4LB6B

Crystal structure of pkz zalpha in complex with ds(cg)6 (tetragonal form)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
ENEIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDNKRPVWNLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase containing Z-DNA binding domains
publication title Structural basis for Z-DNA binding and stabilization by the zebrafish Z-DNA dependent protein kinase PKZ.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase/dna
total genus 20
structure length 63
sequence length 63
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lb6B00
3BJOA 3I59A 3KP3A 3IWZA 2W25A 1O3TA 3FM5A 3FMRA 4P9UA 2P5KA 4OU0A 3KP4A 3F6VA 2HQRA 5ILVA 3GW2A 3KP2A 3AAFA 2EA2A 4UVAA 1IN6A 5K1YA 1JHHA 2JZYA 3F8FA 4FX0A 2CWEA 1HSJA 3VOEA 4HLXA 3E5XA 4EMSA 1U2WA 2DI3A 4MQ9F 1FT9A 4PGGA 2HOEA 3BPVA 5KVRA 4Y17A 2M5WA 2EJRA 3RKYA 3SZTA 5BPIA 1XGMA 1RUOA 2EA4A 2FBIA 4LG0B 3RKXA 2ZJ2A 2FMLA 4BHBA 4IRHA 1QO0D 3BJAA 4BXUA 1T39A 3TO6A 1FWZA 1J2XA 1EH8A 1LDJA 3BROA 5ED4A 4ZZLA 2FNAA 4ASNA 1KU9A 1S8NA 3L09A 2J5OA 4WXHA 4NHJA 3GFIA 1D8JA 1ZH5A 5A2QK 2DPUA 3WTUC 1BM9A 2DQLA 4MEXF 3H3ZA 1FBUA 5CLSA 1UHMA 3O6BB 1IRFA 3EETA 3M8FA 4A0YA 4KA4A 2JRTA 4KMUX 3IWFA 2BYVE 4A6EA 2M30A 2DBBA 1G4DA 2DQRA 3KZZA 2OQRA 1FYKA 4EJVA 1BI0A 2IT0A 4LMYA 2J5PA 4M9ZA 4EV0A 4BQAA 3L00A 2BV6A 3I53A 1IRGA 2VT2A 2G7UA 3I64A 3QPHA 4HLYA 1MD0A 2FBKA 4RAZA 3N4MA 2AXLA 3H92A 1IN5A 4U0YA 4HV6A 3VFZA 5LRRA 4HQEA 4HQMA 5D4RA 1LJ9A 3ZMUA 5TRDA 4CHUA 4U0WA 4CYDA 1W5SA 1T2KA 2PBIA 2DT5A 5E8IA 4K2EA 4PGHA 4L0YB 3F22A 4ETSA 1ON2A 3WTXC 1XDUA 1FOKA 3LA7A 2QBYB 4ZH4F 3SXYA 3Q5FA 4CO8A 5H20A 4IRIA 4G7OF 2W57A 1O3SA 1IN7A 1K78B 2XHKA 1T98A 4UHTA 2GXGA 1IXRC 2L54A 2Y0MA 1UHWA 2V79A 5D8KB 1ULYA 3LFKA 4ON0A 4ZZDA 3F8MA 1DPUA 2F2EA 5ILUA 3FXQA 2G9WA 5E1WA 1F4KA 4UUVA 2LNBA 1UCRA 1FPQA 5JR3A 1G3WA 5CJ9A 5FLXK 2ESHA 1PUEE 1D5VA 2PI0A 2V1UA 5KK1A 1JXSA 2XGXA 2R3SA 1KYZA 2JPCA 1XGSA 1B59A 2ZFWA 1W7PB 3K2ZA 2FNPA 1P92A 2ZMEB 2HFHA 2PFBA 1L3LA 3G73A 5HLHA 5ICCA 1Z1DA 2HZTA 5A2QZ 4F7ZA 3R60A 3D0SA 4LLGF 2FXAA 2RV8A 4RB0A 2CSOA 4RB2C 3IC7A 5D8LB 3HHGA 2A5YB 2COMA 2VXZA 3QAHA 2JSCA 3DV8A 5DEQA 2QQBA 4EJOA 1C0WA 4O3MA 4XSXF 5CVRA 2IVMA 2STTA 2O03A 3U9GA 4EM2A 2HR3A 3F23A 5F64A 4ZYDA 3KZYA 4CICA 1DP7P 3KE2A 1IW7F 4Q4ZF 3DFGA 3GUDA 1SD4A 1B1BA 2LF7A 1I5ZA 1Z6RA 1S29A 1B6AA 5BS6A 4IHTA 4G9YA 2KJCA 5CYVA 1IXSB 3KLOA 2FSWA 1QZZA 1ZAOA 1MDMA 2GWRA 4L5IA 3U1DA 4FHTA 4AD9A 2JT1A 4Q5SF 5BQTA 5E1XA 3FXUA 1I1SA 3HSRA 3WU1B 1MZBA 2IPQX 1LVAA 5JFRA 4LLLA 2HGCA 4BYYA 1F9NA 1TBXA 2QENA 4HDUA 3CLOA 2VBZA 3QP6A 4M73A 3ZMTA 3LA3A 4OMZA 4OINF 1U3EM 2L4AA 3TOBA 3KEOA 4EM0B 2HYFA 2UZKA 5FLXZ 1FX7A 1RIOH 1U6GA 3B73A 3LSTA 2F5DA 4LJZF 2NYXA 4MTEA 4G7ZF 4HV5A 3IKVA 3CO7C 3R0JA 1LDKB 2M87A 4RGRA 2PMHA 2NNNA 2GAUA 4JBAA 3JSPA 1FSHA 3FM3A 1FSEA 4S05A 2HWVA 3WGGA 3JSOA 3QRFF 1XSXA 5CVVA 1J59A 2K7LA 4AIJA 5HDNA 3RTRA 3P7NA 2EV0A 2P4WA 4L9VA 2QVOA 1E17A 1XMAA 3GEZA 3WTVC 1YYVA 4I01A 4TV7A 4MTDA 4PZJA 2QUFA 4Y15A 5FFZA 3B02A 5ILSA 1R7JA 1H9GA 4HZFA 3GXOA 4UXNA 3D5LA 4MQVA 3GFLA 3E5QA 4CDGA 2DO7A 4U7BA 4QLCU 3I58A 3IL2A 3K1MA 1TW3A 3E3VA 2HTSA 1W7PD 4RB1A 1VTNC 1WWXA 2O61A 2PMUA 2JTVA 2D45A 5D6FA 5FD5A 1YW8A 3KP7A 1DDNA 2W85A 1BIAA 4WXDA 5H6QA 3JTHA 4EM1A 1R22A 4LFUA 1SFXA 3GWZA 5ICGA 3BP8A 2FEZA 2DLLA 3ZMZA 3DPTA 1R58A 3K0LA 2EV6A 2VOPA 3NQOA 4N0BA 1ZG1A 1CF7B 4BNCA 3HOSA 1ZYRF 3DF8A 3CUQB 1MJ9A 5TJJA 1PDNC 5L3BA 3CUQC 3ULQB 1HKSA 3QU3A 1EH7A 4IHSA 3CUOA 2K4BA 2IA0A 5CVJA 1IUYA 1YTYA 1YG2A 1B4AA 3WODF 4A0ZA 5HDGA 3T0YA 3U2RA 2Q8KA 2HKXA 2K4JA 4UVBA 2NRAC 1RI7A 1KQ9A 3S2WA 2FMYA 2VONA 2P7CB 1KU7A 2Z5UA 4M9XA 2KIUA 4A6DA 2L3DA 3J7AO 3C18A 3SFZA 1LEBA 1R00A 3GFJA 2A61A 1TNTA 4GGGA 4GO1A 1ZRDA 2FBHA 2GA2A 2HS5A 1USTA 3TO9A 1V3FA 3KP5A 3GVAA 4R79A 2O0YA 2DTRA 4GYGA 4EVIA 1G6NA 1OR7A 4ESBA 2GIVA 3M8EA 4IRGA 1QPMA 1TNSA 1KU3A 2XAFA 4HX7A 2W84A 4L5JA 4OIRF 2KIFA 2VBXA 4AVPA 5K5OA 3FMQA 3F3XA 1HW5A 1KGSA 4M74A 4KNYA 3TKYA 1ON1A 4HYEA 5AIPA 3MEXA 3BPXA 2CYYA 1HW1A 4GXOA 2IW5A 1TTYA 2EFOA 4O5VA 4YG2F 3RYPA 4I98B 1ZLJA 1E2XA 1BC8C 3J80K 1W4MA 3KEQA 3DPLC 1R5HA 4ENKA 1TQPA 2XRNA 5BOXA 4WXCA 4M6XA 4A0XA 1R1TA 1T0FA 3RYRA 1G3SA 1P6RA 4U88A 2M8EA 3ZMVA 2FOKA 2D1HA 2H6BA 3HTUA 3MQ0A 4E70A 4A5MA 1U5TB 1TLHB 5FGMA 3R4KA 5CVUA 1ZGAA 3E6CC 3L2CA 2IP2A 4M6YA 4LG0A 2YSRA 2GZWA 3BZ6A 4U0VA 3K69A 3VEPA 3ZN1A 1ZARA 2ZBKA 3W6KB 2CFXA 2BGCA 3K1NA 3M7GA 2VN2A 2OA4A 1FP2A 5HLGA 2RGVA 1R5GA 1XCBA 2MA3A 4YFXF 2EV5A 3ELKA 3ECHA 3L7WA 3FWEA 3ROUA 3WU0A 2P7VB 2OU2A 4IPAA 1R36A 2HKOA 1T38A 1J0RA 2DK8A 4A12A 1D3YA 2ISZA 3TQNA 3WTTC 3KETA 1MGTA 2Z9OA 3IRQA 2IA2A 3P9CA 1IZ1A 2PJPA 1IN8A 3COAC 1REPC 3I4PA 2DW4A 3EUHA 2G7HA 1SD6A 1Z91A 2EB7A 2ZKZA 5D5UB 3HTSB 4KICA 4HW0A 3WG9A 2TDXA 2RC4A 2RKHA 1ZRFA 2GXBA 1FZPB 1BBYA 2QQAA 2CG4A 2XIGA 1KA8A 4RGXA 4M71A 2VOOA 4YFKF 2UXNA 1STZA 1FNNA 2MH9A 4LGWA 3VODA 3E6DA 1ZG5A 2C6YA 2LSOA 3NEUA 4DNCA 5HOOA 3JTGA 1JHFA 3EYYA 4EJTA 3P9IA 1YS7A 2QBYA 2HEOA 3F6OA 1XGNA 3V8LA 1BN5A 4GCVA 1HXDA 4H0EA 4I0BA 4ENJA 2CW0F 1U8RA 1K78A 2H27A 2VODA 2V1XA 3ZN0A 2NS0A 3V8KA 4Z2YA 3HOTA 3BDDA 1XD7A 2Z3YA 4EJWA 3H3UA 1SMTA 3MFKA 5LGNA 1YW7A 2FF4A 5D5WB 4P9FA 4OIOF 5H6RA 1ODDA 1WRJA 3HUGA 3HRMA 4EQQA 5J8CA 2V1DA 3MCZA 1I1GA 1FP1D 3K1PA 2RDPA 2K02A 1H0MA 1W7PA 5D4SA 5E18F 2WV0A 1R23A 3O2PE 4N9IA 1QGPA 2ZMEA 1XCVA 1SMYF 1V4RA 1FY7A 1YLFA 3SQNA 3N97A 4I7HA 3GLXA 3RPQA 2E1CA 2ZNYA 5DYMA 1Y0UA 1S6LA 2EFPA 1H9TA 2BBYA 3RJPA 2XAHA 2XROA 1GXQA 1U78A 4M9SA 3V8JA 3KCCA 3OOPA 2ZNZA 3BY6A 2FA5A 3I54A 4LK0F 3HIFA 2FU4A 1TQIA 3BWGA 1F1ZA 3KLNA 2DU9A 4WF2A 1ZN2A 3ERED 4OOIA 4L9JA 1NHAA 1AOYA 3HSEA 3T8RA 4A5NA 2FQ3A 4L9TA 1LNWA 5J8FA 3HSFA 4LB6B 3R0AA 2UXXA 4A2UA 2X4HA 3RI4A 3LWFA 4XBFA 1ZHFA 2P5LC 4YIFA 1P4AA 1R1UA 5CVIA 3J81K 3GFMA 3WE3A 3QPTA 3RPUA 4LB5A 3GZ5A 2Y75A 5LHHA 2R7DA 1QQIA 2KKOA 1ZRCA 1SFEA 2E1NA 2WWYA 1SD7A 2XV4S 1OPCA 3HRUA 4UVCA 3RKWA 3GO5A 3FZVA 2CGPA 4G6QA 5HS7A 1HSTA 5DCMB 2BEOA 4XSZF 4HF0A 3I0TA 2MH2A 1I6XA 3SHFA 1RNLA 4NQWA 3ZP5A 2H09A 5EEGA 1O3RA 2STWA 5AONA 4ENNA 2E7XA 2IRFG 4HX8A 1P4XA 1BIBA 4L0ZB 1LDDA 4I02A 5BPDA 3GX4X 3KFWX 1XB4A 3ZMSA 2WTEA 4XLPF 3L9FA 3OV8A 3F21A 4G7HF 4I09A 1BI1A 4RGUA 3I59B 1XN7A 3WGIA 3CO6C 3EQLF 1QBJA 1MJBA 4KYWA 1ZGJA 3IHUA 4L9NA 5ERIA 3T8TA 2MD5A 2MBFA 3WTWC 1OYYA 1BOAA 2VE8A 5DUIA 3KP6A 4HOBA 1EH6A 3ZPLA 2M1BA 1D8KA 3IRRA 3ECOA 1K7AA 3DP7A 1YW9A 4YIIA 5HDKA 3IKTA 2KIMA 4XRFA 4EGZA 2GA1A 4WCGA 2A68F 3E6BA 3M1EA 3BOQA 4RB3C 1GVJA 2K27A 3TGNA 1FYMA 5DD8A 1AWCA 2DPDA 1LEAA 2FRHA 2XKOA 1Z05A 5LRSA 2UWMA 2LKPA 2YR2A 3ABUA 1RZ4A 3MWMA 4G8XA 5JI6A 5ICEA 1J75A 4R1HA 4I0AA 2ZXJA 5L3DA 1MKMA 4OIPF 3MZHA 3I5UA 2K86A 1FC3A 2Z33A 4S04A 3J81Z 5F1RA 3FHZA 3TO7A 1ZG3A 3ZQ7A 3F8BA 5HS9A 2KJBA 4CXFA 4JK1X 2MC3A 2ZCWA 1J5YA 3K9TA 3GF2A 3V4GA 4IF4A 3F72A 4Q48A 4U7DA 1BI2A 4NB5A 1CF7A 5D6EA 3F8CA 2P8TA 3CUQA 2A3SA 3E97A 5DUKA 1SD5A 1K6OA 4UV9A 2O3FA 4DQ2A 4KDPA 1K79A 2X0LA 5DD4A 5LEJA 5HVQC 2A07F 2IJLA 5DDGA 2QLZA 4ZYHA 5IT9K 1TW2A 2W24A 4IXAA 3RDIA 4GYIA 3V7RA 3JAMK 2KRFA 3E5UA 4RS8A 4JQFA 1OMIA 1T6SA 2E7WA 1TQMA 3MZYA 1I27A 4OMYA 1UFMA 2VC1A 1LB2A 1O3QA 3O3KA 3R61A 5AIQA 4PCQA 2MLGA 2B0LA 4KIBA 4ZYGA 2ESNA 4R8HA 4HAMA 1U5TC 4CZZA 2O6GE 4HF2A 3C7JA 5F6FA 4P55A 1DUXC 1P4WA 3LA2A 2RNJA 4P5OA 3M9AA 5J6XA 3DEUA 3DXJF 1W5TA 1P2FA 2VT3A 4P96A 5K5RA 3ZMDA 1QNTA 2VBWA 2QYOA 1X3UA 4ESFA 4EJUA 1PP7U 1LQ1A 2XAJA 5BMZA 1S7OA 1BI3A 1R1VA 5EEHA 4KN7X 3EYIA 2OD5A 2Z99A 1WQ2A 4UV8A 1BJAA 3QOPA 2Q2EA 2XAQA 4Y13A 3CJNA 2AS5F 5LGUA 1WI9A 3LAPA 1EV7A 2D1VA 3V7SA 2A6HF 1S3JA 3EDPA 5LHIA 4YFNF 4AWXB 2R7FA 3BJ6A 2QQ9A 1DPRA 2RQPA 5IT3A 3T5XA 6PAXA 1U5TA 4LD5A 2ETHA 3GYHX 2P6SA 1WSUA 4O6JA 2DFIA 1FBSA 2ELHA 1XDSA 1J9IA 3FMSA 2HYGD 4KIGA 1YQAA 2LDUA 5DCFA 3SZPA 2PN6A 5E1ZB 3V7CA 1PP8F 4D0PA 3WE2A 2EFNA 3WTYC 4WX9A 1F5TA 4BHCA 3HRSA 3JW4A 1IF1A 4KT5C 2H94A 5DV5A 1MDMB 4KN4X 5IT9Z 3QP5A 2F5FA 3FF5A 3C1DA 3J80Z 4B8XA 3T1BA 2PLYA 3JAMZ 1YFHA 4FX4A 5HS8A 4MHGA 1OKRA 1KQ0A 1RUNA 1ZREA 1IAWA 1IN4A 1XSVA 3WGHA 1HQCA 3WTSC 3RIRA 4B09A 1KU2A 5FB2A 5JVTA 3HRTA 5L3GA 5E17F 4KMFA 2PEXA 2L01A 3FX3A 3R6SA 1WKMA 2ACJA 2F5EA 4LK1F 2YX4A 1YIOA 5LEKA 4G94A 1L0OC 2XASA 5L3FA 3DKWA 1Z9CA 4PDKA 1XGOA 3LQRA 1J7KA 1JE8A 3LAJA 2OZUA 2XAGA 5FFXA 2EWNA 2OAZA 2EK5A 5K5QA 4M72A 2LF8A 4Q47A 1MJAA 2RN7A 2OZ6A 4BAYA 1O57A 3F8NA 2OQGA 4OIQF 3DQVC 3MAJA 5FO5A 1GHCA 2O8XA 2NAZA 3E6MA 3PFIA 5FD6A 3W6JB 1YS6A 3Q9VA 1JGSA 4HX4A 2XKPA 1HKQA 2HDCA 1Q1HA 1S7AA 1KQ8A 4RAYA 4I2OA 1BC7C 3P9KA 4BHPA 3Q9SA 1G3YA 2FE3A 2H6CA 1SAXA 2A6EF 4XLNF 2D2WA 4EGYA 4ENMA 3WTZA 1CGPA 2WC2A 2V9VA 2EFWA 1ZLKA 2XUBA 4AIKA 1KYWA 5ICFA 3TDZC 4MGRA 1UB9A 1XSDA 1O7LA 4MEYF 3PQJA 5LHGA 2PQ8A 3ABTA 3CDHA 1O7FA 4KUMA 2Y48A 2BE5F 3C3WA 1B9MA 4AIHA 2MLKA 2V6CA 3TDUC 1OYIA 3VB2A 2HTJA 1A04A 1FLIA 3PQKA 4WWCA 5LGTA 3QU6A 5D5XB 4G6DA 1HBXG 2DK5A 2JPBA 5JHUA 5E8GA 2IA1A 2CQKA 1G3TA 2ADUA 4UNOA 2GQQA 1HKTA 2VBYA 5L3EA 2P6TA 5LBQA 4QWQA 1Z7UA 3HHHA 4CGZA 3HYIA 3LQQA 2A69F 1QZYA 2L4MA 2P5VA 3I71A 2ZO4A 5E20A 4HBLA 2F5CA 4IVNA 4KIFA 4LLNA 1SFUA 1B9NA 2VC0A 5LLQA 3REOA 2HQNA 3ISPA 4BH9A 1IXCA 2XVCA 2Q0OA 2DAOA 2YU3A 2QWWA 4HF1A 1XMKA 4MNUA 1USSA 5HLIA 4FT8A 5L3CA 1GXPA 1OYWA 1ONVA 2QM3A 5DCMA 3G3ZA 4WK8F 1Z6TA 3ML6A 1YO5C 1FBQA 3CTAA 2EFQA 5D5VB 1HW2A 4ESJA 4ZYEA 3FXRA 4KFCA 2ISYA 2M45A 3TOAA 4N9HA 1FYLA 2L02A 2OBPA 3GZ6A 4HA8A 2YX7A 3NRVA 2QZ8A 2RVCA 4IJAA 2CO5A 2PG4A 2YPRA 4L18B 2NNYA 2VE9A 4HDVA 4RGSA
chains in the Genus database with same CATH superfamily
3BJOA 2YUSA 3ASOH 2IS2A 3I59A 5EGOA 3KP3A 3A01A 3E7LA 3IWZA 2N8GA 2W25A 1O3TA 1CQTA 3FM5A 3Q0UA 2EZKA 3FMRA 3W3CA 1TWGJ 4P9UA 2P5KA 4OU0A 2VB6A 3KP4A 3BR5A 2DT7B 2F5VA 3F6VA 2HQRA 5ILVA 3GW2A 3KP2A 3AAFA 2KRCA 2EA2A 4UVAA 3HOYJ 3C2BA 3OR1C 3D1NI 1IN6A 5K1YA 1JHHA 2JZYA 3F8FA 2CRGA 4FE7A 2CWEA 1HSJA 4FX0A 3WG7H 1YJWI 2V9PA 4CCLA 1ZR4A 3VOEA 4Y52J 1ETVA 4HLXA 3E5XA 4EMSA 1U2WA 2DI3A 4MQ9F 1ZKGA 4E7JA 1FT9A 1Z3YA 3NWTA 4PGGA 3JRDA 4NUBA 2HOEA 3BPVA 5KVRA 4Y17A 2M5WA 2EJRA 4DZPA 3RKYA 3SZTA 3EPZA 5BPIA 3A03A 1XGMA 3JRIA 1RUOA 2LBFB 2EA4A 4F92B 2FBIA 4LG0B 3RKXA 2ZJ2A 2CUZA 5C4XJ 2L7MP 2HQ5A 2FMLA 4BHBA 1XMXA 2XF5A 4DJAA 3C2GA 1QRYA 4IRHA 1QO0D 2H1LA 2DXIA 3VWBA 2DFHA 3BJAA 3GZNB 2JK3A 4BXUA 1JJ6C 1X1AA 3PL8A 1T39A 1TWFJ 3TO6A 2ZJRF 1HDDC 1QHGA 1FWZA 3PNVA 1J2XA 1EH8A 3G2BA 1BW6A 1LDJA 3BROA 4N4NB 5ED4A 4ZZLA 2FNAA 1Q1VA 4ASNA 1KU9A 1S8NA 4BBSJ 3I9V2 3L09A 4HSTA 3BTCA 2J5OA 2L9SA 2X6OA 1MIJA 4WXHA 2X1CA 4NHJA 3LSJA 3GFIA 1D8JA 1ZH5A 5A2QK 2DPUA 1FIAA 2DA3A 3WTUC 2MSYA 5FKLA 1FTTA 1BM9A 1VF9A 2ICWG 4CYCB 2DQLA 4MEXF 5IPAA 5B3SH 2VJ4A 5IYCJ 3H3ZA 1FBUA 5CLSA 3S16J 4RM2A 3OYLA 2JUGA 1UHMA 2FUG2 3O6BB 3SYTA 4UUSB 2XF6A 1IRFA 3EETA 3M8FA 4CH7A 1OCPA 4A0YA 3OIPA 4KA4A 2JRTA 3G4SI 4KMUX 2CS3A 3S15J 2XGDA 3IWFA 2BYVE 4A6EA 3G1MA 2M30A 4XLHA 2DBBA 1G4DA 1D0YA 2DQRA 3W2AA 3KZZA 2OQRA 1FYKA 4EJVA 1BI0A 2IT0A 3JRBA 4LMYA 2J5PA 4M9ZA 4EV0A 4BS9A 4BQAA 2RQQA 3L00A 2BV6A 3I53A 4XL9A 3OYCA 4PJLA 1IRGA 3CJQB 2VXDA 2R7SA 2VT2A 3BG6A 2G7UA 3I64A 2LYCA 4YELA 3QPHA 4PFPA 2LY1A 1KZHA 4HLYA 2E1MC 1MD0A 2FBKA 2DODA 4RAZA 1VQ8I 3N4MA 2AXLA 3H92A 1IN5A 2KZVA 3OYGA 3RQIA 2LLKA 1FTZA 3OS1A 2M2EA 4U0YA 4HV6A 2X1DA 3VFZA 2V4JC 5LRRA 4HQEA 4HQMA 4HSRA 5D4RA 1LJ9A 3ZMUA 5TRDA 4CHUA 5LD2C 3FK6A 4U0WA 2LR8A 4CYDA 5JHFA 1W5SA 1T2KA 4L5EA 1MBKA 3KEYA 1Y8QB 2PBIA 2DT5A 5IP6A 5E8IA 1BR4A 1BR2A 2RAEA 4K2EA 4PGHA 4BQOA 4L0YB 3F22A 2DJIA 4ETSA 1ON2A 2VJ5A 3WTXC 1XDUA 1FOKA 3IV5A 1LFPA 3LA7A 3GTLJ 4AYBN 2W4SA 3BR6A 4J19A 2WY7Q 2QBYB 2VQCA 4F3QA 4ZH4F 2X6YA 4B4CA 3CMEI 4C2UA 