2HOTA

Phage selected homeodomain bound to modified dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKNMRAKIKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*CP*CP*CP*CP*
publication title Structure and properties of a re-engineered homeodomain protein-DNA interface.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 19
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hotA00
1ORKA 1QPIA 2M0CA 1G2HA 2LVSA 1ETXA 5DS9A 1MBGA 1VI0A 2R0QC 1D5YA 3LOCA 4LOCA 4D5FA 2JN6A 3BR0A 4XICA 4D7NA 4M6VA 3M4OJ 4C2MJ 2EH3A 1YRNA 2OF7A 2ECCA 3K7AJ 1TWAJ 3Q3SA 2GM4A 3BR5A 4V2FA 5C3EJ 4Y52J 1BL0A 3GTPJ 5C4XJ 2JK3A 3BG9A 2DA4A 2NVTJ 4JX6A 3G1LA 2Y0SN 4XK4A 2IEKA 2NS7A 2DMNA 4FCYA 4QSHA 5F0FA 2R93J 1TWHJ 4MLOA 3SJMA 4XRSG 5JLWA 1BJZA 2FQ4A 3OSFA 1ETWA 2OPTA 3BTIA 5IOZA 2EQRA 4DYRA 1FIPA 1B8IB 4M3BA 1TWGJ 1SANA 2FJ1A 2HXOA 4X6AJ 4UUSB 1Y1VJ 1P7JA 2ME6A 5IP9J 1BW6A 1QVUA 1RR7A 3L1PA 3CMYA 4M3DA 3PO3J 4DZPA 9ANTA 1F36A 2YUSA 2VPRA 2Y9ZA 2WV1A 2LP0A 3I4MJ 5FKNA 2JWTA 2XGEA 1F43A 1FEXA 1RETA 1IGNA 4A93J 4HNVA 2I10A 3SDGA 2CUFA 5GPAA 3PO2J 4A3MJ 3HDDA 2DA7A 2LK2A 4JX4A 4W97A 2DA1A 3JRCA 1P7IA 1UMQA 3JRHA 4IHXA 3H0GJ 1I3QJ 1GVDA 4IHWA 1WGXA 2R5ZB 1K83J 1Z77A 1NK3P 1LE8B 1HOMA 2LR8A 3BTCA 3HOXJ 2EZIA 1O4XA 2ECBA 3S14J 3A01B 4A3FJ 3GTKJ 4C3HJ 1W0TA 1RKTA 2HOSA 5M5XJ 1ZR4A 5F04A 3JRBA 3ZQLA 2KT0A 5IYBJ 1JGGA 2LFBA 5F1JA 1JJ8C 2QCOA 1ETKA 4C3IJ 2LLKA 1CQTA 2DMTA 1GV5A 3HOYJ 4M3EA 2G0EA 1IUFA 1OCTC 3HKZN 1UHSA 2Y2ZA 1IJWC 1GDTA 1VNDA 3BTLA 3Q0VA 4B1RA 5IYCJ 1JUSA 5FJ8J 5IPAA 1NTCA 4CYCA 4S0HB 2CUEA 5EGOA 2TCTA 3Q0WA 1H88C 3WHCA 2X48A 1YRNB 3FK7A 1EF4A 3S1MJ 3GTOJ 4J19A 2ZB9A 3DEWA 4MFDA 4UUTA 3TP0A 1SFOJ 1Q1VA 3Q0UA 5IOYA 4A3IJ 2O9LA 1MBHA 3O8HA 1JJ6C 1JUMA 1OFCX 1XC5A 5GPCA 2N8GA 1RPWA 1HDPA 1IV6A 4A3EJ 1B72A 3W6VA 4D7MA 2EBIA 4I76A 5EZGA 3TW7A 1MNMC 4QIWN 4FTHA 2IBDA 3GTGJ 2L0KA 2B63J 3CQZJ 5M5WJ 1JTYA 2M9HA 1RESA 3OSGA 1JTXA 1AKHA 2JA6J 3GTMJ 5IYDJ 1I6HJ 2R5YA 5C4JJ 3BTJA 1U78A 4I6ZA 2ID6A 2VUMJ 2QF7A 2L7ZA 4G12A 2ID3A 1POGA 3JRDA 1FTZA 2CU7A 2EZLA 3JRFA 2JMWA 1JKOC 2X9DA 1IC8A 5JLXA 2K40A 2HXIA 3FK6A 3ZOBA 2VKVA 1ITYA 2XRLA 5FKMA 3QPLA 2EZKA 5F0CA 4FE7A 3NARA 4B3AA 2Y9YA 3GTJJ 3S2HJ 3G1OA 4QTRA 2MW8A 1GT0C 2O7OA 3ZQHA 2DTZA 2NVXJ 3BQZA 2VI6A 3JRGA 2CRGA 4X1EA 3FKIJ 4AYBN 1U9NA 4D5CA 3B6AA 1Z0XA 3LSGA 4A3BJ 3JRIA 3BT9A 3GBGA 5F27A 5EDNA 4B4CA 2JJ7A 5BNGA 3RZDJ 1BW5A 2MGQA 2XB0X 2EZHA 2ME0A 3HEFA 3MVPA 3WHBA 2DJNA 1H8AC 1QRYA 2XPVA 4BXXJ 3IV5A 3HOUJ 1WI3A 3HGYA 3BR1A 1MSFC 5FKOA 4IHYA 4IEJA 5GP9A 4A3DJ 5C44J 3S1NJ 4BBRJ 1OCPA 3VPRA 4M3GA 3RZOJ 2IAIA 1I50J 1X2NA 1PUFA 1BA5A 1X58A 2H8RA 4EEFG 2R7ZJ 2DA6A 2E19A 4FE4A 1HF0A 3HM5A 4MO7A 2NVYJ 2HDDA 2R92J 4CYCB 2HOAA 5EGOB 3CCYA 3IH4A 2D5VA 3QPSA 4JX5A 1OJLA 2XPUA 2HQ5A 2CQQA 5EG0A 3LSRA 1JKQC 1ETYA 1A5JA 2FX0A 3G1MA 2TRTA 2K9QA 5E3LA 1U9OA 1T33A 3BR3A 4L5EA 5E3MA 4A69C 2H1KA 4BY7J 3CDLA 1AHDP 1HLVA 1ZTRA 2L7MP 2MSYA 1JT0A 1ZQ3P 4GFBA 1AU7A 1B72B 2MG4A 2E1OA 5FLVA 1ENHA 4XRSA 3LNQA 4M3FA 2K9SA 1ZK8A 3MN2A 3HOWJ 2XGCA 2XGDA 1IG7A 1MBFA 3TEDA 2XPWA 1FTTA 4DW6A 3S17J 2E2IJ 2M34A 4AUXA 1AKHB 3GTLJ 3JREA 2K9NA 2R5YB 5J1YA 1IDZA 3A02A 2JA5J 1XS9A 4FISA 1JKPC 1MBKA 3ZQFA 1RKWA 4A3KJ 3JRAA 3S15J 2LKXA 3DCFA 1UG2A 2ELKA 3HBLA 4Y7NJ 2CJJA 3RKQA 2WB1N 3S2DJ 2M8GX 5HODA 5FKLA 3F0CA 5FKKA 4MFEA 4JP0A 2YU9J 5F0HA 1HDDC 2NVQJ 2W48A 3GTQJ 3O8GA 2E2JJ 1WPKA 3S1RJ 1FJLA 1VF9A 5J1UA 2AHQA 2LY9A 1TC3C 1U8BA 4A3CJ 3IH3A 1MBEA 2GLOA 2PMZN 1ETVA 5E3OA 2FD5A 5DTDA 1MSEC 3A03A 5K7HA 3I4NJ 3BR6A 1IDYA 3HOVJ 1IRZA 1GV2A 2CQXA 2COBA 2O8KA 1FIAA 1XG1A 3OOUA 2DN0A 1H89C 5K7FA 1GUUA 2X6OA 1WCMJ 2Y30A 5EYRA 2KDZA 2M2EA 4A3JJ 3LSPA 2P81A 2NS8A 3PM1A 5IP7J 2XSDC 3K2AA 3C2BA 4XIDA 3JR9A 1NK2P 2NOGA 2L7FP 5F08A 1JT6A 3FISA 4DYCA 1APLC 4BKXA 2DMUA 4XRMA 2HOTA 1TWCJ 2GBYA 1PUFB 3BG5A 1LFBA 1WH7A 3TW6A 4V2GA 3E7LA 1ZGWA 1S7EA 2LD5A 1B8IA 4AC0A 2DMPA 2WAQN 1K61A 1MBJA 2VKEA 4ABZA 1QVTA 1DU6A 1JKRC 3S16J 2HYJA 4UUSA 3FIWA 5J3LA 5EG0B 3HOZJ 5K7ZA 2JA8J 4A3LJ 2HI3A 4JYKA 3MKLA 5EZHA 1E3OC 2DMQA 1X2MA 2AO9A 4NDLA 3UKGA 1W0UA 5J1RA 3OIOA 5EF6A 4C3JJ 1MH4A 1LFUP 1T56A 3LSJA 3ZQCA 1Y1WJ 1ETQA 5E3NA 1A6IA 3S1QJ 2RAEA 4DZJA 1VFCA 2L9RA 3QQAA 2DA5A 3M3YJ 2LTPA 5M3MJ 2DA3A 2R5ZA 5M5YJ 4A3GJ 2DA2A 5EEAA 4RDUA 3D1NI 1LE8A 1ZKGA 4MIMA 1DU0A 1ETOA 1TWFJ 3BG3A 3A01A 3SFIA 1R9TJ 4BBSJ 5IP6A 3RQIA 3ZQIA 4IHVA 3H3VK 3B6CA 5M3FJ 4DYQA 3HB9A 1JUPA 3HGGA 4W1UA 3ZQGA 5FLMJ 2Y31A 1MH3A 4BY1J 2YS9A 2JA7J 2XB5A 1WH5A 3BR2A 3NAUA 4RBOA 3TP3A 3IH2A 3BQYA 1HCRA 2E2HJ 1ZR2A
chains in the Genus database with same CATH superfamily
4NBQA 4DBQA 5LEKA 1TL8A 1B9NA 5AIPA 1QPIA 4QPQA 1G2HA 2KP6A 1DGRM 2V26A 2Y0SA 3I4PA 4U7DA 1MBGA 3GZ6A 4H0EA 2XAQA 3VOEA 3LFKA 5JVTA 4E7KA 1VTNC 3BR0A 2X51A 3RCOA 1YRNA 1TWAJ 5E79C 1W5TA 1G4DA 5C3EJ 1BL0A 3GTPJ 1EH8A 4PFOA 4AIDA 1R00A 3AAFA 4JX6A 2XC7A 2K02A 2Y0SN 3CCMI 3GFIA 2JPBA 2XHKA 5GAEJ 1Y39A 3LSKA 4GCVA 1TQMA 4XN0A 2EK5A 1E0EA 3IP4B 5E18F 1FOKA 3B73A 2R93J 1TWHJ 3WG9A 3VWBA 3N97A 3IKTA 4HYEA 1DPRA 3SQNA 4LIVA 4CZZA 2DXIA 4GXOA 1AA7A 1ETWA 3BTIA 4XKVA 3RTRA 5IOZA 5HLGA 3RPUA 3OYKA 4AVZA 2EQRA 4EJVA 2XIGA 2F4IA 2FF4A 1NG7A 2G7UA 2P0WA 4BS9A 2ISYA 3VEPA 4XBFA 2HXOA 5BPIA 1P7JA 3RKYA 2ME6A 5IP9J 3P7NA 2EINH 1QVUA 5CQGA 1RR7A 2MD0A 4K2EA 2BZTA 2F6CA 3COAC 3BCAA 4XKCA 1F36A 3CUOA 1WFXA 1UG0A 5JHUA 4HQMA 2IXSA 1BC8C 1ZHFA 1TTYA 1F43A 2GXGA 1RETA 3AG4H 1IGNA 4A93J 5GADJ 4M73A 1TQPA 4L9TA 3SEZA 4A0YA 3HDDA 2LKSA 1HA8A 4JX4A 2Z2SB 2DA1A 1G3WA 2WBMA 3TQNA 5FROA 3H0GJ 1I3QJ 2DFHA 1X1CA 2HNHA 2WY8Q 2VKDA 2LH9A 3HOXJ 4IOCF 2EZIA 2XAJA 1O4XA 2ECBA 3MFKA 2MH2A 1E3HA 3A01B 4I2OA 3ONQA 3S14J 4HV6A 1UHWA 3F9KA 1RKTA 1OMIA 1MMDA 5L3EA 1WJCA 5M5XJ 3ZXSA 4P9UA 1UFMA 3ZQLA 2H09A 5IYBJ 3WTUC 3V8JA 2PBIA 2HQRA 1U6GA 4BHCA 5F1RA 1JJ8C 1SFXA 1ETKA 2K3PA 1D1CA 3HOYJ 4G6QA 2Y48A 1OCTC 3FXUA 2EA4A 3G73A 2CUZA 4ESFA 1UHSA 3IUOA 4OIPF 3G3ZA 1R23A 2A6HF 2FSWA 3CO7C 1SAUA 2DBBA 4B1RA 5IYCJ 1JUSA 3BPVA 5IPAA 2ELHA 2WV0A 4HW0A 4LLNA 1MDMA 1P4WA 4Y17A 2W82A 2F5VA 4RLFA 3FK7A 2HPMA 2KFDA 1T95A 2V9KA 3LA7A 1VQKI 3CCLI 3F72A 3OIQA 3DEWA 2ZFUA 1ON1A 3TP0A 5IOYA 5ILVA 3O8HA 2B9SA 2BEOA 2ELJA 1JUMA 1OFCX 3DLAA 1XC5A 4PSXA 4N9HA 3MZ8A 1RZ4A 3CO6C 2N8GA 3T8TA 3R61A 3H35A 1RPWA 1LVKA 2VJJA 1CF7A 1ZRDA 4D7MA 2EBIA 4I76A 3S3MA 2DO7A 2PFBA 2K86A 1T39A 3C3WA 4FTHA 4LIUA 2FOWA 4KITB 3CQZJ 4RGSA 3TGNA 4N4NB 4ASNA 5KNLA 4IXAA 2KDOA 1RESA 1K78B 2X6YA 2DDBA 1I6HJ 5C4JJ 5BMZA 2OTLI 3C2HA 4KYWA 2QF7A 4A2UA 4G12A 5ERIA 3OL4A 3JRDA 1FTZA 1GXPA 4RAZA 3I5UA 4UVAA 2I5UA 2X9DA 3N4MA 1JKOC 3DWLE 4G6TB 2AQFA 3NWSA 5JLXA 2K40A 4XL9A 1PVEA 4LLGF 2EFQA 3ZOBA 1ITYA 5K5QA 3C1DA 3J7AY 5CVUA 4FE7A 1BI2A 2V9PA 2XKPA 4KN4X 4QTRA 3L2CA 3MMYB 4XSXF 2KISA 2O7OA 3K4KA 1ZREA 2O3FA 3C2GA 3HRSA 2WADA 5FB2A 3KFWX 2CRGA 4U88A 3K70D 4RB1A 1XTAA 3V7RA 4AYBN 1DDNA 3CJTB 4AIHA 3LSGA 3CCSI 2IS4A 4XNFA 3RKXA 4PGHA 4BNCA 1SD4A 2H8WA 1R6RA 5EDNA 1BW5A 4R79A 1VQ7I 2EZHA 3IAM2 2IS2A 3OYHA 1HQCA 1B59A 1X3WB 2XPVA 3H9QA 4NQWB 1DUXC 3F23A 3LL7A 1MGTA 5FKOA 1MSFC 4IEJA 4IHYA 1JXSA 4D1QA 5KVRA 2L02A 4L0YB 4E7LA 4BBRJ 4M3GA 4BE0A 2IAIA 1HKQA 2XRNA 3TO7A 5BS6A 4UY8I 2ZMEC 4KNYA 3CCUI 5J8FA 2LY1A 3SYTA 1PUFA 2P7CB 3HKZA 2ZNYA 1BA5A 2CW8A 1X58A 4EEFG 4CGZA 2VONA 1D8JA 2JSPA 2JRTA 4HX8A 1FSHA 4ZDPA 3CDHA 2QBYA 2NVYJ 1X4OA 3OS0A 3L2VA 4CYCB 3CCYA 3IH4A 3QOPA 1OJLA 1Q1HA 2XPUA 2HQ5A 2CQQA 2AS5F 3REOA 3RJPA 2R7WA 3E97A 3ISPA 5DYMA 2FX0A 1D0XA 3GX4X 2K9QA 2QQ8A 2QVOA 1W36C 4L5EA 3RI4A 2H1KA 1SVLA 4RM3A 4LB6B 2GAUA 1QZZA 4BDYA 1D3YA 1VQ4I 3OYEA 2D1HA 3E5XA 2MSYA 4XR6A 4XQFA 4L5IA 4BGDA 1JT0A 2XASA 4M6YA 5FO5A 1OYWA 4IF4A 1ZH5A 1X4PA 4XRSA 4HF2A 3F22A 3LNQA 2HQAA 1EH7A 2K9SA 3AG3H 4PJLA 3S8PA 3JAMK 5F6FA 1MBFA 3TEDA 2XPWA 4YFNF 3S17J 2JT1A 2YPRA 3A0HC 2DT7B 3P9IA 3I55I 3GTLJ 4EV0A 5AIQA 3I59A 4A12A 2OC6A 1XS9A 1ZRCA 1JKPC 1UAAA 2F4OB 2V7FA 3HBLA 1UG2A 2ELKA 5E1WA 3DKWA 4Y7NJ 2PMZA 3ZRGA 2DLLA 2VBWA 2IS1A 2HGCA 2ADUA 3L7WA 2GIVA 3J7AO 4BEHB 4IJAA 2XKOA 3JTGA 2FE3A 2GA2A 2VT3A 2W48A 4M9XA 1B1BA 5IT9K 4Y13A 1WPKA 1L3LA 1BIBA 5HDNA 3S1RJ 2LY9A 1U8BA 1MBEA 2DOFA 3KP6A 2GLOA 4BQOA 2PMZN 4BQQA 3NQOA 3QOEA 3VYUB 4KA4A 1YFHA 4ZYHA 2ETHA 3AFHA 2FD5A 1ZRFA 2CUJA 4GYIA 4BU2A 1SVOA 4PGGA 1MSEC 2I8DA 3KP4A 4LD5A 1GV2A 2VN2A 1MD0A 4B43A 4ZH4F 3K9TA 2DFIA 3OOUA 1OISA 2FEZA 3KCCA 4XLHA 5ICEA 3GVAA 3AL0B 4CCLA 4B48A 4BUPA 2UZKA 1WCMJ 3H1CA 1OYIA 3K1MA 3LSPA 2NS8A 3PM1A 2E1CA 4YFKF 1WRJA 2XSDC 3C2BA 2PMUA 4XIDA 1R1UA 2QSFX 2PI0A 2WAQA 1MMAA 3GW2A 3FISA 1A35A 2F5DA 3QP5A 5KHDA 4RAYA 3ML6A 3S32A 5KAFC 1LVAA 3HTSB 1LFBA 4I09A 4B09A 1I6XA 4NB5A 2QKLB 2Q0OA 2JA2A 