5C3EJ

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5c3eJ00
5FJ8J 4C2MJ 4Y52J 1B8IA 3HOZJ 1W0UA 1ORKA 5E3OA 2ELKA 2FD5A 5J3LA 2EZHA 1IDZA 1UMQA 1K83J 3UKGA 4I76A 3GTPJ 1MH4A 3LSGA 4BKXA 3S15J 5JLXA 3VPRA 3GTMJ 2N8GA 5IYDJ 3QPSA 4MFDA 1WGXA 1FEXA 3HGYA 5M3MJ 2DA5A 2TRTA 1JT0A 2KT0A 1APLC 3D1NI 3PO3J 2DTZA 5GPAA 2WV1A 2X9DA 4A3KJ 1P7JA 5DS9A 2HQ5A 3W6VA 3CMYA 2O9LA 1JTXA 4M3FA 5IOZA 3DEWA 1Z77A 5M5YJ 1HDPA 1YRNA 3JRCA 3TW7A 3LSRA 3PO2J 4FCYA 3BR0A 3BTCA 1AHDP 3HEFA 2R92J 1HCRA 5EYRA 1QVUA 5IYCJ 4IHVA 1GT0C 5F0CA 2EZLA 2CRGA 3BG3A 2EZKA 1TWGJ 3RQIA 3OSFA 1FIPA 3MVPA 1I3QJ 3O8GA 1RKWA 2D5VA 3OSGA 4M3DA 1ETVA 1MBFA 3MKLA 4JX4A 3S1QJ 3IH2A 2MGQA 3GTOJ 1IJWC 5C4XJ 5M5XJ 1XG1A 5F0HA 5F1JA 1VI0A 5IP7J 1AKHB 2LFBA 2JA5J 2PMZN 3WHCA 4QTRA 5M3FJ 1JUPA 2M9HA 3S1MJ 2FX0A 1VNDA 4FE4A 4XICA 1A6IA 5EG0B 1CQTA 2OF7A 3SJMA 1QVTA 1TC3C 3HGGA 1RPWA 4M3BA 3ZOBA 3HDDA 2NVXJ 1JT6A 2E19A 1VFCA 3PM1A 2M2EA 3H0GJ 2DMTA 2CU7A 4JX6A 4MIMA 2O8KA 1Z0XA 4A69C 2L7MP 3JRHA 3BG5A 3BTJA 3ZQIA 2LK2A 1B8IB 4B3AA 2R7ZJ 2FQ4A 3FK6A 2QCOA 5EF6A 1WCMJ 2VI6A 3BTIA 5GP9A 5DTDA 1JKOC 3ZQCA 1RETA 5HODA 1OCPA 4D7NA 2HI3A 3SDGA 1ETXA 2VPRA 5IYBJ 3BTLA 2K40A 1GDTA 3GTKJ 2B63J 1MBKA 4Y7NJ 1T33A 3A03A 2IBDA 1RR7A 3HM5A 1ZK8A 1JKPC 2H8RA 1GUUA 4M3GA 3CDLA 1JUSA 4DW6A 1ZTRA 3OIOA 3JREA 2DA6A 3ZQGA 2LLKA 2ME6A 5GPCA 1Q1VA 4FISA 2P81A 5FKLA 3JRFA 1A5JA 4W1UA 2JA7J 4M3EA 3LOCA 2RAEA 1ZGWA 1FTZA 2K9QA 1AU7A 2LTPA 3BR6A 4XRMA 2DA1A 2JK3A 1BJZA 1BA5A 2HOTA 2X48A 2E2IJ 2Y31A 4MFEA 1FIAA 1YRNB 1MSFC 2L0KA 1O4XA 4A3EJ 2JMWA 5EZHA 1T56A 1UHSA 2VUMJ 1DU6A 3OOUA 3ZQFA 3NARA 4L5EA 1MBJA 4A3FJ 2M34A 5EZGA 1B72A 3GBGA 4A3GJ 4V2GA 2EQRA 4DYRA 3NAUA 4C3JJ 4D7MA 2FJ1A 4IHYA 2R5YB 1XS9A 2L7FP 2ECBA 2NVYJ 2XGEA 4DZPA 2AO9A 3BQZA 3Q0WA 1MSEC 1MH3A 3BR3A 2YUSA 2K9SA 5E3LA 2DN0A 4J19A 2MW8A 3CCYA 4JX5A 5K7ZA 1I6HJ 1IRZA 1P7IA 4UUTA 5E3MA 5IOYA 2M0CA 9ANTA 3LSJA 4EEFG 3GTGJ 1JGGA 2XPWA 3BR1A 2HOAA 3S14J 4A3CJ 2CQQA 2R5YA 5F27A 1ZR4A 2I10A 3HBLA 2DMUA 1WI3A 3HOYJ 1OJLA 4B4CA 4A3BJ 2E2JJ 1NK3P 2JN6A 3HKZN 2ME0A 1K61A 1ITYA 5JLWA 1U8BA 1W0TA 1JKRC 4JYKA 4A3MJ 5F0FA 1BL0A 1HDDC 1IV6A 3QPLA 4CYCB 1MBEA 3K7AJ 1GVDA 3B6CA 2NS7A 1JTYA 2DMNA 3CQZJ 1PUFB 3S2DJ 3TW6A 1X58A 2XGDA 1E3OC 4BBSJ 3TP0A 1IUFA 1MBGA 2IEKA 2XPVA 3GTLJ 2COBA 3LSPA 3HOVJ 1H89C 2JWTA 4XRSA 2LY9A 2M8GX 1XC5A 1NK2P 1VF9A 2L7ZA 3B6AA 3FKIJ 1TWAJ 4BXXJ 5FKNA 2HDDA 4CYCA 1ETOA 3FIWA 4DYCA 2HOSA 4A3IJ 1PUFA 1IGNA 3HB9A 2YU9J 3K2AA 1SANA 4JP0A 1JUMA 2JA8J 5C3EJ 1GV2A 1WPKA 3DCFA 2LKXA 2LP0A 4A3LJ 3A01A 1U78A 2DMPA 5F08A 4MLOA 4B1RA 3Q0UA 2XGCA 4XK4A 3FISA 3S1NJ 1MBHA 1H88C 1U9OA 2JJ7A 2LVSA 4W97A 2X6OA 2R93J 5EEAA 5J1UA 2CJJA 2ID3A 1FTTA 4NDLA 5BNGA 1SFOJ 3GTQJ 4HNVA 2AHQA 3G1MA 1BW5A 2XSDC 2ID6A 1GV5A 2JA6J 1ETWA 2NVQJ 3JRIA 4QSHA 4XIDA 4DZJA 2R5ZA 4AUXA 5FKKA 2CUEA 4QIWN 3QQAA 1WH5A 4AC0A 1Y1VJ 5EDNA 4IHWA 1B72B 2NS8A 2DJNA 1U9NA 2DMQA 4MO7A 5IPAA 1F43A 2NVTJ 5EGOA 2Y2ZA 3BQYA 3F0CA 2LD5A 1LFBA 5K7HA 5K7FA 1ZQ3P 1S7EA 2HYJA 3G1LA 5FLMJ 5M5WJ 1POGA 2CQXA 1H8AC 3IH4A 1TWCJ 3A02A 2DA2A 3BT9A 3BR2A 1MNMC 3I4MJ 2NOGA 3S2HJ 2GM4A 5J1YA 2E1OA 4D5FA 2O7OA 2Y9ZA 1NTCA 2E2HJ 1RESA 5FKMA 4G12A 2VKEA 4FE7A 3JRGA 3JRBA 3G1OA 1ZKGA 2CUFA 1HLVA 2MSYA 1EF4A 4RBOA 4GFBA 3HOUJ 4I6ZA 4DYQA 1UG2A 2HXIA 1ETKA 3BG9A 1X2NA 2OPTA 2H1KA 2G0EA 3HOXJ 3H3VK 3L1PA 4V2FA 3C2BA 4D5CA 5C44J 5IP9J 1IG7A 3IV5A 3MN2A 2Y9YA 4BBRJ 3ZQLA 4BY1J 4A93J 2WAQN 2LR8A 1IDYA 2DA4A 1LE8B 2K9NA 3RZOJ 5F04A 3I4NJ 1JJ6C 3O8HA 1LFUP 2R0QC 2QF7A 1OCTC 1Y1WJ 2IAIA 3BR5A 4XRSG 2DA7A 1D5YA 4S0HB 3E7LA 4FTHA 1QRYA 4BY7J 1JKQC 1HF0A 4LOCA 4X6AJ 2XB0X 2ECCA 1DU0A 2XB5A 3WHBA 2EZIA 3JRDA 1LE8A 3SFIA 4C3IJ 5FLVA 3HOWJ 2KDZA 4IHXA 1IC8A 1RKTA 2L9RA 3IH3A 3TP3A 3A01B 2YS9A 5FKOA 5E3NA 1QPIA 3GTJJ 4ABZA 4UUSB 1BW6A 4M6VA 1FJLA 2XRLA 2EBIA 1ETQA 2WB1N 3ZQHA 2TCTA 4RDUA 5IP6A 1WH7A 3S16J 4X1EA 2Y0SN 1F36A 2DA3A 3S1RJ 3Q0VA 2Y30A 1OFCX 1I50J 2R5ZB 4IEJA 1AKHA 3RZDJ 3FK7A 2MG4A 2HXOA 2W48A 3TEDA 2GLOA 5EGOB 3M4OJ 4UUSA 2XPUA 3S17J 1HOMA 1ETYA 2GBYA 3Q3SA 3JR9A 1ENHA 5EG0A 1X2MA 3M3YJ 5J1RA 1G2HA 4A3JJ 1TWFJ 3LNQA 3RKQA 3JRAA 2ZB9A 1ZR2A 5C4JJ 4C3HJ 4A3DJ 1R9TJ 4AYBN 2VKVA 1TWHJ 1JJ8C 2EH3A
chains in the Genus database with same CATH superfamily
2Y0MA 5CQEA 4KFCA 3QOEA 2BY2A 1IN5A 2TDXA 3ABUA 1YHQI 1K79A 2EZHA 1IDZA 3HKZA 4ZJZA 2GOMA 2BHYA 3A2KA 2W00A 1FMVA 3RQ4A 1D5VA 4UXNA 4IXAA 2DDAA 3ZMTA 3H1CA 2O03A 3LWFA 4BYYA 3ABLH 2LNBA 2PQ8A 3ZMVA 3U1DA 4BDZA 2VE8A 5IYDJ 4Y3OA 1WGXA 2FRHA 2M0MA 3JAMZ 4MEXF 1Y0UA 3ASNH 1FEXA 2O3FA 3I3LA 1B59A 1LKXA 2XF5A 2EK5A 1FWZA 4CCNA 2X9DA 4A3KJ 3F9KA 4WXDA 1F4KA 3K4JA 4N4OB 4FX4A 5M5YJ 1HDPA 1X3ZB 3GVAA 2FQ3A 1YRNA 3TO6A 3J7ZI 2CQNA 4HV6A 3PO2J 3FKJA 3OS1A 2X6YA 4N9HA 2W57A 3EUKL 4OMZA 4E4HA 1AHDP 4L9JA 3GLXA 3NEUA 1R1VA 1OYYA 3F8BA 1Z67A 5F0CA 4FQGA 3K9TA 1D0ZA 2V1DA 3BJ6A 4HF0A 1OCRH 1KYZA 1ONVA 2EZKA 3BG3A 5CQGA 3OSFA 2V1UA 2DOEA 3MVPA 1I3QJ 1F1ZA 4FASD 1MBFA 3MKLA 5LFAA 1NHAA 2VQGA 2MGQA 3OMYA 2ZXIA 4U88A 1IJWC 2CGPA 2VIXA 4RGXA 1VI0A 2M8EA 3EETA 2ELJA 3H35A 5D5WB 2LFBA 2JPBA 3OYLA 1P92A 2PMZN 2F4IA 3KZZA 4BQOA 4CCKA 2X6XA 3JTGA 5M3FJ 1U5TA 2M9HA 3WU1B 2BYVE 2COMA 4XLEA 3CCVI 1RR8C 1D8JA 1FOYA 2EV6A 2JA2A 2ZFWA 4F55A 1VQOI 5DCFA 2EWNA 1N77A 2BOLA 1QVTA 3I55I 1TC3C 3DXJF 5J4YA 2H1LA 1J7KA 3K4BA 1XSVA 1YITI 3MZ8A 2A5YB 1YG2A 3DPLC 3KLOA 3PM1A 4XOPA 4XKBA 1D1BA 4WXCA 1UZCA 2DMTA 2GA2A 1BM9A 1Z0XA 2V4JC 3EUHC 2IS4A 2O6GE 2ZMEC 1XCVA 4KJZA 2QGUA 2QSGX 3BTJA 1MMDA 3ZQIA 1S9HA 1B8IB 1FT9A 1BI3A 3KYLA 3ABTA 2MD5A 2QCOA 2QSFX 3FK6A 3WTXC 5DCMA 4HQEA 4A2UA 1R36A 3LFUA 4Q4ZF 3SDGA 2QSHX 4FETA 2QBYA 4Q5SF 3I64A 2K40A 4ZYGA 2B63J 2L9NA 1MBKA 4YELA 5E18F 4OOIA 1P9QC 1PJRA 2IBDA 3HM5A 4N0BA 4U0VA 3OYCA 1GUUA 2H8RA 4M3GA 4IRIA 4EJWA 4DW6A 4G7OF 1ZTRA 2VXDA 1T08B 5E1XA 3ZQGA 1BI1A 5AIPA 1I39A 1B4AA 3G71I 3AG3H 3KP2A 4FISA 4G6DA 2HPIA 1GHCA 4W1UA 2XF7A 5FROA 2JA7J 1BOBA 3DU5A 2RAEA 2VBYA 1ZGWA 3V7RA 1XSXA 1FTZA 2K9QA 1ZG1A 2DA1A 5H20A 2DK8A 4NHJA 3U9GA 4MFEA 1FIAA 2CQ7A 2IS2A 2DBBA 2DPUA 5HLGA 3J7YJ 3TO7A 4E7SA 2GXBA 3CJTB 5GTHC 3T0YA 4A3EJ 3OYIA 2FOWA 1Z7UA 2P5VA 2A6TA 2PMZA 4EATA 2VUMJ 1T2KA 4LITA 4RM2A 3CDIA 1OPCA 4GXOA 4A0ZA 3ZXSA 3GW2A 4PK4A 2JUCA 3L09A 3PFIA 1G3YA 2M34A 2CG4A 3GBGA 1ZRCA 2EIKH 3F72A 3DBLB 2R5YB 2L54A 2QENA 2L7FP 2WV0A 1TP4A 3BZKA 4JQFA 1QZZA 1ZG5A 2RDPA 3CF5F 3CF2A 3IAM2 1EA3A 1U3EM 4OIPF 3J7AO 3BQZA 2FUG2 1XN7A 2QEXI 2QVOA 3L2QA 3MKWB 2V1NA 4J19A 2OV7A 2BBYA 2P8TA 3CCYA 4JX5A 2M30A 1IRZA 4NC8A 4UUTA 4BEHA 2QQ9A 5LGNA 3COAC 5E3MA 2PMHA 5IOYA 2Z16A 3MAJA 2XPWA 3BR1A 4HLXA 2HOAA 3S14J 1W7PB 4LJZF 2CQQA 1TLHB 5DYMA 3S8PA 3CP8A 4HG2A 2RQPA 4CCMA 4YIRX 1G59A 2BY0A 5IY5H 5CKTA 2R7UA 3GF2A 1F9NA 1W5CC 5CVVA 3JSOA 1NK3P 5FD5A 4EM2A 4WX9A 3IP4B 2Q2EB 1J0RA 1SVOA 2CW7A 4JYKA 2A69F 4BHPA 1W5SA 2EIMH 5E20A 3ZCOA 2ZNYA 3FXLA 1FP2A 4PUSA 3K7AJ 1WKMA 2AXLA 1JTYA 3GLLA 3CQZJ 4PDKA 1X58A 1R5ID 2KIUA 2LKSA 3IUOA 2E34A 3ZGKA 3TP0A 1IUFA 4ZDOA 1EH8A 2V79A 5H2FC 2IEKA 2MYSA 2XPVA 3EQLF 3HUGB 3M8EA 1CF7B 1T98A 2COBA 4IOAF 2M5WA 2JWTA 3BPXA 2VB6A 3CUQC 3HJEA 4XRSA 3FKIJ 1S29A 4RGUA 3VYSB 1KU3A 4EJTA 3PSFA 1P2FA 1FOWA 2LRDA 1DDNA 1H0MA 2PBIA 3FIWA 2A07F 2JZYA 1O3SA 2W25A 4L5IA 1P4AA 2WAFA 4QWQA 2BEOA 1YI2I 3E6CC 1SANA 3GX4X 5ICGA 2JQ7A 2D1VA 4Z6YA 2E35A 2M7BA 1X1PA 2E7XA 3A01A 1VQ5I 2DMPA 2FMLA 5F08A 4B1RA 2OC6A 3VODA 3FZVA 3I59B 2IVMA 2X6OA 1YX3A 2V1XA 1L3LA 3F8FA 5J1UA 2ID3A 2DW4A 1DP3A 4RAFA 2X6WA 3GTQJ 1QHGA 3V7SA 3RPUD 1LB2A 3L00A 3FX3A 3I9V2 1GV5A 4YIIA 1N78A 4XIDA 2ELHA 5EEGA 2WY8Q 4AUXA 5FKKA 3RPQA 3CCJI 4QIWN 3KEYA 4J01A 1UFMA 3KYCB 2NAZA 4HX4A 1B72B 2DJNA 1F43A 5EGOA 4ANJA 3AAFA 2F4MB 2IA2A 3F0CA 3GFIA 2LD5A 3KPHA 2DDBA 2RREA 2FXAA 1ZQ3P 3DLAA 5DD8A 2IPQX 1TTYA 5M5WJ 2GA1A 4JOMA 4I09A 4BU2A 3OV8A 3IH4A 2H8WA 2DA2A 4ZYEA 2X85A 3I4MJ 1HW1A 2KMUA 4A5MA 4BQAA 3RYPA 4QPQA 1WJ5A 3OL4A 4D5FA 1XPXA 1S7OA 4MTDA 2KHMA 2Y9ZA 2E2HJ 2DO7A 2ZNZA 2VKEA 3JRGA 1OR7A 1ZKGA 4G7HF 1QZEA 1WRJA 4RBOA 3ECOA 1EKEA 1FZPB 2HXIA 3RI4A 1KU7A 1K78B 3DBHB 2ZJQF 2QA4I 3K4NA 4UV8A 2CSOA 3BG9A 2DOAA 2G0EA 3PFYA 3L1PA 4V2FA 3D0SA 1O7FA 3C2BA 3OOPA 1V55H 4RS8A 3RSNA 1LFPA 3IV5A 2P0WA 3MN2A 4RAYA 2Y9YA 4XKWA 4ESBA 4BE1A 1WI9A 4YIFA 2LR8A 1HBXG 1LE8B 1YW9A 3QPTA 3I4NJ 1JJ6C 2R7FA 4I02A 2R0QC 2QF7A 4QLCU 2KDOA 1Y1WJ 1D5YA 2DA7A 4RGRA 1J75A 1MJAA 3MEXA 4CZZA 2AXTC 1N25A 4LOCA 4X6AJ 4Q47A 1SFUA 4OU0A 3EUAA 5E1WA 2ECCA 2XB5A 2EZIA 3JRDA 1B1BA 3BG7A 4RB3C 2NVUB 2Z1DA 1R58A 3SFIA 4C3IJ 2IXSA 1XGMA 1QNTA 2VC0A 2NNYA 3FXQA 5B1BH 2Z3YA 3TP3A 1QPIA 5E3NA 2EB7A 4ABZA 3F8MA 3GTJJ 4ENJA 