2HOTA

Phage selected homeodomain bound to modified dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKNMRAKIKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and properties of a re-engineered homeodomain protein-DNA interface.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*CP*CP*CP*CP*
total genus 19
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hotA00
4M3FA 4QSHA 4MIMA 5JLWA 3JRGA 1HDPA 5K7FA 2EQRA 2XRLA 2D5VA 3G1LA 2XGEA 5BNGA 3A01A 2NS8A 2XPVA 2NOGA 5FKMA 4FCYA 4JX6A 2VI6A 2NVYJ 4MO7A 1ZTRA 1UHSA 1P7IA 1GV2A 4JP0A 1NTCA 3W6VA 1VI0A 5J3LA 3S1MJ 1Z0XA 5EYRA 2VKVA 3G1OA 1JGGA 2VPRA 1ZR2A 4RDUA 1ETXA 2YUSA 1ZK8A 1GDTA 1W0UA 1JKRC 1AHDP 2LR8A 5M5YJ 2MW8A 2FQ4A 4GFBA 1MH4A 2AHQA 2CQQA 5M5WJ 3GTMJ 2YU9J 2K9QA 1QPIA 2TRTA 1OCTC 1FEXA 5HODA 1E3OC 4JX4A 3L1PA 3BG5A 3BQZA 1ETKA 3CQZJ 2XPWA 2CUFA 1TWFJ 1OCPA 1K61A 5FKNA 1ZQ3P 2DMPA 5E3OA 4AYBN 1JTXA 1HLVA 2FJ1A 3LSRA 3RZDJ 2XB0X 4C2MJ 2O9LA 3HOWJ 2WAQN 1MNMC 5J1RA 5IYCJ 3HOYJ 2JJ7A 2R93J 3GTGJ 1Z77A 1IDYA 1XC5A 1TC3C 1FIPA 4JYKA 1SFOJ 1IRZA 1ETOA 1X58A 2IAIA 2WB1N 4XRSG 3GTKJ 2OPTA 3BG3A 2FX0A 3TW7A 1JTYA 4BXXJ 1FTZA 2JA7J 4XRMA 4D7NA 1ETWA 1AKHB 3GBGA 2GBYA 3GTOJ 4BBRJ 1IUFA 2O7OA 4M6VA 5M3FJ 1IV6A 1CQTA 1RESA 1T56A 5F0FA 3S1QJ 2ID3A 1W0TA 4IEJA 1YRNA 1TWGJ 3HOUJ 1HOMA 2EZLA 2HDDA 5M5XJ 3HEFA 3S14J 3BTIA 3MN2A 5C4JJ 1P7JA 1NK2P 3B6AA 1POGA 4A3IJ 2CJJA 4DZJA 1LFBA 2JA5J 1A6IA 2P81A 2OF7A 3ZQIA 3O8GA 4AC0A 2Y31A 3A01B 1JKQC 2EBIA 3H3VK 1B8IA 1OJLA 3C2BA 5K7ZA 3TEDA 3I4MJ 5EF6A 5IP9J 1JUMA 1WI3A 2DMQA 1ZKGA 1QVUA 2WV1A 1U9OA 4BY7J 2LK2A 4B1RA 2Y30A 2JA8J 2CU7A 3ZQLA 4A3LJ 1MH3A 2ECCA 2DA3A 5GPCA 3JRDA 1MBKA 1MBGA 2CQXA 3BT9A 5M3MJ 1FTTA 5IP6A 3FK6A 2DMUA 2Y9ZA 3JREA 1ZR4A 2N8GA 5C4XJ 3BR2A 2JK3A 4X1EA 5EZGA 1FIAA 2DA7A 2ID6A 3HB9A 4BY1J 3FIWA 3TP0A 2DMNA 3IH2A 3HOZJ 3HGGA 2X9DA 1Y1WJ 2R5YB 4S0HB 4A3KJ 3CMYA 2CUEA 4DZPA 5FLVA 2Y2ZA 1RPWA 2HYJA 2LP0A 2NS7A 1IJWC 2NVQJ 2JN6A 2XPUA 2LD5A 1WPKA 2L7FP 2GLOA 5JLXA 4FTHA 5J1YA 2E2JJ 2DJNA 4UUSA 1F43A 1H89C 2DA2A 2B63J 5GPAA 4C3JJ 4FISA 1HDDC 4DW6A 2E2IJ 2EH3A 2CRGA 1DU6A 1BJZA 3OSGA 1ETYA 2KDZA 5FLMJ 4Y52J 3Q0VA 2VUMJ 3MVPA 2K9NA 4A69C 1WH5A 2X48A 4AUXA 1WCMJ 4M3EA 2HOAA 1IDZA 3CCYA 1I6HJ 4A93J 1ZGWA 2H8RA 1TWHJ 3RQIA 2DA6A 3SJMA 3HGYA 2EZHA 2HQ5A 3FK7A 3GTQJ 3D1NI 2ELKA 1QVTA 1R9TJ 9ANTA 5DTDA 4FE7A 1O4XA 2O8KA 2HOSA 3RZOJ 1QRYA 4MFEA 4UUTA 3S2DJ 1GVDA 3SDGA 1RR7A 2DA5A 1IC8A 3BR1A 3Q0WA 1IG7A 1U8BA 1WGXA 3QPSA 4QIWN 5IYBJ 5K7HA 1BW5A 4DYCA 1BL0A 1MSEC 3VPRA 3M3YJ 3F0CA 4B3AA 4ABZA 1JKPC 2R5ZA 1JJ8C 4HNVA 5EZHA 2M34A 3DEWA 3PM1A 3JRAA 4IHYA 4L5EA 3K7AJ 2XGCA 3Q3SA 4XIDA 3ZQGA 1YRNB 1UG2A 4XRSA 1Y1VJ 4V2FA 2M8GX 1ENHA 5EG0B 2M2EA 3BG9A 3BR5A 2ME6A 5EGOA 1ITYA 1MBEA 2L0KA 2MG4A 2KT0A 3HBLA 1AKHA 2DTZA 2HXIA 3FISA 2DN0A 2K9SA 4A3MJ 1MBFA 1PUFA 2LFBA 1F36A 4BBSJ 4NDLA 2LTPA 2XB5A 2R5ZB 5EEAA 3Q0UA 3G1MA 4M3GA 4A3BJ 1I3QJ 2COBA 3HOVJ 1EF4A 2HI3A 5EDNA 2H1KA 2L9RA 4A3EJ 5E3LA 3HKZN 3FKIJ 3TP3A 5FJ8J 5F1JA 3LSJA 2G0EA 1RKWA 3RKQA 4QTRA 4MFDA 4A3DJ 1ORKA 2HOTA 3JRHA 1TWAJ 4EEFG 2HXOA 2XSDC 5C44J 1X2NA 4DYRA 1LE8A 3S1RJ 3M4OJ 2PMZN 3ZQHA 3ZQFA 3LSPA 2L7ZA 3IV5A 1PUFB 3LSGA 3GTPJ 3BTCA 3JR9A 1AU7A 3JRIA 5FKKA 1XG1A 1GV5A 3GTLJ 1ETQA 2L7MP 3E7LA 3ZOBA 2X6OA 4W1UA 4RBOA 5IP7J 3IH4A 4I6ZA 1NK3P 3PO2J 1JT0A 2ZB9A 2Y9YA 1BW6A 1APLC 4UUSB 2K40A 3BR6A 1BA5A 3A03A 2LKXA 4M3BA 4G12A 5FKOA 2JA6J 5E3NA 3S1NJ 2LLKA 3MKLA 1SANA 3CDLA 3HM5A 1HF0A 1Q1VA 5F08A 2LVSA 1S7EA 4J19A 4MLOA 1H8AC 2DA1A 2FD5A 2E1OA 2TCTA 3PO3J 1JKOC 3GTJJ 4V2GA 5F0HA 3WHBA 3OSFA 3IH3A 4A3JJ 3BR3A 4DYQA 1U78A 4M3DA 1WH7A 5IYDJ 5IOZA 3I4NJ 1D5YA 5F27A 1ETVA 1VNDA 3HOXJ 2R0QC 4FE4A 3SFIA 3BQYA 2JWTA 3S15J 5F04A 3WHCA 3UKGA 1A5JA 3TW6A 1GUUA 3BR0A 1B72B 1B72A 4D5FA 4IHXA 1RKTA 4C3HJ 1K83J 1JJ6C 3LOCA 3JRFA 2AO9A 2XGDA 4IHVA 2NVXJ 2RAEA 3S2HJ 1TWCJ 5J1UA 2NVTJ 3DCFA 4D7MA 2DMTA 1I50J 3BTLA 4D5CA 4LOCA 5GP9A 1JUPA 1JT6A 2IEKA 5C3EJ 1H88C 1FJLA 3BTJA 2W48A 4JX5A 2JMWA 4BKXA 3NAUA 2R92J 5IPAA 1VFCA 2ECBA 2LY9A 5F0CA 1VF9A 2MGQA 3JRCA 3S17J 4A3GJ 3QQAA 3QPLA 4C3IJ 2YS9A 2R7ZJ 4A3CJ 1MSFC 2VKEA 1XS9A 1MBJA 3OOUA 1UMQA 2E2HJ 1JUSA 5IOYA 4CYCB 2ME0A 4CYCA 1OFCX 4XK4A 3HDDA 1MBHA 2IBDA 4X6AJ 3ZQCA 4IHWA 5E3MA 4Y7NJ 2EZKA 2MSYA 3B6CA 1HCRA 2EZIA 5FKLA 1LE8B 4I76A 5DS9A 2M0CA 2E19A 3A02A 4B4CA 1B8IB 1X2MA 3H0GJ 2M9HA 3S16J 2R5YA 3JRBA 4A3FJ 1T33A 1U9NA 3NARA 1RETA 2Y0SN 4W97A 1G2HA 2QF7A 1GT0C 2I10A 3K2AA 3LNQA 1LFUP 2GM4A 1IGNA 3OIOA 2QCOA 3O8HA 5EGOB 5EG0A 1DU0A 4XICA 2DA4A
chains in the Genus database with same CATH superfamily
3FF5A 3WTVC 3EETA 3L2UA 3IHUA 1IN4A 5FRMA 3A01A 2NS8A 2R7UA 5HOOA 4FCYA 1X4PA 4C2TA 3OYAA 1IXSB 1ZTRA 1UHSA 2MA3A 3WTZA 4JP0A 1VI0A 3U21A 4RB1A 2W4SA 3OYEA 1ACIA 3GZ5A 2JSCA 2BW3B 3M07A 2LOOA 4PSWA 1JGGA 3PQJA 5LHHA 2QYOA 1ETXA 1UCRA 5KK1A 4XN0A 1FP2A 3WTUC 1W0UA 2VXZA 2LR8A 2FMLA 4EM2A 2KPMA 4Y33A 4EJWA 5GAEJ 1YTYA 3VDXA 1QPIA 1LDKB 2TRTA 3LA7A 1OCTC 1FEXA 4G6QA 4JX4A 2FNPA 4Q47A 1SC7A 1GHCA 2A61A 2KDOA 2ZSHB 3BQZA 5HS8A 2G7HA 1ETKA 2HKXA 3D5SC 3C2GA 3CQZJ 4J00A 2XPWA 2CUFA 1TWFJ 3KP6A 1OCPA 3KYCB 3SEZA 4D0PA 2DMPA 3I58A 3RIRA 5KAFC 5E3OA 2ISYA 2ICWG 1TNSA 2K86A 1K4SA 2BHYA 3A1YA 3FHNA 3K70D 4LITA 2DOAA 3IWFA 4C2MJ 1MNMC 5IYCJ 3TBIA 4HLYA 2JJ7A 4BQNA 1ZH5A 1XC5A 4P96A 1FIPA 4JYKA 3CMEI 1P2FA 3WTXC 1X1DA 1SFOJ 2E5ZA 1U5TA 2WB1N 3DKYA 3GTKJ 4IRIA 2FX0A 1LEAA 2HQRA 4RS8A 3FX3A 5H6RA 4FX4A 4BXXJ 4DBRA 4EATA 3TOBA 2P8TA 1B9MA 4A12A 3GBGA 1QZEA 1AKHB 2GBYA 3U9GA 2O7OA 3LWFA 5ILSA 3OOPA 3WU2C 3JAMZ 2A5WA 3H36A 3S3OA 1WJEA 2QSFX 3MZHA 3DU6A 4DNCA 1W0TA 1TWGJ 3CCRI 3CC4I 1S29A 3MMYB 3HOUJ 2MH9A 2EZLA 3N97A 2QZ8A 1CGPA 3AFHA 5FO5A 5B1BH 4F93B 3OV8A 3DKWA 1POGA 3RSNA 2VPLA 4A3IJ 4DZJA 1LFBA 2JA5J 2JT1A 2OF7A 4BQQA 1FLIA 2Y31A 4N4OB 2NNNA 3BPXA 3MEXA 1R71A 3J81K 4I99C 5EF6A 3K4KA 5IP9J 2OTJI 1JUMA 2ZXWH 4UUVA 1WI3A 4KMFA 2DMQA 2VT2A 3GO5A 1H9TA 4CGZA 1QVUA 3PFYA 1YOVB 5JI6A 4Y4RA 1U9OA 3L9FA 2Z2SB 4BY7J 2LK2A 2Y30A 3KCCA 1T6SA 1KU2A 5D5UB 1MH3A 4OAYA 3CO7C 3JRDA 2L01A 1MBGA 2CQXA 2WB1A 4GYGA 1YG2A 1ZAOA 4RGXA 2PJRA 3JREA 3N4MA 1ZR4A 4X1EA 2DA7A 4BY1J 5LD2C 4E4HA 1K6YA 1OCCH 2DMNA 3CUQC 3ESWB 2O03A 1LPQA 2X6YA 4B09A 3ZR8X 2OC6A 2R7OA 1Z3XA 3K4CA 2LH9A 3ZMTA 3S2WA 2HPIA 1RPWA 4ESFA 4PFPA 4KDPA 2O8XA 3FBIB 1W5SA 1Z1DA 3RQ4A 2IGMA 2GLOA 2IS4A 5JLXA 4FTHA 2V7FA 3FMRA 1VQ6I 2BVLA 3CDIA 1F43A 1ZHFA 3ROUA 2DO7A 5L3GA 2COMA 1HDDC 1SFEA 3L2RA 3RI4A 5LEJA 2LF7A 2X0LA 2W1OA 2DOEA 1BJZA 2IA0A 5JVGF 3DBHB 3QRFF 3U1DA 1JHFA 1TZLA 1MMNA 4A69C 1LNWA 1V54H 1WH5A 4AUXA 1WCMJ 4M3EA 4P9FA 1ULYA 1T0FA 4JQFA 4MEYF 1I6HJ 4XOTA 2G7UA 3B73A 3H5AA 4XKVA 5JR3A 3G71I 1Y0NA 3OYMA 2QSHX 2HDCA 1G3TA 2HQ5A 2XASA 5CVRA 3A0HC 4KA4A 3J80K 3EUKL 3GUDA 1W7PD 9ANTA 3CUOA 2DXIA 2O61A 1ONVA 1MJ9A 4S05A 4C2UA 2D45A 2RC4A 1JI8A 1ZYRF 1TT0A 1ERDA 5KCMA 4PCQA 1GVDA 1BC8C 3SDGA 2DA5A 3Q0WA 2BEOA 4BU2A 1BM9A 2OA4A 1EH6A 4HAMA 1K79A 2QSGX 4EVIA 3ABLH 1PYVA 1OPCA 4GGGA 3E6MA 2AXTC 3F0CA 4RA2A 3JSOA 3HC7A 1JJ8C 1R00A 2CO5A 4HNVA 2WV0A 2YX4A 3HTUA 3DEWA 4IHYA 2W57A 4NC6A 3JRAA 4IRGA 2DJIA 3K7AJ 1WJDA 1LQ1A 1LVAA 1QGPA 1Z6TA 3H92A 3C1DA 4XIDA 1XD7A 1BI0A 4BDZA 4LMYA 2CH0A 1LUJB 1BIAA 2KHMA 2MBFA 1ENHA 3BG9A 4WXDA 3GW2A 2HEOA 2FEZA 4YIFA 3FISA 4L18B 2K9SA 1MBFA 3DFGA 4ZYHA 2QA4I 1OCRH 2EFWA 2VQLA 3NWSA 3H9JA 1SAUA 4M6XA 4ZDOA 4NDLA 3RKWA 3KLNA 2H09A 4XM3A 1G3YA 1X1AA 4M3GA 2M7AA 2COBA 3HOVJ 2HI3A 5HVQC 5EDNA 5LRRA 4GDFA 3TDUC 1PVEA 1Y56A 2XAUA 2P7CB 3LSJA 5DCMB 1T39A 2HTJA 4NQWA 1R49A 3FXJA 4QTRA 4UVCA 4MFDA 2R7VA 2HOTA 3CCEI 3R61A 2HFHA 1X1CA 3F8BA 2HXOA 2DFHA 4BXFA 2B0LA 1X3UA 2DFIA 3LSPA 2L7ZA 3FXMA 1B59A 3LSGA 1F9NA 3BTCA 2V9VA 1AU7A 2ZO4A 1L0OC 3OY9A 5F6FA 3LFKA 4F7ZA 5FKKA 1Z67A 1S72I 2QBYA 2KIFA 3GTLJ 2KZGA 2A6TA 2KMUA 2Z9OA 4W1UA 3J7ZI 1KA8A 3K4JA 4I6ZA 1YIJI 3WTTC 2MABA 3ZCOA 1JT0A 1B4AA 1BW6A 4AIDA 2EFPA 2K40A 2M1BA 3BR6A 4UXNA 3A03A 4HV6A 4A6EA 1H9GA 2DFEA 1SD4A 1R36A 3RKXA 2LLKA 4U0WA 3MKLA 2DOFA 2KIMA 4HF0A 2ZNZA 2LVSA 3WTSC 3TDZC 4AU7A 3FDYA 3V42A 4MLOA 2R7DA 1H8AC 3R4KA 3F6OA 3ECOA 4HX7A 4F3QA 2FD5A 1CF7A 2R7QA 1Z91A 3I59B 3PO3J 1JKOC 1R4MB 1ON1A 2NAZA 4IJAA 5K5QA 1Z6RA 4WWCA 5IT9K 2RVCA 1WWXA 4M3DA 1MDMA 3FM3A 2Z16A 1W1WE 2VKHA 1AA7A 3RPQA 1XN7A 2DCEA 3VODA 1A6QA 5KHDA 3VSKA 4FHTA 2JWTA 3S15J 5F04A 2ESNA 3W2WA 3UKGA 5IY5H 3RCOA 3TW6A 2BXYA 4IHTA 4AIHA 3S3MA 1B72A 3TOAA 1E0EA 1J09A 2QUFA 3ZP5A 3W6JB 3VYTB 3LOCA 2V4JC 4ZH4F 3VSLA 2Y69H 1EH7A 4OMYA 2NVXJ 4XNFA 1DPUA 4E7SA 1WKMA 5AONA 3I3LA 1BI1A 3DCFA 2AS5F 1XDUA 1TW2A 4LLGF 3BTLA 2QM3A 4LOCA 4P1WA 5GP9A 3RJPA 1ZLJA 4HLXA 2J5OA 2W25A 1VQ7I 4UV9A 1XMAA 2HYGD 