2KRHA 3SXYA 4RBOA 3Q5FA 4CO8A 5H20A 3LNQA 4IRIA 1VFCA 4G7OF 2W57A 2VL8A 3FISA 5M3FJ 4A3IJ 3DKXA 1V54H 2BW3B 4V2GA 1O3SA 1ZR2A 1IN7A 2VKVA 1K78B 2R5YB 2XHKA 1T98A 4UHTA 2H8RA 2GXGA 2GLOA 1IXRC 4X1EA 1X1BA 2L54A 1DP3A 2Y0MA 1UHWA 1IG7A 2V79A 3VPRA 2Z16A 5D8KB 4XK4A 1ULYA 2H8WA 3LFKA 4ON0A 4ZZDA 3F8MA 1DPUA 2F2EA 2B7EA 1YRNB 5ILUA 3FXQA 2G9WA 1X3ZB 4XLEA 1VQNI 3CMAI 5E1WA 2QKMB 2XPUA 3HOUJ 1BL0A 1F4KA 4UUVA 2LNBA 3CP8A 3J7ZI 1UCRA 2BY1A 1FPQA 5F04A 1LE8A 3LSGA 5M5XJ 5JR3A 1G3WA 3HUGB 5CJ9A 5FLXK 2ESHA 2KPMA 1PUEE 2E35A 3S17J 1LUJB 1D5VA 2B63J 1NG6A 1X4PA 1KONA 2PI0A 2E19A 2V1UA 5KK1A 1JXSA 2XGXA 4DGWB 2BY2A 2R93J 2R3SA 1YHQI 1KYZA 3HXLA 1TWCJ 2R7RA 4A3DJ 1JTXA 2JPCA 4HG2A 1XGSA 1B59A 2JJ7A 2ZFWA 1W7PB 3BG3A 2K9SA 3K2ZA 5J1YA 2FNPA 1P92A 2ZMEB 2HFHA 2PFBA 1L3LA 3G73A 5HLHA 4B48A 5ICCA 1Z1DA 2R7WA 2KLOA 3F0CA 2HZTA 3Q3SA 5A2QZ 2MC4A 4LITA 4F7ZA 3IUOA 3R60A 4XOTA 2R0QC 3A4CA 3DEEA 5CPRB 4BXFA 3D0SA 2VASA 1QA6A 4LLGF 2Z1DA 2FXAA 3SFIA 1D1AA 2BXZA 2LFBA 1NK2P 2RV8A 3IAM2 4RB0A 2CSOA 4B3XA 4RB2C 1RC9A 3HC7A 3IC7A 5D8LB 5E3LA 1D1CA 2V26A 3HHGA 4RAGA 2A5YB 2COMA 2VXZA 3QAHA 2JSCA 3DV8A 5DEQA 2K9NA 2QQBA 5M5WJ 4EJOA 2WBMA 4BACA 3K70C 1C0WA 1QVTA 2IGMA 2NS7A 4O3MA 4XSXF 2L7FP 5CVRA 2IVMA 2H1KA 3AL0B 4E7HA 2STTA 4C9YA 3HOXJ 2O03A 3U9GA 2E2JJ 3H5AA 3GMEA 3CF5F 1OCZH 2QGUA 4C3HJ 4EM2A 2HR3A 2JUCA 3AL0C 4XOPA 3ERMA 1WCMJ 3N05A 3F23A 5F64A 1WHUA 2IGOA 4PSWA 4AYBA 5EF6A 4ZYDA 2DMPA 3KZYA 4CICA 4IHWA 2LY9A 4XLCA 1DP7P 2MABA 2CQNA 4NC8A 4IHXA 1JKQC 5HODA 3RSNA 3KE2A 1IW7F 1MBHA 4XKWA 3DFGA 4Q4ZF 3GUDA 2DT6A 5J1UA 1SD4A 1E0EA 1B1BA 2LF7A 1RR8C 1I5ZA 1Z6RA 3SZGA 1S29A 2VKEA 1B6AA 3OL4A 5BS6A 3QYFA 2JSPA 2PJRB 4IHTA 4G9YA 2GOXB 4A3MJ 2IS4A 4PUSA 2KJCA 2VIXA 2WY8Q 5CYVA 4NNJA 1YX3A 1IXSB 3KLOA 4F91B 2FSWA 2I5UA 1QZZA 2PMZN 4FISA 1ZAOA 1LFUP 1SFKA 2BHZA 2NVQJ 1MDMA 1OCRH 1V5GA 2E60A 2GWRA 4L5IA 1UHSA 4DW6A 3U1DA 5IOZA 4FHTA 4AD9A 2M0CA 1R49A 4MO7A 3MVPA 2JT1A 4BE1A 4Q5SF 5BQTA 5E1XA 1NK3P 3ZQHA 2VKHA 2WV1A 3FXUA 1I1SA 3HSRA 3WU1B 1MZBA 2GOMA 2IPQX 2W82A 2EILH 1LVAA 5JFRA 4LLLA 1S9HA 2HGCA 4NQWB 4BYYA 1A6IA 1F9NA 2V7FA 1TBXA 2QENA 4CCMA 4HDUA 1I6HJ 3CLOA 4BE0A 2VBZA 4Z6YA 3K4CA 3LL7A 3KIOA 1UJ8A 4DBRA 2MGQA 2ZFUA 2NVUB 3QP6A 4M73A 3ZMTA 3LA3A 3WU2C 4F52A 4OMZA 4OINF 1U3EM 1WGXA 5B66C 1N77A 3ZQGA 2X51A 2L4AA 1NH3A 5FKMA 3TOBA 2KHMA 3KEOA 1BW5A 2K9MA 4EM0B 4D1QA 2NOGA 3GBGA 2HYFA 3MD2A 2ZSIB 2UZKA 4AC0A 5FLXZ 1FX7A 1RIOH 4FASD 1U6GA 2UUZA 3B73A 5IOYA 3LSTA 1ZQ3P 2F5DA 1Z7LA 2FD5A 5BNGA 2KMUA 2ELJA 4BKXA 1H8AC 3OYKA 2LK2A 4LJZF 2NYXA 4MTEA 4G7ZF 1ERDA 4HV5A 2ZJQF 3IKVA 2NS8A 3CO7C 2R7XA 5FLVA 2DYSH 3PUFA 1JKPC 3R0JA 1I3AA 5EEAA 1LDKB 1RR7A 2M87A 3ZXSA 4RGRA 2PJRA 2PMHA 2NNNA 3L2VA 2GAUA 4JBAA 3JSPA 1OQYA 1FSHA 3FM3A 3MKWB 1FSEA 3ZCOA 4YIRX 2M0MA 4S05A 2HWVA 3WGGA 3JSOA 1VQ6I 3QRFF 3VYSB 1XSXA 3G71I 2Y30A 5CVVA 1J59A 2K7LA 4AIJA 2DFFA 5HDNA 2MYSA 3RTRA 5FRNA 3P7NA 2EV0A 5DM6F 4C2MJ 1W36C 2P4WA 2HXIA 4KJZA 4L9VA 4PJJA 3JR9A 2QVOA 2I10A 1E17A 4D7NA 1XMAA 3FK7A 3GEZA 3WTVC 1YYVA 4I01A 4TV7A 3DPUA 4HRIA 2I8DA 4B47A 4MTDA 3CCJI 3E0JB 5GPAA 4PZJA 1R9TJ 4JX6A 2QUFA 4CUGA 4Y15A 5FFZA 2LH9A 3B02A 1R7JA 5ILSA 5JVGF 1H9GA 4HZFA 2R7TA 4IQJA 1X1DA 3GXOA 4UXNA 3D5LA 4MQVA 2WAFA 3PSIA 3GFLA 2DMUA 2BOLA 2PMZA 3E5QA 1TC3C 4CDGA 2DO7A 4U7BA 3OIOA 2NVTJ 4QLCU 3I58A 3IL2A 3K1MA 2R5ZB 1HLVA 1TW3A 3E3VA 2HTSA 1W7PD 2CV1A 4RB1A 4IOAF 1FOWA 2CUEA 1VTNC 2KZGA 2F6CA 1FOYA 1WWXA 3PSFA 2O61A 2PMUA 2JTVA 3I55I 5CQEA 2D45A 5D6FA 5J4VA 5FD5A 1YW8A 2D5VA 5K7ZA 1UMQA 3KP7A 4D5CA 2IXSA 5M3MJ 1DDNA 2DDBA 2Q1ZB 2W85A 2BXYA 2HOSA 4XONA 1BIAA 4WXDA 5H6QA 3JTHA 4BJTA 4EM1A 4HNVA 1IDYA 4BDYA 4AIDA 9ANTA 1R22A 1UELB 1UG0A 4LFUA 1MSFC 2ME6A 4QSHA 1SFXA 3GWZA 5ICGA 3H36A 3ZQLA 2M3AA 3BP8A 4JP0A 2FEZA 2DLLA 3ZMZA 3DPTA 2OTJI 3K70D 2FX0A 3L2RA 3H5NA 3RZOJ 3HOZJ 1VQ5I 1R58A 3K4KA 5FKKA 1OR7C 3K0LA 2EV6A 4YRVA 2VOPA 3KYLA 1BR1A 3NQOA 4N0BA 1JKOC 5C44J 1ZG1A 1CF7B 4BNCA 3G1OA 3HOSA 1ZYRF 4XKCA 3DF8A 5F0CA 3CUQB 1MJ9A 5TJJA 1PDNC 5L3BA 4XRSA 3PFYA 3CUQC 3ULQB 3HGGA 3S14J 2ZB9A 1HKSA 3QU3A 1EH7A 4IHSA 3CUOA 2K4BA 4CSWA 1AHDP 2X6WA 4HEA2 1GVDA 3Q0WA 2IA0A 5CVJA 1MBGA 1XG1A 1IUYA 2XPWA 2KL4A 1Z67A 3GTQJ 5JLWA 3K4LA 1YTYA 4W97A 1YG2A 1B4AA 3CF2A 3WODF 3OR2C 4A0ZA 2O8KA 5HDGA 3T0YA 1AU7A 3U2RA 3G1LA 4DYQA 3CCLI 1Y39A 2A5WA 2Q8KA 2OCCH 4C30A 2HKXA 2WAEA 2K4JA 3NAUA 4UVBA 2NRAC 1RI7A 4HNUA 1Z0XA 1KQ9A 3S2WA 2FMYA 4Y33A 2VONA 3GTOJ 2QSGX 2P7CB 1T0FC 5GP9A 1KU7A 4XLFA 2Z5UA 1B72B 2XSDC 5EG0B 4M9XA 4BUPA 2KIUA 1BJZA 4A6DA 2L3DA 2E5NA 1ZTRA 1IV6A 2F4OB 3B6AA 4IHYA 3J7AO 3C18A 4XKVA 3SFZA 1LEBA 1R00A 1X1PA 3AG3H 3GFJA 3I3LA 2EIMH 3PIOF 2E1OA 2A61A 3OYNA 3KPHA 1TNTA 4GGGA 4GO1A 1ZRDA 2FBHA 2GIZA 3V42A 2GA2A 3I4NJ 5GTIC 2HS5A 1USTA 3TO9A 1V3FA 3OSGA 3KP5A 3GVAA 4R79A 1WPKA 2O0YA 2DTRA 4GYGA 4EVIA 1G6NA 1OR7A 3OYBA 4UUTA 4ESBA 2GIVA 3M8EA 5J4YA 4IRGA 1I3QJ 3RQ4A 4BY1J 3FDYA 1QPMA 1TNSA 4M3BA 1KU3A 2XAFA 4FCYA 4HX7A 4IHVA 2W84A 4L5JA 1WFXA 2MG4A 2KIFA 2VBXA 4OIRF 4AVPA 5K5OA 2NXNB 3FMQA 3F3XA 1HW5A 1JTYA 1KGSA 4M74A 1X3WB 4KNYA 2QSFX 3TKYA 1A5JA 1ON1A 1Y8RB 3HB9A 2MD0A 4HYEA 1P7JA 5K7HA 3FXLA 2DYRH 3MEXA 5AIPA 2KDZA 3BPXA 1HW1A 1NG7A 1Z77A 2CYYA 2HDWA 3KX2A 4GXOA 2M4GA 2IW5A 4M6VA 1TTYA 3S3NA 1PVEA 3U1KA 2EFOA 2EH3A 1MNEA 2E71A 4O5VA 3QPSA 1SC7A 3FIWA 1JT6A 4YG2F 3OYHA 4GDFA 5GADJ 3RYPA 1U8BA 4I98B 2Q2EB 2KIQA 1RETA 1ZLJA 4A3BJ 4FQGA 1E2XA 1BC8C 3CCUI 3J80K 1W4MA 1SVLA 3HBLA 3KEQA 3DPLC 1R5HA 1W36D 4ENKA 2AHQA 1TQPA 2XRNA 5BOXA 4WXCA 4M6XA 4A0XA 3TBIA 1R1TA 1T0FA 1VQKI 3RYRA 1SANA 3EUHC 1G3SA 1P6RA 3BTJA 1VQ7I 4U88A 1T56A 1Y56A 2CH0A 2M8EA 3ZMVA 3J7AY 3BT9A 3CDLA 1YI2I 1B72A 2KDOA 2FOKA 1GUUA 1LPQA 2D1HA 2H6BA 3HTUA 1W0UA 3OWTA 3MQ0A 4OWRB 4E70A 1R71A 1YJ9I 4A5MA 1U5TB 1TLHB 3MMYB 4AU7A 5FGMA 3R4KA 5CVUA 1ZGAA 4E7SA 3L2CA 3E6CC 1HF0A 5J1RA 2IP2A 2CW7A 4M6YA 2LBFA 4LG0A 2YSRA 3CESA 2GZWA 3BZ6A 3FHNA 1WJ5A 1E3OC 4U0VA 3PO2J 3K69A 4CCJA 3VEPA 3ZN1A 1ZARA 1T08B 3BR1A 2ZBKA 4A3CJ 2VQHA 2HOAA 3W6KB 2CFXA 2BGCA 3VDXA 3K1NA 2YU9J 3M7GA 2AO9A 5KNLA 2V1NA 3M8JA 2VN2A 1Y0NA 2OA4A 1FP2A 2QQ8A 5HLGA 2CFOA 1WH5A 2HYJA 2RGVA 1R5GA 4U87A 3ABLH 1XCBA 2MA3A 4YFXF 2EV5A 3ELKA 2HVQA 3FXOA 3ECHA 3L7WA 3FWEA 3ROUA 3WU0A 1EKEA 2ME0A 4F93B 3HGYA 2P7VB 3I4MJ 2OU2A 4IPAA 3H9QA 4PJNA 2R7UA 1R36A 4CYCA 4CCNA 2JA8J 2R7VA 2HKOA 1T38A 1J0RA 2DK8A 4FETA 4A12A 1D3YA 3H5RA 1W0TA 2ISZA 3TQNA 3W2WA 2DOFA 3WTTC 1TT0A 1AA7A 3KETA 4UUSA 1MGTA 2Z9OA 2LD5A 3BQYA 3IRQA 2IA2A 3P9CA 1LKXA 1IZ1A 4M3GA 2PJPA 3SDGA 5K7FA 1IN8A 3L1PA 3CZ6A 1WJBA 1DQUA 3COAC 1REPC 3I4PA 2DW4A 3DTKA 2BVMA 3EUHA 2G7HA 1SD6A 3S2DJ 1VQ9I 1Z91A 2EB7A 4KISA 4II2A 2ZKZA 5J3LA 5D5UB 3OYMA 3OYAA 2VQLA 2DA5A 3HTSB 3BC8A 4KICA 1FEXA 2BY3A 2CJJA 1NTCA 2IGNA 3HZJA 3MKYB 2JQ7A 4HW0A 1VQLI 3WG9A 5KAIC 2HOTA 2TDXA 2RC4A 2RKHA 1MMGA 1ZRFA 1FJLA 1M1EB 1R4NB 1YX5A 3L2QA 2GXBA 1FZPB 2O9LA 1BBYA 3TW6A 3HPHA 1U0JA 2QQAA 2W7NA 3CLQA 2IS6A 2CG4A 3CCYA 1VQMI 2XIGA 2HZDA 1KA8A 4RGXA 1A35A 2CV2A 4M71A 4QIWN 2VOOA 3K4MA 3CCSI 4YFKF 4AM3A 2UXNA 3CD6I 1STZA 4LOCA 1FNNA 3HL2A 2CQ7A 3EUAA 2OV7A 2ZMEC 2MH9A 4LGWA 3VODA 3E6DA 3X2QH 1ZG5A 3DKYA 4DOZA 2LSOA 2C6YA 2CQQA 3NEUA 4DNCA 5HOOA 3JTGA 3BR3A 5FKOA 1JHFA 4DZJA 4CZCA 2DA7A 3EYYA 4EJTA 2L9NA 3DWLE 3P9IA 1YS7A 3FKJA 4IX7A 2HEOA 2QBYA 3F6OA 1XGNA 2RREA 1GV2A 4M3EA 2LVSA 3V8LA 2GM4A 2IEKA 1BN5A 1EJ9A 1V55H 4GCVA 2DN0A 1HXDA 4H0EA 3S93A 4I0BA 4ENJA 1VQOI 4G12A 1JGGA 4Y4RA 2BW3A 3PNYA 2M7AA 4NC6A 2CW0F 3TP0A 1U8RA 1K78A 2H27A 5KAFC 2R5YA 2VODA 2V1XA 5JLXA 1K4TA 4BDZA 4AVZA 3QWLA 3CMMA 4IKFA 3K10A 1X2NA 2NS0A 4II3A 3ZN0A 3V8KA 4Z2YA 3ABKH 3HOTA 3BDDA 1XX5A 3FKIJ 1XD7A 2Z3YA 4EJWA 3H3UA 2V6EA 2LREA 3D5SC 1SMTA 1YRNA 4XM3A 2WADA 3OYEA 3MFKA 5LGNA 1YW7A 2FF4A 1UZCA 4ZYAA 1O4XA 1OCCH 5D5WB 2LMDA 1QU3A 2AQEA 2G0EA 4P9FA 4OIOF 2OCEA 2IS1A 1BOBA 5H6RA 3ZOBA 1ODDA 3OL3A 3OYFA 2XRLA 1WRJA 2EQRA 3HRMA 3HUGA 1E3HA 1MBFA 1ZGWA 4EQQA 2TCTA 1EF4A 3DBRB 1WJCA 2DMQA 5J8CA 1D5YA 2V1DA 3MCZA 1I1GA 5C3EJ 3BCBA 2OTLI 1FP1D 3K1PA 1ORKA 2RDPA 5FLMJ 2K02A 2E2HJ 4XICA 1PUFB 2QSHX 5GAGJ 1IC8A 1H0MA 3LSRA 1W7PA 1ETWA 2Y9ZA 1MBJA 5D4SA 5E18F 2WV0A 4BE2A 1R23A 3O2PE 4N9IA 3M3YJ 1QGPA 2ZMEA 1XCVA 4V19K 2LG4A 1XPXA 1SMYF 1V4RA 1FY7A 1YLFA 3FXKA 3CQZJ 3SQNA 3N97A 4E4HA 4I7HA 2Y31A 5F27A 3GLXA 5B1BH 2ZXHA 3RPQA 3SDBA 4IOCF 4JYKA 4BBRJ 2E1CA 2ZNYA 5DYMA 2EPFA 1Y0UA 1H89C 2JVHA 1S6LA 5DM7F 2EFPA 4QPQA 1H9TA 2BBYA 1GT0C 4YEJA 4KT6A 4I6ZA 3RJPA 2XAHA 2XROA 1W5CC 1GXQA 1U78A 2BY0A 3CJRB 4M9SA 3V8JA 4ZTFA 4B1RA 3GTGJ 3KCCA 3DCFA 3OOPA 3JREA 2ZNZA 3BY6A 2FA5A 2JA2A 2X6XA 3I54A 3HIFA 4LK0F 1B8IB 2FU4A 1Z3XA 2FJ1A 1QVUA 1TWHJ 1TQIA 3AKZA 3BWGA 1MSEC 3A2KA 4ZDOA 1F1ZA 2M7BA 3KLNA 1R5ID 2DU9A 4A69C 4WF2A 1ZN2A 1D0ZA 4OOIA 3ERED 4L9JA 1NHAA 2ELKA 1AOYA 3S3OA 3HSEA 3T8RA 4A5NA 2FQ3A 3CDIA 5IY5H 4L9TA 2HQAA 1YE9A 1LNWA 5J8FA 3HSFA 4LB6B 3R0AA 2JA5J 3K4NA 1T95A 2UXXA 4A2UA 2X4HA 2NVXJ 2VPRA 3RI4A 1TZLA 1VNDA 2IGKA 2P81A 2L7ZA 3LWFA 3FBIB 4XBFA 1ZHFA 2M9HA 2P5LC 4X0GA 4YIFA 1P4AA 1JI8A 1R1UA 4EEFG 5CVIA 1TWAJ 3CCVI 2W1OA 3J81K 3MN2A 3GFMA 4RLQA 3WE3A 4A93J 1ETXA 3QPTA 3RPUA 4LB5A 2X85A 3LFUA 3GZ5A 2Y75A 5LHHA 2R7DA 4C3JJ 2QCOA 1WJEA 3WHCA 3BR0A 1QQIA 2KKOA 3DLLF 2DFEA 1ZRCA 1YIJI 1SFEA 4E7ZA 2EINH 3HM5A 2E1NA 2WWYA 1SD7A 1GLNA 2XV4S 1OPCA 3HRUA 3K7AJ 4UVCA 4XLAA 3RKWA 3UNGC 3GO5A 3I56I 2A6TA 3LSIA 1UAAA 3FZVA 4XR6A 4LIVA 2CGPA 4G6QA 5HS7A 3VSKA 1HSTA 5DCMB 2BEOA 4XSZF 3PNTA 1N25A 2BVLA 4HF0A 3I0TA 4D9JA 2MH2A 3DLAA 1I6XA 3SHFA 1RNLA 4NQWA 3ZP5A 2H09A 2E36A 5EEGA 1O3RA 3HDDA 2STWA 5AONA 4JX5A 4ENNA 2E7XA 2OPTA 3CCQI 3PO3J 2IRFG 4HX8A 3CC4I 1P4XA 5GTHC 4KITB 2XGCA 4PFOA 1BIBA 4L0ZB 1LDDA 5DTDA 4I02A 3SEQA 4B43A 1A36A 1VI0A 1HDPA 2O7OA 3ZRGA 5BPDA 4IO9F 3GX4X 1MMNA 3HKZN 1XB4A 3KFWX 3ZMSA 5J47A 1SVOA 2WTEA 4XLPF 2ZXIA 3L9FA 3OV8A 4ZDLA 4D5FA 3F21A 4E7IA 4G7HF 4MFEA 2M8GX 4IQ4A 4I09A 1BI1A 4RGUA 1G59A 3I59B 3DU6A 5EGOB 3BZKA 1XN7A 3DTIA 2AQFA 3Q0VA 3WGIA 3CO6C 3EQLF 4EATA 1MJBA 1SAUA 1T33A 3OSFA 3S1RJ 1QBJA 4KYWA 1ZGJA 3OS2A 3DBHB 5EZHA 3IHUA 2Y0SN 4L9NA 5ERIA 4I99C 3T8TA 2MD5A 2MBFA 3E1SA 3H35A 3P5JA 4BQQA 4XRSG 3WTWC 3ZQQA 1OYYA 2KISA 3H1CA 1BOAA 4W1UA 2VE8A 5DUIA 3KP6A 4HOBA 1EH6A 2R4GA 3ZQCA 3LOCA 2CU7A 2Y9YA 3ZPLA 2M1BA 2KFDA 3LSHA 1DU6A 1W1WE 1D8KA 3IRRA 3ECOA 1K7AA 2ECCA 1YW9A 3DP7A 1G8XA 3BG9A 4YIIA 5EJCA 5HDKA 3IKTA 2KIMA 2XGEA 4BXXJ 4XRFA 3FXMA 2HVSA 4B44A 1WJFA 4EGZA 2GA1A 3S3MA 3CCEI 3FXJA 4BEHB 4WCGA 3KYDB 2A68F 2DMNA 3JRHA 1ITYA 2JA7J 3SEZA 3E6BA 3M1EA 4XKBA 3ABMH 2L2OA 4C2TA 3EUKL 3BOQA 1MMAA 4ITVA 2P0WA 4RB3C 3G6EI 1GVJA 2BHYA 2K27A 4ZC3A 3CCMI 4OAYA 2VJJA 3OY9A 3TGNA 1FYMA 5DD8A 1VQ4I 2NOJB 1AWCA 3RPUD 1LEAA 2DPDA 2FRHA 2XKOA 4QTRA 5EYRA 2R5ZA 1Z05A 5LRSA 5KHDA 3JRAA 2UWMA 2LKPA 3W2VA 4DIQA 2YR2A 2YS9A 2ECBA 3ABUA 2OC6A 1RZ4A 3MWMA 1ZK8A 4G8XA 3TW7A 5JI6A 2F4IA 3BTLA 3O8GA 3K6GA 5ICEA 1JT0A 5IP7J 4NBQA 1J75A 4R1HA 4I0AA 3HOVJ 5GAHJ 2ZXJA 3O8HA 5L3DA 1MKMA 4OIPF 3S1MJ 3MZHA 3I5UA 2K86A 4DYRA 1FC3A 2Z33A 2XSJC 4S04A 3J81Z 3ZGKA 5F1RA 3FHZA 2IBDA 2ZXWH 2OUMA 2HDDA 2E2IJ 2CMPA 3TO7A 3QYEA 2COBA 1ZG3A 3UKGA 2DA1A 3ZQ7A 3F8BA 5LFAA 2FOWA 5HS9A 2KJBA 4J00A 4CXFA 3H0GJ 4JK1X 4RMNA 2MC3A 2ZCWA 1J5YA 1FMVA 4G6TB 2VKDA 1MMSA 3K9TA 2BZTA 2LTPA 4PJ0C 3GF2A 4PK4A 3V4GA 3HKZA 1ENHA 1GDTA 4IF4A 2WAQN 3F72A 3RCOA 4Q48A 4U7DA 1DGRM 1FMWA 2DTZA 4F55A 1BI2A 1ETQA 4NB5A 1APLC 1ETYA 3ZQIA 3DU5A 1CF7A 5D6EA 1AKHB 4A3LJ 3F8CA 3HEFA 3A0HC 2P8TA 3A0BC 3CUQA 2A3SA 3E97A 1RRJA 5DUKA 4BEHA 1FIPA 2XDVA 2Y0SA 1SD5A 1K6OA 3OIQA 3QPLA 3H0DA 5GPCA 4UV9A 2O3FA 4DQ2A 4KDPA 2WA0A 3L2WA 4DYCA 3OYJA 3AFHA 1K79A 