3O3KA

Crystal structure of af1382 from archaeoglobus fulgidus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
ERIKLLFKEKALEILMTIYYESLGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECELEGRTKIIRLTDKGQKIAQQIKSIIDIMEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Archaeoglobus fulgidus orphan ORF AF1382 determined by sulfur SAD from a moderately diffracting crystal.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein AF_1382
total genus 28
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3o3kA00
4OIQF 3FMSA 3D5LA 2ACJA 3J7AO 1FWZA 2RQPA 1J5YA 3I5UA 4WXHA 3R61A 3QU6A 1ULYA 1ZREA 2YR2A 2F5CA 1SFXA 2IP2A 3ZMUA 2MH2A 2LF8A 1K6OA 1XB4A 1E2XA 3IKTA 4PGGA 4BYYA 1ZRFA 2FMYA 4N9HA 5JI6A 1QGPA 2FEZA 4L0ZB 3C7JA 1JHFA 2Z5UA 2DPUA 4L5IA 4YIFA 2Z99A 4WXCA 1ZRDA 2HKXA 3J80Z 5CVRA 1Z9CA 4U7DA 5L3CA 1KQ9A 3FM3A 1KQ8A 2QBYA 5FD6A 5DYMA 5HDNA 1BOAA 3ZMDA 1OYYA 2M1BA 5J8FA 2W24A 1STZA 2PEXA 4M71A 2HQNA 3HSRA 4ESBA 4UXNA 2D1HA 4HDUA 1HKSA 3VOEA 5DUKA 1ZRCA 5D5XB 1G3SA 5FGMA 2DLLA 2MA3A 2O0YA 2P5LC 1Q1HA 3DKWA 1BC7C 4A6EA 3EQLF 5E8IA 2FSWA 1WQ2A 2QUFA 3E5UA 2P7VB 1HQCA 4Y17A 5BOXA 1QO0D 1SFEA 5KVRA 1F9NA 1FNNA 2GAUA 1P92A 4HV5A 5F6FA 4IVNA 1RZ4A 4M9XA 1P2FA 1LVAA 3LA7A 4LB5A 1B59A 2A61A 4DQ2A 3EDPA 2F5DA 1FPQA 4P96A 1U5TA 2RKHA 3AAFA 3ML6A 5D8KB 2JTVA 5LEJA 3BJ6A 1FBUA 2DQLA 3RPUA 3RI4A 3KP4A 1U78A 2F5FA 2LDUA 4LG0B 5JVTA 5HS9A 5AIQA 3ABTA 1OPCA 2ZO4A 3KFWX 1BI1A 1G6NA 2XVCA 1Y0UA 2ZCWA 3LQQA 1XCBA 1H9GA 5LHIA 1OR7A 2HEOA 5HDKA 2ZNZA 1HXDA 2L01A 2PFBA 1YYVA 3VB2A 4KFCA 2G9WA 4G9YA 5E1WA 1FP1D 1W4MA 4HAMA 3KE2A 5D4SA 3ZN0A 1F5TA 4AIKA 1S7OA 2L4MA 2XAGA 5DCFA 3NRVA 2QBYB 1KYWA 4EM0B 2QQBA 1SMYF 4HZFA 4HF0A 1MJBA 2MH9A 3KLNA 4K2EA 4L9TA 3E97A 2PG4A 1XD7A 3KETA 4ZYEA 1Z7UA 1IRFA 4LLNA 4HF1A 3K9TA 4MEXF 2DO7A 1WWXA 4R79A 2OQRA 2P7CB 4IF4A 1FBSA 5H20A 2YX4A 5BMZA 2XAJA 2M87A 4RB3C 4HQEA 3LA3A 4OINF 2IW5A 3HTSB 3TOBA 1YFHA 5LHHA 1XMAA 1F4KA 3DF8A 3T0YA 4M74A 5DD8A 3WGGA 1Z6RA 1R1VA 4PZJA 1BI3A 2IPQX 4U7BA 4MQVA 4HBLA 3QAHA 3O2PE 4XSXF 5H6QA 2QYOA 4HF2A 2ZMEB 2VE9A 3V8KA 1ZGAA 2O6GE 2M8EA 2KJCA 2R7FA 1USSA 1BN5A 3F3XA 1OYWA 3IWZA 1KU3A 3WODF 3JAMK 4LG0A 2HYFA 3LQRA 3KEQA 3EYYA 1UB9A 1YW9A 1IXCA 2IA0A 4CDGA 1T98A 3GVAA 1PDNC 2XRNA 1DP7P 2P5KA 4IPAA 1YW8A 3L00A 4GYGA 4IRIA 2H6CA 4EJUA 3ULQB 3E5QA 2K4JA 2J5PA 3CDHA 1VTNC 1T39A 3WTSC 4AD9A 4D0PA 2FF4A 5ICGA 1W5SA 1HSJA 1R36A 4L18B 3NEUA 4OIRF 1R5GA 4F7ZA 5ILUA 1IAWA 2FU4A 4DNCA 2UZKA 4EJVA 3MFKA 1MDMB 3PQJA 2V1XA 3BDDA 4EM2A 1SD4A 3MZYA 1K7AA 1B4AA 2JT1A 3I59B 4YIIA 1IN4A 2STTA 1R22A 2X0LA 2R7DA 2FQ3A 4XSZF 5LGNA 2O8XA 2GZWA 1G4DA 3M1EA 3MCZA 1XCVA 2VODA 2VBZA 2W57A 2HQRA 2V1DA 4CYDA 1FOKA 3OV8A 3ZMZA 4ZH4F 1FC3A 2NS0A 4BXUA 3P7NA 4IRGA 1BIAA 2L54A 1O3RA 1I27A 1GHCA 4ZZDA 1XDUA 2DI3A 4OOIA 1JXSA 2L4AA 3KCCA 4AIHA 4EJWA 3GEZA 4FX4A 1AWCA 1I1GA 3QRFF 4Q48A 2XKPA 2VT2A 2YX7A 5CLSA 3WU0A 5K5OA 4G94A 1BI0A 2MD5A 2KIUA 3E6DA 4KN4X 4PGHA 1IUYA 3RKWA 3MQ0A 2VOPA 4AVPA 1W7PB 4WX9A 2ZXJA 2H94A 1J0RA 3I71A 2Z33A 4KNYA 4M6YA 1XDSA 1FP2A 5FD5A 4IHSA 3EUHA 5HLGA 3E5XA 2NNYA 4GGGA 2CYYA 2RGVA 3VFZA 5DCMB 5D5UB 3L2CA 2RVCA 4G6DA 1V3FA 3ROUA 3FM5A 1LNWA 3ABUA 1MJAA 2AXLA 2ESHA 3KP5A 5LBQA 4EV0A 2YU3A 1ZLJA 5LRSA 2D2WA 4UVCA 2OD5A 3J80K 3E6BA 3IC7A 2OQGA 3CO6C 1U6GA 2DW4A 3V7RA 1EV7A 3C18A 1Z1DA 4IXAA 2OU2A 5FLXK 1KU9A 4KT5C 4Y15A 3EETA 3VODA 4HDVA 3DPLC 3BWGA 3ZMVA 3RPQA 2RV8A 3M8FA 1O3TA 1XN7A 4A2UA 3CUQC 1QZZA 5A2QZ 1P4WA 3GXOA 4ZYHA 3HSFA 1ZG5A 3NQOA 3ZQ7A 3KEOA 2STWA 2QVOA 3E3VA 3WG9A 3D0SA 3BJAA 2H27A 4I7HA 3CUQB 4ZYGA 2XUBA 4G7OF 2DBBA 3C1DA 2PJPA 1REPC 1D8KA 4KIBA 2KIFA 4ASNA 2A69F 1QBJA 3WGIA 3HOSA 1V4RA 5KK1A 2CQKA 2K86A 3FXUA 2ESNA 2MLGA 4NQWA 1XSXA 1CF7A 1OYIA 2CW0F 3K1MA 4CO8A 4BAYA 3RKYA 4Q5SF 2F2EA 4G7ZF 2Q0OA 2EB7A 3RKXA 5DV5A 1ZARA 2DK5A 3P9KA 3F21A 1S7AA 2BGCA 4UNOA 3JSOA 5D5VB 2FBHA 2DTRA 2BYVE 2E7WA 4M73A 6PAXA 1XSDA 1BC8C 4L5JA 4AWXB 2JRTA 2K7LA 1YQAA 3HIFA 3WGHA 2A6EF 5E17F 1IRGA 2LSOA 1O3SA 5JHUA 3CJNA 1ZAOA 2GIVA 2GXBA 3I4PA 3VEPA 2HGCA 2MC3A 2VN2A 3GYHX 4FX0A 2HZTA 2P6SA 1P4XA 3U2RA 2X4HA 1YS7A 3U9GA 4LMYA 4ESFA 1Z6TA 3O3KA 1L0OC 2A3SA 5LHGA 1TBXA 2PMUA 2M5WA 1U8RA 1SAXA 3FZVA 1WSUA 3ZMTA 4NHJA 2XASA 1AOYA 1J59A 4I09A 5DDGA 2EFOA 1U3EM 5ICEA 1WI9A 5E1ZB 2HOEA 3K1PA 4TV7A 5CVUA 2JZYA 2YSRA 3FXQA 4EJOA 2LNBA 3GFMA 3G3ZA 4PDKA 2B0LA 1T0FA 2RDPA 1T2KA 4E70A 3IRRA 1BBYA 2FNPA 4HX4A 1QQIA 2XHKA 3V4GA 1LEBA 1Z91A 3MEXA 3GO5A 1G3YA 4G6QA 2NNNA 2V6CA 2V1UA 3DXJF 5BPDA 3E6CC 2W84A 1JE8A 2TDXA 1FX7A 3IKVA 2RNJA 2Y0MA 4I02A 4Q4ZF 2NRAC 5J8CA 2MLKA 3E6MA 3F22A 3GW2A 2G7HA 2COMA 3DPTA 4A6DA 1MD0A 3HHGA 3G73A 1ONVA 3CUOA 4UV9A 2DT5A 4EQQA 1IF1A 2NAZA 3GFJA 1R7JA 1K78A 2XV4S 4P55A 1FYLA 3SXYA 2VT3A 2L3DA 2JPBA 2V9VA 4WWCA 3BOQA 1YTYA 3N4MA 2FA5A 1HW5A 3H92A 2HYGD 4I2OA 5LLQA 3ECHA 3HRUA 2EV6A 3KP6A 3W6KB 2UWMA 5D6FA 1UCRA 2QQAA 1TQIA 5EEHA 4RB1A 4LFUA 1YIOA 4WK8F 3LFKA 1R23A 2KRFA 2F5EA 2VXZA 2EWNA 1P6RA 5L3FA 4CICA 2CGPA 1ZG3A 3J81Z 3M7GA 2UXXA 1HKQA 2HDCA 3C3WA 3F8MA 2EA2A 5HS7A 4HQMA 1USTA 3EYIA 2P4WA 3ISPA 4RGRA 1XGOA 1LDJA 1B1BA 3SFZA 1D3YA 3BPVA 3I54A 4OMYA 1YS6A 5BQTA 1U5TC 5EEGA 4A0ZA 1QNTA 2ZMEA 1PP7U 2HWVA 5FLXZ 3ERED 2WTEA 4RAYA 2KIMA 1IN5A 4OMZA 1GXPA 4CZZA 4S05A 3K1NA 3I53A 1C0WA 5HLHA 3OOPA 1KA8A 5HS8A 3QPTA 4QLCU 3DQVC 3F6VA 3F8CA 3RJPA 2GA2A 3H3UA 4U88A 1SMTA 1W7PD 4RS8A 2YPRA 3HRMA 3R60A 3GX4X 1LB2A 1LDDA 1H9TA 3SQNA 2MBFA 1ZN2A 2FBIA 4CHUA 2ADUA 5BS6A 1K78B 4LLLA 2H6BA 2QENA 3HYIA 3L9FA 4U0VA 2PMHA 3IHUA 5ICCA 3LSTA 4HOBA 4XLNF 1J9IA 1MJ9A 3KZZA 2AS5F 1WRJA 5F64A 2Q2EA 2CFXA 1DDNA 2C6YA 2RC4A 3L09A 3H3ZA 4RGSA 2EFWA 2DAOA 4Z2YA 4ENJA 2OA4A 2OZUA 2DU9A 1FZPB 3WTYC 4B09A 2OAZA 4QWQA 2HS5A 3F23A 3SZPA 1S29A 1LDKB 4ETSA 2GA1A 2A6HF 2HTSA 2PBIA 4WF2A 2GQQA 2XAHA 1FT9A 3TO7A 5K5RA 3LWFA 3DFGA 2A5YB 3WU1B 2JPCA 3V8JA 5CVIA 2XROA 1B6AA 4O6JA 4HLXA 3V7SA 4ENMA 2VBYA 2FXAA 4LD5A 5TRDA 5TJJA 4B8XA 3Q5FA 3QOPA 2QM3A 4BH9A 1W7PA 1WKMA 3KZYA 5E8GA 4JBAA 4MHGA 4M72A 1DPRA 3M8EA 2LKPA 3ECOA 2PI0A 5L3DA 1QPMA 3DEUA 1O57A 4CGZA 3TKYA 2Z9OA 4KN7X 2D1VA 2L02A 3ZPLA 3WTVC 1TNSA 4YFXF 4L0YB 2IA2A 1YLFA 2R3SA 5HLIA 3T8RA 1PUEE 2FRHA 5H6RA 1IN7A 1MGTA 4EGZA 4MGRA 2WC2A 3BZ6A 1FY7A 1QZYA 1KU2A 2O61A 3IL2A 2PQ8A 3FX3A 3K0LA 5L3BA 1JHHA 3WTTC 1IZ1A 3BPXA 3R0AA 3F8NA 5D8LB 4BHBA 4LGWA 4O5VA 4FT8A 4GXOA 4LB6B 4UHTA 4GYIA 1EH7A 4MQ9F 2BE5F 1GVJA 5CVJA 4MEYF 3FWEA 2EFPA 1O7FA 2DPDA 1YO5C 1DUXC 4FHTA 4I01A 2ISZA 2A68F 3K2ZA 2FNAA 3MWMA 5DEQA 3FHZA 4BHCA 4I0BA 4NB5A 2ZFWA 2Q8KA 2RN7A 1FYMA 4P5OA 1TW3A 1MDMA 3KLOA 3FMRA 3U1DA 4KYWA 1HSTA 4JK1X 4UVAA 2XKOA 3M9AA 5CYVA 1W5TA 3LA2A 2OBPA 2Y48A 1ZH5A 1G3WA 2EFNA 2LF7A 4A0YA 3HRTA 3GUDA 4G7HF 1HW1A 1ODDA 3I58A 5JR3A 1F1ZA 3KP7A 3P9IA 4UV8A 3DV8A 4ON0A 3TO6A 5D4RA 5L3GA 1SD6A 5AONA 4LK0F 3K69A 3WE2A 4MTDA 4OU0A 1FBQA 4KMFA 4KUMA 2E1NA 4H0EA 2DFIA 3GZ5A 2A07F 5K5QA 1D5VA 2WV0A 4Y13A 3L7WA 3HOTA 1GXQA 3JSPA 2IA1A 4OIPF 3DP7A 3QPHA 1J2XA 1BI2A 2VBWA 4IJAA 1IN6A 2ISYA 3FXRA 4Q47A 2P5VA 4CXFA 3QP5A 1RUNA 2XAQA 5FB2A 1YW7A 3T8TA 3TO9A 5DUIA 2ZKZA 4M9ZA 1S3JA 2JSCA 4BNCA 1BM9A 1S6LA 3T1BA 1Z05A 1XSVA 2VE8A 4R1HA 4RAZA 5LGTA 1SD7A 2FBKA 4EVIA 4PCQA 3TQNA 3I64A 4MTEA 4KIGA 2QQ9A 1OKRA 2ETHA 1CF7B 4A5MA 4M6XA 1X3UA 2KJBA 2W25A 5LRRA 2P6TA 5FO5A 4KIFA 3CTAA 4I98B 4L9JA 3RDIA 3TGNA 2J5OA 2FE3A 1RNLA 1YG2A 2HFHA 5F1RA 3COAC 2K02A 2CG4A 2BEOA 3V7CA 1MZBA 1T38A 1O3QA 2D45A 2XAFA 4UUVA 2O03A 3IWFA 4HA8A 4AIJA 4GCVA 1KQ0A 3N97A 1TW2A 3BY6A 4JQFA 1UHMA 4MNUA 2VOOA 1UFMA 4RB2C 3LAJA 3SHFA 2O3FA 3GLXA 4ESJA 4ENKA 2BBYA 3J81K 1A04A 2K4BA 4A12A 1XGMA 3W6JB 2VONA 1ZYRF 1FSHA 2FMLA 3HUGA 5ERIA 1XGNA 1TTYA 2FOKA 2VBXA 4S04A 3MAJA 3JW4A 3BJOA 4KMUX 3GZ6A 1MKMA 3I0TA 1B9NA 3GWZA 1I5ZA 1IXRC 1JGSA 2KKOA 1R00A 4L9NA 4HYEA 4EM1A 5HVQC 1IW7F 1RIOH 3WTWC 4O3MA 1IN8A 2EV0A 3HTUA 1J7KA 4BHPA 1ZG1A 1SFUA 2CO5A 2ZBKA 3F72A 5ILSA 3WTZA 3IRQA 5JFRA 4LLGF 3TDUC 1EH8A 3ZMSA 1ON1A 3I59A 3KP2A 2Y75A 2W85A 2QLZA 5ILVA 4P9FA 1ZLKA 3SZTA 5ED4A 4RB0A 1TNTA 1K79A 3HHHA 1FLIA 3R0JA 5FFZA 3JTGA 2IT0A 5LEKA 4LJZF 5DD4A 5A2QK 1G3TA 1TQMA 1R58A 3GF2A 5K1YA 4U0YA 1L3LA 5E18F 2IJLA 2Z3YA 5DCMA 2PN6A 2QWWA 2GWRA 1S8NA 3KP3A 4L9VA 3WTXC 1EH6A 4WXDA 1O7LA 3R6SA 4GO1A 3TOAA 4KDPA 4KICA 5FFXA 1J75A 2OZ6A 3TDZC 4YFKF 1R1TA 3F8FA 1HKTA 5IT9Z 2NYXA 3QP6A 1OMIA 5LGUA 3CO7C 4R8HA 4EMSA 5L3EA 4HX7A 2IRFG 3Q9SA 4IHTA 3QU3A 4I0AA 3F8BA 1KGSA 4LK1F 2EJRA 1ZGJA 3P9CA 1ZHFA 5D5WB 1ON2A 3BROA 4UVBA 3CLOA 2HKOA 4KA4A 2GXGA 3RTRA 2VC0A 1SD5A 3GFIA 4BQAA 2P8TA 1TLHB 3HSEA 3ZP5A 4XBFA 3JAMZ 1I1SA 3WE3A 3RYPA 3BP8A 1RI7A 1KYZA 5E1XA 3ZN1A 3GFLA 3V8LA 2IVMA 1FYKA 1R1UA 2VC1A 4U0WA 2PLYA 3MZHA 1UHWA 1B9MA 3RYRA 3O6BB 1E17A 1HBXG 3FF5A 2M45A 2EK5A 2H09A 2EFQA 2DQRA 4P9UA 1PP8F 2V79A 3WTUC 2E7XA 2G7UA 4A5NA 1DPUA 2CSOA 2HR3A 1U5TB 2EA4A 1T6SA 3B73A 4G8XA 1BJAA 1IXSB 3PQKA 3FMQA 5IT3A 1KU7A 1D8JA 1H0MA 4OIOF 2CWEA 2ZJ2A 5E20A 5CVVA 4IRHA 1CGPA 5ICFA 4YG2F 4XLPF 1I6XA 2M30A 5HDGA 1BIBA 1LJ9A 3PFIA 4M9SA 2EV5A 2XIGA 3ELKA 1LEAA 1XMKA 4N9IA 2K27A 5BPIA 1LQ1A 3T5XA 4ZYDA 4YFNF 4HW0A 4A0XA 2QZ8A 3CUQA 4HLYA 2WWYA 5IT9K 4HX8A 4XRFA 5J6XA 4HV6A 4EJTA 5CJ9A 1P4AA 2ELHA 5AIPA 3Q9VA 1TQPA 4RGUA 1RUOA 2UXNA 2XGXA 1NHAA 1HW2A 3S2WA 3REOA 3LAPA 3B02A 2ZNYA 2DK8A 4EGYA 3R4KA 4ZZLA 5HOOA 1R5HA 4N0BA 4RGXA 2BV6A 1XGSA 4WCGA 1U2WA 3HRSA 3RIRA 3F6OA 2E1CA 3JTHA 1FSEA 2HTJA 4ENNA 5D6EA
chains in the Genus database with same CATH superfamily
3BR1A 4OIQF 3FMSA 5M5YJ 3D5LA 3PO3J 2DA1A 2ACJA 3O8GA 2M4GA 3J7AO 1FWZA 2RQPA 1J5YA 3I5UA 2YS9A 4WXHA 3R61A 3QU6A 2CFOA 1D1AA 3UKGA 1ULYA 4IO9F 2YR2A 1ZREA 2F5CA 1OCTC 1SFXA 2IP2A 3ZMUA 2MH2A 2LF8A 1K6OA 1XB4A 1E2XA 3SEZA 3IKTA 4PGGA 1YHQI 4FCYA 2QQ8A 3KEYA 4BYYA 2EZKA 2LKXA 1QZEA 4XORA 1V5GA 1V55H 2PX9A 2FMYA 1ZRFA 2IGOA 2LY2A 3G1OA 1VQ7I 5LD2C 4N9HA 5JI6A 4FASD 1QGPA 2FEZA 2M9HA 1X4PA 1JHFA 3C7JA 3E0JB 4L0ZB 2Z5UA 2DPUA 1OJLA 4E7JA 4L5IA 3PIOF 3W2AA 4YIFA 1BA5A 1WHUA 2Z99A 4WXCA 3ZQLA 1ZRDA 5JLXA 1A5JA 1WGXA 2HKXA 4J00A 2HNHA 3FKIJ 3J80Z 2L7KA 5CVRA 1Z9CA 3MN2A 3JRGA 1FTZA 3WHCA 3ZQFA 4U7DA 1HF0A 2VPLA 4B4CA 1KONA 5L3CA 2JVGA 1KQ9A 3FM3A 4AC0A 1KQ8A 2JRMA 2QBYA 4XONA 3FK7A 1M1EB 3DBHB 5FD6A 3BT9A 2KQRA 2DCEA 5DYMA 3L2UA 1Y1VJ 1N75A 1ETWA 1Y1WJ 1N77A 1D5YA 1X1CA 5HDNA 1BOAA 3KIOA 3ZMDA 4XICA 1OYYA 1ZELA 2L9RA 3OR1C 2M1BA 3PIPF 2KRHA 1YITI 3AG2H 5J8FA 1RKTA 4LOCA 3H36A 2W24A 1STZA 3BG3A 3CMEI 2PEXA 4M71A 2W1OA 2HQNA 3ZGKA 1EJ9A 1VQKI 3HSRA 4ESBA 4UXNA 2D1HA 4HDUA 2HXOA 1B72B 3RQIA 3LSMA 3BG9A 3ZQIA 4A3IJ 2QCOA 1HKSA 3M4OJ 2VQCA 3VOEA 5DUKA 2L9NA 1ZRCA 4XIDA 5D5XB 1V5EA 3VYUB 2JA2A 4JX6A 1G3SA 2L9VA 2W48A 4BXXJ 5FGMA 1DGRM 4OAYA 2CW8A 2DLLA 3HL2A 2MA3A 2O0YA 4PJMA 2P5LC 4UB8C 3RPUD 1Q1HA 3DKWA 4ITVA 1BC7C 4A6EA 2CQ7A 3EQLF 3LNQA 1SEUA 4N4NB 5E8IA 2FSWA 1WQ2A 2QUFA 3PUBA 1WI3A 2DFFA 1D0ZA 2AQFA 5FKMA 3E5UA 1VFCA 2P7VB 2JK3A 5GTIC 1ZTRA 1OCCH 1HQCA 5E3LA 3DWLE 4Y17A 3IV5A 5BOXA 1QO0D 1SFEA 5KVRA 2MGQA 5HNHA 4A3BJ 1B8IB 1F9NA 1FNNA 2GAUA 1XC5A 2LK2A 2JA7J 1P92A 4N4OB 3OL3A 4HV5A 5F6FA 4IVNA 1RZ4A 4BDZA 5GPAA 4M9XA 1P2FA 2KIQA 2UUZA 2X1CA 4JYKA 1LVAA 3K4LA 2CRGA 3LA7A 4LB5A 4ZDLA 1HC8A 1B59A 2A61A 2D5VA 4DQ2A 3BQYA 3EDPA 2F5DA 1FPQA 3BG7A 4P96A 2DYSH 3BLYA 1U5TA 2RKHA 3AAFA 3OWTA 4B3XA 3ML6A 3KX2A 4IKFA 5D8KB 5FKOA 3VDXA 2H1LA 2JTVA 2UV1A 5LEJA 3BJ6A 1FBUA 4B43A 1JUPA 2DQLA 3GTOJ 1WJEA 3RPUA 3RI4A 3WU2C 3KP4A 1U78A 2F5FA 2LDUA 3SJMA 4LG0B 5JVTA 2WB1A 5HS9A 5AIQA 3CQZJ 2M3AA 3ABTA 2XGEA 1ENHA 1X1BA 4MIMA 1OPCA 2ZO4A 3S16J 4DYRA 3KFWX 1NG7A 5B5EC 1ITYA 1BI1A 3OMYA 3OSGA 1G6NA 1VQPI 1D1BA 5IYDJ 