 2IA1A 4YFKF 2HDCA 1OMIA 3LA7A 2P5KA 1TBXA 1QZYA 3HYIA 5A2QK 1HW5A 1V3FA 4I0AA 3RYRA 3GFMA 4L5JA 1G3TA 3FXUA 3F6OA 1O7LA 2WV0A 3RYPA 1XGSA 1FYMA 4R1HA 1MJAA 5CVIA 2QBYB 1B6AA 3U9GA 3JW4A 2F2EA 4IHSA 2EV6A 4G7HF 1Z6TA 1ODDA 3K1PA 3RKWA 2STWA 1DDNA 3QPHA 5H6RA 5K1YA 4EMSA 2ZO4A 1XGMA 3GF2A 1XSVA 4Q47A 1SD6A 1EH8A 4ESFA 1ZRDA 1MKMA 4YFXF 1FYLA 3WTUC 1FLIA 1ZLJA 3I64A 2R3SA 1BC7C 2RKHA 2P6TA 3F22A 3CUQA 4ENNA 3FXRA 2QLZA 1XMAA 4LLNA 1UB9A 3I71A 2RV8A 4HBLA 2HGCA 1FYKA 4P96A 1HSTA 1CF7B 5FFXA 2FEZA 3PQJA 2GWRA 2Q2EA 5L3GA 1U5TB 3W6KB 4IJAA 3ABTA 4KNYA 1QNTA 5CLSA 2VBWA 3IWZA 2G9WA 3P9CA 2GAUA 3ZMSA 5BOXA 1STZA 4MHGA 1FZPB 3CUOA 3T1BA 1YTYA 3ZMVA 3L2CA 5IT9K 3MEXA 2YSRA 4YIFA 4IRHA 4RB3C 2MLGA 4LB5A 2XROA 3M9AA 3ML6A 4BNCA 3WU1B 3V7CA 2FNPA 1SD7A 1Z05A 2Z33A 2CW0F 2OBPA 5JFRA 2LF7A 5E1ZB 3B02A 2W57A 3V8JA 4IXAA 3LFKA 3HTUA 5BPIA 1U5TA 3L9FA 3HIFA 4OIQF 2D2WA 1ZLKA 2NAZA 4CO8A 5D6FA 3QOPA 4WXHA 4IPAA 5FLXZ 2Y75A 5H6QA 5CYVA 1JHHA 4O6JA 5AIPA 1IZ1A 4A6DA 1Z91A 1XSDA 4LLLA 2XVCA 4H0EA 4HF2A 1TNTA 2A6EF 2XUBA 4CGZA 1GXQA 2E7XA 1ON1A 3KP2A 3BROA 3R61A 1IN8A 1ZRCA 2RC4A 1R7JA 5BS6A 5LHHA 2B0LA 1MJ9A 4A0YA 4CHUA 2A5YB 1ON2A 4GO1A 1W5SA 5AONA 1IW7F 2RDPA 4ETSA 2LF8A 2EJRA 3F72A 4MEXF 3E6BA 3WU0A 2J5PA 1XDUA 4WK8F 3GFLA 4FX4A 5FFZA 3FMQA 3V8LA 5HDGA 1W5TA 2XRNA 1IXCA 5DUKA 1KYWA 2Z99A 5D4RA 4UHTA 1J9IA 2CGPA 2CSOA 3CUQC 5LLQA 3WE3A 3F8FA 5FD6A 3COAC 1W7PB 4A2UA 2TDXA 2BEOA 2ZJ2A 2FBHA 5HDKA 1W4MA 2IA0A 1R36A 2QVOA 4U88A 5CJ9A 2UXXA 2X0LA 1QBJA 2RNJA 5HLGA 1LDKB 1U2WA 5BMZA 4Q48A 5HS7A 3GUDA 1GXPA 3ZMDA 1D3YA 1WKMA 5LRRA 1R00A 2UZKA 2VE8A 3DFGA 1YLFA 3T0YA 2FBKA 3BPVA 2CQKA 1KYZA 3I59B 1O57A 1W7PA 4NQWA 3EDPA 2XAQA 2BGCA 1Z7UA 1U5TC 2EB7A 1ZG1A 4KN7X 2CYYA 5FB2A 3WTSC 1KQ9A 3L7WA 3BWGA 3RDIA 5K5OA 4KIGA 1MGTA 4P9UA 1G3SA 1U6GA 2PI0A 3JTHA 4U0WA 2AXLA 2ZMEB 3OV8A 4KN4X 3P9KA 1PDNC 2O0YA 1OKRA 4XBFA 2Q0OA 2XIGA 3LA2A 4AIHA 4ZYDA 1HKSA 2EFWA 4I02A 4M9SA 3GZ6A 3IHUA 2FA5A 3KP6A 5J6XA 2QWWA 3I59A 3R0AA 1QGPA 4QLCU 3NRVA 2ZNZA 3F8BA 2MC3A 4ON0A 3TOBA 4OIOF 1KQ0A 1EV7A 5HLHA 1LDJA 4M73A 4Y15A 3W6JB 4A6EA 1K78A 2FE3A 2VXZA 3MZHA 3IKVA 2ACJA 2DQLA 2D1VA 1D5VA 3S2WA 2EFPA 3GXOA 3EQLF 3KETA 2RVCA 2XAJA 4ZYEA 3JSPA 3WTYC 3V4GA 2DLLA 2DI3A 2A68F 3H92A 1FP1D 2P7CB 1UCRA 3I4PA 5ILVA 3U1DA 1DPRA 4LJZF 2HTSA 3SZTA 3GO5A 3GFIA 3EYYA 5F6FA 3OOPA 5E18F 2Z9OA 5CVJA 4EM2A 2MA3A 3RTRA 3KP5A 3HRSA 2M8EA 5E20A 2DQRA 4S05A 2CFXA 1J2XA 4GYIA 2O61A 5DD8A 4A0XA 1FBSA 2JT1A 3WTWC 3ZMUA 1G3WA 3SHFA 4EGZA 1DUXC 4IVNA 1R1TA 1T39A 5D5WB 2V1XA 3M8FA 1E17A 1Z6RA 2PMUA 1U78A 1KGSA 3FHZA 4OIRF 4L9JA 2IVMA 3HOSA 2HS5A 4A12A 2HZTA 3MFKA 3ZN1A 3QU3A 3M8EA 1HXDA 2XAGA 1XN7A 2L01A 3RJPA 4NB5A 2X4HA 4MQVA 5ERIA 5E17F 2RGVA 3R4KA 1R22A 3V7SA 2VT3A 1HW2A 1RUNA 2ADUA 1XSXA 2PFBA 4M9ZA 3KLOA 3DPLC 5BPDA 1SFUA 2KIFA 3KP7A 5D8KB 4RB2C 4KUMA 4FHTA 4HDVA 2JZYA 3C18A 4L9VA 4KMFA 4HOBA 2OAZA 2VC0A 4HF1A 2VC1A 5L3CA 2XKOA 3J81K 4CZZA 1BI2A 1FC3A 1FPQA 3J7AO 2NNYA 4LD5A 2GA2A 3DF8A 3DV8A 1USTA 2DFIA 4B8XA 4KYWA 5LRSA 2GQQA 3HTSB 2BBYA 2WWYA 4AVPA 1F9NA 5LGTA 1YS7A 2HYGD 4G6QA 1MD0A 2YR2A 1O3SA 2EFOA 4MEYF 1AWCA 1BIBA 5LHIA 4OOIA 3CUQB 3EETA 4LGWA 5A2QZ 3G73A 4M74A 1D8KA 3N97A 1J75A 2YX7A 3V7RA 1VTNC 3TOAA 2GIVA 2HEOA 1F5TA 1OYWA 1R23A 1ULYA 4AIKA 4L9NA 1V4RA 3TO7A 1KU3A 3VFZA 4KICA 1TW3A 5HVQC 5E1XA 2GA1A 1SD4A 1EH7A 1SMTA 1PUEE 2IPQX 1Q1HA 1FSEA 4HYEA 1I1SA 3KCCA 4NHJA 5DDGA 4ZZDA 5EEGA 2R7FA 3GVAA 2DW4A 3B73A 3PQKA 5LGNA 1J0RA 2L02A 4BYYA 3KP3A 3C7JA 3R6SA 2K4BA 5FO5A 5AIQA 2JTVA 3RPUA 1B59A 1IN6A 2A69F 2DO7A 5TRDA 2PBIA 3GZ5A 4QWQA 3TKYA 1HKQA 1T98A 5ED4A 3GWZA 4Q5SF 4UV8A 3WTXC 2M45A 1TQPA 2XAFA 1ZGAA 1A04A 1YW8A 5DEQA 1W7PD 1E2XA 4KA4A 4BQAA 1ZGJA 2HR3A 1G6NA 3SXYA 2JSCA 3RIRA 4O5VA 4RB0A 2XGXA 2M87A 2A07F 3ULQB 5BQTA 2P6SA 2K27A 1GVJA 3DEUA 2OZ6A 2E1NA 4ENJA 1KQ8A 1F4KA 2ISYA 4ZYGA 2H6CA 2QENA 5CVUA 3WGHA 1RNLA 1K7AA 2HFHA 2W84A 2OA4A 1LJ9A 5CVRA 2QYOA 1LQ1A 5FLXK 2E1CA 2DPUA 4K2EA 5DV5A 4L0ZB 3FMRA 3HSRA 2ZBKA 1G4DA 2PN6A 2KJBA 1P4AA 2KJCA 1OR7A 4BAYA 4EVIA 4HQMA 5D6EA 2MLKA 4U0VA 1PP7U 4XSXF 5E1WA 5J8FA 1EH6A 3BDDA 1IRFA 3REOA 2QUFA 4RGUA 3R0JA 4RGXA 4F7ZA 2PEXA 3ZN0A 2VBXA 5D5XB 2COMA 2IA2A 3TDZC 1OYIA 4YIIA 2W85A 5JI6A 2NRAC 1MJBA 3E97A 1UHWA 1YYVA 2MH9A 1REPC 2D45A 3ZMTA 5LEJA 2FQ3A 3V8KA 1MZBA 1ZRFA 2ESHA 4S04A 6PAXA 1O3QA 4BH9A 3SQNA 5HS8A 4RB1A 2V79A 3K1MA 3E5XA 1H0MA 1D8JA 5FGMA 4MGRA 4WF2A 4HDUA 5HDNA 4GCVA 2OU2A 3LQQA 3LWFA 5HLIA 4UXNA 2WTEA 1I1GA 4I7HA 3MWMA 1LEAA 4R79A 1BJAA 2ELHA 1RZ4A 4HX4A 5E8GA 1BI3A 3IRQA 3DQVC 4M71A 4A5NA 1JHFA 2K86A 3RI4A 3Q5FA 2BE5F 2MH2A 5LHGA 1H9GA 1G3YA 3WTTC 4EQQA 2XHKA 3FWEA 3T5XA 5DYMA 3CO6C 4CICA 1L0OC 3QU6A 1SD5A 1TNSA 3DP7A 4M72A 1K78B 3BP8A 4I01A 4ZH4F 3E3VA 2EK5A 4RAYA 1WWXA 2J5OA 4KIFA 2FU4A 2O6GE 4YG2F 2QM3A 4MQ9F 4EJVA 2P4WA 3ZMZA 1Y0UA 1YQAA 4EJUA 3KLNA 3BOQA 3L09A 2E7WA 2HQRA 2LKPA 1T38A 5K5QA 5DCMB 4OMZA 2HQNA 5J8CA 2BV6A 5ICEA 2F5DA 1ZREA 3Q9SA 3E6MA 2P7VB 3E6CC 3E5UA 4XSZF 1DPUA 4WXCA 5EEHA 1BN5A 3CJNA 3K1NA 1XMKA 2XV4S 3QPTA 2STTA 3IWFA 2DAOA 4YFNF 2OQRA 4HF0A 3T8RA 3ECHA 5F1RA 1K6OA 5JVTA 2PJPA 1B9NA 3HRTA 4P9FA 2A61A 4P5OA 3T8TA 4GXOA 4MNUA 3KEQA 3DPTA 4GGGA 4KIBA 5IT3A 4RGSA 4OU0A 2P5LC 5DCMA 3SFZA 4XRFA 3J80Z 4HAMA 1IUYA 2UXNA 3VB2A 3IKTA 3LAJA 1FX7A 1FOKA 1UHMA 5DD4A 3BZ6A 4HA8A 4U0YA 1IN4A 3KE2A 3DXJF 2EV0A 5ICFA 2H09A 1R1UA 2PQ8A 1BI0A 3WG9A 2K7LA 3JAMK 1HW1A 3U2RA 1JGSA 1ZH5A 4KMUX 4PZJA 4MTEA 3WTVC 2KIMA 2OQGA 2FMYA 1FP2A 1BM9A 4I2OA 4TV7A 1LDDA 5HOOA 1ZG3A 4DNCA 4CXFA 4RS8A 4GYGA 2EA2A 1PP8F 2HKXA 1O7FA 5ILUA 2L54A 4ZYHA 2O8XA 2Y48A 2EWNA 5CVVA 1RUOA 3FM5A 3M7GA 3K9TA 2M30A 3RKYA 1B4AA 4RAZA 4WCGA 4E70A 2VE9A 1J5YA 2P5VA 1IAWA 4ESBA 1YS6A 2MBFA 3GLXA 4HLXA 4IF4A 2RN7A 5ICCA 2EA4A 4LLGF 3WTZA 2A6HF 3I5UA 4UVAA 1XD7A 1I27A 5JHUA 1B1BA 4JQFA 2XASA 1LEBA 2HWVA 3MZYA 1SMYF 4U7DA 4L18B 4LB6B 3WGGA 3KZYA 2VOPA 3AAFA 3SZPA 1TQIA 5LGUA 3GFJA 3O6BB 1YO5C 1UFMA 1S8NA 2V6CA 4G94A 2VT2A 1YFHA 2DU9A 1TLHB 5H20A 3QP5A 1TQMA 5FD5A 3DKWA 2QQBA 1WSUA 3GW2A 3JSOA 3ABUA 4A0ZA 2VONA 4I09A 5D4SA 4WWCA 1BC8C 1QQIA 1U8RA 2HOEA 2PLYA 3ZPLA 2VBYA 3HSFA 1IN5A 1BIAA 1DP7P 3K0LA 1TW2A 1FSHA 4ASNA 2DK8A 4PDKA 1ONVA 1O3TA 1WQ2A 3CTAA 1ZYRF 4ESJA 3FZVA 3FMSA 3CO7C 2FNAA 2FRHA 1XDSA 3LA3A 3O3KA 2MD5A 4P55A 1IXSB 2YU3A 5KK1A 2VBZA 3GEZA 2K4JA 2L4MA 3D0SA 4LK1F 2JPBA 5L3BA 1QO0D 4KT5C 4G7OF 1S3JA 4JBAA 1F1ZA 1T6SA 1YG2A 3HHGA 1YIOA 4XLNF 2WC2A 2QZ8A 5L3EA 3Q9VA 2RQPA 3MCZA 2H94A 4WXDA 3LQRA 1HQCA 4CYDA 4D0PA 1RI7A 2G7HA 2JRTA 2Y0MA 2CG4A 1QPMA 3F23A 3FM3A 2G7UA 2QBYA 4HW0A 4N9IA 4MTDA 2NNNA 3E5QA 2IW5A 1GHCA 3I0TA 2F5CA 1ZARA 3HRUA 3BPXA 1T2KA 3CLOA 1YW9A 5ILSA 4LK0F 4IHTA 2KKOA 4HLYA 2W24A 2JPCA 3KEOA 5IT9Z 1S29A 4U7BA 3NQOA 1HBXG 2CO5A 1FBUA 4I98B 4L9TA 4CDGA 1HSJA 2LNBA 4KDPA 3F8CA 1JXSA 4B09A 3TO9A 4FX0A 4O3MA 5KVRA 4DQ2A 3E6DA 5L3DA 1P4XA 1CF7A 1FBQA 4UV9A 5DCFA 1I5ZA 2NS0A 5L3FA 3P9IA 4IRGA 4AWXB 2ETHA 2YPRA 3IRRA 4EM1A 4HQEA 2ISZA 4HZFA 4KFCA 1P4WA 2PMHA 3HHHA 4EJOA 2P8TA 5F64A 3R60A 5D5UB 1USSA 3WGIA 1MDMB 1WRJA 4G7ZF 1FWZA 3TGNA 4AIJA 1P6RA 2FMLA 1S7AA 2PG4A 1AOYA 2YX4A 2IT0A 1XGNA 4M6XA 2F5EA 4PGHA 2V1DA 3LAPA 2K02A 4L0YB 3EUHA 1J7KA 4HV6A 2UWMA 2VOOA 1S7OA 5DUIA 2ZXJA 1FNNA 4Y17A 1FT9A 3FXQA 1MDMA 5HS9A 5ICGA 3EYIA 3C1DA 2QQAA 1IXRC 4HX7A 2HTJA 3I54A 1XCBA 3HUGA 5E8IA 4LFUA 4OINF 4LMYA 3BJAA 2AS5F 3M1EA 1JE8A 3HSEA 3H3UA 2EFNA 2IJLA 3HOTA 1SFEA 1B9MA 3ELKA 3K2ZA 4OIPF 2HYFA 2Q8KA 5JR3A 1T0FA 2L3DA 4EM0B 4Y13A 1RIOH 1IRGA 4PGGA 2DK5A 3D5LA 2ZKZA 2LDUA 2W25A 5LEKA 3O2PE 4IRIA 5D8LB 4G8XA 3N4MA 3IL2A 4N0BA 4LG0B 1FY7A 1R5HA 2XKPA 2Z5UA 2BYVE 2QQ9A 4OMYA 2OD5A 3VODA 1NHAA 1SFXA 1YW7A 3WODF 1IN7A 4G9YA 3ZP5A 4RGRA 2IP2A 3F3XA 2NYXA 3RKXA 4N9HA 3GX4X 3KZZA 2Z3YA 4HV5A 2ZNYA 1CGPA 4EJWA 3L00A 3F6VA 3F8NA 4FT8A 4BHBA 3MAJA 3WE2A 3VEPA 4G6DA 1LB2A 2H27A 3NEUA 3TDUC 3F21A 4EV0A 2ZMEA 4LG0A 4R8HA 1KU2A 2GXGA
chains in the Genus database with same CATH superfamily
1H9TA 1MW7A 3M07A 1W1WE 4Z2YA 1IRXA 1QHHD 2E2HJ 2A3SA 3BZKA 2LRDA 1Z1DA 2QSHX 2JA6J 1SAXA 4NC6A 3TP3A 3W2WA 1X2NA 4A3CJ 3S14J 1T08B 2D1HA 3UKGA 3HPHA 4HNUA 3L2UA 1RKWA 3QPLA 1BI1A 2QQ8A 1K79A 5EGOB 3KFWX 4XLHA 4AD9A 5D5VB 4ENKA 3J80K 3G3ZA 3H9GA 1ZG5A 1J59A 4E7HA 2M5WA 1ZR4A 4UVBA 5K5RA 3RCOA 2V1NA 1L3LA 1R58A 2KIUA 3ERED 1O3RA 1OYYA 2YU9J 3OR2C 4A5MA 3CZ6A 2CQQA 1ENHA 4M9XA 3MQ0A 4DJAA 4II3A 3I53A 2GZWA 1KU9A 2DTRA 3GTPJ 3VOEA 4PCQA 1V5EA 2X48A 2XF7A 3I4MJ 1ZN2A 3CQZJ 4A3GJ 1B8IA 2LVSA 2LSOA 3ABKH 1IJWC 2O03A 3PFIA 2CWEA 2DFHA 1HC8A 3JTGA 1YHQI 4UUVA 1T0FC 4IZZA 2L7KA 3EPZA 5KNLA 3A02A 1BOAA 3JAMZ 1I3AA 1BBYA 2ZCWA 1BL0A 4XLCA 2FOKA 2WAQA 1W0UA 1TTYA 2XGEA 1I6XA 2ZC2A 3BG7A 2GXBA 1K6YA 3ZQHA 2QSFX 2X6OA 3CDHA 4ENMA 1T33A 4Y33A 3QAHA 2ME6A 1E3HA 4BXUA 4RDUA 1D0XA 1QZEA 3QRFF 3OMYA 4QSHA 1S6LA 2VN2A 1JI8A 3BY6A 1JKPC 2HNHA 1U3EM 3ROUA 4M6YA 1P2FA 4CH7A 4BUPA 2K9SA 4L5IA 2C6YA 1WI9A 2EV5A 4WX9A 4JK1X 3ZQ7A 3IC7A 2XAHA 3GYHX 4C2UA 2DBBA 2MC4A 4EGYA 3MVPA 1JT0A 2F4MB 1ZHFA 2DPDA 1LNWA 1FIPA 1KA8A 2IRFG 1Y1VJ 2H6BA 5LBQA 1R1VA 2JVHA 2M1BA 2FBIA 1KU7A 3QP6A 4Q4ZF 4EJTA 2HOSA 4UUSA 1DU0A 4MFEA 3K69A 4F91B 1HA8A 1XCVA 4I0BA 2EFQA 2O3FA 3I3LA 4BHCA 2FF4A 4KT6A 3P7NA 2BOLA 1ZAOA 2KRFA 2L4AA 3ECOA 1XGOA 1LVAA 4ZZLA 2VXDA 2W1OA 1WJ5A 4HX8A 2G0EA 3C3WA 2ESNA 5EG0B 3KP4A 1R5GA 1A5JA 1X1BA 1MMAA 2FXAA 2YS9A 3DU6A 1QPIA 2VODA 2ZMEC 5IP9J 1H8AC 2V9VA 3S1RJ 5J4YA 4HNTA 3BJ6A 5M3MJ 2L7MP 3FX3A 2OZUA 3FF5A 2LK2A 1XB4A 1Z3YA 1OCCH 2FSWA 3AG3H 5B1BH 4XOPA 3ISPA 1VQMI 3HOUJ 4QIWN 1OPCA 1IF1A 4BHPA 3H3ZA 2R7DA 2FUG2 2VB6A 3F8MA 3TO6A 3TQNA 3J81Z 1GDTA 2TRTA 1HKTA 2ZFWA 5TJJA 2HKOA 3BJOA 1C0WA 2IEKA 3RPQA 1G8XA 1P92A 1UJ8A 2WAFA 3I58A 2MGQA 3LSTA 4A3BJ 1QZZA 1SVMA 1Z9CA 2V1UA 3VYTB 1X3UA 2CMPA 4S0HB 2F5FA 1VQ6I 4UVCA 3PNYA 4UNOA 4XLPF 3HRMA 2DT5A 2ICWG 3HKZN 2DMPA 2IA1A 3ZGKA 4F55A 3PIOF 4YFKF 3H5AA 1OMIA 3LA7A 4FE4A 2P5KA 2HDCA 4ABZA 4D9JA 1TBXA 1QZYA 3PSFA 3HYIA 3S2HJ 5A2QK 2MFZA 3X2QH 1HW5A 4A3IJ 5EG0A 1V3FA 4XQFA 4I0AA 3CF5F 4AC0A 3PNTA 3RYRA 5EZGA 2JSPA 1X3WB 3GFMA 1K61A 4L5JA 1G3TA 3FXUA 4HG2A 3F6OA 1O7LA 2DYRH 1RKTA 3DEWA 1A36A 1XTAA 4ZDOA 2WV0A 2OUMA 2DN0A 3RYPA 1XGSA 2XB0X 1FYMA 4R1HA 1MJAA 2CS3A 3S17J 1J09A 5CVIA 2QBYB 1B6AA 2DDAA 4I6ZA 4ZDLA 3A0HC 4NDLA 5IY5H 3U9GA 3D5SC 3JW4A 1D1CA 3A01B 2F2EA 3BTJA 2Q2EB 4IHSA 2EV6A 4G7HF 1Z6TA 1ODDA 3K1PA 3RKWA 2EZKA 3ZXSA 2STWA 1DDNA 3QPHA 4XKCA 4CYCA 3G6EI 5H6RA 2O5RA 3H1CA 1X4OA 4EMSA 5K1YA 2ZO4A 1XGMA 2LOOA 3GF2A 3KYLA 1XSVA 3HB9A 4Q47A 3K4NA 4ANJA 1SD6A 1EH8A 1X58A 2OCCH 4ESFA 4ZJZA 1ZRDA 2E34A 2VIXA 5CQGA 1MKMA 4PSWA 3OYLA 4YFXF 3CMAI 3S16J 4HSRA 1FYLA 5C4XJ 3WTUC 1FLIA 4FE7A 1R4NB 1SVOA 1ZLJA 2L7ZA 3I64A 2M4GA 5CQEA 2R3SA 1BC7C 2RKHA 2DCEA 1JJ8C 4CA0A 2P6TA 3RKQA 3SFIA 3F22A 3S3OA 3CUQA 4ENNA 2M4KA 3PM1A 3FXRA 2QLZA 1XMAA 4NC8A 4LLNA 1UB9A 3I71A 2RV8A 4HBLA 5IYCJ 2HGCA 1FYKA 3PL8A 1X4PA 3CMYA 3U1KA 4P96A 4BACA 3CP2A 3GTLJ 1HSTA 3BTLA 4CCKA 1CF7B 3A01A 5FFXA 2FEZA 3PQJA 2GWRA 4EEFG 2Q2EA 5L3GA 1U5TB 2VKEA 4IJAA 3W6KB 2ZJQF 2FOWA 1NK2P 2CUZA 3ABTA 4KNYA 1QNTA 5CLSA 2VBWA 5JLWA 2HXIA 1BOBA 3IWZA 2G9WA 3P9CA 3OY9A 2GAUA 2P0WA 3ZMSA 5BOXA 1STZA 2WY8Q 4MHGA 1FZPB 2I8DA 3CUOA 5C44J 2ELJA 2LY1A 2DDBA 5E3LA 3OYGA 3T1BA 2D5VA 5HLTA 1YTYA 3ZMVA 3OIQA 3L2CA 5IT9K 3MEXA 1ETYA 2YSRA 4YIFA 1S72I 4IRHA 4NBQA 4RB3C 2MLGA 4M3BA 1R9TJ 2I5UA 1VQLI 1RESA 4RMNA 4PSXA 4XLAA 3MN2A 