1IRGA

Interferon regulatory factor-2 dna binding domain, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
112
structure length
112
Chain Sequence
PVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERFERON REGULATORY FACTOR-2
publication title Solution structure of the IRF-2 DNA-binding domain: a novel subgroup of the winged helix-turn-helix family.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription regulation
total genus 14
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1997-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1irgA00
3GX4X 1QBJA 5DCFA 4R79A 2MLGA 1W5SA 2M5WA 1DDNA 2NAZA 3T0YA 1BC8C 2DPUA 4HF1A 3TDUC 1FP2A 1TQIA 3K1MA 5D5UB 3JTGA 5HDNA 3M1EA 4K2EA 4AVPA 2HOEA 2H27A 4ON0A 3I59B 1P2FA 1R5GA 4RB1A 1GHCA 4KMUX 4U0YA 5E1ZB 3WTZA 3LWFA 3WE2A 4KNYA 5HDGA 4CDGA 5LEKA 4KFCA 2M8EA 3H3UA 5TRDA 3IRRA 3K9TA 4BHCA 2XRNA 2PMHA 1JGSA 3VEPA 2X0LA 5HVQC 3RPUA 1BI1A 2DI3A 1ZG5A 3V8LA 3MAJA 2VN2A 2JZYA 4LLNA 2E1CA 3SZPA 4LLLA 4EJVA 3RKYA 2L4MA 4N9HA 3WTUC 2DK5A 2K4JA 4M9ZA 3I64A 1BI0A 1ZHFA 4LB5A 1YFHA 3DFGA 2O3FA 1DP7P 1R1VA 3KEOA 2PJPA 2BEOA 3KP6A 2PI0A 2ISYA 2BV6A 5ICEA 4G7OF 1PDNC 4LD5A 2P8TA 4RB2C 4M71A 2F5DA 3JSOA 5DV5A 5JR3A 5BQTA 2L02A 2DAOA 3DP7A 3M8EA 1LDDA 1U5TB 2ZKZA 1BI2A 1NHAA 1BOAA 1XSXA 4A2UA 1FX7A 2BGCA 4BAYA 4YFKF 1USTA 2P5KA 3WG9A 2G7HA 3GZ5A 1FBUA 4M9SA 1Y0UA 1F1ZA 1J9IA 1IXCA 3F8FA 2FRHA 2OD5A 1FLIA 3WGGA 2QQBA 4KMFA 1RI7A 1I1SA 4ZYHA 4EMSA 3V8KA 2KJBA 4CICA 1T2KA 3R6SA 1O7LA 1KA8A 2W85A 4N0BA 2PLYA 2L54A 1STZA 2RNJA 5DD8A 3PQKA 1D8JA 3ABTA 2XUBA 3K1NA 4JBAA 4D0PA 1TW2A 3ZMZA 1FC3A 1XD7A 1R36A 5L3EA 5K5OA 3ZPLA 5JI6A 2OA4A 1HW2A 4UV9A 1R58A 5L3BA 2DLLA 3U2RA 1HW5A 5D5XB 2OZ6A 3K1PA 3U1DA 4FHTA 1P4XA 2OAZA 4KA4A 1B9MA 3T1BA 2EWNA 4HX4A 2NS0A 4HZFA 3ECOA 5LLQA 2D45A 1WI9A 1JE8A 2FOKA 3KZYA 3WTVC 3ULQB 2Z99A 3DXJF 2NYXA 2W84A 3V7CA 1L3LA 3ZMUA 3BY6A 2FBIA 4U7BA 5L3DA 3H3ZA 2DO7A 4PZJA 3LA2A 5EEHA 1F4KA 1HKQA 3ELKA 3D5LA 4PCQA 2EK5A 1OPCA 2NRAC 4KYWA 2UZKA 4L0ZB 2OBPA 2XAJA 4L5IA 3TO7A 2L4AA 4HDVA 3F8NA 2PBIA 1DPUA 3RPQA 4RGRA 2QENA 3BOQA 4MNUA 2ZNZA 3EUHA 4KICA 3LA3A 4IVNA 4ZH4F 3SFZA 1Z91A 5BOXA 2J5OA 4BHBA 3OOPA 4HA8A 2Z33A 4EM0B 4LG0B 5D8LB 4EJWA 3RIRA 3LSTA 4EVIA 5AIQA 4L18B 5HDKA 3O6BB 5DEQA 1GXPA 1YW7A 3IKVA 3FZVA 2FMYA 3IRQA 2V79A 4HAMA 4E70A 4HX8A 3JSPA 5D6EA 2P7CB 2E1NA 2IA0A 4LB6B 4QWQA 4IHTA 1ZRDA 2HEOA 1X3UA 2XKPA 2XAQA 5J8CA 1HXDA 3WTSC 5ILSA 1G6NA 3NQOA 1TNSA 3FXUA 2VBXA 3JW4A 2O6GE 3K2ZA 2CW0F 3S2WA 1T6SA 1IN6A 2BYVE 1G4DA 2AXLA 1SD6A 1C0WA 5AIPA 1IZ1A 3F3XA 1Z1DA 2EB7A 4BYYA 3W6KB 1I5ZA 4G6DA 4A12A 1LQ1A 2OQGA 2XAFA 1K79A 3BJ6A 4F7ZA 5FLXK 3ZMTA 4OMYA 3E6CC 1B59A 3G73A 3EDPA 6PAXA 1YO5C 3R4KA 1F9NA 3F72A 5H20A 2WC2A 4KDPA 2C6YA 5E18F 3GFIA 1Z7UA 2GAUA 4G7HF 3IL2A 3KP4A 3WODF 4EGZA 3BDDA 3I53A 2MBFA 5F1RA 1ZG1A 3HIFA 4HF2A 4MQVA 2VC1A 4LJZF 2PQ8A 1QQIA 1O3SA 2V6CA 3TDZC 4MEXF 4BNCA 4GXOA 4AIKA 4G9YA 1QZZA 1MJ9A 2FMLA 3ABUA 4PGGA 2RV8A 3J80K 5LHGA 1XDSA 4RGUA 1SAXA 1P4WA 1KU9A 4OIPF 3WTXC 2HKXA 5CVJA 2FBHA 3E97A 3HRMA 3NEUA 1K7AA 2BBYA 4AIJA 3CLOA 1XDUA 3ML6A 2EFWA 4G94A 3SQNA 2HWVA 4LLGF 3KEQA 5HLHA 1ZN2A 3JTHA 5LRRA 2HTSA 4IJAA 3TKYA 2ESHA 3O3KA 1EH8A 3IC7A 4R8HA 5DYMA 3R0AA 3LQQA 3CJNA 3MCZA 1J2XA 5E17F 3QPHA 2F5EA 2GQQA 2XKOA 2ZFWA 2XAGA 5K5QA 1BIAA 4GYGA 1RNLA 3J81K 2P6TA 1V4RA 5CVIA 2JT1A 5LEJA 2XIGA 2QWWA 3B02A 3QU3A 1Z6TA 1ON1A 3RYPA 2HR3A 2IW5A 3P9IA 3HTSB 3TGNA 2LKPA 3HTUA 3MFKA 4CGZA 2K02A 1SFUA 3C7JA 3HRUA 3V4GA 1R22A 4KUMA 1MD0A 5HS8A 3O2PE 2FF4A 1T38A 4ZZDA 1UCRA 2OZUA 4ZYDA 2V9VA 1IRGA 3TOBA 2OQRA 3BPXA 4HBLA 2QYOA 2VT2A 3N4MA 1TLHB 2MD5A 3MEXA 3FM3A 1O3TA 5ED4A 3IWFA 3TQNA 2M1BA 5LHHA 3HUGA 2RC4A 5D8KB 3HHGA 2DU9A 4HDUA 4MTDA 4EV0A 2R3SA 4KN7X 4ZZLA 3BPVA 4XBFA 1T0FA 3SXYA 1FBQA 2CQKA 3KLNA 3R60A 1KQ0A 2VC0A 1G3TA 4IRHA 1TBXA 1YLFA 2ESNA 3GZ6A 1U8RA 1LEBA 1XCVA 1VTNC 2K86A 3GFLA 1O57A 4RAYA 5CVRA 2VOOA 5IT9K 1ZRFA 5TJJA 5LGTA 4RGSA 3FWEA 1BJAA 5ICFA 1FBSA 3ISPA 4DQ2A 5IT3A 3DEUA 4Y17A 4M6XA 1XMKA 1BC7C 1B1BA 3FHZA 3FX3A 3Q9SA 2M30A 5LHIA 2FXAA 4M72A 2B0LA 5E8IA 1J0RA 2ADUA 2FU4A 3I4PA 1LB2A 2QBYA 5EEGA 1FPQA 2HS5A 2W57A 5JFRA 4JK1X 5HOOA 5D5VB 2ZMEA 3GVAA 2A5YB 2R7DA 1XGOA 4A6EA 3IHUA 2P6SA 4Q48A 3V7RA 5JVTA 4I0AA 2IP2A 5ICGA 3P9KA 3EQLF 3DF8A 1EH6A 4PGHA 3QP5A 1OKRA 4YFXF 3F22A 3L00A 2WTEA 3F8MA 1KQ8A 3E5XA 3E6MA 3SHFA 1FYMA 3ZMVA 1WSUA 1XMAA 1TNTA 2HYGD 1CF7B 3HSRA 1KU7A 2IVMA 4R1HA 3N97A 3HSFA 3IWZA 2EJRA 4Y13A 1GVJA 3HHHA 1OYWA 3L09A 4QLCU 1FT9A 2OU2A 1XSDA 4UHTA 2O0YA 4P5OA 2ZBKA 3HOTA 1HKSA 1UB9A 1IAWA 5BPIA 3RJPA 4OINF 5CVUA 4GCVA 2MA3A 3DPLC 1S7AA 2ZXJA 3MZYA 3MZHA 2QQ9A 3AAFA 4CYDA 2WV0A 5L3GA 2VODA 3VFZA 2KIFA 3DV8A 4YFNF 2FBKA 3PQJA 4N9IA 3Q5FA 1CF7A 4B8XA 3QAHA 1U5TC 3JAMK 2XV4S 2D2WA 3GWZA 4A0XA 1ZG3A 4OMZA 1R1TA 2RDPA 4O5VA 3BP8A 3TO9A 4FT8A 1SD7A 3HRTA 3RI4A 2A6EF 1K78A 2VT3A 2JPBA 2CFXA 1XGSA 1YW9A 5J6XA 1OMIA 1B9NA 2GZWA 4WXCA 1KYWA 2HQRA 4B09A 4HYEA 2G7UA 2LNBA 1R1UA 4L9TA 2DTRA 2RKHA 4AD9A 1K6OA 3E5QA 1S8NA 3WTTC 3GF2A 4O6JA 4A5MA 3CUQC 2NNYA 1IN5A 1OYYA 3VB2A 1H9TA 2RGVA 2EV6A 4ETSA 4I98B 2PFBA 1W5TA 5FFZA 2W25A 2HFHA 5L3FA 4EJOA 1HSTA 4EJTA 4Q47A 3F6VA 4O3MA 4I0BA 4XLNF 2E7WA 2VOPA 3K69A 5LBQA 4L9VA 1QNTA 1I1GA 5HS7A 4IRGA 3I0TA 2P5VA 3WU1B 5AONA 2VBZA 2XHKA 4BH9A 4LFUA 1R00A 2DQRA 2RN7A 4CHUA 4HLXA 1IRFA 1YW8A 2Z3YA 2M87A 5E1WA 3I58A 3R0JA 1T98A 1ZLKA 4OIOF 3REOA 1QO0D 4G6QA 3BROA 4U7DA 1YG2A 5LGNA 5H6QA 4S04A 1FY7A 3FF5A 2TDXA 4FX0A 2H6BA 4S05A 3ZP5A 3FM5A 3KETA 3V7SA 1YTYA 1HBXG 2PEXA 2V1XA 3FMRA 1E17A 2P4WA 5FLXZ 2QUFA 1TQPA 3H92A 2UXXA 3WE3A 4HLYA 2DBBA 2EV5A 3I54A 2ZCWA 1ZRCA 2Y48A 2GXBA 2A3SA 2ETHA 1O7FA 3KZZA 5FFXA 3R61A 1SFXA 4WF2A 3GUDA 1S6LA 2XVCA 3QU6A 3GFMA 2QLZA 3B73A 2FNPA 3E6DA 2ZNYA 2EFOA 4MTEA 1MGTA 4M9XA 1WRJA 2KKOA 3T8RA 2QVOA 3V8JA 2F5FA 2YX4A 2IA2A 4LMYA 3WTYC 2XROA 2L3DA 4U0WA 3VOEA 5KK1A 3LA7A 2NNNA 4G8XA 1AWCA 3NRVA 3T8TA 4A0ZA 2LDUA 2DW4A 1BN5A 4LK1F 3J80Z 3RTRA 4GO1A 5DUKA 1KYZA 4A0YA 1YS6A 1ZGJA 3F8BA 2PN6A 1F5TA 3DQVC 5K1YA 4ESBA 1FOKA 1SMYF 2CWEA 5K5RA 4MGRA 1SMTA 3BWGA 2Q2EA 3HRSA 2XGXA 3I5UA 5DD4A 4Z2YA 2EFNA 5FGMA 3KP2A 1UHMA 4UXNA 3E6BA 3E5UA 5ILUA 1KU2A 1IF1A 2MLKA 1P6RA 4JQFA 4U88A 1HSJA 5E1XA 1XN7A 2FEZA 4A6DA 4WCGA 4ENJA 2DFIA 3CO7C 1RUOA 4I02A 2ACJA 1Z05A 1J75A 4IRIA 1IN4A 1IN7A 4A5NA 1WKMA 4IF4A 2YSRA 4AIHA 2JPCA 5DCMA 3LAPA 4IXAA 1R7JA 3C3WA 5LGUA 5BPDA 1FWZA 3J81Z 5FB2A 2R7FA 2YX7A 1R5HA 3F21A 2QM3A 4P9FA 2ZJ2A 2JTVA 3HOSA 4XRFA 2A68F 3FXRA 1GXQA 4I7HA 2KJCA 4ENKA 4M6YA 1OR7A 3FXQA 1IW7F 1SD4A 4NQWA 4HF0A 2GA2A 2FSWA 1I6XA 5CJ9A 2PMUA 1ZLJA 4EM1A 5D6FA 2IPQX 5ICCA 4I01A 4OIQF 1LNWA 4XSZF 4ESFA 1H9GA 1PP8F 1CGPA 1BI3A 2CYYA 3WTWC 2EV0A 1LVAA 3BJOA 1U3EM 2HTJA 2FQ3A 1TTYA 3EETA 5KVRA 1MDMA 4OIRF 3HSEA 2QQAA 3IKTA 4EM2A 4DNCA 2RQPA 4FX4A 3M9AA 5F6FA 1J59A 5DUIA 2QBYB 3KLOA 1PP7U 2COMA 3P7NA 4M73A 1IN8A 1LDKB 1QPMA 1W4MA 2ZMEB 1IXRC 4UVAA 1O3RA 5CVVA 5HLIA 1O3QA 2P5LC 1S29A 1OYIA 1ONVA 1ZARA 5E8GA 5IT9Z 2FA5A 4RAZA 1ODDA 3I59A 2Q8KA 2STWA 2F5CA 4G7ZF 3GYHX 3LQRA 1HW1A 2Q0OA 1W7PD 4P55A 1ZREA 4P9UA 1XSVA 1UFMA 5CYVA 4WX9A 4L5JA 4KT5C 4IHSA 2LSOA 3C18A 4BQAA 1JHHA 1BIBA 4WXHA 3QRFF 2EA4A 2EA2A 4UV8A 3QP6A 2FE3A 2STTA 4HQEA 4YIFA 2HYFA 3RKWA 3DKWA 2GXGA 5DDGA 2BE5F 1S7OA 3WGHA 4UNOA 1LJ9A 5D5WB 2AS5F 1ZGAA 1WWXA 4RB0A 1ZYRF 2K4BA 4EJUA 4ZYGA 1G3YA 2J5PA 3M8FA 3PFIA 4ENNA 1KU3A 2A6HF 4AWXB 3KP3A 2EFQA 2VXZA 1P92A 4M74A 1JHFA 1U5TA 1EV7A 2L01A 2YPRA 3CUQB 1K78B 1QZYA 4CZZA 2MH2A 2RVCA 1QGPA 5E20A 1YIOA 4GYIA 5H6RA 4RGXA 1BBYA 3C1DA 5ERIA 1XGMA 2VBYA 2EFPA 2GWRA 2ISZA 1FYLA 2CG4A 1PUEE 1W7PB 5ILVA 1U2WA 1YS7A 1BM9A 1TW3A 2ELHA 3W6JB 2LF8A 2XASA 1SFEA 4YG2F 1I27A 3E3VA 1HQCA 4ASNA 1YQAA 2X4HA 2Y0MA 1RIOH 5LRSA 1H0MA 2O61A 2CSOA 2VE8A 2CO5A 3KP7A 4KIGA 3JAMZ 1MKMA 1TQMA 1G3WA 4NHJA 1DUXC 4UUVA 3EYIA 4L9JA 1U78A 3F23A 3CUQA 1XCBA 5BMZA 2ZO4A 5FO5A 4EQQA 4ESJA 1FYKA 3GEZA 5FD5A 1FSHA 1AOYA 3U9GA 1LDJA 1MJAA 3VODA 1D3YA 3KCCA 2WWYA 5D4SA 2PG4A 3GO5A 4XSXF 1W7PA 2MC3A 1J7KA 2YU3A 5FD6A 5D4RA 1REPC 3QOPA 3TO6A 3COAC 1YYVA 2IJLA 3SZTA 2F2EA 1XGNA 4HOBA 2HGCA 4XLPF 3CTAA 2E7XA 3ZN1A 1R23A 3DPTA 3QPTA 1EH7A 1T39A 3CO6C 2KIMA 2D1HA 4CO8A 2H6CA 4WK8F 4HX7A 3TOAA 4ZYEA 1ULYA 4OU0A 3ECHA 3I71A 2VE9A 2JRTA 3ZMDA 1LEAA 1USSA 1DPRA 4L9NA 4KN4X 1RZ4A 1Z6RA 2GIVA 4HV5A 4CXFA 1HKTA 2O8XA 2IT0A 5A2QK 4BHPA 2JSCA 2A69F 5HLGA 1MJBA 5A2QZ 5CLSA 1SD5A 4GGGA 4MQ9F 3L2CA 2HKOA 3G3ZA 3J7AO 2P7VB 2VBWA 3M7GA 2H09A 2IA1A 1FZPB 4RS8A 2YR2A 1RUNA 4Q5SF 3ZMSA 1G3SA 3HYIA 2GA1A 4LG0A 1L0OC 3WU0A 4PDKA 4H0EA 4MEYF 4WWCA 2DQLA 3RYRA 1WQ2A 4WXDA 4IPAA 4HW0A 2HZTA 2VONA 2K7LA 2CGPA 1B6AA 4U0VA 2K27A 2DPDA 3GLXA 4NB5A 1S3JA 1P4AA 2KIUA 4I09A 4KIBA 4LGWA 2V1UA 2XAHA 2QZ8A 2D1VA 2FNAA 3GW2A 3P9CA 4MHGA 1Z9CA 3ROUA 1Q1HA 3LAJA 4Q4ZF 1B4AA 4UVBA 4BXUA 3KP5A 1FP1D 1ON2A 4UVCA 1D5VA 4EGYA 2UWMA 2DK8A 2O03A 2Y75A 3CUOA 4L0YB 1ZH5A 3EYYA 2UXNA 3FMQA 3D0SA 4TV7A 1V3FA 3Q9VA 2MH9A 1JXSA 3ERED 3MQ0A 3BJAA 1D8KA 4KIFA 2HDCA 3F8CA 3FMSA 5DCMB 3KE2A 3K0LA 4ENMA 3WGIA 1MZBA 2HQNA 3MWMA 3ZN0A 4HQMA 5J8FA 4YIIA 2Z9OA 2A61A 3GXOA 4HV6A 3RDIA 5JHUA 4Y15A 1UHWA 1FNNA 3OV8A 3L9FA 1E2XA 1ZAOA 1KGSA 3LFKA 2M45A 5BS6A 2KRFA 1U6GA 2DT5A 5HS9A 4I2OA 3BZ6A 3L7WA 4OOIA 2A07F 3CDHA 3KFWX 1J5YA 3ZQ7A 1A04A 2G9WA 2LF7A 4LK0F 1IUYA 3GFJA 1IXSB 2Z5UA 1MDMB 2V1DA 2H94A 1XB4A 5F64A 1KQ9A 3T5XA 3F6OA 4P96A 3RKXA 2IRFG 1FSEA 4RB3C 5L3CA 2W24A
chains in the Genus database with same CATH superfamily
2DDBA 3FXJA 3BCAA 4PSXA 3GX4X 2LD5A 1QBJA 5DCFA 1ETKA 3N05A 4R79A 2MFZA 2MLGA 1W5SA 2DCEA 4XOTA 2M5WA 3J7YJ 5IYBJ 1DDNA 2NAZA 2HXOA 3T0YA 1BC8C 2DPUA 4IQJA 4HF1A 3TDUC 1G8XA 1FP2A 1TQIA 1SVLA 2VASA 3MKLA 5F08A 4GDFA 3K1MA 1ITYA 5D5UB 3JTGA 5HDNA 3M1EA 2KMUA 4K2EA 4AVPA 2M7BA 2HOEA 2ZC2A 4PFOA 4XM3A 1JJ8C 2H27A 2R7UA 4ON0A 3I59B 2CV0A 1P2FA 1R5GA 3BG3A 4PJJA 2ECBA 1S5LC 4RB1A 4KMUX 4U0YA 4XKWA 5E1ZB 5KCMA 4M3EA 2R7WA 1GHCA 3WTZA 1A36A 4BQNA 2L7ZA 3NWTA 2R92J 3LWFA 3HOYJ 3WE2A 4KNYA 2AQFA 2X6XA 2HPMA 5HDGA 2KDOA 4CDGA 3OS2A 3CF2A 4V2FA 5LEKA 4KISA 4Y7NJ 2NOGA 1WJFA 4KFCA 1R4NB 3DBLB 2M8EA 4IKFA 3RQIA 3H3UA 1YRNA 2R5ZA 3ZXSA 2EIKH 2CV1A 5TRDA 2IEKA 3OIQA 4J19A 3W3CA 3IRRA 3K9TA 4BHCA 1BW5A 3TP0A 2XRNA 3QYEA 2PMHA 3NAUA 4IO9F 1JGSA 5LFAA 3VEPA 2X0LA 5HVQC 3A4CA 5DS9A 3RPUA 1P7JA 1BI1A 3OYEA 2DI3A 4BY7J 1ZG5A 3V8LA 4UUSA 3IUOA 3MAJA 2VN2A 2JZYA 4LLNA 2G0EA 2NVUB 2HOSA 2E1CA 3SZPA 2FOWA 1XS9A 4LLLA 4EJVA 3AG2H 4A3LJ 5B66C 2IBDA 3RKYA 2L4MA 4N9HA 1RPWA 2CUZA 1R9TJ 2CUEA 2Y69H 4CCJA 3ZQLA 1N77A 3HOVJ 3WTUC 3LSGA 2DK5A 3OYCA 4GRIA 3I9V2 1T0FC 2K4JA 3UNGC 3BTCA 4M9ZA 3ZRGA 2ELJA 3I64A 2Y9YA 1BI0A 1ZHFA 1XG1A 3S3NA 1YFHA 1VQ9I 4LB5A 3DFGA 2BHYA 1G59A 2O3FA 1DP7P 1R1VA 3KEOA 3EPZA 4NC6A 2E19A 2PJPA 2BEOA 3KP6A 2PI0A 2ISYA 3CCVI 2BV6A 3CP2A 5ICEA 2FJ1A 1SC7A 4G7OF 1X1CA 1PDNC 4LD5A 2EQRA 2P8TA 4RB2C 3PJRA 4OAZA 4M71A 2F5DA 3JSOA 1BL0A 5DV5A 5JR3A 5EG0B 5GP9A 5BQTA 4BJTA 2L02A 2DAOA 2PMZA 3WHCA 1RR8C 3DP7A 3M8EA 3CQZJ 1LDDA 1U5TB 2ZKZA 4M3BA 1NG6A 1BI2A 1NHAA 1BOAA 1XSXA 4A2UA 1FX7A 2R0QC 2BGCA 4BAYA 3AL0C 1FOYA 2HDWA 4YFKF 5FRNA 1USTA 4B3XA 2P5KA 3WG9A 2G7HA 2Q1ZB 3GZ5A 4D1QA 1FBUA 4F91B 4M9SA 3VWBA 1Y0UA 1F1ZA 2AQEA 2X9DA 1J9IA 3TP3A 2JMWA 1IXCA 1WFXA 3F8FA 2FRHA 2D5VA 1X58A 2OD5A 3RSNA 1FLIA 3WGGA 2QQBA 4KMFA 1RI7A 1I1SA 4ZYHA 4EMSA 3KYLA 3V8KA 2KJBA 3KYDB 2F4IA 2I5UA 2BVLA 3QODA 4LIUA 1W1WE 5EF6A 4CICA 2LG4A 1T2KA 2NVXJ 1RRJA 2LY2A 3R6SA 1O7LA 1KA8A 2W85A 4N0BA 2LRDA 1W36C 2ZMEC 2EBIA 5EG0A 2PLYA 2IGOA 2OV7A 1WCMJ 1P7IA 1RC9A 2XF5A 3CESA 2L54A 2O8KA 4PFPA 1STZA 