5C3EJ

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5c3eJ00
1YRNB 4UUSB 5M5WJ 3HKZN 4DYCA 3JRBA 1RESA 4A3MJ 2IEKA 3UKGA 2O7OA 1WCMJ 2DTZA 3W6VA 4W1UA 4A3GJ 1ETOA 1MSEC 3LOCA 1X2MA 2JN6A 3LSRA 2VUMJ 4M3BA 3GTGJ 2HXIA 1ORKA 5J1YA 2L7ZA 2CUFA 3D1NI 1H8AC 2R7ZJ 5C44J 2HXOA 3HOYJ 3JRHA 2ME6A 2LLKA 1ZKGA 3PO2J 5E3LA 1K83J 4X6AJ 2DN0A 2XPWA 1JT0A 1IG7A 3S16J 2DA6A 5K7FA 1MH4A 1ZQ3P 2WAQN 2EZHA 4JX4A 3LSGA 2LD5A 1ZR2A 5EZGA 2R93J 5EEAA 1G2HA 4XRSA 2JA8J 2P81A 5M3FJ 3G1LA 4B3AA 4Y7NJ 1LE8A 5F1JA 1EF4A 4MFDA 1QVUA 1AU7A 2R92J 2XGEA 5GPCA 5JLWA 2I10A 2LR8A 2PMZN 3LSPA 1APLC 1OCTC 1ITYA 2LVSA 3HOZJ 3HGYA 3GTLJ 2XB5A 5F0FA 5GP9A 2R0QC 2OPTA 3BQZA 5C4JJ 1ZGWA 1IV6A 2COBA 3ZQIA 4V2GA 2XPUA 1JKOC 3TEDA 2HOSA 1P7IA 3CMYA 4D7NA 2NVXJ 2EZIA 3GTQJ 1A5JA 5F27A 1GT0C 5IYCJ 3ZQCA 1JUPA 2DA4A 3S1RJ 1GV2A 4ABZA 3FISA 2IBDA 3I4MJ 2M9HA 2LP0A 3PM1A 1RKTA 1GVDA 2B63J 1IUFA 2G0EA 3CCYA 3TW6A 4MFEA 2Y2ZA 3HB9A 3S17J 3C2BA 5FJ8J 3OOUA 3B6AA 2Y0SN 2MGQA 5J1UA 1JGGA 1VFCA 3QPLA 4C3IJ 3S1QJ 2CRGA 3NAUA 1Y1WJ 1NK2P 4GFBA 1FIAA 2O9LA 4NDLA 4XRSG 1T33A 5EG0A 2K40A 2NS7A 2VKVA 1A6IA 3MKLA 3S2HJ 1MBHA 1YRNA 2O8KA 4B4CA 3SFIA 4FCYA 2DJNA 1SANA 1UMQA 3GTMJ 3DEWA 1VF9A 1W0UA 4M3FA 4AC0A 2TRTA 3FK6A 5FKLA 2NVYJ 2CJJA 1IC8A 1JJ6C 2E2HJ 4B1RA 1TC3C 4A3KJ 3Q0VA 4FISA 3O8HA 3GTJJ 1BJZA 2EZKA 1JT6A 4LOCA 3HGGA 5DTDA 5IPAA 2XB0X 3H3VK 1TWFJ 1H88C 3Q0WA 3ZQHA 3S2DJ 1Z77A 2JA5J 1IDZA 5F0HA 1LFBA 2FQ4A 4A69C 1QRYA 4IEJA 2M2EA 2FJ1A 4DZJA 3OIOA 1AKHA 1IRZA 3O8GA 5JLXA 1K61A 4BY1J 1IGNA 3A03A 2K9QA 3A01B 1ENHA 2E2IJ 1JKPC 2GM4A 3I4NJ 3F0CA 1ZTRA 4W97A 1CQTA 4BBRJ 5C4XJ 1B8IB 4C2MJ 2ZB9A 1I50J 1WH7A 2R5ZA 5EZHA 4FE4A 3B6CA 1MBGA 1B8IA 4IHVA 5C3EJ 1XC5A 4BXXJ 3NARA 2E19A 4A3EJ 1X58A 5E3MA 4HNVA 2DA7A 9ANTA 5F04A 3GTKJ 1WGXA 1ETKA 2NOGA 2OF7A 1ETWA 1MBFA 2M0CA 4CYCA 3H0GJ 3IH3A 4QTRA 1NK3P 4IHWA 1Q1VA 3FIWA 3JRAA 1U78A 2DA2A 2DMQA 5F08A 3HBLA 3ZOBA 1QVTA 1ETQA 2NS8A 1JJ8C 1HLVA 5EGOB 5M5XJ 3OSFA 2L9RA 2RAEA 2XGDA 3K7AJ 1DU0A 2DA3A 1JKQC 2M8GX 3QQAA 3G1OA 3LNQA 2LK2A 4X1EA 2VI6A 1Z0XA 1XG1A 3CDLA 3BG9A 5E3NA 2X9DA 2CU7A 3BR1A 3VPRA 3JRFA 1RR7A 3S1NJ 1GUUA 2HI3A 4BKXA 4M3EA 5J1RA 3JRGA 2JA7J 1MNMC 4A3DJ 1UHSA 1P7JA 3SDGA 4UUSA 2HOAA 2N8GA 5FKKA 4JP0A 3RKQA 1BW5A 5EG0B 3HOXJ 3HOVJ 4BY7J 1FTZA 3BG3A 1I3QJ 2FD5A 2K9SA 1DU6A 1TWGJ 4JYKA 2DMTA 5IYBJ 4A3LJ 1MSFC 4D5CA 1X2NA 1H89C 3K2AA 1XS9A 1ETVA 2GBYA 3HM5A 2IAIA 1LE8B 4I76A 2ID3A 1BL0A 2JK3A 2EBIA 2EZLA 1RETA 3FKIJ 5F0CA 4A3FJ 1OJLA 2TCTA 3BTIA 3CQZJ 3HOUJ 1OFCX 3BR6A 3WHBA 2ID6A 1PUFA 3FK7A 4UUTA 4D7MA 3OSGA 2LFBA 4CYCB 1JUMA 3BG5A 3GBGA 3WHCA 1ETYA 2XSDC 2XPVA 2R5ZB 1F36A 3MVPA 4I6ZA 5K7ZA 1SFOJ 2Y9YA 3BT9A 1GV5A 2XGCA 4C3JJ 4A3IJ 1QPIA 4EEFG 2E1OA 2HOTA 3TP0A 5DS9A 3Q3SA 3S1MJ 2ECCA 2JJ7A 4AUXA 1FTTA 1MH3A 4FE7A 3E7LA 4RDUA 5FLVA 1IJWC 2L0KA 2JA6J 1TWAJ 1U8BA 2AHQA 1TWHJ 3JRCA 3RZDJ 2X6OA 1I6HJ 3L1PA 4C3HJ 2NVTJ 1GDTA 4MIMA 3BR2A 3LSJA 4JX5A 3BR0A 5EDNA 1ZR4A 2KDZA 1HDPA 1F43A 3JRIA 2ME0A 4M6VA 1AHDP 4Y52J 3BR3A 4XICA 4QIWN 3JRDA 1RPWA 2Y30A 4JX6A 5IYDJ 1HOMA 1RKWA 1W0TA 4IHXA 5FKOA 1JKRC 2MG4A 2CQQA 1MBEA 1ZK8A 2YUSA 2VKEA 2E2JJ 4IHYA 2L7MP 1WH5A 1FEXA 1JUSA 2ECBA 3JR9A 4XRMA 4DW6A 4MLOA 5J3LA 3ZQGA 3TW7A 5IOZA 1PUFB 1B72A 2ELKA 3BTJA 3G1MA 4L5EA 5M3MJ 3MN2A 2LKXA 5IP7J 1TWCJ 2HYJA 1JTYA 5IP6A 1E3OC 2EQRA 2JMWA 1OCPA 2QF7A 1T56A 4V2FA 2KT0A 3S14J 3BTCA 2VPRA 4DYQA 1U9OA 2NVQJ 2YU9J 4BBSJ 3A02A 2DMPA 4G12A 4FTHA 2HDDA 4DZPA 2DMNA 3DCFA 3BR5A 2YS9A 2LTPA 5K7HA 4MO7A 1AKHB 2H8RA 3GTPJ 2HQ5A 4RBOA 3A01A 4A93J 5EGOA 4DYRA 1VNDA 1Y1VJ 3GTOJ 1WPKA 2Y9ZA 2DA1A 3IV5A 3HEFA 1R9TJ 4M3GA 1HCRA 1BW6A 3ZQLA 2LY9A 2FX0A 2D5VA 1HDDC 2JWTA 1O4XA 3IH4A 4A3BJ 2CQXA 5EYRA 2L7FP 2WV1A 2W48A 3M3YJ 3Q0UA 2WB1N 4XIDA 5HODA 2DMUA 2Y31A 2MSYA 2M34A 5BNGA 5FLMJ 3JREA 1B72B 5GPAA 1ETXA 3QPSA 1BA5A 4XK4A 1VI0A 2DA5A 1FJLA 3TP3A 3BTLA 1HF0A 4J19A 2MW8A 4M3DA 2X48A 5FKNA 3SJMA 4QSHA 1MBJA 2EH3A 3S15J 2H1KA 4D5FA 5FKMA 3RZOJ 3HOWJ 5IP9J 1U9NA 1FIPA 1D5YA 2QCOA 5M5YJ 4AYBN 5EF6A 4A3JJ 5IOYA 1IDYA 3IH2A 3M4OJ 1LFUP 2R5YB 2CUEA 1POGA 3HDDA 3RQIA 5E3OA 1NTCA 3ZQFA 1S7EA 1JTXA 3BQYA 2R5YA 2K9NA 2GLOA 4A3CJ 1WI3A 4S0HB 1UG2A 3PO3J 1MBKA 2AO9A 2XRLA
chains in the Genus database with same CATH superfamily
1B4AA 2M4GA 3OS0A 4BDYA 5CKTA 3JRBA 2B7EA 1DQUA 2JSCA 2EV6A 2IEKA 2O6GE 2E5ZA 2JUCA 4DIQA 4W1UA 1ETOA 3TKYA 3LOCA 2VUMJ 1YG2A 4M73A 2XIGA 2KL4A 1H9TA 3D1NI 3ESWB 5FGMA 3D5LA 2JQ7A 4HSRA 2DT5A 1H8AC 2R7ZJ 3OYJA 2Z2SB 2A3SA 4LK1F 2FF4A 2HXOA 3R0AA 2LLKA 2M30A 4L0ZB 3IRQA 4HNUA 1F5TA 4OINF 2G7HA 5HDNA 1K83J 2QQ9A 2V26A 3QYBA 3OR2C 2XPWA 1IN8A 1OQYA 3P9CA 1MH4A 1KQ9A 1ZQ3P 2EPFA 5D8KB 2D1HA 5HLIA 2WAQN 3LSGA 2HZDA 5EEAA 3CLQA 4BH9A 2F5VA 2EFWA 2JA8J 4HV5A 1O3QA 2P81A 5M3FJ 1TQPA 3G1LA 4B3AA 2HNHA 1VQ8I 1LDJA 3DWLE 4MFDA 3CC2I 4NC6A 1QVUA 3IKVA 1AU7A 4OAYA 3HC7A 5JVTA 2XGEA 1WRJA 2CYYA 3CF5F 3K4MA 2H27A 1I5ZA 2LR8A 2ZMEA 2PMZN 2E60A 3M8FA 1U3EM 2STTA 4LD5A 1QZZA 4CUGA 3HSFA 2F4IA 4KN7X 1ITYA 5ILVA 3HGYA 4LLNA 4KT6A 4DJAA 4XM3A 2CW0F 3S3MA 2CSOA 2V1DA 4PZJA 4KIBA 3ZQIA 5TRDA 2CUZA 1U6GA 4E7JA 4QWQA 1MDMA 3ZQQA 1JKOC 4GYGA 4CCNA 3TEDA 2KFDA 1P7IA 3W2VA 1ZARA 5L3FA 3I71A 3T8RA 4ZYDA 2GZWA 1JUPA 3S1RJ 2O5RA 2UV1A 5CYVA 4ABZA 3PIOF 3H92A 4H4KC 2Z5UA 2A69F 3DTKA 4LG3A 4OU0A 1DUXC 5D5WB 1K4TA 1H0MA 2EFQA 1IN4A 3PM1A 2G0EA 3OYGA 4PUSA 5HLHA 3IAM2 3C2BA 3OOUA 3DKWA 2Y0SN 3NQOA 3CMMA 5FROA 2E34A 1I39A 2ISZA 4WX9A 4G6QA 2WA0A 2K85A 1VFCA 1ZRDA 2OTLI 3I56I 4LGWA 1NK2P 1FIAA 4P1WA 1VQ5I 1S3JA 4CA0A 4XRSG 1T33A 2E1MC 3VSKA 4XKVA 2VOPA 3DEUA 2VASA 3MFKA 1R00A 2R7DA 3GX4X 3MKLA 1G59A 3S2HJ 5E1WA 3IUOA 4BYYA 1O3SA 3GFJA 2O8KA 1V5EA 1RZ4A 2DJNA 3FBNB 3FM5A 4E7IA 2BXYA 2DODA 2DPDA 3OYDA 3GMEA 1IUYA 1FBSA 3BJ6A 2K02A 2TRTA 3FK6A 4EM1A 4B1RA 1TNSA 4HDVA 2A05A 4CGZA 3DFGA 4KMUX 4A3KJ 4IQJA 4FISA 3CJTB 3JTHA 3H3VK 2KHMA 1X1DA 2XB0X 2IS4A 1HKTA 4XNFA 2QSFX 3LSTA 3L9FA 1PVEA 4KMFA 1LFBA 2QKLB 2ZSHB 1VZ0A 1J5YA 2MC4A 3V8LA 2NYXA 2FQ4A 4A69C 3D0SA 3OIOA 1GHCA 3H35A 4ZDLA 1R71A 3PQKA 3OYMA 3SEQA 5F6FA 4F92B 3A03A 2K9QA 3HPGA 2CUJA 2E2IJ 2GIZA 3I4NJ 2GXGA 4F55A 3KYLA 1RUNA 1VQ4I 1TQIA 1B8IB 3F8FA 2LF8A 1I50J 1P4AA 1Y8RB 4MQVA 1Q1HA 5HS9A 2PG4A 3FF5A 1SAUA 1R23A 3BZCA 1S29A 2HWVA 4TV7A 1MBGA 4YFXF 5CLSA 4XLPF 5C3EJ 1YITI 1XC5A 4IHVA 4C9YA 1AA7A 1R4MB 4BXXJ 1MD0A 4BXFA 5LHIA 4GO1A 2GXAA 4G6DA 1T38A 9ANTA 3EUKL 2W84A 1TW3A 2HOEA 2P6TA 1IW7F 3IAS2 1BC8C 3SXYA 2KP6A 1ETWA 4MQ9F 4RMNA 1A6QA 3ELKA 5LEJA 4E70A 3GXOA 1NK3P 4IHWA 3UR3C 1YOVB 3VYUB 1JXSA 3FIWA 2GOMA 3JRAA 2LC2A 2DA2A 4L5JA 2DMQA 5F08A 3L2CA 3DBRB 5LHHA 4AIKA 5DCMA 1QVTA 1ETQA 1JJ8C 2VPLA 4FX0A 1HLVA 5EGOB 5M5XJ 2KDOA 4E4HA 3L09A 3OSFA 3F8CA 2LH9A 2RAEA 1G3WA 2K27A 3K0LA 3U9GA 2EJRA 4OIOF 3D5RC 3S93A 2WY8Q 3OYFA 2M8GX 1WQ2A 1MJBA 3LNQA 2GA2A 4KYWA 1J9IA 2VI6A 1Z0XA 4YFNF 4CICA 2CU7A 3VPRA 3MZ8A 3QPTA 1RR7A 2RQQA 3S1NJ 3KE2A 4U87A 1SFKA 1LKXA 4AYBA 4N4OB 2N8GA 2X85A 3SYTA 2ZFWA 5EG0B 3HOVJ 4MNUA 1TT0A 2Y48A 4RGSA 5LGNA 1MKMA 3J7AO 1IRGA 1HXDA 1V3FA 2FD5A 3QOPA 3GLLA 1NG6A 3H5RA 1MSFC 3TL4X 1SC7A 5D4RA 2IRFG 2FSWA 3JW4A 4LB5A 1XS9A 1BJAA 1DGRM 5HDGA 4AM3A 2OAZA 3DV8A 2PN6A 2H94A 2XF7A 3MAJA 1MDMB 4HX8A 2CW8A 4A3FJ 2L02A 5ILSA 4RB1A 3HOUJ 2ID6A 2L3DA 3FK7A 3HHHA 3OYEA 3ASOH 3OSGA 3BG5A 3GBGA 2BY2A 2XPVA 2R5ZB 1J59A 3MVPA 2ZO4A 5FRNA 4XQFA 3NWSA 4GCVA 4HBLA 2XROA 3K4JA 3R6SA 3TBIA 3V7RA 2R4GA 1W7PD 3TDZC 3C2HA 3DBLB 5DS9A 1IN5A 4IVNA 1GXQA 3AKZA 3Q3SA 2JJ7A 4JK1X 1FTTA 5B3SH 5LGUA 2FBKA 2QVOA 3A1YA 3FXOA 4G94A 4RDUA 3OYIA 3WTSC 2JA6J 4UXNA 1TWAJ 3JRCA 2VJIA 2J5OA 3WODF 2X6OA 1I6HJ 2GOXB 3FM3A 2Q8KA 3ZMSA 3DPTA 2QGUA 2V79A 3LSJA 2E7XA 2KDZA 1HDPA 5CVIA 1ZREA 1F43A 4HF1A 1FOXA 2ME0A 4RM3A 2QWWA 3ZMVA 2G7UA 3BR3A 4Y52J 4Q47A 4J01A 3DF8A 4R79A 2FMLA 1K6OA 4L9NA 3ABMH 1RPWA 1GXPA 2MABA 3ML6A 1RKWA 1TTYA 4P9FA 3S3OA 3K4KA 4IHXA 3EPZA 1JKRC 5GAGJ 1PUEE 1O7FA 4NNJA 4RAZA 3GFMA 1R58A 5H20A 2E2JJ 2R7WA 2HKOA 1JUSA 3GZ6A 1TT5B 2EA4A 2HYGD 4XLCA 1FPQA 4H0EA 3TW7A 4M74A 2XAQA 1B72A 5FLXZ 3BCBA 4L5EA 4LMYA 1YO5C 3KFWX 2HKXA 2DDBA 4IKFA 1X3WB 2IA1A 2Q2EA 4HF0A 1JTYA 5BOXA 3D5SC 2DTRA 4XLFA 4G7HF 1HKSA 1ON2A 2KT0A 3S14J 5IY5H 3CCQI 4E7ZA 2B9SA 2L9NA 3HPHA 3IWFA 4FTHA 4S04A 2HDDA 3FKJA 1O3TA 1MMAA 4MO7A 2EV0A 2GIVA 2DJIA 4R8HA 4RBOA 1S7AA 4A93J 4D9JA 4A5NA 1Z9CA 2ZJ2A 2KZVA 1QNTA 5D5VB 2X0LA 3K4LA 2Z16A 1R9TJ 1S7OA 1YIOA 1ULYA 4M3GA 1HCRA 1BW6A 2R7UA 2LY9A 3H36A 4A0ZA 4EM2A 3WTWC 2D5VA 3V8JA 1HDDC 4MTDA 1DP7P 2M7BA 1R1VA 4BEHA 1R49A 2JWTA 3CDHA 3IH4A 3HOSA 2W4SA 4LLLA 4LB6B 3FXUA 5CVJA 2QQAA 3DBHB 2K86A 2HTSA 4B43A 3ZMDA 