2RV8A 3VDXA 1BM9A 1YYVA 3PSIA 5LBQA 2RGVA 2ZXIA 3FXOA 1XMKA 3K1PA 2WAQN 4C2UA 2OZ6A 1T38A 2K5CA 3QYBA 1JKRC 1R36A 3CDIA 1R5GA 2HYJA 3FIWA 2LMDA 3HOZJ 3DBRB 4C2TA 4A3LJ 2R7UA 2FXAA 2XUBA 2A68F 3MKLA 3CUQB 1B6AA 2AO9A 3V4GA 3UKGA 1FOXA 4ENNA 3MZYA 1W0UA 4UNOA 2W57A 3J80K 1T56A 3LSJA 2P6TA 3ZQCA 4ZTFA 2GWRA 4EM2A 1P4XA 2A07F 2MD5A 3TOAA 1VQ5I 1R5HA 3WTVC 5ILUA 3KX2A 3AG2H 2HS5A 1YE9A 2B7EA 2PJRB 2DA3A 1YHQI 5M5YJ 5CJ9A 5EEAA 2ZJPF 3D1NI 2X85A 1ZKGA 4NC8A 1IUYA 3OS1A 1TWFJ 3GEZA 1UHMA 4M74A 3M1EA 2XDVA 3BZ6A 2OD5A 1SD7A 4UVCA 4Q48A 1IV8A 3SFIA 5IP6A 2XF6A 1TBXA 1C0WA 1WKMA 4DYQA 3HB9A 3BWGA 3HGGA 3DTEA 1MH3A 5AONA 2JA7J 1KU2A 1WJDA 3PIPF 3BR2A 2X4HA 2Z3YA 4RBOA 2WC2A 1WQ2A 5K5OA 3HL2A 3K70C 4HSTA 4D0PA 3OWTA 1HCRA 2BVMA 2E2HJ 1SVMA 3E6MA 4CCOA 2IPQX 3M1CA 2ZSIB 2M7BA 1K7AA 5JI6A 1HC8A 4NHJA 4UUVA 4D5FA 2JN6A 4M6VA 3J7ZI 2EH3A 1FBQA 2GM4A 1XGOA 2DOEA 3OYLA 2EFWA 3DF8A 2LBFA 1XMXA 3BG9A 2MYSA 4E70A 2JPCA 4RB2C 1BIAA 2NVTJ 1LQ1A 1OQYA 4EJOA 3DBLB 2NYXA 1HBXG 4FCYA 3Q9SA 2DK5A 2MC4A 2E5NA 2LY2A 1XD7A 2Q2EB 4XRSG 3V7CA 2KRFA 1BJZA 3O6BB 1H9GA 1YIJI 2A5YB 2OPTA 3CD6I 3NEUA 4CSWA 1D8KA 3ZQQA 4DYRA 3JSOA 2R7RA 4IKFA 2QEXI 4BYYA 1SANA 1WJFA 2L4MA 2FJ1A 3KETA 3TBIA 1Z7UA 2QWWA 1Y1VJ 3BPXA 4U7BA 1BW6A 2CH0A 2QQ9A 4O5VA 2WAEA 2DTRA 3PO3J 4UB6C 4S05A 1XGNA 3LFUA 3DBHB 3FMQA 4NC6A 3LMMA 2WV1A 2LP0A 1J7KA 2JWTA 2Y0MA 2KJCA 3DPUA 4HSRA 2I10A 4F52A 2P5VA 4HRIA 4ZYDA 2QA4I 2L2OA 5JHFA 2DA7A 1FMWA 2HTJA 2LK2A 3S3OA 1KGSA 4L5JA 5HNFA 2STTA 2E71A 1UMQA 5EJCA 3ECOA 1GVDA 3GZ5A 4IHWA 3K4LA 2R5ZB 1LE8B 1HOMA 1I27A 1K79A 4HV5A 2HYGD 3BTCA 2E36A 1LDKB 2CQ7A 4DBRA 2YU3A 4C9YA 4C3HJ 3WTXC 4DGWB 1W0TA 3QYFA 3CP2A 3GFJA 4CUGA 4HDUA 5F04A 3JRBA 2BY3A 2WAFA 1U5TA 5DM7F 1IXCA 2L3DA 4BAYA 1W4MA 4YELA 1V5GA 3MKWB 2GIZA 2QM3A 4KFCA 4C3IJ 3LSMA 1T0FC 2LLKA 5BQTA 5HLHA 1GV5A 3ZN1A 4M3EA 2K4BA 5CVRA 2DPUA 2QYOA 3CCRI 1IJWC 3DV8A 3FMRA 2XF7A 3KZYA 4II2A 2ZFWA 4KT5C 3A4CA 1OR7A 2Y69H 1GHCA 2UXNA 1IN6A 2XF5A 2CV2A 2UWMA 1YG2A 2V1NA 2TCTA 2R7QA 3Q0WA 2M30A 1HW1A 1UJ8A 2CWEA 3WHCA 1YRNB 4ZJZA 5LFAA 4EQQA 3WTYC 3HYIA 3GTOJ 1MNDA 1PP7U 2ZB9A 3OYMA 4BJ5C 4V19K 1IF1A 4QPOA 4CCKA 2CG4A 3PFYA 4PJ0C 4FASD 2ZXJA 2BHYA 4C30A 5FFZA 2EPFA 3EUHA 3K69A 2DFEA 1V3FA 5D6EA 1B72A 3W6VA 3ABLH 1S29A 1SMYF 5HDKA 1MNMC 3GTGJ 3I54A 3P5JA 2VODA 3PSFA 3M7GA 1XSXA 3OV8A 5CVJA 2V6EA 4OIQF 1F9NA 3R4KA 5IYDJ 3N05A 1YOVB 1R4MB 2YX4A 5TISC 1NH3A 2HZDA 1AKHA 1S7AA 2V9VA 2HYFA 3G6EI 2IGOA 4E6KG 2HR3A 2ID6A 3I71A 1POGA 3KZZA 2CU7A 2EZLA 3JRFA 2JMWA 4DNCA 3K0LA 4Y15A 2MBFA 3R0JA 3S93A 2XRLA 5FKMA 4F3QA 5HLIA 4GDFA 2QUFA 5TRDA 2KZGA 2Y9YA 4YRVA 2FU4A 3P9CA 3RDIA 3NWTA 3FM3A 5H6RA 2NVXJ 3BJ6A 3H9JA 1KA8A 1ZYRF 2VI6A 4Q4ZF 2DYSH 3WTWC 4EGYA 3MEXA 1SMTA 1V54H 4NUBA 4GYGA 2OJED 4A3BJ 1J5YA 4LG0A 3GBGA 3SZPA 5LGUA 1ZLKA 5F27A 1Z21A 2KKOA 3FXLA 5A2QZ 4LK1F 4ZZDA 4QWQA 2EILH 2L9NA 2D1VA 1I3AA 2V1XA 2ME0A 4CXFA 1JGSA 3OYFA 3HEFA 3MAJA 3WHBA 2DJNA 2A61A 1QRYA 2OUMA 4JQFA 3CF5F 1QU3A 2VOPA 3IV5A 4KMUX 4AD9A 3HGYA 4UB8C 3C18A 4EGZA 3OYJA 5J4YA 5GP9A 3OS2A 1VQPI 3E3VA 1QHGA 4PZJA 2W25A 4MNUA 3ZMDA 1S9HA 4LB5A 2VBYA 3GLXA 3PQJA 4LFUA 2QENA 4JK1X 5FGMA 4HDVA 3E0JB 2NXNB 3KEQA 3FZVA 4M72A 1Y8QB 5IY5H 2DODA 3MZHA 2R7ZJ 3ABUA 3K4CA 4FE4A 3OY9A 2IW5A 3CC4I 3W2AA 3K10A 2MA3A 1MDMB 2D5VA 2RNGA 2P8TA 2M7AA 3ASOH 1S3JA 1ETYA 2PX9A 1FNNA 2ESNA 1Z9CA 2W1OA 1FZPB 4MGRA 3S2WA 3FX3A 1WJAA 1Y0NA 4ZDOA 1T33A 3V8LA 3BR3A 4A69C 3GZNB 3ZN0A 3AL0C 1LB2A 1AHDP 3EYYA 1BR1A 3D5LA 1KQ8A 2LRDA 4XOTA 2IJLA 4A5NA 2GA1A 5HS8A 5LHHA 2ISZA 1DPUA 1R7JA 3HRMA 1IN8A 1CF7B 4RMNA 2MG4A 1HSTA 4MQ9F 4IQ4A 3K6GA 1ZK8A 2XGCA 1J9IA 3MKZA 4R8HA 4DW6A 3LSHA 3QRFF 2E2IJ 4XORA 3DU5A 1XDSA 3JREA 5J1YA 5DEQA 3C7JA 3A02A 4B3XA 5EEHA 4OWRB 4BHPA 5D8KB 3JRAA 2O0YA 2A6TA 4UVBA 4DQ2A 1N25A 3R6SA 3RPUD 3HZJA 1G6NA 1EA3A 1FBSA 5FKLA 3F0CA 5FKKA 4IRIA 1XGMA 4MFEA 5FLXZ 4JP0A 3CMMA 5E17F 3BZCA 2HPIA 3CUQC 2RQQA 1UZCA 1FJLA 3DEEA 4P1WA 2AHQA 3W2VA 3BZKA 2R7XA 2IVMA 4A3CJ 3KP5A 3IWZA 1ETVA 4AYBA 2MFZA 4XRFA 3AG1H 5J8CA 5E3OA 5DTDA 2GXBA 3DEUA 5CYVA 4ETSA 1JE8A 1YJ9I 4XM3A 1HKSA 5HNHA 3HXLA 1IDYA 1IRZA 1IN5A 3K4JA 3HOTA 1XCVA 4Y4RA 1FLIA 3E6CC 3T1BA 2HKXA 3ZQ7A 3SEQA 2DN0A 5DCMA 2AXLA 1QGPA 2OZUA 2X1CA 4PJNA 1KU9A 3M8EA 2LNBA 4RM2A 1ZARA 2HTSA 1EKEA 5EYRA 5K1YA 2JTVA 2M2EA 2KDZA 3EYIA 1W5CC 3ZMTA 3BG6A 4A0ZA 3SDBA 1U8RA 3QODA 1NK2P 2V79A 2H6BA 3PUFA 5DDGA 2NOGA 2Z33A 4R1HA 1ZG3A 4G7ZF 4MEXF 2R7FA 3PNTA 2M87A 3HPHA 2KQRA 2L5QA 2GBYA 4WXHA 1PUFB 4IOAF 1YJWI 1N78A 3TW6A 2BXZA 2A5WA 1LKXA 1ZGWA 1DP7P 1RNLA 1BI3A 2QBYB 1B8IA 4LMYA 1YO5C 4RA2A 2DT6A 4AU7A 1V55H 2DMPA 1MBJA 1RC9A 2QKMB 4ABZA 2P6SA 4UUSA 2FMLA 4II3A 1HW5A 3L09A 4E7IA 1QBJA 5EZHA 5CPRB 1E3OC 4BE2A 2LSOA 1P6RA 4E7SA 3WGHA 1SFUA 4E7HA 3A1YA 5FRMA 3DU6A 1R49A 4XLAA 1R1TA 3PNVA 4C3JJ 1Z3YA 1LFUP 1P9QC 1OCOH 2K9LA 4N9IA 3WG7H 5E3NA 1M1EB 1TW3A 1USSA 4AWXB 1FYKA 4DZJA 1MKMA 2XGXA 5JVGF 1LEBA 4HQEA 4KMFA 2W84A 4EMSA 2OV7A 4HBLA 1Z6RA 4A3GJ 4EATA 4EVIA 3MKYB 2DA2A 1OCZH 3F8CA 3L9FA 2XAHA 2AXTC 1ETOA 2HFHA 2MABA 3I59B 2JUGA 3BG3A 2LKPA 1QPMA 3CC2I 1R9TJ 3ELKA 1PJRA 2YSRA 3BC8A 2K27A 4W1UA 5FLMJ 4BQAA 2Y31A 3Q5FA 4BY1J 2YS9A 2PG4A 3E5QA 3K4MA 2XB5A 3W3CA 4ESBA 3CP8A 3TP3A 1VQ6I 4OU0A 3BQYA 3FXRA 5K5RA 3GMEA 1TT0A 3HSFA 3RPQA 4NC7A 4ANJA 3SZTA 3L2WA 5LEJA 1QA6A 1OYYA 1YX5A 3GLLA 1WSUA 1ORKA 3H5AA 2M0CA 1SFKA 2LVSA 1ETXA 1WJEA 3HUGA 2MC3A 3J81K 5DS9A 2HVSA 2P5KA 3UR3C 5FD5A 1VI0A 1I39A 2R0QC 1BC7C 2J5PA 2RVCA 3LOCA 4LOCA 5CVVA 3SHFA 5LRSA 4XICA 1IO2A 2K3FA 2MH9A 2YR2A 4OMYA 3BR5A 4Y52J 2L9SA 4YEJA 1ZG1A 1KU3A 5C4XJ 3OOPA 4OOIA 1U3EM 1X1DA 3G1LA 3VSKA 3DQVC 2NS7A 2RDPA 2ZC2A 2O61A 2BY2A 2CGPA 2CV0A 1R71A 2IGNA 1W5SA 2TDXA 5F0FA 2XV4S 3SJMA 4XLFA 5JLWA 1X1AA 2M5WA 3LAJA 4KT6A 3OR1C 2PJPA 2CS3A 3F3XA 4G7HF 4XLEA 3FXKA 2IA2A 1TLHB 4XONA 1FIPA 2RC4A 3OR2C 1MJAA 2VT2A 3FMSA 1QQIA 2EWNA 2CV1A 4X6AJ 3E6DA 2M45A 2XSJC 1SD6A 5EEGA 4XMYA 2LYCA 3L1PA 3T0YA 2FNAA 3DFGA 3JSPA 5LRRA 3I3LA 1XSVA 4HZFA 2VPRA 3L2UA 3DTKA 2A05A 3GUDA 1XCBA 3I4MJ 4FT8A 1FEXA 2M3AA 4HNVA 4IVNA 2LG4A 3FBIB 3SDGA 2CUFA 5GPAA 2KHMA 3PO2J 3HHHA 1UELB 2BGCA 1TZLA 2FOKA 4KIFA 4W97A 1LFPA 4LJZF 4MHGA 2QSGX 1P7IA 3JRHA 4OIOF 3G71I 4IHXA 2BW3A 3E5UA 2OBPA 1O3SA 2X1DA 4JBAA 3UNGC 2VE8A 1GVJA 2D45A 1IZ1A 4KISA 1ONVA 2Q8KA 1TP4A 1LUJB 3EPZA 4FX0A 4ZYEA 2NRAC 3GTKJ 1U2WA 3KPHA 3U9GA 3GFLA 1Y6IA 4KJZA 2L01A 2KT0A 1IN4A 3U21A 5LLQA 4L0ZB 5F1JA 1OKRA 4HX4A 2Z5UA 4WK8F 2VXDA 3GWZA 2ZCWA 3HHGA 2DU9A 2Y2ZA 4BXUA 2IRFG 1J2XA 1EH6A 1VNDA 2BYVE 4IRHA 3M07A 3FM5A 2XAUA 3HSEA 1FYMA 2AQEA 2O8XA 5FJ8J 4EM1A 1U0JA 5CKTA 1W7PA 2VJ4A 4S0HB 3OYDA 5EGOA 4G6DA 3U1DA 4D9JA 1S7OA 1H88C 4A6DA 2VJ5A 2X48A 1EF4A 1RUNA 3S1MJ 1OCRH 1YW9A 3PQKA 2UUZA 5L3FA 1JI8A 2UV1A 3EETA 2LBFB 1ZGAA 2WTEA 4HX7A 3X2QH 1A31A 2JQ7A 1SFOJ 2G7HA 3NRVA 1STZA 4A3IJ 2O9LA 2EFPA 4M6XA 1Z6TA 4CCMA 2GOXB 1X1PA 1HDPA 3CJQB 2B0LA 4A3EJ 1RI7A 1OLTA 2W24A 5ICGA 4OAYA 1K4SA 2DQRA 3KLNA 3H92A 2EB7A 5D8LB 1E2XA 4QIWN 2IBDA 4RAGA 1YS7A 2B63J 1D1BA 1MJBA 2EFNA 4HLYA 3WU0A 1I1GA 4PJMA 1YITI 2JA6J 3JAMZ 1E17A 2R5YA 4MQVA 3BTJA 1U78A 4F92B 4CCJA 3RSNA 2VUMJ 1TT5B 2L7ZA 3EQLF 4BH9A 3S3NA 3D5SC 1IXRC 2EFOA 1F5TA 2O03A 5L3CA 4O6JA 3PNYA 2DT5A 2WA0A 1S72I 2HXIA 1F4KA 3FK6A 3LQQA 1D0ZA 2VKVA 1ERDA 3QPLA 1Y0UA 3V8KA 4FX4A 2KJBA 2ZMEA 5F0CA 5D5UB 3NARA 4ZYGA 1E3PA 3S2HJ 3F8BA 3G1OA 3B02A 2MW8A 2R7OA 1GT0C 1I5ZA 4HPQA 3OYBA 1Z7LA 1KYWA 3QU6A 2P7VB 4L18B 4U87A 1GLNA 3JRGA 1VQMI 5LHIA 1DQUA 4X1EA 2EA2A 5HDGA 5ICFA 4E7ZA 3HRTA 3ZMZA 3GXOA 1AWCA 4D5CA 3GO5A 3B6AA 4CHUA 1TW2A 2HKOA 3LAPA 3OYIA 1Y56A 5BOXA 2H94A 2L4AA 3JRIA 3BT9A 5FRNA 1ULYA 3Q9VA 2E1MB 4H4KC 4KUMA 2JJ7A 5BNGA 3BP8A 3CJRB 2XAFA 3WE2A 3RZDJ 3DPLC 2XB0X 4IO9F 3MVPA 1H8AC 1Z91A 2VC1A 2MLGA 1Z67A 3GFMA 3HOUJ 2G9WA 2DK8A 1U5TB 4I99C 1N75A 1WJ5A 2LREA 3MD2A 4A3DJ 3S1NJ 1FOYA 4I01A 1OCPA 3VPRA 3RZOJ 3T8RA 4XKBA 3JW4A 1I50J 5JFRA 2GOMA 2JVGA 4F91B 1F1ZA 2FBHA 1KYZA 1X2NA 4U0WA 3ASNH 3D5RC 4HF1A 3KZIC 3LA2A 1MZBA 4MTDA 2E19A 1HF0A 1QO0D 3HM5A 4OAZA 4OINF 4AVPA 2HDDA 2R92J 4BXFA 2HOAA 2ZNZA 3QPSA 3K2ZA 3VFZA 3OYAA 5TGTA 4AIKA 4B47A 2E60A 5E1ZB 2R7DA 2E35A 1A6QA 5EG0A 3LSRA 3MQ0A 2ACJA 4WWCA 1XPXA 1KU7A 3CF2A 2Z9OA 2CQNA 2W4SA 3KP2A 1FMVA 1T98A 2R7SA 2CW0F 4UXNA 3K4NA 1ZTRA 2L7MP 4U0VA 3WU2C 3L00A 1JHHA 4CH7A 2X0LA 1XSDA 2OTJI 2VIXA 3ZPLA 2CYYA 1B72B 4RS8A 2E1OA 5FLVA 1ENHA 3V42A 4A0XA 5FLXK 2WB1A 5HS9A 2OAZA 4LLLA 1LNWA 3MN2A 2KMUA 5L3BA 5LGTA 1XX5A 3J7YJ 2CMPA 5LD2C 2PLYA 1RIOH 1J59A 4AUXA 1AKHB 1HKTA 2ZO4A 2DOAA 2K9NA 1IDZA 4HOBA 4Z2YA 3EDPA 3H9GA 4HAMA 4LK0F 2J5OA 1MBKA 1FT9A 3ZQFA 3ECHA 1BOAA 3S15J 