4LB6B

Crystal structure of pkz zalpha in complex with ds(cg)6 (tetragonal form)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
ENEIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDNKRPVWNLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Z-DNA binding and stabilization by the zebrafish Z-DNA dependent protein kinase PKZ.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase/dna
molecule keywords Protein kinase containing Z-DNA binding domains
total genus 20
structure length 63
sequence length 63
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lb6B00
2X0LA 3BDDA 3L7WA 4AIKA 4OIOF 4OOIA 1XB4A 4KN7X 3EUHA 1TQIA 4Z2YA 3BOQA 1BM9A 3WGHA 1UHWA 3F23A 3DEUA 2EFNA 2ESHA 3T0YA 3FMQA 2W25A 4MTDA 2EA4A 3M7GA 3AAFA 2FBHA 4CZZA 1XN7A 3GXOA 3MZHA 2NNNA 5ICCA 2OQRA 2XV4S 2E1NA 1DPRA 4U0YA 2BEOA 3GF2A 2EV0A 3K1MA 3F8MA 3QP5A 4A6EA 2RNJA 4JQFA 2QQBA 4KFCA 4BQAA 2PN6A 5D8LB 3MFKA 3H3ZA 4ZYGA 3WTTC 5H20A 4UXNA 2QUFA 1LQ1A 4O5VA 3SZPA 5EEHA 5DUIA 1FYMA 2PEXA 1K6OA 1IN8A 4LD5A 2J5PA 1Z05A 5LRSA 2R3SA 2JPCA 5E20A 2Q2EA 1R1VA 4KA4A 4IJAA 3FXQA 3ROUA 1P6RA 5ICEA 1RIOH 4Y15A 4P96A 4M72A 2F5FA 3C3WA 4U0WA 5HLIA 3I64A 3BP8A 2P7VB 4G6QA 4RAZA 1SMYF 4TV7A 4UV8A 1H0MA 5HLHA 1LVAA 3E6BA 2ACJA 1FT9A 3WTVC 3KZZA 1ZH5A 5BMZA 3CJNA 1SAXA 3FHZA 1Q1HA 3I4PA 1IN6A 3EYIA 3DF8A 4EJTA 3J81K 3ABUA 3U1DA 2M45A 5LEJA 4S04A 1K78B 2GWRA 4R1HA 2DO7A 4ZZLA 1Z7UA 4B09A 3R60A 2VT2A 5FFXA 1SD5A 4A5MA 3HOSA 3I59A 2RQPA 3BZ6A 3MCZA 3C1DA 2Z3YA 3SXYA 1BI1A 2F5DA 2K4JA 2RKHA 1KU3A 1LJ9A 1U8RA 2YX7A 3QAHA 4FHTA 1YLFA 3O6BB 2Y48A 2HGCA 1J0RA 3V7RA 3K69A 3ULQB 2MLKA 3DFGA 1REPC 2YPRA 2KRFA 5ED4A 4LG0A 3IKVA 2XGXA 1TNTA 5FD5A 3ISPA 3GVAA 3EQLF 4RB2C 4ETSA 4G8XA 5CVVA 4NHJA 1LDKB 2VT3A 3CUOA 1C0WA 4KNYA 1R36A 1BIAA 4WCGA 2DW4A 2YU3A 4Q4ZF 4ESFA 4OINF 1B6AA 2EJRA 3E5UA 3GFIA 2UZKA 5F1RA 4WXDA 4NQWA 2VN2A 2OZ6A 3MEXA 4HW0A 1XD7A 2H27A 1Z1DA 3FX3A 1HW5A 2WC2A 5DCMB 3W6JB 2G7HA 3JAMZ 4XLNF 1MGTA 3V8JA 1KYWA 4PGHA 2L3DA 1Z9CA 5JR3A 2A68F 3RJPA 2LNBA 2VE9A 5J8FA 4CHUA 5F64A 3RKXA 4OMZA 4XSXF 3U9GA 4M6XA 3JSPA 1I6XA 3M8EA 4EM2A 3L09A 1RZ4A 4BAYA 4CDGA 1T2KA 1KQ0A 2D45A 1O7LA 1X3UA 3WTWC 2GXGA 1FWZA 4L0ZB 4ENNA 4CYDA 1H9GA 2PQ8A 3RI4A 2STTA 4IHTA 5E17F 1W4MA 4M9XA 2DI3A 1DDNA 2JSCA 2NNYA 3SZTA 4LG0B 4EJVA 2XKOA 2A61A 4U7BA 3P7NA 2G9WA 3ECHA 2D1VA 1YS6A 1P4XA 1B59A 3T8TA 4XRFA 3V7SA 5E1XA 3HRSA 2VC0A 4Q5SF 4KIGA 3F8NA 1U2WA 3WTSC 1I1GA 5HS7A 3KE2A 3LQRA 3KCCA 4UHTA 3IHUA 1D5VA 3MWMA 2FOKA 3Q9VA 2RN7A 3FMRA 3I59B 4IRGA 1T98A 2BGCA 4M74A 1FOKA 1FP2A 3CTAA 4IRHA 1OYIA 2BE5F 2COMA 4G94A 5A2QZ 5LRRA 4M9SA 4U0VA 4MNUA 4EJUA 2Q8KA 2PMHA 4ZZDA 3E97A 5DD4A 2RVCA 1S29A 2ZMEA 1IN4A 3R0AA 4ZYDA 4Y17A 1JE8A 4N9HA 1OYYA 3WE2A 3KZYA 1U78A 2GAUA 2HKXA 4LK1F 1T39A 2W24A 3ZPLA 4G6DA 1BC7C 2E1CA 1PP8F 4OU0A 5LLQA 1S7OA 4ENJA 2XROA 5D5UB 1IRGA 2EA2A 1IW7F 5TJJA 4WX9A 2K7LA 2LF7A 5HDKA 1TW3A 3H3UA 1P4WA 4KMFA 2STWA 1BI3A 3WGIA 3ELKA 1ZG5A 3KLOA 1ZAOA 2GA2A 4L5JA 1EH8A 3ECOA 2V1XA 3TOBA 3I53A 3M8FA 2EK5A 5E18F 3ABTA 2M1BA 4BH9A 1O7FA 3TDZC 3O2PE 2D1HA 2FNPA 3KP5A 1YW7A 4Y13A 4N0BA 4AIJA 3DKWA 2EB7A 2MH2A 4A5NA 5L3BA 3H92A 2P7CB 2VONA 1OR7A 2R7DA 1JGSA 2XAQA 1QBJA 4FX0A 2EFQA 4KN4X 3NEUA 5LHIA 5CJ9A 3LAJA 3JAMK 3QRFF 3M9AA 5HLGA 4YFKF 3KP7A 4OIPF 3V7CA 3HSEA 2F2EA 4HLXA 3F72A 2PLYA 2HDCA 3LWFA 1DPUA 4HOBA 3GEZA 2AS5F 3OV8A 4KIBA 4I09A 2O03A 4PCQA 1T38A 2NAZA 4CO8A 1U5TC 5ILUA 4EGYA 2PJPA 2L01A 2FNAA 2H09A 1TW2A 3GFMA 3SHFA 4GCVA 5ERIA 2KIUA 5DUKA 4KT5C 4OIQF 3N4MA 3DXJF 3GWZA 1ZN2A 4WXHA 5FD6A 2CSOA 2RC4A 3LA7A 3RTRA 2LF8A 2L4AA 1R22A 2V1DA 5LGUA 1CGPA 2HTSA 4O6JA 2A69F 4N9IA 2A6HF 2HEOA 1T0FA 4MQ9F 1STZA 1R5HA 4I0BA 2IP2A 2Y0MA 1JHHA 5FFZA 4I7HA 2BV6A 1MZBA 3WG9A 2M5WA 2MA3A 3WODF 2DFIA 2EFPA 2CO5A 1S6LA 2KIFA 3GO5A 4BHPA 5IT9K 4OIRF 4IRIA 2VODA 1ZRFA 1KQ9A 4AIHA 4IXAA 4EVIA 2QBYA 4HF2A 1GVJA 5JVTA 1ZLJA 3LA3A 4BHCA 2IA0A 1BI2A 2XHKA 4LLLA 4PZJA 1QGPA 1ZGAA 2O3FA 5IT9Z 3D5LA 3OOPA 1UFMA 2VOOA 1ZREA 3M1EA 3I5UA 1KYZA 3FF5A 1FNNA 3F8BA 5DCFA 1RI7A 2VXZA 4UVAA 1BIBA 1G6NA 2HS5A 1O3TA 1QZZA 4KDPA 4E70A 1IUYA 2YSRA 3FXUA 1QPMA 2HYFA 5K1YA 2VE8A 5HDNA 2XIGA 3KEQA 1YTYA 2W57A 2VOPA 4LLGF 5DEQA 4IPAA 3ZN0A 1P92A 2KJBA 2XUBA 2HQNA 1TTYA 4RB0A 1NHAA 2QENA 4L9JA 2FBKA 1KU2A 2QM3A 3RDIA 5D8KB 2HYGD 3GYHX 3TO7A 5JI6A 4KYWA 1SD6A 5DCMA 3J81Z 3HRUA 4MTEA 1J2XA 3JTGA 2AXLA 3WTYC 1FZPB 1B9MA 1ON1A 5D4RA 4HLYA 5AONA 2FMYA 5K5QA 4GO1A 2XAHA 4I98B 1BOAA 2MC3A 4UVBA 3FZVA 3BY6A 1TNSA 3ZN1A 3BPVA 4IVNA 3JSOA 3KFWX 1WSUA 2XKPA 4AWXB 5LHGA 4GYIA 2PBIA 5FLXZ 2B0LA 3WU0A 3FXRA 1MD0A 3B73A 4HDUA 1XMKA 4HA8A 1J9IA 5EEGA 1OYWA 2ZMEB 1R00A 5HS9A 3HTSB 4HBLA 1LEAA 2IA1A 2P6TA 2FF4A 2EWNA 5FLXK 1O3QA 3HTUA 1FP1D 4ZH4F 4WXCA 3CO6C 1SFXA 4S05A 3QP6A 2K4BA 4LFUA 3JTHA 4ZYHA 3CUQC 1WWXA 5K5RA 3KP6A 2FU4A 4QWQA 1J5YA 3KLNA 3HRMA 2ZJ2A 4B8XA 3KETA 3LQQA 3ZMDA 3IWFA 1KU7A 1G3SA 2HKOA 2O61A 3L00A 2MLGA 4RB1A 1F1ZA 1FLIA 3NQOA 3TOAA 4M71A 3TO6A 2P5VA 3ERED 1W5TA 4RAYA 3DPLC 2H94A 2K86A 2M30A 1FBUA 5D5XB 3E6CC 4HDVA 3G3ZA 1J7KA 4D0PA 5D5WB 5D4SA 4PGGA 1UHMA 1MDMB 1R5GA 1LB2A 5H6RA 4U88A 3EETA 3I54A 3LSTA 3CDHA 2L4MA 4G9YA 4MEYF 2L02A 3V4GA 2NS0A 4LB5A 5E8GA 5L3CA 2DT5A 4KUMA 4EJOA 3ZMUA 1ZGJA 2ZNYA 4LMYA 2QYOA 1XDSA 5L3GA 4L9NA 1EV7A 3RYPA 1DP7P 1XDUA 1O3SA 4BNCA 4UNOA 2ADUA 2FQ3A 2XAJA 1IF1A 2EFOA 1P2FA 2XVCA 2YX4A 4GGGA 1ON2A 3LA2A 1B4AA 3O3KA 1G3YA 2ZBKA 1ZG1A 1HW2A 4HF1A 2ZCWA 1OKRA 3G73A 5AIQA 3IWZA 3CO7C 2DLLA 5D5VB 1MDMA 3E5QA 3W6KB 1JXSA 2KJCA 3TGNA 3N97A 2UWMA 4PDKA 2FBIA 3JW4A 4HX4A 1TBXA 5L3DA 2OAZA 3J80K 1I27A 2P5KA 3MZYA 4NB5A 5CLSA 4KIFA 3P9IA 1E17A 1LDJA 1G4DA 5F6FA 1U5TA 2RGVA 4RB3C 2EV5A 1VTNC 1R58A 1RNLA 1FX7A 1RUOA 3IRRA 2FMLA 2M87A 2A07F 1S3JA 3PFIA 3IKTA 1LEBA 4I01A 4A2UA 2NYXA 3HIFA 2O8XA 1FBQA 4OMYA 3ZMTA 2GQQA 4I2OA 3TDUC 1O57A 1G3TA 1YYVA 3F3XA 3GZ5A 3LFKA 3BJOA 1ZG3A 4A0ZA 2DQLA 3MQ0A 3CLOA 4YFXF 1BJAA 1UCRA 3FWEA 3ZQ7A 1HQCA 5H6QA 1UB9A 1R23A 1T6SA 4MHGA 3VODA 1D3YA 2Y75A 4L5IA 1SD4A 1V4RA 3E5XA 5LEKA 2DBBA 4UV9A 3LAPA 2M8EA 3SQNA 1J59A 5BPIA 2CGPA 2R7FA 2NRAC 2DK5A 1IXCA 2Z33A 1U6GA 3FMSA 3P9KA 4RS8A 2W84A 2IJLA 3EDPA 2RDPA 3T1BA 1XGNA 2VBXA 3V8LA 1Z6RA 1FYKA 2XAGA 2PG4A 2A5YB 1YW9A 4A6DA 2LSOA 4JBAA 2P6SA 3REOA 1ZRDA 4RGRA 4MGRA 4EM0B 3BPXA 3CUQB 4YFNF 1OMIA 3C7JA 4HF0A 4P5OA 4IHSA 2H6CA 2ISZA 4P9FA 1IZ1A 1MJBA 3CUQA 2GA1A 3IL2A 3BWGA 2ZNZA 1Z6TA 3DPTA 3VOEA 3DP7A 4LJZF 4AVPA 1V3FA 1WQ2A 4HZFA 3VEPA 2O6GE 3GZ6A 4A0XA 3IRQA 1ONVA 2GIVA 4GYGA 3K0LA 4A0YA 2JPBA 3HOTA 2CWEA 4BXUA 1TQPA 2BBYA 2HTJA 1HW1A 1IN7A 4YG2F 1GXQA 2QWWA 4EM1A 5HOOA 1S7AA 4P9UA 1ZLKA 1FY7A 4U7DA 1W5SA 4HAMA 2LDUA 2V9VA 4FX4A 1P4AA 2OD5A 3FM5A 3WE3A 1R7JA 3F21A 5CVIA 2ISYA 2MH9A 1Z91A 4GXOA 1GXPA 1ULYA 4AD9A 4KMUX 4LLNA 3BJAA 5JHUA 2JT1A 2XAFA 3PQKA 4HQEA 4MQVA 4CXFA 5LBQA 3C18A 1F5TA 1FSEA 3F8FA 2DK8A 1FSHA 1F4KA 2EFWA 1WI9A 1PUEE 2GZWA 1EH6A 3L9FA 2UXNA 4HX8A 2C6YA 1W7PA 1FPQA 1I1SA 1HKSA 5J6XA 4LB6B 3QU3A 5DYMA 1HSTA 1K78A 4FT8A 3WGGA 2K02A 2QQAA 2E7WA 2YR2A 3QPTA 3I58A 4CGZA 2DPDA 5BOXA 1YW8A 2KKOA 1E2XA 1IXRC 5LGTA 4HV6A 2P8TA 1HXDA 3KP2A 4ESJA 2DAOA 5KK1A 5JFRA 3IC7A 1TLHB 4LGWA 2XRNA 4L9TA 1KGSA 1OPCA 5E1ZB 3SFZA 2V1UA 3J80Z 3GUDA 3HSFA 4I0AA 2O0YA 3I71A 2DPUA 2HFHA 4Q47A 2OQGA 2QLZA 2JTVA 4LK0F 1R1TA 2DU9A 1I5ZA 1ZARA 2PFBA 1YS7A 2FEZA 3HYIA 3WU1B 1J75A 3RKWA 1XGMA 1HKTA 1S8NA 1CF7B 3WTUC 1DUXC 4BHBA 2EV6A 1HSJA 3TQNA 4L9VA 5BPDA 2CG4A 3F22A 5ILSA 1LNWA 4XLPF 2E7XA 5L3EA 4XSZF 3R6SA 4XBFA 3RYRA 2D2WA 1PDNC 1W7PD 1W7PB 4P55A 4QLCU 2H6BA 5HS8A 2IVMA 4M9ZA 2K27A 3U2RA 3HUGA 1ZRCA 2ZKZA 1PP7U 3PQJA 3KEOA 3KP3A 2ELHA 2L54A 3GLXA 3DV8A 1ODDA 1QZYA 2Z5UA 1BN5A 5BQTA 2QQ9A 3F8CA 3I0TA 5AIPA 4EJWA 2HWVA 2IT0A 3HRTA 2QZ8A 1BI0A 3V8KA 4HX7A 4O3MA 3K9TA 3K1NA 5DDGA 1XSVA 4RGXA 2WTEA 1D8JA 3P9CA 3RKYA 2FA5A 3WTXC 3BROA 5FO5A 5CVRA 2HOEA 3L2CA 5J8CA 2OBPA 3R4KA 2MD5A 3S2WA 1EH7A 1XCBA 2UXXA 1Y0UA 2CQKA 2VBZA 4G7OF 4R8HA 4L0YB 2IA2A 4F7ZA 4K2EA 2J5OA 4IF4A 4RGUA 2WV0A 3HHGA 1H9TA 2F5EA 3T5XA 1BBYA 2HQRA 2VC1A 3E6MA 3GFLA 1G3WA 4M73A 2PMUA 3QPHA 2GXBA 3D0SA 3ZMZA 4ASNA 2WWYA 1B9NA 5CVUA 2Z99A 2OZUA 1SD7A 2CW0F 1SFUA 2Q0OA 1WKMA 5ILVA 1FC3A 2OA4A 1MJ9A 3ZP5A 3QOPA 3HHHA 1FYLA 4WK8F 5CVJA 3BJ6A 3NRVA 5K5OA 4G7ZF 6PAXA 1QQIA 2IW5A 3COAC 4KICA 4ENKA 1L3LA 4RGSA 4HV5A 2TDXA 4EMSA 1U3EM 2VBYA 4Q48A 5ICGA 2A3SA 3B02A 5D6FA 2P4WA 1YG2A 3RIRA 2FE3A 3TO9A 1K7AA 1AOYA 1R1UA 1LDDA 4HQMA 2BYVE 4EV0A 3GFJA 4YIIA 1L0OC 1XSDA 2ZXJA 3WTZA 4WWCA 5L3FA 1FBSA 4CICA 1YFHA 5A2QK 1XMAA 4MEXF 1XGOA 2X4HA 1XGSA 1XCVA 4A12A 2LKPA 2IPQX 5LHHA 3J7AO 1BC8C 4DNCA 3Q5FA 2G7UA 1IAWA 4HYEA 3GW2A 5FGMA 1K79A 3T8RA 4ZYEA 2P5LC 5KVRA 3EYYA 1IXSB 4YIFA 2ESNA 4JK1X 4BYYA 2CYYA 4M6YA 2ZFWA 2FSWA 1U5TB 2A6EF 5ICFA 5LGNA 2QBYB 1GHCA 1USSA 3R61A 5DD8A 4DQ2A 2CFXA 3DQVC 2FXAA 1O3RA 2JZYA 1HBXG 5IT3A 3K1PA 1AWCA 3E6DA 4I02A 5D6EA 2IRFG 3TKYA 1KA8A 4EQQA 1MKMA 5HDGA 1QNTA 4H0EA 3GX4X 1XSXA 5HVQC 1KQ8A 2MBFA 3KP4A 2W85A 2OU2A 3QU6A 1JHFA 1F9NA 1IN5A 3K2ZA 4G7HF 4WF2A 2Z9OA 4L18B 2QVOA 1ZHFA 4UUVA 2FRHA 1IRFA 2ETHA 1CF7A 2HZTA 2JRTA 1YO5C 1D8KA 2KIMA 1MJAA 3E3VA 1YQAA 1RUNA 3ZMVA 5FB2A 4R79A 5CYVA 3FM3A 1SMTA 1YIOA 3ML6A 1USTA 5E8IA 1SFEA 4ESBA 1QO0D 4UVCA 2RV8A 2VBWA 3VB2A 2DQRA 1WRJA 2HR3A 1A04A 2V79A 2F5CA 4ON0A 3F6OA 3Q9SA 3R0JA 2PI0A 1B1BA 1KU9A 2DTRA 2V6CA 2ZO4A 3RPUA 1HKQA 5DV5A 4ENMA 3MAJA 3RPQA 3ZMSA 3HSRA 5TRDA 4EGZA 1ZYRF 5E1WA 2XASA 5BS6A 3F6VA 1TQMA 3VFZA
chains in the Genus database with same CATH superfamily
2X0LA 3BDDA 4EEFG 3L7WA 2CV0A 3L1PA 4AIKA 3G1LA 4OIOF 2DA3A 4OOIA 2K9MA 1XB4A 4KN7X 3MVPA 3EUHA 1TQIA 2E34A 3OSGA 3PIOF 3MKWB 2IXSA 4Z2YA 5IY5H 2JMWA 1BW6A 1IO2A 3BOQA 2CRGA 5KHDA 1BM9A 3S1RJ 3WGHA 2BZTA 1UHWA 3F23A 2A6TA 3DEUA 2R7ZJ 2JUGA 2EFNA 2ESHA 2VQLA 1FIAA 3T0YA 4D1QA 1TL8A 3FMQA 2B9SA 4Y7NJ 1JUSA 2B63J 2W25A 4W1UA 3VYTB 4MTDA 2EA4A 3M7GA 3AAFA 1MMGA 2CUFA 2AQFA 3DTEA 2FBHA 4CZZA 3OYLA 4A3MJ 3IH4A 2JK3A 5DTDA 1XN7A 3GXOA 2W7NA 3MZHA 2NNNA 4XOTA 5B66C 5ICCA 2OQRA 2XV4S 4B4CA 2A5WA 2E1NA 5IYDJ 2EIMH 2G0EA 1DPRA 4U0YA 1WJCA 2BEOA 2LY1A 3GF2A 2EV0A 3K1MA 3F8MA 3OR2C 3QP5A 3TW7A 3VPRA 4A6EA 4C2TA 2RNJA 4JQFA 4M6VA 2QQBA 4KFCA 4BQAA 2PN6A 5D8LB 3MFKA 3CESA 3H3ZA 4ZYGA 3WTTC 1UELB 1X4OA 5LD2C 3ASOH 3QODA 4IHVA 5H20A 4OAZA 4UXNA 2QUFA 4NC6A 3RKQA 2O8KA 2H8RA 1VQ6I 4DIQA 1LQ1A 1Z3XA 4O5VA 1VQMI 3SZPA 5EEHA 4XICA 1BR4A 5DUIA 1FYMA 2PEXA 2FJ1A 1K6OA 1IN8A 1GV2A 4LD5A 2J5PA 1Z05A 1LFPA 2CH0A 3HPGA 4M3DA 3NWSA 3NWTA 1SFOJ 1PVEA 2ME6A 2F4OB 5LRSA 1DQUA 2R3SA 2X85A 5DM6F 2JPCA 2BXZA 2HI3A 5E20A 4IKFA 2Q2EA 1R1VA 4KA4A 4IJAA 4HEA2 1OJLA 5F1JA 3FXQA 3ROUA 1P6RA 5ICEA 1RIOH 4Y15A 2L7KA 2FOWA 3S1NJ 4P96A 1JTXA 4M72A 4AU7A 3OSFA 1GV5A 2F5FA 3C3WA 2HQAA 1OR7C 2W82A 2LR8A 4U0WA 4ANJA 4D9JA 5HLIA 3I64A 3HZJA 3BP8A 2P7VB 3HXLA 1X1PA 4G6QA 4CYCA 3DKXA 2I8DA 3D5RC 4RAZA 5KNLA 1SMYF 4TV7A 4UV8A 1H0MA 5HLHA 4BEHA 1LVAA 3E6BA 4RM2A 2ACJA 2R7UA 3OYBA 1FT9A 3WTVC 3KZZA 2DYRH 2LBFA 3GTQJ 1ZH5A 1LFUP 5BMZA 3CJNA 1Y6IA 3OR1C 3NAUA 1SAXA 3FHZA 2BVLA 1Q1HA 3I4PA 1IN6A 1T0FC 2WB1N 3BTLA 3QYBA 1QZEA 3EYIA 3DF8A 4X1EA 5GTIC 3LFUA 4EJTA 4BY7J 3J81K 2YU9J 3ABUA 3U1DA 3B6AA 2M45A 4C2MJ 5LEJA 4S04A 1K4TA 1K78B 4IEJA 2GWRA 2PJRB 4R1HA 2DO7A 4ZZLA 1Z7UA 4B09A 1VQOI 3R60A 2VT2A 3CCMI 3PNTA 4BXFA 5FFXA 2M2EA 1SD5A 4A5MA 3HOSA 3I59A 5IOYA 3I4NJ 1SVMA 2V26A 2RQPA 3BZ6A 3DTKA 3MCZA 3C1DA 2Z3YA 3SXYA 3BTJA 1BI1A 2X1EA 3CCJI 4ITVA 2F5DA 1XG1A 2K4JA 1S72I 5JLXA 2RKHA 1BR1A 3LSHA 2ZJRF 4F55A 1KU3A 1LJ9A 2EPFA 5K7HA 1U8RA 2VKDA 2YX7A 3OYCA 4AYBA 3QQAA 4A3DJ 1HC8A 3AG1H 2EINH 3A2KA 2EZLA 