5D5WB

Crystal structure of chaetomium thermophilum skn7 with hse dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
94
Chain Sequence
SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRPYGRDAWEFKHPEFRADRKDNLDNIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HSE DNA
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transcription
total genus 23
structure length 94
sequence length 102
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5wB00
4M73A 3ZMDA 3KP5A 2PMUA 1P4XA 1FOKA 3MZHA 2YPRA 2HQRA 2JZYA 1V3FA 1J75A 3RKYA 4ZYDA 3HRMA 5TRDA 1K78B 2IVMA 4S05A 1H0MA 5CVUA 2EA4A 2GXGA 1UHMA 4KUMA 5E8GA 1FY7A 3WGHA 5D5WB 2NYXA 3ZN0A 4EV0A 5H6QA 3F8FA 1LQ1A 2Q8KA 2QVOA 1HBXG 3GFLA 5LHHA 3GX4X 4AWXB 1O3SA 2QQ9A 4CDGA 4U88A 1WWXA 1YFHA 3HSEA 1TQIA 5EEHA 2HZTA 1TW3A 3HTUA 2IT0A 3RKWA 1SFXA 1R23A 3K1NA 1D3YA 1U2WA 1J5YA 3E6BA 2W57A 5K5OA 1YW7A 2XV4S 3K69A 4HLYA 1FYLA 4WXCA 3KZYA 5IT3A 1MZBA 4IPAA 5J6XA 4EVIA 2DU9A 4GGGA 4EJOA 4LJZF 3LAPA 4UVAA 5JHUA 3BDDA 4HF2A 3Q9SA 2HYGD 3CUQA 1ZG3A 1Y0UA 2QM3A 1DDNA 1C0WA 4R1HA 1RIOH 2FE3A 5ICFA 1HXDA 4HX7A 4YIFA 5K5QA 2M45A 1XCVA 1ONVA 3IL2A 1O7LA 5D4SA 4AIKA 5HLGA 1OKRA 3IWZA 1ZGJA 2TDXA 1IUYA 5HLHA 1KA8A 1AWCA 1B59A 3GFJA 4GYIA 2P6TA 3DEUA 1T2KA 3I64A 3DPTA 1I6XA 5D6FA 1J9IA 1S29A 3F6VA 2EFNA 3HOTA 1O7FA 2RVCA 2EFOA 2E7XA 3CUQB 3V4GA 3CUOA 3S2WA 1F9NA 1ZRFA 5AIQA 3CUQC 1S7OA 1IZ1A 3HHGA 2P5LC 2M30A 3U9GA 4HX4A 2R7DA 4IHSA 3GFIA 1ZRDA 1TQPA 2KIFA 1R1UA 3FM3A 4KIGA 4PDKA 5JVTA 1FX7A 3LA3A 1OYIA 4M71A 3DQVC 1YYVA 5LHIA 1LEAA 4HQMA 3BPXA 5DCMA 3FMQA 3I53A 4L5IA 1KYZA 4YIIA 2XAGA 5LGNA 4JBAA 3CTAA 2IRFG 4XSXF 2HTJA 5ICGA 3RTRA 2O61A 1ON2A 3F6OA 1KU7A 4MTEA 3HSRA 2ISYA 4G7OF 3KLNA 2YSRA 3QPTA 4LFUA 1B1BA 3ZMUA 3F8NA 3BJOA 3M9AA 2HS5A 3L2CA 1LEBA 2DPUA 2D45A 2Z5UA 2EV5A 2P6SA 4PCQA 3WU0A 1OR7A 4OMZA 4OIPF 2XRNA 3R4KA 4IVNA 3GW2A 4PGGA 5FO5A 1LB2A 4EM1A 4ETSA 5BS6A 3ZPLA 3DF8A 3C18A 1FBUA 3E6DA 3E5UA 2XAJA 2HDCA 1WI9A 1YG2A 4H0EA 2OBPA 2QBYB 1WKMA 3GXOA 1XMAA 5L3CA 4DQ2A 5L3EA 1XMKA 4WWCA 2Z33A 3F8MA 3F22A 1SMTA 2Z3YA 5F6FA 2VOOA 1IAWA 3BWGA 2BYVE 3KE2A 3MCZA 4P55A 2WV0A 4EM0B 1Z6TA 4M6YA 1HSJA 1H9GA 2P5VA 3ZMZA 3HUGA 2M87A 4EGYA 2R7FA 3QP6A 4G6QA 1FYMA 3HRUA 4FT8A 4RGRA 2GA2A 4EGZA 3KEOA 4ZH4F 2CQKA 4M74A 3G3ZA 3FMSA 4MQ9F 4A2UA 1FPQA 4WXHA 5H20A 4O5VA 4NHJA 1G3WA 4S04A 3ABUA 3LQRA 3WTXC 3NEUA 1K6OA 3RYPA 2K02A 2ZNYA 5AIPA 1EV7A 2CYYA 3WGGA 5HDGA 2RDPA 3H3ZA 1R36A 3FZVA 3F8CA 4KIBA 1KYWA 1U5TA 1TBXA 1I1GA 2H94A 3NQOA 1XB4A 2DBBA 1EH6A 2MD5A 3E97A 2DI3A 3CJNA 5FD5A 2RC4A 1P6RA 1R1TA 2DK8A 4D0PA 2DQRA 2K86A 2W25A 2GQQA 3F3XA 3I54A 2JTVA 4HX8A 3WU1B 2RGVA 4A6EA 2ACJA 3H3UA 2VBYA 1IXRC 1PP7U 1W5SA 3TDZC 4B09A 4GCVA 3KP4A 3I5UA 2MH2A 1AOYA 1X3UA 5J8FA 2VC0A 1LDKB 4L9NA 3GWZA 4YFNF 1IRGA 5FGMA 4FHTA 1K7AA 1W7PD 5D6EA 4K2EA 5LHGA 1O3RA 2JT1A 2P4WA 3QU3A 5J8CA 2VONA 1ZH5A 3ROUA 3M7GA 2V1DA 3WE2A 2OZUA 3E6MA 1UB9A 2JPCA 1L0OC 5DDGA 6PAXA 3HSFA 1Z7UA 3ELKA 5D5UB 2PI0A 2FMLA 4HDUA 3I4PA 2GXBA 5HS9A 2HTSA 2QYOA 3N97A 3FXRA 1K79A 1HW5A 4JQFA 3BPVA 1BIAA 3JW4A 1LVAA 4RGSA 1YS6A 2Z9OA 2H6CA 4ENKA 1SMYF 4P5OA 2XASA 3K9TA 2EFWA 1IF1A 2XAQA 5HDKA 1P92A 2Y48A 2QENA 2XAHA 3ECHA 3E5XA 4HW0A 3E3VA 3V7SA 4HV6A 3TQNA 2KIMA 3LQQA 2DQLA 2F5FA 1YTYA 4WXDA 2H27A 4RS8A 1T98A 4MHGA 4KYWA 2UXXA 2H6BA 1QQIA 3K2ZA 2VE9A 2O3FA 3VODA 2GAUA 3HTSB 4RB2C 3ABTA 3M8EA 3VB2A 1FSHA 2A3SA 1LNWA 3V7RA 1XSDA 1Z1DA 2XUBA 4UVBA 2PJPA 5ERIA 3R6SA 1R5HA 3P7NA 2A61A 4YG2F 3QP5A 3FXQA 4RAZA 5K1YA 4OU0A 4NB5A 3GEZA 2P7VB 4KICA 5CLSA 2ESNA 1Z91A 3R0JA 2EFQA 4HF0A 2F5CA 1JE8A 4UV9A 1W7PB 1YS7A 2DFIA 3IC7A 1TQMA 4Y17A 1XN7A 5DV5A 5LEJA 4WCGA 3D0SA 2ETHA 4M9XA 1OYYA 3QU6A 4I0BA 1ZGAA 4AIHA 1CF7B 2JSCA 4AVPA 2DW4A 1HW1A 3ISPA 3R61A 2YX4A 4ESFA 4HV5A 4HQEA 2VC1A 4BH9A 2XROA 1TNSA 3JSPA 4F7ZA 3FM5A 1BC7C 1S3JA 2M5WA 3O2PE 1STZA 1LDDA 4RGUA 5LBQA 4FX4A 4CYDA 4XSZF 1J2XA 4LG0A 2IJLA 4HDVA 1Q1HA 2OD5A 2KRFA 5BPDA 2ZCWA 1J7KA 4MGRA 2DAOA 2W24A 4L9TA 1KU9A 2P8TA 2R3SA 4MQVA 4ESJA 2P7CB 2KIUA 2UXNA 5LLQA 1D8KA 1R00A 3EETA 1BN5A 3RYRA 4KNYA 5HLIA 2WTEA 5HDNA 3L7WA 2W84A 2GIVA 2G9WA 4ZYHA 3DKWA 1QGPA 3LA2A 2BE5F 2HQNA 4U7DA 1RUNA 1GHCA 3SZTA 4LG0B 3JTGA 1FYKA 5AONA 4BQAA 4EJVA 3V7CA 3JAMZ 3HIFA 1GXPA 3M8FA 3ZN1A 2FBHA 3G73A 4P9FA 4WK8F 2V1UA 1WQ2A 4L18B 4IXAA 3IRRA 5JFRA 4A0XA 3RDIA 4BAYA 2VOPA 2K4BA 2L4AA 2Q2EA 1S7AA 3EDPA 1KGSA 2RNJA 3BOQA 5JI6A 2FBIA 1U3EM 3QOPA 2F5DA 1GVJA 2XAFA 3F23A 2QWWA 4HZFA 2FRHA 3DXJF 1BI3A 1J59A 3FXUA 1FNNA 2FU4A 1ZREA 4Z2YA 1MJAA 3DPLC 4LGWA 3TO9A 3MWMA 2VBXA 3HRSA 3B73A 5DUKA 2XKPA 5EEGA 2FXAA 2VT2A 4I01A 3SZPA 4LLGF 5IT9Z 4MEXF 5BPIA 3GZ6A 2E1CA 2M8EA 4GXOA 3J81Z 4N9IA 3ECOA 3HYIA 3QAHA 1PUEE 1SD6A 1YW8A 2Y75A 2L4MA 2ZFWA 2OA4A 2NAZA 3VOEA 4G7ZF 2KKOA 3R0AA 1G6NA 2HKXA 1UFMA 2W85A 4P9UA 1DUXC 3KP3A 2O03A 2EB7A 1KQ0A 3SFZA 4OINF 3L00A 4KN4X 3IKTA 1ZG1A 4EJUA 4DNCA 4HF1A 1ON1A 5DCMB 3GYHX 2K27A 1SD4A 4I09A 1BI1A 3I59A 4P96A 5KVRA 1WSUA 3LSTA 2CGPA 2COMA 2LNBA 2VXZA 1B9MA 3C3WA 5ILSA 1FZPB 2ELHA 4M9SA 2VT3A 1FP1D 3MQ0A 1EH7A 2LDUA 5LEKA 3GUDA 3COAC 3TO7A 1D8JA 1ZRCA 5IT9K 3L9FA 3BROA 4LLLA 2CWEA 2LKPA 3I58A 3J81K 5ILVA 4AIJA 1U8RA 4GO1A 2A68F 1HKSA 5ICEA 4HOBA 1ZARA 2D1VA 1RZ4A 2QLZA 2ZBKA 1MKMA 3EYIA 3RKXA 4ZYEA 2IP2A 1ODDA 1IXCA 3TOBA 4RB0A 5E1ZB 4CHUA 5L3BA 2B0LA 1SD5A 4IHTA 1G3SA 3RPUA 5HOOA 4CZZA 1QBJA 2A6EF 4M72A 4MEYF 2FMYA 2MLKA 4NQWA 3ULQB 2VE8A 2HYFA 4BXUA 3LWFA 1VTNC 2ISZA 5E17F 4A0YA 2CO5A 5D8KB 3MFKA 2FNAA 3FF5A 5KK1A 3RPQA 2HGCA 2Q0OA 4KMUX 2X4HA 1XDUA 2K4JA 3GO5A 5CVJA 5BMZA 2XVCA 2LF7A 1BI0A 5CYVA 3K1PA 1IN4A 1DPRA 1R5GA 5TJJA 1ULYA 4LB5A 2VBWA 1G4DA 5FD6A 3P9KA 1XGSA 4CGZA 1BOAA 3L09A 3KFWX 1G3YA 3F8BA 5CVRA 5JR3A 3IRQA 4IRHA 3F72A 2NNYA 4A5MA 1U5TB 2A69F 1U6GA 1FP2A 3ZMTA 3GVAA 5HVQC 1U5TC 2EV6A 1XSXA 4ZZDA 2QQAA 2ZJ2A 3I0TA 4I2OA 1KU3A 3HOSA 3BY6A 1WRJA 3EYYA 4I0AA 1F4KA 4IF4A 5CVIA 5LGUA 1XD7A 1UHWA 1T6SA 1EH8A 3PFIA 3P9IA 1XCBA 1JGSA 3FWEA 2L3DA 1YIOA 2EJRA 3P9CA 5DEQA 2IPQX 4UV8A 4N9HA 2X0LA 1IN6A 2UZKA 1E17A 3K1MA 3GFMA 5E1WA 4O3MA 1QPMA 2Z99A 5E8IA 4JK1X 4G6DA 4CO8A 1NHAA 2DO7A 2BEOA 1SFUA 1OMIA 2CFXA 3PQJA 5FB2A 4RB3C 2E7WA 2PG4A 1H9TA 4EM2A 3LA7A 4OMYA 3RI4A 2XIGA 2EA2A 4ZZLA 2QZ8A 2WWYA 2CW0F 2H09A 2FQ3A 4L0YB 4PGHA 2A5YB 1U78A 2NRAC 2XKOA 3WODF 2PEXA 4ZYGA 5DD4A 3W6JB 2DK5A 3DV8A 4CXFA 1CGPA 4IJAA 1IN7A 2MBFA 2ZKZA 4G8XA 4M9ZA 3MZYA 1W5TA 4B8XA 3KLOA 2A07F 3U2RA 3U1DA 4UUVA 4A5NA 2Y0MA 1G3TA 5DD8A 1TTYA 3Q5FA 3WE3A 5D4RA 1REPC 3DP7A 1S8NA 2L01A 2MA3A 1ZAOA 2HFHA 2OAZA 5A2QZ 2D2WA 5LGTA 4LK0F 2LSOA 1P2FA 3TOAA 2STTA 3LFKA 2EK5A 2KJCA 3WG9A 4BHPA 1YO5C 5L3DA 4Q48A 1TNTA 3K0LA 1A04A 4ENMA 4G7HF 4MTDA 1B6AA 3F21A 1RNLA 3I71A 1BC8C 1XGNA 1IN8A 1PP8F 4RAYA 5DUIA 4Y15A 2ZXJA 2G7HA 3MEXA 4BYYA 4ESBA 5LRSA 2A6HF 2OU2A 1O3TA 2GWRA 2NS0A 1O3QA 3HRTA 3B02A 1FLIA 3IKVA 2EFPA 2O6GE 2VBZA 3RJPA 1QZYA 2FNPA 3V8KA 3WTWC 2FEZA 4Q4ZF 1ZLJA 3KEQA 5F1RA 3TGNA 4EQQA 2WC2A 3D5LA 4HAMA 5DYMA 3T8TA 5A2QK 3CDHA 4L9VA 1BJAA 5ICCA 3ZQ7A 1USTA 3SXYA 4XBFA 5HS7A 2PFBA 1R22A 1B9NA 2HKOA 4AD9A 3M1EA 2FSWA 4ENNA 2M1BA 1ZN2A 3SHFA 2ZO4A 3ERED 2RKHA 4BHBA 4YFXF 4OOIA 1LJ9A 4RB1A 3MAJA 5L3GA 3T0YA 5LRRA 2GA1A 1IRFA 3V8LA 1D5VA 2FBKA 2PN6A 5BQTA 3E6CC 4KDPA 1HKQA 1FT9A 2UWMA 2VODA 3CO6C 3EQLF 1RI7A 2ZMEA 2E1NA 2IA0A 1OPCA 1LDJA 4LD5A 2MH9A 2V79A 1T0FA 4R8HA 1O57A 4LK1F 1HKTA 4Y13A 1JHFA 4KIFA 2IA1A 4U0WA 1F1ZA 3JAMK 3WTUC 1FBQA 3VFZA 1FBSA 4OIRF 1MD0A 4XLNF 2YX7A 4IRGA 4EJWA 2ZMEB 3WTVC 4O6JA 5CVVA 2J5PA 2JPBA 4L0ZB 1GXQA 1TW2A 2CG4A 3T5XA 4CICA 2FA5A 2BV6A 3FX3A 4QWQA 2QBYA 1BIBA 2OQGA 1BI2A 1T39A 2V1XA 4N0BA 5HS8A 3VEPA 4I7HA 4WX9A 1MDMA 5FLXZ 1IXSB 3ML6A 2NNNA 2HR3A 3T8RA 2BGCA 4KA4A 2V6CA 1JXSA 2IA2A 2DPDA 2OQRA 4YFKF 1FC3A 2MLGA 4TV7A 1MJ9A 4HLXA 1P4AA 2PBIA 3OV8A 3EUHA 5ED4A 1R1VA 4KMFA 4BNCA 3ZP5A 4LB6B 1S6LA 1OYWA 3KCCA 1Z05A 4Q47A 2XGXA 3FMRA 3WGIA 4MNUA 3BP8A 2ADUA 4QLCU 3I59B 3DFGA 3TDUC 4XLPF 1L3LA 2AS5F 4XRFA 1MDMB 2J5OA 4HBLA 3HHHA 3WTSC 2VN2A 3Q9VA 4OIQF 5BOXA 3T1BA 4E70A 1MGTA 3LAJA 2BBYA 4HA8A 2PQ8A 2ESHA 1FSEA 1IW7F 1YW9A 4A6DA 2DLLA 2F5EA 4U7BA 3W6KB 2PLYA 1XDSA 2EWNA 3AAFA 5FLXK 1FWZA 5ILUA 1J0RA 1USSA 3C7JA 2DTRA 2MC3A 3WTYC 1Z9CA 3GLXA 1SFEA 1QO0D 1BM9A 4UXNA 4ASNA 1ZHFA 4EMSA 1XSVA 3KZZA 4UVCA 2HWVA 2F2EA 1W4MA 3BZ6A 5FFZA 5FFXA 4RGXA 3BJ6A 2PMHA 2KJBA 4EJTA 2P5KA 3KP2A 4G9YA 3J80Z 2C6YA 3JTHA 1BBYA 1HW2A 2RV8A 1SAXA 3TKYA 4OIOF 2XHKA 3GZ5A 1MJBA 1KQ9A 2EV0A 4HYEA 4LMYA 4UNOA 4BHCA 2L54A 5CJ9A 1XGMA 5E1XA 1ZLKA 4ENJA 3WTZA 1IN5A 1YLFA 5K5RA 3JSOA 1QZZA 2G7UA 4PZJA 3QRFF 2OZ6A 1I27A 2K7LA 1P4WA 4FX0A 4KN7X 4GYGA 3NRVA 4M6XA 3QPHA 2ZNZA 4R79A 2LF8A 3CLOA 5F64A 4I02A 4A0ZA 1R58A 4ON0A 3ZMSA 2L02A 2RQPA 3GF2A 3H92A 2QQBA 4IRIA 1TLHB 4WF2A 1JHHA 1I5ZA 1XGOA 3REOA 3V8JA 3KP6A 5E18F 1KQ8A 5E20A 3J80K 3IHUA 2GZWA 3CO7C 1SD7A 4KT5C 2O0YA 1HSTA 1HQCA 1V4RA 3J7AO 3PQKA 3RIRA 2RN7A 4G94A 1ZYRF 1F5TA 4LLNA 1PDNC 5D5VB 5DCFA 4I98B 3C1DA 2HOEA 3E5QA 1RUOA 2YR2A 3N4MA 3R60A 1R7JA 2CSOA 3KETA 1UCRA 1I1SA 2STWA 1YQAA 3BJAA 4UHTA 2D1HA 1E2XA 1QNTA 3O3KA 5L3FA 1T38A 3TO6A 2FF4A 2IW5A 4U0VA 4A12A 4Q5SF 1Z6RA 1KU2A 2O8XA 4KFCA 1DPUA 1DP7P 2V9VA 1ZG5A 1K78A 2QUFA 3FHZA 2FOKA 3ZMVA 3OOPA 3SQNA 2DT5A 4L9JA 2YU3A 3O6BB 1W7PA 3KP7A 2JRTA 5D8LB 2HEOA 5D5XB 4L5JA 1B4AA 3WTTC 1CF7A 3IWFA 2AXLA 4U0YA 5H6RA
