3OR1C

Crystal structure of dissimilatory sulfite reductase i (dsri)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
104
structure length
104
Chain Sequence
AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKNTGFALKEIYELFPSGPGKGACKMAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite reductase alpha
publication title Structure insights into the enzyme catalysis from comparison of three forms of dissimilatory sulfite reductase from Desulfovibrio gigas
rcsb
molecule tags Oxidoreductase
total genus 30
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3or1C02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 3or1C01
3OR2C 2V4JC 2XSJC 1YX3A 1JI8A 3OR1C 2A5WA 1SAUA
chains in the Genus database with same CATH superfamily
5ICCA 5H20A 3L2WA 3E5QA 5CQEA 3LSRA 1V5GA 2DXIA 1JKQC 3FIWA 2EPFA 1RRJA 1MBGA 4XLAA 2JSPA 1A5JA 3M07A 1PJRA 3KEQA 4OAZA 3VOEA 5HS8A 4L5JA 3LSHA 3L2QA 3HGGA 1FYMA 5F0HA 4IEJA 1JXSA 2PEXA 1N75A 4MFDA 2HYGD 2R4GA 3OSGA 2ESNA 2LYCA 1FSHA 3E3VA 1I1SA 4G7HF 1P2FA 2ELJA 4II2A 4XBFA 5M5YJ 3CCUI 1YW9A 2ELHA 1B4AA 2KRFA 2M8GX 3BC8A 1IO2A 2ISYA 3VSKA 4IQJA 2HR3A 3F22A 3H36A 3RKYA 5F1RA 5LHGA 3CD6I 2ZSHB 3DCFA 1HF0A 3TO6A 1V3FA 4E6KG 4A3EJ 2XAGA 3NQOA 2IW5A 4LG0A 2DI3A 4KYWA 1HW1A 1SD5A 3QU3A 3OYGA 2GQQA 3ZMSA 2K86A 1NH3A 4OU0A 5F04A 1FOWA 2BZTA 3DKYA 3QYBA 5ILUA 2KT0A 3JRDA 4BE1A 2W82A 2JPCA 4B09A 1X1DA 5GP9A 3R60A 1TW2A 4ENJA 1I50J 4LIUA 5DTDA 1A6IA 3GUDA 3KIOA 2HTJA 3F8NA 1MBEA 5FKNA 2PFBA 4GYGA 2D1HA 2JT1A 5M3MJ 4LJZF 3P9KA 1S6LA 5F27A 4C3HJ 5CYVA 1USTA 1UHSA 4ENNA 1ZR4A 4MTEA 4ETSA 2XKPA 3CP8A 3ZN0A 3PUFA 4BEHA 1Z7UA 2Z16A 3KZIC 4HG2A 4BJ6C 1XS9A 3HRUA 1OPCA 2DJNA 4DOZA 4YFXF 5A2QK 3AL0B 2Y69H 3K0LA 2CUFA 2ECCA 3CQZJ 4CDGA 2GA1A 3DXJF 3FM3A 3P7NA 2GXGA 3K4JA 3SQNA 4C2UA 2XF6A 3W2WA 3TBIA 5JVGF 3I9V2 4KICA 1OCPA 2H6BA 4ESBA 1IRGA 1D8JA 3SFZA 1FWZA 3AKZA 3J7AO 2XAJA 4HBLA 5K7FA 1IRXA 1JGGA 4XRMA 2XROA 5HS7A 3LMMA 2FQ4A 4KIGA 4U0VA 5HLTA 2VODA 3S3MA 2ADUA 1MKMA 4Y4RA 3L9FA 1XGSA 5TJJA 2CH0A 1U2WA 2W48A 2XHKA 3PNVA 4ZDLA 5FFZA 3LL7A 4TV7A 4IRGA 3SDBA 3MCZA 1Y1VJ 2VPRA 3D1NI 1JHHA 4CICA 1BI0A 1AKHB 2VQGA 2DA3A 2H1LA 2DA4A 1SC7A 2CUJA 1RUOA 4WXDA 3KP3A 5C44J 2IPQX 3J80K 3GTMJ 3IH2A 1U3EM 4L5IA 3PQKA 1Y0UA 2L9VA 2M4GA 2V1DA 1K79A 5IYDJ 2JPBA 2FUG2 1P7IA 2XGDA 2IVMA 3L09A 1KA8A 1V54H 2OC6A 1D5VA 1S3JA 4IJAA 3OYEA 2CW0F 2DT7B 3N05A 4X1EA 4LMYA 3TDUC 1T39A 3M4OJ 2EZHA 2EFWA 2E1MB 3VYSB 2EA4A 3PUBA 4OIOF 5IYBJ 4M9XA 4AIDA 5TRDA 4KISA 1S7AA 1MDMB 1MSFC 3S32A 1K7AA 4N4NB 3K1MA 2IAIA 1O3TA 3S1MJ 2IS4A 1OFCX 4S0HB 5E20A 5KCMA 3TGNA 4WWCA 1IV6A 4XKCA 4L0YB 5EYRA 1X4OA 2V26A 4JQFA 3MEXA 1YFHA 4A3DJ 3OR1C 2EILH 3WE3A 3H9QA 4Q5SF 4ZDOA 2IA0A 1ZQ3P 4A6EA 3EUAA 3H3VK 1KQ8A 3OYBA 2LFBA 3TKYA 1FSEA 3PSIA 2HKOA 1R6RA 3SYTA 1Z3XA 2OTLI 2EZKA 3ZXSA 3KFWX 4J19A 1ZHFA 3LSIA 2MLGA 2JA6J 1R7JA 1R00A 2XPWA 2R7FA 2K9QA 2L7KA 2OD5A 4ITVA 1KYZA 1H88C 3BQYA 3DPUA 5F1JA 1AA7A 1E2XA 1ULYA 2OTJI 1VNDA 4D5FA 3SZTA 3KEYA 2RREA 3CUOA 3SFIA 4EJWA 3H0DA 4E70A 1MMAA 2K7LA 1POGA 4LB5A 1S7EA 1N25A 3S8PA 3CCLI 3C2BA 2XAQA 2K27A 2LRDA 2XPVA 3FMQA 4XKBA 1ZG5A 5GPCA 4KFCA 3OOPA 5H6RA 1YHQI 1Z91A 3VFZA 1UB9A 1VQPI 4LG0B 2M2EA 2ELKA 2ZMEA 1FJLA 2AXLA 4EQQA 3FBNB 2CW8A 4HX4A 2VKEA 3D5LA 2CRGA 3IH4A 4PCQA 1IRZA 2E60A 3G1OA 4HV6A 1BW6A 1Z21A 4RMNA 3A02A 3BT9A 2XF7A 2GLOA 2D1VA 1YE9A 1J75A 1TWFJ 3OYHA 2IGNA 1BI1A 2E1CA 3CLOA 1PUEE 3WU0A 3E5XA 1GV2A 1WJEA 2R0QC 2RDPA 4ZYEA 1BM9A 5JVTA 2GWRA 2JA8J 5ICGA 2OV7A 3V8KA 1HQCA 5LD2C 4B4CA 4N0BA 2YU3A 1FBUA 3ZN1A 1D0XA 2DT6A 2JWTA 4BEHB 1TWGJ 2BY1A 2VUMJ 3CCQI 5CLSA 1RPWA 3IAM2 2KIUA 1T08B 3HOXJ 2ZKZA 2NS7A 2UV1A 1X1BA 2PLYA 1UCRA 4MGRA 2O9LA 2WBMA 4A6DA 1H0MA 3KPHA 1ZREA 1R1VA 2WB1A 3C2HA 5GTIC 1F36A 2IJLA 3VPRA 1DP3A 3TOBA 5FJ8J 5FKMA 1WPKA 3T8TA 1HLVA 2PMZA 3HBLA 1GV5A 5E1XA 2HXIA 2OUMA 1I6XA 4BJTA 2KLOA 4B1RA 1FOKA 3ECOA 1MZBA 2GOMA 3LA2A 1KONA 3CDLA 5HVQC 4E7LA 1RKWA 1O7LA 5L3GA 1YJ9I 3HOYJ 4CA0A 3OYIA 5L3EA 5LGNA 3ASNH 2CV2A 2PBIA 2G7UA 5GAGJ 1LVKA 4G6TB 1KYWA 2L5QA 2LKPA 2XKOA 1SEUA 1QNTA 4R8HA 3W2AA 3KLOA 3V8JA 4BACA 2K02A 2QLZA 2FOKA 1BBYA 2Y0SA 3K4MA 2O8KA 2FD5A 3HUGA 4IOCF 4M3GA 4PJJA 2GOXB 1Z05A 1QZEA 5AONA 5ILSA 4PSXA 2LREA 1U5TC 3PQJA 1VQ8I 2OBPA 3TP3A 1JT0A 1CF7B 2DOFA 3I71A 3HPGA 3OY9A 3DEEA 3R6SA 2R3SA 3HKZN 1TP4A 3FHNA 4O3MA 4DIQA 3OR2C 3DBLB 1E3HA 4W97A 1HSJA 3CJTB 1ITYA 2ID3A 4I6ZA 4FX0A 2QENA 2K4JA 2KISA 3M9AA 3V7CA 3MZ8A 4UVAA 2LY9A 4UHTA 2ECBA 3Q5FA 2L4AA 2CJJA 5ILVA 4IHYA 1OCRH 2D2WA 2ZJRF 3RJPA 1SD6A 3H5NA 3MKZA 1JJ8C 4BQAA 4Y52J 4YIIA 4N9IA 1IG7A 5E18F 3QPLA 2DMNA 2HQRA 1MIJA 2HI3A 4UUSA 2MGQA 3LSKA 3BPXA 1Y8RB 3KP4A 4AU7A 2D45A 4CHUA 2OZUA 3K1PA 3DLLF 2DLLA 3GZ5A 2MFZA 2ZNYA 2YS9A 2JJ7A 4C2TA 2DA7A 5CVRA 4HNVA 2OZ6A 3GF2A 2GM4A 1JGSA 2VT3A 3VODA 3WTZA 4F93B 2L9SA 2IA1A 2QQBA 3E6MA 3BR1A 2G9WA 1IF1A 2LF7A 3CUQA 2FNAA 1QHGA 1JKOC 4IHSA 2K9NA 4BYYA 4LG3A 2Q8KA 5K7HA 2Z33A 4Y15A 3CMEI 2E35A 3CJQB 1B9NA 2XVCA 4CXFA 2FSWA 4M74A 5LEKA 3FXQA 2DA6A 1MH3A 3DBHB 1XC5A 4OIQF 2XUBA 3A01B 2W1OA 4IRHA 1SAUA 2BHYA 3RYRA 5GTHC 2GBYA 3BCAA 4B3AA 2ZMEB 1RZ4A 1G2HA 2EK5A 2R5ZA 1KU9A 3CZ6A 1P92A 3E1SA 4EM0B 3BR6A 1NTCA 4HQEA 3AG4H 3ZPLA 4U0WA 1VTNC 3PFYA 5HOOA 3C7JA 1G3YA 2VXDA 2BBYA 4M3DA 2R7DA 1DGWY 3M7GA 3ZQFA 4QLCU 4BE2A 5A2QZ 4UUVA 2OQGA 1W0UA 1YOVB 1YITI 2HFHA 1YIOA 4G94A 4QSHA 2VC0A 2P6TA 4Y13A 3L2VA 2KKOA 3E6CC 2BY2A 2DA1A 1ACIA 1I3QJ 5ICEA 1W5CC 4BXXJ 1SD4A 3T0YA 1FY7A 2WV1A 5FB2A 2Z3YA 3JAMK 3T5XA 2KJCA 1V5EA 5B1BH 4A5NA 1JE8A 2DCEA 3BR0A 1XTAA 2VQHA 4XRSG 3LA3A 4KN7X 4HSRA 3R4KA 1FYLA 2DMQA 2RN7A 4RDUA 1NG7A 2NS0A 2NNNA 1TT0A 4U7DA 5IT9Z 2KZGA 4RAZA 3CMAI 1GUUA 5GAEJ 2I8DA 4LLLA 1D1CA 2M34A 3JW4A 4CYCA 3U21A 2M7BA 4JX5A 5JHUA 3JRCA 4IHTA 4PJLA 2MW8A 2L3DA 3ESWB 2WWYA 1IDYA 3F8FA 2R7ZJ 3P5JA 2YUSA 2UXNA 3ML6A 3BG5A 3AL0C 4RA2A 3CF5F 4LIVA 4AYBA 3CC7I 3M1EA 5ERIA 1R58A 5IPAA 5EEHA 3TO7A 2MLKA 4A3IJ 2Y0MA 3HPHA 2MD0A 4HOBA 1K4SA 3R61A 4MEYF 3BLYA 1Z0XA 1V4RA 3O8GA 2R5YB 4MQVA 3S3OA 4IVNA 3N97A 4GFBA 4GRIA 5J1RA 2FNPA 3ERED 1ZRFA 3F8MA 2JRMA 1YRNA 1IN6A 4QPQA 5KK1A 2E1OA 4OMYA 2W57A 4M9ZA 4D7MA 1FBSA 2A3SA 3O2PE 2NVYJ 4HA8A 4AIJA 2LTPA 1NG6A 2X6OA 4XNFA 1R1TA 4WX9A 3WTUC 4A3KJ 1WZ2A 4HRIA 1F9NA 1HCRA 3ZOBA 2EH3A 5K5RA 3DEUA 1OCCH 1YS7A 2K85A 2LOOA 2BXYA 2UXXA 5M5XJ 1HW5A 1IN7A 2QEXI 2Z9OA 4C3IJ 2NVQJ 3B6AA 1E17A 1FIAA 2Z1DA 3JTGA 2DODA 3GW2A 1JTXA 2E5ZA 5CVIA 2NXNB 2AQFA 5CVUA 5E1WA 4UUSB 3C1DA 1OR7A 2GA2A 4XOTA 3TMOA 3M3YJ 3FZVA 3N4MA 4G7OF 5LHHA 4I02A 4ABZA 2VJ5A 4RB1A 2X6XA 2F5EA 2E1MC 1GLNA 2HPIA 2M45A 4GCVA 3H35A 4A3CJ 2QSHX 1AU7A 3SDGA 1SMTA 4XKWA 4CZZA 2QBYB 1WRJA 4MO7A 5E79C 2G0EA 4BE0A 1EV7A 4IHXA 1B59A 4KT6A 1YI2I 1ENHA 4O6JA 3FF5A 3CUQB 3AFHA 2H94A 2MABA 3HOTA 4ZYGA 5FO5A 3ZQLA 3BDDA 4C30A 3I59A 3L2CA 3JSOA 4RAGA 1P6RA 1HKTA 2QZ8A 2CS3A 1MH4A 3O8HA 4A3MJ 4CUGA 1WJCA 4ON0A 1VQ5I 1QVUA 2DFFA 4DBQA 3B6CA 4II3A 4S04A 1BW5A 2QCOA 1PDNC 3OYAA 2DAOA 2EIJH 1QGPA 1G59A 4PDKA 3DP7A 1MBJA 5F08A 4BL0B 2KHMA 3H0GJ 2CQKA 5BMZA 2R5ZB 1YQAA 2BHZA 1QA6A 4Z6YA 2M1BA 4Y33A 3GFIA 1D0YA 3OYMA 1G3SA 5J1YA 1ZTRA 1Z7LA 3ZMZA 5TGTA 1G3WA 4OIRF 2ICWG 1A31A 1ETQA 5C4JJ 3RSNA 2HGCA 1RNLA 4LLGF 1WH7A 2L01A 2XRNA 1TQIA 1U9OA 2RVCA 2PMHA 1FOYA 1ETKA 3FDYA 1FNNA 4UVCA 4B3XA 2DMPA 3F6OA 3V7RA 4F3QA 5C3EJ 1Q1HA 4AIKA 1HC8A 2UWMA 3ULQB 3WE2A 2ZXHA 3ABUA 2LBFB 3CCJI 1LDJA 1ZH5A 3OYCA 5DV5A 1E0EA 1A6QA 4ZC3A 2F48A 4ZYDA 