4LB6B

Crystal structure of pkz zalpha in complex with ds(cg)6 (tetragonal form)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
ENEIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDNKRPVWNLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Protein kinase containing Z-DNA binding domains
publication title Structural basis for Z-DNA binding and stabilization by the zebrafish Z-DNA dependent protein kinase PKZ.
pubmed doi rcsb
source organism Danio rerio
total genus 20
structure length 63
sequence length 63
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lb6B00
3KEQA 3JSOA 1KU7A 3BJOA 2KRFA 3HUGA 3M8FA 1YLFA 2ZO4A 3BROA 2RDPA 3K69A 1SD4A 5E1WA 4CICA 1GHCA 3HYIA 3ECOA 3BPVA 3FHZA 1U6GA 4FX0A 4HV5A 1QNTA 5H6QA 1U8RA 1WQ2A 1BIAA 3VFZA 1YYVA 4M9XA 3MAJA 4L9VA 4Q4ZF 4LG0B 3DFGA 5DYMA 4EM0B 3DKWA 3LA3A 3VB2A 2ZKZA 3J80Z 3QAHA 2W85A 1WWXA 1BJAA 3CUOA 1KU3A 1Z7UA 3QPHA 1FOKA 3L00A 5ICGA 5E20A 4YIFA 4IF4A 2PMHA 2DT5A 2RC4A 4OMZA 2O8XA 3J80K 1B59A 2Q0OA 2AXLA 5DUKA 3AAFA 1Z9CA 2QUFA 1FP2A 1U3EM 4MHGA 2BGCA 3RPQA 2M8EA 1PP7U 4GGGA 4IHTA 5LHHA 2Z99A 3LWFA 1GVJA 2VN2A 4JQFA 3RPUA 1CGPA 1OKRA 2XAFA 3QOPA 1WRJA 3VEPA 5HS8A 3WTUC 2VBZA 2HYGD 1O3SA 2EK5A 3R60A 3WTZA 4I2OA 3W6KB 4EV0A 4KICA 3TGNA 4IRGA 3RYRA 1H9TA 4HBLA 4HF1A 1ZGAA 1XD7A 3ML6A 4IXAA 4HX7A 4ESBA 4EJWA 1TBXA 2KJCA 5EEGA 1ON2A 5AONA 1FLIA 2VT2A 4HV6A 4M9ZA 4CGZA 1U5TC 2VBYA 1ON1A 2VOPA 1R22A 2EFWA 1SD5A 3T5XA 1O3TA 2F5EA 2FQ3A 5ED4A 3IKTA 1W5SA 5F1RA 5D8LB 2JPCA 1EH8A 5K5OA 2ISYA 4RB3C 3H3ZA 2ETHA 2DPDA 3SZTA 4BHBA 3DEUA 2K7LA 1EV7A 2PEXA 4G7ZF 1SFEA 3KZYA 2EFPA 2OU2A 1BIBA 4CZZA 2EA4A 1UHMA 3FF5A 5HVQC 4BNCA 5FD5A 4A0YA 3CTAA 4GYGA 3PQKA 2PLYA 4HW0A 1R1UA 3ZN1A 1FY7A 4R79A 2FMLA 4WXCA 4A6DA 4JK1X 1F4KA 1XN7A 4P9UA 4BXUA 5HLIA 4MEYF 2VE8A 5LEKA 3N97A 1DUXC 3GX4X 4XLNF 1FP1D 3JTHA 3BWGA 4PGGA 2V6CA 2A3SA 2HTSA 5JR3A 1YTYA 2NS0A 4EJVA 2E7XA 1K79A 2P6SA 3G3ZA 1XDUA 1QZZA 1IN4A 4A2UA 3K1NA 3ERED 4AIJA 4EMSA 3F8NA 1O57A 1FC3A 4WXHA 4A0ZA 2LNBA 5HS7A 1CF7B 2KKOA 5H20A 3C18A 4Q5SF 4PCQA 1ONVA 3U2RA 3EYYA 1FX7A 1BI2A 5LBQA 4L9TA 1USSA 3KEOA 1V4RA 2QM3A 2RKHA 4IPAA 2G7UA 2XAGA 2STWA 3KLOA 4NQWA 1F5TA 3ZMVA 2BBYA 2DLLA 3V8JA 2DW4A 1RZ4A 4RAYA 3EQLF 1J2XA 1S3JA 1OPCA 4HDVA 4ZH4F 3IHUA 1EH7A 4RGSA 2X0LA 1J0RA 1ZN2A 1B1BA 3WTTC 4KNYA 5DUIA 2D1HA 5TRDA 3DXJF 5D8KB 2ACJA 5D4SA 4RS8A 3KP5A 1LDDA 3F3XA 2VC1A 5J6XA 2AS5F 4AWXB 1TW2A 2F5FA 1ZH5A 1Z1DA 4XSZF 3SZPA 5HLHA 2A69F 1IZ1A 1O3RA 1AOYA 3R61A 3WU0A 3G73A 3LA7A 1AWCA 1YQAA 2NRAC 3HTUA 3WE3A 1G3TA 1IRGA 1UCRA 3I4PA 5DD4A 1PDNC 4HX4A 2EFQA 3ZN0A 5BPIA 1SAXA 2CG4A 3KP2A 4HZFA 5LGTA 3DV8A 2FNPA 4M6XA 5BS6A 2GIVA 2LKPA 2M30A 1IN6A 2V1DA 1FBSA 3GFJA 1GXPA 2IT0A 5HLGA 3P9KA 2MH9A 1XGNA 5L3GA 4LLLA 1CF7A 1K78B 1FSEA 3O3KA 1JGSA 2DPUA 3E5XA 2DK5A 1JHHA 4LLNA 2K02A 2GWRA 1RNLA 4QWQA 4HX8A 2A6HF 3IWZA 5DV5A 4PZJA 4PDKA 3QP6A 1ODDA 2JPBA 2PMUA 3RIRA 3I71A 1ZLKA 1S6LA 2ISZA 4EJTA 2BV6A 4CXFA 3BJAA 1JHFA 4DNCA 1YO5C 2ESNA 2HGCA 2GQQA 1OR7A 2VT3A 3SQNA 3E6BA 3LAJA 1HW2A 3RJPA 1DDNA 1MJBA 2HKXA 4N9IA 1K7AA 4I09A 4G7HF 2WC2A 1P4WA 3JSPA 1O7LA 3MZHA 2W25A 5BOXA 5AIPA 1WI9A 3LFKA 2PQ8A 5AIQA 2E7WA 2LDUA 5ILUA 2Z9OA 2F5DA 3EYIA 2DFIA 3O2PE 2D2WA 4KIFA 4YFNF 5D5XB 1I5ZA 4HDUA 3GFIA 2P7CB 2P4WA 3HIFA 1KQ9A 2XKOA 4MQVA 3V7RA 3QU3A 2A07F 3R4KA 4CDGA 5DD8A 4RB1A 4XBFA 3RKXA 2RVCA 2HYFA 3E97A 3GW2A 2EFOA 1XB4A 3R0AA 2DBBA 2FE3A 2DQLA 2IW5A 3WODF 2XHKA 3L2CA 1T39A 2P5VA 4L18B 4NB5A 5JI6A 3MEXA 1SMTA 3F6VA 3EDPA 2O03A 3IL2A 2HKOA 1Z05A 4UHTA 3CUQC 4L0YB 4LMYA 4L0ZB 1Y0UA 3DF8A 1S7OA 4EM1A 1K78A 4UUVA 2TDXA 3PFIA 3CLOA 2MBFA 2MD5A 1U78A 2HQRA 1YW7A 1IN8A 4LB6B 4L9NA 2O61A 1B4AA 1OYWA 3V7CA 5L3BA 1A04A 2L54A 4Z2YA 2E1CA 3P7NA 2J5OA 2CQKA 3FMSA 4ON0A 1KGSA 1RIOH 2IP2A 2GXBA 1G3WA 3MFKA 4WXDA 2IA2A 1J7KA 4CYDA 2XROA 4BAYA 4MQ9F 1MGTA 4IHSA 1HQCA 3E5UA 4ZYEA 1IW7F 2X4HA 2QBYA 5D6FA 4KN4X 4ENMA 2GAUA 4PGHA 4BHPA 3H3UA 4ENJA 4BH9A 3LA2A 4OU0A 2HDCA 4KN7X 1XGMA 2ESHA 2W24A 2HEOA 2ADUA 1YG2A 2VBXA 2RGVA 4KDPA 2V79A 2CSOA 2EA2A 2PJPA 3KP4A 4UV8A 4M71A 1P2FA 4P55A 2PN6A 5J8CA 3NRVA 5FLXZ 3U9GA 3B73A 1PUEE 5JHUA 2WWYA 1BM9A 2R3SA 3WU1B 4HOBA 1R23A 3ZMUA 2ZXJA 5FLXK 2UWMA 1SMYF 4GO1A 2Z3YA 1FWZA 2W84A 3FM3A 5EEHA 3F8CA 2LSOA 3D5LA 2J5PA 1FYMA 1Z91A 1NHAA 1G3SA 4GYIA 3WTSC 3HOTA 3K9TA 3OOPA 4KMUX 1MZBA 1YS7A 2XASA 2YSRA 3JW4A 2STTA 2D45A 4A12A 3CO7C 2BYVE 3FX3A 3JTGA 1O3QA 3FXQA 1HBXG 3IC7A 2QQBA 5D4RA 2XGXA 3ECHA 3IWFA 4G9YA 1RUOA 1MDMB 4ZYDA 1LEBA 2L4AA 4ESJA 1BC8C 2YX4A 2OQRA 1I1GA 2O3FA 1R7JA 1KU9A 3F22A 3Q9VA 2OA4A 1TW3A 3LSTA 1XCBA 4XRFA 5LRSA 3KE2A 2XRNA 3QRFF 1FBQA 1OYIA 3FXRA 3M9AA 5DEQA 2ZBKA 5J8FA 1V3FA 2FEZA 4Y13A 1JXSA 4G8XA 2FMYA 1HKQA 2K27A 3LQQA 1I1SA 1FBUA 4MTEA 4FT8A 3KCCA 1TNSA 1MJ9A 2NYXA 1E17A 1HXDA 5CVRA 1XDSA 5KVRA 1S7AA 4ZYHA 1S8NA 4OIOF 2HR3A 3HRMA 4YFXF 1ZARA 2COMA 1DPRA 1YW8A 1ZRCA 3IKVA 3VOEA 3ISPA 2QYOA 2NAZA 1G6NA 2YU3A 2V1XA 5LEJA 3P9CA 1R5GA 1P4XA 1L3LA 1IXSB 5FGMA 4EGYA 2CWEA 2BE5F 1BOAA 2Z5UA 4EM2A 3M1EA 5ICEA 1MJAA 1LDJA 3GEZA 4XLPF 3C3WA 5L3FA 1SFUA 4WK8F 1BN5A 5CLSA 4UNOA 4R8HA 5FFXA 3FZVA 3HSRA 4ESFA 4U0VA 4LJZF 1IRFA 5DCFA 3KLNA 5ICFA 4A5MA 2LF7A 5DCMA 1ZG3A 1B9NA 5CYVA 3FM5A 4S05A 1OYYA 5D5VB 2ZNYA 2HQNA 2K4BA 3NQOA 1H0MA 1MDMA 2QQAA 2WTEA 4I02A 2FA5A 4MNUA 5L3EA 1DPUA 5IT9Z 2R7DA 1P6RA 2RNJA 4S04A 1GXQA 4RAZA 1REPC 4EQQA 1BBYA 3GFLA 1J59A 1BC7C 2ZNZA 1Z6RA 1MKMA 1P4AA 5CVIA 4I0BA 3F23A 2RQPA 3HRSA 4EVIA 3T1BA 4KMFA 1SD6A 3M8EA 1R36A 5KK1A 2CO5A 5FD6A 1F1ZA 2OAZA 2H27A 1BI1A 3DP7A 3DPLC 1QPMA 2A61A 3N4MA 2YX7A 4FHTA 1ZG5A 3BY6A 4GCVA 2ZFWA 4HQMA 2ZCWA 4ZYGA 4LK0F 2FSWA 1T98A 2W57A 2VBWA 1HSJA 3SHFA 1LVAA 1R58A 5LGNA 2ZJ2A 3I58A 2K86A 1ZAOA 2ELHA 5L3DA 4RB0A 2QWWA 2EV5A 4RGXA 4MGRA 1T6SA 4N0BA 3ELKA 4K2EA 4G7OF 5HOOA 3ZP5A 3E6CC 4UVCA 3KETA 2QENA 1XSXA 4RGRA 3DQVC 4B8XA 2GA2A 3J81Z 3F8MA 1X3UA 1LQ1A 4LGWA 4U7BA 2G9WA 2VC0A 1Z6TA 1H9GA 3TO6A 1XMAA 4U88A 2EB7A 3L7WA 3T8RA 2V1UA 3JAMZ 2HTJA 4A0XA 4MEXF 3KP3A 2PG4A 3I0TA 2PI0A 3GO5A 3S2WA 1XGOA 1C0WA 1ZRFA 4L5IA 1W7PD 3O6BB 2GZWA 1D3YA 1I27A 4UV9A 5D5UB 3FMRA 5TJJA 4Y15A 1G3YA 5F6FA 2HWVA 3K2ZA 2CGPA 3BZ6A 3GF2A 3ABUA 4ZZLA 2QBYB 3R0JA 2FXAA 1R5HA 1FZPB 2D1VA 4CO8A 2MLGA 4IRHA 5HDKA 4G6QA 2K4JA 2V9VA 5BMZA 4KA4A 1SFXA 4HF2A 1VTNC 5LHGA 4KIBA 3TDZC 4LLGF 3OV8A 2FU4A 2CYYA 2JRTA 4GXOA 3E6MA 3GWZA 2Y48A 3V8LA 4A5NA 4IJAA 3VODA 1USTA 3I5UA 1LEAA 1TQPA 5BQTA 2OBPA 4O6JA 1KYZA 4G6DA 4EJOA 5H6RA 2FBKA 1KQ8A 5CJ9A 2QVOA 1T2KA 2H6CA 2NNNA 3KFWX 1LNWA 3Q9SA 1BI3A 2RV8A 3TOAA 3F8BA 5F64A 3V7SA 2A68F 2EV0A 2VODA 4OMYA 1YW9A 1IUYA 4KUMA 2VXZA 2VE9A 4U7DA 4DQ2A 2HOEA 2FOKA 2L4MA 5HS9A 2KIFA 3GFMA 5E1XA 3ULQB 3HRTA 4N9HA 4Y17A 4I01A 5IT3A 4LK1F 3LAPA 1LDKB 5DDGA 4YG2F 2KJBA 5D6EA 1IXCA 3GLXA 5JFRA 2FF4A 3HOSA 3HHGA 5FFZA 1FT9A 2IJLA 3K1MA 1STZA 2XUBA 4WX9A 2KIMA 4AIKA 1RUNA 2YPRA 4D0PA 3COAC 1I6XA 4JBAA 2DU9A 4H0EA 3I59A 1K6OA 4KIGA 2EV6A 3KP7A 1FPQA 3Q5FA 2ZMEB 2CFXA 3CDHA 5ILVA 1WSUA 2VOOA 4WF2A 3MWMA 1HW5A 2OD5A 4HF0A 5L3CA 3WTYC 3MCZA 3GUDA 3E6DA 4M9SA 2UZKA 2LF8A 2IPQX 4BHCA 5ERIA 1B6AA 3GZ5A 1ZHFA 3BOQA 1E2XA 1DP7P 1UFMA 2M1BA 4LFUA 2MC3A 4ASNA 1LB2A 2G7HA 4KFCA 3TO7A 1WKMA 2DI3A 3FWEA 3I64A 2A6EF 1QQIA 4M6YA 1R1TA 2WV0A 3WE2A 4ENNA 4WWCA 1TQMA 1HKTA 2XIGA 3IRQA 1HW1A 3SXYA 5LGUA 2OZUA 3WGIA 2A5YB 3RTRA 3HTSB 2L02A 3U1DA 5CVVA 1F9NA 3D0SA 2QLZA 3ZMTA 2IVMA 3TOBA 2JTVA 3CUQB 3QP5A 2UXXA 3IRRA 1KA8A 4AD9A 4E70A 4M72A 2P8TA 3F21A 4BYYA 3BPXA 3M7GA 3V8KA 6PAXA 1R1VA 4ENKA 2JZYA 5DCMB 3NEUA 1D8JA 1G4DA 1XGSA 3WTXC 1FYLA 2EJRA 4U0YA 2Q2EA 5CVJA 3EUHA 2QZ8A 2ZMEA 2MH2A 1QO0D 3ZMDA 4HLXA 2FBHA 1TNTA 2HZTA 2NNYA 1ZRDA 3WGHA 1EH6A 3RKYA 2MA3A 4G94A 4LD5A 4TV7A 1W7PB 5K1YA 2HFHA 2P5KA 4LG0A 5FO5A 4I0AA 1UB9A 3C7JA 3MQ0A 4CHUA 3ZMSA 3RKWA 2P7VB 1XSVA 3W6JB 5JVTA 1S29A 3L9FA 2CW0F 4P9FA 3CJNA 3ZQ7A 2PFBA 5A2QZ 2EWNA 1ZREA 1IAWA 3C1DA 4BQAA 1J9IA 4R1HA 1P92A 3WTVC 3HSFA 2FBIA 4A6EA 5BPDA 5A2QK 5K5QA 1O7FA 4YIIA 3HRUA 3CUQA 2PBIA 1XCVA 5HDNA 1JE8A 3LQRA 1KYWA 5D5WB 1UHWA 3K0LA 4P96A 1U5TB 4NHJA 2XKPA 5LHIA 2P6TA 4UVAA 3BP8A 4M73A 1D5VA 3EETA 2R7FA 1FYKA 1ZYRF 1MD0A 4ETSA 4F7ZA 3T8TA 2XVCA 3CO6C 3R6SA 3L09A 1FNNA 3TO9A 4OOIA 1QZYA 1HKSA 2C6YA 2XAJA 2F2EA 1TLHB 2P5LC 4HLYA 5IT9K 1W7PA 1ZGJA 3TQNA 4L9JA 3KZZA 3I54A 4OINF 2FNAA 2IA1A 4Q48A 2L01A 4HA8A 5ICCA 2H94A 3P9IA 3GYHX 2DTRA 1ZG1A 3ZPLA 3HHHA 2JT1A 3ABTA 4B09A 1KQ0A 5K5RA 4RGUA 4M74A 3REOA 2KIUA 3WGGA 4IVNA 2UXNA 1QBJA 4P5OA 1IN5A 1YIOA 2M87A 1QGPA 2GA1A 2IRFG 2DK8A 2VONA 4O5VA 1OMIA 2YR2A 5E17F 3FMQA 1D8KA 2M5WA 4Q47A 3K1PA 4O3MA 1YFHA 4KYWA 3ZMZA 1IN7A 2QQ9A 1TTYA 4QLCU 1SD7A 1U5TA 1B9MA 3DPTA 2GXGA 3GVAA 3J81K 2DAOA 2XAHA 3J7AO 2DO7A 5CVUA 3SFZA 2MLKA 2Y0MA 1W4MA 2OQGA 4ZZDA 4AVPA 2B0LA 3F72A 4OIRF 4AIHA 1YS6A 1W5TA 3JAMK 3I53A 4L5JA 3PQJA 3I59B 1KU2A 1Q1HA 1XMKA 3BJ6A 2M45A 3TKYA 3HSEA 2E1NA 3WTWC 1XSDA 3H92A 3GZ6A 1BI0A 1RI7A 3BDDA 4I7HA 2O6GE 5HDGA 2EFNA 3T0YA 1J75A 4XSXF 3V4GA 2L3DA 1T38A 4LB5A 1U2WA 5E1ZB 2O0YA 5E18F 2RN7A 4YFKF 2H6BA 1IXRC 3QU6A 1HSTA 1J5YA 4KT5C 5LLQA 2Q8KA 2DQRA 2FRHA 3RYPA 4OIQF 4UVBA 1TQIA 1LJ9A 2HS5A 3RI4A 4OIPF 4WCGA 2JSCA 3MZYA 4I98B 2IA0A 5E8GA 2BEOA 1IF1A 3KP6A 4EJUA 4MTDA 3FXUA 3E3VA 1L0OC 1T0FA 3QPTA 2H09A 3GXOA 2F5CA 3E5QA 4RB2C 1ZLJA 2XV4S 3ROUA 4HYEA 3B02A 5FB2A 2Z33A 2OZ6A 1PP8F 4FX4A 4IRIA 2XAQA 1FSHA 3TDUC 3WG9A 3F6OA 4U0WA 4HAMA 5ILSA 3RDIA 5E8IA 5LRRA 4HQEA 4UXNA 1ULYA 2Y75A 4EGZA 3F8FA 1R00A
chains in the Genus database with same CATH superfamily
2F4MB 3KEQA 2VJIA 5FKNA 4XRMA 2CFOA 1T8IA 3JSOA 4BUPA 1KU7A 3BJOA 2KRFA 4F52A 3HUGA 1X19A 3ABKH 3M8FA 2XB0X 1YLFA 2V9KA 2ZO4A 4YRVA 4D5FA 3BROA 1Z77A 2E5ZA 1EJ9A 2Q2EB 3GZNB 2RDPA 3K69A 1SD4A 2ZXHA 5E1WA 4CICA 4PJJA 1AU7A 1I6HJ 1GHCA 3HYIA 3ECOA 3S32A 2CQXA 5FKOA 3SFIA 3BPVA 2ZJQF 3FHZA 1U6GA 5C4XJ 2WAFA 2KLOA 4A93J 4FX0A 4HV5A 5M5YJ 2LFBA 2YUSA 1RKWA 1QNTA 5H6QA 1U8RA 4A3KJ 2CUFA 2O9LA 1WQ2A 3KZIC 1BIAA 3J7ZI 3DLLF 3VFZA 1POGA 1YYVA 4M9XA 4FTHA 1ZK8A 3MAJA 4L9VA 4Q4ZF 2ZXWH 4UY8I 2X85A 5E3LA 4LG0B 3DFGA 1ENHA 4MO7A 5DYMA 2OF7A 3DKWA 2OUMA 3LA3A 1QZEA 4LOCA 3VB2A 2ZKZA 4EM0B 1VQPI 5B66C 2X1CA 3J80Z 3CMAI 3QAHA 2W85A 1FTZA 2LKXA 1WWXA 2X6WA 1BJAA 5EGOB 1Y6IA 3CUOA 1KU3A 1Y1WJ 1Z7UA 3QPHA 2JVHA 1ZR2A 1FOKA 3L00A 3AG3H 1NH3A 5ICGA 2VQHA 5JHFA 2NVQJ 2EILH 5E20A 4YIFA 4IF4A 2PMHA 2V26A 2DT5A 1B8IB 3FXJA 2RC4A 2L9RA 2PMZA 3MKYB 4OMZA 2CRGA 4JX5A 4BDYA 2O8XA 2VJ4A 3OIOA 3J80K 1B59A 2Q0OA 3PJRA 2A5WA 2JRMA 4UUSB 2AXLA 2DOEA 5DUKA 3AAFA 1V5EA 1X1BA 3M3YJ 1Z9CA 2QUFA 1MMNA 3CJRB 1NK2P 1FP2A 2X6OA 1U3EM 5EDNA 4MHGA 4E4HA 2BGCA 3RPQA 2DYRH 2M8EA 1PP7U 4GGGA 4X1EA 4IHTA 2B7EA 5LHHA 2QCOA 1IDYA 2Z99A 3LSIA 3LWFA 1GVJA 2BXYA 2VN2A 4JQFA 3RPUA 3TW7A 2BXZA 3L2VA 4D1QA 1CGPA 4PJNA 1OKRA 2H1KA 2XAFA 3DBHB 3QOPA 1WRJA 3LSMA 3VEPA 5HS8A 3VYSB 3WTUC 2VBZA 1IC8A 2HYGD 2AQFA 3BLYA 1O3SA 2EK5A 2XSJC 3R60A 3H9JA 3WTZA 3DKYA 1VQLI 1GV5A 3W6KB 2W00A 4I2OA 4EV0A 4KICA 4LITA 3TGNA 2K40A 3K4LA 4IRGA 3RYRA 1H9TA 2KZVA 1MH3A 2DOFA 4W1UA 4BQOA 4KITB 2L9NA 3K7AJ 3PNTA 4HBLA 4HF1A 1ZGAA 1XD7A 2HXOA 3ML6A 4IXAA 5K7HA 1I50J 2QA4I 4HX7A 4ESBA 2K9SA 4EJWA 1TBXA 2KQRA 2AQEA 2KJCA 5EEGA 1ON2A 3L2UA 4XMYA 5B1BH 5AONA 1FLIA 3S16J 2VT2A 4HV6A 4M9ZA 2QEXI 4CGZA 1HA8A 5IY5H 1U5TC 2VBYA 2AHQA 3K4BA 1ON1A 2VOPA 1R22A 2EFWA 1VQMI 3W2VA 1X3ZB 1SD5A 3T5XA 2B63J 1WHUA 1O3TA 1IO2A 2F5EA 1YX3A 2FQ3A 5ED4A 3IKTA 1W5SA 5F1RA 3N05A 5D8LB 2JPCA 2M0CA 1EH8A 5K5OA 1YJWI 1PVEA 2ISYA 2NOGA 4RB3C 1MBJA 4B1RA 3H3ZA 1UAAA 3BC8A 2ETHA 2DPDA 2R7SA 3SZTA 4BHBA 3DEUA 2K7LA 1EV7A 2PEXA 1VQ9I 4XKCA 3QWLA 