chains in the Genus database with same CATH superfamily
4M73A 3ZMDA 3KP5A 2PMUA 1D0ZA 1P4XA 5EZHA 3MZHA 2KZGA 1FOKA 2YPRA 3VSLA 1YRNB 2HQRA 3CCEI 2JZYA 1V3FA 3G1LA 1J75A 3RKYA 4ZYDA 3HRMA 5DM7F 5DM6F 2CQQA 5TRDA 1K78B 2IVMA 4S05A 1YJWI 2A6TA 1H0MA 5CVUA 4V19K 2EA4A 2GXGA 4C9YA 1UHMA 4KUMA 4KT6A 5E8GA 1FY7A 2E1OA 3WGHA 1JJ6C 5D5WB 2NYXA 3ZN0A 4EV0A 5J1YA 2Y2ZA 5H6QA 5IYDJ 4B1RA 1YI2I 2VIXA 3F8FA 1LQ1A 2Q8KA 2QVOA 4AC0A 1HBXG 3GFLA 5LHHA 3GX4X 4IHWA 4AWXB 4F93B 5GP9A 1VZ0A 1Z0XA 1IO2A 1O3SA 2QQ9A 4CDGA 4U88A 1WWXA 3U21A 1D1CA 1FOYA 1YFHA 2ZXWH 3HSEA 1TQIA 2DMPA 5EEHA 1X1PA 2HZTA 1TW3A 3HTUA 1OCCH 3IAM2 2O5RA 1XC5A 2IT0A 3NWTA 3RKWA 3RCOA 2LY1A 2VPRA 1SFXA 1R23A 3K1NA 1D3YA 1U2WA 4JYKA 3LL7A 4BU2A 3MVPA 1J5YA 2HZDA 4FQGA 3E6BA 2W57A 5K5OA 1Y39A 1YW7A 5HNHA 4PFPA 2XV4S 3S8PA 1APLC 3CESA 3LNQA 3K69A 1YX5A 4CCOA 1MMAA 4HLYA 4ZTFA 1FYLA 4WXCA 5EZGA 4X0GA 1XS9A 2W1OA 2HPIA 3BLYA 4RA2A 1D1AA 2F4IA 4UUSA 3KZYA 4ZDOA 1X1CA 1UG2A 4GFBA 5IT3A 1MZBA 2VKHA 4IPAA 4E7SA 1QZEA 3LSGA 3QYBA 2LY2A 5J6XA 4EVIA 1MNMC 2DU9A 4GGGA 4EJOA 4XL9A 5K7ZA 5FKMA 2ID6A 4LJZF 1X4OA 5KCMA 3LAPA 2X9DA 3QWLA 4UVAA 1UJ8A 2WB1A 3V42A 3DTEA 5JHUA 3GTQJ 2NVQJ 2HPMA 3BDDA 4HF2A 3Q9SA 2HYGD 3PL8A 4DW6A 2O8KA 3CUQA 1ZG3A 1Y0UA 2QM3A 3EUAA 2KQRA 4MFDA 3OY9A 1DDNA 2H8RA 1C0WA 2LTPA 3D5RC 1UHSA 3OIOA 4R1HA 1RIOH 2FE3A 4JX5A 4D9JA 5ICFA 1Q1VA 1HXDA 3QPLA 4JOMA 2L7FP 4HX7A 4YIFA 5K5QA 2M45A 1XCVA 2ELKA 1ONVA 4XLCA 4BACA 2V1NA 2DDBA 1YJ9I 3IL2A 3DTKA 2ZJRF 1W1WE 3IH3A 1O7LA 5D4SA 5HLGA 4AIKA 2F6CA 1OKRA 5EEAA 1POGA 4UUSB 3K4CA 3IWZA 4NDLA 2R5YA 5LFAA 1ZGJA 2TDXA 1IUYA 2HVQA 5HLHA 2R4GA 2IGMA 1KA8A 1AWCA 1B59A 2DFEA 3GFJA 4GYIA 2P6TA 2OV7A 3DEUA 3K4MA 2OUMA 1T2KA 3I64A 3DPTA 1I6XA 5D6FA 3W6VA 1S29A 1J9IA 3CCSI 3F6VA 3M3YJ 4XKCA 2H1LA 3PO2J 2EFNA 3HOTA 1O7FA 2L5QA 1X1BA 3QQAA 2OCCH 2RVCA 1BW6A 2EFOA 5JHFA 2E7XA 3CUQB 3V4GA 2QSFX 2WY8Q 4B48A 1JT0A 3CUOA 3S2WA 1F9NA 4W97A 1W0UA 1ZRFA 4E7ZA 2WB1N 3CUQC 5AIQA 1S7OA 1IZ1A 1RPWA 3HHGA 4JX4A 4LIUA 2P5LC 2M30A 3U9GA 3UNGC 4HX4A 4PJNA 2R7DA 1BR4A 5B5EC 5FLMJ 4IHSA 3GFIA 1ZRDA 1TQPA 2KIFA 1R1UA 2R5YB 5C4XJ 3FM3A 4KIGA 4PDKA 5JVTA 1FX7A 3LA3A 1OYIA 2E2IJ 4DBRA 2XGDA 4M71A 3DQVC 1YYVA 3MZ8A 5LHIA 1LEAA 2ID3A 4C2MJ 4HQMA 3BPXA 2K5CA 5DCMA 3FMQA 3I53A 4L5IA 1KYZA 2QGUA 3DLAA 5E3LA 3HGYA 4YIIA 2XAGA 5LGNA 4JBAA 4A3BJ 3CTAA 2IRFG 4XSXF 1E0EA 2HTJA 3TP3A 3LSIA 2KL4A 5ICGA 3RTRA 2O61A 2DMUA 4PUSA 1ON2A 3F6OA 1KU7A 1ITYA 3CCRI 4MTEA 3OMYA 5J4VA 4E7LA 1OCTC 2DT6A 3HSRA 2ISYA 4G7OF 4LITA 5GAHJ 1W36D 3KLNA 2XPWA 4F91B 1PUFA 2YSRA 3QPTA 4LFUA 1B1BA 3ZMUA 3F8NA 1JUPA 2HOTA 1T0FC 3BJOA 3M8JA 3M9AA 2KLOA 2HS5A 3H1CA 3L2CA 1TWFJ 1LEBA 2XPVA 2DPUA 3IAS2 1UZCA 2WAQA 2D45A 2Z5UA 2EV5A 2P6SA 5F27A 4PCQA 3WU0A 4C3JJ 3I9V2 4L5EA 1OR7A 2DA6A 4XNFA 4OMZA 4OIPF 2XRNA 3R4KA 4IVNA 3OYLA 3GW2A 4PGGA 3JCUC 5FO5A 1LB2A 2M8GX 3S32A 4EM1A 2AQFA 5IYCJ 4BJ5C 4CCKA 4ETSA 5BS6A 3ZPLA 3HOVJ 3DF8A 5GAEJ 3C18A 1FBUA 4YEJA 3E6DA 1VQNI 4F55A 1HC8A 3E5UA 2XAJA 2HDCA 2W4SA 2O7OA 1WI9A 4XKBA 1YG2A 3Q0WA 4H0EA 2F4MB 2OBPA 3AG4H 1CQTA 3OYIA 1D5YA 3ZQHA 2QBYB 1WKMA 3GXOA 1XMAA 2Y9ZA 4E7JA 2X1CA 2DOEA 3DTIA 2L9VA 5L3CA 4OAYA 4DQ2A 1H88C 5L3EA 1XMKA 5J1UA 3RZOJ 4WWCA 2Z33A 3F8MA 2HXOA 3F22A 1SMTA 1NH3A 5M5YJ 2Z3YA 5F6FA 2VOOA 3IH4A 1V5FA 1WJEA 1IAWA 4A3DJ 3BWGA 2BYVE 3KYCB 2R7VA 4M3GA 4RAGA 3KE2A 3MCZA 4P55A 2WV0A 1N78A 4EM0B 1XPXA 1ACIA 1Z6TA 4M6YA 1HSJA 1H9GA 2BY1A 2G0EA 2L9NA 2P5VA 3ZMZA 3HUGA 2M87A 2K3FA 4EGYA 2R7FA 3FISA 3QP6A 4G6QA 5FKLA 1FYMA 2ME6A 5FROA 3TW6A 1A6QA 4Y4RA 2IAIA 3ZOBA 3HRUA 4BDZA 4FT8A 4RGRA 2GA2A 4EGZA 1JI8A 3KEOA 4ZH4F 4ABZA 2PMZA 2CQKA 1HDPA 4M74A 3G3ZA 1Z67A 3FMSA 4MQ9F 4A2UA 4XK4A 1IDZA 1FPQA 3SEQA 1PVEA 2VKEA 2CW7A 2I5UA 4WXHA 1D1BA 5H20A 3OYBA 4O5VA 4NHJA 1G3WA 2VQCA 4S04A 3ABUA 3LQRA 3IUOA 1JGGA 2LLKA 3WTXC 3NEUA 2DA5A 1DGRM 1K6OA 4FCYA 2XGCA 4EATA 1WCMJ 3MKYB 3RYPA 2K02A 4HNVA 3CP2A 1R71A 2ZNYA 1A36A 3BZKA 5AIPA 1EV7A 2B63J 1WJBA 2CYYA 3WGGA 5HDGA 2RDPA 1A6IA 3A1YA 2UUZA 3H3ZA 1R36A 3FZVA 3F8CA 4A3EJ 1IDYA 4KIBA 3OSFA 1YITI 1KYWA 3BZCA 1U5TA 1TBXA 3BG3A 3C2GA 4J19A 1BL0A 1I1GA 2H94A 3NQOA 1XB4A 4KISA 2CS3A 2DBBA 1EH6A 2MD5A 3E97A 2DI3A 3CJNA 5FD5A 1V5EA 2RC4A 1P6RA 1R1TA 4FETA 1ETKA 4ZDPA 2DK8A 4D0PA 2PX9A 2DQRA 2K86A 2W25A 3LFUA 2GQQA 3F3XA 1MH3A 2JTVA 3I54A 4BQNA 4HX8A 3WU1B 2RGVA 4ITVA 4A6EA 2ACJA 2OPTA 3H3UA 2VBYA 2XRLA 2GM4A 4BXXJ 3H9GA 1IXRC 2ZXIA 1PP7U 1W5SA 3TDZC 2R7TA 1T33A 4B09A 1IRXA 4GCVA 1R4MB 3OR1C 3C2BA 3KP4A 3I5UA 1SVMA 1I3AA 4XLFA 5KHDA 2MH2A 2E19A 1AOYA 1X3UA 2CUJA 5J8FA 3L2VA 1WJFA 2VC0A 1LDKB 3K4BA 4L9NA 4BY7J 3GWZA 4YFNF 1IRGA 1JKPC 5FGMA 4FHTA 2XAUA 1K7AA 3OL4A 4FTHA 1W7PD 5D6EA 4IOCF 4LOCA 4K2EA 4XLAA 5LHGA 1O3RA 5E79C 4P1WA 2JT1A 3WHBA 2P4WA 3WHCA 3QU3A 2VASA 3S3OA 5J8CA 4BY1J 2VONA 1ZH5A 3KZIC 1XG1A 3ROUA 3M7GA 4A3FJ 2V1DA 2VB6A 3CZ6A 3WE2A 2IS6A 1VQPI 2K9LA 4BE0A 2OZUA 4PSXA 3E6MA 1UB9A 4HG2A 2JPCA 1L0OC 5B3SH 5DDGA 6PAXA 3HSFA 1Z7UA 3ELKA 5D5UB 2PI0A 1GT0C 1G59A 1GVDA 2FMLA 3TMOA 4HDUA 3FBNB 3ONQA 3I4PA 4XMYA 2X6XA 2GXBA 5HS9A 5M3MJ 1QA6A 4XQFA 3S2DJ 5HODA 2HTSA 3E1SA 4B3XA 2QYOA 3N97A 2QEXI 3DKXA 3N05A 3FXRA 1U0JA 1K79A 4AU7A 1HW5A 1VQMI 2EZIA 4B43A 4JQFA 3BPVA 1BIAA 3JW4A 1LVAA 4RGSA 1YS6A 2WA0A 4A3JJ 2Z9OA 2H6CA 3H9QA 5KNLA 4ENKA 4I6ZA 3S1MJ 5F1JA 4DBQA 1SMYF 3P5JA 3H5RA 1QVTA 2Y69H 4P5OA 2M7AA 1DP3A 4PJMA 2XASA 3K9TA 2EFWA 1IF1A 2XAQA 3M07A 3MN2A 3DLLF 1TWHJ 4QTRA 5EYRA 4E6KG 5HDKA 1P92A 3IH2A 2Y31A 2Y48A 3A03A 1TP4A 2QENA 3AL0B 5FLVA 2DA1A 2XAHA 3ECHA 3E5XA 4DYQA 3SFIA 4HW0A 3B6AA 3E3VA 3V7SA 5HNFA 3VSKA 4HV6A 3TQNA 2KIMA 2GOMA 3LOCA 3LQQA 3NAUA 1W0TA 2R7ZJ 1IV8A 4CYCA 2CU7A 3RKQA 4NBQA 2AXTC 2DQLA 2F5FA 1MNDA 1YTYA 1EF4A 2B7EA 4WXDA 2H27A 1FOXA 3A0BC 2E71A 4RS8A 4XLHA 1QU3A 1T98A 4MHGA 3H9JA 4II2A 1H8AC 4KYWA 2UXXA 2NVUB 4AUXA 2H6BA 1QQIA 2JQ7A 1JKQC 1FEXA 4C3IJ 3K2ZA 3FDYA 5E3MA 2VE9A 2LD5A 2O3FA 2X1EA 1TC3C 3VODA 2GAUA 3LSHA 3HTSB 4RB2C 1Y0NA 3ZRGA 2HYJA 4C30A 3ABTA 3ZQIA 3M8EA 4D7NA 4HNUA 3VB2A 1FSHA 2A3SA 5TGTA 1LNWA 3FK6A 1Z77A 3OYCA 2LR8A 3V7RA 1XSDA 1Z1DA 2LKSA 4DIQA 2XUBA 4UVBA 4ANJA 2PJPA 5F0FA 5ERIA 3PNYA 5IPAA 2JA5J 4II3A 2L7MP 3R6SA 1R5HA 3P7NA 2A61A 4YG2F 3JRGA 3QP5A 3FXQA 4XM3A 1MBGA 5EG0A 3HPGA 4RAZA 2DYRH 5K1YA 3CMYA 4OU0A 4NB5A 1UG0A 3SEZA 2VLAA 3GEZA 4NC8A 5JVGF 2L2OA 3WG7H 2DFFA 3BCBA 5F0CA 1LFBA 2P7VB 4KICA 2OCEA 5CLSA 2ESNA 2M4KA 1ETXA 5C3EJ 1Z91A 2V26A 3HZJA 3R0JA 4XRSA 2EFQA 4HF0A 2F5CA 4B47A 1JE8A 1OCOH 4UV9A 1W7PB 3DBLB 3S2HJ 1YS7A 2DFIA 3IC7A 2KZVA 1B8IA 5TISC 4RAFA 1S72I 1TQMA 5IY5H 4Y17A 1XN7A 3J7ZI 1K61A 1FJLA 3HXLA 5DV5A 5LEJA 4WCGA 3D0SA 2ETHA 2JRMA 2QCOA 4M9XA 1OYYA 4ZYAA 3KYDB 3QU6A 2MSYA 4I0BA 1ZGAA 4AIHA 1Y1VJ 2Y0SA 3OYFA 2JSCA 4AVPA 1CF7B 3PIPF 2DW4A 1HCRA 2WY7Q 1HW1A 2CUZA 3A0HC 1JT6A 4IZZA 1A5JA 1ZKGA 3BTLA 1OJLA 3ISPA 3R61A 5M5WJ 2X51A 2YX4A 3H5NA 4ESFA 4HV5A 2F4OB 4HQEA 1AKHA 2VC1A 2IS2A 2JA2A 2GIZA 2KISA 2R7SA 4BH9A 2LP0A 2XROA 1TNSA 3CQZJ 3JSPA 4F7ZA 3FM5A 2A5WA 3WU2C 4B4CA 2DA7A 1BC7C 2NVXJ 3HDDA 4IO9F 1ETOA 1S3JA 4IL6C 2M5WA 3ABMH 3I56I 1MBEA 3O2PE 4DZPA 1STZA 1LDDA 2L7KA 2VXDA 4RGUA 5LBQA 4FX4A 4CYDA 4XSZF 1J09A 1J2XA 1GV2A 4LG0A 4BGDA 1Z7LA 2IJLA 2Y30A 4HDVA 1Q1HA 3RZDJ 2OD5A 1B8IB 2KRFA 2N8GA 5BPDA 4IQJA 1XTAA 2ZCWA 4MO7A 1J7KA 4MGRA 2DAOA 2W24A 4L9TA 1DU0A 1KU9A 3FXLA 4F92B 4BEHA 2B9SA 2P8TA 2DN0A 2R3SA 3I4NJ 4MQVA 4ESJA 2P7CB 2KIUA 3OYJA 2UXNA 1V54H 5LLQA 3OS0A 5M3FJ 4I99C 5FKKA 1D8KA 2R7XA 2CH0A 1R00A 3EETA 1SAUA 1BN5A 3S14J 3IV5A 3RYRA 1AKHB 4KNYA 1GDTA 5HLIA 2CV0A 2WTEA 5HDNA 2XC7A 3L7WA 2W84A 2VJIA 2Y0SN 1X1AA 2G9WA 2GIVA 4ZYHA 3KYLA 3DKWA 1QGPA 4IHYA 3LA2A 2BE5F 3Q3SA 3L1PA 2HQNA 4U7DA 1RUNA 1GHCA 1HLVA 1MBKA 3UKGA 3SZTA 4LG0B 3JTGA 1FYKA 1MBJA 2R7UA 5AONA 4BQAA 4EJVA 3V7CA 3JAMZ 3PSFA 3HIFA 1GXPA 3M8FA 3CCMI 4B3AA 3ZN1A 3CF2A 2HOSA 2FBHA 2WBMA 3CDLA 4PJ0C 4HPQA 2K3PA 5GTHC 3G73A 