2LP0A 2X0LA 2EZIA 5DD4A 5HNFA 2WB1N 1WZ2A 1K83J 1OFCX 5LEJA 3BG7A 4CCKA 5HVQC 2A07F 1RKWA 2IJLA 5DDGA 2QLZA 4ZYHA 4V2FA 5IT9K 1R6RA 1TW2A 3M1CA 2W24A 4IXAA 3RDIA 4GYIA 1IRXA 3V7RA 4Y3OA 5B1AH 1JUSA 3JAMK 2KRFA 2DA2A 3E5UA 3GTJJ 4RS8A 4JQFA 1OMIA 1T6SA 2E7WA 1TQMA 5GAEJ 3FBNB 3MZYA 1I27A 1VZ0A 4CCOA 4OMYA 2ZJPF 3A02A 1UFMA 4PJMA 4FE4A 1N75A 2X48A 2VC1A 1LB2A 4XIDA 1SVMA 1O3QA 1S7EA 3O3KA 3R61A 5AIQA 4BJ5C 5KCMA 5EG0A 4M3FA 2K40A 4PCQA 1VQPI 4D7MA 1OISA 2MLGA 3DTEA 2B0LA 4KIBA 1F43A 1E3PA 1D0XA 4ZYGA 2ESNA 2B9SA 4R8HA 4HAMA 1U5TC 5FROA 5CQGA 4CZZA 2HPMA 5E3MA 2O6GE 2E1MB 2E5ZA 2JN6A 1LE8B 5EDNA 4HF2A 3C7JA 5F6FA 4NDLA 4P55A 1JJ8C 1DUXC 3MKZA 2R92J 1MNMC 1P4WA 3LA2A 1WI3A 5HLTA 1MH3A 2RNJA 4P5OA 3ZQFA 3M9AA 4Y7NJ 4N4OB 3ONQA 5J6XA 1J09A 3DEUA 3DXJF 2HXOA 3JRCA 1W5TA 2LRDA 1P2FA 2VT3A 1AKHA 5F1JA 4P96A 5K5RA 4CA0A 3F9KA 3ZMDA 1QNTA 2DA4A 2VBWA 2XPVA 3RKQA 2QYOA 1X3UA 1OCTC 4ESFA 4EJUA 1PP7U 3PIPF 3JRGA 2L9RA 2OF7A 3A1YA 1LQ1A 2XAJA 2HU9A 1IJWC 3C2HA 5BMZA 1S7OA 1BI3A 1POGA 1R1VA 5EEHA 4KN7X 3EYIA 2HPIA 3IP4B 5FKNA 3OYDA 4M3DA 1LVKA 1XS9A 4GFBA 2OD5A 2Z99A 1WQ2A 2DCEA 2WAQA 4XNFA 4UV8A 4HPQA 1BJAA 3QOPA 2Q2EA 3MKLA 2XAQA 3GCMA 3IH4A 4Y13A 3CJNA 4QPOA 2ID3A 1PYVA 2VI6A 2AS5F 5LGUA 1WI9A 4RA2A 3LAPA 1EV7A 4A3KJ 2D1VA 3K4BA 3V7SA 2A6HF 4XRMA 1S3JA 2CQXA 4A3EJ 3EDPA 1U9NA 5LHIA 4YFNF 4AWXB 2VLAA 2R7FA 3BJ6A 2QQ9A 1DPRA 2WB1A 2RQPA 5IT3A 1TL8A 3T5XA 6PAXA 1I39A 1U5TA 1WVRA 4LD5A 2ETHA 3GYHX 2P6SA 2MFZA 4UB6C 1WSUA 1PJRA 4O6JA 2DFIA 1FBSA 4I76A 5TISC 4MIMA 1X2MA 2ELHA 5EZGA 1XDSA 3M4OJ 1J9IA 3FMSA 2HYGD 2EIJH 4C3IJ 4KIGA 1IUFA 2LKSA 1YQAA 2LDUA 5DCFA 4XN3A 3SZPA 2PN6A 5E1ZB 3D5RC 3V7CA 3VYTB 1PP8F 4D0PA 1U9OA 2CW8A 3WE2A 1Y1VJ 5E3NA 4B3AA 2EFNA 3WTYC 1YOVB 4OAZA 3CCRI 4WX9A 2LY2A 1OCOH 3ASNH 1F5TA 4BHCA 3HRSA 2CUJA 1TT5B 2DJNA 2L9VA 1WJAA 3JW4A 4RM3A 5E3OA 1IF1A 4KT5C 2H94A 5DV5A 1MBEA 3S1QJ 2KQRA 2K5CA 1MDMB 4KN4X 3LSMA 5IT9Z 2NVYJ 3QP5A 3QOEA 2F5FA 3FF5A 5B5EC 3OS0A 4X6AJ 4E7LA 3CC7I 4GRIA 3C1DA 3J80Z 1Y6IA 4AUXA 4B8XA 3T1BA 2PLYA 1A6QA 3JAMZ 4DBQA 1YFHA 2O5RA 4FX4A 1X1CA 3DBLB 1OLTA 5HS8A 4MHGA 1OKRA 1KQ0A 1HA8A 3S8PA 3KYCB 1RUNA 1ZREA 1IAWA 1IN4A 1XSVA 3WGHA 1HQCA 3L2UA 3H9JA 3WTSC 3W6VA 1WJDA 5FJ8J 3RIRA 4B09A 5HNHA 1KU2A 1QZEA 5FB2A 5JVTA 2TRTA 4PSXA 3S32A 1F36A 1GV5A 3HRTA 5L3GA 5E17F 4KMFA 2PEXA 3NARA 4XN0A 1JKRC 2VPLA 2L01A 1P7IA 3FX3A 3R6SA 1WKMA 1SFOJ 2W00A 2PX9A 2ACJA 2F5EA 3JRFA 4LK1F 2YX4A 2M4KA 3QQAA 2HI3A 1YIOA 1X19A 3PM1A 2EIKH 5LEKA 3BCAA 4G94A 1L0OC 3TMOA 2XASA 5L3FA 3DKWA 3AG4H 1Z9CA 1JUMA 5M5YJ 4PDKA 1XGOA 2JRMA 3LQRA 1A31A 1ZELA 1J7KA 3NWSA 1JE8A 3B6CA 3VSLA 2OZUA 2XAGA 5FFXA 3LAJA 4A3JJ 1RESA 1K61A 2EWNA 1H88C 2OAZA 1N78A 1TP4A 2EK5A 5K5QA 3H9GA 4UB8C 1IO2A 3LMMA 4M72A 3AG1H 4RDUA 4IZZA 3ESWB 2LF8A 4Q47A 4BGDA 1EA3A 2V9KA 4ZTJA 1MJAA 2EBIA 2RN7A 1YITI 2OZ6A 2QF7A 4BAYA 2XB5A 1O57A 3F8NA 3OOUA 3KZIC 3TEDA 2OQGA 1MNDA 4OIQF 3DQVC 3MAJA 5FO5A 5J40A 2VQGA 1GHCA 2O8XA 2NAZA 4JX4A 4IL6C 4JOMA 1XTAA 3GTKJ 3QODA 1MH4A 3E6MA 2F4MB 1DGWY 5IYDJ 2X1EA 3HG9A 3PFIA 1QHHD 3BQZA 5IP9J 5FD6A 3IH3A 4BL0B 3W6JB 3BR2A 1YS6A 3Q9VA 1JGSA 4HX4A 2XB0X 1RPWA 2XKPA 4BY7J 2ZC2A 1HKQA 2HDCA 4NC7A 1Q1HA 1S7AA 1QPIA 1KQ8A 4RAYA 3OYIA 2ID6A 4I2OA 1BC7C 4BU2A 2GBYA 3P9KA 4BHPA 3S2HJ 1K6YA 3Q9SA 1HOMA 1G3YA 2Y2ZA 2FE3A 2H6CA 1MW7A 3TL4X 3OMYA 1T8IA 3HJEA 1FOXA 1SAXA 1RKTA 2A6EF 5DS9A 2M34A 1HC8A 2D2WA 4XLNF 4EGYA 2L7KA 1S5LC 4MFDA 1S72I 3CC2I 4ENMA 2DMTA 1R4MB 1IGNA 3WTZA 1CGPA 3VYUB 2K9QA 2F48A 2WC2A 2V9VA 3PUBA 2EFWA 3CMYA 1ZLKA 2XUBA 2JVGA 2VUMJ 4AIKA 1KYWA 4S0HB 4BQNA 5ICFA 3TDZC 2K3FA 3LSKA 2QEXI 4MGRA 3DEWA 1UB9A 2XAUA 3JCUC 4ZDPA 1XSDA 1O7LA 2L0KA 1JUPA 4MEYF 2K85A 1PUFA 4ANJA 4E6KG 2QA4I 3PQJA 5LHGA 4P1WA 1OJLA 2PQ8A 2RNGA 1XC5A 3ABTA 3K4JA 2CV0A 4RLFA 3CDHA 2W48A 1O7FA 5C4JJ 4KUMA 2Y48A 2BE5F 2KT0A 1B9MA 3C3WA 4AIHA 2OJED 1Y1WJ 2MLKA 2V6CA 4FTHA 3TDUC 1OYIA 3VB2A 1YJNI 2HTJA 1ACIA 2EZLA 5F08A 5F0FA 1A04A 2XF7A 1BA5A 1FLIA 2VJIA 3PQKA 3VYRB 4WWCA 1WH7A 5LGTA 3QU6A 5D5XB 4G6DA 4XMYA 3GTPJ 1HBXG 4RAFA 2DK5A 2JPBA 5E79C 3K2AA 5JHUA 5E8GA 2IA1A 2CQKA 1G3TA 2ADUA 4UNOA 2GQQA 4LIUA 1B8IA 1HKTA 1X58A 2VBYA 5L3EA 2P6TA 1ETOA 3AG2H 1LFBA 2K9LA 5LBQA 3BTIA 2IAIA 3J7YJ 2FQ4A 4QWQA 1Z7UA 5TGTA 4E7KA 2Y69H 3HHHA 3ZR8X 1MMDA 4CGZA 3HYIA 3LQQA 2QKLB 3SJMA 2A69F 1QZYA 2L4MA 2P5VA 3TP3A 3H3VK 3CP2A 3RZDJ 2LOOA 3A01B 3HPGA 2ZO4A 3I71A 5E20A 4HBLA 2F5CA 2LKXA 2MW8A 2GXAA 4IVNA 4KIFA 4LLNA 3IAS2 1SFUA 3QYBA 2EZHA 4ABZA 2HVRA 1V5EA 1B9NA 1K4SA 2K3PA 2VC0A 4XQFA 5LLQA 2HNHA 3REOA 2HQNA 3ISPA 2E34A 3U21A 4J01A 1V5FA 2DOEA 2LC2A 4BH9A 4IEJA 1IXCA 3M07A 5F0HA 1SEUA 2XVCA 5IYBJ 2Q0OA 2DAOA 2YU3A 2QWWA 3WHBA 1IV8A 4HF1A 1XMKA 4MNUA 3MZ8A 1USSA 5HLIA 2CUFA 4FT8A 1D1BA 5FRMA 5L3CA 1GXPA 2R7OA 2A05A 1P9QC 3BLYA 1OYWA 2KP6A 3HOWJ 2JMWA 3LSPA 2JWTA 2Z2SB 1ONVA 2QM3A 5DCMA 2XC7A 3PJRA 3UR3C 2ZSHB 3G3ZA 4WK8F 1G2HA 4XORA 1Z6TA 2AXTC 3ML6A 3GLLA 1Z21A 1YO5C 1FBQA 2L5QA 3CTAA 2EFQA 4ZJZA 5D5VB 1HW2A 4ESJA 4ZYEA 5CKTA 2DOAA 3FXRA 1UG2A 1X4OA 3S1NJ 4KFCA 4LG3A 1I50J 2ISYA 4H4KC 2M45A 3TOAA 2JA6J 4A3GJ 3BZCA 3CJTB 4N9HA 2X9DA 1FYLA 2DA6A 2L02A 2OBPA 3GZ6A 2DDAA 4HA8A 4HNTA 2YX7A 3NRVA 2QZ8A 1IDZA 4A3FJ 2R7ZJ 2RVCA 1IRZA 4IJAA 1HCRA 2CO5A 2UV1A 3BG5A 1DU0A 2PG4A 4MLOA 2YPRA 5H2FC 4L18B 2NNYA 2VE9A 4UY8I 1ETKA 3GTMJ 4BJ6C 4HDVA 2R7QA 4RGSA 3IH2A
chains in the Genus database with same CATH topology
3BJOA 3I59A 3KP3A 3IWZA 2W25A 1O3TA 3FM5A 3FMRA 4P9UA 2P5KA 4OU0A 3KP4A 3F6VA 2HQRA 5ILVA 3GW2A 3KP2A 3AAFA 2EA2A 4UVAA 1IN6A 5K1YA 1JHHA 2JZYA 3F8FA 4FX0A 2CWEA 1HSJA 3VOEA 4HLXA 3E5XA 4EMSA 1U2WA 2DI3A 4MQ9F 1FT9A 4PGGA 2HOEA 3BPVA 5KVRA 4Y17A 2M5WA 2EJRA 3RKYA 3SZTA 5BPIA 1XGMA 1RUOA 2EA4A 2FBIA 4LG0B 3RKXA 2ZJ2A 2FMLA 4BHBA 4IRHA 1QO0D 3BJAA 4BXUA 1T39A 3TO6A 1FWZA 1J2XA 1EH8A 1LDJA 3BROA 5ED4A 4ZZLA 2FNAA 4ASNA 1KU9A 1S8NA 3L09A 2J5OA 4WXHA 4NHJA 3GFIA 1D8JA 1ZH5A 5A2QK 2DPUA 3WTUC 1BM9A 2DQLA 4MEXF 3H3ZA 1FBUA 5CLSA 1UHMA 3O6BB 1IRFA 3EETA 3M8FA 4A0YA 4KA4A 2JRTA 4KMUX 3IWFA 2BYVE 4A6EA 2M30A 2DBBA 1G4DA 2DQRA 3KZZA 2OQRA 1FYKA 4EJVA 1BI0A 2IT0A 4LMYA 2J5PA 4M9ZA 4EV0A 4BQAA 3L00A 2BV6A 3I53A 1IRGA 2VT2A 2G7UA 3I64A 3QPHA 4HLYA 1MD0A 2FBKA 4RAZA 3N4MA 2AXLA 3H92A 1IN5A 4U0YA 4HV6A 3VFZA 5LRRA 4HQEA 4HQMA 5D4RA 1LJ9A 3ZMUA 5TRDA 4CHUA 4U0WA 4CYDA 1W5SA 1T2KA 2PBIA 2DT5A 5E8IA 4K2EA 4PGHA 4L0YB 3F22A 4ETSA 1ON2A 3WTXC 1XDUA 1FOKA 3LA7A 2QBYB 4ZH4F 3SXYA 3Q5FA 4CO8A 5H20A 4IRIA 4G7OF 2W57A 1O3SA 1IN7A 1K78B 2XHKA 1T98A 4UHTA 2GXGA 1IXRC 2L54A 2Y0MA 1UHWA 2V79A 5D8KB 1ULYA 3LFKA 4ON0A 4ZZDA 3F8MA 1DPUA 2F2EA 5ILUA 3FXQA 2G9WA 5E1WA 1F4KA 4UUVA 2LNBA 1UCRA 1FPQA 5JR3A 1G3WA 5CJ9A 5FLXK 2ESHA 1PUEE 1D5VA 2PI0A 2V1UA 5KK1A 1JXSA 2XGXA 2R3SA 1KYZA 2JPCA 1XGSA 1B59A 2ZFWA 1W7PB 3K2ZA 2FNPA 1P92A 2ZMEB 2HFHA 2PFBA 1L3LA 3G73A 5HLHA 5ICCA 1Z1DA 2HZTA 5A2QZ 4F7ZA 3R60A 3D0SA 4LLGF 2FXAA 2RV8A 4RB0A 2CSOA 4RB2C 3IC7A 5D8LB 3HHGA 2A5YB 2COMA 2VXZA 3QAHA 2JSCA 3DV8A 5DEQA 2QQBA 4EJOA 1C0WA 4O3MA 4XSXF 5CVRA 2IVMA 2STTA 2O03A 3U9GA 4EM2A 2HR3A 3F23A 5F64A 4ZYDA 3KZYA 4CICA 1DP7P 3KE2A 1IW7F 4Q4ZF 3DFGA 3GUDA 1SD4A 1B1BA 2LF7A 1I5ZA 1Z6RA 1S29A 1B6AA 5BS6A 4IHTA 4G9YA 2KJCA 5CYVA 1IXSB 3KLOA 2FSWA 1QZZA 1ZAOA 1MDMA 2GWRA 4L5IA 3U1DA 4FHTA 4AD9A 2JT1A 4Q5SF 5BQTA 5E1XA 3FXUA 1I1SA 3HSRA 3WU1B 1MZBA 2IPQX 1LVAA 5JFRA 4LLLA 2HGCA 4BYYA 1F9NA 1TBXA 2QENA 4HDUA 3CLOA 2VBZA 3QP6A 4M73A 3ZMTA 3LA3A 4OMZA 4OINF 1U3EM 2L4AA 3TOBA 3KEOA 4EM0B 2HYFA 2UZKA 5FLXZ 1FX7A 1RIOH 1U6GA 3B73A 3LSTA 2F5DA 4LJZF 2NYXA 4MTEA 4G7ZF 4HV5A 3IKVA 3CO7C 3R0JA 1LDKB 2M87A 4RGRA 2PMHA 2NNNA 2GAUA 4JBAA 3JSPA 1FSHA 3FM3A 1FSEA 4S05A 2HWVA 3WGGA 3JSOA 3QRFF 1XSXA 5CVVA 1J59A 2K7LA 4AIJA 5HDNA 3RTRA 3P7NA 2EV0A 2P4WA 4L9VA 2QVOA 1E17A 1XMAA 3GEZA 3WTVC 1YYVA 4I01A 4TV7A 4MTDA 4PZJA 2QUFA 4Y15A 5FFZA 3B02A 5ILSA 1R7JA 1H9GA 4HZFA 3GXOA 4UXNA 3D5LA 4MQVA 3GFLA 3E5QA 4CDGA 2DO7A 4U7BA 4QLCU 3I58A 3IL2A 3K1MA 1TW3A 3E3VA 2HTSA 1W7PD 4RB1A 1VTNC 1WWXA 2O61A 2PMUA 2JTVA 2D45A 5D6FA 5FD5A 1YW8A 3KP7A 1DDNA 2W85A 1BIAA 4WXDA 5H6QA 3JTHA 4EM1A 1R22A 4LFUA 1SFXA 3GWZA 5ICGA 3BP8A 2FEZA 2DLLA 3ZMZA 3DPTA 1R58A 3K0LA 2EV6A 2VOPA 3NQOA 4N0BA 1ZG1A 1CF7B 4BNCA 3HOSA 1ZYRF 3DF8A 3CUQB 1MJ9A 5TJJA 1PDNC 5L3BA 3CUQC 3ULQB 1HKSA 3QU3A 1EH7A 4IHSA 3CUOA 2K4BA 2IA0A 5CVJA 1IUYA 1YTYA 1YG2A 1B4AA 3WODF 4A0ZA 5HDGA 3T0YA 3U2RA 2Q8KA 2HKXA 2K4JA 4UVBA 2NRAC 1RI7A 1KQ9A 3S2WA 2FMYA 2VONA 2P7CB 1KU7A 2Z5UA 4M9XA 2KIUA 4A6DA 2L3DA 3J7AO 3C18A 3SFZA 1LEBA 1R00A 3GFJA 2A61A 1TNTA 4GGGA 4GO1A 1ZRDA 2FBHA 2GA2A 2HS5A 1USTA 3TO9A 1V3FA 3KP5A 3GVAA 4R79A 2O0YA 2DTRA 4GYGA 4EVIA 1G6NA 1OR7A 4ESBA 2GIVA 3M8EA 4IRGA 1QPMA 1TNSA 1KU3A 2XAFA 4HX7A 2W84A 4L5JA 4OIRF 2KIFA 2VBXA 4AVPA 5K5OA 3FMQA 3F3XA 1HW5A 1KGSA 4M74A 4KNYA 3TKYA 1ON1A 4HYEA 5AIPA 3MEXA 3BPXA 2CYYA 1HW1A 4GXOA 2IW5A 1TTYA 2EFOA 4O5VA 4YG2F 3RYPA 4I98B 1ZLJA 1E2XA 1BC8C 3J80K 1W4MA 3KEQA 3DPLC 1R5HA 4ENKA 1TQPA 2XRNA 5BOXA 4WXCA 4M6XA 4A0XA 1R1TA 1T0FA 3RYRA 1G3SA 1P6RA 4U88A 2M8EA 3ZMVA 2FOKA 2D1HA 2H6BA 3HTUA 3MQ0A 4E70A 4A5MA 1U5TB 1TLHB 5FGMA 3R4KA 5CVUA 1ZGAA 3E6CC 3L2CA 2IP2A 4M6YA 4LG0A 2YSRA 2GZWA 3BZ6A 4U0VA 3K69A 3VEPA 3ZN1A 1ZARA 2ZBKA 3W6KB 2CFXA 2BGCA 3K1NA 3M7GA 2VN2A 2OA4A 1FP2A 5HLGA 2RGVA 1R5GA 1XCBA 2MA3A 4YFXF 2EV5A 3ELKA 3ECHA 3L7WA 3FWEA 3ROUA 3WU0A 2P7VB 2OU2A 4IPAA 1R36A 2HKOA 1T38A 1J0RA 2DK8A 4A12A 1D3YA 2ISZA 3TQNA 3WTTC 3KETA 1MGTA 2Z9OA 3IRQA 2IA2A 3P9CA 1IZ1A 2PJPA 1IN8A 3COAC 1REPC 3I4PA 2DW4A 3EUHA 2G7HA 1SD6A 1Z91A 2EB7A 2ZKZA 5D5UB 3HTSB 4KICA 4HW0A 3WG9A 2TDXA 2RC4A 2RKHA 1ZRFA 2GXBA 1FZPB 1BBYA 2QQAA 2CG4A 2XIGA 1KA8A 4RGXA 4M71A 2VOOA 4YFKF 2UXNA 1STZA 1FNNA 2MH9A 4LGWA 3VODA 3E6DA 1ZG5A 2C6YA 2LSOA 3NEUA 4DNCA 5HOOA 3JTGA 1JHFA 3EYYA 4EJTA 3P9IA 1YS7A 2QBYA 2HEOA 3F6OA 1XGNA 3V8LA 1BN5A 4GCVA 1HXDA 4H0EA 4I0BA 4ENJA 2CW0F 1U8RA 1K78A 2H27A 2VODA 2V1XA 3ZN0A 2NS0A 3V8KA 4Z2YA 3HOTA 3BDDA 1XD7A 2Z3YA 4EJWA 3H3UA 1SMTA 3MFKA 5LGNA 1YW7A 2FF4A 5D5WB 4P9FA 4OIOF 5H6RA 1ODDA 1WRJA 3HUGA 3HRMA 4EQQA 5J8CA 2V1DA 3MCZA 1I1GA 1FP1D 3K1PA 2RDPA 2K02A 1H0MA 1W7PA 5D4SA 5E18F 2WV0A 1R23A 3O2PE 4N9IA 1QGPA 2ZMEA 1XCVA 1SMYF 1V4RA 1FY7A 1YLFA 3SQNA 3N97A 4I7HA 3GLXA 3RPQA 2E1CA 2ZNYA 5DYMA 1Y0UA 1S6LA 2EFPA 1H9TA 2BBYA 3RJPA 2XAHA 2XROA 1GXQA 1U78A 4M9SA 3V8JA 3KCCA 3OOPA 2ZNZA 3BY6A 2FA5A 3I54A 4LK0F 3HIFA 2FU4A 1TQIA 3BWGA 1F1ZA 3KLNA 2DU9A 4WF2A 1ZN2A 3ERED 4OOIA 4L9JA 1NHAA 1AOYA 3HSEA 3T8RA 4A5NA 2FQ3A 4L9TA 1LNWA 5J8FA 3HSFA 4LB6B 3R0AA 2UXXA 4A2UA 2X4HA 3RI4A 3LWFA 4XBFA 1ZHFA 2P5LC 4YIFA 1P4AA 1R1UA 5CVIA 3J81K 3GFMA 3WE3A 3QPTA 3RPUA 4LB5A 3GZ5A 2Y75A 5LHHA 2R7DA 1QQIA 2KKOA 1ZRCA 1SFEA 2E1NA 2WWYA 1SD7A 2XV4S 1OPCA 3HRUA 4UVCA 3RKWA 3GO5A 3FZVA 2CGPA 4G6QA 5HS7A 1HSTA 5DCMB 2BEOA 4XSZF 4HF0A 3I0TA 2MH2A 1I6XA 3SHFA 1RNLA 4NQWA 3ZP5A 2H09A 5EEGA 1O3RA 2STWA 5AONA 4ENNA 2E7XA 2IRFG 4HX8A 1P4XA 1BIBA 4L0ZB 1LDDA 4I02A 5BPDA 3GX4X 3KFWX 1XB4A 3ZMSA 2WTEA 4XLPF 3L9FA 3OV8A 3F21A 4G7HF 4I09A 1BI1A 4RGUA 3I59B 1XN7A 3WGIA 3CO6C 3EQLF 1QBJA 1MJBA 4KYWA 1ZGJA 3IHUA 4L9NA 5ERIA 3T8TA 2MD5A 2MBFA 3WTWC 1OYYA 1BOAA 2VE8A 5DUIA 3KP6A 4HOBA 1EH6A 3ZPLA 2M1BA 1D8KA 3IRRA 3ECOA 1K7AA 3DP7A 1YW9A 4YIIA 5HDKA 3IKTA 2KIMA 4XRFA 4EGZA 2GA1A 4WCGA 2A68F 3E6BA 3M1EA 3BOQA 4RB3C 1GVJA 2K27A 3TGNA 1FYMA 5DD8A 1AWCA 2DPDA 1LEAA 2FRHA 2XKOA 1Z05A 5LRSA 2UWMA 2LKPA 2YR2A 3ABUA 1RZ4A 3MWMA 4G8XA 5JI6A 5ICEA 1J75A 4R1HA 4I0AA 2ZXJA 5L3DA 1MKMA 4OIPF 3MZHA 3I5UA 2K86A 1FC3A 2Z33A 4S04A 3J81Z 5F1RA 3FHZA 3TO7A 1ZG3A 3ZQ7A 3F8BA 5HS9A 2KJBA 4CXFA 4JK1X 2MC3A 