3HOSA 2HXOA 1MNEA 2COBA 3DQVC 2DPDA 3CO6C 2LDUA 2JUCA 4XM3A 1ZLJA 1YTYA 4DNCA 1B6AA 2NOJB 1WKMA 3G71I 1HDPA 2LF8A 1P4XA 2KRCA 2KZVA 4YELA 3L7WA 1B1BA 1LNWA 2YR2A 4GXOA 4MQ9F 1BR1A 2W7NA 3U1DA 4B8XA 5IOYA 1W36C 1S7OA 3DPTA 1YIJI 1EJ9A 1SANA 3GZNB 4A3BJ 1Z9CA 4CYCB 3FX3A 2M0CA 2V1XA 3HB9A 3COAC 4L9TA 1ZLKA 2GAUA 2ME6A 3SEZA 5JR3A 5LBQA 4QWQA 5HDKA 1TWHJ 3F21A 2CMPA 1OCTC 4A3FJ 1VQMI 4KDPA 1TQMA 1H9GA 3AG3H 1W0TA 4EATA 1BN5A 3ZGKA 2PQ8A 1A04A 4F7ZA 2XAUA 1YW8A 1MMDA 2IGKA 1NK2P 3L2UA 1Y8QB 4M3FA 3JRAA 2PN6A 3NRVA 3UNGC 1EF4A 4A0XA 4AUXA 3K4LA 2M8EA 1FX7A 1T33A 2QKLB 2VBYA 4LITA 3EDPA 2NRAC 3S14J 2RC4A 2K40A 2F5FA 3K70D 2WAQN 2EINH 3GO5A 4RAYA 4DYCA 3RZDJ 1DUXC 5F64A 4KUMA 4XLFA 3BTLA 4HF1A 2Q0OA 1BR2A 3IUOA 2FJ1A 3GFLA 3GFJA 2DA5A 3HTUA 1RC9A 2BW3A 1BOAA 3B73A 3JCUC 1Z1DA 5ICFA 3LSJA 2QGUA 2IA2A 3I4MJ 4G9YA 4IF4A 5AIQA 3S2WA 4FASD 1MMSA 4KN4X 2TRTA 2EFNA 3F8BA 4RAFA 2DT5A 4A3GJ 1SMYF 2DK8A 2HWVA 3P9IA 2CW7A 2HQ5A 4A2UA 3T1BA 2H8WA 1PP8F 3CMYA 4AVPA 3GYHX 1AWCA 2M9HA 2DYRH 4E7ZA 4RB3C 5E3OA 1FYKA 1MSEC 2LKXA 2L7ZA 1LJ9A 3I3LA 3K2AA 4HEA2 3WG7H 1S5LC 1D3YA 5IP7J 4E7HA 3PSFA 4JOMA 4ZH4F 1SFUA 2Z99A 2TCTA 2K9MA 3TO9A 1X1AA 3GEZA 3HG9A 4M6YA 2F4OB 2WV0A 3BG7A 3M8JA 3JRGA 2O61A 4LOCA 3SZPA 3GTPJ 2LG4A 3ONQA 1XSXA 3I59B 4WK8F 2IS6A 3KLNA 2FBIA 4P96A 2RAEA 5BQTA 5FLMJ 1ZARA 3BG6A 4LK1F 2F5DA 3IL2A 1JT6A 1ZYRF 2MC4A 2XIGA 3DF8A 4F92B 3ZQQA 4XK4A 2NS8A 4E7JA 2L9RA 5J8CA 4IRIA 3EETA 3BPVA 3GLLA 4XMYA 1D1BA 2WY8Q 4X0GA 2XSDC 2F5CA 3IP4B 1P9QC 3QWLA 5F6FA 3KX2A 1WH5A 4KIFA 5CVVA 2V9PA 3C2GA 4ESFA 2Y2ZA 1WI3A 3U1KA 1MBHA 3JAMZ 1Z6TA 4L9VA 2XAHA 4LLNA 1FTZA 2E7WA 1WJDA 1GDTA 1UFMA 2ACJA 3RZOJ 3GTGJ 3Q3SA 3QRFF 2WTEA 1DU6A 1VFCA 4XORA 2CV1A 3HIFA 2ZMEC 1B8IA 3X2QH 1IN4A 3DTIA 5D4SA 2MBFA 2JA2A 2DFHA 4XSZF 2YX4A 3TW6A 2DW4A 3NARA 5BNGA 4DW6A 3Q9VA 2LY1A 1P7JA 2KDZA 3S2HJ 3F72A 4EM2A 5E17F 3QYEA 4XONA 4Z2YA 2E36A 2HZTA 3H1CA 4MIMA 5B1AH 4CCOA 4EEFG 3S17J 3RIRA 3WTTC 4IHWA 4LK0F 2CQNA 3BR2A 1MMNA 1OYYA 4JX6A 1HW2A 1TLHB 1XDSA 1N77A 1DGRM 3VYTB 2CWEA 4E7KA 2MSYA 2XDVA 4EJVA 2DA2A 5DM7F 2Y48A 3RKQA 4V2FA 4ASNA 2EV0A 5B5EC 4EVIA 2RQPA 4L0ZB 2A5WA 4L18B 4A12A 2E1NA 4J00A 4XL9A 1IXSB 1CGPA 2F6CA 4GO1A 4LGWA 2JZYA 4UV8A 4RBOA 2CG4A 1T6SA 2VC1A 3EQLF 4OIPF 2P6SA 1LPQA 1XMKA 4NUBA 1I27A 1AHDP 3E0JB 1WGXA 3CCMI 2ZJPF 2LNBA 4EJOA 1D5YA 3FWEA 3OWTA 2HOTA 3RPQA 1J0RA 6PAXA 1JHFA 2Z2SB 2FOWA 2E2HJ 1GT0C 4A5MA 3F9KA 4EM1A 4PGGA 2I10A 3JRBA 2JA5J 4ESJA 2CV0A 1Y0NA 1XGOA 2P0WA 1BR4A 3ZQIA 2PJPA 1IXCA 1Y39A 1X3ZB 3MVPA 1FOXA 2LH9A 3MKLA 2ZXIA 4ZTFA 1J9IA 4OAYA 2LP0A 4AC0A 1LKXA 4PZJA 2CGPA 2VT2A 1T95A 5FKOA 2ID6A 2BW3B 4U7BA 2FE3A 3WHBA 5EG0A 1TL8A 2W85A 5HDGA 2HVQA 3WU2C 4QTRA 3BTJA 2R92J 1VI0A 5FLXK 4P55A 2DMTA 2VOPA 1FC3A 2Y9YA 3WGGA 2PX9A 1TW3A 1GXQA 3MZYA 4L9JA 1A36A 4EJTA 5FFXA 2OQRA 4B48A 4IOAF 4H0EA 5K5OA 3I55I 5E1ZB 1QBJA 3BG3A 1TWCJ 2DPUA 3RTRA 1W7PD 3RI4A 1QO0D 4HDVA 4CCNA 3DU5A 1LUJB 4M73A 2IGOA 2JTVA 3VEPA 5DM6F 2L0KA 1Z67A 2E5NA 3OL3A 2IEKA 4CZCA 1MD0A 2EV5A 4D5CA 2BGCA 4I99C 1ON1A 1IV8A 4NC8A 3ZP5A 4QIWN 1LDDA 2QQ8A 3KP5A 1U6GA 3TL4X 4E7SA 2LSOA 1R9TJ 4A93J 3HSFA 2GIVA 3ABTA 4OWRB 3BJOA 3K7AJ 1T0FA 5IOZA 5CVJA 2CO5A 3GVAA 1MNMC 2IGMA 3FKIJ 4G8XA 1B72A 5J4YA 2WC2A 3OYJA 2KP6A 3CLQA 1N78A 2V9KA 1ETWA 1EKEA 3RQIA 2YSRA 1NK3P 3S1QJ 1QZZA 3J7ZI 2QQAA 3CUQC 2QQ9A 1NHAA 3H3ZA 2HOSA 4UXNA 1MNDA 1FZPB 2XF5A 3S3NA 1EH7A 3KYLA 3DV8A 4EGYA 2NOGA 2AO9A 3CJNA 2HDWA 4CSWA 1BC8C 1X3UA 5BOXA 4CYDA 1LFBA 2K5CA 3BY6A 2HVSA 2QM3A 3G3ZA 3G6EI 5HNFA 4UUTA 4PFPA 1BOBA 3MZHA 1GXPA 3QOPA 2M4KA 1B8IB 1MGTA 2J5PA 3SJMA 1IDZA 1USSA 2YU9J 3PL8A 2E71A 2PMUA 3JR9A 2CYYA 1RR7A 2AHQA 2VKDA 1FP1D 3O6BB 4RGUA 2JQ7A 3JSPA 5BS6A 2P5LC 3F8CA 2QVOA 2LKSA 5IT3A 2DN0A 4G6QA 3QP6A 1YO5C 4OINF 2V1UA 2WAFA 5LEJA 1S9HA 4S05A 1XSDA 5K1YA 2C6YA 1QVTA 3MKYB 2FBHA 2W24A 1KZHA 1BC7C 2VXZA 1KGSA 1TNTA 3E7LA 3GBGA 2VQLA 1ERDA 4JP0A 1I39A 1ZAOA 1KQ9A 5IY5H 3TEDA 1SD7A 4RM3A 4G6DA 4RB0A 1AOYA 2KPMA 5D6EA 3CC4I 3M1CA 3BJ6A 1MJBA 1LQ1A 2X48A 4XR6A 3ELKA 4IKFA 1BIAA 5FROA 3CCRI 4A0ZA 2L7MP 2IT0A 3BZ6A 4ZYHA 5J8FA 2CFXA 3CCEI 3ECHA 3ZR8X 3CP2A 1Y1WJ 4YFKF 1OCOH 1OYIA 2OF7A 1XPXA 4B44A 2FRHA 2ESHA 2M3AA 2H6CA 2XPUA 3HJEA 4GDFA 1GHCA 2BE5F 3HSEA 2RKHA 1D0ZA 1C0WA 3L00A 1IW7F 2QSGX 4RGRA 2Q2EA 2A61A 3W3CA 3D5SC 2VBXA 3C3WA 2MA3A 4IX7A 3TDZC 5GAHJ 3J80Z 1O3QA 1JKRC 3DFGA 3K4BA 3G1MA 2EWNA 4I7HA 4DQ2A 1XCVA 2XGEA 1UJ8A 3H92A 5EGOA 2VONA 1DDNA 3A0HC 3BP8A 3HTSB 5FRMA 4UNOA 4F91B 1OQYA 3WU1B 1FPQA 2N8GA 3S1RJ 2VASA 5EG0B 1FIPA 2P5VA 3EPZA 1IJWC 2VOOA 3H3UA 3GTJJ 2MH2A 2ZCWA 3K10A 3R0AA 4P1WA 5D5VB 4G7ZF 3CESA 2B63J 4HNTA 3RCOA 3G4SI 3AG2H 1QQIA 3HUGB 3HDDA 4Q48A 3S2DJ 2GIZA 5L3FA 1BL0A 2VJIA 3EUHA 2A68F 1QHHD 2HYFA 5J47A 1R36A 5LGTA 5IP9J 3OYFA 1J09A 2R7WA 2OU2A 2EZIA 5EEAA 2COMA 1IN5A 1WCMJ 2K3PA 1W4MA 3GFMA 3QPTA 1TWAJ 3KYDB 3I64A 3S1NJ 1K4TA 1J2XA 1IC8A 4E4HA 1OR7C 3H5RA 1BA5A 1ZRDA 3K1NA 5M3FJ 2DK5A 4P5OA 2M5WA 2ZB9A 4BJ5C 3LFUA 2ZC2A 3GZ6A 1R4NB 1HA8A 2HYJA 4BBSJ 4BQNA 3V7SA 3AG1H 5E3NA 4EMSA 4N9HA 4A0YA 4CGZA 1B72B 1SFEA 2J5OA 2KIQA 1PUFA 5L3DA 3QAHA 4CCLA 4R1HA 2JVGA 1RKTA 2F4MB 1R5ID 2DOEA 4KMUX 1JJ6C 2EIMH 2NVUB 3W2VA 3RPUD 4RS8A 1XMXA 1UZCA 2K3FA 1AKHA 3LAJA 1M1EB 1TBXA 3OYLA 3VYUB 4M71A 2DDAA 2LY2A 3CCVI 2WA0A 3DEWA 4BHCA 4UB8C 1X1PA 4BUPA 1YJWI 2XASA 3MAJA 3HOZJ 1R23A 2WADA 5D8KB 2DOAA 2XRLA 3HKZA 4BU2A 2BOLA 2LMDA 4AVZA 3IV5A 3KE2A 2OPTA 1PYVA 5D6FA 3I5UA 4RM2A 4HYEA 4KIBA 1YW7A 3OV8A 5FRNA 1HKQA 1A35A 5CKTA 1IUFA 1TZLA 1WWXA 5LGUA 3V4GA 5E3MA 3TW7A 2AS5F 4B47A 5IP6A 2P7CB 3WTYC 4XLEA 2R7UA 2Q1ZB 1SVOA 4UY8I 1MMGA 4YIFA 5FKLA 3HRMA 3J81K 3ERMA 1DQUA 4V19K 4IQ4A 5C4XJ 1Z77A 2A05A 5FD5A 1OJLA 3BJAA 1JUMA 5GADJ 2A6HF 4DYQA 3S16J 2O03A 2DTRA 4FQGA 2H1KA 3W6KB 2IS2A 2L02A 5M5WJ 2FEZA 3K4NA 4Q4ZF 1VQ7I 3BCBA 2JMWA 1I5ZA 2H8RA 3O3KA 4FE7A 2ZFWA 1ZG1A 1DPUA 2ZBKA 1WHUA 3GMEA 3HZJA 3DKXA 4M3BA 1R1UA 2FMLA 3D5RC 1JUPA 3SXYA 4HNUA 3BQZA 2DJIA 3M8FA 2CQXA 3K4KA 1LEBA 4D7NA 2BY3A 3FXRA 1E3OC 2KRHA 2LK2A 1R71A 3DPLC 5JFRA 1R49A 1D1AA 2ZJ2A 5F0FA 1OMIA 5HDNA 2ZNZA 4A69C 1F43A 2TDXA 2STWA 2HQNA 4KMFA 1FT9A 3JREA 5DCFA 4HF2A 4W1UA 2STTA 2DO7A 4BHPA 2ZFUA 2ZXWH 3G73A 1IGNA 3QP5A 1T38A 4LD5A 3H5AA 1QRYA 5KNLA 5GPAA 1XD7A 2Y31A 5FLXZ 4AIHA 4E7IA 2Q2EB 3WTSC 1TC3C 4FISA 1IZ1A 2WB1N 5J3LA 2BV6A 1GVJA 1FLIA 3WGHA 1BJAA 3LFKA 1YX3A 1QU3A 5D5WB 4BDYA 2QKMB 2FQ3A 5EGOB 2R7TA 5D4RA 2CUEA 2IXSA 3OIPA 5CQGA 4L9NA 3OS2A 4BQQA 2PMZN 3PNYA 1O3RA 2O0YA 4XICA 3J7YJ 5FGMA 2R93J 3FXLA 4PJ0C 3PFIA 4N4OB 2RQQA 3KP2A 2W25A 1L0OC 3KP6A 2E7XA 1S72I 4M9SA 3CTAA 1ZG3A 5DEQA 1RI7A 2HOAA 3HOUJ 1QZYA 9ANTA 1QPMA 3V42A 4DZPA 2IRFG 1YRNB 2VB6A 1MBFA 2OA4A 4HLXA 4JX4A 1U78A 2Y0SN 5KAFC 2VL8A 2X0LA 3ZQ7A 2V7FA 1O4XA 2CFOA 4HPQA 3RQ4A 3OMYA 2V4JC 4KA4A 3ZQCA 2A6EF 5DCMA 5EF6A 2P81A 2VKVA 4MTDA 3G2BA 3F23A 4MHGA 3HGYA 1FEXA 4RLQA 1XGMA 1XG1A 5LRSA 1TNSA 4MLOA 1HDDC 4M6VA 1F5TA 3I56I 4RB2C 2MG4A 1LFPA 3DU6A 3MMYB 4XSXF 3S15J 4MNUA 1YJNI 2QUFA 2A6TA 3I54A 1IXRC 5D8LB 2GXAA 5H2FC 3IKTA 4PJMA 4XLPF 3MD2A 3QOEA 3ZQHA 4BS9A 2P8TA 3K6GA 3GTKJ 1WJ5A 5EEGA 5KVRA 2VJJA 4BXFA 1IN8A 2XAFA 3KYCB 4BHBA 1PUFB 1VQ4I 1ETXA 2QYOA 1DU0A 2LVSA 2HTSA 3DTEA 3IHUA 1X2MA 3IWZA 4I09A 4U0YA 1V5FA 3GXOA 3HSRA 3KP7A 1I3AA 2X4HA 5IT9K 2X9DA 4HAMA 1DPRA 2P7VB 1XDUA 3TQNA 2B0LA 3B02A 3I0TA 3RDIA 3CF2A 1SFXA 2DDBA 1H89C 1FP2A 3A4CA 1WJBA 4H4KC 4XRSA 1SFOJ 1LEAA 2FA5A 2Y30A 