1ZTRA 3QAHA 4FHTA 3SZGA 1YLFA 3O6BB 4BE2A 4UY8I 2Y48A 2HGCA 1J0RA 3V7RA 3K69A 5F04A 2JUCA 3ERMA 3ULQB 2MLKA 2N8GA 3DFGA 1REPC 2YPRA 2KRFA 5ED4A 2LC2A 4C3IJ 4LG0A 3X2QH 3IKVA 2XC7A 2XGXA 3L2VA 1TNTA 2BHZA 5FD5A 3ISPA 3GVAA 3EQLF 3RPUD 4RB2C 4PJJA 3HL2A 3I56I 4ETSA 3JRBA 3J7AY 4G8XA 5CVVA 4NHJA 4XR6A 2LMDA 1LDKB 2VT3A 3CUOA 1C0WA 3BCBA 3ZR8X 1YE9A 4KNYA 1OCOH 3OY9A 3JRAA 1R36A 3CCUI 3QOEA 1BIAA 4WCGA 2DW4A 2YU3A 4Q4ZF 3IUOA 4ESFA 1JGGA 1OLTA 4PJLA 4OINF 2IS4A 1B6AA 2EJRA 2GOXB 3E5UA 3FXOA 3GFIA 2UZKA 1WPKA 5F1RA 1I3AA 4WXDA 4NQWA 2VN2A 1XMXA 1RETA 2DMUA 5GTHC 2OZ6A 3DKYA 3MEXA 3BR0A 3PSIA 1A31A 4ZDLA 3K70C 2KRCA 5K7FA 4HW0A 1XD7A 1X3ZB 2H27A 4XL9A 2DA2A 2VL8A 4IL6C 2H1KA 3PM1A 1LUJB 1Z1DA 2M7AA 3FX3A 2WBMA 3BR3A 2NVXJ 1HW5A 2X9DA 4ZDPA 2VKVA 5GP9A 2WC2A 2XDVA 3I9V2 5DCMB 5E79C 3KIOA 2X51A 1JKPC 3W6JB 2G7HA 2X48A 3JAMZ 4XLNF 1OCCH 4A3LJ 4JYKA 1MGTA 3V8JA 1B72B 2NS7A 1KYWA 3C2BA 4PGHA 3BG5A 3G1MA 2L3DA 1Z9CA 3S1QJ 5JR3A 2A68F 3AFHA 1MNMC 3BR5A 1X3WB 3RJPA 2LNBA 2DMPA 2VE9A 5J8FA 4CHUA 2DTZA 1SVLA 1YITI 1V55H 1BJZA 5F64A 4X0GA 3RKXA 2R5YB 3GLLA 4OMZA 4XSXF 3U9GA 1FIPA 2Q2EB 4M6XA 3JSPA 3SJMA 4XRSA 1I6XA 3M8EA 1RKWA 4NC7A 4EM2A 3C2GA 3L09A 3OYNA 3GTOJ 2QF7A 1RZ4A 1MNDA 3CP2A 3M4OJ 1VQ5I 4BAYA 4CDGA 3GTLJ 2EIKH 1T2KA 1KQ0A 2IGOA 2MYSA 2V6EA 2D45A 1O7LA 1IRXA 2KMUA 2I5UA 1X3UA 1QHHD 3WTWC 1D5YA 3SYTA 2GXGA 1VQ8I 3TW6A 5EF6A 1FWZA 2IS2A 4L0ZB 4ENNA 4CYDA 1H9GA 2PQ8A 5B5EC 3HOYJ 2CW7A 3RI4A 2STTA 4IHTA 5E17F 1LVKA 1VFCA 2BW3B 1W4MA 4I76A 4M9XA 4QIWN 2QA4I 1ETOA 1JUMA 2DI3A 4Z6YA 2W00A 2DOFA 1UG0A 1DDNA 2JSCA 1W0TA 2QSGX 1K61A 2IAIA 4A3KJ 3NARA 2NNYA 3SZTA 5GAHJ 4LG0B 2HXIA 4EJVA 3QPSA 2XKOA 2W4SA 2A61A 2DOAA 4U7BA 3P7NA 2G9WA 2R7VA 3ECHA 3LSKA 4NDLA 2D1VA 1YS6A 1P4XA 1B59A 3T8TA 4XRFA 3V7SA 5E1XA 3HRSA 2VC0A 2HYJA 2M8GX 4Q5SF 4KIGA 4XLAA 2LYCA 3F8NA 1U2WA 3WTSC 1I1GA 2L9RA 5HS7A 3KE2A 3LQRA 5F0CA 3KCCA 4UHTA 5H2FC 2B7EA 3IHUA 1VQLI 1D5VA 3GMEA 2O7OA 4XK4A 2E71A 1IV6A 3MWMA 3BT9A 4XKBA 5IPAA 2E35A 2FOKA 2ZMEC 1SANA 5CPRB 4KT6A 2JA7J 3Q9VA 4XOPA 3LSIA 3CJQB 2RN7A 3FMRA 3I59B 4IRGA 4YIRX 1Y39A 2JA8J 1T98A 2BGCA 4M74A 1FOKA 4II3A 5EYRA 1ETYA 1FP2A 3CTAA 4F93B 1UAAA 4IRHA 3IH3A 1OYIA 3OYIA 2BE5F 2COMA 2VQHA 4XKCA 3WHCA 3A4CA 2ZC2A 4G94A 5A2QZ 2O9LA 1ETQA 1G2HA 2HDWA 5LRRA 2BVMA 4M9SA 4IOCF 5FRMA 3HM5A 3RZDJ 4U0VA 1BA5A 4AYBN 2CV2A 5B1BH 4DYQA 4MNUA 5B3SH 3ABLH 4EJUA 1FOYA 2Q8KA 2PMHA 4ZZDA 3E97A 5DD4A 4UUSA 1ERDA 4LIVA 2DMQA 1VF9A 2RVCA 3OYKA 3LL7A 1S29A 2ZMEA 1IN4A 3ONQA 3R0AA 3TEDA 4ZYDA 2NOJB 4Y17A 4N9HA 1JE8A 3PNYA 4JOMA 4E6KG 4Y33A 4YRVA 2M0MA 4DGWB 5GAEJ 1OYYA 4RLQA 1DGRM 2XAUA 3K2AA 2P0WA 3KZYA 3WE2A 2JA2A 3W3CA 4CYCB 1U78A 3OYGA 1DU6A 2GAUA 2HKXA 4LK1F 4CCJA 1T39A 2W24A 1SVOA 3ZPLA 4W97A 4G6DA 1BC7C 2E1CA 1PP8F 4OU0A 5LLQA 1S7OA 2LP0A 4ENJA 1G59A 4C2UA 4NNJA 2XROA 5D5UB 1IRGA 3I3LA 3BQZA 2EA2A 4F91B 2E2HJ 2VQGA 1IW7F 5EZHA 5TJJA 3VSKA 4WX9A 4AIDA 2K7LA 3MD2A 2LF7A 2BY0A 3CC4I 1G8XA 5HDKA 2LVSA 1TW3A 3H3UA 1P4WA 2CUZA 2R4GA 2ECCA 3DU6A 4KMFA 4ZJZA 2STWA 1BI3A 3WGIA 3ELKA 3CMMA 1ZG5A 1J09A 3KLOA 1ZAOA 5FRNA 2GA2A 5EGOB 4L5JA 1EH8A 2LD5A 1OQYA 3ECOA 2V1XA 3TOBA 3I53A 3M8FA 2EK5A 3S93A 5E18F 3HBLA 3ABTA 2QKMB 1BR2A 2GBYA 1ITYA 2M1BA 2ZJQF 4XRSG 4BH9A 1O7FA 2VXDA 1W36C 3TDZC 3H9QA 3O2PE 2D1HA 2FNPA 3KP5A 3IV5A 1YW7A 4Y13A 4N0BA 4AIJA 3DKWA 5EG0B 2EB7A 2MH2A 4A5NA 5L3BA 3H92A 2P7CB 2VONA 1OR7A 1P7JA 2R7DA 1JGSA 2DJIA 3Q0UA 2WY7Q 1S9HA 1Z3YA 2XAQA 1QBJA 2HNHA 4XLEA 3S32A 4FX0A 2EFQA 4KN4X 1QA6A 3NEUA 3OL4A 2F6CA 1RRJA 1W1WE 5IYBJ 5LHIA 5CJ9A 3LAJA 3HGYA 3JAMK 4E7ZA 3QRFF 1VQ4I 1V54H 3M9AA 5HLGA 4FASD 4FQGA 3H9GA 4YFKF 3BR6A 3KP7A 5FLVA 4OIPF 3BC8A 2FX0A 2Y0SN 3V7CA 3HSEA 1NTCA 4B3XA 2F2EA 4HLXA 3F72A 3L2WA 2EIJH 2PLYA 2HDCA 1XX5A 2K9NA 2CS3A 3LWFA 1DPUA 4HOBA 3GEZA 2AS5F 1MBGA 3GTGJ 4HSRA 1RC9A 3B6CA 3OV8A 4KIBA 4I09A 2O03A 3CDIA 3LOCA 5IOZA 1H88C 3HKZA 5EGOA 1A6IA 4PCQA 5TISC 2VLAA 1T38A 2NAZA 4CO8A 2WAQA 1U5TC 2NVYJ 5ILUA 1LKXA 4EGYA 2PJPA 2L01A 2FNAA 2KL4A 2H09A 1EJ9A 1TW2A 3GFMA 2ID3A 3SHFA 2M0CA 4GCVA 5ERIA 2KIUA 4D5CA 3V42A 1Q1VA 5DUKA 1MSFC 4KT5C 3FDYA 4OIQF 3DEEA 5F0HA 1X1AA 4RA2A 3N4MA 3DXJF 3GWZA 4EATA 2WAQN 4U87A 2X6OA 1ZN2A 4WXHA 2DOEA 3G4SI 5FD6A 1XPXA 2CSOA 2RC4A 4RAFA 3LA7A 1TWAJ 3RTRA 1YIJI 2LF8A 3ZCOA 2L4AA 1R22A 3FKJA 3JRHA 2XPUA 2V1DA 5LGUA 3WHBA 2Z2SB 1CGPA 4DBQA 4IZZA 1Y8RB 3HDDA 2HTSA 1IJWC 1LE8B 4O6JA 3HGGA 2A69F 4FETA 3DBRB 5FKOA 1I39A 4DZJA 2K3PA 4N9IA 2A6HF 4B1RA 2HEOA 1T0FA 1TWFJ 3VYUB 3MKZA 2KQRA 4IO9F 1V5EA 4MQ9F 1STZA 1R5HA 4I0BA 4BU2A 2IP2A 2Y0MA 4HNTA 1JHHA 3G1OA 2HVSA 4LIUA 3DWLE 5FFZA 3HC7A 3TP3A 3K4NA 4I7HA 4C9YA 2BV6A 1MZBA 4NQWB 1IDZA 2KT0A 4KISA 4XMYA 3K7AJ 3WG9A 2WV1A 2M5WA 1EKEA 1X1BA 2MA3A 5C3EJ 3WODF 2DFIA 2EFPA 1VNDA 3G6EI 2KLOA 2CO5A 2GM4A 1S6LA 1D1AA 2KIFA 4Y52J 3CCQI 3GO5A 5J4YA 3PFYA 3HOVJ 1WJFA 2XRLA 4BHPA 5IT9K 2XF7A 3DLAA 4OIRF 4IRIA 1WJ5A 1RESA 2VODA 3OIOA 4BJ6C 5E3MA 1ZRFA 1KQ9A 3A0HC 1OCZH 1MBJA 2JRMA 4AIHA 4IXAA 3ASNH 4C3HJ 5J40A 4EVIA 1JT0A 2QBYA 2K9QA 4HF2A 1GVJA 5JVTA 1ZLJA 4CZCA 3LA3A 4BHCA 3KEYA 3TMOA 2E36A 3S8PA 3GTJJ 3H3VK 1WJDA 1BI2A 2IA0A 2XHKA 3BLYA 2LK2A 5FKKA 4LLLA 4PZJA 1QGPA 1ZGAA 2O3FA 4FE4A 2I10A 4QSHA 5IT9Z 3D5LA 1D0YA 3OOPA 3C2HA 3W2WA 2QCOA 1UFMA 2ZXWH 3BZCA 3SEZA 4HSTA 2TCTA 2XGDA 2V9KA 2VOOA 4XQFA 4V2GA 5LFAA 3JR9A 1ZREA 1V5FA 4DW6A 3FXMA 3H1CA 3M1EA 2OTJI 3I5UA 4QPOA 3BG7A 1KYZA 3FF5A 1FNNA 1HDDC 3RZOJ 3K10A 3VSLA 3ZQHA 1ENHA 4CUGA 3F8BA 5DCFA 2DN0A 4HG2A 1MH3A 1RI7A 3SFIA 2VXZA 4UVAA 1BIBA 1G6NA 2HS5A 1O3TA 3L2QA 9ANTA 1T08B 1QZZA 4KDPA 4XN0A 3PIPF 4E70A 1IUYA 2YSRA 3FXUA 3H35A 3PO3J 1QPMA 3P5JA 4MFEA 2HYFA 2FUG2 2LOOA 5K1YA 2VE8A 5HDNA 2XIGA 3KEQA 1YTYA 1R5ID 2W57A 3HUGB 4BJTA 2VOPA 3DU5A 1WFXA 2Y9YA 4XONA 1MW7A 4LLGF 5DEQA 1UJ8A 4M3FA 1E3PA 3JRFA 3GTPJ 4IPAA 2KISA 2VJIA 3ZN0A 4PSXA 2WAEA 2Z1DA 1P92A 2KJBA 2XUBA 3AG2H 2HQNA 4BJ5C 3JCUC 1TTYA 2XPVA 2GOMA 4RB0A 2JVHA 4CCMA 1NHAA 3KZIC 3CMAI 2R7QA 2QENA 4L9JA 5M5YJ 2FBKA 1KU2A 2KZGA 2QM3A 4KITB 3RDIA 5D8KB 2HYGD 4FE7A 3GYHX 3TO7A 5JI6A 4KYWA 1SD6A 4E7SA 5DCMA 3Q0VA 3J81Z 3HRUA 1MIJA 4MTEA 1J2XA 1T33A 3JTGA 2AXLA 4KJZA 3VDXA 3WTYC 1FZPB 2Y0SA 1I6HJ 3OS0A 1B9MA 2E2JJ 1X4PA 1ON1A 2XB5A 2F5VA 2W48A 2ZSHB 5D4RA 3W2AA 4HNVA 4HLYA 5AONA 2FMYA 2WY8Q 4GO1A 2KP6A 5K5QA 2XAHA 4I98B 3LSMA 2IBDA 4A3IJ 1BOAA 2K9SA 2MC3A 4UVBA 2IGMA 2JJ7A 3FZVA 3BY6A 1TNSA 3ZN1A 3BPVA 4BS9A 3CF5F 2HOAA 4IVNA 2M4GA 3JSOA 3KFWX 1WSUA 2XKPA 4AWXB 2M34A 5LHGA 3FISA 2PBIA 2KRHA 4GYIA 1MMSA 5FLXZ 2B0LA 3WU0A 3FXRA 1MD0A 3B73A 4HDUA 3DBLB 3N05A 1XMKA 4HA8A 3CCRI 2Z16A 1VQ7I 1J9IA 3CCYA 1QVUA 2VB6A 5EEGA 2R5ZA 1OYWA 5HODA 4XLCA 2ZMEB 1R00A 5HS9A 1O4XA 3HTSB 4HBLA 1HOMA 3BTIA 1X2NA 1LEAA 2IA1A 2P6TA 3S2HJ 2DMTA 1ORKA 2FF4A 3PUBA 2EWNA 5FLXK 1AKHB 1O3QA 3HTUA 3AKZA 4Y4RA 1VZ0A 1FP1D 2QSFX 4WXCA 4ZH4F 3CO6C 1SFXA 4S05A 1QRYA 3QP6A 2K4BA 4LFUA 1MBEA 1VQ9I 3JTHA 4ZYHA 1TWCJ 3IAM2 3CUQC 1WWXA 2JVGA 4OWRB 1CQTA 5K5RA 1U0JA 3KP6A 4IQ4A 3S14J 3H5AA 3DEWA 2FD5A 5IP7J 4AC0A 2FU4A 4QWQA 1J5YA 3MN2A 5EEAA 3KLNA 5C44J 3HRMA 1B8IB 3UR3C 5HLTA 1E3HA 3G2BA 1TP4A 2BY2A 4I6ZA 3CCSI 4BDZA 2ZJ2A 4B8XA 3A03A 3KETA 2ELKA 3LQQA 3ZMDA 3IWFA 4XKWA 1KU7A 1P9QC 1G3SA 1Z0XA 5GADJ 1N75A 4PJNA 2HDDA 2HKOA 2O61A 3FKIJ 3L00A 2PMZA 2MLGA 3A1YA 4RB1A 1F1ZA 1FLIA 3NQOA 2R92J 3TOAA 5JLWA 1R71A 3Q0WA 3I4MJ 4M71A 4IHWA 4IOAF 2VQCA 3FIWA 2R7SA 3TO6A 1B8IA 5F27A 3LMMA 2P5VA 3ERED 1N78A 2R7XA 1W5TA 1U9OA 1PUFA 1JJ8C 4RAYA 2RNGA 3DPLC 2H94A 3ZOBA 2K86A 3O8HA 2M30A 1FBUA 5D5XB 3E6CC 4HDVA 4H4KC 3G3ZA 2W1OA 3BTCA 1J7KA 4D0PA 5D5WB 5J4VA 5D4SA 1X2MA 4PGGA 2VI6A 3BQYA 3BG6A 1X1CA 5M5XJ 1UHMA 1XC5A 2JN6A 1MDMB 1UHSA 1R5GA 4CH7A 3F9KA 2LBFB 1LB2A 5H6RA 3BCAA 2X6YA 1Z21A 4U88A 1E3OC 3ABMH 4BEHB 2CW8A 3EETA 3I54A 3LSTA 2R5ZB 3CDHA 2LRDA 4PK4A 2L4MA 4BY1J 2X6WA 4G9YA 5IYCJ 4MEYF 4RDUA 1BOBA 2L02A 1HA8A 3V4GA 2NS0A 1YX3A 4LB5A 3KPHA 2A05A 5E8GA 2DT5A 5L3CA 3SDGA 4KUMA 2Q1ZB 5JHFA 4E7LA 2CQ7A 4EJOA 1JI8A 3M1CA 3ZMUA 3J7YJ 1R6RA 1ZGJA 3SEQA 2ZNYA 4LMYA 1IGNA 2QYOA 3QYEA 2NS8A 3ZQIA 1XDSA 5L3GA 4L9NA 1EV7A 3RYPA 2DDBA 5GPCA 3S3NA 1H8AC 4D7MA 3HOUJ 5CKTA 3ZQLA 1DP7P 1XDUA 1O3SA 2E2IJ 4BNCA 2WA0A 4UNOA 3CCVI 2ADUA 2FQ3A 2WB1A 2WAFA 2XAJA 1IF1A 2EFOA 1P2FA 1I50J 2XVCA 2YX4A 2UUZA 3ZQCA 4GGGA 1ON2A 2RREA 5B1AH 3LA2A 1B4AA 4BE0A 3O3KA 1G3YA 2ZBKA 5IP6A 1ZG1A 2H8WA 1YOVB 1HW2A 4HF1A 2ZCWA 2KDZA 2EILH 3CMEI 3OYEA 3OOUA 2LFBA 1W5CC 2CUJA 4M3BA 1OKRA 2L7ZA 3G73A 2MC4A 5AIQA 3IWZA 3CO7C 2DLLA 4X6AJ 3PNVA 4BQOA 5D5VB 1MDMA 3OYMA 1MMDA 2EZIA 3E5QA 2F4MB 3W6KB 4BQNA 2QKLB 2LY2A 1JXSA 1NG7A 4ABZA 2KJCA 3TGNA 1TT5B 3N97A 3OYHA 2LREA 2UWMA 3PJRA 5JVGF 4PDKA 1F36A 2FBIA 1Z77A 3JW4A 4HX4A 1Y1WJ 1TBXA 5L3DA 3TP0A 1IDYA 2OAZA 3J80K 1I27A 1YJWI 2P5KA 3MZYA 4NB5A 5CLSA 2ZFUA 2DA1A 4KIFA 3P9IA 3OWTA 2E5NA 5M3FJ 3AG3H 1E17A 2MGQA 2Y30A 1LDJA 1G4DA 2LLKA 5F6FA 2E19A 1U5TA 2RGVA 3S17J 2DA7A 4RB3C 1ETWA 2EV5A 1RR7A 1VTNC 1R58A 1RNLA 1FX7A 1LPQA 5FKMA 3BG9A 1ZGWA 1RUOA 3IRRA 2FMLA 2M87A 3TL4X 2A07F 4L5EA 2QQ8A 1ZR2A 1S3JA 2CFOA 3PFIA 4LITA 3IKTA 2GLOA 4I01A 1LEBA 1GUUA 2KDOA 4UB8C 2L7FP 4A2UA 3H5RA 2GIZA 4QPQA 2E60A 2NYXA 1JKQC 2OV7A 3HIFA 2XSJC 2KIQA 2O8XA 2XB0X 4MO7A 4A3BJ 1FBQA 1D1CA 4OMYA 3ZMTA 2DFFA 2ZB9A 2GQQA 2QSHX 3GTKJ 1GT0C 1TWGJ 4I2OA 3TDUC 1E0EA 2R7RA 2BHYA 1O57A 4YEJA 4B43A 1G3TA 1YYVA 3F3XA 3GZ5A 2CJJA 3BJOA 3LFKA 1ZG3A 1BL0A 4A0ZA 2DQLA 3MQ0A 3CLOA 4YFXF 1OCTC 3CQZJ 1WJAA 1T56A 1BJAA 1MBKA 1UCRA 1UZCA 3FWEA 3JRDA 4DBRA 1EF4A 3ZQ7A 1HQCA 5H6QA 1UB9A 3D1NI 2M4KA 1UG2A 3I55I 3JRGA 1TC3C 1R23A 1D0XA 1T6SA 4MHGA 1FEXA 2VJ5A 3VODA 1D3YA 3OYJA 2Y75A 2JA5J 2ECBA 1IUFA 3EUKL 3HOWJ 4L5IA 1NK2P 2XSDC 1JKRC 1SD4A 1V4RA 2V1NA 3FXLA 3E5XA 3K6GA 3KX2A 5LEKA 2DBBA 4UV9A 3LAPA 2M8EA 4AUXA 3SQNA 5BPIA 1J59A 1RKTA 4B3AA 4HPQA 4BGDA 2CGPA 1OCRH 2R7FA 2VIXA 4MLOA 2KPMA 3U1KA 2DK5A 2NRAC 1IXCA 2Z33A 1U6GA 3FMSA 2PJRA 3P9KA 4JP0A 4BL0B 2R93J 4RS8A 2OCCH 2W84A 2IJLA 3EDPA 2RDPA 3T1BA 3HPHA 1XGNA 2IGKA 1N25A 2VBXA 3V8LA 3A01A 1Z6RA 1FYKA 2XAGA 2AXTC 2PG4A 2A5YB 4LG3A 5DM7F 1YW9A 3ZQGA 4A6DA 2LSOA 3FXKA 4A3CJ 2NVTJ 3BR2A 4JBAA 2QEXI 2K3FA 3LSRA 2P6SA 3REOA 1W36D 2R5YA 1ZRDA 3OYFA 3H0DA 4RGRA 4MGRA 2VPLA 4EM0B 2L0KA 1LE8A 3O8GA 3BPXA 3CUQB 1ZKGA 1OMIA 3C7JA 4YFNF 2C6YA 4HF0A 4P5OA 1APLC 2IGNA 1U9NA 1R9TJ 2JQ7A 4IHSA 2H6CA 2ISZA 4P9FA 3W2VA 1IZ1A 4ZTFA 1MJBA 3CUQA 2GA1A 2XF5A 1W0UA 5FKNA 1OFCX 3IL2A 4JX6A 2HOSA 3BWGA 2ZNZA 1Z6TA 2K40A 3DPTA 3S1MJ 2HQ5A 1FMWA 3VOEA 3PUFA 3DP7A 4LJZF 1D1BA 4AVPA 3VYSB 1V3FA 1R4NB 3M8JA 1WQ2A 2DFEA 4HZFA 3VEPA 2LTPA 2O6GE 3GZ6A 3K4KA 4JX5A 4G12A 4A0XA 2X1CA 1ACIA 3IRQA 1ONVA 2GIVA 1F43A 2KHMA 3MZ8A 4GYGA 3A01B 3K0LA 1MNEA 4A0YA 2JPBA 3HOTA 4E7HA 4A3EJ 2CWEA 3SDBA 4BXUA 2PX9A 1TQPA 2BBYA 2HTJA 1HF0A 2DJNA 1HW1A 1IN7A 1SEUA 4YG2F 3OIPA 1T8IA 1IC8A 1GXQA 2QWWA 4EM1A 2JSPA 1S7AA 5HOOA 4BE1A 2R7OA 4FTHA 4P9UA 1ZLKA 1FY7A 4E7KA 1PYVA 2L5QA 4PUSA 3W6VA 5KAIC 4U7DA 1W5SA 4HAMA 2DDAA 5C4JJ 2LDUA 1YI2I 2V9VA 4FX4A 2CV1A 1P4AA 3E7LA 2OD5A 3LSJA 3FM5A 3WE3A 3RSNA 3LSPA 2BY1A 1ETVA 1R7JA 3F21A 5CVIA 2ISYA 3CD6I 2MH9A 2BOLA 3JRIA 1Y8QB 4BUPA 2M3AA 4IHXA 1Z91A 1ZR4A 3H36A 5EZGA 4XNFA 4RLFA 1I3QJ 4GXOA 2VPRA 2DA6A 1GXPA 3MKLA 4JX4A 4ZYAA 3M07A 1ULYA 5K7ZA 4M3GA 4AD9A 1N77A 1PUFB 4KMUX 4LLNA 3CJRB 3ABKH 3BJAA 4V2FA 5JHUA 4FCYA 4NUBA 1GDTA 2JT1A 1FMVA 2XAFA 3PQKA 4HQEA 4MQVA 4GRIA 4CXFA 2ZSIB 2UV1A 4DYRA 5LBQA 3C18A 3H0GJ 1F5TA 1FSEA 2CQNA 5EG0A 3F8FA 2DK8A 1FSHA 1F4KA 1T95A 3K4BA 4NC8A 2EFWA 1WI9A 1WI3A 2GZWA 2VKEA 1EH6A 3VYRB 1PUEE 3L9FA 4G6TB 2EH3A 5KAFC 2UXNA 4N4OB 1FTTA 4XN3A 1R4MB 2EZKA 4HX8A 