2ZCWA 1J5YA 3K9TA 3GF2A 3V4GA 4IF4A 3F72A 4Q48A 4U7DA 1BI2A 4NB5A 1CF7A 5D6EA 3F8CA 2P8TA 3CUQA 2A3SA 3E97A 5DUKA 1SD5A 1K6OA 4UV9A 2O3FA 4DQ2A 4KDPA 1K79A 2X0LA 5DD4A 5LEJA 5HVQC 2A07F 2IJLA 5DDGA 2QLZA 4ZYHA 5IT9K 1TW2A 2W24A 4IXAA 3RDIA 4GYIA 3V7RA 3JAMK 2KRFA 3E5UA 4RS8A 4JQFA 1OMIA 1T6SA 2E7WA 1TQMA 3MZYA 1I27A 4OMYA 1UFMA 2VC1A 1LB2A 1O3QA 3O3KA 3R61A 5AIQA 4PCQA 2MLGA 2B0LA 4KIBA 4ZYGA 2ESNA 4R8HA 4HAMA 1U5TC 4CZZA 2O6GE 4HF2A 3C7JA 5F6FA 4P55A 1DUXC 1P4WA 3LA2A 2RNJA 4P5OA 3M9AA 5J6XA 3DEUA 3DXJF 1W5TA 1P2FA 2VT3A 4P96A 5K5RA 3ZMDA 1QNTA 2VBWA 2QYOA 1X3UA 4ESFA 4EJUA 1PP7U 1LQ1A 2XAJA 5BMZA 1S7OA 1BI3A 1R1VA 5EEHA 4KN7X 3EYIA 2OD5A 2Z99A 1WQ2A 4UV8A 1BJAA 3QOPA 2Q2EA 2XAQA 4Y13A 3CJNA 2AS5F 5LGUA 1WI9A 3LAPA 1EV7A 2D1VA 3V7SA 2A6HF 1S3JA 3EDPA 5LHIA 4YFNF 4AWXB 2R7FA 3BJ6A 2QQ9A 1DPRA 2RQPA 5IT3A 3T5XA 6PAXA 1U5TA 4LD5A 2ETHA 3GYHX 2P6SA 1WSUA 4O6JA 2DFIA 1FBSA 2ELHA 1XDSA 1J9IA 3FMSA 2HYGD 4KIGA 1YQAA 2LDUA 5DCFA 3SZPA 2PN6A 5E1ZB 3V7CA 1PP8F 4D0PA 3WE2A 2EFNA 3WTYC 4WX9A 1F5TA 4BHCA 3HRSA 3JW4A 1IF1A 4KT5C 2H94A 5DV5A 1MDMB 4KN4X 5IT9Z 3QP5A 2F5FA 3FF5A 3C1DA 3J80Z 4B8XA 3T1BA 2PLYA 3JAMZ 1YFHA 4FX4A 5HS8A 4MHGA 1OKRA 1KQ0A 1RUNA 1ZREA 1IAWA 1IN4A 1XSVA 3WGHA 1HQCA 3WTSC 3RIRA 4B09A 1KU2A 5FB2A 5JVTA 3HRTA 5L3GA 5E17F 4KMFA 2PEXA 2L01A 3FX3A 3R6SA 1WKMA 2ACJA 2F5EA 4LK1F 2YX4A 1YIOA 5LEKA 4G94A 1L0OC 2XASA 5L3FA 3DKWA 1Z9CA 4PDKA 1XGOA 3LQRA 1J7KA 1JE8A 3LAJA 2OZUA 2XAGA 5FFXA 2EWNA 2OAZA 2EK5A 5K5QA 4M72A 2LF8A 4Q47A 1MJAA 2RN7A 2OZ6A 4BAYA 1O57A 3F8NA 2OQGA 4OIQF 3DQVC 3MAJA 5FO5A 1GHCA 2O8XA 2NAZA 3E6MA 3PFIA 5FD6A 3W6JB 1YS6A 3Q9VA 1JGSA 4HX4A 2XKPA 1HKQA 2HDCA 1Q1HA 1S7AA 1KQ8A 4RAYA 4I2OA 1BC7C 3P9KA 4BHPA 3Q9SA 1G3YA 2FE3A 2H6CA 1SAXA 2A6EF 4XLNF 2D2WA 4EGYA 4ENMA 3WTZA 1CGPA 2WC2A 2V9VA 2EFWA 1ZLKA 2XUBA 4AIKA 1KYWA 5ICFA 3TDZC 4MGRA 1UB9A 1XSDA 1O7LA 4MEYF 3PQJA 5LHGA 2PQ8A 3ABTA 3CDHA 1O7FA 4KUMA 2Y48A 2BE5F 3C3WA 1B9MA 4AIHA 2MLKA 2V6CA 3TDUC 1OYIA 3VB2A 2HTJA 1A04A 1FLIA 3PQKA 4WWCA 5LGTA 3QU6A 5D5XB 4G6DA 1HBXG 2DK5A 2JPBA 5JHUA 5E8GA 2IA1A 2CQKA 1G3TA 2ADUA 4UNOA 2GQQA 1HKTA 2VBYA 5L3EA 2P6TA 5LBQA 4QWQA 1Z7UA 3HHHA 4CGZA 3HYIA 3LQQA 2A69F 1QZYA 2L4MA 2P5VA 3I71A 2ZO4A 5E20A 4HBLA 2F5CA 4IVNA 4KIFA 4LLNA 1SFUA 1B9NA 2VC0A 5LLQA 3REOA 2HQNA 3ISPA 4BH9A 1IXCA 2XVCA 2Q0OA 2DAOA 2YU3A 2QWWA 4HF1A 1XMKA 4MNUA 1USSA 5HLIA 4FT8A 5L3CA 1GXPA 1OYWA 1ONVA 2QM3A 5DCMA 3G3ZA 4WK8F 1Z6TA 3ML6A 1YO5C 1FBQA 3CTAA 2EFQA 5D5VB 1HW2A 4ESJA 4ZYEA 3FXRA 4KFCA 2ISYA 2M45A 3TOAA 4N9HA 1FYLA 2L02A 2OBPA 3GZ6A 4HA8A 2YX7A 3NRVA 2QZ8A 2RVCA 4IJAA 2CO5A 2PG4A 2YPRA 4L18B 2NNYA 2VE9A 4HDVA 4RGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJO A;  3I59 A;  3KP3 A;  3IWZ A;  2W25 A;  1O3T A;  3FM5 A;  3FMR A;  4P9U A;  2P5K A;  4OU0 A;  3KP4 A;  3F6V A;  2HQR A;  5ILV A;  3GW2 A;  3KP2 A;  3AAF A;  2EA2 A;  4UVA A;  1IN6 A;  5K1Y A;  1JHH A;  2JZY A;  3F8F A;  4FX0 A;  2CWE A;  1HSJ A;  3VOE A;  4HLX A;  3E5X A;  4EMS A;  1U2W A;  2DI3 A;  4MQ9 F;  1FT9 A;  4PGG A;  2HOE A;  3BPV A;  5KVR A;  4Y17 A;  2M5W A;  2EJR A;  3RKY A;  3SZT A;  5BPI A;  1XGM A;  1RUO A;  2EA4 A;  2FBI A;  4LG0 B;  3RKX A;  2ZJ2 A;  2FML A;  4BHB A;  4IRH A;  1QO0 D;  3BJA A;  4BXU A;  1T39 A;  3TO6 A;  1FWZ A;  1J2X A;  1EH8 A;  1LDJ A;  3BRO A;  5ED4 A;  4ZZL A;  2FNA A;  4ASN A;  1KU9 A;  1S8N A;  3L09 A;  2J5O A;  4WXH A;  4NHJ A;  3GFI A;  1D8J A;  1ZH5 A;  5A2Q K;  2DPU A;  3WTU C;  1BM9 A;  2DQL A;  4MEX F;  3H3Z A;  1FBU A;  5CLS A;  1UHM A;  3O6B B;  1IRF A;  3EET A;  3M8F A;  4A0Y A;  4KA4 A;  2JRT A;  4KMU X;  3IWF A;  2BYV E;  4A6E A;  2M30 A;  2DBB A;  1G4D A;  2DQR A;  3KZZ A;  2OQR A;  1FYK A;  4EJV A;  1BI0 A;  2IT0 A;  4LMY A;  2J5P A;  4M9Z A;  4EV0 A;  4BQA A;  3L00 A;  2BV6 A;  3I53 A;  1IRG A;  2VT2 A;  2G7U A;  3I64 A;  3QPH A;  4HLY A;  1MD0 A;  2FBK A;  4RAZ A;  3N4M A;  2AXL A;  3H92 A;  1IN5 A;  4U0Y A;  4HV6 A;  3VFZ A;  5LRR A;  4HQE A;  4HQM A;  5D4R A;  1LJ9 A;  3ZMU A;  5TRD A;  4CHU A;  4U0W A;  4CYD A;  1W5S A;  1T2K A;  2PBI A;  2DT5 A;  5E8I A;  4K2E A;  4PGH A;  4L0Y B;  3F22 A;  4ETS A;  1ON2 A;  3WTX C;  1XDU A;  1FOK A;  3LA7 A;  2QBY B;  4ZH4 F;  3SXY A;  3Q5F A;  4CO8 A;  5H20 A;  4IRI A;  4G7O F;  2W57 A;  1O3S A;  1IN7 A;  1K78 B;  2XHK A;  1T98 A;  4UHT A;  2GXG A;  1IXR C;  2L54 A;  2Y0M A;  1UHW A;  2V79 A;  5D8K B;  1ULY A;  3LFK A;  4ON0 A;  4ZZD A;  3F8M A;  1DPU A;  2F2E A;  5ILU A;  3FXQ A;  2G9W A;  5E1W A;  1F4K A;  4UUV A;  2LNB A;  1UCR A;  1FPQ A;  5JR3 A;  1G3W A;  5CJ9 A;  5FLX K;  2ESH A;  1PUE E;  1D5V A;  2PI0 A;  2V1U A;  5KK1 A;  1JXS A;  2XGX A;  2R3S A;  1KYZ A;  2JPC A;  1XGS A;  1B59 A;  2ZFW A;  1W7P B;  3K2Z A;  2FNP A;  1P92 A;  2ZME B;  2HFH A;  2PFB A;  1L3L A;  3G73 A;  5HLH A;  5ICC A;  1Z1D A;  2HZT A;  5A2Q Z;  4F7Z A;  3R60 A;  3D0S A;  4LLG F;  2FXA A;  2RV8 A;  4RB0 A;  2CSO A;  4RB2 C;  3IC7 A;  5D8L B;  3HHG A;  2A5Y B;  2COM A;  2VXZ A;  3QAH A;  2JSC A;  3DV8 A;  5DEQ A;  2QQB A;  4EJO A;  1C0W A;  4O3M A;  4XSX F;  5CVR A;  2IVM A;  2STT A;  2O03 A;  3U9G A;  4EM2 A;  2HR3 A;  3F23 A;  5F64 A;  4ZYD A;  3KZY A;  4CIC A;  1DP7 P;  3KE2 A;  1IW7 F;  4Q4Z F;  3DFG A;  3GUD A;  1SD4 A;  1B1B A;  2LF7 A;  1I5Z A;  1Z6R A;  1S29 A;  1B6A A;  5BS6 A;  4IHT A;  4G9Y A;  2KJC A;  5CYV A;  1IXS B;  3KLO A;  2FSW A;  1QZZ A;  1ZAO A;  1MDM A;  2GWR A;  4L5I A;  3U1D A;  4FHT A;  4AD9 A;  2JT1 A;  4Q5S F;  5BQT A;  5E1X A;  3FXU A;  1I1S A;  3HSR A;  3WU1 B;  1MZB A;  2IPQ X;  1LVA A;  5JFR A;  4LLL A;  2HGC A;  4BYY A;  1F9N A;  1TBX A;  2QEN A;  4HDU A;  3CLO A;  2VBZ A;  3QP6 A;  4M73 A;  3ZMT A;  3LA3 A;  4OMZ A;  4OIN F;  1U3E M;  2L4A A;  3TOB A;  3KEO A;  4EM0 B;  2HYF A;  2UZK A;  5FLX Z;  1FX7 A;  1RIO H;  1U6G A;  3B73 A;  3LST A;  2F5D A;  4LJZ F;  2NYX A;  4MTE A;  4G7Z F;  4HV5 A;  3IKV A;  3CO7 C;  3R0J A;  1LDK B;  2M87 A;  4RGR A;  2PMH A;  2NNN A;  2GAU A;  4JBA A;  3JSP A;  1FSH A;  3FM3 A;  1FSE A;  4S05 A;  2HWV A;  3WGG A;  3JSO A;  3QRF F;  1XSX A;  5CVV A;  1J59 A;  2K7L A;  4AIJ A;  5HDN A;  3RTR A;  3P7N A;  2EV0 A;  2P4W A;  4L9V A;  2QVO A;  1E17 A;  1XMA A;  3GEZ A;  3WTV C;  1YYV A;  4I01 A;  4TV7 A;  4MTD A;  4PZJ A;  2QUF A;  4Y15 A;  5FFZ A;  3B02 A;  5ILS A;  1R7J A;  1H9G A;  4HZF A;  3GXO A;  4UXN A;  3D5L A;  4MQV A;  3GFL A;  3E5Q A;  4CDG A;  2DO7 A;  4U7B A;  4QLC U;  3I58 A;  3IL2 A;  3K1M A;  1TW3 A;  3E3V A;  2HTS A;  1W7P D;  4RB1 A;  1VTN C;  1WWX A;  2O61 A;  2PMU A;  2JTV A;  2D45 A;  5D6F A;  5FD5 A;  1YW8 A;  3KP7 A;  1DDN A;  2W85 A;  1BIA A;  4WXD A;  5H6Q A;  3JTH A;  4EM1 A;  1R22 A;  4LFU A;  1SFX A;  3GWZ A;  5ICG A;  3BP8 A;  2FEZ A;  2DLL A;  3ZMZ A;  3DPT A;  1R58 A;  3K0L A;  2EV6 A;  2VOP A;  3NQO A;  4N0B A;  1ZG1 A;  1CF7 B;  4BNC A;  3HOS A;  1ZYR F;  3DF8 A;  3CUQ B;  1MJ9 A;  5TJJ A;  1PDN C;  5L3B A;  3CUQ C;  3ULQ B;  1HKS A;  3QU3 A;  1EH7 A;  4IHS A;  3CUO A;  2K4B A;  2IA0 A;  5CVJ A;  1IUY A;  1YTY A;  1YG2 A;  1B4A A;  3WOD F;  4A0Z A;  5HDG A;  3T0Y A;  3U2R A;  2Q8K A;  2HKX A;  2K4J A;  4UVB A;  2NRA C;  1RI7 A;  1KQ9 A;  3S2W A;  2FMY A;  2VON A;  2P7C B;  1KU7 A;  2Z5U A;  4M9X A;  2KIU A;  4A6D A;  2L3D A;  3J7A O;  3C18 A;  3SFZ A;  1LEB A;  1R00 A;  3GFJ A;  2A61 A;  1TNT A;  4GGG A;  4GO1 A;  1ZRD A;  2FBH A;  2GA2 A;  2HS5 A;  1UST A;  3TO9 A;  1V3F A;  3KP5 A;  3GVA A;  4R79 A;  2O0Y A;  2DTR A;  4GYG A;  4EVI A;  1G6N A;  1OR7 A;  4ESB A;  2GIV A;  3M8E A;  4IRG A;  1QPM A;  1TNS A;  1KU3 A;  2XAF A;  4HX7 A;  2W84 A;  4L5J A;  4OIR F;  2KIF A;  2VBX A;  4AVP A;  5K5O A;  3FMQ A;  3F3X A;  1HW5 A;  1KGS A;  4M74 A;  4KNY A;  3TKY A;  1ON1 A;  4HYE A;  5AIP A;  3MEX A;  3BPX A;  2CYY A;  1HW1 A;  4GXO A;  2IW5 A;  1TTY A;  2EFO A;  4O5V A;  4YG2 F;  3RYP A;  4I98 B;  1ZLJ A;  1E2X A;  1BC8 C;  3J80 K;  1W4M A;  3KEQ A;  3DPL C;  1R5H A;  4ENK A;  1TQP A;  2XRN A;  5BOX A;  4WXC A;  4M6X A;  4A0X A;  1R1T A;  1T0F A;  3RYR A;  1G3S A;  1P6R A;  4U88 A;  2M8E A;  3ZMV A;  2FOK A;  2D1H A;  2H6B A;  3HTU A;  3MQ0 A;  4E70 A;  4A5M A;  1U5T B;  1TLH B;  5FGM A;  3R4K A;  5CVU A;  1ZGA A;  3E6C C;  3L2C A;  2IP2 A;  4M6Y A;  4LG0 A;  2YSR A;  2GZW A;  3BZ6 A;  4U0V A;  3K69 A;  3VEP A;  3ZN1 A;  1ZAR A;  2ZBK A;  3W6K B;  2CFX A;  2BGC A;  3K1N A;  3M7G A;  2VN2 A;  2OA4 A;  1FP2 A;  5HLG A;  2RGV A;  1R5G A;  1XCB A;  2MA3 A;  4YFX F;  2EV5 A;  3ELK A;  3ECH A;  3L7W A;  3FWE A;  3ROU A;  3WU0 A;  2P7V B;  2OU2 A;  4IPA A;  1R36 A;  2HKO A;  1T38 A;  1J0R A;  2DK8 A;  4A12 A;  1D3Y A;  2ISZ A;  3TQN A;  3WTT C;  3KET A;  1MGT A;  2Z9O A;  3IRQ A;  2IA2 A;  3P9C A;  1IZ1 A;  2PJP A;  1IN8 A;  3COA C;  1REP C;  3I4P A;  2DW4 A;  3EUH A;  2G7H A;  1SD6 A;  1Z91 A;  2EB7 A;  2ZKZ A;  5D5U B;  3HTS B;  4KIC A;  4HW0 A;  3WG9 A;  2TDX A;  2RC4 A;  2RKH A;  1ZRF A;  2GXB A;  1FZP B;  1BBY A;  2QQA A;  2CG4 A;  2XIG A;  1KA8 A;  4RGX A;  4M71 A;  2VOO A;  4YFK F;  2UXN A;  1STZ A;  1FNN A;  2MH9 A;  4LGW A;  3VOD A;  3E6D A;  1ZG5 A;  2C6Y A;  2LSO A;  3NEU A;  4DNC A;  5HOO A;  3JTG A;  1JHF A;  3EYY A;  4EJT A;  3P9I A;  1YS7 A;  2QBY A;  2HEO A;  3F6O A;  1XGN A;  3V8L A;  1BN5 A;  4GCV A;  1HXD A;  4H0E A;  4I0B A;  4ENJ A;  2CW0 F;  1U8R A;  1K78 A;  2H27 A;  2VOD A;  2V1X A;  3ZN0 A;  2NS0 A;  3V8K A;  4Z2Y A;  3HOT A;  3BDD A;  1XD7 A;  2Z3Y A;  4EJW A;  3H3U A;  1SMT A;  3MFK A;  5LGN A;  1YW7 A;  2FF4 A;  5D5W B;  4P9F A;  4OIO F;  5H6R A;  1ODD A;  1WRJ A;  3HUG A;  3HRM A;  4EQQ A;  5J8C A;  2V1D A;  3MCZ A;  1I1G A;  1FP1 D;  3K1P A;  2RDP A;  2K02 A;  1H0M A;  1W7P A;  5D4S A;  5E18 F;  2WV0 A;  1R23 A;  3O2P E;  4N9I A;  1QGP A;  2ZME A;  1XCV A;  1SMY F;  1V4R A;  1FY7 A;  1YLF A;  3SQN A;  3N97 A;  4I7H A;  3GLX A;  3RPQ A;  2E1C A;  2ZNY A;  5DYM A;  1Y0U A;  1S6L A;  2EFP A;  1H9T A;  2BBY A;  3RJP A;  2XAH A;  2XRO A;  1GXQ A;  1U78 A;  4M9S A;  3V8J A;  3KCC A;  3OOP A;  2ZNZ A;  3BY6 A;  2FA5 A;  3I54 A;  4LK0 F;  3HIF A;  2FU4 A;  1TQI A;  3BWG A;  1F1Z A;  3KLN A;  2DU9 A;  4WF2 A;  1ZN2 A;  3ERE D;  4OOI A;  4L9J A;  1NHA A;  1AOY A;  3HSE A;  3T8R A;  4A5N A;  2FQ3 A;  4L9T A;  1LNW A;  5J8F A;  3HSF A;  4LB6 B;  3R0A A;  2UXX A;  4A2U A;  2X4H A;  3RI4 A;  3LWF A;  4XBF A;  1ZHF A;  2P5L C;  4YIF A;  1P4A A;  1R1U A;  5CVI A;  3J81 K;  3GFM A;  3WE3 A;  3QPT A;  3RPU A;  4LB5 A;  3GZ5 A;  2Y75 A;  5LHH A;  2R7D A;  1QQI A;  2KKO A;  1ZRC A;  1SFE A;  2E1N A;  2WWY A;  1SD7 A;  2XV4 S;  1OPC A;  3HRU A;  4UVC A;  3RKW A;  3GO5 A;  3FZV A;  2CGP A;  4G6Q A;  5HS7 A;  1HST A;  5DCM B;  2BEO A;  4XSZ F;  4HF0 A;  3I0T A;  2MH2 A;  1I6X A;  3SHF A;  1RNL A;  4NQW A;  3ZP5 A;  2H09 A;  5EEG A;  1O3R A;  2STW A;  5AON A;  4ENN A;  2E7X A;  2IRF G;  4HX8 A;  1P4X A;  1BIB A;  4L0Z B;  1LDD A;  4I02 A;  5BPD A;  3GX4 X;  3KFW X;  1XB4 A;  3ZMS A;  2WTE A;  4XLP F;  3L9F A;  3OV8 A;  3F21 A;  4G7H F;  4I09 A;  1BI1 A;  4RGU A;  3I59 B;  1XN7 A;  3WGI A;  3CO6 C;  3EQL F;  1QBJ A;  1MJB A;  4KYW A;  1ZGJ A;  3IHU A;  4L9N A;  5ERI A;  3T8T A;  2MD5 A;  2MBF A;  3WTW C;  1OYY A;  1BOA A;  2VE8 A;  5DUI A;  3KP6 A;  4HOB A;  1EH6 A;  3ZPL A;  2M1B A;  1D8K A;  3IRR A;  3ECO A;  1K7A A;  3DP7 A;  1YW9 A;  4YII A;  5HDK A;  3IKT A;  2KIM A;  4XRF A;  4EGZ A;  2GA1 A;  4WCG A;  2A68 F;  3E6B A;  3M1E A;  3BOQ A;  4RB3 C;  1GVJ A;  2K27 A;  3TGN A;  1FYM A;  5DD8 A;  1AWC