2HOTA

Phage selected homeodomain bound to modified dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKNMRAKIKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*CP*CP*CP*CP*
publication title Structure and properties of a re-engineered homeodomain protein-DNA interface.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 19
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hotA00
2DJNA 5IP9J 2Y0SN 3G1MA 3WHCA 4X6AJ 1QVUA 2DA1A 4AUXA 1FTTA 1YRNA 2XSDC 2XPVA 3S16J 2ECCA 3ZQGA 2XGCA 3HBLA 3JREA 1T56A 1U78A 4CYCB 3CQZJ 2X6OA 3IH3A 3LOCA 3BR0A 2ME0A 5K7FA 3JRGA 1WCMJ 3BR1A 2G0EA 1VI0A 2DMTA 1JUPA 2E19A 5C3EJ 1MSEC 3JRDA 2ME6A 3I4MJ 4A3LJ 1IDZA 1T33A 3H3VK 4JX5A 3K7AJ 4AYBN 1BA5A 3ZQHA 4W1UA 1MH4A 1XC5A 1I3QJ 3BTJA 3S1MJ 5FKNA 3S2DJ 1PUFB 3BG9A 1AKHB 2WB1N 3S1QJ 4XRMA 3G1LA 2DA7A 1JT6A 3BQYA 1MBEA 3TW6A 4XRSA 5J1RA 2NVYJ 4M6VA 4B3AA 3GTKJ 2LK2A 3RZOJ 1ETKA 4S0HB 2HXIA 5IOZA 4CYCA 3JRFA 1WH7A 1I50J 2OPTA 2JJ7A 4FCYA 1JT0A 1ZTRA 1CQTA 2CU7A 2KDZA 1W0TA 1IG7A 3MVPA 1HDDC 3ZQFA 1HDPA 3H0GJ 3ZQIA 1RPWA 5EZHA 3OSFA 2LTPA 4MLOA 5F27A 3WHBA 1OCTC 2RAEA 3HM5A 5F0FA 3PO2J 3GTMJ 4IHXA 4LOCA 3E7LA 1QRYA 1OJLA 3BQZA 3K2AA 1ETOA 5F08A 3CDLA 3LSGA 5JLXA 5C4JJ 5IP7J 4J19A 1X2MA 1MBJA 4ABZA 2NS7A 2R5YB 4A3EJ 4Y7NJ 2COBA 2JA7J 2K9QA 2P81A 1PUFA 4C2MJ 1ETQA 5F04A 3GTJJ 2JA8J 1UMQA 4C3HJ 2CQXA 5FKKA 3LSRA 1LE8B 1U9OA 3MN2A 1IJWC 2HXOA 4DYCA 5DS9A 2NVXJ 3S15J 2EZLA 2VI6A 1JKOC 3BG3A 4M3FA 3S1RJ 4XRSG 2E2IJ 3TW7A 4DW6A 2NVTJ 2H8RA 2Y2ZA 1SANA 1JKRC 1OCPA 3HGGA 3IH2A 1HCRA 5M3FJ 1WH5A 1WPKA 3PM1A 2GBYA 1JKPC 1IV6A 2GM4A 4RBOA 1IRZA 3O8HA 3OIOA 3IV5A 3FK7A 2QF7A 2YU9J 5GPCA 5FLMJ 2YUSA 4XK4A 1SFOJ 4A3CJ 2JWTA 3W6VA 1HLVA 1Q1VA 4A3GJ 1H8AC 1GDTA 4XIDA 4QIWN 1B72A 2K9SA 2L9RA 1RKTA 1JJ6C 1GUUA 5BNGA 4XICA 2K40A 5EEAA 3BT9A 1FIPA 2AO9A 1Y1WJ 5J3LA 1IUFA 1MNMC 3OSGA 3Q3SA 2Y31A 2DA4A 4QSHA 2DA3A 2VKVA 3HOVJ 3CCYA 4DYRA 4QTRA 2TRTA 3S17J 2NS8A 3Q0UA 1Z77A 1ZR4A 1JKQC 3G1OA 1RKWA 5F0HA 4G12A 4MFEA 3HOYJ 4W97A 2HYJA 3MKLA 5EZGA 1NK2P 3JRBA 4UUSB 1DU0A 1X58A 3M3YJ 1TWHJ 5K7ZA 3PO3J 1HF0A 1VNDA 1ETYA 3JRCA 1MBKA 2ID6A 2M34A 5F1JA 4A3KJ 2IAIA 3A02A 3HOXJ 4IEJA 3S14J 3BR3A 1X2NA 4FISA 1ETWA 2ID3A 4DZJA 4JX6A 3I4NJ 3M4OJ 1LFBA 4GFBA 4M3GA 4C3IJ 4EEFG 2ZB9A 3A01B 5M5WJ 1MBHA 3FIWA 5E3MA 1I6HJ 3QPSA 4FTHA 1RETA 1LFUP 4JP0A 1ENHA 2XB0X 2ECBA 4D7NA 1RESA 2R5ZB 2X9DA 3HOWJ 9ANTA 3A03A 4M3EA 2R93J 2QCOA 5E3LA 5EDNA 4DYQA 2HDDA 3BR6A 1P7IA 1F43A 1ZKGA 2OF7A 1MBFA 2ELKA 2KT0A 4V2FA 3TP0A 1BJZA 5J1YA 4BXXJ 3GBGA 3SJMA 2M2EA 4MIMA 3LNQA 1JTXA 1AHDP 2EZHA 3HEFA 1H89C 5IYDJ 5HODA 1AKHA 3FK6A 4M3BA 4MFDA 3VPRA 3JRHA 1ORKA 1IGNA 3GTPJ 5C44J 4A93J 2FJ1A 2DMUA 4D7MA 5EGOB 5EG0B 1TWAJ 1GVDA 5IPAA 3QQAA 5FJ8J 1GV2A 3Q0WA 2HQ5A 1A6IA 3BTLA 3IH4A 1MSFC 1YRNB 2O8KA 2LP0A 4IHWA 1S7EA 1FIAA 3S2HJ 4UUTA 1B8IB 3HOZJ 1G2HA 4BY1J 3TEDA 4RDUA 4NDLA 1JGGA 5M3MJ 4C3JJ 4I76A 2R5ZA 1WGXA 4IHVA 2JMWA 4FE7A 2FX0A 3SDGA 5EF6A 4MO7A 3NARA 1JUMA 3OOUA 1EF4A 1TWGJ 1TWFJ 1ETVA 2LVSA 3HOUJ 1BW6A 3RZDJ 1BL0A 4A3JJ 2CUFA 2R5YA 1FJLA 5IP6A 4BBRJ 5M5YJ 2JN6A 3BTIA 2YS9A 3HB9A 1O4XA 5FKOA 1QVTA 4A3FJ 2B63J 2IEKA 2L0KA 1W0UA 1LE8A 1XS9A 4B1RA 3UKGA 2I10A 2EH3A 2MSYA 3DCFA 5EGOA 4IHYA 1R9TJ 5EG0A 2IBDA 1AU7A 1FTZA 2CQQA 3JR9A 2R92J 2CRGA 1Y1VJ 2L7ZA 4L5EA 1K61A 1JJ8C 5EYRA 2O9LA 2R0QC 2D5VA 1BW5A 1VF9A 2LFBA 2O7OA 2MW8A 3B6CA 1B8IA 4BBSJ 2XB5A 3O8GA 2EZKA 2FD5A 1ITYA 1MH3A 2CUEA 2EQRA 2CJJA 2JK3A 2M8GX 4BKXA 5C4XJ 2GLOA 2PMZN 2X48A 2Y9YA 3BR2A 2JA6J 5J1UA 3BR5A 4M3DA 2HI3A 5K7HA 2K9NA 4A3MJ 2M0CA 5IOYA 2FQ4A 3HKZN 3GTOJ 2WAQN 2Y9ZA 4B4CA 2L7MP 2HOTA 5FLVA 4HNVA 1POGA 3ZOBA 2EZIA 2VKEA 1TWCJ 4A3BJ 1UHSA 4A3IJ 5E3OA 2E2HJ 1ZR2A 4I6ZA 3GTGJ 5GP9A 2LLKA 2DMNA 3TP3A 2WV1A 2LKXA 1QPIA 1XG1A 2DMQA 5JLWA 3C2BA 3BG5A 3NAUA 3JRIA 1GV5A 3RQIA 2XPWA 4JX4A 1GT0C 2DN0A 4UUSA 5GPAA 2NOGA 2XGDA 2LR8A 1K83J 1H88C 2DA5A 3DEWA 3BTCA 1JUSA 2DA2A 2MG4A 2JA5J 1APLC 2LD5A 2H1KA 3FKIJ 2HOSA 5IYBJ 4BY7J 1ETXA 3Q0VA 2XGEA 1WI3A 2XPUA 4Y52J 3D1NI 1F36A 1IC8A 1UG2A 3ZQLA 1DU6A 2MGQA 5FKLA 3HDDA 2EBIA 1E3OC 3ZQCA 3A01A 2XRLA 2DMPA 1D5YA 3F0CA 1U9NA 3QPLA 1B72B 3LSPA 5FKMA 3HGYA 4A69C 3LSJA 2VUMJ 2M9HA 1RR7A 3FISA 2VPRA 2DTZA 4DZPA 5DTDA 1VFCA 3SFIA 1P7JA 5E3NA 3S1NJ 2L7FP 1Z0XA 2LY9A 3GTLJ 2HOAA 3JRAA 1NK3P 5M5XJ 1OFCX 5IYCJ 1ZK8A 4D5CA 1FEXA 1HOMA 4AC0A 2Y30A 4JYKA 2AHQA 2N8GA 2W48A 4FE4A 2E2JJ 3GTQJ 4V2GA 3L1PA 3B6AA 1JTYA 1MBGA 3CMYA 2NVQJ 1ZQ3P 5F0CA 4A3DJ 1ZGWA 1TC3C 1A5JA 2TCTA 1IDYA 2E1OA 3RKQA 4D5FA 1NTCA 1U8BA 2R7ZJ 4X1EA 2DA6A
chains in the Genus database with same CATH superfamily
3E5UA 5IP9J 4L9JA 1P92A 1QVUA 2DA1A 2Y48A 3FM3A 4EGZA 1FTTA 2BW3A 2M1BA 3K9TA 2E7XA 1QQIA 3HBLA 3K70C 4HX7A 2ESHA 3JREA 2F5DA 5H2FC 1QZYA 2P5VA 3F21A 2NRAC 1V54H 2X1CA 2GA2A 3M8FA 4EM2A 3LOCA 1Z91A 2BYVE 1T6SA 1WRJA 2Y69H 5K7FA 3S8PA 2OZUA 2XHKA 4ZH4F 3BR1A 3OYIA 1IW7F 2LF7A 2DMTA 2E19A 4I0BA 2H8WA 1YS7A 5D6EA 1LEAA 2ME6A 4UUVA 2H6BA 2KRCA 2P6TA 1OYWA 1GXPA 4RM2A 3GFIA 3MWMA 4AYBN 2BVMA 5HDNA 2MLKA 1IAWA 2HPMA 2VLAA 1I3QJ 2XROA 3CD6I 3W6JB 2DW4A 4RB2C 1S7OA 2XSJC 3M8JA 3J7AO 3S2DJ 1PUFB 4AVZA 1AKHB 5J6XA 1TT5B 3J80Z 3NWSA 1KYZA 2HVRA 3EPZA 2IT0A 2DA7A 1Z6TA 4ITVA 3TW6A 4HEA2 2HQRA 4M6VA 3SHFA 3GTKJ 2W4SA 2LK2A 1ETKA 4IPAA 2VQHA 3IRQA 1QZZA 4BACA 2XASA 1NG6A 4CYCA 3CCMI 1X1DA 1WH7A 2RV8A 3TQNA 1ZTRA 4N9HA 1J5YA 4OMZA 5LBQA 2X85A 1RPWA 3BG7A 3KEYA 4MLOA 4LITA 4PSWA 3S3NA 4F93B 2KJBA 1K6OA 3GTMJ 4S05A 2CS3A 1S8NA 3C7JA 3I59A 4LOCA 3E7LA 3KFWX 2H1LA 4UB6C 2KQRA 4XLAA 3LSGA 2YX7A 3ECOA 3ERED 5D8LB 3NRVA 1MBJA 3OYJA 4NNJA 2VIXA 1YJNI 2FMYA 4Y7NJ 2K7LA 1IN7A 2EFNA 1R7JA 2COBA 2P81A 4C2MJ 2OU2A 3A0BC 1R58A 3LSRA 2DXIA 4HG2A 1IJWC 2NVXJ 4BDZA 1KYWA 1MMAA 3BG3A 3LSTA 3SFZA 4AYBA 5HLIA 3ERMA 4P5OA 2KIMA 5L3FA 4UVBA 2NVTJ 2W7NA 3PNVA 1P4AA 1JKRC 5CKTA 3GX4X 1HCRA 3WTVC 3OL3A 2E1MB 3CP8A 3DKWA 5FFZA 2GBYA 1I39A 4CYDA 1ZGAA 4Q47A 4KICA 1FMWA 3FXKA 3O8HA 1IXRC 4XR6A 5A2QK 3J81Z 4YIRX 2A6EF 5FLMJ 1IN4A 4CCMA 2KKOA 4EGYA 3BWGA 1Z3XA 4XK4A 5JR3A 2JWTA 4UV9A 1HLVA 2KZVA 1ULYA 5FFXA 3OYCA 4QIWN 1YJ9I 3F9KA 2L9RA 2E5NA 4XICA 1ZLKA 4RLFA 3SDBA 1OCZH 1Y1WJ 2OQRA 1G3SA 2VQCA 2GOMA 3FXUA 4UNOA 4N0BA 2FOWA 3CO7C 1R6RA 4QSHA 2VBYA 1J2XA 2DA3A 4AIKA 4EJUA 2DDBA 1ZYRF 4QTRA 1F9NA 2NS8A 1ZR4A 1WJ5A 2QSFX 3OYLA 3G2BA 3PIOF 2Z9OA 4MFEA 1NH3A 4W97A 3AL0C 3MKLA 1NK2P 3K4KA 4G94A 4M9XA 4YEJA 5K7ZA 4ZYEA 1FYMA 3PQJA 1EA3A 4PCQA 1HF0A 4LG0B 1J0RA 5DCMB 4FHTA 1ETYA 3JTGA 1MBKA 5DUIA 2GWRA 4PGGA 1MD0A 5L3DA 1MDMB 3HOXJ 4IEJA 2QKLB 2W00A 4ZJZA 2YSRA 4GFBA 3KEQA 1MJAA 1WKMA 2OV7A 4HDUA 4H4KC 4EEFG 3WGHA 5M5WJ 1MBHA 2X6WA 2WY8Q 5K5RA 1ODDA 3KYDB 2ZFWA 1P2FA 3OS0A 1LFUP 2Z16A 2XB0X 3G73A 2OQGA 4D7NA 1D1BA 1Z3YA 1BI0A 2BHYA 1HXDA 3ZP5A 3HOWJ 5LEKA 1VQ6I 1HW5A 1LDDA 2DK5A 2UXNA 2FUG2 2NS0A 5FLXK 4GO1A 2MLGA 3GWZA 5KCMA 1P7IA 4EVIA 2HDDA 1FT9A 5KK1A 4KJZA 1D1AA 3DKYA 4IXAA 3Q9VA 1XMKA 1PJRA 4V2FA 3TP0A 2F5EA 1QPMA 2XKPA 1KA8A 2E1CA 4MQ9F 1KQ9A 2NYXA 3GBGA 3OL4A 1JHFA 2ZMEC 4E7KA 2M2EA 3LNQA 2UWMA 4GYIA 5HODA 3FK6A 4MFDA 4BU2A 1TW2A 3GTPJ 1W7PD 5IT3A 2X6XA 4A93J 1XDUA 3UNGC 5EG0B 1TWAJ 5IT9Z 1K7AA 1MMGA 1GV2A 4GDFA 1A6IA 1OYYA 4A0YA 1SD7A 2XC7A 3KCCA 1FC3A 5HDKA 1E3HA 4NC6A 1FIAA 3GO5A 3ZN1A 4UUTA 1B8IB 4BY1J 2V1DA 1UELB 3T1BA 1DGRM 4H0EA 2Q8KA 2M45A 2WA0A 4B3XA 5D4SA 2K3PA 2Y75A 2MYSA 2WC2A 4FE7A 2E60A 4LFUA 5DDGA 1RUOA 3FXJA 1WZ2A 1TWFJ 3HOUJ 1N25A 2L9NA 3DQVC 2ACJA 2STWA 3IP4B 2R5YA 4Y33A 1TNTA 3KZYA 3ZQ7A 1MNEA 4KYWA 4I09A 1QVTA 4A3FJ 4LG3A 4AIDA 1KZHA 4L9NA 4CA0A 3QYBA 1BI2A 1LVAA 2I10A 4RAYA 1FTZA 4E7SA 1LFPA 1U6GA 2PQ8A 2O8KA 2VONA 2R92J 4I01A 1Y1VJ 1JJ8C 3I64A 1ZREA 3RIRA 2D5VA 3F8CA 1BW5A 1WI9A 4NQWA 3T8TA 1Z9CA 1PP7U 4HNTA 2MW8A 3DBRB 3EUAA 4G7ZF 3GVAA 3E97A 3QYFA 1MH3A 2CUEA 3D5RC 3I4PA 3FHNA 2M8GX 4GCVA 2AQEA 4IHTA 5C4XJ 1D0XA 3E6DA 4OIPF 3FDYA 1X3UA 2JA6J 3OYEA 1FWZA 2L4AA 4II3A 5J1UA 3BR5A 4XONA 5LLQA 5LHHA 2K9NA 4A3MJ 2JUCA 2JTVA 2HEOA 3V8KA 2ISZA 1OR7A 3GTOJ 3GEZA 2R7TA 2BEOA 5LGNA 4B4CA 2Y9ZA 1U5TA 2L7MP 3PNTA 4UVAA 2R4GA 1K4SA 3K4BA 3LWFA 4IL6C 4Q5SF 2W24A 4BXFA 1JXSA 1TT0A 1F1ZA 2VKEA 2FF4A 1Y8RB 3PUBA 1EV7A 4CCJA 1FNNA 2HS5A 5CQEA 4I6ZA 5GP9A 4P9UA 1BIBA 2DMNA 1WQ2A 5JLWA 3BG5A 3NAUA 3SQNA 1X3WB 3JRIA 1GV5A 3RQIA 1KQ8A 1F4KA 5AIPA 1XPXA 3J81K 5LRSA 1GXQA 5GPAA 2NOGA 4C2UA 2L4MA 2ZJRF 5GADJ 3DU6A 2XGDA 2LR8A 4KITB 3QP6A 4XLHA 2EWNA 2RNGA 1ACIA 2F5VA 2IW5A 2LD5A 3FKIJ 2QZ8A 3WU1B 3FWEA 3Q0VA 3ESWB 2XGEA 4CCNA 2X0LA 4IQJA 2LDUA 5E1ZB 2Q2EA 2XPUA 3A2KA 3D1NI 1IC8A 1DU6A 2O5RA 4BHCA 4RB3C 3HDDA 1E3OC 5FRNA 2ESNA 3ZGKA 4BXUA 2DMPA 4S04A 5BQTA 1U9NA 3I54A 3V8JA 3HSFA 2XAGA 