3OR1C

Crystal structure of dissimilatory sulfite reductase i (dsri)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
104
structure length
104
Chain Sequence
b'AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKNTGFALKEIYELFPSGPGKGACKMAGLPKPTGCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite reductase alpha
publication title Structure insights into the enzyme catalysis from comparison of three forms of dissimilatory sulfite reductase from Desulfovibrio gigas
rcsb
molecule tags Oxidoreductase
total genus 30
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3or1C02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 3or1C01
3OR2C 3OR1C 1JI8A 2XSJC 2A5WA 1YX3A 2V4JC 1SAUA
chains in the Genus database with same CATH superfamily
1G3YA 3AKZA 2L7MP 2O8KA 2CU7A 3WTVC 2X85A 2JWTA 4G6DA 4P96A 4ZTJA 4WF2A 3RYPA 2VT2A 3HKZN 1ZN2A 5KCMA 3I5UA 1ZELA 2O5RA 3OYDA 2M5WA 2VIXA 3PSFA 5FLMJ 3HOVJ 1O3TA 1MBKA 2PN6A 4BDZA 2BZTA 3KP2A 5ERIA 3ABLH 3NEUA 4UVCA 2DTZA 4OWRB 1XSDA 1FMWA 1OLTA 4FHTA 3UR3C 4S05A 1S7EA 5C4XJ 2CW0F 4RB2C 1WJDA 2DA3A 1N77A 1AWCA 5B5EC 4MEYF 2XSJC 5F0CA 3HSEA 1EF4A 2F6CA 1T6SA 4EV0A 2CV0A 1ZH5A 2W1OA 2V4JC 4HA8A 1HW2A 2DT5A 1E3HA 2IBDA 3GFJA 2E34A 4BACA 1FYMA 1LE8A 1ETKA 1FP2A 2MA3A 1E0EA 4M72A 2K3PA 5JVGF 2E35A 3GLLA 1AKHA 1F1ZA 4EJUA 1LNWA 2LNBA 2VJIA 3K10A 2OTJI 3NARA 1IAWA 1GV5A 3WU2C 2VBXA 1ETWA 3RDIA 3VOEA 4KIGA 4R8HA 5KNLA 3MN2A 4HF0A 3AL0B 2P6SA 2RDPA 2DBBA 4AVPA 2WTEA 4DYCA 2L9NA 3E97A 3H5RA 4ESJA 2V7FA 1K83J 3JRBA 5EG0B 2M7AA 1RR7A 3ECOA 3H9QA 2LY9A 4ZYAA 3DV8A 4RGRA 4LD5A 3MKYB 3R0AA 5K5QA 1SD5A 2MC3A 1S6LA 3WGGA 1K7AA 3SDGA 2HDWA 4X6AJ 2HNHA 1BR1A 3HB9A 2BE5F 5CVJA 5D6FA 2DODA 3VSLA 3I55I 3HL2A 2EA2A 5GAHJ 4XKWA 1NTCA 1MMAA 4BYYA 5FROA 3ERED 2MFZA 2Z2SB 2NVTJ 1D1BA 2RKHA 2DPDA 3NQOA 5DEQA 1I50J 2XVCA 4F55A 3OYAA 1VFCA 4HRIA 3LSTA 4I09A 4BY7J 3RJPA 4BJTA 3PM1A 5DD8A 1Y1WJ 1YTYA 2CGPA 4M74A 4RGSA 5FKMA 1QHHD 2YU3A 1JT6A 2X6WA 2QVOA 4R1HA 1VQNI 4JQFA 1TNTA 1ULYA 5GAEJ 4A3EJ 4NUBA 2K02A 4FISA 2ID3A 3S3NA 2VI6A 3PQJA 1KYWA 2DDAA 2IA2A 2NS0A 5AIPA 4NDLA 3Q0UA 1J7KA 3LQQA 2GOXB 3EUHC 5B3SH 3HRSA 2NNNA 4WCGA 1QNTA 1T8IA 2FJ1A 5FLVA 2A5YB 3C7JA 2FNPA 4D7NA 1HKQA 3QP5A 4IOCF 5BNGA 2ISZA 2K85A 5E1WA 3M1EA 3V8LA 4M9SA 1OCCH 1RI7A 5J1RA 3B02A 3BCBA 3L2VA 3PQKA 2EPFA 1SVLA 2GOMA 3D5SC 3C2BA 2O8XA 1LKXA 2HTSA 1YO5C 3X2QH 4BJ6C 5L3GA 3DKYA 3DLLF 4B3AA 5BPDA 1ZAOA 2L3DA 2EZKA 5F0HA 2L0KA 1HW5A 3G4SI 4A3CJ 2ZJPF 1J75A 1A6IA 2F5FA 4CH7A 1ONVA 3DTKA 5LGUA 1MW7A 2DFHA 5TGTA 2ZKZA 4PJLA 2HQAA 1VQ9I 1ZRCA 1G59A 3H92A 3K70D 2O3FA 2H6BA 1WCMJ 2ZJ2A 3DEWA 5BQTA 3L00A 2EV0A 2DA1A 2MC4A 4E7LA 2WB1N 2IAIA 4ZZLA 4F52A 4W97A 2R7ZJ 2EK5A 1G8XA 2LTPA 2IA1A 2IXSA 2HVRA 5JFRA 3GTJJ 4L5IA 3A01B 2XAHA 1OR7A 3HOYJ 2KT0A 1V5EA 2PMUA 3D5RC 2K5CA 4HQMA 2LY2A 4GFBA 1U9OA 3E5UA 1B72A 4M3DA 2Z99A 1HLVA 1MZBA 3VDXA 2IJLA 1QRYA 2BHZA 3H1CA 2EFOA 2P7VB 2WWYA 5L3DA 1A31A 3OIPA 3A4CA 1FOWA 2DA5A 2FE3A 2D45A 3WTYC 3U2RA 4UB6C 3WTSC 3TQNA 3HOZJ 1SEUA 2AS5F 1PP7U 1UMQA 3OSFA 2WV1A 5TJJA 3CCSI 1GXPA 1IXRC 4NC8A 3LNQA 3W2WA 5EZGA 1A5JA 1T98A 1LE8B 4E7HA 3ZQGA 1R1TA 3KP3A 4ANJA 4Y52J 2A69F 3JSPA 2V6EA 2QWWA 1TQMA 3FK7A 3KEOA 5HDNA 1AKHB 5K5OA 3HRUA 4GYIA 3OYKA 3PL8A 2X1EA 3QPHA 1SC7A 2XGDA 3ZN0A 2OV7A 2M4GA 1VQ5I 3OYGA 4G12A 3V4GA 4AM3A 3CO6C 3AG3H 1FEXA 3HM5A 2UWMA 2OU2A 4EMSA 2DJNA 2HZDA 1DP3A 2GAUA 2QEXI 2VE8A 1CF7A 2MD0A 1TP4A 4IO9F 4IPAA 3JTHA 3S3MA 1J9IA 1G3WA 2V9KA 4IOAF 1BR4A 2HEOA 1MMNA 1FSHA 2XF7A 4KYWA 1U5TA 2X6OA 3A03A 3HPHA 4XN0A 3JREA 1SD4A 3MMYB 4KJZA 4UVAA 3ZMUA 3HJEA 2P0WA 1LDDA 5E1ZB 3GTKJ 4CZZA 4BXFA 5ED4A 2H1LA 1G4DA 5KK1A 3MVPA 3NWTA 4EJOA 4PFPA 1MSEC 5HLTA 2HOEA 1EA3A 1N78A 4LK0F 1IN4A 1MBJA 2ZFWA 3SEZA 3KIOA 3CC2I 3OS0A 3JRDA 1IN8A 1XSVA 3CESA 3RSNA 4A5NA 2E5ZA 2CQXA 2LVSA 3BR1A 1UB9A 4HYEA 2GIVA 3G6EI 2B9SA 2E1MB 2DYRH 2KRFA 2K40A 3ZQIA 4E70A 2COMA 2EJRA 3MZYA 1UG2A 3BR3A 5D8KB 4DQ2A 1BOBA 1KU9A 4LITA 4B09A 2VQLA 1GXQA 3TP3A 1JXSA 2QENA 2ZXWH 2DQRA 3O2PE 5H20A 1FT9A 2R7QA 4WXCA 5JI6A 3BT9A 5GAGJ 2PQ8A 2LMDA 1XB4A 4OIRF 1GLNA 3LOCA 2HI3A 5DM6F 1D8JA 1IJWC 3VPRA 1WSUA 5IYBJ 1PUFB 5ILVA 4F92B 5D5VB 3EPZA 2E36A 2O6GE 3RZDJ 3M9AA 2RN7A 3K1MA 4HX4A 1YX3A 4NBQA 3M4OJ 2DFFA 4C30A 2Z1DA 1R5HA 3J7AO 4II3A 3BZCA 3LSRA 3OOPA 1IV8A 1W5SA 2VPLA 2FNAA 2A07F 2JA6J 2VJ5A 4HOBA 1DU0A 1T08B 2MW8A 4RAYA 3F8MA 1ZARA 4XSZF 3IKTA 3ROUA 4PDKA 3JAMK 2ECBA 1ETQA 3HOSA 1GHCA 2R7FA 4I01A 4M71A 1KGSA 1Q1HA 1HC8A 2FMLA 1G3TA 2LK2A 3A1YA 1DP7P 2LKPA 4RLFA 4MEXF 1TWCJ 2Z3YA 1GV2A 1TT5B 4BHCA 2VN2A 1A36A 4AIKA 5JHUA 3DQVC 1SFOJ 2A05A 3QQAA 2YU9J 5FLXZ 3J7YJ 1X2NA 1I27A 4DNCA 2DA6A 2QZ8A 4BGDA 4UV8A 1J0RA 3GTLJ 1JJ6C 2VXZA 3WTTC 1K4TA 3HXLA 2HFHA 3F8BA 1T33A 3W6VA 4P1WA 4Q47A 2X6YA 1FIPA 1T95A 2B0LA 3FXUA 1C0WA 3WE3A 3LMMA 1MGTA 1XN7A 4W1UA 4ZC3A 1I3QJ 5K5RA 4KISA 3RCOA 3EDPA 2NRAC 3OIOA 3ABKH 4QTRA 4BUPA 2XKOA 3LSGA 2D5VA 3KZZA 1B72B 2MLKA 2ESHA 3K4CA 4ESBA 3FF5A 3C3WA 2Z16A 1QGPA 1GUUA 2EA4A 2KMUA 3M7GA 4HX7A 3TDUC 5GPCA 4U0YA 3LAPA 3P5JA 5L3FA 4EGZA 4BS9A 2HQRA 2ZMEA 3S93A 1X2MA 3DBRB 1HDPA 2NOJB 3AG1H 2VOPA 3TKYA 3L2QA 3QWLA 1X3WB 1YLFA 2ME0A 2QM3A 4L5JA 3S1QJ 1XDUA 1V3FA 1FBQA 5KHDA 3F23A 5KAIC 1YJ9I 4A3BJ 3U21A 3TMOA 3K1PA 4BNCA 2DLLA 4YIFA 2RQQA 3MKZA 4L9VA 2XHKA 3E0JB 1T2KA 2W85A 4DGWB 1X1PA 4DYQA 4ZZDA 3KYDB 5B66C 2STWA 3CMYA 3OY9A 2DMPA 3H0DA 1AA7A 2XF5A 2EFPA 3LSHA 1MH3A 1IN5A 1TBXA 1JKRC 3B73A 3EUKL 4KN4X 5JLWA 4MQ9F 4HNVA 4C3IJ 3CUQA 5CVIA 1ZQ3P 3OYLA 4S04A 2M4KA 3AL0C 1UHMA 2LF8A 1S5LC 3F6OA 1YOVB 4MNUA 3RQ4A 3KFWX 4A12A 1CF7B 4PZJA 3RPUA 1J5YA 1PP8F 3CCQI 2HZTA 2LBFB 1KONA 4CDGA 4N4OB 4A3JJ 2XPWA 2DK5A 3S17J 4XOPA 1U5TB 1R7JA 3GFIA 2JA7J 1D0ZA 1ODDA 3HSRA 1JT0A 2IS6A 1Y6IA 9ANTA 3RIRA 5EJCA 5D4SA 3FXLA 2OTLI 3BLYA 4HV5A 4M3BA 5FKOA 2FSWA 2MH2A 5J1YA 1IW7F 1D8KA 3ESWB 1VQMI 4WX9A 3ZMSA 3TO7A 5E17F 3KLOA 4IRIA 4AUXA 3KEQA 4DZJA 1SAXA 1MBHA 2OD5A 3FIWA 1FOXA 3I53A 5M5YJ 3J7AY 2BGCA 3WTXC 3VB2A 4HZFA 1Y39A 4ZYDA 3S1RJ 1YX5A 2OBPA 4B43A 4DBRA 2VL8A 1MMGA 4DIQA 4EJTA 4XLCA 1H9TA 2GLOA 4FE7A 3BC8A 4IRHA 1IG7A 3FKIJ 1YG2A 2ZXIA 4XN3A 5HOOA 2L2OA 4XNFA 1A6QA 4N9IA 3VWBA 3S16J 2R93J 2IGKA 3GUDA 3HC7A 3LAJA 1P4AA 1R9TJ 4XLEA 2QSGX 1PDNC 1EH7A 1QZEA 3F3XA 4BQQA 4XRFA 3LSIA 3MQ0A 3ZMTA 5LEKA 1FYKA 1AOYA 2HYJA 3S8PA 1A35A 4EVIA 1K79A 5BMZA 1X1AA 1OYIA 1TWHJ 2J5PA 2Y48A 3H5AA 4U0WA 3JTGA 4N9HA 3VYRB 1P2FA 5K1YA 5KVRA 1WFXA 3ABTA 1ETOA 1LVKA 3KZYA 2DMUA 1GVDA 4LG0A 3CMAI 3DKWA 2LKSA 4Z6YA 1G6NA 3EYYA 2QSFX 3ZQHA 3OOUA 2LG4A 1Z05A 2QUFA 2JPCA 2YSRA 1IGNA 1VNDA 1XDSA 1W0UA 1O4XA 3W2VA 2QBYB 1MBGA 1ZYRF 2WY8Q 4EM1A 4H0EA 2AXLA 2IEKA 5J3LA 2E2IJ 4YG2F 3J81Z 1YJNI 1PUEE 3DPLC 3DP7A 1FTZA 3PIPF 5TRDA 1MD0A 1OCRH 2OPTA 2A61A 3FWEA 2HOTA 4E7JA 3F9KA 3J80K 3DU6A 5KAFC 4Y3OA 1IUFA 2V1DA 2HR3A 2NS8A 4UB8C 3QU3A 5J47A 2F5EA 2VKEA 4KFCA 2COBA 1LJ9A 2DFEA 1ETYA 3R6SA 2QLZA 3U9GA 1HKSA 3LWFA 2LDUA 1IZ1A 2OQRA 1APLC 1Z9CA 4D5CA 1XSXA 1G2HA 5H6RA 1R49A 3BTLA 3HKZA 3TOAA 5IP7J 4XL9A 1E3OC 3PNTA 3QYFA 1DUXC 2DDBA 3ZMVA 2CG4A 3IRQA 3WE2A 4DYRA 1O57A 3FXKA 4E4HA 3ZQQA 3H36A 2E2JJ 4CCJA 3QYEA 1S72I 2DQLA 4M3GA 4UVBA 1OYWA 2JSPA 1RPWA 2FRHA 2ZMEB 1EJ9A 2Y75A 3DEUA 1FSEA 2Q8KA 2E1NA 2BY1A 2LD5A 3HHGA 3A01A 3IV5A 1ZGAA 5GPAA 2HGCA 2BY3A 2UZKA 3OYCA 3VODA 5E18F 4HDUA 4B8XA 3QYBA 3DXJF 4TV7A 3BCAA 3U1DA 4OIQF 1QQIA 5C4JJ 3V7RA 3SQNA 2WAFA 2XAGA 2HQ5A 1XMAA 1KU3A 2P6TA 2QSHX 1ETVA 