3O3KA

Crystal structure of af1382 from archaeoglobus fulgidus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
ERIKLLFKEKALEILMTIYYESLGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECELEGRTKIIRLTDKGQKIAQQIKSIIDIMEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein AF_1382
publication title Structure of the Archaeoglobus fulgidus orphan ORF AF1382 determined by sulfur SAD from a moderately diffracting crystal.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 28
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3o3kA00
3V7CA 3JSPA 2UXXA 2H94A 3J81K 1S7OA 1MJBA 2YX7A 4YIIA 2OU2A 3QPTA 4HQMA 1UHWA 1E17A 4PGGA 1U5TC 4L5IA 1U5TB 2PJPA 4P96A 5TJJA 2VBYA 2IT0A 1HW5A 2X4HA 5FLXK 2H09A 5JFRA 5LRRA 4IRIA 4HF2A 3HOSA 2XKPA 3E97A 4ETSA 3MAJA 3NRVA 3HTUA 2FBKA 2XGXA 1P92A 2DK5A 2XUBA 2MD5A 2RGVA 3IWFA 3KE2A 3K0LA 4YFXF 1R1VA 2HZTA 2XAGA 2CSOA 1G3SA 3JSOA 3CUQC 3CUQB 5LHHA 3WTYC 1FPQA 2HS5A 4HLYA 1YLFA 3M8EA 3EUHA 3ERED 1BC8C 5ICEA 4OMYA 3H3UA 2FF4A 1MD0A 1IRFA 4M6XA 5FFXA 3HRTA 4HV6A 2D1VA 2D1HA 3BJ6A 2OBPA 2BV6A 4WF2A 2G7UA 2RQPA 4HLXA 1JXSA 2ETHA 1SMTA 3HTSB 1W4MA 5IT9Z 3DKWA 2VC1A 4HDVA 1U6GA 1D8KA 4KN7X 3QAHA 4M71A 5HOOA 1DP7P 2VBXA 5LGTA 2KIMA 4GXOA 4BHCA 4LJZF 2VONA 4L9TA 3I58A 3JAMZ 1P4WA 4I2OA 3HSFA 2UZKA 1MDMB 5A2QZ 3LA3A 3LAPA 2PEXA 3KFWX 1K6OA 3WTSC 1FYMA 2H6CA 3IKTA 1RNLA 4KDPA 3O3KA 4UNOA 5CVRA 4LG0B 1UCRA 4HA8A 4LK1F 1YYVA 3KLNA 2QYOA 4ESFA 1XD7A 3G3ZA 5K1YA 5ILSA 1LEAA 2QBYB 3ZMVA 1WQ2A 5E8GA 1YS7A 4PGHA 4KA4A 1OYYA 1FT9A 5E1ZB 4JQFA 5JR3A 2FBIA 2HKXA 2ZMEB 1FZPB 1ZRFA 3FF5A 1ZG3A 2EFOA 2DPDA 2CFXA 4L0ZB 4HBLA 4RB3C 4HF0A 4G6DA 2XAFA 2EA4A 2K02A 1USTA 4EM0B 4D0PA 5KVRA 2A5YB 4BYYA 1MJAA 4OINF 2RN7A 1KU3A 4FX0A 1YW8A 3I53A 3TDUC 2MLKA 1Z6TA 2VT3A 3M7GA 5EEHA 3BP8A 1FSEA 1IXCA 3Q9SA 4Y15A 1QO0D 5E20A 2E1NA 1B9NA 3WTVC 2ZNYA 3LA2A 3P9CA 2BEOA 4U0YA 2IVMA 5DV5A 4A5MA 4IJAA 5CYVA 3J80Z 2QQBA 2Z5UA 4UVCA 3BY6A 4K2EA 3ULQB 1FY7A 5H6QA 4ZYGA 4XLPF 5D5VB 1WKMA 5DEQA 2GIVA 3V4GA 4A5NA 5FB2A 2XVCA 3L7WA 1K79A 1ODDA 3FMSA 1YO5C 1SFUA 2L4AA 3LFKA 4U88A 4L18B 3ZPLA 1JGSA 1S3JA 3CUOA 1IF1A 2IP2A 1KU9A 2K7LA 1B1BA 3F72A 2V1UA 1IN8A 4RGUA 2LNBA 1LDKB 4AIJA 3GFMA 2MBFA 3L2CA 2ZKZA 2P5LC 2HOEA 5DYMA 4A2UA 2JT1A 3KEQA 2M5WA 4IPAA 1ONVA 2BE5F 3WODF 3ZMZA 3WGGA 5LBQA 1Z7UA 5FGMA 4MTEA 3SZPA 1CF7A 1ON2A 5D6EA 4MHGA 1HXDA 3VOEA 3F6OA 2IJLA 2F5FA 4UHTA 1TQPA 2PN6A 3HRMA 1J2XA 1EH6A 1R36A 1IN7A 4B8XA 3KP7A 3M1EA 3WTXC 4M9ZA 2LSOA 3HRSA 2VOOA 5J8FA 3EQLF 3BDDA 4EJVA 2PI0A 1K78A 3ABUA 2GAUA 3DXJF 4I01A 5IT9K 2HKOA 2ZFWA 1KGSA 4LLLA 3ZMSA 2GWRA 4KN4X 2K27A 1FNNA 3JAMK 5FD5A 1BI1A 2L54A 5A2QK 3RKYA 2MH2A 4IF4A 2OD5A 1KU7A 5L3GA 5CVUA 1FBQA 2DTRA 2UXNA 1W5TA 4CZZA 3LQRA 1O7FA 4UV9A 2FU4A 5ILUA 2QWWA 2Q8KA 3W6KB 1NHAA 1O57A 3HOTA 3F22A 1D8JA 3E3VA 4BAYA 1C0WA 1ZGAA 4ENJA 1SMYF 4EQQA 1TTYA 1FP2A 4EJTA 3F8MA 2HR3A 2Z33A 2QQ9A 1B4AA 3R0JA 2IRFG 3TO9A 4OIRF 3ZMTA 2F5CA 1SD4A 1KQ0A 5D5UB 5D5WB 2L01A 1Z05A 1G3YA 4A0XA 3TDZC 2XAHA 4HAMA 2V6CA 3F6VA 3KP3A 1LEBA 3KP5A 2P5KA 3WU0A 2GZWA 3BZ6A 4EVIA 2FQ3A 3IRRA 5HDNA 4U7DA 4G7HF 2KJCA 3T0YA 6PAXA 4EJWA 2DU9A 1IN6A 4EJUA 4YIFA 2HTSA 3EYYA 3FWEA 1QZYA 1TW3A 1SFEA 5K5OA 5FD6A 5LHGA 2A07F 4Q4ZF 1U5TA 4RAZA 2OZUA 3J80K 3I0TA 5F1RA 5E18F 3LAJA 2O8XA 4LFUA 4EM1A 3REOA 3ECHA 2E1CA 1XCVA 2RKHA 1PP8F 3MCZA 1T0FA 2YPRA 1H9GA 3H3ZA 2A3SA 1PP7U 1I1GA 3C3WA 2QM3A 3DP7A 3MZYA 3K1NA 4S04A 3NEUA 4OIQF 4LB6B 1I1SA 1IN5A 1XGMA 4HZFA 5EEGA 1HW1A 3KCCA 3QU6A 2BYVE 1G4DA 1QGPA 4EGYA 3U9GA 3HUGA 3W6JB 3L9FA 5H20A 3VB2A 4CGZA 1R00A 3CDHA 4P9FA 3B02A 2PFBA 1XCBA 3T1BA 4L0YB 2CW0F 2CG4A 3FMQA 1QZZA 4LD5A 5AIQA 4CICA 2Q0OA 1BOAA 2XAJA 2Y0MA 1BC7C 3D5LA 3K1PA 2PQ8A 4IHSA 4M6YA 1ZYRF 2ZNZA 3QP5A 2RDPA 3GEZA 3TO6A 5E8IA 2XIGA 1R5GA 4N9IA 1T6SA 5BPDA 4R8HA 1XGNA 5DD8A 3WTZA 4OOIA 1OYWA 3U2RA 2AXLA 4N9HA 4HX7A 1MDMA 4KUMA 1S7AA 1ZHFA 4KMUX 3SFZA 1T2KA 1AOYA 1STZA 2ZBKA 2K86A 2VT2A 3BJAA 2VE8A 1HW2A 3FM3A 4LG0A 3JW4A 4BHBA 1GVJA 4IXAA 4MEXF 3WGHA 3HYIA 3DPLC 1SFXA 1BJAA 3QRFF 3ZP5A 1FLIA 4ENKA 3WU1B 3FHZA 3MQ0A 3DEUA 3F23A 1IXRC 2QBYA 4N0BA 4TV7A 5HS8A 4B09A 5IT3A 5DCMB 3R61A 1U8RA 2ZMEA 4WXHA 1FBUA 3IC7A 2DBBA 2W57A 4RAYA 2J5OA 5BMZA 2COMA 4ZYEA 1G6NA 2L4MA 1T38A 4I02A 4PDKA 3L00A 1PDNC 1EV7A 2EFQA 3ZN0A 3GF2A 4NB5A 3QP6A 2KIFA 4ESBA 3BOQA 2J5PA 2GQQA 2QLZA 3K69A 3E6BA 1UB9A 2EWNA 4RGXA 2Z99A 4KMFA 4ZYDA 3E6CC 1JHFA 5E1WA 4A0ZA 5L3CA 4IRHA 1U3EM 2LKPA 1G3TA 2A69F 3RPQA 2JRTA 2WWYA 4KIGA 4IRGA 2EJRA 1ZGJA 2JPBA 5JI6A 1QPMA 2F2EA 5K5RA 3PFIA 2P6SA 4OU0A 3V7RA 3DV8A 3ELKA 2W24A 3Q9VA 5LEKA 4U7BA 2VC0A 1W7PD 1Q1HA 2DO7A 3FX3A 1HBXG 2RVCA 5HS7A 2HDCA 1UFMA 2NYXA 3R60A 4EMSA 3P7NA 4Z2YA 4NQWA 3I5UA 2Z9OA 1KU2A 4G6QA 3PQJA 5JHUA 2GXGA 1F1ZA 4ASNA 1WSUA 3M9AA 2DAOA 4EV0A 3ZMUA 1F9NA 2HQNA 4FHTA 3DFGA 4AVPA 3RI4A 3KLOA 3GVAA 2QUFA 3GYHX 2JTVA 3KETA 3C18A 2VODA 1YW9A 1XGOA 5ERIA 5J6XA 2EB7A 2A61A 2MH9A 1WRJA 3F21A 1T98A 5D4RA 3GUDA 4ESJA 4H0EA 4I98B 3DPTA 4U0VA 1IW7F 2W84A 1GHCA 3V7SA 2XAQA 2M45A 3MEXA 1T39A 1OYIA 2DFIA 2OZ6A 4EJOA 1QNTA 2NS0A 1PUEE 1KQ9A 3E6MA 4AIHA 5CVIA 4EGZA 4YG2F 1LQ1A 2KIUA 2R3SA 1HSTA 2FE3A 3KP4A 3RYRA 4S05A 1ZH5A 3GW2A 1ZLKA 5E1XA 3RTRA 4WX9A 4UVBA 2HEOA 1R1TA 2Q2EA 4MQ9F 4BH9A 3B73A 1BN5A 3OOPA 2RV8A 4P9UA 4Y17A 2HGCA 1B9MA 3I64A 4M74A 3WGIA 3VFZA 1I5ZA 2UWMA 3FXRA 1IRGA 3I71A 1BI0A 2KKOA 2D45A 3HRUA 2HTJA 2DQRA 3SZTA 2PMHA 3D0SA 3R0AA 1O3QA 2VXZA 4ZYHA 3C7JA 2FEZA 2FXAA 4GYGA 1DPRA 5HLGA 1J75A 3RDIA 5LGNA 1MGTA 4CYDA 2ESNA 3GWZA 3Q5FA 3GXOA 2EV0A 5LGUA 2F5DA 2ZJ2A 4KYWA 2ZCWA 4G94A 2VOPA 1QBJA 2V9VA 4KIBA 2P7CB 5BQTA 1O3RA 1W7PB 1R23A 3U1DA 2O6GE 5BOXA 1USSA 2O3FA 5ICFA 4PZJA 1EH7A 2NNYA 2IA1A 3IHUA 1B6AA 3NQOA 4OIPF 2DLLA 4E70A 1GXQA 4UXNA 1ULYA 2G9WA 3MFKA 4R1HA 2RNJA 2XROA 1ZRCA 5HVQC 1LDDA 1X3UA 2H6BA 4CDGA 4GYIA 1J5YA 2FMLA 2EA2A 2EV5A 1FSHA 2P5VA 2FNAA 3DF8A 3QOPA 2JPCA 2DT5A 1HSJA 1Z6RA 5D8LB 2FA5A 4LLNA 3TQNA 5LRSA 3R6SA 1XMKA 4BHPA 1YW7A 3F8BA 2IA0A 4L9NA 2LF8A 4KT5C 3HIFA 1YG2A 3N97A 3H92A 2ELHA 1A04A 5L3BA 3TO7A 2BGCA 3V8JA 1XSXA 4I7HA 2M1BA 2NAZA 1DDNA 2CYYA 1W5SA 4U0WA 4HX8A 4UVAA 1FWZA 4ZZDA 2QQAA 3P9IA 1LB2A 3IKVA 2W85A 4WWCA 3CO7C 4OIOF 4YFKF 1SAXA 3GLXA 3O6BB 3F3XA 2YR2A 1OR7A 3IL2A 4MTDA 4Q48A 4JK1X 4P5OA 3IWZA 3O2PE 2GA2A 2LDUA 4RB0A 1J59A 1F4KA 1MKMA 1P2FA 5LLQA 1HKTA 2KRFA 2P8TA 4L9JA 5D6FA 4A0YA 1CGPA 5DD4A 3VODA 1RI7A 1Z91A 5JVTA 5D8KB 2MLGA 1P4XA 1RUNA 2HQRA 2XV4S 5J8CA 1TNTA 4EM2A 5ED4A 4G8XA 4HYEA 5HLIA 2FBHA 1YS6A 3S2WA 3CUQA 3COAC 4KFCA 2YU3A 4Y13A 4QLCU 4KNYA 2ISYA 3I54A 1BI2A 1R58A 5AONA 4Q47A 1D5VA 3EETA 3MWMA 5L3DA 3GFIA 4MNUA 1TW2A 3RPUA 4RS8A 2CWEA 1BI3A 4NHJA 4MEYF 2B0LA 3IRQA 5FFZA 4IHTA 3E5XA 1E2XA 3SQNA 1FX7A 2NRAC 5DCMA 3F8CA 2HYFA 3RIRA 3TOAA 4LMYA 3LA7A 4G7OF 5LHIA 4P55A 2ESHA 1SD7A 3KP2A 3MZHA 1IAWA 3RKWA 1FYKA 2EFNA 1Y0UA 4Q5SF 1H0MA 3EYIA 2R7DA 2HFHA 5ICCA 4HX4A 1SD6A 1U78A 3TKYA 2DQLA 3RJPA 1JE8A 4UUVA 2FNPA 4IVNA 3BPVA 3I59B 1ZG1A 4L9VA 1RIOH 4WK8F 3WTWC 5BPIA 2V1XA 5CLSA 3SHFA 2K4JA 3GX4X 5H6RA 3JTHA 5K5QA 2P4WA 1VTNC 3OV8A 2L02A 3WE3A 4A12A 2PLYA 2WC2A 2ZO4A 1FP1D 5HS9A 2D2WA 2FRHA 2Z3YA 3BROA 4AIKA 4I0AA 1OPCA 3I4PA 5FO5A 3BPXA 2DPUA 2E7WA 3CJNA 2GXBA 1IUYA 4DNCA 2STWA 3F8FA 3KZYA 4CHUA 4GCVA 1Z9CA 2BBYA 2FMYA 5TRDA 2M30A 2W25A 1S8NA 2NNNA 1AWCA 3T5XA 4WXCA 4G7ZF 3P9KA 5DUKA 3AAFA 1G3WA 2M87A 2VE9A 1TQMA 2TDXA 2ADUA 4R79A 2OQGA 3V8LA 4I09A 2EK5A 5LEJA 1MZBA 3L09A 2EFWA 2R7FA 4RB1A 4XSXF 2GA1A 3E5QA 2LF7A 1REPC 4O5VA 1HKQA 1LJ9A 4GGGA 2CGPA 2O0YA 3CLOA 2XHKA 1XSDA 1BM9A 5CJ9A 1ZN2A 2WTEA 2YSRA 1ZREA 4JBAA 2CO5A 2CQKA 3FM5A 1V4RA 1KA8A 1I27A 1K7AA 1OKRA 5CVJA 3TOBA 1LNWA 2QENA 4A6DA 2V1DA 3CTAA 1FYLA 2RC4A 3LWFA 3G73A 2EV6A 2EFPA 2A6EF 1UHMA 4LK0F 4M9SA 4LB5A 3RKXA 4BXUA 1BBYA 1KYWA 3ML6A 2K4BA 2DW4A 2XKOA 1TNSA 4GO1A 1XGSA 4M9XA 4CXFA 1L3LA 1H9TA 1FC3A 3T8RA 4HQEA 1BIBA 2L3DA 1IZ1A 3K9TA 1J9IA 2O03A 3KEOA 1ZLJA 2JSCA 3K1MA 4HW0A 2G7HA 1XDSA 4HV5A 1XSVA 2P6TA 5DCFA 4DQ2A 1XDUA 5AIPA 1TQIA 2FSWA 1ZARA 3EDPA 2V79A 3PQKA 5L3FA 4G9YA 1O3TA 4L5JA 4WCGA 1I6XA 1TLHB 1KQ8A 1FBSA 3GFJA 5DUIA 1RZ4A 1WI9A 1W7PA 3K2ZA 3HHGA 2OAZA 3LSTA 1D3YA 4RGSA 2VN2A 4KIFA 1V3FA 1U2WA 3J7AO 2KJBA 1KYZA 3QU3A 5F6FA 4XRFA 1WWXA 3ECOA 1ZG5A 4CO8A 1B59A 3HHHA 3R4KA 3ZN1A 3QPHA 4F7ZA 3J81Z 3WTUC 1Z1DA 3GFLA 5KK1A 1XN7A 2FOKA 1HQCA 3HSRA 5CVVA 2H27A 4A6EA 3SXYA 1J0RA 4WXDA 1YIOA 2QVOA 1TBXA 3N4MA 1DPUA 2A68F 5BS6A 1OMIA 4ZZLA 4PCQA 3E6DA 4HDUA 5F64A 4I0BA 3GO5A 5FLXZ 2VBZA 2ACJA 3V8KA 2AS5F 4QWQA 3LQQA 2P7VB 5ICGA 3C1DA 1O7LA 1L0OC 1YQAA 2WV0A 2F5EA 4UV8A 2HWVA 5L3EA 1F5TA 2O61A 2IPQX 3BJOA 1BIAA 3GZ6A 4O3MA 1LDJA 1YTYA 2PMUA 3VEPA 1MJ9A 2X0LA 4BNCA 4M73A 3KZZA 2M8EA 1DUXC 4KICA 3ROUA 1O3SA 4XLNF 2OA4A 3ABTA 1GXPA 5HLHA 1JHHA 2QZ8A 4AWXB 2YX4A 1CF7B 1IXSB 3HSEA 3T8TA 4ENNA 2DI3A 5D4SA 1SD5A 4OMZA 4LGWA 3DQVC 1YFHA 1R22A 1FOKA 5HDKA 4AD9A 1ZRDA 3WE2A 1IN4A 2HYGD 3ZMDA 4MGRA 1K78B 1EH8A 2ISZA 3TGNA 3FZVA 1ZAOA 1LVAA 2VBWA 3M8FA 2STTA 4YFNF 1ON1A 2Y48A 4O6JA 1S29A 4HOBA 1P4AA 3CO6C 1S6LA 1RUOA 4LLGF 4ON0A 4HF1A 4MQVA 2ZXJA 1HKSA 3FXUA 4RGRA 3F8NA 2XRNA 1J7KA 4BQAA 2Y75A 4XBFA 3E5UA 3ISPA 4FT8A 1XB4A 5D5XB 5ILVA 3FMRA 3BWGA 2MA3A 4ENMA 1QQIA 2OQRA 1R5HA 1P6RA 2C6YA 4XSZF 1R7JA 2DK8A 5DDGA 1XMAA 2JZYA 4FX4A 2IA2A 1R1UA 2PG4A 2MC3A 5HDGA 3JTGA 2A6HF 2E7XA 4RB2C 3WG9A 3FXQA 4M72A 2IW5A 2PBIA 3KP6A 2XASA 3GZ5A 5E17F 3RYPA 3I59A 4ZH4F 3ZQ7A 3WTTC
chains in the Genus database with same CATH superfamily
1VZ0A 3V7CA 1ZGWA 3JSPA 2UXXA 4CCOA 2H94A 3J81K 1GVDA 1S7OA 2QEXI 1VQLI 5FKKA 1M1EB 5IYCJ 1MJBA 2YX7A 4A3MJ 2H1KA 2HI3A 5E3NA 4YIIA 2OU2A 3QPTA 2BHYA 4HQMA 1UHWA 3ERMA 4ZDPA 3JR9A 1E17A 4PGGA 4XORA 3PIPF 1U5TC 2VLAA 4L5IA 3K70C 4F52A 1U5TB 2PJPA 4P96A 2R7OA 5TJJA 3K4BA 2LTPA 1YITI 2JA2A 2VBYA 2R7UA 2IT0A 4XR6A 1I50J 1HW5A 3HGYA 3CC7I 1UMQA 1A6QA 2JK3A 1XG1A 1X1DA 2X4HA 5FLXK 2H09A 5JFRA 1T0FC 3PFYA 1WJFA 3SYTA 5LRRA 4Y3OA 4IRIA 1VI0A 2E5ZA 4HF2A 3HOSA 1WJBA 2XKPA 3E97A 4IO9F 2KDOA 4ETSA 3MAJA 3NRVA 3SDGA 3HTUA 1VQMI 2FBKA 2XGXA 1P92A 2E34A 1TWHJ 4OAZA 1QHHD 4FASD 2DK5A 2COBA 2HVSA 2R93J 1I6HJ 2XUBA 1ETVA 2MD5A 2RGVA 3IWFA 3KE2A 3BQZA 3K0LA 4YFXF 1R1VA 2HZTA 2XAGA 2CSOA 3M4OJ 4ZDOA 5B5EC 1G3SA 3JSOA 1RRJA 4BY7J 5J3LA 3CUQC 2CRGA 1UZCA 2L7KA 3CUQB 5GAEJ 3QOEA 5LHHA 1O4XA 3WTYC 1FPQA 1RPWA 2OJED 2VB6A 2M34A 2IGMA 3RKQA 2HS5A 1RR8C 4N4NB 4HLYA 2FX0A 1TWFJ 4XNFA 1YLFA 4MFEA 3M8EA 5B3SH 2L9NA 3EUHA 3ERED 1BC8C 5ICEA 3DTIA 1N75A 4OMYA 3H3UA 1Y1VJ 1MMSA 5KAFC 4E7ZA 3H9QA 2FF4A 2WA0A 1MD0A 2BOLA 4BEHA 4X0GA 1IRFA 4M6XA 3OS0A 3A02A 5FFXA 2KPMA 4C3IJ 3HRTA 2W1OA 3LSHA 4HV6A 2D1VA 4FE4A 4BQNA 2D1HA 1VQOI 1OISA 3BJ6A 2OBPA 2BV6A 4WF2A 2G7UA 1ETQA 2RQPA 3ZR8X 4HEA2 4HLXA 2VQHA 1X2MA 1JXSA 2ETHA 1SMTA 1FOXA 3HTSB 4AM3A 2WY8Q 2BW3B 3S14J 3GBGA 1Z0XA 1W4MA 5IT9Z 2R7WA 3DKWA 2VC1A 4HDVA 1U6GA 1D8KA 4KN7X 3QAHA 4M71A 5HOOA 1DP7P 2CQ7A 2KT0A 2VBXA 2XF5A 1Z7LA 2KIMA 4GXOA 2XGCA 3SDBA 4LJZF 4BHCA 2VQLA 1HF0A 4DBRA 1SVMA 1MMNA 1FTZA 4NC7A 3ZQIA 2VONA 4L9TA 3I58A 1E3HA 4E7HA 3O8GA 1P4WA 3JAMZ 4I2OA 3HSFA 2UZKA 4HG2A 3KYLA 1MDMB 2ZXIA 4C2MJ 5A2QZ 3ABKH 3H5RA 3LA3A 3LAPA 2PEXA 3KFWX 1JUPA 1K6OA 3FXOA 3NWTA 3WTSC 1FYMA 2KLOA 2H6CA 3IKTA 1RNLA 4KDPA 3MZ8A 3O3KA 4UNOA 5CVRA 2KP6A 4LG0B 1UCRA 4HA8A 1WJCA 4ZYAA 2HDWA 4ITVA 4IHYA 1TT0A 4LK1F 4AUXA 1YYVA 3KLNA 2ZSHB 2F48A 2QYOA 3BG7A 4ESFA 1F36A 1XD7A 3G3ZA 5K1YA 3JRIA 2E71A 5ILSA 2R5ZA 2HDDA 1LEAA 3JRDA 2QBYB 4C9YA 1X1PA 3JRHA 3ZMVA 1WQ2A 3OIQA 5E8GA 1YS7A 4PGHA 4KA4A 1OYYA 1FT9A 5E1ZB 4JQFA 5JR3A 2FBIA 2HKXA 1AU7A 2ZMEC 3QPLA 1IO2A 1LE8B 1FJLA 