3CJTB 3PFYA 2XVCA 1Y0UA 5BNGA 2ZCWA 2COBA 3S1NJ 2HI3A 3LQQA 1XCBA 1H9GA 4A3LJ 5LHIA 1OR7A 4HNVA 2HEOA 5HDKA 2ZNZA 1JT6A 1HXDA 1YIJI 2QSGX 2IGMA 2L01A 1D0XA 2H1KA 2PFBA 1DGWY 1YYVA 3DCFA 3VB2A 3G6EI 5E3NA 3A2KA 4KFCA 3BG5A 1CQTA 2G9WA 4G9YA 5E1WA 5KAFC 1JUSA 1FP1D 1W4MA 4HAMA 3H3VK 1S5LC 1MIJA 3KE2A 5D4SA 4HNUA 3ZN0A 3K7AJ 1F5TA 2L7ZA 4AIKA 1S7OA 2L4MA 2XAGA 5DCFA 3NRVA 2QBYB 4Z6YA 1KYWA 2BZTA 2EIMH 4EM0B 3EUKL 2QQBA 3HOVJ 1Y39A 2E1MC 2WBMA 1SMYF 1JGGA 3DLLF 2JUCA 4HZFA 4HF0A 4U87A 1MJBA 2MH9A 3KLNA 3RSNA 3MD2A 4K2EA 4XR6A 4BY1J 4L9TA 3K4KA 3E97A 2PG4A 3QODA 1E0EA 2DOFA 1XD7A 1E3OC 4XLCA 5C3EJ 1K4TA 2WADA 2X1DA 3KETA 1IJWC 4ZYEA 1NTCA 1Z7UA 2VQGA 1UMQA 1IRFA 2V1NA 4RBOA 1IV8A 4XN0A 4LLNA 2IXSA 4HF1A 1WFXA 2EZHA 1Y0NA 3Q0WA 2VJJA 3OYCA 3K9TA 4RM3A 4MEXF 2XGDA 4DBQA 3N05A 1U0JA 2DO7A 1WWXA 3L2RA 3FBNB 4R79A 2OQRA 3A01B 2O5RA 2P7CB 1TWFJ 2K9SA 4IF4A 1FBSA 5H20A 3B6CA 3I9V2 1K61A 3JRFA 2KP6A 1O4XA 1IDYA 2YX4A 5BMZA 2XAJA 3HBLA 2M87A 4RB3C 3ZQGA 2ZXHA 3OS2A 2MD0A 2EZIA 4HQEA 3LA3A 4OINF 1OLTA 2Y0SA 1T33A 2IW5A 1VQ8I 2R7VA 1D1CA 1K83J 2I8DA 2NXNB 3TOBA 1YFHA 3HTSB 5LHHA 2B7EA 1XMAA 2DDBA 5IP6A 1F4KA 3ASOH 2A5WA 3DF8A 3T0YA 2MW8A 4M74A 2TRTA 5DD8A 5M5WJ 3WGGA 5C4JJ 2VASA 2R92J 1Z6RA 3L2VA 1R1VA 5KNLA 1K6YA 2E34A 1ETYA 4PZJA 3NARA 1BI3A 5EEAA 2IPQX 5J1UA 2ID6A 4U7BA 4C3JJ 2VKDA 3K70C 2DA7A 3JR9A 4MQVA 2JVHA 4HBLA 3HOYJ 2R4GA 3FXKA 3QAHA 3O2PE 4XSXF 2K9QA 1FEXA 5H6QA 2QYOA 1Y6IA 4HF2A 2ZMEB 2VE9A 2X1EA 1JKOC 3V8KA 2JUGA 1VQMI 1ZGAA 2R5YB 2O6GE 4XM3A 4BDYA 2M8EA 2KJCA 2R7FA 2E2JJ 2DXIA 3JCUC 1USSA 1BN5A 3F3XA 1OYWA 2ZXIA 3IWZA 1KU3A 4RMNA 3WODF 3JAMK 3W6VA 5FRMA 4LG0A 1U8BA 2HYFA 4YEJA 3LQRA 4CCNA 1MMNA 4J19A 3KEQA 2X48A 3EYYA 1UB9A 2L7FP 1WZ2A 2DYRH 1YW9A 4PJ0C 1IXCA 3OYKA 2IA0A 2JSPA 4CDGA 1T98A 4C3IJ 1LUJB 3GVAA 4DJAA 1PDNC 2XRNA 2BOLA 1DP7P 2P5KA 4IPAA 1YW8A 4UY8I 1A36A 3BR5A 2VPRA 3L00A 4GYGA 2G0EA 2I5UA 1TWAJ 2H6CA 4EJUA 2PJRB 4IRIA 3JRCA 4P1WA 4IHXA 2WY7Q 1W5CC 3ULQB 3E5QA 1TZLA 2K4JA 2ELKA 2J5PA 5F0CA 3CDHA 3B6AA 1VTNC 1T39A 5LFAA 3WTSC 2AQEA 2K9NA 4AD9A 4D0PA 3JRBA 3M3YJ 4G6TB 2W00A 2ZSIB 2FF4A 2QEXI 2DMUA 2KZVA 5ICGA 1W5SA 1HSJA 3O8HA 4Y33A 3TP0A 1Y8QB 3G2BA 1R36A 4L18B 1NH3A 2L7MP 1W1WE 2HVQA 2QA4I 3NEUA 1BR1A 3BR0A 4OIRF 1R5GA 4F7ZA 5ILUA 2XSDC 2FU4A 1MBGA 4DNCA 1IAWA 4IQ4A 3I3LA 2UZKA 4EJVA 5B66C 3MFKA 2R0QC 1MDMB 2HYJA 5GADJ 3PQJA 2V1XA 3FK6A 3BDDA 4L5EA 4EM2A 1SD4A 3MZYA 4V2FA 4BQQA 1K7AA 1B4AA 2JT1A 3I59B 4YIIA 3K2AA 1IN4A 3FDYA 1XX5A 2ZSHB 5F1JA 2STTA 3MZ8A 1R22A 4XLHA 1TL8A 4FTHA 3JRAA 1RR7A 3PSFA 2ID3A 2X0LA 2R7DA 1TP4A 1SVLA 4BBRJ 3HKZN 2FQ3A 1VZ0A 3CJRB 2BVLA 4GDFA 4XSZF 5LGNA 2O8XA 1MMDA 3HOXJ 3HUGB 2GZWA 2E35A 4XN3A 1G4DA 1Z3YA 3ZQQA 1KZHA 3M1EA 3MCZA 1SFOJ 1XCVA 5J4VA 2VODA 3HGYA 3LSGA 2VBZA 2W57A 2HQRA 2V1DA 4CYDA 4D7MA 1FOKA 3M07A 3OV8A 2DMQA 4NC8A 5F0HA 3MKZA 3ZMZA 4ZH4F 1FC3A 2NS0A 4BXUA 3P7NA 4IRGA 2MG4A 1BIAA 2L54A 1YOVB 3S3NA 1O3RA 1I27A 2WV1A 1GHCA 1NG6A 2QSFX 4ZZDA 1XDUA 2KPMA 3CD6I 2DI3A 4OOIA 1JXSA 2L4AA 4BACA 3KCCA 4AIHA 4EJWA 3GEZA 4FX4A 2OCCH 1AWCA 3S1QJ 2IS6A 1TT5B 2BHYA 3J7YJ 1I1GA 3KYCB 3PSIA 3QRFF 4Q48A 5FJ8J 2XKPA 2VJ4A 2VT2A 2YX7A 5CLSA 1HCRA 2ZJRF 3WU0A 5K5OA 3QYEA 1BI0A 4G94A 2MD5A 2KIUA 2HPMA 3E6DA 4KN4X 4PGHA 4PK4A 1IUYA 1ZKGA 3RKWA 3MQ0A 1QA6A 4ZYAA 2VOPA 4AVPA 3J7ZI 1W7PB 4WX9A 2ZXJA 2H94A 3TW7A 1J0RA 2JQ7A 2R5ZB 1YJWI 2NVYJ 5JLWA 3I71A 2Q1ZB 2Z33A 4KNYA 2Q2EB 4M6YA 1XDSA 1FP2A 1A6IA 5FD5A 4IHSA 2OTLI 3A01A 3EUHA 5HLGA 5FLVA 3C2BA 2HDWA 2OJED 3S15J 3E5XA 3TEDA 2NNYA 4GGGA 1MSFC 2CYYA 2A05A 2RGVA 3H5AA 1ZR4A 3VFZA 5DCMB 5D5UB 3L2CA 1T8IA 2RVCA 2N8GA 4G6DA 1V3FA 3ROUA 2DA6A 3FM5A 1X1PA 1LNWA 3L1PA 3ABUA 1MJAA 5DS9A 2AXLA 2Y9ZA 3WHBA 2ESHA 3KP5A 3E7LA 5LBQA 4EV0A 3AG1H 2YU3A 1ZLJA 3OYBA 5LRSA 2D2WA 1F36A 2OD5A 4UVCA 3J80K 3E6BA 2Z2SB 3IC7A 4II2A 4C2MJ 2OQGA 3CO6C 1U6GA 2DW4A 3V7RA 3MKWB 1EV7A 2MC4A 3C18A 1ERDA 3TBIA 1Z1DA 4IXAA 4YIRX 3CMAI 2OU2A 4HG2A 5FLXK 3KPHA 1KU9A 3NAUA 2LG4A 4KT5C 2GLOA 4C2UA 3H5RA 1QVTA 3EETA 3MMYB 4Y15A 3VODA 5HLTA 4HDVA 1PVEA 3DPLC 3BWGA 3ZMVA 3RPQA 2K85A 4FETA 2R5ZA 3IH3A 2RV8A 3M8FA 1O3TA 1XN7A 4A2UA 1E3PA 5KAIC 3CUQC 1R71A 4CYCA 1QZZA 3BR6A 2E5NA 5A2QZ 1P4WA 3GXOA 4ZYHA 2IBDA 3HSFA 3DEEA 1ZG5A 3NQOA 3GMEA 1EA3A 3ZQ7A 2LTPA 3BZCA 3KEOA 2QVOA 3E3VA 2STWA 3F9KA 3WG9A 3D0SA 2YU9J 3BJAA 3OYFA 1FTTA 3OYNA 5E3OA 2H27A 4I7HA 3HB9A 3NWTA 3CUQB 3L2WA 4ZYGA 4AYBN 2XUBA 4G7OF 1ZQ3P 5TISC 2DBBA 3C1DA 3DPUA 2PJPA 1REPC 2LY9A 3H0GJ 2DFHA 1D8KA 4QIWN 4KIBA 1J09A 2AHQA 4IHWA 2F4OB 2FJ1A 2KIFA 4ASNA 2A69F 1QBJA 3P5JA 3BR2A 3IP4B 3WGIA 3HOSA 1JJ8C 1V4RA 5KK1A 3OOUA 2TCTA 2CQKA 2K86A 4ZC3A 3FXUA 2XB0X 2R7WA 2ESNA 4XLAA 2KZGA 4E7ZA 2MLGA 1DU0A 4KITB 4NQWA 3G4SI 2FOWA 1XSXA 1FJLA 1CF7A 1X1AA 1A31A 2E71A 5HODA 1OYIA 1MBEA 2CQNA 3FBIB 2CW0F 3K1MA 4CO8A 4BAYA 3RKYA 4Q5SF 2F2EA 1IRXA 4FE4A 4G7ZF 2Q0OA 2VIXA 3ONQA 4PFPA 3BZKA 4BGDA 3ABLH 1R6RA 3EPZA 2EB7A 4AM3A 3RKXA 1IG7A 5J4YA 5DV5A 5HNFA 3IAS2 1ZARA 2DK5A 3P9KA 4XKBA 1R4NB 2KMUA 3F21A 3GTPJ 1S7AA 2BGCA 2AO9A 4UNOA 3JSOA 1A35A 4E6KG 2DJNA 4JOMA 5D5VB 2FBHA 4XL9A 4A69C 2CV2A 2CV0A 2DTRA 3VWBA 2BYVE 2CUJA 2E7WA 4M73A 6PAXA 4PSXA 1FIPA 1RETA 1XSDA 1BC8C 1SVOA 4BE0A 4L5JA 1OCZH 4AWXB 2JRTA 2K7LA 3M8JA 1YQAA 3HIFA 2Z16A 3WGHA 4B48A 2A6EF 4DBRA 4CA0A 5E17F 1IRGA 2LSOA 2R7SA 3ZR8X 1O3SA 5JHUA 2QKMB 3CJNA 1UG0A 1ZAOA 2GIVA 2GXBA 1ACIA 3I4PA 3VEPA 2HGCA 2MC3A 2VN2A 1LE8A 4XLEA 3GYHX 3HPGA 2LVSA 2VQLA 4FX0A 2VL8A 2HZTA 2P6SA 1P4XA 3U2RA 5CQGA 2X4HA 1YS7A 3U9GA 4LMYA 4ESFA 4D5FA 3JRHA 1Z6TA 3O3KA 2EILH 1L0OC 2A3SA 2OC6A 2VQHA 5LHGA 2HDDA 1TBXA 3BTIA 1PJRA 1SANA 2M5WA 2PMUA 1U8RA 3HKZA 3FXJA 1WJBA 1SAXA 2VXDA 3FZVA 3AG4H 2JA5J 2E1OA 1WSUA 3ZMTA 4NHJA 1B72A 2XASA 4DYQA 1AOYA 3CDIA 1J59A 2HOTA 4I09A 5DDGA 2EFOA 2Y9YA 1QU3A 1U3EM 2DT6A 3A1YA 4G12A 5ICEA 1WI9A 5E1ZB 1UELB 2IS1A 3DU6A 2HOEA 2W4SA 2NS8A 3K1PA 4MFEA 4TV7A 5CVUA 3VYSB 2JZYA 2E1MB 2YSRA 1AKHA 3FXQA 4EJOA 2O9LA 2LNBA 3D5RC 4B1RA 4S0HB 3GFMA 3G3ZA 4PDKA 2B0LA 1Y56A 1AU7A 2NOGA 1I39A 2E5ZA 1T0FA 2RDPA 2XF6A 1T2KA 4E70A 3IRRA 1BBYA 2HVRA 2PMZN 2FNPA 4HX4A 5B1AH 2EZLA 4BE2A 1QQIA 3LSKA 2XHKA 2E60A 3V4GA 2B9SA 1JJ6C 1LEBA 1Z91A 3MEXA 2ME0A 5FKNA 3TW6A 4DYCA 3A0HC 3GO5A 3UR3C 3S17J 4BEHA 4PUSA 1G3YA 3J7AY 2DDAA 4G6QA 2NNNA 3CF5F 1WVRA 2V6CA 2V1UA 3DXJF 5K7FA 5BPDA 2GXAA 3HC7A 3E6CC 5IP7J 2W84A 1JE8A 2TDXA 1FX7A 3IKVA 2RNJA 2Y31A 2Y0MA 4H4KC 4I02A 5K7ZA 3CCRI 4Q4ZF 3S8PA 2HOAA 2NRAC 1S9HA 5J8CA 2MLKA 1MSEC 2OTJI 2IAIA 3E6MA 2QSHX 3F22A 1RC9A 5FLMJ 3GW2A 4IEJA 2G7HA 1VQNI 4B47A 3PNYA 4UUTA 3RCOA 4II3A 2COMA 3IH4A 4ABZA 3DPTA 2LRDA 4A6DA 3U21A 1MD0A 3HHGA 3G73A 1ONVA 3CC7I 3CUOA 4UV9A 2DT5A 4HEA2 4EQQA 1POGA 3OR2C 1Z67A 1IF1A 4NBQA 5GP9A 4BJ6C 2V4JC 3LSJA 2NAZA 2CJJA 3GFJA 1R7JA 4Y7NJ 1K78A 2V6EA 2XV4S 3C2GA 3C2HA 3LOCA 2FUG2 4C2TA 1IO2A 4P55A 4LITA 2HQAA 1FYLA 1RR8C 4HNTA 5IPAA 1MMGA 3SXYA 3IUOA 2VT3A 2L3DA 3GTMJ 4D7NA 3GTGJ 1XPXA 1JKPC 2JPBA 3TL4X 3W3CA 2V9VA 4WWCA 3AG3H 3BOQA 1YTYA 3OYJA 2FA5A 1HW5A 2HZDA 1VNDA 3H92A 2P0WA 3N4MA 2HYGD 4I2OA 4MFDA 2FQ4A 5LLQA 2CUFA 3ECHA 4RDUA 3HRUA 2EV6A 2R7RA 2OPTA 1MMSA 3KP6A 3W6KB 2KFDA 2UWMA 5D6FA 1LFBA 2Y0SN 1WJ5A 4C9YA 1UCRA 2QQAA 1TQIA 5EEHA 4RB1A 2LD5A 4LFUA 1ORKA 2OCEA 3LSPA 1YIOA 2DTZA 4WK8F 2F48A 3BR3A 3LFKA 1TWHJ 1R23A 2KRFA 3OYHA 2F5EA 4PSWA 2VXZA 3ZOBA 4BEHB 3JRIA 2CS3A 2R7XA 4AYBA 2EWNA 2K5CA 1P6RA 2GBYA 2F5VA 5L3FA 4CICA 1ZG3A 3M7GA 2KT0A 3J81Z 2CGPA 2UXXA 1HKQA 1MH3A 2R93J 3MVPA 3CCVI 2HDCA 2DJIA 4HSRA 1Z21A 2XSJC 2PMZA 3C3WA 3F8MA 3GZNB 2A6TA 1R9TJ 2HQ5A 3DTIA 2WAEA 4IHVA 4IHYA 2DMPA 2EA2A 3FISA 5HS7A 1WCMJ 1W0UA 1WH5A 4HQMA 1USTA 1U9OA 1BL0A 3EYIA 3Q3SA 2P4WA 3ISPA 4RGRA 3F0CA 2RAEA 1XGOA 1AA7A 1V54H 1LDJA 1B1BA 3DKXA 2LBFB 3SFZA 5B3SH 4NUBA 4E4HA 2EH3A 1D3YA 4I99C 1ETOA 1RRJA 1E3HA 2BVMA 4CCMA 1BW5A 3BPVA 3HM5A 3I54A 1D0YA 4OMYA 1YS6A 5BQTA 1U5TC 1RPWA 1VQOI 5EEGA 1LE8B 5CPRB 1LKXA 4A0ZA 3HJEA 1QNTA 1MBKA 2E19A 2ZMEA 3CCEI 1PP7U 3BQZA 2HWVA 5EG0A 4M3BA 1GUUA 5FLXZ 2JJ7A 4FE7A 3ERED 2WTEA 4RAYA 3QYBA 3ESWB 1ETKA 1MBHA 5E79C 2KIMA 1IN5A 4OMZA 3I56I 1GXPA 1QVUA 4CZZA 4S05A 3H0DA 3K1NA 1FOWA 3I53A 1C0WA 5HLHA 3OOPA 1KA8A 3S3OA 3I55I 2V9KA 1X3ZB 5HS8A 3QPTA 3HOZJ 2WAFA 2WAQA 3DLAA 2NVXJ 1Z7LA 4QLCU 3DQVC 3LSIA 3F6VA 3F8CA 3BTCA 2H8RA 1DP3A 3RJPA 5IOYA 5M5XJ 2GA2A 2ZFUA 3H3UA 4U88A 4QPQA 4V19K 4RLFA 1SMTA 1K4SA 1W7PD 4RS8A 1SAUA 3CCJI 1P7JA 2NOJB 2XB5A 2YPRA 4DGWB 3HRMA 3R60A 3GX4X 1YRNA 1PUFB 1LB2A 5GAHJ 4M3DA 3EUAA 4XRSG 4D5CA 1LDDA 4BKXA 1H9TA 2CUZA 3SQNA 4A3FJ 2W7NA 2JWTA 2MBFA 2XAUA 1P9QC 2DT7B 1ZN2A 2FBIA 2IGNA 2K9MA 3K4BA 4CHUA 2HU9A 2JA8J 2RNGA 5IYBJ 4F93B 2ADUA 3SFIA 2MYSA 2ICWG 2M7AA 5BS6A 1IC8A 1K78B 4LLLA 4XLFA 2H6BA 2X6WA 4BQNA 2QENA 3HYIA 1GLNA 3L9FA 4W1UA 4U0VA 3VSLA 2PMHA 5F04A 3CMYA 3IHUA 5M3MJ 2IEKA 2DMNA 1UHSA 5ICCA 3LSTA 4HOBA 4XLNF 1J9IA 1MJ9A 3KZZA 3HOUJ 2AS5F 1WJAA 5E3MA 2K3PA 2V7FA 1WRJA 5F64A 3SDBA 2Q2EA 1X4OA 2LY1A 2CFXA 1DDNA 2V26A 1NK2P 2OV7A 3KYDB 1ZK8A 4CCOA 2BW3B 2C6YA 4BU2A 4J01A 2RC4A 3L09A 3H3ZA 4RGSA 2CMPA 3NWSA 2EFWA 3QQAA 2DAOA 2ZC2A 4Z2YA 2XGCA 1VI0A 4ENJA 3VSKA 4Y52J 2OA4A 4BJ5C 3GCMA 2OZUA 1ETVA 2DU9A 1FZPB 4PJNA 1GT0C 1N25A 3WTYC 4B09A 4CCKA 2MABA 2OAZA 2R7UA 1Z0XA 2HS5A 4QWQA 3F23A 3HXLA 3SZPA 1S29A 1YI2I 1LDKB 1S72I 4A3CJ 4ETSA 2GA1A 2A6HF 5EF6A 1YX5A 2HTSA 2PBIA 3H9JA 4KISA 4WF2A 1JUMA 2GQQA 5GAGJ 1G8XA 2XAHA 1FT9A 2DOEA 3TO7A 3A0BC 5K5RA 3LWFA 3DFGA 4A93J 3H9GA 2A5YB 2DFEA 4LIVA 3WU1B 2JPCA 3V8JA 3OYLA 5CVIA 3OL4A 2XROA 2LFBA 2LOOA 1N78A 1B6AA 4O6JA 4HLXA 3V7SA 3ABKH 4ENMA 4D9JA 2VBYA 2ZMEC 2FXAA 4HPQA 2EQRA 4LD5A 4IQJA 2HXIA 2JA6J 5TRDA 5TJJA 2R7ZJ 2BXYA 4B8XA 3Q5FA 1EKEA 3QOPA 3S14J 3DU5A 2QM3A 3PO2J 5KCMA 5GPCA 4BH9A 1W7PA 1WKMA 3K10A 3KZYA 5DTDA 5E8GA 4JBAA 4MHGA 2ZJPF 4M72A 1DPRA 3M8EA 4ZTJA 2LKPA 3OIQA 3ECOA 2PI0A 5L3DA 4XMYA 1QPMA 3DEUA 1O57A 2H8WA 2Y69H 2X9DA 3TKYA 4CGZA 2WY8Q 2Z9OA 4KN7X 1MBFA 2D1VA 4C30A 2L02A 3MKLA 2DOAA 4E7HA 3GTJJ 3PJRA 3CJQB 1TC3C 1JTXA 4X0GA 3FXLA 3ZPLA 3WTVC 1TNSA 3W2VA 2CQQA 2XPWA 4YFXF 1H8AC 3V42A 2LC2A 4L0YB 4XNFA 2IA2A 2ME6A 4GFBA 1YLFA 2R3SA 1LFUP 3PNTA 2EINH 5TGTA 4NC7A 3HG9A 5HLIA 3T8RA 1PUEE 2FRHA 2DA5A 3Q0VA 1IN7A 1MGTA 2X51A 5H6RA 4EGZA 4MGRA 4NQWB 2WC2A 1W0TA 3BZ6A 1FY7A 2BY2A 3TP3A 1QZYA 2L0KA 3CP2A 1KU2A 2O61A 2VKEA 4F3QA 4PJJA 3OS0A 3IL2A 1G2HA 2PQ8A 2P81A 3FX3A 3K0LA 1HA8A 5L3BA 1JHHA 3WTTC 1IZ1A 3BPXA 1UJ8A 1Z77A 3R0AA 3F8NA 5D8LB 1HOMA 3A03A 1IRZA 4BHBA 3GLLA 4LGWA 2XC7A 3OIOA 3SYTA 4O5VA 5C44J 4FT8A 4GXOA 3S32A 1YJ9I 4LB6B 4IOAF 2LKSA 4UHTA 4GYIA 1EH7A 4MQ9F 2BE5F 1P7IA 1GVJA 1YJNI 5CVJA 2ECCA 5J40A 4MEYF 3FWEA 4M3EA 2EBIA 3ZCOA 2EFPA 2O7OA 5IP9J 1O7FA 4D1QA 4F52A 2DPDA 3DBRB 1YO5C 3K4CA 4NC6A 1DUXC 4FHTA 2E2HJ 1Z3XA 2NVTJ 2X85A 4I01A 4RA2A 2A68F 3K2ZA 2BW3A 3VYRB 2ISZA 2FNAA 3MWMA 5DEQA 3S93A 3K70D 2CW7A 3IAM2 3SEQA 3FHZA 3PNVA 1FOYA 4BHCA 4I0BA 4NB5A 4QPOA 2ZFWA 3CCYA 2RN7A 2Q8KA 1FYMA 2GM4A 3A02A 2R7OA 4XKWA 1MNDA 4P5OA 5EYRA 4CZCA 2KHMA 3OYGA 1TW3A 1MDMA 4E7LA 2L9SA 3KLOA 3FMRA 3U1DA 2M4KA 4BBSJ 2DA4A 4XOPA 4KYWA 1HSTA 5DM6F 3K6GA 4JK1X 4AUXA 4UVAA 1OCPA 1AKHB 3L2QA 2ELJA 2XKOA 3DTKA 3CP8A 2ZJQF 3M9AA 1X58A 4UUSB 1OISA 2NVUB 5CYVA 1W5TA 3LA2A 2OBPA 2Y48A 1ZH5A 1G3WA 2VJ5A 2EFNA 2LF7A 4A0YA 3HRTA 4ZDOA 1AHDP 1X1DA 2M0CA 3GUDA 4AIDA 1HW1A 4G7HF 1QPIA 1ODDA 4I6ZA 3I58A 5F08A 1WJDA 5JR3A 2M8GX 3A4CA 1F1ZA 3KP7A 3P9IA 4UV8A 4E7IA 3JRDA 3DV8A 4ON0A 1PYVA 3TO6A 5D4RA 1BJZA 5L3GA 1SD6A 1QHGA 3OY9A 5DM7F 1RESA 5AONA 1VQ5I 3CMMA 4LK0F 3OYDA 3GTQJ 1I3QJ 2JN6A 3K69A 3WE2A 4MTDA 4OU0A 1FBQA 4XK4A 4KMFA 4KUMA 4EEFG 3K4NA 