3NWTA 3PQKA 4RLFA 2W85A 1WRJA 3HSRA 1FMWA 3K2ZA 2X85A 1J7KA 2MGQA 3K1NA 4LLLA 3S17J 3QQAA 3QPLA 5H2FC 2R7ZJ 2VKEA 1HC8A 2K9MA 4CCJA 3K4MA 2ZJRF 3SFZA 4RMNA 5EEHA 2ME0A 4HZFA 4WCGA 5ICFA 3KP7A 2IBDA 2F5FA 3CC2I 3LSHA 5D4RA 2IW5A 1K6OA 3K4LA 2XAJA 3PSFA 4IHWA 1Y0UA 3AG3H 2GZWA 4LG0A 4LG0B 3W2AA 2MSYA 2AQFA 5FKLA 3F22A 3WGHA 3HSEA 3ASOH 4I76A 1PJRA 2L7KA 4U7DA 3LAJA 3FKJA 3S16J 1OISA 2WAFA 3ZQ7A 4GXOA 1UG0A 1U9NA 2OBPA 3NARA 3CCSI 1G2HA 1W5CC 5JFRA 1BOBA 3KP3A 4NB5A 4G7ZF 3RPUA 4MGRA 2QCOA 2R4GA 1OKRA 2FQ3A 2JUCA 1W7PA 3CD6I 4X0GA 3J7AO 3BCAA 4QSHA 5JLWA 1RNLA 1HDPA 3S3NA 1HW2A 5K7FA 1LB2A 1XSVA 4XLHA 2EQRA 2HTSA 2D5VA 2F5DA 3G1LA 4IRHA 4RGSA 2NOGA 4UB8C 2VI6A 5E18F 3OYJA 3FM5A 4M74A 2HKOA 1GV2A 2PMUA 1NTCA 5IT3A 5BPIA 1F1ZA 4HOBA 4RAYA 5J3LA 3ZMVA 4ZJZA 2VPRA 4B3XA 1N25A 4OIRF 1ZR2A 1X19A 3ECHA 2HVSA 1XTAA 5LHGA 1ZK8A 3NQOA 1AHDP 5M5YJ 2MW8A 3S8PA 2AHQA 5M5WJ 3DF8A 4XLCA 4GFBA 2IPQX 3GTMJ 4KNYA 5HODA 2RGVA 3EYYA 5B3SH 3L1PA 1ODDA 2AQEA 1FMVA 3BZKA 4XLNF 3R6SA 3F6VA 5HDNA 3ZRGA 2JZYA 1YIOA 5DD4A 1K61A 5FKNA 3WG9A 1TQIA 3OYLA 1G59A 3AL0B 3OYCA 4LK1F 2DU9A 4CO8A 2ZJQF 4L9VA 3RZDJ 2XB0X 4PFOA 2WWYA 2O9LA 3M8JA 2EV5A 4LIUA 2WAQN 2IS6A 3HOYJ 4KIBA 3HYIA 3GTGJ 4N4NB 1JE8A 1QPMA 3H5NA 4KICA 1TC3C 3QP6A 2EFNA 3V4GA 2F48A 2E35A 1X58A 2IAIA 4BQAA 1Z21A 3BG3A 3OWTA 4L5IA 3IWZA 3TW7A 5BQTA 2XVCA 2K9LA 4XLPF 4CCLA 4KJZA 1K78A 2F6CA 5AIQA 3GTOJ 3CC7I 1IUFA 3QYFA 1QQIA 3QYEA 1IV6A 3JCUC 1RESA 5BMZA 3EUAA 5F0FA 2RDPA 2RQPA 4IVNA 5FFZA 3S1QJ 2QENA 5ICCA 4O3MA 2A05A 3LSIA 1HOMA 1TBXA 2EFOA 2HDDA 3HEFA 2W00A 1SEUA 1G8XA 4DJAA 4O6JA 5J8CA 1W36D 2GXAA 2K4BA 1Z7LA 4XLEA 4BUPA 5BPDA 2PFBA 1DGRM 2XHKA 6PAXA 3GEZA 5L3CA 4ZZLA 4AIKA 4G7OF 2P81A 3KYLA 3F3XA 2EJRA 2ZXIA 1FYMA 4XKBA 3DPLC 2E7XA 1JKQC 4L9JA 3V7CA 3C2BA 5K7ZA 3TEDA 4FQGA 4PJMA 2V1XA 2IJLA 3HPGA 3PNYA 3QU6A 3OYDA 3EPZA 4CA0A 4OIOF 2STWA 1RUOA 1OQYA 3COAC 1GVJA 5D5WB 1BI2A 1NG6A 3DBLB 2J5PA 1FOYA 5D6EA 3H0DA 4F92B 4RB2C 3CJQB 4A3LJ 2DA3A 3EDPA 1WHUA 3VFZA 4XRFA 1Q1HA 2Z5UA 1V55H 5IP6A 3ZPLA 3PNVA 3BWGA 4KYWA 3MD2A 2QQBA 5EZGA 5HLGA 1JGSA 3BG6A 2VBWA 2R3SA 3FIWA 3TP0A 4U0YA 3VYSB 4CCKA 3HOZJ 1KQ8A 1UFMA 4ITVA 2X9DA 4RM3A 2R5YB 2A5YB 1P4AA 1SMYF 2CUEA 3KZIC 3CCQI 5FLVA 1J9IA 2YX7A 2R7XA 2LP0A 2Q1ZB 3FXRA 2KRFA 2R7RA 4IKFA 3AG2H 1BIBA 4M9XA 2M30A 5EJCA 2ZMEA 4BE0A 5E1XA 3GF2A 4PJ0C 5J1YA 4UY8I 2ADUA 5E1ZB 3D5RC 2DJNA 1H89C 2DA2A 1MJAA 1IN6A 5GPAA 4FISA 4C3JJ 1VQ4I 4G8XA 4MNUA 4MEXF 1PUEE 2CRGA 1KONA 1DU6A 2V9KA 2RNJA 1Y6IA 5DYMA 3OSGA 4IOCF 3F8MA 2KDZA 5FLMJ 1SVLA 4BHCA 5DUKA 3DV8A 3OIQA 1T38A 2CV1A 2VL8A 1T2KA 2RNGA 2HOAA 3E5UA 2E7WA 4XKCA 4WXCA 1KYZA 2IRFG 1I27A 3I71A 2P5LC 1TWHJ 3RQIA 3MQ0A 2VODA 5CVJA 2DA6A 2VXDA 2H6CA 3GTQJ 3PUFA 3BC8A 2RKHA 3K10A 5LGNA 1Y39A 2JPCA 1D5VA 2FUG2 2MD5A 5DTDA 1O4XA 3PUBA 2EA2A 2CW8A 2NXNB 1S7AA 5CQGA 3GMEA 1VQPI 2A6EF 3OYGA 2HOSA 3RZOJ 1J59A 1QRYA 4MFEA 4QWQA 3S2DJ 2IVMA 2YR2A 1W36C 1U8BA 4C9YA 2X1EA 2DTRA 3QPSA 2JPBA 1SVMA 2Y0SA 1BL0A 2QEXI 1MSEC 3VPRA 5H20A 4B3AA 1MW7A 5HNFA 1BR4A 3GFJA 1DUXC 2H8WA 1U2WA 2BW3A 2HNHA 1VQKI 2ZMEB 3T8RA 4L5EA 3W3CA 1O7LA 3TGNA 1WVRA 3D5LA 2K02A 1YW7A 4M6YA 3LA2A 4XSZF 2QKMB 4YEJA 4CYDA 2ZFUA 1ZRCA 4XRSA 4L0YB 3ZGKA 5GAHJ 1O3SA 1PP8F 2M8GX 3K4BA 3RTRA 5DM7F 3HXLA 3WG7H 5EG0B 3BR5A 2ME6A 1ITYA 3M9AA 2MG4A 3HBLA 1SD7A 1K78B 1AKHA 2HXIA 5A2QK 3UNGC 1FYLA 2KRHA 1NHAA 1PUFA 3DXJF 4DQ2A 2LY1A 2A6HF 1RRJA 3Q0UA 1GXQA 4LFUA 4PJNA 1R22A 3DP7A 2LKSA 3IRRA 4A3EJ 4EV0A 2M4KA 2VLAA 1KU3A 2JA2A 3TP3A 1VQ9I 5F1JA 2NVUB 2G0EA 2BVMA 2L4AA 4A3DJ 3MCZA 1IN5A 2R7TA 2QLZA 3FXUA 2EILH 2EPFA 4A0XA 3FMSA 3MKYB 2V1NA 3QYBA 5D8LB 3IV5A 1E2XA 4OMZA 2GOXB 5CJ9A 1SD6A 2ZXHA 4E7KA 3CP8A 1HKTA 4CCMA 1BBYA 4UVBA 4XORA 2H1LA 3R0JA 4Y17A 2YU3A 1ETQA 2IA1A 3E7LA 3ZOBA 3CO6C 5IP7J 2CYYA 3IH4A 1DDNA 3CCJI 3KEQA 3PO2J 1WJBA 1A31A 2VBZA 4E6KG 2Y9YA 5HLIA 3I0TA 2DPDA 4UUSB 1BA5A 1C0WA 5DEQA 4E7LA 2UV1A 1Y8QB 3ULQB 3KX2A 1O3TA 3MWMA 3G3ZA 3CJRB 3ABKH 4F55A 2NYXA 1ZREA 4EJUA 1Q1VA 2IGKA 2Q0OA 4HEA2 2PI0A 4XSXF 2VJ4A 2PQ8A 2BHZA 2VT3A 4J19A 2CUJA 3BOQA 3KETA 3OS1A 2KKOA 2V1UA 1S5LC 2XAFA 4HYEA 2R7SA 3CZ6A 3KYDB 4IOAF 2E1OA 3I56I 1D0XA 2TCTA 1ZRDA 3F9KA 3GTJJ 2XF6A 4V2GA 4KISA 3DKXA 3A4CA 3SYTA 5CPRB 5FD5A 1IZ1A 2FF4A 5F27A 3V7RA 1W7PB 1ETVA 1XGSA 5FD6A 4AIJA 4UV8A 2VONA 3IL2A 4FE4A 2LREA 3IP4B 2LG4A 3BQYA 4PUSA 1YYVA 5H6QA 3DU5A 3WHCA 2Q8KA 4IX7A 3P5JA 3PIPF 1YITI 3OYIA 5CVIA 5L3FA 1BR2A 4Q5SF 5E8GA 1TTYA 4YFXF 1B72B 4DBQA 4HDUA 1EV7A 1K4TA 1P9QC 1K83J 3K1PA 4C3HJ 4HRIA 1FBUA 2OTLI 1QZZA 3KLOA 5D6FA 3ISPA 2FBHA 2XROA 2LKPA 3S2HJ 1TWCJ 5J1UA 2A69F 5LBQA 1U6GA 4LB5A 1EKEA 2UWMA 4IO9F 4D5CA 2QQ8A 2G9WA 4A0YA 2IEKA 1JT6A 2PJRB 3C2HA 3SZPA 2IT0A 1GLNA 4RAFA 3KP4A 5AIPA 2KJBA 2XAGA 2R92J 2CW0F 2WC2A 3K70C 5ED4A 1P6RA 4RAZA 3B02A 3IKVA 2XGXA 4NC7A 2P4WA 2HS5A 3DEEA 2DQRA 3OMYA 5ICGA 1XGOA 2K27A 4XL9A 2YS9A 5BOXA 1MGTA 2HYFA 1MBJA 3HKZA 1BOAA 2F4MB 3OOUA 5FFXA 1UMQA 4EGZA 2E2HJ 3BJOA 4CYCA 2WA0A 2E1CA 1WZ2A 1FP1D 4HSTA 2F5EA 4XLFA 4IPAA 3KP2A 1STZA 2QVOA 2UXXA 2EZKA 1HCRA 4TV7A 1LE8B 4K2EA 3KIOA 2BV6A 3W2VA 2HR3A 3ABTA 4BH9A 2FBKA 1I1SA 1ZARA 3A02A 3D0SA 4B4CA 5E8IA 1B8IB 1X2MA 3H0GJ 2HWVA 2M9HA 4HSRA 2KIQA 4LD5A 1LKXA 3V8KA 4QLCU 1J75A 3JRBA 1YHQI 1PDNC 3BY6A 4XONA 4CUGA 1OYIA 2L9NA 1N77A 1S7OA 1RETA 5CVVA 2BY2A 2BGCA 4A0ZA 2RN7A 4HX8A 3TMOA 1GT0C 3JW4A 2I10A 2IS1A 1LFUP 4WK8F 2DA4A 3OIOA 4N0BA 1J0RA 2ZXJA 1SFXA 5EGOB 5LFAA 1SD5A 2LDUA 4KFCA 2R7FA 4UB6C 4U88A 2M45A 5DV5A 4OWRB 1HBXG 4D1QA 4JX6A 1OMIA 2NVYJ 3KEOA 5LGUA 3E5XA 1NH3A 2K85A 2VOPA 3W6VA 2UXNA 4ZDLA 5J6XA 3M7GA 4HA8A 3S1MJ 4ZTJA 3ABMH 4P5OA 4E7ZA 1MD0A 3G1OA 2DW4A 2F5VA 4BJ5C 3EUHC 3RKYA 1TQPA 1RUNA 2HZDA 2V26A 4IL6C 4ON0A 4JOMA 3LA3A 2CQQA 5DCFA 3I4PA 3BG7A 2JSPA 2LNBA 2OQRA 4LJZF 3BPVA 1E3OC 1UAAA 4ASNA 2BYVE 3BG5A 4PJJA 5TRDA 2XUBA 2FOKA 2WAQA 3HZJA 3MAJA 3RYRA 4A5NA 2HPMA 2MYSA 4CDGA 2A3SA 2OZ6A 1JXSA 2LC2A 3LQQA 4EMSA 2FJ1A 1FPQA 1TNTA 1YW9A 1XX5A 3ONQA 3FBNB 1B1BA 4NBQA 5J47A 4CHUA 3HOWJ 2R93J 4KN7X 4G7HF 3LL7A 2V6EA 1IDYA 1IDZA 4I2OA 2M5WA 4XMYA 1IRZA 1ETOA 4XRSG 2OPTA 2W84A 3K4NA 5HLTA 2BY3A 2GIVA 3I54A 2JA7J 4XRMA 5E79C 5ILVA 2VQGA 5FLXZ 1A04A 1IXRC 1FX7A 1ETWA 3JTGA 3E6DA 2FMYA 2Y48A 3DLLF 5K1YA 4BBRJ 4M6VA 2PEXA 1X4OA 1CQTA 1F4KA 2JVGA 1T56A 2VJ5A 2X6XA 4JBAA 2OZUA 2HU9A 5FRNA 1R6RA 2ID3A 1D1BA 4IEJA 4HQEA 4PK4A 5HDKA 3OL3A 3BROA 1G3WA 5M5XJ 2VE9A 1ZG5A 3S14J 3L00A 4U0VA 1P7JA 3OYKA 3B6AA 1XPXA 2JRTA 4ENNA 2CJJA 1J2XA 1A6IA 3ZQIA 3O8GA 2NS0A 4PJLA 2M87A 3A01B 4EQQA 4EJTA 3H3VK 3TKYA 1B8IA 1IV8A 1OJLA 2LYCA 1ZRFA 1ZKGA 1O3RA 1VQ8I 2WV1A 3BCBA 1A36A 4KIFA 4B1RA 1WQ2A 2CU7A 2ECCA 3HSFA 5GPCA 1TL8A 2Z1DA 3GZNB 4N9HA 2TDXA 2CUZA 4NC8A 5J4YA 4MTEA 5M3MJ 3OS0A 1FTTA 3J7YJ 3R0AA 1KYWA 2L4MA 3ZN1A 3GLXA 5C4XJ 3BR2A 2JK3A 1A35A 1FIAA 3IH2A 3HGGA 1Y1WJ 4RAGA 3ERMA 4M9ZA 4DZPA 2DYRH 3CMYA 4F91B 1T95A 3J7AY 2HYJA 1IJWC 2NOJB 3FXLA 2JN6A 5HLHA 3V7SA 2DK5A 4GCVA 3LSMA 4ZDPA 2QBYB 2Y0MA 2BBYA 2XAQA 3ZXSA 5FROA 3BLYA 4UUSA 2E2JJ 2OCEA 5DUIA 4BE2A 1WSUA 2XIGA 5HS7A 4Z2YA 3L7WA 2E2IJ 2EA4A 2EH3A 3JSPA 2KL4A 2M4GA 5L3EA 1U3EM 4PGHA 1HW1A 3MZ8A 1ETYA 3WTYC 3L2QA 4XOPA 3DTIA 4AM3A 4Y52J 2VUMJ 3QODA 4O5VA 4XR6A 3VB2A 2K9NA 1YJNI 1TW3A 2ZJPF 2QGUA 4CCOA 5JHFA 2HVQA 3CCYA 2VASA 1IO2A 1SMTA 1G3SA 3O2PE 3QWLA 1XMKA 4NNJA 3V8LA 4A93J 2O0YA 3H9GA 5HNHA 3N05A 2MC3A 4G6TB 3DLAA 4YG2F 3DBRB 3F21A 3HGYA 2EZHA 1LVKA 3E1SA 1DP3A 1SFKA 5CYVA 1R58A 3T1BA 1YO5C 1QVTA 1OYYA 2O8KA 1VQOI 5FB2A 4UUTA 2K4JA 4H0EA 1IG7A 4HNUA 1IC8A 2MH2A 5A2QZ 3GZ6A 1WGXA 3OR1C 1USSA 4DYCA 1BW5A 5JVTA 2XC7A 1R1UA 4ABZA 1L3LA 1EH8A 1R7JA 4PDKA 2MLKA 1FOKA 5EZHA 2M34A 3P9KA 2DLLA 2H94A 1USTA 2E1MB 4EJOA 2ZNYA 4EM1A 1VQNI 5ILUA 1HW5A 2P7VB 2XGCA 3Q3SA 2A07F 3CDHA 1YRNB 1UG2A 2VN2A 3G2BA 1Y1VJ 1ZELA 3MKWB 2GA2A 3GLLA 4V2FA 2BE5F 3BZ6A 4M73A 2GIZA 3F72A 5JHUA 5EGOA 1EA3A 3GYHX 3I55I 1MBEA 2KT0A 3QU3A 3S93A 4RB0A 2OD5A 3HL2A 2DN0A 4A3MJ 3M1EA 4G94A 2BXZA 4HBLA 3CLOA 3I53A 1PP7U 2EFQA 4BBSJ 2O3FA 1WJAA 5EEAA 4U7BA 1I6XA 2GXGA 4HNTA 3L2WA 4RGUA 3G1MA 3ERED 1I3QJ 3F8CA 1EF4A 3OIPA 2E1MC 2L9RA 1VZ0A 1R23A 3HRSA 1MZBA 3FKIJ 4ZZDA 4A5MA 3HRTA 3T0YA 5FJ8J 4M9SA 1YI2I 3BDDA 4OINF 4OIPF 5GADJ 4PGGA 4CXFA 1ORKA 4ZC3A 1HSTA 1TWAJ 1OLTA 2RV8A 4M71A 3AG4H 2XSDC 1M1EB 2CQKA 3S1RJ 3M4OJ 1WJCA 2KZVA 1U8RA 4PSXA 3SHFA 3JR9A 3BP8A 3E6BA 2EV0A 3GVAA 3DQVC 4CICA 3OS2A 2WAEA 1GV5A 2ETHA 5GTIC 2L7MP 3IRQA 2X6OA 1NK3P 4Y15A 3FXQA 2XV4S 3H35A 4KITB 2E71A 1IAWA 1Z05A 1APLC 1QU3A 3ZN0A 1QHGA 4M3BA 4G12A 5FKOA 3S1NJ 5E3NA 4BAYA 1LEBA 3F8FA 1KQ0A 4DOZA 3TL4X 1B6AA 1XGNA 2ZSIB 3CDLA 3SZGA 2HDWA 3HM5A 