2OZUA 2LYCA 3LFUA 2E19A 3DEEA 4HEA2 1X4OA 4IL6C 4IHSA 1V5FA 1W36D 3PUFA 2W48A 3F0CA 3TBIA 2XGCA 3PFIA 3G2BA 2KIFA 2UUZA 1PJRA 1ORKA 2VT3A 4MHGA 4L0YB 2LY1A 1F4KA 4AIHA 3CUQB 3BR6A 3KE2A 3I4NJ 4CA0A 1WI3A 4L5EA 2Q0OA 3VSKA 4PJ0C 1KQ9A 5F6FA 2ECCA 4GXOA 1RKWA 2ETHA 4JX5A 3ZXSA 3CCMI 4MLOA 2XGXA 3CP2A 2IT0A 2JK3A 4IHTA 3WHBA 1ON1A 2DW4A 2G0EA 2NVUB 2CUFA 4OIOF 2L5QA 4I7HA 3ZR8X 2E71A 4GRIA 2EZHA 5HS7A 4ZDOA 4QWQA 5IT9Z 3H3ZA 2M30A 2QQ9A 1VQPI 3BR0A 5EEAA 5B1BH 1XGOA 3FM3A 3EYIA 2XB0X 2CSOA 4LB5A 2KDOA 1TQPA 3P9CA 2OF7A 5FO5A 3CD6I 4GO1A 2UXXA 1DQUA 3KP6A 2XRLA 2JVHA 3DBLB 2W84A 3IAM2 2L54A 4LJZF 5ICFA 2EWNA 4YIIA 2W7NA 4EATA 3BJOA 2VKHA 2XIGA 3CUOA 2FUG2 3BR2A 4MFEA 4E7SA 2E1MC 3SDBA 3HEFA 3DPUA 4HDVA 3BTIA 3MKWB 2QKLB 3PFYA 2JTVA 4BEHB 1B4AA 2FBHA 4BE0A 1NK2P 2JUCA 1UELB 3S3OA 2M0MA 2BYVE 3BP8A 2A6EF 2O0YA 3U1KA 2PMZN 2EBIA 4BAYA 3CDLA 2M7BA 1SVOA 3WHCA 4ZTFA 3OMYA 3WTWC 2GZWA 1HW1A 4PGGA 3BY6A 2WBMA 1U2WA 2YX7A 2FF4A 5JLXA 1UCRA 1W4MA 2KHMA 5E20A 1H88C 4OOIA 2HQNA 1TWGJ 4LIVA 1MNEA 3QPLA 2JSCA 3TGNA 5HLHA 3LQRA 3VYUB 3CCYA 3CJRB 5LHHA 3UKGA 1NG6A 3OR2C 4QLCU 5FJ8J 2HOSA 4OIPF 4DOZA 4K2EA 1H9GA 4HX8A 2ELHA 4KDPA 4MQVA 4BHPA 4IEJA 5FFXA 3HIFA 2M8GX 3LSJA 4LG0B 4MTEA 3ZCOA 2EIKH 4XLAA 1PUFA 2W00A 1TW2A 3E5XA 2VXDA 1VQ7I 2Y9ZA 3FXJA 3GCMA 4HNTA 3CCVI 3PJRA 2X1DA 3A0HC 3F72A 3Q3SA 2IRFG 3DU5A 1FX7A 4MGRA 5TISC 2GA1A 4U87A 1NG7A 2HKOA 2NVXJ 4A3DJ 2V1NA 4P55A 2XPVA 1SAUA 3NRVA 3JW4A 2Y0MA 5IT3A 2K7LA 2YR2A 3WU0A 4YFKF 4LG3A 1HSTA 2FA5A 2PI0A 4M3EA 2HXIA 4F91B 1J2XA 3HRTA 1P7IA 2BY0A 3AFHA 5E1XA 4BQNA 4C2TA 1SMTA 3QODA 4BKXA 4HG2A 1YRNA 3MZ8A 3KPHA 2BXYA 3VYTB 1ZK8A 5LHIA 4XKCA 3M8FA 1TT0A 2X48A 5LGTA 5DV5A 2NOGA 4A0ZA 4ZYHA 4B3XA 3H3UA 1H0MA 3HOTA 1KQ8A 4XR6A 4N0BA 1OR7C 1FOKA 2K9MA 1XGSA 2K9SA 3I64A 4UUTA 3IC7A 5GTIC 3IL2A 2I5UA 4IHYA 2YS9A 1T38A 4KMFA 4CGZA 4BH9A 3B6AA 3OYHA 1W36C 5CKTA 2ZSHB 2XC7A 3AG4H 5DCMA 1Z7LA 2LSOA 5E3NA 3JCUC 4KNYA 2CFXA 2BVLA 2XPUA 2VODA 1HF0A 4FX4A 1RIOH 3DWLE 2V6CA 2KQRA 2CV1A 1XGNA 5FRMA 4EM2A 3GVAA 1UHWA 5CVUA 4XLFA 3LFKA 5A2QK 2JN6A 4AIDA 4M73A 2CMPA 1LEBA 3BG6A 1BI1A 3FHZA 3E6CC 2AQFA 4GDFA 5E8GA 3GLXA 5D4RA 2VQGA 2Y30A 3SFZA 5L3CA 2E1CA 1OJLA 3CJQB 2KIQA 4CZCA 5AONA 1HDDC 4BU2A 2M9HA 2EV5A 1RKTA 3BJAA 4BQOA 3NWSA 3Q0WA 2JA5J 4WK8F 4KUMA 2RAEA 2WAQN 2E2HJ 4PSXA 4HAMA 2VASA 2VC0A 1FBSA 3ZPLA 1BR2A 4J01A 1ZR2A 1Z6TA 2FOWA 3O8HA 3T8RA 3WG7H 1OCTC 4YELA 3I4PA 2A5WA 4LMYA 2DN0A 2VJ4A 4MO7A 1J59A 1U0JA 5C44J 1U8BA 1U5TC 3H35A 2GIZA 5J4VA 2FQ3A 1BJZA 4BY1J 3KZIC 4HPQA 1R22A 3K4LA 2NYXA 4AU7A 1D5VA 2IPQX 3KP4A 4PJNA 2DMTA 3T1BA 1MNDA 4KICA 2VBZA 4X0GA 3S32A 2LF7A 4OAYA 4XIDA 2PJRA 2H94A 5DUKA 3RKWA 1LDJA 2WADA 1WHUA 1MNMC 2LBFA 2XDVA 1IO2A 3IP4B 4G7OF 3CO7C 3RPUD 1HBXG 2HU9A 4I6ZA 3DBHB 4LLGF 5IP9J 2TCTA 6PAXA 4CUGA 5LBQA 4G6TB 4AIJA 4OMYA 4BXXJ 2KP6A 5CPRB 1M1EB 4C9YA 1X3ZB 2ZCWA 2PMHA 1OISA 1U6GA 1SFXA 2W24A 4M9ZA 1BI2A 2UXNA 1W5TA 3GO5A 4DBQA 2DU9A 3BR5A 2VBYA 5D8LB 2ACJA 1KU2A 2EZLA 3K6GA 2HDDA 2LH9A 1LQ1A 1ZGWA 2DA2A 3HTUA 3SZGA 5H2FC 2GA2A 3OS1A 2R4GA 3A2KA 2FXAA 2Y0SN 1YFHA 4G8XA 3KEYA 4XLNF 2VJJA 2A68F 3L09A 1D5YA 5LEJA 1FY7A 5BS6A 1ENHA 2R7XA 2CUJA 2CUZA 2DJIA 5M5WJ 1Z21A 4ITVA 4AC0A 4UUSB 5BPIA 1OFCX 5EDNA 1SFEA 1H89C 4PJMA 2OCCH 4FASD 2B63J 4V2GA 1Y0UA 1O3QA 1R36A 3EUAA 4I99C 4ENNA 2O61A 1DPUA 2KPMA 2XROA 2MD5A 5B1AH 3F8FA 3DTIA 4EJVA 3KCCA 2R7WA 2P5LC 2FD5A 1QA6A 2DFIA 2EINH 3V7CA 2IA0A 1MMSA 4IF4A 4A0XA 4U0VA 5IOYA 1YRNB 2QBYA 1P9QC 3O6BB 2CW8A 1R4MB 1R5GA 1ZR4A 3RPQA 1XCBA 2M8EA 3W2AA 4ENJA 1JJ8C 4IHXA 3R61A 1KQ0A 1Z6RA 2BXZA 2HPIA 4HF2A 4CHUA 4WXDA 2H8RA 1DPRA 1T0FA 3PO2J 1XC5A 4JBAA 1OCPA 4RM3A 1TC3C 2WC2A 4XM3A 3H0GJ 3FKJA 4XSXF 1P4WA 4RBOA 5DCMB 1UHSA 1XD7A 2ZMEC 5FD5A 3VYSB 1BIBA 5GTHC 1FNNA 1YS6A 3IRRA 2DA7A 1TW3A 3GTQJ 4AVZA 3N4MA 1XPXA 4AYBN 5IOZA 4YFXF 4WWCA 2VBWA 2DXIA 1S7OA 1VQ8I 3QP6A 3LA2A 1WJEA 2DMQA 3S1MJ 2MGQA 4G9YA 4DZPA 2ELKA 1YHQI 4XONA 5HDGA 1WZ2A 3KYCB 2KRHA 4CYCB 1XGMA 4XOTA 3PIOF 3GTMJ 3V7SA 3MWMA 1BW6A 2DCEA 3ZMZA 3S15J 4A69C 1FOYA 2E7WA 2P4WA 2XAUA 1LB2A 3M8JA 2VQHA 3OSGA 5F1JA 1QU3A 2L4AA 4YRVA 3HRMA 4IJAA 2L9VA 2F5VA 2FOKA 3CUQC 2JVGA 1WKMA 3AG2H 4HF1A 5J1UA 2L4MA 2YPRA 4ESFA 3T8TA 4U88A 4A5MA 3F8NA 1X1DA 1NK3P 2AQEA 2CV2A 4GGGA 1WJ5A 3TO6A 1JUPA 2DOAA 1QZZA 1O3RA 1JGGA 4AWXB 4G7ZF 1RNLA 2PLYA 5HVQC 2QYOA 1VQOI 1T39A 3PNVA 4NC6A 2EFQA 5DUIA 3WGIA 2QF7A 1Z7UA 4YFNF 2PJRB 4JOMA 1WPKA 2ZNYA 5LD2C 5E8IA 2L7ZA 5IYDJ 3BROA 2O9LA 1IDYA 2X51A 3N05A 2NXNB 1WI9A 3I58A 1E2XA 5F1RA 3GXOA 2BW3A 1IRZA 3HYIA 4IQJA 1IN7A 5DM7F 2DYSH 2M87A 3TO9A 4A3KJ 2QQBA 3E6DA 4JYKA 3IWZA 3BQZA 4X1EA 1AU7A 2KLOA 4A3GJ 2E5NA 1ZLJA 3W6KB 5CVVA 1WRJA 3K7AJ 4D9JA 2LR8A 2XAFA 2W57A 4EM0B 2L01A 2P8TA 4FCYA 4C3JJ 4KMUX 4OINF 2GXAA 2EB7A 4PK4A 1LDKB 2K27A 4Y4RA 5AIQA 3F22A 1QBJA 1YYVA 3FXMA 1FYLA 4BEHA 1JHHA 2CFOA 2R7OA 1F43A 3PNYA 5LLQA 1BI0A 1XS9A 3HOWJ 3L2WA 2Z33A 2ZXJA 3FXQA 3MKLA 3P9IA 5LGNA 2JA8J 2LRDA 3Q0VA 4UUVA 3CF5F 3GYHX 1XMKA 3SHFA 3CCRI 3GBGA 5EZHA 2XUBA 3CDIA 2ICWG 4YIRX 5F0FA 3TW7A 2YUSA 1SMYF 4MFDA 3BG3A 4CCKA 1O7LA 2GXBA 1RRJA 1I3AA 1YJWI 1O3SA 2KKOA 2M1BA 2Z5UA 1MMDA 1IRFA 2HVSA 3SXYA 4G94A 2STTA 3BZKA 2XGEA 1USTA 3HZJA 2X1CA 1MJAA 3HG9A 5F08A 4M3FA 5F27A 1JGSA 3L9FA 3FM5A 4DW6A 1Z0XA 2FX0A 2E7XA 5F64A 2GXGA 3RKYA 3RI4A 2BOLA 3QPTA 1ETXA 3RKQA 1ZHFA 1Z3YA 2E1OA 2C6YA 3HUGA 3BTCA 2FU4A 3PSIA 1HA8A 1N75A 3G73A 4OU0A 2PX9A 3ZQFA 2NAZA 1VI0A 5C3EJ 3FZVA 4FX0A 1HKTA 3COAC 4KT6A 1GT0C 1UZCA 5J6XA 2RNJA 2ZFUA 5EF6A 2HKXA 3IH4A 1VQKI 3FHNA 4RM2A 3DTEA 3G1LA 4LB6B 3K2AA 1IN6A 1I5ZA 4RAGA 2LKXA 5CLSA 3K4BA 4GYGA 2BHYA 1F5TA 1MJ9A 3M3YJ 4J00A 2DOEA 5JR3A 2CUEA 2K3FA 3CC7I 1Q1VA 3E6MA 2KIUA 2F5DA 2W25A 2W4SA 4C3HJ 1ZREA 3SJMA 3CCUI 3DCFA 4PCQA 1R4NB 2IGNA 1JUSA 5CYVA 1K78A 4S0HB 1BM9A 1JKPC 4QIWN 4HNUA 1FPQA 2EV6A 4IHVA 2R92J 4IHWA 2F4IA 5ICGA 3G1OA 2RC4A 3FX3A 3JRIA 2TRTA 5HDKA 2QCOA 1K6OA 2LREA 1ZTRA 1Z91A 1WWXA 1S8NA 2K4JA 4I2OA 2OQGA 3LSKA 4FQGA 2DK8A 3ZQLA 2G7HA 1QO0D 1V5GA 2CS3A 2JRTA 4CCOA 3OYFA 1WH5A 3HGGA 4UV9A 2XV4S 4XMYA 4JX6A 4ZJZA 2R7TA 4C2MJ 2KZGA 2FMYA 3S2WA 1BC7C 2GQQA 3H9GA 2IS2A 1P6RA 4G6QA 3FBIB 2DMNA 4XORA 3HSFA 4ABZA 3HBLA 5ILUA 4Y13A 4KIBA 3FXOA 4XK4A 5ICEA 1FBUA 1BI3A 2X0LA 3K69A 4A2UA 4CCLA 2ZXHA 3CJNA 3BDDA 1QVTA 2M2EA 1W5CC 1XG1A 2V9VA 3GFLA 2RQPA 2CRGA 1S9HA 4BE1A 3WGHA 3BWGA 4N4NB 4II2A 2VKDA 3ABMH 2AHQA 4E6KG 2ZSIB 2E60A 3L1PA 2QKMB 3O8GA 1VQ4I 4XKVA 2MG4A 1FMVA 4AD9A 1FTTA 3C18A 3JRAA 5DDGA 5L3EA 1I6XA 3R4KA 4BHBA 2IGMA 1X1CA 5FFZA 2PJPA 5FLXK 2CWEA 3MEXA 2KJBA 5DYMA 2BW3B 1VZ0A 2V1XA 5E3OA 4A6EA 3OL4A 4KN7X 1B1BA 1ZGJA 2J5OA 5IYCJ 1MSFC 1BIAA 1RUOA 2IGOA 2DPUA 3BTJA 2PMZA 4WXHA 1S29A 2FBIA 5HNFA 4B48A 4OAZA 3GTGJ 3CP8A 5JVTA 1ITYA 2ZBKA 2JRMA 3DLAA 2EH3A 1SFKA 1TZLA 2G7UA 2X4HA 3KYLA 1MJBA 1SVMA 2WY7Q 1ZKGA 2ME6A 2VE9A 1YI2I 1D1CA 2L02A 2M3AA 3SEQA 4EGYA 1U3EM 3JRCA 3ZOBA 1AHDP 3ZRGA 1OQYA 2R7DA 2VLAA 1UAAA 3GTPJ 1MH4A 5H6QA 5D6EA 5EGOA 2JJ7A 4RS8A 1B9NA 3JAMZ 4PFOA 1W1WE 2KFDA 2XAQA 5GP9A 3K4NA 5HS9A 4ZYGA 3ASNH 4ENMA 3ASOH 5HS8A 4P9UA 4YEJA 1MDMA 5K7HA 1JTYA 2L9SA 1W7PA 4EQQA 3K1NA 4V2FA 5LHGA 5J8CA 1FJLA 1YS7A 2EZIA 3M07A 1RETA 2BEOA 2H6CA 2NNYA 4O3MA 4ETSA 5HODA 1WJCA 2ZB9A 2P81A 1S3JA 2R7SA 3Q9SA 3MCZA 4BBRJ 3GTOJ 3W3CA 3OYEA 4D5FA 5CJ9A 4HV6A 3IH3A 3KLNA 3M8EA 1YIOA 3G3ZA 2N8GA 3OV8A 1U78A 3MAJA 1K6YA 1FP1D 4I0AA 1WH7A 4IXAA 3HUGB 2EQRA 1I1GA 1KA8A 2FQ4A 