1OLTA 2ZMEB 2OTJI 2W4SA 1MNEA 1FZPB 2DCEA 2L7ZA 2UV1A 1QPIA 3WHCA 1W1WE 1SFKA 3L2QA 1ZRFA 1FEXA 3FF5A 4PK4A 1ZG3A 3KYCB 2EFOA 5F0CA 2DPDA 4XLHA 2CFXA 4L0ZB 4HBLA 1ETWA 4RB3C 1U0JA 1MH4A 2DA1A 4HF0A 5GPAA 4G6DA 2XAFA 1LFUP 2QA4I 2V4JC 1I3QJ 4DYRA 2EA4A 2K02A 3OR2C 2R0QC 2TRTA 1USTA 4EM0B 1WJEA 4D0PA 2IS4A 5KVRA 2A5YB 2K9SA 2NOJB 4BYYA 1MJAA 3DU6A 4OINF 2JN6A 2LBFA 1T56A 1Z77A 2RN7A 1KU3A 3CMAI 4FX0A 4IOAF 5B66C 1YW8A 3I53A 4XRMA 3TDUC 3OL4A 3JRCA 3HL2A 2V6EA 2MLKA 1Z6TA 2VT3A 4BQQA 2H8RA 2LOOA 3M7GA 5EEHA 3ZXSA 5J40A 1AHDP 2V9KA 3BP8A 3C2GA 2E35A 4MO7A 1FSEA 5M3FJ 1IXCA 3Q9SA 4Y15A 2F4MB 2VQCA 2OPTA 1QO0D 5E20A 2E1NA 4F91B 1B9NA 2EINH 4DYCA 3WTVC 2E1OA 1MBFA 2Q1ZB 2ZNYA 3LA2A 4MLOA 4A3KJ 2K9QA 3P9CA 4FQGA 4V2GA 2BEOA 1U9NA 4U0YA 3AL0C 2IVMA 5DV5A 4A5MA 2VJIA 3AL0B 4IJAA 3LSKA 3K4LA 5CYVA 3J80Z 2QQBA 2Z5UA 2Y9YA 4UVCA 3HDDA 4NDLA 3H1CA 2AO9A 3BY6A 4K2EA 1W36D 4NNJA 2LP0A 1VQ9I 4CH7A 3ULQB 3L2VA 1FY7A 5H6QA 4AYBN 4ZYGA 1WPKA 5D5VB 4XLPF 1WKMA 2E1MC 5DEQA 4MIMA 1NG7A 4GFBA 2VUMJ 2E1MB 3PNTA 2GIVA 3V4GA 4A5NA 5FB2A 3MKYB 2XVCA 3FBNB 3L7WA 1ACIA 5EGOA 1K79A 1ODDA 4XOPA 3FMSA 1YO5C 1SFUA 2WY7Q 2L4AA 3LFKA 4U88A 4L18B 4BXFA 1JGSA 3ZPLA 1S3JA 2H8WA 2ZC2A 4DBQA 1ETOA 3CUOA 3OIPA 1IF1A 2IP2A 2X51A 3A01B 3PNYA 1KU9A 1MSEC 5H2FC 4NQWB 4Y4RA 1A31A 2X6XA 2K7LA 1B1BA 2HVRA 3ZQLA 3F72A 1K61A 2V1UA 3BZCA 1IN8A 2CUFA 4RGUA 2LNBA 2Y9ZA 1LDKB 1HLVA 4AIJA 2O8KA 3NARA 3GFMA 2MBFA 1R5ID 2HVQA 4D1QA 2L0KA 3OYEA 2LKXA 1LVKA 3L2CA 2ZKZA 4GRIA 4XL9A 9ANTA 3DEEA 2P5LC 2HOEA 3G1MA 1XPXA 5DYMA 4A2UA 3OYLA 2JT1A 3DBHB 3KEQA 2M5WA 4IPAA 1ONVA 3ASNH 3G6EI 2BE5F 3WODF 3ZMZA 3K7AJ 2ZXWH 3WGGA 5LBQA 1Z7UA 3G1OA 4UUSA 4YRVA 4FTHA 4V19K 5FGMA 4MTEA 3SZPA 4B4CA 1CF7A 5IP9J 5EG0B 1ON2A 2JUCA 5D6EA 3GTMJ 4MHGA 1HXDA 3VOEA 4XRSA 3F6OA 2IJLA 1JJ6C 1VQ8I 1YJWI 5M5YJ 2F5FA 2OCEA 4UHTA 1TQPA 3M8JA 1SEUA 2PN6A 3K2AA 3HRMA 1J2XA 2LREA 1EH6A 1R36A 2XF7A 3HOWJ 2R7VA 1IN7A 4B8XA 2DYRH 4RLFA 3KP7A 3M1EA 3WTXC 1XTAA 3W3CA 4M9ZA 4BU2A 2LSOA 3PSFA 1X19A 4PJMA 2R7QA 3HRSA 3KZIC 1WZ2A 1Y39A 5J8FA 2VOOA 3EQLF 3BDDA 4EJVA 2PI0A 1K78A 5B1BH 3ABUA 3OIOA 5FKLA 1IC8A 2GAUA 4J00A 3DXJF 4I01A 4DGWB 1LFPA 2CUZA 3IP4B 5IT9K 4C3JJ 2HKOA 2XSDC 2IXSA 2ZFWA 1PUFB 1KGSA 1D1BA 5FRNA 2Q2EB 3CCSI 5FKNA 4LLLA 5C3EJ 3ZMSA 2GWRA 4KN4X 3LNQA 2K27A 2B7EA 2HOSA 1FNNA 1R49A 2X6WA 1JGGA 2KZGA 5C4JJ 1DGWY 3JAMK 3BG5A 4E7JA 2DA5A 3S8PA 5FD5A 1BI1A 2L54A 3LL7A 3HKZN 5DM6F 5A2QK 3RKYA 2MH2A 4IF4A 4ZTJA 2OD5A 1KU7A 5L3GA 5CVUA 1FBQA 2DTRA 2UXNA 3RCOA 1W5TA 4CZZA 5J1RA 3CMMA 2MGQA 2BXZA 3GZNB 1TL8A 3LQRA 1O7FA 4UV9A 4D9JA 2FU4A 2UUZA 5ILUA 3CCJI 2QWWA 3HOVJ 2LK2A 2Q8KA 3W6KB 1V55H 1IV8A 2IS1A 1NHAA 2CJJA 2W7NA 4HNTA 3DLLF 1O57A 3HOTA 3F22A 1D8JA 3E3VA 2JVHA 4BAYA 1C0WA 1ZGAA 3JRAA 2QSGX 3FBIB 5M3MJ 2ICWG 4PFPA 4ENJA 1SMYF 1DQUA 2F6CA 4EQQA 2M0MA 1TTYA 1FP2A 2LG4A 3BZKA 4XN0A 2VKEA 3CZ6A 4EJTA 3F8MA 2M7AA 2HR3A 2Z33A 2QQ9A 1B4AA 1D0ZA 2DT7B 3R0JA 1YJNI 2IRFG 4IHVA 3TO9A 4OIRF 2W48A 3ZMTA 2V1NA 4P1WA 2F5CA 2DDAA 1SD4A 1TWAJ 4MFDA 1KQ0A 4H4KC 1D0YA 5D5UB 3H9JA 5D5WB 2L01A 2ME6A 1Z05A 1G3YA 3P5JA 4IZZA 1IG7A 4A0XA 3TDZC 1FIPA 2XAHA 4HAMA 2V6CA 3F6VA 3KP3A 3HB9A 1LEBA 3KP5A 1HOMA 1KONA 2HPMA 2P5KA 2GOMA 3WU0A 2GZWA 3BZ6A 4E7KA 4EVIA 3MVPA 1RKTA 2FQ3A 3IRRA 2KDZA 5HDNA 3CJTB 4U7DA 4G7HF 2KJCA 3PM1A 3T0YA 6PAXA 1POGA 3ABMH 5FLMJ 2NS7A 2FOWA 4EJWA 2F4OB 1SAUA 2DU9A 1IN6A 4EJUA 4YIFA 2MFZA 1TT5B 5EEAA 2HTSA 2K3FA 3BCAA 2P81A 3EYYA 2VKVA 4A3LJ 3AKZA 3FWEA 3MMYB 2EPFA 1QZYA 3H5NA 4AIDA 3G71I 1TW3A 1SFEA 2ID6A 1JKOC 5K5OA 4BDZA 5FD6A 2VJ5A 4D5CA 5LHGA 2OC6A 4NC8A 4J19A 2Y0SA 3M07A 2A07F 4Q4ZF 1U5TA 4RAZA 2OZUA 3CDLA 4QPOA 1V5FA 1X4OA 1P7JA 3CJRB 2XB0X 3BR5A 1BJZA 3J80K 4Y52J 3I0TA 5GADJ 5F1RA 5E18F 3LAJA 2O8XA 4LFUA 4EM1A 1XS9A 4BXXJ 3REOA 3ECHA 2E1CA 3HOUJ 4E4HA 3Q0UA 2LY2A 2L9SA 3BTIA 1XCVA 2RKHA 2X1CA 1PP8F 4W97A 4D7NA 4C2UA 3MCZA 3VYRB 2OF7A 1T0FA 2YPRA 1H9GA 2MC4A 3H3ZA 1BR4A 1I3AA 1ZKGA 2A3SA 1S9HA 4XKCA 1PP7U 2EZHA 2EIKH 2EIJH 4IOCF 1I1GA 3C3WA 5J1YA 2QM3A 1Z3XA 3DP7A 1WH5A 1VQ5I 4XN3A 3MZYA 2GXAA 1ZTRA 3LFUA 4XKVA 1GLNA 3K1NA 4S04A 1IDZA 5KCMA 3NEUA 1ZQ3P 3BTLA 4OIQF 2NXNB 1RKWA 4LB6B 1I1SA 1J09A 1WCMJ 1IN5A 4XOTA 1XGMA 4HZFA 5EEGA 1HW1A 1AA7A 3KCCA 4PJJA 3QU6A 2BYVE 5F1JA 1G4DA 3AG2H 4HNVA 1OR7C 1QGPA 4EGYA 2XRLA 3U9GA 1YX3A 1YJ9I 3HUGA 3W6JB 1R6RA 3L9FA 2MABA 5H20A 2ZJQF 3F9KA 4M3FA 3VB2A 4CGZA 1Y8QB 3PJRA 5GTIC 1R00A 3CDHA 4P9FA 3CC4I 2CV2A 2NVQJ 3B02A 2PFBA 3EPZA 3CCLI 3I4NJ 2O9LA 5JHFA 1XCBA 1N78A 3FHNA 3T1BA 4YIRX 5IP6A 4L0YB 2CW0F 1OCZH 2PMZN 2CG4A 5K7HA 1HDDC 1UG0A 3S32A 3FMQA 1IJWC 1QZZA 4LD5A 5AIQA 4CICA 2Q0OA 1BOAA 5IPAA 3CCQI 2XAJA 4CSWA 1U9OA 2Y0MA 1BC7C 3D5LA 3K1PA 2PQ8A 4IHSA 3PSIA 2BW3A 2AXTC 4XLCA 3GTJJ 1TWGJ 1ZYRF 4M6YA 3OYKA 2ZNZA 3FISA 3QP5A 3OOUA 2KHMA 2RDPA 3GEZA 3TO6A 5E8IA 2X6OA 2XIGA 1QA6A 1R5GA 3OYIA 3ZQQA 1NG6A 4N9IA 2L9VA 1T6SA 3OYDA 2YS9A 3PO2J 1MBEA 5BPDA 2CW8A 4R8HA 1XGNA 5DD8A 4W1UA 3WTZA 4OOIA 1OYWA 3U2RA 2AXLA 3BTCA 2L5QA 4N9HA 2JA6J 4HX7A 1MDMA 4KUMA 4UY8I 1S7AA 1ZHFA 4KMUX 3SFZA 1T2KA 1AOYA 1STZA 2ZBKA 2K86A 2MG4A 2VT2A 2R92J 4UB8C 3BJAA 2VE8A 4G12A 2R7RA 1HW2A 4XLAA 3DLAA 1BL0A 1T8IA 3FM3A 4LG0A 2NVTJ 3JW4A 3DU5A 2ELKA 1S7EA 1HC8A 4BHBA 1GVJA 4IXAA 3JRBA 2CV1A 2OCCH 3CDIA 3WGHA 4MEXF 3HYIA 3DPLC 4QTRA 1SFXA 1BJAA 4IKFA 3A2KA 5HNHA 1ORKA 3ZP5A 3QRFF 1FLIA 4ENKA 3WU1B 5HODA 3FHZA 3MQ0A 2VXDA 3DEUA 2LD5A 3F23A 1IXRC 3QYFA 2QBYA 3K4KA 4N0BA 3CD6I 2L2OA 3UNGC 4TV7A 5HS8A 1ITYA 4B09A 4XKBA 2CQQA 5DCMB 5IT3A 1WJAA 3CC2I 1G2HA 3R61A 5FRMA 1U8RA 4CCNA 3HC7A 2ZMEA 4WXHA 2M4GA 5C4XJ 2BXYA 2CQXA 3W2WA 4BE2A 1FBUA 1K6YA 4NUBA 3IC7A 4RBOA 4HNUA 2I8DA 1VQPI 2KRHA 2DBBA 1QHGA 2W57A 1JT0A 4RAYA 1MBHA 3CCVI 2GM4A 2J5OA 3E7LA 5BMZA 4IHXA 2EZLA 4CA0A 3ZQCA 2COMA 4ZYEA 1G6NA 2L4MA 4KITB 1PJRA 3GTLJ 1T38A 4I02A 4PDKA 1DGRM 3L00A 1PDNC 1EV7A 2EFQA 3ZN0A 5F0HA 3NAUA 3GF2A 1IGNA 4NB5A 2XPUA 4XQFA 2WADA 3QP6A 1W5CC 1D5YA 2KIFA 2R7TA 4ESBA 3BOQA 2J5PA 2GQQA 1F43A 3TW7A 1LUJB 2DOAA 4BUPA 2QLZA 3CESA 2Y69H 1FOWA 3K69A 3E6BA 1LPQA 3TP3A 1EJ9A 1UB9A 4BL0B 1BR2A 2EWNA 2JSPA 1LKXA 4RGXA 2Z99A 4KMFA 4ZYDA 4A3FJ 1QVUA 4II2A 2R5YB 1V54H 3E6CC 1JHFA 3LSIA 4QSHA 5E1WA 4A0ZA 5L3CA 5M5XJ 4LOCA 4E7IA 2R7XA 2QKLB 4IRHA 1U3EM 2LKPA 3CMYA 1G3TA 3W2AA 2A69F 3RPQA 2JRTA 2WWYA 4KIGA 1R4MB 1MIJA 4IRGA 1B8IB 2EJRA 1ZGJA 2JPBA 5IP7J 3ZOBA 5JI6A 1QPMA 2F5VA 2F2EA 4E6KG 5K5RA 3PFIA 4LIVA 1T95A 2P6SA 4OU0A 3V7RA 3DV8A 3ELKA 3BR2A 2W24A 1R9TJ 2HOAA 4F55A 3Q9VA 5LEKA 4XICA 4U7BA 3TBIA 3GCMA 2EZKA 3NWSA 1GT0C 2VC0A 2DJIA 4EEFG 1W7PD 1TC3C 1Q1HA 3OYJA 1OCOH 2AQFA 2DO7A 3FX3A 2L7FP 1HBXG 2RVCA 1MMAA 1UG2A 4J01A 5GPCA 5HS7A 1YE9A 2HDCA 3DEWA 1UFMA 1YIJI 1Y8RB 3CP2A 2NYXA 2XSJC 3R60A 1JKRC 3OR1C 4BKXA 1ZR2A 1HCRA 2DA3A 4EMSA 3P7NA 4Z2YA 4A69C 3A01A 5E3LA 4BJ5C 2ID3A 4NQWA 4YEJA 3BR0A 3I5UA 2Z9OA 1KU2A 3A03A 5KNLA 4G6QA 1Z21A 3PQJA 4AVZA 3UKGA 3OYMA 1JUMA 2HZDA 1U8BA 5FLVA 4I6ZA 2I5UA 2N8GA 5JHUA 3EUAA 2LKSA 2DMNA 2GXGA 1F1ZA 4ASNA 1WSUA 2EQRA 1A35A 4PSXA 3M9AA 2DAOA 2WV1A 1JKPC 4EV0A 3ZMUA 4BS9A 1F9NA 2HQNA 3N05A 4FHTA 5DS9A 3DFGA 4AVPA 4XMYA 2MSYA 3RI4A 1BR1A 3ZQGA 3KLOA 3LSGA 3GVAA 2QUFA 3HBLA 3GYHX 2JTVA 3KETA 4B48A 3C18A 2VODA 1YW9A 5FROA 1V5GA 1FMVA 1XGOA 2GLOA 3OMYA 1VQ6I 5ERIA 2HQ5A 5J6XA 1V5EA 2GIZA 2EB7A 2A61A 2MH9A 1WRJA 2DFFA 5EG0A 4ANJA 3F21A 3E0JB 1T98A 5D4RA 3GUDA 3M3YJ 1K83J 4ESJA 4H0EA 4I98B 3DPTA 3HPGA 4U0VA 1IW7F 2W84A 4DJAA 3S1QJ 1GHCA 4JX5A 5K7FA 3OYAA 3I56I 3V7SA 2XAQA 2M45A 3MEXA 1T39A 1OYIA 2DFIA 2OZ6A 2DA4A 2R4GA 1MH3A 2QF7A 2YUSA 4EJOA 1QNTA 2HU9A 2NS0A 1PUEE 1I39A 1KQ9A 3E6MA 4AIHA 1JJ8C 3H9GA 5CVIA 3ZQHA 5GAGJ 4EGZA 4YG2F 1GV2A 1LQ1A 2KIUA 3CLQA 4KISA 1ETYA 2R3SA 4Z6YA 1GV5A 1HSTA 1JI8A 2FE3A 3KP4A 3RYRA 4S05A 1ZH5A 3GW2A 1ZLKA 3IV5A 2KL4A 5LFAA 5E1XA 3RTRA 2WAQN 4WX9A 2BY1A 2XB5A 1RR7A 4UVBA 4DOZA 2HEOA 1PUFA 1R1TA 1PVEA 4RAGA 1R71A 3ZQFA 2Q2EA 3RQ4A 2ECBA 3BR3A 2V7FA 4MQ9F 4BH9A 4CUGA 3B73A 1BN5A 3OOPA 3FIWA 2RV8A 3K4JA 1JT6A 2DYSH 4P9UA 3J7AY 4Y17A 4B43A 1H88C 2HGCA 1X58A 1B9MA 2AHQA 3I64A 4M74A 3WGIA 3SEZA 3HG9A 3QPSA 3VFZA 1I5ZA 4KT6A 4BE0A 2UWMA 2DDBA 2IGNA 3FXRA 1IRGA 2DOFA 3TW6A 3I71A 3LSMA 3IAS2 1BI0A 3MD2A 3HXLA 2CUJA 2KKOA 2MD0A 2D45A 5EDNA 3S3NA 4X6AJ 3HRUA 2HTJA 2DQRA 3SZTA 3LOCA 2PMHA 1X1AA 3RZDJ 1PYVA 3D0SA 1NK3P 5KAIC 3R0AA 1O3QA 2VXZA 2XGDA 4ZYHA 1SVOA 3C7JA 1T33A 4BY1J 2FEZA 2FXAA 4GYGA 4ZC3A 1DPRA 5HLGA 3G1LA 1J75A 3RDIA 1MBKA 1FIAA 5LGNA 1ENHA 1MGTA 4CYDA 2ESNA 4Y7NJ 4HRIA 2V9PA 3GWZA 3Q5FA 4ABZA 2HXIA 3GXOA 1TZLA 1Z3YA 2EV0A 4DW6A 5LGUA 5EF6A 3OYFA 2F5DA 3CQZJ 5GAHJ 2ZJ2A 4KYWA 2ZCWA 4DZJA 4G94A 2VOPA 2E5NA 5KHDA 2R7ZJ 1QBJA 2V9VA 4KIBA 3MKWB 2P7CB 2VIXA 5BQTA 1O3RA 1W7PB 1R23A 3U1DA 1WHUA 3FK7A 2O6GE 3FDYA 4IHWA 5BOXA 2PJRB 1USSA 2O3FA 5ICFA 4PZJA 1EH7A 1P9QC 3Q3SA 2Z1DA 2NNYA 2IA1A 3IHUA 1B6AA 3DWLE 3NQOA 3H0DA 2E36A 4OIPF 3FXJA 1S5LC 4F92B 4JOMA 2VI6A 2DLLA 3KIOA 2ME0A 4A3BJ 2VPRA 4E70A 1GXQA 4UXNA 1ULYA 2G9WA 3HGGA 3MFKA 4FE7A 4R1HA 2IGOA 2RNJA 2A6TA 2XROA 1ZRCA 2X85A 5HVQC 1LDDA 1X3UA 3QWLA 2H6BA 4JX6A 2LLKA 2QKMB 4XK4A 3H35A 2NVUB 4CDGA 2ZXHA 4GYIA 3OSFA 2JA8J 1J5YA 2FMLA 2KZVA 2LR8A 3CCUI 2EA2A 2EV5A 4I99C 1H89C 4B44A 1FSHA 3Q0VA 2P5VA 2FNAA 1A6IA 3DF8A 2DOEA 4E7LA 2GOXB 4UUTA 1VQNI 2AQEA 4BDYA 3C2HA 4RA2A 5FJ8J 3QOPA 2JPCA 3K70D 4E7SA 3PUBA 3S2DJ 2DT5A 1HSJA 2DA2A 5HNFA 1W36C 1Z6RA 3L2WA 5D8LB 2FA5A 1ETKA 5IYBJ 4LLNA 3S1MJ 5B1AH 3TQNA 5LRSA 3R6SA 1XMKA 4BHPA 1YW7A 3F8BA 4C3HJ 5LD2C 1K4SA 4AYBA 1G59A 1Y6IA 2IA0A 4A3IJ 2EIMH 2VQGA 4L9NA 3DBRB 2GBYA 2LF8A 2O5RA 4KT5C 3HIFA 3I9V2 1YG2A 3N97A 3DTEA 3H92A 2ELHA 1A04A 1VQKI 4M3BA 2OTLI 2M9HA 3TO7A 5L3BA 2E19A 3I3LA 2BGCA 3V8JA 1XSXA 4C30A 1VQ7I 4I7HA 2M1BA 2NAZA 3CF2A 2CYYA 1W5SA 1DDNA 1A36A 2LH9A 3O8HA 4U0WA 4HX8A 4BE1A 4B3XA 4UVAA 1FWZA 1SANA 2XF6A 4ZZDA 2QQAA 2IS2A 1VNDA 2A5WA 1DU0A 3P9IA 3FXKA 1LB2A 2XDVA 3IKVA 1XMXA 4RM2A 2QSHX 2W85A 4WWCA 3CO7C 1ERDA 4OIOF 1WH7A 5JVGF 1YRNB 4YFKF 1SAXA 3GLXA 3RSNA 4N4OB 3O6BB 3F3XA 3U21A 2XPVA 2YR2A 3E1SA 2CFOA 1OR7A 4HSTA 3IL2A 2X48A 1KZHA 4MTDA 4Q48A 3UR3C 4B47A 3OYCA 3DKYA 4JK1X 2M3AA 3MKZA 1XX5A 4P5OA 5CKTA 5F04A 3EUKL 3IWZA 3O2PE 1SC7A 2GA2A 2PX9A 4BJTA 5M5WJ 5EJCA 2HPIA 2LDUA 4RB0A 2Y2ZA 1J59A 1F4KA 3QODA 1MKMA 1P2FA 5LLQA 1HKTA 4XKWA 3ZCOA 2KRFA 2P8TA 4L9JA 3BR6A 5D6FA 1UELB 5CQGA 4QIWN 4A0YA 1CGPA 2K5CA 1P7IA 2E60A 2YU9J 5DD4A 3RZOJ 3VODA 1RI7A 1Z91A 5JVTA 2JA5J 4PJNA 3WHBA 5D8KB 2MLGA 5DM7F 1P4XA 5F08A 4JYKA 5E79C 3MKLA 1RUNA 2HQRA 2NS8A 4M6VA 2XV4S 5J8CA 3SJMA 1D0XA 1TNTA 1AKHB 4EM2A 5ED4A 4G8XA 4HYEA 2I10A 5HLIA 1OCCH 2FBHA 2JWTA 1YS6A 3S2WA 2Z2SB 3CUQA 1MNMC 1OJLA 3COAC 4DYQA 4XRSG 2CMPA 3PL8A 4KFCA 2YU3A 3HKZA 4Y13A 3GTGJ 4QLCU 4KNYA 2ISYA 3I54A 1BI2A 3FXMA 2X9DA 3BR1A 1R58A 3LSPA 1X3WB 2K9LA 5AONA 2DJNA 4Q47A 3EETA 3MWMA 1D5VA 5L3DA 3GFIA 1DU6A 4MNUA 1TW2A 4F3QA 3RPUA 1QZEA 4I76A 2CWEA 4RS8A 3I4MJ 2MYSA 5BNGA 1BI3A 4LG3A 3KYDB 4NHJA 2NOGA 4CCLA 4MEYF 2B0LA 1BW6A 3IRQA 5FFZA 5J1UA 4IHTA 3JRFA 2KIQA 3E5XA 3HPHA 1E2XA 2BVLA 3SQNA 1FX7A 2NRAC 5DCMA 3F8CA 2HYFA 3RIRA 3TOAA 4LMYA 3LA7A 4G7OF 1UAAA 1RESA 1FTTA 5LHIA 4P55A 2ESHA 1OCPA 4CYCB 1ZK8A 2DMPA 2CU7A 2HNHA 1SD7A 1JTYA 2KFDA 3K4NA 3KP2A 3L2UA 3DKXA 3MZHA 2NVYJ 5IY5H 1IAWA 2JQ7A 2QSFX 3DTKA 3RKWA 1FYKA 2EFNA 3OSGA 1Y0UA 4Q5SF 1H0MA 3EYIA 2BY3A 2R7DA 2HFHA 5ICCA 1B72B 4HX4A 1GDTA 3DCFA 1SD6A 4JX4A 1U78A 3TKYA 2DODA 2DQLA 3RJPA 3HOZJ 1JE8A 4UUVA 2FNPA 4IVNA 3BPVA 2JRMA 4CCKA 3I59B 1ZG1A 3TP0A 3X2QH 4L9VA 2ZJPF 1RIOH 1NH3A 1IRXA 4WK8F 4CCMA 3WTWC 5BPIA 2V1XA 2XGEA 1SVLA 5CLSA 3IH3A 4BBRJ 3SHFA 3H0GJ 2K4JA 