5F08A 2ZJ2A 1WI9A 4AVPA 4L0ZB 3CCUI 1DP7P 3KPHA 4IHSA 4P9UA 1OYWA 4CZZA 3FHZA 2DA1A 1FY7A 2X4HA 2X51A 2MD0A 1MJBA 2V1DA 3JTHA 1O3QA 3IKTA 4YIIA 1E17A 1XCVA 2DFFA 2Y75A 5FGMA 3VEPA 3WHBA 5F0HA 4EGYA 3OSFA 1N75A 1U0JA 4A3JJ 1FZPB 3BR3A 4DYQA 4MQVA 1WH7A 2RREA 5IYDJ 4L9TA 5TISC 5IOZA 2P5VA 3OYBA 5LEKA 3I4NJ 3HPHA 4UVAA 2WY8Q 3CP2A 3M8EA 4NUBA 3LSTA 4BGDA 4EM0B 2CQ7A 3HOXJ 4XBFA 3SFIA 3QPHA 1U5TC 1TQMA 4J01A 1MMAA 3FMQA 2X1DA 2FE3A 3AAFA 3RDIA 1Y8RB 2VJIA 2DI3A 1GUUA 1J5YA 2PJPA 4I0BA 2MFZA 4RM2A 3HUGB 1RKTA 5LGTA 1BR1A 1JJ6C 1D8JA 4LB6B 4ESJA 3JRFA 1XSXA 3PSIA 3IC7A 4E7HA 3H5RA 1IW7F 1FSEA 2RAEA 1LDJA 2IXSA 2NVTJ 2IGOA 4D7MA 2DMTA 1I50J 1R1TA 3O6BB 3ZMZA 2ZC2A 1RR8C 2EIKH 1QHHD 2E36A 5C3EJ 1MMDA 4OIQF 3FXOA 1H88C 1FJLA 4GRIA 3SEQA 2L2OA 5CVUA 4JX5A 1FBSA 1D1CA 1T0FC 2JMWA 3NAUA 5IPAA 5E17F 5F0CA 1GXPA 2DDAA 1X1PA 2QKLB 4CZCA 3I59A 2Z33A 2GA1A 4P55A 2LBFB 4A3CJ 1XS9A 1FWZA 1R5GA 1JUSA 2PG4A 2VQCA 1D3YA 2L5QA 1S3JA 5IOYA 2R7WA 4CSWA 4XK4A 4U87A 3HDDA 1I3AA 5DCMA 4AYBA 4Z6YA 1MBHA 2DBBA 1ZN2A 2KRCA 3QOEA 3ZQCA 1DPRA 2ZFWA 4LK0F 1D0ZA 5CKTA 2P6SA 3B6CA 4F52A 4Y7NJ 3IAS2 2LMDA 3C3WA 4QPOA 1V4RA 2ELJA 2EB7A 2X1CA 1TP4A 3TO9A 3VOEA 4MQ9F 4RB3C 1HQCA 2HGCA 4HDVA 4A3FJ 1T33A 2XSJC 5DD8A 2B7EA 3BJAA 3DPTA 1IRFA 2Y0SN 2I8DA 4W97A 2QF7A 4BDYA 4E7JA 3CMMA 4LGWA 1UHMA 2MC4A 5D8KB 3K2AA 4BHPA 1XSDA 3OR2C 1IGNA 1UB9A 4ENMA 3NEUA 2ISZA 1KU9A 5EG0A 1QBJA 2DT7B 4XICA 3GFMA 1DU0A 3W6KB 4M3FA 4MIMA 3JRGA 2L9SA 2CQNA 4YFNF 5LLQA 4C30A 1WJFA 5LHIA 1RI7A 1QO0D 2XRLA 1T08B 2XGEA 3CUQA 1DGWY 3CUQB 5KAIC 2K5CA 5BNGA 2CG4A 2XPVA 3U2RA 2I5UA 5FKMA 2K3PA 2FA5A 4CH7A 2BY0A 4MO7A 1P7IA 2Z3YA 3DEUA 3E0JB 2C6YA 4QPQA 2W24A 1P92A 2VC1A 1E3PA 3A2KA 1Z0XA 5EYRA 2VKVA 1KZHA 1T8IA 2EWNA 3P9IA 3I64A 1CF7B 1R1VA 2Q2EA 2Q2EB 5L3DA 4RDUA 2F4IA 2YUSA 2PLYA 3K6GA 1LFPA 4FX0A 1GDTA 1JKRC 4HG2A 1FNNA 1HA8A 2FQ4A 1MH4A 4AVZA 5LRSA 1S8NA 2YU9J 2K9QA 4YRVA 4I02A 2O5RA 3EQLF 2O6GE 3MKZA 4HX4A 2IA2A 3I5UA 3LFUA 3M1CA 2EV6A 3MFKA 1YJ9I 1XCBA 1ZQ3P 2OV7A 2WBMA 3TQNA 4AYBN 1JTXA 1HLVA 3KP5A 4ZTFA 2LSOA 5F1RA 2LBFA 3L2VA 3LSRA 3H9QA 2GAUA 3IAM2 4A2UA 5BS6A 5J1RA 3G4SI 1IN7A 1Z77A 1DQUA 2HOEA 4FT8A 1MMGA 2YSRA 4BJTA 3WE3A 1E3HA 1O57A 2VBXA 4Y13A 1JTYA 1YFHA 2P0WA 5K5RA 1MIJA 3WGIA 4BEHB 1FTZA 1UELB 2B9SA 4D7NA 3LAPA 2D1HA 2KQRA 5CLSA 2DK8A 3REOA 3T5XA 2XKOA 2P6TA 2VC0A 4D9JA 2VIXA 5M3FJ 2BZTA 4R1HA 4I98B 3AL0C 2UUZA 3OYFA 3GFLA 3MZYA 2STTA 1BN5A 3QPTA 1MMSA 3PIOF 3RYPA 1YRNA 2WADA 1MNEA 2JTVA 3FZVA 3O3KA 5GTHC 5D4SA 3AKZA 4ZYEA 1V3FA 4ANJA 3BTIA 2F2EA 2E5NA 3MN2A 5C4JJ 4FETA 5F64A 4MTDA 1NK2P 5D5VB 5E1WA 2OJED 4G9YA 4BJ6C 2CS3A 2OQGA 4AC0A 4I01A 5DDGA 1Z9CA 2WTEA 1TLHB 2EBIA 4JK1X 3WU0A 4OU0A 2E34A 3ABUA 3I4MJ 4BYYA 2EINH 1VQ5I 2W82A 1MNDA 1TT5B 2NRAC 1WJ5A 2DYSH 2CFOA 5D5XB 5IT9Z 2KLOA 2A68F 2JA8J 2GXBA 1VTNC 2XDVA 1HKQA 4BS9A 3ZQLA 3G6EI 1YQAA 2DQLA 4MHGA 1MBKA 1EJ9A 2V6CA 4NHJA 3CJTB 2XKPA 1YX3A 3BT9A 5KVRA 3FK6A 2DMUA 2CWEA 2Y9ZA 2Z99A 1S6LA 2N8GA 3X2QH 3HB9A 2ID6A 2FU4A 2XF7A 4KT6A 5J40A 1YS6A 4S0HB 4A3KJ 4N9IA 2LF8A 2Y2ZA 1VQLI 1LJ9A 2BY1A 3E3VA 2NS7A 4CCNA 2HZTA 2IGNA 4LIVA 2NVQJ 4BE1A 4KIGA 2XPUA 4GYIA 4UNOA 2LD5A 1WPKA 2L7FP 1JHHA 5FLXK 1P4XA 2CW7A 3KE2A 3J80Z 2F4OB 4H4KC 2B63J 3A0BC 4DW6A 5CQEA 3GX4X 1O7FA 4R79A 3H1CA 3GWZA 2DT5A 1YX5A 2EIMH 5B66C 3SQNA 2KIUA 1QNTA 3S32A 3WU1B 3Q0VA 3CCMI 3P7NA 1K7AA 1N78A 3U1KA 3MVPA 3E5QA 2X48A 4KUMA 2E60A 4GO1A 1W4MA 2OU2A 2GWRA 4HV5A 3F8NA 1ZGWA 3K1MA 2AXLA 4ENJA 1T98A 2H8RA 2ZMEC 4I7HA 1IN8A 1IUYA 1AWCA 4IXAA 3SJMA 2RQQA 2FSWA 4B43A 3FK7A 3BJ6A 1HSJA 5EEGA 3D1NI 1Z3YA 2ELKA 2V79A 2PBIA 2L9VA 3FXKA 3PJRA 1R9TJ 3VYRB 4HW0A 1HXDA 3FWEA 4FE7A 3CESA 4B47A 1OR7C 1FYKA 2D1VA 4AD9A 1FT9A 2K7LA 4R8HA 3SDBA 1XMXA 3HOTA 1UZCA 4RGRA 1RR7A 3BR1A 4IZZA 1U5TB 2M0MA 4PZJA 1KU7A 3HOSA 4QIWN 5IYBJ 5K7HA 2VJJA 3HJEA 4BHBA 4XQFA 3M3YJ 1BC7C 4ZYGA 2CMPA 3DPUA 5HDGA 1IXCA 4B8XA 2K3FA 1JKPC 2R5ZA 4BNCA 3T8TA 3UR3C 2OAZA 4IQ4A 2NNYA 1I5ZA 3QP5A 3PM1A 1V5EA 3G73A 2CFXA 1S9HA 1G6NA 2KISA 3ZQGA 1YS7A 2L02A 3HG9A 4II2A 2H27A 3E97A 3ZMUA 4V19K 1XGMA 1BJAA 3R60A 1YW8A 4L9NA 3V8JA 4LLNA 2KP6A 2M2EA 4UHTA 2L0KA 4ENKA 3J81Z 3K9TA 2KJCA 4B44A 2DTZA 2VBYA 4WF2A 3VWBA 1OCZH 2H6BA 3H3UA 4YELA 1Z7UA 2HQAA 3BZCA 1H0MA 2LFBA 5TJJA 1F36A 2L3DA 1I1GA 2LTPA 2XB5A 1QA6A 3QOPA 2R5ZB 1FSHA 3ZMSA 3ELKA 4A3BJ 5ERIA 4BACA 2QQAA 1BI3A 3SXYA 2H1KA 2XRNA 3K69A 5E3LA 1ZGAA 3CCLI 3HKZN 3M8FA 1ON2A 2VQHA 2DPUA 1RKWA 3CTAA 4NQWB 3ZQQA 3CMAI 3RKQA 1R5ID 1FOXA 4E7IA 1FOWA 3JRHA 1R4NB 5B1AH 4HF2A 2E1NA 5ICEA 4M72A 3OYHA 4EEFG 2JRMA 1XDSA 5KNLA 2FBIA 2PMZA 4I0AA 5C44J 2QWWA 1X2NA 2ZCWA 3NRVA 4I09A 2LY2A 4DYRA 1LE8A 1X1BA 2PMHA 2PMZN 3ZQHA 2LRDA 3C18A 3SZTA 3ZQFA 3KEYA 3C7JA 3KZZA 1PUFB 3PFIA 3GTPJ 3OYNA 2FNAA 4S04A 3ZMDA 3JRIA 3RPUD 4IQJA 1G4DA 4HPQA 2EK5A 1XG1A 1V5GA 2GOMA 4BQOA 2CSOA 2YPRA 4RBOA 4OOIA 3CJNA 3Q5FA 2X6WA 2ZB9A 2ELHA 3QAHA 3WGGA 2WY7Q 3DTEA 5TGTA 1V5FA 4DGWB 4YFKF 3LMMA 3PL8A 1LDDA 2LKXA 3ASNH 2JA6J 3GFIA 2D2WA 3GXOA 4XN3A 1NG7A 3CCVI 1X3WB 1SANA 2BOLA 3K0LA 1HF0A 2CGPA 3VYUB 2JQ7A 1S7EA 3I9V2 4KT5C 4LG3A 1KGSA 4ETSA 2VB6A 3E6CC 2F5CA 2UZKA 1FBQA 2M7BA 3PNTA 2QQ9A 5GAGJ 3L09A 5J4VA 2IP2A 2OCCH 3L2CA 2W7NA 2JUGA 5L3BA 4OAZA 1RC9A 1D8KA 4DIQA 4BXUA 3IH3A 3F23A 3CF2A 1U78A 1MDMB 5HS9A 3CF5F 1AOYA 1HKSA 1D5YA 1F5TA 1VNDA 1D0YA 3HHHA 2R0QC 2VOOA 3EYIA 1RIOH 2DT6A 4WXHA 1SVOA 1KQ9A 2CV0A 4Y3OA 3HHGA 1I39A 1A5JA 1YJWI 1X3ZB 3GCMA 4EJVA 2VKDA 4XLAA 1ZGJA 4ZYAA 3BR0A 1R5HA 1QZYA 2CV2A 3TO6A 4II3A 4D5FA 4IHXA 2KFDA 5E20A 2AO9A 4HQMA 2XGDA 2XF5A 1OR7A 3LQRA 2XAHA 4IHVA 1YE9A 2ACJA 2L54A 4ESBA 4L5JA 1SFUA 2FOWA 2IS2A 3H3ZA 4KMUX 1MKMA 2DODA 3KZYA 1B9NA 4BL0B 3JAMK 4Q4ZF 4BEHA 4KN4X 5DM6F 2V9PA 4E70A 1JUPA 3WE2A 2MLGA 3KFWX 1YLFA 3BTJA 2FXAA 2W48A 2ESHA 1WFXA 3WTWC 4BKXA 2M3AA 1IRGA 1D1AA 3LSKA 2ZKZA 4WX9A 1VFCA 2ECBA 3IUOA 2LY9A 3OL4A 4FASD 5J8FA 1IF1A 1VF9A 3JRCA 2DAOA 3DWLE 1ZG3A 4A3GJ 1RZ4A 4C3IJ 4XKWA 2HVRA 1SAXA 1MSFC 2P5KA 1ZG1A 3TO7A 4B48A 4Q48A 4AWXB 4CYCB 4YIRX 5B5EC 4A6DA 5K5OA 1OFCX 4G6DA 2DDBA 4ZYDA 4X6AJ 1XB4A 1UJ8A 2ZBKA 2M8EA 5E3MA 2OUMA 1IRXA 3ML6A 1OCOH 2EZIA 2FRHA 2PN6A 5DS9A 1VQMI 2M0CA 3DTKA 1UHWA 2E19A 2VE8A 3AG1H 3Q9SA 2R5YA 3CLQA 3HUGA 3HRMA 1REPC 1W5TA 1P4WA 4IF4A 1ZLKA 2EIJH 3HTSB 3EUHA 3HRUA 3HIFA 3P9CA 3LNQA 3Q9VA 3WODF 4RLQA 2GM4A 2PX9A 2GQQA 3O8HA 2JVHA 4HF1A 2HQNA 1FC3A
chains in the Genus database with same CATH topology
4M3FA 4QSHA 4MIMA 5JLWA 3JRGA 1HDPA 5K7FA 2EQRA 2XRLA 2D5VA 3G1LA 2XGEA 5BNGA 3A01A 2NS8A 2XPVA 2NOGA 5FKMA 4FCYA 4JX6A 2VI6A 2NVYJ 4MO7A 1ZTRA 1UHSA 1P7IA 1GV2A 4JP0A 1NTCA 3W6VA 1VI0A 5J3LA 3S1MJ 1Z0XA 5EYRA 2VKVA 3G1OA 1JGGA 2VPRA 1ZR2A 4RDUA 1ETXA 2YUSA 1ZK8A 1GDTA 1W0UA 1JKRC 1AHDP 2LR8A 5M5YJ 2MW8A 2FQ4A 4GFBA 1MH4A 2AHQA 2CQQA 5M5WJ 3GTMJ 2YU9J 2K9QA 1QPIA 2TRTA 1OCTC 1FEXA 5HODA 1E3OC 4JX4A 3L1PA 3BG5A 3BQZA 1ETKA 3CQZJ 2XPWA 2CUFA 1TWFJ 1OCPA 1K61A 5FKNA 1ZQ3P 2DMPA 5E3OA 4AYBN 1JTXA 1HLVA 2FJ1A 3LSRA 3RZDJ 2XB0X 4C2MJ 2O9LA 3HOWJ 2WAQN 1MNMC 5J1RA 5IYCJ 3HOYJ 2JJ7A 2R93J 3GTGJ 1Z77A 1IDYA 1XC5A 1TC3C 1FIPA 4JYKA 1SFOJ 1IRZA 1ETOA 1X58A 2IAIA 2WB1N 4XRSG 3GTKJ 2OPTA 3BG3A 2FX0A 3TW7A 1JTYA 4BXXJ 1FTZA 2JA7J 4XRMA 4D7NA 1ETWA 1AKHB 3GBGA 2GBYA 3GTOJ 4BBRJ 1IUFA 2O7OA 4M6VA 5M3FJ 1IV6A 1CQTA 1RESA 1T56A 5F0FA 3S1QJ 2ID3A 1W0TA 4IEJA 1YRNA 1TWGJ 3HOUJ 1HOMA 2EZLA 2HDDA 5M5XJ 3HEFA 3S14J 3BTIA 3MN2A 5C4JJ 1P7JA 1NK2P 3B6AA 1POGA 4A3IJ 2CJJA 4DZJA 1LFBA 2JA5J 1A6IA 2P81A 2OF7A 3ZQIA 3O8GA 4AC0A 2Y31A 3A01B 1JKQC 2EBIA 3H3VK 1B8IA 1OJLA 3C2BA 5K7ZA 3TEDA 3I4MJ 5EF6A 5IP9J 1JUMA 1WI3A 2DMQA 1ZKGA 1QVUA 2WV1A 1U9OA 4BY7J 2LK2A 4B1RA 2Y30A 2JA8J 2CU7A 3ZQLA 4A3LJ 1MH3A 2ECCA 2DA3A 5GPCA 3JRDA 1MBKA 1MBGA 2CQXA 3BT9A 5M3MJ 1FTTA 5IP6A 3FK6A 2DMUA 2Y9ZA 3JREA 1ZR4A 2N8GA 5C4XJ 3BR2A 2JK3A 4X1EA 5EZGA 1FIAA 2DA7A 2ID6A 3HB9A 4BY1J 3FIWA 3TP0A 2DMNA 3IH2A 3HOZJ 3HGGA 2X9DA 1Y1WJ 2R5YB 4S0HB 4A3KJ 3CMYA 2CUEA 4DZPA 5FLVA 2Y2ZA 1RPWA 2HYJA 2LP0A 2NS7A 1IJWC 2NVQJ 2JN6A 2XPUA 2LD5A 1WPKA 2L7FP 2GLOA 5JLXA 4FTHA 5J1YA 2E2JJ 2DJNA 4UUSA 1F43A 1H89C 2DA2A 2B63J 5GPAA 4C3JJ 4FISA 1HDDC 4DW6A 2E2IJ 2EH3A 2CRGA 1DU6A 1BJZA 3OSGA 1ETYA 2KDZA 5FLMJ 4Y52J 3Q0VA 2VUMJ 3MVPA 2K9NA 4A69C 1WH5A 2X48A 4AUXA 1WCMJ 4M3EA 2HOAA 1IDZA 3CCYA 1I6HJ 4A93J 1ZGWA 2H8RA 1TWHJ 3RQIA 2DA6A 3SJMA 3HGYA 2EZHA 2HQ5A 3FK7A 3GTQJ 3D1NI 2ELKA 1QVTA 1R9TJ 9ANTA 5DTDA 4FE7A 1O4XA 2O8KA 2HOSA 3RZOJ 1QRYA 4MFEA 4UUTA 3S2DJ 1GVDA 3SDGA 1RR7A 2DA5A 1IC8A 3BR1A 3Q0WA 1IG7A 1U8BA 1WGXA 3QPSA 4QIWN 5IYBJ 5K7HA 1BW5A 4DYCA 1BL0A 1MSEC 3VPRA 3M3YJ 3F0CA 4B3AA 4ABZA 1JKPC 2R5ZA 1JJ8C 4HNVA 