5C3EJ

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5c3eJ00
5C44J 1JUSA 3ZQCA 3HEFA 2P81A 2AHQA 4JX4A 5F04A 5IOYA 3DEWA 4UUSB 2R5YA 2HOSA 5IP9J 2JA6J 4A3BJ 3TP3A 4BY1J 2M8GX 3BG3A 3CQZJ 2O7OA 1ZGWA 1QVTA 2MW8A 5F27A 4XICA 5FLVA 2EZLA 5FKOA 1HCRA 4G12A 1X2NA 2LP0A 3HKZN 2COBA 4D7MA 2MSYA 1FEXA 4MFDA 5M3MJ 1U8BA 2ECBA 4IEJA 1BA5A 2DA5A 3LSRA 2HOTA 4FE4A 1E3OC 3FISA 1W0UA 5FKNA 2XB0X 4XIDA 2D5VA 1T33A 5IP6A 3WHBA 5J1UA 4L5EA 2E2HJ 1PUFA 4CYCB 2Y9ZA 1TC3C 2HQ5A 1HDDC 3HOWJ 3S15J 3GTLJ 2DA3A 5DTDA 2K40A 1FJLA 1XG1A 2VKEA 2NS7A 1JKQC 1MNMC 3HGYA 1LE8A 3S2HJ 3BG5A 3ZQLA 1QPIA 3PM1A 2QF7A 1JKOC 2EZIA 1MBJA 3H0GJ 3IH3A 1S7EA 1VI0A 2EH3A 3S2DJ 5EG0A 2VI6A 2HI3A 2N8GA 1H88C 5F0HA 1A5JA 4BBRJ 1EF4A 4M3GA 2JK3A 2JN6A 1ETYA 3BTJA 3GTJJ 1A6IA 5GPAA 1JUPA 5EYRA 1ETXA 3A02A 3HOVJ 4IHYA 2YUSA 2L9RA 1I3QJ 4IHXA 3BTIA 1OCTC 5FKLA 4C3IJ 3OSGA 3LSJA 1SFOJ 2M0CA 5IYDJ 4V2GA 3TEDA 3BQZA 2DTZA 4BY7J 1JTXA 1R9TJ 3BR5A 3FK6A 4I76A 2LY9A 1ZK8A 2ID6A 1UHSA 5K7ZA 3GTKJ 1AKHB 5EGOB 2KDZA 3UKGA 1AHDP 4IHWA 1GV2A 4XRSG 3JRBA 2H1KA 3HB9A 1GDTA 1X58A 3TP0A 3HOUJ 1F43A 1Z0XA 5IYBJ 4FE7A 4A3CJ 4FISA 4X6AJ 5C4JJ 3K7AJ 1BL0A 1IG7A 1B72B 2CUFA 4FTHA 1B8IB 2R5ZA 2JA7J 2X48A 5E3NA 2M2EA 1QRYA 4MO7A 2FX0A 2L0KA 2OPTA 3OSFA 2FQ4A 2O8KA 1BJZA 5F0FA 1WCMJ 2XGDA 5EEAA 2G0EA 3Q0WA 2DMTA 2CU7A 1NK3P 5EZHA 1I50J 5IYCJ 5M5WJ 5JLWA 2DMUA 3H3VK 3C2BA 4D7NA 4C3JJ 5DS9A 3S17J 1AU7A 1TWCJ 3S1RJ 4XK4A 2QCOA 5M3FJ 2K9NA 4V2FA 2R5YB 1JJ8C 4MFEA 4B1RA 5EDNA 3A01B 4DYQA 3S1MJ 2DN0A 3CDLA 3O8HA 5BNGA 2GLOA 4W97A 4A69C 4DYCA 3HOYJ 4M6VA 5F08A 4UUSA 1HLVA 5C4XJ 4A3IJ 5FKKA 2JJ7A 4A3LJ 4XRSA 2CUEA 3RKQA 3F0CA 3HDDA 3JREA 1U78A 5J3LA 2EQRA 3K2AA 1JT0A 2KT0A 1Q1VA 2JA5J 2R0QC 2MG4A 3RZOJ 1Y1VJ 3BR3A 2NVYJ 4XRMA 2ECCA 4IHVA 5K7HA 1K83J 1PUFB 3GTQJ 2YU9J 1ETVA 2R92J 1YRNA 2ZB9A 2Y30A 3WHCA 2PMZN 3BR1A 3D1NI 2XPUA 2DMPA 5F0CA 3JRGA 3IH2A 1IV6A 1LE8B 3Q3SA 4CYCA 5EF6A 2CQQA 1DU0A 4C3HJ 2K9SA 1WH5A 3VPRA 3I4NJ 3RQIA 5HODA 3A03A 5EG0B 3DCFA 1XC5A 2HXIA 1MBKA 3FIWA 2IEKA 1ETKA 3G1MA 1WH7A 2ID3A 1W0TA 4DZJA 2LKXA 2VUMJ 4M3BA 1UMQA 4BKXA 4A3JJ 2R93J 1BW6A 4DZPA 1XS9A 2M34A 2E2JJ 4RDUA 4B3AA 1RETA 4M3FA 3CMYA 1U9OA 4LOCA 3LNQA 2JWTA 1ZR4A 3OIOA 1WI3A 4GFBA 1RESA 2NVXJ 2I10A 2CJJA 2XPWA 3MKLA 1NK2P 1BW5A 4MIMA 2RAEA 2AO9A 4I6ZA 1FIAA 1POGA 2HOAA 1MH4A 3BR2A 3HBLA 1JKRC 2B63J 1GT0C 4A3MJ 1NTCA 2E1OA 2L7ZA 2Y0SN 5IP7J 1ETOA 3BG9A 1IRZA 5IPAA 1G2HA 1MBHA 4AUXA 2DA6A 1HDPA 5FJ8J 2DA4A 2XGCA 3SJMA 5EGOA 3IH4A 3JRIA 2R5ZB 4A3GJ 2Y9YA 3LOCA 1FTZA 2LR8A 3MVPA 1JT6A 1O4XA 1TWFJ 1IC8A 2DA7A 2LK2A 2X6OA 3G1LA 4X1EA 1P7JA 1TWGJ 3HOXJ 1MBGA 3ZOBA 1U9NA 2CQXA 3PO3J 1B72A 1ETQA 1JUMA 1RKTA 4D5FA 3L1PA 4B4CA 3GTOJ 1Z77A 4QTRA 1TWAJ 1IUFA 1FTTA 3RZDJ 2JA8J 4QSHA 4J19A 3QQAA 4AYBN 2L7MP 2E2IJ 2H8RA 3SFIA 2EZHA 3GTPJ 1LFBA 1MH3A 2XPVA 2Y2ZA 2XSDC 1OCPA 1ZR2A 2W48A 2YS9A 2XB5A 4D5CA 3CCYA 1ZTRA 3IV5A 5E3LA 2O9LA 2ME6A 3BR6A 1ZQ3P 3B6CA 2XGEA 3FKIJ 2ELKA 1IDZA 4ABZA 2DMQA 3A01A 3G1OA 3S14J 2OF7A 4EEFG 3GTMJ 4RBOA 1GV5A 3Q0VA 3BTCA 4A93J 1JTYA 2DA2A 3SDGA 5FLMJ 3JRDA 1ITYA 4BBSJ 3ZQGA 2WB1N 2WAQN 2FJ1A 1RR7A 3S16J 3LSPA 4HNVA 1APLC 4Y52J 1I6HJ 1YRNB 3M4OJ 1H89C 2VKVA 1OFCX 5M5XJ 2HXOA 1RKWA 2CRGA 1CQTA 1MBFA 2XRLA 5K7FA 3NAUA 5GP9A 3PO2J 3NARA 5FKMA 4JP0A 3HM5A 3GBGA 1Y1WJ 3B6AA 3BTLA 1F36A 1JGGA 1VFCA 1P7IA 3Q0UA 5E3MA 2X9DA 3W6VA 3O8GA 3HGGA 3TW7A 2HYJA 1ORKA 2L7FP 3ZQIA 5C3EJ 4BXXJ 3BT9A 1VF9A 1IGNA 5M5YJ 3TW6A 2HDDA 2WV1A 3LSGA 1QVUA 2ME0A 3S1NJ 2GBYA 2K9QA 2LVSA 4JX5A 1UG2A 4MLOA 2JMWA 2TRTA 4C2MJ 1IDYA 1T56A 1MBEA 2MGQA 2Y31A 4M3EA 4JYKA 2EZKA 5GPCA 2IAIA 1H8AC 4JX6A 1ENHA 2LD5A 3OOUA 1OJLA 4DYRA 5JLXA 3I4MJ 3S1QJ 4M3DA 1HF0A 1MSEC 1TWHJ 4NDLA 2LTPA 2LLKA 3BQYA 3ZQHA 4FCYA 5J1RA 4DW6A 4AC0A 1JJ6C 2DA1A 1MSFC 9ANTA 3JRCA 2GM4A 5IOZA 5E3OA 1JKPC 2NVQJ 1GVDA 3ZQFA 2EBIA 1D5YA 4QIWN 1AKHA 4UUTA 2NS8A 2R7ZJ 3GTGJ 5F1JA 1FIPA 3HOZJ 1RPWA 1IJWC 5EZGA 1DU6A 2TCTA 4A3FJ 3JRAA 4S0HB 2NOGA 1LFUP 1GUUA 4A3EJ 1B8IA 2E19A 2LFBA 3QPLA 1ZKGA 3MN2A 3M3YJ 1VNDA 1HOMA 1WGXA 2FD5A 3JRFA 1X2MA 4Y7NJ 3JRHA 1ETWA 3QPSA 5J1YA 1K61A 4A3KJ 3E7LA 2IBDA 1SANA 2NVTJ 2M9HA 2DMNA 4W1UA 3JR9A 4A3DJ 3FK7A 2VPRA 1WPKA 2DJNA 3BR0A
chains in the Genus database with same CATH superfamily
1BBYA 4NQWB 3ZQCA 4KMUX 3HEFA 2AHQA 4JX4A 2OJED 1FBQA 3ZMTA 5FFZA 3KEQA 2EV5A 5FLXZ 1S7OA 3FXQA 1WJDA 4JBAA 2JA6J 1V5FA 1L0OC 3ABKH 4M72A 4BQQA 2IA0A 4BAYA 4HNTA 3DEUA 3M8JA 1HC8A 5AIPA 4XICA 1BC8C 3IKVA 5FKOA 3NQOA 2MH2A 1DGRM 4CCNA 3I4PA 3MZ8A 2VC0A 3VOEA 1S29A 3FXKA 4D7MA 4AVZA 5L3EA 1QZYA 4BS9A 4YRVA 1Z3XA 5TGTA 2DA5A 3LSRA 1IXCA 1E3OC 5HLIA 5D5XB 3IP4B 5FKNA 4BE1A 2R7SA 4D9JA 3VEPA 3DP7A 1T33A 2V4JC 5IP6A 5J1UA 1BIBA 1UZCA 2E2HJ 3CJTB 1O7LA 5L3FA 4U0VA 4CYCB 1OLTA 5HOOA 2DOAA 1P4WA 4XKCA 5GTIC 4PCQA 3KLOA 4CA0A 3GZNB 2VQCA 5JVGF 3ABTA 1LE8A 2FXAA 4RGSA 1Z1DA 2KIMA 4GXOA 3ZQLA 2QF7A 2EZIA 1FSEA 1S7EA 1R58A 3FXRA 2EK5A 2YSRA 3QAHA 1FPQA 5F0HA 3FKJA 3GF2A 2F48A 3D5SC 2JK3A 2JN6A 4C2TA 3BTJA 1TNTA 4LIUA 4ZYGA 1D5VA 1JUPA 1ETXA 1TT0A 4EJWA 1EKEA 2GIZA 2LY2A 1KQ0A 2V1UA 1QHGA 2PN6A 2YUSA 2DT5A 4IHXA 3BTIA 2D1HA 1OCTC 5FKLA 1TBXA 1WJEA 2VIXA 2L01A 4C3IJ 4G7OF 1GLNA 3OSGA 1XCVA 1SFOJ 4YELA 5IYDJ 4XN3A 1XPXA 1PJRA 1K6OA 3OY9A 1IRXA 4EV0A 3FBIB 4XNFA 3WTZA 1P4XA 2TDXA 4XOPA 1FWZA 3LSIA 1R9TJ 3QOEA 4I7HA 4P5OA 2Z16A 4ZH4F 2Q8KA 3JTGA 2NS0A 1EH8A 2ID6A 5LBQA 3CC7I 4PUSA 2P5KA 1YJWI 1VZ0A 5EGOB 5CQGA 3UKGA 2DXIA 3E3VA 1GV2A 4XRSG 3HOSA 1Y56A 3HB9A 2EPFA 1X58A 3ML6A 3TP0A 2KRFA 3CD6I 3HOUJ 3DFGA 1Z0XA 4EM1A 4BUPA 2ZJ2A 4FISA 4KUMA 1BL0A 1GHCA 2VE8A 1F1ZA 4FTHA 4U0WA 1B8IB 2XGXA 2KRCA 2PLYA 2A07F 5E3NA 2KL4A 1WHUA 1USTA 3CLQA 4OIOF 3L09A 3OYDA 2EFWA 1W5TA 2L0KA 1QO0D 2OPTA 2ZMEA 2FQ4A 1BR2A 1MMDA 3N97A 4Y15A 2KFDA 4RGRA 5F0FA 2O8KA 1WCMJ 4KITB 2E1MC 1JHHA 3GMEA 3Q0WA 4GDFA 2DMTA 1T8IA 2O6GE 2HDCA 2VXDA 3X2QH 1I50J 5IYCJ 1HA8A 5M5WJ 1LDDA 2LMDA 2V1NA 1RR8C 3CCVI 3H3VK 2E36A 2XKOA 4C3JJ 3SZTA 5DS9A 2PJPA 2ZFWA 4XK4A 2PJRB 2H6CA 4E7JA 3RTRA 3MKZA 3CJNA 2JZYA 1R4MB 3PFYA 1HSJA 2P4WA 1N78A 4CH7A 3D5RC 5LEJA 2XDVA 4OINF 4KFCA 2MA3A 5H20A 4UUSA 2M87A 2CWEA 5C4XJ 4A3IJ 4GRIA 2C6YA 1XDUA 2R7FA 3RKQA 3F0CA 3JREA 3K2AA 2BGCA 5ICFA 1JT0A 2O0YA 3FF5A 2VBZA 4JQFA 2ZO4A 1OYYA 5DM6F 4E70A 1ULYA 3TO9A 4BEHA 3OR2C 1E0EA 1XTAA 1TQMA 3FMQA 4G9YA 4A0XA 3TMOA 4JOMA 1QPMA 4LG3A 3F23A 1D8KA 3F8FA 1BIAA 3WG7H 5K5RA 2CV0A 2P7CB 1JI8A 2PMZN 1YITI 2UWMA 1MMGA 2KISA 2XPUA 1QNTA 3BG7A 2BY3A 4ZJZA 3IH2A 3U9GA 1IV6A 1CF7A 2L9SA 3AL0C 1IUYA 1LE8B 4XONA 1OQYA 4JK1X 4CCMA 1IZ1A 1FYMA 5ILSA 5BS6A 3VPRA 1EJ9A 3I56I 1Z91A 3ZP5A 1F4KA 3MFKA 3MAJA 5DM7F 3FM3A 1W0TA 4DZJA 4BU2A 2LKXA 2VUMJ 1UMQA 3HHGA 1XSVA 1BW6A 1FBUA 3S2WA 2R7WA 1XS9A 1MW7A 2M34A 4ETSA 4WK8F 3MQ0A 4HW0A 3VB2A 4RDUA 4B3AA 2QSHX 1RETA 4M74A 1YIJI 3CMYA 4LOCA 4MEYF 3GVAA 3LNQA 2JWTA 1ZR4A 2UXXA 3OIOA 3AKZA 3TGNA 4KICA 4ANJA 3QOPA 1RESA 1SFXA 2PMHA 3SDBA 3M1CA 1FMWA 3DTIA 1OCCH 2F5DA 2FNPA 1NK2P 1BW5A 2AO9A 3CDIA 3TDUC 2HOAA 3DPTA 1MH4A 3FWEA 2QYOA 5FD5A 1D1AA 2Y0SN 3OYJA 1UHWA 5IPAA 3RPUA 4CZCA 1MBHA 3LWFA 3WE3A 2E71A 2LNBA 2IXSA 3T8TA 4F52A 3HL2A 3BOQA 3IRQA 2WA0A 1Y39A 4IRIA 4UY8I 2X6WA 1XCBA 1FP1D 1Q1HA 3V7RA 3JRIA 3HSEA 5IT9K 1ZGJA 3IC7A 5CKTA 4A3GJ 1JT6A 3K4CA 1O4XA 1TWFJ 5ICGA 2DA7A 2WB1A 2OZUA 2X6OA 3I3LA 3COAC 2WAQA 1ZELA 1G8XA 1KU3A 3G1LA 2ZMEB 2DDAA 3GCMA 3TBIA 3HOXJ 1U9NA 2CQXA 3VYTB 2VPLA 3CP8A 1B72A 1JUMA 3PUBA 5JHFA 3IWFA 5BPIA 4AVPA 1TP4A 1QGPA 3JCUC 2VN2A 1RKTA 3F8CA 4P1WA 1R36A 5JR3A 5ILUA 4C2UA 4IL6C 2DPDA 5HLGA 1FT9A 1O57A 1R4NB 3HSRA 4TV7A 5HLTA 2A6TA 1PP8F 3RZDJ 5E79C 4LLLA 1NH3A 2HPMA 4QSHA 2XVCA 1XMAA 4CZZA 2X6XA 1R5HA 1S7AA 2XPVA 3KFWX 1X3ZB 2KDOA 1OCPA 4WXHA 2MD5A 4E7KA 2VOOA 3BWGA 2FRHA 2ZJRF 3CCYA 4UVBA 3CO6C 1ZTRA 3IV5A 2KJCA 1Z67A 4X0GA 2XAFA 1LFPA 3KP7A 3FXLA 3KEYA 4DBRA 3JSPA 3KP3A 1XN7A 2WADA 4NC8A 5HDGA 4IZZA 2DBBA 1LDKB 5HS8A 4L9JA 2ELKA 3A01A 2DMQA 3S14J 4PJ0C 4LD5A 1DDNA 4LG0A 4QLCU 3GTMJ 3Q0VA 1Z7UA 4C9YA 3BTCA 1B1BA 3F8NA 2DA2A 4OU0A 2H09A 3FM5A 4B43A 5FLMJ 3V8KA 3WTUC 1V3FA 5LHGA 3AG2H 2DT7B 3DBLB 3VDXA 3CJQB 2MBFA 3GFJA 3LL7A 3OYCA 3MEXA 3OS1A 2IS2A 2KRHA 1ERDA 1ONVA 5M5XJ 2WAFA 1WKMA 2CRGA 1MBFA 2FBKA 5EJCA 5GP9A 3SXYA 1CF7B 3L2CA 1PDNC 2F5FA 3HM5A 3CC2I 3E6BA 4M6XA 1BOBA 2RVCA 4I09A 3G2BA 1WI9A 3DXJF 3W6VA 3O8GA 3K70D 3ZQIA 1T0FC 3BT9A 1IGNA 4IX7A 5M5YJ 2UXNA 1XMKA 1TTYA 4I99C 1B9MA 2R7XA 1OKRA 1FOYA 3CCSI 4HF0A 2ME0A 3TO6A 2DFEA 3L2WA 1UG2A 4MLOA 2JMWA 2O61A 2LBFB 4J01A 1IDYA 1P4AA 1SFKA 1X4PA 2VT3A 3T8RA 1PUEE 2Y31A 4S05A 4P55A 5FROA 5GPCA 2RC4A 4DQ2A 2GA2A 2HYGD 