3FXJA 5DM6F 2VQHA 2LKXA 3RKQA 4CO8A 3S2DJ 1PDNC 2WB1N 3CJNA 1WVRA 2M8GX 5HODA 2E1NA 3DXJF 3ULQB 4E4HA 2V1UA 2VKHA 1T8IA 3E1SA 1BR4A 1R58A 2H27A 1V5FA 3RQ4A 5F0HA 1HDDC 1R1VA 5H6QA 2VOOA 4HEA2 3LWFA 2WWYA 2E2JJ 3CTAA 2OCCH 1VF9A 5J1UA 1TC3C 2W7NA 2BY0A 2JUCA 5B3SH 3TDUC 3IRRA 5LHGA 2F5EA 4ENJA 2VQGA 3JTHA 4LITA 4XLNF 1BI1A 1K6OA 3GF2A 5B66C 2PQ8A 1REPC 4N0BA 4LG0B 3ZMVA 1SD5A 4ZZLA 5J47A 1Z05A 4RB0A 3BJAA 4UV8A 1W36D 2BBYA 2CQXA 2CQKA 3LQRA 2COBA 3SXYA 4DIQA 1G8XA 2FNPA 3E6BA 5GTHC 2ICWG 4G8XA 4ON0A 1H89C 2JVHA 1GUUA 5K7FA 3PUBA 2X6OA 3V7SA 2ZJQF 1ZELA 2KRCA 3MCZA 4CICA 4ZC3A 1MMGA 5CQEA 2P81A 3JR9A 1XN7A 5F08A 1JT6A 3QAHA 1APLC 4BKXA 2DMUA 5E8GA 4XRMA 2HOTA 1TWCJ 4P55A 1MMNA 3BG5A 4G94A 3BCBA 1BR2A 3IAS2 2BVLA 2ESHA 1WH7A 2DCEA 3H3UA 3E7LA 4J01A 4S04A 1S7EA 2LDUA 3RIRA 1O7LA 3PIOF 4NNJA 2NOJB 2CFOA 1O57A 4AC0A 1FY7A 2BV6A 4M9ZA 1K61A 2BOLA 1PP8F 1DU6A 1LDDA 1YW7A 3CCQI 3F6VA 1KQ9A 2EIMH 1USTA 5J3LA 4HF0A 3VYSB 1J09A 3TOBA 4JYKA 1TNSA 1HW2A 1X19A 2FUG2 2ZXHA 1UCRA 2HWVA 1TQIA 2RQPA 1FYLA 3QPHA 2JZYA 2R4GA 4BQNA 5J1RA 2K4JA 2X6XA 1MH4A 3ZMUA 3W2WA 1Y1WJ 2F5CA 2RKHA 1ETQA 2V1DA 3S1QJ 5GTIC 1O3QA 2PEXA 1FPQA 3AKZA 3F6OA 1WZ2A 4PJJA 4BHBA 4I7HA 3F8MA 2KIMA 2DA5A 2LTPA 4XLCA 2C6YA 1UB9A 1D1AA 1G3TA 1DU0A 2W85A 1P92A 5B1BH 4IQJA 3A01A 2ZJRF 2GZWA 2QZ8A 3O2PE 3B6CA 3KYCB 4BJTA 2DQLA 3IRQA 3CCJI 3O3KA 2M8EA 3NAUA 2Z1DA 3WU1B 3IC7A 4IL6C 2A69F 4ESJA 3HC7A 3IH2A 3CZ6A 2RREA 3KLOA 3KEYA 3QU3A 2X1EA 4IPAA 2VQCA 1XMAA 2BE5F 4RGRA 1ZR2A 1ACIA 4Y33A 2HZTA 2VC0A 3I56I 4M71A 2F2EA 4BE1A 4KN7X 5D6FA 4KIGA 3ZMSA 4XOPA 2JSCA 3G2BA 2F4MB 1D5YA 2HVQA 2E7WA 3LSIA 4U0YA 4D7NA 3M4OJ 1IN7A 1O7FA 2KIFA 3KIOA 4C2MJ 3L2RA 2OF7A 2ECCA 4ZYAA 3K7AJ 3EUKL 3Q3SA 4V2FA 3G4SI 5DD8A 4EJWA 5DCMB 2JK3A 2DA4A 3CC7I 4RB3C 4I02A 4XK4A 2IEKA 2DMNA 3TKYA 5D5WB 2VLAA 3HSRA 4QSHA 4MLOA 3H0DA 2CW7A 2V4JC 4I98B 1RUOA 2ZBKA 2FQ4A 3OSFA 3CCEI 4JOMA 1YJNI 2LF7A 3OIPA 1S6LA 4ENMA 4IHSA 4EM0B 3KP3A 2KIUA 1K78A 1B8IB 4M3BA 5D4RA 1TWGJ 4Q5SF 2EIKH 1AOYA 5J40A 1IRGA 4BDZA 4UUSB 2H6CA 5HVQC 2KZVA 1DP3A 4XSZF 5DUKA 3VB2A 1OCCH 3WTZA 4F7ZA 3H36A 3CMYA 3OYGA 3R60A 1P4AA 4M3DA 1MJ9A 3ESWB 5L3GA 4DZPA 1T0FA 4XN3A 9ANTA 1NG6A 1S8NA 2YUSA 3DKYA 4YIFA 4CYDA 2Y9ZA 4J00A 4P9FA 3HOSA 5FKNA 2XGEA 1IXSB 2A3SA 3PL8A 1QZYA 1BJAA 2KL4A 2YX7A 4KIBA 3FHNA 4A3MJ 3CMEI 3JRCA 4X0GA 1X3UA 3BROA 3KYDB 4P96A 4Z6YA 3WGIA 3IKVA 2OQGA 3ZR8X 1WGXA 1GXQA 1K83J 3HTUA 4YG2F 2VPLA 3H5NA 1Z77A 1NK3P 3I58A 1RR8C 1MIJA 3ERED 2LR8A 5FD6A 4HA8A 4A6EA 2IS6A 4PDKA 2GQQA 5H2FC 2VXZA 4A3FJ 1X3ZB 2IA1A 4WCGA 2HOSA 1T6SA 3A0BC 3I0TA 5D5XB 3ABTA 5ILSA 1ZR4A 2DI3A 2FMYA 3ABMH 4NQWA 1H9TA 3KP7A 4PFPA 1JGGA 2VJIA 2LFBA 1N77A 1KZHA 4B44A 3VSLA 2CSOA 5H20A 3ZP5A 2QCOA 5KCMA 1L0OC 1H0MA 1SAXA 2ZXWH 1G3SA 2DMTA 3M9AA 1CQTA 2BY1A 4B8XA 1EJ9A 5E1XA 1VQLI 2G0EA 2LF8A 1IUFA 2M1BA 1B4AA 2IGKA 1WI9A 3HKZN 4E7JA 3HUGB 1GDTA 3H5RA 5GAGJ 1IRXA 3BTLA 3Q0VA 5BPDA 4GO1A 3VYRB 1LJ9A 2DFFA 1T08B 1NTCA 4CYCA 2CUEA 3U2RA 1ZG5A 2DYRH 2EJRA 3K1NA 1VQNI 1RRJA 2MLKA 3FXMA 4J19A 5D4SA 2E1MC 1O3RA 3OYCA 2V6CA 2OA4A 4O3MA 4MFDA 4UUTA 1YX3A 2PMHA 5GAHJ 1Q1VA 2VQLA 1ZN2A 3Q0UA 4LGWA 2VE9A 3FWEA 1MBHA 4CZCA 3OL3A 3A2KA 4L9VA 1JJ6C 4AIJA 3IWFA 5GPCA 1U5TC 3HJEA 3BY6A 4Q47A 3OMYA 2Z16A 1IV6A 5EZGA 2HVRA 2NNYA 1ZGJA 2M4KA 3TW7A 4CDGA 1IW7F 2L0KA 2R3SA 5M5WJ 3W6KB 3TMOA 5J4VA 1JTYA 1R5ID 3K4BA 2M9HA 5J6XA 3FDYA 3OYNA 3OSGA 1JTXA 2WY7Q 3FBNB 3GTMJ 1PYVA 2E34A 1A04A 2DW4A 1TNTA 4RGXA 4I6ZA 3CLOA 1OR7C 2ID3A 4XKWA 2O6GE 5E20A 1FSEA 1P2FA 1B9MA 1IC8A 3VYTB 5L3DA 5HLTA 5D5VB 2R7TA 1WHUA 4CCNA 4BL0B 3DP7A 4DOZA 4BEHA 1ODDA 1G59A 1FC3A 2EZKA 1SEUA 3T5XA 4B3AA 2QGUA 3GTJJ 1Y8RB 2FBIA 2QLZA 1X1BA 3ZQHA 2DTZA 1HSJA 2Q1ZB 3BJOA 3HIFA 3JCUC 3BQZA 3KEOA 4I0AA 3CCVI 3ROUA 1G3YA 3FKIJ 3EUHC 4HNTA 1VQOI 1U9NA 3CESA 3ABKH 1QHHD 2FBKA 4PCQA 1Z0XA 4ZDLA 4CA0A 4KICA 2BW3B 4IRGA 1VQ9I 2X6WA 1T2KA 1R4NB 2Z99A 4B4CA 2O5RA 2H1LA 2EV6A 2MGQA 1BBYA 4AM3A 2CO5A 2A6EF 4KDPA 4ZTJA 3FHZA 4G9YA 4BXXJ 1O3TA 3TDZC 1WI3A 3BR1A 3W6JB 1DGWY 2F48A 5ED4A 5C44J 3ERMA 1R22A 2KRHA 5E8IA 2OCEA 1SC7A 3R0AA 4EJTA 4G7OF 1LDJA 1D0YA 4N4OB 1JHFA 1BOBA 5FFXA 2DDAA 4BACA 2HEOA 2L7KA 2P5LC 2F5FA 2H8RA 1FWZA 2DA6A 2K85A 4UV9A 5ICCA 4MO7A 1XGSA 1W7PB 2VASA 1I1SA 5JR3A 5DV5A 5EGOB 1CGPA 2EIJH 4JX5A 2NVUB 3QPTA 2BHZA 4M9SA 1YTYA 1JKQC 1J75A 1A5JA 3G1MA 2TRTA 3RKWA 3CUQA 5E3LA 3WGGA 4GGGA 2BXYA 1U9OA 4GRIA 5E3MA 2COMA 3FXQA 4FHTA 2IT0A 4OMZA 4BY7J 3CDLA 3RYPA 3GCMA 1HLVA 5CVIA 4WF2A 1ZQ3P 4GFBA 1AU7A 4F55A 2K9MA 5LGNA 3CLQA 3GYHX 3CMAI 2NS0A 3QYEA 3ZCOA 1YW8A 2EV5A 3I9V2 4F93B 4M3FA 3KYLA 3HOWJ 3MWMA 2XGDA 1IG7A 1PUEE 1FTTA 2PJRA 2E7XA 2VBZA 3WTTC 1FOWA 2M34A 3BG7A 2STWA 1Z3XA 2LOOA 2R5YB 3F21A 2JA5J 3PFIA 4FISA 1D5VA 1RKWA 4A3KJ 2L9VA 2QSHX 3DCFA 2QQAA 3BLYA 2CJJA 1V4RA 2VBXA 4WXCA 4RLQA 4A5MA 4TV7A 4PSWA 5KAIC 2D2WA 2HDWA 5HOOA 3P9KA 2OU2A 4UHTA 4OIRF 2ZKZA 2FA5A 3SFZA 2YU9J 1YI2I 2NVQJ 2ZMEB 2GXAA 3FF5A 1S5LC 3O8GA 3GTQJ 2R7VA 3IL2A 5TJJA 2E5ZA 1FX7A 3LA3A 4BJ6C 2K7LA 2KLOA 3IH3A 3H3ZA 2EV0A 3I64A 4Y3OA 2VB6A 2DJIA 3QWLA 3WTSC 2FRHA 2IP2A 4ITVA 2JRMA 3F8FA 1SFEA 1FBUA 2RNJA 4MEYF 4YIRX 1HXDA 5A2QK 2UXXA 2QQBA 1WWXA 3A03A 5K7HA 1WJBA 3I4NJ 3BR6A 5F64A 3J81Z 4L9NA 3HOVJ 4FQGA 5DD4A 5IT9Z 1VQ8I 2M4GA 2ZJ2A 2KIQA 2O8KA 1FIAA 1XG1A 1ON2A 2XAGA 2M0MA 3D0SA 4I0BA 4RGUA 2NAZA 1J0RA 3WODF 3PJRA 2Y30A 4EJUA 1BI0A 1XB4A 4A3JJ 1K4TA 3BOQA 5IP7J 3K2AA 3L2QA 2DPDA 5IT3A 1YQAA 2RN7A 4MTEA 2L7FP 4XLPF 1KQ0A 1Z1DA 2Q2EA 4DYCA 2Y75A 2DAOA 3M8JA 3HRUA 1QZEA 3IHUA 2IA0A 4WXDA 4HLXA 2P4WA 5CLSA 5B1AH 2KPMA 4V2GA 4IHTA 2NNNA 2LD5A 3RYRA 1IAWA 4LG3A 5KK1A 1FP2A 1YIOA 1VZ0A 5DUIA 4ENKA 2VL8A 3U1KA 2VKEA 4HG2A 1MMSA 3DPTA 1BN5A 3M8FA 1W1WE 4YFXF 1K6YA 4IX7A 1QVTA 3S16J 5EG0B 3DTIA 5K7ZA 2W00A 2JA8J 2HI3A 3I53A 3WE3A 1IRFA 2DMQA 1X2MA 4NDLA 2HU9A 3EUAA 1W7PD 3F8NA 4P5OA 1LPQA 3OIOA 1LEAA 3ZGKA 5EF6A 1ZLJA 1MNEA 2FQ3A 1ZAOA 2HDCA 3DLLF 1A36A 1A6IA 1YS6A 3TL4X 3LSTA 2RAEA 1XDUA 2L54A 3HG9A 5DCFA 1VFCA 1FP1D 4L9JA 4IZZA 2L9RA 1OPCA 3QQAA 1MW7A 3M3YJ 3HPGA 5M3MJ 2ZSHB 2HOEA 3DKXA 1NHAA 2R5ZA 2LC2A 2CFXA 4RDUA 3VODA 1LE8A 1V5EA 1YLFA 3KE2A 6PAXA 4MIMA 1KONA 2OQRA 4DJAA 3FKJA 4RAFA 3TO6A 3J80Z 3SZGA 4BBSJ 3RQIA 1EV7A 2PN6A 3ZQIA 4IHVA 3H3VK 5M3FJ 4YIIA 3QP6A 3ZQGA 1JUPA 2IGMA 1QNTA 4PK4A 4FETA 1WH5A 2HQNA 3BDDA 4HNUA 2XVCA 4QLCU 4WX9A 3TO9A 5B5EC 2XROA 4PUSA 5HS7A
chains in the Genus database with same CATH topology
1ORKA 1QPIA 2M0CA 1G2HA 2LVSA 1ETXA 5DS9A 1MBGA 1VI0A 2R0QC 1D5YA 3LOCA 4LOCA 4D5FA 2JN6A 3BR0A 4XICA 4D7NA 4M6VA 3M4OJ 4C2MJ 2EH3A 1YRNA 2OF7A 2ECCA 3K7AJ 1TWAJ 3Q3SA 2GM4A 3BR5A 4V2FA 5C3EJ 4Y52J 1BL0A 3GTPJ 5C4XJ 2JK3A 3BG9A 2DA4A 2NVTJ 4JX6A 3G1LA 2Y0SN 4XK4A 2IEKA 2NS7A 2DMNA 4FCYA 4QSHA 5F0FA 2R93J 1TWHJ 4MLOA 3SJMA 4XRSG 5JLWA 1BJZA 2FQ4A 3OSFA 1ETWA 2OPTA 3BTIA 5IOZA 2EQRA 4DYRA 1FIPA 1B8IB 4M3BA 1TWGJ 1SANA 2FJ1A 2HXOA 4X6AJ 4UUSB 1Y1VJ 1P7JA 2ME6A 5IP9J 1BW6A 1QVUA 1RR7A 3L1PA 3CMYA 4M3DA 3PO3J 4DZPA 9ANTA 1F36A 2YUSA 2VPRA 2Y9ZA 2WV1A 2LP0A 3I4MJ 5FKNA 2JWTA 2XGEA 1F43A 1FEXA 1RETA 1IGNA 4A93J 4HNVA 2I10A 3SDGA 2CUFA 5GPAA 3PO2J 4A3MJ 3HDDA 2DA7A 2LK2A 4JX4A 4W97A 2DA1A 3JRCA 1P7IA 1UMQA 3JRHA 4IHXA 3H0GJ 1I3QJ 1GVDA 4IHWA 1WGXA 2R5ZB 1K83J 1Z77A 1NK3P 1LE8B 1HOMA 2LR8A 3BTCA 3HOXJ 2EZIA 1O4XA 2ECBA 3S14J 3A01B 4A3FJ 3GTKJ 4C3HJ 1W0TA 1RKTA 2HOSA 5M5XJ 1ZR4A 5F04A 3JRBA 3ZQLA 2KT0A 5IYBJ 1JGGA 2LFBA 5F1JA 1JJ8C 2QCOA 1ETKA 4C3IJ 2LLKA 1CQTA 2DMTA 1GV5A 3HOYJ 4M3EA 2G0EA 1IUFA 1OCTC 3HKZN 1UHSA 2Y2ZA 1IJWC 1GDTA 1VNDA 3BTLA 3Q0VA 4B1RA 5IYCJ 1JUSA 5FJ8J 5IPAA 1NTCA 4CYCA 4S0HB 2CUEA 5EGOA 2TCTA 3Q0WA 1H88C 3WHCA 2X48A 1YRNB 3FK7A 1EF4A 3S1MJ 3GTOJ 4J19A 2ZB9A 3DEWA 4MFDA 4UUTA 3TP0A 1SFOJ 1Q1VA 3Q0UA 5IOYA 4A3IJ 2O9LA 1MBHA 3O8HA 1JJ6C 1JUMA 1OFCX 1XC5A 5GPCA 2N8GA 1RPWA 1HDPA 1IV6A 4A3EJ 1B72A 3W6VA 4D7MA 2EBIA 4I76A 5EZGA 3TW7A 1MNMC 4QIWN 4FTHA 2IBDA 3GTGJ 2L0KA 2B63J 3CQZJ 5M5WJ 1JTYA 2M9HA 1RESA 3OSGA 1JTXA 1AKHA 2JA6J 3GTMJ 5IYDJ 1I6HJ 2R5YA 5C4JJ 3BTJA 1U78A 4I6ZA 2ID6A 2VUMJ 2QF7A 2L7ZA 4G12A 2ID3A 1POGA 3JRDA 1FTZA 2CU7A 2EZLA 3JRFA 2JMWA 1JKOC 2X9DA 1IC8A 5JLXA 2K40A 2HXIA 3FK6A 3ZOBA 2VKVA 1ITYA 2XRLA 5FKMA 3QPLA 2EZKA 5F0CA 4FE7A 3NARA 4B3AA 2Y9YA 3GTJJ 3S2HJ 3G1OA 4QTRA 2MW8A 1GT0C 2O7OA 3ZQHA 2DTZA 2NVXJ 3BQZA 2VI6A 3JRGA 2CRGA 4X1EA 3FKIJ 4AYBN 1U9NA 4D5CA 3B6AA 1Z0XA 3LSGA 4A3BJ 3JRIA 3BT9A 3GBGA 5F27A 5EDNA 4B4CA 2JJ7A 5BNGA 3RZDJ 1BW5A 2MGQA 2XB0X 2EZHA 2ME0A 3HEFA 3MVPA 3WHBA 2DJNA 1H8AC 1QRYA 2XPVA 4BXXJ 3IV5A 3HOUJ 1WI3A 3HGYA 3BR1A 1MSFC 5FKOA 4IHYA 4IEJA 5GP9A 4A3DJ 5C44J 3S1NJ 4BBRJ 1OCPA 3VPRA 