4LB6B

Crystal structure of pkz zalpha in complex with ds(cg)6 (tetragonal form)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
b'ENEIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDNKRPVWNLVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase containing Z-DNA binding domains
publication title Structural basis for Z-DNA binding and stabilization by the zebrafish Z-DNA dependent protein kinase PKZ.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase/dna
total genus 20
structure length 63
sequence length 63
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lb6B00
3TQNA 3RYPA 1BIBA 1YW9A 2FU4A 3GUDA 1YW7A 1B9MA 3G73A 3V8LA 4MGRA 1R23A 4QLCU 1WQ2A 4HQMA 3L2CA 2DI3A 3DV8A 2EK5A 5LGUA 2EV0A 1EH8A 5KVRA 1BI1A 4LLGF 3RPUA 1MDMA 2DAOA 1LVAA 2OD5A 2JZYA 4MEXF 2MH9A 3WTWC 4PCQA 1SAXA 2V1XA 4OU0A 2DTRA 4L0ZB 1XGSA 2NAZA 4ZZLA 3QP5A 2MC3A 3O6BB 2KIMA 1LJ9A 3M8FA 1YS7A 3E6DA 1S8NA 1GHCA 4KA4A 4LJZF 5ICFA 2KIFA 5LRRA 5DD4A 3GLXA 1E17A 4XSXF 3D0SA 5E18F 1MD0A 3DXJF 4M6YA 3QU3A 1LB2A 1X3UA 1FSEA 3I0TA 1Q1HA 1W7PA 3V8JA 2EA2A 3HOSA 3WTUC 3BWGA 1HW1A 1YW8A 2ZNZA 3F8MA 1HKSA 2L4AA 3F8NA 3T8RA 2RGVA 4AIKA 4A0ZA 5ERIA 2M1BA 2D45A 3RKXA 4M72A 4LK0F 4KNYA 1LQ1A 2KIUA 4YIFA 4TV7A 1IAWA 4L0YB 1HSJA 3FM3A 5DD8A 2O6GE 2QENA 3HTSB 4EM2A 3GZ6A 3HRTA 1J59A 3T8TA 1QZYA 1XSVA 3K1MA 4GO1A 1J75A 4CZZA 1R5HA 1ZRCA 2CG4A 4FX4A 1J0RA 2VT3A 3U1DA 2E7WA 1DDNA 2D2WA 2W24A 3FM5A 3REOA 1HKTA 4HF2A 4ZYEA 3BDDA 4N9HA 3KZYA 4MTDA 3AAFA 1ZARA 1YIOA 1QQIA 2XKPA 2DQLA 4HYEA 2BV6A 3ULQB 1I6XA 1ON1A 2P6TA 3VFZA 2HTSA 5HS9A 1U5TB 3V7RA 4IF4A 2HQRA 4YFKF 5J8FA 4ENMA 2DK5A 4KICA 2GIVA 3ERED 1K78A 4WXHA 1IUYA 4EJTA 2OAZA 4KIFA 3LWFA 1R1VA 2VONA 4L9JA 4Q47A 5E8GA 3H3UA 3FMRA 2ZNYA 2DW4A 3V7CA 5FB2A 5ICCA 2ESNA 2FEZA 2RVCA 1UB9A 5F1RA 3KP6A 4CGZA 4DQ2A 4HF0A 5D8LB 3WU1B 4XLNF 3ECHA 2A69F 4UV9A 5IT3A 2DBBA 3KEOA 2QLZA 2W57A 1BI3A 2IPQX 3DFGA 4EJWA 4CDGA 2XASA 3GFLA 5ICEA 3DP7A 1G6NA 4FT8A 4LGWA 5FFZA 2RQPA 2HYFA 2EV6A 1DPUA 2GA2A 1WWXA 4A5NA 4LB6B 3BJ6A 4EJOA 3SZPA 1U3EM 1LEBA 1V3FA 2HDCA 5HLIA 5BS6A 5ILSA 3NQOA 3MZHA 2FBHA 2VOPA 2E1CA 4WCGA 1REPC 3I59A 1SD6A 1OYYA 2OQRA 3FZVA 3LA3A 3GO5A 2PLYA 3QPTA 4CICA 1R5GA 1P4WA 1GVJA 5L3EA 3N4MA 2F5CA 5DCFA 3HTUA 1IN6A 1MDMB 3BPVA 5H6QA 2P5VA 1F1ZA 2M30A 3FX3A 1L0OC 5K5OA 2QUFA 3R0AA 4B8XA 5DUIA 2GZWA 5TRDA 3SQNA 1R7JA 4HDVA 2ZFWA 1WRJA 2ZKZA 3QPHA 1V4RA 2BBYA 3TKYA 2OU2A 2NNYA 1ZG5A 2Z3YA 2CGPA 1W7PB 4D0PA 1O3TA 5LHIA 2B0LA 1TW2A 2XIGA 2EFOA 3M7GA 1P6RA 3HRMA 1O3SA 1ZHFA 2QQ9A 4XRFA 3ZMTA 3T5XA 2JTVA 3H3ZA 4KDPA 2A5YB 4I2OA 3RI4A 2UXNA 3M1EA 4KMFA 3HRUA 4BHPA 2M5WA 4L9NA 1H9TA 3TO9A 3MQ0A 2IVMA 1XD7A 1S7AA 1I1SA 2GAUA 3DPLC 1W4MA 2H09A 4UVBA 1PDNC 1IXCA 2FMYA 5DCMA 2RNJA 3GFIA 3C7JA 4KIBA 1TBXA 3BZ6A 1J7KA 1B4AA 5DUKA 4N9IA 5EEHA 3WTYC 4BQAA 4OINF 1FYKA 1ZRFA 5KK1A 4HX7A 4BH9A 3WTZA 3ELKA 4GGGA 1FNNA 4ZH4F 4RS8A 1B1BA 3F21A 5L3GA 3BPXA 1H9GA 1S29A 1MKMA 4P9FA 1P4AA 3B02A 1D8KA 4KT5C 1K78B 3WTSC 4UVAA 4BHCA 4EGYA 3R61A 1KU3A 3ZMSA 3IWFA 2MLGA 1PP7U 2X4HA 3L09A 4FX0A 2P6SA 5LBQA 3EYIA 5BQTA 2DPDA 1RZ4A 2GXBA 2ISZA 4MTEA 4BNCA 2FRHA 1ULYA 2XGXA 3V7SA 1IN8A 2F5EA 3HIFA 1Z7UA 3C18A 2ZCWA 3I58A 3C3WA 1Z6RA 2FQ3A 4JBAA 3OOPA 5A2QK 1JHHA 5L3DA 4I01A 4ESFA 5CLSA 3HSRA 3Q9SA 3ZQ7A 1K7AA 2F5DA 5IT9K 1XCBA 3J81Z 3E3VA 2FNAA 4HZFA 2DPUA 3LSTA 4N0BA 3I53A 5FD6A 1AWCA 1WKMA 1XCVA 2WV0A 1HQCA 2EA4A 2JRTA 5K1YA 1GXPA 1O3QA 3KP7A 6PAXA 3E5QA 5FGMA 3P9KA 1USTA 3IL2A 3K2ZA 3I59B 3RYRA 2PEXA 1YLFA 2PFBA 3I4PA 2C6YA 3TOAA 5CVJA 1HW5A 5JVTA 1S6LA 5FLXZ 3WGGA 5DYMA 3FMQA 3R60A 2EFPA 4B09A 3QP6A 4S04A 2CSOA 4XLPF 1D3YA 1SD5A 3ZMZA 5ILUA 1BI2A 5JFRA 4YFXF 4QWQA 2L3DA 2L01A 3MEXA 2EFNA 3RTRA 5K5RA 3R6SA 2QZ8A 2BEOA 3DEUA 4ESJA 1T98A 4IRIA 4LD5A 4MEYF 2R7FA 1IN7A 4KMUX 1HXDA 4CXFA 2XV4S 2Q8KA 4I0BA 4EJUA 3EYYA 1HKQA 2VBXA 2HR3A 4I0AA 3WE3A 2LSOA 4RGRA 4U7BA 3VEPA 1FWZA 3Q9VA 2ACJA 2YPRA 1JE8A 4IHTA 5HLHA 4AIHA 2J5OA 3VB2A 3E5XA 4RB2C 2VBZA 4JQFA 2J5PA 2XVCA 5ICGA 2RV8A 2GXGA 2XAFA 1T0FA 3LAPA 4HDUA 1XGMA 3ZMUA 1IN5A 3QU6A 3IHUA 2A6EF 3K1NA 1FBQA 5E20A 5DCMB 1IRFA 3P9CA 2Z33A 4WK8F 1D8JA 1OKRA 4Y15A 1F5TA 3PFIA 1IZ1A 4WXDA 1ZREA 4U0VA 3J81K 4O3MA 1TNSA 2ETHA 2Y0MA 3KLNA 3J7AO 3ABTA 1OMIA 1FBSA 2KRFA 4UHTA 2V6CA 4KFCA 1TLHB 3HHHA 2A61A 2A07F 1LDDA 2WC2A 1MJBA 4ON0A 2RKHA 3DF8A 1KU9A 1Z1DA 4NHJA 4CO8A 1OYIA 1F9NA 2M87A 5D4RA 5HS8A 2XROA 1I5ZA 1RUOA 1U78A 3GZ5A 1XB4A 3L9FA 3JW4A 3ROUA 1G3SA 2A6HF 1QPMA 5BOXA 4E70A 1FPQA 1FT9A 1R1TA 5LGTA 4EQQA 4G8XA 2FBIA 1BC7C 4EMSA 5FLXK 3S2WA 1UFMA 1LDJA 2FNPA 1L3LA 2ADUA 3E6CC 1CF7A 4ZYDA 2F5FA 5CJ9A 5HDKA 4HV5A 3ML6A 1PP8F 5LEJA 1BOAA 3P9IA 3GFJA 2IA0A 3VODA 4PDKA 2RDPA 1XDSA 2W85A 2ISYA 3B73A 1IXSB 3K69A 3V4GA 2O3FA 1P2FA 1EV7A 4ZZDA 2STTA 2RN7A 2M45A 3H92A 5F6FA 1K79A 2P4WA 2DQRA 3TGNA 1KGSA 4IPAA 3GF2A 1ZG1A 4MNUA 3U2RA 3CO7C 3WTXC 4YG2F 1BJAA 5D8KB 2E7XA 5L3BA 1HW2A 3TO6A 2PI0A 2VC0A 3Q5FA 4I09A 1T39A 1W7PD 1ZGJA 4ASNA 3HHGA 4OIOF 4G6DA 4KUMA 3G3ZA 3HSFA 2ZMEA 3BY6A 2KJCA 4RB3C 2CWEA 2PBIA 2QVOA 3WTVC 4Y13A 1R00A 3KFWX 2LF7A 4L5IA 2A68F 4LG0A 3R0JA 3F22A 2DT5A 5D6EA 3RKYA 2L02A 4O6JA 1XN7A 2LF8A 4WX9A 2G7HA 4OIPF 1BN5A 2O8XA 3LA2A 1K6OA 5FD5A 1FSHA 4K2EA 2IRFG 4ENNA 2FE3A 5J6XA 1BBYA 1MJ9A 3VOEA 1O7FA 4I7HA 4WWCA 1ZLKA 2VXZA 4LLNA 1STZA 2OA4A 3J80Z 4UV8A 5LLQA 2HKOA 5L3FA 2JT1A 4L5JA 2XAGA 1QBJA 4PGGA 1OYWA 4M71A 2OZUA 3CJNA 5LGNA 3R4KA 4PZJA 1YFHA 2ELHA 1RI7A 2H6BA 1KU2A 3GWZA 4LLLA 1R1UA 4KIGA 4BAYA 3RPQA 1ZN2A 1GXQA 3MWMA 4RB0A 3D5LA 2DLLA 3JSOA 1ON2A 4MHGA 4YFNF 2VE9A 3O3KA 3OV8A 3WTTC 3LAJA 1IRGA 4R8HA 5AIPA 1FZPB 1BIAA 1KQ0A 3CDHA 3WE2A 1FYLA 2PMUA 1SD4A 1XSDA 5E17F 4HV6A 4HX4A 2HYGD 2XAQA 3GW2A 4ENJA 3GEZA 4HW0A 1DPRA 1XGNA 1Z9CA 2CYYA 4RB1A 2BGCA 2A3SA 3JSPA 2W25A 1EH7A 4OMYA 4S05A 4IHSA 1BI0A 2MBFA 4UUVA 1O3RA 2UWMA 1Z91A 2K27A 2NS0A 2OBPA 4RGXA 2CFXA 3IC7A 5H6RA 3KZZA 2EV5A 3QOPA 5FO5A 3ZN1A 1XDUA 3SXYA 2ZXJA 4XSZF 1XSXA 1Y0UA 3QRFF 4U7DA 3GFMA 2LNBA 1DP7P 3DKWA 2D1VA 5HDGA 2AXLA 4CHUA 2VN2A 3C1DA 1CF7B 2QQAA 4G7HF 4CYDA 3EETA 4BYYA 4Q5SF 5J8CA 1ZG3A 2JPBA 3TO7A 5ED4A 3L7WA 5D5UB 1G4DA 3HRSA 4EGZA 2DK8A 4ETSA 3CO6C 2HZTA 3GXOA 4P9UA 2IT0A 4BHBA 1O57A 4LB5A 1KU7A 4HLYA 1C0WA 1LEAA 4WXCA 4OIQF 4DNCA 5HOOA 2FF4A 2UZKA 4IVNA 2L4MA 2JPCA 1ZYRF 1IW7F 1OPCA 4HF1A 1RUNA 2VBYA 4Z2YA 4RGUA 1S7OA 5CVVA 5D4SA 2Q0OA 1NHAA 1Z6TA 2Y75A 4M9XA 2FMLA 1TTYA 3EDPA 1UHMA 3IKTA 3IKVA 5JR3A 2FSWA 2ZMEB 3HYIA 3ZPLA 1ZGAA 1T38A 2E1NA 2BYVE 2FA5A 4HBLA 4LG0B 1FY7A 3DPTA 4JK1X 1A04A 1SFEA 4A0YA 4KN7X 2W84A 2EFQA 2OZ6A 1ODDA 4A6DA 2NNNA 1D5VA 2FBKA 5CYVA 3JAMZ 5FFXA 4HX8A 3KP2A 2HS5A 3F8CA 4Q4ZF 1TW3A 2XAHA 1AOYA 3WG9A 3FXQA 1IN4A 3I5UA 3U9GA 4WF2A 2ZJ2A 1FP2A 4HQEA 1Z05A 3KP5A 3HOTA 3IRQA 1U2WA 2IW5A 3V8KA 1IXRC 4IXAA 4L9VA 2HEOA 3SHFA 2ZBKA 5AONA 1ZH5A 5BPDA 1U6GA 2KKOA 3I54A 2XRNA 1MZBA 2H94A 5CVUA 3ZMDA 1W5TA 1BM9A 2MA3A 1SFUA 2DFIA 2XKOA 4HLXA 2IA1A 2O61A 2R7DA 3CTAA 2HKXA 3GYHX 2P8TA 3NRVA 2WWYA 4ZYGA 1FYMA 4L9TA 3TDUC 1YYVA 2FXAA 3KETA 2G9WA 4BXUA 3KP4A 4EM1A 1KYZA 1H0MA 3RIRA 3LQQA 5E8IA 4M74A 4UNOA 4LFUA 3FXRA 2MLKA 2K4JA 4MQ9F 2CW0F 3FHZA 1QNTA 2UXXA 1R58A 2RC4A 3LQRA 4PGHA 3L00A 2H27A 2F2EA 3MAJA 3RKWA 3CUQC 3IWZA 2Y48A 2M8EA 1J2XA 1DUXC 3WGHA 4G7OF 1TQIA 5D5WB 3M8EA 1ZAOA 5E1WA 1YTYA 4F7ZA 1FP1D 1VTNC 3BJAA 2HOEA 4GYGA 1BC8C 2Z5UA 4EM0B 4MQVA 1B6AA 2PN6A 2WTEA 4U88A 1QZZA 5D5VB 4A6EA 3ECOA 3ZMVA 2EWNA 1T2KA 1P4XA 3FF5A 3MCZA 2YX4A 2ZO4A 3KP3A 3JAMK 4RGSA 3JTGA 2NYXA 3TDZC 3T0YA 3CUOA 2HGCA 3JTHA 1UCRA 4HA8A 2EFWA 5JI6A 4R1HA 5D6FA 2DO7A 2GA1A 1XMAA 3FMSA 2K86A 2YSRA 1SFXA 4I02A 2QM3A 4OOIA 2PJPA 5JHUA 3F3XA 2CO5A 1J9IA 3E5UA 4NQWA 3FXUA 1I1GA 1T6SA 4P55A 2FOKA 3PQKA 4HOBA 3RDIA 1MJAA 4G6QA 3NEUA 4IJAA 5LHGA 4KYWA 3T1BA 1G3YA 5EEGA 2O0YA 5L3CA 1FOKA 1TQPA 3K1PA 4I98B 3K9TA 2XUBA 2PQ8A 2XHKA 3CUQA 5ILVA 1EH6A 2ESHA 1CGPA 2XAJA 4P96A 1HBXG 3BP8A 4ZYHA 3F6VA 2NRAC 3I64A 2P5LC 3E97A 1YG2A 3F6OA 3TOBA 2AS5F 1O7LA 2YR2A 4GCVA 1FBUA 4M73A 1G3TA 4NB5A 1P92A 1LDKB 5LEKA 2TDXA 2VODA 3BROA 2L54A 4R79A 2QBYA 4IRGA 4AIJA 2X0LA 2D1HA 3E6MA 2QYOA 3P7NA 1U8RA 3IRRA 2V79A 2V1DA 2HQNA 3MZYA 2EB7A 1J5YA 1QGPA 2K02A 5HLGA 5AIQA 2P7VB 3F8BA 2DU9A 4H0EA 4Y17A 2PG4A 1YQAA 4A0XA 1KQ8A 1KA8A 5K5QA 4XBFA 4G7ZF 1TQMA 3E6BA 1B59A 4L18B 1G3WA 5DV5A 1USSA 4FHTA 4LMYA 3F72A 3GX4X 3SFZA 4ENKA 3W6JB 1IF1A 1JXSA 1U5TC 2MD5A 3SZTA 2COMA 3O2PE 5A2QZ 2HFHA 4M9SA 5F64A 3KLOA 4EV0A 3F8FA 5E1XA 1WI9A 3I71A 1JHFA 1WSUA 1S3JA 5IT9Z 4AD9A 4AWXB 1SMTA 1B9NA 4A12A 4AVPA 1MGTA 2K4BA 2QQBA 2Z99A 5HVQC 2VBWA 3GVAA 5HS7A 4U0YA 5LHHA 2V9VA 3ISPA 3EQLF 4U0WA 5H20A 3FWEA 3EUHA 5E1ZB 4GXOA 1PUEE 1FC3A 2H6CA 3W6KB 2QWWA 4UVCA 4HAMA 2HWVA 3LFKA 3PQJA 4GYIA 3KCCA 3RJPA 2VT2A 1ZRDA 1ZLJA 3WGIA 4IRHA 1F4KA 1JGSA 3ZN0A 4A5MA 2Q2EA 2LKPA 3MFKA 4UXNA 1LNWA 1XGOA 4OIRF 3LA7A 5TJJA 2GQQA 5HDNA 4G94A 1R22A 1SD7A 1XMKA 2STWA 2MH2A 4M9ZA 4KN4X 3DQVC 2BE5F 1E2XA 1KYWA 1RNLA 3WU0A 1UHWA 3K0LA 3COAC 3BJOA 2GWRA 2IA2A 4YIIA 5DDGA 4P5OA 1YO5C 2HTJA 5CVIA 1U5TA 1QO0D 3HSEA 4LK1F 4Q48A 3BOQA 2G7UA 3ZP5A 1SMYF 1ONVA 2P5KA 2YU3A 4RAZA 4A2UA 1OR7A 3CLOA 2EJRA 3N97A 4G9YA 4EJVA 5BPIA 2Z9OA 2IJLA 4O5VA 2K7LA 3J80K 3HUGA 5CVRA 2V1UA 3CUQB 2VC1A 1HSTA 2OQGA 2R3SA 4ESBA 1W5SA 2VE8A 3M9AA 2O03A 3WODF 1YS6A 4OMZA 1FLIA 5BMZA 1R36A 1I27A 1TNTA 2PMHA 2P7CB 2CQKA 3KEQA 5DEQA 3ABUA 1KQ9A 4EVIA 3KE2A 1FX7A 4RAYA 2YX7A 4M6XA 2VOOA 1RIOH 3QAHA 2QBYB 2LDUA 2IP2A 2JSCA 5D5XB 3F23A 2KJBA 5LRSA
chains in the Genus database with same CATH superfamily
3TQNA 3RYPA 2XC7A 1BIBA 3A4CA 3A01A 3A0HC 1YW9A 2FU4A 1EF4A 2BXZA 1DGWY 3NWTA 1OCPA 4ZYAA 3GUDA 1YW7A 1H88C 1BW6A 1V5GA 3TBIA 1B9MA 2LY2A 3G73A 5J3LA 3V8LA 2IAIA 4MGRA 1R23A 3FK7A 4QLCU 1WQ2A 3CJTB 4HQMA 3L2CA 2DI3A 4D7NA 3DV8A 2EK5A 4CSWA 1J09A 1MMAA 3L2RA 1O4XA 5LGUA 2EV0A 1EH8A 5KVRA 3DTIA 1BI1A 2QQ8A 4LLGF 3RPUA 3TP0A 1MDMA 1HF0A 1A31A 5IP6A 2DAOA 1LVAA 2OD5A 2JZYA 4DGWB 4C3IJ 4MEXF 2MH9A 2DT7B 3WTWC 4DW6A 4PCQA 1SAXA 5TISC 2V1XA 4OU0A 2DTRA 4XOPA 1X1BA 2AXTC 3I56I 4L0ZB 2E2IJ 2DJIA 1A6QA 1XGSA 5C4JJ 1X4PA 2TRTA 1PUFA 2NAZA 4ZZLA 1RR8C 4I6ZA 3QP5A 1D0ZA 2MC3A 3O6BB 2KIMA 3S3OA 4A3FJ 2VJJA 3HOVJ 1LJ9A 3G71I 4JX4A 3M8FA 1RR7A 5KHDA 1YS7A 3BR3A 3E6DA 1S8NA 3V42A 1YHQI 1GHCA 1RPWA 4KA4A 4LJZF 5ICFA 2KIFA 5LRRA 3RZOJ 5DD4A 3GLXA 1E17A 1MBKA 4XSXF 3DEEA 3D0SA 5E18F 1MD0A 3DXJF 4M6YA 3QU3A 1LB2A 1X3UA 1FSEA 2BW3B 2ZC2A 3I0TA 5KAFC 1Q1HA 1W7PA 4CCLA 4ZTFA 3V8JA 1JUPA 3OS0A 2EA2A 3HOSA 3DKXA 1PJRA 3WTUC 2BY1A 3QODA 3BWGA 1HW1A 1YW8A 2ZNZA 3F8MA 1HKSA 2WAQN 3H0DA 1WJDA 2L4AA 3F8NA 3J7AY 4B48A 3T8RA 4KISA 2PMZN 1WI3A 2FUG2 2RGVA 3HBLA 4AIKA 1GDTA 3FKIJ 4A0ZA 3HOXJ 3FHNA 2BY2A 1YRNB 1WH7A 4DBRA 1UHSA 1DU6A 5ERIA 2V26A 2M1BA 2D45A 1QVTA 3RKXA 4M72A 3CMEI 2R7UA 4LK0F 4KNYA 1LQ1A 2KIUA 4II2A 4YIFA 1RKWA 1V54H 1Y1VJ 3GTQJ 3BTJA 4TV7A 1IAWA 4L0YB 1HSJA 3GTGJ 2DA2A 2BVMA 1K4SA 2JUCA 2AQEA 2VKDA 3FM3A 5DD8A 2O6GE 3OIQA 2QENA 4M3FA 3HTSB 4EM2A 5F0HA 3HRTA 5GTIC 3GZ6A 3AL0C 1J59A 3ASNH 2CW8A 2Q2EB 2QEXI 4NC6A 3T8TA 5IYCJ 1QZYA 1XSVA 3K1MA 4GO1A 3UKGA 4CZZA 2IEKA 1ETKA 3AG2H 1R5HA 3LSGA 1J75A 1ZRCA 2CG4A 4FX4A 1J0RA 4ZJZA 5GPAA 2VT3A 1SFKA 3U1DA 2E7WA 1W0TA 1DDNA 2D2WA 2W24A 3FM5A 3REOA 1HKTA 3FXMA 4HF2A 2KHMA 3PIOF 2WV1A 3O8GA 1OQYA 4PFPA 2NVQJ 2ZMEC 4J19A 2JA5J 4KITB 5J4VA 4ZYEA 2BY0A 3BDDA 2KZVA 3KZYA 4N9HA 1W36C 4MTDA 3E0JB 4JX6A 2E5NA 3D5RC 3AAFA 1ZARA 1YIOA 4RAGA 1PYVA 2VPRA 3IH4A 1QQIA 4F52A 2R4GA 5K7ZA 3LSMA 2WAQA 2XKPA 2DQLA 4HYEA 2BV6A 3VYTB 2PMZA 1X1PA 2IS6A 3ULQB 1I6XA 2L2OA 1D0XA 5J1RA 4NNJA 2IS1A 1ON1A 1YJ9I 2P6TA 4RLFA 3VFZA 2W1OA 