3OOUA 1OJLA 4DYRA 3TQNA 5FRMA 4M3DA 1HF0A 4LLNA 2FEZA 4B48A 4DW6A 4AC0A 1JJ6C 2ZJPF 1NG7A 9ANTA 5FLXK 3H92A 5H2FC 4FX0A 2E1CA 1FSHA 4HX4A 1WJ5A 2GWRA 3SZGA 1AKHA 2WY8Q 2NS8A 3GTGJ 4UXNA 3U1DA 4CSWA 4MQ9F 2YX7A 1J7KA 1RPWA 4OAZA 5BQTA 1K7AA 1DUXC 2TCTA 2F6CA 4MNUA 1GUUA 2DI3A 3GWZA 4RLQA 3CCEI 2CMPA 1W7PB 2W85A 4M9ZA 1XSDA 1IXRC 2LFBA 5HS9A 2VKHA 3J80Z 3M3YJ 4C30A 4AIKA 3ZMDA 3ECOA 2Y0MA 4Q4ZF 2MABA 3HTUA 4G6QA 3JRFA 1STZA 1PVEA 3FBNB 5J8CA 1OPCA 5HVQC 4L0ZB 4A3KJ 2BVLA 2IBDA 1SANA 5E1WA 2M9HA 4XLCA 2QZ8A 4W1UA 3GLXA 2VJJA 1A04A 4M9XA 4B3XA 5E1ZB 5KVRA 4AD9A 1HKTA 5F04A 3P5JA 3WTTC 4RAZA 1X1BA 4PJJA 5DCMA 2EFQA 3AG3H 2W4SA 4I0BA 1VQKI 2IS6A 4A3BJ 3RSNA 4CYDA 4BY1J 3BG3A 1WQ2A 3DU5A 2DLLA 1BR1A 3BG6A 2MW8A 4KIFA 3MZHA 5F27A 4LG0B 4PSWA 1TT5B 3U2RA 3G4SI 2BOLA 2NXNB 1W4MA 1X2NA 2A68F 2MC4A 3HKZN 3ZQQA 3PJRA 2L7KA 2MSYA 4E6KG 4PJMA 2M3AA 3WGIA 1U8BA 4E7HA 4A5MA 2HOTA 1MMSA 5CVVA 3FISA 1W0UA 4XIDA 3ZMSA 2HZTA 2VOPA 1VQPI 3M9AA 3PFIA 1PUFA 4XLAA 2EILH 1FC3A 2FA5A 2Y9ZA 1GXQA 3WU0A 1TC3C 2HQ5A 4IQJA 5DTDA 3SQNA 2HVRA 4PJNA 1KU2A 4RM3A 2QKLB 3BCAA 1A31A 3OWTA 1RNLA 2VKEA 5B3SH 2BVMA 5E17F 3M8FA 1MNMC 4ZYHA 4BE0A 2I8DA 1FLIA 4M73A 1YHQI 1OISA 1QU3A 1U5TA 2CS3A 1JKOC 2LF8A 1MMAA 2M8EA 2YR2A 2ZSIB 5AONA 3VWBA 2N8GA 1A5JA 3BY6A 2DOFA 4M3GA 4Q47A 3OYFA 3GTJJ 2FSWA 2F5CA 2PQ8A 5AIQA 4XBFA 3S32A 4P9UA 3RKXA 6PAXA 2W00A 1LUJB 3DKYA 2EIJH 1SVMA 1I39A 2A5YB 3ZGKA 3G6EI 4BHCA 1KU7A 3LMMA 2ESHA 3ABMH 4CHUA 1SFUA 2W25A 3VYSB 1Z21A 4BY7J 4Y4RA 3ZRGA 4I98B 5D4SA 3G71I 3E1SA 3FK6A 2LY9A 4XLFA 3H3UA 2NVUB 1UHSA 2CV1A 2K9MA 1DP3A 1AKHB 5LFAA 3JRBA 2LF7A 3S3OA 2H1KA 2MD0A 1GDTA 3EUHA 1DPUA 1E3HA 4XLEA 3CZ6A 3E6CC 2A6HF 2RQPA 3F22A 2CUFA 2BBYA 2HS5A 2R5ZA 1KZHA 3VFZA 1Z9CA 4BHBA 1V54H 2M0MA 1QRYA 4L0YB 3SHFA 5CYVA 1T95A 3LA2A 3CCUI 1ZARA 2ETHA 2OCCH 1V5GA 2J5PA 1OMIA 4UV9A 2STWA 3PSFA 2CU7A 1G3WA 2YPRA 1NK3P 2IGOA 3E5XA 4YIRX 3M7GA 4U7BA 2LDUA 2QLZA 1TLHB 2GQQA 1G3SA 3FMSA 3VYUB 2X85A 2UZKA 3K2ZA 1FMVA 3T5XA 1SD7A 3K69A 4I0AA 3ZQ7A 5DCMB 2K9NA 1SMTA 1V4RA 4RLFA 2D45A 3BCBA 5EDNA 1HW1A 3LSMA 2FMYA 5F6FA 3UNGC 2KP6A 5BNGA 2GLOA 3KZZA 3EQLF 2DFFA 4W97A 1BN5A 4CICA 2CFXA 5K5QA 3HOYJ 2O03A 3HIFA 2DTRA 3I54A 2GIVA 1WRJA 2QQBA 5EEGA 2VODA 4F3QA 2M4KA 4BQOA 2F5VA 4N0BA 2JJ7A 2Y75A 3R6SA 2YX4A 3T0YA 2XF6A 2VJ5A 4FHTA 3CCQI 2NRAC 2KT0A 4BYYA 1FOWA 3HC7A 4E4HA 2MG4A 3RZOJ 3BJAA 3D5LA 3BZ6A 3WTVC 1WJFA 1IO2A 4XRMA 1UELB 5K7HA 1OR7A 1K83J 4B09A 4B44A 1PUFB 1X1PA 1R6RA 2YU9J 4OAYA 4XKVA 1UJ8A 2CYYA 3OYBA 4BQAA 3WU2C 3QYFA 2ZB9A 4CCOA 4WX9A 4HDVA 1X1CA 2EV6A 2A69F 2EA2A 2BE5F 2L9NA 5TJJA 3GZ6A 1YO5C 4PJLA 4RGXA 3H3ZA 2CQQA 1U5TB 4IHTA 4UV8A 5H6RA 2K9SA 3I4NJ 2Z9OA 5HODA 1MKMA 3K4KA 3ZN0A 3DCFA 2HXIA 3DPUA 1MBKA 2ISYA 3FIWA 3VSKA 4KIBA 2IEKA 1NG6A 4HV6A 1ETKA 1RRJA 3G1MA 1WH7A 2OCEA 5B1AH 3TO7A 3OYKA 4M3BA 3CUQA 1LB2A 2EIKH 4U87A 4A3JJ 4DZPA 3F21A 3HUGA 2E2JJ 3DPLC 3CMAI 2K85A 1B9NA 4M3FA 4EMSA 2QBYA 1YX5A 3QU6A 1WI3A 1BOAA 1USSA 1JHFA 3WTYC 1W5SA 2NVXJ 5LRRA 3OL3A 3MKLA 4MIMA 1XGMA 4B8XA 4MTDA 4RB1A 4I6ZA 1JKRC 3BR2A 2VC1A 3HBLA 2B63J 1GT0C 5E18F 2Z33A 3OOPA 1NTCA 2JPCA 3L7WA 5D4RA 3U21A 3F8MA 1MJAA 3I59B 1IRZA 3HPGA 2JRMA 2BEOA 4HA8A 4ZTJA 1HDPA 3FX3A 2F5EA 1I3AA 3SZPA 5ED4A 2VLAA 1EA3A 2HTSA 1J09A 2HVSA 2FBIA 4CDGA 2IGKA 2R5ZB 2AXLA 2LR8A 3MVPA 4ESFA 4KA4A 3WG9A 4LB6B 3EETA 3HKZA 3A1YA 4X1EA 1TWGJ 2L5QA 1ON1A 3LFKA 3PO3J 3NWSA 2DK8A 5DD8A 5CJ9A 1WJBA 1LVKA 2W82A 1P6RA 4D5FA 3L1PA 3MMYB 3QP5A 3ZCOA 1U6GA 4GCVA 3GTOJ 4QTRA 5JHUA 4AIJA 1S5LC 5FGMA 1S8NA 4G6TB 3QQAA 4V19K 4AYBN 2E2IJ 3SFIA 3GTPJ 5HDKA 3KZYA 1A35A 2W24A 1VQLI 3J7ZI 3EPZA 4YFNF 4BACA 1ZR2A 2YS9A 4BJTA 2R7TA 4L9TA 5E3LA 2O9LA 4I01A 2QGUA 4OOIA 3S3MA 2MLGA 2KJBA 3BR6A 1NHAA 3H9QA 3IWZA 4UB6C 4CUGA 5A2QZ 1ZQ3P 2JQ7A 3D0SA 3LAPA 1IDZA 2XAUA 4IKFA 3MWMA 4RBOA 1J0RA 1ZYRF 4ZZDA 4A93J 4ZYAA 4ENNA 3I55I 5K1YA 2L4MA 4ZC3A 3W2AA 4HAMA 4BBSJ 2FE3A 3CUOA 1RR7A 3WODF 3L2UA 3EYYA 2VXZA 3KLNA 2GXAA 2XASA 1I6HJ 2VKVA 2HGCA 1Y8QB 1RKWA 3MZYA 4ZZLA 5LHIA 3I9V2 3NARA 4IQ4A 2DK5A 2MYSA 3ZR8X 3HJEA 4EJUA 2AQFA 4LB5A 3DLAA 2QQAA 4BDYA 3Q0UA 5E3MA 3LA7A 3HRUA 2OD5A 3QU3A 2KLOA 3K4LA 1O3QA 2M7AA 4Y33A 1HBXG 2CW8A 3I53A 5FRNA 2RNGA 3J80K 3CUQB 2IGNA 2HYFA 3JAMZ 2K9QA 2LVSA 4G8XA 3EUKL 1E3PA 2P0WA 3HUGB 4QWQA 4WXCA 4MHGA 2CW7A 4C2MJ 1LNWA 1MBEA 4DJAA 2VE9A 1V5EA 1SD4A 1H0MA 2EZKA 2PFBA 4HBLA 2F2EA 1W36C 1H8AC 1X1AA 2Y69H 4AWXB 3S1QJ 4NDLA 3AG4H 2AQEA 1UAAA 1RC9A 5J1RA 2DA1A 5LLQA 4HLYA 4EGYA 1SAXA 2HQAA 4WXDA 1JKPC 1GXPA 1GVDA 4EQQA 3JSOA 2EBIA 1D5YA 4PGGA 1D8JA 4D0PA 2L4AA 2R7ZJ 4XL9A 5F1JA 1FIPA 2ZXJA 3HOZJ 4XR6A 1VQMI 1YS7A 1FOXA 3BP8A 2BXYA 3CCJI 3ZXSA 3DF8A 4L9VA 4A3FJ 1Z6RA 5HS7A 3ONQA 5B5EC 2IVMA 2CO5A 4RB3C 3QPLA 4EJVA 5DUIA 5F1RA 1R1VA 1I5ZA 4AIDA 3I0TA 1VNDA 1HOMA 1VQNI 2HFHA 2XUBA 5HNHA 3OV8A 1ZLJA 1YW8A 5CPRB 1QQIA 2OV7A 1X2MA 4ITVA 5E8GA 2ZBKA 4P96A 3OL4A 5DEQA 2ZJQF 1G4DA 4ESJA 3QPSA 5J1YA 3J7YJ 1IF1A 3E7LA 2E7WA 3G3ZA 3S3NA 2XF7A 3M1EA 3RPQA 1IN7A 4LK0F 4ESBA 2VPRA 3PL8A 2NNYA 4QPQA 4XOTA 4P9FA 1ZG1A 2E35A 1JUSA 3PQJA 2P81A 1BI3A 2ZMEC 1T38A 1TQIA 2RKHA 2HDWA 4ZDLA 4UUSB 3HRTA 1X3WB 4GO1A 5D8KB 2R5YA 1RIOH 2HOSA 3TP3A 2K27A 3CQZJ 2O7OA 1OCRH 3P9IA 1IRFA 2QQ8A 4DBQA 2K5CA 2Q2EA 2VJ4A 4EM0B 2EZLA 4Y13A 2KIFA 3C1DA 4G12A 4BEHB 4BE2A 2HPIA 2FF4A 4IRGA 1G59A 3P7NA 1K6YA 1Y0NA 4FX4A 1FEXA 1I6XA 3OYGA 3RJPA 2OZ6A 5M3MJ 5D5VB 2ECBA 4IEJA 5ICEA 3LSHA 2FMLA 2K86A 2QWWA 3MKWB 2BHZA 1VQ8I 2HR3A 1KU9A 2A5WA 3WHBA 2X0LA 4L5EA 4XMYA 5B66C 3TL4X 4ZYEA 2JTVA 2VL8A 1QZZA 2V6EA 2V9KA 1H9GA 2OTJI 3GTLJ 1A6QA 2K40A 1FJLA 1FY7A 2R3SA 3IL2A 1JKQC 4BXUA 3HGYA 3L2QA 3BG5A 3PM1A 3S93A 3OYAA 2KPMA 3C7JA 2EWNA 3H0GJ 3IH3A 4IPAA 1DPRA 2ZNZA 3CJRB 5EG0A 5GTHC 2HI3A 3REOA 4UVAA 4BBRJ 1EF4A 4HG2A 1ETYA 3OR1C 1T6SA 2A3SA 3ZN1A 1A6IA 5GPAA 5DV5A 2WAEA 5B1BH 4IHYA 2HKXA 2IS4A 1I3QJ 1EV7A 3GZ5A 1R49A 4XSXF 2JUCA 3WGGA 5CVUA 2ZC2A 4WWCA 2PI0A 1HQCA 4V2GA 4MTEA 2DTZA 3A0BC 2K3FA 2P8TA 1JTXA 1P2FA 3BR5A 4PZJA 2WBMA 4I76A 1ZK8A 2MH9A 2O5RA 2DDBA 4OIRF 2H8WA 1AHDP 4IHWA 1P9QC 2A05A 1KGSA 1SAUA 1AA7A 3VYRB 3PIOF 2KIQA 2HQNA 1F43A 5IYBJ 4FE7A 2JRTA 4AM3A 2ZKZA 4A3CJ 4X6AJ 1IG7A 1UG0A 1B72B 1SD6A 2X48A 1ZREA 3NEUA 1LJ9A 4HX8A 5GADJ 2M2EA 3L00A 4R1HA 4XLPF 2ELHA 2VQHA 2BW3A 2FUG2 3HPHA 3K1NA 2FX0A 5BPDA 4AIHA 1BJZA 3HXLA 2KMUA 1BI2A 3KYCB 2M4GA 4BJ5C 5EEAA 4Z6YA 3KYDB 1R22A 4DOZA 1K79A 2PMZA 5IT3A 1G3TA 3KX2A 4IHSA 3I64A 4L18B 2HWVA 2OQGA 3GO5A 1RUOA 5JLWA 3FHNA 1Z3YA 4LIVA 2XIGA 4D7NA 1G3YA 1ZLKA 4ZTFA 1HKQA 3DV8A 4KJZA 4A5NA 1AU7A 4Y17A 3S17J 2QCOA 1VQ9I 5M3FJ 2PMUA 2R5YB 1JJ8C 4MFEA 3KP2A 3A01B 4PSXA 4RA2A 4DYQA 4CGZA 2DN0A 3CDLA 4RS8A 4A0YA 2X4HA 5FO5A 4NQWA 2CGPA 1IN4A 2F4MB 4A69C 4DYCA 2XAQA 4M6VA 4U88A 4ENJA 2M1BA 1PP7U 1HLVA 2Y48A 3BZKA 1IN5A 1IV8A 3OIPA 5FKKA 3L2RA 5HNFA 4IOCF 4A3LJ 3BDDA 2CUEA 5D6FA 1I1SA 5J3LA 1XGOA 1EH6A 2FNAA 5ERIA 4FASD 2ZXHA 3J81Z 2X1CA 2IPQX 2DPUA 4YG2F 1TZLA 2WC2A 1SMYF 2IT0A 2VBYA 3LQQA 3K4MA 2Y0SA 2M5WA 4F92B 3LAJA 4ZDOA 2OA4A 3GTQJ 2EFNA 2R7UA 1ETVA 2R92J 1LEAA 3ZMUA 1KQ8A 2Y30A 4II3A 3BR1A 4A2UA 5DUKA 3BJOA 2DMPA 1JE8A 5F0CA 3JRGA 1T39A 3CESA 3FXOA 4E7LA 5GAGJ 4A6EA 1X19A 4CYCA 1SVLA 2O8XA 4C3HJ 5JI6A 2MC3A 3C2GA 1IRGA 1E17A 5EG0B 1XC5A 3QYEA 1T08B 2L02A 4EM2A 2CG4A 4M9SA 4UUVA 4IOAF 2ICWG 2Z2SB 5CLSA 1OCZH 4IRHA 5LRSA 2DODA 1FP2A 2BY2A 4HF2A 2M7BA 1VQ4I 3V8LA 4KT5C 2LH9A 1N25A 3PUFA 1UCRA 3BC8A 3PIPF 3PNTA 3CMEI 4M71A 3J7AY 4NHJA 2V9PA 3IAM2 1S3JA 3EDPA 1X4OA 2OAZA 2VT2A 4IXAA 3DWLE 1XD7A 3P9CA 3CCRI 4YFKF 1WVRA 2VQLA 5BMZA 1KYWA 4GFBA 2M30A 2I10A 4ZDPA 2CJJA 3BLYA 2RAEA 4AU7A 5H6QA 4HX7A 5E8IA 2L7ZA 2CQKA 1LKXA 5IP7J 1ETOA 3BG9A 2LOOA 1VTNC 2QEXI 1G2HA 2DT6A 3F8BA 2DU9A 2FU4A 2DA6A 1Y6IA 2NAZA 1DQUA 5L3BA 2NOJB 5FJ8J 3ECHA 4BH9A 4WF2A 4YIIA 2DA4A 2XGCA 3E5UA 2JSPA 4NNJA 1YJ9I 2E7XA 4G7HF 1G6NA 5EGOA 4U7DA 4NC6A 3HOTA 2CW0F 2VJIA 2Q1ZB 4YIFA 2IA1A 3LOCA 1FTZA 2GXBA 1J75A 4KN7X 4B47A 4F55A 2KQRA 4XLNF 2BW3B 2LK2A 2LG4A 1AWCA 3R60A 5IY5H 2WY7Q 2O3FA 3HRSA 5KAFC 3OS2A 3FZVA 3MD2A 2J5OA 2OBPA 1ETQA 4XLHA 2IRFG 1W5CC 3K0LA 2Z99A 1X3UA 2HKOA 4XN0A 1LPQA 3DTEA 1YFHA 3B73A 3RYPA 2RGVA 4BJ6C 2ZXIA 1R1TA 1TWAJ 2K4BA 2XAGA 3BROA 3N05A 1MJBA 5L3GA 2JA8J 1YYVA 3V42A 3QODA 4J19A 1S72I 2EZHA 1LFBA 2H1LA 5JFRA 1MH3A 2Y2ZA 3FXUA 3RKYA 2XSDC 4ENKA 4HSTA 2EA4A 3OYHA 1B4AA 3CF2A 1KONA 4EJOA 1ODDA 4RB0A 1WWXA 3M07A 1TNSA 2E60A 3L2VA 2OUMA 2PJRA 2IW5A 3JAMK 3K6GA 3CCMI 2IJLA 1FX7A 3KP4A 4ABZA 1FOKA 1WJCA 2KZVA 2V1XA 2DAOA 2OF7A 2NYXA 1GV5A 4F93B 3H35A 1JTYA 1D0YA 4HQMA 3V4GA 3JRDA 2QA4I 5L3DA 2GZWA 