2XROA 4LB5A 2PX9A 3PO2J 3M9AA 3ML6A 1FJLA 3BTCA 2OC6A 4BNCA 4FTHA 3WU1B 3V7CA 5H2FC 1PUFB 1XX5A 4L5EA 2FNPA 1SD7A 3L2QA 1Z05A 2Z33A 3S1NJ 2R7UA 2CW0F 2OBPA 2V4JC 5JFRA 2LF7A 5E1ZB 2NXNB 2QKMB 3B02A 2W57A 3V8JA 4IXAA 3LFKA 4E7JA 3KPHA 1R71A 3HTUA 5BPIA 2CUFA 1U5TA 4BQOA 1ZTRA 3HG9A 3DBLB 2BXZA 3L9FA 2HZDA 2RNGA 3HIFA 4OIQF 2D2WA 1TT5B 1JKRC 2HI3A 1ZLKA 2NAZA 4CO8A 1SAUA 4BJ5C 5D6FA 3QOPA 3ABMH 3WHBA 4WXHA 3CMEI 5EJCA 4IPAA 5FLXZ 2Y75A 5H6QA 1POGA 2K9QA 5CYVA 5GP9A 1JHHA 4O6JA 4XM3A 4IX7A 1A35A 5AIPA 2LLKA 3S93A 1IZ1A 4IO9F 4A6DA 1Z91A 1XSDA 3ASOH 4LLLA 2XVCA 4H0EA 3Q0VA 4B3XA 3E7LA 4HF2A 1GV2A 1TNTA 2A6EF 2XUBA 4CGZA 1GXQA 2E7XA 2PMZA 3A03A 1EKEA 4FQGA 3BR1A 1ON1A 3KP2A 3BROA 1MBGA 3R61A 1IN8A 5IOYA 1ZRCA 2OTLI 4A93J 1PUFA 2RC4A 1R7JA 5BS6A 5LHHA 2QEXI 2B0LA 1MJ9A 4A0YA 4CHUA 2A5YB 1ON2A 4GO1A 4C2TA 1W5SA 1T56A 3CC4I 5AONA 1IW7F 2LR8A 2RDPA 4ETSA 2LF8A 2EJRA 3F72A 1Z0XA 4MEXF 2JJ7A 3E6BA 4FISA 1JGGA 2KLOA 3WU0A 4YRVA 2J5PA 1XDUA 2XF6A 1EJ9A 4I99C 4WK8F 3Q3SA 1S9HA 3GFLA 4FX4A 4Y52J 5FFZA 3FMQA 3V8LA 5HDGA 1W5TA 2XRNA 1Z7LA 3L2VA 3DWLE 1IXCA 4QPQA 5DUKA 1KYWA 5LFAA 4PUSA 2FJ1A 2Z99A 3OYFA 4Y7NJ 5D4RA 4UHTA 1SC7A 1J9IA 3PFYA 4IOCF 2CGPA 4A3LJ 3CCUI 3FDYA 1H88C 4GDFA 3HOYJ 2LP0A 2XPWA 2CSOA 2AQEA 3CUQC 5LLQA 5GTHC 3VYRB 4F92B 3WE3A 4V2GA 2ID3A 3F8FA 5FD6A 2Z1DA 5CPRB 4M6VA 5B1AH 3COAC 1KONA 4KISA 1W7PB 3BTIA 3GCMA 4NQWB 4XLEA 5E3MA 1Y56A 4A2UA 2TDXA 2BEOA 1N77A 2ZJ2A 4IEJA 2FBHA 1ITYA 4BBRJ 5HDKA 1W4MA 2IA0A 2HQ5A 1R36A 1YOVB 4IHVA 1A6QA 2VJ4A 2QVOA 4FASD 4U88A 5CJ9A 1D5YA 2UV1A 2R7RA 3M3YJ 2EZIA 1NTCA 4V2FA 2UXXA 2X0LA 1QBJA 2ZSIB 4RM3A 2RNJA 4NC7A 5HLGA 1LDKB 2DT7B 1U2WA 5BMZA 3FBNB 4Q48A 3F0CA 1IUYA 5HS7A 3GUDA 5TISC 1GXPA 4XNFA 3I4NJ 3G4SI 1R4MB 2F6CA 3ZMDA 1D3YA 3L2RA 2AO9A 2X85A 1WKMA 1FTTA 5LRRA 1ZQ3P 1R00A 3IH2A 2UZKA 1WJCA 1GLNA 2F4IA 2VE8A 3DFGA 1YLFA 1VQ4I 3T0YA 2FBKA 3BPVA 2CQKA 3OL3A 1KYZA 2IBDA 3I59B 4XMYA 1O57A 1W7PA 4NQWA 2OJED 3EDPA 5IYDJ 2XAQA 2BGCA 3ZRGA 2OCEA 1Z7UA 1U5TC 2EB7A 1ZG1A 4KN7X 2CYYA 4CCJA 5FB2A 5EEAA 3WTSC 1KQ9A 3L7WA 3BWGA 3ZQIA 4E7ZA 4X0GA 4D5CA 4E4HA 3RDIA 3TW7A 4F52A 3B6AA 5K5OA 4KIGA 2ECCA 1MGTA 4P9UA 1G3SA 1U6GA 2IS2A 2O9LA 3JTHA 2PI0A 5K7HA 3IAS2 3MKYB 4U0WA 3OR1C 4BXXJ 2AXLA 4EATA 2DJIA 2ZMEB 1LFPA 3OV8A 4KN4X 3P9KA 1WGXA 1PDNC 4OAYA 2O0YA 3H36A 1OKRA 1X1CA 1NH3A 4ZC3A 3OIPA 4DYRA 1YJWI 3ZQGA 4XBFA 1O4XA 4AYBN 3FXLA 4RLFA 2Q0OA 2XIGA 3LA2A 1YJ9I 4AIHA 5IYBJ 4ZYDA 1HKSA 1DGWY 3H5NA 2EFWA 1MH3A 4M3FA 1MBKA 1UELB 4I02A 4M9SA 2E2JJ 1WZ2A 3P5JA 1MH4A 1Z67A 4XKBA 3VDXA 3GZ6A 3Q0WA 2DFEA 3G71I 3IHUA 1QRYA 1TWCJ 1X2MA 2FA5A 4BXFA 3HOXJ 3KP6A 4A3JJ 1R6RA 5J6XA 2QCOA 2QWWA 3I59A 3R0AA 1QGPA 2JA5J 2DODA 4QLCU 3NRVA 3JRDA 3OIOA 3S32A 3U21A 2GBYA 3ASNH 4F3QA 1MMDA 1TP4A 2ZNZA 2M0CA 3H9JA 3F8BA 2MC3A 4ON0A 3TOBA 2HQAA 1MNEA 2XDVA 4OIOF 1YX3A 2L9NA 1KQ0A 1EV7A 3NAUA 1B8IB 5HLHA 3CDLA 1LDJA 4M73A 4Y15A 3W6JB 4A6EA 4J01A 1K78A 2FE3A 2VXZA 1PYVA 3MZHA 3IKVA 1EF4A 1XS9A 2ACJA 2KT0A 2DQLA 2EIKH 3K4LA 1JUSA 3JRHA 2D1VA 4HPQA 2VJIA 1D5VA 3S2WA 1UHSA 1WJAA 2EFPA 3GXOA 3EQLF 1WPKA 3TEDA 4M3EA 3KETA 4IOAF 4D7MA 2HVSA 2RVCA 2XAJA 4W1UA 2V6EA 2HU9A 2RQQA 4ZYEA 3DLAA 3JSPA 3WTYC 3V4GA 2DLLA 2DI3A 2A68F 4B48A 4IQ4A 2KMUA 2WB1N 3H92A 4NUBA 1FP1D 3DLLF 1TZLA 1ZELA 1UCRA 2P7CB 3CCLI 3VPRA 4W97A 3I4PA 3CP8A 5ILVA 3FXOA 2MG4A 4UY8I 3U1DA 1DPRA 2CFOA 4LJZF 2XSJC 4BGDA 3MD2A 2DA2A 2HTSA 3SZTA 3K10A 3GO5A 4CCMA 3GFIA 3EYYA 3DKXA 2HVQA 2VLAA 4XL9A 4F93B 2FX0A 5F6FA 4BBSJ 1OCOH 1LVKA 3OOPA 3CJQB 1VQOI 3HXLA 3UNGC 2IGKA 5E18F 2Z9OA 5CVJA 3W6VA 1X1DA 1WI3A 3NWTA 5K7FA 4UUSB 3K70C 5HNFA 4EM2A 2M9HA 2VASA 5M5WJ 1YITI 2MA3A 3RTRA 1V55H 3KP5A 3GTOJ 3HRSA 2M8EA 1P7JA 2X1EA 4N4OB 5E20A 4KITB 2DQRA 2VPRA 5GAHJ 2CFXA 4S05A 3BG3A 4BEHB 5K7ZA 1J2XA 3OYEA 2DJNA 4GYIA 2O61A 5DD8A 2HDDA 4A0XA 1FBSA 3CCQI 2JT1A 1SEUA 3WTWC 3ZMUA 1G3WA 3J7AY 3SHFA 3I55I 4EGZA 1APLC 1DUXC 4IVNA 2LKXA 1HCRA 2EQRA 1VQNI 1ETKA 1R1TA 3SDGA 3G2BA 5GPCA 5D5WB 2V1XA 1T39A 3M8FA 2NVXJ 1E17A 3FXMA 3ZQFA 1Z6RA 2PMUA 4CCLA 1U78A 1KGSA 3HC7A 4B1RA 4DOZA 3FHZA 5GPAA 4OIRF 4L9JA 1X1PA 4RAFA 2IVMA 3HOSA 2HS5A 1N25A 2LFBA 5F08A 4A12A 2HZTA 3MFKA 3ZN1A 5M3FJ 3QU3A 4U87A 5FROA 3M8EA 1HXDA 1VQKI 2XAGA 1F36A 4LIVA 1XN7A 2L01A 3RJPA 4NB5A 3SEQA 1R5ID 1AA7A 2VL8A 2X4HA 4MQVA 2AHQA 5ERIA 5IOZA 5E17F 1PJRA 2RGVA 3R4KA 1R22A 3K4MA 2EIJH 2EZHA 3V7SA 2KIQA 2VT3A 1HW2A 1RUNA 2BY3A 2DA6A 4BEHA 4KJZA 2ADUA 1XSXA 2CV0A 1BW6A 4CZCA 3W2AA 2PFBA 4M9ZA 4XKVA 3KLOA 3DPLC 5BPDA 1SFUA 2KIFA 2XRLA 3K2AA 3KP7A 1LFUP 2O8KA 2DA1A 4AUXA 1HDPA 3FISA 5D8KB 4KUMA 4RB2C 3ONQA 4FHTA 4HDVA 5EYRA 3K4BA 3MMYB 2JZYA 1XC5A 3C18A 2JUGA 4G6TB 2KQRA 2V9PA 4L9VA 4KMFA 3QOEA 3WG7H 4HOBA 3NARA 2OAZA 3OYAA 2VC0A 4HF1A 2VC1A 5L3CA 2B63J 2XKOA 2FD5A 2H8WA 1GUUA 4CCOA 1ZKGA 3IAM2 4CZZA 4RAGA 3J81K 1BI2A 2WADA 2Q1ZB 4BKXA 1RR8C 1P9QC 2Y31A 3PUBA 1EA3A 1FC3A 1FPQA 1U9NA 3J7AO 2NNYA 4LD5A 1NK3P 2GA2A 4CYCB 2E5NA 3DF8A 4M3DA 4XRMA 5KAFC 1TC3C 1H89C 1IDZA 3GTJJ 3DV8A 2JQ7A 1USTA 5KHDA 1N75A 2L9SA 2DFIA 4B8XA 4ZTJA 2IAIA 2ID6A 4OAZA 4KYWA 4D7NA 3S3MA 4RA2A 4Y3OA 2HOAA 5LRSA 3OS0A 2GQQA 4C3HJ 3HTSB 2BBYA 4IKFA 2WWYA 4PFPA 4AVPA 3ERMA 5GADJ 2JN6A 2HVRA 4BDYA 1F9NA 5LGTA 1YS7A 2HYGD 3PSIA 4G6QA 1MD0A 2YR2A 5CKTA 1O3SA 2EFOA 3AG2H 2E5ZA 4MEYF 1AWCA 3LSPA 3LSRA 1TWHJ 1BIBA 3AG4H 5LHIA 4OOIA 5E3NA 2E71A 3CUQB 3EETA 1UMQA 4LGWA 3K7AJ 5A2QZ 3CCVI 3G73A 3CC2I 2UUZA 1D8KA 4M74A 1VFCA 3N97A 1J75A 3FXJA 2YX7A 3V7RA 1VTNC 2XB5A 3TOAA 1T95A 2GIVA 1GV5A 2HEOA 1F5TA 1OYWA 1BR2A 2LY2A 5J47A 1R23A 1I3QJ 1ULYA 4AIKA 4AIDA 4L9NA 1V4RA 3CD6I 3TO7A 1KU3A 3VFZA 3MZ8A 4KICA 5J1UA 5KCMA 1K83J 1TW3A 1WJEA 5HVQC 5E1XA 2QSGX 2GA1A 1SD4A 1EH7A 1MMSA 2CJJA 1G59A 2KDOA 2ZJRF 3LOCA 1SMTA 4ZYAA 1PUEE 4BQNA 1YE9A 1TL8A 2IPQX 1Q1HA 4B4CA 2M7BA 3CCEI 3QODA 1FSEA 2GOXB 4HYEA 2KL4A 4UUTA 5DM6F 1I1SA 3KCCA 1IV8A 2EBIA 4NHJA 5DDGA 4JX4A 4ZZDA 5EEGA 2R7FA 4DBRA 3GVAA 2DW4A 3JCUC 1E0EA 2BZTA 3B73A 3PQKA 2BHYA 5LGNA 1J0RA 2L02A 2VKVA 4BYYA 3KP3A 3C7JA 3R6SA 4G12A 2CQNA 2DMQA 2K4BA 3PJRA 2K3FA 5FO5A 5AIQA 2JTVA 3RPUA 2OTJI 2X6WA 5IP6A 1B59A 1IN6A 3H0GJ 1OLTA 2A69F 2DO7A 4DYQA 1MBJA 5TRDA 3ZQQA 2PBIA 3GZ5A 4QWQA 4C9YA 2WV1A 3OSFA 4YIRX 1HKQA 1T98A 3TKYA 5HNHA 1Y6IA 4GFBA 4A3FJ 5ED4A 2E35A 3GWZA 2L9RA 4Q5SF 4UV8A 3WTXC 2M45A 1TQPA 2XAFA 1ZGAA 2BY1A 1A04A 3K70D 1YW8A 5DEQA 1W7PD 3LSKA 2K9LA 3O8HA 3BQZA 1E2XA 4KA4A 4BQAA 1TWAJ 3OYHA 3FXKA 5J1YA 3O8GA 1ZGJA 3JRGA 2HR3A 4J00A 1XPXA 3PO3J 1G6NA 1LUJB 3SXYA 2JSCA 2NVYJ 3RIRA 4O5VA 4RB0A 2CW7A 2R7QA 2XGXA 2M87A 3OYMA 1AKHB 2A07F 3ULQB 5BQTA 2BW3A 2P6SA 4UB6C 2O7OA 3LFUA 1V5FA 2K27A 3HM5A 4MLOA 1BJZA 4I76A 2HPMA 5JLXA 1HF0A 1GVJA 1PVEA 1UG2A 3DEUA 2OZ6A 2E1NA 4ENJA 1KQ8A 1F4KA 2ISYA 3LSIA 2H6CA 3DTEA 4AYBA 4ZYGA 1B72A 2QENA 2HOTA 5CVUA 3WGHA 1RNLA 1K7AA 2HFHA 2JA2A 2W84A 2OA4A 1LJ9A 2MD0A 2R0QC 2LC2A 2QYOA 5CVRA 2QA4I 4AM3A 5J1RA 4BE0A 1LQ1A 5FLXK 2E1CA 2DPUA 4K2EA 5DV5A 2B9SA 1VNDA 4L0ZB 2HYJA 2EINH 3FMRA 3HSRA 1A31A 2ZBKA 2WY7Q 1G4DA 2PN6A 2KJBA 1P4AA 4AVZA 3BR0A 1ZGWA 4XN0A 4DZPA 2KJCA 4C2MJ 1OR7A 2JWTA 4BAYA 4EVIA 4HQMA 3PUFA 5D6EA 2MLKA 4U0VA 1TWGJ 3S1MJ 1PP7U 2RREA 4XSXF 3BG5A 2M34A 3B6CA 1AKHA 5E1WA 5J8FA 1XMXA 2V7FA 3OS2A 1EH6A 2HPIA 3BDDA 1S7EA 1IRFA 1IO2A 3REOA 5C4JJ 5F0HA 2Y2ZA 2QUFA 4RGUA 3R0JA 3HOVJ 3DKYA 4RGXA 4F7ZA 1WH5A 2PEXA 1VQ5I 1N78A 2YUSA 2CUEA 4DGWB 2DOAA 3QYFA 3ZN0A 2VBXA 3TBIA 5D5XB 1VQPI 2COMA 2IA2A 4PFOA 2LBFB 4DW6A 1MBHA 1IV6A 3TDZC 1OYIA 1FOXA 4YIIA 2W85A 2R7SA 3IV5A 5JI6A 2NRAC 2WB1A 1MJBA 3E97A 5GAGJ 1I50J 1UHWA 1YYVA 2MH9A 4ZTFA 1W36C 1REPC 2BVMA 2D45A 1FOYA 1VQ9I 3ZR8X 3ZMTA 4A69C 5LEJA 1VZ0A 2FQ3A 4ZDPA 2NOJB 3G1OA 3V8KA 1MZBA 1ZRFA 1VF9A 2JRMA 2ESHA 3CMMA 3AL0B 4S04A 2KRCA 6PAXA 2Y0SN 1O3QA 4IL6C 1OCTC 4BH9A 3TMOA 3JR9A 4A3EJ 2MSYA 3SQNA 5HS8A 4RB1A 2V79A 3K1MA 2K3PA 3E5XA 1H0MA 1ACIA 1D8JA 3OYNA 1Y8QB 5FGMA 1I6HJ 4MGRA 4WF2A 4HDUA 5HDNA 4GCVA 1AU7A 2KHMA 2OU2A 5J40A 3LQQA 3L1PA 4A3DJ 3LWFA 3TW6A 2VQGA 4XLFA 2XC7A 5FKMA 3D1NI 5HLIA 4UXNA 2WTEA 1T8IA 1SFOJ 5IPAA 1I1GA 2LBFA 4I7HA 3MWMA 1JJ6C 2M2EA 1LEAA 4R79A 1BJAA 2ELHA 3BQYA 1RZ4A 1Z77A 3OYDA 4HX4A 5E8GA 1BI3A 1CQTA 3DPUA 3IRQA 2L2OA 3DQVC 4M71A 4CUGA 2ZJPF 4A5NA 1JHFA 3JRCA 2K86A 3HL2A 3K4CA 3RI4A 3Q5FA 2BE5F 4XIDA 2MH2A 2ME0A 5LHGA 2VUMJ 3S8PA 1H9GA 2BXYA 2KZVA 2IS4A 3QWLA 3AFHA 2E1MC 1G3YA 2TCTA 4RLQA 3WTTC 1MMNA 4EQQA 2JA7J 2XHKA 3FWEA 3T5XA 2I10A 3JRBA 5DYMA 1WFXA 4QPOA 3CO6C 1A6IA 4D5FA 2H8RA 1OCRH 4CICA 2F4OB 1L0OC 3QU6A 4YELA 1SD5A 1TNSA 3DP7A 1Y39A 4IHYA 4XK4A 4M72A 1K78B 1JTYA 1WJBA 3BP8A 4I01A 3E3VA 4ZH4F 2EK5A 1WJFA 1K4TA 2XPVA 4BL0B 5BNGA 2LMDA 3KZIC 4RAYA 3HPGA 2DMUA 1WWXA 2J5OA 1D1BA 2FU4A 4KIFA 2O6GE 4YG2F 3H5RA 3Q0UA 1OR7C 2QM3A 1MBEA 4MQ9F 2R5YB 4EJVA 2MW8A 2W48A 3KYCB 3S15J 4JP0A 1YJNI 1DP3A 2P4WA 3MKWB 3ZMZA 4CCNA 1X19A 1Y0UA 1YQAA 2VKDA 3ABLH 3LSHA 3ZCOA 4EJUA 3A2KA 2DA5A 2CRGA 3KLNA 2E1OA 3BOQA 3L09A 3JREA 2E7WA 2R92J 3GTKJ 1IUFA 2HQRA 1IGNA 2LKPA 1MIJA 2DA4A 3EUAA 4E6KG 1IRZA 1T38A 5K5QA 2JMWA 2WA0A 1MNDA 5DCMB 1ETVA 5F27A 2VPLA 4OMZA 2HQNA 5J8CA 1HLVA 2BV6A 2M7AA 1YRNA 5ICEA 2KPMA 2F5DA 5J3LA 1ZREA 2KP6A 5FKNA 2CUJA 3Q9SA 3E6MA 2P7VB 3OS1A 3E6CC 3E5UA 4XSZF 2EPFA 1FTZA 3LL7A 1RRJA 1DPUA 4WXCA 3CDIA 5EEHA 4B47A 2PMZN 1BN5A 3D5RC 1E3PA 4HEA2 3CJNA 3K1NA 1XMKA 2XV4S 3QPTA 2STTA 2H1LA 4DYCA 3IWFA 2DAOA 3HKZA 4YFNF 2OQRA 3CJTB 4HF0A 2VQCA 3T8RA 3ECHA 2R5YA 9ANTA 3OL4A 4GRIA 3WHCA 5F1RA 1K6OA 5JVTA 2PJPA 5KAIC 1B9NA 3HRTA 4RM2A 4DZJA 4P9FA 2A61A 4P5OA 3T8TA 4GXOA 2JUCA 4MNUA 3KEQA 4JOMA 3DPTA 4GGGA 4KIBA 1ORKA 5IT3A 2X1DA 1MNMC 4RGSA 4OU0A 5F1JA 4JYKA 2LYCA 3KIOA 2P5LC 1YIJI 5DCMA 3SYTA 4UB8C 3SFZA 1LPQA 1NG6A 1RR7A 2VJ5A 1DGRM 4HAMA 4XRFA 2UXNA 2X1CA 2DA3A 2LG4A 3J80Z 3J7ZI 3H9QA 3ZQCA 2R93J 1ETWA 1QHGA 3VB2A 3IKTA 3LAJA 1FX7A 4XKWA 2IGOA 3GLLA 1BA5A 1FOKA 4XN3A 1UHMA 4A3MJ 5DD4A 2HXOA 3CCMI 1WJDA 3BZ6A 3IH4A 2A5WA 4HA8A 5GTIC 1SVLA 4U0YA 1IN4A 3KE2A 2LREA 1QA6A 3DXJF 2EV0A 5ICFA 2VQLA 2X51A 2H09A 4OWRB 1P7IA 1R1UA 2PQ8A 1BI0A 3WG9A 2K7LA 3NWSA 3JAMK 1HW1A 5HODA 2K9MA 3U2RA 1JGSA 1ZH5A 4KMUX 3AL0C 4PZJA 4MTEA 3WTVC 2KIMA 2LKSA 1LE8A 1JUPA 2OQGA 2FMYA 1FP2A 1JKOC 3OSGA 1OCZH 1Y1WJ 1BM9A 1YX5A 3LSMA 1FEXA 2PJRB 3ZOBA 4I2OA 2ZFUA 4TV7A 1LDDA 5HOOA 5M5YJ 1ZG3A 4DNCA 4CXFA 2COBA 3CESA 4B44A 4IHWA 4RS8A 5F04A 4RBOA 4GYGA 2EA2A 4NNJA 5IP7J 3BR6A 3HBLA 1PP8F 5EGOA 5FRMA 3BR3A 2HKXA 1W36D 1IDYA 4XOTA 1O7FA 5ILUA 2L54A 4ZYHA 2O8XA 2Y48A 1DU6A 2EWNA 5CVVA 1RUOA 3FM5A 3M7GA 5TGTA 5FJ8J 1Z3XA 3K9TA 2M30A 2KRHA 3RKYA 1B4AA 2JA8J 3RPUD 4RAZA 1IG7A 5FRNA 4WCGA 4E70A 2VE9A 3DBHB 3MKLA 2VJJA 1J5YA 2P5VA 4PJLA 3CF2A 5B3SH 1S5LC 2NS7A 1IAWA 2DT6A 4ESBA 1YS6A 1TT0A 2MBFA 4MFDA 3GLXA 4HLXA 4IF4A 4LITA 1FIAA 2DFFA 2RN7A 2MYSA 5ICCA 2EA4A 4LLGF 5FKOA 3JRIA 3WTZA 2Y9YA 3VYUB 2PJRA 2A6HF 2BHZA 3I5UA 4UVAA 3HGYA 4IHXA 1XD7A 2X6XA 3GZNB 2KZGA 5DS9A 1I27A 3BR5A 5JHUA 1B1BA 4JQFA 2XASA 2GOMA 1ZR2A 3C2GA 1W5CC 1LEBA 3OYCA 2HWVA 3MZYA 1MBFA 2QF7A 1SMYF 4U7DA 4L18B 1UZCA 4LB6B 4ITVA 3UR3C 3KZYA 3WGGA 3HDDA 3GTMJ 2VOPA 3AAFA 3SZPA 1RPWA 2QKLB 2XGCA 2Y9ZA 1TQIA 5LGUA 3GFJA 3O6BB 3SZGA 1YO5C 1UFMA 3OYKA 4J19A 1S8NA 2V6CA 3V42A 4G94A 2VT2A 2ZB9A 1YFHA 2DU9A 1TLHB 4PJJA 5H20A 2EH3A 4X1EA 3QP5A 2BVLA 1OJLA 2KISA 1TQMA 5FD5A 3DKWA 2QQBA 2EILH 5FLMJ 1WSUA 1Q1VA 3N05A 4HRIA 4E7SA 3GW2A 3JSOA 3ABUA 4A0ZA 3PNVA 3A4CA 1ETXA 2VONA 3RZOJ 4I09A 1KZHA 3IP4B 4FETA 