3LSJA 2PN6A 4EM0B 4YFNF 2M9HA 1SVOA 1D8JA 1YFHA 3KLOA 5E3NA 3BJAA 4OOIA 2R7QA 3V42A 5GAGJ 2IRFG 2LY9A 4F91B 3C2GA 2EV6A 3AKZA 4BQAA 2QSHX 2HOAA 1NK3P 2MD5A 1YOVB 2M4KA 1ZK8A 4D5CA 4ZDOA 1W5CC 2BXYA 3H9GA 4AC0A 5B66C 2ZMEA 2N8GA 4BJTA 4UY8I 1FSHA 2V79A 3ABTA 1BIAA 1ZRDA 1XSXA 4PDKA 1VZ0A 3B6AA 1JTYA 4L5JA 4EATA 4L18B 4UB8C 3VYUB 3PL8A 3ZRGA 3CMAI 2XAUA 4FETA 3CMYA 3K6GA 2ZC2A 1MMNA 3C3WA 4RA2A 1J75A 5F0CA 1USTA 3HZJA 2KHMA 4I02A 1ZGWA 1TC3C 2TCTA 4A3DJ 1A5JA 3G6EI 5J8CA 2LF8A 4BAYA 3SZGA 4G6QA 2F4OB 4D5FA 3SZPA 4HSRA 1SVMA 1QHGA 4DBQA 1U8BA 2WAFA 1XCBA 2WADA 3G71I 2PFBA 2DA6A 4N9IA 1G3TA 1L0OC 2PMHA 4KIFA 5CVJA 4AUXA 2A6TA 4E70A 2DFIA 4HX4A 2XPVA 4II2A 2QQAA 1Z67A 3S16J 3ZQGA 3HL2A 2LC2A 4WXDA 2FQ3A 1CF7A 2CYYA 1SD4A 2VASA 2R3SA 1O3QA 3BDDA 3CQZJ 3HUGA 1FOXA 4RM3A 5K5OA 3ASNH 2RREA 2ZKZA 1WCMJ 3VSKA 1EJ9A 2OZ6A 1VI0A 1EKEA 5C3EJ 2A07F 1XSDA 4FASD 4I2OA 1HC8A 2DQLA 4LJZF 4A3LJ 1P4WA 2IS1A 1DPUA 3HIFA 5CYVA 4KN7X 4JX5A 3H3VK 3W3CA 3DLLF 1HA8A 1XGSA 4XLEA 2OCCH 2ZXIA 3VDXA 3I9V2 3WU2C 1IXSB 3CJTB 2ZSHB 3GZ5A 1TBXA 5FKNA 2CQ7A 3F22A 2FOKA 5KVRA 3TKYA 2VJ4A 3LQQA 4ZYGA 3QYEA 1SD5A 1WJBA 1STZA 3CMMA 3IUOA 3MZYA 1Y0UA 1V3FA 3CJQB 3CO6C 4A6EA 5J1RA 2DYSH 5KAFC 3OIQA 4B3AA 2OAZA 2GQQA 3BCAA 3RZOJ 3PFIA 2XUBA 3KX2A 4ENJA 2HXIA 4PJNA 3S93A 1VQNI 5IOZA 2LG4A 1YX3A 1RI7A 2IJLA 2OPTA 1JT0A 2EFPA 3D5LA 3IWFA 2KDZA 3MVPA 2NXNB 3BROA 2XGXA 2LTPA 4LIUA 1OCTC 2RAEA 3HM5A 3L09A 5DD8A 4E7IA 3L2WA 3PO2J 2O6GE 1IN5A 2B0LA 1W7PA 2BGCA 3BPXA 4RAGA 1FBQA 1OJLA 3BQZA 4WXHA 4L0YB 5F08A 2Q0OA 2RGVA 1X2MA 1BR1A 4ABZA 2R5YB 2P6SA 1B9NA 1KU3A 3HXLA 4F52A 4KDPA 2JQ7A 2JA7J 3HYIA 2V1NA 2VT2A 5F04A 3GTJJ 2E7WA 3CUOA 4C3HJ 5LGTA 5FKKA 1ZLJA 4HRIA 2MC4A 3CCEI 3ZN0A 3JCUC 1OCRH 3WGIA 2K27A 1FY7A 2STTA 5FGMA 1G3YA 1LVKA 2MH2A 3WODF 4XKVA 1UFMA 3C1DA 1O3TA 4XLPF 1ON1A 2D45A 1LB2A 4KNYA 1I3AA 4V19K 3IH2A 4HV5A 5M3FJ 3VODA 2DPUA 1WH5A 1WPKA 2YX4A 3PM1A 1RRJA 1RUNA 1BC8C 3AG1H 2L54A 2GM4A 4RBOA 3F23A 1BC7C 4C2TA 2VJ5A 2PJRA 3H0DA 2UZKA 3FK7A 1UJ8A 2OBPA 1SMYF 2QF7A 4I0AA 1PYVA 2RNJA 4BS9A 2YUSA 3T0YA 4KT5C 2IXSA 3OYAA 1YITI 4LK0F 3W6VA 1D0ZA 5AIQA 1GDTA 4KFCA 3F3XA 4OWRB 1OISA 4HX8A 1LJ9A 5BNGA 5TGTA 4RGSA 5EEAA 3BT9A 1FIPA 3ABMH 5J3LA 3GUDA 3M7GA 2ADUA 3CCLI 1MNMC 1YE9A 3R0AA 4L9TA 3AL0B 2CWEA 3CJRB 4PSXA 4DYRA 4QWQA 3Q0UA 4L9VA 1JKQC 1MW7A 3G1OA 3NWTA 4G12A 1RIOH 3HOYJ 2LMDA 2HPIA 1N77A 2R7VA 1XMAA 2HYJA 3QOPA 4QPQA 3PNYA 1TWHJ 1ZG5A 1Z1DA 1SD6A 3KLNA 3DU5A 3VSLA 3PO3J 3OYKA 1Y8QB 3HC7A 3ZMTA 5BMZA 1S3JA 2Z1DA 2L9VA 2NOJB 4HOBA 3ZCOA 4EJWA 5CQGA 1J7KA 2M34A 5F1JA 2QQ9A 2BXZA 2IAIA 4O5VA 3A02A 3FX3A 3BR3A 1X2NA 5BPIA 1ETWA 3VEPA 1X4PA 2ID3A 4DZJA 5B3SH 2CFXA 4JX6A 2DODA 3M9AA 5DM6F 1LFBA 4EJVA 3M4OJ 2Q2EB 4P55A 3LSHA 4M3GA 4KIGA 1W36D 1R23A 1YLFA 3LSIA 4Y4RA 3L2VA 2OTLI 5HNHA 3QPSA 3DP7A 3E5QA 4LB5A 4L5IA 4YFKF 1YW9A 2BV6A 1G4DA 1R49A 2M3AA 3A03A 2ETHA 3QWLA 1LUJB 4UVCA 5E3LA 1R1VA 3WTYC 4DYQA 3BR6A 2OUMA 2ZMEB 3MQ0A 5HS8A 1FOKA 3E6CC 2QENA 3DKXA 2KT0A 2Z99A 2HU9A 1IRXA 4G7HF 2VBWA 3BJ6A 4LLNA 5DCFA 3QODA 4F92B 1AHDP 3HEFA 3L2CA 5IYDJ 1U8RA 4M3BA 3JRHA 1ORKA 5C44J 3LSKA 5HLGA 2XDVA 2FJ1A 2DMUA 5EGOB 2D1VA 1O3RA 3WTWC 2MFZA 5K5QA 5IPAA 3HPGA 5JFRA 3OYBA 4MHGA 5FJ8J 4FQGA 3LAPA 3IHUA 4XQFA 5TJJA 3IH4A 1MSFC 1E2XA 2P7VB 1AOYA 2A5YB 3I0TA 1A04A 4OAZA 1LEBA 3TEDA 1YS6A 3K2ZA 3VYTB 3S32A 3O2PE 2GAUA 3HUGB 2QSGX 3OWTA 2COMA 1IV8A 2R5ZA 3V7CA 5E1XA 1E17A 3FMQA 2OTJI 4QPOA 2QVOA 2HGCA 2NAZA 4KN4X 3DPUA 1EF4A 2DOFA 4NUBA 3DTKA 2A5WA 2VN2A 3TOBA 5E8IA 1CGPA 4HA8A 4A3JJ 4U88A 4PZJA 4BYYA 3KP3A 1VQOI 3RSNA 2EV0A 2BY1A 1QA6A 5IP6A 4BBRJ 1UHMA 2JN6A 3LA2A 2YS9A 3E1SA 3MMYB 3HB9A 2DT6A 1OR7C 1UZCA 3EYIA 2IEKA 1BN5A 1W36C 1LE8A 1U5TC 1TLHB 4G6TB 1R9TJ 4A6DA 3V7RA 2ZCWA 2CQQA 3JR9A 4RGXA 4XSZF 3FBNB 2D1HA 2L7ZA 2IA0A 3FF5A 3ZQQA 5EYRA 2A69F 4HLXA 2O9LA 3VB2A 3ABKH 1N75A 2L5QA 5L3EA 2LFBA 3ML6A 1D1CA 1R5GA 2KRFA 3VFZA 4HPQA 1W5TA 3B6CA 4BBSJ 3O8GA 2EZKA 3GF2A 3PFYA 3CCSI 1R1TA 2CG4A 2CJJA 2KRHA 2GLOA 2K4JA 2X48A 2Y9YA 3C18A 2WAEA 2HI3A 4NC8A 4AWXB 2QGUA 1P4XA 1KONA 1DP3A 5D6FA 4A2UA 3HKZN 2X6YA 3KP4A 3K0LA 1E3PA 3BPVA 3TO6A 4IO9F 2OA4A 1FBUA 4PK4A 5FLVA 4XORA 4A0ZA 2CUZA 4XSXF 4HNVA 3KYLA 4BQOA 1O3SA 4G8XA 4L0ZB 3ZOBA 2FXAA 4ASNA 4MNUA 1W5SA 4JOMA 5F1RA 1V55H 3HRSA 2ZXHA 5E3OA 2OD5A 3BG6A 4P9FA 3DWLE 1G3WA 4LLLA 2LLKA 2LKXA 2WV1A 2DMQA 1RC9A 1D0YA 2QKMB 4ENNA 3ABLH 1GVJA 2FRHA 3QU6A 3CLOA 4UUSA 3LFKA 1T98A 1K78A 3OY9A 4Z2YA 2IGMA 1K83J 2IGOA 2DA5A 1H88C 1WJDA 4R1HA 2ZJPF 1NG7A 3L2UA 2JA5J 5JVGF 2HOSA 3QPHA 3DFGA 3ECHA 3RPUD 5FD5A 2CMPA 1Q1HA 1ETXA 4OU0A 2HYFA 2FSWA 4ZTFA 2HZTA 3V7SA 5J4YA 4IHSA 4HBLA 5DV5A 2VOPA 2HNHA 1HKTA 3ZQLA 2AQFA 3F6VA 2EBIA 3BOQA 3ZQCA 3GFMA 3ROUA 1O7FA 2BW3B 4M6XA 3HGYA 5FKMA 2RC4A 2HKXA 4A5MA 3WTTC 1RR7A 2VPRA 1ERDA 4ESBA 4DZPA 3SFIA 3S1NJ 2IA2A 1DQUA 2L7FP 1GHCA 5AONA 5HLHA 1T38A 3HKZA 4IVNA 2R7DA 2EFOA 1UAAA 3HTSB 3JRAA 1OFCX 2MA3A 3MKZA 3CCJI 2LREA 1FEXA 2CW0F 2K3FA 2Y30A 1X3ZB 2F5FA 2VJJA 4FE4A 3SYTA 4IKFA 3HSEA 4U7BA 1ZAOA 3RCOA 3K10A 1IN6A 2KZGA 2KDOA 3L1PA 4F55A 5F6FA 4U7DA 4B44A 3H5NA 2VODA 3PUFA 3LAJA 5H6QA 1TQIA 3WG7H 2NVQJ 2V7FA 2K4BA 2KMUA 2Y0MA 3WG9A 1ZQ3P 3T8RA 3H3UA 5HS9A 4AD9A 2FMLA 5E8GA 3RKQA 3MZHA 2EB7A 1O7LA 1NTCA 3ZR8X 2R7ZJ 4X1EA 4X6AJ 3WHCA 3K69A 4AM3A 3HTUA 5HOOA 2X1DA 1YRNA 2XSDC 3R6SA 4ZYDA 4YELA 4FX4A 2ECCA 5E20A 1XB4A 2M8EA 4ZYAA 4WWCA 3COAC 1XCVA 3IL2A 1T56A 2FNPA 2XF7A 4CYCB 2P8TA 2QEXI 1U78A 3P9IA 5GTHC 4KUMA 4CDGA 1T39A 2BY2A 2IGNA 3BR0A 3EQLF 2ME0A 4XLCA 3JRGA 3T5XA 5EEHA 2G0EA 2GZWA 2HTSA 1MSEC 4PJ0C 3TOAA 3C2HA 2KLOA 1V5FA 3I4MJ 3I59B 3CUQA 5HLTA 2CO5A 1IDZA 1R00A 1LPQA 3OYFA 3ZQHA 3I58A 1XC5A 5CVIA 4ZDLA 2MABA 4U87A 1VQ9I 2IVMA 3G3ZA 3S1MJ 4BE2A 1BOAA 2JVHA 3BG9A 3PIPF 1SFKA 3FZVA 5FB2A 4HSTA 4XRMA 3TBIA 1K4TA 3G1LA 1T0FC 1T08B 1YO5C 5ICEA 2XF6A 2F4MB 1MBEA 3DBLB 1DPRA 3FM5A 2EA4A 2QLZA 4BJ5C 4XRSA 2FEZA 1KQ0A 2WWYA 1ZHFA 3OOPA 1DGWY 1WFXA 1R5ID 3EUHC 4U0WA 1BR4A 4P1WA 1L3LA 2R7SA 1TQPA 1I50J 4FCYA 1CQTA 2V9PA 2CU7A 2ZXJA 3F6OA 3WTXC 3ZQFA 1TW3A 1HDPA 2L3DA 3H0GJ 3LFUA 2BE5F 3R60A 3PJRA 5EZHA 4HF2A 1MZBA 3WHBA 2R7WA 1FLIA 1UB9A 2J5OA 2Z2SB 1WJEA 5F0FA 5LFAA 3I3LA 5DEQA 3CC2I 1QRYA 2EA2A 1IRFA 3OYDA 1ETOA 5JLXA 5C4JJ 4J19A 6PAXA 2NS7A 3OYNA 1O57A 4RAZA 1PP8F 5DUKA 2K9QA 1PUFA 1FSEA 1ETQA 3N05A 5CJ9A 3RYRA 3E5XA 2HQNA 5ICFA 2JA8J 4HYEA 2CQXA 2LY1A 4GXOA 3CZ6A 4BUPA 2H6CA 1LE8B 3MN2A 2HXOA 4DYCA 1Z7UA 5DS9A 3DPTA 3S15J 2VI6A 1JKOC 1ZGJA 1SFXA 3TDZC 1XSVA 2E2IJ 1ZG1A 3TW7A 4EQQA 1IXCA 3DPLC 3U1DA 3SEZA 2H8RA 2Y2ZA 3CTAA 1ZH5A 1SANA 2LOOA 1A31A 1ZELA 1KGSA 4J01A 2E35A 2FBKA 3ASOH 3OV8A 2LYCA 2E5ZA 2R7OA 2MH9A 2VXZA 1D5VA 4BE1A 1JKPC 3HHGA 2ISYA 3H36A 1IF1A 2XF5A 2B9SA 5EJCA 2PI0A 1IRZA 3QAHA 3OIOA 3WGGA 1OPCA 3QOEA 3IV5A 5EEGA 2I5UA 5GPCA 2EIJH 4O6JA 4A3CJ 2G7UA 3HG9A 4CCLA 1J09A 1OMIA 4HLYA 3H1CA 1H8AC 4XIDA 1QZEA 2MBFA 4MEYF 1D3YA 1RKTA 4GGGA 4WF2A 4XBFA 4ZC3A 2BBYA 1VQLI 3RI4A 5KAIC 1IUFA 3K4NA 1YIOA 1P9QC 2PJPA 4BH9A 3Q3SA 2V4JC 1VQMI 3G4SI 3CCYA 5L3GA 1YJWI 2QA4I 3TO7A 2LBFA 1IZ1A 1RKWA 1IUYA 2BOLA 3V4GA 1XDSA 2XRNA 4KMUX 2RKHA 3JRBA 4UUSB 1DU0A 1S9HA 3ULQB 1K78B 3M3YJ 4HNUA 1LDJA 3K4MA 3I53A 1VNDA 3IKTA 4HF1A 4HQEA 2IS6A 2DTRA 4IRIA 1UCRA 2ID6A 3F8NA 1TNSA 1U2WA 5LHGA 1H9TA 4EM1A 4LLGF 5IY5H 5JHFA 5ICGA 4FISA 2JSPA 4CCKA 3LA3A 1T8IA 3FXRA 4E7HA 1WJFA 3JSPA 2EFWA 2R7RA 4KMFA 2M30A 2ZB9A 4OMYA 2E34A 2R7FA 3FIWA 5E3MA 2M4GA 2IGKA 4OIOF 1I6HJ 4GRIA 1XN7A 4Z6YA 3ONQA 4EMSA 5J47A 3J7ZI 4FTHA 1EH7A 4MEXF 4CUGA 3UR3C 4E4HA 1X1AA 1ENHA 2ECBA 1QNTA 4I7HA 2UUZA 2H94A 2X9DA 1WHUA 4M3EA 1YW8A 1F5TA 1I6XA 2QCOA 2XKOA 3RPUA 5EDNA 1TQMA 2FBIA 2A68F 2HVSA 2AS5F 1HKQA 2LKPA 2VE9A 3EETA 1F43A 2OF7A 4B47A 3FMSA 2ELKA 2YU3A 2LH9A 4C30A 1BJZA 2J5PA 3CESA 1MMDA 4BXXJ 1T0FA 1MJBA 3SJMA 2CV0A 4MIMA 4M6YA 4WXCA 1B4AA 4M9SA 1IGNA 5BS6A 3EUHA 4BDYA 4IF4A 4D7MA 2ZO4A 5ILSA 2HFHA 3QQAA 2BZTA 4D9JA 2VB6A 1ONVA 2AXTC 3BTLA 3DXJF 2I8DA 1YRNB 2LP0A 3DLAA 4NQWB 4J00A 1S7EA 3KYCB 4IHWA 1UHWA 1TL8A 1I1GA 3WU0A 4KA4A 1FOYA 4MTEA 1G2HA 4LK1F 2BY3A 4D1QA 2QWWA 3GXOA 1JGGA 5M3MJ 4B8XA 4CGZA 2IA1A 2DT7B 5E79C 2JMWA 3WTZA 2GA1A 3R4KA 3N4MA 4A0XA 1I1SA 1B1BA 2V1XA 1SMTA 1VQKI 4WCGA 3OOUA 3LL7A 2VE8A 1TWGJ 1ETVA 3CLQA 1BW6A 3RZDJ 3B73A 1S72I 2DLLA 3RKWA 3K1PA 2CUFA 1X1CA 1IN8A 2YPRA 1FJLA 1U5TB 3CCUI 4Q4ZF 4CICA 3BP8A 1G6NA 1O4XA 4JQFA 5CVRA 1W1WE 3J7YJ 3U1KA 2B63J 3E3VA 3HRTA 1W0UA 3KIOA 1U3EM 4B1RA 3UKGA 2L7KA 4M73A 4WK8F 3DCFA 3IAM2 1R1UA 2IBDA 2P0WA 4CH7A 5EG0A 2VQLA 2CRGA 1V5GA 5J40A 4EJOA 2LY2A 3MCZA 4HQMA 4X0GA 3BY6A 4XNFA 2QM3A 3S3OA 3A0HC 1KU2A 2EV5A 2HZDA 