4G7ZF 1SFEA 1QPIA 3HEFA 3KZYA 2EFPA 2G0EA 4F55A 2OU2A 1BIBA 2M4KA 2EA4A 4GRIA 4CZZA 4RAFA 1UHMA 2DA4A 3FF5A 5HVQC 4BNCA 4DZJA 2O8KA 5FD5A 4L5EA 4A0YA 3CTAA 4GYGA 2ZB9A 2LC2A 5EGOA 3PQKA 2QSFX 2PLYA 2H1LA 4HW0A 1R1UA 1JUSA 4M3FA 3IAS2 4IHXA 3ZN1A 2M4GA 1FTTA 1FY7A 2QF7A 3JRCA 4R79A 3DU6A 2JWTA 2KIQA 3BR1A 2MSYA 3CP2A 1TZLA 2FJ1A 2FMLA 4WXCA 4A6DA 1B8IA 4JK1X 1F4KA 1XN7A 4P9UA 2V7FA 4RMNA 4BXUA 3H1CA 3AL0B 5HLIA 3W2WA 1OCPA 4MEYF 2VE8A 5LEKA 3N97A 1DUXC 2ZXIA 3GX4X 2LH9A 4XLNF 1FP1D 4BGDA 3JTHA 2A6TA 4RM3A 3BWGA 1OLTA 4PGGA 4FISA 2V6CA 2A3SA 3HKZN 4B3XA 2HTSA 5JR3A 1YTYA 3A0HC 1TWHJ 4CUGA 2NS0A 2IEKA 4EJVA 2E7XA 2K9MA 5F0CA 4G12A 4A3CJ 2OTJI 1K79A 2P6SA 1TWCJ 3G3ZA 4NC8A 1XDUA 2LY1A 1D0YA 3P5JA 5EZHA 3HOWJ 2Z1DA 1U8BA 3TP0A 5JLXA 1QZZA 1TC3C 2L0KA 2K9LA 5GAEJ 4E6KG 1IN4A 2OJED 4A2UA 3GCMA 1EF4A 1VNDA 3K1NA 3ERED 3H5NA 4AIJA 2OV7A 4CCMA 5B1AH 4EMSA 3F8NA 2DMQA 1O57A 9ANTA 2K3FA 1FC3A 4WXHA 3DPUA 3IH2A 4A0ZA 4BQNA 3H36A 4BY1J 3NWTA 4M3GA 2LNBA 4HNTA 2XRLA 5HS7A 3F9KA 1ZKGA 4F3QA 1CF7B 2R92J 1HDDC 3HOUJ 3S3OA 1X1PA 2E19A 2KKOA 5H20A 2MFZA 3C18A 4Q5SF 4PCQA 2LRDA 1ONVA 3U2RA 3EYYA 2NXNB 3DBLB 1FX7A 1BI2A 5LBQA 4L9TA 4XKBA 2QKMB 1USSA 3KEOA 5E79C 2HPMA 3IP4B 1V4RA 2QM3A 2RKHA 2L9SA 2CS3A 3OR1C 1YE9A 1D1CA 1XG1A 2LY9A 4IPAA 2G7UA 1YITI 2XAGA 2I10A 2HI3A 2STWA 3KLOA 3JRHA 4NQWA 3FXLA 1F5TA 3ZMVA 2BBYA 2DLLA 3V8JA 4X0GA 3OYHA 2DW4A 1RZ4A 4RAYA 3EQLF 1U9NA 4E7LA 1J2XA 1S3JA 1OPCA 4HDVA 2EZLA 4ZH4F 3IHUA 1EH7A 4RGSA 2X0LA 3W2AA 2JK3A 1QVTA 2QSHX 1J0RA 3A4CA 1ZN2A 1B1BA 3WTTC 4KNYA 3CCMI 3MMYB 5DUIA 2X6YA 2D1HA 1PJRA 4BKXA 5TRDA 2TCTA 3G4SI 2XC7A 3DXJF 5CQGA 5C3EJ 3H35A 3PNYA 1B72B 3I4NJ 4RBOA 5D8KB 2XPVA 2ACJA 5D4SA 4RS8A 3KX2A 3KP5A 1LDDA 3F3XA 3LNQA 2DDAA 2VC1A 1QU3A 5J6XA 2AS5F 2ZJPF 2VPRA 4AWXB 4PFPA 1ORKA 1Q1VA 1TW2A 2F5FA 3BR0A 1JUPA 2ZSIB 3K2AA 3U21A 4BJ6C 1ZH5A 2BY1A 1G59A 1J09A 3HG9A 4HRIA 5F0FA 3HXLA 1Z1DA 3H5RA 5DS9A 4XSZF 3SZPA 3BR2A 1R4MB 5HLHA 2A69F 1IZ1A 1O3RA 1AOYA 3R61A 4RM2A 4XKWA 3WU0A 3LA7A 3G73A 3TEDA 5FLVA 1AWCA 1YQAA 4V2GA 2ME6A 1Y8QB 4F91B 2NRAC 2E2HJ 3HTUA 3WE3A 5GAGJ 1DU0A 1E3OC 2WAEA 4XKVA 2AXTC 1G3TA 1IRGA 5C4JJ 1UCRA 3I4PA 4XR6A 5DD4A 1PDNC 4HX4A 3RQ4A 2EFQA 1MSFC 3ZN0A 5BPIA 1SAXA 3Q0WA 2CG4A 3KP2A 5IP9J 3GTOJ 4HZFA 5LGTA 3DV8A 1K83J 2FNPA 5FKLA 4GFBA 4M6XA 5BS6A 2GIVA 2LKPA 2M30A 2M3AA 5F0HA 1PYVA 3OIPA 1IN6A 2V1DA 4EATA 4C2MJ 1FBSA 4MLOA 3BR5A 4YEJA 3SYTA 3AG2H 2M9HA 3GFJA 1GXPA 2IT0A 5HLGA 3P9KA 4ZJZA 2MH9A 2W48A 3G1LA 1XGNA 3W6VA 5L3GA 2BZTA 4LLLA 1CF7A 1G2HA 1K78B 1FSEA 3O3KA 2JQ7A 1JGSA 1I3AA 3E5XA 4G6TB 2DPUA 3TL4X 3HDDA 4BL0B 2DK5A 4BY7J 2LBFB 1JHHA 4LLNA 2HVRA 2K02A 3HZJA 2GWRA 1K6YA 1RNLA 4QWQA 4HX8A 1OISA 4XLFA 3IWZA 1T08B 4IZZA 2DN0A 5DV5A 4PZJA 4PDKA 2HOTA 1VQNI 4IOCF 3QP6A 5J1RA 1DU6A 1ODDA 2JPBA 2PMUA 3RIRA 3I71A 1ZLKA 1S6LA 2ZFUA 2VB6A 2ISZA 1WH5A 3UKGA 4EJTA 2BV6A 3DU5A 4CXFA 3BJAA 1JHFA 4QPQA 2K85A 4DNCA 1QHHD 1YO5C 2ESNA 2HGCA 3E1SA 2GQQA 1OR7A 5DM6F 1ETQA 2VT3A 3SQNA 1LVKA 3E6BA 4HG2A 4A3FJ 3LAJA 3SEZA 3PSIA 1HW2A 3RJPA 1DDNA 1MJBA 2HKXA 2R7ZJ 4N9IA 2Y31A 1K7AA 4I09A 2DMTA 5GPCA 1NK3P 3EUHC 4G7HF 2WC2A 2F6CA 1F43A 1P4WA 3JSPA 3KYCB 3G2BA 4RLFA 1RRJA 1A5JA 2R4GA 2XSDC 1O7LA 3MZHA 4P1WA 2W25A 3AG4H 2MGQA 5BOXA 2H8RA 4XORA 5AIPA 1BR2A 1OJLA 1WI9A 2PQ8A 3LFKA 2E7WA 2LDUA 3CLQA 5AIQA 5ILUA 2Z9OA 4A3LJ 2F5DA 4OWRB 3EYIA 1IV6A 3BG9A 3K4MA 2DFIA 3O2PE 4A3EJ 2D2WA 2BY2A 4KIFA 4YFNF 4XN3A 5D5XB 4Y4RA 1I5ZA 4HDUA 3GFIA 2P7CB 1Y56A 2P4WA 2P81A 3HIFA 1GT0C 1KQ9A 2XKOA 4MQVA 3V7RA 5GADJ 5K7ZA 3HGGA 2IS1A 3QU3A 5B5EC 1WJCA 3M4OJ 2DA6A 3ABMH 2A07F 2OC6A 3R4KA 4CDGA 4IOAF 5E3MA 5DD8A 3QYFA 1ETWA 2CQ7A 2MABA 3OWTA 4RB1A 4XBFA 4BQQA 3PIOF 4AC0A 3OMYA 3RKXA 2RVCA 2HYFA 3E97A 3VYUB 3GW2A 2EFOA 1S7EA 2MG4A 1XB4A 3R0AA 3OYMA 2DBBA 2FE3A 1WFXA 2DQLA 2IW5A 2JUGA 3WODF 4NUBA 1MIJA 2XHKA 2F48A 3L2CA 1T39A 4LG3A 4FE7A 2P5VA 3Q3SA 4L18B 4NB5A 5JI6A 3MEXA 4N4OB 1SMTA 3FHNA 3M1CA 3F6VA 3EDPA 2CH0A 2O03A 3C2GA 3BZKA 3IL2A 2HKOA 1Z05A 1YIJI 1WI3A 1ZQ3P 4A3JJ 4UHTA 3CUQC 2QGUA 4L0YB 2KPMA 4LMYA 4L0ZB 3C2HA 4ABZA 1Y0UA 1NTCA 3CP8A 3DF8A 3FKIJ 1S7OA 4EM1A 1K78A 4UUVA 2TDXA 1EA3A 3PFIA 3CLOA 2DA2A 2MBFA 2MD5A 1U78A 1WJBA 2HQRA 1N75A 1YW7A 1IN8A 4LB6B 3S15J 4XRSG 4L9NA 2EQRA 2O61A 2X1DA 1B4AA 3AG1H 2E2JJ 2BHYA 1OYWA 1Y1VJ 3V7CA 1LE8B 5L3BA 4FETA 1A04A 2L54A 4Z2YA 2E1CA 3S2DJ 3P7NA 2JSPA 2J5OA 2CQKA 3FMSA 4ON0A 1KGSA 1JUMA 3RQIA 2VQCA 4BS9A 1W0TA 2LR8A 2DDBA 1RIOH 3O8HA 4B43A 3JREA 1JKRC 5KNLA 2IP2A 2GXBA 1G3WA 3MFKA 2ZSHB 3M8JA 1IUFA 4WXDA 2GBYA 2IA2A 2JA5J 2LP0A 1J7KA 4CYDA 1X58A 4B4CA 2CUJA 1OQYA 2XROA 2VL8A 4BAYA 4MQ9F 3OYIA 1MGTA 4IHSA 1HQCA 3E5UA 3X2QH 3ZR8X 2M2EA 3K6GA 3ZCOA 1FJLA 2GLOA 2L7KA 3VDXA 3BR3A 4ZYEA 1IW7F 2X4HA 4JP0A 2QBYA 2RAEA 5D6FA 2DMPA 4IL6C 4XN0A 4KN4X 4LIUA 1DQUA 4ENMA 1UG0A 3EPZA 2KHMA 2GAUA 1JKOC 4PGHA 4AVZA 2E2IJ 1S5LC 4BHPA 3H3UA 4AIDA 2KISA 4N4NB 4XLEA 2R5ZB 4ENJA 4BH9A 3LA2A 4XIDA 2XGEA 2R93J 4OU0A 2NVUB 4KN7X 2HDCA 3A2KA 3RCOA 1XGMA 2ESHA 2W24A 2HEOA 2W82A 2ADUA 5IP7J 1YG2A 4NC7A 2VBXA 3DBRB 3G71I 2RGVA 4KDPA 2V79A 2CSOA 2EA2A 2PJPA 3KP4A 4I99C 2P0WA 4UV8A 2FOWA 1N25A 4M71A 4C2UA 1P2FA 3PO2J 4P55A 3AL0C 1SFKA 1KONA 2PN6A 5J8CA 4ZDPA 5IYDJ 3NRVA 3PM1A 1YX5A 5FLXZ 1W36D 4PJMA 1HF0A 2IS6A 3QYEA 2DA7A 3S8PA 2GIZA 3HPGA 2Z2SB 1XS9A 4V2FA 1ACIA 1WJEA 2WB1N 3U9GA 3B73A 1LPQA 5CKTA 1TWAJ 1IG7A 5JHUA 1PUEE 4XLHA 2WWYA 1BM9A 4DIQA 2R3SA 3WU1B 4HOBA 1R23A 3ZMUA 2ZXJA 5FLXK 1ZR4A 2UWMA 4AM3A 1HOMA 1SMYF 1VFCA 4GO1A 4ITVA 4DOZA 2IS4A 4BE0A 4QSHA 2Z3YA 1FWZA 2W84A 3FM3A 5EEHA 3F8CA 2LSOA 2VASA 2IGNA 3JCUC 3D5LA 1RETA 2J5PA 1FYMA 2VI6A 2QKLB 4Z6YA 3S93A 2X9DA 1Z91A 1NHAA 1G3SA 1UG2A 4PFOA 3WG7H 4GYIA 4JX6A 5B3SH 5FJ8J 2CJJA 1LE8A 3WTSC 3CJTB 3HOTA 3K9TA 2UUZA 2JVGA 2MC4A 3E7LA 3OOPA 4KMUX 1MZBA 1YS7A 4AU7A 2N8GA 2XASA 4I6ZA 3ZXSA 2YSRA 3JW4A 2STTA 2D45A 1R4NB 4A69C 4A12A 1WJ5A 4BE1A 3CO7C 2BYVE 3FX3A 3ASNH 4IX7A 3JTGA 4KJZA 1O3QA 3FXQA 3NWSA 1HBXG 2LYCA 3IC7A 2QQBA 1VI0A 5D4RA 2ZC2A 3LSHA 3D1NI 2XGXA 3ECHA 3WU2C 4NQWB 2ELKA 3IWFA 4IKFA 4G9YA 1RUOA 5J4YA 1MDMB 3L2WA 1RKTA 3H9GA 4ZYDA 4FASD 2DT7B 2KP6A 4A3BJ 3FIWA 1LEBA 2L4AA 4ESJA 3QOEA 2ECBA 1BC8C 2YX4A 5GPAA 2OQRA 1IDZA 1I1GA 5EEAA 2FQ4A 2O3FA 1MBEA 1MNMC 1R7JA 1LFUP 4XOPA 1KU9A 2KMUA 2K9NA 5IYCJ 3F22A 3Q9VA 2OA4A 1TW3A 2Q1ZB 1XCBA 3LSTA 3BTLA 4XRFA 5LRSA 3KE2A 2XRNA 1TP4A 4QTRA 4E7KA 3QRFF 1R6RA 1FBQA 1OYIA 1R5ID 3GTGJ 3FXRA 3M9AA 5DEQA 3VYRB 5M5WJ 2ZBKA 5J8FA 2R5ZA 3B6AA 3OY9A 1V3FA 2FEZA 4PSWA 4Y13A 1JXSA 3MKZA 4EEFG 2UV1A 4G8XA 2FMYA 3I4MJ 1HKQA 2K27A 3LQQA 1ERDA 2Y9YA 3CC4I 1I1SA 2L7FP 1FBUA 4MTEA 2Z16A 4FT8A 3KCCA 1TNSA 3ZQCA 1MJ9A 2JN6A 2F4IA 2NYXA 1W1WE 2YS9A 4RDUA 1E17A 1HXDA 5CVRA 4DW6A 1XDSA 3SDGA 1ETYA 1S7AA 2WY8Q 2XF7A 5KVRA 4ZYHA 1S8NA 4OIOF 2HR3A 3HRMA 3M07A 1W5CC 1APLC 1GLNA 4YFXF 1ZARA 3H0GJ 3FBIB 1PUFB 2COMA 2B9SA 1O4XA 2E1MC 1DPRA 1YW8A 3A02A 1ZRCA 5KHDA 3IKVA 3VOEA 3ISPA 2QYOA 4PSXA 1A36A 2NAZA 1G6NA 2YU3A 3GTJJ 1AHDP 3GTKJ 3OYAA 3OS1A 2NVXJ 2V1XA 5LEJA 3KYLA 5BNGA 2M7BA 3P9CA 1R5GA 5FKMA 4E7ZA 1P4XA 1L3LA 3A0BC 1IXSB 1V55H 5FGMA 4EGYA 2CWEA 2BE5F 1BOAA 2Z5UA 4HEA2 4EM2A 3UR3C 1V5FA 1XX5A 1T0FC 3M1EA 2M7AA 5ICEA 1ETXA 1MJAA 2L5QA 3W3CA 5IP6A 4YIRX 4B3AA 4PUSA 4XLCA 2LG4A 4H4KC 5CQEA 1LDJA 3GEZA 4DJAA 2HDDA 4XLPF 1R49A 3C3WA 2IGKA 5L3FA 1MBFA 3WHBA 1SFUA 4Y52J 3PFYA 1W36C 4WK8F 1BN5A 1MNEA 2KRCA 5CLSA 4UNOA 4R8HA 2JA6J 2E1OA 1VQ6I 3LSJA 4JX4A 5FFXA 3DEWA 2Y2ZA 3FZVA 3HSRA 4ESFA 5DM7F 4C2TA 4U0VA 4XLAA 2CV2A 4FCYA 5C44J 4LJZF 1Z7LA 1IRFA 3GTPJ 5DCFA 3KLNA 4BDZA 5ICFA 2E36A 2E71A 4A5MA 4HNUA 2WB1A 1A31A 1JKQC 4XICA 3OL4A 4XONA 2LF7A 2W4SA 3HPHA 1LFPA 5DCMA 2R7RA 1ZG3A 2ID3A 3DTEA 1B9NA 4NDLA 5CYVA 3FM5A 2K9QA 1FOXA 1I3QJ 1X3WB 3LFUA 4S05A 4IQ4A 1OYYA 5D5VB 2E5NA 2HOAA 2ZNYA 2HQNA 2K4BA 3NQOA 1H0MA 1YRNB 1MDMA 2QQAA 2WTEA 4I02A 2DFHA 2FA5A 4MNUA 5L3EA 1DPUA 5IT9Z 2FD5A 3CCVI 5EZGA 2EBIA 3FXKA 2R7DA 4A3IJ 1P6RA 2RNJA 2AO9A 2EH3A 3I3LA 2O7OA 4S04A 4CCOA 1GXQA 5EJCA 1WJDA 3KEYA 4RAZA 3CF5F 4EQQA 1REPC 2VUMJ 3HL2A 1BBYA 3GFLA 2LREA 1X1AA 1DGWY 3OS2A 1J59A 1BC7C 2ZNZA 1Z6RA 2EPFA 4FE4A 1FMVA 2VKDA 3CCSI 1IGNA 5FROA 1MKMA 1P4AA 5CVIA 4U87A 2HOSA 1MW7A 4I0BA 3F23A 3GLLA 3H3VK 2RQPA 3HRSA 4EVIA 1DGRM 3T1BA 3HC7A 5KAIC 1R71A 3OYJA 4KMFA 1SD6A 3PO3J 2DTZA 4ZDOA 2JA2A 4BBSJ 3D5SC 3CMYA 3HOZJ 3M8EA 1R36A 5KK1A 2CO5A 5FD6A 1XTAA 1F1ZA 3F0CA 2HZDA 2OAZA 1MH4A 2H27A 1BI1A 1BA5A 3DP7A 1GDTA 3DPLC 1T33A 1QPMA 2A61A 2FUG2 2Y0SA 3OOUA 3N4MA 4A3GJ 2YX7A 1IJWC 2NS7A 4FHTA 3WHCA 3BY6A 4GCVA 3H0DA 1ZG5A 1PUFA 5FKKA 2DJNA 2ZFWA 4MFEA 3PIPF 5GTIC 4HQMA 1GUUA 3RZDJ 1ZELA 3HOYJ 2ZCWA 4ZYGA 4LK0F 1HCRA 3LSKA 5IPAA 3HOVJ 2FSWA 1P7IA 1T98A 2W57A 2VBWA 1HSJA 3S3NA 3SHFA 1LVAA 1UMQA 1R58A 5LGNA 1QVUA 2ZJ2A 3I58A 2K86A 4NNJA 1ZAOA 2ELHA 5L3DA 4ZC3A 4RB0A 4M3EA 2QWWA 2EV5A 4RGXA 4MGRA 1T6SA 1UELB 4N0BA 3ELKA 4HSTA 4K2EA 4G7OF 5HOOA 3ZP5A 2HYJA 3E6CC 2NVYJ 4UVCA 2W1OA 3KETA 2QENA 1UJ8A 1XSXA 4RGRA 1LKXA 3OYKA 3JRGA 3DQVC 4B8XA 3L2RA 3S1MJ 2GA2A 3J81Z 2CV0A 3F8MA 1X3UA 1LQ1A 4LGWA 4U7BA 2G9WA 2VC0A 2IAIA 1TT5B 2X6XA 1Z6TA 2F4OB 1H9GA 4PK4A 3TO6A 1XMAA 3AKZA 4U88A 2EB7A 3L7WA 4E7SA 3T8RA 2V1UA 3JAMZ 2HTJA 4A0XA 2EZKA 2GOMA 4MEXF 3KP3A 2PG4A 3FK6A 3I0TA 3VWBA 2I5UA 1U9OA 2PI0A 3GO5A 1MBKA 3S2WA 3MN2A 3OYNA 3GTMJ 1XGOA 1YRNA 3CCQI 2MW8A 5GP9A 5J1YA 2HDWA 1C0WA 2XAUA 5JLWA 1ZRFA 3QPSA 5K7FA 4L5IA 1W7PD 2DYSH 3DKXA 3O6BB 2GZWA 1D3YA 3RSNA 1I27A 3MVPA 4UV9A 2VKHA 2VXDA 5D5UB 1IV8A 3ZQHA 3HB9A 3FMRA 3OR2C 4OAYA 4Y15A 5TJJA 1G3YA 5F6FA 2HWVA 2OCCH 3G6EI 2XPUA 3K2ZA 3OYEA 2CGPA 3BZ6A 3GF2A 3ABUA 4ZDLA 4C30A 4ZZLA 2QBYB 3R0JA 1VQ5I 4BE2A 1QHGA 1V5GA 2FXAA 1R5HA 1FZPB 2D1VA 2KDZA 1E3HA 4CO8A 2MLGA 4IRHA 3V42A 3VYTB 5HDKA 2M8GX 2R7UA 4G6QA 2R0QC 2K4JA 2V9VA 4YELA 2V4JC 4DYRA 4E7JA 5HLTA 5BMZA 4KA4A 3DTKA 1SFXA 4HF2A 1VTNC 5LHGA 2EZIA 4KIBA 3TDZC 4LLGF 2ZJRF 1RR8C 3BQZA 4M6VA 5J47A 3BCBA 3OV8A 2XGCA 2RREA 2CYYA 2FU4A 2JRTA 4GXOA 3E6MA 5GTHC 3GWZA 3LOCA 2Y48A 1YJ9I 3V8LA 4A5NA 1SC7A 4DBRA 4IJAA 3VODA 1USTA 2IGMA 3BT9A 3I5UA 2WAQA 2VKVA 1LEAA 1TQPA 2DA1A 4C3JJ 5BQTA 2OBPA 1RC9A 4O6JA 1MMAA 1KYZA 4G6DA 4EJOA 5H6RA 2FBKA 2NOJB 1KQ8A 2DFEA 3RZOJ 3LL7A 1AKHB 5CJ9A 2OTLI 2QVOA 4ZTJA 1JT0A 1OCRH 1T2KA 2GXAA 3I56I 2CQNA 2H6CA 2NNNA 3ZRGA 3KFWX 1FOWA 1LNWA 1RESA 3Q9SA 2Y69H 1SVMA 1BI3A 5F1JA 2VJJA 2HNHA 2RV8A 3TOAA 3F8BA 4CYCA 5F64A 2MYSA 3V7SA 2A68F 2EV0A 2VODA 4AYBN 4OMYA 1YW9A 2CQQA 1IUYA 4KUMA 5EYRA 2VXZA 2VE9A 4U7DA 4DQ2A 1JT6A 3OL3A 2HOEA 4Y7NJ 2CW7A 2FOKA 2L4MA 5HS9A 1BOBA 2KIFA 3GFMA 5E1XA 4XL9A 2JMWA 4I76A 3ULQB 2CUZA 3FBNB 3HRTA 4N9HA 1JJ6C 4Y17A 3GBGA 4I01A 1MMSA 4IQJA 5IT3A 1VQKI 4LK1F 3LAPA 1LDKB 5DDGA 5EF6A 4YG2F 3A1YA 1T56A 1D1AA 2KJBA 3CJQB 5J4VA 2EIJH 5D6EA 1ETVA 2KFDA 1IXCA 3GLXA 2FX0A 2FF4A 5JFRA 3HOSA 3HHGA 3TW6A 4M3BA 5FFZA 1FT9A 3OSFA 4XRSA 2IJLA 3K1MA 1STZA 3CZ6A 3A03A 2XUBA 5TGTA 4WX9A 2KIMA 4AIKA 1RUNA 1Y0NA 2V1NA 2YPRA 4D0PA 3K70D 3COAC 2WV1A 1OCOH 1I6XA 2YU9J 1UZCA 4JBAA 2DU9A 2R7WA 4H0EA 3I59A 2MD0A 2VIXA 1K6OA 1LFBA 3EUKL 4KIGA 3ESWB 1SVOA 3IH4A 2CV1A 1D0XA 2EV6A 1MBGA 3KP7A 1FPQA 4Y3OA 3Q5FA 2ZMEB 3QYBA 1WJFA 2CFXA 4NBQA 3CDHA 2BHZA 5ILVA 2LK2A 1WSUA 4IHYA 2VOOA 4WF2A 5M3FJ 4HNVA 3S14J 3S1NJ 3MWMA 1HW5A 2OD5A 4HF0A 5L3CA 3WTYC 3OYFA 3MCZA 3KIOA 3GUDA 5IOYA 3FKJA 3E6DA 4M9SA 2ELJA 3L2QA 2K3PA 2UZKA 2LF8A 2IPQX 5F04A 5ERIA 4BHCA 2IGOA 3L1PA 1B6AA 3GZ5A 1ZHFA 2VLAA 3BOQA 1TWGJ 1E2XA 5J40A 1UFMA 5TISC 1DP7P 2XF6A 4HSRA 3JRIA 4DYQA 2M1BA 4LFUA 5HNFA 5M5XJ 2MC3A 4ASNA 3JR9A 1LB2A 3ZQFA 5JVGF 2G7HA 4KFCA 3PSFA 3TO7A 1WKMA 5J3LA 3U1KA 2DI3A 