5EZHA 2M34A 3DEWA 3PM1A 3JRAA 4IHYA 4L5EA 3K7AJ 2XGCA 3Q3SA 4XIDA 3ZQGA 1YRNB 1UG2A 4XRSA 1Y1VJ 4V2FA 2M8GX 1ENHA 5EG0B 2M2EA 3BG9A 3BR5A 2ME6A 5EGOA 1ITYA 1MBEA 2L0KA 2MG4A 2KT0A 3HBLA 1AKHA 2DTZA 2HXIA 3FISA 2DN0A 2K9SA 4A3MJ 1MBFA 1PUFA 2LFBA 1F36A 4BBSJ 4NDLA 2LTPA 2XB5A 2R5ZB 5EEAA 3Q0UA 3G1MA 4M3GA 4A3BJ 1I3QJ 2COBA 3HOVJ 1EF4A 2HI3A 5EDNA 2H1KA 2L9RA 4A3EJ 5E3LA 3HKZN 3FKIJ 3TP3A 5FJ8J 5F1JA 3LSJA 2G0EA 1RKWA 3RKQA 4QTRA 4MFDA 4A3DJ 1ORKA 2HOTA 3JRHA 1TWAJ 4EEFG 2HXOA 2XSDC 5C44J 1X2NA 4DYRA 1LE8A 3S1RJ 3M4OJ 2PMZN 3ZQHA 3ZQFA 3LSPA 2L7ZA 3IV5A 1PUFB 3LSGA 3GTPJ 3BTCA 3JR9A 1AU7A 3JRIA 5FKKA 1XG1A 1GV5A 3GTLJ 1ETQA 2L7MP 3E7LA 3ZOBA 2X6OA 4W1UA 4RBOA 5IP7J 3IH4A 4I6ZA 1NK3P 3PO2J 1JT0A 2ZB9A 2Y9YA 1BW6A 1APLC 4UUSB 2K40A 3BR6A 1BA5A 3A03A 2LKXA 4M3BA 4G12A 5FKOA 2JA6J 5E3NA 3S1NJ 2LLKA 3MKLA 1SANA 3CDLA 3HM5A 1HF0A 1Q1VA 5F08A 2LVSA 1S7EA 4J19A 4MLOA 1H8AC 2DA1A 2FD5A 2E1OA 2TCTA 3PO3J 1JKOC 3GTJJ 4V2GA 5F0HA 3WHBA 3OSFA 3IH3A 4A3JJ 3BR3A 4DYQA 1U78A 4M3DA 1WH7A 5IYDJ 5IOZA 3I4NJ 1D5YA 5F27A 1ETVA 1VNDA 3HOXJ 2R0QC 4FE4A 3SFIA 3BQYA 2JWTA 3S15J 5F04A 3WHCA 3UKGA 1A5JA 3TW6A 1GUUA 3BR0A 1B72B 1B72A 4D5FA 4IHXA 1RKTA 4C3HJ 1K83J 1JJ6C 3LOCA 3JRFA 2AO9A 2XGDA 4IHVA 2NVXJ 2RAEA 3S2HJ 1TWCJ 5J1UA 2NVTJ 3DCFA 4D7MA 2DMTA 1I50J 3BTLA 4D5CA 4LOCA 5GP9A 1JUPA 1JT6A 2IEKA 5C3EJ 1H88C 1FJLA 3BTJA 2W48A 4JX5A 2JMWA 4BKXA 3NAUA 2R92J 5IPAA 1VFCA 2ECBA 2LY9A 5F0CA 1VF9A 2MGQA 3JRCA 3S17J 4A3GJ 3QQAA 3QPLA 4C3IJ 2YS9A 2R7ZJ 4A3CJ 1MSFC 2VKEA 1XS9A 1MBJA 3OOUA 1UMQA 2E2HJ 1JUSA 5IOYA 4CYCB 2ME0A 4CYCA 1OFCX 4XK4A 3HDDA 1MBHA 2IBDA 4X6AJ 3ZQCA 4IHWA 5E3MA 4Y7NJ 2EZKA 2MSYA 3B6CA 1HCRA 2EZIA 5FKLA 1LE8B 4I76A 5DS9A 2M0CA 2E19A 3A02A 4B4CA 1B8IB 1X2MA 3H0GJ 2M9HA 3S16J 2R5YA 3JRBA 4A3FJ 1T33A 1U9NA 3NARA 1RETA 2Y0SN 4W97A 1G2HA 2QF7A 1GT0C 2I10A 3K2AA 3LNQA 1LFUP 2GM4A 1IGNA 3OIOA 2QCOA 3O8HA 5EGOB 5EG0A 1DU0A 4XICA 2DA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3F A;  4QSH A;  4MIM A;  5JLW A;  3JRG A;  1HDP A;  5K7F A;  2EQR A;  2XRL A;  2D5V A;  3G1L A;  2XGE A;  5BNG A;  3A01 A;  2NS8 A;  2XPV A;  2NOG A;  5FKM A;  4FCY A;  4JX6 A;  2VI6 A;  2NVY J;  4MO7 A;  1ZTR A;  1UHS A;  1P7I A;  1GV2 A;  4JP0 A;  1NTC A;  3W6V A;  1VI0 A;  5J3L A;  3S1M J;  1Z0X A;  5EYR A;  2VKV A;  3G1O A;  1JGG A;  2VPR A;  1ZR2 A;  4RDU A;  1ETX A;  2YUS A;  1ZK8 A;  1GDT A;  1W0U A;  1JKR C;  1AHD P;  2LR8 A;  5M5Y J;  2MW8 A;  2FQ4 A;  4GFB A;  1MH4 A;  2AHQ A;  2CQQ A;  5M5W J;  3GTM J;  2YU9 J;  2K9Q A;  1QPI A;  2TRT A;  1OCT C;  1FEX A;  5HOD A;  1E3O C;  4JX4 A;  3L1P A;  3BG5 A;  3BQZ A;  1ETK A;  3CQZ J;  2XPW A;  2CUF A;  1TWF J;  1OCP A;  1K61 A;  5FKN A;  1ZQ3 P;  2DMP A;  5E3O A;  4AYB N;  1JTX A;  1HLV A;  2FJ1 A;  3LSR A;  3RZD J;  2XB0 X;  4C2M J;  2O9L A;  3HOW J;  2WAQ N;  1MNM C;  5J1R A;  5IYC J;  3HOY J;  2JJ7 A;  2R93 J;  3GTG J;  1Z77 A;  1IDY A;  1XC5 A;  1TC3 C;  1FIP A;  4JYK A;  1SFO J;  1IRZ A;  1ETO A;  1X58 A;  2IAI A;  2WB1 N;  4XRS G;  3GTK J;  2OPT A;  3BG3 A;  2FX0 A;  3TW7 A;  1JTY A;  4BXX J;  1FTZ A;  2JA7 J;  4XRM A;  4D7N A;  1ETW A;  1AKH B;  3GBG A;  2GBY A;  3GTO J;  4BBR J;  1IUF A;  2O7O A;  4M6V A;  5M3F J;  1IV6 A;  1CQT A;  1RES A;  1T56 A;  5F0F A;  3S1Q J;  2ID3 A;  1W0T A;  4IEJ A;  1YRN A;  1TWG J;  3HOU J;  1HOM A;  2EZL A;  2HDD A;  5M5X J;  3HEF A;  3S14 J;  3BTI A;  3MN2 A;  5C4J J;  1P7J A;  1NK2 P;  3B6A A;  1POG A;  4A3I J;  2CJJ A;  4DZJ A;  1LFB A;  2JA5 J;  1A6I A;  2P81 A;  2OF7 A;  3ZQI A;  3O8G A;  4AC0 A;  2Y31 A;  3A01 B;  1JKQ C;  2EBI A;  3H3V K;  1B8I A;  1OJL A;  3C2B A;  5K7Z A;  3TED A;  3I4M J;  5EF6 A;  5IP9 J;  1JUM A;  1WI3 A;  2DMQ A;  1ZKG A;  1QVU A;  2WV1 A;  1U9O A;  4BY7 J;  2LK2 A;  4B1R A;  2Y30 A;  2JA8 J;  2CU7 A;  3ZQL A;  4A3L J;  1MH3 A;  2ECC A;  2DA3 A;  5GPC A;  3JRD A;  1MBK A;  1MBG A;  2CQX A;  3BT9 A;  5M3M J;  1FTT A;  5IP6 A;  3FK6 A;  2DMU A;  2Y9Z A;  3JRE A;  1ZR4 A;  2N8G A;  5C4X J;  3BR2 A;  2JK3 A;  4X1E A;  5EZG A;  1FIA A;  2DA7 A;  2ID6 A;  3HB9 A;  4BY1 J;  3FIW A;  3TP0 A;  2DMN A;  3IH2 A;  3HOZ J;  3HGG A;  2X9D A;  1Y1W J;  2R5Y B;  4S0H B;  4A3K J;  3CMY A;  2CUE A;  4DZP A;  5FLV A;  2Y2Z A;  1RPW A;  2HYJ A;  2LP0 A;  2NS7 A;  1IJW C;  2NVQ J;  2JN6 A;  2XPU A;  2LD5 A;  1WPK A;  2L7F P;  2GLO A;  5JLX A;  4FTH A;  5J1Y A;  2E2J J;  2DJN A;  4UUS A;  1F43 A;  1H89 C;  2DA2 A;  2B63 J;  5GPA A;  4C3J J;  4FIS A;  1HDD C;  4DW6 A;  2E2I J;  2EH3 A;  2CRG A;  1DU6 A;  1BJZ A;  3OSG A;  1ETY A;  2KDZ A;  5FLM J;  4Y52 J;  3Q0V A;  2VUM J;  3MVP A;  2K9N A;  4A69 C;  1WH5 A;  2X48 A;  4AUX A;  1WCM J;  4M3E A;  2HOA A;  1IDZ A;  3CCY A;  1I6H J;  4A93 J;  1ZGW A;  2H8R A;  1TWH J;  3RQI A;  2DA6 A;  3SJM A;  3HGY A;  2EZH A;  2HQ5 A;  3FK7 A;  3GTQ J;  3D1N I;  2ELK A;  1QVT A;  1R9T J;  9ANT A;  5DTD A;  4FE7 A;  1O4X A;  2O8K A;  2HOS A;  3RZO J;  1QRY A;  4MFE A;  4UUT A;  3S2D J;  1GVD A;  3SDG A;  1RR7 A;  2DA5 A;  1IC8 A;  3BR1 A;  3Q0W A;  1IG7 A;  1U8B A;  1WGX A;  3QPS A;  4QIW N;  5IYB J;  5K7H A;  1BW5 A;  4DYC A;  1BL0 A;  1MSE C;  3VPR A;  3M3Y J;  3F0C A;  4B3A A;  4ABZ A;  1JKP C;  2R5Z A;  1JJ8 C;  4HNV A;  5EZH A;  2M34 A;  3DEW A;  3PM1 A;  3JRA A;  4IHY A;  4L5E A;  3K7A J;  2XGC A;  3Q3S A;  4XID A;  3ZQG A;  1YRN B;  1UG2 A;  4XRS A;  1Y1V J;  4V2F A;  2M8G X;  1ENH A;  5EG0 B;  2M2E A;  3BG9 A;  3BR5 A;  2ME6 A;  5EGO A;  1ITY A;  1MBE A;  2L0K A;  2MG4 A;  2KT0 A;  3HBL A;  1AKH A;  2DTZ A;  2HXI A;  3FIS A;  2DN0 A;  2K9S A;  4A3M J;  1MBF A;  1PUF A;  2LFB A;  1F36 A;  4BBS J;  4NDL A;  2LTP A;  2XB5 A;  2R5Z B;  5EEA A;  3Q0U A;  3G1M A;  4M3G A;  4A3B J;  1I3Q J;  2COB A;  3HOV J;  1EF4 A;  2HI3 A;  5EDN A;  2H1K A;  2L9R A;  4A3E J;  5E3L A;  3HKZ N;  3FKI J;  3TP3 A;  5FJ8 J;  5F1J A;  3LSJ A;  2G0E A;  1RKW A;  3RKQ A;  4QTR A;  4MFD A;  4A3D J;  1ORK A;  2HOT A;  3JRH A;  1TWA J;  4EEF G;  2HXO A;  2XSD C;  5C44 J;  1X2N A;  4DYR A;  1LE8 A;  3S1R J;  3M4O J;  2PMZ N;  3ZQH A;  3ZQF A;  3LSP A;  2L7Z A;  3IV5 A;  1PUF B;  3LSG A;  3GTP J;  3BTC A;  3JR9 A;  1AU7 A;  3JRI A;  5FKK A;  1XG1 A;  1GV5 A;  3GTL J;  1ETQ A;  2L7M P;  3E7L A;  3ZOB A;  2X6O A;  4W1U A;  4RBO A;  5IP7 J;  3IH4 A;  4I6Z A;  1NK3 P;  3PO2 J;  1JT0 A;  2ZB9 A;  2Y9Y A;  1BW6 A;  1APL C;  4UUS B;  2K40 A;  3BR6 A;  1BA5 A;  3A03 A;  2LKX A;  4M3B A;  4G12 A;  5FKO A;  2JA6 J;  5E3N A;  3S1N J;  2LLK A;  3MKL A;  1SAN A;  3CDL A;  3HM5 A;  1HF0 A;  1Q1V A;  5F08 A;  2LVS A;  1S7E A;  4J19 A;  4MLO A;  1H8A C;  2DA1 A;  2FD5 A;  2E1O A;  2TCT A;  3PO3 J;  1JKO C;  3GTJ J;  4V2G A;  5F0H A;  3WHB A;  3OSF A;  3IH3 A;  4A3J J;  3BR3 A;  4DYQ A;  1U78 A;  4M3D A;  1WH7 A;  5IYD J;  5IOZ A;  3I4N J;  1D5Y A;  5F27 A;  1ETV A;  1VND A;  3HOX J;  2R0Q C;  4FE4 A;  3SFI A;  3BQY A;  2JWT A;  3S15 J;  5F04 A;  3WHC A;  3UKG A;  1A5J A;  3TW6 A;  1GUU A;  3BR0 A;  1B72 B;  1B72 A;  4D5F A;  4IHX A;  1RKT A;  4C3H J;  1K83 J;  1JJ6 C;  3LOC A;  3JRF A;  2AO9 A;  2XGD A;  4IHV A;  2NVX J;  2RAE A;  3S2H J;  1TWC J;  5J1U A;  2NVT J;  3DCF A;  4D7M A;  2DMT A;  1I50 J;  3BTL A;  4D5C A;  4LOC A;  5GP9 A;  1JUP A;  1JT6 A;  2IEK A;  5C3E J;  1H88 C;  1FJL A;  3BTJ A;  2W48 A;  4JX5 A;  2JMW A;  4BKX A;  3NAU A;  2R92 J;  5IPA A;  1VFC A;  2ECB A;  2LY9 A;  5F0C A;  1VF9 A;  2MGQ A;  3JRC A;  3S17 J;  4A3G J;  3QQA A;  3QPL A;  4C3I J;  2YS9 A;  2R7Z J;  4A3C J;  1MSF C;  2VKE A;  1XS9 A;  1MBJ A;  3OOU A;  1UMQ A;  2E2H J;  1JUS A;  5IOY A;  4CYC B;  2ME0 A;  4CYC A;  1OFC X;  4XK4 A;  3HDD A;  1MBH A;  2IBD A;  4X6A J;  3ZQC A;  4IHW A;  5E3M A;  4Y7N J;  2EZK A;  2MSY A;  3B6C A;  1HCR A;  2EZI A;  5FKL A;  1LE8 B;  4I76 A;  5DS9 A;  2M0C A;  2E19 A;  3A02 A;  4B4C A;  1B8I B;  1X2M A;  3H0G J;  2M9H A;  3S16 J;  2R5Y A;  3JRB A;  4A3F J;  1T33 A;  1U9N A;  3NAR A;  1RET A;  2Y0S N;  4W97 A;  1G2H A;  2QF7 A;  1GT0 C;  2I10 A;  3K2A A;  3LNQ A;  1LFU P;  2GM4 A;  1IGN A;  3OIO A;  2QCO A;  3O8H A;  5EGO B;  5EG0 A;  1DU0 A;  4XIC A;  2DA4 A; 
#chains in the Genus database with same CATH topology