4M3GA 3RZOJ 2IAIA 1I50J 1X2NA 1PUFA 1BA5A 1X58A 2H8RA 4EEFG 2R7ZJ 2DA6A 2E19A 4FE4A 1HF0A 3HM5A 4MO7A 2NVYJ 2HDDA 2R92J 4CYCB 2HOAA 5EGOB 3CCYA 3IH4A 2D5VA 3QPSA 4JX5A 1OJLA 2XPUA 2HQ5A 2CQQA 5EG0A 3LSRA 1JKQC 1ETYA 1A5JA 2FX0A 3G1MA 2TRTA 2K9QA 5E3LA 1U9OA 1T33A 3BR3A 4L5EA 5E3MA 4A69C 2H1KA 4BY7J 3CDLA 1AHDP 1HLVA 1ZTRA 2L7MP 2MSYA 1JT0A 1ZQ3P 4GFBA 1AU7A 1B72B 2MG4A 2E1OA 5FLVA 1ENHA 4XRSA 3LNQA 4M3FA 2K9SA 1ZK8A 3MN2A 3HOWJ 2XGCA 2XGDA 1IG7A 1MBFA 3TEDA 2XPWA 1FTTA 4DW6A 3S17J 2E2IJ 2M34A 4AUXA 1AKHB 3GTLJ 3JREA 2K9NA 2R5YB 5J1YA 1IDZA 3A02A 2JA5J 1XS9A 4FISA 1JKPC 1MBKA 3ZQFA 1RKWA 4A3KJ 3JRAA 3S15J 2LKXA 3DCFA 1UG2A 2ELKA 3HBLA 4Y7NJ 2CJJA 3RKQA 2WB1N 3S2DJ 2M8GX 5HODA 5FKLA 3F0CA 5FKKA 4MFEA 4JP0A 2YU9J 5F0HA 1HDDC 2NVQJ 2W48A 3GTQJ 3O8GA 2E2JJ 1WPKA 3S1RJ 1FJLA 1VF9A 5J1UA 2AHQA 2LY9A 1TC3C 1U8BA 4A3CJ 3IH3A 1MBEA 2GLOA 2PMZN 1ETVA 5E3OA 2FD5A 5DTDA 1MSEC 3A03A 5K7HA 3I4NJ 3BR6A 1IDYA 3HOVJ 1IRZA 1GV2A 2CQXA 2COBA 2O8KA 1FIAA 1XG1A 3OOUA 2DN0A 1H89C 5K7FA 1GUUA 2X6OA 1WCMJ 2Y30A 5EYRA 2KDZA 2M2EA 4A3JJ 3LSPA 2P81A 2NS8A 3PM1A 5IP7J 2XSDC 3K2AA 3C2BA 4XIDA 3JR9A 1NK2P 2NOGA 2L7FP 5F08A 1JT6A 3FISA 4DYCA 1APLC 4BKXA 2DMUA 4XRMA 2HOTA 1TWCJ 2GBYA 1PUFB 3BG5A 1LFBA 1WH7A 3TW6A 4V2GA 3E7LA 1ZGWA 1S7EA 2LD5A 1B8IA 4AC0A 2DMPA 2WAQN 1K61A 1MBJA 2VKEA 4ABZA 1QVTA 1DU6A 1JKRC 3S16J 2HYJA 4UUSA 3FIWA 5J3LA 5EG0B 3HOZJ 5K7ZA 2JA8J 4A3LJ 2HI3A 4JYKA 3MKLA 5EZHA 1E3OC 2DMQA 1X2MA 2AO9A 4NDLA 3UKGA 1W0UA 5J1RA 3OIOA 5EF6A 4C3JJ 1MH4A 1LFUP 1T56A 3LSJA 3ZQCA 1Y1WJ 1ETQA 5E3NA 1A6IA 3S1QJ 2RAEA 4DZJA 1VFCA 2L9RA 3QQAA 2DA5A 3M3YJ 2LTPA 5M3MJ 2DA3A 2R5ZA 5M5YJ 4A3GJ 2DA2A 5EEAA 4RDUA 3D1NI 1LE8A 1ZKGA 4MIMA 1DU0A 1ETOA 1TWFJ 3BG3A 3A01A 3SFIA 1R9TJ 4BBSJ 5IP6A 3RQIA 3ZQIA 4IHVA 3H3VK 3B6CA 5M3FJ 4DYQA 3HB9A 1JUPA 3HGGA 4W1UA 3ZQGA 5FLMJ 2Y31A 1MH3A 4BY1J 2YS9A 2JA7J 2XB5A 1WH5A 3BR2A 3NAUA 4RBOA 3TP3A 3IH2A 3BQYA 1HCRA 2E2HJ 1ZR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORK A;  1QPI A;  2M0C A;  1G2H A;  2LVS A;  1ETX A;  5DS9 A;  1MBG A;  1VI0 A;  2R0Q C;  1D5Y A;  3LOC A;  4LOC A;  4D5F A;  2JN6 A;  3BR0 A;  4XIC A;  4D7N A;  4M6V A;  3M4O J;  4C2M J;  2EH3 A;  1YRN A;  2OF7 A;  2ECC A;  3K7A J;  1TWA J;  3Q3S A;  2GM4 A;  3BR5 A;  4V2F A;  5C3E J;  4Y52 J;  1BL0 A;  3GTP J;  5C4X J;  2JK3 A;  3BG9 A;  2DA4 A;  2NVT J;  4JX6 A;  3G1L A;  2Y0S N;  4XK4 A;  2IEK A;  2NS7 A;  2DMN A;  4FCY A;  4QSH A;  5F0F A;  2R93 J;  1TWH J;  4MLO A;  3SJM A;  4XRS G;  5JLW A;  1BJZ A;  2FQ4 A;  3OSF A;  1ETW A;  2OPT A;  3BTI A;  5IOZ A;  2EQR A;  4DYR A;  1FIP A;  1B8I B;  4M3B A;  1TWG J;  1SAN A;  2FJ1 A;  2HXO A;  4X6A J;  4UUS B;  1Y1V J;  1P7J A;  2ME6 A;  5IP9 J;  1BW6 A;  1QVU A;  1RR7 A;  3L1P A;  3CMY A;  4M3D A;  3PO3 J;  4DZP A;  9ANT A;  1F36 A;  2YUS A;  2VPR A;  2Y9Z A;  2WV1 A;  2LP0 A;  3I4M J;  5FKN A;  2JWT A;  2XGE A;  1F43 A;  1FEX A;  1RET A;  1IGN A;  4A93 J;  4HNV A;  2I10 A;  3SDG A;  2CUF A;  5GPA A;  3PO2 J;  4A3M J;  3HDD A;  2DA7 A;  2LK2 A;  4JX4 A;  4W97 A;  2DA1 A;  3JRC A;  1P7I A;  1UMQ A;  3JRH A;  4IHX A;  3H0G J;  1I3Q J;  1GVD A;  4IHW A;  1WGX A;  2R5Z B;  1K83 J;  1Z77 A;  1NK3 P;  1LE8 B;  1HOM A;  2LR8 A;  3BTC A;  3HOX J;  2EZI A;  1O4X A;  2ECB A;  3S14 J;  3A01 B;  4A3F J;  3GTK J;  4C3H J;  1W0T A;  1RKT A;  2HOS A;  5M5X J;  1ZR4 A;  5F04 A;  3JRB A;  3ZQL A;  2KT0 A;  5IYB J;  1JGG A;  2LFB A;  5F1J A;  1JJ8 C;  2QCO A;  1ETK A;  4C3I J;  2LLK A;  1CQT A;  2DMT A;  1GV5 A;  3HOY J;  4M3E A;  2G0E A;  1IUF A;  1OCT C;  3HKZ N;  1UHS A;  2Y2Z A;  1IJW C;  1GDT A;  1VND A;  3BTL A;  3Q0V A;  4B1R A;  5IYC J;  1JUS A;  5FJ8 J;  5IPA A;  1NTC A;  4CYC A;  4S0H B;  2CUE A;  5EGO A;  2TCT A;  3Q0W A;  1H88 C;  3WHC A;  2X48 A;  1YRN B;  3FK7 A;  1EF4 A;  3S1M J;  3GTO J;  4J19 A;  2ZB9 A;  3DEW A;  4MFD A;  4UUT A;  3TP0 A;  1SFO J;  1Q1V A;  3Q0U A;  5IOY A;  4A3I J;  2O9L A;  1MBH A;  3O8H A;  1JJ6 C;  1JUM A;  1OFC X;  1XC5 A;  5GPC A;  2N8G A;  1RPW A;  1HDP A;  1IV6 A;  4A3E J;  1B72 A;  3W6V A;  4D7M A;  2EBI A;  4I76 A;  5EZG A;  3TW7 A;  1MNM C;  4QIW N;  4FTH A;  2IBD A;  3GTG J;  2L0K A;  2B63 J;  3CQZ J;  5M5W J;  1JTY A;  2M9H A;  1RES A;  3OSG A;  1JTX A;  1AKH A;  2JA6 J;  3GTM J;  5IYD J;  1I6H J;  2R5Y A;  5C4J J;  3BTJ A;  1U78 A;  4I6Z A;  2ID6 A;  2VUM J;  2QF7 A;  2L7Z A;  4G12 A;  2ID3 A;  1POG A;  3JRD A;  1FTZ A;  2CU7 A;  2EZL A;  3JRF A;  2JMW A;  1JKO C;  2X9D A;  1IC8 A;  5JLX A;  2K40 A;  2HXI A;  3FK6 A;  3ZOB A;  2VKV A;  1ITY A;  2XRL A;  5FKM A;  3QPL A;  2EZK A;  5F0C A;  4FE7 A;  3NAR A;  4B3A A;  2Y9Y A;  3GTJ J;  3S2H J;  3G1O A;  4QTR A;  2MW8 A;  1GT0 C;  2O7O A;  3ZQH A;  2DTZ A;  2NVX J;  3BQZ A;  2VI6 A;  3JRG A;  2CRG A;  4X1E A;  3FKI J;  4AYB N;  1U9N A;  4D5C A;  3B6A A;  1Z0X A;  3LSG A;  4A3B J;  3JRI A;  3BT9 A;  3GBG A;  5F27 A;  5EDN A;  4B4C A;  2JJ7 A;  5BNG A;  3RZD J;  1BW5 A;  2MGQ A;  2XB0 X;  2EZH A;  2ME0 A;  3HEF A;  3MVP A;  3WHB A;  2DJN A;  1H8A C;  1QRY A;  2XPV A;  4BXX J;  3IV5 A;  3HOU J;  1WI3 A;  3HGY A;  3BR1 A;  1MSF C;  5FKO A;  4IHY A;  4IEJ A;  5GP9 A;  4A3D J;  5C44 J;  3S1N J;  4BBR J;  1OCP A;  3VPR A;  4M3G A;  3RZO J;  2IAI A;  1I50 J;  1X2N A;  1PUF A;  1BA5 A;  1X58 A;  2H8R A;  4EEF G;  2R7Z J;  2DA6 A;  2E19 A;  4FE4 A;  1HF0 A;  3HM5 A;  4MO7 A;  2NVY J;  2HDD A;  2R92 J;  4CYC B;  2HOA A;  5EGO B;  3CCY A;  3IH4 A;  2D5V A;  3QPS A;  4JX5 A;  1OJL A;  2XPU A;  2HQ5 A;  2CQQ A;  5EG0 A;  3LSR A;  1JKQ C;  1ETY A;  1A5J A;  2FX0 A;  3G1M A;  2TRT A;  2K9Q A;  5E3L A;  1U9O A;  1T33 A;  3BR3 A;  4L5E A;  5E3M A;  4A69 C;  2H1K A;  4BY7 J;  3CDL A;  1AHD P;  1HLV A;  1ZTR A;  2L7M P;  2MSY A;  1JT0 A;  1ZQ3 P;  4GFB A;  1AU7 A;  1B72 B;  2MG4 A;  2E1O A;  5FLV A;  1ENH A;  4XRS A;  3LNQ A;  4M3F A;  2K9S A;  1ZK8 A;  3MN2 A;  3HOW J;  2XGC A;  2XGD A;  1IG7 A;  1MBF A;  3TED A;  2XPW A;  1FTT A;  4DW6 A;  3S17 J;  2E2I J;  2M34 A;  4AUX A;  1AKH B;  3GTL J;  3JRE A;  2K9N A;  2R5Y B;  5J1Y A;  1IDZ A;  3A02 A;  2JA5 J;  1XS9 A;  4FIS A;  1JKP C;  1MBK A;  3ZQF A;  1RKW A;  4A3K J;  3JRA A;  3S15 J;  2LKX A;  3DCF A;  1UG2 A;  2ELK A;  3HBL A;  4Y7N J;  2CJJ A;  3RKQ A;  2WB1 N;  3S2D J;  2M8G X;  5HOD A;  5FKL A;  3F0C A;  5FKK A;  4MFE A;  4JP0 A;  2YU9 J;  5F0H A;  1HDD C;  2NVQ J;  2W48 A;  3GTQ J;  3O8G A;  2E2J J;  1WPK A;  3S1R J;  1FJL A;  1VF9 A;  5J1U A;  2AHQ A;  2LY9 A;  1TC3 C;  1U8B A;  4A3C J;  3IH3 A;  1MBE A;  2GLO A;  2PMZ N;  1ETV A;  5E3O A;  2FD5 A;  5DTD A;  1MSE C;  3A03 A;  5K7H A;  3I4N J;  3BR6 A;  1IDY A;  3HOV J;  1IRZ A;  1GV2 A;  2CQX A;  2COB A;  2O8K A;  1FIA A;  1XG1 A;  3OOU A;  2DN0 A;  1H89 C;  5K7F A;  1GUU A;  2X6O A;  1WCM J;  2Y30 A;  5EYR A;  2KDZ A;  2M2E A;  4A3J J;  3LSP A;  2P81 A;  2NS8 A;  3PM1 A;  5IP7 J;  2XSD C;  3K2A A;  3C2B A;  4XID A;  3JR9 A;  1NK2 P;  2NOG A;  2L7F P;  5F08 A;  1JT6 A;  3FIS A;  4DYC A;  1APL C;  4BKX A;  2DMU A;  4XRM A;  2HOT A;  1TWC J;  2GBY A;  1PUF B;  3BG5 A;  1LFB A;  1WH7 A;  3TW6 A;  4V2G A;  3E7L A;  1ZGW A;  1S7E A;  2LD5 A;  1B8I A;  4AC0 A;  2DMP A;  2WAQ N;  1K61 A;  1MBJ A;  2VKE A;  4ABZ A;  1QVT A;  1DU6 A;  1JKR C;  3S16 J;  2HYJ A;  4UUS A;  3FIW A;  5J3L A;  5EG0 B;  3HOZ J;  5K7Z A;  2JA8 J;  4A3L J;  2HI3 A;  4JYK A;  3MKL A;  5EZH A;  1E3O C;  2DMQ A;  1X2M A;  2AO9 A;  4NDL A;  3UKG A;  1W0U A;  5J1R A;  3OIO A;  5EF6 A;  4C3J J;  1MH4 A;  1LFU P;  1T56 A;  3LSJ A;  3ZQC A;  1Y1W J;  1ETQ A;  5E3N A;  1A6I A;  3S1Q J;  2RAE A;  4DZJ A;  1VFC A;  2L9R A;  3QQA A;  2DA5 A;  3M3Y J;  2LTP A;  5M3M J;  2DA3 A;  2R5Z A;  5M5Y J;  4A3G J;  2DA2 A;  5EEA A;  4RDU A;  3D1N I;  1LE8 A;  1ZKG A;  4MIM A;  1DU0 A;  1ETO A;  1TWF J;  3BG3 A;  3A01 A;  3SFI A;  1R9T J;  4BBS J;  5IP6 A;  3RQI A;  3ZQI A;  4IHV A;  3H3V K;  3B6C A;  5M3F J;  4DYQ A;  3HB9 A;  1JUP A;  3HGG A;  4W1U A;  3ZQG A;  5FLM J;  2Y31 A;  1MH3 A;  4BY1 J;  2YS9 A;  2JA7 J;  2XB5 A;  1WH5 A;  3BR2 A;  3NAU A;  4RBO A;  3TP3 A;  3IH2 A;  3BQY A;  1HCR A;  2E2H J;  1ZR2 A; 
#chains in the Genus database with same CATH topology