3FWEA 3I64A 2BY0A 4BXFA 4UUTA 1BJZA 3KPHA 4J00A 4IHVA 2A6EF 1QQIA 4M6YA 3SZGA 1R1TA 2WV0A 3K10A 3WE2A 4ENNA 2L7ZA 1K4TA 4WWCA 1TQMA 1AKHA 4B47A 2D5VA 1HKTA 1N77A 2IXSA 2XIGA 3IRQA 1VQ8I 1HW1A 1WPKA 5EG0A 1X1CA 4PJ0C 2I8DA 4BACA 3S1QJ 5CPRB 3SXYA 5LGUA 2OZUA 1K4SA 1Z0XA 3WGIA 2A5YB 3ONQA 3RTRA 3OIQA 2DOAA 3HTSB 2R7XA 2R7TA 1IRXA 1SFOJ 2L02A 3U1DA 5CVVA 1F9NA 1Z3XA 3D0SA 2QLZA 2H8WA 2CU7A 2HQAA 1RR7A 3ZMTA 3CCJI 2IVMA 3TOBA 5LFAA 4PJLA 3KYDB 1DP3A 2BVMA 2JTVA 3PUFA 3CUQB 1YOVB 1GVDA 3QP5A 1MMDA 3J7YJ 2UXXA 4BJTA 1KA8A 3VPRA 3IRRA 3JRBA 1WVRA 4AD9A 2E60A 3DLAA 4E70A 3ZOBA 4M72A 4UB8C 2P8TA 1E0EA 3F21A 4BBRJ 2QSGX 3FISA 4BYYA 3BPXA 1MSEC 1G8XA 1SANA 3M7GA 3V8KA 3MKWB 4J01A 1TL8A 6PAXA 1R1VA 1GV2A 4ENKA 1R00A 3IAM2 2O5RA 1A6QA 1OFCX 2JZYA 5DCMB 3TMOA 3NEUA 1VQ4I 1D8JA 1G4DA 1X2NA 4CA0A 2WBMA 1XGSA 3WTXC 4BXXJ 1FYLA 1BR4A 4AYBA 3GTQJ 2EJRA 2Y0SN 4U0YA 1OR7C 1P7JA 2ECCA 2Q2EA 2KL4A 4BEHB 4CSWA 3H9QA 2ICWG 3EUHA 5CVJA 2KRHA 1X1DA 2QZ8A 2ZMEA 2MH2A 3MD2A 1NG6A 2M34A 1QO0D 2VPLA 3ZMDA 2DJIA 4HLXA 2XPWA 5KCMA 3ZQIA 1JKPC 4Y33A 2FBHA 3JRFA 1WZ2A 1OCCH 3AFHA 1TNTA 2HZTA 4ANJA 2CUEA 2NNYA 2A05A 1ZRDA 2ID6A 3WGHA 4B48A 1A6IA 3CMMA 1QA6A 1EH6A 3RKYA 2MA3A 4G94A 4LD5A 3JRAA 5F27A 4TV7A 3QQAA 1W7PB 3QODA 1V54H 4DYCA 3BTIA 5K1YA 2HFHA 2P5KA 3G1MA 4LG0A 5FO5A 3K70C 4I0AA 1UB9A 3C7JA 1CQTA 3MQ0A 3ZGKA 2BY3A 1KZHA 3CESA 4CHUA 3ZMSA 4KT6A 3SDBA 3RKWA 5HNHA 2P7VB 4GDFA 4C9YA 1XSVA 2RNGA 4CZCA 3W6JB 3HM5A 5JVTA 1S29A 2JA7J 3L9FA 1XPXA 3DTIA 2CW0F 1OCZH 3RPUD 4DBQA 1X4PA 4P9FA 3CJNA 2XB5A 4UUSA 3ZQ7A 2PFBA 2EIKH 1MMGA 5A2QZ 2EWNA 1ZREA 2NVTJ 4CCKA 3ZQGA 1D5YA 4XQFA 3BG5A 4CCJA 1IAWA 3CF2A 3C1DA 4BQAA 3C2BA 5IOZA 1J9IA 4R1HA 1P92A 3S1RJ 1VQOI 3WTVC 3HSFA 2FBIA 2CW8A 5GAHJ 2R7OA 2JJ7A 3ASOH 2BOLA 4A6EA 3Q0VA 1S72I 1JGGA 5E3NA 1VQ7I 5BPDA 1N78A 1BW5A 5A2QK 4XOTA 4CCNA 2LOOA 5K5QA 1O7FA 3EUAA 4YIIA 3HRUA 3CUQA 2R7QA 3A01B 1JJ8C 2KDOA 3PL8A 2PBIA 1YI2I 4E7IA 3BTCA 1XCVA 4CH7A 5HDNA 1D1BA 3ZQQA 2X48A 3ERMA 1Y39A 3OYDA 2Y9ZA 1JE8A 3LQRA 1KYWA 2WY7Q 3MKLA 5D5WB 1WCMJ 3BR6A 2L2OA 1FMWA 1U0JA 4ZYAA 1UHWA 3K0LA 2LY2A 4P96A 2DMNA 1K61A 3K4KA 1U5TB 1F36A 2Y30A 4NHJA 1Z3YA 2HPIA 3HGYA 2XKPA 5M3MJ 5LHIA 2P6TA 4UVAA 3I55I 3BP8A 3IH3A 4IO9F 4M73A 1D5VA 3EETA 3LSPA 4F93B 2R7FA 4II3A 4W97A 1ZYRF 1FYKA 2QQ8A 3MZ8A 1MD0A 4ETSA 1M1EB 1Z67A 2V9PA 4F7ZA 5HODA 2WADA 4XM3A 3T8TA 2VQLA 4BEHA 3O8GA 2XVCA 3OS0A 1MNDA 1H89C 3LSRA 3CO6C 2R5YB 1JI8A 1X2MA 3R6SA 2WAQN 1FNNA 3L09A 3TO9A 4OOIA 3OYLA 1QZYA 3OYBA 1HKSA 2WA0A 2C6YA 2XAJA 3D5RC 3OSGA 4B44A 2F2EA 1TLHB 2P5LC 1A35A 4HLYA 2ME0A 4C3IJ 1VF9A 2PX9A 5IT9K 2E35A 4BU2A 1W7PA 1ZGJA 3UNGC 2DXIA 3CCLI 3S3MA 4IEJA 1MBHA 3TQNA 4L9JA 3KZZA 3I54A 4OINF 2FNAA 4KISA 3BCAA 2IA1A 4Q48A 2L01A 2L7MP 3QPLA 1TWFJ 4HA8A 5ICCA 5FLMJ 2H94A 2X1EA 3P9IA 5FRNA 3GYHX 2DTRA 1ZG1A 3ZPLA 4MIMA 1ZTRA 4UB6C 3JRDA 3HHHA 2JT1A 2DFFA 3ABTA 3LMMA 4OAZA 4B09A 1KQ0A 1Y8RB 4RGUA 5K5RA 4QIWN 3HOXJ 2IBDA 4M3DA 2RQQA 4M74A 4DGWB 2JUCA 2F5VA 2HQ5A 3TP3A 3REOA 2KIUA 3BTJA 3ABLH 4LIVA 3WGGA 5E3OA 2HXIA 3K4NA 2PJRB 1JTYA 5DTDA 3BG6A 4F92B 2BW3B 2E1MB 1ITYA 3DCFA 4RLQA 2JA8J 3CDIA 3BZCA 4IVNA 3OYGA 1LUJB 2EINH 1ETOA 1FOYA 2UXNA 1QBJA 4P5OA 3TBIA 1SEUA 1IN5A 4II2A 1YIOA 1YJNI 3CCEI 1HC8A 2M87A 1QGPA 2GA1A 2X51A 2IRFG 2DK8A 4IHWA 5F08A 4CYCB 2VONA 4O5VA 3A01A 3CC2I 5FRMA 1EKEA 1OMIA 1HDPA 2YR2A 1BL0A 1UHSA 5E17F 5J1UA 3K4JA 3HJEA 3FMQA 3FDYA 3CCRI 3BQYA 1D8KA 2M5WA 4Q47A 3K1PA 2DA3A 4O3MA 1YFHA 4KYWA 3ZMZA 2XDVA 3FXOA 1IN7A 2QQ9A 5KAFC 1TTYA 4QLCU 1R9TJ 4ZTFA 1SD7A 1T95A 1U5TA 2DA5A 1AA7A 1B9MA 3CDLA 3DPTA 4RAGA 1P9QC 2GXGA 3PNVA 3GVAA 3J81K 2DAOA 2XAHA 3J7AO 2DO7A 5CVUA 3SFZA 2MLKA 2Y0MA 1W4MA 1WH7A 2OQGA 1FIAA 3HKZA 2W7NA 3SEQA 3GTLJ 4ZZDA 4AVPA 2B0LA 2V6EA 3F72A 4OIRF 4RA2A 4AIHA 3DWLE 1YS6A 1W5TA 3JAMK 3HUGB 4A3MJ 2CMPA 1WGXA 2R5YA 3I53A 4L5JA 3PQJA 3FK7A 2HU9A 1KU2A 1Q1HA 3I59B 2HVQA 3I9V2 3DEEA 4D9JA 1ETKA 1XMKA 3BJ6A 1Z21A 2M45A 3OYCA 3TKYA 4CCLA 3HSEA 2BVLA 4V19K 2E1NA 2NS8A 4A3DJ 3WTWC 2PMZN 4DZPA 1YHQI 1XSDA 3NARA 2VQGA 3H92A 1BI0A 2OCEA 3HBLA 1BW6A 3GZ6A 2HVSA 1BR1A 1RPWA 2DMUA 1RI7A 2LTPA 2ZMEC 3BDDA 4I7HA 2LLKA 3G1OA 2IS2A 2O6GE 5HDGA 2EFNA 2R7VA 3GMEA 3Q0UA 1WJAA 3CCYA 3E0JB 3T0YA 1J75A 3VSKA 4XSXF 3IUOA 1NG7A 4HPQA 3V4GA 2L3DA 1T38A 5H2FC 4LB5A 1B72A 1E3PA 3BG3A 1U2WA 2K5CA 4AUXA 2COBA 5E1ZB 2O0YA 1SAUA 2EZHA 5E18F 2RN7A 4YFKF 4BJ5C 4XNFA 2H6BA 3B6CA 2XF5A 1IXRC 3QU6A 4S0HB 1JTXA 4XK4A 1HSTA 2LMDA 2LD5A 1J5YA 3S2HJ 4KT5C 3FXMA 3LSGA 5LD2C 5LLQA 3H5AA 2Q8KA 2DQRA 2FRHA 4D7NA 3RYPA 1QRYA 1IRZA 2DODA 3BG7A 4E7HA 1W0UA 1FEXA 2PJRA 4OIQF 4JYKA 1I39A 3CQZJ 4UVBA 2BW3A 1TQIA 2LVSA 1LJ9A 2HS5A 4QPOA 3RI4A 1OCTC 4OIPF 4WCGA 2M0MA 1ZGWA 2JSCA 4MFDA 1X4OA 2KT0A 3MZYA 4I98B 3CMEI 2IA0A 5E8GA 2KZGA 5EG0B 4X6AJ 1HLVA 3CC7I 1S9HA 2BEOA 1IF1A 3RKQA 3KP6A 2GM4A 5IYBJ 4EJUA 4J19A 1TT0A 2DCEA 4MTDA 3IV5A 3CCUI 1H8AC 3FXUA 3E3VA 1D0ZA 4JOMA 2GOXB 3K4CA 1L0OC 1T0FA 3QPTA 1VZ0A 2H09A 1H88C 2LKSA 3GXOA 2F5CA 1XMXA 3E5QA 4RB2C 1ZLJA 4FQGA 2XV4S 3ROUA 4D7MA 4HYEA 3B02A 5FB2A 3VSLA 2Z33A 2OZ6A 1PP8F 3S17J 2XGDA 1SVLA 2EIMH 2L9VA 4D5CA 1FIPA 3SJMA 4FX4A 2OPTA 4IRIA 2XAQA 4C3HJ 4NC6A 3NAUA 1FSHA 3J7AY 3CD6I 3TDUC 3WG9A 3F6OA 2DT6A 4U0WA 4HAMA 5ILSA 2LBFA 3RDIA 5E8IA 5LRRA 3PUBA 4HQEA 2E34A 4UXNA 1ULYA 2VKEA 2Y75A 4EGZA 1XC5A 3F8FA 3ZQLA 2A6HF 2TRTA 2VJ5A
chains in the Genus database with same CATH topology
3KEQA 3JSOA 1KU7A 3BJOA 2KRFA 3HUGA 3M8FA 1YLFA 2ZO4A 3BROA 2RDPA 3K69A 1SD4A 5E1WA 4CICA 1GHCA 3HYIA 3ECOA 3BPVA 3FHZA 1U6GA 4FX0A 4HV5A 1QNTA 5H6QA 1U8RA 1WQ2A 1BIAA 3VFZA 1YYVA 4M9XA 3MAJA 4L9VA 4Q4ZF 4LG0B 3DFGA 5DYMA 4EM0B 3DKWA 3LA3A 3VB2A 2ZKZA 3J80Z 3QAHA 2W85A 1WWXA 1BJAA 3CUOA 1KU3A 1Z7UA 3QPHA 1FOKA 3L00A 5ICGA 5E20A 4YIFA 4IF4A 2PMHA 2DT5A 2RC4A 4OMZA 2O8XA 3J80K 1B59A 2Q0OA 2AXLA 5DUKA 3AAFA 1Z9CA 2QUFA 1FP2A 1U3EM 4MHGA 2BGCA 3RPQA 2M8EA 1PP7U 4GGGA 4IHTA 5LHHA 2Z99A 3LWFA 1GVJA 2VN2A 4JQFA 3RPUA 1CGPA 1OKRA 2XAFA 3QOPA 1WRJA 3VEPA 5HS8A 3WTUC 2VBZA 2HYGD 1O3SA 2EK5A 3R60A 3WTZA 4I2OA 3W6KB 4EV0A 4KICA 3TGNA 4IRGA 3RYRA 1H9TA 4HBLA 4HF1A 1ZGAA 1XD7A 3ML6A 4IXAA 4HX7A 4ESBA 4EJWA 1TBXA 2KJCA 5EEGA 1ON2A 5AONA 1FLIA 2VT2A 4HV6A 4M9ZA 4CGZA 1U5TC 2VBYA 1ON1A 2VOPA 1R22A 2EFWA 1SD5A 3T5XA 1O3TA 2F5EA 2FQ3A 5ED4A 3IKTA 1W5SA 5F1RA 5D8LB 2JPCA 1EH8A 5K5OA 2ISYA 4RB3C 3H3ZA 2ETHA 2DPDA 3SZTA 4BHBA 3DEUA 2K7LA 1EV7A 2PEXA 4G7ZF 1SFEA 3KZYA 2EFPA 2OU2A 1BIBA 4CZZA 2EA4A 1UHMA 3FF5A 5HVQC 4BNCA 5FD5A 4A0YA 3CTAA 4GYGA 3PQKA 2PLYA 4HW0A 1R1UA 3ZN1A 1FY7A 4R79A 2FMLA 4WXCA 4A6DA 4JK1X 1F4KA 1XN7A 4P9UA 4BXUA 5HLIA 4MEYF 2VE8A 5LEKA 3N97A 1DUXC 3GX4X 4XLNF 1FP1D 3JTHA 3BWGA 4PGGA 2V6CA 2A3SA 2HTSA 5JR3A 1YTYA 2NS0A 4EJVA 2E7XA 1K79A 2P6SA 3G3ZA 1XDUA 1QZZA 1IN4A 4A2UA 3K1NA 3ERED 4AIJA 4EMSA 3F8NA 1O57A 1FC3A 4WXHA 4A0ZA 2LNBA 5HS7A 1CF7B 2KKOA 5H20A 3C18A 4Q5SF 4PCQA 1ONVA 3U2RA 3EYYA 1FX7A 1BI2A 5LBQA 4L9TA 1USSA 3KEOA 1V4RA 2QM3A 2RKHA 4IPAA 2G7UA 2XAGA 2STWA 3KLOA 4NQWA 1F5TA 3ZMVA 2BBYA 2DLLA 3V8JA 2DW4A 1RZ4A 4RAYA 3EQLF 1J2XA 1S3JA 1OPCA 4HDVA 4ZH4F 3IHUA 1EH7A 4RGSA 2X0LA 1J0RA 1ZN2A 1B1BA 3WTTC 4KNYA 5DUIA 2D1HA 5TRDA 3DXJF 5D8KB 2ACJA 5D4SA 4RS8A 3KP5A 1LDDA 3F3XA 2VC1A 5J6XA 2AS5F 4AWXB 1TW2A 2F5FA 1ZH5A 1Z1DA 4XSZF 3SZPA 5HLHA 2A69F 1IZ1A 1O3RA 1AOYA 3R61A 3WU0A 3G73A 3LA7A 1AWCA 1YQAA 2NRAC 3HTUA 3WE3A 1G3TA 1IRGA 1UCRA 3I4PA 5DD4A 1PDNC 4HX4A 2EFQA 3ZN0A 5BPIA 1SAXA 2CG4A 3KP2A 4HZFA 5LGTA 3DV8A 2FNPA 4M6XA 5BS6A 2GIVA 2LKPA 2M30A 1IN6A 2V1DA 1FBSA 3GFJA 1GXPA 2IT0A 5HLGA 3P9KA 2MH9A 1XGNA 5L3GA 4LLLA 1CF7A 1K78B 1FSEA 3O3KA 1JGSA 2DPUA 3E5XA 2DK5A 1JHHA 4LLNA 2K02A 2GWRA 1RNLA 4QWQA 4HX8A 2A6HF 3IWZA 5DV5A 4PZJA 4PDKA 3QP6A 1ODDA 2JPBA 2PMUA 3RIRA 3I71A 1ZLKA 1S6LA 2ISZA 4EJTA 2BV6A 4CXFA 3BJAA 1JHFA 4DNCA 1YO5C 2ESNA 2HGCA 2GQQA 1OR7A 2VT3A 3SQNA 3E6BA 3LAJA 1HW2A 3RJPA 1DDNA 1MJBA 2HKXA 4N9IA 1K7AA 4I09A 4G7HF 2WC2A 1P4WA 3JSPA 1O7LA 3MZHA 2W25A 5BOXA 5AIPA 1WI9A 3LFKA 2PQ8A 5AIQA 2E7WA 2LDUA 5ILUA 2Z9OA 2F5DA 3EYIA 2DFIA 3O2PE 2D2WA 4KIFA 4YFNF 5D5XB 1I5ZA 4HDUA 3GFIA 2P7CB 2P4WA 3HIFA 1KQ9A 2XKOA 4MQVA 3V7RA 3QU3A 2A07F 3R4KA 4CDGA 5DD8A 4RB1A 4XBFA 3RKXA 2RVCA 2HYFA 3E97A 3GW2A 2EFOA 1XB4A 3R0AA 2DBBA 2FE3A 2DQLA 2IW5A 3WODF 2XHKA 3L2CA 1T39A 2P5VA 4L18B 4NB5A 5JI6A 3MEXA 1SMTA 3F6VA 3EDPA 2O03A 3IL2A 2HKOA 1Z05A 4UHTA 3CUQC 4L0YB 4LMYA 4L0ZB 1Y0UA 3DF8A 1S7OA 4EM1A 1K78A 4UUVA 2TDXA 3PFIA 3CLOA 2MBFA 2MD5A 1U78A 2HQRA 1YW7A 1IN8A 4LB6B 4L9NA 2O61A 1B4AA 1OYWA 3V7CA 5L3BA 1A04A 2L54A 4Z2YA 2E1CA 3P7NA 2J5OA 2CQKA 3FMSA 4ON0A 1KGSA 1RIOH 2IP2A 2GXBA 1G3WA 3MFKA 4WXDA 2IA2A 1J7KA 4CYDA 2XROA 4BAYA 4MQ9F 1MGTA 4IHSA 1HQCA 3E5UA 4ZYEA 1IW7F 2X4HA 2QBYA 5D6FA 4KN4X 4ENMA 2GAUA 4PGHA 4BHPA 3H3UA 4ENJA 4BH9A 3LA2A 4OU0A 2HDCA 4KN7X 1XGMA 2ESHA 2W24A 2HEOA 2ADUA 1YG2A 2VBXA 2RGVA 4KDPA 2V79A 2CSOA 2EA2A 2PJPA 3KP4A 4UV8A 4M71A 1P2FA 4P55A 2PN6A 5J8CA 3NRVA 5FLXZ 3U9GA 3B73A 1PUEE 5JHUA 2WWYA 1BM9A 2R3SA 3WU1B 4HOBA 1R23A 3ZMUA 2ZXJA 5FLXK 2UWMA 1SMYF 4GO1A 2Z3YA 1FWZA 2W84A 3FM3A 5EEHA 3F8CA 2LSOA 3D5LA 2J5PA 1FYMA 1Z91A 1NHAA 1G3SA 4GYIA 3WTSC 3HOTA 3K9TA 3OOPA 4KMUX 1MZBA 1YS7A 2XASA 2YSRA 3JW4A 2STTA 2D45A 4A12A 3CO7C 2BYVE 3FX3A 3JTGA 1O3QA 3FXQA 1HBXG 3IC7A 2QQBA 5D4RA 2XGXA 3ECHA 3IWFA 4G9YA 1RUOA 1MDMB 4ZYDA 1LEBA 2L4AA 4ESJA 1BC8C 2YX4A 2OQRA 1I1GA 2O3FA 1R7JA 1KU9A 3F22A 3Q9VA 2OA4A 1TW3A 3LSTA 1XCBA 4XRFA 5LRSA 3KE2A 2XRNA 3QRFF 1FBQA 1OYIA 3FXRA 3M9AA 5DEQA 2ZBKA 5J8FA 1V3FA 2FEZA 4Y13A 1JXSA 4G8XA 2FMYA 1HKQA 2K27A 3LQQA 1I1SA 1FBUA 4MTEA 4FT8A 3KCCA 1TNSA 1MJ9A 2NYXA 1E17A 1HXDA 5CVRA 1XDSA 5KVRA 1S7AA 4ZYHA 1S8NA 4OIOF 2HR3A 3HRMA 4YFXF 1ZARA 2COMA 1DPRA 1YW8A 1ZRCA 3IKVA 3VOEA 3ISPA 2QYOA 2NAZA 1G6NA 2YU3A 2V1XA 5LEJA 3P9CA 1R5GA 1P4XA 1L3LA 1IXSB 5FGMA 4EGYA 2CWEA 2BE5F 1BOAA 2Z5UA 4EM2A 3M1EA 5ICEA 1MJAA 1LDJA 3GEZA 4XLPF 3C3WA 5L3FA 1SFUA 4WK8F 1BN5A 5CLSA 4UNOA 4R8HA 5FFXA 3FZVA 3HSRA 4ESFA 4U0VA 4LJZF 1IRFA 5DCFA 3KLNA 5ICFA 4A5MA 2LF7A 5DCMA 1ZG3A 1B9NA 5CYVA 3FM5A 4S05A 1OYYA 5D5VB 2ZNYA 2HQNA 2K4BA 3NQOA 1H0MA 1MDMA 2QQAA 2WTEA 4I02A 2FA5A 4MNUA 5L3EA 1DPUA 5IT9Z 2R7DA 1P6RA 2RNJA 4S04A 1GXQA 4RAZA 1REPC 4EQQA 1BBYA 3GFLA 1J59A 1BC7C 2ZNZA 1Z6RA 1MKMA 1P4AA 5CVIA 4I0BA 3F23A 2RQPA 3HRSA 4EVIA 3T1BA 4KMFA 1SD6A 3M8EA 1R36A 5KK1A 2CO5A 5FD6A 1F1ZA 2OAZA 2H27A 1BI1A 3DP7A 3DPLC 1QPMA 2A61A 3N4MA 2YX7A 4FHTA 1ZG5A 3BY6A 4GCVA 2ZFWA 4HQMA 2ZCWA 4ZYGA 4LK0F 2FSWA 1T98A 2W57A 2VBWA 1HSJA 3SHFA 1LVAA 1R58A 5LGNA 2ZJ2A 3I58A 2K86A 1ZAOA 2ELHA 5L3DA 4RB0A 2QWWA 2EV5A 4RGXA 4MGRA 1T6SA 4N0BA 3ELKA 4K2EA 4G7OF 5HOOA 3ZP5A 3E6CC 4UVCA 3KETA 2QENA 1XSXA 4RGRA 3DQVC 4B8XA 2GA2A 3J81Z 3F8MA 1X3UA 1LQ1A 4LGWA 4U7BA 2G9WA 2VC0A 1Z6TA 1H9GA 3TO6A 1XMAA 4U88A 2EB7A 3L7WA 3T8RA 2V1UA 3JAMZ 2HTJA 4A0XA 4MEXF 3KP3A 2PG4A 3I0TA 2PI0A 3GO5A 3S2WA 1XGOA 1C0WA 1ZRFA 4L5IA 1W7PD 3O6BB 2GZWA 1D3YA 1I27A 4UV9A 5D5UB 3FMRA 5TJJA 4Y15A 1G3YA 5F6FA 2HWVA 3K2ZA 2CGPA 3BZ6A 3GF2A 3ABUA 4ZZLA 2QBYB 3R0JA 2FXAA 1R5HA 1FZPB 2D1VA 4CO8A 2MLGA 4IRHA 5HDKA 4G6QA 2K4JA 2V9VA 5BMZA 4KA4A 1SFXA 4HF2A 1VTNC 5LHGA 4KIBA 3TDZC 4LLGF 3OV8A 2FU4A 2CYYA 2JRTA 4GXOA 3E6MA 3GWZA 2Y48A 3V8LA 4A5NA 4IJAA 3VODA 1USTA 3I5UA 1LEAA 1TQPA 5BQTA 2OBPA 4O6JA 1KYZA 4G6DA 4EJOA 5H6RA 2FBKA 1KQ8A 5CJ9A 2QVOA 1T2KA 2H6CA 2NNNA 3KFWX 1LNWA 3Q9SA 1BI3A 2RV8A 3TOAA 3F8BA 5F64A 3V7SA 2A68F 2EV0A 2VODA 4OMYA 1YW9A 1IUYA 4KUMA 2VXZA 2VE9A 4U7DA 4DQ2A 2HOEA 2FOKA 2L4MA 5HS9A 2KIFA 3GFMA 5E1XA 3ULQB 3HRTA 4N9HA 4Y17A 4I01A 5IT3A 4LK1F 3LAPA 1LDKB 5DDGA 4YG2F 2KJBA 5D6EA 1IXCA 3GLXA 5JFRA 