2V9VA 3UKGA 2A07F 1K6OA 1FMVA 3JTHA 3PIPF 3KETA 1EH6A 3GX4X 1ON2A 1SFKA 1XMAA 3AAFA 3FHZA 3BTCA 3GCMA 1XX5A 2MD5A 5D5XB 3FM5A 4ENKA 4B43A 3ZCOA 4PSWA 4BBRJ 5LRRA 3K69A 2G7HA 3NWTA 4M6XA 2R7SA 2XV4S 4XN3A 5B66C 1OLTA 3A2KA 5HNHA 3GTQJ 1CF7A 3I58A 4DJAA 4AD9A 3OYNA 1G8XA 3KCCA 3SEQA 3I53A 1J7KA 3WODF 4BDZA 3K4CA 1UHWA 4L5EA 1R5HA 1UELB 2PG4A 3P9CA 3CJRB 5BPIA 4WF2A 1U9NA 4FCYA 1SVLA 2DBBA 3Q0WA 2L4MA 2QF7A 4U88A 3REOA 3TOAA 1DP7P 4BKXA 2DMUA 1UG2A 1H8AC 4FE4A 1BI3A 3E6BA 2BVLA 3F6VA 4DBRA 1YYVA 3CCYA 1H9TA 1VF9A 2EFQA 2I5UA 5KHDA 2ZXJA 3HHGA 5H6QA 2ISZA 4HF0A 4J01A 1HBXG 4FHTA 4ZYAA 2IP2A 1ZK8A 1R22A 3NEUA 3L1PA 4QPOA 3LQRA 1W7PA 2X51A 4AWXB 1XN7A 3RKXA 1W36D 1REPC 2EFPA 1S8NA 3WGIA 1ETOA 5L3CA 4K2EA 2OCCH 3FBIB 1ETYA 4Q47A 4IHVA 1WJFA 2WY7Q 4F52A 2Y9ZA 4UB6C 1JKPC 1X2NA 3R0JA 3L2RA 4HX7A 3IKVA 5CJ9A 5DYMA 4KT5C 3LSTA 3SZGA 5AIPA 4I76A 3HC7A 2L54A 2V1NA 3QQAA 1X4PA 4ZTJA 1TQPA 2CSOA 1O57A 3DBRB 2AXTC 1I1GA 3A01A 2DU9A 2W00A 3E6DA 3I4NJ 2X6WA 2EB7A 2QSFX 3JRFA 3GTLJ 3W6JB 4ZJZA 1ETVA 5DD8A 2W84A 4PK4A 1R5GA 2B7EA 2P4WA 2KFDA 1ZGWA 1P4AA 3K2ZA 4MEXF 5LFAA 1CQTA 3CMMA 4XLNF 4KNYA 4YFNF 2GZWA 1S29A 2QA4I 1WSUA 1P4WA 3LNQA 1YLFA 2OCEA 2ME0A 4NNJA 4AYBN 2CU7A 1ZELA 1YS6A 1K78A 3U9GA 4R79A 3GWZA 5K5QA 3E97A 3OIOA 2WAEA 4P9UA 1VQKI 2X1EA 4EGZA 2MYSA 3VSLA 3VYRB 1UG0A 3DKWA 1RESA 2ETHA 4XKVA 4WCGA 1BIBA 5DCMB 1W5SA 2W4SA 2VBWA 2JN6A 3ZQGA 4GYIA 1G4DA 1WQ2A 3HHHA 4IZZA 1XSVA 3F0CA 2F5VA 1FBQA 4PJNA 4D0PA 5DUIA 2FBKA 2EFOA 4NQWA 3CC2I 3ABKH 4I98B 2OAZA 3J7AY 2JRTA 4I2OA 4UV9A 3Q0VA 4ANJA 1APLC 2VPLA 1ZR2A 5TISC 3ZMVA 4BQOA 5EDNA 3ZMUA 3PIOF 2IBDA 2K9SA 1XCBA 1OYWA 4UVBA 3QYFA 3FISA 4WXHA 2BY0A 3I4PA 2GXBA 1ONVA 5B3SH 4MFEA 3CO7C 3UR3C 1UHMA 1Y56A 1I6HJ 3BWGA 3LSMA 4PUSA 4Y7NJ 2FF4A 1MJ9A 3FXUA 2KJBA 2VQCA 5DD4A 4IXAA 5FKKA 3FK7A 5ED4A 1EA3A 2O7OA 3V8LA 2FXAA 1WFXA 2FX0A 1FTTA 2ZSIB 5HODA 1G6NA 1LVAA 4D1QA 4XQFA 1K6YA 2LR8A 2K4BA 3EYIA 4X6AJ 2L9NA 4HQMA 3HM5A 3JRHA 2RNJA 4A3JJ 2R5YA 1T0FC 1D8KA 1BJZA 3WG9A 2PJRA 2KL4A 3BOQA 1VQOI 1T8IA 4RLFA 2WAQA 3EUKL 3ABMH 3NWSA 4XOPA 4C2MJ 2HQAA 1U8RA 3J81Z 4CCJA 1F4KA 4HX8A 5J40A 4XN0A 1JUSA 3HOWJ 1IUYA 2R7RA 4ZZDA 4NBQA 1ZGJA 3WTXC 2VE8A 5DUKA 2KIMA 4NC6A 3BTIA 1TT5B 3E5UA 3D0SA 2V6CA 4C3JJ 3WHCA 3Q0UA 3S93A 4I0BA 2UZKA 1U5TA 2DQLA 2VIXA 2CQQA 2R7QA 2XGCA 5HLIA 3MFKA 2H09A 1F1ZA 4NB5A 3DTKA 1HXDA 3OL4A 1BI2A 4LB6B 3LOCA 4BXUA 1VQ9I 3OSFA 1WI9A 2E34A 3LWFA 4JK1X 4BNCA 2AQEA 4FT8A 1U8BA 2VLAA 3M8EA 5HLHA 5E8IA 1L3LA 1LDKB 2F2EA 1IRFA 3FXKA 4LFUA 1Z6RA 2VI6A 1V55H 1KQ0A 2JSCA 3BR3A 1UAAA 2M30A 2XGXA 4M3EA 1ZN2A 3LSPA 4JYKA 1Y6IA 3A03A 5F0CA 1W7PB 3VB2A 3HL2A 2NNYA 2QBYA 2LD5A 1B9MA 1W5TA 1LE8A 1OCZH 4ZDPA 1YX5A 2A69F 1EH8A 1X1CA 4D9JA 1KU2A 2EV6A 4YIRX 4CO8A 3HRTA 4BY7J 2OJED 3IH3A 2YX7A 2HKXA 3LAPA 1XB4A 2Z5UA 3C18A 1RR8C 2HDCA 4I0AA 1T2KA 3LQQA 5FD6A 1O3SA 3FXMA 1WVRA 2HPMA 2E2IJ 2IS1A 4KITB 1LB2A 4PGHA 3PNTA 3BROA 3CCSI 2HNHA 5E3LA 4V2GA 3BR5A 5DDGA 2HVRA 3Q9SA 2M0MA 2X1CA 4HV5A 4P9FA 1VQLI 3OOUA 2KIFA 1TTYA 3QPHA 4FETA 3MKWB 2RGVA 2DQRA 2VKHA 2XB0X 2JVHA 4FX4A 3A0BC 2LLKA 1XGNA 4RGSA 3MN2A 4Y17A 1YG2A 1VZ0A 1IAWA 2M87A 3RPUA 2R7XA 4JBAA 3FXJA 2K9LA 4BGDA 1Z3YA 4BY1J 3F3XA 2O3FA 4IPAA 4C9YA 1PP7U 2JA7J 3LSGA 3HOVJ 2JUGA 2PI0A 2BVMA 1T98A 2X6YA 4HSTA 3RYPA 1U0JA 2E19A 3IRQA 2LC2A 1SAXA 2B9SA 1K78B 2MC3A 2EQRA 2RV8A 3DWLE 1VQNI 1R4MB 5J6XA 3G1LA 5JLXA 3IRRA 1RETA 1WJAA 4U87A 1UMQA 2EIKH 3FKJA 2A5YB 2DTZA 2LBFA 3OS1A 4EJUA 5KAIC 4EV0A 4DGWB 1PVEA 2V79A 3H9GA 3OIQA 3OYDA 2XC7A 1RIOH 2H27A 1MBKA 1JTYA 4YG2F 4KJZA 1VQ6I 3A1YA 3EYYA 3U2RA 1ZRCA 4DYRA 4NQWB 3VDXA 2O8XA 1KU3A 2EZLA 1W1WE 1GVDA 1MJAA 3ISPA 3CDIA 5JI6A 3EUHC 4I01A 3MQ0A 3IC7A 1ZGAA 2F4IA 3FMSA 2HU9A 1HSTA 3BZCA 3KZZA 5HS9A 4RGXA 2Y75A 4FTHA 3PM1A 2EJRA 1ODDA 3MWMA 5EZHA 2P5KA 1G3TA 2FMYA 2O5RA 1ORKA 4O5VA 4NHJA 1SVMA 4AM3A 5K7ZA 2EBIA 5E8GA 5LHIA 2R7OA 3NAUA 4WXCA 3ZRGA 2D5VA 3T8RA 4CCKA 3HRSA 3FMRA 5DS9A 3FK6A 2PJRB 1STZA 2BEOA 3VWBA 3BZKA 4IO9F 3GTOJ 4XIDA 4G12A 3ROUA 1E3PA 4YRVA 2L7FP 4CH7A 2NVXJ 5J1UA 4Y3OA 5FLVA 2KQRA 2X1DA 1LFUP 2VJ4A 2E2JJ 4BAYA 3HEFA 1ZKGA 2VN2A 3QU6A 4BH9A 2NYXA 4YEJA 4CCMA 2MH9A 1O7FA 1MW7A 4IL6C 4HDUA 3PO3J 2R7VA 1U5TB 3H9JA 4XRFA 3CDHA 3OS0A 3ASOH 3PO2J 4HW0A 1RUNA 2XSJC 1JI8A 4HZFA 5L3BA 3K9TA 4ENMA 2CQ7A 4A3LJ 2HZDA 4M72A 5JLWA 1X58A 1X3WB 3K70C 4DZJA 3RKWA 2V6EA 2VE9A 2VBZA 5J4VA 4PFOA 3IWFA 3BG9A 5LLQA 2ZJQF 1K83J 2JK3A 3FXOA 3QPSA 4HLYA 1X19A 2XB5A 1Q1VA 2HDDA 2KMUA 1KU7A 1HKSA 3KEOA 1LE8B 1FMWA 2CUZA 2L2OA 1OISA 5BPDA 2ZO4A 4XLHA 4ZZLA 1MDMA 3ABLH 4GGGA 2YPRA 2RNGA 3OYKA 4XLCA 3HXLA 3QODA 2M7AA 5CPRB 3WTWC 3PJRA 3W6VA 2UUZA 2KDOA 1J5YA 2BYVE 3SHFA 1OKRA 2BXZA 1HOMA 2DYSH 4OMZA 2X85A 5JHFA 3KZYA 2HOEA 4OOIA 1J59A 2DFEA 3HYIA 3ZMDA 2DFIA 2NAZA 5HLGA 3IAS2 3JRIA 2EA2A 5EJCA 4NC7A 3DLAA 3WTVC 2HEOA 3TP0A 1K61A 5D5UB 1T56A 4F55A 2QWWA 5EZGA 3ZMTA 5IYCJ 1QPIA 2NVTJ 3GLXA 2FU4A 4NDLA 2O6GE 2HS5A 3LA7A
chains in the Genus database with same CATH topology
2DCEA 3L2WA 2HVQA 2VQHA 2R7SA 3NWTA 5CQEA 1V5GA 4XN3A 2DXIA 4HSRA 1OLTA 3A2KA 5HNHA 4XLAA 2JSPA 4DJAA 3OYNA 1G8XA 1NG7A 3SEQA 1PJRA 4OAZA 4BDZA 1TT0A 3K4CA 3LSHA 3L2QA 1UELB 4B48A 1N75A 3CJRB 2R4GA 2I8DA 2LYCA 1D1CA 3RTRA 3U21A 2M7BA 4PJLA 4CCNA 3DU5A 2IGOA 2ELJA 4II2A 2E5NA 3OL3A 3BC8A 4CZCA 3AL0C 3VSKA 4IQJA 2BVLA 4LIVA 4AYBA 4DBRA 4NC8A 2ZSHB 3TL4X 4E6KG 5KHDA 4E7SA 4J01A 4ZYAA 4OWRB 3HPHA 2MD0A 4QPOA 3OYGA 3BLYA 2X51A 1W36D 2IGMA 3S3OA 3OYJA 3FBIB 3DKYA 2KP6A 4GRIA 3QYBA 1N78A 1WJFA 2V9KA 4BE1A 4QPQA 2W82A 2WY7Q 4F52A 1X1DA 3L2RA 4LIUA 1MNDA 3SZGA 4XNFA 1NG6A 3HC7A 2V1NA 2XF5A 1X4PA 4ZTJA 4HRIA 3S3NA 3KYLA 2LOOA 2HDWA 4CSWA 3CP8A 2W00A 4BEHA 2X6WA 2Z16A 4HG2A 4BJ6C 2K5CA 2HVSA 2Z1DA 5HNFA 4PFPA 1BOBA 4ZJZA 4DOZA 3AL0B 2E5ZA 2AQFA 4PK4A 2M4KA 4XOTA 3TMOA 3K4JA 4C2UA 3PL8A 2VJ5A 2XF6A 3W2WA 3TBIA 2X6XA 3I9V2 5LFAA 2E1MC 3CMMA 1GLNA 2HPIA 2VKDA 3AKZA 3H35A 1IRXA 4NNJA 3LMMA 1ZELA 5HLTA 4XKWA 3S3MA 4R79A 4Y4RA 4BE0A 2WAFA 2WAEA 4KT6A 1S9HA 2CH0A 2X1EA 3MKYB 2MYSA 3AFHA 3PNVA 4ZDLA 2MABA 2VXZA 3LL7A 3VSLA 3SDBA 3VYRB 1UG0A 3HOTA 4XKVA 3GBGA 4C30A 2VQLA 1ERDA 2W4SA 2VQGA 2CS3A 4RM3A 4IZZA 4CUGA 2CUJA 1WJCA 2F5VA 2KPMA 4DBQA 3M1CA 4PJNA 4II3A 2M4GA 3OYAA 3J7AY 4XR6A 2FUG2 4ANJA 4IKFA 2VPLA 1G59A 5FROA 4BQOA 4BL0B 2OC6A 2KHMA 3QYFA 3ZR8X 3OYEA 2DT7B 3N05A 3CP2A 4Y33A 2E1MB 1D0YA 3VYSB 3OYMA 3PUBA 4B44A 1Z7LA 3UR3C 2M3AA 5TGTA 4KISA 1Y56A 3LSMA 4PUSA 3S32A 4N4NB 1D0ZA 2VQCA 3RSNA 1EA3A 1WFXA 2IS4A 3W3CA 3D5SC 2ZSIB 4IX7A 4D1QA 5KCMA 4XQFA 1K6YA 4XKCA 2L9NA 3K4BA 1X4OA 2V26A 4JQFA 3FDYA 4B3XA 3OR1C 1T0FC 4F3QA 3H9QA 4ZDOA 2UWMA 5FRMA 2ZXHA 2PJRA 3EUAA 2KL4A 4F91B 2LBFB 4RLFA 2WAQA 3EUKL 4XOPA 3NWSA 3OYBA 3OYCA 1E0EA 2HQAA 2VASA 4ZC3A 3HOSA 3PSIA 4CCJA 1MNEA 1R6RA 3DQVC 1Z3XA 3EPZA 3SYTA 4XM3A 4XN0A 3ZXSA 2R7RA 3LSIA 2NOJB 3K10A 4P1WA 3CESA 4HNTA 2KRCA 2KZVA 3RCOA 4YELA 3HUGB 3S93A 2W7NA 1BR1A 2L7KA 2VJIA 4ITVA 1QHHD 1W36C 3DPUA 2VIXA 2R7QA 3DPTA 1AA7A 3DTKA 3OL4A 3OYFA 1J09A 2R7WA 3KEYA 2RREA 3H0DA 2K3PA 1MMAA 2AQEA 3SEZA 3S8PA 2VLAA 4XKBA 2LRDA 2CMPA 4E4HA 1LDKB 1OR7C 3H5RA 4EATA 3ZGKA 1UAAA 4P5OA 2XAUA 4BJ5C 3LFUA 3FBNB 1HA8A 1Y6IA 2CW8A 3HL2A 1MMDA 4BQNA 3D5LA 2IGKA 2E60A 3L2UA 4ZDPA 1YX5A 1Z21A 1X1CA 4RMNA 4D9JA 2XF7A 3UNGC 1YE9A 4CCLA 2JVGA 3K4LA 2QKLB 3OYHA 2IGNA 4LITA 3W2VA 3RPUD 2HPMA 3K70D 2IS1A 4KITB 1WJEA 3PNTA 2HNHA 4XLFA 3OYLA 3VYUB 2HVRA 1BR2A 3IUOA 2LY2A 