5D4SA 4WWCA 1BC8C 2BY2A 1TWFJ 2Z16A 1QQIA 3M1CA 1U8RA 1BR1A 2HOEA 2PLYA 3ZPLA 3BG6A 2ZXIA 2VKHA 2L7FP 2VBYA 3HSFA 2R7WA 2CV2A 1ZK8A 1IN5A 1BIAA 1JT6A 2GLOA 1X1AA 3BT9A 2P81A 1DP7P 1IC8A 2R7OA 1R49A 1JKQC 1OCPA 1V5GA 3K0LA 1TW2A 1FSHA 4XR6A 2HDWA 4ASNA 2DK8A 3F9KA 4HSTA 2K40A 4PDKA 1ONVA 4PJMA 3SDBA 1MSFC 1O3TA 3FK6A 1XG1A 2R4GA 1WQ2A 3CTAA 1ZYRF 1GVDA 4ESJA 3VWBA 1BW5A 3FZVA 3FMSA 4E7LA 2N8GA 3KEYA 3CO7C 3S2DJ 4XICA 2FNAA 2XAUA 2FRHA 2Z2SB 2L9VA 1SFKA 1XDSA 3LA3A 3O3KA 2MD5A 2XPUA 4N4NB 3DTIA 4P55A 2DOEA 1IXSB 2YU3A 1K4SA 2XSDC 3S1QJ 2X6YA 3FK7A 3RZDJ 1QVUA 2VBZA 5KK1A 2DMTA 4BQQA 3CC7I 3GEZA 2K4JA 4BE1A 2L4MA 3SEZA 2R7VA 2ELKA 3D0SA 4D1QA 4LK1F 2JPBA 2Y0SA 3BLYA 5L3BA 5JVGF 3FIWA 1QO0D 4KT5C 2LY9A 4JX5A 5FLVA 4Z6YA 4G7OF 2F5VA 2E2IJ 1S3JA 3GTGJ 4JBAA 3VSKA 3I56I 1F1ZA 1MSEC 1T6SA 2WAQN 1YG2A 3HHGA 1YIOA 3CCJI 4XLNF 1VI0A 4BJTA 3CLQA 2BW3B 1HOMA 4E7IA 2FQ4A 3BZCA 2WC2A 2QZ8A 5EZHA 2M8GX 4YEJA 5L3EA 4BE2A 3Q9VA 4PK4A 4X6AJ 2E1MB 2K5CA 2RQPA 3K6GA 3MCZA 2DA7A 2H94A 4WXDA 1B72B 3LQRA 1HQCA 4BU2A 2NS8A 3K4KA 4CYDA 4D0PA 1RI7A 3BC8A 2KDZA 2G7HA 2JRTA 1JUMA 2Y0MA 4LIUA 2CG4A 1QPMA 3F23A 3FM3A 5GAEJ 1LFBA 1UG0A 2G7UA 2CU7A 3E1SA 2QBYA 4HW0A 1U8BA 3QPSA 4N9IA 2H1KA 1LKXA 2A6TA 2V9KA 2A05A 2BY0A 4MTDA 2R7XA 3CCSI 3CJRB 2NNNA 3E5QA 5FKLA 2GM4A 2IW5A 1DQUA 1GHCA 5E79C 3I0TA 2OPTA 1GT0C 2F5CA 1ZARA 3HRUA 3BPXA 1T2KA 3CLOA 1YW9A 5ILSA 3LSGA 4LK0F 4LOCA 3DEEA 4IHTA 1U0JA 2KKOA 3OWTA 4HLYA 3MKZA 2W24A 2JPCA 3KEOA 3JRFA 5IT9Z 3A1YA 1M1EB 3LMMA 4P1WA 1S29A 3HJEA 2F48A 2R7TA 3EUKL 4U7BA 3QYBA 3NQOA 1HBXG 2CO5A 2E19A 1FBUA 2KFDA 1BR4A 4I98B 3DBRB 4QTRA 4L9TA 2CH0A 3KX2A 2DYSH 3OYIA 5M5XJ 2R5ZB 4CDGA 3GTQJ 1HSJA 5B5EC 3FBIB 2IXSA 2LNBA 4KDPA 3F8CA 5J4VA 2W00A 1JXSA 4E7KA 3BG9A 4B09A 3TO9A 3M4OJ 1V54H 4FX0A 3QQAA 4O3MA 3DTKA 5KVRA 5DTDA 1F43A 4JX6A 4DQ2A 1NG7A 3E6DA 5L3DA 1P4XA 1CF7A 1FBQA 2LH9A 3GBGA 1I5ZA 4M3GA 4UV9A 5DCFA 2NS0A 2CW8A 5L3FA 3P9IA 2DOFA 4IRGA 4AWXB 2ETHA 2YPRA 3IRRA 3ZQLA 4EM1A 4HQEA 4XRSG 2W82A 1RC9A 5C3EJ 2L5QA 3FHNA 1VQ8I 4B3AA 3QYEA 2ISZA 4HZFA 4KFCA 1RETA 1P4WA 2PMHA 2DXIA 3G1LA 3HHHA 1D0ZA 2E36A 4EJOA 1U9OA 2P8TA 3OYBA 4H4KC 3DU5A 3JRAA 5F64A 3R60A 1WVRA 2AQFA 5D5UB 1USSA 1ETOA 3WGIA 4DIQA 1MDMB 2R5ZA 1E3OC 1WRJA 2IGNA 3I9V2 3RSNA 4G7ZF 1FWZA 3ESWB 3KYDB 3IUOA 3TGNA 4AIJA 4MIMA 1P6RA 4C30A 3W2VA 2EIMH 4C3JJ 2FMLA 1S7AA 2PG4A 1AOYA 3A0BC 2IGMA 3TP0A 3BCBA 3HUGB 2YX4A 4HNVA 2ZXHA 3GMEA 5F0CA 4CSWA 2IT0A 1XGNA 1YI2I 3LSJA 4M6XA 2F5EA 3M8JA 4PGHA 2V1DA 3OYJA 3LAPA 2CQ7A 2K02A 2W4SA 4L0YB 3EUHA 2ECBA 1J7KA 4II2A 4HV6A 2JK3A 2GIZA 2NOGA 2UWMA 2VOOA 3C2BA 1S7OA 5DUIA 2ZXJA 1FNNA 4Y17A 1FT9A 3HOWJ 3C2HA 3FXQA 1MDMA 1SANA 3AKZA 5HS9A 3AG1H 5ICGA 2DMNA 3EYIA 3LNQA 2Y30A 2QQAA 3C1DA 1W0TA 1X3ZB 1IXRC 3CCYA 2W7NA 4HX7A 1QVTA 2HTJA 3FKJA 4PJ0C 3I54A 5JHFA 1XCBA 2M0MA 3HUGA 5E8IA 3HGGA 4XORA 1QU3A 4LFUA 1OFCX 4BY7J 2XGDA 3H3VK 4OINF 4LMYA 3BJAA 2AS5F 3M1EA 1Y0NA 5EDNA 2OF7A 1OISA 3CCRI 2NVQJ 1JE8A 2K9NA 5E3OA 2WBMA 1FOWA 3HSEA 1JTXA 4BY1J 2RAEA 2CQXA 2MABA 1Y8RB 1D1AA 3H3UA 4BDZA 2EFNA 4LG3A 2IJLA 1SFEA 2ZSHB 1B9MA 2V26A 4AU7A 3HOTA 3ELKA 3K2ZA 2GXAA 3H0DA 4OIPF 2HYFA 3J7YJ 2NVTJ 1YRNB 2Q8KA 5JR3A 3SJMA 5F0FA 1T0FA 4PJNA 2R7ZJ 3PIPF 3L2WA 4V19K 2QGUA 2L3DA 4EM0B 4Y13A 2CV1A 1RIOH 4A3KJ 4DBQA 1IRGA 1WH7A 4PGGA 2K85A 1HDDC 2DK5A 4B43A 1MMGA 3D5LA 2ZKZA 2LDUA 2W25A 2LD5A 1G2HA 1ERDA 5LEKA 4IQJA 3O2PE 2L0KA 1ETQA 3HZJA 4IRIA 5D8LB 4G8XA 3N4MA 3G1MA 3IL2A 2IS1A 3BR2A 3H35A 2Y69H 4N0BA 1UAAA 4LG0B 2EZLA 5LD2C 1FY7A 1R5HA 2XKPA 4FCYA 2Z5UA 2BYVE 2X9DA 2QQ9A 4BJ6C 1FMVA 4OMYA 1FMWA 3BCAA 3K4JA 2OD5A 2JVGA 2M3AA 2OV7A 3VSLA 3VODA 1NHAA 1SFXA 4MO7A 3WU2C 1YW7A 2IS6A 2VI6A 1WHUA 2LTPA 3WODF 1IN7A 4G9YA 3ZP5A 4RGRA 2VQHA 1WCMJ 2IP2A 3F3XA 2NYXA 2WAEA 3IH3A 3RKXA 4N9HA 3E0JB 3RQIA 3GX4X 3S3NA 3KZZA 5FKKA 2XF5A 3DCFA 2Z3YA 2AXTC 2E60A 3FKIJ 4HV5A 2ZNYA 4XONA 3HEFA 1I39A 3W3CA 1Z21A 3OOUA 4Y4RA 5DM7F 1CGPA 5B66C 4EJWA 5EF6A 3RQ4A 4BS9A 3EUHC 3L00A 3F6VA 3F8NA 4FT8A 2NVUB 4BHBA 3HOZJ 1D0YA 4C3IJ 3MAJA 3WE2A 3VEPA 1VQ7I 4G6DA 1LB2A 2H27A 2B7EA 2ZXWH 3NEUA 3TDUC 4XRSA 3VYSB 3F21A 1LE8B 4EV0A 2ZMEA 4LG0A 3TL4X 1AHDP 4R8HA 1KU2A 2DTZA 1OQYA 2GXGA
chains in the Genus database with same CATH topology
1H9TA 4Z2YA 2A3SA 1Z1DA 1SAXA 2D1HA 1BI1A 1K79A 3KFWX 4AD9A 5D5VB 4ENKA 3J80K 3G3ZA 1ZG5A 1J59A 2M5WA 4UVBA 5K5RA 1L3LA 1R58A 2KIUA 3ERED 1O3RA 1OYYA 4A5MA 4M9XA 3MQ0A 3I53A 2GZWA 1KU9A 2DTRA 3VOEA 4PCQA 1ZN2A 2LSOA 2O03A 3PFIA 2CWEA 3JTGA 4UUVA 1BOAA 3JAMZ 1BBYA 2ZCWA 2FOKA 1TTYA 1I6XA 2GXBA 3CDHA 4ENMA 3QAHA 4BXUA 3QRFF 1S6LA 2VN2A 3BY6A 1U3EM 3ROUA 4M6YA 1P2FA 4L5IA 2C6YA 1WI9A 2EV5A 4WX9A 4JK1X 3ZQ7A 3IC7A 2XAHA 3GYHX 2DBBA 4EGYA 1ZHFA 2DPDA 1LNWA 1KA8A 2IRFG 2H6BA 5LBQA 1R1VA 2M1BA 2FBIA 1KU7A 3QP6A 4Q4ZF 4EJTA 3K69A 1XCVA 4I0BA 2EFQA 2O3FA 4BHCA 2FF4A 3P7NA 2L4AA 1ZAOA 2KRFA 3ECOA 1XGOA 1LVAA 4ZZLA 4HX8A 3C3WA 2ESNA 3KP4A 1R5GA 2FXAA 2VODA 2V9VA 3BJ6A 3FX3A 2OZUA 3FF5A 1XB4A 2FSWA 3ISPA 1OPCA 1IF1A 4BHPA 3H3ZA 2R7DA 3TO6A 3F8MA 3TQNA 3J81Z 1HKTA 2ZFWA 5TJJA 2HKOA 3BJOA 1C0WA 3RPQA 1P92A 3I58A 3LSTA 1QZZA 1Z9CA 2V1UA 1X3UA 2F5FA 4UVCA 4UNOA 4XLPF 3HRMA 2DT5A 2IA1A 4YFKF 2HDCA 1OMIA 3LA7A 2P5KA 1TBXA 1QZYA 3HYIA 5A2QK 1HW5A 1V3FA 4I0AA 3RYRA 3GFMA 4L5JA 1G3TA 3FXUA 3F6OA 1O7LA 2WV0A 3RYPA 1XGSA 1FYMA 4R1HA 1MJAA 5CVIA 2QBYB 1B6AA 3U9GA 3JW4A 2F2EA 4IHSA 2EV6A 4G7HF 1Z6TA 1ODDA 3K1PA 3RKWA 2STWA 1DDNA 3QPHA 5H6RA 5K1YA 4EMSA 2ZO4A 1XGMA 3GF2A 1XSVA 4Q47A 1SD6A 1EH8A 4ESFA 1ZRDA 1MKMA 4YFXF 1FYLA 3WTUC 1FLIA 1ZLJA 3I64A 2R3SA 1BC7C 2RKHA 2P6TA 3F22A 3CUQA 4ENNA 3FXRA 2QLZA 1XMAA 4LLNA 1UB9A 3I71A 2RV8A 4HBLA 2HGCA 1FYKA 4P96A 1HSTA 1CF7B 5FFXA 2FEZA 3PQJA 2GWRA 2Q2EA 5L3GA 1U5TB 3W6KB 4IJAA 3ABTA 4KNYA 1QNTA 5CLSA 2VBWA 3IWZA 2G9WA 3P9CA 2GAUA 3ZMSA 5BOXA 1STZA 4MHGA 1FZPB 3CUOA 3T1BA 1YTYA 3ZMVA 3L2CA 5IT9K 3MEXA 2YSRA 4YIFA 4IRHA 4RB3C 2MLGA 4LB5A 2XROA 3M9AA 3ML6A 4BNCA 3WU1B 3V7CA 2FNPA 1SD7A 1Z05A 2Z33A 2CW0F 2OBPA 5JFRA 2LF7A 5E1ZB 3B02A 2W57A 3V8JA 4IXAA 3LFKA 3HTUA 5BPIA 1U5TA 3L9FA 3HIFA 4OIQF 2D2WA 1ZLKA 2NAZA 4CO8A 5D6FA 3QOPA 4WXHA 4IPAA 5FLXZ 2Y75A 5H6QA 5CYVA 1JHHA 4O6JA 5AIPA 1IZ1A 4A6DA 1Z91A 1XSDA 4LLLA 2XVCA 4H0EA 4HF2A 1TNTA 2A6EF 2XUBA 4CGZA 1GXQA 2E7XA 1ON1A 3KP2A 3BROA 3R61A 1IN8A 1ZRCA 2RC4A 1R7JA 5BS6A 5LHHA 2B0LA 1MJ9A 4A0YA 4CHUA 2A5YB 1ON2A 4GO1A 1W5SA 5AONA 1IW7F 2RDPA 4ETSA 2LF8A 2EJRA 3F72A 4MEXF 3E6BA 3WU0A 2J5PA 1XDUA 4WK8F 3GFLA 4FX4A 5FFZA 3FMQA 3V8LA 5HDGA 1W5TA 2XRNA 1IXCA 5DUKA 1KYWA 2Z99A 5D4RA 4UHTA 1J9IA 2CGPA 2CSOA 3CUQC 5LLQA 3WE3A 3F8FA 5FD6A 3COAC 1W7PB 4A2UA 2TDXA 2BEOA 2ZJ2A 2FBHA 5HDKA 1W4MA 2IA0A 1R36A 2QVOA 4U88A 5CJ9A 2UXXA 2X0LA 1QBJA 2RNJA 5HLGA 1LDKB 1U2WA 5BMZA 4Q48A 5HS7A 3GUDA 1GXPA 3ZMDA 1D3YA 1WKMA 5LRRA 1R00A 2UZKA 2VE8A 3DFGA 1YLFA 3T0YA 2FBKA 3BPVA 2CQKA 1KYZA 3I59B 1O57A 1W7PA 4NQWA 3EDPA 2XAQA 2BGCA 1Z7UA 1U5TC 2EB7A 1ZG1A 4KN7X 2CYYA 5FB2A 3WTSC 1KQ9A 3L7WA 3BWGA 3RDIA 5K5OA 4KIGA 1MGTA 4P9UA 1G3SA 1U6GA 2PI0A 3JTHA 4U0WA 2AXLA 2ZMEB 3OV8A 4KN4X 3P9KA 1PDNC 2O0YA 1OKRA 4XBFA 2Q0OA 2XIGA 3LA2A 4AIHA 4ZYDA 1HKSA 2EFWA 4I02A 4M9SA 3GZ6A 3IHUA 2FA5A 3KP6A 5J6XA 2QWWA 3I59A 3R0AA 1QGPA 4QLCU 3NRVA 2ZNZA 3F8BA 2MC3A 4ON0A 3TOBA 4OIOF 1KQ0A 1EV7A 5HLHA 1LDJA 4M73A 4Y15A 3W6JB 4A6EA 1K78A 2FE3A 2VXZA 3MZHA 3IKVA 2ACJA 2DQLA 2D1VA 1D5VA 3S2WA 2EFPA 3GXOA 3EQLF 3KETA 2RVCA 2XAJA 4ZYEA 3JSPA 3WTYC 3V4GA 2DLLA 2DI3A 2A68F 3H92A 1FP1D 2P7CB 1UCRA 3I4PA 5ILVA 3U1DA 1DPRA 4LJZF 2HTSA 3SZTA 3GO5A 3GFIA 3EYYA 5F6FA 3OOPA 5E18F 2Z9OA 5CVJA 4EM2A 2MA3A 3RTRA 3KP5A 3HRSA 2M8EA 5E20A 2DQRA 4S05A 2CFXA 1J2XA 4GYIA 2O61A 5DD8A 4A0XA 1FBSA 2JT1A 3WTWC 3ZMUA 1G3WA 3SHFA 4EGZA 1DUXC 4IVNA 1R1TA 1T39A 5D5WB 2V1XA 3M8FA 1E17A 1Z6RA 2PMUA 1U78A 1KGSA 3FHZA 4OIRF 4L9JA 2IVMA 3HOSA 2HS5A 4A12A 2HZTA 3MFKA 3ZN1A 3QU3A 3M8EA 1HXDA 2XAGA 1XN7A 2L01A 3RJPA 4NB5A 2X4HA 4MQVA 5ERIA 5E17F 2RGVA 3R4KA 1R22A 3V7SA 2VT3A 1HW2A 1RUNA 2ADUA 1XSXA 2PFBA 4M9ZA 3KLOA 3DPLC 5BPDA 1SFUA 2KIFA 3KP7A 5D8KB 4RB2C 4KUMA 4FHTA 4HDVA 2JZYA 3C18A 4L9VA 4KMFA 4HOBA 2OAZA 2VC0A 4HF1A 2VC1A 5L3CA 2XKOA 3J81K 4CZZA 1BI2A 1FC3A 1FPQA 3J7AO 2NNYA 4LD5A 2GA2A 3DF8A 3DV8A 1USTA 2DFIA 4B8XA 4KYWA 5LRSA 2GQQA 3HTSB 2BBYA 2WWYA 4AVPA 1F9NA 5LGTA 1YS7A 2HYGD 4G6QA 1MD0A 2YR2A 1O3SA 2EFOA 4MEYF 1AWCA 1BIBA 5LHIA 4OOIA 3CUQB 3EETA 4LGWA 5A2QZ 3G73A 4M74A 1D8KA 3N97A 1J75A 2YX7A 3V7RA 1VTNC 3TOAA 2GIVA 2HEOA 1F5TA 1OYWA 1R23A 1ULYA 4AIKA 4L9NA 1V4RA 3TO7A 1KU3A 3VFZA 4KICA 1TW3A 5HVQC 5E1XA 2GA1A 1SD4A 1EH7A 1SMTA 1PUEE 2IPQX 1Q1HA 1FSEA 4HYEA 1I1SA 3KCCA 4NHJA 5DDGA 4ZZDA 5EEGA 2R7FA 3GVAA 2DW4A 3B73A 3PQKA 5LGNA 1J0RA 2L02A 4BYYA 3KP3A 3C7JA 3R6SA 2K4BA 5FO5A 5AIQA 2JTVA 3RPUA 1B59A 1IN6A 2A69F 2DO7A 5TRDA 2PBIA 3GZ5A 4QWQA 3TKYA 1HKQA 1T98A 5ED4A 3GWZA 4Q5SF 4UV8A 3WTXC 2M45A 1TQPA 2XAFA 1ZGAA 1A04A 1YW8A 5DEQA 1W7PD 1E2XA 4KA4A 4BQAA 1ZGJA 2HR3A 1G6NA 3SXYA 2JSCA 3RIRA 4O5VA 4RB0A 2XGXA 2M87A 2A07F 3ULQB 5BQTA 2P6SA 2K27A 1GVJA 3DEUA 2OZ6A 2E1NA 4ENJA 1KQ8A 1F4KA 2ISYA 4ZYGA 2H6CA 2QENA 5CVUA 3WGHA 1RNLA 1K7AA 2HFHA 2W84A 2OA4A 1LJ9A 5CVRA 2QYOA 1LQ1A 5FLXK 2E1CA 2DPUA 4K2EA 5DV5A 4L0ZB 3FMRA 3HSRA 2ZBKA 1G4DA 2PN6A 2KJBA 1P4AA 2KJCA 1OR7A 4BAYA 4EVIA 4HQMA 5D6EA 2MLKA 4U0VA 1PP7U 4XSXF 5E1WA 5J8FA 1EH6A 3BDDA 1IRFA 3REOA 2QUFA 4RGUA 3R0JA 4RGXA 4F7ZA 2PEXA 3ZN0A 2VBXA 5D5XB 2COMA 2IA2A 3TDZC 1OYIA 4YIIA 2W85A 5JI6A 2NRAC 1MJBA 3E97A 1UHWA 1YYVA 2MH9A 1REPC 2D45A 3ZMTA 5LEJA 2FQ3A 3V8KA 1MZBA 1ZRFA 2ESHA 4S04A 6PAXA 1O3QA 4BH9A 3SQNA 5HS8A 4RB1A 2V79A 3K1MA 3E5XA 1H0MA 1D8JA 5FGMA 4MGRA 4WF2A 4HDUA 5HDNA 4GCVA 2OU2A 3LQQA 3LWFA 5HLIA 4UXNA 2WTEA 1I1GA 4I7HA 3MWMA 1LEAA 4R79A 1BJAA 2ELHA 1RZ4A 4HX4A 5E8GA 1BI3A 3IRQA 3DQVC 4M71A 4A5NA 1JHFA 2K86A 3RI4A 3Q5FA 2BE5F 2MH2A 5LHGA 1H9GA 1G3YA 3WTTC 4EQQA 2XHKA 3FWEA 3T5XA 5DYMA 3CO6C 4CICA 1L0OC 3QU6A 1SD5A 1TNSA 3DP7A 4M72A 1K78B 3BP8A 4I01A 4ZH4F 3E3VA 2EK5A 4RAYA 1WWXA 2J5OA 4KIFA 2FU4A 2O6GE 4YG2F 2QM3A 4MQ9F 4EJVA 2P4WA 3ZMZA 1Y0UA 1YQAA 4EJUA 3KLNA 3BOQA 3L09A 2E7WA 2HQRA 2LKPA 1T38A 5K5QA 5DCMB 4OMZA 2HQNA 5J8CA 2BV6A 5ICEA 2F5DA 1ZREA 3Q9SA 3E6MA 2P7VB 3E6CC 3E5UA 4XSZF 1DPUA 4WXCA 5EEHA 1BN5A 3CJNA 3K1NA 1XMKA 2XV4S 3QPTA 2STTA 3IWFA 2DAOA 4YFNF 2OQRA 4HF0A 3T8RA 3ECHA 5F1RA 1K6OA 5JVTA 2PJPA 1B9NA 3HRTA 4P9FA 2A61A 4P5OA 3T8TA 4GXOA 4MNUA 3KEQA 3DPTA 4GGGA 4KIBA 5IT3A 4RGSA 4OU0A 2P5LC 5DCMA 3SFZA 4XRFA 3J80Z 4HAMA 1IUYA 2UXNA 3VB2A 3IKTA 3LAJA 1FX7A 1FOKA 1UHMA 5DD4A 3BZ6A 4HA8A 4U0YA 1IN4A 3KE2A 3DXJF 2EV0A 5ICFA 2H09A 1R1UA 2PQ8A 1BI0A 3WG9A 2K7LA 3JAMK 1HW1A 3U2RA 1JGSA 1ZH5A 4KMUX 4PZJA 4MTEA 3WTVC 2KIMA 2OQGA 2FMYA 1FP2A 1BM9A 4I2OA 4TV7A 1LDDA 5HOOA 1ZG3A 4DNCA 4CXFA 4RS8A 4GYGA 2EA2A 1PP8F 2HKXA 1O7FA 5ILUA 2L54A 4ZYHA 2O8XA 2Y48A 2EWNA 5CVVA 1RUOA 3FM5A 3M7GA 3K9TA 2M30A 3RKYA 1B4AA 4RAZA 4WCGA 4E70A 2VE9A 1J5YA 2P5VA 1IAWA 4ESBA 1YS6A 2MBFA 3GLXA 4HLXA 4IF4A 2RN7A 5ICCA 2EA4A 4LLGF 3WTZA 2A6HF 3I5UA 4UVAA 1XD7A 1I27A 5JHUA 1B1BA 4JQFA 2XASA 1LEBA 2HWVA 3MZYA 1SMYF 4U7DA 4L18B 4LB6B 3WGGA 3KZYA 2VOPA 3AAFA 3SZPA 1TQIA 5LGUA 3GFJA 3O6BB 1YO5C 1UFMA 1S8NA 2V6CA 4G94A 2VT2A 1YFHA 2DU9A 1TLHB 5H20A 3QP5A 1TQMA 5FD5A 3DKWA 2QQBA 1WSUA 3GW2A 3JSOA 3ABUA 4A0ZA 2VONA 4I09A 5D4SA 4WWCA 1BC8C 1QQIA 1U8RA 2HOEA 2PLYA 3ZPLA 2VBYA 3HSFA 1IN5A 1BIAA 1DP7P 3K0LA 1TW2A 1FSHA 4ASNA 2DK8A 4PDKA 1ONVA 