2FF4A 3HOSA 3HHGA 5FFZA 1FT9A 2IJLA 3K1MA 1STZA 2XUBA 4WX9A 2KIMA 4AIKA 1RUNA 2YPRA 4D0PA 3COAC 1I6XA 4JBAA 2DU9A 4H0EA 3I59A 1K6OA 4KIGA 2EV6A 3KP7A 1FPQA 3Q5FA 2ZMEB 2CFXA 3CDHA 5ILVA 1WSUA 2VOOA 4WF2A 3MWMA 1HW5A 2OD5A 4HF0A 5L3CA 3WTYC 3MCZA 3GUDA 3E6DA 4M9SA 2UZKA 2LF8A 2IPQX 4BHCA 5ERIA 1B6AA 3GZ5A 1ZHFA 3BOQA 1E2XA 1DP7P 1UFMA 2M1BA 4LFUA 2MC3A 4ASNA 1LB2A 2G7HA 4KFCA 3TO7A 1WKMA 2DI3A 3FWEA 3I64A 2A6EF 1QQIA 4M6YA 1R1TA 2WV0A 3WE2A 4ENNA 4WWCA 1TQMA 1HKTA 2XIGA 3IRQA 1HW1A 3SXYA 5LGUA 2OZUA 3WGIA 2A5YB 3RTRA 3HTSB 2L02A 3U1DA 5CVVA 1F9NA 3D0SA 2QLZA 3ZMTA 2IVMA 3TOBA 2JTVA 3CUQB 3QP5A 2UXXA 3IRRA 1KA8A 4AD9A 4E70A 4M72A 2P8TA 3F21A 4BYYA 3BPXA 3M7GA 3V8KA 6PAXA 1R1VA 4ENKA 2JZYA 5DCMB 3NEUA 1D8JA 1G4DA 1XGSA 3WTXC 1FYLA 2EJRA 4U0YA 2Q2EA 5CVJA 3EUHA 2QZ8A 2ZMEA 2MH2A 1QO0D 3ZMDA 4HLXA 2FBHA 1TNTA 2HZTA 2NNYA 1ZRDA 3WGHA 1EH6A 3RKYA 2MA3A 4G94A 4LD5A 4TV7A 1W7PB 5K1YA 2HFHA 2P5KA 4LG0A 5FO5A 4I0AA 1UB9A 3C7JA 3MQ0A 4CHUA 3ZMSA 3RKWA 2P7VB 1XSVA 3W6JB 5JVTA 1S29A 3L9FA 2CW0F 4P9FA 3CJNA 3ZQ7A 2PFBA 5A2QZ 2EWNA 1ZREA 1IAWA 3C1DA 4BQAA 1J9IA 4R1HA 1P92A 3WTVC 3HSFA 2FBIA 4A6EA 5BPDA 5A2QK 5K5QA 1O7FA 4YIIA 3HRUA 3CUQA 2PBIA 1XCVA 5HDNA 1JE8A 3LQRA 1KYWA 5D5WB 1UHWA 3K0LA 4P96A 1U5TB 4NHJA 2XKPA 5LHIA 2P6TA 4UVAA 3BP8A 4M73A 1D5VA 3EETA 2R7FA 1FYKA 1ZYRF 1MD0A 4ETSA 4F7ZA 3T8TA 2XVCA 3CO6C 3R6SA 3L09A 1FNNA 3TO9A 4OOIA 1QZYA 1HKSA 2C6YA 2XAJA 2F2EA 1TLHB 2P5LC 4HLYA 5IT9K 1W7PA 1ZGJA 3TQNA 4L9JA 3KZZA 3I54A 4OINF 2FNAA 2IA1A 4Q48A 2L01A 4HA8A 5ICCA 2H94A 3P9IA 3GYHX 2DTRA 1ZG1A 3ZPLA 3HHHA 2JT1A 3ABTA 4B09A 1KQ0A 5K5RA 4RGUA 4M74A 3REOA 2KIUA 3WGGA 4IVNA 2UXNA 1QBJA 4P5OA 1IN5A 1YIOA 2M87A 1QGPA 2GA1A 2IRFG 2DK8A 2VONA 4O5VA 1OMIA 2YR2A 5E17F 3FMQA 1D8KA 2M5WA 4Q47A 3K1PA 4O3MA 1YFHA 4KYWA 3ZMZA 1IN7A 2QQ9A 1TTYA 4QLCU 1SD7A 1U5TA 1B9MA 3DPTA 2GXGA 3GVAA 3J81K 2DAOA 2XAHA 3J7AO 2DO7A 5CVUA 3SFZA 2MLKA 2Y0MA 1W4MA 2OQGA 4ZZDA 4AVPA 2B0LA 3F72A 4OIRF 4AIHA 1YS6A 1W5TA 3JAMK 3I53A 4L5JA 3PQJA 3I59B 1KU2A 1Q1HA 1XMKA 3BJ6A 2M45A 3TKYA 3HSEA 2E1NA 3WTWC 1XSDA 3H92A 3GZ6A 1BI0A 1RI7A 3BDDA 4I7HA 2O6GE 5HDGA 2EFNA 3T0YA 1J75A 4XSXF 3V4GA 2L3DA 1T38A 4LB5A 1U2WA 5E1ZB 2O0YA 5E18F 2RN7A 4YFKF 2H6BA 1IXRC 3QU6A 1HSTA 1J5YA 4KT5C 5LLQA 2Q8KA 2DQRA 2FRHA 3RYPA 4OIQF 4UVBA 1TQIA 1LJ9A 2HS5A 3RI4A 4OIPF 4WCGA 2JSCA 3MZYA 4I98B 2IA0A 5E8GA 2BEOA 1IF1A 3KP6A 4EJUA 4MTDA 3FXUA 3E3VA 1L0OC 1T0FA 3QPTA 2H09A 3GXOA 2F5CA 3E5QA 4RB2C 1ZLJA 2XV4S 3ROUA 4HYEA 3B02A 5FB2A 2Z33A 2OZ6A 1PP8F 4FX4A 4IRIA 2XAQA 1FSHA 3TDUC 3WG9A 3F6OA 4U0WA 4HAMA 5ILSA 3RDIA 5E8IA 5LRRA 4HQEA 4UXNA 1ULYA 2Y75A 4EGZA 3F8FA 1R00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEQ A;  3JSO A;  1KU7 A;  3BJO A;  2KRF A;  3HUG A;  3M8F A;  1YLF A;  2ZO4 A;  3BRO A;  2RDP A;  3K69 A;  1SD4 A;  5E1W A;  4CIC A;  1GHC A;  3HYI A;  3ECO A;  3BPV A;  3FHZ A;  1U6G A;  4FX0 A;  4HV5 A;  1QNT A;  5H6Q A;  1U8R A;  1WQ2 A;  1BIA A;  3VFZ A;  1YYV A;  4M9X A;  3MAJ A;  4L9V A;  4Q4Z F;  4LG0 B;  3DFG A;  5DYM A;  4EM0 B;  3DKW A;  3LA3 A;  3VB2 A;  2ZKZ A;  3J80 Z;  3QAH A;  2W85 A;  1WWX A;  1BJA A;  3CUO A;  1KU3 A;  1Z7U A;  3QPH A;  1FOK A;  3L00 A;  5ICG A;  5E20 A;  4YIF A;  4IF4 A;  2PMH A;  2DT5 A;  2RC4 A;  4OMZ A;  2O8X A;  3J80 K;  1B59 A;  2Q0O A;  2AXL A;  5DUK A;  3AAF A;  1Z9C A;  2QUF A;  1FP2 A;  1U3E M;  4MHG A;  2BGC A;  3RPQ A;  2M8E A;  1PP7 U;  4GGG A;  4IHT A;  5LHH A;  2Z99 A;  3LWF A;  1GVJ A;  2VN2 A;  4JQF A;  3RPU A;  1CGP A;  1OKR A;  2XAF A;  3QOP A;  1WRJ A;  3VEP A;  5HS8 A;  3WTU C;  2VBZ A;  2HYG D;  1O3S A;  2EK5 A;  3R60 A;  3WTZ A;  4I2O A;  3W6K B;  4EV0 A;  4KIC A;  3TGN A;  4IRG A;  3RYR A;  1H9T A;  4HBL A;  4HF1 A;  1ZGA A;  1XD7 A;  3ML6 A;  4IXA A;  4HX7 A;  4ESB A;  4EJW A;  1TBX A;  2KJC A;  5EEG A;  1ON2 A;  5AON A;  1FLI A;  2VT2 A;  4HV6 A;  4M9Z A;  4CGZ A;  1U5T C;  2VBY A;  1ON1 A;  2VOP A;  1R22 A;  2EFW A;  1SD5 A;  3T5X A;  1O3T A;  2F5E A;  2FQ3 A;  5ED4 A;  3IKT A;  1W5S A;  5F1R A;  5D8L B;  2JPC A;  1EH8 A;  5K5O A;  2ISY A;  4RB3 C;  3H3Z A;  2ETH A;  2DPD A;  3SZT A;  4BHB A;  3DEU A;  2K7L A;  1EV7 A;  2PEX A;  4G7Z F;  1SFE A;  3KZY A;  2EFP A;  2OU2 A;  1BIB A;  4CZZ A;  2EA4 A;  1UHM A;  3FF5 A;  5HVQ C;  4BNC A;  5FD5 A;  4A0Y A;  3CTA A;  4GYG A;  3PQK A;  2PLY A;  4HW0 A;  1R1U A;  3ZN1 A;  1FY7 A;  4R79 A;  2FML A;  4WXC A;  4A6D A;  4JK1 X;  1F4K A;  1XN7 A;  4P9U A;  4BXU A;  5HLI A;  4MEY F;  2VE8 A;  5LEK A;  3N97 A;  1DUX C;  3GX4 X;  4XLN F;  1FP1 D;  3JTH A;  3BWG A;  4PGG A;  2V6C A;  2A3S A;  2HTS A;  5JR3 A;  1YTY A;  2NS0 A;  4EJV A;  2E7X A;  1K79 A;  2P6S A;  3G3Z A;  1XDU A;  1QZZ A;  1IN4 A;  4A2U A;  3K1N A;  3ERE D;  4AIJ A;  4EMS A;  3F8N A;  1O57 A;  1FC3 A;  4WXH A;  4A0Z A;  2LNB A;  5HS7 A;  1CF7 B;  2KKO A;  5H20 A;  3C18 A;  4Q5S F;  4PCQ A;  1ONV A;  3U2R A;  3EYY A;  1FX7 A;  1BI2 A;  5LBQ A;  4L9T A;  1USS A;  3KEO A;  1V4R A;  2QM3 A;  2RKH A;  4IPA A;  2G7U A;  2XAG A;  2STW A;  3KLO A;  4NQW A;  1F5T A;  3ZMV A;  2BBY A;  2DLL A;  3V8J A;  2DW4 A;  1RZ4 A;  4RAY A;  3EQL F;  1J2X A;  1S3J A;  1OPC A;  4HDV A;  4ZH4 F;  3IHU A;  1EH7 A;  4RGS A;  2X0L A;  1J0R A;  1ZN2 A;  1B1B A;  3WTT C;  4KNY A;  5DUI A;  2D1H A;  5TRD A;  3DXJ F;  5D8K B;  2ACJ A;  5D4S A;  4RS8 A;  3KP5 A;  1LDD A;  3F3X A;  2VC1 A;  5J6X A;  2AS5 F;  4AWX B;  1TW2 A;  2F5F A;  1ZH5 A;  1Z1D A;  4XSZ F;  3SZP A;  5HLH A;  2A69 F;  1IZ1 A;  1O3R A;  1AOY A;  3R61 A;  3WU0 A;  3G73 A;  3LA7 A;  1AWC A;  1YQA A;  2NRA C;  3HTU A;  3WE3 A;  1G3T A;  1IRG A;  1UCR A;  3I4P A;  5DD4 A;  1PDN C;  4HX4 A;  2EFQ A;  3ZN0 A;  5BPI A;  1SAX A;  2CG4 A;  3KP2 A;  4HZF A;  5LGT A;  3DV8 A;  2FNP A;  4M6X A;  5BS6 A;  2GIV A;  2LKP A;  2M30 A;  1IN6 A;  2V1D A;  1FBS A;  3GFJ A;  1GXP A;  2IT0 A;  5HLG A;  3P9K A;  2MH9 A;  1XGN A;  5L3G A;  4LLL A;  1CF7 A;  1K78 B;  1FSE A;  3O3K A;  1JGS A;  2DPU A;  3E5X A;  2DK5 A;  1JHH A;  4LLN A;  2K02 A;  2GWR A;  1RNL A;  4QWQ A;  4HX8 A;  2A6H F;  3IWZ A;  5DV5 A;  4PZJ A;  4PDK A;  3QP6 A;  1ODD A;  2JPB A;  2PMU A;  3RIR A;  3I71 A;  1ZLK A;  1S6L A;  2ISZ A;  4EJT A;  2BV6 A;  4CXF A;  3BJA A;  1JHF A;  4DNC A;  1YO5 C;  2ESN A;  2HGC A;  2GQQ A;  1OR7 A;  2VT3 A;  3SQN A;  3E6B A;  3LAJ A;  1HW2 A;  3RJP A;  1DDN A;  1MJB A;  2HKX A;  4N9I A;  1K7A A;  4I09 A;  4G7H F;  2WC2 A;  1P4W A;  3JSP A;  1O7L A;  3MZH A;  2W25 A;  5BOX A;  5AIP A;  1WI9 A;  3LFK A;  2PQ8 A;  5AIQ A;  2E7W A;  2LDU A;  5ILU A;  2Z9O A;  2F5D A;  3EYI A;  2DFI A;  3O2P E;  2D2W A;  4KIF A;  4YFN F;  5D5X B;  1I5Z A;  4HDU A;  3GFI A;  2P7C B;  2P4W A;  3HIF A;  1KQ9 A;  2XKO A;  4MQV A;  3V7R A;  3QU3 A;  2A07 F;  3R4K A;  4CDG A;  5DD8 A;  4RB1 A;  4XBF A;  3RKX A;  2RVC A;  2HYF A;  3E97 A;  3GW2 A;  2EFO A;  1XB4 A;  3R0A A;  2DBB A;  2FE3 A;  2DQL A;  2IW5 A;  3WOD F;  2XHK A;  3L2C A;  1T39 A;  2P5V A;  4L18 B;  4NB5 A;  5JI6 A;  3MEX A;  1SMT A;  3F6V A;  3EDP A;  2O03 A;  3IL2 A;  2HKO A;  1Z05 A;  4UHT A;  3CUQ C;  4L0Y B;  4LMY A;  4L0Z B;  1Y0U A;  3DF8 A;  1S7O A;  4EM1 A;  1K78 A;  4UUV A;  2TDX A;  3PFI A;  3CLO A;  2MBF A;  2MD5 A;  1U78 A;  2HQR A;  1YW7 A;  1IN8 A;  4LB6 B;  4L9N A;  2O61 A;  1B4A A;  1OYW A;  3V7C A;  5L3B A;  1A04 A;  2L54 A;  4Z2Y A;  2E1C A;  3P7N A;  2J5O A;  2CQK A;  3FMS A;  4ON0 A;  1KGS A;  1RIO H;  2IP2 A;  2GXB A;  1G3W A;  3MFK A;  4WXD A;  2IA2 A;  1J7K A;  4CYD A;  2XRO A;  4BAY A;  4MQ9 F;  1MGT A;  4IHS A;  1HQC A;  3E5U A;  4ZYE A;  1IW7 F;  2X4H A;  2QBY A;  5D6F A;  4KN4 X;  4ENM A;  2GAU A;  4PGH A;  4BHP A;  3H3U A;  4ENJ A;  4BH9 A;  3LA2 A;  4OU0 A;  2HDC A;  4KN7 X;  1XGM A;  2ESH A;  2W24 A;  2HEO A;  2ADU A;  1YG2 A;  2VBX A;  2RGV A;  4KDP A;  2V79 A;  2CSO A;  2EA2 A;  2PJP A;  3KP4 A;  4UV8 A;  4M71 A;  1P2F A;  4P55 A;  2PN6 A;  5J8C A;  3NRV A;  5FLX Z;  3U9G A;  3B73 A;  1PUE E;  5JHU A;  2WWY A;  1BM9 A;  2R3S A;  3WU1 B;  4HOB A;  1R23 A;  3ZMU A;  2ZXJ A;  5FLX K;  2UWM A;  1SMY F;  4GO1 A;  2Z3Y A;  1FWZ A;  2W84 A;  3FM3 A;  5EEH A;  3F8C A;  2LSO A;  3D5L A;  2J5P A;  1FYM A;  1Z91 A;  1NHA A;  1G3S A;  4GYI A;  3WTS C;  3HOT A;  3K9T A;  3OOP A;  4KMU X;  1MZB A;  1YS7 A;  2XAS A;  2YSR A;  3JW4 A;  2STT A;  2D45 A;  4A12 A;  3CO7 C;  2BYV E;  3FX3 A;  3JTG A;  1O3Q A;  3FXQ A;  1HBX G;  3IC7 A;  2QQB A;  5D4R A;  2XGX A;  3ECH A;  3IWF A;  4G9Y A;  1RUO A;  1MDM B;  4ZYD A;  1LEB A;  2L4A A;  4ESJ A;  1BC8 C;  2YX4 A;  2OQR A;  1I1G A;  2O3F A;  1R7J A;  1KU9 A;  3F22 A;  3Q9V A;  2OA4 A;  1TW3 A;  3LST A;  1XCB A;  4XRF A;  5LRS A;  3KE2 A;  2XRN A;  3QRF F;  1FBQ A;  1OYI A;  3FXR A;  3M9A A;  5DEQ A;  2ZBK A;  5J8F A;  1V3F A;  2FEZ A;  4Y13 A;  1JXS A;  4G8X A;  2FMY A;  1HKQ A;  2K27 A;  3LQQ A;  1I1S A;  1FBU A;  4MTE A;  4FT8 A;  3KCC A;  1TNS A;  1MJ9 A;  2NYX A;  1E17 A;  1HXD A;  5CVR A;  1XDS A;  5KVR A;  1S7A A;  4ZYH A;  1S8N A;  4OIO F;  2HR3 A;  3HRM A;  4YFX F;  1ZAR A;  2COM A;  1DPR A;  1YW8 A;  1ZRC A;  3IKV A;  3VOE A;  3ISP A;  2QYO A;  2NAZ A;  1G6N A;  2YU3 A;  2V1X A;  5LEJ A;  3P9C A;  1R5G A;  1P4X A;  1L3L A;  1IXS B;  5FGM A;  4EGY A;  2CWE A;  2BE5 F;  1BOA A;  2Z5U A;  4EM2 A;  3M1E A;  5ICE A;  1MJA A;  1LDJ A;  3GEZ A;  4XLP F;  3C3W A;  5L3F A;  1SFU A;  4WK8 F;  1BN5 A;  5CLS A;  4UNO A;  4R8H A;  5FFX A;  3FZV A;  3HSR A;  4ESF A;  4U0V A;  4LJZ F;  1IRF A;  5DCF A;  3KLN A;  5ICF A;  4A5M A;  2LF7 A;  5DCM A;  1ZG3 A;  1B9N A;  5CYV A;  3FM5 A;  4S05 A;  1OYY A;  5D5V B;  2ZNY A;  2HQN A;  2K4B A;  3NQO A;  1H0M A;  1MDM A;  2QQA A;  2WTE A;  4I02 A;  2FA5 A;  4MNU A;  5L3E A;  1DPU A;  5IT9 Z;  2R7D A;  1P6R A;  2RNJ A;  4S04 A;  1GXQ A;  4RAZ A;  1REP C;  4EQQ A;  1BBY A;  3GFL A;  1J59 A;  1BC7 C;  2ZNZ A;  1Z6R A;  1MKM A;  1P4A A;  5CVI A;  4I0B A;  3F23 A;  2RQP A;  3HRS A;  4EVI A;  3T1B A;  4KMF A;  1SD6 A;  3M8E A;  1R36 A;  5KK1 A;  2CO5 A;  5FD6 A;  1F1Z A;  2OAZ A;  2H27 A;  1BI1 A;  3DP7 A;  3DPL C;  1QPM A;  2A61 A;  3N4M A;  2YX7 A;  4FHT A;  1ZG5 A;  3BY6 A;  4GCV A;  2ZFW A;  4HQM A;  2ZCW A;  4ZYG A;  4LK0 F;  2FSW A;  1T98 A;  2W57 A;  2VBW A;  1HSJ A;  3SHF A;  1LVA A;  1R58 A;  5LGN A;  2ZJ2 A;  3I58 A;  2K86 A;  1ZAO A;  2ELH A;  5L3D A;  4RB0 A;  2QWW A;  2EV5 A;  4RGX A;  4MGR A;  1T6S A;  4N0B A;  3ELK A;  4K2E A;  4G7O F;  5HOO A;  3ZP5 A;  3E6C C;  4UVC A;  3KET A;  2QEN A;  1XSX A;  4RGR A;  3DQV C;  4B8X A;  2GA2 A;  3J81 Z;  3F8M A;  1X3U A;  1LQ1 A;  4LGW A;  4U7B A;  2G9W A;  2VC0 A;  1Z6T A;  1H9G A;  3TO6 A;  1XMA A;  4U88 A;  2EB7 A;  3L7W A;  3T8R A;  2V1U A;  3JAM Z;  2HTJ A;  4A0X A;  4MEX F;  3KP3 A;  2PG4 A;  3I0T A;  2PI0 A;  3GO5 A;  3S2W A;  1XGO A;  1C0W A;  1ZRF A;  4L5I A;  1W7P D;  3O6B B;  2GZW A;  1D3Y A;  1I27 A;  4UV9 A;  5D5U B;  3FMR A;  5TJJ A;  4Y15 A;  1G3Y A;  5F6F A;  2HWV A;  3K2Z A;  2CGP A;  3BZ6 A;  3GF2 A;  3ABU A;  4ZZL A;  2QBY B;  3R0J A;  2FXA A;  1R5H A;  1FZP B;  2D1V A;  4CO8 A;  2MLG A;  4IRH A;  5HDK A;  4G6Q A;  2K4J A;  2V9V A;  5BMZ A;  4KA4 A;  1SFX A;  4HF2 A;  1VTN C;  5LHG A;  4KIB A;  3TDZ C;  4LLG F;  3OV8 A;  2FU4 A;  2CYY A;  2JRT A;  4GXO A;  3E6M A;  3GWZ A;  2Y48 A;  3V8L A;  4A5N A;  4IJA A;  3VOD A;  1UST A;  3I5U A;  1LEA A;  1TQP A;  5BQT A;  2OBP A;  4O6J A;  1KYZ A;  4G6D A;  4EJO A;  5H6R A;  2FBK A;  1KQ8 A;  5CJ9 A;  2QVO A;  1T2K A;  2H6C A;  2NNN A;  3KFW X;  1LNW