2DT6A 4Y17A 1BJAA 4CSWA 2M45A 1HOMA 3BG9A 5JHFA 2KRCA 4BDYA 5M5XJ 4UUSA 3GW2A 2RREA 2IP2A 1NH3A 5M3FJ 3HPGA 2R5YA 2GWRA 2RGVA 4M6VA 2LFBA 2GBYA 2K86A 5M3MJ 4U7DA 3PO3J 1YIJI 2NS7A 2WA0A 2L7FP 4HBLA 1FLIA 1K61A 4L9JA 2HPMA 1VTNC 2BBYA 2F5CA 1DU6A 2ADUA 1Z77A 4LK1F 3ISPA 4M6YA 2WB1A 3BOQA 2I8DA 3V8KA 3ZMDA 1IV6A 2CH0A 1I39A 2F48A 3PUBA 1B9MA 1DGRM 1GVJA 1L0OC 2R5ZA 2JA2A 4D1QA 2DTRA 4O5VA 5L3BA 2VB6A 4B4CA 1K78B 1BN5A 5HLGA 1EV7A 3CCJI 3WODF 2OUMA 3EUHA 3LA3A 4BQAA 5CVRA 2OCEA 4XLPF 4NNJA 3ZQ7A 1BL0A 4I76A 5IPAA 3OYMA 3TOBA 2MABA 2OAZA 2Q2EA 3BG7A 2ESNA 2MH9A 2V79A 2D1HA 4Z2YA 3WG9A 3W6JB 3P7NA 1BC8C 3S1NJ 2O7OA 3SYTA 3CLQA 1RUNA 2IVMA 5F04A 3HOXJ 4JP0A 2Q1ZB 1OYYA 3NAUA 3TDZC 2HDCA 2IS4A 4JK1X 3Q9VA 1OCOH 3HTSB 1LFBA 4RLQA 4A0YA 2WAQA 4A3IJ 2OZ6A 2HXOA 2ISYA 3ML6A 2GM4A 4JX4A 1E17A 1GDTA 4G7HF 5DS9A 1WGXA 4HQEA 3BPVA 3IUOA 2KJCA 1WJAA 4CYCA 3F21A 1X4PA 4L0ZB 4EJWA 3N97A 3MD2A 1OKRA 2JZYA 3QPSA 4Q5SF 4Y33A 1JHFA 1REPC 1IDZA 3CMEI 2RVCA 1TNSA 1Y0NA 5E3MA 4RGUA 2F4OB 2ZNZA 4PJJA 3V42A 3GEZA 4ZDPA 4F3QA 2K9QA 1QZYA 2HYFA 3J81K 1R71A 1MKMA 4LFUA 2F2EA 3FXRA 4XRMA 1B6AA 4I0BA 2Y2ZA 3C2GA 4CICA 1JKOC 4A3LJ 2JPBA 4NB5A 4CCMA 2OC6A 4O6JA 2FEZA 4NC7A 4Q48A 5J4YA 1DGWY 1R00A 2CQQA 2LOOA 4IKFA 5CQGA 1ZG5A 3D0SA 3I59A 3C1DA 3D5LA 1MBFA 2ZJRF 3BPXA 4ON0A 1ON2A 2XAJA 4HSRA 3GZ6A 1RZ4A 2PFBA 5FRNA 3SZTA 2MLGA 2KDZA 3R0JA 3HOUJ 1HQCA 4XICA 4U7BA 1KU7A 1B8IA 1TLHB 4E7ZA 1SD6A 5FGMA 3C2HA 1POGA 3SZPA 1BA5A 1NHAA 3ABUA 3TL4X 5EGOB 3QU6A 2VONA 1X3UA 4ZH4F 1ZLKA 1CGPA 4RGXA 4D7MA 1PYVA 4L9TA 4B44A 3ONQA 5IY5H 4Q4ZF 1MDMB 3S2HJ 5CQEA 2R7VA 4HLYA 1W7PB 3FMRA 1U9NA 1IXCA 2Y0SA 2L7KA 1IC8A 3FBNB 3E6BA 3QOPA 3OYNA 1HXDA 1F36A 3LL7A 3B6CA 1RR8C 5HNHA 1VQ6I 5LFAA 4Y15A 4CYDA 3HDDA 1EH8A 1G3SA 3WTZA 4R79A 1SD7A 2JMWA 2XRNA 4PSWA 1EKEA 3J80Z 2DO7A 2QQAA 3T5XA 2G9WA 4UXNA 5D5WB 1YITI 2WAEA 5J40A 1W0TA 2PEXA 1V55H 3WU1B 2XB5A 2QQ8A 2P5KA 1JUMA 1U8RA 3REOA 3RYRA 1ACIA 3GFMA 4GCVA 3ZP5A 5DTDA 1UFMA 3CLOA 3CC4I 3EQLF 2CO5A 1LVAA 1YW7A 2Y69H 1R5ID 4MTDA 1YW9A 3L2CA 4B1RA 1XX5A 4ZDLA 3CDHA 4XKBA 3RTRA 1XTAA 4CO8A 1D3YA 2R5YB 4HSTA 1P4XA 2A6HF 1Z1DA 1DDNA 3S2DJ 1O7FA 4PUSA 5IT9K 4V19K 2ZO4A 1I1SA 1I6HJ 4M9XA 1Y1VJ 1ZRDA 2BVMA 1P7JA 3RZOJ 5E79C 1T0FC 2HTJA 2I10A 2M34A 4QPQA 4NQWA 1R6RA 4IZZA 3G71I 4XQFA 1QPMA 3HHHA 1JI8A 3JRHA 5EEHA 5HLIA 3L2RA 1F9NA 3K70C 2L9RA 1TTYA 1ZG1A 2R5ZB 4F7ZA 2A3SA 3K9TA 4AYBA 4LLNA 1R58A 3S14J 5J8FA 4L18B 2O03A 1YW8A 3RKXA 4DJAA 1A04A 4BL0B 3UNGC 1V54H 4XRSG 1FC3A 4A93J 2Q2EB 3I3LA 3KETA 2JT1A 3OS2A 1D1AA 3IAS2 1KYZA 2H8WA 3A0BC 2MBFA 3ECHA 2UV1A 3Q5FA 3F6VA 2DI3A 1R1VA 3RQIA 2DOFA 3IH2A 1KZHA 5BOXA 2HWVA 1Y8RB 1J09A 1Z67A 2P5VA 2HVQA 3OIQA 3BQYA 3FMSA 2VQCA 3FDYA 1V4RA 4D0PA 3AAFA 5FKKA 3GX4X 3DPTA 4Y7NJ 3K4KA 4IRGA 4XLHA 1IXSB 3IWFA 1FWZA 2IS1A 1BOAA 2VUMJ 2VKVA 1BW5A 3I54A 1VQLI 1R23A 3D1NI 4RA2A 4H4KC 2ZJQF 3FK6A 2W82A 1Z3XA 2H09A 3FMQA 4RB1A 4RDUA 1IUYA 2EIJH 5D5UB 2BV6A 2WV0A 2XF6A 2XSDC 3V8JA 2CJJA 2V9PA 3FISA 2RNGA 1HCRA 2HYGD 3GMEA 1T56A 4ZYEA 3BZ6A 5FB2A 2VC1A 4IQ4A 3E1SA 4A3FJ 1JE8A 1HSJA 3TEDA 1TL8A 3R60A 2Y9YA 2P7CB 2CQKA 3J7ZI 2V1UA 2CQ7A 3CJTB 2BY2A 1ZRFA 3I4MJ 4LIUA 3I9V2 1D0YA 2YX4A 3EETA 2CQNA 4M6XA 2M0CA 3DFGA 3I71A 1LFPA 2R7RA 2EILH 2R3SA 2Z9OA 1E3PA 2ID6A 1OMIA 1H8AC 3I59B 4RAFA 1IF1A 4ASNA 2CW7A 3ZN1A 5GADJ 2B7EA 1VF9A 2PG4A 3VEPA 2R7UA 3OYJA 1L3LA 4P9FA 2XKPA 3E5QA 3H5NA 1TWAJ 1UJ8A 4XBFA 4UY8I 5E3LA 3A02A 1B8IB 2D2WA 1Y8QB 5D5XB 3CCEI 1X19A 2TDXA 3OWTA 4RB3C 3H3VK 3IHUA 4BXUA 2ELJA 5LRRA 3LA7A 4B47A 2VPRA 1IRXA 3CTAA 1QPIA 3GF2A 3GZNB 3JRFA 2F4MB 1FZPB 4I98B 5FD6A 3TP0A 2H27A 3BJ6A 1STZA 2R0QC 2KZVA 2NVYJ 1RESA 5DCFA 1Y56A 2K4BA 1OPCA 4FTHA 1QHGA 2K9LA 2PBIA 4HLXA 3M1CA 1MIJA 5ILSA 2KL4A 4J19A 2DA4A 2LP0A 3CQZJ 3WTUC 4QSHA 4L9NA 4IX7A 4XRSA 3I0TA 1X58A 1N25A 3I56I 4UHTA 1IRGA 2Y31A 4LGWA 3OR1C 5EG0A 4KA4A 3K2ZA 1SFUA 5DD4A 3JRGA 3OL3A 4BE2A 4PGHA 4E7IA 2LLKA 5IP6A 1XMXA 1S7AA 3BG5A 1WQ2A 3VFZA 3K0LA 3ULQB 5K7ZA 1W7PD 1RC9A 2KISA 4CCNA 3CZ6A 3GZ5A 1MBEA 2A6TA 3OYBA 3CCLI 3MZHA 2FBKA 4P5OA 5EEGA 3ERMA 5FKNA 1X1BA 2OA4A 1LUJB 4EEFG 1D0XA 2K9NA 4A3MJ 2H1KA 4FE4A 3MFKA 3E7LA 5EYRA 3HGYA 2JUGA 2MSYA 3JSOA 2EFWA 3L7WA 4KITB 2DT7B 1USSA 2X6XA 3LSPA 4E7KA 3SFIA 3E3VA 3OYIA 1CQTA 4RAZA 4KIFA 1JTXA 4NQWB 5A2QZ 4C2UA 1SANA 2OJED 2D1VA 3KP7A 4NHJA 3CF2A 3F8CA 2LC2A 2MYSA 1JKQC 3L2UA 1P92A 1TQIA 1WJFA 3G1MA 3QOEA 4LOCA 2QGUA 1BBYA 1K4SA 4CXFA 3H9JA 2X9DA 2IW5A 2XASA 4RB0A 5ICCA 3K4MA 5K7FA 1ERDA 3DF8A 3QRFF 2ZC2A 4HW0A 3CMMA 1YE9A 2HOAA 4UNOA 2V26A 2EFNA 4LLLA 2AO9A 3KP5A 3IKVA 4FETA 4RMNA 4MIMA 3ZQCA 4OMZA 4F93B 1PVEA 1R1UA 1UG0A 2HS5A 4BJ5C 1XCVA 3ELKA 2RV8A 3ZGKA 1WVRA 3P9KA 3QAHA 4A6DA 1LPQA 2KIMA 4ENKA 1ZG3A 2CYYA 1LEAA 1OCZH 2EIMH 4BBSJ 4FT8A 3GWZA 1B59A 1YQAA 4QPOA 2JQ7A 1FIAA 5LRSA 1QVUA 3DKXA 3LSMA 2VOOA 5FKLA 4I02A 3T0YA 3TW6A 1LFUP 1WJBA 4KT5C 2DAOA 3KX2A 2NVQJ 3K4JA 1TWFJ 2AXTC 1EH6A 3O3KA 3JR9A 2QA4I 4IVNA
chains in the Genus database with same CATH topology
3RQ4A 2CH0A 2R4GA 3AKZA 3A2KA 2LBFB 1KONA 2X85A 4N4OB 3PUBA 1DGRM 4ZTJA 4XOPA 2JA2A 4D1QA 5KCMA 3KEYA 1ZELA 2O5RA 2VB6A 1D0ZA 3OYDA 2VJJA 2VIXA 2IS6A 1Y6IA 3PSFA 2OUMA 4BDZA 3BLYA 2R7XA 2CUJA 2CUZA 2DJIA 4NNJA 3OYMA 1Z21A 2MABA 3BG7A 4ITVA 4OWRB 1FMWA 1OLTA 3UR3C 4PJMA 4FASD 1WJDA 1N77A 3SYTA 2XSJC 3EUAA 3J7AY 2F6CA 2Q1ZB 2CV0A 2IS4A 2KPMA 3DTIA 2W1OA 1YX5A 4RLQA 4B43A 2R7WA 2V4JC 4DBRA 2WAQA 2VL8A 1MMGA 4DIQA 4XLCA 3BC8A 1P9QC 4BACA 2ZXIA 4XN3A 5HOOA 2CW8A 2L2OA 1E0EA 4XNFA 2K3PA 3IUOA 1WJAA 3VWBA 1X4PA 2IGKA 3HC7A 4XLEA 3MD2A 2VJIA 3K10A 3W2AA 4BQQA 4Y33A 3LSIA 2HPIA 3S8PA 4PJJA 3V42A 1X1AA 4RM3A 4ZDPA 5KNLA 4F3QA 4XM3A 3AL0B 3FKJA 2L9NA 3H5AA 3H5RA 2V7FA 3VYSB 3VYRB 2M7AA 3H9QA 4ZYAA 3C2GA 1WFXA 1LVKA 4CCMA 2OC6A 4AVZA 3MKYB 4NC7A 3OOUA 1DGWY 2LG4A 2LOOA 4IKFA 5CQGA 2HDWA 2DXIA 2HNHA 1BR1A 3VSLA 3HL2A 1WJEA 3W2VA 4XKWA 1MMAA 3D5LA 2I8DA 5FROA 2WY8Q 2MFZA 2Z2SB 1D1BA 4XONA 4HSRA 2KRHA 5FRNA 4XOTA 4F55A 3DPLC 3OYAA 4HRIA 2DCEA 4U7BA 2XAUA 3M8JA 2VQHA 4BJTA 4E7ZA 3C2HA 1QU3A 4YRVA 4E7JA 3F9KA 3DU6A 2F5VA 3TL4X 4Y3OA 2JVGA 1QHHD 2X6WA 1PYVA 1X1DA 4JQFA 3ONQA 4B44A 2R7VA 2AQEA 5CQEA 2CV2A 1WJ5A 2Y0SA 2L7KA 4NUBA 2DOAA 3FBNB 3S3NA 3HKZA 3OYNA 4XL9A 5HVQC 3PNTA 3QYFA 3LL7A 3PNVA 5HNHA 4E4HA 2GOXB 3EUHC 3ZQQA 5LFAA 4R79A 4CCJA 3QYEA 4PSWA 2JSPA 2PJRB 4JOMA 2WAEA 5LD2C 2X51A 3N05A 3L2VA 3BCBA 3OYCA 2BW3A 2GOMA 3D5SC 4IQJA 3QYBA 1LKXA 3BCAA 4BJ6C 3DKYA 2WAFA 2KLOA 2E5NA 4ZDLA 3RTRA 4XKBA 2LYCA 3LFUA 4CH7A 3DEEA 4HEA2 1X4OA 3DTKA 4D9JA 1V5FA 1W36D 4HSTA 1MW7A 5TGTA 4PJLA 2HQAA 3TBIA 3G2BA 2UUZA 1PJRA 4PUSA 2LY1A 4PK4A 1G59A 1LDKB 4Y4RA 2BVMA 3K70D 1T0FC 4BEHA 2CFOA 2R7OA 4QPQA 4CA0A 3PNYA 2MC4A 3L2WA 1R6RA 3VSKA 4E7LA 4IZZA 4XQFA 4F52A 3ZXSA 1G8XA 2LRDA 4MLOA 1JI8A 2IXSA 2HVRA 3CP2A 3L2RA 3K70C 3GBGA 4AYBA 1V5EA 3D5RC 2K5CA 2L5QA 3ZR8X 2LY2A 4CCKA 4GRIA 4ZDOA 4DJAA 4BL0B 3UNGC 1MMDA 2HVSA 3VDXA 2Q2EB 3I3LA 2X1CA 3HG9A 2KDOA 3OS2A 3OIPA 1DQUA 3A4CA 1D1AA 3IAS2 2JVHA 3IAM2 2UV1A 2BOLA 2W7NA 4EATA 2VKHA 2FUG2 4E7SA 1J09A 1Z3YA 2HVQA 2E1MC 3OIQA 3SDBA 2VQCA 3DPUA 3FDYA 3PSIA 3MKWB 2QKLB 3PFYA 4BEHB 1HA8A 4BE0A 1UELB 1N75A 4NC8A 2M0MA 3S3OA 3DPTA 3W2WA 3K4KA 4XLHA 4E7HA 2M7BA 4ZTFA 2IS1A 4KT6A 3OMYA 4ANJA 2V6EA 4H4KC 2WBMA 2ZFUA 2KHMA 2W82A 1Z3XA 3FHNA 4RM2A 3DTEA 3OYKA 4LIVA 3PL8A 2X1EA 1MNEA 2OV7A 2M4GA 3OYGA 2XF6A 3K4BA 2RNGA 3VYUB 2UWMA 4J00A 3CJRB 2HZDA 4IQ4A 3E1SA 