3O3KA

Crystal structure of af1382 from archaeoglobus fulgidus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
ERIKLLFKEKALEILMTIYYESLGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECELEGRTKIIRLTDKGQKIAQQIKSIIDIMEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AF_1382
publication title Structure of the Archaeoglobus fulgidus orphan ORF AF1382 determined by sulfur SAD from a moderately diffracting crystal.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 28
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3o3kA00
5IT9Z 3BZ6A 4KUMA 5DYMA 1G4DA 1IRGA 2DPUA 2GZWA 1KU2A 3TO9A 3C1DA 4AIJA 1TQPA 1TW3A 2LDUA 2F2EA 3K1PA 2H6BA 1J7KA 3KP5A 2R3SA 1HW5A 1P4AA 2ISZA 2Y75A 2Z3YA 1S6LA 4QWQA 2IT0A 1SD6A 5DUIA 4CDGA 3WTVC 3LQQA 1GHCA 1R5HA 4KICA 5D4SA 1H9TA 4I0AA 2P8TA 2NNNA 2CYYA 4HF1A 4KN7X 2F5FA 3RPUA 4KMFA 1ONVA 3BY6A 3GFLA 1ZRFA 3R0JA 4P55A 2IJLA 5DCMB 5HLHA 3CO6C 1ZGAA 2IA2A 1XMAA 2ADUA 3R60A 2E1CA 3R0AA 1K6OA 3KLNA 4S04A 3EUHA 2HYFA 3RKWA 2EFQA 2WTEA 4OU0A 3TDZC 4XBFA 1B6AA 2A5YB 3FMSA 3ERED 1R23A 3FXQA 5KK1A 3V8JA 1U5TA 4RGSA 1BC7C 3KP2A 4HZFA 3R61A 1T2KA 1HSTA 3EQLF 2D1VA 3B73A 1F4KA 1B9MA 4B8XA 4PGGA 4XSXF 3HSEA 4EJWA 3F6OA 1KU7A 1ZGJA 2P7VB 4AIHA 4KN4X 3I0TA 2XGXA 3VODA 5CJ9A 2QQ9A 4P9UA 4XSZF 4OIPF 4MEYF 2HOEA 4AD9A 2XKPA 2ESNA 3U9GA 2IPQX 4A6EA 4KT5C 3SZPA 4LLNA 2XHKA 3ULQB 2XIGA 2HKOA 3MEXA 2CFXA 5EEHA 1OYYA 1RNLA 2XAFA 3OV8A 1HBXG 4G94A 4YFNF 4I09A 4WCGA 4HA8A 3WU0A 2XAHA 2BE5F 2RQPA 1LDJA 4CXFA 4LB5A 1U5TB 4RAZA 2KIMA 3FM5A 1U3EM 1ZYRF 1S7AA 4LFUA 5CYVA 3O6BB 2AS5F 2YR2A 2P6TA 2VXZA 5JI6A 4P96A 1G3TA 4UUVA 4K2EA 1F9NA 2FMYA 2CGPA 1W5TA 2HR3A 4HF2A 1S29A 1PP8F 2HKXA 5D4RA 4O3MA 1L3LA 5ICGA 3L9FA 1J2XA 4RGRA 4A6DA 4I0BA 1TBXA 2FEZA 1BI3A 1ZG3A 3KZZA 1T38A 2EA4A 2WV0A 1YG2A 1BM9A 1XDUA 1BIAA 4ON0A 3DPTA 1J0RA 2PFBA 3B02A 2COMA 5BS6A 1LB2A 2DBBA 5BPDA 2OBPA 2AXLA 5L3DA 3U1DA 3GFMA 4P5OA 1BC8C 1DPRA 5IT9K 2QYOA 2ZO4A 3P7NA 2FU4A 2HTJA 3RI4A 3CUQC 3JSPA 1USSA 2HWVA 4HQMA 1D8JA 3DXJF 2VBZA 2STWA 2HTSA 1XGMA 1UB9A 1JHHA 2QM3A 4UVCA 2V1XA 1HW2A 2STTA 2Z9OA 3MQ0A 2FMLA 1ZG5A 2WC2A 3M9AA 2V1DA 5K5QA 4EM2A 3WTWC 4UV9A 1HQCA 2DO7A 4ESFA 3HOTA 4IJAA 1S3JA 5LHIA 2FSWA 4RGXA 1R00A 2RVCA 3HRUA 1HXDA 5L3GA 2K7LA 3J81Z 4M72A 2VBWA 4I7HA 2GAUA 2HZTA 1ZH5A 5HS9A 4N0BA 2W25A 5FD6A 2FNAA 2G7UA 4UV8A 5DD4A 3GXOA 3KEOA 5K1YA 3P9IA 2YX4A 1KU3A 3WTYC 2P5KA 1Y0UA 2D45A 4D0PA 2FBIA 1O7LA 2OD5A 4LMYA 4EQQA 4EJVA 4Y15A 4MTEA 1YIOA 2MD5A 1FC3A 1LJ9A 4IHSA 2CO5A 3QRFF 4R79A 1O3QA 3HTUA 4OOIA 4FT8A 4L9TA 3E3VA 1O3SA 1QGPA 2EV5A 2VODA 2IP2A 2Z5UA 3WTTC 3V7CA 2QWWA 3BJ6A 2Z33A 3GZ5A 2ZMEB 4ENMA 5BOXA 3M8FA 2HEOA 2FF4A 4NQWA 4RGUA 2RGVA 2ZFWA 3MCZA 3TGNA 4P9FA 4WXCA 4PZJA 1A04A 5D5UB 2W85A 1E2XA 4KMUX 2MH2A 2DPDA 3E6BA 1TLHB 3ZMZA 3VB2A 2HFHA 5BQTA 2KIFA 2KJBA 1J5YA 4RS8A 4XLPF 3GYHX 1VTNC 3ISPA 4JQFA 3I64A 3FWEA 2FE3A 2ZXJA 2XV4S 2RDPA 3GF2A 1Z91A 1R36A 1W4MA 4BH9A 4CHUA 3K9TA 4GCVA 1FOKA 3MFKA 1R1UA 2IRFG 4M9SA 1I5ZA 5H6QA 1G3YA 3RKXA 2GQQA 3T8TA 2FNPA 1FYLA 4YIIA 2L54A 5CVRA 1BOAA 1T6SA 3JTHA 4ZYGA 3KLOA 5CVUA 1KYZA 1XB4A 1IN8A 3LAJA 3IL2A 2FOKA 1UHMA 1LDKB 1I1GA 2XAGA 4G6DA 2ZBKA 4TV7A 2M45A 4GXOA 2FA5A 3EYYA 3V8LA 2NNYA 3DQVC 4R1HA 4U7DA 1LNWA 2GWRA 2J5PA 4YG2F 1CF7B 1QZZA 3GUDA 4MHGA 4ASNA 4Q4ZF 5FD5A 1TW2A 5CVVA 4JK1X 2RV8A 3M1EA 3DEUA 1YQAA 3Q9SA 5HLGA 3F8CA 1MDMA 3JSOA 3ZPLA 5ILVA 2EV6A 2M5WA 1FBUA 5DV5A 1RUOA 2MLGA 2DAOA 3H3ZA 5HDGA 3GZ6A 1I6XA 1XDSA 1Z6TA 2NAZA 4U88A 3ZMSA 4KIBA 5FO5A 2UXXA 2C6YA 5HOOA 2QLZA 4GGGA 3WGGA 4G7HF 1E17A 3K0LA 3S2WA 1ZREA 4HX7A 3ZP5A 1YYVA 1MKMA 1RIOH 3T8RA 4NHJA 2M87A 3BPXA 4MQVA 2EV0A 3WGHA 2DW4A 4ZYHA 3H92A 1UFMA 3L7WA 2IVMA 3E6DA 3ZMVA 1MJBA 4IPAA 5FFZA 5K5RA 1IUYA 3TO7A 1B1BA 4YIFA 4ZZDA 1ZLJA 4M9XA 1WKMA 3ZMTA 3NRVA 4IRIA 2ZCWA 3MZYA 2OA4A 5LEJA 5E1WA 3FX3A 3RPQA 2QQBA 3I5UA 2YPRA 5ED4A 2LSOA 2W24A 2V1UA 2ISYA 1CGPA 1MDMB 3J7AO 3ELKA 4WXHA 5LHHA 2MH9A 4GYIA 3J81K 2FBHA 4OINF 3FF5A 2OQGA 4M6XA 2HQNA 5E8GA 2PBIA 1P4WA 2VT2A 3CJNA 2XASA 2L4AA 4LGWA 3KP4A 2PG4A 5ERIA 3F22A 1R58A 1AWCA 3LAPA 4A12A 4HW0A 2MBFA 5LGTA 4BHBA 5HS8A 3HTSB 4G8XA 5FFXA 3BJOA 2G7HA 3QPHA 3G73A 3QP6A 2JT1A 1BIBA 2HYGD 4A0YA 4IRHA 5ICFA 1O7FA 2BBYA 1SMTA 4UXNA 3GLXA 3SQNA 5ILUA 5AONA 4M73A 2XAQA 3CLOA 3IWFA 4U0YA 3QU6A 1O3TA 3NEUA 4A5NA 4HLYA 2P6SA 3F8NA 3U2RA 1EV7A 5BPIA 4L0YB 1XSDA 2BV6A 5D5VB 4HDUA 3LA2A 3SZTA 1J9IA 1IXRC 1P6RA 4KNYA 4LLGF 3L2CA 3RIRA 2EFPA 5K5OA 1IW7F 4KIFA 3RYRA 3LSTA 3ZN0A 3RTRA 4IRGA 3LA3A 5AIQA 4B09A 1O3RA 3IRRA 3FZVA 3DF8A 4R8HA 1FX7A 1XMKA 1SFXA 5F1RA 1B4AA 2F5DA 3L09A 1Z7UA 3MWMA 2M1BA 1HKTA 1L0OC 1USTA 4PGHA 3C18A 1BN5A 2K4JA 3NQOA 4MQ9F 4HDVA 2V79A 1BJAA 1YTYA 3KEQA 1IRFA 1T98A 3MZHA 4A0ZA 3REOA 1OPCA 1H9GA 1ODDA 1YW7A 1U6GA 3KP7A 3I4PA 2X0LA 5A2QZ 5D8KB 2A6EF 1R1TA 4Z2YA 4FX4A 1B9NA 2K27A 2L4MA 4IHTA 1FSHA 1TQIA 3HSRA 4IVNA 1W5SA 2ZKZA 2CWEA 1YS6A 1R5GA 2DK8A 2GXBA 2NRAC 1TNTA 1B59A 1JHFA 4OIRF 1QO0D 5CLSA 4N9IA 3V8KA 4U0VA 4E70A 5D6EA 2GXGA 4EJUA 3QOPA 3RJPA 3ML6A 2YSRA 4LLLA 3HRTA 1JGSA 4A0XA 5TJJA 2QENA 6PAXA 2CW0F 3PFIA 4F7ZA 4EM0B 1PDNC 5JFRA 3ROUA 2UXNA 3K69A 1MD0A 2YX7A 1D8KA 1HSJA 3M8EA 4KIGA 4M74A 2EFNA 1K78A 5F6FA 3ABUA 2JRTA 5J6XA 2JZYA 1SAXA 1HW1A 3WTXC 2JTVA 4HV6A 3GFIA 1WSUA 1Q1HA 2WWYA 2ZNYA 3HHHA 5H6RA 1KQ8A 2XAJA 3P9KA 1H0MA 4HBLA 1EH8A 3ECOA 2VBXA 1U78A 3JW4A 4KFCA 3WTSC 1Z9CA 1XGSA 1FLIA 2G9WA 1FBSA 2HDCA 4LK1F 5E17F 3DFGA 5D5WB 3DPLC 2VBYA 5E18F 3KP3A 3RYPA 3EYIA 3F72A 4EM1A 5HVQC 2VONA 1W7PA 2O3FA 1D5VA 4N9HA 1XGOA 4ETSA 1C0WA 3GFJA 1K7AA 2P7CB 3KZYA 2Q0OA 1P4XA 4ENNA 1I27A 3FMRA 4MGRA 3ZN1A 3FXRA 1MZBA 1XSXA 2RC4A 4GYGA 1TQMA 1OR7A 5L3FA 1PUEE 4YFKF 1K78B 3RKYA 4EJTA 4Q5SF 2Y0MA 2EB7A 5ICCA 4HAMA 5H20A 4BQAA 2A07F 3W6JB 1G6NA 2PJPA 2MA3A 4ESJA 2XVCA 4EGYA 5D6FA 2DLLA 4Y13A 4LJZF 3WTUC 3PQKA 3GWZA 3F23A 1BI1A 2D1HA 5HDKA 3PQJA 2L01A 2K86A 2O0YA 1HKQA 3V7SA 3KETA 4EGZA 2GIVA 2CSOA 3IKVA 3DP7A 3CUOA 1IN4A 4WXDA 4CO8A 3DV8A 4DQ2A 5FLXZ 1G3WA 1KU9A 4EV0A 1R22A 2KKOA 4AIKA 4L9NA 4I98B 5F64A 1KQ9A 2ACJA 1U5TC 1W7PB 3WU1B 2FXAA 3HRSA 3ZQ7A 1FNNA 3GO5A 1S8NA 3CUQA 4OIOF 3Q5FA 2JSCA 2VT3A 2CG4A 4BXUA 1REPC 5HLIA 4ESBA 4JBAA 2E7WA 4RB0A 3Q9VA 3V7RA 1RZ4A 2UWMA 3D5LA 3M7GA 3HYIA 2EFOA 4WF2A 5CVJA 1IN7A 2DU9A 5DUKA 2VE9A 5A2QK 4U7BA 4XLNF 1W7PD 2E1NA 5J8FA 1XCVA 4ZH4F 1MGTA 2BGCA 4EJOA 1XSVA 4EVIA 4ENJA 2PEXA 1DP7P 4L5JA 1QQIA 1BI2A 3WE3A 3TOBA 1F5TA 2A61A 2FRHA 1UCRA 1YW8A 4ZYDA 1JE8A 3T1BA 4OMZA 4CICA 2LF7A 4HLXA 2PLYA 4L9JA 4PCQA 1ZN2A 3QAHA 3CUQB 1PP7U 5E1ZB 1X3UA 3LQRA 3KE2A 4MNUA 3SHFA 1Z05A 5JR3A 3FXUA 2XUBA 2GA2A 4CYDA 3EDPA 2OZ6A 1FBQA 1XN7A 1R1VA 2EFWA 2OU2A 1IAWA 1GXQA 1XGNA 4G7ZF 5L3CA 4EMSA 3TQNA 1AOYA 1DDNA 1QNTA 1YLFA 3WGIA 2JPCA 1S7OA 3T0YA 2F5EA 1IXCA 4O5VA 1ZRDA 4BAYA 2DFIA 4QLCU 1FP2A 3G3ZA 1FYKA 4CGZA 2A69F 2Z99A 1GXPA 1TNSA 4XRFA 1WRJA 5DCFA 5FGMA 5LLQA 3BOQA 2H94A 4RB3C 2XROA 2LNBA 3EETA 1FPQA 4HF0A 2KRFA 5CVIA 5D5XB 3I59A 3QPTA 4KA4A 1WI9A 3W6KB 1ULYA 2ZJ2A 3F8BA 4LG0A 4L9VA 3JAMZ 1IXSB 2M30A 1I1SA 2PN6A 2DQLA 2A6HF 3KP6A 3K1MA 5IT3A 2MLKA 3ZMDA 3C3WA 2DI3A 1IN6A 2F5CA 3K2ZA 3F8MA 3VOEA 1QPMA 4NB5A 1J59A 1IN5A 3BP8A 1P92A 3ECHA 4G6QA 1ZARA 2RKHA 4KDPA 1SMYF 3WG9A 4M71A 2RNJA 2V9VA 1KGSA 1XD7A 2LKPA 2OAZA 2RN7A 2EWNA 1ZRCA 1FWZA 2W84A 3ABTA 4Y17A 3T5XA 3SXYA 1RUNA 5LBQA 3JTGA 2M8EA 5LGNA 4L5IA 3F3XA 3K1NA 3IRQA 2IW5A 2VOOA 3KFWX 1T0FA 5DEQA 1RI7A 1STZA 4UHTA 1G3SA 3HHGA 2H27A 4BNCA 3E6MA 2L02A 3GVAA 3OOPA 3KCCA 2TDXA 2VC1A 4BHPA 1FYMA 2QZ8A 3CTAA 3I59B 2L3DA 2R7DA 3N97A 3CO7C 5FLXK 1WWXA 5BMZA 4LG0B 1T39A 1MJ9A 3FHZA 3I58A 4HOBA 3H3UA 2J5OA 1V3FA 5ILSA 4L0ZB 1Z1DA 5KVRA 1SFEA 4HX4A 3GEZA 1LDDA 1R7JA 2BEOA 1SD5A 2DK5A 2EA2A 2IA0A 3BPVA 2K4BA 2DTRA 4I2OA 2NS0A 4LB6B 2O6GE 4BYYA 2E7XA 3J80K 1QZYA 2JPBA 3QP5A 1FP1D 4UNOA 2IA1A 2XRNA 3HOSA 2Y48A 3E97A 4MEXF 2UZKA 1JXSA 4G9YA 3VEPA 4Q48A 3L00A 4H0EA 3QU3A 1YS7A 1LQ1A 5LRRA 1EH7A 1U8RA 4OIQF 3IHUA 2KJCA 4I01A 1BBYA 2QQAA 2HGCA 4I02A 5HS7A 4AVPA 4IF4A 5HDNA 3I54A 2B0LA 1OYWA 4PDKA 2ESHA 5JVTA 3E5QA 3IKTA 3CDHA 1IZ1A 2D2WA 2DQRA 4IXAA 4A2UA 5EEGA 2VOPA 1ON1A 3TDUC 2BYVE 3E6CC 1FSEA 1SD7A 2W57A 2R7FA 3BROA 2OQRA 2P5VA 1Z6RA 5ICEA 2H6CA 1FY7A 4U0WA 1D3YA 2VC0A 2HS5A 3C7JA 1HKSA 2HQRA 5LRSA 2QUFA 5E1XA 1ZG1A 1TTYA 1EH6A 4ZZLA 2MC3A 1KA8A 1QBJA 5J8CA 1ZAOA 2CQKA 2ZMEA 3F6VA 4FX0A 2O61A 3GW2A 3I71A 2Q2EA 3V4GA 4GO1A 1F1ZA 3D0SA 4DNCA 5LEKA 4UVBA 2O03A 1NHAA 4A5MA 5DD8A 2A3SA 2VN2A 4HYEA 1WQ2A 3R6SA 2EK5A 1XCBA 3E5UA 1LVAA 1KYWA 4RB2C 4CZZA 3AAFA 5DDGA 5L3EA 2EJRA 3TO6A 3JAMK 2P5LC 3LFKA 3IC7A 1O57A 4FHTA 1FZPB 4KYWA 1OMIA 1OYIA 2H09A 3SFZA 1SFUA 3VFZA 2VE8A 2ZNZA 2X4HA 4AWXB 1IF1A 1MJAA 4WWCA 4UVAA 3HRMA 3BDDA 2ELHA 1YW9A 5D8LB 1DUXC 1U2WA 2QBYA 5E8IA 3DKWA 1SD4A 5TRDA 5E20A 3HUGA 2PMHA 4LK0F 3BWGA 2A68F 4BHCA 3I53A 3HIFA 3F8FA 3MAJA 4LD5A 5AIPA 4OMYA 2PI0A 1LEAA 1CF7A 3E5XA 1OKRA 3O3KA 3N4MA 3R4KA 5L3BA 4G7OF 3ZMUA 3WODF 3IWZA 3LA7A 2DT5A 3HSFA 1ON2A 4RB1A 4ENKA 1YFHA 3TOAA 2P4WA 1K79A 1FT9A 3BJAA 1KQ0A 3F21A 2FBKA 4YFXF 1DPUA 4WX9A 3WTZA 1BI0A 4WK8F 3RDIA 2O8XA 4S05A 2V6CA 2NYXA 2PQ8A 2Q8KA 5LHGA 1LEBA 3J80Z 3LWFA 3P9CA 4RAYA 2LF8A 4M9ZA 2QBYB 2GA1A 3WE2A 5FB2A 1ZHFA 4HV5A 1P2FA 4HQEA 4MTDA 1GVJA 3FM3A 4M6YA 2KIUA 1J75A 2XKOA 2OZUA 1V4RA 2ETHA 3COAC 3TKYA 1ZLKA 5JHUA 1UHWA 4L18B 2FQ3A 4O6JA 1YO5C 2YU3A 2PMUA 5DCMA 4ZYEA 4HX8A 3FMQA 2QVOA 3GX4X 3O2PE 2K02A 5LGUA 4Q47A
chains in the Genus database with same CATH superfamily
4E7IA 5IT9Z 3BZ6A 1BL0A 1TL8A 3FBIB 4KUMA 5DYMA 1G4DA 5TGTA 1IRGA 2DPUA 2DJNA 2GZWA 1KU2A 5EF6A 1TC3C 4M3EA 3TO9A 3RZDJ 1F36A 5JLXA 3C1DA 2A05A 2OCCH 4C2UA 4IL6C 2NVXJ 5LFAA 3IH4A 4AIJA 1TQPA 1TW3A 1WPKA 3OOUA 5GAEJ 3OY9A 2LDUA 4A3MJ 4XIDA 4IHVA 2F2EA 3K1PA 1MBFA 2H6BA 1J7KA 3KP5A 1WJBA 3UNGC 2R3SA 4HSRA 2F4OB 2XGCA 3PSFA 2LK2A 5GPCA 1HW5A 3OYKA 5B5EC 2KL4A 1P4AA 2ISZA 2Y75A 5GAGJ 2Z3YA 1MBEA 4YEJA 2LY9A 2MD0A 1GVDA 1S6LA 4QWQA 5CKTA 2AO9A 1SD6A 2IT0A 2ID6A 1JKPC 1OCTC 3BR0A 5DUIA 4CDGA 5K7HA 5M3MJ 3WTVC 3LQQA 2E2IJ 1GHCA 1R5HA 4KICA 4B1RA 5D4SA 1H9TA 4I0AA 2P8TA 3A1YA 5BNGA 2NNNA 2CYYA 4HF1A 4KN7X 2F5FA 3RPUA 3VYUB 1ONVA 4KMFA 2DMNA 2XB5A 3BY6A 3GFLA 1ZRFA 3CC4I 2VQGA 3R0JA 4P55A 1D5YA 2R4GA 2ZJQF 1I6HJ 2QGUA 2IJLA 4E4HA 1G59A 3GTOJ 2IS6A 2MABA 1BA5A 4AU7A 3VSLA 5DCMB 1U8BA 3ZOBA 3AKZA 5HLHA 4A93J 1MSEC 2BXZA 3CO6C 1B8IB 1SVMA 1ZGAA 3PSIA 1Z21A 1XMAA 2ADUA 2IA2A 4D5CA 3R60A 2E1CA 1WJEA 4N4OB 3R0AA 3LFUA 1X19A 1K6OA 3KLNA 1MSFC 2R93J 4EATA 4S04A 3EUHA 2HYFA 3RKWA 2EFQA 2WTEA 4OU0A 3TDZC 4XBFA 1B6AA 3DWLE 2A5YB 4A3DJ 4PJLA 2EINH 3FMSA 3ERED 3LSJA 4IOAF 3CMMA 1R23A 3FXQA 5KK1A 2NOJB 3V8JA 4BGDA 1U5TA 4RGSA 4NDLA 3KP2A 1BC7C 4HZFA 3R61A 2K5CA 3ABKH 4NNJA 1BJZA 1T2KA 4NC8A 1HSTA 4Y7NJ 3QWLA 3EQLF 2D1VA 1GT0C 2E1MC 3B73A 4OWRB 1F4KA 3GTGJ 2W00A 1B9MA 4B8XA 3JRBA 4PGGA 4XSXF 3HSEA 4EJWA 2ELJA 3F6OA 1X58A 2DMUA 1KU7A 1ZGJA 2ELKA 2P7VB 1W0UA 1E3OC 4AIHA 4L5EA 2HXIA 1SFOJ 4KN4X 3I0TA 2E19A 2XGXA 3VODA 5CJ9A 2EZLA 1ORKA 2QQ9A 2LC2A 4P9UA 3OS1A 3QYFA 4XSZF 4OIPF 4MEYF 2HOEA 1YI2I 1UAAA 4AD9A 2OCEA 2XKPA 2YS9A 2ESNA 3H9GA 3U9GA 2CJJA 2R7OA 3K6GA 2IPQX 4A6EA 3K4JA 4KT5C 3SZPA 2DOAA 1XG1A 4LLNA 1W36D 2HVSA 1A5JA 1QZEA 2XHKA 4W1UA 1MMNA 3ULQB 2XIGA 5CPRB 2HKOA 3MEXA 2CFXA 4XKWA 5EEHA 1OYYA 1MBHA 3ZGKA 1RNLA 4HRIA 4C3JJ 3JRIA 2R7TA 3GZNB 5EDNA 2XAFA 4ABZA 3OR1C 3OV8A 1HBXG 1ZQ3P 4G94A 5EJCA 1SVLA 3PM1A 1P7JA 4P1WA 4YFNF 4I09A 4WCGA 4HA8A 2HDDA 3CC2I 3WU0A 2EBIA 2XAHA 2BE5F 2RQPA 1LDJA 4CXFA 4LB5A 3DU6A 2M9HA 1VQMI 1OISA 1U5TB 2FUG2 4XKBA 3RPUD 5GPAA 1NK2P 3HC7A 4KT6A 4RAZA 2KIMA 3FM5A 