4BL0B 3WTVC 1FMVA 5BNGA 3OL3A 2EIJH 2M34A 4ZYGA 2NNNA 4HYEA 1B72B 2VQGA 1T0FA 1MJ9A 2EILH 3BZ6A 4IL6C 3PUBA 3GYHX 3K70D 1A36A 2WC2A 1PJRA 1WZ2A 5BPIA 1HW5A 4RA2A 2HZTA 3AG3H 1RUOA 5FKNA 1LEBA 3A0HC 2M7AA 1X1AA 1WJDA 4D5FA 2DFHA 3RZOJ 3HOWJ 3HJEA 1FIPA 1MGTA 1NG7A 5M5YJ 1FBQA 2XGXA 2O61A 2R7RA 5DM6F 3ZPLA 2Q0OA 3J7ZI 2L7KA 2R5YB 5DCFA 2M1BA 4KNYA 3RQIA 4Y4RA 5BQTA 2CH0A 2XAJA 1SMYF 4AD9A 3F9KA 3B02A 1S7EA 4K2EA 3BQYA 4ZZLA 1BR1A 1ONVA 2K9NA 2LREA 1HC8A 2DOFA 4S0HB 1UG2A 3RIRA 2CFOA 2BV6A 3T5XA 5JI6A 3MKZA 2XRLA 4AU7A 4ENNA 1YRNB 1V55H 3G3ZA 2ZXHA 4PJ0C 4D1QA 1T98A 2XAUA 3UKGA 1XD7A 2O7OA 2DTZA 4BACA 3W6VA 2ESNA 4A3GJ 3HOTA 4XLAA 1MSEC 3I54A 2HXIA 2I5UA 3DKXA 2L7ZA 3DKYA 4D0PA 2FXAA 2YSRA 2LKPA 3WU1B 3B73A 3KLNA 4KJZA 1IO2A 3GFLA 2XC7A 4HNTA 2ZMEB 1OYIA 5C44J 3NEUA 4PK4A 3LA7A 5DM7F 1EH8A 1R5HA 1YYVA 1G3SA 1Y39A 1KQ0A 1ZKGA 3QP5A 5JFRA 3NWTA 3GWZA 1SFEA 1X1BA 3DP7A 2JRTA 1RIOH 3KZZA 4X6AJ 2DN0A 5LFAA 1JT0A 2DT6A 2E1NA 2L01A 1Y0UA 2QKMB 2DA6A 5K7FA 3AL0C 4CO8A 4RB3C 2EZHA 1B1BA 4JX4A 2LD5A 5EZGA 1G2HA 2BVLA 2QLZA 4A6EA 3G6EI 3F21A 4Y7NJ 2G9WA 2JVHA 2QBYB 5GPCA 5JLWA 4XLHA 3L7WA 3JCUC 2I10A 2K5CA 4A2UA 1K78A 1W36C 3HTUA 4L9JA 3ABLH 4NC8A 3V7SA 2JSPA 5F0FA 3HTSB 5GP9A 1XGMA 3H1CA 1YIJI 2JT1A 2Z99A 1ZGWA 1KYZA 4LITA 1YE9A 4O3MA 2XPUA 3KEOA 1EA3A 2A5WA 2FNAA 3F72A 4HOBA 4I0BA 4WWCA 4I99C 3CMYA 1MZBA 1A5JA 5F27A 5A2QK 2RKHA 3J81K 3VWBA 4ESBA 3FISA 5E79C 5L3GA 1X19A 2EB7A 2IBDA 2PJPA 3I4MJ 4PJLA 2VJ4A 4Y3OA 2B63J 1SVMA 1IUFA 3CCYA 3QU3A 3OY9A 2Y2ZA 5FJ8J 2E1CA 1HA8A 3B6AA 4Y33A 3W3CA 3M8EA 1X1CA 3FMQA 3S1QJ 1HSTA 2CRGA 5KAIC 1D0YA 1Y1WJ 4GFBA 2O9LA 4NDLA 2F4MB 1ZG5A 1SD4A 2K40A 2NS7A 1R1UA 4CXFA 2VKVA 1BI0A 2XRNA 3QRFF 5HNFA 1YFHA 1YW8A 3IL2A 2IW5A 4A6DA 4B4CA 4Z6YA 4FCYA 5KCMA 2FNPA 4UB6C 1TP4A 3GTMJ 1HSJA 4KFCA 3DEWA 3ZXSA 3LFUA 4ETSA 5ICGA 5K5RA 4ZZDA 4ZTFA 1ZLJA 4RS8A 2LSOA 1BJZA 4B3XA 3GTJJ 2UWMA 1JT6A 4LOCA 1FBUA 1JE8A 2OJED 2A6EF 4BAYA 3K6GA 1H9GA 2K7LA 2ISYA 1TWFJ 4G6TB 4HQEA 1T8IA 3ABUA 1BM9A 4YEJA 3Q0WA 4IXAA 3ZQHA 1FZPB 1VQ6I 2JA5J 3S2DJ 5F0HA 4PJMA 3IWZA 1WJAA 2UXXA 4F52A 2RGVA 3VB2A 3PUFA 1WSUA 4UHTA 4Y13A 4IX7A 3F23A 4LJZF 3OYLA 3SDBA 1YX3A 1IRZA 1LEAA 5LRRA 3W2WA 1K61A 1JHFA 2GWRA 1IGNA 5DYMA 1Z6RA 3A01B 1JKPC 3ZN1A 5H2FC 1R7JA 2M4KA 4W97A 2QQ8A 1Z67A 2O8XA 2F5CA 3CJNA 3U21A 2CQKA 4BBRJ 1CQTA 3WG9A 4C2MJ 2DW4A 3BJAA 4II2A 4YG2F 1W36D 4A5MA 3OYNA 4A0XA 3IHUA 5K5OA 2LRDA 2R5ZA 5EZHA 3B6CA 1B8IA 4KUMA 3HRTA 2Z33A 2LNBA 1BR4A 3R61A 4WK8F 4HF2A 3NARA 1YLFA 4A3EJ 1X58A 2OV7A 5L3BA 4KITB 1LDKB 4HNVA 2DA7A 3DPUA 4IO9F 3SEZA 2A61A 4RAFA 1ETKA 5B1BH 1MBFA 3QWLA 2RV8A 4CYCA 1QHGA 3WU2C 1N75A 2VONA 3ZP5A 3IP4B 1P4WA 3HBLA 2VQLA 5E1XA 3ZOBA 3ZCOA 2QA4I 3A4CA 1KZHA 3OOPA 2TDXA 1DU0A 3KYCB 4ZDOA 3J80Z 4Y15A 2YU3A 2VLAA 2DA3A 2IS1A 4QPQA 3U1KA 4P96A 1HW1A 3G1OA 1REPC 4EJVA 3OIPA 3ZMZA 4X1EA 1LJ9A 3BG9A 5E3NA 4YELA 1FSEA 4WCGA 3FMRA 2KRFA 1GUUA 5J1RA 3JRGA 4ENJA 4A3DJ 4NC7A 2PMHA 3EETA 3AFHA 5J47A 4JP0A 3K1MA 3VEPA 3RKQA 5ERIA 2JPCA 3HUGA 4BY7J 3KP7A 3K70C 3LA2A 4OIPF 4EJOA 3W6KB 4EV0A 1K79A 1I3QJ 4LLGF 3H5AA 1DU6A 1TWGJ 4JYKA 2DMTA 3KP5A 3CMAI 4A3LJ 4KIFA 2CGPA 4D5CA 2Y69H 1VQNI 1X2NA 4L18B 4OWRB 3RPQA 1BR2A 1H89C 4RAYA 1FP1D 5FLXK 2GBYA 2IAIA 2K4BA 3ZN0A 4XONA 1BL0A 4Q4ZF 3N4MA 3FKIJ 3R0JA 1AWCA 4Z2YA 2BYVE 4DBQA 1WJBA 3OIQA 2DYSH 4B09A 4G7OF 1PUFA 4D7MA 3FXMA 1STZA 3T8TA 2IGOA 1HKQA 3WHCA 3HRUA 3QYEA 5EEHA 1K78B 2MA3A 2R7TA 1G4DA 2HVSA 2Q1ZB 4GRIA 1SFOJ 3KLOA 1RC9A 2L5QA 2CW7A 2XGCA 4A3IJ 1O7LA 2HQNA 4EEFG 2E1OA 2FOKA 3OL4A 3VODA 4BE0A 1J75A 2DQLA 2W82A 5D5UB 2DQRA 2DOAA 4YFKF 1EV7A 3HHGA 5D6EA 1MMSA 1MH3A 5JVGF 3E7LA 2VE8A 5ICCA 4OIQF 5FD6A 3OV8A 3K9TA 4M6XA 3RZDJ 2WV0A 1ZLKA 2C6YA 4BHPA 4IQ4A 3Q9SA 1B6AA 3PL8A 1GDTA 1KU2A 2ZFUA 3BR0A 1ZR4A 1G3TA 1W4MA 5LLQA 3WGIA 3BLYA 1QPMA 3LSIA 4PFPA 1QHHD 4RGUA 4QIWN 2QM3A 4OIRF 2Y30A 4HEA2 3T0YA 2LDUA 3E3VA 3ABTA 2XF6A 3CCLI 1Z6TA 1IN6A 3BDDA 2Y0MA 1ZK8A 4A0YA 3AAFA 1F1ZA 3OWTA 3ULQB 1YI2I 2FMYA 5K5QA 1FEXA 3WU0A 3JR9A 5FRMA 1OLTA 4XRMA 4X0GA 2H09A 2VE9A 5BPDA 2KZGA 2UUZA 3ZQGA 5IOZA 1U2WA 3BY6A 4ESJA 2ELKA 3BTJA 3G1MA 3MN2A 3F8NA 2AXTC 4YIFA 2PJRB 5IP7J 1TWCJ 1FYLA 1X3UA 3ERMA 2VN2A 3RTRA 2KLOA 4UV9A 1VTNC 3WTTC 3CC4I 2QENA 4AIJA 1T56A 3KX2A 4XKCA 3RI4A 1YHQI 1U9OA 2NVQJ 2YU9J 3A02A 2DMPA 4OMYA 1OKRA 4DZPA 3GUDA 5K7HA 2H8RA 2HQ5A 3EUHC 2FEZA 3E6BA 1WJFA 5J8FA 2RN7A 1ZGAA 3GTOJ 1WPKA 4LFUA 1HW2A 2DA1A 4U0VA 3IV5A 4WXDA 1V54H 1K4SA 3DTEA 3MWMA 3CZ6A 3KP3A 1FP2A 3KEYA 3HZJA 2IGMA 4L5IA 2FUG2 5F1RA 1FOWA 1SVOA 3L2WA 1DP3A 4A3BJ 3N97A 1LQ1A 2XAHA 2X51A 1LDDA 2QSHX 2BW3A 2KJBA 2WB1N 4CCJA 4XIDA 2R7SA 3I55I 2LBFA 4FT8A 1N78A 1QGPA 4I02A 2Y31A 2MSYA 4BHBA 2L4MA 4BQNA 5D5XB 4ANJA 5FLMJ 5GPAA 4FQGA 3GFIA 3H9JA 4BHCA 3Q5FA 2OD5A 1USSA 3C2GA 2Y0SA 2CWEA 5DEQA 1VI0A 1ZYRF 3X2QH 1FJLA 3CO6C 2UZKA 1HF0A 3BG7A 1YQAA 2MW8A 1WI9A 4CDGA 4EMSA 4BJTA 1MBJA 2DYRH 2EH3A 3COAC 5IP9J 4E7KA 2DK5A 2IS2A 4DOZA 2BHYA 4AYBN 5IOYA 4YIRX 1IDYA 4XSZF 1XCVA 1LFUP 5DUKA 2CUEA 1POGA 2GA1A 3GO5A 3HDDA 4AVPA 1QA6A 3SQNA 5E3OA 1NTCA 2HGCA 3ZQFA 3K10A 5ICEA 2A07F 2V1UA 3O3KA 2R5YA 3ROUA 1WI3A 3ZRGA 1MBKA 1WGXA 4UUSB 3KEQA 2H6BA 2CS3A 3W6JB 1M1EB 4EGYA 2D2WA 1RESA 2VQHA 4PSXA 1S9HA 2PMUA 1WCMJ 2XASA 1XGNA 4R1HA 1TZLA 2QZ8A 2CG4A 4RLQA 5J1YA 3WTXC 1FYMA 3JSPA 3K1PA 1W5SA 3J7AY 4UUVA 2CUFA 4KA4A 2VC0A 1D1AA 3TOAA 4ZC3A 2P5KA 2XAFA 3V7CA 1G3YA 2VBXA 1Y6IA 2NAZA 2K9LA 1I27A 1EH6A 3HOYJ 4MTEA 3HKZA 1W7PA 3JRHA 3I58A 3CUQA 2LMDA 2ME6A 1WHUA 2IGKA 4LK0F 1Y8QB 3PO2J 3QOEA 2NVUB 2IT0A 5E3LA 4RGXA 3G73A 4G8XA 1IG7A 1J2XA 2ZNYA 5HLGA 4XOTA 3PO3J 3KZYA 2HYFA 5EEGA 3FZVA 1P2FA 1MNDA 1ZR2A 3KPHA 2MFZA 2STWA 1ON1A 2P0WA 4CCMA 3MEXA 1YTYA 3V4GA 3ZMUA 2NNYA 2LYCA 1IRFA 2DXIA 1PP7U 2NXNB 3GZ5A 2ZJRF 3H0DA 3PFIA 3TOBA 2AXLA 1J09A 3RPUA 3LSPA 3L00A 1APLC 5LD2C 2ESHA 2LVSA 3HOZJ 2M8EA 3L2VA 2R7VA 4RAGA 3GTLJ 2KISA 4DBRA 2ZXJA 3BPXA 2IA2A 3DLLF 1QBJA 1BIBA 2MYSA 5C4JJ 1P9QC 1IV6A 4HAMA 1D8KA 1D1BA 1T2KA 2JZYA 1CF7A 2FBHA 4MGRA 2HOSA 2E36A 4D7NA 2EZIA 2BVMA 2W00A 5JHFA 1GT0C 5IYCJ 3ZQCA 1GV2A 4B44A 2K9MA 2M9HA 3GVAA 2K3PA 2LP0A 1W5CC 5HNHA 1RKTA 3HG9A 5FB2A 2MD0A 3TW6A 3OYBA 2DCEA 4MFEA 4I2OA 2VBWA 3HB9A 3S17J 1P4XA 2V6CA 3MKWB 4RB0A 5ILUA 3C7JA 2DU9A 1BOAA 2XVCA 3WE3A 1JGGA 3BOQA 4XR6A 2PJRA 2RVCA 4BXUA 4C3IJ 3NAUA 3K69A 2V9VA 5GTIC 2XDVA 2YX4A 1BN5A 1DGWY 3BP8A 1A6IA 1V4RA 3VOEA 2KJCA 4IZZA 3R60A 1VQ7I 2EINH 4AIDA 1MMNA 1R5ID 3L2QA 1YJNI 1YRNA 4IHSA 1I1GA 3HIFA 2FOWA 4E7SA 2PEXA 5HOOA 1YS6A 3LAJA 4U88A 1W0UA 4M3FA 3EQLF 4XN0A 2M45A 4RB2C 1JHHA 5FKLA 2NVYJ 4BGDA 4UB8C 1IC8A 3RCOA 1QZEA 2E2HJ 2MLKA 1TC3C 1IAWA 2BBYA 1O3RA 3Q0VA 2EZKA 3MCZA 2ZKZA 2LG4A 5DTDA 1SFUA 2DDAA 1SMTA 4EVIA 1R1TA 1H88C 2XKOA 3VYRB 3KCCA 5DD8A 3MZYA 3SZTA 1E0EA 5CVRA 1IDZA 2HVQA 5D6FA 2W24A 4MHGA 3RPUD 4S05A 1QRYA 3EYIA 4I98B 2HEOA 4F93B 5J4YA 2JPBA 1MMGA 5DV5A 4DZJA 4BE1A 3O8GA 4ENKA 1ERDA 2V9KA 3PIPF 2NS0A 1YW9A 3WGGA 4BY1J 1ENHA 4IRHA 2DPUA 2GM4A 2LOOA 3QYFA 4I0AA 1X4OA 5LRSA 1ZN2A 3ASNH 3E97A 2ZB9A 3EUHA 1MIJA 2RQPA 3UNGC 1MMDA 1R22A 4HRIA 3CJRB 4AWXB 2E35A 5CVVA 3C3WA 5L3CA 4F7ZA 1NH3A 2COMA 5F04A 3FDYA 3GTKJ 2NOGA 2OF7A 2DBBA 2HDWA 1Z91A 2VIXA 3H0GJ 2I8DA 3F8MA 2ADUA 3IH3A 1XX5A 4HZFA 3LQQA 5E17F 1ODDA 1WVRA 3DU6A 4BJ5C 1RNLA 3EYYA 1SAXA 3ZR8X 2HQRA 4JBAA 2WAEA 2Z9OA 2NS8A 4U7BA 3J80K 4HDUA 4UNOA 1XSVA 2L9RA 3R4KA 4EJWA 2XGDA 4RM2A 3K7AJ 1XSDA 3ECHA 1JKQC 3BCAA 3QQAA 4DGWB 3CDIA 1T95A 2VC1A 2FU4A 3EDPA 1WJEA 2LK2A 1KYWA 2DO7A 2EIMH 2YPRA 2DT7B 3LQRA 5TISC 4MEXF 3CDLA 2JA2A 1OMIA 5J6XA 1TL8A 4CCKA 4FHTA 3BR1A 4N9IA 1QZYA 3CCUI 2L54A 4BKXA 4AVZA 2JA7J 3AL0B 1SD7A 3I4PA 3SDGA 4UUSA 2HOAA 3T1BA 1KU7A 4OMZA 1I3AA 3RKWA 4CHUA 5FKKA 2PBIA 1IXCA 3HOXJ 1BW5A 1Y56A 4BU2A 3S32A 1FTZA 3G71I 3FX3A 3ZGKA 2K9SA 2OCEA 5D4SA 5GADJ 3K4NA 5HVQC 3MKYB 3TMOA 3RJPA 2BOLA 3K2AA 1HBXG 1ETVA 1XB4A 3HM5A 1ZG3A 1MJAA 2GQQA 2ID3A 4I76A 1LE8B 2ZMEC 4N0BA 4YRVA 2JK3A 4M71A 4EATA 2EBIA 2M3AA 3DLAA 4IPAA 1N77A 5BMZA 5IT9Z 2HQAA 3CQZJ 4M6YA 1OFCX 3BR6A 2IVMA 3WHBA 1FWZA 3F6VA 5CQEA 5ED4A 4CYCB 1JUMA 1XDSA 1X3ZB 5CJ9A 1ETYA 1F36A 2JTVA 4I6ZA 3A0BC 1PP8F 2XHKA 2AQFA 1FX7A 1UCRA 3BT9A 3KP4A 4FASD 3WTZA 4C3JJ 1FMWA 2VT3A 1OR7A 1T6SA 2ZBKA 3K4BA 1GVJA 3HSEA 3E6CC 1V5FA 4E7HA 3A2KA 2ECCA 3S1MJ 2OBPA 2QQBA 3DEEA 2IXSA 1USTA 2ZSIB 4P55A 5FLVA 1IJWC 4OAZA 1O57A 3PNTA 1D0XA 2P4WA 1UFMA 5AIQA 1A31A 4PJNA 3FXKA 1E2XA 1TWHJ 4PGGA 1P6RA 4BS9A 4ASNA 3CLOA 2WY7Q 2FE3A 1IXRC 3L1PA 4C3HJ 3RKYA 4IOCF 2QEXI 3S3NA 4BUPA 4MIMA 5EDNA 4JX5A 3V8KA 3AG2H 4B8XA 1ZG1A 4L9TA 4M6VA 1AHDP 4XICA 