3IAS2 3GZNB 1P7IA 1W7PA 1X1DA 3DBHB 1FPQA 2OPTA 2XGCA 3L2RA 1HKSA 1I1SA 5J6XA 2COBA 4BKXA 4GDFA 4LB6B 1Y56A 2TRTA 3QU3A 4I99C 5DYMA 1HSTA 1K78A 4FT8A 1UMQA 4V19K 3CCEI 2E1MC 3WGGA 3G71I 1JKOC 2VUMJ 2K02A 2P81A 2QQAA 1YJ9I 2E7WA 2YR2A 3QPTA 3I58A 4CGZA 2DPDA 4AM3A 1AKHA 5J1UA 5BOXA 1JUPA 4YELA 1YW8A 2H1LA 4XIDA 1VI0A 2KKOA 1LFBA 3OS2A 1E2XA 1IXRC 4A69C 2K5CA 5LGTA 4HV6A 2P8TA 1HXDA 3KP2A 2CU7A 4ESJA 1DP3A 2DAOA 5KK1A 1K6YA 5JFRA 3HJEA 2V7FA 3IC7A 1TLHB 4LGWA 2XRNA 4L9TA 2E1OA 2VKHA 4ZC3A 2ZXIA 1KGSA 1OPCA 5E1ZB 4A3GJ 2X6XA 3SFZA 2V1UA 3J80Z 3GUDA 3HSFA 3K70D 2NVUB 2EQRA 2KFDA 4I0AA 1ZK8A 2MFZA 2O0YA 3I71A 3IP4B 2DPUA 2HFHA 2X1DA 4Q47A 4E7JA 3PO2J 2OQGA 2QLZA 2JTVA 4LK0F 3CLQA 1R1TA 2DU9A 1KONA 1ZQ3P 1D0ZA 1I5ZA 1MBHA 1RR8C 1ZARA 2PFBA 2MABA 3CCLI 1YS7A 3EUAA 2FEZA 1WCMJ 3HYIA 2OJED 4RBOA 1K83J 3WU1B 4UB6C 4BDYA 2CQXA 1J75A 3RKWA 1XGMA 1HKTA 2LKXA 1S8NA 1CF7B 3WTUC 1DUXC 4UUTA 4BHBA 3FK7A 2YS9A 2EV6A 1HSJA 2E1MB 3FK6A 5E3LA 3TQNA 2DA5A 3M3YJ 5C4XJ 4L9VA 5BPDA 2BY3A 3FBNB 1YRNB 2RAEA 2CG4A 3F22A 5FKLA 4AVZA 3GBGA 4A93J 5ILSA 1LNWA 2ID6A 2DMNA 4B48A 4XLPF 2E7XA 5L3EA 4XSZF 1X58A 3R6SA 4XBFA 3RYRA 4RM3A 2D2WA 1YJNI 1PDNC 1W7PD 3S3OA 1W7PB 3FHNA 2QGUA 5J3LA 1X19A 4P55A 2YUSA 3KYDB 3S2DJ 4QLCU 2H6BA 5HS8A 2IVMA 4M9ZA 2L2OA 2K27A 1VQNI 3U2RA 3HUGA 1ZRCA 2ZKZA 1PP7U 3PQJA 3KEOA 3KP3A 3TBIA 2ELHA 3CZ6A 2HXOA 2L54A 5FJ8J 2HPMA 3GLXA 3DV8A 4XRMA 1ODDA 1QZYA 2Z5UA 3OYAA 1BN5A 1WH7A 4XORA 3MKYB 5BQTA 2AHQA 4DYCA 2ME0A 2QQ9A 3PL8A 3ESWB 5J47A 3F8CA 3I0TA 4BBSJ 5AIPA 4EJWA 2HWVA 3CF2A 3HKZN 2IT0A 1XTAA 5J1RA 1DGWY 3HRTA 1S5LC 2QZ8A 1BI0A 4BXXJ 5CQGA 3WG7H 3V8KA 1MMAA 1A36A 4HX7A 3EPZA 4O3MA 1WGXA 3K9TA 2M7BA 3ZQFA 2AQEA 1Y0NA 1WVRA 3K1NA 5DDGA 1XSVA 4RGXA 5BNGA 1S7EA 2WTEA 3Q3SA 5E3NA 1Y1VJ 1D8JA 3P9CA 3UKGA 3RKYA 2FA5A 4MFDA 4BBRJ 3WTXC 3BROA 5FO5A 5CVRA 4C30A 1YHQI 4NBQA 1K4SA 5EJCA 4DZPA 2HOEA 3L2CA 5J8CA 4C3JJ 2OBPA 3A0BC 3R4KA 3OMYA 2MD5A 4J01A 3S2WA 1JTYA 4II2A 4E4HA 3VWBA 1YRNA 1EH7A 1XCBA 2DT7B 4ZDOA 2K85A 1IRZA 2UXXA 1Y0UA 2DODA 2CQKA 2VBZA 2L9NA 2XF6A 4HNUA 3FXJA 4G7OF 3MMYB 4R8HA 1OCPA 3UNGC 4L0YB 2XPWA 1H89C 5TGTA 4GFBA 5IP9J 2V4JC 2IA2A 4F7ZA 5KCMA 3CJTB 2Y2ZA 1EA3A 4K2EA 2R0QC 2J5OA 4IF4A 1WZ2A 3HOXJ 2JWTA 4RGUA 1VQPI 4IX7A 4DJAA 2WV0A 1OISA 3HHGA 2R7TA 1H9TA 2F5EA 3E0JB 1JT6A 1R49A 2ZXHA 4BQQA 3L2UA 3S3MA 1AHDP 3OL3A 1WJBA 2K9LA 2M9HA 3T5XA 1VQKI 1BBYA 2HQRA 3OIQA 2VC1A 3E6MA 3GFLA 2MD0A 1SC7A 1G3WA 1A6QA 4M73A 3HOZJ 2PMUA 2LG4A 3QPHA 2GXBA 3D0SA 1QVTA 3ZMZA 4B44A 4E7IA 4ASNA 3U21A 1MSEC 2WWYA 1B9NA 5CVUA 4D7NA 2Z99A 5CQEA 2CQQA 2OZUA 1SD7A 2CW0F 1FTZA 1SFUA 3OS1A 4F3QA 2Q0OA 3H9JA 5GPAA 3FBIB 1WKMA 3H5NA 5ILVA 1FC3A 2OA4A 5HNHA 2IS1A 3JREA 1FOXA 1MJ9A 3ZP5A 1KZHA 2ICWG 2DT6A 2VJJA 3QOPA 3HHHA 1FYLA 4WK8F 2GXAA 5CVJA 1QHGA 2E5ZA 3BJ6A 1NK3P 3NRVA 5K5OA 2OUMA 4G7ZF 2KZVA 3F0CA 3PSFA 4DOZA 1IG7A 6PAXA 4PJMA 4ZTJA 3AL0B 1A5JA 1QQIA 2IW5A 3QWLA 3ZRGA 3COAC 3BG3A 2HPIA 4FISA 4KICA 2OTLI 4ENKA 1L3LA 2PMZN 3CMYA 4RGSA 4LOCA 4HV5A 2TDXA 4EMSA 1U3EM 2VBYA 2DCEA 2MSYA 4Q48A 5ICGA 2A3SA 2AO9A 3DCFA 3B02A 3OYDA 5D6FA 3RQIA 2FQ4A 4CCKA 2P4WA 1YG2A 2O5RA 3RIRA 2FE3A 3TO9A 1K7AA 3GTMJ 1AOYA 3S16J 1R1UA 1LDDA 4HQMA 2BYVE 4RMNA 4EV0A 3KYLA 1POGA 3GFJA 4F52A 1MMNA 4YIIA 1L0OC 1XSDA 1JJ6C 2ZXJA 3K4JA 3WTZA 4WWCA 5L3FA 1FBSA 4CICA 4B47A 1MBFA 2R7WA 1YFHA 5A2QK 2HZDA 2L7MP 1XS9A 1XMAA 4MEXF 1XGOA 1GLNA 2X4HA 5HNFA 1XGSA 5F08A 1RPWA 3K4LA 2MW8A 4D5FA 1XCVA 5GAGJ 4A12A 2HOTA 2LKPA 2IPQX 5LHHA 3J7AO 2F4IA 4PJ0C 1BC8C 1HDPA 4XM3A 2LKSA 4DNCA 3Q5FA 4M3EA 4CA0A 2NXNB 2G7UA 2VASA 5E3OA 1IAWA 3RCOA 4HYEA 3ZGKA 3GW2A 1MH4A 5FGMA 1K79A 3T8RA 3CC7I 3RQ4A 3K4MA 4ZYEA 2P5LC 5KVRA 3EYYA 1IXSB 4YIFA 2ESNA 4JK1X 2BW3A 2OC6A 4HRIA 2CMPA 4BYYA 2CYYA 4M6YA 2ELJA 1SFKA 1GVDA 2ZFWA 2FSWA 1U5TB 2A6EF 5ICFA 4CCNA 2CUEA 1M1EB 4PFOA 2JA6J 2V9PA 4XLHA 3E1SA 4CSWA 5LGNA 3AL0C 2QBYB 1GHCA 1USSA 2DXIA 2XGEA 2OCEA 4S0HB 2IEKA 3R61A 4A3JJ 3S15J 2Y31A 5DD8A 1TZLA 4DQ2A 3DLLF 2CFXA 3DQVC 4BACA 2VJ4A 1ZELA 2FXAA 5FROA 3A02A 1O3RA 2JZYA 3LNQA 4IHYA 1HBXG 5IT3A 3DTIA 3K1PA 1AWCA 1U8BA 3E6DA 5DS9A 4I02A 5D6EA 2RQQA 1QU3A 3D5SC 2IRFG 2DYSH 3QYFA 3TKYA 4QTRA 1ETKA 1KA8A 2L9VA 1DU0A 3J7ZI 4EQQA 5EDNA 1MKMA 2WADA 5HDGA 2DFHA 1QNTA 4H0EA 2HVRA 1AA7A 1XSXA 3GX4X 4XKVA 1HCRA 3LSGA 5HVQC 1KQ8A 4CCLA 2MBFA 5M3MJ 3DPUA 2W85A 3KP4A 2OU2A 3QU6A 4PFPA 3GCMA 1JHFA 1F9NA 2L9SA 1IN5A 3ZXSA 4CCOA 3K2ZA 1WJEA 2LY9A 4G7HF 4WF2A 5M5WJ 1BW5A 1B72A 2Z9OA 4L18B 2QVOA 2HU9A 2D5VA 1ZHFA 4UUVA 2Y9ZA 2FRHA 1IRFA 2ETHA 1AU7A 1CF7A 2HZTA 2JRTA 3HEFA 1TWHJ 1YX5A 5FLMJ 1YO5C 1D8KA 2KIMA 3QPLA 1QPIA 1MJAA 1A35A 3E3VA 1YQAA 1RUNA 3ZMVA 5FB2A 4R79A 1SAUA 3K4CA 5CYVA 3FM3A 1SMTA 1FOWA 2IS6A 1V5GA 1YIOA 3ML6A 3KYCB 1USTA 4OAYA 4RAGA 2EZHA 5E8IA 1SFEA 2OF7A 4N4NB 4ESBA 1QO0D 3JRCA 4A3FJ 4UVCA 2RV8A 3IH2A 4J19A 2DA4A 4PSWA 2VBWA 3VB2A 2DQRA 4IQJA 1WRJA 2NVQJ 2HR3A 1A04A 2HVQA 2V79A 2F5CA 3EUHC 4ON0A 1TT0A 2LH9A 1FJLA 2NOGA 3F6OA 3Q9SA 2F48A 1Z7LA 3R0JA 1WH5A 2PI0A 4XLFA 1HLVA 1B1BA 1KU9A 2DTRA 2V6CA 3BZKA 4MIMA 2ZO4A 3CC2I 3ZQQA 3RPUA 1HKQA 4UUSB 3CDLA 5DV5A 4ENMA 3MAJA 3RPQA 3HB9A 4Y3OA 3ZMSA 3HSRA 5J1YA 5TRDA 3HG9A 3WU2C 4P1WA 2EBIA 3CP8A 4EGZA 4F92B 3BR1A 1PJRA 1ZYRF 1Z67A 3AG4H 2ZJPF 5E1WA 5F0FA 2XASA 5BS6A 3F6VA 1NG6A 1TQMA 1ETXA 1WHUA 4J00A 2Y69H 3VFZA 1NH3A 1IV8A 2BXYA 2MG4A
chains in the Genus database with same CATH topology
2X0LA 3BDDA 3L7WA 4AIKA 4OIOF 4OOIA 1XB4A 4KN7X 3EUHA 1TQIA 4Z2YA 3BOQA 1BM9A 3WGHA 1UHWA 3F23A 3DEUA 2EFNA 2ESHA 3T0YA 3FMQA 2W25A 4MTDA 2EA4A 3M7GA 3AAFA 2FBHA 4CZZA 1XN7A 3GXOA 3MZHA 2NNNA 5ICCA 2OQRA 2XV4S 2E1NA 1DPRA 4U0YA 2BEOA 3GF2A 2EV0A 3K1MA 3F8MA 3QP5A 4A6EA 2RNJA 4JQFA 2QQBA 4KFCA 4BQAA 2PN6A 5D8LB 3MFKA 3H3ZA 4ZYGA 3WTTC 5H20A 4UXNA 2QUFA 1LQ1A 4O5VA 3SZPA 5EEHA 5DUIA 1FYMA 2PEXA 1K6OA 1IN8A 4LD5A 2J5PA 1Z05A 5LRSA 2R3SA 2JPCA 5E20A 2Q2EA 1R1VA 4KA4A 4IJAA 3FXQA 3ROUA 1P6RA 5ICEA 1RIOH 4Y15A 4P96A 4M72A 2F5FA 3C3WA 4U0WA 5HLIA 3I64A 3BP8A 2P7VB 4G6QA 4RAZA 1SMYF 4TV7A 4UV8A 1H0MA 5HLHA 1LVAA 3E6BA 2ACJA 1FT9A 3WTVC 3KZZA 1ZH5A 5BMZA 3CJNA 1SAXA 3FHZA 1Q1HA 3I4PA 1IN6A 3EYIA 3DF8A 4EJTA 3J81K 3ABUA 3U1DA 2M45A 5LEJA 4S04A 1K78B 2GWRA 4R1HA 2DO7A 4ZZLA 1Z7UA 4B09A 3R60A 2VT2A 5FFXA 1SD5A 4A5MA 3HOSA 3I59A 2RQPA 3BZ6A 3MCZA 3C1DA 2Z3YA 3SXYA 1BI1A 2F5DA 2K4JA 2RKHA 1KU3A 1LJ9A 1U8RA 2YX7A 3QAHA 4FHTA 1YLFA 3O6BB 2Y48A 2HGCA 1J0RA 3V7RA 3K69A 3ULQB 2MLKA 3DFGA 1REPC 2YPRA 2KRFA 5ED4A 4LG0A 3IKVA 2XGXA 1TNTA 5FD5A 3ISPA 3GVAA 3EQLF 4RB2C 4ETSA 4G8XA 5CVVA 4NHJA 1LDKB 2VT3A 3CUOA 1C0WA 4KNYA 1R36A 1BIAA 4WCGA 2DW4A 2YU3A 4Q4ZF 4ESFA 4OINF 1B6AA 2EJRA 3E5UA 3GFIA 2UZKA 5F1RA 4WXDA 4NQWA 2VN2A 2OZ6A 3MEXA 4HW0A 1XD7A 2H27A 1Z1DA 3FX3A 1HW5A 2WC2A 5DCMB 3W6JB 2G7HA 3JAMZ 4XLNF 1MGTA 3V8JA 1KYWA 4PGHA 2L3DA 1Z9CA 5JR3A 2A68F 3RJPA 2LNBA 2VE9A 5J8FA 4CHUA 5F64A 3RKXA 4OMZA 4XSXF 3U9GA 4M6XA 3JSPA 1I6XA 3M8EA 4EM2A 3L09A 1RZ4A 4BAYA 4CDGA 1T2KA 1KQ0A 2D45A 1O7LA 1X3UA 3WTWC 2GXGA 1FWZA 4L0ZB 4ENNA 4CYDA 1H9GA 2PQ8A 3RI4A 2STTA 4IHTA 5E17F 1W4MA 4M9XA 2DI3A 1DDNA 2JSCA 2NNYA 3SZTA 4LG0B 4EJVA 2XKOA 2A61A 4U7BA 3P7NA 2G9WA 3ECHA 2D1VA 1YS6A 1P4XA 1B59A 3T8TA 4XRFA 3V7SA 5E1XA 3HRSA 2VC0A 4Q5SF 4KIGA 3F8NA 1U2WA 3WTSC 1I1GA 5HS7A 3KE2A 3LQRA 3KCCA 4UHTA 3IHUA 1D5VA 3MWMA 2FOKA 3Q9VA 2RN7A 3FMRA 3I59B 4IRGA 1T98A 2BGCA 4M74A 1FOKA 1FP2A 3CTAA 4IRHA 1OYIA 2BE5F 2COMA 4G94A 5A2QZ 5LRRA 4M9SA 4U0VA 4MNUA 4EJUA 2Q8KA 2PMHA 4ZZDA 3E97A 5DD4A 2RVCA 1S29A 2ZMEA 1IN4A 3R0AA 4ZYDA 4Y17A 1JE8A 4N9HA 1OYYA 3WE2A 3KZYA 1U78A 2GAUA 2HKXA 4LK1F 1T39A 2W24A 3ZPLA 4G6DA 1BC7C 2E1CA 1PP8F 4OU0A 5LLQA 1S7OA 4ENJA 2XROA 5D5UB 1IRGA 2EA2A 1IW7F 5TJJA 4WX9A 2K7LA 2LF7A 5HDKA 1TW3A 3H3UA 1P4WA 4KMFA 2STWA 1BI3A 3WGIA 3ELKA 1ZG5A 3KLOA 1ZAOA 2GA2A 4L5JA 1EH8A 3ECOA 2V1XA 3TOBA 3I53A 3M8FA 2EK5A 5E18F 3ABTA 2M1BA 4BH9A 1O7FA 3TDZC 3O2PE 2D1HA 2FNPA 3KP5A 1YW7A 4Y13A 4N0BA 4AIJA 3DKWA 2EB7A 2MH2A 4A5NA 5L3BA 3H92A 2P7CB 2VONA 1OR7A 2R7DA 1JGSA 2XAQA 1QBJA 4FX0A 2EFQA 4KN4X 3NEUA 5LHIA 5CJ9A 3LAJA 3JAMK 3QRFF 3M9AA 5HLGA 4YFKF 3KP7A 4OIPF 3V7CA 3HSEA 2F2EA 4HLXA 3F72A 2PLYA 2HDCA 3LWFA 1DPUA 4HOBA 3GEZA 2AS5F 3OV8A 4KIBA 4I09A 2O03A 4PCQA 1T38A 2NAZA 4CO8A 1U5TC 5ILUA 4EGYA 2PJPA 2L01A 2FNAA 2H09A 1TW2A 3GFMA 3SHFA 4GCVA 5ERIA 2KIUA 5DUKA 4KT5C 4OIQF 3N4MA 3DXJF 3GWZA 1ZN2A 4WXHA 5FD6A 2CSOA 2RC4A 3LA7A 3RTRA 2LF8A 2L4AA 1R22A 2V1DA 5LGUA 1CGPA 2HTSA 4O6JA 2A69F 4N9IA 2A6HF 2HEOA 1T0FA 4MQ9F 1STZA 1R5HA 4I0BA 2IP2A 2Y0MA 1JHHA 5FFZA 4I7HA 2BV6A 1MZBA 3WG9A 2M5WA 2MA3A 3WODF 2DFIA 2EFPA 2CO5A 1S6LA 2KIFA 3GO5A 4BHPA 5IT9K 4OIRF 4IRIA 2VODA 1ZRFA 1KQ9A 4AIHA 4IXAA 4EVIA 2QBYA 4HF2A 1GVJA 5JVTA 1ZLJA 3LA3A 4BHCA 2IA0A 1BI2A 2XHKA 4LLLA 4PZJA 1QGPA 1ZGAA 2O3FA 5IT9Z 3D5LA 3OOPA 1UFMA 2VOOA 1ZREA 3M1EA 3I5UA 1KYZA 3FF5A 1FNNA 3F8BA 5DCFA 1RI7A 2VXZA 4UVAA 1BIBA 1G6NA 2HS5A 1O3TA 1QZZA 4KDPA 4E70A 1IUYA 2YSRA 3FXUA 1QPMA 2HYFA 5K1YA 2VE8A 5HDNA 2XIGA 3KEQA 1YTYA 2W57A 2VOPA 4LLGF 5DEQA 4IPAA 3ZN0A 1P92A 2KJBA 2XUBA 2HQNA 1TTYA 4RB0A 1NHAA 2QENA 4L9JA 2FBKA 1KU2A 2QM3A 3RDIA 5D8KB 2HYGD 3GYHX 3TO7A 5JI6A 4KYWA 1SD6A 5DCMA 3J81Z 3HRUA 4MTEA 1J2XA 3JTGA 2AXLA 3WTYC 1FZPB 1B9MA 1ON1A 5D4RA 4HLYA 5AONA 2FMYA 5K5QA 4GO1A 2XAHA 4I98B 1BOAA 2MC3A 4UVBA 3FZVA 3BY6A 1TNSA 3ZN1A 3BPVA 4IVNA 3JSOA 3KFWX 1WSUA 2XKPA 4AWXB 5LHGA 4GYIA 2PBIA 5FLXZ 2B0LA 3WU0A 3FXRA 1MD0A 3B73A 4HDUA 1XMKA 4HA8A 1J9IA 5EEGA 1OYWA 2ZMEB 1R00A 5HS9A 3HTSB 4HBLA 1LEAA 2IA1A 2P6TA 2FF4A 2EWNA 5FLXK 1O3QA 3HTUA 1FP1D 4ZH4F 4WXCA 3CO6C 1SFXA 4S05A 3QP6A 2K4BA 4LFUA 3JTHA 4ZYHA 3CUQC 1WWXA 5K5RA 3KP6A 2FU4A 4QWQA 1J5YA 3KLNA 3HRMA 2ZJ2A 4B8XA 3KETA 3LQQA 3ZMDA 3IWFA 1KU7A 1G3SA 2HKOA 2O61A 3L00A 2MLGA 4RB1A 1F1ZA 1FLIA 3NQOA 3TOAA 4M71A 3TO6A 2P5VA 3ERED 1W5TA 4RAYA 3DPLC 2H94A 2K86A 2M30A 1FBUA 5D5XB 3E6CC 4HDVA 3G3ZA 1J7KA 4D0PA 5D5WB 5D4SA 4PGGA 1UHMA 1MDMB 1R5GA 1LB2A 5H6RA 4U88A 3EETA 3I54A 3LSTA 3CDHA 2L4MA 4G9YA 4MEYF 2L02A 3V4GA 2NS0A 4LB5A 5E8GA 5L3CA 2DT5A 4KUMA 4EJOA 3ZMUA 1ZGJA 2ZNYA 4LMYA 2QYOA 1XDSA 5L3GA 4L9NA 1EV7A 3RYPA 1DP7P 1XDUA 1O3SA 4BNCA 4UNOA 2ADUA 2FQ3A 2XAJA 1IF1A 2EFOA 1P2FA 2XVCA 2YX4A 4GGGA 1ON2A 3LA2A 1B4AA 3O3KA 1G3YA 2ZBKA 1ZG1A 1HW2A 4HF1A 2ZCWA 1OKRA 3G73A 5AIQA 3IWZA 3CO7C 2DLLA 5D5VB 1MDMA 3E5QA 3W6KB 1JXSA 2KJCA 3TGNA 3N97A 2UWMA 4PDKA 2FBIA 3JW4A 4HX4A 1TBXA 5L3DA 2OAZA 3J80K 1I27A 2P5KA 3MZYA 4NB5A 5CLSA 4KIFA 3P9IA 1E17A 1LDJA 1G4DA 5F6FA 1U5TA 2RGVA 4RB3C 2EV5A 1VTNC 1R58A 1RNLA 1FX7A 1RUOA 3IRRA 2FMLA 2M87A 2A07F 1S3JA 3PFIA 3IKTA 1LEBA 4I01A 4A2UA 2NYXA 3HIFA 2O8XA 1FBQA 4OMYA 3ZMTA 2GQQA 4I2OA 3TDUC 1O57A 1G3TA 1YYVA 3F3XA 3GZ5A 3LFKA 3BJOA 1ZG3A 4A0ZA 2DQLA 3MQ0A 3CLOA 4YFXF 1BJAA 1UCRA 3FWEA 3ZQ7A 1HQCA 5H6QA 1UB9A 1R23A 1T6SA 4MHGA 3VODA 1D3YA 2Y75A 4L5IA 1SD4A 1V4RA 3E5XA 5LEKA 2DBBA 4UV9A 3LAPA 2M8EA 3SQNA 1J59A 5BPIA 2CGPA 2R7FA 2NRAC 2DK5A 1IXCA 2Z33A 1U6GA 3FMSA 3P9KA 4RS8A 2W84A 2IJLA 3EDPA 2RDPA 3T1BA 1XGNA 2VBXA 3V8LA 1Z6RA 1FYKA 2XAGA 2PG4A 2A5YB 1YW9A 4A6DA 2LSOA 4JBAA 2P6SA 3REOA 1ZRDA 4RGRA 4MGRA 4EM0B 3BPXA 3CUQB 4YFNF 1OMIA 3C7JA 4HF0A 4P5OA 4IHSA 2H6CA 2ISZA 4P9FA 1IZ1A 1MJBA 3CUQA 2GA1A 3IL2A 3BWGA 2ZNZA 1Z6TA 3DPTA 3VOEA 3DP7A 4LJZF 4AVPA 1V3FA 1WQ2A 4HZFA 3VEPA 2O6GE 3GZ6A 4A0XA 3IRQA 1ONVA 2GIVA 4GYGA 3K0LA 4A0YA 2JPBA 3HOTA 2CWEA 4BXUA 1TQPA 2BBYA 2HTJA 1HW1A 1IN7A 4YG2F 1GXQA 2QWWA 4EM1A 5HOOA 1S7AA 4P9UA 1ZLKA 1FY7A 4U7DA 1W5SA 4HAMA 2LDUA 2V9VA 4FX4A 1P4AA 2OD5A 3FM5A 3WE3A 1R7JA 3F21A 5CVIA 2ISYA 2MH9A 1Z91A 4GXOA 1GXPA 1ULYA 4AD9A 4KMUX 4LLNA 3BJAA 5JHUA 2JT1A 