3BR2A 4XORA 4C2MJ 4F52A 1ZGWA 1ZYRF 1U3EM 1S7AA 2ZXWH 2NS7A 1YJWI 4LFUA 5CYVA 1ZR2A 1SC7A 2BY0A 3O6BB 3S1NJ 3TEDA 2AS5F 2YR2A 2P6TA 4BQQA 2VXZA 5JI6A 1JT0A 4P96A 1G3TA 4UUVA 4K2EA 1TZLA 2JK3A 3GTJJ 1ZKGA 2LRDA 1YJ9I 1F9NA 2FMYA 2CGPA 4E7KA 1SAUA 3IH3A 2V1NA 1W5TA 2DYSH 2LKXA 1OR7C 2JA8J 1YJNI 2MSYA 2HR3A 3JREA 4HF2A 1S29A 3BG3A 1Y39A 1A36A 4D9JA 3JRHA 2CU7A 2XB0X 2IGMA 2Y2ZA 1PP8F 3W3CA 1VFCA 2HKXA 5D4RA 1ZTRA 2HU9A 5H2FC 4O3MA 2VKVA 1L3LA 3PIPF 5ICGA 3L9FA 1IRXA 1J2XA 2KDOA 4RGRA 1DGWY 4A6DA 4I0BA 4D7MA 4A3CJ 1QVUA 1TBXA 2FEZA 1BI3A 2RNGA 4E7HA 1ZG3A 1H88C 3KZZA 1T38A 5KNLA 2EA4A 1G8XA 1MH3A 3ESWB 3FBNB 2WV0A 4XRMA 4PSXA 1YG2A 1BM9A 3OYDA 1XDUA 1BIAA 2BY3A 2M34A 2K9MA 4DJAA 2LY1A 3J7ZI 4ON0A 3DPTA 5GP9A 3ERMA 3QOEA 1RC9A 1J0RA 3LSKA 2PFBA 4DIQA 3B02A 3M8JA 4BXFA 2COMA 5M5WJ 5BS6A 1LB2A 3OYMA 2DBBA 1AKHB 5BPDA 1FIAA 3EUKL 2OBPA 2AXLA 5L3DA 3U1DA 4DGWB 5C4JJ 3GFMA 3DEEA 3QYBA 4P5OA 1BC8C 1BW5A 1DPRA 2QSGX 2M3AA 5IT9K 4PJJA 4MIMA 2QYOA 2ZO4A 3P7NA 2FU4A 2HTJA 2E34A 1QRYA 2A6TA 4I6ZA 3RI4A 3H3VK 2KPMA 3CUQC 3H0GJ 3JSPA 1USSA 2HWVA 4HQMA 1RR8C 1D8JA 4C2TA 3BQZA 3BZCA 3ABLH 3DXJF 2VBZA 2STWA 4A3GJ 5F0CA 2HTSA 1XGMA 1UB9A 2W7NA 4BY1J 1JHHA 2QM3A 1IC8A 4UVCA 2WB1N 1F43A 2FX0A 2V1XA 3W2AA 5B66C 2LY2A 1HW2A 2STTA 2Z9OA 3MQ0A 2FMLA 5J4VA 3SDGA 1ZG5A 1K6YA 2WC2A 2IXSA 2V1DA 3M9AA 5K5QA 3F0CA 4G6TB 2AHQA 1ETQA 4EM2A 3BCAA 4ZTJA 3WTWC 2X6OA 1JI8A 1T56A 4UV9A 4CUGA 1HQCA 4BBSJ 1U9NA 3IH2A 3BR5A 1UG0A 2DO7A 4ESFA 3H9JA 3HOTA 3OMYA 1ETVA 2LR8A 2VKEA 4IJAA 1S3JA 4LG3A 5LHIA 3CMEI 4A3IJ 2FSWA 4RGXA 3DPUA 3PO3J 3LL7A 1MH4A 1R00A 2RVCA 3HG9A 3RKQA 3S1RJ 2R7UA 4DBQA 3HRUA 2VIXA 1HXDA 5L3GA 4M3FA 2K7LA 5CQGA 3DCFA 4F91B 5KAFC 3J81Z 4M72A 3CJRB 2JMWA 3HGGA 2VBWA 4I7HA 2VXDA 2GAUA 3BTCA 3HZJA 1HA8A 4LIVA 2HZTA 1ZH5A 1RETA 1YX3A 2KQRA 4NBQA 5HS9A 3KPHA 4N0BA 1E0EA 2W25A 1E3PA 1IO2A 5GTHC 5FD6A 2XAUA 2HQ5A 5JLWA 3BT9A 2LLKA 2FNAA 3KX2A 2G7UA 2HOTA 4UV8A 5DD4A 3GXOA 3KEOA 4CCOA 4RBOA 1IV8A 5K1YA 1NK3P 3P9IA 2YX4A 1IV6A 1KU3A 2NVYJ 2XF5A 2YU9J 4IHXA 1LUJB 3WTYC 4FQGA 2P5KA 2JUCA 1GLNA 1Y0UA 2D45A 3S1QJ 4D0PA 1TWFJ 2BZTA 2FBIA 1O7LA 1JKRC 2OD5A 4IHYA 2F5VA 4LMYA 3ABMH 4EQQA 4EJVA 4Y15A 4MTEA 2ECCA 3CLQA 4Y33A 4CYCB 1VQ5I 3S3OA 1YIOA 3BQYA 2MD5A 1FC3A 1LJ9A 1U0JA 1K61A 2WA0A 4IHSA 5J1RA 2CO5A 3QODA 3A0HC 3QRFF 4R79A 1O3QA 3HTUA 3DBHB 4OOIA 4FT8A 4BS9A 4L9TA 2HVRA 3E3VA 1JKQC 1O3SA 4AYBN 2Z2SB 1QGPA 5DM7F 2R7WA 1UG2A 2EV5A 2VODA 2IP2A 3CCEI 2JWTA 2Z5UA 3WTTC 3V7CA 3CCYA 2QWWA 3K7AJ 3BJ6A 2Z33A 1QHHD 3GZ5A 1PJRA 2ZMEB 1TT5B 4ENMA 5BOXA 3OYLA 3S17J 1TWCJ 3PIOF 2Q2EB 3M8FA 2ZXIA 1EJ9A 2TRTA 4XMYA 2ME6A 3W2VA 2DDAA 2HEOA 2CQQA 2FF4A 4NQWA 4FTHA 4RGUA 3S15J 2RGVA 2VJ5A 2ZFWA 3ZQLA 3OR2C 3MCZA 3TGNA 4P9FA 4WXCA 4PZJA 1A04A 5D5UB 2W85A 1E2XA 3TW6A 5TISC 4KMUX 2AQFA 2MH2A 2DPDA 3E6BA 1TLHB 3AL0C 2E36A 3ZMZA 3CJQB 3H0DA 3I4MJ 2LKSA 3VB2A 2HFHA 5BQTA 4BE0A 4RAFA 2KIFA 2KJBA 3GTMJ 2LOOA 2LYCA 1J5YA 4RS8A 4PFPA 4XLPF 3GYHX 1VTNC 3ISPA 4JQFA 2CUJA 3I64A 3FWEA 2E2HJ 4ITVA 2FE3A 2ZXJA 4ZC3A 2XV4S 2RDPA 5JHFA 3SYTA 3GF2A 1Z91A 4PSWA 1R36A 1W4MA 4D1QA 4BH9A 4CHUA 2XF6A 3K9TA 2K9SA 3SEZA 1X4OA 3OL3A 3L2WA 2DA6A 2Z16A 1NG7A 4GCVA 1FOKA 2CV0A 3MFKA 1R1UA 3FXJA 2IRFG 1HDDC 4M9SA 1I5ZA 5H6QA 4KJZA 1G3YA 4XLHA 3RKXA 2GQQA 3T8TA 1PUFB 2FNPA 3Q3SA 1FYLA 4YIIA 3IV5A 2L54A 5CVRA 1BOAA 1T6SA 3JTHA 1S72I 4ZYGA 3KLOA 5CVUA 2DFHA 1KYZA 1XB4A 1IN8A 3LAJA 3RZOJ 3IL2A 3QYEA 4F92B 4OAZA 2FOKA 1UHMA 4RMNA 1LDKB 1I1GA 2XAGA 4G6DA 2ZBKA 4TV7A 2M45A 4LOCA 4GXOA 2DDBA 2FA5A 3BC8A 3EYYA 3V8LA 2NNYA 3DQVC 4R1HA 4U7DA 1LNWA 2GWRA 2J5PA 4YG2F 1CF7B 4IQ4A 2NXNB 1QZZA 3M07A 3GUDA 4MHGA 4ASNA 4E7JA 4Q4ZF 3H9QA 2Y9YA 5FD5A 4NQWB 1TW2A 5CVVA 2G0EA 2MW8A 2RV8A 4JK1X 1QA6A 3M1EA 1T0FC 2JN6A 3DEUA 1X1DA 2M4GA 4HPQA 1YQAA 3Q9SA 5HLGA 3MKWB 2VJ4A 3F8CA 1DP3A 4CCLA 4ZDLA 1WZ2A 1MDMA 3JSOA 3ZPLA 5ILVA 1X1AA 3OYFA 2HPMA 5IP9J 2EV6A 1Z7LA 2M5WA 1OCCH 1YIJI 1FBUA 4DYQA 5DV5A 5C44J 1RUOA 2ZFUA 2CW7A 2E1OA 3QPSA 4B4CA 5M5XJ 4ZJZA 2DA5A 2MLGA 3DKYA 2DAOA 2DMTA 4BQNA 3H3ZA 1QU3A 5HDGA 1LKXA 3CCSI 3GZ6A 2OC6A 1I6XA 1LFPA 1MBKA 1XDSA 2GOMA 4FCYA 3FIWA 1Z6TA 2NAZA 4U88A 3ZMSA 4KIBA 1IUFA 2CFOA 5FO5A 4UUSA 5EGOA 2UXXA 2C6YA 4CA0A 3CCQI 5HOOA 3I9V2 3I3LA 5HNHA 2QLZA 3J7AY 1LVKA 2E35A 4GGGA 4X6AJ 3WGGA 2DA2A 4G7HF 1E17A 3K0LA 5FKOA 3S2WA 1ZREA 1AU7A 3FISA 4C30A 4HX7A 9ANTA 1N77A 3ZP5A 4DZPA 1YYVA 1MKMA 3QQAA 3T8RA 1RIOH 4NHJA 2M87A 3BPXA 3AG4H 3LSRA 4MQVA 2L7MP 2EV0A 2R7SA 3WGHA 2DW4A 4ZYHA 2CS3A 1X1BA 3SEQA 4B48A 1FTZA 2E5ZA 3K70C 2CQNA 3H92A 1S7EA 1FEXA 1UFMA 3L7WA 1KONA 2PMZN 2IVMA 3E6DA 3OS2A 3ZMVA 2LH9A 2K3PA 1MJBA 4IPAA 5FFZA 5K5RA 1R4MB 1IUYA 3TO7A 1IG7A 2CUZA 1B1BA 4YIFA 4ZZDA 4DYCA 2X1CA 1ZLJA 4M9XA 3A4CA 1WKMA 3ZMTA 3HOVJ 3LMMA 3NRVA 3M3YJ 1VQ7I 4IRIA 2ZCWA 4LITA 3MZYA 2VL8A 2M7AA 1ETXA 2K85A 2L9NA 2OA4A 2I10A 5LEJA 5E1WA 3FX3A 3RPQA 2QQBA 4CCNA 1X1CA 3I5UA 2YPRA 4BUPA 5ED4A 2LSOA 2W24A 2V1UA 2ISYA 1CGPA 1MDMB 3J7AO 3ELKA 4WXHA 5J1YA 5LHHA 3K4BA 2MH9A 1MNEA 5EG0A 2E60A 4GYIA 3J81K 1V5GA 2FBHA 3AG2H 3FF5A 2HVQA 4OINF 1UELB 2DYRH 2OQGA 1WH7A 4M6XA 2CW8A 3HDDA 1JUMA 2E71A 4BDZA 5E3NA 2HQNA 5E8GA 2PBIA 1P4WA 2VT2A 3CQZJ 3CJNA 1BR2A 3AG1H 2XASA 2L4AA 4LGWA 2Y0SN 3FKIJ 3KP4A 2PG4A 5ERIA 3F22A 1R58A 4HNUA 3ZR8X 1Z0XA 4DBRA 1H8AC 1AWCA 4A3KJ 2DN0A 1T33A 4HG2A 4J00A 3LAPA 1H89C 1R6RA 5EEAA 3U21A 2VPRA 4A12A 4HW0A 4XLCA 4FASD 1R4NB 3K4CA 5FKKA 4ZYAA 2MBFA 5GAHJ 5LGTA 1U9OA 4BHBA 5IP6A 5HS8A 2KRHA 3HTSB 1YE9A 4G8XA 5FFXA 3BJOA 4XN0A 2G7HA 3QPHA 4PJNA 3G73A 3QP6A 3KYDB 2JT1A 1BIBA 2HYGD 4A0YA 4IRHA 5ICFA 1T8IA 4F93B 1O7FA 5IPAA 2BBYA 3JRDA 1SMTA 2L0KA 4UXNA 1ZK8A 3GLXA 3SQNA 4Z6YA 5ILUA 2RREA 4XKCA 2JUGA 4E6KG 1A6QA 1MNMC 5AONA 4M73A 2XAQA 4XLEA 3CLOA 3TBIA 3GTKJ 3IWFA 4U0YA 3QU6A 1VZ0A 1O3TA 3NEUA 4A5NA 4HLYA 3CCMI 3KEYA 2P6SA 3F8NA 3U2RA 1TT0A 1WJDA 3BTLA 1VQOI 5LD2C 1EV7A 3VPRA 5BPIA 3BLYA 5EG0B 4L0YB 1WJ5A 1XSDA 2BV6A 5D5VB 1HCRA 4HDUA 3LA2A 3FXLA 3SZTA 1J9IA 1IXRC 1P6RA 4KNYA 4LLGF 4XLAA 3L2CA 3CF2A 3RIRA 2VLAA 2WB1A 3CMYA 2EFPA 2Z1DA 5K5OA 1IW7F 4HSTA 4KIFA 3RYRA 2XGEA 3LSTA 1SVOA 3ZN0A 3RTRA 1LFBA 4IRGA 2M7BA 3W6VA 3LA3A 5AIQA 3EPZA 5GADJ 1WJCA 5IYBJ 1D1AA 1DQUA 4B09A 2OJED 1O3RA 3IRRA 2BW3A 1MMDA 2DT7B 3FZVA 3DF8A 4R8HA 1FX7A 3VYSB 4JP0A 4RM3A 4E7LA 2O7OA 1D1BA 1UMQA 1XMKA 5E3MA 1PVEA 1OCOH 1SFXA 5F1RA 1B4AA 4PJ0C 2F5DA 2JA5J 3BCBA 3G1OA 1WJAA 3PUBA 4IKFA 1FJLA 3L09A 1Z7UA 3MWMA 2KIQA 2M1BA 5K7FA 1HKTA 2NVTJ 2H1KA 1L0OC 1USTA 1I50J 4PGHA 3C18A 4CSWA 1BN5A 2K4JA 3GTQJ 3BG9A 3NQOA 4MQ9F 1OCPA 2V79A 4HDVA 1BJAA 2HQAA 1N75A 2H8WA 1YTYA 3IUOA 3KEQA 1IRFA 1T98A 3S2HJ 3MZHA 4A0ZA 3REOA 1OPCA 2MGQA 3S93A 2FJ1A 1H9GA 1ODDA 2W82A 1DGRM 1YW7A 1U6GA 1EF4A 3KP7A 2VPLA 2VUMJ 2GBYA 5KCMA 3C2HA 3I4PA 2X0LA 5A2QZ 2X48A 5D8KB 4CZCA 2XRLA 3A0BC 2A6EF 4GDFA 1R1TA 4BACA 2VJIA 1X3WB 4Z2YA 2X51A 4FX4A 3HJEA 3QPLA 2X9DA 1HLVA 1B9NA 2K27A 3CZ6A 1WFXA 2L4MA 4IHTA 2JSPA 2DFEA 4B47A 1FSHA 1TQIA 3HSRA 4IVNA 4XOPA 3TL4X 1W5SA 2K40A 3BZKA 2DTZA 2ZKZA 2CWEA 1YS6A 3ZQFA 3SJMA 1R5GA 2DK8A 3DTKA 1T95A 2GXBA 2ZSIB 2P81A 4HEA2 1SEUA 2NRAC 2CMPA 1TNTA 1B59A 1JHFA 2OF7A 2KLOA 4OIRF 1QO0D 5CLSA 2L5QA 2DA4A 4N9IA 5EYRA 2BW3B 2TCTA 3V8KA 4U0VA 5J47A 1R5ID 4E70A 5D6EA 5FLMJ 2GXGA 3LSMA 3OIOA 4AYBA 4EJUA 5IP7J 1A35A 3QOPA 2IBDA 2KP6A 2XF7A 4CCJA 4C3HJ 4BY7J 3RJPA 3ML6A 3PNTA 3OSGA 2YSRA 3BTJA 2GOXB 3NWTA 3Q0WA 4LLLA 3HRTA 1JGSA 2L9SA 1HDPA 4A0XA 2R5YA 1JJ6C 5TJJA 4Y52J 2QENA 6PAXA 5HLTA 1RRJA 2R7ZJ 2CW0F 3PFIA 3WG7H 3L2RA 4F7ZA 4XN3A 1TWHJ 4EM0B 2HYJA 3OSFA 1PDNC 1X4PA 4IEJA 3ZQHA 5JFRA 1IGNA 1Y6IA 2QF7A 2O9LA 3ROUA 2DT6A 2UXNA 3K69A 1MD0A 3S8PA 2YX7A 2R92J 4BU2A 4QPQA 2M0CA 1D8KA 1HSJA 3M8EA 4RA2A 5JVGF 2F4MB 1WVRA 2ZXHA 4KIGA 4M74A 2EFNA 4UUSB 1K78A 5F6FA 3ABUA 1Q1VA 2ECBA 2JRTA 4XR6A 2E5NA 4IHWA 5F08A 3TP3A 3D5SC 2M8GX 5J6XA 3MD2A 1WH5A 2FOWA 5GTIC 1MIJA 2JZYA 1SAXA 2R7XA 1HW1A 3WTXC 1TWGJ 4RAGA 2OV7A 1VQ6I 3WU2C 2JTVA 5C3EJ 5E79C 4HV6A 4J01A 1X1PA 1V5EA 3GFIA 1WSUA 1Q1HA 1FOXA 2WWYA 2JVGA 2ZNYA 3RQIA 3HHHA 2K9QA 5H6RA 3OYIA 1KQ8A 2XAJA 2DODA 3P9KA 1H0MA 4HBLA 1EH8A 4E7ZA 3ECOA 2VBXA 3OYEA 3JW4A 1U78A 1X3ZB 2EIKH 4KFCA 3WTSC 1Z9CA 1Z3XA 2NVQJ 4N4NB 2EZKA 1XGSA 3RCOA 1FLIA 1JJ8C 2G9WA 1FBSA 1DU0A 2IS1A 2HDCA 3A2KA 3FKJA 4LK1F 3VWBA 1GUUA 4D5FA 5E17F 3BTIA 3JR9A 3DFGA 1JT6A 5D5WB 3DPLC 2VBYA 1O4XA 1D0XA 5E18F 4ZDOA 3KP3A 3RYPA 3EYIA 3F72A 2Q1ZB 3HL2A 2AQEA 2R5YB 4EM1A 5HVQC 2VONA 1W7PA 3LOCA 5IY5H 3HOUJ 2DJIA 2O3FA 3JRAA 2E1MB 1D5VA 4N9HA 2LG4A 2K9NA 2KRCA 3IAM2 1XGOA 2HOAA 4ETSA 1C0WA 3GFJA 2Y9ZA 2O5RA 1K7AA 3MKZA 2P7CB 5FJ8J 3KZYA 2Q0OA 3HKZN 5J3LA 1P4XA 2VB6A 1W36C 1JKOC 4M6VA 4ENNA 3HM5A 1I27A 4J19A 4NC6A 2XPWA 3FMRA 2BXYA 4MGRA 2FD5A 3ZN1A 3FXRA 1MZBA 1QVTA 1XSXA 2RC4A 4GYGA 1TQMA 1OR7A 5L3FA 2VI6A 4XQFA 1PUEE 2KFDA 4YFKF 1K78B 3RKYA 4EJTA 1HF0A 2DOEA 4Q5SF 3OYCA 4BJ5C 3I55I 2Y0MA 2EB7A 3U1KA 3WHCA 4BL0B 5ICCA 4HAMA 1MMSA 5H20A 4BQAA 2A07F 3DU5A 3W6JB 1G6NA 5J40A 2PJPA 3UKGA 2F48A 2MA3A 2HZDA 4ESJA 1POGA 1P9QC 2XVCA 3NWSA 3ZRGA 4AM3A 2X6WA 4EGYA 3H5NA 5D6FA 2DLLA 2XC7A 4Y13A 4S0HB 1FIPA 4LJZF 2DA1A 5J1UA 4A3LJ 3WTUC 3PQKA 3GWZA 3F23A 1BI1A 1JTXA 3ZQQA 4DW6A 4PFOA 2D1HA 1YX5A 5HDKA 3PQJA 2L01A 3CMAI 2K86A 2MFZA 1V55H 3JRGA 2O0YA 1HKQA 2LBFA 3OIQA 3V7SA 3KETA 4XRSA 4EGZA 4A3JJ 2GIVA 2CSOA 3IKVA 3DP7A 3IP4B 3W2WA 3CUOA 2VQCA 4QPOA 5F0FA 1IN4A 2V9PA 4WXDA 2JQ7A 4CO8A 3DV8A 4DQ2A 3FHNA 1KZHA 2DMPA 5FLXZ 1G3WA 3EUHC 1KU9A 4EV0A 3OYAA 1R22A 3DTEA 2KKOA 4AIKA 4IQJA 3K10A 1LE8A 4L9NA 2PMZA 3OYJA 4I98B 2WADA 3L1PA 5F64A 4RLFA 2HPIA 3EUAA 1BW6A 1KQ9A 3F9KA 4QTRA 2ACJA 1VQ4I 1U5TC 1W7PB 4PK4A 2FXAA 3WU1B 3HOYJ 3HRSA 3MVPA 4Y4RA 3ZQ7A 1RKWA 1W0TA 1GV5A 1FNNA 3GO5A 4RDUA 1S8NA 3CUQA 3BR3A 4OIOF 2GM4A 1Y56A 1TWAJ 3Q5FA 2JSCA 4B43A 1D1CA 5F04A 2VKDA 5IYDJ 3OYBA 1FTTA 2VT3A 2CG4A 3FXMA 4BXUA 1REPC 2X1EA 5HLIA 4ESBA 4CCMA 4JBAA 4PUSA 2E7WA 4RB0A 3Q9VA 3V7RA 3CF5F 2CRGA 3OL4A 1RZ4A 3HB9A 4BBRJ 3I4NJ 4DOZA 2UWMA 3D5LA 3M7GA 2DOFA 4KISA 3HYIA 2EFOA 1NTCA 4WF2A 5CVJA 1WGXA 3DBRB 3FK6A 2LREA 4I76A 1IN7A 4U87A 3OYGA 3KZIC 5E3LA 2DU9A 5DUKA 2VE9A 1A6IA 1MMAA 5A2QK 2X85A 1W7PD 4XLNF 2Y0SA 4U7BA 2E1NA 5J8FA 1XCVA 3CD6I 4ZH4F 1QPIA 5M3FJ 1MGTA 2BGCA 3HOZJ 3G6EI 2BHYA 4EJOA 3E0JB 4BJ6C 3B6AA 2GIZA 1ERDA 3S14J 1XSVA 4EVIA 2LBFB 4ENJA 1OCZH 1ETKA 3NAUA 1DU6A 2PEXA 1DP7P 2X1DA 4L5JA 1QQIA 2WAEA 5DS9A 1BI2A 3WE3A 3TOBA 1F5TA 2A61A 2FRHA 2OTLI 3CCUI 3ZQIA 2L9VA 3ZQCA 2ZJPF 1LE8B 1UCRA 2WAQN 3HGYA 1YW8A 4ZYDA 2QSHX 2VASA 2IEKA 1B8IA 1JE8A 3MMYB 2CQ7A 3T1BA 4OMZA 4A69C 2LF7A 4CICA 2K9LA 4HLXA 1VQ8I 5DM6F 2PLYA 2DCEA 1VF9A 5FKNA 4L9JA 1XC5A 4PCQA 3S3NA 1ZN2A 3QAHA 3CUQB 1PP7U 5E1ZB 1X3UA 1Y0NA 3LQRA 3KE2A 4MNUA 3SHFA 1Z05A 5JR3A 3FXUA 2XUBA 2GA2A 3PFYA 2W1OA 4CYDA 3EDPA 3H5AA 2CH0A 2OZ6A 3I56I 1FBQA 1P7IA 2HNHA 2E2JJ 1MBJA 1R49A 1XN7A 1YOVB 3BR6A 1I3AA 1R1VA 2EFWA 2OU2A 1IAWA 2M2EA 1GXQA 1XGNA 2ZC2A 4G7ZF 5L3CA 2OTJI 2I8DA 4EMSA 4AC0A 1Z3YA 3TQNA 1AOYA 1DDNA 1W5CC 3KIOA 2X6YA 2B9SA 1QNTA 1YLFA 3WGIA 2B7EA 2BY2A 2JPCA 1S7OA 3T0YA 2F5EA 1JGGA 3WHBA 3JCUC 1IXCA 3VDXA 4CCKA 4O5VA 2NS8A 1ZRDA 3SDBA 2IAIA 4BAYA 5FRMA 2WBMA 2DFIA 2XPVA 4XOTA 1RPWA 4QLCU 4BXXJ 4JX4A 1FP2A 2W48A 3G3ZA 2PJRA 2VJJA 1FOWA 1FYKA 1YRNA 3CDIA 4CGZA 3G2BA 4Y3OA 2Z99A 2A69F 3A03A 1TNSA 3GBGA 1GXPA 3K4LA 3S32A 1WI3A 1V5FA 4AUXA 2O8KA 1VI0A 4XRFA 1VNDA 2LP0A 2QKMB 1J09A 1WRJA 5DCFA 5FGMA 5LLQA 3BOQA 3B6CA 3DLAA 2H94A 2JJ7A 4RB3C 2XROA 2LNBA 3EETA 1FPQA 4HF0A 1ZELA 2KRFA 5CVIA 5FKMA 1SANA 2XDVA 2MG4A 5D5XB 3HPGA 3I59A 4HNTA 3QPTA 4XK4A 4KA4A 4A3FJ 1WI9A 3AG3H 3A02A 3W6KB 2QA4I 3CP2A 