3JRDA 2L9VA 1VQKI 3DTIA 5H6RA 5IYDJ 1HOMA 1W0TA 3IRRA 2OU2A 5FKOA 2CQQA 3S8PA 4O6JA 4M9SA 1LVKA 1SVLA 2YUSA 2VKEA 4BJ6C 1J0RA 4ZYAA 4IHYA 4JQFA 1BI2A 2P5VA 3HSRA 2CV0A 2ECBA 3M07A 2CO5A 2BE5F 2V1XA 2VT2A 4DQ2A 4MLOA 5J3LA 3H5NA 4Y17A 1PUFB 1JI8A 3DPLC 3LSKA 4LIVA 2A6HF 4L9VA 4AIHA 3VYSB 3C1DA 1XTAA 1D8JA 3TDUC 4U0YA 2BY3A 2HYJA 3HRMA 2JRMA 3CC7I 1KA8A 3LFKA 1EH7A 5IP6A 2EQRA 2JMWA 3MZHA 2QF7A 3I0TA 3O6BB 4LG0B 2OC6A 4V2FA 2X1EA 1R4NB 1X4PA 4M9ZA 3BTCA 1ZH5A 4DYQA 4C2UA 3QAHA 1N25A 4HPQA 2KMUA 4G12A 1OCRH 1HQCA 2LTPA 2FRHA 1AKHB 3WGHA 1UZCA 2EA2A 1W5TA 1OR7C 3M1EA 2EIKH 4DYRA 4XKBA 5LHGA 1Y1VJ 4KICA 1XN7A 3ONQA 2Y9ZA 4Q48A 3HEFA 2ZJPF 2BY0A 2BXZA 2Z3YA 3LWFA 3OYAA 2XUBA 2CMPA 2DK8A 3HL2A 1E3PA 2VKDA 5KNLA 3K2ZA 4RLFA 2FX0A 1OISA 1GLNA 3I9V2 2ZC2A 4B47A 3H3UA 2P6SA 2A6TA 2CQXA 2ETHA 1VQ9I 4XBFA 1XCBA 2XKPA 2L7FP 2PQ8A 2WV1A 5K1YA 3DU5A 3M3YJ 1OCOH 3IKTA 4ESFA 5JR3A 5LGTA 2O3FA 1LFPA 4I01A 5HODA 3G4SI 4HV6A 1YJ9I 2BW3B 1C0WA 2PI0A 2X6YA 5B66C 4XLEA 1AOYA 3FWEA 2HFHA 2E5NA 1BA5A 3I59A 2EK5A 4XK4A 3W2AA 2DA5A 4CCOA 4NB5A 2HPMA 2KRCA 1W1WE 4J19A 1MNEA 2X48A 3CTAA 1XSXA 2HR3A 3SJMA 4QSHA 4BDZA 4UVCA 2ELHA 3CP8A 1RR8C 2H1KA 5FKMA 1IZ1A 2KIFA 1D5YA 1U5TC 4N9HA 5EF6A 3HXLA 5FO5A 1YW7A 1XDUA 3IH2A 3M4OJ 3P7NA 2WB1A 1R36A 1YS7A 4G9YA 4B48A 2F6CA 2LY2A 1YJWI 3KP6A 4F91B 2K4JA 1JTXA 2QUFA 1BBYA 2GLOA 1TW2A 4PJJA 3TO6A 3I3LA 3DQVC 1R5GA 5J8CA 2AO9A 2V1NA 5M5WJ 3HKZN 1LUJB 2V4JC 4DYCA 3CO7C 1X1PA 4P9UA 2WBMA 4A3MJ 2V9PA 1BC7C 1B9MA 4GGGA 4PGHA 5KHDA 1Z7UA 3FXQA 2OZ6A 1VQLI 3DXJF 1OCCH 2KIQA 1SD6A 1X2MA 2JN6A 2R7QA 2ZXIA 1YX5A 2XV4S 2M5WA 4M3BA 1ORKA 5TGTA 3LSRA 3E1SA 3QU6A 3GTGJ 3CUOA 2L9SA 2EV5A 3CESA 2QBYA 3LMMA 1U0JA 1Y0NA 3F8BA 2OCCH 4GXOA 4WF2A 4XL9A 5JHUA 5HS7A 3KIOA 1BIAA 4II3A 2OUMA 4KDPA 1WKMA 2BHZA 2ZXWH 1VQPI 2LF7A 3F6OA 2MLGA 3HRSA 4XRFA 4OOIA 5TJJA 2BEOA 2VXDA 1BI1A 1CF7B 4N4NB 1Z3XA 4L0YB 4KIGA 3S16J 2E1MB 2VODA 3F3XA 2DOEA 2R93J 4E6KG 4XRSA 3OS1A 1QU3A 1FNNA 1LE8A 5F1JA 1EF4A 1S6LA 2R92J 3Q9VA 1DPUA 4Q5SF 3OYHA 2D1VA 4A12A 2KIUA 3SZGA 4ENMA 5J40A 1A04A 4BEHB 4BQQA 1OCTC 1UB9A 3CCVI 4FETA 2W85A 2XB5A 2FBIA 1D0ZA 1OYYA 1PDNC 2R0QC 2OPTA 3BQZA 3QODA 4WXHA 2COBA 4PDKA 4XLNF 2W7NA 2VOOA 1WWXA 4V2GA 4NQWB 1Z21A 1KU3A 2WAFA 2QSGX 4QPOA 4HA8A 3CF2A 1XMAA 1K7AA 2NVXJ 3REOA 4XMYA 5E1ZB 3IC7A 5CQGA 3JSOA 1U8RA 3GTQJ 4BNCA 5B5EC 3I64A 2F4OB 2EWNA 3RYRA 2DA4A 4KT5C 2MBFA 4CYDA 1GVDA 4C30A 5DDGA 5L3DA 2OQRA 3BWGA 2KKOA 2H8WA 2VXZA 3HYIA 4HX4A 2VKHA 3P9KA 2MGQA 2PFBA 5J1UA 1KONA 4HSTA 3QPLA 1BI3A 2R3SA 1TNTA 3BPVA 3LL7A 5EG0A 3EUAA 2KIMA 2MH9A 1PYVA 1TQMA 1LB2A 3P9IA 5CPRB 4CH7A 4NQWA 1ZELA 1MBHA 2MH2A 2GAUA 3SFIA 4EGZA 1SANA 5KAFC 1UMQA 5DD4A 1VF9A 2KRHA 1OYWA 2L4AA 4AC0A 5LEKA 3U1DA 4ZTJA 5HS8A 2CJJA 3GZNB 2CV1A 2IS6A 3GCMA 1JJ6C 5A2QZ 4ITVA 5FD5A 1UG0A 3LAPA 1OPCA 2ZCWA 4KISA 2F2EA 4M9XA 2CFXA 3O8HA 5DCMB 2P7CB 4LG0A 2A5YB 2O0YA 2J5PA 3HGGA 5IPAA 3GW2A 2MC3A 2PMZA 1Z77A 2B0LA 2IP2A 2YX7A 2CQ7A 4ON0A 4NUBA 3LSHA 1G6NA 2F5DA 4IEJA 1XGOA 2M2EA 2VBZA 2WAQA 2FJ1A 2XF5A 1AKHA 2M87A 5JLXA 4CCLA 3CCRI 2RNGA 5AIPA 2IPQX 2WADA 4I7HA 1ZRFA 4XORA 3PQJA 4RGRA 2P7VB 1JGSA 2H1LA 3PNYA 1IRXA 3F0CA 2OQGA 1ZTRA 1SEUA 3JAMZ 3RSNA 5C4XJ 2ELJA 2F48A 5DUIA 1WH7A 2L2OA 3TQNA 3JAMK 3J81Z 4FE4A 1UAAA 4XSXF 5E20A 3CCSI 1J7KA 5H6QA 5GTHC 1FSHA 1D5VA 2E19A 2VQCA 4HX7A 5E3MA 4ZJZA 3H9GA 2YR2A 5HLTA 3J7YJ 1QO0D 3K4CA 3FBIB 4PFOA 4BQOA 2LY1A 3QP6A 1FLIA 2M0CA 4QTRA 3JTGA 2K3FA 3CJQB 5FFZA 1Q1VA 3M9AA 1VQMI 4IRIA 1U78A 1F9NA 3ABKH 1UELB 1LNWA 3SZPA 2NRAC 2E7WA 2HTJA 2DFEA 3I59B 4UV8A 4BE2A 2DAOA 5EJCA 1QQIA 2DLLA 3KETA 3N05A 1T0FC 2XSJC 3MD2A 2LKSA 1FC3A 4NBQA 3S2WA 3WE2A 4EQQA 3BG6A 3CUQC 1ZAOA 1KGSA 1XG1A 2X9DA 2IJLA 4QLCU 5F64A 1G8XA 5L3EA 1L0OC 2ICWG 2BY1A 1D1CA 1Z05A 1KU9A 3JRFA 2Z1DA 3WG7H 3RKXA 1ZRCA 2HI3A 4M3EA 2AQEA 3RDIA 1U5TA 1MNMC 1UHSA 1P7JA 3KYDB 5AONA 4IOAF 2X6WA 3M8JA 4XKWA 4EM0B 4GYIA 2WWYA 3PJRA 1A35A 5KK1A 2F5FA 3SFZA 4EJUA 3BG3A 3BROA 4XN3A 4CZCA 5IYBJ 1K6YA 2R7OA 1ACIA 1Z1DA 1FYKA 1D3YA 3H3ZA 1IXSB 4BQAA 3PSIA 2HDCA 4FX4A 2VBYA 3OR1C 3PNVA 4HW0A 3E5XA 2W1OA 2EZLA 1RETA 5F0CA 3FXJA 3I53A 3TO9A 3ERED 1OJLA 3U2RA 1S5LC 2TCTA 3BTIA 4DNCA 4UUTA 3GF2A 1L3LA 1FT9A 3QPHA 2LFBA 1W7PB 2DFIA 2XSDC 3OS2A 1U5TB 3RYPA 2PLYA 2JUGA 1B59A 5E8GA 2OZUA 3K1NA 4U7DA 4IHTA 5K7ZA 5E18F 2Y9YA 2VL8A 1GV5A 4KN4X 2MD5A 1QPIA 3BJOA 2P8TA 2Q2EB 3G2BA 2HOTA 3TP0A 3FHNA 2EFNA 4AUXA 1F4KA 4FE7A 4XOPA 3OYKA 1FOKA 1OCZH 5HDKA 2L0KA 2DI3A 2D45A 4ZYHA 1S72I 1U8BA 2AHQA 4LIUA 2ZJQF 2FQ3A 3WTUC 2M0MA 3F22A 4WXCA 2A68F 6PAXA 2DFFA 2EFOA 4JOMA 4M72A 2NVTJ 2HVRA 2GXBA 3BR2A 3L2UA 5ICFA 5LBQA 3ISPA 3SHFA 3CCMI 2XAGA 3JRIA 4PCQA 5GAEJ 1XPXA 2KQRA 3CUQB 3KZIC 1VQOI 2CV2A 1E17A 1BOBA 3E5UA 1V5GA 4JX6A 4ZYEA 2RDPA 5BS6A 4ZDPA 3V42A 1B9NA 2ZNZA 1T08B 3M7GA 2MG4A 5IT3A 2CQNA 3C18A 1NHAA 4MEYF 1DDNA 4IJAA 1MBEA 4EJTA 1LPQA 4HG2A 2LBFB 2L7MP 1WH5A 1XGSA 1RRJA 2PX9A 4J00A 3LSMA 4DW6A 4F3QA 3CD6I 2FA5A 3H9QA 3HUGB 5CVUA 3BC8A 3E5QA 1ZGJA 4V19K 4UVAA 3GLXA 2E71A 5B1AH 2Y75A 3LA3A 4U0WA 1WJCA 5M3MJ 2LKXA 3VYTB 1T39A 1Z7LA 2O03A 2AS5F 4UY8I 1UHMA 2ACJA 1XMXA 4P5OA 1E3OC 1OCPA 2RREA 1R6RA 4CZZA 2VPRA 3WTYC 4NHJA 2RNJA 4BBSJ 2HPIA 3CCJI 3O2PE 3GEZA 2DMNA 3DCFA 3BR5A 4CSWA 2YS9A 2P5LC 2OA4A 3GTPJ 2W25A 3A01A 1IV8A 3AG1H 3VFZA 5EGOA 1WFXA 1UHWA 1VNDA 2VB6A 1SD5A 2VJ5A 2HU9A 3ZQ7A 4I09A 1UJ8A 3L2RA 3VSLA 2VJJA 1XMKA 2BZTA 5E8IA 3E0JB 3ZQLA 3AG4H 3P5JA 2R7FA 3OYCA 3CMEI 2IGNA 3OMYA 1TLHB 3VDXA 4YIIA 1FOYA 3PFYA 3ECOA 2UXNA 1O4XA 3FXRA 1LVAA 4PSWA 2QYOA 2RC4A 1RI7A 1IN7A 3PSFA 5EYRA 2WTEA 3BZKA 2KPMA 4HLXA 2W48A 4IF4A 5IT9K 2W57A 2X1CA 3Q0UA 1Z3YA 3FHZA 2HS5A 1MW7A 3E6DA 5D8LB 4ZH4F 2DMUA 2X4HA 3TO7A 3JREA 4UVBA 4GDFA 1ZHFA 3CCEI 3I5UA 1TBXA 3M1CA 3TGNA 4E7LA 1EJ9A 2JVGA 3ZMTA 1ETXA 3QPSA 1CGPA 5FFXA 3MMYB 2R7XA 3NRVA 5GAHJ 3TP3A 3BTLA 3FXLA 1I1SA 2F5EA 5KVRA 4M3DA 2V7FA 2X1DA 3CP2A 2V6EA 3S15J 4C2TA 2OTJI 4O5VA 5J4VA 1U9NA 1EKEA 1P92A 3RQ4A 1KQ8A 2BGCA 3E6MA 2QCOA 4A3JJ 2EFPA 1E3HA 1S8NA 3MQ0A 1I6XA 1SFXA 1DPRA 4IRGA 1FY7A 2H6CA 4HQMA 3FMSA 2IA0A 4HLYA 4A3CJ 2NOJB 2X6XA 3KP2A 4G7ZF 1IF1A 1WJ5A
chains in the Genus database with same CATH topology
1YRNB 4UUSB 5M5WJ 3HKZN 4DYCA 3JRBA 1RESA 4A3MJ 2IEKA 3UKGA 2O7OA 1WCMJ 2DTZA 3W6VA 4W1UA 4A3GJ 1ETOA 1MSEC 3LOCA 1X2MA 2JN6A 3LSRA 2VUMJ 4M3BA 3GTGJ 2HXIA 1ORKA 5J1YA 2L7ZA 2CUFA 3D1NI 1H8AC 2R7ZJ 5C44J 2HXOA 3HOYJ 3JRHA 2ME6A 2LLKA 1ZKGA 3PO2J 5E3LA 1K83J 4X6AJ 2DN0A 2XPWA 1JT0A 1IG7A 3S16J 2DA6A 5K7FA 1MH4A 1ZQ3P 2WAQN 2EZHA 4JX4A 3LSGA 2LD5A 1ZR2A 5EZGA 2R93J 5EEAA 1G2HA 4XRSA 2JA8J 2P81A 5M3FJ 3G1LA 4B3AA 4Y7NJ 1LE8A 5F1JA 1EF4A 4MFDA 1QVUA 1AU7A 2R92J 2XGEA 5GPCA 5JLWA 2I10A 2LR8A 2PMZN 3LSPA 1APLC 1OCTC 1ITYA 2LVSA 3HOZJ 3HGYA 3GTLJ 2XB5A 5F0FA 5GP9A 2R0QC 2OPTA 3BQZA 5C4JJ 1ZGWA 1IV6A 2COBA 3ZQIA 4V2GA 2XPUA 1JKOC 3TEDA 2HOSA 1P7IA 3CMYA 4D7NA 2NVXJ 2EZIA 3GTQJ 1A5JA 5F27A 1GT0C 5IYCJ 3ZQCA 1JUPA 2DA4A 3S1RJ 1GV2A 4ABZA 3FISA 2IBDA 3I4MJ 2M9HA 2LP0A 3PM1A 1RKTA 1GVDA 2B63J 1IUFA 2G0EA 3CCYA 3TW6A 4MFEA 2Y2ZA 3HB9A 3S17J 3C2BA 5FJ8J 3OOUA 3B6AA 2Y0SN 2MGQA 5J1UA 1JGGA 1VFCA 3QPLA 4C3IJ 3S1QJ 2CRGA 3NAUA 1Y1WJ 1NK2P 4GFBA 1FIAA 2O9LA 4NDLA 4XRSG 1T33A 5EG0A 2K40A 2NS7A 2VKVA 1A6IA 3MKLA 3S2HJ 1MBHA 1YRNA 2O8KA 4B4CA 3SFIA 4FCYA 2DJNA 1SANA 1UMQA 3GTMJ 3DEWA 1VF9A 1W0UA 4M3FA 4AC0A 2TRTA 3FK6A 5FKLA 2NVYJ 2CJJA 1IC8A 1JJ6C 2E2HJ 4B1RA 1TC3C 4A3KJ 3Q0VA 4FISA 3O8HA 3GTJJ 1BJZA 2EZKA 1JT6A 4LOCA 3HGGA 5DTDA 5IPAA 2XB0X 3H3VK 1TWFJ 1H88C 3Q0WA 3ZQHA 3S2DJ 1Z77A 2JA5J 1IDZA 5F0HA 1LFBA 2FQ4A 4A69C 1QRYA 4IEJA 2M2EA 2FJ1A 4DZJA 3OIOA 1AKHA 1IRZA 3O8GA 5JLXA 1K61A 4BY1J 1IGNA 3A03A 2K9QA 3A01B 1ENHA 2E2IJ 1JKPC 2GM4A 3I4NJ 3F0CA 1ZTRA 4W97A 1CQTA 4BBRJ 5C4XJ 1B8IB 4C2MJ 2ZB9A 1I50J 1WH7A 2R5ZA 5EZHA 4FE4A 3B6CA 1MBGA 1B8IA 4IHVA 5C3EJ 1XC5A 4BXXJ 3NARA 2E19A 4A3EJ 1X58A 5E3MA 4HNVA 2DA7A 9ANTA 5F04A 3GTKJ 1WGXA 1ETKA 2NOGA 2OF7A 1ETWA 1MBFA 2M0CA 4CYCA 3H0GJ 3IH3A 4QTRA 1NK3P 4IHWA 1Q1VA 3FIWA 3JRAA 1U78A 2DA2A 2DMQA 5F08A 3HBLA 3ZOBA 1QVTA 1ETQA 2NS8A 1JJ8C 1HLVA 5EGOB 5M5XJ 3OSFA 2L9RA 2RAEA 2XGDA 3K7AJ 1DU0A 2DA3A 1JKQC 2M8GX 3QQAA 3G1OA 3LNQA 2LK2A 4X1EA 2VI6A 1Z0XA 1XG1A 3CDLA 3BG9A 5E3NA 2X9DA 2CU7A 3BR1A 3VPRA 3JRFA 1RR7A 3S1NJ 1GUUA 2HI3A 4BKXA 4M3EA 5J1RA 3JRGA 2JA7J 1MNMC 4A3DJ 1UHSA 1P7JA 3SDGA 4UUSA 2HOAA 2N8GA 5FKKA 4JP0A 3RKQA 1BW5A 5EG0B 3HOXJ 3HOVJ 4BY7J 1FTZA 3BG3A 1I3QJ 2FD5A 2K9SA 1DU6A 1TWGJ 4JYKA 2DMTA 5IYBJ 4A3LJ 1MSFC 4D5CA 1X2NA 1H89C 3K2AA 1XS9A 1ETVA 2GBYA 3HM5A 2IAIA 1LE8B 4I76A 2ID3A 1BL0A 2JK3A 2EBIA 