A;  3Q9S A;  1BI3 A;  2RV8 A;  3TOA A;  3F8B A;  5F64 A;  3V7S A;  2A68 F;  2EV0 A;  2VOD A;  4OMY A;  1YW9 A;  1IUY A;  4KUM A;  2VXZ A;  2VE9 A;  4U7D A;  4DQ2 A;  2HOE A;  2FOK A;  2L4M A;  5HS9 A;  2KIF A;  3GFM A;  5E1X A;  3ULQ B;  3HRT A;  4N9H A;  4Y17 A;  4I01 A;  5IT3 A;  4LK1 F;  3LAP A;  1LDK B;  5DDG A;  4YG2 F;  2KJB A;  5D6E A;  1IXC A;  3GLX A;  5JFR A;  2FF4 A;  3HOS A;  3HHG A;  5FFZ A;  1FT9 A;  2IJL A;  3K1M A;  1STZ A;  2XUB A;  4WX9 A;  2KIM A;  4AIK A;  1RUN A;  2YPR A;  4D0P A;  3COA C;  1I6X A;  4JBA A;  2DU9 A;  4H0E A;  3I59 A;  1K6O A;  4KIG A;  2EV6 A;  3KP7 A;  1FPQ A;  3Q5F A;  2ZME B;  2CFX A;  3CDH A;  5ILV A;  1WSU A;  2VOO A;  4WF2 A;  3MWM A;  1HW5 A;  2OD5 A;  4HF0 A;  5L3C A;  3WTY C;  3MCZ A;  3GUD A;  3E6D A;  4M9S A;  2UZK A;  2LF8 A;  2IPQ X;  4BHC A;  5ERI A;  1B6A A;  3GZ5 A;  1ZHF A;  3BOQ A;  1E2X A;  1DP7 P;  1UFM A;  2M1B A;  4LFU A;  2MC3 A;  4ASN A;  1LB2 A;  2G7H A;  4KFC A;  3TO7 A;  1WKM A;  2DI3 A;  3FWE A;  3I64 A;  2A6E F;  1QQI A;  4M6Y A;  1R1T A;  2WV0 A;  3WE2 A;  4ENN A;  4WWC A;  1TQM A;  1HKT A;  2XIG A;  3IRQ A;  1HW1 A;  3SXY A;  5LGU A;  2OZU A;  3WGI A;  2A5Y B;  3RTR A;  3HTS B;  2L02 A;  3U1D A;  5CVV A;  1F9N A;  3D0S A;  2QLZ A;  3ZMT A;  2IVM A;  3TOB A;  2JTV A;  3CUQ B;  3QP5 A;  2UXX A;  3IRR A;  1KA8 A;  4AD9 A;  4E70 A;  4M72 A;  2P8T A;  3F21 A;  4BYY A;  3BPX A;  3M7G A;  3V8K A;  6PAX A;  1R1V A;  4ENK A;  2JZY A;  5DCM B;  3NEU A;  1D8J A;  1G4D A;  1XGS A;  3WTX C;  1FYL A;  2EJR A;  4U0Y A;  2Q2E A;  5CVJ A;  3EUH A;  2QZ8 A;  2ZME A;  2MH2 A;  1QO0 D;  3ZMD A;  4HLX A;  2FBH A;  1TNT A;  2HZT A;  2NNY A;  1ZRD A;  3WGH A;  1EH6 A;  3RKY A;  2MA3 A;  4G94 A;  4LD5 A;  4TV7 A;  1W7P B;  5K1Y A;  2HFH A;  2P5K A;  4LG0 A;  5FO5 A;  4I0A A;  1UB9 A;  3C7J A;  3MQ0 A;  4CHU A;  3ZMS A;  3RKW A;  2P7V B;  1XSV A;  3W6J B;  5JVT A;  1S29 A;  3L9F A;  2CW0 F;  4P9F A;  3CJN A;  3ZQ7 A;  2PFB A;  5A2Q Z;  2EWN A;  1ZRE A;  1IAW A;  3C1D A;  4BQA A;  1J9I A;  4R1H A;  1P92 A;  3WTV C;  3HSF A;  2FBI A;  4A6E A;  5BPD A;  5A2Q K;  5K5Q A;  1O7F A;  4YII A;  3HRU A;  3CUQ A;  2PBI A;  1XCV A;  5HDN A;  1JE8 A;  3LQR A;  1KYW A;  5D5W B;  1UHW A;  3K0L A;  4P96 A;  1U5T B;  4NHJ A;  2XKP A;  5LHI A;  2P6T A;  4UVA A;  3BP8 A;  4M73 A;  1D5V A;  3EET A;  2R7F A;  1FYK A;  1ZYR F;  1MD0 A;  4ETS A;  4F7Z A;  3T8T A;  2XVC A;  3CO6 C;  3R6S A;  3L09 A;  1FNN A;  3TO9 A;  4OOI A;  1QZY A;  1HKS A;  2C6Y A;  2XAJ A;  2F2E A;  1TLH B;  2P5L C;  4HLY A;  5IT9 K;  1W7P A;  1ZGJ A;  3TQN A;  4L9J A;  3KZZ A;  3I54 A;  4OIN F;  2FNA A;  2IA1 A;  4Q48 A;  2L01 A;  4HA8 A;  5ICC A;  2H94 A;  3P9I A;  3GYH X;  2DTR A;  1ZG1 A;  3ZPL A;  3HHH A;  2JT1 A;  3ABT A;  4B09 A;  1KQ0 A;  5K5R A;  4RGU A;  4M74 A;  3REO A;  2KIU A;  3WGG A;  4IVN A;  2UXN A;  1QBJ A;  4P5O A;  1IN5 A;  1YIO A;  2M87 A;  1QGP A;  2GA1 A;  2IRF G;  2DK8 A;  2VON A;  4O5V A;  1OMI A;  2YR2 A;  5E17 F;  3FMQ A;  1D8K A;  2M5W A;  4Q47 A;  3K1P A;  4O3M A;  1YFH A;  4KYW A;  3ZMZ A;  1IN7 A;  2QQ9 A;  1TTY A;  4QLC U;  1SD7 A;  1U5T A;  1B9M A;  3DPT A;  2GXG A;  3GVA A;  3J81 K;  2DAO A;  2XAH A;  3J7A O;  2DO7 A;  5CVU A;  3SFZ A;  2MLK A;  2Y0M A;  1W4M A;  2OQG A;  4ZZD A;  4AVP A;  2B0L A;  3F72 A;  4OIR F;  4AIH A;  1YS6 A;  1W5T A;  3JAM K;  3I53 A;  4L5J A;  3PQJ A;  3I59 B;  1KU2 A;  1Q1H A;  1XMK A;  3BJ6 A;  2M45 A;  3TKY A;  3HSE A;  2E1N A;  3WTW C;  1XSD A;  3H92 A;  3GZ6 A;  1BI0 A;  1RI7 A;  3BDD A;  4I7H A;  2O6G E;  5HDG A;  2EFN A;  3T0Y A;  1J75 A;  4XSX F;  3V4G A;  2L3D A;  1T38 A;  4LB5 A;  1U2W A;  5E1Z B;  2O0Y A;  5E18 F;  2RN7 A;  4YFK F;  2H6B A;  1IXR C;  3QU6 A;  1HST A;  1J5Y A;  4KT5 C;  5LLQ A;  2Q8K A;  2DQR A;  2FRH A;  3RYP A;  4OIQ F;  4UVB A;  1TQI A;  1LJ9 A;  2HS5 A;  3RI4 A;  4OIP F;  4WCG A;  2JSC A;  3MZY A;  4I98 B;  2IA0 A;  5E8G A;  2BEO A;  1IF1 A;  3KP6 A;  4EJU A;  4MTD A;  3FXU A;  3E3V A;  1L0O C;  1T0F A;  3QPT A;  2H09 A;  3GXO A;  2F5C A;  3E5Q A;  4RB2 C;  1ZLJ A;  2XV4 S;  3ROU A;  4HYE A;  3B02 A;  5FB2 A;  2Z33 A;  2OZ6 A;  1PP8 F;  4FX4 A;  4IRI A;  2XAQ A;  1FSH A;  3TDU C;  3WG9 A;  3F6O A;  4U0W A;  4HAM A;  5ILS A;  3RDI A;  5E8I A;  5LRR A;  4HQE A;  4UXN A;  1ULY A;  2Y75 A;  4EGZ A;  3F8F A;  1R00 A; 
#chains in the Genus database with same CATH topology
 2F4M B;  3KEQ A;  2VJI A;  5FKN A;  4XRM A;  2CFO A;  1T8I A;  3JSO A;  4BUP A;  1KU7 A;  3BJO A;  2KRF A;  4F52 A;  3HUG A;  1X19 A;  3ABK H;  3M8F A;  2XB0 X;  1YLF A;  2V9K A;  2ZO4 A;  4YRV A;  4D5F A;  3BRO A;  1Z77 A;  2E5Z A;  1EJ9 A;  2Q2E B;  3GZN B;  2RDP A;  3K69 A;  1SD4 A;  2ZXH A;  5E1W A;  4CIC A;  4PJJ A;  1AU7 A;  1I6H J;  1GHC A;  3HYI A;  3ECO A;  3S32 A;  2CQX A;  5FKO A;  3SFI A;  3BPV A;  2ZJQ F;  3FHZ A;  1U6G A;  5C4X J;  2WAF A;  2KLO A;  4A93 J;  4FX0 A;  4HV5 A;  5M5Y J;  2LFB A;  2YUS A;  1RKW A;  1QNT A;  5H6Q A;  1U8R A;  4A3K J;  2CUF A;  2O9L A;  1WQ2 A;  3KZI C;  1BIA A;  3J7Z I;  3DLL F;  3VFZ A;  1POG A;  1YYV A;  4M9X A;  4FTH A;  1ZK8 A;  3MAJ A;  4L9V A;  4Q4Z F;  2ZXW H;  4UY8 I;  2X85 A;  5E3L A;  4LG0 B;  3DFG A;  1ENH A;  4MO7 A;  5DYM A;  2OF7 A;  3DKW A;  2OUM A;  3LA3 A;  1QZE A;  4LOC A;  3VB2 A;  2ZKZ A;  4EM0 B;  1VQP I;  5B66 C;  2X1C A;  3J80 Z;  3CMA I;  3QAH A;  2W85 A;  1FTZ A;  2LKX A;  1WWX A;  2X6W A;  1BJA A;  5EGO B;  1Y6I A;  3CUO A;  1KU3 A;  1Y1W J;  1Z7U A;  3QPH A;  2JVH A;  1ZR2 A;  1FOK A;  3L00 A;  3AG3 H;  1NH3 A;  5ICG A;  2VQH A;  5JHF A;  2NVQ J;  2EIL H;  5E20 A;  4YIF A;  4IF4 A;  2PMH A;  2V26 A;  2DT5 A;  1B8I B;  3FXJ A;  2RC4 A;  2L9R A;  2PMZ A;  3MKY B;  4OMZ A;  2CRG A;  4JX5 A;  4BDY A;  2O8X A;  2VJ4 A;  3OIO A;  3J80 K;  1B59 A;  2Q0O A;  3PJR A;  2A5W A;  2JRM A;  4UUS B;  2AXL A;  2DOE A;  5DUK A;  3AAF A;  1V5E A;  1X1B A;  3M3Y J;  1Z9C A;  2QUF A;  1MMN A;  3CJR B;  1NK2 P;  1FP2 A;  2X6O A;  1U3E M;  5EDN A;  4MHG A;  4E4H A;  2BGC A;  3RPQ A;  2DYR H;  2M8E A;  1PP7 U;  4GGG A;  4X1E A;  4IHT A;  2B7E A;  5LHH A;  2QCO A;  1IDY A;  2Z99 A;  3LSI A;  3LWF A;  1GVJ A;  2BXY A;  2VN2 A;  4JQF A;  3RPU A;  3TW7 A;  2BXZ A;  3L2V A;  4D1Q A;  1CGP A;  4PJN A;  1OKR A;  2H1K A;  2XAF A;  3DBH B;  3QOP A;  1WRJ A;  3LSM A;  3VEP A;  5HS8 A;  3VYS B;  3WTU C;  2VBZ A;  1IC8 A;  2HYG D;  2AQF A;  3BLY A;  1O3S A;  2EK5 A;  2XSJ C;  3R60 A;  3H9J A;  3WTZ A;  3DKY A;  1VQL I;  1GV5 A;  3W6K B;  2W00 A;  4I2O A;  4EV0 A;  4KIC A;  4LIT A;  3TGN A;  2K40 A;  3K4L A;  4IRG A;  3RYR A;  1H9T A;  2KZV A;  1MH3 A;  2DOF A;  4W1U A;  4BQO A;  4KIT B;  2L9N A;  3K7A J;  3PNT A;  4HBL A;  4HF1 A;  1ZGA A;  1XD7 A;  2HXO A;  3ML6 A;  4IXA A;  5K7H A;  1I50 J;  2QA4 I;  4HX7 A;  4ESB A;  2K9S A;  4EJW A;  1TBX A;  2KQR A;  2AQE A;  2KJC A;  5EEG A;  1ON2 A;  3L2U A;  4XMY A;  5B1B H;  5AON A;  1FLI A;  3S16 J;  2VT2 A;  4HV6 A;  4M9Z A;  2QEX I;  4CGZ A;  1HA8 A;  5IY5 H;  1U5T C;  2VBY A;  2AHQ A;  3K4B A;  1ON1 A;  2VOP A;  1R22 A;  2EFW A;  1VQM I;  3W2V A;  1X3Z B;  1SD5 A;  3T5X A;  2B63 J;  1WHU A;  1O3T A;  1IO2 A;  2F5E A;  1YX3 A;  2FQ3 A;  5ED4 A;  3IKT A;  1W5S A;  5F1R A;  3N05 A;  5D8L B;  2JPC A;  2M0C A;  1EH8 A;  5K5O A;  1YJW I;  1PVE A;  2ISY A;  2NOG A;  4RB3 C;  1MBJ A;  4B1R A;  3H3Z A;  1UAA A;  3BC8 A;  2ETH A;  2DPD A;  2R7S A;  3SZT A;  4BHB A;  3DEU A;  2K7L A;  1EV7 A;  2PEX A;  1VQ9 I;  4XKC A;  3QWL A;  4G7Z F;  1SFE A;  1QPI A;  3HEF A;  3KZY A;  2EFP A;  2G0E A;  4F55 A;  2OU2 A;  1BIB A;  2M4K A;  2EA4 A;  4GRI A;  4CZZ A;  4RAF A;  1UHM A;  2DA4 A;  3FF5 A;  5HVQ C;  4BNC A;  4DZJ A;  2O8K A;  5FD5 A;  4L5E A;  4A0Y A;  3CTA A;  4GYG A;  2ZB9 A;  2LC2 A;  5EGO A;  3PQK A;  2QSF X;  2PLY A;  2H1L A;  4HW0 A;  1R1U A;  1JUS A;  4M3F A;  3IAS 2;  4IHX A;  3ZN1 A;  2M4G A;  1FTT A;  1FY7 A;  2QF7 A;  3JRC A;  4R79 A;  3DU6 A;  2JWT A;  2KIQ A;  3BR1 A;  2MSY A;  3CP2 A;  1TZL A;  2FJ1 A;  2FML A;  4WXC A;  4A6D A;  1B8I A;  4JK1 X;  1F4K A;  1XN7 A;  4P9U A;  2V7F A;  4RMN A;  4BXU A;  3H1C A;  3AL0 B;  5HLI A;  3W2W A;  1OCP A;  4MEY F;  2VE8 A;  5LEK A;  3N97 A;  1DUX C;  2ZXI A;  3GX4 X;  2LH9 A;  4XLN F;  1FP1 D;  4BGD A;  3JTH A;  2A6T A;  4RM3 A;  3BWG A;  1OLT A;  4PGG A;  4FIS A;  2V6C A;  2A3S A;  3HKZ N;  4B3X A;  2HTS A;  5JR3 A;  1YTY A;  3A0H C;  1TWH J;  4CUG A;  2NS0 A;  2IEK A;  4EJV A;  2E7X A;  2K9M A;  5F0C A;  4G12 A;  4A3C J;  2OTJ I;  1K79 A;  2P6S A;  1TWC J;  3G3Z A;  4NC8 A;  1XDU A;  2LY1 A;  1D0Y A;  3P5J A;  5EZH A;  3HOW J;  2Z1D A;  1U8B A;  3TP0 A;  5JLX A;  1QZZ A;  1TC3 C;  2L0K A;  2K9L A;  5GAE J;  4E6K G;  1IN4 A;  2OJE D;  4A2U A;  3GCM A;  1EF4 A;  1VND A;  3K1N A;  3ERE D;  3H5N A;  4AIJ A;  2OV7 A;  4CCM A;  5B1A H;  4EMS A;  3F8N A;  2DMQ A;  1O57 A;  9ANT A;  2K3F A;  1FC3 A;  4WXH A;  3DPU A;  3IH2 A;  4A0Z A;  4BQN A;  3H36 A;  4BY1 J;  3NWT A;  4M3G A;  2LNB A;  4HNT A;  2XRL A;  5HS7 A;  3F9K A;  1ZKG A;  4F3Q A;  1CF7 B;  2R92 J;  1HDD C;  3HOU J;  3S3O A;  1X1P A;  2E19 A;  2KKO A;  5H20 A;  2MFZ A;  3C18 A;  4Q5S F;  4PCQ A;  2LRD A;  1ONV A;  3U2R A;  3EYY A;  2NXN B;  3DBL B;  1FX7 A;  1BI2 A;  5LBQ A;  4L9T A;  4XKB A;  2QKM B;  1USS A;  3KEO A;  5E79 C;  2HPM A;  3IP4 B;  1V4R A;  2QM3 A;  2RKH A;  2L9S A;  2CS3 A;  3OR1 C;  1YE9 A;  1D1C A;  1XG1 A;  2LY9 A;  4IPA A;  2G7U A;  1YIT I;  2XAG A;  2I10 A;  2HI3 A;  2STW A;  3KLO A;  3JRH A;  4NQW A;  3FXL A;  1F5T A;  3ZMV A;  2BBY A;  2DLL A;  3V8J A;  4X0G A;  3OYH A;  2DW4 A;  1RZ4 A;  4RAY A;  3EQL F;  1U9N A;  4E7L A;  1J2X A;  1S3J A;  1OPC A;  4HDV A;  2EZL A;  4ZH4 F;  3IHU A;  1EH7 A;  4RGS A;  2X0L A;  3W2A A;  2JK3 A;  1QVT A;  2QSH X;  1J0R A;  3A4C A;  1ZN2 A;  1B1B A;  3WTT C;  4KNY A;  3CCM I;  3MMY B;  5DUI A;  2X6Y A;  2D1H A;  1PJR A;  4BKX A;  5TRD A;  2TCT A;  3G4S I;  2XC7 A;  3DXJ F;  5CQG A;  5C3E J;  3H35 A;  3PNY A;  1B72 B;  3I4N J;  4RBO A;  5D8K B;  2XPV A;  2ACJ A;  5D4S A;  4RS8 A;  3KX2 A;  3KP5 A;  1LDD A;  3F3X A;  3LNQ A;  2DDA A;  2VC1 A;  1QU3 A;  5J6X A;  2AS5 F;  2ZJP F;  2VPR A;  4AWX B;  4PFP A;  1ORK A;  1Q1V A;  1TW2 A;  2F5F A;  3BR0 A;  1JUP A;  2ZSI B;  3K2A A;  3U21 A;  4BJ6 C;  1ZH5 A;  2BY1 A;  1G59 A;  1J09 A;  3HG9 A;  4HRI A;  5F0F A;  3HXL A;  1Z1D A;  3H5R A;  5DS9 A;  4XSZ F;  3SZP A;  3BR2 A;  1R4M B;  5HLH A;  2A69 F;  1IZ1 A;  1O3R A;  1AOY A;  3R61 A;  4RM2 A;  4XKW A;  3WU0 A;  3LA7 A;  3G73 A;  3TED A;  5FLV A;  1AWC A;  1YQA A;  4V2G A;  2ME6 A;  1Y8Q B;  4F91 B;  2NRA C;  2E2H J;  3HTU A;  3WE3 A;  5GAG J;  1DU0 A;  1E3O C;  2WAE A;  4XKV A;  2AXT C;  1G3T A;  1IRG A;  5C4J J;  1UCR A;  3I4P A;  4XR6 A;  5DD4 A;  1PDN C;  4HX4 A;  3RQ4 A;  2EFQ A;  1MSF C;  3ZN0 A;  5BPI A;  1SAX A;  3Q0W A;  2CG4 A;  3KP2 A;  5IP9 J;  3GTO J;  4HZF A;  5LGT A;  3DV8 A;  1K83 J;  2FNP A;  5FKL A;  4GFB A;  4M6X A;  5BS6 A;  2GIV A;  2LKP A;  2M30 A;  2M3A A;  5F0H A;  1PYV A;  3OIP A;  1IN6 A;  2V1D A;  4EAT A;  4C2M J;  1FBS A;  4MLO A;  3BR5 A;  4YEJ A;  3SYT A;  3AG2 H;  2M9H A;  3GFJ A;  1GXP A;  2IT0 A;  5HLG A;  3P9K A;  4ZJZ A;  2MH9 A;  2W48 A;  3G1L A;  1XGN A;  3W6V A;  5L3G A;  2BZT A;  4LLL A;  1CF7 A;  1G2H A;  1K78 B;  1FSE A;  3O3K A;  2JQ7 A;  1JGS A;  1I3A A;  3E5X A;  4G6T B;  2DPU A;  3TL4 X;  3HDD A;  4BL0 B;  2DK5 A;  4BY7 J;  2LBF B;  1JHH A;  4LLN A;  2HVR A;  2K02 A;  3HZJ A;  2GWR A;  