2RNJA 5DD8A 3PQKA 1D8JA 1ETQA 4DGWB 3ABTA 2XUBA 1MH3A 3K1NA 4XQFA 1R49A 4JBAA 2L9NA 2WAQN 3CJRB 4D0PA 1TW2A 4FETA 4AIDA 3ZMZA 1FC3A 4BGDA 2JA7J 1FTTA 3CLQA 1XD7A 3FBIB 1R36A 5L3EA 3CJQB 1MBKA 5K5OA 2OC6A 3ZPLA 5JI6A 2OA4A 1HW2A 3VYTB 4UV9A 1R58A 2L9RA 1WH7A 5L3BA 3TW6A 2CH0A 2DLLA 1TT5B 2HQ5A 3U2RA 3O8GA 1HW5A 5D5XB 1VQ7I 2OZ6A 3K1PA 2OPTA 4RAGA 4XMYA 3U1DA 1Z67A 2KRCA 1FOWA 4FHTA 1BOBA 1P4XA 2OAZA 4DYRA 3HOXJ 4KA4A 1B9MA 3T1BA 2EWNA 4HPQA 4HX4A 4E4HA 2HI3A 2NS0A 4HZFA 3RZOJ 3ECOA 2DA3A 5LLQA 1MBGA 2GXAA 2D45A 4DZPA 1WI9A 1JE8A 1X2MA 3MKYB 2FOKA 3KZYA 3QOEA 1GVDA 3WTVC 3ULQB 4Y3OA 2VL8A 2Z99A 3AG1H 2E1MC 3DXJF 3G1LA 2NYXA 2MABA 2W84A 3G6EI 1ZGWA 1A5JA 4CUGA 2V7FA 3V7CA 4NUBA 1L3LA 4MFDA 1U0JA 3ZMUA 4AU7A 5F27A 1IGNA 4N4OB 3BY6A 2FBIA 4U7BA 2HU9A 5L3DA 3H3ZA 3L2WA 2DO7A 1XMXA 2HZDA 2CW7A 4PZJA 1ETVA 4PJ0C 4IZZA 1IV8A 3L2VA 2QQ8A 3LA2A 5EEHA 4CCMA 2E2JJ 1F4KA 1HKQA 4II2A 3CDLA 1BW6A 3ZQIA 5B5EC 3ELKA 1NK3P 2XGEA 2HQAA 1VQ5I 3D5LA 4BACA 1HOMA 4PCQA 2EK5A 4C2UA 3C2BA 1OPCA 2NRAC 4KYWA 2UZKA 1SEUA 4E7SA 4L0ZB 2OBPA 2XAJA 3OY9A 4L5IA 3TO7A 5FROA 1QHGA 2L4AA 4CCNA 4HDVA 3F8NA 2PBIA 4FASD 1DPUA 2P0WA 2R4GA 2QSHX 2LBFB 1ZK8A 5DTDA 3DKXA 1RKWA 1TC3C 2Y30A 1MBFA 2DMNA 3RPQA 4RGRA 2QENA 3BOQA 4MNUA 1MMAA 2ZNZA 3AFHA 3FDYA 3EUHA 3DBHB 1UELB 4M3GA 4KICA 3LA3A 4IVNA 1ZELA 4ZH4F 3VYUB 3SFZA 1Z91A 2RREA 5BOXA 2J5OA 4BHBA 4Y52J 1JUSA 4Y33A 3OOPA 4HA8A 4M6VA 2VUMJ 4XKVA 2Z33A 4EM0B 4E7KA 4KITB 4LG0B 3ZCOA 4PSWA 2E2IJ 3NARA 4QSHA 2R7OA 5D8LB 4E7IA 4EJWA 1YITI 1MNEA 3RIRA 1T33A 3LSTA 5EYRA 4EVIA 5AIQA 5IP6A 1HA8A 1Z0XA 5M5YJ 4L18B 5HDKA 1ETWA 3O6BB 2O5RA 1YHQI 5DEQA 3QPSA 4XKBA 1GXPA 1YW7A 2DMTA 4W97A 3S2HJ 2I10A 1Z3YA 3FZVA 3IKVA 1APLC 2FMYA 3S15J 3IRQA 3CJTB 2V79A 3HC7A 4HAMA 4D7MA 4E70A 5K7HA 2WY7Q 3VSKA 3LSPA 3PFYA 4HX8A 3JSPA 5D6EA 2P7CB 4J00A 2E1NA 2IA0A 3BG9A 1IRZA 4LB6B 1I39A 4QWQA 1W0UA 4IHTA 1ZRDA 2LBFA 4HNUA 2HEOA 1X3UA 3LSHA 2XKPA 2XAQA 5J8CA 1HXDA 3WTSC 1MH4A 5ILSA 1G6NA 3NQOA 4J01A 2LH9A 2ID3A 3HGGA 1TNSA 3ZQQA 3FXUA 3GTLJ 1H88C 2XF6A 2GBYA 2BY3A 2VBXA 2IAIA 3JW4A 2WAQA 4C30A 4RBOA 2O6GE 3K2ZA 1IO2A 1TT0A 2CW0F 1T6SA 3S2WA 1P9QC 1IN6A 2BYVE 4P1WA 1G4DA 2AXLA 1A6IA 1FTZA 1SD6A 1B72B 1C0WA 2CQNA 5AIPA 1IZ1A 1UG0A 3F3XA 4C2TA 1T95A 4A3BJ 1Z1DA 2GIZA 2EB7A 3OS1A 4BYYA 4BJ5C 3W6KB 1I5ZA 3HBLA 4HEA2 2RAEA 4G6DA 4A12A 1LQ1A 2OQGA 2XAFA 1K79A 2F6CA 2HNHA 3OYMA 3BJ6A 3L2RA 3K4LA 4F7ZA 2QA4I 5FLXK 5F0FA 2BHZA 3HKZN 1JKOC 3ZMTA 4IHVA 4OMYA 3E6CC 1B59A 4E7JA 3G73A 3EDPA 2OCEA 6PAXA 1YO5C 5C3EJ 3R4KA 1F9NA 3F72A 5H20A 3ABKH 5K7ZA 2HVQA 5EGOB 1JT0A 1TWFJ 2KLOA 5CQGA 2WC2A 2Y0SN 1A6QA 2ZJQF 4KDPA 1R4MB 1DQUA 2E35A 5CKTA 2C6YA 5E18F 5J4VA 2X1EA 2KT0A 3OR1C 3GFIA 1Z7UA 2GAUA 1XTAA 4G7HF 2R7QA 3LSIA 3FK6A 3IL2A 3KP4A 3PSFA 3ERMA 3CCJI 3WODF 2K9MA 4EGZA 3BDDA 4B43A 3I53A 1MNMC 2MBFA 1WJEA 5F1RA 1ZG1A 2CW8A 3HIFA 4CYCA 2M2EA 1Y1VJ 3BR0A 3BT9A 2L7KA 2CU7A 4HF2A 3ZQFA 3IAS2 4MQVA 2VC1A 3MZ8A 4LJZF 2PQ8A 1QQIA 1O3SA 3K70C 2V6CA 3TDZC 4MEXF 4BNCA 2IS2A 4CCOA 2X6OA 4ITVA 4GXOA 3JRCA 2DA7A 5IYCJ 3OYNA 4AIKA 1ERDA 4G9YA 1QZZA 1MJ9A 1QRYA 2FMLA 3ABUA 4PGGA 2RV8A 3J80K 2EZKA 3OYLA 2CJJA 1XDSA 3B6AA 3CP8A 5LHGA 4RGUA 2IS6A 1SAXA 1P4WA 3ZOBA 1KU9A 3H9GA 4OIPF 3WTXC 1OCTC 2EIJH 3OYHA 4XRSA 2OUMA 2HKXA 5CVJA 3PNVA 2FBHA 3E97A 3OYDA 3HRMA 3NEUA 1K7AA 4EATA 2BBYA 4ZJZA 4BEHB 2KL4A 3RQ4A 3ESWB 4AIJA 1X1PA 3SJMA 3JRIA 3CLOA 1XDUA 3ML6A 1AU7A 3K4MA 2EFWA 2TCTA 1OISA 1QZEA 5EEAA 3PNYA 1TZLA 4G94A 3SQNA 4DYQA 2HWVA 4LLGF 1U9NA 3KEQA 5HLHA 1ZN2A 3JTHA 5JVGF 1E3PA 5LRRA 2EZIA 2HTSA 2JQ7A 2LOOA 1X19A 2CMPA 4IJAA 3TKYA 2ESHA 3O3KA 3VPRA 1GLNA 2DA1A 1EH8A 1AKHA 3IC7A 1ZTRA 1YX5A 3H0GJ 4R8HA 1BR4A 5DYMA 1I3QJ 3R0AA 4F3QA 4JX5A 1B8IA 3LQQA 2DFEA 2LREA 1D0XA 4EEFG 3CJNA 1H8AC 1X3ZB 1K4SA 2IGKA 2PMZN 4B48A 3MCZA 1YOVB 1BR2A 2VB6A 1B8IB 1J2XA 5E17F 3QPHA 3OSGA 1JI8A 2JA8J 5H2FC 2F5EA 2ELKA 2GQQA 5F0HA 5KHDA 2XKOA 2DJNA 2ZFWA 2XAGA 5K5QA 1BIAA 4GYGA 3WU2C 1S9HA 1Z7LA 3GLLA 1W36D 1RNLA 3J81K 3RZDJ 1OCPA 2F48A 3IH2A 2P6TA 2PJRB 1V4RA 5CVIA 4LIVA 2JT1A 1MBHA 3RCOA 5LEJA 2WV1A 5F1JA 1IC8A 3IH4A 1IUFA 2CUFA 5J3LA 4HSTA 2KDZA 3HUGB 2XIGA 4II3A 2QWWA 5FLMJ 2HOTA 4B3AA 1VQKI 1FMVA 2ID6A 3B02A 3QU3A 1Z6TA 2IGMA 3JRHA 1ON1A 5KAFC 2M34A 3RYPA 2E2HJ 3HKZA 2HR3A 2IW5A 3P9IA 3DTIA 1V54H 3FISA 3HTSB 3TGNA 4B1RA 2LKPA 2B7EA 3HTUA 3CCYA 3MFKA 2Y0SA 2MYSA 4MIMA 4UUSB 4CGZA 1M1EB 2K02A 2DTZA 4IL6C 5J47A 3CC2I 2I8DA 1SFUA 2MW8A 3C7JA 3HRUA 4XNFA 3TBIA 3V4GA 2ZJRF 3A01B 1R22A 4KUMA 3F0CA 4PJLA 4IOCF 1MD0A 4IQ4A 5HS8A 3O2PE 2FF4A 1T38A 4ZZDA 2R7SA 4XK4A 3S17J 1UCRA 2DOEA 2OZUA 4ZYDA 2V9VA 3BTIA 4HSRA 1IRGA 3TOBA 2OQRA 3BPXA 4HBLA 4IHXA 1LVKA 2Z1DA 2QYOA 2VT2A 3N4MA 1TLHB 2BY0A 3PSIA 4ZDOA 3CC7I 2PJRA 2DMUA 2LK2A 2MD5A 3MEXA 3FIWA 3FM3A 1OR7C 1O3TA 3KPHA 5ED4A 3IWFA 3HOZJ 3TQNA 2M1BA 2UV1A 5LHHA 3HUGA 2RC4A 5D8KB 3HHGA 2DU9A 4MTDA 4HDUA 4EV0A 2R3SA 4KN7X 4ZZLA 1ETXA 4JOMA 1QU3A 3HJEA 2VJ4A 2XF7A 3BPVA 4XBFA 1T0FA 3SXYA 4XOPA 1FBQA 5GAHJ 2CQKA 1X1BA 3KLNA 3P5JA 3Q0UA 3R60A 1UG2A 2K3PA 1KQ0A 2VC0A 1S7EA 2PX9A 3MKZA 1G3TA 3H9JA 5E3OA 4IRHA 4KJZA 1TBXA 3DBRB 2E5ZA 1Q1VA 1YLFA 2ESNA 3GZ6A 3X2QH 4E6KG 1WZ2A 1U8RA 1LEBA 3A01A 1XCVA 1Y39A 1VTNC 2K86A 4FTHA 2F4MB 4CCKA 3GFLA 1O57A 4RAYA 4B44A 3GTQJ 1BA5A 3SFIA 5CVRA 2VOOA 5IT9K 1ZRFA 5TJJA 2OJED 5LGTA 2CFOA 1LUJB 4F93B 2NOJB 4RGSA 1RR7A 1X4PA 4AVZA 3FWEA 2CV2A 1F36A 4FE4A 1BJAA 1TL8A 2E1OA 5ICFA 2XGCA 3ABLH 1FBSA 3ISPA 4DQ2A 5IT3A 3DEUA 1ZR2A 2ICWG 4Y17A 4PK4A 4UB8C 4M6XA 1XMKA 3CF5F 2MSYA 1N25A 1BC7C 1B1BA 3MVPA 1GDTA 2ZSHB 1EJ9A 1HDDC 2W1OA 5IP9J 1EKEA 3FHZA 3FX3A 3Q9SA 1FOXA 2M30A 2W82A 5LHIA 4GFBA 2FXAA 4M72A 2B0LA 1ZKGA 2FU4A 1J0RA 2ADUA 5E8IA 3I4PA 1LB2A 2JUGA 2K3FA 2QBYA 4DBQA 3H5NA 5EEGA 1FPQA 2HS5A 3K10A 3LSJA 3WHBA 2WADA 3HOWJ 2W57A 5JFRA 2E60A 4Z6YA 4JK1X 5HOOA 1VI0A 1E3HA 3BR5A 5D5VB 2ZMEA 3GVAA 2A5YB 3M8JA 2R7DA 1RKTA 1XGOA 2JSPA 4A6EA 3IHUA 2L2OA 1ORKA 2WB1A 2XGDA 4LOCA 2P6SA 4Q48A 3V7RA 5JVTA 4I0AA 2IP2A 5ICGA 1JGGA 3P9KA 3EQLF 4BBRJ 4A3CJ 3KZIC 3DF8A 2VKVA 2VPRA 4F52A 2W7NA 1EH6A 2GOXB 4PGHA 2QKLB 4X1EA 3QP5A 1OKRA 4YFXF 2KPMA 2FUG2 2K5CA 5J1YA 3L00A 3F22A 1VQMI 2WTEA 3F8MA 1KQ8A 3E5XA 2W00A 2R7TA 3E6MA 3SHFA 2DA5A 1FYMA 3M4OJ 3ZMVA 1WSUA 1XMAA 1TNTA 3D1NI 3M07A 3OMYA 2HYGD 3GZNB 1CF7B 3JREA 3HSRA 1KU7A 2IVMA 3LFUA 4R1HA 5FKOA 2KP6A 3N97A 3HSFA 3IWZA 3K4BA 2EJRA 4Y13A 3CMAI 1EF4A 4AUXA 2ECCA 1GVJA 3HHHA 1OYWA 3L09A 2GLOA 2Y2ZA 3K6GA 4QLCU 1XC5A 1OFCX 2X1CA 1FT9A 2OU2A 1GV5A 2ZSIB 4UHTA 5FKLA 2O0YA 5GTHC 1XSDA 4P5OA 2ZBKA 3HOTA 2R7ZJ 5GPAA 1HKSA 1POGA 1UB9A 4F92B 1LFUP 1IAWA 5BPIA 2JVGA 3RJPA 1BR1A 2F4OB 4IX7A 4OINF 3DU6A 4FQGA 5CVUA 4GCVA 2HVSA 2MA3A 2QSFX 1MBEA 1AHDP 3K4JA 2BY1A 3DPLC 1A31A 4BKXA 1S7AA 2ZXJA 3MZYA 5E79C 3MZHA 3HGYA 2QQ9A 3AAFA 4CYDA 1T8IA 2A5WA 2WV0A 3IV5A 2QSGX 4BL0B 5L3GA 2YU9J 3VFZA 2VODA 2KIFA 3DV8A 4S0HB 2FBKA 4YFNF 3K70D 4A3JJ 3PQJA 3MN2A 4N9IA 3FK7A 3FXKA 3Q5FA 1CF7A 1LKXA 1HLVA 3DLAA 4B8XA 3I4NJ 3QAHA 1U5TC 3CMMA 2JRMA 4NC7A 3JAMK 3LNQA 2XV4S 1E3OC 3OOUA 2D2WA 1HCRA 3GWZA 4A0XA 5EZHA 4A3DJ 1ZG3A 1PUFA 1N78A 2ZFUA 1N75A 4OMZA 1R1TA 2RDPA 4I99C 4O5VA 3TEDA 1HC8A 1QVTA 3HOUJ 1JT6A 5FKKA 1TP4A 2R93J 3BP8A 3TO9A 4FT8A 3VDXA 3BQZA 4QTRA 3BG5A 1SD7A 3HRTA 3RI4A 1WGXA 1Y8RB 2A6EF 1K78A 2VT3A 2JPBA 2WBMA 2CFXA 2YUSA 5GAEJ 1XGSA 1YW9A 1E0EA 5J6XA 1OMIA 4FE7A 4CA0A 5FJ8J 2OF7A 2X6YA 4XLAA 1B9NA 2XPVA 2GZWA 2IXSA 4WXCA 1KYWA 3K7AJ 3MMYB 2OTLI 2HQRA 4B09A 4HYEA 2G7UA 1O4XA 2LNBA 1R1UA 1R5ID 4L9TA 5FKMA 2DTRA 2RKHA 3KX2A 4AD9A 1K6OA 4NBQA 3E5QA 1S8NA 3S1RJ 3WTTC 2X85A 3GF2A 2VLAA 1VQPI 4O6JA 4LITA 2M0CA 4A5MA 3KEYA 5M5WJ 2YS9A 3CUQC 2NNYA 1IN5A 1OYYA 4G12A 3VB2A 1H9TA 2RGVA 4DBRA 2EV6A 4ETSA 2NVYJ 4I98B 2PFBA 1W5TA 5FFZA 2W25A 4X0GA 4V2GA 3OR2C 3H5AA 1IV6A 2HFHA 5L3FA 4EJOA 1HSTA 2L7FP 2DA4A 4EJTA 4XL9A 1U9OA 1Z3XA 3ASOH 3F6VA 4Q47A 4O3MA 1R6RA 4I0BA 1WH5A 2M4GA 4XLNF 1OLTA 2E7WA 3ZQHA 4BUPA 4E7LA 3K69A 2VOPA 5LBQA 2DN0A 3PNTA 4L9VA 1VZ0A 3HB9A 2Z16A 1T56A 1QNTA 2LR8A 3BQYA 3TMOA 4L5EA 1I1GA 1WJAA 5HS7A 1WHUA 4IRGA 5IOYA 3I0TA 5IPAA 1TWHJ 2P5VA 3FXLA 2NS7A 5M5XJ 4C9YA 3WU1B 2JVHA 2M8GX 4JX6A 5AONA 2VBZA 1VQ8I 2XHKA 4BH9A 1WI3A 3LSRA 4LFUA 1SANA 3UKGA 1R00A 3DWLE 2DQRA 2OCCH 2RN7A 4CHUA 1WPKA 4HLXA 2M3AA 1IRFA 1YW8A 2Z3YA 2M87A 4NDLA 5E1WA 3FHNA 4CYCB 3I58A 2QCOA 3R0JA 4N4NB 3CD6I 1T98A 2KQRA 1ZLKA 4OIOF 3REOA 1FJLA 1QO0D 2X51A 4G6QA 1D5YA 2VQLA 3BROA 3NWSA 4U7DA 1YG2A 3DEEA 5LGNA 2DDAA 3MD2A 5H6QA 5B1BH 4S04A 1V5FA 1FY7A 3FF5A 2TDXA 4FX0A 2XAUA 2H6BA 4S05A 3A0HC 3ZP5A 3FM5A 1R71A 3DLLF 3KETA 3V7SA 2VKDA 2HDDA 1YTYA 1HBXG 3H5RA 3I4MJ 4XRSG 2DMQA 2PEXA 1GT0C 2LMDA 2V1XA 3FMRA 1E17A 1QA6A 1VQNI 2P4WA 5FLXZ 3PL8A 2QUFA 1VQLI 1VQ6I 1TQPA 3H92A 2UXXA 3WE3A 4C3IJ 3VYRB 4A93J 2LTPA 1UHSA 3J7ZI 4HLYA 5J4YA 2DBBA 2EV5A 1I50J 3I54A 2ZCWA 1ZRCA 2Y48A 2GXBA 2L7MP 2LC2A 3B6CA 4D9JA 2A3SA 2ETHA 1O7FA 3DKYA 1YI2I 3KZZA 2JA6J 2DT6A 1K6YA 4BQOA 3HZJA 2BW3A 5FFXA 3R61A 2IS1A 1SFXA 2L5QA 2L9VA 3OL4A 3GUDA 4WF2A 4XICA 4XLHA 5JHFA 3G1OA 5LD2C 3S1QJ 1S6LA 1ENHA 3QQAA 2XVCA 3W2WA 4RM3A 3G1MA 3QU6A 3GFMA 4C3JJ 2QLZA 3B73A 5F0CA 1X4OA 2FNPA 2ZNYA 3E6DA 4CZCA 1AKHB 2EFOA 3U1KA 4RLFA 3PO3J 4MTEA 1MGTA 4M9XA 1WRJA 1VFCA 2KKOA 3T8RA 3GCMA 2QVOA 1IRXA 2F5FA 2YX4A 4XKCA 2IA2A 4LMYA 4QPOA 3V8JA 3FXOA 2CQXA 4AYBN 2KIQA 2L3DA 3WTYC 3I56I 1ZR4A 1ACIA 4U0WA 3LOCA 1PVEA 3VOEA 2BXYA 5KK1A 5TISC 2MD0A 1Y56A 1S72I 3LA7A 1DGRM 2NNNA 4BE0A 2HOAA 4G8XA 1AWCA 3NRVA 3T8TA 1FEXA 2BXZA 4A0ZA 2LDUA 2DW4A 1BN5A 1QHHD 4LK1F 3J80Z 2H1KA 2HPIA 3FXMA 3GTOJ 2DODA 4GO1A 5DUKA 3RTRA 1KYZA 3BLYA 4A0YA 1YS6A 1ZGJA 2RQQA 2K9LA 3F8BA 2PN6A 2E36A 4A3EJ 4XIDA 1F5TA 3DQVC 5K1YA 3JCUC 4ESBA 5B3SH 3CC4I 1FOKA 2NVTJ 3E0JB 2LKSA 1NG7A 2RNGA 1X3WB 4XRMA 1UMQA 3ZGKA 3BR2A 1SMYF 2CWEA 2X6WA 4QIWN 5K5RA 1W0TA 4MGRA 1SMTA 3BWGA 2Q2EA 3HRSA 2XGXA 3I5UA 2Y31A 5DD4A 3K4NA 4Z2YA 2EPFA 2WAEA 2EFNA 4M3DA 4XLFA 2W48A 3C2GA 2GOMA 4C3HJ 5K7FA 5FGMA 1VNDA 4A3MJ 3KP2A 1DU0A 5IOZA 1UHMA 4UXNA 2O9LA 4IHWA 3D5RC 3E6BA 3E5UA 5ILUA 1KU2A 1Z21A 1IF1A 2BOLA 2DYSH 4ZDLA 1LFBA 2MLKA 1P6RA 4JQFA 1OCOH 4U88A 1WJDA 3SDGA 1HSJA 5E1XA 1XN7A 2FEZA 3AKZA 4A6DA 4A3IJ 3JRFA 4WCGA 4ENJA 1MSFC 2EZHA 2DFIA 1OQYA 3CO7C 1K61A 1RUOA 3BCBA 4I02A 5HNFA 1OCCH 1Z05A 4DIQA 2ZXIA 2ACJA 1J75A 4IRIA 3BR1A 3CDIA 4D5CA 1IN4A 1MMNA 5HNHA 1IN7A 4A5NA 5KNLA 1WKMA 4IF4A 3G71I 1YX3A 2YSRA 4AIHA 2JPCA 1Y6IA 4B47A 1RETA 5DCMA 3PUBA 3LAPA 2WB1N 3CMEI 4IXAA 1R7JA 3C3WA 5LGUA 1Y1WJ 5BPDA 1FWZA 1OCRH 3J81Z 5FB2A 3K2AA 4XLCA 1HF0A 2K9NA 2R7FA 2M0MA 2KZVA 2YX7A 1D0YA 1IDYA 1R5HA 2E5NA 4MFEA 2QM3A 1X2NA 3S93A 3F21A 1EA3A 4P9FA 3RKQA 2ZJ2A 2ZXWH 3HPHA 2JTVA 1JKPC 2M9HA 3HOSA 2E71A 2KHMA 4DOZA 4XRFA 2A68F 3BG6A 3FXRA 2KISA 1GXQA 4RDUA 1DP3A 4I7HA 2KJCA 4YEJA 9ANTA 4ENKA 4M6YA 1OR7A 4V19K 3FXQA 1IW7F 2DFHA 3JR9A 1SD4A 2V6EA 3L1PA 1KZHA 3DTKA 4NQWA 2K40A 4ZC3A 4HF0A 2GA2A 2FSWA 4BE2A 1I6XA 5CJ9A 2PMUA 1ZLJA 4EM1A 4BY1J 5D6FA 2IPQX 5ICCA 4I01A 5C4JJ 4OIQF 1LNWA 4XSZF 3LMMA 2FQ4A 3Q3SA 4I6ZA 4RM2A 4ESFA 2JA5J 1JUMA 2XSJC 5E3LA 1H9GA 4W1UA 1PP8F 1CGPA 3KIOA 1BI3A 4XLEA 3AL0B 1UZCA 2CYYA 3FBNB 3WTWC 4UB6C 3JRDA 2LP0A 2OTJI 2EV0A 1LVAA 3OYJA 3BJOA 1U3EM 3A2KA 2HTJA 3QWLA 4HG2A 3JRBA 3GTPJ 2FQ3A 3DCFA 4CSWA 5J40A 4JX4A 1TTYA 3EETA 5KVRA 1MDMA 4OIRF 3HSEA 2QQAA 2R7XA 1D1CA 5GTIC 2VQCA 3IKTA 4FCYA 3HEFA 5EZGA 2VJJA 3AG3H 3LSMA 4AYBA 4EM2A 4YELA 4DNCA 2K9QA 1H89C 2RQPA 5GAGJ 4FX4A 3M9AA 5F6FA 1J59A 3H9QA 5DUIA 2EILH 1IJWC 4Y4RA 3H3VK 2QBYB 3KLOA 2VIXA 2DFFA 4ZYAA 1PP7U 2R5YB 3S14J 2COMA 3P7NA 4M73A 4KT6A 2TRTA 2EIMH 3S8PA 3W6VA 1IN8A 1NH3A 