4M3DA 3GTLJ 1ULYA 2ZJ2A 3F8BA 4LG0A 1LFUP 1BR1A 3H1CA 4L9VA 3JAMZ 1QHGA 1IXSB 2M30A 1VQKI 1I1SA 4JYKA 2QCOA 4MFDA 3OYHA 3K4KA 2ZJRF 2PN6A 2OPTA 2DQLA 3GTPJ 2A6HF 2V26A 3KP6A 3K1MA 1OFCX 5IT3A 2MLKA 2A5WA 3OIPA 3ZMDA 2LVSA 3C3WA 2DI3A 3JRFA 4UB8C 3TMOA 4B3XA 1IN6A 2F5CA 1N25A 3K2ZA 2ZB9A 3F8MA 3VOEA 1QPMA 5F0HA 4NB5A 1J59A 1IN5A 2F6CA 1JUPA 4H4KC 4MLOA 4NC7A 4XICA 3DTIA 1VQPI 3BP8A 2BOLA 1P92A 3ECHA 4G6QA 1ZARA 3NARA 4DZJA 2RKHA 4KDPA 1SMYF 3WG9A 4M71A 4FE7A 2RNJA 5IOZA 2V9VA 3OS0A 1ETYA 1KGSA 5IOYA 1XD7A 4ZTFA 1XX5A 3D1NI 3LSHA 2LKPA 2OAZA 2RN7A 3N05A 2EWNA 4UB6C 3G71I 2PJRB 1ACIA 1ZRCA 2ZMEC 1FWZA 2W84A 2BY1A 2L2OA 3ABTA 1YRNB 4Y17A 2R5ZA 5HODA 3T5XA 3LNQA 3SXYA 3CCVI 3H36A 1RUNA 5LBQA 2DA3A 3JTGA 3ZQGA 3PNVA 2M8EA 5LGNA 4L5IA 2WY8Q 3F3XA 3K1NA 3HPHA 3S16J 2QSFX 3IRQA 2IW5A 2VOOA 3DBLB 3KFWX 1W1WE 1T0FA 5DEQA 4KITB 1RI7A 1V54H 3DKXA 1STZA 4UHTA 2CV1A 1G3SA 3HBLA 4XLFA 3HHGA 2H27A 4BNCA 3E6MA 2L02A 3GVAA 3OOPA 3S3MA 3KCCA 2TDXA 4F3QA 2M4KA 3CCRI 3AL0B 2VC1A 4IOCF 4FE4A 1JUSA 2L9RA 5J4YA 4BHPA 3M4OJ 1FYMA 1AHDP 2QZ8A 3OWTA 4II3A 3CTAA 4II2A 5M5YJ 1RESA 3I59B 1D0ZA 2FQ4A 2L3DA 2Y69H 4PJMA 2R7DA 4W97A 2EIMH 3N97A 3CO7C 5FLXK 3UR3C 4BDYA 1WWXA 5BMZA 1YHQI 4LG0B 2UV1A 1T39A 2NVUB 3L2UA 1MJ9A 3FHZA 2CQXA 3I58A 1AKHA 4ZDPA 4XL9A 4HOBA 3H3UA 2J5OA 1V3FA 5ILSA 4L0ZB 3CDLA 1Z1DA 5FRNA 2PX9A 5KVRA 1SFEA 2Y31A 3L2QA 1R71A 4HX4A 3GEZA 1LDDA 1R7JA 2BEOA 1SD5A 2DK5A 1CQTA 2I5UA 2EA2A 2IA0A 4X1EA 2ZSHB 3SFIA 3BPVA 1VQNI 2KDZA 2WY7Q 2K4BA 2ME0A 2DTRA 4I2OA 2JA6J 2NS0A 4LB6B 2B63J 2CUFA 4JX5A 4BYYA 5F1JA 2O6GE 4JOMA 2E7XA 3RQ4A 3J80K 1QZYA 2LD5A 4BKXA 3GMEA 3LSPA 2JA2A 1X2NA 2Y30A 1I3QJ 1WHUA 5DTDA 2JPBA 3QP5A 3J7YJ 1FP1D 3AFHA 3CJTB 4UNOA 2IA1A 2XRNA 3O8GA 5B1AH 4D7NA 3HOSA 2R5ZB 2Y48A 3ZXSA 3E97A 3LSGA 3A01A 3MKLA 4DYRA 3JRCA 4MEXF 2UZKA 2V9KA 4MFEA 2AXTC 3TW7A 1JXSA 4G9YA 2QQ8A 3VEPA 4Q48A 1IDYA 2V4JC 3L00A 2COBA 3K4NA 3CESA 3QU3A 4H0EA 2H8RA 1YS7A 1K4TA 2DXIA 1GV2A 1LQ1A 1IDZA 5LRRA 2L7KA 4G12A 1MMGA 3HKZA 2KZGA 4YRVA 1EH7A 1FMVA 3X2QH 3Q0UA 4YELA 1U8RA 1RKTA 4OIQF 3IHUA 2KJCA 4I01A 5E3OA 1BBYA 2QQAA 1E3HA 5CQEA 2HGCA 4I02A 5HS7A 4AVPA 2W4SA 4IF4A 5HDNA 3I54A 3C2BA 5FLVA 2B0LA 1OYWA 4PDKA 1K83J 3CCLI 2ESHA 1Y8RB 5JVTA 2BVLA 3E5QA 4AVZA 5KHDA 3IKTA 4CH7A 3CDHA 1IZ1A 2D2WA 2DQRA 4IXAA 1ITYA 4A2UA 2XGDA 4IZZA 5EEGA 2VOPA 3L2VA 1ON1A 3TDUC 2GLOA 2BYVE 3E6CC 2LMDA 3C2GA 4BQOA 2VQLA 3D5RC 1FSEA 2OUMA 1SD7A 2W57A 4MO7A 5B1BH 2R7FA 1BOBA 3BROA 2OQRA 1APLC 2D5VA 1YITI 4EEFG 2P5VA 1Z6RA 5ICEA 2H6CA 1X2MA 2HXOA 1D0YA 1FY7A 4RLQA 1Y1WJ 4CYCA 1SFKA 4U0WA 2L7FP 1D3YA 1N78A 2VC0A 2HS5A 3C7JA 3BG7A 2M0MA 1HKSA 3GCMA 2HOSA 3A01B 2HQRA 5LRSA 1A31A 2KMUA 2QUFA 5FROA 2BHZA 2ICWG 2IGKA 4AIDA 4X0GA 3FXKA 3S2DJ 5E1XA 1ZG1A 1TTYA 2EILH 1EH6A 4ANJA 4XKVA 2JRMA 1R9TJ 3SZGA 1ENHA 4ZZLA 2MC3A 1KA8A 2N8GA 2KISA 4B3AA 5J8CA 1QBJA 1ZAOA 2CQKA 2ZMEA 3F6VA 4FX0A 2EIJH 2O61A 1MNDA 1WJFA 1Y1VJ 3GW2A 3I71A 2Q2EA 4JX6A 1Y8QB 3KYCB 3V4GA 4GO1A 1F1ZA 4M3GA 3D0SA 3K70D 2MYSA 2GXAA 4FISA 3BG6A 4DNCA 5LEKA 4UVBA 2O03A 5EZHA 1NHAA 4A5MA 5DD8A 4BE1A 4YIRX 1LPQA 2A3SA 1NH3A 3PNYA 2VN2A 1IJWC 3MZ8A 4HYEA 1WQ2A 3R6SA 2XPUA 2EK5A 1XCBA 2YUSA 3E5UA 1LVAA 1KYWA 4RB2C 2XSDC 5F27A 1XPXA 4CZZA 4UY8I 2P0WA 3AAFA 5DDGA 5L3EA 2EJRA 1ZR4A 3TO6A 3O8HA 3HEFA 3MN2A 3JAMK 2P5LC 2EPFA 3LFKA 3IC7A 3ASOH 1O57A 4FHTA 4E7SA 1FZPB 4IO9F 5IYCJ 4KYWA 1OMIA 4B44A 3DLLF 3CP8A 2X6XA 3PJRA 1OYIA 4XNFA 4GRIA 1EA3A 2H09A 5KAIC 3SFZA 1XTAA 3V42A 4C3IJ 1SFUA 1FMWA 1BR4A 4M3BA 3VFZA 2VE8A 1RR7A 1Z67A 1VQLI 3FK7A 2KZVA 2LTPA 2VQHA 2RQQA 3M1CA 2EZIA 2ZNZA 2X4HA 4AWXB 3PUFA 1IF1A 2MC4A 1MJAA 1OJLA 4WWCA 1B72A 4UVAA 4A3BJ 3MKYB 4UUTA 4XM3A 1PUFA 1UZCA 3BG5A 3HRMA 3BDDA 2ELHA 1YW9A 2V7FA 5D8LB 1DUXC 1U2WA 5EZGA 4RM2A 2EH3A 2WAQA 2QBYA 5E8IA 3DKWA 1SD4A 5TRDA 5E20A 3HUGA 2PMHA 2KT0A 1HC8A 4LK0F 3BWGA 1S5LC 2A68F 4BHCA 3I53A 3HIFA 3F8FA 3MAJA 4V2GA 3H5RA 2IGOA 2F4IA 2HI3A 4LD5A 3HOWJ 5AIPA 4OMYA 2ID3A 2K3FA 2PI0A 2CV2A 4NUBA 1LEAA 3H35A 3OYNA 1CF7A 1IRZA 3E5XA 1OKRA 3O3KA 4BJTA 2JA7J 3N4MA 3R4KA 5L3BA 2IS2A 3KYLA 3K4MA 3ZMUA 4G7OF 1OCRH 1T08B 3WODF 2VKHA 3E7LA 3IWZA 3LA7A 2DT5A 3K2AA 2LFBA 3HSFA 1ON2A 3HXLA 4BEHA 3CCJI 2R0QC 4I99C 3PO2J 4RB1A 5K7ZA 4ENKA 1TP4A 3CC7I 2BVMA 1OLTA 1YFHA 1MW7A 5HNFA 3TOAA 4V19K 2P4WA 4IX7A 3ASNH 1K79A 3BR1A 2R7RA 3FDYA 1FT9A 3BJAA 2HDWA 1KQ0A 3F21A 2FBKA 3ONQA 2H1LA 1UJ8A 4LIUA 5FKLA 3G1LA 3RSNA 4YFXF 1DPUA 2DMQA 4FETA 2QKLB 4A3EJ 1GDTA 1AA7A 4WX9A 3WTZA 3FXOA 1M1EB 1BI0A 4WK8F 5C4XJ 3VSKA 2L7ZA 3RDIA 2O8XA 4S05A 2V6CA 2NYXA 1S9HA 2PQ8A 2Q8KA 5LHGA 1LEBA 3J80Z 4GFBA 2NOGA 1I39A 3LWFA 2V6EA 1B72B 3P9CA 4RAYA 2EZHA 2LF8A 4M9ZA 2R7VA 2UUZA 1HOMA 5EGOB 2QBYB 1MBGA 2GA1A 3GLLA 2RAEA 3HUGB 3WE2A 2JVHA 5FB2A 1FOYA 1ZHFA 4HV5A 2R7QA 1OQYA 1P2FA 4HQEA 1PYVA 1ETWA 4OAYA 1EKEA 4MTDA 1JTYA 4QSHA 1GVJA 2XSJC 3FM3A 4V2FA 1K4SA 3VYRB 2KHMA 1G2HA 4M6YA 3G4SI 1WCMJ 1XS9A 3ZCOA 2KIUA 1J75A 3LSIA 4XRSG 2XKOA 2OZUA 1ETOA 1V4RA 2ETHA 5B3SH 2DA7A 3COAC 3TKYA 1NG6A 1ZLKA 5JHUA 1UHWA 3HOXJ 4L18B 4BEHB 1UHSA 2FQ3A 2WAFA 4O6JA 3VYTB 1YO5C 2YU3A 2EQRA 2PMUA 4BE2A 2DFFA 3TP0A 5DCMA 4ZYEA 3DEWA 3Q0VA 1VQ9I 3E1SA 1Z77A 4HX8A 4C9YA 4F55A 3FMQA 2QVOA 3GX4X 3S1MJ 2CUEA 3O2PE 3IAS2 3PL8A 2K02A 3G1MA 2WV1A 4HNVA 2QEXI 2IS4A 5LGUA 4QIWN 2IGNA 3P5JA 4XONA 4Q47A 1XMXA
chains in the Genus database with same CATH topology
5IT9Z 3BZ6A 4KUMA 5DYMA 1G4DA 1IRGA 2DPUA 2GZWA 1KU2A 3TO9A 3C1DA 4AIJA 1TQPA 1TW3A 2LDUA 2F2EA 3K1PA 2H6BA 1J7KA 3KP5A 2R3SA 1HW5A 1P4AA 2ISZA 2Y75A 2Z3YA 1S6LA 4QWQA 2IT0A 1SD6A 5DUIA 4CDGA 3WTVC 3LQQA 1GHCA 1R5HA 4KICA 5D4SA 1H9TA 4I0AA 2P8TA 2NNNA 2CYYA 4HF1A 4KN7X 2F5FA 3RPUA 4KMFA 1ONVA 3BY6A 3GFLA 1ZRFA 3R0JA 4P55A 2IJLA 5DCMB 5HLHA 3CO6C 1ZGAA 2IA2A 1XMAA 2ADUA 3R60A 2E1CA 3R0AA 1K6OA 3KLNA 4S04A 3EUHA 2HYFA 3RKWA 2EFQA 2WTEA 4OU0A 3TDZC 4XBFA 1B6AA 2A5YB 3FMSA 3ERED 1R23A 3FXQA 5KK1A 3V8JA 1U5TA 4RGSA 1BC7C 3KP2A 4HZFA 3R61A 1T2KA 1HSTA 3EQLF 2D1VA 3B73A 1F4KA 1B9MA 4B8XA 4PGGA 4XSXF 3HSEA 4EJWA 3F6OA 1KU7A 1ZGJA 2P7VB 4AIHA 4KN4X 3I0TA 2XGXA 3VODA 5CJ9A 2QQ9A 4P9UA 4XSZF 4OIPF 4MEYF 2HOEA 4AD9A 2XKPA 2ESNA 3U9GA 2IPQX 4A6EA 4KT5C 3SZPA 4LLNA 2XHKA 3ULQB 2XIGA 2HKOA 3MEXA 2CFXA 5EEHA 1OYYA 1RNLA 2XAFA 3OV8A 1HBXG 4G94A 4YFNF 4I09A 4WCGA 4HA8A 3WU0A 2XAHA 2BE5F 2RQPA 1LDJA 4CXFA 4LB5A 1U5TB 4RAZA 2KIMA 3FM5A 1U3EM 1ZYRF 1S7AA 4LFUA 5CYVA 3O6BB 2AS5F 2YR2A 2P6TA 2VXZA 5JI6A 4P96A 1G3TA 4UUVA 4K2EA 1F9NA 2FMYA 2CGPA 1W5TA 2HR3A 4HF2A 1S29A 1PP8F 2HKXA 5D4RA 4O3MA 1L3LA 5ICGA 3L9FA 1J2XA 4RGRA 4A6DA 4I0BA 1TBXA 2FEZA 1BI3A 1ZG3A 3KZZA 1T38A 2EA4A 2WV0A 1YG2A 1BM9A 1XDUA 1BIAA 4ON0A 3DPTA 1J0RA 2PFBA 3B02A 2COMA 5BS6A 1LB2A 2DBBA 5BPDA 2OBPA 2AXLA 5L3DA 3U1DA 3GFMA 4P5OA 1BC8C 1DPRA 5IT9K 2QYOA 2ZO4A 3P7NA 2FU4A 2HTJA 3RI4A 3CUQC 3JSPA 1USSA 2HWVA 4HQMA 1D8JA 3DXJF 2VBZA 2STWA 2HTSA 1XGMA 1UB9A 1JHHA 2QM3A 4UVCA 2V1XA 1HW2A 2STTA 2Z9OA 3MQ0A 2FMLA 1ZG5A 2WC2A 3M9AA 2V1DA 5K5QA 4EM2A 3WTWC 4UV9A 1HQCA 2DO7A 4ESFA 3HOTA 4IJAA 1S3JA 5LHIA 2FSWA 4RGXA 1R00A 2RVCA 3HRUA 1HXDA 5L3GA 2K7LA 3J81Z 4M72A 2VBWA 4I7HA 2GAUA 2HZTA 1ZH5A 5HS9A 4N0BA 2W25A 5FD6A 2FNAA 2G7UA 4UV8A 5DD4A 3GXOA 3KEOA 5K1YA 3P9IA 2YX4A 1KU3A 3WTYC 2P5KA 1Y0UA 2D45A 4D0PA 2FBIA 1O7LA 2OD5A 4LMYA 4EQQA 4EJVA 4Y15A 4MTEA 1YIOA 2MD5A 1FC3A 1LJ9A 4IHSA 2CO5A 3QRFF 4R79A 1O3QA 3HTUA 4OOIA 4FT8A 4L9TA 3E3VA 1O3SA 1QGPA 2EV5A 2VODA 2IP2A 2Z5UA 3WTTC 3V7CA 2QWWA 3BJ6A 2Z33A 3GZ5A 2ZMEB 4ENMA 5BOXA 3M8FA 2HEOA 2FF4A 4NQWA 4RGUA 2RGVA 2ZFWA 3MCZA 3TGNA 4P9FA 4WXCA 4PZJA 1A04A 5D5UB 2W85A 1E2XA 4KMUX 2MH2A 2DPDA 3E6BA 1TLHB 3ZMZA 3VB2A 2HFHA 5BQTA 2KIFA 2KJBA 1J5YA 4RS8A 4XLPF 3GYHX 1VTNC 3ISPA 4JQFA 3I64A 3FWEA 2FE3A 2ZXJA 2XV4S 2RDPA 3GF2A 1Z91A 1R36A 1W4MA 4BH9A 4CHUA 3K9TA 4GCVA 1FOKA 3MFKA 1R1UA 2IRFG 4M9SA 1I5ZA 5H6QA 1G3YA 3RKXA 2GQQA 3T8TA 2FNPA 1FYLA 4YIIA 2L54A 5CVRA 1BOAA 1T6SA 3JTHA 4ZYGA 3KLOA 5CVUA 1KYZA 1XB4A 1IN8A 3LAJA 3IL2A 2FOKA 1UHMA 1LDKB 1I1GA 2XAGA 4G6DA 2ZBKA 4TV7A 2M45A 4GXOA 2FA5A 3EYYA 3V8LA 2NNYA 3DQVC 4R1HA 4U7DA 1LNWA 2GWRA 2J5PA 4YG2F 1CF7B 1QZZA 3GUDA 4MHGA 4ASNA 4Q4ZF 5FD5A 1TW2A 5CVVA 4JK1X 2RV8A 3M1EA 3DEUA 1YQAA 3Q9SA 5HLGA 3F8CA 1MDMA 3JSOA 3ZPLA 5ILVA 2EV6A 2M5WA 1FBUA 5DV5A 1RUOA 2MLGA 2DAOA 3H3ZA 5HDGA 3GZ6A 1I6XA 1XDSA 1Z6TA 2NAZA 4U88A 3ZMSA 4KIBA 5FO5A 2UXXA 2C6YA 5HOOA 2QLZA 4GGGA 3WGGA 4G7HF 1E17A 3K0LA 3S2WA 1ZREA 4HX7A 3ZP5A 1YYVA 1MKMA 1RIOH 3T8RA 4NHJA 2M87A 3BPXA 4MQVA 2EV0A 3WGHA 2DW4A 4ZYHA 3H92A 1UFMA 3L7WA 2IVMA 3E6DA 3ZMVA 1MJBA 4IPAA 5FFZA 5K5RA 1IUYA 3TO7A 1B1BA 4YIFA 4ZZDA 1ZLJA 4M9XA 1WKMA 3ZMTA 3NRVA 4IRIA 2ZCWA 3MZYA 2OA4A 5LEJA 5E1WA 3FX3A 3RPQA 2QQBA 3I5UA 2YPRA 5ED4A 2LSOA 2W24A 2V1UA 2ISYA 1CGPA 1MDMB 3J7AO 3ELKA 4WXHA 5LHHA 2MH9A 4GYIA 3J81K 2FBHA 4OINF 3FF5A 2OQGA 4M6XA 2HQNA 5E8GA 2PBIA 1P4WA 2VT2A 3CJNA 2XASA 2L4AA 4LGWA 3KP4A 2PG4A 5ERIA 3F22A 1R58A 1AWCA 3LAPA 4A12A 4HW0A 2MBFA 5LGTA 4BHBA 5HS8A 3HTSB 4G8XA 5FFXA 3BJOA 2G7HA 3QPHA 3G73A 3QP6A 2JT1A 1BIBA 2HYGD 4A0YA 4IRHA 5ICFA 1O7FA 2BBYA 1SMTA 4UXNA 3GLXA 3SQNA 5ILUA 5AONA 4M73A 2XAQA 3CLOA 3IWFA 4U0YA 3QU6A 1O3TA 3NEUA 4A5NA 4HLYA 2P6SA 3F8NA 3U2RA 1EV7A 5BPIA 4L0YB 1XSDA 2BV6A 5D5VB 4HDUA 3LA2A 3SZTA 1J9IA 1IXRC 1P6RA 4KNYA 4LLGF 3L2CA 3RIRA 2EFPA 5K5OA 1IW7F 4KIFA 3RYRA 3LSTA 3ZN0A 3RTRA 4IRGA 3LA3A 5AIQA 4B09A 1O3RA 3IRRA 3FZVA 3DF8A 4R8HA 1FX7A 1XMKA 1SFXA 5F1RA 1B4AA 2F5DA 3L09A 1Z7UA 3MWMA 2M1BA 1HKTA 1L0OC 1USTA 4PGHA 3C18A 1BN5A 2K4JA 3NQOA 4MQ9F 4HDVA 2V79A 1BJAA 1YTYA 3KEQA 1IRFA 1T98A 3MZHA 4A0ZA 3REOA 1OPCA 1H9GA 1ODDA 1YW7A 1U6GA 3KP7A 3I4PA 2X0LA 5A2QZ 5D8KB 2A6EF 1R1TA 4Z2YA 4FX4A 1B9NA 2K27A 2L4MA 4IHTA 1FSHA 1TQIA 3HSRA 4IVNA 1W5SA 2ZKZA 2CWEA 1YS6A 1R5GA 2DK8A 2GXBA 2NRAC 1TNTA 1B59A 1JHFA 4OIRF 1QO0D 5CLSA 4N9IA 3V8KA 4U0VA 4E70A 5D6EA 2GXGA 4EJUA 3QOPA 3RJPA 3ML6A 2YSRA 4LLLA 3HRTA 1JGSA 4A0XA 5TJJA 2QENA 6PAXA 2CW0F 3PFIA 4F7ZA 4EM0B 1PDNC 5JFRA 3ROUA 2UXNA 3K69A 1MD0A 2YX7A 1D8KA 1HSJA 3M8EA 4KIGA 4M74A 2EFNA 1K78A 5F6FA 3ABUA 2JRTA 5J6XA 2JZYA 1SAXA 1HW1A 3WTXC 2JTVA 4HV6A 3GFIA 1WSUA 1Q1HA 2WWYA 2ZNYA 3HHHA 5H6RA 1KQ8A 2XAJA 3P9KA 1H0MA 4HBLA 1EH8A 3ECOA 2VBXA 1U78A 3JW4A 4KFCA 3WTSC 1Z9CA 1XGSA 1FLIA 2G9WA 1FBSA 2HDCA 4LK1F 5E17F 3DFGA 5D5WB 3DPLC 2VBYA 5E18F 3KP3A 3RYPA 3EYIA 3F72A 4EM1A 5HVQC 2VONA 1W7PA 2O3FA 1D5VA 4N9HA 1XGOA 4ETSA 1C0WA 3GFJA 1K7AA 2P7CB 3KZYA 2Q0OA 1P4XA 4ENNA 1I27A 3FMRA 4MGRA 3ZN1A 3FXRA 1MZBA 1XSXA 2RC4A 4GYGA 1TQMA 1OR7A 5L3FA 1PUEE 4YFKF 1K78B 3RKYA 4EJTA 4Q5SF 2Y0MA 2EB7A 5ICCA 4HAMA 5H20A 4BQAA 2A07F 3W6JB 1G6NA 2PJPA 2MA3A 4ESJA 2XVCA 4EGYA 5D6FA 2DLLA 4Y13A 4LJZF 3WTUC 3PQKA 3GWZA 3F23A 1BI1A 2D1HA 5HDKA 3PQJA 2L01A 2K86A 2O0YA 1HKQA 3V7SA 3KETA 4EGZA 2GIVA 2CSOA 3IKVA 3DP7A 3CUOA 1IN4A 4WXDA 4CO8A 3DV8A 4DQ2A 5FLXZ 1G3WA 1KU9A 4EV0A 1R22A 2KKOA 4AIKA 4L9NA 4I98B 5F64A 1KQ9A 2ACJA 1U5TC 1W7PB 3WU1B 2FXAA 3HRSA 3ZQ7A 1FNNA 3GO5A 1S8NA 3CUQA 4OIOF 3Q5FA 2JSCA 2VT3A 2CG4A 4BXUA 1REPC 5HLIA 4ESBA 4JBAA 2E7WA 4RB0A 3Q9VA 3V7RA 1RZ4A 2UWMA 3D5LA 3M7GA 3HYIA 2EFOA 4WF2A 5CVJA 1IN7A 2DU9A 5DUKA 2VE9A 5A2QK 4U7BA 4XLNF 1W7PD 2E1NA 5J8FA 1XCVA 4ZH4F 1MGTA 2BGCA 4EJOA 1XSVA 4EVIA 4ENJA 2PEXA 1DP7P 4L5JA 1QQIA 1BI2A 3WE3A 3TOBA 1F5TA 2A61A 2FRHA 1UCRA 1YW8A 4ZYDA 1JE8A 3T1BA 4OMZA 4CICA 2LF7A 4HLXA 2PLYA 4L9JA 4PCQA 1ZN2A 3QAHA 3CUQB 1PP7U 5E1ZB 1X3UA 3LQRA 3KE2A 4MNUA 3SHFA 1Z05A 5JR3A 3FXUA 2XUBA 2GA2A 4CYDA 3EDPA 2OZ6A 1FBQA 1XN7A 1R1VA 2EFWA 2OU2A 1IAWA 1GXQA 1XGNA 4G7ZF 5L3CA 4EMSA 3TQNA 1AOYA 1DDNA 1QNTA 1YLFA 3WGIA 2JPCA 1S7OA 3T0YA 2F5EA 1IXCA 