2FQ3A 2V6CA 3IHUA 1ITYA 4N4NB 2WB1N 1YX3A 2WAQN 3F72A 1K78A 3S16J 2M45A 1K4SA 4HNVA 1FYKA 4O6JA 1APLC 2D2WA 1B59A 2RN7A 2QKMB 3M8EA 2HXOA 2CQ7A 1CQTA 2XRLA 4IJAA 4XQFA 3R61A 3NAUA 3V7SA 5LGTA 3PO2J 1Y1WJ 3B6AA 2WWYA 5TISC 3NRVA 3QWLA 3TOBA 1P7IA 2X9DA 3ABLH 2HU9A 5F64A 2LYCA 1XGNA 2L7FP 4Q5SF 4BXXJ 3Q9SA 3W3CA 2CQNA 2YU3A 3ELKA 1U2WA 5DCFA 2GOMA 2HDDA 3K4JA 1R23A 3O2PE 4E7SA 1D3YA 2WV1A 3K4NA 1QVUA 4R79A 5D6EA 1IW7F 4G94A 3OYEA 4JX5A 3PNYA 2W7NA 2TRTA 2L9VA 3ZMZA 1T56A 4HNUA 4UB8C 3KETA 2QSGX 2MGQA 4M3EA 1BI0A 5KHDA 2FBHA 4JYKA 1U5TC 2IAIA 2P5VA 3RIRA 4JX6A 2LD5A 2IA2A 2STTA 4BXFA 2HOEA 3RCOA 4BL0B 3I4MJ 1TWHJ 2LTPA 1A36A 2GXGA 4HOBA 1ZAOA 3ZQHA 4FCYA 3KYLA 2K9LA 1WJAA 2H94A 2DOEA 5JVTA 2GA1A 2GM4A 1MIJA 5IOZA 3ZQFA 3K1PA 2PX9A 1YJNI 5KCMA 2HNHA 2V79A 1YW9A 4QIWN 2E1MB 4ON0A 3K10A 5KK1A 1CGPA 2Z5UA 5E1XA 3ISPA 2VONA 3QPHA 4PFPA 3E97A 1R00A 1IJWC 3IKTA 4N9HA 5EZGA 2HEOA 1DU6A 4F91B 3TKYA 3JRAA 1VQOI 2K3PA 2NOGA 1LFUP 1J2XA 2G9WA 4O5VA 3UR3C 3MN2A 3V8JA 3W6JB 3KEOA 4XM3A 1WGXA 3E6DA 3T1BA 2E5ZA 1QHHD 3TDZC 3EUHC 4Y7NJ 2LREA 3JRHA 1ETWA 3W2WA 3HHHA 1K61A 2WTEA 5CVJA 2BY1A 2NVTJ 2X1DA 1Z6TA 3FK7A 3F6OA 1P92A 3CDHA 4KNYA 2DJIA 2G7HA 5C44J 4F7ZA 5E20A 4H4KC 2K7LA 2EFOA 2LSOA 2VB6A 4ASNA 5IOYA 4HF1A 3DEWA 3PSIA 4HLXA 4RAGA 1YS6A 1MDMA 2DYSH 4U0YA 1MMNA 5IP9J 1KYZA 2M8GX 1O3SA 3HG9A 3H5NA 4M6YA 1ZGWA 1QVTA 1Y8RB 1N75A 2BHYA 3KZIC 5J47A 5FLVA 2DFIA 3DTKA 4MEXF 4L5IA 2XV4S 2EB7A 1GVJA 3DBHB 1HCRA 2BYVE 1MZBA 2IGMA 2QVOA 2LC2A 2LP0A 4E7IA 3AL0B 2COBA 1I1GA 5J40A 4MFDA 5D5UB 1K78B 3DKXA 1BA5A 3ERMA 3VODA 4FE4A 4H0EA 4CCLA 2D5VA 2XB0X 2I5UA 2OQRA 1UFMA 1T0FA 4GYGA 2OU2A 5CQEA 3H5RA 1WSUA 4CXFA 2ZCWA 1ACIA 3CMMA 2NNNA 5DDGA 1XMXA 1HDDC 2X1EA 3HOWJ 3R0AA 3S15J 2D1VA 2DA3A 4L9NA 4N4OB 4PK4A 2W57A 3H36A 1DP7P 2EINH 1Z05A 4G7ZF 1XG1A 1HW2A 4BQNA 1QZEA 2NS7A 4Y3OA 3CTAA 1FYLA 2DW4A 1R5GA 3S2HJ 1OR7C 1QPIA 3CC4I 5KAIC 4BDZA 1MBJA 4N9IA 2BZTA 3H5AA 1VI0A 2EH3A 5FD6A 3S2DJ 3A0HC 2VI6A 4RB2C 4II2A 1H88C 3FMRA 2QBYB 2QENA 4NC7A 3BZCA 4EGZA 5EYRA 3A02A 1O3RA 3HOVJ 1RZ4A 1YTYA 2L9RA 3EYIA 3G73A 3JW4A 3KPHA 1B6AA 1EH7A 3LSJA 3OS0A 3GYHX 2LBFA 2V1DA 2M0CA 1U3EM 3OMYA 3GFIA 2IS1A 2V26A 5LEKA 3H9GA 3TEDA 3BQZA 4FQGA 3U1KA 2LKSA 3HTSB 5L3CA 2ISZA 2PG4A 4WCGA 5DYMA 3CUQC 2F4IA 2CUJA 4BHPA 3ZPLA 1D0ZA 3BJ6A 5CVIA 1WZ2A 3GTKJ 5K7ZA 3ASNH 1BC7C 2VKDA 4GGGA 2KDZA 1S9HA 1D1BA 3WTSC 3GFMA 4XORA 2L2OA 2FOWA 2WV0A 4Z2YA 1IN8A 2XHKA 2CSOA 2V7FA 2RNJA 2LKPA 5C4JJ 3K7AJ 1MGTA 4E7ZA 3WGHA 2EIMH 3O3KA 1ZRDA 2JA7J 3J81K 1XSXA 2OTLI 1UB9A 1MD0A 2GOXB 4MO7A 1HSTA 2B7EA 2RREA 5BOXA 1I27A 1SD5A 2XSJC 2ACJA 2XRNA 5LGNA 3OSFA 2VBWA 3IUOA 3ROUA 4XKBA 2XGDA 3I5UA 1R71A 4A12A 1W36D 2JPBA 2G0EA 1W7PA 2X51A 3KIOA 3FDYA 3GW2A 4KT6A 3RI4A 1F5TA 5D5WB 5HDNA 2ZNYA 3OYIA 1V55H 5EZHA 2W1OA 3IRRA 2B9SA 4O3MA 2DMUA 1E2XA 3C2BA 5FFXA 1JGSA 3A4CA 2Z3YA 3CP2A 1BJAA 4LJZF 5ICCA 3DBRB 4YEJA 1TWCJ 3I58A 4KN4X 1TW3A 3RQ4A 2P6SA 3S1RJ 3WTXC 1PYVA 1R5ID 2F4OB 4V2FA 1MDMB 2KZGA 1XX5A 2G7UA 4B1RA 3FXJA 4CCJA 3S1MJ 3OYLA 3MCZA 3O8HA 4Q48A 4NB5A 3K70C 2R7DA 2VQGA 2X6YA 3HRMA 4S04A 3SEQA 4NBQA 5F08A 1T2KA 4OMZA 3SYTA 5GAHJ 2ADUA 4XRSA 3HDDA 1U78A 2EQRA 3WU1B 1YI2I 4BGDA 1Q1VA 2JA5J 2R0QC 2K02A 4DIQA 1Y1VJ 3BR3A 4KISA 1YG2A 2NVYJ 3R4KA 2ECCA 4IHVA 3N4MA 3L9FA 2JSCA 2UUZA 2ZSHB 4KDPA 2GAUA 1QA6A 5J6XA 3R0JA 1YIOA 3SEZA 5D8LB 1BM9A 2JA2A 1YRNA 3FHZA 3WHCA 1BI1A 2JT1A 2VASA 2R4GA 3OIQA 3D1NI 5LGUA 3C2HA 4HZFA 2XKPA 1LVAA 3CLOA 3LFUA 1ZN2A 3Q3SA 1Y0UA 5EF6A 2BXZA 4EVIA 1DU0A 1WH5A 2W84A 2LY1A 3RQIA 3CCLI 2V9VA 3A03A 2Z1DA 5EEHA 1R1UA 4RAYA 5K5OA 4CO8A 3I71A 2MLKA 3AFHA 2E5NA 2ID3A 4HQEA 4BKXA 1YE9A 3JTHA 3VSLA 2R93J 2CFOA 3QYBA 2B0LA 5J4VA 2UV1A 4HSRA 2CUZA 3OYMA 1U9OA 1OCOH 4XRFA 4AYBA 3H1CA 2A6EF 4HV5A 3GLLA 4QPOA 1SFEA 2H6BA 2XPWA 3SFZA 3KP6A 1SVOA 1FIAA 2EFPA 3QRFF 1POGA 3WTWC 2KKOA 4EJTA 3F6VA 3BPVA 1O7FA 3C18A 3DQVC 3C3WA 1FNNA 2E1OA 5CVRA 3RKWA 4A3MJ 3A2KA 5J4YA 1C0WA 3DLLF 1SC7A 4AUXA 1U8RA 4FT8A 2E34A 3QPTA 3AAFA 2P7VB 1ON2A 3SJMA 1RI7A 3IH4A 1YQAA 5DD4A 1TW2A 4A0ZA 2Y9YA 2JVGA 3RYRA 4K2EA 3CO7C 5TRDA 4RAFA 5HLHA 1IC8A 3J7AO 2QM3A 2CH0A 1P7JA 3F3XA 1MBGA 3ZOBA 1XB4A 4BNCA 4PDKA 4PGHA 1Z7LA 1N77A 5LD2C 1ZGAA 4MQVA 3KP5A 1T98A 2JVHA 4LMYA 2ELJA 4RM2A 1LEBA 3S8PA 5FB2A 5GAEJ 2L54A 4B4CA 1W1WE 1IN6A 4OIPF 1Z77A 2QSFX 1D0XA 1VQ5I 4RGUA 1IUFA 1FTTA 1ZG3A 1RUNA 2COMA 2XC7A 2L7MP 4D1QA 2H8RA 1YOVB 1U0JA 3KCCA 4UNOA 1UHMA 2R7VA 2Q0OA 4LLGF 3LSKA 1HKSA 4LK1F 1LQ1A 3E5QA 3W6KB 2W48A 2Q2EB 2XB5A 2ESNA 4D5CA 4LFUA 4XSZF 1ZG5A 3CF5F 4HEA2 1VQ7I 2OC6A 2ME6A 2P5LC 3B6CA 2XGEA 3ABUA 3ZMVA 3MKYB 3FKIJ 2JUGA 2P6TA 1LDJA 2DFHA 3FXMA 3G1OA 3Q9VA 1FZPB 3K1MA 4DNCA 4EEFG 2HTJA 2L3DA 4UHTA 5IT9Z 1SEUA 4J00A 3KE2A 2XAJA 3PQKA 2KHMA 1XGSA 3RPUD 3SDGA 4CCKA 1JXSA 5J8FA 3E0JB 3NWTA 3TOAA 1MNDA 2FOKA 3ZQGA 3P9KA 1J5YA 4IO9F 2FJ1A 2BV6A 1VQ6I 4KMFA 1TQPA 1FBSA 3LSPA 4EATA 4Y52J 1DGWY 1YRNB 3M4OJ 1H89C 1AOYA 1OFCX 2LRDA 3ESWB 2R7OA 3ASOH 3GEZA 3BPXA 2DQLA 5K7FA 4HYEA 1W7PD 5LHHA 2VBXA 1HW5A 1WFXA 2IP2A 1QBJA 5FKMA 1R7JA 4JP0A 3GBGA 2PEXA 4L5JA 3BTLA 1F36A 1D1CA 3IAS2 2XROA 1VFCA 4PFOA 1JGGA 1H9TA 2HZDA 4KIGA 3OYNA 1IXSB 3HGGA 3TW7A 2AXTC 1ORKA 2HYJA 4A6DA 3GFLA 5C3EJ 1M1EB 1IAWA 1VF9A 2R7QA 3GUDA 4OMYA 1HXDA 3TW6A 3LSTA 2BY0A 2K4JA 1BR4A 4FETA 1ZH5A 3LSGA 3RDIA 3S1NJ 4ENMA 2H27A 2GBYA 4OWRB 4UVCA 3H9JA 2R7RA 4NUBA 3H0DA 3K9TA 1O3TA 2E1NA 1KA8A 5KNLA 4OIQF 2ZXWH 4LITA 4G6DA 3V7CA 1ZHFA 4XKWA 1TL8A 1ENHA 3WE2A 5JLXA 4HPQA 1MSEC 1F9NA 4DGWB 3W2VA 5ILVA 3GXOA 1OYIA 2LLKA 2XF5A 3BQYA 2HVQA 1J59A 4YFXF 2EV0A 1MJ9A 4ZYDA 2RDPA 2DYRH 3B02A 5A2QK 1MSFC 4HDUA 1XDSA 3JRCA 4IF4A 3E6MA 2NVQJ 5E3OA 3EUAA 3Q5FA 2XAHA 4UUTA 3HZJA 3AG1H 4HRIA 2QQ9A 3ULQB 2RQQA 3HSFA 1KQ9A 3LA3A 1OYWA 3I59A 4I02A 4R8HA 4RMNA 1S6LA 4IVNA 1REPC 3DU6A 4S0HB 4A3EJ 3K4BA 1B8IA 1X1DA 2E19A 1ZRCA 1ZKGA 2DQRA 2RV8A 2CV2A 3LQRA 3QP6A 4MGRA 1ZRFA 1K4TA 2FD5A 2DCEA 1YW7A 3PNVA 2EJRA 2PBIA 3GX4X 4GYIA 2KIUA 4I2OA 2QUFA 3DKWA 3F9KA 2AS5F 3O6BB 1YLFA 2DMNA 1MNEA 2ZFUA 2A61A 3JR9A 3HYIA 4A3DJ 3DEEA 1J9IA 4KYWA 2MFZA 1WPKA 2DJNA 2HQRA 3ERED 4LGWA 3BR0A 2DO7A 1L3LA
chains in the Genus database with same CATH topology
5C44J 1JUSA 3ZQCA 3HEFA 2P81A 2AHQA 4JX4A 5F04A 5IOYA 3DEWA 4UUSB 2R5YA 2HOSA 5IP9J 2JA6J 4A3BJ 3TP3A 4BY1J 2M8GX 3BG3A 3CQZJ 2O7OA 1ZGWA 1QVTA 2MW8A 5F27A 4XICA 5FLVA 2EZLA 5FKOA 1HCRA 4G12A 1X2NA 2LP0A 3HKZN 2COBA 4D7MA 2MSYA 1FEXA 4MFDA 5M3MJ 1U8BA 2ECBA 4IEJA 1BA5A 2DA5A 3LSRA 2HOTA 4FE4A 1E3OC 3FISA 1W0UA 5FKNA 2XB0X 4XIDA 2D5VA 1T33A 5IP6A 3WHBA 5J1UA 4L5EA 2E2HJ 1PUFA 4CYCB 2Y9ZA 1TC3C 2HQ5A 1HDDC 3HOWJ 3S15J 3GTLJ 2DA3A 5DTDA 2K40A 1FJLA 1XG1A 2VKEA 2NS7A 1JKQC 1MNMC 3HGYA 1LE8A 3S2HJ 3BG5A 3ZQLA 1QPIA 3PM1A 2QF7A 1JKOC 2EZIA 1MBJA 3H0GJ 3IH3A 1S7EA 1VI0A 2EH3A 3S2DJ 5EG0A 2VI6A 2HI3A 2N8GA 1H88C 5F0HA 1A5JA 4BBRJ 1EF4A 4M3GA 2JK3A 2JN6A 1ETYA 3BTJA 3GTJJ 1A6IA 5GPAA 1JUPA 5EYRA 1ETXA 3A02A 3HOVJ 4IHYA 2YUSA 2L9RA 1I3QJ 4IHXA 3BTIA 1OCTC 5FKLA 4C3IJ 3OSGA 3LSJA 1SFOJ 2M0CA 5IYDJ 4V2GA 3TEDA 3BQZA 2DTZA 4BY7J 1JTXA 1R9TJ 3BR5A 3FK6A 4I76A 2LY9A 1ZK8A 2ID6A 1UHSA 5K7ZA 3GTKJ 1AKHB 5EGOB 2KDZA 3UKGA 1AHDP 4IHWA 1GV2A 4XRSG 3JRBA 2H1KA 3HB9A 1GDTA 1X58A 3TP0A 3HOUJ 1F43A 1Z0XA 5IYBJ 4FE7A 4A3CJ 4FISA 4X6AJ 5C4JJ 3K7AJ 1BL0A 1IG7A 1B72B 2CUFA 4FTHA 1B8IB 2R5ZA 2JA7J 2X48A 5E3NA 2M2EA 1QRYA 4MO7A 2FX0A 2L0KA 2OPTA 3OSFA 2FQ4A 2O8KA 1BJZA 5F0FA 1WCMJ 2XGDA 5EEAA 2G0EA 3Q0WA 2DMTA 2CU7A 1NK3P 5EZHA 1I50J 5IYCJ 5M5WJ 5JLWA 2DMUA 3H3VK 3C2BA 4D7NA 4C3JJ 5DS9A 3S17J 1AU7A 1TWCJ 3S1RJ 4XK4A 2QCOA 5M3FJ 2K9NA 4V2FA 2R5YB 1JJ8C 4MFEA 4B1RA 5EDNA 3A01B 4DYQA 3S1MJ 2DN0A 3CDLA 3O8HA 5BNGA 2GLOA 4W97A 4A69C 4DYCA 3HOYJ 4M6VA 5F08A 4UUSA 1HLVA 5C4XJ 4A3IJ 5FKKA 2JJ7A 4A3LJ 4XRSA 2CUEA 3RKQA 3F0CA 3HDDA 3JREA 1U78A 5J3LA 2EQRA 3K2AA 1JT0A 2KT0A 1Q1VA 2JA5J 2R0QC 2MG4A 3RZOJ 1Y1VJ 3BR3A 2NVYJ 4XRMA 2ECCA 4IHVA 5K7HA 1K83J 1PUFB 3GTQJ 2YU9J 1ETVA 2R92J 1YRNA 2ZB9A 2Y30A 3WHCA 2PMZN 3BR1A 3D1NI 2XPUA 2DMPA 5F0CA 3JRGA 3IH2A 1IV6A 1LE8B 3Q3SA 4CYCA 5EF6A 2CQQA 1DU0A 4C3HJ 2K9SA 1WH5A 3VPRA 3I4NJ 3RQIA 5HODA 3A03A 5EG0B 3DCFA 1XC5A 2HXIA 1MBKA 3FIWA 2IEKA 1ETKA 3G1MA 1WH7A 2ID3A 1W0TA 4DZJA 2LKXA 2VUMJ 4M3BA 1UMQA 4BKXA 4A3JJ 2R93J 1BW6A 4DZPA 1XS9A 2M34A 2E2JJ 4RDUA 4B3AA 1RETA 4M3FA 3CMYA 1U9OA 4LOCA 3LNQA 2JWTA 1ZR4A 3OIOA 1WI3A 4GFBA 1RESA 2NVXJ 2I10A 2CJJA 2XPWA 3MKLA 1NK2P 1BW5A 4MIMA 2RAEA 2AO9A 4I6ZA 1FIAA 1POGA 2HOAA 1MH4A 3BR2A 3HBLA 1JKRC 2B63J 1GT0C 4A3MJ 1NTCA 2E1OA 2L7ZA 2Y0SN 5IP7J 1ETOA 3BG9A 1IRZA 5IPAA 1G2HA 1MBHA 4AUXA 2DA6A 