2XAFA 3PQKA 4HQEA 4MQVA 4CXFA 5LBQA 3C18A 1F5TA 1FSEA 3F8FA 2DK8A 1FSHA 1F4KA 2EFWA 1WI9A 1PUEE 2GZWA 1EH6A 3L9FA 2UXNA 4HX8A 2C6YA 1W7PA 1FPQA 1I1SA 1HKSA 5J6XA 4LB6B 3QU3A 5DYMA 1HSTA 1K78A 4FT8A 3WGGA 2K02A 2QQAA 2E7WA 2YR2A 3QPTA 3I58A 4CGZA 2DPDA 5BOXA 1YW8A 2KKOA 1E2XA 1IXRC 5LGTA 4HV6A 2P8TA 1HXDA 3KP2A 4ESJA 2DAOA 5KK1A 5JFRA 3IC7A 1TLHB 4LGWA 2XRNA 4L9TA 1KGSA 1OPCA 5E1ZB 3SFZA 2V1UA 3J80Z 3GUDA 3HSFA 4I0AA 2O0YA 3I71A 2DPUA 2HFHA 4Q47A 2OQGA 2QLZA 2JTVA 4LK0F 1R1TA 2DU9A 1I5ZA 1ZARA 2PFBA 1YS7A 2FEZA 3HYIA 3WU1B 1J75A 3RKWA 1XGMA 1HKTA 1S8NA 1CF7B 3WTUC 1DUXC 4BHBA 2EV6A 1HSJA 3TQNA 4L9VA 5BPDA 2CG4A 3F22A 5ILSA 1LNWA 4XLPF 2E7XA 5L3EA 4XSZF 3R6SA 4XBFA 3RYRA 2D2WA 1PDNC 1W7PD 1W7PB 4P55A 4QLCU 2H6BA 5HS8A 2IVMA 4M9ZA 2K27A 3U2RA 3HUGA 1ZRCA 2ZKZA 1PP7U 3PQJA 3KEOA 3KP3A 2ELHA 2L54A 3GLXA 3DV8A 1ODDA 1QZYA 2Z5UA 1BN5A 5BQTA 2QQ9A 3F8CA 3I0TA 5AIPA 4EJWA 2HWVA 2IT0A 3HRTA 2QZ8A 1BI0A 3V8KA 4HX7A 4O3MA 3K9TA 3K1NA 5DDGA 1XSVA 4RGXA 2WTEA 1D8JA 3P9CA 3RKYA 2FA5A 3WTXC 3BROA 5FO5A 5CVRA 2HOEA 3L2CA 5J8CA 2OBPA 3R4KA 2MD5A 3S2WA 1EH7A 1XCBA 2UXXA 1Y0UA 2CQKA 2VBZA 4G7OF 4R8HA 4L0YB 2IA2A 4F7ZA 4K2EA 2J5OA 4IF4A 4RGUA 2WV0A 3HHGA 1H9TA 2F5EA 3T5XA 1BBYA 2HQRA 2VC1A 3E6MA 3GFLA 1G3WA 4M73A 2PMUA 3QPHA 2GXBA 3D0SA 3ZMZA 4ASNA 2WWYA 1B9NA 5CVUA 2Z99A 2OZUA 1SD7A 2CW0F 1SFUA 2Q0OA 1WKMA 5ILVA 1FC3A 2OA4A 1MJ9A 3ZP5A 3QOPA 3HHHA 1FYLA 4WK8F 5CVJA 3BJ6A 3NRVA 5K5OA 4G7ZF 6PAXA 1QQIA 2IW5A 3COAC 4KICA 4ENKA 1L3LA 4RGSA 4HV5A 2TDXA 4EMSA 1U3EM 2VBYA 4Q48A 5ICGA 2A3SA 3B02A 5D6FA 2P4WA 1YG2A 3RIRA 2FE3A 3TO9A 1K7AA 1AOYA 1R1UA 1LDDA 4HQMA 2BYVE 4EV0A 3GFJA 4YIIA 1L0OC 1XSDA 2ZXJA 3WTZA 4WWCA 5L3FA 1FBSA 4CICA 1YFHA 5A2QK 1XMAA 4MEXF 1XGOA 2X4HA 1XGSA 1XCVA 4A12A 2LKPA 2IPQX 5LHHA 3J7AO 1BC8C 4DNCA 3Q5FA 2G7UA 1IAWA 4HYEA 3GW2A 5FGMA 1K79A 3T8RA 4ZYEA 2P5LC 5KVRA 3EYYA 1IXSB 4YIFA 2ESNA 4JK1X 4BYYA 2CYYA 4M6YA 2ZFWA 2FSWA 1U5TB 2A6EF 5ICFA 5LGNA 2QBYB 1GHCA 1USSA 3R61A 5DD8A 4DQ2A 2CFXA 3DQVC 2FXAA 1O3RA 2JZYA 1HBXG 5IT3A 3K1PA 1AWCA 3E6DA 4I02A 5D6EA 2IRFG 3TKYA 1KA8A 4EQQA 1MKMA 5HDGA 1QNTA 4H0EA 3GX4X 1XSXA 5HVQC 1KQ8A 2MBFA 3KP4A 2W85A 2OU2A 3QU6A 1JHFA 1F9NA 1IN5A 3K2ZA 4G7HF 4WF2A 2Z9OA 4L18B 2QVOA 1ZHFA 4UUVA 2FRHA 1IRFA 2ETHA 1CF7A 2HZTA 2JRTA 1YO5C 1D8KA 2KIMA 1MJAA 3E3VA 1YQAA 1RUNA 3ZMVA 5FB2A 4R79A 5CYVA 3FM3A 1SMTA 1YIOA 3ML6A 1USTA 5E8IA 1SFEA 4ESBA 1QO0D 4UVCA 2RV8A 2VBWA 3VB2A 2DQRA 1WRJA 2HR3A 1A04A 2V79A 2F5CA 4ON0A 3F6OA 3Q9SA 3R0JA 2PI0A 1B1BA 1KU9A 2DTRA 2V6CA 2ZO4A 3RPUA 1HKQA 5DV5A 4ENMA 3MAJA 3RPQA 3ZMSA 3HSRA 5TRDA 4EGZA 1ZYRF 5E1WA 2XASA 5BS6A 3F6VA 1TQMA 3VFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X0L A;  3BDD A;  3L7W A;  4AIK A;  4OIO F;  4OOI A;  1XB4 A;  4KN7 X;  3EUH A;  1TQI A;  4Z2Y A;  3BOQ A;  1BM9 A;  3WGH A;  1UHW A;  3F23 A;  3DEU A;  2EFN A;  2ESH A;  3T0Y A;  3FMQ A;  2W25 A;  4MTD A;  2EA4 A;  3M7G A;  3AAF A;  2FBH A;  4CZZ A;  1XN7 A;  3GXO A;  3MZH A;  2NNN A;  5ICC A;  2OQR A;  2XV4 S;  2E1N A;  1DPR A;  4U0Y A;  2BEO A;  3GF2 A;  2EV0 A;  3K1M A;  3F8M A;  3QP5 A;  4A6E A;  2RNJ A;  4JQF A;  2QQB A;  4KFC A;  4BQA A;  2PN6 A;  5D8L B;  3MFK A;  3H3Z A;  4ZYG A;  3WTT C;  5H20 A;  4UXN A;  2QUF A;  1LQ1 A;  4O5V A;  3SZP A;  5EEH A;  5DUI A;  1FYM A;  2PEX A;  1K6O A;  1IN8 A;  4LD5 A;  2J5P A;  1Z05 A;  5LRS A;  2R3S A;  2JPC A;  5E20 A;  2Q2E A;  1R1V A;  4KA4 A;  4IJA A;  3FXQ A;  3ROU A;  1P6R A;  5ICE A;  1RIO H;  4Y15 A;  4P96 A;  4M72 A;  2F5F A;  3C3W A;  4U0W A;  5HLI A;  3I64 A;  3BP8 A;  2P7V B;  4G6Q A;  4RAZ A;  1SMY F;  4TV7 A;  4UV8 A;  1H0M A;  5HLH A;  1LVA A;  3E6B A;  2ACJ A;  1FT9 A;  3WTV C;  3KZZ A;  1ZH5 A;  5BMZ A;  3CJN A;  1SAX A;  3FHZ A;  1Q1H A;  3I4P A;  1IN6 A;  3EYI A;  3DF8 A;  4EJT A;  3J81 K;  3ABU A;  3U1D A;  2M45 A;  5LEJ A;  4S04 A;  1K78 B;  2GWR A;  4R1H A;  2DO7 A;  4ZZL A;  1Z7U A;  4B09 A;  3R60 A;  2VT2 A;  5FFX A;  1SD5 A;  4A5M A;  3HOS A;  3I59 A;  2RQP A;  3BZ6 A;  3MCZ A;  3C1D A;  2Z3Y A;  3SXY A;  1BI1 A;  2F5D A;  2K4J A;  2RKH A;  1KU3 A;  1LJ9 A;  1U8R A;  2YX7 A;  3QAH A;  4FHT A;  1YLF A;  3O6B B;  2Y48 A;  2HGC A;  1J0R A;  3V7R A;  3K69 A;  3ULQ B;  2MLK A;  3DFG A;  1REP C;  2YPR A;  2KRF A;  5ED4 A;  4LG0 A;  3IKV A;  2XGX A;  1TNT A;  5FD5 A;  3ISP A;  3GVA A;  3EQL F;  4RB2 C;  4ETS A;  4G8X A;  5CVV A;  4NHJ A;  1LDK B;  2VT3 A;  3CUO A;  1C0W A;  4KNY A;  1R36 A;  1BIA A;  4WCG A;  2DW4 A;  2YU3 A;  4Q4Z F;  4ESF A;  4OIN F;  1B6A A;  2EJR A;  3E5U A;  3GFI A;  2UZK A;  5F1R A;  4WXD A;  4NQW A;  2VN2 A;  2OZ6 A;  3MEX A;  4HW0 A;  1XD7 A;  2H27 A;  1Z1D A;  3FX3 A;  1HW5 A;  2WC2 A;  5DCM B;  3W6J B;  2G7H A;  3JAM Z;  4XLN F;  1MGT A;  3V8J A;  1KYW A;  4PGH A;  2L3D A;  1Z9C A;  5JR3 A;  2A68 F;  3RJP A;  2LNB A;  2VE9 A;  5J8F A;  4CHU A;  5F64 A;  3RKX A;  4OMZ A;  4XSX F;  3U9G A;  4M6X A;  3JSP A;  1I6X A;  3M8E A;  4EM2 A;  3L09 A;  1RZ4 A;  4BAY A;  4CDG A;  1T2K A;  1KQ0 A;  2D45 A;  1O7L A;  1X3U A;  3WTW C;  2GXG A;  1FWZ A;  4L0Z B;  4ENN A;  4CYD A;  1H9G A;  2PQ8 A;  3RI4 A;  2STT A;  4IHT A;  5E17 F;  1W4M A;  4M9X A;  2DI3 A;  1DDN A;  2JSC A;  2NNY A;  3SZT A;  4LG0 B;  4EJV A;  2XKO A;  2A61 A;  4U7B A;  3P7N A;  2G9W A;  3ECH A;  2D1V A;  1YS6 A;  1P4X A;  1B59 A;  3T8T A;  4XRF A;  3V7S A;  5E1X A;  3HRS A;  2VC0 A;  4Q5S F;  4KIG A;  3F8N A;  1U2W A;  3WTS C;  1I1G A;  5HS7 A;  3KE2 A;  3LQR A;  3KCC A;  4UHT A;  3IHU A;  1D5V A;  3MWM A;  2FOK A;  3Q9V A;  2RN7 A;  3FMR A;  3I59 B;  4IRG A;  1T98 A;  2BGC A;  4M74 A;  1FOK A;  1FP2 A;  3CTA A;  4IRH A;  1OYI A;  2BE5 F;  2COM A;  4G94 A;  5A2Q Z;  5LRR A;  4M9S A;  4U0V A;  4MNU A;  4EJU A;  2Q8K A;  2PMH A;  4ZZD A;  3E97 A;  5DD4 A;  2RVC A;  1S29 A;  2ZME A;  1IN4 A;  3R0A A;  4ZYD A;  4Y17 A;  1JE8 A;  4N9H A;  1OYY A;  3WE2 A;  3KZY A;  1U78 A;  2GAU A;  2HKX A;  4LK1 F;  1T39 A;  2W24 A;  3ZPL A;  4G6D A;  1BC7 C;  2E1C A;  1PP8 F;  4OU0 A;  5LLQ A;  1S7O A;  4ENJ A;  2XRO A;  5D5U B;  1IRG A;  2EA2 A;  1IW7 F;  5TJJ A;  4WX9 A;  2K7L A;  2LF7 A;  5HDK A;  1TW3 A;  3H3U A;  1P4W A;  4KMF A;  2STW A;  1BI3 A;  3WGI A;  3ELK A;  1ZG5 A;  3KLO A;  1ZAO A;  2GA2 A;  4L5J A;  1EH8 A;  3ECO A;  2V1X A;  3TOB A;  3I53 A;  3M8F A;  2EK5 A;  5E18 F;  3ABT A;  2M1B A;  4BH9 A;  1O7F A;  3TDZ C;  3O2P E;  2D1H A;  2FNP A;  3KP5 A;  1YW7 A;  4Y13 A;  4N0B A;  4AIJ A;  3DKW A;  2EB7 A;  2MH2 A;  4A5N A;  5L3B A;  3H92 A;  2P7C B;  2VON A;  1OR7 A;  2R7D A;  1JGS A;  2XAQ A;  1QBJ A;  4FX0 A;  2EFQ A;  4KN4 X;  3NEU A;  5LHI A;  5CJ9 A;  3LAJ A;  3JAM K;  3QRF F;  3M9A A;  5HLG A;  4YFK F;  3KP7 A;  4OIP F;  3V7C A;  3HSE A;  2F2E A;  4HLX A;  3F72 A;  2PLY A;  2HDC A;  3LWF A;  1DPU A;  4HOB A;  3GEZ A;  2AS5 F;  3OV8 A;  4KIB A;  4I09 A;  2O03 A;  4PCQ A;  1T38 A;  2NAZ A;  4CO8 A;  1U5T C;  5ILU A;  4EGY A;  2PJP A;  2L01 A;  2FNA A;  2H09 A;  1TW2 A;  3GFM A;  3SHF A;  4GCV A;  5ERI A;  2KIU A;  5DUK A;  4KT5 C;  4OIQ F;  3N4M A;  3DXJ F;  3GWZ A;  1ZN2 A;  4WXH A;  5FD6 A;  2CSO A;  2RC4 A;  3LA7 A;  3RTR A;  2LF8 A;  2L4A A;  1R22 A;  2V1D A;  5LGU A;  1CGP A;  2HTS A;  4O6J A;  2A69 F;  4N9I A;  2A6H F;  2HEO A;  1T0F A;  4MQ9 F;  1STZ A;  1R5H A;  4I0B A;  2IP2 A;  2Y0M A;  1JHH A;  5FFZ A;  4I7H A;  2BV6 A;  1MZB A;  3WG9 A;  2M5W A;  2MA3 A;  3WOD F;  2DFI A;  2EFP A;  2CO5 A;  1S6L A;  2KIF A;  3GO5 A;  4BHP A;  5IT9 K;  4OIR F;  4IRI A;  2VOD A;  1ZRF A;  1KQ9 A;  4AIH A;  4IXA A;  4EVI A;  2QBY A;  4HF2 A;  1GVJ A;  5JVT A;  1ZLJ A;  3LA3 A;  4BHC A;  2IA0 A;  1BI2 A;  2XHK A;  4LLL A;  4PZJ A;  1QGP A;  1ZGA A;  2O3F A;  5IT9 Z;  3D5L A;  3OOP A;  1UFM A;  2VOO A;  1ZRE A;  3M1E A;  3I5U A;  1KYZ A;  3FF5 A;  1FNN A;  3F8B A;  5DCF A;  1RI7 A;  2VXZ A;  4UVA A;  1BIB A;  1G6N A;  2HS5 A;  1O3T A;  1QZZ A;  4KDP A;  4E70 A;  1IUY A;  2YSR A;  3FXU A;  1QPM A;  2HYF A;  5K1Y A;  2VE8 A;  5HDN A;  2XIG A;  3KEQ A;  1YTY A;  2W57 A;  2VOP A;  4LLG F;  5DEQ A;  4IPA A;  3ZN0 A;  1P92 A;  2KJB A;  2XUB A;  2HQN A;  1TTY A;  4RB0 A;  1NHA A;  2QEN A;  4L9J A;  2FBK A;  1KU2 A;  2QM3 A;  3RDI A;  5D8K B;  2HYG D;  3GYH X;  3TO7 A;  5JI6 A;  4KYW A;  1SD6 A;  5DCM A;  3J81 Z;  3HRU A;  4MTE A;  1J2X A;  3JTG A;  2AXL A;  3WTY C;  1FZP B;  1B9M A;  1ON1 A;  5D4R A;  4HLY A;  5AON A;  2FMY A;  5K5Q A;  4GO1 A;  2XAH A;  4I98 B;  1BOA A;  2MC3 A;  4UVB A;  3FZV A;  3BY6 A;  1TNS A;  3ZN1 A;  3BPV A;  4IVN A;  3JSO A;  3KFW X;  1WSU A;  2XKP A;  4AWX B;  5LHG A;  4GYI A;  2PBI A;  5FLX Z;  2B0L A;  3WU0 A;  3FXR A;  1MD0 A;  3B73 A;  4HDU A;  1XMK A;  4HA8 A;  1J9I A;  5EEG A;  1OYW A;  2ZME B;  1R00 A;  5HS9 A;  3HTS B;  4HBL A;  1LEA A;  2IA1 A;  2P6T A;  2FF4 A;  2EWN A;  5FLX K;  1O3Q A;  3HTU A;  1FP1 D;  4ZH4 F;  4WXC A;  3CO6 C;  1SFX A;  4S05 A;  3QP6 A;  2K4B A;  4LFU A;  3JTH A;  4ZYH A;  3CUQ C;  1WWX A;  5K5R A;  3KP6 A;  2FU4 A;  4QWQ A;  1J5Y A;  3KLN A;  3HRM A;  2ZJ2 A;  4B8X A;  3KET A;  3LQQ A;  3ZMD A;  3IWF A;  1KU7 A;  1G3S A;  2HKO A;  2O61 A;  3L00 A;  2MLG A;  4RB1 A;  1F1Z A;  1FLI A;  3NQO A;  3TOA A;  4M71 A;  3TO6 A;  2P5V A;  3ERE D;  1W5T A;  4RAY A;  3DPL C;  2H94 A;  2K86 A;  2M30 A;  1FBU A;  5D5X B;  3E6C C;  4HDV A;  3G3Z A;  1J7K A;  4D0P A;  5D5W B;  5D4S A;  4PGG A;  1UHM A;  1MDM B;  1R5G A;  1LB2 A;  5H6R A;  4U88 A;  3EET A;  3I54 A;  3LST A;  3CDH A;  2L4M A;  4G9Y A;  4MEY F;  2L02 A;  3V4G A;  2NS0 A;  4LB5 A;  5E8G A;  5L3C A;  2DT5 A;  4KUM A;  4EJO A;  3ZMU A;  1ZGJ A;  2ZNY A;  4LMY A;  2QYO A;  1XDS A;  5L3G A;  4L9N A;  1EV7 A;  3RYP A;  1DP7 P;  1XDU A;  1O3S A;  4BNC A;  4UNO A;  2ADU A;  2FQ3 A;  2XAJ A;  1IF1 A;  2EFO A;  1P2F A;  2XVC A;  2YX4 A;  4GGG A;  1ON2 A;  3LA2 A;  1B4A A;  3O3K A;  1G3Y A;  2ZBK A;  1ZG1 A;  1HW2 A;  4HF1 A;  2ZCW A;  1OKR A;  3G73 A;  5AIQ A;  3IWZ A;  3CO7 C;  2DLL A;  5D5V B;  1MDM A;  3E5Q A;  3W6K B;  1JXS A;  2KJC A;  3TGN A;  3N97 A;  2UWM A;  4PDK A;  2FBI A;  3JW4 A;  4HX4 A;  1TBX A;  5L3D A;  2OAZ A;  3J80 K;  1I27 A;  2P5K A;  3MZY A;  4NB5 A;  5CLS A;  4KIF A;  3P9I A;  1E17 A;  1LDJ A;  1G4D A;  5F6F A;  1U5T A;  2RGV A;  4RB3 C;  2EV5 A;  1VTN C;  1R58 A;  1RNL A;  1FX7 A;  1RUO A;  3IRR A;  2FML A;  2M87 A;  2A07 F;  1S3J A;  3PFI A;  3IKT A;  1LEB A;  4I01 A;  4A2U A;  2NYX A;  3HIF A;  2O8X A;  1FBQ A;  4OMY A;  3ZMT A;  2GQQ A;  4I2O A;  3TDU C;  1O57 A;  1G3T A;  1YYV A;  3F3X A;  3GZ5 A;  3LFK A;  3BJO A;  1ZG3 A;  4A0Z A;  2DQL A;  3MQ0 A;  3CLO A;  4YFX F;  1BJA A;  1UCR A;  3FWE A;  3ZQ7 A;  1HQC A;  5H6Q A;  1UB9 A;  1R23 A;  1T6S A;  4MHG A;  3VOD A;  1D3Y A;  2Y75 A;  4L5I A;  1SD4 A;  1V4R A;  3E5X A;  5LEK A;  2DBB A;  4UV9 A;  3LAP A;  2M8E A;  3SQN A;  1J59 A;  5BPI A;  2CGP A;  2R7F A;  2NRA C;  2DK5 A;  1IXC A;  2Z33 A;  1U6G A;  3FMS A;  3P9K A;  4RS8 A;  2W84 A;  2IJL A;  3EDP A;  2RDP A;  3T1B A;  1XGN A;  2VBX A;  3V8L A;  1Z6R A;  1FYK A;  2XAG A;  2PG4 A;  2A5Y B;  1YW9 A;  4A6D A;  2LSO A;  4JBA A;  2P6S A;  3REO A;  1ZRD A;  4RGR A;  4MGR A;  4EM0 B;  3BPX A;  3CUQ B;  4YFN F;  1OMI A;  3C7J A;  4HF0 A;  4P5O A;  4IHS A;  2H6C A;  2ISZ A;  4P9F A;  1IZ1 A;  1MJB A;  3CUQ A;  2GA1 A;  3IL2 A;  3BWG A;  2ZNZ A;  1Z6T A;  3DPT A;  3VOE A;  3DP7 A;  4LJZ F;  4AVP A;  1V3F A;  1WQ2 A;  4HZF A;  3VEP A;  2O6G E;  3GZ6 A;  4A0X A;  3IRQ A;  1ONV A;  2GIV A;  4GYG A;  3K0L A;  4A0Y A;  2JPB A;  