3OR1C

Crystal structure of dissimilatory sulfite reductase i (dsri)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
104
structure length
104
Chain Sequence
AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKNTGFALKEIYELFPSGPGKGACKMAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfite reductase alpha
publication title Structure insights into the enzyme catalysis from comparison of three forms of dissimilatory sulfite reductase from Desulfovibrio gigas
rcsb
total genus 30
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3or1C02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 3or1C01
2XSJC 1JI8A 1YX3A 1SAUA 3OR1C 2A5WA 2V4JC 3OR2C
chains in the Genus database with same CATH superfamily
2ZMEB 1FYKA 3ESWB 4LIVA 2OU2A 2OAZA 2R7SA 3GF2A 2HOAA 2CU7A 3BLYA 3F8FA 1UHSA 3L00A 4N9IA 1JI8A 2DA5A 4RLQA 5F27A 5F64A 2ZXJA 4HX8A 1G3TA 4YIFA 2E7WA 1B8IA 1DP7P 5H20A 3RPQA 3VB2A 1G2HA 1RUOA 4MTDA 3BZCA 1SVOA 1X2NA 2X1EA 3K9TA 4PUSA 4AIDA 3OR1C 4DYCA 1FT9A 2JJ7A 5F0FA 1ETYA 2FD5A 3EUAA 3OYMA 2RAEA 2K4BA 3DKWA 2WWYA 3OYIA 3WGHA 3E6BA 4AIJA 2EH3A 3RZDJ 4RGSA 1YJWI 3DBHB 1X3ZB 2O3FA 1KYWA 1ZH5A 4G7HF 1LQ1A 4J01A 2IA2A 1ORKA 2WTEA 2BZTA 4OINF 2E1MB 4DYQA 1DP3A 2KRFA 1G6NA 5EF6A 2R7XA 4L9JA 1O7FA 2D45A 4F93B 1WI9A 2D2WA 5EGOA 3FXQA 3CP2A 4MLOA 1I50J 4XLPF 4DNCA 1HQCA 4M9ZA 1FC3A 1B59A 3QPLA 2VOPA 1BR2A 3QP5A 3JRGA 2PFBA 3FIWA 2MC3A 4HF2A 1H89C 5HLGA 4PFPA 2UV1A 2KISA 2RGVA 1S72I 1PUFA 2NS0A 1VQ7I 4ZYGA 3OYEA 2BVMA 4NNJA 4XRSG 1ZLJA 4UNOA 3TDUC 1LVAA 2BVLA 4BYYA 3ZQLA 2Q8KA 1J5YA 2ZJRF 1QO0D 5IYCJ 2ZJPF 1PP7U 1BI2A 3HGYA 3VYTB 4D5FA 5ICFA 1HCRA 3WTUC 4P9FA 3OL3A 4BHPA 4RB1A 1U5TA 3T1BA 1H9TA 1ZGAA 3GLXA 3ZOBA 1ZN2A 4P1WA 2G7HA 4L0YB 2Q2EB 1HA8A 1I27A 1YRNA 4LMYA 2P8TA 2DTRA 3G1OA 5CQEA 3IH4A 1FYMA 3QOEA 2PI0A 2JPCA 1K78A 1S9HA 1XB4A 3DP7A 3K70C 4BNCA 4L5EA 4CO8A 5D5WB 4GFBA 2CO5A 3KEQA 4U0YA 4L5IA 2CW8A 4PJJA 4G7ZF 3QWLA 2IA1A 5DD4A 5FD6A 5K1YA 2EPFA 2IGMA 4G9YA 4B1RA 4HEA2 2XC7A 1SFOJ 1LEBA 2QQ9A 4HF1A 2FRHA 2NVTJ 1SFEA 4F52A 5B66C 4CCLA 3WTTC 4FTHA 3O8HA 2HR3A 1IN4A 3MKZA 3LAJA 4PJMA 5E1WA 1S7OA 4A0XA 3WTWC 1D3YA 1K6OA 1XSXA 1Y6IA 2XPVA 5GPAA 4HA8A 1JUPA 1SANA 2EIMH 1P7IA 2XKOA 1IXCA 1WFXA 3RPUA 3OYBA 1JKQC 3S1MJ 3ZQCA 4CA0A 4XORA 5FKMA 1G4DA 4N4OB 3E6DA 5J3LA 1X1CA 3LSKA 1MZBA 1QRYA 1SD4A 3KEOA 1WZ2A 3GTOJ 2FNAA 2Z3YA 2W25A 1LE8B 2V1XA 2QCOA 3OYHA 2K3FA 3RQ4A 1DQUA 2HQNA 3CUOA 5DUKA 3DWLE 2AQFA 4AVZA 2EQRA 4HX4A 3U21A 3A1YA 2FMLA 3DLAA 3GWZA 2V79A 3BR1A 2DCEA 3QAHA 2IGNA 3JTHA 4M6VA 4OWRB 5L3GA 3N97A 3R6SA 2LY1A 5JR3A 3CCRI 1GV2A 3SZPA 2VUMJ 5J6XA 2L5QA 3T0YA 3ML6A 3LOCA 2LRDA 1H9GA 4E7HA 3IV5A 1O3TA 1R23A 1D0XA 2DA7A 1N25A 4D0PA 5FKNA 2VC0A 3BDDA 4PZJA 3WG7H 1I3QJ 1RKWA 2RNJA 2F6CA 4X0GA 2VN2A 2EFQA 5ILUA 2VXZA 2FEZA 2V9VA 5KAIC 2XPUA 1ZR4A 3HYIA 1UG0A 5TJJA 3EDPA 3GEZA 3HUGB 4M73A 3L09A 3HOUJ 2R92J 4XICA 3REOA 3FBNB 3EYIA 4NC8A 5B1BH 1V3FA 5FFZA 3MN2A 1T6SA 5D8LB 4BXXJ 3BT9A 3DLLF 2Q1ZB 2EWNA 4FASD 3F8CA 2EZIA 3FWEA 3S3OA 2VKDA 2MGQA 3E1SA 3I56I 2K5CA 4EV0A 3CQZJ 3FXLA 4U87A 2EZHA 5ICCA 2DMUA 1MH4A 2Z1DA 4NC6A 5JFRA 2GM4A 4OIPF 4G7OF 3OS2A 4UB8C 1B8IB 1E2XA 3IRRA 2BGCA 3R4KA 2E1MC 2CG4A 4RLFA 3TW7A 1T98A 1Y39A 1V5EA 4LOCA 3ZQGA 1V4RA 4EGZA 4HLYA 2K9LA 1HW2A 1IG7A 3LSMA 2L7KA 3CZ6A 3GZ5A 1T39A 4XRFA 4NBQA 4UVCA 2DMPA 3PO2J 4JYKA 2GZWA 2WC2A 4EM2A 3LSRA 2EFNA 2HVQA 2EILH 2NXNB 1YO5C 2JA2A 3RPUD 2V26A 2IS6A 5C44J 2W84A 4PSXA 2Z5UA 4B3XA 4A6EA 3LSHA 2UZKA 3J80Z 4ON0A 2HWVA 4BE2A 5LHHA 2LDUA 4CYDA 3AG2H 4DJAA 3GTPJ 1RZ4A 3PIPF 1BN5A 2M8GX 4HRIA 4ETSA 5LGNA 4QPQA 1D5VA 3DTKA 1X3UA 3D5RC 5EGOB 4XOPA 2ZSHB 3I9V2 1J2XA 1D1AA 3O8GA 1MIJA 3CJQB 1TW3A 2Y2ZA 3SFIA 3HG9A 1Y0NA 3DBLB 5HNHA 3JSPA 5L3EA 1WHUA 2ZO4A 4B48A 4KYWA 3ZP5A 2EA2A 4Y15A 5FKLA 1MNDA 3PNYA 4JX5A 4YELA 2ME6A 2JA7J 1LUJB 1IRFA 3OYLA 2MLGA 2H09A 4XLEA 2ELJA 1XD7A 3MKWB 2L7MP 3S1RJ 5DCMB 3W6VA 1XMAA 3C18A 2LR8A 4PJ0C 2FBKA 4XSXF 2XF6A 2R4GA 2WAEA 4M72A 4NQWA 3GFIA 1TBXA 5IT3A 1FBUA 3B6AA 4BDZA 2HKXA 1XMKA 2KDOA 1XG1A 1CF7A 2F5EA 1WJDA 3H35A 4FE7A 2P81A 2W48A 1E17A 1YRNB 1XCBA 4LLGF 4PCQA 3E5XA 1WPKA 2Y0SA 3DPUA 5DEQA 3N4MA 2X6OA 1XDSA 3S2WA 1OR7A 1FNNA 2DA4A 2JSCA 4M71A 3WTZA 2STWA 2OCEA 2L9VA 2HOSA 5HS7A 2DDAA 1MMNA 3CCLI 2IBDA 5LGTA 4MFEA 3FM3A 3FXKA 1RPWA 1SAXA 3NEUA 4HPQA 1YHQI 2LKXA 1G3YA 4GXOA 4WXHA 4JK1X 4R8HA 1ZG1A 4I01A 2P6SA 2HPMA 4F55A 2ESNA 2A5YB 1YX5A 3HPHA 3PFIA 1STZA 1IUYA 1FX7A 2JVHA 2E7XA 1MBEA 2BV6A 3SFZA 4I09A 5H6RA 1S7AA 5FLVA 1P4AA 3NWSA 1YS7A 3I4NJ 3O2PE 3ZXSA 2OBPA 4DW6A 1OFCX 2BYVE 1OJLA 1MNEA 1WH5A 3NAUA 2HU9A 3GCMA 4IO9F 3Q9SA 4KIFA 4A0YA 1ULYA 5D5VB 1P4XA 2PG4A 2DOAA 4BQNA 1TWFJ 1QZEA 3F6VA 4KN4X 3CMYA 1L3LA 2VC1A 2CFXA 3DEWA 2EFOA 3S16J 2V4JC 3HXLA 4I2OA 4AM3A 2VE8A 2FE3A 2L4AA 1Z6RA 3Q5FA 1TTYA 4IF4A 3CUQA 1O7LA 3KP5A 3KYDB 1FTTA 4Y33A 3KP4A 3GZ6A 3E0JB 3HC7A 1WJBA 3OS1A 1JGSA 3OL4A 5DTDA 2L0KA 1TP4A 4L0ZB 2W1OA 4ZTJA 2VKHA 3S1NJ 2ADUA 5FRNA 4BXUA 4LITA 3K4NA 5GTHC 5EEAA 2O9LA 4KN7X 1FWZA 2E60A 2EV5A 1MJBA 4HLXA 2M8EA 1SVMA 4LK1F 3GYHX 2XGEA 4Y7NJ 4ZC3A 6PAXA 2FX0A 1BW5A 1OLTA 4LB5A 3WE3A 2DFIA 1GV5A 2E71A 3BR3A 2XHKA 3JRIA 2BY1A 1LFUP 1MBFA 3FKIJ 4L18B 5M5WJ 4MGRA 3KP3A 4NC7A 3G2BA 3QODA 1XDUA 1R1TA 2PMZN 4LFUA 1K79A 1A6QA 2WADA 5LFAA 1R6RA 5DM6F 3I64A 1UHWA 5J8FA 2RC4A 1HKQA 3KFWX 3FDYA 5J4VA 5EG0A 1QBJA 4HX7A 3H5AA 4NDLA 5H2FC 3K6GA 4WF2A 5EEGA 1Z7UA 1XTAA 3FK6A 5HDGA 1KQ8A 3SHFA 1A6IA 1T56A 1E3OC 1FMWA 2BXYA 1F4KA 4W1UA 3HOTA 4M9SA 3BTLA 2E2JJ 2DDBA 2WV1A 3VSLA 4GRIA 5DS9A 1LKXA 3PL8A 3VYSB 3BR2A 3ZN0A 2XAFA 2Z16A 3HKZA 4KJZA 1NK2P 3UKGA 1PDNC 4RDUA 4HQEA 3FXMA 2OCCH 5D5XB 4A3JJ 1D1CA 2DK5A 1TZLA 1XPXA 3LFKA 4RBOA 2F5CA 4O5VA 2VI6A 2Y9YA 2JA8J 2W00A 2ACJA 3IKTA 2HS5A 2DTZA 4F3QA 2JWTA 3W2AA 2I10A 1HSJA 2L3DA 3FK7A 4C2MJ 2R7DA 2VT3A 3I4PA 3E3VA 4JBAA 5DV5A 4D9JA 2K86A 1IXRC 3KZYA 3HOXJ 5KAFC 2GIZA 3F22A 2H94A 2R7UA 2WAQA 3ZMDA 3R0JA 3B73A 4CH7A 3PUBA 1FOKA 1Z1DA 4PJNA 2QENA 4XN0A 2UXXA 1BR4A 3IAS2 4D5CA 1OYWA 5DM7F 3ZGKA 4ZZDA 1U5TC 4YEJA 3DTEA 4Z2YA 4X6AJ 1U3EM 1T33A 4BU2A 2KL4A 4Q5SF 4I99C 2QA4I 1NK3P 4G6QA 3RDIA 2UWMA 2CQQA 3TQNA 2COBA 2L4MA 1XN7A 5JHUA 3OYDA 2ISYA 4KNYA 1B6AA 1F36A 2HKOA 3MKYB 3KLOA 2JRMA 1AA7A 3PSFA 1HLVA 2ZSIB 4BACA 2TCTA 2IJLA 2EZKA 5FKKA 4WWCA 2ETHA 1UB9A 5TISC 5ICEA 3VPRA 3FMQA 1JKOC 4L9TA 4BJ6C 2ZXIA 4EQQA 4DYRA 2CW0F 1ZG5A 2A68F 1E0EA 3FMSA 1XGMA 3A4CA 3X2QH 1IC8A 1XC5A 2NVUB 1JKPC 4DBQA 1CF7B 1V5FA 4ESFA 1OCZH 4ENMA 2BY2A 2L9RA 4Q47A 1ITYA 2M45A 2FA5A 2XAGA 3AKZA 4BDYA 4EEFG 2XROA 4EJVA 1K83J 2K3PA 3P7NA 2HI3A 2E2IJ 4I7HA 2DOEA 4PGHA 4WCGA 1Q1VA 1RKTA 3L2QA 1C0WA 1T2KA 2LOOA 4P96A 2QEXI 2GAUA 1LJ9A 2X1DA 1O4XA 1J75A 2XRLA 5FJ8J 1AKHA 3CDLA 5F0CA 2X51A 3CDIA 1QVUA 1WKMA 1Z7LA 3GTLJ 3GTMJ 3NRVA 1U0JA 2O03A 2DK8A 3ZCOA 2MW8A 4KUMA 1BW6A 2M7BA 5D5UB 3W2VA 3ZMSA 1HW1A 3T8RA 4UB6C 2BE5F 4DBRA 3OV8A 3CCSI 4AVPA 3DTIA 2BW3A 1MGTA 1R71A 5ED4A 1A5JA 4HG2A 5IT9Z 2VB6A 1B9NA 4TV7A 3TDZC 2BHYA 3FXRA 2L7ZA 3I58A 1VQMI 2O8KA 3BG3A 4EGYA 5JVGF 5J4YA 2IRFG 5FROA 1TQMA 4JQFA 1VQ8I 2A6EF 4ESBA 1ZGWA 3TEDA 1RR7A 5F6FA 2CW7A 2ESHA 3H9QA 1V54H 3J80K 2VBYA 4RB3C 2M5WA 4MQ9F 2FOKA 1NG6A 4HF0A 3H36A 2LLKA 2VL8A 1EA3A 3C1DA 1U8RA 3F0CA 2M3AA 4IXAA 5IP6A 4CGZA 4A93J 3DPTA 4ASNA 4G12A 1T0FA 3F72A 2OQGA 1UJ8A 3KP7A 3W6KB 1MD0A 2OTJI 1YI2I 3I71A 2QM3A 3MQ0A 4V19K 4IZZA 2DOFA 3HRSA 2XIGA 2P4WA 4IL6C 3HOSA 5CVRA 2MLKA 1J09A 5CJ9A 