2M0MA 2WA0A 2X1CA 2OV7A 5LD2C 4BUPA 3OOUA 2BW3A 1D0XA 4FETA 2DT6A 2WADA 3MKWB 4BEHB 2VKHA 2DOAA 2JVHA 3HKZA 4BU2A 2BOLA 4FASD 4AVZA 1VZ0A 1PYVA 3IAM2 4RM2A 2R7XA 2K9LA 4BGDA 1Z3YA 5FRNA 2UV1A 1X1BA 5CKTA 4C9YA 1TZLA 2CW7A 2WBMA 3LSGA 4B47A 2JUGA 2WB1A 4XLEA 3C2HA 2BVMA 2X6YA 1DP3A 4HSTA 1U0JA 2R7UA 4E7ZA 2Q1ZB 1MMGA 2LC2A 3I3LA 4HEA2 1DQUA 4IQ4A 4E7HA 3PSFA 2PMZA 4JOMA 3DWLE 2OUMA 4BJTA 2K9MA 2KLOA 1X1AA 4E7LA 2GOMA 3HG9A 1KONA 5HVQC 1WJAA 4U87A 3FKJA 3BG7A 2LBFA 3OS1A 3M8JA 2IS2A 4CA0A 3OYIA 4DGWB 3K4NA 2CV2A 2LG4A 3ONQA 3BCBA 1LVKA 3H9GA 3OIQA 4G6TB 3OYDA 2XC7A 2L5QA 2IS6A 3DKXA 4KJZA 3D5RC 3W2AA 4BACA 3BG6A 3K4MA 2Y0SA 3A1YA 4HNUA 2DJIA 3K4KA 4NQWB 4PJJA 3VDXA 2MC4A 4F92B 2GOXB 3ZQQA 2KRHA 4E7JA 3DPLC 4XMYA 1D1AA 4PSXA 1D1BA 2LREA 2WY8Q 4X0GA 3EUHC 3IP4B 1P9QC 3KX2A 3OY9A 3HPGA 3DEEA 2F4IA 3C2GA 2HU9A 3FHNA 4DIQA 3OR2C 2ZFUA 3H5AA 5KNLA 4E7IA 1WJDA 2Q2EB 3MKZA 3H5NA 2O5RA 4XORA 2CV1A 1YX3A 1QU3A 3LSKA 2R7OA 3ZRGA 4BDYA 3DTIA 2QKMB 4AU7A 2R7TA 4CCKA 2IXSA 3OIPA 5CQGA 3OS2A 2JA2A 4BQQA 2PJRB 3PNYA 3VWBA 4YRVA 4CH7A 2LY1A 2MFZA 4C2TA 4Y3OA 2KQRA 2RQQA 2X1DA 4N4OB 2VJ4A 4F93B 2L9SA 3QYEA 4XONA 4YEJA 4CCMA 2R7VA 1MW7A 3V42A 4CCOA 2VB6A 3H9JA 2VL8A 1MMNA 1QHGA 2V7FA 3OS0A 2CFOA 4HPQA 3RQ4A 3OMYA 2V4JC 1N77A 1DGRM 2XSJC 1JI8A 3VYTB 4E7KA 2XDVA 3G2BA 4LG3A 4RLQA 2HZDA 3CJQB 4MLOA 2A5WA 3K70C 4J00A 4XL9A 3DU6A 1LFPA 2V6EA 3MMYB 2F6CA 4PFOA 2A6TA 2W1OA 1SAUA 3BCAA 4PJMA 4NUBA 3E0JB 3MD2A 3QOEA 1X19A 4BS9A 2KMUA 3CZ6A 3K6GA 3OWTA 1WJ5A 3E1SA 4BXFA 2VJJA 1FMWA 2CUZA 2Z2SB 2L2OA 3PFYA 5HOOA 4XLHA 2VXDA 3F9KA 2RNGA 3DTEA 3OYKA 4XLCA 3HXLA 3QODA 2M7AA 5CPRB 1DGWY 2CV0A 3PJRA 4BE2A 1V5FA 2UUZA 2P0WA 1BR4A 2KDOA 2X85A 3CF2A 5JHFA 2LH9A 3A4CA 1WJBA 4H4KC 2ZXIA 4ZTFA 3L2VA 3IAS2 4OAYA 1FMVA 4NC7A 3DLAA 1LKXA 1SFKA 4F55A 1T95A 2BW3B 1V5EA 4U7BA 4B43A 3ZCOA 4PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR2 C;  2V4J C;  2XSJ C;  1YX3 A;  1JI8 A;  3OR1 C;  2A5W A;  1SAU A; 
#chains in the Genus database with same CATH topology
 5ICC A;  5H20 A;  3L2W A;  3E5Q A;  5CQE A;  3LSR A;  1V5G A;  2DXI A;  1JKQ C;  3FIW A;  2EPF A;  1RRJ A;  1MBG A;  4XLA A;  2JSP A;  1A5J A;  3M07 A;  1PJR A;  3KEQ A;  4OAZ A;  3VOE A;  5HS8 A;  4L5J A;  3LSH A;  3L2Q A;  3HGG A;  1FYM A;  5F0H A;  4IEJ A;  1JXS A;  2PEX A;  1N75 A;  4MFD A;  2HYG D;  2R4G A;  3OSG A;  2ESN A;  2LYC A;  1FSH A;  3E3V A;  1I1S A;  4G7H F;  1P2F A;  2ELJ A;  4II2 A;  4XBF A;  5M5Y J;  3CCU I;  1YW9 A;  2ELH A;  1B4A A;  2KRF A;  2M8G X;  3BC8 A;  1IO2 A;  2ISY A;  3VSK A;  4IQJ A;  2HR3 A;  3F22 A;  3H36 A;  3RKY A;  5F1R A;  5LHG A;  3CD6 I;  2ZSH B;  3DCF A;  1HF0 A;  3TO6 A;  1V3F A;  4E6K G;  4A3E J;  2XAG A;  3NQO A;  2IW5 A;  4LG0 A;  2DI3 A;  4KYW A;  1HW1 A;  1SD5 A;  3QU3 A;  3OYG A;  2GQQ A;  3ZMS A;  2K86 A;  1NH3 A;  4OU0 A;  5F04 A;  1FOW A;  2BZT A;  3DKY A;  3QYB A;  5ILU A;  2KT0 A;  3JRD A;  4BE1 A;  2W82 A;  2JPC A;  4B09 A;  1X1D A;  5GP9 A;  3R60 A;  1TW2 A;  4ENJ A;  1I50 J;  4LIU A;  5DTD A;  1A6I A;  3GUD A;  3KIO A;  2HTJ A;  3F8N A;  1MBE A;  5FKN A;  2PFB A;  4GYG A;  2D1H A;  2JT1 A;  5M3M J;  4LJZ F;  3P9K A;  1S6L A;  5F27 A;  4C3H J;  5CYV A;  1UST A;  1UHS A;  4ENN A;  1ZR4 A;  4MTE A;  4ETS A;  2XKP A;  3CP8 A;  3ZN0 A;  3PUF A;  4BEH A;  1Z7U A;  2Z16 A;  3KZI C;  4HG2 A;  4BJ6 C;  1XS9 A;  3HRU A;  1OPC A;  2DJN A;  4DOZ A;  4YFX F;  5A2Q K;  3AL0 B;  2Y69 H;  3K0L A;  2CUF A;  2ECC A;  3CQZ J;  4CDG A;  2GA1 A;  3DXJ F;  3FM3 A;  3P7N A;  2GXG A;  3K4J A;  3SQN A;  4C2U A;  2XF6 A;  3W2W A;  3TBI A;  5JVG F;  3I9V 2;  4KIC A;  1OCP A;  2H6B A;  4ESB A;  1IRG A;  1D8J A;  3SFZ A;  1FWZ A;  3AKZ A;  3J7A O;  2XAJ A;  4HBL A;  5K7F A;  1IRX A;  1JGG A;  4XRM A;  2XRO A;  5HS7 A;  3LMM A;  2FQ4 A;  4KIG A;  4U0V A;  5HLT A;  2VOD A;  3S3M A;  2ADU A;  1MKM A;  4Y4R A;  3L9F A;  1XGS A;  5TJJ A;  2CH0 A;  1U2W A;  2W48 A;  2XHK A;  3PNV A;  4ZDL A;  5FFZ A;  3LL7 A;  4TV7 A;  4IRG A;  3SDB A;  3MCZ A;  1Y1V J;  2VPR A;  3D1N I;  1JHH A;  4CIC A;  1BI0 A;  1AKH B;  2VQG A;  2DA3 A;  2H1L A;  2DA4 A;  1SC7 A;  2CUJ A;  1RUO A;  4WXD A;  3KP3 A;  5C44 J;  2IPQ X;  3J80 K;  3GTM J;  3IH2 A;  1U3E M;  4L5I A;  3PQK A;  1Y0U A;  2L9V A;  2M4G A;  2V1D A;  1K79 A;  5IYD J;  2JPB A;  2FUG 2;  1P7I A;  2XGD A;  2IVM A;  3L09 A;  1KA8 A;  1V54 H;  2OC6 A;  1D5V A;  1S3J A;  4IJA A;  3OYE A;  2CW0 F;  2DT7 B;  3N05 A;  4X1E A;  4LMY A;  3TDU C;  1T39 A;  3M4O J;  2EZH A;  2EFW A;  2E1M B;  3VYS B;  2EA4 A;  3PUB A;  4OIO F;  5IYB J;  4M9X A;  4AID A;  5TRD A;  4KIS A;  1S7A A;  1MDM B;  1MSF C;  3S32 A;  1K7A A;  4N4N B;  3K1M A;  2IAI A;  1O3T A;  3S1M J;  2IS4 A;  1OFC X;  4S0H B;  5E20 A;  5KCM A;  3TGN A;  4WWC A;  1IV6 A;  4XKC A;  4L0Y B;  5EYR A;  1X4O A;  2V26 A;  4JQF A;  3MEX A;  1YFH A;  4A3D J;  3OR1 C;  2EIL H;  3WE3 A;  3H9Q A;  4Q5S F;  4ZDO A;  2IA0 A;  1ZQ3 P;  4A6E A;  3EUA A;  3H3V K;  1KQ8 A;  3OYB A;  2LFB A;  3TKY A;  1FSE A;  3PSI A;  2HKO A;  1R6R A;  3SYT A;  1Z3X A;  2OTL I;  2EZK A;  3ZXS A;  3KFW X;  4J19 A;  1ZHF A;  3LSI A;  2MLG A;  2JA6 J;  1R7J A;  1R00 A;  2XPW A;  2R7F A;  2K9Q A;  2L7K A;  2OD5 A;  4ITV A;  1KYZ A;  1H88 C;  3BQY A;  3DPU A;  5F1J A;  1AA7 A;  1E2X A;  1ULY A;  2OTJ I;  1VND A;  4D5F A;  3SZT A;  3KEY A;  2RRE A;  3CUO A;  3SFI A;  4EJW A;  3H0D A;  4E70 A;  1MMA A;  2K7L A;  1POG A;  4LB5 A;  1S7E A;  1N25 A;  3S8P A;  3CCL I;  3C2B A;  2XAQ A;  2K27 A;  2LRD A;  2XPV A;  3FMQ A;  4XKB A;  1ZG5 A;  5GPC A;  4KFC A;  3OOP A;  5H6R A;  1YHQ I;  1Z91 A;  3VFZ A;  1UB9 A;  1VQP I;  4LG0 B;  2M2E A;  2ELK A;  2ZME A;  1FJL A;  2AXL A;  4EQQ A;  3FBN B;  2CW8 A;  4HX4 A;  2VKE A;  3D5L A;  2CRG A;  3IH4 A;  4PCQ A;  1IRZ A;  2E60 A;  3G1O A;  4HV6 A;  1BW6 A;  1Z21 A;  4RMN A;  3A02 A;  3BT9 A;  2XF7 A;  2GLO A;  2D1V A;  1YE9 A;  1J75 A;  1TWF J;  3OYH A;  2IGN A;  1BI1 A;  2E1C A;  3CLO A;  1PUE E;  3WU0 A;  3E5X A;  1GV2 A;  1WJE A;  2R0Q C;  2RDP A;  4ZYE A;  1BM9 A;  5JVT A;  2GWR A;  2JA8 J;  5ICG A;  2OV7 A;  3V8K A;  1HQC A;  5LD2 C;  4B4C A;  4N0B A;  2YU3 A;  1FBU A;  3ZN1 A;  1D0X A;  2DT6 A;  2JWT A;  4BEH B;  1TWG J;  2BY1 A;  2VUM J;  3CCQ I;  5CLS A;  1RPW A;  3IAM 2;  2KIU A;  1T08 B;  3HOX J;  2ZKZ A;  2NS7 A;  2UV1 A;  1X1B A;  2PLY A;  1UCR A;  4MGR A;  2O9L A;  2WBM A;  4A6D A;  1H0M A;  3KPH A;  1ZRE A;  1R1V A;  2WB1 A;  3C2H A;  5GTI C;  1F36 A;  2IJL A;  3VPR A;  1DP3 A;  3TOB A;  5FJ8 J;  5FKM A;  1WPK A;  3T8T A;  1HLV A;  2PMZ A;  3HBL A;  1GV5 A;  5E1X A;  2HXI A;  2OUM A;  1I6X A;  4BJT A;  2KLO A;  4B1R A;  1FOK A;  3ECO A;  1MZB A;  2GOM A;  3LA2 A;  1KON A;  3CDL A;  5HVQ C;  4E7L A;  1RKW A;  1O7L A;  5L3G A;  1YJ9 I;  3HOY J;  4CA0 A;  3OYI A;  5L3E A;  5LGN A;  3ASN H;  2CV2 A;  2PBI A;  2G7U A;  5GAG J;  1LVK A;  4G6T B;  1KYW A;  2L5Q A;  2LKP A;  2XKO A;  1SEU A;  1QNT A;  4R8H A;  3W2A A;  3KLO A;  3V8J A;  4BAC A;  2K02 A;  2QLZ A;  2FOK A;  1BBY A;  2Y0S A;  3K4M A;  2O8K A;  2FD5 A;  3HUG A;  4IOC F;  4M3G A;  4PJJ A;  2GOX B;  1Z05 A;  1QZE A;  5AON A;  5ILS A;  4PSX A;  2LRE A;  1U5T C;  3PQJ A;  1VQ8 I;  2OBP A;  3TP3 A;  1JT0 A;  1CF7 B;  2DOF A;  3I71 A;  3HPG A;  3OY9 A;  3DEE A;  3R6S A;  2R3S A;  3HKZ N;  1TP4 A;  3FHN A;  4O3M A;  4DIQ A;  3OR2 C;  3DBL