4O5VA 1ZRDA 4BAYA 2DFIA 4QLCU 1FP2A 3G3ZA 1FYKA 4CGZA 2A69F 2Z99A 1GXPA 1TNSA 4XRFA 1WRJA 5DCFA 5FGMA 5LLQA 3BOQA 2H94A 4RB3C 2XROA 2LNBA 3EETA 1FPQA 4HF0A 2KRFA 5CVIA 5D5XB 3I59A 3QPTA 4KA4A 1WI9A 3W6KB 1ULYA 2ZJ2A 3F8BA 4LG0A 4L9VA 3JAMZ 1IXSB 2M30A 1I1SA 2PN6A 2DQLA 2A6HF 3KP6A 3K1MA 5IT3A 2MLKA 3ZMDA 3C3WA 2DI3A 1IN6A 2F5CA 3K2ZA 3F8MA 3VOEA 1QPMA 4NB5A 1J59A 1IN5A 3BP8A 1P92A 3ECHA 4G6QA 1ZARA 2RKHA 4KDPA 1SMYF 3WG9A 4M71A 2RNJA 2V9VA 1KGSA 1XD7A 2LKPA 2OAZA 2RN7A 2EWNA 1ZRCA 1FWZA 2W84A 3ABTA 4Y17A 3T5XA 3SXYA 1RUNA 5LBQA 3JTGA 2M8EA 5LGNA 4L5IA 3F3XA 3K1NA 3IRQA 2IW5A 2VOOA 3KFWX 1T0FA 5DEQA 1RI7A 1STZA 4UHTA 1G3SA 3HHGA 2H27A 4BNCA 3E6MA 2L02A 3GVAA 3OOPA 3KCCA 2TDXA 2VC1A 4BHPA 1FYMA 2QZ8A 3CTAA 3I59B 2L3DA 2R7DA 3N97A 3CO7C 5FLXK 1WWXA 5BMZA 4LG0B 1T39A 1MJ9A 3FHZA 3I58A 4HOBA 3H3UA 2J5OA 1V3FA 5ILSA 4L0ZB 1Z1DA 5KVRA 1SFEA 4HX4A 3GEZA 1LDDA 1R7JA 2BEOA 1SD5A 2DK5A 2EA2A 2IA0A 3BPVA 2K4BA 2DTRA 4I2OA 2NS0A 4LB6B 2O6GE 4BYYA 2E7XA 3J80K 1QZYA 2JPBA 3QP5A 1FP1D 4UNOA 2IA1A 2XRNA 3HOSA 2Y48A 3E97A 4MEXF 2UZKA 1JXSA 4G9YA 3VEPA 4Q48A 3L00A 4H0EA 3QU3A 1YS7A 1LQ1A 5LRRA 1EH7A 1U8RA 4OIQF 3IHUA 2KJCA 4I01A 1BBYA 2QQAA 2HGCA 4I02A 5HS7A 4AVPA 4IF4A 5HDNA 3I54A 2B0LA 1OYWA 4PDKA 2ESHA 5JVTA 3E5QA 3IKTA 3CDHA 1IZ1A 2D2WA 2DQRA 4IXAA 4A2UA 5EEGA 2VOPA 1ON1A 3TDUC 2BYVE 3E6CC 1FSEA 1SD7A 2W57A 2R7FA 3BROA 2OQRA 2P5VA 1Z6RA 5ICEA 2H6CA 1FY7A 4U0WA 1D3YA 2VC0A 2HS5A 3C7JA 1HKSA 2HQRA 5LRSA 2QUFA 5E1XA 1ZG1A 1TTYA 1EH6A 4ZZLA 2MC3A 1KA8A 1QBJA 5J8CA 1ZAOA 2CQKA 2ZMEA 3F6VA 4FX0A 2O61A 3GW2A 3I71A 2Q2EA 3V4GA 4GO1A 1F1ZA 3D0SA 4DNCA 5LEKA 4UVBA 2O03A 1NHAA 4A5MA 5DD8A 2A3SA 2VN2A 4HYEA 1WQ2A 3R6SA 2EK5A 1XCBA 3E5UA 1LVAA 1KYWA 4RB2C 4CZZA 3AAFA 5DDGA 5L3EA 2EJRA 3TO6A 3JAMK 2P5LC 3LFKA 3IC7A 1O57A 4FHTA 1FZPB 4KYWA 1OMIA 1OYIA 2H09A 3SFZA 1SFUA 3VFZA 2VE8A 2ZNZA 2X4HA 4AWXB 1IF1A 1MJAA 4WWCA 4UVAA 3HRMA 3BDDA 2ELHA 1YW9A 5D8LB 1DUXC 1U2WA 2QBYA 5E8IA 3DKWA 1SD4A 5TRDA 5E20A 3HUGA 2PMHA 4LK0F 3BWGA 2A68F 4BHCA 3I53A 3HIFA 3F8FA 3MAJA 4LD5A 5AIPA 4OMYA 2PI0A 1LEAA 1CF7A 3E5XA 1OKRA 3O3KA 3N4MA 3R4KA 5L3BA 4G7OF 3ZMUA 3WODF 3IWZA 3LA7A 2DT5A 3HSFA 1ON2A 4RB1A 4ENKA 1YFHA 3TOAA 2P4WA 1K79A 1FT9A 3BJAA 1KQ0A 3F21A 2FBKA 4YFXF 1DPUA 4WX9A 3WTZA 1BI0A 4WK8F 3RDIA 2O8XA 4S05A 2V6CA 2NYXA 2PQ8A 2Q8KA 5LHGA 1LEBA 3J80Z 3LWFA 3P9CA 4RAYA 2LF8A 4M9ZA 2QBYB 2GA1A 3WE2A 5FB2A 1ZHFA 4HV5A 1P2FA 4HQEA 4MTDA 1GVJA 3FM3A 4M6YA 2KIUA 1J75A 2XKOA 2OZUA 1V4RA 2ETHA 3COAC 3TKYA 1ZLKA 5JHUA 1UHWA 4L18B 2FQ3A 4O6JA 1YO5C 2YU3A 2PMUA 5DCMA 4ZYEA 4HX8A 3FMQA 2QVOA 3GX4X 3O2PE 2K02A 5LGUA 4Q47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 Z;  3BZ6 A;  4KUM A;  5DYM A;  1G4D A;  1IRG A;  2DPU A;  2GZW A;  1KU2 A;  3TO9 A;  3C1D A;  4AIJ A;  1TQP A;  1TW3 A;  2LDU A;  2F2E A;  3K1P A;  2H6B A;  1J7K A;  3KP5 A;  2R3S A;  1HW5 A;  1P4A A;  2ISZ A;  2Y75 A;  2Z3Y A;  1S6L A;  4QWQ A;  2IT0 A;  1SD6 A;  5DUI A;  4CDG A;  3WTV C;  3LQQ A;  1GHC A;  1R5H A;  4KIC A;  5D4S A;  1H9T A;  4I0A A;  2P8T A;  2NNN A;  2CYY A;  4HF1 A;  4KN7 X;  2F5F A;  3RPU A;  4KMF A;  1ONV A;  3BY6 A;  3GFL A;  1ZRF A;  3R0J A;  4P55 A;  2IJL A;  5DCM B;  5HLH A;  3CO6 C;  1ZGA A;  2IA2 A;  1XMA A;  2ADU A;  3R60 A;  2E1C A;  3R0A A;  1K6O A;  3KLN A;  4S04 A;  3EUH A;  2HYF A;  3RKW A;  2EFQ A;  2WTE A;  4OU0 A;  3TDZ C;  4XBF A;  1B6A A;  2A5Y B;  3FMS A;  3ERE D;  1R23 A;  3FXQ A;  5KK1 A;  3V8J A;  1U5T A;  4RGS A;  1BC7 C;  3KP2 A;  4HZF A;  3R61 A;  1T2K A;  1HST A;  3EQL F;  2D1V A;  3B73 A;  1F4K A;  1B9M A;  4B8X A;  4PGG A;  4XSX F;  3HSE A;  4EJW A;  3F6O A;  1KU7 A;  1ZGJ A;  2P7V B;  4AIH A;  4KN4 X;  3I0T A;  2XGX A;  3VOD A;  5CJ9 A;  2QQ9 A;  4P9U A;  4XSZ F;  4OIP F;  4MEY F;  2HOE A;  4AD9 A;  2XKP A;  2ESN A;  3U9G A;  2IPQ X;  4A6E A;  4KT5 C;  3SZP A;  4LLN A;  2XHK A;  3ULQ B;  2XIG A;  2HKO A;  3MEX A;  2CFX A;  5EEH A;  1OYY A;  1RNL A;  2XAF A;  3OV8 A;  1HBX G;  4G94 A;  4YFN F;  4I09 A;  4WCG A;  4HA8 A;  3WU0 A;  2XAH A;  2BE5 F;  2RQP A;  1LDJ A;  4CXF A;  4LB5 A;  1U5T B;  4RAZ A;  2KIM A;  3FM5 A;  1U3E M;  1ZYR F;  1S7A A;  4LFU A;  5CYV A;  3O6B B;  2AS5 F;  2YR2 A;  2P6T A;  2VXZ A;  5JI6 A;  4P96 A;  1G3T A;  4UUV A;  4K2E A;  1F9N A;  2FMY A;  2CGP A;  1W5T A;  2HR3 A;  4HF2 A;  1S29 A;  1PP8 F;  2HKX A;  5D4R A;  4O3M A;  1L3L A;  5ICG A;  3L9F A;  1J2X A;  4RGR A;  4A6D A;  4I0B A;  1TBX A;  2FEZ A;  1BI3 A;  1ZG3 A;  3KZZ A;  1T38 A;  2EA4 A;  2WV0 A;  1YG2 A;  1BM9 A;  1XDU A;  1BIA A;  4ON0 A;  3DPT A;  1J0R A;  2PFB A;  3B02 A;  2COM A;  5BS6 A;  1LB2 A;  2DBB A;  5BPD A;  2OBP A;  2AXL A;  5L3D A;  3U1D A;  3GFM A;  4P5O A;  1BC8 C;  1DPR A;  5IT9 K;  2QYO A;  2ZO4 A;  3P7N A;  2FU4 A;  2HTJ A;  3RI4 A;  3CUQ C;  3JSP A;  1USS A;  2HWV A;  4HQM A;  1D8J A;  3DXJ F;  2VBZ A;  2STW A;  2HTS A;  1XGM A;  1UB9 A;  1JHH A;  2QM3 A;  4UVC A;  2V1X A;  1HW2 A;  2STT A;  2Z9O A;  3MQ0 A;  2FML A;  1ZG5 A;  2WC2 A;  3M9A A;  2V1D A;  5K5Q A;  4EM2 A;  3WTW C;  4UV9 A;  1HQC A;  2DO7 A;  4ESF A;  3HOT A;  4IJA A;  1S3J A;  5LHI A;  2FSW A;  4RGX A;  1R00 A;  2RVC A;  3HRU A;  1HXD A;  5L3G A;  2K7L A;  3J81 Z;  4M72 A;  2VBW A;  4I7H A;  2GAU A;  2HZT A;  1ZH5 A;  5HS9 A;  4N0B A;  2W25 A;  5FD6 A;  2FNA A;  2G7U A;  4UV8 A;  5DD4 A;  3GXO A;  3KEO A;  5K1Y A;  3P9I A;  2YX4 A;  1KU3 A;  3WTY C;  2P5K A;  1Y0U A;  2D45 A;  4D0P A;  2FBI A;  1O7L A;  2OD5 A;  4LMY A;  4EQQ A;  4EJV A;  4Y15 A;  4MTE A;  1YIO A;  2MD5 A;  1FC3 A;  1LJ9 A;  4IHS A;  2CO5 A;  3QRF F;  4R79 A;  1O3Q A;  3HTU A;  4OOI A;  4FT8 A;  4L9T A;  3E3V A;  1O3S A;  1QGP A;  2EV5 A;  2VOD A;  2IP2 A;  2Z5U A;  3WTT C;  3V7C A;  2QWW A;  3BJ6 A;  2Z33 A;  3GZ5 A;  2ZME B;  4ENM A;  5BOX A;  3M8F A;  2HEO A;  2FF4 A;  4NQW A;  4RGU A;  2RGV A;  2ZFW A;  3MCZ A;  3TGN A;  4P9F A;  4WXC A;  4PZJ A;  1A04 A;  5D5U B;  2W85 A;  1E2X A;  4KMU X;  2MH2 A;  2DPD A;  3E6B A;  1TLH B;  3ZMZ A;  3VB2 A;  2HFH A;  5BQT A;  2KIF A;  2KJB A;  1J5Y A;  4RS8 A;  4XLP F;  3GYH X;  1VTN C;  3ISP A;  4JQF A;  3I64 A;  3FWE A;  2FE3 A;  2ZXJ A;  2XV4 S;  2RDP A;  3GF2 A;  1Z91 A;  1R36 A;  1W4M A;  4BH9 A;  4CHU A;  3K9T A;  4GCV A;  1FOK A;  3MFK A;  1R1U A;  2IRF G;  4M9S A;  1I5Z A;  5H6Q A;  1G3Y A;  3RKX A;  2GQQ A;  3T8T A;  2FNP A;  1FYL A;  4YII A;  2L54 A;  5CVR A;  1BOA A;  1T6S A;  3JTH A;  4ZYG A;  3KLO A;  5CVU A;  1KYZ A;  1XB4 A;  1IN8 A;  3LAJ A;  3IL2 A;  2FOK A;  1UHM A;  1LDK B;  1I1G A;  2XAG A;  4G6D A;  2ZBK A;  4TV7 A;  2M45 A;  4GXO A;  2FA5 A;  3EYY A;  3V8L A;  2NNY A;  3DQV C;  4R1H A;  4U7D A;  1LNW A;  2GWR A;  2J5P A;  4YG2 F;  1CF7 B;  1QZZ A;  3GUD A;  4MHG A;  4ASN A;  4Q4Z F;  5FD5 A;  1TW2 A;  5CVV A;  4JK1 X;  2RV8 A;  3M1E A;  3DEU A;  1YQA A;  3Q9S A;  5HLG A;  3F8C A;  1MDM A;  3JSO A;  3ZPL A;  5ILV A;  2EV6 A;  2M5W A;  1FBU A;  5DV5 A;  1RUO A;  2MLG A;  2DAO A;  3H3Z A;  5HDG A;  3GZ6 A;  1I6X A;  1XDS A;  1Z6T A;  2NAZ A;  4U88 A;  3ZMS A;  4KIB A;  5FO5 A;  2UXX A;  2C6Y A;  5HOO A;  2QLZ A;  4GGG A;  3WGG A;  4G7H F;  1E17 A;  3K0L A;  3S2W A;  1ZRE A;  4HX7 A;  3ZP5 A;  1YYV A;  1MKM A;  1RIO H;  3T8R A;  4NHJ A;  2M87 A;  3BPX A;  4MQV A;  2EV0 A;  3WGH A;  2DW4 A;  4ZYH A;  3H92 A;  1UFM A;  3L7W A;  2IVM A;  3E6D A;  3ZMV A;  1MJB A;  4IPA A;  5FFZ A;  5K5R A;  1IUY A;  3TO7 A;  1B1B A;  4YIF A;  4ZZD A;  1ZLJ A;  4M9X A;  1WKM A;  3ZMT A;  3NRV A;  4IRI A;  2ZCW A;  3MZY A;  2OA4 A;  5LEJ A;  5E1W A;  3FX3 A;  3RPQ A;  2QQB A;  3I5U A;  2YPR A;  5ED4 A;  2LSO A;  2W24 A;  2V1U A;  2ISY A;  1CGP A;  1MDM B;  3J7A O;  3ELK A;  4WXH A;  5LHH A;  2MH9 A;  4GYI A;  3J81 K;  2FBH A;  4OIN F;  3FF5 A;  2OQG A;  4M6X A;  2HQN A;  5E8G A;  2PBI A;  1P4W A;  2VT2 A;  3CJN A;  2XAS A;  2L4A A;  4LGW A;  3KP4 A;  2PG4 A;  5ERI A;  3F22 A;  1R58 A;  1AWC A;  3LAP A;  4A12 A;  4HW0 A;  2MBF A;  5LGT A;  4BHB A;  5HS8 A;  3HTS B;  4G8X A;  5FFX A;  3BJO A;  2G7H A;  3QPH A;  3G73 A;  3QP6 A;  2JT1 A;  1BIB A;  2HYG D;  4A0Y A;  4IRH A;  5ICF A;  1O7F A;  2BBY A;  1SMT A;  4UXN A;  3GLX A;  3SQN A;  5ILU A;  5AON A;  4M73 A;  2XAQ A;  3CLO A;  3IWF A;  4U0Y A;  3QU6 A;  1O3T A;  3NEU A;  4A5N A;  4HLY A;  2P6S A;  3F8N A;  3U2R A;  1EV7 A;  5BPI A;  4L0Y B;  1XSD A;  2BV6 A;  5D5V B;  4HDU A;  3LA2 A;  3SZT A;  1J9I A;  1IXR C;  1P6R A;  4KNY A;  4LLG F;  3L2C A;  3RIR A;  2EFP A;  5K5O A;  1IW7 F;  4KIF A;  3RYR A;  3LST A;  3ZN0 A;  3RTR A;  4IRG A;  3LA3 A;  5AIQ A;  4B09 A;  1O3R A;  3IRR A;  3FZV A;  3DF8 A;  4R8H A;  1FX7 A;  1XMK A;  1SFX A;  5F1R A;  1B4A A;  2F5D A;  3L09 A;  1Z7U A;  3MWM A;  2M1B A;  1HKT A;  1L0O C;  1UST A;  4PGH A;  3C18 A;  1BN5 A;  2K4J A;  3NQO A;  4MQ9 F;  4HDV A;  2V79 A;  1BJA A;  1YTY A;  3KEQ A;  1IRF A;  1T98 A;  3MZH A;  4A0Z A;  3REO A;  1OPC A;  1H9G A;  1ODD A;  1YW7 A;  1U6G A;  3KP7 A;  3I4P A;  2X0L A;  5A2Q Z;  5D8K B;  2A6E F;  1R1T A;  4Z2Y A;  4FX4 A;  1B9N A;  2K27 A;  2L4M A;  4IHT A;  1FSH A;  1TQI A;  3HSR A;  4IVN A;  1W5S A;  2ZKZ A;  2CWE A;  1YS6 A;  1R5G A;  2DK8 A;  2GXB A;  2NRA C;  1TNT A;  1B59 A;  1JHF A;  4OIR F;  1QO0 D;  5CLS A;  4N9I A;  3V8K A;  4U0V A;  4E70 A;  5D6E A;  2GXG A;  4EJU A;  3QOP A;  3RJP A;  3ML6 A;  2YSR A;  4LLL A;  3HRT A;  1JGS A;  4A0X A;  5TJJ A;  2QEN A;  6PAX A;  2CW0 F;  3PFI A;  4F7Z A;  4EM0 B;  1PDN C;  5JFR A;  3ROU A;  2UXN A;  3K69 A;  1MD0 A;  2YX7 A;  1D8K A;  1HSJ A;  3M8E A;  4KIG A;  4M74 A;  2EFN A;  1K78 A;  5F6F A;  3ABU A;  2JRT A;  5J6X A;  2JZY A;  1SAX A;  1HW1 A;  3WTX C;  2JTV A;  4HV6 A;  3GFI A;  1WSU A;  1Q1H A;  2WWY A;  2ZNY A;  3HHH A;  5H6R A;  1KQ8 A;  2XAJ A;  3P9K A;  1H0M A;  4HBL A;  1EH8 A;  3ECO A;  2VBX A;  1U78 A;  3JW4 A;  4KFC A;  3WTS C;  1Z9C A;  1XGS A;  1FLI A;  2G9W A;  1FBS A;  2HDC A;  4LK1 F;  5E17 F;  3DFG A;  5D5W B;  3DPL C;  2VBY A;  5E18 F;  3KP3 A;  3RYP A;  3EYI A;  3F72 A;  4EM1 A;  5HVQ C;  2VON A;  1W7P A;  2O3F A;  1D5V A;  4N9H A;  1XGO A;  4ETS A;  1C0W A;  3GFJ A;  1K7A A;  2P7C B;  3KZY A;  2Q0O A;  1P4X A;  4ENN A;  1I27 A;  3FMR A;  4MGR A;  3ZN1 A;  3FXR A;  1MZB A;  1XSX A;  2RC4 A;  4GYG A;  1TQM A;  1OR7 A;  5L3F A;  1PUE E;  4YFK F;  1K78 B;  3RKY A;  4EJT A;  4Q5S F;  2Y0M A;  2EB7 A;  5ICC A;  4HAM A;  5H20 A;  4BQA A;  2A07 F;  3W6J B;  1G6N A;  2PJP A;  2MA3 A;  4ESJ A;  2XVC A;  4EGY A;  5D6F A;  2DLL A;  4Y13 A;  4LJZ F;  3WTU C;  3PQK A;  3GWZ A;  3F23 A;  1BI1 A;  2D1H A;  5HDK A;  3PQJ A;  2L01 A;  2K86 A;  2O0Y A;  1HKQ A;  3V7S A;  3KET A;  4EGZ A;  2GIV A;  2CSO A;  3IKV A;  3DP7 A;  3CUO A;  1IN4 A;  4WXD A;  4CO8 A;  3DV8 A;  4DQ2 A;  5FLX Z;  1G3W A;  1KU9 A;  4EV0 A;  1R22 A;  2KKO A;  4AIK A;  4L9N A;  4I98 B;  5F64 A;  1KQ9 A;  2ACJ A;  1U5T C;  1W7P B;  3WU1 B;  2FXA A;  3HRS A;  3ZQ7 A;  1FNN A;  3GO5 A;  1S8N A;  3CUQ A;  4OIO F;  3Q5F A;  2JSC A;  2VT3 A;  2CG4 A;  4BXU A;  1REP C;  5HLI A;  4ESB A;  4JBA A;  2E7W A;  4RB0 A;  3Q9V A;  3V7R A;  1RZ4 A;  2UWM A;  3D5L A;  3M7G A;  3HYI A;  2EFO A;  4WF2 A;  5CVJ A;  1IN7 A;  2DU9 A;  5DUK A;  2VE9 A;  5A2Q K;  4U7B A;  4XLN F;  1W7P D;  2E1N A;  5J8F A;  1XCV A;  4ZH4 F;  1MGT A;  2BGC A;  4EJO A;  1XSV A;  4EVI A;  4ENJ A;  2PEX A;  1DP7 P;  4L5J A;  1QQI A;  1BI2 A;  3WE3 A;  3TOB A;  1F5T A;  2A61 A;  2FRH A;  1UCR A;  1YW8 A;  4ZYD A;  1JE8 A;  3T1B A;  4OMZ A;  4CIC A;  2LF7 A;  4HLX A;  