1HDPA 5FJ8J 2DA4A 2XGCA 3SJMA 5EGOA 3IH4A 3JRIA 2R5ZB 4A3GJ 2Y9YA 3LOCA 1FTZA 2LR8A 3MVPA 1JT6A 1O4XA 1TWFJ 1IC8A 2DA7A 2LK2A 2X6OA 3G1LA 4X1EA 1P7JA 1TWGJ 3HOXJ 1MBGA 3ZOBA 1U9NA 2CQXA 3PO3J 1B72A 1ETQA 1JUMA 1RKTA 4D5FA 3L1PA 4B4CA 3GTOJ 1Z77A 4QTRA 1TWAJ 1IUFA 1FTTA 3RZDJ 2JA8J 4QSHA 4J19A 3QQAA 4AYBN 2L7MP 2E2IJ 2H8RA 3SFIA 2EZHA 3GTPJ 1LFBA 1MH3A 2XPVA 2Y2ZA 2XSDC 1OCPA 1ZR2A 2W48A 2YS9A 2XB5A 4D5CA 3CCYA 1ZTRA 3IV5A 5E3LA 2O9LA 2ME6A 3BR6A 1ZQ3P 3B6CA 2XGEA 3FKIJ 2ELKA 1IDZA 4ABZA 2DMQA 3A01A 3G1OA 3S14J 2OF7A 4EEFG 3GTMJ 4RBOA 1GV5A 3Q0VA 3BTCA 4A93J 1JTYA 2DA2A 3SDGA 5FLMJ 3JRDA 1ITYA 4BBSJ 3ZQGA 2WB1N 2WAQN 2FJ1A 1RR7A 3S16J 3LSPA 4HNVA 1APLC 4Y52J 1I6HJ 1YRNB 3M4OJ 1H89C 2VKVA 1OFCX 5M5XJ 2HXOA 1RKWA 2CRGA 1CQTA 1MBFA 2XRLA 5K7FA 3NAUA 5GP9A 3PO2J 3NARA 5FKMA 4JP0A 3HM5A 3GBGA 1Y1WJ 3B6AA 3BTLA 1F36A 1JGGA 1VFCA 1P7IA 3Q0UA 5E3MA 2X9DA 3W6VA 3O8GA 3HGGA 3TW7A 2HYJA 1ORKA 2L7FP 3ZQIA 5C3EJ 4BXXJ 3BT9A 1VF9A 1IGNA 5M5YJ 3TW6A 2HDDA 2WV1A 3LSGA 1QVUA 2ME0A 3S1NJ 2GBYA 2K9QA 2LVSA 4JX5A 1UG2A 4MLOA 2JMWA 2TRTA 4C2MJ 1IDYA 1T56A 1MBEA 2MGQA 2Y31A 4M3EA 4JYKA 2EZKA 5GPCA 2IAIA 1H8AC 4JX6A 1ENHA 2LD5A 3OOUA 1OJLA 4DYRA 5JLXA 3I4MJ 3S1QJ 4M3DA 1HF0A 1MSEC 1TWHJ 4NDLA 2LTPA 2LLKA 3BQYA 3ZQHA 4FCYA 5J1RA 4DW6A 4AC0A 1JJ6C 2DA1A 1MSFC 9ANTA 3JRCA 2GM4A 5IOZA 5E3OA 1JKPC 2NVQJ 1GVDA 3ZQFA 2EBIA 1D5YA 4QIWN 1AKHA 4UUTA 2NS8A 2R7ZJ 3GTGJ 5F1JA 1FIPA 3HOZJ 1RPWA 1IJWC 5EZGA 1DU6A 2TCTA 4A3FJ 3JRAA 4S0HB 2NOGA 1LFUP 1GUUA 4A3EJ 1B8IA 2E19A 2LFBA 3QPLA 1ZKGA 3MN2A 3M3YJ 1VNDA 1HOMA 1WGXA 2FD5A 3JRFA 1X2MA 4Y7NJ 3JRHA 1ETWA 3QPSA 5J1YA 1K61A 4A3KJ 3E7LA 2IBDA 1SANA 2NVTJ 2M9HA 2DMNA 4W1UA 3JR9A 4A3DJ 3FK7A 2VPRA 1WPKA 2DJNA 3BR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 J;  1JUS A;  3ZQC A;  3HEF A;  2P81 A;  2AHQ A;  4JX4 A;  5F04 A;  5IOY A;  3DEW A;  4UUS B;  2R5Y A;  2HOS A;  5IP9 J;  2JA6 J;  4A3B J;  3TP3 A;  4BY1 J;  2M8G X;  3BG3 A;  3CQZ J;  2O7O A;  1ZGW A;  1QVT A;  2MW8 A;  5F27 A;  4XIC A;  5FLV A;  2EZL A;  5FKO A;  1HCR A;  4G12 A;  1X2N A;  2LP0 A;  3HKZ N;  2COB A;  4D7M A;  2MSY A;  1FEX A;  4MFD A;  5M3M J;  1U8B A;  2ECB A;  4IEJ A;  1BA5 A;  2DA5 A;  3LSR A;  2HOT A;  4FE4 A;  1E3O C;  3FIS A;  1W0U A;  5FKN A;  2XB0 X;  4XID A;  2D5V A;  1T33 A;  5IP6 A;  3WHB A;  5J1U A;  4L5E A;  2E2H J;  1PUF A;  4CYC B;  2Y9Z A;  1TC3 C;  2HQ5 A;  1HDD C;  3HOW J;  3S15 J;  3GTL J;  2DA3 A;  5DTD A;  2K40 A;  1FJL A;  1XG1 A;  2VKE A;  2NS7 A;  1JKQ C;  1MNM C;  3HGY A;  1LE8 A;  3S2H J;  3BG5 A;  3ZQL A;  1QPI A;  3PM1 A;  2QF7 A;  1JKO C;  2EZI A;  1MBJ A;  3H0G J;  3IH3 A;  1S7E A;  1VI0 A;  2EH3 A;  3S2D J;  5EG0 A;  2VI6 A;  2HI3 A;  2N8G A;  1H88 C;  5F0H A;  1A5J A;  4BBR J;  1EF4 A;  4M3G A;  2JK3 A;  2JN6 A;  1ETY A;  3BTJ A;  3GTJ J;  1A6I A;  5GPA A;  1JUP A;  5EYR A;  1ETX A;  3A02 A;  3HOV J;  4IHY A;  2YUS A;  2L9R A;  1I3Q J;  4IHX A;  3BTI A;  1OCT C;  5FKL A;  4C3I J;  3OSG A;  3LSJ A;  1SFO J;  2M0C A;  5IYD J;  4V2G A;  3TED A;  3BQZ A;  2DTZ A;  4BY7 J;  1JTX A;  1R9T J;  3BR5 A;  3FK6 A;  4I76 A;  2LY9 A;  1ZK8 A;  2ID6 A;  1UHS A;  5K7Z A;  3GTK J;  1AKH B;  5EGO B;  2KDZ A;  3UKG A;  1AHD P;  4IHW A;  1GV2 A;  4XRS G;  3JRB A;  2H1K A;  3HB9 A;  1GDT A;  1X58 A;  3TP0 A;  3HOU J;  1F43 A;  1Z0X A;  5IYB J;  4FE7 A;  4A3C J;  4FIS A;  4X6A J;  5C4J J;  3K7A J;  1BL0 A;  1IG7 A;  1B72 B;  2CUF A;  4FTH A;  1B8I B;  2R5Z A;  2JA7 J;  2X48 A;  5E3N A;  2M2E A;  1QRY A;  4MO7 A;  2FX0 A;  2L0K A;  2OPT A;  3OSF A;  2FQ4 A;  2O8K A;  1BJZ A;  5F0F A;  1WCM J;  2XGD A;  5EEA A;  2G0E A;  3Q0W A;  2DMT A;  2CU7 A;  1NK3 P;  5EZH A;  1I50 J;  5IYC J;  5M5W J;  5JLW A;  2DMU A;  3H3V K;  3C2B A;  4D7N A;  4C3J J;  5DS9 A;  3S17 J;  1AU7 A;  1TWC J;  3S1R J;  4XK4 A;  2QCO A;  5M3F J;  2K9N A;  4V2F A;  2R5Y B;  1JJ8 C;  4MFE A;  4B1R A;  5EDN A;  3A01 B;  4DYQ A;  3S1M J;  2DN0 A;  3CDL A;  3O8H A;  5BNG A;  2GLO A;  4W97 A;  4A69 C;  4DYC A;  3HOY J;  4M6V A;  5F08 A;  4UUS A;  1HLV A;  5C4X J;  4A3I J;  5FKK A;  2JJ7 A;  4A3L J;  4XRS A;  2CUE A;  3RKQ A;  3F0C A;  3HDD A;  3JRE A;  1U78 A;  5J3L A;  2EQR A;  3K2A A;  1JT0 A;  2KT0 A;  1Q1V A;  2JA5 J;  2R0Q C;  2MG4 A;  3RZO J;  1Y1V J;  3BR3 A;  2NVY J;  4XRM A;  2ECC A;  4IHV A;  5K7H A;  1K83 J;  1PUF B;  3GTQ J;  2YU9 J;  1ETV A;  2R92 J;  1YRN A;  2ZB9 A;  2Y30 A;  3WHC A;  2PMZ N;  3BR1 A;  3D1N I;  2XPU A;  2DMP A;  5F0C A;  3JRG A;  3IH2 A;  1IV6 A;  1LE8 B;  3Q3S A;  4CYC A;  5EF6 A;  2CQQ A;  1DU0 A;  4C3H J;  2K9S A;  1WH5 A;  3VPR A;  3I4N J;  3RQI A;  5HOD A;  3A03 A;  5EG0 B;  3DCF A;  1XC5 A;  2HXI A;  1MBK A;  3FIW A;  2IEK A;  1ETK A;  3G1M A;  1WH7 A;  2ID3 A;  1W0T A;  4DZJ A;  2LKX A;  2VUM J;  4M3B A;  1UMQ A;  4BKX A;  4A3J J;  2R93 J;  1BW6 A;  4DZP A;  1XS9 A;  2M34 A;  2E2J J;  4RDU A;  4B3A A;  1RET A;  4M3F A;  3CMY A;  1U9O A;  4LOC A;  3LNQ A;  2JWT A;  1ZR4 A;  3OIO A;  1WI3 A;  4GFB A;  1RES A;  2NVX J;  2I10 A;  2CJJ A;  2XPW A;  3MKL A;  1NK2 P;  1BW5 A;  4MIM A;  2RAE A;  2AO9 A;  4I6Z A;  1FIA A;  1POG A;  2HOA A;  1MH4 A;  3BR2 A;  3HBL A;  1JKR C;  2B63 J;  1GT0 C;  4A3M J;  1NTC A;  2E1O A;  2L7Z A;  2Y0S N;  5IP7 J;  1ETO A;  3BG9 A;  1IRZ A;  5IPA A;  1G2H A;  1MBH A;  4AUX A;  2DA6 A;  1HDP A;  5FJ8 J;  2DA4 A;  2XGC A;  3SJM A;  5EGO A;  3IH4 A;  3JRI A;  2R5Z B;  4A3G J;  2Y9Y A;  3LOC A;  1FTZ A;  2LR8 A;  3MVP A;  1JT6 A;  1O4X A;  1TWF J;  1IC8 A;  2DA7 A;  2LK2 A;  2X6O A;  3G1L A;  4X1E A;  1P7J A;  1TWG J;  3HOX J;  1MBG A;  3ZOB A;  1U9N A;  2CQX A;  3PO3 J;  1B72 A;  1ETQ A;  1JUM A;  1RKT A;  4D5F A;  3L1P A;  4B4C A;  3GTO J;  1Z77 A;  4QTR A;  1TWA J;  1IUF A;  1FTT A;  3RZD J;  2JA8 J;  4QSH A;  4J19 A;  3QQA A;  4AYB N;  2L7M P;  2E2I J;  2H8R A;  3SFI A;  2EZH A;  3GTP J;  1LFB A;  1MH3 A;  2XPV A;  2Y2Z A;  2XSD C;  1OCP A;  1ZR2 A;  2W48 A;  2YS9 A;  2XB5 A;  4D5C A;  3CCY A;  1ZTR A;  3IV5 A;  5E3L A;  2O9L A;  2ME6 A;  3BR6 A;  1ZQ3 P;  3B6C A;  2XGE A;  3FKI J;  2ELK A;  1IDZ A;  4ABZ A;  2DMQ A;  3A01 A;  3G1O A;  3S14 J;  2OF7 A;  4EEF G;  3GTM J;  4RBO A;  1GV5 A;  3Q0V A;  3BTC A;  4A93 J;  1JTY A;  2DA2 A;  3SDG A;  5FLM J;  3JRD A;  1ITY A;  4BBS J;  3ZQG A;  2WB1 N;  2WAQ N;  2FJ1 A;  1RR7 A;  3S16 J;  3LSP A;  4HNV A;  1APL C;  4Y52 J;  1I6H J;  1YRN B;  3M4O J;  1H89 C;  2VKV A;  1OFC X;  5M5X J;  2HXO A;  1RKW A;  2CRG A;  1CQT A;  1MBF A;  2XRL A;  5K7F A;  3NAU A;  5GP9 A;  3PO2 J;  3NAR A;  5FKM A;  4JP0 A;  3HM5 A;  3GBG A;  1Y1W J;  3B6A A;  3BTL A;  1F36 A;  1JGG A;  1VFC A;  1P7I A;  3Q0U A;  5E3M A;  2X9D A;  3W6V A;  3O8G A;  3HGG A;  3TW7 A;  2HYJ A;  1ORK A;  2L7F P;  3ZQI A;  5C3E J;  4BXX J;  3BT9 A;  1VF9 A;  1IGN A;  5M5Y J;  3TW6 A;  2HDD A;  2WV1 A;  3LSG A;  1QVU A;  2ME0 A;  3S1N J;  2GBY A;  2K9Q A;  2LVS A;  4JX5 A;  1UG2 A;  4MLO A;  2JMW A;  2TRT A;  4C2M J;  1IDY A;  1T56 A;  1MBE A;  2MGQ A;  2Y31 A;  4M3E A;  4JYK A;  2EZK A;  5GPC A;  2IAI A;  1H8A C;  4JX6 A;  1ENH A;  2LD5 A;  3OOU A;  1OJL A;  4DYR A;  5JLX A;  3I4M J;  3S1Q J;  4M3D A;  1HF0 A;  1MSE C;  1TWH J;  4NDL A;  2LTP A;  2LLK A;  3BQY A;  3ZQH A;  4FCY A;  5J1R A;  4DW6 A;  4AC0 A;  1JJ6 C;  2DA1 A;  1MSF C;  9ANT A;  3JRC A;  2GM4 A;  5IOZ A;  5E3O A;  1JKP C;  2NVQ J;  1GVD A;  3ZQF A;  2EBI A;  1D5Y A;  4QIW N;  1AKH A;  4UUT A;  2NS8 A;  2R7Z J;  3GTG J;  5F1J A;  1FIP A;  3HOZ J;  1RPW A;  1IJW C;  5EZG A;  1DU6 A;  2TCT A;  4A3F J;  3JRA A;  4S0H B;  2NOG A;  1LFU P;  1GUU A;  4A3E J;  1B8I A;  2E19 A;  2LFB A;  3QPL A;  1ZKG A;  3MN2 A;  3M3Y J;  1VND A;  1HOM A;  1WGX A;  2FD5 A;  3JRF A;  1X2M A;  4Y7N J;  3JRH A;  1ETW A;  3QPS A;  5J1Y A;  1K61 A;  4A3K J;  3E7L A;  2IBD A;  1SAN A;  2NVT J;  2M9H A;  2DMN A;  4W1U A;  3JR9 A;  4A3D J;  3FK7 A;  2VPR A;  1WPK A;  2DJN A;  3BR0 A; 
#chains in the Genus database with same CATH topology