 4NBQ A;  4DBQ A;  5LEK A;  1TL8 A;  1B9N A;  5AIP A;  1QPI A;  4QPQ A;  1G2H A;  2KP6 A;  1DGR M;  2V26 A;  2Y0S A;  3I4P A;  4U7D A;  1MBG A;  3GZ6 A;  4H0E A;  2XAQ A;  3VOE A;  3LFK A;  5JVT A;  4E7K A;  1VTN C;  3BR0 A;  2X51 A;  3RCO A;  1YRN A;  1TWA J;  5E79 C;  1W5T A;  1G4D A;  5C3E J;  1BL0 A;  3GTP J;  1EH8 A;  4PFO A;  4AID A;  1R00 A;  3AAF A;  4JX6 A;  2XC7 A;  2K02 A;  2Y0S N;  3CCM I;  3GFI A;  2JPB A;  2XHK A;  5GAE J;  1Y39 A;  3LSK A;  4GCV A;  1TQM A;  4XN0 A;  2EK5 A;  1E0E A;  3IP4 B;  5E18 F;  1FOK A;  3B73 A;  2R93 J;  1TWH J;  3WG9 A;  3VWB A;  3N97 A;  3IKT A;  4HYE A;  1DPR A;  3SQN A;  4LIV A;  4CZZ A;  2DXI A;  4GXO A;  1AA7 A;  1ETW A;  3BTI A;  4XKV A;  3RTR A;  5IOZ A;  5HLG A;  3RPU A;  3OYK A;  4AVZ A;  2EQR A;  4EJV A;  2XIG A;  2F4I A;  2FF4 A;  1NG7 A;  2G7U A;  2P0W A;  4BS9 A;  2ISY A;  3VEP A;  4XBF A;  2HXO A;  5BPI A;  1P7J A;  3RKY A;  2ME6 A;  5IP9 J;  3P7N A;  2EIN H;  1QVU A;  5CQG A;  1RR7 A;  2MD0 A;  4K2E A;  2BZT A;  2F6C A;  3COA C;  3BCA A;  4XKC A;  1F36 A;  3CUO A;  1WFX A;  1UG0 A;  5JHU A;  4HQM A;  2IXS A;  1BC8 C;  1ZHF A;  1TTY A;  1F43 A;  2GXG A;  1RET A;  3AG4 H;  1IGN A;  4A93 J;  5GAD J;  4M73 A;  1TQP A;  4L9T A;  3SEZ A;  4A0Y A;  3HDD A;  2LKS A;  1HA8 A;  4JX4 A;  2Z2S B;  2DA1 A;  1G3W A;  2WBM A;  3TQN A;  5FRO A;  3H0G J;  1I3Q J;  2DFH A;  1X1C A;  2HNH A;  2WY8 Q;  2VKD A;  2LH9 A;  3HOX J;  4IOC F;  2EZI A;  2XAJ A;  1O4X A;  2ECB A;  3MFK A;  2MH2 A;  1E3H A;  3A01 B;  4I2O A;  3ONQ A;  3S14 J;  4HV6 A;  1UHW A;  3F9K A;  1RKT A;  1OMI A;  1MMD A;  5L3E A;  1WJC A;  5M5X J;  3ZXS A;  4P9U A;  1UFM A;  3ZQL A;  2H09 A;  5IYB J;  3WTU C;  3V8J A;  2PBI A;  2HQR A;  1U6G A;  4BHC A;  5F1R A;  1JJ8 C;  1SFX A;  1ETK A;  2K3P A;  1D1C A;  3HOY J;  4G6Q A;  2Y48 A;  1OCT C;  3FXU A;  2EA4 A;  3G73 A;  2CUZ A;  4ESF A;  1UHS A;  3IUO A;  4OIP F;  3G3Z A;  1R23 A;  2A6H F;  2FSW A;  3CO7 C;  1SAU A;  2DBB A;  4B1R A;  5IYC J;  1JUS A;  3BPV A;  5IPA A;  2ELH A;  2WV0 A;  4HW0 A;  4LLN A;  1MDM A;  1P4W A;  4Y17 A;  2W82 A;  2F5V A;  4RLF A;  3FK7 A;  2HPM A;  2KFD A;  1T95 A;  2V9K A;  3LA7 A;  1VQK I;  3CCL I;  3F72 A;  3OIQ A;  3DEW A;  2ZFU A;  1ON1 A;  3TP0 A;  5IOY A;  5ILV A;  3O8H A;  2B9S A;  2BEO A;  2ELJ A;  1JUM A;  1OFC X;  3DLA A;  1XC5 A;  4PSX A;  4N9H A;  3MZ8 A;  1RZ4 A;  3CO6 C;  2N8G A;  3T8T A;  3R61 A;  3H35 A;  1RPW A;  1LVK A;  2VJJ A;  1CF7 A;  1ZRD A;  4D7M A;  2EBI A;  4I76 A;  3S3M A;  2DO7 A;  2PFB A;  2K86 A;  1T39 A;  3C3W A;  4FTH A;  4LIU A;  2FOW A;  4KIT B;  3CQZ J;  4RGS A;  3TGN A;  4N4N B;  4ASN A;  5KNL A;  4IXA A;  2KDO A;  1RES A;  1K78 B;  2X6Y A;  2DDB A;  1I6H J;  5C4J J;  5BMZ A;  2OTL I;  3C2H A;  4KYW A;  2QF7 A;  4A2U A;  4G12 A;  5ERI A;  3OL4 A;  3JRD A;  1FTZ A;  1GXP A;  4RAZ A;  3I5U A;  4UVA A;  2I5U A;  2X9D A;  3N4M A;  1JKO C;  3DWL E;  4G6T B;  2AQF A;  3NWS A;  5JLX A;  2K40 A;  4XL9 A;  1PVE A;  4LLG F;  2EFQ A;  3ZOB A;  1ITY A;  5K5Q A;  3C1D A;  3J7A Y;  5CVU A;  4FE7 A;  1BI2 A;  2V9P A;  2XKP A;  4KN4 X;  4QTR A;  3L2C A;  3MMY B;  4XSX F;  2KIS A;  2O7O A;  3K4K A;  1ZRE A;  2O3F A;  3C2G A;  3HRS A;  2WAD A;  5FB2 A;  3KFW X;  2CRG A;  4U88 A;  3K70 D;  4RB1 A;  1XTA A;  3V7R A;  4AYB N;  1DDN A;  3CJT B;  4AIH A;  3LSG A;  3CCS I;  2IS4 A;  4XNF A;  3RKX A;  4PGH A;  4BNC A;  1SD4 A;  2H8W A;  1R6R A;  5EDN A;  1BW5 A;  4R79 A;  1VQ7 I;  2EZH A;  3IAM 2;  2IS2 A;  3OYH A;  1HQC A;  1B59 A;  1X3W B;  2XPV A;  3H9Q A;  4NQW B;  1DUX C;  3F23 A;  3LL7 A;  1MGT A;  5FKO A;  1MSF C;  4IEJ A;  4IHY A;  1JXS A;  4D1Q A;  5KVR A;  2L02 A;  4L0Y B;  4E7L A;  4BBR J;  4M3G A;  4BE0 A;  2IAI A;  1HKQ A;  2XRN A;  3TO7 A;  5BS6 A;  4UY8 I;  2ZME C;  4KNY A;  3CCU I;  5J8F A;  2LY1 A;  3SYT A;  1PUF A;  2P7C B;  3HKZ A;  2ZNY A;  1BA5 A;  2CW8 A;  1X58 A;  4EEF G;  4CGZ A;  2VON A;  1D8J A;  2JSP A;  2JRT A;  4HX8 A;  1FSH A;  4ZDP A;  3CDH A;  2QBY A;  2NVY J;  1X4O A;  3OS0 A;  3L2V A;  4CYC B;  3CCY A;  3IH4 A;  3QOP A;  1OJL A;  1Q1H A;  2XPU A;  2HQ5 A;  2CQQ A;  2AS5 F;  3REO A;  3RJP A;  2R7W A;  3E97 A;  3ISP A;  5DYM A;  2FX0 A;  1D0X A;  3GX4 X;  2K9Q A;  2QQ8 A;  2QVO A;  1W36 C;  4L5E A;  3RI4 A;  2H1K A;  1SVL A;  4RM3 A;  4LB6 B;  2GAU A;  1QZZ A;  4BDY A;  1D3Y A;  1VQ4 I;  3OYE A;  2D1H A;  3E5X A;  2MSY A;  4XR6 A;  4XQF A;  4L5I A;  4BGD A;  1JT0 A;  2XAS A;  4M6Y A;  5FO5 A;  1OYW A;  4IF4 A;  1ZH5 A;  1X4P A;  4XRS A;  4HF2 A;  3F22 A;  3LNQ A;  2HQA A;  1EH7 A;  2K9S A;  3AG3 H;  4PJL A;  3S8P A;  3JAM K;  5F6F A;  1MBF A;  3TED A;  2XPW A;  4YFN F;  3S17 J;  2JT1 A;  2YPR A;  3A0H C;  2DT7 B;  3P9I A;  3I55 I;  3GTL J;  4EV0 A;  5AIQ A;  3I59 A;  4A12 A;  2OC6 A;  1XS9 A;  1ZRC A;  1JKP C;  1UAA A;  2F4O B;  2V7F A;  3HBL A;  1UG2 A;  2ELK A;  5E1W A;  3DKW A;  4Y7N J;  2PMZ A;  3ZRG A;  2DLL A;  2VBW A;  2IS1 A;  2HGC A;  2ADU A;  3L7W A;  2GIV A;  3J7A O;  4BEH B;  4IJA A;  2XKO A;  3JTG A;  2FE3 A;  2GA2 A;  2VT3 A;  2W48 A;  4M9X A;  1B1B A;  5IT9 K;  4Y13 A;  1WPK A;  1L3L A;  1BIB A;  5HDN A;  3S1R J;  2LY9 A;  1U8B A;  1MBE A;  2DOF A;  3KP6 A;  2GLO A;  4BQO A;  2PMZ N;  4BQQ A;  3NQO A;  3QOE A;  3VYU B;  4KA4 A;  1YFH A;  4ZYH A;  2ETH A;  3AFH A;  2FD5 A;  1ZRF A;  2CUJ A;  4GYI A;  4BU2 A;  1SVO A;  4PGG A;  1MSE C;  2I8D A;  3KP4 A;  4LD5 A;  1GV2 A;  2VN2 A;  1MD0 A;  4B43 A;  4ZH4 F;  3K9T A;  2DFI A;  3OOU A;  1OIS A;  2FEZ A;  3KCC A;  4XLH A;  5ICE A;  3GVA A;  3AL0 B;  4CCL A;  4B48 A;  4BUP A;  2UZK A;  1WCM J;  3H1C A;  1OYI A;  3K1M A;  3LSP A;  2NS8 A;  3PM1 A;  2E1C A;  4YFK F;  1WRJ A;  2XSD C;  3C2B A;  2PMU A;  4XID A;  1R1U A;  2QSF X;  2PI0 A;  2WAQ A;  1MMA A;  3GW2 A;  3FIS A;  1A35 A;  2F5D A;  3QP5 A;  5KHD A;  4RAY A;  3ML6 A;  3S32 A;  5KAF C;  1LVA A;  3HTS B;  1LFB A;  4I09 A;  4B09 A;  1I6X A;  4NB5 A;  2QKL B;  2Q0O A;  2JA2 A;  2RV8 A;  3VDX A;  1BM9 A;  1YYV A;  3PSI A;  5LBQ A;  2RGV A;  2ZXI A;  3FXO A;  1XMK A;  3K1P A;  2WAQ N;  4C2U A;  2OZ6 A;  1T38 A;  2K5C A;  3QYB A;  1JKR C;  1R36 A;  3CDI A;  1R5G A;  2HYJ A;  3FIW A;  2LMD A;  3HOZ J;  3DBR B;  4C2T A;  4A3L J;  2R7U A;  2FXA A;  2XUB A;  2A68 F;  3MKL A;  3CUQ B;  1B6A A;  2AO9 A;  3V4G A;  3UKG A;  1FOX A;  4ENN A;  3MZY A;  1W0U A;  4UNO A;  2W57 A;  3J80 K;  1T56 A;  3LSJ A;  2P6T A;  3ZQC A;  4ZTF A;  2GWR A;  4EM2 A;  1P4X A;  2A07 F;  2MD5 A;  3TOA A;  1VQ5 I;  1R5H A;  3WTV C;  5ILU A;  3KX2 A;  3AG2 H;  2HS5 A;  1YE9 A;  2B7E A;  2PJR B;  2DA3 A;  1YHQ I;  5M5Y J;  5CJ9 A;  5EEA A;  2ZJP F;  3D1N I;  2X85 A;  1ZKG A;  4NC8 A;  1IUY A;  3OS1 A;  1TWF J;  3GEZ A;  1UHM A;  4M74 A;  3M1E A;  2XDV A;  3BZ6 A;  2OD5 A;  1SD7 A;  4UVC A;  4Q48 A;  1IV8 A;  3SFI A;  5IP6 A;  2XF6 A;  1TBX A;  1C0W A;  1WKM A;  4DYQ A;  3HB9 A;  3BWG A;  3HGG A;  3DTE A;  1MH3 A;  5AON A;  2JA7 J;  1KU2 A;  1WJD A;  3PIP F;  3BR2 A;  2X4H A;  2Z3Y A;  4RBO A;  2WC2 A;  1WQ2 A;  5K5O A;  3HL2 A;  3K70 C;  4HST A;  4D0P A;  3OWT A;  1HCR A;  2BVM A;  2E2H J;  1SVM A;  3E6M A;  4CCO A;  2IPQ X;  3M1C A;  2ZSI B;  2M7B A;  1K7A A;  5JI6 A;  1HC8 A;  4NHJ A;  4UUV A;  4D5F A;  2JN6 A;  4M6V A;  3J7Z I;  2EH3 A;  1FBQ A;  2GM4 A;  1XGO A;  2DOE A;  3OYL A;  2EFW A;  3DF8 A;  2LBF A;  1XMX A;  3BG9 A;  2MYS A;  4E70 A;  2JPC A;  4RB2 C;  1BIA A;  2NVT J;  1LQ1 A;  1OQY A;  4EJO A;  3DBL B;  2NYX A;  1HBX G;  4FCY A;  3Q9S A;  2DK5 A;  2MC4 A;  2E5N A;  2LY2 A;  1XD7 A;  2Q2E B;  4XRS G;  3V7C A;  2KRF A;  1BJZ A;  3O6B B;  1H9G A;  1YIJ I;  2A5Y B;  2OPT A;  3CD6 I;  3NEU A;  4CSW A;  1D8K A;  3ZQQ A;  4DYR A;  3JSO A;  2R7R A;  4IKF A;  2QEX I;  4BYY A;  1SAN A;  1WJF A;  2L4M A;  2FJ1 A;  3KET A;  3TBI A;  1Z7U A;  2QWW A;  1Y1V J;  3BPX A;  4U7B A;  1BW6 A;  2CH0 A;  2QQ9 A;  4O5V A;  2WAE A;  2DTR A;  3PO3 J;  4UB6 C;  4S05 A;  1XGN A;  3LFU A;  3DBH B;  3FMQ A;  4NC6 A;  3LMM A;  2WV1 A;  2LP0 A;  1J7K A;  2JWT A;  2Y0M A;  2KJC A;  3DPU A;  4HSR A;  2I10 A;  4F52 A;  2P5V A;  4HRI A;  4ZYD A;  2QA4 I;  2L2O A;  5JHF A;  2DA7 A;  1FMW A;  2HTJ A;  2LK2 A;  3S3O A;  1KGS A;  4L5J A;  5HNF A;  2STT A;  2E71 A;  1UMQ A;  5EJC A;  3ECO A;  1GVD A;  3GZ5 A;  4IHW A;  3K4L A;  2R5Z B;  1LE8 B;  1HOM A;  1I27 A;  1K79 A;  4HV5 A;  2HYG D;  3BTC A;  2E36 A;  1LDK B;  2CQ7 A;  4DBR A;  2YU3 A;  4C9Y A;  4C3H J;  3WTX C;  4DGW B;  1W0T A;  3QYF A;  3CP2 A;  3GFJ A;  4CUG A;  4HDU A;  5F04 A;  3JRB A;  2BY3 A;  2WAF A;  1U5T A;  5DM7 F;  1IXC A;  2L3D A;  4BAY A;  1W4M A;  4YEL A;  1V5G A;  3MKW B;  2GIZ A;  2QM3 A;  4KFC A;  4C3I J;  3LSM A;  1T0F C;  2LLK A;  5BQT A;  5HLH A;  1GV5 A;  3ZN1 A;  4M3E A;  2K4B A;  5CVR A;  2DPU A;  2QYO A;  3CCR I;  1IJW C;  3DV8 A;  3FMR A;  2XF7 A;  3KZY A;  4II2 A;  2ZFW A;  4KT5 C;  3A4C A;  1OR7 A;  2Y69 H;  