1NG6A 1DP3A 3OR2C 4DOZA 2MD0A 3S3MA 2V9KA 4LIUA 1BR4A 2W4SA 3I9V2 1MMNA 2XF7A 1D0YA 3ZCOA 3HPHA 4XN0A 2IGNA 4XLAA 1LFPA 3MMYB 2R7RA 4KJZA 2W00A 2P0WA 4HNUA 2F4IA 2VXDA 4BXFA 2CW7A 4HNTA 3PJRA 2X1DA 3NWTA 4PFPA 5HLTA 2R7UA 3OYJA 3DU5A 2LREA 1EA3A 1N78A 3SEZA 3LSKA 4U87A 1NG7A 3OS0A 3H5NA 1V5GA 3CESA 2CS3A 3RSNA 2V1NA 2E5ZA 1SAUA 4CCOA 3OYFA 2E1MB 1X19A 3OWTA 4LG3A 4XMYA 4ZJZA 2R7TA 4F91B 2ELJA 3AFHA 2IS2A 3H9GA 4BQNA 1BOBA 4LITA 3QODA 4B47A 3FBIB 1IRXA 4HG2A 4C2TA 2VQLA 4XORA 3VYTB 4XKCA 2R7QA 1TT0A 2KZVA 1GLNA 4CCLA 2ZXHA 4B3XA 3HOTA 1Y56A 4XR6A 1OR7C 1QHGA 2K9LA 2K9MA 1S9HA 3M1CA 4BE1A 4F92B 4N4NB 2KL4A 4II2A 3EPZA 2VKDA 4E6KG 4IX7A 2ZSIB 2E60A 3OYHA 1W36C 1YX3A 5CKTA 2QKMB 2ZSHB 4C30A 2Z1DA 2XC7A 4XKVA 1Z7LA 1FMVA 3OR1C 4II3A 2IGMA 2BVLA 1X1CA 3OL3A 2VPLA 4BE2A 4E7IA 2VJ5A 2BW3B 1VZ0A 3DWLE 2KQRA 2CV1A 3OL4A 5FRMA 4XLFA 2IGOA 4CCNA 3HOSA 3CZ6A 2CMPA 2A6TA 3BG6A 3OYBA 4P5OA 2AQFA 3A1YA 2PMZA 1X1BA 4RLFA 2VQGA 5HNFA 4B48A 1D0XA 4OAZA 3CJQB 3CP8A 4CZCA 3DLAA 1SFKA 1TZLA 4BU2A 2JUGA 3KYLA 2WY7Q 3DQVC 4KITB 2DT7B 4BQOA 3NWSA 1D1CA 2M3AA 3SEQA 2X6XA 4E7KA 4BGDA 3ZRGA 3OYIA 2VLAA 1UAAA 4PSXA 2VXZA 3HXLA 2VASA 4NQWB 1BR2A 4PFOA 4J01A 3K4NA 4C2UA 4P1WA 2X6YA 1T95A 3LMMA 4YELA 4YEJA 2A5WA 2L9SA 4ZC3A 3CF2A 4KISA 2VJ4A 2LC2A 2MYSA 1U0JA 3RCOA 3L2UA 1WJFA 3H35A 3QOEA 4BUPA 3LSGA 1WJCA 3H9JA 4HPQA 3K4LA 3K4CA 4AU7A 3K4MA 4PJNA 2R7SA 2Z16A 2KMUA 1MNDA 4X0GA 3S32A 1ERDA 3W3CA 3CMMA 4OAYA 3OYEA 4BS9A 2PJRA 1YE9A 3S93A 2V26A 2NOJB 2WADA 4FETA 2LBFA 4RMNA 2XDVA 3L2QA 3IP4B 4F93B 1K6YA 3RPUD 4BJ5C 1UG0A 2HU9A 5KHDA 3HUGB 3ZGKA 2DT6A 3U21A 4CSWA 3TMOA 4CUGA 2RQQA 5JHFA 3MKZA 4G6TB 2KRCA 4BDYA 3E0JB 2KP6A 2RREA 5CPRB 4C9YA 4DGWB 3HPGA 3OY9A 2WA0A 4QPOA 4DBQA 1AA7A 3H0DA 2XF5A 3LSHA 3DKXA 3LSMA 2HPMA 3K6GA 2LH9A 3EUKL 1WJBA 3KX2A 3K4JA 3OYLA 3SZGA 2M4KA 3AL0C 2WB1A 3OS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR2 C;  3OR1 C;  1JI8 A;  2XSJ C;  2A5W A;  1YX3 A;  2V4J C;  1SAU A; 
#chains in the Genus database with same CATH topology
 1G3Y A;  3AKZ A;  2L7M P;  2O8K A;  2CU7 A;  3WTV C;  2X85 A;  2JWT A;  4G6D A;  4P96 A;  4ZTJ A;  4WF2 A;  3RYP A;  2VT2 A;  3HKZ N;  1ZN2 A;  5KCM A;  3I5U A;  1ZEL A;  2O5R A;  3OYD A;  2M5W A;  2VIX A;  3PSF A;  5FLM J;  3HOV J;  1O3T A;  1MBK A;  2PN6 A;  4BDZ A;  2BZT A;  3KP2 A;  5ERI A;  3ABL H;  3NEU A;  4UVC A;  2DTZ A;  4OWR B;  1XSD A;  1FMW A;  1OLT A;  4FHT A;  3UR3 C;  4S05 A;  1S7E A;  5C4X J;  2CW0 F;  4RB2 C;  1WJD A;  2DA3 A;  1N77 A;  1AWC A;  5B5E C;  4MEY F;  2XSJ C;  5F0C A;  3HSE A;  1EF4 A;  2F6C A;  1T6S A;  4EV0 A;  2CV0 A;  1ZH5 A;  2W1O A;  2V4J C;  4HA8 A;  1HW2 A;  2DT5 A;  1E3H A;  2IBD A;  3GFJ A;  2E34 A;  4BAC A;  1FYM A;  1LE8 A;  1ETK A;  1FP2 A;  2MA3 A;  1E0E A;  4M72 A;  2K3P A;  5JVG F;  2E35 A;  3GLL A;  1AKH A;  1F1Z A;  4EJU A;  1LNW A;  2LNB A;  2VJI A;  3K10 A;  2OTJ I;  3NAR A;  1IAW A;  1GV5 A;  3WU2 C;  2VBX A;  1ETW A;  3RDI A;  3VOE A;  4KIG A;  4R8H A;  5KNL A;  3MN2 A;  4HF0 A;  3AL0 B;  2P6S A;  2RDP A;  2DBB A;  4AVP A;  2WTE A;  4DYC A;  2L9N A;  3E97 A;  3H5R A;  4ESJ A;  2V7F A;  1K83 J;  3JRB A;  5EG0 B;  2M7A A;  1RR7 A;  3ECO A;  3H9Q A;  2LY9 A;  4ZYA A;  3DV8 A;  4RGR A;  4LD5 A;  3MKY B;  3R0A A;  5K5Q A;  1SD5 A;  2MC3 A;  1S6L A;  3WGG A;  1K7A A;  3SDG A;  2HDW A;  4X6A J;  2HNH A;  1BR1 A;  3HB9 A;  2BE5 F;  5CVJ A;  5D6F A;  2DOD A;  3VSL A;  3I55 I;  3HL2 A;  2EA2 A;  5GAH J;  4XKW A;  1NTC A;  1MMA A;  4BYY A;  5FRO A;  3ERE D;  2MFZ A;  2Z2S B;  2NVT J;  1D1B A;  2RKH A;  2DPD A;  3NQO A;  5DEQ A;  1I50 J;  2XVC A;  4F55 A;  3OYA A;  1VFC A;  4HRI A;  3LST A;  4I09 A;  4BY7 J;  3RJP A;  4BJT A;  3PM1 A;  5DD8 A;  1Y1W J;  1YTY A;  2CGP A;  4M74 A;  4RGS A;  5FKM A;  1QHH D;  2YU3 A;  1JT6 A;  2X6W A;  2QVO A;  4R1H A;  1VQN I;  4JQF A;  1TNT A;  1ULY A;  5GAE J;  4A3E J;  4NUB A;  2K02 A;  4FIS A;  2ID3 A;  3S3N A;  2VI6 A;  3PQJ A;  1KYW A;  2DDA A;  2IA2 A;  2NS0 A;  5AIP A;  4NDL A;  3Q0U A;  1J7K A;  3LQQ A;  2GOX B;  3EUH C;  5B3S H;  3HRS A;  2NNN A;  4WCG A;  1QNT A;  1T8I A;  2FJ1 A;  5FLV A;  2A5Y B;  3C7J A;  2FNP A;  4D7N A;  1HKQ A;  3QP5 A;  4IOC F;  5BNG A;  2ISZ A;  2K85 A;  5E1W A;  3M1E A;  3V8L A;  4M9S A;  1OCC H;  1RI7 A;  5J1R A;  3B02 A;  3BCB A;  3L2V A;  3PQK A;  2EPF A;  1SVL A;  2GOM A;  3D5S C;  3C2B A;  2O8X A;  1LKX A;  2HTS A;  1YO5 C;  3X2Q H;  4BJ6 C;  5L3G A;  3DKY A;  3DLL F;  4B3A A;  5BPD A;  1ZAO A;  2L3D A;  2EZK A;  5F0H A;  2L0K A;  1HW5 A;  3G4S I;  4A3C J;  2ZJP F;  1J75 A;  1A6I A;  2F5F A;  4CH7 A;  1ONV A;  3DTK A;  5LGU A;  1MW7 A;  2DFH A;  5TGT A;  2ZKZ A;  4PJL A;  2HQA A;  1VQ9 I;  1ZRC A;  1G59 A;  3H92 A;  3K70 D;  2O3F A;  2H6B A;  1WCM J;  2ZJ2 A;  3DEW A;  5BQT A;  3L00 A;  2EV0 A;  2DA1 A;  2MC4 A;  4E7L A;  2WB1 N;  2IAI A;  4ZZL A;  4F52 A;  4W97 A;  2R7Z J;  2EK5 A;  1G8X A;  2LTP A;  2IA1 A;  2IXS A;  2HVR A;  5JFR A;  3GTJ J;  4L5I A;  3A01 B;  2XAH A;  1OR7 A;  3HOY J;  2KT0 A;  1V5E A;  2PMU A;  3D5R C;  2K5C A;  4HQM A;  2LY2 A;  4GFB A;  1U9O A;  3E5U A;  1B72 A;  4M3D A;  2Z99 A;  1HLV A;  1MZB A;  3VDX A;  2IJL A;  1QRY A;  2BHZ A;  3H1C A;  2EFO A;  2P7V B;  2WWY A;  5L3D A;  1A31 A;  3OIP A;  3A4C A;  1FOW A;  2DA5 A;  2FE3 A;  2D45 A;  3WTY C;  3U2R A;  4UB6 C;  3WTS C;  3TQN A;  3HOZ J;  1SEU A;  2AS5 F;  1PP7 U;  1UMQ A;  3OSF A;  2WV1 A;  5TJJ A;  3CCS I;  1GXP A;  1IXR C;  4NC8 A;  3LNQ A;  3W2W A;  5EZG A;  1A5J A;  1T98 A;  1LE8 B;  4E7H A;  3ZQG A;  1R1T A;  3KP3 A;  4ANJ A;  4Y52 J;  2A69 F;  3JSP A;  2V6E A;  2QWW A;  1TQM A;  3FK7 A;  3KEO A;  5HDN A;  1AKH B;  5K5O A;  3HRU A;  4GYI A;  3OYK A;  3PL8 A;  2X1E A;  3QPH A;  1SC7 A;  2XGD A;  3ZN0 A;  2OV7 A;  2M4G A;  1VQ5 I;  3OYG A;  4G12 A;  3V4G A;  4AM3 A;  3CO6 C;  3AG3 H;  1FEX A;  3HM5 A;  2UWM A;  2OU2 A;  4EMS A;  2DJN A;  2HZD A;  1DP3 A;  2GAU A;  2QEX I;  2VE8 A;  1CF7 A;  2MD0 A;  1TP4 A;  4IO9 F;  4IPA A;  3JTH A;  3S3M A;  1J9I A;  1G3W A;  2V9K A;  4IOA F;  1BR4 A;  2HEO A;  1MMN A;  1FSH A;  2XF7 A;  4KYW A;  1U5T A;  2X6O A;  3A03 A;  3HPH A;  4XN0 A;  3JRE A;  1SD4 A;  3MMY B;  4KJZ A;  4UVA A;  3ZMU A;  3HJE A;  2P0W A;  1LDD A;  5E1Z B;  3GTK J;  4CZZ A;  4BXF A;  5ED4 A;  2H1L A;  1G4D A;  5KK1 A;  3MVP A;  3NWT A;  4EJO A;  4PFP A;  1MSE C;  5HLT A;  2HOE A;  1EA3 A;  1N78 A;  4LK0 F;  1IN4 A;  1MBJ A;  2ZFW A;  3SEZ A;  3KIO A;  3CC2 I;  3OS0 A;  3JRD A;  1IN8 A;  1XSV A;  3CES A;  3RSN A;  4A5N A;  2E5Z A;  2CQX A;  2LVS A;  3BR1 A;  1UB9 A;  4HYE A;  2GIV A;  3G6E I;  2B9S A;  2E1M B;  2DYR H;  2KRF A;  2K40 A;  3ZQI A;  4E70 A;  2COM A;  2EJR A;  3MZY A;  1UG2 A;  3BR3 A;  5D8K B;  4DQ2 A;  1BOB A;  1KU9 A;  4LIT A;  4B09 A;  2VQL A;  1GXQ A;  3TP3 A;  1JXS A;  2QEN A;  2ZXW H;  2DQR A;  3O2P E;  5H20 A;  1FT9 A;  2R7Q A;  4WXC A;  5JI6 A;  3BT9 A;  5GAG J;  2PQ8 A;  2LMD A;  1XB4 A;  4OIR F;  1GLN A;  3LOC A;  2HI3 A;  5DM6 F;  1D8J A;  1IJW C;  3VPR A;  1WSU A;  5IYB J;  1PUF B;  5ILV A;  4F92 B;  5D5V B;  3EPZ A;  2E36 A;  2O6G E;  3RZD J;  3M9A A;  2RN7 A;  3K1M A;  4HX4 A;  1YX3 A;  4NBQ A;  3M4O J;  2DFF A;  4C30 A;  2Z1D A;  1R5H A;  3J7A O;  4II3 A;  3BZC A;  3LSR A;  3OOP A;  1IV8 A;  1W5S A;  2VPL A;  2FNA A;  2A07 F;  2JA6 J;  2VJ5 A;  4HOB A;  1DU0 A;  1T08 B;  