3PNVA 2R7SA 1IRZA 3GX4X 3W6VA 3L2RA 1IV6A 2VPLA 5H6RA 2ELJA 3VDXA 3LSRA 3JTHA 5K5QA 3OS2A 5K7ZA 2P4WA 3J7ZI 4CZCA 1VTNC 3OV8A 3CCRI 4M3EA 1E3OC 3HUGB 2L02A 3WE3A 3CF5F 1X1BA 2WC2A 2R5YA 4A12A 2ZO4A 2PLYA 1FP1D 5HS9A 2D2WA 4PUSA 2FRHA 2Z3YA 3BROA 4AIKA 4I0AA 1OPCA 1WFXA 2XPWA 4LIUA 1E0EA 3A4CA 3I4PA 4IEJA 4PJ0C 5LGTA 1VFCA 2HYJA 5FO5A 3BPXA 2DPUA 2E7WA 1B8IA 1LE8A 1D1AA 3L1PA 3CJNA 2VJ4A 2GXBA 1IUYA 4DNCA 1A5JA 3K6GA 3HOXJ 2STWA 3F8FA 3KZYA 3HEFA 1APLC 4CHUA 1EF4A 4GCVA 4DZPA 1YOVB 2BBYA 1Z9CA 2FMYA 3GMEA 1N25A 5TRDA 5C44J 1XC5A 2M30A 2W25A 2CUEA 4CCJA 1S8NA 2L9RA 2NNNA 4FETA 1AWCA 3T5XA 5E3MA 4WXCA 1QVTA 4G7ZF 1MMDA 3P9KA 1S72I 5DUKA 3AAFA 1G3WA 2M87A 3CCEI 2VE9A 1TQMA 2TDXA 2ADUA 1QRYA 4R79A 3VYSB 2OQGA 2P0WA 2DMQA 3V8LA 2ECCA 5FKMA 4I09A 2EK5A 5LEJA 3BG6A 1MZBA 3L09A 2EFWA 2R7FA 4RB1A 4XSXF 2GA1A 3E5QA 3M1CA 1FMWA 2VL8A 2LF7A 3PUFA 1REPC 4O5VA 3A1YA 3PO3J 3EUHC 5E3OA 1DP3A 1HKQA 1LJ9A 4GGGA 3SZGA 2CGPA 1OCRH 2O0YA 3CP8A 2G0EA 3CLOA 4X1EA 3MN2A 2EILH 2WB1N 3J7YJ 2XHKA 2E2IJ 1XSDA 1BM9A 5CJ9A 1ZN2A 3AFHA 4BEHB 2WTEA 3C2BA 3VSKA 2YSRA 1ZREA 1WGXA 2B63J 3S17J 2LY9A 2CQNA 4JBAA 3S1NJ 2CO5A 4UB6C 2CQKA 3FM5A 1V4RA 1KA8A 2VJJA 1I27A 3HM5A 3WG7H 1K7AA 3G4SI 1R4NB 1OKRA 5CVJA 2PMZA 3TOBA 3D1NI 1WJDA 1LNWA 4M3GA 1MBJA 4IX7A 2D5VA 2QCOA 2QENA 4A6DA 2KISA 2V1DA 2LVSA 3CTAA 3ESWB 2K9MA 4FISA 3H5AA 1FYLA 4BJ6C 5IOYA 2RC4A 3LWFA 3G73A 2IAIA 2M7BA 3HZJA 2EV6A 2ZSIB 2EFPA 4ZJZA 2LRDA 2A6EF 4D7MA 1UHMA 4LK0F 4M9SA 4A3GJ 1EKEA 4BGDA 4XM3A 4LB5A 3OYNA 1TP4A 4A3JJ 3RKXA 4RLQA 2V26A 2W00A 4BXUA 1NTCA 4II3A 1BBYA 1KYWA 3ML6A 3OY9A 2K4BA 3D5SC 3VSLA 2DW4A 2XKOA 2CV0A 1WI3A 1TNSA 1JUSA 4XIDA 4GO1A 1XGSA 4M9XA 2K3PA 4CXFA 2K9NA 1L3LA 4A3CJ 1BW5A 2JVGA 1FC3A 3T8RA 1H9TA 2M8GX 4HQEA 5F27A 4A3DJ 3VYUB 1BIBA 3GTQJ 2L3DA 1IZ1A 2DMUA 1N77A 3K9TA 1J9IA 1MMGA 2O03A 1YI2I 1W0TA 3KEOA 2Y31A 2R5ZB 1ZLJA 2M0CA 2JSCA 3K1MA 4HW0A 2DT6A 2G7HA 1XDSA 4OWRB 4HV5A 1XSVA 3S3OA 2RAEA 2LFBA 5TGTA 3FK6A 2CW7A 3U1KA 2P6TA 2W82A 1Y1WJ 5DCFA 2ZJRF 4DQ2A 4IQ4A 1XDUA 5AIPA 1TQIA 4L5EA 5J47A 3CCMI 4RAFA 2FSWA 1ZARA 2LY1A 3EDPA 5JLWA 2V79A 3PQKA 2CH0A 3BG9A 3IAM2 1Y0NA 3PIOF 3BT9A 5L3FA 3QYEA 4G9YA 3K10A 4L5JA 1O3TA 2LMDA 4WCGA 1E3PA 1I6XA 4IQJA 1TLHB 1KQ8A 1BA5A 3B6CA 2LYCA 2DFHA 2X1DA 1IDYA 3JRGA 1FBSA 3GFJA 5DUIA 1FOYA 1OQYA 1RZ4A 1WI9A 3IH2A 2BVMA 2DA6A 2M2EA 1W7PA 2ZFUA 3K2ZA 1X2NA 2OV7A 2IBDA 3ABLH 2FD5A 3HHGA 2OAZA 3LSTA 1D3YA 2PJRA 2JUGA 4B3AA 3S3MA 2LBFB 4RGSA 2VN2A 4KIFA 3TMOA 2H1LA 1V3FA 1U2WA 3J7AO 3GTKJ 3KPHA 2KJBA 1KYZA 3DBLB 3BTJA 5JLXA 3QU3A 5F6FA 4XRFA 3OL3A 1WWXA 3ECOA 1ZG5A 1BOBA 4ZDLA 2RREA 4CO8A 1B59A 3HHHA 3R4KA 2BY2A 1TWCJ 3ZN1A 3DPUA 3QPHA 4F7ZA 3J81Z 2X6YA 3WTUC 2HQAA 3B6AA 5J4YA 1Z1DA 3GFLA 5KK1A 1XN7A 2FOKA 1HQCA 3HSRA 2LC2A 5CVVA 2H27A 4A6EA 3SXYA 2NVXJ 1J0RA 2Y0SN 1SFOJ 3FXLA 2JMWA 4B1RA 4WXDA 1YIOA 4GDFA 3AG4H 3G2BA 2K85A 2QVOA 2FQ4A 1TBXA 2F4IA 3N4MA 1JTXA 2A68F 5BS6A 1DPUA 1OMIA 1VQ4I 4ZZLA 1Z67A 5FKOA 2WB1A 4PCQA 3E6DA 3ZRGA 4HDUA 3KX2A 5F64A 4I0BA 3GTPJ 3GO5A 5FLXZ 2BY0A 1WJ5A 2VBZA 2ACJA 5EGOB 4DIQA 3V8KA 2B9SA 3BQYA 2AS5F 1ETXA 4FCYA 4QWQA 3H36A 4M3DA 1ZR4A 3S15J 3LQQA 2P7VB 5ICGA 3C1DA 5IOZA 1O7LA 1L0OC 2KQRA 1YQAA 3OYGA 4AC0A 2HOTA 2X1EA 4F93B 2WV0A 1JKQC 2FJ1A 2F5EA 3Q0WA 4UV8A 2HWVA 3A0HC 1EA3A 1MW7A 5L3EA 3H3VK 2DTZA 1F5TA 3S1RJ 2OUMA 2O61A 2IPQX 3BJOA 1MNDA 1BIAA 3GZ6A 4O3MA 1LDJA 2XAUA 1YTYA 2PMUA 3VEPA 5HLTA 1MJ9A 2X0LA 4BNCA 4KJZA 3BG3A 4M73A 5CPRB 1YHQI 3TL4X 1IUFA 3CJQB 4NBQA 3KZZA 2HXOA 3QYBA 3S2HJ 3BC8A 4YELA 2M8EA 4PJLA 4KICA 1DUXC 5EZHA 3ROUA 1O3SA 3HOYJ 2K40A 4XLNF 2IGKA 5CQEA 2OA4A 3ABTA 1GXPA 5HLHA 1JHHA 1YRNA 4UUSB 2QZ8A 4AWXB 4HSRA 2QGUA 5TISC 2YX4A 2JA7J 1CF7B 1IXSB 3HSEA 3T8TA 2E2HJ 4ENNA 3AG3H 1H8AC 2DI3A 5D4SA 1SD5A 3OS1A 3JCUC 4OMZA 4D5FA 3BCBA 4A3EJ 3IH4A 2BHZA 4LGWA 3DQVC 4HPQA 1YFHA 1R22A 2IEKA 2RNGA 1FOKA 3LSJA 1ZELA 1WVRA 1RETA 5HDKA 3HJEA 4U87A 3OYHA 4AD9A 2DXIA 1ZRDA 4RM3A 3WE2A 5EYRA 2O7OA 3RQIA 3GLLA 2CS3A 1IN4A 2HYGD 3ASOH 3ZMDA 3K4CA 4MGRA 1NK2P 2E2JJ 4EATA 5EZGA 2WAFA 5J4VA 1K78B 2VKHA 3OWTA 4IL6C 1MSFC 2IS6A 1EH8A 1W0UA 1UJ8A 2ISZA 2WAEA 3TGNA 1X4PA 5DTDA 3FZVA 1ZAOA 5IYDJ 4JP0A 3GTOJ 1LVAA 3WU2C 2FUG2 1QU3A 2VBWA 2Y30A 3M8FA 2STTA 3IUOA 1ON1A 4YFNF 2Y48A 3LMMA 4O6JA 1S29A 2BZTA 3I55I 2KMUA 1Y56A 2RQQA 4HOBA 4QPQA 1P4AA 3CO6C 1S6LA 1X3ZB 1RUOA 2WAQA 4LLGF 4XONA 4ON0A 1AKHA 3SEQA 4HF1A 2XC7A 4MQVA 1G8XA 1OFCX 2ZXJA 3FKIJ 2MW8A 1D1CA 1YX5A 1HKSA 3S16J 4BQOA 3FXUA 4RGRA 3F8NA 2L7MP 2XRNA 3D5RC 1J7KA 4BQAA 1GUUA 3BLYA 2Y75A 4XBFA 2M4KA 3ZGKA 1LFBA 3E5UA 3ISPA 2DMTA 4FT8A 3RPUD 1CQTA 1T08B 4RMNA 3VWBA 1XB4A 5D5XB 4ZTFA 4BBSJ 1X1CA 3QQAA 2WBMA 3VYTB 5ILVA 1Q1VA 3FMRA 3BWGA 5GP9A 2MA3A 4ENMA 1QQIA 2OQRA 1R5HA 2QQ8A 1P6RA 2C6YA 4XSZF 1R7JA 1HA8A 4PSWA 4S0HB 3K4MA 2DK8A 3SFIA 2VKDA 5DDGA 1XMAA 3ONQA 3CCYA 1MBGA 2EBIA 4XLFA 2JZYA 3A0BC 4FX4A 3TEDA 3FKJA 4BACA 1OCTC 1HDPA 2IA2A 3F0CA 1R1UA 4LITA 4CYCA 3AG1H 4RDUA 4NC6A 2PG4A 3S93A 2A05A 4XLEA 2DA7A 2MC3A 5HDGA 3JTGA 2A6HF 2KRCA 2TCTA 3V42A 2E7XA 4RB2C 3WG9A 3FXQA 4OAYA 4M72A 2ZB9A 1B72A 3JREA 2JJ7A 2IW5A 4A93J 2PBIA 1VF9A 2EZIA 5F0FA 3CMEI 1UHSA 3KP6A 4V2FA 2DFEA 4Y33A 3VPRA 2XASA 3GZ5A 5E17F 3RYPA 3W2VA 3I59A 2Z16A 2VASA 4G6TB 4ZH4F 3OYBA 5GTHC 4AU7A 1K4TA 2EH3A 3ZQ7A 3KEYA 1RC9A 4PFOA 3WTTC 4C2TA 2DN0A
chains in the Genus database with same CATH topology
3V7CA 3JSPA 2UXXA 2H94A 3J81K 1S7OA 1MJBA 2YX7A 4YIIA 2OU2A 3QPTA 4HQMA 1UHWA 1E17A 4PGGA 1U5TC 4L5IA 1U5TB 2PJPA 4P96A 5TJJA 2VBYA 2IT0A 1HW5A 2X4HA 5FLXK 2H09A 5JFRA 5LRRA 4IRIA 4HF2A 3HOSA 2XKPA 3E97A 4ETSA 3MAJA 3NRVA 3HTUA 2FBKA 2XGXA 1P92A 2DK5A 2XUBA 2MD5A 2RGVA 3IWFA 3KE2A 3K0LA 4YFXF 1R1VA 2HZTA 2XAGA 2CSOA 1G3SA 3JSOA 3CUQC 3CUQB 5LHHA 3WTYC 1FPQA 2HS5A 4HLYA 1YLFA 3M8EA 3EUHA 3ERED 1BC8C 5ICEA 4OMYA 3H3UA 2FF4A 1MD0A 1IRFA 4M6XA 5FFXA 3HRTA 4HV6A 2D1VA 2D1HA 3BJ6A 2OBPA 2BV6A 4WF2A 2G7UA 2RQPA 4HLXA 1JXSA 2ETHA 1SMTA 3HTSB 1W4MA 5IT9Z 3DKWA 2VC1A 4HDVA 1U6GA 1D8KA 4KN7X 3QAHA 4M71A 5HOOA 1DP7P 2VBXA 5LGTA 2KIMA 4GXOA 4BHCA 4LJZF 2VONA 4L9TA 3I58A 3JAMZ 1P4WA 4I2OA 3HSFA 2UZKA 1MDMB 5A2QZ 3LA3A 3LAPA 2PEXA 3KFWX 1K6OA 3WTSC 1FYMA 2H6CA 3IKTA 1RNLA 4KDPA 3O3KA 4UNOA 5CVRA 4LG0B 1UCRA 4HA8A 4LK1F 1YYVA 3KLNA 2QYOA 4ESFA 1XD7A 3G3ZA 5K1YA 5ILSA 1LEAA 2QBYB 3ZMVA 1WQ2A 5E8GA 1YS7A 4PGHA 4KA4A 1OYYA 1FT9A 5E1ZB 4JQFA 5JR3A 2FBIA 2HKXA 2ZMEB 1FZPB 1ZRFA 3FF5A 1ZG3A 2EFOA 2DPDA 2CFXA 4L0ZB 4HBLA 4RB3C 4HF0A 4G6DA 2XAFA 2EA4A 2K02A 1USTA 4EM0B 4D0PA 5KVRA 2A5YB 4BYYA 1MJAA 4OINF 2RN7A 1KU3A 4FX0A 1YW8A 3I53A 3TDUC 2MLKA 1Z6TA 2VT3A 3M7GA 5EEHA 3BP8A 1FSEA 1IXCA 3Q9SA 4Y15A 1QO0D 5E20A 2E1NA 1B9NA 3WTVC 2ZNYA 3LA2A 3P9CA 2BEOA 4U0YA 2IVMA 5DV5A 4A5MA 4IJAA 5CYVA 3J80Z 2QQBA 2Z5UA 4UVCA 3BY6A 4K2EA 3ULQB 1FY7A 5H6QA 4ZYGA 4XLPF 5D5VB 1WKMA 5DEQA 2GIVA 3V4GA 4A5NA 5FB2A 2XVCA 3L7WA 1K79A 1ODDA 3FMSA 1YO5C 1SFUA 2L4AA 3LFKA 4U88A 4L18B 3ZPLA 1JGSA 1S3JA 3CUOA 1IF1A 2IP2A 1KU9A 2K7LA 1B1BA 3F72A 2V1UA 1IN8A 4RGUA 2LNBA 1LDKB 4AIJA 3GFMA 2MBFA 3L2CA 2ZKZA 2P5LC 2HOEA 5DYMA 4A2UA 2JT1A 3KEQA 2M5WA 4IPAA 1ONVA 2BE5F 3WODF 3ZMZA 3WGGA 5LBQA 1Z7UA 5FGMA 4MTEA 3SZPA 1CF7A 1ON2A 5D6EA 4MHGA 1HXDA 3VOEA 3F6OA 2IJLA 2F5FA 4UHTA 1TQPA 2PN6A 3HRMA 1J2XA 1EH6A 1R36A 1IN7A 4B8XA 3KP7A 3M1EA 3WTXC 4M9ZA 2LSOA 3HRSA 2VOOA 5J8FA 3EQLF 3BDDA 4EJVA 2PI0A 1K78A 3ABUA 2GAUA 3DXJF 4I01A 5IT9K 2HKOA 2ZFWA 1KGSA 4LLLA 3ZMSA 2GWRA 4KN4X 2K27A 1FNNA 3JAMK 5FD5A 1BI1A 2L54A 5A2QK 3RKYA 2MH2A 4IF4A 2OD5A 1KU7A 5L3GA 5CVUA 1FBQA 2DTRA 2UXNA 1W5TA 4CZZA 3LQRA 1O7FA 4UV9A 2FU4A 5ILUA 2QWWA 2Q8KA 3W6KB 1NHAA 1O57A 3HOTA 3F22A 1D8JA 3E3VA 4BAYA 1C0WA 1ZGAA 4ENJA 1SMYF 4EQQA 1TTYA 1FP2A 4EJTA 3F8MA 2HR3A 2Z33A 2QQ9A 1B4AA 3R0JA 2IRFG 3TO9A 4OIRF 3ZMTA 2F5CA 1SD4A 1KQ0A 5D5UB 5D5WB 2L01A 1Z05A 1G3YA 4A0XA 3TDZC 2XAHA 4HAMA 2V6CA 3F6VA 3KP3A 1LEBA 3KP5A 2P5KA 3WU0A 2GZWA 3BZ6A 4EVIA 2FQ3A 3IRRA 5HDNA 4U7DA 4G7HF 2KJCA 3T0YA 6PAXA 4EJWA 2DU9A 1IN6A 4EJUA 4YIFA 2HTSA 3EYYA 3FWEA 1QZYA 1TW3A 1SFEA 5K5OA 5FD6A 5LHGA 2A07F 4Q4ZF 1U5TA 4RAZA 2OZUA 3J80K 3I0TA 5F1RA 5E18F 3LAJA 2O8XA 4LFUA 4EM1A 3REOA 3ECHA 2E1CA 1XCVA 2RKHA 1PP8F 3MCZA 1T0FA 2YPRA 1H9GA 3H3ZA 2A3SA 1PP7U 1I1GA 3C3WA 2QM3A 3DP7A 3MZYA 3K1NA 4S04A 3NEUA 4OIQF 4LB6B 1I1SA 1IN5A 1XGMA 4HZFA 5EEGA 1HW1A 3KCCA 3QU6A 2BYVE 1G4DA 1QGPA 4EGYA 3U9GA 3HUGA 3W6JB 3L9FA 5H20A 3VB2A 4CGZA 1R00A 3CDHA 4P9FA 3B02A 2PFBA 1XCBA 3T1BA 4L0YB 2CW0F 2CG4A 3FMQA 1QZZA 4LD5A 5AIQA 4CICA 2Q0OA 1BOAA 2XAJA 2Y0MA 1BC7C 3D5LA 3K1PA 2PQ8A 4IHSA 4M6YA 1ZYRF 2ZNZA 3QP5A 2RDPA 3GEZA 3TO6A 5E8IA 2XIGA 1R5GA 4N9IA 1T6SA 5BPDA 4R8HA 1XGNA 5DD8A 3WTZA 4OOIA 1OYWA 3U2RA 2AXLA 4N9HA 4HX7A 1MDMA 4KUMA 1S7AA 1ZHFA 4KMUX 3SFZA 1T2KA 1AOYA 1STZA 2ZBKA 2K86A 2VT2A 3BJAA 2VE8A 1HW2A 3FM3A 4LG0A 3JW4A 4BHBA 1GVJA 4IXAA 4MEXF 3WGHA 3HYIA 3DPLC 1SFXA 1BJAA 3QRFF 3ZP5A 1FLIA 4ENKA 3WU1B 3FHZA 3MQ0A 3DEUA 3F23A 1IXRC 2QBYA 4N0BA 4TV7A 5HS8A 4B09A 5IT3A 5DCMB 3R61A 1U8RA 2ZMEA 4WXHA 1FBUA 3IC7A 2DBBA 2W57A 4RAYA 2J5OA 5BMZA 2COMA 4ZYEA 1G6NA 2L4MA 1T38A 4I02A 4PDKA 3L00A 1PDNC 1EV7A 2EFQA 3ZN0A 3GF2A 4NB5A 3QP6A 2KIFA 4ESBA 3BOQA 2J5PA 2GQQA 2QLZA 3K69A 3E6BA 1UB9A 2EWNA 4RGXA 2Z99A 4KMFA 4ZYDA 3E6CC 1JHFA 5E1WA 4A0ZA 5L3CA 4IRHA 1U3EM 2LKPA 1G3TA 2A69F 3RPQA 2JRTA 2WWYA 4KIGA 4IRGA 2EJRA 1ZGJA 2JPBA 5JI6A 1QPMA 2F2EA 5K5RA 3PFIA 2P6SA 4OU0A 3V7RA 3DV8A 3ELKA 2W24A 3Q9VA 5LEKA 4U7BA 2VC0A 1W7PD 1Q1HA 2DO7A 3FX3A 1HBXG 2RVCA 5HS7A 2HDCA 1UFMA 2NYXA 3R60A 4EMSA 3P7NA 4Z2YA 4NQWA 3I5UA 2Z9OA 1KU2A 4G6QA 3PQJA 5JHUA 2GXGA 1F1ZA 4ASNA 1WSUA 3M9AA 2DAOA 4EV0A 3ZMUA 1F9NA 2HQNA 4FHTA 3DFGA 4AVPA 3RI4A 3KLOA 3GVAA 2QUFA 3GYHX 2JTVA 3KETA 3C18A 2VODA 1YW9A 1XGOA 5ERIA 5J6XA 2EB7A 2A61A 2MH9A 1WRJA 3F21A 1T98A 5D4RA 3GUDA 4ESJA 4H0EA 4I98B 3DPTA 4U0VA 1IW7F 2W84A 1GHCA 3V7SA 2XAQA 2M45A 3MEXA 1T39A 1OYIA 2DFIA 2OZ6A 4EJOA 1QNTA 2NS0A 1PUEE 1KQ9A 3E6MA 4AIHA 5CVIA 4EGZA 4YG2F 1LQ1A 2KIUA 2R3SA 1HSTA 2FE3A 3KP4A 3RYRA 4S05A 1ZH5A 3GW2A 1ZLKA 5E1XA 3RTRA 4WX9A 4UVBA 2HEOA 1R1TA 2Q2EA 4MQ9F 4BH9A 3B73A 1BN5A 3OOPA 2RV8A 4P9UA 4Y17A 2HGCA 1B9MA 3I64A 4M74A 3WGIA 3VFZA 1I5ZA 2UWMA 3FXRA 1IRGA 3I71A 1BI0A 2KKOA 2D45A 3HRUA 2HTJA 2DQRA 3SZTA 2PMHA 3D0SA 3R0AA 1O3QA 2VXZA 4ZYHA 3C7JA 2FEZA 2FXAA 4GYGA 1DPRA 5HLGA 1J75A 3RDIA 5LGNA 1MGTA 4CYDA 2ESNA 3GWZA 3Q5FA 3GXOA 2EV0A 5LGUA 2F5DA 2ZJ2A 4KYWA 2ZCWA 4G94A 2VOPA 1QBJA 2V9VA 4KIBA 2P7CB 5BQTA 1O3RA 1W7PB 1R23A 3U1DA 2O6GE 5BOXA 1USSA 2O3FA 5ICFA 4PZJA 1EH7A 2NNYA 2IA1A 3IHUA 1B6AA 3NQOA 4OIPF 2DLLA 4E70A 1GXQA 4UXNA 1ULYA 2G9WA 3MFKA 4R1HA 2RNJA 2XROA 1ZRCA 5HVQC 1LDDA 1X3UA 2H6BA 4CDGA 4GYIA 1J5YA 2FMLA 2EA2A 2EV5A 1FSHA 2P5VA 2FNAA 3DF8A 3QOPA 2JPCA 2DT5A 1HSJA 1Z6RA 5D8LB 2FA5A 4LLNA 3TQNA 5LRSA 3R6SA 1XMKA 4BHPA 1YW7A 3F8BA 2IA0A 4L9NA 2LF8A 4KT5C 3HIFA 1YG2A 3N97A 3H92A 2ELHA 1A04A 5L3BA 3TO7A 2BGCA 3V8JA 1XSXA 4I7HA 2M1BA 2NAZA 1DDNA 2CYYA 1W5SA 4U0WA 4HX8A 4UVAA 1FWZA 4ZZDA 2QQAA 3P9IA 1LB2A 3IKVA 2W85A 4WWCA 3CO7C 4OIOF 4YFKF 1SAXA 3GLXA 3O6BB 3F3XA 2YR2A 1OR7A 3IL2A 4MTDA 4Q48A 4JK1X 4P5OA 3IWZA 3O2PE 2GA2A 2LDUA 4RB0A 1J59A 1F4KA 1MKMA 1P2FA 5LLQA 1HKTA 2KRFA 2P8TA 4L9JA 5D6FA 4A0YA 1CGPA 5DD4A 3VODA 1RI7A 1Z91A 5JVTA 5D8KB 2MLGA 1P4XA 1RUNA 2HQRA 2XV4S 5J8CA 1TNTA 4EM2A 5ED4A 4G8XA 4HYEA 5HLIA 2FBHA 1YS6A 3S2WA 3CUQA 3COAC 4KFCA 2YU3A 4Y13A 4QLCU 4KNYA 2ISYA 3I54A 1BI2A 1R58A 5AONA 4Q47A 1D5VA 3EETA 3MWMA 5L3DA 3GFIA 4MNUA 1TW2A 3RPUA 4RS8A 2CWEA 1BI3A 4NHJA 4MEYF 2B0LA 3IRQA 5FFZA 4IHTA 3E5XA 1E2XA 3SQNA 1FX7A 2NRAC 5DCMA 3F8CA 2HYFA 3RIRA 3TOAA 4LMYA 3LA7A 