1GHC A;  2UXN A;  1IN6 A;  2XF5 A;  2CV2 A;  2UWM A;  1YG2 A;  2V1N A;  2TCT A;  2R7Q A;  3Q0W A;  2M30 A;  1HW1 A;  1UJ8 A;  2CWE A;  3WHC A;  1YRN B;  4ZJZ A;  5LFA A;  4EQQ A;  3WTY C;  3HYI A;  3GTO J;  1MND A;  1PP7 U;  2ZB9 A;  3OYM A;  4BJ5 C;  4V19 K;  1IF1 A;  4QPO A;  4CCK A;  2CG4 A;  3PFY A;  4PJ0 C;  4FAS D;  2ZXJ A;  2BHY A;  4C30 A;  5FFZ A;  2EPF A;  3EUH A;  3K69 A;  2DFE A;  1V3F A;  5D6E A;  1B72 A;  3W6V A;  3ABL H;  1S29 A;  1SMY F;  5HDK A;  1MNM C;  3GTG J;  3I54 A;  3P5J A;  2VOD A;  3PSF A;  3M7G A;  1XSX A;  3OV8 A;  5CVJ A;  2V6E A;  4OIQ F;  1F9N A;  3R4K A;  5IYD J;  3N05 A;  1YOV B;  1R4M B;  2YX4 A;  5TIS C;  1NH3 A;  2HZD A;  1AKH A;  1S7A A;  2V9V A;  2HYF A;  3G6E I;  2IGO A;  4E6K G;  2HR3 A;  2ID6 A;  3I71 A;  1POG A;  3KZZ A;  2CU7 A;  2EZL A;  3JRF A;  2JMW A;  4DNC A;  3K0L A;  4Y15 A;  2MBF A;  3R0J A;  3S93 A;  2XRL A;  5FKM A;  4F3Q A;  5HLI A;  4GDF A;  2QUF A;  5TRD A;  2KZG A;  2Y9Y A;  4YRV A;  2FU4 A;  3P9C A;  3RDI A;  3NWT A;  3FM3 A;  5H6R A;  2NVX J;  3BJ6 A;  3H9J A;  1KA8 A;  1ZYR F;  2VI6 A;  4Q4Z F;  2DYS H;  3WTW C;  4EGY A;  3MEX A;  1SMT A;  1V54 H;  4NUB A;  4GYG A;  2OJE D;  4A3B J;  1J5Y A;  4LG0 A;  3GBG A;  3SZP A;  5LGU A;  1ZLK A;  5F27 A;  1Z21 A;  2KKO A;  3FXL A;  5A2Q Z;  4LK1 F;  4ZZD A;  4QWQ A;  2EIL H;  2L9N A;  2D1V A;  1I3A A;  2V1X A;  2ME0 A;  4CXF A;  1JGS A;  3OYF A;  3HEF A;  3MAJ A;  3WHB A;  2DJN A;  2A61 A;  1QRY A;  2OUM A;  4JQF A;  3CF5 F;  1QU3 A;  2VOP A;  3IV5 A;  4KMU X;  4AD9 A;  3HGY A;  4UB8 C;  3C18 A;  4EGZ A;  3OYJ A;  5J4Y A;  5GP9 A;  3OS2 A;  1VQP I;  3E3V A;  1QHG A;  4PZJ A;  2W25 A;  4MNU A;  3ZMD A;  1S9H A;  4LB5 A;  2VBY A;  3GLX A;  3PQJ A;  4LFU A;  2QEN A;  4JK1 X;  5FGM A;  4HDV A;  3E0J B;  2NXN B;  3KEQ A;  3FZV A;  4M72 A;  1Y8Q B;  5IY5 H;  2DOD A;  3MZH A;  2R7Z J;  3ABU A;  3K4C A;  4FE4 A;  3OY9 A;  2IW5 A;  3CC4 I;  3W2A A;  3K10 A;  2MA3 A;  1MDM B;  2D5V A;  2RNG A;  2P8T A;  2M7A A;  3ASO H;  1S3J A;  1ETY A;  2PX9 A;  1FNN A;  2ESN A;  1Z9C A;  2W1O A;  1FZP B;  4MGR A;  3S2W A;  3FX3 A;  1WJA A;  1Y0N A;  4ZDO A;  1T33 A;  3V8L A;  3BR3 A;  4A69 C;  3GZN B;  3ZN0 A;  3AL0 C;  1LB2 A;  1AHD P;  3EYY A;  1BR1 A;  3D5L A;  1KQ8 A;  2LRD A;  4XOT A;  2IJL A;  4A5N A;  2GA1 A;  5HS8 A;  5LHH A;  2ISZ A;  1DPU A;  1R7J A;  3HRM A;  1IN8 A;  1CF7 B;  4RMN A;  2MG4 A;  1HST A;  4MQ9 F;  4IQ4 A;  3K6G A;  1ZK8 A;  2XGC A;  1J9I A;  3MKZ A;  4R8H A;  4DW6 A;  3LSH A;  3QRF F;  2E2I J;  4XOR A;  3DU5 A;  1XDS A;  3JRE A;  5J1Y A;  5DEQ A;  3C7J A;  3A02 A;  4B3X A;  5EEH A;  4OWR B;  4BHP A;  5D8K B;  3JRA A;  2O0Y A;  2A6T A;  4UVB A;  4DQ2 A;  1N25 A;  3R6S A;  3RPU D;  3HZJ A;  1G6N A;  1EA3 A;  1FBS A;  5FKL A;  3F0C A;  5FKK A;  4IRI A;  1XGM A;  4MFE A;  5FLX Z;  4JP0 A;  3CMM A;  5E17 F;  3BZC A;  2HPI A;  3CUQ C;  2RQQ A;  1UZC A;  1FJL A;  3DEE A;  4P1W A;  2AHQ A;  3W2V A;  3BZK A;  2R7X A;  2IVM A;  4A3C J;  3KP5 A;  3IWZ A;  1ETV A;  4AYB A;  2MFZ A;  4XRF A;  3AG1 H;  5J8C A;  5E3O A;  5DTD A;  2GXB A;  3DEU A;  5CYV A;  4ETS A;  1JE8 A;  1YJ9 I;  4XM3 A;  1HKS A;  5HNH A;  3HXL A;  1IDY A;  1IRZ A;  1IN5 A;  3K4J A;  3HOT A;  1XCV A;  4Y4R A;  1FLI A;  3E6C C;  3T1B A;  2HKX A;  3ZQ7 A;  3SEQ A;  2DN0 A;  5DCM A;  2AXL A;  1QGP A;  2OZU A;  2X1C A;  4PJN A;  1KU9 A;  3M8E A;  2LNB A;  4RM2 A;  1ZAR A;  2HTS A;  1EKE A;  5EYR A;  5K1Y A;  2JTV A;  2M2E A;  2KDZ A;  3EYI A;  1W5C C;  3ZMT A;  3BG6 A;  4A0Z A;  3SDB A;  1U8R A;  3QOD A;  1NK2 P;  2V79 A;  2H6B A;  3PUF A;  5DDG A;  2NOG A;  2Z33 A;  4R1H A;  1ZG3 A;  4G7Z F;  4MEX F;  2R7F A;  3PNT A;  2M87 A;  3HPH A;  2KQR A;  2L5Q A;  2GBY A;  4WXH A;  1PUF B;  4IOA F;  1YJW I;  1N78 A;  3TW6 A;  2BXZ A;  2A5W A;  1LKX A;  1ZGW A;  1DP7 P;  1RNL A;  1BI3 A;  2QBY B;  1B8I A;  4LMY A;  1YO5 C;  4RA2 A;  2DT6 A;  4AU7 A;  1V55 H;  2DMP A;  1MBJ A;  1RC9 A;  2QKM B;  4ABZ A;  2P6S A;  4UUS A;  2FML A;  4II3 A;  1HW5 A;  3L09 A;  4E7I A;  1QBJ A;  5EZH A;  5CPR B;  1E3O C;  4BE2 A;  2LSO A;  1P6R A;  4E7S A;  3WGH A;  1SFU A;  4E7H A;  3A1Y A;  5FRM A;  3DU6 A;  1R49 A;  4XLA A;  1R1T A;  3PNV A;  4C3J J;  1Z3Y A;  1LFU P;  1P9Q C;  1OCO H;  2K9L A;  4N9I A;  3WG7 H;  5E3N A;  1M1E B;  1TW3 A;  1USS A;  4AWX B;  1FYK A;  4DZJ A;  1MKM A;  2XGX A;  5JVG F;  1LEB A;  4HQE A;  4KMF A;  2W84 A;  4EMS A;  2OV7 A;  4HBL A;  1Z6R A;  4A3G J;  4EAT A;  4EVI A;  3MKY B;  2DA2 A;  1OCZ H;  3F8C A;  3L9F A;  2XAH A;  2AXT C;  1ETO A;  2HFH A;  2MAB A;  3I59 B;  2JUG A;  3BG3 A;  2LKP A;  1QPM A;  3CC2 I;  1R9T J;  3ELK A;  1PJR A;  2YSR A;  3BC8 A;  2K27 A;  4W1U A;  5FLM J;  4BQA A;  2Y31 A;  3Q5F A;  4BY1 J;  2YS9 A;  2PG4 A;  3E5Q A;  3K4M A;  2XB5 A;  3W3C A;  4ESB A;  3CP8 A;  3TP3 A;  1VQ6 I;  4OU0 A;  3BQY A;  3FXR A;  5K5R A;  3GME A;  1TT0 A;  3HSF A;  3RPQ A;  4NC7 A;  4ANJ A;  3SZT A;  3L2W A;  5LEJ A;  1QA6 A;  1OYY A;  1YX5 A;  3GLL A;  1WSU A;  1ORK A;  3H5A A;  2M0C A;  1SFK A;  2LVS A;  1ETX A;  1WJE A;  3HUG A;  2MC3 A;  3J81 K;  5DS9 A;  2HVS A;  2P5K A;  3UR3 C;  5FD5 A;  1VI0 A;  1I39 A;  2R0Q C;  1BC7 C;  2J5P A;  2RVC A;  3LOC A;  4LOC A;  5CVV A;  3SHF A;  5LRS A;  4XIC A;  1IO2 A;  2K3F A;  2MH9 A;  2YR2 A;  4OMY A;  3BR5 A;  4Y52 J;  2L9S A;  4YEJ A;  1ZG1 A;  1KU3 A;  5C4X J;  3OOP A;  4OOI A;  1U3E M;  1X1D A;  3G1L A;  3VSK A;  3DQV C;  2NS7 A;  2RDP A;  2ZC2 A;  2O61 A;  2BY2 A;  2CGP A;  2CV0 A;  1R71 A;  2IGN A;  1W5S A;  2TDX A;  5F0F A;  2XV4 S;  3SJM A;  4XLF A;  5JLW A;  1X1A A;  2M5W A;  3LAJ A;  4KT6 A;  3OR1 C;  2PJP A;  2CS3 A;  3F3X A;  4G7H F;  4XLE A;  3FXK A;  2IA2 A;  1TLH B;  4XON A;  1FIP A;  2RC4 A;  3OR2 C;  1MJA A;  2VT2 A;  3FMS A;  1QQI A;  2EWN A;  2CV1 A;  4X6A J;  3E6D A;  2M45 A;  2XSJ C;  1SD6 A;  5EEG A;  4XMY A;  2LYC A;  3L1P A;  3T0Y A;  2FNA A;  3DFG A;  3JSP A;  5LRR A;  3I3L A;  1XSV A;  4HZF A;  2VPR A;  3L2U A;  3DTK A;  2A05 A;  3GUD A;  1XCB A;  3I4M J;  4FT8 A;  1FEX A;  2M3A A;  4HNV A;  4IVN A;  2LG4 A;  3FBI B;  3SDG A;  2CUF A;  5GPA A;  2KHM A;  3PO2 J;  3HHH A;  1UEL B;  2BGC A;  1TZL A;  2FOK A;  4KIF A;  4W97 A;  1LFP A;  4LJZ F;  4MHG A;  2QSG X;  1P7I A;  3JRH A;  4OIO F;  3G71 I;  4IHX A;  2BW3 A;  3E5U A;  2OBP A;  1O3S A;  2X1D A;  4JBA A;  3UNG C;  2VE8 A;  1GVJ A;  2D45 A;  1IZ1 A;  4KIS A;  1ONV A;  2Q8K A;  1TP4 A;  1LUJ B;  3EPZ A;  4FX0 A;  4ZYE A;  2NRA C;  3GTK J;  1U2W A;  3KPH A;  3U9G A;  3GFL A;  1Y6I A;  4KJZ A;  2L01 A;  2KT0 A;  1IN4 A;  3U21 A;  5LLQ A;  4L0Z B;  5F1J A;  1OKR A;  4HX4 A;  2Z5U A;  4WK8 F;  2VXD A;  3GWZ A;  2ZCW A;  3HHG A;  2DU9 A;  2Y2Z A;  4BXU A;  2IRF G;  1J2X A;  1EH6 A;  1VND A;  2BYV E;  4IRH A;  3M07 A;  3FM5 A;  2XAU A;  3HSE A;  1FYM A;  2AQE A;  2O8X A;  5FJ8 J;  4EM1 A;  1U0J A;  5CKT A;  1W7P A;  2VJ4 A;  4S0H B;  3OYD A;  5EGO A;  4G6D A;  3U1D A;  4D9J A;  1S7O A;  1H88 C;  4A6D A;  2VJ5 A;  2X48 A;  1EF4 A;  1RUN A;  3S1M J;  1OCR H;  1YW9 A;  3PQK A;  2UUZ A;  5L3F A;  1JI8 A;  2UV1 A;  3EET A;  2LBF B;  1ZGA A;  2WTE A;  4HX7 A;  3X2Q H;  1A31 A;  2JQ7 A;  1SFO J;  2G7H A;  3NRV A;  1STZ A;  4A3I J;  2O9L A;  2EFP A;  4M6X A;  1Z6T A;  4CCM A;  2GOX B;  1X1P A;  1HDP A;  3CJQ B;  2B0L A;  4A3E J;  1RI7 A;  1OLT A;  2W24 A;  5ICG A;  4OAY A;  1K4S A;  2DQR A;  3KLN A;  3H92 A;  2EB7 A;  5D8L B;  1E2X A;  4QIW N;  2IBD A;  4RAG A;  1YS7 A;  2B63 J;  1D1B A;  1MJB A;  2EFN A;  4HLY A;  3WU0 A;  1I1G A;  4PJM A;  1YIT I;  2JA6 J;  3JAM Z;  1E17 A;  2R5Y A;  4MQV A;  3BTJ A;  1U78 A;  4F92 B;  4CCJ A;  3RSN A;  2VUM J;  1TT5 B;  2L7Z A;  3EQL F;  4BH9 A;  3S3N A;  3D5S C;  1IXR C;  2EFO A;  1F5T A;  2O03 A;  5L3C A;  4O6J A;  3PNY A;  2DT5 A;  2WA0 A;  1S72 I;  2HXI A;  1F4K A;  3FK6 A;  3LQQ A;  1D0Z A;  2VKV A;  1ERD A;  3QPL A;  1Y0U A;  3V8K A;  4FX4 A;  2KJB A;  2ZME A;  5F0C A;  5D5U B;  3NAR A;  4ZYG A;  1E3P A;  3S2H J;  3F8B A;  3G1O A;  3B02 A;  2MW8 A;  2R7O A;  1GT0 C;  1I5Z A;  4HPQ A;  3OYB A;  1Z7L A;  1KYW A;  3QU6 A;  2P7V B;  4L18 B;  4U87 A;  1GLN A;  3JRG A;  1VQM I;  5LHI A;  1DQU A;  4X1E A;  2EA2 A;  5HDG A;  5ICF A;  4E7Z A;  3HRT A;  3ZMZ A;  3GXO A;  1AWC A;  4D5C A;  3GO5 A;  3B6A A;  4CHU A;  1TW2 A;  2HKO A;  3LAP A;  3OYI A;  1Y56 A;  5BOX A;  2H94 A;  2L4A A;  3JRI A;  3BT9 A;  5FRN A;  1ULY A;  3Q9V A;  2E1M B;  4H4K C;  4KUM A;  2JJ7 A;  5BNG A;  3BP8 A;  3CJR B;  2XAF A;  3WE2 A;  3RZD J;  3DPL C;  2XB0 X;  