2MW8 A;  4RAY A;  3F8M A;  1ZAR A;  4XSZ F;  3IKT A;  3ROU A;  4PDK A;  3JAM K;  2ECB A;  1ETQ A;  3HOS A;  1GHC A;  2R7F A;  4I01 A;  4M71 A;  1KGS A;  1Q1H A;  1HC8 A;  2FML A;  1G3T A;  2LK2 A;  3A1Y A;  1DP7 P;  2LKP A;  4RLF A;  4MEX F;  1TWC J;  2Z3Y A;  1GV2 A;  1TT5 B;  4BHC A;  2VN2 A;  1A36 A;  4AIK A;  5JHU A;  3DQV C;  1SFO J;  2A05 A;  3QQA A;  2YU9 J;  5FLX Z;  3J7Y J;  1X2N A;  1I27 A;  4DNC A;  2DA6 A;  2QZ8 A;  4BGD A;  4UV8 A;  1J0R A;  3GTL J;  1JJ6 C;  2VXZ A;  3WTT C;  1K4T A;  3HXL A;  2HFH A;  3F8B A;  1T33 A;  3W6V A;  4P1W A;  4Q47 A;  2X6Y A;  1FIP A;  1T95 A;  2B0L A;  3FXU A;  1C0W A;  3WE3 A;  3LMM A;  1MGT A;  1XN7 A;  4W1U A;  4ZC3 A;  1I3Q J;  5K5R A;  4KIS A;  3RCO A;  3EDP A;  2NRA C;  3OIO A;  3ABK H;  4QTR A;  4BUP A;  2XKO A;  3LSG A;  2D5V A;  3KZZ A;  1B72 B;  2MLK A;  2ESH A;  3K4C A;  4ESB A;  3FF5 A;  3C3W A;  2Z16 A;  1QGP A;  1GUU A;  2EA4 A;  2KMU A;  3M7G A;  4HX7 A;  3TDU C;  5GPC A;  4U0Y A;  3LAP A;  3P5J A;  5L3F A;  4EGZ A;  4BS9 A;  2HQR A;  2ZME A;  3S93 A;  1X2M A;  3DBR B;  1HDP A;  2NOJ B;  3AG1 H;  2VOP A;  3TKY A;  3L2Q A;  3QWL A;  1X3W B;  1YLF A;  2ME0 A;  2QM3 A;  4L5J A;  3S1Q J;  1XDU A;  1V3F A;  1FBQ A;  5KHD A;  3F23 A;  5KAI C;  1YJ9 I;  4A3B J;  3U21 A;  3TMO A;  3K1P A;  4BNC A;  2DLL A;  4YIF A;  2RQQ A;  3MKZ A;  4L9V A;  2XHK A;  3E0J B;  1T2K A;  2W85 A;  4DGW B;  1X1P A;  4DYQ A;  4ZZD A;  3KYD B;  5B66 C;  2STW A;  3CMY A;  3OY9 A;  2DMP A;  3H0D A;  1AA7 A;  2XF5 A;  2EFP A;  3LSH A;  1MH3 A;  1IN5 A;  1TBX A;  1JKR C;  3B73 A;  3EUK L;  4KN4 X;  5JLW A;  4MQ9 F;  4HNV A;  4C3I J;  3CUQ A;  5CVI A;  1ZQ3 P;  3OYL A;  4S04 A;  2M4K A;  3AL0 C;  1UHM A;  2LF8 A;  1S5L C;  3F6O A;  1YOV B;  4MNU A;  3RQ4 A;  3KFW X;  4A12 A;  1CF7 B;  4PZJ A;  3RPU A;  1J5Y A;  1PP8 F;  3CCQ I;  2HZT A;  2LBF B;  1KON A;  4CDG A;  4N4O B;  4A3J J;  2XPW A;  2DK5 A;  3S17 J;  4XOP A;  1U5T B;  1R7J A;  3GFI A;  2JA7 J;  1D0Z A;  1ODD A;  3HSR A;  1JT0 A;  2IS6 A;  1Y6I A;  9ANT A;  3RIR A;  5EJC A;  5D4S A;  3FXL A;  2OTL I;  3BLY A;  4HV5 A;  4M3B A;  5FKO A;  2FSW A;  2MH2 A;  5J1Y A;  1IW7 F;  1D8K A;  3ESW B;  1VQM I;  4WX9 A;  3ZMS A;  3TO7 A;  5E17 F;  3KLO A;  4IRI A;  4AUX A;  3KEQ A;  4DZJ A;  1SAX A;  1MBH A;  2OD5 A;  3FIW A;  1FOX A;  3I53 A;  5M5Y J;  3J7A Y;  2BGC A;  3WTX C;  3VB2 A;  4HZF A;  1Y39 A;  4ZYD A;  3S1R J;  1YX5 A;  2OBP A;  4B43 A;  4DBR A;  2VL8 A;  1MMG A;  4DIQ A;  4EJT A;  4XLC A;  1H9T A;  2GLO A;  4FE7 A;  3BC8 A;  4IRH A;  1IG7 A;  3FKI J;  1YG2 A;  2ZXI A;  4XN3 A;  5HOO A;  2L2O A;  4XNF A;  1A6Q A;  4N9I A;  3VWB A;  3S16 J;  2R93 J;  2IGK A;  3GUD A;  3HC7 A;  3LAJ A;  1P4A A;  1R9T J;  4XLE A;  2QSG X;  1PDN C;  1EH7 A;  1QZE A;  3F3X A;  4BQQ A;  4XRF A;  3LSI A;  3MQ0 A;  3ZMT A;  5LEK A;  1FYK A;  1AOY A;  2HYJ A;  3S8P A;  1A35 A;  4EVI A;  1K79 A;  5BMZ A;  1X1A A;  1OYI A;  1TWH J;  2J5P A;  2Y48 A;  3H5A A;  4U0W A;  3JTG A;  4N9H A;  3VYR B;  1P2F A;  5K1Y A;  5KVR A;  1WFX A;  3ABT A;  1ETO A;  1LVK A;  3KZY A;  2DMU A;  1GVD A;  4LG0 A;  3CMA I;  3DKW A;  2LKS A;  4Z6Y A;  1G6N A;  3EYY A;  2QSF X;  3ZQH A;  3OOU A;  2LG4 A;  1Z05 A;  2QUF A;  2JPC A;  2YSR A;  1IGN A;  1VND A;  1XDS A;  1W0U A;  1O4X A;  3W2V A;  2QBY B;  1MBG A;  1ZYR F;  2WY8 Q;  4EM1 A;  4H0E A;  2AXL A;  2IEK A;  5J3L A;  2E2I J;  4YG2 F;  3J81 Z;  1YJN I;  1PUE E;  3DPL C;  3DP7 A;  1FTZ A;  3PIP F;  5TRD A;  1MD0 A;  1OCR H;  2OPT A;  2A61 A;  3FWE A;  2HOT A;  4E7J A;  3F9K A;  3J80 K;  3DU6 A;  5KAF C;  4Y3O A;  1IUF A;  2V1D A;  2HR3 A;  2NS8 A;  4UB8 C;  3QU3 A;  5J47 A;  2F5E A;  2VKE A;  4KFC A;  2COB A;  1LJ9 A;  2DFE A;  1ETY A;  3R6S A;  2QLZ A;  3U9G A;  1HKS A;  3LWF A;  2LDU A;  1IZ1 A;  2OQR A;  1APL C;  1Z9C A;  4D5C A;  1XSX A;  1G2H A;  5H6R A;  1R49 A;  3BTL A;  3HKZ A;  3TOA A;  5IP7 J;  4XL9 A;  1E3O C;  3PNT A;  3QYF A;  1DUX C;  2DDB A;  3ZMV A;  2CG4 A;  3IRQ A;  3WE2 A;  4DYR A;  1O57 A;  3FXK A;  4E4H A;  3ZQQ A;  3H36 A;  2E2J J;  4CCJ A;  3QYE A;  1S72 I;  2DQL A;  4M3G A;  4UVB A;  1OYW A;  2JSP A;  1RPW A;  2FRH A;  2ZME B;  1EJ9 A;  2Y75 A;  3DEU A;  1FSE A;  2Q8K A;  2E1N A;  2BY1 A;  2LD5 A;  3HHG A;  3A01 A;  3IV5 A;  1ZGA A;  5GPA A;  2HGC A;  2BY3 A;  2UZK A;  3OYC A;  3VOD A;  5E18 F;  4HDU A;  4B8X A;  3QYB A;  3DXJ F;  4TV7 A;  3BCA A;  3U1D A;  4OIQ F;  1QQI A;  5C4J J;  3V7R A;  3SQN A;  2WAF A;  2XAG A;  2HQ5 A;  1XMA A;  1KU3 A;  2P6T A;  2QSH X;  1ETV A;  2OZU A;  2LYC A;  3LFU A;  2E19 A;  3DEE A;  4HEA 2;  1X4O A;  4IL6 C;  4IHS A;  1V5F A;  1W36 D;  3PUF A;  2W48 A;  3F0C A;  3TBI A;  2XGC A;  3PFI A;  3G2B A;  2KIF A;  2UUZ A;  1PJR A;  1ORK A;  2VT3 A;  4MHG A;  4L0Y B;  2LY1 A;  1F4K A;  4AIH A;  3CUQ B;  3BR6 A;  3KE2 A;  3I4N J;  4CA0 A;  1WI3 A;  4L5E A;  2Q0O A;  3VSK A;  4PJ0 C;  1KQ9 A;  5F6F A;  2ECC A;  4GXO A;  1RKW A;  2ETH A;  4JX5 A;  3ZXS A;  3CCM I;  4MLO A;  2XGX A;  3CP2 A;  2IT0 A;  2JK3 A;  4IHT A;  3WHB A;  1ON1 A;  2DW4 A;  2G0E A;  2NVU B;  2CUF A;  4OIO F;  2L5Q A;  4I7H A;  3ZR8 X;  2E71 A;  4GRI A;  2EZH A;  5HS7 A;  4ZDO A;  4QWQ A;  5IT9 Z;  3H3Z A;  2M30 A;  2QQ9 A;  1VQP I;  3BR0 A;  5EEA A;  5B1B H;  1XGO A;  3FM3 A;  3EYI A;  2XB0 X;  2CSO A;  4LB5 A;  2KDO A;  1TQP A;  3P9C A;  2OF7 A;  5FO5 A;  3CD6 I;  4GO1 A;  2UXX A;  1DQU A;  3KP6 A;  2XRL A;  2JVH A;  3DBL B;  2W84 A;  3IAM 2;  2L54 A;  4LJZ F;  5ICF A;  2EWN A;  4YII A;  2W7N A;  4EAT A;  3BJO A;  2VKH A;  2XIG A;  3CUO A;  2FUG 2;  3BR2 A;  4MFE A;  4E7S A;  2E1M C;  3SDB A;  3HEF A;  3DPU A;  4HDV A;  3BTI A;  3MKW B;  2QKL B;  3PFY A;  2JTV A;  4BEH B;  1B4A A;  2FBH A;  4BE0 A;  1NK2 P;  2JUC A;  1UEL B;  3S3O A;  2M0M A;  2BYV E;  3BP8 A;  2A6E F;  2O0Y A;  3U1K A;  2PMZ N;  2EBI A;  4BAY A;  3CDL A;  2M7B A;  1SVO A;  3WHC A;  4ZTF A;  3OMY A;  3WTW C;  2GZW A;  1HW1 A;  4PGG A;  3BY6 A;  2WBM A;  1U2W A;  2YX7 A;  2FF4 A;  5JLX A;  1UCR A;  1W4M A;  2KHM A;  5E20 A;  1H88 C;  4OOI A;  2HQN A;  1TWG J;  4LIV A;  1MNE A;  3QPL A;  2JSC A;  3TGN A;  5HLH A;  3LQR A;  3VYU B;  3CCY A;  3CJR B;  5LHH A;  3UKG A;  1NG6 A;  3OR2 C;  4QLC U;  5FJ8 J;  2HOS A;  4OIP F;  4DOZ A;  4K2E A;  1H9G A;  4HX8 A;  2ELH A;  4KDP A;  4MQV A;  4BHP A;  4IEJ A;  5FFX A;  3HIF A;  2M8G X;  3LSJ A;  4LG0 B;  4MTE A;  3ZCO A;  2EIK H;  4XLA A;  1PUF A;  2W00 A;  1TW2 A;  3E5X A;  2VXD A;  1VQ7 I;  2Y9Z A;  3FXJ A;  3GCM A;  4HNT A;  3CCV I;  3PJR A;  2X1D A;  3A0H C;  3F72 A;  3Q3S A;  2IRF G;  3DU5 A;  1FX7 A;  4MGR A;  5TIS C;  2GA1 A;  4U87 A;  1NG7 A;  2HKO A;  2NVX J;  4A3D J;  2V1N A;  4P55 A;  2XPV A;  1SAU A;  3NRV A;  3JW4 A;  2Y0M A;  5IT3 A;  2K7L A;  2YR2 A;  3WU0 A;  4YFK F;  4LG3 A;  1HST A;  2FA5 A;  2PI0 A;  4M3E A;  2HXI A;  4F91 B;  1J2X A;  3HRT A;  1P7I A;  2BY0 A;  3AFH A;  5E1X A;  4BQN A;  4C2T A;  1SMT A;  3QOD A;  4BKX A;  4HG2 A;  1YRN A;  3MZ8 A;  3KPH A;  2BXY A;  3VYT B;  1ZK8 A;  5LHI A;  4XKC A;  3M8F A;  1TT0 A;  2X48 A;  5LGT A;  5DV5 A;  2NOG A;  4A0Z A;  4ZYH A;  4B3X A;  3H3U A;  1H0M A;  3HOT A;  1KQ8 A;  4XR6 A;  4N0B A;  1OR7 C;  1FOK A;  2K9M A;  1XGS A;  2K9S A;  3I64 A;  4UUT A;  3IC7 A;  5GTI C;  3IL2 A;  2I5U A;  4IHY A;  2YS9 A;  1T38 A;  4KMF A;  4CGZ A;  4BH9 A;  3B6A A;  3OYH