 3FF5 A;  3WTV C;  3EET A;  3L2U A;  3IHU A;  1IN4 A;  5FRM A;  3A01 A;  2NS8 A;  2R7U A;  5HOO A;  4FCY A;  1X4P A;  4C2T A;  3OYA A;  1IXS B;  1ZTR A;  1UHS A;  2MA3 A;  3WTZ A;  4JP0 A;  1VI0 A;  3U21 A;  4RB1 A;  2W4S A;  3OYE A;  1ACI A;  3GZ5 A;  2JSC A;  2BW3 B;  3M07 A;  2LOO A;  4PSW A;  1JGG A;  3PQJ A;  5LHH A;  2QYO A;  1ETX A;  1UCR A;  5KK1 A;  4XN0 A;  1FP2 A;  3WTU C;  1W0U A;  2VXZ A;  2LR8 A;  2FML A;  4EM2 A;  2KPM A;  4Y33 A;  4EJW A;  5GAE J;  1YTY A;  3VDX A;  1QPI A;  1LDK B;  2TRT A;  3LA7 A;  1OCT C;  1FEX A;  4G6Q A;  4JX4 A;  2FNP A;  4Q47 A;  1SC7 A;  1GHC A;  2A61 A;  2KDO A;  2ZSH B;  3BQZ A;  5HS8 A;  2G7H A;  1ETK A;  2HKX A;  3D5S C;  3C2G A;  3CQZ J;  4J00 A;  2XPW A;  2CUF A;  1TWF J;  3KP6 A;  1OCP A;  3KYC B;  3SEZ A;  4D0P A;  2DMP A;  3I58 A;  3RIR A;  5KAF C;  5E3O A;  2ISY A;  2ICW G;  1TNS A;  2K86 A;  1K4S A;  2BHY A;  3A1Y A;  3FHN A;  3K70 D;  4LIT A;  2DOA A;  3IWF A;  4C2M J;  1MNM C;  5IYC J;  3TBI A;  4HLY A;  2JJ7 A;  4BQN A;  1ZH5 A;  1XC5 A;  4P96 A;  1FIP A;  4JYK A;  3CME I;  1P2F A;  3WTX C;  1X1D A;  1SFO J;  2E5Z A;  1U5T A;  2WB1 N;  3DKY A;  3GTK J;  4IRI A;  2FX0 A;  1LEA A;  2HQR A;  4RS8 A;  3FX3 A;  5H6R A;  4FX4 A;  4BXX J;  4DBR A;  4EAT A;  3TOB A;  2P8T A;  1B9M A;  4A12 A;  3GBG A;  1QZE A;  1AKH B;  2GBY A;  3U9G A;  2O7O A;  3LWF A;  5ILS A;  3OOP A;  3WU2 C;  3JAM Z;  2A5W A;  3H36 A;  3S3O A;  1WJE A;  2QSF X;  3MZH A;  3DU6 A;  4DNC A;  1W0T A;  1TWG J;  3CCR I;  3CC4 I;  1S29 A;  3MMY B;  3HOU J;  2MH9 A;  2EZL A;  3N97 A;  2QZ8 A;  1CGP A;  3AFH A;  5FO5 A;  5B1B H;  4F93 B;  3OV8 A;  3DKW A;  1POG A;  3RSN A;  2VPL A;  4A3I J;  4DZJ A;  1LFB A;  2JA5 J;  2JT1 A;  2OF7 A;  4BQQ A;  1FLI A;  2Y31 A;  4N4O B;  2NNN A;  3BPX A;  3MEX A;  1R71 A;  3J81 K;  4I99 C;  5EF6 A;  3K4K A;  5IP9 J;  2OTJ I;  1JUM A;  2ZXW H;  4UUV A;  1WI3 A;  4KMF A;  2DMQ A;  2VT2 A;  3GO5 A;  1H9T A;  4CGZ A;  1QVU A;  3PFY A;  1YOV B;  5JI6 A;  4Y4R A;  1U9O A;  3L9F A;  2Z2S B;  4BY7 J;  2LK2 A;  2Y30 A;  3KCC A;  1T6S A;  1KU2 A;  5D5U B;  1MH3 A;  4OAY A;  3CO7 C;  3JRD A;  2L01 A;  1MBG A;  2CQX A;  2WB1 A;  4GYG A;  1YG2 A;  1ZAO A;  4RGX A;  2PJR A;  3JRE A;  3N4M A;  1ZR4 A;  4X1E A;  2DA7 A;  4BY1 J;  5LD2 C;  4E4H A;  1K6Y A;  1OCC H;  2DMN A;  3CUQ C;  3ESW B;  2O03 A;  1LPQ A;  2X6Y A;  4B09 A;  3ZR8 X;  2OC6 A;  2R7O A;  1Z3X A;  3K4C A;  2LH9 A;  3ZMT A;  3S2W A;  2HPI A;  1RPW A;  4ESF A;  4PFP A;  4KDP A;  2O8X A;  3FBI B;  1W5S A;  1Z1D A;  3RQ4 A;  2IGM A;  2GLO A;  2IS4 A;  5JLX A;  4FTH A;  2V7F A;  3FMR A;  1VQ6 I;  2BVL A;  3CDI A;  1F43 A;  1ZHF A;  3ROU A;  2DO7 A;  5L3G A;  2COM A;  1HDD C;  1SFE A;  3L2R A;  3RI4 A;  5LEJ A;  2LF7 A;  2X0L A;  2W1O A;  2DOE A;  1BJZ A;  2IA0 A;  5JVG F;  3DBH B;  3QRF F;  3U1D A;  1JHF A;  1TZL A;  1MMN A;  4A69 C;  1LNW A;  1V54 H;  1WH5 A;  4AUX A;  1WCM J;  4M3E A;  4P9F A;  1ULY A;  1T0F A;  4JQF A;  4MEY F;  1I6H J;  4XOT A;  2G7U A;  3B73 A;  3H5A A;  4XKV A;  5JR3 A;  3G71 I;  1Y0N A;  3OYM A;  2QSH X;  2HDC A;  1G3T A;  2HQ5 A;  2XAS A;  5CVR A;  3A0H C;  4KA4 A;  3J80 K;  3EUK L;  3GUD A;  1W7P D;  9ANT A;  3CUO A;  2DXI A;  2O61 A;  1ONV A;  1MJ9 A;  4S05 A;  4C2U A;  2D45 A;  2RC4 A;  1JI8 A;  1ZYR F;  1TT0 A;  1ERD A;  5KCM A;  4PCQ A;  1GVD A;  1BC8 C;  3SDG A;  2DA5 A;  3Q0W A;  2BEO A;  4BU2 A;  1BM9 A;  2OA4 A;  1EH6 A;  4HAM A;  1K79 A;  2QSG X;  4EVI A;  3ABL H;  1PYV A;  1OPC A;  4GGG A;  3E6M A;  2AXT C;  3F0C A;  4RA2 A;  3JSO A;  3HC7 A;  1JJ8 C;  1R00 A;  2CO5 A;  4HNV A;  2WV0 A;  2YX4 A;  3HTU A;  3DEW A;  4IHY A;  2W57 A;  4NC6 A;  3JRA A;  4IRG A;  2DJI A;  3K7A J;  1WJD A;  1LQ1 A;  1LVA A;  1QGP A;  1Z6T A;  3H92 A;  3C1D A;  4XID A;  1XD7 A;  1BI0 A;  4BDZ A;  4LMY A;  2CH0 A;  1LUJ B;  1BIA A;  2KHM A;  2MBF A;  1ENH A;  3BG9 A;  4WXD A;  3GW2 A;  2HEO A;  2FEZ A;  4YIF A;  3FIS A;  4L18 B;  2K9S A;  1MBF A;  3DFG A;  4ZYH A;  2QA4 I;  1OCR H;  2EFW A;  2VQL A;  3NWS A;  3H9J A;  1SAU A;  4M6X A;  4ZDO A;  4NDL A;  3RKW A;  3KLN A;  2H09 A;  4XM3 A;  1G3Y A;  1X1A A;  4M3G A;  2M7A A;  2COB A;  3HOV J;  2HI3 A;  5HVQ C;  5EDN A;  5LRR A;  4GDF A;  3TDU C;  1PVE A;  1Y56 A;  2XAU A;  2P7C B;  3LSJ A;  5DCM B;  1T39 A;  2HTJ A;  4NQW A;  1R49 A;  3FXJ A;  4QTR A;  4UVC A;  4MFD A;  2R7V A;  2HOT A;  3CCE I;  3R61 A;  2HFH A;  1X1C A;  3F8B A;  2HXO A;  2DFH A;  4BXF A;  2B0L A;  1X3U A;  2DFI A;  3LSP A;  2L7Z A;  3FXM A;  1B59 A;  3LSG A;  1F9N A;  3BTC A;  2V9V A;  1AU7 A;  2ZO4 A;  1L0O C;  3OY9 A;  5F6F A;  3LFK A;  4F7Z A;  5FKK A;  1Z67 A;  1S72 I;  2QBY A;  2KIF A;  3GTL J;  2KZG A;  2A6T A;  2KMU A;  2Z9O A;  4W1U A;  3J7Z I;  1KA8 A;  3K4J A;  4I6Z A;  1YIJ I;  3WTT C;  2MAB A;  3ZCO A;  1JT0 A;  1B4A A;  1BW6 A;  4AID A;  2EFP A;  2K40 A;  2M1B A;  3BR6 A;  4UXN A;  3A03 A;  4HV6 A;  4A6E A;  1H9G A;  2DFE A;  1SD4 A;  1R36 A;  3RKX A;  2LLK A;  4U0W A;  3MKL A;  2DOF A;  2KIM A;  4HF0 A;  2ZNZ A;  2LVS A;  3WTS C;  3TDZ C;  4AU7 A;  3FDY A;  3V42 A;  4MLO A;  2R7D A;  1H8A C;  3R4K A;  3F6O A;  3ECO A;  4HX7 A;  4F3Q A;  2FD5 A;  1CF7 A;  2R7Q A;  1Z91 A;  3I59 B;  3PO3 J;  1JKO C;  1R4M B;  1ON1 A;  2NAZ A;  4IJA A;  5K5Q A;  1Z6R A;  4WWC A;  5IT9 K;  2RVC A;  1WWX A;  4M3D A;  1MDM A;  3FM3 A;  2Z16 A;  1W1W E;  2VKH A;  1AA7 A;  3RPQ A;  1XN7 A;  2DCE A;  3VOD A;  1A6Q A;  5KHD A;  3VSK A;  4FHT A;  2JWT A;  3S15 J;  5F04 A;  2ESN A;  3W2W A;  3UKG A;  5IY5 H;  3RCO A;  3TW6 A;  2BXY A;  4IHT A;  4AIH A;  3S3M A;  1B72 A;  3TOA A;  1E0E A;  1J09 A;  2QUF A;  3ZP5 A;  3W6J B;  3VYT B;  3LOC A;  2V4J C;  4ZH4 F;  3VSL A;  2Y69 H;  1EH7 A;  4OMY A;  2NVX J;  4XNF A;  1DPU A;  4E7S A;  1WKM A;  5AON A;  3I3L A;  1BI1 A;  3DCF A;  2AS5 F;  1XDU A;  1TW2 A;  4LLG F;  3BTL A;  2QM3 A;  4LOC A;  4P1W A;  5GP9 A;  3RJP A;  1ZLJ A;  4HLX A;  2J5O A;  2W25 A;  1VQ7 I;  4UV9 A;  1XMA A;  2HYG D;  3NWT A;  3PQK A;  4RLF A;  2W85 A;  1WRJ A;  3HSR A;  1FMW A;  3K2Z A;  2X85 A;  1J7K A;  2MGQ A;  3K1N A;  4LLL A;  3S17 J;  3QQA A;  3QPL A;  5H2F C;  2R7Z J;  2VKE A;  1HC8 A;  2K9M A;  4CCJ A;  3K4M A;  2ZJR F;  3SFZ A;  4RMN A;  5EEH A;  2ME0 A;  4HZF A;  4WCG A;  5ICF A;  3KP7 A;  2IBD A;  2F5F A;  3CC2 I;  3LSH A;  5D4R A;  2IW5 A;  1K6O A;  3K4L A;  2XAJ A;  3PSF A;  4IHW A;  1Y0U A;  3AG3 H;  2GZW A;  4LG0 A;  4LG0 B;  3W2A A;  2MSY A;  2AQF A;  5FKL A;  3F22 A;  3WGH A;  3HSE A;  3ASO H;  4I76 A;  1PJR A;  2L7K A;  4U7D A;  3LAJ A;  3FKJ A;  3S16 J;  1OIS A;  2WAF A;  3ZQ7 A;  4GXO A;  1UG0 A;  1U9N A;  2OBP A;  3NAR A;  3CCS I;  1G2H A;  1W5C C;  5JFR A;  1BOB A;  3KP3 A;  4NB5 A;  4G7Z F;  3RPU A;  4MGR A;  2QCO A;  2R4G A;  1OKR A;  2FQ3 A;  2JUC A;  1W7P A;  3CD6 I;  4X0G A;  3J7A O;  3BCA A;  4QSH A;  5JLW A;  1RNL A;  1HDP A;  3S3N A;  1HW2 A;  5K7F A;  1LB2 A;  1XSV A;  4XLH A;  2EQR A;  2HTS A;  2D5V A;  2F5D A;  3G1L A;  4IRH A;  4RGS A;  2NOG A;  4UB8 C;  2VI6 A;  5E18 F;  3OYJ A;  3FM5 A;  4M74 A;  2HKO A;  1GV2 A;  2PMU A;  1NTC A;  5IT3 A;  5BPI A;  1F1Z A;  4HOB A;  4RAY A;  5J3L A;  3ZMV A;  4ZJZ A;  2VPR A;  4B3X A;  1N25 A;  4OIR F;  1ZR2 A;  1X19 A;  3ECH A;  2HVS A;  1XTA A;  5LHG A;  1ZK8 A;  3NQO A;  1AHD P;  5M5Y J;  2MW8 A;  3S8P A;  2AHQ A;  5M5W J;  3DF8 A;  4XLC A;  4GFB A;  2IPQ X;  3GTM J;  4KNY A;  5HOD A;  2RGV A;  3EYY A;  5B3S H;  3L1P A;  1ODD A;  2AQE A;  1FMV A;  3BZK A;  4XLN F;  3R6S A;  3F6V A;  5HDN A;  3ZRG A;  2JZY A;  1YIO A;  5DD4 A;  1K61 A;  5FKN A;  3WG9 A;  1TQI A;  3OYL A;  1G59 A;  3AL0 B;  3OYC A;  4LK1 F;  2DU9 A;  4CO8 A;  2ZJQ F;  4L9V A;  3RZD J;  2XB0 X;  4PFO A;  2WWY A;  2O9L A;  3M8J A;  2EV5 A;  4LIU A;  2WAQ N;  2IS6 A;  3HOY J;  4KIB A;  3HYI A;  3GTG J;  4N4N B;  1JE8 A;  1QPM A;  3H5N A;  4KIC A;  1TC3 C;  3QP6 A;  2EFN A;  3V4G A;  2F48 A;  2E35 A;  1X58 A;  2IAI A;  4BQA A;  1Z21 A;  3BG3 A;  3OWT A;  4L5I A;  3IWZ A;  3TW7 A;  5BQT A;  2XVC A;  2K9L A;  4XLP F;  4CCL A;  4KJZ A;  1K78 A;  2F6C A;  5AIQ A;  3GTO J;  3CC7 I;  1IUF A;  3QYF A;  1QQI A;  3QYE A;  1IV6 A;  3JCU C;  1RES A;  5BMZ A;  3EUA A;  5F0F A;  2RDP A;  2RQP A;  4IVN A;  5FFZ A;  3S1Q J;  2QEN A;  5ICC A;  4O3M A;  2A05 A;  3LSI A;  1HOM A;  1TBX A;  2EFO A;  2HDD A;  3HEF A;  2W00 A;  1SEU A;  1G8X A;  4DJA A;  4O6J A;  5J8C A;  1W36 D;  2GXA A;  2K4B A;  1Z7L A;  4XLE A;  4BUP A;  5BPD A;  2PFB A;  1DGR M;  2XHK A;  6PAX A;  3GEZ A;  5L3C A;  4ZZL A;  4AIK A;  4G7O F;  2P81 A;  3KYL A;  3F3X A;  2EJR A;  2ZXI A;  1FYM A;  4XKB A;  3DPL C;  2E7X A;  1JKQ C;  4L9J A;  3V7C A;  3C2B A;  5K7Z A;  3TED A;  4FQG A;  4PJM A;  2V1X A;  2IJL A;  3HPG A;  3PNY A;  3QU6 A;  3OYD A;  3EPZ A;  4CA0 A;  4OIO F;  2STW A;  1RUO A;  1OQY A;  3COA C;  1GVJ A;  5D5W B;  1BI2 A;  1NG6 A;  3DBL B;  2J5P A;  1FOY A;  