1O3TA 1WQ2A 3CTAA 1ZYRF 4ESJA 3FZVA 3FMSA 3CO7C 2FNAA 2FRHA 1XDSA 3LA3A 3O3KA 2MD5A 4P55A 1IXSB 2YU3A 5KK1A 2VBZA 3GEZA 2K4JA 2L4MA 3D0SA 4LK1F 2JPBA 5L3BA 1QO0D 4KT5C 4G7OF 1S3JA 4JBAA 1F1ZA 1T6SA 1YG2A 3HHGA 1YIOA 4XLNF 2WC2A 2QZ8A 5L3EA 3Q9VA 2RQPA 3MCZA 2H94A 4WXDA 3LQRA 1HQCA 4CYDA 4D0PA 1RI7A 2G7HA 2JRTA 2Y0MA 2CG4A 1QPMA 3F23A 3FM3A 2G7UA 2QBYA 4HW0A 4N9IA 4MTDA 2NNNA 3E5QA 2IW5A 1GHCA 3I0TA 2F5CA 1ZARA 3HRUA 3BPXA 1T2KA 3CLOA 1YW9A 5ILSA 4LK0F 4IHTA 2KKOA 4HLYA 2W24A 2JPCA 3KEOA 5IT9Z 1S29A 4U7BA 3NQOA 1HBXG 2CO5A 1FBUA 4I98B 4L9TA 4CDGA 1HSJA 2LNBA 4KDPA 3F8CA 1JXSA 4B09A 3TO9A 4FX0A 4O3MA 5KVRA 4DQ2A 3E6DA 5L3DA 1P4XA 1CF7A 1FBQA 4UV9A 5DCFA 1I5ZA 2NS0A 5L3FA 3P9IA 4IRGA 4AWXB 2ETHA 2YPRA 3IRRA 4EM1A 4HQEA 2ISZA 4HZFA 4KFCA 1P4WA 2PMHA 3HHHA 4EJOA 2P8TA 5F64A 3R60A 5D5UB 1USSA 3WGIA 1MDMB 1WRJA 4G7ZF 1FWZA 3TGNA 4AIJA 1P6RA 2FMLA 1S7AA 2PG4A 1AOYA 2YX4A 2IT0A 1XGNA 4M6XA 2F5EA 4PGHA 2V1DA 3LAPA 2K02A 4L0YB 3EUHA 1J7KA 4HV6A 2UWMA 2VOOA 1S7OA 5DUIA 2ZXJA 1FNNA 4Y17A 1FT9A 3FXQA 1MDMA 5HS9A 5ICGA 3EYIA 3C1DA 2QQAA 1IXRC 4HX7A 2HTJA 3I54A 1XCBA 3HUGA 5E8IA 4LFUA 4OINF 4LMYA 3BJAA 2AS5F 3M1EA 1JE8A 3HSEA 3H3UA 2EFNA 2IJLA 3HOTA 1SFEA 1B9MA 3ELKA 3K2ZA 4OIPF 2HYFA 2Q8KA 5JR3A 1T0FA 2L3DA 4EM0B 4Y13A 1RIOH 1IRGA 4PGGA 2DK5A 3D5LA 2ZKZA 2LDUA 2W25A 5LEKA 3O2PE 4IRIA 5D8LB 4G8XA 3N4MA 3IL2A 4N0BA 4LG0B 1FY7A 1R5HA 2XKPA 2Z5UA 2BYVE 2QQ9A 4OMYA 2OD5A 3VODA 1NHAA 1SFXA 1YW7A 3WODF 1IN7A 4G9YA 3ZP5A 4RGRA 2IP2A 3F3XA 2NYXA 3RKXA 4N9HA 3GX4X 3KZZA 2Z3YA 4HV5A 2ZNYA 1CGPA 4EJWA 3L00A 3F6VA 3F8NA 4FT8A 4BHBA 3MAJA 3WE2A 3VEPA 4G6DA 1LB2A 2H27A 3NEUA 3TDUC 3F21A 4EV0A 2ZMEA 4LG0A 4R8HA 1KU2A 2GXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9T A;  4Z2Y A;  2A3S A;  1Z1D A;  1SAX A;  2D1H A;  1BI1 A;  1K79 A;  3KFW X;  4AD9 A;  5D5V B;  4ENK A;  3J80 K;  3G3Z A;  1ZG5 A;  1J59 A;  2M5W A;  4UVB A;  5K5R A;  1L3L A;  1R58 A;  2KIU A;  3ERE D;  1O3R A;  1OYY A;  4A5M A;  4M9X A;  3MQ0 A;  3I53 A;  2GZW A;  1KU9 A;  2DTR A;  3VOE A;  4PCQ A;  1ZN2 A;  2LSO A;  2O03 A;  3PFI A;  2CWE A;  3JTG A;  4UUV A;  1BOA A;  3JAM Z;  1BBY A;  2ZCW A;  2FOK A;  1TTY A;  1I6X A;  2GXB A;  3CDH A;  4ENM A;  3QAH A;  4BXU A;  3QRF F;  1S6L A;  2VN2 A;  3BY6 A;  1U3E M;  3ROU A;  4M6Y A;  1P2F A;  4L5I A;  2C6Y A;  1WI9 A;  2EV5 A;  4WX9 A;  4JK1 X;  3ZQ7 A;  3IC7 A;  2XAH A;  3GYH X;  2DBB A;  4EGY A;  1ZHF A;  2DPD A;  1LNW A;  1KA8 A;  2IRF G;  2H6B A;  5LBQ A;  1R1V A;  2M1B A;  2FBI A;  1KU7 A;  3QP6 A;  4Q4Z F;  4EJT A;  3K69 A;  1XCV A;  4I0B A;  2EFQ A;  2O3F A;  4BHC A;  2FF4 A;  3P7N A;  2L4A A;  1ZAO A;  2KRF A;  3ECO A;  1XGO A;  1LVA A;  4ZZL A;  4HX8 A;  3C3W A;  2ESN A;  3KP4 A;  1R5G A;  2FXA A;  2VOD A;  2V9V A;  3BJ6 A;  3FX3 A;  2OZU A;  3FF5 A;  1XB4 A;  2FSW A;  3ISP A;  1OPC A;  1IF1 A;  4BHP A;  3H3Z A;  2R7D A;  3TO6 A;  3F8M A;  3TQN A;  3J81 Z;  1HKT A;  2ZFW A;  5TJJ A;  2HKO A;  3BJO A;  1C0W A;  3RPQ A;  1P92 A;  3I58 A;  3LST A;  1QZZ A;  1Z9C A;  2V1U A;  1X3U A;  2F5F A;  4UVC A;  4UNO A;  4XLP F;  3HRM A;  2DT5 A;  2IA1 A;  4YFK F;  2HDC A;  1OMI A;  3LA7 A;  2P5K A;  1TBX A;  1QZY A;  3HYI A;  5A2Q K;  1HW5 A;  1V3F A;  4I0A A;  3RYR A;  3GFM A;  4L5J A;  1G3T A;  3FXU A;  3F6O A;  1O7L A;  2WV0 A;  3RYP A;  1XGS A;  1FYM A;  4R1H A;  1MJA A;  5CVI A;  2QBY B;  1B6A A;  3U9G A;  3JW4 A;  2F2E A;  4IHS A;  2EV6 A;  4G7H F;  1Z6T A;  1ODD A;  3K1P A;  3RKW A;  2STW A;  1DDN A;  3QPH A;  5H6R A;  5K1Y A;  4EMS A;  2ZO4 A;  1XGM A;  3GF2 A;  1XSV A;  4Q47 A;  1SD6 A;  1EH8 A;  4ESF A;  1ZRD A;  1MKM A;  4YFX F;  1FYL A;  3WTU C;  1FLI A;  1ZLJ A;  3I64 A;  2R3S A;  1BC7 C;  2RKH A;  2P6T A;  3F22 A;  3CUQ A;  4ENN A;  3FXR A;  2QLZ A;  1XMA A;  4LLN A;  1UB9 A;  3I71 A;  2RV8 A;  4HBL A;  2HGC A;  1FYK A;  4P96 A;  1HST A;  1CF7 B;  5FFX A;  2FEZ A;  3PQJ A;  2GWR A;  2Q2E A;  5L3G A;  1U5T B;  3W6K B;  4IJA A;  3ABT A;  4KNY A;  1QNT A;  5CLS A;  2VBW A;  3IWZ A;  2G9W A;  3P9C A;  2GAU A;  3ZMS A;  5BOX A;  1STZ A;  4MHG A;  1FZP B;  3CUO A;  3T1B A;  1YTY A;  3ZMV A;  3L2C A;  5IT9 K;  3MEX A;  2YSR A;  4YIF A;  4IRH A;  4RB3 C;  2MLG A;  4LB5 A;  2XRO A;  3M9A A;  3ML6 A;  4BNC A;  3WU1 B;  3V7C A;  2FNP A;  1SD7 A;  1Z05 A;  2Z33 A;  2CW0 F;  2OBP A;  5JFR A;  2LF7 A;  5E1Z B;  3B02 A;  2W57 A;  3V8J A;  4IXA A;  3LFK A;  3HTU A;  5BPI A;  1U5T A;  3L9F A;  3HIF A;  4OIQ F;  2D2W A;  1ZLK A;  2NAZ A;  4CO8 A;  5D6F A;  3QOP A;  4WXH A;  4IPA A;  5FLX Z;  2Y75 A;  5H6Q A;  5CYV A;  1JHH A;  4O6J A;  5AIP A;  1IZ1 A;  4A6D A;  1Z91 A;  1XSD A;  4LLL A;  2XVC A;  4H0E A;  4HF2 A;  1TNT A;  2A6E F;  2XUB A;  4CGZ A;  1GXQ A;  2E7X A;  1ON1 A;  3KP2 A;  3BRO A;  3R61 A;  1IN8 A;  1ZRC A;  2RC4 A;  1R7J A;  5BS6 A;  5LHH A;  2B0L A;  1MJ9 A;  4A0Y A;  4CHU A;  2A5Y B;  1ON2 A;  4GO1 A;  1W5S A;  5AON A;  1IW7 F;  2RDP A;  4ETS A;  2LF8 A;  2EJR A;  3F72 A;  4MEX F;  3E6B A;  3WU0 A;  2J5P A;  1XDU A;  4WK8 F;  3GFL A;  4FX4 A;  5FFZ A;  3FMQ A;  3V8L A;  5HDG A;  1W5T A;  2XRN A;  1IXC A;  5DUK A;  1KYW A;  2Z99 A;  5D4R A;  4UHT A;  1J9I A;  2CGP A;  2CSO A;  3CUQ C;  5LLQ A;  3WE3 A;  3F8F A;  5FD6 A;  3COA C;  1W7P B;  4A2U A;  2TDX A;  2BEO A;  2ZJ2 A;  2FBH A;  5HDK A;  1W4M A;  2IA0 A;  1R36 A;  2QVO A;  4U88 A;  5CJ9 A;  2UXX A;  2X0L A;  1QBJ A;  2RNJ A;  5HLG A;  1LDK B;  1U2W A;  5BMZ A;  4Q48 A;  5HS7 A;  3GUD A;  1GXP A;  3ZMD A;  1D3Y A;  1WKM A;  5LRR A;  1R00 A;  2UZK A;  2VE8 A;  3DFG A;  1YLF A;  3T0Y A;  2FBK A;  3BPV A;  2CQK A;  1KYZ A;  3I59 B;  1O57 A;  1W7P A;  4NQW A;  3EDP A;  2XAQ A;  2BGC A;  1Z7U A;  1U5T C;  2EB7 A;  1ZG1 A;  4KN7 X;  2CYY A;  5FB2 A;  3WTS C;  1KQ9 A;  3L7W A;  3BWG A;  3RDI A;  5K5O A;  4KIG A;  1MGT A;  4P9U A;  1G3S A;  1U6G A;  2PI0 A;  3JTH A;  4U0W A;  2AXL A;  2ZME B;  3OV8 A;  4KN4 X;  3P9K A;  1PDN C;  2O0Y A;  1OKR A;  4XBF A;  2Q0O A;  2XIG A;  3LA2 A;  4AIH A;  4ZYD A;  1HKS A;  2EFW A;  4I02 A;  4M9S A;  3GZ6 A;  3IHU A;  2FA5 A;  3KP6 A;  5J6X A;  2QWW A;  3I59 A;  3R0A A;  1QGP A;  4QLC U;  3NRV A;  2ZNZ A;  3F8B A;  2MC3 A;  4ON0 A;  3TOB A;  4OIO F;  1KQ0 A;  1EV7 A;  5HLH A;  1LDJ A;  4M73 A;  4Y15 A;  3W6J B;  4A6E A;  1K78 A;  2FE3 A;  2VXZ A;  3MZH A;  3IKV A;  2ACJ A;  2DQL A;  2D1V A;  1D5V A;  3S2W A;  2EFP A;  3GXO A;  3EQL F;  3KET A;  2RVC A;  2XAJ A;  4ZYE A;  3JSP A;  3WTY C;  3V4G A;  2DLL A;  2DI3 A;  2A68 F;  3H92 A;  1FP1 D;  2P7C B;  1UCR A;  3I4P A;  5ILV A;  3U1D A;  1DPR A;  4LJZ F;  2HTS A;  3SZT A;  3GO5 A;  3GFI A;  3EYY A;  5F6F A;  3OOP A;  5E18 F;  2Z9O A;  5CVJ A;  4EM2 A;  2MA3 A;  3RTR A;  3KP5 A;  3HRS A;  2M8E A;  5E20 A;  2DQR A;  4S05 A;  2CFX A;  1J2X A;  4GYI A;  2O61 A;  5DD8 A;  4A0X A;  1FBS A;  2JT1 A;  3WTW C;  3ZMU A;  1G3W A;  3SHF A;  4EGZ A;  1DUX C;  4IVN A;  1R1T A;  1T39 A;  5D5W B;  2V1X A;  3M8F A;  1E17 A;  1Z6R A;  2PMU A;  1U78 A;  1KGS A;  3FHZ A;  4OIR F;  4L9J A;  2IVM A;  3HOS A;  2HS5 A;  4A12 A;  2HZT A;  3MFK A;  3ZN1 A;  3QU3 A;  3M8E A;  1HXD A;  2XAG A;  1XN7 A;  2L01 A;  3RJP A;  4NB5 A;  2X4H A;  4MQV A;  5ERI A;  5E17 F;  2RGV A;  3R4K A;  1R22 A;  3V7S A;  2VT3 A;  1HW2 A;  1RUN A;  2ADU A;  1XSX A;  2PFB A;  4M9Z A;  3KLO A;  3DPL C;  5BPD A;  1SFU A;  2KIF A;  3KP7 A;  5D8K B;  4RB2 C;  4KUM A;  4FHT A;  4HDV A;  2JZY A;  3C18 A;  4L9V A;  4KMF A;  4HOB A;  2OAZ A;  2VC0 A;  4HF1 A;  2VC1 A;  5L3C A;  2XKO A;  3J81 K;  4CZZ A;  1BI2 A;  1FC3 A;  1FPQ A;  3J7A O;  2NNY A;  4LD5 A;  2GA2 A;  3DF8 A;  3DV8 A;  1UST A;  2DFI A;  4B8X A;  4KYW A;  5LRS A;  2GQQ A;  3HTS B;  2BBY A;  2WWY A;  4AVP A;  1F9N A;  5LGT A;  1YS7 A;  2HYG D;  4G6Q A;  1MD0 A;  2YR2 A;  1O3S A;  2EFO A;  4MEY F;  1AWC A;  1BIB A;  5LHI A;  4OOI A;  3CUQ B;  3EET A;  4LGW A;  5A2Q Z;  3G73 A;  4M74 A;  1D8K A;  3N97 A;  1J75 A;  2YX7 A;  3V7R A;  1VTN C;  3TOA A;  2GIV A;  2HEO A;  1F5T A;  1OYW A;  1R23 A;  1ULY A;  4AIK A;  4L9N A;  1V4R A;  3TO7 A;  1KU3 A;  3VFZ A;  4KIC A;  1TW3 A;  5HVQ C;  5E1X A;  2GA1 A;  1SD4 A;  1EH7 A;  1SMT A;  1PUE E;  2IPQ X;  1Q1H A;  1FSE A;  4HYE A;  1I1S A;  3KCC A;  4NHJ A;  5DDG A;  4ZZD A;  5EEG A;  2R7F A;  3GVA A;  2DW4 A;  3B73 A;  3PQK A;  5LGN A;  1J0R A;  2L02 A;  4BYY A;  3KP3 A;  3C7J A;  3R6S A;  2K4B A;  5FO5 A;  5AIQ A;  2JTV A;  3RPU A;  1B59 A;  1IN6 A;  2A69 F;  2DO7 A;  5TRD A;  2PBI A;  3GZ5 A;  4QWQ A;  3TKY A;  1HKQ A;  1T98 A;  5ED4 A;  3GWZ A;  4Q5S F;  4UV8 A;  3WTX C;  2M45 A;  1TQP A;  2XAF A;  1ZGA A;  1A04 A;  1YW8 A;  5DEQ A;  1W7P D;  1E2X A;  4KA4 A;  4BQA A;  1ZGJ A;  2HR3 A;  1G6N A;  3SXY A;  2JSC A;  3RIR A;  4O5V A;  4RB0 A;  2XGX A;  2M87 A;  2A07 F;  3ULQ B;  5BQT A;  2P6S A;  2K27 A;  1GVJ A;  3DEU A;  2OZ6 A;  2E1N A;  4ENJ A;  1KQ8 A;  1F4K A;  2ISY A;  4ZYG A;  2H6C A;  2QEN A;  5CVU A;  3WGH A;  1RNL A;  1K7A A;  2HFH A;  2W84 A;  2OA4 A;  1LJ9 A;  5CVR A;  2QYO A;  1LQ1 A;  5FLX K;  2E1C A;  2DPU A;  4K2E A;  5DV5 A;  4L0Z B;  3FMR A;  3HSR A;  2ZBK A;  1G4D A;  2PN6 A;  2KJB A;  1P4A A;  2KJC A;  1OR7 A;  4BAY A;  4EVI A;  4HQM A;  5D6E A;  2MLK A;  4U0V A;  1PP7 U;  4XSX F;  5E1W A;  5J8F A;  1EH6 A;  3BDD A;  1IRF A;  3REO A;  2QUF A;  4RGU A;  3R0J A;  4RGX A;  4F7Z A;  2PEX A;  3ZN0 A;  2VBX A;  5D5X B;  2COM A;  2IA2 A;  3TDZ C;  1OYI A;  4YII A;  2W85 A;  5JI6 A;  2NRA C;  1MJB A;  3E97 A;  1UHW A;  1YYV A;  2MH9 A;  1REP C;  2D45 A;  3ZMT A;  5LEJ A;  2FQ3 A;  3V8K A;  1MZB A;  1ZRF A;  2ESH A;  4S04 A;  6PAX A;  1O3Q A;  4BH9 A;  3SQN A;  5HS8 A;  4RB1 A;  2V79 A;  3K1M A;  3E5X A;  1H0M A;  1D8J A;  5FGM A;  4MGR A;  4WF2 A;  4HDU A;  5HDN A;  4GCV A;  2OU2 A;  3LQQ A;  3LWF A;  5HLI A;  4UXN A;  2WTE A;  1I1G A;  4I7H A;  3MWM A;  1LEA A;  4R79 A;  1BJA A;  2ELH A;  1RZ4 A;  4HX4 A;  5E8G A;  1BI3 A;  3IRQ A;  3DQV C;  4M71 A;  4A5N A;  1JHF A;  2K86 A;  3RI4 A;  3Q5F A;  2BE5 F;  2MH2 A;  5LHG A;  1H9G A;  1G3Y A;  3WTT C;  4EQQ A;  2XHK A;  3FWE A;  3T5X A;  5DYM A;  3CO6 C;  4CIC A;  1L0O C;  3QU6 A;  1SD5 A;  1TNS A;  3DP7 A;  4M72 A;  1K78 B;  3BP8 A;  4I01 A;  4ZH4 F;  3E3V A;  2EK5 A;  4RAY A;  1WWX A;  2J5O A;  4KIF A;  2FU4 A;  2O6G E;  4YG2 F;  2QM3 A;  4MQ9 F;  4EJV A;  2P4W A;  3ZMZ A;  1Y0U A;  1YQA A;  4EJU A;  3KLN A;  3BOQ A;  3L09 A;  2E7W A;  2HQR A;  2LKP A;  1T38 A;  5K5Q A;  5DCM B;  4OMZ A;  2HQN A;  5J8C A;  2BV6 A;  5ICE A;  2F5D A;  1ZRE A;  3Q9S A;  3E6M A;  2P7V B;  3E6C C;  3E5U A;  4XSZ F;  1DPU A;  4WXC A;  5EEH A;  1BN5 A;  3CJN A;  3K1N A;  1XMK A;  2XV4 S;  3QPT A;  2STT A;  3IWF A;  2DAO A;  4YFN F;  2OQR A;  4HF0 A;  3T8R A;  3ECH A;  5F1R A;  1K6O A;  5JVT A;  2PJP A;  1B9N A;  3HRT A;  4P9F A;  2A61 A;  4P5O A;  3T8T A;  4GXO A;  4MNU A;  3KEQ A;  3DPT A;  4GGG A;  4KIB A;  5IT3 A;  4RGS A;  4OU0 A;  2P5L C;  5DCM A;  3SFZ A;  4XRF A;  3J80 Z;  4HAM A;  1IUY A;  2UXN A;  3VB2 A;  3IKT A;  3LAJ A;  1FX7 A;  1FOK A;  1UHM A;  5DD4 A;  3BZ6 A;  4HA8 A;  4U0Y A;  1IN4 A;  3KE2 A;  3DXJ F;  2EV0 A;  5ICF A;  2H09 A;  1R1U A;  2PQ8 A;  1BI0 A;  3WG9 A;  2K7L A;  3JAM K;  1HW1 A;  3U2R A;  1JGS A;  1ZH5 A;  4KMU X;  4PZJ A;  4MTE A;  3WTV C;  2KIM A;  2OQG A;  2FMY A;  1FP2 A;  1BM9 