 1BBY A;  4NQW B;  3ZQC A;  4KMU X;  3HEF A;  2AHQ A;  4JX4 A;  2OJE D;  1FBQ A;  3ZMT A;  5FFZ A;  3KEQ A;  2EV5 A;  5FLX Z;  1S7O A;  3FXQ A;  1WJD A;  4JBA A;  2JA6 J;  1V5F A;  1L0O C;  3ABK H;  4M72 A;  4BQQ A;  2IA0 A;  4BAY A;  4HNT A;  3DEU A;  3M8J A;  1HC8 A;  5AIP A;  4XIC A;  1BC8 C;  3IKV A;  5FKO A;  3NQO A;  2MH2 A;  1DGR M;  4CCN A;  3I4P A;  3MZ8 A;  2VC0 A;  3VOE A;  1S29 A;  3FXK A;  4D7M A;  4AVZ A;  5L3E A;  1QZY A;  4BS9 A;  4YRV A;  1Z3X A;  5TGT A;  2DA5 A;  3LSR A;  1IXC A;  1E3O C;  5HLI A;  5D5X B;  3IP4 B;  5FKN A;  4BE1 A;  2R7S A;  4D9J A;  3VEP A;  3DP7 A;  1T33 A;  2V4J C;  5IP6 A;  5J1U A;  1BIB A;  1UZC A;  2E2H J;  3CJT B;  1O7L A;  5L3F A;  4U0V A;  4CYC B;  1OLT A;  5HOO A;  2DOA A;  1P4W A;  4XKC A;  5GTI C;  4PCQ A;  3KLO A;  4CA0 A;  3GZN B;  2VQC A;  5JVG F;  3ABT A;  1LE8 A;  2FXA A;  4RGS A;  1Z1D A;  2KIM A;  4GXO A;  3ZQL A;  2QF7 A;  2EZI A;  1FSE A;  1S7E A;  1R58 A;  3FXR A;  2EK5 A;  2YSR A;  3QAH A;  1FPQ A;  5F0H A;  3FKJ A;  3GF2 A;  2F48 A;  3D5S C;  2JK3 A;  2JN6 A;  4C2T A;  3BTJ A;  1TNT A;  4LIU A;  4ZYG A;  1D5V A;  1JUP A;  1ETX A;  1TT0 A;  4EJW A;  1EKE A;  2GIZ A;  2LY2 A;  1KQ0 A;  2V1U A;  1QHG A;  2PN6 A;  2YUS A;  2DT5 A;  4IHX A;  3BTI A;  2D1H A;  1OCT C;  5FKL A;  1TBX A;  1WJE A;  2VIX A;  2L01 A;  4C3I J;  4G7O F;  1GLN A;  3OSG A;  1XCV A;  1SFO J;  4YEL A;  5IYD J;  4XN3 A;  1XPX A;  1PJR A;  1K6O A;  3OY9 A;  1IRX A;  4EV0 A;  3FBI B;  4XNF A;  3WTZ A;  1P4X A;  2TDX A;  4XOP A;  1FWZ A;  3LSI A;  1R9T J;  3QOE A;  4I7H A;  4P5O A;  2Z16 A;  4ZH4 F;  2Q8K A;  3JTG A;  2NS0 A;  1EH8 A;  2ID6 A;  5LBQ A;  3CC7 I;  4PUS A;  2P5K A;  1YJW I;  1VZ0 A;  5EGO B;  5CQG A;  3UKG A;  2DXI A;  3E3V A;  1GV2 A;  4XRS G;  3HOS A;  1Y56 A;  3HB9 A;  2EPF A;  1X58 A;  3ML6 A;  3TP0 A;  2KRF A;  3CD6 I;  3HOU J;  3DFG A;  1Z0X A;  4EM1 A;  4BUP A;  2ZJ2 A;  4FIS A;  4KUM A;  1BL0 A;  1GHC A;  2VE8 A;  1F1Z A;  4FTH A;  4U0W A;  1B8I B;  2XGX A;  2KRC A;  2PLY A;  2A07 F;  5E3N A;  2KL4 A;  1WHU A;  1UST A;  3CLQ A;  4OIO F;  3L09 A;  3OYD A;  2EFW A;  1W5T A;  2L0K A;  1QO0 D;  2OPT A;  2ZME A;  2FQ4 A;  1BR2 A;  1MMD A;  3N97 A;  4Y15 A;  2KFD A;  4RGR A;  5F0F A;  2O8K A;  1WCM J;  4KIT B;  2E1M C;  1JHH A;  3GME A;  3Q0W A;  4GDF A;  2DMT A;  1T8I A;  2O6G E;  2HDC A;  2VXD A;  3X2Q H;  1I50 J;  5IYC J;  1HA8 A;  5M5W J;  1LDD A;  2LMD A;  2V1N A;  1RR8 C;  3CCV I;  3H3V K;  2E36 A;  2XKO A;  4C3J J;  3SZT A;  5DS9 A;  2PJP A;  2ZFW A;  4XK4 A;  2PJR B;  2H6C A;  4E7J A;  3RTR A;  3MKZ A;  3CJN A;  2JZY A;  1R4M B;  3PFY A;  1HSJ A;  2P4W A;  1N78 A;  4CH7 A;  3D5R C;  5LEJ A;  2XDV A;  4OIN F;  4KFC A;  2MA3 A;  5H20 A;  4UUS A;  2M87 A;  2CWE A;  5C4X J;  4A3I J;  4GRI A;  2C6Y A;  1XDU A;  2R7F A;  3RKQ A;  3F0C A;  3JRE A;  3K2A A;  2BGC A;  5ICF A;  1JT0 A;  2O0Y A;  3FF5 A;  2VBZ A;  4JQF A;  2ZO4 A;  1OYY A;  5DM6 F;  4E70 A;  1ULY A;  3TO9 A;  4BEH A;  3OR2 C;  1E0E A;  1XTA A;  1TQM A;  3FMQ A;  4G9Y A;  4A0X A;  3TMO A;  4JOM A;  1QPM A;  4LG3 A;  3F23 A;  1D8K A;  3F8F A;  1BIA A;  3WG7 H;  5K5R A;  2CV0 A;  2P7C B;  1JI8 A;  2PMZ N;  1YIT I;  2UWM A;  1MMG A;  2KIS A;  2XPU A;  1QNT A;  3BG7 A;  2BY3 A;  4ZJZ A;  3IH2 A;  3U9G A;  1IV6 A;  1CF7 A;  2L9S A;  3AL0 C;  1IUY A;  1LE8 B;  4XON A;  1OQY A;  4JK1 X;  4CCM A;  1IZ1 A;  1FYM A;  5ILS A;  5BS6 A;  3VPR A;  1EJ9 A;  3I56 I;  1Z91 A;  3ZP5 A;  1F4K A;  3MFK A;  3MAJ A;  5DM7 F;  3FM3 A;  1W0T A;  4DZJ A;  4BU2 A;  2LKX A;  2VUM J;  1UMQ A;  3HHG A;  1XSV A;  1BW6 A;  1FBU A;  3S2W A;  2R7W A;  1XS9 A;  1MW7 A;  2M34 A;  4ETS A;  4WK8 F;  3MQ0 A;  4HW0 A;  3VB2 A;  4RDU A;  4B3A A;  2QSH X;  1RET A;  4M74 A;  1YIJ I;  3CMY A;  4LOC A;  4MEY F;  3GVA A;  3LNQ A;  2JWT A;  1ZR4 A;  2UXX A;  3OIO A;  3AKZ A;  3TGN A;  4KIC A;  4ANJ A;  3QOP A;  1RES A;  1SFX A;  2PMH A;  3SDB A;  3M1C A;  1FMW A;  3DTI A;  1OCC H;  2F5D A;  2FNP A;  1NK2 P;  1BW5 A;  2AO9 A;  3CDI A;  3TDU C;  2HOA A;  3DPT A;  1MH4 A;  3FWE A;  2QYO A;  5FD5 A;  1D1A A;  2Y0S N;  3OYJ A;  1UHW A;  5IPA A;  3RPU A;  4CZC A;  1MBH A;  3LWF A;  3WE3 A;  2E71 A;  2LNB A;  2IXS A;  3T8T A;  4F52 A;  3HL2 A;  3BOQ A;  3IRQ A;  2WA0 A;  1Y39 A;  4IRI A;  4UY8 I;  2X6W A;  1XCB A;  1FP1 D;  1Q1H A;  3V7R A;  3JRI A;  3HSE A;  5IT9 K;  1ZGJ A;  3IC7 A;  5CKT A;  4A3G J;  1JT6 A;  3K4C A;  1O4X A;  1TWF J;  5ICG A;  2DA7 A;  2WB1 A;  2OZU A;  2X6O A;  3I3L A;  3COA C;  2WAQ A;  1ZEL A;  1G8X A;  1KU3 A;  3G1L A;  2ZME B;  2DDA A;  3GCM A;  3TBI A;  3HOX J;  1U9N A;  2CQX A;  3VYT B;  2VPL A;  3CP8 A;  1B72 A;  1JUM A;  3PUB A;  5JHF A;  3IWF A;  5BPI A;  4AVP A;  1TP4 A;  1QGP A;  3JCU C;  2VN2 A;  1RKT A;  3F8C A;  4P1W A;  1R36 A;  5JR3 A;  5ILU A;  4C2U A;  4IL6 C;  2DPD A;  5HLG A;  1FT9 A;  1O57 A;  1R4N B;  3HSR A;  4TV7 A;  5HLT A;  2A6T A;  1PP8 F;  3RZD J;  5E79 C;  4LLL A;  1NH3 A;  2HPM A;  4QSH A;  2XVC A;  1XMA A;  4CZZ A;  2X6X A;  1R5H A;  1S7A A;  2XPV A;  3KFW X;  1X3Z B;  2KDO A;  1OCP A;  4WXH A;  2MD5 A;  4E7K A;  2VOO A;  3BWG A;  2FRH A;  2ZJR F;  3CCY A;  4UVB A;  3CO6 C;  1ZTR A;  3IV5 A;  2KJC A;  1Z67 A;  4X0G A;  2XAF A;  1LFP A;  3KP7 A;  3FXL A;  3KEY A;  4DBR A;  3JSP A;  3KP3 A;  1XN7 A;  2WAD A;  4NC8 A;  5HDG A;  4IZZ A;  2DBB A;  1LDK B;  5HS8 A;  4L9J A;  2ELK A;  3A01 A;  2DMQ A;  3S14 J;  4PJ0 C;  4LD5 A;  1DDN A;  4LG0 A;  4QLC U;  3GTM J;  3Q0V A;  1Z7U A;  4C9Y A;  3BTC A;  1B1B A;  3F8N A;  2DA2 A;  4OU0 A;  2H09 A;  3FM5 A;  4B43 A;  5FLM J;  3V8K A;  3WTU C;  1V3F A;  5LHG A;  3AG2 H;  2DT7 B;  3DBL B;  3VDX A;  3CJQ B;  2MBF A;  3GFJ A;  3LL7 A;  3OYC A;  3MEX A;  3OS1 A;  2IS2 A;  2KRH A;  1ERD A;  1ONV A;  5M5X J;  2WAF A;  1WKM A;  2CRG A;  1MBF A;  2FBK A;  5EJC A;  5GP9 A;  3SXY A;  1CF7 B;  3L2C A;  1PDN C;  2F5F A;  3HM5 A;  3CC2 I;  3E6B A;  4M6X A;  1BOB A;  2RVC A;  4I09 A;  3G2B A;  1WI9 A;  3DXJ F;  3W6V A;  3O8G A;  3K70 D;  3ZQI A;  1T0F C;  3BT9 A;  1IGN A;  4IX7 A;  5M5Y J;  2UXN A;  1XMK A;  1TTY A;  4I99 C;  1B9M A;  2R7X A;  1OKR A;  1FOY A;  3CCS I;  4HF0 A;  2ME0 A;  3TO6 A;  2DFE A;  3L2W A;  1UG2 A;  4MLO A;  2JMW A;  2O61 A;  2LBF B;  4J01 A;  1IDY A;  1P4A A;  1SFK A;  1X4P A;  2VT3 A;  3T8R A;  1PUE E;  2Y31 A;  4S05 A;  4P55 A;  5FRO A;  5GPC A;  2RC4 A;  4DQ2 A;  2GA2 A;  2HYG D;  3OOU A;  1OJL A;  4DYR A;  3TQN A;  5FRM A;  4M3D A;  1HF0 A;  4LLN A;  2FEZ A;  4B48 A;  4DW6 A;  4AC0 A;  1JJ6 C;  2ZJP F;  1NG7 A;  9ANT A;  5FLX K;  3H92 A;  5H2F C;  4FX0 A;  2E1C A;  1FSH A;  4HX4 A;  1WJ5 A;  2GWR A;  3SZG A;  1AKH A;  2WY8 Q;  2NS8 A;  3GTG J;  4UXN A;  3U1D A;  4CSW A;  4MQ9 F;  2YX7 A;  1J7K A;  1RPW A;  4OAZ A;  5BQT A;  1K7A A;  1DUX C;  2TCT A;  2F6C A;  4MNU A;  1GUU A;  2DI3 A;  3GWZ A;  4RLQ A;  3CCE I;  2CMP A;  1W7P B;  2W85 A;  4M9Z A;  1XSD A;  1IXR C;  2LFB A;  5HS9 A;  2VKH A;  3J80 Z;  3M3Y J;  4C30 A;  4AIK A;  3ZMD A;  3ECO A;  2Y0M A;  4Q4Z F;  2MAB A;  3HTU A;  4G6Q A;  3JRF A;  1STZ A;  1PVE A;  3FBN B;  5J8C A;  1OPC A;  5HVQ C;  4L0Z B;  4A3K J;  2BVL A;  2IBD A;  1SAN A;  5E1W A;  2M9H A;  4XLC A;  2QZ8 A;  4W1U A;  3GLX A;  2VJJ A;  1A04 A;  4M9X A;  4B3X A;  5E1Z B;  5KVR A;  4AD9 A;  1HKT A;  5F04 A;  3P5J A;  3WTT C;  4RAZ A;  1X1B A;  4PJJ A;  5DCM A;  2EFQ A;  3AG3 H;  2W4S A;  4I0B A;  1VQK I;  2IS6 A;  4A3B J;  3RSN A;  4CYD A;  4BY1 J;  3BG3 A;  1WQ2 A;  3DU5 A;  2DLL A;  1BR1 A;  3BG6 A;  2MW8 A;  4KIF A;  3MZH A;  5F27 A;  4LG0 B;  4PSW A;  1TT5 B;  3U2R A;  3G4S I;  2BOL A;  2NXN B;  1W4M A;  1X2N A;  2A68 F;  2MC4 A;  3HKZ N;  3ZQQ A;  3PJR A;  2L7K A;  2MSY A;  4E6K G;  4PJM A;  2M3A A;  3WGI A;  1U8B A;  4E7H A;  4A5M A;  2HOT A;  1MMS A;  5CVV A;  3FIS A;  1W0U A;  4XID A;  3ZMS A;  2HZT A;  2VOP A;  1VQP I;  3M9A A;  3PFI A;  1PUF A;  4XLA A;  2EIL H;  1FC3 A;  2FA5 A;  2Y9Z A;  1GXQ A;  3WU0 A;  1TC3 C;  2HQ5 A;  4IQJ A;  5DTD A;  3SQN A;  2HVR A;  4PJN A;  1KU2 A;  4RM3 A;  2QKL B;  3BCA A;  1A31 A;  3OWT A;  1RNL A;  2VKE A;  5B3S H;  2BVM A;  5E17 F;  3M8F A;  1MNM C;  4ZYH A;  4BE0 A;  2I8D A;  1FLI A;  4M73 A;  1YHQ I;  1OIS A;  1QU3 A;  1U5T A;  2CS3 A;  1JKO C;  2LF8 A;  1MMA A;  2M8E A;  2YR2 A;  2ZSI B;  5AON A;  3VWB A;  2N8G A;  1A5J A;  3BY6 A;  2DOF A;  4M3G A;  4Q47 A;  3OYF A;  3GTJ J;  2FSW A;  2F5C A;  2PQ8 A;  5AIQ A;  4XBF A;  3S32 A;  4P9U A;  3RKX A;  6PAX A;  2W00 A;  1LUJ B;  3DKY A;  2EIJ H;  1SVM A;  1I39 A;  2A5Y B;  3ZGK A;  3G6E I;  4BHC A;  1KU7 A;  3LMM A;  2ESH A;  3ABM H;  4CHU A;  1SFU A;  2W25 A;  3VYS B;  1Z21 A;  4BY7 J;  4Y4R A;  3ZRG A;  4I98 B;  5D4S A;  3G71 I;  3E1S A;  3FK6 A;  2LY9 A;  4XLF A;  3H3U A;  2NVU B;  1UHS A;  2CV1 A;  2K9M A;  1DP3 A;  1AKH B;  5LFA A;  3JRB A;  2LF7 A;  3S3O A;  2H1K A;  2MD0 A;  1GDT A;  3EUH A;  1DPU A;  1E3H A;  4XLE A;  3CZ6 A;  3E6C C;  2A6H F;  2RQP A;  3F22 A;  2CUF A;  2BBY A;  2HS5 A;  2R5Z A;  1KZH A;  3VFZ A;  