2PLY A;  4L9J A;  4PCQ A;  1ZN2 A;  3QAH A;  3CUQ B;  1PP7 U;  5E1Z B;  1X3U A;  3LQR A;  3KE2 A;  4MNU A;  3SHF A;  1Z05 A;  5JR3 A;  3FXU A;  2XUB A;  2GA2 A;  4CYD A;  3EDP A;  2OZ6 A;  1FBQ A;  1XN7 A;  1R1V A;  2EFW A;  2OU2 A;  1IAW A;  1GXQ A;  1XGN A;  4G7Z F;  5L3C A;  4EMS A;  3TQN A;  1AOY A;  1DDN A;  1QNT A;  1YLF A;  3WGI A;  2JPC A;  1S7O A;  3T0Y A;  2F5E A;  1IXC A;  4O5V A;  1ZRD A;  4BAY A;  2DFI A;  4QLC U;  1FP2 A;  3G3Z A;  1FYK A;  4CGZ A;  2A69 F;  2Z99 A;  1GXP A;  1TNS A;  4XRF A;  1WRJ A;  5DCF A;  5FGM A;  5LLQ A;  3BOQ A;  2H94 A;  4RB3 C;  2XRO A;  2LNB A;  3EET A;  1FPQ A;  4HF0 A;  2KRF A;  5CVI A;  5D5X B;  3I59 A;  3QPT A;  4KA4 A;  1WI9 A;  3W6K B;  1ULY A;  2ZJ2 A;  3F8B A;  4LG0 A;  4L9V A;  3JAM Z;  1IXS B;  2M30 A;  1I1S A;  2PN6 A;  2DQL A;  2A6H F;  3KP6 A;  3K1M A;  5IT3 A;  2MLK A;  3ZMD A;  3C3W A;  2DI3 A;  1IN6 A;  2F5C A;  3K2Z A;  3F8M A;  3VOE A;  1QPM A;  4NB5 A;  1J59 A;  1IN5 A;  3BP8 A;  1P92 A;  3ECH A;  4G6Q A;  1ZAR A;  2RKH A;  4KDP A;  1SMY F;  3WG9 A;  4M71 A;  2RNJ A;  2V9V A;  1KGS A;  1XD7 A;  2LKP A;  2OAZ A;  2RN7 A;  2EWN A;  1ZRC A;  1FWZ A;  2W84 A;  3ABT A;  4Y17 A;  3T5X A;  3SXY A;  1RUN A;  5LBQ A;  3JTG A;  2M8E A;  5LGN A;  4L5I A;  3F3X A;  3K1N A;  3IRQ A;  2IW5 A;  2VOO A;  3KFW X;  1T0F A;  5DEQ A;  1RI7 A;  1STZ A;  4UHT A;  1G3S A;  3HHG A;  2H27 A;  4BNC A;  3E6M A;  2L02 A;  3GVA A;  3OOP A;  3KCC A;  2TDX A;  2VC1 A;  4BHP A;  1FYM A;  2QZ8 A;  3CTA A;  3I59 B;  2L3D A;  2R7D A;  3N97 A;  3CO7 C;  5FLX K;  1WWX A;  5BMZ A;  4LG0 B;  1T39 A;  1MJ9 A;  3FHZ A;  3I58 A;  4HOB A;  3H3U A;  2J5O A;  1V3F A;  5ILS A;  4L0Z B;  1Z1D A;  5KVR A;  1SFE A;  4HX4 A;  3GEZ A;  1LDD A;  1R7J A;  2BEO A;  1SD5 A;  2DK5 A;  2EA2 A;  2IA0 A;  3BPV A;  2K4B A;  2DTR A;  4I2O A;  2NS0 A;  4LB6 B;  2O6G E;  4BYY A;  2E7X A;  3J80 K;  1QZY A;  2JPB A;  3QP5 A;  1FP1 D;  4UNO A;  2IA1 A;  2XRN A;  3HOS A;  2Y48 A;  3E97 A;  4MEX F;  2UZK A;  1JXS A;  4G9Y A;  3VEP A;  4Q48 A;  3L00 A;  4H0E A;  3QU3 A;  1YS7 A;  1LQ1 A;  5LRR A;  1EH7 A;  1U8R A;  4OIQ F;  3IHU A;  2KJC A;  4I01 A;  1BBY A;  2QQA A;  2HGC A;  4I02 A;  5HS7 A;  4AVP A;  4IF4 A;  5HDN A;  3I54 A;  2B0L A;  1OYW A;  4PDK A;  2ESH A;  5JVT A;  3E5Q A;  3IKT A;  3CDH A;  1IZ1 A;  2D2W A;  2DQR A;  4IXA A;  4A2U A;  5EEG A;  2VOP A;  1ON1 A;  3TDU C;  2BYV E;  3E6C C;  1FSE A;  1SD7 A;  2W57 A;  2R7F A;  3BRO A;  2OQR A;  2P5V A;  1Z6R A;  5ICE A;  2H6C A;  1FY7 A;  4U0W A;  1D3Y A;  2VC0 A;  2HS5 A;  3C7J A;  1HKS A;  2HQR A;  5LRS A;  2QUF A;  5E1X A;  1ZG1 A;  1TTY A;  1EH6 A;  4ZZL A;  2MC3 A;  1KA8 A;  1QBJ A;  5J8C A;  1ZAO A;  2CQK A;  2ZME A;  3F6V A;  4FX0 A;  2O61 A;  3GW2 A;  3I71 A;  2Q2E A;  3V4G A;  4GO1 A;  1F1Z A;  3D0S A;  4DNC A;  5LEK A;  4UVB A;  2O03 A;  1NHA A;  4A5M A;  5DD8 A;  2A3S A;  2VN2 A;  4HYE A;  1WQ2 A;  3R6S A;  2EK5 A;  1XCB A;  3E5U A;  1LVA A;  1KYW A;  4RB2 C;  4CZZ A;  3AAF A;  5DDG A;  5L3E A;  2EJR A;  3TO6 A;  3JAM K;  2P5L C;  3LFK A;  3IC7 A;  1O57 A;  4FHT A;  1FZP B;  4KYW A;  1OMI A;  1OYI A;  2H09 A;  3SFZ A;  1SFU A;  3VFZ A;  2VE8 A;  2ZNZ A;  2X4H A;  4AWX B;  1IF1 A;  1MJA A;  4WWC A;  4UVA A;  3HRM A;  3BDD A;  2ELH A;  1YW9 A;  5D8L B;  1DUX C;  1U2W A;  2QBY A;  5E8I A;  3DKW A;  1SD4 A;  5TRD A;  5E20 A;  3HUG A;  2PMH A;  4LK0 F;  3BWG A;  2A68 F;  4BHC A;  3I53 A;  3HIF A;  3F8F A;  3MAJ A;  4LD5 A;  5AIP A;  4OMY A;  2PI0 A;  1LEA A;  1CF7 A;  3E5X A;  1OKR A;  3O3K A;  3N4M A;  3R4K A;  5L3B A;  4G7O F;  3ZMU A;  3WOD F;  3IWZ A;  3LA7 A;  2DT5 A;  3HSF A;  1ON2 A;  4RB1 A;  4ENK A;  1YFH A;  3TOA A;  2P4W A;  1K79 A;  1FT9 A;  3BJA A;  1KQ0 A;  3F21 A;  2FBK A;  4YFX F;  1DPU A;  4WX9 A;  3WTZ A;  1BI0 A;  4WK8 F;  3RDI A;  2O8X A;  4S05 A;  2V6C A;  2NYX A;  2PQ8 A;  2Q8K A;  5LHG A;  1LEB A;  3J80 Z;  3LWF A;  3P9C A;  4RAY A;  2LF8 A;  4M9Z A;  2QBY B;  2GA1 A;  3WE2 A;  5FB2 A;  1ZHF A;  4HV5 A;  1P2F A;  4HQE A;  4MTD A;  1GVJ A;  3FM3 A;  4M6Y A;  2KIU A;  1J75 A;  2XKO A;  2OZU A;  1V4R A;  2ETH A;  3COA C;  3TKY A;  1ZLK A;  5JHU A;  1UHW A;  4L18 B;  2FQ3 A;  4O6J A;  1YO5 C;  2YU3 A;  2PMU A;  5DCM A;  4ZYE A;  4HX8 A;  3FMQ A;  2QVO A;  3GX4 X;  3O2P E;  2K02 A;  5LGU A;  4Q47 A; 
#chains in the Genus database with same CATH topology
 4E7I A;  5IT9 Z;  3BZ6 A;  1BL0 A;  1TL8 A;  3FBI B;  4KUM A;  5DYM A;  1G4D A;  5TGT A;  1IRG A;  2DPU A;  2DJN A;  2GZW A;  1KU2 A;  5EF6 A;  1TC3 C;  4M3E A;  3TO9 A;  3RZD J;  1F36 A;  5JLX A;  3C1D A;  2A05 A;  2OCC H;  4C2U A;  4IL6 C;  2NVX J;  5LFA A;  3IH4 A;  4AIJ A;  1TQP A;  1TW3 A;  1WPK A;  3OOU A;  5GAE J;  3OY9 A;  2LDU A;  4A3M J;  4XID A;  4IHV A;  2F2E A;  3K1P A;  1MBF A;  2H6B A;  1J7K A;  3KP5 A;  1WJB A;  3UNG C;  2R3S A;  4HSR A;  2F4O B;  2XGC A;  3PSF A;  2LK2 A;  5GPC A;  1HW5 A;  3OYK A;  5B5E C;  2KL4 A;  1P4A A;  2ISZ A;  2Y75 A;  5GAG J;  2Z3Y A;  1MBE A;  4YEJ A;  2LY9 A;  2MD0 A;  1GVD A;  1S6L A;  4QWQ A;  5CKT A;  2AO9 A;  1SD6 A;  2IT0 A;  2ID6 A;  1JKP C;  1OCT C;  3BR0 A;  5DUI A;  4CDG A;  5K7H A;  5M3M J;  3WTV C;  3LQQ A;  2E2I J;  1GHC A;  1R5H A;  4KIC A;  4B1R A;  5D4S A;  1H9T A;  4I0A A;  2P8T A;  3A1Y A;  5BNG A;  2NNN A;  2CYY A;  4HF1 A;  4KN7 X;  2F5F A;  3RPU A;  3VYU B;  1ONV A;  4KMF A;  2DMN A;  2XB5 A;  3BY6 A;  3GFL A;  1ZRF A;  3CC4 I;  2VQG A;  3R0J A;  4P55 A;  1D5Y A;  2R4G A;  2ZJQ F;  1I6H J;  2QGU A;  2IJL A;  4E4H A;  1G59 A;  3GTO J;  2IS6 A;  2MAB A;  1BA5 A;  4AU7 A;  3VSL A;  5DCM B;  1U8B A;  3ZOB A;  3AKZ A;  5HLH A;  4A93 J;  1MSE C;  2BXZ A;  3CO6 C;  1B8I B;  1SVM A;  1ZGA A;  3PSI A;  1Z21 A;  1XMA A;  2ADU A;  2IA2 A;  4D5C A;  3R60 A;  2E1C A;  1WJE A;  4N4O B;  3R0A A;  3LFU A;  1X19 A;  1K6O A;  3KLN A;  1MSF C;  2R93 J;  4EAT A;  4S04 A;  3EUH A;  2HYF A;  3RKW A;  2EFQ A;  2WTE A;  4OU0 A;  3TDZ C;  4XBF A;  1B6A A;  3DWL E;  2A5Y B;  4A3D J;  4PJL A;  2EIN H;  3FMS A;  3ERE D;  3LSJ A;  4IOA F;  3CMM A;  1R23 A;  3FXQ A;  5KK1 A;  2NOJ B;  3V8J A;  4BGD A;  1U5T A;  4RGS A;  4NDL A;  3KP2 A;  1BC7 C;  4HZF A;  3R61 A;  2K5C A;  3ABK H;  4NNJ A;  1BJZ A;  1T2K A;  4NC8 A;  1HST A;  4Y7N J;  3QWL A;  3EQL F;  2D1V A;  1GT0 C;  2E1M C;  3B73 A;  4OWR B;  1F4K A;  3GTG J;  2W00 A;  1B9M A;  4B8X A;  3JRB A;  4PGG A;  4XSX F;  3HSE A;  4EJW A;  2ELJ A;  3F6O A;  1X58 A;  2DMU A;  1KU7 A;  1ZGJ A;  2ELK A;  2P7V B;  1W0U A;  1E3O C;  4AIH A;  4L5E A;  2HXI A;  1SFO J;  4KN4 X;  3I0T A;  2E19 A;  2XGX A;  3VOD A;  5CJ9 A;  2EZL A;  1ORK A;  2QQ9 A;  2LC2 A;  4P9U A;  3OS1 A;  3QYF A;  4XSZ F;  4OIP F;  4MEY F;  2HOE A;  1YI2 I;  1UAA A;  4AD9 A;  2OCE A;  2XKP A;  2YS9 A;  2ESN A;  3H9G A;  3U9G A;  2CJJ A;  2R7O A;  3K6G A;  2IPQ X;  4A6E A;  3K4J A;  4KT5 C;  3SZP A;  2DOA A;  1XG1 A;  4LLN A;  1W36 D;  2HVS A;  1A5J A;  1QZE A;  2XHK A;  4W1U A;  1MMN A;  3ULQ B;  2XIG A;  5CPR B;  2HKO A;  3MEX A;  2CFX A;  4XKW A;  5EEH A;  1OYY A;  1MBH A;  3ZGK A;  1RNL A;  4HRI A;  4C3J J;  3JRI A;  2R7T A;  3GZN B;  5EDN A;  2XAF A;  4ABZ A;  3OR1 C;  3OV8 A;  1HBX G;  1ZQ3 P;  4G94 A;  5EJC A;  1SVL A;  3PM1 A;  1P7J A;  4P1W A;  4YFN F;  4I09 A;  4WCG A;  4HA8 A;  2HDD A;  3CC2 I;  3WU0 A;  2EBI A;  2XAH A;  2BE5 F;  2RQP A;  1LDJ A;  4CXF A;  4LB5 A;  3DU6 A;  2M9H A;  1VQM I;  1OIS A;  1U5T B;  2FUG 2;  4XKB A;  3RPU D;  5GPA A;  1NK2 P;  3HC7 A;  4KT6 A;  4RAZ A;  2KIM A;  3FM5 A;  3BR2 A;  4XOR A;  4C2M J;  4F52 A;  1ZGW A;  1ZYR F;  1U3E M;  1S7A A;  2ZXW H;  2NS7 A;  1YJW I;  4LFU A;  5CYV A;  1ZR2 A;  1SC7 A;  2BY0 A;  3O6B B;  3S1N J;  3TED A;  2AS5 F;  2YR2 A;  2P6T A;  4BQQ A;  2VXZ A;  5JI6 A;  1JT0 A;  4P96 A;  1G3T A;  4UUV A;  4K2E A;  1TZL A;  2JK3 A;  3GTJ J;  1ZKG A;  2LRD A;  1YJ9 I;  1F9N A;  2FMY A;  2CGP A;  4E7K A;  1SAU A;  3IH3 A;  2V1N A;  1W5T A;  2DYS H;  2LKX A;  1OR7 C;  2JA8 J;  1YJN I;  2MSY A;  2HR3 A;  3JRE A;  4HF2 A;  1S29 A;  3BG3 A;  1Y39 A;  1A36 A;  4D9J A;  3JRH A;  2CU7 A;  2XB0 X;  2IGM A;  2Y2Z A;  1PP8 F;  3W3C A;  1VFC A;  2HKX A;  5D4R A;  1ZTR A;  2HU9 A;  5H2F C;  4O3M A;  2VKV A;  1L3L A;  3PIP F;  5ICG A;  3L9F A;  1IRX A;  1J2X A;  2KDO A;  4RGR A;  1DGW Y;  4A6D A;  4I0B A;  4D7M A;  4A3C J;  1QVU A;  1TBX A;  2FEZ A;  1BI3 A;  2RNG A;  4E7H A;  1ZG3 A;  1H88 C;  3KZZ A;  1T38 A;  5KNL A;  2EA4 A;  1G8X A;  1MH3 A;  3ESW B;  3FBN B;  2WV0 A;  4XRM A;  4PSX A;  1YG2 A;  1BM9 A;  3OYD A;  1XDU A;  1BIA A;  2BY3 A;  2M34 A;  2K9M A;  4DJA A;  2LY1 A;  3J7Z I;  4ON0 A;  3DPT A;  5GP9 A;  3ERM A;  3QOE A;  1RC9 A;  1J0R A;  3LSK A;  2PFB A;  4DIQ A;  3B02 A;  3M8J A;  4BXF A;  2COM A;  5M5W J;  5BS6 A;  1LB2 A;  3OYM A;  2DBB A;  1AKH B;  5BPD A;  1FIA A;  3EUK L;  2OBP A;  2AXL A;  5L3D A;  3U1D A;  4DGW B;  5C4J J;  3GFM A;  3DEE A;  3QYB A;  4P5O A;  1BC8 C;  1BW5 A;  1DPR A;  2QSG X;  2M3A A;  5IT9 K;  4PJJ A;  4MIM A;  2QYO A;  2ZO4 A;  3P7N A;  2FU4 A;  2HTJ A;  2E34 A;  1QRY A;  2A6T A;  4I6Z A;  3RI4 A;  3H3V K;  2KPM A;  3CUQ C;  3H0G J;  3JSP A;  1USS A;  2HWV A;  4HQM A;  1RR8 C;  1D8J A;  4C2T A;  3BQZ A;  3BZC A;  3ABL H;  3DXJ F;  2VBZ A;  2STW A;  4A3G J;  5F0C A;  2HTS A;  1XGM A;  1UB9 A;  2W7N A;  4BY1 J;  1JHH A;  2QM3 A;  1IC8 A;  4UVC A;  2WB1 N;  1F43 A;  2FX0 A;  2V1X A;  3W2A A;  5B66 C;  2LY2 A;  1HW2 A;  2STT A;  2Z9O A;  3MQ0 A;  2FML A;  5J4V A;  3SDG A;  1ZG5 A;  1K6Y A;  2WC2 A;  2IXS A;  2V1D A;  3M9A A;  5K5Q A;  3F0C A;  4G6T B;  2AHQ A;  1ETQ A;  4EM2 A;  3BCA A;  4ZTJ A;  3WTW C;  2X6O A;  1JI8 A;  1T56 A;  4UV9 A;  4CUG A;  1HQC A;  4BBS J;  1U9N A;  3IH2 A;  3BR5 A;  1UG0 A;  2DO7 A;  4ESF A;  3H9J A;  3HOT A;  3OMY A;  1ETV A;  2LR8 A;  2VKE A;  4IJA A;  1S3J A;  4LG3 A;  5LHI A;  3CME I;  4A3I J;  2FSW A;  4RGX A;  3DPU A;  3PO3 J;  3LL7 A;  1MH4 A;  1R00 A;  2RVC A;  3HG9 A;  3RKQ A;  3S1R J;  2R7U A;  4DBQ A;  3HRU A;  2VIX A;  1HXD A;  5L3G A;  4M3F A;  2K7L A;  5CQG A;  3DCF A;  4F91 B;  5KAF C;  3J81 Z;  4M72 A;  3CJR B;  2JMW A;  3HGG A;  2VBW A;  4I7H A;  2VXD A;  2GAU A;  3BTC A;  3HZJ A;  1HA8 A;  4LIV A;  2HZT A;  1ZH5 A;  1RET A;  1YX3 A;  2KQR A;  4NBQ A;  5HS9 A;  3KPH A;  4N0B A;  1E0E A;  2W25 A;  1E3P A;  1IO2 A;  5GTH C;  5FD6 A;  2XAU A;  2HQ5 A;  5JLW A;  3BT9 A;  2LLK A;  2FNA A;  3KX2 A;  2G7U A;  2HOT A;  4UV8 A;  5DD4 A;  3GXO A;  3KEO A;  4CCO A;  4RBO A;  1IV8 A;  5K1Y A;  1NK3 P;  3P9I A;  2YX4 A;  1IV6 A;  1KU3 A;  2NVY J;  2XF5 A;  2YU9 J;  4IHX A;  1LUJ B;  3WTY C;  4FQG A;  2P5K A;  2JUC A;  1GLN A;  1Y0U A;  2D45 A;  3S1Q J;  4D0P A;  1TWF J;  2BZT A;  2FBI A;  1O7L A;  1JKR C;  2OD5 A;  4IHY A;  2F5V A;  4LMY A;  3ABM H;  4EQQ A;  4EJV A;  4Y15 A;  4MTE A;  2ECC A;  3CLQ A;  4Y33 A;  4CYC B;  1VQ5 I;  3S3O A;  1YIO A;  3BQY A;  2MD5 A;  1FC3 A;  1LJ9 A;  1U0J A;  1K61 A;  2WA0 A;  4IHS A;  5J1R A;  2CO5 A;  3QOD A;  3A0H C;  3QRF F;  4R79 A;  1O3Q A;  3HTU A;  3DBH B;  4OOI A;  4FT8 A;  4BS9 A;  4L9T A;  2HVR A;  3E3V A;  1JKQ C;  1O3S A;  4AYB N;  2Z2S B;  1QGP A;  5DM7 F;  2R7W A;  1UG2 A;  2EV5 A;  2VOD A;  2IP2 A;  3CCE I;  2JWT A;  2Z5U A;  3WTT C;  3V7C A;  3CCY A;  2QWW A;  3K7A J;  3BJ6 A;  2Z33 A;  1QHH D;  3GZ5 A;  1PJR A;  2ZME B;  1TT5 B;  4ENM A;  5BOX A;  3OYL A;  3S17 J;  1TWC J;  3PIO F;  2Q2E B;  3M8F A;  2ZXI A;  1EJ9 A;  2TRT A;  4XMY A;  2ME6 A;  3W2V A;  2DDA