2KDZA 2E1NA 4CH7A 4H0EA 2DFIA 3GZ5A 4JX5A 3BG6A 5K5QA 2A07F 5J1RA 1D5VA 2WV0A 4Y13A 4UUSA 3L7WA 3HOTA 2VJIA 3HZJA 3RZOJ 4UB6C 1GXQA 3JSPA 2IA1A 1S7EA 2QF7A 4OIPF 3DP7A 3BCBA 3QPHA 4XKVA 3I4NJ 1APLC 1J2XA 3OSFA 3CC2I 1BI2A 3BC8A 2R5YA 2VBWA 3K4MA 1OFCX 5IY5H 1SVMA 4IJAA 4BXFA 3H1CA 1IN6A 1T08B 4JX4A 2W82A 4XRMA 3QYFA 1H89C 2RREA 2ISYA 1MW7A 3FXRA 4Q47A 2OF7A 2P5VA 3CESA 4CXFA 5FRNA 3QP5A 1RUNA 2XF5A 2XAQA 5FB2A 1YW7A 4BS9A 4XKCA 3T8TA 2EIKH 3TO9A 3WG7H 5DUIA 2BHZA 2M7BA 2ZKZA 4M9ZA 1S3JA 3G1MA 4XOTA 5CKTA 2JSCA 1VQLI 4BNCA 1BM9A 5IYCJ 1T56A 1S6LA 1NK3P 3T1BA 5F27A 1Z05A 1XSVA 2VE8A 4R1HA 4RAZA 2EIJH 5LGTA 1OCOH 1SD7A 2FBKA 3DBLB 4EVIA 4PCQA 3ZQCA 5EJCA 2HPIA 2F4MB 4YELA 3TQNA 3OYEA 3QPLA 5CQEA 3I64A 2GIZA 2VB6A 3CF2A 4ANJA 4MTEA 3OYIA 4KIGA 2QQ9A 1OKRA 1VQ6I 2ETHA 1CF7B 1YRNB 4A5MA 2VUMJ 1JTYA 4M6XA 3HGGA 1VQ9I 1X3UA 4X6AJ 2KJBA 4W97A 2W25A 2F4IA 1X19A 2P6TA 5LRRA 2YUSA 5FO5A 1OCRH 4KIFA 2GOMA 4A3EJ 4QSHA 4JP0A 3CTAA 4I98B 4ZJZA 4L9JA 4BY7J 2BY1A 3RDIA 2GOXB 4GRIA 3TGNA 1HLVA 5C4XJ 2X6XA 4KJZA 2J5OA 3LL7A 1XMXA 4M3FA 3ASNH 4A3JJ 2FE3A 1RNLA 4F92B 2V9PA 3IH2A 1HDDC 1YG2A 2HFHA 5F1RA 3COAC 5M3FJ 2K02A 2CG4A 2BEOA 4RAGA 3V7CA 1MZBA 1T38A 1O3QA 2D45A 3CC4I 2XAFA 1I50J 4IL6C 3S1RJ 4DZJA 3QOEA 1B8IA 4UUVA 1ETXA 2O03A 3IWFA 4HA8A 4AIJA 4GCVA 1KQ0A 3N97A 1TW2A 2K9LA 3BY6A 4LG3A 4JQFA 1UHMA 3SDGA 3FIWA 2LP0A 3KZIC 4MNUA 2VOOA 1UFMA 1WH7A 4RB2C 3LAJA 2XF7A 3SHFA 2O3FA 3GLXA 2LBFA 4ESJA 2M0MA 4ENKA 1U9NA 2BBYA 2K40A 3J81K 3HPHA 1A04A 1W36C 3M1CA 2K4BA 4A12A 1F43A 5JVGF 4CUGA 1XGMA 2L5QA 2ECBA 3W6JB 3CZ6A 1IV6A 1ZYRF 2VONA 2PJRA 1FSHA 2FMLA 4A3DJ 3HUGA 5FKKA 1IGNA 1QRYA 5ERIA 1XGNA 1TTYA 2FOKA 2VBXA 4S04A 3MAJA 4OWRB 2JMWA 3CDLA 4RM2A 1JKQC 1QHHD 3JW4A 3BJOA 4KMUX 4A3MJ 2CUEA 5IOZA 1MKMA 2FD5A 1OQYA 4AU7A 3GZ6A 3I0TA 1B9NA 3GWZA 4BE1A 1I5ZA 1IXRC 1JGSA 2WB1N 2KKOA 1R00A 4L9NA 1FIAA 1MNEA 4HYEA 5EZGA 2VKHA 4EM1A 1MBJA 5HVQC 1R4MB 1IW7F 4KT6A 1RIOH 4M6VA 3WTWC 4O3MA 1IN8A 2M34A 1LFPA 2EV0A 5F0FA 4IX7A 2FX0A 3HTUA 1J7KA 4BHPA 2ZXWH 5J3LA 2LLKA 1ZG1A 1SFUA 2CO5A 2ZBKA 3F72A 5ILSA 3WTZA 1XS9A 3IRQA 5JFRA 4LLGF 4BUPA 1R5ID 1EH8A 3TDUC 3ZMSA 1ON1A 3I59A 3K4JA 2Y75A 3KP2A 3RZDJ 1T95A 1SFKA 2W85A 2QLZA 5FROA 5ILVA 4DZPA 5EDNA 1ZGWA 4P9FA 1ZLKA 1X2MA 2LH9A 1IUFA 3SZTA 5ED4A 4ZTFA 4RB0A 2VLAA 1TNTA 1BW6A 1K79A 2MFZA 3D1NI 3LSHA 4F55A 2IS2A 3HHHA 5B1BH 3CCSI 1FLIA 1TWCJ 3R0JA 5FFZA 3JTGA 2IT0A 5LEKA 4OAZA 2CH0A 5EG0B 1TWGJ 3G1LA 4LJZF 5DD4A 5A2QK 1G3TA 2KLOA 1TQMA 1OR7C 1R58A 3GF2A 2DA3A 2F6CA 3ZQHA 1YX3A 5K1YA 4U0YA 3FHNA 1L3LA 5E18F 2IJLA 2Z3YA 2KISA 2E2IJ 4Y3OA 5DCMA 2PN6A 2QWWA 2XPVA 2GWRA 1S8NA 3KP3A 4L9VA 3CCUI 2CV1A 3PL8A 3WTXC 1EH6A 3MKYB 2EPFA 4HRIA 1IDZA 4CCLA 4LIUA 1FMVA 1GV2A 4WXDA 3HOWJ 1O7LA 2CQXA 3BTJA 4MLOA 3R6SA 4FISA 4GO1A 2HOSA 5FKLA 3TOAA 4KDPA 3LSRA 3QPSA 3OS1A 3JREA 3E1SA 1MMAA 2NS7A 4KICA 1FMWA 5FFXA 1J75A 3LFUA 2OZ6A 3TDZC 4YFKF 1R1TA 3F8FA 1HKTA 5IT9Z 1T0FC 2VI6A 3S2DJ 1HDPA 1PUFA 2NYXA 1MNMC 2I10A 2KRCA 3QP6A 1VQ4I 1OMIA 2L2OA 3SZGA 5LGUA 3CO7C 5GTHC 4QTRA 2LMDA 3X2QH 4R8HA 4E7KA 1BOBA 1GV5A 4EMSA 5L3EA 4HX7A 2IRFG 3OIPA 3Q9SA 3U1KA 4IHTA 3QU3A 1DU6A 4I0AA 3F8BA 1KGSA 4LK1F 3OYAA 2EJRA 5J47A 1ZGJA 3P9CA 4RLQA 3BTLA 3DKYA 4PJLA 1ZHFA 1FOXA 5D5WB 1ON2A 3BROA 4UVBA 3CLOA 1UZCA 4XRSA 2HKOA 3D5SC 4KA4A 4C3HJ 2GXGA 3RTRA 3FXMA 2VKVA 2VC0A 2HVSA 3QWLA 3H5NA 1SD5A 3GFIA 2WA0A 4BQAA 2P8TA 4DOZA 1TLHB 3HSEA 3FKJA 2K3FA 4XBFA 3JAMZ 3ZP5A 3DEWA 1I1SA 1H88C 5H2FC 1UG2A 3WE3A 2DA2A 3RYPA 3BP8A 3PM1A 2LYCA 3PUFA 4HSTA 3AL0B 1RI7A 1KYZA 5E1XA 3ZN1A 3GFLA 2R7QA 1YE9A 3V8LA 4CSWA 2IVMA 4A3GJ 3EUHC 1FYKA 1JT0A 1R1UA 1XG1A 1LVKA 3H9QA 1ETQA 2VC1A 4U0WA 1A6QA 2PLYA 3MZHA 1UHWA 3AFHA 3AL0C 1B9MA 1XTAA 5GAEJ 3S3MA 3RYRA 3O6BB 3CCQI 2R7TA 4B44A 4XQFA 5EZHA 1E17A 1HBXG 2DODA 2M2EA 3FF5A 2M45A 2DMTA 2IGKA 1WJFA 2EK5A 2H09A 2EFQA 1V5FA 2E36A 3RQ4A 2DQRA 4FQGA 4P9UA 1PP8F 2BY0A 1DQUA 2Y30A 2V79A 4IOCF 3WTUC 2E7XA 2G7UA 4A5NA 1DPUA 2CSOA 2HR3A 3ZRGA 5EGOA 1U5TB 4A3KJ 4AVZA 2EA4A 4M3GA 3H35A 1R49A 1T6SA 3VYTB 1LPQA 4V2GA 4B3AA 3B73A 4G8XA 1I6HJ 3UNGC 4MO7A 3GTKJ 2IS4A 1BJAA 1IXSB 3PQKA 2ZB9A 3FMQA 5IT3A 4DW6A 3FXOA 1KU7A 2OUMA 1D8JA 1H0MA 4OIOF 3CCLI 2CWEA 2ZJ2A 5E20A 5EGOB 5CVVA 4IZZA 1ZR2A 2KDOA 4IRHA 1SC7A 1CGPA 5ICFA 4YG2F 3W2WA 4XLPF 1VF9A 3GBGA 1I6XA 2AXTC 2M30A 2XPUA 5HDGA 1BIBA 4RAFA 3KYLA 2X6YA 1Y8RB 1LJ9A 5JHFA 3PFIA 3S1MJ 1WJCA 4YRVA 1JI8A 3ZXSA 4BL0B 2NVQJ 2LREA 2BXZA 4M9SA 1X3WB 2O8KA 2EV5A 2XIGA 3ELKA 4F91B 1EF4A 1LEAA 1XMKA 3ERMA 4PFOA 4N9IA 3S2HJ 2Y2ZA 2K27A 4X1EA 5BPIA 4I76A 1LQ1A 2WAQN 4EATA 1GVDA 2XDVA 3T5XA 4ZYDA 3Q0UA 4YFNF 3I4MJ 4HW0A 4NNJA 4A0XA 3ABMH 2LR8A 5KHDA 9ANTA 2QZ8A 3CUQA 2BY3A 4HLYA 3RKQA 2WWYA 2B63J 5IT9K 2XRLA 3DTEA 4HX8A 4XRFA 5J6XA 4HV6A 2Z1DA 4EJTA 3CLQA 3BCAA 5CJ9A 1P4AA 2ELHA 2KL4A 5AIPA 4CCJA 3Q9VA 3GTLJ 2CU7A 1TQPA 4RGUA 1RUOA 4NDLA 1GDTA 3AKZA 1X2NA 3OYMA 4BJTA 1BR2A 2UXNA 2XGXA 2RQQA 1G59A 3TMOA 1NHAA 1HW2A 3S2WA 3REOA 3LAPA 1JKRC 3B02A 3LMMA 1RKWA 5J1YA 1BR4A 2QGUA 2ZNYA 2DK8A 2X6OA 1I3AA 1Q1VA 2MSYA 4ZDPA 2DN0A 4EGYA 3R4KA 4ZZLA 4E7SA 5HOOA 1R5HA 1MH4A 4N0BA 4RGXA 1TT0A 3HDDA 2BV6A 4DIQA 1W36D 1XGSA 3HEFA 4WCGA 1U2WA 3HRSA 3G71I 4Y4RA 3RIRA 1UAAA 3F6OA 2E1CA 3VPRA 3JTHA 1FSEA 2HTJA 4CYCB 2QKLB 1WPKA 3CCMI 5K7HA 5D6EA 4ENNA 4BQOA
chains in the Genus database with same CATH topology
4OIQF 3FMSA 3D5LA 2ACJA 3J7AO 1FWZA 2RQPA 1J5YA 3I5UA 4WXHA 3R61A 3QU6A 1ULYA 1ZREA 2YR2A 2F5CA 1SFXA 2IP2A 3ZMUA 2MH2A 2LF8A 1K6OA 1XB4A 1E2XA 3IKTA 4PGGA 4BYYA 1ZRFA 2FMYA 4N9HA 5JI6A 1QGPA 2FEZA 4L0ZB 3C7JA 1JHFA 2Z5UA 2DPUA 4L5IA 4YIFA 2Z99A 4WXCA 1ZRDA 2HKXA 3J80Z 5CVRA 1Z9CA 4U7DA 5L3CA 1KQ9A 3FM3A 1KQ8A 2QBYA 5FD6A 5DYMA 5HDNA 1BOAA 3ZMDA 1OYYA 2M1BA 5J8FA 2W24A 1STZA 2PEXA 4M71A 2HQNA 3HSRA 4ESBA 4UXNA 2D1HA 4HDUA 1HKSA 3VOEA 5DUKA 1ZRCA 5D5XB 1G3SA 5FGMA 2DLLA 2MA3A 2O0YA 2P5LC 1Q1HA 3DKWA 1BC7C 4A6EA 3EQLF 5E8IA 2FSWA 1WQ2A 2QUFA 3E5UA 2P7VB 1HQCA 4Y17A 5BOXA 1QO0D 1SFEA 5KVRA 1F9NA 1FNNA 2GAUA 1P92A 4HV5A 5F6FA 4IVNA 1RZ4A 4M9XA 1P2FA 1LVAA 3LA7A 4LB5A 1B59A 2A61A 4DQ2A 3EDPA 2F5DA 1FPQA 4P96A 1U5TA 2RKHA 3AAFA 3ML6A 5D8KB 2JTVA 5LEJA 3BJ6A 1FBUA 2DQLA 3RPUA 3RI4A 3KP4A 1U78A 2F5FA 2LDUA 4LG0B 5JVTA 5HS9A 5AIQA 3ABTA 1OPCA 2ZO4A 3KFWX 1BI1A 1G6NA 2XVCA 1Y0UA 2ZCWA 3LQQA 1XCBA 1H9GA 5LHIA 1OR7A 2HEOA 5HDKA 2ZNZA 1HXDA 2L01A 2PFBA 1YYVA 3VB2A 4KFCA 2G9WA 4G9YA 5E1WA 1FP1D 1W4MA 4HAMA 3KE2A 5D4SA 3ZN0A 1F5TA 4AIKA 1S7OA 2L4MA 2XAGA 5DCFA 3NRVA 2QBYB 1KYWA 4EM0B 2QQBA 1SMYF 4HZFA 4HF0A 1MJBA 2MH9A 3KLNA 4K2EA 4L9TA 3E97A 2PG4A 1XD7A 3KETA 4ZYEA 1Z7UA 1IRFA 4LLNA 4HF1A 3K9TA 4MEXF 2DO7A 1WWXA 4R79A 2OQRA 2P7CB 4IF4A 1FBSA 5H20A 2YX4A 5BMZA 2XAJA 2M87A 4RB3C 4HQEA 3LA3A 4OINF 2IW5A 3HTSB 3TOBA 1YFHA 5LHHA 1XMAA 1F4KA 3DF8A 3T0YA 4M74A 5DD8A 3WGGA 1Z6RA 1R1VA 4PZJA 1BI3A 2IPQX 4U7BA 4MQVA 4HBLA 3QAHA 3O2PE 4XSXF 5H6QA 2QYOA 4HF2A 2ZMEB 2VE9A 3V8KA 1ZGAA 2O6GE 2M8EA 2KJCA 2R7FA 1USSA 1BN5A 3F3XA 1OYWA 3IWZA 1KU3A 3WODF 3JAMK 4LG0A 2HYFA 3LQRA 3KEQA 3EYYA 1UB9A 1YW9A 1IXCA 2IA0A 4CDGA 1T98A 3GVAA 1PDNC 2XRNA 1DP7P 2P5KA 4IPAA 1YW8A 3L00A 4GYGA 4IRIA 2H6CA 4EJUA 3ULQB 3E5QA 2K4JA 2J5PA 3CDHA 1VTNC 1T39A 3WTSC 4AD9A 4D0PA 2FF4A 5ICGA 1W5SA 1HSJA 1R36A 4L18B 3NEUA 4OIRF 1R5GA 4F7ZA 5ILUA 1IAWA 2FU4A 4DNCA 2UZKA 4EJVA 3MFKA 1MDMB 3PQJA 2V1XA 3BDDA 4EM2A 1SD4A 3MZYA 1K7AA 1B4AA 2JT1A 3I59B 4YIIA 1IN4A 2STTA 1R22A 2X0LA 2R7DA 2FQ3A 4XSZF 5LGNA 2O8XA 2GZWA 1G4DA 3M1EA 3MCZA 1XCVA 2VODA 2VBZA 2W57A 2HQRA 2V1DA 4CYDA 1FOKA 3OV8A 3ZMZA 4ZH4F 1FC3A 2NS0A 4BXUA 3P7NA 4IRGA 1BIAA 2L54A 1O3RA 1I27A 1GHCA 4ZZDA 1XDUA 2DI3A 4OOIA 1JXSA 2L4AA 3KCCA 4AIHA 4EJWA 3GEZA 4FX4A 1AWCA 1I1GA 3QRFF 4Q48A 2XKPA 2VT2A 2YX7A 5CLSA 3WU0A 5K5OA 4G94A 1BI0A 2MD5A 2KIUA 3E6DA 4KN4X 4PGHA 1IUYA 3RKWA 3MQ0A 2VOPA 4AVPA 1W7PB 4WX9A 2ZXJA 2H94A 1J0RA 3I71A 2Z33A 4KNYA 4M6YA 1XDSA 1FP2A 5FD5A 4IHSA 3EUHA 5HLGA 3E5XA 2NNYA 4GGGA 2CYYA 2RGVA 3VFZA 5DCMB 5D5UB 3L2CA 2RVCA 4G6DA 1V3FA 3ROUA 3FM5A 1LNWA 3ABUA 1MJAA 2AXLA 2ESHA 3KP5A 5LBQA 4EV0A 2YU3A 1ZLJA 5LRSA 2D2WA 4UVCA 2OD5A 3J80K 3E6BA 3IC7A 2OQGA 3CO6C 1U6GA 2DW4A 3V7RA 1EV7A 3C18A 1Z1DA 4IXAA 2OU2A 5FLXK 1KU9A 4KT5C 4Y15A 3EETA 3VODA 4HDVA 3DPLC 3BWGA 3ZMVA 3RPQA 2RV8A 3M8FA 1O3TA 1XN7A 4A2UA 3CUQC 1QZZA 5A2QZ 1P4WA 3GXOA 4ZYHA 3HSFA 1ZG5A 3NQOA 3ZQ7A 3KEOA 2STWA 2QVOA 3E3VA 3WG9A 3D0SA 3BJAA 2H27A 4I7HA 3CUQB 4ZYGA 2XUBA 4G7OF 2DBBA 3C1DA 2PJPA 1REPC 1D8KA 4KIBA 2KIFA 4ASNA 2A69F 1QBJA 3WGIA 3HOSA 1V4RA 5KK1A 2CQKA 2K86A 3FXUA 2ESNA 2MLGA 4NQWA 1XSXA 1CF7A 1OYIA 2CW0F 3K1MA 4CO8A 4BAYA 3RKYA 4Q5SF 2F2EA 4G7ZF 2Q0OA 2EB7A 3RKXA 5DV5A 1ZARA 2DK5A 3P9KA 3F21A 1S7AA 2BGCA 4UNOA 3JSOA 5D5VB 2FBHA 2DTRA 2BYVE 2E7WA 4M73A 6PAXA 1XSDA 1BC8C 4L5JA 4AWXB 2JRTA 2K7LA 1YQAA 3HIFA 3WGHA 2A6EF 5E17F 1IRGA 2LSOA 1O3SA 5JHUA 3CJNA 1ZAOA 2GIVA 2GXBA 3I4PA 3VEPA 2HGCA 2MC3A 2VN2A 3GYHX 4FX0A 2HZTA 2P6SA 1P4XA 3U2RA 2X4HA 1YS7A 3U9GA 4LMYA 4ESFA 1Z6TA 3O3KA 1L0OC 2A3SA 5LHGA 1TBXA 2PMUA 2M5WA 1U8RA 1SAXA 3FZVA 1WSUA 3ZMTA 4NHJA 2XASA 1AOYA 1J59A 4I09A 5DDGA 2EFOA 1U3EM 5ICEA 1WI9A 5E1ZB 2HOEA 3K1PA 4TV7A 5CVUA 2JZYA 2YSRA 3FXQA 4EJOA 2LNBA 3GFMA 3G3ZA 4PDKA 2B0LA 1T0FA 2RDPA 1T2KA 4E70A 3IRRA 1BBYA 2FNPA 4HX4A 1QQIA 2XHKA 3V4GA 1LEBA 1Z91A 3MEXA 3GO5A 1G3YA 4G6QA 2NNNA 2V6CA 2V1UA 3DXJF 5BPDA 3E6CC 2W84A 1JE8A 2TDXA 1FX7A 3IKVA 2RNJA 2Y0MA 4I02A 4Q4ZF 2NRAC 5J8CA 2MLKA 3E6MA 3F22A 3GW2A 2G7HA 2COMA 3DPTA 4A6DA 1MD0A 3HHGA 3G73A 1ONVA 3CUOA 4UV9A 2DT5A 4EQQA 1IF1A 2NAZA 3GFJA 1R7JA 1K78A 2XV4S 4P55A 1FYLA 3SXYA 2VT3A 2L3DA 2JPBA 2V9VA 4WWCA 3BOQA 1YTYA 3N4MA 2FA5A 1HW5A 3H92A 2HYGD 4I2OA 5LLQA 3ECHA 3HRUA 2EV6A 3KP6A 3W6KB 2UWMA 5D6FA 1UCRA 2QQAA 1TQIA 5EEHA 4RB1A 4LFUA 1YIOA 4WK8F 3LFKA 1R23A 2KRFA 2F5EA 2VXZA 2EWNA 1P6RA 5L3FA 4CICA 2CGPA 1ZG3A 3J81Z 3M7GA 2UXXA 1HKQA 2HDCA 3C3WA 3F8MA 2EA2A 5HS7A 4HQMA 1USTA 3EYIA 2P4WA 3ISPA 4RGRA 1XGOA 1LDJA 1B1BA 3SFZA 1D3YA 3BPVA 3I54A 4OMYA 1YS6A 5BQTA 1U5TC 5EEGA 4A0ZA 1QNTA 2ZMEA 1PP7U 2HWVA 5FLXZ 3ERED 2WTEA 4RAYA 2KIMA 1IN5A 4OMZA 1GXPA 4CZZA 4S05A 3K1NA 3I53A 1C0WA 5HLHA 3OOPA 1KA8A 5HS8A 3QPTA 4QLCU 3DQVC 3F6VA 3F8CA 3RJPA 2GA2A 3H3UA 4U88A 1SMTA 1W7PD 4RS8A 2YPRA 3HRMA 3R60A 3GX4X 1LB2A 1LDDA 1H9TA 3SQNA 2MBFA 1ZN2A 2FBIA 4CHUA 2ADUA 5BS6A 1K78B 4LLLA 2H6BA 2QENA 3HYIA 3L9FA 4U0VA 2PMHA 3IHUA 5ICCA 3LSTA 4HOBA 4XLNF 1J9IA 1MJ9A 3KZZA 2AS5F 1WRJA 5F64A 2Q2EA 2CFXA 1DDNA 2C6YA 2RC4A 3L09A 3H3ZA 4RGSA 2EFWA 2DAOA 4Z2YA 4ENJA 2OA4A 2OZUA 2DU9A 1FZPB 3WTYC 4B09A 2OAZA 4QWQA 2HS5A 3F23A 3SZPA 1S29A 1LDKB 4ETSA 2GA1A 2A6HF 2HTSA 2PBIA 4WF2A 2GQQA 2XAHA 1FT9A 3TO7A 5K5RA 3LWFA 3DFGA 2A5YB 3WU1B 2JPCA 3V8JA 5CVIA 2XROA 1B6AA 4O6JA 4HLXA 3V7SA 4ENMA 2VBYA 2FXAA 4LD5A 5TRDA 5TJJA 4B8XA 3Q5FA 3QOPA 2QM3A 4BH9A 1W7PA 1WKMA 3KZYA 5E8GA 4JBAA 4MHGA 4M72A 1DPRA 3M8EA 2LKPA 3ECOA 2PI0A 5L3DA 1QPMA 3DEUA 1O57A 4CGZA 3TKYA 2Z9OA 4KN7X 2D1VA 2L02A 3ZPLA 3WTVC 1TNSA 4YFXF 4L0YB 2IA2A 1YLFA 2R3SA 5HLIA 3T8RA 1PUEE 2FRHA 5H6RA 1IN7A 1MGTA 4EGZA 4MGRA 2WC2A 3BZ6A 1FY7A 1QZYA 1KU2A 2O61A 3IL2A 2PQ8A 3FX3A 3K0LA 5L3BA 1JHHA 3WTTC 1IZ1A 3BPXA 3R0AA 3F8NA 5D8LB 4BHBA 4LGWA 4O5VA 4FT8A 4GXOA 4LB6B 4UHTA 4GYIA 1EH7A 4MQ9F 2BE5F 1GVJA 5CVJA 4MEYF 3FWEA 2EFPA 1O7FA 2DPDA 1YO5C 1DUXC 4FHTA 4I01A 2ISZA 2A68F 3K2ZA 2FNAA 3MWMA 5DEQA 3FHZA 4BHCA 4I0BA 4NB5A 2ZFWA 2Q8KA 2RN7A 1FYMA 4P5OA 1TW3A 1MDMA 3KLOA 3FMRA 3U1DA 4KYWA 1HSTA 4JK1X 4UVAA 2XKOA 3M9AA 5CYVA 1W5TA 3LA2A 2OBPA 2Y48A 1ZH5A 1G3WA 2EFNA 2LF7A 4A0YA 3HRTA 3GUDA 4G7HF 1HW1A 1ODDA 3I58A 5JR3A 1F1ZA 3KP7A 3P9IA 4UV8A 