1JHHA 3M1CA 1B8IA 4UXNA 2FD5A 1ITYA 3W6KB 5TISC 2RDPA 1I27A 3ZMVA 2RQQA 2EFQA 3ZMZA 2EQRA 2JK3A 4BKXA 2QUFA 4FT8A 1FPQA 3SZTA 4NHJA 1LNWA 3BC8A 2KL4A 3Q9SA 2CH0A 4E7JA 3F72A 3IKVA 2CW7A 5D5WB 3CDIA 1X4OA 3DEUA 3SXYA 5IOYA 3RKYA 2HDCA 4IQ4A 2DOAA 1JE8A 2B7EA 1POGA 2K02A 1MNDA 4Y17A 3GFLA 2EZIA 1LDKB 4A3BJ 5FROA 4A3IJ 5D5XB 1Z05A 2KPMA 2E2HJ 1HSTA 3GTGJ 1AA7A 3TP3A 3H92A 1XG1A 2DU9A 1ZG3A 4F3QA 5JHUA 2DDAA 3U9GA 4JX4A 1GT0C 2DN0A 2EK5A 2IPQX 2HQAA 1JGSA 1XGNA 3WE3A 4BEHA 2XAFA 2VBZA 1K79A 2FBHA 2HWVA 2K86A 1JUSA 4QLCU 1MGTA 2DFFA 2MG4A 1ZRFA 3H9JA 2H1KA 2A05A 2F6CA 4DQ2A 3WTSC 5IYBJ 3ZPLA 4BY7J 4AVPA 2EJRA 1REPC 4KISA 3TL4X 4M9ZA 2VQGA 3K4CA 4C9YA 4M71A 3LQRA 1M1EB 2MGQA 4N4NB 3L2RA 3A01A 3AG2H 2XRLA 3ELKA 3F0CA 3QPLA 2KP6A 3VOEA 3JW4A 4TV7A 2NNNA 2X1EA 3W2WA 5E18F 5ILVA 4WX9A 4I99C 2GXBA 5B1BH 3FISA 3CCQI 5JI6A 1VFCA 4LB6B 1UG0A 3IWZA 1CF7B 3QU3A 2V6CA 1VTNC 2O61A 2VXDA 1QU3A 4FX0A 4ON0A 1Z0XA 4MGRA 2RN7A 4CCOA 3O6BB 3BZCA 3P7NA 3GTLJ 3MFKA 3CP2A 2W1OA 5M5XJ 1VQ4I 1Y6IA 4E7LA 1HOMA 2LBFB 3RDIA 3MEXA 2PG4A 1EH8A 3GTQJ 4CHUA 3D5SC 1H0MA 3IAS2 5GAEJ 3DV8A 4OIQF 2ZNZA 5CLSA 1PUEE 2ZJQF 1BI1A 4CZCA 5B1AH 2BVLA 1S29A 2P5LC 1Z21A 3P9KA 1ON2A 2M87A 1HKSA 3CUQC 2A6HF 2KISA 2HR3A 4M72A 4PGHA 4BGDA 4EJTA 1SAXA 3K4LA 2M7BA 1XGMA 2F5CA 3MD2A 4XOTA 2DJNA 2QBYA 2Y0SN 3E6BA 3G1MA 3WE2A 5GAHJ 2WTEA 3MKWB 3R0JA 4K2EA 2XGCA 2CSOA 3EUKL 2CQKA 5J8FA 2X6OA 3IH3A 1G8XA 2MC3A 5CVUA 2CGPA 2V9KA 4JK1X 2JT1A 2QYOA 3QPTA 4DIQA 3OYGA 1AWCA 1JUPA 2L02A 4RAFA 3K4JA 1NHAA 3ZMUA 1FYLA 4IX7A 1BJAA 3JRDA 1W7PB 3K1MA 4PFOA 4RGRA 1DUXC 3P9CA 1T33A 3K7AJ 4EV0A 3MAJA 2K5CA 1V5EA 3GFJA 1BA5A 3GW2A 4W1UA 1MH4A 3BTJA 2JA2A 1R22A 2ZJ2A 3TGNA 4ZDPA 3LA7A 2OCEA 2WB1N 2W85A 1G59A 4DGWB 3S1QJ 1GLNA 1YYVA 2ZXWH 1JT6A 3BQYA 1T95A 5FO5A 2LSOA 3I5UA 3D0SA 4HZFA 4D0PA 2NVYJ 4PFPA 2A61A 2E71A 3E0JB 1Z7LA 2ELHA 3ZMDA 5D8KB 3W2AA 1IRGA 2A3SA 4F7ZA 1SVLA 2K9MA 3OYHA 2JPBA 5TRDA 4E7ZA 4S0HB 5H6RA 4ZZLA 2VPLA 3HSRA 2HKOA 4PJMA 5DD4A 4Y13A 3JRFA 1FZPB 2JJ7A 2L2OA 1W0TA 1BI3A 4MQVA 1IG7A 3S3MA 3H5AA 3JAMZ 1FP1D 1R71A 1HDDC 3ZQIA 3OSFA 2PJRB 3TDUC 2Y0SA 1DP7P 5F27A 2PBIA 2DOEA 3GYHX 4KIBA 4IOAF 4IHXA 2DK8A 1DDNA 3K2AA 3CDLA 2VJIA 5IP7J 1QBJA 2P4WA 5LGUA 4DJAA 4A3EJ 3P5JA 3F8MA 4M74A 1MIJA 2XVCA 1UMQA 4RB0A 2TDXA 1U9OA 5BOXA 2VT3A 4HAMA 2EZLA 5LHIA 3AAFA 2DCEA 1Z6RA 2PLYA 3CC4I 4M3FA 3S1RJ 4XRSG 3W2VA 2W84A 3KETA 3QP5A 2HDWA 1R5HA 3BZKA 4AIJA 1HBXG 2QQBA 4DW6A 3DTIA 2V1UA 2GXAA 1XX5A 2E1NA 1SC7A 1OCPA 2HOEA 3HGGA 3ABUA 1R4MB 2WB1A 2KJCA 1YHQI 3IC7A 1VQPI 1B59A 3A4CA 1IV6A 2F48A 4I98B 1VQ7I 2RVCA 3BCBA 3KZZA 3CF2A 3FBIB 1A6QA 1S7AA 2YU9J 3KZIC 2E1MC 2K9LA 1VQ5I 2F2EA 1RR8C 1JI8A 2HTJA 1SFOJ 3OYMA 4BJ6C 5CPRB 2PX9A 4OAYA 3J80K 1Q1VA 2NVUB 4A3GJ 1TP4A 1B72A 2K9SA 4XN3A 5HDGA 1GUUA 1JJ6C 3EYYA 1XMXA 3HPHA 3HJEA 3RPQA 2DBBA 3KPHA 2K40A 3R61A 1E0EA 2AO9A 3F8BA 1YI2I 4HDVA 2FA5A 4XKCA 5L3BA 3OSGA 2VOOA 2CUJA 2Y31A 3LMMA 2DA4A 3MZ8A 4N4OB 2VKVA 3FHZA 3HOVJ 5GTIC 4Y3OA 1USSA 2FNAA 2TRTA 3S17J 1Z77A 1Y0NA 3H3ZA 4YIFA 5F0HA 1A35A 3DF8A 4HF0A 1J59A 5EZGA 4BL0B 4MTDA 1W4MA 3BZ6A 1X58A 3RQ4A 4YG2F 3HOTA 5DM7F 4BEHB 5D4RA 5ERIA 2BHZA 3OMYA 1IO2A 2FU4A 3OS2A 3OIPA 3JRCA 2CV2A 3RKXA 2HYGD 1N78A 1YW7A 3Q5FA 3NQOA 3O3KA 3TMOA 4A3KJ 4LD5A 4YFXF 4R79A 3S14J 1K6YA 3KEOA 4O3MA 2IS2A 2KIUA 2LKSA 4CZZA 1D8KA 3VYRB 1XTAA 5D5VB 3I4NJ 3ISPA 3N97A 4C3IJ 1H9GA 1PDNC 3A01B 4IJAA 1SEUA 2HVQA 2DAOA 3FXMA 2ZFUA 2P5KA 3IRRA 4DNCA 5D5UB 2D2WA 4XN0A 1RETA 4IRGA 4JP0A 2DI3A 1BBYA 1B6AA 1RESA 3DEEA 2WBMA 3I55I 3GZNB 2R5ZB 4YRVA 3KP6A 9ANTA 1X19A 3F8FA 1X1BA 4HW0A 2L01A 2R93J 1WJCA 1S5LC 2DFEA 2UXXA 2VC0A 4A12A 2CQNA 2X4HA 2H27A 1RZ4A 1YX5A 1ZKGA 1MBFA 1ZARA 2W57A 5CVVA 1HW2A 2CW8A 3CJNA 1ZN2A 3AFHA 3WTUC 3ZXSA 4ANJA 2G7HA 4ZZDA 5J1YA 4ESJA 3VWBA 2R7UA 1JTXA 2ZNYA 4LGWA 2EZHA 2Z5UA 3RJPA 1XGOA 2IP2A 3PSFA 2LRDA 2ICWG 1T2KA 1H89C 1AKHA 2EIKH 3VPRA 1ZRCA 2JUGA 4P96A 5LD2C 3U21A 4ENKA 1LKXA 1HW1A 2G9WA 1GVDA 3VYSB 4IOCF 2KFDA 1LQ1A 1QGPA 4CSWA 1KU7A 2QBYB 3A1YA 3Q0WA 2DJIA 2YR2A 3KP7A 2GIZA 2HQ5A 4UHTA 3H5RA 3BJOA 1I5ZA 3M1EA 2PEXA 3FKJA 2GOXB 1MMSA 1FX7A 1X1PA 1YQAA 2VL8A 4XLNF 4HV6A 3FXLA 3S2HJ 4LIVA 3HOZJ 3DBHB 2GXGA 4RS8A 4RDUA 4NDLA 4C3JJ 3RYPA 3B02A 2CV1A 4I76A 3L00A 1WGXA 1WSUA 4IHVA 5HVQC 2VBXA 2BY0A 3KP2A 1FOWA 2WY7Q 5LRRA 2NNYA 3E6MA 1QO0D 2FX0A 3SDGA 5EF6A 4MO7A 2O03A 4B43A 2X51A 3NARA 1JUMA 2VKHA 4IZZA 2XAJA 3GZ6A 2JRMA 2LVSA 4A5NA 4OIRF 5E17F 1BL0A 3HOSA 3L9FA 1OLTA 4Y15A 1SFUA 2H09A 2IS4A 2VKDA 2V26A 1Y56A 2O8XA 5M5YJ 3CCVI 3BTIA 3DTEA 4E6KG 5FKOA 4BHPA 4RGUA 3FXQA 3GMEA 2L0KA 3PQKA 3CDHA 2L9SA 3KP5A 1XS9A 3CCRI 3L7WA 2EH3A 2MSYA 1BOBA 5EGOA 2P7CB 4IHYA 1AU7A 2DQRA 3FXOA 4XRFA 4PUSA 4L5EA 1K61A 4XL9A 4DOZA 2R0QC 2C6YA 5B5EC 2DYRH 3JAMK 2DPDA 3H9QA 1VF9A 2O7OA 1YG2A 3MKYB 2XB5A 2M0MA 3SEQA 2Z33A 1QHHD 2R7XA 2OJED 1MKMA 1U0JA 5E1WA 2EINH 4ZYHA 2PMZN 5DYMA 3BR2A 3M07A 3I71A 3REOA 1V4RA 4BHBA 4ESFA 2JZYA 2W82A 4M3DA 4XKBA 1FYKA 5K7HA 2EPFA 5ICCA 2M0CA 1OCOH 4PJJA 3AG4H 3EDPA 2FQ4A 3KE2A 4KT6A 5LEJA 3X2QH 4RB1A 3LSMA 1FBSA 1SFEA 2WAQN 2JVGA 2HOTA 5A2QZ 3JSOA 3JTHA 4PJLA 5IT9K 4ETSA 3CF5F 4G9YA 2LNBA 3HRUA 5ILUA 2KIQA 4R8HA 5KNLA 1TWCJ 3L2QA 3J7AY 1UHSA 3OR2C 5H20A 1C0WA 1A36A 2MD0A 3K70D 4RMNA 4G6DA 2OC6A 1ZR2A 2ELJA 2DO7A 3HHHA 1QPIA 3TO9A 3S2WA 3C2BA 4CO8A 1R4NB 2EILH 2F4IA 1WWXA 2QQ8A 1EH6A 2VC1A 3AG3H 5BPDA 2XPWA 4XKWA 5JVTA 4G7OF 4U0YA 4Q48A 2V6EA 3CMEI 2UV1A 2WV0A 2XAQA 2JRTA 4JBAA 3GCMA 1TTYA 4LG0A 3DEWA 5DCMA 1KU9A 1J9IA 3BTCA 4B09A 4RLQA 2DA2A 4U0VA 3V8LA 5F64A 1APLC 2JSCA 3ZMSA 4B48A 1MDMA 2KIFA 1B9MA 2K85A 4ZTJA 1WI3A 4UV8A 2DFHA 2AXLA 4AU7A 2PMUA 4Y52J 1F36A 2XV4S 1UG2A 4AIHA 5FKLA 4BNCA 1BR2A 3GLXA 1FMVA 1OCCH 1OQYA 4LMYA 1D5YA 4ENMA 3OS1A 1XD7A 1B72B 2XAHA 3LSPA 2CFOA 4NBQA 4A69C 2E36A 5HS7A 2VUMJ 1HSJA 1S6LA 2PMZA 4NB5A 2DTZA 5DTDA 1P7JA 3RTRA 5FRMA 1OKRA 2XIGA 2FE3A 4NC7A 1YIJI 2ZSIB 5ED4A 1WJAA 5K1YA 2V9VA 3H35A 1Y39A 1RNLA 4XOPA 1BM9A 4GYGA 1HQCA 2WAQA 1MJ9A 3K1NA 4CXFA 5IYCJ 2RQPA 2M7AA 1FP2A 4JYKA 2AHQA 2W48A 4DBRA 5FD6A 2E2JJ 3CUQB 1P6RA 1R36A 2DT5A 3HRMA 4V2GA 2GIVA 4OINF 1VQ8I 2O0YA 1TZLA 2JPCA 3GLLA 3OR1C 4XMYA 2W25A 5HNFA 1MBGA 5KHDA 2M5WA 5FLXZ 1PVEA 1SAUA 3PSIA 3NEUA 1OYIA 3FMRA 2Q1ZB 2Z3YA 3M8EA 3U2RA 4BE0A 3BLYA 1WVRA 5L3CA 3CC7I 2O3FA 1IDYA 2EIMH 4BQNA 4BQQA 3I56I 3QRFF 2E1OA 2ZBKA 4YIIA 1YTYA 4IRHA 4XM3A 4XLFA 5J4VA
chains in the Genus database with same CATH topology
2DJNA 5IP9J 2Y0SN 3G1MA 3WHCA 4X6AJ 1QVUA 2DA1A 4AUXA 1FTTA 1YRNA 2XSDC 2XPVA 3S16J 2ECCA 3ZQGA 2XGCA 3HBLA 3JREA 1T56A 1U78A 4CYCB 3CQZJ 2X6OA 3IH3A 3LOCA 3BR0A 2ME0A 5K7FA 3JRGA 1WCMJ 3BR1A 2G0EA 1VI0A 2DMTA 1JUPA 2E19A 5C3EJ 1MSEC 3JRDA 2ME6A 3I4MJ 4A3LJ 1IDZA 1T33A 3H3VK 4JX5A 3K7AJ 4AYBN 1BA5A 3ZQHA 4W1UA 1MH4A 1XC5A 1I3QJ 3BTJA 3S1MJ 5FKNA 3S2DJ 1PUFB 3BG9A 1AKHB 2WB1N 3S1QJ 4XRMA 3G1LA 2DA7A 1JT6A 3BQYA 1MBEA 3TW6A 4XRSA 5J1RA 2NVYJ 4M6VA 4B3AA 3GTKJ 2LK2A 3RZOJ 1ETKA 4S0HB 2HXIA 5IOZA 4CYCA 3JRFA 1WH7A 1I50J 2OPTA 2JJ7A 4FCYA 1JT0A 1ZTRA 1CQTA 2CU7A 2KDZA 1W0TA 1IG7A 3MVPA 1HDDC 3ZQFA 1HDPA 3H0GJ 3ZQIA 1RPWA 5EZHA 3OSFA 2LTPA 4MLOA 5F27A 3WHBA 1OCTC 2RAEA 3HM5A 5F0FA 3PO2J 3GTMJ 4IHXA 4LOCA 3E7LA 1QRYA 1OJLA 3BQZA 3K2AA 1ETOA 5F08A 3CDLA 3LSGA 5JLXA 5C4JJ 5IP7J 4J19A 1X2MA 1MBJA 4ABZA 2NS7A 2R5YB 4A3EJ 4Y7NJ 2COBA 2JA7J 2K9QA 2P81A 1PUFA 4C2MJ 1ETQA 5F04A 3GTJJ 2JA8J 1UMQA 4C3HJ 2CQXA 5FKKA 3LSRA 1LE8B 1U9OA 3MN2A 1IJWC 2HXOA 4DYCA 5DS9A 2NVXJ 3S15J 2EZLA 2VI6A 1JKOC 3BG3A 4M3FA 3S1RJ 4XRSG 2E2IJ 3TW7A 4DW6A 2NVTJ 2H8RA 2Y2ZA 1SANA 1JKRC 1OCPA 3HGGA 3IH2A 1HCRA 5M3FJ 1WH5A 1WPKA 3PM1A 2GBYA 1JKPC 1IV6A 2GM4A 4RBOA 1IRZA 3O8HA 3OIOA 3IV5A 3FK7A 2QF7A 2YU9J 5GPCA 5FLMJ 2YUSA 4XK4A 1SFOJ 4A3CJ 2JWTA 3W6VA 1HLVA 1Q1VA 4A3GJ 1H8AC 1GDTA 4XIDA 4QIWN 1B72A 2K9SA 2L9RA 1RKTA 1JJ6C 1GUUA 5BNGA 4XICA 2K40A 5EEAA 3BT9A 1FIPA 2AO9A 1Y1WJ 5J3LA 1IUFA 1MNMC 3OSGA 3Q3SA 2Y31A 2DA4A 4QSHA 2DA3A 2VKVA 3HOVJ 3CCYA 4DYRA 4QTRA 2TRTA 3S17J 2NS8A 3Q0UA 1Z77A 1ZR4A 1JKQC 3G1OA 1RKWA 5F0HA 4G12A 4MFEA 3HOYJ 4W97A 2HYJA 3MKLA 5EZGA 1NK2P 3JRBA 4UUSB 1DU0A 1X58A 3M3YJ 1TWHJ 5K7ZA 3PO3J 1HF0A 1VNDA 1ETYA 3JRCA 1MBKA 2ID6A 2M34A 5F1JA 4A3KJ 2IAIA 3A02A 3HOXJ 4IEJA 3S14J 3BR3A 1X2NA 4FISA 1ETWA 2ID3A 4DZJA 4JX6A 3I4NJ 3M4OJ 1LFBA 4GFBA 4M3GA 4C3IJ 4EEFG 2ZB9A 3A01B 5M5WJ 1MBHA 3FIWA 5E3MA 1I6HJ 3QPSA 4FTHA 1RETA 1LFUP 4JP0A 1ENHA 2XB0X 2ECBA 4D7NA 1RESA 2R5ZB 2X9DA 3HOWJ 9ANTA 3A03A 4M3EA 2R93J 2QCOA 5E3LA 5EDNA 4DYQA 2HDDA 3BR6A 1P7IA 1F43A 1ZKGA 2OF7A 1MBFA 2ELKA 2KT0A 4V2FA 3TP0A 1BJZA 5J1YA 4BXXJ 3GBGA 3SJMA 2M2EA 4MIMA 3LNQA 1JTXA 1AHDP 2EZHA 