B;  1E3H A;  4W97 A;  1HSJ A;  3CJT B;  1ITY A;  2ID3 A;  4I6Z A;  4FX0 A;  2QEN A;  2K4J A;  2KIS A;  3M9A A;  3V7C A;  3MZ8 A;  4UVA A;  2LY9 A;  4UHT A;  2ECB A;  3Q5F A;  2L4A A;  2CJJ A;  5ILV A;  4IHY A;  1OCR H;  2D2W A;  2ZJR F;  3RJP A;  1SD6 A;  3H5N A;  3MKZ A;  1JJ8 C;  4BQA A;  4Y52 J;  4YII A;  4N9I A;  1IG7 A;  5E18 F;  3QPL A;  2DMN A;  2HQR A;  1MIJ A;  2HI3 A;  4UUS A;  2MGQ A;  3LSK A;  3BPX A;  1Y8R B;  3KP4 A;  4AU7 A;  2D45 A;  4CHU A;  2OZU A;  3K1P A;  3DLL F;  2DLL A;  3GZ5 A;  2MFZ A;  2ZNY A;  2YS9 A;  2JJ7 A;  4C2T A;  2DA7 A;  5CVR A;  4HNV A;  2OZ6 A;  3GF2 A;  2GM4 A;  1JGS A;  2VT3 A;  3VOD A;  3WTZ A;  4F93 B;  2L9S A;  2IA1 A;  2QQB A;  3E6M A;  3BR1 A;  2G9W A;  1IF1 A;  2LF7 A;  3CUQ A;  2FNA A;  1QHG A;  1JKO C;  4IHS A;  2K9N A;  4BYY A;  4LG3 A;  2Q8K A;  5K7H A;  2Z33 A;  4Y15 A;  3CME I;  2E35 A;  3CJQ B;  1B9N A;  2XVC A;  4CXF A;  2FSW A;  4M74 A;  5LEK A;  3FXQ A;  2DA6 A;  1MH3 A;  3DBH B;  1XC5 A;  4OIQ F;  2XUB A;  3A01 B;  2W1O A;  4IRH A;  1SAU A;  2BHY A;  3RYR A;  5GTH C;  2GBY A;  3BCA A;  4B3A A;  2ZME B;  1RZ4 A;  1G2H A;  2EK5 A;  2R5Z A;  1KU9 A;  3CZ6 A;  1P92 A;  3E1S A;  4EM0 B;  3BR6 A;  1NTC A;  4HQE A;  3AG4 H;  3ZPL A;  4U0W A;  1VTN C;  3PFY A;  5HOO A;  3C7J A;  1G3Y A;  2VXD A;  2BBY A;  4M3D A;  2R7D A;  1DGW Y;  3M7G A;  3ZQF A;  4QLC U;  4BE2 A;  5A2Q Z;  4UUV A;  2OQG A;  1W0U A;  1YOV B;  1YIT I;  2HFH A;  1YIO A;  4G94 A;  4QSH A;  2VC0 A;  2P6T A;  4Y13 A;  3L2V A;  2KKO A;  3E6C C;  2BY2 A;  2DA1 A;  1ACI A;  1I3Q J;  5ICE A;  1W5C C;  4BXX J;  1SD4 A;  3T0Y A;  1FY7 A;  2WV1 A;  5FB2 A;  2Z3Y A;  3JAM K;  3T5X A;  2KJC A;  1V5E A;  5B1B H;  4A5N A;  1JE8 A;  2DCE A;  3BR0 A;  1XTA A;  2VQH A;  4XRS G;  3LA3 A;  4KN7 X;  4HSR A;  3R4K A;  1FYL A;  2DMQ A;  2RN7 A;  4RDU A;  1NG7 A;  2NS0 A;  2NNN A;  1TT0 A;  4U7D A;  5IT9 Z;  2KZG A;  4RAZ A;  3CMA I;  1GUU A;  5GAE J;  2I8D A;  4LLL A;  1D1C A;  2M34 A;  3JW4 A;  4CYC A;  3U21 A;  2M7B A;  4JX5 A;  5JHU A;  3JRC A;  4IHT A;  4PJL A;  2MW8 A;  2L3D A;  3ESW B;  2WWY A;  1IDY A;  3F8F A;  2R7Z J;  3P5J A;  2YUS A;  2UXN A;  3ML6 A;  3BG5 A;  3AL0 C;  4RA2 A;  3CF5 F;  4LIV A;  4AYB A;  3CC7 I;  3M1E A;  5ERI A;  1R58 A;  5IPA A;  5EEH A;  3TO7 A;  2MLK A;  4A3I J;  2Y0M A;  3HPH A;  2MD0 A;  4HOB A;  1K4S A;  3R61 A;  4MEY F;  3BLY A;  1Z0X A;  1V4R A;  3O8G A;  2R5Y B;  4MQV A;  3S3O A;  4IVN A;  3N97 A;  4GFB A;  4GRI A;  5J1R A;  2FNP A;  3ERE D;  1ZRF A;  3F8M A;  2JRM A;  1YRN A;  1IN6 A;  4QPQ A;  5KK1 A;  2E1O A;  4OMY A;  2W57 A;  4M9Z A;  4D7M A;  1FBS A;  2A3S A;  3O2P E;  2NVY J;  4HA8 A;  4AIJ A;  2LTP A;  1NG6 A;  2X6O A;  4XNF A;  1R1T A;  4WX9 A;  3WTU C;  4A3K J;  1WZ2 A;  4HRI A;  1F9N A;  1HCR A;  3ZOB A;  2EH3 A;  5K5R A;  3DEU A;  1OCC H;  1YS7 A;  2K85 A;  2LOO A;  2BXY A;  2UXX A;  5M5X J;  1HW5 A;  1IN7 A;  2QEX I;  2Z9O A;  4C3I J;  2NVQ J;  3B6A A;  1E17 A;  1FIA A;  2Z1D A;  3JTG A;  2DOD A;  3GW2 A;  1JTX A;  2E5Z A;  5CVI A;  2NXN B;  2AQF A;  5CVU A;  5E1W A;  4UUS B;  3C1D A;  1OR7 A;  2GA2 A;  4XOT A;  3TMO A;  3M3Y J;  3FZV A;  3N4M A;  4G7O F;  5LHH A;  4I02 A;  4ABZ A;  2VJ5 A;  4RB1 A;  2X6X A;  2F5E A;  2E1M C;  1GLN A;  2HPI A;  2M45 A;  4GCV A;  3H35 A;  4A3C J;  2QSH X;  1AU7 A;  3SDG A;  1SMT A;  4XKW A;  4CZZ A;  2QBY B;  1WRJ A;  4MO7 A;  5E79 C;  2G0E A;  4BE0 A;  1EV7 A;  4IHX A;  1B59 A;  4KT6 A;  1YI2 I;  1ENH A;  4O6J A;  3FF5 A;  3CUQ B;  3AFH A;  2H94 A;  2MAB A;  3HOT A;  4ZYG A;  5FO5 A;  3ZQL A;  3BDD A;  4C30 A;  3I59 A;  3L2C A;  3JSO A;  4RAG A;  1P6R A;  1HKT A;  2QZ8 A;  2CS3 A;  1MH4 A;  3O8H A;  4A3M J;  4CUG A;  1WJC A;  4ON0 A;  1VQ5 I;  1QVU A;  2DFF A;  4DBQ A;  3B6C A;  4II3 A;  4S04 A;  1BW5 A;  2QCO A;  1PDN C;  3OYA A;  2DAO A;  2EIJ H;  1QGP A;  1G59 A;  4PDK A;  3DP7 A;  1MBJ A;  5F08 A;  4BL0 B;  2KHM A;  3H0G J;  2CQK A;  5BMZ A;  2R5Z B;  1YQA A;  2BHZ A;  1QA6 A;  4Z6Y A;  2M1B A;  4Y33 A;  3GFI A;  1D0Y A;  3OYM A;  1G3S A;  5J1Y A;  1ZTR A;  1Z7L A;  3ZMZ A;  5TGT A;  1G3W A;  4OIR F;  2ICW G;  1A31 A;  1ETQ A;  5C4J J;  3RSN A;  2HGC A;  1RNL A;  4LLG F;  1WH7 A;  2L01 A;  2XRN A;  1TQI A;  1U9O A;  2RVC A;  2PMH A;  1FOY A;  1ETK A;  3FDY A;  1FNN A;  4UVC A;  4B3X A;  2DMP A;  3F6O A;  3V7R A;  4F3Q A;  5C3E J;  1Q1H A;  4AIK A;  1HC8 A;  2UWM A;  3ULQ B;  3WE2 A;  2ZXH A;  3ABU A;  2LBF B;  3CCJ I;  1LDJ A;  1ZH5 A;  3OYC A;  5DV5 A;  1E0E A;  1A6Q A;  4ZC3 A;  2F48 A;  4ZYD A;  3HOS A;  2HXO A;  1MNE A;  2COB A;  3DQV C;  2DPD A;  3CO6 C;  2LDU A;  2JUC A;  4XM3 A;  1ZLJ A;  1YTY A;  4DNC A;  1B6A A;  2NOJ B;  1WKM A;  3G71 I;  1HDP A;  2LF8 A;  1P4X A;  2KRC A;  2KZV A;  4YEL A;  3L7W A;  1B1B A;  1LNW A;  2YR2 A;  4GXO A;  4MQ9 F;  1BR1 A;  2W7N A;  3U1D A;  4B8X A;  5IOY A;  1W36 C;  1S7O A;  3DPT A;  1YIJ I;  1EJ9 A;  1SAN A;  3GZN B;  4A3B J;  1Z9C A;  4CYC B;  3FX3 A;  2M0C A;  2V1X A;  3HB9 A;  3COA C;  4L9T A;  1ZLK A;  2GAU A;  2ME6 A;  3SEZ A;  5JR3 A;  5LBQ A;  4QWQ A;  5HDK A;  1TWH J;  3F21 A;  2CMP A;  1OCT C;  4A3F J;  1VQM I;  4KDP A;  1TQM A;  1H9G A;  3AG3 H;  1W0T A;  4EAT A;  1BN5 A;  3ZGK A;  2PQ8 A;  1A04 A;  4F7Z A;  2XAU A;  1YW8 A;  1MMD A;  2IGK A;  1NK2 P;  3L2U A;  1Y8Q B;  4M3F A;  3JRA A;  2PN6 A;  3NRV A;  3UNG C;  1EF4 A;  4A0X A;  4AUX A;  3K4L A;  2M8E A;  1FX7 A;  1T33 A;  2QKL B;  2VBY A;  4LIT A;  3EDP A;  2NRA C;  3S14 J;  2RC4 A;  2K40 A;  2F5F A;  3K70 D;  2WAQ N;  2EIN H;  3GO5 A;  4RAY A;  4DYC A;  3RZD J;  1DUX C;  5F64 A;  4KUM A;  4XLF A;  3BTL A;  4HF1 A;  2Q0O A;  1BR2 A;  3IUO A;  2FJ1 A;  3GFL A;  3GFJ A;  2DA5 A;  3HTU A;  1RC9 A;  2BW3 A;  1BOA A;  3B73 A;  3JCU C;  1Z1D A;  5ICF A;  3LSJ A;  2QGU A;  2IA2 A;  3I4M J;  4G9Y A;  4IF4 A;  5AIQ A;  3S2W A;  4FAS D;  1MMS A;  4KN4 X;  2TRT A;  2EFN A;  3F8B A;  4RAF A;  2DT5 A;  4A3G J;  1SMY F;  2DK8 A;  2HWV A;  3P9I A;  2CW7 A;  2HQ5 A;  4A2U A;  3T1B A;  2H8W A;  1PP8 F;  3CMY A;  4AVP A;  3GYH X;  1AWC A;  2M9H A;  2DYR H;  4E7Z A;  4RB3 C;  5E3O A;  1FYK A;  1MSE C;  2LKX A;  2L7Z A;  1LJ9 A;  3I3L A;  3K2A A;  4HEA 2;  3WG7 H;  1S5L C;  1D3Y A;  5IP7 J;  4E7H A;  3PSF A;  4JOM A;  4ZH4 F;  1SFU A;  2Z99 A;  2TCT A;  2K9M A;  3TO9 A;  1X1A A;  3GEZ A;  3HG9 A;  4M6Y A;  2F4O B;  2WV0 A;  3BG7 A;  3M8J A;  3JRG A;  2O61 A;  4LOC A;  3SZP A;  3GTP J;  2LG4 A;  3ONQ A;  1XSX A;  3I59 B;  4WK8 F;  2IS6 A;  3KLN A;  2FBI A;  4P96 A;  2RAE A;  5BQT A;  5FLM J;  1ZAR A;  3BG6 A;  4LK1 F;  2F5D A;  3IL2 A;  1JT6 A;  1ZYR F;  2MC4 A;  2XIG A;  3DF8 A;  4F92 B;  3ZQQ A;  4XK4 A;  2NS8 A;  4E7J A;  2L9R A;  5J8C A;  4IRI A;  3EET A;  3BPV A;  3GLL A;  4XMY A;  1D1B A;  2WY8 Q;  4X0G A;  2XSD C;  2F5C A;  3IP4 B;  1P9Q C;  3QWL A;  5F6F A;  3KX2 A;  1WH5 A;  4KIF A;  5CVV A;  2V9P A;  3C2G A;  4ESF A;  2Y2Z A;  1WI3 A;  3U1K A;  1MBH A;  3JAM Z;  1Z6T A;  4L9V A;  2XAH A;  4LLN A;  1FTZ A;  2E7W A;  1WJD A;  1GDT A;  1UFM A;  2ACJ A;  3RZO J;  3GTG J;  3Q3S A;  3QRF F;  2WTE A;  1DU6 A;  1VFC A;  4XOR A;  2CV1 A;  3HIF A;  2ZME C;  1B8I A;  3X2Q H;  1IN4 A;  3DTI A;  5D4S A;  2MBF A;  2JA2 A;  2DFH A;  4XSZ F;  2YX4 A;  3TW6 A;  2DW4 A;  3NAR A;  5BNG A;  4DW6 A;  3Q9V A;  2LY1 A;  1P7J A;  2KDZ A;  3S2H J;  3F72 A;  4EM2 A;  