5D6E A;  3H0D A;  4F92 B;  4RB2 C;  3CJQ B;  4A3L J;  2DA3 A;  3EDP A;  1WHU A;  3VFZ A;  4XRF A;  1Q1H A;  2Z5U A;  1V55 H;  5IP6 A;  3ZPL A;  3PNV A;  3BWG A;  4KYW A;  3MD2 A;  2QQB A;  5EZG A;  5HLG A;  1JGS A;  3BG6 A;  2VBW A;  2R3S A;  3FIW A;  3TP0 A;  4U0Y A;  3VYS B;  4CCK A;  3HOZ J;  1KQ8 A;  1UFM A;  4ITV A;  2X9D A;  4RM3 A;  2R5Y B;  2A5Y B;  1P4A A;  1SMY F;  2CUE A;  3KZI C;  3CCQ I;  5FLV A;  1J9I A;  2YX7 A;  2R7X A;  2LP0 A;  2Q1Z B;  3FXR A;  2KRF A;  2R7R A;  4IKF A;  3AG2 H;  1BIB A;  4M9X A;  2M30 A;  5EJC A;  2ZME A;  4BE0 A;  5E1X A;  3GF2 A;  4PJ0 C;  5J1Y A;  4UY8 I;  2ADU A;  5E1Z B;  3D5R C;  2DJN A;  1H89 C;  2DA2 A;  1MJA A;  1IN6 A;  5GPA A;  4FIS A;  4C3J J;  1VQ4 I;  4G8X A;  4MNU A;  4MEX F;  1PUE E;  2CRG A;  1KON A;  1DU6 A;  2V9K A;  2RNJ A;  1Y6I A;  5DYM A;  3OSG A;  4IOC F;  3F8M A;  2KDZ A;  5FLM J;  1SVL A;  4BHC A;  5DUK A;  3DV8 A;  3OIQ A;  1T38 A;  2CV1 A;  2VL8 A;  1T2K A;  2RNG A;  2HOA A;  3E5U A;  2E7W A;  4XKC A;  4WXC A;  1KYZ A;  2IRF G;  1I27 A;  3I71 A;  2P5L C;  1TWH J;  3RQI A;  3MQ0 A;  2VOD A;  5CVJ A;  2DA6 A;  2VXD A;  2H6C A;  3GTQ J;  3PUF A;  3BC8 A;  2RKH A;  3K10 A;  5LGN A;  1Y39 A;  2JPC A;  1D5V A;  2FUG 2;  2MD5 A;  5DTD A;  1O4X A;  3PUB A;  2EA2 A;  2CW8 A;  2NXN B;  1S7A A;  5CQG A;  3GME A;  1VQP I;  2A6E F;  3OYG A;  2HOS A;  3RZO J;  1J59 A;  1QRY A;  4MFE A;  4QWQ A;  3S2D J;  2IVM A;  2YR2 A;  1W36 C;  1U8B A;  4C9Y A;  2X1E A;  2DTR A;  3QPS A;  2JPB A;  1SVM A;  2Y0S A;  1BL0 A;  2QEX I;  1MSE C;  3VPR A;  5H20 A;  4B3A A;  1MW7 A;  5HNF A;  1BR4 A;  3GFJ A;  1DUX C;  2H8W A;  1U2W A;  2BW3 A;  2HNH A;  1VQK I;  2ZME B;  3T8R A;  4L5E A;  3W3C A;  1O7L A;  3TGN A;  1WVR A;  3D5L A;  2K02 A;  1YW7 A;  4M6Y A;  3LA2 A;  4XSZ F;  2QKM B;  4YEJ A;  4CYD A;  2ZFU A;  1ZRC A;  4XRS A;  4L0Y B;  3ZGK A;  5GAH J;  1O3S A;  1PP8 F;  2M8G X;  3K4B A;  3RTR A;  5DM7 F;  3HXL A;  3WG7 H;  5EG0 B;  3BR5 A;  2ME6 A;  1ITY A;  3M9A A;  2MG4 A;  3HBL A;  1SD7 A;  1K78 B;  1AKH A;  2HXI A;  5A2Q K;  3UNG C;  1FYL A;  2KRH A;  1NHA A;  1PUF A;  3DXJ F;  4DQ2 A;  2LY1 A;  2A6H F;  1RRJ A;  3Q0U A;  1GXQ A;  4LFU A;  4PJN A;  1R22 A;  3DP7 A;  2LKS A;  3IRR A;  4A3E J;  4EV0 A;  2M4K A;  2VLA A;  1KU3 A;  2JA2 A;  3TP3 A;  1VQ9 I;  5F1J A;  2NVU B;  2G0E A;  2BVM A;  2L4A A;  4A3D J;  3MCZ A;  1IN5 A;  2R7T A;  2QLZ A;  3FXU A;  2EIL H;  2EPF A;  4A0X A;  3FMS A;  3MKY B;  2V1N A;  3QYB A;  5D8L B;  3IV5 A;  1E2X A;  4OMZ A;  2GOX B;  5CJ9 A;  1SD6 A;  2ZXH A;  4E7K A;  3CP8 A;  1HKT A;  4CCM A;  1BBY A;  4UVB A;  4XOR A;  2H1L A;  3R0J A;  4Y17 A;  2YU3 A;  1ETQ A;  2IA1 A;  3E7L A;  3ZOB A;  3CO6 C;  5IP7 J;  2CYY A;  3IH4 A;  1DDN A;  3CCJ I;  3KEQ A;  3PO2 J;  1WJB A;  1A31 A;  2VBZ A;  4E6K G;  2Y9Y A;  5HLI A;  3I0T A;  2DPD A;  4UUS B;  1BA5 A;  1C0W A;  5DEQ A;  4E7L A;  2UV1 A;  1Y8Q B;  3ULQ B;  3KX2 A;  1O3T A;  3MWM A;  3G3Z A;  3CJR B;  3ABK H;  4F55 A;  2NYX A;  1ZRE A;  4EJU A;  1Q1V A;  2IGK A;  2Q0O A;  4HEA 2;  2PI0 A;  4XSX F;  2VJ4 A;  2PQ8 A;  2BHZ A;  2VT3 A;  4J19 A;  2CUJ A;  3BOQ A;  3KET A;  3OS1 A;  2KKO A;  2V1U A;  1S5L C;  2XAF A;  4HYE A;  2R7S A;  3CZ6 A;  3KYD B;  4IOA F;  2E1O A;  3I56 I;  1D0X A;  2TCT A;  1ZRD A;  3F9K A;  3GTJ J;  2XF6 A;  4V2G A;  4KIS A;  3DKX A;  3A4C A;  3SYT A;  5CPR B;  5FD5 A;  1IZ1 A;  2FF4 A;  5F27 A;  3V7R A;  1W7P B;  1ETV A;  1XGS A;  5FD6 A;  4AIJ A;  4UV8 A;  2VON A;  3IL2 A;  4FE4 A;  2LRE A;  3IP4 B;  2LG4 A;  3BQY A;  4PUS A;  1YYV A;  5H6Q A;  3DU5 A;  3WHC A;  2Q8K A;  4IX7 A;  3P5J A;  3PIP F;  1YIT I;  3OYI A;  5CVI A;  5L3F A;  1BR2 A;  4Q5S F;  5E8G A;  1TTY A;  4YFX F;  1B72 B;  4DBQ A;  4HDU A;  1EV7 A;  1K4T A;  1P9Q C;  1K83 J;  3K1P A;  4C3H J;  4HRI A;  1FBU A;  2OTL I;  1QZZ A;  3KLO A;  5D6F A;  3ISP A;  2FBH A;  2XRO A;  2LKP A;  3S2H J;  1TWC J;  5J1U A;  2A69 F;  5LBQ A;  1U6G A;  4LB5 A;  1EKE A;  2UWM A;  4IO9 F;  4D5C A;  2QQ8 A;  2G9W A;  4A0Y A;  2IEK A;  1JT6 A;  2PJR B;  3C2H A;  3SZP A;  2IT0 A;  1GLN A;  4RAF A;  3KP4 A;  5AIP A;  2KJB A;  2XAG A;  2R92 J;  2CW0 F;  2WC2 A;  3K70 C;  5ED4 A;  1P6R A;  4RAZ A;  3B02 A;  3IKV A;  2XGX A;  4NC7 A;  2P4W A;  2HS5 A;  3DEE A;  2DQR A;  3OMY A;  5ICG A;  1XGO A;  2K27 A;  4XL9 A;  2YS9 A;  5BOX A;  1MGT A;  2HYF A;  1MBJ A;  3HKZ A;  1BOA A;  2F4M B;  3OOU A;  5FFX A;  1UMQ A;  4EGZ A;  2E2H J;  3BJO A;  4CYC A;  2WA0 A;  2E1C A;  1WZ2 A;  1FP1 D;  4HST A;  2F5E A;  4XLF A;  4IPA A;  3KP2 A;  1STZ A;  2QVO A;  2UXX A;  2EZK A;  1HCR A;  4TV7 A;  1LE8 B;  4K2E A;  3KIO A;  2BV6 A;  3W2V A;  2HR3 A;  3ABT A;  4BH9 A;  2FBK A;  1I1S A;  1ZAR A;  3A02 A;  3D0S A;  4B4C A;  5E8I A;  1B8I B;  1X2M A;  3H0G J;  2HWV A;  2M9H A;  4HSR A;  2KIQ A;  4LD5 A;  1LKX A;  3V8K A;  4QLC U;  1J75 A;  3JRB A;  1YHQ I;  1PDN C;  3BY6 A;  4XON A;  4CUG A;  1OYI A;  2L9N A;  1N77 A;  1S7O A;  1RET A;  5CVV A;  2BY2 A;  2BGC A;  4A0Z A;  2RN7 A;  4HX8 A;  3TMO A;  1GT0 C;  3JW4 A;  2I10 A;  2IS1 A;  1LFU P;  4WK8 F;  2DA4 A;  3OIO A;  4N0B A;  1J0R A;  2ZXJ A;  1SFX A;  5EGO B;  5LFA A;  1SD5 A;  2LDU A;  4KFC A;  2R7F A;  4UB6 C;  4U88 A;  2M45 A;  5DV5 A;  4OWR B;  1HBX G;  4D1Q A;  4JX6 A;  1OMI A;  2NVY J;  3KEO A;  5LGU A;  3E5X A;  1NH3 A;  2K85 A;  2VOP A;  3W6V A;  2UXN A;  4ZDL A;  5J6X A;  3M7G A;  4HA8 A;  3S1M J;  4ZTJ A;  3ABM H;  4P5O A;  4E7Z A;  1MD0 A;  3G1O A;  2DW4 A;  2F5V A;  4BJ5 C;  3EUH C;  3RKY A;  1TQP A;  1RUN A;  2HZD A;  2V26 A;  4IL6 C;  4ON0 A;  4JOM A;  3LA3 A;  2CQQ A;  5DCF A;  3I4P A;  3BG7 A;  2JSP A;  2LNB A;  2OQR A;  4LJZ F;  3BPV A;  1E3O C;  1UAA A;  4ASN A;  2BYV E;  3BG5 A;  4PJJ A;  5TRD A;  2XUB A;  2FOK A;  2WAQ A;  3HZJ A;  3MAJ A;  3RYR A;  4A5N A;  2HPM A;  2MYS A;  4CDG A;  2A3S A;  2OZ6 A;  1JXS A;  2LC2 A;  3LQQ A;  4EMS A;  2FJ1 A;  1FPQ A;  1TNT A;  1YW9 A;  1XX5 A;  3ONQ A;  3FBN B;  1B1B A;  4NBQ A;  5J47 A;  4CHU A;  3HOW J;  2R93 J;  4KN7 X;  4G7H F;  3LL7 A;  2V6E A;  1IDY A;  1IDZ A;  4I2O A;  2M5W A;  4XMY A;  1IRZ A;  1ETO A;  4XRS G;  2OPT A;  2W84 A;  3K4N A;  5HLT A;  2BY3 A;  2GIV A;  3I54 A;  2JA7 J;  4XRM A;  5E79 C;  5ILV A;  2VQG A;  5FLX Z;  1A04 A;  1IXR C;  1FX7 A;  1ETW A;  3JTG A;  3E6D A;  2FMY A;  2Y48 A;  3DLL F;  5K1Y A;  4BBR J;  4M6V A;  2PEX A;  1X4O A;  1CQT A;  1F4K A;  2JVG A;  1T56 A;  2VJ5 A;  2X6X A;  4JBA A;  2OZU A;  2HU9 A;  5FRN A;  1R6R A;  2ID3 A;  1D1B A;  4IEJ A;  4HQE A;  4PK4 A;  5HDK A;  3OL3 A;  3BRO A;  1G3W A;  5M5X J;  2VE9 A;  1ZG5 A;  3S14 J;  3L00 A;  4U0V A;  1P7J A;  3OYK A;  3B6A A;  1XPX A;  2JRT A;  4ENN A;  2CJJ A;  1J2X A;  1A6I A;  3ZQI A;  3O8G A;  2NS0 A;  4PJL A;  2M87 A;  3A01 B;  4EQQ A;  4EJT A;  3H3V K;  3TKY A;  1B8I A;  1IV8 A;  1OJL A;  2LYC A;  1ZRF A;  1ZKG A;  1O3R A;  1VQ8 I;  2WV1 A;  3BCB A;  1A36 A;  4KIF A;  4B1R A;  1WQ2 A;  2CU7 A;  2ECC A;  3HSF A;  5GPC A;  1TL8 A;  2Z1D A;  3GZN B;  4N9H A;  2TDX A;  2CUZ A;  4NC8 A;  5J4Y A;  4MTE A;  5M3M J;  3OS0 A;  1FTT A;  3J7Y J;  3R0A A;  1KYW A;  2L4M A;  3ZN1 A;  3GLX A;  5C4X J;  3BR2 A;  2JK3 A;  1A35 A;  1FIA A;  3IH2 A;  3HGG A;  1Y1W J;  4RAG A;  3ERM A;  4M9Z A;  4DZP A;  2DYR H;  3CMY A;  4F91 B;  1T95 A;  3J7A Y;  2HYJ A;  1IJW C;  2NOJ B;  3FXL A;  2JN6 A;  5HLH A;  3V7S A;  2DK5 A;  4GCV A;  3LSM A;  4ZDP A;  2QBY B;  2Y0M A;  2BBY A;  2XAQ A;  3ZXS A;  5FRO A;  3BLY A;  4UUS A;  2E2J J;  2OCE A;  5DUI A;  4BE2 A;  1WSU A;  2XIG A;  5HS7 A;  4Z2Y A;  3L7W A;  2E2I J;  2EA4 A;  2EH3 A;  3JSP A;  2KL4 A;  2M4G A;  5L3E A;  1U3E M;  4PGH A;  1HW1 A;  3MZ8 A;  1ETY A;  3WTY C;  3L2Q A;  4XOP A;  3DTI A;  4AM3 A;  4Y52 J;  2VUM J;  3QOD A;  4O5V A;  4XR6 A;  3VB2 A;  2K9N A;  1YJN I;  1TW3 A;  2ZJP F;  2QGU A;  4CCO A;  5JHF A;  2HVQ A;  3CCY A;  2VAS A;  1IO2 A;  1SMT A;  1G3S A;  3O2P E;  3QWL A;  1XMK A;  4NNJ A;  3V8L A;  4A93 J;  2O0Y A;  3H9G A;  5HNH A;  3N05 A;  2MC3 A;  4G6T B;  3DLA A;  4YG2 F;  3DBR B;  3F21 A;  3HGY A;  2EZH A;  1LVK A;  3E1S A;  1DP3 A;  1SFK A;  5CYV A;  1R58 A;  3T1B A;  1YO5 C;  1QVT A;  1OYY A;  2O8K A;  1VQO I;  5FB2 A;  4UUT A;  2K4J A;  4H0E A;  1IG7 A;  4HNU A;  1IC8 A;  2MH2 A;  5A2Q Z;  3GZ6 A;  1WGX A;  3OR1 C;  1USS A;  4DYC A;  1BW5 A;  5JVT A;  2XC7 A;  1R1U A;  4ABZ A;  1L3L A;  1EH8 A;  1R7J A;  4PDK A;  2MLK A;  1FOK A;  5EZH A;  2M34 A;  3P9K A;  2DLL A;  2H94 A;  1UST A;  2E1M B;  4EJO A;  2ZNY A;  4EM1 A;  1VQN