4P9FA 4WK8F 2W48A 1WQ2A 2V1UA 4L18B 1ZR2A 3BQZA 4IXAA 3IRRA 5LD2C 5JFRA 2QA4I 4A0XA 3KEYA 1N77A 3RDIA 4BAYA 2VOPA 4BQOA 2W7NA 2LOOA 3VYSB 3OYDA 2K4BA 2Q2EA 2L4AA 1S7AA 3EDPA 4H4KC 1KGSA 2RNJA 3BOQA 1LKXA 2FBIA 5JI6A 4RLFA 1U3EM 2ZB9A 2W82A 3QOPA 2A05A 5FRMA 1X2NA 2F5DA 2R92J 2XF5A 3HOUJ 3L2UA 2XGEA 1WJDA 1GVJA 3HBLA 1SVOA 1U9OA 2XAFA 3S1QJ 3F23A 2QWWA 2KT0A 3GLLA 1RRJA 4HZFA 2FRHA 2BY2A 3DXJF 1BI3A 2BY3A 3OS1A 1J59A 2ZJQF 3FXUA 2HOAA 1FNNA 3HJEA 2EIMH 4A69C 2F5VA 2XDVA 4F3QA 4XICA 4CA0A 2FU4A 1MNEA 3LSMA 1ZREA 2ZFUA 1I3QJ 4Z2YA 1MJAA 4E4HA 3GTKJ 3DPLC 4MLOA 4LGWA 3TO9A 3MWMA 2VBXA 3HRSA 3CCQI 3ZR8X 1MH4A 3B73A 5DUKA 4PFOA 1H89C 2XKPA 2BHZA 1ZTRA 5EEGA 3A4CA 1NG7A 5CPRB 1ZELA 2FXAA 2Q2EB 2LH9A 2LKXA 5CQGA 2VT2A 3F9KA 4I01A 5K7HA 3SZPA 4LLGF 5IT9Z 4MEXF 5BPIA 3OYEA 3GZ6A 2E1CA 4ZJZA 2DFHA 2M8EA 4GXOA 3J81Z 4N9IA 3ECOA 3HYIA 3ZQGA 3QAHA 1PUEE 1SD6A 1YW8A 2DDAA 4M6VA 1TWAJ 2Y75A 5EF6A 2L4MA 2ZFWA 2OA4A 1X19A 3BR2A 2NAZA 3GTJJ 3VOEA 4G7ZF 4Y3OA 5B1BH 2KKOA 3R0AA 2CQNA 1G6NA 2JA7J 2HKXA 4IKFA 2CW8A 3DBRB 1WHUA 1UFMA 3BG9A 3OS2A 5EGOA 2XB5A 2W85A 4P9UA 2DOFA 2MGQA 5GPAA 1DUXC 3JR9A 4BJ6C 3KP3A 2O03A 2XF6A 3CDIA 2EB7A 1KQ0A 1X2MA 3SFZA 2MFZA 4OINF 1VI0A 3L00A 4KN4X 3IKTA 1ZG1A 4N4NB 4EJUA 1UMQA 4DNCA 2DODA 2XB0X 1WJCA 2X48A 3I3LA 3BTCA 2HVRA 4HF1A 1ON1A 1V5GA 5DCMB 2DTZA 3GYHX 2K27A 2HDWA 2H8WA 4C2TA 1SD4A 2LYCA 4I09A 1BI1A 1FMWA 2LY9A 3I59A 3I55I 4P96A 3OL3A 1HOMA 5KVRA 1WSUA 2HQAA 4BQQA 2RNGA 3DU6A 3LSTA 5IOYA 2BY0A 2COMA 2CGPA 2LNBA 4BE2A 2VXZA 1B9MA 1ZQ3P 1YE9A 3C3WA 1X4PA 3LMMA 5ILSA 3CCLI 1FZPB 2ELHA 1SFOJ 4M9SA 2ECCA 2VT3A 1FP1D 1F36A 3MQ0A 3NARA 1HDDC 1EH7A 1X1DA 2LDUA 3UR3C 2KMUA 1I39A 5LEKA 3GUDA 4A3MJ 1PUFB 3COAC 1NK3P 3CJTB 2QF7A 5E3NA 3TO7A 1D8JA 3BG7A 1ZRCA 5IT9K 2NOJB 3L9FA 3BR1A 3BROA 4LLLA 2CWEA 3HG9A 2LKPA 3I58A 4BBRJ 3J81K 2IXSA 5ILVA 4AIJA 1FOWA 1U8RA 2GOXB 3ZQQA 2MYSA 3OYNA 5M5XJ 4GO1A 4G12A 1JJ8C 3ZGKA 2A68F 1OR7C 2KFDA 1HKSA 1BR1A 5ICEA 4HOBA 2OTJI 1ZARA 3AG3H 3TW7A 3ZQFA 2D1VA 1RZ4A 2IEKA 2QLZA 2HXIA 2Z2SB 2ZBKA 2EBIA 1MKMA 3EYIA 2IS1A 3RKXA 4ZYEA 2BZTA 3AFHA 4QIWN 2IP2A 3L2QA 1ODDA 1WH7A 1IXCA 4JP0A 3ZXSA 1E3OC 3K4LA 1EA3A 3TOBA 4RB0A 3S17J 5E1ZB 4CHUA 5L3BA 2B0LA 1NG6A 1SD5A 1G3SA 3RPUA 2QSGX 4IHTA 1WVRA 5HOOA 2E34A 2EILH 4CZZA 2HI3A 3L2RA 3FXKA 4V2FA 1R6RA 4DJAA 1QBJA 1TT5B 2A6EF 4M72A 1SVLA 3CJRB 4MEYF 2FMYA 2MLKA 4NQWA 3ULQB 2CFOA 1R9TJ 1VQ7I 1M1EB 2K9MA 2BVMA 1BR2A 2VE8A 2HYFA 4BXUA 2KHMA 3X2QH 3LWFA 1VTNC 2ISZA 3SJMA 3MD2A 4CCLA 1BOBA 3S16J 5E17F 3OIQA 4XN0A 4A0YA 4GDFA 2CO5A 2I8DA 1OFCX 2R7OA 3SYTA 3K70D 2GLOA 5D8KB 3HUGB 1MW7A 2JVHA 3MKZA 1Y6IA 1E3HA 3MFKA 5KAFC 4XIDA 3FHNA 2M0MA 2ZC2A 2ELJA 3KIOA 3PNTA 2FNAA 3FF5A 5KK1A 3G1OA 3RPQA 2HGCA 2Q0OA 4KMUX 2X4HA 1XDUA 2K4JA 4XORA 4XR6A 1QPIA 2XSJC 3GO5A 5CVJA 5BMZA 3BCAA 2NVTJ 5K7FA 1T56A 2XVCA 1RKTA 3OYHA 2LMDA 2ZSIB 2LF7A 2R7RA 1BI0A 5BNGA 1OCPA 2NS7A 5CYVA 3K1PA 2MD0A 4CCNA 1IN4A 3FXOA 1DPRA 1R5GA 4RMNA 4AM3A 3FK7A 2CUEA 5TJJA 1TWCJ 1ULYA 2JMWA 2Q1ZB 3AKZA 4NQWB 4LB5A 2VBWA 1G4DA 5FD6A 3P9KA 3JRDA 3ERMA 2YUSA 1XGSA 3D5SC 1NK2P 4HRIA 2JWTA 1QHGA 4M3BA 4CGZA 1BOAA 1AHDP 3L09A 3KFWX 1G3YA 2Z1DA 3F8BA 5CVRA 5JR3A 1DU6A 3IRQA 2CUFA 4IRHA 3BTIA 2CRGA 3ASOH 3F72A 3ZCOA 2NNYA 4A5MA 1U5TB 4XKWA 2A69F 1G8XA 4BUPA 1U6GA 2CQ7A 4LG3A 1FP2A 1MMNA 4Y52J 3ZMTA 1RKWA 3DKYA 3GTMJ 3GVAA 5FJ8J 4M3DA 5HVQC 1RC9A 2VUMJ 3QYEA 1U5TC 2EV6A 4PK4A 1EJ9A 1XSXA 2MG4A 2V6EA 3TP0A 4ZZDA 4NUBA 2QQAA 2ZJ2A 2EINH 3I0TA 2Z16A 4I2OA 3DEWA 1KU3A 3HOSA 1IC8A 2BVLA 1WH5A 3BY6A 1WRJA 2EZHA 3EYYA 1SC7A 1LVKA 1MMSA 4I0AA 1F4KA 4IF4A 4E7HA 3LSKA 3GTGJ 2JUGA 5CVIA 5LGUA 2K9QA 5J4YA 3EUKL 1ENHA 4AYBN 1XD7A 2KIQA 1X3WB 1UHWA 1T6SA 1EH8A 3ESWB 2HVSA 3PFIA 3BG6A 3P9IA 1P9QC 2CMPA 1XCBA 1JGSA 3BR6A 3FWEA 2M4GA 2L3DA 1YIOA 2EJRA 2HDDA 3P9CA 1MSEC 3CJQB 5DEQA 3CMEI 2IPQX 4UV8A 3JREA 2IS4A 4A3CJ 3J7AY 5C4JJ 2OC6A 3QPSA 4N9HA 2X0LA 1IN6A 2KRHA 1X58A 2UZKA 4CCMA 4HSRA 3ABLH 1U8BA 1E17A 3K1MA 3GFMA 5E1WA 3H35A 3S93A 1YX3A 2VJ5A 4O3MA 2DT7B 1QPMA 2K9NA 2Z99A 3CMMA 2MABA 2RQQA 2V7FA 5EJCA 1WJAA 5E8IA 1VQ5I 4JK1X 3LSPA 3A02A 4DGWB 4M3FA 4XRSG 2VQHA 1WJ5A 3KPHA 4G6DA 4CO8A 1NHAA 2DO7A 2BEOA 1RETA 1SFUA 1OMIA 3E7LA 3PNVA 4UB8C 2CFXA 1LE8A 3PQJA 4BDYA 5FB2A 4RB3C 4QPOA 4Z6YA 3AL0C 2BOLA 4G6TB 2E7WA 2PG4A 2VKDA 2XPUA 4EM2A 1H9TA 3CCYA 1X3ZB 2ICWG 3LA7A 4OMYA 3O8HA 1T08B 3I4MJ 3RI4A 2VI6A 2XIGA 2EA2A 3PFYA 4PJLA 3K4JA 3GBGA 3FXMA 4ZZLA 3QYFA 5C44J 3L2WA 2VPLA 2QZ8A 1LUJB 2WWYA 2VQLA 2CW0F 2H09A 3G1MA 1YRNA 3K70C 2FQ3A 3DPUA 3CD6I 4L0YB 4PGHA 4I76A 2A5YB 2V9PA 1U78A 2NRAC 2M7BA 2XKOA 1VQ4I 5IP6A 3WODF 2PEXA 4ZYGA 5DD4A 3K7AJ 3W6JB 2KDZA 5EDNA 2OTLI 1WPKA 2DK5A 3DV8A 5IYBJ 4UUTA 4CXFA 1CGPA 1Y56A 1Y8QB 4IJAA 2K40A 3CCVI 1OCZH 1IN7A 2MBFA 1K83J 3CC4I 2OF7A 2ZKZA 2DMTA 4G8XA 4M9ZA 3OYAA 4CYCB 2YS9A 2AO9A 3MZYA 1W5TA 4DZJA 2PJRA 4B8XA 4FASD 3KLOA 2A07F 3AG2H 3U2RA 2QKMB 3U1DA 3S1NJ 2FUG2 1OISA 1DQUA 2W00A 4UUVA 3IP4B 1SANA 4A5NA 2Y0MA 1Z3YA 1G3TA 5DD8A 2WAEA 1TTYA 3Q5FA 1OLTA 2M9HA 3VPRA 3WE3A 4UY8I 5D4RA 1REPC 3DP7A 2QKLB 1S8NA 1XX5A 2L01A 5J1RA 5GAGJ 2MA3A 2M2EA 1ZAOA 2HFHA 2NXNB 1U9NA 2OAZA 4PJJA 4A3GJ 2HU9A 2P81A 3S3NA 2FJ1A 4XOTA 4Y7NJ 2BXZA 4RBOA 2AHQA 3HPHA 2D2WA 5LGTA 5A2QZ 1YOVB 2JVGA 1R5ID 4LK0F 2LSOA 3DCFA 3CF5F 3W2VA 1ETWA 1P2FA 3TOAA 2STTA 3LFKA 2EK5A 3GMEA 5JLXA 2KJCA 1IGNA 3WG9A 4BHPA 3BT9A 2DA3A 4D7MA 1YO5C 5L3DA 2DA4A 3HGGA 5EG0B 3W2AA 4Q48A 1TNTA 2JN6A 1TZLA 3C2HA 1BA5A 1ERDA 1RR8C 3K0LA 1A04A 2R5ZA 1VQOI 1XMXA 4ENMA 2PJRB 1EKEA 2E36A 1T95A 3GCMA 4ZDLA 4IOAF 4G7HF 4MTDA 1B6AA 3F21A 4CCJA 1RNLA 1P7IA 3I71A 1BC8C 2X85A 1XGNA 3HKZA 1IN8A 2V4JC 1PP8F 4RAYA 5DUIA 4Y15A 5GTIC 2ZXJA 2G7HA 1JTYA 1S7EA 3MEXA 4BYYA 4ESBA 5LRSA 2A6HF 2OU2A 1O3TA 3BQYA 2GWRA 2NS0A 1O3QA 1ORKA 3HRTA 1GV5A 2L7ZA 3B02A 1FLIA 4EEFG 2EH3A 4YELA 1A35A 4RLQA 3K10A 3IKVA 3VDXA 2EFPA 1KZHA 2O6GE 2VBZA 5FRNA 3RJPA 1QZYA 2BW3A 2FNPA 3ABKH 4NC6A 3V8KA 3WTWC 1K4SA 2FEZA 4Q4ZF 4HNTA 4FE4A 1ZLJA 3CCJI 3KEQA 2E2JJ 1VQ6I 2VJ4A 4XOPA 3BTJA 3TGNA 5F1RA 2R5ZB 1RESA 4EQQA 2WC2A 3D5LA 4HAMA 3RQIA 4NC7A 4A3KJ 1MMGA 5DYMA 1TWGJ 3T8TA 5A2QK 4MIMA 3GTOJ 3CDHA 3OWTA 4L9VA 4NNJA 1BJAA 5ICCA 3EPZA 3ZQ7A 1GLNA 4IHXA 3GZNB 1USTA 2LK2A 3SXYA 4XBFA 2OJED 2E35A 5HS7A 3GTLJ 4BBSJ 3JRFA 2PFBA 1YHQI 1I6HJ 2E5ZA 1I50J 1R22A 1B9NA 2HKOA 4XONA 3OR2C 4RM3A 4AD9A 1D0YA 2JUCA 3M1EA 2FSWA 4BEHB 2R7WA 3HKZN 3RQ4A 2IBDA 4ENNA 2M1BA 1ZN2A 3SHFA 2ZO4A 3ERED 3VYUB 3JRBA 1VFCA 1TL8A 1UAAA 2KRCA 4LIVA 1AA7A 1SEUA 2ECBA 2RKHA 4BHBA 4YFXF 2BW3B 3B6CA 4OOIA 1LJ9A 3Q0VA 5F0HA 3H3VK 1MIJA 3FXJA 3TL4X 4RB1A 4BL0B 3MAJA 5L3GA 3T0YA 5LRRA 1S9HA 2GA1A 1IRFA 3V8LA 1D5VA 1BW5A 2FBKA 3OIPA 2E1MB 2V9KA 1VQKI 1KONA 4U87A 1N25A 2PN6A 3G2BA 3A2KA 1JTXA 1OQYA 5FKNA 5BQTA 3E6CC 4KDPA 1HKQA 1FT9A 2VQGA 1W5CC 2UWMA 2E1MC 2VODA 2WV1A 2FX0A 3EQLF 1V55H 3CO6C 1RI7A 2ZMEA 2E1NA 2IA0A 1QHHD 3LSRA 2QQ8A 1MBFA 4BXFA 1OPCA 1WI3A 1LDJA 4LD5A 5E3OA 2MH9A 2V79A 1T0FA 2X6WA 1MSFC 4R8HA 1O57A 4LK1F 4YRVA 1HKTA 4Y13A 1ZGWA 3M1CA 1JHFA 3BR0A 4FISA 4DYRA 1G2HA 4KIFA 2IA1A 3BC8A 3QODA 4U0WA 1F1ZA 4QSHA 4W1UA 3K4NA 3H0GJ 3OYMA 4QPQA 4B44A 2IGNA 3JAMK 3WTUC 3H5AA 2FQ4A 1FBQA 1NTCA 4JX6A 3VFZA 1FBSA 4OIRF 3RPUD 4IX7A 2L9RA 1MD0A 4XLNF 2DMNA 4XRMA 5KAIC 2LBFA 3S3MA 2YX7A 3A01A 4IRGA 4F52A 4A3LJ 4EJWA 1Y8RB 1OCRH 2K85A 4E7KA 3PSIA 2DCEA 2ZMEB 3VYTB 3HC7A 3WTVC 4O6JA 5CVVA 2J5PA 2JPBA 4L0ZB 3PJRA 1GXQA 5GADJ 1TW2A 2CG4A 3T5XA 1SFKA 4CICA 2ZMEC 2FA5A 3G6EI 1MMDA 2BV6A 3FX3A 4QWQA 1E3PA 2VL8A 2QBYA 1BIBA 2OQGA 4XLEA 1BI2A 2TCTA 1T39A 3OOUA 2CJJA 3AG1H 2V1XA 4N0BA 5HS8A 3VEPA 4X6AJ 4I7HA 1IG7A 1WZ2A 4WX9A 1MDMA 1IRZA 5FLXZ 3H0DA 2X1DA 3HOYJ 1IXSB 1N75A 3ML6A 2NNNA 2HR3A 3T8RA 3TEDA 2BGCA 4KA4A 2LC2A 2V6CA 1JXSA 2IA2A 2LBFB 2DPDA 2OQRA 4YFKF 3A01B 2Y9YA 1FC3A 2IGKA 2MLGA 3HOXJ 1R49A 4TV7A 1MJ9A 2DXIA 1FIAA 3SZGA 5EGOB 2I10A 1FTZA 4HLXA 1P4AA 2PBIA 3DU5A 2JK3A 3OV8A 3E0JB 3EUHA 5ED4A 3BG5A 1R1VA 4KMFA 3HB9A 3ASNH 3ZP5A 4LB6B 1S6LA 4BNCA 1OYWA 3KCCA 2JJ7A 1JKRC 3FIWA 5B1AH 1Z05A 1IUFA 2KDOA 4Q47A 2LRDA 3PO3J 2XGXA 3FMRA 3WGIA 3LSJA 3BP8A 4MNUA 2E5NA 2ADUA 4QLCU 4J01A 3I59B 3DFGA 3TDUC 2LG4A 4XLPF 1L3LA 2AS5F 4XRFA 3J7YJ 4ZTJA 1MDMB 2J5OA 4HBLA 3HHHA 3WTSC 2VN2A 2R0QC 3H36A 3Q9VA 2BHYA 2DJIA 4OIQF 5BOXA 3T1BA 2UV1A 2JA6J 2EQRA 4E70A 1MGTA 1Z3XA 1P7JA 1QRYA 1IJWC 5HLTA 3LAJA 2BBYA 3CP8A 4HA8A 4D5CA 4D1QA 2PQ8A 4FE7A 2ESHA 1JKOC 3SDBA 5J47A 1FSEA 2LFBA 3W2WA 1BJZA 3K4KA 3PUBA 1IW7F 1YW9A 1QVUA 2WAQN 4A6DA 2DLLA 1TT0A 1VNDA 2F5EA 4X1EA 4U7BA 4OWRB 3W6KB 4DOZA 4M3EA 2GBYA 2XF7A 1B72A 2WAFA 3EUHC 2PLYA 1K6YA 1XDSA 2EWNA 