2EZLA 1RETA 3FKIJ 5F0CA 4A3FJ 1OJLA 2TCTA 3BTIA 3CQZJ 3HOUJ 1OFCX 3BR6A 3WHBA 2ID6A 1PUFA 3FK7A 4UUTA 4D7MA 3OSGA 2LFBA 4CYCB 1JUMA 3BG5A 3GBGA 3WHCA 1ETYA 2XSDC 2XPVA 2R5ZB 1F36A 3MVPA 4I6ZA 5K7ZA 1SFOJ 2Y9YA 3BT9A 1GV5A 2XGCA 4C3JJ 4A3IJ 1QPIA 4EEFG 2E1OA 2HOTA 3TP0A 5DS9A 3Q3SA 3S1MJ 2ECCA 2JJ7A 4AUXA 1FTTA 1MH3A 4FE7A 3E7LA 4RDUA 5FLVA 1IJWC 2L0KA 2JA6J 1TWAJ 1U8BA 2AHQA 1TWHJ 3JRCA 3RZDJ 2X6OA 1I6HJ 3L1PA 4C3HJ 2NVTJ 1GDTA 4MIMA 3BR2A 3LSJA 4JX5A 3BR0A 5EDNA 1ZR4A 2KDZA 1HDPA 1F43A 3JRIA 2ME0A 4M6VA 1AHDP 4Y52J 3BR3A 4XICA 4QIWN 3JRDA 1RPWA 2Y30A 4JX6A 5IYDJ 1HOMA 1RKWA 1W0TA 4IHXA 5FKOA 1JKRC 2MG4A 2CQQA 1MBEA 1ZK8A 2YUSA 2VKEA 2E2JJ 4IHYA 2L7MP 1WH5A 1FEXA 1JUSA 2ECBA 3JR9A 4XRMA 4DW6A 4MLOA 5J3LA 3ZQGA 3TW7A 5IOZA 1PUFB 1B72A 2ELKA 3BTJA 3G1MA 4L5EA 5M3MJ 3MN2A 2LKXA 5IP7J 1TWCJ 2HYJA 1JTYA 5IP6A 1E3OC 2EQRA 2JMWA 1OCPA 2QF7A 1T56A 4V2FA 2KT0A 3S14J 3BTCA 2VPRA 4DYQA 1U9OA 2NVQJ 2YU9J 4BBSJ 3A02A 2DMPA 4G12A 4FTHA 2HDDA 4DZPA 2DMNA 3DCFA 3BR5A 2YS9A 2LTPA 5K7HA 4MO7A 1AKHB 2H8RA 3GTPJ 2HQ5A 4RBOA 3A01A 4A93J 5EGOA 4DYRA 1VNDA 1Y1VJ 3GTOJ 1WPKA 2Y9ZA 2DA1A 3IV5A 3HEFA 1R9TJ 4M3GA 1HCRA 1BW6A 3ZQLA 2LY9A 2FX0A 2D5VA 1HDDC 2JWTA 1O4XA 3IH4A 4A3BJ 2CQXA 5EYRA 2L7FP 2WV1A 2W48A 3M3YJ 3Q0UA 2WB1N 4XIDA 5HODA 2DMUA 2Y31A 2MSYA 2M34A 5BNGA 5FLMJ 3JREA 1B72B 5GPAA 1ETXA 3QPSA 1BA5A 4XK4A 1VI0A 2DA5A 1FJLA 3TP3A 3BTLA 1HF0A 4J19A 2MW8A 4M3DA 2X48A 5FKNA 3SJMA 4QSHA 1MBJA 2EH3A 3S15J 2H1KA 4D5FA 5FKMA 3RZOJ 3HOWJ 5IP9J 1U9NA 1FIPA 1D5YA 2QCOA 5M5YJ 4AYBN 5EF6A 4A3JJ 5IOYA 1IDYA 3IH2A 3M4OJ 1LFUP 2R5YB 2CUEA 1POGA 3HDDA 3RQIA 5E3OA 1NTCA 3ZQFA 1S7EA 1JTXA 3BQYA 2R5YA 2K9NA 2GLOA 4A3CJ 1WI3A 4S0HB 1UG2A 3PO3J 1MBKA 2AO9A 2XRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRN B;  4UUS B;  5M5W J;  3HKZ N;  4DYC A;  3JRB A;  1RES A;  4A3M J;  2IEK A;  3UKG A;  2O7O A;  1WCM J;  2DTZ A;  3W6V A;  4W1U A;  4A3G J;  1ETO A;  1MSE C;  3LOC A;  1X2M A;  2JN6 A;  3LSR A;  2VUM J;  4M3B A;  3GTG J;  2HXI A;  1ORK A;  5J1Y A;  2L7Z A;  2CUF A;  3D1N I;  1H8A C;  2R7Z J;  5C44 J;  2HXO A;  3HOY J;  3JRH A;  2ME6 A;  2LLK A;  1ZKG A;  3PO2 J;  5E3L A;  1K83 J;  4X6A J;  2DN0 A;  2XPW A;  1JT0 A;  1IG7 A;  3S16 J;  2DA6 A;  5K7F A;  1MH4 A;  1ZQ3 P;  2WAQ N;  2EZH A;  4JX4 A;  3LSG A;  2LD5 A;  1ZR2 A;  5EZG A;  2R93 J;  5EEA A;  1G2H A;  4XRS A;  2JA8 J;  2P81 A;  5M3F J;  3G1L A;  4B3A A;  4Y7N J;  1LE8 A;  5F1J A;  1EF4 A;  4MFD A;  1QVU A;  1AU7 A;  2R92 J;  2XGE A;  5GPC A;  5JLW A;  2I10 A;  2LR8 A;  2PMZ N;  3LSP A;  1APL C;  1OCT C;  1ITY A;  2LVS A;  3HOZ J;  3HGY A;  3GTL J;  2XB5 A;  5F0F A;  5GP9 A;  2R0Q C;  2OPT A;  3BQZ A;  5C4J J;  1ZGW A;  1IV6 A;  2COB A;  3ZQI A;  4V2G A;  2XPU A;  1JKO C;  3TED A;  2HOS A;  1P7I A;  3CMY A;  4D7N A;  2NVX J;  2EZI A;  3GTQ J;  1A5J A;  5F27 A;  1GT0 C;  5IYC J;  3ZQC A;  1JUP A;  2DA4 A;  3S1R J;  1GV2 A;  4ABZ A;  3FIS A;  2IBD A;  3I4M J;  2M9H A;  2LP0 A;  3PM1 A;  1RKT A;  1GVD A;  2B63 J;  1IUF A;  2G0E A;  3CCY A;  3TW6 A;  4MFE A;  2Y2Z A;  3HB9 A;  3S17 J;  3C2B A;  5FJ8 J;  3OOU A;  3B6A A;  2Y0S N;  2MGQ A;  5J1U A;  1JGG A;  1VFC A;  3QPL A;  4C3I J;  3S1Q J;  2CRG A;  3NAU A;  1Y1W J;  1NK2 P;  4GFB A;  1FIA A;  2O9L A;  4NDL A;  4XRS G;  1T33 A;  5EG0 A;  2K40 A;  2NS7 A;  2VKV A;  1A6I A;  3MKL A;  3S2H J;  1MBH A;  1YRN A;  2O8K A;  4B4C A;  3SFI A;  4FCY A;  2DJN A;  1SAN A;  1UMQ A;  3GTM J;  3DEW A;  1VF9 A;  1W0U A;  4M3F A;  4AC0 A;  2TRT A;  3FK6 A;  5FKL A;  2NVY J;  2CJJ A;  1IC8 A;  1JJ6 C;  2E2H J;  4B1R A;  1TC3 C;  4A3K J;  3Q0V A;  4FIS A;  3O8H A;  3GTJ J;  1BJZ A;  2EZK A;  1JT6 A;  4LOC A;  3HGG A;  5DTD A;  5IPA A;  2XB0 X;  3H3V K;  1TWF J;  1H88 C;  3Q0W A;  3ZQH A;  3S2D J;  1Z77 A;  2JA5 J;  1IDZ A;  5F0H A;  1LFB A;  2FQ4 A;  4A69 C;  1QRY A;  4IEJ A;  2M2E A;  2FJ1 A;  4DZJ A;  3OIO A;  1AKH A;  1IRZ A;  3O8G A;  5JLX A;  1K61 A;  4BY1 J;  1IGN A;  3A03 A;  2K9Q A;  3A01 B;  1ENH A;  2E2I J;  1JKP C;  2GM4 A;  3I4N J;  3F0C A;  1ZTR A;  4W97 A;  1CQT A;  4BBR J;  5C4X J;  1B8I B;  4C2M J;  2ZB9 A;  1I50 J;  1WH7 A;  2R5Z A;  5EZH A;  4FE4 A;  3B6C A;  1MBG A;  1B8I A;  4IHV A;  5C3E J;  1XC5 A;  4BXX J;  3NAR A;  2E19 A;  4A3E J;  1X58 A;  5E3M A;  4HNV A;  2DA7 A;  9ANT A;  5F04 A;  3GTK J;  1WGX A;  1ETK A;  2NOG A;  2OF7 A;  1ETW A;  1MBF A;  2M0C A;  4CYC A;  3H0G J;  3IH3 A;  4QTR A;  1NK3 P;  4IHW A;  1Q1V A;  3FIW A;  3JRA A;  1U78 A;  2DA2 A;  2DMQ A;  5F08 A;  3HBL A;  3ZOB A;  1QVT A;  1ETQ A;  2NS8 A;  1JJ8 C;  1HLV A;  5EGO B;  5M5X J;  3OSF A;  2L9R A;  2RAE A;  2XGD A;  3K7A J;  1DU0 A;  2DA3 A;  1JKQ C;  2M8G X;  3QQA A;  3G1O A;  3LNQ A;  2LK2 A;  4X1E A;  2VI6 A;  1Z0X A;  1XG1 A;  3CDL A;  3BG9 A;  5E3N A;  2X9D A;  2CU7 A;  3BR1 A;  3VPR A;  3JRF A;  1RR7 A;  3S1N J;  1GUU A;  2HI3 A;  4BKX A;  4M3E A;  5J1R A;  3JRG A;  2JA7 J;  1MNM C;  4A3D J;  1UHS A;  1P7J A;  3SDG A;  4UUS A;  2HOA A;  2N8G A;  5FKK A;  4JP0 A;  3RKQ A;  1BW5 A;  5EG0 B;  3HOX J;  3HOV J;  4BY7 J;  1FTZ A;  3BG3 A;  1I3Q J;  2FD5 A;  2K9S A;  1DU6 A;  1TWG J;  4JYK A;  2DMT A;  5IYB J;  4A3L J;  1MSF C;  4D5C A;  1X2N A;  1H89 C;  3K2A A;  1XS9 A;  1ETV A;  2GBY A;  3HM5 A;  2IAI A;  1LE8 B;  4I76 A;  2ID3 A;  1BL0 A;  2JK3 A;  2EBI A;  2EZL A;  1RET A;  3FKI J;  5F0C A;  4A3F J;  1OJL A;  2TCT A;  3BTI A;  3CQZ J;  3HOU J;  1OFC X;  3BR6 A;  3WHB A;  2ID6 A;  1PUF A;  3FK7 A;  4UUT A;  4D7M A;  3OSG A;  2LFB A;  4CYC B;  1JUM A;  3BG5 A;  3GBG A;  3WHC A;  1ETY A;  2XSD C;  2XPV A;  2R5Z B;  1F36 A;  3MVP A;  4I6Z A;  5K7Z A;  1SFO J;  2Y9Y A;  3BT9 A;  1GV5 A;  2XGC A;  4C3J J;  4A3I J;  1QPI A;  4EEF G;  2E1O A;  2HOT A;  3TP0 A;  5DS9 A;  3Q3S A;  3S1M J;  2ECC A;  2JJ7 A;  4AUX A;  1FTT A;  1MH3 A;  4FE7 A;  3E7L A;  4RDU A;  5FLV A;  1IJW C;  2L0K A;  2JA6 J;  1TWA J;  1U8B A;  2AHQ A;  1TWH J;  3JRC A;  3RZD J;  2X6O A;  1I6H J;  3L1P A;  4C3H J;  2NVT J;  1GDT A;  4MIM A;  3BR2 A;  3LSJ A;  4JX5 A;  3BR0 A;  5EDN A;  1ZR4 A;  2KDZ A;  1HDP A;  1F43 A;  3JRI A;  2ME0 A;  4M6V A;  1AHD P;  4Y52 J;  3BR3 A;  4XIC A;  4QIW N;  3JRD A;  1RPW A;  2Y30 A;  4JX6 A;  5IYD J;  1HOM A;  1RKW A;  1W0T A;  4IHX A;  5FKO A;  1JKR C;  2MG4 A;  2CQQ A;  1MBE A;  1ZK8 A;  2YUS A;  2VKE A;  2E2J J;  4IHY A;  2L7M P;  1WH5 A;  1FEX A;  1JUS A;  2ECB A;  3JR9 A;  4XRM A;  4DW6 A;  4MLO A;  5J3L A;  3ZQG A;  3TW7 A;  5IOZ A;  1PUF B;  1B72 A;  2ELK A;  3BTJ A;  3G1M A;  4L5E A;  5M3M J;  3MN2 A;  2LKX A;  5IP7 J;  1TWC J;  2HYJ A;  1JTY A;  5IP6 A;  1E3O C;  2EQR A;  2JMW A;  1OCP A;  2QF7 A;  1T56 A;  4V2F A;  2KT0 A;  3S14 J;  3BTC A;  2VPR A;  4DYQ A;  1U9O A;  2NVQ J;  2YU9 J;  4BBS J;  3A02 A;  2DMP A;  4G12 A;  4FTH A;  2HDD A;  4DZP A;  2DMN A;  3DCF A;  3BR5 A;  2YS9 A;  2LTP A;  5K7H A;  4MO7 A;  1AKH B;  2H8R A;  3GTP J;  2HQ5 A;  4RBO A;  3A01 A;  4A93 J;  5EGO A;  4DYR A;  1VND A;  1Y1V J;  3GTO J;  1WPK A;  2Y9Z A;  2DA1 A;  3IV5 A;  3HEF A;  1R9T J;  4M3G A;  1HCR A;  1BW6 A;  3ZQL A;  2LY9 A;  2FX0 A;  2D5V A;  1HDD C;  2JWT A;  1O4X A;  3IH4 A;  4A3B J;  2CQX A;  5EYR A;  2L7F P;  2WV1 A;  2W48 A;  3M3Y J;  3Q0U A;  2WB1 N;  4XID A;  5HOD A;  2DMU A;  2Y31 A;  2MSY A;  2M34 A;  5BNG A;  5FLM J;  3JRE A;  1B72 B;  5GPA A;  1ETX A;  3QPS A;  1BA5 A;  4XK4 A;  1VI0 A;  2DA5 A;  1FJL A;  3TP3 A;  3BTL A;  1HF0 A;  4J19 A;  2MW8 A;  4M3D A;  2X48 A;  5FKN A;  3SJM A;  4QSH A;  1MBJ A;  2EH3 A;  3S15 J;  2H1K A;  4D5F A;  5FKM A;  3RZO J;  3HOW J;  5IP9 J;  1U9N A;  1FIP A;  1D5Y A;  2QCO A;  5M5Y J;  4AYB N;  5EF6 A;  4A3J J;  5IOY A;  1IDY A;  3IH2 A;  3M4O J;  1LFU P;  2R5Y B;  2CUE A;  1POG A;  3HDD A;  3RQI A;  5E3O A;  1NTC A;  3ZQF A;  1S7E A;  1JTX A;  3BQY A;  2R5Y A;  2K9N A;  2GLO A;  4A3C J;  1WI3 A;  4S0H B;  1UG2 A;  3PO3 J;  1MBK A;  2AO9 A;  2XRL A; 
#chains in the Genus database with same CATH topology