3BPXA 5EZGA 1MMGA 1IW7F 1X1PA 2X6YA 3GTKJ 1RESA 3OS0A 1G3SA 4Y13A 1LNWA 5LHGA 3WTVC 1J0RA 3FXJA 4I6ZA 1WH7A 2E5ZA 2R7VA 2XVCA 3CCQI 2KIQA 4LG0A 2PJRB 3HOVJ 4XKCA 4L5JA 1JUMA 3GFJA 2QYOA 1Y0UA 2M87A 3GO5A 3A2KA 3AFHA 3BCBA 5CLSA 3VODA 1ZAOA 3BPVA 3I53A 2FF4A 1D1BA 4DGWB 1YW7A 5FLXZ 2P7CB 2VKVA 5J8CA 3BY6A 1R36A 1ETWA 5LBQA 4BL0B 1IN6A 3QP6A 1BIBA 1DPRA 2E5NA 4M3EA 2HFHA 5E8GA 4CCKA 2XSDC 2CWEA 3E6CC 1R1UA 4CCJA 1JTXA 5IOZA 2CUFA 2DJIA 1T38A 4A6DA 3DU6A 5AIQA 2L9SA 5D6FA 4OIRF 4ENKA 1PYVA 2KRCA 2OF7A 4E7SA 1W1WE 2O7OA 3CLOA 1DU0A 2XDVA 1AOYA 1EV7A 1MJAA 3TO7A 1XMXA 3HSRA 2ISZA 1JHHA 2MH2A 2MA3A 5IY5H 1P6RA 2QBYA 2F48A 3HPGA 3RKWA 2O5RA 1Y56A 5CVUA 5J1RA 4YFNF 1TL8A 4RGUA 4RS8A 4BXFA 1IGNA 2HVSA 4BY1J 3GLLA 2ZNZA 4HSRA 5EDNA 3DCFA 2R3SA 3HRTA 5L3DA 3BROA 3QPSA 4XOTA 1UFMA 4BKXA 1HBXG 1NG7A 1X2MA 3WU1B 1H0MA 4KIGA 2I5UA 4C30A 2AXLA 3OYKA 3BG6A 5DUIA 3A0HC 3IC7A 2A69F 3RCOA 3IKVA 1KQ0A 2FJ1A 2MG4A 3F6OA 4ESJA 3ASOH 5IYBJ 4MQVA 2IXSA 3GVAA 3CF5F 1TNSA 5E20A 1S5LC 4IOCF 2IS4A 1NH3A 2XV4S 4RAYA 4MEXF 3BJOA 2BY3A 3HRMA 4Q4ZF 4PK4A 3G71I 2QVOA 1HC8A 2QGUA 3Q3SA 4XSZF 4CCNA 4E7JA 2ZJ2A 2PEXA 4IPAA 3TKYA 4A3CJ 3NARA 2NS8A 5FLMJ 1O3QA 5F08A 4NB5A 4KA4A 2COMA 1Y1WJ 1W0UA 2M4GA 1GXPA 1XS9A 1W5CC 2X85A 3S2HJ 1AHDP 1IRGA 3M07A 2Z2SB 1WJ5A 3F8MA 4P5OA 3RKQA 5HS9A 1MKMA 2E1OA 1HOMA 2ZFUA 4RAFA 1ERDA 1R4MB 1PJRA 1IUFA 2GOXB 4I0BA 4G6DA 4XBFA 2R5ZA 1YW8A 2XKPA 2C6YA 2Q0OA 3Q0WA 3L1PA 5FB2A 2V9PA 2DMQA 3W3CA 2ID3A 2X4HA 1MDMA 1BBYA 1H88C 2HDDA 1RC9A 5TGTA 1ENHA 2VQHA 3I59A 3L7WA 2KIFA 2QWWA 1YS6A 1GLNA 1RR8C 1S6LA 2K85A 3S3MA 2CV2A 5CYVA 3V8LA 2V6EA 1VZ0A 2LG4A 2ZC2A 3CESA 2TDXA 1QPIA 1YG2A 2M0MA 4XN3A 2HYFA 1VI0A 4UV9A 3A01A 5LEKA 3M1CA 4W97A 4XK4A 3K4BA 2W4SA 4R79A 4E7LA 5LD2C 2HOEA 1TQIA 2CYYA 4BE0A 3L2CA 3CJTB 4MHGA 2GLOA 1IN8A 1Z3YA 2FQ3A 4HZFA 5KNLA 1USTA 2VQLA 2XF7A 5K7FA 4OIQF 1TQPA 4ENJA 3U1KA 2KJBA 2L9NA 1YE9A 1X4PA 2PQ8A 4D1QA 1POGA 2V9KA 2DA6A 4BEHB 3FHZA 2R7WA 1I6XA 4A3FJ 2ZJQF 4RMNA 1OCPA 2FSWA 2LF8A 5K5RA 3OIQA 4KICA 3CUQC 4CUGA 3M4OJ 3N05A 1R5HA 1QU3A 4QLCU 4GGGA 1QZYA 3LAPA 2XUBA 3CF2A 4XIDA 1MBHA 4YFKF 3WTYC 4WXCA 4C3IJ 1RIOH 2XPWA 1OKRA 3V7CA 2KLOA 3R0AA 5LGUA 5M5XJ 2PBIA 2E36A 5HNFA 4ZYHA 5FFXA 3JRHA 3AG4H 1W7PA 3PUFA 1J9IA 2VXDA 3W2WA 1ZRCA 4D7NA 5IYDJ 2KP6A 3ERMA 1Z3XA 2WY8Q 4IOAF 1V5GA 2FU4A 4CYCA 1AWCA 3ZMUA 1EJ9A 2GWRA 3OSGA 1HKSA 2QQ8A 3M9AA 1GT0C 1Z67A 3EPZA 2LY9A 2Y75A 3KETA 1P4WA 1EF4A 3QYBA 2IS1A 2KZGA 5GP9A 4HOBA 2MD5A 1CGPA 1QHHD 4QPOA 1X3WB 3RIRA 3BTCA 4DQ2A 4LG0B 3T5XA 2NVXJ 1X4OA 1BOAA 3H5RA 1DU6A 1VQOI 2O61A 1Z91A 1T8IA 1QNTA 2EV0A 2VT2A 3LA3A 4GCVA 3RSNA 3SDGA 4CCMA 1HF0A 2XSJC 1VQ9I 4ZH4F 2DA2A 2OZUA 3ZN1A 2QSHX 3Q9VA 2J5OA 1KZHA 2UXNA 2W82A 2ZXWH 4FX0A 3A0BC 4ZDLA 2DPDA 2JA5J 1WVRA 3PO3J 1PUFB 4ANJA 3T8TA 4F91B 1R58A 3LQRA 2EFWA 2WV0A 2ZFWA 3ABTA 3H5NA 3VFZA 2A6HF 1MBJA 2BOLA 5GTIC 2LKPA 1LDDA 2X6WA 2DODA 2FUG2 5M5YJ 4YG2F 4F7ZA 3CD6I 3LL7A 1Z9CA 1IRZA 4OIOF 4S0HB 2LKSA 4RGRA 1B72A 2YU9J 1OQYA 1U5TB 5H6QA 5BQTA 5M3MJ 3GTGJ 3ABKH 2YX7A 1G59A 2JVGA 1R00A 3I3LA 3BQYA 4Y17A 2NAZA 3P9IA 5CVJA 3S2DJ 2HQAA 3IP4B 4E70A 5J1UA 3U2RA 2IT0A 1ZKGA 5DCFA 3GW2A 4EJWA 4N4NB 1K78B 1KONA 3K69A 4XRMA 1R5GA 3M3YJ 4MIMA 5IT9K 3R61A 2DMTA 4N9HA 4LD5A 4LIUA 1D0ZA 4B8XA 3ZQ7A 2K02A 3DEUA 1HDDC 2A5WA 2RN7A 3OYAA 1R1VA 3HTSB 2H6CA 2NNNA 3SZGA 5BPIA 1W7PD 3J7ZI 2HZTA 1Y8RB 2NS7A 1WCMJ 4FT8A 2JRTA 5HDNA 2CJJA 2PMUA 2ELHA 3K4CA 4E6KG 1MMSA 1EH8A 3HTUA 2DT7B 3I5UA 4EMSA 3OWTA 4A2UA 2R7TA 1Z05A 5FO5A 1I39A 2P5VA 4II3A 1YW9A 1S7EA 1BI3A 3WE2A 1W36D 2ICWG 4B09A 1SMTA 4IVNA 2ZMEA 1FBSA 3K4MA 1O3RA 2MH9A 3WHBA 2IEKA 1J59A 2ID6A 1SFKA 3BP8A 2PMZA 4DZPA 1MSFC 3KZZA 1I1SA 1XGSA 2A07F 3VWBA 1QHGA 3E5UA 3TMOA 1Z77A 3QQAA 3HDDA 2OQRA 4G8XA 2G7UA 2YR2A 4M6YA 3EUHC 3VEPA 3H3VK 3CLQA 3DPLC 3GTQJ 1IN5A 2KT0A 4FQGA 3FXOA 5L3FA 2BBYA 2K4JA 2H1LA 1YTYA 1YYVA 1X19A 3BZ6A 4OAZA 1MDMB 2BXZA 2K27A 4ABZA 2MD0A 2HTSA 5ICGA 1ZREA 1LB2A 1O57A 1FZPB 1DGWY 3FISA 5FGMA 5ILVA 1FOXA 1KYZA 2R7OA 3FX3A 3JRAA 1N78A 4HYEA 1KU7A 1IO2A 2QKLB 3WGIA 3ELKA 2GXBA 1GVDA 3DKXA 2N8GA 3A01B 3KCCA 3WG9A 1KU3A 1A04A 3ABLH 4KIBA 1ZLKA 4BE1A 2E34A 1FP1D 1AU7A 2FQ4A 2X48A 4UVBA 2GOMA 3BCAA 1IJWC 3DFGA 3BG7A 3IRQA 4RGXA 3I55I 4HDUA 1MJ9A 4Z6YA 1S29A 2EJRA 3SYTA 5L3BA 5K5OA 4JX6A 4EM1A 1T0FC 2LK2A 4GO1A 4HV6A 2HDWA 2XAUA 5M3FJ 1REPC 3GBGA 2A05A 3ROUA 5DD8A 3HZJA 3K10A 4H4KC 5E17F 4B3AA 4I0AA 3GUDA 1WJAA 1DUXC 1OCRH 4UV8A 2EIKH 2DN0A 3MCZA 4KITB 4WXDA 2IS2A 5C3EJ 3TW6A 5HS8A 3ZQFA 4EM0B 4A3DJ 2KQRA 2P5KA 2NYXA 1D0YA 5K7ZA 3QYEA 3M8EA 2XB5A 4XLNF 1QQIA 4AU7A 3Q0UA 2O6GE 2DFEA 1K4SA 1FIAA 3ZMVA 3KP2A 2QKMB 1TC3C 3K7AJ 2VE9A 1VFCA 2PLYA 3S3NA 2Y69H 4OMYA 3BOQA 4UHTA 1ETKA 4BQQA 2WB1A 2XASA 3WU2C 4AWXB 1P7JA 4BUPA 2B0LA 3JCUC 1VQ4I 5EYRA 2W85A 5HOOA 3WTXC 4ZDOA 3U1DA 3COAC 5D4SA 2M2EA 4IQJA 2M7AA 3A02A 2LP0A 3M1EA 3QRFF 1H8AC 3SEQA 1UHMA 4XNFA 2HOTA 1LVKA 3IH2A 2ZB9A 4IJAA 2DAOA 2MBFA 2A6TA 3I4MJ 2CQKA 2M4KA 5E3NA 2RV8A 9ANTA 3CMMA 5BPDA 3CCYA 5J40A 1BM9A 3L2VA 1ZQ3P 1TNTA 1X1AA 4EJOA 1WRJA 3AL0B 4N0BA 1JTYA 2H1KA 4XONA 5CVVA 1F9NA 2Y30A 2KRHA 2VLAA 2CSOA 1ZYRF 2CV0A 4FX4A 2OD5A 3BG9A 2IGKA 1WI3A 2M30A 3DV8A 4CSWA 4J19A 3JRBA 5E3LA 1VQ5I 1FJLA 2Y48A 4NQWB 4UUVA 2CUJA 4M3FA 1LE8A 2B7EA 3HSFA 3DXJF 3H1CA 2BEOA 3CCMI 1GDTA 3ZPLA 3R60A 5E8IA 3RKXA 1FIPA 3V8KA 3L2UA 3KYCB 1HW5A 2L54A 2LY2A 2QQAA 3K4KA 4GYGA 2DT5A 2RQPA 4Q48A 5D6EA 1JE8A 2PN6A 2AQEA 1OYIA 3B6CA 3HSEA 3SEZA 3ZRGA 2P5LC 2LBFA 3S32A 1IAWA 2HEOA 3ZQQA 2KIUA 1G8XA 3RTRA 3LWFA 3KLNA 2Y9ZA 3GZNB 4P55A 3S17J 1TWGJ 2QSGX 2OC6A 2J5PA 5HODA 3QYFA 5FRMA 1SC7A 1IXSB 2WAQN 2Y0MA 2L01A 4CHUA 2Z33A 2DFHA 3F8NA 2HQRA 2RREA 2EK5A 4IHXA 1I1GA 2WBMA 2GXAA 4U88A 3OYGA 3JRFA 1JJ6C 1D5YA 1B9MA 4KMFA 2IGOA 4XRSA 1BR1A 1UG2A 1FBQA 2HNHA 3HUGA 2IA0A 1ZTRA 4CZCA 2VKEA 2Z99A 1ONVA 3MKLA 1FOWA 2E19A 2MFZA 1TT0A 3S93A 3E6MA 4QTRA 1SD7A 1W0TA 4Y52J 3FM5A 4S04A 5CQGA 1P92A 2MABA 3MWMA 4AYBN 2CQNA 4U7DA 1UAAA 2KMUA 2DT6A 4IRGA 3RJPA 2STTA 4AIHA 4XKWA 1BA5A 4B4CA 3D5LA 4HQMA 2F4MB 4XM3A 2VJ5A 2KKOA 1ZRDA 1KA8A 2XAJA 4BQAA 2KJCA 3K4JA 1WJFA 3HGGA 3RQIA 1LDJA 2IVMA 2HPIA 5K7HA 2E1CA 1FOYA 1YJNI 2L7FP 2CS3A 2NOGA 2L2OA 3CUQB 3MFKA 1X58A 4E7KA 1YQAA 1U9NA 3ECOA 2EZLA 2P6TA 5B5EC 1RETA 2D1HA 4BJ5C 4MFDA 3ERED 4LLNA 4QIWN 3DQVC 4AC0A 2VASA 1W5TA 2K9SA 1IN7A 3IWZA 2HTJA 4G6TB 2R5YA 4L9NA 4AUXA 1IF1A 4OOIA 2HYGD 4S05A 2V1NA 2LH9A 1HSTA 1F43A 4A5MA 1XX5A 2QF7A 1BC7C 1V55H 2OV7A 3BWGA 4OMZA 3V7SA 5A2QZ 2OA4A 4M74A 3KIOA 1G3WA 2VPRA 1R22A 2PX9A 3K1PA 1K7AA 4LG3A 2R7ZJ 3M8FA 1MSEC 2MSYA 4G94A 3GXOA 1QZZA 4HV5A 1GUUA 4BAYA 1Y1VJ 2GA2A 2VPLA 1QPMA 2F4IA 2DLLA 3JSOA 2EV6A 1ETVA 1JT6A 4O6JA 5EG0B 1NTCA 3JRDA 1M1EB 2JK3A 1DGRM 1R7JA 1W36C 4U0VA 1UMQA 2ZKZA 3WGGA 3SQNA 2JPBA 3CO6C 4NUBA 4GYIA 4X1EA 2DI3A 3BJAA 1ZG3A 1SMYF 2VJIA 1USSA 1XGOA 4MNUA 3G3ZA 1YJ9I 1FTZA 3E5QA 4I98B 3WTSC 5DCMA 1B4AA 1EH7A 4ZYDA 4KMUX 4BHBA 2F5DA 4YFXF 2ZCWA 3CCJI 1D8KA 3E97A 5BS6A 5K5QA 5HLIA 3UR3C 4HDVA 4WK8F 4XKBA 1TT5B 3TP3A 4E7ZA 1P9QC 4JX4A 5JLXA 3OYJA 1SD6A 1IV8A 1OPCA 1FLIA 4UUTA 1ZK8A 3V7RA 3JW4A 2XF5A 3AL0C 2W24A 2E1NA 2L02A 4I76A 3HL2A 1ETQA 2M9HA 3FKJA 2IP2A 2LVSA 4RM2A 3FF5A 3F8BA 5JVTA 1FSHA 2OTLI 3VSKA 3Q0VA 4E4HA 1OISA 4RB0A 3DEEA 2H8WA 3KX2A 4BH9A 4RB2C 4A0ZA 4CDGA 2DQRA 4M3GA 5F0HA 3ABUA 3GFLA 4PFOA 3GX4X 3NQOA 4PSWA 3FHNA 2DYRH 4IHYA 3K1MA 3HBLA 3S14J 5JLWA 2VBWA 4Y4RA 4A3MJ 3BTIA 