4UUSB 3LA3A 2KJBA 3DQVC 1DPRA 2CH0A 4BXUA 3F6VA 3ZN1A 3LSHA 5IP6A 1TNSA 1MMSA 4B3XA 2ZSIB 3HHGA 2FMYA 1WVRA 3K6GA 1RUOA 1OFCX 1Z3XA 1I50J 3FDYA 5DUIA 3FK7A 1P6RA 4A5NA 3HOSA 1ACIA 3JAMK 2KRFA 4UB8C 1R7JA 1KU2A 3KE2A 3J80K 2EFQA 1ETYA 2GBYA 3JR9A 3M3YJ 2KKOA 1I6XA 3OIQA 3H36A 5BPDA 1QZYA 4D9JA 2W85A 3LNQA 1YE9A 4L0ZB 4HW0A 3JRAA 1EV7A 3WG7H 4M72A 5C4JJ 3DWLE 1BN5A 2M45A 4C3HJ 1XGNA 4AYBN 2GXAA 2VKVA 1FLIA 5FJ8J 1J9IA 4Y52J 3CMMA 1B8IA 3W2WA 4HQMA 3H0DA 5LRRA 1W0UA 5J3LA 4EJUA 3LSMA 2F4OB 1LJ9A 2XROA 1T95A 4PJ0C 3LAPA 3UKGA 1Z6TA 3PIPF 2LY1A 1MH4A 3E97A 4KT6A 1MD0A 5DDGA 1D1CA 1BI2A 2ADUA 4WCGA 1DP7P 3S15J 2R7XA 3HRMA 5JLXA 4CGZA 3VPRA 1LDJA 5B66C 3K1NA 4B48A 1DQUA 1ZLJA 2DCEA 5CLSA 1YJNI 2GOXB 4XR6A 4RGSA 3PO3J 4LB6B 2K7LA 2DTZA 5GPAA 2E1MB 1KQ0A 5HNFA 4CICA 1KGSA 2W4SA 1R6RA 3CMYA 1Y56A 3DEEA 4UVCA 1JTXA 2GQQA 5KNLA 3JRCA 2XIGA 1MNDA 5ERIA 5LHIA 3E6BA 3LSRA 4FCYA 3IRRA 2DODA 5BS6A 4XKVA 1ZGJA 3SEZA 2UXNA 3H92A 3N97A 1HCRA 2R92J 5EYRA 2IGOA 3QODA 3V8LA 5IYCJ 4IHVA 1GT0C 1FMWA 3DTEA 4IF4A 5KK1A 2XKPA 1TBXA 3RQIA 2IJLA 3LSKA 2E1NA 2XAFA 1RKWA 2IA0A 4BXFA 3QPHA 4B43A 1HKSA 3E5QA 1IRFA 2DLLA 3OSGA 5L3BA 2VC1A 4M3DA 4JX4A 2JRMA 4IO9F 4E7KA 2E1CA 2A61A 3S1QJ 1I5ZA 3IH2A 4FHTA 2MFZA 5C4XJ 4A6DA 1SFEA 5M5XJ 2DFIA 5BQTA 2PJRB 1AKHB 3SYTA 2HFHA 2IGNA 1JUPA 3BC8A 1E3PA 2DT6A 2OQRA 4WXHA 3ZMSA 4AYBA 3D5LA 2H94A 4AM3A 1V54H 2XVCA 2XAGA 3PUBA 3SJMA 2OTLI 1X3UA 3FXUA 3ZR8X 1SVMA 2GZWA 1W7PA 3ZOBA 3HDDA 3FM3A 4HF1A 5D5UB 2HVSA 3BPVA 1YO5C 4A12A 1R71A 2M2EA 3Q9VA 1FY7A 4EGZA 4XBFA 4ZDPA 4KICA 4AWXB 2Q2EA 3IC7A 5LD2C 4MGRA 4BHBA 1IXRC 5D4SA 2D45A 3TBIA 4F91B 2HZDA 2R7RA 2JVHA 4B3AA 5EF6A 4IHSA 5GP9A 5DTDA 3ABMH 1OKRA 3CDHA 5HODA 3ZQCA 2ZFUA 3CC7I 4D7NA 2RNJA 1ETXA 2HR3A 2W84A 4EMSA 4PFOA 4PGGA 3WTVC 4ZDLA 2D2WA 3EPZA 1TL8A 2A5WA 1ZRDA 3S93A 3PIOF 3HTSB 1ZK8A 1CF7A 4MHGA 2HGCA 5J8CA 2LBFB 1X4OA 2P81A 5FKLA 2WTEA 3KP6A 1A5JA 4IPAA 1TW2A 4U0WA 2L02A 3LOCA 4P1WA 3EYYA 1WJEA 4KITB 2LTPA 2QQ8A 3DFGA 4LG0B 3C18A 3RJPA 2BVMA 2JK3A 3MD2A 3VOEA 1RRJA 5GAEJ 5L3FA 2I5UA 4NC7A 1HSTA 4Q48A 3IWFA 2ETHA 3BZCA 1MSFC 4G6QA 2HDCA 4DGWB 2L0KA 2OJED 1O4XA 4HSRA 3HRUA 3WODF 5AIQA 5K5QA 3F23A 5EZHA 1JHHA 5E79C 2ZXWH 4D0PA 3R4KA 3CO6C 1T8IA 2Z99A 1DU6A 4XQFA 2PMUA 3GXOA 1BR1A 3K70C 2O61A 4XORA 1XGSA 2CS3A 3NARA 4O5VA 2JTVA 2WA0A 4L5EA 1MBJA 5HVQC 5IT9K 4A3FJ 2WB1A 4CCJA 5EZGA 5JVTA 2IGKA 3E1SA 1B72A 2M4GA 4V2GA 4DJAA 3L2RA 2IS6A 3OWTA 1WJDA 2F5DA 3PNTA 2FOKA 1XS9A 2HVQA 1R49A 2NVYJ 2CFOA 2R7WA 1V5FA 3HIFA 3I0TA 4I0AA 1MSEC 3BR3A 4BAYA 5E3LA 2CUZA 3BROA 2DN0A 4H4KC 4HF2A 4LB5A 1W5TA 3CLQA 4S04A 3GYHX 3SXYA 1PUEE 3F6OA 5F1RA 3DP7A 2AQEA 1P7IA 2VJIA 4KIGA 5J47A 4HLYA 1QBJA 1R23A 4XN0A 3KFWX 4G9YA 2J5OA 2MC3A 2XAJA 4NC6A 1B9NA 4RB2C 2O8XA 3ZMUA 2OD5A 3OYFA 5J40A 3ROUA 2R7DA 2DMUA 3QU3A 4LMYA 5AONA 3TL4X 1XMXA 4E7ZA 2E2JJ 3KETA 4PJJA 1IRGA 3GO5A 2DU9A 4Y17A 1K78A 4L9TA 1U8BA 1NG7A 1FYKA 4ENMA 2UV1A 1BL0A 3GFMA 1HDDC 4GDFA 1IV6A 1G4DA 3QPLA 5EJCA 1MBEA 1USTA 4KN7X 4BDYA 2EV0A 3OIPA 2DQRA 2Z2SB 3V7CA 1PUFB 1ZRFA 3S2DJ 4FX0A 2RV8A 4BBSJ 2X51A 4ZYAA 2H6CA 4XLFA 1MBGA 4UV9A 5JVGF 3Q5FA 4KNYA 1ZAOA 2XKOA 2X0LA 4CYDA 1BI0A 2LY9A 2ZC2A 2K4JA 1XC5A 1NK2P 2L7ZA 2Q0OA 1IZ1A 1KA8A 5FFXA 1KONA 2V9VA 3DBRB 3KZYA 4R8HA 4BE0A 2HDDA 4HAMA 4CYCA 5GAHJ 2L2OA 3DU6A 2L9SA 4JBAA 4DYCA 4A3IJ 4EJOA 3SEQA 4G6TB 2W7NA 3QP6A 1JUMA 3DCFA 3CJQB 1U5TC 2Z33A 3FMSA 5LHGA 4A3LJ 5E17F 2FEZA 5HLIA 1IW7F 2CYYA 2W82A 5ICEA 2VKDA 4XK4A 1XD7A 2QKLB 2E5NA 1R1UA 1I3AA 1U9OA 1EH6A 2DYRH 2FSWA 1QHHD 3HPGA 3GFJA 3QOPA 4BUPA 5HDNA 1LEBA 3GFLA 5EEAA 2CJJA 3L7WA 1SFOJ 4HNVA 4KUMA 5KAFC 1BW5A 2ID6A 3SQNA 1ETWA 2V7FA 4XOTA 3JRIA 4DZJA 3QRFF 4CHUA 2R7OA 3CD6I 3SZTA 3CCQI 3TDUC 2CUEA 4RB0A 2NYXA 4MQ9F 2IW5A 1YQAA 2MA3A 3T8RA 2NS8A 2HYFA 5BMZA 2Y2ZA 3AG1H 2HQAA 3BQYA 5DM6F 1WQ2A 4M9SA 5K7FA 1S7EA 1SMTA 2E71A 4KT5C 3BCAA 3A0HC 4L0YB 2BY1A 3KP3A 2UWMA 1HC8A 5HDKA 3ZQQA 2XASA 2XUBA 1J2XA 2EV5A 3TQNA 5J8FA 3BT9A 3BR2A 1Z05A 3PQJA 1K6OA 2CV2A 2K02A 3CJRB 1QA6A 3NWTA 2E60A 3KZIC 4BE2A 1LNWA 1BR4A 3SDBA 3IKTA 3ASOH 4C2TA 3FF5A 5B1AH 3WGHA 4P5OA 2BXZA 4C9YA 1RESA 1SAXA 4FE7A 3JRBA 1MZBA 2QLZA 5CVRA 3G1OA 1YIOA 2CUFA 1EF4A 2MSYA 3K70D 3HOUJ 3D5SC 2VT2A 1TQMA 2L3DA 4DYQA 1UG2A 4M9XA 2LDUA 2UZKA 1X3WB 2RKHA 6PAXA 2H1KA 3A0BC 3HOXJ 3UNGC 4F92B 4ZYHA 3RKWA 1QPMA 5IP9J 4PSXA 4BY1J 4RMNA 3ZQLA 4A93J 2K9NA 3RZOJ 5F04A 3E5XA 2HTJA 3F3XA 3L2VA 2DTRA 3DF8A 4N9IA 4OAZA 4GCVA 5L3CA 2DOFA 2HKOA 4ON0A 3X2QH 1LFUP 2JRTA 4ZZDA 1OCTC 1UELB 2GWRA 3BR5A 4XRSG 4E6KG 2CUJA 3GMEA 1T6SA 2MLKA 3DV8A 2KQRA 4S0HB 5CJ9A 1HF0A 3CCRI 3B73A 4KN4X 4E7LA 3GCMA 3H9GA 3O2PE 1UCRA 2JSPA 1LDKB 2OQGA 2QWWA 1U8RA 3BJOA 2HQRA 3HG9A 3ISPA 2VOPA 5HLHA 5D4RA 1IC8A 1RKTA 3IH3A 5JFRA 2VJ5A 3CC2I 2VT3A 4S05A 3VWBA 1V5EA 4L9NA 5A2QZ 4ESFA 2XRLA 3J7AY 4DQ2A 2O5RA 4LLLA 1HQCA 1K4SA 5FLXZ 2DYSH 3OR1C 3OR2C 4O6JA 1MJBA 3OYBA 4AIKA 3VB2A 4CCOA 2D1HA 4XLCA 2Y0SN 1G8XA 2KRHA 4H0EA 3S1RJ 3Q0VA 4C30A 1IXSB 3IWZA 2EFPA 4HA8A 3RZDJ 1YFHA 1AKHA 1BC7C 2PJRA 2MG4A 1Y0NA 1L0OC 1ZREA 5FD6A 2GLOA 1FNNA 2HKXA 2LF8A 2XV4S 4P96A 1SEUA 3DTKA 2HTSA 3V8KA 5LEKA 2FA5A 1ENHA 3LMMA 1ODDA 1ERDA 1TWFJ 3KEOA 3RKQA 2OZUA 4UB6C 3AKZA 3TMOA 3CCEI 3HSFA 5TRDA 1T38A 1R9TJ 2RN7A 3I71A 4AVPA 5F64A 1TWHJ 3G2BA 2EH3A 4IQJA 4C2MJ 4F7ZA 3GWZA 3BJAA 2Q8KA 2L4AA 5E3OA 1UJ8A 2ELKA 4RLFA 2FD5A 1CGPA 1O3QA 1BIBA 1YLFA 3GUDA 3CCSI 2BY3A 1VQ7I 4RAGA 3WE2A 1UMQA 1K83J 3GTPJ 1T39A 2PG4A 2P6SA 3FBIB 4MQVA 4IZZA 3QP5A 4ESJA 1G3SA 4CZCA 3IAS2 4N4NB 5H6QA 2LBFA 2EA2A 2OBPA 3QPSA 3TOBA 3HGYA 3LA2A 3PSIA 2TRTA 1JT0A 2KT0A 2DI3A 1YW8A 2WV1A 2K9MA 3HRSA 2ZJ2A 1P7JA 5DS9A 3W6VA 4LG0A 1F5TA 2O9LA 4HDUA 3WTTC 5L3EA 3P9KA 5IOZA 3BP8A 3H3ZA 2ZMEB 3N4MA 2R7TA 1ZLKA 1J09A 4A0YA 2ZXHA 1K4TA 1FBSA 5CVUA 5E8IA 5J4VA 2Y0SA 2K3PA 1ZGAA 3HEFA 3E5UA 1GLNA 2R4GA 1QVUA 3VYRB 2CQKA 4Y33A 1BJAA 3BY6A 3EDPA 2VBXA 5KAIC 4ZYDA 4IRGA 1TWGJ 4V19K 2F48A 4PFPA 2FF4A 4XRFA 3O8GA 3OYGA 3VSLA 2D5VA 2KL4A 2VLAA 1ETVA 1IN7A 2VN2A 4HV5A 4LFUA 5JHUA 1T0FA 4GO1A 4IJAA 2KP6A 3IKVA 2WAEA 1OR7C 5F0HA 2STWA 2ZSHB 5LBQA 2R7QA 1RI7A 2LSOA 1RUNA 4I01A 3HRTA 3E3VA 1MKMA 3DPTA 3HSEA 3S1MJ 3U1KA 3ZQ7A 2FX0A 1FC3A 5CVJA 1IAWA 4FE4A 4XICA 2VQLA 4E70A 4AVZA 1XB4A 2LH9A 3L2WA 1CQTA 1ON2A 4IVNA 2ESHA 2M1BA 1RPWA 3AL0B 4M3BA 5HNHA 4CXFA 2NVXJ 4RLQA 2VODA 3CCUI 1JT6A 3KYDB 1K6YA 1AA7A 2E19A 2DXIA 2VONA 1J5YA 3HTUA 2CU7A 2KIQA 4F93B 3K4CA 4P9FA 4II3A 4A69C 3ZRGA 2L7MP 3CMEI 5TGTA 3BG5A 1T0FC 2RVCA 1A36A 4OMYA 1LVAA 2R7ZJ 2FQ4A 3MKYB 1GXPA 4HDVA 1JKOC 3C2HA 1RETA 1A6QA 4PJLA 2B9SA 3G3ZA 3OYEA 3OYAA 3MZYA 4GYIA 5IYBJ 3T1BA 4HBLA 1OMIA 1GDTA 1TQPA 5FRNA 4CSWA 4M6YA 1D8KA 1RR7A 2IRFG 3N05A 5D6FA 3CDLA 1JUSA 4NBQA 1DUXC 2HYGD 1HKQA 2DA6A 3LFKA 2ME6A 3CJNA 3L2CA 1LUJB 3FWEA 1Z21A 3MKZA 1AU7A 2AS5F 4XRMA 3DLLF 3CP2A 2OU2A 1XSDA 2HOTA 2X48A 1BA5A 3V8JA 3KX2A 1O3RA 1X1CA 3CLOA 4BL0B 3I4PA 2Y75A 1KYWA 2KPMA 3S3OA 5B3SH 2L7KA 4XKCA 3ERED 1UHSA 3K4LA 3E6MA 3OOUA 1LPQA 3M8JA 1IV8A 2CW0F 2XAHA 1W36C 1OYWA 2JT1A 4ENKA 3H5AA 4M9ZA 4PCQA 2XGXA 2C6YA 3DKYA 1Y39A 1VQ8I 3CUQB 1FP1D 5K5RA 3DTIA 1G6NA 3DKWA 4M71A 4A3GJ 3V4GA 2EQRA 3MCZA 4C3JJ 5K1YA 4II2A 3ONQA 2VKHA 1ZH5A 2F5FA 4GRIA 2XGEA 1IN6A 4DZPA 3Q0WA 4ASNA 1MH3A 4HYEA 1DGWY 4LLNA 1MMAA 1FX7A 3ULQB 2G7UA 5K7ZA 1O3TA 2VPLA 1HA8A 2VBZA 2Z9OA 1XDSA 2ZJPF 2KLOA 1OISA 2M0CA 3H5NA 3QYFA 3LSJA 3VSKA 2PJPA 3GTGJ 1LEAA 1JGGA 4LLGF 3MMYB 4A3CJ 3M7GA 4OINF 2R5YA 3MZHA 2W1OA 1ZR4A 2YR2A 1WI3A 2DFHA 3MFKA 2HOEA 3K1MA 1BBYA 1TQIA 3Q9SA 2O0YA 3HKZN 3K1PA 2ME0A 1K61A 1ITYA 4UVBA 2L01A 3WU2C 1Z3YA 1HXDA 4A3MJ 2A3SA 3E0JB 2JPCA 5DUKA 3CMAI 2L4MA 3BCBA 3WU0A 2NS7A 2MC4A 3G73A 3SFZA 1V5GA 3TKYA 2HPMA 3JCUC 2LG4A 2G9WA 1SD7A 4ITVA 3OYMA 4IL6C 3GTLJ 1AOYA 2KZGA 2P5KA 3LSPA 3HOVJ 2UUZA 2M8GX 4OAYA 1VF9A 4ENNA 3B6AA 4UNOA 5FKNA 1TW3A 3R6SA 1C0WA 3FMQA 3TOAA 2XAQA 2G7HA 2ICWG 4CUGA 3M9AA 5CPRB 4KMFA 3L2UA 1WSUA 2A68F 2YU9J 1KZHA 3K2AA 4JP0A 3HXLA 2MABA 5BPIA 1OQYA 1O57A 2LP0A 3KP5A 3QAHA 1N75A 5ICCA 1FBUA 3HUGA 1Y8QB 1M1EB 2XGCA 5HLTA 3FISA 3S1NJ 2YU3A 4BNCA 1MBHA 1H88C 2EPFA 2LVSA 1JXSA 4AU7A 4HPQA 3FXRA 1XDUA 3S32A 2P6TA 1FTTA 3NRVA 4NDLA 2QKMB 5BNGA 2AHQA 1H9GA 2XSDC 4AD9A 2NVQJ 2E36A 2BE5F 4QSHA 4WWCA 5J6XA 3QQAA 4XLPF 1Y1VJ 1SFXA 1JE8A 2LKPA 3CO7C 2DMQA 3CUOA 5IPAA 3AG2H 1KU9A 3FMRA 1U2WA 1LFBA 3D5RC 5K7HA 4LD5A 3I59A 2HYJA 3REOA 3I54A 3G1LA 5FLMJ 3PNYA 2XRNA 1A31A 4XSZF 2X1DA 1POGA 2WADA 4Y4RA 1H8AC 1TWCJ 2VXZA 3A02A 3C7JA 3HSRA 3HOTA 3W6KB 2EILH 3HPHA 3JSPA 2GM4A 3S2HJ 3KCCA 2M3AA 2H6BA 2ZBKA 5J1YA 2E1OA 3HZJA 3TO9A 2O7OA 