2HTSA 1WZ2A 5F04A 5HS9A 1U5TB 2L7FP 2L7MP 3V7RA 4Z6YA 2MD0A 3KIOA 3FIWA 3QPLA 4IF4A 2R7SA 2HQRA 4YFKF 5J8FA 3G4SI 1UJ8A 4ENMA 2L7ZA 2CUZA 3BCBA 2DK5A 2LTPA 4KICA 2GIVA 3HOUJ 1BR2A 3ERED 5EDNA 1K78A 2XPVA 4WXHA 5GADJ 1IUYA 5FLVA 3BR6A 1ZR2A 4EJTA 3BTCA 3BG3A 2OAZA 2KQRA 4J01A 2IS4A 3IP4B 4KIFA 3LWFA 4A3DJ 4CCMA 1A6IA 3AG4H 1R1VA 2VONA 4L9JA 1X4OA 4Q47A 1TT0A 5E8GA 4M3DA 1E3HA 3H3UA 5EF6A 3ZGKA 3FMRA 1JUSA 5EJCA 3IH3A 2ZNYA 2JA6J 2DW4A 3M4OJ 3HUGB 3V7CA 4FASD 5FB2A 2JVHA 5ICCA 4J00A 4B1RA 1POGA 2ESNA 4EATA 1NG6A 3OYDA 2FEZA 2RVCA 1UB9A 1U9OA 3KP6A 5F1RA 4CGZA 1D1BA 4DQ2A 4HF0A 5D8LB 3WU1B 2R7TA 4XLNF 3LSHA 3ECHA 2A69F 3HC7A 4UV9A 5KAIC 2V4JC 3BTIA 5IT3A 2DBBA 3TEDA 2XDVA 3KEOA 2QLZA 2X1DA 2W57A 3BR5A 1BI3A 3ZQFA 2IPQX 4XLFA 3DFGA 3GZNB 3OS1A 4EJWA 4CDGA 2XASA 2Y9YA 3W2WA 2OV7A 3GFLA 3GMEA 5ICEA 3HOZJ 3DP7A 1G6NA 4FT8A 3I4NJ 5M3FJ 4LGWA 5FFZA 1IUFA 2RQPA 2HYFA 2EV6A 3L2UA 1DPUA 1VNDA 2W82A 2GOXB 2GA2A 5DM6F 1WWXA 3CQZJ 2EIJH 4A5NA 4LB6B 4FTHA 3BJ6A 3OYGA 4EJOA 2LVSA 3SZPA 1U3EM 2R7XA 1LEBA 5HNFA 1V3FA 3PUBA 3ESWB 2HDCA 1FOXA 5HLIA 5BS6A 3A1YA 4RAFA 5ILSA 2O8KA 3NQOA 2V7FA 3A01B 2FBHA 3MZHA 2VOPA 2E1CA 4WCGA 4UUTA 1REPC 4PJMA 1S7EA 3I59A 2HXIA 5DS9A 2M0MA 1SD6A 4HSTA 1QRYA 1OYYA 2MSYA 2OQRA 3FZVA 1ETYA 3KPHA 3LA3A 4M3BA 3GO5A 4I76A 2PLYA 4M3EA 3QPTA 5F27A 4CICA 1R5GA 2XF6A 1P4WA 1GVJA 3S32A 5L3EA 3N4MA 2F5CA 5DCFA 3ZQGA 3HTUA 1IN6A 1IRXA 1Z3YA 1MDMB 3BPVA 2Y0SN 3IH2A 5H6QA 2P5VA 1F1ZA 2M30A 3FX3A 1WJAA 1L0OC 5K5OA 2QUFA 5J4YA 4UUSA 3R0AA 1R5ID 4B8XA 3JRDA 5DUIA 5FKNA 2GZWA 5GP9A 5CQEA 4B44A 4BJTA 4Y7NJ 4LIUA 5TRDA 3S93A 3LSPA 3ONQA 3SQNA 3CJQB 1PUFB 1R7JA 5FJ8J 1IDYA 3EUKL 4HDVA 2ZFWA 2VIXA 4E7LA 1WRJA 1ORKA 2ZKZA 2QF7A 1D1CA 5J40A 4XICA 1AU7A 3DPUA 3CD6I 2ZXIA 3QPHA 2X6WA 2NVTJ 1V4RA 3IAM2 3U1KA 2BBYA 2BXYA 2KT0A 2R7ZJ 2M4KA 1XPXA 3X2QH 2V1NA 5CKTA 3TKYA 4EEFG 2OU2A 5EYRA 2NNYA 3ABKH 3OYEA 1ZG5A 4DZJA 1G59A 4AIDA 1OCCH 2Z3YA 1T95A 2CGPA 1W7PB 4XLAA 4D0PA 3AG1H 2IS2A 4DYRA 1DQUA 2ZJQF 4BACA 1MBEA 3S1RJ 1O3TA 2ZJRF 3QOEA 1P7IA 1ZELA 2WAEA 2A5WA 5LHIA 2B0LA 3PNTA 5FRMA 1TW2A 2XIGA 1I6HJ 5FRNA 2EFOA 3M7GA 1P6RA 2DODA 3HRMA 2LBFA 3EUAA 1ZHFA 1O3SA 2QQ9A 4XRFA 3JRAA 3ZMTA 4I99C 5FKMA 3T5XA 5IY5H 2JTVA 1NH3A 3N05A 3H3ZA 4KDPA 1WJEA 2A5YB 2DCEA 3I4MJ 1DGRM 1UG0A 2X85A 3OYNA 2Y0SA 3I9V2 1TT5B 2W00A 3NWSA 2M4GA 2OTJI 1X3ZB 4I2OA 3CMAI 2LYCA 1T33A 3RI4A 2UXNA 3HXLA 3M1EA 4KMFA 3HRUA 4BHPA 2DOFA 2M5WA 4L9NA 2MYSA 1H9TA 1FMVA 3MQ0A 3TO9A 2IVMA 1XD7A 1S7AA 1I1SA 4KT6A 2GAUA 4LIVA 3DPLC 4HG2A 1W4MA 4IOCF 2VLAA 1H89C 1NK3P 1NG7A 4XIDA 4C30A 2H09A 4UVBA 1PDNC 1IXCA 2FOWA 2FMYA 4XONA 5DCMA 2RNJA 3GFIA 3C7JA 1GUUA 4KIBA 1TBXA 1GT0C 2BZTA 1JKQC 3BZ6A 1J7KA 1B4AA 2CJJA 2HZDA 2H1LA 5DUKA 4IHXA 3CCQI 3Q0UA 4N9IA 2KIQA 2CMPA 2E1MC 5EEHA 3HDDA 3WTYC 2LD5A 4BQAA 1JJ6C 1XMXA 4IZZA 4OINF 1FYKA 3IAS2 3ZQCA 1LVKA 1ZRFA 1S9HA 1OLTA 3K4MA 5CPRB 5KK1A 4IHWA 4HX7A 4BH9A 1P9QC 3CCEI 3WTZA 3ELKA 5IPAA 3K70D 4GGGA 1FNNA 1D0YA 4ABZA 4ZH4F 4C2TA 2A05A 3QYEA 4RS8A 2GM4A 1B1BA 5J47A 5LD2C 2Z2SB 3F21A 1TC3C 5L3GA 4V19K 3S17J 1T08B 4PJJA 3BPXA 1H9GA 1S29A 1MKMA 4P9FA 1P4AA 3B02A 1D8KA 2M7BA 3GLLA 4BEHA 4KT5C 1K78B 3WTSC 3HEFA 4XR6A 4UVAA 2F4OB 5GPCA 4BHCA 4EGYA 3R61A 1IG7A 1KU3A 3ZMSA 3IWFA 4AYBN 2HU9A 3CDLA 2MLGA 1PP7U 2PX9A 2X4HA 4PJ0C 3H9JA 3L09A 4FX0A 2OPTA 2P6SA 3LSIA 5LBQA 3Q0WA 3RQ4A 3PUFA 3EYIA 3BG6A 3SEQA 3OYLA 5BQTA 2DPDA 1RZ4A 2GXBA 2GOMA 2ISZA 2ELKA 4MTEA 5M5XJ 4BNCA 2FRHA 1ULYA 4D5CA 2XGXA 3V7SA 3DBHB 1IN8A 2F5EA 3HIFA 1Z7UA 1MH3A 2EZLA 3C18A 2ZCWA 3I58A 3NARA 3C3WA 4ITVA 1Z6RA 1W5CC 2FQ3A 3RQIA 2HQ5A 2OUMA 3OOPA 4JBAA 5A2QK 3WHCA 1JHHA 5L3DA 3SDBA 1MW7A 4I01A 1OJLA 2K9QA 5CLSA 4ESFA 3HSRA 3HJEA 1A36A 1I39A 3Q9SA 2JMWA 3ZQ7A 2R5YA 1K7AA 2KDOA 2F5DA 4S0HB 3HOWJ 5IT9K 1XCBA 3J81Z 3E3VA 1WJFA 2FNAA 2ZXWH 4HZFA 2DPUA 3LSTA 4N0BA 1SANA 3I53A 5FD6A 1AWCA 4A3GJ 1WKMA 1XCVA 3S16J 3MKZA 2IGKA 1FOWA 1VQOI 1Y8QB 2ECCA 3W2AA 2Y31A 4G6TB 3LL7A 2WV0A 1VFCA 1HQCA 2EA4A 2JRTA 4AYBA 2EZKA 5K1YA 1ETWA 1GXPA 1O3QA 2LOOA 3KP7A 3B6CA 6PAXA 3E5QA 1PVEA 5F0CA 5FGMA 3P9KA 1USTA 3IL2A 3K2ZA 4HNVA 3I59B 3RYRA 3BG7A 1R4MB 2PEXA 1YLFA 2PFBA 1MSFC 1X1DA 3CCMI 5F08A 3I4PA 3DU6A 2C6YA 2KRCA 3TOAA 5CVJA 1HW5A 5DTDA 2CQ7A 1WHUA 1UZCA 4FCYA 4NDLA 5JVTA 1S6LA 1VF9A 1LFPA 5FLXZ 3WGGA 5LFAA 5DYMA 3FMQA 3R60A 4UUSB 1K61A 1BL0A 2EFPA 2EIKH 4B09A 1MIJA 3QP6A 4S04A 4BQNA 3BZCA 2CSOA 5M5YJ 3LFUA 1VQ8I 4XLPF 1D3YA 2HDWA 2CW7A 1SD5A 3ZMZA 5ILUA 2XPUA 3BTLA 5JVGF 1U8BA 3H9GA 1BI2A 2LMDA 2OJED 1Z21A 3K4LA 5JFRA 4YFXF 4QWQA 2L3DA 2L01A 4BQOA 3SEZA 3MEXA 4LOCA 4II3A 2B9SA 2HVRA 2EFNA 2R7OA 3RTRA 5K5RA 3R6SA 4BE0A 1FJLA 2QZ8A 1IRZA 2BEOA 4RMNA 3DEUA 1X3WB 4ESJA 1T98A 4IRIA 2OCEA 4LD5A 3KZIC 4MEYF 3HM5A 4F93B 2R7FA 1IN7A 4KMUX 1HXDA 4CXFA 4DYCA 2XV4S 2EILH 2Q8KA 3GBGA 4I0BA 4EJUA 3K2AA 1T56A 3EYYA 1HKQA 1ETOA 2VBXA 2HR3A 1B8IA 4I0AA 3WE3A 2LSOA 4RGRA 2LBFB 4U7BA 3VEPA 1FWZA 1GLNA 9ANTA 3Q9VA 2ACJA 2R92J 2YPRA 1JE8A 4IHTA 1FMWA 2ZSHB 4XOTA 5HLHA 4GFBA 4AIHA 2J5OA 3VB2A 3E5XA 1OCZH 2YUSA 5F1JA 4RB2C 2VBZA 1ZGWA 4JQFA 1RETA 2J5PA 2XVCA 5ICGA 2RV8A 2GXGA 2XAFA 2KPMA 4QIWN 1T0FA 3LAPA 1XS9A 4HDUA 1YIJI 1XGMA 3ZMUA 1MNMC 1IN5A 3QU6A 3IHUA 4XKVA 2A6EF 3K1NA 4RDUA 1BJZA 4QPQA 1IV8A 2P0WA 1FBQA 1JI8A 3MKWB 4CA0A 2E35A 5E20A 5DCMB 1IRFA 3P9CA 3OYJA 2Z33A 3MZ8A 4WK8F 2R7QA 1D8JA 1OKRA 4Y15A 4BL0B 1F5TA 3PFIA 4CCOA 1IZ1A 4WXDA 1ZREA 4U0VA 4HSRA 4B4CA 4BS9A 2DMTA 3J81K 4O3MA 1TNSA 4OAYA 2ETHA 2Y0MA 2X51A 3KLNA 3J7AO 3ABTA 1OMIA 1FBSA 2KRFA 2XPWA 1BR1A 4RLQA 4UHTA 5E3LA 2V6CA 4PSWA 2ID3A 4XKWA 4KFCA 4IOAF 2LRDA 1TLHB 3HHHA 4M3GA 2A61A 2A07F 1LDDA 2WC2A 1MJBA 4ON0A 3C2BA 2RKHA 4BBRJ 3NAUA 3DF8A 1KU9A 1I50J 3ERMA 2MG4A 1Z1DA 3PSIA 4NHJA 3BR2A 1OYIA 2WAFA 4CO8A 1VQ6I 1F9NA 2V6EA 4XLEA 2M87A 5D4RA 1TP4A 5HS8A 2XROA 4CCNA 1I5ZA 3S15J 1TWFJ 3FBNB 1RUOA 1SAUA 1U78A 3GZ5A 1XB4A 2LKSA 1IGNA 1YJNI 2RAEA 3L9FA 2HOTA 3JW4A 5K7HA 2LC2A 2H1KA 3ROUA 1G3SA 2EZHA 2A6HF 1QPMA 5BOXA 1B72A 4E70A 1FPQA 1FT9A 4YEJA 4BEHB 1VQ9I 1R1TA 2XB5A 5LGTA 4EQQA 1JTYA 3OS2A 4G8XA 4NC8A 4QPOA 3U21A 2BY3A 3CF2A 2FBIA 3OIPA 1LPQA 2JUGA 1BC7C 4F92B 2H8RA 4AUXA 4EMSA 1FOYA 5FLXK 3CC2I 2HNHA 3S2WA 3JCUC 1UFMA 2R93J 1LDJA 2FNPA 1L3LA 2ADUA 3K4NA 3E6CC 2VUMJ 1CF7A 2HYJA 4RM3A 4ZYDA 4XLCA 3DLLF 1ZK8A 2F5FA 2HI3A 4A3JJ 5CJ9A 5HDKA 4HV5A 3ML6A 1IV6A 1PP8F 4F91B 5LEJA 3H3VK 2M8GX 1BOAA 1V5FA 3P9IA 3GFJA 1Y8RB 5CQGA 2IA0A 4NC7A 2DMNA 2V9PA 2W48A 4HEA2 5EG0A 3VODA 4PDKA 1LFUP 3RPUD 2RDPA 2FX0A 4H4KC 1XDSA 3GCMA 2D5VA 5HODA 2W85A 2ISYA 3B73A 1Y1WJ 1IXSB 3K69A 3G2BA 3V4GA 3OYFA 2O3FA 1P2FA 3H5NA 1EV7A 4ZZDA 2STTA 3G1OA 1MMSA 5E3NA 2HVQA 2R5YB 1RKTA 2RN7A 2M45A 1Y0NA 3H92A 5F6FA 1K79A 2P4WA 4BKXA 2DQRA 3TGNA 4X0GA 3OR2C 1KGSA 3A0BC 4IPAA 2KMUA 3FXKA 2IGMA 1ETQA 3GF2A 4XMYA 1ACIA 3QYFA 3FXJA 1ZG1A 3PNVA 4PSXA 1JT6A 4MNUA 2M9HA 1OFCX 3U2RA 3CO7C 2FQ4A 3WTXC 1FTTA 3LSKA 4YG2F 1BJAA 4M6VA 2QA4I 2E60A 1TWGJ 1XTAA 4G12A 5D8KB 3JREA 4MLOA 2E7XA 2VL8A 5L3BA 4F55A 1HW2A 1MNDA 3D1NI 1U9NA 3TO6A 2PI0A 2VC0A 1MBHA 2R7WA 1HLVA 4XN3A 3Q5FA 4I09A 4JP0A 2F4IA 1W7PD 1ZGJA 1T39A 3PNYA 3S8PA 4ASNA 3CCLI 3HHGA 3FK6A 4OIOF 4G6DA 2VQCA 5KNLA 4KUMA 3G3ZA 4DZPA 3HSFA 2ZMEA 3C2GA 3BY6A 1LKXA 3EUHC 2CFOA 2KJCA 1QHGA 1K4TA 2CWEA 4RB3C 2PBIA 2QVOA 3WTVC 3TMOA 1I3AA 2QKLB 1R00A 4Y13A 4BE1A 3KFWX 2LF7A 4L5IA 2A68F 1ITYA 3OYBA 3SFIA 2VJ5A 4LG0A 3R0JA 3S1NJ 3O8HA 3F22A 4YIRX 5B1AH 2DT5A 2CQXA 5D6EA 3ZCOA 3RKYA 2LK2A 3OSFA 2L02A 3VDXA 3Q0VA 2VQHA 4O6JA 5B5EC 4E6KG 1XN7A 3PO3J 2LF8A 4CCJA 4WX9A 2G7HA 4OIPF 1BN5A 1FEXA 3H5AA 4BQQA 2DDBA 2O8XA 3LA2A 1K6OA 2M3AA 4A93J 3C2HA 1D1AA 1V55H 3VYSB 2O7OA 1XG1A 2MW8A 2DMQA 3PSFA 3DBLB 3HL2A 2NVUB 5FD5A 1FSHA 2BOLA 2RNGA 3LSJA 4A69C 3MMYB 1N77A 4K2EA 2X6YA 2IRFG 4ENNA 2HXOA 2FE3A 3OMYA 2UUZA 4JYKA 3K4BA 2H8WA 1X2NA 3PFYA 5J6XA 1QU3A 1BBYA 1MJ9A 3CF5F 1IC8A 3CLQA 4HPQA 3VOEA 1O7FA 1XX5A 4I7HA 3VPRA 4WWCA 1ZLKA 3BQYA 2PJRA 2VXZA 1B8IB 4LLNA 3F9KA 1STZA 3WHBA 2OA4A 3OYKA 3J80Z 5FLMJ 4UV8A 5LLQA 2HKOA 3FXLA 2W7NA 5L3FA 2JT1A 4L5JA 1ETVA 1A35A 2XAGA 4ZDLA 1QBJA 1HA8A 2NOJB 4PGGA 3HKZN 3VSLA 4XL9A 1OYWA 4M71A 2OZUA 3JRHA 3HOYJ 2KISA 3CJNA 2WY7Q 3JRFA 3RKQA 3CP8A 5LGNA 3R4KA 5JLWA 4PZJA 2G0EA 2Y2ZA 1YFHA 2VQGA 1RI7A 2ELHA 2H6BA 4XK4A 5TGTA 3ZQLA 1KU2A 3GWZA 4LLLA 3CMYA 1R1UA 1LUJB 4W97A 3CCJI 4KIGA 4BAYA 3RPQA 4OWRB 5M5WJ 4Y33A 3K4JA 1AHDP 4C2UA 1ZN2A 1KONA 2JVGA 3S3NA 1H8AC 1GXQA 3J7ZI 2DA3A 3MWMA 4RB0A 1Z77A 1GV2A 3D5LA 2DLLA 4D5FA 3GTPJ 4AU7A 1DP3A 3JSOA 1ON2A 1TWHJ 3I55I 4W1UA 4MHGA 4BJ5C 4YFNF 2CV0A 1Q1VA 2VE9A 3OYMA 2VB6A 3O3KA 3OV8A 5GAEJ 3WTTC 3LAJA 2CRGA 1IRGA 4R8HA 5AIPA 3HPHA 2X6XA 4AC0A 1FZPB 1BIAA 1KQ0A 2DMUA 4LITA 3CDHA 3WE2A 1FYLA 2PMUA 1SD4A 2KLOA 4E7JA 3OY9A 2K9NA 1XSDA 3S14J 2EBIA 5E17F 4PFOA 2ZXHA 2LG4A 3E1SA 4HV6A 4HX4A 2HYGD 2CS3A 3FXOA 2XAQA 3GW2A 2KRHA 4ENJA 3GEZA 1Z7LA 4HW0A 1DPRA 4FISA 2Z16A 5C4XJ 4XKCA 4BJ6C 1XGNA 2DA1A 1Z9CA 2CYYA 4RB1A 2BGCA 2A3SA 1W1WE 3JSPA 3G1LA 2W25A 3KX2A 3S1MJ 4X1EA 2DT6A 1EH7A 1SEUA 2CV2A 1RC9A 3HKZA 4OMYA 4S05A 1YI2I 1ZQ3P 4IHSA 1BI0A 4BBSJ 2MBFA 4UUVA 1O3RA 2BHYA 2RREA 2UWMA 1Z91A 2K27A 2NS0A 2K40A 2OBPA 4RGXA 1B72B 1MMGA 1WJ5A 2CFXA 3IC7A 5H6RA 3KZZA 1OCTC 2WY8Q 2DA7A 2EV5A 2Y69H 3QOPA 5FO5A 3ZN1A 4PK4A 1XDUA 3SXYA 2ZXJA 4XSZF 1S72I 1K6YA 4A3EJ 2E36A 1XSXA 1Y0UA 2B63J 5F0FA 3QRFF 2JRMA 4U7DA 3GFMA 2LNBA 3QYBA 1DP7P 3DKWA 2D1VA 5HDGA 2F6CA 1EKEA 4V2GA 5EEAA 2E2JJ 2AXLA 4CHUA 3UR3C 2M7AA 3W2VA 2VN2A 3RZDJ 2I10A 3C1DA 1ZKGA 1WCMJ 1CF7B 2QQAA 3KYCB 1VZ0A 2YU9J 4XM3A 1SVMA 4G7HF 4CYDA 2CH0A 3BG9A 4ANJA 3EETA 5FROA 3L1PA 4BYYA 4BU2A 4Q5SF 5J8CA 1ZG3A 5GAHJ 2JPBA 3TO7A 5ED4A 5HLTA 3L7WA 5D5UB 1OISA 3M07A 1G4DA 3HRSA 1YX3A 3DCFA 5EG0B 2JA7J 2E5ZA 1RRJA 4EGZA 2DK8A 3HPGA 4XRSA 4ETSA 4XRMA 3CO6C 2HZTA 4FETA 3GXOA 2X6OA 3IUOA 3TP3A 4MO7A 4P9UA 4RM2A 4BHBA 2DDAA 1VQLI 1O57A 2IT0A 4BY1J 4LB5A 2ZJPF 4HNUA 1KU7A 3ZOBA 2VKEA 4HLYA 1C0WA 1HDPA 1LEAA 3ZR8X 4IQJA 1YJWI 4WXCA 3QQAA 4E7IA 4OIQF 4DNCA 5HOOA 3HB9A 2KZGA 3OR1C 2FF4A 2UZKA 2M2EA 2DJNA 4IVNA 2L4MA 2KFDA 2JPCA 1QA6A 1ZYRF 1IW7F 1OPCA 4HF1A 3AL0B 1RUNA 2VBYA 4Z2YA 4E7HA 2OC6A 4RGUA 1S7OA 5CVVA 2EINH 2DFEA 2MC4A 1E3OC 5D4SA 2XRLA 4UB6C 2Q0OA 1NHAA 3PM1A 5E3OA 1Z6TA 4B3AA 2Y75A 4M9XA 2FMLA 1ERDA 1TTYA 3HGYA 2VXDA 3EDPA 1UHMA 3IKTA 3IKVA 4BE2A 3SDGA 2P81A 5JR3A 2XB0X 2FSWA 2VQLA 2ZMEB 1SVLA 5EZGA 3IV5A 1QPIA 3HYIA 3ZPLA 2COBA 2JSPA 3VYUB 1ZGAA 3HGGA 1T38A 1JKPC 2E1NA 2JK3A 3L2VA 2BYVE 2FA5A 1ZTRA 3HZJA 4HBLA 4LG0B 1FY7A 3DPTA 4RBOA 4JK1X 2ZFUA 3BCAA 1A04A 1SFEA 4A0YA 4KN7X 2W84A 2F48A 2EFQA 2OZ6A 1ODDA 4A6DA 2NNNA 4XKBA 1D5VA 3VYRB 2FBKA 2Y30A 5CYVA 3JAMZ 1E0EA 4V2FA 4CYCB 1R6RA 4Y4RA 5FFXA 4HX8A 1LE8A 3OYAA 2DFHA 1WJBA 2B7EA 3BR1A 2E1OA 3KP2A 1LFBA 2HS5A 3W6VA 3F8CA 4Q4ZF 2XSJC 2IGNA 2XF7A 1TW3A 2NOGA 2XAHA 1AOYA 3DTKA 3WG9A 1VQMI 2QSHX 1MMNA 4BDYA 2LFBA 1W0UA 3FXQA 2WA0A 4DJAA 1BW5A 1ENHA 2AHQA 1IN4A 3I5UA 3U9GA 4WF2A 1BR4A 2ZJ2A 2M0CA 2NVXJ 1FP2A 1X1CA 4HQEA 1VQ4I 1Z05A 3PL8A 3KP5A 2ZSIB 3CJRB 3ZXSA 3J7YJ 3HOTA 3BC8A 3K6GA 3IRQA 1U2WA 3S2HJ 1Z0XA 3S1QJ 2IW5A 3V8KA 3GTJJ 2R5ZA 1WPKA 1F43A 1IXRC 4IXAA 1SFOJ 2VASA 2DYSH 1OCRH 4L9VA 1NK2P 2HOSA 2XGEA 3MKLA 2HEOA 2PJRB 3SHFA 2ZBKA 1V5EA 2KDZA 5AONA 4F3QA 2DOAA 2XF5A 1ZH5A 5BPDA 1U6GA 3QWLA 3S3MA 3S2DJ 2KKOA 3I54A 1TL8A 4ZDOA 2ME6A 1VQKI 2XRNA 1MZBA 4A3LJ 2H94A 5CVUA 3ZMDA 2ZB9A 2WADA 1W5TA 1BM9A 2MA3A 1SFUA 2DFIA 2XKOA 1HC8A 2K9LA 2IA1A 4HLXA 2O61A 1OCOH 2K3FA 2R7DA 2X9DA 3H1CA 3A02A 3CTAA 2HKXA 5BNGA 3GYHX 2P8TA 3NRVA 2WWYA 4ZYGA 1UELB 2R7VA 1FYMA 4L9TA 3TDUC 3PJRA 4HNTA 1YYVA 2FXAA 2JN6A 3LMMA 