3DV8A 4ON0A 3TO6A 5D4RA 5L3GA 1SD6A 5AONA 4LK0F 3K69A 3WE2A 4MTDA 4OU0A 1FBQA 4KMFA 4KUMA 2E1NA 4H0EA 2DFIA 3GZ5A 2A07F 5K5QA 1D5VA 2WV0A 4Y13A 3L7WA 3HOTA 1GXQA 3JSPA 2IA1A 4OIPF 3DP7A 3QPHA 1J2XA 1BI2A 2VBWA 4IJAA 1IN6A 2ISYA 3FXRA 4Q47A 2P5VA 4CXFA 3QP5A 1RUNA 2XAQA 5FB2A 1YW7A 3T8TA 3TO9A 5DUIA 2ZKZA 4M9ZA 1S3JA 2JSCA 4BNCA 1BM9A 1S6LA 3T1BA 1Z05A 1XSVA 2VE8A 4R1HA 4RAZA 5LGTA 1SD7A 2FBKA 4EVIA 4PCQA 3TQNA 3I64A 4MTEA 4KIGA 2QQ9A 1OKRA 2ETHA 1CF7B 4A5MA 4M6XA 1X3UA 2KJBA 2W25A 5LRRA 2P6TA 5FO5A 4KIFA 3CTAA 4I98B 4L9JA 3RDIA 3TGNA 2J5OA 2FE3A 1RNLA 1YG2A 2HFHA 5F1RA 3COAC 2K02A 2CG4A 2BEOA 3V7CA 1MZBA 1T38A 1O3QA 2D45A 2XAFA 4UUVA 2O03A 3IWFA 4HA8A 4AIJA 4GCVA 1KQ0A 3N97A 1TW2A 3BY6A 4JQFA 1UHMA 4MNUA 2VOOA 1UFMA 4RB2C 3LAJA 3SHFA 2O3FA 3GLXA 4ESJA 4ENKA 2BBYA 3J81K 1A04A 2K4BA 4A12A 1XGMA 3W6JB 2VONA 1ZYRF 1FSHA 2FMLA 3HUGA 5ERIA 1XGNA 1TTYA 2FOKA 2VBXA 4S04A 3MAJA 3JW4A 3BJOA 4KMUX 3GZ6A 1MKMA 3I0TA 1B9NA 3GWZA 1I5ZA 1IXRC 1JGSA 2KKOA 1R00A 4L9NA 4HYEA 4EM1A 5HVQC 1IW7F 1RIOH 3WTWC 4O3MA 1IN8A 2EV0A 3HTUA 1J7KA 4BHPA 1ZG1A 1SFUA 2CO5A 2ZBKA 3F72A 5ILSA 3WTZA 3IRQA 5JFRA 4LLGF 3TDUC 1EH8A 3ZMSA 1ON1A 3I59A 3KP2A 2Y75A 2W85A 2QLZA 5ILVA 4P9FA 1ZLKA 3SZTA 5ED4A 4RB0A 1TNTA 1K79A 3HHHA 1FLIA 3R0JA 5FFZA 3JTGA 2IT0A 5LEKA 4LJZF 5DD4A 5A2QK 1G3TA 1TQMA 1R58A 3GF2A 5K1YA 4U0YA 1L3LA 5E18F 2IJLA 2Z3YA 5DCMA 2PN6A 2QWWA 2GWRA 1S8NA 3KP3A 4L9VA 3WTXC 1EH6A 4WXDA 1O7LA 3R6SA 4GO1A 3TOAA 4KDPA 4KICA 5FFXA 1J75A 2OZ6A 3TDZC 4YFKF 1R1TA 3F8FA 1HKTA 5IT9Z 2NYXA 3QP6A 1OMIA 5LGUA 3CO7C 4R8HA 4EMSA 5L3EA 4HX7A 2IRFG 3Q9SA 4IHTA 3QU3A 4I0AA 3F8BA 1KGSA 4LK1F 2EJRA 1ZGJA 3P9CA 1ZHFA 5D5WB 1ON2A 3BROA 4UVBA 3CLOA 2HKOA 4KA4A 2GXGA 3RTRA 2VC0A 1SD5A 3GFIA 4BQAA 2P8TA 1TLHB 3HSEA 3ZP5A 4XBFA 3JAMZ 1I1SA 3WE3A 3RYPA 3BP8A 1RI7A 1KYZA 5E1XA 3ZN1A 3GFLA 3V8LA 2IVMA 1FYKA 1R1UA 2VC1A 4U0WA 2PLYA 3MZHA 1UHWA 1B9MA 3RYRA 3O6BB 1E17A 1HBXG 3FF5A 2M45A 2EK5A 2H09A 2EFQA 2DQRA 4P9UA 1PP8F 2V79A 3WTUC 2E7XA 2G7UA 4A5NA 1DPUA 2CSOA 2HR3A 1U5TB 2EA4A 1T6SA 3B73A 4G8XA 1BJAA 1IXSB 3PQKA 3FMQA 5IT3A 1KU7A 1D8JA 1H0MA 4OIOF 2CWEA 2ZJ2A 5E20A 5CVVA 4IRHA 1CGPA 5ICFA 4YG2F 4XLPF 1I6XA 2M30A 5HDGA 1BIBA 1LJ9A 3PFIA 4M9SA 2EV5A 2XIGA 3ELKA 1LEAA 1XMKA 4N9IA 2K27A 5BPIA 1LQ1A 3T5XA 4ZYDA 4YFNF 4HW0A 4A0XA 2QZ8A 3CUQA 4HLYA 2WWYA 5IT9K 4HX8A 4XRFA 5J6XA 4HV6A 4EJTA 5CJ9A 1P4AA 2ELHA 5AIPA 3Q9VA 1TQPA 4RGUA 1RUOA 2UXNA 2XGXA 1NHAA 1HW2A 3S2WA 3REOA 3LAPA 3B02A 2ZNYA 2DK8A 4EGYA 3R4KA 4ZZLA 5HOOA 1R5HA 4N0BA 4RGXA 2BV6A 1XGSA 4WCGA 1U2WA 3HRSA 3RIRA 3F6OA 2E1CA 3JTHA 1FSEA 2HTJA 4ENNA 5D6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIQ F;  3FMS A;  3D5L A;  2ACJ A;  3J7A O;  1FWZ A;  2RQP A;  1J5Y A;  3I5U A;  4WXH A;  3R61 A;  3QU6 A;  1ULY A;  1ZRE A;  2YR2 A;  2F5C A;  1SFX A;  2IP2 A;  3ZMU A;  2MH2 A;  2LF8 A;  1K6O A;  1XB4 A;  1E2X A;  3IKT A;  4PGG A;  4BYY A;  1ZRF A;  2FMY A;  4N9H A;  5JI6 A;  1QGP A;  2FEZ A;  4L0Z B;  3C7J A;  1JHF A;  2Z5U A;  2DPU A;  4L5I A;  4YIF A;  2Z99 A;  4WXC A;  1ZRD A;  2HKX A;  3J80 Z;  5CVR A;  1Z9C A;  4U7D A;  5L3C A;  1KQ9 A;  3FM3 A;  1KQ8 A;  2QBY A;  5FD6 A;  5DYM A;  5HDN A;  1BOA A;  3ZMD A;  1OYY A;  2M1B A;  5J8F A;  2W24 A;  1STZ A;  2PEX A;  4M71 A;  2HQN A;  3HSR A;  4ESB A;  4UXN A;  2D1H A;  4HDU A;  1HKS A;  3VOE A;  5DUK A;  1ZRC A;  5D5X B;  1G3S A;  5FGM A;  2DLL A;  2MA3 A;  2O0Y A;  2P5L C;  1Q1H A;  3DKW A;  1BC7 C;  4A6E A;  3EQL F;  5E8I A;  2FSW A;  1WQ2 A;  2QUF A;  3E5U A;  2P7V B;  1HQC A;  4Y17 A;  5BOX A;  1QO0 D;  1SFE A;  5KVR A;  1F9N A;  1FNN A;  2GAU A;  1P92 A;  4HV5 A;  5F6F A;  4IVN A;  1RZ4 A;  4M9X A;  1P2F A;  1LVA A;  3LA7 A;  4LB5 A;  1B59 A;  2A61 A;  4DQ2 A;  3EDP A;  2F5D A;  1FPQ A;  4P96 A;  1U5T A;  2RKH A;  3AAF A;  3ML6 A;  5D8K B;  2JTV A;  5LEJ A;  3BJ6 A;  1FBU A;  2DQL A;  3RPU A;  3RI4 A;  3KP4 A;  1U78 A;  2F5F A;  2LDU A;  4LG0 B;  5JVT A;  5HS9 A;  5AIQ A;  3ABT A;  1OPC A;  2ZO4 A;  3KFW X;  1BI1 A;  1G6N A;  2XVC A;  1Y0U A;  2ZCW A;  3LQQ A;  1XCB A;  1H9G A;  5LHI A;  1OR7 A;  2HEO A;  5HDK A;  2ZNZ A;  1HXD A;  2L01 A;  2PFB A;  1YYV A;  3VB2 A;  4KFC A;  2G9W A;  4G9Y A;  5E1W A;  1FP1 D;  1W4M A;  4HAM A;  3KE2 A;  5D4S A;  3ZN0 A;  1F5T A;  4AIK A;  1S7O A;  2L4M A;  2XAG A;  5DCF A;  3NRV A;  2QBY B;  1KYW A;  4EM0 B;  2QQB A;  1SMY F;  4HZF A;  4HF0 A;  1MJB A;  2MH9 A;  3KLN A;  4K2E A;  4L9T A;  3E97 A;  2PG4 A;  1XD7 A;  3KET A;  4ZYE A;  1Z7U A;  1IRF A;  4LLN A;  4HF1 A;  3K9T A;  4MEX F;  2DO7 A;  1WWX A;  4R79 A;  2OQR A;  2P7C B;  4IF4 A;  1FBS A;  5H20 A;  2YX4 A;  5BMZ A;  2XAJ A;  2M87 A;  4RB3 C;  4HQE A;  3LA3 A;  4OIN F;  2IW5 A;  3HTS B;  3TOB A;  1YFH A;  5LHH A;  1XMA A;  1F4K A;  3DF8 A;  3T0Y A;  4M74 A;  5DD8 A;  3WGG A;  1Z6R A;  1R1V A;  4PZJ A;  1BI3 A;  2IPQ X;  4U7B A;  4MQV A;  4HBL A;  3QAH A;  3O2P E;  4XSX F;  5H6Q A;  2QYO A;  4HF2 A;  2ZME B;  2VE9 A;  3V8K A;  1ZGA A;  2O6G E;  2M8E A;  2KJC A;  2R7F A;  1USS A;  1BN5 A;  3F3X A;  1OYW A;  3IWZ A;  1KU3 A;  3WOD F;  3JAM K;  4LG0 A;  2HYF A;  3LQR A;  3KEQ A;  3EYY A;  1UB9 A;  1YW9 A;  1IXC A;  2IA0 A;  4CDG A;  1T98 A;  3GVA A;  1PDN C;  2XRN A;  1DP7 P;  2P5K A;  4IPA A;  1YW8 A;  3L00 A;  4GYG A;  4IRI A;  2H6C A;  4EJU A;  3ULQ B;  3E5Q A;  2K4J A;  2J5P A;  3CDH A;  1VTN C;  1T39 A;  3WTS C;  4AD9 A;  4D0P A;  2FF4 A;  5ICG A;  1W5S A;  1HSJ A;  1R36 A;  4L18 B;  3NEU A;  4OIR F;  1R5G A;  4F7Z A;  5ILU A;  1IAW A;  2FU4 A;  4DNC A;  2UZK A;  4EJV A;  3MFK A;  1MDM B;  3PQJ A;  2V1X A;  3BDD A;  4EM2 A;  1SD4 A;  3MZY A;  1K7A A;  1B4A A;  2JT1 A;  3I59 B;  4YII A;  1IN4 A;  2STT A;  1R22 A;  2X0L A;  2R7D A;  2FQ3 A;  4XSZ F;  5LGN A;  2O8X A;  2GZW A;  1G4D A;  3M1E A;  3MCZ A;  1XCV A;  2VOD A;  2VBZ A;  2W57 A;  2HQR A;  2V1D A;  4CYD A;  1FOK A;  3OV8 A;  3ZMZ A;  4ZH4 F;  1FC3 A;  2NS0 A;  4BXU A;  3P7N A;  4IRG A;  1BIA A;  2L54 A;  1O3R A;  1I27 A;  1GHC A;  4ZZD A;  1XDU A;  2DI3 A;  4OOI A;  1JXS A;  2L4A A;  3KCC A;  4AIH A;  4EJW A;  3GEZ A;  4FX4 A;  1AWC A;  1I1G A;  3QRF F;  4Q48 A;  2XKP A;  2VT2 A;  2YX7 A;  5CLS A;  3WU0 A;  5K5O A;  4G94 A;  1BI0 A;  2MD5 A;  2KIU A;  3E6D A;  4KN4 X;  4PGH A;  1IUY A;  3RKW A;  3MQ0 A;  2VOP A;  4AVP A;  1W7P B;  4WX9 A;  2ZXJ A;  2H94 A;  1J0R A;  3I71 A;  2Z33 A;  4KNY A;  4M6Y A;  1XDS A;  1FP2 A;  5FD5 A;  4IHS A;  3EUH A;  5HLG A;  3E5X A;  2NNY A;  4GGG A;  2CYY A;  2RGV A;  3VFZ A;  5DCM B;  5D5U B;  3L2C A;  2RVC A;  4G6D A;  1V3F A;  3ROU A;  3FM5 A;  1LNW A;  3ABU A;  1MJA A;  2AXL A;  2ESH A;  3KP5 A;  5LBQ A;  4EV0 A;  2YU3 A;  1ZLJ A;  5LRS A;  2D2W A;  4UVC A;  2OD5 A;  3J80 K;  3E6B A;  3IC7 A;  2OQG A;  3CO6 C;  1U6G A;  2DW4 A;  3V7R A;  1EV7 A;  3C18 A;  1Z1D A;  4IXA A;  2OU2 A;  5FLX K;  1KU9 A;  4KT5 C;  4Y15 A;  3EET A;  3VOD A;  4HDV A;  3DPL C;  3BWG A;  3ZMV A;  3RPQ A;  2RV8 A;  3M8F A;  1O3T A;  1XN7 A;  4A2U A;  3CUQ C;  1QZZ A;  5A2Q Z;  1P4W A;  3GXO A;  4ZYH A;  3HSF A;  1ZG5 A;  3NQO A;  3ZQ7 A;  3KEO A;  2STW A;  2QVO A;  3E3V A;  3WG9 A;  3D0S A;  3BJA A;  2H27 A;  4I7H A;  3CUQ B;  4ZYG A;  2XUB A;  4G7O F;  2DBB A;  3C1D A;  2PJP A;  1REP C;  1D8K A;  4KIB A;  2KIF A;  4ASN A;  2A69 F;  1QBJ A;  3WGI A;  3HOS A;  1V4R A;  5KK1 A;  2CQK A;  2K86 A;  3FXU A;  2ESN A;  2MLG A;  4NQW A;  1XSX A;  1CF7 A;  1OYI A;  2CW0 F;  3K1M A;  4CO8 A;  4BAY A;  3RKY A;  4Q5S F;  2F2E A;  4G7Z F;  2Q0O A;  2EB7 A;  3RKX A;  5DV5 A;  1ZAR A;  2DK5 A;  3P9K A;  3F21 A;  1S7A A;  2BGC A;  4UNO A;  3JSO A;  5D5V B;  2FBH A;  2DTR A;  2BYV E;  2E7W A;  4M73 A;  6PAX A;  1XSD A;  1BC8 C;  4L5J A;  4AWX B;  2JRT A;  2K7L A;  1YQA A;  3HIF A;  3WGH A;  2A6E F;  5E17 F;  1IRG A;  2LSO A;  1O3S A;  5JHU A;  3CJN A;  1ZAO A;  2GIV A;  2GXB A;  3I4P A;  3VEP A;  2HGC A;  2MC3 A;  2VN2 A;  3GYH X;  4FX0 A;  2HZT A;  2P6S A;  1P4X A;  3U2R A;  2X4H A;  1YS7 A;  3U9G A;  4LMY A;  4ESF A;  1Z6T A;  3O3K A;  1L0O C;  2A3S A;  5LHG A;  1TBX A;  2PMU A;  2M5W A;  1U8R A;  1SAX A;  3FZV A;  1WSU A;  3ZMT A;  4NHJ A;  2XAS A;  1AOY A;  1J59 A;  4I09 A;  5DDG A;  2EFO A;  1U3E M;  5ICE A;  1WI9 A;  5E1Z B;  2HOE A;  3K1P A;  4TV7 A;  5CVU A;  2JZY A;  2YSR A;  3FXQ A;  4EJO A;  2LNB A;  3GFM A;  3G3Z A;  4PDK A;  2B0L A;  1T0F A;  2RDP A;  1T2K A;  4E70 A;  3IRR A;  1BBY A;  2FNP A;  4HX4 A;  1QQI A;  2XHK A;  3V4G A;  1LEB A;  1Z91 A;  3MEX A;  3GO5 A;  1G3Y A;  4G6Q A;  2NNN A;  2V6C A;  2V1U A;  3DXJ F;  5BPD A;  3E6C C;  2W84 A;  1JE8 A;  2TDX A;  1FX7 A;  3IKV A;  2RNJ A;  2Y0M A;  4I02 A;  4Q4Z F;  2NRA C;  5J8C A;  2MLK A;  3E6M A;  3F22 A;  3GW2 A;  2G7H A;  2COM A;  3DPT A;  4A6D A;  1MD0 A;  3HHG A;  3G73 A;  1ONV A;  3CUO A;  4UV9 A;  2DT5 A;  4EQQ A;  1IF1 A;  2NAZ A;  3GFJ A;  1R7J A;  1K78 A;  2XV4 S;  4P55 A;  1FYL A;  3SXY A;  2VT3 A;  2L3D A;  2JPB A;  2V9V A;  4WWC A;  3BOQ A;  1YTY A;  3N4M A;  2FA5 A;  1HW5 A;  3H92 A;  2HYG D;  4I2O A;  5LLQ A;  3ECH A;  3HRU A;  2EV6 A;  3KP6 A;  3W6K B;  2UWM A;  5D6F A;  1UCR A;  2QQA A;  1TQI A;  5EEH A;  4RB1 A;  4LFU A;  1YIO A;  4WK8 F;  3LFK A;  1R23 A;  2KRF A;  2F5E A;  2VXZ A;  2EWN A;  1P6R A;  5L3F A;  4CIC A;  2CGP A;  1ZG3 A;  3J81 Z;  3M7G A;  2UXX A;  1HKQ A;  2HDC A;  3C3W A;  3F8M A;  2EA2 A;  5HS7 A;  4HQM A;  1UST A;  3EYI A;  2P4W A;  3ISP A;  4RGR A;  1XGO A;  1LDJ A;  1B1B A;  3SFZ A;  1D3Y A;  3BPV A;  3I54 A;  4OMY A;  1YS6 A;  5BQT A;  1U5T C;  5EEG A;  4A0Z A;  1QNT A;  2ZME A;  1PP7 U;  2HWV A;  5FLX Z;  3ERE D;  2WTE A;  4RAY A;  2KIM A;  1IN5 A;  4OMZ A;  1GXP A;  4CZZ A;  4S05 A;  3K1N A;  3I53 A;  1C0W A;  5HLH A;  3OOP A;  1KA8 A;  5HS8 A;  3QPT A;  4QLC U;  3DQV C;  3F6V A;  3F8C A;  3RJP A;  2GA2 A;  3H3U A;  4U88 A;  1SMT A;  1W7P D;  4RS8 A;  2YPR A;  3HRM A;  3R60 A;  3GX4 X;  1LB2 A;  1LDD A;  1H9T A;  3SQN A;  2MBF A;  1ZN2 A;  2FBI A;  4CHU A;  2ADU A;  5BS6 A;  1K78 B;  4LLL A;  2H6B A;  2QEN A;  3HYI A;  3L9F A;  4U0V A;  2PMH A;  3IHU A;  5ICC A;  3LST A;  4HOB A;  4XLN F;  1J9I A;  1MJ9 A;  3KZZ A;  2AS5 F;  1WRJ A;  5F64 A;  2Q2E A;  2CFX A;  1DDN A;  2C6Y A;  2RC4 A;  3L09 A;  3H3Z A;  4RGS A;  2EFW A;  2DAO A;  4Z2Y A;  4ENJ A;  2OA4 A;  2OZU A;  2DU9 A;  1FZP B;  3WTY C;  4B09 A;  2OAZ A;  4QWQ A;  2HS5 A;  3F23 A;  3SZP A;  1S29 A;  1LDK B;  4ETS A;  2GA1 A;  2A6H F;  2HTS A;  2PBI A;  4WF2 A;  2GQQ A;  2XAH A;  1FT9 A;  3TO7 A;  5K5R A;  3LWF A;  3DFG A;  2A5Y B;  3WU1 B;  2JPC A;  3V8J A;  5CVI A;  2XRO A;  1B6A A;  4O6J A;  4HLX A;  3V7S A;  4ENM A;  2VBY A;  2FXA A;  4LD5 A;  5TRD A;  5TJJ A;  4B8X A;  3Q5F A;  3QOP A;  2QM3 A;  4BH9 A;  1W7P A;  1WKM A;  3KZY A;  5E8G A;  4JBA A;  4MHG A;  4M72 A;  1DPR A;  3M8E A;  2LKP A;  3ECO A;  2PI0 A;  5L3D A;  1QPM A;  3DEU A;  1O57 A;  4CGZ A;  3TKY A;  2Z9O A;  4KN7 X;  2D1V A;  2L02 A;  3ZPL A;  3WTV C;  1TNS A;  4YFX F;  4L0Y B;  2IA2 A;  1YLF A;  2R3S A;  5HLI A;  3T8R A;  1PUE E;  2FRH A;  5H6R A;  1IN7 A;  1MGT A;  4EGZ A;  4MGR A;  2WC2 A;  3BZ6 A;  1FY7 A;  1QZY A;  1KU2 A;  2O61 A;  3IL2 A;  2PQ8 A;  3FX3 A;  3K0L A;  5L3B A;  1JHH A;  3WTT C;  1IZ1 A;  3BPX A;  3R0A A;  3F8N A;  5D8L B;  4BHB A;  4LGW A;  4O5V A;  4FT8 A;  4GXO A;  4LB6 B;  4UHT A;  4GYI A;  1EH7 A;  4MQ9 F;  2BE5 F;  1GVJ A;  5CVJ A;  4MEY F;  3FWE A;  2EFP A;  1O7F A;  2DPD A;  1YO5 C;  1DUX C;  4FHT A;  4I01 A;  2ISZ A;  2A68 F;  3K2Z A;  