3HOT A;  2CWE A;  4BXU A;  1TQP A;  2BBY A;  2HTJ A;  1HW1 A;  1IN7 A;  4YG2 F;  1GXQ A;  2QWW A;  4EM1 A;  5HOO A;  1S7A A;  4P9U A;  1ZLK A;  1FY7 A;  4U7D A;  1W5S A;  4HAM A;  2LDU A;  2V9V A;  4FX4 A;  1P4A A;  2OD5 A;  3FM5 A;  3WE3 A;  1R7J A;  3F21 A;  5CVI A;  2ISY A;  2MH9 A;  1Z91 A;  4GXO A;  1GXP A;  1ULY A;  4AD9 A;  4KMU X;  4LLN A;  3BJA A;  5JHU A;  2JT1 A;  2XAF A;  3PQK A;  4HQE A;  4MQV A;  4CXF A;  5LBQ A;  3C18 A;  1F5T A;  1FSE A;  3F8F A;  2DK8 A;  1FSH A;  1F4K A;  2EFW A;  1WI9 A;  1PUE E;  2GZW A;  1EH6 A;  3L9F A;  2UXN A;  4HX8 A;  2C6Y A;  1W7P A;  1FPQ A;  1I1S A;  1HKS A;  5J6X A;  4LB6 B;  3QU3 A;  5DYM A;  1HST A;  1K78 A;  4FT8 A;  3WGG A;  2K02 A;  2QQA A;  2E7W A;  2YR2 A;  3QPT A;  3I58 A;  4CGZ A;  2DPD A;  5BOX A;  1YW8 A;  2KKO A;  1E2X A;  1IXR C;  5LGT A;  4HV6 A;  2P8T A;  1HXD A;  3KP2 A;  4ESJ A;  2DAO A;  5KK1 A;  5JFR A;  3IC7 A;  1TLH B;  4LGW A;  2XRN A;  4L9T A;  1KGS A;  1OPC A;  5E1Z B;  3SFZ A;  2V1U A;  3J80 Z;  3GUD A;  3HSF A;  4I0A A;  2O0Y A;  3I71 A;  2DPU A;  2HFH A;  4Q47 A;  2OQG A;  2QLZ A;  2JTV A;  4LK0 F;  1R1T A;  2DU9 A;  1I5Z A;  1ZAR A;  2PFB A;  1YS7 A;  2FEZ A;  3HYI A;  3WU1 B;  1J75 A;  3RKW A;  1XGM A;  1HKT A;  1S8N A;  1CF7 B;  3WTU C;  1DUX C;  4BHB A;  2EV6 A;  1HSJ A;  3TQN A;  4L9V A;  5BPD A;  2CG4 A;  3F22 A;  5ILS A;  1LNW A;  4XLP F;  2E7X A;  5L3E A;  4XSZ F;  3R6S A;  4XBF A;  3RYR A;  2D2W A;  1PDN C;  1W7P D;  1W7P B;  4P55 A;  4QLC U;  2H6B A;  5HS8 A;  2IVM A;  4M9Z A;  2K27 A;  3U2R A;  3HUG A;  1ZRC A;  2ZKZ A;  1PP7 U;  3PQJ A;  3KEO A;  3KP3 A;  2ELH A;  2L54 A;  3GLX A;  3DV8 A;  1ODD A;  1QZY A;  2Z5U A;  1BN5 A;  5BQT A;  2QQ9 A;  3F8C A;  3I0T A;  5AIP A;  4EJW A;  2HWV A;  2IT0 A;  3HRT A;  2QZ8 A;  1BI0 A;  3V8K A;  4HX7 A;  4O3M A;  3K9T A;  3K1N A;  5DDG A;  1XSV A;  4RGX A;  2WTE A;  1D8J A;  3P9C A;  3RKY A;  2FA5 A;  3WTX C;  3BRO A;  5FO5 A;  5CVR A;  2HOE A;  3L2C A;  5J8C A;  2OBP A;  3R4K A;  2MD5 A;  3S2W A;  1EH7 A;  1XCB A;  2UXX A;  1Y0U A;  2CQK A;  2VBZ A;  4G7O F;  4R8H A;  4L0Y B;  2IA2 A;  4F7Z A;  4K2E A;  2J5O A;  4IF4 A;  4RGU A;  2WV0 A;  3HHG A;  1H9T A;  2F5E A;  3T5X A;  1BBY A;  2HQR A;  2VC1 A;  3E6M A;  3GFL A;  1G3W A;  4M73 A;  2PMU A;  3QPH A;  2GXB A;  3D0S A;  3ZMZ A;  4ASN A;  2WWY A;  1B9N A;  5CVU A;  2Z99 A;  2OZU A;  1SD7 A;  2CW0 F;  1SFU A;  2Q0O A;  1WKM A;  5ILV A;  1FC3 A;  2OA4 A;  1MJ9 A;  3ZP5 A;  3QOP A;  3HHH A;  1FYL A;  4WK8 F;  5CVJ A;  3BJ6 A;  3NRV A;  5K5O A;  4G7Z F;  6PAX A;  1QQI A;  2IW5 A;  3COA C;  4KIC A;  4ENK A;  1L3L A;  4RGS A;  4HV5 A;  2TDX A;  4EMS A;  1U3E M;  2VBY A;  4Q48 A;  5ICG A;  2A3S A;  3B02 A;  5D6F A;  2P4W A;  1YG2 A;  3RIR A;  2FE3 A;  3TO9 A;  1K7A A;  1AOY A;  1R1U A;  1LDD A;  4HQM A;  2BYV E;  4EV0 A;  3GFJ A;  4YII A;  1L0O C;  1XSD A;  2ZXJ A;  3WTZ A;  4WWC A;  5L3F A;  1FBS A;  4CIC A;  1YFH A;  5A2Q K;  1XMA A;  4MEX F;  1XGO A;  2X4H A;  1XGS A;  1XCV A;  4A12 A;  2LKP A;  2IPQ X;  5LHH A;  3J7A O;  1BC8 C;  4DNC A;  3Q5F A;  2G7U A;  1IAW A;  4HYE A;  3GW2 A;  5FGM A;  1K79 A;  3T8R A;  4ZYE A;  2P5L C;  5KVR A;  3EYY A;  1IXS B;  4YIF A;  2ESN A;  4JK1 X;  4BYY A;  2CYY A;  4M6Y A;  2ZFW A;  2FSW A;  1U5T B;  2A6E F;  5ICF A;  5LGN A;  2QBY B;  1GHC A;  1USS A;  3R61 A;  5DD8 A;  4DQ2 A;  2CFX A;  3DQV C;  2FXA A;  1O3R A;  2JZY A;  1HBX G;  5IT3 A;  3K1P A;  1AWC A;  3E6D A;  4I02 A;  5D6E A;  2IRF G;  3TKY A;  1KA8 A;  4EQQ A;  1MKM A;  5HDG A;  1QNT A;  4H0E A;  3GX4 X;  1XSX A;  5HVQ C;  1KQ8 A;  2MBF A;  3KP4 A;  2W85 A;  2OU2 A;  3QU6 A;  1JHF A;  1F9N A;  1IN5 A;  3K2Z A;  4G7H F;  4WF2 A;  2Z9O A;  4L18 B;  2QVO A;  1ZHF A;  4UUV A;  2FRH A;  1IRF A;  2ETH A;  1CF7 A;  2HZT A;  2JRT A;  1YO5 C;  1D8K A;  2KIM A;  1MJA A;  3E3V A;  1YQA A;  1RUN A;  3ZMV A;  5FB2 A;  4R79 A;  5CYV A;  3FM3 A;  1SMT A;  1YIO A;  3ML6 A;  1UST A;  5E8I A;  1SFE A;  4ESB A;  1QO0 D;  4UVC A;  2RV8 A;  2VBW A;  3VB2 A;  2DQR A;  1WRJ A;  2HR3 A;  1A04 A;  2V79 A;  2F5C A;  4ON0 A;  3F6O A;  3Q9S A;  3R0J A;  2PI0 A;  1B1B A;  1KU9 A;  2DTR A;  2V6C A;  2ZO4 A;  3RPU A;  1HKQ A;  5DV5 A;  4ENM A;  3MAJ A;  3RPQ A;  3ZMS A;  3HSR A;  5TRD A;  4EGZ A;  1ZYR F;  5E1W A;  2XAS A;  5BS6 A;  3F6V A;  1TQM A;  3VFZ A; 
#chains in the Genus database with same CATH topology
 2X0L A;  3BDD A;  4EEF G;  3L7W A;  2CV0 A;  3L1P A;  4AIK A;  3G1L A;  4OIO F;  2DA3 A;  4OOI A;  2K9M A;  1XB4 A;  4KN7 X;  3MVP A;  3EUH A;  1TQI A;  2E34 A;  3OSG A;  3PIO F;  3MKW B;  2IXS A;  4Z2Y A;  5IY5 H;  2JMW A;  1BW6 A;  1IO2 A;  3BOQ A;  2CRG A;  5KHD A;  1BM9 A;  3S1R J;  3WGH A;  2BZT A;  1UHW A;  3F23 A;  2A6T A;  3DEU A;  2R7Z J;  2JUG A;  2EFN A;  2ESH A;  2VQL A;  1FIA A;  3T0Y A;  4D1Q A;  1TL8 A;  3FMQ A;  2B9S A;  4Y7N J;  1JUS A;  2B63 J;  2W25 A;  4W1U A;  3VYT B;  4MTD A;  2EA4 A;  3M7G A;  3AAF A;  1MMG A;  2CUF A;  2AQF A;  3DTE A;  2FBH A;  4CZZ A;  3OYL A;  4A3M J;  3IH4 A;  2JK3 A;  5DTD A;  1XN7 A;  3GXO A;  2W7N A;  3MZH A;  2NNN A;  4XOT A;  5B66 C;  5ICC A;  2OQR A;  2XV4 S;  4B4C A;  2A5W A;  2E1N A;  5IYD J;  2EIM H;  2G0E A;  1DPR A;  4U0Y A;  1WJC A;  2BEO A;  2LY1 A;  3GF2 A;  2EV0 A;  3K1M A;  3F8M A;  3OR2 C;  3QP5 A;  3TW7 A;  3VPR A;  4A6E A;  4C2T A;  2RNJ A;  4JQF A;  4M6V A;  2QQB A;  4KFC A;  4BQA A;  2PN6 A;  5D8L B;  3MFK A;  3CES A;  3H3Z A;  4ZYG A;  3WTT C;  1UEL B;  1X4O A;  5LD2 C;  3ASO H;  3QOD A;  4IHV A;  5H20 A;  4OAZ A;  4UXN A;  2QUF A;  4NC6 A;  3RKQ A;  2O8K A;  2H8R A;  1VQ6 I;  4DIQ A;  1LQ1 A;  1Z3X A;  4O5V A;  1VQM I;  3SZP A;  5EEH A;  4XIC A;  1BR4 A;  5DUI A;  1FYM A;  2PEX A;  2FJ1 A;  1K6O A;  1IN8 A;  1GV2 A;  4LD5 A;  2J5P A;  1Z05 A;  1LFP A;  2CH0 A;  3HPG A;  4M3D A;  3NWS A;  3NWT A;  1SFO J;  1PVE A;  2ME6 A;  2F4O B;  5LRS A;  1DQU A;  2R3S A;  2X85 A;  5DM6 F;  2JPC A;  2BXZ A;  2HI3 A;  5E20 A;  4IKF A;  2Q2E A;  1R1V A;  4KA4 A;  4IJA A;  4HEA 2;  1OJL A;  5F1J A;  3FXQ A;  3ROU A;  1P6R A;  5ICE A;  1RIO H;  4Y15 A;  2L7K A;  2FOW A;  3S1N J;  4P96 A;  1JTX A;  4M72 A;  4AU7 A;  3OSF A;  1GV5 A;  2F5F A;  3C3W A;  2HQA A;  1OR7 C;  2W82 A;  2LR8 A;  4U0W A;  4ANJ A;  4D9J A;  5HLI A;  3I64 A;  3HZJ A;  3BP8 A;  2P7V B;  3HXL A;  1X1P A;  4G6Q A;  4CYC A;  3DKX A;  2I8D A;  3D5R C;  4RAZ A;  5KNL A;  1SMY F;  4TV7 A;  4UV8 A;  1H0M A;  5HLH A;  4BEH A;  1LVA A;  3E6B A;  4RM2 A;  2ACJ A;  2R7U A;  3OYB A;  1FT9 A;  3WTV C;  3KZZ A;  2DYR H;  2LBF A;  3GTQ J;  1ZH5 A;  1LFU P;  5BMZ A;  3CJN A;  1Y6I A;  3OR1 C;  3NAU A;  1SAX A;  3FHZ A;  2BVL A;  1Q1H A;  3I4P A;  1IN6 A;  1T0F C;  2WB1 N;  3BTL A;  3QYB A;  1QZE A;  3EYI A;  3DF8 A;  4X1E A;  5GTI C;  3LFU A;  4EJT A;  4BY7 J;  3J81 K;  2YU9 J;  3ABU A;  3U1D A;  3B6A A;  2M45 A;  4C2M J;  5LEJ A;  4S04 A;  1K4T A;  1K78 B;  4IEJ A;  2GWR A;  2PJR B;  4R1H A;  2DO7 A;  4ZZL A;  1Z7U A;  4B09 A;  1VQO I;  3R60 A;  2VT2 A;  3CCM I;  3PNT A;  4BXF A;  5FFX A;  2M2E A;  1SD5 A;  4A5M A;  3HOS A;  3I59 A;  5IOY A;  3I4N J;  1SVM A;  2V26 A;  2RQP A;  3BZ6 A;  3DTK A;  3MCZ A;  3C1D A;  2Z3Y A;  3SXY A;  3BTJ A;  1BI1 A;  2X1E A;  3CCJ I;  4ITV A;  2F5D A;  1XG1 A;  2K4J A;  1S72 I;  5JLX A;  2RKH A;  1BR1 A;  3LSH A;  2ZJR F;  4F55 A;  1KU3 A;  1LJ9 A;  2EPF A;  5K7H A;  1U8R A;  2VKD A;  2YX7 A;  3OYC A;  4AYB A;  3QQA A;  4A3D J;  1HC8 A;  3AG1 H;  2EIN H;  3A2K A;  2EZL A;  1ZTR A;  3QAH A;  4FHT A;  3SZG A;  1YLF A;  3O6B B;  4BE2 A;  4UY8 I;  2Y48 A;  2HGC A;  1J0R A;  3V7R A;  3K69 A;  5F04 A;  2JUC A;  3ERM A;  3ULQ B;  2MLK A;  2N8G A;  3DFG A;  1REP C;  2YPR A;  2KRF A;  5ED4 A;  2LC2 A;  4C3I J;  4LG0 A;  3X2Q H;  3IKV A;  2XC7 A;  2XGX A;  3L2V A;  1TNT A;  2BHZ A;  5FD5 A;  3ISP A;  3GVA A;  3EQL F;  3RPU D;  4RB2 C;  4PJJ A;  3HL2 A;  3I56 I;  4ETS A;  3JRB A;  3J7A Y;  4G8X A;  5CVV A;  4NHJ A;  4XR6 A;  2LMD A;  1LDK B;  2VT3 A;  3CUO A;  1C0W A;  3BCB A;  3ZR8 X;  1YE9 A;  4KNY A;  1OCO H;  3OY9 A;  3JRA A;  1R36 A;  3CCU I;  3QOE A;  1BIA A;  4WCG A;  2DW4 A;  2YU3 A;  4Q4Z F;  3IUO A;  4ESF A;  1JGG A;  1OLT A;  4PJL A;  4OIN F;  2IS4 A;  1B6A A;  2EJR A;  2GOX B;  3E5U A;  3FXO A;  3GFI A;  2UZK A;  1WPK A;  5F1R A;  1I3A A;  4WXD A;  4NQW A;  2VN2 A;  1XMX A;  1RET A;  2DMU A;  5GTH C;  2OZ6 A;  3DKY A;  3MEX A;  3BR0 A;  3PSI A;  1A31 A;  4ZDL A;  3K70 C;  2KRC A;  5K7F A;  4HW0 A;  1XD7 A;  1X3Z B;  2H27 A;  4XL9 A;  2DA2 A;  2VL8 A;  4IL6 C;  2H1K A;  3PM1 A;  1LUJ B;  1Z1D A;  2M7A A;  3FX3 A;  2WBM A;  3BR3 A;  2NVX J;  1HW5 A;  2X9D A;  4ZDP A;  2VKV A;  5GP9 A;  2WC2 A;  2XDV A;  3I9V 2;  5DCM B;  5E79 C;  3KIO A;  2X51 A;  1JKP C;  3W6J B;  2G7H A;  2X48 A;  3JAM Z;  4XLN F;  1OCC H;  4A3L J;  4JYK A;  1MGT A;  3V8J A;  1B72 B;  2NS7 A;  1KYW A;  3C2B A;  4PGH A;  3BG5 A;  3G1M A;  2L3D A;  1Z9C A;  3S1Q J;  5JR3 A;  2A68 F;  3AFH A;  1MNM C;  3BR5 A;  1X3W B;  3RJP A;  2LNB A;  2DMP A;  2VE9 A;  5J8F A;  4CHU A;  2DTZ A;  1SVL A;  1YIT I;  1V55 H;  1BJZ A;  5F64 A;  4X0G A;  3RKX A;  2R5Y B;  3GLL A;  4OMZ A;  4XSX F;  3U9G A;  1FIP A;  2Q2E B;  4M6X A;  3JSP A;  3SJM A;  4XRS A;  1I6X A;  3M8E A;  1RKW A;  4NC7 A;  4EM2 A;  3C2G A;  3L09 A;  3OYN A;  3GTO J;  2QF7 A;  1RZ4 A;  1MND A;  3CP2 A;  3M4O J;  1VQ5 I;  4BAY A;  4CDG A;  3GTL J;  2EIK H;  1T2K A;  1KQ0 A;  2IGO A;  2MYS A;  2V6E A;  2D45 A;  1O7L A;  1IRX A;  2KMU A;  2I5U A;  1X3U A;  1QHH D;  3WTW C;  1D5Y A;  3SYT A;  2GXG A;  1VQ8 I;  3TW6 A;  5EF6 A;  1FWZ A;  2IS2 A;  4L0Z B;  4ENN A;  4CYD A;  1H9G A;  2PQ8 A;  5B5E C;  3HOY J;  2CW7 A;  3RI4 A;  2STT A;  4IHT A;  5E17 F;  1LVK A;  1VFC A;  2BW3 B;  1W4M A;  4I76 A;  4M9X A;  4QIW N;  2QA4 I;  1ETO A;  1JUM A;  2DI3 A;  4Z6Y A;  2W00 A;  2DOF A;  1UG0 A;  1DDN A;  2JSC A;  1W0T A;  2QSG X;  1K61 A;  2IAI A;  4A3K J;  3NAR A;  2NNY A;  3SZT A;  5GAH J;  4LG0 B;  2HXI A;  4EJV A;  3QPS A;  2XKO A;  2W4S A;  2A61 A;  2DOA A;  4U7B A;  3P7N A;  2G9W A;  2R7V A;  3ECH A;  3LSK A;  4NDL A;  2D1V A;  1YS6 A;  1P4X A;  1B59 A;  3T8T A;  4XRF A;  3V7S A;  5E1X A;  3HRS A;  2VC0 A;  2HYJ A;  2M8G X;  4Q5S F;  4KIG A;  4XLA A;  2LYC A;  3F8N A;  1U2W A;  3WTS C;  1I1G A;  2L9R A;  5HS7 A;  3KE2 A;  3LQR A;  5F0C A;  3KCC A;  4UHT A;  5H2F C;  2B7E A;  3IHU A;  1VQL I;  1D5V A;  3GME A;  2O7O A;  4XK4 A;  2E71 A;  1IV6 A;  3MWM A;  3BT9 A;  4XKB A;  5IPA A;  2E35 A;  2FOK A;  2ZME C;  1SAN A;  5CPR B;  4KT6 A;  2JA7 J;  3Q9V A;  4XOP A;  3LSI A;  3CJQ B;  2RN7 A;  3FMR A;  3I59 B;  4IRG A;  4YIR X;  1Y39 A;  2JA8 J;  1T98 A;  2BGC A;  4M74 A;  1FOK A;  4II3 A;  5EYR A;  1ETY A;  1FP2 A;  3CTA A;  4F93 B;  1UAA A;  4IRH A;  3IH3 A;  1OYI A;  3OYI A;  2BE5 F;  2COM A;  2VQH A;  4XKC A;  3WHC A;  3A4C A;  2ZC2 A;  4G94 A;  5A2Q Z;  2O9L A;  1ETQ A;  1G2H A;  2HDW A;  5LRR A;  2BVM A;  4M9S A;  4IOC F;  5FRM A;  3HM5 A;  3RZD J;  4U0V A;  1BA5 A;  4AYB N;  2CV2 A;  5B1B H;  4DYQ A;  4MNU A;  5B3S H;  3ABL H;  4EJU A;  1FOY A;  2Q8K A;  2PMH A;  4ZZD A;  3E97 A;  5DD4 A;  4UUS A;  1ERD A;  4LIV A;  2DMQ A;  1VF9 A;  2RVC A;  3OYK A;  3LL7 A;  1S29 A;  2ZME A;  1IN4 A;  3ONQ A;  3R0A A;  3TED A;  4ZYD A;  2NOJ B;  4Y17 A;  4N9H A;  1JE8 A;  3PNY A;  4JOM A;  4E6K G;  4Y33 A;  4YRV A;  2M0M A;  4DGW B;  5GAE J;  1OYY A;  4RLQ A;  1DGR M;  2XAU A;  3K2A A;  2P0W A;  3KZY A;  3WE2 A;  2JA2 A;  