3HEFA 1H89C 5IYDJ 5HODA 1AKHA 3FK6A 4M3BA 4MFDA 3VPRA 3JRHA 1ORKA 1IGNA 3GTPJ 5C44J 4A93J 2FJ1A 2DMUA 4D7MA 5EGOB 5EG0B 1TWAJ 1GVDA 5IPAA 3QQAA 5FJ8J 1GV2A 3Q0WA 2HQ5A 1A6IA 3BTLA 3IH4A 1MSFC 1YRNB 2O8KA 2LP0A 4IHWA 1S7EA 1FIAA 3S2HJ 4UUTA 1B8IB 3HOZJ 1G2HA 4BY1J 3TEDA 4RDUA 4NDLA 1JGGA 5M3MJ 4C3JJ 4I76A 2R5ZA 1WGXA 4IHVA 2JMWA 4FE7A 2FX0A 3SDGA 5EF6A 4MO7A 3NARA 1JUMA 3OOUA 1EF4A 1TWGJ 1TWFJ 1ETVA 2LVSA 3HOUJ 1BW6A 3RZDJ 1BL0A 4A3JJ 2CUFA 2R5YA 1FJLA 5IP6A 4BBRJ 5M5YJ 2JN6A 3BTIA 2YS9A 3HB9A 1O4XA 5FKOA 1QVTA 4A3FJ 2B63J 2IEKA 2L0KA 1W0UA 1LE8A 1XS9A 4B1RA 3UKGA 2I10A 2EH3A 2MSYA 3DCFA 5EGOA 4IHYA 1R9TJ 5EG0A 2IBDA 1AU7A 1FTZA 2CQQA 3JR9A 2R92J 2CRGA 1Y1VJ 2L7ZA 4L5EA 1K61A 1JJ8C 5EYRA 2O9LA 2R0QC 2D5VA 1BW5A 1VF9A 2LFBA 2O7OA 2MW8A 3B6CA 1B8IA 4BBSJ 2XB5A 3O8GA 2EZKA 2FD5A 1ITYA 1MH3A 2CUEA 2EQRA 2CJJA 2JK3A 2M8GX 4BKXA 5C4XJ 2GLOA 2PMZN 2X48A 2Y9YA 3BR2A 2JA6J 5J1UA 3BR5A 4M3DA 2HI3A 5K7HA 2K9NA 4A3MJ 2M0CA 5IOYA 2FQ4A 3HKZN 3GTOJ 2WAQN 2Y9ZA 4B4CA 2L7MP 2HOTA 5FLVA 4HNVA 1POGA 3ZOBA 2EZIA 2VKEA 1TWCJ 4A3BJ 1UHSA 4A3IJ 5E3OA 2E2HJ 1ZR2A 4I6ZA 3GTGJ 5GP9A 2LLKA 2DMNA 3TP3A 2WV1A 2LKXA 1QPIA 1XG1A 2DMQA 5JLWA 3C2BA 3BG5A 3NAUA 3JRIA 1GV5A 3RQIA 2XPWA 4JX4A 1GT0C 2DN0A 4UUSA 5GPAA 2NOGA 2XGDA 2LR8A 1K83J 1H88C 2DA5A 3DEWA 3BTCA 1JUSA 2DA2A 2MG4A 2JA5J 1APLC 2LD5A 2H1KA 3FKIJ 2HOSA 5IYBJ 4BY7J 1ETXA 3Q0VA 2XGEA 1WI3A 2XPUA 4Y52J 3D1NI 1F36A 1IC8A 1UG2A 3ZQLA 1DU6A 2MGQA 5FKLA 3HDDA 2EBIA 1E3OC 3ZQCA 3A01A 2XRLA 2DMPA 1D5YA 3F0CA 1U9NA 3QPLA 1B72B 3LSPA 5FKMA 3HGYA 4A69C 3LSJA 2VUMJ 2M9HA 1RR7A 3FISA 2VPRA 2DTZA 4DZPA 5DTDA 1VFCA 3SFIA 1P7JA 5E3NA 3S1NJ 2L7FP 1Z0XA 2LY9A 3GTLJ 2HOAA 3JRAA 1NK3P 5M5XJ 1OFCX 5IYCJ 1ZK8A 4D5CA 1FEXA 1HOMA 4AC0A 2Y30A 4JYKA 2AHQA 2N8GA 2W48A 4FE4A 2E2JJ 3GTQJ 4V2GA 3L1PA 3B6AA 1JTYA 1MBGA 3CMYA 2NVQJ 1ZQ3P 5F0CA 4A3DJ 1ZGWA 1TC3C 1A5JA 2TCTA 1IDYA 2E1OA 3RKQA 4D5FA 1NTCA 1U8BA 2R7ZJ 4X1EA 2DA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJN A;  5IP9 J;  2Y0S N;  3G1M A;  3WHC A;  4X6A J;  1QVU A;  2DA1 A;  4AUX A;  1FTT A;  1YRN A;  2XSD C;  2XPV A;  3S16 J;  2ECC A;  3ZQG A;  2XGC A;  3HBL A;  3JRE A;  1T56 A;  1U78 A;  4CYC B;  3CQZ J;  2X6O A;  3IH3 A;  3LOC A;  3BR0 A;  2ME0 A;  5K7F A;  3JRG A;  1WCM J;  3BR1 A;  2G0E A;  1VI0 A;  2DMT A;  1JUP A;  2E19 A;  5C3E J;  1MSE C;  3JRD A;  2ME6 A;  3I4M J;  4A3L J;  1IDZ A;  1T33 A;  3H3V K;  4JX5 A;  3K7A J;  4AYB N;  1BA5 A;  3ZQH A;  4W1U A;  1MH4 A;  1XC5 A;  1I3Q J;  3BTJ A;  3S1M J;  5FKN A;  3S2D J;  1PUF B;  3BG9 A;  1AKH B;  2WB1 N;  3S1Q J;  4XRM A;  3G1L A;  2DA7 A;  1JT6 A;  3BQY A;  1MBE A;  3TW6 A;  4XRS A;  5J1R A;  2NVY J;  4M6V A;  4B3A A;  3GTK J;  2LK2 A;  3RZO J;  1ETK A;  4S0H B;  2HXI A;  5IOZ A;  4CYC A;  3JRF A;  1WH7 A;  1I50 J;  2OPT A;  2JJ7 A;  4FCY A;  1JT0 A;  1ZTR A;  1CQT A;  2CU7 A;  2KDZ A;  1W0T A;  1IG7 A;  3MVP A;  1HDD C;  3ZQF A;  1HDP A;  3H0G J;  3ZQI A;  1RPW A;  5EZH A;  3OSF A;  2LTP A;  4MLO A;  5F27 A;  3WHB A;  1OCT C;  2RAE A;  3HM5 A;  5F0F A;  3PO2 J;  3GTM J;  4IHX A;  4LOC A;  3E7L A;  1QRY A;  1OJL A;  3BQZ A;  3K2A A;  1ETO A;  5F08 A;  3CDL A;  3LSG A;  5JLX A;  5C4J J;  5IP7 J;  4J19 A;  1X2M A;  1MBJ A;  4ABZ A;  2NS7 A;  2R5Y B;  4A3E J;  4Y7N J;  2COB A;  2JA7 J;  2K9Q A;  2P81 A;  1PUF A;  4C2M J;  1ETQ A;  5F04 A;  3GTJ J;  2JA8 J;  1UMQ A;  4C3H J;  2CQX A;  5FKK A;  3LSR A;  1LE8 B;  1U9O A;  3MN2 A;  1IJW C;  2HXO A;  4DYC A;  5DS9 A;  2NVX J;  3S15 J;  2EZL A;  2VI6 A;  1JKO C;  3BG3 A;  4M3F A;  3S1R J;  4XRS G;  2E2I J;  3TW7 A;  4DW6 A;  2NVT J;  2H8R A;  2Y2Z A;  1SAN A;  1JKR C;  1OCP A;  3HGG A;  3IH2 A;  1HCR A;  5M3F J;  1WH5 A;  1WPK A;  3PM1 A;  2GBY A;  1JKP C;  1IV6 A;  2GM4 A;  4RBO A;  1IRZ A;  3O8H A;  3OIO A;  3IV5 A;  3FK7 A;  2QF7 A;  2YU9 J;  5GPC A;  5FLM J;  2YUS A;  4XK4 A;  1SFO J;  4A3C J;  2JWT A;  3W6V A;  1HLV A;  1Q1V A;  4A3G J;  1H8A C;  1GDT A;  4XID A;  4QIW N;  1B72 A;  2K9S A;  2L9R A;  1RKT A;  1JJ6 C;  1GUU A;  5BNG A;  4XIC A;  2K40 A;  5EEA A;  3BT9 A;  1FIP A;  2AO9 A;  1Y1W J;  5J3L A;  1IUF A;  1MNM C;  3OSG A;  3Q3S A;  2Y31 A;  2DA4 A;  4QSH A;  2DA3 A;  2VKV A;  3HOV J;  3CCY A;  4DYR A;  4QTR A;  2TRT A;  3S17 J;  2NS8 A;  3Q0U A;  1Z77 A;  1ZR4 A;  1JKQ C;  3G1O A;  1RKW A;  5F0H A;  4G12 A;  4MFE A;  3HOY J;  4W97 A;  2HYJ A;  3MKL A;  5EZG A;  1NK2 P;  3JRB A;  4UUS B;  1DU0 A;  1X58 A;  3M3Y J;  1TWH J;  5K7Z A;  3PO3 J;  1HF0 A;  1VND A;  1ETY A;  3JRC A;  1MBK A;  2ID6 A;  2M34 A;  5F1J A;  4A3K J;  2IAI A;  3A02 A;  3HOX J;  4IEJ A;  3S14 J;  3BR3 A;  1X2N A;  4FIS A;  1ETW A;  2ID3 A;  4DZJ A;  4JX6 A;  3I4N J;  3M4O J;  1LFB A;  4GFB A;  4M3G A;  4C3I J;  4EEF G;  2ZB9 A;  3A01 B;  5M5W J;  1MBH A;  3FIW A;  5E3M A;  1I6H J;  3QPS A;  4FTH A;  1RET A;  1LFU P;  4JP0 A;  1ENH A;  2XB0 X;  2ECB A;  4D7N A;  1RES A;  2R5Z B;  2X9D A;  3HOW J;  9ANT A;  3A03 A;  4M3E A;  2R93 J;  2QCO A;  5E3L A;  5EDN A;  4DYQ A;  2HDD A;  3BR6 A;  1P7I A;  1F43 A;  1ZKG A;  2OF7 A;  1MBF A;  2ELK A;  2KT0 A;  4V2F A;  3TP0 A;  1BJZ A;  5J1Y A;  4BXX J;  3GBG A;  3SJM A;  2M2E A;  4MIM A;  3LNQ A;  1JTX A;  1AHD P;  2EZH A;  3HEF A;  1H89 C;  5IYD J;  5HOD A;  1AKH A;  3FK6 A;  4M3B A;  4MFD A;  3VPR A;  3JRH A;  1ORK A;  1IGN A;  3GTP J;  5C44 J;  4A93 J;  2FJ1 A;  2DMU A;  4D7M A;  5EGO B;  5EG0 B;  1TWA J;  1GVD A;  5IPA A;  3QQA A;  5FJ8 J;  1GV2 A;  3Q0W A;  2HQ5 A;  1A6I A;  3BTL A;  3IH4 A;  1MSF C;  1YRN B;  2O8K A;  2LP0 A;  4IHW A;  1S7E A;  1FIA A;  3S2H J;  4UUT A;  1B8I B;  3HOZ J;  1G2H A;  4BY1 J;  3TED A;  4RDU A;  4NDL A;  1JGG A;  5M3M J;  4C3J J;  4I76 A;  2R5Z A;  1WGX A;  4IHV A;  2JMW A;  4FE7 A;  2FX0 A;  3SDG A;  5EF6 A;  4MO7 A;  3NAR A;  1JUM A;  3OOU A;  1EF4 A;  1TWG J;  1TWF J;  1ETV A;  2LVS A;  3HOU J;  1BW6 A;  3RZD J;  1BL0 A;  4A3J J;  2CUF A;  2R5Y A;  1FJL A;  5IP6 A;  4BBR J;  5M5Y J;  2JN6 A;  3BTI A;  2YS9 A;  3HB9 A;  1O4X A;  5FKO A;  1QVT A;  4A3F J;  2B63 J;  2IEK A;  2L0K A;  1W0U A;  1LE8 A;  1XS9 A;  4B1R A;  3UKG A;  2I10 A;  2EH3 A;  2MSY A;  3DCF A;  5EGO A;  4IHY A;  1R9T J;  5EG0 A;  2IBD A;  1AU7 A;  1FTZ A;  2CQQ A;  3JR9 A;  2R92 J;  2CRG A;  1Y1V J;  2L7Z A;  4L5E A;  1K61 A;  1JJ8 C;  5EYR A;  2O9L A;  2R0Q C;  2D5V A;  1BW5 A;  1VF9 A;  2LFB A;  2O7O A;  2MW8 A;  3B6C A;  1B8I A;  4BBS J;  2XB5 A;  3O8G A;  2EZK A;  2FD5 A;  1ITY A;  1MH3 A;  2CUE A;  2EQR A;  2CJJ A;  2JK3 A;  2M8G X;  4BKX A;  5C4X J;  2GLO A;  2PMZ N;  2X48 A;  2Y9Y A;  3BR2 A;  2JA6 J;  5J1U A;  3BR5 A;  4M3D A;  2HI3 A;  5K7H A;  2K9N A;  4A3M J;  2M0C A;  5IOY A;  2FQ4 A;  3HKZ N;  3GTO J;  2WAQ N;  2Y9Z A;  4B4C A;  2L7M P;  2HOT A;  5FLV A;  4HNV A;  1POG A;  3ZOB A;  2EZI A;  2VKE A;  1TWC J;  4A3B J;  1UHS A;  4A3I J;  5E3O A;  2E2H J;  1ZR2 A;  4I6Z A;  3GTG J;  5GP9 A;  2LLK A;  2DMN A;  3TP3 A;  2WV1 A;  2LKX A;  1QPI A;  1XG1 A;  2DMQ A;  5JLW A;  3C2B A;  3BG5 A;  3NAU A;  3JRI A;  1GV5 A;  3RQI A;  2XPW A;  4JX4 A;  1GT0 C;  2DN0 A;  4UUS A;  5GPA A;  2NOG A;  2XGD A;  2LR8 A;  1K83 J;  1H88 C;  2DA5 A;  3DEW A;  3BTC A;  1JUS A;  2DA2 A;  2MG4 A;  2JA5 J;  1APL C;  2LD5 A;  2H1K A;  3FKI J;  2HOS A;  5IYB J;  4BY7 J;  1ETX A;  3Q0V A;  2XGE A;  1WI3 A;  2XPU A;  4Y52 J;  3D1N I;  1F36 A;  1IC8 A;  1UG2 A;  3ZQL A;  1DU6 A;  2MGQ A;  5FKL A;  3HDD A;  2EBI A;  1E3O C;  3ZQC A;  3A01 A;  2XRL A;  2DMP A;  1D5Y A;  3F0C A;  1U9N A;  3QPL A;  1B72 B;  3LSP A;  5FKM A;  3HGY A;  4A69 C;  3LSJ A;  2VUM J;  2M9H A;  1RR7 A;  3FIS A;  2VPR A;  2DTZ A;  4DZP A;  5DTD A;  1VFC A;  3SFI A;  1P7J A;  5E3N A;  3S1N J;  2L7F P;  1Z0X A;  2LY9 A;  3GTL J;  2HOA A;  3JRA A;  1NK3 P;  5M5X J;  1OFC X;  5IYC J;  1ZK8 A;  4D5C A;  1FEX A;  1HOM A;  4AC0 A;  2Y30 A;  4JYK A;  2AHQ A;  2N8G A;  2W48 A;  4FE4 A;  2E2J J;  3GTQ J;  4V2G A;  3L1P A;  3B6A A;  1JTY A;  1MBG A;  3CMY A;  2NVQ J;  1ZQ3 P;  5F0C A;  4A3D J;  1ZGW A;  1TC3 C;  1A5J A;  2TCT A;  1IDY A;  2E1O A;  3RKQ A;  4D5F A;  1NTC A;  1U8B A;  2R7Z J;  4X1E A;  2DA6 A; 
#chains in the Genus database with same CATH topology