2FNA A;  3MWM A;  5DEQ A;  3FHZ A;  4BHC A;  4I0B A;  4NB5 A;  2ZFW A;  2Q8K A;  2RN7 A;  1FYM A;  4P5O A;  1TW3 A;  1MDM A;  3KLO A;  3FMR A;  3U1D A;  4KYW A;  1HST A;  4JK1 X;  4UVA A;  2XKO A;  3M9A A;  5CYV A;  1W5T A;  3LA2 A;  2OBP A;  2Y48 A;  1ZH5 A;  1G3W A;  2EFN A;  2LF7 A;  4A0Y A;  3HRT A;  3GUD A;  4G7H F;  1HW1 A;  1ODD A;  3I58 A;  5JR3 A;  1F1Z A;  3KP7 A;  3P9I A;  4UV8 A;  3DV8 A;  4ON0 A;  3TO6 A;  5D4R A;  5L3G A;  1SD6 A;  5AON A;  4LK0 F;  3K69 A;  3WE2 A;  4MTD A;  4OU0 A;  1FBQ A;  4KMF A;  4KUM A;  2E1N A;  4H0E A;  2DFI A;  3GZ5 A;  2A07 F;  5K5Q A;  1D5V A;  2WV0 A;  4Y13 A;  3L7W A;  3HOT A;  1GXQ A;  3JSP A;  2IA1 A;  4OIP F;  3DP7 A;  3QPH A;  1J2X A;  1BI2 A;  2VBW A;  4IJA A;  1IN6 A;  2ISY A;  3FXR A;  4Q47 A;  2P5V A;  4CXF A;  3QP5 A;  1RUN A;  2XAQ A;  5FB2 A;  1YW7 A;  3T8T A;  3TO9 A;  5DUI A;  2ZKZ A;  4M9Z A;  1S3J A;  2JSC A;  4BNC A;  1BM9 A;  1S6L A;  3T1B A;  1Z05 A;  1XSV A;  2VE8 A;  4R1H A;  4RAZ A;  5LGT A;  1SD7 A;  2FBK A;  4EVI A;  4PCQ A;  3TQN A;  3I64 A;  4MTE A;  4KIG A;  2QQ9 A;  1OKR A;  2ETH A;  1CF7 B;  4A5M A;  4M6X A;  1X3U A;  2KJB A;  2W25 A;  5LRR A;  2P6T A;  5FO5 A;  4KIF A;  3CTA A;  4I98 B;  4L9J A;  3RDI A;  3TGN A;  2J5O A;  2FE3 A;  1RNL A;  1YG2 A;  2HFH A;  5F1R A;  3COA C;  2K02 A;  2CG4 A;  2BEO A;  3V7C A;  1MZB A;  1T38 A;  1O3Q A;  2D45 A;  2XAF A;  4UUV A;  2O03 A;  3IWF A;  4HA8 A;  4AIJ A;  4GCV A;  1KQ0 A;  3N97 A;  1TW2 A;  3BY6 A;  4JQF A;  1UHM A;  4MNU A;  2VOO A;  1UFM A;  4RB2 C;  3LAJ A;  3SHF A;  2O3F A;  3GLX A;  4ESJ A;  4ENK A;  2BBY A;  3J81 K;  1A04 A;  2K4B A;  4A12 A;  1XGM A;  3W6J B;  2VON A;  1ZYR F;  1FSH A;  2FML A;  3HUG A;  5ERI A;  1XGN A;  1TTY A;  2FOK A;  2VBX A;  4S04 A;  3MAJ A;  3JW4 A;  3BJO A;  4KMU X;  3GZ6 A;  1MKM A;  3I0T A;  1B9N A;  3GWZ A;  1I5Z A;  1IXR C;  1JGS A;  2KKO A;  1R00 A;  4L9N A;  4HYE A;  4EM1 A;  5HVQ C;  1IW7 F;  1RIO H;  3WTW C;  4O3M A;  1IN8 A;  2EV0 A;  3HTU A;  1J7K A;  4BHP A;  1ZG1 A;  1SFU A;  2CO5 A;  2ZBK A;  3F72 A;  5ILS A;  3WTZ A;  3IRQ A;  5JFR A;  4LLG F;  3TDU C;  1EH8 A;  3ZMS A;  1ON1 A;  3I59 A;  3KP2 A;  2Y75 A;  2W85 A;  2QLZ A;  5ILV A;  4P9F A;  1ZLK A;  3SZT A;  5ED4 A;  4RB0 A;  1TNT A;  1K79 A;  3HHH A;  1FLI A;  3R0J A;  5FFZ A;  3JTG A;  2IT0 A;  5LEK A;  4LJZ F;  5DD4 A;  5A2Q K;  1G3T A;  1TQM A;  1R58 A;  3GF2 A;  5K1Y A;  4U0Y A;  1L3L A;  5E18 F;  2IJL A;  2Z3Y A;  5DCM A;  2PN6 A;  2QWW A;  2GWR A;  1S8N A;  3KP3 A;  4L9V A;  3WTX C;  1EH6 A;  4WXD A;  1O7L A;  3R6S A;  4GO1 A;  3TOA A;  4KDP A;  4KIC A;  5FFX A;  1J75 A;  2OZ6 A;  3TDZ C;  4YFK F;  1R1T A;  3F8F A;  1HKT A;  5IT9 Z;  2NYX A;  3QP6 A;  1OMI A;  5LGU A;  3CO7 C;  4R8H A;  4EMS A;  5L3E A;  4HX7 A;  2IRF G;  3Q9S A;  4IHT A;  3QU3 A;  4I0A A;  3F8B A;  1KGS A;  4LK1 F;  2EJR A;  1ZGJ A;  3P9C A;  1ZHF A;  5D5W B;  1ON2 A;  3BRO A;  4UVB A;  3CLO A;  2HKO A;  4KA4 A;  2GXG A;  3RTR A;  2VC0 A;  1SD5 A;  3GFI A;  4BQA A;  2P8T A;  1TLH B;  3HSE A;  3ZP5 A;  4XBF A;  3JAM Z;  1I1S A;  3WE3 A;  3RYP A;  3BP8 A;  1RI7 A;  1KYZ A;  5E1X A;  3ZN1 A;  3GFL A;  3V8L A;  2IVM A;  1FYK A;  1R1U A;  2VC1 A;  4U0W A;  2PLY A;  3MZH A;  1UHW A;  1B9M A;  3RYR A;  3O6B B;  1E17 A;  1HBX G;  3FF5 A;  2M45 A;  2EK5 A;  2H09 A;  2EFQ A;  2DQR A;  4P9U A;  1PP8 F;  2V79 A;  3WTU C;  2E7X A;  2G7U A;  4A5N A;  1DPU A;  2CSO A;  2HR3 A;  1U5T B;  2EA4 A;  1T6S A;  3B73 A;  4G8X A;  1BJA A;  1IXS B;  3PQK A;  3FMQ A;  5IT3 A;  1KU7 A;  1D8J A;  1H0M A;  4OIO F;  2CWE A;  2ZJ2 A;  5E20 A;  5CVV A;  4IRH A;  1CGP A;  5ICF A;  4YG2 F;  4XLP F;  1I6X A;  2M30 A;  5HDG A;  1BIB A;  1LJ9 A;  3PFI A;  4M9S A;  2EV5 A;  2XIG A;  3ELK A;  1LEA A;  1XMK A;  4N9I A;  2K27 A;  5BPI A;  1LQ1 A;  3T5X A;  4ZYD A;  4YFN F;  4HW0 A;  4A0X A;  2QZ8 A;  3CUQ A;  4HLY A;  2WWY A;  5IT9 K;  4HX8 A;  4XRF A;  5J6X A;  4HV6 A;  4EJT A;  5CJ9 A;  1P4A A;  2ELH A;  5AIP A;  3Q9V A;  1TQP A;  4RGU A;  1RUO A;  2UXN A;  2XGX A;  1NHA A;  1HW2 A;  3S2W A;  3REO A;  3LAP A;  3B02 A;  2ZNY A;  2DK8 A;  4EGY A;  3R4K A;  4ZZL A;  5HOO A;  1R5H A;  4N0B A;  4RGX A;  2BV6 A;  1XGS A;  4WCG A;  1U2W A;  3HRS A;  3RIR A;  3F6O A;  2E1C A;  3JTH A;  1FSE A;  2HTJ A;  4ENN A;  5D6E A; 
#chains in the Genus database with same CATH topology
 3BR1 A;  4OIQ F;  3FMS A;  5M5Y J;  3D5L A;  3PO3 J;  2DA1 A;  2ACJ A;  3O8G A;  2M4G A;  3J7A O;  1FWZ A;  2RQP A;  1J5Y A;  3I5U A;  2YS9 A;  4WXH A;  3R61 A;  3QU6 A;  2CFO A;  1D1A A;  3UKG A;  1ULY A;  4IO9 F;  2YR2 A;  1ZRE A;  2F5C A;  1OCT C;  1SFX A;  2IP2 A;  3ZMU A;  2MH2 A;  2LF8 A;  1K6O A;  1XB4 A;  1E2X A;  3SEZ A;  3IKT A;  4PGG A;  1YHQ I;  4FCY A;  2QQ8 A;  3KEY A;  4BYY A;  2EZK A;  2LKX A;  1QZE A;  4XOR A;  1V5G A;  1V55 H;  2PX9 A;  2FMY A;  1ZRF A;  2IGO A;  2LY2 A;  3G1O A;  1VQ7 I;  5LD2 C;  4N9H A;  5JI6 A;  4FAS D;  1QGP A;  2FEZ A;  2M9H A;  1X4P A;  1JHF A;  3C7J A;  3E0J B;  4L0Z B;  2Z5U A;  2DPU A;  1OJL A;  4E7J A;  4L5I A;  3PIO F;  3W2A A;  4YIF A;  1BA5 A;  1WHU A;  2Z99 A;  4WXC A;  3ZQL A;  1ZRD A;  5JLX A;  1A5J A;  1WGX A;  2HKX A;  4J00 A;  2HNH A;  3FKI J;  3J80 Z;  2L7K A;  5CVR A;  1Z9C A;  3MN2 A;  3JRG A;  1FTZ A;  3WHC A;  3ZQF A;  4U7D A;  1HF0 A;  2VPL A;  4B4C A;  1KON A;  5L3C A;  2JVG A;  1KQ9 A;  3FM3 A;  4AC0 A;  1KQ8 A;  2JRM A;  2QBY A;  4XON A;  3FK7 A;  1M1E B;  3DBH B;  5FD6 A;  3BT9 A;  2KQR A;  2DCE A;  5DYM A;  3L2U A;  1Y1V J;  1N75 A;  1ETW A;  1Y1W J;  1N77 A;  1D5Y A;  1X1C A;  5HDN A;  1BOA A;  3KIO A;  3ZMD A;  4XIC A;  1OYY A;  1ZEL A;  2L9R A;  3OR1 C;  2M1B A;  3PIP F;  2KRH A;  1YIT I;  3AG2 H;  5J8F A;  1RKT A;  4LOC A;  3H36 A;  2W24 A;  1STZ A;  3BG3 A;  3CME I;  2PEX A;  4M71 A;  2W1O A;  2HQN A;  3ZGK A;  1EJ9 A;  1VQK I;  3HSR A;  4ESB A;  4UXN A;  2D1H A;  4HDU A;  2HXO A;  1B72 B;  3RQI A;  3LSM A;  3BG9 A;  3ZQI A;  4A3I J;  2QCO A;  1HKS A;  3M4O J;  2VQC A;  3VOE A;  5DUK A;  2L9N A;  1ZRC A;  4XID A;  5D5X B;  1V5E A;  3VYU B;  2JA2 A;  4JX6 A;  1G3S A;  2L9V A;  2W48 A;  4BXX J;  5FGM A;  1DGR M;  4OAY A;  2CW8 A;  2DLL A;  3HL2 A;  2MA3 A;  2O0Y A;  4PJM A;  2P5L C;  4UB8 C;  3RPU D;  1Q1H A;  3DKW A;  4ITV A;  1BC7 C;  4A6E A;  2CQ7 A;  3EQL F;  3LNQ A;  1SEU A;  4N4N B;  5E8I A;  2FSW A;  1WQ2 A;  2QUF A;  3PUB A;  1WI3 A;  2DFF A;  1D0Z A;  2AQF A;  5FKM A;  3E5U A;  1VFC A;  2P7V B;  2JK3 A;  5GTI C;  1ZTR A;  1OCC H;  1HQC A;  5E3L A;  3DWL E;  4Y17 A;  3IV5 A;  5BOX A;  1QO0 D;  1SFE A;  5KVR A;  2MGQ A;  5HNH A;  4A3B J;  1B8I B;  1F9N A;  1FNN A;  2GAU A;  1XC5 A;  2LK2 A;  2JA7 J;  1P92 A;  4N4O B;  3OL3 A;  4HV5 A;  5F6F A;  4IVN A;  1RZ4 A;  4BDZ A;  5GPA A;  4M9X A;  1P2F A;  2KIQ A;  2UUZ A;  2X1C A;  4JYK A;  1LVA A;  3K4L A;  2CRG A;  3LA7 A;  4LB5 A;  4ZDL A;  1HC8 A;  1B59 A;  2A61 A;  2D5V A;  4DQ2 A;  3BQY A;  3EDP A;  2F5D A;  1FPQ A;  3BG7 A;  4P96 A;  2DYS H;  3BLY A;  1U5T A;  2RKH A;  3AAF A;  3OWT A;  4B3X A;  3ML6 A;  3KX2 A;  4IKF A;  5D8K B;  5FKO A;  3VDX A;  2H1L A;  2JTV A;  2UV1 A;  5LEJ A;  3BJ6 A;  1FBU A;  4B43 A;  1JUP A;  2DQL A;  3GTO J;  1WJE A;  3RPU A;  3RI4 A;  3WU2 C;  3KP4 A;  1U78 A;  2F5F A;  2LDU A;  3SJM A;  4LG0 B;  5JVT A;  2WB1 A;  5HS9 A;  5AIQ A;  3CQZ J;  2M3A A;  3ABT A;  2XGE A;  1ENH A;  1X1B A;  4MIM A;  1OPC A;  2ZO4 A;  3S16 J;  4DYR A;  3KFW X;  1NG7 A;  5B5E C;  1ITY A;  1BI1 A;  3OMY A;  3OSG A;  1G6N A;  1VQP I;  1D1B A;  5IYD J;  3CJT B;  3PFY A;  2XVC A;  1Y0U A;  5BNG A;  2ZCW A;  2COB A;  3S1N J;  2HI3 A;  3LQQ A;  1XCB A;  1H9G A;  4A3L J;  5LHI A;  1OR7 A;  4HNV A;  2HEO A;  5HDK A;  2ZNZ A;  1JT6 A;  1HXD A;  1YIJ I;  2QSG X;  2IGM A;  2L01 A;  1D0X A;  2H1K A;  2PFB A;  1DGW Y;  1YYV A;  3DCF A;  3VB2 A;  3G6E I;  5E3N A;  3A2K A;  4KFC A;  3BG5 A;  1CQT A;  2G9W A;  4G9Y A;  5E1W A;  5KAF C;  1JUS A;  1FP1 D;  1W4M A;  4HAM A;  3H3V K;  1S5L C;  1MIJ A;  3KE2 A;  5D4S A;  4HNU A;  3ZN0 A;  3K7A J;  1F5T A;  2L7Z A;  4AIK A;  1S7O A;  2L4M A;  2XAG A;  5DCF A;  3NRV A;  2QBY B;  4Z6Y A;  1KYW A;  2BZT A;  2EIM H;  4EM0 B;  3EUK L;  2QQB A;  3HOV J;  1Y39 A;  2E1M C;  2WBM A;  1SMY F;  1JGG A;  3DLL F;  2JUC A;  4HZF A;  4HF0 A;  4U87 A;  1MJB A;  2MH9 A;  3KLN A;  3RSN A;  3MD2 A;  4K2E A;  4XR6 A;  4BY1 J;  4L9T A;  3K4K A;  3E97 A;  2PG4 A;  3QOD A;  1E0E A;  2DOF A;  1XD7 A;  1E3O C;  4XLC A;  5C3E J;  1K4T A;  2WAD A;  2X1D A;  3KET A;  1IJW C;  4ZYE A;  1NTC A;  1Z7U A;  2VQG A;  1UMQ A;  1IRF A;  2V1N A;  4RBO A;  1IV8 A;  4XN0 A;  4LLN A;  2IXS A;  4HF1 A;  1WFX A;  2EZH A;  1Y0N A;  3Q0W A;  2VJJ A;  3OYC A;  3K9T A;  4RM3 A;  4MEX F;  2XGD A;  4DBQ A;  3N05 A;  1U0J A;  2DO7 A;  1WWX A;  3L2R A;  3FBN B;  4R79 A;  2OQR A;  3A01 B;  2O5R A;  2P7C B;  1TWF J;  2K9S A;  4IF4 A;  1FBS A;  5H20 A;  3B6C A;  3I9V 2;  1K61 A;  3JRF A;  2KP6 A;  1O4X A;  1IDY A;  2YX4 A;  5BMZ A;  2XAJ A;  3HBL A;  2M87 A;  4RB3 C;  3ZQG A;  2ZXH A;  3OS2 A;  2MD0 A;  2EZI A;  4HQE A;  3LA3 A;  4OIN F;  1OLT A;  2Y0S A;  1T33 A;  2IW5 A;  1VQ8 I;  2R7V A;  1D1C A;  1K83 J;  2I8D A;  2NXN B;  3TOB A;  1YFH A;  3HTS B;  5LHH A;  2B7E A;  1XMA A;  2DDB A;  5IP6 A;  1F4K A;  3ASO H;  2A5W A;  3DF8 A;  3T0Y A;  2MW8 A;  4M74 A;  2TRT A;  5DD8 A;  5M5W J;  3WGG A;  5C4J J;  2VAS A;  2R92 J;  1Z6R A;  3L2V A;  1R1V A;  5KNL A;  1K6Y A;  2E34 A;  1ETY A;  4PZJ A;  3NAR A;  1BI3 A;  5EEA A;  2IPQ X;  5J1U A;  2ID6 A;  4U7B A;  4C3J J;  2VKD A;  3K70 C;  2DA7 A;  3JR9 A;  4MQV A;  2JVH A;  4HBL A;  3HOY J;  2R4G A;  3FXK A;  3QAH A;  3O2P E;  4XSX F;  2K9Q A;  1FEX A;  5H6Q A;  2QYO A;  1Y6I A;  4HF2 A;  2ZME B;  2VE9 A;  2X1E A;  1JKO C;  3V8K A;  2JUG A;  1VQM I;  1ZGA A;  2R5Y B;  2O6G E;  4XM3 A;  4BDY A;  2M8E A;  2KJC A;  2R7F A;  2E2J J;  2DXI A;  3JCU C;  1USS A;  1BN5 A;  3F3X A;  1OYW A;  2ZXI A;  3IWZ A;  1KU3 A;  4RMN A;  3WOD F;  3JAM K;  3W6V A;  5FRM A;  4LG0 A;  1U8B A;  2HYF A;  4YEJ A;  3LQR A;  4CCN A;  1MMN A;  4J19 A;  3KEQ A;  2X48 A;  3EYY A;  1UB9 A;  2L7F P;  1WZ2 A;  2DYR H;  1YW9 A;  4PJ0 C;  1IXC A;  3OYK A;  2IA0 A;  2JSP A;  4CDG A;  1T98 A;  4C3I J;  1LUJ B;  3GVA A;  4DJA A;  1PDN C;  2XRN A;  2BOL A;  1DP7 P;  2P5K A;  4IPA A;  1YW8 A;  4UY8 I;  1A36 A;  3BR5 A;  2VPR A;  3L00 A;  4GYG A;  2G0E A;  2I5U A;  1TWA J;  2H6C A;  4EJU A;  2PJR B;  4IRI A;  3JRC A;  4P1W A;  4IHX A;  2WY7 Q;  1W5C C;  3ULQ B;  3E5Q A;  1TZL A;  2K4J A;  2ELK A;  2J5P A;  5F0C A;  3CDH A;  3B6A A;  1VTN C;  1T39 A;  5LFA A;  3WTS C;  2AQE A;  2K9N A;  4AD9 A;  4D0P A;  3JRB A;  3M3Y J;  4G6T B;  2W00 A;  2ZSI B;  2FF4 A;  2QEX I;  2DMU A;  2KZV A;  5ICG A;  1W5S A;  1HSJ A;  3O8H A;  4Y33 A;  3TP0 A;  1Y8Q B;  3G2B A;  1R36 A;  4L18 B;  1NH3 A;  2L7M P;  1W1W E;  2HVQ A;  2QA4 I;  3NEU A;  1BR1 A;  3BR0 A;  4OIR F;  1R5G A;  4F7Z A;  5ILU A;  2XSD C;  2FU4 A;  1MBG A;  4DNC A;  1IAW A;  4IQ4 A;  3I3L A;  2UZK A;  4EJV A;  5B66 C;  3MFK A;  2R0Q C;  1MDM B;  2HYJ A;  5GAD J;  3PQJ A;  2V1X A;  3FK6 A;  3BDD A;  4L5E A;  4EM2 A;  1SD4 A;  3MZY A;  4V2F A;  4BQQ A;  1K7A A;  1B4A A;  2JT1 A;  3I59 B;  4YII A;  3K2A A;  1IN4 A;  3FDY A;  1XX5 A;  2ZSH B;  5F1J A;  2STT A;  3MZ8 A;  1R22 A;  4XLH A;  1TL8 A;  4FTH A;  3JRA A;  1RR7 A;  3PSF A;  2ID3 A;  2X0L A;  2R7D A;  1TP4 A;  1SVL A;  4BBR J;  3HKZ N;  2FQ3 A;  1VZ0 A;  3CJR B;  2BVL