3W3C A;  4CYC B;  1U78 A;  3OYG A;  1DU6 A;  2GAU A;  2HKX A;  4LK1 F;  4CCJ A;  1T39 A;  2W24 A;  1SVO A;  3ZPL A;  4W97 A;  4G6D A;  1BC7 C;  2E1C A;  1PP8 F;  4OU0 A;  5LLQ A;  1S7O A;  2LP0 A;  4ENJ A;  1G59 A;  4C2U A;  4NNJ A;  2XRO A;  5D5U B;  1IRG A;  3I3L A;  3BQZ A;  2EA2 A;  4F91 B;  2E2H J;  2VQG A;  1IW7 F;  5EZH A;  5TJJ A;  3VSK A;  4WX9 A;  4AID A;  2K7L A;  3MD2 A;  2LF7 A;  2BY0 A;  3CC4 I;  1G8X A;  5HDK A;  2LVS A;  1TW3 A;  3H3U A;  1P4W A;  2CUZ A;  2R4G A;  2ECC A;  3DU6 A;  4KMF A;  4ZJZ A;  2STW A;  1BI3 A;  3WGI A;  3ELK A;  3CMM A;  1ZG5 A;  1J09 A;  3KLO A;  1ZAO A;  5FRN A;  2GA2 A;  5EGO B;  4L5J A;  1EH8 A;  2LD5 A;  1OQY A;  3ECO A;  2V1X A;  3TOB A;  3I53 A;  3M8F A;  2EK5 A;  3S93 A;  5E18 F;  3HBL A;  3ABT A;  2QKM B;  1BR2 A;  2GBY A;  1ITY A;  2M1B A;  2ZJQ F;  4XRS G;  4BH9 A;  1O7F A;  2VXD A;  1W36 C;  3TDZ C;  3H9Q A;  3O2P E;  2D1H A;  2FNP A;  3KP5 A;  3IV5 A;  1YW7 A;  4Y13 A;  4N0B A;  4AIJ A;  3DKW A;  5EG0 B;  2EB7 A;  2MH2 A;  4A5N A;  5L3B A;  3H92 A;  2P7C B;  2VON A;  1OR7 A;  1P7J A;  2R7D A;  1JGS A;  2DJI A;  3Q0U A;  2WY7 Q;  1S9H A;  1Z3Y A;  2XAQ A;  1QBJ A;  2HNH A;  4XLE A;  3S32 A;  4FX0 A;  2EFQ A;  4KN4 X;  1QA6 A;  3NEU A;  3OL4 A;  2F6C A;  1RRJ A;  1W1W E;  5IYB J;  5LHI A;  5CJ9 A;  3LAJ A;  3HGY A;  3JAM K;  4E7Z A;  3QRF F;  1VQ4 I;  1V54 H;  3M9A A;  5HLG A;  4FAS D;  4FQG A;  3H9G A;  4YFK F;  3BR6 A;  3KP7 A;  5FLV A;  4OIP F;  3BC8 A;  2FX0 A;  2Y0S N;  3V7C A;  3HSE A;  1NTC A;  4B3X A;  2F2E A;  4HLX A;  3F72 A;  3L2W A;  2EIJ H;  2PLY A;  2HDC A;  1XX5 A;  2K9N A;  2CS3 A;  3LWF A;  1DPU A;  4HOB A;  3GEZ A;  2AS5 F;  1MBG A;  3GTG J;  4HSR A;  1RC9 A;  3B6C A;  3OV8 A;  4KIB A;  4I09 A;  2O03 A;  3CDI A;  3LOC A;  5IOZ A;  1H88 C;  3HKZ A;  5EGO A;  1A6I A;  4PCQ A;  5TIS C;  2VLA A;  1T38 A;  2NAZ A;  4CO8 A;  2WAQ A;  1U5T C;  2NVY J;  5ILU A;  1LKX A;  4EGY A;  2PJP A;  2L01 A;  2FNA A;  2KL4 A;  2H09 A;  1EJ9 A;  1TW2 A;  3GFM A;  2ID3 A;  3SHF A;  2M0C A;  4GCV A;  5ERI A;  2KIU A;  4D5C A;  3V42 A;  1Q1V A;  5DUK A;  1MSF C;  4KT5 C;  3FDY A;  4OIQ F;  3DEE A;  5F0H A;  1X1A A;  4RA2 A;  3N4M A;  3DXJ F;  3GWZ A;  4EAT A;  2WAQ N;  4U87 A;  2X6O A;  1ZN2 A;  4WXH A;  2DOE A;  3G4S I;  5FD6 A;  1XPX A;  2CSO A;  2RC4 A;  4RAF A;  3LA7 A;  1TWA J;  3RTR A;  1YIJ I;  2LF8 A;  3ZCO A;  2L4A A;  1R22 A;  3FKJ A;  3JRH A;  2XPU A;  2V1D A;  5LGU A;  3WHB A;  2Z2S B;  1CGP A;  4DBQ A;  4IZZ A;  1Y8R B;  3HDD A;  2HTS A;  1IJW C;  1LE8 B;  4O6J A;  3HGG A;  2A69 F;  4FET A;  3DBR B;  5FKO A;  1I39 A;  4DZJ A;  2K3P A;  4N9I A;  2A6H F;  4B1R A;  2HEO A;  1T0F A;  1TWF J;  3VYU B;  3MKZ A;  2KQR A;  4IO9 F;  1V5E A;  4MQ9 F;  1STZ A;  1R5H A;  4I0B A;  4BU2 A;  2IP2 A;  2Y0M A;  4HNT A;  1JHH A;  3G1O A;  2HVS A;  4LIU A;  3DWL E;  5FFZ A;  3HC7 A;  3TP3 A;  3K4N A;  4I7H A;  4C9Y A;  2BV6 A;  1MZB A;  4NQW B;  1IDZ A;  2KT0 A;  4KIS A;  4XMY A;  3K7A J;  3WG9 A;  2WV1 A;  2M5W A;  1EKE A;  1X1B A;  2MA3 A;  5C3E J;  3WOD F;  2DFI A;  2EFP A;  1VND A;  3G6E I;  2KLO A;  2CO5 A;  2GM4 A;  1S6L A;  1D1A A;  2KIF A;  4Y52 J;  3CCQ I;  3GO5 A;  5J4Y A;  3PFY A;  3HOV J;  1WJF A;  2XRL A;  4BHP A;  5IT9 K;  2XF7 A;  3DLA A;  4OIR F;  4IRI A;  1WJ5 A;  1RES A;  2VOD A;  3OIO A;  4BJ6 C;  5E3M A;  1ZRF A;  1KQ9 A;  3A0H C;  1OCZ H;  1MBJ A;  2JRM A;  4AIH A;  4IXA A;  3ASN H;  4C3H J;  5J40 A;  4EVI A;  1JT0 A;  2QBY A;  2K9Q A;  4HF2 A;  1GVJ A;  5JVT A;  1ZLJ A;  4CZC A;  3LA3 A;  4BHC A;  3KEY A;  3TMO A;  2E36 A;  3S8P A;  3GTJ J;  3H3V K;  1WJD A;  1BI2 A;  2IA0 A;  2XHK A;  3BLY A;  2LK2 A;  5FKK A;  4LLL A;  4PZJ A;  1QGP A;  1ZGA A;  2O3F A;  4FE4 A;  2I10 A;  4QSH A;  5IT9 Z;  3D5L A;  1D0Y A;  3OOP A;  3C2H A;  3W2W A;  2QCO A;  1UFM A;  2ZXW H;  3BZC A;  3SEZ A;  4HST A;  2TCT A;  2XGD A;  2V9K A;  2VOO A;  4XQF A;  4V2G A;  5LFA A;  3JR9 A;  1ZRE A;  1V5F A;  4DW6 A;  3FXM A;  3H1C A;  3M1E A;  2OTJ I;  3I5U A;  4QPO A;  3BG7 A;  1KYZ A;  3FF5 A;  1FNN A;  1HDD C;  3RZO J;  3K10 A;  3VSL A;  3ZQH A;  1ENH A;  4CUG A;  3F8B A;  5DCF A;  2DN0 A;  4HG2 A;  1MH3 A;  1RI7 A;  3SFI A;  2VXZ A;  4UVA A;  1BIB A;  1G6N A;  2HS5 A;  1O3T A;  3L2Q A;  9ANT A;  1T08 B;  1QZZ A;  4KDP A;  4XN0 A;  3PIP F;  4E70 A;  1IUY A;  2YSR A;  3FXU A;  3H35 A;  3PO3 J;  1QPM A;  3P5J A;  4MFE A;  2HYF A;  2FUG 2;  2LOO A;  5K1Y A;  2VE8 A;  5HDN A;  2XIG A;  3KEQ A;  1YTY A;  1R5I D;  2W57 A;  3HUG B;  4BJT A;  2VOP A;  3DU5 A;  1WFX A;  2Y9Y A;  4XON A;  1MW7 A;  4LLG F;  5DEQ A;  1UJ8 A;  4M3F A;  1E3P A;  3JRF A;  3GTP J;  4IPA A;  2KIS A;  2VJI A;  3ZN0 A;  4PSX A;  2WAE A;  2Z1D A;  1P92 A;  2KJB A;  2XUB A;  3AG2 H;  2HQN A;  4BJ5 C;  3JCU C;  1TTY A;  2XPV A;  2GOM A;  4RB0 A;  2JVH A;  4CCM A;  1NHA A;  3KZI C;  3CMA I;  2R7Q A;  2QEN A;  4L9J A;  5M5Y J;  2FBK A;  1KU2 A;  2KZG A;  2QM3 A;  4KIT B;  3RDI A;  5D8K B;  2HYG D;  4FE7 A;  3GYH X;  3TO7 A;  5JI6 A;  4KYW A;  1SD6 A;  4E7S A;  5DCM A;  3Q0V A;  3J81 Z;  3HRU A;  1MIJ A;  4MTE A;  1J2X A;  1T33 A;  3JTG A;  2AXL A;  4KJZ A;  3VDX A;  3WTY C;  1FZP B;  2Y0S A;  1I6H J;  3OS0 A;  1B9M A;  2E2J J;  1X4P A;  1ON1 A;  2XB5 A;  2F5V A;  2W48 A;  2ZSH B;  5D4R A;  3W2A A;  4HNV A;  4HLY A;  5AON A;  2FMY A;  2WY8 Q;  4GO1 A;  2KP6 A;  5K5Q A;  2XAH A;  4I98 B;  3LSM A;  2IBD A;  4A3I J;  1BOA A;  2K9S A;  2MC3 A;  4UVB A;  2IGM A;  2JJ7 A;  3FZV A;  3BY6 A;  1TNS A;  3ZN1 A;  3BPV A;  4BS9 A;  3CF5 F;  2HOA A;  4IVN A;  2M4G A;  3JSO A;  3KFW X;  1WSU A;  2XKP A;  4AWX B;  2M34 A;  5LHG A;  3FIS A;  2PBI A;  2KRH A;  4GYI A;  1MMS A;  5FLX Z;  2B0L A;  3WU0 A;  3FXR A;  1MD0 A;  3B73 A;  4HDU A;  3DBL B;  3N05 A;  1XMK A;  4HA8 A;  3CCR I;  2Z16 A;  1VQ7 I;  1J9I A;  3CCY A;  1QVU A;  2VB6 A;  5EEG A;  2R5Z A;  1OYW A;  5HOD A;  4XLC A;  2ZME B;  1R00 A;  5HS9 A;  1O4X A;  3HTS B;  4HBL A;  1HOM A;  3BTI A;  1X2N A;  1LEA A;  2IA1 A;  2P6T A;  3S2H J;  2DMT A;  1ORK A;  2FF4 A;  3PUB A;  2EWN A;  5FLX K;  1AKH B;  1O3Q A;  3HTU A;  3AKZ A;  4Y4R A;  1VZ0 A;  1FP1 D;  2QSF X;  4WXC A;  4ZH4 F;  3CO6 C;  1SFX A;  4S05 A;  1QRY A;  3QP6 A;  2K4B A;  4LFU A;  1MBE A;  1VQ9 I;  3JTH A;  4ZYH A;  1TWC J;  3IAM 2;  3CUQ C;  1WWX A;  2JVG A;  4OWR B;  1CQT A;  5K5R A;  1U0J A;  3KP6 A;  4IQ4 A;  3S14 J;  3H5A A;  3DEW A;  2FD5 A;  5IP7 J;  4AC0 A;  2FU4 A;  4QWQ A;  1J5Y A;  3MN2 A;  5EEA A;  3KLN A;  5C44 J;  3HRM A;  1B8I B;  3UR3 C;  5HLT A;  1E3H A;  3G2B A;  1TP4 A;  2BY2 A;  4I6Z A;  3CCS I;  4BDZ A;  2ZJ2 A;  4B8X A;  3A03 A;  3KET A;  2ELK A;  3LQQ A;  3ZMD A;  3IWF A;  4XKW A;  1KU7 A;  1P9Q C;  1G3S A;  1Z0X A;  5GAD J;  1N75 A;  4PJN A;  2HDD A;  2HKO A;  2O61 A;  3FKI J;  3L00 A;  2PMZ A;  2MLG A;  3A1Y A;  4RB1 A;  1F1Z A;  1FLI A;  3NQO A;  2R92 J;  3TOA A;  5JLW A;  1R71 A;  3Q0W A;  3I4M J;  4M71 A;  4IHW A;  4IOA F;  2VQC A;  3FIW A;  2R7S A;  3TO6 A;  1B8I A;  5F27 A;  3LMM A;  2P5V A;  3ERE D;  1N78 A;  2R7X A;  1W5T A;  1U9O A;  1PUF A;  1JJ8 C;  4RAY A;  2RNG A;  3DPL C;  2H94 A;  3ZOB A;  2K86 A;  3O8H A;  2M30 A;  1FBU A;  5D5X B;  3E6C C;  4HDV A;  4H4K C;  3G3Z A;  2W1O A;  3BTC A;  1J7K A;  4D0P A;  5D5W B;  5J4V A;  5D4S A;  1X2M A;  4PGG A;  2VI6 A;  3BQY A;  3BG6 A;  1X1C A;  5M5X J;  1UHM A;  1XC5 A;  2JN6 A;  1MDM B;  1UHS A;  1R5G A;  4CH7 A;  3F9K A;  2LBF B;  1LB2 A;  5H6R A;  3BCA A;  2X6Y A;  1Z21 A;  4U88 A;  1E3O C;  3ABM H;  4BEH B;  2CW8 A;  3EET A;  3I54 A;  3LST A;  2R5Z B;  3CDH A;  2LRD A;  4PK4 A;  2L4M A;  4BY1 J;  2X6W A;  4G9Y A;  5IYC J;  4MEY F;  4RDU A;  1BOB A;  2L02 A;  1HA8 A;  3V4G A;  2NS0 A;  1YX3 A;  4LB5 A;  3KPH A;  2A05 A;  5E8G A;  2DT5 A;  5L3C A;  3SDG A;  4KUM A;  2Q1Z B;  5JHF A;  4E7L A;  2CQ7 A;  4EJO A;  1JI8 A;  3M1C A;  3ZMU A;  3J7Y J;  1R6R A;  1ZGJ A;  3SEQ A;  2ZNY A;  4LMY A;  1IGN A;  2QYO A;  3QYE A;  2NS8 A;  3ZQI A;  1XDS A;  5L3G A;  4L9N A;  1EV7 A;  3RYP A;  2DDB A;  5GPC A;  3S3N A;  1H8A C;  4D7M A;  3HOU J;  5CKT A;  3ZQL A;  1DP7 P;  1XDU A;  1O3S A;  2E2I J;  4BNC A;  2WA0 A;  4UNO A;  3CCV I;  2ADU A;  2FQ3 A;  2WB1 A;  2WAF A;  2XAJ A;  1IF1 A;  2EFO A;  1P2F A;  1I50 J;  2XVC A;  2YX4 A;  2UUZ A;  3ZQC A;  4GGG A;  1ON2 A;  2RRE A;  5B1A H;  3LA2 A;  1B4A A;  4BE0 A;  3O3K A;  1G3Y A;  2ZBK A;  5IP6 A;  1ZG1 A;  2H8W A;  1YOV B;  1HW2 A;  4HF1 A;  2ZCW A;  2KDZ A;  2EIL H;  3CME I;  3OYE A;  3OOU A;  2LFB A;  1W5C C;  2CUJ A;  4M3B A;  1OKR A;  2L7Z A;  3G73 A;  2MC4 A;  5AIQ A;  3IWZ A;  3CO7 C;  2DLL A;  4X6A J;  3PNV A;  4BQO A;  5D5V B;  1MDM A;  3OYM A;  1MMD A;  2EZI A;  3E5Q A;  2F4M B;  3W6K B;  4BQN A;  2QKL B;  2LY2 A;  1JXS A;  1NG7 A;  4ABZ A;  2KJC A;  3TGN A;  1TT5 B;  3N97 A;  3OYH A;  2LRE A;  2UWM A;  3PJR A;  5JVG F;  4PDK A;  1F36 A;  2FBI A;  1Z77 A;  3JW4 A;  4HX4 A;  1Y1W J;  1TBX A;  5L3D A;  3TP0 A;  1IDY A;  2OAZ A;  3J80 K;  1I27 A;  1YJW I;  2P5K A;  3MZY A;  4NB5 A;  5CLS A;  2ZFU A;  2DA1 A;  4KIF A;  3P9I A;  3OWT A;  2E5N A;  5M3F J;  3AG3 H;  1E17 A;  2MGQ A;  2Y30 A;  1LDJ A;  1G4D A;  2LLK A;  5F6F A;  2E19 A;  1U5T A;  2RGV A;  3S17 J;  2DA7 A;  4RB3 C;  1ETW A;  2EV5 A;  1RR7 A;  1VTN C;  1R58 A;  1RNL A;  1FX7 A;  1LPQ A;  5FKM A;  3BG9 A;  1ZGW A;  1RUO A;  3IRR A;  2FML A;  2M87 A;  3TL4 X;  2A07 F;  4L5E A;  2QQ8 A;  1ZR2 A;  1S3J A;  2CFO A;  3PFI A;  4LIT A;  3IKT A;  2GLO A;  4I01 A;  1LEB A;  1GUU A;  2KDO A;  4UB8 C;  2L7F P;  4A2U A;  3H5R A;  2GIZ A;  4QPQ A;  2E60 A;  2NYX A;  1JKQ C;  2OV7 A;  3HIF A;  2XSJ C;  2KIQ A;  2O8X A;  2XB0 X;  4MO7 A;  4A3B J;  1FBQ A;  1D1C A;  4OMY A;  3ZMT A;  2DFF A;  2ZB9 A;  2GQQ A;  2QSH X;  3GTK J;  1GT0 C;  1TWG J;  4I2O A;  3TDU C;  1E0E A;  2R7R A;  2BHY A;  1O57 A;  4YEJ A;  4B43 A;  1G3T A;  1YYV A;  3F3X A;  3GZ5 A;  2CJJ A;  3BJO A;  3LFK A;  1ZG3 A;  1BL0 A;  4A0Z A;  2DQL A;  3MQ0 A;  3CLO A;  4YFX F;  1OCT C;  3CQZ J;  1WJA A;  1T56 A;  1BJA A;  1MBK A;  1UCR A;  1UZC A;  3FWE A;  3JRD A;  4DBR A;  1EF4 A;  3ZQ7 A;  1HQC A;  5H6Q A;  1UB9 A;  3D1N I;  2M4K A;  1UG2 A;  3I55 I;  3JRG A;  1TC3 C;  1R23 A;  1D0X A;  1T6S A;  4MHG A;  1FEX A;  2VJ5 A;  3VOD A;  1D3Y A;  3OYJ A;  2Y75 A;  2JA5 J;  2ECB A;  1IUF A;  3EUK L;  3HOW J;  4L5I A;  1NK2 P;  2XSD C;  1JKR C;  1SD4 A;  1V4R A;  2V1N A;  3FXL A;  3E5X A;  3K6G A;  3KX2 A;  5LEK A;  2DBB A;  4UV9 A;  3LAP A;  2M8E A;  4AUX A;  3SQN A;  5BPI A;  1J59 A;  1RKT A;  4B3A A;  4HPQ A;  4BGD A;  2CGP A;  1OCR H;  2R7F A;  2VIX A;  4MLO A;  2KPM A;  3U1K A;  2DK5 A;  2NRA C;  1IXC A;  2Z33 A;  1U6G A;  3FMS A;  2PJR A;  3P9K A;  4JP0 A;  4BL0 B;  2R93 J;  4RS8 A;  2OCC H;  2W84 A;  2IJL A;  3EDP A;  2RDP A;  3T1B A;  3HPH A;  1XGN A;  2IGK A;  1N25 A;  2VBX A;  3V8L A;  3A01 A;  1Z6R A;  1FYK A;  2XAG A;  2AXT C;  2PG4 A;  2A5Y B;  4LG3 A;  5DM7 F;  1YW9 A;  3ZQG A;  4A6D A;  2LSO A;  3FXK A;  4A3C J;  2NVT J;  3BR2 A;  4JBA A;  2QEX I;  2K3F A;  3LSR A;  2P6S A;  3REO A;  1W36 D;  2R5Y A;  1ZRD A;  3OYF A;  3H0D A;  4RGR A;  4MGR A;  2VPL A;  4EM0 B;  2L0K A;  1LE8 A;  3O8G A;  3BPX A;  3CUQ B;  1ZKG A;  1OMI A;  3C7J A;  4YFN F;  2C6Y A;  4HF0 A;  4P5O A;  1APL C;  2IGN A;  1U9N A;  1R9T J;  2JQ7 A;  4IHS A;  2H6C A;  2ISZ A;  4P9F A;  3W2V A;  1IZ1 A;  4ZTF A;  1MJB A;  3CUQ A;  2GA1 A;  2XF5 A;  1W0U A;  5FKN A;  1OFC X;  3IL2 A;  4JX6 A;  2HOS A;  