 3E5U A;  5IP9 J;  4L9J A;  1P92 A;  1QVU A;  2DA1 A;  2Y48 A;  3FM3 A;  4EGZ A;  1FTT A;  2BW3 A;  2M1B A;  3K9T A;  2E7X A;  1QQI A;  3HBL A;  3K70 C;  4HX7 A;  2ESH A;  3JRE A;  2F5D A;  5H2F C;  1QZY A;  2P5V A;  3F21 A;  2NRA C;  1V54 H;  2X1C A;  2GA2 A;  3M8F A;  4EM2 A;  3LOC A;  1Z91 A;  2BYV E;  1T6S A;  1WRJ A;  2Y69 H;  5K7F A;  3S8P A;  2OZU A;  2XHK A;  4ZH4 F;  3BR1 A;  3OYI A;  1IW7 F;  2LF7 A;  2DMT A;  2E19 A;  4I0B A;  2H8W A;  1YS7 A;  5D6E A;  1LEA A;  2ME6 A;  4UUV A;  2H6B A;  2KRC A;  2P6T A;  1OYW A;  1GXP A;  4RM2 A;  3GFI A;  3MWM A;  4AYB N;  2BVM A;  5HDN A;  2MLK A;  1IAW A;  2HPM A;  2VLA A;  1I3Q J;  2XRO A;  3CD6 I;  3W6J B;  2DW4 A;  4RB2 C;  1S7O A;  2XSJ C;  3M8J A;  3J7A O;  3S2D J;  1PUF B;  4AVZ A;  1AKH B;  5J6X A;  1TT5 B;  3J80 Z;  3NWS A;  1KYZ A;  2HVR A;  3EPZ A;  2IT0 A;  2DA7 A;  1Z6T A;  4ITV A;  3TW6 A;  4HEA 2;  2HQR A;  4M6V A;  3SHF A;  3GTK J;  2W4S A;  2LK2 A;  1ETK A;  4IPA A;  2VQH A;  3IRQ A;  1QZZ A;  4BAC A;  2XAS A;  1NG6 A;  4CYC A;  3CCM I;  1X1D A;  1WH7 A;  2RV8 A;  3TQN A;  1ZTR A;  4N9H A;  1J5Y A;  4OMZ A;  5LBQ A;  2X85 A;  1RPW A;  3BG7 A;  3KEY A;  4MLO A;  4LIT A;  4PSW A;  3S3N A;  4F93 B;  2KJB A;  1K6O A;  3GTM J;  4S05 A;  2CS3 A;  1S8N A;  3C7J A;  3I59 A;  4LOC A;  3E7L A;  3KFW X;  2H1L A;  4UB6 C;  2KQR A;  4XLA A;  3LSG A;  2YX7 A;  3ECO A;  3ERE D;  5D8L B;  3NRV A;  1MBJ A;  3OYJ A;  4NNJ A;  2VIX A;  1YJN I;  2FMY A;  4Y7N J;  2K7L A;  1IN7 A;  2EFN A;  1R7J A;  2COB A;  2P81 A;  4C2M J;  2OU2 A;  3A0B C;  1R58 A;  3LSR A;  2DXI A;  4HG2 A;  1IJW C;  2NVX J;  4BDZ A;  1KYW A;  1MMA A;  3BG3 A;  3LST A;  3SFZ A;  4AYB A;  5HLI A;  3ERM A;  4P5O A;  2KIM A;  5L3F A;  4UVB A;  2NVT J;  2W7N A;  3PNV A;  1P4A A;  1JKR C;  5CKT A;  3GX4 X;  1HCR A;  3WTV C;  3OL3 A;  2E1M B;  3CP8 A;  3DKW A;  5FFZ A;  2GBY A;  1I39 A;  4CYD A;  1ZGA A;  4Q47 A;  4KIC A;  1FMW A;  3FXK A;  3O8H A;  1IXR C;  4XR6 A;  5A2Q K;  3J81 Z;  4YIR X;  2A6E F;  5FLM J;  1IN4 A;  4CCM A;  2KKO A;  4EGY A;  3BWG A;  1Z3X A;  4XK4 A;  5JR3 A;  2JWT A;  4UV9 A;  1HLV A;  2KZV A;  1ULY A;  5FFX A;  3OYC A;  4QIW N;  1YJ9 I;  3F9K A;  2L9R A;  2E5N A;  4XIC A;  1ZLK A;  4RLF A;  3SDB A;  1OCZ H;  1Y1W J;  2OQR A;  1G3S A;  2VQC A;  2GOM A;  3FXU A;  4UNO A;  4N0B A;  2FOW A;  3CO7 C;  1R6R A;  4QSH A;  2VBY A;  1J2X A;  2DA3 A;  4AIK A;  4EJU A;  2DDB A;  1ZYR F;  4QTR A;  1F9N A;  2NS8 A;  1ZR4 A;  1WJ5 A;  2QSF X;  3OYL A;  3G2B A;  3PIO F;  2Z9O A;  4MFE A;  1NH3 A;  4W97 A;  3AL0 C;  3MKL A;  1NK2 P;  3K4K A;  4G94 A;  4M9X A;  4YEJ A;  5K7Z A;  4ZYE A;  1FYM A;  3PQJ A;  1EA3 A;  4PCQ A;  1HF0 A;  4LG0 B;  1J0R A;  5DCM B;  4FHT A;  1ETY A;  3JTG A;  1MBK A;  5DUI A;  2GWR A;  4PGG A;  1MD0 A;  5L3D A;  1MDM B;  3HOX J;  4IEJ A;  2QKL B;  2W00 A;  4ZJZ A;  2YSR A;  4GFB A;  3KEQ A;  1MJA A;  1WKM A;  2OV7 A;  4HDU A;  4H4K C;  4EEF G;  3WGH A;  5M5W J;  1MBH A;  2X6W A;  2WY8 Q;  5K5R A;  1ODD A;  3KYD B;  2ZFW A;  1P2F A;  3OS0 A;  1LFU P;  2Z16 A;  2XB0 X;  3G73 A;  2OQG A;  4D7N A;  1D1B A;  1Z3Y A;  1BI0 A;  2BHY A;  1HXD A;  3ZP5 A;  3HOW J;  5LEK A;  1VQ6 I;  1HW5 A;  1LDD A;  2DK5 A;  2UXN A;  2FUG 2;  2NS0 A;  5FLX K;  4GO1 A;  2MLG A;  3GWZ A;  5KCM A;  1P7I A;  4EVI A;  2HDD A;  1FT9 A;  5KK1 A;  4KJZ A;  1D1A A;  3DKY A;  4IXA A;  3Q9V A;  1XMK A;  1PJR A;  4V2F A;  3TP0 A;  2F5E A;  1QPM A;  2XKP A;  1KA8 A;  2E1C A;  4MQ9 F;  1KQ9 A;  2NYX A;  3GBG A;  3OL4 A;  1JHF A;  2ZME C;  4E7K A;  2M2E A;  3LNQ A;  2UWM A;  4GYI A;  5HOD A;  3FK6 A;  4MFD A;  4BU2 A;  1TW2 A;  3GTP J;  1W7P D;  5IT3 A;  2X6X A;  4A93 J;  1XDU A;  3UNG C;  5EG0 B;  1TWA J;  5IT9 Z;  1K7A A;  1MMG A;  1GV2 A;  4GDF A;  1A6I A;  1OYY A;  4A0Y A;  1SD7 A;  2XC7 A;  3KCC A;  1FC3 A;  5HDK A;  1E3H A;  4NC6 A;  1FIA A;  3GO5 A;  3ZN1 A;  4UUT A;  1B8I B;  4BY1 J;  2V1D A;  1UEL B;  3T1B A;  1DGR M;  4H0E A;  2Q8K A;  2M45 A;  2WA0 A;  4B3X A;  5D4S A;  2K3P A;  2Y75 A;  2MYS A;  2WC2 A;  4FE7 A;  2E60 A;  4LFU A;  5DDG A;  1RUO A;  3FXJ A;  1WZ2 A;  1TWF J;  3HOU J;  1N25 A;  2L9N A;  3DQV C;  2ACJ A;  2STW A;  3IP4 B;  2R5Y A;  4Y33 A;  1TNT A;  3KZY A;  3ZQ7 A;  1MNE A;  4KYW A;  4I09 A;  1QVT A;  4A3F J;  4LG3 A;  4AID A;  1KZH A;  4L9N A;  4CA0 A;  3QYB A;  1BI2 A;  1LVA A;  2I10 A;  4RAY A;  1FTZ A;  4E7S A;  1LFP A;  1U6G A;  2PQ8 A;  2O8K A;  2VON A;  2R92 J;  4I01 A;  1Y1V J;  1JJ8 C;  3I64 A;  1ZRE A;  3RIR A;  2D5V A;  3F8C A;  1BW5 A;  1WI9 A;  4NQW A;  3T8T A;  1Z9C A;  1PP7 U;  4HNT A;  2MW8 A;  3DBR B;  3EUA A;  4G7Z F;  3GVA A;  3E97 A;  3QYF A;  1MH3 A;  2CUE A;  3D5R C;  3I4P A;  3FHN A;  2M8G X;  4GCV A;  2AQE A;  4IHT A;  5C4X J;  1D0X A;  3E6D A;  4OIP F;  3FDY A;  1X3U A;  2JA6 J;  3OYE A;  1FWZ A;  2L4A A;  4II3 A;  5J1U A;  3BR5 A;  4XON A;  5LLQ A;  5LHH A;  2K9N A;  4A3M J;  2JUC A;  2JTV A;  2HEO A;  3V8K A;  2ISZ A;  1OR7 A;  3GTO J;  3GEZ A;  2R7T A;  2BEO A;  5LGN A;  4B4C A;  2Y9Z A;  1U5T A;  2L7M P;  3PNT A;  4UVA A;  2R4G A;  1K4S A;  3K4B A;  3LWF A;  4IL6 C;  4Q5S F;  2W24 A;  4BXF A;  1JXS A;  1TT0 A;  1F1Z A;  2VKE A;  2FF4 A;  1Y8R B;  3PUB A;  1EV7 A;  4CCJ A;  1FNN A;  2HS5 A;  5CQE A;  4I6Z A;  5GP9 A;  4P9U A;  1BIB A;  2DMN A;  1WQ2 A;  5JLW A;  3BG5 A;  3NAU A;  3SQN A;  1X3W B;  3JRI A;  1GV5 A;  3RQI A;  1KQ8 A;  1F4K A;  5AIP A;  1XPX A;  3J81 K;  5LRS A;  1GXQ A;  5GPA A;  2NOG A;  4C2U A;  2L4M A;  2ZJR F;  5GAD J;  3DU6 A;  2XGD A;  2LR8 A;  4KIT B;  3QP6 A;  4XLH A;  2EWN A;  2RNG A;  1ACI A;  2F5V A;  2IW5 A;  2LD5 A;  3FKI J;  2QZ8 A;  3WU1 B;  3FWE A;  3Q0V A;  3ESW B;  2XGE A;  4CCN A;  2X0L A;  4IQJ A;  2LDU A;  5E1Z B;  2Q2E A;  2XPU A;  3A2K A;  3D1N I;  1IC8 A;  1DU6 A;  2O5R A;  4BHC A;  4RB3 C;  3HDD A;  1E3O C;  5FRN A;  2ESN A;  3ZGK A;  4BXU A;  2DMP A;  4S04 A;  5BQT A;  1U9N A;  3I54 A;  3V8J A;  3HSF A;  2XAG A;  3LSJ A;  2PN6 A;  4EM0 B;  4YFN F;  2M9H A;  1SVO A;  1D8J A;  1YFH A;  3KLO A;  5E3N A;  3BJA A;  4OOI A;  2R7Q A;  3V42 A;  5GAG J;  2IRF G;  2LY9 A;  4F91 B;  3C2G A;  2EV6 A;  3AKZ A;  4BQA A;  2QSH X;  2HOA A;  1NK3 P;  2MD5 A;  1YOV B;  2M4K A;  1ZK8 A;  4D5C A;  4ZDO A;  1W5C C;  2BXY A;  3H9G A;  4AC0 A;  5B66 C;  2ZME A;  2N8G A;  4BJT A;  4UY8 I;  1FSH A;  2V79 A;  3ABT A;  1BIA A;  1ZRD A;  1XSX A;  4PDK A;  1VZ0 A;  3B6A A;  1JTY A;  4L5J A;  4EAT A;  4L18 B;  4UB8 C;  3VYU B;  3PL8 A;  3ZRG A;  3CMA I;  2XAU A;  4FET A;  3CMY A;  3K6G A;  2ZC2 A;  1MMN A;  3C3W A;  4RA2 A;  1J75 A;  5F0C A;  1UST A;  3HZJ A;  2KHM A;  4I02 A;  1ZGW A;  1TC3 C;  2TCT A;  4A3D J;  1A5J A;  3G6E I;  5J8C A;  2LF8 A;  4BAY A;  3SZG A;  4G6Q A;  2F4O B;  4D5F A;  3SZP A;  4HSR A;  1SVM A;  1QHG A;  4DBQ A;  1U8B A;  2WAF A;  1XCB A;  2WAD A;  3G71 I;  2PFB A;  2DA6 A;  4N9I A;  1G3T A;  1L0O C;  2PMH A;  4KIF A;  5CVJ A;  4AUX A;  2A6T A;  4E70 A;  2DFI A;  4HX4 A;  2XPV A;  4II2 A;  2QQA A;  1Z67 A;  3S16 J;  3ZQG A;  3HL2 A;  2LC2 A;  4WXD A;  2FQ3 A;  1CF7 A;  2CYY A;  1SD4 A;  2VAS A;  2R3S A;  1O3Q A;  3BDD A;  3CQZ J;  3HUG A;  1FOX A;  4RM3 A;  5K5O A;  3ASN H;  2RRE A;  2ZKZ A;  1WCM J;  3VSK A;  1EJ9 A;  2OZ6 A;  1VI0 A;  1EKE A;  5C3E J;  2A07 F;  1XSD A;  4FAS D;  4I2O A;  1HC8 A;  2DQL A;  4LJZ F;  4A3L J;  1P4W A;  2IS1 A;  1DPU A;  3HIF A;  5CYV A;  4KN7 X;  4JX5 A;  3H3V K;  3W3C A;  3DLL F;  1HA8 A;  1XGS A;  4XLE A;  2OCC H;  2ZXI A;  3VDX A;  3I9V 2;  3WU2 C;  1IXS B;  3CJT B;  2ZSH B;  3GZ5 A;  1TBX A;  5FKN A;  2CQ7 A;  3F22 A;  2FOK A;  5KVR A;  3TKY A;  2VJ4 A;  3LQQ A;  4ZYG A;  3QYE A;  1SD5 A;  1WJB A;  1STZ A;  3CMM A;  3IUO A;  3MZY A;  1Y0U A;  1V3F A;  3CJQ B;  3CO6 C;  4A6E A;  5J1R A;  2DYS H;  5KAF C;  3OIQ A;  4B3A A;  2OAZ A;  2GQQ A;  3BCA A;  3RZO J;  3PFI A;  2XUB A;  3KX2 A;  4ENJ A;  2HXI A;  4PJN A;  3S93 A;  1VQN I;  5IOZ A;  2LG4 A;  1YX3 A;  1RI7 A;  2IJL A;  2OPT A;  1JT0 A;  2EFP A;  3D5L A;  3IWF A;  2KDZ A;  3MVP A;  2NXN B;  3BRO A;  2XGX A;  2LTP A;  4LIU A;  1OCT C;  2RAE A;  3HM5 A;  3L09 A;  5DD8 A;  4E7I A;  3L2W A;  3PO2 J;  2O6G E;  1IN5 A;  2B0L A;  1W7P A;  2BGC A;  3BPX A;  4RAG A;  1FBQ A;  1OJL A;  3BQZ A;  4WXH A;  4L0Y B;  5F08 A;  2Q0O A;  2RGV A;  1X2M A;  1BR1 A;  4ABZ A;  2R5Y B;  2P6S A;  1B9N A;  1KU3 A;  3HXL A;  4F52 A;  4KDP A;  2JQ7 A;  2JA7 J;  3HYI A;  2V1N A;  2VT2 A;  5F04 A;  3GTJ J;  2E7W A;  3CUO A;  4C3H J;  5LGT A;  5FKK A;  1ZLJ A;  4HRI A;  2MC4 A;  3CCE I;  3ZN0 A;  3JCU C;  1OCR H;  3WGI A;  2K27 A;  1FY7 A;  2STT A;  5FGM A;  1G3Y A;  1LVK A;  2MH2 A;  3WOD F;  4XKV A;  1UFM A;  3C1D A;  1O3T A;  4XLP F;  1ON1 A;  2D45 A;  1LB2 A;  4KNY A;  1I3A A;  4V19 K;  3IH2 A;  4HV5 A;  5M3F J;  3VOD A;  2DPU A;  1WH5 A;  1WPK A;  2YX4 A;  3PM1 A;  1RRJ A;  1RUN A;  1BC8 C;  3AG1 H;  2L54 A;  