A;  4GDF A;  4XSZ F;  5LGN A;  2O8X A;  1MMD A;  3HOX J;  3HUG B;  2GZW A;  2E35 A;  4XN3 A;  1G4D A;  1Z3Y A;  3ZQQ A;  1KZH A;  3M1E A;  3MCZ A;  1SFO J;  1XCV A;  5J4V A;  2VOD A;  3HGY A;  3LSG A;  2VBZ A;  2W57 A;  2HQR A;  2V1D A;  4CYD A;  4D7M A;  1FOK A;  3M07 A;  3OV8 A;  2DMQ A;  4NC8 A;  5F0H A;  3MKZ A;  3ZMZ A;  4ZH4 F;  1FC3 A;  2NS0 A;  4BXU A;  3P7N A;  4IRG A;  2MG4 A;  1BIA A;  2L54 A;  1YOV B;  3S3N A;  1O3R A;  1I27 A;  2WV1 A;  1GHC A;  1NG6 A;  2QSF X;  4ZZD A;  1XDU A;  2KPM A;  3CD6 I;  2DI3 A;  4OOI A;  1JXS A;  2L4A A;  4BAC A;  3KCC A;  4AIH A;  4EJW A;  3GEZ A;  4FX4 A;  2OCC H;  1AWC A;  3S1Q J;  2IS6 A;  1TT5 B;  2BHY A;  3J7Y J;  1I1G A;  3KYC B;  3PSI A;  3QRF F;  4Q48 A;  5FJ8 J;  2XKP A;  2VJ4 A;  2VT2 A;  2YX7 A;  5CLS A;  1HCR A;  2ZJR F;  3WU0 A;  5K5O A;  3QYE A;  1BI0 A;  4G94 A;  2MD5 A;  2KIU A;  2HPM A;  3E6D A;  4KN4 X;  4PGH A;  4PK4 A;  1IUY A;  1ZKG A;  3RKW A;  3MQ0 A;  1QA6 A;  4ZYA A;  2VOP A;  4AVP A;  3J7Z I;  1W7P B;  4WX9 A;  2ZXJ A;  2H94 A;  3TW7 A;  1J0R A;  2JQ7 A;  2R5Z B;  1YJW I;  2NVY J;  5JLW A;  3I71 A;  2Q1Z B;  2Z33 A;  4KNY A;  2Q2E B;  4M6Y A;  1XDS A;  1FP2 A;  1A6I A;  5FD5 A;  4IHS A;  2OTL I;  3A01 A;  3EUH A;  5HLG A;  5FLV A;  3C2B A;  2HDW A;  2OJE D;  3S15 J;  3E5X A;  3TED A;  2NNY A;  4GGG A;  1MSF C;  2CYY A;  2A05 A;  2RGV A;  3H5A A;  1ZR4 A;  3VFZ A;  5DCM B;  5D5U B;  3L2C A;  1T8I A;  2RVC A;  2N8G A;  4G6D A;  1V3F A;  3ROU A;  2DA6 A;  3FM5 A;  1X1P A;  1LNW A;  3L1P A;  3ABU A;  1MJA A;  5DS9 A;  2AXL A;  2Y9Z A;  3WHB A;  2ESH A;  3KP5 A;  3E7L A;  5LBQ A;  4EV0 A;  3AG1 H;  2YU3 A;  1ZLJ A;  3OYB A;  5LRS A;  2D2W A;  1F36 A;  2OD5 A;  4UVC A;  3J80 K;  3E6B A;  2Z2S B;  3IC7 A;  4II2 A;  4C2M J;  2OQG A;  3CO6 C;  1U6G A;  2DW4 A;  3V7R A;  3MKW B;  1EV7 A;  2MC4 A;  3C18 A;  1ERD A;  3TBI A;  1Z1D A;  4IXA A;  4YIR X;  3CMA I;  2OU2 A;  4HG2 A;  5FLX K;  3KPH A;  1KU9 A;  3NAU A;  2LG4 A;  4KT5 C;  2GLO A;  4C2U A;  3H5R A;  1QVT A;  3EET A;  3MMY B;  4Y15 A;  3VOD A;  5HLT A;  4HDV A;  1PVE A;  3DPL C;  3BWG A;  3ZMV A;  3RPQ A;  2K85 A;  4FET A;  2R5Z A;  3IH3 A;  2RV8 A;  3M8F A;  1O3T A;  1XN7 A;  4A2U A;  1E3P A;  5KAI C;  3CUQ C;  1R71 A;  4CYC A;  1QZZ A;  3BR6 A;  2E5N A;  5A2Q Z;  1P4W A;  3GXO A;  4ZYH A;  2IBD A;  3HSF A;  3DEE A;  1ZG5 A;  3NQO A;  3GME A;  1EA3 A;  3ZQ7 A;  2LTP A;  3BZC A;  3KEO A;  2QVO A;  3E3V A;  2STW A;  3F9K A;  3WG9 A;  3D0S A;  2YU9 J;  3BJA A;  3OYF A;  1FTT A;  3OYN A;  5E3O A;  2H27 A;  4I7H A;  3HB9 A;  3NWT A;  3CUQ B;  3L2W A;  4ZYG A;  4AYB N;  2XUB A;  4G7O F;  1ZQ3 P;  5TIS C;  2DBB A;  3C1D A;  3DPU A;  2PJP A;  1REP C;  2LY9 A;  3H0G J;  2DFH A;  1D8K A;  4QIW N;  4KIB A;  1J09 A;  2AHQ A;  4IHW A;  2F4O B;  2FJ1 A;  2KIF A;  4ASN A;  2A69 F;  1QBJ A;  3P5J A;  3BR2 A;  3IP4 B;  3WGI A;  3HOS A;  1JJ8 C;  1V4R A;  5KK1 A;  3OOU A;  2TCT A;  2CQK A;  2K86 A;  4ZC3 A;  3FXU A;  2XB0 X;  2R7W A;  2ESN A;  4XLA A;  2KZG A;  4E7Z A;  2MLG A;  1DU0 A;  4KIT B;  4NQW A;  3G4S I;  2FOW A;  1XSX A;  1FJL A;  1CF7 A;  1X1A A;  1A31 A;  2E71 A;  5HOD A;  1OYI A;  1MBE A;  2CQN A;  3FBI B;  2CW0 F;  3K1M A;  4CO8 A;  4BAY A;  3RKY A;  4Q5S F;  2F2E A;  1IRX A;  4FE4 A;  4G7Z F;  2Q0O A;  2VIX A;  3ONQ A;  4PFP A;  3BZK A;  4BGD A;  3ABL H;  1R6R A;  3EPZ A;  2EB7 A;  4AM3 A;  3RKX A;  1IG7 A;  5J4Y A;  5DV5 A;  5HNF A;  3IAS 2;  1ZAR A;  2DK5 A;  3P9K A;  4XKB A;  1R4N B;  2KMU A;  3F21 A;  3GTP J;  1S7A A;  2BGC A;  2AO9 A;  4UNO A;  3JSO A;  1A35 A;  4E6K G;  2DJN A;  4JOM A;  5D5V B;  2FBH A;  4XL9 A;  4A69 C;  2CV2 A;  2CV0 A;  2DTR A;  3VWB A;  2BYV E;  2CUJ A;  2E7W A;  4M73 A;  6PAX A;  4PSX A;  1FIP A;  1RET A;  1XSD A;  1BC8 C;  1SVO A;  4BE0 A;  4L5J A;  1OCZ H;  4AWX B;  2JRT A;  2K7L A;  3M8J A;  1YQA A;  3HIF A;  2Z16 A;  3WGH A;  4B48 A;  2A6E F;  4DBR A;  4CA0 A;  5E17 F;  1IRG A;  2LSO A;  2R7S A;  3ZR8 X;  1O3S A;  5JHU A;  2QKM B;  3CJN A;  1UG0 A;  1ZAO A;  2GIV A;  2GXB A;  1ACI A;  3I4P A;  3VEP A;  2HGC A;  2MC3 A;  2VN2 A;  1LE8 A;  4XLE A;  3GYH X;  3HPG A;  2LVS A;  2VQL A;  4FX0 A;  2VL8 A;  2HZT A;  2P6S A;  1P4X A;  3U2R A;  5CQG A;  2X4H A;  1YS7 A;  3U9G A;  4LMY A;  4ESF A;  4D5F A;  3JRH A;  1Z6T A;  3O3K A;  2EIL H;  1L0O C;  2A3S A;  2OC6 A;  2VQH A;  5LHG A;  2HDD A;  1TBX A;  3BTI A;  1PJR A;  1SAN A;  2M5W A;  2PMU A;  1U8R A;  3HKZ A;  3FXJ A;  1WJB A;  1SAX A;  2VXD A;  3FZV A;  3AG4 H;  2JA5 J;  2E1O A;  1WSU A;  3ZMT A;  4NHJ A;  1B72 A;  2XAS A;  4DYQ A;  1AOY A;  3CDI A;  1J59 A;  2HOT A;  4I09 A;  5DDG A;  2EFO A;  2Y9Y A;  1QU3 A;  1U3E M;  2DT6 A;  3A1Y A;  4G12 A;  5ICE A;  1WI9 A;  5E1Z B;  1UEL B;  2IS1 A;  3DU6 A;  2HOE A;  2W4S A;  2NS8 A;  3K1P A;  4MFE A;  4TV7 A;  5CVU A;  3VYS B;  2JZY A;  2E1M B;  2YSR A;  1AKH A;  3FXQ A;  4EJO A;  2O9L A;  2LNB A;  3D5R C;  4B1R A;  4S0H B;  3GFM A;  3G3Z A;  4PDK A;  2B0L A;  1Y56 A;  1AU7 A;  2NOG A;  1I39 A;  2E5Z A;  1T0F A;  2RDP A;  2XF6 A;  1T2K A;  4E70 A;  3IRR A;  1BBY A;  2HVR A;  2PMZ N;  2FNP A;  4HX4 A;  5B1A H;  2EZL A;  4BE2 A;  1QQI A;  3LSK A;  2XHK A;  2E60 A;  3V4G A;  2B9S A;  1JJ6 C;  1LEB A;  1Z91 A;  3MEX A;  2ME0 A;  5FKN A;  3TW6 A;  4DYC A;  3A0H C;  3GO5 A;  3UR3 C;  3S17 J;  4BEH A;  4PUS A;  1G3Y A;  3J7A Y;  2DDA A;  4G6Q A;  2NNN A;  3CF5 F;  1WVR A;  2V6C A;  2V1U A;  3DXJ F;  5K7F A;  5BPD A;  2GXA A;  3HC7 A;  3E6C C;  5IP7 J;  2W84 A;  1JE8 A;  2TDX A;  1FX7 A;  3IKV A;  2RNJ A;  2Y31 A;  2Y0M A;  4H4K C;  4I02 A;  5K7Z A;  3CCR I;  4Q4Z F;  3S8P A;  2HOA A;  2NRA C;  1S9H A;  5J8C A;  2MLK A;  1MSE C;  2OTJ I;  2IAI A;  3E6M A;  2QSH X;  3F22 A;  1RC9 A;  5FLM J;  3GW2 A;  4IEJ A;  2G7H A;  1VQN I;  4B47 A;  3PNY A;  4UUT A;  3RCO A;  4II3 A;  2COM A;  3IH4 A;  4ABZ A;  3DPT A;  2LRD A;  4A6D A;  3U21 A;  1MD0 A;  3HHG A;  3G73 A;  1ONV A;  3CC7 I;  3CUO A;  4UV9 A;  2DT5 A;  4HEA 2;  4EQQ A;  1POG A;  3OR2 C;  1Z67 A;  1IF1 A;  4NBQ A;  5GP9 A;  4BJ6 C;  2V4J C;  3LSJ A;  2NAZ A;  2CJJ A;  3GFJ A;  1R7J A;  4Y7N J;  1K78 A;  2V6E A;  2XV4 S;  3C2G A;  3C2H A;  3LOC A;  2FUG 2;  4C2T A;  1IO2 A;  4P55 A;  4LIT A;  2HQA A;  1FYL A;  1RR8 C;  4HNT A;  5IPA A;  1MMG A;  3SXY A;  3IUO A;  2VT3 A;  2L3D A;  3GTM J;  4D7N A;  3GTG J;  1XPX A;  1JKP C;  2JPB A;  3TL4 X;  3W3C A;  2V9V A;  4WWC A;  3AG3 H;  3BOQ A;  1YTY A;  3OYJ A;  2FA5 A;  1HW5 A;  2HZD A;  1VND A;  3H92 A;  2P0W A;  3N4M A;  2HYG D;  4I2O A;  4MFD A;  2FQ4 A;  5LLQ A;  2CUF A;  3ECH A;  4RDU A;  3HRU A;  2EV6 A;  2R7R A;  2OPT A;  1MMS A;  3KP6 A;  3W6K B;  2KFD A;  2UWM A;  5D6F A;  1LFB A;  2Y0S N;  1WJ5 A;  4C9Y A;  1UCR A;  2QQA A;  1TQI A;  5EEH A;  4RB1 A;  2LD5 A;  4LFU A;  1ORK A;  2OCE A;  3LSP A;  1YIO A;  2DTZ A;  4WK8 F;  2F48 A;  3BR3 A;  3LFK A;  1TWH J;  1R23 A;  2KRF A;  3OYH A;  2F5E A;  4PSW A;  2VXZ A;  3ZOB A;  4BEH B;  3JRI A;  2CS3 A;  2R7X A;  4AYB A;  2EWN A;  2K5C A;  1P6R A;  2GBY A;  2F5V A;  5L3F A;  4CIC A;  1ZG3 A;  3M7G A;  2KT0 A;  3J81 Z;  2CGP A;  2UXX A;  1HKQ A;  1MH3 A;  2R93 J;  3MVP A;  3CCV I;  2HDC A;  2DJI A;  4HSR A;  1Z21 A;  2XSJ C;  2PMZ A;  3C3W A;  3F8M A;  3GZN B;  2A6T A;  1R9T J;  2HQ5 A;  3DTI A;  2WAE A;  4IHV A;  4IHY A;  2DMP A;  2EA2 A;  3FIS A;  5HS7 A;  1WCM J;  1W0U A;  1WH5 A;  4HQM A;  1UST A;  1U9O A;  1BL0 A;  3EYI A;  3Q3S A;  2P4W A;  3ISP A;  4RGR A;  3F0C A;  2RAE A;  1XGO A;  1AA7 A;  1V54 H;  1LDJ A;  1B1B A;  3DKX A;  2LBF B;  3SFZ A;  5B3S H;  4NUB A;  4E4H A;  2EH3 A;  1D3Y A;  4I99 C;  1ETO A;  1RRJ A;  1E3H A;  2BVM A;  4CCM A;  1BW5 A;  3BPV A;  3HM5 A;  3I54 A;  1D0Y A;  4OMY A;  1YS6 A;  5BQT A;  1U5T C;  1RPW A;  1VQO I;  5EEG A;  1LE8 B;  5CPR B;  1LKX A;  4A0Z A;  3HJE A;  1QNT A;  1MBK A;  2E19 A;  2ZME A;  3CCE I;  1PP7 U;  3BQZ A;  2HWV A;  5EG0 A;  4M3B A;  1GUU A;  5FLX Z;  2JJ7 A;  4FE7 A;  3ERE D;  2WTE A;  4RAY A;  3QYB A;  3ESW B;  1ETK A;  1MBH A;  5E79 C;  2KIM A;  1IN5 A;  4OMZ A;  3I56 I;  1GXP A;  1QVU A;  4CZZ A;  4S05 A;  3H0D A;  3K1N A;  1FOW A;  3I53 A;  1C0W A;  5HLH A;  3OOP A;  1KA8 A;  3S3O A;  3I55 I;  2V9K A;  1X3Z B;  5HS8 A;  3QPT A;  3HOZ J;  2WAF A;  2WAQ A;  3DLA A;  2NVX J;  1Z7L A;  4QLC U;  3DQV C;  3LSI A;  3F6V A;  3F8C A;  3BTC A;  2H8R A;  1DP3 A;  3RJP A;  5IOY A;  5M5X J;  2GA2 A;  2ZFU A;  3H3U A;  4U88 A;  4QPQ A;  4V19 K;  4RLF A;  1SMT A;  1K4S A;  1W7P D;  4RS8 A;  1SAU A;  3CCJ I;  1P7J A;  2NOJ B;  2XB5 A;  2YPR A;  4DGW B;  3HRM A;  3R60 A;  3GX4 X;  1YRN A;  1PUF B;  1LB2 A;  5GAH J;  4M3D A;  3EUA A;  4XRS G;  4D5C A;  1LDD A;  4BKX A;  1H9T A;  2CUZ A;  3SQN A;  4A3F J;  2W7N A;  2JWT A;  2MBF A;  2XAU A;  1P9Q C;  2DT7 B;  1ZN2 A;  2FBI A;  2IGN A;  2K9M A;  3K4B A;  4CHU A;  2HU9 A;  2JA8 J;  2RNG A;  5IYB J;  4F93 B;  2ADU A;  3SFI A;  2MYS A;  2ICW G;  2M7A A;  5BS6 A;  1IC8 A;  1K78 B;  4LLL A;  4XLF A;  2H6B A;  2X6W A;  4BQN A;  2QEN A;  3HYI A;  1GLN A;  3L9F A;  4W1U A;  4U0V A;  3VSL A;  2PMH A;  5F04 A;  3CMY A;  3IHU A;  5M3M J;  2IEK A;  2DMN A;  1UHS A;  5ICC A;  3LST A;  4HOB A;  4XLN F;  1J9I A;  1MJ9 A;  3KZZ A;  3HOU J;  2AS5 F;  1WJA A;  5E3M A;  2K3P A;  2V7F A;  1WRJ A;  5F64 A;  3SDB A;  2Q2E A;  1X4O A;  2LY1 A;  2CFX A;  1DDN A;  2V26 A;  1NK2 P;  2OV7 A;  3KYD B;  1ZK8 A;  4CCO A;  2BW3 B;  2C6Y A;  4BU2 A;  4J01 A;  2RC4 A;  3L09 A;  3H3Z A;  4RGS A;  2CMP A;  3NWS A;  2EFW A;  3QQA A;  2DAO A;  2ZC2 A;  4Z2Y A;  2XGC A;  1VI0 A;  4ENJ A;  3VSK A;  4Y52 J;  2OA4 A;  4BJ5 C;  3GCM A;  2OZU A;  1ETV A;  2DU9 A;  1FZP B;  4PJN A;  1GT0 C;  1N25 A;  3WTY C;  4B09 A;  4CCK A;  2MAB A;  2OAZ A;  2R7U A;  1Z0X A;  2HS5 A;  4QWQ A;  3F23 A;  3HXL A;  3SZP A;  1S29 A;  1YI2 I;  1LDK B;  1S72 I;  4A3C J;  4ETS A;  2GA1 A;  2A6H F;  5EF6 A;  1YX5 A;  2HTS A;  2PBI A;  3H9J A;  4KIS A;  4WF2 A;  1JUM A;  2GQQ A;  5GAG J;  1G8X A;  2XAH A;  1FT9 A;  2DOE A;  3TO7 A;  3A0B C;  5K5R A;  3LWF A;  3DFG A;  4A93 J;  3H9G A;  2A5Y B;  2DFE A;  4LIV A;  3WU1 B;  2JPC A;  3V8J A;  3OYL A;  5CVI A;  3OL4 A;  2XRO A;  2LFB A;  2LOO A;  1N78 A;  1B6A A;  4O6J A;  4HLX A;  3V7S A;  3ABK H;  4ENM A;  4D9J A;  2VBY A;  2ZME C;  2FXA A;  4HPQ A;  2EQR A;  4LD5 A;  4IQJ A;  2HXI A;  2JA6 J;  5TRD A;  5TJJ A;  2R7Z J;  2BXY A;  4B8X A;  3Q5F A;  1EKE A;  3QOP A;  3S14 J;  3DU5 A;  2QM3 A;  3PO2 J;  5KCM A;  5GPC A;  4BH9 A;  1W7P A;  1WKM A;  3K10 A;  3KZY A;  5DTD A;  5E8G A;  4JBA A;  4MHG A;  2ZJP F;  4M72 A;  1DPR A;  3M8E A;  4ZTJ A;  2LKP A;  3OIQ A;  3ECO A;  2PI0 A;  5L3D A;  4XMY A;  1QPM A;  3DEU A;  1O57 A;  2H8W A;  2Y69 H;  2X9D A;  3TKY A;  4CGZ A;  2WY8 Q;  2Z9O A;  4KN7 X;  1MBF A;  2D1V A;  4C30 A;  2L02 A;  3MKL A;  2DOA A;  4E7H A;  3GTJ J;  3PJR A;  3CJQ B;  1TC3 C;  1JTX A;  4X0G A;  3FXL A;  3ZPL A;  3WTV C;  1TNS A;  3W2V A;  2CQQ A;  2XPW A;  4YFX F;  1H8A C;  3V42 A;  2LC2 A;  4L0Y B;  4XNF A;  2IA2 A;  2ME6 A;  4GFB A;  1YLF A;  2R3S A;  1LFU P;  3PNT A;  2EIN H;  5TGT A;  4NC7 A;  3HG9 A;  5HLI A;  3T8R A;  1PUE E;  2FRH A;  2DA5 A;  3Q0V A;  1IN7 A;  1MGT A;  2X51 A;  5H6R A;  4EGZ A;  4MGR A;  4NQW B;  2WC2 A;  1W0T A;  3BZ6 A;  1FY7 A;  2BY2 A;  3TP3 A;  1QZY A;  2L0K A;  3CP2 A;  1KU2 A;  2O61 A;  2VKE A;  4F3Q A;  4PJJ A;  3OS0 A;  3IL2 A;  1G2H A;  2PQ8 A;  2P81 A;  3FX3 A;  3K0L A;  1HA8 A;  5L3B A;  1JHH