I;  5ILU A;  1HW5 A;  2P7V B;  2XGC A;  3Q3S A;  2A07 F;  3CDH A;  1YRN B;  1UG2 A;  2VN2 A;  3G2B A;  1Y1V J;  1ZEL A;  3MKW B;  2GA2 A;  3GLL A;  4V2F A;  2BE5 F;  3BZ6 A;  4M73 A;  2GIZ A;  3F72 A;  5JHU A;  5EGO A;  1EA3 A;  3GYH X;  3I55 I;  1MBE A;  2KT0 A;  3QU3 A;  3S93 A;  4RB0 A;  2OD5 A;  3HL2 A;  2DN0 A;  4A3M J;  3M1E A;  4G94 A;  2BXZ A;  4HBL A;  3CLO A;  3I53 A;  1PP7 U;  2EFQ A;  4BBS J;  2O3F A;  1WJA A;  5EEA A;  4U7B A;  1I6X A;  2GXG A;  4HNT A;  3L2W A;  4RGU A;  3G1M A;  3ERE D;  1I3Q J;  3F8C A;  1EF4 A;  3OIP A;  2E1M C;  2L9R A;  1VZ0 A;  1R23 A;  3HRS A;  1MZB A;  3FKI J;  4ZZD A;  4A5M A;  3HRT A;  3T0Y A;  5FJ8 J;  4M9S A;  1YI2 I;  3BDD A;  4OIN F;  4OIP F;  5GAD J;  4PGG A;  4CXF A;  1ORK A;  4ZC3 A;  1HST A;  1TWA J;  1OLT A;  2RV8 A;  4M71 A;  3AG4 H;  2XSD C;  1M1E B;  2CQK A;  3S1R J;  3M4O J;  1WJC A;  2KZV A;  1U8R A;  4PSX A;  3SHF A;  3JR9 A;  3BP8 A;  3E6B A;  2EV0 A;  3GVA A;  3DQV C;  4CIC A;  3OS2 A;  2WAE A;  1GV5 A;  2ETH A;  5GTI C;  2L7M P;  3IRQ A;  2X6O A;  1NK3 P;  4Y15 A;  3FXQ A;  2XV4 S;  3H35 A;  4KIT B;  2E71 A;  1IAW A;  1Z05 A;  1APL C;  1QU3 A;  3ZN0 A;  1QHG A;  4M3B A;  4G12 A;  5FKO A;  3S1N J;  5E3N A;  4BAY A;  1LEB A;  3F8F A;  1KQ0 A;  4DOZ A;  3TL4 X;  1B6A A;  1XGN A;  2ZSI B;  3CDL A;  3SZG A;  2HDW A;  3HM5 A;  5F08 A;  2ZJ2 A;  1WI9 A;  4AVP A;  4L0Z B;  3CCU I;  1DP7 P;  3KPH A;  4IHS A;  4P9U A;  1OYW A;  4CZZ A;  3FHZ A;  2DA1 A;  1FY7 A;  2X4H A;  2X51 A;  2MD0 A;  1MJB A;  2V1D A;  3JTH A;  1O3Q A;  3IKT A;  4YII A;  1E17 A;  1XCV A;  2DFF A;  2Y75 A;  5FGM A;  3VEP A;  3WHB A;  5F0H A;  4EGY A;  3OSF A;  1N75 A;  1U0J A;  4A3J J;  1FZP B;  3BR3 A;  4DYQ A;  4MQV A;  1WH7 A;  2RRE A;  5IYD J;  4L9T A;  5TIS C;  5IOZ A;  2P5V A;  3OYB A;  5LEK A;  3I4N J;  3HPH A;  4UVA A;  2WY8 Q;  3CP2 A;  3M8E A;  4NUB A;  3LST A;  4BGD A;  4EM0 B;  2CQ7 A;  3HOX J;  4XBF A;  3SFI A;  3QPH A;  1U5T C;  1TQM A;  4J01 A;  1MMA A;  3FMQ A;  2X1D A;  2FE3 A;  3AAF A;  3RDI A;  1Y8R B;  2VJI A;  2DI3 A;  1GUU A;  1J5Y A;  2PJP A;  4I0B A;  2MFZ A;  4RM2 A;  3HUG B;  1RKT A;  5LGT A;  1BR1 A;  1JJ6 C;  1D8J A;  4LB6 B;  4ESJ A;  3JRF A;  1XSX A;  3PSI A;  3IC7 A;  4E7H A;  3H5R A;  1IW7 F;  1FSE A;  2RAE A;  1LDJ A;  2IXS A;  2NVT J;  2IGO A;  4D7M A;  2DMT A;  1I50 J;  1R1T A;  3O6B B;  3ZMZ A;  2ZC2 A;  1RR8 C;  2EIK H;  1QHH D;  2E36 A;  5C3E J;  1MMD A;  4OIQ F;  3FXO A;  1H88 C;  1FJL A;  4GRI A;  3SEQ A;  2L2O A;  5CVU A;  4JX5 A;  1FBS A;  1D1C A;  1T0F C;  2JMW A;  3NAU A;  5IPA A;  5E17 F;  5F0C A;  1GXP A;  2DDA A;  1X1P A;  2QKL B;  4CZC A;  3I59 A;  2Z33 A;  2GA1 A;  4P55 A;  2LBF B;  4A3C J;  1XS9 A;  1FWZ A;  1R5G A;  1JUS A;  2PG4 A;  2VQC A;  1D3Y A;  2L5Q A;  1S3J A;  5IOY A;  2R7W A;  4CSW A;  4XK4 A;  4U87 A;  3HDD A;  1I3A A;  5DCM A;  4AYB A;  4Z6Y A;  1MBH A;  2DBB A;  1ZN2 A;  2KRC A;  3QOE A;  3ZQC A;  1DPR A;  2ZFW A;  4LK0 F;  1D0Z A;  5CKT A;  2P6S A;  3B6C A;  4F52 A;  4Y7N J;  3IAS 2;  2LMD A;  3C3W A;  4QPO A;  1V4R A;  2ELJ A;  2EB7 A;  2X1C A;  1TP4 A;  3TO9 A;  3VOE A;  4MQ9 F;  4RB3 C;  1HQC A;  2HGC A;  4HDV A;  4A3F J;  1T33 A;  2XSJ C;  5DD8 A;  2B7E A;  3BJA A;  3DPT A;  1IRF A;  2Y0S N;  2I8D A;  4W97 A;  2QF7 A;  4BDY A;  4E7J A;  3CMM A;  4LGW A;  1UHM A;  2MC4 A;  5D8K B;  3K2A A;  4BHP A;  1XSD A;  3OR2 C;  1IGN A;  1UB9 A;  4ENM A;  3NEU A;  2ISZ A;  1KU9 A;  5EG0 A;  1QBJ A;  2DT7 B;  4XIC A;  3GFM A;  1DU0 A;  3W6K B;  4M3F A;  4MIM A;  3JRG A;  2L9S A;  2CQN A;  4YFN F;  5LLQ A;  4C30 A;  1WJF A;  5LHI A;  1RI7 A;  1QO0 D;  2XRL A;  1T08 B;  2XGE A;  3CUQ A;  1DGW Y;  3CUQ B;  5KAI C;  2K5C A;  5BNG A;  2CG4 A;  2XPV A;  3U2R A;  2I5U A;  5FKM A;  2K3P A;  2FA5 A;  4CH7 A;  2BY0 A;  4MO7 A;  1P7I A;  2Z3Y A;  3DEU A;  3E0J B;  2C6Y A;  4QPQ A;  2W24 A;  1P92 A;  2VC1 A;  1E3P A;  3A2K A;  1Z0X A;  5EYR A;  2VKV A;  1KZH A;  1T8I A;  2EWN A;  3P9I A;  3I64 A;  1CF7 B;  1R1V A;  2Q2E A;  2Q2E B;  5L3D A;  4RDU A;  2F4I A;  2YUS A;  2PLY A;  3K6G A;  1LFP A;  4FX0 A;  1GDT A;  1JKR C;  4HG2 A;  1FNN A;  1HA8 A;  2FQ4 A;  1MH4 A;  4AVZ A;  5LRS A;  1S8N A;  2YU9 J;  2K9Q A;  4YRV A;  4I02 A;  2O5R A;  3EQL F;  2O6G E;  3MKZ A;  4HX4 A;  2IA2 A;  3I5U A;  3LFU A;  3M1C A;  2EV6 A;  3MFK A;  1YJ9 I;  1XCB A;  1ZQ3 P;  2OV7 A;  2WBM A;  3TQN A;  4AYB N;  1JTX A;  1HLV A;  3KP5 A;  4ZTF A;  2LSO A;  5F1R A;  2LBF A;  3L2V A;  3LSR A;  3H9Q A;  2GAU A;  3IAM 2;  4A2U A;  5BS6 A;  5J1R A;  3G4S I;  1IN7 A;  1Z77 A;  1DQU A;  2HOE A;  4FT8 A;  1MMG A;  2YSR A;  4BJT A;  3WE3 A;  1E3H A;  1O57 A;  2VBX A;  4Y13 A;  1JTY A;  1YFH A;  2P0W A;  5K5R A;  1MIJ A;  3WGI A;  4BEH B;  1FTZ A;  1UEL B;  2B9S A;  4D7N A;  3LAP A;  2D1H A;  2KQR A;  5CLS A;  2DK8 A;  3REO A;  3T5X A;  2XKO A;  2P6T A;  2VC0 A;  4D9J A;  2VIX A;  5M3F J;  2BZT A;  4R1H A;  4I98 B;  3AL0 C;  2UUZ A;  3OYF A;  3GFL A;  3MZY A;  2STT A;  1BN5 A;  3QPT A;  1MMS A;  3PIO F;  3RYP A;  1YRN A;  2WAD A;  1MNE A;  2JTV A;  3FZV A;  3O3K A;  5GTH C;  5D4S A;  3AKZ A;  4ZYE A;  1V3F A;  4ANJ A;  3BTI A;  2F2E A;  2E5N A;  3MN2 A;  5C4J J;  4FET A;  5F64 A;  4MTD A;  1NK2 P;  5D5V B;  5E1W A;  2OJE D;  4G9Y A;  4BJ6 C;  2CS3 A;  2OQG A;  4AC0 A;  4I01 A;  5DDG A;  1Z9C A;  2WTE A;  1TLH B;  2EBI A;  4JK1 X;  3WU0 A;  4OU0 A;  2E34 A;  3ABU A;  3I4M J;  4BYY A;  2EIN H;  1VQ5 I;  2W82 A;  1MND A;  1TT5 B;  2NRA C;  1WJ5 A;  2DYS H;  2CFO A;  5D5X B;  5IT9 Z;  2KLO A;  2A68 F;  2JA8 J;  2GXB A;  1VTN C;  2XDV A;  1HKQ A;  4BS9 A;  3ZQL A;  3G6E I;  1YQA A;  2DQL A;  4MHG A;  1MBK A;  1EJ9 A;  2V6C A;  4NHJ A;  3CJT B;  2XKP A;  1YX3 A;  3BT9 A;  5KVR A;  3FK6 A;  2DMU A;  2CWE A;  2Y9Z A;  2Z99 A;  1S6L A;  2N8G A;  3X2Q H;  3HB9 A;  2ID6 A;  2FU4 A;  2XF7 A;  4KT6 A;  5J40 A;  1YS6 A;  4S0H B;  4A3K J;  4N9I A;  2LF8 A;  2Y2Z A;  1VQL I;  1LJ9 A;  2BY1 A;  3E3V A;  2NS7 A;  4CCN A;  2HZT A;  2IGN A;  4LIV A;  2NVQ J;  4BE1 A;  4KIG A;  2XPU A;  4GYI A;  4UNO A;  2LD5 A;  1WPK A;  2L7F P;  1JHH A;  5FLX K;  1P4X A;  2CW7 A;  3KE2 A;  3J80 Z;  2F4O B;  4H4K C;  2B63 J;  3A0B C;  4DW6 A;  5CQE A;  3GX4 X;  1O7F A;  4R79 A;  3H1C A;  3GWZ A;  2DT5 A;  1YX5 A;  2EIM H;  5B66 C;  3SQN A;  2KIU A;  1QNT A;  3S32 A;  3WU1 B;  3Q0V A;  3CCM I;  3P7N A;  1K7A A;  1N78 A;  3U1K A;  3MVP A;  3E5Q A;  2X48 A;  4KUM A;  2E60 A;  4GO1 A;  1W4M A;  2OU2 A;  2GWR A;  4HV5 A;  3F8N A;  1ZGW A;  3K1M A;  2AXL A;  4ENJ A;  1T98 A;  2H8R A;  2ZME C;  4I7H A;  1IN8 A;  1IUY A;  1AWC A;  4IXA A;  3SJM A;  2RQQ A;  2FSW A;  4B43 A;  3FK7 A;  3BJ6 A;  1HSJ A;  5EEG A;  3D1N I;  1Z3Y A;  2ELK A;  2V79 A;  2PBI A;  2L9V A;  3FXK A;  3PJR A;  1R9T J;  3VYR B;  4HW0 A;  1HXD A;  3FWE A;  4FE7 A;  3CES A;  4B47 A;  1OR7 C;  1FYK A;  2D1V A;  4AD9 A;  1FT9 A;  2K7L A;  4R8H A;  3SDB A;  1XMX A;  3HOT A;  1UZC A;  4RGR A;  1RR7 A;  3BR1 A;  4IZZ A;  1U5T B;  2M0M A;  4PZJ A;  1KU7 A;  3HOS A;  4QIW N;  5IYB J;  5K7H A;  2VJJ A;  3HJE A;  4BHB A;  4XQF A;  3M3Y J;  1BC7 C;  4ZYG A;  2CMP A;  3DPU A;  5HDG A;  1IXC A;  4B8X A;  2K3F A;  1JKP C;  2R5Z A;  4BNC A;  3T8T A;  3UR3 C;  2OAZ A;  4IQ4 A;  2NNY A;  1I5Z A;  3QP5 A;  3PM1 A;  1V5E A;  3G73 A;  2CFX A;  1S9H A;  1G6N A;  2KIS A;  3ZQG A;  1YS7 A;  2L02 A;  3HG9 A;  4II2 A;  2H27 A;  3E97 A;  3ZMU A;  4V19 K;  1XGM A;  1BJA A;  3R60 A;  1YW8 A;  4L9N A;  3V8J A;  4LLN A;  2KP6 A;  2M2E A;  4UHT A;  2L0K A;  4ENK A;  3J81 Z;  3K9T A;  2KJC A;  4B44 A;  2DTZ A;  2VBY A;  4WF2 A;  3VWB A;  1OCZ H;  2H6B A;  3H3U A;  4YEL A;  1Z7U A;  2HQA A;  3BZC A;  1H0M A;  2LFB A;  5TJJ A;  1F36 A;  2L3D A;  1I1G A;  2LTP A;  2XB5 A;  1QA6 A;  3QOP A;  2R5Z B;  1FSH A;  3ZMS A;  3ELK A;  4A3B J;  5ERI A;  4BAC A;  2QQA A;  1BI3 A;  3SXY A;  2H1K A;  2XRN A;  3K69 A;  5E3L A;  1ZGA A;  3CCL I;  3HKZ N;  3M8F A;  1ON2 A;  2VQH A;  2DPU A;  1RKW A;  3CTA A;  4NQW B;  3ZQQ A;  3CMA I;  3RKQ A;  1R5I D;  1FOX A;  4E7I A;  1FOW A;  3JRH A;  1R4N B;  5B1A H;  4HF2 A;  2E1N A;  5ICE A;  4M72 A;  3OYH A;  4EEF G;  2JRM A;  1XDS A;  5KNL A;  2FBI A;  2PMZ A;  4I0A A;  5C44 J;  2QWW A;  1X2N A;  2ZCW A;  3NRV A;  4I09 A;  2LY2 A;  4DYR A;  1LE8 A;  1X1B A;  2PMH A;  2PMZ N;  3ZQH A;  2LRD A;  3C18 A;  3SZT A;  3ZQF A;  3KEY A;  3C7J A;  3KZZ A;  1PUF B;  3PFI A;  3GTP J;  3OYN A;  2FNA A;  4S04 A;  3ZMD A;  3JRI A;  3RPU D;  4IQJ A;  1G4D A;  4HPQ A;  2EK5 A;  1XG1 A;  1V5G A;  