1K6Y A;  1RNL A;  4QWQ A;  4HX8 A;  1OIS A;  4XLF A;  3IWZ A;  1T08 B;  4IZZ A;  2DN0 A;  5DV5 A;  4PZJ A;  4PDK A;  2HOT A;  1VQN I;  4IOC F;  3QP6 A;  5J1R A;  1DU6 A;  1ODD A;  2JPB A;  2PMU A;  3RIR A;  3I71 A;  1ZLK A;  1S6L A;  2ZFU A;  2VB6 A;  2ISZ A;  1WH5 A;  3UKG A;  4EJT A;  2BV6 A;  3DU5 A;  4CXF A;  3BJA A;  1JHF A;  4QPQ A;  2K85 A;  4DNC A;  1QHH D;  1YO5 C;  2ESN A;  2HGC A;  3E1S A;  2GQQ A;  1OR7 A;  5DM6 F;  1ETQ A;  2VT3 A;  3SQN A;  1LVK A;  3E6B A;  4HG2 A;  4A3F J;  3LAJ A;  3SEZ A;  3PSI A;  1HW2 A;  3RJP A;  1DDN A;  1MJB A;  2HKX A;  2R7Z J;  4N9I A;  2Y31 A;  1K7A A;  4I09 A;  2DMT A;  5GPC A;  1NK3 P;  3EUH C;  4G7H F;  2WC2 A;  2F6C A;  1F43 A;  1P4W A;  3JSP A;  3KYC B;  3G2B A;  4RLF A;  1RRJ A;  1A5J A;  2R4G A;  2XSD C;  1O7L A;  3MZH A;  4P1W A;  2W25 A;  3AG4 H;  2MGQ A;  5BOX A;  2H8R A;  4XOR A;  5AIP A;  1BR2 A;  1OJL A;  1WI9 A;  2PQ8 A;  3LFK A;  2E7W A;  2LDU A;  3CLQ A;  5AIQ A;  5ILU A;  2Z9O A;  4A3L J;  2F5D A;  4OWR B;  3EYI A;  1IV6 A;  3BG9 A;  3K4M A;  2DFI A;  3O2P E;  4A3E J;  2D2W A;  2BY2 A;  4KIF A;  4YFN F;  4XN3 A;  5D5X B;  4Y4R A;  1I5Z A;  4HDU A;  3GFI A;  2P7C B;  1Y56 A;  2P4W A;  2P81 A;  3HIF A;  1GT0 C;  1KQ9 A;  2XKO A;  4MQV A;  3V7R A;  5GAD J;  5K7Z A;  3HGG A;  2IS1 A;  3QU3 A;  5B5E C;  1WJC A;  3M4O J;  2DA6 A;  3ABM H;  2A07 F;  2OC6 A;  3R4K A;  4CDG A;  4IOA F;  5E3M A;  5DD8 A;  3QYF A;  1ETW A;  2CQ7 A;  2MAB A;  3OWT A;  4RB1 A;  4XBF A;  4BQQ A;  3PIO F;  4AC0 A;  3OMY A;  3RKX A;  2RVC A;  2HYF A;  3E97 A;  3VYU B;  3GW2 A;  2EFO A;  1S7E A;  2MG4 A;  1XB4 A;  3R0A A;  3OYM A;  2DBB A;  2FE3 A;  1WFX A;  2DQL A;  2IW5 A;  2JUG A;  3WOD F;  4NUB A;  1MIJ A;  2XHK A;  2F48 A;  3L2C A;  1T39 A;  4LG3 A;  4FE7 A;  2P5V A;  3Q3S A;  4L18 B;  4NB5 A;  5JI6 A;  3MEX A;  4N4O B;  1SMT A;  3FHN A;  3M1C A;  3F6V A;  3EDP A;  2CH0 A;  2O03 A;  3C2G A;  3BZK A;  3IL2 A;  2HKO A;  1Z05 A;  1YIJ I;  1WI3 A;  1ZQ3 P;  4A3J J;  4UHT A;  3CUQ C;  2QGU A;  4L0Y B;  2KPM A;  4LMY A;  4L0Z B;  3C2H A;  4ABZ A;  1Y0U A;  1NTC A;  3CP8 A;  3DF8 A;  3FKI J;  1S7O A;  4EM1 A;  1K78 A;  4UUV A;  2TDX A;  1EA3 A;  3PFI A;  3CLO A;  2DA2 A;  2MBF A;  2MD5 A;  1U78 A;  1WJB A;  2HQR A;  1N75 A;  1YW7 A;  1IN8 A;  4LB6 B;  3S15 J;  4XRS G;  4L9N A;  2EQR A;  2O61 A;  2X1D A;  1B4A A;  3AG1 H;  2E2J J;  2BHY A;  1OYW A;  1Y1V J;  3V7C A;  1LE8 B;  5L3B A;  4FET A;  1A04 A;  2L54 A;  4Z2Y A;  2E1C A;  3S2D J;  3P7N A;  2JSP A;  2J5O A;  2CQK A;  3FMS A;  4ON0 A;  1KGS A;  1JUM A;  3RQI A;  2VQC A;  4BS9 A;  1W0T A;  2LR8 A;  2DDB A;  1RIO H;  3O8H A;  4B43 A;  3JRE A;  1JKR C;  5KNL A;  2IP2 A;  2GXB A;  1G3W A;  3MFK A;  2ZSH B;  3M8J A;  1IUF A;  4WXD A;  2GBY A;  2IA2 A;  2JA5 J;  2LP0 A;  1J7K A;  4CYD A;  1X58 A;  4B4C A;  2CUJ A;  1OQY A;  2XRO A;  2VL8 A;  4BAY A;  4MQ9 F;  3OYI A;  1MGT A;  4IHS A;  1HQC A;  3E5U A;  3X2Q H;  3ZR8 X;  2M2E A;  3K6G A;  3ZCO A;  1FJL A;  2GLO A;  2L7K A;  3VDX A;  3BR3 A;  4ZYE A;  1IW7 F;  2X4H A;  4JP0 A;  2QBY A;  2RAE A;  5D6F A;  2DMP A;  4IL6 C;  4XN0 A;  4KN4 X;  4LIU A;  1DQU A;  4ENM A;  1UG0 A;  3EPZ A;  2KHM A;  2GAU A;  1JKO C;  4PGH A;  4AVZ A;  2E2I J;  1S5L C;  4BHP A;  3H3U A;  4AID A;  2KIS A;  4N4N B;  4XLE A;  2R5Z B;  4ENJ A;  4BH9 A;  3LA2 A;  4XID A;  2XGE A;  2R93 J;  4OU0 A;  2NVU B;  4KN7 X;  2HDC A;  3A2K A;  3RCO A;  1XGM A;  2ESH A;  2W24 A;  2HEO A;  2W82 A;  2ADU A;  5IP7 J;  1YG2 A;  4NC7 A;  2VBX A;  3DBR B;  3G71 I;  2RGV A;  4KDP A;  2V79 A;  2CSO A;  2EA2 A;  2PJP A;  3KP4 A;  4I99 C;  2P0W A;  4UV8 A;  2FOW A;  1N25 A;  4M71 A;  4C2U A;  1P2F A;  3PO2 J;  4P55 A;  3AL0 C;  1SFK A;  1KON A;  2PN6 A;  5J8C A;  4ZDP A;  5IYD J;  3NRV A;  3PM1 A;  1YX5 A;  5FLX Z;  1W36 D;  4PJM A;  1HF0 A;  2IS6 A;  3QYE A;  2DA7 A;  3S8P A;  2GIZ A;  3HPG A;  2Z2S B;  1XS9 A;  4V2F A;  1ACI A;  1WJE A;  2WB1 N;  3U9G A;  3B73 A;  1LPQ A;  5CKT A;  1TWA J;  1IG7 A;  5JHU A;  1PUE E;  4XLH A;  2WWY A;  1BM9 A;  4DIQ A;  2R3S A;  3WU1 B;  4HOB A;  1R23 A;  3ZMU A;  2ZXJ A;  5FLX K;  1ZR4 A;  2UWM A;  4AM3 A;  1HOM A;  1SMY F;  1VFC A;  4GO1 A;  4ITV A;  4DOZ A;  2IS4 A;  4BE0 A;  4QSH A;  2Z3Y A;  1FWZ A;  2W84 A;  3FM3 A;  5EEH A;  3F8C A;  2LSO A;  2VAS A;  2IGN A;  3JCU C;  3D5L A;  1RET A;  2J5P A;  1FYM A;  2VI6 A;  2QKL B;  4Z6Y A;  3S93 A;  2X9D A;  1Z91 A;  1NHA A;  1G3S A;  1UG2 A;  4PFO A;  3WG7 H;  4GYI A;  4JX6 A;  5B3S H;  5FJ8 J;  2CJJ A;  1LE8 A;  3WTS C;  3CJT B;  3HOT A;  3K9T A;  2UUZ A;  2JVG A;  2MC4 A;  3E7L A;  3OOP A;  4KMU X;  1MZB A;  1YS7 A;  4AU7 A;  2N8G A;  2XAS A;  4I6Z A;  3ZXS A;  2YSR A;  3JW4 A;  2STT A;  2D45 A;  1R4N B;  4A69 C;  4A12 A;  1WJ5 A;  4BE1 A;  3CO7 C;  2BYV E;  3FX3 A;  3ASN H;  4IX7 A;  3JTG A;  4KJZ A;  1O3Q A;  3FXQ A;  3NWS A;  1HBX G;  2LYC A;  3IC7 A;  2QQB A;  1VI0 A;  5D4R A;  2ZC2 A;  3LSH A;  3D1N I;  2XGX A;  3ECH A;  3WU2 C;  4NQW B;  2ELK A;  3IWF A;  4IKF A;  4G9Y A;  1RUO A;  5J4Y A;  1MDM B;  3L2W A;  1RKT A;  3H9G A;  4ZYD A;  4FAS D;  2DT7 B;  2KP6 A;  4A3B J;  3FIW A;  1LEB A;  2L4A A;  4ESJ A;  3QOE A;  2ECB A;  1BC8 C;  2YX4 A;  5GPA A;  2OQR A;  1IDZ A;  1I1G A;  5EEA A;  2FQ4 A;  2O3F A;  1MBE A;  1MNM C;  1R7J A;  1LFU P;  4XOP A;  1KU9 A;  2KMU A;  2K9N A;  5IYC J;  3F22 A;  3Q9V A;  2OA4 A;  1TW3 A;  2Q1Z B;  1XCB A;  3LST A;  3BTL A;  4XRF A;  5LRS A;  3KE2 A;  2XRN A;  1TP4 A;  4QTR A;  4E7K A;  3QRF F;  1R6R A;  1FBQ A;  1OYI A;  1R5I D;  3GTG J;  3FXR A;  3M9A A;  5DEQ A;  3VYR B;  5M5W J;  2ZBK A;  5J8F A;  2R5Z A;  3B6A A;  3OY9 A;  1V3F A;  2FEZ A;  4PSW A;  4Y13 A;  1JXS A;  3MKZ A;  4EEF G;  2UV1 A;  4G8X A;  2FMY A;  3I4M J;  1HKQ A;  2K27 A;  3LQQ A;  1ERD A;  2Y9Y A;  3CC4 I;  1I1S A;  2L7F P;  1FBU A;  4MTE A;  2Z16 A;  4FT8 A;  3KCC A;  1TNS A;  3ZQC A;  1MJ9 A;  2JN6 A;  2F4I A;  2NYX A;  1W1W E;  2YS9 A;  4RDU A;  1E17 A;  1HXD A;  5CVR A;  4DW6 A;  1XDS A;  3SDG A;  1ETY A;  1S7A A;  2WY8 Q;  2XF7 A;  5KVR A;  4ZYH A;  1S8N A;  4OIO F;  2HR3 A;  3HRM A;  3M07 A;  1W5C C;  1APL C;  1GLN A;  4YFX F;  1ZAR A;  3H0G J;  3FBI B;  1PUF B;  2COM A;  2B9S A;  1O4X A;  2E1M C;  1DPR A;  1YW8 A;  3A02 A;  1ZRC A;  5KHD A;  3IKV A;  3VOE A;  3ISP A;  2QYO A;  4PSX A;  1A36 A;  2NAZ A;  1G6N A;  2YU3 A;  3GTJ J;  1AHD P;  3GTK J;  3OYA A;  3OS1 A;  2NVX J;  2V1X A;  5LEJ A;  3KYL A;  5BNG A;  2M7B A;  3P9C A;  1R5G A;  5FKM A;  4E7Z A;  1P4X A;  1L3L A;  3A0B C;  1IXS B;  1V55 H;  5FGM A;  4EGY A;  2CWE A;  2BE5 F;  1BOA A;  2Z5U A;  4HEA 2;  4EM2 A;  3UR3 C;  1V5F A;  1XX5 A;  1T0F C;  3M1E A;  2M7A A;  5ICE A;  1ETX A;  1MJA A;  2L5Q A;  3W3C A;  5IP6 A;  4YIR X;  4B3A A;  4PUS A;  4XLC A;  2LG4 A;  4H4K C;  5CQE A;  1LDJ A;  3GEZ A;  4DJA A;  2HDD A;  4XLP F;  1R49 A;  3C3W A;  2IGK A;  5L3F A;  1MBF A;  3WHB A;  1SFU A;  4Y52 J;  3PFY A;  1W36 C;  4WK8 F;  1BN5 A;  1MNE A;  2KRC A;  5CLS A;  4UNO A;  4R8H A;  2JA6 J;  2E1O A;  1VQ6 I;  3LSJ A;  4JX4 A;  5FFX A;  3DEW A;  2Y2Z A;  3FZV A;  3HSR A;  4ESF A;  5DM7 F;  4C2T A;  4U0V A;  4XLA A;  2CV2 A;  4FCY A;  5C44 J;  4LJZ F;  1Z7L A;  1IRF A;  3GTP J;  5DCF A;  3KLN A;  4BDZ A;  5ICF A;  2E36 A;  2E71 A;  4A5M A;  4HNU A;  2WB1 A;  1A31 A;  1JKQ C;  4XIC A;  3OL4 A;  4XON A;  2LF7 A;  2W4S A;  3HPH A;  1LFP A;  5DCM A;  2R7R A;  1ZG3 A;  2ID3 A;  3DTE A;  1B9N A;  4NDL A;  5CYV A;  3FM5 A;  2K9Q A;  1FOX A;  1I3Q J;  1X3W B;  3LFU A;  4S05 A;  4IQ4 A;  1OYY A;  5D5V B;  2E5N A;  2HOA A;  2ZNY A;  2HQN A;  2K4B A;  3NQO A;  1H0M A;  1YRN B;  1MDM A;  2QQA A;  2WTE A;  4I02 A;  2DFH A;  2FA5 A;  4MNU A;  5L3E A;  1DPU A;  5IT9 Z;  2FD5 A;  3CCV I;  5EZG A;  2EBI A;  3FXK A;  2R7D A;  4A3I J;  1P6R A;  2RNJ A;  2AO9 A;  2EH3 A;  3I3L A;  2O7O A;  4S04 A;  4CCO A;  1GXQ A;  5EJC A;  1WJD A;  3KEY A;  4RAZ A;  3CF5 F;  4EQQ A;  1REP C;  2VUM J;  3HL2 A;  1BBY A;  3GFL A;  2LRE A;  1X1A A;  1DGW Y;  3OS2 A;  1J59 A;  1BC7 C;  2ZNZ A;  1Z6R A;  2EPF A;  4FE4 A;  1FMV A;  2VKD A;  3CCS I;  1IGN A;  5FRO A;  1MKM A;  1P4A A;  5CVI A;  4U87 A;  2HOS A;  1MW7 A;  4I0B A;  3F23 A;  3GLL A;  3H3V K;  2RQP A;  3HRS A;  4EVI A;  1DGR M;  3T1B A;  3HC7 A;  5KAI C;  1R71 A;  3OYJ A;  4KMF A;  1SD6 A;  3PO3 J;  2DTZ A;  4ZDO A;  2JA2 A;  4BBS J;  3D5S C;  3CMY A;  3HOZ J;  3M8E A;  1R36 A;  5KK1 A;  2CO5 A;  5FD6 A;  1XTA A;  1F1Z A;  3F0C A;  2HZD A;  2OAZ A;  1MH4 A;  2H27 A;  1BI1 A;  1BA5 A;  3DP7 A;  1GDT A;  3DPL C;  1T33 A;  1QPM A;  2A61 A;  2FUG 2;  2Y0S A;  3OOU A;  3N4M A;  4A3G J;  2YX7 A;  1IJW C;  2NS7 A;  4FHT A;  3WHC A;  3BY6 A;  4GCV A;  3H0D A;  1ZG5 A;  1PUF A;  5FKK A;  2DJN A;  2ZFW A;  4MFE A;  3PIP F;  5GTI C;  4HQM A;  1GUU A;  3RZD J;  1ZEL A;  3HOY J;  2ZCW A;  4ZYG A;  4LK0 F;  1HCR A;  3LSK A;  5IPA A;  3HOV J;  2FSW A;  1P7I A;  1T98 A;  2W57 A;  2VBW A;  1HSJ A;  3S3N A;  3SHF A;  1LVA A;  1UMQ A;  1R58 A;  5LGN A;  1QVU A;  2ZJ2 A;  3I58 A;  2K86 A;  4NNJ A;  1ZAO A;  2ELH A;  5L3D A;  4ZC3 A;  4RB0 A;  4M3E A;  2QWW A;  2EV5 A;  4RGX A;  4MGR A;  1T6S A;  1UEL B;  4N0B A;  3ELK A;  4HST A;  4K2E A;  4G7O F;  5HOO A;  3ZP5 A;  2HYJ A;  3E6C C;  2NVY J;  4UVC A;  2W1O A;  3KET A;  2QEN A;  1UJ8 A;  1XSX A;  4RGR A;  1LKX A;  3OYK A;  3JRG A;  3DQV C;  4B8X A;  3L2R A;  3S1M J;  2GA2 A;  3J81 Z;  2CV0 A;  3F8M A;  1X3U A;  1LQ1 A;  4LGW A;  4U7B A;  2G9W A;  2VC0 A;  2IAI A;  1TT5 B;  2X6X A;  1Z6T A;  2F4O B;  1H9G A;  4PK4 A;  3TO6 A;  1XMA A;  3AKZ A;  4U88 A;  2EB7 A;  3L7W A;  4E7S A;  3T8R A;  2V1U A;  3JAM Z;  2HTJ A;  4A0X A;  2EZK A;  2GOM A;  4MEX F;  3KP3 A;  2PG4 A;  3FK6 A;  3I0T A;  3VWB A;  2I5U A;  1U9O A;  2PI0 A;  3GO5 A;  1MBK A;  3S2W A;  3MN2 A;  3OYN A;  3GTM J;  1XGO A;  1YRN A;  3CCQ I;  2MW8 A;  5GP9 A;  5J1Y A;  2HDW A;  1C0W A;  2XAU A;  5JLW A;  1ZRF A;  3QPS A;  5K7F A;  4L5I A;  1W7P D;  2DYS H;  3DKX A;  3O6B B;  2GZW A;  1D3Y A;  3RSN A;  1I27 A;  3MVP A;  4UV9 A;  2VKH A;  2VXD A;  5D5U B;  1IV8 A;  3ZQH A;  3HB9 A;  3FMR A;  3OR2 C;  4OAY A;  4Y15 A;  5TJJ A;  1G3Y A;  5F6F A;  2HWV A;  2OCC H;  3G6E I;  2XPU A;  3K2Z A;  3OYE A;  2CGP A;  3BZ6 A;  3GF2 A;  3ABU A;  4ZDL A;  4C30 A;  4ZZL A;  2QBY B;  3R0J A;  1VQ5 I;  4BE2 A;  1QHG A;  1V5G A;  2FXA A;  1R5H A;  1FZP B;  2D1V A;  2KDZ A;  1E3H A;  4CO8 A;  2MLG A;  4IRH A;  3V42 A;  3VYT B;  5HDK A;  2M8G X;  2R7U A;  4G6Q A;  2R0Q C;  2K4J A;  2V9V A;  4YEL A;  2V4J C;  4DYR A;  4E7J A;  5HLT A;  5BMZ A;  4KA4 A;  3DTK A;  1SFX A;  4HF2 A;  1VTN C;  5LHG A;  2EZI A;  4KIB A;  3TDZ C;  4LLG F;  2ZJR F;  1RR8 C;  3BQZ A;  4M6V A;  5J47 A;  3BCB A;  3OV8 A;  2XGC A;  2RRE A;  2CYY A;  2FU4 A;  2JRT A;  4GXO A;  3E6M A;  5GTH C;  3GWZ A;  3LOC A;  2Y48 A;  1YJ9 I;  3V8L A;  4A5N A;  1SC7 A;  4DBR A;  4IJA A;  3VOD A;  1UST A;  2IGM A;  3BT9 A;  3I5U A;  2WAQ A;  2VKV A;  1LEA A;  1TQP A;  2DA1 A;  4C3J J;  5BQT A;  2OBP A;  1RC9 A;  4O6J A;  1MMA A;  1KYZ A;  4G6D A;  4EJO A;  5H6R A;  2FBK A;  2NOJ B;  1KQ8 A;  2DFE A;  3RZO J;  3LL7 A;  1AKH B;  5CJ9 A;  2OTL I;  2QVO A;  4ZTJ A;  1JT0 A;  1OCR H;  1T2K A;  2GXA A;  3I56 I;  2CQN A;  2H6C A;  2NNN A;  3ZRG A;  3KFW X;  1FOW A;  1LNW A;  1RES A;  3Q9S A;  2Y69 H;  1SVM A;  1BI3 A;  5F1J A;  2VJJ A;  2HNH A;  2RV8 A;  3TOA A;  3F8B A;  4CYC A;  5F64 A;  2MYS A;  3V7S A;  2A68 F;  2EV0 A;  2VOD A;  4AYB N;  