5ILSA 1DPUA 3O6BB 1X4PA 3WGGA 1XMAA 4BS9A 2V6EA 2R7SA 3KP4A 2JSCA 1W1WE 3FBNB 5A2QK 1MJ9A 2XDVA 4L18B 2ZCWA 3K69A 4GFBA 3J80Z 2ISYA 4I6ZA 1W36D 2B0LA 3H3UA 4OIQF 2YX4A 3G4SI 2LC2A 2PI0A 1ETKA 5FLXK 3GZ5A 3J81Z 1J59A 3LL7A 1PP7U 1SD5A 5EEHA 2FNPA 4YFNF 1LVKA 4D5CA 2OZ6A 3BZ6A 4XLHA 1IG7A 2R7VA 2Y48A 3KP7A 4BBRJ 1YTYA 1A04A 4KYWA 1V4RA 2DFEA 1SVLA 1USSA 2DA4A 2YPRA 5E1ZB 3K4KA 3W2VA 3HL2A 2A6HF 1WFXA 2IP2A 3O8HA 3VYUB 5GTIC 3C2GA 3IRQA 2IS1A 1FSEA 4UUVA 2IAIA 3R60A 4WF2A 4RAZA 1VQPI 3EUHA 3E7LA 4I0BA 4FTHA 5D6EA 4F3QA 1JKQC 2RQQA 3CESA 4KA4A 2ZMEA 2L9VA 2HEOA 1S7AA 1U6GA 1K7AA 1Q1HA 3OYKA 1DU0A 1MDMB 2FE3A 4E7HA 1LE8A 3HOWJ 5FO5A 2KDZA 2QM3A 1TNTA 4NQWB 4IHXA 5JHFA 2LYCA 3RPUA 4ZC3A 2YS9A 5FKOA 4G94A 2EFNA 1BW6A 2EBIA 2NOJB 5HS9A 5E8GA 1ETQA 2STTA 4RDUA 1IUYA 2UXXA 3GZ6A 2HZTA 1XGOA 4R79A 4X1EA 5DEQA 2VQHA 3ZPLA 2DA3A 4UY8I 3ERMA 1RZ4A 2WBMA 4KIBA 5B5EC 2IT0A 2R5ZB 2ACJA 2RGVA 2ZO4A 5HS7A 4OIRF 2HVRA 2HXOA 2KIFA 1UAAA 1YS7A 3TEDA 3OYDA 1BIAA 3P9IA 3BWGA 3M4OJ 4UUSA 2XPUA 5F6FA 3S17J 1P4WA 4NB5A 3WTZA 2GAUA 3Q3SA 2H27A 4L9VA 1B9MA 2PEXA 5FFZA 1QQIA 1Z6RA 2EINH 1SC7A 3TDZC 2RNGA 1WHUA 4XM3A 4I2OA 1DGRM 3OY9A 4BQNA 1VQKI 4Y13A 1RIOH 4LGWA 2ZB9A 1XCBA 2CMPA 2A05A 1ZR2A 3FXJA 2BV6A 4YFXF 3F22A 4YEJA 1LQ1A 3BG6A 3P7NA 1PP8F 3M1EA 5JI6A 3H9JA 1R1TA 4G8XA 1JJ8C 2VOOA 1ETOA 2J5PA 1W7PD 2WC2A 2KFDA 3HOZJ 1UB9A 2XSJC 4NNJA 4IX7A 1ORKA 1WJBA 4XLAA 2FNAA 3FXKA 4LG3A 2BVLA 1X1AA 4EVIA 1YOVB 2DJIA 2V9KA 4I76A 4HNTA 1FYLA 3G6EI 2P7CB 3U21A 2OUMA 3LSGA 4BKXA 1I27A 1MNEA 1OCZH 2VE9A 2OA4A 3T8TA 2VQCA 1GXQA 3GTMJ 3M8FA 1ZELA 2NXNB 4BACA 4I98B 4CO8A 2N8GA 3V42A 2QQAA 4MFDA 4GGGA 2YX7A 4G7ZF 5CVIA 3R0JA 2DA5A 5M3MJ 3AL0C 1YX5A 2K4BA 3W2AA 5ILUA 1APLC 4HSTA 3D1NI 2GIVA 2ZJRF 3BDDA 1OCCH 2HQ5A 4EM0B 1UG0A 3BOQA 2OAZA 4GYGA 4M3FA 4YG2F 3DEWA 1Z77A 2Q1ZB 3LQRA 3FM5A 4U87A 4QPOA 1VQ4I 3TW7A 1S3JA 2VJJA 2P4WA 4HOBA 3BR0A 3BTCA 3O3KA 1W4MA 1Z7LA 2EIJH 2KJCA 3K2ZA 1NH3A 2ZKZA 3WGIA 3HYIA 5HS8A 4OIOF 2FU4A 2EZLA 4AIDA 2CRGA 1TZLA 3I5UA 2QQBA 3ABKH 1FIPA 4CDGA 1FOXA 2ESNA 2X1EA 3W6JB 3W3CA 3CUQA 3RYRA 1YW7A 3GTOJ 4BHCA 3DEUA 2EA4A 2ISZA 1Y6IA 1XG1A 1A35A 2VL8A 5F1JA 1P4XA 1PVEA 5IP7J 1OCOH 2JA5J 3F21A 3WHCA 4QTRA 2BW3B 4EJVA 1MMGA 5KHDA 2OCEA 3TGNA 2V9PA 1VNDA 2CO5A 1A6IA 5EG0B 1MGTA 2OF7A 1OYIA 5KCMA 2FBIA 3HGGA 1HW5A 5IT9Z 3RDIA 4DBQA 1R5HA 3MWMA 1FPQA 1VFCA 4U7DA 1MIJA 4KIFA 3RIRA 2E1MC 1Y8RB 3H0GJ 4JX6A 4MIMA 4DNCA 4ZZLA 1YIJI 2O8KA 4OWRB 2HS5A 3JRHA 2JVGA 3H5RA 3WE3A 1JHFA 5TISC 2LK2A 1UHMA 1SFKA 3PJRA 3S2WA 1IN4A 4CA0A 1YS6A 1WCMJ 2VI6A 3BTIA 4PJMA 4LK0F 2X1CA 1OCPA 2HI3A 2Y69H 4HZFA 2VPRA 4TV7A 5L3GA 4XSXF 3BTLA 2I8DA 4ZTFA 3GTKJ 5ED4A 4Y7NJ 1T33A 3A03A 3QU6A 4EM1A 1JKPC 2DPDA 2RC4A 1Z9CA 2EFWA 5H6RA 1E0EA 2M7AA 3OIOA 3JREA 2LLKA 3F8CA 5GPCA 2HWVA 5KVRA 3AFHA 1Q1VA 2E5ZA 3GZNB 4P55A 3JRFA 1TT0A 5CYVA 4M3EA 1RNLA 4KMUX 1EH7A 3VDXA 4EGYA 2M87A 1SD6A 3BR6A 5GADJ 1BJZA 4I99C 2BGCA 2XF6A 2E2IJ 2Y31A 3CC4I 1YRNB 2F5VA 2ZXJA 2QZ8A 4YRVA 4K2EA 4XL9A 1TT5B 4E7IA 4XONA 2E7WA 3RCOA 2JMWA 1HKTA 1T56A 2XHKA 1RC9A 1EJ9A 4B8XA 3RKXA 4WK8F 3ELKA 3ZMZA 1R22A 2DT5A 3R0AA 3ZQFA 3UR3C 3WTUC 1VQNI 1VQMI 4X0GA 4M6XA 2WY7Q 1X1DA 3KLNA 4MEYF 2Z5UA 2CFXA 3NAUA 4DYRA 3KIOA 5LGUA 3A1YA 4XNFA 4D7MA 1IN8A 2FJ1A 4RA2A 4XMYA 4RB1A 2GXGA 1FOKA 4ZTJA 4IHYA 2ECBA 2BZTA 1FYMA 1R00A 3P5JA 4UHTA 2AO9A 4DIQA 2YUSA 2IA1A 2K9SA 1U5TB 2KZVA 1BC8C 1IRXA 2DFFA 2X4HA 2MW8A 5HDGA 3I56I 1I6HJ 2NNNA 3C1DA 1ULYA 2XC7A 9ANTA 4EEFG 4LK1F 1S72I 1Z1DA 1O7LA 3ZN0A 2DK5A 3F8NA 2IGMA 1VTNC 5F27A 3JTHA 2I10A 2K9LA 1VQLI 3HBLA 1S5LC 3HOYJ 3FHZA 1OJLA 1SAUA 4XN3A 4B4CA 3SZPA 4A3BJ 1V3FA 1IXCA 1XMKA 2JN6A 3PUFA 3VEPA 1G3WA 5JLWA 1W0TA 2MLGA 1JKRC 1VZ0A 4F52A 5F0FA 4KISA 4CYCB 2NRAC 2JUGA 2F6CA 5DCMB 4E7JA 3B6CA 1GVDA 3B02A 3RKYA 4I7HA 3OS2A 3S3NA 2DMNA 3C3WA 3TW6A 5GAGJ 2QBYB 2XGDA 3LAJA 2WWYA 1E3OC 1H9TA 4CCLA 2V26A 3ESWB 3I58A 5D8KB 1PDNC 4HX8A 1H89C 2H09A 4PZJA 4NUBA 5D5XB 1TWAJ 4BXXJ 3DPUA 2VASA 1XTAA 3A4CA 2P7VB 1REPC 1MDMA 3IL2A 2HOSA 1ZYRF 1PUFA 3WTYC 1IGNA 3HB9A 4Y15A 5FB2A 4B44A 4NQWA 2JA8J 5C3EJ 1GV2A 1WPKA 2HQNA 1Z91A 4BGDA 5DV5A 2LKXA 4LIVA 5DM7F 1U78A 1I1SA 4MLOA 1BR2A 3IHUA 3Q0UA 3VFZA 3BLYA 2PLYA 5JR3A 1STZA 4ETSA 1S8NA 2JJ7A 4W97A 4IHTA 1MW7A 2R3SA 2R93J 3J81K 4D1QA 4M73A 3EYIA 1WZ2A 1B6AA 1SD4A 1PYVA 3G1MA 4IQ4A 2JA6J 1YJ9I 1ZN2A 3QWLA 2R5ZA 3ECHA 2BXYA 3QYEA 2V6CA 3SHFA 4A0XA 5K5OA 3PL8A 5FRMA 2LF7A 2MD0A 3RTRA 1WH5A 1E2XA 4AC0A 4PJNA 2A6EF 1D0XA 3KEQA 5ICFA 5EDNA 4IHWA 1U9NA 4MO7A 1OLTA 4BJ6C 5TJJA 5FGMA 2NVTJ 3M07A 4O3MA 2HU9A 1G3TA 4BH9A 1FBQA 2K86A 3CCLI 1D0YA 4R1HA 2MBFA 4A6EA 1ON1A 3U2RA 2YSRA 2GIZA 3FXMA 4DBRA 2CQXA 3LSTA 1JI8A 2K3FA 1D1AA 3AG4H 4BJTA 2CW8A 2HNHA 1X19A 5LRSA 1MNMC 2CV0A 4BEHB 3OS0A 1VQ6I 2NOGA 1ZHFA 2K5CA 3CZ6A 4Z2YA 4B47A 4CH7A 3PQKA 3S3MA 3VYTB 1LDDA 3OYNA 4RM3A 2VJ4A 2MH9A 1GVJA 1ZARA 3OYJA 3OYHA 3K4MA 4U7BA 1NTCA 1YYVA 2L5QA 1ZG3A 5FKMA 5LGTA 4G12A 4YFKF 1JGSA 5L3DA 3FHNA 1WJCA 1HLVA 2XAUA 1FSHA 5IT3A 1I1GA 3LQQA 3WTSC 1E3HA 1IF1A 1WJFA 3QYBA 2LOOA 1X2NA 2HDWA 2OPTA 3R61A 3H3VK 1MMNA 1R4NB 1IO2A 2F5EA 4PSWA 3I53A 3LA7A 1XX5A 5C44J 2EJRA 4KDPA 1R4MB 2K85A 1R5GA 1WWXA 3L9FA 1QGPA 3ML6A 2WAQN 1IDYA 2QUFA 4HX7A 1YJWI 5D8LB 1HW2A 2LMDA 3ZMDA 2OTJI 1VQ9I 2VBWA 3PNVA 3FXOA 3ZP5A 3SZGA 3HHHA 3JW4A 1QRYA 4BY7J 4BQQA 2PFBA 3OL3A 2XB0X 3GEZA 1WJAA 2MH2A 2NS0A 3MQ0A 1SMYF 1UHWA 3WHBA 1BOAA 4DOZA 4MNUA 5LEJA 4EV0A 5FLVA 2BHZA 4IRHA 4M74A 4C2UA 2L9RA 4JK1X 2K27A 4PGHA 3A01B 3CCMI 4U0YA 2FBHA 3T5XA 2OCCH 4M6VA 1FJLA 4P9UA 2B7EA 4J00A 3M1CA 2KRCA 4AIHA 2WB1N 3ZQHA 2TCTA 1HSJA 3LSIA 2AQFA 4BJ5C 4HRIA 4XLNF 2DAOA 2FBKA 1WH7A 3S16J 3K10A 1S6LA 5LHHA 1F36A 1E17A 1X1BA 2DQLA 3NWSA 1NG6A 2Y30A 3NQOA 1KQ8A 4IEJA 2F2EA 4UVAA 5D5VB 2CV1A 3P9CA 5DD4A 2LY2A 2W48A 2BW3A 4L5JA 4LIUA 2F5CA 3H9QA 5EGOB 3DKXA 1U0JA 2P5LC 1HOMA 3HC7A 4IOCF 5LLQA 2M4KA 5EG0A 1X2MA 1QU3A 5J1RA 4EQQA 1G2HA 1KQ9A 3E6DA 4MTEA 4A3JJ 4AIJA 1QO0D 2KIMA 5ILVA 4IKFA 2EFOA 2CWEA 2PX9A 2DT7B 1D3YA 2PN6A 5BOXA 4HNUA 3CTAA 3K0LA 2KISA 2W24A 5HOOA 2LREA 4ZH4F 1AWCA 4B09A 4FT8A 4A3DJ 2QYOA 3WTWC 2WAQA 4HEA2 3WG9A
chains in the Genus database with same CATH topology
5FJ8J 4C2MJ 4Y52J 1B8IA 3HOZJ 1W0UA 1ORKA 5E3OA 2ELKA 2FD5A 5J3LA 2EZHA 1IDZA 1UMQA 1K83J 3UKGA 4I76A 3GTPJ 1MH4A 3LSGA 4BKXA 3S15J 5JLXA 3VPRA 3GTMJ 2N8GA 5IYDJ 3QPSA 4MFDA 1WGXA 1FEXA 3HGYA 5M3MJ 2DA5A 2TRTA 1JT0A 2KT0A 1APLC 3D1NI 3PO3J 2DTZA 5GPAA 2WV1A 2X9DA 4A3KJ 1P7JA 5DS9A 2HQ5A 3W6VA 3CMYA 2O9LA 1JTXA 4M3FA 5IOZA 3DEWA 1Z77A 5M5YJ 1HDPA 1YRNA 3JRCA 3TW7A 3LSRA 3PO2J 4FCYA 3BR0A 3BTCA 1AHDP 3HEFA 2R92J 1HCRA 5EYRA 1QVUA 5IYCJ 4IHVA 1GT0C 5F0CA 2EZLA 2CRGA 3BG3A 2EZKA 1TWGJ 3RQIA 3OSFA 1FIPA 3MVPA 1I3QJ 3O8GA 1RKWA 2D5VA 3OSGA 4M3DA 1ETVA 1MBFA 3MKLA 4JX4A 3S1QJ 3IH2A 2MGQA 3GTOJ 1IJWC 5C4XJ 5M5XJ 1XG1A 5F0HA 5F1JA 1VI0A 5IP7J 1AKHB 2LFBA 2JA5J 2PMZN 3WHCA 4QTRA 5M3FJ 1JUPA 2M9HA 3S1MJ 2FX0A 1VNDA 4FE4A 4XICA 1A6IA 5EG0B 1CQTA 2OF7A 3SJMA 1QVTA 1TC3C 3HGGA 1RPWA 4M3BA 3ZOBA 3HDDA 2NVXJ 1JT6A 2E19A 1VFCA 3PM1A 2M2EA 3H0GJ 2DMTA 2CU7A 4JX6A 4MIMA 2O8KA 1Z0XA 4A69C 2L7MP 3JRHA 3BG5A 3BTJA 3ZQIA 2LK2A 1B8IB 4B3AA 2R7ZJ 2FQ4A 3FK6A 2QCOA 5EF6A 1WCMJ 2VI6A 3BTIA 5GP9A 5DTDA 1JKOC 3ZQCA 1RETA 5HODA 1OCPA 4D7NA 2HI3A 3SDGA 1ETXA 2VPRA 5IYBJ 3BTLA 2K40A 1GDTA 3GTKJ 2B63J 1MBKA 4Y7NJ 1T33A 3A03A 2IBDA 1RR7A 3HM5A 1ZK8A 1JKPC 2H8RA 1GUUA 4M3GA 3CDLA 1JUSA 4DW6A 1ZTRA 3OIOA 3JREA 2DA6A 3ZQGA 2LLKA 2ME6A 5GPCA 1Q1VA 4FISA 2P81A 5FKLA 3JRFA 1A5JA 4W1UA 2JA7J 4M3EA 3LOCA 2RAEA 1ZGWA 1FTZA 2K9QA 1AU7A 2LTPA 3BR6A 4XRMA 2DA1A 2JK3A 1BJZA 1BA5A 2HOTA 2X48A 2E2IJ 2Y31A 4MFEA 1FIAA 1YRNB 1MSFC 2L0KA 1O4XA 4A3EJ 2JMWA 5EZHA 1T56A 1UHSA 2VUMJ 1DU6A 3OOUA 3ZQFA 3NARA 4L5EA 1MBJA 4A3FJ 2M34A 5EZGA 1B72A 3GBGA 4A3GJ 4V2GA 2EQRA 4DYRA 3NAUA 4C3JJ 4D7MA 2FJ1A 4IHYA 2R5YB 1XS9A 2L7FP 2ECBA 2NVYJ 2XGEA 4DZPA 2AO9A 3BQZA 3Q0WA 1MSEC 1MH3A 3BR3A 2YUSA 2K9SA 5E3LA 2DN0A 4J19A 2MW8A 3CCYA 4JX5A 5K7ZA 1I6HJ 1IRZA 1P7IA 4UUTA 5E3MA 5IOYA 2M0CA 9ANTA 3LSJA 4EEFG 3GTGJ 1JGGA 2XPWA 3BR1A 2HOAA 3S14J 4A3CJ 2CQQA 2R5YA 5F27A 1ZR4A 2I10A 3HBLA 2DMUA 1WI3A 3HOYJ 1OJLA 4B4CA 4A3BJ 2E2JJ 1NK3P 2JN6A 3HKZN 2ME0A 1K61A 1ITYA 5JLWA 1U8BA 1W0TA 1JKRC 4JYKA 4A3MJ 5F0FA 1BL0A 1HDDC 1IV6A 3QPLA 4CYCB 1MBEA 3K7AJ 1GVDA 3B6CA 2NS7A 1JTYA 2DMNA 3CQZJ 1PUFB 3S2DJ 3TW6A 1X58A 2XGDA 1E3OC 4BBSJ 3TP0A 1IUFA 1MBGA 2IEKA 2XPVA 3GTLJ 2COBA 3LSPA 3HOVJ 1H89C 2JWTA 4XRSA 2LY9A 2M8GX 1XC5A 1NK2P 1VF9A 2L7ZA 3B6AA 3FKIJ 1TWAJ 4BXXJ 5FKNA 2HDDA 4CYCA 1ETOA 3FIWA 4DYCA 2HOSA 4A3IJ 1PUFA 