A;  4I2O A;  4TV7 A;  1LDD A;  5HOO A;  1ZG3 A;  4DNC A;  4CXF A;  4RS8 A;  4GYG A;  2EA2 A;  1PP8 F;  2HKX A;  1O7F A;  5ILU A;  2L54 A;  4ZYH A;  2O8X A;  2Y48 A;  2EWN A;  5CVV A;  1RUO A;  3FM5 A;  3M7G A;  3K9T A;  2M30 A;  3RKY A;  1B4A A;  4RAZ A;  4WCG A;  4E70 A;  2VE9 A;  1J5Y A;  2P5V A;  1IAW A;  4ESB A;  1YS6 A;  2MBF A;  3GLX A;  4HLX A;  4IF4 A;  2RN7 A;  5ICC A;  2EA4 A;  4LLG F;  3WTZ A;  2A6H F;  3I5U A;  4UVA A;  1XD7 A;  1I27 A;  5JHU A;  1B1B A;  4JQF A;  2XAS A;  1LEB A;  2HWV A;  3MZY A;  1SMY F;  4U7D A;  4L18 B;  4LB6 B;  3WGG A;  3KZY A;  2VOP A;  3AAF A;  3SZP A;  1TQI A;  5LGU A;  3GFJ A;  3O6B B;  1YO5 C;  1UFM A;  1S8N A;  2V6C A;  4G94 A;  2VT2 A;  1YFH A;  2DU9 A;  1TLH B;  5H20 A;  3QP5 A;  1TQM A;  5FD5 A;  3DKW A;  2QQB A;  1WSU A;  3GW2 A;  3JSO A;  3ABU A;  4A0Z A;  2VON A;  4I09 A;  5D4S A;  4WWC A;  1BC8 C;  1QQI A;  1U8R A;  2HOE A;  2PLY A;  3ZPL A;  2VBY A;  3HSF A;  1IN5 A;  1BIA A;  1DP7 P;  3K0L A;  1TW2 A;  1FSH A;  4ASN A;  2DK8 A;  4PDK A;  1ONV A;  1O3T A;  1WQ2 A;  3CTA A;  1ZYR F;  4ESJ A;  3FZV A;  3FMS A;  3CO7 C;  2FNA A;  2FRH A;  1XDS A;  3LA3 A;  3O3K A;  2MD5 A;  4P55 A;  1IXS B;  2YU3 A;  5KK1 A;  2VBZ A;  3GEZ A;  2K4J A;  2L4M A;  3D0S A;  4LK1 F;  2JPB A;  5L3B A;  1QO0 D;  4KT5 C;  4G7O F;  1S3J A;  4JBA A;  1F1Z A;  1T6S A;  1YG2 A;  3HHG A;  1YIO A;  4XLN F;  2WC2 A;  2QZ8 A;  5L3E A;  3Q9V A;  2RQP A;  3MCZ A;  2H94 A;  4WXD A;  3LQR A;  1HQC A;  4CYD A;  4D0P A;  1RI7 A;  2G7H A;  2JRT A;  2Y0M A;  2CG4 A;  1QPM A;  3F23 A;  3FM3 A;  2G7U A;  2QBY A;  4HW0 A;  4N9I A;  4MTD A;  2NNN A;  3E5Q A;  2IW5 A;  1GHC A;  3I0T A;  2F5C A;  1ZAR A;  3HRU A;  3BPX A;  1T2K A;  3CLO A;  1YW9 A;  5ILS A;  4LK0 F;  4IHT A;  2KKO A;  4HLY A;  2W24 A;  2JPC A;  3KEO A;  5IT9 Z;  1S29 A;  4U7B A;  3NQO A;  1HBX G;  2CO5 A;  1FBU A;  4I98 B;  4L9T A;  4CDG A;  1HSJ A;  2LNB A;  4KDP A;  3F8C A;  1JXS A;  4B09 A;  3TO9 A;  4FX0 A;  4O3M A;  5KVR A;  4DQ2 A;  3E6D A;  5L3D A;  1P4X A;  1CF7 A;  1FBQ A;  4UV9 A;  5DCF A;  1I5Z A;  2NS0 A;  5L3F A;  3P9I A;  4IRG A;  4AWX B;  2ETH A;  2YPR A;  3IRR A;  4EM1 A;  4HQE A;  2ISZ A;  4HZF A;  4KFC A;  1P4W A;  2PMH A;  3HHH A;  4EJO A;  2P8T A;  5F64 A;  3R60 A;  5D5U B;  1USS A;  3WGI A;  1MDM B;  1WRJ A;  4G7Z F;  1FWZ A;  3TGN A;  4AIJ A;  1P6R A;  2FML A;  1S7A A;  2PG4 A;  1AOY A;  2YX4 A;  2IT0 A;  1XGN A;  4M6X A;  2F5E A;  4PGH A;  2V1D A;  3LAP A;  2K02 A;  4L0Y B;  3EUH A;  1J7K A;  4HV6 A;  2UWM A;  2VOO A;  1S7O A;  5DUI A;  2ZXJ A;  1FNN A;  4Y17 A;  1FT9 A;  3FXQ A;  1MDM A;  5HS9 A;  5ICG A;  3EYI A;  3C1D A;  2QQA A;  1IXR C;  4HX7 A;  2HTJ A;  3I54 A;  1XCB A;  3HUG A;  5E8I A;  4LFU A;  4OIN F;  4LMY A;  3BJA A;  2AS5 F;  3M1E A;  1JE8 A;  3HSE A;  3H3U A;  2EFN A;  2IJL A;  3HOT A;  1SFE A;  1B9M A;  3ELK A;  3K2Z A;  4OIP F;  2HYF A;  2Q8K A;  5JR3 A;  1T0F A;  2L3D A;  4EM0 B;  4Y13 A;  1RIO H;  1IRG A;  4PGG A;  2DK5 A;  3D5L A;  2ZKZ A;  2LDU A;  2W25 A;  5LEK A;  3O2P E;  4IRI A;  5D8L B;  4G8X A;  3N4M A;  3IL2 A;  4N0B A;  4LG0 B;  1FY7 A;  1R5H A;  2XKP A;  2Z5U A;  2BYV E;  2QQ9 A;  4OMY A;  2OD5 A;  3VOD A;  1NHA A;  1SFX A;  1YW7 A;  3WOD F;  1IN7 A;  4G9Y A;  3ZP5 A;  4RGR A;  2IP2 A;  3F3X A;  2NYX A;  3RKX A;  4N9H A;  3GX4 X;  3KZZ A;  2Z3Y A;  4HV5 A;  2ZNY A;  1CGP A;  4EJW A;  3L00 A;  3F6V A;  3F8N A;  4FT8 A;  4BHB A;  3MAJ A;  3WE2 A;  3VEP A;  4G6D A;  1LB2 A;  2H27 A;  3NEU A;  3TDU C;  3F21 A;  4EV0 A;  2ZME A;  4LG0 A;  4R8H A;  1KU2 A;  2GXG A; 
#chains in the Genus database with same CATH topology
 1H9T A;  1MW7 A;  3M07 A;  1W1W E;  4Z2Y A;  1IRX A;  1QHH D;  2E2H J;  2A3S A;  3BZK A;  2LRD A;  1Z1D A;  2QSH X;  2JA6 J;  1SAX A;  4NC6 A;  3TP3 A;  3W2W A;  1X2N A;  4A3C J;  3S14 J;  1T08 B;  2D1H A;  3UKG A;  3HPH A;  4HNU A;  3L2U A;  1RKW A;  3QPL A;  1BI1 A;  2QQ8 A;  1K79 A;  5EGO B;  3KFW X;  4XLH A;  4AD9 A;  5D5V B;  4ENK A;  3J80 K;  3G3Z A;  3H9G A;  1ZG5 A;  1J59 A;  4E7H A;  2M5W A;  1ZR4 A;  4UVB A;  5K5R A;  3RCO A;  2V1N A;  1L3L A;  1R58 A;  2KIU A;  3ERE D;  1O3R A;  1OYY A;  2YU9 J;  3OR2 C;  4A5M A;  3CZ6 A;  2CQQ A;  1ENH A;  4M9X A;  3MQ0 A;  4DJA A;  4II3 A;  3I53 A;  2GZW A;  1KU9 A;  2DTR A;  3GTP J;  3VOE A;  4PCQ A;  1V5E A;  2X48 A;  2XF7 A;  3I4M J;  1ZN2 A;  3CQZ J;  4A3G J;  1B8I A;  2LVS A;  2LSO A;  3ABK H;  1IJW C;  2O03 A;  3PFI A;  2CWE A;  2DFH A;  1HC8 A;  3JTG A;  1YHQ I;  4UUV A;  1T0F C;  4IZZ A;  2L7K A;  3EPZ A;  5KNL A;  3A02 A;  1BOA A;  3JAM Z;  1I3A A;  1BBY A;  2ZCW A;  1BL0 A;  4XLC A;  2FOK A;  2WAQ A;  1W0U A;  1TTY A;  2XGE A;  1I6X A;  2ZC2 A;  3BG7 A;  2GXB A;  1K6Y A;  3ZQH A;  2QSF X;  2X6O A;  3CDH A;  4ENM A;  1T33 A;  4Y33 A;  3QAH A;  2ME6 A;  1E3H A;  4BXU A;  4RDU A;  1D0X A;  1QZE A;  3QRF F;  3OMY A;  4QSH A;  1S6L A;  2VN2 A;  1JI8 A;  3BY6 A;  1JKP C;  2HNH A;  1U3E M;  3ROU A;  4M6Y A;  1P2F A;  4CH7 A;  4BUP A;  2K9S A;  4L5I A;  2C6Y A;  1WI9 A;  2EV5 A;  4WX9 A;  4JK1 X;  3ZQ7 A;  3IC7 A;  2XAH A;  3GYH X;  4C2U A;  2DBB A;  2MC4 A;  4EGY A;  3MVP A;  1JT0 A;  2F4M B;  1ZHF A;  2DPD A;  1LNW A;  1FIP A;  1KA8 A;  2IRF G;  1Y1V J;  2H6B A;  5LBQ A;  1R1V A;  2JVH A;  2M1B A;  2FBI A;  1KU7 A;  3QP6 A;  4Q4Z F;  4EJT A;  2HOS A;  4UUS A;  1DU0 A;  4MFE A;  3K69 A;  4F91 B;  1HA8 A;  1XCV A;  4I0B A;  2EFQ A;  2O3F A;  3I3L A;  4BHC A;  2FF4 A;  4KT6 A;  3P7N A;  2BOL A;  1ZAO A;  2KRF A;  2L4A A;  3ECO A;  1XGO A;  1LVA A;  4ZZL A;  2VXD A;  2W1O A;  1WJ5 A;  4HX8 A;  2G0E A;  3C3W A;  2ESN A;  5EG0 B;  3KP4 A;  1R5G A;  1A5J A;  1X1B A;  1MMA A;  2FXA A;  2YS9 A;  3DU6 A;  1QPI A;  2VOD A;  2ZME C;  5IP9 J;  1H8A C;  2V9V A;  3S1R J;  5J4Y A;  4HNT A;  3BJ6 A;  5M3M J;  2L7M P;  3FX3 A;  2OZU A;  3FF5 A;  2LK2 A;  1XB4 A;  1Z3Y A;  1OCC H;  2FSW A;  3AG3 H;  5B1B H;  4XOP A;  3ISP A;  1VQM I;  3HOU J;  4QIW N;  1OPC A;  1IF1 A;  4BHP A;  3H3Z A;  2R7D A;  2FUG 2;  2VB6 A;  3F8M A;  3TO6 A;  3TQN A;  3J81 Z;  1GDT A;  2TRT A;  1HKT A;  2ZFW A;  5TJJ A;  2HKO A;  3BJO A;  1C0W A;  2IEK A;  3RPQ A;  1G8X A;  1P92 A;  1UJ8 A;  2WAF A;  3I58 A;  2MGQ A;  3LST A;  4A3B J;  1QZZ A;  1SVM A;  1Z9C A;  2V1U A;  3VYT B;  1X3U A;  2CMP A;  4S0H B;  2F5F A;  1VQ6 I;  4UVC A;  3PNY A;  4UNO A;  4XLP F;  3HRM A;  2DT5 A;  2ICW G;  3HKZ N;  2DMP A;  2IA1 A;  3ZGK A;  4F55 A;  3PIO F;  4YFK F;  3H5A A;  1OMI A;  3LA7 A;  4FE4 A;  2P5K A;  2HDC A;  4ABZ A;  4D9J A;  1TBX A;  1QZY A;  3PSF A;  3HYI A;  3S2H J;  5A2Q K;  2MFZ A;  3X2Q H;  1HW5 A;  4A3I J;  5EG0 A;  1V3F A;  4XQF A;  4I0A A;  3CF5 F;  4AC0 A;  3PNT A;  3RYR A;  5EZG A;  2JSP A;  1X3W B;  3GFM A;  1K61 A;  4L5J A;  1G3T A;  3FXU A;  4HG2 A;  3F6O A;  1O7L A;  2DYR H;  1RKT A;  3DEW A;  1A36 A;  1XTA A;  4ZDO A;  2WV0 A;  2OUM A;  2DN0 A;  3RYP A;  1XGS A;  2XB0 X;  1FYM A;  4R1H A;  1MJA A;  2CS3 A;  3S17 J;  1J09 A;  5CVI A;  2QBY B;  1B6A A;  2DDA A;  4I6Z A;  4ZDL A;  3A0H C;  4NDL A;  5IY5 H;  3U9G A;  3D5S C;  3JW4 A;  1D1C A;  3A01 B;  2F2E A;  3BTJ A;  2Q2E B;  4IHS A;  2EV6 A;  4G7H F;  1Z6T A;  1ODD A;  3K1P A;  3RKW A;  2EZK A;  3ZXS A;  2STW A;  1DDN A;  3QPH A;  4XKC A;  4CYC A;  3G6E I;  5H6R A;  2O5R A;  3H1C A;  1X4O A;  4EMS A;  5K1Y A;  2ZO4 A;  1XGM A;  2LOO A;  3GF2 A;  3KYL A;  1XSV A;  3HB9 A;  4Q47 A;  3K4N A;  4ANJ A;  1SD6 A;  1EH8 A;  1X58 A;  2OCC H;  4ESF A;  4ZJZ A;  1ZRD A;  2E34 A;  2VIX A;  5CQG A;  1MKM A;  4PSW A;  3OYL A;  4YFX F;  3CMA I;  3S16 J;  4HSR A;  1FYL A;  5C4X J;  3WTU C;  1FLI A;  4FE7 A;  1R4N B;  1SVO A;  1ZLJ A;  2L7Z A;  3I64 A;  2M4G A;  5CQE A;  2R3S A;  1BC7 C;  2RKH A;  2DCE A;  1JJ8 C;  4CA0 A;  2P6T A;  3RKQ A;  3SFI A;  3F22 A;  3S3O A;  3CUQ A;  4ENN A;  2M4K A;  3PM1 A;  3FXR A;  2QLZ A;  1XMA A;  4NC8 A;  4LLN A;  1UB9 A;  3I71 A;  2RV8 A;  4HBL A;  5IYC J;  2HGC A;  1FYK A;  3PL8 A;  1X4P A;  3CMY A;  3U1K A;  4P96 A;  4BAC A;  3CP2 A;  3GTL J;  1HST A;  3BTL A;  4CCK A;  1CF7 B;  3A01 A;  5FFX A;  2FEZ A;  3PQJ A;  2GWR A;  4EEF G;  2Q2E A;  5L3G A;  1U5T B;  2VKE A;  4IJA A;  3W6K B;  2ZJQ F;  2FOW A;  1NK2 P;  2CUZ A;  3ABT A;  4KNY A;  1QNT A;  5CLS A;  2VBW A;  5JLW A;  2HXI A;  1BOB A;  3IWZ A;  2G9W A;  3P9C A;  3OY9 A;  2GAU A;  2P0W A;  3ZMS A;  5BOX A;  1STZ A;  2WY8 Q;  4MHG A;  1FZP B;  2I8D A;  3CUO A;  5C44 J;  2ELJ A;  2LY1 A;  2DDB A;  5E3L A;  3OYG A;  3T1B A;  2D5V A;  5HLT A;  1YTY A;  3ZMV A;  3OIQ A;  3L2C A;  5IT9 K;  3MEX A;  1ETY A;  2YSR A;  4YIF A;  1S72 I;  4IRH A;  4NBQ A;  4RB3 C;  2MLG A;  4M3B A;  1R9T J;  2I5U A;  1VQL I;  1RES A;  4RMN A;  4PSX A;  4XLA A;  3MN2 A;  2XRO A;  4LB5 A;  2PX9 A;  3PO2 J;  3M9A A;  3ML6 A;  1FJL A;  3BTC A;  2OC6 A;  4BNC A;  4FTH A;  3WU1 B;  3V7C A;  5H2F C;  1PUF B;  1XX5 A;  4L5E A;  2FNP A;  1SD7 A;  3L2Q A;  1Z05 A;  2Z33 A;  3S1N J;  2R7U A;  2CW0 F;  2OBP A;  2V4J C;  5JFR A;  2LF7 A;  5E1Z B;  2NXN B;  2QKM B;  3B02 A;  2W57 A;  3V8J A;  4IXA A;  3LFK A;  4E7J A;  3KPH A;  1R71 A;  3HTU A;  5BPI A;  2CUF A;  1U5T A;  4BQO A;  1ZTR A;  3HG9 A;  3DBL B;  2BXZ A;  3L9F A;  2HZD A;  2RNG A;  3HIF A;  4OIQ F;  2D2W A;  1TT5 B;  1JKR C;  2HI3 A;  1ZLK A;  2NAZ A;  4CO8 A;  1SAU A;  4BJ5 C;  5D6F A;  3QOP A;  3ABM H;  3WHB A;  4WXH A;  3CME I;  5EJC A;  4IPA A;  5FLX Z;  2Y75 A;  5H6Q A;  1POG A;  2K9Q A;  5CYV A;  5GP9 A;  1JHH A;  4O6J A;  4XM3 A;  4IX7 A;  1A35 A;  5AIP A;  2LLK A;  3S93 A;  1IZ1 A;  4IO9 F;  4A6D A;  1Z91 A;  1XSD A;  3ASO H;  4LLL A;  2XVC A;  4H0E A;  3Q0V A;  4B3X A;  3E7L A;  4HF2 A;  1GV2 A;  1TNT A;  2A6E F;  2XUB A;  4CGZ A;  1GXQ A;  2E7X A;  2PMZ A;  3A03 A;  1EKE A;  4FQG A;  3BR1 A;  1ON1 A;  3KP2 A;  3BRO A;  1MBG A;  3R61 A;  1IN8 A;  5IOY A;  1ZRC A;  2OTL I;  4A93 J;  1PUF A;  2RC4 A;  1R7J A;  5BS6 A;  5LHH A;  2QEX I;  2B0L A;  1MJ9 A;  4A0Y A;  4CHU A;  2A5Y B;  1ON2 A;  4GO1 A;  4C2T A;  1W5S A;  1T56 A;  3CC4 I;  5AON A;  1IW7 F;  2LR8 A;  2RDP A;  4ETS A;  2LF8 A;  2EJR A;  3F72 A;  1Z0X A;  4MEX F;  2JJ7 A;  3E6B A;  4FIS A;  1JGG A;  2KLO A;  3WU0 A;  4YRV A;  2J5P A;  1XDU A;  2XF6 A;  1EJ9 A;  4I99 C;  4WK8 F;  3Q3S A;  1S9H A;  3GFL A;  4FX4 A;  4Y52 J;  5FFZ A;  3FMQ A;  3V8L A;  5HDG A;  1W5T A;  2XRN A;  1Z7L A;  3L2V A;  3DWL E;  1IXC A;  4QPQ A;  5DUK A;  1KYW A;  5LFA A;  4PUS A;  2FJ1 A;  2Z99 A;  3OYF A;  4Y7N J;  5D4R A;  4UHT A;  1SC7 A;  1J9I A;  3PFY A;  4IOC F;  2CGP A;  4A3L J;  3CCU I;  3FDY A;  1H88 C;  4GDF A;  3HOY J;  2LP0 A;  2XPW A;  2CSO A;  2AQE A;  3CUQ C;  5LLQ A;  5GTH C;  3VYR B;  4F92 B;  3WE3 A;  4V2G A;  2ID3 A;  3F8F A;  5FD6 A;  2Z1D A;  5CPR B;  4M6V A;  5B1A H;  3COA C;  1KON A;  4KIS A;  1W7P B;  3BTI A;  3GCM A;  4NQW B;  4XLE A;  5E3M A;  1Y56 A;  4A2U A;  2TDX A;  2BEO A;  1N77 A;  2ZJ2 A;  4IEJ A;  2FBH A;  1ITY A;  4BBR J;  5HDK A;  1W4M A;  2IA0 A;  2HQ5 A;  1R36 A;  1YOV B;  4IHV A;  1A6Q A;  2VJ4 A;  2QVO A;  4FAS D;  4U88 A;  5CJ9 A;  1D5Y A;  2UV1 A;  2R7R A;  3M3Y J;  2EZI A;  1NTC A;  4V2F A;  2UXX A;  2X0L A;  1QBJ A;  2ZSI B;  4RM3 A;  2RNJ A;  4NC7 A;  5HLG A;  1LDK B;  2DT7 B;  1U2W A;  5BMZ A;  3FBN B;  4Q48 A;  3F0C A;  1IUY A;  5HS7 A;  3GUD