4OMY A;  1YW9 A;  2CQQ A;  1IUY A;  4KUM A;  5EYR A;  2VXZ A;  2VE9 A;  4U7D A;  4DQ2 A;  1JT6 A;  3OL3 A;  2HOE A;  4Y7N J;  2CW7 A;  2FOK A;  2L4M A;  5HS9 A;  1BOB A;  2KIF A;  3GFM A;  5E1X A;  4XL9 A;  2JMW A;  4I76 A;  3ULQ B;  2CUZ A;  3FBN B;  3HRT A;  4N9H A;  1JJ6 C;  4Y17 A;  3GBG A;  4I01 A;  1MMS A;  4IQJ A;  5IT3 A;  1VQK I;  4LK1 F;  3LAP A;  1LDK B;  5DDG A;  5EF6 A;  4YG2 F;  3A1Y A;  1T56 A;  1D1A A;  2KJB A;  3CJQ B;  5J4V A;  2EIJ H;  5D6E A;  1ETV A;  2KFD A;  1IXC A;  3GLX A;  2FX0 A;  2FF4 A;  5JFR A;  3HOS A;  3HHG A;  3TW6 A;  4M3B A;  5FFZ A;  1FT9 A;  3OSF A;  4XRS A;  2IJL A;  3K1M A;  1STZ A;  3CZ6 A;  3A03 A;  2XUB A;  5TGT A;  4WX9 A;  2KIM A;  4AIK A;  1RUN A;  1Y0N A;  2V1N A;  2YPR A;  4D0P A;  3K70 D;  3COA C;  2WV1 A;  1OCO H;  1I6X A;  2YU9 J;  1UZC A;  4JBA A;  2DU9 A;  2R7W A;  4H0E A;  3I59 A;  2MD0 A;  2VIX A;  1K6O A;  1LFB A;  3EUK L;  4KIG A;  3ESW B;  1SVO A;  3IH4 A;  2CV1 A;  1D0X A;  2EV6 A;  1MBG A;  3KP7 A;  1FPQ A;  4Y3O A;  3Q5F A;  2ZME B;  3QYB A;  1WJF A;  2CFX A;  4NBQ A;  3CDH A;  2BHZ A;  5ILV A;  2LK2 A;  1WSU A;  4IHY A;  2VOO A;  4WF2 A;  5M3F J;  4HNV A;  3S14 J;  3S1N J;  3MWM A;  1HW5 A;  2OD5 A;  4HF0 A;  5L3C A;  3WTY C;  3OYF A;  3MCZ A;  3KIO A;  3GUD A;  5IOY A;  3FKJ A;  3E6D A;  4M9S A;  2ELJ A;  3L2Q A;  2K3P A;  2UZK A;  2LF8 A;  2IPQ X;  5F04 A;  5ERI A;  4BHC A;  2IGO A;  3L1P A;  1B6A A;  3GZ5 A;  1ZHF A;  2VLA A;  3BOQ A;  1TWG J;  1E2X A;  5J40 A;  1UFM A;  5TIS C;  1DP7 P;  2XF6 A;  4HSR A;  3JRI A;  4DYQ A;  2M1B A;  4LFU A;  5HNF A;  5M5X J;  2MC3 A;  4ASN A;  3JR9 A;  1LB2 A;  3ZQF A;  5JVG F;  2G7H A;  4KFC A;  3PSF A;  3TO7 A;  1WKM A;  5J3L A;  3U1K A;  2DI3 A;  3FWE A;  3I64 A;  2BY0 A;  4BXF A;  4UUT A;  1BJZ A;  3KPH A;  4J00 A;  4IHV A;  2A6E F;  1QQI A;  4M6Y A;  3SZG A;  1R1T A;  2WV0 A;  3K10 A;  3WE2 A;  4ENN A;  2L7Z A;  1K4T A;  4WWC A;  1TQM A;  1AKH A;  4B47 A;  2D5V A;  1HKT A;  1N77 A;  2IXS A;  2XIG A;  3IRQ A;  1VQ8 I;  1HW1 A;  1WPK A;  5EG0 A;  1X1C A;  4PJ0 C;  2I8D A;  4BAC A;  3S1Q J;  5CPR B;  3SXY A;  5LGU A;  2OZU A;  1K4S A;  1Z0X A;  3WGI A;  2A5Y B;  3ONQ A;  3RTR A;  3OIQ A;  2DOA A;  3HTS B;  2R7X A;  2R7T A;  1IRX A;  1SFO J;  2L02 A;  3U1D A;  5CVV A;  1F9N A;  1Z3X A;  3D0S A;  2QLZ A;  2H8W A;  2CU7 A;  2HQA A;  1RR7 A;  3ZMT A;  3CCJ I;  2IVM A;  3TOB A;  5LFA A;  4PJL A;  3KYD B;  1DP3 A;  2BVM A;  2JTV A;  3PUF A;  3CUQ B;  1YOV B;  1GVD A;  3QP5 A;  1MMD A;  3J7Y J;  2UXX A;  4BJT A;  1KA8 A;  3VPR A;  3IRR A;  3JRB A;  1WVR A;  4AD9 A;  2E60 A;  3DLA A;  4E70 A;  3ZOB A;  4M72 A;  4UB8 C;  2P8T A;  1E0E A;  3F21 A;  4BBR J;  2QSG X;  3FIS A;  4BYY A;  3BPX A;  1MSE C;  1G8X A;  1SAN A;  3M7G A;  3V8K A;  3MKW B;  4J01 A;  1TL8 A;  6PAX A;  1R1V A;  1GV2 A;  4ENK A;  1R00 A;  3IAM 2;  2O5R A;  1A6Q A;  1OFC X;  2JZY A;  5DCM B;  3TMO A;  3NEU A;  1VQ4 I;  1D8J A;  1G4D A;  1X2N A;  4CA0 A;  2WBM A;  1XGS A;  3WTX C;  4BXX J;  1FYL A;  1BR4 A;  4AYB A;  3GTQ J;  2EJR A;  2Y0S N;  4U0Y A;  1OR7 C;  1P7J A;  2ECC A;  2Q2E A;  2KL4 A;  4BEH B;  4CSW A;  3H9Q A;  2ICW G;  3EUH A;  5CVJ A;  2KRH A;  1X1D A;  2QZ8 A;  2ZME A;  2MH2 A;  3MD2 A;  1NG6 A;  2M34 A;  1QO0 D;  2VPL A;  3ZMD A;  2DJI A;  4HLX A;  2XPW A;  5KCM A;  3ZQI A;  1JKP C;  4Y33 A;  2FBH A;  3JRF A;  1WZ2 A;  1OCC H;  3AFH A;  1TNT A;  2HZT A;  4ANJ A;  2CUE A;  2NNY A;  2A05 A;  1ZRD A;  2ID6 A;  3WGH A;  4B48 A;  1A6I A;  3CMM A;  1QA6 A;  1EH6 A;  3RKY A;  2MA3 A;  4G94 A;  4LD5 A;  3JRA A;  5F27 A;  4TV7 A;  3QQA A;  1W7P B;  3QOD A;  1V54 H;  4DYC A;  3BTI A;  5K1Y A;  2HFH A;  2P5K A;  3G1M A;  4LG0 A;  5FO5 A;  3K70 C;  4I0A A;  1UB9 A;  3C7J A;  1CQT A;  3MQ0 A;  3ZGK A;  2BY3 A;  1KZH A;  3CES A;  4CHU A;  3ZMS A;  4KT6 A;  3SDB A;  3RKW A;  5HNH A;  2P7V B;  4GDF A;  4C9Y A;  1XSV A;  2RNG A;  4CZC A;  3W6J B;  3HM5 A;  5JVT A;  1S29 A;  2JA7 J;  3L9F A;  1XPX A;  3DTI A;  2CW0 F;  1OCZ H;  3RPU D;  4DBQ A;  1X4P A;  4P9F A;  3CJN A;  2XB5 A;  4UUS A;  3ZQ7 A;  2PFB A;  2EIK H;  1MMG A;  5A2Q Z;  2EWN A;  1ZRE A;  2NVT J;  4CCK A;  3ZQG A;  1D5Y A;  4XQF A;  3BG5 A;  4CCJ A;  1IAW A;  3CF2 A;  3C1D A;  4BQA A;  3C2B A;  5IOZ A;  1J9I A;  4R1H A;  1P92 A;  3S1R J;  1VQO I;  3WTV C;  3HSF A;  2FBI A;  2CW8 A;  5GAH J;  2R7O A;  2JJ7 A;  3ASO H;  2BOL A;  4A6E A;  3Q0V A;  1S72 I;  1JGG A;  5E3N A;  1VQ7 I;  5BPD A;  1N78 A;  1BW5 A;  5A2Q K;  4XOT A;  4CCN A;  2LOO A;  5K5Q A;  1O7F A;  3EUA A;  4YII A;  3HRU A;  3CUQ A;  2R7Q A;  3A01 B;  1JJ8 C;  2KDO A;  3PL8 A;  2PBI A;  1YI2 I;  4E7I A;  3BTC A;  1XCV A;  4CH7 A;  5HDN A;  1D1B A;  3ZQQ A;  2X48 A;  3ERM A;  1Y39 A;  3OYD A;  2Y9Z A;  1JE8 A;  3LQR A;  1KYW A;  2WY7 Q;  3MKL A;  5D5W B;  1WCM J;  3BR6 A;  2L2O A;  1FMW A;  1U0J A;  4ZYA A;  1UHW A;  3K0L A;  2LY2 A;  4P96 A;  2DMN A;  1K61 A;  3K4K A;  1U5T B;  1F36 A;  2Y30 A;  4NHJ A;  1Z3Y A;  2HPI A;  3HGY A;  2XKP A;  5M3M J;  5LHI A;  2P6T A;  4UVA A;  3I55 I;  3BP8 A;  3IH3 A;  4IO9 F;  4M73 A;  1D5V A;  3EET A;  3LSP A;  4F93 B;  2R7F A;  4II3 A;  4W97 A;  1ZYR F;  1FYK A;  2QQ8 A;  3MZ8 A;  1MD0 A;  4ETS A;  1M1E B;  1Z67 A;  2V9P A;  4F7Z A;  5HOD A;  2WAD A;  4XM3 A;  3T8T A;  2VQL A;  4BEH A;  3O8G A;  2XVC A;  3OS0 A;  1MND A;  1H89 C;  3LSR A;  3CO6 C;  2R5Y B;  1JI8 A;  1X2M A;  3R6S A;  2WAQ N;  1FNN A;  3L09 A;  3TO9 A;  4OOI A;  3OYL A;  1QZY A;  3OYB A;  1HKS A;  2WA0 A;  2C6Y A;  2XAJ A;  3D5R C;  3OSG A;  4B44 A;  2F2E A;  1TLH B;  2P5L C;  1A35 A;  4HLY A;  2ME0 A;  4C3I J;  1VF9 A;  2PX9 A;  5IT9 K;  2E35 A;  4BU2 A;  1W7P A;  1ZGJ A;  3UNG C;  2DXI A;  3CCL I;  3S3M A;  4IEJ A;  1MBH A;  3TQN A;  4L9J A;  3KZZ A;  3I54 A;  4OIN F;  2FNA A;  4KIS A;  3BCA A;  2IA1 A;  4Q48 A;  2L01 A;  2L7M P;  3QPL A;  1TWF J;  4HA8 A;  5ICC A;  5FLM J;  2H94 A;  2X1E A;  3P9I A;  5FRN A;  3GYH X;  2DTR A;  1ZG1 A;  3ZPL A;  4MIM A;  1ZTR A;  4UB6 C;  3JRD A;  3HHH A;  2JT1 A;  2DFF A;  3ABT A;  3LMM A;  4OAZ A;  4B09 A;  1KQ0 A;  1Y8R B;  4RGU A;  5K5R A;  4QIW N;  3HOX J;  2IBD A;  4M3D A;  2RQQ A;  4M74 A;  4DGW B;  2JUC A;  2F5V A;  2HQ5 A;  3TP3 A;  3REO A;  2KIU A;  3BTJ A;  3ABL H;  4LIV A;  3WGG A;  5E3O A;  2HXI A;  3K4N A;  2PJR B;  1JTY A;  5DTD A;  3BG6 A;  4F92 B;  2BW3 B;  2E1M B;  1ITY A;  3DCF A;  4RLQ A;  2JA8 J;  3CDI A;  3BZC A;  4IVN A;  3OYG A;  1LUJ B;  2EIN H;  1ETO A;  1FOY A;  2UXN A;  1QBJ A;  4P5O A;  3TBI A;  1SEU A;  1IN5 A;  4II2 A;  1YIO A;  1YJN I;  3CCE I;  1HC8 A;  2M87 A;  1QGP A;  2GA1 A;  2X51 A;  2IRF G;  2DK8 A;  4IHW A;  5F08 A;  4CYC B;  2VON A;  4O5V A;  3A01 A;  3CC2 I;  5FRM A;  1EKE A;  1OMI A;  1HDP A;  2YR2 A;  1BL0 A;  1UHS A;  5E17 F;  5J1U A;  3K4J A;  3HJE A;  3FMQ A;  3FDY A;  3CCR I;  3BQY A;  1D8K A;  2M5W A;  4Q47 A;  3K1P A;  2DA3 A;  4O3M A;  1YFH A;  4KYW A;  3ZMZ A;  2XDV A;  3FXO A;  1IN7 A;  2QQ9 A;  5KAF C;  1TTY A;  4QLC U;  1R9T J;  4ZTF A;  1SD7 A;  1T95 A;  1U5T A;  2DA5 A;  1AA7 A;  1B9M A;  3CDL A;  3DPT A;  4RAG A;  1P9Q C;  2GXG A;  3PNV A;  3GVA A;  3J81 K;  2DAO A;  2XAH A;  3J7A O;  2DO7 A;  5CVU A;  3SFZ A;  2MLK A;  2Y0M A;  1W4M A;  1WH7 A;  2OQG A;  1FIA A;  3HKZ A;  2W7N A;  3SEQ A;  3GTL J;  4ZZD A;  4AVP A;  2B0L A;  2V6E A;  3F72 A;  4OIR F;  4RA2 A;  4AIH A;  3DWL E;  1YS6 A;  1W5T A;  3JAM K;  3HUG B;  4A3M J;  2CMP A;  1WGX A;  2R5Y A;  3I53 A;  4L5J A;  3PQJ A;  3FK7 A;  2HU9 A;  1KU2 A;  1Q1H A;  3I59 B;  2HVQ A;  3I9V 2;  3DEE A;  4D9J A;  1ETK A;  1XMK A;  3BJ6 A;  1Z21 A;  2M45 A;  3OYC A;  3TKY A;  4CCL A;  3HSE A;  2BVL A;  4V19 K;  2E1N A;  2NS8 A;  4A3D J;  3WTW C;  2PMZ N;  4DZP A;  1YHQ I;  1XSD A;  3NAR A;  2VQG A;  3H92 A;  1BI0 A;  2OCE A;  3HBL A;  1BW6 A;  3GZ6 A;  2HVS A;  1BR1 A;  1RPW A;  2DMU A;  1RI7 A;  2LTP A;  2ZME C;  3BDD A;  4I7H A;  2LLK A;  3G1O A;  2IS2 A;  2O6G E;  5HDG A;  2EFN A;  2R7V A;  3GME A;  3Q0U A;  1WJA A;  3CCY A;  3E0J B;  3T0Y A;  1J75 A;  3VSK A;  4XSX F;  3IUO A;  1NG7 A;  4HPQ A;  3V4G A;  2L3D A;  1T38 A;  5H2F C;  4LB5 A;  1B72 A;  1E3P A;  3BG3 A;  1U2W A;  2K5C A;  4AUX A;  2COB A;  5E1Z B;  2O0Y A;  1SAU A;  2EZH A;  5E18 F;  2RN7 A;  4YFK F;  4BJ5 C;  4XNF A;  2H6B A;  3B6C A;  2XF5 A;  1IXR C;  3QU6 A;  4S0H B;  1JTX A;  4XK4 A;  1HST A;  2LMD A;  2LD5 A;  1J5Y A;  3S2H J;  4KT5 C;  3FXM A;  3LSG A;  5LD2 C;  5LLQ A;  3H5A A;  2Q8K A;  2DQR A;  2FRH A;  4D7N A;  3RYP A;  1QRY A;  1IRZ A;  2DOD A;  3BG7 A;  4E7H A;  1W0U A;  1FEX A;  2PJR A;  4OIQ F;  4JYK A;  1I39 A;  3CQZ J;  4UVB A;  2BW3 A;  1TQI A;  2LVS A;  1LJ9 A;  2HS5 A;  4QPO A;  3RI4 A;  1OCT C;  4OIP F;  4WCG A;  2M0M A;  1ZGW A;  2JSC A;  4MFD A;  1X4O A;  2KT0 A;  3MZY A;  4I98 B;  3CME I;  2IA0 A;  5E8G A;  2KZG A;  5EG0 B;  4X6A J;  1HLV A;  3CC7 I;  1S9H A;  2BEO A;  1IF1 A;  3RKQ A;  3KP6 A;  2GM4 A;  5IYB J;  4EJU A;  4J19 A;  1TT0 A;  2DCE A;  4MTD A;  3IV5 A;  3CCU I;  1H8A C;  3FXU A;  3E3V A;  1D0Z A;  4JOM A;  2GOX B;  3K4C A;  1L0O C;  1T0F A;  3QPT A;  1VZ0 A;  2H09 A;  1H88 C;  2LKS A;  3GXO A;  2F5C A;  1XMX A;  3E5Q A;  4RB2 C;  1ZLJ A;  4FQG A;  2XV4 S;  3ROU A;  4D7M A;  4HYE A;  3B02 A;  5FB2 A;  3VSL A;  2Z33 A;  2OZ6 A;  1PP8 F;  3S17 J;  2XGD A;  1SVL A;  2EIM H;  2L9V A;  4D5C A;  1FIP A;  3SJM A;  4FX4 A;  2OPT A;  4IRI A;  2XAQ A;  4C3H J;  4NC6 A;  3NAU A;  1FSH A;  3J7A Y;  3CD6 I;  3TDU C;  3WG9 A;  3F6O A;  2DT6 A;  4U0W A;  4HAM A;  5ILS A;  2LBF A;  3RDI A;  5E8I A;  5LRR A;  3PUB A;  4HQE A;  2E34 A;  4UXN A;  1ULY A;  2VKE A;  2Y75 A;  4EGZ A;  1XC5 A;  3F8F A;  3ZQL A;  2A6H F;  2TRT A;  2VJ5 A; 
#chains in the Genus database with same CATH homology