1IGNA 3HB9A 2YU9J 3K2AA 1SANA 4JP0A 1JUMA 2JA8J 5C3EJ 1GV2A 1WPKA 3DCFA 2LKXA 2LP0A 4A3LJ 3A01A 1U78A 2DMPA 5F08A 4MLOA 4B1RA 3Q0UA 2XGCA 4XK4A 3FISA 3S1NJ 1MBHA 1H88C 1U9OA 2JJ7A 2LVSA 4W97A 2X6OA 2R93J 5EEAA 5J1UA 2CJJA 2ID3A 1FTTA 4NDLA 5BNGA 1SFOJ 3GTQJ 4HNVA 2AHQA 3G1MA 1BW5A 2XSDC 2ID6A 1GV5A 2JA6J 1ETWA 2NVQJ 3JRIA 4QSHA 4XIDA 4DZJA 2R5ZA 4AUXA 5FKKA 2CUEA 4QIWN 3QQAA 1WH5A 4AC0A 1Y1VJ 5EDNA 4IHWA 1B72B 2NS8A 2DJNA 1U9NA 2DMQA 4MO7A 5IPAA 1F43A 2NVTJ 5EGOA 2Y2ZA 3BQYA 3F0CA 2LD5A 1LFBA 5K7HA 5K7FA 1ZQ3P 1S7EA 2HYJA 3G1LA 5FLMJ 5M5WJ 1POGA 2CQXA 1H8AC 3IH4A 1TWCJ 3A02A 2DA2A 3BT9A 3BR2A 1MNMC 3I4MJ 2NOGA 3S2HJ 2GM4A 5J1YA 2E1OA 4D5FA 2O7OA 2Y9ZA 1NTCA 2E2HJ 1RESA 5FKMA 4G12A 2VKEA 4FE7A 3JRGA 3JRBA 3G1OA 1ZKGA 2CUFA 1HLVA 2MSYA 1EF4A 4RBOA 4GFBA 3HOUJ 4I6ZA 4DYQA 1UG2A 2HXIA 1ETKA 3BG9A 1X2NA 2OPTA 2H1KA 2G0EA 3HOXJ 3H3VK 3L1PA 4V2FA 3C2BA 4D5CA 5C44J 5IP9J 1IG7A 3IV5A 3MN2A 2Y9YA 4BBRJ 3ZQLA 4BY1J 4A93J 2WAQN 2LR8A 1IDYA 2DA4A 1LE8B 2K9NA 3RZOJ 5F04A 3I4NJ 1JJ6C 3O8HA 1LFUP 2R0QC 2QF7A 1OCTC 1Y1WJ 2IAIA 3BR5A 4XRSG 2DA7A 1D5YA 4S0HB 3E7LA 4FTHA 1QRYA 4BY7J 1JKQC 1HF0A 4LOCA 4X6AJ 2XB0X 2ECCA 1DU0A 2XB5A 3WHBA 2EZIA 3JRDA 1LE8A 3SFIA 4C3IJ 5FLVA 3HOWJ 2KDZA 4IHXA 1IC8A 1RKTA 2L9RA 3IH3A 3TP3A 3A01B 2YS9A 5FKOA 5E3NA 1QPIA 3GTJJ 4ABZA 4UUSB 1BW6A 4M6VA 1FJLA 2XRLA 2EBIA 1ETQA 2WB1N 3ZQHA 2TCTA 4RDUA 5IP6A 1WH7A 3S16J 4X1EA 2Y0SN 1F36A 2DA3A 3S1RJ 3Q0VA 2Y30A 1OFCX 1I50J 2R5ZB 4IEJA 1AKHA 3RZDJ 3FK7A 2MG4A 2HXOA 2W48A 3TEDA 2GLOA 5EGOB 3M4OJ 4UUSA 2XPUA 3S17J 1HOMA 1ETYA 2GBYA 3Q3SA 3JR9A 1ENHA 5EG0A 1X2MA 3M3YJ 5J1RA 1G2HA 4A3JJ 1TWFJ 3LNQA 3RKQA 3JRAA 2ZB9A 1ZR2A 5C4JJ 4C3HJ 4A3DJ 1R9TJ 4AYBN 2VKVA 1TWHJ 1JJ8C 2EH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 J;  4C2M J;  4Y52 J;  1B8I A;  3HOZ J;  1W0U A;  1ORK A;  5E3O A;  2ELK A;  2FD5 A;  5J3L A;  2EZH A;  1IDZ A;  1UMQ A;  1K83 J;  3UKG A;  4I76 A;  3GTP J;  1MH4 A;  3LSG A;  4BKX A;  3S15 J;  5JLX A;  3VPR A;  3GTM J;  2N8G A;  5IYD J;  3QPS A;  4MFD A;  1WGX A;  1FEX A;  3HGY A;  5M3M J;  2DA5 A;  2TRT A;  1JT0 A;  2KT0 A;  1APL C;  3D1N I;  3PO3 J;  2DTZ A;  5GPA A;  2WV1 A;  2X9D A;  4A3K J;  1P7J A;  5DS9 A;  2HQ5 A;  3W6V A;  3CMY A;  2O9L A;  1JTX A;  4M3F A;  5IOZ A;  3DEW A;  1Z77 A;  5M5Y J;  1HDP A;  1YRN A;  3JRC A;  3TW7 A;  3LSR A;  3PO2 J;  4FCY A;  3BR0 A;  3BTC A;  1AHD P;  3HEF A;  2R92 J;  1HCR A;  5EYR A;  1QVU A;  5IYC J;  4IHV A;  1GT0 C;  5F0C A;  2EZL A;  2CRG A;  3BG3 A;  2EZK A;  1TWG J;  3RQI A;  3OSF A;  1FIP A;  3MVP A;  1I3Q J;  3O8G A;  1RKW A;  2D5V A;  3OSG A;  4M3D A;  1ETV A;  1MBF A;  3MKL A;  4JX4 A;  3S1Q J;  3IH2 A;  2MGQ A;  3GTO J;  1IJW C;  5C4X J;  5M5X J;  1XG1 A;  5F0H A;  5F1J A;  1VI0 A;  5IP7 J;  1AKH B;  2LFB A;  2JA5 J;  2PMZ N;  3WHC A;  4QTR A;  5M3F J;  1JUP A;  2M9H A;  3S1M J;  2FX0 A;  1VND A;  4FE4 A;  4XIC A;  1A6I A;  5EG0 B;  1CQT A;  2OF7 A;  3SJM A;  1QVT A;  1TC3 C;  3HGG A;  1RPW A;  4M3B A;  3ZOB A;  3HDD A;  2NVX J;  1JT6 A;  2E19 A;  1VFC A;  3PM1 A;  2M2E A;  3H0G J;  2DMT A;  2CU7 A;  4JX6 A;  4MIM A;  2O8K A;  1Z0X A;  4A69 C;  2L7M P;  3JRH A;  3BG5 A;  3BTJ A;  3ZQI A;  2LK2 A;  1B8I B;  4B3A A;  2R7Z J;  2FQ4 A;  3FK6 A;  2QCO A;  5EF6 A;  1WCM J;  2VI6 A;  3BTI A;  5GP9 A;  5DTD A;  1JKO C;  3ZQC A;  1RET A;  5HOD A;  1OCP A;  4D7N A;  2HI3 A;  3SDG A;  1ETX A;  2VPR A;  5IYB J;  3BTL A;  2K40 A;  1GDT A;  3GTK J;  2B63 J;  1MBK A;  4Y7N J;  1T33 A;  3A03 A;  2IBD A;  1RR7 A;  3HM5 A;  1ZK8 A;  1JKP C;  2H8R A;  1GUU A;  4M3G A;  3CDL A;  1JUS A;  4DW6 A;  1ZTR A;  3OIO A;  3JRE A;  2DA6 A;  3ZQG A;  2LLK A;  2ME6 A;  5GPC A;  1Q1V A;  4FIS A;  2P81 A;  5FKL A;  3JRF A;  1A5J A;  4W1U A;  2JA7 J;  4M3E A;  3LOC A;  2RAE A;  1ZGW A;  1FTZ A;  2K9Q A;  1AU7 A;  2LTP A;  3BR6 A;  4XRM A;  2DA1 A;  2JK3 A;  1BJZ A;  1BA5 A;  2HOT A;  2X48 A;  2E2I J;  2Y31 A;  4MFE A;  1FIA A;  1YRN B;  1MSF C;  2L0K A;  1O4X A;  4A3E J;  2JMW A;  5EZH A;  1T56 A;  1UHS A;  2VUM J;  1DU6 A;  3OOU A;  3ZQF A;  3NAR A;  4L5E A;  1MBJ A;  4A3F J;  2M34 A;  5EZG A;  1B72 A;  3GBG A;  4A3G J;  4V2G A;  2EQR A;  4DYR A;  3NAU A;  4C3J J;  4D7M A;  2FJ1 A;  4IHY A;  2R5Y B;  1XS9 A;  2L7F P;  2ECB A;  2NVY J;  2XGE A;  4DZP A;  2AO9 A;  3BQZ A;  3Q0W A;  1MSE C;  1MH3 A;  3BR3 A;  2YUS A;  2K9S A;  5E3L A;  2DN0 A;  4J19 A;  2MW8 A;  3CCY A;  4JX5 A;  5K7Z A;  1I6H J;  1IRZ A;  1P7I A;  4UUT A;  5E3M A;  5IOY A;  2M0C A;  9ANT A;  3LSJ A;  4EEF G;  3GTG J;  1JGG A;  2XPW A;  3BR1 A;  2HOA A;  3S14 J;  4A3C J;  2CQQ A;  2R5Y A;  5F27 A;  1ZR4 A;  2I10 A;  3HBL A;  2DMU A;  1WI3 A;  3HOY J;  1OJL A;  4B4C A;  4A3B J;  2E2J J;  1NK3 P;  2JN6 A;  3HKZ N;  2ME0 A;  1K61 A;  1ITY A;  5JLW A;  1U8B A;  1W0T A;  1JKR C;  4JYK A;  4A3M J;  5F0F A;  1BL0 A;  1HDD C;  1IV6 A;  3QPL A;  4CYC B;  1MBE A;  3K7A J;  1GVD A;  3B6C A;  2NS7 A;  1JTY A;  2DMN A;  3CQZ J;  1PUF B;  3S2D J;  3TW6 A;  1X58 A;  2XGD A;  1E3O C;  4BBS J;  3TP0 A;  1IUF A;  1MBG A;  2IEK A;  2XPV A;  3GTL J;  2COB A;  3LSP A;  3HOV J;  1H89 C;  2JWT A;  4XRS A;  2LY9 A;  2M8G X;  1XC5 A;  1NK2 P;  1VF9 A;  2L7Z A;  3B6A A;  3FKI J;  1TWA J;  4BXX J;  5FKN A;  2HDD A;  4CYC A;  1ETO A;  3FIW A;  4DYC A;  2HOS A;  4A3I J;  1PUF A;  1IGN A;  3HB9 A;  2YU9 J;  3K2A A;  1SAN A;  4JP0 A;  1JUM A;  2JA8 J;  5C3E J;  1GV2 A;  1WPK A;  3DCF A;  2LKX A;  2LP0 A;  4A3L J;  3A01 A;  1U78 A;  2DMP A;  5F08 A;  4MLO A;  4B1R A;  3Q0U A;  2XGC A;  4XK4 A;  3FIS A;  3S1N J;  1MBH A;  1H88 C;  1U9O A;  2JJ7 A;  2LVS A;  4W97 A;  2X6O A;  2R93 J;  5EEA A;  5J1U A;  2CJJ A;  2ID3 A;  1FTT A;  4NDL A;  5BNG A;  1SFO J;  3GTQ J;  4HNV A;  2AHQ A;  3G1M A;  1BW5 A;  2XSD C;  2ID6 A;  1GV5 A;  2JA6 J;  1ETW A;  2NVQ J;  3JRI A;  4QSH A;  4XID A;  4DZJ A;  2R5Z A;  4AUX A;  5FKK A;  2CUE A;  4QIW N;  3QQA A;  1WH5 A;  4AC0 A;  1Y1V J;  5EDN A;  4IHW A;  1B72 B;  2NS8 A;  2DJN A;  1U9N A;  2DMQ A;  4MO7 A;  5IPA A;  1F43 A;  2NVT J;  5EGO A;  2Y2Z A;  3BQY A;  3F0C A;  2LD5 A;  1LFB A;  5K7H A;  5K7F A;  1ZQ3 P;  1S7E A;  2HYJ A;  3G1L A;  5FLM J;  5M5W J;  1POG A;  2CQX A;  1H8A C;  3IH4 A;  1TWC J;  3A02 A;  2DA2 A;  3BT9 A;  3BR2 A;  1MNM C;  3I4M J;  2NOG A;  3S2H J;  2GM4 A;  5J1Y A;  2E1O A;  4D5F A;  2O7O A;  2Y9Z A;  1NTC A;  2E2H J;  1RES A;  5FKM A;  4G12 A;  2VKE A;  4FE7 A;  3JRG A;  3JRB A;  3G1O A;  1ZKG A;  2CUF A;  1HLV A;  2MSY A;  1EF4 A;  4RBO A;  4GFB A;  3HOU J;  4I6Z A;  4DYQ A;  1UG2 A;  2HXI A;  1ETK A;  3BG9 A;  1X2N A;  2OPT A;  2H1K A;  2G0E A;  3HOX J;  3H3V K;  3L1P A;  4V2F A;  3C2B A;  4D5C A;  5C44 J;  5IP9 J;  1IG7 A;  3IV5 A;  3MN2 A;  2Y9Y A;  4BBR J;  3ZQL A;  4BY1 J;  4A93 J;  2WAQ N;  2LR8 A;  1IDY A;  2DA4 A;  1LE8 B;  2K9N A;  3RZO J;  5F04 A;  3I4N J;  1JJ6 C;  3O8H A;  1LFU P;  2R0Q C;  2QF7 A;  1OCT C;  1Y1W J;  2IAI A;  3BR5 A;  4XRS G;  2DA7 A;  1D5Y A;  4S0H B;  3E7L A;  4FTH A;  1QRY A;  4BY7 J;  1JKQ C;  1HF0 A;  4LOC A;  4X6A J;  2XB0 X;  2ECC A;  1DU0 A;  2XB5 A;  3WHB A;  2EZI A;  3JRD A;  1LE8 A;  3SFI A;  4C3I J;  5FLV A;  3HOW J;  2KDZ A;  4IHX A;  1IC8 A;  1RKT A;  2L9R A;  3IH3 A;  3TP3 A;  3A01 B;  2YS9 A;  5FKO A;  5E3N A;  1QPI A;  3GTJ J;  4ABZ A;  4UUS B;  1BW6 A;  4M6V A;  1FJL A;  2XRL A;  2EBI A;  1ETQ A;  2WB1 N;  3ZQH A;  2TCT A;  4RDU A;  5IP6 A;  1WH7 A;  3S16 J;  4X1E A;  2Y0S N;  1F36 A;  2DA3 A;  3S1R J;  3Q0V A;  2Y30 A;  1OFC X;  1I50 J;  2R5Z B;  4IEJ A;  1AKH A;  3RZD J;  3FK7 A;  2MG4 A;  2HXO A;  2W48 A;  3TED A;  2GLO A;  5EGO B;  3M4O J;  4UUS A;  2XPU A;  3S17 J;  1HOM A;  1ETY A;  2GBY A;  3Q3S A;  3JR9 A;  1ENH A;  5EG0 A;  1X2M A;  3M3Y J;  5J1R A;  1G2H A;  4A3J J;  1TWF J;  3LNQ A;  3RKQ A;  3JRA A;  2ZB9 A;  1ZR2 A;  5C4J J;  4C3H J;  4A3D J;  1R9T J;  4AYB N;  2VKV A;  1TWH J;  1JJ8 C;  2EH3 A; 
#chains in the Genus database with same CATH topology