A;  2DPD A;  1LEA A;  2FRH A;  2XKO A;  1Z05 A;  5LRS A;  2UWM A;  2LKP A;  2YR2 A;  3ABU A;  1RZ4 A;  3MWM A;  4G8X A;  5JI6 A;  5ICE A;  1J75 A;  4R1H A;  4I0A A;  2ZXJ A;  5L3D A;  1MKM A;  4OIP F;  3MZH A;  3I5U A;  2K86 A;  1FC3 A;  2Z33 A;  4S04 A;  3J81 Z;  5F1R A;  3FHZ A;  3TO7 A;  1ZG3 A;  3ZQ7 A;  3F8B A;  5HS9 A;  2KJB A;  4CXF A;  4JK1 X;  2MC3 A;  2ZCW A;  1J5Y A;  3K9T A;  3GF2 A;  3V4G A;  4IF4 A;  3F72 A;  4Q48 A;  4U7D A;  1BI2 A;  4NB5 A;  1CF7 A;  5D6E A;  3F8C A;  2P8T A;  3CUQ A;  2A3S A;  3E97 A;  5DUK A;  1SD5 A;  1K6O A;  4UV9 A;  2O3F A;  4DQ2 A;  4KDP A;  1K79 A;  2X0L A;  5DD4 A;  5LEJ A;  5HVQ C;  2A07 F;  2IJL A;  5DDG A;  2QLZ A;  4ZYH A;  5IT9 K;  1TW2 A;  2W24 A;  4IXA A;  3RDI A;  4GYI A;  3V7R A;  3JAM K;  2KRF A;  3E5U A;  4RS8 A;  4JQF A;  1OMI A;  1T6S A;  2E7W A;  1TQM A;  3MZY A;  1I27 A;  4OMY A;  1UFM A;  2VC1 A;  1LB2 A;  1O3Q A;  3O3K A;  3R61 A;  5AIQ A;  4PCQ A;  2MLG A;  2B0L A;  4KIB A;  4ZYG A;  2ESN A;  4R8H A;  4HAM A;  1U5T C;  4CZZ A;  2O6G E;  4HF2 A;  3C7J A;  5F6F A;  4P55 A;  1DUX C;  1P4W A;  3LA2 A;  2RNJ A;  4P5O A;  3M9A A;  5J6X A;  3DEU A;  3DXJ F;  1W5T A;  1P2F A;  2VT3 A;  4P96 A;  5K5R A;  3ZMD A;  1QNT A;  2VBW A;  2QYO A;  1X3U A;  4ESF A;  4EJU A;  1PP7 U;  1LQ1 A;  2XAJ A;  5BMZ A;  1S7O A;  1BI3 A;  1R1V A;  5EEH A;  4KN7 X;  3EYI A;  2OD5 A;  2Z99 A;  1WQ2 A;  4UV8 A;  1BJA A;  3QOP A;  2Q2E A;  2XAQ A;  4Y13 A;  3CJN A;  2AS5 F;  5LGU A;  1WI9 A;  3LAP A;  1EV7 A;  2D1V A;  3V7S A;  2A6H F;  1S3J A;  3EDP A;  5LHI A;  4YFN F;  4AWX B;  2R7F A;  3BJ6 A;  2QQ9 A;  1DPR A;  2RQP A;  5IT3 A;  3T5X A;  6PAX A;  1U5T A;  4LD5 A;  2ETH A;  3GYH X;  2P6S A;  1WSU A;  4O6J A;  2DFI A;  1FBS A;  2ELH A;  1XDS A;  1J9I A;  3FMS A;  2HYG D;  4KIG A;  1YQA A;  2LDU A;  5DCF A;  3SZP A;  2PN6 A;  5E1Z B;  3V7C A;  1PP8 F;  4D0P A;  3WE2 A;  2EFN A;  3WTY C;  4WX9 A;  1F5T A;  4BHC A;  3HRS A;  3JW4 A;  1IF1 A;  4KT5 C;  2H94 A;  5DV5 A;  1MDM B;  4KN4 X;  5IT9 Z;  3QP5 A;  2F5F A;  3FF5 A;  3C1D A;  3J80 Z;  4B8X A;  3T1B A;  2PLY A;  3JAM Z;  1YFH A;  4FX4 A;  5HS8 A;  4MHG A;  1OKR A;  1KQ0 A;  1RUN A;  1ZRE A;  1IAW A;  1IN4 A;  1XSV A;  3WGH A;  1HQC A;  3WTS C;  3RIR A;  4B09 A;  1KU2 A;  5FB2 A;  5JVT A;  3HRT A;  5L3G A;  5E17 F;  4KMF A;  2PEX A;  2L01 A;  3FX3 A;  3R6S A;  1WKM A;  2ACJ A;  2F5E A;  4LK1 F;  2YX4 A;  1YIO A;  5LEK A;  4G94 A;  1L0O C;  2XAS A;  5L3F A;  3DKW A;  1Z9C A;  4PDK A;  1XGO A;  3LQR A;  1J7K A;  1JE8 A;  3LAJ A;  2OZU A;  2XAG A;  5FFX A;  2EWN A;  2OAZ A;  2EK5 A;  5K5Q A;  4M72 A;  2LF8 A;  4Q47 A;  1MJA A;  2RN7 A;  2OZ6 A;  4BAY A;  1O57 A;  3F8N A;  2OQG A;  4OIQ F;  3DQV C;  3MAJ A;  5FO5 A;  1GHC A;  2O8X A;  2NAZ A;  3E6M A;  3PFI A;  5FD6 A;  3W6J B;  1YS6 A;  3Q9V A;  1JGS A;  4HX4 A;  2XKP A;  1HKQ A;  2HDC A;  1Q1H A;  1S7A A;  1KQ8 A;  4RAY A;  4I2O A;  1BC7 C;  3P9K A;  4BHP A;  3Q9S A;  1G3Y A;  2FE3 A;  2H6C A;  1SAX A;  2A6E F;  4XLN F;  2D2W A;  4EGY A;  4ENM A;  3WTZ A;  1CGP A;  2WC2 A;  2V9V A;  2EFW A;  1ZLK A;  2XUB A;  4AIK A;  1KYW A;  5ICF A;  3TDZ C;  4MGR A;  1UB9 A;  1XSD A;  1O7L A;  4MEY F;  3PQJ A;  5LHG A;  2PQ8 A;  3ABT A;  3CDH A;  1O7F A;  4KUM A;  2Y48 A;  2BE5 F;  3C3W A;  1B9M A;  4AIH A;  2MLK A;  2V6C A;  3TDU C;  1OYI A;  3VB2 A;  2HTJ A;  1A04 A;  1FLI A;  3PQK A;  4WWC A;  5LGT A;  3QU6 A;  5D5X B;  4G6D A;  1HBX G;  2DK5 A;  2JPB A;  5JHU A;  5E8G A;  2IA1 A;  2CQK A;  1G3T A;  2ADU A;  4UNO A;  2GQQ A;  1HKT A;  2VBY A;  5L3E A;  2P6T A;  5LBQ A;  4QWQ A;  1Z7U A;  3HHH A;  4CGZ A;  3HYI A;  3LQQ A;  2A69 F;  1QZY A;  2L4M A;  2P5V A;  3I71 A;  2ZO4 A;  5E20 A;  4HBL A;  2F5C A;  4IVN A;  4KIF A;  4LLN A;  1SFU A;  1B9N A;  2VC0 A;  5LLQ A;  3REO A;  2HQN A;  3ISP A;  4BH9 A;  1IXC A;  2XVC A;  2Q0O A;  2DAO A;  2YU3 A;  2QWW A;  4HF1 A;  1XMK A;  4MNU A;  1USS A;  5HLI A;  4FT8 A;  5L3C A;  1GXP A;  1OYW A;  1ONV A;  2QM3 A;  5DCM A;  3G3Z A;  4WK8 F;  1Z6T A;  3ML6 A;  1YO5 C;  1FBQ A;  3CTA A;  2EFQ A;  5D5V B;  1HW2 A;  4ESJ A;  4ZYE A;  3FXR A;  4KFC A;  2ISY A;  2M45 A;  3TOA A;  4N9H A;  1FYL A;  2L02 A;  2OBP A;  3GZ6 A;  4HA8 A;  2YX7 A;  3NRV A;  2QZ8 A;  2RVC A;  4IJA A;  2CO5 A;  2PG4 A;  2YPR A;  4L18 B;  2NNY A;  2VE9 A;  4HDV A;  4RGS A; 
#chains in the Genus database with same CATH topology
 3BJO A;  2YUS A;  3ASO H;  2IS2 A;  3I59 A;  5EGO A;  3KP3 A;  3A01 A;  3E7L A;  3IWZ A;  2N8G A;  2W25 A;  1O3T A;  1CQT A;  3FM5 A;  3Q0U A;  2EZK A;  3FMR A;  3W3C A;  1TWG J;  4P9U A;  2P5K A;  4OU0 A;  2VB6 A;  3KP4 A;  3BR5 A;  2DT7 B;  2F5V A;  3F6V A;  2HQR A;  5ILV A;  3GW2 A;  3KP2 A;  3AAF A;  2KRC A;  2EA2 A;  4UVA A;  3HOY J;  3C2B A;  3OR1 C;  3D1N I;  1IN6 A;  5K1Y A;  1JHH A;  2JZY A;  3F8F A;  2CRG A;  4FE7 A;  2CWE A;  1HSJ A;  4FX0 A;  3WG7 H;  1YJW I;  2V9P A;  4CCL A;  1ZR4 A;  3VOE A;  4Y52 J;  1ETV A;  4HLX A;  3E5X A;  4EMS A;  1U2W A;  2DI3 A;  4MQ9 F;  1ZKG A;  4E7J A;  1FT9 A;  1Z3Y A;  3NWT A;  4PGG A;  3JRD A;  4NUB A;  2HOE A;  3BPV A;  5KVR A;  4Y17 A;  2M5W A;  2EJR A;  4DZP A;  3RKY A;  3SZT A;  3EPZ A;  5BPI A;  3A03 A;  1XGM A;  3JRI A;  1RUO A;  2LBF B;  2EA4 A;  4F92 B;  2FBI A;  4LG0 B;  3RKX A;  2ZJ2 A;  2CUZ A;  5C4X J;  2L7M P;  2HQ5 A;  2FML A;  4BHB A;  1XMX A;  2XF5 A;  4DJA A;  3C2G A;  1QRY A;  4IRH A;  1QO0 D;  2H1L A;  2DXI A;  3VWB A;  2DFH A;  3BJA A;  3GZN B;  2JK3 A;  4BXU A;  1JJ6 C;  1X1A A;  3PL8 A;  1T39 A;  1TWF J;  3TO6 A;  2ZJR F;  1HDD C;  1QHG A;  1FWZ A;  3PNV A;  1J2X A;  1EH8 A;  3G2B A;  1BW6 A;  1LDJ A;  3BRO A;  4N4N B;  5ED4 A;  4ZZL A;  2FNA A;  1Q1V A;  4ASN A;  1KU9 A;  1S8N A;  4BBS J;  3I9V 2;  3L09 A;  4HST A;  3BTC A;  2J5O A;  2L9S A;  2X6O A;  1MIJ A;  4WXH A;  2X1C A;  4NHJ A;  3LSJ A;  3GFI A;  1D8J A;  1ZH5 A;  5A2Q K;  2DPU A;  1FIA A;  2DA3 A;  3WTU C;  2MSY A;  5FKL A;  1FTT A;  1BM9 A;  1VF9 A;  2ICW G;  4CYC B;  2DQL A;  4MEX F;  5IPA A;  5B3S H;  2VJ4 A;  5IYC J;  3H3Z A;  1FBU A;  5CLS A;  3S16 J;  4RM2 A;  3OYL A;  2JUG A;  1UHM A;  2FUG 2;  3O6B B;  3SYT A;  4UUS B;  2XF6 A;  1IRF A;  3EET A;  3M8F A;  4CH7 A;  1OCP A;  4A0Y A;  3OIP A;  4KA4 A;  2JRT A;  3G4S I;  4KMU X;  2CS3 A;  3S15 J;  2XGD A;  3IWF A;  2BYV E;  4A6E A;  3G1M A;  2M30 A;  4XLH A;  2DBB A;  1G4D A;  1D0Y A;  2DQR A;  3W2A A;  3KZZ A;  2OQR A;  1FYK A;  4EJV A;  1BI0 A;  2IT0 A;  3JRB A;  4LMY A;  2J5P A;  4M9Z A;  4EV0 A;  4BS9 A;  4BQA A;  2RQQ A;  3L00 A;  2BV6 A;  3I53 A;  4XL9 A;  3OYC A;  4PJL A;  1IRG A;  3CJQ B;  2VXD A;  2R7S A;  2VT2 A;  3BG6 A;  2G7U A;  3I64 A;  2LYC A;  4YEL A;  3QPH A;  4PFP A;  2LY1 A;  1KZH A;  4HLY A;  2E1M C;  1MD0 A;  2FBK A;  2DOD A;  4RAZ A;  1VQ8 I;  3N4M A;  2AXL A;  3H92 A;  1IN5 A;  2KZV A;  3OYG A;  3RQI A;  2LLK A;  1FTZ A;  3OS1 A;  2M2E A;  4U0Y A;  4HV6 A;  2X1D A;  3VFZ A;  2V4J C;  5LRR A;  4HQE A;  4HQM A;  4HSR A;  5D4R A;  1LJ9 A;  3ZMU A;  5TRD A;  4CHU A;  5LD2 C;  3FK6 A;  4U0W A;  2LR8 A;  4CYD A;  5JHF A;  1W5S A;  1T2K A;  4L5E A;  1MBK A;  3KEY A;  1Y8Q B;  2PBI A;  2DT5 A;  5IP6 A;  5E8I A;  1BR4 A;  1BR2 A;  2RAE A;  4K2E A;  4PGH A;  4BQO A;  4L0Y B;  3F22 A;  2DJI A;  4ETS A;  1ON2 A;  2VJ5 A;  3WTX C;  1XDU A;  1FOK A;  3IV5 A;  1LFP A;  3LA7 A;  3GTL J;  4AYB N;  2W4S A;  3BR6 A;  4J19 A;  2WY7 Q;  2QBY B;  2VQC A;  4F3Q A;  4ZH4 F;  2X6Y A;  4B4C A;  3CME I;  4C2U A;  2KRH A;  3SXY A;  4RBO A;  3Q5F A;  4CO8 A;  5H20 A;  3LNQ A;  4IRI A;  1VFC A;  4G7O F;  2W57 A;  2VL8 A;  3FIS A;  5M3F J;  4A3I J;  3DKX A;  1V54 H;  2BW3 B;  4V2G A;  1O3S A;  1ZR2 A;  1IN7 A;  2VKV A;  1K78 B;  2R5Y B;  2XHK A;  1T98 A;  4UHT A;  2H8R A;  2GXG A;  2GLO A;  1IXR C;  4X1E A;  1X1B A;  2L54 A;  1DP3 A;  2Y0M A;  1UHW A;  1IG7 A;  2V79 A;  3VPR A;  2Z16 A;  5D8K B;  4XK4 A;  1ULY A;  2H8W A;  3LFK A;  4ON0 A;  4ZZD A;  3F8M A;  1DPU A;  2F2E A;  2B7E A;  1YRN B;  5ILU A;  3FXQ A;  2G9W A;  1X3Z B;  4XLE A;  1VQN I;  3CMA I;  5E1W A;  2QKM B;  2XPU A;  3HOU J;  1BL0 A;  1F4K A;  4UUV A;  2LNB A;  3CP8 A;  3J7Z I;  1UCR A;  2BY1 A;  1FPQ A;  5F04 A;  1LE8 A;  3LSG A;  5M5X J;  5JR3 A;  1G3W A;  3HUG B;  5CJ9 A;  5FLX K;  2ESH A;  2KPM A;  1PUE E;  2E35 A;  3S17 J;  1LUJ B;  1D5V A;  2B63 J;  1NG6 A;  1X4P A;  1KON A;  2PI0 A;  2E19 A;  2V1U A;  5KK1 A;  1JXS A;  2XGX A;  4DGW B;  2BY2 A;  2R93 J;  2R3S A;  1YHQ I;  1KYZ A;  3HXL A;  1TWC J;  2R7R A;  4A3D J;  1JTX A;  2JPC A;  4HG2 A;  1XGS A;  1B59 A;  2JJ7 A;  2ZFW A;  1W7P B;  3BG3 A;  2K9S A;  3K2Z A;  5J1Y A;  2FNP A;  1P92 A;  2ZME B;  2HFH A;  2PFB A;  1L3L A;  3G73 A;  5HLH A;  4B48 A;  5ICC A;  1Z1D A;  2R7W A;  2KLO A;  3F0C A;  2HZT A;  3Q3S A;  5A2Q Z;  2MC4 A;  4LIT A;  4F7Z A;  3IUO A;  3R60 A;  4XOT A;  2R0Q C;  3A4C A;  3DEE A;  5CPR B;  4BXF A;  3D0S A;  2VAS A;  1QA6 A;  4LLG F;  2Z1D A;  2FXA A;  3SFI A;  1D1A A;  2BXZ A;  2LFB A;  1NK2 P;  2RV8 A;  3IAM 2;  4RB0 A;  2CSO A;  4B3X A;  4RB2 C;  1RC9 A;  3HC7 A;  3IC7 A;  5D8L B;  5E3L A;  1D1C A;  2V26 A;  3HHG A;  4RAG A;  2A5Y B;  2COM A;  2VXZ A;  3QAH A;  2JSC A;  3DV8 A;  5DEQ A;  2K9N A;  2QQB A;  5M5W J;  4EJO A;  2WBM A;  4BAC A;  3K70 C;  1C0W A;  1QVT A;  2IGM A;  2NS7 A;  4O3M A;  4XSX F;  2L7F P;  5CVR A;  2IVM A;  2H1K A;  3AL0 B;  4E7H A;  2STT A;  4C9Y A;  3HOX J;  2O03 A;  3U9G A;  2E2J J;  3H5A A;  3GME A;  3CF5 F;  1OCZ H;  2QGU A;  4C3H J;  4EM2 A;  2HR3 A;  2JUC A;  3AL0 C;  4XOP A;  3ERM A;  1WCM J;  3N05 A;  3F23 A;  5F64 A;  1WHU A;  2IGO A;  4PSW A;  4AYB A;  5EF6 A;  4ZYD A;  2DMP A;  3KZY A;  4CIC A;  4IHW A;  2LY9 A;  4XLC A;  1DP7 P;  2MAB A;  2CQN A;  4NC8 A;  4IHX A;  1JKQ C;  5HOD A;  3RSN A;  3KE2 A;  1IW7 F;  1MBH A;  4XKW A;  3DFG A;  4Q4Z F;  3GUD A;  2DT6 A;  5J1U A;  1SD4 A;  1E0E A;  1B1B A;  2LF7 A;  1RR8 C;  1I5Z A;  1Z6R A;  3SZG A;  1S29 A;  2VKE A;  1B6A A;  3OL4 A;  5BS6 A;  3QYF A;  2JSP A;  2PJR B;  4IHT A;  4G9Y A;  2GOX B;  4A3M J;  2IS4 A;  4PUS A;  2KJC A;  2VIX A;  2WY8 Q;  5CYV A;  4NNJ A;  1YX3 A;  1IXS B;  3KLO A;  4F91 B;  2FSW A;  2I5U A;  1QZZ A;  2PMZ N;  4FIS A;  1ZAO A;  1LFU P;  1SFK A;  2BHZ A;  2NVQ J;  1MDM A;  1OCR H;  1V5G A;  2E60 A;  2GWR A;  4L5I A;  1UHS A;  4DW6 A;  3U1D A;  5IOZ A;  4FHT A;  4AD9 A;  2M0C A;  1R49 A;  4MO7 A;  3MVP A;  2JT1 A;  4BE1 A;  4Q5S F;  5BQT A;  5E1X A;  1NK3 P;  3ZQH A;  2VKH A;  2WV1 A;  3FXU A;  1I1S A;  3HSR A;  3WU1 B;  1MZB A;  2GOM A;  2IPQ X;  2W82 A;  2EIL H;  1LVA A;  5JFR A;  4LLL A;  1S9H A;  2HGC A;  4NQW B;  4BYY A;  1A6I A;  1F9N A;  2V7F A;  1TBX A;  2QEN A;  4CCM A;  4HDU A;  1I6H J;  3CLO A;  4BE0 A;  2VBZ A;  4Z6Y A;  3K4C A;  3LL7 A;  3KIO A;  1UJ8 A;  4DBR A;  2MGQ A;  2ZFU A;  2NVU B;  3QP6 A;  4M73 A;  3ZMT A;  3LA3 A;  3WU2 C;  4F52 A;  4OMZ A;  4OIN F;  1U3E M;  1WGX A;  5B66 C;  1N77 A;  3ZQG A;  2X51 A;  2L4A A;  1NH3 A;  5FKM A;  3TOB A;  2KHM A;  3KEO A;  1BW5 A;  2K9M A;  4EM0 B;  4D1Q A;  2NOG A;  3GBG A;  2HYF A;  3MD2 A;  2ZSI B;  2UZK A;  4AC0 A;  5FLX Z;  1FX7 A;  1RIO H;  4FAS D;  1U6G A;  2UUZ A;  3B73 A;  5IOY A;  3LST A;  1ZQ3 P;  2F5D A;  1Z7L A;  2FD5 A;  5BNG A;  2KMU A;  2ELJ A;  4BKX A;  1H8A C;  3OYK A;  2LK2 A;  4LJZ F;  2NYX A;  4MTE A;  4G7Z F;  1ERD A;  4HV5 A;  2ZJQ F;  3IKV A;  2NS8 A;  3CO7 C;  2R7X A;  5FLV A;  2DYS H;  3PUF A;  1JKP C;  3R0J A;  1I3A A;  5EEA A;  1LDK B;  1RR7 