3LSPA 2VODA 4A3EJ 2OPTA 3OYNA 3O6BB 1ETOA 5GADJ 2JUGA 4JP0A 4HNUA 4PDKA 3HRUA 1SEUA 2DA3A 2DMNA 4RA2A 3S15J 3KEYA 2MYSA 2NRAC 3D1NI 3K2AA 4R1HA 4V2GA 1OR7C 3ASNH 3VYRB 1KGSA 1OCCH 2OUMA 2DQLA 4H0EA 1OCOH 4IKFA 3V8JA 5E3OA 1PUEE 3CJRB 2K7LA 5C4XJ 2EINH 2XGCA 3TP0A 3WU0A 1SFUA 2O8XA 4A3KJ 3OIPA 3JAMZ 1WWXA 2LMDA 2YUSA 1RNLA 1TWAJ 4YRVA 1E3PA 3P9KA 3G73A 4IEJA 3JRCA 4IQ4A 3J81Z 1BOBA 2JUCA 2VQCA 5BNGA 2F4OB 1I6HJ 1Z0XA 1UELB 3DF8A 5LRSA 4XL9A 1R5ID 3BQZA 3KE2A 3RYPA 5FKOA 5IP7J 2F5VA 1MNMC 2LSOA 2GQQA 2X0LA 1JHFA 4AD9A 1J7KA 2LBFB 4A3BJ 4BQOA 3QOPA 2MC4A 4LJZF 2LREA 4OU0A 1AKHB 2YPRA 2CV1A 3D0SA 4J00A 1Z6TA 3ONQA 3G1LA 1YIOA 2CQXA 4UUSA 1W5SA 2F5FA 3HHHA 3BG5A 3K2ZA 3CP8A 2JQ7A 2EIJH 4UXNA 2D5VA 2GIVA 3TBIA 3HOZJ 2ZMEC 2DO7A 3ZMZA 3ECHA 3ULQB 3F9KA 4ZJZA 1P2FA 2EA4A 4ZYEA 1XCVA 2WAFA 2BW3B 5D8KB 2XAQA 1ACIA 2DBBA 4BBSJ 4UVAA 3G6EI 1TW2A 5E3MA 1OCTC 3HB9A 2RQQA 2A61A 1RI7A 5J1YA 1YFHA 2HZDA 3O3KA 3TL4X 4K2EA 1JKRC 1QA6A 1IDYA 3H3UA 1WJEA 2OJED 1T08B 4O3MA 2DYSH 3VDXA 2FBHA 5HDKA 5HVQC 1ON1A 4F92B 3AG3H 4M3DA 2JMWA 4M6XA 2VJ4A 5JI6A 2W57A 3EYYA 1U6GA 4C2TA 5F04A 5LHIA 3P9CA 3FMRA 1X1BA 2ZBKA 3HOWJ 4A12A 4KFCA 3PSIA 4PJLA 3CC7I 3HIFA 2H27A 4KT6A 4A69C 2G9WA 4XLHA 2R7FA 3TOAA 2R0QC 2Z9OA 1R4NB 2QLZA 3CCVI 1HKTA 1VNDA 1MW7A 2ECBA 1DDNA 5IOYA 3DBRB 3I0TA 2R5YB 4IHVA 2V1DA 3C7JA 1S3JA 1APLC 3LQQA 2IPQX 4YIRX 1TLHB 1VQKI 5DDGA 2KDZA 4IHTA 1LFBA 1U78A 5IPAA 4NHJA 4UY8I 3HEFA 2DXIA 3KZIC 3C2HA 4C3JJ 3IL2A 1BI1A 2ME0A 3M8JA 3CMEI 2R93J 3H9JA 3KYLA 3QU6A 5AONA 1KU9A 5BOXA 4DIQA 3GMEA 3HJEA 4CZZA 2AXTC 1JJ8C 4DZJA 3PM1A 5LLQA 3LSJA 2PJPA 2ECCA 2E2HJ 1U2WA 1XSDA 1SFXA 4XR6A 3L2RA 1QGPA 3ABMH 4XQFA 4M3BA 1BL0A 2B9SA 4M9XA 3U9GA 2HXOA 2V7FA 3JTGA 2AS5F 4FCYA 2GBYA 2BY0A 2VIXA 2D1VA 4HBLA 1K6YA 1UCRA 5KVRA 3J7AY 4IRHA 2JN6A 2CRGA 1IRXA 4Y3OA 2K9QA 1SVLA 3D5SC 2CQ7A 3IUOA 5HLHA 2WA0A 4FETA 1YITI 2QBYB 1KQ9A 1SD5A 1ZR2A 4BGDA 2M1BA 3MZYA 3OSFA 3OOPA 1RRJA 4C2UA 2LNBA 2K40A 1ON2A 4FISA 3RYRA 2RVCA 3F21A 3QPTA 3CO7C 1K4TA 3AG1H 1BJZA 3OYFA 2FBIA 5IP9J 2YS9A 3LSIA 2B63J 3MEXA 3HOYJ 4CXFA 1I5ZA 3DU5A 4XLFA 4ENNA 3BR6A 2KHMA 2P7VB 3KPHA 3PFYA 3LNQA 2NOJB 4LK0F 1FPQA 2KPMA 5E79C 1R49A 2ZXHA 3G1MA 2M34A 3CDHA 3QU3A 5GAHJ 3BZKA 1OYYA 1LEAA 1YOVB 3KP6A 3MAJA 1MBGA 3HM5A 3ZQHA 1EKEA 2HQ5A 4ZTFA 3H0GJ 1R9TJ 2R7RA 1MBKA 5DYMA 3LMMA 5E1XA 5ILSA 2IW5A 4FHTA 2BHZA 2DFFA 3G4SI 3SZTA 3MD2A 2EFPA 1FMVA 3MZ8A 4JOMA 2VONA 3J7AO 2H6BA 2DPUA 4L9VA 3IWFA 2RDPA 4D7MA 2GXGA 2NVYJ 4WX9A 2CUEA 4B44A 3L2WA 1ETXA 5ERIA 2HDCA 2JZYA 1WQ2A 3BR5A 3C2BA 3S8PA 1ZARA 2R5ZB 4QSHA 5LRRA 4U7BA 3CMAI 2AHQA 5EZHA 4ZZLA 2PMHA 2KZVA 5A2QK 2Y0SN 3RZOJ 4MO7A 1WSUA 3MZHA 2CGPA 1EH6A 2XGDA 5KCMA 5FLXK 3B02A 3F23A 2ZNYA 3I59B 1JXSA 4XLCA 1S8NA 1IZ1A 4HAMA 2NVQJ 1T95A 1Q1HA 1CQTA 2CMPA 1JUSA 4RAGA 2FMYA 5FD5A 5B3SH 3SJMA 1HXDA 4IHSA 3K70D 3CC2I 3S1QJ 4ZDPA 3V4GA 4II2A 2V6CA 5BMZA 3I54A 2WY7Q 1FY7A 2QSFX 2FNPA 3CTAA 5TRDA 3E7LA 3F3XA 5CVIA 1FSEA 4EATA 4EVIA 4IRIA 5EEHA 4UUSB 2CFOA 3OR2C 3TOBA 2XB0X 1GXQA 3PQJA 2UUZA 1O3SA 1VQPI 2JTVA 1D8JA 5L3CA 3H92A 3UNGC 1ZRFA 2AO9A 3OIOA 1YLFA 3CCUI 2PJRA 4HNVA 3CCEI 3FXUA 4I02A 5GPCA 5J47A 4KDPA 2X1CA 1WGXA 3TO6A 2IAIA 4V2FA 3PJRA 2JA6J 3H0DA 1VQNI 1YIJI 2ELKA 3JR9A 1U8BA 5D4RA 2LFBA 2VOOA 2DA1A 1IV6A 3IAM2 1VTNC 2XGXA 1OMIA 2LF7A 3J7YJ 3ZR8X 5B1AH 4IHWA 4CCOA 4MEYF 5HLTA 2V1UA 3LSGA 5GAEJ 4A3IJ 1BJAA 1N75A 2VJJA 5F1RA 2VBZA 1VQLI 3H9GA 1W7PB 1KU2A 3MMYB 1E3HA 2DW4A 3IH3A 3QPHA 4RM3A 3GTJJ 1ZELA 3JREA 3M7GA 4E7IA 1JT0A 4CYCB 1A36A 2HYJA 2KFDA 4IX7A 3K0LA 1I3AA 4PGGA 4U0WA 3HHGA 4LLLA 3EQLF 1XSVA 2K9NA 3FBIB 4BY7J 3VYUB 1LDKB 4KISA 1GVJA 3PNTA 4ZYAA 4GDFA 4C3HJ 4HW0A 3SXYA 1VQ6I 3K4LA 2RNGA 2XAHA 2Q2EA 2W7NA 2Y31A 1WJCA 1A35A 3W6JB 4KT5C 2LD5A 2CUZA 5JHFA 5EJCA 1TWCJ 1W4MA 1PP8F 2EBIA 1PVEA 1NHAA 1K61A 1HDPA 1VF9A 3CC4I 2CH0A 2DJNA 2R7QA 3H3ZA 3ISPA 1RUNA 2EB7A 1X1DA 3OYCA 3TO9A 3P5JA 1MMAA 1ZHFA 2GA1A 1MH3A 5F1JA 1JGGA 2X9DA 2G0EA 1N77A 2LC2A 3GFMA 2VBXA 3OY9A 1Z21A 3JAMK 4A5NA 1IDZA 4MTEA 4RAZA 3A03A 4LB6B 2P0WA 1F5TA 3TGNA 2X6XA 2M0CA 3J81K 3BTJA 4BJTA 3CJNA 2QUFA 2YSRA 3BC8A 4P9UA 4BS9A 2QZ8A 5CKTA 2RKHA 4DOZA 3LSTA 1QVTA 1A31A 2O0YA 2TRTA 4XKVA 3EUKL 2KIMA 1BIAA 3PNVA 1FP2A 4QWQA 3RKYA 3HKZN 5KK1A 1TWHJ 1L0OC 2FOWA 2LYCA 1ODDA 5AIPA 5C4JJ 2QQBA 4HSTA 1LFPA 2YX4A 2H8RA 1GHCA 3EETA 1B72B 1UZCA 4B47A 1BI0A 2F2EA 3PQKA 4LGWA 4A3GJ 5CPRB 2I8DA 3IHUA 2HGCA 3DKYA 1FEXA 2LTPA 3NWTA 4B43A 2K9MA 2JT1A 4AYBA 3BR0A 5GAGJ 2OZ6A 5E18F 1XGNA 2WB1N 2NNYA 4YIIA 2JSPA 4EJUA 3LA2A 5KHDA 3OOUA 3C3WA 3PIOF 4A3LJ 4HNTA 4CICA 3C2GA 4BHCA 1B1BA 1DPUA 3V42A 3RI4A 1BC8C 4AIKA 4OAYA 3WODF 3LA7A 3SDBA 4EJTA 2E35A 2DU9A 1U9OA 5E1ZB 1LPQA 2HXIA 3BJ6A 3K1NA 4XMYA 3AAFA 3LFUA 2HVRA 2XRNA 3OMYA 4FE4A 3L9FA 4C9YA 1YX3A 3MVPA 2VQGA 3EUHA 5LEJA 1FYLA 1F1ZA 1SAUA 3WHCA 3FZVA 4XLAA 2FXAA 1ZGJA 1MMDA 3ZQIA 3ZMTA 4BEHA 1Y8QB 4BBRJ 2A3SA 3VOEA 2YU3A 4ITVA
chains in the Genus database with same CATH topology
4LIVA 3KEYA 2MYSA 3FDYA 3H5NA 2BOLA 2R7SA 3H5AA 1OR7C 3BLYA 3K6GA 3VYRB 2OUMA 1JI8A 4IKFA 2X6WA 2FUG2 4RLQA 3CJRB 3LL7A 3OIPA 1FMWA 3HOTA 3VSLA 4GRIA 4YRVA 2X1EA 4PUSA 1LKXA 1G59A 2JVGA 3OR1C 3PL8A 4IQ4A 3VYSB 1BOBA 3I3LA 2VQCA 2HQAA 3IP4B 1UELB 4XL9A 2Z16A 3HKZA 3EUAA 4KJZA 3OYMA 2F5VA 4N4NB 1KONA 3OYIA 2LBFB 4BQOA 1D1CA 2MC4A 2LREA 1TZLA 2CV1A 4LIUA 4J00A 1D0ZA 3ONQA 2W00A 4J01A 2A5WA 4F3QA 3CP8A 3OYAA 3W2AA 3TBIA 3SZGA 3F9KA 2E1MB 4ZJZA 4D9JA 1DP3A 2R7XA 2WAFA 4F93B 2BW3B 2R7UA 3K4CA 4E6KG 2WAQA 3CP2A 4MLOA 2DT7B 4CH7A 3PUBA 3OWTA 2RQQA 4PJNA 2R7TA 4XN0A 1BR2A 1BR4A 2HZDA 3IAS2 3ZGKA 4YEJA 3DTEA 4II3A 3TL4X 4BU2A 1W36D 2KL4A 4PFPA 2UV1A 1WJEA 2UWMA 3OYDA 3VDXA 5HVQC 4F92B 3MKYB 1AA7A 3K4MA 3PSFA 3OYEA 2BVMA 4NNJA 2VJ4A 2ZSIB 4BACA 4C2TA 1SFKA 2PMZA 2BVLA 3VWBA 1QHGA 1X1BA 4BJ6C 3TMOA 2ZXIA 4HNUA 1E0EA 3EUHC 3PSIA 4PJLA 3VYTB 3DPLC 3A4CA 3OL3A 4KT6A 4DBQA 4XLHA 1X19A 1V5FA 4OAZA 2MD0A 4P1WA 4BDYA 3AKZA 2Q2EB 1HA8A 2K3PA 1DGWY 1MW7A 5CQEA 3QOEA 2R7OA 1N78A 1S9HA 3L2QA 3K70C 2LOOA 2X1DA 2QKLB 2X51A 3DKXA 2CW8A 4PJJA 1Z7LA 4BE1A 2DXIA 2IGMA 1U0JA 3C2HA 3ZCOA 2GOMA 4HEA2 2XC7A 3BCAA 2M7BA 3W2VA 3M8JA 3BG7A 4F52A 3H9JA 4CCLA 3KYLA 4DIQA 3MKZA 4DBRA 3SYTA 4PJMA 3DTIA 2BW3A 4HG2A 2VB6A 1T0FC 1Y6IA 2HDWA 2XAUA 3GBGA 4XR6A 1WFXA 3OYBA 4CA0A 3L2RA 3K10A 4XORA 4XQFA 4H4KC 4N4OB 5FROA 1X1CA 3LSKA 4JQFA 1WJAA 2V7FA 2CW7A 3H9QA 3OYHA 3RQ4A 2VIXA 1DQUA 4KITB 1K6YA 2IS2A 3J7AY 3DWLE 2AQFA 4AVZA 3U21A 4Y3OA 1IRXA 1NG6A 3A1YA 3D5SC 3IUOA 3DLAA 2VL8A 2KQRA 1EA3A 2WA0A 4FETA 1D0YA 2M3AA 2DCEA 3QYEA 4AU7A 3DPTA 2IGNA 4OWRB 4BGDA 2LY1A 2QKMB 4C2UA 2L5QA 2LRDA 4IZZA 4E7HA 3S3NA 3HOSA 1D0XA 4BQQA 2WB1A 1J09A 3OYFA 1MMGA 2X6YA 4BUPA 3LSIA 5HOOA 3OS0A 3DU5A 4XLFA 4ZDOA 2KHMA 2E5ZA 2F6CA 3PFYA 4X0GA 2NOJB 2R7VA 2KPMA 2PJRB 4IQJA 2M7AA 4XKCA 2VXZA 2ZXHA 3SEQA 3A2KA 3AFHA 1UG0A 3BCBA 3HUGB 4XNFA 1LVKA 1D1BA 4DGWB 4ZTFA 3FBNB 2A6TA 2R7RA 2M4KA 4NC8A 3LMMA 3CMMA 4BL0B 3L2VA 3MD2A 1FMVA 2E5NA 2Q1ZB 1X1AA 4FASD 4JOMA 3AL0B 4XONA 3S3OA 4CCKA 2KRHA 2VLAA 2VKDA 3E1SA 2K5CA 2CV0A 4CCJA 2IGKA 4B44A 4CSWA 3L2WA 4U87A 4NQWB 2DJIA 2Z1DA 3S8PA 2CUJA 3DU6A 4U7BA 2L9SA 3OS2A 1PYVA 2KRCA 2KZVA 4E7SA 2E1MC 4RLFA 2XDVA 1V5EA 3L2UA 5KCMA 2LY2A 3K4KA 4XLCA 2K9LA 3LSMA 2L7KA 1T95A 3CZ6A 3HPGA 2O5RA 1Y56A 2CMPA 2AQEA 3ZRGA 3SEZA 4BXFA 2HVSA 2LBFA 3S32A 4HSRA 3ZQQA 2HVQA 3K70D 4XOTA 1G8XA 4ZDPA 2JA2A 1NG7A 4II2A 3RPUD 2V26A 2WY7Q 