A;  3WTT C;  1IZ1 A;  3BPX A;  1UJ8 A;  1Z77 A;  3R0A A;  3F8N A;  5D8L B;  1HOM A;  3A03 A;  1IRZ A;  4BHB A;  3GLL A;  4LGW A;  2XC7 A;  3OIO A;  3SYT A;  4O5V A;  5C44 J;  4FT8 A;  4GXO A;  3S32 A;  1YJ9 I;  4LB6 B;  4IOA F;  2LKS A;  4UHT A;  4GYI A;  1EH7 A;  4MQ9 F;  2BE5 F;  1P7I A;  1GVJ A;  1YJN I;  5CVJ A;  2ECC A;  5J40 A;  4MEY F;  3FWE A;  4M3E A;  2EBI A;  3ZCO A;  2EFP A;  2O7O A;  5IP9 J;  1O7F A;  4D1Q A;  4F52 A;  2DPD A;  3DBR B;  1YO5 C;  3K4C A;  4NC6 A;  1DUX C;  4FHT A;  2E2H J;  1Z3X A;  2NVT J;  2X85 A;  4I01 A;  4RA2 A;  2A68 F;  3K2Z A;  2BW3 A;  3VYR B;  2ISZ A;  2FNA A;  3MWM A;  5DEQ A;  3S93 A;  3K70 D;  2CW7 A;  3IAM 2;  3SEQ A;  3FHZ A;  3PNV A;  1FOY A;  4BHC A;  4I0B A;  4NB5 A;  4QPO A;  2ZFW A;  3CCY A;  2RN7 A;  2Q8K A;  1FYM A;  2GM4 A;  3A02 A;  2R7O A;  4XKW A;  1MND A;  4P5O A;  5EYR A;  4CZC A;  2KHM A;  3OYG A;  1TW3 A;  1MDM A;  4E7L A;  2L9S A;  3KLO A;  3FMR A;  3U1D A;  2M4K A;  4BBS J;  2DA4 A;  4XOP A;  4KYW A;  1HST A;  5DM6 F;  3K6G A;  4JK1 X;  4AUX A;  4UVA A;  1OCP A;  1AKH B;  3L2Q A;  2ELJ A;  2XKO A;  3DTK A;  3CP8 A;  2ZJQ F;  3M9A A;  1X58 A;  4UUS B;  1OIS A;  2NVU B;  5CYV A;  1W5T A;  3LA2 A;  2OBP A;  2Y48 A;  1ZH5 A;  1G3W A;  2VJ5 A;  2EFN A;  2LF7 A;  4A0Y A;  3HRT A;  4ZDO A;  1AHD P;  1X1D A;  2M0C A;  3GUD A;  4AID A;  1HW1 A;  4G7H F;  1QPI A;  1ODD A;  4I6Z A;  3I58 A;  5F08 A;  1WJD A;  5JR3 A;  2M8G X;  3A4C A;  1F1Z A;  3KP7 A;  3P9I A;  4UV8 A;  4E7I A;  3JRD A;  3DV8 A;  4ON0 A;  1PYV A;  3TO6 A;  5D4R A;  1BJZ A;  5L3G A;  1SD6 A;  1QHG A;  3OY9 A;  5DM7 F;  1RES A;  5AON A;  1VQ5 I;  3CMM A;  4LK0 F;  3OYD A;  3GTQ J;  1I3Q J;  2JN6 A;  3K69 A;  3WE2 A;  4MTD A;  4OU0 A;  1FBQ A;  4XK4 A;  4KMF A;  4KUM A;  4EEF G;  3K4N A;  2KDZ A;  2E1N A;  4CH7 A;  4H0E A;  2DFI A;  3GZ5 A;  4JX5 A;  3BG6 A;  5K5Q A;  2A07 F;  5J1R A;  1D5V A;  2WV0 A;  4Y13 A;  4UUS A;  3L7W A;  3HOT A;  2VJI A;  3HZJ A;  3RZO J;  4UB6 C;  1GXQ A;  3JSP A;  2IA1 A;  1S7E A;  2QF7 A;  4OIP F;  3DP7 A;  3BCB A;  3QPH A;  4XKV A;  3I4N J;  1APL C;  1J2X A;  3OSF A;  3CC2 I;  1BI2 A;  3BC8 A;  2R5Y A;  2VBW A;  3K4M A;  1OFC X;  5IY5 H;  1SVM A;  4IJA A;  4BXF A;  3H1C A;  1IN6 A;  1T08 B;  4JX4 A;  2W82 A;  4XRM A;  3QYF A;  1H89 C;  2RRE A;  2ISY A;  1MW7 A;  3FXR A;  4Q47 A;  2OF7 A;  2P5V A;  3CES A;  4CXF A;  5FRN A;  3QP5 A;  1RUN A;  2XF5 A;  2XAQ A;  5FB2 A;  1YW7 A;  4BS9 A;  4XKC A;  3T8T A;  2EIK H;  3TO9 A;  3WG7 H;  5DUI A;  2BHZ A;  2M7B A;  2ZKZ A;  4M9Z A;  1S3J A;  3G1M A;  4XOT A;  5CKT A;  2JSC A;  1VQL I;  4BNC A;  1BM9 A;  5IYC J;  1T56 A;  1S6L A;  1NK3 P;  3T1B A;  5F27 A;  1Z05 A;  1XSV A;  2VE8 A;  4R1H A;  4RAZ A;  2EIJ H;  5LGT A;  1OCO H;  1SD7 A;  2FBK A;  3DBL B;  4EVI A;  4PCQ A;  3ZQC A;  5EJC A;  2HPI A;  2F4M B;  4YEL A;  3TQN A;  3OYE A;  3QPL A;  5CQE A;  3I64 A;  2GIZ A;  2VB6 A;  3CF2 A;  4ANJ A;  4MTE A;  3OYI A;  4KIG A;  2QQ9 A;  1OKR A;  1VQ6 I;  2ETH A;  1CF7 B;  1YRN B;  4A5M A;  2VUM J;  1JTY A;  4M6X A;  3HGG A;  1VQ9 I;  1X3U A;  4X6A J;  2KJB A;  4W97 A;  2W25 A;  2F4I A;  1X19 A;  2P6T A;  5LRR A;  2YUS A;  5FO5 A;  1OCR H;  4KIF A;  2GOM A;  4A3E J;  4QSH A;  4JP0 A;  3CTA A;  4I98 B;  4ZJZ A;  4L9J A;  4BY7 J;  2BY1 A;  3RDI A;  2GOX B;  4GRI A;  3TGN A;  1HLV A;  5C4X J;  2X6X A;  4KJZ A;  2J5O A;  3LL7 A;  1XMX A;  4M3F A;  3ASN H;  4A3J J;  2FE3 A;  1RNL A;  4F92 B;  2V9P A;  3IH2 A;  1HDD C;  1YG2 A;  2HFH A;  5F1R A;  3COA C;  5M3F J;  2K02 A;  2CG4 A;  2BEO A;  4RAG A;  3V7C A;  1MZB A;  1T38 A;  1O3Q A;  2D45 A;  3CC4 I;  2XAF A;  1I50 J;  4IL6 C;  3S1R J;  4DZJ A;  3QOE A;  1B8I A;  4UUV A;  1ETX A;  2O03 A;  3IWF A;  4HA8 A;  4AIJ A;  4GCV A;  1KQ0 A;  3N97 A;  1TW2 A;  2K9L A;  3BY6 A;  4LG3 A;  4JQF A;  1UHM A;  3SDG A;  3FIW A;  2LP0 A;  3KZI C;  4MNU A;  2VOO A;  1UFM A;  1WH7 A;  4RB2 C;  3LAJ A;  2XF7 A;  3SHF A;  2O3F A;  3GLX A;  2LBF A;  4ESJ A;  2M0M A;  4ENK A;  1U9N A;  2BBY A;  2K40 A;  3J81 K;  3HPH A;  1A04 A;  1W36 C;  3M1C A;  2K4B A;  4A12 A;  1F43 A;  5JVG F;  4CUG A;  1XGM A;  2L5Q A;  2ECB A;  3W6J B;  3CZ6 A;  1IV6 A;  1ZYR F;  2VON A;  2PJR A;  1FSH A;  2FML A;  4A3D J;  3HUG A;  5FKK A;  1IGN A;  1QRY A;  5ERI A;  1XGN A;  1TTY A;  2FOK A;  2VBX A;  4S04 A;  3MAJ A;  4OWR B;  2JMW A;  3CDL A;  4RM2 A;  1JKQ C;  1QHH D;  3JW4 A;  3BJO A;  4KMU X;  4A3M J;  2CUE A;  5IOZ A;  1MKM A;  2FD5 A;  1OQY A;  4AU7 A;  3GZ6 A;  3I0T A;  1B9N A;  3GWZ A;  4BE1 A;  1I5Z A;  1IXR C;  1JGS A;  2WB1 N;  2KKO A;  1R00 A;  4L9N A;  1FIA A;  1MNE A;  4HYE A;  5EZG A;  2VKH A;  4EM1 A;  1MBJ A;  5HVQ C;  1R4M B;  1IW7 F;  4KT6 A;  1RIO H;  4M6V A;  3WTW C;  4O3M A;  1IN8 A;  2M34 A;  1LFP A;  2EV0 A;  5F0F A;  4IX7 A;  2FX0 A;  3HTU A;  1J7K A;  4BHP A;  2ZXW H;  5J3L A;  2LLK A;  1ZG1 A;  1SFU A;  2CO5 A;  2ZBK A;  3F72 A;  5ILS A;  3WTZ A;  1XS9 A;  3IRQ A;  5JFR A;  4LLG F;  4BUP A;  1R5I D;  1EH8 A;  3TDU C;  3ZMS A;  1ON1 A;  3I59 A;  3K4J A;  2Y75 A;  3KP2 A;  3RZD J;  1T95 A;  1SFK A;  2W85 A;  2QLZ A;  5FRO A;  5ILV A;  4DZP A;  5EDN A;  1ZGW A;  4P9F A;  1ZLK A;  1X2M A;  2LH9 A;  1IUF A;  3SZT A;  5ED4 A;  4ZTF A;  4RB0 A;  2VLA A;  1TNT A;  1BW6 A;  1K79 A;  2MFZ A;  3D1N I;  3LSH A;  4F55 A;  2IS2 A;  3HHH A;  5B1B H;  3CCS I;  1FLI A;  1TWC J;  3R0J A;  5FFZ A;  3JTG A;  2IT0 A;  5LEK A;  4OAZ A;  2CH0 A;  5EG0 B;  1TWG J;  3G1L A;  4LJZ F;  5DD4 A;  5A2Q K;  1G3T A;  2KLO A;  1TQM A;  1OR7 C;  1R58 A;  3GF2 A;  2DA3 A;  2F6C A;  3ZQH A;  1YX3 A;  5K1Y A;  4U0Y A;  3FHN A;  1L3L A;  5E18 F;  2IJL A;  2Z3Y A;  2KIS A;  2E2I J;  4Y3O A;  5DCM A;  2PN6 A;  2QWW A;  2XPV A;  2GWR A;  1S8N A;  3KP3 A;  4L9V A;  3CCU I;  2CV1 A;  3PL8 A;  3WTX C;  1EH6 A;  3MKY B;  2EPF A;  4HRI A;  1IDZ A;  4CCL A;  4LIU A;  1FMV A;  1GV2 A;  4WXD A;  3HOW J;  1O7L A;  2CQX A;  3BTJ A;  4MLO A;  3R6S A;  4FIS A;  4GO1 A;  2HOS A;  5FKL A;  3TOA A;  4KDP A;  3LSR A;  3QPS A;  3OS1 A;  3JRE A;  3E1S A;  1MMA A;  2NS7 A;  4KIC A;  1FMW A;  5FFX A;  1J75 A;  3LFU A;  2OZ6 A;  3TDZ C;  4YFK F;  1R1T A;  3F8F A;  1HKT A;  5IT9 Z;  1T0F C;  2VI6 A;  3S2D J;  1HDP A;  1PUF A;  2NYX A;  1MNM C;  2I10 A;  2KRC A;  3QP6 A;  1VQ4 I;  1OMI A;  2L2O A;  3SZG A;  5LGU A;  3CO7 C;  5GTH C;  4QTR A;  2LMD A;  3X2Q H;  4R8H A;  4E7K A;  1BOB A;  1GV5 A;  4EMS A;  5L3E A;  4HX7 A;  2IRF G;  3OIP A;  3Q9S A;  3U1K A;  4IHT A;  3QU3 A;  1DU6 A;  4I0A A;  3F8B A;  1KGS A;  4LK1 F;  3OYA A;  2EJR A;  5J47 A;  1ZGJ A;  3P9C A;  4RLQ A;  3BTL A;  3DKY A;  4PJL A;  1ZHF A;  1FOX A;  5D5W B;  1ON2 A;  3BRO A;  4UVB A;  3CLO A;  1UZC A;  4XRS A;  2HKO A;  3D5S C;  4KA4 A;  4C3H J;  2GXG A;  3RTR A;  3FXM A;  2VKV A;  2VC0 A;  2HVS A;  3QWL A;  3H5N A;  1SD5 A;  3GFI A;  2WA0 A;  4BQA A;  2P8T A;  4DOZ A;  1TLH B;  3HSE A;  3FKJ A;  2K3F A;  4XBF A;  3JAM Z;  3ZP5 A;  3DEW A;  1I1S A;  1H88 C;  5H2F C;  1UG2 A;  3WE3 A;  2DA2 A;  3RYP A;  3BP8 A;  3PM1 A;  2LYC A;  3PUF A;  4HST A;  3AL0 B;  1RI7 A;  1KYZ A;  5E1X A;  3ZN1 A;  3GFL A;  2R7Q A;  1YE9 A;  3V8L A;  4CSW A;  2IVM A;  4A3G J;  3EUH C;  1FYK A;  1JT0 A;  1R1U A;  1XG1 A;  1LVK A;  3H9Q A;  1ETQ A;  2VC1 A;  4U0W A;  1A6Q A;  2PLY A;  3MZH A;  1UHW A;  3AFH A;  3AL0 C;  1B9M A;  1XTA A;  5GAE J;  3S3M A;  3RYR A;  3O6B B;  3CCQ I;  2R7T A;  4B44 A;  4XQF A;  5EZH A;  1E17 A;  1HBX G;  2DOD A;  2M2E A;  3FF5 A;  2M45 A;  2DMT A;  2IGK A;  1WJF A;  2EK5 A;  2H09 A;  2EFQ A;  1V5F A;  2E36 A;  3RQ4 A;  2DQR A;  4FQG A;  4P9U A;  1PP8 F;  2BY0 A;  1DQU A;  2Y30 A;  2V79 A;  4IOC F;  3WTU C;  2E7X A;  2G7U A;  4A5N A;  1DPU A;  2CSO A;  2HR3 A;  3ZRG A;  5EGO A;  1U5T B;  4A3K J;  4AVZ A;  2EA4 A;  4M3G A;  3H35 A;  1R49 A;  1T6S A;  3VYT B;  1LPQ A;  4V2G A;  4B3A A;  3B73 A;  4G8X A;  1I6H J;  3UNG C;  4MO7 A;  3GTK J;  2IS4 A;  1BJA A;  1IXS B;  3PQK A;  2ZB9 A;  3FMQ A;  5IT3 A;  4DW6 A;  3FXO A;  1KU7 A;  2OUM A;  1D8J A;  1H0M A;  4OIO F;  3CCL I;  2CWE A;  2ZJ2 A;  5E20 A;  5EGO B;  5CVV A;  4IZZ A;  1ZR2 A;  2KDO A;  4IRH A;  1SC7 A;  1CGP A;  5ICF A;  4YG2 F;  3W2W A;  4XLP F;  1VF9 A;  3GBG A;  1I6X A;  2AXT C;  2M30 A;  2XPU A;  5HDG A;  1BIB A;  4RAF A;  3KYL A;  2X6Y A;  1Y8R B;  1LJ9 A;  5JHF A;  3PFI A;  3S1M J;  1WJC A;  4YRV A;  1JI8 A;  3ZXS A;  4BL0 B;  2NVQ J;  2LRE A;  2BXZ A;  4M9S A;  1X3W B;  2O8K A;  2EV5 A;  2XIG A;  3ELK A;  4F91 B;  1EF4 A;  1LEA A;  1XMK A;  3ERM A;  4PFO A;  4N9I A;  3S2H J;  2Y2Z A;  2K27 A;  4X1E A;  5BPI A;  4I76 A;  1LQ1 A;  2WAQ N;  4EAT A;  1GVD A;  2XDV A;  3T5X A;  4ZYD A;  3Q0U A;  4YFN F;  3I4M J;  4HW0 A;  4NNJ A;  4A0X A;  3ABM H;  2LR8 A;  5KHD A;  9ANT A;  2QZ8 A;  3CUQ A;  2BY3 A;  4HLY A;  3RKQ A;  2WWY A;  2B63 J;  5IT9 K;  2XRL A;  3DTE A;  4HX8 A;  4XRF A;  5J6X A;  4HV6 A;  2Z1D A;  4EJT A;  3CLQ A;  3BCA A;  5CJ9 A;  1P4A A;  2ELH A;  2KL4 A;  5AIP A;  4CCJ A;  3Q9V A;  3GTL J;  2CU7 A;  1TQP A;  4RGU A;  1RUO A;  4NDL A;  1GDT A;  3AKZ A;  1X2N A;  3OYM A;  4BJT A;  1BR2 A;  2UXN A;  2XGX A;  2RQQ A;  1G59 A;  3TMO A;  1NHA A;  1HW2 A;  3S2W A;  3REO A;  3LAP A;  1JKR C;  3B02 A;  3LMM A;  1RKW A;  5J1Y A;  1BR4 A;  2QGU A;  2ZNY A;  2DK8 A;  2X6O A;  1I3A A;  1Q1V A;  2MSY A;  4ZDP A;  2DN0 A;  4EGY A;  3R4K A;  4ZZL A;  4E7S A;  5HOO A;  1R5H A;  1MH4 A;  4N0B A;  4RGX A;  1TT0 A;  3HDD A;  2BV6 A;  4DIQ A;  1W36 D;  1XGS A;  3HEF A;  4WCG A;  1U2W A;  3HRS A;  3G71 I;  4Y4R A;  3RIR A;  1UAA A;  3F6O A;  2E1C A;  3VPR A;  3JTH A;  1FSE A;  2HTJ A;  4CYC B;  2QKL B;  1WPK A;  3CCM I;  5K7H A;  5D6E A;  4ENN A;  4BQO A; 
#chains in the Genus database with same CATH homology