5E17 F;  3QYE A;  4XON A;  4Z2Y A;  2E36 A;  2HZT A;  3H1C A;  4MIM A;  5B1A H;  4CCO A;  4EEF G;  3S17 J;  3RIR A;  3WTT C;  4IHW A;  4LK0 F;  2CQN A;  3BR2 A;  1MMN A;  1OYY A;  4JX6 A;  1HW2 A;  1TLH B;  1XDS A;  1N77 A;  1DGR M;  3VYT B;  2CWE A;  4E7K A;  2MSY A;  2XDV A;  4EJV A;  2DA2 A;  5DM7 F;  2Y48 A;  3RKQ A;  4V2F A;  4ASN A;  2EV0 A;  5B5E C;  4EVI A;  2RQP A;  4L0Z B;  2A5W A;  4L18 B;  4A12 A;  2E1N A;  4J00 A;  4XL9 A;  1IXS B;  1CGP A;  2F6C A;  4GO1 A;  4LGW A;  2JZY A;  4UV8 A;  4RBO A;  2CG4 A;  1T6S A;  2VC1 A;  3EQL F;  4OIP F;  2P6S A;  1LPQ A;  1XMK A;  4NUB A;  1I27 A;  1AHD P;  3E0J B;  1WGX A;  3CCM I;  2ZJP F;  2LNB A;  4EJO A;  1D5Y A;  3FWE A;  3OWT A;  2HOT A;  3RPQ A;  1J0R A;  6PAX A;  1JHF A;  2Z2S B;  2FOW A;  2E2H J;  1GT0 C;  4A5M A;  3F9K A;  4EM1 A;  4PGG A;  2I10 A;  3JRB A;  2JA5 J;  4ESJ A;  2CV0 A;  1Y0N A;  1XGO A;  2P0W A;  1BR4 A;  3ZQI A;  2PJP A;  1IXC A;  1Y39 A;  1X3Z B;  3MVP A;  1FOX A;  2LH9 A;  3MKL A;  2ZXI A;  4ZTF A;  1J9I A;  4OAY A;  2LP0 A;  4AC0 A;  1LKX A;  4PZJ A;  2CGP A;  2VT2 A;  1T95 A;  5FKO A;  2ID6 A;  2BW3 B;  4U7B A;  2FE3 A;  3WHB A;  5EG0 A;  1TL8 A;  2W85 A;  5HDG A;  2HVQ A;  3WU2 C;  4QTR A;  3BTJ A;  2R92 J;  1VI0 A;  5FLX K;  4P55 A;  2DMT A;  2VOP A;  1FC3 A;  2Y9Y A;  3WGG A;  2PX9 A;  1TW3 A;  1GXQ A;  3MZY A;  4L9J A;  1A36 A;  4EJT A;  5FFX A;  2OQR A;  4B48 A;  4IOA F;  4H0E A;  5K5O A;  3I55 I;  5E1Z B;  1QBJ A;  3BG3 A;  1TWC J;  2DPU A;  3RTR A;  1W7P D;  3RI4 A;  1QO0 D;  4HDV A;  4CCN A;  3DU5 A;  1LUJ B;  4M73 A;  2IGO A;  2JTV A;  3VEP A;  5DM6 F;  2L0K A;  1Z67 A;  2E5N A;  3OL3 A;  2IEK A;  4CZC A;  1MD0 A;  2EV5 A;  4D5C A;  2BGC A;  4I99 C;  1ON1 A;  1IV8 A;  4NC8 A;  3ZP5 A;  4QIW N;  1LDD A;  2QQ8 A;  3KP5 A;  1U6G A;  3TL4 X;  4E7S A;  2LSO A;  1R9T J;  4A93 J;  3HSF A;  2GIV A;  3ABT A;  4OWR B;  3BJO A;  3K7A J;  1T0F A;  5IOZ A;  5CVJ A;  2CO5 A;  3GVA A;  1MNM C;  2IGM A;  3FKI J;  4G8X A;  1B72 A;  5J4Y A;  2WC2 A;  3OYJ A;  2KP6 A;  3CLQ A;  1N78 A;  2V9K A;  1ETW A;  1EKE A;  3RQI A;  2YSR A;  1NK3 P;  3S1Q J;  1QZZ A;  3J7Z I;  2QQA A;  3CUQ C;  2QQ9 A;  1NHA A;  3H3Z A;  2HOS A;  4UXN A;  1MND A;  1FZP B;  2XF5 A;  3S3N A;  1EH7 A;  3KYL A;  3DV8 A;  4EGY A;  2NOG A;  2AO9 A;  3CJN A;  2HDW A;  4CSW A;  1BC8 C;  1X3U A;  5BOX A;  4CYD A;  1LFB A;  2K5C A;  3BY6 A;  2HVS A;  2QM3 A;  3G3Z A;  3G6E I;  5HNF A;  4UUT A;  4PFP A;  1BOB A;  3MZH A;  1GXP A;  3QOP A;  2M4K A;  1B8I B;  1MGT A;  2J5P A;  3SJM A;  1IDZ A;  1USS A;  2YU9 J;  3PL8 A;  2E71 A;  2PMU A;  3JR9 A;  2CYY A;  1RR7 A;  2AHQ A;  2VKD A;  1FP1 D;  3O6B B;  4RGU A;  2JQ7 A;  3JSP A;  5BS6 A;  2P5L C;  3F8C A;  2QVO A;  2LKS A;  5IT3 A;  2DN0 A;  4G6Q A;  3QP6 A;  1YO5 C;  4OIN F;  2V1U A;  2WAF A;  5LEJ A;  1S9H A;  4S05 A;  1XSD A;  5K1Y A;  2C6Y A;  1QVT A;  3MKY B;  2FBH A;  2W24 A;  1KZH A;  1BC7 C;  2VXZ A;  1KGS A;  1TNT A;  3E7L A;  3GBG A;  2VQL A;  1ERD A;  4JP0 A;  1I39 A;  1ZAO A;  1KQ9 A;  5IY5 H;  3TED A;  1SD7 A;  4RM3 A;  4G6D A;  4RB0 A;  1AOY A;  2KPM A;  5D6E A;  3CC4 I;  3M1C A;  3BJ6 A;  1MJB A;  1LQ1 A;  2X48 A;  4XR6 A;  3ELK A;  4IKF A;  1BIA A;  5FRO A;  3CCR I;  4A0Z A;  2L7M P;  2IT0 A;  3BZ6 A;  4ZYH A;  5J8F A;  2CFX A;  3CCE I;  3ECH A;  3ZR8 X;  3CP2 A;  1Y1W J;  4YFK F;  1OCO H;  1OYI A;  2OF7 A;  1XPX A;  4B44 A;  2FRH A;  2ESH A;  2M3A A;  2H6C A;  2XPU A;  3HJE A;  4GDF A;  1GHC A;  2BE5 F;  3HSE A;  2RKH A;  1D0Z A;  1C0W A;  3L00 A;  1IW7 F;  2QSG X;  4RGR A;  2Q2E A;  2A61 A;  3W3C A;  3D5S C;  2VBX A;  3C3W A;  2MA3 A;  4IX7 A;  3TDZ C;  5GAH J;  3J80 Z;  1O3Q A;  1JKR C;  3DFG A;  3K4B A;  3G1M A;  2EWN A;  4I7H A;  4DQ2 A;  1XCV A;  2XGE A;  1UJ8 A;  3H92 A;  5EGO A;  2VON A;  1DDN A;  3A0H C;  3BP8 A;  3HTS B;  5FRM A;  4UNO A;  4F91 B;  1OQY A;  3WU1 B;  1FPQ A;  2N8G A;  3S1R J;  2VAS A;  5EG0 B;  1FIP A;  2P5V A;  3EPZ A;  1IJW C;  2VOO A;  3H3U A;  3GTJ J;  2MH2 A;  2ZCW A;  3K10 A;  3R0A A;  4P1W A;  5D5V B;  4G7Z F;  3CES A;  2B63 J;  4HNT A;  3RCO A;  3G4S I;  3AG2 H;  1QQI A;  3HUG B;  3HDD A;  4Q48 A;  3S2D J;  2GIZ A;  5L3F A;  1BL0 A;  2VJI A;  3EUH A;  2A68 F;  1QHH D;  2HYF A;  5J47 A;  1R36 A;  5LGT A;  5IP9 J;  3OYF A;  1J09 A;  2R7W A;  2OU2 A;  2EZI A;  5EEA A;  2COM A;  1IN5 A;  1WCM J;  2K3P A;  1W4M A;  3GFM A;  3QPT A;  1TWA J;  3KYD B;  3I64 A;  3S1N J;  1K4T A;  1J2X A;  1IC8 A;  4E4H A;  1OR7 C;  3H5R A;  1BA5 A;  1ZRD A;  3K1N A;  5M3F J;  2DK5 A;  4P5O A;  2M5W A;  2ZB9 A;  4BJ5 C;  3LFU A;  2ZC2 A;  3GZ6 A;  1R4N B;  1HA8 A;  2HYJ A;  4BBS J;  4BQN A;  3V7S A;  3AG1 H;  5E3N A;  4EMS A;  4N9H A;  4A0Y A;  4CGZ A;  1B72 B;  1SFE A;  2J5O A;  2KIQ A;  1PUF A;  5L3D A;  3QAH A;  4CCL A;  4R1H A;  2JVG A;  1RKT A;  2F4M B;  1R5I D;  2DOE A;  4KMU X;  1JJ6 C;  2EIM H;  2NVU B;  3W2V A;  3RPU D;  4RS8 A;  1XMX A;  1UZC A;  2K3F A;  1AKH A;  3LAJ A;  1M1E B;  1TBX A;  3OYL A;  3VYU B;  4M71 A;  2DDA A;  2LY2 A;  3CCV I;  2WA0 A;  3DEW A;  4BHC A;  4UB8 C;  1X1P A;  4BUP A;  1YJW I;  2XAS A;  3MAJ A;  3HOZ J;  1R23 A;  2WAD A;  5D8K B;  2DOA A;  2XRL A;  3HKZ A;  4BU2 A;  2BOL A;  2LMD A;  4AVZ A;  3IV5 A;  3KE2 A;  2OPT A;  1PYV A;  5D6F A;  3I5U A;  4RM2 A;  4HYE A;  4KIB A;  1YW7 A;  3OV8 A;  5FRN A;  1HKQ A;  1A35 A;  5CKT A;  1IUF A;  1TZL A;  1WWX A;  5LGU A;  3V4G A;  5E3M A;  3TW7 A;  2AS5 F;  4B47 A;  5IP6 A;  2P7C B;  3WTY C;  4XLE A;  2R7U A;  2Q1Z B;  1SVO A;  4UY8 I;  1MMG A;  4YIF A;  5FKL A;  3HRM A;  3J81 K;  3ERM A;  1DQU A;  4V19 K;  4IQ4 A;  5C4X J;  1Z77 A;  2A05 A;  5FD5 A;  1OJL A;  3BJA A;  1JUM A;  5GAD J;  2A6H F;  4DYQ A;  3S16 J;  2O03 A;  2DTR A;  4FQG A;  2H1K A;  3W6K B;  2IS2 A;  2L02 A;  5M5W J;  2FEZ A;  3K4N A;  4Q4Z F;  1VQ7 I;  3BCB A;  2JMW A;  1I5Z A;  2H8R A;  3O3K A;  4FE7 A;  2ZFW A;  1ZG1 A;  1DPU A;  2ZBK A;  1WHU A;  3GME A;  3HZJ A;  3DKX A;  4M3B A;  1R1U A;  2FML A;  3D5R C;  1JUP A;  3SXY A;  4HNU A;  3BQZ A;  2DJI A;  3M8F A;  2CQX A;  3K4K A;  1LEB A;  4D7N A;  2BY3 A;  3FXR A;  1E3O C;  2KRH A;  2LK2 A;  1R71 A;  3DPL C;  5JFR A;  1R49 A;  1D1A A;  2ZJ2 A;  5F0F A;  1OMI A;  5HDN A;  2ZNZ A;  4A69 C;  1F43 A;  2TDX A;  2STW A;  2HQN A;  4KMF A;  1FT9 A;  3JRE A;  5DCF A;  4HF2 A;  4W1U A;  2STT A;  2DO7 A;  4BHP A;  2ZFU A;  2ZXW H;  3G73 A;  1IGN A;  3QP5 A;  1T38 A;  4LD5 A;  3H5A A;  1QRY A;  5KNL A;  5GPA A;  1XD7 A;  2Y31 A;  5FLX Z;  4AIH A;  4E7I A;  2Q2E B;  3WTS C;  1TC3 C;  4FIS A;  1IZ1 A;  2WB1 N;  5J3L A;  2BV6 A;  1GVJ A;  1FLI A;  3WGH A;  1BJA A;  3LFK A;  1YX3 A;  1QU3 A;  5D5W B;  4BDY A;  2QKM B;  2FQ3 A;  5EGO B;  2R7T A;  5D4R A;  2CUE A;  2IXS A;  3OIP A;  5CQG A;  4L9N A;  3OS2 A;  4BQQ A;  2PMZ N;  3PNY A;  1O3R A;  2O0Y A;  4XIC A;  3J7Y J;  5FGM A;  2R93 J;  3FXL A;  4PJ0 C;  3PFI A;  4N4O B;  2RQQ A;  3KP2 A;  2W25 A;  1L0O C;  3KP6 A;  2E7X A;  1S72 I;  4M9S A;  3CTA A;  1ZG3 A;  5DEQ A;  1RI7 A;  2HOA A;  3HOU J;  1QZY A;  9ANT A;  1QPM A;  3V42 A;  4DZP A;  2IRF G;  1YRN B;  2VB6 A;  1MBF A;  2OA4 A;  4HLX A;  4JX4 A;  1U78 A;  2Y0S N;  5KAF C;  2VL8 A;  2X0L A;  3ZQ7 A;  2V7F A;  1O4X A;  2CFO A;  4HPQ A;  3RQ4 A;  3OMY A;  2V4J C;  4KA4 A;  3ZQC A;  2A6E F;  5DCM A;  5EF6 A;  2P81 A;  2VKV A;  4MTD A;  3G2B