4G7OF 5LHIA 4P55A 2ESHA 1SD7A 3KP2A 3MZHA 1IAWA 3RKWA 1FYKA 2EFNA 1Y0UA 4Q5SF 1H0MA 3EYIA 2R7DA 2HFHA 5ICCA 4HX4A 1SD6A 1U78A 3TKYA 2DQLA 3RJPA 1JE8A 4UUVA 2FNPA 4IVNA 3BPVA 3I59B 1ZG1A 4L9VA 1RIOH 4WK8F 3WTWC 5BPIA 2V1XA 5CLSA 3SHFA 2K4JA 3GX4X 5H6RA 3JTHA 5K5QA 2P4WA 1VTNC 3OV8A 2L02A 3WE3A 4A12A 2PLYA 2WC2A 2ZO4A 1FP1D 5HS9A 2D2WA 2FRHA 2Z3YA 3BROA 4AIKA 4I0AA 1OPCA 3I4PA 5FO5A 3BPXA 2DPUA 2E7WA 3CJNA 2GXBA 1IUYA 4DNCA 2STWA 3F8FA 3KZYA 4CHUA 4GCVA 1Z9CA 2BBYA 2FMYA 5TRDA 2M30A 2W25A 1S8NA 2NNNA 1AWCA 3T5XA 4WXCA 4G7ZF 3P9KA 5DUKA 3AAFA 1G3WA 2M87A 2VE9A 1TQMA 2TDXA 2ADUA 4R79A 2OQGA 3V8LA 4I09A 2EK5A 5LEJA 1MZBA 3L09A 2EFWA 2R7FA 4RB1A 4XSXF 2GA1A 3E5QA 2LF7A 1REPC 4O5VA 1HKQA 1LJ9A 4GGGA 2CGPA 2O0YA 3CLOA 2XHKA 1XSDA 1BM9A 5CJ9A 1ZN2A 2WTEA 2YSRA 1ZREA 4JBAA 2CO5A 2CQKA 3FM5A 1V4RA 1KA8A 1I27A 1K7AA 1OKRA 5CVJA 3TOBA 1LNWA 2QENA 4A6DA 2V1DA 3CTAA 1FYLA 2RC4A 3LWFA 3G73A 2EV6A 2EFPA 2A6EF 1UHMA 4LK0F 4M9SA 4LB5A 3RKXA 4BXUA 1BBYA 1KYWA 3ML6A 2K4BA 2DW4A 2XKOA 1TNSA 4GO1A 1XGSA 4M9XA 4CXFA 1L3LA 1H9TA 1FC3A 3T8RA 4HQEA 1BIBA 2L3DA 1IZ1A 3K9TA 1J9IA 2O03A 3KEOA 1ZLJA 2JSCA 3K1MA 4HW0A 2G7HA 1XDSA 4HV5A 1XSVA 2P6TA 5DCFA 4DQ2A 1XDUA 5AIPA 1TQIA 2FSWA 1ZARA 3EDPA 2V79A 3PQKA 5L3FA 4G9YA 1O3TA 4L5JA 4WCGA 1I6XA 1TLHB 1KQ8A 1FBSA 3GFJA 5DUIA 1RZ4A 1WI9A 1W7PA 3K2ZA 3HHGA 2OAZA 3LSTA 1D3YA 4RGSA 2VN2A 4KIFA 1V3FA 1U2WA 3J7AO 2KJBA 1KYZA 3QU3A 5F6FA 4XRFA 1WWXA 3ECOA 1ZG5A 4CO8A 1B59A 3HHHA 3R4KA 3ZN1A 3QPHA 4F7ZA 3J81Z 3WTUC 1Z1DA 3GFLA 5KK1A 1XN7A 2FOKA 1HQCA 3HSRA 5CVVA 2H27A 4A6EA 3SXYA 1J0RA 4WXDA 1YIOA 2QVOA 1TBXA 3N4MA 1DPUA 2A68F 5BS6A 1OMIA 4ZZLA 4PCQA 3E6DA 4HDUA 5F64A 4I0BA 3GO5A 5FLXZ 2VBZA 2ACJA 3V8KA 2AS5F 4QWQA 3LQQA 2P7VB 5ICGA 3C1DA 1O7LA 1L0OC 1YQAA 2WV0A 2F5EA 4UV8A 2HWVA 5L3EA 1F5TA 2O61A 2IPQX 3BJOA 1BIAA 3GZ6A 4O3MA 1LDJA 1YTYA 2PMUA 3VEPA 1MJ9A 2X0LA 4BNCA 4M73A 3KZZA 2M8EA 1DUXC 4KICA 3ROUA 1O3SA 4XLNF 2OA4A 3ABTA 1GXPA 5HLHA 1JHHA 2QZ8A 4AWXB 2YX4A 1CF7B 1IXSB 3HSEA 3T8TA 4ENNA 2DI3A 5D4SA 1SD5A 4OMZA 4LGWA 3DQVC 1YFHA 1R22A 1FOKA 5HDKA 4AD9A 1ZRDA 3WE2A 1IN4A 2HYGD 3ZMDA 4MGRA 1K78B 1EH8A 2ISZA 3TGNA 3FZVA 1ZAOA 1LVAA 2VBWA 3M8FA 2STTA 4YFNF 1ON1A 2Y48A 4O6JA 1S29A 4HOBA 1P4AA 3CO6C 1S6LA 1RUOA 4LLGF 4ON0A 4HF1A 4MQVA 2ZXJA 1HKSA 3FXUA 4RGRA 3F8NA 2XRNA 1J7KA 4BQAA 2Y75A 4XBFA 3E5UA 3ISPA 4FT8A 1XB4A 5D5XB 5ILVA 3FMRA 3BWGA 2MA3A 4ENMA 1QQIA 2OQRA 1R5HA 1P6RA 2C6YA 4XSZF 1R7JA 2DK8A 5DDGA 1XMAA 2JZYA 4FX4A 2IA2A 1R1UA 2PG4A 2MC3A 5HDGA 3JTGA 2A6HF 2E7XA 4RB2C 3WG9A 3FXQA 4M72A 2IW5A 2PBIA 3KP6A 2XASA 3GZ5A 5E17F 3RYPA 3I59A 4ZH4F 3ZQ7A 3WTTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7C A;  3JSP A;  2UXX A;  2H94 A;  3J81 K;  1S7O A;  1MJB A;  2YX7 A;  4YII A;  2OU2 A;  3QPT A;  4HQM A;  1UHW A;  1E17 A;  4PGG A;  1U5T C;  4L5I A;  1U5T B;  2PJP A;  4P96 A;  5TJJ A;  2VBY A;  2IT0 A;  1HW5 A;  2X4H A;  5FLX K;  2H09 A;  5JFR A;  5LRR A;  4IRI A;  4HF2 A;  3HOS A;  2XKP A;  3E97 A;  4ETS A;  3MAJ A;  3NRV A;  3HTU A;  2FBK A;  2XGX A;  1P92 A;  2DK5 A;  2XUB A;  2MD5 A;  2RGV A;  3IWF A;  3KE2 A;  3K0L A;  4YFX F;  1R1V A;  2HZT A;  2XAG A;  2CSO A;  1G3S A;  3JSO A;  3CUQ C;  3CUQ B;  5LHH A;  3WTY C;  1FPQ A;  2HS5 A;  4HLY A;  1YLF A;  3M8E A;  3EUH A;  3ERE D;  1BC8 C;  5ICE A;  4OMY A;  3H3U A;  2FF4 A;  1MD0 A;  1IRF A;  4M6X A;  5FFX A;  3HRT A;  4HV6 A;  2D1V A;  2D1H A;  3BJ6 A;  2OBP A;  2BV6 A;  4WF2 A;  2G7U A;  2RQP A;  4HLX A;  1JXS A;  2ETH A;  1SMT A;  3HTS B;  1W4M A;  5IT9 Z;  3DKW A;  2VC1 A;  4HDV A;  1U6G A;  1D8K A;  4KN7 X;  3QAH A;  4M71 A;  5HOO A;  1DP7 P;  2VBX A;  5LGT A;  2KIM A;  4GXO A;  4BHC A;  4LJZ F;  2VON A;  4L9T A;  3I58 A;  3JAM Z;  1P4W A;  4I2O A;  3HSF A;  2UZK A;  1MDM B;  5A2Q Z;  3LA3 A;  3LAP A;  2PEX A;  3KFW X;  1K6O A;  3WTS C;  1FYM A;  2H6C A;  3IKT A;  1RNL A;  4KDP A;  3O3K A;  4UNO A;  5CVR A;  4LG0 B;  1UCR A;  4HA8 A;  4LK1 F;  1YYV A;  3KLN A;  2QYO A;  4ESF A;  1XD7 A;  3G3Z A;  5K1Y A;  5ILS A;  1LEA A;  2QBY B;  3ZMV A;  1WQ2 A;  5E8G A;  1YS7 A;  4PGH A;  4KA4 A;  1OYY A;  1FT9 A;  5E1Z B;  4JQF A;  5JR3 A;  2FBI A;  2HKX A;  2ZME B;  1FZP B;  1ZRF A;  3FF5 A;  1ZG3 A;  2EFO A;  2DPD A;  2CFX A;  4L0Z B;  4HBL A;  4RB3 C;  4HF0 A;  4G6D A;  2XAF A;  2EA4 A;  2K02 A;  1UST A;  4EM0 B;  4D0P A;  5KVR A;  2A5Y B;  4BYY A;  1MJA A;  4OIN F;  2RN7 A;  1KU3 A;  4FX0 A;  1YW8 A;  3I53 A;  3TDU C;  2MLK A;  1Z6T A;  2VT3 A;  3M7G A;  5EEH A;  3BP8 A;  1FSE A;  1IXC A;  3Q9S A;  4Y15 A;  1QO0 D;  5E20 A;  2E1N A;  1B9N A;  3WTV C;  2ZNY A;  3LA2 A;  3P9C A;  2BEO A;  4U0Y A;  2IVM A;  5DV5 A;  4A5M A;  4IJA A;  5CYV A;  3J80 Z;  2QQB A;  2Z5U A;  4UVC A;  3BY6 A;  4K2E A;  3ULQ B;  1FY7 A;  5H6Q A;  4ZYG A;  4XLP F;  5D5V B;  1WKM A;  5DEQ A;  2GIV A;  3V4G A;  4A5N A;  5FB2 A;  2XVC A;  3L7W A;  1K79 A;  1ODD A;  3FMS A;  1YO5 C;  1SFU A;  2L4A A;  3LFK A;  4U88 A;  4L18 B;  3ZPL A;  1JGS A;  1S3J A;  3CUO A;  1IF1 A;  2IP2 A;  1KU9 A;  2K7L A;  1B1B A;  3F72 A;  2V1U A;  1IN8 A;  4RGU A;  2LNB A;  1LDK B;  4AIJ A;  3GFM A;  2MBF A;  3L2C A;  2ZKZ A;  2P5L C;  2HOE A;  5DYM A;  4A2U A;  2JT1 A;  3KEQ A;  2M5W A;  4IPA A;  1ONV A;  2BE5 F;  3WOD F;  3ZMZ A;  3WGG A;  5LBQ A;  1Z7U A;  5FGM A;  4MTE A;  3SZP A;  1CF7 A;  1ON2 A;  5D6E A;  4MHG A;  1HXD A;  3VOE A;  3F6O A;  2IJL A;  2F5F A;  4UHT A;  1TQP A;  2PN6 A;  3HRM A;  1J2X A;  1EH6 A;  1R36 A;  1IN7 A;  4B8X A;  3KP7 A;  3M1E A;  3WTX C;  4M9Z A;  2LSO A;  3HRS A;  2VOO A;  5J8F A;  3EQL F;  3BDD A;  4EJV A;  2PI0 A;  1K78 A;  3ABU A;  2GAU A;  3DXJ F;  4I01 A;  5IT9 K;  2HKO A;  2ZFW A;  1KGS A;  4LLL A;  3ZMS A;  2GWR A;  4KN4 X;  2K27 A;  1FNN A;  3JAM K;  5FD5 A;  1BI1 A;  2L54 A;  5A2Q K;  3RKY A;  2MH2 A;  4IF4 A;  2OD5 A;  1KU7 A;  5L3G A;  5CVU A;  1FBQ A;  2DTR A;  2UXN A;  1W5T A;  4CZZ A;  3LQR A;  1O7F A;  4UV9 A;  2FU4 A;  5ILU A;  2QWW A;  2Q8K A;  3W6K B;  1NHA A;  1O57 A;  3HOT A;  3F22 A;  1D8J A;  3E3V A;  4BAY A;  1C0W A;  1ZGA A;  4ENJ A;  1SMY F;  4EQQ A;  1TTY A;  1FP2 A;  4EJT A;  3F8M A;  2HR3 A;  2Z33 A;  2QQ9 A;  1B4A A;  3R0J A;  2IRF G;  3TO9 A;  4OIR F;  3ZMT A;  2F5C A;  1SD4 A;  1KQ0 A;  5D5U B;  5D5W B;  2L01 A;  1Z05 A;  1G3Y A;  4A0X A;  3TDZ C;  2XAH A;  4HAM A;  2V6C A;  3F6V A;  3KP3 A;  1LEB A;  3KP5 A;  2P5K A;  3WU0 A;  2GZW A;  3BZ6 A;  4EVI A;  2FQ3 A;  3IRR A;  5HDN A;  4U7D A;  4G7H F;  2KJC A;  3T0Y A;  6PAX A;  4EJW A;  2DU9 A;  1IN6 A;  4EJU A;  4YIF A;  2HTS A;  3EYY A;  3FWE A;  1QZY A;  1TW3 A;  1SFE A;  5K5O A;  5FD6 A;  5LHG A;  2A07 F;  4Q4Z F;  1U5T A;  4RAZ A;  2OZU A;  3J80 K;  3I0T A;  5F1R A;  5E18 F;  3LAJ A;  2O8X A;  4LFU A;  4EM1 A;  3REO A;  3ECH A;  2E1C A;  1XCV A;  2RKH A;  1PP8 F;  3MCZ A;  1T0F A;  2YPR A;  1H9G A;  3H3Z A;  2A3S A;  1PP7 U;  1I1G A;  3C3W A;  2QM3 A;  3DP7 A;  3MZY A;  3K1N A;  4S04 A;  3NEU A;  4OIQ F;  4LB6 B;  1I1S A;  1IN5 A;  1XGM A;  4HZF A;  5EEG A;  1HW1 A;  3KCC A;  3QU6 A;  2BYV E;  1G4D A;  1QGP A;  4EGY A;  3U9G A;  3HUG A;  3W6J B;  3L9F A;  5H20 A;  3VB2 A;  4CGZ A;  1R00 A;  3CDH A;  4P9F A;  3B02 A;  2PFB A;  1XCB A;  3T1B A;  4L0Y B;  2CW0 F;  2CG4 A;  3FMQ A;  1QZZ A;  4LD5 A;  5AIQ A;  4CIC A;  2Q0O A;  1BOA A;  2XAJ A;  2Y0M A;  1BC7 C;  3D5L A;  3K1P A;  2PQ8 A;  4IHS A;  4M6Y A;  1ZYR F;  2ZNZ A;  3QP5 A;  2RDP A;  3GEZ A;  3TO6 A;  5E8I A;  2XIG A;  1R5G A;  4N9I A;  1T6S A;  5BPD A;  4R8H A;  1XGN A;  5DD8 A;  3WTZ A;  4OOI A;  1OYW A;  3U2R A;  2AXL A;  4N9H A;  4HX7 A;  1MDM A;  4KUM A;  1S7A A;  1ZHF A;  4KMU X;  3SFZ A;  1T2K A;  1AOY A;  1STZ A;  2ZBK A;  2K86 A;  2VT2 A;  3BJA A;  2VE8 A;  1HW2 A;  3FM3 A;  4LG0 A;  3JW4 A;  4BHB A;  1GVJ A;  4IXA A;  4MEX F;  3WGH A;  3HYI A;  3DPL C;  1SFX A;  1BJA A;  3QRF F;  3ZP5 A;  1FLI A;  4ENK A;  3WU1 B;  3FHZ A;  3MQ0 A;  3DEU A;  3F23 A;  1IXR C;  2QBY A;  4N0B A;  4TV7 A;  5HS8 A;  4B09 A;  5IT3 A;  5DCM B;  3R61 A;  1U8R A;  2ZME A;  4WXH A;  1FBU A;  3IC7 A;  2DBB A;  2W57 A;  4RAY A;  2J5O A;  5BMZ A;  2COM A;  4ZYE A;  1G6N A;  2L4M A;  1T38 A;  4I02 A;  4PDK A;  3L00 A;  1PDN C;  1EV7 A;  2EFQ A;  3ZN0 A;  3GF2 A;  4NB5 A;  3QP6 A;  2KIF A;  4ESB A;  3BOQ A;  2J5P A;  2GQQ A;  2QLZ A;  3K69 A;  3E6B A;  1UB9 A;  2EWN A;  4RGX A;  2Z99 A;  4KMF A;  4ZYD A;  3E6C C;  1JHF A;  5E1W A;  4A0Z A;  5L3C A;  4IRH A;  1U3E M;  2LKP A;  1G3T A;  2A69 F;  3RPQ A;  2JRT A;  2WWY A;  4KIG A;  4IRG A;  2EJR A;  1ZGJ A;  2JPB A;  5JI6 A;  1QPM A;  2F2E A;  5K5R A;  3PFI A;  2P6S A;  4OU0 A;  3V7R A;  3DV8 A;  3ELK A;  2W24 A;  3Q9V A;  5LEK A;  4U7B A;  2VC0 A;  1W7P D;  1Q1H A;  2DO7 A;  3FX3 A;  1HBX G;  2RVC A;  5HS7 A;  2HDC A;  1UFM A;  2NYX A;  3R60 A;  4EMS A;  3P7N A;  4Z2Y A;  4NQW A;  3I5U A;  2Z9O A;  1KU2 A;  4G6Q A;  3PQJ A;  5JHU A;  2GXG A;  1F1Z A;  4ASN A;  1WSU A;  3M9A A;  2DAO A;  4EV0 A;  3ZMU A;  1F9N A;  2HQN A;  4FHT A;  3DFG A;  4AVP A;  3RI4 A;  3KLO A;  3GVA A;  2QUF A;  3GYH X;  2JTV A;  3KET A;  3C18 A;  2VOD A;  1YW9 A;  1XGO A;  5ERI A;  5J6X A;  2EB7 A;  2A61 A;  2MH9 A;  1WRJ A;  3F21 A;  1T98 A;  5D4R A;  3GUD A;  4ESJ A;  4H0E A;  4I98 B;  3DPT A;  4U0V A;  1IW7 F;  2W84 A;  1GHC A;  3V7S A;  2XAQ A;  2M45 A;  3MEX A;  1T39 A;  1OYI A;  2DFI A;  2OZ6 A;  4EJO A;  1QNT A;  2NS0 A;  1PUE E;  1KQ9 A;  3E6M A;  4AIH A;  5CVI A;  4EGZ A;  4YG2 F;  1LQ1 A;  2KIU A;  2R3S A;  1HST A;  2FE3 A;  3KP4 A;  3RYR A;  4S05 A;  1ZH5 A;  3GW2 A;  1ZLK A;  5E1X A;  3RTR A;  4WX9 A;  4UVB A;  2HEO A;  1R1T A;  2Q2E A;  4MQ9 F;  4BH9 A;  3B73 A;  1BN5 A;  3OOP A;  2RV8 A;  4P9U A;  4Y17 A;  2HGC A;  1B9M A;  3I64 A;  4M74 A;  3WGI A;  3VFZ A;  1I5Z A;  2UWM A;  3FXR A;  1IRG A;  3I71 A;  1BI0 A;  2KKO A;  2D45 A;  3HRU A;  2HTJ A;  2DQR A;  3SZT A;  2PMH A;  3D0S A;  3R0A A;  1O3Q A;  2VXZ A;  4ZYH A;  3C7J A;  2FEZ A;  2FXA A;  4GYG A;  1DPR A;  5HLG A;  1J75 A;  3RDI A;  5LGN A;  1MGT A;  4CYD A;  2ESN A;  3GWZ A;  3Q5F A;  3GXO A;  2EV0 A;  5LGU A;  2F5D A;  2ZJ2 A;  4KYW A;  2ZCW A;  4G94 A;  2VOP A;  1QBJ A;  2V9V A;  4KIB A;  2P7C B;  5BQT A;  1O3R A;  1W7P B;  1R23 A;  3U1D A;  2O6G E;  5BOX A;  1USS A;  2O3F A;  5ICF A;  4PZJ A;  1EH7 A;  2NNY A;  2IA1 A;  3IHU A;  1B6A A;  3NQO A;  4OIP F;  2DLL A;  4E70 A;  1GXQ A;  4UXN A;  1ULY A;  2G9W A;  3MFK A;  4R1H A;  2RNJ A;  2XRO A;  1ZRC A;  5HVQ C;  1LDD A;  1X3U A;  2H6B A;  4CDG A;  4GYI A;  1J5Y A;  2FML A;  2EA2 A;  2EV5 A;  1FSH A;  2P5V A;  2FNA A;  3DF8 A;  3QOP A;  2JPC A;  2DT5 A;  1HSJ A;  1Z6R A;  5D8L B;  2FA5 A;  4LLN A;  3TQN A;  5LRS A;  3R6S A;  1XMK A;  4BHP A;  1YW7 A;  3F8B A;  2IA0 A;  4L9N A;  2LF8 A;  4KT5 C;  3HIF A;  1YG2 A;  3N97 A;  3H92 A;  2ELH A;  1A04 A;  5L3B A;  3TO7 A;  2BGC A;  3V8J A;  1XSX A;  4I7H A;  2M1B A;  2NAZ A;  1DDN A;  2CYY A;  1W5S A;  4U0W A;  4HX8 A;  4UVA A;  1FWZ A;  4ZZD A;  2QQA A;  3P9I A;  1LB2 A;  3IKV A;  2W85 A;  4WWC A;  3CO7 C;  4OIO F;  4YFK F;  1SAX A;  3GLX A;  3O6B B;  3F3X A;  2YR2 A;  1OR7 A;  3IL2 A;  4MTD A;  4Q48 A;  4JK1 X;  4P5O A;  3IWZ A;  3O2P E;  2GA2 A;  2LDU A;  4RB0 A;  1J59 A;  1F4K A;  1MKM A;  1P2F A;  5LLQ A;  1HKT A;  2KRF A;  2P8T A;  4L9J A;  5D6F A;  4A0Y A;  1CGP A;  5DD4 A;  3VOD A;  1RI7 A;  1Z91 A;  5JVT A;  5D8K B;  2MLG A;  1P4X A;  1RUN A;  2HQR A;  2XV4 S;  5J8C A;  1TNT A;  4EM2 A;  5ED4 A;  4G8X A;  4HYE A;  5HLI A;  2FBH A;  1YS6 