 4OIQ F;  3FMS A;  3D5L A;  2ACJ A;  3J7A O;  1FWZ A;  2RQP A;  1J5Y A;  3I5U A;  4WXH A;  3R61 A;  3QU6 A;  1ULY A;  1ZRE A;  2YR2 A;  2F5C A;  1SFX A;  2IP2 A;  3ZMU A;  2MH2 A;  2LF8 A;  1K6O A;  1XB4 A;  1E2X A;  3IKT A;  4PGG A;  4BYY A;  1ZRF A;  2FMY A;  4N9H A;  5JI6 A;  1QGP A;  2FEZ A;  4L0Z B;  3C7J A;  1JHF A;  2Z5U A;  2DPU A;  4L5I A;  4YIF A;  2Z99 A;  4WXC A;  1ZRD A;  2HKX A;  3J80 Z;  5CVR A;  1Z9C A;  4U7D A;  5L3C A;  1KQ9 A;  3FM3 A;  1KQ8 A;  2QBY A;  5FD6 A;  5DYM A;  5HDN A;  1BOA A;  3ZMD A;  1OYY A;  2M1B A;  5J8F A;  2W24 A;  1STZ A;  2PEX A;  4M71 A;  2HQN A;  3HSR A;  4ESB A;  4UXN A;  2D1H A;  4HDU A;  1HKS A;  3VOE A;  5DUK A;  1ZRC A;  5D5X B;  1G3S A;  5FGM A;  2DLL A;  2MA3 A;  2O0Y A;  2P5L C;  1Q1H A;  3DKW A;  1BC7 C;  4A6E A;  3EQL F;  5E8I A;  2FSW A;  1WQ2 A;  2QUF A;  3E5U A;  2P7V B;  1HQC A;  4Y17 A;  5BOX A;  1QO0 D;  1SFE A;  5KVR A;  1F9N A;  1FNN A;  2GAU A;  1P92 A;  4HV5 A;  5F6F A;  4IVN A;  1RZ4 A;  4M9X A;  1P2F A;  1LVA A;  3LA7 A;  4LB5 A;  1B59 A;  2A61 A;  4DQ2 A;  3EDP A;  2F5D A;  1FPQ A;  4P96 A;  1U5T A;  2RKH A;  3AAF A;  3ML6 A;  5D8K B;  2JTV A;  5LEJ A;  3BJ6 A;  1FBU A;  2DQL A;  3RPU A;  3RI4 A;  3KP4 A;  1U78 A;  2F5F A;  2LDU A;  4LG0 B;  5JVT A;  5HS9 A;  5AIQ A;  3ABT A;  1OPC A;  2ZO4 A;  3KFW X;  1BI1 A;  1G6N A;  2XVC A;  1Y0U A;  2ZCW A;  3LQQ A;  1XCB A;  1H9G A;  5LHI A;  1OR7 A;  2HEO A;  5HDK A;  2ZNZ A;  1HXD A;  2L01 A;  2PFB A;  1YYV A;  3VB2 A;  4KFC A;  2G9W A;  4G9Y A;  5E1W A;  1FP1 D;  1W4M A;  4HAM A;  3KE2 A;  5D4S A;  3ZN0 A;  1F5T A;  4AIK A;  1S7O A;  2L4M A;  2XAG A;  5DCF A;  3NRV A;  2QBY B;  1KYW A;  4EM0 B;  2QQB A;  1SMY F;  4HZF A;  4HF0 A;  1MJB A;  2MH9 A;  3KLN A;  4K2E A;  4L9T A;  3E97 A;  2PG4 A;  1XD7 A;  3KET A;  4ZYE A;  1Z7U A;  1IRF A;  4LLN A;  4HF1 A;  3K9T A;  4MEX F;  2DO7 A;  1WWX A;  4R79 A;  2OQR A;  2P7C B;  4IF4 A;  1FBS A;  5H20 A;  2YX4 A;  5BMZ A;  2XAJ A;  2M87 A;  4RB3 C;  4HQE A;  3LA3 A;  4OIN F;  2IW5 A;  3HTS B;  3TOB A;  1YFH A;  5LHH A;  1XMA A;  1F4K A;  3DF8 A;  3T0Y A;  4M74 A;  5DD8 A;  3WGG A;  1Z6R A;  1R1V A;  4PZJ A;  1BI3 A;  2IPQ X;  4U7B A;  4MQV A;  4HBL A;  3QAH A;  3O2P E;  4XSX F;  5H6Q A;  2QYO A;  4HF2 A;  2ZME B;  2VE9 A;  3V8K A;  1ZGA A;  2O6G E;  2M8E A;  2KJC A;  2R7F A;  1USS A;  1BN5 A;  3F3X A;  1OYW A;  3IWZ A;  1KU3 A;  3WOD F;  3JAM K;  4LG0 A;  2HYF A;  3LQR A;  3KEQ A;  3EYY A;  1UB9 A;  1YW9 A;  1IXC A;  2IA0 A;  4CDG A;  1T98 A;  3GVA A;  1PDN C;  2XRN A;  1DP7 P;  2P5K A;  4IPA A;  1YW8 A;  3L00 A;  4GYG A;  4IRI A;  2H6C A;  4EJU A;  3ULQ B;  3E5Q A;  2K4J A;  2J5P A;  3CDH A;  1VTN C;  1T39 A;  3WTS C;  4AD9 A;  4D0P A;  2FF4 A;  5ICG A;  1W5S A;  1HSJ A;  1R36 A;  4L18 B;  3NEU A;  4OIR F;  1R5G A;  4F7Z A;  5ILU A;  1IAW A;  2FU4 A;  4DNC A;  2UZK A;  4EJV A;  3MFK A;  1MDM B;  3PQJ A;  2V1X A;  3BDD A;  4EM2 A;  1SD4 A;  3MZY A;  1K7A A;  1B4A A;  2JT1 A;  3I59 B;  4YII A;  1IN4 A;  2STT A;  1R22 A;  2X0L A;  2R7D A;  2FQ3 A;  4XSZ F;  5LGN A;  2O8X A;  2GZW A;  1G4D A;  3M1E A;  3MCZ A;  1XCV A;  2VOD A;  2VBZ A;  2W57 A;  2HQR A;  2V1D A;  4CYD A;  1FOK A;  3OV8 A;  3ZMZ A;  4ZH4 F;  1FC3 A;  2NS0 A;  4BXU A;  3P7N A;  4IRG A;  1BIA A;  2L54 A;  1O3R A;  1I27 A;  1GHC A;  4ZZD A;  1XDU A;  2DI3 A;  4OOI A;  1JXS A;  2L4A A;  3KCC A;  4AIH A;  4EJW A;  3GEZ A;  4FX4 A;  1AWC A;  1I1G A;  3QRF F;  4Q48 A;  2XKP A;  2VT2 A;  2YX7 A;  5CLS A;  3WU0 A;  5K5O A;  4G94 A;  1BI0 A;  2MD5 A;  2KIU A;  3E6D A;  4KN4 X;  4PGH A;  1IUY A;  3RKW A;  3MQ0 A;  2VOP A;  4AVP A;  1W7P B;  4WX9 A;  2ZXJ A;  2H94 A;  1J0R A;  3I71 A;  2Z33 A;  4KNY A;  4M6Y A;  1XDS A;  1FP2 A;  5FD5 A;  4IHS A;  3EUH A;  5HLG A;  3E5X A;  2NNY A;  4GGG A;  2CYY A;  2RGV A;  3VFZ A;  5DCM B;  5D5U B;  3L2C A;  2RVC A;  4G6D A;  1V3F A;  3ROU A;  3FM5 A;  1LNW A;  3ABU A;  1MJA A;  2AXL A;  2ESH A;  3KP5 A;  5LBQ A;  4EV0 A;  2YU3 A;  1ZLJ A;  5LRS A;  2D2W A;  4UVC A;  2OD5 A;  3J80 K;  3E6B A;  3IC7 A;  2OQG A;  3CO6 C;  1U6G A;  2DW4 A;  3V7R A;  1EV7 A;  3C18 A;  1Z1D A;  4IXA A;  2OU2 A;  5FLX K;  1KU9 A;  4KT5 C;  4Y15 A;  3EET A;  3VOD A;  4HDV A;  3DPL C;  3BWG A;  3ZMV A;  3RPQ A;  2RV8 A;  3M8F A;  1O3T A;  1XN7 A;  4A2U A;  3CUQ C;  1QZZ A;  5A2Q Z;  1P4W A;  3GXO A;  4ZYH A;  3HSF A;  1ZG5 A;  3NQO A;  3ZQ7 A;  3KEO A;  2STW A;  2QVO A;  3E3V A;  3WG9 A;  3D0S A;  3BJA A;  2H27 A;  4I7H A;  3CUQ B;  4ZYG A;  2XUB A;  4G7O F;  2DBB A;  3C1D A;  2PJP A;  1REP C;  1D8K A;  4KIB A;  2KIF A;  4ASN A;  2A69 F;  1QBJ A;  3WGI A;  3HOS A;  1V4R A;  5KK1 A;  2CQK A;  2K86 A;  3FXU A;  2ESN A;  2MLG A;  4NQW A;  1XSX A;  1CF7 A;  1OYI A;  2CW0 F;  3K1M A;  4CO8 A;  4BAY A;  3RKY A;  4Q5S F;  2F2E A;  4G7Z F;  2Q0O A;  2EB7 A;  3RKX A;  5DV5 A;  1ZAR A;  2DK5 A;  3P9K A;  3F21 A;  1S7A A;  2BGC A;  4UNO A;  3JSO A;  5D5V B;  2FBH A;  2DTR A;  2BYV E;  2E7W A;  4M73 A;  6PAX A;  1XSD A;  1BC8 C;  4L5J A;  4AWX B;  2JRT A;  2K7L A;  1YQA A;  3HIF A;  3WGH A;  2A6E F;  5E17 F;  1IRG A;  2LSO A;  1O3S A;  5JHU A;  3CJN A;  1ZAO A;  2GIV A;  2GXB A;  3I4P A;  3VEP A;  2HGC A;  2MC3 A;  2VN2 A;  3GYH X;  4FX0 A;  2HZT A;  2P6S A;  1P4X A;  3U2R A;  2X4H A;  1YS7 A;  3U9G A;  4LMY A;  4ESF A;  1Z6T A;  3O3K A;  1L0O C;  2A3S A;  5LHG A;  1TBX A;  2PMU A;  2M5W A;  1U8R A;  1SAX A;  3FZV A;  1WSU A;  3ZMT A;  4NHJ A;  2XAS A;  1AOY A;  1J59 A;  4I09 A;  5DDG A;  2EFO A;  1U3E M;  5ICE A;  1WI9 A;  5E1Z B;  2HOE A;  3K1P A;  4TV7 A;  5CVU A;  2JZY A;  2YSR A;  3FXQ A;  4EJO A;  2LNB A;  3GFM A;  3G3Z A;  4PDK A;  2B0L A;  1T0F A;  2RDP A;  1T2K A;  4E70 A;  3IRR A;  1BBY A;  2FNP A;  4HX4 A;  1QQI A;  2XHK A;  3V4G A;  1LEB A;  1Z91 A;  3MEX A;  3GO5 A;  1G3Y A;  4G6Q A;  2NNN A;  2V6C A;  2V1U A;  3DXJ F;  5BPD A;  3E6C C;  2W84 A;  1JE8 A;  2TDX A;  1FX7 A;  3IKV A;  2RNJ A;  2Y0M A;  4I02 A;  4Q4Z F;  2NRA C;  5J8C A;  2MLK A;  3E6M A;  3F22 A;  3GW2 A;  2G7H A;  2COM A;  3DPT A;  4A6D A;  1MD0 A;  3HHG A;  3G73 A;  1ONV A;  3CUO A;  4UV9 A;  2DT5 A;  4EQQ A;  1IF1 A;  2NAZ A;  3GFJ A;  1R7J A;  1K78 A;  2XV4 S;  4P55 A;  1FYL A;  3SXY A;  2VT3 A;  2L3D A;  2JPB A;  2V9V A;  4WWC A;  3BOQ A;  1YTY A;  3N4M A;  2FA5 A;  1HW5 A;  3H92 A;  2HYG D;  4I2O A;  5LLQ A;  3ECH A;  3HRU A;  2EV6 A;  3KP6 A;  3W6K B;  2UWM A;  5D6F A;  1UCR A;  2QQA A;  1TQI A;  5EEH A;  4RB1 A;  4LFU A;  1YIO A;  4WK8 F;  3LFK A;  1R23 A;  2KRF A;  2F5E A;  2VXZ A;  2EWN A;  1P6R A;  5L3F A;  4CIC A;  2CGP A;  1ZG3 A;  3J81 Z;  3M7G A;  2UXX A;  1HKQ A;  2HDC A;  3C3W A;  3F8M A;  2EA2 A;  5HS7 A;  4HQM A;  1UST A;  3EYI A;  2P4W A;  3ISP A;  4RGR A;  1XGO A;  1LDJ A;  1B1B A;  3SFZ A;  1D3Y A;  3BPV A;  3I54 A;  4OMY A;  1YS6 A;  5BQT A;  1U5T C;  5EEG A;  4A0Z A;  1QNT A;  2ZME A;  1PP7 U;  2HWV A;  5FLX Z;  3ERE D;  2WTE A;  4RAY A;  2KIM A;  1IN5 A;  4OMZ A;  1GXP A;  4CZZ A;  4S05 A;  3K1N A;  3I53 A;  1C0W A;  5HLH A;  3OOP A;  1KA8 A;  5HS8 A;  3QPT A;  4QLC U;  3DQV C;  3F6V A;  3F8C A;  3RJP A;  2GA2 A;  3H3U A;  4U88 A;  1SMT A;  1W7P D;  4RS8 A;  2YPR A;  3HRM A;  3R60 A;  3GX4 X;  1LB2 A;  1LDD A;  1H9T A;  3SQN A;  2MBF A;  1ZN2 A;  2FBI A;  4CHU A;  2ADU A;  5BS6 A;  1K78 B;  4LLL A;  2H6B A;  2QEN A;  3HYI A;  3L9F A;  4U0V A;  2PMH A;  3IHU A;  5ICC A;  3LST A;  4HOB A;  4XLN F;  1J9I A;  1MJ9 A;  3KZZ A;  2AS5 F;  1WRJ A;  5F64 A;  2Q2E A;  2CFX A;  1DDN A;  2C6Y A;  2RC4 A;  3L09 A;  3H3Z A;  4RGS A;  2EFW A;  2DAO A;  4Z2Y A;  4ENJ A;  2OA4 A;  2OZU A;  2DU9 A;  1FZP B;  3WTY C;  4B09 A;  2OAZ A;  4QWQ A;  2HS5 A;  3F23 A;  3SZP A;  1S29 A;  1LDK B;  4ETS A;  2GA1 A;  2A6H F;  2HTS A;  2PBI A;  4WF2 A;  2GQQ A;  2XAH A;  1FT9 A;  3TO7 A;  5K5R A;  3LWF A;  3DFG A;  2A5Y B;  3WU1 B;  2JPC A;  3V8J A;  5CVI A;  2XRO A;  1B6A A;  4O6J A;  4HLX A;  3V7S A;  4ENM A;  2VBY A;  2FXA A;  4LD5 A;  5TRD A;  5TJJ A;  4B8X A;  3Q5F A;  3QOP A;  2QM3 A;  4BH9 A;  1W7P A;  1WKM A;  3KZY A;  5E8G A;  4JBA A;  4MHG A;  4M72 A;  1DPR A;  3M8E A;  2LKP A;  3ECO A;  2PI0 A;  5L3D A;  1QPM A;  3DEU A;  1O57 A;  4CGZ A;  3TKY A;  2Z9O A;  4KN7 X;  2D1V A;  2L02 A;  3ZPL A;  3WTV C;  1TNS A;  4YFX F;  4L0Y B;  2IA2 A;  1YLF A;  2R3S A;  5HLI A;  3T8R A;  1PUE E;  2FRH A;  5H6R A;  1IN7 A;  1MGT A;  4EGZ A;  4MGR A;  2WC2 A;  3BZ6 A;  1FY7 A;  1QZY A;  1KU2 A;  2O61 A;  3IL2 A;  2PQ8 A;  3FX3 A;  3K0L A;  5L3B A;  1JHH A;  3WTT C;  1IZ1 A;  3BPX A;  3R0A A;  3F8N A;  5D8L B;  4BHB A;  4LGW A;  4O5V A;  4FT8 A;  4GXO A;  4LB6 B;  4UHT A;  4GYI A;  1EH7 A;  4MQ9 F;  2BE5 F;  1GVJ A;  5CVJ A;  4MEY F;  3FWE A;  2EFP A;  1O7F A;  2DPD A;  1YO5 C;  1DUX C;  4FHT A;  4I01 A;  2ISZ A;  2A68 F;  3K2Z A;  2FNA A;  3MWM A;  5DEQ A;  3FHZ A;  4BHC A;  4I0B A;  4NB5 A;  2ZFW A;  2Q8K A;  2RN7 A;  1FYM A;  4P5O A;  1TW3 A;  1MDM A;  3KLO A;  3FMR A;  3U1D A;  4KYW A;  1HST A;  4JK1 X;  4UVA A;  2XKO A;  3M9A A;  5CYV A;  1W5T A;  3LA2 A;  2OBP A;  2Y48 A;  1ZH5 A;  1G3W A;  2EFN A;  2LF7 A;  4A0Y A;  3HRT A;  3GUD A;  4G7H F;  1HW1 A;  1ODD A;  3I58 A;  5JR3 A;  1F1Z A;  3KP7 A;  3P9I A;  4UV8 A;  3DV8 A;  4ON0 A;  3TO6 A;  5D4R A;  5L3G A;  1SD6 A;  5AON A;  4LK0 F;  3K69 A;  3WE2 A;  4MTD A;  4OU0 A;  1FBQ A;  4KMF A;  4KUM A;  2E1N A;  4H0E A;  2DFI A;  3GZ5 A;  2A07 F;  5K5Q A;  1D5V A;  2WV0 A;  4Y13 A;  3L7W A;  3HOT A;  1GXQ A;  3JSP A;  2IA1 A;  4OIP F;  3DP7 A;  3QPH A;  1J2X A;  1BI2 A;  2VBW A;  4IJA A;  1IN6 A;  2ISY A;  3FXR A;  4Q47 A;  2P5V A;  4CXF A;  3QP5 A;  1RUN A;  2XAQ A;  5FB2 A;  1YW7 A;  3T8T A;  3TO9 A;  5DUI A;  2ZKZ A;  4M9Z A;  1S3J A;  2JSC A;  4BNC A;  1BM9 A;  1S6L A;  3T1B A;  1Z05 A;  1XSV A;  2VE8 A;  4R1H A;  4RAZ A;  5LGT A;  1SD7 A;  2FBK A;  4EVI A;  4PCQ A;  3TQN A;  3I64 A;  4MTE A;  4KIG A;  2QQ9 A;  1OKR A;  2ETH A;  1CF7 B;  4A5M A;  4M6X A;  1X3U A;  2KJB A;  2W25 A;  5LRR A;  2P6T A;  5FO5 A;  4KIF A;  3CTA A;  4I98 B;  4L9J A;  3RDI A;  3TGN A;  2J5O A;  2FE3 A;  1RNL A;  1YG2 A;  2HFH A;  5F1R A;  3COA C;  2K02 A;  2CG4 A;  2BEO A;  3V7C A;  1MZB A;  1T38 A;  1O3Q A;  2D45 A;  2XAF A;  4UUV A;  2O03 A;  3IWF A;  4HA8 A;  4AIJ A;  4GCV A;  1KQ0 A;  3N97 A;  1TW2 A;  3BY6 A;  4JQF A;  1UHM A;  4MNU A;  2VOO A;  1UFM A;  4RB2 C;  3LAJ A;  3SHF A;  2O3F A;  3GLX A;  4ESJ A;  4ENK A;  2BBY A;  3J81 K;  1A04 A;  2K4B A;  4A12 A;  1XGM A;  3W6J B;  2VON A;  1ZYR F;  1FSH A;  2FML A;  3HUG A;  5ERI A;  1XGN A;  1TTY A;  2FOK A;  2VBX A;  4S04 A;  3MAJ A;  3JW4 A;  3BJO A;  4KMU X;  3GZ6 A;  1MKM A;  3I0T A;  1B9N A;  3GWZ A;  1I5Z A;  1IXR C;  1JGS A;  2KKO A;  1R00 A;  4L9N A;  4HYE A;  4EM1 A;  5HVQ C;  1IW7 F;  1RIO H;  3WTW C;  4O3M A;  1IN8 A;  2EV0 A;  3HTU A;  1J7K A;  4BHP A;  1ZG1 A;  1SFU A;  2CO5 A;  2ZBK A;  3F72 A;  5ILS A;  3WTZ A;  3IRQ A;  5JFR A;  4LLG F;  3TDU C;  1EH8 A;  3ZMS A;  1ON1 A;  3I59 A;  3KP2 A;  2Y75 A;  2W85 A;  2QLZ A;  5ILV A;  4P9F A;  1ZLK A;  3SZT A;  5ED4 A;  4RB0 A;  1TNT A;  1K79 A;  3HHH A;  1FLI A;  3R0J A;  5FFZ A;  3JTG A;  2IT0 A;  5LEK A;  4LJZ F;  5DD4 A;  5A2Q K;  1G3T A;  1TQM A;  1R58 A;  3GF2 A;  5K1Y A;  4U0Y A;  1L3L A;  5E18 F;  2IJL A;  2Z3Y A;  5DCM A;  2PN6 A;  2QWW A;  2GWR A;  1S8N A;  3KP3 A;  4L9V A;  3WTX C;  1EH6 A;  4WXD A;  1O7L A;  3R6S A;  4GO1 A;  3TOA A;  4KDP A;  4KIC A;  5FFX A;  1J75 A;  2OZ6 A;  3TDZ C;  4YFK F;  1R1T A;  3F8F A;  1HKT A;  5IT9 Z;  2NYX A;  3QP6 A;  1OMI A;  5LGU A;  3CO7 C;  4R8H A;  4EMS A;  5L3E A;  4HX7 A;  2IRF G;  3Q9S A;  4IHT A;  3QU3 A;  4I0A A;  3F8B A;  1KGS A;  4LK1 F;  2EJR A;  1ZGJ A;  3P9C A;  1ZHF A;  5D5W B;  1ON2 A;  3BRO A;  4UVB A;  3CLO A;  2HKO A;  4KA4 A;  2GXG A;  3RTR A;  2VC0 A;  1SD5 A;  3GFI A;  4BQA A;  2P8T A;  1TLH B;  3HSE A;  3ZP5 A;  4XBF A;  3JAM Z;  1I1S A;  3WE3 A;  3RYP A;  3BP8 A;  1RI7 A;  1KYZ A;  5E1X A;  3ZN1 A;  3GFL A;  3V8L A;  2IVM A;  1FYK A;  1R1U A;  2VC1 A;  4U0W A;  2PLY A;  3MZH A;  1UHW A;  1B9M A;  3RYR A;  3O6B B;  1E17 A;  1HBX G;  3FF5 A;  2M45 A;  2EK5 A;  2H09 A;  2EFQ A;  2DQR A;  4P9U A;  1PP8 F;  2V79 A;  3WTU C;  2E7X A;  2G7U A;  4A5N A;  1DPU A;  2CSO A;  2HR3 A;  1U5T B;  2EA4 A;  1T6S A;  3B73 A;  4G8X A;  1BJA A;  1IXS B;  3PQK A;  3FMQ A;  5IT3 A;  1KU7 A;  1D8J A;  1H0M A;  4OIO F;  2CWE A;  2ZJ2 A;  5E20 A;  5CVV A;  4IRH A;  1CGP A;  5ICF A;  4YG2 F;  4XLP F;  1I6X A;  2M30 A;  5HDG A;  1BIB A;  1LJ9 A;  3PFI A;  4M9S A;  2EV5 A;  2XIG A;  3ELK A;  1LEA A;  1XMK A;  4N9I A;  2K27 A;  5BPI A;  1LQ1 A;  3T5X A;  4ZYD A;  4YFN F;  4HW0 A;  4A0X A;  2QZ8 A;  3CUQ A;  4HLY A;  2WWY A;  5IT9 K;  4HX8 A;  4XRF A;  5J6X A;  4HV6 A;  4EJT A;  5CJ9 A;  1P4A A;  2ELH A;  5AIP A;  3Q9V A;  1TQP A;  4RGU A;  1RUO A;  2UXN A;  2XGX A;  1NHA A;  1HW2 A;  3S2W A;  3REO A;  3LAP A;  3B02 A;  2ZNY A;  2DK8 A;  4EGY A;  3R4K A;  4ZZL A;  5HOO A;  1R5H A;  4N0B A;  4RGX A;  2BV6 A;  1XGS A;  4WCG A;  1U2W A;  3HRS A;  3RIR A;  3F6O A;  2E1C A;  3JTH A;  1FSE A;  2HTJ A;  4ENN A;  5D6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...