1Z9C A;  4BHB A;  1V54 H;  2M0M A;  1QRY A;  4L0Y B;  3SHF A;  5CYV A;  1T95 A;  3LA2 A;  3CCU I;  1ZAR A;  2ETH A;  2OCC H;  1V5G A;  2J5P A;  1OMI A;  4UV9 A;  2STW A;  3PSF A;  2CU7 A;  1G3W A;  2YPR A;  1NK3 P;  2IGO A;  3E5X A;  4YIR X;  3M7G A;  4U7B A;  2LDU A;  2QLZ A;  1TLH B;  2GQQ A;  1G3S A;  3FMS A;  3VYU B;  2X85 A;  2UZK A;  3K2Z A;  1FMV A;  3T5X A;  1SD7 A;  3K69 A;  4I0A A;  3ZQ7 A;  5DCM B;  2K9N A;  1SMT A;  1V4R A;  4RLF A;  2D45 A;  3BCB A;  5EDN A;  1HW1 A;  3LSM A;  2FMY A;  5F6F A;  3UNG C;  2KP6 A;  5BNG A;  2GLO A;  3KZZ A;  3EQL F;  2DFF A;  4W97 A;  1BN5 A;  4CIC A;  2CFX A;  5K5Q A;  3HOY J;  2O03 A;  3HIF A;  2DTR A;  3I54 A;  2GIV A;  1WRJ A;  2QQB A;  5EEG A;  2VOD A;  4F3Q A;  2M4K A;  4BQO A;  2F5V A;  4N0B A;  2JJ7 A;  2Y75 A;  3R6S A;  2YX4 A;  3T0Y A;  2XF6 A;  2VJ5 A;  4FHT A;  3CCQ I;  2NRA C;  2KT0 A;  4BYY A;  1FOW A;  3HC7 A;  4E4H A;  2MG4 A;  3RZO J;  3BJA A;  3D5L A;  3BZ6 A;  3WTV C;  1WJF A;  1IO2 A;  4XRM A;  1UEL B;  5K7H A;  1OR7 A;  1K83 J;  4B09 A;  4B44 A;  1PUF B;  1X1P A;  1R6R A;  2YU9 J;  4OAY A;  4XKV A;  1UJ8 A;  2CYY A;  3OYB A;  4BQA A;  3WU2 C;  3QYF A;  2ZB9 A;  4CCO A;  4WX9 A;  4HDV A;  1X1C A;  2EV6 A;  2A69 F;  2EA2 A;  2BE5 F;  2L9N A;  5TJJ A;  3GZ6 A;  1YO5 C;  4PJL A;  4RGX A;  3H3Z A;  2CQQ A;  1U5T B;  4IHT A;  4UV8 A;  5H6R A;  2K9S A;  3I4N J;  2Z9O A;  5HOD A;  1MKM A;  3K4K A;  3ZN0 A;  3DCF A;  2HXI A;  3DPU A;  1MBK A;  2ISY A;  3FIW A;  3VSK A;  4KIB A;  2IEK A;  1NG6 A;  4HV6 A;  1ETK A;  1RRJ A;  3G1M A;  1WH7 A;  2OCE A;  5B1A H;  3TO7 A;  3OYK A;  4M3B A;  3CUQ A;  1LB2 A;  2EIK H;  4U87 A;  4A3J J;  4DZP A;  3F21 A;  3HUG A;  2E2J J;  3DPL C;  3CMA I;  2K85 A;  1B9N A;  4M3F A;  4EMS A;  2QBY A;  1YX5 A;  3QU6 A;  1WI3 A;  1BOA A;  1USS A;  1JHF A;  3WTY C;  1W5S A;  2NVX J;  5LRR A;  3OL3 A;  3MKL A;  4MIM A;  1XGM A;  4B8X A;  4MTD A;  4RB1 A;  4I6Z A;  1JKR C;  3BR2 A;  2VC1 A;  3HBL A;  2B63 J;  1GT0 C;  5E18 F;  2Z33 A;  3OOP A;  1NTC A;  2JPC A;  3L7W A;  5D4R A;  3U21 A;  3F8M A;  1MJA A;  3I59 B;  1IRZ A;  3HPG A;  2JRM A;  2BEO A;  4HA8 A;  4ZTJ A;  1HDP A;  3FX3 A;  2F5E A;  1I3A A;  3SZP A;  5ED4 A;  2VLA A;  1EA3 A;  2HTS A;  1J09 A;  2HVS A;  2FBI A;  4CDG A;  2IGK A;  2R5Z B;  2AXL A;  2LR8 A;  3MVP A;  4ESF A;  4KA4 A;  3WG9 A;  4LB6 B;  3EET A;  3HKZ A;  3A1Y A;  4X1E A;  1TWG J;  2L5Q A;  1ON1 A;  3LFK A;  3PO3 J;  3NWS A;  2DK8 A;  5DD8 A;  5CJ9 A;  1WJB A;  1LVK A;  2W82 A;  1P6R A;  4D5F A;  3L1P A;  3MMY B;  3QP5 A;  3ZCO A;  1U6G A;  4GCV A;  3GTO J;  4QTR A;  5JHU A;  4AIJ A;  1S5L C;  5FGM A;  1S8N A;  4G6T B;  3QQA A;  4V19 K;  4AYB N;  2E2I J;  3SFI A;  3GTP J;  5HDK A;  3KZY A;  1A35 A;  2W24 A;  1VQL I;  3J7Z I;  3EPZ A;  4YFN F;  4BAC A;  1ZR2 A;  2YS9 A;  4BJT A;  2R7T A;  4L9T A;  5E3L A;  2O9L A;  4I01 A;  2QGU A;  4OOI A;  3S3M A;  2MLG A;  2KJB A;  3BR6 A;  1NHA A;  3H9Q A;  3IWZ A;  4UB6 C;  4CUG A;  5A2Q Z;  1ZQ3 P;  2JQ7 A;  3D0S A;  3LAP A;  1IDZ A;  2XAU A;  4IKF A;  3MWM A;  4RBO A;  1J0R A;  1ZYR F;  4ZZD A;  4A93 J;  4ZYA A;  4ENN A;  3I55 I;  5K1Y A;  2L4M A;  4ZC3 A;  3W2A A;  4HAM A;  4BBS J;  2FE3 A;  3CUO A;  1RR7 A;  3WOD F;  3L2U A;  3EYY A;  2VXZ A;  3KLN A;  2GXA A;  2XAS A;  1I6H J;  2VKV A;  2HGC A;  1Y8Q B;  1RKW A;  3MZY A;  4ZZL A;  5LHI A;  3I9V 2;  3NAR A;  4IQ4 A;  2DK5 A;  2MYS A;  3ZR8 X;  3HJE A;  4EJU A;  2AQF A;  4LB5 A;  3DLA A;  2QQA A;  4BDY A;  3Q0U A;  5E3M A;  3LA7 A;  3HRU A;  2OD5 A;  3QU3 A;  2KLO A;  3K4L A;  1O3Q A;  2M7A A;  4Y33 A;  1HBX G;  2CW8 A;  3I53 A;  5FRN A;  2RNG A;  3J80 K;  3CUQ B;  2IGN A;  2HYF A;  3JAM Z;  2K9Q A;  2LVS A;  4G8X A;  3EUK L;  1E3P A;  2P0W A;  3HUG B;  4QWQ A;  4WXC A;  4MHG A;  2CW7 A;  4C2M J;  1LNW A;  1MBE A;  4DJA A;  2VE9 A;  1V5E A;  1SD4 A;  1H0M A;  2EZK A;  2PFB A;  4HBL A;  2F2E A;  1W36 C;  1H8A C;  1X1A A;  2Y69 H;  4AWX B;  3S1Q J;  4NDL A;  3AG4 H;  2AQE A;  1UAA A;  1RC9 A;  5J1R A;  2DA1 A;  5LLQ A;  4HLY A;  4EGY A;  1SAX A;  2HQA A;  4WXD A;  1JKP C;  1GXP A;  1GVD A;  4EQQ A;  3JSO A;  2EBI A;  1D5Y A;  4PGG A;  1D8J A;  4D0P A;  2L4A A;  2R7Z J;  4XL9 A;  5F1J A;  1FIP A;  2ZXJ A;  3HOZ J;  4XR6 A;  1VQM I;  1YS7 A;  1FOX A;  3BP8 A;  2BXY A;  3CCJ I;  3ZXS A;  3DF8 A;  4L9V A;  4A3F J;  1Z6R A;  5HS7 A;  3ONQ A;  5B5E C;  2IVM A;  2CO5 A;  4RB3 C;  3QPL A;  4EJV A;  5DUI A;  5F1R A;  1R1V A;  1I5Z A;  4AID A;  3I0T A;  1VND A;  1HOM A;  1VQN I;  2HFH A;  2XUB A;  5HNH A;  3OV8 A;  1ZLJ A;  1YW8 A;  5CPR B;  1QQI A;  2OV7 A;  1X2M A;  4ITV A;  5E8G A;  2ZBK A;  4P96 A;  3OL4 A;  5DEQ A;  2ZJQ F;  1G4D A;  4ESJ A;  3QPS A;  5J1Y A;  3J7Y J;  1IF1 A;  3E7L A;  2E7W A;  3G3Z A;  3S3N A;  2XF7 A;  3M1E A;  3RPQ A;  1IN7 A;  4LK0 F;  4ESB A;  2VPR A;  3PL8 A;  2NNY A;  4QPQ A;  4XOT A;  4P9F A;  1ZG1 A;  2E35 A;  1JUS A;  3PQJ A;  2P81 A;  1BI3 A;  2ZME C;  1T38 A;  1TQI A;  2RKH A;  2HDW A;  4ZDL A;  4UUS B;  3HRT A;  1X3W B;  4GO1 A;  5D8K B;  2R5Y A;  1RIO H;  2HOS A;  3TP3 A;  2K27 A;  3CQZ J;  2O7O A;  1OCR H;  3P9I A;  1IRF A;  2QQ8 A;  4DBQ A;  2K5C A;  2Q2E A;  2VJ4 A;  4EM0 B;  2EZL A;  4Y13 A;  2KIF A;  3C1D A;  4G12 A;  4BEH B;  4BE2 A;  2HPI A;  2FF4 A;  4IRG A;  1G59 A;  3P7N A;  1K6Y A;  1Y0N A;  4FX4 A;  1FEX A;  1I6X A;  3OYG A;  3RJP A;  2OZ6 A;  5M3M J;  5D5V B;  2ECB A;  4IEJ A;  5ICE A;  3LSH A;  2FML A;  2K86 A;  2QWW A;  3MKW B;  2BHZ A;  1VQ8 I;  2HR3 A;  1KU9 A;  2A5W A;  3WHB A;  2X0L A;  4L5E A;  4XMY A;  5B66 C;  3TL4 X;  4ZYE A;  2JTV A;  2VL8 A;  1QZZ A;  2V6E A;  2V9K A;  1H9G A;  2OTJ I;  3GTL J;  1A6Q A;  2K40 A;  1FJL A;  1FY7 A;  2R3S A;  3IL2 A;  1JKQ C;  4BXU A;  3HGY A;  3L2Q A;  3BG5 A;  3PM1 A;  3S93 A;  3OYA A;  2KPM A;  3C7J A;  2EWN A;  3H0G J;  3IH3 A;  4IPA A;  1DPR A;  2ZNZ A;  3CJR B;  5EG0 A;  5GTH C;  2HI3 A;  3REO A;  4UVA A;  4BBR J;  1EF4 A;  4HG2 A;  1ETY A;  3OR1 C;  1T6S A;  2A3S A;  3ZN1 A;  1A6I A;  5GPA A;  5DV5 A;  2WAE A;  5B1B H;  4IHY A;  2HKX A;  2IS4 A;  1I3Q J;  1EV7 A;  3GZ5 A;  1R49 A;  4XSX F;  2JUC A;  3WGG A;  5CVU A;  2ZC2 A;  4WWC A;  2PI0 A;  1HQC A;  4V2G A;  4MTE A;  2DTZ A;  3A0B C;  2K3F A;  2P8T A;  1JTX A;  1P2F A;  3BR5 A;  4PZJ A;  2WBM A;  4I76 A;  1ZK8 A;  2MH9 A;  2O5R A;  2DDB A;  4OIR F;  2H8W A;  1AHD P;  4IHW A;  1P9Q C;  2A05 A;  1KGS A;  1SAU A;  1AA7 A;  3VYR B;  3PIO F;  2KIQ A;  2HQN A;  1F43 A;  5IYB J;  4FE7 A;  2JRT A;  4AM3 A;  2ZKZ A;  4A3C J;  4X6A J;  1IG7 A;  1UG0 A;  1B72 B;  1SD6 A;  2X48 A;  1ZRE A;  3NEU A;  1LJ9 A;  4HX8 A;  5GAD J;  2M2E A;  3L00 A;  4R1H A;  4XLP F;  2ELH A;  2VQH A;  2BW3 A;  2FUG 2;  3HPH A;  3K1N A;  2FX0 A;  5BPD A;  4AIH A;  1BJZ A;  3HXL A;  2KMU A;  1BI2 A;  3KYC B;  2M4G A;  4BJ5 C;  5EEA A;  4Z6Y A;  3KYD B;  1R22 A;  4DOZ A;  1K79 A;  2PMZ A;  5IT3 A;  1G3T A;  3KX2 A;  4IHS A;  3I64 A;  4L18 B;  2HWV A;  2OQG A;  3GO5 A;  1RUO A;  5JLW A;  3FHN A;  1Z3Y A;  4LIV A;  2XIG A;  4D7N A;  1G3Y A;  1ZLK A;  4ZTF A;  1HKQ A;  3DV8 A;  4KJZ A;  4A5N A;  1AU7 A;  4Y17 A;  3S17 J;  2QCO A;  1VQ9 I;  5M3F J;  2PMU A;  2R5Y B;  1JJ8 C;  4MFE A;  3KP2 A;  3A01 B;  4PSX A;  4RA2 A;  4DYQ A;  4CGZ A;  2DN0 A;  3CDL A;  4RS8 A;  4A0Y A;  2X4H A;  5FO5 A;  4NQW A;  2CGP A;  1IN4 A;  2F4M B;  4A69 C;  4DYC A;  2XAQ A;  4M6V A;  4U88 A;  4ENJ A;  2M1B A;  1PP7 U;  1HLV A;  2Y48 A;  3BZK A;  1IN5 A;  1IV8 A;  3OIP A;  5FKK A;  3L2R A;  5HNF A;  4IOC F;  4A3L J;  3BDD A;  2CUE A;  5D6F A;  1I1S A;  5J3L A;  1XGO A;  1EH6 A;  2FNA A;  5ERI A;  4FAS D;  2ZXH A;  3J81 Z;  2X1C A;  2IPQ X;  2DPU A;  4YG2 F;  1TZL A;  2WC2 A;  1SMY F;  2IT0 A;  2VBY A;  3LQQ A;  3K4M A;  2Y0S A;  2M5W A;  4F92 B;  3LAJ A;  4ZDO A;  2OA4 A;  3GTQ J;  2EFN A;  2R7U A;  1ETV A;  2R92 J;  1LEA A;  3ZMU A;  1KQ8 A;  2Y30 A;  4II3 A;  3BR1 A;  4A2U A;  5DUK A;  3BJO A;  2DMP A;  1JE8 A;  5F0C A;  3JRG A;  1T39 A;  3CES A;  3FXO A;  4E7L A;  5GAG J;  4A6E A;  1X19 A;  4CYC A;  1SVL A;  2O8X A;  4C3H J;  5JI6 A;  2MC3 A;  3C2G A;  1IRG A;  1E17 A;  5EG0 B;  1XC5 A;  3QYE A;  1T08 B;  2L02 A;  4EM2 A;  2CG4 A;  4M9S A;  4UUV A;  4IOA F;  2ICW G;  2Z2S B;  5CLS A;  1OCZ H;  4IRH A;  5LRS A;  2DOD A;  1FP2 A;  2BY2 A;  4HF2 A;  2M7B A;  1VQ4 I;  3V8L A;  4KT5 C;  2LH9 A;  1N25 A;  3PUF A;  1UCR A;  3BC8 A;  3PIP F;  3PNT A;  3CME I;  4M71 A;  3J7A Y;  4NHJ A;  2V9P A;  3IAM 2;  1S3J A;  3EDP A;  