3AAFA 2F48A 5FLXK 1FWZA 3OYKA 3Q0UA 3QOEA 5ILUA 9ANTA 4Y33A 1J0RA 1USSA 3C7JA 2R93J 3F0CA 3DBHB 4CZCA 2DTRA 3ZQLA 5F04A 2M3AA 2MC3A 3WTYC 1Z9CA 4DYCA 3GLXA 2VKVA 3ZQCA 2HNHA 3S1RJ 4N4OB 1SFEA 1QO0D 3K6GA 1BM9A 4UXNA 4ASNA 4BE1A 5J3LA 1ZHFA 4EMSA 4HSTA 4KJZA 2XSDC 2ZXHA 1XSVA 2DJNA 3KZZA 4UVCA 4RM2A 2HWVA 2EZLA 2F2EA 1AU7A 1W4MA 3BZ6A 5FFZA 5FFXA 4RGXA 3BJ6A 4V2GA 5GPCA 2PMHA 1VF9A 3TBIA 2KJBA 4AYBA 4EJTA 2P5KA 5H2FC 1ETYA 1GUUA 3HOZJ 1PJRA 3KP2A 3OSGA 1FMVA 2KPMA 4G9YA 3J80Z 1B72B 2C6YA 3JTHA 4E7IA 2QSHX 1LPQA 1BBYA 1HW2A 2ME0A 2RV8A 1SAXA 2P0WA 2X6YA 3TKYA 4OIOF 3GTPJ 2XHKA 3GZ5A 1MJBA 4BJTA 1KQ9A 4GRIA 4BKXA 4CUGA 2EV0A 4HYEA 4LMYA 3S15J 1R4NB 2E2HJ 1JUSA 5IP7J 4UNOA 2R7QA 1UELB 2PMZN 2EPFA 4BHCA 1F43A 3CCUI 1Z21A 2L54A 4OAZA 2D5VA 5CJ9A 1XGMA 3OYGA 3BR5A 1IV6A 4IQ4A 3HM5A 5E1XA 1ZLKA 4ENJA 3WTZA 3G4SI 3U1KA 1IN5A 1YLFA 5K5RA 4ZC3A 3CC2I 1HA8A 1T8IA 3HL2A 3HEFA 1LFPA 1W36C 4IHVA 3JSOA 1QZZA 3MKLA 3D1NI 3HOWJ 1WFXA 2G7UA 3DWLE 4PZJA 3W3CA 3M4OJ 5CKTA 5CQEA 5IOZA 2M0CA 3QRFF 3FBIB 2OZ6A 2YU9J 1I27A 2K7LA 5DTDA 2JA8J 1P4WA 1A31A 4FX0A 2MC4A 4GYGA 3NRVA 4KN7X 4M6XA 2CV1A 3QPHA 1ZK8A 2ZNZA 4YIRX 2O9LA 1RR7A 5JLWA 4R79A 4AVZA 4D5FA 2X6OA 2LF8A 5F08A 3DEEA 2COBA 3CLOA 4AIDA 5F64A 4I02A 4RDUA 4A0ZA 1YJNI 1R58A 5FKOA 2DMQA 2IGOA 2BXYA 3KX2A 3O8GA 4ON0A 3ZMSA 2L02A 2RQPA 1PYVA 3GF2A 3H92A 4PSWA 4XKVA 2M34A 2QQBA 2ZSHB 4IRIA 2EZKA 1TLHB 4WF2A 1JHHA 1Y1WJ 1I5ZA 1XGOA 1HF0A 4UB6C 3REOA 3V8JA 3KP6A 5E18F 1KQ8A 2LREA 2NVYJ 5E20A 4XN3A 3J80K 1MBHA 2JSPA 4IEJA 3IHUA 2GZWA 3CO7C 4C3HJ 1SD7A 4KT5C 2O0YA 1HSTA 2GXAA 1HQCA 1V4RA 1ETVA 1S5LC 3J7AO 3PQKA 3RIRA 2RN7A 4CH7A 4G94A 1ZR4A 1ZYRF 2CV2A 3FKIJ 1D0XA 1F5TA 1WGXA 4LLNA 1PDNC 5B66C 5D5VB 5DCFA 3K2AA 4I98B 3C1DA 2HOEA 3E5QA 1RUOA 2YR2A 2RAEA 3N4MA 2MW8A 3R60A 1FTTA 2L0KA 4MFEA 1R7JA 2CSOA 3KETA 1UCRA 1I1SA 2STWA 1VQ9I 1YQAA 3MKWB 3CC7I 2KP6A 3BJAA 4UHTA 2D1HA 1E2XA 1QNTA 3O3KA 5L3FA 1T38A 4HEA2 3JRIA 3CLQA 3TO6A 2E60A 2FF4A 2IW5A 4U0VA 4A12A 4Q5SF 5IP9J 1Z6RA 3RSNA 1KU2A 2DOAA 2ZJPF 2O8XA 3PIOF 4KFCA 4S0HB 2DA2A 3CMAI 1JUMA 4A3IJ 3G71I 1DPUA 2VJJA 1DP7P 1DGWY 1ETQA 2TRTA 3PM1A 1VQ8I 3PUFA 2V9VA 2NS8A 4A93J 1ZG5A 4CSWA 1K78A 2NOGA 2QUFA 4C2UA 3JRCA 3FHZA 3VWBA 2FOKA 4KITB 3NWSA 2WADA 3ZMVA 3OOPA 3SQNA 5J40A 2DT5A 2HQ5A 4L9JA 2H1KA 3FKJA 2YU3A 3O6BB 1W7PA 2FOWA 3KP7A 2JRTA 3JRHA 2AQEA 3SDGA 2CQXA 1LE8B 2LVSA 3VYRB 3MMYB 2L9SA 5D8LB 2EIKH 2HEOA 1K4TA 1VQLI 1FIPA 2FD5A 5D5XB 5DS9A 4L5JA 4BS9A 1O4XA 3BR3A 1B4AA 2EIJH 4J00A 2K9SA 3WTTC 3IWFA 1CF7A 2AXLA 2DYSH 1LFUP 3JRAA 4U0YA 1YIJI 5H6RA 2RREA
chains in the Genus database with same CATH topology
4M73A 3ZMDA 3KP5A 2PMUA 1P4XA 1FOKA 3MZHA 2YPRA 2HQRA 2JZYA 1V3FA 1J75A 3RKYA 4ZYDA 3HRMA 5TRDA 1K78B 2IVMA 4S05A 1H0MA 5CVUA 2EA4A 2GXGA 1UHMA 4KUMA 5E8GA 1FY7A 3WGHA 5D5WB 2NYXA 3ZN0A 4EV0A 5H6QA 3F8FA 1LQ1A 2Q8KA 2QVOA 1HBXG 3GFLA 5LHHA 3GX4X 4AWXB 1O3SA 2QQ9A 4CDGA 4U88A 1WWXA 1YFHA 3HSEA 1TQIA 5EEHA 2HZTA 1TW3A 3HTUA 2IT0A 3RKWA 1SFXA 1R23A 3K1NA 1D3YA 1U2WA 1J5YA 3E6BA 2W57A 5K5OA 1YW7A 2XV4S 3K69A 4HLYA 1FYLA 4WXCA 3KZYA 5IT3A 1MZBA 4IPAA 5J6XA 4EVIA 2DU9A 4GGGA 4EJOA 4LJZF 3LAPA 4UVAA 5JHUA 3BDDA 4HF2A 3Q9SA 2HYGD 3CUQA 1ZG3A 1Y0UA 2QM3A 1DDNA 1C0WA 4R1HA 1RIOH 2FE3A 5ICFA 1HXDA 4HX7A 4YIFA 5K5QA 2M45A 1XCVA 1ONVA 3IL2A 1O7LA 5D4SA 4AIKA 5HLGA 1OKRA 3IWZA 1ZGJA 2TDXA 1IUYA 5HLHA 1KA8A 1AWCA 1B59A 3GFJA 4GYIA 2P6TA 3DEUA 1T2KA 3I64A 3DPTA 1I6XA 5D6FA 1J9IA 1S29A 3F6VA 2EFNA 3HOTA 1O7FA 2RVCA 2EFOA 2E7XA 3CUQB 3V4GA 3CUOA 3S2WA 1F9NA 1ZRFA 5AIQA 3CUQC 1S7OA 1IZ1A 3HHGA 2P5LC 2M30A 3U9GA 4HX4A 2R7DA 4IHSA 3GFIA 1ZRDA 1TQPA 2KIFA 1R1UA 3FM3A 4KIGA 4PDKA 5JVTA 1FX7A 3LA3A 1OYIA 4M71A 3DQVC 1YYVA 5LHIA 1LEAA 4HQMA 3BPXA 5DCMA 3FMQA 3I53A 4L5IA 1KYZA 4YIIA 2XAGA 5LGNA 4JBAA 3CTAA 2IRFG 4XSXF 2HTJA 5ICGA 3RTRA 2O61A 1ON2A 3F6OA 1KU7A 4MTEA 3HSRA 2ISYA 4G7OF 3KLNA 2YSRA 3QPTA 4LFUA 1B1BA 3ZMUA 3F8NA 3BJOA 3M9AA 2HS5A 3L2CA 1LEBA 2DPUA 2D45A 2Z5UA 2EV5A 2P6SA 4PCQA 3WU0A 1OR7A 4OMZA 4OIPF 2XRNA 3R4KA 4IVNA 3GW2A 4PGGA 5FO5A 1LB2A 4EM1A 4ETSA 5BS6A 3ZPLA 3DF8A 3C18A 1FBUA 3E6DA 3E5UA 2XAJA 2HDCA 1WI9A 1YG2A 4H0EA 2OBPA 2QBYB 1WKMA 3GXOA 1XMAA 5L3CA 4DQ2A 5L3EA 1XMKA 4WWCA 2Z33A 3F8MA 3F22A 1SMTA 2Z3YA 5F6FA 2VOOA 1IAWA 3BWGA 2BYVE 3KE2A 3MCZA 4P55A 2WV0A 4EM0B 1Z6TA 4M6YA 1HSJA 1H9GA 2P5VA 3ZMZA 3HUGA 2M87A 4EGYA 2R7FA 3QP6A 4G6QA 1FYMA 3HRUA 4FT8A 4RGRA 2GA2A 4EGZA 3KEOA 4ZH4F 2CQKA 4M74A 3G3ZA 3FMSA 4MQ9F 4A2UA 1FPQA 4WXHA 5H20A 4O5VA 4NHJA 1G3WA 4S04A 3ABUA 3LQRA 3WTXC 3NEUA 1K6OA 3RYPA 2K02A 2ZNYA 5AIPA 1EV7A 2CYYA 3WGGA 5HDGA 2RDPA 3H3ZA 1R36A 3FZVA 3F8CA 4KIBA 1KYWA 1U5TA 1TBXA 1I1GA 2H94A 3NQOA 1XB4A 2DBBA 1EH6A 2MD5A 3E97A 2DI3A 3CJNA 5FD5A 2RC4A 1P6RA 1R1TA 2DK8A 4D0PA 2DQRA 2K86A 2W25A 2GQQA 3F3XA 3I54A 2JTVA 4HX8A 3WU1B 2RGVA 4A6EA 2ACJA 3H3UA 2VBYA 1IXRC 1PP7U 1W5SA 3TDZC 4B09A 4GCVA 3KP4A 3I5UA 2MH2A 1AOYA 1X3UA 5J8FA 2VC0A 1LDKB 4L9NA 3GWZA 4YFNF 1IRGA 5FGMA 4FHTA 1K7AA 1W7PD 5D6EA 4K2EA 5LHGA 1O3RA 2JT1A 2P4WA 3QU3A 5J8CA 2VONA 1ZH5A 3ROUA 3M7GA 2V1DA 3WE2A 2OZUA 3E6MA 1UB9A 2JPCA 1L0OC 5DDGA 6PAXA 3HSFA 1Z7UA 3ELKA 5D5UB 2PI0A 2FMLA 4HDUA 3I4PA 2GXBA 5HS9A 2HTSA 2QYOA 3N97A 3FXRA 1K79A 1HW5A 4JQFA 3BPVA 1BIAA 3JW4A 1LVAA 4RGSA 1YS6A 2Z9OA 2H6CA 4ENKA 1SMYF 4P5OA 2XASA 3K9TA 2EFWA 1IF1A 2XAQA 5HDKA 1P92A 2Y48A 2QENA 2XAHA 3ECHA 3E5XA 4HW0A 3E3VA 3V7SA 4HV6A 3TQNA 2KIMA 3LQQA 2DQLA 2F5FA 1YTYA 4WXDA 2H27A 4RS8A 1T98A 4MHGA 4KYWA 2UXXA 2H6BA 1QQIA 3K2ZA 2VE9A 2O3FA 3VODA 2GAUA 3HTSB 4RB2C 3ABTA 3M8EA 3VB2A 1FSHA 2A3SA 1LNWA 3V7RA 1XSDA 1Z1DA 2XUBA 4UVBA 2PJPA 5ERIA 3R6SA 1R5HA 3P7NA 2A61A 4YG2F 3QP5A 3FXQA 4RAZA 5K1YA 4OU0A 4NB5A 3GEZA 2P7VB 4KICA 5CLSA 2ESNA 1Z91A 3R0JA 2EFQA 4HF0A 2F5CA 1JE8A 4UV9A 1W7PB 1YS7A 2DFIA 3IC7A 1TQMA 4Y17A 1XN7A 5DV5A 5LEJA 4WCGA 3D0SA 2ETHA 4M9XA 1OYYA 3QU6A 4I0BA 1ZGAA 4AIHA 1CF7B 2JSCA 4AVPA 2DW4A 1HW1A 3ISPA 3R61A 2YX4A 4ESFA 4HV5A 4HQEA 2VC1A 4BH9A 2XROA 1TNSA 3JSPA 4F7ZA 3FM5A 1BC7C 1S3JA 2M5WA 3O2PE 1STZA 1LDDA 4RGUA 5LBQA 4FX4A 4CYDA 4XSZF 1J2XA 4LG0A 2IJLA 4HDVA 1Q1HA 2OD5A 2KRFA 5BPDA 2ZCWA 1J7KA 4MGRA 2DAOA 2W24A 4L9TA 1KU9A 2P8TA 2R3SA 4MQVA 4ESJA 2P7CB 2KIUA 2UXNA 5LLQA 1D8KA 1R00A 3EETA 1BN5A 3RYRA 4KNYA 5HLIA 2WTEA 5HDNA 3L7WA 2W84A 2GIVA 2G9WA 4ZYHA 3DKWA 1QGPA 3LA2A 2BE5F 2HQNA 4U7DA 1RUNA 1GHCA 3SZTA 4LG0B 3JTGA 1FYKA 5AONA 4BQAA 4EJVA 3V7CA 3JAMZ 3HIFA 1GXPA 3M8FA 3ZN1A 2FBHA 3G73A 4P9FA 4WK8F 2V1UA 1WQ2A 4L18B 4IXAA 3IRRA 5JFRA 4A0XA 3RDIA 4BAYA 2VOPA 2K4BA 2L4AA 2Q2EA 1S7AA 3EDPA 1KGSA 2RNJA 3BOQA 5JI6A 2FBIA 1U3EM 3QOPA 2F5DA 1GVJA 2XAFA 3F23A 2QWWA 4HZFA 2FRHA 3DXJF 1BI3A 1J59A 3FXUA 1FNNA 2FU4A 1ZREA 4Z2YA 1MJAA 3DPLC 4LGWA 3TO9A 3MWMA 2VBXA 3HRSA 3B73A 5DUKA 2XKPA 5EEGA 2FXAA 2VT2A 4I01A 3SZPA 4LLGF 5IT9Z 4MEXF 5BPIA 3GZ6A 2E1CA 2M8EA 4GXOA 3J81Z 4N9IA 3ECOA 3HYIA 3QAHA 1PUEE 1SD6A 1YW8A 2Y75A 2L4MA 2ZFWA 2OA4A 2NAZA 3VOEA 4G7ZF 2KKOA 3R0AA 1G6NA 2HKXA 1UFMA 2W85A 4P9UA 1DUXC 3KP3A 2O03A 2EB7A 1KQ0A 3SFZA 4OINF 3L00A 4KN4X 3IKTA 1ZG1A 4EJUA 4DNCA 4HF1A 1ON1A 5DCMB 3GYHX 2K27A 1SD4A 4I09A 1BI1A 3I59A 4P96A 5KVRA 1WSUA 3LSTA 2CGPA 2COMA 2LNBA 2VXZA 1B9MA 3C3WA 5ILSA 1FZPB 2ELHA 4M9SA 2VT3A 1FP1D 3MQ0A 1EH7A 2LDUA 5LEKA 3GUDA 3COAC 3TO7A 1D8JA 1ZRCA 5IT9K 3L9FA 3BROA 4LLLA 2CWEA 2LKPA 3I58A 3J81K 5ILVA 4AIJA 1U8RA 4GO1A 2A68F 1HKSA 5ICEA 4HOBA 1ZARA 2D1VA 1RZ4A 2QLZA 2ZBKA 1MKMA 3EYIA 3RKXA 4ZYEA 2IP2A 1ODDA 1IXCA 3TOBA 4RB0A 5E1ZB 4CHUA 5L3BA 2B0LA 1SD5A 4IHTA 1G3SA 3RPUA 5HOOA 4CZZA 1QBJA 2A6EF 4M72A 4MEYF 2FMYA 2MLKA 4NQWA 3ULQB 2VE8A 2HYFA 4BXUA 3LWFA 1VTNC 2ISZA 5E17F 4A0YA 2CO5A 5D8KB 3MFKA 2FNAA 3FF5A 5KK1A 3RPQA 2HGCA 2Q0OA 4KMUX 2X4HA 1XDUA 2K4JA 3GO5A 5CVJA 5BMZA 2XVCA 2LF7A 1BI0A 5CYVA 3K1PA 1IN4A 1DPRA 1R5GA 5TJJA 1ULYA 4LB5A 2VBWA 1G4DA 5FD6A 3P9KA 1XGSA 4CGZA 1BOAA 3L09A 3KFWX 1G3YA 3F8BA 5CVRA 5JR3A 3IRQA 4IRHA 3F72A 2NNYA 4A5MA 1U5TB 2A69F 1U6GA 1FP2A 3ZMTA 3GVAA 5HVQC 1U5TC 2EV6A 1XSXA 4ZZDA 2QQAA 2ZJ2A 3I0TA 4I2OA 1KU3A 3HOSA 3BY6A 1WRJA 3EYYA 4I0AA 1F4KA 4IF4A 5CVIA 5LGUA 1XD7A 1UHWA 1T6SA 1EH8A 3PFIA 3P9IA 1XCBA 1JGSA 3FWEA 2L3DA 1YIOA 2EJRA 3P9CA 5DEQA 2IPQX 4UV8A 4N9HA 2X0LA 1IN6A 2UZKA 1E17A 3K1MA 3GFMA 5E1WA 4O3MA 1QPMA 2Z99A 5E8IA 4JK1X 4G6DA 4CO8A 1NHAA 2DO7A 2BEOA 1SFUA 1OMIA 2CFXA 3PQJA 5FB2A 4RB3C 2E7WA 2PG4A 1H9TA 4EM2A 3LA7A 4OMYA 3RI4A 2XIGA 2EA2A 4ZZLA 2QZ8A 2WWYA 2CW0F 2H09A 2FQ3A 4L0YB 4PGHA 2A5YB 1U78A 2NRAC 2XKOA 3WODF 2PEXA 4ZYGA 5DD4A 3W6JB 2DK5A 3DV8A 4CXFA 1CGPA 4IJAA 1IN7A 2MBFA 2ZKZA 4G8XA 4M9ZA 3MZYA 1W5TA 4B8XA 3KLOA 2A07F 3U2RA 3U1DA 