1LDKB 1QPMA 1W4MA 2ZMEB 1IXRC 2DOFA 3E7LA 4UVAA 3IH3A 1O3RA 5CVVA 5HLIA 1O3QA 4BXXJ 2P5LC 4U87A 1OCZH 1S29A 3QYFA 2E34A 1T08B 2JJ7A 1OYIA 4OAYA 3ASNH 1YJWI 4XN3A 2H8RA 1ONVA 2QF7A 2DXIA 3PIPF 1ZARA 4PJNA 5E8GA 1IDZA 3S3OA 1KONA 3A0BC 5IT9Z 2FA5A 2LY9A 4RAZA 2WAFA 3G4SI 1TWCJ 1ODDA 3I59A 2EINH 3H1CA 2Q8KA 2STWA 2F5CA 3C2HA 4BQQA 5GADJ 2LLKA 4G7ZF 3GYHX 3LQRA 2XRLA 4F55A 1HW1A 4XN0A 2Q0OA 3L2QA 5GPCA 1W7PD 2H8WA 3GBGA 2ME0A 4P55A 1JJ6C 4RLQA 1ZREA 4P9UA 1ZQ3P 1MBJA 1XSVA 1UFMA 5CYVA 5DM7F 2EZLA 5TGTA 4WX9A 2E1MB 2R5YA 4L5JA 2MG4A 3S32A 3A03A 2BY2A 4H4KC 4KT5C 3PO2J 3TL4X 1QVUA 4IHSA 4A3FJ 2LSOA 1I6HJ 4E7ZA 4X6AJ 3CCMI 3C18A 4BQAA 4D5FA 1OJLA 1JHHA 1BIBA 2HVRA 4WXHA 1SVMA 3QRFF 2EA4A 2EA2A 3U21A 3Q0VA 4UV8A 3QP6A 1MMSA 2FE3A 3OYBA 2V4JC 4HQEA 2LKXA 2STTA 4YIFA 5FRMA 2HYFA 3BG7A 3RKWA 4JP0A 3DKWA 2GXGA 2MGQA 4CH7A 5DDGA 2AXTC 2BE5F 2UUZA 4CCLA 1S7OA 2EH3A 2HYJA 3WGHA 4UNOA 2QGUA 2IS4A 4ANJA 1LJ9A 5D5WB 2AS5F 3S2DJ 4DW6A 1ZGAA 1WWXA 3DEWA 4RB0A 4RMNA 3O8HA 1MSEC 1ZYRF 2K4BA 3VYSB 1WVRA 2JA2A 5J1RA 1NK2P 5J1UA 1WJ5A 4EJUA 2Y9ZA 1VQ4I 3KYCB 2A05A 1A35A 1AA7A 4ZYGA 1G3YA 2J5PA 3M8FA 2W4SA 3PFIA 1PUFB 3CZ6A 1ETOA 4ENNA 3VSLA 1KU3A 2A6HF 4AC0A 4AWXB 3OYKA 3OIOA 4LG3A 3KP3A 2EFQA 2AHQA 2VXZA 4RA2A 1P92A 4UY8I 4M74A 3LL7A 4MLOA 1LFPA 1JHFA 1U5TA 1EV7A 2L01A 3WG7H 2YPRA 3IAM2 3CUQB 2O7OA 1K78B 1QZYA 4CZZA 1MMGA 2VPLA 2MH2A 3CMYA 2RVCA 4M3FA 5JLWA 3SDBA 1QGPA 5E20A 4YIRX 3GTGJ 4B4CA 1VQOI 2V9PA 1YIOA 4GYIA 2NS8A 3S1NJ 5H6RA 4RGXA 1LE8B 1BBYA 3C1DA 5ERIA 1XGMA 3BZCA 1RESA 2VBYA 1MW7A 3HPGA 3PUFA 2EFPA 2GWRA 2ZXHA 2ISZA 3OL3A 4DJAA 1FYLA 2CG4A 1PUEE 1FIPA 1W7PB 3K4KA 1Z77A 4NNJA 5JLXA 5ILVA 1U2WA 1YS7A 2VQHA 1JTYA 1BM9A 1TW3A 4RAFA 2VJIA 2ELHA 3CCUI 2A6TA 3W6JB 2LF8A 2XASA 1SFEA 4YG2F 3OYAA 1I27A 3E3VA 1HQCA 4ASNA 1YQAA 2X4HA 3OYGA 2Y0MA 4DYCA 5HODA 1K83J 2R7RA 1RIOH 5LRSA 4ZTJA 1H0MA 4BDYA 2O61A 2CSOA 2VE8A 2CO5A 3KP7A 5CQEA 4HNTA 2XC7A 4KIGA 3JAMZ 1MKMA 1G3WA 1TQMA 4XONA 4XR6A 2KRHA 4NHJA 3BTJA 1DUXC 2L0KA 1DGWY 5C44J 4L9JA 3EYIA 2X48A 5E3MA 4UUVA 1CQTA 1U78A 2LY1A 3UR3C 1UAAA 2FD5A 2VJ5A 4IHYA 3F23A 3CUQA 5M3FJ 1XCBA 5BMZA 1V5EA 2ZO4A 5EJCA 5FO5A 3HDDA 4EQQA 4ESJA 1FYKA 3GEZA 5FD5A 1FSHA 2VI6A 1AOYA 3U9GA 1LDJA 1MJAA 2CS3A 3I55I 1LE8A 3VODA 1D3YA 3KCCA 3ONQA 2WWYA 2KZGA 5D4SA 2PG4A 3HM5A 3GO5A 4XSXF 5CPRB 1W7PA 2MC3A 3OYIA 1J7KA 2YU3A 5FD6A 5D4RA 1MNDA 1REPC 3QOPA 3TO6A 3COAC 1YYVA 2IJLA 2LVSA 3SZTA 3CCRI 2F2EA 1WJCA 1XGNA 3D5SC 4HOBA 2HGCA 4XLPF 3J7AY 3CTAA 3CCLI 2DA2A 1XX5A 2E7XA 2XDVA 5FLVA 1HDPA 1V55H 1R23A 3ZN1A 3DPTA 3QPTA 1EH7A 1T39A 3CO6C 2JK3A 3DPUA 2KIMA 1LPQA 2D1HA 2V9KA 4CO8A 2CRGA 1YJ9I 2H6CA 4WK8F 2QEXI 4PUSA 1UJ8A 2XB0X 4HX7A 3TOAA 3V42A 4ZYEA 1SFOJ 2R7VA 1ULYA 3LSKA 4OU0A 3BR6A 3G2BA 3EUAA 1I3AA 3ECHA 3I71A 4BS9A 2VE9A 4DZJA 1JKRC 5DM6F 3M1CA 2JRTA 3ZMDA 5IY5H 1LEAA 1USSA 1DPRA 4L9NA 2JUCA 2NXNB 4KN4X 1RZ4A 2N8GA 1DU6A 1JUPA 1Z6RA 3ZQCA 2GIVA 1V5GA 4HV5A 4CXFA 3GMEA 1HKTA 3OS0A 2O8XA 2DOAA 3A02A 3GTJJ 2IT0A 2DYRH 3EUHC 5A2QK 1Y8QB 4BHPA 1JKQC 1QPIA 2JSCA 1MMDA 2A69F 1SVOA 4UUTA 4ZDPA 5HLGA 3W2AA 1J09A 3A1YA 3SYTA 4A3GJ 2KFDA 2VKHA 2NVQJ 3EUKL 4BJ6C 1MJBA 4I76A 5A2QZ 2JWTA 1SD5A 3BR3A 4GGGA 5CLSA 4MQ9F 1PYVA 2HKOA 3SEZA 3G3ZA 2V1NA 3L2CA 2P7VB 3J7AO 1XPXA 2BW3B 2B63J 1YJNI 2VBWA 3M7GA 1W5CC 2H09A 2ZJPF 2CUJA 2IA1A 1FZPB 4RS8A 2ME6A 2YR2A 1D1AA 4NC8A 1RUNA 1IG7A 5M3MJ 2WA0A 4Q5SF 3ZR8X 1Y0NA 3ZMSA 3F9KA 2DT7B 3DU5A 1D1BA 1G3SA 5BNGA 3HYIA 1TWGJ 2GA1A 3QPLA 4LG0A 3JRGA 3IP4B 1L0OC 3WU0A 4HNVA 3HG9A 3I3LA 4PDKA 4H0EA 5B1AH 5EDNA 4MEYF 4WWCA 2LYCA 2DQLA 2X1DA 2VXDA 1WQ2A 3RYRA 4WXDA 4IPAA 2JN6A 4HW0A 2HZTA 2VONA 2K7LA 4BE1A 2CGPA 3S1MJ 1B6AA 4U0VA 1GV2A 2K27A 4A3KJ 2DPDA 3BZKA 4AM3A 5C4XJ 3H35A 3GLXA 3FKIJ 4NB5A 2F5VA 2H1LA 2WY8Q 1S3JA 1P4AA 1BJZA 2KIUA 4I09A 4KIBA 4LGWA 3CCSI 3OSFA 2V1UA 2XAHA 2QZ8A 2D1VA 2FNAA 3QYBA 2DJIA 4D7NA 1TWAJ 2AO9A 3GW2A 1ETYA 3P9CA 3SZGA 4XORA 3PIOF 3S3MA 4MHGA 3OIPA 4BDZA 1Z9CA 3K4CA 3ROUA 1SAUA 5IP7J 2COBA 1MIJA 2HXIA 3GTKJ 3M3YJ 1Q1HA 3OWTA 3LAJA 4Q4ZF 4BU2A 3CCEI 2Q2EB 2XPUA 1B4AA 2DMPA 4UVBA 1GUUA 2XB5A 5FKNA 4BXUA 5KAIC 2QKMB 3KP5A 2M7AA 4QPQA 4IOAF 2CQQA 1FP1D 1ON2A 4UVCA 1K4TA 1D5VA 4EGYA 2UWMA 2DK8A 2CQ7A 2O03A 2Y75A 4OWRB 3CUOA 4L0YB 3PM1A 1ZH5A 3EYYA 4JYKA 3BC8A 2UXNA 4MO7A 1B72A 3E1SA 3FMQA 3D0SA 1WJBA 4TV7A 1V3FA 3OYFA 3Q9VA 2MH9A 1JXSA 2VKEA 4YRVA 2B9SA 3GTMJ 4BXFA 3SEQA 4A69C 3ERED 3MQ0A 3BJAA 3HXLA 1D8KA 4KIFA 2HDCA 1X1AA 3F8CA 3FMSA 5DCMB 3KE2A 3K0LA 4ENMA 5F04A 3RPUD 3WGIA 1MZBA 1NTCA 2HQNA 3MWMA 1G2HA 4G6TB 5EGOA 3ZN0A 4HQMA 5J8FA 4YIIA 2Z9OA 1VF9A 2A61A 3H36A 3GXOA 4HV6A 3RDIA 3CCQI 5JHUA 3TW7A 4Y15A 1UHWA 5E3NA 1FNNA 2ZB9A 3OV8A 3L9FA 1E2XA 3JRAA 1ZAOA 2Z2SB 1KGSA 3LFKA 1F43A 2M45A 4NQWB 1JTXA 5BS6A 4C2MJ 2KRFA 3BTLA 1FMWA 1U6GA 2BZTA 2VQGA 2DT5A 5HS9A 3S16J 4BBSJ 4I2OA 3AG4H 1U8BA 2V26A 2IGNA 3BZ6A 3L7WA 4ABZA 3MKWB 4OOIA 4ZTFA 1D0ZA 2A07F 3CDHA 3KFWX 2FX0A 4E7HA 1J5YA 5HLTA 1YE9A 2K85A 3L2UA 3ZQ7A 1A04A 2G9WA 1PJRA 2LF7A 4LK0F 1IUYA 3GFJA 1IXSB 2Z5UA 2GM4A 1SFKA 2V1DA 1MDMB 2LFBA 3H0DA 2H94A 2P81A 1FIAA 1XB4A 5F64A 1KQ9A 3T5XA 3F6OA 2K9SA 4P96A 4BEHA 3RKXA 2IRFG 2L9SA 2MC4A 3Q0WA 3ZQGA 1X1DA 3DTEA 3HL2A 4PJMA 1FSEA 1YIJI 2XPWA 2XSDC 5IYDJ 2BVMA 4RB3C 2DA6A 2M4KA 4HRIA 5L3CA 3W2VA 3FKJA 1YRNB 4FISA 2XROA 2W24A 3ABMH 2R5ZB 4IEJA
chains in the Genus database with same CATH topology
3GX4X 1QBJA 5DCFA 4R79A 2MLGA 1W5SA 2M5WA 1DDNA 2NAZA 3T0YA 1BC8C 2DPUA 4HF1A 3TDUC 1FP2A 1TQIA 3K1MA 5D5UB 3JTGA 5HDNA 3M1EA 4K2EA 4AVPA 2HOEA 2H27A 4ON0A 3I59B 1P2FA 1R5GA 4RB1A 1GHCA 4KMUX 4U0YA 5E1ZB 3WTZA 3LWFA 3WE2A 4KNYA 5HDGA 4CDGA 5LEKA 4KFCA 2M8EA 3H3UA 5TRDA 3IRRA 3K9TA 4BHCA 2XRNA 2PMHA 1JGSA 3VEPA 2X0LA 5HVQC 3RPUA 1BI1A 2DI3A 1ZG5A 3V8LA 3MAJA 2VN2A 2JZYA 4LLNA 2E1CA 3SZPA 4LLLA 4EJVA 3RKYA 2L4MA 4N9HA 3WTUC 2DK5A 2K4JA 4M9ZA 3I64A 1BI0A 1ZHFA 4LB5A 1YFHA 3DFGA 2O3FA 1DP7P 1R1VA 3KEOA 2PJPA 2BEOA 3KP6A 2PI0A 2ISYA 2BV6A 5ICEA 4G7OF 1PDNC 4LD5A 2P8TA 4RB2C 4M71A 2F5DA 3JSOA 5DV5A 5JR3A 5BQTA 2L02A 2DAOA 3DP7A 3M8EA 1LDDA 1U5TB 2ZKZA 1BI2A 1NHAA 1BOAA 1XSXA 4A2UA 1FX7A 2BGCA 4BAYA 4YFKF 1USTA 2P5KA 3WG9A 2G7HA 3GZ5A 1FBUA 4M9SA 1Y0UA 1F1ZA 1J9IA 1IXCA 3F8FA 2FRHA 2OD5A 1FLIA 3WGGA 2QQBA 4KMFA 1RI7A 1I1SA 4ZYHA 4EMSA 3V8KA 2KJBA 4CICA 1T2KA 3R6SA 1O7LA 1KA8A 2W85A 4N0BA 2PLYA 2L54A 1STZA 2RNJA 5DD8A 3PQKA 1D8JA 3ABTA 2XUBA 3K1NA 4JBAA 4D0PA 1TW2A 3ZMZA 1FC3A 1XD7A 1R36A 5L3EA 5K5OA 3ZPLA 5JI6A 2OA4A 1HW2A 4UV9A 1R58A 5L3BA 2DLLA 3U2RA 1HW5A 5D5XB 2OZ6A 3K1PA 3U1DA 4FHTA 1P4XA 2OAZA 4KA4A 1B9MA 3T1BA 2EWNA 4HX4A 2NS0A 4HZFA 3ECOA 5LLQA 2D45A 1WI9A 1JE8A 2FOKA 3KZYA 3WTVC 3ULQB 2Z99A 3DXJF 2NYXA 2W84A 3V7CA 1L3LA 3ZMUA 3BY6A 2FBIA 4U7BA 5L3DA 3H3ZA 2DO7A 4PZJA 3LA2A 5EEHA 1F4KA 1HKQA 3ELKA 3D5LA 4PCQA 2EK5A 1OPCA 2NRAC 4KYWA 2UZKA 4L0ZB 2OBPA 2XAJA 4L5IA 3TO7A 2L4AA 4HDVA 3F8NA 2PBIA 1DPUA 3RPQA 4RGRA 2QENA 3BOQA 4MNUA 2ZNZA 3EUHA 4KICA 3LA3A 4IVNA 4ZH4F 3SFZA 1Z91A 5BOXA 2J5OA 4BHBA 3OOPA 4HA8A 2Z33A 4EM0B 4LG0B 5D8LB 4EJWA 3RIRA 3LSTA 4EVIA 5AIQA 4L18B 5HDKA 3O6BB 5DEQA 1GXPA 1YW7A 3IKVA 3FZVA 2FMYA 3IRQA 2V79A 4HAMA 4E70A 4HX8A 3JSPA 5D6EA 2P7CB 2E1NA 2IA0A 4LB6B 4QWQA 4IHTA 1ZRDA 2HEOA 1X3UA 2XKPA 2XAQA 5J8CA 1HXDA 3WTSC 5ILSA 1G6NA 3NQOA 1TNSA 3FXUA 2VBXA 3JW4A 2O6GE 3K2ZA 2CW0F 3S2WA 1T6SA 1IN6A 2BYVE 1G4DA 2AXLA 1SD6A 1C0WA 5AIPA 1IZ1A 3F3XA 1Z1DA 2EB7A 4BYYA 3W6KB 1I5ZA 4G6DA 4A12A 1LQ1A 2OQGA 2XAFA 1K79A 3BJ6A 4F7ZA 5FLXK 3ZMTA 4OMYA 3E6CC 1B59A 3G73A 3EDPA 6PAXA 1YO5C 3R4KA 1F9NA 3F72A 5H20A 2WC2A 4KDPA 2C6YA 5E18F 3GFIA 1Z7UA 2GAUA 4G7HF 3IL2A 3KP4A 3WODF 4EGZA 3BDDA 3I53A 2MBFA 5F1RA 1ZG1A 3HIFA 4HF2A 4MQVA 2VC1A 4LJZF 2PQ8A 1QQIA 1O3SA 2V6CA 3TDZC 4MEXF 4BNCA 4GXOA 4AIKA 4G9YA 1QZZA 1MJ9A 2FMLA 3ABUA 4PGGA 2RV8A 3J80K 5LHGA 1XDSA 4RGUA 1SAXA 1P4WA 1KU9A 4OIPF 3WTXC 2HKXA 5CVJA 2FBHA 3E97A 3HRMA 3NEUA 1K7AA 2BBYA 4AIJA 3CLOA 1XDUA 3ML6A 2EFWA 4G94A 3SQNA 2HWVA 4LLGF 3KEQA 5HLHA 1ZN2A 3JTHA 5LRRA 2HTSA 4IJAA 3TKYA 2ESHA 3O3KA 1EH8A 3IC7A 4R8HA 5DYMA 3R0AA 3LQQA 3CJNA 3MCZA 1J2XA 5E17F 3QPHA 2F5EA 2GQQA 2XKOA 2ZFWA 2XAGA 5K5QA 1BIAA 4GYGA 1RNLA 3J81K 2P6TA 1V4RA 5CVIA 2JT1A 5LEJA 2XIGA 2QWWA 3B02A 3QU3A 1Z6TA 1ON1A 3RYPA 2HR3A 2IW5A 3P9IA 3HTSB 3TGNA 2LKPA 3HTUA 3MFKA 4CGZA 2K02A 1SFUA 3C7JA 3HRUA 3V4GA 1R22A 4KUMA 1MD0A 5HS8A 3O2PE 2FF4A 1T38A 4ZZDA 1UCRA 2OZUA 4ZYDA 2V9VA 1IRGA 3TOBA 2OQRA 3BPXA 4HBLA 2QYOA 2VT2A 3N4MA 1TLHB 2MD5A 3MEXA 3FM3A 1O3TA 5ED4A 3IWFA 3TQNA 2M1BA 5LHHA 3HUGA 2RC4A 5D8KB 3HHGA 2DU9A 4HDUA 4MTDA 4EV0A 2R3SA 4KN7X 4ZZLA 3BPVA 4XBFA 1T0FA 3SXYA 1FBQA 2CQKA 3KLNA 3R60A 1KQ0A 2VC0A 1G3TA 4IRHA 1TBXA 1YLFA 2ESNA 3GZ6A 1U8RA 1LEBA 1XCVA 1VTNC 2K86A 3GFLA 1O57A 4RAYA 5CVRA 2VOOA 5IT9K 1ZRFA 5TJJA 5LGTA 4RGSA 3FWEA 1BJAA 5ICFA 1FBSA 3ISPA 4DQ2A 5IT3A 3DEUA 4Y17A 4M6XA 1XMKA 1BC7C 1B1BA 3FHZA 3FX3A 3Q9SA 2M30A 5LHIA 2FXAA 4M72A 2B0LA 5E8IA 1J0RA 2ADUA 2FU4A 3I4PA 1LB2A 2QBYA 5EEGA 1FPQA 2HS5A 2W57A 5JFRA 4JK1X 5HOOA 5D5VB 2ZMEA 3GVAA 2A5YB 2R7DA 1XGOA 4A6EA 3IHUA 2P6SA 4Q48A 3V7RA 5JVTA 4I0AA 2IP2A 5ICGA 3P9KA 3EQLF 3DF8A 1EH6A 4PGHA 3QP5A 1OKRA 4YFXF 3F22A 3L00A 2WTEA 3F8MA 1KQ8A 3E5XA 3E6MA 3SHFA 1FYMA 3ZMVA 1WSUA 1XMAA 1TNTA 2HYGD 1CF7B 3HSRA 1KU7A 2IVMA 4R1HA 3N97A 3HSFA 3IWZA 2EJRA 4Y13A 1GVJA 3HHHA 1OYWA 3L09A 4QLCU 1FT9A 2OU2A 1XSDA 4UHTA 2O0YA 4P5OA 2ZBKA 3HOTA 1HKSA 1UB9A 1IAWA 5BPIA 3RJPA 4OINF 5CVUA 4GCVA 2MA3A 3DPLC 1S7AA 2ZXJA 3MZYA 3MZHA 2QQ9A 3AAFA 4CYDA 2WV0A 5L3GA 2VODA 3VFZA 2KIFA 3DV8A 4YFNF 2FBKA 3PQJA 4N9IA 3Q5FA 1CF7A 4B8XA 3QAHA 1U5TC 3JAMK 2XV4S 2D2WA 3GWZA 4A0XA 1ZG3A 4OMZA 1R1TA 2RDPA 4O5VA 3BP8A 3TO9A 4FT8A 1SD7A 3HRTA 3RI4A 2A6EF 1K78A 2VT3A 2JPBA 2CFXA 1XGSA 1YW9A 5J6XA 1OMIA 1B9NA 2GZWA 4WXCA 1KYWA 2HQRA 4B09A 4HYEA 2G7UA 2LNBA 1R1UA 4L9TA 2DTRA 2RKHA 4AD9A 1K6OA 3E5QA 1S8NA 3WTTC 3GF2A 4O6JA 4A5MA 3CUQC 2NNYA 1IN5A 1OYYA 3VB2A 1H9TA 2RGVA 2EV6A 4ETSA 4I98B 2PFBA 1W5TA 5FFZA 2W25A 2HFHA 5L3FA 4EJOA 1HSTA 4EJTA 4Q47A 3F6VA 4O3MA 4I0BA 4XLNF 2E7WA 2VOPA 3K69A 5LBQA 4L9VA 1QNTA 1I1GA 5HS7A 4IRGA 3I0TA 2P5VA 3WU1B 5AONA 2VBZA 2XHKA 4BH9A 4LFUA 1R00A 2DQRA 2RN7A 4CHUA 4HLXA 1IRFA 1YW8A 2Z3YA 2M87A 5E1WA 3I58A 3R0JA 1T98A 1ZLKA 4OIOF 3REOA 1QO0D 4G6QA 3BROA 4U7DA 1YG2A 5LGNA 5H6QA 4S04A 1FY7A 3FF5A 2TDXA 4FX0A 2H6BA 4S05A 3ZP5A 3FM5A 3KETA 3V7SA 1YTYA 1HBXG 2PEXA 2V1XA 3FMRA 1E17A 2P4WA 5FLXZ 2QUFA 1TQPA 3H92A 2UXXA 3WE3A 4HLYA 2DBBA 2EV5A 3I54A 2ZCWA 1ZRCA 2Y48A 2GXBA 2A3SA 2ETHA 1O7FA 3KZZA 5FFXA 3R61A 1SFXA 4WF2A 3GUDA 1S6LA 2XVCA 3QU6A 3GFMA 2QLZA 3B73A 2FNPA 3E6DA 2ZNYA 2EFOA 4MTEA 1MGTA 4M9XA 1WRJA 2KKOA 3T8RA 2QVOA 3V8JA 2F5FA 2YX4A 2IA2A 4LMYA 3WTYC 2XROA 2L3DA 4U0WA 3VOEA 5KK1A 3LA7A 2NNNA 4G8XA 1AWCA 3NRVA 3T8TA 4A0ZA 2LDUA 2DW4A 1BN5A 4LK1F 3J80Z 3RTRA 4GO1A 5DUKA 1KYZA 4A0YA 1YS6A 1ZGJA 3F8BA 2PN6A 1F5TA 3DQVC 5K1YA 4ESBA 1FOKA 1SMYF 2CWEA 5K5RA 4MGRA 1SMTA 3BWGA 2Q2EA 3HRSA 2XGXA 3I5UA 5DD4A 4Z2YA 2EFNA 5FGMA 3KP2A 1UHMA 4UXNA 3E6BA 3E5UA 5ILUA 1KU2A 1IF1A 2MLKA 1P6RA 4JQFA 4U88A 1HSJA 5E1XA 1XN7A 2FEZA 4A6DA 4WCGA 4ENJA 2DFIA 3CO7C 1RUOA 4I02A 2ACJA 1Z05A 1J75A 4IRIA 1IN4A 1IN7A 4A5NA 1WKMA 4IF4A 2YSRA 4AIHA 2JPCA 5DCMA 3LAPA 4IXAA 1R7JA 3C3WA 5LGUA 5BPDA 1FWZA 3J81Z 5FB2A 2R7FA 2YX7A 1R5HA 3F21A 2QM3A 4P9FA 2ZJ2A 2JTVA 3HOSA 4XRFA 2A68F 3FXRA 1GXQA 4I7HA 2KJCA 4ENKA 4M6YA 1OR7A 3FXQA 1IW7F 1SD4A 4NQWA 4HF0A 2GA2A 2FSWA 1I6XA 5CJ9A 2PMUA 1ZLJA 4EM1A 5D6FA 2IPQX 5ICCA 4I01A 4OIQF 1LNWA 4XSZF 4ESFA 1H9GA 1PP8F 1CGPA 1BI3A 2CYYA 3WTWC 2EV0A 1LVAA 3BJOA 1U3EM 2HTJA 2FQ3A 1TTYA 3EETA 5KVRA 1MDMA 