A;  3S2W A;  3CUQ A;  3COA C;  4KFC A;  2YU3 A;  4Y13 A;  4QLC U;  4KNY A;  2ISY A;  3I54 A;  1BI2 A;  1R58 A;  5AON A;  4Q47 A;  1D5V A;  3EET A;  3MWM A;  5L3D A;  3GFI A;  4MNU A;  1TW2 A;  3RPU A;  4RS8 A;  2CWE A;  1BI3 A;  4NHJ A;  4MEY F;  2B0L A;  3IRQ A;  5FFZ A;  4IHT A;  3E5X A;  1E2X A;  3SQN A;  1FX7 A;  2NRA C;  5DCM A;  3F8C A;  2HYF A;  3RIR A;  3TOA A;  4LMY A;  3LA7 A;  4G7O F;  5LHI A;  4P55 A;  2ESH A;  1SD7 A;  3KP2 A;  3MZH A;  1IAW A;  3RKW A;  1FYK A;  2EFN A;  1Y0U A;  4Q5S F;  1H0M A;  3EYI A;  2R7D A;  2HFH A;  5ICC A;  4HX4 A;  1SD6 A;  1U78 A;  3TKY A;  2DQL A;  3RJP A;  1JE8 A;  4UUV A;  2FNP A;  4IVN A;  3BPV A;  3I59 B;  1ZG1 A;  4L9V A;  1RIO H;  4WK8 F;  3WTW C;  5BPI A;  2V1X A;  5CLS A;  3SHF A;  2K4J A;  3GX4 X;  5H6R A;  3JTH A;  5K5Q A;  2P4W A;  1VTN C;  3OV8 A;  2L02 A;  3WE3 A;  4A12 A;  2PLY A;  2WC2 A;  2ZO4 A;  1FP1 D;  5HS9 A;  2D2W A;  2FRH A;  2Z3Y A;  3BRO A;  4AIK A;  4I0A A;  1OPC A;  3I4P A;  5FO5 A;  3BPX A;  2DPU A;  2E7W A;  3CJN A;  2GXB A;  1IUY A;  4DNC A;  2STW A;  3F8F A;  3KZY A;  4CHU A;  4GCV A;  1Z9C A;  2BBY A;  2FMY A;  5TRD A;  2M30 A;  2W25 A;  1S8N A;  2NNN A;  1AWC A;  3T5X A;  4WXC A;  4G7Z F;  3P9K A;  5DUK A;  3AAF A;  1G3W A;  2M87 A;  2VE9 A;  1TQM A;  2TDX A;  2ADU A;  4R79 A;  2OQG A;  3V8L A;  4I09 A;  2EK5 A;  5LEJ A;  1MZB A;  3L09 A;  2EFW A;  2R7F A;  4RB1 A;  4XSX F;  2GA1 A;  3E5Q A;  2LF7 A;  1REP C;  4O5V A;  1HKQ A;  1LJ9 A;  4GGG A;  2CGP A;  2O0Y A;  3CLO A;  2XHK A;  1XSD A;  1BM9 A;  5CJ9 A;  1ZN2 A;  2WTE A;  2YSR A;  1ZRE A;  4JBA A;  2CO5 A;  2CQK A;  3FM5 A;  1V4R A;  1KA8 A;  1I27 A;  1K7A A;  1OKR A;  5CVJ A;  3TOB A;  1LNW A;  2QEN A;  4A6D A;  2V1D A;  3CTA A;  1FYL A;  2RC4 A;  3LWF A;  3G73 A;  2EV6 A;  2EFP A;  2A6E F;  1UHM A;  4LK0 F;  4M9S A;  4LB5 A;  3RKX A;  4BXU A;  1BBY A;  1KYW A;  3ML6 A;  2K4B A;  2DW4 A;  2XKO A;  1TNS A;  4GO1 A;  1XGS A;  4M9X A;  4CXF A;  1L3L A;  1H9T A;  1FC3 A;  3T8R A;  4HQE A;  1BIB A;  2L3D A;  1IZ1 A;  3K9T A;  1J9I A;  2O03 A;  3KEO A;  1ZLJ A;  2JSC A;  3K1M A;  4HW0 A;  2G7H A;  1XDS A;  4HV5 A;  1XSV A;  2P6T A;  5DCF A;  4DQ2 A;  1XDU A;  5AIP A;  1TQI A;  2FSW A;  1ZAR A;  3EDP A;  2V79 A;  3PQK A;  5L3F A;  4G9Y A;  1O3T A;  4L5J A;  4WCG A;  1I6X A;  1TLH B;  1KQ8 A;  1FBS A;  3GFJ A;  5DUI A;  1RZ4 A;  1WI9 A;  1W7P A;  3K2Z A;  3HHG A;  2OAZ A;  3LST A;  1D3Y A;  4RGS A;  2VN2 A;  4KIF A;  1V3F A;  1U2W A;  3J7A O;  2KJB A;  1KYZ A;  3QU3 A;  5F6F A;  4XRF A;  1WWX A;  3ECO A;  1ZG5 A;  4CO8 A;  1B59 A;  3HHH A;  3R4K A;  3ZN1 A;  3QPH A;  4F7Z A;  3J81 Z;  3WTU C;  1Z1D A;  3GFL A;  5KK1 A;  1XN7 A;  2FOK A;  1HQC A;  3HSR A;  5CVV A;  2H27 A;  4A6E A;  3SXY A;  1J0R A;  4WXD A;  1YIO A;  2QVO A;  1TBX A;  3N4M A;  1DPU A;  2A68 F;  5BS6 A;  1OMI A;  4ZZL A;  4PCQ A;  3E6D A;  4HDU A;  5F64 A;  4I0B A;  3GO5 A;  5FLX Z;  2VBZ A;  2ACJ A;  3V8K A;  2AS5 F;  4QWQ A;  3LQQ A;  2P7V B;  5ICG A;  3C1D A;  1O7L A;  1L0O C;  1YQA A;  2WV0 A;  2F5E A;  4UV8 A;  2HWV A;  5L3E A;  1F5T A;  2O61 A;  2IPQ X;  3BJO A;  1BIA A;  3GZ6 A;  4O3M A;  1LDJ A;  1YTY A;  2PMU A;  3VEP A;  1MJ9 A;  2X0L A;  4BNC A;  4M73 A;  3KZZ A;  2M8E A;  1DUX C;  4KIC A;  3ROU A;  1O3S A;  4XLN F;  2OA4 A;  3ABT A;  1GXP A;  5HLH A;  1JHH A;  2QZ8 A;  4AWX B;  2YX4 A;  1CF7 B;  1IXS B;  3HSE A;  3T8T A;  4ENN A;  2DI3 A;  5D4S A;  1SD5 A;  4OMZ A;  4LGW A;  3DQV C;  1YFH A;  1R22 A;  1FOK A;  5HDK A;  4AD9 A;  1ZRD A;  3WE2 A;  1IN4 A;  2HYG D;  3ZMD A;  4MGR A;  1K78 B;  1EH8 A;  2ISZ A;  3TGN A;  3FZV A;  1ZAO A;  1LVA A;  2VBW A;  3M8F A;  2STT A;  4YFN F;  1ON1 A;  2Y48 A;  4O6J A;  1S29 A;  4HOB A;  1P4A A;  3CO6 C;  1S6L A;  1RUO A;  4LLG F;  4ON0 A;  4HF1 A;  4MQV A;  2ZXJ A;  1HKS A;  3FXU A;  4RGR A;  3F8N A;  2XRN A;  1J7K A;  4BQA A;  2Y75 A;  4XBF A;  3E5U A;  3ISP A;  4FT8 A;  1XB4 A;  5D5X B;  5ILV A;  3FMR A;  3BWG A;  2MA3 A;  4ENM A;  1QQI A;  2OQR A;  1R5H A;  1P6R A;  2C6Y A;  4XSZ F;  1R7J A;  2DK8 A;  5DDG A;  1XMA A;  2JZY A;  4FX4 A;  2IA2 A;  1R1U A;  2PG4 A;  2MC3 A;  5HDG A;  3JTG A;  2A6H F;  2E7X A;  4RB2 C;  3WG9 A;  3FXQ A;  4M72 A;  2IW5 A;  2PBI A;  3KP6 A;  2XAS A;  3GZ5 A;  5E17 F;  3RYP A;  3I59 A;  4ZH4 F;  3ZQ7 A;  3WTT C; 
#chains in the Genus database with same CATH topology
 1VZ0 A;  3V7C A;  1ZGW A;  3JSP A;  2UXX A;  4CCO A;  2H94 A;  3J81 K;  1GVD A;  1S7O A;  2QEX I;  1VQL I;  5FKK A;  1M1E B;  5IYC J;  1MJB A;  2YX7 A;  4A3M J;  2H1K A;  2HI3 A;  5E3N A;  4YII A;  2OU2 A;  3QPT A;  2BHY A;  4HQM A;  1UHW A;  3ERM A;  4ZDP A;  3JR9 A;  1E17 A;  4PGG A;  4XOR A;  3PIP F;  1U5T C;  2VLA A;  4L5I A;  3K70 C;  4F52 A;  1U5T B;  2PJP A;  4P96 A;  2R7O A;  5TJJ A;  3K4B A;  2LTP A;  1YIT I;  2JA2 A;  2VBY A;  2R7U A;  2IT0 A;  4XR6 A;  1I50 J;  1HW5 A;  3HGY A;  3CC7 I;  1UMQ A;  1A6Q A;  2JK3 A;  1XG1 A;  1X1D A;  2X4H A;  5FLX K;  2H09 A;  5JFR A;  1T0F C;  3PFY A;  1WJF A;  3SYT A;  5LRR A;  4Y3O A;  4IRI A;  1VI0 A;  2E5Z A;  4HF2 A;  3HOS A;  1WJB A;  2XKP A;  3E97 A;  4IO9 F;  2KDO A;  4ETS A;  3MAJ A;  3NRV A;  3SDG A;  3HTU A;  1VQM I;  2FBK A;  2XGX A;  1P92 A;  2E34 A;  1TWH J;  4OAZ A;  1QHH D;  4FAS D;  2DK5 A;  2COB A;  2HVS A;  2R93 J;  1I6H J;  2XUB A;  1ETV A;  2MD5 A;  2RGV A;  3IWF A;  3KE2 A;  3BQZ A;  3K0L A;  4YFX F;  1R1V A;  2HZT A;  2XAG A;  2CSO A;  3M4O J;  4ZDO A;  5B5E C;  1G3S A;  3JSO A;  1RRJ A;  4BY7 J;  5J3L A;  3CUQ C;  2CRG A;  1UZC A;  2L7K A;  3CUQ B;  5GAE J;  3QOE A;  5LHH A;  1O4X A;  3WTY C;  1FPQ A;  1RPW A;  2OJE D;  2VB6 A;  2M34 A;  2IGM A;  3RKQ A;  2HS5 A;  1RR8 C;  4N4N B;  4HLY A;  2FX0 A;  1TWF J;  4XNF A;  1YLF A;  4MFE A;  3M8E A;  5B3S H;  2L9N A;  3EUH A;  3ERE D;  1BC8 C;  5ICE A;  3DTI A;  1N75 A;  4OMY A;  3H3U A;  1Y1V J;  1MMS A;  5KAF C;  4E7Z A;  3H9Q A;  2FF4 A;  2WA0 A;  1MD0 A;  2BOL A;  4BEH A;  4X0G A;  1IRF A;  4M6X A;  3OS0 A;  3A02 A;  5FFX A;  2KPM A;  4C3I J;  3HRT A;  2W1O A;  3LSH A;  4HV6 A;  2D1V A;  4FE4 A;  4BQN A;  2D1H A;  1VQO I;  1OIS A;  3BJ6 A;  2OBP A;  2BV6 A;  4WF2 A;  2G7U A;  1ETQ A;  2RQP A;  3ZR8 X;  4HEA 2;  4HLX A;  2VQH A;  1X2M A;  1JXS A;  2ETH A;  1SMT A;  1FOX A;  3HTS B;  4AM3 A;  2WY8 Q;  2BW3 B;  3S14 J;  3GBG A;  1Z0X A;  1W4M A;  5IT9 Z;  2R7W A;  3DKW A;  2VC1 A;  4HDV A;  1U6G A;  1D8K A;  4KN7 X;  3QAH A;  4M71 A;  5HOO A;  1DP7 P;  2CQ7 A;  2KT0 A;  2VBX A;  2XF5 A;  1Z7L A;  2KIM A;  4GXO A;  2XGC A;  3SDB A;  4LJZ F;  4BHC A;  2VQL A;  1HF0 A;  4DBR A;  1SVM A;  1MMN A;  1FTZ A;  4NC7 A;  3ZQI A;  2VON A;  4L9T A;  3I58 A;  1E3H A;  4E7H A;  3O8G A;  1P4W A;  3JAM Z;  4I2O A;  3HSF A;  2UZK A;  4HG2 A;  3KYL A;  1MDM B;  2ZXI A;  4C2M J;  5A2Q Z;  3ABK H;  3H5R A;  3LA3 A;  3LAP A;  2PEX A;  3KFW X;  1JUP A;  1K6O A;  3FXO A;  3NWT A;  3WTS C;  1FYM A;  2KLO A;  2H6C A;  3IKT A;  1RNL A;  4KDP A;  3MZ8 A;  3O3K A;  4UNO A;  5CVR A;  2KP6 A;  4LG0 B;  1UCR A;  4HA8 A;  1WJC A;  4ZYA A;  2HDW A;  4ITV A;  4IHY A;  1TT0 A;  4LK1 F;  4AUX A;  1YYV A;  3KLN A;  2ZSH B;  2F48 A;  2QYO A;  3BG7 A;  4ESF A;  1F36 A;  1XD7 A;  3G3Z A;  5K1Y A;  3JRI A;  2E71 A;  5ILS A;  2R5Z A;  2HDD A;  1LEA A;  3JRD A;  2QBY B;  4C9Y A;  1X1P A;  3JRH A;  3ZMV A;  1WQ2 A;  3OIQ A;  5E8G A;  1YS7 A;  4PGH A;  4KA4 A;  1OYY A;  1FT9 A;  5E1Z B;  4JQF A;  5JR3 A;  2FBI A;  2HKX A;  1AU7 A;  2ZME C;  3QPL A;  1IO2 A;  1LE8 B;  1FJL A;  1OLT A;  2ZME B;  2OTJ I;  2W4S A;  1MNE A;  1FZP B;  2DCE A;  2L7Z A;  2UV1 A;  1QPI A;  3WHC A;  1W1W E;  1SFK A;  3L2Q A;  1ZRF A;  1FEX A;  3FF5 A;  4PK4 A;  1ZG3 A;  3KYC B;  2EFO A;  5F0C A;  2DPD A;  4XLH A;  2CFX A;  4L0Z B;  4HBL A;  1ETW A;  4RB3 C;  1U0J A;  1MH4 A;  2DA1 A;  4HF0 A;  5GPA A;  4G6D A;  2XAF A;  1LFU P;  2QA4 I;  2V4J C;  1I3Q J;  4DYR A;  2EA4 A;  2K02 A;  3OR2 C;  2R0Q C;  2TRT A;  1UST A;  4EM0 B;  1WJE A;  4D0P A;  2IS4 A;  5KVR A;  2A5Y B;  2K9S A;  2NOJ B;  4BYY A;  1MJA A;  3DU6 A;  4OIN F;  2JN6 A;  2LBF A;  1T56 A;  1Z77 A;  2RN7 A;  1KU3 A;  3CMA I;  4FX0 A;  4IOA F;  5B66 C;  1YW8 A;  3I53 A;  4XRM A;  3TDU C;  3OL4 A;  3JRC A;  3HL2 A;  2V6E A;  2MLK A;  1Z6T A;  2VT3 A;  4BQQ A;  2H8R A;  2LOO A;  3M7G A;  5EEH A;  3ZXS A;  5J40 A;  1AHD P;  2V9K A;  3BP8 A;  3C2G A;  2E35 A;  4MO7 A;  1FSE A;  5M3F J;  1IXC A;  3Q9S A;  4Y15 A;  2F4M B;  2VQC A;  2OPT A;  1QO0 D;  5E20 A;  2E1N A;  4F91 B;  1B9N A;  2EIN H;  4DYC A;  3WTV C;  2E1O A;  1MBF A;  2Q1Z B;  2ZNY A;  3LA2 A;  4MLO A;  4A3K J;  2K9Q A;  3P9C A;  4FQG A;  4V2G A;  2BEO A;  1U9N A;  4U0Y A;  3AL0 C;  2IVM A;  5DV5 A;  4A5M A;  2VJI A;  3AL0 B;  4IJA A;  3LSK A;  3K4L A;  5CYV A;  3J80 Z;  2QQB A;  2Z5U A;  2Y9Y A;  4UVC A;  3HDD A;  4NDL A;  3H1C A;  2AO9 A;  3BY6 A;  4K2E A;  1W36 D;  4NNJ A;  2LP0 A;  1VQ9 I;  4CH7 A;  3ULQ B;  3L2V A;  1FY7 A;  5H6Q A;  4AYB N;  4ZYG A;  1WPK A;  5D5V B;  4XLP F;  1WKM A;  2E1M C;  5DEQ A;  4MIM A;  1NG7 A;  4GFB A;  2VUM J;  2E1M B;  3PNT A;  2GIV A;  3V4G A;  4A5N A;  5FB2 A;  3MKY B;  2XVC A;  3FBN B;  3L7W A;  1ACI A;  5EGO A;  1K79 A;  1ODD A;  4XOP A;  3FMS A;  1YO5 C;  1SFU A;  2WY7 Q;  2L4A A;  3LFK A;  4U88 A;  4L18 B;  4BXF A;  1JGS A;  3ZPL A;  1S3J A;  2H8W A;  2ZC2 A;  4DBQ A;  1ETO A;  3CUO A;  3OIP A;  1IF1 A;  2IP2 A;  2X51 A;  3A01 B;  3PNY A;  1KU9 A;  1MSE C;  5H2F C;  4NQW B;  4Y4R A;  1A31 A;  2X6X A;  2K7L A;  1B1B A;  2HVR A;  3ZQL A;  3F72 A;  1K61 A;  2V1U A;  3BZC A;  1IN8 A;  2CUF A;  4RGU A;  2LNB A;  2Y9Z A;  1LDK B;  1HLV A;  4AIJ A;  2O8K A;  3NAR A;  3GFM A;  2MBF A;  1R5I D;  2HVQ A;  4D1Q A;  2L0K A;  3OYE A;  2LKX A;  1LVK A;  3L2C A;  2ZKZ A;  4GRI A;  4XL9 A;  9ANT A;  3DEE A;  2P5L C;  2HOE A;  3G1M A;  1XPX A;  5DYM A;  4A2U A;  3OYL A;  2JT1 A;  3DBH B;  3KEQ A;  2M5W A;  4IPA A;  1ONV A;  3ASN H;  3G6E I;  2BE5 F;  3WOD F;  3ZMZ A;  3K7A J;  2ZXW H;  3WGG A;  5LBQ A;  1Z7U A;  3G1O A;  4UUS A;  4YRV A;  4FTH A;  4V19 K;  5FGM A;  4MTE A;  3SZP A;  4B4C A;  1CF7 A;  5IP9 J;  5EG0 B;  1ON2 A;  2JUC A;  5D6E A;  3GTM J;  4MHG A;  1HXD A;  3VOE A;  4XRS A;  3F6O A;  2IJL A;  1JJ6 C;  1VQ8 I;  1YJW I;  5M5Y J;  2F5F A;  2OCE A;  4UHT A;  1TQP A;  3M8J A;  1SEU A;  2PN6 A;  3K2A A;  3HRM A;  1J2X A;  2LRE A;  1EH6 A;  1R36 A;  2XF7 A;  3HOW J;  2R7V A;  1IN7 A;  4B8X A;  2DYR H;  4RLF A;  3KP7 A;  3M1E A;  3WTX C;  1XTA A;  3W3C A;  4M9Z A;  4BU2 A;  2LSO A;  3PSF A;  1X19 A;  4PJM A;  2R7Q A;  3HRS A;  3KZI C;  1WZ2 A;  1Y39 A;  5J8F A;  2VOO A;  3EQL F;  3BDD A;  4EJV A;  2PI0 A;  1K78 A;  5B1B H;  3ABU A;  3OIO A;  5FKL A;  1IC8 A;  2GAU A;  4J00 A;  3DXJ F;  4I01 A;  4DGW B;  1LFP A;  2CUZ A;  3IP4 B;  5IT9 K;  4C3J J;  2HKO A;  2XSD C;  2IXS A;  2ZFW A;  1PUF B;  1KGS A;  1D1B A;  5FRN A;  2Q2E B;  3CCS I;  5FKN A;  4LLL A;  5C3E J;  3ZMS A;  2GWR A;  4KN4 X;  3LNQ A;  2K27 A;  2B7E A;  2HOS A;  1FNN A;  1R49 A;  2X6W A;  1JGG A;  2KZG A;  5C4J J;  1DGW Y;  3JAM K;  3BG5 A;  4E7J A;  2DA5 A;  3S8P A;  5FD5 A;  1BI1 A;  2L54 A;  3LL7 A;  3HKZ N;  5DM6 F;  5A2Q K;  3RKY A;  2MH2 A;  4IF4 A;  4ZTJ A;  2OD5 A;  1KU7 A;  5L3G A;  5CVU A;  1FBQ A;  2DTR A;  2UXN A;  3RCO A;  1W5T A;  4CZZ A;  5J1R A;  3CMM A;  2MGQ A;  2BXZ A;  3GZN B;  1TL8 A;  3LQR A;  1O7F A;  4UV9 A;  4D9J A;  2FU4 A;  2UUZ A;  5ILU A;  3CCJ I;  2QWW A;  3HOV J;  2LK2 A;  2Q8K A;  3W6K