3KETA 2G9WA 4BXUA 3MVPA 3KP4A 4EM1A 4DOZA 1KYZA 1H0MA 3RIRA 3LQQA 5E8IA 4OAZA 3I3LA 1Y56A 1SVOA 5H2FC 2CQQA 4M74A 3WG7H 4UNOA 2EH3A 4LFUA 3FXRA 2XSDC 2LREA 3EPZA 2MLKA 2K4JA 4MQ9F 2CW0F 3FHZA 1QNTA 2UXXA 1R58A 4MFDA 2DA4A 2RC4A 3LQRA 2LY9A 4BUPA 2OF7A 4PGHA 1VQ7I 3L00A 2H27A 4IQ4A 2M34A 2F2EA 3MAJA 2ECBA 1ETXA 2TCTA 4B47A 3RKWA 3CUQC 2VKVA 4DIQA 3BG5A 1HDDC 3IWZA 2Y48A 2ELJA 2M8EA 4CZCA 2GBYA 1J2XA 1DUXC 3WGHA 1X58A 3K4KA 4G7OF 1VQ5I 1TQIA 4BGDA 5D5WB 3M8EA 1ZAOA 2OCCH 5E1WA 3K70C 1YTYA 3CC7I 1XC5A 4ZTJA 4F7ZA 5IOZA 3ZQHA 1FP1D 2HOAA 1VTNC 3BJAA 3SZGA 2HOEA 5J1YA 3HG9A 4GYGA 4XRSG 1BC8C 3CCUI 2Z5UA 2CUJA 2FD5A 5FKLA 3OYIA 5E3MA 4EM0B 1YX5A 4MQVA 1B6AA 2W4SA 2PN6A 2WTEA 1HOMA 4U88A 4PUSA 1QZZA 3CCYA 2ME0A 2K3PA 5D5VB 3ZQIA 1Z3XA 4A6EA 2QKMB 3ECOA 4C3JJ 4L5EA 3ZMVA 5K7FA 4NBQA 2EWNA 1WJCA 3M8JA 1T2KA 1P4XA 2LP0A 1R71A 5JLXA 2F5VA 2HVSA 3FF5A 3MCZA 3OIOA 3DEWA 2DTZA 1T8IA 2A6TA 1QVUA 4CCKA 2YX4A 2ZO4A 4FQGA 3KP3A 3JAMK 4X6AJ 1N25A 4RGSA 3JTGA 2NYXA 4E7KA 3TDZC 3T0YA 3CUOA 3FISA 3CDIA 2HGCA 4BXXJ 5GAGJ 4CUGA 2QSGX 3JR9A 3JTHA 1UCRA 4HA8A 2EFWA 4E7ZA 5JI6A 3OYCA 2E71A 4R1HA 3ZRGA 4IHVA 1FIPA 1FIAA 2XGDA 2L9RA 3FKJA 4D9JA 2WBMA 5D6FA 2DO7A 3A2KA 2GA1A 4GDFA 1XMAA 4BY7J 3FMSA 3BLYA 2K86A 2WB1N 2MGQA 2YSRA 1SFXA 4I02A 2QM3A 3ABMH 4OOIA 2PJPA 5JHUA 3CCVI 3F3XA 2CO5A 1FTZA 1WVRA 1J9IA 3E5UA 4NQWA 5EGOA 1SC7A 2KL4A 3FXUA 2AO9A 3MN2A 3ZQQA 4PJNA 4B43A 3OSGA 1I1GA 3M3YJ 4IL6C 1T6SA 4P55A 2FOKA 3PQKA 4HOBA 3RDIA 1MJAA 4G6QA 3NEUA 2Q1ZB 4IJAA 4D7MA 1JT0A 3DTEA 5LHGA 4KYWA 3G1MA 1WH5A 3T1BA 1VQPI 1MH4A 5E79C 1G3YA 2VI6A 5EEGA 1E3PA 2O0YA 5L3CA 1FOKA 1TQPA 3K1PA 4I98B 3K9TA 3LOCA 2R7RA 2XUBA 2PQ8A 4FE7A 3L2QA 1X19A 1JKOC 2XHKA 3CUQA 5ILVA 1P7JA 2QSFX 2I5UA 1EH6A 2ESHA 1F36A 3OOUA 4LG3A 2F4MB 3ABLH 3CZ6A 5EZHA 5KCMA 3PO2J 1CGPA 2VKHA 2XAJA 4AM3A 5B3SH 4P96A 1HBXG 2XGCA 3BP8A 3SJMA 4ZYHA 4NUBA 1BOBA 2CQNA 2E1MB 3F6VA 2NRAC 3I64A 5JHFA 1KZHA 2P5LC 3E97A 1YG2A 3F6OA 3KYDB 2IBDA 2EPFA 4XNFA 3TW6A 1GV5A 3TOBA 2AS5F 4E4HA 1O7LA 2EZIA 2YR2A 3VWBA 2QGUA 3BZKA 3E7LA 2MABA 4GCVA 1FBUA 1M1EB 2Z1DA 3F0CA 1I3QJ 4A3KJ 4JOMA 3H35A 4M73A 1G3TA 2MFZA 2X1EA 4BDZA 4NB5A 2WB1A 1P92A 1LDKB 5LEKA 1UG2A 2TDXA 1HCRA 1APLC 3OWTA 3BROA 4MIMA 2VODA 2VPLA 2L54A 5FKOA 2IXSA 1LE8B 4R79A 2QBYA 1AKHA 4IRGA 2DXIA 1QZEA 4IO9F 4AIJA 2LLKA 2HQAA 2D1HA 2X0LA 2QYOA 3E6MA 3P7NA 3TL4X 1U8RA 3IRRA 2V79A 2V1DA 1IO2A 3A03A 2HQNA 2K9MA 3MZYA 4CYCA 2EB7A 1J5YA 1G8XA 4IEJA 1QGPA 2K02A 4HRIA 3H36A 3L2WA 5HLGA 3AFHA 5AIQA 2RQQA 3Q3SA 3GTOJ 2P7VB 2OTLI 3F8BA 4YELA 2L9VA 2AQFA 3OL4A 3JRBA 2DMPA 1TZLA 2DU9A 5FKKA 4H0EA 1JUMA 4Y17A 2K85A 2R5ZB 2PG4A 1YQAA 4A0XA 1KQ8A 1KA8A 5K5QA 2GIZA 4XBFA 3JRIA 4G7ZF 1TQMA 3E6BA 1B59A 5B1BH 2L7KA 4L18B 3AG3H 2E2HJ 2JQ7A 4QTRA 1EA3A 1G3WA 5DV5A 1D5YA 3D5SC 1USSA 4UY8I 4FHTA 4LMYA 4A3CJ 3CESA 1X2MA 2BHZA 4KJZA 3F72A 2X48A 2E34A 2UV1A 3DKYA 4D1QA 3GX4X 4E7SA 2EIMH 3SFZA 2DA6A 3PIPF 5C44J 4ENKA 2QCOA 3W6JB 2CUFA 1IF1A 1JXSA 1U5TC 2MD5A 3H9QA 3SZTA 2COMA 4DBQA 3O2PE 2N8GA 5A2QZ 1S5LC 2HFHA 4M9SA 2L9SA 3CC4I 1IDZA 5F64A 4C9YA 1WGXA 5J1UA 2X1CA 3GTKJ 1MNEA 3KLOA 5IYBJ 1G2HA 4EV0A 4JX5A 3F8FA 5E1XA 1WI9A 3I71A 4N4OB 1JHFA 1WSUA 2L0KA 1JTXA 1S3JA 5IT9Z 4AD9A 1VQNI 2ICWG 1OR7C 2BW3A 4AWXB 3W3CA 1SMTA 1AA7A 1B9NA 4U87A 4A12A 4AVPA 3LSRA 4MFEA 1MGTA 2K4BA 2QQBA 5M3MJ 2Z99A 5HVQC 2VBWA 4XLHA 4IX7A 5HNHA 3GVAA 5HS7A 4U0YA 5LHHA 2V9VA 4DYQA 3ISPA 1MBFA 3EQLF 1EJ9A 3GTLJ 4U0WA 5C3EJ 5H20A 3FWEA 3K4CA 4XORA 2VJ4A 3EUHA 2Y9ZA 5E1ZB 1JGGA 1NTCA 4GXOA 1PUEE 4ZDPA 1YRNA 1DU0A 2HPMA 2JA2A 1FC3A 4AVZA 3BQZA 2LR8A 2H6CA 3QPSA 4BXFA 3MKYB 1UAAA 3W6KB 1BA5A 2QWWA 4UVCA 4HAMA 2HWVA 1MSEC 2E19A 4Y52J 3LFKA 3PQJA 4GYIA 4A3IJ 2LY1A 3KCCA 3RJPA 1Y6IA 2VT2A 3H5RA 1ZRDA 2JJ7A 1ZLJA 2DFFA 3DBRB 2K5CA 3WGIA 4C2MJ 4IRHA 5DM7F 3KEYA 1F4KA 3VSKA 1JGSA 1TWAJ 3RSNA 2GXAA 3ZN0A 5IP7J 2NS8A 5B66C 1CQTA 4A5MA 3CP2A 3DLAA 4P1WA 1Y39A 2Q2EA 2LKPA 3MFKA 4UXNA 1LNWA 3CCSI 1XGOA 4OIRF 3LA7A 4A3MJ 2BVLA 2CUEA 5TJJA 2L9NA 2GQQA 1N78A 3DWLE 5HDNA 4G94A 1R22A 1SD7A 1XMKA 2STWA 3GTMJ 2XAUA 3MD2A 2MH2A 3JRCA 4M9ZA 3BT9A 4KN4X 4C3HJ 3DQVC 3KYLA 2L5QA 3ASOH 2R0QC 5IOYA 3AKZA 2BE5F 4IKFA 1E2XA 1RNLA 1KYWA 3WU0A 1UHWA 3K0LA 3COAC 1GVDA 2HPIA 3BJOA 1A5JA 2GWRA 1U0JA 1MBJA 2IA2A 1W36D 2KP6A 4YIIA 1RESA 4QSHA 1IJWC 5DDGA 2LH9A 3FBIB 1YOVB 4P5OA 1ZR4A 2GLOA 1YO5C 2HTJA 5CVIA 1U5TA 1QO0D 1YITI 3LNQA 3HSEA 3SYTA 2VJIA 4LK1F 4CH7A 2LKXA 2NVYJ 4Q48A 3BOQA 2FJ1A 3DU5A 2G7UA 3ZP5A 1SMYF 5EGOB 1ONVA 4NQWB 2ID6A 2P5KA 3JRGA 3UNGC 2DA5A 4A3BJ 1MBGA 2YU3A 3P5JA 1X1AA 4YRVA 4IHYA 4RAZA 4A2UA 3M1CA 1OR7A 3CLOA 2EJRA 3N97A 1UMQA 3G6EI 4G9YA 2YS9A 3WU2C 4EJVA 5BPIA 2O5RA 2Z9OA 3CMMA 2IJLA 1YE9A 1K83J 4O5VA 2JA8J 4XN0A 2K7LA 3H0GJ 1N75A 3OYHA 2DN0A 3J80K 1TWCJ 2IGOA 5GTHC 3HUGA 5CVRA 2CU7A 2V1UA 3CUQB 2VC1A 3K7AJ 2DOEA 3OL3A 4ZC3A 1HSTA 5IP9J 1R4NB 2CV1A 2OQGA 4UB8C 2R3SA 1WFXA 4Y3OA 4ESBA 1R9TJ 2I8DA 2JWTA 1MMDA 1W5SA 2VE8A 3TW7A 1Z67A 3M9AA 2O03A 3WODF 4N4NB 1YS6A 4OMZA 4FE4A 2EQRA 2HDDA 1JJ8C 1FLIA 4RA2A 5BMZA 3RCOA 1R36A 2PMHA 1I27A 1TNTA 2P7CB 2NXNB 2CQKA 3KEQA 1VI0A 3B6AA 5DEQA 1JKRC 3K10A 2O9LA 3ABUA 1KQ9A 4EVIA 3KE2A 3BR0A 1T0FC 1FX7A 4RAYA 2YX7A 2K9SA 4M6XA 1R49A 2VOOA 2V9KA 1RIOH 5IYDJ 2DYRH 2NS7A 3QAHA 1QHHD 3CCRI 2QBYB 1AKHB 2LDUA 4B3XA 4PJLA 4GRIA 2IP2A 2JSCA 5D5XB 3F23A 4XQFA 2KJBA 5LRSA 3FDYA
chains in the Genus database with same CATH topology
3TQNA 3RYPA 1BIBA 1YW9A 2FU4A 3GUDA 1YW7A 1B9MA 3G73A 3V8LA 4MGRA 1R23A 4QLCU 1WQ2A 4HQMA 3L2CA 2DI3A 3DV8A 2EK5A 5LGUA 2EV0A 1EH8A 5KVRA 1BI1A 4LLGF 3RPUA 1MDMA 2DAOA 1LVAA 2OD5A 2JZYA 4MEXF 2MH9A 3WTWC 4PCQA 1SAXA 2V1XA 4OU0A 2DTRA 4L0ZB 1XGSA 2NAZA 4ZZLA 3QP5A 2MC3A 3O6BB 2KIMA 1LJ9A 3M8FA 1YS7A 3E6DA 1S8NA 1GHCA 4KA4A 4LJZF 5ICFA 2KIFA 5LRRA 5DD4A 3GLXA 1E17A 4XSXF 3D0SA 5E18F 1MD0A 3DXJF 4M6YA 3QU3A 1LB2A 1X3UA 1FSEA 3I0TA 1Q1HA 1W7PA 3V8JA 2EA2A 3HOSA 3WTUC 3BWGA 1HW1A 1YW8A 2ZNZA 3F8MA 1HKSA 2L4AA 3F8NA 3T8RA 2RGVA 4AIKA 4A0ZA 5ERIA 2M1BA 2D45A 3RKXA 4M72A 4LK0F 4KNYA 1LQ1A 2KIUA 4YIFA 4TV7A 1IAWA 4L0YB 1HSJA 3FM3A 5DD8A 2O6GE 2QENA 3HTSB 4EM2A 3GZ6A 3HRTA 1J59A 3T8TA 1QZYA 1XSVA 3K1MA 4GO1A 1J75A 4CZZA 1R5HA 1ZRCA 2CG4A 4FX4A 1J0RA 2VT3A 3U1DA 2E7WA 1DDNA 2D2WA 2W24A 3FM5A 3REOA 1HKTA 4HF2A 4ZYEA 3BDDA 4N9HA 3KZYA 4MTDA 3AAFA 1ZARA 1YIOA 1QQIA 2XKPA 2DQLA 4HYEA 2BV6A 3ULQB 1I6XA 1ON1A 2P6TA 3VFZA 2HTSA 5HS9A 1U5TB 3V7RA 4IF4A 2HQRA 4YFKF 5J8FA 4ENMA 2DK5A 4KICA 2GIVA 3ERED 1K78A 4WXHA 1IUYA 4EJTA 2OAZA 4KIFA 3LWFA 1R1VA 2VONA 4L9JA 4Q47A 5E8GA 3H3UA 3FMRA 2ZNYA 2DW4A 3V7CA 5FB2A 5ICCA 2ESNA 2FEZA 2RVCA 1UB9A 5F1RA 3KP6A 4CGZA 4DQ2A 4HF0A 5D8LB 3WU1B 4XLNF 3ECHA 2A69F 4UV9A 5IT3A 2DBBA 3KEOA 2QLZA 2W57A 1BI3A 2IPQX 3DFGA 4EJWA 4CDGA 2XASA 3GFLA 5ICEA 3DP7A 1G6NA 4FT8A 4LGWA 5FFZA 2RQPA 2HYFA 2EV6A 1DPUA 2GA2A 1WWXA 4A5NA 4LB6B 3BJ6A 4EJOA 3SZPA 1U3EM 1LEBA 1V3FA 2HDCA 5HLIA 5BS6A 5ILSA 3NQOA 3MZHA 2FBHA 2VOPA 2E1CA 4WCGA 1REPC 3I59A 1SD6A 1OYYA 2OQRA 3FZVA 3LA3A 3GO5A 2PLYA 3QPTA 4CICA 1R5GA 1P4WA 1GVJA 5L3EA 3N4MA 2F5CA 5DCFA 3HTUA 1IN6A 1MDMB 3BPVA 5H6QA 2P5VA 1F1ZA 2M30A 3FX3A 1L0OC 5K5OA 2QUFA 3R0AA 4B8XA 5DUIA 2GZWA 5TRDA 3SQNA 1R7JA 4HDVA 2ZFWA 1WRJA 2ZKZA 3QPHA 1V4RA 2BBYA 3TKYA 2OU2A 2NNYA 1ZG5A 2Z3YA 2CGPA 1W7PB 4D0PA 1O3TA 5LHIA 2B0LA 1TW2A 2XIGA 2EFOA 3M7GA 1P6RA 3HRMA 1O3SA 1ZHFA 2QQ9A 4XRFA 3ZMTA 3T5XA 2JTVA 3H3ZA 4KDPA 2A5YB 4I2OA 3RI4A 2UXNA 3M1EA 4KMFA 3HRUA 4BHPA 2M5WA 4L9NA 1H9TA 3TO9A 3MQ0A 2IVMA 1XD7A 1S7AA 1I1SA 2GAUA 3DPLC 1W4MA 2H09A 4UVBA 1PDNC 1IXCA 2FMYA 5DCMA 2RNJA 3GFIA 3C7JA 4KIBA 1TBXA 3BZ6A 1J7KA 1B4AA 5DUKA 4N9IA 5EEHA 3WTYC 4BQAA 4OINF 1FYKA 1ZRFA 5KK1A 4HX7A 4BH9A 3WTZA 3ELKA 4GGGA 1FNNA 4ZH4F 4RS8A 1B1BA 3F21A 5L3GA 3BPXA 1H9GA 1S29A 1MKMA 4P9FA 1P4AA 3B02A 1D8KA 4KT5C 1K78B 3WTSC 4UVAA 4BHCA 4EGYA 3R61A 1KU3A 3ZMSA 3IWFA 2MLGA 1PP7U 2X4HA 3L09A 4FX0A 2P6SA 5LBQA 3EYIA 5BQTA 2DPDA 1RZ4A 2GXBA 2ISZA 4MTEA 4BNCA 2FRHA 1ULYA 2XGXA 3V7SA 1IN8A 2F5EA 3HIFA 1Z7UA 3C18A 2ZCWA 3I58A 3C3WA 1Z6RA 2FQ3A 4JBAA 3OOPA 5A2QK 1JHHA 5L3DA 4I01A 4ESFA 5CLSA 3HSRA 3Q9SA 3ZQ7A 1K7AA 2F5DA 5IT9K 1XCBA 3J81Z 3E3VA 2FNAA 4HZFA 2DPUA 3LSTA 4N0BA 3I53A 5FD6A 1AWCA 1WKMA 1XCVA 2WV0A 1HQCA 2EA4A 2JRTA 5K1YA 1GXPA 1O3QA 3KP7A 6PAXA 3E5QA 5FGMA 3P9KA 1USTA 3IL2A 3K2ZA 3I59B 3RYRA 2PEXA 1YLFA 2PFBA 3I4PA 2C6YA 3TOAA 5CVJA 1HW5A 5JVTA 1S6LA 5FLXZ 3WGGA 5DYMA 3FMQA 3R60A 2EFPA 4B09A 3QP6A 4S04A 2CSOA 4XLPF 1D3YA 1SD5A 3ZMZA 5ILUA 1BI2A 5JFRA 4YFXF 4QWQA 2L3DA 2L01A 3MEXA 2EFNA 3RTRA 5K5RA 3R6SA 2QZ8A 2BEOA 3DEUA 4ESJA 1T98A 4IRIA 4LD5A 4MEYF 2R7FA 1IN7A 4KMUX 1HXDA 4CXFA 2XV4S 2Q8KA 4I0BA 4EJUA 3EYYA 1HKQA 2VBXA 2HR3A 4I0AA 3WE3A 2LSOA 4RGRA 4U7BA 3VEPA 1FWZA 3Q9VA 2ACJA 2YPRA 1JE8A 4IHTA 5HLHA 4AIHA 2J5OA 3VB2A 3E5XA 4RB2C 2VBZA 4JQFA 2J5PA 2XVCA 5ICGA 2RV8A 2GXGA 2XAFA 1T0FA 3LAPA 4HDUA 1XGMA 3ZMUA 1IN5A 3QU6A 3IHUA 2A6EF 3K1NA 1FBQA 5E20A 5DCMB 1IRFA 3P9CA 2Z33A 4WK8F 1D8JA 1OKRA 4Y15A 1F5TA 3PFIA 1IZ1A 4WXDA 1ZREA 4U0VA 3J81K 4O3MA 1TNSA 2ETHA 2Y0MA 3KLNA 3J7AO 3ABTA 1OMIA 1FBSA 2KRFA 4UHTA 2V6CA 4KFCA 1TLHB 3HHHA 2A61A 2A07F 1LDDA 2WC2A 1MJBA 4ON0A 2RKHA 3DF8A 1KU9A 1Z1DA 4NHJA 4CO8A 1OYIA 1F9NA 2M87A 5D4RA 5HS8A 2XROA 1I5ZA 1RUOA 1U78A 3GZ5A 1XB4A 3L9FA 3JW4A 3ROUA 1G3SA 2A6HF 1QPMA 5BOXA 4E70A 1FPQA 1FT9A 1R1TA 5LGTA 4EQQA 4G8XA 2FBIA 1BC7C 4EMSA 5FLXK 3S2WA 1UFMA 1LDJA 2FNPA 1L3LA 2ADUA 3E6CC 1CF7A 4ZYDA 2F5FA 5CJ9A 5HDKA 4HV5A 3ML6A 1PP8F 5LEJA 1BOAA 3P9IA 3GFJA 2IA0A 3VODA 4PDKA 2RDPA 1XDSA 2W85A 2ISYA 3B73A 1IXSB 3K69A 3V4GA 2O3FA 1P2FA 1EV7A 4ZZDA 2STTA 2RN7A 2M45A 3H92A 5F6FA 1K79A 2P4WA 2DQRA 3TGNA 1KGSA 4IPAA 3GF2A 1ZG1A 4MNUA 3U2RA 3CO7C 3WTXC 4YG2F 1BJAA 5D8KB 2E7XA 5L3BA 1HW2A 3TO6A 2PI0A 2VC0A 3Q5FA 4I09A 1T39A 1W7PD 1ZGJA 4ASNA 3HHGA 4OIOF 4G6DA 4KUMA 3G3ZA 3HSFA 2ZMEA 3BY6A 2KJCA 4RB3C 2CWEA 2PBIA 2QVOA 3WTVC 4Y13A 1R00A 3KFWX 2LF7A 4L5IA 2A68F 4LG0A 3R0JA 3F22A 2DT5A 5D6EA 3RKYA 2L02A 4O6JA 1XN7A 2LF8A 4WX9A 2G7HA 4OIPF 1BN5A 2O8XA 3LA2A 1K6OA 5FD5A 1FSHA 4K2EA 2IRFG 4ENNA 2FE3A 5J6XA 1BBYA 1MJ9A 3VOEA 1O7FA 4I7HA 4WWCA 1ZLKA 2VXZA 4LLNA 1STZA 2OA4A 3J80Z 4UV8A 5LLQA 2HKOA 5L3FA 2JT1A 4L5JA 2XAGA 1QBJA 4PGGA 1OYWA 4M71A 2OZUA 3CJNA 5LGNA 3R4KA 4PZJA 1YFHA 2ELHA 1RI7A 2H6BA 1KU2A 3GWZA 4LLLA 1R1UA 4KIGA 4BAYA 3RPQA 1ZN2A 1GXQA 3MWMA 4RB0A 3D5LA 2DLLA 3JSOA 1ON2A 4MHGA 4YFNF 2VE9A 3O3KA 3OV8A 3WTTC 3LAJA 1IRGA 4R8HA 5AIPA 1FZPB 1BIAA 1KQ0A 3CDHA 3WE2A 1FYLA 2PMUA 1SD4A 1XSDA 5E17F 4HV6A 4HX4A 2HYGD 2XAQA 3GW2A 4ENJA 3GEZA 4HW0A 1DPRA 1XGNA 1Z9CA 2CYYA 4RB1A 2BGCA 2A3SA 3JSPA 2W25A 1EH7A 4OMYA 4S05A 4IHSA 1BI0A 2MBFA 4UUVA 1O3RA 2UWMA 1Z91A 2K27A 2NS0A 2OBPA 4RGXA 2CFXA 3IC7A 5H6RA 3KZZA 2EV5A 3QOPA 5FO5A 3ZN1A 1XDUA 3SXYA 2ZXJA 4XSZF 1XSXA 1Y0UA 3QRFF 4U7DA 3GFMA 2LNBA 1DP7P 3DKWA 2D1VA 5HDGA 2AXLA 4CHUA 2VN2A 3C1DA 1CF7B 2QQAA 4G7HF 4CYDA 3EETA 4BYYA 4Q5SF 5J8CA 1ZG3A 2JPBA 3TO7A 5ED4A 3L7WA 5D5UB 1G4DA 3HRSA 4EGZA 2DK8A 4ETSA 3CO6C 2HZTA 3GXOA 4P9UA 2IT0A 4BHBA 1O57A 4LB5A 1KU7A 4HLYA 1C0WA 1LEAA 4WXCA 4OIQF 4DNCA 5HOOA 2FF4A 2UZKA 4IVNA 2L4MA 2JPCA 1ZYRF 1IW7F 1OPCA 4HF1A 1RUNA 2VBYA 4Z2YA 4RGUA 1S7OA 5CVVA 5D4SA 2Q0OA 1NHAA 1Z6TA 2Y75A 4M9XA 2FMLA 1TTYA 3EDPA 1UHMA 3IKTA 3IKVA 5JR3A 2FSWA 2ZMEB 3HYIA 3ZPLA 1ZGAA 1T38A 2E1NA 2BYVE 2FA5A 4HBLA 4LG0B 1FY7A 3DPTA 4JK1X 1A04A 1SFEA 4A0YA 4KN7X 2W84A 2EFQA 2OZ6A 1ODDA 4A6DA 2NNNA 1D5VA 2FBKA 5CYVA 3JAMZ 5FFXA 4HX8A 3KP2A 2HS5A 3F8CA 4Q4ZF 1TW3A 2XAHA 1AOYA 3WG9A 3FXQA 1IN4A 3I5UA 3U9GA 4WF2A 2ZJ2A 1FP2A 4HQEA 1Z05A 3KP5A 3HOTA 3IRQA 1U2WA 2IW5A 3V8KA 1IXRC 4IXAA 4L9VA 