4UUVA 4A5NA 2Y0MA 1G3TA 5DD8A 1TTYA 3Q5FA 3WE3A 5D4RA 1REPC 3DP7A 1S8NA 2L01A 2MA3A 1ZAOA 2HFHA 2OAZA 5A2QZ 2D2WA 5LGTA 4LK0F 2LSOA 1P2FA 3TOAA 2STTA 3LFKA 2EK5A 2KJCA 3WG9A 4BHPA 1YO5C 5L3DA 4Q48A 1TNTA 3K0LA 1A04A 4ENMA 4G7HF 4MTDA 1B6AA 3F21A 1RNLA 3I71A 1BC8C 1XGNA 1IN8A 1PP8F 4RAYA 5DUIA 4Y15A 2ZXJA 2G7HA 3MEXA 4BYYA 4ESBA 5LRSA 2A6HF 2OU2A 1O3TA 2GWRA 2NS0A 1O3QA 3HRTA 3B02A 1FLIA 3IKVA 2EFPA 2O6GE 2VBZA 3RJPA 1QZYA 2FNPA 3V8KA 3WTWC 2FEZA 4Q4ZF 1ZLJA 3KEQA 5F1RA 3TGNA 4EQQA 2WC2A 3D5LA 4HAMA 5DYMA 3T8TA 5A2QK 3CDHA 4L9VA 1BJAA 5ICCA 3ZQ7A 1USTA 3SXYA 4XBFA 5HS7A 2PFBA 1R22A 1B9NA 2HKOA 4AD9A 3M1EA 2FSWA 4ENNA 2M1BA 1ZN2A 3SHFA 2ZO4A 3ERED 2RKHA 4BHBA 4YFXF 4OOIA 1LJ9A 4RB1A 3MAJA 5L3GA 3T0YA 5LRRA 2GA1A 1IRFA 3V8LA 1D5VA 2FBKA 2PN6A 5BQTA 3E6CC 4KDPA 1HKQA 1FT9A 2UWMA 2VODA 3CO6C 3EQLF 1RI7A 2ZMEA 2E1NA 2IA0A 1OPCA 1LDJA 4LD5A 2MH9A 2V79A 1T0FA 4R8HA 1O57A 4LK1F 1HKTA 4Y13A 1JHFA 4KIFA 2IA1A 4U0WA 1F1ZA 3JAMK 3WTUC 1FBQA 3VFZA 1FBSA 4OIRF 1MD0A 4XLNF 2YX7A 4IRGA 4EJWA 2ZMEB 3WTVC 4O6JA 5CVVA 2J5PA 2JPBA 4L0ZB 1GXQA 1TW2A 2CG4A 3T5XA 4CICA 2FA5A 2BV6A 3FX3A 4QWQA 2QBYA 1BIBA 2OQGA 1BI2A 1T39A 2V1XA 4N0BA 5HS8A 3VEPA 4I7HA 4WX9A 1MDMA 5FLXZ 1IXSB 3ML6A 2NNNA 2HR3A 3T8RA 2BGCA 4KA4A 2V6CA 1JXSA 2IA2A 2DPDA 2OQRA 4YFKF 1FC3A 2MLGA 4TV7A 1MJ9A 4HLXA 1P4AA 2PBIA 3OV8A 3EUHA 5ED4A 1R1VA 4KMFA 4BNCA 3ZP5A 4LB6B 1S6LA 1OYWA 3KCCA 1Z05A 4Q47A 2XGXA 3FMRA 3WGIA 4MNUA 3BP8A 2ADUA 4QLCU 3I59B 3DFGA 3TDUC 4XLPF 1L3LA 2AS5F 4XRFA 1MDMB 2J5OA 4HBLA 3HHHA 3WTSC 2VN2A 3Q9VA 4OIQF 5BOXA 3T1BA 4E70A 1MGTA 3LAJA 2BBYA 4HA8A 2PQ8A 2ESHA 1FSEA 1IW7F 1YW9A 4A6DA 2DLLA 2F5EA 4U7BA 3W6KB 2PLYA 1XDSA 2EWNA 3AAFA 5FLXK 1FWZA 5ILUA 1J0RA 1USSA 3C7JA 2DTRA 2MC3A 3WTYC 1Z9CA 3GLXA 1SFEA 1QO0D 1BM9A 4UXNA 4ASNA 1ZHFA 4EMSA 1XSVA 3KZZA 4UVCA 2HWVA 2F2EA 1W4MA 3BZ6A 5FFZA 5FFXA 4RGXA 3BJ6A 2PMHA 2KJBA 4EJTA 2P5KA 3KP2A 4G9YA 3J80Z 2C6YA 3JTHA 1BBYA 1HW2A 2RV8A 1SAXA 3TKYA 4OIOF 2XHKA 3GZ5A 1MJBA 1KQ9A 2EV0A 4HYEA 4LMYA 4UNOA 4BHCA 2L54A 5CJ9A 1XGMA 5E1XA 1ZLKA 4ENJA 3WTZA 1IN5A 1YLFA 5K5RA 3JSOA 1QZZA 2G7UA 4PZJA 3QRFF 2OZ6A 1I27A 2K7LA 1P4WA 4FX0A 4KN7X 4GYGA 3NRVA 4M6XA 3QPHA 2ZNZA 4R79A 2LF8A 3CLOA 5F64A 4I02A 4A0ZA 1R58A 4ON0A 3ZMSA 2L02A 2RQPA 3GF2A 3H92A 2QQBA 4IRIA 1TLHB 4WF2A 1JHHA 1I5ZA 1XGOA 3REOA 3V8JA 3KP6A 5E18F 1KQ8A 5E20A 3J80K 3IHUA 2GZWA 3CO7C 1SD7A 4KT5C 2O0YA 1HSTA 1HQCA 1V4RA 3J7AO 3PQKA 3RIRA 2RN7A 4G94A 1ZYRF 1F5TA 4LLNA 1PDNC 5D5VB 5DCFA 4I98B 3C1DA 2HOEA 3E5QA 1RUOA 2YR2A 3N4MA 3R60A 1R7JA 2CSOA 3KETA 1UCRA 1I1SA 2STWA 1YQAA 3BJAA 4UHTA 2D1HA 1E2XA 1QNTA 3O3KA 5L3FA 1T38A 3TO6A 2FF4A 2IW5A 4U0VA 4A12A 4Q5SF 1Z6RA 1KU2A 2O8XA 4KFCA 1DPUA 1DP7P 2V9VA 1ZG5A 1K78A 2QUFA 3FHZA 2FOKA 3ZMVA 3OOPA 3SQNA 2DT5A 4L9JA 2YU3A 3O6BB 1W7PA 3KP7A 2JRTA 5D8LB 2HEOA 5D5XB 4L5JA 1B4AA 3WTTC 1CF7A 3IWFA 2AXLA 4U0YA 5H6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M73 A;  3ZMD A;  3KP5 A;  2PMU A;  1P4X A;  1FOK A;  3MZH A;  2YPR A;  2HQR A;  2JZY A;  1V3F A;  1J75 A;  3RKY A;  4ZYD A;  3HRM A;  5TRD A;  1K78 B;  2IVM A;  4S05 A;  1H0M A;  5CVU A;  2EA4 A;  2GXG A;  1UHM A;  4KUM A;  5E8G A;  1FY7 A;  3WGH A;  5D5W B;  2NYX A;  3ZN0 A;  4EV0 A;  5H6Q A;  3F8F A;  1LQ1 A;  2Q8K A;  2QVO A;  1HBX G;  3GFL A;  5LHH A;  3GX4 X;  4AWX B;  1O3S A;  2QQ9 A;  4CDG A;  4U88 A;  1WWX A;  1YFH A;  3HSE A;  1TQI A;  5EEH A;  2HZT A;  1TW3 A;  3HTU A;  2IT0 A;  3RKW A;  1SFX A;  1R23 A;  3K1N A;  1D3Y A;  1U2W A;  1J5Y A;  3E6B A;  2W57 A;  5K5O A;  1YW7 A;  2XV4 S;  3K69 A;  4HLY A;  1FYL A;  4WXC A;  3KZY A;  5IT3 A;  1MZB A;  4IPA A;  5J6X A;  4EVI A;  2DU9 A;  4GGG A;  4EJO A;  4LJZ F;  3LAP A;  4UVA A;  5JHU A;  3BDD A;  4HF2 A;  3Q9S A;  2HYG D;  3CUQ A;  1ZG3 A;  1Y0U A;  2QM3 A;  1DDN A;  1C0W A;  4R1H A;  1RIO H;  2FE3 A;  5ICF A;  1HXD A;  4HX7 A;  4YIF A;  5K5Q A;  2M45 A;  1XCV A;  1ONV A;  3IL2 A;  1O7L A;  5D4S A;  4AIK A;  5HLG A;  1OKR A;  3IWZ A;  1ZGJ A;  2TDX A;  1IUY A;  5HLH A;  1KA8 A;  1AWC A;  1B59 A;  3GFJ A;  4GYI A;  2P6T A;  3DEU A;  1T2K A;  3I64 A;  3DPT A;  1I6X A;  5D6F A;  1J9I A;  1S29 A;  3F6V A;  2EFN A;  3HOT A;  1O7F A;  2RVC A;  2EFO A;  2E7X A;  3CUQ B;  3V4G A;  3CUO A;  3S2W A;  1F9N A;  1ZRF A;  5AIQ A;  3CUQ C;  1S7O A;  1IZ1 A;  3HHG A;  2P5L C;  2M30 A;  3U9G A;  4HX4 A;  2R7D A;  4IHS A;  3GFI A;  1ZRD A;  1TQP A;  2KIF A;  1R1U A;  3FM3 A;  4KIG A;  4PDK A;  5JVT A;  1FX7 A;  3LA3 A;  1OYI A;  4M71 A;  3DQV C;  1YYV A;  5LHI A;  1LEA A;  4HQM A;  3BPX A;  5DCM A;  3FMQ A;  3I53 A;  4L5I A;  1KYZ A;  4YII A;  2XAG A;  5LGN A;  4JBA A;  3CTA A;  2IRF G;  4XSX F;  2HTJ A;  5ICG A;  3RTR A;  2O61 A;  1ON2 A;  3F6O A;  1KU7 A;  4MTE A;  3HSR A;  2ISY A;  4G7O F;  3KLN A;  2YSR A;  3QPT A;  4LFU A;  1B1B A;  3ZMU A;  3F8N A;  3BJO A;  3M9A A;  2HS5 A;  3L2C A;  1LEB A;  2DPU A;  2D45 A;  2Z5U A;  2EV5 A;  2P6S A;  4PCQ A;  3WU0 A;  1OR7 A;  4OMZ A;  4OIP F;  2XRN A;  3R4K A;  4IVN A;  3GW2 A;  4PGG A;  5FO5 A;  1LB2 A;  4EM1 A;  4ETS A;  5BS6 A;  3ZPL A;  3DF8 A;  3C18 A;  1FBU A;  3E6D A;  3E5U A;  2XAJ A;  2HDC A;  1WI9 A;  1YG2 A;  4H0E A;  2OBP A;  2QBY B;  1WKM A;  3GXO A;  1XMA A;  5L3C A;  4DQ2 A;  5L3E A;  1XMK A;  4WWC A;  2Z33 A;  3F8M A;  3F22 A;  1SMT A;  2Z3Y A;  5F6F A;  2VOO A;  1IAW A;  3BWG A;  2BYV E;  3KE2 A;  3MCZ A;  4P55 A;  2WV0 A;  4EM0 B;  1Z6T A;  4M6Y A;  1HSJ A;  1H9G A;  2P5V A;  3ZMZ A;  3HUG A;  2M87 A;  4EGY A;  2R7F A;  3QP6 A;  4G6Q A;  1FYM A;  3HRU A;  4FT8 A;  4RGR A;  2GA2 A;  4EGZ A;  3KEO A;  4ZH4 F;  2CQK A;  4M74 A;  3G3Z A;  3FMS A;  4MQ9 F;  4A2U A;  1FPQ A;  4WXH A;  5H20 A;  4O5V A;  4NHJ A;  1G3W A;  4S04 A;  3ABU A;  3LQR A;  3WTX C;  3NEU A;  1K6O A;  3RYP A;  2K02 A;  2ZNY A;  5AIP A;  1EV7 A;  2CYY A;  3WGG A;  5HDG A;  2RDP A;  3H3Z A;  1R36 A;  3FZV A;  3F8C A;  4KIB A;  1KYW A;  1U5T A;  1TBX A;  1I1G A;  2H94 A;  3NQO A;  1XB4 A;  2DBB A;  1EH6 A;  2MD5 A;  3E97 A;  2DI3 A;  3CJN A;  5FD5 A;  2RC4 A;  1P6R A;  1R1T A;  2DK8 A;  4D0P A;  2DQR A;  2K86 A;  2W25 A;  2GQQ A;  3F3X A;  3I54 A;  2JTV A;  4HX8 A;  3WU1 B;  2RGV A;  4A6E A;  2ACJ A;  3H3U A;  2VBY A;  1IXR C;  1PP7 U;  1W5S A;  3TDZ C;  4B09 A;  4GCV A;  3KP4 A;  3I5U A;  2MH2 A;  1AOY A;  1X3U A;  5J8F A;  2VC0 A;  1LDK B;  4L9N A;  3GWZ A;  4YFN F;  1IRG A;  5FGM A;  4FHT A;  1K7A A;  1W7P D;  5D6E A;  4K2E A;  5LHG A;  1O3R A;  2JT1 A;  2P4W A;  3QU3 A;  5J8C A;  2VON A;  1ZH5 A;  3ROU A;  3M7G A;  2V1D A;  3WE2 A;  2OZU A;  3E6M A;  1UB9 A;  2JPC A;  1L0O C;  5DDG A;  6PAX A;  3HSF A;  1Z7U A;  3ELK A;  5D5U B;  2PI0 A;  2FML A;  4HDU A;  3I4P A;  2GXB A;  5HS9 A;  2HTS A;  2QYO A;  3N97 A;  3FXR A;  1K79 A;  1HW5 A;  4JQF A;  3BPV A;  1BIA A;  3JW4 A;  1LVA A;  4RGS A;  1YS6 A;  2Z9O A;  2H6C A;  4ENK A;  1SMY F;  4P5O A;  2XAS A;  3K9T A;  2EFW A;  1IF1 A;  2XAQ A;  5HDK A;  1P92 A;  2Y48 A;  2QEN A;  2XAH A;  3ECH A;  3E5X A;  4HW0 A;  3E3V A;  3V7S A;  4HV6 A;  3TQN A;  2KIM A;  3LQQ A;  2DQL A;  2F5F A;  1YTY A;  4WXD A;  2H27 A;  4RS8 A;  1T98 A;  4MHG A;  4KYW A;  2UXX A;  2H6B A;  1QQI A;  3K2Z A;  2VE9 A;  2O3F A;  3VOD A;  2GAU A;  3HTS B;  4RB2 C;  3ABT A;  3M8E A;  3VB2 A;  1FSH A;  2A3S A;  1LNW A;  3V7R A;  1XSD A;  1Z1D A;  2XUB A;  4UVB A;  2PJP A;  5ERI A;  3R6S A;  1R5H A;  3P7N A;  2A61 A;  4YG2 F;  3QP5 A;  3FXQ A;  4RAZ A;  5K1Y A;  4OU0 A;  4NB5 A;  3GEZ A;  2P7V B;  4KIC A;  5CLS A;  2ESN A;  1Z91 A;  3R0J A;  2EFQ A;  4HF0 A;  2F5C A;  1JE8 A;  4UV9 A;  1W7P B;  1YS7 A;  2DFI A;  3IC7 A;  1TQM A;  4Y17 A;  1XN7 A;  5DV5 A;  5LEJ A;  4WCG A;  3D0S A;  2ETH A;  4M9X A;  1OYY A;  3QU6 A;  4I0B A;  1ZGA A;  4AIH A;  1CF7 B;  2JSC A;  4AVP A;  2DW4 A;  1HW1 A;  3ISP A;  3R61 A;  2YX4 A;  4ESF A;  4HV5 A;  4HQE A;  2VC1 A;  4BH9 A;  2XRO A;  1TNS A;  3JSP A;  4F7Z A;  3FM5 A;  1BC7 C;  1S3J A;  2M5W A;  3O2P E;  1STZ A;  1LDD A;  4RGU A;  5LBQ A;  4FX4 A;  4CYD A;  4XSZ F;  1J2X A;  4LG0 A;  2IJL A;  4HDV A;  1Q1H A;  2OD5 A;  2KRF A;  5BPD A;  2ZCW A;  1J7K A;  4MGR A;  2DAO A;  2W24 A;  4L9T A;  1KU9 A;  2P8T A;  2R3S A;  4MQV A;  4ESJ A;  2P7C B;  2KIU A;  2UXN A;  5LLQ A;  1D8K A;  1R00 A;  3EET A;  1BN5 A;  3RYR A;  4KNY A;  5HLI A;  2WTE A;  5HDN A;  3L7W A;  2W84 A;  2GIV A;  2G9W A;  4ZYH A;  3DKW A;  1QGP A;  3LA2 A;  2BE5 F;  2HQN A;  4U7D A;  1RUN A;  1GHC A;  3SZT A;  4LG0 B;  3JTG A;  1FYK A;  5AON A;  4BQA A;  4EJV A;  3V7C A;  3JAM Z;  3HIF A;  1GXP