 3KEQ A;  3JSO A;  1KU7 A;  3BJO A;  2KRF A;  3HUG A;  3M8F A;  1YLF A;  2ZO4 A;  3BRO A;  2RDP A;  3K69 A;  1SD4 A;  5E1W A;  4CIC A;  1GHC A;  3HYI A;  3ECO A;  3BPV A;  3FHZ A;  1U6G A;  4FX0 A;  4HV5 A;  1QNT A;  5H6Q A;  1U8R A;  1WQ2 A;  1BIA A;  3VFZ A;  1YYV A;  4M9X A;  3MAJ A;  4L9V A;  4Q4Z F;  4LG0 B;  3DFG A;  5DYM A;  4EM0 B;  3DKW A;  3LA3 A;  3VB2 A;  2ZKZ A;  3J80 Z;  3QAH A;  2W85 A;  1WWX A;  1BJA A;  3CUO A;  1KU3 A;  1Z7U A;  3QPH A;  1FOK A;  3L00 A;  5ICG A;  5E20 A;  4YIF A;  4IF4 A;  2PMH A;  2DT5 A;  2RC4 A;  4OMZ A;  2O8X A;  3J80 K;  1B59 A;  2Q0O A;  2AXL A;  5DUK A;  3AAF A;  1Z9C A;  2QUF A;  1FP2 A;  1U3E M;  4MHG A;  2BGC A;  3RPQ A;  2M8E A;  1PP7 U;  4GGG A;  4IHT A;  5LHH A;  2Z99 A;  3LWF A;  1GVJ A;  2VN2 A;  4JQF A;  3RPU A;  1CGP A;  1OKR A;  2XAF A;  3QOP A;  1WRJ A;  3VEP A;  5HS8 A;  3WTU C;  2VBZ A;  2HYG D;  1O3S A;  2EK5 A;  3R60 A;  3WTZ A;  4I2O A;  3W6K B;  4EV0 A;  4KIC A;  3TGN A;  4IRG A;  3RYR A;  1H9T A;  4HBL A;  4HF1 A;  1ZGA A;  1XD7 A;  3ML6 A;  4IXA A;  4HX7 A;  4ESB A;  4EJW A;  1TBX A;  2KJC A;  5EEG A;  1ON2 A;  5AON A;  1FLI A;  2VT2 A;  4HV6 A;  4M9Z A;  4CGZ A;  1U5T C;  2VBY A;  1ON1 A;  2VOP A;  1R22 A;  2EFW A;  1SD5 A;  3T5X A;  1O3T A;  2F5E A;  2FQ3 A;  5ED4 A;  3IKT A;  1W5S A;  5F1R A;  5D8L B;  2JPC A;  1EH8 A;  5K5O A;  2ISY A;  4RB3 C;  3H3Z A;  2ETH A;  2DPD A;  3SZT A;  4BHB A;  3DEU A;  2K7L A;  1EV7 A;  2PEX A;  4G7Z F;  1SFE A;  3KZY A;  2EFP A;  2OU2 A;  1BIB A;  4CZZ A;  2EA4 A;  1UHM A;  3FF5 A;  5HVQ C;  4BNC A;  5FD5 A;  4A0Y A;  3CTA A;  4GYG A;  3PQK A;  2PLY A;  4HW0 A;  1R1U A;  3ZN1 A;  1FY7 A;  4R79 A;  2FML A;  4WXC A;  4A6D A;  4JK1 X;  1F4K A;  1XN7 A;  4P9U A;  4BXU A;  5HLI A;  4MEY F;  2VE8 A;  5LEK A;  3N97 A;  1DUX C;  3GX4 X;  4XLN F;  1FP1 D;  3JTH A;  3BWG A;  4PGG A;  2V6C A;  2A3S A;  2HTS A;  5JR3 A;  1YTY A;  2NS0 A;  4EJV A;  2E7X A;  1K79 A;  2P6S A;  3G3Z A;  1XDU A;  1QZZ A;  1IN4 A;  4A2U A;  3K1N A;  3ERE D;  4AIJ A;  4EMS A;  3F8N A;  1O57 A;  1FC3 A;  4WXH A;  4A0Z A;  2LNB A;  5HS7 A;  1CF7 B;  2KKO A;  5H20 A;  3C18 A;  4Q5S F;  4PCQ A;  1ONV A;  3U2R A;  3EYY A;  1FX7 A;  1BI2 A;  5LBQ A;  4L9T A;  1USS A;  3KEO A;  1V4R A;  2QM3 A;  2RKH A;  4IPA A;  2G7U A;  2XAG A;  2STW A;  3KLO A;  4NQW A;  1F5T A;  3ZMV A;  2BBY A;  2DLL A;  3V8J A;  2DW4 A;  1RZ4 A;  4RAY A;  3EQL F;  1J2X A;  1S3J A;  1OPC A;  4HDV A;  4ZH4 F;  3IHU A;  1EH7 A;  4RGS A;  2X0L A;  1J0R A;  1ZN2 A;  1B1B A;  3WTT C;  4KNY A;  5DUI A;  2D1H A;  5TRD A;  3DXJ F;  5D8K B;  2ACJ A;  5D4S A;  4RS8 A;  3KP5 A;  1LDD A;  3F3X A;  2VC1 A;  5J6X A;  2AS5 F;  4AWX B;  1TW2 A;  2F5F A;  1ZH5 A;  1Z1D A;  4XSZ F;  3SZP A;  5HLH A;  2A69 F;  1IZ1 A;  1O3R A;  1AOY A;  3R61 A;  3WU0 A;  3G73 A;  3LA7 A;  1AWC A;  1YQA A;  2NRA C;  3HTU A;  3WE3 A;  1G3T A;  1IRG A;  1UCR A;  3I4P A;  5DD4 A;  1PDN C;  4HX4 A;  2EFQ A;  3ZN0 A;  5BPI A;  1SAX A;  2CG4 A;  3KP2 A;  4HZF A;  5LGT A;  3DV8 A;  2FNP A;  4M6X A;  5BS6 A;  2GIV A;  2LKP A;  2M30 A;  1IN6 A;  2V1D A;  1FBS A;  3GFJ A;  1GXP A;  2IT0 A;  5HLG A;  3P9K A;  2MH9 A;  1XGN A;  5L3G A;  4LLL A;  1CF7 A;  1K78 B;  1FSE A;  3O3K A;  1JGS A;  2DPU A;  3E5X A;  2DK5 A;  1JHH A;  4LLN A;  2K02 A;  2GWR A;  1RNL A;  4QWQ A;  4HX8 A;  2A6H F;  3IWZ A;  5DV5 A;  4PZJ A;  4PDK A;  3QP6 A;  1ODD A;  2JPB A;  2PMU A;  3RIR A;  3I71 A;  1ZLK A;  1S6L A;  2ISZ A;  4EJT A;  2BV6 A;  4CXF A;  3BJA A;  1JHF A;  4DNC A;  1YO5 C;  2ESN A;  2HGC A;  2GQQ A;  1OR7 A;  2VT3 A;  3SQN A;  3E6B A;  3LAJ A;  1HW2 A;  3RJP A;  1DDN A;  1MJB A;  2HKX A;  4N9I A;  1K7A A;  4I09 A;  4G7H F;  2WC2 A;  1P4W A;  3JSP A;  1O7L A;  3MZH A;  2W25 A;  5BOX A;  5AIP A;  1WI9 A;  3LFK A;  2PQ8 A;  5AIQ A;  2E7W A;  2LDU A;  5ILU A;  2Z9O A;  2F5D A;  3EYI A;  2DFI A;  3O2P E;  2D2W A;  4KIF A;  4YFN F;  5D5X B;  1I5Z A;  4HDU A;  3GFI A;  2P7C B;  2P4W A;  3HIF A;  1KQ9 A;  2XKO A;  4MQV A;  3V7R A;  3QU3 A;  2A07 F;  3R4K A;  4CDG A;  5DD8 A;  4RB1 A;  4XBF A;  3RKX A;  2RVC A;  2HYF A;  3E97 A;  3GW2 A;  2EFO A;  1XB4 A;  3R0A A;  2DBB A;  2FE3 A;  2DQL A;  2IW5 A;  3WOD F;  2XHK A;  3L2C A;  1T39 A;  2P5V A;  4L18 B;  4NB5 A;  5JI6 A;  3MEX A;  1SMT A;  3F6V A;  3EDP A;  2O03 A;  3IL2 A;  2HKO A;  1Z05 A;  4UHT A;  3CUQ C;  4L0Y B;  4LMY A;  4L0Z B;  1Y0U A;  3DF8 A;  1S7O A;  4EM1 A;  1K78 A;  4UUV A;  2TDX A;  3PFI A;  3CLO A;  2MBF A;  2MD5 A;  1U78 A;  2HQR A;  1YW7 A;  1IN8 A;  4LB6 B;  4L9N A;  2O61 A;  1B4A A;  1OYW A;  3V7C A;  5L3B A;  1A04 A;  2L54 A;  4Z2Y A;  2E1C A;  3P7N A;  2J5O A;  2CQK A;  3FMS A;  4ON0 A;  1KGS A;  1RIO H;  2IP2 A;  2GXB A;  1G3W A;  3MFK A;  4WXD A;  2IA2 A;  1J7K A;  4CYD A;  2XRO A;  4BAY A;  4MQ9 F;  1MGT A;  4IHS A;  1HQC A;  3E5U A;  4ZYE A;  1IW7 F;  2X4H A;  2QBY A;  5D6F A;  4KN4 X;  4ENM A;  2GAU A;  4PGH A;  4BHP A;  3H3U A;  4ENJ A;  4BH9 A;  3LA2 A;  4OU0 A;  2HDC A;  4KN7 X;  1XGM A;  2ESH A;  2W24 A;  2HEO A;  2ADU A;  1YG2 A;  2VBX A;  2RGV A;  4KDP A;  2V79 A;  2CSO A;  2EA2 A;  2PJP A;  3KP4 A;  4UV8 A;  4M71 A;  1P2F A;  4P55 A;  2PN6 A;  5J8C A;  3NRV A;  5FLX Z;  3U9G A;  3B73 A;  1PUE E;  5JHU A;  2WWY A;  1BM9 A;  2R3S A;  3WU1 B;  4HOB A;  1R23 A;  3ZMU A;  2ZXJ A;  5FLX K;  2UWM A;  1SMY F;  4GO1 A;  2Z3Y A;  1FWZ A;  2W84 A;  3FM3 A;  5EEH A;  3F8C A;  2LSO A;  3D5L A;  2J5P A;  1FYM A;  1Z91 A;  1NHA A;  1G3S A;  4GYI A;  3WTS C;  3HOT A;  3K9T A;  3OOP A;  4KMU X;  1MZB A;  1YS7 A;  2XAS A;  2YSR A;  3JW4 A;  2STT A;  2D45 A;  4A12 A;  3CO7 C;  2BYV E;  3FX3 A;  3JTG A;  1O3Q A;  3FXQ A;  1HBX G;  3IC7 A;  2QQB A;  5D4R A;  2XGX A;  3ECH A;  3IWF A;  4G9Y A;  1RUO A;  1MDM B;  4ZYD A;  1LEB A;  2L4A A;  4ESJ A;  1BC8 C;  2YX4 A;  2OQR A;  1I1G A;  2O3F A;  1R7J A;  1KU9 A;  3F22 A;  3Q9V A;  2OA4 A;  1TW3 A;  3LST A;  1XCB A;  4XRF A;  5LRS A;  3KE2 A;  2XRN A;  3QRF F;  1FBQ A;  1OYI A;  3FXR A;  3M9A A;  5DEQ A;  2ZBK A;  5J8F A;  1V3F A;  2FEZ A;  4Y13 A;  1JXS A;  4G8X A;  2FMY A;  1HKQ A;  2K27 A;  3LQQ A;  1I1S A;  1FBU A;  4MTE A;  4FT8 A;  3KCC A;  1TNS A;  1MJ9 A;  2NYX A;  1E17 A;  1HXD A;  5CVR A;  1XDS A;  5KVR A;  1S7A A;  4ZYH A;  1S8N A;  4OIO F;  2HR3 A;  3HRM A;  4YFX F;  1ZAR A;  2COM A;  1DPR A;  1YW8 A;  1ZRC A;  3IKV A;  3VOE A;  3ISP A;  2QYO A;  2NAZ A;  1G6N A;  2YU3 A;  2V1X A;  5LEJ A;  3P9C A;  1R5G A;  1P4X A;  1L3L A;  1IXS B;  5FGM A;  4EGY A;  2CWE A;  2BE5 F;  1BOA A;  2Z5U A;  4EM2 A;  3M1E A;  5ICE A;  1MJA A;  1LDJ A;  3GEZ A;  4XLP F;  3C3W A;  5L3F A;  1SFU A;  4WK8 F;  1BN5 A;  5CLS A;  4UNO A;  4R8H A;  5FFX A;  3FZV A;  3HSR A;  4ESF A;  4U0V A;  4LJZ F;  1IRF A;  5DCF A;  3KLN A;  5ICF A;  4A5M A;  2LF7 A;  5DCM A;  1ZG3 A;  1B9N A;  5CYV A;  3FM5 A;  4S05 A;  1OYY A;  5D5V B;  2ZNY A;  2HQN A;  2K4B A;  3NQO A;  1H0M A;  1MDM A;  2QQA A;  2WTE A;  4I02 A;  2FA5 A;  4MNU A;  5L3E A;  1DPU A;  5IT9 Z;  2R7D A;  1P6R A;  2RNJ A;  4S04 A;  1GXQ A;  4RAZ A;  1REP C;  4EQQ A;  1BBY A;  3GFL A;  1J59 A;  1BC7 C;  2ZNZ A;  1Z6R A;  1MKM A;  1P4A A;  5CVI A;  4I0B A;  3F23 A;  2RQP A;  3HRS A;  4EVI A;  3T1B A;  4KMF A;  1SD6 A;  3M8E A;  1R36 A;  5KK1 A;  2CO5 A;  5FD6 A;  1F1Z A;  2OAZ A;  2H27 A;  1BI1 A;  3DP7 A;  3DPL C;  1QPM A;  2A61 A;  3N4M A;  2YX7 A;  4FHT A;  1ZG5 A;  3BY6 A;  4GCV A;  2ZFW A;  4HQM A;  2ZCW A;  4ZYG A;  4LK0 F;  2FSW A;  1T98 A;  2W57 A;  2VBW A;  1HSJ A;  3SHF A;  1LVA A;  1R58 A;  5LGN A;  2ZJ2 A;  3I58 A;  2K86 A;  1ZAO A;  2ELH A;  5L3D A;  4RB0 A;  2QWW A;  2EV5 A;  4RGX A;  4MGR A;  1T6S A;  4N0B A;  3ELK A;  4K2E A;  4G7O F;  5HOO A;  3ZP5 A;  3E6C C;  4UVC A;  3KET A;  2QEN A;  1XSX A;  4RGR A;  3DQV C;  4B8X A;  2GA2 A;  3J81 Z;  3F8M A;  1X3U A;  1LQ1 A;  4LGW A;  4U7B A;  2G9W A;  2VC0 A;  1Z6T A;  1H9G A;  3TO6 A;  1XMA A;  4U88 A;  2EB7 A;  3L7W A;  3T8R A;  2V1U A;  3JAM Z;  2HTJ A;  4A0X A;  4MEX F;  3KP3 A;  2PG4 A;  3I0T A;  2PI0 A;  3GO5 A;  3S2W A;  1XGO A;  1C0W A;  1ZRF A;  4L5I A;  1W7P D;  3O6B B;  2GZW A;  1D3Y A;  1I27 A;  4UV9 A;  5D5U B;  3FMR A;  5TJJ A;  4Y15 A;  1G3Y A;  5F6F A;  2HWV A;  3K2Z A;  2CGP A;  3BZ6 A;  3GF2 A;  3ABU A;  4ZZL A;  2QBY B;  3R0J A;  2FXA A;  1R5H A;  1FZP B;  2D1V A;  4CO8 A;  2MLG A;  4IRH A;  5HDK A;  4G6Q A;  2K4J A;  2V9V A;  5BMZ A;  4KA4 A;  1SFX A;  4HF2 A;  1VTN C;  5LHG A;  4KIB A;  3TDZ C;  4LLG F;  3OV8 A;  2FU4 A;  2CYY A;  2JRT A;  4GXO A;  3E6M A;  3GWZ A;  2Y48 A;  3V8L A;  4A5N A;  4IJA A;  3VOD A;  1UST A;  3I5U A;  1LEA A;  1TQP A;  5BQT A;  2OBP A;  4O6J A;  1KYZ A;  4G6D A;  4EJO A;  5H6R A;  2FBK A;  1KQ8 A;  5CJ9 A;  2QVO A;  1T2K A;  2H6C A;  2NNN A;  3KFW X;  1LNW A;  3Q9S A;  1BI3 A;  2RV8 A;  3TOA A;  3F8B A;  5F64 A;  3V7S A;  2A68 F;  2EV0 A;  2VOD A;  4OMY A;  1YW9 A;  1IUY A;  4KUM A;  2VXZ A;  2VE9 A;  4U7D A;  4DQ2 A;  2HOE A;  2FOK A;  2L4M A;  5HS9 A;  2KIF A;  3GFM A;  5E1X A;  3ULQ B;  3HRT A;  4N9H A;  4Y17 A;  4I01 A;  5IT3 A;  4LK1 F;  3LAP A;  1LDK B;  5DDG A;  4YG2 F;  2KJB A;  5D6E A;  1IXC A;  3GLX A;  5JFR A;  2FF4 A;  3HOS A;  3HHG A;  5FFZ A;  1FT9 A;  2IJL A;  3K1M A;  1STZ A;  2XUB A;  4WX9 A;  2KIM A;  4AIK A;  1RUN A;  2YPR A;  4D0P A;  3COA C;  1I6X A;  4JBA A;  2DU9 A;  4H0E A;  3I59 A;  1K6O A;  4KIG A;  2EV6 A;  3KP7 A;  1FPQ A;  3Q5F A;  2ZME B;  2CFX A;  3CDH A;  5ILV A;  1WSU A;  2VOO A;  4WF2 A;  3MWM A;  1HW5 A;  2OD5 A;  4HF0 A;  5L3C A;  3WTY C;  3MCZ A;  3GUD A;  3E6D A;  4M9S A;  2UZK A;  2LF8 A;  2IPQ X;  4BHC A;  5ERI A;  1B6A A;  3GZ5 A;  1ZHF A;  3BOQ A;  1E2X A;  1DP7 P;  1UFM A;  2M1B A;  4LFU A;  2MC3 A;  4ASN A;  1LB2 A;  2G7H A;  4KFC A;  3TO7 A;  1WKM A;  2DI3 A;  3FWE A;  3I64 A;  2A6E F;  1QQI A;  4M6Y A;  1R1T A;  2WV0 A;  3WE2 A;  4ENN A;  4WWC A;  1TQM A;  1HKT A;  2XIG A;  3IRQ A;  1HW1 A;  3SXY A;  5LGU A;  2OZU A;  3WGI A;  2A5Y B;  3RTR A;  3HTS B;  2L02 A;  3U1D A;  5CVV A;  1F9N A;  3D0S A;  2QLZ A;  3ZMT A;  2IVM A;  3TOB A;  2JTV A;  3CUQ B;  3QP5 A;  2UXX A;  3IRR A;  1KA8 A;  4AD9 A;  4E70 A;  4M72 A;  2P8T A;  3F21 A;  4BYY A;  3BPX A;  3M7G A;  3V8K A;  6PAX A;  1R1V A;  4ENK A;  2JZY A;  5DCM B;  3NEU A;  1D8J A;  1G4D A;  1XGS A;  3WTX C;  1FYL A;  2EJR A;  4U0Y A;  2Q2E A;  5CVJ A;  3EUH A;  2QZ8 A;  2ZME A;  2MH2 A;  1QO0 D;  3ZMD A;  4HLX A;  2FBH A;  1TNT A;  2HZT A;  2NNY A;  1ZRD A;  3WGH A;  1EH6 A;  3RKY A;  2MA3 A;  4G94 A;  4LD5 A;  4TV7 A;  1W7P B;  5K1Y A;  2HFH A;  2P5K A;  4LG0 A;  5FO5 A;  4I0A A;  1UB9 A;  3C7J A;  3MQ0 A;  4CHU A;  3ZMS A;  3RKW A;  2P7V B;  1XSV A;  3W6J B;  5JVT A;  1S29 A;  3L9F A;  2CW0 F;  4P9F A;  3CJN A;  3ZQ7 A;  2PFB A;  5A2Q Z;  2EWN A;  1ZRE A;  1IAW A;  3C1D A;  4BQA A;  1J9I A;  4R1H A;  1P92 A;  3WTV C;  3HSF A;  2FBI A;  4A6E A;  5BPD A;  5A2Q K;  5K5Q A;  1O7F A;  4YII A;  3HRU A;  3CUQ A;  2PBI A;  1XCV A;  5HDN A;  1JE8 A;  3LQR A;  1KYW A;  5D5W B;  1UHW A;  3K0L A;  4P96 A;  1U5T B;  4NHJ A;  2XKP A;  5LHI A;  2P6T A;  4UVA A;  3BP8 A;  4M73 A;  1D5V A;  3EET A;  2R7F A;  1FYK A;  1ZYR F;  1MD0 A;  4ETS A;  4F7Z A;  3T8T A;  2XVC A;  3CO6 C;  3R6S A;  3L09 A;  1FNN A;  3TO9 A;  4OOI A;  1QZY A;  1HKS A;  2C6Y A;  2XAJ A;  2F2E A;  1TLH B;  2P5L C;  4HLY A;  5IT9 K;  1W7P A;  1ZGJ A;  3TQN A;  4L9J A;  3KZZ A;  3I54 A;  4OIN F;  2FNA A;  2IA1 A;  4Q48 A;  2L01 A;  4HA8 A;  5ICC A;  2H94 A;  3P9I A;  3GYH X;  2DTR A;  1ZG1 A;  3ZPL A;  3HHH A;  2JT1 A;  3ABT A;  4B09 A;  1KQ0 A;  5K5R A;  4RGU A;  4M74 A;  3REO A;  2KIU A;  3WGG A;  4IVN A;  2UXN A;  1QBJ A;  4P5O A;  1IN5 A;  1YIO A;  2M87 A;  1QGP A;  2GA1 A;  2IRF G;  2DK8 A;  2VON A;  4O5V A;  1OMI A;  2YR2 A;  5E17 F;  3FMQ A;  1D8K A;  2M5W A;  4Q47 A;  3K1P A;  4O3M A;  1YFH A;  4KYW A;  3ZMZ A;  1IN7 A;  2QQ9 A;  1TTY A;  4QLC U;  1SD7 A;  1U5T A;  1B9M A;  3DPT A;  2GXG A;  3GVA A;  3J81 K;  2DAO A;  2XAH A;  3J7A O;  2DO7 A;  5CVU A;  3SFZ A;  2MLK A;  2Y0M A;  1W4M A;  2OQG A;  4ZZD A;  4AVP A;  2B0L A;  3F72 A;  4OIR F;  4AIH A;  1YS6 A;  1W5T A;  3JAM K;  3I53 A;  4L5J A;  3PQJ A;  3I59 B;  1KU2 A;  1Q1H A;  1XMK A;  3BJ6 A;  2M45 A;  3TKY A;  3HSE A;  2E1N A;  3WTW C;  1XSD A;  3H92 A;  3GZ6 A;  1BI0 A;  1RI7 A;  3BDD A;  4I7H A;  2O6G E;  5HDG A;  2EFN A;  3T0Y A;  1J75 A;  4XSX F;  3V4G A;  2L3D A;  1T38 A;  4LB5 A;  1U2W A;  5E1Z B;  2O0Y A;  5E18 F;  2RN7 A;  4YFK F;  2H6B A;  1IXR C;  3QU6 A;  1HST A;  1J5Y A;  4KT5 C;  5LLQ A;  2Q8K A;  2DQR A;  2FRH A;  3RYP A;  4OIQ F;  4UVB A;  1TQI A;  1LJ9 A;  2HS5 A;  3RI4 A;  4OIP F;  4WCG A;  2JSC A;  3MZY A;  4I98 B;  2IA0 A;  5E8G A;  2BEO A;  1IF1 A;  3KP6 A;  4EJU A;  4MTD A;  3FXU A;  3E3V A;  1L0O C;  1T0F A;  3QPT A;  2H09 A;  3GXO A;  2F5C A;  3E5Q A;  4RB2 C;  1ZLJ A;  2XV4 S;  3ROU A;  4HYE A;  3B02 A;  5FB2 A;  2Z33 A;  2OZ6 A;  1PP8 F;  4FX4 A;  4IRI A;  2XAQ A;  1FSH A;  3TDU C;  3WG9 A;  3F6O A;  4U0W A;  4HAM A;  5ILS A;  3RDI A;  5E8I A;  5LRR A;  4HQE A;  4UXN A;  1ULY A;  2Y75 A;  4EGZ A;  3F8F A;  1R00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...