2HEOA 3SHFA 2ZBKA 5AONA 1ZH5A 5BPDA 1U6GA 2KKOA 3I54A 2XRNA 1MZBA 2H94A 5CVUA 3ZMDA 1W5TA 1BM9A 2MA3A 1SFUA 2DFIA 2XKOA 4HLXA 2IA1A 2O61A 2R7DA 3CTAA 2HKXA 3GYHX 2P8TA 3NRVA 2WWYA 4ZYGA 1FYMA 4L9TA 3TDUC 1YYVA 2FXAA 3KETA 2G9WA 4BXUA 3KP4A 4EM1A 1KYZA 1H0MA 3RIRA 3LQQA 5E8IA 4M74A 4UNOA 4LFUA 3FXRA 2MLKA 2K4JA 4MQ9F 2CW0F 3FHZA 1QNTA 2UXXA 1R58A 2RC4A 3LQRA 4PGHA 3L00A 2H27A 2F2EA 3MAJA 3RKWA 3CUQC 3IWZA 2Y48A 2M8EA 1J2XA 1DUXC 3WGHA 4G7OF 1TQIA 5D5WB 3M8EA 1ZAOA 5E1WA 1YTYA 4F7ZA 1FP1D 1VTNC 3BJAA 2HOEA 4GYGA 1BC8C 2Z5UA 4EM0B 4MQVA 1B6AA 2PN6A 2WTEA 4U88A 1QZZA 5D5VB 4A6EA 3ECOA 3ZMVA 2EWNA 1T2KA 1P4XA 3FF5A 3MCZA 2YX4A 2ZO4A 3KP3A 3JAMK 4RGSA 3JTGA 2NYXA 3TDZC 3T0YA 3CUOA 2HGCA 3JTHA 1UCRA 4HA8A 2EFWA 5JI6A 4R1HA 5D6FA 2DO7A 2GA1A 1XMAA 3FMSA 2K86A 2YSRA 1SFXA 4I02A 2QM3A 4OOIA 2PJPA 5JHUA 3F3XA 2CO5A 1J9IA 3E5UA 4NQWA 3FXUA 1I1GA 1T6SA 4P55A 2FOKA 3PQKA 4HOBA 3RDIA 1MJAA 4G6QA 3NEUA 4IJAA 5LHGA 4KYWA 3T1BA 1G3YA 5EEGA 2O0YA 5L3CA 1FOKA 1TQPA 3K1PA 4I98B 3K9TA 2XUBA 2PQ8A 2XHKA 3CUQA 5ILVA 1EH6A 2ESHA 1CGPA 2XAJA 4P96A 1HBXG 3BP8A 4ZYHA 3F6VA 2NRAC 3I64A 2P5LC 3E97A 1YG2A 3F6OA 3TOBA 2AS5F 1O7LA 2YR2A 4GCVA 1FBUA 4M73A 1G3TA 4NB5A 1P92A 1LDKB 5LEKA 2TDXA 2VODA 3BROA 2L54A 4R79A 2QBYA 4IRGA 4AIJA 2X0LA 2D1HA 3E6MA 2QYOA 3P7NA 1U8RA 3IRRA 2V79A 2V1DA 2HQNA 3MZYA 2EB7A 1J5YA 1QGPA 2K02A 5HLGA 5AIQA 2P7VB 3F8BA 2DU9A 4H0EA 4Y17A 2PG4A 1YQAA 4A0XA 1KQ8A 1KA8A 5K5QA 4XBFA 4G7ZF 1TQMA 3E6BA 1B59A 4L18B 1G3WA 5DV5A 1USSA 4FHTA 4LMYA 3F72A 3GX4X 3SFZA 4ENKA 3W6JB 1IF1A 1JXSA 1U5TC 2MD5A 3SZTA 2COMA 3O2PE 5A2QZ 2HFHA 4M9SA 5F64A 3KLOA 4EV0A 3F8FA 5E1XA 1WI9A 3I71A 1JHFA 1WSUA 1S3JA 5IT9Z 4AD9A 4AWXB 1SMTA 1B9NA 4A12A 4AVPA 1MGTA 2K4BA 2QQBA 2Z99A 5HVQC 2VBWA 3GVAA 5HS7A 4U0YA 5LHHA 2V9VA 3ISPA 3EQLF 4U0WA 5H20A 3FWEA 3EUHA 5E1ZB 4GXOA 1PUEE 1FC3A 2H6CA 3W6KB 2QWWA 4UVCA 4HAMA 2HWVA 3LFKA 3PQJA 4GYIA 3KCCA 3RJPA 2VT2A 1ZRDA 1ZLJA 3WGIA 4IRHA 1F4KA 1JGSA 3ZN0A 4A5MA 2Q2EA 2LKPA 3MFKA 4UXNA 1LNWA 1XGOA 4OIRF 3LA7A 5TJJA 2GQQA 5HDNA 4G94A 1R22A 1SD7A 1XMKA 2STWA 2MH2A 4M9ZA 4KN4X 3DQVC 2BE5F 1E2XA 1KYWA 1RNLA 3WU0A 1UHWA 3K0LA 3COAC 3BJOA 2GWRA 2IA2A 4YIIA 5DDGA 4P5OA 1YO5C 2HTJA 5CVIA 1U5TA 1QO0D 3HSEA 4LK1F 4Q48A 3BOQA 2G7UA 3ZP5A 1SMYF 1ONVA 2P5KA 2YU3A 4RAZA 4A2UA 1OR7A 3CLOA 2EJRA 3N97A 4G9YA 4EJVA 5BPIA 2Z9OA 2IJLA 4O5VA 2K7LA 3J80K 3HUGA 5CVRA 2V1UA 3CUQB 2VC1A 1HSTA 2OQGA 2R3SA 4ESBA 1W5SA 2VE8A 3M9AA 2O03A 3WODF 1YS6A 4OMZA 1FLIA 5BMZA 1R36A 1I27A 1TNTA 2PMHA 2P7CB 2CQKA 3KEQA 5DEQA 3ABUA 1KQ9A 4EVIA 3KE2A 1FX7A 4RAYA 2YX7A 4M6XA 2VOOA 1RIOH 3QAHA 2QBYB 2LDUA 2IP2A 2JSCA 5D5XB 3F23A 2KJBA 5LRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQN A;  3RYP A;  1BIB A;  1YW9 A;  2FU4 A;  3GUD A;  1YW7 A;  1B9M A;  3G73 A;  3V8L A;  4MGR A;  1R23 A;  4QLC U;  1WQ2 A;  4HQM A;  3L2C A;  2DI3 A;  3DV8 A;  2EK5 A;  5LGU A;  2EV0 A;  1EH8 A;  5KVR A;  1BI1 A;  4LLG F;  3RPU A;  1MDM A;  2DAO A;  1LVA A;  2OD5 A;  2JZY A;  4MEX F;  2MH9 A;  3WTW C;  4PCQ A;  1SAX A;  2V1X A;  4OU0 A;  2DTR A;  4L0Z B;  1XGS A;  2NAZ A;  4ZZL A;  3QP5 A;  2MC3 A;  3O6B B;  2KIM A;  1LJ9 A;  3M8F A;  1YS7 A;  3E6D A;  1S8N A;  1GHC A;  4KA4 A;  4LJZ F;  5ICF A;  2KIF A;  5LRR A;  5DD4 A;  3GLX A;  1E17 A;  4XSX F;  3D0S A;  5E18 F;  1MD0 A;  3DXJ F;  4M6Y A;  3QU3 A;  1LB2 A;  1X3U A;  1FSE A;  3I0T A;  1Q1H A;  1W7P A;  3V8J A;  2EA2 A;  3HOS A;  3WTU C;  3BWG A;  1HW1 A;  1YW8 A;  2ZNZ A;  3F8M A;  1HKS A;  2L4A A;  3F8N A;  3T8R A;  2RGV A;  4AIK A;  4A0Z A;  5ERI A;  2M1B A;  2D45 A;  3RKX A;  4M72 A;  4LK0 F;  4KNY A;  1LQ1 A;  2KIU A;  4YIF A;  4TV7 A;  1IAW A;  4L0Y B;  1HSJ A;  3FM3 A;  5DD8 A;  2O6G E;  2QEN A;  3HTS B;  4EM2 A;  3GZ6 A;  3HRT A;  1J59 A;  3T8T A;  1QZY A;  1XSV A;  3K1M A;  4GO1 A;  1J75 A;  4CZZ A;  1R5H A;  1ZRC A;  2CG4 A;  4FX4 A;  1J0R A;  2VT3 A;  3U1D A;  2E7W A;  1DDN A;  2D2W A;  2W24 A;  3FM5 A;  3REO A;  1HKT A;  4HF2 A;  4ZYE A;  3BDD A;  4N9H A;  3KZY A;  4MTD A;  3AAF A;  1ZAR A;  1YIO A;  1QQI A;  2XKP A;  2DQL A;  4HYE A;  2BV6 A;  3ULQ B;  1I6X A;  1ON1 A;  2P6T A;  3VFZ A;  2HTS A;  5HS9 A;  1U5T B;  3V7R A;  4IF4 A;  2HQR A;  4YFK F;  5J8F A;  4ENM A;  2DK5 A;  4KIC A;  2GIV A;  3ERE D;  1K78 A;  4WXH A;  1IUY A;  4EJT A;  2OAZ A;  4KIF A;  3LWF A;  1R1V A;  2VON A;  4L9J A;  4Q47 A;  5E8G A;  3H3U A;  3FMR A;  2ZNY A;  2DW4 A;  3V7C A;  5FB2 A;  5ICC A;  2ESN A;  2FEZ A;  2RVC A;  1UB9 A;  5F1R A;  3KP6 A;  4CGZ A;  4DQ2 A;  4HF0 A;  5D8L B;  3WU1 B;  4XLN F;  3ECH A;  2A69 F;  4UV9 A;  5IT3 A;  2DBB A;  3KEO A;  2QLZ A;  2W57 A;  1BI3 A;  2IPQ X;  3DFG A;  4EJW A;  4CDG A;  2XAS A;  3GFL A;  5ICE A;  3DP7 A;  1G6N A;  4FT8 A;  4LGW A;  5FFZ A;  2RQP A;  2HYF A;  2EV6 A;  1DPU A;  2GA2 A;  1WWX A;  4A5N A;  4LB6 B;  3BJ6 A;  4EJO A;  3SZP A;  1U3E M;  1LEB A;  1V3F A;  2HDC A;  5HLI A;  5BS6 A;  5ILS A;  3NQO A;  3MZH A;  2FBH A;  2VOP A;  2E1C A;  4WCG A;  1REP C;  3I59 A;  1SD6 A;  1OYY A;  2OQR A;  3FZV A;  3LA3 A;  3GO5 A;  2PLY A;  3QPT A;  4CIC A;  1R5G A;  1P4W A;  1GVJ A;  5L3E A;  3N4M A;  2F5C A;  5DCF A;  3HTU A;  1IN6 A;  1MDM B;  3BPV A;  5H6Q A;  2P5V A;  1F1Z A;  2M30 A;  3FX3 A;  1L0O C;  5K5O A;  2QUF A;  3R0A A;  4B8X A;  5DUI A;  2GZW A;  5TRD A;  3SQN A;  1R7J A;  4HDV A;  2ZFW A;  1WRJ A;  2ZKZ A;  3QPH A;  1V4R A;  2BBY A;  3TKY A;  2OU2 A;  2NNY A;  1ZG5 A;  2Z3Y A;  2CGP A;  1W7P B;  4D0P A;  1O3T A;  5LHI A;  2B0L A;  1TW2 A;  2XIG A;  2EFO A;  3M7G A;  1P6R A;  3HRM A;  1O3S A;  1ZHF A;  2QQ9 A;  4XRF A;  3ZMT A;  3T5X A;  2JTV A;  3H3Z A;  4KDP A;  2A5Y B;  4I2O A;  3RI4 A;  2UXN A;  3M1E A;  4KMF A;  3HRU A;  4BHP A;  2M5W A;  4L9N A;  1H9T A;  3TO9 A;  3MQ0 A;  2IVM A;  1XD7 A;  1S7A A;  1I1S A;  2GAU A;  3DPL C;  1W4M A;  2H09 A;  4UVB A;  1PDN C;  1IXC A;  2FMY A;  5DCM A;  2RNJ A;  3GFI A;  3C7J A;  4KIB A;  1TBX A;  3BZ6 A;  1J7K A;  1B4A A;  5DUK A;  4N9I A;  5EEH A;  3WTY C;  4BQA A;  4OIN F;  1FYK A;  1ZRF A;  5KK1 A;  4HX7 A;  4BH9 A;  3WTZ A;  3ELK A;  4GGG A;  1FNN A;  4ZH4 F;  4RS8 A;  1B1B A;  3F21 A;  5L3G A;  3BPX A;  1H9G A;  1S29 A;  1MKM A;  4P9F A;  1P4A A;  3B02 A;  1D8K A;  4KT5 C;  1K78 B;  3WTS C;  4UVA A;  4BHC A;  4EGY A;  3R61 A;  1KU3 A;  3ZMS A;  3IWF A;  2MLG A;  1PP7 U;  2X4H A;  3L09 A;  4FX0 A;  2P6S A;  5LBQ A;  3EYI A;  5BQT A;  2DPD A;  1RZ4 A;  2GXB A;  2ISZ A;  4MTE A;  4BNC A;  2FRH A;  1ULY A;  2XGX A;  3V7S A;  1IN8 A;  2F5E A;  3HIF A;  1Z7U A;  3C18 A;  2ZCW A;  3I58 A;  3C3W A;  1Z6R A;  2FQ3 A;  4JBA A;  3OOP A;  5A2Q K;  1JHH A;  5L3D A;  4I01 A;  4ESF A;  5CLS A;  3HSR A;  3Q9S A;  3ZQ7 A;  1K7A A;  2F5D A;  5IT9 K;  1XCB A;  3J81 Z;  3E3V A;  2FNA A;  4HZF A;  2DPU A;  3LST A;  4N0B A;  3I53 A;  5FD6 A;  1AWC A;  1WKM A;  1XCV A;  2WV0 A;  1HQC A;  2EA4 A;  2JRT A;  5K1Y A;  1GXP A;  1O3Q A;  3KP7 A;  6PAX A;  3E5Q A;  5FGM A;  3P9K A;  1UST A;  3IL2 A;  3K2Z A;  3I59 B;  3RYR A;  2PEX A;  1YLF A;  2PFB A;  3I4P A;  2C6Y A;  3TOA A;  5CVJ A;  1HW5 A;  5JVT A;  1S6L A;  5FLX Z;  3WGG A;  5DYM A;  3FMQ A;  3R60 A;  2EFP A;  4B09 A;  3QP6 A;  4S04 A;  2CSO A;  4XLP F;  1D3Y A;  1SD5 A;  3ZMZ A;  5ILU A;  1BI2 A;  5JFR A;  4YFX F;  4QWQ A;  2L3D A;  2L01 A;  3MEX A;  2EFN A;  3RTR A;  5K5R A;  3R6S A;  2QZ8 A;  2BEO A;  3DEU A;  4ESJ A;  1T98 A;  4IRI A;  4LD5 A;  4MEY F;  2R7F A;  1IN7 A;  4KMU X;  1HXD A;  4CXF A;  2XV4 S;  2Q8K A;  4I0B A;  4EJU A;  3EYY A;  1HKQ A;  2VBX A;  2HR3 A;  4I0A A;  3WE3 A;  2LSO A;  4RGR A;  4U7B A;  3VEP A;  1FWZ A;  3Q9V A;  2ACJ A;  2YPR A;  1JE8 A;  4IHT A;  5HLH A;  4AIH A;  2J5O A;  3VB2 A;  3E5X A;  4RB2 C;  2VBZ A;  4JQF A;  2J5P A;  2XVC A;  5ICG A;  2RV8 A;  2GXG A;  2XAF A;  1T0F A;  3LAP A;  4HDU A;  1XGM A;  3ZMU A;  1IN5 A;  3QU6 A;  3IHU A;  2A6E F;  3K1N A;  1FBQ A;  5E20 A;  5DCM B;  1IRF A;  3P9C A;  2Z33 A;  4WK8 F;  1D8J A;  1OKR A;  4Y15 A;  1F5T A;  3PFI A;  1IZ1 A;  4WXD A;  1ZRE A;  4U0V A;  3J81 K;  4O3M A;  1TNS A;  2ETH A;  2Y0M A;  3KLN A;  3J7A O;  3ABT A;  1OMI A;  1FBS A;  2KRF A;  4UHT A;  2V6C A;  4KFC A;  1TLH B;  3HHH A;  2A61 A;  2A07 F;  1LDD A;  2WC2 A;  1MJB A;  4ON0 A;  2RKH A;  3DF8 A;  1KU9 A;  1Z1D A;  4NHJ A;  4CO8 A;  1OYI A;  1F9N A;  2M87 A;  5D4R A;  5HS8 A;  2XRO A;  1I5Z A;  1RUO A;  1U78 A;  3GZ5 A;  1XB4 A;  3L9F A;  3JW4 A;  3ROU A;  1G3S A;  2A6H F;  1QPM A;  5BOX A;  4E70 A;  1FPQ A;  1FT9 A;  1R1T A;  5LGT A;  4EQQ A;  4G8X A;  2FBI A;  1BC7 C;  4EMS A;  5FLX K;  3S2W A;  1UFM A;  1LDJ A;  2FNP A;  1L3L A;  2ADU A;  3E6C C;  1CF7 A;  4ZYD A;  2F5F A;  5CJ9 A;  5HDK A;  4HV5 A;  3ML6 A;  1PP8 F;  5LEJ A;  1BOA A;  3P9I A;  3GFJ A;  2IA0 A;  3VOD A;  4PDK A;  2RDP A;  1XDS A;  2W85 A;  2ISY A;  3B73 A;  1IXS B;  3K69 A;  3V4G A;  2O3F A;  1P2F A;  1EV7 A;  4ZZD A;  2STT A;  2RN7 A;  2M45 A;  3H92 A;  5F6F A;  1K79 A;  2P4W A;  2DQR A;  3TGN A;  1KGS A;  4IPA A;  3GF2 A;  1ZG1 A;  4MNU A;  3U2R A;  3CO7 C;  3WTX C;  4YG2 F;  1BJA A;  5D8K B;  2E7X A;  5L3B A;  1HW2 A;  3TO6 A;  2PI0 A;  2VC0 A;  3Q5F A;  4I09 A;  1T39 A;  1W7P D;  1ZGJ A;  4ASN A;  3HHG A;  4OIO F;  4G6D A;  4KUM A;  3G3Z A;  3HSF A;  2ZME A;  3BY6 A;  2KJC A;  4RB3 C;  2CWE A;  2PBI A;  2QVO A;  3WTV C;  4Y13 A;  1R00 A;  3KFW X;  2LF7 A;  4L5I A;  2A68 F;  4LG0 A;  3R0J A;  3F22 A;  2DT5 A;  5D6E A;  3RKY A;  2L02 A;  4O6J A;  1XN7 A;  2LF8 A;  4WX9 A;  2G7H A;  4OIP F;  1BN5 A;  2O8X A;  3LA2 A;  1K6O A;  5FD5 A;  1FSH A;  4K2E A;  2IRF G;  4ENN A;  2FE3 A;  5J6X A;  1BBY A;  1MJ9 A;  3VOE A;  1O7F A;  4I7H A;  4WWC A;  1ZLK A;  2VXZ A;  4LLN A;  1STZ A;  2OA4 A;  3J80 Z;  4UV8 A;  5LLQ A;  2HKO A;  5L3F A;  2JT1 A;  4L5J A;  2XAG A;  1QBJ A;  4PGG A;  1OYW A;  4M71 A;  2OZU A;  3CJN A;  5LGN A;  3R4K A;  4PZJ A;  1YFH A;  2ELH A;  1RI7 A;  2H6B A;  1KU2 A;  3GWZ A;  4LLL A;  1R1U A;  4KIG A;  4BAY A;  3RPQ A;  1ZN2 A;  1GXQ A;  3MWM A;  4RB0 A;  3D5L A;  2DLL A;  3JSO A;  1ON2 A;  4MHG A;  4YFN F;  2VE9 A;  3O3K A;  3OV8 A;  3WTT C;  3LAJ A;  1IRG A;  4R8H A;  5AIP A;  1FZP B;  1BIA A;  1KQ0 A;  3CDH A;  3WE2 A;  1FYL A;  2PMU A;  1SD4 A;  1XSD A;  5E17 F;  4HV6 A;  4HX4 A;  2HYG D;  2XAQ A;  3GW2 A;  4ENJ A;  3GEZ A;  4HW0 A;  1DPR A;  1XGN A;  1Z9C A;  2CYY A;  4RB1 A;  2BGC A;  2A3S A;  3JSP A;  2W25 A;  1EH7 A;  4OMY A;  4S05 A;  4IHS A;  1BI0 A;  2MBF A;  4UUV A;  1O3R A;  2UWM A;  1Z91 A;  2K27 A;  2NS0 A;  2OBP A;  4RGX A;  2CFX A;  3IC7 A;  5H6R A;  3KZZ A;  2EV5 A;  3QOP A;  5FO5 A;  3ZN1 A;  1XDU A;  3SXY A;  2ZXJ A;  4XSZ F;  1XSX A;  1Y0U A;  3QRF F;  4U7D A;  3GFM A;  2LNB A;  1DP7 P;  3DKW A;  2D1V A;  5HDG A;  2AXL A;  4CHU A;  2VN2 A;  3C1D A;  1CF7 B;  2QQA A;  4G7H F;  4CYD A;  3EET A;  4BYY A;  4Q5S F;  5J8C A;  1ZG3 A;  2JPB A;  3TO7 A;  5ED4 A;  3L7W A;  5D5U B;  1G4D A;  3HRS A;  4EGZ A;  2DK8 A;  4ETS A;  3CO6 C;  2HZT A;  3GXO A;  4P9U A;  2IT0 A;  4BHB A;  1O57 A;  4LB5 A;  1KU7 A;  4HLY A;  1C0W A;  1LEA A;  4WXC A;  4OIQ F;  4DNC A;  5HOO A;  2FF4 A;  2UZK A;  4IVN A;  2L4M A;  2JPC A;  1ZYR F;  1IW7 F;  1OPC A;  4HF1 A;  1RUN A;  2VBY A;  4Z2Y A;  4RGU A;  1S7O A;  5CVV A;  5D4S A;  2Q0O A;  1NHA A;  1Z6T A;  2Y75 A;  4M9X A;  2FML A;  1TTY A;  3EDP A;  1UHM A;  3IKT A;  3IKV A;  5JR3 A;  2FSW A;  2ZME B;  3HYI A;  3ZPL A;  1ZGA A;  1T38 A;  2E1N A;  2BYV E;  2FA5 A;  4HBL A;  4LG0 B;  1FY7 A;  3DPT A;  4JK1 X;  1A04 A;  