A;  2HEO A;  2CQQ A;  2FF4 A;  4NQW A;  4FTH A;  4RGU A;  3S15 J;  2RGV A;  2VJ5 A;  2ZFW A;  3ZQL A;  3OR2 C;  3MCZ A;  3TGN A;  4P9F A;  4WXC A;  4PZJ A;  1A04 A;  5D5U B;  2W85 A;  1E2X A;  3TW6 A;  5TIS C;  4KMU X;  2AQF A;  2MH2 A;  2DPD A;  3E6B A;  1TLH B;  3AL0 C;  2E36 A;  3ZMZ A;  3CJQ B;  3H0D A;  3I4M J;  2LKS A;  3VB2 A;  2HFH A;  5BQT A;  4BE0 A;  4RAF A;  2KIF A;  2KJB A;  3GTM J;  2LOO A;  2LYC A;  1J5Y A;  4RS8 A;  4PFP A;  4XLP F;  3GYH X;  1VTN C;  3ISP A;  4JQF A;  2CUJ A;  3I64 A;  3FWE A;  2E2H J;  4ITV A;  2FE3 A;  2ZXJ A;  4ZC3 A;  2XV4 S;  2RDP A;  5JHF A;  3SYT A;  3GF2 A;  1Z91 A;  4PSW A;  1R36 A;  1W4M A;  4D1Q A;  4BH9 A;  4CHU A;  2XF6 A;  3K9T A;  2K9S A;  3SEZ A;  1X4O A;  3OL3 A;  3L2W A;  2DA6 A;  2Z16 A;  1NG7 A;  4GCV A;  1FOK A;  2CV0 A;  3MFK A;  1R1U A;  3FXJ A;  2IRF G;  1HDD C;  4M9S A;  1I5Z A;  5H6Q A;  4KJZ A;  1G3Y A;  4XLH A;  3RKX A;  2GQQ A;  3T8T A;  1PUF B;  2FNP A;  3Q3S A;  1FYL A;  4YII A;  3IV5 A;  2L54 A;  5CVR A;  1BOA A;  1T6S A;  3JTH A;  1S72 I;  4ZYG A;  3KLO A;  5CVU A;  2DFH A;  1KYZ A;  1XB4 A;  1IN8 A;  3LAJ A;  3RZO J;  3IL2 A;  3QYE A;  4F92 B;  4OAZ A;  2FOK A;  1UHM A;  4RMN A;  1LDK B;  1I1G A;  2XAG A;  4G6D A;  2ZBK A;  4TV7 A;  2M45 A;  4LOC A;  4GXO A;  2DDB A;  2FA5 A;  3BC8 A;  3EYY A;  3V8L A;  2NNY A;  3DQV C;  4R1H A;  4U7D A;  1LNW A;  2GWR A;  2J5P A;  4YG2 F;  1CF7 B;  4IQ4 A;  2NXN B;  1QZZ A;  3M07 A;  3GUD A;  4MHG A;  4ASN A;  4E7J A;  4Q4Z F;  3H9Q A;  2Y9Y A;  5FD5 A;  4NQW B;  1TW2 A;  5CVV A;  2G0E A;  2MW8 A;  2RV8 A;  4JK1 X;  1QA6 A;  3M1E A;  1T0F C;  2JN6 A;  3DEU A;  1X1D A;  2M4G A;  4HPQ A;  1YQA A;  3Q9S A;  5HLG A;  3MKW B;  2VJ4 A;  3F8C A;  1DP3 A;  4CCL A;  4ZDL A;  1WZ2 A;  1MDM A;  3JSO A;  3ZPL A;  5ILV A;  1X1A A;  3OYF A;  2HPM A;  5IP9 J;  2EV6 A;  1Z7L A;  2M5W A;  1OCC H;  1YIJ I;  1FBU A;  4DYQ A;  5DV5 A;  5C44 J;  1RUO A;  2ZFU A;  2CW7 A;  2E1O A;  3QPS A;  4B4C A;  5M5X J;  4ZJZ A;  2DA5 A;  2MLG A;  3DKY A;  2DAO A;  2DMT A;  4BQN A;  3H3Z A;  1QU3 A;  5HDG A;  1LKX A;  3CCS I;  3GZ6 A;  2OC6 A;  1I6X A;  1LFP A;  1MBK A;  1XDS A;  2GOM A;  4FCY A;  3FIW A;  1Z6T A;  2NAZ A;  4U88 A;  3ZMS A;  4KIB A;  1IUF A;  2CFO A;  5FO5 A;  4UUS A;  5EGO A;  2UXX A;  2C6Y A;  4CA0 A;  3CCQ I;  5HOO A;  3I9V 2;  3I3L A;  5HNH A;  2QLZ A;  3J7A Y;  1LVK A;  2E35 A;  4GGG A;  4X6A J;  3WGG A;  2DA2 A;  4G7H F;  1E17 A;  3K0L A;  5FKO A;  3S2W A;  1ZRE A;  1AU7 A;  3FIS A;  4C30 A;  4HX7 A;  9ANT A;  1N77 A;  3ZP5 A;  4DZP A;  1YYV A;  1MKM A;  3QQA A;  3T8R A;  1RIO H;  4NHJ A;  2M87 A;  3BPX A;  3AG4 H;  3LSR A;  4MQV A;  2L7M P;  2EV0 A;  2R7S A;  3WGH A;  2DW4 A;  4ZYH A;  2CS3 A;  1X1B A;  3SEQ A;  4B48 A;  1FTZ A;  2E5Z A;  3K70 C;  2CQN A;  3H92 A;  1S7E A;  1FEX A;  1UFM A;  3L7W A;  1KON A;  2PMZ N;  2IVM A;  3E6D A;  3OS2 A;  3ZMV A;  2LH9 A;  2K3P A;  1MJB A;  4IPA A;  5FFZ A;  5K5R A;  1R4M B;  1IUY A;  3TO7 A;  1IG7 A;  2CUZ A;  1B1B A;  4YIF A;  4ZZD A;  4DYC A;  2X1C A;  1ZLJ A;  4M9X A;  3A4C A;  1WKM A;  3ZMT A;  3HOV J;  3LMM A;  3NRV A;  3M3Y J;  1VQ7 I;  4IRI A;  2ZCW A;  4LIT A;  3MZY A;  2VL8 A;  2M7A A;  1ETX A;  2K85 A;  2L9N A;  2OA4 A;  2I10 A;  5LEJ A;  5E1W A;  3FX3 A;  3RPQ A;  2QQB A;  4CCN A;  1X1C A;  3I5U A;  2YPR A;  4BUP A;  5ED4 A;  2LSO A;  2W24 A;  2V1U A;  2ISY A;  1CGP A;  1MDM B;  3J7A O;  3ELK A;  4WXH A;  5J1Y A;  5LHH A;  3K4B A;  2MH9 A;  1MNE A;  5EG0 A;  2E60 A;  4GYI A;  3J81 K;  1V5G A;  2FBH A;  3AG2 H;  3FF5 A;  2HVQ A;  4OIN F;  1UEL B;  2DYR H;  2OQG A;  1WH7 A;  4M6X A;  2CW8 A;  3HDD A;  1JUM A;  2E71 A;  4BDZ A;  5E3N A;  2HQN A;  5E8G A;  2PBI A;  1P4W A;  2VT2 A;  3CQZ J;  3CJN A;  1BR2 A;  3AG1 H;  2XAS A;  2L4A A;  4LGW A;  2Y0S N;  3FKI J;  3KP4 A;  2PG4 A;  5ERI A;  3F22 A;  1R58 A;  4HNU A;  3ZR8 X;  1Z0X A;  4DBR A;  1H8A C;  1AWC A;  4A3K J;  2DN0 A;  1T33 A;  4HG2 A;  4J00 A;  3LAP A;  1H89 C;  1R6R A;  5EEA A;  3U21 A;  2VPR A;  4A12 A;  4HW0 A;  4XLC A;  4FAS D;  1R4N B;  3K4C A;  5FKK A;  4ZYA A;  2MBF A;  5GAH J;  5LGT A;  1U9O A;  4BHB A;  5IP6 A;  5HS8 A;  2KRH A;  3HTS B;  1YE9 A;  4G8X A;  5FFX A;  3BJO A;  4XN0 A;  2G7H A;  3QPH A;  4PJN A;  3G73 A;  3QP6 A;  3KYD B;  2JT1 A;  1BIB A;  2HYG D;  4A0Y A;  4IRH A;  5ICF A;  1T8I A;  4F93 B;  1O7F A;  5IPA A;  2BBY A;  3JRD A;  1SMT A;  2L0K A;  4UXN A;  1ZK8 A;  3GLX A;  3SQN A;  4Z6Y A;  5ILU A;  2RRE A;  4XKC A;  2JUG A;  4E6K G;  1A6Q A;  1MNM C;  5AON A;  4M73 A;  2XAQ A;  4XLE A;  3CLO A;  3TBI A;  3GTK J;  3IWF A;  4U0Y A;  3QU6 A;  1VZ0 A;  1O3T A;  3NEU A;  4A5N A;  4HLY A;  3CCM I;  3KEY A;  2P6S A;  3F8N A;  3U2R A;  1TT0 A;  1WJD A;  3BTL A;  1VQO I;  5LD2 C;  1EV7 A;  3VPR A;  5BPI A;  3BLY A;  5EG0 B;  4L0Y B;  1WJ5 A;  1XSD A;  2BV6 A;  5D5V B;  1HCR A;  4HDU A;  3LA2 A;  3FXL A;  3SZT A;  1J9I A;  1IXR C;  1P6R A;  4KNY A;  4LLG F;  4XLA A;  3L2C A;  3CF2 A;  3RIR A;  2VLA A;  2WB1 A;  3CMY A;  2EFP A;  2Z1D A;  5K5O A;  1IW7 F;  4HST A;  4KIF A;  3RYR A;  2XGE A;  3LST A;  1SVO A;  3ZN0 A;  3RTR A;  1LFB A;  4IRG A;  2M7B A;  3W6V A;  3LA3 A;  5AIQ A;  3EPZ A;  5GAD J;  1WJC A;  5IYB J;  1D1A A;  1DQU A;  4B09 A;  2OJE D;  1O3R A;  3IRR A;  2BW3 A;  1MMD A;  2DT7 B;  3FZV A;  3DF8 A;  4R8H A;  1FX7 A;  3VYS B;  4JP0 A;  4RM3 A;  4E7L A;  2O7O A;  1D1B A;  1UMQ A;  1XMK A;  5E3M A;  1PVE A;  1OCO H;  1SFX A;  5F1R A;  1B4A A;  4PJ0 C;  2F5D A;  2JA5 J;  3BCB A;  3G1O A;  1WJA A;  3PUB A;  4IKF A;  1FJL A;  3L09 A;  1Z7U A;  3MWM A;  2KIQ A;  2M1B A;  5K7F A;  1HKT A;  2NVT J;  2H1K A;  1L0O C;  1UST A;  1I50 J;  4PGH A;  3C18 A;  4CSW A;  1BN5 A;  2K4J A;  3GTQ J;  3BG9 A;  3NQO A;  4MQ9 F;  1OCP A;  2V79 A;  4HDV A;  1BJA A;  2HQA A;  1N75 A;  2H8W A;  1YTY A;  3IUO A;  3KEQ A;  1IRF A;  1T98 A;  3S2H J;  3MZH A;  4A0Z A;  3REO A;  1OPC A;  2MGQ A;  3S93 A;  2FJ1 A;  1H9G A;  1ODD A;  2W82 A;  1DGR M;  1YW7 A;  1U6G A;  1EF4 A;  3KP7 A;  2VPL A;  2VUM J;  2GBY A;  5KCM A;  3C2H A;  3I4P A;  2X0L A;  5A2Q Z;  2X48 A;  5D8K B;  4CZC A;  2XRL A;  3A0B C;  2A6E F;  4GDF A;  1R1T A;  4BAC A;  2VJI A;  1X3W B;  4Z2Y A;  2X51 A;  4FX4 A;  3HJE A;  3QPL A;  2X9D A;  1HLV A;  1B9N A;  2K27 A;  3CZ6 A;  1WFX A;  2L4M A;  4IHT A;  2JSP A;  2DFE A;  4B47 A;  1FSH A;  1TQI A;  3HSR A;  4IVN A;  4XOP A;  3TL4 X;  1W5S A;  2K40 A;  3BZK A;  2DTZ A;  2ZKZ A;  2CWE A;  1YS6 A;  3ZQF A;  3SJM A;  1R5G A;  2DK8 A;  3DTK A;  1T95 A;  2GXB A;  2ZSI B;  2P81 A;  4HEA 2;  1SEU A;  2NRA C;  2CMP A;  1TNT A;  1B59 A;  1JHF A;  2OF7 A;  2KLO A;  4OIR F;  1QO0 D;  5CLS A;  2L5Q A;  2DA4 A;  4N9I A;  5EYR A;  2BW3 B;  2TCT A;  3V8K A;  4U0V A;  5J47 A;  1R5I D;  4E70 A;  5D6E A;  5FLM J;  2GXG A;  3LSM A;  3OIO A;  4AYB A;  4EJU A;  5IP7 J;  1A35 A;  3QOP A;  2IBD A;  2KP6 A;  2XF7 A;  4CCJ A;  4C3H J;  4BY7 J;  3RJP A;  3ML6 A;  3PNT A;  3OSG A;  2YSR A;  3BTJ A;  2GOX B;  3NWT A;  3Q0W A;  4LLL A;  3HRT A;  1JGS A;  2L9S A;  1HDP A;  4A0X A;  2R5Y A;  1JJ6 C;  5TJJ A;  4Y52 J;  2QEN A;  6PAX A;  5HLT A;  1RRJ A;  2R7Z J;  2CW0 F;  3PFI A;  3WG7 H;  3L2R A;  4F7Z A;  4XN3 A;  1TWH J;  4EM0 B;  2HYJ A;  3OSF A;  1PDN C;  1X4P A;  4IEJ A;  3ZQH A;  5JFR A;  1IGN A;  1Y6I A;  2QF7 A;  2O9L A;  3ROU A;  2DT6 A;  2UXN A;  3K69 A;  1MD0 A;  3S8P A;  2YX7 A;  2R92 J;  4BU2 A;  4QPQ A;  2M0C A;  1D8K A;  1HSJ A;  3M8E A;  4RA2 A;  5JVG F;  2F4M B;  1WVR A;  2ZXH A;  4KIG A;  4M74 A;  2EFN A;  4UUS B;  1K78 A;  5F6F A;  3ABU A;  1Q1V A;  2ECB A;  2JRT A;  4XR6 A;  2E5N A;  4IHW A;  5F08 A;  3TP3 A;  3D5S C;  2M8G X;  5J6X A;  3MD2 A;  1WH5 A;  2FOW A;  5GTI C;  1MIJ A;  2JZY A;  1SAX A;  2R7X A;  1HW1 A;  3WTX C;  1TWG J;  4RAG A;  2OV7 A;  1VQ6 I;  3WU2 C;  2JTV A;  5C3E J;  5E79 C;  4HV6 A;  4J01 A;  1X1P A;  1V5E A;  3GFI A;  1WSU A;  1Q1H A;  1FOX A;  2WWY A;  2JVG A;  2ZNY A;  3RQI A;  3HHH A;  2K9Q A;  5H6R A;  3OYI A;  1KQ8 A;  2XAJ A;  2DOD A;  3P9K A;  1H0M A;  4HBL A;  1EH8 A;  4E7Z A;  3ECO A;  2VBX A;  3OYE A;  3JW4 A;  1U78 A;  1X3Z B;  2EIK H;  4KFC A;  3WTS C;  1Z9C A;  1Z3X A;  2NVQ J;  4N4N B;  2EZK A;  1XGS A;  3RCO A;  1FLI A;  1JJ8 C;  2G9W A;  1FBS A;  1DU0 A;  2IS1 A;  2HDC A;  3A2K A;  3FKJ A;  4LK1 F;  3VWB A;  1GUU A;  4D5F A;  5E17 F;  3BTI A;  3JR9 A;  3DFG A;  1JT6 A;  5D5W B;  3DPL C;  2VBY A;  1O4X A;  1D0X A;  5E18 F;  4ZDO A;  3KP3 A;  3RYP A;  3EYI A;  3F72 A;  2Q1Z B;  3HL2 A;  2AQE A;  2R5Y B;  4EM1 A;  5HVQ C;  2VON A;  1W7P A;  3LOC A;  5IY5 H;  3HOU J;  2DJI A;  2O3F A;  3JRA A;  2E1M B;  1D5V A;  4N9H A;  2LG4 A;  2K9N A;  2KRC A;  3IAM 2;  1XGO A;  2HOA A;  4ETS A;  1C0W A;  3GFJ A;  2Y9Z A;  2O5R A;  1K7A A;  3MKZ A;  2P7C B;  5FJ8 J;  3KZY A;  2Q0O A;  3HKZ N;  5J3L A;  1P4X A;  2VB6 A;  1W36 C;  1JKO C;  4M6V A;  4ENN A;  3HM5 A;  1I27 A;  4J19 A;  4NC6 A;  2XPW A;  3FMR A;  2BXY A;  4MGR A;  2FD5 A;  3ZN1 A;  3FXR A;  1MZB A;  1QVT A;  1XSX A;  2RC4 A;  4GYG A;  1TQM A;  1OR7 A;  5L3F A;  2VI6 A;  4XQF A;  1PUE E;  2KFD A;  4YFK F;  1K78 B;  3RKY A;  4EJT A;  1HF0 A;  2DOE A;  4Q5S F;  3OYC A;  4BJ5 C;  3I55 I;  2Y0M A;  2EB7 A;  3U1K A;  3WHC A;  4BL0 B;  5ICC A;  4HAM A;  1MMS A;  5H20 A;  4BQA A;  2A07 F;  3DU5 A;  3W6J B;  1G6N A;  5J40 A;  2PJP A;  3UKG A;  2F48 A;  2MA3 A;  2HZD A;  4ESJ A;  1POG A;  1P9Q C;  2XVC A;  3NWS A;  3ZRG A;  4AM3 A;  2X6W A;  4EGY A;  3H5N A;  5D6F A;  2DLL A;  2XC7 A;  4Y13 A;  4S0H B;  1FIP A;  4LJZ F;  2DA1 A;  5J1U A;  4A3L J;  3WTU C;  3PQK A;  3GWZ A;  3F23 A;  1BI1 A;  1JTX A;  3ZQQ A;  4DW6 A;  4PFO A;  2D1H A;  1YX5 A;  5HDK A;  3PQJ A;  2L01 A;  3CMA I;  2K86 A;  2MFZ A;  1V55 H;  3JRG A;  2O0Y A;  1HKQ A;  2LBF A;  3OIQ A;  3V7S A;  3KET A;  4XRS A;  4EGZ A;  4A3J J;  2GIV A;  2CSO A;  3IKV A;  3DP7 A;  3IP4 B;  3W2W A;  3CUO A;  2VQC A;  4QPO A;  5F0F A;  1IN4 A;  2V9P A;  4WXD A;  2JQ7 A;  4CO8 A;  3DV8 A;  4DQ2 A;  3FHN A;  1KZH A;  2DMP A;  5FLX Z;  1G3W A;  3EUH C;  1KU9 A;  4EV0 A;  3OYA A;  1R22 A;  3DTE A;  2KKO A;  4AIK A;  4IQJ A;  3K10 A;  1LE8 A;  4L9N A;  2PMZ A;  3OYJ A;  4I98 B;  2WAD A;  3L1P A;  5F64 A;  4RLF A;  2HPI A;  3EUA A;  1BW6 A;  1KQ9 A;  3F9K A;  4QTR A;  2ACJ A;  1VQ4 I;  1U5T C;  1W7P B;  4PK4 A;  2FXA A;  3WU1 B;  3HOY J;  3HRS A;  3MVP A;  4Y4R A;  3ZQ7 A;  1RKW A;  1W0T A;  1GV5 A;  1FNN A;  3GO5 A;  4RDU A;  1S8N A;  3CUQ A;  3BR3 A;  4OIO F;  2GM4 A;  1Y56 A;  1TWA J;  3Q5F A;  2JSC A;  4B43 A;  1D1C A;  5F04 A;  2VKD A;  5IYD J;  3OYB A;  1FTT A;  2VT3 A;  2CG4 A;  3FXM A;  4BXU A;  1REP C;  2X1E A;  5HLI A;  4ESB A;  4CCM A;  4JBA A;  4PUS A;  2E7W A;  4RB0 A;  3Q9V A;  3V7R A;  3CF5 F;  2CRG A;  3OL4 A;  1RZ4 A;  3HB9 A;  4BBR J;  3I4N J;  4DOZ A;  2UWM A;  3D5L A;  3M7G A;  2DOF A;  4KIS A;  3HYI A;  2EFO A;  1NTC A;  4WF2 A;  5CVJ A;  1WGX A;  3DBR B;  3FK6 A;  2LRE A;  4I76 A;  1IN7 A;  4U87 A;  3OYG A;  3KZI C;  5E3L A;  2DU9 A;  5DUK A;  2VE9 A;  1A6I A;  1MMA A;  5A2Q K;  2X85 A;  1W7P D;  4XLN F;  2Y0S A;  4U7B A;  2E1N A;  5J8F A;  1XCV A;  3CD6 I;  4ZH4 F;  1QPI A;  5M3F J;  1MGT A;  2BGC A;  3HOZ J;  3G6E I;  2BHY A;  4EJO A;  3E0J B;  4BJ6 C;  3B6A A;  2GIZ A;  1ERD A;  3S14 J;  1XSV A;  4EVI A;  2LBF B;  4ENJ A;  1OCZ H;  1ETK A;  3NAU A;  1DU6 A;  2PEX A;  1DP7 P;  2X1D A;  4L5J A;  1QQI A;  2WAE A;  5DS9 A;  1BI2 A;  3WE3 A;  3TOB A;  1F5T A;  2A61 