A;  2M87 A;  3ZXS A;  4RGR A;  2PJR A;  2PMH A;  2NNN A;  3L2V A;  2GAU A;  4JBA A;  3JSP A;  1OQY A;  1FSH A;  3FM3 A;  3MKW B;  1FSE A;  3ZCO A;  4YIR X;  2M0M A;  4S05 A;  2HWV A;  3WGG A;  3JSO A;  1VQ6 I;  3QRF F;  3VYS B;  1XSX A;  3G71 I;  2Y30 A;  5CVV A;  1J59 A;  2K7L A;  4AIJ A;  2DFF A;  5HDN A;  2MYS A;  3RTR A;  5FRN A;  3P7N A;  2EV0 A;  5DM6 F;  4C2M J;  1W36 C;  2P4W A;  2HXI A;  4KJZ A;  4L9V A;  4PJJ A;  3JR9 A;  2QVO A;  2I10 A;  1E17 A;  4D7N A;  1XMA A;  3FK7 A;  3GEZ A;  3WTV C;  1YYV A;  4I01 A;  4TV7 A;  3DPU A;  4HRI A;  2I8D A;  4B47 A;  4MTD A;  3CCJ I;  3E0J B;  5GPA A;  4PZJ A;  1R9T J;  4JX6 A;  2QUF A;  4CUG A;  4Y15 A;  5FFZ A;  2LH9 A;  3B02 A;  1R7J A;  5ILS A;  5JVG F;  1H9G A;  4HZF A;  2R7T A;  4IQJ A;  1X1D A;  3GXO A;  4UXN A;  3D5L A;  4MQV A;  2WAF A;  3PSI A;  3GFL A;  2DMU A;  2BOL A;  2PMZ A;  3E5Q A;  1TC3 C;  4CDG A;  2DO7 A;  4U7B A;  3OIO A;  2NVT J;  4QLC U;  3I58 A;  3IL2 A;  3K1M A;  2R5Z B;  1HLV A;  1TW3 A;  3E3V A;  2HTS A;  1W7P D;  2CV1 A;  4RB1 A;  4IOA F;  1FOW A;  2CUE A;  1VTN C;  2KZG A;  2F6C A;  1FOY A;  1WWX A;  3PSF A;  2O61 A;  2PMU A;  2JTV A;  3I55 I;  5CQE A;  2D45 A;  5D6F A;  5J4V A;  5FD5 A;  1YW8 A;  2D5V A;  5K7Z A;  1UMQ A;  3KP7 A;  4D5C A;  2IXS A;  5M3M J;  1DDN A;  2DDB A;  2Q1Z B;  2W85 A;  2BXY A;  2HOS A;  4XON A;  1BIA A;  4WXD A;  5H6Q A;  3JTH A;  4BJT A;  4EM1 A;  4HNV A;  1IDY A;  4BDY A;  4AID A;  9ANT A;  1R22 A;  1UEL B;  1UG0 A;  4LFU A;  1MSF C;  2ME6 A;  4QSH A;  1SFX A;  3GWZ A;  5ICG A;  3H36 A;  3ZQL A;  2M3A A;  3BP8 A;  4JP0 A;  2FEZ A;  2DLL A;  3ZMZ A;  3DPT A;  2OTJ I;  3K70 D;  2FX0 A;  3L2R A;  3H5N A;  3RZO J;  3HOZ J;  1VQ5 I;  1R58 A;  3K4K A;  5FKK A;  1OR7 C;  3K0L A;  2EV6 A;  4YRV A;  2VOP A;  3KYL A;  1BR1 A;  3NQO A;  4N0B A;  1JKO C;  5C44 J;  1ZG1 A;  1CF7 B;  4BNC A;  3G1O A;  3HOS A;  1ZYR F;  4XKC A;  3DF8 A;  5F0C A;  3CUQ B;  1MJ9 A;  5TJJ A;  1PDN C;  5L3B A;  4XRS A;  3PFY A;  3CUQ C;  3ULQ B;  3HGG A;  3S14 J;  2ZB9 A;  1HKS A;  3QU3 A;  1EH7 A;  4IHS A;  3CUO A;  2K4B A;  4CSW A;  1AHD P;  2X6W A;  4HEA 2;  1GVD A;  3Q0W A;  2IA0 A;  5CVJ A;  1MBG A;  1XG1 A;  1IUY A;  2XPW A;  2KL4 A;  1Z67 A;  3GTQ J;  5JLW A;  3K4L A;  1YTY A;  4W97 A;  1YG2 A;  1B4A A;  3CF2 A;  3WOD F;  3OR2 C;  4A0Z A;  2O8K A;  5HDG A;  3T0Y A;  1AU7 A;  3U2R A;  3G1L A;  4DYQ A;  3CCL I;  1Y39 A;  2A5W A;  2Q8K A;  2OCC H;  4C30 A;  2HKX A;  2WAE A;  2K4J A;  3NAU A;  4UVB A;  2NRA C;  1RI7 A;  4HNU A;  1Z0X A;  1KQ9 A;  3S2W A;  2FMY A;  4Y33 A;  2VON A;  3GTO J;  2QSG X;  2P7C B;  1T0F C;  5GP9 A;  1KU7 A;  4XLF A;  2Z5U A;  1B72 B;  2XSD C;  5EG0 B;  4M9X A;  4BUP A;  2KIU A;  1BJZ A;  4A6D A;  2L3D A;  2E5N A;  1ZTR A;  1IV6 A;  2F4O B;  3B6A A;  4IHY A;  3J7A O;  3C18 A;  4XKV A;  3SFZ A;  1LEB A;  1R00 A;  1X1P A;  3AG3 H;  3GFJ A;  3I3L A;  2EIM H;  3PIO F;  2E1O A;  2A61 A;  3OYN A;  3KPH A;  1TNT A;  4GGG A;  4GO1 A;  1ZRD A;  2FBH A;  2GIZ A;  3V42 A;  2GA2 A;  3I4N J;  5GTI C;  2HS5 A;  1UST A;  3TO9 A;  1V3F A;  3OSG A;  3KP5 A;  3GVA A;  4R79 A;  1WPK A;  2O0Y A;  2DTR A;  4GYG A;  4EVI A;  1G6N A;  1OR7 A;  3OYB A;  4UUT A;  4ESB A;  2GIV A;  3M8E A;  5J4Y A;  4IRG A;  1I3Q J;  3RQ4 A;  4BY1 J;  3FDY A;  1QPM A;  1TNS A;  4M3B A;  1KU3 A;  2XAF A;  4FCY A;  4HX7 A;  4IHV A;  2W84 A;  4L5J A;  1WFX A;  2MG4 A;  2KIF A;  2VBX A;  4OIR F;  4AVP A;  5K5O A;  2NXN B;  3FMQ A;  3F3X A;  1HW5 A;  1JTY A;  1KGS A;  4M74 A;  1X3W B;  4KNY A;  2QSF X;  3TKY A;  1A5J A;  1ON1 A;  1Y8R B;  3HB9 A;  2MD0 A;  4HYE A;  1P7J A;  5K7H A;  3FXL A;  2DYR H;  3MEX A;  5AIP A;  2KDZ A;  3BPX A;  1HW1 A;  1NG7 A;  1Z77 A;  2CYY A;  2HDW A;  3KX2 A;  4GXO A;  2M4G A;  2IW5 A;  4M6V A;  1TTY A;  3S3N A;  1PVE A;  3U1K A;  2EFO A;  2EH3 A;  1MNE A;  2E71 A;  4O5V A;  3QPS A;  1SC7 A;  3FIW A;  1JT6 A;  4YG2 F;  3OYH A;  4GDF A;  5GAD J;  3RYP A;  1U8B A;  4I98 B;  2Q2E B;  2KIQ A;  1RET A;  1ZLJ A;  4A3B J;  4FQG A;  1E2X A;  1BC8 C;  3CCU I;  3J80 K;  1W4M A;  1SVL A;  3HBL A;  3KEQ A;  3DPL C;  1R5H A;  1W36 D;  4ENK A;  2AHQ A;  1TQP A;  2XRN A;  5BOX A;  4WXC A;  4M6X A;  4A0X A;  3TBI A;  1R1T A;  1T0F A;  1VQK I;  3RYR A;  1SAN A;  3EUH C;  1G3S A;  1P6R A;  3BTJ A;  1VQ7 I;  4U88 A;  1T56 A;  1Y56 A;  2CH0 A;  2M8E A;  3ZMV A;  3J7A Y;  3BT9 A;  3CDL A;  1YI2 I;  1B72 A;  2KDO A;  2FOK A;  1GUU A;  1LPQ A;  2D1H A;  2H6B A;  3HTU A;  1W0U A;  3OWT A;  3MQ0 A;  4OWR B;  4E70 A;  1R71 A;  1YJ9 I;  4A5M A;  1U5T B;  1TLH B;  3MMY B;  4AU7 A;  5FGM A;  3R4K A;  5CVU A;  1ZGA A;  4E7S A;  3L2C A;  3E6C C;  1HF0 A;  5J1R A;  2IP2 A;  2CW7 A;  4M6Y A;  2LBF A;  4LG0 A;  2YSR A;  3CES A;  2GZW A;  3BZ6 A;  3FHN A;  1WJ5 A;  1E3O C;  4U0V A;  3PO2 J;  3K69 A;  4CCJ A;  3VEP A;  3ZN1 A;  1ZAR A;  1T08 B;  3BR1 A;  2ZBK A;  4A3C J;  2VQH A;  2HOA A;  3W6K B;  2CFX A;  2BGC A;  3VDX A;  3K1N A;  2YU9 J;  3M7G A;  2AO9 A;  5KNL A;  2V1N A;  3M8J A;  2VN2 A;  1Y0N A;  2OA4 A;  1FP2 A;  2QQ8 A;  5HLG A;  2CFO A;  1WH5 A;  2HYJ A;  2RGV A;  1R5G A;  4U87 A;  3ABL H;  1XCB A;  2MA3 A;  4YFX F;  2EV5 A;  3ELK A;  2HVQ A;  3FXO A;  3ECH A;  3L7W A;  3FWE A;  3ROU A;  3WU0 A;  1EKE A;  2ME0 A;  4F93 B;  3HGY A;  2P7V B;  3I4M J;  2OU2 A;  4IPA A;  3H9Q A;  4PJN A;  2R7U A;  1R36 A;  4CYC A;  4CCN A;  2JA8 J;  2R7V A;  2HKO A;  1T38 A;  1J0R A;  2DK8 A;  4FET A;  4A12 A;  1D3Y A;  3H5R A;  1W0T A;  2ISZ A;  3TQN A;  3W2W A;  2DOF A;  3WTT C;  1TT0 A;  1AA7 A;  3KET A;  4UUS A;  1MGT A;  2Z9O A;  2LD5 A;  3BQY A;  3IRQ A;  2IA2 A;  3P9C A;  1LKX A;  1IZ1 A;  4M3G A;  2PJP A;  3SDG A;  5K7F A;  1IN8 A;  3L1P A;  3CZ6 A;  1WJB A;  1DQU A;  3COA C;  1REP C;  3I4P A;  2DW4 A;  3DTK A;  2BVM A;  3EUH A;  2G7H A;  1SD6 A;  3S2D J;  1VQ9 I;  1Z91 A;  2EB7 A;  4KIS A;  4II2 A;  2ZKZ A;  5J3L A;  5D5U B;  3OYM A;  3OYA A;  2VQL A;  2DA5 A;  3HTS B;  3BC8 A;  4KIC A;  1FEX A;  2BY3 A;  2CJJ A;  1NTC A;  2IGN A;  3HZJ A;  3MKY B;  2JQ7 A;  4HW0 A;  1VQL I;  3WG9 A;  5KAI C;  2HOT A;  2TDX A;  2RC4 A;  2RKH A;  1MMG A;  1ZRF A;  1FJL A;  1M1E B;  1R4N B;  1YX5 A;  3L2Q A;  2GXB A;  1FZP B;  2O9L A;  1BBY A;  3TW6 A;  3HPH A;  1U0J A;  2QQA A;  2W7N A;  3CLQ A;  2IS6 A;  2CG4 A;  3CCY A;  1VQM I;  2XIG A;  2HZD A;  1KA8 A;  4RGX A;  1A35 A;  2CV2 A;  4M71 A;  4QIW N;  2VOO A;  3K4M A;  3CCS I;  4YFK F;  4AM3 A;  2UXN A;  3CD6 I;  1STZ A;  4LOC A;  1FNN A;  3HL2 A;  2CQ7 A;  3EUA A;  2OV7 A;  2ZME C;  2MH9 A;  4LGW A;  3VOD A;  3E6D A;  3X2Q H;  1ZG5 A;  3DKY A;  4DOZ A;  2LSO A;  2C6Y A;  2CQQ A;  3NEU A;  4DNC A;  5HOO A;  3JTG A;  3BR3 A;  5FKO A;  1JHF A;  4DZJ A;  4CZC A;  2DA7 A;  3EYY A;  4EJT A;  2L9N A;  3DWL E;  3P9I A;  1YS7 A;  3FKJ A;  4IX7 A;  2HEO A;  2QBY A;  3F6O A;  1XGN A;  2RRE A;  1GV2 A;  4M3E A;  2LVS A;  3V8L A;  2GM4 A;  2IEK A;  1BN5 A;  1EJ9 A;  1V55 H;  4GCV A;  2DN0 A;  1HXD A;  4H0E A;  3S93 A;  4I0B A;  4ENJ A;  1VQO I;  4G12 A;  1JGG A;  4Y4R A;  2BW3 A;  3PNY A;  2M7A A;  4NC6 A;  2CW0 F;  3TP0 A;  1U8R A;  1K78 A;  2H27 A;  5KAF C;  2R5Y A;  2VOD A;  2V1X A;  5JLX A;  1K4T A;  4BDZ A;  4AVZ A;  3QWL A;  3CMM A;  4IKF A;  3K10 A;  1X2N A;  2NS0 A;  4II3 A;  3ZN0 A;  3V8K A;  4Z2Y A;  3ABK H;  3HOT A;  3BDD A;  1XX5 A;  3FKI J;  1XD7 A;  2Z3Y A;  4EJW A;  3H3U A;  2V6E A;  2LRE A;  3D5S C;  1SMT A;  1YRN A;  4XM3 A;  2WAD A;  3OYE A;  3MFK A;  5LGN A;  1YW7 A;  2FF4 A;  1UZC A;  4ZYA A;  1O4X A;  1OCC H;  5D5W B;  2LMD A;  1QU3 A;  2AQE A;  2G0E A;  4P9F A;  4OIO F;  2OCE A;  2IS1 A;  1BOB A;  5H6R A;  3ZOB A;  1ODD A;  3OL3 A;  3OYF A;  2XRL A;  1WRJ A;  2EQR A;  3HRM A;  3HUG A;  1E3H A;  1MBF A;  1ZGW A;  4EQQ A;  2TCT A;  1EF4 A;  3DBR B;  1WJC A;  2DMQ A;  5J8C A;  1D5Y A;  2V1D A;  3MCZ A;  1I1G A;  5C3E J;  3BCB A;  2OTL I;  1FP1 D;  3K1P A;  1ORK A;  2RDP A;  5FLM J;  2K02 A;  2E2H J;  4XIC A;  1PUF B;  2QSH X;  5GAG J;  1IC8 A;  1H0M A;  3LSR A;  1W7P A;  1ETW A;  2Y9Z A;  1MBJ A;  5D4S A;  5E18 F;  2WV0 A;  4BE2 A;  1R23 A;  3O2P E;  4N9I A;  3M3Y J;  1QGP A;  2ZME A;  1XCV A;  4V19 K;  2LG4 A;  1XPX A;  1SMY F;  1V4R A;  1FY7 A;  1YLF A;  3FXK A;  3CQZ J;  3SQN A;  3N97 A;  4E4H A;  4I7H A;  2Y31 A;  5F27 A;  3GLX A;  5B1B H;  2ZXH A;  3RPQ A;  3SDB A;  4IOC F;  4JYK A;  4BBR J;  2E1C A;  2ZNY A;  5DYM A;  2EPF A;  1Y0U A;  1H89 C;  2JVH A;  1S6L A;  5DM7 F;  2EFP A;  4QPQ A;  1H9T A;  2BBY A;  1GT0 C;  4YEJ A;  4KT6 A;  4I6Z A;  3RJP A;  2XAH A;  2XRO A;  1W5C C;  1GXQ A;  1U78 A;  2BY0 A;  3CJR B;  4M9S A;  3V8J A;  4ZTF A;  4B1R A;  3GTG J;  3KCC A;  3DCF A;  3OOP A;  3JRE A;  2ZNZ A;  3BY6 A;  2FA5 A;  2JA2 A;  2X6X A;  3I54 A;  3HIF A;  4LK0 F;  1B8I B;  2FU4 A;  1Z3X A;  2FJ1 A;  1QVU A;  1TWH J;  1TQI A;  3AKZ A;  3BWG A;  1MSE C;  3A2K A;  4ZDO A;  1F1Z A;  2M7B A;  3KLN A;  1R5I D;  2DU9 A;  4A69 C;  4WF2 A;  1ZN2 A;  1D0Z A;  4OOI A;  3ERE D;  4L9J A;  1NHA A;  2ELK A;  1AOY A;  3S3O A;  3HSE A;  3T8R A;  4A5N A;  2FQ3 A;  3CDI A;  5IY5 H;  4L9T A;  2HQA A;  1YE9 A;  1LNW A;  5J8F A;  3HSF A;  4LB6 B;  3R0A A;  2JA5 J;  3K4N A;  1T95 A;  2UXX A;  4A2U A;  2X4H A;  2NVX J;  2VPR A;  3RI4 A;  1TZL A;  1VND A;  2IGK A;  2P81 A;  2L7Z A;  3LWF A;  3FBI B;  4XBF A;  1ZHF A;  2M9H A;  2P5L C;  4X0G A;  4YIF A;  1P4A A;  1JI8 A;  1R1U A;  4EEF G;  5CVI A;  1TWA J;  3CCV I;  2W1O A;  3J81 K;  3MN2 A;  3GFM A;  4RLQ A;  3WE3 A;  4A93 J;  1ETX A;  3QPT A;  3RPU A;  4LB5 A;  2X85 A;  3LFU A;  3GZ5 A;  2Y75 A;  5LHH A;  2R7D A;  4C3J J;  2QCO A;  1WJE A;  3WHC A;  3BR0 A;  1QQI A;  2KKO A;  3DLL F;  2DFE A;  1ZRC A;  1YIJ I;  1SFE A;  4E7Z A;  2EIN H;  3HM5 A;  2E1N A;  2WWY A;  1SD7 A;  1GLN A;  2XV4 S;  1OPC A;  3HRU A;  3K7A J;  4UVC A;  4XLA A;  3RKW A;  3UNG C;  3GO5 A;  3I56 I;  2A6T A;  3LSI A;  1UAA A;  3FZV A;  4XR6 A;  4LIV A;  2CGP A;  4G6Q A;  5HS7 A;  3VSK A;  1HST A;  5DCM B;  2BEO A;  4XSZ F;  3PNT A;  1N25 A;  2BVL A;  4HF0 A;  3I0T A;  4D9J A;  2MH2 A;  3DLA A;  1I6X A;  3SHF A;  1RNL A;  4NQW A;  3ZP5 A;  2H09 A;  2E36 A;  5EEG A;  1O3R A;  3HDD A;  2STW A;  5AON A;  4JX5 A;  4ENN A;  2E7X A;  2OPT A;  3CCQ I;  3PO3 J;  2IRF G;  4HX8 A;  3CC4 I;  1P4X A;  5GTH C;  4KIT B;  2XGC A;  4PFO A;  1BIB A;  4L0Z B;  1LDD A;  5DTD A;  4I02 A;  3SEQ A;  4B43 A;  1A36 A;  1VI0 A;  1HDP A;  2O7O A;  3ZRG A;  5BPD A;  4IO9 F;  3GX4 X;  1MMN A;  3HKZ N;  1XB4 A;  3KFW X;  3ZMS A;  5J47 A;  1SVO A;  2WTE A;  4XLP F;  2ZXI A;  3L9F A;  3OV8 A;  4ZDL A;  4D5F A;  3F21 A;  4E7I A;  4G7H F;  4MFE A;  2M8G X;  4IQ4 A;  4I09 A;  1BI1 A;  4RGU A;  1G59 A;  3I59 B;  3DU6 A;  5EGO B;  3BZK A;  1XN7 A;  3DTI A;  2AQF A;  3Q0V A;  3WGI A;  3CO6 C;  3EQL F;  4EAT A;  1MJB A;  1SAU A;  1T33 A;  3OSF A;  3S1R J;  1QBJ A;  4KYW A;  1ZGJ A;  3OS2 A;  3DBH B;  5EZH A;  3IHU A;  2Y0S N;  4L9N A;  5ERI A;  4I99 C;  3T8T A;  2MD5 A;  2MBF A;  3E1S A;  3H35 A;  3P5J A;  4BQQ A;  4XRS G;  3WTW C;  3ZQQ A;  1OYY A;  2KIS A;  3H1C A;  1BOA A;  4W1U A;  2VE8 A;  5DUI A;  3KP6 A;  4HOB A;  1EH6 A;  2R4G A;  3ZQC A;  3LOC A;  2CU7 A;  2Y9Y A;  3ZPL A;  2M1B A;  2KFD A;  3LSH A;  1DU6 A;  1W1W E;  1D8K A;  3IRR A;  3ECO A;  1K7A A;  2ECC A;  1YW9 A;  3DP7 A;  1G8X A;  3BG9 A;  4YII A;  5EJC A;  5HDK A;  3IKT A;  2KIM A;  2XGE A;  4BXX J;  4XRF A;  3FXM A;  2HVS A;  4B44 A;  1WJF A;  4EGZ A;  2GA1 A;  3S3M A;  3CCE I;  