1SFE A;  4A0Y A;  4KN7 X;  2W84 A;  2EFQ A;  2OZ6 A;  1ODD A;  4A6D A;  2NNN A;  1D5V A;  2FBK A;  5CYV A;  3JAM Z;  5FFX A;  4HX8 A;  3KP2 A;  2HS5 A;  3F8C A;  4Q4Z F;  1TW3 A;  2XAH A;  1AOY A;  3WG9 A;  3FXQ A;  1IN4 A;  3I5U A;  3U9G A;  4WF2 A;  2ZJ2 A;  1FP2 A;  4HQE A;  1Z05 A;  3KP5 A;  3HOT A;  3IRQ A;  1U2W A;  2IW5 A;  3V8K A;  1IXR C;  4IXA A;  4L9V A;  2HEO A;  3SHF A;  2ZBK A;  5AON A;  1ZH5 A;  5BPD A;  1U6G A;  2KKO A;  3I54 A;  2XRN A;  1MZB A;  2H94 A;  5CVU A;  3ZMD A;  1W5T A;  1BM9 A;  2MA3 A;  1SFU A;  2DFI A;  2XKO A;  4HLX A;  2IA1 A;  2O61 A;  2R7D A;  3CTA A;  2HKX A;  3GYH X;  2P8T A;  3NRV A;  2WWY A;  4ZYG A;  1FYM A;  4L9T A;  3TDU C;  1YYV A;  2FXA A;  3KET A;  2G9W A;  4BXU A;  3KP4 A;  4EM1 A;  1KYZ A;  1H0M A;  3RIR A;  3LQQ A;  5E8I A;  4M74 A;  4UNO A;  4LFU A;  3FXR A;  2MLK A;  2K4J A;  4MQ9 F;  2CW0 F;  3FHZ A;  1QNT A;  2UXX A;  1R58 A;  2RC4 A;  3LQR A;  4PGH A;  3L00 A;  2H27 A;  2F2E A;  3MAJ A;  3RKW A;  3CUQ C;  3IWZ A;  2Y48 A;  2M8E A;  1J2X A;  1DUX C;  3WGH A;  4G7O F;  1TQI A;  5D5W B;  3M8E A;  1ZAO A;  5E1W A;  1YTY A;  4F7Z A;  1FP1 D;  1VTN C;  3BJA A;  2HOE A;  4GYG A;  1BC8 C;  2Z5U A;  4EM0 B;  4MQV A;  1B6A A;  2PN6 A;  2WTE A;  4U88 A;  1QZZ A;  5D5V B;  4A6E A;  3ECO A;  3ZMV A;  2EWN A;  1T2K A;  1P4X A;  3FF5 A;  3MCZ A;  2YX4 A;  2ZO4 A;  3KP3 A;  3JAM K;  4RGS A;  3JTG A;  2NYX A;  3TDZ C;  3T0Y A;  3CUO A;  2HGC A;  3JTH A;  1UCR A;  4HA8 A;  2EFW A;  5JI6 A;  4R1H A;  5D6F A;  2DO7 A;  2GA1 A;  1XMA A;  3FMS A;  2K86 A;  2YSR A;  1SFX A;  4I02 A;  2QM3 A;  4OOI A;  2PJP A;  5JHU A;  3F3X A;  2CO5 A;  1J9I A;  3E5U A;  4NQW A;  3FXU A;  1I1G A;  1T6S A;  4P55 A;  2FOK A;  3PQK A;  4HOB A;  3RDI A;  1MJA A;  4G6Q A;  3NEU A;  4IJA A;  5LHG A;  4KYW A;  3T1B A;  1G3Y A;  5EEG A;  2O0Y A;  5L3C A;  1FOK A;  1TQP A;  3K1P A;  4I98 B;  3K9T A;  2XUB A;  2PQ8 A;  2XHK A;  3CUQ A;  5ILV A;  1EH6 A;  2ESH A;  1CGP A;  2XAJ A;  4P96 A;  1HBX G;  3BP8 A;  4ZYH A;  3F6V A;  2NRA C;  3I64 A;  2P5L C;  3E97 A;  1YG2 A;  3F6O A;  3TOB A;  2AS5 F;  1O7L A;  2YR2 A;  4GCV A;  1FBU A;  4M73 A;  1G3T A;  4NB5 A;  1P92 A;  1LDK B;  5LEK A;  2TDX A;  2VOD A;  3BRO A;  2L54 A;  4R79 A;  2QBY A;  4IRG A;  4AIJ A;  2X0L A;  2D1H A;  3E6M A;  2QYO A;  3P7N A;  1U8R A;  3IRR A;  2V79 A;  2V1D A;  2HQN A;  3MZY A;  2EB7 A;  1J5Y A;  1QGP A;  2K02 A;  5HLG A;  5AIQ A;  2P7V B;  3F8B A;  2DU9 A;  4H0E A;  4Y17 A;  2PG4 A;  1YQA A;  4A0X A;  1KQ8 A;  1KA8 A;  5K5Q A;  4XBF A;  4G7Z F;  1TQM A;  3E6B A;  1B59 A;  4L18 B;  1G3W A;  5DV5 A;  1USS A;  4FHT A;  4LMY A;  3F72 A;  3GX4 X;  3SFZ A;  4ENK A;  3W6J B;  1IF1 A;  1JXS A;  1U5T C;  2MD5 A;  3SZT A;  2COM A;  3O2P E;  5A2Q Z;  2HFH A;  4M9S A;  5F64 A;  3KLO A;  4EV0 A;  3F8F A;  5E1X A;  1WI9 A;  3I71 A;  1JHF A;  1WSU A;  1S3J A;  5IT9 Z;  4AD9 A;  4AWX B;  1SMT A;  1B9N A;  4A12 A;  4AVP A;  1MGT A;  2K4B A;  2QQB A;  2Z99 A;  5HVQ C;  2VBW A;  3GVA A;  5HS7 A;  4U0Y A;  5LHH A;  2V9V A;  3ISP A;  3EQL F;  4U0W A;  5H20 A;  3FWE A;  3EUH A;  5E1Z B;  4GXO A;  1PUE E;  1FC3 A;  2H6C A;  3W6K B;  2QWW A;  4UVC A;  4HAM A;  2HWV A;  3LFK A;  3PQJ A;  4GYI A;  3KCC A;  3RJP A;  2VT2 A;  1ZRD A;  1ZLJ A;  3WGI A;  4IRH A;  1F4K A;  1JGS A;  3ZN0 A;  4A5M A;  2Q2E A;  2LKP A;  3MFK A;  4UXN A;  1LNW A;  1XGO A;  4OIR F;  3LA7 A;  5TJJ A;  2GQQ A;  5HDN A;  4G94 A;  1R22 A;  1SD7 A;  1XMK A;  2STW A;  2MH2 A;  4M9Z A;  4KN4 X;  3DQV C;  2BE5 F;  1E2X A;  1KYW A;  1RNL A;  3WU0 A;  1UHW A;  3K0L A;  3COA C;  3BJO A;  2GWR A;  2IA2 A;  4YII A;  5DDG A;  4P5O A;  1YO5 C;  2HTJ A;  5CVI A;  1U5T A;  1QO0 D;  3HSE A;  4LK1 F;  4Q48 A;  3BOQ A;  2G7U A;  3ZP5 A;  1SMY F;  1ONV A;  2P5K A;  2YU3 A;  4RAZ A;  4A2U A;  1OR7 A;  3CLO A;  2EJR A;  3N97 A;  4G9Y A;  4EJV A;  5BPI A;  2Z9O A;  2IJL A;  4O5V A;  2K7L A;  3J80 K;  3HUG A;  5CVR A;  2V1U A;  3CUQ B;  2VC1 A;  1HST A;  2OQG A;  2R3S A;  4ESB A;  1W5S A;  2VE8 A;  3M9A A;  2O03 A;  3WOD F;  1YS6 A;  4OMZ A;  1FLI A;  5BMZ A;  1R36 A;  1I27 A;  1TNT A;  2PMH A;  2P7C B;  2CQK A;  3KEQ A;  5DEQ A;  3ABU A;  1KQ9 A;  4EVI A;  3KE2 A;  1FX7 A;  4RAY A;  2YX7 A;  4M6X A;  2VOO A;  1RIO H;  3QAH A;  2QBY B;  2LDU A;  2IP2 A;  2JSC A;  5D5X B;  3F23 A;  2KJB A;  5LRS A; 
#chains in the Genus database with same CATH topology
 3TQN A;  3RYP A;  2XC7 A;  1BIB A;  3A4C A;  3A01 A;  3A0H C;  1YW9 A;  2FU4 A;  1EF4 A;  2BXZ A;  1DGW Y;  3NWT A;  1OCP A;  4ZYA A;  3GUD A;  1YW7 A;  1H88 C;  1BW6 A;  1V5G A;  3TBI A;  1B9M A;  2LY2 A;  3G73 A;  5J3L A;  3V8L A;  2IAI A;  4MGR A;  1R23 A;  3FK7 A;  4QLC U;  1WQ2 A;  3CJT B;  4HQM A;  3L2C A;  2DI3 A;  4D7N A;  3DV8 A;  2EK5 A;  4CSW A;  1J09 A;  1MMA A;  3L2R A;  1O4X A;  5LGU A;  2EV0 A;  1EH8 A;  5KVR A;  3DTI A;  1BI1 A;  2QQ8 A;  4LLG F;  3RPU A;  3TP0 A;  1MDM A;  1HF0 A;  1A31 A;  5IP6 A;  2DAO A;  1LVA A;  2OD5 A;  2JZY A;  4DGW B;  4C3I J;  4MEX F;  2MH9 A;  2DT7 B;  3WTW C;  4DW6 A;  4PCQ A;  1SAX A;  5TIS C;  2V1X A;  4OU0 A;  2DTR A;  4XOP A;  1X1B A;  2AXT C;  3I56 I;  4L0Z B;  2E2I J;  2DJI A;  1A6Q A;  1XGS A;  5C4J J;  1X4P A;  2TRT A;  1PUF A;  2NAZ A;  4ZZL A;  1RR8 C;  4I6Z A;  3QP5 A;  1D0Z A;  2MC3 A;  3O6B B;  2KIM A;  3S3O A;  4A3F J;  2VJJ A;  3HOV J;  1LJ9 A;  3G71 I;  4JX4 A;  3M8F A;  1RR7 A;  5KHD A;  1YS7 A;  3BR3 A;  3E6D A;  1S8N A;  3V42 A;  1YHQ I;  1GHC A;  1RPW A;  4KA4 A;  4LJZ F;  5ICF A;  2KIF A;  5LRR A;  3RZO J;  5DD4 A;  3GLX A;  1E17 A;  1MBK A;  4XSX F;  3DEE A;  3D0S A;  5E18 F;  1MD0 A;  3DXJ F;  4M6Y A;  3QU3 A;  1LB2 A;  1X3U A;  1FSE A;  2BW3 B;  2ZC2 A;  3I0T A;  5KAF C;  1Q1H A;  1W7P A;  4CCL A;  4ZTF A;  3V8J A;  1JUP A;  3OS0 A;  2EA2 A;  3HOS A;  3DKX A;  1PJR A;  3WTU C;  2BY1 A;  3QOD A;  3BWG A;  1HW1 A;  1YW8 A;  2ZNZ A;  3F8M A;  1HKS A;  2WAQ N;  3H0D A;  1WJD A;  2L4A A;  3F8N A;  3J7A Y;  4B48 A;  3T8R A;  4KIS A;  2PMZ N;  1WI3 A;  2FUG 2;  2RGV A;  3HBL A;  4AIK A;  1GDT A;  3FKI J;  4A0Z A;  3HOX J;  3FHN A;  2BY2 A;  1YRN B;  1WH7 A;  4DBR A;  1UHS A;  1DU6 A;  5ERI A;  2V26 A;  2M1B A;  2D45 A;  1QVT A;  3RKX A;  4M72 A;  3CME I;  2R7U A;  4LK0 F;  4KNY A;  1LQ1 A;  2KIU A;  4II2 A;  4YIF A;  1RKW A;  1V54 H;  1Y1V J;  3GTQ J;  3BTJ A;  4TV7 A;  1IAW A;  4L0Y B;  1HSJ A;  3GTG J;  2DA2 A;  2BVM A;  1K4S A;  2JUC A;  2AQE A;  2VKD A;  3FM3 A;  5DD8 A;  2O6G E;  3OIQ A;  2QEN A;  4M3F A;  3HTS B;  4EM2 A;  5F0H A;  3HRT A;  5GTI C;  3GZ6 A;  3AL0 C;  1J59 A;  3ASN H;  2CW8 A;  2Q2E B;  2QEX I;  4NC6 A;  3T8T A;  5IYC J;  1QZY A;  1XSV A;  3K1M A;  4GO1 A;  3UKG A;  4CZZ A;  2IEK A;  1ETK A;  3AG2 H;  1R5H A;  3LSG A;  1J75 A;  1ZRC A;  2CG4 A;  4FX4 A;  1J0R A;  4ZJZ A;  5GPA A;  2VT3 A;  1SFK A;  3U1D A;  2E7W A;  1W0T A;  1DDN A;  2D2W A;  2W24 A;  3FM5 A;  3REO A;  1HKT A;  3FXM A;  4HF2 A;  2KHM A;  3PIO F;  2WV1 A;  3O8G A;  1OQY A;  4PFP A;  2NVQ J;  2ZME C;  4J19 A;  2JA5 J;  4KIT B;  5J4V A;  4ZYE A;  2BY0 A;  3BDD A;  2KZV A;  3KZY A;  4N9H A;  1W36 C;  4MTD A;  3E0J B;  4JX6 A;  2E5N A;  3D5R C;  3AAF A;  1ZAR A;  1YIO A;  4RAG A;  1PYV A;  2VPR A;  3IH4 A;  1QQI A;  4F52 A;  2R4G A;  5K7Z A;  3LSM A;  2WAQ A;  2XKP A;  2DQL A;  4HYE A;  2BV6 A;  3VYT B;  2PMZ A;  1X1P A;  2IS6 A;  3ULQ B;  1I6X A;  2L2O A;  1D0X A;  5J1R A;  4NNJ A;  2IS1 A;  1ON1 A;  1YJ9 I;  2P6T A;  4RLF A;  3VFZ A;  2W1O A;  2HTS A;  1WZ2 A;  5F04 A;  5HS9 A;  1U5T B;  2L7F P;  2L7M P;  3V7R A;  4Z6Y A;  2MD0 A;  3KIO A;  3FIW A;  3QPL A;  4IF4 A;  2R7S A;  2HQR A;  4YFK F;  5J8F A;  3G4S I;  1UJ8 A;  4ENM A;  2L7Z A;  2CUZ A;  3BCB A;  2DK5 A;  2LTP A;  4KIC A;  2GIV A;  3HOU J;  1BR2 A;  3ERE D;  5EDN A;  1K78 A;  2XPV A;  4WXH A;  5GAD J;  1IUY A;  5FLV A;  3BR6 A;  1ZR2 A;  4EJT A;  3BTC A;  3BG3 A;  2OAZ A;  2KQR A;  4J01 A;  2IS4 A;  3IP4 B;  4KIF A;  3LWF A;  4A3D J;  4CCM A;  1A6I A;  3AG4 H;  1R1V A;  2VON A;  4L9J A;  1X4O A;  4Q47 A;  1TT0 A;  5E8G A;  4M3D A;  1E3H A;  3H3U A;  5EF6 A;  3ZGK A;  3FMR A;  1JUS A;  5EJC A;  3IH3 A;  2ZNY A;  2JA6 J;  2DW4 A;  3M4O J;  3HUG B;  3V7C A;  4FAS D;  5FB2 A;  2JVH A;  5ICC A;  4J00 A;  4B1R A;  1POG A;  2ESN A;  4EAT A;  1NG6 A;  3OYD A;  2FEZ A;  2RVC A;  1UB9 A;  1U9O A;  3KP6 A;  5F1R A;  4CGZ A;  1D1B A;  4DQ2 A;  4HF0 A;  5D8L B;  3WU1 B;  2R7T A;  4XLN F;  3LSH A;  3ECH A;  2A69 F;  3HC7 A;  4UV9 A;  5KAI C;  2V4J C;  3BTI A;  5IT3 A;  2DBB A;  3TED A;  2XDV A;  3KEO A;  2QLZ A;  2X1D A;  2W57 A;  3BR5 A;  1BI3 A;  3ZQF A;  2IPQ X;  4XLF A;  3DFG A;  3GZN B;  3OS1 A;  4EJW A;  4CDG A;  2XAS A;  2Y9Y A;  3W2W A;  2OV7 A;  3GFL A;  3GME A;  5ICE A;  3HOZ J;  3DP7 A;  1G6N A;  4FT8 A;  3I4N J;  5M3F J;  4LGW A;  5FFZ A;  1IUF A;  2RQP A;  2HYF A;  2EV6 A;  3L2U A;  1DPU A;  1VND A;  2W82 A;  2GOX B;  2GA2 A;  5DM6 F;  1WWX A;  3CQZ J;  2EIJ H;  4A5N A;  4LB6 B;  4FTH A;  3BJ6 A;  3OYG A;  4EJO A;  2LVS A;  3SZP A;  1U3E M;  2R7X A;  1LEB A;  5HNF A;  1V3F A;  3PUB A;  3ESW B;  2HDC A;  1FOX A;  5HLI A;  5BS6 A;  3A1Y A;  4RAF A;  5ILS A;  2O8K A;  3NQO A;  2V7F A;  3A01 B;  2FBH A;  3MZH A;  2VOP A;  2E1C A;  4WCG A;  4UUT A;  1REP C;  4PJM A;  1S7E A;  3I59 A;  2HXI A;  5DS9 A;  2M0M A;  1SD6 A;  4HST A;  1QRY A;  1OYY A;  2MSY A;  2OQR A;  3FZV A;  1ETY A;  3KPH A;  3LA3 A;  4M3B A;  3GO5 A;  4I76 A;  2PLY A;  4M3E A;  3QPT A;  5F27 A;  4CIC A;  1R5G A;  2XF6 A;  1P4W A;  1GVJ A;  3S32 A;  5L3E A;  3N4M A;  2F5C A;  5DCF A;  3ZQG A;  3HTU A;  1IN6 A;  1IRX A;  1Z3Y A;  1MDM B;  3BPV A;  2Y0S N;  3IH2 A;  5H6Q A;  2P5V A;  1F1Z A;  2M30 A;  3FX3 A;  1WJA A;  1L0O C;  5K5O A;  2QUF A;  5J4Y A;  4UUS A;  3R0A A;  1R5I D;  4B8X A;  3JRD A;  5DUI A;  5FKN A;  2GZW A;  5GP9 A;  5CQE A;  4B44 A;  4BJT A;  4Y7N J;  4LIU A;  5TRD A;  3S93 A;  3LSP A;  3ONQ A;  3SQN A;  3CJQ B;  1PUF B;  1R7J A;  5FJ8 J;  1IDY A;  3EUK L;  4HDV A;  2ZFW A;  2VIX A;  4E7L A;  1WRJ A;  1ORK A;  2ZKZ A;  2QF7 A;  1D1C A;  5J40 A;  4XIC A;  1AU7 A;  3DPU A;  3CD6 I;  2ZXI A;  3QPH A;  2X6W A;  2NVT J;  1V4R A;  3IAM 2;  3U1K A;  2BBY A;  2BXY A;  2KT0 A;  2R7Z J;  2M4K A;  1XPX A;  3X2Q H;  2V1N A;  5CKT A;  3TKY A;  4EEF G;  2OU2 A;  5EYR A;  2NNY A;  3ABK H;  3OYE A;  1ZG5 A;  4DZJ A;  1G59 A;  4AID A;  1OCC H;  2Z3Y A;  1T95 A;  2CGP A;  1W7P B;  4XLA A;  4D0P A;  3AG1 H;  2IS2 A;  4DYR A;  1DQU A;  2ZJQ F;  4BAC A;  1MBE A;  3S1R J;  1O3T A;  2ZJR F;  3QOE A;  1P7I A;  1ZEL A;  2WAE A;  2A5W A;  5LHI A;  2B0L A;  3PNT A;  5FRM A;  1TW2 A;  2XIG A;  1I6H J;  5FRN A;  2EFO A;  3M7G A;  1P6R A;  2DOD A;  3HRM A;  2LBF A;  3EUA A;  1ZHF A;  1O3S A;  2QQ9 A;  4XRF A;  3JRA A;  3ZMT A;  4I99 C;  5FKM A;  3T5X A;  5IY5 H;  2JTV A;  1NH3 A;  3N05 A;  3H3Z A;  4KDP A;  1WJE A;  2A5Y B;  2DCE A;  3I4M J;  1DGR M;  1UG0 A;  2X85 A;  3OYN A;  2Y0S A;  3I9V 2;  1TT5 B;  2W00 A;  3NWS A;  2M4G A;  2OTJ I;  1X3Z B;  4I2O A;  3CMA I;  2LYC A;  1T33 A;  3RI4 A;  2UXN A;  3HXL A;  3M1E A;  4KMF A;  3HRU A;  4BHP A;  2DOF A;  2M5W A;  4L9N A;  2MYS A;  1H9T A;  1FMV A;  3MQ0 A;  3TO9 A;  2IVM A;  1XD7 A;  1S7A A;  1I1S A;  4KT6 A;  2GAU A;  4LIV A;  3DPL C;  4HG2 A;  1W4M A;  4IOC F;  2VLA A;  1H89 C;  1NK3 P;  1NG7 A;  4XID A;  4C30 A;  2H09 A;  4UVB A;  1PDN C;  1IXC A;  2FOW A;  2FMY A;  4XON A;  5DCM A;  2RNJ A;  3GFI A;  3C7J A;  1GUU A;  4KIB A;  1TBX A;  1GT0 