3RTRA 2IS6A 4PSXA 4EATA 2OC6A 4C30A 4B3XA 3OYKA 3BG6A 3QYFA 3LSHA 2CFOA 5FRMA 3OR2C 4BE2A 3RCOA 2UUZA 4DJAA 2RREA 2IXSA 2WBMA 3UNGC 3OYGA 2PJRA 2IS4A 2X1CA 4HRIA 2IGOA 4QPQA 3DTKA 3PJRA 1BR1A 3D5RC 3H0DA 4XOPA 2HNHA 2ZSHB 3I9V2 1D1AA 4CZCA 4PK4A 3CJQB 3IAM2 2MFZA 1TT0A 3HG9A 3S93A 4CCNA 3ZR8X 5HNHA 4E7JA 4CCOA 5CQGA 4B48A 2MABA 5HLTA 3LSGA 1UAAA 2KMUA 1N75A 2VJJA 2DT6A 1MNDA 4XKWA 3PNYA 4YELA 3H9GA 3MMYB 3D5LA 3OYLA 2M4GA 4XM3A 2X85A 2VJ5A 4XLEA 2ELJA 3MKWB 2Z2SB 1WJ5A 4P5OA 4RM3A 3K4JA 2ZFUA 1WJFA 2XF6A 2HPIA 1ERDA 2R4GA 1ZELA 2WAEA 1PJRA 2GOXB 4E7IA 4BDZA 2CS3A 2L2OA 4IX7A 4E7KA 2KDOA 3VYUB 3FBIB 4KISA 3W3CA 1LDKB 1WJDA 3H35A 3PNTA 4ZYAA 3K4LA 4BJ5C 2RNGA 5TGTA 2VQHA 2W7NA 1WJCA 3DQVC 2VASA 2CUZA 5JHFA 4G6TB 1GLNA 2CV2A 3S3MA 2CH0A 1VZ0A 2LG4A 3CESA 2V6EA 2R7QA 2Y0SA 3DPUA 2M0MA 1X1DA 3OYCA 4XN3A 2V1NA 2LH9A 1MMAA 1MMNA 3M1CA 4R79A 5LD2C 3K4BA 2W4SA 4E7LA 2OV7A 1N77A 4HPQA 2LC2A 4BE0A 3OY9A 1Z21A 1Z3YA 5KNLA 4LG3A 2VQLA 2XF7A 2HPMA 4F55A 2P0WA 2L9NA 1YE9A 1X4PA 2X6XA 1YX5A 3HPHA 2V9KA 4BEHB 4BJTA 4D1QA 2R7WA 2VPLA 2F4IA 2JVHA 4RMNA 3BC8A 4BS9A 3OIQA 4CUGA 3N05A 1QU3A 5CKTA 4DOZA 3CF2A 3NWSA 1DGRM 1W36C 4XKVA 3EUKL 3ZXSA 3PNVA 2KLOA 1MNEA 2LYCA 4NUBA 2HU9A 5HNFA 4HSTA 1LFPA 4B47A 2VJIA 5CPRB 2VXDA 2I8DA 2DOAA 3W2WA 4BQNA 3DKYA 2KP6A 3NWTA 4B43A 2K9MA 4AYBA 2V4JC 3HXLA 1Z3XA 2WY8Q 1V5GA 2JSPA 5KHDA 3UR3C 3OOUA 4Y33A 3E0JB 3HC7A 4XKBA 1WJBA 3OS1A 4E7ZA 1P9QC 3OL4A 4HNTA 3OYJA 3C2GA 2W1OA 4ZTJA 3EPZA 2VKHA 3V42A 5FRNA 4OAYA 3QYBA 4LITA 2IS1A 3K4NA 3SDBA 2XF5A 3AL0C 3HL2A 2E60A 3FKJA 4RM2A 1QHHD 4QPOA 4XMYA 3VSKA 4E4HA 3LFUA 2HVRA 4ZC3A 3DEEA 1X4OA 3H5RA 3KX2A 3OMYA 1OLTA 4C9YA 1YX3A 2VQGA 3RSNA 4CCMA 2XSJC 4NC7A 3G2BA 4PFOA 1SAUA 3QODA 4PSWA 3FHNA 4XLAA 2WADA 5LFAA 2W82A 1MMDA 4Y4RA 4ZDLA 1R6RA 4BEHA 3OYNA 4ANJA 4F91B 2JUGA 4ITVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSJ C;  1JI8 A;  1YX3 A;  1SAU A;  3OR1 C;  2A5W A;  2V4J C;  3OR2 C; 
#chains in the Genus database with same CATH topology
 2ZME B;  1FYK A;  3ESW B;  4LIV A;  2OU2 A;  2OAZ A;  2R7S A;  3GF2 A;  2HOA A;  2CU7 A;  3BLY A;  3F8F A;  1UHS A;  3L00 A;  4N9I A;  1JI8 A;  2DA5 A;  4RLQ A;  5F27 A;  5F64 A;  2ZXJ A;  4HX8 A;  1G3T A;  4YIF A;  2E7W A;  1B8I A;  1DP7 P;  5H20 A;  3RPQ A;  3VB2 A;  1G2H A;  1RUO A;  4MTD A;  3BZC A;  1SVO A;  1X2N A;  2X1E A;  3K9T A;  4PUS A;  4AID A;  3OR1 C;  4DYC A;  1FT9 A;  2JJ7 A;  5F0F A;  1ETY A;  2FD5 A;  3EUA A;  3OYM A;  2RAE A;  2K4B A;  3DKW A;  2WWY A;  3OYI A;  3WGH A;  3E6B A;  4AIJ A;  2EH3 A;  3RZD J;  4RGS A;  1YJW I;  3DBH B;  1X3Z B;  2O3F A;  1KYW A;  1ZH5 A;  4G7H F;  1LQ1 A;  4J01 A;  2IA2 A;  1ORK A;  2WTE A;  2BZT A;  4OIN F;  2E1M B;  4DYQ A;  1DP3 A;  2KRF A;  1G6N A;  5EF6 A;  2R7X A;  4L9J A;  1O7F A;  2D45 A;  4F93 B;  1WI9 A;  2D2W A;  5EGO A;  3FXQ A;  3CP2 A;  4MLO A;  1I50 J;  4XLP F;  4DNC A;  1HQC A;  4M9Z A;  1FC3 A;  1B59 A;  3QPL A;  2VOP A;  1BR2 A;  3QP5 A;  3JRG A;  2PFB A;  3FIW A;  2MC3 A;  4HF2 A;  1H89 C;  5HLG A;  4PFP A;  2UV1 A;  2KIS A;  2RGV A;  1S72 I;  1PUF A;  2NS0 A;  1VQ7 I;  4ZYG A;  3OYE A;  2BVM A;  4NNJ A;  4XRS G;  1ZLJ A;  4UNO A;  3TDU C;  1LVA A;  2BVL A;  4BYY A;  3ZQL A;  2Q8K A;  1J5Y A;  2ZJR F;  1QO0 D;  5IYC J;  2ZJP F;  1PP7 U;  1BI2 A;  3HGY A;  3VYT B;  4D5F A;  5ICF A;  1HCR A;  3WTU C;  4P9F A;  3OL3 A;  4BHP A;  4RB1 A;  1U5T A;  3T1B A;  1H9T A;  1ZGA A;  3GLX A;  3ZOB A;  1ZN2 A;  4P1W A;  2G7H A;  4L0Y B;  2Q2E B;  1HA8 A;  1I27 A;  1YRN A;  4LMY A;  2P8T A;  2DTR A;  3G1O A;  5CQE A;  3IH4 A;  1FYM A;  3QOE A;  2PI0 A;  2JPC A;  1K78 A;  1S9H A;  1XB4 A;  3DP7 A;  3K70 C;  4BNC A;  4L5E A;  4CO8 A;  5D5W B;  4GFB A;  2CO5 A;  3KEQ A;  4U0Y A;  4L5I A;  2CW8 A;  4PJJ A;  4G7Z F;  3QWL A;  2IA1 A;  5DD4 A;  5FD6 A;  5K1Y A;  2EPF A;  2IGM A;  4G9Y A;  4B1R A;  4HEA 2;  2XC7 A;  1SFO J;  1LEB A;  2QQ9 A;  4HF1 A;  2FRH A;  2NVT J;  1SFE A;  4F52 A;  5B66 C;  4CCL A;  3WTT C;  4FTH A;  3O8H A;  2HR3 A;  1IN4 A;  3MKZ A;  3LAJ A;  4PJM A;  5E1W A;  1S7O A;  4A0X A;  3WTW C;  1D3Y A;  1K6O A;  1XSX A;  1Y6I A;  2XPV A;  5GPA A;  4HA8 A;  1JUP A;  1SAN A;  2EIM H;  1P7I A;  2XKO A;  1IXC A;  1WFX A;  3RPU A;  3OYB A;  1JKQ C;  3S1M J;  3ZQC A;  4CA0 A;  4XOR A;  5FKM A;  1G4D A;  4N4O B;  3E6D A;  5J3L A;  1X1C A;  3LSK A;  1MZB A;  1QRY A;  1SD4 A;  3KEO A;  1WZ2 A;  3GTO J;  2FNA A;  2Z3Y A;  2W25 A;  1LE8 B;  2V1X A;  2QCO A;  3OYH A;  2K3F A;  3RQ4 A;  1DQU A;  2HQN A;  3CUO A;  5DUK A;  3DWL E;  2AQF A;  4AVZ A;  2EQR A;  4HX4 A;  3U21 A;  3A1Y A;  2FML A;  3DLA A;  3GWZ A;  2V79 A;  3BR1 A;  2DCE A;  3QAH A;  2IGN A;  3JTH A;  4M6V A;  4OWR B;  5L3G A;  3N97 A;  3R6S A;  2LY1 A;  5JR3 A;  3CCR I;  1GV2 A;  3SZP A;  2VUM J;  5J6X A;  2L5Q A;  3T0Y A;  3ML6 A;  3LOC A;  2LRD A;  1H9G A;  4E7H A;  3IV5 A;  1O3T A;  1R23 A;  1D0X A;  2DA7 A;  1N25 A;  4D0P A;  5FKN A;  2VC0 A;  3BDD A;  4PZJ A;  3WG7 H;  1I3Q J;  1RKW A;  2RNJ A;  2F6C A;  4X0G A;  2VN2 A;  2EFQ A;  5ILU A;  2VXZ A;  2FEZ A;  2V9V A;  5KAI C;  2XPU A;  1ZR4 A;  3HYI A;  1UG0 A;  5TJJ A;  3EDP A;  3GEZ A;  3HUG B;  4M73 A;  3L09 A;  3HOU J;  2R92 J;  4XIC A;  3REO A;  3FBN B;  3EYI A;  4NC8 A;  5B1B H;  1V3F A;  5FFZ A;  3MN2 A;  1T6S A;  5D8L B;  4BXX J;  3BT9 A;  3DLL F;  2Q1Z B;  2EWN A;  4FAS D;  3F8C A;  2EZI A;  3FWE A;  3S3O A;  2VKD A;  2MGQ A;  3E1S A;  3I56 I;  2K5C A;  4EV0 A;  3CQZ J;  3FXL A;  4U87 A;  2EZH A;  5ICC A;  2DMU A;  1MH4 A;  2Z1D A;  4NC6 A;  5JFR A;  2GM4 A;  4OIP F;  4G7O F;  3OS2 A;  4UB8 C;  1B8I B;  1E2X A;  3IRR A;  2BGC A;  3R4K A;  2E1M C;  2CG4 A;  4RLF A;  3TW7 A;  1T98 A;  1Y39 A;  1V5E A;  4LOC A;  3ZQG A;  1V4R A;  4EGZ A;  4HLY A;  2K9L A;  1HW2 A;  1IG7 A;  3LSM A;  2L7K A;  3CZ6 A;  3GZ5 A;  1T39 A;  4XRF A;  4NBQ A;  4UVC A;  2DMP A;  3PO2 J;  4JYK A;  2GZW A;  2WC2 A;  4EM2 A;  3LSR A;  2EFN A;  2HVQ A;  2EIL H;  2NXN B;  1YO5 C;  2JA2 A;  3RPU D;  2V26 A;  2IS6 A;  5C44 J;  2W84 A;  4PSX A;  2Z5U A;  4B3X A;  4A6E A;  3LSH A;  2UZK A;  3J80 Z;  4ON0 A;  2HWV A;  4BE2 A;  5LHH A;  2LDU A;  4CYD A;  3AG2 H;  4DJA A;  3GTP J;  1RZ4 A;  3PIP F;  1BN5 A;  2M8G X;  4HRI A;  4ETS A;  5LGN A;  4QPQ A;  1D5V A;  3DTK A;  1X3U A;  3D5R C;  5EGO B;  4XOP A;  2ZSH B;  3I9V 2;  1J2X A;  1D1A A;  3O8G A;  1MIJ A;  3CJQ B;  1TW3 A;  2Y2Z A;  3SFI A;  3HG9 A;  1Y0N A;  3DBL B;  5HNH A;  3JSP A;  5L3E A;  1WHU A;  2ZO4 A;  4B48 A;  4KYW A;  3ZP5 A;  2EA2 A;  4Y15 A;  5FKL A;  1MND A;  3PNY A;  4JX5 A;  4YEL A;  2ME6 A;  2JA7 J;  1LUJ B;  1IRF A;  3OYL A;  2MLG A;  2H09 A;  4XLE A;  2ELJ A;  1XD7 A;  3MKW B;  2L7M P;  3S1R J;  5DCM B;  3W6V A;  1XMA A;  3C18 A;  2LR8 A;  4PJ0 C;  2FBK A;  4XSX F;  2XF6 A;  2R4G A;  2WAE A;  4M72 A;  4NQW A;  3GFI A;  1TBX A;  5IT3 A;  1FBU A;  3B6A A;  4BDZ A;  2HKX A;  1XMK A;  2KDO A;  1XG1 A;  1CF7 A;  2F5E A;  1WJD A;  3H35 A;  4FE7 A;  2P81 A;  2W48 A;  1E17 A;  1YRN B;  1XCB A;  4LLG F;  4PCQ A;  3E5X A;  1WPK A;  2Y0S A;  3DPU A;  5DEQ A;  3N4M A;  2X6O A;  1XDS A;  3S2W A;  1OR7 A;  1FNN A;  2DA4 A;  2JSC A;  4M71 A;  3WTZ A;  2STW A;  2OCE A;  2L9V A;  2HOS A;  5HS7 A;  2DDA A;  1MMN A;  3CCL I;  2IBD A;  5LGT A;  4MFE A;  3FM3 A;  3FXK A;  1RPW A;  1SAX A;  3NEU A;  4HPQ A;  1YHQ I;  2LKX A;  1G3Y A;  