B;  1V55 H;  1IV8 A;  2IS1 A;  1NHA A;  2CJJ A;  2W7N A;  4HNT A;  3DLL F;  1O57 A;  3HOT A;  3F22 A;  1D8J A;  3E3V A;  2JVH A;  4BAY A;  1C0W A;  1ZGA A;  3JRA A;  2QSG X;  3FBI B;  5M3M J;  2ICW G;  4PFP A;  4ENJ A;  1SMY F;  1DQU A;  2F6C A;  4EQQ A;  2M0M A;  1TTY A;  1FP2 A;  2LG4 A;  3BZK A;  4XN0 A;  2VKE A;  3CZ6 A;  4EJT A;  3F8M A;  2M7A A;  2HR3 A;  2Z33 A;  2QQ9 A;  1B4A A;  1D0Z A;  2DT7 B;  3R0J A;  1YJN I;  2IRF G;  4IHV A;  3TO9 A;  4OIR F;  2W48 A;  3ZMT A;  2V1N A;  4P1W A;  2F5C A;  2DDA A;  1SD4 A;  1TWA J;  4MFD A;  1KQ0 A;  4H4K C;  1D0Y A;  5D5U B;  3H9J A;  5D5W B;  2L01 A;  2ME6 A;  1Z05 A;  1G3Y A;  3P5J A;  4IZZ A;  1IG7 A;  4A0X A;  3TDZ C;  1FIP A;  2XAH A;  4HAM A;  2V6C A;  3F6V A;  3KP3 A;  3HB9 A;  1LEB A;  3KP5 A;  1HOM A;  1KON A;  2HPM A;  2P5K A;  2GOM A;  3WU0 A;  2GZW A;  3BZ6 A;  4E7K A;  4EVI A;  3MVP A;  1RKT A;  2FQ3 A;  3IRR A;  2KDZ A;  5HDN A;  3CJT B;  4U7D A;  4G7H F;  2KJC A;  3PM1 A;  3T0Y A;  6PAX A;  1POG A;  3ABM H;  5FLM J;  2NS7 A;  2FOW A;  4EJW A;  2F4O B;  1SAU A;  2DU9 A;  1IN6 A;  4EJU A;  4YIF A;  2MFZ A;  1TT5 B;  5EEA A;  2HTS A;  2K3F A;  3BCA A;  2P81 A;  3EYY A;  2VKV A;  4A3L J;  3AKZ A;  3FWE A;  3MMY B;  2EPF A;  1QZY A;  3H5N A;  4AID A;  3G71 I;  1TW3 A;  1SFE A;  2ID6 A;  1JKO C;  5K5O A;  4BDZ A;  5FD6 A;  2VJ5 A;  4D5C A;  5LHG A;  2OC6 A;  4NC8 A;  4J19 A;  2Y0S A;  3M07 A;  2A07 F;  4Q4Z F;  1U5T A;  4RAZ A;  2OZU A;  3CDL A;  4QPO A;  1V5F A;  1X4O A;  1P7J A;  3CJR B;  2XB0 X;  3BR5 A;  1BJZ A;  3J80 K;  4Y52 J;  3I0T A;  5GAD J;  5F1R A;  5E18 F;  3LAJ A;  2O8X A;  4LFU A;  4EM1 A;  1XS9 A;  4BXX J;  3REO A;  3ECH A;  2E1C A;  3HOU J;  4E4H A;  3Q0U A;  2LY2 A;  2L9S A;  3BTI A;  1XCV A;  2RKH A;  2X1C A;  1PP8 F;  4W97 A;  4D7N A;  4C2U A;  3MCZ A;  3VYR B;  2OF7 A;  1T0F A;  2YPR A;  1H9G A;  2MC4 A;  3H3Z A;  1BR4 A;  1I3A A;  1ZKG A;  2A3S A;  1S9H A;  4XKC A;  1PP7 U;  2EZH A;  2EIK H;  2EIJ H;  4IOC F;  1I1G A;  3C3W A;  5J1Y A;  2QM3 A;  1Z3X A;  3DP7 A;  1WH5 A;  1VQ5 I;  4XN3 A;  3MZY A;  2GXA A;  1ZTR A;  3LFU A;  4XKV A;  1GLN A;  3K1N A;  4S04 A;  1IDZ A;  5KCM A;  3NEU A;  1ZQ3 P;  3BTL A;  4OIQ F;  2NXN B;  1RKW A;  4LB6 B;  1I1S A;  1J09 A;  1WCM J;  1IN5 A;  4XOT A;  1XGM A;  4HZF A;  5EEG A;  1HW1 A;  1AA7 A;  3KCC A;  4PJJ A;  3QU6 A;  2BYV E;  5F1J A;  1G4D A;  3AG2 H;  4HNV A;  1OR7 C;  1QGP A;  4EGY A;  2XRL A;  3U9G A;  1YX3 A;  1YJ9 I;  3HUG A;  3W6J B;  1R6R A;  3L9F A;  2MAB A;  5H20 A;  2ZJQ F;  3F9K A;  4M3F A;  3VB2 A;  4CGZ A;  1Y8Q B;  3PJR A;  5GTI C;  1R00 A;  3CDH A;  4P9F A;  3CC4 I;  2CV2 A;  2NVQ J;  3B02 A;  2PFB A;  3EPZ A;  3CCL I;  3I4N J;  2O9L A;  5JHF A;  1XCB A;  1N78 A;  3FHN A;  3T1B A;  4YIR X;  5IP6 A;  4L0Y B;  2CW0 F;  1OCZ H;  2PMZ N;  2CG4 A;  5K7H A;  1HDD C;  1UG0 A;  3S32 A;  3FMQ A;  1IJW C;  1QZZ A;  4LD5 A;  5AIQ A;  4CIC A;  2Q0O A;  1BOA A;  5IPA A;  3CCQ I;  2XAJ A;  4CSW A;  1U9O A;  2Y0M A;  1BC7 C;  3D5L A;  3K1P A;  2PQ8 A;  4IHS A;  3PSI A;  2BW3 A;  2AXT C;  4XLC A;  3GTJ J;  1TWG J;  1ZYR F;  4M6Y A;  3OYK A;  2ZNZ A;  3FIS A;  3QP5 A;  3OOU A;  2KHM A;  2RDP A;  3GEZ A;  3TO6 A;  5E8I A;  2X6O A;  2XIG A;  1QA6 A;  1R5G A;  3OYI A;  3ZQQ A;  1NG6 A;  4N9I A;  2L9V A;  1T6S A;  3OYD A;  2YS9 A;  3PO2 J;  1MBE A;  5BPD A;  2CW8 A;  4R8H A;  1XGN A;  5DD8 A;  4W1U A;  3WTZ A;  4OOI A;  1OYW A;  3U2R A;  2AXL A;  3BTC A;  2L5Q A;  4N9H A;  2JA6 J;  4HX7 A;  1MDM A;  4KUM A;  4UY8 I;  1S7A A;  1ZHF A;  4KMU X;  3SFZ A;  1T2K A;  1AOY A;  1STZ A;  2ZBK A;  2K86 A;  2MG4 A;  2VT2 A;  2R92 J;  4UB8 C;  3BJA A;  2VE8 A;  4G12 A;  2R7R A;  1HW2 A;  4XLA A;  3DLA A;  1BL0 A;  1T8I A;  3FM3 A;  4LG0 A;  2NVT J;  3JW4 A;  3DU5 A;  2ELK A;  1S7E A;  1HC8 A;  4BHB A;  1GVJ A;  4IXA A;  3JRB A;  2CV1 A;  2OCC H;  3CDI A;  3WGH A;  4MEX F;  3HYI A;  3DPL C;  4QTR A;  1SFX A;  1BJA A;  4IKF A;  3A2K A;  5HNH A;  1ORK A;  3ZP5 A;  3QRF F;  1FLI A;  4ENK A;  3WU1 B;  5HOD A;  3FHZ A;  3MQ0 A;  2VXD A;  3DEU A;  2LD5 A;  3F23 A;  1IXR C;  3QYF A;  2QBY A;  3K4K A;  4N0B A;  3CD6 I;  2L2O A;  3UNG C;  4TV7 A;  5HS8 A;  1ITY A;  4B09 A;  4XKB A;  2CQQ A;  5DCM B;  5IT3 A;  1WJA A;  3CC2 I;  1G2H A;  3R61 A;  5FRM A;  1U8R A;  4CCN A;  3HC7 A;  2ZME A;  4WXH A;  2M4G A;  5C4X J;  2BXY A;  2CQX A;  3W2W A;  4BE2 A;  1FBU A;  1K6Y A;  4NUB A;  3IC7 A;  4RBO A;  4HNU A;  2I8D A;  1VQP I;  2KRH A;  2DBB A;  1QHG A;  2W57 A;  1JT0 A;  4RAY A;  1MBH A;  3CCV I;  2GM4 A;  2J5O A;  3E7L A;  5BMZ A;  4IHX A;  2EZL A;  4CA0 A;  3ZQC A;  2COM A;  4ZYE A;  1G6N A;  2L4M A;  4KIT B;  1PJR A;  3GTL J;  1T38 A;  4I02 A;  4PDK A;  1DGR M;  3L00 A;  1PDN C;  1EV7 A;  2EFQ A;  3ZN0 A;  5F0H A;  3NAU A;  3GF2 A;  1IGN A;  4NB5 A;  2XPU A;  4XQF A;  2WAD A;  3QP6 A;  1W5C C;  1D5Y A;  2KIF A;  2R7T A;  4ESB A;  3BOQ A;  2J5P A;  2GQQ A;  1F43 A;  3TW7 A;  1LUJ B;  2DOA A;  4BUP A;  2QLZ A;  3CES A;  2Y69 H;  1FOW A;  3K69 A;  3E6B A;  1LPQ A;  3TP3 A;  1EJ9 A;  1UB9 A;  4BL0 B;  1BR2 A;  2EWN A;  2JSP A;  1LKX A;  4RGX A;  2Z99 A;  4KMF A;  4ZYD A;  4A3F J;  1QVU A;  4II2 A;  2R5Y B;  1V54 H;  3E6C C;  1JHF A;  3LSI A;  4QSH A;  5E1W A;  4A0Z A;  5L3C A;  5M5X J;  4LOC A;  4E7I A;  2R7X A;  2QKL B;  4IRH A;  1U3E M;  2LKP A;  3CMY A;  1G3T A;  3W2A A;  2A69 F;  3RPQ A;  2JRT A;  2WWY A;  4KIG A;  1R4M B;  1MIJ A;  4IRG A;  1B8I B;  2EJR A;  1ZGJ A;  2JPB A;  5IP7 J;  3ZOB A;  5JI6 A;  1QPM A;  2F5V A;  2F2E A;  4E6K G;  5K5R A;  3PFI A;  4LIV A;  1T95 A;  2P6S A;  4OU0 A;  3V7R A;  3DV8 A;  3ELK A;  3BR2 A;  2W24 A;  1R9T J;  2HOA A;  4F55 A;  3Q9V A;  5LEK A;  4XIC A;  4U7B A;  3TBI A;  3GCM A;  2EZK A;  3NWS A;  1GT0 C;  2VC0 A;  2DJI A;  4EEF G;  1W7P D;  1TC3 C;  1Q1H A;  3OYJ A;  1OCO H;  2AQF A;  2DO7 A;  3FX3 A;  2L7F P;  1HBX G;  2RVC A;  1MMA A;  1UG2 A;  4J01 A;  5GPC A;  5HS7 A;  1YE9 A;  2HDC A;  3DEW A;  1UFM A;  1YIJ I;  1Y8R B;  3CP2 A;  2NYX A;  2XSJ C;  3R60 A;  1JKR C;  3OR1 C;  4BKX A;  1ZR2 A;  1HCR A;  2DA3 A;  4EMS A;  3P7N A;  4Z2Y A;  4A69 C;  3A01 A;  5E3L A;  4BJ5 C;  2ID3 A;  4NQW A;  4YEJ A;  3BR0 A;  3I5U A;  2Z9O A;  1KU2 A;  3A03 A;  5KNL A;  4G6Q A;  1Z21 A;  3PQJ A;  4AVZ A;  3UKG A;  3OYM A;  1JUM A;  2HZD A;  1U8B A;  5FLV A;  4I6Z A;  2I5U A;  2N8G A;  5JHU A;  3EUA A;  2LKS A;  2DMN A;  2GXG A;  1F1Z A;  4ASN A;  1WSU A;  2EQR A;  1A35 A;  4PSX A;  3M9A A;  2DAO A;  2WV1 A;  1JKP C;  4EV0 A;  3ZMU A;  4BS9 A;  1F9N A;  2HQN A;  3N05 A;  4FHT A;  5DS9 A;  3DFG A;  4AVP A;  4XMY A;  2MSY A;  3RI4 A;  1BR1 A;  3ZQG A;  3KLO A;  3LSG A;  3GVA A;  2QUF A;  3HBL A;  3GYH X;  2JTV A;  3KET A;  4B48 A;  3C18 A;  2VOD A;  1YW9 A;  5FRO A;  1V5G A;  1FMV A;  1XGO A;  2GLO A;  3OMY A;  1VQ6 I;  5ERI A;  2HQ5 A;  5J6X A;  1V5E A;  2GIZ A;  2EB7 A;  2A61 A;  2MH9 A;  1WRJ A;  2DFF A;  5EG0 A;  4ANJ A;  3F21 A;  3E0J B;  1T98 A;  5D4R A;  3GUD A;  3M3Y J;  1K83 J;  4ESJ A;  4H0E A;  4I98 B;  3DPT A;  3HPG A;  4U0V A;  1IW7 F;  2W84 A;  4DJA A;  3S1Q J;  1GHC A;  4JX5 A;  5K7F A;  3OYA A;  3I56 I;  3V7S A;  2XAQ A;  2M45 A;  3MEX A;  1T39 A;  1OYI A;  2DFI A;  2OZ6 A;  2DA4 A;  2R4G A;  1MH3 A;  2QF7 A;  2YUS A;  4EJO A;  1QNT A;  2HU9 A;  2NS0 A;  1PUE E;  1I39 A;  1KQ9 A;  3E6M A;  4AIH A;  1JJ8 C;  3H9G A;  5CVI A;  3ZQH A;  5GAG J;  4EGZ A;  4YG2 F;  1GV2 A;  1LQ1 A;  2KIU A;  3CLQ A;  4KIS A;  1ETY A;  2R3S A;  4Z6Y A;  1GV5 A;  1HST A;  1JI8 A;  2FE3 A;  3KP4 A;  3RYR A;  4S05 A;  1ZH5 A;  3GW2 A;  1ZLK A;  3IV5 A;  2KL4 A;  5LFA A;  5E1X A;  3RTR A;  2WAQ N;  4WX9 A;  2BY1 A;  2XB5 A;  1RR7 A;  4UVB A;  4DOZ A;  2HEO A;  1PUF A;  1R1T A;  1PVE A;  4RAG A;  1R71 A;  3ZQF A;  2Q2E A;  3RQ4 A;  2ECB A;  3BR3 A;  2V7F A;  4MQ9 F;  4BH9 A;  4CUG A;  3B73 A;  1BN5 A;  3OOP A;  3FIW A;  2RV8 A;  3K4J A;  1JT6 A;  2DYS H;  4P9U A;  3J7A Y;  4Y17 A;  4B43 A;  1H88 C;  2HGC A;  1X58 A;  1B9M A;  2AHQ A;  3I64 A;  4M74 A;  3WGI A;  3SEZ A;  3HG9 A;  3QPS A;  3VFZ A;  1I5Z A;  4KT6 A;  4BE0 A;  2UWM A;  2DDB A;  2IGN A;  3FXR A;  1IRG A;  2DOF A;  3TW6 A;  3I71 A;  3LSM A;  3IAS 2;  1BI0 A;  3MD2 A;  3HXL A;  2CUJ A;  2KKO A;  2MD0 A;  2D45 A;  5EDN A;  3S3N A;  4X6A J;  3HRU A;  2HTJ A;  2DQR A;  3SZT A;  3LOC A;  2PMH A;  1X1A A;  3RZD J;  1PYV A;  3D0S A;  1NK3 P;  5KAI C;  3R0A A;  1O3Q A;  2VXZ A;  2XGD A;  4ZYH A;  1SVO A;  3C7J A;  1T33 A;  4BY1 J;  2FEZ A;  2FXA A;  4GYG A;  4ZC3 A;  1DPR A;  5HLG A;  3G1L A;  1J75 A;  3RDI A;  1MBK A;  1FIA A;  5LGN A;  1ENH A;  1MGT A;  4CYD A;  2ESN A;  4Y7N J;  4HRI A;  2V9P A;  3GWZ A;  3Q5F A;  4ABZ A;  2HXI A;  3GXO A;  1TZL A;  1Z3Y A;  2EV0 A;  4DW6 A;  5LGU A;  5EF6 A;  3OYF A;  2F5D A;  3CQZ J;  5GAH J;  2ZJ2 A;  4KYW A;  2ZCW A;  4DZJ A;  4G94 A;  2VOP A;  2E5N A;  5KHD A;  2R7Z J;  1QBJ A;  2V9V A;  4KIB A;  3MKW B;  2P7C B;  2VIX A;  5BQT A;  1O3R A;  1W7P B;  1R23 A;  3U1D A;  1WHU A;  3FK7 A;  2O6G E;  3FDY A;  4IHW A;  5BOX A;  2PJR B;  1USS A;  2O3F A;  5ICF A;  4PZJ A;  1EH7 A;  1P9Q C;  3Q3S A;  2Z1D A;  2NNY A;  2IA1 A;  3IHU A;  1B6A A;  3DWL E;  3NQO A;  3H0D A;  2E36 A;  4OIP F;  3FXJ A;  1S5L C;  4F92 B;  4JOM A;  2VI6 A;  2DLL A;  3KIO A;  2ME0 A;  4A3B J;  2VPR A;  4E70 A;  1GXQ A;  4UXN A;  1ULY A;  2G9W A;  3HGG A;  3MFK A;  4FE7 A;  4R1H A;  2IGO A;  2RNJ A;  2A6T A;  2XRO A;  1ZRC A;  2X85 A;  5HVQ C;  1LDD A;  1X3U A;  3QWL A;  2H6B A;  4JX6 A;  2LLK A;  2QKM B;  4XK4 A;  3H35 A;  2NVU B;  4CDG A;  2ZXH A;  4GYI A;  3OSF A;  2JA8 J;  1J5Y A;  2FML A;  2KZV A;  2LR8 A;  3CCU I;  2EA2 A;  2EV5 A;  4I99 C;  1H89 C;  4B44 A;  1FSH A;  3Q0V A;  2P5V A;  2FNA A;  1A6I A;  3DF8 A;  2DOE A;  4E7L A;  2GOX B;  4UUT A;  1VQN I;  2AQE A;  4BDY A;  3C2H A;  4RA2 A;  5FJ8 J;  3QOP A;  2JPC A;  3K70 D;  4E7S A;  3PUB A;  3S2D J;  2DT5 A;  1HSJ A;  2DA2 A;  5HNF A;  1W36 C;  1Z6R A;  3L2W A;  5D8L B;  2FA5 A;  1ETK A;  5IYB J;  4LLN A;  3S1M J;  5B1A H;  3TQN A;  5LRS A;  3R6S A;  1XMK A;  4BHP A;  1YW7 A;  3F8B A;  4C3H J;  5LD2 C;  1K4S A;  4AYB A;  1G59 A;  1Y6I A;  2IA0 A;  4A3I J;  2EIM H;  2VQG A;  4L9N A;  3DBR B;  2GBY A;  2LF8 A;  2O5R A;  4KT5 C;  3HIF A;  3I9V 2;  1YG2 A;  3N97 A;  3DTE A;  3H92 A;  2ELH A;  1A04 A;  1VQK I;  4M3B A;  2OTL I;  2M9H A;  3TO7 A;  5L3B A;  2E19 A;  3I3L A;  2BGC A;  3V8J A;  1XSX A;  4C30 A;  1VQ7 I;  4I7H A;  2M1B A;  2NAZ A;  3CF2 A;  2CYY A;  1W5S A;  1DDN A;  1A36 A;  2LH9 A;  3O8H A;  4U0W A;  4HX8 A;  4BE1 A;  4B3X A;  4UVA A;  1FWZ A;  1SAN A;  2XF6 A;  4ZZD A;  2QQA A;  2IS2 A;  1VND A;  2A5W A;  1DU0 A;  3P9I A;  3FXK A;  1LB2 A;  2XDV A;  3IKV A;  1XMX A;  4RM2 A;  2QSH X;  2W85 A;  4WWC A;  3CO7 C;  1ERD A;  4OIO F;  1WH7 A;  5JVG F;  1YRN B;  4YFK F;  1SAX A;  3GLX A;  3RSN A;  4N4O B;  3O6B B;  3F3X A;  3U21 A;  2XPV A;  2YR2 A;  3E1S A;  2CFO A;  1OR7 A;  4HST A;  3IL2 A;  2X48 A;  1KZH A;  4MTD A;  4Q48 A;  3UR3 C;  4B47 A;  3OYC A;  3DKY A;  4JK1 X;  2M3A A;  3MKZ A;  1XX5 A;  4P5O A;  5CKT A;  5F04 A;  3EUK L;  3IWZ A;  3O2P E;  1SC7 A;  2GA2 A;  2PX9 A;  4BJT A;  5M5W J;  5EJC A;  2HPI A;  2LDU A;  4RB0 A;  2Y2Z A;  1J59 A;  1F4K A;  3QOD A;  1MKM A;  1P2F A;  5LLQ A;  1HKT A;  4XKW A;  3ZCO A;  2KRF A;  2P8T A;  4L9J A;  3BR6 A;  5D6F A;  1UEL B;  5CQG A;  4QIW N;  4A0Y A;  1CGP A;  2K5C A;  1P7I A;  2E60 A;  2YU9 J;  5DD4 A;  3RZO J;  3VOD A;  