A;  2FRH A;  2OTL I;  3CCU I;  3ZQI A;  2L9V A;  3ZQC A;  2ZJP F;  1LE8 B;  1UCR A;  2WAQ N;  3HGY A;  1YW8 A;  4ZYD A;  2QSH X;  2VAS A;  2IEK A;  1B8I A;  1JE8 A;  3MMY B;  2CQ7 A;  3T1B A;  4OMZ A;  4A69 C;  2LF7 A;  4CIC A;  2K9L A;  4HLX A;  1VQ8 I;  5DM6 F;  2PLY A;  2DCE A;  1VF9 A;  5FKN A;  4L9J A;  1XC5 A;  4PCQ A;  3S3N A;  1ZN2 A;  3QAH A;  3CUQ B;  1PP7 U;  5E1Z B;  1X3U A;  1Y0N A;  3LQR A;  3KE2 A;  4MNU A;  3SHF A;  1Z05 A;  5JR3 A;  3FXU A;  2XUB A;  2GA2 A;  3PFY A;  2W1O A;  4CYD A;  3EDP A;  3H5A A;  2CH0 A;  2OZ6 A;  3I56 I;  1FBQ A;  1P7I A;  2HNH A;  2E2J J;  1MBJ A;  1R49 A;  1XN7 A;  1YOV B;  3BR6 A;  1I3A A;  1R1V A;  2EFW A;  2OU2 A;  1IAW A;  2M2E A;  1GXQ A;  1XGN A;  2ZC2 A;  4G7Z F;  5L3C A;  2OTJ I;  2I8D A;  4EMS A;  4AC0 A;  1Z3Y A;  3TQN A;  1AOY A;  1DDN A;  1W5C C;  3KIO A;  2X6Y A;  2B9S A;  1QNT A;  1YLF A;  3WGI A;  2B7E A;  2BY2 A;  2JPC A;  1S7O A;  3T0Y A;  2F5E A;  1JGG A;  3WHB A;  3JCU C;  1IXC A;  3VDX A;  4CCK A;  4O5V A;  2NS8 A;  1ZRD A;  3SDB A;  2IAI A;  4BAY A;  5FRM A;  2WBM A;  2DFI A;  2XPV A;  4XOT A;  1RPW A;  4QLC U;  4BXX J;  4JX4 A;  1FP2 A;  2W48 A;  3G3Z A;  2PJR A;  2VJJ A;  1FOW A;  1FYK A;  1YRN A;  3CDI A;  4CGZ A;  3G2B A;  4Y3O A;  2Z99 A;  2A69 F;  3A03 A;  1TNS A;  3GBG A;  1GXP A;  3K4L A;  3S32 A;  1WI3 A;  1V5F A;  4AUX A;  2O8K A;  1VI0 A;  4XRF A;  1VND A;  2LP0 A;  2QKM B;  1J09 A;  1WRJ A;  5DCF A;  5FGM A;  5LLQ A;  3BOQ A;  3B6C A;  3DLA A;  2H94 A;  2JJ7 A;  4RB3 C;  2XRO A;  2LNB A;  3EET A;  1FPQ A;  4HF0 A;  1ZEL A;  2KRF A;  5CVI A;  5FKM A;  1SAN A;  2XDV A;  2MG4 A;  5D5X B;  3HPG A;  3I59 A;  4HNT A;  3QPT A;  4XK4 A;  4KA4 A;  4A3F J;  1WI9 A;  3AG3 H;  3A02 A;  3W6K B;  2QA4 I;  3CP2 A;  4M3D A;  3GTL J;  1ULY A;  2ZJ2 A;  3F8B A;  4LG0 A;  1LFU P;  1BR1 A;  3H1C A;  4L9V A;  3JAM Z;  1QHG A;  1IXS B;  2M30 A;  1VQK I;  1I1S A;  4JYK A;  2QCO A;  4MFD A;  3OYH A;  3K4K A;  2ZJR F;  2PN6 A;  2OPT A;  2DQL A;  3GTP J;  2A6H F;  2V26 A;  3KP6 A;  3K1M A;  1OFC X;  5IT3 A;  2MLK A;  2A5W A;  3OIP A;  3ZMD A;  2LVS A;  3C3W A;  2DI3 A;  3JRF A;  4UB8 C;  3TMO A;  4B3X A;  1IN6 A;  2F5C A;  1N25 A;  3K2Z A;  2ZB9 A;  3F8M A;  3VOE A;  1QPM A;  5F0H A;  4NB5 A;  1J59 A;  1IN5 A;  2F6C A;  1JUP A;  4H4K C;  4MLO A;  4NC7 A;  4XIC A;  3DTI A;  1VQP I;  3BP8 A;  2BOL A;  1P92 A;  3ECH A;  4G6Q A;  1ZAR A;  3NAR A;  4DZJ A;  2RKH A;  4KDP A;  1SMY F;  3WG9 A;  4M71 A;  4FE7 A;  2RNJ A;  5IOZ A;  2V9V A;  3OS0 A;  1ETY A;  1KGS A;  5IOY A;  1XD7 A;  4ZTF A;  1XX5 A;  3D1N I;  3LSH A;  2LKP A;  2OAZ A;  2RN7 A;  3N05 A;  2EWN A;  4UB6 C;  3G71 I;  2PJR B;  1ACI A;  1ZRC A;  2ZME C;  1FWZ A;  2W84 A;  2BY1 A;  2L2O A;  3ABT A;  1YRN B;  4Y17 A;  2R5Z A;  5HOD A;  3T5X A;  3LNQ A;  3SXY A;  3CCV I;  3H36 A;  1RUN A;  5LBQ A;  2DA3 A;  3JTG A;  3ZQG A;  3PNV A;  2M8E A;  5LGN A;  4L5I A;  2WY8 Q;  3F3X A;  3K1N A;  3HPH A;  3S16 J;  2QSF X;  3IRQ A;  2IW5 A;  2VOO A;  3DBL B;  3KFW X;  1W1W E;  1T0F A;  5DEQ A;  4KIT B;  1RI7 A;  1V54 H;  3DKX A;  1STZ A;  4UHT A;  2CV1 A;  1G3S A;  3HBL A;  4XLF A;  3HHG A;  2H27 A;  4BNC A;  3E6M A;  2L02 A;  3GVA A;  3OOP A;  3S3M A;  3KCC A;  2TDX A;  4F3Q A;  2M4K A;  3CCR I;  3AL0 B;  2VC1 A;  4IOC F;  4FE4 A;  1JUS A;  2L9R A;  5J4Y A;  4BHP A;  3M4O J;  1FYM A;  1AHD P;  2QZ8 A;  3OWT A;  4II3 A;  3CTA A;  4II2 A;  5M5Y J;  1RES A;  3I59 B;  1D0Z A;  2FQ4 A;  2L3D A;  2Y69 H;  4PJM A;  2R7D A;  4W97 A;  2EIM H;  3N97 A;  3CO7 C;  5FLX K;  3UR3 C;  4BDY A;  1WWX A;  5BMZ A;  1YHQ I;  4LG0 B;  2UV1 A;  1T39 A;  2NVU B;  3L2U A;  1MJ9 A;  3FHZ A;  2CQX A;  3I58 A;  1AKH A;  4ZDP A;  4XL9 A;  4HOB A;  3H3U A;  2J5O A;  1V3F A;  5ILS A;  4L0Z B;  3CDL A;  1Z1D A;  5FRN A;  2PX9 A;  5KVR A;  1SFE A;  2Y31 A;  3L2Q A;  1R71 A;  4HX4 A;  3GEZ A;  1LDD A;  1R7J A;  2BEO A;  1SD5 A;  2DK5 A;  1CQT A;  2I5U A;  2EA2 A;  2IA0 A;  4X1E A;  2ZSH B;  3SFI A;  3BPV A;  1VQN I;  2KDZ A;  2WY7 Q;  2K4B A;  2ME0 A;  2DTR A;  4I2O A;  2JA6 J;  2NS0 A;  4LB6 B;  2B63 J;  2CUF A;  4JX5 A;  4BYY A;  5F1J A;  2O6G E;  4JOM A;  2E7X A;  3RQ4 A;  3J80 K;  1QZY A;  2LD5 A;  4BKX A;  3GME A;  3LSP A;  2JA2 A;  1X2N A;  2Y30 A;  1I3Q J;  1WHU A;  5DTD A;  2JPB A;  3QP5 A;  3J7Y J;  1FP1 D;  3AFH A;  3CJT B;  4UNO A;  2IA1 A;  2XRN A;  3O8G A;  5B1A H;  4D7N A;  3HOS A;  2R5Z B;  2Y48 A;  3ZXS A;  3E97 A;  3LSG A;  3A01 A;  3MKL A;  4DYR A;  3JRC A;  4MEX F;  2UZK A;  2V9K A;  4MFE A;  2AXT C;  3TW7 A;  1JXS A;  4G9Y A;  2QQ8 A;  3VEP A;  4Q48 A;  1IDY A;  2V4J C;  3L00 A;  2COB A;  3K4N A;  3CES A;  3QU3 A;  4H0E A;  2H8R A;  1YS7 A;  1K4T A;  2DXI A;  1GV2 A;  1LQ1 A;  1IDZ A;  5LRR A;  2L7K A;  4G12 A;  1MMG A;  3HKZ A;  2KZG A;  4YRV A;  1EH7 A;  1FMV A;  3X2Q H;  3Q0U A;  4YEL A;  1U8R A;  1RKT A;  4OIQ F;  3IHU A;  2KJC A;  4I01 A;  5E3O A;  1BBY A;  2QQA A;  1E3H A;  5CQE A;  2HGC A;  4I02 A;  5HS7 A;  4AVP A;  2W4S A;  4IF4 A;  5HDN A;  3I54 A;  3C2B A;  5FLV A;  2B0L A;  1OYW A;  4PDK A;  1K83 J;  3CCL I;  2ESH A;  1Y8R B;  5JVT A;  2BVL A;  3E5Q A;  4AVZ A;  5KHD A;  3IKT A;  4CH7 A;  3CDH A;  1IZ1 A;  2D2W A;  2DQR A;  4IXA A;  1ITY A;  4A2U A;  2XGD A;  4IZZ A;  5EEG A;  2VOP A;  3L2V A;  1ON1 A;  3TDU C;  2GLO A;  2BYV E;  3E6C C;  2LMD A;  3C2G A;  4BQO A;  2VQL A;  3D5R C;  1FSE A;  2OUM A;  1SD7 A;  2W57 A;  4MO7 A;  5B1B H;  2R7F A;  1BOB A;  3BRO A;  2OQR A;  1APL C;  2D5V A;  1YIT I;  4EEF G;  2P5V A;  1Z6R A;  5ICE A;  2H6C A;  1X2M A;  2HXO A;  1D0Y A;  1FY7 A;  4RLQ A;  1Y1W J;  4CYC A;  1SFK A;  4U0W A;  2L7F P;  1D3Y A;  1N78 A;  2VC0 A;  2HS5 A;  3C7J A;  3BG7 A;  2M0M A;  1HKS A;  3GCM A;  2HOS A;  3A01 B;  2HQR A;  5LRS A;  1A31 A;  2KMU A;  2QUF A;  5FRO A;  2BHZ A;  2ICW G;  2IGK A;  4AID A;  4X0G A;  3FXK A;  3S2D J;  5E1X A;  1ZG1 A;  1TTY A;  2EIL H;  1EH6 A;  4ANJ A;  4XKV A;  2JRM A;  1R9T J;  3SZG A;  1ENH A;  4ZZL A;  2MC3 A;  1KA8 A;  2N8G A;  2KIS A;  4B3A A;  5J8C A;  1QBJ A;  1ZAO A;  2CQK A;  2ZME A;  3F6V A;  4FX0 A;  2EIJ H;  2O61 A;  1MND A;  1WJF A;  1Y1V J;  3GW2 A;  3I71 A;  2Q2E A;  4JX6 A;  1Y8Q B;  3KYC B;  3V4G A;  4GO1 A;  1F1Z A;  4M3G A;  3D0S A;  3K70 D;  2MYS A;  2GXA A;  4FIS A;  3BG6 A;  4DNC A;  5LEK A;  4UVB A;  2O03 A;  5EZH A;  1NHA A;  4A5M A;  5DD8 A;  4BE1 A;  4YIR X;  1LPQ A;  2A3S A;  1NH3 A;  3PNY A;  2VN2 A;  1IJW C;  3MZ8 A;  4HYE A;  1WQ2 A;  3R6S A;  2XPU A;  2EK5 A;  1XCB A;  2YUS A;  3E5U A;  1LVA A;  1KYW A;  4RB2 C;  2XSD C;  5F27 A;  1XPX A;  4CZZ A;  4UY8 I;  2P0W A;  3AAF A;  5DDG A;  5L3E A;  2EJR A;  1ZR4 A;  3TO6 A;  3O8H A;  3HEF A;  3MN2 A;  3JAM K;  2P5L C;  2EPF A;  3LFK A;  3IC7 A;  3ASO H;  1O57 A;  4FHT A;  4E7S A;  1FZP B;  4IO9 F;  5IYC J;  4KYW A;  1OMI A;  4B44 A;  3DLL F;  3CP8 A;  2X6X A;  3PJR A;  1OYI A;  4XNF A;  4GRI A;  1EA3 A;  2H09 A;  5KAI C;  3SFZ A;  1XTA A;  3V42 A;  4C3I J;  1SFU A;  1FMW A;  1BR4 A;  4M3B A;  3VFZ A;  2VE8 A;  1RR7 A;  1Z67 A;  1VQL I;  3FK7 A;  2KZV A;  2LTP A;  2VQH A;  2RQQ A;  3M1C A;  2EZI A;  2ZNZ A;  2X4H A;  4AWX B;  3PUF A;  1IF1 A;  2MC4 A;  1MJA A;  1OJL A;  4WWC A;  1B72 A;  4UVA A;  4A3B J;  3MKY B;  4UUT A;  4XM3 A;  1PUF A;  1UZC A;  3BG5 A;  3HRM A;  3BDD A;  2ELH A;  1YW9 A;  2V7F A;  5D8L B;  1DUX C;  1U2W A;  5EZG A;  4RM2 A;  2EH3 A;  2WAQ A;  2QBY A;  5E8I A;  3DKW A;  1SD4 A;  5TRD A;  5E20 A;  3HUG A;  2PMH A;  2KT0 A;  1HC8 A;  4LK0 F;  3BWG A;  1S5L C;  2A68 F;  4BHC A;  3I53 A;  3HIF A;  3F8F A;  3MAJ A;  4V2G A;  3H5R A;  2IGO A;  2F4I A;  2HI3 A;  4LD5 A;  3HOW J;  5AIP A;  4OMY A;  2ID3 A;  2K3F A;  2PI0 A;  2CV2 A;  4NUB A;  1LEA A;  3H35 A;  3OYN A;  1CF7 A;  1IRZ A;  3E5X A;  1OKR A;  3O3K A;  4BJT A;  2JA7 J;  3N4M A;  3R4K A;  5L3B A;  2IS2 A;  3KYL A;  3K4M A;  3ZMU A;  4G7O F;  1OCR H;  1T08 B;  3WOD F;  2VKH A;  3E7L A;  3IWZ A;  3LA7 A;  2DT5 A;  3K2A A;  2LFB A;  3HSF A;  1ON2 A;  3HXL A;  4BEH A;  3CCJ I;  2R0Q C;  4I99 C;  3PO2 J;  4RB1 A;  5K7Z A;  4ENK A;  1TP4 A;  3CC7 I;  2BVM A;  1OLT A;  1YFH A;  1MW7 A;  5HNF A;  3TOA A;  4V19 K;  2P4W A;  4IX7 A;  3ASN H;  1K79 A;  3BR1 A;  2R7R A;  3FDY A;  1FT9 A;  3BJA A;  2HDW A;  1KQ0 A;  3F21 A;  2FBK A;  3ONQ A;  2H1L A;  1UJ8 A;  4LIU A;  5FKL A;  3G1L A;  3RSN A;  4YFX F;  1DPU A;  2DMQ A;  4FET A;  2QKL B;  4A3E J;  1GDT A;  1AA7 A;  4WX9 A;  3WTZ A;  3FXO A;  1M1E B;  1BI0 A;  4WK8 F;  5C4X J;  3VSK A;  2L7Z A;  3RDI A;  2O8X A;  4S05 A;  2V6C A;  2NYX A;  1S9H A;  2PQ8 A;  2Q8K A;  5LHG A;  1LEB A;  3J80 Z;  4GFB A;  2NOG A;  1I39 A;  3LWF A;  2V6E A;  1B72 B;  3P9C A;  4RAY A;  2EZH A;  2LF8 A;  4M9Z A;  2R7V A;  2UUZ A;  1HOM A;  5EGO B;  2QBY B;  1MBG A;  2GA1 A;  3GLL A;  2RAE A;  3HUG B;  3WE2 A;  2JVH A;  5FB2 A;  1FOY A;  1ZHF A;  4HV5 A;  2R7Q A;  1OQY A;  1P2F A;  4HQE A;  1PYV A;  1ETW A;  4OAY A;  1EKE A;  4MTD A;  1JTY A;  4QSH A;  1GVJ A;  2XSJ C;  3FM3 A;  4V2F A;  1K4S A;  3VYR B;  2KHM A;  1G2H A;  4M6Y A;  3G4S I;  1WCM J;  1XS9 A;  3ZCO A;  2KIU A;  1J75 A;  3LSI A;  4XRS G;  2XKO A;  2OZU A;  1ETO A;  1V4R A;  2ETH A;  5B3S H;  2DA7 A;  3COA C;  3TKY A;  1NG6 A;  1ZLK A;  5JHU A;  1UHW A;  3HOX J;  4L18 B;  4BEH B;  1UHS A;  2FQ3 A;  2WAF A;  4O6J A;  3VYT B;  1YO5 C;  2YU3 A;  2EQR A;  2PMU A;  4BE2 A;  2DFF A;  3TP0 A;  5DCM A;  4ZYE A;  3DEW A;  3Q0V A;  1VQ9 I;  3E1S A;  1Z77 A;  4HX8 A;  4C9Y A;  4F55 A;  3FMQ A;  2QVO A;  3GX4 X;  3S1M J;  2CUE A;  3O2P E;  3IAS 2;  3PL8 A;  2K02 A;  3G1M A;  2WV1 A;  4HNV A;  2QEX I;  2IS4 A;  5LGU A;  4QIW N;  2IGN A;  3P5J A;  4XON A;  4Q47 A;  1XMX A; 
#chains in the Genus database with same CATH homology