4GXO A;  4WXH A;  4JK1 X;  4R8H A;  1ZG1 A;  4I01 A;  2P6S A;  2HPM A;  4F55 A;  2ESN A;  2A5Y B;  1YX5 A;  3HPH A;  3PFI A;  1STZ A;  1IUY A;  1FX7 A;  2JVH A;  2E7X A;  1MBE A;  2BV6 A;  3SFZ A;  4I09 A;  5H6R A;  1S7A A;  5FLV A;  1P4A A;  3NWS A;  1YS7 A;  3I4N J;  3O2P E;  3ZXS A;  2OBP A;  4DW6 A;  1OFC X;  2BYV E;  1OJL A;  1MNE A;  1WH5 A;  3NAU A;  2HU9 A;  3GCM A;  4IO9 F;  3Q9S A;  4KIF A;  4A0Y A;  1ULY A;  5D5V B;  1P4X A;  2PG4 A;  2DOA A;  4BQN A;  1TWF J;  1QZE A;  3F6V A;  4KN4 X;  3CMY A;  1L3L A;  2VC1 A;  2CFX A;  3DEW A;  2EFO A;  3S16 J;  2V4J C;  3HXL A;  4I2O A;  4AM3 A;  2VE8 A;  2FE3 A;  2L4A A;  1Z6R A;  3Q5F A;  1TTY A;  4IF4 A;  3CUQ A;  1O7L A;  3KP5 A;  3KYD B;  1FTT A;  4Y33 A;  3KP4 A;  3GZ6 A;  3E0J B;  3HC7 A;  1WJB A;  3OS1 A;  1JGS A;  3OL4 A;  5DTD A;  2L0K A;  1TP4 A;  4L0Z B;  2W1O A;  4ZTJ A;  2VKH A;  3S1N J;  2ADU A;  5FRN A;  4BXU A;  4LIT A;  3K4N A;  5GTH C;  5EEA A;  2O9L A;  4KN7 X;  1FWZ A;  2E60 A;  2EV5 A;  1MJB A;  4HLX A;  2M8E A;  1SVM A;  4LK1 F;  3GYH X;  2XGE A;  4Y7N J;  4ZC3 A;  6PAX A;  2FX0 A;  1BW5 A;  1OLT A;  4LB5 A;  3WE3 A;  2DFI A;  1GV5 A;  2E71 A;  3BR3 A;  2XHK A;  3JRI A;  2BY1 A;  1LFU P;  1MBF A;  3FKI J;  4L18 B;  5M5W J;  4MGR A;  3KP3 A;  4NC7 A;  3G2B A;  3QOD A;  1XDU A;  1R1T A;  2PMZ N;  4LFU A;  1K79 A;  1A6Q A;  2WAD A;  5LFA A;  1R6R A;  5DM6 F;  3I64 A;  1UHW A;  5J8F A;  2RC4 A;  1HKQ A;  3KFW X;  3FDY A;  5J4V A;  5EG0 A;  1QBJ A;  4HX7 A;  3H5A A;  4NDL A;  5H2F C;  3K6G A;  4WF2 A;  5EEG A;  1Z7U A;  1XTA A;  3FK6 A;  5HDG A;  1KQ8 A;  3SHF A;  1A6I A;  1T56 A;  1E3O C;  1FMW A;  2BXY A;  1F4K A;  4W1U A;  3HOT A;  4M9S A;  3BTL A;  2E2J J;  2DDB A;  2WV1 A;  3VSL A;  4GRI A;  5DS9 A;  1LKX A;  3PL8 A;  3VYS B;  3BR2 A;  3ZN0 A;  2XAF A;  2Z16 A;  3HKZ A;  4KJZ A;  1NK2 P;  3UKG A;  1PDN C;  4RDU A;  4HQE A;  3FXM A;  2OCC H;  5D5X B;  4A3J J;  1D1C A;  2DK5 A;  1TZL A;  1XPX A;  3LFK A;  4RBO A;  2F5C A;  4O5V A;  2VI6 A;  2Y9Y A;  2JA8 J;  2W00 A;  2ACJ A;  3IKT A;  2HS5 A;  2DTZ A;  4F3Q A;  2JWT A;  3W2A A;  2I10 A;  1HSJ A;  2L3D A;  3FK7 A;  4C2M J;  2R7D A;  2VT3 A;  3I4P A;  3E3V A;  4JBA A;  5DV5 A;  4D9J A;  2K86 A;  1IXR C;  3KZY A;  3HOX J;  5KAF C;  2GIZ A;  3F22 A;  2H94 A;  2R7U A;  2WAQ A;  3ZMD A;  3R0J A;  3B73 A;  4CH7 A;  3PUB A;  1FOK A;  1Z1D A;  4PJN A;  2QEN A;  4XN0 A;  2UXX A;  1BR4 A;  3IAS 2;  4D5C A;  1OYW A;  5DM7 F;  3ZGK A;  4ZZD A;  1U5T C;  4YEJ A;  3DTE A;  4Z2Y A;  4X6A J;  1U3E M;  1T33 A;  4BU2 A;  2KL4 A;  4Q5S F;  4I99 C;  2QA4 I;  1NK3 P;  4G6Q A;  3RDI A;  2UWM A;  2CQQ A;  3TQN A;  2COB A;  2L4M A;  1XN7 A;  5JHU A;  3OYD A;  2ISY A;  4KNY A;  1B6A A;  1F36 A;  2HKO A;  3MKY B;  3KLO A;  2JRM A;  1AA7 A;  3PSF A;  1HLV A;  2ZSI B;  4BAC A;  2TCT A;  2IJL A;  2EZK A;  5FKK A;  4WWC A;  2ETH A;  1UB9 A;  5TIS C;  5ICE A;  3VPR A;  3FMQ A;  1JKO C;  4L9T A;  4BJ6 C;  2ZXI A;  4EQQ A;  4DYR A;  2CW0 F;  1ZG5 A;  2A68 F;  1E0E A;  3FMS A;  1XGM A;  3A4C A;  3X2Q H;  1IC8 A;  1XC5 A;  2NVU B;  1JKP C;  4DBQ A;  1CF7 B;  1V5F A;  4ESF A;  1OCZ H;  4ENM A;  2BY2 A;  2L9R A;  4Q47 A;  1ITY A;  2M45 A;  2FA5 A;  2XAG A;  3AKZ A;  4BDY A;  4EEF G;  2XRO A;  4EJV A;  1K83 J;  2K3P A;  3P7N A;  2HI3 A;  2E2I J;  4I7H A;  2DOE A;  4PGH A;  4WCG A;  1Q1V A;  1RKT A;  3L2Q A;  1C0W A;  1T2K A;  2LOO A;  4P96 A;  2QEX I;  2GAU A;  1LJ9 A;  2X1D A;  1O4X A;  1J75 A;  2XRL A;  5FJ8 J;  1AKH A;  3CDL A;  5F0C A;  2X51 A;  3CDI A;  1QVU A;  1WKM A;  1Z7L A;  3GTL J;  3GTM J;  3NRV A;  1U0J A;  2O03 A;  2DK8 A;  3ZCO A;  2MW8 A;  4KUM A;  1BW6 A;  2M7B A;  5D5U B;  3W2V A;  3ZMS A;  1HW1 A;  3T8R A;  4UB6 C;  2BE5 F;  4DBR A;  3OV8 A;  3CCS I;  4AVP A;  3DTI A;  2BW3 A;  1MGT A;  1R71 A;  5ED4 A;  1A5J A;  4HG2 A;  5IT9 Z;  2VB6 A;  1B9N A;  4TV7 A;  3TDZ C;  2BHY A;  3FXR A;  2L7Z A;  3I58 A;  1VQM I;  2O8K A;  3BG3 A;  4EGY A;  5JVG F;  5J4Y A;  2IRF G;  5FRO A;  1TQM A;  4JQF A;  1VQ8 I;  2A6E F;  4ESB A;  1ZGW A;  3TED A;  1RR7 A;  5F6F A;  2CW7 A;  2ESH A;  3H9Q A;  1V54 H;  3J80 K;  2VBY A;  4RB3 C;  2M5W A;  4MQ9 F;  2FOK A;  1NG6 A;  4HF0 A;  3H36 A;  2LLK A;  2VL8 A;  1EA3 A;  3C1D A;  1U8R A;  3F0C A;  2M3A A;  4IXA A;  5IP6 A;  4CGZ A;  4A93 J;  3DPT A;  4ASN A;  4G12 A;  1T0F A;  3F72 A;  2OQG A;  1UJ8 A;  3KP7 A;  3W6K B;  1MD0 A;  2OTJ I;  1YI2 I;  3I71 A;  2QM3 A;  3MQ0 A;  4V19 K;  4IZZ A;  2DOF A;  3HRS A;  2XIG A;  2P4W A;  4IL6 C;  3HOS A;  5CVR A;  2MLK A;  1J09 A;  5CJ9 A;  3BPX A;  5EZG A;  1MMG A;  1IW7 F;  1X1P A;  2X6Y A;  3GTK J;  1RES A;  3OS0 A;  1G3S A;  4Y13 A;  1LNW A;  5LHG A;  3WTV C;  1J0R A;  3FXJ A;  4I6Z A;  1WH7 A;  2E5Z A;  2R7V A;  2XVC A;  3CCQ I;  2KIQ A;  4LG0 A;  2PJR B;  3HOV J;  4XKC A;  4L5J A;  1JUM A;  3GFJ A;  2QYO A;  1Y0U A;  2M87 A;  3GO5 A;  3A2K A;  3AFH A;  3BCB A;  5CLS A;  3VOD A;  1ZAO A;  3BPV A;  3I53 A;  2FF4 A;  1D1B A;  4DGW B;  1YW7 A;  5FLX Z;  2P7C B;  2VKV A;  5J8C A;  3BY6 A;  1R36 A;  1ETW A;  5LBQ A;  4BL0 B;  1IN6 A;  3QP6 A;  1BIB A;  1DPR A;  2E5N A;  4M3E A;  2HFH A;  5E8G A;  4CCK A;  2XSD C;  2CWE A;  3E6C C;  1R1U A;  4CCJ A;  1JTX A;  5IOZ A;  2CUF A;  2DJI A;  1T38 A;  4A6D A;  3DU6 A;  5AIQ A;  2L9S A;  5D6F A;  4OIR F;  4ENK A;  1PYV A;  2KRC A;  2OF7 A;  4E7S A;  1W1W E;  2O7O A;  3CLO A;  1DU0 A;  2XDV A;  1AOY A;  1EV7 A;  1MJA A;  3TO7 A;  1XMX A;  3HSR A;  2ISZ A;  1JHH A;  2MH2 A;  2MA3 A;  5IY5 H;  1P6R A;  2QBY A;  2F48 A;  3HPG A;  3RKW A;  2O5R A;  1Y56 A;  5CVU A;  5J1R A;  4YFN F;  1TL8 A;  4RGU A;  4RS8 A;  4BXF A;  1IGN A;  2HVS A;  4BY1 J;  3GLL A;  2ZNZ A;  4HSR A;  5EDN A;  3DCF A;  2R3S A;  3HRT A;  5L3D A;  3BRO A;  3QPS A;  4XOT A;  1UFM A;  4BKX A;  1HBX G;  1NG7 A;  1X2M A;  3WU1 B;  1H0M A;  4KIG A;  2I5U A;  4C30 A;  2AXL A;  3OYK A;  3BG6 A;  5DUI A;  3A0H C;  3IC7 A;  2A69 F;  3RCO A;  3IKV A;  1KQ0 A;  2FJ1 A;  2MG4 A;  3F6O A;  4ESJ A;  3ASO H;  5IYB J;  4MQV A;  2IXS A;  3GVA A;  3CF5 F;  1TNS A;  5E20 A;  1S5L C;  4IOC F;  2IS4 A;  1NH3 A;  2XV4 S;  4RAY A;  4MEX F;  3BJO A;  2BY3 A;  3HRM A;  4Q4Z F;  4PK4 A;  3G71 I;  2QVO A;  1HC8 A;  2QGU A;  3Q3S A;  4XSZ F;  4CCN A;  4E7J A;  2ZJ2 A;  2PEX A;  4IPA A;  3TKY A;  4A3C J;  3NAR A;  2NS8 A;  5FLM J;  1O3Q A;  5F08 A;  4NB5 A;  4KA4 A;  2COM A;  1Y1W J;  1W0U A;  2M4G A;  1GXP A;  1XS9 A;  1W5C C;  2X85 A;  3S2H J;  1AHD P;  1IRG A;  3M07 A;  2Z2S B;  1WJ5 A;  3F8M A;  4P5O A;  3RKQ A;  5HS9 A;  1MKM A;  2E1O A;  1HOM A;  2ZFU A;  4RAF A;  1ERD A;  1R4M B;  1PJR A;  1IUF A;  2GOX B;  4I0B A;  4G6D A;  4XBF A;  2R5Z A;  1YW8 A;  2XKP A;  2C6Y A;  2Q0O A;  3Q0W A;  3L1P A;  5FB2 A;  2V9P A;  2DMQ A;  3W3C A;  2ID3 A;  2X4H A;  1MDM A;  1BBY A;  1H88 C;  2HDD A;  1RC9 A;  5TGT A;  1ENH A;  2VQH A;  3I59 A;  3L7W A;  2KIF A;  2QWW A;  1YS6 A;  1GLN A;  1RR8 C;  1S6L A;  2K85 A;  3S3M A;  2CV2 A;  5CYV A;  3V8L A;  2V6E A;  1VZ0 A;  2LG4 A;  2ZC2 A;  3CES A;  2TDX A;  1QPI A;  1YG2 A;  2M0M A;  4XN3 A;  2HYF A;  1VI0 A;  4UV9 A;  3A01 A;  5LEK A;  3M1C A;  4W97 A;  4XK4 A;  3K4B A;  2W4S A;  4R79 A;  4E7L A;  5LD2 C;  2HOE A;  1TQI A;  2CYY A;  4BE0 A;  3L2C A;  3CJT B;  4MHG A;  2GLO A;  1IN8 A;  1Z3Y A;  2FQ3 A;  4HZF A;  5KNL A;  1UST A;  2VQL A;  2XF7 