 1B4A A;  2M4G A;  3OS0 A;  4BDY A;  5CKT A;  3JRB A;  2B7E A;  1DQU A;  2JSC A;  2EV6 A;  2IEK A;  2O6G E;  2E5Z A;  2JUC A;  4DIQ A;  4W1U A;  1ETO A;  3TKY A;  3LOC A;  2VUM J;  1YG2 A;  4M73 A;  2XIG A;  2KL4 A;  1H9T A;  3D1N I;  3ESW B;  5FGM A;  3D5L A;  2JQ7 A;  4HSR A;  2DT5 A;  1H8A C;  2R7Z J;  3OYJ A;  2Z2S B;  2A3S A;  4LK1 F;  2FF4 A;  2HXO A;  3R0A A;  2LLK A;  2M30 A;  4L0Z B;  3IRQ A;  4HNU A;  1F5T A;  4OIN F;  2G7H A;  5HDN A;  1K83 J;  2QQ9 A;  2V26 A;  3QYB A;  3OR2 C;  2XPW A;  1IN8 A;  1OQY A;  3P9C A;  1MH4 A;  1KQ9 A;  1ZQ3 P;  2EPF A;  5D8K B;  2D1H A;  5HLI A;  2WAQ N;  3LSG A;  2HZD A;  5EEA A;  3CLQ A;  4BH9 A;  2F5V A;  2EFW A;  2JA8 J;  4HV5 A;  1O3Q A;  2P81 A;  5M3F J;  1TQP A;  3G1L A;  4B3A A;  2HNH A;  1VQ8 I;  1LDJ A;  3DWL E;  4MFD A;  3CC2 I;  4NC6 A;  1QVU A;  3IKV A;  1AU7 A;  4OAY A;  3HC7 A;  5JVT A;  2XGE A;  1WRJ A;  2CYY A;  3CF5 F;  3K4M A;  2H27 A;  1I5Z A;  2LR8 A;  2ZME A;  2PMZ N;  2E60 A;  3M8F A;  1U3E M;  2STT A;  4LD5 A;  1QZZ A;  4CUG A;  3HSF A;  2F4I A;  4KN7 X;  1ITY A;  5ILV A;  3HGY A;  4LLN A;  4KT6 A;  4DJA A;  4XM3 A;  2CW0 F;  3S3M A;  2CSO A;  2V1D A;  4PZJ A;  4KIB A;  3ZQI A;  5TRD A;  2CUZ A;  1U6G A;  4E7J A;  4QWQ A;  1MDM A;  3ZQQ A;  1JKO C;  4GYG A;  4CCN A;  3TED A;  2KFD A;  1P7I A;  3W2V A;  1ZAR A;  5L3F A;  3I71 A;  3T8R A;  4ZYD A;  2GZW A;  1JUP A;  3S1R J;  2O5R A;  2UV1 A;  5CYV A;  4ABZ A;  3PIO F;  3H92 A;  4H4K C;  2Z5U A;  2A69 F;  3DTK A;  4LG3 A;  4OU0 A;  1DUX C;  5D5W B;  1K4T A;  1H0M A;  2EFQ A;  1IN4 A;  3PM1 A;  2G0E A;  3OYG A;  4PUS A;  5HLH A;  3IAM 2;  3C2B A;  3OOU A;  3DKW A;  2Y0S N;  3NQO A;  3CMM A;  5FRO A;  2E34 A;  1I39 A;  2ISZ A;  4WX9 A;  4G6Q A;  2WA0 A;  2K85 A;  1VFC A;  1ZRD A;  2OTL I;  3I56 I;  4LGW A;  1NK2 P;  1FIA A;  4P1W A;  1VQ5 I;  1S3J A;  4CA0 A;  4XRS G;  1T33 A;  2E1M C;  3VSK A;  4XKV A;  2VOP A;  3DEU A;  2VAS A;  3MFK A;  1R00 A;  2R7D A;  3GX4 X;  3MKL A;  1G59 A;  3S2H J;  5E1W A;  3IUO A;  4BYY A;  1O3S A;  3GFJ A;  2O8K A;  1V5E A;  1RZ4 A;  2DJN A;  3FBN B;  3FM5 A;  4E7I A;  2BXY A;  2DOD A;  2DPD A;  3OYD A;  3GME A;  1IUY A;  1FBS A;  3BJ6 A;  2K02 A;  2TRT A;  3FK6 A;  4EM1 A;  4B1R A;  1TNS A;  4HDV A;  2A05 A;  4CGZ A;  3DFG A;  4KMU X;  4A3K J;  4IQJ A;  4FIS A;  3CJT B;  3JTH A;  3H3V K;  2KHM A;  1X1D A;  2XB0 X;  2IS4 A;  1HKT A;  4XNF A;  2QSF X;  3LST A;  3L9F A;  1PVE A;  4KMF A;  1LFB A;  2QKL B;  2ZSH B;  1VZ0 A;  1J5Y A;  2MC4 A;  3V8L A;  2NYX A;  2FQ4 A;  4A69 C;  3D0S A;  3OIO A;  1GHC A;  3H35 A;  4ZDL A;  1R71 A;  3PQK A;  3OYM A;  3SEQ A;  5F6F A;  4F92 B;  3A03 A;  2K9Q A;  3HPG A;  2CUJ A;  2E2I J;  2GIZ A;  3I4N J;  2GXG A;  4F55 A;  3KYL A;  1RUN A;  1VQ4 I;  1TQI A;  1B8I B;  3F8F A;  2LF8 A;  1I50 J;  1P4A A;  1Y8R B;  4MQV A;  1Q1H A;  5HS9 A;  2PG4 A;  3FF5 A;  1SAU A;  1R23 A;  3BZC A;  1S29 A;  2HWV A;  4TV7 A;  1MBG A;  4YFX F;  5CLS A;  4XLP F;  5C3E J;  1YIT I;  1XC5 A;  4IHV A;  4C9Y A;  1AA7 A;  1R4M B;  4BXX J;  1MD0 A;  4BXF A;  5LHI A;  4GO1 A;  2GXA A;  4G6D A;  1T38 A;  9ANT A;  3EUK L;  2W84 A;  1TW3 A;  2HOE A;  2P6T A;  1IW7 F;  3IAS 2;  1BC8 C;  3SXY A;  2KP6 A;  1ETW A;  4MQ9 F;  4RMN A;  1A6Q A;  3ELK A;  5LEJ A;  4E70 A;  3GXO A;  1NK3 P;  4IHW A;  3UR3 C;  1YOV B;  3VYU B;  1JXS A;  3FIW A;  2GOM A;  3JRA A;  2LC2 A;  2DA2 A;  4L5J A;  2DMQ A;  5F08 A;  3L2C A;  3DBR B;  5LHH A;  4AIK A;  5DCM A;  1QVT A;  1ETQ A;  1JJ8 C;  2VPL A;  4FX0 A;  1HLV A;  5EGO B;  5M5X J;  2KDO A;  4E4H A;  3L09 A;  3OSF A;  3F8C A;  2LH9 A;  2RAE A;  1G3W A;  2K27 A;  3K0L A;  3U9G A;  2EJR A;  4OIO F;  3D5R C;  3S93 A;  2WY8 Q;  3OYF A;  2M8G X;  1WQ2 A;  1MJB A;  3LNQ A;  2GA2 A;  4KYW A;  1J9I A;  2VI6 A;  1Z0X A;  4YFN F;  4CIC A;  2CU7 A;  3VPR A;  3MZ8 A;  3QPT A;  1RR7 A;  2RQQ A;  3S1N J;  3KE2 A;  4U87 A;  1SFK A;  1LKX A;  4AYB A;  4N4O B;  2N8G A;  2X85 A;  3SYT A;  2ZFW A;  5EG0 B;  3HOV J;  4MNU A;  1TT0 A;  2Y48 A;  4RGS A;  5LGN A;  1MKM A;  3J7A O;  1IRG A;  1HXD A;  1V3F A;  2FD5 A;  3QOP A;  3GLL A;  1NG6 A;  3H5R A;  1MSF C;  3TL4 X;  1SC7 A;  5D4R A;  2IRF G;  2FSW A;  3JW4 A;  4LB5 A;  1XS9 A;  1BJA A;  1DGR M;  5HDG A;  4AM3 A;  2OAZ A;  3DV8 A;  2PN6 A;  2H94 A;  2XF7 A;  3MAJ A;  1MDM B;  4HX8 A;  2CW8 A;  4A3F J;  2L02 A;  5ILS A;  4RB1 A;  3HOU J;  2ID6 A;  2L3D A;  3FK7 A;  3HHH A;  3OYE A;  3ASO H;  3OSG A;  3BG5 A;  3GBG A;  2BY2 A;  2XPV A;  2R5Z B;  1J59 A;  3MVP A;  2ZO4 A;  5FRN A;  4XQF A;  3NWS A;  4GCV A;  4HBL A;  2XRO A;  3K4J A;  3R6S A;  3TBI A;  3V7R A;  2R4G A;  1W7P D;  3TDZ C;  3C2H A;  3DBL B;  5DS9 A;  1IN5 A;  4IVN A;  1GXQ A;  3AKZ A;  3Q3S A;  2JJ7 A;  4JK1 X;  1FTT A;  5B3S H;  5LGU A;  2FBK A;  2QVO A;  3A1Y A;  3FXO A;  4G94 A;  4RDU A;  3OYI A;  3WTS C;  2JA6 J;  4UXN A;  1TWA J;  3JRC A;  2VJI A;  2J5O A;  3WOD F;  2X6O A;  1I6H J;  2GOX B;  3FM3 A;  2Q8K A;  3ZMS A;  3DPT A;  2QGU A;  2V79 A;  3LSJ A;  2E7X A;  2KDZ A;  1HDP A;  5CVI A;  1ZRE A;  1F43 A;  4HF1 A;  1FOX A;  2ME0 A;  4RM3 A;  2QWW A;  3ZMV A;  2G7U A;  3BR3 A;  4Y52 J;  4Q47 A;  4J01 A;  3DF8 A;  4R79 A;  2FML A;  1K6O A;  4L9N A;  3ABM H;  1RPW A;  1GXP A;  2MAB A;  3ML6 A;  1RKW A;  1TTY A;  4P9F A;  3S3O A;  3K4K A;  4IHX A;  3EPZ A;  1JKR C;  5GAG J;  1PUE E;  1O7F A;  4NNJ A;  4RAZ A;  3GFM A;  1R58 A;  5H20 A;  2E2J J;  2R7W A;  2HKO A;  1JUS A;  3GZ6 A;  1TT5 B;  2EA4 A;  2HYG D;  4XLC A;  1FPQ A;  4H0E A;  3TW7 A;  4M74 A;  2XAQ A;  1B72 A;  5FLX Z;  3BCB A;  4L5E A;  4LMY A;  1YO5 C;  3KFW X;  2HKX A;  2DDB A;  4IKF A;  1X3W B;  2IA1 A;  2Q2E A;  4HF0 A;  1JTY A;  5BOX A;  3D5S C;  2DTR A;  4XLF A;  4G7H F;  1HKS A;  1ON2 A;  2KT0 A;  3S14 J;  5IY5 H;  3CCQ I;  4E7Z A;  2B9S A;  2L9N A;  3HPH A;  3IWF A;  4FTH A;  4S04 A;  2HDD A;  3FKJ A;  1O3T A;  1MMA A;  4MO7 A;  2EV0 A;  2GIV A;  2DJI A;  4R8H A;  4RBO A;  1S7A A;  4A93 J;  4D9J A;  4A5N A;  1Z9C A;  2ZJ2 A;  2KZV A;  1QNT A;  5D5V B;  2X0L A;  3K4L A;  2Z16 A;  1R9T J;  1S7O A;  1YIO A;  1ULY A;  4M3G A;  1HCR A;  1BW6 A;  2R7U A;  2LY9 A;  3H36 A;  4A0Z A;  4EM2 A;  3WTW C;  2D5V A;  3V8J A;  1HDD C;  4MTD A;  1DP7 P;  2M7B A;  1R1V A;  4BEH A;  1R49 A;  2JWT A;  3CDH A;  3IH4 A;  3HOS A;  2W4S A;  4LLL A;  4LB6 B;  3FXU A;  5CVJ A;  2QQA A;  3DBH B;  2K86 A;  2HTS A;  4B43 A;  3ZMD A;  4BL0 B;  3WTV C;  1FMV A;  5BNG A;  3OL3 A;  2EIJ H;  2M34 A;  4ZYG A;  2NNN A;  4HYE A;  1B72 B;  2VQG A;  1T0F A;  1MJ9 A;  2EIL H;  3BZ6 A;  4IL6 C;  3PUB A;  3GYH X;  3K70 D;  1A36 A;  2WC2 A;  1PJR A;  1WZ2 A;  5BPI A;  1HW5 A;  4RA2 A;  2HZT A;  3AG3 H;  1RUO A;  5FKN A;  1LEB A;  3A0H C;  2M7A A;  1X1A A;  1WJD A;  4D5F A;  2DFH A;  3RZO J;  3HOW J;  3HJE A;  1FIP A;  1MGT A;  1NG7 A;  5M5Y J;  1FBQ A;  2XGX A;  2O61 A;  2R7R A;  5DM6 F;  3ZPL A;  2Q0O A;  3J7Z I;  2L7K A;  2R5Y B;  5DCF A;  2M1B A;  4KNY A;  3RQI A;  4Y4R A;  5BQT A;  2CH0 A;  2XAJ A;  1SMY F;  4AD9 A;  3F9K A;  3B02 A;  1S7E A;  4K2E A;  3BQY A;  4ZZL A;  1BR1 A;  1ONV A;  2K9N A;  2LRE A;  1HC8 A;  2DOF A;  4S0H B;  1UG2 A;  3RIR A;  2CFO A;  2BV6 A;  3T5X A;  5JI6 A;  3MKZ A;  2XRL A;  4AU7 A;  4ENN A;  1YRN B;  1V55 H;  3G3Z A;  2ZXH A;  4PJ0 C;  4D1Q A;  1T98 A;  2XAU A;  3UKG A;  1XD7 A;  2O7O A;  2DTZ A;  4BAC A;  3W6V A;  2ESN A;  4A3G J;  3HOT A;  4XLA A;  1MSE C;  3I54 A;  2HXI A;  2I5U A;  3DKX A;  2L7Z A;  3DKY A;  4D0P A;  2FXA A;  2YSR A;  2LKP A;  3WU1 B;  3B73 A;  3KLN A;  4KJZ A;  1IO2 A;  3GFL A;  2XC7 A;  4HNT A;  2ZME B;  1OYI A;  5C44 J;  3NEU A;  4PK4 A;  3LA7 A;  5DM7 F;  1EH8 A;  1R5H A;  1YYV A;  1G3S A;  1Y39 A;  1KQ0 A;  1ZKG A;  3QP5 A;  5JFR A;  3NWT A;  3GWZ A;  1SFE A;  1X1B A;  3DP7 A;  2JRT A;  1RIO H;  3KZZ A;  4X6A J;  2DN0 A;  5LFA A;  1JT0 A;  2DT6 A;  2E1N A;  2L01 A;  1Y0U A;  2QKM B;  2DA6 A;  5K7F A;  3AL0 C;  4CO8 A;  4RB3 C;  2EZH A;  1B1B A;  4JX4 A;  2LD5 A;  5EZG A;  1G2H A;  2BVL A;  2QLZ A;  4A6E A;  3G6E I;  3F21 A;  4Y7N J;  2G9W A;  2JVH A;  2QBY B;  5GPC A;  5JLW A;  4XLH A;  3L7W A;  3JCU C;  2I10 A;  2K5C A;  4A2U A;  1K78 A;  1W36 C;  3HTU A;  4L9J A;  3ABL H;  4NC8 A;  3V7S A;  2JSP A;  5F0F A;  3HTS B;  5GP9 A;  1XGM A;  3H1C A;  1YIJ I;  2JT1 A;  2Z99 A;  1ZGW A;  1KYZ A;  4LIT A;  1YE9 A;  4O3M A;  2XPU A;  3KEO A;  1EA3 A;  2A5W A;  2FNA A;  3F72 A;  4HOB A;  4I0B A;  4WWC A;  4I99 C;  3CMY A;  1MZB A;  1A5J A;  5F27 A;  5A2Q K;  2RKH A;  3J81 K;  3VWB A;  4ESB A;  3FIS A;  5E79 C;  5L3G A;  1X19 A;  2EB7 A;  2IBD A;  2PJP A;  3I4M J;  4PJL A;  2VJ4 A;  4Y3O A;  2B63 J;  1SVM A;  1IUF A;  3CCY A;  3QU3 A;  3OY9 A;  2Y2Z A;  5FJ8 J;  2E1C A;  1HA8 A;  3B6A A;  4Y33 A;  3W3C A;  3M8E A;  1X1C A;  3FMQ A;  3S1Q J;  1HST A;  2CRG A;  5KAI C;  1D0Y A;  1Y1W J;  4GFB A;  2O9L A;  4NDL A;  2F4M B;  1ZG5 A;  1SD4 A;  2K40 A;  2NS7 A;  1R1U A;  4CXF A;  2VKV A;  1BI0 A;  2XRN A;  3QRF F;  5HNF A;  1YFH A;  1YW8 A;  3IL2 A;  2IW5 