A;  3F23 A;  4MHG A;  3HGY A;  1FEX A;  4RLQ A;  1XGM A;  1XG1 A;  5LRS A;  1TNS A;  4MLO A;  1HDD C;  4M6V A;  1F5T A;  3I56 I;  4RB2 C;  2MG4 A;  1LFP A;  3DU6 A;  3MMY B;  4XSX F;  3S15 J;  4MNU A;  1YJN I;  2QUF A;  2A6T A;  3I54 A;  1IXR C;  5D8L B;  2GXA A;  5H2F C;  3IKT A;  4PJM A;  4XLP F;  3MD2 A;  3QOE A;  3ZQH A;  4BS9 A;  2P8T A;  3K6G A;  3GTK J;  1WJ5 A;  5EEG A;  5KVR A;  2VJJ A;  4BXF A;  1IN8 A;  2XAF A;  3KYC B;  4BHB A;  1PUF B;  1VQ4 I;  1ETX A;  2QYO A;  1DU0 A;  2LVS A;  2HTS A;  3DTE A;  3IHU A;  1X2M A;  3IWZ A;  4I09 A;  4U0Y A;  1V5F A;  3GXO A;  3HSR A;  3KP7 A;  1I3A A;  2X4H A;  5IT9 K;  2X9D A;  4HAM A;  1DPR A;  2P7V B;  1XDU A;  3TQN A;  2B0L A;  3B02 A;  3I0T A;  3RDI A;  3CF2 A;  1SFX A;  2DDB A;  1H89 C;  1FP2 A;  3A4C A;  1WJB A;  4H4K C;  4XRS A;  1SFO J;  1LEA A;  2FA5 A;  2Y30 A;  2V9V A;  3UKG A;  2A07 F;  1K6O A;  1FMV A;  3JTH A;  3PIP F;  3KET A;  1EH6 A;  3GX4 X;  1ON2 A;  1SFK A;  1XMA A;  3AAF A;  3FHZ A;  3BTC A;  3GCM A;  1XX5 A;  2MD5 A;  5D5X B;  3FM5 A;  4ENK A;  4B43 A;  3ZCO A;  4PSW A;  4BBR J;  5LRR A;  3K69 A;  2G7H A;  3NWT A;  4M6X A;  2R7S A;  2XV4 S;  4XN3 A;  5B66 C;  1OLT A;  3A2K A;  5HNH A;  3GTQ J;  1CF7 A;  3I58 A;  4DJA A;  4AD9 A;  3OYN A;  1G8X A;  3KCC A;  3SEQ A;  3I53 A;  1J7K A;  3WOD F;  4BDZ A;  3K4C A;  1UHW A;  4L5E A;  1R5H A;  1UEL B;  2PG4 A;  3P9C A;  3CJR B;  5BPI A;  4WF2 A;  1U9N A;  4FCY A;  1SVL A;  2DBB A;  3Q0W A;  2L4M A;  2QF7 A;  4U88 A;  3REO A;  3TOA A;  1DP7 P;  4BKX A;  2DMU A;  1UG2 A;  1H8A C;  4FE4 A;  1BI3 A;  3E6B A;  2BVL A;  3F6V A;  4DBR A;  1YYV A;  3CCY A;  1H9T A;  1VF9 A;  2EFQ A;  2I5U A;  5KHD A;  2ZXJ A;  3HHG A;  5H6Q A;  2ISZ A;  4HF0 A;  4J01 A;  1HBX G;  4FHT A;  4ZYA A;  2IP2 A;  1ZK8 A;  1R22 A;  3NEU A;  3L1P A;  4QPO A;  3LQR A;  1W7P A;  2X51 A;  4AWX B;  1XN7 A;  3RKX A;  1W36 D;  1REP C;  2EFP A;  1S8N A;  3WGI A;  1ETO A;  5L3C A;  4K2E A;  2OCC H;  3FBI B;  1ETY A;  4Q47 A;  4IHV A;  1WJF A;  2WY7 Q;  4F52 A;  2Y9Z A;  4UB6 C;  1JKP C;  1X2N A;  3R0J A;  3L2R A;  4HX7 A;  3IKV A;  5CJ9 A;  5DYM A;  4KT5 C;  3LST A;  3SZG A;  5AIP A;  4I76 A;  3HC7 A;  2L54 A;  2V1N A;  3QQA A;  1X4P A;  4ZTJ A;  1TQP A;  2CSO A;  1O57 A;  3DBR B;  2AXT C;  1I1G A;  3A01 A;  2DU9 A;  2W00 A;  3E6D A;  3I4N J;  2X6W A;  2EB7 A;  2QSF X;  3JRF A;  3GTL J;  3W6J B;  4ZJZ A;  1ETV A;  5DD8 A;  2W84 A;  4PK4 A;  1R5G A;  2B7E A;  2P4W A;  2KFD A;  1ZGW A;  1P4A A;  3K2Z A;  4MEX F;  5LFA A;  1CQT A;  3CMM A;  4XLN F;  4KNY A;  4YFN F;  2GZW A;  1S29 A;  2QA4 I;  1WSU A;  1P4W A;  3LNQ A;  1YLF A;  2OCE A;  2ME0 A;  4NNJ A;  4AYB N;  2CU7 A;  1ZEL A;  1YS6 A;  1K78 A;  3U9G A;  4R79 A;  3GWZ A;  5K5Q A;  3E97 A;  3OIO A;  2WAE A;  4P9U A;  1VQK I;  2X1E A;  4EGZ A;  2MYS A;  3VSL A;  3VYR B;  1UG0 A;  3DKW A;  1RES A;  2ETH A;  4XKV A;  4WCG A;  1BIB A;  5DCM B;  1W5S A;  2W4S A;  2VBW A;  2JN6 A;  3ZQG A;  4GYI A;  1G4D A;  1WQ2 A;  3HHH A;  4IZZ A;  1XSV A;  3F0C A;  2F5V A;  1FBQ A;  4PJN A;  4D0P A;  5DUI A;  2FBK A;  2EFO A;  4NQW A;  3CC2 I;  3ABK H;  4I98 B;  2OAZ A;  3J7A Y;  2JRT A;  4I2O A;  4UV9 A;  3Q0V A;  4ANJ A;  1APL C;  2VPL A;  1ZR2 A;  5TIS C;  3ZMV A;  4BQO A;  5EDN A;  3ZMU A;  3PIO F;  2IBD A;  2K9S A;  1XCB A;  1OYW A;  4UVB A;  3QYF A;  3FIS A;  4WXH A;  2BY0 A;  3I4P A;  2GXB A;  1ONV A;  5B3S H;  4MFE A;  3CO7 C;  3UR3 C;  1UHM A;  1Y56 A;  1I6H J;  3BWG A;  3LSM A;  4PUS A;  4Y7N J;  2FF4 A;  1MJ9 A;  3FXU A;  2KJB A;  2VQC A;  5DD4 A;  4IXA A;  5FKK A;  3FK7 A;  5ED4 A;  1EA3 A;  2O7O A;  3V8L A;  2FXA A;  1WFX A;  2FX0 A;  1FTT A;  2ZSI B;  5HOD A;  1G6N A;  1LVA A;  4D1Q A;  4XQF A;  1K6Y A;  2LR8 A;  2K4B A;  3EYI A;  4X6A J;  2L9N A;  4HQM A;  3HM5 A;  3JRH A;  2RNJ A;  4A3J J;  2R5Y A;  1T0F C;  1D8K A;  1BJZ A;  3WG9 A;  2PJR A;  2KL4 A;  3BOQ A;  1VQO I;  1T8I A;  4RLF A;  2WAQ A;  3EUK L;  3ABM H;  3NWS A;  4XOP A;  4C2M J;  2HQA A;  1U8R A;  3J81 Z;  4CCJ A;  1F4K A;  4HX8 A;  5J40 A;  4XN0 A;  1JUS A;  3HOW J;  1IUY A;  2R7R A;  4ZZD A;  4NBQ A;  1ZGJ A;  3WTX C;  2VE8 A;  5DUK A;  2KIM A;  4NC6 A;  3BTI A;  1TT5 B;  3E5U A;  3D0S A;  2V6C A;  4C3J J;  3WHC A;  3Q0U A;  3S93 A;  4I0B A;  2UZK A;  1U5T A;  2DQL A;  2VIX A;  2CQQ A;  2R7Q A;  2XGC A;  5HLI A;  3MFK A;  2H09 A;  1F1Z A;  4NB5 A;  3DTK A;  1HXD A;  3OL4 A;  1BI2 A;  4LB6 B;  3LOC A;  4BXU A;  1VQ9 I;  3OSF A;  1WI9 A;  2E34 A;  3LWF A;  4JK1 X;  4BNC A;  2AQE A;  4FT8 A;  1U8B A;  2VLA A;  3M8E A;  5HLH A;  5E8I A;  1L3L A;  1LDK B;  2F2E A;  1IRF A;  3FXK A;  4LFU A;  1Z6R A;  2VI6 A;  1V55 H;  1KQ0 A;  2JSC A;  3BR3 A;  1UAA A;  2M30 A;  2XGX A;  4M3E A;  1ZN2 A;  3LSP A;  4JYK A;  1Y6I A;  3A03 A;  5F0C A;  1W7P B;  3VB2 A;  3HL2 A;  2NNY A;  2QBY A;  2LD5 A;  1B9M A;  1W5T A;  1LE8 A;  1OCZ H;  4ZDP A;  1YX5 A;  2A69 F;  1EH8 A;  1X1C A;  4D9J A;  1KU2 A;  2EV6 A;  4YIR X;  4CO8 A;  3HRT A;  4BY7 J;  2OJE D;  3IH3 A;  2YX7 A;  2HKX A;  3LAP A;  1XB4 A;  2Z5U A;  3C18 A;  1RR8 C;  2HDC A;  4I0A A;  1T2K A;  3LQQ A;  5FD6 A;  1O3S A;  3FXM A;  1WVR A;  2HPM A;  2E2I J;  2IS1 A;  4KIT B;  1LB2 A;  4PGH A;  3PNT A;  3BRO A;  3CCS I;  2HNH A;  5E3L A;  4V2G A;  3BR5 A;  5DDG A;  2HVR A;  3Q9S A;  2M0M A;  2X1C A;  4HV5 A;  4P9F A;  1VQL I;  3OOU A;  2KIF A;  1TTY A;  3QPH A;  4FET A;  3MKW B;  2RGV A;  2DQR A;  2VKH A;  2XB0 X;  2JVH A;  4FX4 A;  3A0B C;  2LLK A;  1XGN A;  4RGS A;  3MN2 A;  4Y17 A;  1YG2 A;  1VZ0 A;  1IAW A;  2M87 A;  3RPU A;  2R7X A;  4JBA A;  3FXJ A;  2K9L A;  4BGD A;  1Z3Y A;  4BY1 J;  3F3X A;  2O3F A;  4IPA A;  4C9Y A;  1PP7 U;  2JA7 J;  3LSG A;  3HOV J;  2JUG A;  2PI0 A;  2BVM A;  1T98 A;  2X6Y A;  4HST A;  3RYP A;  1U0J A;  2E19 A;  3IRQ A;  2LC2 A;  1SAX A;  2B9S A;  1K78 B;  2MC3 A;  2EQR A;  2RV8 A;  3DWL E;  1VQN I;  1R4M B;  5J6X A;  3G1L A;  5JLX A;  3IRR A;  1RET A;  1WJA A;  4U87 A;  1UMQ A;  2EIK H;  3FKJ A;  2A5Y B;  2DTZ A;  2LBF A;  3OS1 A;  4EJU A;  5KAI C;  4EV0 A;  4DGW B;  1PVE A;  2V79 A;  3H9G A;  3OIQ A;  3OYD A;  2XC7 A;  1RIO H;  2H27 A;  1MBK A;  1JTY A;  4YG2 F;  4KJZ A;  1VQ6 I;  3A1Y A;  3EYY A;  3U2R A;  1ZRC A;  4DYR A;  4NQW B;  3VDX A;  2O8X A;  1KU3 A;  2EZL A;  1W1W E;  1GVD A;  1MJA A;  3ISP A;  3CDI A;  5JI6 A;  3EUH C;  4I01 A;  3MQ0 A;  3IC7 A;  1ZGA A;  2F4I A;  3FMS A;  2HU9 A;  1HST A;  3BZC A;  3KZZ A;  5HS9 A;  4RGX A;  2Y75 A;  4FTH A;  3PM1 A;  2EJR A;  1ODD A;  3MWM A;  5EZH A;  2P5K A;  1G3T A;  2FMY A;  2O5R A;  1ORK A;  4O5V A;  4NHJ A;  1SVM A;  4AM3 A;  5K7Z A;  2EBI A;  5E8G A;  5LHI A;  2R7O A;  3NAU A;  4WXC A;  3ZRG A;  2D5V A;  3T8R A;  4CCK A;  3HRS A;  3FMR A;  5DS9 A;  3FK6 A;  2PJR B;  1STZ A;  2BEO A;  3VWB A;  3BZK A;  4IO9 F;  3GTO J;  4XID A;  4G12 A;  3ROU A;  1E3P A;  4YRV A;  2L7F P;  4CH7 A;  2NVX J;  5J1U A;  4Y3O A;  5FLV A;  2KQR A;  2X1D A;  1LFU P;  2VJ4 A;  2E2J J;  4BAY A;  3HEF A;  1ZKG A;  2VN2 A;  3QU6 A;  4BH9 A;  2NYX A;  4YEJ A;  4CCM A;  2MH9 A;  1O7F A;  1MW7 A;  4IL6 C;  4HDU A;  3PO3 J;  2R7V A;  1U5T B;  3H9J A;  4XRF A;  3CDH A;  3OS0 A;  3ASO H;  3PO2 J;  4HW0 A;  1RUN A;  2XSJ C;  1JI8 A;  4HZF A;  5L3B A;  3K9T A;  4ENM A;  2CQ7 A;  4A3L J;  2HZD A;  4M72 A;  5JLW A;  1X58 A;  1X3W B;  3K70 C;  4DZJ A;  3RKW A;  2V6E A;  2VE9 A;  2VBZ A;  5J4V A;  4PFO A;  3IWF A;  3BG9 A;  5LLQ A;  2ZJQ F;  1K83 J;  2JK3 A;  3FXO A;  3QPS A;  4HLY A;  1X19 A;  2XB5 A;  1Q1V A;  2HDD A;  2KMU A;  1KU7 A;  1HKS A;  3KEO A;  1LE8 B;  1FMW A;  2CUZ A;  2L2O A;  1OIS A;  5BPD A;  2ZO4 A;  4XLH A;  4ZZL A;  1MDM A;  3ABL H;  4GGG A;  2YPR A;  2RNG A;  3OYK A;  4XLC A;  3HXL A;  3QOD A;  2M7A A;  5CPR B;  3WTW C;  3PJR A;  3W6V A;  2UUZ A;  2KDO A;  1J5Y A;  2BYV E;  3SHF A;  1OKR A;  2BXZ A;  1HOM A;  2DYS H;  4OMZ A;  2X85 A;  5JHF A;  3KZY A;  2HOE A;  4OOI A;  1J59 A;  2DFE A;  3HYI A;  3ZMD A;  2DFI A;  2NAZ A;  5HLG A;  3IAS 2;  3JRI A;  2EA2 A;  5EJC A;  4NC7 A;  3DLA A;  3WTV C;  2HEO A;  3TP0 A;  1K61 A;  5D5U B;  1T56 A;  4F55 A;  2QWW A;  5EZG A;  3ZMT A;  5IYC J;  1QPI A;  2NVT J;  3GLX A;  2FU4 A;  4NDL A;  2O6G E;  2HS5 A;  3LA7 A; 