A;  5K7F A;  4OIQ F;  1TQP A;  4ENJ A;  3U1K A;  2KJB A;  2L9N A;  1YE9 A;  1X4P A;  2PQ8 A;  4D1Q A;  1POG A;  2V9K A;  2DA6 A;  4BEH B;  3FHZ A;  2R7W A;  1I6X A;  4A3F J;  2ZJQ F;  4RMN A;  1OCP A;  2FSW A;  2LF8 A;  5K5R A;  3OIQ A;  4KIC A;  3CUQ C;  4CUG A;  3M4O J;  3N05 A;  1R5H A;  1QU3 A;  4QLC U;  4GGG A;  1QZY A;  3LAP A;  2XUB A;  3CF2 A;  4XID A;  1MBH A;  4YFK F;  3WTY C;  4WXC A;  4C3I J;  1RIO H;  2XPW A;  1OKR A;  3V7C A;  2KLO A;  3R0A A;  5LGU A;  5M5X J;  2PBI A;  2E36 A;  5HNF A;  4ZYH A;  5FFX A;  3JRH A;  3AG4 H;  1W7P A;  3PUF A;  1J9I A;  2VXD A;  3W2W A;  1ZRC A;  4D7N A;  5IYD J;  2KP6 A;  3ERM A;  1Z3X A;  2WY8 Q;  4IOA F;  1V5G A;  2FU4 A;  4CYC A;  1AWC A;  3ZMU A;  1EJ9 A;  2GWR A;  3OSG A;  1HKS A;  2QQ8 A;  3M9A A;  1GT0 C;  1Z67 A;  3EPZ A;  2LY9 A;  2Y75 A;  3KET A;  1P4W A;  1EF4 A;  3QYB A;  2IS1 A;  2KZG A;  5GP9 A;  4HOB A;  2MD5 A;  1CGP A;  1QHH D;  4QPO A;  1X3W B;  3RIR A;  3BTC A;  4DQ2 A;  4LG0 B;  3T5X A;  2NVX J;  1X4O A;  1BOA A;  3H5R A;  1DU6 A;  1VQO I;  2O61 A;  1Z91 A;  1T8I A;  1QNT A;  2EV0 A;  2VT2 A;  3LA3 A;  4GCV A;  3RSN A;  3SDG A;  4CCM A;  1HF0 A;  2XSJ C;  1VQ9 I;  4ZH4 F;  2DA2 A;  2OZU A;  3ZN1 A;  2QSH X;  3Q9V A;  2J5O A;  1KZH A;  2UXN A;  2W82 A;  2ZXW H;  4FX0 A;  3A0B C;  4ZDL A;  2DPD A;  2JA5 J;  1WVR A;  3PO3 J;  1PUF B;  4ANJ A;  3T8T A;  4F91 B;  1R58 A;  3LQR A;  2EFW A;  2WV0 A;  2ZFW A;  3ABT A;  3H5N A;  3VFZ A;  2A6H F;  1MBJ A;  2BOL A;  5GTI C;  2LKP A;  1LDD A;  2X6W A;  2DOD A;  2FUG 2;  5M5Y J;  4YG2 F;  4F7Z A;  3CD6 I;  3LL7 A;  1Z9C A;  1IRZ A;  4OIO F;  4S0H B;  2LKS A;  4RGR A;  1B72 A;  2YU9 J;  1OQY A;  1U5T B;  5H6Q A;  5BQT A;  5M3M J;  3GTG J;  3ABK H;  2YX7 A;  1G59 A;  2JVG A;  1R00 A;  3I3L A;  3BQY A;  4Y17 A;  2NAZ A;  3P9I A;  5CVJ A;  3S2D J;  2HQA A;  3IP4 B;  4E70 A;  5J1U A;  3U2R A;  2IT0 A;  1ZKG A;  5DCF A;  3GW2 A;  4EJW A;  4N4N B;  1K78 B;  1KON A;  3K69 A;  4XRM A;  1R5G A;  3M3Y J;  4MIM A;  5IT9 K;  3R61 A;  2DMT A;  4N9H A;  4LD5 A;  4LIU A;  1D0Z A;  4B8X A;  3ZQ7 A;  2K02 A;  3DEU A;  1HDD C;  2A5W A;  2RN7 A;  3OYA A;  1R1V A;  3HTS B;  2H6C A;  2NNN A;  3SZG A;  5BPI A;  1W7P D;  3J7Z I;  2HZT A;  1Y8R B;  2NS7 A;  1WCM J;  4FT8 A;  2JRT A;  5HDN A;  2CJJ A;  2PMU A;  2ELH A;  3K4C A;  4E6K G;  1MMS A;  1EH8 A;  3HTU A;  2DT7 B;  3I5U A;  4EMS A;  3OWT A;  4A2U A;  2R7T A;  1Z05 A;  5FO5 A;  1I39 A;  2P5V A;  4II3 A;  1YW9 A;  1S7E A;  1BI3 A;  3WE2 A;  1W36 D;  2ICW G;  4B09 A;  1SMT A;  4IVN A;  2ZME A;  1FBS A;  3K4M A;  1O3R A;  2MH9 A;  3WHB A;  2IEK A;  1J59 A;  2ID6 A;  1SFK A;  3BP8 A;  2PMZ A;  4DZP A;  1MSF C;  3KZZ A;  1I1S A;  1XGS A;  2A07 F;  3VWB A;  1QHG A;  3E5U A;  3TMO A;  1Z77 A;  3QQA A;  3HDD A;  2OQR A;  4G8X A;  2G7U A;  2YR2 A;  4M6Y A;  3EUH C;  3VEP A;  3H3V K;  3CLQ A;  3DPL C;  3GTQ J;  1IN5 A;  2KT0 A;  4FQG A;  3FXO A;  5L3F A;  2BBY A;  2K4J A;  2H1L A;  1YTY A;  1YYV A;  1X19 A;  3BZ6 A;  4OAZ A;  1MDM B;  2BXZ A;  2K27 A;  4ABZ A;  2MD0 A;  2HTS A;  5ICG A;  1ZRE A;  1LB2 A;  1O57 A;  1FZP B;  1DGW Y;  3FIS A;  5FGM A;  5ILV A;  1FOX A;  1KYZ A;  2R7O A;  3FX3 A;  3JRA A;  1N78 A;  4HYE A;  1KU7 A;  1IO2 A;  2QKL B;  3WGI A;  3ELK A;  2GXB A;  1GVD A;  3DKX A;  2N8G A;  3A01 B;  3KCC A;  3WG9 A;  1KU3 A;  1A04 A;  3ABL H;  4KIB A;  1ZLK A;  4BE1 A;  2E34 A;  1FP1 D;  1AU7 A;  2FQ4 A;  2X48 A;  4UVB A;  2GOM A;  3BCA A;  1IJW C;  3DFG A;  3BG7 A;  3IRQ A;  4RGX A;  3I55 I;  4HDU A;  1MJ9 A;  4Z6Y A;  1S29 A;  2EJR A;  3SYT A;  5L3B A;  5K5O A;  4JX6 A;  4EM1 A;  1T0F C;  2LK2 A;  4GO1 A;  4HV6 A;  2HDW A;  2XAU A;  5M3F J;  1REP C;  3GBG A;  2A05 A;  3ROU A;  5DD8 A;  3HZJ A;  3K10 A;  4H4K C;  5E17 F;  4B3A A;  4I0A A;  3GUD A;  1WJA A;  1DUX C;  1OCR H;  4UV8 A;  2EIK H;  2DN0 A;  3MCZ A;  4KIT B;  4WXD A;  2IS2 A;  5C3E J;  3TW6 A;  5HS8 A;  3ZQF A;  4EM0 B;  4A3D J;  2KQR A;  2P5K A;  2NYX A;  1D0Y A;  5K7Z A;  3QYE A;  3M8E A;  2XB5 A;  4XLN F;  1QQI A;  4AU7 A;  3Q0U A;  2O6G E;  2DFE A;  1K4S A;  1FIA A;  3ZMV A;  3KP2 A;  2QKM B;  1TC3 C;  3K7A J;  2VE9 A;  1VFC A;  2PLY A;  3S3N A;  2Y69 H;  4OMY A;  3BOQ A;  4UHT A;  1ETK A;  4BQQ A;  2WB1 A;  2XAS A;  3WU2 C;  4AWX B;  1P7J A;  4BUP A;  2B0L A;  3JCU C;  1VQ4 I;  5EYR A;  2W85 A;  5HOO A;  3WTX C;  4ZDO A;  3U1D A;  3COA C;  5D4S A;  2M2E A;  4IQJ A;  2M7A A;  3A02 A;  2LP0 A;  3M1E A;  3QRF F;  1H8A C;  3SEQ A;  1UHM A;  4XNF A;  2HOT A;  1LVK A;  3IH2 A;  2ZB9 A;  4IJA A;  2DAO A;  2MBF A;  2A6T A;  3I4M J;  2CQK A;  2M4K A;  5E3N A;  2RV8 A;  9ANT A;  3CMM A;  5BPD A;  3CCY A;  5J40 A;  1BM9 A;  3L2V A;  1ZQ3 P;  1TNT A;  1X1A A;  4EJO A;  1WRJ A;  3AL0 B;  4N0B A;  1JTY A;  2H1K A;  4XON A;  5CVV A;  1F9N A;  2Y30 A;  2KRH A;  2VLA A;  2CSO A;  1ZYR F;  2CV0 A;  4FX4 A;  2OD5 A;  3BG9 A;  2IGK A;  1WI3 A;  2M30 A;  3DV8 A;  4CSW A;  4J19 A;  3JRB A;  5E3L A;  1VQ5 I;  1FJL A;  2Y48 A;  4NQW B;  4UUV A;  2CUJ A;  4M3F A;  1LE8 A;  2B7E A;  3HSF A;  3DXJ F;  3H1C A;  2BEO A;  3CCM I;  1GDT A;  3ZPL A;  3R60 A;  5E8I A;  3RKX A;  1FIP A;  3V8K A;  3L2U A;  3KYC B;  1HW5 A;  2L54 A;  2LY2 A;  2QQA A;  3K4K A;  4GYG A;  2DT5 A;  2RQP A;  4Q48 A;  5D6E A;  1JE8 A;  2PN6 A;  2AQE A;  1OYI A;  3B6C A;  3HSE A;  3SEZ A;  3ZRG A;  2P5L C;  2LBF A;  3S32 A;  1IAW A;  2HEO A;  3ZQQ A;  2KIU A;  1G8X A;  3RTR A;  3LWF A;  3KLN A;  2Y9Z A;  3GZN B;  4P55 A;  3S17 J;  1TWG J;  2QSG X;  2OC6 A;  2J5P A;  5HOD A;  3QYF A;  5FRM A;  1SC7 A;  1IXS B;  2WAQ N;  2Y0M A;  2L01 A;  4CHU A;  2Z33 A;  2DFH A;  3F8N A;  2HQR A;  2RRE A;  2EK5 A;  4IHX A;  1I1G A;  2WBM A;  2GXA A;  4U88 A;  3OYG A;  3JRF A;  1JJ6 C;  1D5Y A;  1B9M A;  4KMF A;  2IGO A;  4XRS A;  1BR1 A;  1UG2 A;  1FBQ A;  2HNH A;  3HUG A;  2IA0 A;  1ZTR A;  4CZC A;  2VKE A;  2Z99 A;  1ONV A;  3MKL A;  1FOW A;  2E19 A;  2MFZ A;  1TT0 A;  3S93 A;  3E6M A;  4QTR A;  1SD7 A;  1W0T A;  4Y52 J;  3FM5 A;  4S04 A;  5CQG A;  1P92 A;  2MAB A;  3MWM A;  4AYB N;  2CQN A;  4U7D A;  1UAA A;  2KMU A;  2DT6 A;  4IRG A;  3RJP A;  2STT A;  4AIH A;  4XKW A;  1BA5 A;  4B4C A;  3D5L A;  4HQM A;  2F4M B;  4XM3 A;  2VJ5 A;  2KKO A;  1ZRD A;  1KA8 A;  2XAJ A;  4BQA A;  2KJC A;  3K4J A;  1WJF A;  3HGG A;  3RQI A;  1LDJ A;  2IVM A;  2HPI A;  5K7H A;  2E1C A;  1FOY A;  1YJN I;  2L7F P;  2CS3 A;  2NOG A;  2L2O A;  3CUQ B;  3MFK A;  1X58 A;  4E7K A;  1YQA A;  1U9N A;  3ECO A;  2EZL A;  2P6T A;  5B5E C;  1RET A;  2D1H A;  4BJ5 C;  4MFD A;  3ERE D;  4LLN A;  4QIW N;  3DQV C;  4AC0 A;  2VAS A;  1W5T A;  2K9S A;  1IN7 A;  3IWZ A;  2HTJ A;  4G6T B;  2R5Y A;  4L9N A;  4AUX A;  1IF1 A;  4OOI A;  2HYG D;  4S05 A;  2V1N A;  2LH9 A;  1HST A;  1F43 A;  4A5M A;  1XX5 A;  2QF7 A;  1BC7 C;  1V55 H;  2OV7 A;  3BWG A;  4OMZ A;  3V7S A;  5A2Q Z;  2OA4 A;  4M74 A;  3KIO A;  1G3W A;  2VPR A;  1R22 A;  2PX9 A;  3K1P A;  1K7A A;  4LG3 A;  2R7Z J;  3M8F A;  1MSE C;  2MSY A;  4G94 A;  3GXO A;  1QZZ A;  4HV5 A;  1GUU A;  4BAY A;  1Y1V J;  2GA2 A;  2VPL A;  1QPM A;  2F4I A;  2DLL A;  3JSO A;  2EV6 A;  1ETV A;  1JT6 A;  4O6J A;  5EG0 B;  1NTC A;  3JRD A;  1M1E B;  2JK3 A;  1DGR M;  1R7J A;  1W36 C;  4U0V A;  1UMQ A;  2ZKZ A;  3WGG A;  3SQN A;  2JPB A;  3CO6 C;  4NUB A;  4GYI A;  4X1E A;  2DI3 A;  3BJA A;  1ZG3 