4OIRF 3HSEA 2QQAA 3IKTA 4EM2A 4DNCA 2RQPA 4FX4A 3M9AA 5F6FA 1J59A 5DUIA 2QBYB 3KLOA 1PP7U 2COMA 3P7NA 4M73A 1IN8A 1LDKB 1QPMA 1W4MA 2ZMEB 1IXRC 4UVAA 1O3RA 5CVVA 5HLIA 1O3QA 2P5LC 1S29A 1OYIA 1ONVA 1ZARA 5E8GA 5IT9Z 2FA5A 4RAZA 1ODDA 3I59A 2Q8KA 2STWA 2F5CA 4G7ZF 3GYHX 3LQRA 1HW1A 2Q0OA 1W7PD 4P55A 1ZREA 4P9UA 1XSVA 1UFMA 5CYVA 4WX9A 4L5JA 4KT5C 4IHSA 2LSOA 3C18A 4BQAA 1JHHA 1BIBA 4WXHA 3QRFF 2EA4A 2EA2A 4UV8A 3QP6A 2FE3A 2STTA 4HQEA 4YIFA 2HYFA 3RKWA 3DKWA 2GXGA 5DDGA 2BE5F 1S7OA 3WGHA 4UNOA 1LJ9A 5D5WB 2AS5F 1ZGAA 1WWXA 4RB0A 1ZYRF 2K4BA 4EJUA 4ZYGA 1G3YA 2J5PA 3M8FA 3PFIA 4ENNA 1KU3A 2A6HF 4AWXB 3KP3A 2EFQA 2VXZA 1P92A 4M74A 1JHFA 1U5TA 1EV7A 2L01A 2YPRA 3CUQB 1K78B 1QZYA 4CZZA 2MH2A 2RVCA 1QGPA 5E20A 1YIOA 4GYIA 5H6RA 4RGXA 1BBYA 3C1DA 5ERIA 1XGMA 2VBYA 2EFPA 2GWRA 2ISZA 1FYLA 2CG4A 1PUEE 1W7PB 5ILVA 1U2WA 1YS7A 1BM9A 1TW3A 2ELHA 3W6JB 2LF8A 2XASA 1SFEA 4YG2F 1I27A 3E3VA 1HQCA 4ASNA 1YQAA 2X4HA 2Y0MA 1RIOH 5LRSA 1H0MA 2O61A 2CSOA 2VE8A 2CO5A 3KP7A 4KIGA 3JAMZ 1MKMA 1TQMA 1G3WA 4NHJA 1DUXC 4UUVA 3EYIA 4L9JA 1U78A 3F23A 3CUQA 1XCBA 5BMZA 2ZO4A 5FO5A 4EQQA 4ESJA 1FYKA 3GEZA 5FD5A 1FSHA 1AOYA 3U9GA 1LDJA 1MJAA 3VODA 1D3YA 3KCCA 2WWYA 5D4SA 2PG4A 3GO5A 4XSXF 1W7PA 2MC3A 1J7KA 2YU3A 5FD6A 5D4RA 1REPC 3QOPA 3TO6A 3COAC 1YYVA 2IJLA 3SZTA 2F2EA 1XGNA 4HOBA 2HGCA 4XLPF 3CTAA 2E7XA 3ZN1A 1R23A 3DPTA 3QPTA 1EH7A 1T39A 3CO6C 2KIMA 2D1HA 4CO8A 2H6CA 4WK8F 4HX7A 3TOAA 4ZYEA 1ULYA 4OU0A 3ECHA 3I71A 2VE9A 2JRTA 3ZMDA 1LEAA 1USSA 1DPRA 4L9NA 4KN4X 1RZ4A 1Z6RA 2GIVA 4HV5A 4CXFA 1HKTA 2O8XA 2IT0A 5A2QK 4BHPA 2JSCA 2A69F 5HLGA 1MJBA 5A2QZ 5CLSA 1SD5A 4GGGA 4MQ9F 3L2CA 2HKOA 3G3ZA 3J7AO 2P7VB 2VBWA 3M7GA 2H09A 2IA1A 1FZPB 4RS8A 2YR2A 1RUNA 4Q5SF 3ZMSA 1G3SA 3HYIA 2GA1A 4LG0A 1L0OC 3WU0A 4PDKA 4H0EA 4MEYF 4WWCA 2DQLA 3RYRA 1WQ2A 4WXDA 4IPAA 4HW0A 2HZTA 2VONA 2K7LA 2CGPA 1B6AA 4U0VA 2K27A 2DPDA 3GLXA 4NB5A 1S3JA 1P4AA 2KIUA 4I09A 4KIBA 4LGWA 2V1UA 2XAHA 2QZ8A 2D1VA 2FNAA 3GW2A 3P9CA 4MHGA 1Z9CA 3ROUA 1Q1HA 3LAJA 4Q4ZF 1B4AA 4UVBA 4BXUA 3KP5A 1FP1D 1ON2A 4UVCA 1D5VA 4EGYA 2UWMA 2DK8A 2O03A 2Y75A 3CUOA 4L0YB 1ZH5A 3EYYA 2UXNA 3FMQA 3D0SA 4TV7A 1V3FA 3Q9VA 2MH9A 1JXSA 3ERED 3MQ0A 3BJAA 1D8KA 4KIFA 2HDCA 3F8CA 3FMSA 5DCMB 3KE2A 3K0LA 4ENMA 3WGIA 1MZBA 2HQNA 3MWMA 3ZN0A 4HQMA 5J8FA 4YIIA 2Z9OA 2A61A 3GXOA 4HV6A 3RDIA 5JHUA 4Y15A 1UHWA 1FNNA 3OV8A 3L9FA 1E2XA 1ZAOA 1KGSA 3LFKA 2M45A 5BS6A 2KRFA 1U6GA 2DT5A 5HS9A 4I2OA 3BZ6A 3L7WA 4OOIA 2A07F 3CDHA 3KFWX 1J5YA 3ZQ7A 1A04A 2G9WA 2LF7A 4LK0F 1IUYA 3GFJA 1IXSB 2Z5UA 1MDMB 2V1DA 2H94A 1XB4A 5F64A 1KQ9A 3T5XA 3F6OA 4P96A 3RKXA 2IRFG 1FSEA 4RB3C 5L3CA 2W24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GX4 X;  1QBJ A;  5DCF A;  4R79 A;  2MLG A;  1W5S A;  2M5W A;  1DDN A;  2NAZ A;  3T0Y A;  1BC8 C;  2DPU A;  4HF1 A;  3TDU C;  1FP2 A;  1TQI A;  3K1M A;  5D5U B;  3JTG A;  5HDN A;  3M1E A;  4K2E A;  4AVP A;  2HOE A;  2H27 A;  4ON0 A;  3I59 B;  1P2F A;  1R5G A;  4RB1 A;  1GHC A;  4KMU X;  4U0Y A;  5E1Z B;  3WTZ A;  3LWF A;  3WE2 A;  4KNY A;  5HDG A;  4CDG A;  5LEK A;  4KFC A;  2M8E A;  3H3U A;  5TRD A;  3IRR A;  3K9T A;  4BHC A;  2XRN A;  2PMH A;  1JGS A;  3VEP A;  2X0L A;  5HVQ C;  3RPU A;  1BI1 A;  2DI3 A;  1ZG5 A;  3V8L A;  3MAJ A;  2VN2 A;  2JZY A;  4LLN A;  2E1C A;  3SZP A;  4LLL A;  4EJV A;  3RKY A;  2L4M A;  4N9H A;  3WTU C;  2DK5 A;  2K4J A;  4M9Z A;  3I64 A;  1BI0 A;  1ZHF A;  4LB5 A;  1YFH A;  3DFG A;  2O3F A;  1DP7 P;  1R1V A;  3KEO A;  2PJP A;  2BEO A;  3KP6 A;  2PI0 A;  2ISY A;  2BV6 A;  5ICE A;  4G7O F;  1PDN C;  4LD5 A;  2P8T A;  4RB2 C;  4M71 A;  2F5D A;  3JSO A;  5DV5 A;  5JR3 A;  5BQT A;  2L02 A;  2DAO A;  3DP7 A;  3M8E A;  1LDD A;  1U5T B;  2ZKZ A;  1BI2 A;  1NHA A;  1BOA A;  1XSX A;  4A2U A;  1FX7 A;  2BGC A;  4BAY A;  4YFK F;  1UST A;  2P5K A;  3WG9 A;  2G7H A;  3GZ5 A;  1FBU A;  4M9S A;  1Y0U A;  1F1Z A;  1J9I A;  1IXC A;  3F8F A;  2FRH A;  2OD5 A;  1FLI A;  3WGG A;  2QQB A;  4KMF A;  1RI7 A;  1I1S A;  4ZYH A;  4EMS A;  3V8K A;  2KJB A;  4CIC A;  1T2K A;  3R6S A;  1O7L A;  1KA8 A;  2W85 A;  4N0B A;  2PLY A;  2L54 A;  1STZ A;  2RNJ A;  5DD8 A;  3PQK A;  1D8J A;  3ABT A;  2XUB A;  3K1N A;  4JBA A;  4D0P A;  1TW2 A;  3ZMZ A;  1FC3 A;  1XD7 A;  1R36 A;  5L3E A;  5K5O A;  3ZPL A;  5JI6 A;  2OA4 A;  1HW2 A;  4UV9 A;  1R58 A;  5L3B A;  2DLL A;  3U2R A;  1HW5 A;  5D5X B;  2OZ6 A;  3K1P A;  3U1D A;  4FHT A;  1P4X A;  2OAZ A;  4KA4 A;  1B9M A;  3T1B A;  2EWN A;  4HX4 A;  2NS0 A;  4HZF A;  3ECO A;  5LLQ A;  2D45 A;  1WI9 A;  1JE8 A;  2FOK A;  3KZY A;  3WTV C;  3ULQ B;  2Z99 A;  3DXJ F;  2NYX A;  2W84 A;  3V7C A;  1L3L A;  3ZMU A;  3BY6 A;  2FBI A;  4U7B A;  5L3D A;  3H3Z A;  2DO7 A;  4PZJ A;  3LA2 A;  5EEH A;  1F4K A;  1HKQ A;  3ELK A;  3D5L A;  4PCQ A;  2EK5 A;  1OPC A;  2NRA C;  4KYW A;  2UZK A;  4L0Z B;  2OBP A;  2XAJ A;  4L5I A;  3TO7 A;  2L4A A;  4HDV A;  3F8N A;  2PBI A;  1DPU A;  3RPQ A;  4RGR A;  2QEN A;  3BOQ A;  4MNU A;  2ZNZ A;  3EUH A;  4KIC A;  3LA3 A;  4IVN A;  4ZH4 F;  3SFZ A;  1Z91 A;  5BOX A;  2J5O A;  4BHB A;  3OOP A;  4HA8 A;  2Z33 A;  4EM0 B;  4LG0 B;  5D8L B;  4EJW A;  3RIR A;  3LST A;  4EVI A;  5AIQ A;  4L18 B;  5HDK A;  3O6B B;  5DEQ A;  1GXP A;  1YW7 A;  3IKV A;  3FZV A;  2FMY A;  3IRQ A;  2V79 A;  4HAM A;  4E70 A;  4HX8 A;  3JSP A;  5D6E A;  2P7C B;  2E1N A;  2IA0 A;  4LB6 B;  4QWQ A;  4IHT A;  1ZRD A;  2HEO A;  1X3U A;  2XKP A;  2XAQ A;  5J8C A;  1HXD A;  3WTS C;  5ILS A;  1G6N A;  3NQO A;  1TNS A;  3FXU A;  2VBX A;  3JW4 A;  2O6G E;  3K2Z A;  2CW0 F;  3S2W A;  1T6S A;  1IN6 A;  2BYV E;  1G4D A;  2AXL A;  1SD6 A;  1C0W A;  5AIP A;  1IZ1 A;  3F3X A;  1Z1D A;  2EB7 A;  4BYY A;  3W6K B;  1I5Z A;  4G6D A;  4A12 A;  1LQ1 A;  2OQG A;  2XAF A;  1K79 A;  3BJ6 A;  4F7Z A;  5FLX K;  3ZMT A;  4OMY A;  3E6C C;  1B59 A;  3G73 A;  3EDP A;  6PAX A;  1YO5 C;  3R4K A;  1F9N A;  3F72 A;  5H20 A;  2WC2 A;  4KDP A;  2C6Y A;  5E18 F;  3GFI A;  1Z7U A;  2GAU A;  4G7H F;  3IL2 A;  3KP4 A;  3WOD F;  4EGZ A;  3BDD A;  3I53 A;  2MBF A;  5F1R A;  1ZG1 A;  3HIF A;  4HF2 A;  4MQV A;  2VC1 A;  4LJZ F;  2PQ8 A;  1QQI A;  1O3S A;  2V6C A;  3TDZ C;  4MEX F;  4BNC A;  4GXO A;  4AIK A;  4G9Y A;  1QZZ A;  1MJ9 A;  2FML A;  3ABU A;  4PGG A;  2RV8 A;  3J80 K;  5LHG A;  1XDS A;  4RGU A;  1SAX A;  1P4W A;  1KU9 A;  4OIP F;  3WTX C;  2HKX A;  5CVJ A;  2FBH A;  3E97 A;  3HRM A;  3NEU A;  1K7A A;  2BBY A;  4AIJ A;  3CLO A;  1XDU A;  3ML6 A;  2EFW A;  4G94 A;  3SQN A;  2HWV A;  4LLG F;  3KEQ A;  5HLH A;  1ZN2 A;  3JTH A;  5LRR A;  2HTS A;  4IJA A;  3TKY A;  2ESH A;  3O3K A;  1EH8 A;  3IC7 A;  4R8H A;  5DYM A;  3R0A A;  3LQQ A;  3CJN A;  3MCZ A;  1J2X A;  5E17 F;  3QPH A;  2F5E A;  2GQQ A;  2XKO A;  2ZFW A;  2XAG A;  5K5Q A;  1BIA A;  4GYG A;  1RNL A;  3J81 K;  2P6T A;  1V4R A;  5CVI A;  2JT1 A;  5LEJ A;  2XIG A;  2QWW A;  3B02 A;  3QU3 A;  1Z6T A;  1ON1 A;  3RYP A;  2HR3 A;  2IW5 A;  3P9I A;  3HTS B;  3TGN A;  2LKP A;  3HTU A;  3MFK A;  4CGZ A;  2K02 A;  1SFU A;  3C7J A;  3HRU A;  3V4G A;  1R22 A;  4KUM A;  1MD0 A;  5HS8 A;  3O2P E;  2FF4 A;  1T38 A;  4ZZD A;  1UCR A;  2OZU A;  4ZYD A;  2V9V A;  1IRG A;  3TOB A;  2OQR A;  3BPX A;  4HBL A;  2QYO A;  2VT2 A;  3N4M A;  1TLH B;  2MD5 A;  3MEX A;  3FM3 A;  1O3T A;  5ED4 A;  3IWF A;  3TQN A;  2M1B A;  5LHH A;  3HUG A;  2RC4 A;  5D8K B;  3HHG A;  2DU9 A;  4HDU A;  4MTD A;  4EV0 A;  2R3S A;  4KN7 X;  4ZZL A;  3BPV A;  4XBF A;  1T0F A;  3SXY A;  1FBQ A;  2CQK A;  3KLN A;  3R60 A;  1KQ0 A;  2VC0 A;  1G3T A;  4IRH A;  1TBX A;  1YLF A;  2ESN A;  3GZ6 A;  1U8R A;  1LEB A;  1XCV A;  1VTN C;  2K86 A;  3GFL A;  1O57 A;  4RAY A;  5CVR A;  2VOO A;  5IT9 K;  1ZRF A;  5TJJ A;  5LGT A;  4RGS A;  3FWE A;  1BJA A;  5ICF A;  1FBS A;  3ISP A;  4DQ2 A;  5IT3 A;  3DEU A;  4Y17 A;  4M6X A;  1XMK A;  1BC7 C;  1B1B A;  3FHZ A;  3FX3 A;  3Q9S A;  2M30 A;  5LHI A;  2FXA A;  4M72 A;  2B0L A;  5E8I A;  1J0R A;  2ADU A;  2FU4 A;  3I4P A;  1LB2 A;  2QBY A;  5EEG A;  1FPQ A;  2HS5 A;  2W57 A;  5JFR A;  4JK1 X;  5HOO A;  5D5V B;  2ZME A;  3GVA A;  2A5Y B;  2R7D A;  1XGO A;  4A6E A;  3IHU A;  2P6S A;  4Q48 A;  3V7R A;  5JVT A;  4I0A A;  2IP2 A;  5ICG A;  3P9K A;  3EQL F;  3DF8 A;  1EH6 A;  4PGH A;  3QP5 A;  1OKR A;  4YFX F;  3F22 A;  3L00 A;  2WTE A;  3F8M A;  1KQ8 A;  3E5X A;  3E6M A;  3SHF A;  1FYM A;  3ZMV A;  1WSU A;  1XMA A;  1TNT A;  2HYG D;  1CF7 B;  3HSR A;  1KU7 A;  2IVM A;  4R1H A;  3N97 A;  3HSF A;  3IWZ A;  2EJR A;  4Y13 A;  1GVJ A;  3HHH A;  1OYW A;  3L09 A;  4QLC U;  1FT9 A;  2OU2 A;  1XSD A;  4UHT A;  2O0Y A;  4P5O A;  2ZBK A;  3HOT A;  1HKS A;  1UB9 A;  1IAW A;  5BPI A;  3RJP A;  4OIN F;  5CVU A;  4GCV A;  2MA3 A;  3DPL C;  1S7A A;  2ZXJ A;  3MZY A;  3MZH A;  2QQ9 A;  3AAF A;  4CYD A;  2WV0 A;  5L3G A;  2VOD A;  3VFZ A;  2KIF A;  3DV8 A;  4YFN F;  2FBK A;  3PQJ A;  4N9I A;  3Q5F A;  1CF7 A;  4B8X A;  3QAH A;  1U5T C;  3JAM K;  2XV4 S;  2D2W A;  3GWZ A;  4A0X A;  1ZG3 A;  4OMZ A;  1R1T A;  2RDP A;  4O5V A;  3BP8 A;  3TO9 A;  4FT8 A;  1SD7 A;  3HRT A;  3RI4 A;  2A6E F;  1K78 A;  2VT3 A;  2JPB A;  2CFX A;  1XGS A;  1YW9 A;  5J6X A;  1OMI A;  1B9N A;  2GZW A;  4WXC A;  1KYW A;  2HQR A;  4B09 A;  4HYE A;  2G7U A;  2LNB A;  1R1U A;  4L9T A;  2DTR A;  2RKH A;  4AD9 A;  1K6O A;  3E5Q A;  1S8N A;  3WTT C;  3GF2 A;  4O6J A;  4A5M A;  3CUQ C;  2NNY A;  1IN5 A;  1OYY A;  3VB2 A;  1H9T A;  2RGV A;  2EV6 A;  4ETS A;  4I98 B;  2PFB A;  1W5T A;  5FFZ A;  2W25 A;  2HFH A;  5L3F A;  4EJO A;  1HST A;  4EJT A;  4Q47 A;  3F6V A;  4O3M A;  4I0B A;  4XLN F;  2E7W A;  2VOP A;  3K69 A;  5LBQ A;  4L9V A;  1QNT A;  1I1G A;  5HS7 A;  4IRG A;  3I0T A;  2P5V A;  3WU1 B;  5AON A;  2VBZ A;  2XHK A;  4BH9 A;  4LFU A;  1R00 A;  2DQR A;  2RN7 A;  4CHU A;  4HLX A;  1IRF A;  1YW8 A;  2Z3Y A;  2M87 A;  5E1W A;  3I58 A;  3R0J A;  1T98 A;  1ZLK A;  4OIO F;  3REO A;  1QO0 D;  4G6Q A;  3BRO A;  4U7D A;  1YG2 A;  5LGN A;  5H6Q A;  4S04 A;  1FY7 A;  3FF5 A;  2TDX A;  4FX0 A;  2H6B A;  4S05 A;  3ZP5 A;  3FM5 A;  3KET A;  3V7S A;  1YTY A;  1HBX G;  2PEX A;  2V1X A;  3FMR A;  1E17 A;  2P4W A;  5FLX Z;  2QUF A;  1TQP A;  3H92 A;  2UXX A;  3WE3 A;  4HLY A;  2DBB A;  2EV5 A;  3I54 A;  2ZCW A;  1ZRC A;  2Y48 A;  2GXB A;  2A3S A;  2ETH A;  1O7F A;  3KZZ A;  5FFX A;  3R61 A;  1SFX A;  4WF2 A;  3GUD A;  1S6L A;  2XVC A;  3QU6 A;  3GFM A;  2QLZ A;  3B73 A;  2FNP A;  3E6D A;  2ZNY A;  2EFO A;  4MTE A;  1MGT A;  4M9X A;  1WRJ A;  2KKO A;  3T8R A;  2QVO A;  3V8J A;  2F5F A;  2YX4 A;  2IA2 A;  4LMY A;  3WTY C;  2XRO A;  2L3D A;  4U0W A;  3VOE A;  5KK1 A;  3LA7 A;  2NNN A;  4G8X A;  1AWC A;  3NRV A;  3T8T A;  4A0Z A;  2LDU A;  2DW4 A;  1BN5 A;  4LK1 F;  3J80 Z;  3RTR A;  4GO1 A;  5DUK A;  1KYZ A;  4A0Y A;  1YS6 A;  1ZGJ A;  3F8B A;  2PN6 A;  1F5T A;  3DQV C;  5K1Y A;  4ESB A;  1FOK A;  1SMY F;  2CWE A;  5K5R A;  4MGR A;  1SMT A;  3BWG A;  2Q2E A;  3HRS A;  2XGX A;  3I5U A;  5DD4 A;  4Z2Y A;  2EFN A;  5FGM A;  3KP2 A;  1UHM A;  4UXN A;  3E6B A;  3E5U A;  5ILU A;  1KU2 A;  1IF1 A;  2MLK A;  1P6R A;  4JQF A;  4U88 A;  1HSJ A;  5E1X A;  1XN7 A;  2FEZ A;  4A6D A;  4WCG A;  4ENJ A;  2DFI A;  3CO7 C;  1RUO A;  4I02 A;  2ACJ A;  1Z05 A;  1J75 A;  4IRI A;  1IN4 A;  1IN7 A;  4A5N A;  1WKM A;  4IF4 A;  2YSR A;  4AIH A;  2JPC A;  5DCM A;  3LAP A;  4IXA A;  1R7J A;  3C3W A;  5LGU A;  5BPD A;  1FWZ A;  3J81 Z;  5FB2 A;  2R7F A;  2YX7 A;  1R5H A;  3F21 A;  2QM3 A;  4P9F A;  2ZJ2 A;  2JTV A;  3HOS A;  4XRF A;  2A68 F;  3FXR