A;  4A6D A;  4B4C A;  4Z6Y A;  4FCY A;  5KCM A;  2FNP A;  4UB6 C;  1TP4 A;  3GTM J;  1HSJ A;  4KFC A;  3DEW A;  3ZXS A;  3LFU A;  4ETS A;  5ICG A;  5K5R A;  4ZZD A;  4ZTF A;  1ZLJ A;  4RS8 A;  2LSO A;  1BJZ A;  4B3X A;  3GTJ J;  2UWM A;  1JT6 A;  4LOC A;  1FBU A;  1JE8 A;  2OJE D;  2A6E F;  4BAY A;  3K6G A;  1H9G A;  2K7L A;  2ISY A;  1TWF J;  4G6T B;  4HQE A;  1T8I A;  3ABU A;  1BM9 A;  4YEJ A;  3Q0W A;  4IXA A;  3ZQH A;  1FZP B;  1VQ6 I;  2JA5 J;  3S2D J;  5F0H A;  4PJM A;  3IWZ A;  1WJA A;  2UXX A;  4F52 A;  2RGV A;  3VB2 A;  3PUF A;  1WSU A;  4UHT A;  4Y13 A;  4IX7 A;  3F23 A;  4LJZ F;  3OYL A;  3SDB A;  1YX3 A;  1IRZ A;  1LEA A;  5LRR A;  3W2W A;  1K61 A;  1JHF A;  2GWR A;  1IGN A;  5DYM A;  1Z6R A;  3A01 B;  1JKP C;  3ZN1 A;  5H2F C;  1R7J A;  2M4K A;  4W97 A;  2QQ8 A;  1Z67 A;  2O8X A;  2F5C A;  3CJN A;  3U21 A;  2CQK A;  4BBR J;  1CQT A;  3WG9 A;  4C2M J;  2DW4 A;  3BJA A;  4II2 A;  4YG2 F;  1W36 D;  4A5M A;  3OYN A;  4A0X A;  3IHU A;  5K5O A;  2LRD A;  2R5Z A;  5EZH A;  3B6C A;  1B8I A;  4KUM A;  3HRT A;  2Z33 A;  2LNB A;  1BR4 A;  3R61 A;  4WK8 F;  4HF2 A;  3NAR A;  1YLF A;  4A3E J;  1X58 A;  2OV7 A;  5L3B A;  4KIT B;  1LDK B;  4HNV A;  2DA7 A;  3DPU A;  4IO9 F;  3SEZ A;  2A61 A;  4RAF A;  1ETK A;  5B1B H;  1MBF A;  3QWL A;  2RV8 A;  4CYC A;  1QHG A;  3WU2 C;  1N75 A;  2VON A;  3ZP5 A;  3IP4 B;  1P4W A;  3HBL A;  2VQL A;  5E1X A;  3ZOB A;  3ZCO A;  2QA4 I;  3A4C A;  1KZH A;  3OOP A;  2TDX A;  1DU0 A;  3KYC B;  4ZDO A;  3J80 Z;  4Y15 A;  2YU3 A;  2VLA A;  2DA3 A;  2IS1 A;  4QPQ A;  3U1K A;  4P96 A;  1HW1 A;  3G1O A;  1REP C;  4EJV A;  3OIP A;  3ZMZ A;  4X1E A;  1LJ9 A;  3BG9 A;  5E3N A;  4YEL A;  1FSE A;  4WCG A;  3FMR A;  2KRF A;  1GUU A;  5J1R A;  3JRG A;  4ENJ A;  4A3D J;  4NC7 A;  2PMH A;  3EET A;  3AFH A;  5J47 A;  4JP0 A;  3K1M A;  3VEP A;  3RKQ A;  5ERI A;  2JPC A;  3HUG A;  4BY7 J;  3KP7 A;  3K70 C;  3LA2 A;  4OIP F;  4EJO A;  3W6K B;  4EV0 A;  1K79 A;  1I3Q J;  4LLG F;  3H5A A;  1DU6 A;  1TWG J;  4JYK A;  2DMT A;  3KP5 A;  3CMA I;  4A3L J;  4KIF A;  2CGP A;  4D5C A;  2Y69 H;  1VQN I;  1X2N A;  4L18 B;  4OWR B;  3RPQ A;  1BR2 A;  1H89 C;  4RAY A;  1FP1 D;  5FLX K;  2GBY A;  2IAI A;  2K4B A;  3ZN0 A;  4XON A;  1BL0 A;  4Q4Z F;  3N4M A;  3FKI J;  3R0J A;  1AWC A;  4Z2Y A;  2BYV E;  4DBQ A;  1WJB A;  3OIQ A;  2DYS H;  4B09 A;  4G7O F;  1PUF A;  4D7M A;  3FXM A;  1STZ A;  3T8T A;  2IGO A;  1HKQ A;  3WHC A;  3HRU A;  3QYE A;  5EEH A;  1K78 B;  2MA3 A;  2R7T A;  1G4D A;  2HVS A;  2Q1Z B;  4GRI A;  1SFO J;  3KLO A;  1RC9 A;  2L5Q A;  2CW7 A;  2XGC A;  4A3I J;  1O7L A;  2HQN A;  4EEF G;  2E1O A;  2FOK A;  3OL4 A;  3VOD A;  4BE0 A;  1J75 A;  2DQL A;  2W82 A;  5D5U B;  2DQR A;  2DOA A;  4YFK F;  1EV7 A;  3HHG A;  5D6E A;  1MMS A;  1MH3 A;  5JVG F;  3E7L A;  2VE8 A;  5ICC A;  4OIQ F;  5FD6 A;  3OV8 A;  3K9T A;  4M6X A;  3RZD J;  2WV0 A;  1ZLK A;  2C6Y A;  4BHP A;  4IQ4 A;  3Q9S A;  1B6A A;  3PL8 A;  1GDT A;  1KU2 A;  2ZFU A;  3BR0 A;  1ZR4 A;  1G3T A;  1W4M A;  5LLQ A;  3WGI A;  3BLY A;  1QPM A;  3LSI A;  4PFP A;  1QHH D;  4RGU A;  4QIW N;  2QM3 A;  4OIR F;  2Y30 A;  4HEA 2;  3T0Y A;  2LDU A;  3E3V A;  3ABT A;  2XF6 A;  3CCL I;  1Z6T A;  1IN6 A;  3BDD A;  2Y0M A;  1ZK8 A;  4A0Y A;  3AAF A;  1F1Z A;  3OWT A;  3ULQ B;  1YI2 I;  2FMY A;  5K5Q A;  1FEX A;  3WU0 A;  3JR9 A;  5FRM A;  1OLT A;  4XRM A;  4X0G A;  2H09 A;  2VE9 A;  5BPD A;  2KZG A;  2UUZ A;  3ZQG A;  5IOZ A;  1U2W A;  3BY6 A;  4ESJ A;  2ELK A;  3BTJ A;  3G1M A;  3MN2 A;  3F8N A;  2AXT C;  4YIF A;  2PJR B;  5IP7 J;  1TWC J;  1FYL A;  1X3U A;  3ERM A;  2VN2 A;  3RTR A;  2KLO A;  4UV9 A;  1VTN C;  3WTT C;  3CC4 I;  2QEN A;  4AIJ A;  1T56 A;  3KX2 A;  4XKC A;  3RI4 A;  1YHQ I;  1U9O A;  2NVQ J;  2YU9 J;  3A02 A;  2DMP A;  4OMY A;  1OKR A;  4DZP A;  3GUD A;  5K7H A;  2H8R A;  2HQ5 A;  3EUH C;  2FEZ A;  3E6B A;  1WJF A;  5J8F A;  2RN7 A;  1ZGA A;  3GTO J;  1WPK A;  4LFU A;  1HW2 A;  2DA1 A;  4U0V A;  3IV5 A;  4WXD A;  1V54 H;  1K4S A;  3DTE A;  3MWM A;  3CZ6 A;  3KP3 A;  1FP2 A;  3KEY A;  3HZJ A;  2IGM A;  4L5I A;  2FUG 2;  5F1R A;  1FOW A;  1SVO A;  3L2W A;  1DP3 A;  4A3B J;  3N97 A;  1LQ1 A;  2XAH A;  2X51 A;  1LDD A;  2QSH X;  2BW3 A;  2KJB A;  2WB1 N;  4CCJ A;  4XID A;  2R7S A;  3I55 I;  2LBF A;  4FT8 A;  1N78 A;  1QGP A;  4I02 A;  2Y31 A;  2MSY A;  4BHB A;  2L4M A;  4BQN A;  5D5X B;  4ANJ A;  5FLM J;  5GPA A;  4FQG A;  3GFI A;  3H9J A;  4BHC A;  3Q5F A;  2OD5 A;  1USS A;  3C2G A;  2Y0S A;  2CWE A;  5DEQ A;  1VI0 A;  1ZYR F;  3X2Q H;  1FJL A;  3CO6 C;  2UZK A;  1HF0 A;  3BG7 A;  1YQA A;  2MW8 A;  1WI9 A;  4CDG A;  4EMS A;  4BJT A;  1MBJ A;  2DYR H;  2EH3 A;  3COA C;  5IP9 J;  4E7K A;  2DK5 A;  2IS2 A;  4DOZ A;  2BHY A;  4AYB N;  5IOY A;  4YIR X;  1IDY A;  4XSZ F;  1XCV A;  1LFU P;  5DUK A;  2CUE A;  1POG A;  2GA1 A;  3GO5 A;  3HDD A;  4AVP A;  1QA6 A;  3SQN A;  5E3O A;  1NTC A;  2HGC A;  3ZQF A;  3K10 A;  5ICE A;  2A07 F;  2V1U A;  3O3K A;  2R5Y A;  3ROU A;  1WI3 A;  3ZRG A;  1MBK A;  1WGX A;  4UUS B;  3KEQ A;  2H6B A;  2CS3 A;  3W6J B;  1M1E B;  4EGY A;  2D2W A;  1RES A;  2VQH A;  4PSX A;  1S9H A;  2PMU A;  1WCM J;  2XAS A;  1XGN A;  4R1H A;  1TZL A;  2QZ8 A;  2CG4 A;  4RLQ A;  5J1Y A;  3WTX C;  1FYM A;  3JSP A;  3K1P A;  1W5S A;  3J7A Y;  4UUV A;  2CUF A;  4KA4 A;  2VC0 A;  1D1A A;  3TOA A;  4ZC3 A;  2P5K A;  2XAF A;  3V7C A;  1G3Y A;  2VBX A;  1Y6I A;  2NAZ A;  2K9L A;  1I27 A;  1EH6 A;  3HOY J;  4MTE A;  3HKZ A;  1W7P A;  3JRH A;  3I58 A;  3CUQ A;  2LMD A;  2ME6 A;  1WHU A;  2IGK A;  4LK0 F;  1Y8Q B;  3PO2 J;  3QOE A;  2NVU B;  2IT0 A;  5E3L A;  4RGX A;  3G73 A;  4G8X A;  1IG7 A;  1J2X A;  2ZNY A;  5HLG A;  4XOT A;  3PO3 J;  3KZY A;  2HYF A;  5EEG A;  3FZV A;  1P2F A;  1MND A;  1ZR2 A;  3KPH A;  2MFZ A;  2STW A;  1ON1 A;  2P0W A;  4CCM A;  3MEX A;  1YTY A;  3V4G A;  3ZMU A;  2NNY A;  2LYC A;  1IRF A;  2DXI A;  1PP7 U;  2NXN B;  3GZ5 A;  2ZJR F;  3H0D A;  3PFI A;  3TOB A;  2AXL A;  1J09 A;  3RPU A;  3LSP A;  3L00 A;  1APL C;  5LD2 C;  2ESH A;  2LVS A;  3HOZ J;  2M8E A;  3L2V A;  2R7V A;  4RAG A;  3GTL J;  2KIS A;  4DBR A;  2ZXJ A;  3BPX A;  2IA2 A;  3DLL F;  1QBJ A;  1BIB A;  2MYS A;  5C4J J;  1P9Q C;  1IV6 A;  4HAM A;  1D8K A;  1D1B A;  1T2K A;  2JZY A;  1CF7 A;  2FBH A;  4MGR A;  2HOS A;  2E36 A;  4D7N A;  2EZI A;  2BVM A;  2W00 A;  5JHF A;  1GT0 C;  5IYC J;  3ZQC A;  1GV2 A;  4B44 A;  2K9M A;  2M9H A;  3GVA A;  2K3P A;  2LP0 A;  1W5C C;  5HNH A;  1RKT A;  3HG9 A;  5FB2 A;  2MD0 A;  3TW6 A;  3OYB A;  2DCE A;  4MFE A;  4I2O A;  2VBW A;  3HB9 A;  3S17 J;  1P4X A;  2V6C A;  3MKW B;  4RB0 A;  5ILU A;  3C7J A;  2DU9 A;  1BOA A;  2XVC A;  3WE3 A;  1JGG A;  3BOQ A;  4XR6 A;  2PJR A;  2RVC A;  4BXU A;  4C3I J;  3NAU A;  3K69 A;  2V9V A;  5GTI C;  2XDV A;  2YX4 A;  1BN5 A;  1DGW Y;  3BP8 A;  1A6I A;  1V4R A;  3VOE A;  2KJC A;  4IZZ A;  3R60 A;  1VQ7 I;  2EIN H;  4AID A;  1MMN A;  1R5I D;  3L2Q A;  1YJN I;  1YRN A;  4IHS A;  1I1G A;  3HIF A;  2FOW A;  4E7S A;  2PEX A;  5HOO A;  1YS6 A;  3LAJ A;  4U88 A;  1W0U A;  4M3F A;  3EQL F;  4XN0 A;  2M45 A;  4RB2 C;  1JHH A;  5FKL A;  2NVY J;  4BGD A;  4UB8 C;  1IC8 A;  3RCO A;  1QZE A;  2E2H J;  2MLK A;  1TC3 C;  1IAW A;  2BBY A;  1O3R A;  3Q0V A;  2EZK A;  3MCZ A;  2ZKZ A;  2LG4 A;  5DTD A;  1SFU A;  2DDA A;  1SMT A;  4EVI A;  1R1T A;  1H88 C;  2XKO A;  3VYR B;  3KCC A;  5DD8 A;  3MZY A;  3SZT A;  1E0E A;  5CVR A;  1IDZ A;  2HVQ A;  5D6F A;  2W24 A;  4MHG A;  3RPU D;  4S05 A;  1QRY A;  3EYI A;  4I98 B;  2HEO A;  4F93 B;  5J4Y A;  2JPB A;  1MMG A;  5DV5 A;  4DZJ A;  4BE1 A;  3O8G A;  4ENK A;  1ERD A;  2V9K A;  3PIP F;  2NS0 A;  1YW9 A;  3WGG A;  4BY1 J;  1ENH A;  4IRH A;  2DPU A;  2GM4 A;  2LOO A;  3QYF A;  4I0A A;  1X4O A;  5LRS A;  1ZN2 A;  3ASN H;  3E97 A;  2ZB9 A;  3EUH A;  1MIJ A;  2RQP A;  3UNG C;  1MMD A;  1R22 A;  4HRI A;  3CJR B;  4AWX B;  2E35 A;  5CVV A;  3C3W A;  5L3C A;  4F7Z A;  1NH3 A;  2COM A;  5F04 A;  3FDY A;  3GTK J;  2NOG A;  2OF7 A;  2DBB A;  2HDW A;  1Z91 A;  2VIX A;  3H0G J;  2I8D A;  3F8M A;  2ADU A;  3IH3 A;  1XX5 A;  4HZF A;  3LQQ A;  5E17 F;  1ODD A;  1WVR A;  3DU6 A;  4BJ5 C;  1RNL A;  3EYY A;  1SAX A;  3ZR8 X;  2HQR A;  4JBA A;  2WAE A;  2Z9O A;  2NS8 A;  4U7B A;  3J80 K;  4HDU A;  4UNO A;  1XSV A;  2L9R A;  3R4K A;  4EJW A;  2XGD A;  4RM2 A;  3K7A J;  1XSD A;  3ECH A;  1JKQ C;  3BCA A;  3QQA A;  4DGW B;  3CDI A;  1T95 A;  2VC1 A;  2FU4 A;  3EDP A;  1WJE A;  