A;  3M8F A;  3ZN1 A;  2FBH A;  3G73 A;  4P9F A;  4WK8 F;  2V1U A;  1WQ2 A;  4L18 B;  4IXA A;  3IRR A;  5JFR A;  4A0X A;  3RDI A;  4BAY A;  2VOP A;  2K4B A;  2L4A A;  2Q2E A;  1S7A A;  3EDP A;  1KGS A;  2RNJ A;  3BOQ A;  5JI6 A;  2FBI A;  1U3E M;  3QOP A;  2F5D A;  1GVJ A;  2XAF A;  3F23 A;  2QWW A;  4HZF A;  2FRH A;  3DXJ F;  1BI3 A;  1J59 A;  3FXU A;  1FNN A;  2FU4 A;  1ZRE A;  4Z2Y A;  1MJA A;  3DPL C;  4LGW A;  3TO9 A;  3MWM A;  2VBX A;  3HRS A;  3B73 A;  5DUK A;  2XKP A;  5EEG A;  2FXA A;  2VT2 A;  4I01 A;  3SZP A;  4LLG F;  5IT9 Z;  4MEX F;  5BPI A;  3GZ6 A;  2E1C A;  2M8E A;  4GXO A;  3J81 Z;  4N9I A;  3ECO A;  3HYI A;  3QAH A;  1PUE E;  1SD6 A;  1YW8 A;  2Y75 A;  2L4M A;  2ZFW A;  2OA4 A;  2NAZ A;  3VOE A;  4G7Z F;  2KKO A;  3R0A A;  1G6N A;  2HKX A;  1UFM A;  2W85 A;  4P9U A;  1DUX C;  3KP3 A;  2O03 A;  2EB7 A;  1KQ0 A;  3SFZ A;  4OIN F;  3L00 A;  4KN4 X;  3IKT A;  1ZG1 A;  4EJU A;  4DNC A;  4HF1 A;  1ON1 A;  5DCM B;  3GYH X;  2K27 A;  1SD4 A;  4I09 A;  1BI1 A;  3I59 A;  4P96 A;  5KVR A;  1WSU A;  3LST A;  2CGP A;  2COM A;  2LNB A;  2VXZ A;  1B9M A;  3C3W A;  5ILS A;  1FZP B;  2ELH A;  4M9S A;  2VT3 A;  1FP1 D;  3MQ0 A;  1EH7 A;  2LDU A;  5LEK A;  3GUD A;  3COA C;  3TO7 A;  1D8J A;  1ZRC A;  5IT9 K;  3L9F A;  3BRO A;  4LLL A;  2CWE A;  2LKP A;  3I58 A;  3J81 K;  5ILV A;  4AIJ A;  1U8R A;  4GO1 A;  2A68 F;  1HKS A;  5ICE A;  4HOB A;  1ZAR A;  2D1V A;  1RZ4 A;  2QLZ A;  2ZBK A;  1MKM A;  3EYI A;  3RKX A;  4ZYE A;  2IP2 A;  1ODD A;  1IXC A;  3TOB A;  4RB0 A;  5E1Z B;  4CHU A;  5L3B A;  2B0L A;  1SD5 A;  4IHT A;  1G3S A;  3RPU A;  5HOO A;  4CZZ A;  1QBJ A;  2A6E F;  4M72 A;  4MEY F;  2FMY A;  2MLK A;  4NQW A;  3ULQ B;  2VE8 A;  2HYF A;  4BXU A;  3LWF A;  1VTN C;  2ISZ A;  5E17 F;  4A0Y A;  2CO5 A;  5D8K B;  3MFK A;  2FNA A;  3FF5 A;  5KK1 A;  3RPQ A;  2HGC A;  2Q0O A;  4KMU X;  2X4H A;  1XDU A;  2K4J A;  3GO5 A;  5CVJ A;  5BMZ A;  2XVC A;  2LF7 A;  1BI0 A;  5CYV A;  3K1P A;  1IN4 A;  1DPR A;  1R5G A;  5TJJ A;  1ULY A;  4LB5 A;  2VBW A;  1G4D A;  5FD6 A;  3P9K A;  1XGS A;  4CGZ A;  1BOA A;  3L09 A;  3KFW X;  1G3Y A;  3F8B A;  5CVR A;  5JR3 A;  3IRQ A;  4IRH A;  3F72 A;  2NNY A;  4A5M A;  1U5T B;  2A69 F;  1U6G A;  1FP2 A;  3ZMT A;  3GVA A;  5HVQ C;  1U5T C;  2EV6 A;  1XSX A;  4ZZD A;  2QQA A;  2ZJ2 A;  3I0T A;  4I2O A;  1KU3 A;  3HOS A;  3BY6 A;  1WRJ A;  3EYY A;  4I0A A;  1F4K A;  4IF4 A;  5CVI A;  5LGU A;  1XD7 A;  1UHW A;  1T6S A;  1EH8 A;  3PFI A;  3P9I A;  1XCB A;  1JGS A;  3FWE A;  2L3D A;  1YIO A;  2EJR A;  3P9C A;  5DEQ A;  2IPQ X;  4UV8 A;  4N9H A;  2X0L A;  1IN6 A;  2UZK A;  1E17 A;  3K1M A;  3GFM A;  5E1W A;  4O3M A;  1QPM A;  2Z99 A;  5E8I A;  4JK1 X;  4G6D A;  4CO8 A;  1NHA A;  2DO7 A;  2BEO A;  1SFU A;  1OMI A;  2CFX A;  3PQJ A;  5FB2 A;  4RB3 C;  2E7W A;  2PG4 A;  1H9T A;  4EM2 A;  3LA7 A;  4OMY A;  3RI4 A;  2XIG A;  2EA2 A;  4ZZL A;  2QZ8 A;  2WWY A;  2CW0 F;  2H09 A;  2FQ3 A;  4L0Y B;  4PGH A;  2A5Y B;  1U78 A;  2NRA C;  2XKO A;  3WOD F;  2PEX A;  4ZYG A;  5DD4 A;  3W6J B;  2DK5 A;  3DV8 A;  4CXF A;  1CGP A;  4IJA A;  1IN7 A;  2MBF A;  2ZKZ A;  4G8X A;  4M9Z A;  3MZY A;  1W5T A;  4B8X A;  3KLO A;  2A07 F;  3U2R A;  3U1D A;  4UUV A;  4A5N A;  2Y0M A;  1G3T A;  5DD8 A;  1TTY A;  3Q5F A;  3WE3 A;  5D4R A;  1REP C;  3DP7 A;  1S8N A;  2L01 A;  2MA3 A;  1ZAO A;  2HFH A;  2OAZ A;  5A2Q Z;  2D2W A;  5LGT A;  4LK0 F;  2LSO A;  1P2F A;  3TOA A;  2STT A;  3LFK A;  2EK5 A;  2KJC A;  3WG9 A;  4BHP A;  1YO5 C;  5L3D A;  4Q48 A;  1TNT A;  3K0L A;  1A04 A;  4ENM A;  4G7H F;  4MTD A;  1B6A A;  3F21 A;  1RNL A;  3I71 A;  1BC8 C;  1XGN A;  1IN8 A;  1PP8 F;  4RAY A;  5DUI A;  4Y15 A;  2ZXJ A;  2G7H A;  3MEX A;  4BYY A;  4ESB A;  5LRS A;  2A6H F;  2OU2 A;  1O3T A;  2GWR A;  2NS0 A;  1O3Q A;  3HRT A;  3B02 A;  1FLI A;  3IKV A;  2EFP A;  2O6G E;  2VBZ A;  3RJP A;  1QZY A;  2FNP A;  3V8K A;  3WTW C;  2FEZ A;  4Q4Z F;  1ZLJ A;  3KEQ A;  5F1R A;  3TGN A;  4EQQ A;  2WC2 A;  3D5L A;  4HAM A;  5DYM A;  3T8T A;  5A2Q K;  3CDH A;  4L9V A;  1BJA A;  5ICC A;  3ZQ7 A;  1UST A;  3SXY A;  4XBF A;  5HS7 A;  2PFB A;  1R22 A;  1B9N A;  2HKO A;  4AD9 A;  3M1E A;  2FSW A;  4ENN A;  2M1B A;  1ZN2 A;  3SHF A;  2ZO4 A;  3ERE D;  2RKH A;  4BHB A;  4YFX F;  4OOI A;  1LJ9 A;  4RB1 A;  3MAJ A;  5L3G A;  3T0Y A;  5LRR A;  2GA1 A;  1IRF A;  3V8L A;  1D5V A;  2FBK A;  2PN6 A;  5BQT A;  3E6C C;  4KDP A;  1HKQ A;  1FT9 A;  2UWM A;  2VOD A;  3CO6 C;  3EQL F;  1RI7 A;  2ZME A;  2E1N A;  2IA0 A;  1OPC A;  1LDJ A;  4LD5 A;  2MH9 A;  2V79 A;  1T0F A;  4R8H A;  1O57 A;  4LK1 F;  1HKT A;  4Y13 A;  1JHF A;  4KIF A;  2IA1 A;  4U0W A;  1F1Z A;  3JAM K;  3WTU C;  1FBQ A;  3VFZ A;  1FBS A;  4OIR F;  1MD0 A;  4XLN F;  2YX7 A;  4IRG A;  4EJW A;  2ZME B;  3WTV C;  4O6J A;  5CVV A;  2J5P A;  2JPB A;  4L0Z B;  1GXQ A;  1TW2 A;  2CG4 A;  3T5X A;  4CIC A;  2FA5 A;  2BV6 A;  3FX3 A;  4QWQ A;  2QBY A;  1BIB A;  2OQG A;  1BI2 A;  1T39 A;  2V1X A;  4N0B A;  5HS8 A;  3VEP A;  4I7H A;  4WX9 A;  1MDM A;  5FLX Z;  1IXS B;  3ML6 A;  2NNN A;  2HR3 A;  3T8R A;  2BGC A;  4KA4 A;  2V6C A;  1JXS A;  2IA2 A;  2DPD A;  2OQR A;  4YFK F;  1FC3 A;  2MLG A;  4TV7 A;  1MJ9 A;  4HLX A;  1P4A A;  2PBI A;  3OV8 A;  3EUH A;  5ED4 A;  1R1V A;  4KMF A;  4BNC A;  3ZP5 A;  4LB6 B;  1S6L A;  1OYW A;  3KCC A;  1Z05 A;  4Q47 A;  2XGX A;  3FMR A;  3WGI A;  4MNU A;  3BP8 A;  2ADU A;  4QLC U;  3I59 B;  3DFG A;  3TDU C;  4XLP F;  1L3L A;  2AS5 F;  4XRF A;  1MDM B;  2J5O A;  4HBL A;  3HHH A;  3WTS C;  2VN2 A;  3Q9V A;  4OIQ F;  5BOX A;  3T1B A;  4E70 A;  1MGT A;  3LAJ A;  2BBY A;  4HA8 A;  2PQ8 A;  2ESH A;  1FSE A;  1IW7 F;  1YW9 A;  4A6D A;  2DLL A;  2F5E A;  4U7B A;  3W6K B;  2PLY A;  1XDS A;  2EWN A;  3AAF A;  5FLX K;  1FWZ A;  5ILU A;  1J0R A;  1USS A;  3C7J A;  2DTR A;  2MC3 A;  3WTY C;  1Z9C A;  3GLX A;  1SFE A;  1QO0 D;  1BM9 A;  4UXN A;  4ASN A;  1ZHF A;  4EMS A;  1XSV A;  3KZZ A;  4UVC A;  2HWV A;  2F2E A;  1W4M A;  3BZ6 A;  5FFZ A;  5FFX A;  4RGX A;  3BJ6 A;  2PMH A;  2KJB A;  4EJT A;  2P5K A;  3KP2 A;  4G9Y A;  3J80 Z;  2C6Y A;  3JTH A;  1BBY A;  1HW2 A;  2RV8 A;  1SAX A;  3TKY A;  4OIO F;  2XHK A;  3GZ5 A;  1MJB A;  1KQ9 A;  2EV0 A;  4HYE A;  4LMY A;  4UNO A;  4BHC A;  2L54 A;  5CJ9 A;  1XGM A;  5E1X A;  1ZLK A;  4ENJ A;  3WTZ A;  1IN5 A;  1YLF A;  5K5R A;  3JSO A;  1QZZ A;  2G7U A;  4PZJ A;  3QRF F;  2OZ6 A;  1I27 A;  2K7L A;  1P4W A;  4FX0 A;  4KN7 X;  4GYG A;  3NRV A;  4M6X A;  3QPH A;  2ZNZ A;  4R79 A;  2LF8 A;  3CLO A;  5F64 A;  4I02 A;  4A0Z A;  1R58 A;  4ON0 A;  3ZMS A;  2L02 A;  2RQP A;  3GF2 A;  3H92 A;  2QQB A;  4IRI A;  1TLH B;  4WF2 A;  1JHH A;  1I5Z A;  1XGO A;  3REO A;  3V8J A;  3KP6 A;  5E18 F;  1KQ8 A;  5E20 A;  3J80 K;  3IHU A;  2GZW A;  3CO7 C;  1SD7 A;  4KT5 C;  2O0Y A;  1HST A;  1HQC A;  1V4R A;  3J7A O;  3PQK A;  3RIR A;  2RN7 A;  4G94 A;  1ZYR F;  1F5T A;  4LLN A;  1PDN C;  5D5V B;  5DCF A;  4I98 B;  3C1D A;  2HOE A;  3E5Q A;  1RUO A;  2YR2 A;  3N4M A;  3R60 A;  1R7J A;  2CSO A;  3KET A;  1UCR A;  1I1S A;  2STW A;  1YQA A;  3BJA A;  4UHT A;  2D1H A;  1E2X A;  1QNT A;  3O3K A;  5L3F A;  1T38 A;  3TO6 A;  2FF4 A;  2IW5 A;  4U0V A;  4A12 A;  4Q5S F;  1Z6R A;  1KU2 A;  2O8X A;  4KFC A;  1DPU A;  1DP7 P;  2V9V A;  1ZG5 A;  1K78 A;  2QUF A;  3FHZ A;  2FOK A;  3ZMV A;  3OOP A;  3SQN A;  2DT5 A;  4L9J A;  2YU3 A;  3O6B B;  1W7P A;  3KP7 A;  2JRT A;  5D8L B;  2HEO A;  5D5X B;  4L5J A;  1B4A A;  3WTT C;  1CF7 A;  3IWF A;  2AXL A;  4U0Y A;  5H6R A; 
#chains in the Genus database with same CATH topology