A;  1GXQ A;  4I7H A;  2KJC A;  4ENK A;  4M6Y A;  1OR7 A;  3FXQ A;  1IW7 F;  1SD4 A;  4NQW A;  4HF0 A;  2GA2 A;  2FSW A;  1I6X A;  5CJ9 A;  2PMU A;  1ZLJ A;  4EM1 A;  5D6F A;  2IPQ X;  5ICC A;  4I01 A;  4OIQ F;  1LNW A;  4XSZ F;  4ESF A;  1H9G A;  1PP8 F;  1CGP A;  1BI3 A;  2CYY A;  3WTW C;  2EV0 A;  1LVA A;  3BJO A;  1U3E M;  2HTJ A;  2FQ3 A;  1TTY A;  3EET A;  5KVR A;  1MDM A;  4OIR F;  3HSE A;  2QQA A;  3IKT A;  4EM2 A;  4DNC A;  2RQP A;  4FX4 A;  3M9A A;  5F6F A;  1J59 A;  5DUI A;  2QBY B;  3KLO A;  1PP7 U;  2COM A;  3P7N A;  4M73 A;  1IN8 A;  1LDK B;  1QPM A;  1W4M A;  2ZME B;  1IXR C;  4UVA A;  1O3R A;  5CVV A;  5HLI A;  1O3Q A;  2P5L C;  1S29 A;  1OYI A;  1ONV A;  1ZAR A;  5E8G A;  5IT9 Z;  2FA5 A;  4RAZ A;  1ODD A;  3I59 A;  2Q8K A;  2STW A;  2F5C A;  4G7Z F;  3GYH X;  3LQR A;  1HW1 A;  2Q0O A;  1W7P D;  4P55 A;  1ZRE A;  4P9U A;  1XSV A;  1UFM A;  5CYV A;  4WX9 A;  4L5J A;  4KT5 C;  4IHS A;  2LSO A;  3C18 A;  4BQA A;  1JHH A;  1BIB A;  4WXH A;  3QRF F;  2EA4 A;  2EA2 A;  4UV8 A;  3QP6 A;  2FE3 A;  2STT A;  4HQE A;  4YIF A;  2HYF A;  3RKW A;  3DKW A;  2GXG A;  5DDG A;  2BE5 F;  1S7O A;  3WGH A;  4UNO A;  1LJ9 A;  5D5W B;  2AS5 F;  1ZGA A;  1WWX A;  4RB0 A;  1ZYR F;  2K4B A;  4EJU A;  4ZYG A;  1G3Y A;  2J5P A;  3M8F A;  3PFI A;  4ENN A;  1KU3 A;  2A6H F;  4AWX B;  3KP3 A;  2EFQ A;  2VXZ A;  1P92 A;  4M74 A;  1JHF A;  1U5T A;  1EV7 A;  2L01 A;  2YPR A;  3CUQ B;  1K78 B;  1QZY A;  4CZZ A;  2MH2 A;  2RVC A;  1QGP A;  5E20 A;  1YIO A;  4GYI A;  5H6R A;  4RGX A;  1BBY A;  3C1D A;  5ERI A;  1XGM A;  2VBY A;  2EFP A;  2GWR A;  2ISZ A;  1FYL A;  2CG4 A;  1PUE E;  1W7P B;  5ILV A;  1U2W A;  1YS7 A;  1BM9 A;  1TW3 A;  2ELH A;  3W6J B;  2LF8 A;  2XAS A;  1SFE A;  4YG2 F;  1I27 A;  3E3V A;  1HQC A;  4ASN A;  1YQA A;  2X4H A;  2Y0M A;  1RIO H;  5LRS A;  1H0M A;  2O61 A;  2CSO A;  2VE8 A;  2CO5 A;  3KP7 A;  4KIG A;  3JAM Z;  1MKM A;  1TQM A;  1G3W A;  4NHJ A;  1DUX C;  4UUV A;  3EYI A;  4L9J A;  1U78 A;  3F23 A;  3CUQ A;  1XCB A;  5BMZ A;  2ZO4 A;  5FO5 A;  4EQQ A;  4ESJ A;  1FYK A;  3GEZ A;  5FD5 A;  1FSH A;  1AOY A;  3U9G A;  1LDJ A;  1MJA A;  3VOD A;  1D3Y A;  3KCC A;  2WWY A;  5D4S A;  2PG4 A;  3GO5 A;  4XSX F;  1W7P A;  2MC3 A;  1J7K A;  2YU3 A;  5FD6 A;  5D4R A;  1REP C;  3QOP A;  3TO6 A;  3COA C;  1YYV A;  2IJL A;  3SZT A;  2F2E A;  1XGN A;  4HOB A;  2HGC A;  4XLP F;  3CTA A;  2E7X A;  3ZN1 A;  1R23 A;  3DPT A;  3QPT A;  1EH7 A;  1T39 A;  3CO6 C;  2KIM A;  2D1H A;  4CO8 A;  2H6C A;  4WK8 F;  4HX7 A;  3TOA A;  4ZYE A;  1ULY A;  4OU0 A;  3ECH A;  3I71 A;  2VE9 A;  2JRT A;  3ZMD A;  1LEA A;  1USS A;  1DPR A;  4L9N A;  4KN4 X;  1RZ4 A;  1Z6R A;  2GIV A;  4HV5 A;  4CXF A;  1HKT A;  2O8X A;  2IT0 A;  5A2Q K;  4BHP A;  2JSC A;  2A69 F;  5HLG A;  1MJB A;  5A2Q Z;  5CLS A;  1SD5 A;  4GGG A;  4MQ9 F;  3L2C A;  2HKO A;  3G3Z A;  3J7A O;  2P7V B;  2VBW A;  3M7G A;  2H09 A;  2IA1 A;  1FZP B;  4RS8 A;  2YR2 A;  1RUN A;  4Q5S F;  3ZMS A;  1G3S A;  3HYI A;  2GA1 A;  4LG0 A;  1L0O C;  3WU0 A;  4PDK A;  4H0E A;  4MEY F;  4WWC A;  2DQL A;  3RYR A;  1WQ2 A;  4WXD A;  4IPA A;  4HW0 A;  2HZT A;  2VON A;  2K7L A;  2CGP A;  1B6A A;  4U0V A;  2K27 A;  2DPD A;  3GLX A;  4NB5 A;  1S3J A;  1P4A A;  2KIU A;  4I09 A;  4KIB A;  4LGW A;  2V1U A;  2XAH A;  2QZ8 A;  2D1V A;  2FNA A;  3GW2 A;  3P9C A;  4MHG A;  1Z9C A;  3ROU A;  1Q1H A;  3LAJ A;  4Q4Z F;  1B4A A;  4UVB A;  4BXU A;  3KP5 A;  1FP1 D;  1ON2 A;  4UVC A;  1D5V A;  4EGY A;  2UWM A;  2DK8 A;  2O03 A;  2Y75 A;  3CUO A;  4L0Y B;  1ZH5 A;  3EYY A;  2UXN A;  3FMQ A;  3D0S A;  4TV7 A;  1V3F A;  3Q9V A;  2MH9 A;  1JXS A;  3ERE D;  3MQ0 A;  3BJA A;  1D8K A;  4KIF A;  2HDC A;  3F8C A;  3FMS A;  5DCM B;  3KE2 A;  3K0L A;  4ENM A;  3WGI A;  1MZB A;  2HQN A;  3MWM A;  3ZN0 A;  4HQM A;  5J8F A;  4YII A;  2Z9O A;  2A61 A;  3GXO A;  4HV6 A;  3RDI A;  5JHU A;  4Y15 A;  1UHW A;  1FNN A;  3OV8 A;  3L9F A;  1E2X A;  1ZAO A;  1KGS A;  3LFK A;  2M45 A;  5BS6 A;  2KRF A;  1U6G A;  2DT5 A;  5HS9 A;  4I2O A;  3BZ6 A;  3L7W A;  4OOI A;  2A07 F;  3CDH A;  3KFW X;  1J5Y A;  3ZQ7 A;  1A04 A;  2G9W A;  2LF7 A;  4LK0 F;  1IUY A;  3GFJ A;  1IXS B;  2Z5U A;  1MDM B;  2V1D A;  2H94 A;  1XB4 A;  5F64 A;  1KQ9 A;  3T5X A;  3F6O A;  4P96 A;  3RKX A;  2IRF G;  1FSE A;  4RB3 C;  5L3C A;  2W24 A; 
#chains in the Genus database with same CATH topology
 2DDB A;  3FXJ A;  3BCA A;  4PSX A;  3GX4 X;  2LD5 A;  1QBJ A;  5DCF A;  1ETK A;  3N05 A;  4R79 A;  2MFZ A;  2MLG A;  1W5S A;  2DCE A;  4XOT A;  2M5W A;  3J7Y J;  5IYB J;  1DDN A;  2NAZ A;  2HXO A;  3T0Y A;  1BC8 C;  2DPU A;  4IQJ A;  4HF1 A;  3TDU C;  1G8X A;  1FP2 A;  1TQI A;  1SVL A;  2VAS A;  3MKL A;  5F08 A;  4GDF A;  3K1M A;  1ITY A;  5D5U B;  3JTG A;  5HDN A;  3M1E A;  2KMU A;  4K2E A;  4AVP A;  2M7B A;  2HOE A;  2ZC2 A;  4PFO A;  4XM3 A;  1JJ8 C;  2H27 A;  2R7U A;  4ON0 A;  3I59 B;  2CV0 A;  1P2F A;  1R5G A;  3BG3 A;  4PJJ A;  2ECB A;  1S5L C;  4RB1 A;  4KMU X;  4U0Y A;  4XKW A;  5E1Z B;  5KCM A;  4M3E A;  2R7W A;  1GHC A;  3WTZ A;  1A36 A;  4BQN A;  2L7Z A;  3NWT A;  2R92 J;  3LWF A;  3HOY J;  3WE2 A;  4KNY A;  2AQF A;  2X6X A;  2HPM A;  5HDG A;  2KDO A;  4CDG A;  3OS2 A;  3CF2 A;  4V2F A;  5LEK A;  4KIS A;  4Y7N J;  2NOG A;  1WJF A;  4KFC A;  1R4N B;  3DBL B;  2M8E A;  4IKF A;  3RQI A;  3H3U A;  1YRN A;  2R5Z A;  3ZXS A;  2EIK H;  2CV1 A;  5TRD A;  2IEK A;  3OIQ A;  4J19 A;  3W3C A;  3IRR A;  3K9T A;  4BHC A;  1BW5 A;  3TP0 A;  2XRN A;  3QYE A;  2PMH A;  3NAU A;  4IO9 F;  1JGS A;  5LFA A;  3VEP A;  2X0L A;  5HVQ C;  3A4C A;  5DS9 A;  3RPU A;  1P7J A;  1BI1 A;  3OYE A;  2DI3 A;  4BY7 J;  1ZG5 A;  3V8L A;  4UUS A;  3IUO A;  3MAJ A;  2VN2 A;  2JZY A;  4LLN A;  2G0E A;  2NVU B;  2HOS A;  2E1C A;  3SZP A;  2FOW A;  1XS9 A;  4LLL A;  4EJV A;  3AG2 H;  4A3L J;  5B66 C;  2IBD A;  3RKY A;  2L4M A;  4N9H A;  1RPW A;  2CUZ A;  1R9T J;  2CUE A;  2Y69 H;  4CCJ A;  3ZQL A;  1N77 A;  3HOV J;  3WTU C;  3LSG A;  2DK5 A;  3OYC A;  4GRI A;  3I9V 2;  1T0F C;  2K4J A;  3UNG C;  3BTC A;  4M9Z A;  3ZRG A;  2ELJ A;  3I64 A;  2Y9Y A;  1BI0 A;  1ZHF A;  1XG1 A;  3S3N A;  1YFH A;  1VQ9 I;  4LB5 A;  3DFG A;  2BHY A;  1G59 A;  2O3F A;  1DP7 P;  1R1V A;  3KEO A;  3EPZ A;  4NC6 A;  2E19 A;  2PJP A;  2BEO A;  3KP6 A;  2PI0 A;  2ISY A;  3CCV I;  2BV6 A;  3CP2 A;  5ICE A;  2FJ1 A;  1SC7 A;  4G7O F;  1X1C A;  1PDN C;  4LD5 A;  2EQR A;  2P8T A;  4RB2 C;  3PJR A;  4OAZ A;  4M71 A;  2F5D A;  3JSO A;  1BL0 A;  5DV5 A;  5JR3 A;  5EG0 B;  5GP9 A;  5BQT A;  4BJT A;  2L02 A;  2DAO A;  2PMZ A;  3WHC A;  1RR8 C;  3DP7 A;  3M8E A;  3CQZ J;  1LDD A;  1U5T B;  2ZKZ A;  4M3B A;  1NG6 A;  1BI2 A;  1NHA A;  1BOA A;  1XSX A;  4A2U A;  1FX7 A;  2R0Q C;  2BGC A;  4BAY A;  3AL0 C;  1FOY A;  2HDW A;  4YFK F;  5FRN A;  1UST A;  4B3X A;  2P5K A;  3WG9 A;  2G7H A;  2Q1Z B;  3GZ5 A;  4D1Q A;  1FBU A;  4F91 B;  4M9S A;  3VWB A;  1Y0U A;  1F1Z A;  2AQE A;  2X9D A;  1J9I A;  3TP3 A;  2JMW A;  1IXC A;  1WFX A;  3F8F A;  2FRH A;  2D5V A;  1X58 A;  2OD5 A;  3RSN A;  1FLI A;  3WGG A;  2QQB A;  4KMF A;  1RI7 A;  1I1S A;  4ZYH A;  4EMS A;  3KYL A;  3V8K A;  2KJB A;  3KYD B;  2F4I A;  2I5U A;  2BVL A;  3QOD A;  4LIU A;  1W1W E;  5EF6 A;  4CIC A;  2LG4 A;  1T2K A;  2NVX J;  1RRJ A;  2LY2 A;  3R6S A;  1O7L A;  1KA8 A;  2W85 A;  4N0B A;  2LRD A;  1W36 C;  2ZME C;  2EBI A;  5EG0 A;  2PLY A;  2IGO A;  2OV7 A;  1WCM J;  1P7I A;  1RC9 A;  2XF5 A;  3CES A;  2L54 A;  2O8K A;  4PFP A;  1STZ A;  2RNJ A;  5DD8 A;  3PQK A;  1D8J A;  1ETQ A;  4DGW B;  3ABT A;  2XUB A;  1MH3 A;  3K1N A;  4XQF A;  1R49 A;  4JBA A;  2L9N A;  2WAQ N;  3CJR B;  4D0P A;  1TW2 A;  4FET A;  4AID A;  3ZMZ A;  1FC3 A;  4BGD A;  2JA7 J;  1FTT A;  3CLQ A;  1XD7 A;  3FBI B;  1R36 A;  5L3E A;  3CJQ B;  1MBK A;  5K5O A;  2OC6 A;  3ZPL A;  5JI6 A;  2OA4 A;  1HW2 A;  3VYT B;  4UV9 A;  1R58 A;  2L9R A;  1WH7 A;  5L3B A;  3TW6 A;  2CH0 A;  2DLL A;  1TT5 B;  2HQ5 A;  3U2R A;  3O8G A;  1HW5 A;  5D5X B;  1VQ7 I;  2OZ6 A;  3K1P A;  2OPT A;  4RAG A;  4XMY A;  3U1D A;  1Z67 A;  2KRC A;  1FOW A;  4FHT A;  1BOB A;  1P4X A;  2OAZ A;  4DYR A;  3HOX J;  4KA4 A;  1B9M A;  3T1B A;  2EWN A;  4HPQ A;  4HX4 A;  4E4H A;  2HI3 A;  2NS0 A;  4HZF A;  3RZO J;  3ECO A;  2DA3 A;  5LLQ A;  1MBG A;  2GXA A;  2D45 A;  4DZP A;  1WI9 A;  1JE8 A;  1X2M A;  3MKY B;  2FOK A;  3KZY A;  3QOE A;  1GVD A;  3WTV C;  3ULQ B;  4Y3O A;  2VL8 A;  2Z99 A;  3AG1 H;  2E1M C;  3DXJ F;  3G1L A;  2NYX A;  2MAB A;  2W84 A;  3G6E I;  1ZGW A;  1A5J A;  4CUG A;  2V7F A;  3V7C A;  4NUB A;  1L3L A;  4MFD A;  1U0J A;  3ZMU A;  4AU7 A;  5F27 A;  1IGN A;  4N4O B;  3BY6 A;  2FBI A;  4U7B A;  2HU9 A;  5L3D A;  3H3Z A;  3L2W A;  2DO7 A;  1XMX A;  2HZD A;  2CW7 A;  4PZJ A;  1ETV A;  4PJ0 C;  4IZZ A;  1IV8 A;  3L2V A;  2QQ8 A;  3LA2 A;  5EEH A;  4CCM A;  2E2J J;  1F4K A;  1HKQ A;  4II2 A;  3CDL A;  1BW6 A;  3ZQI A;  5B5E C;  3ELK A;  1NK3 P;  2XGE A;  2HQA A;  1VQ5 I;  3D5L A;  4BAC A;  1HOM A;  4PCQ A;  2EK5 A;  4C2U A;  3C2B A;  1OPC A;  2NRA C;  4KYW A;  2UZK A;  1SEU A;  4E7S A;  4L0Z B;  2OBP A;  2XAJ A;  3OY9 A;  4L5I A;  3TO7 A;  5FRO A;  1QHG A;  2L4A A;  4CCN A;  4HDV A;  3F8N A;  2PBI A;  4FAS D;  1DPU A;  2P0W A;  2R4G A;  2QSH X;  2LBF B;  1ZK8 A;  5DTD A;  3DKX A;  1RKW A;  1TC3 C;  2Y30 A;  1MBF A;  2DMN A;  3RPQ A;  4RGR A;  2QEN A;  3BOQ A;  4MNU A;  1MMA A;  2ZNZ A;  3AFH A;  3FDY A;  3EUH A;  3DBH B;  1UEL B;  4M3G A;  4KIC A;  3LA3 A;  4IVN A;  1ZEL A;  4ZH4 F;  3VYU B;  3SFZ A;  1Z91 A;  2RRE A;  5BOX A;  2J5O A;  4BHB A;  4Y52 J;  1JUS A;  4Y33 A;  3OOP A;  4HA8 A;  4M6V A;  2VUM J;  4XKV A;  2Z33 A;  4EM0 B;  4E7K A;  4KIT B;  4LG0 B;  3ZCO A;  4PSW A;  2E2I J;  3NAR A;  4QSH A;  2R7O A;  5D8L B;  4E7I A;  4EJW A;  1YIT I;  1MNE A;  3RIR A;  1T33 A;  3LST A;  5EYR A;  4EVI A;  5AIQ A;  5IP6 A;  1HA8 A;  1Z0X A;  5M5Y J;  4L18 B;  5HDK A;  1ETW A;  3O6B B;  2O5R A;  1YHQ I;  5DEQ A;  3QPS A;  4XKB A;  1GXP A;  1YW7 A;  2DMT A;  4W97 A;  3S2H J;  2I10 A;  1Z3Y A;  3FZV A;  3IKV A;  1APL C;  2FMY A;  3S15 J;  3IRQ A;  3CJT B;  2V79 A;  3HC7 A;  4HAM A;  4D7M A;  4E70 A;  5K7H A;  2WY7 Q;  3VSK A;  3LSP A;  3PFY A;  4HX8 A;  3JSP A;  5D6E A;  2P7C B;  4J00 A;  2E1N A;  2IA0 A;  3BG9 A;  1IRZ A;  4LB6 B;  1I39 A;  4QWQ A;  1W0U A;  4IHT A;  1ZRD A;  2LBF A;  4HNU A;  2HEO A;  1X3U A;  3LSH A;  2XKP A;  2XAQ A;  5J8C A;  1HXD A;  3WTS C;  1MH4 A;  5ILS A;  1G6N A;  3NQO A;  4J01 A;  2LH9 A;  2ID3 A;  3HGG A;  1TNS A;  3ZQQ A;  3FXU A;  3GTL J;  1H88 C;  2XF6 A;  2GBY A;  2BY3 A;  2VBX A;  2IAI A;  3JW4 A;  2WAQ A;  4C30 A;  4RBO A;  2O6G E;  3K2Z A;  1IO2 A;  1TT0 A;  2CW0 F;  1T6S A;  3S2W A;  1P9Q C;  1IN6 A;  2BYV E;  4P1W A;  1G4D A;  2AXL A;  1A6I A;  1FTZ A;  1SD6 A;  1B72 B;  1C0W A;  2CQN A;  5AIP A;  1IZ1 A;  1UG0 A;  3F3X A;  4C2T A;  1T95 A;  4A3B J;  1Z1D A;  2GIZ A;  2EB7 A;  3OS1 A;  4BYY A;  4BJ5 C;  3W6K B;  1I5Z A;  3HBL A;  4HEA 2;  2RAE A;  4G6D A;  4A12 A;  1LQ1 A;  2OQG A;  2XAF A;  1K79 A;  2F6C A;  2HNH A;  3OYM A;  3BJ6 A;  3L2R A;  3K4L A;  4F7Z A;  2QA4 I;  5FLX K;  5F0F A;  2BHZ A;  3HKZ N;  1JKO C;  3ZMT A;  4IHV A;  4OMY A;  3E6C C;  1B59 A;  4E7J A;  3G73 A;  3EDP A;  2OCE A;  6PAX A;  1YO5 C;  5C3E J;  3R4K A;  1F9N A;  3F72 A;  5H20 A;  3ABK H;  5K7Z A;  2HVQ A;  5EGO B;  1JT0 A;  1TWF J;  2KLO A;  5CQG A;  2WC2 A;  2Y0S N;  1A6Q A;  2ZJQ F;  4KDP A;  1R4M B;  1DQU A;  2E35 