1RI7 A;  1Z91 A;  5JVT A;  2JA5 J;  4PJN A;  3WHB A;  5D8K B;  2MLG A;  5DM7 F;  1P4X A;  5F08 A;  4JYK A;  5E79 C;  3MKL A;  1RUN A;  2HQR A;  2NS8 A;  4M6V A;  2XV4 S;  5J8C A;  3SJM A;  1D0X A;  1TNT A;  1AKH B;  4EM2 A;  5ED4 A;  4G8X A;  4HYE A;  2I10 A;  5HLI A;  1OCC H;  2FBH A;  2JWT A;  1YS6 A;  3S2W A;  2Z2S B;  3CUQ A;  1MNM C;  1OJL A;  3COA C;  4DYQ A;  4XRS G;  2CMP A;  3PL8 A;  4KFC A;  2YU3 A;  3HKZ A;  4Y13 A;  3GTG J;  4QLC U;  4KNY A;  2ISY A;  3I54 A;  1BI2 A;  3FXM A;  2X9D A;  3BR1 A;  1R58 A;  3LSP A;  1X3W B;  2K9L A;  5AON A;  2DJN A;  4Q47 A;  3EET A;  3MWM A;  1D5V A;  5L3D A;  3GFI A;  1DU6 A;  4MNU A;  1TW2 A;  4F3Q A;  3RPU A;  1QZE A;  4I76 A;  2CWE A;  4RS8 A;  3I4M J;  2MYS A;  5BNG A;  1BI3 A;  4LG3 A;  3KYD B;  4NHJ A;  2NOG A;  4CCL A;  4MEY F;  2B0L A;  1BW6 A;  3IRQ A;  5FFZ A;  5J1U A;  4IHT A;  3JRF A;  2KIQ A;  3E5X A;  3HPH A;  1E2X A;  2BVL A;  3SQN A;  1FX7 A;  2NRA C;  5DCM A;  3F8C A;  2HYF A;  3RIR A;  3TOA A;  4LMY A;  3LA7 A;  4G7O F;  1UAA A;  1RES A;  1FTT A;  5LHI A;  4P55 A;  2ESH A;  1OCP A;  4CYC B;  1ZK8 A;  2DMP A;  2CU7 A;  2HNH A;  1SD7 A;  1JTY A;  2KFD A;  3K4N A;  3KP2 A;  3L2U A;  3DKX A;  3MZH A;  2NVY J;  5IY5 H;  1IAW A;  2JQ7 A;  2QSF X;  3DTK A;  3RKW A;  1FYK A;  2EFN A;  3OSG A;  1Y0U A;  4Q5S F;  1H0M A;  3EYI A;  2BY3 A;  2R7D A;  2HFH A;  5ICC A;  1B72 B;  4HX4 A;  1GDT A;  3DCF A;  1SD6 A;  4JX4 A;  1U78 A;  3TKY A;  2DOD A;  2DQL A;  3RJP A;  3HOZ J;  1JE8 A;  4UUV A;  2FNP A;  4IVN A;  3BPV A;  2JRM A;  4CCK A;  3I59 B;  1ZG1 A;  3TP0 A;  3X2Q H;  4L9V A;  2ZJP F;  1RIO H;  1NH3 A;  1IRX A;  4WK8 F;  4CCM A;  3WTW C;  5BPI A;  2V1X A;  2XGE A;  1SVL A;  5CLS A;  3IH3 A;  4BBR J;  3SHF A;  3H0G J;  2K4J A;  3PNV A;  2R7S A;  1IRZ A;  3GX4 X;  3W6V A;  3L2R A;  1IV6 A;  2VPL A;  5H6R A;  2ELJ A;  3VDX A;  3LSR A;  3JTH A;  5K5Q A;  3OS2 A;  5K7Z A;  2P4W A;  3J7Z I;  4CZC A;  1VTN C;  3OV8 A;  3CCR I;  4M3E A;  1E3O C;  3HUG B;  2L02 A;  3WE3 A;  3CF5 F;  1X1B A;  2WC2 A;  2R5Y A;  4A12 A;  2ZO4 A;  2PLY A;  1FP1 D;  5HS9 A;  2D2W A;  4PUS A;  2FRH A;  2Z3Y A;  3BRO A;  4AIK A;  4I0A A;  1OPC A;  1WFX A;  2XPW A;  4LIU A;  1E0E A;  3A4C A;  3I4P A;  4IEJ A;  4PJ0 C;  5LGT A;  1VFC A;  2HYJ A;  5FO5 A;  3BPX A;  2DPU A;  2E7W A;  1B8I A;  1LE8 A;  1D1A A;  3L1P A;  3CJN A;  2VJ4 A;  2GXB A;  1IUY A;  4DNC A;  1A5J A;  3K6G A;  3HOX J;  2STW A;  3F8F A;  3KZY A;  3HEF A;  1APL C;  4CHU A;  1EF4 A;  4GCV A;  4DZP A;  1YOV B;  2BBY A;  1Z9C A;  2FMY A;  3GME A;  1N25 A;  5TRD A;  5C44 J;  1XC5 A;  2M30 A;  2W25 A;  2CUE A;  4CCJ A;  1S8N A;  2L9R A;  2NNN A;  4FET A;  1AWC A;  3T5X A;  5E3M A;  4WXC A;  1QVT A;  4G7Z F;  1MMD A;  3P9K A;  1S72 I;  5DUK A;  3AAF A;  1G3W A;  2M87 A;  3CCE I;  2VE9 A;  1TQM A;  2TDX A;  2ADU A;  1QRY A;  4R79 A;  3VYS B;  2OQG A;  2P0W A;  2DMQ A;  3V8L A;  2ECC A;  5FKM A;  4I09 A;  2EK5 A;  5LEJ A;  3BG6 A;  1MZB A;  3L09 A;  2EFW A;  2R7F A;  4RB1 A;  4XSX F;  2GA1 A;  3E5Q A;  3M1C A;  1FMW A;  2VL8 A;  2LF7 A;  3PUF A;  1REP C;  4O5V A;  3A1Y A;  3PO3 J;  3EUH C;  5E3O A;  1DP3 A;  1HKQ A;  1LJ9 A;  4GGG A;  3SZG A;  2CGP A;  1OCR H;  2O0Y A;  3CP8 A;  2G0E A;  3CLO A;  4X1E A;  3MN2 A;  2EIL H;  2WB1 N;  3J7Y J;  2XHK A;  2E2I J;  1XSD A;  1BM9 A;  5CJ9 A;  1ZN2 A;  3AFH A;  4BEH B;  2WTE A;  3C2B A;  3VSK A;  2YSR A;  1ZRE A;  1WGX A;  2B63 J;  3S17 J;  2LY9 A;  2CQN A;  4JBA A;  3S1N J;  2CO5 A;  4UB6 C;  2CQK A;  3FM5 A;  1V4R A;  1KA8 A;  2VJJ A;  1I27 A;  3HM5 A;  3WG7 H;  1K7A A;  3G4S I;  1R4N B;  1OKR A;  5CVJ A;  2PMZ A;  3TOB A;  3D1N I;  1WJD A;  1LNW A;  4M3G A;  1MBJ A;  4IX7 A;  2D5V A;  2QCO A;  2QEN A;  4A6D A;  2KIS A;  2V1D A;  2LVS A;  3CTA A;  3ESW B;  2K9M A;  4FIS A;  3H5A A;  1FYL A;  4BJ6 C;  5IOY A;  2RC4 A;  3LWF A;  3G73 A;  2IAI A;  2M7B A;  3HZJ A;  2EV6 A;  2ZSI B;  2EFP A;  4ZJZ A;  2LRD A;  2A6E F;  4D7M A;  1UHM A;  4LK0 F;  4M9S A;  4A3G J;  1EKE A;  4BGD A;  4XM3 A;  4LB5 A;  3OYN A;  1TP4 A;  4A3J J;  3RKX A;  4RLQ A;  2V26 A;  2W00 A;  4BXU A;  1NTC A;  4II3 A;  1BBY A;  1KYW A;  3ML6 A;  3OY9 A;  2K4B A;  3D5S C;  3VSL A;  2DW4 A;  2XKO A;  2CV0 A;  1WI3 A;  1TNS A;  1JUS A;  4XID A;  4GO1 A;  1XGS A;  4M9X A;  2K3P A;  4CXF A;  2K9N A;  1L3L A;  4A3C J;  1BW5 A;  2JVG A;  1FC3 A;  3T8R A;  1H9T A;  2M8G X;  4HQE A;  5F27 A;  4A3D J;  3VYU B;  1BIB A;  3GTQ J;  2L3D A;  1IZ1 A;  2DMU A;  1N77 A;  3K9T A;  1J9I A;  1MMG A;  2O03 A;  1YI2 I;  1W0T A;  3KEO A;  2Y31 A;  2R5Z B;  1ZLJ A;  2M0C A;  2JSC A;  3K1M A;  4HW0 A;  2DT6 A;  2G7H A;  1XDS A;  4OWR B;  4HV5 A;  1XSV A;  3S3O A;  2RAE A;  2LFB A;  5TGT A;  3FK6 A;  2CW7 A;  3U1K A;  2P6T A;  2W82 A;  1Y1W J;  5DCF A;  2ZJR F;  4DQ2 A;  4IQ4 A;  1XDU A;  5AIP A;  1TQI A;  4L5E A;  5J47 A;  3CCM I;  4RAF A;  2FSW A;  1ZAR A;  2LY1 A;  3EDP A;  5JLW A;  2V79 A;  3PQK A;  2CH0 A;  3BG9 A;  3IAM 2;  1Y0N A;  3PIO F;  3BT9 A;  5L3F A;  3QYE A;  4G9Y A;  3K10 A;  4L5J A;  1O3T A;  2LMD A;  4WCG A;  1E3P A;  1I6X A;  4IQJ A;  1TLH B;  1KQ8 A;  1BA5 A;  3B6C A;  2LYC A;  2DFH A;  2X1D A;  1IDY A;  3JRG A;  1FBS A;  3GFJ A;  5DUI A;  1FOY A;  1OQY A;  1RZ4 A;  1WI9 A;  3IH2 A;  2BVM A;  2DA6 A;  2M2E A;  1W7P A;  2ZFU A;  3K2Z A;  1X2N A;  2OV7 A;  2IBD A;  3ABL H;  2FD5 A;  3HHG A;  2OAZ A;  3LST A;  1D3Y A;  2PJR A;  2JUG A;  4B3A A;  3S3M A;  2LBF B;  4RGS A;  2VN2 A;  4KIF A;  3TMO A;  2H1L A;  1V3F A;  1U2W A;  3J7A O;  3GTK J;  3KPH A;  2KJB A;  1KYZ A;  3DBL B;  3BTJ A;  5JLX A;  3QU3 A;  5F6F A;  4XRF A;  3OL3 A;  1WWX A;  3ECO A;  1ZG5 A;  1BOB A;  4ZDL A;  2RRE A;  4CO8 A;  1B59 A;  3HHH A;  3R4K A;  2BY2 A;  1TWC J;  3ZN1 A;  3DPU A;  3QPH A;  4F7Z A;  3J81 Z;  2X6Y A;  3WTU C;  2HQA A;  3B6A A;  5J4Y A;  1Z1D A;  3GFL A;  5KK1 A;  1XN7 A;  2FOK A;  1HQC A;  3HSR A;  2LC2 A;  5CVV A;  2H27 A;  4A6E A;  3SXY A;  2NVX J;  1J0R A;  2Y0S N;  1SFO J;  3FXL A;  2JMW A;  4B1R A;  4WXD A;  1YIO A;  4GDF A;  3AG4 H;  3G2B A;  2K85 A;  2QVO A;  2FQ4 A;  1TBX A;  2F4I A;  3N4M A;  1JTX A;  2A68 F;  5BS6 A;  1DPU A;  1OMI A;  1VQ4 I;  4ZZL A;  1Z67 A;  5FKO A;  2WB1 A;  4PCQ A;  3E6D A;  3ZRG A;  4HDU A;  3KX2 A;  5F64 A;  4I0B A;  3GTP J;  3GO5 A;  5FLX Z;  2BY0 A;  1WJ5 A;  2VBZ A;  2ACJ A;  5EGO B;  4DIQ A;  3V8K A;  2B9S A;  3BQY A;  2AS5 F;  1ETX A;  4FCY A;  4QWQ A;  3H36 A;  4M3D A;  1ZR4 A;  3S15 J;  3LQQ A;  2P7V B;  5ICG A;  3C1D A;  5IOZ A;  1O7L A;  1L0O C;  2KQR A;  1YQA A;  3OYG A;  4AC0 A;  2HOT A;  2X1E A;  4F93 B;  2WV0 A;  1JKQ C;  2FJ1 A;  2F5E A;  3Q0W A;  4UV8 A;  2HWV A;  3A0H C;  1EA3 A;  1MW7 A;  5L3E A;  3H3V K;  2DTZ A;  1F5T A;  3S1R J;  2OUM A;  2O61 A;  2IPQ X;  3BJO A;  1MND A;  1BIA A;  3GZ6 A;  4O3M A;  1LDJ A;  2XAU A;  1YTY A;  2PMU A;  3VEP A;  5HLT A;  1MJ9 A;  2X0L A;  4BNC A;  4KJZ A;  3BG3 A;  4M73 A;  5CPR B;  1YHQ I;  3TL4 X;  1IUF A;  3CJQ B;  4NBQ A;  3KZZ A;  2HXO A;  3QYB A;  3S2H J;  3BC8 A;  4YEL A;  2M8E A;  4PJL A;  4KIC A;  1DUX C;  5EZH A;  3ROU A;  1O3S A;  3HOY J;  2K40 A;  4XLN F;  2IGK A;  5CQE A;  2OA4 A;  3ABT A;  1GXP A;  5HLH A;  1JHH A;  1YRN A;  4UUS B;  2QZ8 A;  4AWX B;  4HSR A;  2QGU A;  5TIS C;  2YX4 A;  2JA7 J;  1CF7 B;  1IXS B;  3HSE A;  3T8T A;  2E2H J;  4ENN A;  3AG3 H;  1H8A C;  2DI3 A;  5D4S A;  1SD5 A;  3OS1 A;  3JCU C;  4OMZ A;  4D5F A;  3BCB A;  4A3E J;  3IH4 A;  2BHZ A;  4LGW A;  3DQV C;  4HPQ A;  1YFH A;  1R22 A;  2IEK A;  2RNG A;  1FOK A;  3LSJ A;  1ZEL A;  1WVR A;  1RET A;  5HDK A;  3HJE A;  4U87 A;  3OYH A;  4AD9 A;  2DXI A;  1ZRD A;  4RM3 A;  3WE2 A;  5EYR A;  2O7O A;  3RQI A;  3GLL A;  2CS3 A;  1IN4 A;  2HYG D;  3ASO H;  3ZMD A;  3K4C A;  4MGR A;  1NK2 P;  2E2J J;  4EAT A;  5EZG A;  2WAF A;  5J4V A;  1K78 B;  2VKH A;  3OWT A;  4IL6 C;  1MSF C;  2IS6 A;  1EH8 A;  1W0U A;  1UJ8 A;  2ISZ A;  2WAE A;  3TGN A;  1X4P A;  5DTD A;  3FZV A;  1ZAO A;  5IYD J;  4JP0 A;  3GTO J;  1LVA A;  3WU2 C;  2FUG 2;  1QU3 A;  2VBW A;  2Y30 A;  3M8F A;  2STT A;  3IUO A;  1ON1 A;  4YFN F;  2Y48 A;  3LMM A;  4O6J A;  1S29 A;  2BZT A;  3I55 I;  2KMU A;  1Y56 A;  2RQQ A;  4HOB A;  4QPQ A;  1P4A A;  3CO6 C;  1S6L A;  1X3Z B;  1RUO A;  2WAQ A;  4LLG F;  4XON A;  4ON0 A;  1AKH A;  3SEQ A;  4HF1 A;  2XC7 A;  4MQV A;  1G8X A;  1OFC X;  2ZXJ A;  3FKI J;  2MW8 A;  1D1C A;  1YX5 A;  1HKS A;  3S16 J;  4BQO A;  3FXU A;  4RGR A;  3F8N A;  2L7M P;  2XRN A;  3D5R C;  1J7K A;  4BQA A;  1GUU A;  3BLY A;  2Y75 A;  4XBF A;  2M4K A;  3ZGK A;  1LFB A;  3E5U A;  3ISP A;  2DMT A;  4FT8 A;  3RPU D;  1CQT A;  1T08 B;  4RMN A;  3VWB A;  1XB4 A;  5D5X B;  4ZTF A;  4BBS J;  1X1C A;  3QQA A;  2WBM A;  3VYT B;  5ILV A;  1Q1V A;  3FMR A;  3BWG A;  5GP9 A;  2MA3 A;  4ENM A;  1QQI A;  2OQR A;  1R5H A;  2QQ8 A;  1P6R A;  2C6Y A;  4XSZ F;  1R7J A;  1HA8 A;  4PSW A;  4S0H B;  3K4M A;  2DK8 A;  3SFI A;  2VKD A;  5DDG A;  1XMA A;  3ONQ A;  3CCY A;  1MBG A;  2EBI A;  4XLF A;  2JZY A;  3A0B C;  4FX4 A;  3TED A;  3FKJ A;  4BAC A;  1OCT C;  1HDP A;  2IA2 A;  3F0C A;  1R1U A;  4LIT A;  4CYC A;  3AG1 H;  4RDU A;  4NC6 A;  2PG4 A;  3S93 A;  2A05 A;  4XLE A;  2DA7 A;  2MC3 A;  5HDG A;  3JTG A;  2A6H F;  2KRC A;  2TCT A;  3V42 A;  2E7X A;  4RB2 C;  3WG9 A;  3FXQ A;  4OAY A;  4M72 A;  2ZB9 A;  1B72 A;  3JRE A;  2JJ7 A;  2IW5 A;  4A93 J;  2PBI A;  1VF9 A;  2EZI A;  5F0F A;  3CME I;  1UHS A;  3KP6 A;  4V2F A;  2DFE A;  4Y33 A;  3VPR A;  2XAS A;  3GZ5 A;  5E17 F;  3RYP A;  3W2V A;  3I59 A;  2Z16 A;  2VAS A;  4G6T B;  4ZH4 F;  3OYB A;  5GTH C;  4AU7 A;  1K4T A;  2EH3 A;  3ZQ7 A;  3KEY A;  1RC9 A;  4PFO A;  3WTT C;  4C2T A;  2DN0 A; 
#chains in the Genus database with same CATH homology