4IO9 F;  3MVP A;  1H8A C;  1Z91 A;  2VC1 A;  2MLG A;  1Z67 A;  3GFM A;  3HOU J;  2G9W A;  2DK8 A;  1U5T B;  4I99 C;  1N75 A;  1WJ5 A;  2LRE A;  3MD2 A;  4A3D J;  3S1N J;  1FOY A;  4I01 A;  1OCP A;  3VPR A;  3RZO J;  3T8R A;  4XKB A;  3JW4 A;  1I50 J;  5JFR A;  2GOM A;  2JVG A;  4F91 B;  1F1Z A;  2FBH A;  1KYZ A;  1X2N A;  4U0W A;  3ASN H;  3D5R C;  4HF1 A;  3KZI C;  3LA2 A;  1MZB A;  4MTD A;  2E19 A;  1HF0 A;  1QO0 D;  3HM5 A;  4OAZ A;  4OIN F;  4AVP A;  2HDD A;  2R92 J;  4BXF A;  2HOA A;  2ZNZ A;  3QPS A;  3K2Z A;  3VFZ A;  3OYA A;  5TGT A;  4AIK A;  4B47 A;  2E60 A;  5E1Z B;  2R7D A;  2E35 A;  1A6Q A;  5EG0 A;  3LSR A;  3MQ0 A;  2ACJ A;  4WWC A;  1XPX A;  1KU7 A;  3CF2 A;  2Z9O A;  2CQN A;  2W4S A;  3KP2 A;  1FMV A;  1T98 A;  2R7S A;  2CW0 F;  4UXN A;  3K4N A;  1ZTR A;  2L7M P;  4U0V A;  3WU2 C;  3L00 A;  1JHH A;  4CH7 A;  2X0L A;  1XSD A;  2OTJ I;  2VIX A;  3ZPL A;  2CYY A;  1B72 B;  4RS8 A;  2E1O A;  5FLV A;  1ENH A;  3V42 A;  4A0X A;  5FLX K;  2WB1 A;  5HS9 A;  2OAZ A;  4LLL A;  1LNW A;  3MN2 A;  2KMU A;  5L3B A;  5LGT A;  1XX5 A;  3J7Y J;  2CMP A;  5LD2 C;  2PLY A;  1RIO H;  1J59 A;  4AUX A;  1AKH B;  1HKT A;  2ZO4 A;  2DOA A;  2K9N A;  1IDZ A;  4HOB A;  4Z2Y A;  3EDP A;  3H9G A;  4HAM A;  4LK0 F;  2J5O A;  1MBK A;  1FT9 A;  3ZQF A;  3ECH A;  1BOA A;  3S15 J;  3FXJ A;  5DM6 F;  2VQH A;  2LKX A;  3RKQ A;  4CO8 A;  3S2D J;  1PDN C;  2WB1 N;  3CJN A;  1WVR A;  2M8G X;  5HOD A;  2E1N A;  3DXJ F;  3ULQ B;  4E4H A;  2V1U A;  2VKH A;  1T8I A;  3E1S A;  1BR4 A;  1R58 A;  2H27 A;  1V5F A;  3RQ4 A;  5F0H A;  1HDD C;  1R1V A;  5H6Q A;  2VOO A;  4HEA 2;  3LWF A;  2WWY A;  2E2J J;  3CTA A;  2OCC H;  1VF9 A;  5J1U A;  1TC3 C;  2W7N A;  2BY0 A;  2JUC A;  5B3S H;  3TDU C;  3IRR A;  5LHG A;  2F5E A;  4ENJ A;  2VQG A;  3JTH A;  4LIT A;  4XLN F;  1BI1 A;  1K6O A;  3GF2 A;  5B66 C;  2PQ8 A;  1REP C;  4N0B A;  4LG0 B;  3ZMV A;  1SD5 A;  4ZZL A;  5J47 A;  1Z05 A;  4RB0 A;  3BJA A;  4UV8 A;  1W36 D;  2BBY A;  2CQX A;  2CQK A;  3LQR A;  2COB A;  3SXY A;  4DIQ A;  1G8X A;  2FNP A;  3E6B A;  5GTH C;  2ICW G;  4G8X A;  4ON0 A;  1H89 C;  2JVH A;  1GUU A;  5K7F A;  3PUB A;  2X6O A;  3V7S A;  2ZJQ F;  1ZEL A;  2KRC A;  3MCZ A;  4CIC A;  4ZC3 A;  1MMG A;  5CQE A;  2P81 A;  3JR9 A;  1XN7 A;  5F08 A;  1JT6 A;  3QAH A;  1APL C;  4BKX A;  2DMU A;  5E8G A;  4XRM A;  2HOT A;  1TWC J;  4P55 A;  1MMN A;  3BG5 A;  4G94 A;  3BCB A;  1BR2 A;  3IAS 2;  2BVL A;  2ESH A;  1WH7 A;  2DCE A;  3H3U A;  3E7L A;  4J01 A;  4S04 A;  1S7E A;  2LDU A;  3RIR A;  1O7L A;  3PIO F;  4NNJ A;  2NOJ B;  2CFO A;  1O57 A;  4AC0 A;  1FY7 A;  2BV6 A;  4M9Z A;  1K61 A;  2BOL A;  1PP8 F;  1DU6 A;  1LDD A;  1YW7 A;  3CCQ I;  3F6V A;  1KQ9 A;  2EIM H;  1UST A;  5J3L A;  4HF0 A;  3VYS B;  1J09 A;  3TOB A;  4JYK A;  1TNS A;  1HW2 A;  1X19 A;  2FUG 2;  2ZXH A;  1UCR A;  2HWV A;  1TQI A;  2RQP A;  1FYL A;  3QPH A;  2JZY A;  2R4G A;  4BQN A;  5J1R A;  2K4J A;  2X6X A;  1MH4 A;  3ZMU A;  3W2W A;  1Y1W J;  2F5C A;  2RKH A;  1ETQ A;  2V1D A;  3S1Q J;  5GTI C;  1O3Q A;  2PEX A;  1FPQ A;  3AKZ A;  3F6O A;  1WZ2 A;  4PJJ A;  4BHB A;  4I7H A;  3F8M A;  2KIM A;  2DA5 A;  2LTP A;  4XLC A;  2C6Y A;  1UB9 A;  1D1A A;  1G3T A;  1DU0 A;  2W85 A;  1P92 A;  5B1B H;  4IQJ A;  3A01 A;  2ZJR F;  2GZW A;  2QZ8 A;  3O2P E;  3B6C A;  3KYC B;  4BJT A;  2DQL A;  3IRQ A;  3CCJ I;  3O3K A;  2M8E A;  3NAU A;  2Z1D A;  3WU1 B;  3IC7 A;  4IL6 C;  2A69 F;  4ESJ A;  3HC7 A;  3IH2 A;  3CZ6 A;  2RRE A;  3KLO A;  3KEY A;  3QU3 A;  2X1E A;  4IPA A;  2VQC A;  1XMA A;  2BE5 F;  4RGR A;  1ZR2 A;  1ACI A;  4Y33 A;  2HZT A;  2VC0 A;  3I56 I;  4M71 A;  2F2E A;  4BE1 A;  4KN7 X;  5D6F A;  4KIG A;  3ZMS A;  4XOP A;  2JSC A;  3G2B A;  2F4M B;  1D5Y A;  2HVQ A;  2E7W A;  3LSI A;  4U0Y A;  4D7N A;  3M4O J;  1IN7 A;  1O7F A;  2KIF A;  3KIO A;  4C2M J;  3L2R A;  2OF7 A;  2ECC A;  4ZYA A;  3K7A J;  3EUK L;  3Q3S A;  4V2F A;  3G4S I;  5DD8 A;  4EJW A;  5DCM B;  2JK3 A;  2DA4 A;  3CC7 I;  4RB3 C;  4I02 A;  4XK4 A;  2IEK A;  2DMN A;  3TKY A;  5D5W B;  2VLA A;  3HSR A;  4QSH A;  4MLO A;  3H0D A;  2CW7 A;  2V4J C;  4I98 B;  1RUO A;  2ZBK A;  2FQ4 A;  3OSF A;  3CCE I;  4JOM A;  1YJN I;  2LF7 A;  3OIP A;  1S6L A;  4ENM A;  4IHS A;  4EM0 B;  3KP3 A;  2KIU A;  1K78 A;  1B8I B;  4M3B A;  5D4R A;  1TWG J;  4Q5S F;  2EIK H;  1AOY A;  5J40 A;  1IRG A;  4BDZ A;  4UUS B;  2H6C A;  5HVQ C;  2KZV A;  1DP3 A;  4XSZ F;  5DUK A;  3VB2 A;  1OCC H;  3WTZ A;  4F7Z A;  3H36 A;  3CMY A;  3OYG A;  3R60 A;  1P4A A;  4M3D A;  1MJ9 A;  3ESW B;  5L3G A;  4DZP A;  1T0F A;  4XN3 A;  9ANT A;  1NG6 A;  1S8N A;  2YUS A;  3DKY A;  4YIF A;  4CYD A;  2Y9Z A;  4J00 A;  4P9F A;  3HOS A;  5FKN A;  2XGE A;  1IXS B;  2A3S A;  3PL8 A;  1QZY A;  1BJA A;  2KL4 A;  2YX7 A;  4KIB A;  3FHN A;  4A3M J;  3CME I;  3JRC A;  4X0G A;  1X3U A;  3BRO A;  3KYD B;  4P96 A;  4Z6Y A;  3WGI A;  3IKV A;  2OQG A;  3ZR8 X;  1WGX A;  1GXQ A;  1K83 J;  3HTU A;  4YG2 F;  2VPL A;  3H5N A;  1Z77 A;  1NK3 P;  3I58 A;  1RR8 C;  1MIJ A;  3ERE D;  2LR8 A;  5FD6 A;  4HA8 A;  4A6E A;  2IS6 A;  4PDK A;  2GQQ A;  5H2F C;  2VXZ A;  4A3F J;  1X3Z B;  2IA1 A;  4WCG A;  2HOS A;  1T6S A;  3A0B C;  3I0T A;  5D5X B;  3ABT A;  5ILS A;  1ZR4 A;  2DI3 A;  2FMY A;  3ABM H;  4NQW A;  1H9T A;  3KP7 A;  4PFP A;  1JGG A;  2VJI A;  2LFB A;  1N77 A;  1KZH A;  4B44 A;  3VSL A;  2CSO A;  5H20 A;  3ZP5 A;  2QCO A;  5KCM A;  1L0O C;  1H0M A;  1SAX A;  2ZXW H;  1G3S A;  2DMT A;  3M9A A;  1CQT A;  2BY1 A;  4B8X A;  1EJ9 A;  5E1X A;  1VQL I;  2G0E A;  2LF8 A;  1IUF A;  2M1B A;  1B4A A;  2IGK A;  1WI9 A;  3HKZ N;  4E7J A;  3HUG B;  1GDT A;  3H5R A;  5GAG J;  1IRX A;  3BTL A;  3Q0V A;  5BPD A;  4GO1 A;  3VYR B;  1LJ9 A;  2DFF A;  1T08 B;  1NTC A;  4CYC A;  2CUE A;  3U2R A;  1ZG5 A;  2DYR H;  2EJR A;  3K1N A;  1VQN I;  1RRJ A;  2MLK A;  3FXM A;  4J19 A;  5D4S A;  2E1M C;  1O3R A;  3OYC A;  2V6C A;  2OA4 A;  4O3M A;  4MFD A;  4UUT A;  1YX3 A;  2PMH A;  5GAH J;  1Q1V A;  2VQL A;  1ZN2 A;  3Q0U A;  4LGW A;  2VE9 A;  3FWE A;  1MBH A;  4CZC A;  3OL3 A;  3A2K A;  4L9V A;  1JJ6 C;  4AIJ A;  3IWF A;  5GPC A;  1U5T C;  3HJE A;  3BY6 A;  4Q47 A;  3OMY A;  2Z16 A;  1IV6 A;  5EZG A;  2HVR A;  2NNY A;  1ZGJ A;  2M4K A;  3TW7 A;  4CDG A;  1IW7 F;  2L0K A;  2R3S A;  5M5W J;  3W6K B;  3TMO A;  5J4V A;  1JTY A;  1R5I D;  3K4B A;  2M9H A;  5J6X A;  3FDY A;  3OYN A;  3OSG A;  1JTX A;  2WY7 Q;  3FBN B;  3GTM J;  1PYV A;  2E34 A;  1A04 A;  2DW4 A;  1TNT A;  4RGX A;  4I6Z A;  3CLO A;  1OR7 C;  2ID3 A;  4XKW A;  2O6G E;  5E20 A;  1FSE A;  1P2F A;  1B9M A;  1IC8 A;  3VYT B;  5L3D A;  5HLT A;  5D5V B;  2R7T A;  1WHU A;  4CCN A;  4BL0 B;  3DP7 A;  4DOZ A;  4BEH A;  1ODD A;  1G59 A;  1FC3 A;  2EZK A;  1SEU A;  3T5X A;  4B3A A;  2QGU A;  3GTJ J;  1Y8R B;  2FBI A;  2QLZ A;  1X1B A;  3ZQH A;  2DTZ A;  1HSJ A;  2Q1Z B;  3BJO A;  3HIF A;  3JCU C;  3BQZ A;  3KEO A;  4I0A A;  3CCV I;  3ROU A;  1G3Y A;  3FKI J;  3EUH C;  4HNT A;  1VQO I;  1U9N A;  3CES A;  3ABK H;  1QHH D;  2FBK A;  4PCQ A;  1Z0X A;  4ZDL A;  4CA0 A;  4KIC A;  2BW3 B;  4IRG A;  1VQ9 I;  2X6W A;  1T2K A;  1R4N B;  2Z99 A;  4B4C A;  2O5R A;  2H1L A;  2EV6 A;  2MGQ A;  1BBY A;  4AM3 A;  2CO5 A;  2A6E F;  4KDP A;  4ZTJ A;  3FHZ A;  4G9Y A;  4BXX J;  1O3T A;  3TDZ C;  1WI3 A;  3BR1 A;  3W6J B;  1DGW Y;  2F48 A;  5ED4 A;  5C44 J;  3ERM A;  1R22 A;  2KRH A;  5E8I A;  2OCE A;  1SC7 A;  3R0A A;  4EJT A;  4G7O F;  1LDJ A;  1D0Y A;  4N4O B;  1JHF A;  1BOB A;  5FFX A;  2DDA A;  4BAC A;  2HEO A;  2L7K A;  2P5L C;  2F5F A;  2H8R A;  1FWZ A;  2DA6 A;  2K85 A;  4UV9 A;  5ICC A;  4MO7 A;  1XGS A;  1W7P B;  2VAS A;  1I1S A;  5JR3 A;  5DV5 A;  5EGO B;  1CGP A;  2EIJ H;  4JX5 A;  2NVU B;  3QPT A;  2BHZ A;  4M9S A;  1YTY A;  1JKQ C;  1J75 A;  1A5J A;  3G1M A;  2TRT A;  3RKW A;  3CUQ A;  5E3L A;  3WGG A;  4GGG A;  2BXY A;  1U9O A;  4GRI A;  5E3M A;  2COM A;  3FXQ A;  4FHT A;  2IT0 A;  4OMZ A;  4BY7 J;  3CDL A;  3RYP A;  3GCM A;  1HLV A;  5CVI A;  4WF2 A;  1ZQ3 P;  4GFB A;  1AU7 A;  4F55 A;  2K9M A;  5LGN A;  3CLQ A;  3GYH X;  3CMA I;  2NS0 A;  3QYE A;  3ZCO A;  1YW8 A;  2EV5 A;  3I9V 2;  4F93 B;  4M3F A;  3KYL A;  3HOW J;  3MWM A;  2XGD A;  1IG7 A;  1PUE E;  1FTT A;  2PJR A;  2E7X A;  2VBZ A;  3WTT C;  1FOW A;  2M34 A;  3BG7 A;  2STW A;  1Z3X A;  2LOO A;  2R5Y B;  3F21 A;  2JA5 J;  3PFI A;  4FIS A;  1D5V A;  1RKW A;  4A3K J;  2L9V A;  2QSH X;  3DCF A;  2QQA A;  3BLY A;  2CJJ A;  1V4R A;  2VBX A;  4WXC A;  4RLQ A;  4A5M A;  4TV7 A;  