C;  2BZT A;  1JKQ C;  3BZ6 A;  1J7K A;  1B4A A;  2CJJ A;  2HZD A;  2H1L A;  5DUK A;  4IHX A;  3CCQ I;  3Q0U A;  4N9I A;  2KIQ A;  2CMP A;  2E1M C;  5EEH A;  3HDD A;  3WTY C;  2LD5 A;  4BQA A;  1JJ6 C;  1XMX A;  4IZZ A;  4OIN F;  1FYK A;  3IAS 2;  3ZQC A;  1LVK A;  1ZRF A;  1S9H A;  1OLT A;  3K4M A;  5CPR B;  5KK1 A;  4IHW A;  4HX7 A;  4BH9 A;  1P9Q C;  3CCE I;  3WTZ A;  3ELK A;  5IPA A;  3K70 D;  4GGG A;  1FNN A;  1D0Y A;  4ABZ A;  4ZH4 F;  4C2T A;  2A05 A;  3QYE A;  4RS8 A;  2GM4 A;  1B1B A;  5J47 A;  5LD2 C;  2Z2S B;  3F21 A;  1TC3 C;  5L3G A;  4V19 K;  3S17 J;  1T08 B;  4PJJ A;  3BPX A;  1H9G A;  1S29 A;  1MKM A;  4P9F A;  1P4A A;  3B02 A;  1D8K A;  2M7B A;  3GLL A;  4BEH A;  4KT5 C;  1K78 B;  3WTS C;  3HEF A;  4XR6 A;  4UVA A;  2F4O B;  5GPC A;  4BHC A;  4EGY A;  3R61 A;  1IG7 A;  1KU3 A;  3ZMS A;  3IWF A;  4AYB N;  2HU9 A;  3CDL A;  2MLG A;  1PP7 U;  2PX9 A;  2X4H A;  4PJ0 C;  3H9J A;  3L09 A;  4FX0 A;  2OPT A;  2P6S A;  3LSI A;  5LBQ A;  3Q0W A;  3RQ4 A;  3PUF A;  3EYI A;  3BG6 A;  3SEQ A;  3OYL A;  5BQT A;  2DPD A;  1RZ4 A;  2GXB A;  2GOM A;  2ISZ A;  2ELK A;  4MTE A;  5M5X J;  4BNC A;  2FRH A;  1ULY A;  4D5C A;  2XGX A;  3V7S A;  3DBH B;  1IN8 A;  2F5E A;  3HIF A;  1Z7U A;  1MH3 A;  2EZL A;  3C18 A;  2ZCW A;  3I58 A;  3NAR A;  3C3W A;  4ITV A;  1Z6R A;  1W5C C;  2FQ3 A;  3RQI A;  2HQ5 A;  2OUM A;  3OOP A;  4JBA A;  5A2Q K;  3WHC A;  1JHH A;  5L3D A;  3SDB A;  1MW7 A;  4I01 A;  1OJL A;  2K9Q A;  5CLS A;  4ESF A;  3HSR A;  3HJE A;  1A36 A;  1I39 A;  3Q9S A;  2JMW A;  3ZQ7 A;  2R5Y A;  1K7A A;  2KDO A;  2F5D A;  4S0H B;  3HOW J;  5IT9 K;  1XCB A;  3J81 Z;  3E3V A;  1WJF A;  2FNA A;  2ZXW H;  4HZF A;  2DPU A;  3LST A;  4N0B A;  1SAN A;  3I53 A;  5FD6 A;  1AWC A;  4A3G J;  1WKM A;  1XCV A;  3S16 J;  3MKZ A;  2IGK A;  1FOW A;  1VQO I;  1Y8Q B;  2ECC A;  3W2A A;  2Y31 A;  4G6T B;  3LL7 A;  2WV0 A;  1VFC A;  1HQC A;  2EA4 A;  2JRT A;  4AYB A;  2EZK A;  5K1Y A;  1ETW A;  1GXP A;  1O3Q A;  2LOO A;  3KP7 A;  3B6C A;  6PAX A;  3E5Q A;  1PVE A;  5F0C A;  5FGM A;  3P9K A;  1UST A;  3IL2 A;  3K2Z A;  4HNV A;  3I59 B;  3RYR A;  3BG7 A;  1R4M B;  2PEX A;  1YLF A;  2PFB A;  1MSF C;  1X1D A;  3CCM I;  5F08 A;  3I4P A;  3DU6 A;  2C6Y A;  2KRC A;  3TOA A;  5CVJ A;  1HW5 A;  5DTD A;  2CQ7 A;  1WHU A;  1UZC A;  4FCY A;  4NDL A;  5JVT A;  1S6L A;  1VF9 A;  1LFP A;  5FLX Z;  3WGG A;  5LFA A;  5DYM A;  3FMQ A;  3R60 A;  4UUS B;  1K61 A;  1BL0 A;  2EFP A;  2EIK H;  4B09 A;  1MIJ A;  3QP6 A;  4S04 A;  4BQN A;  3BZC A;  2CSO A;  5M5Y J;  3LFU A;  1VQ8 I;  4XLP F;  1D3Y A;  2HDW A;  2CW7 A;  1SD5 A;  3ZMZ A;  5ILU A;  2XPU A;  3BTL A;  5JVG F;  1U8B A;  3H9G A;  1BI2 A;  2LMD A;  2OJE D;  1Z21 A;  3K4L A;  5JFR A;  4YFX F;  4QWQ A;  2L3D A;  2L01 A;  4BQO A;  3SEZ A;  3MEX A;  4LOC A;  4II3 A;  2B9S A;  2HVR A;  2EFN A;  2R7O A;  3RTR A;  5K5R A;  3R6S A;  4BE0 A;  1FJL A;  2QZ8 A;  1IRZ A;  2BEO A;  4RMN A;  3DEU A;  1X3W B;  4ESJ A;  1T98 A;  4IRI A;  2OCE A;  4LD5 A;  3KZI C;  4MEY F;  3HM5 A;  4F93 B;  2R7F A;  1IN7 A;  4KMU X;  1HXD A;  4CXF A;  4DYC A;  2XV4 S;  2EIL H;  2Q8K A;  3GBG A;  4I0B A;  4EJU A;  3K2A A;  1T56 A;  3EYY A;  1HKQ A;  1ETO A;  2VBX A;  2HR3 A;  1B8I A;  4I0A A;  3WE3 A;  2LSO A;  4RGR A;  2LBF B;  4U7B A;  3VEP A;  1FWZ A;  1GLN A;  9ANT A;  3Q9V A;  2ACJ A;  2R92 J;  2YPR A;  1JE8 A;  4IHT A;  1FMW A;  2ZSH B;  4XOT A;  5HLH A;  4GFB A;  4AIH A;  2J5O A;  3VB2 A;  3E5X A;  1OCZ H;  2YUS A;  5F1J A;  4RB2 C;  2VBZ A;  1ZGW A;  4JQF A;  1RET A;  2J5P A;  2XVC A;  5ICG A;  2RV8 A;  2GXG A;  2XAF A;  2KPM A;  4QIW N;  1T0F A;  3LAP A;  1XS9 A;  4HDU A;  1YIJ I;  1XGM A;  3ZMU A;  1MNM C;  1IN5 A;  3QU6 A;  3IHU A;  4XKV A;  2A6E F;  3K1N A;  4RDU A;  1BJZ A;  4QPQ A;  1IV8 A;  2P0W A;  1FBQ A;  1JI8 A;  3MKW B;  4CA0 A;  2E35 A;  5E20 A;  5DCM B;  1IRF A;  3P9C A;  3OYJ A;  2Z33 A;  3MZ8 A;  4WK8 F;  2R7Q A;  1D8J A;  1OKR A;  4Y15 A;  4BL0 B;  1F5T A;  3PFI A;  4CCO A;  1IZ1 A;  4WXD A;  1ZRE A;  4U0V A;  4HSR A;  4B4C A;  4BS9 A;  2DMT A;  3J81 K;  4O3M A;  1TNS A;  4OAY A;  2ETH A;  2Y0M A;  2X51 A;  3KLN A;  3J7A O;  3ABT A;  1OMI A;  1FBS A;  2KRF A;  2XPW A;  1BR1 A;  4RLQ A;  4UHT A;  5E3L A;  2V6C A;  4PSW A;  2ID3 A;  4XKW A;  4KFC A;  4IOA F;  2LRD A;  1TLH B;  3HHH A;  4M3G A;  2A61 A;  2A07 F;  1LDD A;  2WC2 A;  1MJB A;  4ON0 A;  3C2B A;  2RKH A;  4BBR J;  3NAU A;  3DF8 A;  1KU9 A;  1I50 J;  3ERM A;  2MG4 A;  1Z1D A;  3PSI A;  4NHJ A;  3BR2 A;  1OYI A;  2WAF A;  4CO8 A;  1VQ6 I;  1F9N A;  2V6E A;  4XLE A;  2M87 A;  5D4R A;  1TP4 A;  5HS8 A;  2XRO A;  4CCN A;  1I5Z A;  3S15 J;  1TWF J;  3FBN B;  1RUO A;  1SAU A;  1U78 A;  3GZ5 A;  1XB4 A;  2LKS A;  1IGN A;  1YJN I;  2RAE A;  3L9F A;  2HOT A;  3JW4 A;  5K7H A;  2LC2 A;  2H1K A;  3ROU A;  1G3S A;  2EZH A;  2A6H F;  1QPM A;  5BOX A;  1B72 A;  4E70 A;  1FPQ A;  1FT9 A;  4YEJ A;  4BEH B;  1VQ9 I;  1R1T A;  2XB5 A;  5LGT A;  4EQQ A;  1JTY A;  3OS2 A;  4G8X A;  4NC8 A;  4QPO A;  3U21 A;  2BY3 A;  3CF2 A;  2FBI A;  3OIP A;  1LPQ A;  2JUG A;  1BC7 C;  4F92 B;  2H8R A;  4AUX A;  4EMS A;  1FOY A;  5FLX K;  3CC2 I;  2HNH A;  3S2W A;  3JCU C;  1UFM A;  2R93 J;  1LDJ A;  2FNP A;  1L3L A;  2ADU A;  3K4N A;  3E6C C;  2VUM J;  1CF7 A;  2HYJ A;  4RM3 A;  4ZYD A;  4XLC A;  3DLL F;  1ZK8 A;  2F5F A;  2HI3 A;  4A3J J;  5CJ9 A;  5HDK A;  4HV5 A;  3ML6 A;  1IV6 A;  1PP8 F;  4F91 B;  5LEJ A;  3H3V K;  2M8G X;  1BOA A;  1V5F A;  3P9I A;  3GFJ A;  1Y8R B;  5CQG A;  2IA0 A;  4NC7 A;  2DMN A;  2V9P A;  2W48 A;  4HEA 2;  5EG0 A;  3VOD A;  4PDK A;  1LFU P;  3RPU D;  2RDP A;  2FX0 A;  4H4K C;  1XDS A;  3GCM A;  2D5V A;  5HOD A;  2W85 A;  2ISY A;  3B73 A;  1Y1W J;  1IXS B;  3K69 A;  3G2B A;  3V4G A;  3OYF A;  2O3F A;  1P2F A;  3H5N A;  1EV7 A;  4ZZD A;  2STT A;  3G1O A;  1MMS A;  5E3N A;  2HVQ A;  2R5Y B;  1RKT A;  2RN7 A;  2M45 A;  1Y0N A;  3H92 A;  5F6F A;  1K79 A;  2P4W A;  4BKX A;  2DQR A;  3TGN A;  4X0G A;  3OR2 C;  1KGS A;  3A0B C;  4IPA A;  2KMU A;  3FXK A;  2IGM A;  1ETQ A;  3GF2 A;  4XMY A;  1ACI A;  3QYF A;  3FXJ A;  1ZG1 A;  3PNV A;  4PSX A;  1JT6 A;  4MNU A;  2M9H A;  1OFC X;  3U2R A;  3CO7 C;  2FQ4 A;  3WTX C;  1FTT A;  3LSK A;  4YG2 F;  1BJA A;  4M6V A;  2QA4 I;  2E60 A;  1TWG J;  1XTA A;  4G12 A;  5D8K B;  3JRE A;  4MLO A;  2E7X A;  2VL8 A;  5L3B A;  4F55 A;  1HW2 A;  1MND A;  3D1N I;  1U9N A;  3TO6 A;  2PI0 A;  2VC0 A;  1MBH A;  2R7W A;  1HLV A;  4XN3 A;  3Q5F A;  4I09 A;  4JP0 A;  2F4I A;  1W7P D;  1ZGJ A;  1T39 A;  3PNY A;  3S8P A;  4ASN A;  3CCL I;  3HHG A;  3FK6 A;  4OIO F;  4G6D A;  2VQC A;  5KNL A;  4KUM A;  3G3Z A;  4DZP A;  3HSF A;  2ZME A;  3C2G A;  3BY6 A;  1LKX A;  3EUH C;  2CFO A;  2KJC A;  1QHG A;  1K4T A;  2CWE A;  4RB3 C;  2PBI A;  2QVO A;  3WTV C;  3TMO A;  1I3A A;  2QKL B;  1R00 A;  4Y13 A;  4BE1 A;  3KFW X;  2LF7 A;  4L5I A;  2A68 F;  1ITY A;  3OYB A;  3SFI A;  2VJ5 A;  4LG0 A;  3R0J A;  3S1N J;  3O8H A;  3F22 A;  4YIR X;  5B1A H;  2DT5 A;  2CQX A;  5D6E A;  3ZCO A;  3RKY A;  2LK2 A;  3OSF A;  2L02 A;  3VDX A;  3Q0V A;  2VQH A;  4O6J A;  5B5E C;  4E6K G;  1XN7 A;  3PO3 J;  2LF8 A;  4CCJ A;  4WX9 A;  2G7H A;  4OIP F;  1BN5 A;  1FEX A;  3H5A A;  4BQQ A;  2DDB A;  2O8X A;  3LA2 A;  1K6O A;  2M3A A;  4A93 J;  3C2H A;  1D1A A;  1V55 H;  3VYS B;  2O7O A;  1XG1 A;  2MW8 A;  2DMQ A;  3PSF A;  3DBL B;  3HL2 A;  2NVU B;  5FD5 A;  1FSH A;  2BOL A;  2RNG A;  3LSJ A;  4A69 C;  3MMY B;  1N77 A;  4K2E A;  2X6Y A;  2IRF G;  4ENN A;  2HXO A;  2FE3 A;  3OMY A;  2UUZ A;  4JYK A;  3K4B A;  2H8W A;  1X2N A;  3PFY A;  5J6X A;  1QU3 A;  1BBY A;  1MJ9 A;  3CF5 F;  1IC8 A;  3CLQ A;  4HPQ A;  3VOE A;  1O7F A;  1XX5 A;  4I7H A;  3VPR A;  4WWC A;  1ZLK A;  3BQY A;  2PJR A;  2VXZ A;  1B8I B;  4LLN A;  3F9K A;  1STZ A;  3WHB A;  2OA4 A;  3OYK A;  3J80 Z;  5FLM J;  4UV8 A;  5LLQ A;  2HKO A;  3FXL A;  2W7N A;  5L3F A;  2JT1 A;  4L5J A;  1ETV A;  1A35 A;  2XAG A;  4ZDL A;  1QBJ A;  1HA8 A;  2NOJ B;  4PGG A;  3HKZ N;  3VSL A;  4XL9 A;  1OYW A;  4M71 A;  2OZU A;  3JRH A;  3HOY J;  2KIS A;  3CJN A;  2WY7 Q;  3JRF A;  3RKQ A;  3CP8 A;  5LGN A;  3R4K A;  5JLW A;  4PZJ A;  2G0E A;  2Y2Z A;  1YFH A;  2VQG A;  1RI7 A;  2ELH A;  2H6B A;  4XK4 A;  5TGT A;  3ZQL A;  1KU2 A;  3GWZ A;  4LLL A;  3CMY A;  1R1U A;  1LUJ B;  4W97 A;  3CCJ I;  4KIG A;  4BAY A;  3RPQ A;  4OWR B;  5M5W J;  4Y33 A;  3K4J A;  1AHD P;  4C2U A;  1ZN2 A;  1KON A;  2JVG A;  3S3N A;  1H8A C;  1GXQ A;  3J7Z I;  2DA3 A;  3MWM A;  4RB0 A;  1Z77 A;  1GV2 A;  3D5L A;  2DLL A;  4D5F A;  3GTP J;  4AU7 A;  1DP3 A;  3JSO A;  1ON2 A;  1TWH J;  3I55 I;  4W1U A;  4MHG A;  4BJ5 C;  4YFN F;  2CV0 A;  1Q1V A;  2VE9 A;  3OYM A;  2VB6 A;  3O3K A;  3OV8 A;  5GAE J;  3WTT C;  3LAJ A;  2CRG A;  1IRG A;  4R8H A;  5AIP A;  3HPH A;  2X6X A;  4AC0 A;  1FZP B;  1BIA A;  1KQ0 A;  2DMU A;  4LIT A;  3CDH A;  3WE2 A;  1FYL A;  2PMU A;  1SD4 A;  2KLO A;  4E7J A;  3OY9 A;  2K9N A;  1XSD A;  3S14 J;  2EBI A;  5E17 F;  4PFO A;  2ZXH A;  2LG4 A;  3E1S A;  4HV6 A;  4HX4 A;  2HYG D;  2CS3 A;  3FXO A;  2XAQ A;  3GW2 A;  2KRH A;  4ENJ A;  3GEZ A;  1Z7L A;  4HW0 A;  1DPR A;  4FIS A;  2Z16 A;  5C4X J;  4XKC A;  4BJ6 C;  1XGN A;  2DA1 A;  1Z9C A;  2CYY A;  4RB1 A;  2BGC A;  2A3S A;  1W1W E;  3JSP A;  3G1L A;  2W25 A;  3KX2 A;  3S1M J;  4X1E A;  2DT6 A;  1EH7 A;  1SEU A;  2CV2 A;  1RC9 A;  3HKZ A;  4OMY A;  4S05 A;  1YI2 I;  1ZQ3 P;  4IHS A;  1BI0 A;  4BBS J;  2MBF A;  4UUV A;  1O3R A;  2BHY A;  2RRE A;  2UWM A;  1Z91 A;  2K27 A;  2NS0 A;  2K40 A;  2OBP A;  4RGX A;  1B72 B;  1MMG A;  1WJ5 A;  2CFX A;  3IC7 A;  5H6R A;  3KZZ A;  1OCT C;  2WY8 Q;  2DA7 A;  2EV5 A;  2Y69 H;  3QOP A;  5FO5 A;  3ZN1 A;  4PK4 A;  1XDU A;  3SXY A;  2ZXJ A;  4XSZ F;  1S72 I;  1K6Y A;  4A3E J;  2E36 A;  1XSX A;  1Y0U A;  2B63 J;  5F0F A;  3QRF F;  2JRM A;  4U7D A;  3GFM A;  2LNB A;  3QYB A;  1DP7 P;  3DKW A;  2D1V A;  5HDG A;  2F6C A;  1EKE A;  4V2G A;  5EEA A;  2E2J J;  2AXL A;  4CHU A;  3UR3 C;  2M7A A;  3W2V A;  2VN2 A;  3RZD J;  2I10 A;  3C1D A;  1ZKG A;  1WCM J;  1CF7 B;  2QQA A;  3KYC B;  1VZ0 A;  2YU9 J;  4XM3 A;  1SVM A;  4G7H F;  4CYD A;  2CH0 A;  3BG9 A;  4ANJ A;  3EET A;  5FRO A;  3L1P A;  4BYY A;  4BU2 A;  4Q5S F;  5J8C A;  1ZG3 A;  5GAH J;  2JPB A;  3TO7 A;  5ED4 A;  5HLT A;  3L7W A;  5D5U B;  1OIS A;  3M07 A;  1G4D A;  3HRS A;  1YX3 A;  3DCF A;  5EG0 B;  2JA7 J;  2E5Z A;  1RRJ A;  4EGZ A;  2DK8 A;  3HPG A;  4XRS A;  4ETS A;  4XRM A;  3CO6 C;  2HZT A;  4FET A;  3GXO A;  2X6O A;  3IUO A;  3TP3 A;  4MO7 A;  4P9U A;  4RM2 A;  4BHB A;  2DDA A;  1VQL I;  1O57 A;  2IT0 A;  4BY1 J;  4LB5 A;  2ZJP F;  4HNU A;  1KU7 A;  3ZOB A;  2VKE A;  4HLY A;  1C0W A;  1HDP A;  1LEA A;  3ZR8 X;  4IQJ A;  1YJW I;  4WXC A;  3QQA A;  4E7I A;  4OIQ F;  4DNC A;  5HOO A;  3HB9 A;  2KZG A;  3OR1 C;  2FF4 A;  2UZK A;  2M2E A;  2DJN A;  4IVN A;  2L4M A;  2KFD A;  2JPC A;  1QA6 A;  1ZYR F;  1IW7 F;  1OPC A;  4HF1 A;  3AL0 B;  1RUN A;  2VBY A;  4Z2Y A;  4E7H A;  2OC6 A;  4RGU A;  1S7O A;  5CVV A;  2EIN H;  2DFE A;  2MC4 A;  1E3O C;  5D4S A;  2XRL A;  4UB6 C;  2Q0O A;  1NHA A;  3PM1 A;  5E3O A;  1Z6T A;  4B3A A;  2Y75 A;  4M9X A;  2FML A;  1ERD A;  1TTY A;  3HGY A;  2VXD A;  3EDP A;  1UHM A;  3IKT A;  3IKV A;  4BE2 A;  3SDG A;  2P81 A;  5JR3 A;  2XB0 X;  2FSW A;  2VQL A;  2ZME B;  1SVL A;  5EZG A;  3IV5 A;  1QPI A;  3HYI A;  3ZPL A;  2COB A;  2JSP A;  3VYU B;  1ZGA A;  3HGG A;  1T38 A;  