3FXJ A;  4BEH B;  4WCG A;  3KYD B;  2A68 F;  2DMN A;  3JRH A;  1ITY A;  2JA7 J;  3SEZ A;  3E6B A;  3M1E A;  4XKB A;  3ABM H;  2L2O A;  4C2T A;  3EUK L;  3BOQ A;  1MMA A;  4ITV A;  2P0W A;  4RB3 C;  3G6E I;  1GVJ A;  2BHY A;  2K27 A;  4ZC3 A;  3CCM I;  4OAY A;  2VJJ A;  3OY9 A;  3TGN A;  1FYM A;  5DD8 A;  1VQ4 I;  2NOJ B;  1AWC A;  3RPU D;  1LEA A;  2DPD A;  2FRH A;  2XKO A;  4QTR A;  5EYR A;  2R5Z A;  1Z05 A;  5LRS A;  5KHD A;  3JRA A;  2UWM A;  2LKP A;  3W2V A;  4DIQ A;  2YR2 A;  2YS9 A;  2ECB A;  3ABU A;  2OC6 A;  1RZ4 A;  3MWM A;  1ZK8 A;  4G8X A;  3TW7 A;  5JI6 A;  2F4I A;  3BTL A;  3O8G A;  3K6G A;  5ICE A;  1JT0 A;  5IP7 J;  4NBQ A;  1J75 A;  4R1H A;  4I0A A;  3HOV J;  5GAH J;  2ZXJ A;  3O8H A;  5L3D A;  1MKM A;  4OIP F;  3S1M J;  3MZH A;  3I5U A;  2K86 A;  4DYR A;  1FC3 A;  2Z33 A;  2XSJ C;  4S04 A;  3J81 Z;  3ZGK A;  5F1R A;  3FHZ A;  2IBD A;  2ZXW H;  2OUM A;  2HDD A;  2E2I J;  2CMP A;  3TO7 A;  3QYE A;  2COB A;  1ZG3 A;  3UKG A;  2DA1 A;  3ZQ7 A;  3F8B A;  5LFA A;  2FOW A;  5HS9 A;  2KJB A;  4J00 A;  4CXF A;  3H0G J;  4JK1 X;  4RMN A;  2MC3 A;  2ZCW A;  1J5Y A;  1FMV A;  4G6T B;  2VKD A;  1MMS A;  3K9T A;  2BZT A;  2LTP A;  4PJ0 C;  3GF2 A;  4PK4 A;  3V4G A;  3HKZ A;  1ENH A;  1GDT A;  4IF4 A;  2WAQ N;  3F72 A;  3RCO A;  4Q48 A;  4U7D A;  1DGR M;  1FMW A;  2DTZ A;  4F55 A;  1BI2 A;  1ETQ A;  4NB5 A;  1APL C;  1ETY A;  3ZQI A;  3DU5 A;  1CF7 A;  5D6E A;  1AKH B;  4A3L J;  3F8C A;  3HEF A;  3A0H C;  2P8T A;  3A0B C;  3CUQ A;  2A3S A;  3E97 A;  1RRJ A;  5DUK A;  4BEH A;  1FIP A;  2XDV A;  2Y0S A;  1SD5 A;  1K6O A;  3OIQ A;  3QPL A;  3H0D A;  5GPC A;  4UV9 A;  2O3F A;  4DQ2 A;  4KDP A;  2WA0 A;  3L2W A;  4DYC A;  3OYJ A;  3AFH A;  1K79 A;  2LP0 A;  2X0L A;  2EZI A;  5DD4 A;  5HNF A;  2WB1 N;  1WZ2 A;  1K83 J;  1OFC X;  5LEJ A;  3BG7 A;  4CCK A;  5HVQ C;  2A07 F;  1RKW A;  2IJL A;  5DDG A;  2QLZ A;  4ZYH A;  4V2F A;  5IT9 K;  1R6R A;  1TW2 A;  3M1C A;  2W24 A;  4IXA A;  3RDI A;  4GYI A;  1IRX A;  3V7R A;  4Y3O A;  5B1A H;  1JUS A;  3JAM K;  2KRF A;  2DA2 A;  3E5U A;  3GTJ J;  4RS8 A;  4JQF A;  1OMI A;  1T6S A;  2E7W A;  1TQM A;  5GAE J;  3FBN B;  3MZY A;  1I27 A;  1VZ0 A;  4CCO A;  4OMY A;  2ZJP F;  3A02 A;  1UFM A;  4PJM A;  4FE4 A;  1N75 A;  2X48 A;  2VC1 A;  1LB2 A;  4XID A;  1SVM A;  1O3Q A;  1S7E A;  3O3K A;  3R61 A;  5AIQ A;  4BJ5 C;  5KCM A;  5EG0 A;  4M3F A;  2K40 A;  4PCQ A;  1VQP I;  4D7M A;  1OIS A;  2MLG A;  3DTE A;  2B0L A;  4KIB A;  1F43 A;  1E3P A;  1D0X A;  4ZYG A;  2ESN A;  2B9S A;  4R8H A;  4HAM A;  1U5T C;  5FRO A;  5CQG A;  4CZZ A;  2HPM A;  5E3M A;  2O6G E;  2E1M B;  2E5Z A;  2JN6 A;  1LE8 B;  5EDN A;  4HF2 A;  3C7J A;  5F6F A;  4NDL A;  4P55 A;  1JJ8 C;  1DUX C;  3MKZ A;  2R92 J;  1MNM C;  1P4W A;  3LA2 A;  1WI3 A;  5HLT A;  1MH3 A;  2RNJ A;  4P5O A;  3ZQF A;  3M9A A;  4Y7N J;  4N4O B;  3ONQ A;  5J6X A;  1J09 A;  3DEU A;  3DXJ F;  2HXO A;  3JRC A;  1W5T A;  2LRD A;  1P2F A;  2VT3 A;  1AKH A;  5F1J A;  4P96 A;  5K5R A;  4CA0 A;  3F9K A;  3ZMD A;  1QNT A;  2DA4 A;  2VBW A;  2XPV A;  3RKQ A;  2QYO A;  1X3U A;  1OCT C;  4ESF A;  4EJU A;  1PP7 U;  3PIP F;  3JRG A;  2L9R A;  2OF7 A;  3A1Y A;  1LQ1 A;  2XAJ A;  2HU9 A;  1IJW C;  3C2H A;  5BMZ A;  1S7O A;  1BI3 A;  1POG A;  1R1V A;  5EEH A;  4KN7 X;  3EYI A;  2HPI A;  3IP4 B;  5FKN A;  3OYD A;  4M3D A;  1LVK A;  1XS9 A;  4GFB A;  2OD5 A;  2Z99 A;  1WQ2 A;  2DCE A;  2WAQ A;  4XNF A;  4UV8 A;  4HPQ A;  1BJA A;  3QOP A;  2Q2E A;  3MKL A;  2XAQ A;  3GCM A;  3IH4 A;  4Y13 A;  3CJN A;  4QPO A;  2ID3 A;  1PYV A;  2VI6 A;  2AS5 F;  5LGU A;  1WI9 A;  4RA2 A;  3LAP A;  1EV7 A;  4A3K J;  2D1V A;  3K4B A;  3V7S A;  2A6H F;  4XRM A;  1S3J A;  2CQX A;  4A3E J;  3EDP A;  1U9N A;  5LHI A;  4YFN F;  4AWX B;  2VLA A;  2R7F A;  3BJ6 A;  2QQ9 A;  1DPR A;  2WB1 A;  2RQP A;  5IT3 A;  1TL8 A;  3T5X A;  6PAX A;  1I39 A;  1U5T A;  1WVR A;  4LD5 A;  2ETH A;  3GYH X;  2P6S A;  2MFZ A;  4UB6 C;  1WSU A;  1PJR A;  4O6J A;  2DFI A;  1FBS A;  4I76 A;  5TIS C;  4MIM A;  1X2M A;  2ELH A;  5EZG A;  1XDS A;  3M4O J;  1J9I A;  3FMS A;  2HYG D;  2EIJ H;  4C3I J;  4KIG A;  1IUF A;  2LKS A;  1YQA A;  2LDU A;  5DCF A;  4XN3 A;  3SZP A;  2PN6 A;  5E1Z B;  3D5R C;  3V7C A;  3VYT B;  1PP8 F;  4D0P A;  1U9O A;  2CW8 A;  3WE2 A;  1Y1V J;  5E3N A;  4B3A A;  2EFN A;  3WTY C;  1YOV B;  4OAZ A;  3CCR I;  4WX9 A;  2LY2 A;  1OCO H;  3ASN H;  1F5T A;  4BHC A;  3HRS A;  2CUJ A;  1TT5 B;  2DJN A;  2L9V A;  1WJA A;  3JW4 A;  4RM3 A;  5E3O A;  1IF1 A;  4KT5 C;  2H94 A;  5DV5 A;  1MBE A;  3S1Q J;  2KQR A;  2K5C A;  1MDM B;  4KN4 X;  3LSM A;  5IT9 Z;  2NVY J;  3QP5 A;  3QOE A;  2F5F A;  3FF5 A;  5B5E C;  3OS0 A;  4X6A J;  4E7L A;  3CC7 I;  4GRI A;  3C1D A;  3J80 Z;  1Y6I A;  4AUX A;  4B8X A;  3T1B A;  2PLY A;  1A6Q A;  3JAM Z;  4DBQ A;  1YFH A;  2O5R A;  4FX4 A;  1X1C A;  3DBL B;  1OLT A;  5HS8 A;  4MHG A;  1OKR A;  1KQ0 A;  1HA8 A;  3S8P A;  3KYC B;  1RUN A;  1ZRE A;  1IAW A;  1IN4 A;  1XSV A;  3WGH A;  1HQC A;  3L2U A;  3H9J A;  3WTS C;  3W6V A;  1WJD A;  5FJ8 J;  3RIR A;  4B09 A;  5HNH A;  1KU2 A;  1QZE A;  5FB2 A;  5JVT A;  2TRT A;  4PSX A;  3S32 A;  1F36 A;  1GV5 A;  3HRT A;  5L3G A;  5E17 F;  4KMF A;  2PEX A;  3NAR A;  4XN0 A;  1JKR C;  2VPL A;  2L01 A;  1P7I A;  3FX3 A;  3R6S A;  1WKM A;  1SFO J;  2W00 A;  2PX9 A;  2ACJ A;  2F5E A;  3JRF A;  4LK1 F;  2YX4 A;  2M4K A;  3QQA A;  2HI3 A;  1YIO A;  1X19 A;  3PM1 A;  2EIK H;  5LEK A;  3BCA A;  4G94 A;  1L0O C;  3TMO A;  2XAS A;  5L3F A;  3DKW A;  3AG4 H;  1Z9C A;  1JUM A;  5M5Y J;  4PDK A;  1XGO A;  2JRM A;  3LQR A;  1A31 A;  1ZEL A;  1J7K A;  3NWS A;  1JE8 A;  3B6C A;  3VSL A;  2OZU A;  2XAG A;  5FFX A;  3LAJ A;  4A3J J;  1RES A;  1K61 A;  2EWN A;  1H88 C;  2OAZ A;  1N78 A;  1TP4 A;  2EK5 A;  5K5Q A;  3H9G A;  4UB8 C;  1IO2 A;  3LMM A;  4M72 A;  3AG1 H;  4RDU A;  4IZZ A;  3ESW B;  2LF8 A;  4Q47 A;  4BGD A;  1EA3 A;  2V9K A;  4ZTJ A;  1MJA A;  2EBI A;  2RN7 A;  1YIT I;  2OZ6 A;  2QF7 A;  4BAY A;  2XB5 A;  1O57 A;  3F8N A;  3OOU A;  3KZI C;  3TED A;  2OQG A;  1MND A;  4OIQ F;  3DQV C;  3MAJ A;  5FO5 A;  5J40 A;  2VQG A;  1GHC A;  2O8X A;  2NAZ A;  4JX4 A;  4IL6 C;  4JOM A;  1XTA A;  3GTK J;  3QOD A;  1MH4 A;  3E6M A;  2F4M B;  1DGW Y;  5IYD J;  2X1E A;  3HG9 A;  3PFI A;  1QHH D;  3BQZ A;  5IP9 J;  5FD6 A;  3IH3 A;  4BL0 B;  3W6J B;  3BR2 A;  1YS6 A;  3Q9V A;  1JGS A;  4HX4 A;  2XB0 X;  1RPW A;  2XKP A;  4BY7 J;  2ZC2 A;  1HKQ A;  2HDC A;  4NC7 A;  1Q1H A;  1S7A A;  1QPI A;  1KQ8 A;  4RAY A;  3OYI A;  2ID6 A;  4I2O A;  1BC7 C;  4BU2 A;  2GBY A;  3P9K A;  4BHP A;  3S2H J;  1K6Y A;  3Q9S A;  1HOM A;  1G3Y A;  2Y2Z A;  2FE3 A;  2H6C A;  1MW7 A;  3TL4 X;  3OMY A;  1T8I A;  3HJE A;  1FOX A;  1SAX A;  1RKT A;  2A6E F;  5DS9 A;  2M34 A;  1HC8 A;  2D2W A;  4XLN F;  4EGY A;  2L7K A;  1S5L C;  4MFD A;  1S72 I;  3CC2 I;  4ENM A;  2DMT A;  1R4M B;  1IGN A;  3WTZ A;  1CGP A;  3VYU B;  2K9Q A;  2F48 A;  2WC2 A;  2V9V A;  3PUB A;  2EFW A;  3CMY A;  1ZLK A;  2XUB A;  2JVG A;  2VUM J;  4AIK A;  1KYW A;  4S0H B;  4BQN A;  5ICF A;  3TDZ C;  2K3F A;  3LSK A;  2QEX I;  4MGR A;  3DEW A;  1UB9 A;  2XAU A;  3JCU C;  4ZDP A;  1XSD A;  1O7L A;  2L0K A;  1JUP A;  4MEY F;  2K85 A;  1PUF A;  4ANJ A;  4E6K G;  2QA4 I;  3PQJ A;  5LHG A;  4P1W A;  1OJL A;  2PQ8 A;  2RNG A;  1XC5 A;  3ABT A;  3K4J A;  2CV0 A;  4RLF A;  3CDH A;  2W48 A;  1O7F A;  5C4J J;  4KUM A;  2Y48 A;  2BE5 F;  2KT0 A;  1B9M A;  3C3W A;  4AIH A;  2OJE D;  1Y1W J;  2MLK A;  2V6C A;  4FTH A;  3TDU C;  1OYI A;  3VB2 A;  1YJN I;  2HTJ A;  1ACI A;  2EZL A;  5F08 A;  5F0F A;  1A04 A;  2XF7 A;  1BA5 A;  1FLI A;  2VJI A;  3PQK A;  3VYR B;  4WWC A;  1WH7 A;  5LGT A;  3QU6 A;  5D5X B;  4G6D A;  4XMY A;  3GTP J;  1HBX G;  4RAF A;  2DK5 A;  2JPB A;  5E79 C;  3K2A A;  5JHU A;  5E8G A;  2IA1 A;  2CQK A;  1G3T A;  2ADU A;  4UNO A;  2GQQ A;  4LIU A;  1B8I A;  1HKT A;  1X58 A;  2VBY A;  5L3E A;  2P6T A;  1ETO A;  3AG2 H;  1LFB A;  2K9L A;  5LBQ A;  3BTI A;  2IAI A;  3J7Y J;  2FQ4 A;  4QWQ A;  1Z7U A;  5TGT A;  4E7K A;  2Y69 H;  3HHH A;  3ZR8 X;  1MMD A;  4CGZ A;  3HYI A;  3LQQ A;  2QKL B;  3SJM A;  2A69 F;  1QZY A;  2L4M A;  2P5V A;  3TP3 A;  3H3V K;  3CP2 A;  3RZD J;  2LOO A;  3A01 B;  3HPG A;  2ZO4 A;  3I71 A;  5E20 A;  4HBL A;  2F5C A;  2LKX A;  2MW8 A;  2GXA A;  4IVN A;  4KIF A;  4LLN A;  3IAS 2;  1SFU A;  3QYB A;  2EZH A;  4ABZ A;  2HVR A;  1V5E A;  1B9N A;  1K4S A;  2K3P A;  2VC0 A;  4XQF A;  5LLQ A;  2HNH A;  3REO A;  2HQN A;  3ISP A;  2E34 A;  3U21 A;  4J01 A;  1V5F A;  2DOE A;  2LC2 A;  4BH9 A;  4IEJ A;  1IXC A;  3M07 A;  5F0H A;  1SEU A;  2XVC A;  5IYB J;  2Q0O A;  2DAO A;  2YU3 A;  2QWW A;  3WHB A;  1IV8 A;  4HF1 A;  1XMK A;  4MNU A;  3MZ8 A;  1USS A;  5HLI A;  2CUF A;  4FT8 A;  1D1B A;  5FRM A;  5L3C A;  1GXP A;  2R7O A;  2A05 A;  1P9Q C;  3BLY A;  1OYW A;  2KP6 A;  3HOW J;  2JMW A;  3LSP A;  2JWT A;  2Z2S B;  1ONV A;  2QM3 A;  5DCM A;  2XC7 A;  3PJR A;  3UR3 C;  2ZSH B;  3G3Z A;  4WK8 F;  1G2H A;  4XOR A;  1Z6T A;  2AXT C;  3ML6 A;  3GLL A;  1Z21 A;  1YO5 C;  1FBQ A;  2L5Q A;  3CTA A;  2EFQ A;  4ZJZ A;  5D5V B;  1HW2 A;  4ESJ A;  4ZYE A;  5CKT A;  2DOA A;  3FXR A;  1UG2 A;  1X4O A;  3S1N J;  4KFC A;  4LG3 A;  1I50 J;  2ISY A;  4H4K C;  2M45 A;  3TOA A;  2JA6 J;  4A3G J;  3BZC A;  3CJT B;  4N9H A;  2X9D A;  1FYL A;  2DA6 A;  2L02 A;  2OBP A;  3GZ6 A;  2DDA A;  4HA8 A;  4HNT A;  2YX7 A;  3NRV A;  2QZ8 A;  1IDZ A;  4A3F J;  2R7Z J;  2RVC A;  1IRZ A;  4IJA A;  1HCR A;  2CO5 A;  2UV1 A;  3BG5 A;  1DU0 A;  2PG4 A;  4MLO A;  2YPR A;  5H2F C;  4L18 B;  2NNY A;  2VE9 A;  4UY8 I;  1ETK A;  3GTM J;  4BJ6 C;  4HDV A;  2R7Q A;  4RGS A;  3IH2 A; 
#chains in the Genus database with same CATH homology