A;  5TIS C;  1GXP A;  4XNF A;  3I4N J;  3G4S I;  1R4M B;  2F6C A;  3ZMD A;  1D3Y A;  3L2R A;  2AO9 A;  2X85 A;  1WKM A;  1FTT A;  5LRR A;  1ZQ3 P;  1R00 A;  3IH2 A;  2UZK A;  1WJC A;  1GLN A;  2F4I A;  2VE8 A;  3DFG A;  1YLF A;  1VQ4 I;  3T0Y A;  2FBK A;  3BPV A;  2CQK A;  3OL3 A;  1KYZ A;  2IBD A;  3I59 B;  4XMY A;  1O57 A;  1W7P A;  4NQW A;  2OJE D;  3EDP A;  5IYD J;  2XAQ A;  2BGC A;  3ZRG A;  2OCE A;  1Z7U A;  1U5T C;  2EB7 A;  1ZG1 A;  4KN7 X;  2CYY A;  4CCJ A;  5FB2 A;  5EEA A;  3WTS C;  1KQ9 A;  3L7W A;  3BWG A;  3ZQI A;  4E7Z A;  4X0G A;  4D5C A;  4E4H A;  3RDI A;  3TW7 A;  4F52 A;  3B6A A;  5K5O A;  4KIG A;  2ECC A;  1MGT A;  4P9U A;  1G3S A;  1U6G A;  2IS2 A;  2O9L A;  3JTH A;  2PI0 A;  5K7H A;  3IAS 2;  3MKY B;  4U0W A;  3OR1 C;  4BXX J;  2AXL A;  4EAT A;  2DJI A;  2ZME B;  1LFP A;  3OV8 A;  4KN4 X;  3P9K A;  1WGX A;  1PDN C;  4OAY A;  2O0Y A;  3H36 A;  1OKR A;  1X1C A;  1NH3 A;  4ZC3 A;  3OIP A;  4DYR A;  1YJW I;  3ZQG A;  4XBF A;  1O4X A;  4AYB N;  3FXL A;  4RLF A;  2Q0O A;  2XIG A;  3LA2 A;  1YJ9 I;  4AIH A;  5IYB J;  4ZYD A;  1HKS A;  1DGW Y;  3H5N A;  2EFW A;  1MH3 A;  4M3F A;  1MBK A;  1UEL B;  4I02 A;  4M9S A;  2E2J J;  1WZ2 A;  3P5J A;  1MH4 A;  1Z67 A;  4XKB A;  3VDX A;  3GZ6 A;  3Q0W A;  2DFE A;  3G71 I;  3IHU A;  1QRY A;  1TWC J;  1X2M A;  2FA5 A;  4BXF A;  3HOX J;  3KP6 A;  4A3J J;  1R6R A;  5J6X A;  2QCO A;  2QWW A;  3I59 A;  3R0A A;  1QGP A;  2JA5 J;  2DOD A;  4QLC U;  3NRV A;  3JRD A;  3OIO A;  3S32 A;  3U21 A;  2GBY A;  3ASN H;  4F3Q A;  1MMD A;  1TP4 A;  2ZNZ A;  2M0C A;  3H9J A;  3F8B A;  2MC3 A;  4ON0 A;  3TOB A;  2HQA A;  1MNE A;  2XDV A;  4OIO F;  1YX3 A;  2L9N A;  1KQ0 A;  1EV7 A;  3NAU A;  1B8I B;  5HLH A;  3CDL A;  1LDJ A;  4M73 A;  4Y15 A;  3W6J B;  4A6E A;  4J01 A;  1K78 A;  2FE3 A;  2VXZ A;  1PYV A;  3MZH A;  3IKV A;  1EF4 A;  1XS9 A;  2ACJ A;  2KT0 A;  2DQL A;  2EIK H;  3K4L A;  1JUS A;  3JRH A;  2D1V A;  4HPQ A;  2VJI A;  1D5V A;  3S2W A;  1UHS A;  1WJA A;  2EFP A;  3GXO A;  3EQL F;  1WPK A;  3TED A;  4M3E A;  3KET A;  4IOA F;  4D7M A;  2HVS A;  2RVC A;  2XAJ A;  4W1U A;  2V6E A;  2HU9 A;  2RQQ A;  4ZYE A;  3DLA A;  3JSP A;  3WTY C;  3V4G A;  2DLL A;  2DI3 A;  2A68 F;  4B48 A;  4IQ4 A;  2KMU A;  2WB1 N;  3H92 A;  4NUB A;  1FP1 D;  3DLL F;  1TZL A;  1ZEL A;  1UCR A;  2P7C B;  3CCL I;  3VPR A;  4W97 A;  3I4P A;  3CP8 A;  5ILV A;  3FXO A;  2MG4 A;  4UY8 I;  3U1D A;  1DPR A;  2CFO A;  4LJZ F;  2XSJ C;  4BGD A;  3MD2 A;  2DA2 A;  2HTS A;  3SZT A;  3K10 A;  3GO5 A;  4CCM A;  3GFI A;  3EYY A;  3DKX A;  2HVQ A;  2VLA A;  4XL9 A;  4F93 B;  2FX0 A;  5F6F A;  4BBS J;  1OCO H;  1LVK A;  3OOP A;  3CJQ B;  1VQO I;  3HXL A;  3UNG C;  2IGK A;  5E18 F;  2Z9O A;  5CVJ A;  3W6V A;  1X1D A;  1WI3 A;  3NWT A;  5K7F A;  4UUS B;  3K70 C;  5HNF A;  4EM2 A;  2M9H A;  2VAS A;  5M5W J;  1YIT I;  2MA3 A;  3RTR A;  1V55 H;  3KP5 A;  3GTO J;  3HRS A;  2M8E A;  1P7J A;  2X1E A;  4N4O B;  5E20 A;  4KIT B;  2DQR A;  2VPR A;  5GAH J;  2CFX A;  4S05 A;  3BG3 A;  4BEH B;  5K7Z A;  1J2X A;  3OYE A;  2DJN A;  4GYI A;  2O61 A;  5DD8 A;  2HDD A;  4A0X A;  1FBS A;  3CCQ I;  2JT1 A;  1SEU A;  3WTW C;  3ZMU A;  1G3W A;  3J7A Y;  3SHF A;  3I55 I;  4EGZ A;  1APL C;  1DUX C;  4IVN A;  2LKX A;  1HCR A;  2EQR A;  1VQN I;  1ETK A;  1R1T A;  3SDG A;  3G2B A;  5GPC A;  5D5W B;  2V1X A;  1T39 A;  3M8F A;  2NVX J;  1E17 A;  3FXM A;  3ZQF A;  1Z6R A;  2PMU A;  4CCL A;  1U78 A;  1KGS A;  3HC7 A;  4B1R A;  4DOZ A;  3FHZ A;  5GPA A;  4OIR F;  4L9J A;  1X1P A;  4RAF A;  2IVM A;  3HOS A;  2HS5 A;  1N25 A;  2LFB A;  5F08 A;  4A12 A;  2HZT A;  3MFK A;  3ZN1 A;  5M3F J;  3QU3 A;  4U87 A;  5FRO A;  3M8E A;  1HXD A;  1VQK I;  2XAG A;  1F36 A;  4LIV A;  1XN7 A;  2L01 A;  3RJP A;  4NB5 A;  3SEQ A;  1R5I D;  1AA7 A;  2VL8 A;  2X4H A;  4MQV A;  2AHQ A;  5ERI A;  5IOZ A;  5E17 F;  1PJR A;  2RGV A;  3R4K A;  1R22 A;  3K4M A;  2EIJ H;  2EZH A;  3V7S A;  2KIQ A;  2VT3 A;  1HW2 A;  1RUN A;  2BY3 A;  2DA6 A;  4BEH A;  4KJZ A;  2ADU A;  1XSX A;  2CV0 A;  1BW6 A;  4CZC A;  3W2A A;  2PFB A;  4M9Z A;  4XKV A;  3KLO A;  3DPL C;  5BPD A;  1SFU A;  2KIF A;  2XRL A;  3K2A A;  3KP7 A;  1LFU P;  2O8K A;  2DA1 A;  4AUX A;  1HDP A;  3FIS A;  5D8K B;  4KUM A;  4RB2 C;  3ONQ A;  4FHT A;  4HDV A;  5EYR A;  3K4B A;  3MMY B;  2JZY A;  1XC5 A;  3C18 A;  2JUG A;  4G6T B;  2KQR A;  2V9P A;  4L9V A;  4KMF A;  3QOE A;  3WG7 H;  4HOB A;  3NAR A;  2OAZ A;  3OYA A;  2VC0 A;  4HF1 A;  2VC1 A;  5L3C A;  2B63 J;  2XKO A;  2FD5 A;  2H8W A;  1GUU A;  4CCO A;  1ZKG A;  3IAM 2;  4CZZ A;  4RAG A;  3J81 K;  1BI2 A;  2WAD A;  2Q1Z B;  4BKX A;  1RR8 C;  1P9Q C;  2Y31 A;  3PUB A;  1EA3 A;  1FC3 A;  1FPQ A;  1U9N A;  3J7A O;  2NNY A;  4LD5 A;  1NK3 P;  2GA2 A;  4CYC B;  2E5N A;  3DF8 A;  4M3D A;  4XRM A;  5KAF C;  1TC3 C;  1H89 C;  1IDZ A;  3GTJ J;  3DV8 A;  2JQ7 A;  1UST A;  5KHD A;  1N75 A;  2L9S A;  2DFI A;  4B8X A;  4ZTJ A;  2IAI A;  2ID6 A;  4OAZ A;  4KYW A;  4D7N A;  3S3M A;  4RA2 A;  4Y3O A;  2HOA A;  5LRS A;  3OS0 A;  2GQQ A;  4C3H J;  3HTS B;  2BBY A;  4IKF A;  2WWY A;  4PFP A;  4AVP A;  3ERM A;  5GAD J;  2JN6 A;  2HVR A;  4BDY A;  1F9N A;  5LGT A;  1YS7 A;  2HYG D;  3PSI A;  4G6Q A;  1MD0 A;  2YR2 A;  5CKT A;  1O3S A;  2EFO A;  3AG2 H;  2E5Z A;  4MEY F;  1AWC A;  3LSP A;  3LSR A;  1TWH J;  1BIB A;  3AG4 H;  5LHI A;  4OOI A;  5E3N A;  2E71 A;  3CUQ B;  3EET A;  1UMQ A;  4LGW A;  3K7A J;  5A2Q Z;  3CCV I;  3G73 A;  3CC2 I;  2UUZ A;  1D8K A;  4M74 A;  1VFC A;  3N97 A;  1J75 A;  3FXJ A;  2YX7 A;  3V7R A;  1VTN C;  2XB5 A;  3TOA A;  1T95 A;  2GIV A;  1GV5 A;  2HEO A;  1F5T A;  1OYW A;  1BR2 A;  2LY2 A;  5J47 A;  1R23 A;  1I3Q J;  1ULY A;  4AIK A;  4AID A;  4L9N A;  1V4R A;  3CD6 I;  3TO7 A;  1KU3 A;  3VFZ A;  3MZ8 A;  4KIC A;  5J1U A;  5KCM A;  1K83 J;  1TW3 A;  1WJE A;  5HVQ C;  5E1X A;  2QSG X;  2GA1 A;  1SD4 A;  1EH7 A;  1MMS A;  2CJJ A;  1G59 A;  2KDO A;  2ZJR F;  3LOC A;  1SMT A;  4ZYA A;  1PUE E;  4BQN A;  1YE9 A;  1TL8 A;  2IPQ X;  1Q1H A;  4B4C A;  2M7B A;  3CCE I;  3QOD A;  1FSE A;  2GOX B;  4HYE A;  2KL4 A;  4UUT A;  5DM6 F;  1I1S A;  3KCC A;  1IV8 A;  2EBI A;  4NHJ A;  5DDG A;  4JX4 A;  4ZZD A;  5EEG A;  2R7F A;  4DBR A;  3GVA A;  2DW4 A;  3JCU C;  1E0E A;  2BZT A;  3B73 A;  3PQK A;  2BHY A;  5LGN A;  1J0R A;  2L02 A;  2VKV A;  4BYY A;  3KP3 A;  3C7J A;  3R6S A;  4G12 A;  2CQN A;  2DMQ A;  2K4B A;  3PJR A;  2K3F A;  5FO5 A;  5AIQ A;  2JTV A;  3RPU A;  2OTJ I;  2X6W A;  5IP6 A;  1B59 A;  1IN6 A;  3H0G J;  1OLT A;  2A69 F;  2DO7 A;  4DYQ A;  1MBJ A;  5TRD A;  3ZQQ A;  2PBI A;  3GZ5 A;  4QWQ A;  4C9Y A;  2WV1 A;  3OSF A;  4YIR X;  1HKQ A;  1T98 A;  3TKY A;  5HNH A;  1Y6I A;  4GFB A;  4A3F J;  5ED4 A;  2E35 A;  3GWZ A;  2L9R A;  4Q5S F;  4UV8 A;  3WTX C;  2M45 A;  1TQP A;  2XAF A;  1ZGA A;  2BY1 A;  1A04 A;  3K70 D;  1YW8 A;  5DEQ A;  1W7P D;  3LSK A;  2K9L A;  3O8H A;  3BQZ A;  1E2X A;  4KA4 A;  4BQA A;  1TWA J;  3OYH A;  3FXK A;  5J1Y A;  3O8G A;  1ZGJ A;  3JRG A;  2HR3 A;  4J00 A;  1XPX A;  3PO3 J;  1G6N A;  1LUJ B;  3SXY A;  2JSC A;  2NVY J;  3RIR A;  4O5V A;  4RB0 A;  2CW7 A;  2R7Q A;  2XGX A;  2M87 A;  3OYM A;  1AKH B;  2A07 F;  3ULQ B;  5BQT A;  2BW3 A;  2P6S A;  4UB6 C;  2O7O A;  3LFU A;  1V5F A;  2K27 A;  3HM5 A;  4MLO A;  1BJZ A;  4I76 A;  2HPM A;  5JLX A;  1HF0 A;  1GVJ A;  1PVE A;  1UG2 A;  3DEU A;  2OZ6 A;  2E1N A;  4ENJ A;  1KQ8 A;  1F4K A;  2ISY A;  3LSI A;  2H6C A;  3DTE A;  4AYB A;  4ZYG A;  1B72 A;  2QEN A;  2HOT A;  5CVU A;  3WGH A;  1RNL A;  1K7A A;  2HFH A;  2JA2 A;  2W84 A;  2OA4 A;  1LJ9 A;  2MD0 A;  2R0Q C;  2LC2 A;  2QYO A;  5CVR A;  2QA4 I;  4AM3 A;  5J1R A;  4BE0 A;  1LQ1 A;  5FLX K;  2E1C A;  2DPU A;  4K2E A;  5DV5 A;  2B9S A;  1VND A;  4L0Z B;  2HYJ A;  2EIN H;  3FMR A;  3HSR A;  1A31 A;  2ZBK A;  2WY7 Q;  1G4D A;  2PN6 A;  2KJB A;  1P4A A;  4AVZ A;  3BR0 A;  1ZGW A;  4XN0 A;  4DZP A;  2KJC A;  4C2M J;  1OR7 A;  2JWT A;  4BAY A;  4EVI A;  4HQM A;  3PUF A;  5D6E A;  2MLK A;  4U0V A;  1TWG J;  3S1M J;  1PP7 U;  2RRE A;  4XSX F;  3BG5 A;  2M34 A;  3B6C A;  1AKH A;  5E1W A;  5J8F A;  1XMX A;  2V7F A;  3OS2 A;  1EH6 A;  2HPI A;  3BDD A;  1S7E A;  1IRF A;  1IO2 A;  3REO A;  5C4J J;  5F0H A;  2Y2Z A;  2QUF A;  4RGU A;  3R0J A;  3HOV J;  3DKY A;  4RGX A;  4F7Z A;  1WH5 A;  2PEX A;  1VQ5 I;  1N78 A;  2YUS A;  2CUE A;  4DGW B;  2DOA A;  3QYF A;  3ZN0 A;  2VBX A;  3TBI A;  5D5X B;  1VQP I;  2COM A;  2IA2 A;  4PFO A;  2LBF B;  4DW6 A;  1MBH A;  1IV6 A;  3TDZ C;  1OYI A;  1FOX A;  4YII A;  2W85 A;  2R7S A;  3IV5 A;  5JI6 A;  2NRA C;  2WB1 A;  1MJB A;  3E97 A;  5GAG J;  1I50 J;  1UHW A;  1YYV A;  2MH9 A;  4ZTF A;  1W36 C;  1REP C;  2BVM A;  2D45 A;  1FOY A;  1VQ9 I;  3ZR8 X;  3ZMT A;  4A69 C;  5LEJ A;  1VZ0 A;  2FQ3 A;  4ZDP A;  2NOJ B;  3G1O A;  3V8K A;  1MZB A;  1ZRF A;  1VF9 A;  2JRM A;  2ESH A;  3CMM A;  3AL0 B;  4S04 A;  2KRC A;  6PAX A;  2Y0S N;  1O3Q A;  4IL6 C;  1OCT C;  4BH9 A;  3TMO A;  3JR9 A;  4A3E J;  2MSY A;  3SQN A;  5HS8 A;  4RB1 A;  2V79 A;  3K1M A;  2K3P A;  3E5X A;  1H0M A;  1ACI A;  1D8J A;  3OYN A;  1Y8Q B;  5FGM A;  1I6H J;  4MGR A;  4WF2 A;  4HDU A;  5HDN A;  4GCV A;  1AU7 A;  2KHM A;  2OU2 A;  5J40 A;  3LQQ A;  3L1P A;  4A3D J;  3LWF A;  3TW6 A;  2VQG A;  4XLF A;  2XC7 A;  5FKM A;  3D1N I;  5HLI A;  4UXN A;  2WTE A;  1T8I A;  1SFO J;  5IPA A;  1I1G A;  2LBF A;  4I7H A;  3MWM A;  1JJ6 C;  2M2E A;  1LEA A;  4R79 A;  1BJA A;  2ELH A;  3BQY A;  1RZ4 A;  1Z77 A;  3OYD A;  4HX4 A;  5E8G A;  1BI3 A;  1CQT A;  3DPU A;  3IRQ A;  2L2O A;  3DQV C;  4M71 A;  4CUG A;  2ZJP F;  4A5N A;  1JHF A;  3JRC A;  2K86 A;  3HL2 A;  3K4C A;  3RI4 A;  3Q5F A;  2BE5 F;  4XID A;  2MH2 A;  2ME0 A;  5LHG A;  2VUM J;  3S8P A;  1H9G A;  2BXY A;  2KZV A;  2IS4 A;  3QWL A;  3AFH A;  2E1M C;  1G3Y A;  2TCT A;  4RLQ A;  3WTT C;  1MMN A;  4EQQ A;  2JA7 J;  2XHK A;  3FWE A;  3T5X A;  2I10 A;  3JRB A;  5DYM A;  1WFX A;  4QPO A;  3CO6 C;  1A6I A;  4D5F A;  2H8R A;  1OCR H;  4CIC A;  2F4O B;  1L0O C;  3QU6 A;  4YEL A;  1SD5 A;  1TNS A;  3DP7 A;  1Y39 A;  4IHY A;  4XK4 A;  4M72 A;  1K78 B;  1JTY A;  1WJB A;  3BP8 A;  4I01 A;  3E3V A;  4ZH4 F;  2EK5 A;  1WJF A;  1K4T A;  2XPV A;  4BL0 B;  5BNG A;  2LMD A;  3KZI C;  4RAY A;  3HPG A;  2DMU A;  1WWX A;  2J5O A;  1D1B A;  2FU4 A;  4KIF A;  2O6G E;  4YG2 F;  3H5R A;  3Q0U A;  1OR7 C;  2QM3 A;  1MBE A;  4MQ9 F;  2R5Y B;  4EJV A;  2MW8 A;  2W48 A;  3KYC B;  3S15 J;  4JP0 A;  1YJN I;  1DP3 A;  2P4W A;  3MKW B;  3ZMZ A;  4CCN A;  1X19 A;  1Y0U A;  1YQA A;  2VKD A;  3ABL H;  3LSH A;  3ZCO A;  4EJU A;  3A2K A;  2DA5 A;  2CRG A;  3KLN A;  2E1O A;  3BOQ A;  3L09 A;  3JRE A;  2E7W A;  2R92 J;  3GTK J;  1IUF A;  2HQR A;  1IGN A;  2LKP A;  1MIJ A;  2DA4 A;  3EUA A;  4E6K G;  1IRZ A;  1T38 A;  5K5Q A;  2JMW A;  2WA0 A;  1MND A;  5DCM B;  1ETV A;  5F27 A;  2VPL A;  4OMZ A;  2HQN A;  5J8C A;  1HLV A;  2BV6 A;  2M7A A;  1YRN A;  5ICE A;  2KPM A;  2F5D A;  5J3L A;  1ZRE A;  2KP6 A;  5FKN A;  2CUJ A;  3Q9S A;  3E6M A;  2P7V B;  3OS1 A;  3E6C C;  3E5U A;  4XSZ F;  2EPF A;  1FTZ A;  3LL7 A;  1RRJ A;  1DPU A;  4WXC A;  3CDI A;  5EEH A;  4B47 A;  2PMZ N;  1BN5 A;  3D5R C;  1E3P A;  4HEA 2;  3CJN A;  3K1N A;  1XMK A;  2XV4 S;  3QPT A;  2STT A;  2H1L