 5IT9 Z;  3BZ6 A;  4KUM A;  5DYM A;  1G4D A;  1IRG A;  2DPU A;  2GZW A;  1KU2 A;  3TO9 A;  3C1D A;  4AIJ A;  1TQP A;  1TW3 A;  2LDU A;  2F2E A;  3K1P A;  2H6B A;  1J7K A;  3KP5 A;  2R3S A;  1HW5 A;  1P4A A;  2ISZ A;  2Y75 A;  2Z3Y A;  1S6L A;  4QWQ A;  2IT0 A;  1SD6 A;  5DUI A;  4CDG A;  3WTV C;  3LQQ A;  1GHC A;  1R5H A;  4KIC A;  5D4S A;  1H9T A;  4I0A A;  2P8T A;  2NNN A;  2CYY A;  4HF1 A;  4KN7 X;  2F5F A;  3RPU A;  4KMF A;  1ONV A;  3BY6 A;  3GFL A;  1ZRF A;  3R0J A;  4P55 A;  2IJL A;  5DCM B;  5HLH A;  3CO6 C;  1ZGA A;  2IA2 A;  1XMA A;  2ADU A;  3R60 A;  2E1C A;  3R0A A;  1K6O A;  3KLN A;  4S04 A;  3EUH A;  2HYF A;  3RKW A;  2EFQ A;  2WTE A;  4OU0 A;  3TDZ C;  4XBF A;  1B6A A;  2A5Y B;  3FMS A;  3ERE D;  1R23 A;  3FXQ A;  5KK1 A;  3V8J A;  1U5T A;  4RGS A;  1BC7 C;  3KP2 A;  4HZF A;  3R61 A;  1T2K A;  1HST A;  3EQL F;  2D1V A;  3B73 A;  1F4K A;  1B9M A;  4B8X A;  4PGG A;  4XSX F;  3HSE A;  4EJW A;  3F6O A;  1KU7 A;  1ZGJ A;  2P7V B;  4AIH A;  4KN4 X;  3I0T A;  2XGX A;  3VOD A;  5CJ9 A;  2QQ9 A;  4P9U A;  4XSZ F;  4OIP F;  4MEY F;  2HOE A;  4AD9 A;  2XKP A;  2ESN A;  3U9G A;  2IPQ X;  4A6E A;  4KT5 C;  3SZP A;  4LLN A;  2XHK A;  3ULQ B;  2XIG A;  2HKO A;  3MEX A;  2CFX A;  5EEH A;  1OYY A;  1RNL A;  2XAF A;  3OV8 A;  1HBX G;  4G94 A;  4YFN F;  4I09 A;  4WCG A;  4HA8 A;  3WU0 A;  2XAH A;  2BE5 F;  2RQP A;  1LDJ A;  4CXF A;  4LB5 A;  1U5T B;  4RAZ A;  2KIM A;  3FM5 A;  1U3E M;  1ZYR F;  1S7A A;  4LFU A;  5CYV A;  3O6B B;  2AS5 F;  2YR2 A;  2P6T A;  2VXZ A;  5JI6 A;  4P96 A;  1G3T A;  4UUV A;  4K2E A;  1F9N A;  2FMY A;  2CGP A;  1W5T A;  2HR3 A;  4HF2 A;  1S29 A;  1PP8 F;  2HKX A;  5D4R A;  4O3M A;  1L3L A;  5ICG A;  3L9F A;  1J2X A;  4RGR A;  4A6D A;  4I0B A;  1TBX A;  2FEZ A;  1BI3 A;  1ZG3 A;  3KZZ A;  1T38 A;  2EA4 A;  2WV0 A;  1YG2 A;  1BM9 A;  1XDU A;  1BIA A;  4ON0 A;  3DPT A;  1J0R A;  2PFB A;  3B02 A;  2COM A;  5BS6 A;  1LB2 A;  2DBB A;  5BPD A;  2OBP A;  2AXL A;  5L3D A;  3U1D A;  3GFM A;  4P5O A;  1BC8 C;  1DPR A;  5IT9 K;  2QYO A;  2ZO4 A;  3P7N A;  2FU4 A;  2HTJ A;  3RI4 A;  3CUQ C;  3JSP A;  1USS A;  2HWV A;  4HQM A;  1D8J A;  3DXJ F;  2VBZ A;  2STW A;  2HTS A;  1XGM A;  1UB9 A;  1JHH A;  2QM3 A;  4UVC A;  2V1X A;  1HW2 A;  2STT A;  2Z9O A;  3MQ0 A;  2FML A;  1ZG5 A;  2WC2 A;  3M9A A;  2V1D A;  5K5Q A;  4EM2 A;  3WTW C;  4UV9 A;  1HQC A;  2DO7 A;  4ESF A;  3HOT A;  4IJA A;  1S3J A;  5LHI A;  2FSW A;  4RGX A;  1R00 A;  2RVC A;  3HRU A;  1HXD A;  5L3G A;  2K7L A;  3J81 Z;  4M72 A;  2VBW A;  4I7H A;  2GAU A;  2HZT A;  1ZH5 A;  5HS9 A;  4N0B A;  2W25 A;  5FD6 A;  2FNA A;  2G7U A;  4UV8 A;  5DD4 A;  3GXO A;  3KEO A;  5K1Y A;  3P9I A;  2YX4 A;  1KU3 A;  3WTY C;  2P5K A;  1Y0U A;  2D45 A;  4D0P A;  2FBI A;  1O7L A;  2OD5 A;  4LMY A;  4EQQ A;  4EJV A;  4Y15 A;  4MTE A;  1YIO A;  2MD5 A;  1FC3 A;  1LJ9 A;  4IHS A;  2CO5 A;  3QRF F;  4R79 A;  1O3Q A;  3HTU A;  4OOI A;  4FT8 A;  4L9T A;  3E3V A;  1O3S A;  1QGP A;  2EV5 A;  2VOD A;  2IP2 A;  2Z5U A;  3WTT C;  3V7C A;  2QWW A;  3BJ6 A;  2Z33 A;  3GZ5 A;  2ZME B;  4ENM A;  5BOX A;  3M8F A;  2HEO A;  2FF4 A;  4NQW A;  4RGU A;  2RGV A;  2ZFW A;  3MCZ A;  3TGN A;  4P9F A;  4WXC A;  4PZJ A;  1A04 A;  5D5U B;  2W85 A;  1E2X A;  4KMU X;  2MH2 A;  2DPD A;  3E6B A;  1TLH B;  3ZMZ A;  3VB2 A;  2HFH A;  5BQT A;  2KIF A;  2KJB A;  1J5Y A;  4RS8 A;  4XLP F;  3GYH X;  1VTN C;  3ISP A;  4JQF A;  3I64 A;  3FWE A;  2FE3 A;  2ZXJ A;  2XV4 S;  2RDP A;  3GF2 A;  1Z91 A;  1R36 A;  1W4M A;  4BH9 A;  4CHU A;  3K9T A;  4GCV A;  1FOK A;  3MFK A;  1R1U A;  2IRF G;  4M9S A;  1I5Z A;  5H6Q A;  1G3Y A;  3RKX A;  2GQQ A;  3T8T A;  2FNP A;  1FYL A;  4YII A;  2L54 A;  5CVR A;  1BOA A;  1T6S A;  3JTH A;  4ZYG A;  3KLO A;  5CVU A;  1KYZ A;  1XB4 A;  1IN8 A;  3LAJ A;  3IL2 A;  2FOK A;  1UHM A;  1LDK B;  1I1G A;  2XAG A;  4G6D A;  2ZBK A;  4TV7 A;  2M45 A;  4GXO A;  2FA5 A;  3EYY A;  3V8L A;  2NNY A;  3DQV C;  4R1H A;  4U7D A;  1LNW A;  2GWR A;  2J5P A;  4YG2 F;  1CF7 B;  1QZZ A;  3GUD A;  4MHG A;  4ASN A;  4Q4Z F;  5FD5 A;  1TW2 A;  5CVV A;  4JK1 X;  2RV8 A;  3M1E A;  3DEU A;  1YQA A;  3Q9S A;  5HLG A;  3F8C A;  1MDM A;  3JSO A;  3ZPL A;  5ILV A;  2EV6 A;  2M5W A;  1FBU A;  5DV5 A;  1RUO A;  2MLG A;  2DAO A;  3H3Z A;  5HDG A;  3GZ6 A;  1I6X A;  1XDS A;  1Z6T A;  2NAZ A;  4U88 A;  3ZMS A;  4KIB A;  5FO5 A;  2UXX A;  2C6Y A;  5HOO A;  2QLZ A;  4GGG A;  3WGG A;  4G7H F;  1E17 A;  3K0L A;  3S2W A;  1ZRE A;  4HX7 A;  3ZP5 A;  1YYV A;  1MKM A;  1RIO H;  3T8R A;  4NHJ A;  2M87 A;  3BPX A;  4MQV A;  2EV0 A;  3WGH A;  2DW4 A;  4ZYH A;  3H92 A;  1UFM A;  3L7W A;  2IVM A;  3E6D A;  3ZMV A;  1MJB A;  4IPA A;  5FFZ A;  5K5R A;  1IUY A;  3TO7 A;  1B1B A;  4YIF A;  4ZZD A;  1ZLJ A;  4M9X A;  1WKM A;  3ZMT A;  3NRV A;  4IRI A;  2ZCW A;  3MZY A;  2OA4 A;  5LEJ A;  5E1W A;  3FX3 A;  3RPQ A;  2QQB A;  3I5U A;  2YPR A;  5ED4 A;  2LSO A;  2W24 A;  2V1U A;  2ISY A;  1CGP A;  1MDM B;  3J7A O;  3ELK A;  4WXH A;  5LHH A;  2MH9 A;  4GYI A;  3J81 K;  2FBH A;  4OIN F;  3FF5 A;  2OQG A;  4M6X A;  2HQN A;  5E8G A;  2PBI A;  1P4W A;  2VT2 A;  3CJN A;  2XAS A;  2L4A A;  4LGW A;  3KP4 A;  2PG4 A;  5ERI A;  3F22 A;  1R58 A;  1AWC A;  3LAP A;  4A12 A;  4HW0 A;  2MBF A;  5LGT A;  4BHB A;  5HS8 A;  3HTS B;  4G8X A;  5FFX A;  3BJO A;  2G7H A;  3QPH A;  3G73 A;  3QP6 A;  2JT1 A;  1BIB A;  2HYG D;  4A0Y A;  4IRH A;  5ICF A;  1O7F A;  2BBY A;  1SMT A;  4UXN A;  3GLX A;  3SQN A;  5ILU A;  5AON A;  4M73 A;  2XAQ A;  3CLO A;  3IWF A;  4U0Y A;  3QU6 A;  1O3T A;  3NEU A;  4A5N A;  4HLY A;  2P6S A;  3F8N A;  3U2R A;  1EV7 A;  5BPI A;  4L0Y B;  1XSD A;  2BV6 A;  5D5V B;  4HDU A;  3LA2 A;  3SZT A;  1J9I A;  1IXR C;  1P6R A;  4KNY A;  4LLG F;  3L2C A;  3RIR A;  2EFP A;  5K5O A;  1IW7 F;  4KIF A;  3RYR A;  3LST A;  3ZN0 A;  3RTR A;  4IRG A;  3LA3 A;  5AIQ A;  4B09 A;  1O3R A;  3IRR A;  3FZV A;  3DF8 A;  4R8H A;  1FX7 A;  1XMK A;  1SFX A;  5F1R A;  1B4A A;  2F5D A;  3L09 A;  1Z7U A;  3MWM A;  2M1B A;  1HKT A;  1L0O C;  1UST A;  4PGH A;  3C18 A;  1BN5 A;  2K4J A;  3NQO A;  4MQ9 F;  4HDV A;  2V79 A;  1BJA A;  1YTY A;  3KEQ A;  1IRF A;  1T98 A;  3MZH A;  4A0Z A;  3REO A;  1OPC A;  1H9G A;  1ODD A;  1YW7 A;  1U6G A;  3KP7 A;  3I4P A;  2X0L A;  5A2Q Z;  5D8K B;  2A6E F;  1R1T A;  4Z2Y A;  4FX4 A;  1B9N A;  2K27 A;  2L4M A;  4IHT A;  1FSH A;  1TQI A;  3HSR A;  4IVN A;  1W5S A;  2ZKZ A;  2CWE A;  1YS6 A;  1R5G A;  2DK8 A;  2GXB A;  2NRA C;  1TNT A;  1B59 A;  1JHF A;  4OIR F;  1QO0 D;  5CLS A;  4N9I A;  3V8K A;  4U0V A;  4E70 A;  5D6E A;  2GXG A;  4EJU A;  3QOP A;  3RJP A;  3ML6 A;  2YSR A;  4LLL A;  3HRT A;  1JGS A;  4A0X A;  5TJJ A;  2QEN A;  6PAX A;  2CW0 F;  3PFI A;  4F7Z A;  4EM0 B;  1PDN C;  5JFR A;  3ROU A;  2UXN A;  3K69 A;  1MD0 A;  2YX7 A;  1D8K A;  1HSJ A;  3M8E A;  4KIG A;  4M74 A;  2EFN A;  1K78 A;  5F6F A;  3ABU A;  2JRT A;  5J6X A;  2JZY A;  1SAX A;  1HW1 A;  3WTX C;  2JTV A;  4HV6 A;  3GFI A;  1WSU A;  1Q1H A;  2WWY A;  2ZNY A;  3HHH A;  5H6R A;  1KQ8 A;  2XAJ A;  3P9K A;  1H0M A;  4HBL A;  1EH8 A;  3ECO A;  2VBX A;  1U78 A;  3JW4 A;  4KFC A;  3WTS C;  1Z9C A;  1XGS A;  1FLI A;  2G9W A;  1FBS A;  2HDC A;  4LK1 F;  5E17 F;  3DFG A;  5D5W B;  3DPL C;  2VBY A;  5E18 F;  3KP3 A;  3RYP A;  3EYI A;  3F72 A;  4EM1 A;  5HVQ C;  2VON A;  1W7P A;  2O3F A;  1D5V A;  4N9H A;  1XGO A;  4ETS A;  1C0W A;  3GFJ A;  1K7A A;  2P7C B;  3KZY A;  2Q0O A;  1P4X A;  4ENN A;  1I27 A;  3FMR A;  4MGR A;  3ZN1 A;  3FXR A;  1MZB A;  1XSX A;  2RC4 A;  4GYG A;  1TQM A;  1OR7 A;  5L3F A;  1PUE E;  4YFK F;  1K78 B;  3RKY A;  4EJT A;  4Q5S F;  2Y0M A;  2EB7 A;  5ICC A;  4HAM A;  5H20 A;  4BQA A;  2A07 F;  3W6J B;  1G6N A;  2PJP A;  2MA3 A;  4ESJ A;  2XVC A;  4EGY A;  5D6F A;  2DLL A;  4Y13 A;  4LJZ F;  3WTU C;  3PQK A;  3GWZ A;  3F23 A;  1BI1 A;  2D1H A;  5HDK A;  3PQJ A;  2L01 A;  2K86 A;  2O0Y A;  1HKQ A;  3V7S A;  3KET A;  4EGZ A;  2GIV A;  2CSO A;  3IKV A;  3DP7 A;  3CUO A;  1IN4 A;  4WXD A;  4CO8 A;  3DV8 A;  4DQ2 A;  5FLX Z;  1G3W A;  1KU9 A;  4EV0 A;  1R22 A;  2KKO A;  4AIK A;  4L9N A;  4I98 B;  5F64 A;  1KQ9 A;  2ACJ A;  1U5T C;  1W7P B;  3WU1 B;  2FXA A;  3HRS A;  3ZQ7 A;  1FNN A;  3GO5 A;  1S8N A;  3CUQ A;  4OIO F;  3Q5F A;  2JSC A;  2VT3 A;  2CG4 A;  4BXU A;  1REP C;  5HLI A;  4ESB A;  4JBA A;  2E7W A;  4RB0 A;  3Q9V A;  3V7R A;  1RZ4 A;  2UWM A;  3D5L A;  3M7G A;  3HYI A;  2EFO A;  4WF2 A;  5CVJ A;  1IN7 A;  2DU9 A;  5DUK A;  2VE9 A;  5A2Q K;  4U7B A;  4XLN F;  1W7P D;  2E1N A;  5J8F A;  1XCV A;  4ZH4 F;  1MGT A;  2BGC A;  4EJO A;  1XSV A;  4EVI A;  4ENJ A;  2PEX A;  1DP7 P;  4L5J A;  1QQI A;  1BI2 A;  3WE3 A;  3TOB A;  1F5T A;  2A61 A;  2FRH A;  1UCR A;  1YW8 A;  4ZYD A;  1JE8 A;  3T1B A;  4OMZ A;  4CIC A;  2LF7 A;  4HLX A;  2PLY A;  4L9J A;  4PCQ A;  1ZN2 A;  3QAH A;  3CUQ B;  1PP7 U;  5E1Z B;  1X3U A;  3LQR A;  3KE2 A;  4MNU A;  3SHF A;  1Z05 A;  5JR3 A;  3FXU A;  2XUB A;  2GA2 A;  4CYD A;  3EDP A;  2OZ6 A;  1FBQ A;  1XN7 A;  1R1V A;  2EFW A;  2OU2 A;  1IAW A;  1GXQ A;  1XGN A;  4G7Z F;  5L3C A;  4EMS A;  3TQN A;  1AOY A;  1DDN A;  1QNT A;  1YLF A;  3WGI A;  2JPC A;  1S7O A;  3T0Y A;  2F5E A;  1IXC A;  4O5V A;  1ZRD A;  4BAY A;  2DFI A;  4QLC U;  1FP2 A;  3G3Z A;  1FYK A;  4CGZ A;  2A69 F;  2Z99 A;  1GXP A;  1TNS A;  4XRF A;  1WRJ A;  5DCF A;  5FGM A;  5LLQ A;  3BOQ A;  2H94 A;  4RB3 C;  2XRO A;  2LNB A;  3EET A;  1FPQ A;  4HF0 A;  2KRF A;  5CVI A;  5D5X B;  3I59 A;  3QPT A;  4KA4 A;  1WI9 A;  3W6K B;  1ULY A;  2ZJ2 A;  3F8B A;  4LG0 A;  4L9V A;  3JAM Z;  1IXS B;  2M30 A;  1I1S A;  2PN6 A;  2DQL A;  2A6H F;  3KP6 A;  3K1M A;  5IT3 A;  2MLK A;  3ZMD A;  3C3W A;  2DI3 A;  1IN6 A;  2F5C A;  3K2Z A;  3F8M A;  3VOE A;  1QPM A;  4NB5 A;  1J59 A;  1IN5 A;  3BP8 A;  1P92 A;  3ECH A;  4G6Q A;  1ZAR A;  2RKH A;  4KDP A;  1SMY F;  3WG9 A;  4M71 A;  2RNJ A;  2V9V A;  1KGS A;  1XD7 A;  2LKP A;  2OAZ A;  2RN7 A;  2EWN A;  1ZRC A;  1FWZ A;  2W84 A;  3ABT A;  4Y17 A;  3T5X A;  3SXY A;  1RUN A;  5LBQ A;  3JTG A;  2M8E A;  5LGN A;  4L5I A;  3F3X A;  3K1N A;  3IRQ A;  2IW5 A;  2VOO A;  3KFW X;  1T0F A;  5DEQ A;  1RI7 A;  1STZ A;  4UHT A;  1G3S A;  3HHG A;  2H27 A;  4BNC A;  3E6M A;  2L02 A;  3GVA A;  3OOP A;  3KCC A;  2TDX A;  2VC1 A;  4BHP A;  1FYM A;  2QZ8 A;  3CTA A;  3I59 B;  2L3D A;  2R7D A;  3N97 A;  3CO7 C;  5FLX K;  1WWX A;  5BMZ A;  4LG0 B;  1T39 A;  1MJ9 A;  3FHZ A;  3I58 A;  4HOB A;  3H3U A;  2J5O A;  1V3F A;  5ILS A;  4L0Z B;  1Z1D A;  5KVR A;  1SFE A;  4HX4 A;  3GEZ A;  1LDD A;  1R7J A;  2BEO A;  1SD5 A;  2DK5 A;  2EA2 A;  2IA0 A;  3BPV A;  2K4B A;  2DTR A;  4I2O A;  2NS0 A;  4LB6 B;  2O6G E;  4BYY A;  2E7X A;  3J80 K;  1QZY A;  2JPB A;  3QP5 A;  1FP1 D;  4UNO A;  2IA1 A;  2XRN A;  3HOS A;  2Y48 A;  3E97 A;  4MEX F;  2UZK A;  1JXS A;  4G9Y A;  3VEP A;  4Q48 A;  3L00 A;  4H0E A;  3QU3 A;  1YS7 A;  1LQ1 A;  5LRR A;  1EH7 A;  1U8R A;  4OIQ F;  3IHU A;  2KJC A;  4I01 A;  1BBY A;  2QQA A;  2HGC A;  4I02 A;  5HS7 A;  4AVP A;  4IF4 A;  5HDN A;  3I54 A;  2B0L A;  1OYW A;  4PDK A;  2ESH A;  5JVT A;  3E5Q A;  3IKT A;  3CDH A;  1IZ1 A;  2D2W A;  2DQR A;  4IXA A;  4A2U A;  5EEG A;  2VOP A;  1ON1 A;  3TDU C;  2BYV E;  3E6C C;  1FSE A;  1SD7 A;  2W57 A;  2R7F A;  3BRO A;  2OQR A;  2P5V A;  1Z6R A;  5ICE A;  2H6C A;  1FY7 A;  4U0W A;  1D3Y A;  2VC0 A;  2HS5 A;  3C7J A;  1HKS A;  2HQR A;  5LRS A;  2QUF A;  5E1X A;  1ZG1 A;  1TTY A;  1EH6 A;  4ZZL A;  2MC3 A;  1KA8 A;  1QBJ A;  5J8C A;  1ZAO A;  2CQK A;  2ZME A;  3F6V A;  4FX0 A;  2O61 A;  3GW2 A;  3I71 A;  2Q2E A;  3V4G A;  4GO1 A;  1F1Z A;  3D0S A;  4DNC A;  5LEK A;  4UVB A;  2O03 A;  1NHA A;  4A5M A;  5DD8 A;  2A3S A;  2VN2 A;  4HYE A;  1WQ2 A;  3R6S A;  2EK5 A;  1XCB A;  3E5U A;  1LVA A;  1KYW A;  4RB2 C;  4CZZ A;  3AAF A;  5DDG A;  5L3E A;  2EJR A;  3TO6 A;  3JAM K;  2P5L C;  3LFK A;  3IC7 A;  1O57 A;  4FHT A;  1FZP B;  4KYW A;  1OMI A;  1OYI A;  2H09 A;  3SFZ A;  1SFU A;  3VFZ A;  2VE8 A;  2ZNZ A;  2X4H A;  4AWX B;  1IF1 A;  1MJA A;  4WWC A;  4UVA A;  3HRM A;  3BDD A;  2ELH A;  1YW9 A;  5D8L B;  1DUX C;  1U2W A;  2QBY A;  5E8I A;  3DKW A;  1SD4 A;  5TRD A;  5E20 A;  3HUG A;  2PMH A;  4LK0 F;  3BWG A;  2A68 F;  4BHC A;  3I53 A;  3HIF A;  3F8F A;  3MAJ A;  4LD5 A;  5AIP A;  4OMY A;  2PI0 A;  1LEA A;  1CF7 A;  3E5X A;  1OKR A;  3O3K A;  3N4M A;  3R4K A;  5L3B A;  4G7O F;  3ZMU A;  3WOD F;  3IWZ A;  3LA7 A;  2DT5 A;  3HSF A;  1ON2 A;  4RB1 A;  4ENK A;  1YFH A;  3TOA A;  2P4W A;  1K79 A;  1FT9 A;  3BJA A;  1KQ0 A;  3F21 A;  2FBK A;  4YFX F;  1DPU A;  4WX9 A;  3WTZ A;  1BI0 A;  4WK8 F;  3RDI A;  2O8X A;  4S05 A;  2V6C A;  2NYX A;  2PQ8 A;  2Q8K A;  5LHG A;  1LEB A;  3J80 Z;  3LWF A;  3P9C A;  4RAY A;  2LF8 A;  4M9Z A;  2QBY B;  2GA1 A;  3WE2 A;  5FB2 A;  1ZHF A;  4HV5 A;  1P2F A;  4HQE A;  4MTD A;  1GVJ A;  3FM3 A;  4M6Y A;  2KIU A;  1J75 A;  2XKO A;  2OZU A;  1V4R A;  2ETH A;  3COA C;  3TKY A;  1ZLK A;  5JHU A;  1UHW A;  4L18 B;  2FQ3 A;  4O6J A;  1YO5 C;  2YU3 A;  2PMU A;  5DCM A;  4ZYE A;  4HX8 A;  3FMQ A;  2QVO A;  3GX4 X;  3O2P E;  2K02 A;  5LGU A;  4Q47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...