A;  5CKT A;  2C6Y A;  5E18 F;  5J4V A;  2X1E A;  2KT0 A;  3OR1 C;  3GFI A;  1Z7U A;  2GAU A;  1XTA A;  4G7H F;  2R7Q A;  3LSI A;  3FK6 A;  3IL2 A;  3KP4 A;  3PSF A;  3ERM A;  3CCJ I;  3WOD F;  2K9M A;  4EGZ A;  3BDD A;  4B43 A;  3I53 A;  1MNM C;  2MBF A;  1WJE A;  5F1R A;  1ZG1 A;  2CW8 A;  3HIF A;  4CYC A;  2M2E A;  1Y1V J;  3BR0 A;  3BT9 A;  2L7K A;  2CU7 A;  4HF2 A;  3ZQF A;  3IAS 2;  4MQV A;  2VC1 A;  3MZ8 A;  4LJZ F;  2PQ8 A;  1QQI A;  1O3S A;  3K70 C;  2V6C A;  3TDZ C;  4MEX F;  4BNC A;  2IS2 A;  4CCO A;  2X6O A;  4ITV A;  4GXO A;  3JRC A;  2DA7 A;  5IYC J;  3OYN A;  4AIK A;  1ERD A;  4G9Y A;  1QZZ A;  1MJ9 A;  1QRY A;  2FML A;  3ABU A;  4PGG A;  2RV8 A;  3J80 K;  2EZK A;  3OYL A;  2CJJ A;  1XDS A;  3B6A A;  3CP8 A;  5LHG A;  4RGU A;  2IS6 A;  1SAX A;  1P4W A;  3ZOB A;  1KU9 A;  3H9G A;  4OIP F;  3WTX C;  1OCT C;  2EIJ H;  3OYH A;  4XRS A;  2OUM A;  2HKX A;  5CVJ A;  3PNV A;  2FBH A;  3E97 A;  3OYD A;  3HRM A;  3NEU A;  1K7A A;  4EAT A;  2BBY A;  4ZJZ A;  4BEH B;  2KL4 A;  3RQ4 A;  3ESW B;  4AIJ A;  1X1P A;  3SJM A;  3JRI A;  3CLO A;  1XDU A;  3ML6 A;  1AU7 A;  3K4M A;  2EFW A;  2TCT A;  1OIS A;  1QZE A;  5EEA A;  3PNY A;  1TZL A;  4G94 A;  3SQN A;  4DYQ A;  2HWV A;  4LLG F;  1U9N A;  3KEQ A;  5HLH A;  1ZN2 A;  3JTH A;  5JVG F;  1E3P A;  5LRR A;  2EZI A;  2HTS A;  2JQ7 A;  2LOO A;  1X19 A;  2CMP A;  4IJA A;  3TKY A;  2ESH A;  3O3K A;  3VPR A;  1GLN A;  2DA1 A;  1EH8 A;  1AKH A;  3IC7 A;  1ZTR A;  1YX5 A;  3H0G J;  4R8H A;  1BR4 A;  5DYM A;  1I3Q J;  3R0A A;  4F3Q A;  4JX5 A;  1B8I A;  3LQQ A;  2DFE A;  2LRE A;  1D0X A;  4EEF G;  3CJN A;  1H8A C;  1X3Z B;  1K4S A;  2IGK A;  2PMZ N;  4B48 A;  3MCZ A;  1YOV B;  1BR2 A;  2VB6 A;  1B8I B;  1J2X A;  5E17 F;  3QPH A;  3OSG A;  1JI8 A;  2JA8 J;  5H2F C;  2F5E A;  2ELK A;  2GQQ A;  5F0H A;  5KHD A;  2XKO A;  2DJN A;  2ZFW A;  2XAG A;  5K5Q A;  1BIA A;  4GYG A;  3WU2 C;  1S9H A;  1Z7L A;  3GLL A;  1W36 D;  1RNL A;  3J81 K;  3RZD J;  1OCP A;  2F48 A;  3IH2 A;  2P6T A;  2PJR B;  1V4R A;  5CVI A;  4LIV A;  2JT1 A;  1MBH A;  3RCO A;  5LEJ A;  2WV1 A;  5F1J A;  1IC8 A;  3IH4 A;  1IUF A;  2CUF A;  5J3L A;  4HST A;  2KDZ A;  3HUG B;  2XIG A;  4II3 A;  2QWW A;  5FLM J;  2HOT A;  4B3A A;  1VQK I;  1FMV A;  2ID6 A;  3B02 A;  3QU3 A;  1Z6T A;  2IGM A;  3JRH A;  1ON1 A;  5KAF C;  2M34 A;  3RYP A;  2E2H J;  3HKZ A;  2HR3 A;  2IW5 A;  3P9I A;  3DTI A;  1V54 H;  3FIS A;  3HTS B;  3TGN A;  4B1R A;  2LKP A;  2B7E A;  3HTU A;  3CCY A;  3MFK A;  2Y0S A;  2MYS A;  4MIM A;  4UUS B;  4CGZ A;  1M1E B;  2K02 A;  2DTZ A;  4IL6 C;  5J47 A;  3CC2 I;  2I8D A;  1SFU A;  2MW8 A;  3C7J A;  3HRU A;  4XNF A;  3TBI A;  3V4G A;  2ZJR F;  3A01 B;  1R22 A;  4KUM A;  3F0C A;  4PJL A;  4IOC F;  1MD0 A;  4IQ4 A;  5HS8 A;  3O2P E;  2FF4 A;  1T38 A;  4ZZD A;  2R7S A;  4XK4 A;  3S17 J;  1UCR A;  2DOE A;  2OZU A;  4ZYD A;  2V9V A;  3BTI A;  4HSR A;  1IRG A;  3TOB A;  2OQR A;  3BPX A;  4HBL A;  4IHX A;  1LVK A;  2Z1D A;  2QYO A;  2VT2 A;  3N4M A;  1TLH B;  2BY0 A;  3PSI A;  4ZDO A;  3CC7 I;  2PJR A;  2DMU A;  2LK2 A;  2MD5 A;  3MEX A;  3FIW A;  3FM3 A;  1OR7 C;  1O3T A;  3KPH A;  5ED4 A;  3IWF A;  3HOZ J;  3TQN A;  2M1B A;  2UV1 A;  5LHH A;  3HUG A;  2RC4 A;  5D8K B;  3HHG A;  2DU9 A;  4MTD A;  4HDU A;  4EV0 A;  2R3S A;  4KN7 X;  4ZZL A;  1ETX A;  4JOM A;  1QU3 A;  3HJE A;  2VJ4 A;  2XF7 A;  3BPV A;  4XBF A;  1T0F A;  3SXY A;  4XOP A;  1FBQ A;  5GAH J;  2CQK A;  1X1B A;  3KLN A;  3P5J A;  3Q0U A;  3R60 A;  1UG2 A;  2K3P A;  1KQ0 A;  2VC0 A;  1S7E A;  2PX9 A;  3MKZ A;  1G3T A;  3H9J A;  5E3O A;  4IRH A;  4KJZ A;  1TBX A;  3DBR B;  2E5Z A;  1Q1V A;  1YLF A;  2ESN A;  3GZ6 A;  3X2Q H;  4E6K G;  1WZ2 A;  1U8R A;  1LEB A;  3A01 A;  1XCV A;  1Y39 A;  1VTN C;  2K86 A;  4FTH A;  2F4M B;  4CCK A;  3GFL A;  1O57 A;  4RAY A;  4B44 A;  3GTQ J;  1BA5 A;  3SFI A;  5CVR A;  2VOO A;  5IT9 K;  1ZRF A;  5TJJ A;  2OJE D;  5LGT A;  2CFO A;  1LUJ B;  4F93 B;  2NOJ B;  4RGS A;  1RR7 A;  1X4P A;  4AVZ A;  3FWE A;  2CV2 A;  1F36 A;  4FE4 A;  1BJA A;  1TL8 A;  2E1O A;  5ICF A;  2XGC A;  3ABL H;  1FBS A;  3ISP A;  4DQ2 A;  5IT3 A;  3DEU A;  1ZR2 A;  2ICW G;  4Y17 A;  4PK4 A;  4UB8 C;  4M6X A;  1XMK A;  3CF5 F;  2MSY A;  1N25 A;  1BC7 C;  1B1B A;  3MVP A;  1GDT A;  2ZSH B;  1EJ9 A;  1HDD C;  2W1O A;  5IP9 J;  1EKE A;  3FHZ A;  3FX3 A;  3Q9S A;  1FOX A;  2M30 A;  2W82 A;  5LHI A;  4GFB A;  2FXA A;  4M72 A;  2B0L A;  1ZKG A;  2FU4 A;  1J0R A;  2ADU A;  5E8I A;  3I4P A;  1LB2 A;  2JUG A;  2K3F A;  2QBY A;  4DBQ A;  3H5N A;  5EEG A;  1FPQ A;  2HS5 A;  3K10 A;  3LSJ A;  3WHB A;  2WAD A;  3HOW J;  2W57 A;  5JFR A;  2E60 A;  4Z6Y A;  4JK1 X;  5HOO A;  1VI0 A;  1E3H A;  3BR5 A;  5D5V B;  2ZME A;  3GVA A;  2A5Y B;  3M8J A;  2R7D A;  1RKT A;  1XGO A;  2JSP A;  4A6E A;  3IHU A;  2L2O A;  1ORK A;  2WB1 A;  2XGD A;  4LOC A;  2P6S A;  4Q48 A;  3V7R A;  5JVT A;  4I0A A;  2IP2 A;  5ICG A;  1JGG A;  3P9K A;  3EQL F;  4BBR J;  4A3C J;  3KZI C;  3DF8 A;  2VKV A;  2VPR A;  4F52 A;  2W7N A;  1EH6 A;  2GOX B;  4PGH A;  2QKL B;  4X1E A;  3QP5 A;  1OKR A;  4YFX F;  2KPM A;  2FUG 2;  2K5C A;  5J1Y A;  3L00 A;  3F22 A;  1VQM I;  2WTE A;  3F8M A;  1KQ8 A;  3E5X A;  2W00 A;  2R7T A;  3E6M A;  3SHF A;  2DA5 A;  1FYM A;  3M4O J;  3ZMV A;  1WSU A;  1XMA A;  1TNT A;  3D1N I;  3M07 A;  3OMY A;  2HYG D;  3GZN B;  1CF7 B;  3JRE A;  3HSR A;  1KU7 A;  2IVM A;  3LFU A;  4R1H A;  5FKO A;  2KP6 A;  3N97 A;  3HSF A;  3IWZ A;  3K4B A;  2EJR A;  4Y13 A;  3CMA I;  1EF4 A;  4AUX A;  2ECC A;  1GVJ A;  3HHH A;  1OYW A;  3L09 A;  2GLO A;  2Y2Z A;  3K6G A;  4QLC U;  1XC5 A;  1OFC X;  2X1C A;  1FT9 A;  2OU2 A;  1GV5 A;  2ZSI B;  4UHT A;  5FKL A;  2O0Y A;  5GTH C;  1XSD A;  4P5O A;  2ZBK A;  3HOT A;  2R7Z J;  5GPA A;  1HKS A;  1POG A;  1UB9 A;  4F92 B;  1LFU P;  1IAW A;  5BPI A;  2JVG A;  3RJP A;  1BR1 A;  2F4O B;  4IX7 A;  4OIN F;  3DU6 A;  4FQG A;  5CVU A;  4GCV A;  2HVS A;  2MA3 A;  2QSF X;  1MBE A;  1AHD P;  3K4J A;  2BY1 A;  3DPL C;  1A31 A;  4BKX A;  1S7A A;  2ZXJ A;  3MZY A;  5E79 C;  3MZH A;  3HGY A;  2QQ9 A;  3AAF A;  4CYD A;  1T8I A;  2A5W A;  2WV0 A;  3IV5 A;  2QSG X;  4BL0 B;  5L3G A;  2YU9 J;  3VFZ A;  2VOD A;  2KIF A;  3DV8 A;  4S0H B;  2FBK A;  4YFN F;  3K70 D;  4A3J J;  3PQJ A;  3MN2 A;  4N9I A;  3FK7 A;  3FXK A;  3Q5F A;  1CF7 A;  1LKX A;  1HLV A;  3DLA A;  4B8X A;  3I4N J;  3QAH A;  1U5T C;  3CMM A;  2JRM A;  4NC7 A;  3JAM K;  3LNQ A;  2XV4 S;  1E3O C;  3OOU A;  2D2W A;  1HCR A;  3GWZ A;  4A0X A;  5EZH A;  4A3D J;  1ZG3 A;  1PUF A;  1N78 A;  2ZFU A;  1N75 A;  4OMZ A;  1R1T A;  2RDP A;  4I99 C;  4O5V A;  3TED A;  1HC8 A;  1QVT A;  3HOU J;  1JT6 A;  5FKK A;  1TP4 A;  2R93 J;  3BP8 A;  3TO9 A;  4FT8 A;  3VDX A;  3BQZ A;  4QTR A;  3BG5 A;  1SD7 A;  3HRT A;  3RI4 A;  1WGX A;  1Y8R B;  2A6E F;  1K78 A;  2VT3 A;  2JPB A;  2WBM A;  2CFX A;  2YUS A;  5GAE J;  1XGS A;  1YW9 A;  1E0E A;  5J6X A;  1OMI A;  4FE7 A;  4CA0 A;  5FJ8 J;  2OF7 A;  2X6Y A;  4XLA A;  1B9N A;  2XPV A;  2GZW A;  2IXS A;  4WXC A;  1KYW A;  3K7A J;  3MMY B;  2OTL I;  2HQR A;  4B09 A;  4HYE A;  2G7U A;  1O4X A;  2LNB A;  1R1U A;  1R5I D;  4L9T A;  5FKM A;  2DTR A;  2RKH A;  3KX2 A;  4AD9 A;  1K6O A;  4NBQ A;  3E5Q A;  1S8N A;  3S1R J;  3WTT C;  2X85 A;  3GF2 A;  2VLA A;  1VQP I;  4O6J A;  4LIT A;  2M0C A;  4A5M A;  3KEY A;  5M5W J;  2YS9 A;  3CUQ C;  2NNY A;  1IN5 A;  1OYY A;  4G12 A;  3VB2 A;  1H9T A;  2RGV A;  4DBR A;  2EV6 A;  4ETS A;  2NVY J;  4I98 B;  2PFB A;  1W5T A;  5FFZ A;  2W25 A;  4X0G A;  4V2G A;  3OR2 C;  3H5A A;  1IV6 A;  2HFH A;  5L3F A;  4EJO A;  1HST A;  2L7F P;  2DA4 A;  4EJT A;  4XL9 A;  1U9O A;  1Z3X A;  3ASO H;  3F6V A;  4Q47 A;  4O3M A;  1R6R A;  4I0B A;  1WH5 A;  2M4G A;  4XLN F;  1OLT A;  2E7W A;  3ZQH A;  4BUP A;  4E7L A;  3K69 A;  2VOP A;  5LBQ A;  2DN0 A;  3PNT A;  4L9V A;  1VZ0 A;  3HB9 A;  2Z16 A;  1T56 A;  1QNT A;  2LR8 A;  3BQY A;  3TMO A;  4L5E A;  1I1G A;  1WJA A;  5HS7 A;  1WHU A;  4IRG A;  5IOY A;  3I0T A;  5IPA A;  1TWH J;  2P5V A;  3FXL A;  2NS7 A;  5M5X J;  4C9Y A;  3WU1 B;  2JVH A;  2M8G X;  4JX6 A;  5AON A;  2VBZ A;  1VQ8 I;  2XHK A;  4BH9 A;  1WI3 A;  3LSR A;  4LFU A;  1SAN A;  3UKG A;  1R00 A;  3DWL E;  2DQR A;  2OCC H;  2RN7 A;  4CHU A;  1WPK A;  4HLX A;  2M3A A;  1IRF A;  1YW8 A;  2Z3Y A;  2M87 A;  4NDL A;  5E1W A;  3FHN A;  4CYC B;  3I58 A;  2QCO A;  3R0J A;  4N4N B;  3CD6 I;  1T98 A;  2KQR A;  1ZLK A;  4OIO F;  3REO A;  1FJL A;  1QO0 D;  2X51 A;  4G6Q A;  1D5Y A;  2VQL A;  3BRO A;  3NWS A;  4U7D A;  1YG2 A;  3DEE A;  5LGN A;  2DDA A;  3MD2 A;  5H6Q A;  5B1B H;  4S04 A;  1V5F A;  1FY7 A;  3FF5 A;  2TDX A;  4FX0 A;  2XAU A;  2H6B A;  4S05 A;  3A0H C;  3ZP5 A;  3FM5 A;  1R71 A;  3DLL F;  3KET A;  3V7S A;  2VKD A;  2HDD A;  1YTY A;  1HBX G;  3H5R A;  3I4M J;  4XRS G;  2DMQ A;  2PEX A;  1GT0 C;  2LMD A;  2V1X A;  3FMR A;  1E17 A;  1QA6 A;  1VQN I;  2P4W A;  5FLX Z;  3PL8 A;  2QUF A;  1VQL I;  1VQ6 I;  1TQP A;  3H92 A;  2UXX A;  3WE3 A;  4C3I J;  3VYR B;  4A93 J;  2LTP A;  1UHS A;  3J7Z I;  4HLY A;  5J4Y A;  2DBB A;  2EV5 A;  1I50 J;  3I54 A;  2ZCW A;  1ZRC A;  2Y48 A;  2GXB A;  2L7M P;  2LC2 A;  3B6C A;  4D9J A;  2A3S A;  2ETH A;  1O7F A;  3DKY A;  1YI2 I;  3KZZ A;  2JA6 J;  2DT6 A;  1K6Y A;  4BQO A;  3HZJ A;  2BW3 A;  5FFX A;  3R61 A;  2IS1 A;  1SFX A;  2L5Q A;  2L9V A;  3OL4 A;  3GUD A;  4WF2 A;  4XIC A;  4XLH A;  5JHF A;  3G1O A;  5LD2 C;  3S1Q J;  1S6L A;  1ENH A;  3QQA A;  2XVC A;  3W2W A;  4RM3 A;  3G1M A;  3QU6 A;  3GFM A;  4C3J J;  2QLZ A;  3B73 A;  5F0C A;  1X4O A;  2FNP A;  2ZNY A;  3E6D A;  4CZC A;  1AKH B;  2EFO A;  3U1K A;  4RLF A;  3PO3 J;  4MTE A;  1MGT A;  4M9X A;  1WRJ A;  1VFC A;  2KKO A;  3T8R A;  3GCM A;  2QVO A;  1IRX A;  2F5F A;  2YX4 A;  4XKC A;  2IA2 A;  4LMY A;  4QPO A;  3V8J A;  3FXO A;  2CQX A;  4AYB N;  2KIQ A;  2L3D A;  3WTY C;  3I56 I;  1ZR4 A;  1ACI A;  4U0W A;  3LOC A;  1PVE A;  3VOE A;  2BXY A;  5KK1 A;  5TIS C;  2MD0 A;  1Y56 A;  1S72 I;  3LA7 A;  1DGR M;  2NNN A;  4BE0 A;  2HOA A;  4G8X A;  1AWC A;  3NRV A;  3T8T A;  1FEX A;  2BXZ A;  4A0Z A;  2LDU A;  2DW4 A;  1BN5 A;  1QHH D;  4LK1 F;  3J80 Z;  2H1K A;  2HPI A;  3FXM A;  3GTO J;  2DOD A;  4GO1 A;  5DUK A;  3RTR A;  1KYZ A;  3BLY A;  4A0Y A;  1YS6 A;  1ZGJ A;  2RQQ A;  2K9L A;  3F8B A;  2PN6 A;  2E36 A;  4A3E J;  4XID A;  1F5T A;  3DQV C;  5K1Y A;  3JCU C;  4ESB A;  5B3S H;  3CC4 I;  1FOK A;  2NVT J;  3E0J B;  2LKS A;  1NG7 A;  2RNG A;  1X3W B;  4XRM A;  1UMQ A;  3ZGK A;  3BR2 A;  1SMY F;  2CWE A;  2X6W A;  4QIW N;  5K5R A;  1W0T A;  4MGR A;  1SMT A;  3BWG A;  2Q2E A;  3HRS A;  2XGX A;  3I5U A;  2Y31 A;  5DD4 A;  3K4N A;  4Z2Y A;  2EPF A;  2WAE A;  2EFN A;  4M3D A;  4XLF A;  2W48 A;  3C2G A;  2GOM A;  4C3H J;  5K7F A;  5FGM A;  1VND A;  4A3M J;  3KP2 A;  1DU0 A;  5IOZ A;  1UHM A;  4UXN A;  2O9L A;  4IHW A;  3D5R C;  3E6B A;  3E5U A;  5ILU A;  1KU2 A;  1Z21 A;  1IF1 A;  2BOL A;  2DYS H;  4ZDL A;  1LFB A;  2MLK A;  1P6R A;  4JQF A;  1OCO H;  4U88 A;  1WJD A;  3SDG A;  1HSJ A;  5E1X A;  1XN7 A;  2FEZ A;  3AKZ A;  4A6D A;  4A3I J;  3JRF A;  4WCG A;  4ENJ A;  1MSF C;  2EZH A;  2DFI A;  1OQY A;  3CO7 C;  1K61 A;  1RUO A;  3BCB A;  4I02 A;  5HNF A;  1OCC H;  1Z05 A;  4DIQ A;  2ZXI A;  2ACJ A;  1J75 A;  4IRI A;  3BR1 A;  3CDI A;  4D5C A;  1IN4 A;  1MMN A;  5HNH A;  1IN7 A;  4A5N A;  5KNL A;  1WKM A;  4IF4 A;  3G71 I;  1YX3 A;  2YSR A;  4AIH A;  2JPC A;  1Y6I A;  4B47 