A;  1SMY F;  2VJI A;  1USS A;  1XGO A;  4MNU A;  3G3Z A;  1YJ9 I;  1FTZ A;  3E5Q A;  4I98 B;  3WTS C;  5DCM A;  1B4A A;  1EH7 A;  4ZYD A;  4KMU X;  4BHB A;  2F5D A;  4YFX F;  2ZCW A;  3CCJ I;  1D8K A;  3E97 A;  5BS6 A;  5K5Q A;  5HLI A;  3UR3 C;  4HDV A;  4WK8 F;  4XKB A;  1TT5 B;  3TP3 A;  4E7Z A;  1P9Q C;  4JX4 A;  5JLX A;  3OYJ A;  1SD6 A;  1IV8 A;  1OPC A;  1FLI A;  4UUT A;  1ZK8 A;  3V7R A;  3JW4 A;  2XF5 A;  3AL0 C;  2W24 A;  2E1N A;  2L02 A;  4I76 A;  3HL2 A;  1ETQ A;  2M9H A;  3FKJ A;  2IP2 A;  2LVS A;  4RM2 A;  3FF5 A;  3F8B A;  5JVT A;  1FSH A;  2OTL I;  3VSK A;  3Q0V A;  4E4H A;  1OIS A;  4RB0 A;  3DEE A;  2H8W A;  3KX2 A;  4BH9 A;  4RB2 C;  4A0Z A;  4CDG A;  2DQR A;  4M3G A;  5F0H A;  3ABU A;  3GFL A;  4PFO A;  3GX4 X;  3NQO A;  4PSW A;  3FHN A;  2DYR H;  4IHY A;  3K1M A;  3HBL A;  3S14 J;  5JLW A;  2VBW A;  4Y4R A;  4A3M J;  3BTI A;  3LSP A;  2VOD A;  4A3E J;  2OPT A;  3OYN A;  3O6B B;  1ETO A;  5GAD J;  2JUG A;  4JP0 A;  4HNU A;  4PDK A;  3HRU A;  1SEU A;  2DA3 A;  2DMN A;  4RA2 A;  3S15 J;  3KEY A;  2MYS A;  2NRA C;  3D1N I;  3K2A A;  4R1H A;  4V2G A;  1OR7 C;  3ASN H;  3VYR B;  1KGS A;  1OCC H;  2OUM A;  2DQL A;  4H0E A;  1OCO H;  4IKF A;  3V8J A;  5E3O A;  1PUE E;  3CJR B;  2K7L A;  5C4X J;  2EIN H;  2XGC A;  3TP0 A;  3WU0 A;  1SFU A;  2O8X A;  4A3K J;  3OIP A;  3JAM Z;  1WWX A;  2LMD A;  2YUS A;  1RNL A;  1TWA J;  4YRV A;  1E3P A;  3P9K A;  3G73 A;  4IEJ A;  3JRC A;  4IQ4 A;  3J81 Z;  1BOB A;  2JUC A;  2VQC A;  5BNG A;  2F4O B;  1I6H J;  1Z0X A;  1UEL B;  3DF8 A;  5LRS A;  4XL9 A;  1R5I D;  3BQZ A;  3KE2 A;  3RYP A;  5FKO A;  5IP7 J;  2F5V A;  1MNM C;  2LSO A;  2GQQ A;  2X0L A;  1JHF A;  4AD9 A;  1J7K A;  2LBF B;  4A3B J;  4BQO A;  3QOP A;  2MC4 A;  4LJZ F;  2LRE A;  4OU0 A;  1AKH B;  2YPR A;  2CV1 A;  3D0S A;  4J00 A;  1Z6T A;  3ONQ A;  3G1L A;  1YIO A;  2CQX A;  4UUS A;  1W5S A;  2F5F A;  3HHH A;  3BG5 A;  3K2Z A;  3CP8 A;  2JQ7 A;  2EIJ H;  4UXN A;  2D5V A;  2GIV A;  3TBI A;  3HOZ J;  2ZME C;  2DO7 A;  3ZMZ A;  3ECH A;  3ULQ B;  3F9K A;  4ZJZ A;  1P2F A;  2EA4 A;  4ZYE A;  1XCV A;  2WAF A;  2BW3 B;  5D8K B;  2XAQ A;  1ACI A;  2DBB A;  4BBS J;  4UVA A;  3G6E I;  1TW2 A;  5E3M A;  1OCT C;  3HB9 A;  2RQQ A;  2A61 A;  1RI7 A;  5J1Y A;  1YFH A;  2HZD A;  3O3K A;  3TL4 X;  4K2E A;  1JKR C;  1QA6 A;  1IDY A;  3H3U A;  1WJE A;  2OJE D;  1T08 B;  4O3M A;  2DYS H;  3VDX A;  2FBH A;  5HDK A;  5HVQ C;  1ON1 A;  4F92 B;  3AG3 H;  4M3D A;  2JMW A;  4M6X A;  2VJ4 A;  5JI6 A;  2W57 A;  3EYY A;  1U6G A;  4C2T A;  5F04 A;  5LHI A;  3P9C A;  3FMR A;  1X1B A;  2ZBK A;  3HOW J;  4A12 A;  4KFC A;  3PSI A;  4PJL A;  3CC7 I;  3HIF A;  2H27 A;  4KT6 A;  4A69 C;  2G9W A;  4XLH A;  2R7F A;  3TOA A;  2R0Q C;  2Z9O A;  1R4N B;  2QLZ A;  3CCV I;  1HKT A;  1VND A;  1MW7 A;  2ECB A;  1DDN A;  5IOY A;  3DBR B;  3I0T A;  2R5Y B;  4IHV A;  2V1D A;  3C7J A;  1S3J A;  1APL C;  3LQQ A;  2IPQ X;  4YIR X;  1TLH B;  1VQK I;  5DDG A;  2KDZ A;  4IHT A;  1LFB A;  1U78 A;  5IPA A;  4NHJ A;  4UY8 I;  3HEF A;  2DXI A;  3KZI C;  3C2H A;  4C3J J;  3IL2 A;  1BI1 A;  2ME0 A;  3M8J A;  3CME I;  2R93 J;  3H9J A;  3KYL A;  3QU6 A;  5AON A;  1KU9 A;  5BOX A;  4DIQ A;  3GME A;  3HJE A;  4CZZ A;  2AXT C;  1JJ8 C;  4DZJ A;  3PM1 A;  5LLQ A;  3LSJ A;  2PJP A;  2ECC A;  2E2H J;  1U2W A;  1XSD A;  1SFX A;  4XR6 A;  3L2R A;  1QGP A;  3ABM H;  4XQF A;  4M3B A;  1BL0 A;  2B9S A;  4M9X A;  3U9G A;  2HXO A;  2V7F A;  3JTG A;  2AS5 F;  4FCY A;  2GBY A;  2BY0 A;  2VIX A;  2D1V A;  4HBL A;  1K6Y A;  1UCR A;  5KVR A;  3J7A Y;  4IRH A;  2JN6 A;  2CRG A;  1IRX A;  4Y3O A;  2K9Q A;  1SVL A;  3D5S C;  2CQ7 A;  3IUO A;  5HLH A;  2WA0 A;  4FET A;  1YIT I;  2QBY B;  1KQ9 A;  1SD5 A;  1ZR2 A;  4BGD A;  2M1B A;  3MZY A;  3OSF A;  3OOP A;  1RRJ A;  4C2U A;  2LNB A;  2K40 A;  1ON2 A;  4FIS A;  3RYR A;  2RVC A;  3F21 A;  3QPT A;  3CO7 C;  1K4T A;  3AG1 H;  1BJZ A;  3OYF A;  2FBI A;  5IP9 J;  2YS9 A;  3LSI A;  2B63 J;  3MEX A;  3HOY J;  4CXF A;  1I5Z A;  3DU5 A;  4XLF A;  4ENN A;  3BR6 A;  2KHM A;  2P7V B;  3KPH A;  3PFY A;  3LNQ A;  2NOJ B;  4LK0 F;  1FPQ A;  2KPM A;  5E79 C;  1R49 A;  2ZXH A;  3G1M A;  2M34 A;  3CDH A;  3QU3 A;  5GAH J;  3BZK A;  1OYY A;  1LEA A;  1YOV B;  3KP6 A;  3MAJ A;  1MBG A;  3HM5 A;  3ZQH A;  1EKE A;  2HQ5 A;  4ZTF A;  3H0G J;  1R9T J;  2R7R A;  1MBK A;  5DYM A;  3LMM A;  5E1X A;  5ILS A;  2IW5 A;  4FHT A;  2BHZ A;  2DFF A;  3G4S I;  3SZT A;  3MD2 A;  2EFP A;  1FMV A;  3MZ8 A;  4JOM A;  2VON A;  3J7A O;  2H6B A;  2DPU A;  4L9V A;  3IWF A;  2RDP A;  4D7M A;  2GXG A;  2NVY J;  4WX9 A;  2CUE A;  4B44 A;  3L2W A;  1ETX A;  5ERI A;  2HDC A;  2JZY A;  1WQ2 A;  3BR5 A;  3C2B A;  3S8P A;  1ZAR A;  2R5Z B;  4QSH A;  5LRR A;  4U7B A;  3CMA I;  2AHQ A;  5EZH A;  4ZZL A;  2PMH A;  2KZV A;  5A2Q K;  2Y0S N;  3RZO J;  4MO7 A;  1WSU A;  3MZH A;  2CGP A;  1EH6 A;  2XGD A;  5KCM A;  5FLX K;  3B02 A;  3F23 A;  2ZNY A;  3I59 B;  1JXS A;  4XLC A;  1S8N A;  1IZ1 A;  4HAM A;  2NVQ J;  1T95 A;  1Q1H A;  1CQT A;  2CMP A;  1JUS A;  4RAG A;  2FMY A;  5FD5 A;  5B3S H;  3SJM A;  1HXD A;  4IHS A;  3K70 D;  3CC2 I;  3S1Q J;  4ZDP A;  3V4G A;  4II2 A;  2V6C A;  5BMZ A;  3I54 A;  2WY7 Q;  1FY7 A;  2QSF X;  2FNP A;  3CTA A;  5TRD A;  3E7L A;  3F3X A;  5CVI A;  1FSE A;  4EAT A;  4EVI A;  4IRI A;  5EEH A;  4UUS B;  2CFO A;  3OR2 C;  3TOB A;  2XB0 X;  1GXQ A;  3PQJ A;  2UUZ A;  1O3S A;  1VQP I;  2JTV A;  1D8J A;  5L3C A;  3H92 A;  3UNG C;  1ZRF A;  2AO9 A;  3OIO A;  1YLF A;  3CCU I;  2PJR A;  4HNV A;  3CCE I;  3FXU A;  4I02 A;  5GPC A;  5J47 A;  4KDP A;  2X1C A;  1WGX A;  3TO6 A;  2IAI A;  4V2F A;  3PJR A;  2JA6 J;  3H0D A;  1VQN I;  1YIJ I;  2ELK A;  3JR9 A;  1U8B A;  5D4R A;  2LFB A;  2VOO A;  2DA1 A;  1IV6 A;  3IAM 2;  1VTN C;  2XGX A;  1OMI A;  2LF7 A;  3J7Y J;  3ZR8 X;  5B1A H;  4IHW A;  4CCO A;  4MEY F;  5HLT A;  2V1U A;  3LSG A;  5GAE J;  4A3I J;  1BJA A;  1N75 A;  2VJJ A;  5F1R A;  2VBZ A;  1VQL I;  3H9G A;  1W7P B;  1KU2 A;  3MMY B;  1E3H A;  2DW4 A;  3IH3 A;  3QPH A;  4RM3 A;  3GTJ J;  1ZEL A;  3JRE A;  3M7G A;  4E7I A;  1JT0 A;  4CYC B;  1A36 A;  2HYJ A;  2KFD A;  4IX7 A;  3K0L A;  1I3A A;  4PGG A;  4U0W A;  3HHG A;  4LLL A;  3EQL F;  1XSV A;  2K9N A;  3FBI B;  4BY7 J;  3VYU B;  1LDK B;  4KIS A;  1GVJ A;  3PNT A;  4ZYA A;  4GDF A;  4C3H J;  4HW0 A;  3SXY A;  1VQ6 I;  3K4L A;  2RNG A;  2XAH A;  2Q2E A;  2W7N A;  2Y31 A;  1WJC A;  1A35 A;  3W6J B;  4KT5 C;  2LD5 A;  2CUZ A;  5JHF A;  5EJC A;  1TWC J;  1W4M A;  1PP8 F;  2EBI A;  1PVE A;  1NHA A;  1K61 A;  1HDP A;  1VF9 A;  3CC4 I;  2CH0 A;  2DJN A;  2R7Q A;  3H3Z A;  3ISP A;  1RUN A;  2EB7 A;  1X1D A;  3OYC A;  3TO9 A;  3P5J A;  1MMA A;  1ZHF A;  2GA1 A;  1MH3 A;  5F1J A;  1JGG A;  2X9D A;  2G0E A;  1N77 A;  2LC2 A;  3GFM A;  2VBX A;  3OY9 A;  1Z21 A;  3JAM K;  4A5N A;  1IDZ A;  4MTE A;  4RAZ A;  3A03 A;  4LB6 B;  2P0W A;  1F5T A;  3TGN A;  2X6X A;  2M0C A;  3J81 K;  3BTJ A;  4BJT A;  3CJN A;  2QUF A;  2YSR A;  3BC8 A;  4P9U A;  4BS9 A;  2QZ8 A;  5CKT A;  2RKH A;  4DOZ A;  3LST A;  1QVT A;  1A31 A;  2O0Y A;  2TRT A;  4XKV A;  3EUK L;  2KIM A;  1BIA A;  3PNV A;  1FP2 A;  4QWQ A;  3RKY A;  3HKZ N;  5KK1 A;  1TWH J;  1L0O C;  2FOW A;  2LYC A;  1ODD A;  5AIP A;  5C4J J;  2QQB A;  4HST A;  1LFP A;  2YX4 A;  2H8R A;  1GHC A;  3EET A;  1B72 B;  1UZC A;  4B47 A;  1BI0 A;  2F2E A;  3PQK A;  4LGW A;  4A3G J;  5CPR B;  2I8D A;  3IHU A;  2HGC A;  3DKY A;  1FEX A;  2LTP A;  3NWT A;  4B43 A;  2K9M A;  2JT1 A;  4AYB A;  3BR0 A;  5GAG J;  2OZ6 A;  5E18 F;  1XGN A;  2WB1 N;  2NNY A;  4YII A;  2JSP A;  4EJU A;  3LA2 A;  5KHD A;  3OOU A;  3C3W A;  3PIO F;  4A3L J;  4HNT A;  4CIC A;  3C2G A;  4BHC A;  1B1B A;  1DPU A;  3V42 A;  3RI4 A;  1BC8 C;  4AIK A;  4OAY A;  3WOD F;  3LA7 A;  3SDB A;  4EJT A;  2E35 A;  2DU9 A;  1U9O A;  5E1Z B;  1LPQ A;  2HXI A;  3BJ6 A;  3K1N A;  4XMY A;  3AAF A;  3LFU A;  2HVR A;  2XRN A;  3OMY A;  4FE4 A;  3L9F A;  4C9Y A;  1YX3 A;  3MVP A;  2VQG A;  3EUH A;  5LEJ A;  1FYL A;  1F1Z A;  1SAU A;  3WHC A;  3FZV A;  4XLA A;  2FXA A;  1ZGJ A;  1MMD A;  3ZQI A;  3ZMT A;  4BEH A;  1Y8Q B;  4BBR J;  2A3S A;  3VOE A;  2YU3 A;  4ITV A; 