 3BJO A;  3I59 A;  3KP3 A;  3IWZ A;  2W25 A;  1O3T A;  3FM5 A;  3FMR A;  4P9U A;  2P5K A;  4OU0 A;  3KP4 A;  3F6V A;  2HQR A;  5ILV A;  3GW2 A;  3KP2 A;  3AAF A;  2EA2 A;  4UVA A;  1IN6 A;  5K1Y A;  1JHH A;  2JZY A;  3F8F A;  4FX0 A;  2CWE A;  1HSJ A;  3VOE A;  4HLX A;  3E5X A;  4EMS A;  1U2W A;  2DI3 A;  4MQ9 F;  1FT9 A;  4PGG A;  2HOE A;  3BPV A;  5KVR A;  4Y17 A;  2M5W A;  2EJR A;  3RKY A;  3SZT A;  5BPI A;  1XGM A;  1RUO A;  2EA4 A;  2FBI A;  4LG0 B;  3RKX A;  2ZJ2 A;  2FML A;  4BHB A;  4IRH A;  1QO0 D;  3BJA A;  4BXU A;  1T39 A;  3TO6 A;  1FWZ A;  1J2X A;  1EH8 A;  1LDJ A;  3BRO A;  5ED4 A;  4ZZL A;  2FNA A;  4ASN A;  1KU9 A;  1S8N A;  3L09 A;  2J5O A;  4WXH A;  4NHJ A;  3GFI A;  1D8J A;  1ZH5 A;  5A2Q K;  2DPU A;  3WTU C;  1BM9 A;  2DQL A;  4MEX F;  3H3Z A;  1FBU A;  5CLS A;  1UHM A;  3O6B B;  1IRF A;  3EET A;  3M8F A;  4A0Y A;  4KA4 A;  2JRT A;  4KMU X;  3IWF A;  2BYV E;  4A6E A;  2M30 A;  2DBB A;  1G4D A;  2DQR A;  3KZZ A;  2OQR A;  1FYK A;  4EJV A;  1BI0 A;  2IT0 A;  4LMY A;  2J5P A;  4M9Z A;  4EV0 A;  4BQA A;  3L00 A;  2BV6 A;  3I53 A;  1IRG A;  2VT2 A;  2G7U A;  3I64 A;  3QPH A;  4HLY A;  1MD0 A;  2FBK A;  4RAZ A;  3N4M A;  2AXL A;  3H92 A;  1IN5 A;  4U0Y A;  4HV6 A;  3VFZ A;  5LRR A;  4HQE A;  4HQM A;  5D4R A;  1LJ9 A;  3ZMU A;  5TRD A;  4CHU A;  4U0W A;  4CYD A;  1W5S A;  1T2K A;  2PBI A;  2DT5 A;  5E8I A;  4K2E A;  4PGH A;  4L0Y B;  3F22 A;  4ETS A;  1ON2 A;  3WTX C;  1XDU A;  1FOK A;  3LA7 A;  2QBY B;  4ZH4 F;  3SXY A;  3Q5F A;  4CO8 A;  5H20 A;  4IRI A;  4G7O F;  2W57 A;  1O3S A;  1IN7 A;  1K78 B;  2XHK A;  1T98 A;  4UHT A;  2GXG A;  1IXR C;  2L54 A;  2Y0M A;  1UHW A;  2V79 A;  5D8K B;  1ULY A;  3LFK A;  4ON0 A;  4ZZD A;  3F8M A;  1DPU A;  2F2E A;  5ILU A;  3FXQ A;  2G9W A;  5E1W A;  1F4K A;  4UUV A;  2LNB A;  1UCR A;  1FPQ A;  5JR3 A;  1G3W A;  5CJ9 A;  5FLX K;  2ESH A;  1PUE E;  1D5V A;  2PI0 A;  2V1U A;  5KK1 A;  1JXS A;  2XGX A;  2R3S A;  1KYZ A;  2JPC A;  1XGS A;  1B59 A;  2ZFW A;  1W7P B;  3K2Z A;  2FNP A;  1P92 A;  2ZME B;  2HFH A;  2PFB A;  1L3L A;  3G73 A;  5HLH A;  5ICC A;  1Z1D A;  2HZT A;  5A2Q Z;  4F7Z A;  3R60 A;  3D0S A;  4LLG F;  2FXA A;  2RV8 A;  4RB0 A;  2CSO A;  4RB2 C;  3IC7 A;  5D8L B;  3HHG A;  2A5Y B;  2COM A;  2VXZ A;  3QAH A;  2JSC A;  3DV8 A;  5DEQ A;  2QQB A;  4EJO A;  1C0W A;  4O3M A;  4XSX F;  5CVR A;  2IVM A;  2STT A;  2O03 A;  3U9G A;  4EM2 A;  2HR3 A;  3F23 A;  5F64 A;  4ZYD A;  3KZY A;  4CIC A;  1DP7 P;  3KE2 A;  1IW7 F;  4Q4Z F;  3DFG A;  3GUD A;  1SD4 A;  1B1B A;  2LF7 A;  1I5Z A;  1Z6R A;  1S29 A;  1B6A A;  5BS6 A;  4IHT A;  4G9Y A;  2KJC A;  5CYV A;  1IXS B;  3KLO A;  2FSW A;  1QZZ A;  1ZAO A;  1MDM A;  2GWR A;  4L5I A;  3U1D A;  4FHT A;  4AD9 A;  2JT1 A;  4Q5S F;  5BQT A;  5E1X A;  3FXU A;  1I1S A;  3HSR A;  3WU1 B;  1MZB A;  2IPQ X;  1LVA A;  5JFR A;  4LLL A;  2HGC A;  4BYY A;  1F9N A;  1TBX A;  2QEN A;  4HDU A;  3CLO A;  2VBZ A;  3QP6 A;  4M73 A;  3ZMT A;  3LA3 A;  4OMZ A;  4OIN F;  1U3E M;  2L4A A;  3TOB A;  3KEO A;  4EM0 B;  2HYF A;  2UZK A;  5FLX Z;  1FX7 A;  1RIO H;  1U6G A;  3B73 A;  3LST A;  2F5D A;  4LJZ F;  2NYX A;  4MTE A;  4G7Z F;  4HV5 A;  3IKV A;  3CO7 C;  3R0J A;  1LDK B;  2M87 A;  4RGR A;  2PMH A;  2NNN A;  2GAU A;  4JBA A;  3JSP A;  1FSH A;  3FM3 A;  1FSE A;  4S05 A;  2HWV A;  3WGG A;  3JSO A;  3QRF F;  1XSX A;  5CVV A;  1J59 A;  2K7L A;  4AIJ A;  5HDN A;  3RTR A;  3P7N A;  2EV0 A;  2P4W A;  4L9V A;  2QVO A;  1E17 A;  1XMA A;  3GEZ A;  3WTV C;  1YYV A;  4I01 A;  4TV7 A;  4MTD A;  4PZJ A;  2QUF A;  4Y15 A;  5FFZ A;  3B02 A;  5ILS A;  1R7J A;  1H9G A;  4HZF A;  3GXO A;  4UXN A;  3D5L A;  4MQV A;  3GFL A;  3E5Q A;  4CDG A;  2DO7 A;  4U7B A;  4QLC U;  3I58 A;  3IL2 A;  3K1M A;  1TW3 A;  3E3V A;  2HTS A;  1W7P D;  4RB1 A;  1VTN C;  1WWX A;  2O61 A;  2PMU A;  2JTV A;  2D45 A;  5D6F A;  5FD5 A;  1YW8 A;  3KP7 A;  1DDN A;  2W85 A;  1BIA A;  4WXD A;  5H6Q A;  3JTH A;  4EM1 A;  1R22 A;  4LFU A;  1SFX A;  3GWZ A;  5ICG A;  3BP8 A;  2FEZ A;  2DLL A;  3ZMZ A;  3DPT A;  1R58 A;  3K0L A;  2EV6 A;  2VOP A;  3NQO A;  4N0B A;  1ZG1 A;  1CF7 B;  4BNC A;  3HOS A;  1ZYR F;  3DF8 A;  3CUQ B;  1MJ9 A;  5TJJ A;  1PDN C;  5L3B A;  3CUQ C;  3ULQ B;  1HKS A;  3QU3 A;  1EH7 A;  4IHS A;  3CUO A;  2K4B A;  2IA0 A;  5CVJ A;  1IUY A;  1YTY A;  1YG2 A;  1B4A A;  3WOD F;  4A0Z A;  5HDG A;  3T0Y A;  3U2R A;  2Q8K A;  2HKX A;  2K4J A;  4UVB A;  2NRA C;  1RI7 A;  1KQ9 A;  3S2W A;  2FMY A;  2VON A;  2P7C B;  1KU7 A;  2Z5U A;  4M9X A;  2KIU A;  4A6D A;  2L3D A;  3J7A O;  3C18 A;  3SFZ A;  1LEB A;  1R00 A;  3GFJ A;  2A61 A;  1TNT A;  4GGG A;  4GO1 A;  1ZRD A;  2FBH A;  2GA2 A;  2HS5 A;  1UST A;  3TO9 A;  1V3F A;  3KP5 A;  3GVA A;  4R79 A;  2O0Y A;  2DTR A;  4GYG A;  4EVI A;  1G6N A;  1OR7 A;  4ESB A;  2GIV A;  3M8E A;  4IRG A;  1QPM A;  1TNS A;  1KU3 A;  2XAF A;  4HX7 A;  2W84 A;  4L5J A;  4OIR F;  2KIF A;  2VBX A;  4AVP A;  5K5O A;  3FMQ A;  3F3X A;  1HW5 A;  1KGS A;  4M74 A;  4KNY A;  3TKY A;  1ON1 A;  4HYE A;  5AIP A;  3MEX A;  3BPX A;  2CYY A;  1HW1 A;  4GXO A;  2IW5 A;  1TTY A;  2EFO A;  4O5V A;  4YG2 F;  3RYP A;  4I98 B;  1ZLJ A;  1E2X A;  1BC8 C;  3J80 K;  1W4M A;  3KEQ A;  3DPL C;  1R5H A;  4ENK A;  1TQP A;  2XRN A;  5BOX A;  4WXC A;  4M6X A;  4A0X A;  1R1T A;  1T0F A;  3RYR A;  1G3S A;  1P6R A;  4U88 A;  2M8E A;  3ZMV A;  2FOK A;  2D1H A;  2H6B A;  3HTU A;  3MQ0 A;  4E70 A;  4A5M A;  1U5T B;  1TLH B;  5FGM A;  3R4K A;  5CVU A;  1ZGA A;  3E6C C;  3L2C A;  2IP2 A;  4M6Y A;  4LG0 A;  2YSR A;  2GZW A;  3BZ6 A;  4U0V A;  3K69 A;  3VEP A;  3ZN1 A;  1ZAR A;  2ZBK A;  3W6K B;  2CFX A;  2BGC A;  3K1N A;  3M7G A;  2VN2 A;  2OA4 A;  1FP2 A;  5HLG A;  2RGV A;  1R5G A;  1XCB A;  2MA3 A;  4YFX F;  2EV5 A;  3ELK A;  3ECH A;  3L7W A;  3FWE A;  3ROU A;  3WU0 A;  2P7V B;  2OU2 A;  4IPA A;  1R36 A;  2HKO A;  1T38 A;  1J0R A;  2DK8 A;  4A12 A;  1D3Y A;  2ISZ A;  3TQN A;  3WTT C;  3KET A;  1MGT A;  2Z9O A;  3IRQ A;  2IA2 A;  3P9C A;  1IZ1 A;  2PJP A;  1IN8 A;  3COA C;  1REP C;  3I4P A;  2DW4 A;  3EUH A;  2G7H A;  1SD6 A;  1Z91 A;  2EB7 A;  2ZKZ A;  5D5U B;  3HTS B;  4KIC A;  4HW0 A;  3WG9 A;  2TDX A;  2RC4 A;  2RKH A;  1ZRF A;  2GXB A;  1FZP B;  1BBY A;  2QQA A;  2CG4 A;  2XIG A;  1KA8 A;  4RGX A;  4M71 A;  2VOO A;  4YFK F;  2UXN A;  1STZ A;  1FNN A;  2MH9 A;  4LGW A;  3VOD A;  3E6D A;  1ZG5 A;  2C6Y A;  2LSO A;  3NEU A;  4DNC A;  5HOO A;  3JTG A;  1JHF A;  3EYY A;  4EJT A;  3P9I A;  1YS7 A;  2QBY A;  2HEO A;  3F6O A;  1XGN A;  3V8L A;  1BN5 A;  4GCV A;  1HXD A;  4H0E A;  4I0B A;  4ENJ A;  2CW0 F;  1U8R A;  1K78 A;  2H27 A;  2VOD A;  2V1X A;  3ZN0 A;  2NS0 A;  3V8K A;  4Z2Y A;  3HOT A;  3BDD A;  1XD7 A;  2Z3Y A;  4EJW A;  3H3U A;  1SMT A;  3MFK A;  5LGN A;  1YW7 A;  2FF4 A;  5D5W B;  4P9F A;  4OIO F;  5H6R A;  1ODD A;  1WRJ A;  3HUG A;  3HRM A;  4EQQ A;  5J8C A;  2V1D A;  3MCZ A;  1I1G A;  1FP1 D;  3K1P A;  2RDP A;  2K02 A;  1H0M A;  1W7P A;  5D4S A;  5E18 F;  2WV0 A;  1R23 A;  3O2P E;  4N9I A;  1QGP A;  2ZME A;  1XCV A;  1SMY F;  1V4R A;  1FY7 A;  1YLF A;  3SQN A;  3N97 A;  4I7H A;  3GLX A;  3RPQ A;  2E1C A;  2ZNY A;  5DYM A;  1Y0U A;  1S6L A;  2EFP A;  1H9T A;  2BBY A;  3RJP A;  2XAH A;  2XRO A;  1GXQ A;  1U78 A;  4M9S A;  3V8J A;  3KCC A;  3OOP A;  2ZNZ A;  3BY6 A;  2FA5 A;  3I54 A;  4LK0 F;  3HIF A;  2FU4 A;  1TQI A;  3BWG A;  1F1Z A;  3KLN A;  2DU9 A;  4WF2 A;  1ZN2 A;  3ERE D;  4OOI A;  4L9J A;  1NHA A;  1AOY A;  3HSE A;  3T8R A;  4A5N A;  2FQ3 A;  4L9T A;  1LNW A;  5J8F A;  3HSF A;  4LB6 B;  3R0A A;  2UXX A;  4A2U A;  2X4H A;  3RI4 A;  3LWF A;  4XBF A;  1ZHF A;  2P5L C;  4YIF A;  1P4A A;  1R1U A;  5CVI A;  3J81 K;  3GFM A;  3WE3 A;  3QPT A;  3RPU A;  4LB5 A;  3GZ5 A;  2Y75 A;  5LHH A;  2R7D A;  1QQI A;  2KKO A;  1ZRC A;  1SFE A;  2E1N A;  2WWY A;  1SD7 A;  2XV4 S;  1OPC A;  3HRU A;  4UVC A;  3RKW A;  3GO5 A;  3FZV A;  2CGP A;  4G6Q A;  5HS7 A;  1HST A;  5DCM B;  2BEO A;  4XSZ F;  4HF0 A;  3I0T A;  2MH2 A;  1I6X A;  3SHF A;  1RNL A;  4NQW A;  3ZP5 A;  2H09 A;  5EEG A;  1O3R A;  2STW A;  5AON A;  4ENN A;  2E7X A;  2IRF G;  4HX8 A;  1P4X A;  1BIB A;  4L0Z B;  1LDD A;  4I02 A;  5BPD A;  3GX4 X;  3KFW X;  1XB4 A;  3ZMS A;  2WTE A;  4XLP F;  3L9F A;  3OV8 A;  3F21 A;  4G7H F;  4I09 A;  1BI1 A;  4RGU A;  3I59 B;  1XN7 A;  3WGI A;  3CO6 C;  3EQL F;  1QBJ A;  1MJB A;  4KYW A;  1ZGJ A;  3IHU A;  4L9N A;  5ERI A;  3T8T A;  2MD5 A;  2MBF A;  3WTW C;  1OYY A;  1BOA A;  2VE8 A;  5DUI A;  3KP6 A;  4HOB A;  1EH6 A;  3ZPL A;  2M1B A;  1D8K A;  3IRR A;  3ECO A;  1K7A A;  3DP7 A;  1YW9 A;  4YII A;  5HDK A;  3IKT A;  2KIM A;  4XRF A;  4EGZ A;  2GA1 A;  4WCG A;  2A68 F;  3E6B A;  3M1E A;  3BOQ A;  4RB3 C;  1GVJ A;  2K27 A;  3TGN A;  1FYM A;  5DD8 A;  1AWC A;  2DPD A;  1LEA A;  2FRH A;  2XKO A;  1Z05 A;  5LRS A;  2UWM A;  2LKP A;  2YR2 A;  3ABU A;  1RZ4 A;  3MWM A;  4G8X A;  5JI6 A;  5ICE A;  1J75 A;  4R1H A;  4I0A A;  2ZXJ A;  5L3D A;  1MKM A;  4OIP F;  3MZH A;  3I5U A;  2K86 A;  1FC3 A;  2Z33 A;  4S04 A;  3J81 Z;  5F1R A;  3FHZ A;  3TO7 A;  1ZG3 A;  3ZQ7 A;  3F8B A;  5HS9 A;  2KJB A;  4CXF A;  4JK1 X;  2MC3 A;  2ZCW A;  1J5Y A;  3K9T A;  3GF2 A;  3V4G A;  4IF4 A;  3F72 A;  4Q48 A;  4U7D A;  1BI2 A;  4NB5 A;  1CF7 A;  5D6E A;  3F8C A;  2P8T A;  3CUQ A;  2A3S A;  3E97 A;  5DUK A;  1SD5 A;  1K6O A;  4UV9 A;  2O3F A;  4DQ2 A;  4KDP A;  1K79 A;  2X0L A;  5DD4 A;  5LEJ A;  5HVQ C;  2A07 F;  2IJL A;  5DDG A;  2QLZ A;  4ZYH A;  5IT9 K;  1TW2 A;  2W24 A;  4IXA A;  3RDI A;  4GYI A;  3V7R A;  3JAM K;  2KRF A;  3E5U A;  4RS8 A;  4JQF A;  1OMI A;  1T6S A;  2E7W A;  1TQM A;  3MZY A;  1I27 A;  4OMY A;  1UFM A;  2VC1 A;  1LB2 A;  1O3Q A;  3O3K A;  3R61 A;  5AIQ A;  4PCQ A;  2MLG A;  2B0L A;  4KIB A;  4ZYG A;  2ESN A;  4R8H A;  4HAM A;  1U5T C;  4CZZ A;  2O6G E;  4HF2 A;  3C7J A;  5F6F A;  4P55 A;  1DUX C;  1P4W A;  3LA2 A;  2RNJ A;  4P5O A;  3M9A A;  5J6X A;  3DEU A;  3DXJ F;  1W5T A;  1P2F A;  2VT3 A;  4P96 A;  5K5R A;  3ZMD A;  1QNT A;  2VBW A;  2QYO A;  1X3U A;  4ESF A;  4EJU A;  1PP7 U;  1LQ1 A;  2XAJ A;  5BMZ A;  1S7O A;  1BI3 A;  1R1V A;  5EEH A;  4KN7 X;  3EYI A;  2OD5 A;  2Z99 A;  1WQ2 A;  4UV8 A;  1BJA A;  3QOP A;  2Q2E A;  2XAQ A;  4Y13 A;  3CJN A;  2AS5 F;  5LGU A;  1WI9 A;  3LAP A;  1EV7 A;  2D1V A;  3V7S A;  2A6H F;  1S3J A;  3EDP A;  5LHI A;  4YFN F;  4AWX B;  2R7F A;  3BJ6 A;  2QQ9 A;  1DPR A;  2RQP A;  5IT3 A;  3T5X A;  6PAX A;  1U5T A;  4LD5 A;  2ETH A;  3GYH X;  2P6S A;  1WSU A;  4O6J A;  2DFI A;  1FBS A;  2ELH A;  1XDS A;  1J9I A;  3FMS A;  2HYG D;  4KIG A;  1YQA A;  2LDU A;  5DCF A;  3SZP A;  2PN6 A;  5E1Z B;  3V7C A;  1PP8 F;  4D0P A;  3WE2 A;  2EFN A;  3WTY C;  4WX9 A;  1F5T A;  4BHC A;  3HRS A;  3JW4 A;  1IF1 A;  4KT5 C;  2H94 A;  5DV5 A;  1MDM B;  4KN4 X;  5IT9 Z;  3QP5 A;  2F5F A;  3FF5 A;  3C1D A;  3J80 Z;  4B8X A;  3T1B A;  2PLY A;  3JAM Z;  1YFH A;  4FX4 A;  5HS8 A;  4MHG A;  1OKR A;  1KQ0 A;  1RUN A;  1ZRE A;  1IAW A;  1IN4 A;  1XSV A;  3WGH A;  1HQC A;  3WTS C;  3RIR A;  4B09 A;  1KU2 A;  5FB2 A;  5JVT A;  3HRT A;  5L3G A;  5E17 F;  4KMF A;  2PEX A;  2L01 A;  3FX3 A;  3R6S A;  1WKM A;  2ACJ A;  2F5E A;  4LK1 F;  2YX4 A;  1YIO A;  5LEK A;  4G94 A;  1L0O C;  2XAS A;  5L3F A;  3DKW A;  1Z9C A;  4PDK A;  1XGO A;  3LQR A;  1J7K A;  1JE8 A;  3LAJ A;  2OZU A;  2XAG A;  5FFX A;  2EWN A;  2OAZ A;  2EK5 A;  5K5Q A;  4M72 A;  2LF8 A;  4Q47 A;  1MJA A;  2RN7 A;  2OZ6 A;  4BAY A;  1O57 A;  3F8N A;  2OQG A;  4OIQ F;  3DQV C;  3MAJ A;  5FO5 A;  1GHC A;  2O8X A;  2NAZ A;  3E6M A;  3PFI A;  5FD6 A;  3W6J B;  1YS6 A;  3Q9V A;  1JGS A;  4HX4 A;  2XKP A;  1HKQ A;  2HDC A;  1Q1H A;  1S7A A;  1KQ8 A;  4RAY A;  4I2O A;  1BC7 C;  3P9K A;  4BHP A;  3Q9S A;  1G3Y A;  2FE3 A;  2H6C A;  1SAX A;  2A6E F;  4XLN F;  2D2W A;  4EGY A;  4ENM A;  3WTZ A;  1CGP A;  2WC2 A;  2V9V A;  2EFW A;  1ZLK A;  2XUB A;  4AIK A;  1KYW A;  5ICF A;  3TDZ C;  4MGR A;  1UB9 A;  1XSD A;  1O7L A;  4MEY F;  3PQJ A;  5LHG A;  2PQ8 A;  3ABT A;  3CDH A;  1O7F A;  4KUM A;  2Y48 A;  2BE5 F;  3C3W A;  1B9M A;  4AIH A;  2MLK A;  2V6C A;  3TDU C;  1OYI A;  3VB2 A;  2HTJ A;  1A04 A;  1FLI A;  3PQK A;  4WWC A;  5LGT A;  3QU6 A;  5D5X B;  4G6D A;  1HBX G;  2DK5 A;  2JPB A;  5JHU A;  5E8G A;  2IA1 A;  2CQK A;  1G3T A;  2ADU A;  4UNO A;  2GQQ A;  1HKT A;  2VBY A;  5L3E A;  2P6T A;  5LBQ A;  4QWQ A;  1Z7U A;  3HHH A;  4CGZ A;  3HYI A;  3LQQ A;  2A69 F;  1QZY A;  2L4M A;  2P5V A;  3I71 A;  2ZO4 A;  5E20 A;  4HBL A;  2F5C A;  4IVN A;  4KIF A;  4LLN A;  1SFU A;  1B9N A;  2VC0 A;  5LLQ A;  3REO A;  2HQN A;  3ISP A;  4BH9 A;  1IXC A;  2XVC A;  2Q0O A;  2DAO A;  2YU3 A;  2QWW A;  4HF1 A;  1XMK A;  4MNU A;  1USS A;  5HLI A;  4FT8 A;  5L3C A;  1GXP A;  1OYW A;  1ONV A;  2QM3 A;  5DCM A;  3G3Z A;  4WK8 F;  1Z6T A;  3ML6 A;  1YO5 C;  1FBQ A;  3CTA A;  2EFQ A;  5D5V B;  1HW2 A;  4ESJ A;  4ZYE A;  3FXR A;  4KFC A;  2ISY A;  2M45 A;  3TOA A;  4N9H A;  1FYL A;  2L02 A;  2OBP A;  3GZ6 A;  4HA8 A;  2YX7 A;  3NRV A;  2QZ8 A;  2RVC A;  4IJA A;  2CO5 A;  2PG4 A;  2YPR A;  4L18 B;  2NNY A;  2VE9 A;  4HDV A;  4RGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...