A;  1RET A;  5DCM A;  3PUB A;  3LAP A;  2WB1 N;  3CME I;  4IXA A;  1R7J A;  3C3W A;  5LGU A;  1Y1W J;  5BPD A;  1FWZ A;  1OCR H;  3J81 Z;  5FB2 A;  3K2A A;  4XLC A;  1HF0 A;  2K9N A;  2R7F A;  2M0M A;  2KZV A;  2YX7 A;  1D0Y A;  1IDY A;  1R5H A;  2E5N A;  4MFE A;  2QM3 A;  1X2N A;  3S93 A;  3F21 A;  1EA3 A;  4P9F A;  3RKQ A;  2ZJ2 A;  2ZXW H;  3HPH A;  2JTV A;  1JKP C;  2M9H A;  3HOS A;  2E71 A;  2KHM A;  4DOZ A;  4XRF A;  2A68 F;  3BG6 A;  3FXR A;  2KIS A;  1GXQ A;  4RDU A;  1DP3 A;  4I7H A;  2KJC A;  4YEJ A;  9ANT A;  4ENK A;  4M6Y A;  1OR7 A;  4V19 K;  3FXQ A;  1IW7 F;  2DFH A;  3JR9 A;  1SD4 A;  2V6E A;  3L1P A;  1KZH A;  3DTK A;  4NQW A;  2K40 A;  4ZC3 A;  4HF0 A;  2GA2 A;  2FSW A;  4BE2 A;  1I6X A;  5CJ9 A;  2PMU A;  1ZLJ A;  4EM1 A;  4BY1 J;  5D6F A;  2IPQ X;  5ICC A;  4I01 A;  5C4J J;  4OIQ F;  1LNW A;  4XSZ F;  3LMM A;  2FQ4 A;  3Q3S A;  4I6Z A;  4RM2 A;  4ESF A;  2JA5 J;  1JUM A;  2XSJ C;  5E3L A;  1H9G A;  4W1U A;  1PP8 F;  1CGP A;  3KIO A;  1BI3 A;  4XLE A;  3AL0 B;  1UZC A;  2CYY A;  3FBN B;  3WTW C;  4UB6 C;  3JRD A;  2LP0 A;  2OTJ I;  2EV0 A;  1LVA A;  3OYJ A;  3BJO A;  1U3E M;  3A2K A;  2HTJ A;  3QWL A;  4HG2 A;  3JRB A;  3GTP J;  2FQ3 A;  3DCF A;  4CSW A;  5J40 A;  4JX4 A;  1TTY A;  3EET A;  5KVR A;  1MDM A;  4OIR F;  3HSE A;  2QQA A;  2R7X A;  1D1C A;  5GTI C;  2VQC A;  3IKT A;  4FCY A;  3HEF A;  5EZG A;  2VJJ A;  3AG3 H;  3LSM A;  4AYB A;  4EM2 A;  4YEL A;  4DNC A;  2K9Q A;  1H89 C;  2RQP A;  5GAG J;  4FX4 A;  3M9A A;  5F6F A;  1J59 A;  3H9Q A;  5DUI A;  2EIL H;  1IJW C;  4Y4R A;  3H3V K;  2QBY B;  3KLO A;  2VIX A;  2DFF A;  4ZYA A;  1PP7 U;  2R5Y B;  3S14 J;  2COM A;  3P7N A;  4M73 A;  4KT6 A;  2TRT A;  2EIM H;  3S8P A;  3W6V A;  1IN8 A;  1NH3 A;  1LDK B;  1QPM A;  1W4M A;  2ZME B;  1IXR C;  2DOF A;  3E7L A;  4UVA A;  3IH3 A;  1O3R A;  5CVV A;  5HLI A;  1O3Q A;  4BXX J;  2P5L C;  4U87 A;  1OCZ H;  1S29 A;  3QYF A;  2E34 A;  1T08 B;  2JJ7 A;  1OYI A;  4OAY A;  3ASN H;  1YJW I;  4XN3 A;  2H8R A;  1ONV A;  2QF7 A;  2DXI A;  3PIP F;  1ZAR A;  4PJN A;  5E8G A;  1IDZ A;  3S3O A;  1KON A;  3A0B C;  5IT9 Z;  2FA5 A;  2LY9 A;  4RAZ A;  2WAF A;  3G4S I;  1TWC J;  1ODD A;  3I59 A;  2EIN H;  3H1C A;  2Q8K A;  2STW A;  2F5C A;  3C2H A;  4BQQ A;  5GAD J;  2LLK A;  4G7Z F;  3GYH X;  3LQR A;  2XRL A;  4F55 A;  1HW1 A;  4XN0 A;  2Q0O A;  3L2Q A;  5GPC A;  1W7P D;  2H8W A;  3GBG A;  2ME0 A;  4P55 A;  1JJ6 C;  4RLQ A;  1ZRE A;  4P9U A;  1ZQ3 P;  1MBJ A;  1XSV A;  1UFM A;  5CYV A;  5DM7 F;  2EZL A;  5TGT A;  4WX9 A;  2E1M B;  2R5Y A;  4L5J A;  2MG4 A;  3S32 A;  3A03 A;  2BY2 A;  4H4K C;  4KT5 C;  3PO2 J;  3TL4 X;  1QVU A;  4IHS A;  4A3F J;  2LSO A;  1I6H J;  4E7Z A;  4X6A J;  3CCM I;  3C18 A;  4BQA A;  4D5F A;  1OJL A;  1JHH A;  1BIB A;  2HVR A;  4WXH A;  1SVM A;  3QRF F;  2EA4 A;  2EA2 A;  3U21 A;  3Q0V A;  4UV8 A;  3QP6 A;  1MMS A;  2FE3 A;  3OYB A;  2V4J C;  4HQE A;  2LKX A;  2STT A;  4YIF A;  5FRM A;  2HYF A;  3BG7 A;  3RKW A;  4JP0 A;  3DKW A;  2GXG A;  2MGQ A;  4CH7 A;  5DDG A;  2AXT C;  2BE5 F;  2UUZ A;  4CCL A;  1S7O A;  2EH3 A;  2HYJ A;  3WGH A;  4UNO A;  2QGU A;  2IS4 A;  4ANJ A;  1LJ9 A;  5D5W B;  2AS5 F;  3S2D J;  4DW6 A;  1ZGA A;  1WWX A;  3DEW A;  4RB0 A;  4RMN A;  3O8H A;  1MSE C;  1ZYR F;  2K4B A;  3VYS B;  1WVR A;  2JA2 A;  5J1R A;  1NK2 P;  5J1U A;  1WJ5 A;  4EJU A;  2Y9Z A;  1VQ4 I;  3KYC B;  2A05 A;  1A35 A;  1AA7 A;  4ZYG A;  1G3Y A;  2J5P A;  3M8F A;  2W4S A;  3PFI A;  1PUF B;  3CZ6 A;  1ETO A;  4ENN A;  3VSL A;  1KU3 A;  2A6H F;  4AC0 A;  4AWX B;  3OYK A;  3OIO A;  4LG3 A;  3KP3 A;  2EFQ A;  2AHQ A;  2VXZ A;  4RA2 A;  1P92 A;  4UY8 I;  4M74 A;  3LL7 A;  4MLO A;  1LFP A;  1JHF A;  1U5T A;  1EV7 A;  2L01 A;  3WG7 H;  2YPR A;  3IAM 2;  3CUQ B;  2O7O A;  1K78 B;  1QZY A;  4CZZ A;  1MMG A;  2VPL A;  2MH2 A;  3CMY A;  2RVC A;  4M3F A;  5JLW A;  3SDB A;  1QGP A;  5E20 A;  4YIR X;  3GTG J;  4B4C A;  1VQO I;  2V9P A;  1YIO A;  4GYI A;  2NS8 A;  3S1N J;  5H6R A;  4RGX A;  1LE8 B;  1BBY A;  3C1D A;  5ERI A;  1XGM A;  3BZC A;  1RES A;  2VBY A;  1MW7 A;  3HPG A;  3PUF A;  2EFP A;  2GWR A;  2ZXH A;  2ISZ A;  3OL3 A;  4DJA A;  1FYL A;  2CG4 A;  1PUE E;  1FIP A;  1W7P B;  3K4K A;  1Z77 A;  4NNJ A;  5JLX A;  5ILV A;  1U2W A;  1YS7 A;  2VQH A;  1JTY A;  1BM9 A;  1TW3 A;  4RAF A;  2VJI A;  2ELH A;  3CCU I;  2A6T A;  3W6J B;  2LF8 A;  2XAS A;  1SFE A;  4YG2 F;  3OYA A;  1I27 A;  3E3V A;  1HQC A;  4ASN A;  1YQA A;  2X4H A;  3OYG A;  2Y0M A;  4DYC A;  5HOD A;  1K83 J;  2R7R A;  1RIO H;  5LRS A;  4ZTJ A;  1H0M A;  4BDY A;  2O61 A;  2CSO A;  2VE8 A;  2CO5 A;  3KP7 A;  5CQE A;  4HNT A;  2XC7 A;  4KIG A;  3JAM Z;  1MKM A;  1G3W A;  1TQM A;  4XON A;  4XR6 A;  2KRH A;  4NHJ A;  3BTJ A;  1DUX C;  2L0K A;  1DGW Y;  5C44 J;  4L9J A;  3EYI A;  2X48 A;  5E3M A;  4UUV A;  1CQT A;  1U78 A;  2LY1 A;  3UR3 C;  1UAA A;  2FD5 A;  2VJ5 A;  4IHY A;  3F23 A;  3CUQ A;  5M3F J;  1XCB A;  5BMZ A;  1V5E A;  2ZO4 A;  5EJC A;  5FO5 A;  3HDD A;  4EQQ A;  4ESJ A;  1FYK A;  3GEZ A;  5FD5 A;  1FSH A;  2VI6 A;  1AOY A;  3U9G A;  1LDJ A;  1MJA A;  2CS3 A;  3I55 I;  1LE8 A;  3VOD A;  1D3Y A;  3KCC A;  3ONQ A;  2WWY A;  2KZG A;  5D4S A;  2PG4 A;  3HM5 A;  3GO5 A;  4XSX F;  5CPR B;  1W7P A;  2MC3 A;  3OYI A;  1J7K A;  2YU3 A;  5FD6 A;  5D4R A;  1MND A;  1REP C;  3QOP A;  3TO6 A;  3COA C;  1YYV A;  2IJL A;  2LVS A;  3SZT A;  3CCR I;  2F2E A;  1WJC A;  1XGN A;  3D5S C;  4HOB A;  2HGC A;  4XLP F;  3J7A Y;  3CTA A;  3CCL I;  2DA2 A;  1XX5 A;  2E7X A;  2XDV A;  5FLV A;  1HDP A;  1V55 H;  1R23 A;  3ZN1 A;  3DPT A;  3QPT A;  1EH7 A;  1T39 A;  3CO6 C;  2JK3 A;  3DPU A;  2KIM A;  1LPQ A;  2D1H A;  2V9K A;  4CO8 A;  2CRG A;  1YJ9 I;  2H6C A;  4WK8 F;  2QEX I;  4PUS A;  1UJ8 A;  2XB0 X;  4HX7 A;  3TOA A;  3V42 A;  4ZYE A;  1SFO J;  2R7V A;  1ULY A;  3LSK A;  4OU0 A;  3BR6 A;  3G2B A;  3EUA A;  1I3A A;  3ECH A;  3I71 A;  4BS9 A;  2VE9 A;  4DZJ A;  1JKR C;  5DM6 F;  3M1C A;  2JRT A;  3ZMD A;  5IY5 H;  1LEA A;  1USS A;  1DPR A;  4L9N A;  2JUC A;  2NXN B;  4KN4 X;  1RZ4 A;  2N8G A;  1DU6 A;  1JUP A;  1Z6R A;  3ZQC A;  2GIV A;  1V5G A;  4HV5 A;  4CXF A;  3GME A;  1HKT A;  3OS0 A;  2O8X A;  2DOA A;  3A02 A;  3GTJ J;  2IT0 A;  2DYR H;  3EUH C;  5A2Q K;  1Y8Q B;  4BHP A;  1JKQ C;  1QPI A;  2JSC A;  1MMD A;  2A69 F;  1SVO A;  4UUT A;  4ZDP A;  5HLG A;  3W2A A;  1J09 A;  3A1Y A;  3SYT A;  4A3G J;  2KFD A;  2VKH A;  2NVQ J;  3EUK L;  4BJ6 C;  1MJB A;  4I76 A;  5A2Q Z;  2JWT A;  1SD5 A;  3BR3 A;  4GGG A;  5CLS A;  4MQ9 F;  1PYV A;  2HKO A;  3SEZ A;  3G3Z A;  2V1N A;  3L2C A;  2P7V B;  3J7A O;  1XPX A;  2BW3 B;  2B63 J;  1YJN I;  2VBW A;  3M7G A;  1W5C C;  2H09 A;  2ZJP F;  2CUJ A;  2IA1 A;  1FZP B;  4RS8 A;  2ME6 A;  2YR2 A;  1D1A A;  4NC8 A;  1RUN A;  1IG7 A;  5M3M J;  2WA0 A;  4Q5S F;  3ZR8 X;  1Y0N A;  3ZMS A;  3F9K A;  2DT7 B;  3DU5 A;  1D1B A;  1G3S A;  5BNG A;  3HYI A;  1TWG J;  2GA1 A;  3QPL A;  4LG0 A;  3JRG A;  3IP4 B;  1L0O C;  3WU0 A;  4HNV A;  3HG9 A;  3I3L A;  4PDK A;  4H0E A;  5B1A H;  5EDN A;  4MEY F;  4WWC A;  2LYC A;  2DQL A;  2X1D A;  2VXD A;  1WQ2 A;  3RYR A;  4WXD A;  4IPA A;  2JN6 A;  4HW0 A;  2HZT A;  2VON A;  2K7L A;  4BE1 A;  2CGP A;  3S1M J;  1B6A A;  4U0V A;  1GV2 A;  2K27 A;  4A3K J;  2DPD A;  3BZK A;  4AM3 A;  5C4X J;  3H35 A;  3GLX A;  3FKI J;  4NB5 A;  2F5V A;  2H1L A;  2WY8 Q;  1S3J A;  1P4A A;  1BJZ A;  2KIU A;  4I09 A;  4KIB A;  4LGW A;  3CCS I;  3OSF A;  2V1U A;  2XAH A;  2QZ8 A;  2D1V A;  2FNA A;  3QYB A;  2DJI A;  4D7N A;  1TWA J;  2AO9 A;  3GW2 A;  1ETY A;  3P9C A;  3SZG A;  4XOR A;  3PIO F;  3S3M A;  4MHG A;  3OIP A;  4BDZ A;  1Z9C A;  3K4C A;  3ROU A;  1SAU A;  5IP7 J;  2COB A;  1MIJ A;  2HXI A;  3GTK J;  3M3Y J;  1Q1H A;  3OWT A;  3LAJ A;  4Q4Z F;  4BU2 A;  3CCE I;  2Q2E B;  2XPU A;  1B4A A;  2DMP A;  4UVB A;  1GUU A;  2XB5 A;  5FKN A;  4BXU A;  5KAI C;  2QKM B;  3KP5 A;  2M7A A;  4QPQ A;  4IOA F;  2CQQ A;  1FP1 D;  1ON2 A;  4UVC A;  1K4T A;  1D5V A;  4EGY A;  2UWM A;  2DK8 A;  2CQ7 A;  2O03 A;  2Y75 A;  4OWR B;  3CUO A;  4L0Y B;  3PM1 A;  1ZH5 A;  3EYY A;  4JYK A;  3BC8 A;  2UXN A;  4MO7 A;  1B72 A;  3E1S A;  3FMQ A;  3D0S A;  1WJB A;  4TV7 A;  1V3F A;  3OYF A;  3Q9V A;  2MH9 A;  1JXS A;  2VKE A;  4YRV A;  2B9S A;  3GTM J;  4BXF A;  3SEQ A;  4A69 C;  3ERE D;  3MQ0 A;  3BJA A;  3HXL A;  1D8K A;  4KIF A;  2HDC A;  1X1A A;  3F8C A;  3FMS A;  5DCM B;  3KE2 A;  3K0L A;  4ENM A;  5F04 A;  3RPU D;  3WGI A;  1MZB A;  1NTC A;  2HQN A;  3MWM A;  1G2H A;  4G6T B;  5EGO A;  3ZN0 A;  4HQM A;  5J8F A;  4YII A;  2Z9O A;  1VF9 A;  2A61 A;  3H36 A;  3GXO A;  4HV6 A;  3RDI A;  3CCQ I;  5JHU A;  3TW7 A;  4Y15 A;  1UHW A;  5E3N A;  1FNN A;  2ZB9 A;  3OV8 A;  3L9F A;  1E2X A;  3JRA A;  1ZAO A;  2Z2S B;  1KGS A;  3LFK A;  1F43 A;  2M45 A;  4NQW B;  1JTX A;  5BS6 A;  4C2M J;  2KRF A;  3BTL A;  1FMW A;  1U6G A;  2BZT A;  2VQG A;  2DT5 A;  5HS9 A;  3S16 J;  4BBS J;  4I2O A;  3AG4 H;  1U8B A;  2V26 A;  2IGN A;  3BZ6 A;  3L7W A;  4ABZ A;  3MKW B;  4OOI A;  4ZTF A;  1D0Z A;  2A07 F;  3CDH A;  3KFW X;  2FX0 A;  4E7H A;  1J5Y A;  5HLT A;  1YE9 A;  2K85 A;  3L2U A;  3ZQ7 A;  1A04 A;  2G9W A;  1PJR A;  2LF7 A;  4LK0 F;  1IUY A;  3GFJ A;  1IXS B;  2Z5U A;  2GM4 A;  1SFK A;  2V1D A;  1MDM B;  2LFB A;  3H0D A;  2H94 A;  2P81 A;  1FIA A;  1XB4 A;  5F64 A;  1KQ9 A;  3T5X A;  3F6O A;  2K9S A;  4P96 A;  4BEH A;  3RKX A;  2IRF G;  2L9S A;  2MC4 A;  3Q0W A;  3ZQG A;  1X1D A;  3DTE A;  3HL2 A;  4PJM A;  1FSE A;  1YIJ I;  2XPW A;  2XSD C;  5IYD J;  2BVM A;  4RB3 C;  2DA6 A;  2M4K A;  4HRI A;  5L3C A;  3W2V A;  3FKJ A;  1YRN B;  4FIS A;  2XRO A;  2W24 A;  3ABM H;  2R5Z B;  4IEJ A; 
#chains in the Genus database with same CATH homology