A;  1W36 C;  5CKT A;  2ZSH B;  2XC7 A;  3AG4 H;  5DCM A;  1Z7L A;  2LSO A;  5E3N A;  3JCU C;  4KNY A;  2CFX A;  2BVL A;  2XPU A;  2VOD A;  1HF0 A;  4FX4 A;  1RIO H;  3DWL E;  2V6C A;  2KQR A;  2CV1 A;  1XGN A;  5FRM A;  4EM2 A;  3GVA A;  1UHW A;  5CVU A;  4XLF A;  3LFK A;  5A2Q K;  2JN6 A;  4AID A;  4M73 A;  2CMP A;  1LEB A;  3BG6 A;  1BI1 A;  3FHZ A;  3E6C C;  2AQF A;  4GDF A;  5E8G A;  3GLX A;  5D4R A;  2VQG A;  2Y30 A;  3SFZ A;  5L3C A;  2E1C A;  1OJL A;  3CJQ B;  2KIQ A;  4CZC A;  5AON A;  1HDD C;  4BU2 A;  2M9H A;  2EV5 A;  1RKT A;  3BJA A;  4BQO A;  3NWS A;  3Q0W A;  2JA5 J;  4WK8 F;  4KUM A;  2RAE A;  2WAQ N;  2E2H J;  4PSX A;  4HAM A;  2VAS A;  2VC0 A;  1FBS A;  3ZPL A;  1BR2 A;  4J01 A;  1ZR2 A;  1Z6T A;  2FOW A;  3O8H A;  3T8R A;  3WG7 H;  1OCT C;  4YEL A;  3I4P A;  2A5W A;  4LMY A;  2DN0 A;  2VJ4 A;  4MO7 A;  1J59 A;  1U0J A;  5C44 J;  1U8B A;  1U5T C;  3H35 A;  2GIZ A;  5J4V A;  2FQ3 A;  1BJZ A;  4BY1 J;  3KZI C;  4HPQ A;  1R22 A;  3K4L A;  2NYX A;  4AU7 A;  1D5V A;  2IPQ X;  3KP4 A;  4PJN A;  2DMT A;  3T1B A;  1MND A;  4KIC A;  2VBZ A;  4X0G A;  3S32 A;  2LF7 A;  4OAY A;  4XID A;  2PJR A;  2H94 A;  5DUK A;  3RKW A;  1LDJ A;  2WAD A;  1WHU A;  1MNM C;  2LBF A;  2XDV A;  1IO2 A;  3IP4 B;  4G7O F;  3CO7 C;  3RPU D;  1HBX G;  2HU9 A;  4I6Z A;  3DBH B;  4LLG F;  5IP9 J;  2TCT A;  6PAX A;  4CUG A;  5LBQ A;  4G6T B;  4AIJ A;  4OMY A;  4BXX J;  2KP6 A;  5CPR B;  1M1E B;  4C9Y A;  1X3Z B;  2ZCW A;  2PMH A;  1OIS A;  1U6G A;  1SFX A;  2W24 A;  4M9Z A;  1BI2 A;  2UXN A;  1W5T A;  3GO5 A;  4DBQ A;  2DU9 A;  3BR5 A;  2VBY A;  5D8L B;  2ACJ A;  1KU2 A;  2EZL A;  3K6G A;  2HDD A;  2LH9 A;  1LQ1 A;  1ZGW A;  2DA2 A;  3HTU A;  3SZG A;  5H2F C;  2GA2 A;  3OS1 A;  2R4G A;  3A2K A;  2FXA A;  2Y0S N;  1YFH A;  4G8X A;  3KEY A;  4XLN F;  2VJJ A;  2A68 F;  3L09 A;  1D5Y A;  5LEJ A;  1FY7 A;  5BS6 A;  1ENH A;  2R7X A;  2CUJ A;  2CUZ A;  2DJI A;  5M5W J;  1Z21 A;  4ITV A;  4AC0 A;  4UUS B;  5BPI A;  1OFC X;  5EDN A;  1SFE A;  1H89 C;  4PJM A;  2OCC H;  4FAS D;  2B63 J;  4V2G A;  1Y0U A;  1O3Q A;  1R36 A;  3EUA A;  4I99 C;  4ENN A;  2O61 A;  1DPU A;  2KPM A;  2XRO A;  2MD5 A;  5B1A H;  3F8F A;  3DTI A;  4EJV A;  3KCC A;  2R7W A;  2P5L C;  2FD5 A;  1QA6 A;  2DFI A;  2EIN H;  3V7C A;  2IA0 A;  1MMS A;  4IF4 A;  4A0X A;  4U0V A;  5IOY A;  1YRN B;  2QBY A;  1P9Q C;  3O6B B;  2CW8 A;  1R4M B;  1R5G A;  1ZR4 A;  3RPQ A;  1XCB A;  2M8E A;  3W2A A;  4ENJ A;  1JJ8 C;  4IHX A;  3R61 A;  1KQ0 A;  1Z6R A;  2BXZ A;  2HPI A;  4HF2 A;  4CHU A;  4WXD A;  2H8R A;  1DPR A;  1T0F A;  3PO2 J;  1XC5 A;  4JBA A;  1OCP A;  4RM3 A;  1TC3 C;  2WC2 A;  4XM3 A;  3H0G J;  3FKJ A;  4XSX F;  1P4W A;  4RBO A;  5DCM B;  1UHS A;  1XD7 A;  2ZME C;  5FD5 A;  3VYS B;  1BIB A;  5GTH C;  1FNN A;  1YS6 A;  3IRR A;  2DA7 A;  1TW3 A;  3GTQ J;  4AVZ A;  3N4M A;  1XPX A;  4AYB N;  5IOZ A;  4YFX F;  4WWC A;  2VBW A;  2DXI A;  1S7O A;  1VQ8 I;  3QP6 A;  3LA2 A;  1WJE A;  2DMQ A;  3S1M J;  2MGQ A;  4G9Y A;  4DZP A;  2ELK A;  1YHQ I;  4XON A;  5HDG A;  1WZ2 A;  3KYC B;  2KRH A;  4CYC B;  1XGM A;  4XOT A;  3PIO F;  3GTM J;  3V7S A;  3MWM A;  1BW6 A;  2DCE A;  3ZMZ A;  3S15 J;  4A69 C;  1FOY A;  2E7W A;  2P4W A;  2XAU A;  1LB2 A;  3M8J A;  2VQH A;  3OSG A;  5F1J A;  1QU3 A;  2L4A A;  4YRV A;  3HRM A;  4IJA A;  2L9V A;  2F5V A;  2FOK A;  3CUQ C;  2JVG A;  1WKM A;  3AG2 H;  4HF1 A;  5J1U A;  2L4M A;  2YPR A;  4ESF A;  3T8T A;  4U88 A;  4A5M A;  3F8N A;  1X1D A;  1NK3 P;  2AQE A;  2CV2 A;  4GGG A;  1WJ5 A;  3TO6 A;  1JUP A;  2DOA A;  1QZZ A;  1O3R A;  1JGG A;  4AWX B;  4G7Z F;  1RNL A;  2PLY A;  5HVQ C;  2QYO A;  1VQO I;  1T39 A;  3PNV A;  4NC6 A;  2EFQ A;  5DUI A;  3WGI A;  2QF7 A;  1Z7U A;  4YFN F;  2PJR B;  4JOM A;  1WPK A;  2ZNY A;  5LD2 C;  5E8I A;  2L7Z A;  5IYD J;  3BRO A;  2O9L A;  1IDY A;  2X51 A;  3N05 A;  2NXN B;  1WI9 A;  3I58 A;  1E2X A;  5F1R A;  3GXO A;  2BW3 A;  1IRZ A;  3HYI A;  4IQJ A;  1IN7 A;  5DM7 F;  2DYS H;  2M87 A;  3TO9 A;  4A3K J;  2QQB A;  3E6D A;  4JYK A;  3IWZ A;  3BQZ A;  4X1E A;  1AU7 A;  2KLO A;  4A3G J;  2E5N A;  1ZLJ A;  3W6K B;  5CVV A;  1WRJ A;  3K7A J;  4D9J A;  2LR8 A;  2XAF A;  2W57 A;  4EM0 B;  2L01 A;  2P8T A;  4FCY A;  4C3J J;  4KMU X;  4OIN F;  2GXA A;  2EB7 A;  4PK4 A;  1LDK B;  2K27 A;  4Y4R A;  5AIQ A;  3F22 A;  1QBJ A;  1YYV A;  3FXM A;  1FYL A;  4BEH A;  1JHH A;  2CFO A;  2R7O A;  1F43 A;  3PNY A;  5LLQ A;  1BI0 A;  1XS9 A;  3HOW J;  3L2W A;  2Z33 A;  2ZXJ A;  3FXQ A;  3MKL A;  3P9I A;  5LGN A;  2JA8 J;  2LRD A;  3Q0V A;  4UUV A;  3CF5 F;  3GYH X;  1XMK A;  3SHF A;  3CCR I;  3GBG A;  5EZH A;  2XUB A;  3CDI A;  2ICW G;  4YIR X;  5F0F A;  3TW7 A;  2YUS A;  1SMY F;  4MFD A;  3BG3 A;  4CCK A;  1O7L A;  2GXB A;  1RRJ A;  1I3A A;  1YJW I;  1O3S A;  2KKO A;  2M1B A;  2Z5U A;  1MMD A;  1IRF A;  2HVS A;  3SXY A;  4G94 A;  2STT A;  3BZK A;  2XGE A;  1UST A;  3HZJ A;  2X1C A;  1MJA A;  3HG9 A;  5F08 A;  4M3F A;  5F27 A;  1JGS A;  3L9F A;  3FM5 A;  4DW6 A;  1Z0X A;  2FX0 A;  2E7X A;  5F64 A;  2GXG A;  3RKY A;  3RI4 A;  2BOL A;  3QPT A;  1ETX A;  3RKQ A;  1ZHF A;  1Z3Y A;  2E1O A;  2C6Y A;  3HUG A;  3BTC A;  2FU4 A;  3PSI A;  1HA8 A;  1N75 A;  3G73 A;  4OU0 A;  2PX9 A;  3ZQF A;  2NAZ A;  1VI0 A;  5C3E J;  3FZV A;  4FX0 A;  1HKT A;  3COA C;  4KT6 A;  1GT0 C;  1UZC A;  5J6X A;  2RNJ A;  2ZFU A;  5EF6 A;  2HKX A;  3IH4 A;  1VQK I;  3FHN A;  4RM2 A;  3DTE A;  3G1L A;  4LB6 B;  3K2A A;  1IN6 A;  1I5Z A;  4RAG A;  2LKX A;  5CLS A;  3K4B A;  4GYG A;  2BHY A;  1F5T A;  1MJ9 A;  3M3Y J;  4J00 A;  2DOE A;  5JR3 A;  2CUE A;  2K3F A;  3CC7 I;  1Q1V A;  3E6M A;  2KIU A;  2F5D A;  2W25 A;  2W4S A;  4C3H J;  1ZRE A;  3SJM A;  3CCU I;  3DCF A;  4PCQ A;  1R4N B;  2IGN A;  1JUS A;  5CYV A;  1K78 A;  4S0H B;  1BM9 A;  1JKP C;  4QIW N;  4HNU A;  1FPQ A;  2EV6 A;  4IHV A;  2R92 J;  4IHW A;  2F4I A;  5ICG A;  3G1O A;  2RC4 A;  3FX3 A;  3JRI A;  2TRT A;  5HDK A;  2QCO A;  1K6O A;  2LRE A;  1ZTR A;  1Z91 A;  1WWX A;  1S8N A;  2K4J A;  4I2O A;  2OQG A;  3LSK A;  4FQG A;  2DK8 A;  3ZQL A;  2G7H A;  1QO0 D;  1V5G A;  2CS3 A;  2JRT A;  4CCO A;  3OYF A;  1WH5 A;  3HGG A;  4UV9 A;  2XV4 S;  4XMY A;  4JX6 A;  4ZJZ A;  2R7T A;  4C2M J;  2KZG A;  2FMY A;  3S2W A;  1BC7 C;  2GQQ A;  3H9G A;  2IS2 A;  1P6R A;  4G6Q A;  3FBI B;  2DMN A;  4XOR A;  3HSF A;  4ABZ A;  3HBL A;  5ILU A;  4Y13 A;  4KIB A;  3FXO A;  4XK4 A;  5ICE A;  1FBU A;  1BI3 A;  2X0L A;  3K69 A;  4A2U A;  4CCL A;  2ZXH A;  3CJN A;  3BDD A;  1QVT A;  2M2E A;  1W5C C;  1XG1 A;  2V9V A;  3GFL A;  2RQP A;  2CRG A;  1S9H A;  4BE1 A;  3WGH A;  3BWG A;  4N4N B;  4II2 A;  2VKD A;  3ABM H;  2AHQ A;  4E6K G;  2ZSI B;  2E60 A;  3L1P A;  2QKM B;  3O8G A;  1VQ4 I;  4XKV A;  2MG4 A;  1FMV A;  4AD9 A;  1FTT A;  3C18 A;  3JRA A;  5DDG A;  5L3E A;  1I6X A;  3R4K A;  4BHB A;  2IGM A;  1X1C A;  5FFZ A;  2PJP A;  5FLX K;  2CWE A;  3MEX A;  2KJB A;  5DYM A;  2BW3 B;  1VZ0 A;  2V1X A;  5E3O A;  4A6E A;  3OL4 A;  4KN7 X;  1B1B A;  1ZGJ A;  2J5O A;  5IYC J;  1MSF C;  1BIA A;  1RUO A;  2IGO A;  2DPU A;  3BTJ A;  2PMZ A;  4WXH A;  1S29 A;  2FBI A;  5HNF A;  4B48 A;  4OAZ A;  3GTG J;  3CP8 A;  5JVT A;  1ITY A;  2ZBK A;  2JRM A;  3DLA A;  2EH3 A;  1SFK A;  1TZL A;  2G7U A;  2X4H A;  3KYL A;  1MJB A;  1SVM A;  2WY7 Q;  1ZKG A;  2ME6 A;  2VE9 A;  1YI2 