1JKP C;  2E1N A;  2JK3 A;  3L2V A;  2BYV E;  2FA5 A;  1ZTR A;  3HZJ A;  4HBL A;  4LG0 B;  1FY7 A;  3DPT A;  4RBO A;  4JK1 X;  2ZFU A;  3BCA A;  1A04 A;  1SFE A;  4A0Y A;  4KN7 X;  2W84 A;  2F48 A;  2EFQ A;  2OZ6 A;  1ODD A;  4A6D A;  2NNN A;  4XKB A;  1D5V A;  3VYR B;  2FBK A;  2Y30 A;  5CYV A;  3JAM Z;  1E0E A;  4V2F A;  4CYC B;  1R6R A;  4Y4R A;  5FFX A;  4HX8 A;  1LE8 A;  3OYA A;  2DFH A;  1WJB A;  2B7E A;  3BR1 A;  2E1O A;  3KP2 A;  1LFB A;  2HS5 A;  3W6V A;  3F8C A;  4Q4Z F;  2XSJ C;  2IGN A;  2XF7 A;  1TW3 A;  2NOG A;  2XAH A;  1AOY A;  3DTK A;  3WG9 A;  1VQM I;  2QSH X;  1MMN A;  4BDY A;  2LFB A;  1W0U A;  3FXQ A;  2WA0 A;  4DJA A;  1BW5 A;  1ENH A;  2AHQ A;  1IN4 A;  3I5U A;  3U9G A;  4WF2 A;  1BR4 A;  2ZJ2 A;  2M0C A;  2NVX J;  1FP2 A;  1X1C A;  4HQE A;  1VQ4 I;  1Z05 A;  3PL8 A;  3KP5 A;  2ZSI B;  3CJR B;  3ZXS A;  3J7Y J;  3HOT A;  3BC8 A;  3K6G A;  3IRQ A;  1U2W A;  3S2H J;  1Z0X A;  3S1Q J;  2IW5 A;  3V8K A;  3GTJ J;  2R5Z A;  1WPK A;  1F43 A;  1IXR C;  4IXA A;  1SFO J;  2VAS A;  2DYS H;  1OCR H;  4L9V A;  1NK2 P;  2HOS A;  2XGE A;  3MKL A;  2HEO A;  2PJR B;  3SHF A;  2ZBK A;  1V5E A;  2KDZ A;  5AON A;  4F3Q A;  2DOA A;  2XF5 A;  1ZH5 A;  5BPD A;  1U6G A;  3QWL A;  3S3M A;  3S2D J;  2KKO A;  3I54 A;  1TL8 A;  4ZDO A;  2ME6 A;  1VQK I;  2XRN A;  1MZB A;  4A3L J;  2H94 A;  5CVU A;  3ZMD A;  2ZB9 A;  2WAD A;  1W5T A;  1BM9 A;  2MA3 A;  1SFU A;  2DFI A;  2XKO A;  1HC8 A;  2K9L A;  2IA1 A;  4HLX A;  2O61 A;  1OCO H;  2K3F A;  2R7D A;  2X9D A;  3H1C A;  3A02 A;  3CTA A;  2HKX A;  5BNG A;  3GYH X;  2P8T A;  3NRV A;  2WWY A;  4ZYG A;  1UEL B;  2R7V A;  1FYM A;  4L9T A;  3TDU C;  3PJR A;  4HNT A;  1YYV A;  2FXA A;  2JN6 A;  3LMM A;  3KET A;  2G9W A;  4BXU A;  3MVP A;  3KP4 A;  4EM1 A;  4DOZ A;  1KYZ A;  1H0M A;  3RIR A;  3LQQ A;  5E8I A;  4OAZ A;  3I3L A;  1Y56 A;  1SVO A;  5H2F C;  2CQQ A;  4M74 A;  3WG7 H;  4UNO A;  2EH3 A;  4LFU A;  3FXR A;  2XSD C;  2LRE A;  3EPZ A;  2MLK A;  2K4J A;  4MQ9 F;  2CW0 F;  3FHZ A;  1QNT A;  2UXX A;  1R58 A;  4MFD A;  2DA4 A;  2RC4 A;  3LQR A;  2LY9 A;  4BUP A;  2OF7 A;  4PGH A;  1VQ7 I;  3L00 A;  2H27 A;  4IQ4 A;  2M34 A;  2F2E A;  3MAJ A;  2ECB A;  1ETX A;  2TCT A;  4B47 A;  3RKW A;  3CUQ C;  2VKV A;  4DIQ A;  3BG5 A;  1HDD C;  3IWZ A;  2Y48 A;  2ELJ A;  2M8E A;  4CZC A;  2GBY A;  1J2X A;  1DUX C;  3WGH A;  1X58 A;  3K4K A;  4G7O F;  1VQ5 I;  1TQI A;  4BGD A;  5D5W B;  3M8E A;  1ZAO A;  2OCC H;  5E1W A;  3K70 C;  1YTY A;  3CC7 I;  1XC5 A;  4ZTJ A;  4F7Z A;  5IOZ A;  3ZQH A;  1FP1 D;  2HOA A;  1VTN C;  3BJA A;  3SZG A;  2HOE A;  5J1Y A;  3HG9 A;  4GYG A;  4XRS G;  1BC8 C;  3CCU I;  2Z5U A;  2CUJ A;  2FD5 A;  5FKL A;  3OYI A;  5E3M A;  4EM0 B;  1YX5 A;  4MQV A;  1B6A A;  2W4S A;  2PN6 A;  2WTE A;  1HOM A;  4U88 A;  4PUS A;  1QZZ A;  3CCY A;  2ME0 A;  2K3P A;  5D5V B;  3ZQI A;  1Z3X A;  4A6E A;  2QKM B;  3ECO A;  4C3J J;  4L5E A;  3ZMV A;  5K7F A;  4NBQ A;  2EWN A;  1WJC A;  3M8J A;  1T2K A;  1P4X A;  2LP0 A;  1R71 A;  5JLX A;  2F5V A;  2HVS A;  3FF5 A;  3MCZ A;  3OIO A;  3DEW A;  2DTZ A;  1T8I A;  2A6T A;  1QVU A;  4CCK A;  2YX4 A;  2ZO4 A;  4FQG A;  3KP3 A;  3JAM K;  4X6A J;  1N25 A;  4RGS A;  3JTG A;  2NYX A;  4E7K A;  3TDZ C;  3T0Y A;  3CUO A;  3FIS A;  3CDI A;  2HGC A;  4BXX J;  5GAG J;  4CUG A;  2QSG X;  3JR9 A;  3JTH A;  1UCR A;  4HA8 A;  2EFW A;  4E7Z A;  5JI6 A;  3OYC A;  2E71 A;  4R1H A;  3ZRG A;  4IHV A;  1FIP A;  1FIA A;  2XGD A;  2L9R A;  3FKJ A;  4D9J A;  2WBM A;  5D6F A;  2DO7 A;  3A2K A;  2GA1 A;  4GDF A;  1XMA A;  4BY7 J;  3FMS A;  3BLY A;  2K86 A;  2WB1 N;  2MGQ A;  2YSR A;  1SFX A;  4I02 A;  2QM3 A;  3ABM H;  4OOI A;  2PJP A;  5JHU A;  3CCV I;  3F3X A;  2CO5 A;  1FTZ A;  1WVR A;  1J9I A;  3E5U A;  4NQW A;  5EGO A;  1SC7 A;  2KL4 A;  3FXU A;  2AO9 A;  3MN2 A;  3ZQQ A;  4PJN A;  4B43 A;  3OSG A;  1I1G A;  3M3Y J;  4IL6 C;  1T6S A;  4P55 A;  2FOK A;  3PQK A;  4HOB A;  3RDI A;  1MJA A;  4G6Q A;  3NEU A;  2Q1Z B;  4IJA A;  4D7M A;  1JT0 A;  3DTE A;  5LHG A;  4KYW A;  3G1M A;  1WH5 A;  3T1B A;  1VQP I;  1MH4 A;  5E79 C;  1G3Y A;  2VI6 A;  5EEG A;  1E3P A;  2O0Y A;  5L3C A;  1FOK A;  1TQP A;  3K1P A;  4I98 B;  3K9T A;  3LOC A;  2R7R A;  2XUB A;  2PQ8 A;  4FE7 A;  3L2Q A;  1X19 A;  1JKO C;  2XHK A;  3CUQ A;  5ILV A;  1P7J A;  2QSF X;  2I5U A;  1EH6 A;  2ESH A;  1F36 A;  3OOU A;  4LG3 A;  2F4M B;  3ABL H;  3CZ6 A;  5EZH A;  5KCM A;  3PO2 J;  1CGP A;  2VKH A;  2XAJ A;  4AM3 A;  5B3S H;  4P96 A;  1HBX G;  2XGC A;  3BP8 A;  3SJM A;  4ZYH A;  4NUB A;  1BOB A;  2CQN A;  2E1M B;  3F6V A;  2NRA C;  3I64 A;  5JHF A;  1KZH A;  2P5L C;  3E97 A;  1YG2 A;  3F6O A;  3KYD B;  2IBD A;  2EPF A;  4XNF A;  3TW6 A;  1GV5 A;  3TOB A;  2AS5 F;  4E4H A;  1O7L A;  2EZI A;  2YR2 A;  3VWB A;  2QGU A;  3BZK A;  3E7L A;  2MAB A;  4GCV A;  1FBU A;  1M1E B;  2Z1D A;  3F0C A;  1I3Q J;  4A3K J;  4JOM A;  3H35 A;  4M73 A;  1G3T A;  2MFZ A;  2X1E A;  4BDZ A;  4NB5 A;  2WB1 A;  1P92 A;  1LDK B;  5LEK A;  1UG2 A;  2TDX A;  1HCR A;  1APL C;  3OWT A;  3BRO A;  4MIM A;  2VOD A;  2VPL A;  2L54 A;  5FKO A;  2IXS A;  1LE8 B;  4R79 A;  2QBY A;  1AKH A;  4IRG A;  2DXI A;  1QZE A;  4IO9 F;  4AIJ A;  2LLK A;  2HQA A;  2D1H A;  2X0L A;  2QYO A;  3E6M A;  3P7N A;  3TL4 X;  1U8R A;  3IRR A;  2V79 A;  2V1D A;  1IO2 A;  3A03 A;  2HQN A;  2K9M A;  3MZY A;  4CYC A;  2EB7 A;  1J5Y A;  1G8X A;  4IEJ A;  1QGP A;  2K02 A;  4HRI A;  3H36 A;  3L2W A;  5HLG A;  3AFH A;  5AIQ A;  2RQQ A;  3Q3S A;  3GTO J;  2P7V B;  2OTL I;  3F8B A;  4YEL A;  2L9V A;  2AQF A;  3OL4 A;  3JRB A;  2DMP A;  1TZL A;  2DU9 A;  5FKK A;  4H0E A;  1JUM A;  4Y17 A;  2K85 A;  2R5Z B;  2PG4 A;  1YQA A;  4A0X A;  1KQ8 A;  1KA8 A;  5K5Q A;  2GIZ A;  4XBF A;  3JRI A;  4G7Z F;  1TQM A;  3E6B A;  1B59 A;  5B1B H;  2L7K A;  4L18 B;  3AG3 H;  2E2H J;  2JQ7 A;  4QTR A;  1EA3 A;  1G3W A;  5DV5 A;  1D5Y A;  3D5S C;  1USS A;  4UY8 I;  4FHT A;  4LMY A;  4A3C J;  3CES A;  1X2M A;  2BHZ A;  4KJZ A;  3F72 A;  2X48 A;  2E34 A;  2UV1 A;  3DKY A;  4D1Q A;  3GX4 X;  4E7S A;  2EIM H;  3SFZ A;  2DA6 A;  3PIP F;  5C44 J;  4ENK A;  2QCO A;  3W6J B;  2CUF A;  1IF1 A;  1JXS A;  1U5T C;  2MD5 A;  3H9Q A;  3SZT A;  2COM A;  4DBQ A;  3O2P E;  2N8G A;  5A2Q Z;  1S5L C;  2HFH A;  4M9S A;  2L9S A;  3CC4 I;  1IDZ A;  5F64 A;  4C9Y A;  1WGX A;  5J1U A;  2X1C A;  3GTK J;  1MNE A;  3KLO A;  5IYB J;  1G2H A;  4EV0 A;  4JX5 A;  3F8F A;  5E1X A;  1WI9 A;  3I71 A;  4N4O B;  1JHF A;  1WSU A;  2L0K A;  1JTX A;  1S3J A;  5IT9 Z;  4AD9 A;  1VQN I;  2ICW G;  1OR7 C;  2BW3 A;  4AWX B;  3W3C A;  1SMT A;  1AA7 A;  1B9N A;  4U87 A;  4A12 A;  4AVP A;  3LSR A;  4MFE A;  1MGT A;  2K4B A;  2QQB A;  5M3M J;  2Z99 A;  5HVQ C;  2VBW A;  4XLH A;  4IX7 A;  5HNH A;  3GVA A;  5HS7 A;  4U0Y A;  5LHH A;  2V9V A;  4DYQ A;  3ISP A;  1MBF A;  3EQL F;  1EJ9 A;  3GTL J;  4U0W A;  5C3E J;  5H20 A;  3FWE A;  3K4C A;  4XOR A;  2VJ4 A;  3EUH A;  2Y9Z A;  5E1Z B;  1JGG A;  1NTC A;  4GXO A;  1PUE E;  4ZDP A;  1YRN A;  1DU0 A;  2HPM A;  2JA2 A;  1FC3 A;  4AVZ A;  3BQZ A;  2LR8 A;  2H6C A;  3QPS A;  4BXF A;  3MKY B;  1UAA A;  3W6K B;  1BA5 A;  2QWW A;  4UVC A;  4HAM A;  2HWV A;  1MSE C;  2E19 A;  4Y52 J;  3LFK A;  3PQJ A;  4GYI A;  4A3I J;  2LY1 A;  3KCC A;  3RJP A;  1Y6I A;  2VT2 A;  3H5R A;  1ZRD A;  2JJ7 A;  1ZLJ A;  2DFF A;  3DBR B;  2K5C A;  3WGI A;  4C2M J;  4IRH A;  5DM7 F;  3KEY A;  1F4K A;  3VSK A;  1JGS A;  1TWA J;  3RSN A;  2GXA A;  3ZN0 A;  5IP7 J;  2NS8 A;  5B66 C;  1CQT A;  4A5M A;  3CP2 A;  3DLA A;  4P1W A;  1Y39 A;  2Q2E A;  2LKP A;  3MFK A;  4UXN A;  1LNW A;  3CCS I;  1XGO A;  4OIR F;  3LA7 A;  4A3M J;  2BVL A;  2CUE A;  5TJJ A;  2L9N A;  2GQQ A;  1N78 A;  3DWL E;  5HDN A;  4G94 A;  1R22 A;  1SD7 A;  1XMK A;  2STW A;  3GTM J;  2XAU A;  3MD2 A;  2MH2 A;  3JRC A;  4M9Z A;  3BT9 A;  4KN4 X;  4C3H J;  3DQV C;  3KYL A;  2L5Q A;  3ASO H;  2R0Q C;  5IOY A;  3AKZ A;  2BE5 F;  4IKF A;  1E2X A;  1RNL A;  1KYW A;  3WU0 A;  1UHW A;  3K0L A;  3COA C;  1GVD A;  2HPI A;  3BJO A;  1A5J A;  2GWR A;  1U0J A;  1MBJ A;  2IA2 A;  1W36 D;  2KP6 A;  4YII A;  1RES A;  4QSH A;  1IJW C;  5DDG A;  2LH9 A;  3FBI B;  1YOV B;  4P5O A;  1ZR4 A;  2GLO A;  1YO5 C;  2HTJ A;  5CVI A;  1U5T A;  1QO0 D;  1YIT I;  3LNQ A;  3HSE A;  3SYT A;  2VJI A;  4LK1 F;  4CH7 A;  2LKX A;  2NVY J;  4Q48 A;  3BOQ A;  2FJ1 A;  3DU5 A;  2G7U A;  3ZP5 A;  1SMY F;  5EGO B;  1ONV A;  4NQW B;  2ID6 A;  2P5K A;  3JRG A;  3UNG C;  2DA5 A;  4A3B J;  1MBG A;  2YU3 A;  3P5J A;  1X1A A;  4YRV A;  4IHY A;  4RAZ A;  4A2U A;  3M1C A;  1OR7 A;  3CLO A;  2EJR A;  3N97 A;  1UMQ A;  3G6E I;  4G9Y A;  2YS9 A;  3WU2 C;  4EJV A;  5BPI A;  2O5R A;  2Z9O A;  3CMM A;  2IJL A;  1YE9 A;  1K83 J;  4O5V A;  2JA8 J;  4XN0 A;  2K7L A;  3H0G J;  1N75 A;  3OYH A;  2DN0 A;  3J80 K;  1TWC J;  2IGO A;  5GTH C;  3HUG A;  5CVR A;  2CU7 A;  2V1U A;  3CUQ B;  2VC1 A;  3K7A J;  2DOE A;  3OL3 A;  4ZC3 A;  1HST A;  5IP9 J;  1R4N B;  2CV1 A;  2OQG A;  4UB8 C;  2R3S A;  1WFX A;  4Y3O A;  4ESB A;  1R9T J;  2I8D A;  2JWT A;  1MMD A;  1W5S A;  2VE8 A;  3TW7 A;  1Z67 A;  3M9A A;  2O03 A;  3WOD F;  4N4N B;  1YS6 A;  4OMZ A;  4FE4 A;  2EQR A;  2HDD A;  1JJ8 C;  1FLI A;  4RA2 A;  5BMZ A;  3RCO A;  1R36 A;  2PMH A;  1I27 A;  1TNT A;  2P7C B;  2NXN B;  2CQK A;  3KEQ A;  1VI0 A;  3B6A A;  5DEQ A;  1JKR C;  3K10 A;  2O9L A;  3ABU A;  1KQ9 A;  4EVI A;  3KE2 A;  3BR0 A;  1T0F C;  1FX7 A;  4RAY A;  2YX7 A;  2K9S A;  4M6X A;  1R49 A;  2VOO A;  2V9K A;  1RIO H;  5IYD J;  2DYR H;  2NS7 A;  3QAH A;  1QHH D;  3CCR I;  2QBY B;  1AKH B;  2LDU A;  4B3X A;  4PJL A;  4GRI A;  2IP2 A;  2JSC A;  5D5X B;  3F23 A;  4XQF A;  2KJB A;  5LRS A;  3FDY A; 
#chains in the Genus database with same CATH homology