 3GX4 X;  1QBJ A;  5DCF A;  4R79 A;  2MLG A;  1W5S A;  2M5W A;  1DDN A;  2NAZ A;  3T0Y A;  1BC8 C;  2DPU A;  4HF1 A;  3TDU C;  1FP2 A;  1TQI A;  3K1M A;  5D5U B;  3JTG A;  5HDN A;  3M1E A;  4K2E A;  4AVP A;  2HOE A;  2H27 A;  4ON0 A;  3I59 B;  1P2F A;  1R5G A;  4RB1 A;  1GHC A;  4KMU X;  4U0Y A;  5E1Z B;  3WTZ A;  3LWF A;  3WE2 A;  4KNY A;  5HDG A;  4CDG A;  5LEK A;  4KFC A;  2M8E A;  3H3U A;  5TRD A;  3IRR A;  3K9T A;  4BHC A;  2XRN A;  2PMH A;  1JGS A;  3VEP A;  2X0L A;  5HVQ C;  3RPU A;  1BI1 A;  2DI3 A;  1ZG5 A;  3V8L A;  3MAJ A;  2VN2 A;  2JZY A;  4LLN A;  2E1C A;  3SZP A;  4LLL A;  4EJV A;  3RKY A;  2L4M A;  4N9H A;  3WTU C;  2DK5 A;  2K4J A;  4M9Z A;  3I64 A;  1BI0 A;  1ZHF A;  4LB5 A;  1YFH A;  3DFG A;  2O3F A;  1DP7 P;  1R1V A;  3KEO A;  2PJP A;  2BEO A;  3KP6 A;  2PI0 A;  2ISY A;  2BV6 A;  5ICE A;  4G7O F;  1PDN C;  4LD5 A;  2P8T A;  4RB2 C;  4M71 A;  2F5D A;  3JSO A;  5DV5 A;  5JR3 A;  5BQT A;  2L02 A;  2DAO A;  3DP7 A;  3M8E A;  1LDD A;  1U5T B;  2ZKZ A;  1BI2 A;  1NHA A;  1BOA A;  1XSX A;  4A2U A;  1FX7 A;  2BGC A;  4BAY A;  4YFK F;  1UST A;  2P5K A;  3WG9 A;  2G7H A;  3GZ5 A;  1FBU A;  4M9S A;  1Y0U A;  1F1Z A;  1J9I A;  1IXC A;  3F8F A;  2FRH A;  2OD5 A;  1FLI A;  3WGG A;  2QQB A;  4KMF A;  1RI7 A;  1I1S A;  4ZYH A;  4EMS A;  3V8K A;  2KJB A;  4CIC A;  1T2K A;  3R6S A;  1O7L A;  1KA8 A;  2W85 A;  4N0B A;  2PLY A;  2L54 A;  1STZ A;  2RNJ A;  5DD8 A;  3PQK A;  1D8J A;  3ABT A;  2XUB A;  3K1N A;  4JBA A;  4D0P A;  1TW2 A;  3ZMZ A;  1FC3 A;  1XD7 A;  1R36 A;  5L3E A;  5K5O A;  3ZPL A;  5JI6 A;  2OA4 A;  1HW2 A;  4UV9 A;  1R58 A;  5L3B A;  2DLL A;  3U2R A;  1HW5 A;  5D5X B;  2OZ6 A;  3K1P A;  3U1D A;  4FHT A;  1P4X A;  2OAZ A;  4KA4 A;  1B9M A;  3T1B A;  2EWN A;  4HX4 A;  2NS0 A;  4HZF A;  3ECO A;  5LLQ A;  2D45 A;  1WI9 A;  1JE8 A;  2FOK A;  3KZY A;  3WTV C;  3ULQ B;  2Z99 A;  3DXJ F;  2NYX A;  2W84 A;  3V7C A;  1L3L A;  3ZMU A;  3BY6 A;  2FBI A;  4U7B A;  5L3D A;  3H3Z A;  2DO7 A;  4PZJ A;  3LA2 A;  5EEH A;  1F4K A;  1HKQ A;  3ELK A;  3D5L A;  4PCQ A;  2EK5 A;  1OPC A;  2NRA C;  4KYW A;  2UZK A;  4L0Z B;  2OBP A;  2XAJ A;  4L5I A;  3TO7 A;  2L4A A;  4HDV A;  3F8N A;  2PBI A;  1DPU A;  3RPQ A;  4RGR A;  2QEN A;  3BOQ A;  4MNU A;  2ZNZ A;  3EUH A;  4KIC A;  3LA3 A;  4IVN A;  4ZH4 F;  3SFZ A;  1Z91 A;  5BOX A;  2J5O A;  4BHB A;  3OOP A;  4HA8 A;  2Z33 A;  4EM0 B;  4LG0 B;  5D8L B;  4EJW A;  3RIR A;  3LST A;  4EVI A;  5AIQ A;  4L18 B;  5HDK A;  3O6B B;  5DEQ A;  1GXP A;  1YW7 A;  3IKV A;  3FZV A;  2FMY A;  3IRQ A;  2V79 A;  4HAM A;  4E70 A;  4HX8 A;  3JSP A;  5D6E A;  2P7C B;  2E1N A;  2IA0 A;  4LB6 B;  4QWQ A;  4IHT A;  1ZRD A;  2HEO A;  1X3U A;  2XKP A;  2XAQ A;  5J8C A;  1HXD A;  3WTS C;  5ILS A;  1G6N A;  3NQO A;  1TNS A;  3FXU A;  2VBX A;  3JW4 A;  2O6G E;  3K2Z A;  2CW0 F;  3S2W A;  1T6S A;  1IN6 A;  2BYV E;  1G4D A;  2AXL A;  1SD6 A;  1C0W A;  5AIP A;  1IZ1 A;  3F3X A;  1Z1D A;  2EB7 A;  4BYY A;  3W6K B;  1I5Z A;  4G6D A;  4A12 A;  1LQ1 A;  2OQG A;  2XAF A;  1K79 A;  3BJ6 A;  4F7Z A;  5FLX K;  3ZMT A;  4OMY A;  3E6C C;  1B59 A;  3G73 A;  3EDP A;  6PAX A;  1YO5 C;  3R4K A;  1F9N A;  3F72 A;  5H20 A;  2WC2 A;  4KDP A;  2C6Y A;  5E18 F;  3GFI A;  1Z7U A;  2GAU A;  4G7H F;  3IL2 A;  3KP4 A;  3WOD F;  4EGZ A;  3BDD A;  3I53 A;  2MBF A;  5F1R A;  1ZG1 A;  3HIF A;  4HF2 A;  4MQV A;  2VC1 A;  4LJZ F;  2PQ8 A;  1QQI A;  1O3S A;  2V6C A;  3TDZ C;  4MEX F;  4BNC A;  4GXO A;  4AIK A;  4G9Y A;  1QZZ A;  1MJ9 A;  2FML A;  3ABU A;  4PGG A;  2RV8 A;  3J80 K;  5LHG A;  1XDS A;  4RGU A;  1SAX A;  1P4W A;  1KU9 A;  4OIP F;  3WTX C;  2HKX A;  5CVJ A;  2FBH A;  3E97 A;  3HRM A;  3NEU A;  1K7A A;  2BBY A;  4AIJ A;  3CLO A;  1XDU A;  3ML6 A;  2EFW A;  4G94 A;  3SQN A;  2HWV A;  4LLG F;  3KEQ A;  5HLH A;  1ZN2 A;  3JTH A;  5LRR A;  2HTS A;  4IJA A;  3TKY A;  2ESH A;  3O3K A;  1EH8 A;  3IC7 A;  4R8H A;  5DYM A;  3R0A A;  3LQQ A;  3CJN A;  3MCZ A;  1J2X A;  5E17 F;  3QPH A;  2F5E A;  2GQQ A;  2XKO A;  2ZFW A;  2XAG A;  5K5Q A;  1BIA A;  4GYG A;  1RNL A;  3J81 K;  2P6T A;  1V4R A;  5CVI A;  2JT1 A;  5LEJ A;  2XIG A;  2QWW A;  3B02 A;  3QU3 A;  1Z6T A;  1ON1 A;  3RYP A;  2HR3 A;  2IW5 A;  3P9I A;  3HTS B;  3TGN A;  2LKP A;  3HTU A;  3MFK A;  4CGZ A;  2K02 A;  1SFU A;  3C7J A;  3HRU A;  3V4G A;  1R22 A;  4KUM A;  1MD0 A;  5HS8 A;  3O2P E;  2FF4 A;  1T38 A;  4ZZD A;  1UCR A;  2OZU A;  4ZYD A;  2V9V A;  1IRG A;  3TOB A;  2OQR A;  3BPX A;  4HBL A;  2QYO A;  2VT2 A;  3N4M A;  1TLH B;  2MD5 A;  3MEX A;  3FM3 A;  1O3T A;  5ED4 A;  3IWF A;  3TQN A;  2M1B A;  5LHH A;  3HUG A;  2RC4 A;  5D8K B;  3HHG A;  2DU9 A;  4HDU A;  4MTD A;  4EV0 A;  2R3S A;  4KN7 X;  4ZZL A;  3BPV A;  4XBF A;  1T0F A;  3SXY A;  1FBQ A;  2CQK A;  3KLN A;  3R60 A;  1KQ0 A;  2VC0 A;  1G3T A;  4IRH A;  1TBX A;  1YLF A;  2ESN A;  3GZ6 A;  1U8R A;  1LEB A;  1XCV A;  1VTN C;  2K86 A;  3GFL A;  1O57 A;  4RAY A;  5CVR A;  2VOO A;  5IT9 K;  1ZRF A;  5TJJ A;  5LGT A;  4RGS A;  3FWE A;  1BJA A;  5ICF A;  1FBS A;  3ISP A;  4DQ2 A;  5IT3 A;  3DEU A;  4Y17 A;  4M6X A;  1XMK A;  1BC7 C;  1B1B A;  3FHZ A;  3FX3 A;  3Q9S A;  2M30 A;  5LHI A;  2FXA A;  4M72 A;  2B0L A;  5E8I A;  1J0R A;  2ADU A;  2FU4 A;  3I4P A;  1LB2 A;  2QBY A;  5EEG A;  1FPQ A;  2HS5 A;  2W57 A;  5JFR A;  4JK1 X;  5HOO A;  5D5V B;  2ZME A;  3GVA A;  2A5Y B;  2R7D A;  1XGO A;  4A6E A;  3IHU A;  2P6S A;  4Q48 A;  3V7R A;  5JVT A;  4I0A A;  2IP2 A;  5ICG A;  3P9K A;  3EQL F;  3DF8 A;  1EH6 A;  4PGH A;  3QP5 A;  1OKR A;  4YFX F;  3F22 A;  3L00 A;  2WTE A;  3F8M A;  1KQ8 A;  3E5X A;  3E6M A;  3SHF A;  1FYM A;  3ZMV A;  1WSU A;  1XMA A;  1TNT A;  2HYG D;  1CF7 B;  3HSR A;  1KU7 A;  2IVM A;  4R1H A;  3N97 A;  3HSF A;  3IWZ A;  2EJR A;  4Y13 A;  1GVJ A;  3HHH A;  1OYW A;  3L09 A;  4QLC U;  1FT9 A;  2OU2 A;  1XSD A;  4UHT A;  2O0Y A;  4P5O A;  2ZBK A;  3HOT A;  1HKS A;  1UB9 A;  1IAW A;  5BPI A;  3RJP A;  4OIN F;  5CVU A;  4GCV A;  2MA3 A;  3DPL C;  1S7A A;  2ZXJ A;  3MZY A;  3MZH A;  2QQ9 A;  3AAF A;  4CYD A;  2WV0 A;  5L3G A;  2VOD A;  3VFZ A;  2KIF A;  3DV8 A;  4YFN F;  2FBK A;  3PQJ A;  4N9I A;  3Q5F A;  1CF7 A;  4B8X A;  3QAH A;  1U5T C;  3JAM K;  2XV4 S;  2D2W A;  3GWZ A;  4A0X A;  1ZG3 A;  4OMZ A;  1R1T A;  2RDP A;  4O5V A;  3BP8 A;  3TO9 A;  4FT8 A;  1SD7 A;  3HRT A;  3RI4 A;  2A6E F;  1K78 A;  2VT3 A;  2JPB A;  2CFX A;  1XGS A;  1YW9 A;  5J6X A;  1OMI A;  1B9N A;  2GZW A;  4WXC A;  1KYW A;  2HQR A;  4B09 A;  4HYE A;  2G7U A;  2LNB A;  1R1U A;  4L9T A;  2DTR A;  2RKH A;  4AD9 A;  1K6O A;  3E5Q A;  1S8N A;  3WTT C;  3GF2 A;  4O6J A;  4A5M A;  3CUQ C;  2NNY A;  1IN5 A;  1OYY A;  3VB2 A;  1H9T A;  2RGV A;  2EV6 A;  4ETS A;  4I98 B;  2PFB A;  1W5T A;  5FFZ A;  2W25 A;  2HFH A;  5L3F A;  4EJO A;  1HST A;  4EJT A;  4Q47 A;  3F6V A;  4O3M A;  4I0B A;  4XLN F;  2E7W A;  2VOP A;  3K69 A;  5LBQ A;  4L9V A;  1QNT A;  1I1G A;  5HS7 A;  4IRG A;  3I0T A;  2P5V A;  3WU1 B;  5AON A;  2VBZ A;  2XHK A;  4BH9 A;  4LFU A;  1R00 A;  2DQR A;  2RN7 A;  4CHU A;  4HLX A;  1IRF A;  1YW8 A;  2Z3Y A;  2M87 A;  5E1W A;  3I58 A;  3R0J A;  1T98 A;  1ZLK A;  4OIO F;  3REO A;  1QO0 D;  4G6Q A;  3BRO A;  4U7D A;  1YG2 A;  5LGN A;  5H6Q A;  4S04 A;  1FY7 A;  3FF5 A;  2TDX A;  4FX0 A;  2H6B A;  4S05 A;  3ZP5 A;  3FM5 A;  3KET A;  3V7S A;  1YTY A;  1HBX G;  2PEX A;  2V1X A;  3FMR A;  1E17 A;  2P4W A;  5FLX Z;  2QUF A;  1TQP A;  3H92 A;  2UXX A;  3WE3 A;  4HLY A;  2DBB A;  2EV5 A;  3I54 A;  2ZCW A;  1ZRC A;  2Y48 A;  2GXB A;  2A3S A;  2ETH A;  1O7F A;  3KZZ A;  5FFX A;  3R61 A;  1SFX A;  4WF2 A;  3GUD A;  1S6L A;  2XVC A;  3QU6 A;  3GFM A;  2QLZ A;  3B73 A;  2FNP A;  3E6D A;  2ZNY A;  2EFO A;  4MTE A;  1MGT A;  4M9X A;  1WRJ A;  2KKO A;  3T8R A;  2QVO A;  3V8J A;  2F5F A;  2YX4 A;  2IA2 A;  4LMY A;  3WTY C;  2XRO A;  2L3D A;  4U0W A;  3VOE A;  5KK1 A;  3LA7 A;  2NNN A;  4G8X A;  1AWC A;  3NRV A;  3T8T A;  4A0Z A;  2LDU A;  2DW4 A;  1BN5 A;  4LK1 F;  3J80 Z;  3RTR A;  4GO1 A;  5DUK A;  1KYZ A;  4A0Y A;  1YS6 A;  1ZGJ A;  3F8B A;  2PN6 A;  1F5T A;  3DQV C;  5K1Y A;  4ESB A;  1FOK A;  1SMY F;  2CWE A;  5K5R A;  4MGR A;  1SMT A;  3BWG A;  2Q2E A;  3HRS A;  2XGX A;  3I5U A;  5DD4 A;  4Z2Y A;  2EFN A;  5FGM A;  3KP2 A;  1UHM A;  4UXN A;  3E6B A;  3E5U A;  5ILU A;  1KU2 A;  1IF1 A;  2MLK A;  1P6R A;  4JQF A;  4U88 A;  1HSJ A;  5E1X A;  1XN7 A;  2FEZ A;  4A6D A;  4WCG A;  4ENJ A;  2DFI A;  3CO7 C;  1RUO A;  4I02 A;  2ACJ A;  1Z05 A;  1J75 A;  4IRI A;  1IN4 A;  1IN7 A;  4A5N A;  1WKM A;  4IF4 A;  2YSR A;  4AIH A;  2JPC A;  5DCM A;  3LAP A;  4IXA A;  1R7J A;  3C3W A;  5LGU A;  5BPD A;  1FWZ A;  3J81 Z;  5FB2 A;  2R7F A;  2YX7 A;  1R5H A;  3F21 A;  2QM3 A;  4P9F A;  2ZJ2 A;  2JTV A;  3HOS A;  4XRF A;  2A68 F;  3FXR A;  1GXQ A;  4I7H A;  2KJC A;  4ENK A;  4M6Y A;  1OR7 A;  3FXQ A;  1IW7 F;  1SD4 A;  4NQW A;  4HF0 A;  2GA2 A;  2FSW A;  1I6X A;  5CJ9 A;  2PMU A;  1ZLJ A;  4EM1 A;  5D6F A;  2IPQ X;  5ICC A;  4I01 A;  4OIQ F;  1LNW A;  4XSZ F;  4ESF A;  1H9G A;  1PP8 F;  1CGP A;  1BI3 A;  2CYY A;  3WTW C;  2EV0 A;  1LVA A;  3BJO A;  1U3E M;  2HTJ A;  2FQ3 A;  1TTY A;  3EET A;  5KVR A;  1MDM A;  4OIR F;  3HSE A;  2QQA A;  3IKT A;  4EM2 A;  4DNC A;  2RQP A;  4FX4 A;  3M9A A;  5F6F A;  1J59 A;  5DUI A;  2QBY B;  3KLO A;  1PP7 U;  2COM A;  3P7N A;  4M73 A;  1IN8 A;  1LDK B;  1QPM A;  1W4M A;  2ZME B;  1IXR C;  4UVA A;  1O3R A;  5CVV A;  5HLI A;  1O3Q A;  2P5L C;  1S29 A;  1OYI A;  1ONV A;  1ZAR A;  5E8G A;  5IT9 Z;  2FA5 A;  4RAZ A;  1ODD A;  3I59 A;  2Q8K A;  2STW A;  2F5C A;  4G7Z F;  3GYH X;  3LQR A;  1HW1 A;  2Q0O A;  1W7P D;  4P55 A;  1ZRE A;  4P9U A;  1XSV A;  1UFM A;  5CYV A;  4WX9 A;  4L5J A;  4KT5 C;  4IHS A;  2LSO A;  3C18 A;  4BQA A;  1JHH A;  1BIB A;  4WXH A;  3QRF F;  2EA4 A;  2EA2 A;  4UV8 A;  3QP6 A;  2FE3 A;  2STT A;  4HQE A;  4YIF A;  2HYF A;  3RKW A;  3DKW A;  2GXG A;  5DDG A;  2BE5 F;  1S7O A;  3WGH A;  4UNO A;  1LJ9 A;  5D5W B;  2AS5 F;  1ZGA A;  1WWX A;  4RB0 A;  1ZYR F;  2K4B A;  4EJU A;  4ZYG A;  1G3Y A;  2J5P A;  3M8F A;  3PFI A;  4ENN A;  1KU3 A;  2A6H F;  4AWX B;  3KP3 A;  2EFQ A;  2VXZ A;  1P92 A;  4M74 A;  1JHF A;  1U5T A;  1EV7 A;  2L01 A;  2YPR A;  3CUQ B;  1K78 B;  1QZY A;  4CZZ A;  2MH2 A;  2RVC A;  1QGP A;  5E20 A;  1YIO A;  4GYI A;  5H6R A;  4RGX A;  1BBY A;  3C1D A;  5ERI A;  1XGM A;  2VBY A;  2EFP A;  2GWR A;  2ISZ A;  1FYL A;  2CG4 A;  1PUE E;  1W7P B;  5ILV A;  1U2W A;  1YS7 A;  1BM9 A;  1TW3 A;  2ELH A;  3W6J B;  2LF8 A;  2XAS A;  1SFE A;  4YG2 F;  1I27 A;  3E3V A;  1HQC A;  4ASN A;  1YQA A;  2X4H A;  2Y0M A;  1RIO H;  5LRS A;  1H0M A;  2O61 A;  2CSO A;  2VE8 A;  2CO5 A;  3KP7 A;  4KIG A;  3JAM Z;  1MKM A;  1TQM A;  1G3W A;  4NHJ A;  1DUX C;  4UUV A;  3EYI A;  4L9J A;  1U78 A;  3F23 A;  3CUQ A;  1XCB A;  5BMZ A;  2ZO4 A;  5FO5 A;  4EQQ A;  4ESJ A;  1FYK A;  3GEZ A;  5FD5 A;  1FSH A;  1AOY A;  3U9G A;  1LDJ A;  1MJA A;  3VOD A;  1D3Y A;  3KCC A;  2WWY A;  5D4S A;  2PG4 A;  3GO5 A;  4XSX F;  1W7P A;  2MC3 A;  1J7K A;  2YU3 A;  5FD6 A;  5D4R A;  1REP C;  3QOP A;  3TO6 A;  3COA C;  1YYV A;  2IJL A;  3SZT A;  2F2E A;  1XGN A;  4HOB A;  2HGC A;  4XLP F;  3CTA A;  2E7X A;  3ZN1 A;  1R23 A;  3DPT A;  3QPT A;  1EH7 A;  1T39 A;  3CO6 C;  2KIM A;  2D1H A;  4CO8 A;  2H6C A;  4WK8 F;  4HX7 A;  3TOA A;  4ZYE A;  1ULY A;  4OU0 A;  3ECH A;  3I71 A;  2VE9 A;  2JRT A;  3ZMD A;  1LEA A;  1USS A;  1DPR A;  4L9N A;  4KN4 X;  1RZ4 A;  1Z6R A;  2GIV A;  4HV5 A;  4CXF A;  1HKT A;  2O8X A;  2IT0 A;  5A2Q K;  4BHP A;  2JSC A;  2A69 F;  5HLG A;  1MJB A;  5A2Q Z;  5CLS A;  1SD5 A;  4GGG A;  4MQ9 F;  3L2C A;  2HKO A;  3G3Z A;  3J7A O;  2P7V B;  2VBW A;  3M7G A;  2H09 A;  2IA1 A;  1FZP B;  4RS8 A;  2YR2 A;  1RUN A;  4Q5S F;  3ZMS A;  1G3S A;  3HYI A;  2GA1 A;  4LG0 A;  1L0O C;  3WU0 A;  4PDK A;  4H0E A;  4MEY F;  4WWC A;  2DQL A;  3RYR A;  1WQ2 A;  4WXD A;  4IPA A;  4HW0 A;  2HZT A;  2VON A;  2K7L A;  2CGP A;  1B6A A;  4U0V A;  2K27 A;  2DPD A;  3GLX A;  4NB5 A;  1S3J A;  1P4A A;  2KIU A;  4I09 A;  4KIB A;  4LGW A;  2V1U A;  2XAH A;  2QZ8 A;  2D1V A;  2FNA A;  3GW2 A;  3P9C A;  4MHG A;  1Z9C A;  3ROU A;  1Q1H A;  3LAJ A;  4Q4Z F;  1B4A A;  4UVB A;  4BXU A;  3KP5 A;  1FP1 D;  1ON2 A;  4UVC A;  1D5V A;  4EGY A;  2UWM A;  2DK8 A;  2O03 A;  2Y75 A;  3CUO A;  4L0Y B;  1ZH5 A;  3EYY A;  2UXN A;  3FMQ A;  3D0S A;  4TV7 A;  1V3F A;  3Q9V A;  2MH9 A;  1JXS A;  3ERE D;  3MQ0 A;  3BJA A;  1D8K A;  4KIF A;  2HDC A;  3F8C A;  3FMS A;  5DCM B;  3KE2 A;  3K0L A;  4ENM A;  3WGI A;  1MZB A;  2HQN A;  3MWM A;  3ZN0 A;  4HQM A;  5J8F A;  4YII A;  2Z9O A;  2A61 A;  3GXO A;  4HV6 A;  3RDI A;  5JHU A;  4Y15 A;  1UHW A;  1FNN A;  3OV8 A;  3L9F A;  1E2X A;  1ZAO A;  1KGS A;  3LFK A;  2M45 A;  5BS6 A;  2KRF A;  1U6G A;  2DT5 A;  5HS9 A;  4I2O A;  3BZ6 A;  3L7W A;  4OOI A;  2A07 F;  3CDH A;  3KFW X;  1J5Y A;  3ZQ7 A;  1A04 A;  2G9W A;  2LF7 A;  4LK0 F;  1IUY A;  3GFJ A;  1IXS B;  2Z5U A;  1MDM B;  2V1D A;  2H94 A;  1XB4 A;  5F64 A;  1KQ9 A;  3T5X A;  3F6O A;  4P96 A;  3RKX A;  2IRF G;  1FSE A;  4RB3 C;  5L3C A;  2W24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...