I;  1D1C A;  2L02 A;  2M3A A;  3SEQ A;  4EGY A;  1U3E M;  3JRC A;  3ZOB A;  1AHD P;  3ZRG A;  1OQY A;  2R7D A;  2VLA A;  1UAA A;  3GTP J;  1MH4 A;  5H6Q A;  5D6E A;  5EGO A;  2JJ7 A;  4RS8 A;  1B9N A;  3JAM Z;  4PFO A;  1W1W E;  2KFD A;  2XAQ A;  5GP9 A;  3K4N A;  5HS9 A;  4ZYG A;  3ASN H;  4ENM A;  3ASO H;  5HS8 A;  4P9U A;  4YEJ A;  1MDM A;  5K7H A;  1JTY A;  2L9S A;  1W7P A;  4EQQ A;  3K1N A;  4V2F A;  5LHG A;  5J8C A;  1FJL A;  1YS7 A;  2EZI A;  3M07 A;  1RET A;  2BEO A;  2H6C A;  2NNY A;  4O3M A;  4ETS A;  5HOD A;  1WJC A;  2ZB9 A;  2P81 A;  1S3J A;  2R7S A;  3Q9S A;  3MCZ A;  4BBR J;  3GTO J;  3W3C A;  3OYE A;  4D5F A;  5CJ9 A;  4HV6 A;  3IH3 A;  3KLN A;  3M8E A;  1YIO A;  3G3Z A;  2N8G A;  3OV8 A;  1U78 A;  3MAJ A;  1K6Y A;  1FP1 D;  4I0A A;  1WH7 A;  4IXA A;  3HUG B;  2EQR A;  1I1G A;  1KA8 A;  2FQ4 A;  2DT6 A;  4Y17 A;  1BJA A;  4CSW A;  2M45 A;  1HOM A;  3BG9 A;  5JHF A;  2KRC A;  4BDY A;  5M5X J;  4UUS A;  3GW2 A;  2RRE A;  2IP2 A;  1NH3 A;  5M3F J;  3HPG A;  2R5Y A;  2GWR A;  2RGV A;  4M6V A;  2LFB A;  2GBY A;  2K86 A;  5M3M J;  4U7D A;  3PO3 J;  1YIJ I;  2NS7 A;  2WA0 A;  2L7F P;  4HBL A;  1FLI A;  1K61 A;  4L9J A;  2HPM A;  1VTN C;  2BBY A;  2F5C A;  1DU6 A;  2ADU A;  1Z77 A;  4LK1 F;  3ISP A;  4M6Y A;  2WB1 A;  3BOQ A;  2I8D A;  3V8K A;  3ZMD A;  1IV6 A;  2CH0 A;  1I39 A;  2F48 A;  3PUB A;  1B9M A;  1DGR M;  1GVJ A;  1L0O C;  2R5Z A;  2JA2 A;  4D1Q A;  2DTR A;  4O5V A;  5L3B A;  2VB6 A;  4B4C A;  1K78 B;  1BN5 A;  5HLG A;  1EV7 A;  3CCJ I;  3WOD F;  2OUM A;  3EUH A;  3LA3 A;  4BQA A;  5CVR A;  2OCE A;  4XLP F;  4NNJ A;  3ZQ7 A;  1BL0 A;  4I76 A;  5IPA A;  3OYM A;  3TOB A;  2MAB A;  2OAZ A;  2Q2E A;  3BG7 A;  2ESN A;  2MH9 A;  2V79 A;  2D1H A;  4Z2Y A;  3WG9 A;  3W6J B;  3P7N A;  1BC8 C;  3S1N J;  2O7O A;  3SYT A;  3CLQ A;  1RUN A;  2IVM A;  5F04 A;  3HOX J;  4JP0 A;  2Q1Z B;  1OYY A;  3NAU A;  3TDZ C;  2HDC A;  2IS4 A;  4JK1 X;  3Q9V A;  1OCO H;  3HTS B;  1LFB A;  4RLQ A;  4A0Y A;  2WAQ A;  4A3I J;  2OZ6 A;  2HXO A;  2ISY A;  3ML6 A;  2GM4 A;  4JX4 A;  1E17 A;  1GDT A;  4G7H F;  5DS9 A;  1WGX A;  4HQE A;  3BPV A;  3IUO A;  2KJC A;  1WJA A;  4CYC A;  3F21 A;  1X4P A;  4L0Z B;  4EJW A;  3N97 A;  3MD2 A;  1OKR A;  2JZY A;  3QPS A;  4Q5S F;  4Y33 A;  1JHF A;  1REP C;  1IDZ A;  3CME I;  2RVC A;  1TNS A;  1Y0N A;  5E3M A;  4RGU A;  2F4O B;  2ZNZ A;  4PJJ A;  3V42 A;  3GEZ A;  4ZDP A;  4F3Q A;  2K9Q A;  1QZY A;  2HYF A;  3J81 K;  1R71 A;  1MKM A;  4LFU A;  2F2E A;  3FXR A;  4XRM A;  1B6A A;  4I0B A;  2Y2Z A;  3C2G A;  4CIC A;  1JKO C;  4A3L J;  2JPB A;  4NB5 A;  4CCM A;  2OC6 A;  4O6J A;  2FEZ A;  4NC7 A;  4Q48 A;  5J4Y A;  1DGW Y;  1R00 A;  2CQQ A;  2LOO A;  4IKF A;  5CQG A;  1ZG5 A;  3D0S A;  3I59 A;  3C1D A;  3D5L A;  1MBF A;  2ZJR F;  3BPX A;  4ON0 A;  1ON2 A;  2XAJ A;  4HSR A;  3GZ6 A;  1RZ4 A;  2PFB A;  5FRN A;  3SZT A;  2MLG A;  2KDZ A;  3R0J A;  3HOU J;  1HQC A;  4XIC A;  4U7B A;  1KU7 A;  1B8I A;  1TLH B;  4E7Z A;  1SD6 A;  5FGM A;  3C2H A;  1POG A;  3SZP A;  1BA5 A;  1NHA A;  3ABU A;  3TL4 X;  5EGO B;  3QU6 A;  2VON A;  1X3U A;  4ZH4 F;  1ZLK A;  1CGP A;  4RGX A;  4D7M A;  1PYV A;  4L9T A;  4B44 A;  3ONQ A;  5IY5 H;  4Q4Z F;  1MDM B;  3S2H J;  5CQE A;  2R7V A;  4HLY A;  1W7P B;  3FMR A;  1U9N A;  1IXC A;  2Y0S A;  2L7K A;  1IC8 A;  3FBN B;  3E6B A;  3QOP A;  3OYN A;  1HXD A;  1F36 A;  3LL7 A;  3B6C A;  1RR8 C;  5HNH A;  1VQ6 I;  5LFA A;  4Y15 A;  4CYD A;  3HDD A;  1EH8 A;  1G3S A;  3WTZ A;  4R79 A;  1SD7 A;  2JMW A;  2XRN A;  4PSW A;  1EKE A;  3J80 Z;  2DO7 A;  2QQA A;  3T5X A;  2G9W A;  4UXN A;  5D5W B;  1YIT I;  2WAE A;  5J40 A;  1W0T A;  2PEX A;  1V55 H;  3WU1 B;  2XB5 A;  2QQ8 A;  2P5K A;  1JUM A;  1U8R A;  3REO A;  3RYR A;  1ACI A;  3GFM A;  4GCV A;  3ZP5 A;  5DTD A;  1UFM A;  3CLO A;  3CC4 I;  3EQL F;  2CO5 A;  1LVA A;  1YW7 A;  2Y69 H;  1R5I D;  4MTD A;  1YW9 A;  3L2C A;  4B1R A;  1XX5 A;  4ZDL A;  3CDH A;  4XKB A;  3RTR A;  1XTA A;  4CO8 A;  1D3Y A;  2R5Y B;  4HST A;  1P4X A;  2A6H F;  1Z1D A;  1DDN A;  3S2D J;  1O7F A;  4PUS A;  5IT9 K;  4V19 K;  2ZO4 A;  1I1S A;  1I6H J;  4M9X A;  1Y1V J;  1ZRD A;  2BVM A;  1P7J A;  3RZO J;  5E79 C;  1T0F C;  2HTJ A;  2I10 A;  2M34 A;  4QPQ A;  4NQW A;  1R6R A;  4IZZ A;  3G71 I;  4XQF A;  1QPM A;  3HHH A;  1JI8 A;  3JRH A;  5EEH A;  5HLI A;  3L2R A;  1F9N A;  3K70 C;  2L9R A;  1TTY A;  1ZG1 A;  2R5Z B;  4F7Z A;  2A3S A;  3K9T A;  4AYB A;  4LLN A;  1R58 A;  3S14 J;  5J8F A;  4L18 B;  2O03 A;  1YW8 A;  3RKX A;  4DJA A;  1A04 A;  4BL0 B;  3UNG C;  1V54 H;  4XRS G;  1FC3 A;  4A93 J;  2Q2E B;  3I3L A;  3KET A;  2JT1 A;  3OS2 A;  1D1A A;  3IAS 2;  1KYZ A;  2H8W A;  3A0B C;  2MBF A;  3ECH A;  2UV1 A;  3Q5F A;  3F6V A;  2DI3 A;  1R1V A;  3RQI A;  2DOF A;  3IH2 A;  1KZH A;  5BOX A;  2HWV A;  1Y8R B;  1J09 A;  1Z67 A;  2P5V A;  2HVQ A;  3OIQ A;  3BQY A;  3FMS A;  2VQC A;  3FDY A;  1V4R A;  4D0P A;  3AAF A;  5FKK A;  3GX4 X;  3DPT A;  4Y7N J;  3K4K A;  4IRG A;  4XLH A;  1IXS B;  3IWF A;  1FWZ A;  2IS1 A;  1BOA A;  2VUM J;  2VKV A;  1BW5 A;  3I54 A;  1VQL I;  1R23 A;  3D1N I;  4RA2 A;  4H4K C;  2ZJQ F;  3FK6 A;  2W82 A;  1Z3X A;  2H09 A;  3FMQ A;  4RB1 A;  4RDU A;  1IUY A;  2EIJ H;  5D5U B;  2BV6 A;  2WV0 A;  2XF6 A;  2XSD C;  3V8J A;  2CJJ A;  2V9P A;  3FIS A;  2RNG A;  1HCR A;  2HYG D;  3GME A;  1T56 A;  4ZYE A;  3BZ6 A;  5FB2 A;  2VC1 A;  4IQ4 A;  3E1S A;  4A3F J;  1JE8 A;  1HSJ A;  3TED A;  1TL8 A;  3R60 A;  2Y9Y A;  2P7C B;  2CQK A;  3J7Z I;  2V1U A;  2CQ7 A;  3CJT B;  2BY2 A;  1ZRF A;  3I4M J;  4LIU A;  3I9V 2;  1D0Y A;  2YX4 A;  3EET A;  2CQN A;  4M6X A;  2M0C A;  3DFG A;  3I71 A;  1LFP A;  2R7R A;  2EIL H;  2R3S A;  2Z9O A;  1E3P A;  2ID6 A;  1OMI A;  1H8A C;  3I59 B;  4RAF A;  1IF1 A;  4ASN A;  2CW7 A;  3ZN1 A;  5GAD J;  2B7E A;  1VF9 A;  2PG4 A;  3VEP A;  2R7U A;  3OYJ A;  1L3L A;  4P9F A;  2XKP A;  3E5Q A;  3H5N A;  1TWA J;  1UJ8 A;  4XBF A;  4UY8 I;  5E3L A;  3A02 A;  1B8I B;  2D2W A;  1Y8Q B;  5D5X B;  3CCE I;  1X19 A;  2TDX A;  3OWT A;  4RB3 C;  3H3V K;  3IHU A;  4BXU A;  2ELJ A;  5LRR A;  3LA7 A;  4B47 A;  2VPR A;  1IRX A;  3CTA A;  1QPI A;  3GF2 A;  3GZN B;  3JRF A;  2F4M B;  1FZP B;  4I98 B;  5FD6 A;  3TP0 A;  2H27 A;  3BJ6 A;  1STZ A;  2R0Q C;  2KZV A;  2NVY J;  1RES A;  5DCF A;  1Y56 A;  2K4B A;  1OPC A;  4FTH A;  1QHG A;  2K9L A;  2PBI A;  4HLX A;  3M1C A;  1MIJ A;  5ILS A;  2KL4 A;  4J19 A;  2DA4 A;  2LP0 A;  3CQZ J;  3WTU C;  4QSH A;  4L9N A;  4IX7 A;  4XRS A;  3I0T A;  1X58 A;  1N25 A;  3I56 I;  4UHT A;  1IRG A;  2Y31 A;  4LGW A;  3OR1 C;  5EG0 A;  4KA4 A;  3K2Z A;  1SFU A;  5DD4 A;  3JRG A;  3OL3 A;  4BE2 A;  4PGH A;  4E7I A;  2LLK A;  5IP6 A;  1XMX A;  1S7A A;  3BG5 A;  1WQ2 A;  3VFZ A;  3K0L A;  3ULQ B;  5K7Z A;  1W7P D;  1RC9 A;  2KIS A;  4CCN A;  3CZ6 A;  3GZ5 A;  1MBE A;  2A6T A;  3OYB A;  3CCL I;  3MZH A;  2FBK A;  4P5O A;  5EEG A;  3ERM A;  5FKN A;  1X1B A;  2OA4 A;  1LUJ B;  4EEF G;  1D0X A;  2K9N A;  4A3M J;  2H1K A;  4FE4 A;  3MFK A;  3E7L A;  5EYR A;  3HGY A;  2JUG A;  2MSY A;  3JSO A;  2EFW A;  3L7W A;  4KIT B;  2DT7 B;  1USS A;  2X6X A;  3LSP A;  4E7K A;  3SFI A;  3E3V A;  3OYI A;  1CQT A;  4RAZ A;  4KIF A;  1JTX A;  4NQW B;  5A2Q Z;  4C2U A;  1SAN A;  2OJE D;  2D1V A;  3KP7 A;  4NHJ A;  3CF2 A;  3F8C A;  2LC2 A;  2MYS A;  1JKQ C;  3L2U A;  1P92 A;  1TQI A;  1WJF A;  3G1M A;  3QOE A;  4LOC A;  2QGU A;  1BBY A;  1K4S A;  4CXF A;  3H9J A;  2X9D A;  2IW5 A;  2XAS A;  4RB0 A;  5ICC A;  3K4M A;  5K7F A;  1ERD A;  3DF8 A;  3QRF F;  2ZC2 A;  4HW0 A;  3CMM A;  1YE9 A;  2HOA A;  4UNO A;  2V26 A;  2EFN A;  4LLL A;  2AO9 A;  3KP5 A;  3IKV A;  4FET A;  4RMN A;  4MIM A;  3ZQC A;  4OMZ A;  4F93 B;  1PVE A;  1R1U A;  1UG0 A;  2HS5 A;  4BJ5 C;  1XCV A;  3ELK A;  2RV8 A;  3ZGK A;  1WVR A;  3P9K A;  3QAH A;  4A6D A;  1LPQ A;  2KIM A;  4ENK A;  1ZG3 A;  2CYY A;  1LEA A;  1OCZ H;  2EIM H;  4BBS J;  4FT8 A;  3GWZ A;  1B59 A;  1YQA A;  4QPO A;  2JQ7 A;  1FIA A;  5LRS A;  1QVU A;  3DKX A;  3LSM A;  2VOO A;  5FKL A;  4I02 A;  3T0Y A;  3TW6 A;  1LFU P;  1WJB A;  4KT5 C;  2DAO A;  3KX2 A;  2NVQ J;  3K4J A;  1TWF J;  2AXT C;  1EH6 A;  3O3K A;  3JR9 A;  2QA4 I;  4IVN A; 