 3TQN A;  3RYP A;  1BIB A;  1YW9 A;  2FU4 A;  3GUD A;  1YW7 A;  1B9M A;  3G73 A;  3V8L A;  4MGR A;  1R23 A;  4QLC U;  1WQ2 A;  4HQM A;  3L2C A;  2DI3 A;  3DV8 A;  2EK5 A;  5LGU A;  2EV0 A;  1EH8 A;  5KVR A;  1BI1 A;  4LLG F;  3RPU A;  1MDM A;  2DAO A;  1LVA A;  2OD5 A;  2JZY A;  4MEX F;  2MH9 A;  3WTW C;  4PCQ A;  1SAX A;  2V1X A;  4OU0 A;  2DTR A;  4L0Z B;  1XGS A;  2NAZ A;  4ZZL A;  3QP5 A;  2MC3 A;  3O6B B;  2KIM A;  1LJ9 A;  3M8F A;  1YS7 A;  3E6D A;  1S8N A;  1GHC A;  4KA4 A;  4LJZ F;  5ICF A;  2KIF A;  5LRR A;  5DD4 A;  3GLX A;  1E17 A;  4XSX F;  3D0S A;  5E18 F;  1MD0 A;  3DXJ F;  4M6Y A;  3QU3 A;  1LB2 A;  1X3U A;  1FSE A;  3I0T A;  1Q1H A;  1W7P A;  3V8J A;  2EA2 A;  3HOS A;  3WTU C;  3BWG A;  1HW1 A;  1YW8 A;  2ZNZ A;  3F8M A;  1HKS A;  2L4A A;  3F8N A;  3T8R A;  2RGV A;  4AIK A;  4A0Z A;  5ERI A;  2M1B A;  2D45 A;  3RKX A;  4M72 A;  4LK0 F;  4KNY A;  1LQ1 A;  2KIU A;  4YIF A;  4TV7 A;  1IAW A;  4L0Y B;  1HSJ A;  3FM3 A;  5DD8 A;  2O6G E;  2QEN A;  3HTS B;  4EM2 A;  3GZ6 A;  3HRT A;  1J59 A;  3T8T A;  1QZY A;  1XSV A;  3K1M A;  4GO1 A;  1J75 A;  4CZZ A;  1R5H A;  1ZRC A;  2CG4 A;  4FX4 A;  1J0R A;  2VT3 A;  3U1D A;  2E7W A;  1DDN A;  2D2W A;  2W24 A;  3FM5 A;  3REO A;  1HKT A;  4HF2 A;  4ZYE A;  3BDD A;  4N9H A;  3KZY A;  4MTD A;  3AAF A;  1ZAR A;  1YIO A;  1QQI A;  2XKP A;  2DQL A;  4HYE A;  2BV6 A;  3ULQ B;  1I6X A;  1ON1 A;  2P6T A;  3VFZ A;  2HTS A;  5HS9 A;  1U5T B;  3V7R A;  4IF4 A;  2HQR A;  4YFK F;  5J8F A;  4ENM A;  2DK5 A;  4KIC A;  2GIV A;  3ERE D;  1K78 A;  4WXH A;  1IUY A;  4EJT A;  2OAZ A;  4KIF A;  3LWF A;  1R1V A;  2VON A;  4L9J A;  4Q47 A;  5E8G A;  3H3U A;  3FMR A;  2ZNY A;  2DW4 A;  3V7C A;  5FB2 A;  5ICC A;  2ESN A;  2FEZ A;  2RVC A;  1UB9 A;  5F1R A;  3KP6 A;  4CGZ A;  4DQ2 A;  4HF0 A;  5D8L B;  3WU1 B;  4XLN F;  3ECH A;  2A69 F;  4UV9 A;  5IT3 A;  2DBB A;  3KEO A;  2QLZ A;  2W57 A;  1BI3 A;  2IPQ X;  3DFG A;  4EJW A;  4CDG A;  2XAS A;  3GFL A;  5ICE A;  3DP7 A;  1G6N A;  4FT8 A;  4LGW A;  5FFZ A;  2RQP A;  2HYF A;  2EV6 A;  1DPU A;  2GA2 A;  1WWX A;  4A5N A;  4LB6 B;  3BJ6 A;  4EJO A;  3SZP A;  1U3E M;  1LEB A;  1V3F A;  2HDC A;  5HLI A;  5BS6 A;  5ILS A;  3NQO A;  3MZH A;  2FBH A;  2VOP A;  2E1C A;  4WCG A;  1REP C;  3I59 A;  1SD6 A;  1OYY A;  2OQR A;  3FZV A;  3LA3 A;  3GO5 A;  2PLY A;  3QPT A;  4CIC A;  1R5G A;  1P4W A;  1GVJ A;  5L3E A;  3N4M A;  2F5C A;  5DCF A;  3HTU A;  1IN6 A;  1MDM B;  3BPV A;  5H6Q A;  2P5V A;  1F1Z A;  2M30 A;  3FX3 A;  1L0O C;  5K5O A;  2QUF A;  3R0A A;  4B8X A;  5DUI A;  2GZW A;  5TRD A;  3SQN A;  1R7J A;  4HDV A;  2ZFW A;  1WRJ A;  2ZKZ A;  3QPH A;  1V4R A;  2BBY A;  3TKY A;  2OU2 A;  2NNY A;  1ZG5 A;  2Z3Y A;  2CGP A;  1W7P B;  4D0P A;  1O3T A;  5LHI A;  2B0L A;  1TW2 A;  2XIG A;  2EFO A;  3M7G A;  1P6R A;  3HRM A;  1O3S A;  1ZHF A;  2QQ9 A;  4XRF A;  3ZMT A;  3T5X A;  2JTV A;  3H3Z A;  4KDP A;  2A5Y B;  4I2O A;  3RI4 A;  2UXN A;  3M1E A;  4KMF A;  3HRU A;  4BHP A;  2M5W A;  4L9N A;  1H9T A;  3TO9 A;  3MQ0 A;  2IVM A;  1XD7 A;  1S7A A;  1I1S A;  2GAU A;  3DPL C;  1W4M A;  2H09 A;  4UVB A;  1PDN C;  1IXC A;  2FMY A;  5DCM A;  2RNJ A;  3GFI A;  3C7J A;  4KIB A;  1TBX A;  3BZ6 A;  1J7K A;  1B4A A;  5DUK A;  4N9I A;  5EEH A;  3WTY C;  4BQA A;  4OIN F;  1FYK A;  1ZRF A;  5KK1 A;  4HX7 A;  4BH9 A;  3WTZ A;  3ELK A;  4GGG A;  1FNN A;  4ZH4 F;  4RS8 A;  1B1B A;  3F21 A;  5L3G A;  3BPX A;  1H9G A;  1S29 A;  1MKM A;  4P9F A;  1P4A A;  3B02 A;  1D8K A;  4KT5 C;  1K78 B;  3WTS C;  4UVA A;  4BHC A;  4EGY A;  3R61 A;  1KU3 A;  3ZMS A;  3IWF A;  2MLG A;  1PP7 U;  2X4H A;  3L09 A;  4FX0 A;  2P6S A;  5LBQ A;  3EYI A;  5BQT A;  2DPD A;  1RZ4 A;  2GXB A;  2ISZ A;  4MTE A;  4BNC A;  2FRH A;  1ULY A;  2XGX A;  3V7S A;  1IN8 A;  2F5E A;  3HIF A;  1Z7U A;  3C18 A;  2ZCW A;  3I58 A;  3C3W A;  1Z6R A;  2FQ3 A;  4JBA A;  3OOP A;  5A2Q K;  1JHH A;  5L3D A;  4I01 A;  4ESF A;  5CLS A;  3HSR A;  3Q9S A;  3ZQ7 A;  1K7A A;  2F5D A;  5IT9 K;  1XCB A;  3J81 Z;  3E3V A;  2FNA A;  4HZF A;  2DPU A;  3LST A;  4N0B A;  3I53 A;  5FD6 A;  1AWC A;  1WKM A;  1XCV A;  2WV0 A;  1HQC A;  2EA4 A;  2JRT A;  5K1Y A;  1GXP A;  1O3Q A;  3KP7 A;  6PAX A;  3E5Q A;  5FGM A;  3P9K A;  1UST A;  3IL2 A;  3K2Z A;  3I59 B;  3RYR A;  2PEX A;  1YLF A;  2PFB A;  3I4P A;  2C6Y A;  3TOA A;  5CVJ A;  1HW5 A;  5JVT A;  1S6L A;  5FLX Z;  3WGG A;  5DYM A;  3FMQ A;  3R60 A;  2EFP A;  4B09 A;  3QP6 A;  4S04 A;  2CSO A;  4XLP F;  1D3Y A;  1SD5 A;  3ZMZ A;  5ILU A;  1BI2 A;  5JFR A;  4YFX F;  4QWQ A;  2L3D A;  2L01 A;  3MEX A;  2EFN A;  3RTR A;  5K5R A;  3R6S A;  2QZ8 A;  2BEO A;  3DEU A;  4ESJ A;  1T98 A;  4IRI A;  4LD5 A;  4MEY F;  2R7F A;  1IN7 A;  4KMU X;  1HXD A;  4CXF A;  2XV4 S;  2Q8K A;  4I0B A;  4EJU A;  3EYY A;  1HKQ A;  2VBX A;  2HR3 A;  4I0A A;  3WE3 A;  2LSO A;  4RGR A;  4U7B A;  3VEP A;  1FWZ A;  3Q9V A;  2ACJ A;  2YPR A;  1JE8 A;  4IHT A;  5HLH A;  4AIH A;  2J5O A;  3VB2 A;  3E5X A;  4RB2 C;  2VBZ A;  4JQF A;  2J5P A;  2XVC A;  5ICG A;  2RV8 A;  2GXG A;  2XAF A;  1T0F A;  3LAP A;  4HDU A;  1XGM A;  3ZMU A;  1IN5 A;  3QU6 A;  3IHU A;  2A6E F;  3K1N A;  1FBQ A;  5E20 A;  5DCM B;  1IRF A;  3P9C A;  2Z33 A;  4WK8 F;  1D8J A;  1OKR A;  4Y15 A;  1F5T A;  3PFI A;  1IZ1 A;  4WXD A;  1ZRE A;  4U0V A;  3J81 K;  4O3M A;  1TNS A;  2ETH A;  2Y0M A;  3KLN A;  3J7A O;  3ABT A;  1OMI A;  1FBS A;  2KRF A;  4UHT A;  2V6C A;  4KFC A;  1TLH B;  3HHH A;  2A61 A;  2A07 F;  1LDD A;  2WC2 A;  1MJB A;  4ON0 A;  2RKH A;  3DF8 A;  1KU9 A;  1Z1D A;  4NHJ A;  4CO8 A;  1OYI A;  1F9N A;  2M87 A;  5D4R A;  5HS8 A;  2XRO A;  1I5Z A;  1RUO A;  1U78 A;  3GZ5 A;  1XB4 A;  3L9F A;  3JW4 A;  3ROU A;  1G3S A;  2A6H F;  1QPM A;  5BOX A;  4E70 A;  1FPQ A;  1FT9 A;  1R1T A;  5LGT A;  4EQQ A;  4G8X A;  2FBI A;  1BC7 C;  4EMS A;  5FLX K;  3S2W A;  1UFM A;  1LDJ A;  2FNP A;  1L3L A;  2ADU A;  3E6C C;  1CF7 A;  4ZYD A;  2F5F A;  5CJ9 A;  5HDK A;  4HV5 A;  3ML6 A;  1PP8 F;  5LEJ A;  1BOA A;  3P9I A;  3GFJ A;  2IA0 A;  3VOD A;  4PDK A;  2RDP A;  1XDS A;  2W85 A;  2ISY A;  3B73 A;  1IXS B;  3K69 A;  3V4G A;  2O3F A;  1P2F A;  1EV7 A;  4ZZD A;  2STT A;  2RN7 A;  2M45 A;  3H92 A;  5F6F A;  1K79 A;  2P4W A;  2DQR A;  3TGN A;  1KGS A;  4IPA A;  3GF2 A;  1ZG1 A;  4MNU A;  3U2R A;  3CO7 C;  3WTX C;  4YG2 F;  1BJA A;  5D8K B;  2E7X A;  5L3B A;  1HW2 A;  3TO6 A;  2PI0 A;  2VC0 A;  3Q5F A;  4I09 A;  1T39 A;  1W7P D;  1ZGJ A;  4ASN A;  3HHG A;  4OIO F;  4G6D A;  4KUM A;  3G3Z A;  3HSF A;  2ZME A;  3BY6 A;  2KJC A;  4RB3 C;  2CWE A;  2PBI A;  2QVO A;  3WTV C;  4Y13 A;  1R00 A;  3KFW X;  2LF7 A;  4L5I A;  2A68 F;  4LG0 A;  3R0J A;  3F22 A;  2DT5 A;  5D6E A;  3RKY A;  2L02 A;  4O6J A;  1XN7 A;  2LF8 A;  4WX9 A;  2G7H A;  4OIP F;  1BN5 A;  2O8X A;  3LA2 A;  1K6O A;  5FD5 A;  1FSH A;  4K2E A;  2IRF G;  4ENN A;  2FE3 A;  5J6X A;  1BBY A;  1MJ9 A;  3VOE A;  1O7F A;  4I7H A;  4WWC A;  1ZLK A;  2VXZ A;  4LLN A;  1STZ A;  2OA4 A;  3J80 Z;  4UV8 A;  5LLQ A;  2HKO A;  5L3F A;  2JT1 A;  4L5J A;  2XAG A;  1QBJ A;  4PGG A;  1OYW A;  4M71 A;  2OZU A;  3CJN A;  5LGN A;  3R4K A;  4PZJ A;  1YFH A;  2ELH A;  1RI7 A;  2H6B A;  1KU2 A;  3GWZ A;  4LLL A;  1R1U A;  4KIG A;  4BAY A;  3RPQ A;  1ZN2 A;  1GXQ A;  3MWM A;  4RB0 A;  3D5L A;  2DLL A;  3JSO A;  1ON2 A;  4MHG A;  4YFN F;  2VE9 A;  3O3K A;  3OV8 A;  3WTT C;  3LAJ A;  1IRG A;  4R8H A;  5AIP A;  1FZP B;  1BIA A;  1KQ0 A;  3CDH A;  3WE2 A;  1FYL A;  2PMU A;  1SD4 A;  1XSD A;  5E17 F;  4HV6 A;  4HX4 A;  2HYG D;  2XAQ A;  3GW2 A;  4ENJ A;  3GEZ A;  4HW0 A;  1DPR A;  1XGN A;  1Z9C A;  2CYY A;  4RB1 A;  2BGC A;  2A3S A;  3JSP A;  2W25 A;  1EH7 A;  4OMY A;  4S05 A;  4IHS A;  1BI0 A;  2MBF A;  4UUV A;  1O3R A;  2UWM A;  1Z91 A;  2K27 A;  2NS0 A;  2OBP A;  4RGX A;  2CFX A;  3IC7 A;  5H6R A;  3KZZ A;  2EV5 A;  3QOP A;  5FO5 A;  3ZN1 A;  1XDU A;  3SXY A;  2ZXJ A;  4XSZ F;  1XSX A;  1Y0U A;  3QRF F;  4U7D A;  3GFM A;  2LNB A;  1DP7 P;  3DKW A;  2D1V A;  5HDG A;  2AXL A;  4CHU A;  2VN2 A;  3C1D A;  1CF7 B;  2QQA A;  4G7H F;  4CYD A;  3EET A;  4BYY A;  4Q5S F;  5J8C A;  1ZG3 A;  2JPB A;  3TO7 A;  5ED4 A;  3L7W A;  5D5U B;  1G4D A;  3HRS A;  4EGZ A;  2DK8 A;  4ETS A;  3CO6 C;  2HZT A;  3GXO A;  4P9U A;  2IT0 A;  4BHB A;  1O57 A;  4LB5 A;  1KU7 A;  4HLY A;  1C0W A;  1LEA A;  4WXC A;  4OIQ F;  4DNC A;  5HOO A;  2FF4 A;  2UZK A;  4IVN A;  2L4M A;  2JPC A;  1ZYR F;  1IW7 F;  1OPC A;  4HF1 A;  1RUN A;  2VBY A;  4Z2Y A;  4RGU A;  1S7O A;  5CVV A;  5D4S A;  2Q0O A;  1NHA A;  1Z6T A;  2Y75 A;  4M9X A;  2FML A;  1TTY A;  3EDP A;  1UHM A;  3IKT A;  3IKV A;  5JR3 A;  2FSW A;  2ZME B;  3HYI A;  3ZPL A;  1ZGA A;  1T38 A;  2E1N A;  2BYV E;  2FA5 A;  4HBL A;  4LG0 B;  1FY7 A;  3DPT A;  4JK1 X;  1A04 A;  1SFE A;  4A0Y A;  4KN7 X;  2W84 A;  2EFQ A;  2OZ6 A;  1ODD A;  4A6D A;  2NNN A;  1D5V A;  2FBK A;  5CYV A;  3JAM Z;  5FFX A;  4HX8 A;  3KP2 A;  2HS5 A;  3F8C A;  4Q4Z F;  1TW3 A;  2XAH A;  1AOY A;  3WG9 A;  3FXQ A;  1IN4 A;  3I5U A;  3U9G A;  4WF2 A;  2ZJ2 A;  1FP2 A;  4HQE A;  1Z05 A;  3KP5 A;  3HOT A;  3IRQ A;  1U2W A;  2IW5 A;  3V8K A;  1IXR C;  4IXA A;  4L9V A;  2HEO A;  3SHF A;  2ZBK A;  5AON A;  1ZH5 A;  5BPD A;  1U6G A;  2KKO A;  3I54 A;  2XRN A;  1MZB A;  2H94 A;  5CVU A;  3ZMD A;  1W5T A;  1BM9 A;  2MA3 A;  1SFU A;  2DFI A;  2XKO A;  4HLX A;  2IA1 A;  2O61 A;  2R7D A;  3CTA A;  2HKX A;  3GYH X;  2P8T A;  3NRV A;  2WWY A;  4ZYG A;  1FYM A;  4L9T A;  3TDU C;  1YYV A;  2FXA A;  3KET A;  2G9W A;  4BXU A;  3KP4 A;  4EM1 A;  1KYZ A;  1H0M A;  3RIR A;  3LQQ A;  5E8I A;  4M74 A;  4UNO A;  4LFU A;  3FXR A;  2MLK A;  2K4J A;  4MQ9 F;  2CW0 F;  3FHZ A;  1QNT A;  2UXX A;  1R58 A;  2RC4 A;  3LQR A;  4PGH A;  3L00 A;  2H27 A;  2F2E A;  3MAJ A;  3RKW A;  3CUQ C;  3IWZ A;  2Y48 A;  2M8E A;  1J2X A;  1DUX C;  3WGH A;  4G7O F;  1TQI A;  5D5W B;  3M8E A;  1ZAO A;  5E1W A;  1YTY A;  4F7Z A;  1FP1 D;  1VTN C;  3BJA A;  2HOE A;  4GYG A;  1BC8 C;  2Z5U A;  4EM0 B;  4MQV A;  1B6A A;  2PN6 A;  2WTE A;  4U88 A;  1QZZ A;  5D5V B;  4A6E A;  3ECO A;  3ZMV A;  2EWN A;  1T2K A;  1P4X A;  3FF5 A;  3MCZ A;  2YX4 A;  2ZO4 A;  3KP3 A;  3JAM K;  4RGS A;  3JTG A;  2NYX A;  3TDZ C;  3T0Y A;  3CUO A;  2HGC A;  3JTH A;  1UCR A;  4HA8 A;  2EFW A;  5JI6 A;  4R1H A;  5D6F A;  2DO7 A;  2GA1 A;  1XMA A;  3FMS A;  2K86 A;  2YSR A;  1SFX A;  4I02 A;  2QM3 A;  4OOI A;  2PJP A;  5JHU A;  3F3X A;  2CO5 A;  1J9I A;  3E5U A;  4NQW A;  3FXU A;  1I1G A;  1T6S A;  4P55 A;  2FOK A;  3PQK A;  4HOB A;  3RDI A;  1MJA A;  4G6Q A;  3NEU A;  4IJA A;  5LHG A;  4KYW A;  3T1B A;  1G3Y A;  5EEG A;  2O0Y A;  5L3C A;  1FOK A;  1TQP A;  3K1P A;  4I98 B;  3K9T A;  2XUB A;  2PQ8 A;  2XHK A;  3CUQ A;  5ILV A;  1EH6 A;  2ESH A;  1CGP A;  2XAJ A;  4P96 A;  1HBX G;  3BP8 A;  4ZYH A;  3F6V A;  2NRA C;  3I64 A;  2P5L C;  3E97 A;  1YG2 A;  3F6O A;  3TOB A;  2AS5 F;  1O7L A;  2YR2 A;  4GCV A;  1FBU A;  4M73 A;  1G3T A;  4NB5 A;  1P92 A;  1LDK B;  5LEK A;  2TDX A;  2VOD A;  3BRO A;  2L54 A;  4R79 A;  2QBY A;  4IRG A;  4AIJ A;  2X0L A;  2D1H A;  3E6M A;  2QYO A;  3P7N A;  1U8R A;  3IRR A;  2V79 A;  2V1D A;  2HQN A;  3MZY A;  2EB7 A;  1J5Y A;  1QGP A;  2K02 A;  5HLG A;  5AIQ A;  2P7V B;  3F8B A;  2DU9 A;  4H0E A;  4Y17 A;  2PG4 A;  1YQA A;  4A0X A;  1KQ8 A;  1KA8 A;  5K5Q A;  4XBF A;  4G7Z F;  1TQM A;  3E6B A;  1B59 A;  4L18 B;  1G3W A;  5DV5 A;  1USS A;  4FHT A;  4LMY A;  3F72 A;  3GX4 X;  3SFZ A;  4ENK A;  3W6J B;  1IF1 A;  1JXS A;  1U5T C;  2MD5 A;  3SZT A;  2COM A;  3O2P E;  5A2Q Z;  2HFH A;  4M9S A;  5F64 A;  3KLO A;  4EV0 A;  3F8F A;  5E1X A;  1WI9 A;  3I71 A;  1JHF A;  1WSU A;  1S3J A;  5IT9 Z;  4AD9 A;  4AWX B;  1SMT A;  1B9N A;  4A12 A;  4AVP A;  1MGT A;  2K4B A;  2QQB A;  2Z99 A;  5HVQ C;  2VBW A;  3GVA A;  5HS7 A;  4U0Y A;  5LHH A;  2V9V A;  3ISP A;  3EQL F;  4U0W A;  5H20 A;  3FWE A;  3EUH A;  5E1Z B;  4GXO A;  1PUE E;  1FC3 A;  2H6C A;  3W6K B;  2QWW A;  4UVC A;  4HAM A;  2HWV A;  3LFK A;  3PQJ A;  4GYI A;  3KCC A;  3RJP A;  2VT2 A;  1ZRD A;  1ZLJ A;  3WGI A;  4IRH A;  1F4K A;  1JGS A;  3ZN0 A;  4A5M A;  2Q2E A;  2LKP A;  3MFK A;  4UXN A;  1LNW A;  1XGO A;  4OIR F;  3LA7 A;  5TJJ A;  2GQQ A;  5HDN A;  4G94 A;  1R22 A;  1SD7 A;  1XMK A;  2STW A;  2MH2 A;  4M9Z A;  4KN4 X;  3DQV C;  2BE5 F;  1E2X A;  1KYW A;  1RNL A;  3WU0 A;  1UHW A;  3K0L A;  3COA C;  3BJO A;  2GWR A;  2IA2 A;  4YII A;  5DDG A;  4P5O A;  1YO5 C;  2HTJ A;  5CVI A;  1U5T A;  1QO0 D;  3HSE A;  4LK1 F;  4Q48 A;  3BOQ A;  2G7U A;  3ZP5 A;  1SMY F;  1ONV A;  2P5K A;  2YU3 A;  4RAZ A;  4A2U A;  1OR7 A;  3CLO A;  2EJR A;  3N97 A;  4G9Y A;  4EJV A;  5BPI A;  2Z9O A;  2IJL A;  4O5V A;  2K7L A;  3J80 K;  3HUG A;  5CVR A;  2V1U A;  3CUQ B;  2VC1 A;  1HST A;  2OQG A;  2R3S A;  4ESB A;  1W5S A;  2VE8 A;  3M9A A;  2O03 A;  3WOD F;  1YS6 A;  4OMZ A;  1FLI A;  5BMZ A;  1R36 A;  1I27 A;  1TNT A;  2PMH A;  2P7C B;  2CQK A;  3KEQ A;  5DEQ A;  3ABU A;  1KQ9 A;  4EVI A;  3KE2 A;  1FX7 A;  4RAY A;  2YX7 A;  4M6X A;  2VOO A;  1RIO H;  3QAH A;  2QBY B;  2LDU A;  2IP2 A;  2JSC A;  5D5X B;  3F23 A;  2KJB A;  5LRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...