 2Y0M A;  5CQE A;  4KFC A;  3QOE A;  2BY2 A;  1IN5 A;  2TDX A;  3ABU A;  1YHQ I;  1K79 A;  2EZH A;  1IDZ A;  3HKZ A;  4ZJZ A;  2GOM A;  2BHY A;  3A2K A;  2W00 A;  1FMV A;  3RQ4 A;  1D5V A;  4UXN A;  4IXA A;  2DDA A;  3ZMT A;  3H1C A;  2O03 A;  3LWF A;  4BYY A;  3ABL H;  2LNB A;  2PQ8 A;  3ZMV A;  3U1D A;  4BDZ A;  2VE8 A;  5IYD J;  4Y3O A;  1WGX A;  2FRH A;  2M0M A;  3JAM Z;  4MEX F;  1Y0U A;  3ASN H;  1FEX A;  2O3F A;  3I3L A;  1B59 A;  1LKX A;  2XF5 A;  2EK5 A;  1FWZ A;  4CCN A;  2X9D A;  4A3K J;  3F9K A;  4WXD A;  1F4K A;  3K4J A;  4N4O B;  4FX4 A;  5M5Y J;  1HDP A;  1X3Z B;  3GVA A;  2FQ3 A;  1YRN A;  3TO6 A;  3J7Z I;  2CQN A;  4HV6 A;  3PO2 J;  3FKJ A;  3OS1 A;  2X6Y A;  4N9H A;  2W57 A;  3EUK L;  4OMZ A;  4E4H A;  1AHD P;  4L9J A;  3GLX A;  3NEU A;  1R1V A;  1OYY A;  3F8B A;  1Z67 A;  5F0C A;  4FQG A;  3K9T A;  1D0Z A;  2V1D A;  3BJ6 A;  4HF0 A;  1OCR H;  1KYZ A;  1ONV A;  2EZK A;  3BG3 A;  5CQG A;  3OSF A;  2V1U A;  2DOE A;  3MVP A;  1I3Q J;  1F1Z A;  4FAS D;  1MBF A;  3MKL A;  5LFA A;  1NHA A;  2VQG A;  2MGQ A;  3OMY A;  2ZXI A;  4U88 A;  1IJW C;  2CGP A;  2VIX A;  4RGX A;  1VI0 A;  2M8E A;  3EET A;  2ELJ A;  3H35 A;  5D5W B;  2LFB A;  2JPB A;  3OYL A;  1P92 A;  2PMZ N;  2F4I A;  3KZZ A;  4BQO A;  4CCK A;  2X6X A;  3JTG A;  5M3F J;  1U5T A;  2M9H A;  3WU1 B;  2BYV E;  2COM A;  4XLE A;  3CCV I;  1RR8 C;  1D8J A;  1FOY A;  2EV6 A;  2JA2 A;  2ZFW A;  4F55 A;  1VQO I;  5DCF A;  2EWN A;  1N77 A;  2BOL A;  1QVT A;  3I55 I;  1TC3 C;  3DXJ F;  5J4Y A;  2H1L A;  1J7K A;  3K4B A;  1XSV A;  1YIT I;  3MZ8 A;  2A5Y B;  1YG2 A;  3DPL C;  3KLO A;  3PM1 A;  4XOP A;  4XKB A;  1D1B A;  4WXC A;  1UZC A;  2DMT A;  2GA2 A;  1BM9 A;  1Z0X A;  2V4J C;  3EUH C;  2IS4 A;  2O6G E;  2ZME C;  1XCV A;  4KJZ A;  2QGU A;  2QSG X;  3BTJ A;  1MMD A;  3ZQI A;  1S9H A;  1B8I B;  1FT9 A;  1BI3 A;  3KYL A;  3ABT A;  2MD5 A;  2QCO A;  2QSF X;  3FK6 A;  3WTX C;  5DCM A;  4HQE A;  4A2U A;  1R36 A;  3LFU A;  4Q4Z F;  3SDG A;  2QSH X;  4FET A;  2QBY A;  4Q5S F;  3I64 A;  2K40 A;  4ZYG A;  2B63 J;  2L9N A;  1MBK A;  4YEL A;  5E18 F;  4OOI A;  1P9Q C;  1PJR A;  2IBD A;  3HM5 A;  4N0B A;  4U0V A;  3OYC A;  1GUU A;  2H8R A;  4M3G A;  4IRI A;  4EJW A;  4DW6 A;  4G7O F;  1ZTR A;  2VXD A;  1T08 B;  5E1X A;  3ZQG A;  1BI1 A;  5AIP A;  1I39 A;  1B4A A;  3G71 I;  3AG3 H;  3KP2 A;  4FIS A;  4G6D A;  2HPI A;  1GHC A;  4W1U A;  2XF7 A;  5FRO A;  2JA7 J;  1BOB A;  3DU5 A;  2RAE A;  2VBY A;  1ZGW A;  3V7R A;  1XSX A;  1FTZ A;  2K9Q A;  1ZG1 A;  2DA1 A;  5H20 A;  2DK8 A;  4NHJ A;  3U9G A;  4MFE A;  1FIA A;  2CQ7 A;  2IS2 A;  2DBB A;  2DPU A;  5HLG A;  3J7Y J;  3TO7 A;  4E7S A;  2GXB A;  3CJT B;  5GTH C;  3T0Y A;  4A3E J;  3OYI A;  2FOW A;  1Z7U A;  2P5V A;  2A6T A;  2PMZ A;  4EAT A;  2VUM J;  1T2K A;  4LIT A;  4RM2 A;  3CDI A;  1OPC A;  4GXO A;  4A0Z A;  3ZXS A;  3GW2 A;  4PK4 A;  2JUC A;  3L09 A;  3PFI A;  1G3Y A;  2M34 A;  2CG4 A;  3GBG A;  1ZRC A;  2EIK H;  3F72 A;  3DBL B;  2R5Y B;  2L54 A;  2QEN A;  2L7F P;  2WV0 A;  1TP4 A;  3BZK A;  4JQF A;  1QZZ A;  1ZG5 A;  2RDP A;  3CF5 F;  3CF2 A;  3IAM 2;  1EA3 A;  1U3E M;  4OIP F;  3J7A O;  3BQZ A;  2FUG 2;  1XN7 A;  2QEX I;  2QVO A;  3L2Q A;  3MKW B;  2V1N A;  4J19 A;  2OV7 A;  2BBY A;  2P8T A;  3CCY A;  4JX5 A;  2M30 A;  1IRZ A;  4NC8 A;  4UUT A;  4BEH A;  2QQ9 A;  5LGN A;  3COA C;  5E3M A;  2PMH A;  5IOY A;  2Z16 A;  3MAJ A;  2XPW A;  3BR1 A;  4HLX A;  2HOA A;  3S14 J;  1W7P B;  4LJZ F;  2CQQ A;  1TLH B;  5DYM A;  3S8P A;  3CP8 A;  4HG2 A;  2RQP A;  4CCM A;  4YIR X;  1G59 A;  2BY0 A;  5IY5 H;  5CKT A;  2R7U A;  3GF2 A;  1F9N A;  1W5C C;  5CVV A;  3JSO A;  1NK3 P;  5FD5 A;  4EM2 A;  4WX9 A;  3IP4 B;  2Q2E B;  1J0R A;  1SVO A;  2CW7 A;  4JYK A;  2A69 F;  4BHP A;  1W5S A;  2EIM H;  5E20 A;  3ZCO A;  2ZNY A;  3FXL A;  1FP2 A;  4PUS A;  3K7A J;  1WKM A;  2AXL A;  1JTY A;  3GLL A;  3CQZ J;  4PDK A;  1X58 A;  1R5I D;  2KIU A;  2LKS A;  3IUO A;  2E34 A;  3ZGK A;  3TP0 A;  1IUF A;  4ZDO A;  1EH8 A;  2V79 A;  5H2F C;  2IEK A;  2MYS A;  2XPV A;  3EQL F;  3HUG B;  3M8E A;  1CF7 B;  1T98 A;  2COB A;  4IOA F;  2M5W A;  2JWT A;  3BPX A;  2VB6 A;  3CUQ C;  3HJE A;  4XRS A;  3FKI J;  1S29 A;  4RGU A;  3VYS B;  1KU3 A;  4EJT A;  3PSF A;  1P2F A;  1FOW A;  2LRD A;  1DDN A;  1H0M A;  2PBI A;  3FIW A;  2A07 F;  2JZY A;  1O3S A;  2W25 A;  4L5I A;  1P4A A;  2WAF A;  4QWQ A;  2BEO A;  1YI2 I;  3E6C C;  1SAN A;  3GX4 X;  5ICG A;  2JQ7 A;  2D1V A;  4Z6Y A;  2E35 A;  2M7B A;  1X1P A;  2E7X A;  3A01 A;  1VQ5 I;  2DMP A;  2FML A;  5F08 A;  4B1R A;  2OC6 A;  3VOD A;  3FZV A;  3I59 B;  2IVM A;  2X6O A;  1YX3 A;  2V1X A;  1L3L A;  3F8F A;  5J1U A;  2ID3 A;  2DW4 A;  1DP3 A;  4RAF A;  2X6W A;  3GTQ J;  1QHG A;  3V7S A;  3RPU D;  1LB2 A;  3L00 A;  3FX3 A;  3I9V 2;  1GV5 A;  4YII A;  1N78 A;  4XID A;  2ELH A;  5EEG A;  2WY8 Q;  4AUX A;  5FKK A;  3RPQ A;  3CCJ I;  4QIW N;  3KEY A;  4J01 A;  1UFM A;  3KYC B;  2NAZ A;  4HX4 A;  1B72 B;  2DJN A;  1F43 A;  5EGO A;  4ANJ A;  3AAF A;  2F4M B;  2IA2 A;  3F0C A;  3GFI A;  2LD5 A;  3KPH A;  2DDB A;  2RRE A;  2FXA A;  1ZQ3 P;  3DLA A;  5DD8 A;  2IPQ X;  1TTY A;  5M5W J;  2GA1 A;  4JOM A;  4I09 A;  4BU2 A;  3OV8 A;  3IH4 A;  2H8W A;  2DA2 A;  4ZYE A;  2X85 A;  3I4M J;  1HW1 A;  2KMU A;  4A5M A;  4BQA A;  3RYP A;  4QPQ A;  1WJ5 A;  3OL4 A;  4D5F A;  1XPX A;  1S7O A;  4MTD A;  2KHM A;  2Y9Z A;  2E2H J;  2DO7 A;  2ZNZ A;  2VKE A;  3JRG A;  1OR7 A;  1ZKG A;  4G7H F;  1QZE A;  1WRJ A;  4RBO A;  3ECO A;  1EKE A;  1FZP B;  2HXI A;  3RI4 A;  1KU7 A;  1K78 B;  3DBH B;  2ZJQ F;  2QA4 I;  3K4N A;  4UV8 A;  2CSO A;  3BG9 A;  2DOA A;  2G0E A;  3PFY A;  3L1P A;  4V2F A;  3D0S A;  1O7F A;  3C2B A;  3OOP A;  1V55 H;  4RS8 A;  3RSN A;  1LFP A;  3IV5 A;  2P0W A;  3MN2 A;  4RAY A;  2Y9Y A;  4XKW A;  4ESB A;  4BE1 A;  1WI9 A;  4YIF A;  2LR8 A;  1HBX G;  1LE8 B;  1YW9 A;  3QPT A;  3I4N J;  1JJ6 C;  2R7F A;  4I02 A;  2R0Q C;  2QF7 A;  4QLC U;  2KDO A;  1Y1W J;  1D5Y A;  2DA7 A;  4RGR A;  1J75 A;  1MJA A;  3MEX A;  4CZZ A;  2AXT C;  1N25 A;  4LOC A;  4X6A J;  4Q47 A;  1SFU A;  4OU0 A;  3EUA A;  5E1W A;  2ECC A;  2XB5 A;  2EZI A;  3JRD A;  1B1B A;  3BG7 A;  4RB3 C;  2NVU B;  2Z1D A;  1R58 A;  3SFI A;  4C3I J;  2IXS A;  1XGM A;  1QNT A;  2VC0 A;  2NNY A;  3FXQ A;  5B1B H;  2Z3Y A;  3TP3 A;  1QPI A;  5E3N A;  2EB7 A;  4ABZ A;  3F8M A;  3GTJ J;  4ENJ A;  4UUS B;  3LA3 A;  2KJB A;  3DQV C;  1DPR A;  2CH0 A;  4BXU A;  3F6V A;  3ZN1 A;  3LSH A;  5IP6 A;  1TNS A;  1MMS A;  4B3X A;  2ZSI B;  3HHG A;  2FMY A;  1WVR A;  3K6G A;  1RUO A;  1OFC X;  1Z3X A;  1I50 J;  3FDY A;  5DUI A;  3FK7 A;  1P6R A;  4A5N A;  3HOS A;  1ACI A;  3JAM K;  2KRF A;  4UB8 C;  1R7J A;  1KU2 A;  3KE2 A;  3J80 K;  2EFQ A;  1ETY A;  2GBY A;  3JR9 A;  3M3Y J;  2KKO A;  1I6X A;  3OIQ A;  3H36 A;  5BPD A;  1QZY A;  4D9J A;  2W85 A;  3LNQ A;  1YE9 A;  4L0Z B;  4HW0 A;  3JRA A;  1EV7 A;  3WG7 H;  4M72 A;  5C4J J;  3DWL E;  1BN5 A;  2M45 A;  4C3H J;  1XGN A;  4AYB N;  2GXA A;  2VKV A;  1FLI A;  5FJ8 J;  1J9I A;  4Y52 J;  3CMM A;  1B8I A;  3W2W A;  4HQM A;  3H0D A;  5LRR A;  1W0U A;  5J3L A;  4EJU A;  3LSM A;  2F4O B;  1LJ9 A;  2XRO A;  1T95 A;  4PJ0 C;  3LAP A;  3UKG A;  1Z6T A;  3PIP F;  2LY1 A;  1MH4 A;  3E97 A;  4KT6 A;  1MD0 A;  5DDG A;  1D1C A;  1BI2 A;  2ADU A;  4WCG A;  1DP7 P;  3S15 J;  2R7X A;  3HRM A;  5JLX A;  4CGZ A;  3VPR A;  1LDJ A;  5B66 C;  3K1N A;  4B48 A;  1DQU A;  1ZLJ A;  2DCE A;  5CLS A;  1YJN I;  2GOX B;  4XR6 A;  4RGS A;  3PO3 J;  4LB6 B;  2K7L A;  2DTZ A;  5GPA A;  2E1M B;  1KQ0 A;  5HNF A;  4CIC A;  1KGS A;  2W4S A;  1R6R A;  3CMY A;  1Y56 A;  3DEE A;  4UVC A;  1JTX A;  2GQQ A;  5KNL A;  3JRC A;  2XIG A;  1MND A;  5ERI A;  5LHI A;  3E6B A;  3LSR A;  4FCY A;  3IRR A;  2DOD A;  5BS6 A;  4XKV A;  1ZGJ A;  3SEZ A;  2UXN A;  3H92 A;  3N97 A;  1HCR A;  2R92 J;  5EYR A;  2IGO A;  3QOD A;  3V8L A;  5IYC J;  4IHV A;  1GT0 C;  1FMW A;  3DTE A;  4IF4 A;  5KK1 A;  2XKP A;  1TBX A;  3RQI A;  2IJL A;  3LSK A;  2E1N A;  2XAF A;  1RKW A;  2IA0 A;  4BXF A;  3QPH A;  4B43 A;  1HKS A;  3E5Q A;  1IRF A;  2DLL A;  3OSG A;  5L3B A;  2VC1 A;  4M3D A;  4JX4 A;  2JRM A;  4IO9 F;  4E7K A;  2E1C A;  2A61 A;  3S1Q J;  1I5Z A;  3IH2 A;  4FHT A;  2MFZ A;  5C4X J;  4A6D A;  1SFE A;  5M5X J;  2DFI A;  5BQT A;  2PJR B;  1AKH B;  3SYT A;  2HFH A;  2IGN A;  1JUP A;  3BC8 A;  1E3P A;  2DT6 A;  2OQR A;  4WXH A;  3ZMS A;  4AYB A;  3D5L A;  2H94 A;  4AM3 A;  1V54 H;  2XVC A;  2XAG A;  3PUB A;  3SJM A;  2OTL I;  1X3U A;  3FXU A;  3ZR8 X;  1SVM A;  2GZW A;  1W7P A;  3ZOB A;  3HDD A;  3FM3 A;  4HF1 A;  5D5U B;  2HVS A;  3BPV A;  1YO5 C;  4A12 A;  1R71 A;  2M2E A;  3Q9V A;  1FY7 A;  4EGZ A;  4XBF A;  4ZDP A;  4KIC A;  4AWX B;  2Q2E A;  3IC7 A;  5LD2 C;  4MGR A;  4BHB A;  1IXR C;  5D4S A;  2D45 A;  3TBI A;  4F91 B;  2HZD A;  2R7R A;  2JVH A;  4B3A A;  5EF6 A;  4IHS A;  5GP9 A;  5DTD A;  3ABM H;  1OKR A;  3CDH A;  5HOD A;  3ZQC A;  2ZFU A;  3CC7 I;  4D7N A;  2RNJ A;  