#chains in the Genus database with same CATH homology
 3RQ4 A;  2CH0 A;  2R4G A;  3AKZ A;  3A2K A;  2LBF B;  1KON A;  2X85 A;  4N4O B;  3PUB A;  1DGR M;  4ZTJ A;  4XOP A;  2JA2 A;  4D1Q A;  5KCM A;  3KEY A;  1ZEL A;  2O5R A;  2VB6 A;  1D0Z A;  3OYD A;  2VJJ A;  2VIX A;  2IS6 A;  1Y6I A;  3PSF A;  2OUM A;  4BDZ A;  3BLY A;  2R7X A;  2CUJ A;  2CUZ A;  2DJI A;  4NNJ A;  3OYM A;  1Z21 A;  2MAB A;  3BG7 A;  4ITV A;  4OWR B;  1FMW A;  1OLT A;  3UR3 C;  4PJM A;  4FAS D;  1WJD A;  1N77 A;  3SYT A;  2XSJ C;  3EUA A;  3J7A Y;  2F6C A;  2Q1Z B;  2CV0 A;  2IS4 A;  2KPM A;  3DTI A;  2W1O A;  1YX5 A;  4RLQ A;  4B43 A;  2R7W A;  2V4J C;  4DBR A;  2WAQ A;  2VL8 A;  1MMG A;  4DIQ A;  4XLC A;  3BC8 A;  1P9Q C;  4BAC A;  2ZXI A;  4XN3 A;  5HOO A;  2CW8 A;  2L2O A;  1E0E A;  4XNF A;  2K3P A;  3IUO A;  1WJA A;  3VWB A;  1X4P A;  2IGK A;  3HC7 A;  4XLE A;  3MD2 A;  2VJI A;  3K10 A;  3W2A A;  4BQQ A;  4Y33 A;  3LSI A;  2HPI A;  3S8P A;  4PJJ A;  3V42 A;  1X1A A;  4RM3 A;  4ZDP A;  5KNL A;  4F3Q A;  4XM3 A;  3AL0 B;  3FKJ A;  2L9N A;  3H5A A;  3H5R A;  2V7F A;  3VYS B;  3VYR B;  2M7A A;  3H9Q A;  4ZYA A;  3C2G A;  1WFX A;  1LVK A;  4CCM A;  2OC6 A;  4AVZ A;  3MKY B;  4NC7 A;  3OOU A;  1DGW Y;  2LG4 A;  2LOO A;  4IKF A;  5CQG A;  2HDW A;  2DXI A;  2HNH A;  1BR1 A;  3VSL A;  3HL2 A;  1WJE A;  3W2V A;  4XKW A;  1MMA A;  3D5L A;  2I8D A;  5FRO A;  2WY8 Q;  2MFZ A;  2Z2S B;  1D1B A;  4XON A;  4HSR A;  2KRH A;  5FRN A;  4XOT A;  4F55 A;  3DPL C;  3OYA A;  4HRI A;  2DCE A;  4U7B A;  2XAU A;  3M8J A;  2VQH A;  4BJT A;  4E7Z A;  3C2H A;  1QU3 A;  4YRV A;  4E7J A;  3F9K A;  3DU6 A;  2F5V A;  3TL4 X;  4Y3O A;  2JVG A;  1QHH D;  2X6W A;  1PYV A;  1X1D A;  4JQF A;  3ONQ A;  4B44 A;  2R7V A;  2AQE A;  5CQE A;  2CV2 A;  1WJ5 A;  2Y0S A;  2L7K A;  4NUB A;  2DOA A;  3FBN B;  3S3N A;  3HKZ A;  3OYN A;  4XL9 A;  5HVQ C;  3PNT A;  3QYF A;  3LL7 A;  3PNV A;  5HNH A;  4E4H A;  2GOX B;  3EUH C;  3ZQQ A;  5LFA A;  4R79 A;  4CCJ A;  3QYE A;  4PSW A;  2JSP A;  2PJR B;  4JOM A;  2WAE A;  5LD2 C;  2X51 A;  3N05 A;  3L2V A;  3BCB A;  3OYC A;  2BW3 A;  2GOM A;  3D5S C;  4IQJ A;  3QYB A;  1LKX A;  3BCA A;  4BJ6 C;  3DKY A;  2WAF A;  2KLO A;  2E5N A;  4ZDL A;  3RTR A;  4XKB A;  2LYC A;  3LFU A;  4CH7 A;  3DEE A;  4HEA 2;  1X4O A;  3DTK A;  4D9J A;  1V5F A;  1W36 D;  4HST A;  1MW7 A;  5TGT A;  4PJL A;  2HQA A;  3TBI A;  3G2B A;  2UUZ A;  1PJR A;  4PUS A;  2LY1 A;  4PK4 A;  1G59 A;  1LDK B;  4Y4R A;  2BVM A;  3K70 D;  1T0F C;  4BEH A;  2CFO A;  2R7O A;  4QPQ A;  4CA0 A;  3PNY A;  2MC4 A;  3L2W A;  1R6R A;  3VSK A;  4E7L A;  4IZZ A;  4XQF A;  4F52 A;  3ZXS A;  1G8X A;  2LRD A;  4MLO A;  1JI8 A;  2IXS A;  2HVR A;  3CP2 A;  3L2R A;  3K70 C;  3GBG A;  4AYB A;  1V5E A;  3D5R C;  2K5C A;  2L5Q A;  3ZR8 X;  2LY2 A;  4CCK A;  4GRI A;  4ZDO A;  4DJA A;  4BL0 B;  3UNG C;  1MMD A;  2HVS A;  3VDX A;  2Q2E B;  3I3L A;  2X1C A;  3HG9 A;  2KDO A;  3OS2 A;  3OIP A;  1DQU A;  3A4C A;  1D1A A;  3IAS 2;  2JVH A;  3IAM 2;  2UV1 A;  2BOL A;  2W7N A;  4EAT A;  2VKH A;  2FUG 2;  4E7S A;  1J09 A;  1Z3Y A;  2HVQ A;  2E1M C;  3OIQ A;  3SDB A;  2VQC A;  3DPU A;  3FDY A;  3PSI A;  3MKW B;  2QKL B;  3PFY A;  4BEH B;  1HA8 A;  4BE0 A;  1UEL B;  1N75 A;  4NC8 A;  2M0M A;  3S3O A;  3DPT A;  3W2W A;  3K4K A;  4XLH A;  4E7H A;  2M7B A;  4ZTF A;  2IS1 A;  4KT6 A;  3OMY A;  4ANJ A;  2V6E A;  4H4K C;  2WBM A;  2ZFU A;  2KHM A;  2W82 A;  1Z3X A;  3FHN A;  4RM2 A;  3DTE A;  3OYK A;  4LIV A;  3PL8 A;  2X1E A;  1MNE A;  2OV7 A;  2M4G A;  3OYG A;  2XF6 A;  3K4B A;  2RNG A;  3VYU B;  2UWM A;  4J00 A;  3CJR B;  2HZD A;  4IQ4 A;  3E1S A;  1NG6 A;  1DP3 A;  3OR2 C;  4DOZ A;  2MD0 A;  3S3M A;  2V9K A;  4LIU A;  1BR4 A;  2W4S A;  3I9V 2;  1MMN A;  2XF7 A;  1D0Y A;  3ZCO A;  3HPH A;  4XN0 A;  2IGN A;  4XLA A;  1LFP A;  3MMY B;  2R7R A;  4KJZ A;  2W00 A;  2P0W A;  4HNU A;  2F4I A;  2VXD A;  4BXF A;  2CW7 A;  4HNT A;  3PJR A;  2X1D A;  3NWT A;  4PFP A;  5HLT A;  2R7U A;  3OYJ A;  3DU5 A;  2LRE A;  1EA3 A;  1N78 A;  3SEZ A;  3LSK A;  4U87 A;  1NG7 A;  3OS0 A;  3H5N A;  1V5G A;  3CES A;  2CS3 A;  3RSN A;  2V1N A;  2E5Z A;  1SAU A;  4CCO A;  3OYF A;  2E1M B;  1X19 A;  3OWT A;  4LG3 A;  4XMY A;  4ZJZ A;  2R7T A;  4F91 B;  2ELJ A;  3AFH A;  2IS2 A;  3H9G A;  4BQN A;  1BOB A;  4LIT A;  3QOD A;  4B47 A;  3FBI B;  1IRX A;  4HG2 A;  4C2T A;  2VQL A;  4XOR A;  3VYT B;  4XKC A;  2R7Q A;  1TT0 A;  2KZV A;  1GLN A;  4CCL A;  2ZXH A;  4B3X A;  3HOT A;  1Y56 A;  4XR6 A;  1OR7 C;  1QHG A;  2K9L A;  2K9M A;  1S9H A;  3M1C A;  4BE1 A;  4F92 B;  4N4N B;  2KL4 A;  4II2 A;  3EPZ A;  2VKD A;  4E6K G;  4IX7 A;  2ZSI B;  2E60 A;  3OYH A;  1W36 C;  1YX3 A;  5CKT A;  2QKM B;  2ZSH B;  4C30 A;  2Z1D A;  2XC7 A;  4XKV A;  1Z7L A;  1FMV A;  3OR1 C;  4II3 A;  2IGM A;  2BVL A;  1X1C A;  3OL3 A;  2VPL A;  4BE2 A;  4E7I A;  2VJ5 A;  2BW3 B;  1VZ0 A;  3DWL E;  2KQR A;  2CV1 A;  3OL4 A;  5FRM A;  4XLF A;  2IGO A;  4CCN A;  3HOS A;  3CZ6 A;  2CMP A;  2A6T A;  3BG6 A;  3OYB A;  4P5O A;  2AQF A;  3A1Y A;  2PMZ A;  1X1B A;  4RLF A;  2VQG A;  5HNF A;  4B48 A;  1D0X A;  4OAZ A;  3CJQ B;  3CP8 A;  4CZC A;  3DLA A;  1SFK A;  1TZL A;  4BU2 A;  2JUG A;  3KYL A;  2WY7 Q;  3DQV C;  4KIT B;  2DT7 B;  4BQO A;  3NWS A;  1D1C A;  2M3A A;  3SEQ A;  2X6X A;  4E7K A;  4BGD A;  3ZRG A;  3OYI A;  2VLA A;  1UAA A;  4PSX A;  2VXZ A;  3HXL A;  2VAS A;  4NQW B;  1BR2 A;  4PFO A;  4J01 A;  3K4N A;  4C2U A;  4P1W A;  2X6Y A;  1T95 A;  3LMM A;  4YEL A;  4YEJ A;  2A5W A;  2L9S A;  4ZC3 A;  3CF2 A;  4KIS A;  2VJ4 A;  2LC2 A;  2MYS A;  1U0J A;  3RCO A;  3L2U A;  1WJF A;  3H35 A;  3QOE A;  4BUP A;  3LSG A;  1WJC A;  3H9J A;  4HPQ A;  3K4L A;  3K4C A;  4AU7 A;  3K4M A;  4PJN A;  2R7S A;  2Z16 A;  2KMU A;  1MND A;  4X0G A;  3S32 A;  1ERD A;  3W3C A;  3CMM A;  4OAY A;  3OYE A;  4BS9 A;  2PJR A;  1YE9 A;  3S93 A;  2V26 A;  2NOJ B;  2WAD A;  4FET A;  2LBF A;  4RMN A;  2XDV A;  3L2Q A;  3IP4 B;  4F93 B;  1K6Y A;  3RPU D;  4BJ5 C;  1UG0 A;  2HU9 A;  5KHD A;  3HUG B;  3ZGK A;  2DT6 A;  3U21 A;  4CSW A;  3TMO A;  4CUG A;  2RQQ A;  5JHF A;  3MKZ A;  4G6T B;  2KRC A;  4BDY A;  3E0J B;  2KP6 A;  2RRE A;  5CPR B;  4C9Y A;  4DGW B;  3HPG A;  3OY9 A;  2WA0 A;  4QPO A;  4DBQ A;  1AA7 A;  3H0D A;  2XF5 A;  3LSH A;  3DKX A;  3LSM A;  2HPM A;  3K6G A;  2LH9 A;  3EUK L;  1WJB A;  3KX2 A;  3K4J A;  3OYL A;  3SZG A;  2M4K A;  3AL0 C;  2WB1 A;  3OS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...