A;  4DYC A;  3IWF A;  2DAO A;  3HKZ A;  4YFN F;  2OQR A;  3CJT B;  4HF0 A;  2VQC A;  3T8R A;  3ECH A;  2R5Y A;  9ANT A;  3OL4 A;  4GRI A;  3WHC A;  5F1R A;  1K6O A;  5JVT A;  2PJP A;  5KAI C;  1B9N A;  3HRT A;  4RM2 A;  4DZJ A;  4P9F A;  2A61 A;  4P5O A;  3T8T A;  4GXO A;  2JUC A;  4MNU A;  3KEQ A;  4JOM A;  3DPT A;  4GGG A;  4KIB A;  1ORK A;  5IT3 A;  2X1D A;  1MNM C;  4RGS A;  4OU0 A;  5F1J A;  4JYK A;  2LYC A;  3KIO A;  2P5L C;  1YIJ I;  5DCM A;  3SYT A;  4UB8 C;  3SFZ A;  1LPQ A;  1NG6 A;  1RR7 A;  2VJ5 A;  1DGR M;  4HAM A;  4XRF A;  2UXN A;  2X1C A;  2DA3 A;  2LG4 A;  3J80 Z;  3J7Z I;  3H9Q A;  3ZQC A;  2R93 J;  1ETW A;  1QHG A;  3VB2 A;  3IKT A;  3LAJ A;  1FX7 A;  4XKW A;  2IGO A;  3GLL A;  1BA5 A;  1FOK A;  4XN3 A;  1UHM A;  4A3M J;  5DD4 A;  2HXO A;  3CCM I;  1WJD A;  3BZ6 A;  3IH4 A;  2A5W A;  4HA8 A;  5GTI C;  1SVL A;  4U0Y A;  1IN4 A;  3KE2 A;  2LRE A;  1QA6 A;  3DXJ F;  2EV0 A;  5ICF A;  2VQL A;  2X51 A;  2H09 A;  4OWR B;  1P7I A;  1R1U A;  2PQ8 A;  1BI0 A;  3WG9 A;  2K7L A;  3NWS A;  3JAM K;  1HW1 A;  5HOD A;  2K9M A;  3U2R A;  1JGS A;  1ZH5 A;  4KMU X;  3AL0 C;  4PZJ A;  4MTE A;  3WTV C;  2KIM A;  2LKS A;  1LE8 A;  1JUP A;  2OQG A;  2FMY A;  1FP2 A;  1JKO C;  3OSG A;  1OCZ H;  1Y1W J;  1BM9 A;  1YX5 A;  3LSM A;  1FEX A;  2PJR B;  3ZOB A;  4I2O A;  2ZFU A;  4TV7 A;  1LDD A;  5HOO A;  5M5Y J;  1ZG3 A;  4DNC A;  4CXF A;  2COB A;  3CES A;  4B44 A;  4IHW A;  4RS8 A;  5F04 A;  4RBO A;  4GYG A;  2EA2 A;  4NNJ A;  5IP7 J;  3BR6 A;  3HBL A;  1PP8 F;  5EGO A;  5FRM A;  3BR3 A;  2HKX A;  1W36 D;  1IDY A;  4XOT A;  1O7F A;  5ILU A;  2L54 A;  4ZYH A;  2O8X A;  2Y48 A;  1DU6 A;  2EWN A;  5CVV A;  1RUO A;  3FM5 A;  3M7G A;  5TGT A;  5FJ8 J;  1Z3X A;  3K9T A;  2M30 A;  2KRH A;  3RKY A;  1B4A A;  2JA8 J;  3RPU D;  4RAZ A;  1IG7 A;  5FRN A;  4WCG A;  4E70 A;  2VE9 A;  3DBH B;  3MKL A;  2VJJ A;  1J5Y A;  2P5V A;  4PJL A;  3CF2 A;  5B3S H;  1S5L C;  2NS7 A;  1IAW A;  2DT6 A;  4ESB A;  1YS6 A;  1TT0 A;  2MBF A;  4MFD A;  3GLX A;  4HLX A;  4IF4 A;  4LIT A;  1FIA A;  2DFF A;  2RN7 A;  2MYS A;  5ICC A;  2EA4 A;  4LLG F;  5FKO A;  3JRI A;  3WTZ A;  2Y9Y A;  3VYU B;  2PJR A;  2A6H F;  2BHZ A;  3I5U A;  4UVA A;  3HGY A;  4IHX A;  1XD7 A;  2X6X A;  3GZN B;  2KZG A;  5DS9 A;  1I27 A;  3BR5 A;  5JHU A;  1B1B A;  4JQF A;  2XAS A;  2GOM A;  1ZR2 A;  3C2G A;  1W5C C;  1LEB A;  3OYC A;  2HWV A;  3MZY A;  1MBF A;  2QF7 A;  1SMY F;  4U7D A;  4L18 B;  1UZC A;  4LB6 B;  4ITV A;  3UR3 C;  3KZY A;  3WGG A;  3HDD A;  3GTM J;  2VOP A;  3AAF A;  3SZP A;  1RPW A;  2QKL B;  2XGC A;  2Y9Z A;  1TQI A;  5LGU A;  3GFJ A;  3O6B B;  3SZG A;  1YO5 C;  1UFM A;  3OYK A;  4J19 A;  1S8N A;  2V6C A;  3V42 A;  4G94 A;  2VT2 A;  2ZB9 A;  1YFH A;  2DU9 A;  1TLH B;  4PJJ A;  5H20 A;  2EH3 A;  4X1E A;  3QP5 A;  2BVL A;  1OJL A;  2KIS A;  1TQM A;  5FD5 A;  3DKW A;  2QQB A;  2EIL H;  5FLM J;  1WSU A;  1Q1V A;  3N05 A;  4HRI A;  4E7S A;  3GW2 A;  3JSO A;  3ABU A;  4A0Z A;  3PNV A;  3A4C A;  1ETX A;  2VON A;  3RZO J;  4I09 A;  1KZH A;  3IP4 B;  4FET A;  5D4S A;  4WWC A;  1BC8 C;  2BY2 A;  1TWF J;  2Z16 A;  1QQI A;  3M1C A;  1U8R A;  1BR1 A;  2HOE A;  2PLY A;  3ZPL A;  3BG6 A;  2ZXI A;  2VKH A;  2L7F P;  2VBY A;  3HSF A;  2R7W A;  2CV2 A;  1ZK8 A;  1IN5 A;  1BIA A;  1JT6 A;  2GLO A;  1X1A A;  3BT9 A;  2P81 A;  1DP7 P;  1IC8 A;  2R7O A;  1R49 A;  1JKQ C;  1OCP A;  1V5G A;  3K0L A;  1TW2 A;  1FSH A;  4XR6 A;  2HDW A;  4ASN A;  2DK8 A;  3F9K A;  4HST A;  2K40 A;  4PDK A;  1ONV A;  4PJM A;  3SDB A;  1MSF C;  1O3T A;  3FK6 A;  1XG1 A;  2R4G A;  1WQ2 A;  3CTA A;  1ZYR F;  1GVD A;  4ESJ A;  3VWB A;  1BW5 A;  3FZV A;  3FMS A;  4E7L A;  2N8G A;  3KEY A;  3CO7 C;  3S2D J;  4XIC A;  2FNA A;  2XAU A;  2FRH A;  2Z2S B;  2L9V A;  1SFK A;  1XDS A;  3LA3 A;  3O3K A;  2MD5 A;  2XPU A;  4N4N B;  3DTI A;  4P55 A;  2DOE A;  1IXS B;  2YU3 A;  1K4S A;  2XSD C;  3S1Q J;  2X6Y A;  3FK7 A;  3RZD J;  1QVU A;  2VBZ A;  5KK1 A;  2DMT A;  4BQQ A;  3CC7 I;  3GEZ A;  2K4J A;  4BE1 A;  2L4M A;  3SEZ A;  2R7V A;  2ELK A;  3D0S A;  4D1Q A;  4LK1 F;  2JPB A;  2Y0S A;  3BLY A;  5L3B A;  5JVG F;  3FIW A;  1QO0 D;  4KT5 C;  2LY9 A;  4JX5 A;  5FLV A;  4Z6Y A;  4G7O F;  2F5V A;  2E2I J;  1S3J A;  3GTG J;  4JBA A;  3VSK A;  3I56 I;  1F1Z A;  1MSE C;  1T6S A;  2WAQ N;  1YG2 A;  3HHG A;  1YIO A;  3CCJ I;  4XLN F;  1VI0 A;  4BJT A;  3CLQ A;  2BW3 B;  1HOM A;  4E7I A;  2FQ4 A;  3BZC A;  2WC2 A;  2QZ8 A;  5EZH A;  2M8G X;  4YEJ A;  5L3E A;  4BE2 A;  3Q9V A;  4PK4 A;  4X6A J;  2E1M B;  2K5C A;  2RQP A;  3K6G A;  3MCZ A;  2DA7 A;  2H94 A;  4WXD A;  1B72 B;  3LQR A;  1HQC A;  4BU2 A;  2NS8 A;  3K4K A;  4CYD A;  4D0P A;  1RI7 A;  3BC8 A;  2KDZ A;  2G7H A;  2JRT A;  1JUM A;  2Y0M A;  4LIU A;  2CG4 A;  1QPM A;  3F23 A;  3FM3 A;  5GAE J;  1LFB A;  1UG0 A;  2G7U A;  2CU7 A;  3E1S A;  2QBY A;  4HW0 A;  1U8B A;  3QPS A;  4N9I A;  2H1K A;  1LKX A;  2A6T A;  2V9K A;  2A05 A;  2BY0 A;  4MTD A;  2R7X A;  3CCS I;  3CJR B;  2NNN A;  3E5Q A;  5FKL A;  2GM4 A;  2IW5 A;  1DQU A;  1GHC A;  5E79 C;  3I0T A;  2OPT A;  1GT0 C;  2F5C A;  1ZAR A;  3HRU A;  3BPX A;  1T2K A;  3CLO A;  1YW9 A;  5ILS A;  3LSG A;  4LK0 F;  4LOC A;  3DEE A;  4IHT A;  1U0J A;  2KKO A;  3OWT A;  4HLY A;  3MKZ A;  2W24 A;  2JPC A;  3KEO A;  3JRF A;  5IT9 Z;  3A1Y A;  1M1E B;  3LMM A;  4P1W A;  1S29 A;  3HJE A;  2F48 A;  2R7T A;  3EUK L;  4U7B A;  3QYB A;  3NQO A;  1HBX G;  2CO5 A;  2E19 A;  1FBU A;  2KFD A;  1BR4 A;  4I98 B;  3DBR B;  4QTR A;  4L9T A;  2CH0 A;  3KX2 A;  2DYS H;  3OYI A;  5M5X J;  2R5Z B;  4CDG A;  3GTQ J;  1HSJ A;  5B5E C;  3FBI B;  2IXS A;  2LNB A;  4KDP A;  3F8C A;  5J4V A;  2W00 A;  1JXS A;  4E7K A;  3BG9 A;  4B09 A;  3TO9 A;  3M4O J;  1V54 H;  4FX0 A;  3QQA A;  4O3M A;  3DTK A;  5KVR A;  5DTD A;  1F43 A;  4JX6 A;  4DQ2 A;  1NG7 A;  3E6D A;  5L3D A;  1P4X A;  1CF7 A;  1FBQ A;  2LH9 A;  3GBG A;  1I5Z A;  4M3G A;  4UV9 A;  5DCF A;  2NS0 A;  2CW8 A;  5L3F A;  3P9I A;  2DOF A;  4IRG A;  4AWX B;  2ETH A;  2YPR A;  3IRR A;  3ZQL A;  4EM1 A;  4HQE A;  4XRS G;  2W82 A;  1RC9 A;  5C3E J;  2L5Q A;  3FHN A;  1VQ8 I;  4B3A A;  3QYE A;  2ISZ A;  4HZF A;  4KFC A;  1RET A;  1P4W A;  2PMH A;  2DXI A;  3G1L A;  3HHH A;  1D0Z A;  2E36 A;  4EJO A;  1U9O A;  2P8T A;  3OYB A;  4H4K C;  3DU5 A;  3JRA A;  5F64 A;  3R60 A;  1WVR A;  2AQF A;  5D5U B;  1USS A;  1ETO A;  3WGI A;  4DIQ A;  1MDM B;  2R5Z A;  1E3O C;  1WRJ A;  2IGN A;  3I9V 2;  3RSN A;  4G7Z F;  1FWZ A;  3ESW B;  3KYD B;  3IUO A;  3TGN A;  4AIJ A;  4MIM A;  1P6R A;  4C30 A;  3W2V A;  2EIM H;  4C3J J;  2FML A;  1S7A A;  2PG4 A;  1AOY A;  3A0B C;  2IGM A;  3TP0 A;  3BCB A;  3HUG B;  2YX4 A;  4HNV A;  2ZXH A;  3GME A;  5F0C A;  4CSW A;  2IT0 A;  1XGN A;  1YI2 I;  3LSJ A;  4M6X A;  2F5E A;  3M8J A;  4PGH A;  2V1D A;  3OYJ A;  3LAP A;  2CQ7 A;  2K02 A;  2W4S A;  4L0Y B;  3EUH A;  2ECB A;  1J7K A;  4II2 A;  4HV6 A;  2JK3 A;  2GIZ A;  2NOG A;  2UWM A;  2VOO A;  3C2B A;  1S7O A;  5DUI A;  2ZXJ A;  1FNN A;  4Y17 A;  1FT9 A;  3HOW J;  3C2H A;  3FXQ A;  1MDM A;  1SAN A;  3AKZ A;  5HS9 A;  3AG1 H;  5ICG A;  2DMN A;  3EYI A;  3LNQ A;  2Y30 A;  2QQA A;  3C1D A;  1W0T A;  1X3Z B;  1IXR C;  3CCY A;  2W7N A;  4HX7 A;  1QVT A;  2HTJ A;  3FKJ A;  4PJ0 C;  3I54 A;  5JHF A;  1XCB A;  2M0M A;  3HUG A;  5E8I A;  3HGG A;  4XOR A;  1QU3 A;  4LFU A;  1OFC X;  4BY7 J;  2XGD A;  3H3V K;  4OIN F;  4LMY A;  3BJA A;  2AS5 F;  3M1E A;  1Y0N A;  5EDN A;  2OF7 A;  1OIS A;  3CCR I;  2NVQ J;  1JE8 A;  2K9N A;  5E3O A;  2WBM A;  1FOW A;  3HSE A;  1JTX A;  4BY1 J;  2RAE A;  2CQX A;  2MAB A;  1Y8R B;  1D1A A;  3H3U A;  4BDZ A;  2EFN A;  4LG3 A;  2IJL A;  1SFE A;  2ZSH B;  1B9M A;  2V26 A;  4AU7 A;  3HOT A;  3ELK A;  3K2Z A;  2GXA A;  3H0D A;  4OIP F;  2HYF A;  3J7Y J;  2NVT J;  1YRN B;  2Q8K A;  5JR3 A;  3SJM A;  5F0F A;  1T0F A;  4PJN A;  2R7Z J;  3PIP F;  3L2W A;  4V19 K;  2QGU A;  2L3D A;  4EM0 B;  4Y13 A;  2CV1 A;  1RIO H;  4A3K J;  4DBQ A;  1IRG A;  1WH7 A;  4PGG A;  2K85 A;  1HDD C;  2DK5 A;  4B43 A;  1MMG A;  3D5L A;  2ZKZ A;  2LDU A;  2W25 A;  2LD5 A;  1G2H A;  1ERD A;  5LEK A;  4IQJ A;  3O2P E;  2L0K A;  1ETQ A;  3HZJ A;  4IRI A;  5D8L B;  4G8X A;  3N4M A;  3G1M A;  3IL2 A;  2IS1 A;  3BR2 A;  3H35 A;  2Y69 H;  4N0B A;  1UAA A;  4LG0 B;  2EZL A;  5LD2 C;  1FY7 A;  1R5H A;  2XKP A;  4FCY A;  2Z5U A;  2BYV E;  2X9D A;  2QQ9 A;  4BJ6 C;  1FMV A;  4OMY A;  1FMW A;  3BCA A;  3K4J A;  2OD5 A;  2JVG A;  2M3A A;  2OV7 A;  3VSL A;  3VOD A;  1NHA A;  1SFX A;  4MO7 A;  3WU2 C;  1YW7 A;  2IS6 A;  2VI6 A;  1WHU A;  2LTP A;  3WOD F;  1IN7 A;  4G9Y A;  3ZP5 A;  4RGR A;  2VQH A;  1WCM J;  2IP2 A;  3F3X A;  2NYX A;  2WAE A;  3IH3 A;  3RKX A;  4N9H A;  3E0J B;  3RQI A;  3GX4 X;  3S3N A;  3KZZ A;  5FKK A;  2XF5 A;  3DCF A;  2Z3Y A;  2AXT C;  2E60 A;  3FKI J;  4HV5 A;  2ZNY A;  4XON A;  3HEF A;  1I39 A;  3W3C A;  1Z21 A;  3OOU A;  4Y4R A;  5DM7 F;  1CGP A;  5B66 C;  4EJW A;  5EF6 A;  3RQ4 A;  4BS9 A;  3EUH C;  3L00 A;  3F6V A;  3F8N A;  4FT8 A;  2NVU B;  4BHB A;  3HOZ J;  1D0Y A;  4C3I J;  3MAJ A;  3WE2 A;  3VEP A;  1VQ7 I;  4G6D A;  1LB2 A;  2H27 A;  2B7E A;  2ZXW H;  3NEU A;  3TDU C;  4XRS A;  3VYS B;  3F21 A;  1LE8 B;  4EV0 A;  2ZME A;  4LG0 A;  3TL4 X;  1AHD P;  4R8H A;  1KU2 A;  2DTZ A;  1OQY A;  2GXG A; 
#chains in the Genus database with same CATH homology
 1H9T A;  4Z2Y A;  2A3S A;  1Z1D A;  1SAX A;  2D1H A;  1BI1 A;  1K79 A;  3KFW X;  4AD9 A;  5D5V B;  4ENK A;  3J80 K;  3G3Z A;  1ZG5 A;  1J59 A;  2M5W A;  4UVB A;  5K5R A;  1L3L A;  1R58 A;  2KIU A;  3ERE D;  1O3R A;  1OYY A;  4A5M A;  4M9X A;  3MQ0 A;  3I53 A;  2GZW A;  1KU9 A;  2DTR A;  3VOE A;  4PCQ A;  1ZN2 A;  2LSO A;  2O03 A;  3PFI A;  2CWE A;  3JTG A;  4UUV A;  1BOA A;  3JAM Z;  1BBY A;  2ZCW A;  2FOK A;  1TTY A;  1I6X A;  2GXB A;  3CDH A;  4ENM A;  3QAH A;  4BXU A;  3QRF F;  1S6L A;  2VN2 A;  3BY6 A;  1U3E M;  3ROU A;  4M6Y A;  1P2F A;  4L5I A;  2C6Y A;  1WI9 A;  2EV5 A;  4WX9 A;  4JK1 X;  3ZQ7 A;  3IC7 A;  2XAH A;  3GYH X;  2DBB A;  4EGY A;  1ZHF A;  2DPD A;  1LNW A;  1KA8 A;  2IRF G;  2H6B A;  5LBQ A;  1R1V A;  2M1B A;  2FBI A;  1KU7 A;  3QP6 A;  4Q4Z F;  4EJT A;  3K69 A;  1XCV A;  4I0B A;  2EFQ A;  2O3F A;  4BHC A;  2FF4 A;  3P7N A;  2L4A A;  1ZAO A;  2KRF A;  3ECO A;  1XGO A;  1LVA A;  4ZZL A;  4HX8 A;  3C3W A;  2ESN A;  3KP4 A;  1R5G A;  2FXA A;  2VOD A;  2V9V A;  3BJ6 A;  3FX3 A;  2OZU A;  3FF5 A;  1XB4 A;  2FSW A;  3ISP A;  1OPC A;  1IF1 A;  4BHP A;  3H3Z A;  2R7D A;  3TO6 A;  3F8M A;  3TQN A;  3J81 Z;  1HKT A;  2ZFW A;  5TJJ A;  2HKO A;  3BJO A;  1C0W A;  3RPQ A;  1P92 A;  3I58 A;  3LST A;  1QZZ A;  1Z9C A;  2V1U A;  1X3U A;  2F5F A;  4UVC A;  4UNO A;  4XLP F;  3HRM A;  2DT5 A;  2IA1 A;  4YFK F;  2HDC A;  1OMI A;  3LA7 A;  2P5K A;  1TBX A;  1QZY A;  3HYI A;  5A2Q K;  1HW5 A;  1V3F A;  4I0A A;  3RYR A;  3GFM A;  4L5J A;  1G3T A;  3FXU A;  3F6O A;  1O7L A;  2WV0 A;  3RYP A;  1XGS A;  1FYM A;  4R1H A;  1MJA A;  5CVI A;  2QBY B;  1B6A A;  3U9G A;  3JW4 A;  2F2E A;  4IHS A;  2EV6 A;  4G7H F;  1Z6T A;  1ODD A;  3K1P A;  3RKW A;  2STW A;  1DDN A;  3QPH A;  5H6R A;  5K1Y A;  4EMS A;  2ZO4 A;  1XGM A;  3GF2 A;  1XSV A;  4Q47 A;  1SD6 A;  1EH8 A;  4ESF A;  1ZRD A;  1MKM A;  4YFX F;  1FYL