2GOM A;  4BQO A;  2CSO A;  2YPR A;  4RBO A;  4OOI A;  3CJN A;  3Q5F A;  2X6W A;  2ZB9 A;  2ELH A;  3QAH A;  3WGG A;  2WY7 Q;  3DTE A;  5TGT A;  1V5F A;  4DGW B;  4YFK F;  3LMM A;  3PL8 A;  1LDD A;  2LKX A;  3ASN H;  2JA6 J;  3GFI A;  2D2W A;  3GXO A;  4XN3 A;  1NG7 A;  3CCV I;  1X3W B;  1SAN A;  2BOL A;  3K0L A;  1HF0 A;  2CGP A;  3VYU B;  2JQ7 A;  1S7E A;  3I9V 2;  4KT5 C;  4LG3 A;  1KGS A;  4ETS A;  2VB6 A;  3E6C C;  2F5C A;  2UZK A;  1FBQ A;  2M7B A;  3PNT A;  2QQ9 A;  5GAG J;  3L09 A;  5J4V A;  2IP2 A;  2OCC H;  3L2C A;  2W7N A;  2JUG A;  5L3B A;  4OAZ A;  1RC9 A;  1D8K A;  4DIQ A;  4BXU A;  3IH3 A;  3F23 A;  3CF2 A;  1U78 A;  1MDM B;  5HS9 A;  3CF5 F;  1AOY A;  1HKS A;  1D5Y A;  1F5T A;  1VND A;  1D0Y A;  3HHH A;  2R0Q C;  2VOO A;  3EYI A;  1RIO H;  2DT6 A;  4WXH A;  1SVO A;  1KQ9 A;  2CV0 A;  4Y3O A;  3HHG A;  1I39 A;  1A5J A;  1YJW I;  1X3Z B;  3GCM A;  4EJV A;  2VKD A;  4XLA A;  1ZGJ A;  4ZYA A;  3BR0 A;  1R5H A;  1QZY A;  2CV2 A;  3TO6 A;  4II3 A;  4D5F A;  4IHX A;  2KFD A;  5E20 A;  2AO9 A;  4HQM A;  2XGD A;  2XF5 A;  1OR7 A;  3LQR A;  2XAH A;  4IHV A;  1YE9 A;  2ACJ A;  2L54 A;  4ESB A;  4L5J A;  1SFU A;  2FOW A;  2IS2 A;  3H3Z A;  4KMU X;  1MKM A;  2DOD A;  3KZY A;  1B9N A;  4BL0 B;  3JAM K;  4Q4Z F;  4BEH A;  4KN4 X;  5DM6 F;  2V9P A;  4E70 A;  1JUP A;  3WE2 A;  2MLG A;  3KFW X;  1YLF A;  3BTJ A;  2FXA A;  2W48 A;  2ESH A;  1WFX A;  3WTW C;  4BKX A;  2M3A A;  1IRG A;  1D1A A;  3LSK A;  2ZKZ A;  4WX9 A;  1VFC A;  2ECB A;  3IUO A;  2LY9 A;  3OL4 A;  4FAS D;  5J8F A;  1IF1 A;  1VF9 A;  3JRC A;  2DAO A;  3DWL E;  1ZG3 A;  4A3G J;  1RZ4 A;  4C3I J;  4XKW A;  2HVR A;  1SAX A;  1MSF C;  2P5K A;  1ZG1 A;  3TO7 A;  4B48 A;  4Q48 A;  4AWX B;  4CYC B;  4YIR X;  5B5E C;  4A6D A;  5K5O A;  1OFC X;  4G6D A;  2DDB A;  4ZYD A;  4X6A J;  1XB4 A;  1UJ8 A;  2ZBK A;  2M8E A;  5E3M A;  2OUM A;  1IRX A;  3ML6 A;  1OCO H;  2EZI A;  2FRH A;  2PN6 A;  5DS9 A;  1VQM I;  2M0C A;  3DTK A;  1UHW A;  2E19 A;  2VE8 A;  3AG1 H;  3Q9S A;  2R5Y A;  3CLQ A;  3HUG A;  3HRM A;  1REP C;  1W5T A;  1P4W A;  4IF4 A;  1ZLK A;  2EIJ H;  3HTS B;  3EUH A;  3HRU A;  3HIF A;  3P9C A;  3LNQ A;  3Q9V A;  3WOD F;  4RLQ A;  2GM4 A;  2PX9 A;  2GQQ A;  3O8H A;  2JVH A;  4HF1 A;  2HQN A;  1FC3 A; 
#chains in the Genus database with same CATH homology
 4M3F A;  4QSH A;  4MIM A;  5JLW A;  3JRG A;  1HDP A;  5K7F A;  2EQR A;  2XRL A;  2D5V A;  3G1L A;  2XGE A;  5BNG A;  3A01 A;  2NS8 A;  2XPV A;  2NOG A;  5FKM A;  4FCY A;  4JX6 A;  2VI6 A;  2NVY J;  4MO7 A;  1ZTR A;  1UHS A;  1P7I A;  1GV2 A;  4JP0 A;  1NTC A;  3W6V A;  1VI0 A;  5J3L A;  3S1M J;  1Z0X A;  5EYR A;  2VKV A;  3G1O A;  1JGG A;  2VPR A;  1ZR2 A;  4RDU A;  1ETX A;  2YUS A;  1ZK8 A;  1GDT A;  1W0U A;  1JKR C;  1AHD P;  2LR8 A;  5M5Y J;  2MW8 A;  2FQ4 A;  4GFB A;  1MH4 A;  2AHQ A;  2CQQ A;  5M5W J;  3GTM J;  2YU9 J;  2K9Q A;  1QPI A;  2TRT A;  1OCT C;  1FEX A;  5HOD A;  1E3O C;  4JX4 A;  3L1P A;  3BG5 A;  3BQZ A;  1ETK A;  3CQZ J;  2XPW A;  2CUF A;  1TWF J;  1OCP A;  1K61 A;  5FKN A;  1ZQ3 P;  2DMP A;  5E3O A;  4AYB N;  1JTX A;  1HLV A;  2FJ1 A;  3LSR A;  3RZD J;  2XB0 X;  4C2M J;  2O9L A;  3HOW J;  2WAQ N;  1MNM C;  5J1R A;  5IYC J;  3HOY J;  2JJ7 A;  2R93 J;  3GTG J;  1Z77 A;  1IDY A;  1XC5 A;  1TC3 C;  1FIP A;  4JYK A;  1SFO J;  1IRZ A;  1ETO A;  1X58 A;  2IAI A;  2WB1 N;  4XRS G;  3GTK J;  2OPT A;  3BG3 A;  2FX0 A;  3TW7 A;  1JTY A;  4BXX J;  1FTZ A;  2JA7 J;  4XRM A;  4D7N A;  1ETW A;  1AKH B;  3GBG A;  2GBY A;  3GTO J;  4BBR J;  1IUF A;  2O7O A;  4M6V A;  5M3F J;  1IV6 A;  1CQT A;  1RES A;  1T56 A;  5F0F A;  3S1Q J;  2ID3 A;  1W0T A;  4IEJ A;  1YRN A;  1TWG J;  3HOU J;  1HOM A;  2EZL A;  2HDD A;  5M5X J;  3HEF A;  3S14 J;  3BTI A;  3MN2 A;  5C4J J;  1P7J A;  1NK2 P;  3B6A A;  1POG A;  4A3I J;  2CJJ A;  4DZJ A;  1LFB A;  2JA5 J;  1A6I A;  2P81 A;  2OF7 A;  3ZQI A;  3O8G A;  4AC0 A;  2Y31 A;  3A01 B;  1JKQ C;  2EBI A;  3H3V K;  1B8I A;  1OJL A;  3C2B A;  5K7Z A;  3TED A;  3I4M J;  5EF6 A;  5IP9 J;  1JUM A;  1WI3 A;  2DMQ A;  1ZKG A;  1QVU A;  2WV1 A;  1U9O A;  4BY7 J;  2LK2 A;  4B1R A;  2Y30 A;  2JA8 J;  2CU7 A;  3ZQL A;  4A3L J;  1MH3 A;  2ECC A;  2DA3 A;  5GPC A;  3JRD A;  1MBK A;  1MBG A;  2CQX A;  3BT9 A;  5M3M J;  1FTT A;  5IP6 A;  3FK6 A;  2DMU A;  2Y9Z A;  3JRE A;  1ZR4 A;  2N8G A;  5C4X J;  3BR2 A;  2JK3 A;  4X1E A;  5EZG A;  1FIA A;  2DA7 A;  2ID6 A;  3HB9 A;  4BY1 J;  3FIW A;  3TP0 A;  2DMN A;  3IH2 A;  3HOZ J;  3HGG A;  2X9D A;  1Y1W J;  2R5Y B;  4S0H B;  4A3K J;  3CMY A;  2CUE A;  4DZP A;  5FLV A;  2Y2Z A;  1RPW A;  2HYJ A;  2LP0 A;  2NS7 A;  1IJW C;  2NVQ J;  2JN6 A;  2XPU A;  2LD5 A;  1WPK A;  2L7F P;  2GLO A;  5JLX A;  4FTH A;  5J1Y A;  2E2J J;  2DJN A;  4UUS A;  1F43 A;  1H89 C;  2DA2 A;  2B63 J;  5GPA A;  4C3J J;  4FIS A;  1HDD C;  4DW6 A;  2E2I J;  2EH3 A;  2CRG A;  1DU6 A;  1BJZ A;  3OSG A;  1ETY A;  2KDZ A;  5FLM J;  4Y52 J;  3Q0V A;  2VUM J;  3MVP A;  2K9N A;  4A69 C;  1WH5 A;  2X48 A;  4AUX A;  1WCM J;  4M3E A;  2HOA A;  1IDZ A;  3CCY A;  1I6H J;  4A93 J;  1ZGW A;  2H8R A;  1TWH J;  3RQI A;  2DA6 A;  3SJM A;  3HGY A;  2EZH A;  2HQ5 A;  3FK7 A;  3GTQ J;  3D1N I;  2ELK A;  1QVT A;  1R9T J;  9ANT A;  5DTD A;  4FE7 A;  1O4X A;  2O8K A;  2HOS A;  3RZO J;  1QRY A;  4MFE A;  4UUT A;  3S2D J;  1GVD A;  3SDG A;  1RR7 A;  2DA5 A;  1IC8 A;  3BR1 A;  3Q0W A;  1IG7 A;  1U8B A;  1WGX A;  3QPS A;  4QIW N;  5IYB J;  5K7H A;  1BW5 A;  4DYC A;  1BL0 A;  1MSE C;  3VPR A;  3M3Y J;  3F0C A;  4B3A A;  4ABZ A;  1JKP C;  2R5Z A;  1JJ8 C;  4HNV A;  5EZH A;  2M34 A;  3DEW A;  3PM1 A;  3JRA A;  4IHY A;  4L5E A;  3K7A J;  2XGC A;  3Q3S A;  4XID A;  3ZQG A;  1YRN B;  1UG2 A;  4XRS A;  1Y1V J;  4V2F A;  2M8G X;  1ENH A;  5EG0 B;  2M2E A;  3BG9 A;  3BR5 A;  2ME6 A;  5EGO A;  1ITY A;  1MBE A;  2L0K A;  2MG4 A;  2KT0 A;  3HBL A;  1AKH A;  2DTZ A;  2HXI A;  3FIS A;  2DN0 A;  2K9S A;  4A3M J;  1MBF A;  1PUF A;  2LFB A;  1F36 A;  4BBS J;  4NDL A;  2LTP A;  2XB5 A;  2R5Z B;  5EEA A;  3Q0U A;  3G1M A;  4M3G A;  4A3B J;  1I3Q J;  2COB A;  3HOV J;  1EF4 A;  2HI3 A;  5EDN A;  2H1K A;  2L9R A;  4A3E J;  5E3L A;  3HKZ N;  3FKI J;  3TP3 A;  5FJ8 J;  5F1J A;  3LSJ A;  2G0E A;  1RKW A;  3RKQ A;  4QTR A;  4MFD A;  4A3D J;  1ORK A;  2HOT A;  3JRH A;  1TWA J;  4EEF G;  2HXO A;  2XSD C;  5C44 J;  1X2N A;  4DYR A;  1LE8 A;  3S1R J;  3M4O J;  2PMZ N;  3ZQH A;  3ZQF A;  3LSP A;  2L7Z A;  3IV5 A;  1PUF B;  3LSG A;  3GTP J;  3BTC A;  3JR9 A;  1AU7 A;  3JRI A;  5FKK A;  1XG1 A;  1GV5 A;  3GTL J;  1ETQ A;  2L7M P;  3E7L A;  3ZOB A;  2X6O A;  4W1U A;  4RBO A;  5IP7 J;  3IH4 A;  4I6Z A;  1NK3 P;  3PO2 J;  1JT0 A;  2ZB9 A;  2Y9Y A;  1BW6 A;  1APL C;  4UUS B;  2K40 A;  3BR6 A;  1BA5 A;  3A03 A;  2LKX A;  4M3B A;  4G12 A;  5FKO A;  2JA6 J;  5E3N A;  3S1N J;  2LLK A;  3MKL A;  1SAN A;  3CDL A;  3HM5 A;  1HF0 A;  1Q1V A;  5F08 A;  2LVS A;  1S7E A;  4J19 A;  4MLO A;  1H8A C;  2DA1 A;  2FD5 A;  2E1O A;  2TCT A;  3PO3 J;  1JKO C;  3GTJ J;  4V2G A;  5F0H A;  3WHB A;  3OSF A;  3IH3 A;  4A3J J;  3BR3 A;  4DYQ A;  1U78 A;  4M3D A;  1WH7 A;  5IYD J;  5IOZ A;  3I4N J;  1D5Y A;  5F27 A;  1ETV A;  1VND A;  3HOX J;  2R0Q C;  4FE4 A;  3SFI A;  3BQY A;  2JWT A;  3S15 J;  5F04 A;  3WHC A;  3UKG A;  1A5J A;  3TW6 A;  1GUU A;  3BR0 A;  1B72 B;  1B72 A;  4D5F A;  4IHX A;  1RKT A;  4C3H J;  1K83 J;  1JJ6 C;  3LOC A;  3JRF A;  2AO9 A;  2XGD A;  4IHV A;  2NVX J;  2RAE A;  3S2H J;  1TWC J;  5J1U A;  2NVT J;  3DCF A;  4D7M A;  2DMT A;  1I50 J;  3BTL A;  4D5C A;  4LOC A;  5GP9 A;  1JUP A;  1JT6 A;  2IEK A;  5C3E J;  1H88 C;  1FJL A;  3BTJ A;  2W48 A;  4JX5 A;  2JMW A;  4BKX A;  3NAU A;  2R92 J;  5IPA A;  1VFC A;  2ECB A;  2LY9 A;  5F0C A;  1VF9 A;  2MGQ A;  3JRC A;  3S17 J;  4A3G J;  3QQA A;  3QPL A;  4C3I J;  2YS9 A;  2R7Z J;  4A3C J;  1MSF C;  2VKE A;  1XS9 A;  1MBJ A;  3OOU A;  1UMQ A;  2E2H J;  1JUS A;  5IOY A;  4CYC B;  2ME0 A;  4CYC A;  1OFC X;  4XK4 A;  3HDD A;  1MBH A;  2IBD A;  4X6A J;  3ZQC A;  4IHW A;  5E3M A;  4Y7N J;  2EZK A;  2MSY A;  3B6C A;  1HCR A;  2EZI A;  5FKL A;  1LE8 B;  4I76 A;  5DS9 A;  2M0C A;  2E19 A;  3A02 A;  4B4C A;  1B8I B;  1X2M A;  3H0G J;  2M9H A;  3S16 J;  2R5Y A;  3JRB A;  4A3F J;  1T33 A;  1U9N A;  3NAR A;  1RET A;  2Y0S N;  4W97 A;  1G2H A;  2QF7 A;  1GT0 C;  2I10 A;  3K2A A;  3LNQ A;  1LFU P;  2GM4 A;  1IGN A;  3OIO A;  2QCO A;  3O8H A;  5EGO B;  5EG0 A;  1DU0 A;  4XIC A;  2DA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...