2LK2 A;  1KYW A;  2DO7 A;  2EIM H;  2YPR A;  2DT7 B;  3LQR A;  5TIS C;  4MEX F;  3CDL A;  2JA2 A;  1OMI A;  5J6X A;  1TL8 A;  4CCK A;  4FHT A;  3BR1 A;  4N9I A;  1QZY A;  3CCU I;  2L54 A;  4BKX A;  4AVZ A;  2JA7 J;  3AL0 B;  1SD7 A;  3I4P A;  3SDG A;  4UUS A;  2HOA A;  3T1B A;  1KU7 A;  4OMZ A;  1I3A A;  3RKW A;  4CHU A;  5FKK A;  2PBI A;  1IXC A;  3HOX J;  1BW5 A;  1Y56 A;  4BU2 A;  3S32 A;  1FTZ A;  3G71 I;  3FX3 A;  3ZGK A;  2K9S A;  2OCE A;  5D4S A;  5GAD J;  3K4N A;  5HVQ C;  3MKY B;  3TMO A;  3RJP A;  2BOL A;  3K2A A;  1HBX G;  1ETV A;  1XB4 A;  3HM5 A;  1ZG3 A;  1MJA A;  2GQQ A;  2ID3 A;  4I76 A;  1LE8 B;  2ZME C;  4N0B A;  4YRV A;  2JK3 A;  4M71 A;  4EAT A;  2EBI A;  2M3A A;  3DLA A;  4IPA A;  1N77 A;  5BMZ A;  5IT9 Z;  2HQA A;  3CQZ J;  4M6Y A;  1OFC X;  3BR6 A;  2IVM A;  3WHB A;  1FWZ A;  3F6V A;  5CQE A;  5ED4 A;  4CYC B;  1JUM A;  1XDS A;  1X3Z B;  5CJ9 A;  1ETY A;  1F36 A;  2JTV A;  4I6Z A;  3A0B C;  1PP8 F;  2XHK A;  2AQF A;  1FX7 A;  1UCR A;  3BT9 A;  3KP4 A;  4FAS D;  3WTZ A;  4C3J J;  1FMW A;  2VT3 A;  1OR7 A;  1T6S A;  2ZBK A;  3K4B A;  1GVJ A;  3HSE A;  3E6C C;  1V5F A;  4E7H A;  3A2K A;  2ECC A;  3S1M J;  2OBP A;  2QQB A;  3DEE A;  2IXS A;  1UST A;  2ZSI B;  4P55 A;  5FLV A;  1IJW C;  4OAZ A;  1O57 A;  3PNT A;  1D0X A;  2P4W A;  1UFM A;  5AIQ A;  1A31 A;  4PJN A;  3FXK A;  1E2X A;  1TWH J;  4PGG A;  1P6R A;  4BS9 A;  4ASN A;  3CLO A;  2WY7 Q;  2FE3 A;  1IXR C;  3L1P A;  4C3H J;  3RKY A;  4IOC F;  2QEX I;  3S3N A;  4BUP A;  4MIM A;  5EDN A;  4JX5 A;  3V8K A;  3AG2 H;  4B8X A;  1ZG1 A;  4L9T A;  4M6V A;  1AHD P;  4XIC A;  3JRD A;  2L9V A;  1VQK I;  3DTI A;  5H6R A;  5IYD J;  1HOM A;  1W0T A;  3IRR A;  2OU2 A;  5FKO A;  2CQQ A;  3S8P A;  4O6J A;  4M9S A;  1LVK A;  1SVL A;  2YUS A;  2VKE A;  4BJ6 C;  1J0R A;  4ZYA A;  4IHY A;  4JQF A;  1BI2 A;  2P5V A;  3HSR A;  2CV0 A;  2ECB A;  3M07 A;  2CO5 A;  2BE5 F;  2V1X A;  2VT2 A;  4DQ2 A;  4MLO A;  5J3L A;  3H5N A;  4Y17 A;  1PUF B;  1JI8 A;  3DPL C;  3LSK A;  4LIV A;  2A6H F;  4L9V A;  4AIH A;  3VYS B;  3C1D A;  1XTA A;  1D8J A;  3TDU C;  4U0Y A;  2BY3 A;  2HYJ A;  3HRM A;  2JRM A;  3CC7 I;  1KA8 A;  3LFK A;  1EH7 A;  5IP6 A;  2EQR A;  2JMW A;  3MZH A;  2QF7 A;  3I0T A;  3O6B B;  4LG0 B;  2OC6 A;  4V2F A;  2X1E A;  1R4N B;  1X4P A;  4M9Z A;  3BTC A;  1ZH5 A;  4DYQ A;  4C2U A;  3QAH A;  1N25 A;  4HPQ A;  2KMU A;  4G12 A;  1OCR H;  1HQC A;  2LTP A;  2FRH A;  1AKH B;  3WGH A;  1UZC A;  2EA2 A;  1W5T A;  1OR7 C;  3M1E A;  2EIK H;  4DYR A;  4XKB A;  5LHG A;  1Y1V J;  4KIC A;  1XN7 A;  3ONQ A;  2Y9Z A;  4Q48 A;  3HEF A;  2ZJP F;  2BY0 A;  2BXZ A;  2Z3Y A;  3LWF A;  3OYA A;  2XUB A;  2CMP A;  2DK8 A;  3HL2 A;  1E3P A;  2VKD A;  5KNL A;  3K2Z A;  4RLF A;  2FX0 A;  1OIS A;  1GLN A;  3I9V 2;  2ZC2 A;  4B47 A;  3H3U A;  2P6S A;  2A6T A;  2CQX A;  2ETH A;  1VQ9 I;  4XBF A;  1XCB A;  2XKP A;  2L7F P;  2PQ8 A;  2WV1 A;  5K1Y A;  3DU5 A;  3M3Y J;  1OCO H;  3IKT A;  4ESF A;  5JR3 A;  5LGT A;  2O3F A;  1LFP A;  4I01 A;  5HOD A;  3G4S I;  4HV6 A;  1YJ9 I;  2BW3 B;  1C0W A;  2PI0 A;  2X6Y A;  5B66 C;  4XLE A;  1AOY A;  3FWE A;  2HFH A;  2E5N A;  1BA5 A;  3I59 A;  2EK5 A;  4XK4 A;  3W2A A;  2DA5 A;  4CCO A;  4NB5 A;  2HPM A;  2KRC A;  1W1W E;  4J19 A;  1MNE A;  2X48 A;  3CTA A;  1XSX A;  2HR3 A;  3SJM A;  4QSH A;  4BDZ A;  4UVC A;  2ELH A;  3CP8 A;  1RR8 C;  2H1K A;  5FKM A;  1IZ1 A;  2KIF A;  1D5Y A;  1U5T C;  4N9H A;  5EF6 A;  3HXL A;  5FO5 A;  1YW7 A;  1XDU A;  3IH2 A;  3M4O J;  3P7N A;  2WB1 A;  1R36 A;  1YS7 A;  4G9Y A;  4B48 A;  2F6C A;  2LY2 A;  1YJW I;  3KP6 A;  4F91 B;  2K4J A;  1JTX A;  2QUF A;  1BBY A;  2GLO A;  1TW2 A;  4PJJ A;  3TO6 A;  3I3L A;  3DQV C;  1R5G A;  5J8C A;  2AO9 A;  2V1N A;  5M5W J;  3HKZ N;  1LUJ B;  2V4J C;  4DYC A;  3CO7 C;  1X1P A;  4P9U A;  2WBM A;  4A3M J;  2V9P A;  1BC7 C;  1B9M A;  4GGG A;  4PGH A;  5KHD A;  1Z7U A;  3FXQ A;  2OZ6 A;  1VQL I;  3DXJ F;  1OCC H;  2KIQ A;  1SD6 A;  1X2M A;  2JN6 A;  2R7Q A;  2ZXI A;  1YX5 A;  2XV4 S;  2M5W A;  4M3B A;  1ORK A;  5TGT A;  3LSR A;  3E1S A;  3QU6 A;  3GTG J;  3CUO A;  2L9S A;  2EV5 A;  3CES A;  2QBY A;  3LMM A;  1U0J A;  1Y0N A;  3F8B A;  2OCC H;  4GXO A;  4WF2 A;  4XL9 A;  5JHU A;  5HS7 A;  3KIO A;  1BIA A;  4II3 A;  2OUM A;  4KDP A;  1WKM A;  2BHZ A;  2ZXW H;  1VQP I;  2LF7 A;  3F6O A;  2MLG A;  3HRS A;  4XRF A;  4OOI A;  5TJJ A;  2BEO A;  2VXD A;  1BI1 A;  1CF7 B;  4N4N B;  1Z3X A;  4L0Y B;  4KIG A;  3S16 J;  2E1M B;  2VOD A;  3F3X A;  2DOE A;  2R93 J;  4E6K G;  4XRS A;  3OS1 A;  1QU3 A;  1FNN A;  1LE8 A;  5F1J A;  1EF4 A;  1S6L A;  2R92 J;  3Q9V A;  1DPU A;  4Q5S F;  3OYH A;  2D1V A;  4A12 A;  2KIU A;  3SZG A;  4ENM A;  5J40 A;  1A04 A;  4BEH B;  4BQQ A;  1OCT C;  1UB9 A;  3CCV I;  4FET A;  2W85 A;  2XB5 A;  2FBI A;  1D0Z A;  1OYY A;  1PDN C;  2R0Q C;  2OPT A;  3BQZ A;  3QOD A;  4WXH A;  2COB A;  4PDK A;  4XLN F;  2W7N A;  2VOO A;  1WWX A;  4V2G A;  4NQW B;  1Z21 A;  1KU3 A;  2WAF A;  2QSG X;  4QPO A;  4HA8 A;  3CF2 A;  1XMA A;  1K7A A;  2NVX J;  3REO A;  4XMY A;  5E1Z B;  3IC7 A;  5CQG A;  3JSO A;  1U8R A;  3GTQ J;  4BNC A;  5B5E C;  3I64 A;  2F4O B;  2EWN A;  3RYR A;  2DA4 A;  4KT5 C;  2MBF A;  4CYD A;  1GVD A;  4C30 A;  5DDG A;  5L3D A;  2OQR A;  3BWG A;  2KKO A;  2H8W A;  2VXZ A;  3HYI A;  4HX4 A;  2VKH A;  3P9K A;  2MGQ A;  2PFB A;  5J1U A;  1KON A;  4HST A;  3QPL A;  1BI3 A;  2R3S A;  1TNT A;  3BPV A;  3LL7 A;  5EG0 A;  3EUA A;  2KIM A;  2MH9 A;  1PYV A;  1TQM A;  1LB2 A;  3P9I A;  5CPR B;  4CH7 A;  4NQW A;  1ZEL A;  1MBH A;  2MH2 A;  2GAU A;  3SFI A;  4EGZ A;  1SAN A;  5KAF C;  1UMQ A;  5DD4 A;  1VF9 A;  2KRH A;  1OYW A;  2L4A A;  4AC0 A;  5LEK A;  3U1D A;  4ZTJ A;  5HS8 A;  2CJJ A;  3GZN B;  2CV1 A;  2IS6 A;  3GCM A;  1JJ6 C;  5A2Q Z;  4ITV A;  5FD5 A;  1UG0 A;  3LAP A;  1OPC A;  2ZCW A;  4KIS A;  2F2E A;  4M9X A;  2CFX A;  3O8H A;  5DCM B;  2P7C B;  4LG0 A;  2A5Y B;  2O0Y A;  2J5P A;  3HGG A;  5IPA A;  3GW2 A;  2MC3 A;  2PMZ A;  1Z77 A;  2B0L A;  2IP2 A;  2YX7 A;  2CQ7 A;  4ON0 A;  4NUB A;  3LSH A;  1G6N A;  2F5D A;  4IEJ A;  1XGO A;  2M2E A;  2VBZ A;  2WAQ A;  2FJ1 A;  2XF5 A;  1AKH A;  2M87 A;  5JLX A;  4CCL A;  3CCR I;  2RNG A;  5AIP A;  2IPQ X;  2WAD A;  4I7H A;  1ZRF A;  4XOR A;  3PQJ A;  4RGR A;  2P7V B;  1JGS A;  2H1L A;  3PNY A;  1IRX A;  3F0C A;  2OQG A;  1ZTR A;  1SEU A;  3JAM Z;  3RSN A;  5C4X J;  2ELJ A;  2F48 A;  5DUI A;  1WH7 A;  2L2O A;  3TQN A;  3JAM K;  3J81 Z;  4FE4 A;  1UAA A;  4XSX F;  5E20 A;  3CCS I;  1J7K A;  5H6Q A;  5GTH C;  1FSH A;  1D5V A;  2E19 A;  2VQC A;  4HX7 A;  5E3M A;  4ZJZ A;  3H9G A;  2YR2 A;  5HLT A;  3J7Y J;  1QO0 D;  3K4C A;  3FBI B;  4PFO A;  4BQO A;  2LY1 A;  3QP6 A;  1FLI A;  2M0C A;  4QTR A;  3JTG A;  2K3F A;  3CJQ B;  5FFZ A;  1Q1V A;  3M9A A;  1VQM I;  4IRI A;  1U78 A;  1F9N A;  3ABK H;  1UEL B;  1LNW A;  3SZP A;  2NRA C;  2E7W A;  2HTJ A;  2DFE A;  3I59 B;  4UV8 A;  4BE2 A;  2DAO A;  5EJC A;  1QQI A;  2DLL A;  3KET A;  3N05 A;  1T0F C;  2XSJ C;  3MD2 A;  2LKS A;  1FC3 A;  4NBQ A;  3S2W A;  3WE2 A;  4EQQ A;  3BG6 A;  3CUQ C;  1ZAO A;  1KGS A;  1XG1 A;  2X9D A;  2IJL A;  4QLC U;  5F64 A;  1G8X A;  5L3E A;  1L0O C;  2ICW G;  2BY1 A;  1D1C A;  1Z05 A;  1KU9 A;  3JRF A;  2Z1D A;  3WG7 H;  3RKX A;  1ZRC A;  2HI3 A;  4M3E A;  2AQE A;  3RDI A;  1U5T A;  1MNM C;  1UHS A;  1P7J A;  3KYD B;  5AON A;  4IOA F;  2X6W A;  3M8J A;  4XKW A;  4EM0 B;  4GYI A;  2WWY A;  3PJR A;  1A35 A;  5KK1 A;  2F5F A;  3SFZ A;  4EJU A;  3BG3 A;  3BRO A;  4XN3 A;  4CZC A;  5IYB J;  1K6Y A;  2R7O A;  1ACI A;  1Z1D A;  1FYK A;  1D3Y A;  3H3Z A;  1IXS B;  4BQA A;  3PSI A;  2HDC A;  4FX4 A;  2VBY A;  3OR1 C;  3PNV A;  4HW0 A;  3E5X A;  2W1O A;  2EZL A;  1RET A;  5F0C A;  3FXJ A;  3I53 A;  3TO9 A;  3ERE D;  1OJL A;  3U2R A;  1S5L C;  2TCT A;  3BTI A;  4DNC A;  4UUT A;  3GF2 A;  1L3L A;  1FT9 A;  3QPH A;  2LFB A;  1W7P B;  2DFI A;  2XSD C;  3OS2 A;  1U5T B;  3RYP A;  2PLY A;  2JUG A;  1B59 A;  5E8G A;  2OZU A;  3K1N A;  4U7D A;  4IHT A;  5K7Z A;  5E18 F;  2Y9Y A;  2VL8 A;  1GV5 A;  4KN4 X;  2MD5 A;  1QPI A;  3BJO A;  2P8T A;  2Q2E B;  3G2B A;  2HOT A;  3TP0 A;  3FHN A;  2EFN A;  4AUX A;  1F4K A;  4FE7 A;  4XOP A;  3OYK A;  1FOK A;  1OCZ H;  5HDK A;  2L0K A;  2DI3 A;  2D45 A;  4ZYH A;  1S72 I;  1U8B A;  2AHQ A;  4LIU A;  2ZJQ F;  2FQ3 A;  3WTU C;  2M0M A;  3F22 A;  4WXC A;  2A68 F;  6PAX A;  2DFF A;  2EFO A;  4JOM A;  4M72 A;  2NVT J;  2HVR A;  2GXB