A;  3WTU C;  1FLI A;  1ZLJ A;  3I64 A;  2R3S A;  1BC7 C;  2RKH A;  2P6T A;  3F22 A;  3CUQ A;  4ENN A;  3FXR A;  2QLZ A;  1XMA A;  4LLN A;  1UB9 A;  3I71 A;  2RV8 A;  4HBL A;  2HGC A;  1FYK A;  4P96 A;  1HST A;  1CF7 B;  5FFX A;  2FEZ A;  3PQJ A;  2GWR A;  2Q2E A;  5L3G A;  1U5T B;  3W6K B;  4IJA A;  3ABT A;  4KNY A;  1QNT A;  5CLS A;  2VBW A;  3IWZ A;  2G9W A;  3P9C A;  2GAU A;  3ZMS A;  5BOX A;  1STZ A;  4MHG A;  1FZP B;  3CUO A;  3T1B A;  1YTY A;  3ZMV A;  3L2C A;  5IT9 K;  3MEX A;  2YSR A;  4YIF A;  4IRH A;  4RB3 C;  2MLG A;  4LB5 A;  2XRO A;  3M9A A;  3ML6 A;  4BNC A;  3WU1 B;  3V7C A;  2FNP A;  1SD7 A;  1Z05 A;  2Z33 A;  2CW0 F;  2OBP A;  5JFR A;  2LF7 A;  5E1Z B;  3B02 A;  2W57 A;  3V8J A;  4IXA A;  3LFK A;  3HTU A;  5BPI A;  1U5T A;  3L9F A;  3HIF A;  4OIQ F;  2D2W A;  1ZLK A;  2NAZ A;  4CO8 A;  5D6F A;  3QOP A;  4WXH A;  4IPA A;  5FLX Z;  2Y75 A;  5H6Q A;  5CYV A;  1JHH A;  4O6J A;  5AIP A;  1IZ1 A;  4A6D A;  1Z91 A;  1XSD A;  4LLL A;  2XVC A;  4H0E A;  4HF2 A;  1TNT A;  2A6E F;  2XUB A;  4CGZ A;  1GXQ A;  2E7X A;  1ON1 A;  3KP2 A;  3BRO A;  3R61 A;  1IN8 A;  1ZRC A;  2RC4 A;  1R7J A;  5BS6 A;  5LHH A;  2B0L A;  1MJ9 A;  4A0Y A;  4CHU A;  2A5Y B;  1ON2 A;  4GO1 A;  1W5S A;  5AON A;  1IW7 F;  2RDP A;  4ETS A;  2LF8 A;  2EJR A;  3F72 A;  4MEX F;  3E6B A;  3WU0 A;  2J5P A;  1XDU A;  4WK8 F;  3GFL A;  4FX4 A;  5FFZ A;  3FMQ A;  3V8L A;  5HDG A;  1W5T A;  2XRN A;  1IXC A;  5DUK A;  1KYW A;  2Z99 A;  5D4R A;  4UHT A;  1J9I A;  2CGP A;  2CSO A;  3CUQ C;  5LLQ A;  3WE3 A;  3F8F A;  5FD6 A;  3COA C;  1W7P B;  4A2U A;  2TDX A;  2BEO A;  2ZJ2 A;  2FBH A;  5HDK A;  1W4M A;  2IA0 A;  1R36 A;  2QVO A;  4U88 A;  5CJ9 A;  2UXX A;  2X0L A;  1QBJ A;  2RNJ A;  5HLG A;  1LDK B;  1U2W A;  5BMZ A;  4Q48 A;  5HS7 A;  3GUD A;  1GXP A;  3ZMD A;  1D3Y A;  1WKM A;  5LRR A;  1R00 A;  2UZK A;  2VE8 A;  3DFG A;  1YLF A;  3T0Y A;  2FBK A;  3BPV A;  2CQK A;  1KYZ A;  3I59 B;  1O57 A;  1W7P A;  4NQW A;  3EDP A;  2XAQ A;  2BGC A;  1Z7U A;  1U5T C;  2EB7 A;  1ZG1 A;  4KN7 X;  2CYY A;  5FB2 A;  3WTS C;  1KQ9 A;  3L7W A;  3BWG A;  3RDI A;  5K5O A;  4KIG A;  1MGT A;  4P9U A;  1G3S A;  1U6G A;  2PI0 A;  3JTH A;  4U0W A;  2AXL A;  2ZME B;  3OV8 A;  4KN4 X;  3P9K A;  1PDN C;  2O0Y A;  1OKR A;  4XBF A;  2Q0O A;  2XIG A;  3LA2 A;  4AIH A;  4ZYD A;  1HKS A;  2EFW A;  4I02 A;  4M9S A;  3GZ6 A;  3IHU A;  2FA5 A;  3KP6 A;  5J6X A;  2QWW A;  3I59 A;  3R0A A;  1QGP A;  4QLC U;  3NRV A;  2ZNZ A;  3F8B A;  2MC3 A;  4ON0 A;  3TOB A;  4OIO F;  1KQ0 A;  1EV7 A;  5HLH A;  1LDJ A;  4M73 A;  4Y15 A;  3W6J B;  4A6E A;  1K78 A;  2FE3 A;  2VXZ A;  3MZH A;  3IKV A;  2ACJ A;  2DQL A;  2D1V A;  1D5V A;  3S2W A;  2EFP A;  3GXO A;  3EQL F;  3KET A;  2RVC A;  2XAJ A;  4ZYE A;  3JSP A;  3WTY C;  3V4G A;  2DLL A;  2DI3 A;  2A68 F;  3H92 A;  1FP1 D;  2P7C B;  1UCR A;  3I4P A;  5ILV A;  3U1D A;  1DPR A;  4LJZ F;  2HTS A;  3SZT A;  3GO5 A;  3GFI A;  3EYY A;  5F6F A;  3OOP A;  5E18 F;  2Z9O A;  5CVJ A;  4EM2 A;  2MA3 A;  3RTR A;  3KP5 A;  3HRS A;  2M8E A;  5E20 A;  2DQR A;  4S05 A;  2CFX A;  1J2X A;  4GYI A;  2O61 A;  5DD8 A;  4A0X A;  1FBS A;  2JT1 A;  3WTW C;  3ZMU A;  1G3W A;  3SHF A;  4EGZ A;  1DUX C;  4IVN A;  1R1T A;  1T39 A;  5D5W B;  2V1X A;  3M8F A;  1E17 A;  1Z6R A;  2PMU A;  1U78 A;  1KGS A;  3FHZ A;  4OIR F;  4L9J A;  2IVM A;  3HOS A;  2HS5 A;  4A12 A;  2HZT A;  3MFK A;  3ZN1 A;  3QU3 A;  3M8E A;  1HXD A;  2XAG A;  1XN7 A;  2L01 A;  3RJP A;  4NB5 A;  2X4H A;  4MQV A;  5ERI A;  5E17 F;  2RGV A;  3R4K A;  1R22 A;  3V7S A;  2VT3 A;  1HW2 A;  1RUN A;  2ADU A;  1XSX A;  2PFB A;  4M9Z A;  3KLO A;  3DPL C;  5BPD A;  1SFU A;  2KIF A;  3KP7 A;  5D8K B;  4RB2 C;  4KUM A;  4FHT A;  4HDV A;  2JZY A;  3C18 A;  4L9V A;  4KMF A;  4HOB A;  2OAZ A;  2VC0 A;  4HF1 A;  2VC1 A;  5L3C A;  2XKO A;  3J81 K;  4CZZ A;  1BI2 A;  1FC3 A;  1FPQ A;  3J7A O;  2NNY A;  4LD5 A;  2GA2 A;  3DF8 A;  3DV8 A;  1UST A;  2DFI A;  4B8X A;  4KYW A;  5LRS A;  2GQQ A;  3HTS B;  2BBY A;  2WWY A;  4AVP A;  1F9N A;  5LGT A;  1YS7 A;  2HYG D;  4G6Q A;  1MD0 A;  2YR2 A;  1O3S A;  2EFO A;  4MEY F;  1AWC A;  1BIB A;  5LHI A;  4OOI A;  3CUQ B;  3EET A;  4LGW A;  5A2Q Z;  3G73 A;  4M74 A;  1D8K A;  3N97 A;  1J75 A;  2YX7 A;  3V7R A;  1VTN C;  3TOA A;  2GIV A;  2HEO A;  1F5T A;  1OYW A;  1R23 A;  1ULY A;  4AIK A;  4L9N A;  1V4R A;  3TO7 A;  1KU3 A;  3VFZ A;  4KIC A;  1TW3 A;  5HVQ C;  5E1X A;  2GA1 A;  1SD4 A;  1EH7 A;  1SMT A;  1PUE E;  2IPQ X;  1Q1H A;  1FSE A;  4HYE A;  1I1S A;  3KCC A;  4NHJ A;  5DDG A;  4ZZD A;  5EEG A;  2R7F A;  3GVA A;  2DW4 A;  3B73 A;  3PQK A;  5LGN A;  1J0R A;  2L02 A;  4BYY A;  3KP3 A;  3C7J A;  3R6S A;  2K4B A;  5FO5 A;  5AIQ A;  2JTV A;  3RPU A;  1B59 A;  1IN6 A;  2A69 F;  2DO7 A;  5TRD A;  2PBI A;  3GZ5 A;  4QWQ A;  3TKY A;  1HKQ A;  1T98 A;  5ED4 A;  3GWZ A;  4Q5S F;  4UV8 A;  3WTX C;  2M45 A;  1TQP A;  2XAF A;  1ZGA A;  1A04 A;  1YW8 A;  5DEQ A;  1W7P D;  1E2X A;  4KA4 A;  4BQA A;  1ZGJ A;  2HR3 A;  1G6N A;  3SXY A;  2JSC A;  3RIR A;  4O5V A;  4RB0 A;  2XGX A;  2M87 A;  2A07 F;  3ULQ B;  5BQT A;  2P6S A;  2K27 A;  1GVJ A;  3DEU A;  2OZ6 A;  2E1N A;  4ENJ A;  1KQ8 A;  1F4K A;  2ISY A;  4ZYG A;  2H6C A;  2QEN A;  5CVU A;  3WGH A;  1RNL A;  1K7A A;  2HFH A;  2W84 A;  2OA4 A;  1LJ9 A;  5CVR A;  2QYO A;  1LQ1 A;  5FLX K;  2E1C A;  2DPU A;  4K2E A;  5DV5 A;  4L0Z B;  3FMR A;  3HSR A;  2ZBK A;  1G4D A;  2PN6 A;  2KJB A;  1P4A A;  2KJC A;  1OR7 A;  4BAY A;  4EVI A;  4HQM A;  5D6E A;  2MLK A;  4U0V A;  1PP7 U;  4XSX F;  5E1W A;  5J8F A;  1EH6 A;  3BDD A;  1IRF A;  3REO A;  2QUF A;  4RGU A;  3R0J A;  4RGX A;  4F7Z A;  2PEX A;  3ZN0 A;  2VBX A;  5D5X B;  2COM A;  2IA2 A;  3TDZ C;  1OYI A;  4YII A;  2W85 A;  5JI6 A;  2NRA C;  1MJB A;  3E97 A;  1UHW A;  1YYV A;  2MH9 A;  1REP C;  2D45 A;  3ZMT A;  5LEJ A;  2FQ3 A;  3V8K A;  1MZB A;  1ZRF A;  2ESH A;  4S04 A;  6PAX A;  1O3Q A;  4BH9 A;  3SQN A;  5HS8 A;  4RB1 A;  2V79 A;  3K1M A;  3E5X A;  1H0M A;  1D8J A;  5FGM A;  4MGR A;  4WF2 A;  4HDU A;  5HDN A;  4GCV A;  2OU2 A;  3LQQ A;  3LWF A;  5HLI A;  4UXN A;  2WTE A;  1I1G A;  4I7H A;  3MWM A;  1LEA A;  4R79 A;  1BJA A;  2ELH A;  1RZ4 A;  4HX4 A;  5E8G A;  1BI3 A;  3IRQ A;  3DQV C;  4M71 A;  4A5N A;  1JHF A;  2K86 A;  3RI4 A;  3Q5F A;  2BE5 F;  2MH2 A;  5LHG A;  1H9G A;  1G3Y A;  3WTT C;  4EQQ A;  2XHK A;  3FWE A;  3T5X A;  5DYM A;  3CO6 C;  4CIC A;  1L0O C;  3QU6 A;  1SD5 A;  1TNS A;  3DP7 A;  4M72 A;  1K78 B;  3BP8 A;  4I01 A;  4ZH4 F;  3E3V A;  2EK5 A;  4RAY A;  1WWX A;  2J5O A;  4KIF A;  2FU4 A;  2O6G E;  4YG2 F;  2QM3 A;  4MQ9 F;  4EJV A;  2P4W A;  3ZMZ A;  1Y0U A;  1YQA A;  4EJU A;  3KLN A;  3BOQ A;  3L09 A;  2E7W A;  2HQR A;  2LKP A;  1T38 A;  5K5Q A;  5DCM B;  4OMZ A;  2HQN A;  5J8C A;  2BV6 A;  5ICE A;  2F5D A;  1ZRE A;  3Q9S A;  3E6M A;  2P7V B;  3E6C C;  3E5U A;  4XSZ F;  1DPU A;  4WXC A;  5EEH A;  1BN5 A;  3CJN A;  3K1N A;  1XMK A;  2XV4 S;  3QPT A;  2STT A;  3IWF A;  2DAO A;  4YFN F;  2OQR A;  4HF0 A;  3T8R A;  3ECH A;  5F1R A;  1K6O A;  5JVT A;  2PJP A;  1B9N A;  3HRT A;  4P9F A;  2A61 A;  4P5O A;  3T8T A;  4GXO A;  4MNU A;  3KEQ A;  3DPT A;  4GGG A;  4KIB A;  5IT3 A;  4RGS A;  4OU0 A;  2P5L C;  5DCM A;  3SFZ A;  4XRF A;  3J80 Z;  4HAM A;  1IUY A;  2UXN A;  3VB2 A;  3IKT A;  3LAJ A;  1FX7 A;  1FOK A;  1UHM A;  5DD4 A;  3BZ6 A;  4HA8 A;  4U0Y A;  1IN4 A;  3KE2 A;  3DXJ F;  2EV0 A;  5ICF A;  2H09 A;  1R1U A;  2PQ8 A;  1BI0 A;  3WG9 A;  2K7L A;  3JAM K;  1HW1 A;  3U2R A;  1JGS A;  1ZH5 A;  4KMU X;  4PZJ A;  4MTE A;  3WTV C;  2KIM A;  2OQG A;  2FMY A;  1FP2 A;  1BM9 A;  4I2O A;  4TV7 A;  1LDD A;  5HOO A;  1ZG3 A;  4DNC A;  4CXF A;  4RS8 A;  4GYG A;  2EA2 A;  1PP8 F;  2HKX A;  1O7F A;  5ILU A;  2L54 A;  4ZYH A;  2O8X A;  2Y48 A;  2EWN A;  5CVV A;  1RUO A;  3FM5 A;  3M7G A;  3K9T A;  2M30 A;  3RKY A;  1B4A A;  4RAZ A;  4WCG A;  4E70 A;  2VE9 A;  1J5Y A;  2P5V A;  1IAW A;  4ESB A;  1YS6 A;  2MBF A;  3GLX A;  4HLX A;  4IF4 A;  2RN7 A;  5ICC A;  2EA4 A;  4LLG F;  3WTZ A;  2A6H F;  3I5U A;  4UVA A;  1XD7 A;  1I27 A;  5JHU A;  1B1B A;  4JQF A;  2XAS A;  1LEB A;  2HWV A;  3MZY A;  1SMY F;  4U7D A;  4L18 B;  4LB6 B;  3WGG A;  3KZY A;  2VOP A;  3AAF A;  3SZP A;  1TQI A;  5LGU A;  3GFJ A;  3O6B B;  1YO5 C;  1UFM A;  1S8N A;  2V6C A;  4G94 A;  2VT2 A;  1YFH A;  2DU9 A;  1TLH B;  5H20 A;  3QP5 A;  1TQM A;  5FD5 A;  3DKW A;  2QQB A;  1WSU A;  3GW2 A;  3JSO A;  3ABU A;  4A0Z A;  2VON A;  4I09 A;  5D4S A;  4WWC A;  1BC8 C;  1QQI A;  1U8R A;  2HOE A;  2PLY A;  3ZPL A;  2VBY A;  3HSF A;  1IN5 A;  1BIA A;  1DP7 P;  3K0L A;  1TW2 A;  1FSH A;  4ASN A;  2DK8 A;  4PDK A;  1ONV A;  1O3T A;  1WQ2 A;  3CTA A;  1ZYR F;  4ESJ A;  3FZV A;  3FMS A;  3CO7 C;  2FNA A;  2FRH A;  1XDS A;  3LA3 A;  3O3K A;  2MD5 A;  4P55 A;  1IXS B;  2YU3 A;  5KK1 A;  2VBZ A;  3GEZ A;  2K4J A;  2L4M A;  3D0S A;  4LK1 F;  2JPB A;  5L3B A;  1QO0 D;  4KT5 C;  4G7O F;  1S3J A;  4JBA A;  1F1Z A;  1T6S A;  1YG2 A;  3HHG A;  1YIO A;  4XLN F;  2WC2 A;  2QZ8 A;  5L3E A;  3Q9V A;  2RQP A;  3MCZ A;  2H94 A;  4WXD A;  3LQR A;  1HQC A;  4CYD A;  4D0P A;  1RI7 A;  2G7H A;  2JRT A;  2Y0M A;  2CG4 A;  1QPM A;  3F23 A;  3FM3 A;  2G7U A;  2QBY A;  4HW0 A;  4N9I A;  4MTD A;  2NNN A;  3E5Q A;  2IW5 A;  1GHC A;  3I0T A;  2F5C A;  1ZAR A;  3HRU A;  3BPX A;  1T2K A;  3CLO A;  1YW9 A;  5ILS A;  4LK0 F;  4IHT A;  2KKO A;  4HLY A;  2W24 A;  2JPC A;  3KEO A;  5IT9 Z;  1S29 A;  4U7B A;  3NQO A;  1HBX G;  2CO5 A;  1FBU A;  4I98 B;  4L9T A;  4CDG A;  1HSJ A;  2LNB A;  4KDP A;  3F8C A;  1JXS A;  4B09 A;  3TO9 A;  4FX0 A;  4O3M A;  5KVR A;  4DQ2 A;  3E6D A;  5L3D A;  1P4X A;  1CF7 A;  1FBQ A;  4UV9 A;  5DCF A;  1I5Z A;  2NS0 A;  5L3F A;  3P9I A;  4IRG A;  4AWX B;  2ETH A;  2YPR A;  3IRR A;  4EM1 A;  4HQE A;  2ISZ A;  4HZF A;  4KFC A;  1P4W A;  2PMH A;  3HHH A;  4EJO A;  2P8T A;  5F64 A;  3R60 A;  5D5U B;  1USS A;  3WGI A;  1MDM B;  1WRJ A;  4G7Z F;  1FWZ A;  3TGN A;  4AIJ A;  1P6R A;  2FML A;  1S7A A;  2PG4 A;  1AOY A;  2YX4 A;  2IT0 A;  1XGN A;  4M6X A;  2F5E A;  4PGH A;  2V1D A;  3LAP A;  2K02 A;  4L0Y B;  3EUH A;  1J7K A;  4HV6 A;  2UWM A;  2VOO A;  1S7O A;  5DUI A;  2ZXJ A;  1FNN A;  4Y17 A;  1FT9 A;  3FXQ A;  1MDM A;  5HS9 A;  5ICG A;  3EYI A;  3C1D A;  2QQA A;  1IXR C;  4HX7 A;  2HTJ A;  3I54 A;  1XCB A;  3HUG A;  5E8I A;  4LFU A;  4OIN F;  4LMY A;  3BJA A;  2AS5 F;  3M1E A;  1JE8 A;  3HSE A;  3H3U A;  2EFN A;  2IJL A;  3HOT A;  1SFE A;  1B9M A;  3ELK A;  3K2Z A;  4OIP F;  2HYF A;  2Q8K A;  5JR3 A;  1T0F A;  2L3D A;  4EM0 B;  4Y13 A;  1RIO H;  1IRG A;  4PGG A;  2DK5 A;  3D5L A;  2ZKZ A;  2LDU A;  2W25 A;  5LEK A;  3O2P E;  4IRI A;  5D8L B;  4G8X A;  3N4M A;  3IL2 A;  4N0B A;  4LG0 B;  1FY7 A;  1R5H A;  2XKP A;  2Z5U A;  2BYV E;  2QQ9 A;  4OMY A;  2OD5 A;  3VOD A;  1NHA A;  1SFX A;  1YW7 A;  3WOD F;  1IN7 A;  4G9Y A;  3ZP5 A;  4RGR A;  2IP2 A;  3F3X A;  2NYX A;  3RKX A;  4N9H A;  3GX4 X;  3KZZ A;  2Z3Y A;  4HV5 A;  2ZNY A;  1CGP A;  4EJW A;  3L00 A;  3F6V A;  3F8N A;  4FT8 A;  4BHB A;  3MAJ A;  3WE2 A;  3VEP A;  4G6D A;  1LB2 A;  2H27 A;  3NEU A;  3TDU C;  3F21 A;  4EV0 A;  2ZME A;  4LG0 A;  4R8H A;  1KU2 A;  2GXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...