1X4O A;  2OAZ A;  2VT2 A;  4IXA A;  3DWL E;  1XD7 A;  3P9C A;  3CCR I;  4YFK F;  1WVR A;  2VQL A;  5BMZ A;  1KYW A;  4GFB A;  2M30 A;  2I10 A;  4ZDP A;  2CJJ A;  3BLY A;  2RAE A;  4AU7 A;  5H6Q A;  4HX7 A;  5E8I A;  2L7Z A;  2CQK A;  1LKX A;  5IP7 J;  1ETO A;  3BG9 A;  2LOO A;  1VTN C;  2QEX I;  1G2H A;  2DT6 A;  3F8B A;  2DU9 A;  2FU4 A;  2DA6 A;  1Y6I A;  2NAZ A;  1DQU A;  5L3B A;  2NOJ B;  5FJ8 J;  3ECH A;  4BH9 A;  4WF2 A;  4YII A;  2DA4 A;  2XGC A;  3E5U A;  2JSP A;  4NNJ A;  1YJ9 I;  2E7X A;  4G7H F;  1G6N A;  5EGO A;  4U7D A;  4NC6 A;  3HOT A;  2CW0 F;  2VJI A;  2Q1Z B;  4YIF A;  2IA1 A;  3LOC A;  1FTZ A;  2GXB A;  1J75 A;  4KN7 X;  4B47 A;  4F55 A;  2KQR A;  4XLN F;  2BW3 B;  2LK2 A;  2LG4 A;  1AWC A;  3R60 A;  5IY5 H;  2WY7 Q;  2O3F A;  3HRS A;  5KAF C;  3OS2 A;  3FZV A;  3MD2 A;  2J5O A;  2OBP A;  1ETQ A;  4XLH A;  2IRF G;  1W5C C;  3K0L A;  2Z99 A;  1X3U A;  2HKO A;  4XN0 A;  1LPQ A;  3DTE A;  1YFH A;  3B73 A;  3RYP A;  2RGV A;  4BJ6 C;  2ZXI A;  1R1T A;  1TWA J;  2K4B A;  2XAG A;  3BRO A;  3N05 A;  1MJB A;  5L3G A;  2JA8 J;  1YYV A;  3V42 A;  3QOD A;  4J19 A;  1S72 I;  2EZH A;  1LFB A;  2H1L A;  5JFR A;  1MH3 A;  2Y2Z A;  3FXU A;  3RKY A;  2XSD C;  4ENK A;  4HST A;  2EA4 A;  3OYH A;  1B4A A;  3CF2 A;  1KON A;  4EJO A;  1ODD A;  4RB0 A;  1WWX A;  3M07 A;  1TNS A;  2E60 A;  3L2V A;  2OUM A;  2PJR A;  2IW5 A;  3JAM K;  3K6G A;  3CCM I;  2IJL A;  1FX7 A;  3KP4 A;  4ABZ A;  1FOK A;  1WJC A;  2KZV A;  2V1X A;  2DAO A;  2OF7 A;  2NYX A;  1GV5 A;  4F93 B;  3H35 A;  1JTY A;  1D0Y A;  4HQM A;  3V4G A;  3JRD A;  2QA4 I;  5L3D A;  2GZW A;  2FQ3 A;  2V6C A;  3IHU A;  1ITY A;  4N4N B;  2WB1 N;  1YX3 A;  2WAQ N;  3F72 A;  1K78 A;  3S16 J;  2M45 A;  1K4S A;  4HNV A;  1FYK A;  4O6J A;  1APL C;  2D2W A;  1B59 A;  2RN7 A;  2QKM B;  3M8E A;  2HXO A;  2CQ7 A;  1CQT A;  2XRL A;  4IJA A;  4XQF A;  3R61 A;  3NAU A;  3V7S A;  5LGT A;  3PO2 J;  1Y1W J;  3B6A A;  2WWY A;  5TIS C;  3NRV A;  3QWL A;  3TOB A;  1P7I A;  2X9D A;  3ABL H;  2HU9 A;  5F64 A;  2LYC A;  1XGN A;  2L7F P;  4Q5S F;  4BXX J;  3Q9S A;  3W3C A;  2CQN A;  2YU3 A;  3ELK A;  1U2W A;  5DCF A;  2GOM A;  2HDD A;  3K4J A;  1R23 A;  3O2P E;  4E7S A;  1D3Y A;  2WV1 A;  3K4N A;  1QVU A;  4R79 A;  5D6E A;  1IW7 F;  4G94 A;  3OYE A;  4JX5 A;  3PNY A;  2W7N A;  2TRT A;  2L9V A;  3ZMZ A;  1T56 A;  4HNU A;  4UB8 C;  3KET A;  2QSG X;  2MGQ A;  4M3E A;  1BI0 A;  5KHD A;  2FBH A;  4JYK A;  1U5T C;  2IAI A;  2P5V A;  3RIR A;  4JX6 A;  2LD5 A;  2IA2 A;  2STT A;  4BXF A;  2HOE A;  3RCO A;  4BL0 B;  3I4M J;  1TWH J;  2LTP A;  1A36 A;  2GXG A;  4HOB A;  1ZAO A;  3ZQH A;  4FCY A;  3KYL A;  2K9L A;  1WJA A;  2H94 A;  2DOE A;  5JVT A;  2GA1 A;  2GM4 A;  1MIJ A;  5IOZ A;  3ZQF A;  3K1P A;  2PX9 A;  1YJN I;  5KCM A;  2HNH A;  2V79 A;  1YW9 A;  4QIW N;  2E1M B;  4ON0 A;  3K10 A;  5KK1 A;  1CGP A;  2Z5U A;  5E1X A;  3ISP A;  2VON A;  3QPH A;  4PFP A;  3E97 A;  1R00 A;  1IJW C;  3IKT A;  4N9H A;  5EZG A;  2HEO A;  1DU6 A;  4F91 B;  3TKY A;  3JRA A;  1VQO I;  2K3P A;  2NOG A;  1LFU P;  1J2X A;  2G9W A;  4O5V A;  3UR3 C;  3MN2 A;  3V8J A;  3W6J B;  3KEO A;  4XM3 A;  1WGX A;  3E6D A;  3T1B A;  2E5Z A;  1QHH D;  3TDZ C;  3EUH C;  4Y7N J;  2LRE A;  3JRH A;  1ETW A;  3W2W A;  3HHH A;  1K61 A;  2WTE A;  5CVJ A;  2BY1 A;  2NVT J;  2X1D A;  1Z6T A;  3FK7 A;  3F6O A;  1P92 A;  3CDH A;  4KNY A;  2DJI A;  2G7H A;  5C44 J;  4F7Z A;  5E20 A;  4H4K C;  2K7L A;  2EFO A;  2LSO A;  2VB6 A;  4ASN A;  5IOY A;  4HF1 A;  3DEW A;  3PSI A;  4HLX A;  4RAG A;  1YS6 A;  1MDM A;  2DYS H;  4U0Y A;  1MMN A;  5IP9 J;  1KYZ A;  2M8G X;  1O3S A;  3HG9 A;  3H5N A;  4M6Y A;  1ZGW A;  1QVT A;  1Y8R B;  1N75 A;  2BHY A;  3KZI C;  5J47 A;  5FLV A;  2DFI A;  3DTK A;  4MEX F;  4L5I A;  2XV4 S;  2EB7 A;  1GVJ A;  3DBH B;  1HCR A;  2BYV E;  1MZB A;  2IGM A;  2QVO A;  2LC2 A;  2LP0 A;  4E7I A;  3AL0 B;  2COB A;  1I1G A;  5J40 A;  4MFD A;  5D5U B;  1K78 B;  3DKX A;  1BA5 A;  3ERM A;  3VOD A;  4FE4 A;  4H0E A;  4CCL A;  2D5V A;  2XB0 X;  2I5U A;  2OQR A;  1UFM A;  1T0F A;  4GYG A;  2OU2 A;  5CQE A;  3H5R A;  1WSU A;  4CXF A;  2ZCW A;  1ACI A;  3CMM A;  2NNN A;  5DDG A;  1XMX A;  1HDD C;  2X1E A;  3HOW J;  3R0A A;  3S15 J;  2D1V A;  2DA3 A;  4L9N A;  4N4O B;  4PK4 A;  2W57 A;  3H36 A;  1DP7 P;  2EIN H;  1Z05 A;  4G7Z F;  1XG1 A;  1HW2 A;  4BQN A;  1QZE A;  2NS7 A;  4Y3O A;  3CTA A;  1FYL A;  2DW4 A;  1R5G A;  3S2H J;  1OR7 C;  1QPI A;  3CC4 I;  5KAI C;  4BDZ A;  1MBJ A;  4N9I A;  2BZT A;  3H5A A;  1VI0 A;  2EH3 A;  5FD6 A;  3S2D J;  3A0H C;  2VI6 A;  4RB2 C;  4II2 A;  1H88 C;  3FMR A;  2QBY B;  2QEN A;  4NC7 A;  3BZC A;  4EGZ A;  5EYR A;  3A02 A;  1O3R A;  3HOV J;  1RZ4 A;  1YTY A;  2L9R A;  3EYI A;  3G73 A;  3JW4 A;  3KPH A;  1B6A A;  1EH7 A;  3LSJ A;  3OS0 A;  3GYH X;  2LBF A;  2V1D A;  2M0C A;  1U3E M;  3OMY A;  3GFI A;  2IS1 A;  2V26 A;  5LEK A;  3H9G A;  3TED A;  3BQZ A;  4FQG A;  3U1K A;  2LKS A;  3HTS B;  5L3C A;  2ISZ A;  2PG4 A;  4WCG A;  5DYM A;  3CUQ C;  2F4I A;  2CUJ A;  4BHP A;  3ZPL A;  1D0Z A;  3BJ6 A;  5CVI A;  1WZ2 A;  3GTK J;  5K7Z A;  3ASN H;  1BC7 C;  2VKD A;  4GGG A;  2KDZ A;  1S9H A;  1D1B A;  3WTS C;  3GFM A;  4XOR A;  2L2O A;  2FOW A;  2WV0 A;  4Z2Y A;  1IN8 A;  2XHK A;  2CSO A;  2V7F A;  2RNJ A;  2LKP A;  5C4J J;  3K7A J;  1MGT A;  4E7Z A;  3WGH A;  2EIM H;  3O3K A;  1ZRD A;  2JA7 J;  3J81 K;  1XSX A;  2OTL I;  1UB9 A;  1MD0 A;  2GOX B;  4MO7 A;  1HST A;  2B7E A;  2RRE A;  5BOX A;  1I27 A;  1SD5 A;  2XSJ C;  2ACJ A;  2XRN A;  5LGN A;  3OSF A;  2VBW A;  3IUO A;  3ROU A;  4XKB A;  2XGD A;  3I5U A;  1R71 A;  4A12 A;  1W36 D;  2JPB A;  2G0E A;  1W7P A;  2X51 A;  3KIO A;  3FDY A;  3GW2 A;  4KT6 A;  3RI4 A;  1F5T A;  5D5W B;  5HDN A;  2ZNY A;  3OYI A;  1V55 H;  5EZH A;  2W1O A;  3IRR A;  2B9S A;  4O3M A;  2DMU A;  1E2X A;  3C2B A;  5FFX A;  1JGS A;  3A4C A;  2Z3Y A;  3CP2 A;  1BJA A;  4LJZ F;  5ICC A;  3DBR B;  4YEJ A;  1TWC J;  3I58 A;  4KN4 X;  1TW3 A;  3RQ4 A;  2P6S A;  3S1R J;  3WTX C;  1PYV A;  1R5I D;  2F4O B;  4V2F A;  1MDM B;  2KZG A;  1XX5 A;  2G7U A;  4B1R A;  3FXJ A;  4CCJ A;  3S1M J;  3OYL A;  3MCZ A;  3O8H A;  4Q48 A;  4NB5 A;  3K70 C;  2R7D A;  2VQG A;  2X6Y A;  3HRM A;  4S04 A;  3SEQ A;  4NBQ A;  5F08 A;  1T2K A;  4OMZ A;  3SYT A;  5GAH J;  2ADU A;  4XRS A;  3HDD A;  1U78 A;  2EQR A;  3WU1 B;  1YI2 I;  4BGD A;  1Q1V A;  2JA5 J;  2R0Q C;  2K02 A;  4DIQ A;  1Y1V J;  3BR3 A;  4KIS A;  1YG2 A;  2NVY J;  3R4K A;  2ECC A;  4IHV A;  3N4M A;  3L9F A;  2JSC A;  2UUZ A;  2ZSH B;  4KDP A;  2GAU A;  1QA6 A;  5J6X A;  3R0J A;  1YIO A;  3SEZ A;  5D8L B;  1BM9 A;  2JA2 A;  1YRN A;  3FHZ A;  3WHC A;  1BI1 A;  2JT1 A;  2VAS A;  2R4G A;  3OIQ A;  3D1N I;  5LGU A;  3C2H A;  4HZF A;  2XKP A;  1LVA A;  3CLO A;  3LFU A;  1ZN2 A;  3Q3S A;  1Y0U A;  5EF6 A;  2BXZ A;  4EVI A;  1DU0 A;  1WH5 A;  2W84 A;  2LY1 A;  3RQI A;  3CCL I;  2V9V A;  3A03 A;  2Z1D A;  5EEH A;  1R1U A;  4RAY A;  5K5O A;  4CO8 A;  3I71 A;  2MLK A;  3AFH A;  2E5N A;  2ID3 A;  4HQE A;  4BKX A;  1YE9 A;  3JTH A;  3VSL A;  2R93 J;  2CFO A;  3QYB A;  2B0L A;  5J4V A;  2UV1 A;  4HSR A;  2CUZ A;  3OYM A;  1U9O A;  1OCO H;  4XRF A;  4AYB A;  3H1C A;  2A6E F;  4HV5 A;  3GLL A;  4QPO A;  1SFE A;  2H6B A;  2XPW A;  3SFZ A;  3KP6 A;  1SVO A;  1FIA A;  2EFP A;  3QRF F;  1POG A;  3WTW C;  2KKO A;  4EJT A;  3F6V A;  3BPV A;  1O7F A;  3C18 A;  3DQV C;  3C3W A;  1FNN A;  2E1O A;  5CVR A;  3RKW A;  4A3M J;  3A2K A;  5J4Y A;  1C0W A;  3DLL F;  1SC7 A;  4AUX A;  1U8R A;  4FT8 A;  2E34 A;  3QPT A;  3AAF A;  2P7V B;  1ON2 A;  3SJM A;  1RI7 A;  3IH4 A;  1YQA A;  5DD4 A;  1TW2 A;  4A0Z A;  2Y9Y A;  2JVG A;  3RYR A;  4K2E A;  3CO7 C;  5TRD A;  4RAF A;  5HLH A;  1IC8 A;  3J7A O;  2QM3 A;  2CH0 A;  1P7J A;  3F3X A;  1MBG A;  3ZOB A;  1XB4 A;  4BNC A;  4PDK A;  4PGH A;  1Z7L A;  1N77 A;  5LD2 C;  1ZGA A;  4MQV A;  3KP5 A;  1T98 A;  2JVH A;  4LMY A;  2ELJ A;  4RM2 A;  1LEB A;  3S8P A;  5FB2 A;  5GAE J;  2L54 A;  4B4C A;  1W1W E;  1IN6 A;  4OIP F;  1Z77 A;  2QSF X;  1D0X A;  1VQ5 I;  4RGU A;  1IUF A;  1FTT A;  1ZG3 A;  1RUN A;  2COM A;  2XC7 A;  2L7M P;  4D1Q A;  2H8R A;  1YOV B;  1U0J A;  3KCC A;  4UNO A;  1UHM A;  2R7V A;  2Q0O A;  4LLG F;  3LSK A;  1HKS A;  4LK1 F;  1LQ1 A;  3E5Q A;  3W6K B;  2W48 A;  2Q2E B;  2XB5 A;  2ESN A;  4D5C A;  4LFU A;  4XSZ F;  1ZG5 A;  3CF5 F;  4HEA 2;  1VQ7 I;  2OC6 A;  2ME6 A;  2P5L C;  3B6C A;  2XGE A;  3ABU A;  3ZMV A;  3MKY