3BWG A;  2ZNZ A;  1Z6T A;  2K40 A;  3DPT A;  3S1M J;  2HQ5 A;  1FMW A;  3VOE A;  3PUF A;  3DP7 A;  4LJZ F;  1D1B A;  4AVP A;  3VYS B;  1V3F A;  1R4N B;  3M8J A;  1WQ2 A;  2DFE A;  4HZF A;  3VEP A;  2LTP A;  2O6G E;  3GZ6 A;  3K4K A;  4JX5 A;  4G12 A;  4A0X A;  2X1C A;  1ACI A;  3IRQ A;  1ONV A;  2GIV A;  1F43 A;  2KHM A;  3MZ8 A;  4GYG A;  3A01 B;  3K0L A;  1MNE A;  4A0Y A;  2JPB A;  3HOT A;  4E7H A;  4A3E J;  2CWE A;  3SDB A;  4BXU A;  2PX9 A;  1TQP A;  2BBY A;  2HTJ A;  1HF0 A;  2DJN A;  1HW1 A;  1IN7 A;  1SEU A;  4YG2 F;  3OIP A;  1T8I A;  1IC8 A;  1GXQ A;  2QWW A;  4EM1 A;  2JSP A;  1S7A A;  5HOO A;  4BE1 A;  2R7O A;  4FTH A;  4P9U A;  1ZLK A;  1FY7 A;  4E7K A;  1PYV A;  2L5Q A;  4PUS A;  3W6V A;  5KAI C;  4U7D A;  1W5S A;  4HAM A;  2DDA A;  5C4J J;  2LDU A;  1YI2 I;  2V9V A;  4FX4 A;  2CV1 A;  1P4A A;  3E7L A;  2OD5 A;  3LSJ A;  3FM5 A;  3WE3 A;  3RSN A;  3LSP A;  2BY1 A;  1ETV A;  1R7J A;  3F21 A;  5CVI A;  2ISY A;  3CD6 I;  2MH9 A;  2BOL A;  3JRI A;  1Y8Q B;  4BUP A;  2M3A A;  4IHX A;  1Z91 A;  1ZR4 A;  3H36 A;  5EZG A;  4XNF A;  4RLF A;  1I3Q J;  4GXO A;  2VPR A;  2DA6 A;  1GXP A;  3MKL A;  4JX4 A;  4ZYA A;  3M07 A;  1ULY A;  5K7Z A;  4M3G A;  4AD9 A;  1N77 A;  1PUF B;  4KMU X;  4LLN A;  3CJR B;  3ABK H;  3BJA A;  4V2F A;  5JHU A;  4FCY A;  4NUB A;  1GDT A;  2JT1 A;  1FMV A;  2XAF A;  3PQK A;  4HQE A;  4MQV A;  4GRI A;  4CXF A;  2ZSI B;  2UV1 A;  4DYR A;  5LBQ A;  3C18 A;  3H0G J;  1F5T A;  1FSE A;  2CQN A;  5EG0 A;  3F8F A;  2DK8 A;  1FSH A;  1F4K A;  1T95 A;  3K4B A;  4NC8 A;  2EFW A;  1WI9 A;  1WI3 A;  2GZW A;  2VKE A;  1EH6 A;  3VYR B;  1PUE E;  3L9F A;  4G6T B;  2EH3 A;  5KAF C;  2UXN A;  4N4O B;  1FTT A;  4XN3 A;  1R4M B;  2EZK A;  4HX8 A;  3IAS 2;  3GZN B;  1P7I A;  1W7P A;  1X1D A;  3DBH B;  1FPQ A;  2OPT A;  2XGC A;  3L2R A;  1HKS A;  1I1S A;  5J6X A;  2COB A;  4BKX A;  4GDF A;  4LB6 B;  1Y56 A;  2TRT A;  3QU3 A;  4I99 C;  5DYM A;  1HST A;  1K78 A;  4FT8 A;  1UMQ A;  4V19 K;  3CCE I;  2E1M C;  3WGG A;  3G71 I;  1JKO C;  2VUM J;  2K02 A;  2P81 A;  2QQA A;  1YJ9 I;  2E7W A;  2YR2 A;  3QPT A;  3I58 A;  4CGZ A;  2DPD A;  4AM3 A;  1AKH A;  5J1U A;  5BOX A;  1JUP A;  4YEL A;  1YW8 A;  2H1L A;  4XID A;  1VI0 A;  2KKO A;  1LFB A;  3OS2 A;  1E2X A;  1IXR C;  4A69 C;  2K5C A;  5LGT A;  4HV6 A;  2P8T A;  1HXD A;  3KP2 A;  2CU7 A;  4ESJ A;  1DP3 A;  2DAO A;  5KK1 A;  1K6Y A;  5JFR A;  3HJE A;  2V7F A;  3IC7 A;  1TLH B;  4LGW A;  2XRN A;  4L9T A;  2E1O A;  2VKH A;  4ZC3 A;  2ZXI A;  1KGS A;  1OPC A;  5E1Z B;  4A3G J;  2X6X A;  3SFZ A;  2V1U A;  3J80 Z;  3GUD A;  3HSF A;  3K70 D;  2NVU B;  2EQR A;  2KFD A;  4I0A A;  1ZK8 A;  2MFZ A;  2O0Y A;  3I71 A;  3IP4 B;  2DPU A;  2HFH A;  2X1D A;  4Q47 A;  4E7J A;  3PO2 J;  2OQG A;  2QLZ A;  2JTV A;  4LK0 F;  3CLQ A;  1R1T A;  2DU9 A;  1KON A;  1ZQ3 P;  1D0Z A;  1I5Z A;  1MBH A;  1RR8 C;  1ZAR A;  2PFB A;  2MAB A;  3CCL I;  1YS7 A;  3EUA A;  2FEZ A;  1WCM J;  3HYI A;  2OJE D;  4RBO A;  1K83 J;  3WU1 B;  4UB6 C;  4BDY A;  2CQX A;  1J75 A;  3RKW A;  1XGM A;  1HKT A;  2LKX A;  1S8N A;  1CF7 B;  3WTU C;  1DUX C;  4UUT A;  4BHB A;  3FK7 A;  2YS9 A;  2EV6 A;  1HSJ A;  2E1M B;  3FK6 A;  5E3L A;  3TQN A;  2DA5 A;  3M3Y J;  5C4X J;  4L9V A;  5BPD A;  2BY3 A;  3FBN B;  1YRN B;  2RAE A;  2CG4 A;  3F22 A;  5FKL A;  4AVZ A;  3GBG A;  4A93 J;  5ILS A;  1LNW A;  2ID6 A;  2DMN A;  4B48 A;  4XLP F;  2E7X A;  5L3E A;  4XSZ F;  1X58 A;  3R6S A;  4XBF A;  3RYR A;  4RM3 A;  2D2W A;  1YJN I;  1PDN C;  1W7P D;  3S3O A;  1W7P B;  3FHN A;  2QGU A;  5J3L A;  1X19 A;  4P55 A;  2YUS A;  3KYD B;  3S2D J;  4QLC U;  2H6B A;  5HS8 A;  2IVM A;  4M9Z A;  2L2O A;  2K27 A;  1VQN I;  3U2R A;  3HUG A;  1ZRC A;  2ZKZ A;  1PP7 U;  3PQJ A;  3KEO A;  3KP3 A;  3TBI A;  2ELH A;  3CZ6 A;  2HXO A;  2L54 A;  5FJ8 J;  2HPM A;  3GLX A;  3DV8 A;  4XRM A;  1ODD A;  1QZY A;  2Z5U A;  3OYA A;  1BN5 A;  1WH7 A;  4XOR A;  3MKY B;  5BQT A;  2AHQ A;  4DYC A;  2ME0 A;  2QQ9 A;  3PL8 A;  3ESW B;  5J47 A;  3F8C A;  3I0T A;  4BBS J;  5AIP A;  4EJW A;  2HWV A;  3CF2 A;  3HKZ N;  2IT0 A;  1XTA A;  5J1R A;  1DGW Y;  3HRT A;  1S5L C;  2QZ8 A;  1BI0 A;  4BXX J;  5CQG A;  3WG7 H;  3V8K A;  1MMA A;  1A36 A;  4HX7 A;  3EPZ A;  4O3M A;  1WGX A;  3K9T A;  2M7B A;  3ZQF A;  2AQE A;  1Y0N A;  1WVR A;  3K1N A;  5DDG A;  1XSV A;  4RGX A;  5BNG A;  1S7E A;  2WTE A;  3Q3S A;  5E3N A;  1Y1V J;  1D8J A;  3P9C A;  3UKG A;  3RKY A;  2FA5 A;  4MFD A;  4BBR J;  3WTX C;  3BRO A;  5FO5 A;  5CVR A;  4C30 A;  1YHQ I;  4NBQ A;  1K4S A;  5EJC A;  4DZP A;  2HOE A;  3L2C A;  5J8C A;  4C3J J;  2OBP A;  3A0B C;  3R4K A;  3OMY A;  2MD5 A;  4J01 A;  3S2W A;  1JTY A;  4II2 A;  4E4H A;  3VWB A;  1YRN A;  1EH7 A;  1XCB A;  2DT7 B;  4ZDO A;  2K85 A;  1IRZ A;  2UXX A;  1Y0U A;  2DOD A;  2CQK A;  2VBZ A;  2L9N A;  2XF6 A;  4HNU A;  3FXJ A;  4G7O F;  3MMY B;  4R8H A;  1OCP A;  3UNG C;  4L0Y B;  2XPW A;  1H89 C;  5TGT A;  4GFB A;  5IP9 J;  2V4J C;  2IA2 A;  4F7Z A;  5KCM A;  3CJT B;  2Y2Z A;  1EA3 A;  4K2E A;  2R0Q C;  2J5O A;  4IF4 A;  1WZ2 A;  3HOX J;  2JWT A;  4RGU A;  1VQP I;  4IX7 A;  4DJA A;  2WV0 A;  1OIS A;  3HHG A;  2R7T A;  1H9T A;  2F5E A;  3E0J B;  1JT6 A;  1R49 A;  2ZXH A;  4BQQ A;  3L2U A;  3S3M A;  1AHD P;  3OL3 A;  1WJB A;  2K9L A;  2M9H A;  3T5X A;  1VQK I;  1BBY A;  2HQR A;  3OIQ A;  2VC1 A;  3E6M A;  3GFL A;  2MD0 A;  1SC7 A;  1G3W A;  1A6Q A;  4M73 A;  3HOZ J;  2PMU A;  2LG4 A;  3QPH A;  2GXB A;  3D0S A;  1QVT A;  3ZMZ A;  4B44 A;  4E7I A;  4ASN A;  3U21 A;  1MSE C;  2WWY A;  1B9N A;  5CVU A;  4D7N A;  2Z99 A;  5CQE A;  2CQQ A;  2OZU A;  1SD7 A;  2CW0 F;  1FTZ A;  1SFU A;  3OS1 A;  4F3Q A;  2Q0O A;  3H9J A;  5GPA A;  3FBI B;  1WKM A;  3H5N A;  5ILV A;  1FC3 A;  2OA4 A;  5HNH A;  2IS1 A;  3JRE A;  1FOX A;  1MJ9 A;  3ZP5 A;  1KZH A;  2ICW G;  2DT6 A;  2VJJ A;  3QOP A;  3HHH A;  1FYL A;  4WK8 F;  2GXA A;  5CVJ A;  1QHG A;  2E5Z A;  3BJ6 A;  1NK3 P;  3NRV A;  5K5O A;  2OUM A;  4G7Z F;  2KZV A;  3F0C A;  3PSF A;  4DOZ A;  1IG7 A;  6PAX A;  4PJM A;  4ZTJ A;  3AL0 B;  1A5J A;  1QQI A;  2IW5 A;  3QWL A;  3ZRG A;  3COA C;  3BG3 A;  2HPI A;  4FIS A;  4KIC A;  2OTL I;  4ENK A;  1L3L A;  2PMZ N;  3CMY A;  4RGS A;  4LOC A;  4HV5 A;  2TDX A;  4EMS A;  1U3E M;  2VBY A;  2DCE A;  2MSY A;  4Q48 A;  5ICG A;  2A3S A;  2AO9 A;  3DCF A;  3B02 A;  3OYD A;  5D6F A;  3RQI A;  2FQ4 A;  4CCK A;  2P4W A;  1YG2 A;  2O5R A;  3RIR A;  2FE3 A;  3TO9 A;  1K7A A;  3GTM J;  1AOY A;  3S16 J;  1R1U A;  1LDD A;  4HQM A;  2BYV E;  4RMN A;  4EV0 A;  3KYL A;  1POG A;  3GFJ A;  4F52 A;  1MMN A;  4YII A;  1L0O C;  1XSD A;  1JJ6 C;  2ZXJ A;  3K4J A;  3WTZ A;  4WWC A;  5L3F A;  1FBS A;  4CIC A;  4B47 A;  1MBF A;  2R7W A;  1YFH A;  5A2Q K;  2HZD A;  2L7M P;  1XS9 A;  1XMA A;  4MEX F;  1XGO A;  1GLN A;  2X4H A;  5HNF A;  1XGS A;  5F08 A;  1RPW A;  3K4L A;  2MW8 A;  4D5F A;  1XCV A;  5GAG J;  4A12 A;  2HOT A;  2LKP A;  2IPQ X;  5LHH A;  3J7A O;  2F4I A;  4PJ0 C;  1BC8 C;  1HDP A;  4XM3 A;  2LKS A;  4DNC A;  3Q5F A;  4M3E A;  4CA0 A;  2NXN B;  2G7U A;  2VAS A;  5E3O A;  1IAW A;  3RCO A;  4HYE A;  3ZGK A;  3GW2 A;  1MH4 A;  5FGM A;  1K79 A;  3T8R A;  3CC7 I;  3RQ4 A;  3K4M A;  4ZYE A;  2P5L C;  5KVR A;  3EYY A;  1IXS B;  4YIF A;  2ESN A;  4JK1 X;  2BW3 A;  2OC6 A;  4HRI A;  2CMP A;  4BYY A;  2CYY A;  4M6Y A;  2ELJ A;  1SFK A;  1GVD A;  2ZFW A;  2FSW A;  1U5T B;  2A6E F;  5ICF A;  4CCN A;  2CUE A;  1M1E B;  4PFO A;  2JA6 J;  2V9P A;  4XLH A;  3E1S A;  4CSW A;  5LGN A;  3AL0 C;  2QBY B;  1GHC A;  1USS A;  2DXI A;  2XGE A;  2OCE A;  4S0H B;  2IEK A;  3R61 A;  4A3J J;  3S15 J;  2Y31 A;  5DD8 A;  1TZL A;  4DQ2 A;  3DLL F;  2CFX A;  3DQV C;  4BAC A;  2VJ4 A;  1ZEL A;  2FXA A;  5FRO A;  3A02 A;  1O3R A;  2JZY A;  3LNQ A;  4IHY A;  1HBX G;  5IT3 A;  3DTI A;  3K1P A;  1AWC A;  1U8B A;  3E6D A;  5DS9 A;  4I02 A;  5D6E A;  2RQQ A;  1QU3 A;  3D5S C;  2IRF G;  2DYS H;  3QYF A;  3TKY A;  4QTR A;  1ETK A;  1KA8 A;  2L9V A;  1DU0 A;  3J7Z I;  4EQQ A;  5EDN A;  1MKM A;  2WAD A;  5HDG A;  2DFH A;  1QNT A;  4H0E A;  2HVR A;  1AA7 A;  1XSX A;  3GX4 X;  4XKV A;  1HCR A;  3LSG A;  5HVQ C;  1KQ8 A;  4CCL A;  2MBF A;  5M3M J;  3DPU A;  2W85 A;  3KP4 A;  2OU2 A;  3QU6 A;  4PFP A;  3GCM A;  1JHF A;  1F9N A;  2L9S A;  1IN5 A;  3ZXS A;  4CCO A;  3K2Z A;  1WJE A;  2LY9 A;  4G7H F;  4WF2 A;  5M5W J;  1BW5 A;  1B72 A;  2Z9O A;  4L18 B;  2QVO A;  2HU9 A;  2D5V A;  1ZHF A;  4UUV A;  2Y9Z A;  2FRH A;  1IRF A;  2ETH A;  1AU7 A;  1CF7 A;  2HZT A;  2JRT A;  3HEF A;  1TWH J;  1YX5 A;  5FLM J;  1YO5 C;  1D8K A;  2KIM A;  3QPL A;  1QPI A;  1MJA A;  1A35 A;  3E3V A;  1YQA A;  1RUN A;  3ZMV A;  5FB2 A;  4R79 A;  1SAU A;  3K4C A;  5CYV A;  3FM3 A;  1SMT A;  1FOW A;  2IS6 A;  1V5G A;  1YIO A;  3ML6 A;  3KYC B;  1UST A;  4OAY A;  4RAG A;  2EZH A;  5E8I A;  1SFE A;  2OF7 A;  4N4N B;  4ESB A;  1QO0 D;  3JRC A;  4A3F J;  4UVC A;  2RV8 A;  3IH2 A;  4J19 A;  2DA4 A;  4PSW A;  2VBW A;  3VB2 A;  2DQR A;  4IQJ A;  1WRJ A;  2NVQ J;  2HR3 A;  1A04 A;  2HVQ A;  2V79 A;  2F5C A;  3EUH C;  4ON0 A;  1TT0 A;  2LH9 A;  1FJL A;  2NOG A;  3F6O A;  3Q9S A;  2F48 A;  1Z7L A;  3R0J A;  1WH5 A;  2PI0 A;  4XLF A;  1HLV A;  1B1B A;  1KU9 A;  2DTR A;  2V6C A;  3BZK A;  4MIM A;  2ZO4 A;  3CC2 I;  3ZQQ A;  3RPU A;  1HKQ A;  4UUS B;  3CDL A;  5DV5 A;  4ENM A;  3MAJ A;  3RPQ A;  3HB9 A;  4Y3O A;  3ZMS A;  3HSR A;  5J1Y A;  5TRD A;  3HG9 A;  3WU2 C;  4P1W A;  2EBI A;  3CP8 A;  4EGZ A;  4F92 B;  3BR1 A;  1PJR A;  1ZYR F;  1Z67 A;  3AG4 H;  2ZJP F;  5E1W A;  5F0F A;  2XAS A;  5BS6 A;  3F6V A;  1NG6 A;  1TQM A;  1ETX A;  1WHU A;  4J00 A;  2Y69 H;  3VFZ A;  1NH3 A;  1IV8 A;  2BXY A;  2MG4 A; 
#chains in the Genus database with same CATH homology
 2X0L A;  3BDD A;  3L7W A;  4AIK A;  4OIO F;  4OOI A;  1XB4 A;  4KN7 X;  3EUH A;  1TQI A;  4Z2Y A;  3BOQ A;  1BM9 A;  3WGH A;  1UHW A;  3F23 A;  3DEU A;  2EFN A;  2ESH A;  3T0Y A;  3FMQ A;  2W25 A;  4MTD A;  2EA4 A;  3M7G A;  3AAF A;  2FBH A;  4CZZ A;  1XN7 A;  3GXO A;  3MZH A;  2NNN A;  5ICC A;  2OQR A;  2XV4 S;  2E1N A;  1DPR A;  4U0Y A;  2BEO A;  3GF2 A;  2EV0 A;  3K1M A;  3F8M A;  3QP5 A;  4A6E A;  2RNJ A;  4JQF A;  2QQB A;  4KFC A;  4BQA A;  2PN6 A;  5D8L B;  3MFK A;  3H3Z A;  4ZYG A;  3WTT C;  5H20 A;  4UXN A;  2QUF A;  1LQ1 A;  4O5V A;  3SZP A;  5EEH A;  5DUI A;  1FYM A;  2PEX A;  1K6O A;  1IN8 A;  4LD5 A;  2J5P A;  1Z05 A;  5LRS A;  2R3S A;  2JPC A;  5E20 A;  2Q2E A;  1R1V A;  4KA4 A;  4IJA A;  3FXQ A;  3ROU A;  1P6R A;  5ICE A;  1RIO H;  4Y15 A;  4P96 A;  4M72 A;  2F5F A;  3C3W A;  4U0W A;  5HLI A;  3I64 A;  3BP8 A;  2P7V B;  4G6Q A;  4RAZ A;  1SMY F;  4TV7 A;  4UV8 A;  1H0M A;  5HLH A;  1LVA A;  3E6B A;  2ACJ A;  1FT9 A;  3WTV C;  3KZZ A;  1ZH5 A;  5BMZ A;  3CJN A;  1SAX A;  3FHZ A;  1Q1H A;  3I4P A;  1IN6 A;  3EYI A;  3DF8 A;  4EJT A;  3J81 K;  3ABU A;  3U1D A;  2M45 A;  5LEJ A;  4S04 A;  1K78 B;  2GWR A;  4R1H A;  2DO7 A;  4ZZL A;  1Z7U A;  4B09 A;  3R60 A;  2VT2 A;  5FFX A;  1SD5 A;  4A5M A;  3HOS A;  3I59 A;  2RQP A;  3BZ6 A;  3MCZ A;  3C1D A;  2Z3Y A;  3SXY A;  1BI1 A;  2F5D A;  2K4J A;  2RKH A;  1KU3 A;  1LJ9 A;  1U8R A;  2YX7 A;  3QAH A;  4FHT A;  1YLF A;  3O6B B;  2Y48 A;  2HGC A;  1J0R A;  3V7R A;  3K69 A;  3ULQ B;  2MLK A;  3DFG A;  1REP C;  2YPR A;  2KRF A;  5ED4 A;  4LG0 A;  3IKV A;  2XGX A;  1TNT A;  5FD5 A;  3ISP A;  3GVA A;  3EQL F;  4RB2 C;  4ETS A;  4G8X A;  5CVV A;  4NHJ A;  1LDK B;  2VT3 A;  3CUO A;  1C0W A;  4KNY A;  1R36 A;  1BIA A;  4WCG A;  2DW4 A;  2YU3 A;  4Q4Z F;  4ESF A;  4OIN F;  1B6A A;  2EJR A;  3E5U A;  3GFI A;  2UZK A;  5F1R A;  4WXD A;  4NQW A;  2VN2 A;  2OZ6 A;  3MEX A;  4HW0 A;  1XD7 A;  2H27 A;  1Z1D A;  3FX3 A;  1HW5 A;  2WC2 A;  5DCM B;  3W6J B;  2G7H A;  3JAM Z;  4XLN F;  1MGT A;  3V8J A;  1KYW A;  4PGH A;  2L3D A;  1Z9C A;  5JR3 A;  2A68 F;  3RJP A;  2LNB A;  2VE9 A;  5J8F A;  4CHU A;  5F64 A;  3RKX A;  4OMZ A;  4XSX F;  3U9G A;  4M6X A;  3JSP A;  1I6X A;  3M8E A;  4EM2 A;  3L09 A;  1RZ4 A;  4BAY A;  4CDG A;  1T2K A;  1KQ0 A;  2D45 A;  1O7L A;  1X3U A;  3WTW C;  2GXG A;  1FWZ A;  4L0Z B;  4ENN A;  4CYD A;  1H9G A;  2PQ8 A;  3RI4 A;  2STT A;  4IHT A;  5E17 F;  1W4M A;  4M9X A;  2DI3 A;  1DDN A;  2JSC A;  2NNY A;  3SZT A;  4LG0 B;  4EJV A;  2XKO A;  2A61 A;  4U7B A;  3P7N A;  2G9W A;  3ECH A;  2D1V A;  1YS6 A;  1P4X A;  1B59 A;  3T8T A;  4XRF A;  3V7S A;  5E1X A;  3HRS A;  2VC0 A;  4Q5S F;  4KIG A;  3F8N A;  1U2W A;  3WTS C;  1I1G A;  5HS7 A;  3KE2 A;  3LQR A;  3KCC A;  4UHT A;  3IHU A;  1D5V A;  3MWM A;  2FOK A;  3Q9V A;  2RN7 A;  3FMR A;  3I59 B;  4IRG A;  1T98 A;  2BGC A;  4M74 A;  1FOK A;  1FP2 A;  3CTA A;  4IRH A;  1OYI A;  2BE5 F;  2COM A;  4G94 A;  5A2Q Z;  5LRR A;  4M9S A;  4U0V A;  4MNU A;  4EJU A;  2Q8K A;  2PMH A;  4ZZD A;  3E97 A;  5DD4 A;  2RVC A;  1S29 A;  2ZME A;  1IN4 A;  3R0A A;  4ZYD A;  4Y17 A;  1JE8 A;  4N9H A;  1OYY A;  3WE2 A;  3KZY A;  1U78 A;  2GAU A;  2HKX A;  4LK1 F;  1T39 A;  2W24 A;  3ZPL A;  4G6D A;  1BC7 C;  2E1C A;  1PP8 F;  4OU0 A;  5LLQ A;  1S7O A;  4ENJ A;  2XRO A;  5D5U B;  1IRG A;  2EA2 A;  1IW7 F;  5TJJ A;  4WX9 A;  2K7L A;  2LF7 A;  5HDK A;  1TW3 A;  3H3U A;  1P4W A;  4KMF A;  2STW A;  1BI3 A;  3WGI A;  3ELK A;  1ZG5 A;  3KLO A;  1ZAO A;  2GA2 A;  4L5J A;  1EH8 A;  3ECO A;  2V1X A;  3TOB A;  3I53 A;  3M8F A;  2EK5 A;  5E18 F;  3ABT A;  2M1B A;  4BH9 A;  1O7F A;  3TDZ C;  3O2P E;  2D1H A;  2FNP A;  3KP5 A;  1YW7 A;  4Y13 A;  4N0B A;  4AIJ A;  3DKW A;  2EB7 A;  2MH2 A;  4A5N A;  5L3B A;  3H92 A;  2P7C B;  2VON A;  1OR7 A;  2R7D A;  1JGS A;  2XAQ A;  1QBJ A;  4FX0 A;  2EFQ A;  4KN4 X;  3NEU A;  5LHI A;  5CJ9 A;  3LAJ A;  3JAM K;  3QRF F;  3M9A A;  5HLG A;  4YFK F;  3KP7 A;  4OIP F;  3V7C A;  3HSE A;  2F2E A;  4HLX A;  3F72 A;  2PLY A;  2HDC A;  3LWF A;  1DPU A;  4HOB A;  3GEZ A;  2AS5 F;  3OV8 A;  4KIB A;  4I09 A;  2O03 A;  4PCQ A;  1T38 A;  2NAZ A;  4CO8 A;  1U5T C;  5ILU A;  4EGY A;  2PJP A;  2L01 A;  2FNA A;  2H09 A;  1TW2 A;  3GFM A;  3SHF A;  4GCV A;  5ERI A;  2KIU A;  5DUK A;  4KT5 C;  4OIQ F;  3N4M A;  3DXJ F;  3GWZ A;  1ZN2 A;  4WXH A;  5FD6 A;  2CSO A;  2RC4 A;  3LA7 A;  3RTR A;  2LF8 A;  2L4A A;  1R22 A;  2V1D A;  5LGU A;  1CGP A;  2HTS A;  4O6J A;  2A69 F;  4N9I A;  2A6H F;  2HEO A;  1T0F A;  4MQ9 F;  1STZ A;  1R5H A;  4I0B A;  2IP2 A;  2Y0M A;  1JHH A;  5FFZ A;  4I7H A;  2BV6 A;  1MZB A;  3WG9 A;  2M5W A;  2MA3 A;  3WOD F;  2DFI A;  2EFP A;  2CO5 A;  1S6L A;  2KIF A;  3GO5 A;  4BHP A;  5IT9 K;  4OIR F;  4IRI A;  2VOD A;  1ZRF A;  1KQ9 A;  4AIH A;  4IXA A;  4EVI A;  2QBY A;  4HF2 A;  1GVJ A;  5JVT A;  1ZLJ A;  3LA3 A;  4BHC A;  2IA0 A;  1BI2 A;  2XHK A;  4LLL A;  4PZJ A;  1QGP A;  1ZGA A;  2O3F A;  5IT9 Z;  3D5L A;  3OOP A;  1UFM A;  2VOO A;  1ZRE A;  3M1E A;  3I5U A;  1KYZ A;  3FF5 A;  1FNN A;  3F8B A;  5DCF A;  1RI7 A;  2VXZ A;  4UVA A;  1BIB A;  1G6N A;  2HS5 A;  1O3T A;  1QZZ A;  4KDP A;  4E70 A;  1IUY A;  2YSR A;  3FXU A;  1QPM A;  2HYF A;  5K1Y A;  2VE8 A;  5HDN A;  2XIG A;  3KEQ A;  1YTY A;  2W57 A;  2VOP A;  4LLG F;  5DEQ A;  4IPA A;  3ZN0 A;  1P92 A;  2KJB A;  2XUB A;  2HQN A;  1TTY A;  4RB0 A;  1NHA A;  2QEN A;  4L9J A;  2FBK A;  1KU2 A;  2QM3 A;  3RDI A;  5D8K B;  2HYG D;  3GYH X;  3TO7 A;  5JI6 A;  4KYW A;  1SD6 A;  5DCM A;  3J81 Z;  3HRU A;  4MTE A;  1J2X A;  3JTG A;  2AXL A;  3WTY C;  1FZP B;  1B9M A;  1ON1 A;  5D4R A;  4HLY A;  5AON A;  2FMY A;  5K5Q A;  4GO1 A;  2XAH A;  4I98 B;  1BOA A;  2MC3 A;  4UVB A;  3FZV A;  3BY6 A;  1TNS A;  3ZN1 A;  3BPV A;  4IVN A;  3JSO A;  3KFW X;  1WSU A;  2XKP A;  4AWX B;  5LHG A;  4GYI A;  2PBI A;  5FLX Z;  2B0L A;  3WU0 A;  3FXR A;  1MD0 A;  3B73 A;  4HDU A;  1XMK A;  4HA8 A;  1J9I A;  5EEG A;  1OYW A;  2ZME B;  1R00 A;  5HS9 A;  3HTS B;  4HBL A;  1LEA A;  2IA1 A;  2P6T A;  2FF4 A;  2EWN A;  5FLX K;  1O3Q A;  3HTU A;  1FP1 D;  4ZH4 F;  4WXC A;  3CO6 C;  1SFX A;  4S05 A;  3QP6 A;  2K4B A;  4LFU A;  3JTH A;  4ZYH A;  3CUQ C;  1WWX A;  5K5R A;  3KP6 A;  2FU4 A;  4QWQ A;  1J5Y A;  3KLN A;  3HRM A;  2ZJ2 A;  4B8X A;  3KET A;  3LQQ A;  3ZMD A;  3IWF A;  1KU7 A;  1G3S A;  2HKO A;  2O61 A;  3L00 A;  2MLG A;  4RB1 A;  1F1Z A;  1FLI A;  3NQO A;  3TOA A;  4M71 A;  3TO6 A;  2P5V A;  3ERE D;  1W5T A;  4RAY A;  3DPL C;  2H94 A;  2K86 A;  2M30 A;  1FBU A;  5D5X B;  3E6C C;  4HDV A;  3G3Z A;  1J7K A;  4D0P A;  5D5W B;  5D4S A;  4PGG A;  1UHM A;  1MDM B;  1R5G A;  1LB2 A;  5H6R A;  4U88 A;  3EET A;  3I54 A;  3LST A;  3CDH A;  2L4M A;  4G9Y A;  4MEY F;  2L02 A;  3V4G A;  2NS0 A;  4LB5 A;  5E8G A;  5L3C A;  2DT5 A;  4KUM A;  4EJO A;  3ZMU A;  1ZGJ A;  2ZNY A;  4LMY A;  2QYO A;  1XDS A;  5L3G A;  4L9N A;  1EV7 A;  3RYP A;  1DP7 P;  1XDU A;  1O3S A;  4BNC A;  4UNO A;  2ADU A;  2FQ3 A;  2XAJ A;  1IF1 A;  2EFO A;  1P2F A;  2XVC A;  2YX4 A;  4GGG A;  1ON2 A;  3LA2 A;  1B4A A;  3O3K A;  1G3Y A;  2ZBK A;  1ZG1 A;  1HW2 A;  4HF1 A;  2ZCW A;  1OKR A;  3G73 A;  5AIQ A;  3IWZ A;  3CO7 C;  2DLL A;  5D5V B;  1MDM A;  3E5Q A;  3W6K B;  1JXS A;  2KJC A;  3TGN A;  3N97 A;  2UWM A;  4PDK A;  2FBI A;  3JW4 A;  4HX4 A;  1TBX A;  5L3D A;  2OAZ A;  3J80 K;  1I27 A;  2P5K A;  3MZY A;  4NB5 A;  5CLS A;  4KIF A;  3P9I A;  1E17 A;  1LDJ A;  1G4D A;  5F6F A;  1U5T A;  2RGV A;  4RB3 C;  2EV5 A;  1VTN C;  1R58 A;  1RNL A;  1FX7 A;  1RUO A;  3IRR A;  2FML A;  2M87 A;  2A07 F;  1S3J A;  3PFI A;  3IKT A;  1LEB A;  4I01 A;  4A2U A;  2NYX A;  3HIF A;  2O8X A;  1FBQ A;  4OMY A;  3ZMT A;  2GQQ A;  4I2O A;  3TDU C;  1O57 A;  1G3T A;  1YYV A;  3F3X A;  3GZ5 A;  3LFK A;  3BJO A;  1ZG3 A;  4A0Z A;  2DQL A;  3MQ0 A;  3CLO A;  4YFX F;  1BJA A;  1UCR A;  3FWE A;  3ZQ7 A;  1HQC A;  5H6Q A;  1UB9 A;  1R23 A;  1T6S A;  4MHG A;  3VOD A;  1D3Y A;  2Y75 A;  4L5I A;  1SD4 A;  1V4R A;  3E5X A;  5LEK A;  2DBB A;  4UV9 A;  3LAP A;  2M8E A;  3SQN A;  1J59 A;  5BPI A;  2CGP A;  2R7F A;  2NRA C;  2DK5 A;  1IXC A;  2Z33 A;  1U6G A;  3FMS A;  3P9K A;  4RS8 A;  2W84 A;  2IJL A;  3EDP A;  2RDP A;  3T1B A;  1XGN A;  2VBX A;  3V8L A;  1Z6R A;  1FYK A;  2XAG A;  2PG4 A;  2A5Y B;  1YW9 A;  4A6D A;  2LSO A;  4JBA A;  2P6S A;  3REO A;  1ZRD A;  4RGR A;  4MGR A;  4EM0 B;  3BPX A;  3CUQ B;  4YFN F;  1OMI A;  3C7J A;  4HF0 A;  4P5O A;  4IHS A;  2H6C A;  2ISZ A;  4P9F A;  1IZ1 A;  1MJB A;  3CUQ A;  2GA1 A;  3IL2 A;  3BWG A;  2ZNZ A;  1Z6T A;  3DPT A;  3VOE A;  3DP7 A;  4LJZ F;  4AVP A;  1V3F A;  1WQ2 A;  4HZF A;  3VEP A;  2O6G E;  3GZ6 A;  4A0X A;  3IRQ A;  1ONV A;  2GIV A;  4GYG A;  3K0L A;  4A0Y A;  2JPB A;  3HOT A;  2CWE A;  4BXU A;  1TQP A;  2BBY A;  2HTJ A;  1HW1 A;  1IN7 A;  4YG2 F;  1GXQ A;  2QWW A;  4EM1 A;  5HOO A;  1S7A A;  4P9U A;  1ZLK A;  1FY7 A;  4U7D A;  1W5S A;  4HAM A;  2LDU A;  2V9V A;  4FX4 A;  1P4A A;  2OD5 A;  3FM5 A;  3WE3 A;  1R7J A;  3F21 A;  5CVI A;  2ISY A;  2MH9 A;  1Z91 A;  4GXO A;  1GXP A;  1ULY A;  4AD9 A;  4KMU X;  4LLN A;  3BJA A;  5JHU A;  2JT1 A;  2XAF A;  3PQK A;  4HQE A;  4MQV A;  4CXF A;  5LBQ A;  3C18 A;  1F5T A;  1FSE A;  3F8F A;  2DK8 A;  1FSH A;  1F4K A;  2EFW A;  1WI9 A;  1PUE E;  2GZW A;  1EH6 A;  3L9F A;  2UXN A;  4HX8 A;  2C6Y A;  1W7P A;  1FPQ A;  1I1S A;  1HKS A;  5J6X A;  4LB6 B;  3QU3 A;  5DYM A;  1HST A;  1K78 A;  4FT8 A;  3WGG A;  2K02 A;  2QQA A;  2E7W A;  2YR2 A;  3QPT A;  3I58 A;  4CGZ A;  2DPD A;  5BOX A;  1YW8 A;  2KKO A;  1E2X A;  1IXR C;  5LGT A;  4HV6 A;  2P8T A;  1HXD A;  3KP2 A;  4ESJ A;  2DAO A;  5KK1 A;  5JFR A;  3IC7 A;  1TLH B;  4LGW A;  2XRN A;  4L9T A;  1KGS A;  1OPC A;  5E1Z B;  3SFZ A;  2V1U A;  3J80 Z;  3GUD A;  3HSF A;  4I0A A;  2O0Y A;  3I71 A;  2DPU A;  2HFH A;  4Q47 A;  2OQG A;  2QLZ A;  2JTV A;  4LK0 F;  1R1T A;  2DU9 A;  1I5Z A;  1ZAR A;  2PFB A;  1YS7 A;  2FEZ A;  3HYI A;  3WU1 B;  1J75 A;  3RKW A;  1XGM A;  1HKT A;  1S8N A;  1CF7 B;  3WTU C;  1DUX C;  4BHB A;  2EV6 A;  1HSJ A;  3TQN A;  4L9V A;  5BPD A;  2CG4 A;  3F22 A;  5ILS A;  1LNW A;  4XLP F;  2E7X A;  5L3E A;  4XSZ F;  3R6S A;  4XBF A;  3RYR A;  2D2W A;  1PDN C;  1W7P D;  1W7P B;  4P55 A;  4QLC U;  2H6B A;  5HS8 A;  2IVM A;  4M9Z A;  2K27 A;  3U2R A;  3HUG A;  1ZRC A;  2ZKZ A;  1PP7 U;  3PQJ A;  3KEO A;  3KP3 A;  2ELH A;  2L54 A;  3GLX A;  3DV8 A;  1ODD A;  1QZY A;  2Z5U A;  1BN5 A;  5BQT A;  2QQ9 A;  3F8C A;  3I0T A;  5AIP A;  4EJW A;  2HWV A;  2IT0 A;  3HRT A;  2QZ8 A;  1BI0 A;  3V8K A;  4HX7 A;  4O3M A;  3K9T A;  3K1N A;  5DDG A;  1XSV A;  4RGX A;  2WTE A;  1D8J A;  3P9C A;  3RKY A;  2FA5 A;  3WTX C;  3BRO A;  5FO5 A;  5CVR A;  2HOE A;  3L2C A;  5J8C A;  2OBP A;  3R4K A;  2MD5 A;  3S2W A;  1EH7 A;  1XCB A;  2UXX A;  1Y0U A;  2CQK A;  2VBZ A;  4G7O F;  4R8H A;  4L0Y B;  2IA2 A;  4F7Z A;  4K2E A;  2J5O A;  4IF4 A;  4RGU A;  2WV0 A;  3HHG A;  1H9T A;  2F5E A;  3T5X A;  1BBY A;  2HQR A;  2VC1 A;  3E6M A;  3GFL A;  1G3W A;  4M73 A;  2PMU A;  3QPH A;  2GXB A;  3D0S A;  3ZMZ A;  4ASN A;  2WWY A;  1B9N A;  5CVU A;  2Z99 A;  2OZU A;  1SD7 A;  2CW0 F;  1SFU A;  2Q0O A;  1WKM A;  5ILV A;  1FC3 A;  2OA4 A;  1MJ9 A;  3ZP5 A;  3QOP A;  3HHH A;  1FYL A;  4WK8 F;  5CVJ A;  3BJ6 A;  3NRV A;  5K5O A;  4G7Z F;  6PAX A;  1QQI A;  2IW5 A;  3COA C;  4KIC A;  4ENK A;  1L3L A;  4RGS A;  4HV5 A;  2TDX A;  4EMS A;  1U3E M;  2VBY A;  4Q48 A;  5ICG A;  2A3S A;  3B02 A;  5D6F A;  2P4W A;  1YG2 A;  3RIR A;  2FE3 A;  3TO9 A;  1K7A A;  1AOY A;  1R1U A;  1LDD A;  4HQM A;  2BYV E;  4EV0 A;  3GFJ A;  4YII A;  1L0O C;  1XSD A;  2ZXJ A;  3WTZ A;  4WWC A;  5L3F A;  1FBS A;  4CIC A;  1YFH A;  5A2Q K;  1XMA A;  4MEX F;  1XGO A;  2X4H A;  1XGS A;  1XCV A;  4A12 A;  2LKP A;  2IPQ X;  5LHH A;  3J7A O;  1BC8 C;  4DNC A;  3Q5F A;  2G7U A;  1IAW A;  4HYE A;  3GW2 A;  5FGM A;  1K79 A;  3T8R A;  4ZYE A;  2P5L C;  5KVR A;  3EYY A;  1IXS B;  4YIF A;  2ESN A;  4JK1 X;  4BYY A;  2CYY A;  4M6Y A;  2ZFW A;  2FSW A;  1U5T B;  2A6E F;  5ICF A;  5LGN A;  2QBY B;  1GHC A;  1USS A;  3R61 A;  5DD8 A;  4DQ2 A;  2CFX A;  3DQV C;  2FXA A;  1O3R A;  2JZY A;  1HBX G;  5IT3 A;  3K1P A;  1AWC A;  3E6D A;  4I02 A;  5D6E A;  2IRF G;  3TKY A;  1KA8 A;  4EQQ A;  1MKM A;  5HDG A;  1QNT A;  4H0E A;  3GX4 X;  1XSX A;  5HVQ C;  1KQ8 A;  2MBF A;  3KP4 A;  2W85 A;  2OU2 A;  3QU6 A;  1JHF A;  1F9N A;  1IN5 A;  3K2Z A;  4G7H F;  4WF2 A;  2Z9O A;  4L18 B;  2QVO A;  1ZHF A;  4UUV A;  2FRH A;  1IRF A;  2ETH A;  1CF7 A;  2HZT A;  2JRT A;  1YO5 C;  1D8K A;  2KIM A;  1MJA A;  3E3V A;  1YQA A;  1RUN A;  3ZMV A;  5FB2 A;  4R79 A;  5CYV A;  3FM3 A;  1SMT A;  1YIO A;  3ML6 A;  1UST A;  5E8I A;  1SFE A;  4ESB A;  1QO0 D;  4UVC A;  2RV8 A;  2VBW A;  3VB2 A;  2DQR A;  1WRJ A;  2HR3 A;  1A04 A;  2V79 A;  2F5C A;  4ON0 A;  3F6O A;  3Q9S A;  3R0J A;  2PI0 A;  1B1B A;  1KU9 A;  2DTR A;  2V6C A;  2ZO4 A;  3RPU A;  1HKQ A;  5DV5 A;  4ENM A;  3MAJ A;  3RPQ A;  3ZMS A;  3HSR A;  5TRD A;  4EGZ A;  1ZYR F;  5E1W A;  2XAS A;  5BS6 A;  3F6V A;  1TQM A;  3VFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...