2GM4 A;  4RBO A;  3F23 A;  1BC7 C;  4C2T A;  2VJ5 A;  2PJR A;  3H0D A;  2UZK A;  3FK7 A;  1UJ8 A;  2OBP A;  1SMY F;  2QF7 A;  4I0A A;  1PYV A;  2RNJ A;  4BS9 A;  2YUS A;  3T0Y A;  4KT5 C;  2IXS A;  3OYA A;  1YIT I;  4LK0 F;  3W6V A;  1D0Z A;  5AIQ A;  1GDT A;  4KFC A;  3F3X A;  4OWR B;  1OIS A;  4HX8 A;  1LJ9 A;  5BNG A;  5TGT A;  4RGS A;  5EEA A;  3BT9 A;  1FIP A;  3ABM H;  5J3L A;  3GUD A;  3M7G A;  2ADU A;  3CCL I;  1MNM C;  1YE9 A;  3R0A A;  4L9T A;  3AL0 B;  2CWE A;  3CJR B;  4PSX A;  4DYR A;  4QWQ A;  3Q0U A;  4L9V A;  1JKQ C;  1MW7 A;  3G1O A;  3NWT A;  4G12 A;  1RIO H;  3HOY J;  2LMD A;  2HPI A;  1N77 A;  2R7V A;  1XMA A;  2HYJ A;  3QOP A;  4QPQ A;  3PNY A;  1TWH J;  1ZG5 A;  1Z1D A;  1SD6 A;  3KLN A;  3DU5 A;  3VSL A;  3PO3 J;  3OYK A;  1Y8Q B;  3HC7 A;  3ZMT A;  5BMZ A;  1S3J A;  2Z1D A;  2L9V A;  2NOJ B;  4HOB A;  3ZCO A;  4EJW A;  5CQG A;  1J7K A;  2M34 A;  5F1J A;  2QQ9 A;  2BXZ A;  2IAI A;  4O5V A;  3A02 A;  3FX3 A;  3BR3 A;  1X2N A;  5BPI A;  1ETW A;  3VEP A;  1X4P A;  2ID3 A;  4DZJ A;  5B3S H;  2CFX A;  4JX6 A;  2DOD A;  3M9A A;  5DM6 F;  1LFB A;  4EJV A;  3M4O J;  2Q2E B;  4P55 A;  3LSH A;  4M3G A;  4KIG A;  1W36 D;  1R23 A;  1YLF A;  3LSI A;  4Y4R A;  3L2V A;  2OTL I;  5HNH A;  3QPS A;  3DP7 A;  3E5Q A;  4LB5 A;  4L5I A;  4YFK F;  1YW9 A;  2BV6 A;  1G4D A;  1R49 A;  2M3A A;  3A03 A;  2ETH A;  3QWL A;  1LUJ B;  4UVC A;  5E3L A;  1R1V A;  3WTY C;  4DYQ A;  3BR6 A;  2OUM A;  2ZME B;  3MQ0 A;  5HS8 A;  1FOK A;  3E6C C;  2QEN A;  3DKX A;  2KT0 A;  2Z99 A;  2HU9 A;  1IRX A;  4G7H F;  2VBW A;  3BJ6 A;  4LLN A;  5DCF A;  3QOD A;  4F92 B;  1AHD P;  3HEF A;  3L2C A;  5IYD J;  1U8R A;  4M3B A;  3JRH A;  1ORK A;  5C44 J;  3LSK A;  5HLG A;  2XDV A;  2FJ1 A;  2DMU A;  5EGO B;  2D1V A;  1O3R A;  3WTW C;  2MFZ A;  5K5Q A;  5IPA A;  3HPG A;  5JFR A;  3OYB A;  4MHG A;  5FJ8 J;  4FQG A;  3LAP A;  3IHU A;  4XQF A;  5TJJ A;  3IH4 A;  1MSF C;  1E2X A;  2P7V B;  1AOY A;  2A5Y B;  3I0T A;  1A04 A;  4OAZ A;  1LEB A;  3TED A;  1YS6 A;  3K2Z A;  3VYT B;  3S32 A;  3O2P E;  2GAU A;  3HUG B;  2QSG X;  3OWT A;  2COM A;  1IV8 A;  2R5Z A;  3V7C A;  5E1X A;  1E17 A;  3FMQ A;  2OTJ I;  4QPO A;  2QVO A;  2HGC A;  2NAZ A;  4KN4 X;  3DPU A;  1EF4 A;  2DOF A;  4NUB A;  3DTK A;  2A5W A;  2VN2 A;  3TOB A;  5E8I A;  1CGP A;  4HA8 A;  4A3J J;  4U88 A;  4PZJ A;  4BYY A;  3KP3 A;  1VQO I;  3RSN A;  2EV0 A;  2BY1 A;  1QA6 A;  5IP6 A;  4BBR J;  1UHM A;  2JN6 A;  3LA2 A;  2YS9 A;  3E1S A;  3MMY B;  3HB9 A;  2DT6 A;  1OR7 C;  1UZC A;  3EYI A;  2IEK A;  1BN5 A;  1W36 C;  1LE8 A;  1U5T C;  1TLH B;  4G6T B;  1R9T J;  4A6D A;  3V7R A;  2ZCW A;  2CQQ A;  3JR9 A;  4RGX A;  4XSZ F;  3FBN B;  2D1H A;  2L7Z A;  2IA0 A;  3FF5 A;  3ZQQ A;  5EYR A;  2A69 F;  4HLX A;  2O9L A;  3VB2 A;  3ABK H;  1N75 A;  2L5Q A;  5L3E A;  2LFB A;  3ML6 A;  1D1C A;  1R5G A;  2KRF A;  3VFZ A;  4HPQ A;  1W5T A;  3B6C A;  4BBS J;  3O8G A;  2EZK A;  3GF2 A;  3PFY A;  3CCS I;  1R1T A;  2CG4 A;  2CJJ A;  2KRH A;  2GLO A;  2K4J A;  2X48 A;  2Y9Y A;  3C18 A;  2WAE A;  2HI3 A;  4NC8 A;  4AWX B;  2QGU A;  1P4X A;  1KON A;  1DP3 A;  5D6F A;  4A2U A;  3HKZ N;  2X6Y A;  3KP4 A;  3K0L A;  1E3P A;  3BPV A;  3TO6 A;  4IO9 F;  2OA4 A;  1FBU A;  4PK4 A;  5FLV A;  4XOR A;  4A0Z A;  2CUZ A;  4XSX F;  4HNV A;  3KYL A;  4BQO A;  1O3S A;  4G8X A;  4L0Z B;  3ZOB A;  2FXA A;  4ASN A;  4MNU A;  1W5S A;  4JOM A;  5F1R A;  1V55 H;  3HRS A;  2ZXH A;  5E3O A;  2OD5 A;  3BG6 A;  4P9F A;  3DWL E;  1G3W A;  4LLL A;  2LLK A;  2LKX A;  2WV1 A;  2DMQ A;  1RC9 A;  1D0Y A;  2QKM B;  4ENN A;  3ABL H;  1GVJ A;  2FRH A;  3QU6 A;  3CLO A;  4UUS A;  3LFK A;  1T98 A;  1K78 A;  3OY9 A;  4Z2Y A;  2IGM A;  1K83 J;  2IGO A;  2DA5 A;  1H88 C;  1WJD A;  4R1H A;  2ZJP F;  1NG7 A;  3L2U A;  2JA5 J;  5JVG F;  2HOS A;  3QPH A;  3DFG A;  3ECH A;  3RPU D;  5FD5 A;  2CMP A;  1Q1H A;  1ETX A;  4OU0 A;  2HYF A;  2FSW A;  4ZTF A;  2HZT A;  3V7S A;  5J4Y A;  4IHS A;  4HBL A;  5DV5 A;  2VOP A;  2HNH A;  1HKT A;  3ZQL A;  2AQF A;  3F6V A;  2EBI A;  3BOQ A;  3ZQC A;  3GFM A;  3ROU A;  1O7F A;  2BW3 B;  4M6X A;  3HGY A;  5FKM A;  2RC4 A;  2HKX A;  4A5M A;  3WTT C;  1RR7 A;  2VPR A;  1ERD A;  4ESB A;  4DZP A;  3SFI A;  3S1N J;  2IA2 A;  1DQU A;  2L7F P;  1GHC A;  5AON A;  5HLH A;  1T38 A;  3HKZ A;  4IVN A;  2R7D A;  2EFO A;  1UAA A;  3HTS B;  3JRA A;  1OFC X;  2MA3 A;  3MKZ A;  3CCJ I;  2LRE A;  1FEX A;  2CW0 F;  2K3F A;  2Y30 A;  1X3Z B;  2F5F A;  2VJJ A;  4FE4 A;  3SYT A;  4IKF A;  3HSE A;  4U7B A;  1ZAO A;  3RCO A;  3K10 A;  1IN6 A;  2KZG A;  2KDO A;  3L1P A;  4F55 A;  5F6F A;  4U7D A;  4B44 A;  3H5N A;  2VOD A;  3PUF A;  3LAJ A;  5H6Q A;  1TQI A;  3WG7 H;  2NVQ J;  2V7F A;  2K4B A;  2KMU A;  2Y0M A;  3WG9 A;  1ZQ3 P;  3T8R A;  3H3U A;  5HS9 A;  4AD9 A;  2FML A;  5E8G A;  3RKQ A;  3MZH A;  2EB7 A;  1O7L A;  1NTC A;  3ZR8 X;  2R7Z J;  4X1E A;  4X6A J;  3WHC A;  3K69 A;  4AM3 A;  3HTU A;  5HOO A;  2X1D A;  1YRN A;  2XSD C;  3R6S A;  4ZYD A;  4YEL A;  4FX4 A;  2ECC A;  5E20 A;  1XB4 A;  2M8E A;  4ZYA A;  4WWC A;  3COA C;  1XCV A;  3IL2 A;  1T56 A;  2FNP A;  2XF7 A;  4CYC B;  2P8T A;  2QEX I;  1U78 A;  3P9I A;  5GTH C;  4KUM A;  4CDG A;  1T39 A;  2BY2 A;  2IGN A;  3BR0 A;  3EQL F;  2ME0 A;  4XLC A;  3JRG A;  3T5X A;  5EEH A;  2G0E A;  2GZW A;  2HTS A;  1MSE C;  4PJ0 C;  3TOA A;  3C2H A;  2KLO A;  1V5F A;  3I4M J;  3I59 B;  3CUQ A;  5HLT A;  2CO5 A;  1IDZ A;  1R00 A;  1LPQ A;  3OYF A;  3ZQH A;  3I58 A;  1XC5 A;  5CVI A;  4ZDL A;  2MAB A;  4U87 A;  1VQ9 I;  2IVM A;  3G3Z A;  3S1M J;  4BE2 A;  1BOA A;  2JVH A;  3BG9 A;  3PIP F;  1SFK A;  3FZV A;  5FB2 A;  4HST A;  4XRM A;  3TBI A;  1K4T A;  3G1L A;  1T0F C;  1T08 B;  1YO5 C;  5ICE A;  2XF6 A;  2F4M B;  1MBE A;  3DBL B;  1DPR A;  3FM5 A;  2EA4 A;  2QLZ A;  4BJ5 C;  4XRS A;  2FEZ A;  1KQ0 A;  2WWY A;  1ZHF A;  3OOP A;  1DGW Y;  1WFX A;  1R5I D;  3EUH C;  4U0W A;  1BR4 A;  4P1W A;  1L3L A;  2R7S A;  1TQP A;  1I50 J;  4FCY A;  1CQT A;  2V9P A;  2CU7 A;  2ZXJ A;  3F6O A;  3WTX C;  3ZQF A;  1TW3 A;  1HDP A;  2L3D A;  3H0G J;  3LFU A;  2BE5 F;  3R60 A;  3PJR A;  5EZH A;  4HF2 A;  1MZB A;  3WHB A;  2R7W A;  1FLI A;  1UB9 A;  2J5O A;  2Z2S B;  1WJE A;  5F0F A;  5LFA A;  3I3L A;  5DEQ A;  3CC2 I;  1QRY A;  2EA2 A;  1IRF A;  3OYD A;  1ETO A;  5JLX A;  5C4J J;  4J19 A;  6PAX A;  2NS7 A;  3OYN A;  1O57 A;  4RAZ A;  1PP8 F;  5DUK A;  2K9Q A;  1PUF A;  1FSE A;  1ETQ A;  3N05 A;  5CJ9 A;  3RYR A;  3E5X A;  2HQN A;  5ICF A;  2JA8 J;  4HYE A;  2CQX A;  2LY1 A;  4GXO A;  3CZ6 A;  4BUP A;  2H6C A;  1LE8 B;  3MN2 A;  2HXO A;  4DYC A;  1Z7U A;  5DS9 A;  3DPT A;  3S15 J;  2VI6 A;  1JKO C;  1ZGJ A;  1SFX A;  3TDZ C;  1XSV A;  2E2I J;  1ZG1 A;  3TW7 A;  4EQQ A;  1IXC A;  3DPL C;  3U1D A;  3SEZ A;  2H8R A;  2Y2Z A;  3CTA A;  1ZH5 A;  1SAN A;  2LOO A;  1A31 A;  1ZEL A;  1KGS A;  4J01 A;  2E35 A;  2FBK A;  3ASO H;  3OV8 A;  2LYC A;  2E5Z A;  2R7O A;  2MH9 A;  2VXZ A;  1D5V A;  4BE1 A;  1JKP C;  3HHG A;  2ISY A;  3H36 A;  1IF1 A;  2XF5 A;  2B9S A;  5EJC A;  2PI0 A;  1IRZ A;  3QAH A;  3OIO A;  3WGG A;  1OPC A;  3QOE A;  3IV5 A;  5EEG A;  2I5U A;  5GPC A;  2EIJ H;  4O6J A;  4A3C J;  2G7U A;  3HG9 A;  4CCL A;  1J09 A;  1OMI A;  4HLY A;  3H1C A;  1H8A C;  4XID A;  1QZE A;  2MBF A;  4MEY F;  1D3Y A;  1RKT A;  4GGG A;  4WF2 A;  4XBF A;  4ZC3 A;  2BBY A;  1VQL I;  3RI4 A;  5KAI C;  1IUF A;  3K4N A;  1YIO A;  1P9Q C;  2PJP A;  4BH9 A;  3Q3S A;  2V4J C;  1VQM I;  3G4S I;  3CCY A;  5L3G A;  1YJW I;  2QA4 I;  3TO7 A;  2LBF A;  1IZ1 A;  1RKW A;  1IUY A;  2BOL A;  3V4G A;  1XDS A;  2XRN A;  4KMU X;  2RKH A;  3JRB A;  4UUS B;  1DU0 A;  1S9H A;  3ULQ B;  1K78 B;  3M3Y J;  4HNU A;  1LDJ A;  3K4M A;  3I53 A;  1VND A;  3IKT A;  4HF1 A;  4HQE A;  2IS6 A;  2DTR A;  4IRI A;  1UCR A;  2ID6 A;  3F8N A;  1TNS A;  1U2W A;  5LHG A;  1H9T A;  4EM1 A;  4LLG F;  5IY5 H;  5JHF A;  5ICG A;  4FIS A;  2JSP A;  4CCK A;  3LA3 A;  1T8I A;  3FXR A;  4E7H A;  1WJF A;  3JSP A;  2EFW A;  2R7R A;  4KMF A;  2M30 A;  2ZB9 A;  4OMY A;  2E34 A;  2R7F A;  3FIW A;  5E3M A;  2M4G A;  2IGK A;  4OIO F;  1I6H J;  4GRI A;  1XN7 A;  4Z6Y A;  3ONQ A;  4EMS A;  5J47 A;  3J7Z I;  4FTH A;  1EH7 A;  4MEX F;  4CUG A;  3UR3 C;  4E4H A;  1X1A A;  1ENH A;  2ECB A;  1QNT A;  4I7H A;  2UUZ A;  2H94 A;  2X9D A;  1WHU A;  4M3E A;  1YW8 A;  1F5T A;  1I6X A;  2QCO A;  2XKO A;  3RPU A;  5EDN A;  1TQM A;  2FBI A;  2A68 F;  2HVS A;  2AS5 F;  1HKQ A;  2LKP A;  2VE9 A;  3EET A;  1F43 A;  2OF7 A;  4B47 A;  