1ETX A;  2HR3 A;  2W84 A;  4EMS A;  4PFO A;  4PGG A;  3WTV C;  4ZDL A;  2D2W A;  3EPZ A;  1TL8 A;  2A5W A;  1ZRD A;  3S93 A;  3PIO F;  3HTS B;  1ZK8 A;  1CF7 A;  4MHG A;  2HGC A;  5J8C A;  2LBF B;  1X4O A;  2P81 A;  5FKL A;  2WTE A;  3KP6 A;  1A5J A;  4IPA A;  1TW2 A;  4U0W A;  2L02 A;  3LOC A;  4P1W A;  3EYY A;  1WJE A;  4KIT B;  2LTP A;  2QQ8 A;  3DFG A;  4LG0 B;  3C18 A;  3RJP A;  2BVM A;  2JK3 A;  3MD2 A;  3VOE A;  1RRJ A;  5GAE J;  5L3F A;  2I5U A;  4NC7 A;  1HST A;  4Q48 A;  3IWF A;  2ETH A;  3BZC A;  1MSF C;  4G6Q A;  2HDC A;  4DGW B;  2L0K A;  2OJE D;  1O4X A;  4HSR A;  3HRU A;  3WOD F;  5AIQ A;  5K5Q A;  3F23 A;  5EZH A;  1JHH A;  5E79 C;  2ZXW H;  4D0P A;  3R4K A;  3CO6 C;  1T8I A;  2Z99 A;  1DU6 A;  4XQF A;  2PMU A;  3GXO A;  1BR1 A;  3K70 C;  2O61 A;  4XOR A;  1XGS A;  2CS3 A;  3NAR A;  4O5V A;  2JTV A;  2WA0 A;  4L5E A;  1MBJ A;  5HVQ C;  5IT9 K;  4A3F J;  2WB1 A;  4CCJ A;  5EZG A;  5JVT A;  2IGK A;  3E1S A;  1B72 A;  2M4G A;  4V2G A;  4DJA A;  3L2R A;  2IS6 A;  3OWT A;  1WJD A;  2F5D A;  3PNT A;  2FOK A;  1XS9 A;  2HVQ A;  1R49 A;  2NVY J;  2CFO A;  2R7W A;  1V5F A;  3HIF A;  3I0T A;  4I0A A;  1MSE C;  3BR3 A;  4BAY A;  5E3L A;  2CUZ A;  3BRO A;  2DN0 A;  4H4K C;  4HF2 A;  4LB5 A;  1W5T A;  3CLQ A;  4S04 A;  3GYH X;  3SXY A;  1PUE E;  3F6O A;  5F1R A;  3DP7 A;  2AQE A;  1P7I A;  2VJI A;  4KIG A;  5J47 A;  4HLY A;  1QBJ A;  1R23 A;  4XN0 A;  3KFW X;  4G9Y A;  2J5O A;  2MC3 A;  2XAJ A;  4NC6 A;  1B9N A;  4RB2 C;  2O8X A;  3ZMU A;  2OD5 A;  3OYF A;  5J40 A;  3ROU A;  2R7D A;  2DMU A;  3QU3 A;  4LMY A;  5AON A;  3TL4 X;  1XMX A;  4E7Z A;  2E2J J;  3KET A;  4PJJ A;  1IRG A;  3GO5 A;  2DU9 A;  4Y17 A;  1K78 A;  4L9T A;  1U8B A;  1NG7 A;  1FYK A;  4ENM A;  2UV1 A;  1BL0 A;  3GFM A;  1HDD C;  4GDF A;  1IV6 A;  1G4D A;  3QPL A;  5EJC A;  1MBE A;  1UST A;  4KN7 X;  4BDY A;  2EV0 A;  3OIP A;  2DQR A;  2Z2S B;  3V7C A;  1PUF B;  1ZRF A;  3S2D J;  4FX0 A;  2RV8 A;  4BBS J;  2X51 A;  4ZYA A;  2H6C A;  4XLF A;  1MBG A;  4UV9 A;  5JVG F;  3Q5F A;  4KNY A;  1ZAO A;  2XKO A;  2X0L A;  4CYD A;  1BI0 A;  2LY9 A;  2ZC2 A;  2K4J A;  1XC5 A;  1NK2 P;  2L7Z A;  2Q0O A;  1IZ1 A;  1KA8 A;  5FFX A;  1KON A;  2V9V A;  3DBR B;  3KZY A;  4R8H A;  4BE0 A;  2HDD A;  4HAM A;  4CYC A;  5GAH J;  2L2O A;  3DU6 A;  2L9S A;  4JBA A;  4DYC A;  4A3I J;  4EJO A;  3SEQ A;  4G6T B;  2W7N A;  3QP6 A;  1JUM A;  3DCF A;  3CJQ B;  1U5T C;  2Z33 A;  3FMS A;  5LHG A;  4A3L J;  5E17 F;  2FEZ A;  5HLI A;  1IW7 F;  2CYY A;  2W82 A;  5ICE A;  2VKD A;  4XK4 A;  1XD7 A;  2QKL B;  2E5N A;  1R1U A;  1I3A A;  1U9O A;  1EH6 A;  2DYR H;  2FSW A;  1QHH D;  3HPG A;  3GFJ A;  3QOP A;  4BUP A;  5HDN A;  1LEB A;  3GFL A;  5EEA A;  2CJJ A;  3L7W A;  1SFO J;  4HNV A;  4KUM A;  5KAF C;  1BW5 A;  2ID6 A;  3SQN A;  1ETW A;  2V7F A;  4XOT A;  3JRI A;  4DZJ A;  3QRF F;  4CHU A;  2R7O A;  3CD6 I;  3SZT A;  3CCQ I;  3TDU C;  2CUE A;  4RB0 A;  2NYX A;  4MQ9 F;  2IW5 A;  1YQA A;  2MA3 A;  3T8R A;  2NS8 A;  2HYF A;  5BMZ A;  2Y2Z A;  3AG1 H;  2HQA A;  3BQY A;  5DM6 F;  1WQ2 A;  4M9S A;  5K7F A;  1S7E A;  1SMT A;  2E71 A;  4KT5 C;  3BCA A;  3A0H C;  4L0Y B;  2BY1 A;  3KP3 A;  2UWM A;  1HC8 A;  5HDK A;  3ZQQ A;  2XAS A;  2XUB A;  1J2X A;  2EV5 A;  3TQN A;  5J8F A;  3BT9 A;  3BR2 A;  1Z05 A;  3PQJ A;  1K6O A;  2CV2 A;  2K02 A;  3CJR B;  1QA6 A;  3NWT A;  2E60 A;  3KZI C;  4BE2 A;  1LNW A;  1BR4 A;  3SDB A;  3IKT A;  3ASO H;  4C2T A;  3FF5 A;  5B1A H;  3WGH A;  4P5O A;  2BXZ A;  4C9Y A;  1RES A;  1SAX A;  4FE7 A;  3JRB A;  1MZB A;  2QLZ A;  5CVR A;  3G1O A;  1YIO A;  2CUF A;  1EF4 A;  2MSY A;  3K70 D;  3HOU J;  3D5S C;  2VT2 A;  1TQM A;  2L3D A;  4DYQ A;  1UG2 A;  4M9X A;  2LDU A;  2UZK A;  1X3W B;  2RKH A;  6PAX A;  2H1K A;  3A0B C;  3HOX J;  3UNG C;  4F92 B;  4ZYH A;  3RKW A;  1QPM A;  5IP9 J;  4PSX A;  4BY1 J;  4RMN A;  3ZQL A;  4A93 J;  2K9N A;  3RZO J;  5F04 A;  3E5X A;  2HTJ A;  3F3X A;  3L2V A;  2DTR A;  3DF8 A;  4N9I A;  4OAZ A;  4GCV A;  5L3C A;  2DOF A;  2HKO A;  4ON0 A;  3X2Q H;  1LFU P;  2JRT A;  4ZZD A;  1OCT C;  1UEL B;  2GWR A;  3BR5 A;  4XRS G;  4E6K G;  2CUJ A;  3GME A;  1T6S A;  2MLK A;  3DV8 A;  2KQR A;  4S0H B;  5CJ9 A;  1HF0 A;  3CCR I;  3B73 A;  4KN4 X;  4E7L A;  3GCM A;  3H9G A;  3O2P E;  1UCR A;  2JSP A;  1LDK B;  2OQG A;  2QWW A;  1U8R A;  3BJO A;  2HQR A;  3HG9 A;  3ISP A;  2VOP A;  5HLH A;  5D4R A;  1IC8 A;  1RKT A;  3IH3 A;  5JFR A;  2VJ5 A;  3CC2 I;  2VT3 A;  4S05 A;  3VWB A;  1V5E A;  4L9N A;  5A2Q Z;  4ESF A;  2XRL A;  3J7A Y;  4DQ2 A;  2O5R A;  4LLL A;  1HQC A;  1K4S A;  5FLX Z;  2DYS H;  3OR1 C;  3OR2 C;  4O6J A;  1MJB A;  3OYB A;  4AIK A;  3VB2 A;  4CCO A;  2D1H A;  4XLC A;  2Y0S N;  1G8X A;  2KRH A;  4H0E A;  3S1R J;  3Q0V A;  4C30 A;  1IXS B;  3IWZ A;  2EFP A;  4HA8 A;  3RZD J;  1YFH A;  1AKH A;  1BC7 C;  2PJR A;  2MG4 A;  1Y0N A;  1L0O C;  1ZRE A;  5FD6 A;  2GLO A;  1FNN A;  2HKX A;  2LF8 A;  2XV4 S;  4P96 A;  1SEU A;  3DTK A;  2HTS A;  3V8K A;  5LEK A;  2FA5 A;  1ENH A;  3LMM A;  1ODD A;  1ERD A;  1TWF J;  3KEO A;  3RKQ A;  2OZU A;  4UB6 C;  3AKZ A;  3TMO A;  3CCE I;  3HSF A;  5TRD A;  1T38 A;  1R9T J;  2RN7 A;  3I71 A;  4AVP A;  5F64 A;  1TWH J;  3G2B A;  2EH3 A;  4IQJ A;  4C2M J;  4F7Z A;  3GWZ A;  3BJA A;  2Q8K A;  2L4A A;  5E3O A;  1UJ8 A;  2ELK A;  4RLF A;  2FD5 A;  1CGP A;  1O3Q A;  1BIB A;  1YLF A;  3GUD A;  3CCS I;  2BY3 A;  1VQ7 I;  4RAG A;  3WE2 A;  1UMQ A;  1K83 J;  3GTP J;  1T39 A;  2PG4 A;  2P6S A;  3FBI B;  4MQV A;  4IZZ A;  3QP5 A;  4ESJ A;  1G3S A;  4CZC A;  3IAS 2;  4N4N B;  5H6Q A;  2LBF A;  2EA2 A;  2OBP A;  3QPS A;  3TOB A;  3HGY A;  3LA2 A;  3PSI A;  2TRT A;  1JT0 A;  2KT0 A;  2DI3 A;  1YW8 A;  2WV1 A;  2K9M A;  3HRS A;  2ZJ2 A;  1P7J A;  5DS9 A;  3W6V A;  4LG0 A;  1F5T A;  2O9L A;  4HDU A;  3WTT C;  5L3E A;  3P9K A;  5IOZ A;  3BP8 A;  3H3Z A;  2ZME B;  3N4M A;  2R7T A;  1ZLK A;  1J09 A;  4A0Y A;  2ZXH A;  1K4T A;  1FBS A;  5CVU A;  5E8I A;  5J4V A;  2Y0S A;  2K3P A;  1ZGA A;  3HEF A;  3E5U A;  1GLN A;  2R4G A;  1QVU A;  3VYR B;  2CQK A;  4Y33 A;  1BJA A;  3BY6 A;  3EDP A;  2VBX A;  5KAI C;  4ZYD A;  4IRG A;  1TWG J;  4V19 K;  2F48 A;  4PFP A;  2FF4 A;  4XRF A;  3O8G A;  3OYG A;  3VSL A;  2D5V A;  2KL4 A;  2VLA A;  1ETV A;  1IN7 A;  2VN2 A;  4HV5 A;  4LFU A;  5JHU A;  1T0F A;  4GO1 A;  4IJA A;  2KP6 A;  3IKV A;  2WAE A;  1OR7 C;  5F0H A;  2STW A;  2ZSH B;  5LBQ A;  2R7Q A;  1RI7 A;  2LSO A;  1RUN A;  4I01 A;  3HRT A;  3E3V A;  1MKM A;  3DPT A;  3HSE A;  3S1M J;  3U1K A;  3ZQ7 A;  2FX0 A;  1FC3 A;  5CVJ A;  1IAW A;  4FE4 A;  4XIC A;  2VQL A;  4E70 A;  4AVZ A;  1XB4 A;  2LH9 A;  3L2W A;  1CQT A;  1ON2 A;  4IVN A;  2ESH A;  2M1B A;  1RPW A;  3AL0 B;  4M3B A;  5HNH A;  4CXF A;  2NVX J;  4RLQ A;  2VOD A;  3CCU I;  1JT6 A;  3KYD B;  1K6Y A;  1AA7 A;  2E19 A;  2DXI A;  2VON A;  1J5Y A;  3HTU A;  2CU7 A;  2KIQ A;  4F93 B;  3K4C A;  4P9F A;  4II3 A;  4A69 C;  3ZRG A;  2L7M P;  3CME I;  5TGT A;  3BG5 A;  1T0F C;  2RVC A;  1A36 A;  4OMY A;  1LVA A;  2R7Z J;  2FQ4 A;  3MKY B;  1GXP A;  4HDV A;  1JKO C;  3C2H A;  1RET A;  1A6Q A;  4PJL A;  2B9S A;  3G3Z A;  3OYE A;  3OYA A;  3MZY A;  4GYI A;  5IYB J;  3T1B A;  4HBL A;  1OMI A;  1GDT A;  1TQP A;  5FRN A;  4CSW A;  4M6Y A;  1D8K A;  1RR7 A;  2IRF G;  3N05 A;  5D6F A;  3CDL A;  1JUS A;  4NBQ A;  1DUX C;  2HYG D;  1HKQ A;  2DA6 A;  3LFK A;  2ME6 A;  3CJN A;  3L2C A;  1LUJ B;  3FWE A;  1Z21 A;  3MKZ A;  1AU7 A;  2AS5 F;  4XRM A;  3DLL F;  3CP2 A;  2OU2 A;  1XSD A;  2HOT A;  2X48 A;  1BA5 A;  3V8J A;  3KX2 A;  1O3R A;  1X1C A;  3CLO A;  4BL0 B;  3I4P A;  2Y75 A;  1KYW A;  2KPM A;  3S3O A;  5B3S H;  2L7K A;  4XKC A;  3ERE D;  1UHS A;  3K4L A;  3E6M A;  3OOU A;  1LPQ A;  3M8J A;  1IV8 A;  2CW0 F;  2XAH A;  1W36 C;  1OYW A;  2JT1 A;  4ENK A;  3H5A A;  4M9Z A;  4PCQ A;  2XGX A;  2C6Y A;  3DKY A;  1Y39 A;  1VQ8 I;  3CUQ B;  1FP1 D;  5K5R A;  3DTI A;  1G6N A;  3DKW A;  4M71 A;  4A3G J;  3V4G A;  2EQR A;  3MCZ A;  4C3J J;  5K1Y A;  4II2 A;  3ONQ A;  2VKH A;  1ZH5 A;  2F5F A;  4GRI A;  2XGE A;  1IN6 A;  4DZP A;  3Q0W A;  4ASN A;  1MH3 A;  4HYE A;  1DGW Y;  4LLN A;  1MMA A;  1FX7 A;  3ULQ B;  2G7U A;  5K7Z A;  1O3T A;  2VPL A;  1HA8 A;  2VBZ A;  2Z9O A;  1XDS A;  2ZJP F;  2KLO A;  1OIS A;  2M0C A;  3H5N A;  3QYF A;  3LSJ A;  3VSK A;  2PJP A;  3GTG J;  1LEA A;  1JGG A;  4LLG F;  3MMY B;  4A3C J;  3M7G A;  4OIN F;  2R5Y A;  3MZH A;  2W1O A;  1ZR4 A;  2YR2 A;  1WI3 A;  