#chains in the Genus database with same CATH homology
 2DCE A;  3L2W A;  2HVQ A;  2VQH A;  2R7S A;  3NWT A;  5CQE A;  1V5G A;  4XN3 A;  2DXI A;  4HSR A;  1OLT A;  3A2K A;  5HNH A;  4XLA A;  2JSP A;  4DJA A;  3OYN A;  1G8X A;  1NG7 A;  3SEQ A;  1PJR A;  4OAZ A;  4BDZ A;  1TT0 A;  3K4C A;  3LSH A;  3L2Q A;  1UEL B;  4B48 A;  1N75 A;  3CJR B;  2R4G A;  2I8D A;  2LYC A;  1D1C A;  3RTR A;  3U21 A;  2M7B A;  4PJL A;  4CCN A;  3DU5 A;  2IGO A;  2ELJ A;  4II2 A;  2E5N A;  3OL3 A;  3BC8 A;  4CZC A;  3AL0 C;  3VSK A;  4IQJ A;  2BVL A;  4LIV A;  4AYB A;  4DBR A;  4NC8 A;  2ZSH B;  3TL4 X;  4E6K G;  5KHD A;  4E7S A;  4J01 A;  4ZYA A;  4OWR B;  3HPH A;  2MD0 A;  4QPO A;  3OYG A;  3BLY A;  2X51 A;  1W36 D;  2IGM A;  3S3O A;  3OYJ A;  3FBI B;  3DKY A;  2KP6 A;  4GRI A;  3QYB A;  1N78 A;  1WJF A;  2V9K A;  4BE1 A;  4QPQ A;  2W82 A;  2WY7 Q;  4F52 A;  1X1D A;  3L2R A;  4LIU A;  1MND A;  3SZG A;  4XNF A;  1NG6 A;  3HC7 A;  2V1N A;  2XF5 A;  1X4P A;  4ZTJ A;  4HRI A;  3S3N A;  3KYL A;  2LOO A;  2HDW A;  4CSW A;  3CP8 A;  2W00 A;  4BEH A;  2X6W A;  2Z16 A;  4HG2 A;  4BJ6 C;  2K5C A;  2HVS A;  2Z1D A;  5HNF A;  4PFP A;  1BOB A;  4ZJZ A;  4DOZ A;  3AL0 B;  2E5Z A;  2AQF A;  4PK4 A;  2M4K A;  4XOT A;  3TMO A;  3K4J A;  4C2U A;  3PL8 A;  2VJ5 A;  2XF6 A;  3W2W A;  3TBI A;  2X6X A;  3I9V 2;  5LFA A;  2E1M C;  3CMM A;  1GLN A;  2HPI A;  2VKD A;  3AKZ A;  3H35 A;  1IRX A;  4NNJ A;  3LMM A;  1ZEL A;  5HLT A;  4XKW A;  3S3M A;  4R79 A;  4Y4R A;  4BE0 A;  2WAF A;  2WAE A;  4KT6 A;  1S9H A;  2CH0 A;  2X1E A;  3MKY B;  2MYS A;  3AFH A;  3PNV A;  4ZDL A;  2MAB A;  2VXZ A;  3LL7 A;  3VSL A;  3SDB A;  3VYR B;  1UG0 A;  3HOT A;  4XKV A;  3GBG A;  4C30 A;  2VQL A;  1ERD A;  2W4S A;  2VQG A;  2CS3 A;  4RM3 A;  4IZZ A;  4CUG A;  2CUJ A;  1WJC A;  2F5V A;  2KPM A;  4DBQ A;  3M1C A;  4PJN A;  4II3 A;  2M4G A;  3OYA A;  3J7A Y;  4XR6 A;  2FUG 2;  4ANJ A;  4IKF A;  2VPL A;  1G59 A;  5FRO A;  4BQO A;  4BL0 B;  2OC6 A;  2KHM A;  3QYF A;  3ZR8 X;  3OYE A;  2DT7 B;  3N05 A;  3CP2 A;  4Y33 A;  2E1M B;  1D0Y A;  3VYS B;  3OYM A;  3PUB A;  4B44 A;  1Z7L A;  3UR3 C;  2M3A A;  5TGT A;  4KIS A;  1Y56 A;  3LSM A;  4PUS A;  3S32 A;  4N4N B;  1D0Z A;  2VQC A;  3RSN A;  1EA3 A;  1WFX A;  2IS4 A;  3W3C A;  3D5S C;  2ZSI B;  4IX7 A;  4D1Q A;  5KCM A;  4XQF A;  1K6Y A;  4XKC A;  2L9N A;  3K4B A;  1X4O A;  2V26 A;  4JQF A;  3FDY A;  4B3X A;  3OR1 C;  1T0F C;  4F3Q A;  3H9Q A;  4ZDO A;  2UWM A;  5FRM A;  2ZXH A;  2PJR A;  3EUA A;  2KL4 A;  4F91 B;  2LBF B;  4RLF A;  2WAQ A;  3EUK L;  4XOP A;  3NWS A;  3OYB A;  3OYC A;  1E0E A;  2HQA A;  2VAS A;  4ZC3 A;  3HOS A;  3PSI A;  4CCJ A;  1MNE A;  1R6R A;  3DQV C;  1Z3X A;  3EPZ A;  3SYT A;  4XM3 A;  4XN0 A;  3ZXS A;  2R7R A;  3LSI A;  2NOJ B;  3K10 A;  4P1W A;  3CES A;  4HNT A;  2KRC A;  2KZV A;  3RCO A;  4YEL A;  3HUG B;  3S93 A;  2W7N A;  1BR1 A;  2L7K A;  2VJI A;  4ITV A;  1QHH D;  1W36 C;  3DPU A;  2VIX A;  2R7Q A;  3DPT A;  1AA7 A;  3DTK A;  3OL4 A;  3OYF A;  1J09 A;  2R7W A;  3KEY A;  2RRE A;  3H0D A;  2K3P A;  1MMA A;  2AQE A;  3SEZ A;  3S8P A;  2VLA A;  4XKB A;  2LRD A;  2CMP A;  4E4H A;  1LDK B;  1OR7 C;  3H5R A;  4EAT A;  3ZGK A;  1UAA A;  4P5O A;  2XAU A;  4BJ5 C;  3LFU A;  3FBN B;  1HA8 A;  1Y6I A;  2CW8 A;  3HL2 A;  1MMD A;  4BQN A;  3D5L A;  2IGK A;  2E60 A;  3L2U A;  4ZDP A;  1YX5 A;  1Z21 A;  1X1C A;  4RMN A;  4D9J A;  2XF7 A;  3UNG C;  1YE9 A;  4CCL A;  2JVG A;  3K4L A;  2QKL B;  3OYH A;  2IGN A;  4LIT A;  3W2V A;  3RPU D;  2HPM A;  3K70 D;  2IS1 A;  4KIT B;  1WJE A;  3PNT A;  2HNH A;  4XLF A;  3OYL A;  3VYU B;  2HVR A;  1BR2 A;  3IUO A;  2LY2 A;  2M0M A;  2WA0 A;  2X1C A;  2OV7 A;  5LD2 C;  4BUP A;  3OOU A;  2BW3 A;  1D0X A;  4FET A;  2DT6 A;  2WAD A;  3MKW B;  4BEH B;  2VKH A;  2DOA A;  2JVH A;  3HKZ A;  4BU2 A;  2BOL A;  4FAS D;  4AVZ A;  1VZ0 A;  1PYV A;  3IAM 2;  4RM2 A;  2R7X A;  2K9L A;  4BGD A;  1Z3Y A;  5FRN A;  2UV1 A;  1X1B A;  5CKT A;  4C9Y A;  1TZL A;  2CW7 A;  2WBM A;  3LSG A;  4B47 A;  2JUG A;  2WB1 A;  4XLE A;  3C2H A;  2BVM A;  2X6Y A;  1DP3 A;  4HST A;  1U0J A;  2R7U A;  4E7Z A;  2Q1Z B;  1MMG A;  2LC2 A;  3I3L A;  4HEA 2;  1DQU A;  4IQ4 A;  4E7H A;  3PSF A;  2PMZ A;  4JOM A;  3DWL E;  2OUM A;  4BJT A;  2K9M A;  2KLO A;  1X1A A;  4E7L A;  2GOM A;  3HG9 A;  1KON A;  5HVQ C;  1WJA A;  4U87 A;  3FKJ A;  3BG7 A;  2LBF A;  3OS1 A;  3M8J A;  2IS2 A;  4CA0 A;  3OYI A;  4DGW B;  3K4N A;  2CV2 A;  2LG4 A;  3ONQ A;  3BCB A;  1LVK A;  3H9G A;  3OIQ A;  4G6T B;  3OYD A;  2XC7 A;  2L5Q A;  2IS6 A;  3DKX A;  4KJZ A;  3D5R C;  3W2A A;  4BAC A;  3BG6 A;  3K4M A;  2Y0S A;  3A1Y A;  4HNU A;  2DJI A;  3K4K A;  4NQW B;  4PJJ A;  3VDX A;  2MC4 A;  4F92 B;  2GOX B;  3ZQQ A;  2KRH A;  4E7J A;  3DPL C;  4XMY A;  1D1A A;  4PSX A;  1D1B A;  2LRE A;  2WY8 Q;  4X0G A;  3EUH C;  3IP4 B;  1P9Q C;  3KX2 A;  3OY9 A;  3HPG A;  3DEE A;  2F4I A;  3C2G A;  2HU9 A;  3FHN A;  4DIQ A;  3OR2 C;  2ZFU A;  3H5A A;  5KNL A;  4E7I A;  1WJD A;  2Q2E B;  3MKZ A;  3H5N A;  2O5R A;  4XOR A;  2CV1 A;  1YX3 A;  1QU3 A;  3LSK A;  2R7O A;  3ZRG A;  4BDY A;  3DTI A;  2QKM B;  4AU7 A;  2R7T A;  4CCK A;  2IXS A;  3OIP A;  5CQG A;  3OS2 A;  2JA2 A;  4BQQ A;  2PJR B;  3PNY A;  3VWB A;  4YRV A;  4CH7 A;  2LY1 A;  2MFZ A;  4C2T A;  4Y3O A;  2KQR A;  2RQQ A;  2X1D A;  4N4O B;  2VJ4 A;  4F93 B;  2L9S A;  3QYE A;  4XON A;  4YEJ A;  4CCM A;  2R7V A;  1MW7 A;  3V42 A;  4CCO A;  2VB6 A;  3H9J A;  2VL8 A;  1MMN A;  1QHG A;  2V7F A;  3OS0 A;  2CFO A;  4HPQ A;  3RQ4 A;  3OMY A;  2V4J C;  1N77 A;  1DGR M;  2XSJ C;  1JI8 A;  3VYT B;  4E7K A;  2XDV A;  3G2B A;  4LG3 A;  4RLQ A;  2HZD A;  3CJQ B;  4MLO A;  2A5W A;  3K70 C;  4J00 A;  4XL9 A;  3DU6 A;  1LFP A;  2V6E A;  3MMY B;  2F6C A;  4PFO A;  2A6T A;  2W1O A;  1SAU A;  3BCA A;  4PJM A;  4NUB A;  3E0J B;  3MD2 A;  3QOE A;  1X19 A;  4BS9 A;  2KMU A;  3CZ6 A;  3K6G A;  3OWT A;  1WJ5 A;  3E1S A;  4BXF A;  2VJJ A;  1FMW A;  2CUZ A;  2Z2S B;  2L2O A;  3PFY A;  5HOO A;  4XLH A;  2VXD A;  3F9K A;  2RNG A;  3DTE A;  3OYK A;  4XLC A;  3HXL A;  3QOD A;  2M7A A;  5CPR B;  1DGW Y;  2CV0 A;  3PJR A;  4BE2 A;  1V5F A;  2UUZ A;  2P0W A;  1BR4 A;  2KDO A;  2X85 A;  3CF2 A;  5JHF A;  2LH9 A;  3A4C A;  1WJB A;  4H4K C;  2ZXI A;  4ZTF A;  3L2V A;  3IAS 2;  4OAY A;  1FMV A;  4NC7 A;  3DLA A;  1LKX A;  1SFK A;  4F55 A;  1T95 A;  2BW3 B;  1V5E A;  4U7B A;  4B43 A;  3ZCO A;  4PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...