#chains in the Genus database with same CATH homology
 4LIV A;  3KEY A;  2MYS A;  3FDY A;  3H5N A;  2BOL A;  2R7S A;  3H5A A;  1OR7 C;  3BLY A;  3K6G A;  3VYR B;  2OUM A;  1JI8 A;  4IKF A;  2X6W A;  2FUG 2;  4RLQ A;  3CJR B;  3LL7 A;  3OIP A;  1FMW A;  3HOT A;  3VSL A;  4GRI A;  4YRV A;  2X1E A;  4PUS A;  1LKX A;  1G59 A;  2JVG A;  3OR1 C;  3PL8 A;  4IQ4 A;  3VYS B;  1BOB A;  3I3L A;  2VQC A;  2HQA A;  3IP4 B;  1UEL B;  4XL9 A;  2Z16 A;  3HKZ A;  3EUA A;  4KJZ A;  3OYM A;  2F5V A;  4N4N B;  1KON A;  3OYI A;  2LBF B;  4BQO A;  1D1C A;  2MC4 A;  2LRE A;  1TZL A;  2CV1 A;  4LIU A;  4J00 A;  1D0Z A;  3ONQ A;  2W00 A;  4J01 A;  2A5W A;  4F3Q A;  3CP8 A;  3OYA A;  3W2A A;  3TBI A;  3SZG A;  3F9K A;  2E1M B;  4ZJZ A;  4D9J A;  1DP3 A;  2R7X A;  2WAF A;  4F93 B;  2BW3 B;  2R7U A;  3K4C A;  4E6K G;  2WAQ A;  3CP2 A;  4MLO A;  2DT7 B;  4CH7 A;  3PUB A;  3OWT A;  2RQQ A;  4PJN A;  2R7T A;  4XN0 A;  1BR2 A;  1BR4 A;  2HZD A;  3IAS 2;  3ZGK A;  4YEJ A;  3DTE A;  4II3 A;  3TL4 X;  4BU2 A;  1W36 D;  2KL4 A;  4PFP A;  2UV1 A;  1WJE A;  2UWM A;  3OYD A;  3VDX A;  5HVQ C;  4F92 B;  3MKY B;  1AA7 A;  3K4M A;  3PSF A;  3OYE A;  2BVM A;  4NNJ A;  2VJ4 A;  2ZSI B;  4BAC A;  4C2T A;  1SFK A;  2PMZ A;  2BVL A;  3VWB A;  1QHG A;  1X1B A;  4BJ6 C;  3TMO A;  2ZXI A;  4HNU A;  1E0E A;  3EUH C;  3PSI A;  4PJL A;  3VYT B;  3DPL C;  3A4C A;  3OL3 A;  4KT6 A;  4DBQ A;  4XLH A;  1X19 A;  1V5F A;  4OAZ A;  2MD0 A;  4P1W A;  4BDY A;  3AKZ A;  2Q2E B;  1HA8 A;  2K3P A;  1DGW Y;  1MW7 A;  5CQE A;  3QOE A;  2R7O A;  1N78 A;  1S9H A;  3L2Q A;  3K70 C;  2LOO A;  2X1D A;  2QKL B;  2X51 A;  3DKX A;  2CW8 A;  4PJJ A;  1Z7L A;  4BE1 A;  2DXI A;  2IGM A;  1U0J A;  3C2H A;  3ZCO A;  2GOM A;  4HEA 2;  2XC7 A;  3BCA A;  2M7B A;  3W2V A;  3M8J A;  3BG7 A;  4F52 A;  3H9J A;  4CCL A;  3KYL A;  4DIQ A;  3MKZ A;  4DBR A;  3SYT A;  4PJM A;  3DTI A;  2BW3 A;  4HG2 A;  2VB6 A;  1T0F C;  1Y6I A;  2HDW A;  2XAU A;  3GBG A;  4XR6 A;  1WFX A;  3OYB A;  4CA0 A;  3L2R A;  3K10 A;  4XOR A;  4XQF A;  4H4K C;  4N4O B;  5FRO A;  1X1C A;  3LSK A;  4JQF A;  1WJA A;  2V7F A;  2CW7 A;  3H9Q A;  3OYH A;  3RQ4 A;  2VIX A;  1DQU A;  4KIT B;  1K6Y A;  2IS2 A;  3J7A Y;  3DWL E;  2AQF A;  4AVZ A;  3U21 A;  4Y3O A;  1IRX A;  1NG6 A;  3A1Y A;  3D5S C;  3IUO A;  3DLA A;  2VL8 A;  2KQR A;  1EA3 A;  2WA0 A;  4FET A;  1D0Y A;  2M3A A;  2DCE A;  3QYE A;  4AU7 A;  3DPT A;  2IGN A;  4OWR B;  4BGD A;  2LY1 A;  2QKM B;  4C2U A;  2L5Q A;  2LRD A;  4IZZ A;  4E7H A;  3S3N A;  3HOS A;  1D0X A;  4BQQ A;  2WB1 A;  1J09 A;  3OYF A;  1MMG A;  2X6Y A;  4BUP A;  3LSI A;  5HOO A;  3OS0 A;  3DU5 A;  4XLF A;  4ZDO A;  2KHM A;  2E5Z A;  2F6C A;  3PFY A;  4X0G A;  2NOJ B;  2R7V A;  2KPM A;  2PJR B;  4IQJ A;  2M7A A;  4XKC A;  2VXZ A;  2ZXH A;  3SEQ A;  3A2K A;  3AFH A;  1UG0 A;  3BCB A;  3HUG B;  4XNF A;  1LVK A;  1D1B A;  4DGW B;  4ZTF A;  3FBN B;  2A6T A;  2R7R A;  2M4K A;  4NC8 A;  3LMM A;  3CMM A;  4BL0 B;  3L2V A;  3MD2 A;  1FMV A;  2E5N A;  2Q1Z B;  1X1A A;  4FAS D;  4JOM A;  3AL0 B;  4XON A;  3S3O A;  4CCK A;  2KRH A;  2VLA A;  2VKD A;  3E1S A;  2K5C A;  2CV0 A;  4CCJ A;  2IGK A;  4B44 A;  4CSW A;  3L2W A;  4U87 A;  4NQW B;  2DJI A;  2Z1D A;  3S8P A;  2CUJ A;  3DU6 A;  4U7B A;  2L9S A;  3OS2 A;  1PYV A;  2KRC A;  2KZV A;  4E7S A;  2E1M C;  4RLF A;  2XDV A;  1V5E A;  3L2U A;  5KCM A;  2LY2 A;  3K4K A;  4XLC A;  2K9L A;  3LSM A;  2L7K A;  1T95 A;  3CZ6 A;  3HPG A;  2O5R A;  1Y56 A;  2CMP A;  2AQE A;  3ZRG A;  3SEZ A;  4BXF A;  2HVS A;  2LBF A;  3S32 A;  4HSR A;  3ZQQ A;  2HVQ A;  3K70 D;  4XOT A;  1G8X A;  4ZDP A;  2JA2 A;  1NG7 A;  4II2 A;  3RPU D;  2V26 A;  2WY7 Q;  3RTR A;  2IS6 A;  4PSX A;  4EAT A;  2OC6 A;  4C30 A;  4B3X A;  3OYK A;  3BG6 A;  3QYF A;  3LSH A;  2CFO A;  5FRM A;  3OR2 C;  4BE2 A;  3RCO A;  2UUZ A;  4DJA A;  2RRE A;  2IXS A;  2WBM A;  3UNG C;  3OYG A;  2PJR A;  2IS4 A;  2X1C A;  4HRI A;  2IGO A;  4QPQ A;  3DTK A;  3PJR A;  1BR1 A;  3D5R C;  3H0D A;  4XOP A;  2HNH A;  2ZSH B;  3I9V 2;  1D1A A;  4CZC A;  4PK4 A;  3CJQ B;  3IAM 2;  2MFZ A;  1TT0 A;  3HG9 A;  3S93 A;  4CCN A;  3ZR8 X;  5HNH A;  4E7J A;  4CCO A;  5CQG A;  4B48 A;  2MAB A;  5HLT A;  3LSG A;  1UAA A;  2KMU A;  1N75 A;  2VJJ A;  2DT6 A;  1MND A;  4XKW A;  3PNY A;  4YEL A;  3H9G A;  3MMY B;  3D5L A;  3OYL A;  2M4G A;  4XM3 A;  2X85 A;  2VJ5 A;  4XLE A;  2ELJ A;  3MKW B;  2Z2S B;  1WJ5 A;  4P5O A;  4RM3 A;  3K4J A;  2ZFU A;  1WJF A;  2XF6 A;  2HPI A;  1ERD A;  2R4G A;  1ZEL A;  2WAE A;  1PJR A;  2GOX B;  4E7I A;  4BDZ A;  2CS3 A;  2L2O A;  4IX7 A;  4E7K A;  2KDO A;  3VYU B;  3FBI B;  4KIS A;  3W3C A;  1LDK B;  1WJD A;  3H35 A;  3PNT A;  4ZYA A;  3K4L A;  4BJ5 C;  2RNG A;  5TGT A;  2VQH A;  2W7N A;  1WJC A;  3DQV C;  2VAS A;  2CUZ A;  5JHF A;  4G6T B;  1GLN A;  2CV2 A;  3S3M A;  2CH0 A;  1VZ0 A;  2LG4 A;  3CES A;  2V6E A;  2R7Q A;  2Y0S A;  3DPU A;  2M0M A;  1X1D A;  3OYC A;  4XN3 A;  2V1N A;  2LH9 A;  1MMA A;  1MMN A;  3M1C A;  4R79 A;  5LD2 C;  3K4B A;  2W4S A;  4E7L A;  2OV7 A;  1N77 A;  4HPQ A;  2LC2 A;  4BE0 A;  3OY9 A;  1Z21 A;  1Z3Y A;  5KNL A;  4LG3 A;  2VQL A;  2XF7 A;  2HPM A;  4F55 A;  2P0W A;  2L9N A;  1YE9 A;  1X4P A;  2X6X A;  1YX5 A;  3HPH A;  2V9K A;  4BEH B;  4BJT A;  4D1Q A;  2R7W A;  2VPL A;  2F4I A;  2JVH A;  4RMN A;  3BC8 A;  4BS9 A;  3OIQ A;  4CUG A;  3N05 A;  1QU3 A;  5CKT A;  4DOZ A;  3CF2 A;  3NWS A;  1DGR M;  1W36 C;  4XKV A;  3EUK L;  3ZXS A;  3PNV A;  2KLO A;  1MNE A;  2LYC A;  4NUB A;  2HU9 A;  5HNF A;  4HST A;  1LFP A;  4B47 A;  2VJI A;  5CPR B;  2VXD A;  2I8D A;  2DOA A;  3W2W A;  4BQN A;  3DKY A;  2KP6 A;  3NWT A;  4B43 A;  2K9M A;  4AYB A;  2V4J C;  3HXL A;  1Z3X A;  2WY8 Q;  1V5G A;  2JSP A;  5KHD A;  3UR3 C;  3OOU A;  4Y33 A;  3E0J B;  3HC7 A;  4XKB A;  1WJB A;  3OS1 A;  4E7Z A;  1P9Q C;  3OL4 A;  4HNT A;  3OYJ A;  3C2G A;  2W1O A;  4ZTJ A;  3EPZ A;  2VKH A;  3V42 A;  5FRN A;  4OAY A;  3QYB A;  4LIT A;  2IS1 A;  3K4N A;  3SDB A;  2XF5 A;  3AL0 C;  3HL2 A;  2E60 A;  3FKJ A;  4RM2 A;  1QHH D;  4QPO A;  4XMY A;  3VSK A;  4E4H A;  3LFU A;  2HVR A;  4ZC3 A;  3DEE A;  1X4O A;  3H5R A;  3KX2 A;  3OMY A;  1OLT A;  4C9Y A;  1YX3 A;  2VQG A;  3RSN A;  4CCM A;  2XSJ C;  4NC7 A;  3G2B A;  4PFO A;  1SAU A;  3QOD A;  4PSW A;  3FHN A;  4XLA A;  2WAD A;  5LFA A;  2W82 A;  1MMD A;  4Y4R A;  4ZDL A;  1R6R A;  4BEH A;  3OYN A;  4ANJ A;  4F91 B;  2JUG A;  4ITV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...