2DFH A;  3MFK A;  2HOE A;  3K1M A;  1BBY A;  1TQI A;  3Q9S A;  2O0Y A;  3HKZ N;  3K1P A;  2ME0 A;  1K61 A;  1ITY A;  4UVB A;  2L01 A;  3WU2 C;  1Z3Y A;  1HXD A;  4A3M J;  2A3S A;  3E0J B;  2JPC A;  5DUK A;  3CMA I;  2L4M A;  3BCB A;  3WU0 A;  2NS7 A;  2MC4 A;  3G73 A;  3SFZ A;  1V5G A;  3TKY A;  2HPM A;  3JCU C;  2LG4 A;  2G9W A;  1SD7 A;  4ITV A;  3OYM A;  4IL6 C;  3GTL J;  1AOY A;  2KZG A;  2P5K A;  3LSP A;  3HOV J;  2UUZ A;  2M8G X;  4OAY A;  1VF9 A;  4ENN A;  3B6A A;  4UNO A;  5FKN A;  1TW3 A;  3R6S A;  1C0W A;  3FMQ A;  3TOA A;  2XAQ A;  2G7H A;  2ICW G;  4CUG A;  3M9A A;  5CPR B;  4KMF A;  3L2U A;  1WSU A;  2A68 F;  2YU9 J;  1KZH A;  3K2A A;  4JP0 A;  3HXL A;  2MAB A;  5BPI A;  1OQY A;  1O57 A;  2LP0 A;  3KP5 A;  3QAH A;  1N75 A;  5ICC A;  1FBU A;  3HUG A;  1Y8Q B;  1M1E B;  2XGC A;  5HLT A;  3FIS A;  3S1N J;  2YU3 A;  4BNC A;  1MBH A;  1H88 C;  2EPF A;  2LVS A;  1JXS A;  4AU7 A;  4HPQ A;  3FXR A;  1XDU A;  3S32 A;  2P6T A;  1FTT A;  3NRV A;  4NDL A;  2QKM B;  5BNG A;  2AHQ A;  1H9G A;  2XSD C;  4AD9 A;  2NVQ J;  2E36 A;  2BE5 F;  4QSH A;  4WWC A;  5J6X A;  3QQA A;  4XLP F;  1Y1V J;  1SFX A;  1JE8 A;  2LKP A;  3CO7 C;  2DMQ A;  3CUO A;  5IPA A;  3AG2 H;  1KU9 A;  3FMR A;  1U2W A;  1LFB A;  3D5R C;  5K7H A;  4LD5 A;  3I59 A;  2HYJ A;  3REO A;  3I54 A;  3G1L A;  5FLM J;  3PNY A;  2XRN A;  1A31 A;  4XSZ F;  2X1D A;  1POG A;  2WAD A;  4Y4R A;  1H8A C;  1TWC J;  2VXZ A;  3A02 A;  3C7J A;  3HSR A;  3HOT A;  3W6K B;  2EIL H;  3HPH A;  3JSP A;  2GM4 A;  3S2H J;  3KCC A;  2M3A A;  2H6B A;  2ZBK A;  5J1Y A;  2E1O A;  3HZJ A;  3TO9 A;  2O7O A;  5ILS A;  1DPU A;  3O6B B;  1X4P A;  3WGG A;  1XMA A;  4BS9 A;  2V6E A;  2R7S A;  3KP4 A;  2JSC A;  1W1W E;  3FBN B;  5A2Q K;  1MJ9 A;  2XDV A;  4L18 B;  2ZCW A;  3K69 A;  4GFB A;  3J80 Z;  2ISY A;  4I6Z A;  1W36 D;  2B0L A;  3H3U A;  4OIQ F;  2YX4 A;  3G4S I;  2LC2 A;  2PI0 A;  1ETK A;  5FLX K;  3GZ5 A;  3J81 Z;  1J59 A;  3LL7 A;  1PP7 U;  1SD5 A;  5EEH A;  2FNP A;  4YFN F;  1LVK A;  4D5C A;  2OZ6 A;  3BZ6 A;  4XLH A;  1IG7 A;  2R7V A;  2Y48 A;  3KP7 A;  4BBR J;  1YTY A;  1A04 A;  4KYW A;  1V4R A;  2DFE A;  1SVL A;  1USS A;  2DA4 A;  2YPR A;  5E1Z B;  3K4K A;  3W2V A;  3HL2 A;  2A6H F;  1WFX A;  2IP2 A;  3O8H A;  3VYU B;  5GTI C;  3C2G A;  3IRQ A;  2IS1 A;  1FSE A;  4UUV A;  2IAI A;  3R60 A;  4WF2 A;  4RAZ A;  1VQP I;  3EUH A;  3E7L A;  4I0B A;  4FTH A;  5D6E A;  4F3Q A;  1JKQ C;  2RQQ A;  3CES A;  4KA4 A;  2ZME A;  2L9V A;  2HEO A;  1S7A A;  1U6G A;  1K7A A;  1Q1H A;  3OYK A;  1DU0 A;  1MDM B;  2FE3 A;  4E7H A;  1LE8 A;  3HOW J;  5FO5 A;  2KDZ A;  2QM3 A;  1TNT A;  4NQW B;  4IHX A;  5JHF A;  2LYC A;  3RPU A;  4ZC3 A;  2YS9 A;  5FKO A;  4G94 A;  2EFN A;  1BW6 A;  2EBI A;  2NOJ B;  5HS9 A;  5E8G A;  1ETQ A;  2STT A;  4RDU A;  1IUY A;  2UXX A;  3GZ6 A;  2HZT A;  1XGO A;  4R79 A;  4X1E A;  5DEQ A;  2VQH A;  3ZPL A;  2DA3 A;  4UY8 I;  3ERM A;  1RZ4 A;  2WBM A;  4KIB A;  5B5E C;  2IT0 A;  2R5Z B;  2ACJ A;  2RGV A;  2ZO4 A;  5HS7 A;  4OIR F;  2HVR A;  2HXO A;  2KIF A;  1UAA A;  1YS7 A;  3TED A;  3OYD A;  1BIA A;  3P9I A;  3BWG A;  3M4O J;  4UUS A;  2XPU A;  5F6F A;  3S17 J;  1P4W A;  4NB5 A;  3WTZ A;  2GAU A;  3Q3S A;  2H27 A;  4L9V A;  1B9M A;  2PEX A;  5FFZ A;  1QQI A;  1Z6R A;  2EIN H;  1SC7 A;  3TDZ C;  2RNG A;  1WHU A;  4XM3 A;  4I2O A;  1DGR M;  3OY9 A;  4BQN A;  1VQK I;  4Y13 A;  1RIO H;  4LGW A;  2ZB9 A;  1XCB A;  2CMP A;  2A05 A;  1ZR2 A;  3FXJ A;  2BV6 A;  4YFX F;  3F22 A;  4YEJ A;  1LQ1 A;  3BG6 A;  3P7N A;  1PP8 F;  3M1E A;  5JI6 A;  3H9J A;  1R1T A;  4G8X A;  1JJ8 C;  2VOO A;  1ETO A;  2J5P A;  1W7P D;  2WC2 A;  2KFD A;  3HOZ J;  1UB9 A;  2XSJ C;  4NNJ A;  4IX7 A;  1ORK A;  1WJB A;  4XLA A;  2FNA A;  3FXK A;  4LG3 A;  2BVL A;  1X1A A;  4EVI A;  1YOV B;  2DJI A;  2V9K A;  4I76 A;  4HNT A;  1FYL A;  3G6E I;  2P7C B;  3U21 A;  2OUM A;  3LSG A;  4BKX A;  1I27 A;  1MNE A;  1OCZ H;  2VE9 A;  2OA4 A;  3T8T A;  2VQC A;  1GXQ A;  3GTM J;  3M8F A;  1ZEL A;  2NXN B;  4BAC A;  4I98 B;  4CO8 A;  2N8G A;  3V42 A;  2QQA A;  4MFD A;  4GGG A;  2YX7 A;  4G7Z F;  5CVI A;  3R0J A;  2DA5 A;  5M3M J;  3AL0 C;  1YX5 A;  2K4B A;  3W2A A;  5ILU A;  1APL C;  4HST A;  3D1N I;  2GIV A;  2ZJR F;  3BDD A;  1OCC H;  2HQ5 A;  4EM0 B;  1UG0 A;  3BOQ A;  2OAZ A;  4GYG A;  4M3F A;  4YG2 F;  3DEW A;  1Z77 A;  2Q1Z B;  3LQR A;  3FM5 A;  4U87 A;  4QPO A;  1VQ4 I;  3TW7 A;  1S3J A;  2VJJ A;  2P4W A;  4HOB A;  3BR0 A;  3BTC A;  3O3K A;  1W4M A;  1Z7L A;  2EIJ H;  2KJC A;  3K2Z A;  1NH3 A;  2ZKZ A;  3WGI A;  3HYI A;  5HS8 A;  4OIO F;  2FU4 A;  2EZL A;  4AID A;  2CRG A;  1TZL A;  3I5U A;  2QQB A;  3ABK H;  1FIP A;  4CDG A;  1FOX A;  2ESN A;  2X1E A;  3W6J B;  3W3C A;  3CUQ A;  3RYR A;  1YW7 A;  3GTO J;  4BHC A;  3DEU A;  2EA4 A;  2ISZ A;  1Y6I A;  1XG1 A;  1A35 A;  2VL8 A;  5F1J A;  1P4X A;  1PVE A;  5IP7 J;  1OCO H;  2JA5 J;  3F21 A;  3WHC A;  4QTR A;  2BW3 B;  4EJV A;  1MMG A;  5KHD A;  2OCE A;  3TGN A;  2V9P A;  1VND A;  2CO5 A;  1A6I A;  5EG0 B;  1MGT A;  2OF7 A;  1OYI A;  5KCM A;  2FBI A;  3HGG A;  1HW5 A;  5IT9 Z;  3RDI A;  4DBQ A;  1R5H A;  3MWM A;  1FPQ A;  1VFC A;  4U7D A;  1MIJ A;  4KIF A;  3RIR A;  2E1M C;  1Y8R B;  3H0G J;  4JX6 A;  4MIM A;  4DNC A;  4ZZL A;  1YIJ I;  2O8K A;  4OWR B;  2HS5 A;  3JRH A;  2JVG A;  3H5R A;  3WE3 A;  1JHF A;  5TIS C;  2LK2 A;  1UHM A;  1SFK A;  3PJR A;  3S2W A;  1IN4 A;  4CA0 A;  1YS6 A;  1WCM J;  2VI6 A;  3BTI A;  4PJM A;  4LK0 F;  2X1C A;  1OCP A;  2HI3 A;  2Y69 H;  4HZF A;  2VPR A;  4TV7 A;  5L3G A;  4XSX F;  3BTL A;  2I8D A;  4ZTF A;  3GTK J;  5ED4 A;  4Y7N J;  1T33 A;  3A03 A;  3QU6 A;  4EM1 A;  1JKP C;  2DPD A;  2RC4 A;  1Z9C A;  2EFW A;  5H6R A;  1E0E A;  2M7A A;  3OIO A;  3JRE A;  2LLK A;  3F8C A;  5GPC A;  2HWV A;  5KVR A;  3AFH A;  1Q1V A;  2E5Z A;  3GZN B;  4P55 A;  3JRF A;  1TT0 A;  5CYV A;  4M3E A;  1RNL A;  4KMU X;  1EH7 A;  3VDX A;  4EGY A;  2M87 A;  1SD6 A;  3BR6 A;  5GAD J;  1BJZ A;  4I99 C;  2BGC A;  2XF6 A;  2E2I J;  2Y31 A;  3CC4 I;  1YRN B;  2F5V A;  2ZXJ A;  2QZ8 A;  4YRV A;  4K2E A;  4XL9 A;  1TT5 B;  4E7I A;  4XON A;  2E7W A;  3RCO A;  2JMW A;  1HKT A;  1T56 A;  2XHK A;  1RC9 A;  1EJ9 A;  4B8X A;  3RKX A;  4WK8 F;  3ELK A;  3ZMZ A;  1R22 A;  2DT5 A;  3R0A A;  3ZQF A;  3UR3 C;  3WTU C;  1VQN I;  1VQM I;  4X0G A;  4M6X A;  2WY7 Q;  1X1D A;  3KLN A;  4MEY F;  2Z5U A;  2CFX A;  3NAU A;  4DYR A;  3KIO A;  5LGU A;  3A1Y A;  4XNF A;  4D7M A;  1IN8 A;  2FJ1 A;  4RA2 A;  4XMY A;  4RB1 A;  2GXG A;  1FOK A;  4ZTJ A;  4IHY A;  2ECB A;  2BZT A;  1FYM A;  1R00 A;  3P5J A;  4UHT A;  2AO9 A;  4DIQ A;  2YUS A;  2IA1 A;  2K9S A;  1U5T B;  2KZV A;  1BC8 C;  1IRX A;  2DFF A;  2X4H A;  2MW8 A;  5HDG A;  3I56 I;  1I6H J;  2NNN A;  3C1D A;  1ULY A;  2XC7 A;  9ANT A;  4EEF G;  4LK1 F;  1S72 I;  1Z1D A;  1O7L A;  3ZN0 A;  2DK5 A;  3F8N A;  2IGM A;  1VTN C;  5F27 A;  3JTH A;  2I10 A;  2K9L A;  1VQL I;  3HBL A;  1S5L C;  3HOY J;  3FHZ A;  1OJL A;  1SAU A;  4XN3 A;  4B4C A;  3SZP A;  4A3B J;  1V3F A;  1IXC A;  1XMK A;  2JN6 A;  3PUF A;  3VEP A;  1G3W A;  5JLW A;  1W0T A;  2MLG A;  1JKR C;  1VZ0 A;  4F52 A;  5F0F A;  4KIS A;  4CYC B;  2NRA C;  2JUG A;  2F6C A;  5DCM B;  4E7J A;  3B6C A;  1GVD A;  3B02 A;  3RKY A;  4I7H A;  3OS2 A;  3S3N A;  2DMN A;  3C3W A;  3TW6 A;  5GAG J;  2QBY B;  2XGD A;  3LAJ A;  2WWY A;  1E3O C;  1H9T A;  4CCL A;  2V26 A;  3ESW B;  3I58 A;  5D8K B;  1PDN C;  4HX8 A;  1H89 C;  2H09 A;  4PZJ A;  4NUB A;  5D5X B;  1TWA J;  4BXX J;  3DPU A;  2VAS A;  1XTA A;  3A4C A;  2P7V B;  1REP C;  1MDM A;  3IL2 A;  2HOS A;  1ZYR F;  1PUF A;  3WTY C;  1IGN A;  3HB9 A;  4Y15 A;  5FB2 A;  4B44 A;  4NQW A;  2JA8 J;  5C3E J;  1GV2 A;  1WPK A;  2HQN A;  1Z91 A;  4BGD A;  5DV5 A;  2LKX A;  4LIV A;  5DM7 F;  1U78 A;  1I1S A;  4MLO A;  1BR2 A;  3IHU A;  3Q0U A;  3VFZ A;  3BLY A;  2PLY A;  5JR3 A;  1STZ A;  4ETS A;  1S8N A;  2JJ7 A;  4W97 A;  4IHT A;  1MW7 A;  2R3S A;  2R93 J;  3J81 K;  4D1Q A;  4M73 A;  3EYI A;  1WZ2 A;  1B6A A;  1SD4 A;  1PYV A;  3G1M A;  4IQ4 A;  2JA6 J;  1YJ9 I;  1ZN2 A;  3QWL A;  2R5Z A;  3ECH A;  2BXY A;  3QYE A;  2V6C A;  3SHF A;  4A0X A;  5K5O A;  3PL8 A;  5FRM A;  2LF7 A;  2MD0 A;  3RTR A;  1WH5 A;  1E2X A;  4AC0 A;  4PJN A;  2A6E F;  1D0X A;  3KEQ A;  5ICF A;  5EDN A;  4IHW A;  1U9N A;  4MO7 A;  1OLT A;  4BJ6 C;  5TJJ A;  5FGM A;  2NVT J;  3M07 A;  4O3M A;  2HU9 A;  1G3T A;  4BH9 A;  1FBQ A;  2K86 A;  3CCL I;  1D0Y A;  4R1H