4PSW A;  5KAI C;  2D2W A;  2HDW A;  5HOO A;  3P9K A;  2OU2 A;  4UHT A;  4OIR F;  2ZKZ A;  2FA5 A;  3SFZ A;  2YU9 J;  1YI2 I;  2NVQ J;  2ZME B;  2GXA A;  3FF5 A;  1S5L C;  3O8G A;  3GTQ J;  2R7V A;  3IL2 A;  5TJJ A;  2E5Z A;  1FX7 A;  3LA3 A;  4BJ6 C;  2K7L A;  2KLO A;  3IH3 A;  3H3Z A;  2EV0 A;  3I64 A;  4Y3O A;  2VB6 A;  2DJI A;  3QWL A;  3WTS C;  2FRH A;  2IP2 A;  4ITV A;  2JRM A;  3F8F A;  1SFE A;  1FBU A;  2RNJ A;  4MEY F;  4YIR X;  1HXD A;  5A2Q K;  2UXX A;  2QQB A;  1WWX A;  3A03 A;  5K7H A;  1WJB A;  3I4N J;  3BR6 A;  5F64 A;  3J81 Z;  4L9N A;  3HOV J;  4FQG A;  5DD4 A;  5IT9 Z;  1VQ8 I;  2M4G A;  2ZJ2 A;  2KIQ A;  2O8K A;  1FIA A;  1XG1 A;  1ON2 A;  2XAG A;  2M0M A;  3D0S A;  4I0B A;  4RGU A;  2NAZ A;  1J0R A;  3WOD F;  3PJR A;  2Y30 A;  4EJU A;  1BI0 A;  1XB4 A;  4A3J J;  1K4T A;  3BOQ A;  5IP7 J;  3K2A A;  3L2Q A;  2DPD A;  5IT3 A;  1YQA A;  2RN7 A;  4MTE A;  2L7F P;  4XLP F;  1KQ0 A;  1Z1D A;  2Q2E A;  4DYC A;  2Y75 A;  2DAO A;  3M8J A;  3HRU A;  1QZE A;  3IHU A;  2IA0 A;  4WXD A;  4HLX A;  2P4W A;  5CLS A;  5B1A H;  2KPM A;  4V2G A;  4IHT A;  2NNN A;  2LD5 A;  3RYR A;  1IAW A;  4LG3 A;  5KK1 A;  1FP2 A;  1YIO A;  1VZ0 A;  5DUI A;  4ENK A;  2VL8 A;  3U1K A;  2VKE A;  4HG2 A;  1MMS A;  3DPT A;  1BN5 A;  3M8F A;  1W1W E;  4YFX F;  1K6Y A;  4IX7 A;  1QVT A;  3S16 J;  5EG0 B;  3DTI A;  5K7Z A;  2W00 A;  2JA8 J;  2HI3 A;  3I53 A;  3WE3 A;  1IRF A;  2DMQ A;  1X2M A;  4NDL A;  2HU9 A;  3EUA A;  1W7P D;  3F8N A;  4P5O A;  1LPQ A;  3OIO A;  1LEA A;  3ZGK A;  5EF6 A;  1ZLJ A;  1MNE A;  2FQ3 A;  1ZAO A;  2HDC A;  3DLL F;  1A36 A;  1A6I A;  1YS6 A;  3TL4 X;  3LST A;  2RAE A;  1XDU A;  2L54 A;  3HG9 A;  5DCF A;  1VFC A;  1FP1 D;  4L9J A;  4IZZ A;  2L9R A;  1OPC A;  3QQA A;  1MW7 A;  3M3Y J;  3HPG A;  5M3M J;  2ZSH B;  2HOE A;  3DKX A;  1NHA A;  2R5Z A;  2LC2 A;  2CFX A;  4RDU A;  3VOD A;  1LE8 A;  1V5E A;  1YLF A;  3KE2 A;  6PAX A;  4MIM A;  1KON A;  2OQR A;  4DJA A;  3FKJ A;  4RAF A;  3TO6 A;  3J80 Z;  3SZG A;  4BBS J;  3RQI A;  1EV7 A;  2PN6 A;  3ZQI A;  4IHV A;  3H3V K;  5M3F J;  4YII A;  3QP6 A;  3ZQG A;  1JUP A;  2IGM A;  1QNT A;  4PK4 A;  4FET A;  1WH5 A;  2HQN A;  3BDD A;  4HNU A;  2XVC A;  4QLC U;  4WX9 A;  3TO9 A;  5B5E C;  2XRO A;  4PUS A;  5HS7 A; 
#chains in the Genus database with same CATH homology
 1ORK A;  1QPI A;  2M0C A;  1G2H A;  2LVS A;  1ETX A;  5DS9 A;  1MBG A;  1VI0 A;  2R0Q C;  1D5Y A;  3LOC A;  4LOC A;  4D5F A;  2JN6 A;  3BR0 A;  4XIC A;  4D7N A;  4M6V A;  3M4O J;  4C2M J;  2EH3 A;  1YRN A;  2OF7 A;  2ECC A;  3K7A J;  1TWA J;  3Q3S A;  2GM4 A;  3BR5 A;  4V2F A;  5C3E J;  4Y52 J;  1BL0 A;  3GTP J;  5C4X J;  2JK3 A;  3BG9 A;  2DA4 A;  2NVT J;  4JX6 A;  3G1L A;  2Y0S N;  4XK4 A;  2IEK A;  2NS7 A;  2DMN A;  4FCY A;  4QSH A;  5F0F A;  2R93 J;  1TWH J;  4MLO A;  3SJM A;  4XRS G;  5JLW A;  1BJZ A;  2FQ4 A;  3OSF A;  1ETW A;  2OPT A;  3BTI A;  5IOZ A;  2EQR A;  4DYR A;  1FIP A;  1B8I B;  4M3B A;  1TWG J;  1SAN A;  2FJ1 A;  2HXO A;  4X6A J;  4UUS B;  1Y1V J;  1P7J A;  2ME6 A;  5IP9 J;  1BW6 A;  1QVU A;  1RR7 A;  3L1P A;  3CMY A;  4M3D A;  3PO3 J;  4DZP A;  9ANT A;  1F36 A;  2YUS A;  2VPR A;  2Y9Z A;  2WV1 A;  2LP0 A;  3I4M J;  5FKN A;  2JWT A;  2XGE A;  1F43 A;  1FEX A;  1RET A;  1IGN A;  4A93 J;  4HNV A;  2I10 A;  3SDG A;  2CUF A;  5GPA A;  3PO2 J;  4A3M J;  3HDD A;  2DA7 A;  2LK2 A;  4JX4 A;  4W97 A;  2DA1 A;  3JRC A;  1P7I A;  1UMQ A;  3JRH A;  4IHX A;  3H0G J;  1I3Q J;  1GVD A;  4IHW A;  1WGX A;  2R5Z B;  1K83 J;  1Z77 A;  1NK3 P;  1LE8 B;  1HOM A;  2LR8 A;  3BTC A;  3HOX J;  2EZI A;  1O4X A;  2ECB A;  3S14 J;  3A01 B;  4A3F J;  3GTK J;  4C3H J;  1W0T A;  1RKT A;  2HOS A;  5M5X J;  1ZR4 A;  5F04 A;  3JRB A;  3ZQL A;  2KT0 A;  5IYB J;  1JGG A;  2LFB A;  5F1J A;  1JJ8 C;  2QCO A;  1ETK A;  4C3I J;  2LLK A;  1CQT A;  2DMT A;  1GV5 A;  3HOY J;  4M3E A;  2G0E A;  1IUF A;  1OCT C;  3HKZ N;  1UHS A;  2Y2Z A;  1IJW C;  1GDT A;  1VND A;  3BTL A;  3Q0V A;  4B1R A;  5IYC J;  1JUS A;  5FJ8 J;  5IPA A;  1NTC A;  4CYC A;  4S0H B;  2CUE A;  5EGO A;  2TCT A;  3Q0W A;  1H88 C;  3WHC A;  2X48 A;  1YRN B;  3FK7 A;  1EF4 A;  3S1M J;  3GTO J;  4J19 A;  2ZB9 A;  3DEW A;  4MFD A;  4UUT A;  3TP0 A;  1SFO J;  1Q1V A;  3Q0U A;  5IOY A;  4A3I J;  2O9L A;  1MBH A;  3O8H A;  1JJ6 C;  1JUM A;  1OFC X;  1XC5 A;  5GPC A;  2N8G A;  1RPW A;  1HDP A;  1IV6 A;  4A3E J;  1B72 A;  3W6V A;  4D7M A;  2EBI A;  4I76 A;  5EZG A;  3TW7 A;  1MNM C;  4QIW N;  4FTH A;  2IBD A;  3GTG J;  2L0K A;  2B63 J;  3CQZ J;  5M5W J;  1JTY A;  2M9H A;  1RES A;  3OSG A;  1JTX A;  1AKH A;  2JA6 J;  3GTM J;  5IYD J;  1I6H J;  2R5Y A;  5C4J J;  3BTJ A;  1U78 A;  4I6Z A;  2ID6 A;  2VUM J;  2QF7 A;  2L7Z A;  4G12 A;  2ID3 A;  1POG A;  3JRD A;  1FTZ A;  2CU7 A;  2EZL A;  3JRF A;  2JMW A;  1JKO C;  2X9D A;  1IC8 A;  5JLX A;  2K40 A;  2HXI A;  3FK6 A;  3ZOB A;  2VKV A;  1ITY A;  2XRL A;  5FKM A;  3QPL A;  2EZK A;  5F0C A;  4FE7 A;  3NAR A;  4B3A A;  2Y9Y A;  3GTJ J;  3S2H J;  3G1O A;  4QTR A;  2MW8 A;  1GT0 C;  2O7O A;  3ZQH A;  2DTZ A;  2NVX J;  3BQZ A;  2VI6 A;  3JRG A;  2CRG A;  4X1E A;  3FKI J;  4AYB N;  1U9N A;  4D5C A;  3B6A A;  1Z0X A;  3LSG A;  4A3B J;  3JRI A;  3BT9 A;  3GBG A;  5F27 A;  5EDN A;  4B4C A;  2JJ7 A;  5BNG A;  3RZD J;  1BW5 A;  2MGQ A;  2XB0 X;  2EZH A;  2ME0 A;  3HEF A;  3MVP A;  3WHB A;  2DJN A;  1H8A C;  1QRY A;  2XPV A;  4BXX J;  3IV5 A;  3HOU J;  1WI3 A;  3HGY A;  3BR1 A;  1MSF C;  5FKO A;  4IHY A;  4IEJ A;  5GP9 A;  4A3D J;  5C44 J;  3S1N J;  4BBR J;  1OCP A;  3VPR A;  4M3G A;  3RZO J;  2IAI A;  1I50 J;  1X2N A;  1PUF A;  1BA5 A;  1X58 A;  2H8R A;  4EEF G;  2R7Z J;  2DA6 A;  2E19 A;  4FE4 A;  1HF0 A;  3HM5 A;  4MO7 A;  2NVY J;  2HDD A;  2R92 J;  4CYC B;  2HOA A;  5EGO B;  3CCY A;  3IH4 A;  2D5V A;  3QPS A;  4JX5 A;  1OJL A;  2XPU A;  2HQ5 A;  2CQQ A;  5EG0 A;  3LSR A;  1JKQ C;  1ETY A;  1A5J A;  2FX0 A;  3G1M A;  2TRT A;  2K9Q A;  5E3L A;  1U9O A;  1T33 A;  3BR3 A;  4L5E A;  5E3M A;  4A69 C;  2H1K A;  4BY7 J;  3CDL A;  1AHD P;  1HLV A;  1ZTR A;  2L7M P;  2MSY A;  1JT0 A;  1ZQ3 P;  4GFB A;  1AU7 A;  1B72 B;  2MG4 A;  2E1O A;  5FLV A;  1ENH A;  4XRS A;  3LNQ A;  4M3F A;  2K9S A;  1ZK8 A;  3MN2 A;  3HOW J;  2XGC A;  2XGD A;  1IG7 A;  1MBF A;  3TED A;  2XPW A;  1FTT A;  4DW6 A;  3S17 J;  2E2I J;  2M34 A;  4AUX A;  1AKH B;  3GTL J;  3JRE A;  2K9N A;  2R5Y B;  5J1Y A;  1IDZ A;  3A02 A;  2JA5 J;  1XS9 A;  4FIS A;  1JKP C;  1MBK A;  3ZQF A;  1RKW A;  4A3K J;  3JRA A;  3S15 J;  2LKX A;  3DCF A;  1UG2 A;  2ELK A;  3HBL A;  4Y7N J;  2CJJ A;  3RKQ A;  2WB1 N;  3S2D J;  2M8G X;  5HOD A;  5FKL A;  3F0C A;  5FKK A;  4MFE A;  4JP0 A;  2YU9 J;  5F0H A;  1HDD C;  2NVQ J;  2W48 A;  3GTQ J;  3O8G A;  2E2J J;  1WPK A;  3S1R J;  1FJL A;  1VF9 A;  5J1U A;  2AHQ A;  2LY9 A;  1TC3 C;  1U8B A;  4A3C J;  3IH3 A;  1MBE A;  2GLO A;  2PMZ N;  1ETV A;  5E3O A;  2FD5 A;  5DTD A;  1MSE C;  3A03 A;  5K7H A;  3I4N J;  3BR6 A;  1IDY A;  3HOV J;  1IRZ A;  1GV2 A;  2CQX A;  2COB A;  2O8K A;  1FIA A;  1XG1 A;  3OOU A;  2DN0 A;  1H89 C;  5K7F A;  1GUU A;  2X6O A;  1WCM J;  2Y30 A;  5EYR A;  2KDZ A;  2M2E A;  4A3J J;  3LSP A;  2P81 A;  2NS8 A;  3PM1 A;  5IP7 J;  2XSD C;  3K2A A;  3C2B A;  4XID A;  3JR9 A;  1NK2 P;  2NOG A;  2L7F P;  5F08 A;  1JT6 A;  3FIS A;  4DYC A;  1APL C;  4BKX A;  2DMU A;  4XRM A;  2HOT A;  1TWC J;  2GBY A;  1PUF B;  3BG5 A;  1LFB A;  1WH7 A;  3TW6 A;  4V2G A;  3E7L A;  1ZGW A;  1S7E A;  2LD5 A;  1B8I A;  4AC0 A;  2DMP A;  2WAQ N;  1K61 A;  1MBJ A;  2VKE A;  4ABZ A;  1QVT A;  1DU6 A;  1JKR C;  3S16 J;  2HYJ A;  4UUS A;  3FIW A;  5J3L A;  5EG0 B;  3HOZ J;  5K7Z A;  2JA8 J;  4A3L J;  2HI3 A;  4JYK A;  3MKL A;  5EZH A;  1E3O C;  2DMQ A;  1X2M A;  2AO9 A;  4NDL A;  3UKG A;  1W0U A;  5J1R A;  3OIO A;  5EF6 A;  4C3J J;  1MH4 A;  1LFU P;  1T56 A;  3LSJ A;  3ZQC A;  1Y1W J;  1ETQ A;  5E3N A;  1A6I A;  3S1Q J;  2RAE A;  4DZJ A;  1VFC A;  2L9R A;  3QQA A;  2DA5 A;  3M3Y J;  2LTP A;  5M3M J;  2DA3 A;  2R5Z A;  5M5Y J;  4A3G J;  2DA2 A;  5EEA A;  4RDU A;  3D1N I;  1LE8 A;  1ZKG A;  4MIM A;  1DU0 A;  1ETO A;  1TWF J;  3BG3 A;  3A01 A;  3SFI A;  1R9T J;  4BBS J;  5IP6 A;  3RQI A;  3ZQI A;  4IHV A;  3H3V K;  3B6C A;  5M3F J;  4DYQ A;  3HB9 A;  1JUP A;  3HGG A;  4W1U A;  3ZQG A;  5FLM J;  2Y31 A;  1MH3 A;  4BY1 J;  2YS9 A;  2JA7 J;  2XB5 A;  1WH5 A;  3BR2 A;  3NAU A;  4RBO A;  3TP3 A;  3IH2 A;  3BQY A;  1HCR A;  2E2H J;  1ZR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...