3FMS A;  2ELK A;  2YU3 A;  2LH9 A;  4C30 A;  1BJZ A;  2J5P A;  3CES A;  1MMD A;  4BXX J;  1T0F A;  1MJB A;  3SJM A;  2CV0 A;  4MIM A;  4M6Y A;  4WXC A;  1B4A A;  4M9S A;  1IGN A;  5BS6 A;  3EUH A;  4BDY A;  4IF4 A;  4D7M A;  2ZO4 A;  5ILS A;  2HFH A;  3QQA A;  2BZT A;  4D9J A;  2VB6 A;  1ONV A;  2AXT C;  3BTL A;  3DXJ F;  2I8D A;  1YRN B;  2LP0 A;  3DLA A;  4NQW B;  4J00 A;  1S7E A;  3KYC B;  4IHW A;  1UHW A;  1TL8 A;  1I1G A;  3WU0 A;  4KA4 A;  1FOY A;  4MTE A;  1G2H A;  4LK1 F;  2BY3 A;  4D1Q A;  2QWW A;  3GXO A;  1JGG A;  5M3M J;  4B8X A;  4CGZ A;  2IA1 A;  2DT7 B;  5E79 C;  2JMW A;  3WTZ A;  2GA1 A;  3R4K A;  3N4M A;  4A0X A;  1I1S A;  1B1B A;  2V1X A;  1SMT A;  1VQK I;  4WCG A;  3OOU A;  3LL7 A;  2VE8 A;  1TWG J;  1ETV A;  3CLQ A;  1BW6 A;  3RZD J;  3B73 A;  1S72 I;  2DLL A;  3RKW A;  3K1P A;  2CUF A;  1X1C A;  1IN8 A;  2YPR A;  1FJL A;  1U5T B;  3CCU I;  4Q4Z F;  4CIC A;  3BP8 A;  1G6N A;  1O4X A;  4JQF A;  5CVR A;  1W1W E;  3J7Y J;  3U1K A;  2B63 J;  3E3V A;  3HRT A;  1W0U A;  3KIO A;  1U3E M;  4B1R A;  3UKG A;  2L7K A;  4M73 A;  4WK8 F;  3DCF A;  3IAM 2;  1R1U A;  2IBD A;  2P0W A;  4CH7 A;  5EG0 A;  2VQL A;  2CRG A;  1V5G A;  5J40 A;  4EJO A;  2LY2 A;  3MCZ A;  4HQM A;  4X0G A;  3BY6 A;  4XNF A;  2QM3 A;  3S3O A;  3A0H C;  1KU2 A;  2EV5 A;  2HZD A;  1JHH A;  3M1C A;  1B8I A;  4UXN A;  2FD5 A;  1ITY A;  3W6K B;  5TIS C;  2RDP A;  1I27 A;  3ZMV A;  2RQQ A;  2EFQ A;  3ZMZ A;  2EQR A;  2JK3 A;  4BKX A;  2QUF A;  4FT8 A;  1FPQ A;  3SZT A;  4NHJ A;  1LNW A;  3BC8 A;  2KL4 A;  3Q9S A;  2CH0 A;  4E7J A;  3F72 A;  3IKV A;  2CW7 A;  5D5W B;  3CDI A;  1X4O A;  3DEU A;  3SXY A;  5IOY A;  3RKY A;  2HDC A;  4IQ4 A;  2DOA A;  1JE8 A;  2B7E A;  1POG A;  2K02 A;  1MND A;  4Y17 A;  3GFL A;  2EZI A;  1LDK B;  4A3B J;  5FRO A;  4A3I J;  5D5X B;  1Z05 A;  2KPM A;  2E2H J;  1HST A;  3GTG J;  1AA7 A;  3TP3 A;  3H92 A;  1XG1 A;  2DU9 A;  1ZG3 A;  4F3Q A;  5JHU A;  2DDA A;  3U9G A;  4JX4 A;  1GT0 C;  2DN0 A;  2EK5 A;  2IPQ X;  2HQA A;  1JGS A;  1XGN A;  3WE3 A;  4BEH A;  2XAF A;  2VBZ A;  1K79 A;  2FBH A;  2HWV A;  2K86 A;  1JUS A;  4QLC U;  1MGT A;  2DFF A;  2MG4 A;  1ZRF A;  3H9J A;  2H1K A;  2A05 A;  2F6C A;  4DQ2 A;  3WTS C;  5IYB J;  3ZPL A;  4BY7 J;  4AVP A;  2EJR A;  1REP C;  4KIS A;  3TL4 X;  4M9Z A;  2VQG A;  3K4C A;  4C9Y A;  4M71 A;  3LQR A;  1M1E B;  2MGQ A;  4N4N B;  3L2R A;  3A01 A;  3AG2 H;  2XRL A;  3ELK A;  3F0C A;  3QPL A;  2KP6 A;  3VOE A;  3JW4 A;  4TV7 A;  2NNN A;  2X1E A;  3W2W A;  5E18 F;  5ILV A;  4WX9 A;  4I99 C;  2GXB A;  5B1B H;  3FIS A;  3CCQ I;  5JI6 A;  1VFC A;  4LB6 B;  1UG0 A;  3IWZ A;  1CF7 B;  3QU3 A;  2V6C A;  1VTN C;  2O61 A;  2VXD A;  1QU3 A;  4FX0 A;  4ON0 A;  1Z0X A;  4MGR A;  2RN7 A;  4CCO A;  3O6B B;  3BZC A;  3P7N A;  3GTL J;  3MFK A;  3CP2 A;  2W1O A;  5M5X J;  1VQ4 I;  1Y6I A;  4E7L A;  1HOM A;  2LBF B;  3RDI A;  3MEX A;  2PG4 A;  1EH8 A;  3GTQ J;  4CHU A;  3D5S C;  1H0M A;  3IAS 2;  5GAE J;  3DV8 A;  4OIQ F;  2ZNZ A;  5CLS A;  1PUE E;  2ZJQ F;  1BI1 A;  4CZC A;  5B1A H;  2BVL A;  1S29 A;  2P5L C;  1Z21 A;  3P9K A;  1ON2 A;  2M87 A;  1HKS A;  3CUQ C;  2A6H F;  2KIS A;  2HR3 A;  4M72 A;  4PGH A;  4BGD A;  4EJT A;  1SAX A;  3K4L A;  2M7B A;  1XGM A;  2F5C A;  3MD2 A;  4XOT A;  2DJN A;  2QBY A;  2Y0S N;  3E6B A;  3G1M A;  3WE2 A;  5GAH J;  2WTE A;  3MKW B;  3R0J A;  4K2E A;  2XGC A;  2CSO A;  3EUK L;  2CQK A;  5J8F A;  2X6O A;  3IH3 A;  1G8X A;  2MC3 A;  5CVU A;  2CGP A;  2V9K A;  4JK1 X;  2JT1 A;  2QYO A;  3QPT A;  4DIQ A;  3OYG A;  1AWC A;  1JUP A;  2L02 A;  4RAF A;  3K4J A;  1NHA A;  3ZMU A;  1FYL A;  4IX7 A;  1BJA A;  3JRD A;  1W7P B;  3K1M A;  4PFO A;  4RGR A;  1DUX C;  3P9C A;  1T33 A;  3K7A J;  4EV0 A;  3MAJ A;  2K5C A;  1V5E A;  3GFJ A;  1BA5 A;  3GW2 A;  4W1U A;  1MH4 A;  3BTJ A;  2JA2 A;  1R22 A;  2ZJ2 A;  3TGN A;  4ZDP A;  3LA7 A;  2OCE A;  2WB1 N;  2W85 A;  1G59 A;  4DGW B;  3S1Q J;  1GLN A;  1YYV A;  2ZXW H;  1JT6 A;  3BQY A;  1T95 A;  5FO5 A;  2LSO A;  3I5U A;  3D0S A;  4HZF A;  4D0P A;  2NVY J;  4PFP A;  2A61 A;  2E71 A;  3E0J B;  1Z7L A;  2ELH A;  3ZMD A;  5D8K B;  3W2A A;  1IRG A;  2A3S A;  4F7Z A;  1SVL A;  2K9M A;  3OYH A;  2JPB A;  5TRD A;  4E7Z A;  4S0H B;  5H6R A;  4ZZL A;  2VPL A;  3HSR A;  2HKO A;  4PJM A;  5DD4 A;  4Y13 A;  3JRF A;  1FZP B;  2JJ7 A;  2L2O A;  1W0T A;  1BI3 A;  4MQV A;  1IG7 A;  3S3M A;  3H5A A;  3JAM Z;  1FP1 D;  1R71 A;  1HDD C;  3ZQI A;  3OSF A;  2PJR B;  3TDU C;  2Y0S A;  1DP7 P;  5F27 A;  2PBI A;  2DOE A;  3GYH X;  4KIB A;  4IOA F;  4IHX A;  2DK8 A;  1DDN A;  3K2A A;  3CDL A;  2VJI A;  5IP7 J;  1QBJ A;  2P4W A;  5LGU A;  4DJA A;  4A3E J;  3P5J A;  3F8M A;  4M74 A;  1MIJ A;  2XVC A;  1UMQ A;  4RB0 A;  2TDX A;  1U9O A;  5BOX A;  2VT3 A;  4HAM A;  2EZL A;  5LHI A;  3AAF A;  2DCE A;  1Z6R A;  2PLY A;  3CC4 I;  4M3F A;  3S1R J;  4XRS G;  3W2V A;  2W84 A;  3KET A;  3QP5 A;  2HDW A;  1R5H A;  3BZK A;  4AIJ A;  1HBX G;  2QQB A;  4DW6 A;  3DTI A;  2V1U A;  2GXA A;  1XX5 A;  2E1N A;  1SC7 A;  1OCP A;  2HOE A;  3HGG A;  3ABU A;  1R4M B;  2WB1 A;  2KJC A;  1YHQ I;  3IC7 A;  1VQP I;  1B59 A;  3A4C A;  1IV6 A;  2F48 A;  4I98 B;  1VQ7 I;  2RVC A;  3BCB A;  3KZZ A;  3CF2 A;  3FBI B;  1A6Q A;  1S7A A;  2YU9 J;  3KZI C;  2E1M C;  2K9L A;  1VQ5 I;  2F2E A;  1RR8 C;  1JI8 A;  2HTJ A;  1SFO J;  3OYM A;  4BJ6 C;  5CPR B;  2PX9 A;  4OAY A;  3J80 K;  1Q1V A;  2NVU B;  4A3G J;  1TP4 A;  1B72 A;  2K9S A;  4XN3 A;  5HDG A;  1GUU A;  1JJ6 C;  3EYY A;  1XMX A;  3HPH A;  3HJE A;  3RPQ A;  2DBB A;  3KPH A;  2K40 A;  3R61 A;  1E0E A;  2AO9 A;  3F8B A;  1YI2 I;  4HDV A;  2FA5 A;  4XKC A;  5L3B A;  3OSG A;  2VOO A;  2CUJ A;  2Y31 A;  3LMM A;  2DA4 A;  3MZ8 A;  4N4O B;  2VKV A;  3FHZ A;  3HOV J;  5GTI C;  4Y3O A;  1USS A;  2FNA A;  2TRT A;  3S17 J;  1Z77 A;  1Y0N A;  3H3Z A;  4YIF A;  5F0H A;  1A35 A;  3DF8 A;  4HF0 A;  1J59 A;  5EZG A;  4BL0 B;  4MTD A;  1W4M A;  3BZ6 A;  1X58 A;  3RQ4 A;  4YG2 F;  3HOT A;  5DM7 F;  4BEH B;  5D4R A;  5ERI A;  2BHZ A;  3OMY A;  1IO2 A;  2FU4 A;  3OS2 A;  3OIP A;  3JRC A;  2CV2 A;  3RKX A;  2HYG D;  1N78 A;  1YW7 A;  3Q5F A;  3NQO A;  3O3K A;  3TMO A;  4A3K J;  4LD5 A;  4YFX F;  4R79 A;  3S14 J;  1K6Y A;  3KEO A;  4O3M A;  2IS2 A;  2KIU A;  2LKS A;  4CZZ A;  1D8K A;  3VYR B;  1XTA A;  5D5V B;  3I4N J;  3ISP A;  3N97 A;  4C3I J;  1H9G A;  1PDN C;  3A01 B;  4IJA A;  1SEU A;  2HVQ A;  2DAO A;  3FXM A;  2ZFU A;  2P5K A;  3IRR A;  4DNC A;  5D5U B;  2D2W A;  4XN0 A;  1RET A;  4IRG A;  4JP0 A;  2DI3 A;  1BBY A;  1B6A A;  1RES A;  3DEE A;  2WBM A;  3I55 I;  3GZN B;  2R5Z B;  4YRV A;  3KP6 A;  9ANT A;  1X19 A;  3F8F A;  1X1B A;  4HW0 A;  2L01 A;  2R93 J;  1WJC A;  1S5L C;  2DFE A;  2UXX A;  2VC0 A;  4A12 A;  2CQN A;  2X4H A;  2H27 A;  1RZ4 A;  1YX5 A;  1ZKG A;  1MBF A;  1ZAR A;  2W57 A;  5CVV A;  1HW2 A;  2CW8 A;  3CJN A;  1ZN2 A;  3AFH A;  3WTU C;  3ZXS A;  4ANJ A;  2G7H A;  4ZZD A;  5J1Y A;  4ESJ A;  3VWB A;  2R7U A;  1JTX A;  2ZNY A;  4LGW A;  2EZH A;  2Z5U A;  3RJP A;  1XGO A;  2IP2 A;  3PSF A;  2LRD A;  2ICW G;  1T2K A;  1H89 C;  1AKH A;  2EIK H;  3VPR A;  1ZRC A;  2JUG A;  4P96 A;  5LD2 C;  3U21 A;  4ENK A;  1LKX A;  1HW1 A;  2G9W A;  1GVD A;  3VYS B;  4IOC F;  2KFD A;  1LQ1 A;  1QGP A;  4CSW A;  1KU7 A;  2QBY B;  3A1Y A;  3Q0W A;  2DJI A;  2YR2 A;  3KP7 A;  2GIZ A;  2HQ5 A;  4UHT A;  3H5R A;  3BJO A;  1I5Z A;  3M1E A;  2PEX A;  3FKJ A;  2GOX B;  1MMS A;  1FX7 A;  1X1P A;  1YQA A;  2VL8 A;  4XLN F;  4HV6 A;  3FXL A;  3S2H J;  4LIV A;  3HOZ J;  3DBH B;  2GXG A;  4RS8 A;  4RDU A;  4NDL A;  4C3J J;  3RYP A;  3B02 A;  2CV1 A;  4I76 A;  3L00 A;  1WGX A;  1WSU A;  4IHV A;  5HVQ C;  2VBX A;  2BY0 A;  3KP2 A;  1FOW A;  2WY7 Q;  5LRR A;  2NNY A;  3E6M A;  1QO0 D;  2FX0 A;  3SDG A;  5EF6 A;  4MO7 A;  2O03 A;  4B43 A;  2X51 A;  3NAR A;  1JUM A;  2VKH A;  4IZZ A;  2XAJ A;  3GZ6 A;  2JRM A;  2LVS A;  4A5N A;  4OIR F;  5E17 F;  1BL0 A;  3HOS A;  3L9F A;  1OLT A;  4Y15 A;  1SFU A;  2H09 A;  2IS4 A;  2VKD A;  2V26 A;  1Y56 A;  2O8X A;  5M5Y J;  3CCV I;  3BTI A;  3DTE A;  4E6K G;  5FKO A;  4BHP A;  4RGU A;  3FXQ A;  3GME A;  2L0K A;  3PQK A;  3CDH A;  2L9S A;  3KP5 A;  1XS9 A;  3CCR I;  3L7W A;  2EH3 A;  2MSY A;  1BOB A;  5EGO A;  2P7C B;  4IHY A;  1AU7 A;  2DQR A;  3FXO A;  4XRF A;  4PUS A;  4L5E A;  1K61 A;  4XL9 A;  4DOZ A;  2R0Q C;  2C6Y A;  5B5E C;  2DYR H;  3JAM K;  2DPD A;  3H9Q A;  1VF9 A;  2O7O A;  1YG2 A;  3MKY B;  2XB5 A;  2M0M A;  3SEQ A;  2Z33 A;  1QHH D;  2R7X A;  