A;  2MBF A;  4A6E A;  1ON1 A;  3U2R A;  2YSR A;  2GIZ A;  3FXM A;  4DBR A;  2CQX A;  3LST A;  1JI8 A;  2K3F A;  1D1A A;  3AG4 H;  4BJT A;  2CW8 A;  2HNH A;  1X19 A;  5LRS A;  1MNM C;  2CV0 A;  4BEH B;  3OS0 A;  1VQ6 I;  2NOG A;  1ZHF A;  2K5C A;  3CZ6 A;  4Z2Y A;  4B47 A;  4CH7 A;  3PQK A;  3S3M A;  3VYT B;  1LDD A;  3OYN A;  4RM3 A;  2VJ4 A;  2MH9 A;  1GVJ A;  1ZAR A;  3OYJ A;  3OYH A;  3K4M A;  4U7B A;  1NTC A;  1YYV A;  2L5Q A;  1ZG3 A;  5FKM A;  5LGT A;  4G12 A;  4YFK F;  1JGS A;  5L3D A;  3FHN A;  1WJC A;  1HLV A;  2XAU A;  1FSH A;  5IT3 A;  1I1G A;  3LQQ A;  3WTS C;  1E3H A;  1IF1 A;  1WJF A;  3QYB A;  2LOO A;  1X2N A;  2HDW A;  2OPT A;  3R61 A;  3H3V K;  1MMN A;  1R4N B;  1IO2 A;  2F5E A;  4PSW A;  3I53 A;  3LA7 A;  1XX5 A;  5C44 J;  2EJR A;  4KDP A;  1R4M B;  2K85 A;  1R5G A;  1WWX A;  3L9F A;  1QGP A;  3ML6 A;  2WAQ N;  1IDY A;  2QUF A;  4HX7 A;  1YJW I;  5D8L B;  1HW2 A;  2LMD A;  3ZMD A;  2OTJ I;  1VQ9 I;  2VBW A;  3PNV A;  3FXO A;  3ZP5 A;  3SZG A;  3HHH A;  3JW4 A;  1QRY A;  4BY7 J;  4BQQ A;  2PFB A;  3OL3 A;  2XB0 X;  3GEZ A;  1WJA A;  2MH2 A;  2NS0 A;  3MQ0 A;  1SMY F;  1UHW A;  3WHB A;  1BOA A;  4DOZ A;  4MNU A;  5LEJ A;  4EV0 A;  5FLV A;  2BHZ A;  4IRH A;  4M74 A;  4C2U A;  2L9R A;  4JK1 X;  2K27 A;  4PGH A;  3A01 B;  3CCM I;  4U0Y A;  2FBH A;  3T5X A;  2OCC H;  4M6V A;  1FJL A;  4P9U A;  2B7E A;  4J00 A;  3M1C A;  2KRC A;  4AIH A;  2WB1 N;  3ZQH A;  2TCT A;  1HSJ A;  3LSI A;  2AQF A;  4BJ5 C;  4HRI A;  4XLN F;  2DAO A;  2FBK A;  1WH7 A;  3S16 J;  3K10 A;  1S6L A;  5LHH A;  1F36 A;  1E17 A;  1X1B A;  2DQL A;  3NWS A;  1NG6 A;  2Y30 A;  3NQO A;  1KQ8 A;  4IEJ A;  2F2E A;  4UVA A;  5D5V B;  2CV1 A;  3P9C A;  5DD4 A;  2LY2 A;  2W48 A;  2BW3 A;  4L5J A;  4LIU A;  2F5C A;  3H9Q A;  5EGO B;  3DKX A;  1U0J A;  2P5L C;  1HOM A;  3HC7 A;  4IOC F;  5LLQ A;  2M4K A;  5EG0 A;  1X2M A;  1QU3 A;  5J1R A;  4EQQ A;  1G2H A;  1KQ9 A;  3E6D A;  4MTE A;  4A3J J;  4AIJ A;  1QO0 D;  2KIM A;  5ILV A;  4IKF A;  2EFO A;  2CWE A;  2PX9 A;  2DT7 B;  1D3Y A;  2PN6 A;  5BOX A;  4HNU A;  3CTA A;  3K0L A;  2KIS A;  2W24 A;  5HOO A;  2LRE A;  4ZH4 F;  1AWC A;  4B09 A;  4FT8 A;  4A3D J;  2QYO A;  3WTW C;  2WAQ A;  4HEA 2;  3WG9 A; 
#chains in the Genus database with same CATH homology
 5FJ8 J;  4C2M J;  4Y52 J;  1B8I A;  3HOZ J;  1W0U A;  1ORK A;  5E3O A;  2ELK A;  2FD5 A;  5J3L A;  2EZH A;  1IDZ A;  1UMQ A;  1K83 J;  3UKG A;  4I76 A;  3GTP J;  1MH4 A;  3LSG A;  4BKX A;  3S15 J;  5JLX A;  3VPR A;  3GTM J;  2N8G A;  5IYD J;  3QPS A;  4MFD A;  1WGX A;  1FEX A;  3HGY A;  5M3M J;  2DA5 A;  2TRT A;  1JT0 A;  2KT0 A;  1APL C;  3D1N I;  3PO3 J;  2DTZ A;  5GPA A;  2WV1 A;  2X9D A;  4A3K J;  1P7J A;  5DS9 A;  2HQ5 A;  3W6V A;  3CMY A;  2O9L A;  1JTX A;  4M3F A;  5IOZ A;  3DEW A;  1Z77 A;  5M5Y J;  1HDP A;  1YRN A;  3JRC A;  3TW7 A;  3LSR A;  3PO2 J;  4FCY A;  3BR0 A;  3BTC A;  1AHD P;  3HEF A;  2R92 J;  1HCR A;  5EYR A;  1QVU A;  5IYC J;  4IHV A;  1GT0 C;  5F0C A;  2EZL A;  2CRG A;  3BG3 A;  2EZK A;  1TWG J;  3RQI A;  3OSF A;  1FIP A;  3MVP A;  1I3Q J;  3O8G A;  1RKW A;  2D5V A;  3OSG A;  4M3D A;  1ETV A;  1MBF A;  3MKL A;  4JX4 A;  3S1Q J;  3IH2 A;  2MGQ A;  3GTO J;  1IJW C;  5C4X J;  5M5X J;  1XG1 A;  5F0H A;  5F1J A;  1VI0 A;  5IP7 J;  1AKH B;  2LFB A;  2JA5 J;  2PMZ N;  3WHC A;  4QTR A;  5M3F J;  1JUP A;  2M9H A;  3S1M J;  2FX0 A;  1VND A;  4FE4 A;  4XIC A;  1A6I A;  5EG0 B;  1CQT A;  2OF7 A;  3SJM A;  1QVT A;  1TC3 C;  3HGG A;  1RPW A;  4M3B A;  3ZOB A;  3HDD A;  2NVX J;  1JT6 A;  2E19 A;  1VFC A;  3PM1 A;  2M2E A;  3H0G J;  2DMT A;  2CU7 A;  4JX6 A;  4MIM A;  2O8K A;  1Z0X A;  4A69 C;  2L7M P;  3JRH A;  3BG5 A;  3BTJ A;  3ZQI A;  2LK2 A;  1B8I B;  4B3A A;  2R7Z J;  2FQ4 A;  3FK6 A;  2QCO A;  5EF6 A;  1WCM J;  2VI6 A;  3BTI A;  5GP9 A;  5DTD A;  1JKO C;  3ZQC A;  1RET A;  5HOD A;  1OCP A;  4D7N A;  2HI3 A;  3SDG A;  1ETX A;  2VPR A;  5IYB J;  3BTL A;  2K40 A;  1GDT A;  3GTK J;  2B63 J;  1MBK A;  4Y7N J;  1T33 A;  3A03 A;  2IBD A;  1RR7 A;  3HM5 A;  1ZK8 A;  1JKP C;  2H8R A;  1GUU A;  4M3G A;  3CDL A;  1JUS A;  4DW6 A;  1ZTR A;  3OIO A;  3JRE A;  2DA6 A;  3ZQG A;  2LLK A;  2ME6 A;  5GPC A;  1Q1V A;  4FIS A;  2P81 A;  5FKL A;  3JRF A;  1A5J A;  4W1U A;  2JA7 J;  4M3E A;  3LOC A;  2RAE A;  1ZGW A;  1FTZ A;  2K9Q A;  1AU7 A;  2LTP A;  3BR6 A;  4XRM A;  2DA1 A;  2JK3 A;  1BJZ A;  1BA5 A;  2HOT A;  2X48 A;  2E2I J;  2Y31 A;  4MFE A;  1FIA A;  1YRN B;  1MSF C;  2L0K A;  1O4X A;  4A3E J;  2JMW A;  5EZH A;  1T56 A;  1UHS A;  2VUM J;  1DU6 A;  3OOU A;  3ZQF A;  3NAR A;  4L5E A;  1MBJ A;  4A3F J;  2M34 A;  5EZG A;  1B72 A;  3GBG A;  4A3G J;  4V2G A;  2EQR A;  4DYR A;  3NAU A;  4C3J J;  4D7M A;  2FJ1 A;  4IHY A;  2R5Y B;  1XS9 A;  2L7F P;  2ECB A;  2NVY J;  2XGE A;  4DZP A;  2AO9 A;  3BQZ A;  3Q0W A;  1MSE C;  1MH3 A;  3BR3 A;  2YUS A;  2K9S A;  5E3L A;  2DN0 A;  4J19 A;  2MW8 A;  3CCY A;  4JX5 A;  5K7Z A;  1I6H J;  1IRZ A;  1P7I A;  4UUT A;  5E3M A;  5IOY A;  2M0C A;  9ANT A;  3LSJ A;  4EEF G;  3GTG J;  1JGG A;  2XPW A;  3BR1 A;  2HOA A;  3S14 J;  4A3C J;  2CQQ A;  2R5Y A;  5F27 A;  1ZR4 A;  2I10 A;  3HBL A;  2DMU A;  1WI3 A;  3HOY J;  1OJL A;  4B4C A;  4A3B J;  2E2J J;  1NK3 P;  2JN6 A;  3HKZ N;  2ME0 A;  1K61 A;  1ITY A;  5JLW A;  1U8B A;  1W0T A;  1JKR C;  4JYK A;  4A3M J;  5F0F A;  1BL0 A;  1HDD C;  1IV6 A;  3QPL A;  4CYC B;  1MBE A;  3K7A J;  1GVD A;  3B6C A;  2NS7 A;  1JTY A;  2DMN A;  3CQZ J;  1PUF B;  3S2D J;  3TW6 A;  1X58 A;  2XGD A;  1E3O C;  4BBS J;  3TP0 A;  1IUF A;  1MBG A;  2IEK A;  2XPV A;  3GTL J;  2COB A;  3LSP A;  3HOV J;  1H89 C;  2JWT A;  4XRS A;  2LY9 A;  2M8G X;  1XC5 A;  1NK2 P;  1VF9 A;  2L7Z A;  3B6A A;  3FKI J;  1TWA J;  4BXX J;  5FKN A;  2HDD A;  4CYC A;  1ETO A;  3FIW A;  4DYC A;  2HOS A;  4A3I J;  1PUF A;  1IGN A;  3HB9 A;  2YU9 J;  3K2A A;  1SAN A;  4JP0 A;  1JUM A;  2JA8 J;  5C3E J;  1GV2 A;  1WPK A;  3DCF A;  2LKX A;  2LP0 A;  4A3L J;  3A01 A;  1U78 A;  2DMP A;  5F08 A;  4MLO A;  4B1R A;  3Q0U A;  2XGC A;  4XK4 A;  3FIS A;  3S1N J;  1MBH A;  1H88 C;  1U9O A;  2JJ7 A;  2LVS A;  4W97 A;  2X6O A;  2R93 J;  5EEA A;  5J1U A;  2CJJ A;  2ID3 A;  1FTT A;  4NDL A;  5BNG A;  1SFO J;  3GTQ J;  4HNV A;  2AHQ A;  3G1M A;  1BW5 A;  2XSD C;  2ID6 A;  1GV5 A;  2JA6 J;  1ETW A;  2NVQ J;  3JRI A;  4QSH A;  4XID A;  4DZJ A;  2R5Z A;  4AUX A;  5FKK A;  2CUE A;  4QIW N;  3QQA A;  1WH5 A;  4AC0 A;  1Y1V J;  5EDN A;  4IHW A;  1B72 B;  2NS8 A;  2DJN A;  1U9N A;  2DMQ A;  4MO7 A;  5IPA A;  1F43 A;  2NVT J;  5EGO A;  2Y2Z A;  3BQY A;  3F0C A;  2LD5 A;  1LFB A;  5K7H A;  5K7F A;  1ZQ3 P;  1S7E A;  2HYJ A;  3G1L A;  5FLM J;  5M5W J;  1POG A;  2CQX A;  1H8A C;  3IH4 A;  1TWC J;  3A02 A;  2DA2 A;  3BT9 A;  3BR2 A;  1MNM C;  3I4M J;  2NOG A;  3S2H J;  2GM4 A;  5J1Y A;  2E1O A;  4D5F A;  2O7O A;  2Y9Z A;  1NTC A;  2E2H J;  1RES A;  5FKM A;  4G12 A;  2VKE A;  4FE7 A;  3JRG A;  3JRB A;  3G1O A;  1ZKG A;  2CUF A;  1HLV A;  2MSY A;  1EF4 A;  4RBO A;  4GFB A;  3HOU J;  4I6Z A;  4DYQ A;  1UG2 A;  2HXI A;  1ETK A;  3BG9 A;  1X2N A;  2OPT A;  2H1K A;  2G0E A;  3HOX J;  3H3V K;  3L1P A;  4V2F A;  3C2B A;  4D5C A;  5C44 J;  5IP9 J;  1IG7 A;  3IV5 A;  3MN2 A;  2Y9Y A;  4BBR J;  3ZQL A;  4BY1 J;  4A93 J;  2WAQ N;  2LR8 A;  1IDY A;  2DA4 A;  1LE8 B;  2K9N A;  3RZO J;  5F04 A;  3I4N J;  1JJ6 C;  3O8H A;  1LFU P;  2R0Q C;  2QF7 A;  1OCT C;  1Y1W J;  2IAI A;  3BR5 A;  4XRS G;  2DA7 A;  1D5Y A;  4S0H B;  3E7L A;  4FTH A;  1QRY A;  4BY7 J;  1JKQ C;  1HF0 A;  4LOC A;  4X6A J;  2XB0 X;  2ECC A;  1DU0 A;  2XB5 A;  3WHB A;  2EZI A;  3JRD A;  1LE8 A;  3SFI A;  4C3I J;  5FLV A;  3HOW J;  2KDZ A;  4IHX A;  1IC8 A;  1RKT A;  2L9R A;  3IH3 A;  3TP3 A;  3A01 B;  2YS9 A;  5FKO A;  5E3N A;  1QPI A;  3GTJ J;  4ABZ A;  4UUS B;  1BW6 A;  4M6V A;  1FJL A;  2XRL A;  2EBI A;  1ETQ A;  2WB1 N;  3ZQH A;  2TCT A;  4RDU A;  5IP6 A;  1WH7 A;  3S16 J;  4X1E A;  2Y0S N;  1F36 A;  2DA3 A;  3S1R J;  3Q0V A;  2Y30 A;  1OFC X;  1I50 J;  2R5Z B;  4IEJ A;  1AKH A;  3RZD J;  3FK7 A;  2MG4 A;  2HXO A;  2W48 A;  3TED A;  2GLO A;  5EGO B;  3M4O J;  4UUS A;  2XPU A;  3S17 J;  1HOM A;  1ETY A;  2GBY A;  3Q3S A;  3JR9 A;  1ENH A;  5EG0 A;  1X2M A;  3M3Y J;  5J1R A;  1G2H A;  4A3J J;  1TWF J;  3LNQ A;  3RKQ A;  3JRA A;  2ZB9 A;  1ZR2 A;  5C4J J;  4C3H J;  4A3D J;  1R9T J;  4AYB N;  2VKV A;  1TWH J;  1JJ8 C;  2EH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...