B;  3FKI J;  2JUG A;  2P6T A;  1LDJ A;  2DFH A;  3FXM A;  3G1O A;  3Q9V A;  1FZP B;  3K1M A;  4DNC A;  4EEF G;  2HTJ A;  2L3D A;  4UHT A;  5IT9 Z;  1SEU A;  4J00 A;  3KE2 A;  2XAJ A;  3PQK A;  2KHM A;  1XGS A;  3RPU D;  3SDG A;  4CCK A;  1JXS A;  5J8F A;  3E0J B;  3NWT A;  3TOA A;  1MND A;  2FOK A;  3ZQG A;  3P9K A;  1J5Y A;  4IO9 F;  2FJ1 A;  2BV6 A;  1VQ6 I;  4KMF A;  1TQP A;  1FBS A;  3LSP A;  4EAT A;  4Y52 J;  1DGW Y;  1YRN B;  3M4O J;  1H89 C;  1AOY A;  1OFC X;  2LRD A;  3ESW B;  2R7O A;  3ASO H;  3GEZ A;  3BPX A;  2DQL A;  5K7F A;  4HYE A;  1W7P D;  5LHH A;  2VBX A;  1HW5 A;  1WFX A;  2IP2 A;  1QBJ A;  5FKM A;  1R7J A;  4JP0 A;  3GBG A;  2PEX A;  4L5J A;  3BTL A;  1F36 A;  1D1C A;  3IAS 2;  2XRO A;  1VFC A;  4PFO A;  1JGG A;  1H9T A;  2HZD A;  4KIG A;  3OYN A;  1IXS B;  3HGG A;  3TW7 A;  2AXT C;  1ORK A;  2HYJ A;  4A6D A;  3GFL A;  5C3E J;  1M1E B;  1IAW A;  1VF9 A;  2R7Q A;  3GUD A;  4OMY A;  1HXD A;  3TW6 A;  3LST A;  2BY0 A;  2K4J A;  1BR4 A;  4FET A;  1ZH5 A;  3LSG A;  3RDI A;  3S1N J;  4ENM A;  2H27 A;  2GBY A;  4OWR B;  4UVC A;  3H9J A;  2R7R A;  4NUB A;  3H0D A;  3K9T A;  1O3T A;  2E1N A;  1KA8 A;  5KNL A;  4OIQ F;  2ZXW H;  4LIT A;  4G6D A;  3V7C A;  1ZHF A;  4XKW A;  1TL8 A;  1ENH A;  3WE2 A;  5JLX A;  4HPQ A;  1MSE C;  1F9N A;  4DGW B;  3W2V A;  5ILV A;  3GXO A;  1OYI A;  2LLK A;  2XF5 A;  3BQY A;  2HVQ A;  1J59 A;  4YFX F;  2EV0 A;  1MJ9 A;  4ZYD A;  2RDP A;  2DYR H;  3B02 A;  5A2Q K;  1MSF C;  4HDU A;  1XDS A;  3JRC A;  4IF4 A;  3E6M A;  2NVQ J;  5E3O A;  3EUA A;  3Q5F A;  2XAH A;  4UUT A;  3HZJ A;  3AG1 H;  4HRI A;  2QQ9 A;  3ULQ B;  2RQQ A;  3HSF A;  1KQ9 A;  3LA3 A;  1OYW A;  3I59 A;  4I02 A;  4R8H A;  4RMN A;  1S6L A;  4IVN A;  1REP C;  3DU6 A;  4S0H B;  4A3E J;  3K4B A;  1B8I A;  1X1D A;  2E19 A;  1ZRC A;  1ZKG A;  2DQR A;  2RV8 A;  2CV2 A;  3LQR A;  3QP6 A;  4MGR A;  1ZRF A;  1K4T A;  2FD5 A;  2DCE A;  1YW7 A;  3PNV A;  2EJR A;  2PBI A;  3GX4 X;  4GYI A;  2KIU A;  4I2O A;  2QUF A;  3DKW A;  3F9K A;  2AS5 F;  3O6B B;  1YLF A;  2DMN A;  1MNE A;  2ZFU A;  2A61 A;  3JR9 A;  3HYI A;  4A3D J;  3DEE A;  1J9I A;  4KYW A;  2MFZ A;  1WPK A;  2DJN A;  2HQR A;  3ERE D;  4LGW A;  3BR0 A;  2DO7 A;  1L3L A; 
#chains in the Genus database with same CATH homology
 5C44 J;  1JUS A;  3ZQC A;  3HEF A;  2P81 A;  2AHQ A;  4JX4 A;  5F04 A;  5IOY A;  3DEW A;  4UUS B;  2R5Y A;  2HOS A;  5IP9 J;  2JA6 J;  4A3B J;  3TP3 A;  4BY1 J;  2M8G X;  3BG3 A;  3CQZ J;  2O7O A;  1ZGW A;  1QVT A;  2MW8 A;  5F27 A;  4XIC A;  5FLV A;  2EZL A;  5FKO A;  1HCR A;  4G12 A;  1X2N A;  2LP0 A;  3HKZ N;  2COB A;  4D7M A;  2MSY A;  1FEX A;  4MFD A;  5M3M J;  1U8B A;  2ECB A;  4IEJ A;  1BA5 A;  2DA5 A;  3LSR A;  2HOT A;  4FE4 A;  1E3O C;  3FIS A;  1W0U A;  5FKN A;  2XB0 X;  4XID A;  2D5V A;  1T33 A;  5IP6 A;  3WHB A;  5J1U A;  4L5E A;  2E2H J;  1PUF A;  4CYC B;  2Y9Z A;  1TC3 C;  2HQ5 A;  1HDD C;  3HOW J;  3S15 J;  3GTL J;  2DA3 A;  5DTD A;  2K40 A;  1FJL A;  1XG1 A;  2VKE A;  2NS7 A;  1JKQ C;  1MNM C;  3HGY A;  1LE8 A;  3S2H J;  3BG5 A;  3ZQL A;  1QPI A;  3PM1 A;  2QF7 A;  1JKO C;  2EZI A;  1MBJ A;  3H0G J;  3IH3 A;  1S7E A;  1VI0 A;  2EH3 A;  3S2D J;  5EG0 A;  2VI6 A;  2HI3 A;  2N8G A;  1H88 C;  5F0H A;  1A5J A;  4BBR J;  1EF4 A;  4M3G A;  2JK3 A;  2JN6 A;  1ETY A;  3BTJ A;  3GTJ J;  1A6I A;  5GPA A;  1JUP A;  5EYR A;  1ETX A;  3A02 A;  3HOV J;  4IHY A;  2YUS A;  2L9R A;  1I3Q J;  4IHX A;  3BTI A;  1OCT C;  5FKL A;  4C3I J;  3OSG A;  3LSJ A;  1SFO J;  2M0C A;  5IYD J;  4V2G A;  3TED A;  3BQZ A;  2DTZ A;  4BY7 J;  1JTX A;  1R9T J;  3BR5 A;  3FK6 A;  4I76 A;  2LY9 A;  1ZK8 A;  2ID6 A;  1UHS A;  5K7Z A;  3GTK J;  1AKH B;  5EGO B;  2KDZ A;  3UKG A;  1AHD P;  4IHW A;  1GV2 A;  4XRS G;  3JRB A;  2H1K A;  3HB9 A;  1GDT A;  1X58 A;  3TP0 A;  3HOU J;  1F43 A;  1Z0X A;  5IYB J;  4FE7 A;  4A3C J;  4FIS A;  4X6A J;  5C4J J;  3K7A J;  1BL0 A;  1IG7 A;  1B72 B;  2CUF A;  4FTH A;  1B8I B;  2R5Z A;  2JA7 J;  2X48 A;  5E3N A;  2M2E A;  1QRY A;  4MO7 A;  2FX0 A;  2L0K A;  2OPT A;  3OSF A;  2FQ4 A;  2O8K A;  1BJZ A;  5F0F A;  1WCM J;  2XGD A;  5EEA A;  2G0E A;  3Q0W A;  2DMT A;  2CU7 A;  1NK3 P;  5EZH A;  1I50 J;  5IYC J;  5M5W J;  5JLW A;  2DMU A;  3H3V K;  3C2B A;  4D7N A;  4C3J J;  5DS9 A;  3S17 J;  1AU7 A;  1TWC J;  3S1R J;  4XK4 A;  2QCO A;  5M3F J;  2K9N A;  4V2F A;  2R5Y B;  1JJ8 C;  4MFE A;  4B1R A;  5EDN A;  3A01 B;  4DYQ A;  3S1M J;  2DN0 A;  3CDL A;  3O8H A;  5BNG A;  2GLO A;  4W97 A;  4A69 C;  4DYC A;  3HOY J;  4M6V A;  5F08 A;  4UUS A;  1HLV A;  5C4X J;  4A3I J;  5FKK A;  2JJ7 A;  4A3L J;  4XRS A;  2CUE A;  3RKQ A;  3F0C A;  3HDD A;  3JRE A;  1U78 A;  5J3L A;  2EQR A;  3K2A A;  1JT0 A;  2KT0 A;  1Q1V A;  2JA5 J;  2R0Q C;  2MG4 A;  3RZO J;  1Y1V J;  3BR3 A;  2NVY J;  4XRM A;  2ECC A;  4IHV A;  5K7H A;  1K83 J;  1PUF B;  3GTQ J;  2YU9 J;  1ETV A;  2R92 J;  1YRN A;  2ZB9 A;  2Y30 A;  3WHC A;  2PMZ N;  3BR1 A;  3D1N I;  2XPU A;  2DMP A;  5F0C A;  3JRG A;  3IH2 A;  1IV6 A;  1LE8 B;  3Q3S A;  4CYC A;  5EF6 A;  2CQQ A;  1DU0 A;  4C3H J;  2K9S A;  1WH5 A;  3VPR A;  3I4N J;  3RQI A;  5HOD A;  3A03 A;  5EG0 B;  3DCF A;  1XC5 A;  2HXI A;  1MBK A;  3FIW A;  2IEK A;  1ETK A;  3G1M A;  1WH7 A;  2ID3 A;  1W0T A;  4DZJ A;  2LKX A;  2VUM J;  4M3B A;  1UMQ A;  4BKX A;  4A3J J;  2R93 J;  1BW6 A;  4DZP A;  1XS9 A;  2M34 A;  2E2J J;  4RDU A;  4B3A A;  1RET A;  4M3F A;  3CMY A;  1U9O A;  4LOC A;  3LNQ A;  2JWT A;  1ZR4 A;  3OIO A;  1WI3 A;  4GFB A;  1RES A;  2NVX J;  2I10 A;  2CJJ A;  2XPW A;  3MKL A;  1NK2 P;  1BW5 A;  4MIM A;  2RAE A;  2AO9 A;  4I6Z A;  1FIA A;  1POG A;  2HOA A;  1MH4 A;  3BR2 A;  3HBL A;  1JKR C;  2B63 J;  1GT0 C;  4A3M J;  1NTC A;  2E1O A;  2L7Z A;  2Y0S N;  5IP7 J;  1ETO A;  3BG9 A;  1IRZ A;  5IPA A;  1G2H A;  1MBH A;  4AUX A;  2DA6 A;  1HDP A;  5FJ8 J;  2DA4 A;  2XGC A;  3SJM A;  5EGO A;  3IH4 A;  3JRI A;  2R5Z B;  4A3G J;  2Y9Y A;  3LOC A;  1FTZ A;  2LR8 A;  3MVP A;  1JT6 A;  1O4X A;  1TWF J;  1IC8 A;  2DA7 A;  2LK2 A;  2X6O A;  3G1L A;  4X1E A;  1P7J A;  1TWG J;  3HOX J;  1MBG A;  3ZOB A;  1U9N A;  2CQX A;  3PO3 J;  1B72 A;  1ETQ A;  1JUM A;  1RKT A;  4D5F A;  3L1P A;  4B4C A;  3GTO J;  1Z77 A;  4QTR A;  1TWA J;  1IUF A;  1FTT A;  3RZD J;  2JA8 J;  4QSH A;  4J19 A;  3QQA A;  4AYB N;  2L7M P;  2E2I J;  2H8R A;  3SFI A;  2EZH A;  3GTP J;  1LFB A;  1MH3 A;  2XPV A;  2Y2Z A;  2XSD C;  1OCP A;  1ZR2 A;  2W48 A;  2YS9 A;  2XB5 A;  4D5C A;  3CCY A;  1ZTR A;  3IV5 A;  5E3L A;  2O9L A;  2ME6 A;  3BR6 A;  1ZQ3 P;  3B6C A;  2XGE A;  3FKI J;  2ELK A;  1IDZ A;  4ABZ A;  2DMQ A;  3A01 A;  3G1O A;  3S14 J;  2OF7 A;  4EEF G;  3GTM J;  4RBO A;  1GV5 A;  3Q0V A;  3BTC A;  4A93 J;  1JTY A;  2DA2 A;  3SDG A;  5FLM J;  3JRD A;  1ITY A;  4BBS J;  3ZQG A;  2WB1 N;  2WAQ N;  2FJ1 A;  1RR7 A;  3S16 J;  3LSP A;  4HNV A;  1APL C;  4Y52 J;  1I6H J;  1YRN B;  3M4O J;  1H89 C;  2VKV A;  1OFC X;  5M5X J;  2HXO A;  1RKW A;  2CRG A;  1CQT A;  1MBF A;  2XRL A;  5K7F A;  3NAU A;  5GP9 A;  3PO2 J;  3NAR A;  5FKM A;  4JP0 A;  3HM5 A;  3GBG A;  1Y1W J;  3B6A A;  3BTL A;  1F36 A;  1JGG A;  1VFC A;  1P7I A;  3Q0U A;  5E3M A;  2X9D A;  3W6V A;  3O8G A;  3HGG A;  3TW7 A;  2HYJ A;  1ORK A;  2L7F P;  3ZQI A;  5C3E J;  4BXX J;  3BT9 A;  1VF9 A;  1IGN A;  5M5Y J;  3TW6 A;  2HDD A;  2WV1 A;  3LSG A;  1QVU A;  2ME0 A;  3S1N J;  2GBY A;  2K9Q A;  2LVS A;  4JX5 A;  1UG2 A;  4MLO A;  2JMW A;  2TRT A;  4C2M J;  1IDY A;  1T56 A;  1MBE A;  2MGQ A;  2Y31 A;  4M3E A;  4JYK A;  2EZK A;  5GPC A;  2IAI A;  1H8A C;  4JX6 A;  1ENH A;  2LD5 A;  3OOU A;  1OJL A;  4DYR A;  5JLX A;  3I4M J;  3S1Q J;  4M3D A;  1HF0 A;  1MSE C;  1TWH J;  4NDL A;  2LTP A;  2LLK A;  3BQY A;  3ZQH A;  4FCY A;  5J1R A;  4DW6 A;  4AC0 A;  1JJ6 C;  2DA1 A;  1MSF C;  9ANT A;  3JRC A;  2GM4 A;  5IOZ A;  5E3O A;  1JKP C;  2NVQ J;  1GVD A;  3ZQF A;  2EBI A;  1D5Y A;  4QIW N;  1AKH A;  4UUT A;  2NS8 A;  2R7Z J;  3GTG J;  5F1J A;  1FIP A;  3HOZ J;  1RPW A;  1IJW C;  5EZG A;  1DU6 A;  2TCT A;  4A3F J;  3JRA A;  4S0H B;  2NOG A;  1LFU P;  1GUU A;  4A3E J;  1B8I A;  2E19 A;  2LFB A;  3QPL A;  1ZKG A;  3MN2 A;  3M3Y J;  1VND A;  1HOM A;  1WGX A;  2FD5 A;  3JRF A;  1X2M A;  4Y7N J;  3JRH A;  1ETW A;  3QPS A;  5J1Y A;  1K61 A;  4A3K J;  3E7L A;  2IBD A;  1SAN A;  2NVT J;  2M9H A;  2DMN A;  4W1U A;  3JR9 A;  4A3D J;  3FK7 A;  2VPR A;  1WPK A;  2DJN A;  3BR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...