A;  3BR2 A;  3L2U A;  5ICF A;  5LBQ A;  3ISP A;  3SHF A;  3CCM I;  2XAG A;  3JRI A;  4PCQ A;  5GAE J;  1XPX A;  2KQR A;  3CUQ B;  3KZI C;  1VQO I;  2CV2 A;  1E17 A;  1BOB A;  3E5U A;  1V5G A;  4JX6 A;  4ZYE A;  2RDP A;  5BS6 A;  4ZDP A;  3V42 A;  1B9N A;  2ZNZ A;  1T08 B;  3M7G A;  2MG4 A;  5IT3 A;  2CQN A;  3C18 A;  1NHA A;  4MEY F;  1DDN A;  4IJA A;  1MBE A;  4EJT A;  1LPQ A;  4HG2 A;  2LBF B;  2L7M P;  1WH5 A;  1XGS A;  1RRJ A;  2PX9 A;  4J00 A;  3LSM A;  4DW6 A;  4F3Q A;  3CD6 I;  2FA5 A;  3H9Q A;  3HUG B;  5CVU A;  3BC8 A;  3E5Q A;  1ZGJ A;  4V19 K;  4UVA A;  3GLX A;  2E71 A;  5B1A H;  2Y75 A;  3LA3 A;  4U0W A;  1WJC A;  5M3M J;  2LKX A;  3VYT B;  1T39 A;  1Z7L A;  2O03 A;  2AS5 F;  4UY8 I;  1UHM A;  2ACJ A;  1XMX A;  4P5O A;  1E3O C;  1OCP A;  2RRE A;  1R6R A;  4CZZ A;  2VPR A;  3WTY C;  4NHJ A;  2RNJ A;  4BBS J;  2HPI A;  3CCJ I;  3O2P E;  3GEZ A;  2DMN A;  3DCF A;  3BR5 A;  4CSW A;  2YS9 A;  2P5L C;  2OA4 A;  3GTP J;  2W25 A;  3A01 A;  1IV8 A;  3AG1 H;  3VFZ A;  5EGO A;  1WFX A;  1UHW A;  1VND A;  2VB6 A;  1SD5 A;  2VJ5 A;  2HU9 A;  3ZQ7 A;  4I09 A;  1UJ8 A;  3L2R A;  3VSL A;  2VJJ A;  1XMK A;  2BZT A;  5E8I A;  3E0J B;  3ZQL A;  3AG4 H;  3P5J A;  2R7F A;  3OYC A;  3CME I;  2IGN A;  3OMY A;  1TLH B;  3VDX A;  4YII A;  1FOY A;  3PFY A;  3ECO A;  2UXN A;  1O4X A;  3FXR A;  1LVA A;  4PSW A;  2QYO A;  2RC4 A;  1RI7 A;  1IN7 A;  3PSF A;  5EYR A;  2WTE A;  3BZK A;  2KPM A;  4HLX A;  2W48 A;  4IF4 A;  5IT9 K;  2W57 A;  2X1C A;  3Q0U A;  1Z3Y A;  3FHZ A;  2HS5 A;  1MW7 A;  3E6D A;  5D8L B;  4ZH4 F;  2DMU A;  2X4H A;  3TO7 A;  3JRE A;  4UVB A;  4GDF A;  1ZHF A;  3CCE I;  3I5U A;  1TBX A;  3M1C A;  3TGN A;  4E7L A;  1EJ9 A;  2JVG A;  3ZMT A;  1ETX A;  3QPS A;  1CGP A;  5FFX A;  3MMY B;  2R7X A;  3NRV A;  5GAH J;  3TP3 A;  3BTL A;  3FXL A;  1I1S A;  2F5E A;  5KVR A;  4M3D A;  2V7F A;  2X1D A;  3CP2 A;  2V6E A;  3S15 J;  4C2T A;  2OTJ I;  4O5V A;  5J4V A;  1U9N A;  1EKE A;  1P92 A;  3RQ4 A;  1KQ8 A;  2BGC A;  3E6M A;  2QCO A;  4A3J J;  2EFP A;  1E3H A;  1S8N A;  3MQ0 A;  1I6X A;  1SFX A;  1DPR A;  4IRG A;  1FY7 A;  2H6C A;  4HQM A;  3FMS A;  2IA0 A;  4HLY A;  4A3C J;  2NOJ B;  2X6X A;  3KP2 A;  4G7Z F;  1IF1 A;  1WJ5 A; 
#chains in the Genus database with same CATH homology
 1YRN B;  4UUS B;  5M5W J;  3HKZ N;  4DYC A;  3JRB A;  1RES A;  4A3M J;  2IEK A;  3UKG A;  2O7O A;  1WCM J;  2DTZ A;  3W6V A;  4W1U A;  4A3G J;  1ETO A;  1MSE C;  3LOC A;  1X2M A;  2JN6 A;  3LSR A;  2VUM J;  4M3B A;  3GTG J;  2HXI A;  1ORK A;  5J1Y A;  2L7Z A;  2CUF A;  3D1N I;  1H8A C;  2R7Z J;  5C44 J;  2HXO A;  3HOY J;  3JRH A;  2ME6 A;  2LLK A;  1ZKG A;  3PO2 J;  5E3L A;  1K83 J;  4X6A J;  2DN0 A;  2XPW A;  1JT0 A;  1IG7 A;  3S16 J;  2DA6 A;  5K7F A;  1MH4 A;  1ZQ3 P;  2WAQ N;  2EZH A;  4JX4 A;  3LSG A;  2LD5 A;  1ZR2 A;  5EZG A;  2R93 J;  5EEA A;  1G2H A;  4XRS A;  2JA8 J;  2P81 A;  5M3F J;  3G1L A;  4B3A A;  4Y7N J;  1LE8 A;  5F1J A;  1EF4 A;  4MFD A;  1QVU A;  1AU7 A;  2R92 J;  2XGE A;  5GPC A;  5JLW A;  2I10 A;  2LR8 A;  2PMZ N;  3LSP A;  1APL C;  1OCT C;  1ITY A;  2LVS A;  3HOZ J;  3HGY A;  3GTL J;  2XB5 A;  5F0F A;  5GP9 A;  2R0Q C;  2OPT A;  3BQZ A;  5C4J J;  1ZGW A;  1IV6 A;  2COB A;  3ZQI A;  4V2G A;  2XPU A;  1JKO C;  3TED A;  2HOS A;  1P7I A;  3CMY A;  4D7N A;  2NVX J;  2EZI A;  3GTQ J;  1A5J A;  5F27 A;  1GT0 C;  5IYC J;  3ZQC A;  1JUP A;  2DA4 A;  3S1R J;  1GV2 A;  4ABZ A;  3FIS A;  2IBD A;  3I4M J;  2M9H A;  2LP0 A;  3PM1 A;  1RKT A;  1GVD A;  2B63 J;  1IUF A;  2G0E A;  3CCY A;  3TW6 A;  4MFE A;  2Y2Z A;  3HB9 A;  3S17 J;  3C2B A;  5FJ8 J;  3OOU A;  3B6A A;  2Y0S N;  2MGQ A;  5J1U A;  1JGG A;  1VFC A;  3QPL A;  4C3I J;  3S1Q J;  2CRG A;  3NAU A;  1Y1W J;  1NK2 P;  4GFB A;  1FIA A;  2O9L A;  4NDL A;  4XRS G;  1T33 A;  5EG0 A;  2K40 A;  2NS7 A;  2VKV A;  1A6I A;  3MKL A;  3S2H J;  1MBH A;  1YRN A;  2O8K A;  4B4C A;  3SFI A;  4FCY A;  2DJN A;  1SAN A;  1UMQ A;  3GTM J;  3DEW A;  1VF9 A;  1W0U A;  4M3F A;  4AC0 A;  2TRT A;  3FK6 A;  5FKL A;  2NVY J;  2CJJ A;  1IC8 A;  1JJ6 C;  2E2H J;  4B1R A;  1TC3 C;  4A3K J;  3Q0V A;  4FIS A;  3O8H A;  3GTJ J;  1BJZ A;  2EZK A;  1JT6 A;  4LOC A;  3HGG A;  5DTD A;  5IPA A;  2XB0 X;  3H3V K;  1TWF J;  1H88 C;  3Q0W A;  3ZQH A;  3S2D J;  1Z77 A;  2JA5 J;  1IDZ A;  5F0H A;  1LFB A;  2FQ4 A;  4A69 C;  1QRY A;  4IEJ A;  2M2E A;  2FJ1 A;  4DZJ A;  3OIO A;  1AKH A;  1IRZ A;  3O8G A;  5JLX A;  1K61 A;  4BY1 J;  1IGN A;  3A03 A;  2K9Q A;  3A01 B;  1ENH A;  2E2I J;  1JKP C;  2GM4 A;  3I4N J;  3F0C A;  1ZTR A;  4W97 A;  1CQT A;  4BBR J;  5C4X J;  1B8I B;  4C2M J;  2ZB9 A;  1I50 J;  1WH7 A;  2R5Z A;  5EZH A;  4FE4 A;  3B6C A;  1MBG A;  1B8I A;  4IHV A;  5C3E J;  1XC5 A;  4BXX J;  3NAR A;  2E19 A;  4A3E J;  1X58 A;  5E3M A;  4HNV A;  2DA7 A;  9ANT A;  5F04 A;  3GTK J;  1WGX A;  1ETK A;  2NOG A;  2OF7 A;  1ETW A;  1MBF A;  2M0C A;  4CYC A;  3H0G J;  3IH3 A;  4QTR A;  1NK3 P;  4IHW A;  1Q1V A;  3FIW A;  3JRA A;  1U78 A;  2DA2 A;  2DMQ A;  5F08 A;  3HBL A;  3ZOB A;  1QVT A;  1ETQ A;  2NS8 A;  1JJ8 C;  1HLV A;  5EGO B;  5M5X J;  3OSF A;  2L9R A;  2RAE A;  2XGD A;  3K7A J;  1DU0 A;  2DA3 A;  1JKQ C;  2M8G X;  3QQA A;  3G1O A;  3LNQ A;  2LK2 A;  4X1E A;  2VI6 A;  1Z0X A;  1XG1 A;  3CDL A;  3BG9 A;  5E3N A;  2X9D A;  2CU7 A;  3BR1 A;  3VPR A;  3JRF A;  1RR7 A;  3S1N J;  1GUU A;  2HI3 A;  4BKX A;  4M3E A;  5J1R A;  3JRG A;  2JA7 J;  1MNM C;  4A3D J;  1UHS A;  1P7J A;  3SDG A;  4UUS A;  2HOA A;  2N8G A;  5FKK A;  4JP0 A;  3RKQ A;  1BW5 A;  5EG0 B;  3HOX J;  3HOV J;  4BY7 J;  1FTZ A;  3BG3 A;  1I3Q J;  2FD5 A;  2K9S A;  1DU6 A;  1TWG J;  4JYK A;  2DMT A;  5IYB J;  4A3L J;  1MSF C;  4D5C A;  1X2N A;  1H89 C;  3K2A A;  1XS9 A;  1ETV A;  2GBY A;  3HM5 A;  2IAI A;  1LE8 B;  4I76 A;  2ID3 A;  1BL0 A;  2JK3 A;  2EBI A;  2EZL A;  1RET A;  3FKI J;  5F0C A;  4A3F J;  1OJL A;  2TCT A;  3BTI A;  3CQZ J;  3HOU J;  1OFC X;  3BR6 A;  3WHB A;  2ID6 A;  1PUF A;  3FK7 A;  4UUT A;  4D7M A;  3OSG A;  2LFB A;  4CYC B;  1JUM A;  3BG5 A;  3GBG A;  3WHC A;  1ETY A;  2XSD C;  2XPV A;  2R5Z B;  1F36 A;  3MVP A;  4I6Z A;  5K7Z A;  1SFO J;  2Y9Y A;  3BT9 A;  1GV5 A;  2XGC A;  4C3J J;  4A3I J;  1QPI A;  4EEF G;  2E1O A;  2HOT A;  3TP0 A;  5DS9 A;  3Q3S A;  3S1M J;  2ECC A;  2JJ7 A;  4AUX A;  1FTT A;  1MH3 A;  4FE7 A;  3E7L A;  4RDU A;  5FLV A;  1IJW C;  2L0K A;  2JA6 J;  1TWA J;  1U8B A;  2AHQ A;  1TWH J;  3JRC A;  3RZD J;  2X6O A;  1I6H J;  3L1P A;  4C3H J;  2NVT J;  1GDT A;  4MIM A;  3BR2 A;  3LSJ A;  4JX5 A;  3BR0 A;  5EDN A;  1ZR4 A;  2KDZ A;  1HDP A;  1F43 A;  3JRI A;  2ME0 A;  4M6V A;  1AHD P;  4Y52 J;  3BR3 A;  4XIC A;  4QIW N;  3JRD A;  1RPW A;  2Y30 A;  4JX6 A;  5IYD J;  1HOM A;  1RKW A;  1W0T A;  4IHX A;  5FKO A;  1JKR C;  2MG4 A;  2CQQ A;  1MBE A;  1ZK8 A;  2YUS A;  2VKE A;  2E2J J;  4IHY A;  2L7M P;  1WH5 A;  1FEX A;  1JUS A;  2ECB A;  3JR9 A;  4XRM A;  4DW6 A;  4MLO A;  5J3L A;  3ZQG A;  3TW7 A;  5IOZ A;  1PUF B;  1B72 A;  2ELK A;  3BTJ A;  3G1M A;  4L5E A;  5M3M J;  3MN2 A;  2LKX A;  5IP7 J;  1TWC J;  2HYJ A;  1JTY A;  5IP6 A;  1E3O C;  2EQR A;  2JMW A;  1OCP A;  2QF7 A;  1T56 A;  4V2F A;  2KT0 A;  3S14 J;  3BTC A;  2VPR A;  4DYQ A;  1U9O A;  2NVQ J;  2YU9 J;  4BBS J;  3A02 A;  2DMP A;  4G12 A;  4FTH A;  2HDD A;  4DZP A;  2DMN A;  3DCF A;  3BR5 A;  2YS9 A;  2LTP A;  5K7H A;  4MO7 A;  1AKH B;  2H8R A;  3GTP J;  2HQ5 A;  4RBO A;  3A01 A;  4A93 J;  5EGO A;  4DYR A;  1VND A;  1Y1V J;  3GTO J;  1WPK A;  2Y9Z A;  2DA1 A;  3IV5 A;  3HEF A;  1R9T J;  4M3G A;  1HCR A;  1BW6 A;  3ZQL A;  2LY9 A;  2FX0 A;  2D5V A;  1HDD C;  2JWT A;  1O4X A;  3IH4 A;  4A3B J;  2CQX A;  5EYR A;  2L7F P;  2WV1 A;  2W48 A;  3M3Y J;  3Q0U A;  2WB1 N;  4XID A;  5HOD A;  2DMU A;  2Y31 A;  2MSY A;  2M34 A;  5BNG A;  5FLM J;  3JRE A;  1B72 B;  5GPA A;  1ETX A;  3QPS A;  1BA5 A;  4XK4 A;  1VI0 A;  2DA5 A;  1FJL A;  3TP3 A;  3BTL A;  1HF0 A;  4J19 A;  2MW8 A;  4M3D A;  2X48 A;  5FKN A;  3SJM A;  4QSH A;  1MBJ A;  2EH3 A;  3S15 J;  2H1K A;  4D5F A;  5FKM A;  3RZO J;  3HOW J;  5IP9 J;  1U9N A;  1FIP A;  1D5Y A;  2QCO A;  5M5Y J;  4AYB N;  5EF6 A;  4A3J J;  5IOY A;  1IDY A;  3IH2 A;  3M4O J;  1LFU P;  2R5Y B;  2CUE A;  1POG A;  3HDD A;  3RQI A;  5E3O A;  1NTC A;  3ZQF A;  1S7E A;  1JTX A;  3BQY A;  2R5Y A;  2K9N A;  2GLO A;  4A3C J;  1WI3 A;  4S0H B;  1UG2 A;  3PO3 J;  1MBK A;  2AO9 A;  2XRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...