2OJE D;  1MKM A;  1U0J A;  5E1W A;  2EIN H;  4ZYH A;  2PMZ N;  5DYM A;  3BR2 A;  3M07 A;  3I71 A;  3REO A;  1V4R A;  4BHB A;  4ESF A;  2JZY A;  2W82 A;  4M3D A;  4XKB A;  1FYK A;  5K7H A;  2EPF A;  5ICC A;  2M0C A;  1OCO H;  4PJJ A;  3AG4 H;  3EDP A;  2FQ4 A;  3KE2 A;  4KT6 A;  5LEJ A;  3X2Q H;  4RB1 A;  3LSM A;  1FBS A;  1SFE A;  2WAQ N;  2JVG A;  2HOT A;  5A2Q Z;  3JSO A;  3JTH A;  4PJL A;  5IT9 K;  4ETS A;  3CF5 F;  4G9Y A;  2LNB A;  3HRU A;  5ILU A;  2KIQ A;  4R8H A;  5KNL A;  1TWC J;  3L2Q A;  3J7A Y;  1UHS A;  3OR2 C;  5H20 A;  1C0W A;  1A36 A;  2MD0 A;  3K70 D;  4RMN A;  4G6D A;  2OC6 A;  1ZR2 A;  2ELJ A;  2DO7 A;  3HHH A;  1QPI A;  3TO9 A;  3S2W A;  3C2B A;  4CO8 A;  1R4N B;  2EIL H;  2F4I A;  1WWX A;  2QQ8 A;  1EH6 A;  2VC1 A;  3AG3 H;  5BPD A;  2XPW A;  4XKW A;  5JVT A;  4G7O F;  4U0Y A;  4Q48 A;  2V6E A;  3CME I;  2UV1 A;  2WV0 A;  2XAQ A;  2JRT A;  4JBA A;  3GCM A;  1TTY A;  4LG0 A;  3DEW A;  5DCM A;  1KU9 A;  1J9I A;  3BTC A;  4B09 A;  4RLQ A;  2DA2 A;  4U0V A;  3V8L A;  5F64 A;  1APL C;  2JSC A;  3ZMS A;  4B48 A;  1MDM A;  2KIF A;  1B9M A;  2K85 A;  4ZTJ A;  1WI3 A;  4UV8 A;  2DFH A;  2AXL A;  4AU7 A;  2PMU A;  4Y52 J;  1F36 A;  2XV4 S;  1UG2 A;  4AIH A;  5FKL A;  4BNC A;  1BR2 A;  3GLX A;  1FMV A;  1OCC H;  1OQY A;  4LMY A;  1D5Y A;  4ENM A;  3OS1 A;  1XD7 A;  1B72 B;  2XAH A;  3LSP A;  2CFO A;  4NBQ A;  4A69 C;  2E36 A;  5HS7 A;  2VUM J;  1HSJ A;  1S6L A;  2PMZ A;  4NB5 A;  2DTZ A;  5DTD A;  1P7J A;  3RTR A;  5FRM A;  1OKR A;  2XIG A;  2FE3 A;  4NC7 A;  1YIJ I;  2ZSI B;  5ED4 A;  1WJA A;  5K1Y A;  2V9V A;  3H35 A;  1Y39 A;  1RNL A;  4XOP A;  1BM9 A;  4GYG A;  1HQC A;  2WAQ A;  1MJ9 A;  3K1N A;  4CXF A;  5IYC J;  2RQP A;  2M7A A;  1FP2 A;  4JYK A;  2AHQ A;  2W48 A;  4DBR A;  5FD6 A;  2E2J J;  3CUQ B;  1P6R A;  1R36 A;  2DT5 A;  3HRM A;  4V2G A;  2GIV A;  4OIN F;  1VQ8 I;  2O0Y A;  1TZL A;  2JPC A;  3GLL A;  3OR1 C;  4XMY A;  2W25 A;  5HNF A;  1MBG A;  5KHD A;  2M5W A;  5FLX Z;  1PVE A;  1SAU A;  3PSI A;  3NEU A;  1OYI A;  3FMR A;  2Q1Z B;  2Z3Y A;  3M8E A;  3U2R A;  4BE0 A;  3BLY A;  1WVR A;  5L3C A;  3CC7 I;  2O3F A;  1IDY A;  2EIM H;  4BQN A;  4BQQ A;  3I56 I;  3QRF F;  2E1O A;  2ZBK A;  4YII A;  1YTY A;  4IRH A;  4XM3 A;  4XLF A;  5J4V A; 
#chains in the Genus database with same CATH homology
 2DJN A;  5IP9 J;  2Y0S N;  3G1M A;  3WHC A;  4X6A J;  1QVU A;  2DA1 A;  4AUX A;  1FTT A;  1YRN A;  2XSD C;  2XPV A;  3S16 J;  2ECC A;  3ZQG A;  2XGC A;  3HBL A;  3JRE A;  1T56 A;  1U78 A;  4CYC B;  3CQZ J;  2X6O A;  3IH3 A;  3LOC A;  3BR0 A;  2ME0 A;  5K7F A;  3JRG A;  1WCM J;  3BR1 A;  2G0E A;  1VI0 A;  2DMT A;  1JUP A;  2E19 A;  5C3E J;  1MSE C;  3JRD A;  2ME6 A;  3I4M J;  4A3L J;  1IDZ A;  1T33 A;  3H3V K;  4JX5 A;  3K7A J;  4AYB N;  1BA5 A;  3ZQH A;  4W1U A;  1MH4 A;  1XC5 A;  1I3Q J;  3BTJ A;  3S1M J;  5FKN A;  3S2D J;  1PUF B;  3BG9 A;  1AKH B;  2WB1 N;  3S1Q J;  4XRM A;  3G1L A;  2DA7 A;  1JT6 A;  3BQY A;  1MBE A;  3TW6 A;  4XRS A;  5J1R A;  2NVY J;  4M6V A;  4B3A A;  3GTK J;  2LK2 A;  3RZO J;  1ETK A;  4S0H B;  2HXI A;  5IOZ A;  4CYC A;  3JRF A;  1WH7 A;  1I50 J;  2OPT A;  2JJ7 A;  4FCY A;  1JT0 A;  1ZTR A;  1CQT A;  2CU7 A;  2KDZ A;  1W0T A;  1IG7 A;  3MVP A;  1HDD C;  3ZQF A;  1HDP A;  3H0G J;  3ZQI A;  1RPW A;  5EZH A;  3OSF A;  2LTP A;  4MLO A;  5F27 A;  3WHB A;  1OCT C;  2RAE A;  3HM5 A;  5F0F A;  3PO2 J;  3GTM J;  4IHX A;  4LOC A;  3E7L A;  1QRY A;  1OJL A;  3BQZ A;  3K2A A;  1ETO A;  5F08 A;  3CDL A;  3LSG A;  5JLX A;  5C4J J;  5IP7 J;  4J19 A;  1X2M A;  1MBJ A;  4ABZ A;  2NS7 A;  2R5Y B;  4A3E J;  4Y7N J;  2COB A;  2JA7 J;  2K9Q A;  2P81 A;  1PUF A;  4C2M J;  1ETQ A;  5F04 A;  3GTJ J;  2JA8 J;  1UMQ A;  4C3H J;  2CQX A;  5FKK A;  3LSR A;  1LE8 B;  1U9O A;  3MN2 A;  1IJW C;  2HXO A;  4DYC A;  5DS9 A;  2NVX J;  3S15 J;  2EZL A;  2VI6 A;  1JKO C;  3BG3 A;  4M3F A;  3S1R J;  4XRS G;  2E2I J;  3TW7 A;  4DW6 A;  2NVT J;  2H8R A;  2Y2Z A;  1SAN A;  1JKR C;  1OCP A;  3HGG A;  3IH2 A;  1HCR A;  5M3F J;  1WH5 A;  1WPK A;  3PM1 A;  2GBY A;  1JKP C;  1IV6 A;  2GM4 A;  4RBO A;  1IRZ A;  3O8H A;  3OIO A;  3IV5 A;  3FK7 A;  2QF7 A;  2YU9 J;  5GPC A;  5FLM J;  2YUS A;  4XK4 A;  1SFO J;  4A3C J;  2JWT A;  3W6V A;  1HLV A;  1Q1V A;  4A3G J;  1H8A C;  1GDT A;  4XID A;  4QIW N;  1B72 A;  2K9S A;  2L9R A;  1RKT A;  1JJ6 C;  1GUU A;  5BNG A;  4XIC A;  2K40 A;  5EEA A;  3BT9 A;  1FIP A;  2AO9 A;  1Y1W J;  5J3L A;  1IUF A;  1MNM C;  3OSG A;  3Q3S A;  2Y31 A;  2DA4 A;  4QSH A;  2DA3 A;  2VKV A;  3HOV J;  3CCY A;  4DYR A;  4QTR A;  2TRT A;  3S17 J;  2NS8 A;  3Q0U A;  1Z77 A;  1ZR4 A;  1JKQ C;  3G1O A;  1RKW A;  5F0H A;  4G12 A;  4MFE A;  3HOY J;  4W97 A;  2HYJ A;  3MKL A;  5EZG A;  1NK2 P;  3JRB A;  4UUS B;  1DU0 A;  1X58 A;  3M3Y J;  1TWH J;  5K7Z A;  3PO3 J;  1HF0 A;  1VND A;  1ETY A;  3JRC A;  1MBK A;  2ID6 A;  2M34 A;  5F1J A;  4A3K J;  2IAI A;  3A02 A;  3HOX J;  4IEJ A;  3S14 J;  3BR3 A;  1X2N A;  4FIS A;  1ETW A;  2ID3 A;  4DZJ A;  4JX6 A;  3I4N J;  3M4O J;  1LFB A;  4GFB A;  4M3G A;  4C3I J;  4EEF G;  2ZB9 A;  3A01 B;  5M5W J;  1MBH A;  3FIW A;  5E3M A;  1I6H J;  3QPS A;  4FTH A;  1RET A;  1LFU P;  4JP0 A;  1ENH A;  2XB0 X;  2ECB A;  4D7N A;  1RES A;  2R5Z B;  2X9D A;  3HOW J;  9ANT A;  3A03 A;  4M3E A;  2R93 J;  2QCO A;  5E3L A;  5EDN A;  4DYQ A;  2HDD A;  3BR6 A;  1P7I A;  1F43 A;  1ZKG A;  2OF7 A;  1MBF A;  2ELK A;  2KT0 A;  4V2F A;  3TP0 A;  1BJZ A;  5J1Y A;  4BXX J;  3GBG A;  3SJM A;  2M2E A;  4MIM A;  3LNQ A;  1JTX A;  1AHD P;  2EZH A;  3HEF A;  1H89 C;  5IYD J;  5HOD A;  1AKH A;  3FK6 A;  4M3B A;  4MFD A;  3VPR A;  3JRH A;  1ORK A;  1IGN A;  3GTP J;  5C44 J;  4A93 J;  2FJ1 A;  2DMU A;  4D7M A;  5EGO B;  5EG0 B;  1TWA J;  1GVD A;  5IPA A;  3QQA A;  5FJ8 J;  1GV2 A;  3Q0W A;  2HQ5 A;  1A6I A;  3BTL A;  3IH4 A;  1MSF C;  1YRN B;  2O8K A;  2LP0 A;  4IHW A;  1S7E A;  1FIA A;  3S2H J;  4UUT A;  1B8I B;  3HOZ J;  1G2H A;  4BY1 J;  3TED A;  4RDU A;  4NDL A;  1JGG A;  5M3M J;  4C3J J;  4I76 A;  2R5Z A;  1WGX A;  4IHV A;  2JMW A;  4FE7 A;  2FX0 A;  3SDG A;  5EF6 A;  4MO7 A;  3NAR A;  1JUM A;  3OOU A;  1EF4 A;  1TWG J;  1TWF J;  1ETV A;  2LVS A;  3HOU J;  1BW6 A;  3RZD J;  1BL0 A;  4A3J J;  2CUF A;  2R5Y A;  1FJL A;  5IP6 A;  4BBR J;  5M5Y J;  2JN6 A;  3BTI A;  2YS9 A;  3HB9 A;  1O4X A;  5FKO A;  1QVT A;  4A3F J;  2B63 J;  2IEK A;  2L0K A;  1W0U A;  1LE8 A;  1XS9 A;  4B1R A;  3UKG A;  2I10 A;  2EH3 A;  2MSY A;  3DCF A;  5EGO A;  4IHY A;  1R9T J;  5EG0 A;  2IBD A;  1AU7 A;  1FTZ A;  2CQQ A;  3JR9 A;  2R92 J;  2CRG A;  1Y1V J;  2L7Z A;  4L5E A;  1K61 A;  1JJ8 C;  5EYR A;  2O9L A;  2R0Q C;  2D5V A;  1BW5 A;  1VF9 A;  2LFB A;  2O7O A;  2MW8 A;  3B6C A;  1B8I A;  4BBS J;  2XB5 A;  3O8G A;  2EZK A;  2FD5 A;  1ITY A;  1MH3 A;  2CUE A;  2EQR A;  2CJJ A;  2JK3 A;  2M8G X;  4BKX A;  5C4X J;  2GLO A;  2PMZ N;  2X48 A;  2Y9Y A;  3BR2 A;  2JA6 J;  5J1U A;  3BR5 A;  4M3D A;  2HI3 A;  5K7H A;  2K9N A;  4A3M J;  2M0C A;  5IOY A;  2FQ4 A;  3HKZ N;  3GTO J;  2WAQ N;  2Y9Z A;  4B4C A;  2L7M P;  2HOT A;  5FLV A;  4HNV A;  1POG A;  3ZOB A;  2EZI A;  2VKE A;  1TWC J;  4A3B J;  1UHS A;  4A3I J;  5E3O A;  2E2H J;  1ZR2 A;  4I6Z A;  3GTG J;  5GP9 A;  2LLK A;  2DMN A;  3TP3 A;  2WV1 A;  2LKX A;  1QPI A;  1XG1 A;  2DMQ A;  5JLW A;  3C2B A;  3BG5 A;  3NAU A;  3JRI A;  1GV5 A;  3RQI A;  2XPW A;  4JX4 A;  1GT0 C;  2DN0 A;  4UUS A;  5GPA A;  2NOG A;  2XGD A;  2LR8 A;  1K83 J;  1H88 C;  2DA5 A;  3DEW A;  3BTC A;  1JUS A;  2DA2 A;  2MG4 A;  2JA5 J;  1APL C;  2LD5 A;  2H1K A;  3FKI J;  2HOS A;  5IYB J;  4BY7 J;  1ETX A;  3Q0V A;  2XGE A;  1WI3 A;  2XPU A;  4Y52 J;  3D1N I;  1F36 A;  1IC8 A;  1UG2 A;  3ZQL A;  1DU6 A;  2MGQ A;  5FKL A;  3HDD A;  2EBI A;  1E3O C;  3ZQC A;  3A01 A;  2XRL A;  2DMP A;  1D5Y A;  3F0C A;  1U9N A;  3QPL A;  1B72 B;  3LSP A;  5FKM A;  3HGY A;  4A69 C;  3LSJ A;  2VUM J;  2M9H A;  1RR7 A;  3FIS A;  2VPR A;  2DTZ A;  4DZP A;  5DTD A;  1VFC A;  3SFI A;  1P7J A;  5E3N A;  3S1N J;  2L7F P;  1Z0X A;  2LY9 A;  3GTL J;  2HOA A;  3JRA A;  1NK3 P;  5M5X J;  1OFC X;  5IYC J;  1ZK8 A;  4D5C A;  1FEX A;  1HOM A;  4AC0 A;  2Y30 A;  4JYK A;  2AHQ A;  2N8G A;  2W48 A;  4FE4 A;  2E2J J;  3GTQ J;  4V2G A;  3L1P A;  3B6A A;  1JTY A;  1MBG A;  3CMY A;  2NVQ J;  1ZQ3 P;  5F0C A;  4A3D J;  1ZGW A;  1TC3 C;  1A5J A;  2TCT A;  1IDY A;  2E1O A;  3RKQ A;  4D5F A;  1NTC A;  1U8B A;  2R7Z J;  4X1E A;  2DA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...