 3V7C A;  3JSP A;  2UXX A;  2H94 A;  3J81 K;  1S7O A;  1MJB A;  2YX7 A;  4YII A;  2OU2 A;  3QPT A;  4HQM A;  1UHW A;  1E17 A;  4PGG A;  1U5T C;  4L5I A;  1U5T B;  2PJP A;  4P96 A;  5TJJ A;  2VBY A;  2IT0 A;  1HW5 A;  2X4H A;  5FLX K;  2H09 A;  5JFR A;  5LRR A;  4IRI A;  4HF2 A;  3HOS A;  2XKP A;  3E97 A;  4ETS A;  3MAJ A;  3NRV A;  3HTU A;  2FBK A;  2XGX A;  1P92 A;  2DK5 A;  2XUB A;  2MD5 A;  2RGV A;  3IWF A;  3KE2 A;  3K0L A;  4YFX F;  1R1V A;  2HZT A;  2XAG A;  2CSO A;  1G3S A;  3JSO A;  3CUQ C;  3CUQ B;  5LHH A;  3WTY C;  1FPQ A;  2HS5 A;  4HLY A;  1YLF A;  3M8E A;  3EUH A;  3ERE D;  1BC8 C;  5ICE A;  4OMY A;  3H3U A;  2FF4 A;  1MD0 A;  1IRF A;  4M6X A;  5FFX A;  3HRT A;  4HV6 A;  2D1V A;  2D1H A;  3BJ6 A;  2OBP A;  2BV6 A;  4WF2 A;  2G7U A;  2RQP A;  4HLX A;  1JXS A;  2ETH A;  1SMT A;  3HTS B;  1W4M A;  5IT9 Z;  3DKW A;  2VC1 A;  4HDV A;  1U6G A;  1D8K A;  4KN7 X;  3QAH A;  4M71 A;  5HOO A;  1DP7 P;  2VBX A;  5LGT A;  2KIM A;  4GXO A;  4BHC A;  4LJZ F;  2VON A;  4L9T A;  3I58 A;  3JAM Z;  1P4W A;  4I2O A;  3HSF A;  2UZK A;  1MDM B;  5A2Q Z;  3LA3 A;  3LAP A;  2PEX A;  3KFW X;  1K6O A;  3WTS C;  1FYM A;  2H6C A;  3IKT A;  1RNL A;  4KDP A;  3O3K A;  4UNO A;  5CVR A;  4LG0 B;  1UCR A;  4HA8 A;  4LK1 F;  1YYV A;  3KLN A;  2QYO A;  4ESF A;  1XD7 A;  3G3Z A;  5K1Y A;  5ILS A;  1LEA A;  2QBY B;  3ZMV A;  1WQ2 A;  5E8G A;  1YS7 A;  4PGH A;  4KA4 A;  1OYY A;  1FT9 A;  5E1Z B;  4JQF A;  5JR3 A;  2FBI A;  2HKX A;  2ZME B;  1FZP B;  1ZRF A;  3FF5 A;  1ZG3 A;  2EFO A;  2DPD A;  2CFX A;  4L0Z B;  4HBL A;  4RB3 C;  4HF0 A;  4G6D A;  2XAF A;  2EA4 A;  2K02 A;  1UST A;  4EM0 B;  4D0P A;  5KVR A;  2A5Y B;  4BYY A;  1MJA A;  4OIN F;  2RN7 A;  1KU3 A;  4FX0 A;  1YW8 A;  3I53 A;  3TDU C;  2MLK A;  1Z6T A;  2VT3 A;  3M7G A;  5EEH A;  3BP8 A;  1FSE A;  1IXC A;  3Q9S A;  4Y15 A;  1QO0 D;  5E20 A;  2E1N A;  1B9N A;  3WTV C;  2ZNY A;  3LA2 A;  3P9C A;  2BEO A;  4U0Y A;  2IVM A;  5DV5 A;  4A5M A;  4IJA A;  5CYV A;  3J80 Z;  2QQB A;  2Z5U A;  4UVC A;  3BY6 A;  4K2E A;  3ULQ B;  1FY7 A;  5H6Q A;  4ZYG A;  4XLP F;  5D5V B;  1WKM A;  5DEQ A;  2GIV A;  3V4G A;  4A5N A;  5FB2 A;  2XVC A;  3L7W A;  1K79 A;  1ODD A;  3FMS A;  1YO5 C;  1SFU A;  2L4A A;  3LFK A;  4U88 A;  4L18 B;  3ZPL A;  1JGS A;  1S3J A;  3CUO A;  1IF1 A;  2IP2 A;  1KU9 A;  2K7L A;  1B1B A;  3F72 A;  2V1U A;  1IN8 A;  4RGU A;  2LNB A;  1LDK B;  4AIJ A;  3GFM A;  2MBF A;  3L2C A;  2ZKZ A;  2P5L C;  2HOE A;  5DYM A;  4A2U A;  2JT1 A;  3KEQ A;  2M5W A;  4IPA A;  1ONV A;  2BE5 F;  3WOD F;  3ZMZ A;  3WGG A;  5LBQ A;  1Z7U A;  5FGM A;  4MTE A;  3SZP A;  1CF7 A;  1ON2 A;  5D6E A;  4MHG A;  1HXD A;  3VOE A;  3F6O A;  2IJL A;  2F5F A;  4UHT A;  1TQP A;  2PN6 A;  3HRM A;  1J2X A;  1EH6 A;  1R36 A;  1IN7 A;  4B8X A;  3KP7 A;  3M1E A;  3WTX C;  4M9Z A;  2LSO A;  3HRS A;  2VOO A;  5J8F A;  3EQL F;  3BDD A;  4EJV A;  2PI0 A;  1K78 A;  3ABU A;  2GAU A;  3DXJ F;  4I01 A;  5IT9 K;  2HKO A;  2ZFW A;  1KGS A;  4LLL A;  3ZMS A;  2GWR A;  4KN4 X;  2K27 A;  1FNN A;  3JAM K;  5FD5 A;  1BI1 A;  2L54 A;  5A2Q K;  3RKY A;  2MH2 A;  4IF4 A;  2OD5 A;  1KU7 A;  5L3G A;  5CVU A;  1FBQ A;  2DTR A;  2UXN A;  1W5T A;  4CZZ A;  3LQR A;  1O7F A;  4UV9 A;  2FU4 A;  5ILU A;  2QWW A;  2Q8K A;  3W6K B;  1NHA A;  1O57 A;  3HOT A;  3F22 A;  1D8J A;  3E3V A;  4BAY A;  1C0W A;  1ZGA A;  4ENJ A;  1SMY F;  4EQQ A;  1TTY A;  1FP2 A;  4EJT A;  3F8M A;  2HR3 A;  2Z33 A;  2QQ9 A;  1B4A A;  3R0J A;  2IRF G;  3TO9 A;  4OIR F;  3ZMT A;  2F5C A;  1SD4 A;  1KQ0 A;  5D5U B;  5D5W B;  2L01 A;  1Z05 A;  1G3Y A;  4A0X A;  3TDZ C;  2XAH A;  4HAM A;  2V6C A;  3F6V A;  3KP3 A;  1LEB A;  3KP5 A;  2P5K A;  3WU0 A;  2GZW A;  3BZ6 A;  4EVI A;  2FQ3 A;  3IRR A;  5HDN A;  4U7D A;  4G7H F;  2KJC A;  3T0Y A;  6PAX A;  4EJW A;  2DU9 A;  1IN6 A;  4EJU A;  4YIF A;  2HTS A;  3EYY A;  3FWE A;  1QZY A;  1TW3 A;  1SFE A;  5K5O A;  5FD6 A;  5LHG A;  2A07 F;  4Q4Z F;  1U5T A;  4RAZ A;  2OZU A;  3J80 K;  3I0T A;  5F1R A;  5E18 F;  3LAJ A;  2O8X A;  4LFU A;  4EM1 A;  3REO A;  3ECH A;  2E1C A;  1XCV A;  2RKH A;  1PP8 F;  3MCZ A;  1T0F A;  2YPR A;  1H9G A;  3H3Z A;  2A3S A;  1PP7 U;  1I1G A;  3C3W A;  2QM3 A;  3DP7 A;  3MZY A;  3K1N A;  4S04 A;  3NEU A;  4OIQ F;  4LB6 B;  1I1S A;  1IN5 A;  1XGM A;  4HZF A;  5EEG A;  1HW1 A;  3KCC A;  3QU6 A;  2BYV E;  1G4D A;  1QGP A;  4EGY A;  3U9G A;  3HUG A;  3W6J B;  3L9F A;  5H20 A;  3VB2 A;  4CGZ A;  1R00 A;  3CDH A;  4P9F A;  3B02 A;  2PFB A;  1XCB A;  3T1B A;  4L0Y B;  2CW0 F;  2CG4 A;  3FMQ A;  1QZZ A;  4LD5 A;  5AIQ A;  4CIC A;  2Q0O A;  1BOA A;  2XAJ A;  2Y0M A;  1BC7 C;  3D5L A;  3K1P A;  2PQ8 A;  4IHS A;  4M6Y A;  1ZYR F;  2ZNZ A;  3QP5 A;  2RDP A;  3GEZ A;  3TO6 A;  5E8I A;  2XIG A;  1R5G A;  4N9I A;  1T6S A;  5BPD A;  4R8H A;  1XGN A;  5DD8 A;  3WTZ A;  4OOI A;  1OYW A;  3U2R A;  2AXL A;  4N9H A;  4HX7 A;  1MDM A;  4KUM A;  1S7A A;  1ZHF A;  4KMU X;  3SFZ A;  1T2K A;  1AOY A;  1STZ A;  2ZBK A;  2K86 A;  2VT2 A;  3BJA A;  2VE8 A;  1HW2 A;  3FM3 A;  4LG0 A;  3JW4 A;  4BHB A;  1GVJ A;  4IXA A;  4MEX F;  3WGH A;  3HYI A;  3DPL C;  1SFX A;  1BJA A;  3QRF F;  3ZP5 A;  1FLI A;  4ENK A;  3WU1 B;  3FHZ A;  3MQ0 A;  3DEU A;  3F23 A;  1IXR C;  2QBY A;  4N0B A;  4TV7 A;  5HS8 A;  4B09 A;  5IT3 A;  5DCM B;  3R61 A;  1U8R A;  2ZME A;  4WXH A;  1FBU A;  3IC7 A;  2DBB A;  2W57 A;  4RAY A;  2J5O A;  5BMZ A;  2COM A;  4ZYE A;  1G6N A;  2L4M A;  1T38 A;  4I02 A;  4PDK A;  3L00 A;  1PDN C;  1EV7 A;  2EFQ A;  3ZN0 A;  3GF2 A;  4NB5 A;  3QP6 A;  2KIF A;  4ESB A;  3BOQ A;  2J5P A;  2GQQ A;  2QLZ A;  3K69 A;  3E6B A;  1UB9 A;  2EWN A;  4RGX A;  2Z99 A;  4KMF A;  4ZYD A;  3E6C C;  1JHF A;  5E1W A;  4A0Z A;  5L3C A;  4IRH A;  1U3E M;  2LKP A;  1G3T A;  2A69 F;  3RPQ A;  2JRT A;  2WWY A;  4KIG A;  4IRG A;  2EJR A;  1ZGJ A;  2JPB A;  5JI6 A;  1QPM A;  2F2E A;  5K5R A;  3PFI A;  2P6S A;  4OU0 A;  3V7R A;  3DV8 A;  3ELK A;  2W24 A;  3Q9V A;  5LEK A;  4U7B A;  2VC0 A;  1W7P D;  1Q1H A;  2DO7 A;  3FX3 A;  1HBX G;  2RVC A;  5HS7 A;  2HDC A;  1UFM A;  2NYX A;  3R60 A;  4EMS A;  3P7N A;  4Z2Y A;  4NQW A;  3I5U A;  2Z9O A;  1KU2 A;  4G6Q A;  3PQJ A;  5JHU A;  2GXG A;  1F1Z A;  4ASN A;  1WSU A;  3M9A A;  2DAO A;  4EV0 A;  3ZMU A;  1F9N A;  2HQN A;  4FHT A;  3DFG A;  4AVP A;  3RI4 A;  3KLO A;  3GVA A;  2QUF A;  3GYH X;  2JTV A;  3KET A;  3C18 A;  2VOD A;  1YW9 A;  1XGO A;  5ERI A;  5J6X A;  2EB7 A;  2A61 A;  2MH9 A;  1WRJ A;  3F21 A;  1T98 A;  5D4R A;  3GUD A;  4ESJ A;  4H0E A;  4I98 B;  3DPT A;  4U0V A;  1IW7 F;  2W84 A;  1GHC A;  3V7S A;  2XAQ A;  2M45 A;  3MEX A;  1T39 A;  1OYI A;  2DFI A;  2OZ6 A;  4EJO A;  1QNT A;  2NS0 A;  1PUE E;  1KQ9 A;  3E6M A;  4AIH A;  5CVI A;  4EGZ A;  4YG2 F;  1LQ1 A;  2KIU A;  2R3S A;  1HST A;  2FE3 A;  3KP4 A;  3RYR A;  4S05 A;  1ZH5 A;  3GW2 A;  1ZLK A;  5E1X A;  3RTR A;  4WX9 A;  4UVB A;  2HEO A;  1R1T A;  2Q2E A;  4MQ9 F;  4BH9 A;  3B73 A;  1BN5 A;  3OOP A;  2RV8 A;  4P9U A;  4Y17 A;  2HGC A;  1B9M A;  3I64 A;  4M74 A;  3WGI A;  3VFZ A;  1I5Z A;  2UWM A;  3FXR A;  1IRG A;  3I71 A;  1BI0 A;  2KKO A;  2D45 A;  3HRU A;  2HTJ A;  2DQR A;  3SZT A;  2PMH A;  3D0S A;  3R0A A;  1O3Q A;  2VXZ A;  4ZYH A;  3C7J A;  2FEZ A;  2FXA A;  4GYG A;  1DPR A;  5HLG A;  1J75 A;  3RDI A;  5LGN A;  1MGT A;  4CYD A;  2ESN A;  3GWZ A;  3Q5F A;  3GXO A;  2EV0 A;  5LGU A;  2F5D A;  2ZJ2 A;  4KYW A;  2ZCW A;  4G94 A;  2VOP A;  1QBJ A;  2V9V A;  4KIB A;  2P7C B;  5BQT A;  1O3R A;  1W7P B;  1R23 A;  3U1D A;  2O6G E;  5BOX A;  1USS A;  2O3F A;  5ICF A;  4PZJ A;  1EH7 A;  2NNY A;  2IA1 A;  3IHU A;  1B6A A;  3NQO A;  4OIP F;  2DLL A;  4E70 A;  1GXQ A;  4UXN A;  1ULY A;  2G9W A;  3MFK A;  4R1H A;  2RNJ A;  2XRO A;  1ZRC A;  5HVQ C;  1LDD A;  1X3U A;  2H6B A;  4CDG A;  4GYI A;  1J5Y A;  2FML A;  2EA2 A;  2EV5 A;  1FSH A;  2P5V A;  2FNA A;  3DF8 A;  3QOP A;  2JPC A;  2DT5 A;  1HSJ A;  1Z6R A;  5D8L B;  2FA5 A;  4LLN A;  3TQN A;  5LRS A;  3R6S A;  1XMK A;  4BHP A;  1YW7 A;  3F8B A;  2IA0 A;  4L9N A;  2LF8 A;  4KT5 C;  3HIF A;  1YG2 A;  3N97 A;  3H92 A;  2ELH A;  1A04 A;  5L3B A;  3TO7 A;  2BGC A;  3V8J A;  1XSX A;  4I7H A;  2M1B A;  2NAZ A;  1DDN A;  2CYY A;  1W5S A;  4U0W A;  4HX8 A;  4UVA A;  1FWZ A;  4ZZD A;  2QQA A;  3P9I A;  1LB2 A;  3IKV A;  2W85 A;  4WWC A;  3CO7 C;  4OIO F;  4YFK F;  1SAX A;  3GLX A;  3O6B B;  3F3X A;  2YR2 A;  1OR7 A;  3IL2 A;  4MTD A;  4Q48 A;  4JK1 X;  4P5O A;  3IWZ A;  3O2P E;  2GA2 A;  2LDU A;  4RB0 A;  1J59 A;  1F4K A;  1MKM A;  1P2F A;  5LLQ A;  1HKT A;  2KRF A;  2P8T A;  4L9J A;  5D6F A;  4A0Y A;  1CGP A;  5DD4 A;  3VOD A;  1RI7 A;  1Z91 A;  5JVT A;  5D8K B;  2MLG A;  1P4X A;  1RUN A;  2HQR A;  2XV4 S;  5J8C A;  1TNT A;  4EM2 A;  5ED4 A;  4G8X A;  4HYE A;  5HLI A;  2FBH A;  1YS6 A;  3S2W A;  3CUQ A;  3COA C;  4KFC A;  2YU3 A;  4Y13 A;  4QLC U;  4KNY A;  2ISY A;  3I54 A;  1BI2 A;  1R58 A;  5AON A;  4Q47 A;  1D5V A;  3EET A;  3MWM A;  5L3D A;  3GFI A;  4MNU A;  1TW2 A;  3RPU A;  4RS8 A;  2CWE A;  1BI3 A;  4NHJ A;  4MEY F;  2B0L A;  3IRQ A;  5FFZ A;  4IHT A;  3E5X A;  1E2X A;  3SQN A;  1FX7 A;  2NRA C;  5DCM A;  3F8C A;  2HYF A;  3RIR A;  3TOA A;  4LMY A;  3LA7 A;  4G7O F;  5LHI A;  4P55 A;  2ESH A;  1SD7 A;  3KP2 A;  3MZH A;  1IAW A;  3RKW A;  1FYK A;  2EFN A;  1Y0U A;  4Q5S F;  1H0M A;  3EYI A;  2R7D A;  2HFH A;  5ICC A;  4HX4 A;  1SD6 A;  1U78 A;  3TKY A;  2DQL A;  3RJP A;  1JE8 A;  4UUV A;  2FNP A;  4IVN A;  3BPV A;  3I59 B;  1ZG1 A;  4L9V A;  1RIO H;  4WK8 F;  3WTW C;  5BPI A;  2V1X A;  5CLS A;  3SHF A;  2K4J A;  3GX4 X;  5H6R A;  3JTH A;  5K5Q A;  2P4W A;  1VTN C;  3OV8 A;  2L02 A;  3WE3 A;  4A12 A;  2PLY A;  2WC2 A;  2ZO4 A;  1FP1 D;  5HS9 A;  2D2W A;  2FRH A;  2Z3Y A;  3BRO A;  4AIK A;  4I0A A;  1OPC A;  3I4P A;  5FO5 A;  3BPX A;  2DPU A;  2E7W A;  3CJN A;  2GXB A;  1IUY A;  4DNC A;  2STW A;  3F8F A;  3KZY A;  4CHU A;  4GCV A;  1Z9C A;  2BBY A;  2FMY A;  5TRD A;  2M30 A;  2W25 A;  1S8N A;  2NNN A;  1AWC A;  3T5X A;  4WXC A;  4G7Z F;  3P9K A;  5DUK A;  3AAF A;  1G3W A;  2M87 A;  2VE9 A;  1TQM A;  2TDX A;  2ADU A;  4R79 A;  2OQG A;  3V8L A;  4I09 A;  2EK5 A;  5LEJ A;  1MZB A;  3L09 A;  2EFW A;  2R7F A;  4RB1 A;  4XSX F;  2GA1 A;  3E5Q A;  2LF7 A;  1REP C;  4O5V A;  1HKQ A;  1LJ9 A;  4GGG A;  2CGP A;  2O0Y A;  3CLO A;  2XHK A;  1XSD A;  1BM9 A;  5CJ9 A;  1ZN2 A;  2WTE A;  2YSR A;  1ZRE A;  4JBA A;  2CO5 A;  2CQK A;  3FM5 A;  1V4R A;  1KA8 A;  1I27 A;  1K7A A;  1OKR A;  5CVJ A;  3TOB A;  1LNW A;  2QEN A;  4A6D A;  2V1D A;  3CTA A;  1FYL A;  2RC4 A;  3LWF A;  3G73 A;  2EV6 A;  2EFP A;  2A6E F;  1UHM A;  4LK0 F;  4M9S A;  4LB5 A;  3RKX A;  4BXU A;  1BBY A;  1KYW A;  3ML6 A;  2K4B A;  2DW4 A;  2XKO A;  1TNS A;  4GO1 A;  1XGS A;  4M9X A;  4CXF A;  1L3L A;  1H9T A;  1FC3 A;  3T8R A;  4HQE A;  1BIB A;  2L3D A;  1IZ1 A;  3K9T A;  1J9I A;  2O03 A;  3KEO A;  1ZLJ A;  2JSC A;  3K1M A;  4HW0 A;  2G7H A;  1XDS A;  4HV5 A;  1XSV A;  2P6T A;  5DCF A;  4DQ2 A;  1XDU A;  5AIP A;  1TQI A;  2FSW A;  1ZAR A;  3EDP A;  2V79 A;  3PQK A;  5L3F A;  4G9Y A;  1O3T A;  4L5J A;  4WCG A;  1I6X A;  1TLH B;  1KQ8 A;  1FBS A;  3GFJ A;  5DUI A;  1RZ4 A;  1WI9 A;  1W7P A;  3K2Z A;  3HHG A;  2OAZ A;  3LST A;  1D3Y A;  4RGS A;  2VN2 A;  4KIF A;  1V3F A;  1U2W A;  3J7A O;  2KJB A;  1KYZ A;  3QU3 A;  5F6F A;  4XRF A;  1WWX A;  3ECO A;  1ZG5 A;  4CO8 A;  1B59 A;  3HHH A;  3R4K A;  3ZN1 A;  3QPH A;  4F7Z A;  3J81 Z;  3WTU C;  1Z1D A;  3GFL A;  5KK1 A;  1XN7 A;  2FOK A;  1HQC A;  3HSR A;  5CVV A;  2H27 A;  4A6E A;  3SXY A;  1J0R A;  4WXD A;  1YIO A;  2QVO A;  1TBX A;  3N4M A;  1DPU A;  2A68 F;  5BS6 A;  1OMI A;  4ZZL A;  4PCQ A;  3E6D A;  4HDU A;  5F64 A;  4I0B A;  3GO5 A;  5FLX Z;  2VBZ A;  2ACJ A;  3V8K A;  2AS5 F;  4QWQ A;  3LQQ A;  2P7V B;  5ICG A;  3C1D A;  1O7L A;  1L0O C;  1YQA A;  2WV0 A;  2F5E A;  4UV8 A;  2HWV A;  5L3E A;  1F5T A;  2O61 A;  2IPQ X;  3BJO A;  1BIA A;  3GZ6 A;  4O3M A;  1LDJ A;  1YTY A;  2PMU A;  3VEP A;  1MJ9 A;  2X0L A;  4BNC A;  4M73 A;  3KZZ A;  2M8E A;  1DUX C;  4KIC A;  3ROU A;  1O3S A;  4XLN F;  2OA4 A;  3ABT A;  1GXP A;  5HLH A;  1JHH A;  2QZ8 A;  4AWX B;  2YX4 A;  1CF7 B;  1IXS B;  3HSE A;  3T8T A;  4ENN A;  2DI3 A;  5D4S A;  1SD5 A;  4OMZ A;  4LGW A;  3DQV C;  1YFH A;  1R22 A;  1FOK A;  5HDK A;  4AD9 A;  1ZRD A;  3WE2 A;  1IN4 A;  2HYG D;  3ZMD A;  4MGR A;  1K78 B;  1EH8 A;  2ISZ A;  3TGN A;  3FZV A;  1ZAO A;  1LVA A;  2VBW A;  3M8F A;  2STT A;  4YFN F;  1ON1 A;  2Y48 A;  4O6J A;  1S29 A;  4HOB A;  1P4A A;  3CO6 C;  1S6L A;  1RUO A;  4LLG F;  4ON0 A;  4HF1 A;  4MQV A;  2ZXJ A;  1HKS A;  3FXU A;  4RGR A;  3F8N A;  2XRN A;  1J7K A;  4BQA A;  2Y75 A;  4XBF A;  3E5U A;  3ISP A;  4FT8 A;  1XB4 A;  5D5X B;  5ILV A;  3FMR A;  3BWG A;  2MA3 A;  4ENM A;  1QQI A;  2OQR A;  1R5H A;  1P6R A;  2C6Y A;  4XSZ F;  1R7J A;  2DK8 A;  5DDG A;  1XMA A;  2JZY A;  4FX4 A;  2IA2 A;  1R1U A;  2PG4 A;  2MC3 A;  5HDG A;  3JTG A;  2A6H F;  2E7X A;  4RB2 C;  3WG9 A;  3FXQ A;  4M72 A;  2IW5 A;  2PBI A;  3KP6 A;  2XAS A;  3GZ5 A;  5E17 F;  3RYP A;  3I59 A;  4ZH4 F;  3ZQ7 A;  3WTT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...