 4M73 A;  3ZMD A;  3KP5 A;  2PMU A;  1D0Z A;  1P4X A;  5EZH A;  3MZH A;  2KZG A;  1FOK A;  2YPR A;  3VSL A;  1YRN B;  2HQR A;  3CCE I;  2JZY A;  1V3F A;  3G1L A;  1J75 A;  3RKY A;  4ZYD A;  3HRM A;  5DM7 F;  5DM6 F;  2CQQ A;  5TRD A;  1K78 B;  2IVM A;  4S05 A;  1YJW I;  2A6T A;  1H0M A;  5CVU A;  4V19 K;  2EA4 A;  2GXG A;  4C9Y A;  1UHM A;  4KUM A;  4KT6 A;  5E8G A;  1FY7 A;  2E1O A;  3WGH A;  1JJ6 C;  5D5W B;  2NYX A;  3ZN0 A;  4EV0 A;  5J1Y A;  2Y2Z A;  5H6Q A;  5IYD J;  4B1R A;  1YI2 I;  2VIX A;  3F8F A;  1LQ1 A;  2Q8K A;  2QVO A;  4AC0 A;  1HBX G;  3GFL A;  5LHH A;  3GX4 X;  4IHW A;  4AWX B;  4F93 B;  5GP9 A;  1VZ0 A;  1Z0X A;  1IO2 A;  1O3S A;  2QQ9 A;  4CDG A;  4U88 A;  1WWX A;  3U21 A;  1D1C A;  1FOY A;  1YFH A;  2ZXW H;  3HSE A;  1TQI A;  2DMP A;  5EEH A;  1X1P A;  2HZT A;  1TW3 A;  3HTU A;  1OCC H;  3IAM 2;  2O5R A;  1XC5 A;  2IT0 A;  3NWT A;  3RKW A;  3RCO A;  2LY1 A;  2VPR A;  1SFX A;  1R23 A;  3K1N A;  1D3Y A;  1U2W A;  4JYK A;  3LL7 A;  4BU2 A;  3MVP A;  1J5Y A;  2HZD A;  4FQG A;  3E6B A;  2W57 A;  5K5O A;  1Y39 A;  1YW7 A;  5HNH A;  4PFP A;  2XV4 S;  3S8P A;  1APL C;  3CES A;  3LNQ A;  3K69 A;  1YX5 A;  4CCO A;  1MMA A;  4HLY A;  4ZTF A;  1FYL A;  4WXC A;  5EZG A;  4X0G A;  1XS9 A;  2W1O A;  2HPI A;  3BLY A;  4RA2 A;  1D1A A;  2F4I A;  4UUS A;  3KZY A;  4ZDO A;  1X1C A;  1UG2 A;  4GFB A;  5IT3 A;  1MZB A;  2VKH A;  4IPA A;  4E7S A;  1QZE A;  3LSG A;  3QYB A;  2LY2 A;  5J6X A;  4EVI A;  1MNM C;  2DU9 A;  4GGG A;  4EJO A;  4XL9 A;  5K7Z A;  5FKM A;  2ID6 A;  4LJZ F;  1X4O A;  5KCM A;  3LAP A;  2X9D A;  3QWL A;  4UVA A;  1UJ8 A;  2WB1 A;  3V42 A;  3DTE A;  5JHU A;  3GTQ J;  2NVQ J;  2HPM A;  3BDD A;  4HF2 A;  3Q9S A;  2HYG D;  3PL8 A;  4DW6 A;  2O8K A;  3CUQ A;  1ZG3 A;  1Y0U A;  2QM3 A;  3EUA A;  2KQR A;  4MFD A;  3OY9 A;  1DDN A;  2H8R A;  1C0W A;  2LTP A;  3D5R C;  1UHS A;  3OIO A;  4R1H A;  1RIO H;  2FE3 A;  4JX5 A;  4D9J A;  5ICF A;  1Q1V A;  1HXD A;  3QPL A;  4JOM A;  2L7F P;  4HX7 A;  4YIF A;  5K5Q A;  2M45 A;  1XCV A;  2ELK A;  1ONV A;  4XLC A;  4BAC A;  2V1N A;  2DDB A;  1YJ9 I;  3IL2 A;  3DTK A;  2ZJR F;  1W1W E;  3IH3 A;  1O7L A;  5D4S A;  5HLG A;  4AIK A;  2F6C A;  1OKR A;  5EEA A;  1POG A;  4UUS B;  3K4C A;  3IWZ A;  4NDL A;  2R5Y A;  5LFA A;  1ZGJ A;  2TDX A;  1IUY A;  2HVQ A;  5HLH A;  2R4G A;  2IGM A;  1KA8 A;  1AWC A;  1B59 A;  2DFE A;  3GFJ A;  4GYI A;  2P6T A;  2OV7 A;  3DEU A;  3K4M A;  2OUM A;  1T2K A;  3I64 A;  3DPT A;  1I6X A;  5D6F A;  3W6V A;  1S29 A;  1J9I A;  3CCS I;  3F6V A;  3M3Y J;  4XKC A;  2H1L A;  3PO2 J;  2EFN A;  3HOT A;  1O7F A;  2L5Q A;  1X1B A;  3QQA A;  2OCC H;  2RVC A;  1BW6 A;  2EFO A;  5JHF A;  2E7X A;  3CUQ B;  3V4G A;  2QSF X;  2WY8 Q;  4B48 A;  1JT0 A;  3CUO A;  3S2W A;  1F9N A;  4W97 A;  1W0U A;  1ZRF A;  4E7Z A;  2WB1 N;  3CUQ C;  5AIQ A;  1S7O A;  1IZ1 A;  1RPW A;  3HHG A;  4JX4 A;  4LIU A;  2P5L C;  2M30 A;  3U9G A;  3UNG C;  4HX4 A;  4PJN A;  2R7D A;  1BR4 A;  5B5E C;  5FLM J;  4IHS A;  3GFI A;  1ZRD A;  1TQP A;  2KIF A;  1R1U A;  2R5Y B;  5C4X J;  3FM3 A;  4KIG A;  4PDK A;  5JVT A;  1FX7 A;  3LA3 A;  1OYI A;  2E2I J;  4DBR A;  2XGD A;  4M71 A;  3DQV C;  1YYV A;  3MZ8 A;  5LHI A;  1LEA A;  2ID3 A;  4C2M J;  4HQM A;  3BPX A;  2K5C A;  5DCM A;  3FMQ A;  3I53 A;  4L5I A;  1KYZ A;  2QGU A;  3DLA A;  5E3L A;  3HGY A;  4YII A;  2XAG A;  5LGN A;  4JBA A;  4A3B J;  3CTA A;  2IRF G;  4XSX F;  1E0E A;  2HTJ A;  3TP3 A;  3LSI A;  2KL4 A;  5ICG A;  3RTR A;  2O61 A;  2DMU A;  4PUS A;  1ON2 A;  3F6O A;  1KU7 A;  1ITY A;  3CCR I;  4MTE A;  3OMY A;  5J4V A;  4E7L A;  1OCT C;  2DT6 A;  3HSR A;  2ISY A;  4G7O F;  4LIT A;  5GAH J;  1W36 D;  3KLN A;  2XPW A;  4F91 B;  1PUF A;  2YSR A;  3QPT A;  4LFU A;  1B1B A;  3ZMU A;  3F8N A;  1JUP A;  2HOT A;  1T0F C;  3BJO A;  3M8J A;  3M9A A;  2KLO A;  2HS5 A;  3H1C A;  3L2C A;  1TWF J;  1LEB A;  2XPV A;  2DPU A;  3IAS 2;  1UZC A;  2WAQ A;  2D45 A;  2Z5U A;  2EV5 A;  2P6S A;  5F27 A;  4PCQ A;  3WU0 A;  4C3J J;  3I9V 2;  4L5E A;  1OR7 A;  2DA6 A;  4XNF A;  4OMZ A;  4OIP F;  2XRN A;  3R4K A;  4IVN A;  3OYL A;  3GW2 A;  4PGG A;  3JCU C;  5FO5 A;  1LB2 A;  2M8G X;  3S32 A;  4EM1 A;  2AQF A;  5IYC J;  4BJ5 C;  4CCK A;  4ETS A;  5BS6 A;  3ZPL A;  3HOV J;  3DF8 A;  5GAE J;  3C18 A;  1FBU A;  4YEJ A;  3E6D A;  1VQN I;  4F55 A;  1HC8 A;  3E5U A;  2XAJ A;  2HDC A;  2W4S A;  2O7O A;  1WI9 A;  4XKB A;  1YG2 A;  3Q0W A;  4H0E A;  2F4M B;  2OBP A;  3AG4 H;  1CQT A;  3OYI A;  1D5Y A;  3ZQH A;  2QBY B;  1WKM A;  3GXO A;  1XMA A;  2Y9Z A;  4E7J A;  2X1C A;  2DOE A;  3DTI A;  2L9V A;  5L3C A;  4OAY A;  4DQ2 A;  1H88 C;  5L3E A;  1XMK A;  5J1U A;  3RZO J;  4WWC A;  2Z33 A;  3F8M A;  2HXO A;  3F22 A;  1SMT A;  1NH3 A;  5M5Y J;  2Z3Y A;  5F6F A;  2VOO A;  3IH4 A;  1V5F A;  1WJE A;  1IAW A;  4A3D J;  3BWG A;  2BYV E;  3KYC B;  2R7V A;  4M3G A;  4RAG A;  3KE2 A;  3MCZ A;  4P55 A;  2WV0 A;  1N78 A;  4EM0 B;  1XPX A;  1ACI A;  1Z6T A;  4M6Y A;  1HSJ A;  1H9G A;  2BY1 A;  2G0E A;  2L9N A;  2P5V A;  3ZMZ A;  3HUG A;  2M87 A;  2K3F A;  4EGY A;  2R7F A;  3FIS A;  3QP6 A;  4G6Q A;  5FKL A;  1FYM A;  2ME6 A;  5FRO A;  3TW6 A;  1A6Q A;  4Y4R A;  2IAI A;  3ZOB A;  3HRU A;  4BDZ A;  4FT8 A;  4RGR A;  2GA2 A;  4EGZ A;  1JI8 A;  3KEO A;  4ZH4 F;  4ABZ A;  2PMZ A;  2CQK A;  1HDP A;  4M74 A;  3G3Z A;  1Z67 A;  3FMS A;  4MQ9 F;  4A2U A;  4XK4 A;  1IDZ A;  1FPQ A;  3SEQ A;  1PVE A;  2VKE A;  2CW7 A;  2I5U A;  4WXH A;  1D1B A;  5H20 A;  3OYB A;  4O5V A;  4NHJ A;  1G3W A;  2VQC A;  4S04 A;  3ABU A;  3LQR A;  3IUO A;  1JGG A;  2LLK A;  3WTX C;  3NEU A;  2DA5 A;  1DGR M;  1K6O A;  4FCY A;  2XGC A;  4EAT A;  1WCM J;  3MKY B;  3RYP A;  2K02 A;  4HNV A;  3CP2 A;  1R71 A;  2ZNY A;  1A36 A;  3BZK A;  5AIP A;  1EV7 A;  2B63 J;  1WJB A;  2CYY A;  3WGG A;  5HDG A;  2RDP A;  1A6I A;  3A1Y A;  2UUZ A;  3H3Z A;  1R36 A;  3FZV A;  3F8C A;  4A3E J;  1IDY A;  4KIB A;  3OSF A;  1YIT I;  1KYW A;  3BZC A;  1U5T A;  1TBX A;  3BG3 A;  3C2G A;  4J19 A;  1BL0 A;  1I1G A;  2H94 A;  3NQO A;  1XB4 A;  4KIS A;  2CS3 A;  2DBB A;  1EH6 A;  2MD5 A;  3E97 A;  2DI3 A;  3CJN A;  5FD5 A;  1V5E A;  2RC4 A;  1P6R A;  1R1T A;  4FET A;  1ETK A;  4ZDP A;  2DK8 A;  4D0P A;  2PX9 A;  2DQR A;  2K86 A;  2W25 A;  3LFU A;  2GQQ A;  3F3X A;  1MH3 A;  2JTV A;  3I54 A;  4BQN A;  4HX8 A;  3WU1 B;  2RGV A;  4ITV A;  4A6E A;  2ACJ A;  2OPT A;  3H3U A;  2VBY A;  2XRL A;  2GM4 A;  4BXX J;  3H9G A;  1IXR C;  2ZXI A;  1PP7 U;  1W5S A;  3TDZ C;  2R7T A;  1T33 A;  4B09 A;  1IRX A;  4GCV A;  1R4M B;  3OR1 C;  3C2B A;  3KP4 A;  3I5U A;  1SVM A;  1I3A A;  4XLF A;  5KHD A;  2MH2 A;  2E19 A;  1AOY A;  1X3U A;  2CUJ A;  5J8F A;  3L2V A;  1WJF A;  2VC0 A;  1LDK B;  3K4B A;  4L9N A;  4BY7 J;  3GWZ A;  4YFN F;  1IRG A;  1JKP C;  5FGM A;  4FHT A;  2XAU A;  1K7A A;  3OL4 A;  4FTH A;  1W7P D;  5D6E A;  4IOC F;  4LOC A;  4K2E A;  4XLA A;  5LHG A;  1O3R A;  5E79 C;  4P1W A;  2JT1 A;  3WHB A;  2P4W A;  3WHC A;  3QU3 A;  2VAS A;  3S3O A;  5J8C A;  4BY1 J;  2VON A;  1ZH5 A;  3KZI C;  1XG1 A;  3ROU A;  3M7G A;  4A3F J;  2V1D A;  2VB6 A;  3CZ6 A;  3WE2 A;  2IS6 A;  1VQP I;  2K9L A;  4BE0 A;  2OZU A;  4PSX A;  3E6M A;  1UB9 A;  4HG2 A;  2JPC A;  1L0O C;  5B3S H;  5DDG A;  6PAX A;  3HSF A;  1Z7U A;  3ELK A;  5D5U B;  2PI0 A;  1GT0 C;  1G59 A;  1GVD A;  2FML A;  3TMO A;  4HDU A;  3FBN B;  3ONQ A;  3I4P A;  4XMY A;  2X6X A;  2GXB A;  5HS9 A;  5M3M J;  1QA6 A;  4XQF A;  3S2D J;  5HOD A;  2HTS A;  3E1S A;  4B3X A;  2QYO A;  3N97 A;  2QEX I;  3DKX A;  3N05 A;  3FXR A;  1U0J A;  1K79 A;  4AU7 A;  1HW5 A;  1VQM I;  2EZI A;  4B43 A;  4JQF A;  3BPV A;  1BIA A;  3JW4 A;  1LVA A;  4RGS A;  1YS6 A;  2WA0 A;  4A3J J;  2Z9O A;  2H6C A;  3H9Q A;  5KNL A;  4ENK A;  4I6Z A;  3S1M J;  5F1J A;  4DBQ A;  1SMY F;  3P5J A;  3H5R A;  1QVT A;  2Y69 H;  4P5O A;  2M7A A;  1DP3 A;  4PJM A;  2XAS A;  3K9T A;  2EFW A;  1IF1 A;  2XAQ A;  3M07 A;  3MN2 A;  3DLL F;  1TWH J;  4QTR A;  5EYR A;  4E6K G;  5HDK A;  1P92 A;  3IH2 A;  2Y31 A;  2Y48 A;  3A03 A;  1TP4 A;  2QEN A;  3AL0 B;  5FLV A;  2DA1 A;  2XAH A;  3ECH A;  3E5X A;  4DYQ A;  3SFI A;  4HW0 A;  3B6A A;  3E3V A;  3V7S A;  5HNF A;  3VSK A;  4HV6 A;  3TQN A;  2KIM A;  2GOM A;  3LOC A;  3LQQ A;  3NAU A;  1W0T A;  2R7Z J;  1IV8 A;  4CYC A;  2CU7 A;  3RKQ A;  4NBQ A;  2AXT C;  2DQL A;  2F5F A;  1MND A;  1YTY A;  1EF4 A;  2B7E A;  4WXD A;  2H27 A;  1FOX A;  3A0B C;  2E71 A;  4RS8 A;  4XLH A;  1QU3 A;  1T98 A;  4MHG A;  3H9J A;  4II2 A;  1H8A C;  4KYW A;  2UXX A;  2NVU B;  4AUX A;  2H6B A;  1QQI A;  2JQ7 A;  1JKQ C;  1FEX A;  4C3I J;  3K2Z A;  3FDY A;  5E3M A;  2VE9 A;  2LD5 A;  2O3F A;  2X1E A;  1TC3 C;  3VOD A;  2GAU A;  3LSH A;  3HTS B;  4RB2 C;  1Y0N A;  3ZRG A;  2HYJ A;  4C30 A;  3ABT A;  3ZQI A;  3M8E A;  4D7N A;  4HNU A;  3VB2 A;  1FSH A;  2A3S A;  5TGT A;  1LNW A;  3FK6 A;  1Z77 A;  3OYC A;  2LR8 A;  3V7R A;  1XSD A;  1Z1D A;  2LKS A;  4DIQ A;  2XUB A;  4UVB A;  4ANJ A;  2PJP A;  5F0F A;  5ERI A;  3PNY A;  5IPA A;  2JA5 J;  4II3 A;  2L7M P;  3R6S A;  1R5H A;  3P7N A;  2A61 A;  4YG2 F;  3JRG A;  3QP5 A;  3FXQ A;  4XM3 A;  1MBG A;  5EG0 A;  3HPG A;  4RAZ A;  2DYR H;  5K1Y A;  3CMY A;  4OU0 A;  4NB5 A;  1UG0 A;  3SEZ A;  2VLA A;  3GEZ A;  4NC8 A;  5JVG F;  2L2O A;  3WG7 H;  2DFF A;  3BCB A;  5F0C A;  1LFB A;  2P7V B;  4KIC A;  2OCE A;  5CLS A;  2ESN A;  2M4K A;  1ETX A;  5C3E J;  1Z91 A;  2V26 A;  3HZJ A;  3R0J A;  4XRS A;  2EFQ A;  4HF0 A;  2F5C A;  4B47 A;  1JE8 A;  1OCO H;  4UV9 A;  1W7P B;  3DBL B;  3S2H J;  1YS7 A;  2DFI A;  3IC7 A;  2KZV A;  1B8I A;  5TIS C;  4RAF A;  1S72 I;  1TQM A;  5IY5 H;  4Y17 A;  1XN7 A;  3J7Z I;  1K61 A;  1FJL A;  3HXL A;  5DV5 A;  5LEJ A;  4WCG A;  3D0S A;  2ETH A;  2JRM A;  2QCO A;  4M9X A;  1OYY A;  4ZYA A;  3KYD B;  3QU6 A;  2MSY A;  4I0B A;  1ZGA A;  4AIH A;  1Y1V J;  2Y0S A;  3OYF A;  2JSC A;  4AVP A;  1CF7 B;  3PIP F;  2DW4 A;  1HCR A;  2WY7 Q;  1HW1 A;  2CUZ A;  3A0H C;  1JT6 A;  4IZZ A;  1A5J A;  1ZKG A;  3BTL A;  1OJL A;  3ISP A;  3R61 A;  5M5W J;  2X51 A;  2YX4 A;  3H5N A;  4ESF A;  4HV5 A;  2F4O B;  4HQE A;  1AKH A;  2VC1 A;  2IS2 A;  2JA2 A;  2GIZ A;  2KIS A;  2R7S A;  4BH9 A;  2LP0 A;  2XRO A;  1TNS A;  3CQZ J;  3JSP A;  4F7Z A;  3FM5 A;  2A5W A;  3WU2 C;  4B4C A;  2DA7 A;  1BC7 C;  2NVX J;  3HDD A;  4IO9 F;  1ETO A;  1S3J A;  4IL6 C;  2M5W A;  3ABM H;  3I56 I;  1MBE A;  3O2P E;  4DZP A;  1STZ A;  1LDD A;  2L7K A;  2VXD A;  4RGU A;  5LBQ A;  4FX4 A;  4CYD A;  4XSZ F;  1J09 A;  1J2X A;  1GV2 A;  4LG0 A;  4BGD A;  1Z7L A;  2IJL A;  2Y30 A;  4HDV A;  1Q1H A;  3RZD J;  2OD5 A;  1B8I B;  2KRF A;  2N8G A;  5BPD A;  4IQJ A;  1XTA A;  2ZCW A;  4MO7 A;  1J7K A;  4MGR A;  2DAO A;  2W24 A;  4L9T A;  1DU0 A;  1KU9 A;  3FXL A;  4F92 B;  4BEH A;  2B9S A;  2P8T A;  2DN0 A;  2R3S A;  3I4N J;  4MQV A;  4ESJ A;  2P7C B;  2KIU A;  3OYJ A;  2UXN A;  1V54 H;  5LLQ A;  3OS0 A;  5M3F J;  4I99 C;  5FKK A;  1D8K A;  2R7X A;  2CH0 A;  1R00 A;  3EET A;  1SAU A;  1BN5 A;  3S14 J;  3IV5 A;  3RYR A;  1AKH B;  4KNY A;  1GDT A;  5HLI A;  2CV0 A;  2WTE A;  5HDN A;  2XC7 A;  3L7W A;  2W84 A;  2VJI A;  2Y0S N;  1X1A A;  2G9W A;  2GIV A;  4ZYH A;  3KYL A;  3DKW A;  1QGP A;  4IHY A;  3LA2 A;  2BE5 F;  3Q3S A;  3L1P A;  2HQN A;  4U7D A;  1RUN A;  1GHC A;  1HLV A;  1MBK A;  3UKG A;  3SZT A;  4LG0 B;  3JTG A;  1FYK A;  1MBJ A;  2R7U A;  5AON A;  4BQA A;  4EJV A;  3V7C A;  3JAM Z;  3PSF A;  3HIF A;  1GXP A;  3M8F A;  3CCM I;  4B3A A;  3ZN1 A;  3CF2 A;  2HOS A;  2FBH A;  2WBM A;  3CDL A;  4PJ0 C;  4HPQ A;  2K3P A;  5GTH C;  3G73 A;  4P9F A;  4WK8 F;  2W48 A;  1WQ2 A;  2V1U A;  4L18 B;  1ZR2 A;  3BQZ A;  4IXA A;  3IRR A;  5LD2 C;  5JFR A;  2QA4 I;  4A0X A;  3KEY A;  1N77 A;  3RDI A;  4BAY A;  2VOP A;  4BQO A;  2W7N A;  2LOO A;  3VYS B;  3OYD A;  2K4B A;  2Q2E A;  2L4A A;  1S7A A;  3EDP A;  4H4K C;  1KGS A;  2RNJ A;  3BOQ A;  1LKX A;  2FBI A;  5JI6 A;  4RLF A;  1U3E M;  2ZB9 A;  2W82 A;  3QOP A;  2A05 A;  5FRM A;  1X2N A;  2F5D A;  2R92 J;  2XF5 A;  3HOU J;  3L2U A;  2XGE A;  1WJD A;  1GVJ A;  3HBL A;  1SVO A;  1U9O A;  2XAF A;  3S1Q J;  3F23 A;  2QWW A;  2KT0 A;  3GLL A;  1RRJ A;  4HZF A;  2FRH A;  2BY2 A;  3DXJ F;  1BI3 A;  2BY3 A;  3OS1 A;  1J59 A;  2ZJQ F;  3FXU A;  2HOA A;  1FNN A;  3HJE A;  2EIM H;  4A69 C;  2F5V A;  2XDV A;  4F3Q A;  4XIC A;  4CA0 A;  2FU4 A;  1MNE A;  3LSM A;  1ZRE A;  2ZFU A;  1I3Q J;  4Z2Y A;  1MJA A;  4E4H A;  3GTK J;  3DPL C;  4MLO A;  4LGW A;  3TO9 A;  3MWM A;  2VBX A;  3HRS A;  3CCQ I;  3ZR8 X;  1MH4 A;  3B73 A;  5DUK A;  4PFO A;  1H89 C;  2XKP A;  2BHZ A;  1ZTR A;  5EEG A;  3A4C A;  1NG7 A;  5CPR B;  1ZEL A;  2FXA A;  2Q2E B;  2LH9 A;  2LKX A;  5CQG A;  2VT2 A;  3F9K A;  4I01 A;  5K7H A;  3SZP A;  4LLG F;  5IT9 Z;  4MEX F;  5BPI A;  3OYE A;  3GZ6 A;  2E1C A;  4ZJZ A;  2DFH A;  2M8E A;  4GXO A;  3J81 Z;  4N9I A;  3ECO A;  3HYI A;  3ZQG A;  3QAH A;  1PUE E;  1SD6 A;  1YW8 A;  2DDA A;  4M6V A;  1TWA J;  2Y75 A;  5EF6 A;  2L4M A;  2ZFW A;  2OA4 A;  1X19 A;  3BR2 A;  2NAZ A;  3GTJ J;  3VOE A;  4G7Z F;  4Y3O A;  5B1B H;  2KKO A;  3R0A A;  2CQN A;  1G6N A;  2JA7 J;  2HKX A;  4IKF A;  2CW8 A;  3DBR B;  1WHU A;  1UFM A;  3BG9 A;  3OS2 A;  5EGO A;  2XB5 A;  2W85 A;  4P9U A;  2DOF A;  2MGQ A;  5GPA A;  1DUX C;  3JR9 A;  4BJ6 C;  3KP3 A;  2O03 A;  2XF6 A;  3CDI A;  2EB7 A;  1KQ0 A;  1X2M A;  3SFZ A;  2MFZ A;  4OIN F;  1VI0 A;  3L00 A;  4KN4 X;  3IKT A;  1ZG1 A;  4N4N B;  4EJU A;  1UMQ A;  4DNC A;  2DOD A;  2XB0 X;  1WJC A;  2X48 A;  3I3L A;  3BTC A;  2HVR A;  4HF1 A;  1ON1 A;  1V5G A;  5DCM B;  2DTZ A;  3GYH X;  2K27 A;  2HDW A;  2H8W A;  4C2T A;  1SD4 A;  2LYC A;  4I09 A;  1BI1 A;  1FMW A;  2LY9 A;  3I59 A;  3I55 I;  4P96 A;  3OL3 A;  1HOM A;  5KVR A;  1WSU A;  2HQA A;  4BQQ A;  2RNG A;  3DU6 A;  3LST A;  5IOY A;  2BY0 A;  2COM A;  2CGP A;  2LNB A;  4BE2 A;  2VXZ A;  1B9M A;  1ZQ3 P;  1YE9 A;  3C3W A;  1X4P A;  3LMM A;  5ILS A;  3CCL I;  1FZP B;  2ELH A;  1SFO J;  4M9S A;  2ECC A;  2VT3 A;  1FP1 D;  1F36 A;  3MQ0 A;  3NAR A;  1HDD C;  1EH7 A;  1X1D A;  2LDU A;  3UR3 C;  2KMU A;  1I39 A;  5LEK A;  3GUD A;  4A3M J;  1PUF B;  3COA C;  1NK3 P;  3CJT B;  2QF7 A;  5E3N A;  3TO7 A;  1D8J A;  3BG7 A;  1ZRC A;  5IT9 K;  2NOJ B;  3L9F A;  3BR1 A;  3BRO A;  4LLL A;  2CWE A;  3HG9 A;  2LKP A;  3I58 A;  4BBR J;  3J81 K;  2IXS A;  5ILV A;  4AIJ A;  1FOW A;  1U8R A;  2GOX B;  3ZQQ A;  2MYS A;  3OYN A;  5M5X J;  4GO1 A;  4G12 A;  1JJ8 C;  3ZGK A;  2A68 F;  1OR7 C;  2KFD A;  1HKS A;  1BR1 A;  5ICE A;  4HOB A;  2OTJ I;  1ZAR A;  3AG3 H;  3TW7 A;  3ZQF A;  2D1V A;  1RZ4 A;  2IEK A;  2QLZ A;  2HXI A;  2Z2S B;  2ZBK A;  2EBI A;  1MKM A;  3EYI A;  2IS1 A;  3RKX A;  4ZYE A;  2BZT A;  3AFH A;  4QIW N;  2IP2 A;  3L2Q A;  1ODD A;  1WH7 A;  1IXC A;  4JP0 A;  3ZXS A;  1E3O C;  3K4L A;  1EA3 A;  3TOB A;  4RB0 A;  3S17 J;  5E1Z B;  4CHU A;  5L3B A;  2B0L A;  1NG6 A;  1SD5 A;  1G3S A;  3RPU A;  2QSG X;  4IHT A;  1WVR A;  5HOO A;  2E34 A;  2EIL H;  4CZZ A;  2HI3 A;  3L2R A;  3FXK A;  4V2F A;  1R6R A;  4DJA A;  1QBJ A;  1TT5 B;  2A6E F;  4M72 A;  1SVL A;  3CJR B;  4MEY F;  2FMY A;  2MLK A;  4NQW A;  3ULQ B;  2CFO A;  1R9T J;  1VQ7 I;  1M1E B;  2K9M A;  2BVM A;  1BR2 A;  2VE8 A;  2HYF A;  4BXU A;  2KHM A;  3X2Q H;  3LWF A;  1VTN C;  2ISZ A;  3SJM A;  3MD2 A;  4CCL A;  1BOB A;  3S16 J;  5E17 F;  3OIQ A;  4XN0 A;  4A0Y A;  4GDF A;  2CO5 A;  2I8D A;  1OFC X;  2R7O A;  3SYT A;  3K70 D;  2GLO A;  5D8K B;  3HUG B;  1MW7 A;  2JVH A;  3MKZ A;  1Y6I A;  1E3H A;  3MFK A;  5KAF C;  4XID A;  3FHN A;  2M0M A;  2ZC2 A;  2ELJ A;  3KIO A;  3PNT A;  2FNA A;  3FF5 A;  5KK1 A;  3G1O A;  3RPQ A;  2HGC A;  2Q0O A;  4KMU X;  2X4H A;  1XDU A;  2K4J A;  4XOR A;  4XR6 A;  1QPI A;  2XSJ C;  3GO5 A;  5CVJ A;  5BMZ A;  3BCA A;  2NVT J;  5K7F A;  1T56 A;  2XVC A;  1RKT A;  3OYH A;  2LMD A;  2ZSI B;  2LF7 A;  2R7R A;  1BI0 A;  5BNG A;  1OCP A;  2NS7 A;  5CYV A;  3K1P A;  2MD0 A;  4CCN A;  1IN4 A;  3FXO A;  1DPR A;  1R5G A;  4RMN A;  4AM3 A;  3FK7 A;  2CUE A;  5TJJ A;  1TWC J;  1ULY A;  2JMW A;  2Q1Z B;  3AKZ A;  4NQW B;  4LB5 A;  2VBW A;  1G4D A;  5FD6 A;  3P9K A;  3JRD A;  3ERM A;  2YUS A;  1XGS A;  3D5S C;  1NK2 P;  4HRI A;  2JWT A;  1QHG A;  4M3B A;  4CGZ A;  1BOA A;  1AHD P;  3L09 A;  3KFW X;  1G3Y A;  2Z1D A;  3F8B A;  5CVR A;  5JR3 A;  1DU6 A;  3IRQ A;  2CUF A;  4IRH A;  3BTI A;  2CRG A;  3ASO H;  3F72 A;  3ZCO A;  2NNY A;  4A5M A;  1U5T B;  4XKW A;  2A69 F;  1G8X A;  4BUP A;  1U6G A;  2CQ7 A;  4LG3 A;  1FP2 A;  1MMN A;  4Y52 J;  3ZMT A;  1RKW A;  3DKY A;  3GTM J;  3GVA A;  5FJ8 J;  4M3D A;  5HVQ C;  1RC9 A;  2VUM J;  3QYE A;  1U5T C;  2EV6 A;  4PK4 A;  1EJ9 A;  1XSX A;  2MG4 A;  2V6E A;  3TP0 A;  4ZZD A;  4NUB A;  2QQA A;  2ZJ2 A;  2EIN H;  3I0T A;  2Z16 A;  4I2O A;  3DEW A;  1KU3 A;  3HOS A;  1IC8 A;  2BVL A;  1WH5 A;  3BY6 A;  1WRJ A;  2EZH A;  3EYY A;  1SC7 A;  1LVK A;  1MMS A;  4I0A A;  1F4K A;  4IF4 A;  4E7H A;  3LSK A;  3GTG J;  2JUG A;  5CVI A;  5LGU A;  2K9Q A;  5J4Y A;  3EUK L;  1ENH A;  4AYB N;  1XD7 A;  2KIQ A;  1X3W B;  1UHW A;  1T6S A;  1EH8 A;  3ESW B;  2HVS A;  3PFI A;  3BG6 A;  3P9I A;  1P9Q C;  2CMP A;  1XCB A;  1JGS A;  3BR6 A;  3FWE A;  2M4G A;  2L3D A;  1YIO A;  2EJR A;  2HDD A;  3P9C A;  1MSE C;  3CJQ B;  5DEQ A;  3CME I;  2IPQ X;  4UV8 A;  3JRE A;  2IS4 A;  4A3C J;  3J7A Y;  5C4J J;  2OC6 A;  3QPS A;  4N9H A;  2X0L A;  1IN6 A;  2KRH A;  1X58 A;  2UZK A;  4CCM A;  4HSR A;  3ABL H;  1U8B A;  1E17 A;  3K1M A;  3GFM A;  5E1W A;  3H35 A;  3S93 A;  1YX3 A;  2VJ5 A;  4O3M A;  2DT7 B;  1QPM A;  2K9N A;  2Z99 A;  3CMM A;  2MAB A;  2RQQ A;  2V7F A;  5EJC A;  1WJA A;  5E8I A;  1VQ5 I;  4JK1 X;  3LSP A;  3A02 A;  4DGW B;  4M3F A;  4XRS G;  2VQH A;  1WJ5 A;  3KPH A;  4G6D A;  4CO8 A;  1NHA A;  2DO7 A;  2BEO A;  1RET A;  1SFU A;  1OMI A;  3E7L A;  3PNV A;  4UB8 C;  2CFX A;  1LE8 A;  3PQJ A;  4BDY A;  5FB2 A;  4RB3 C;  4QPO A;  4Z6Y A;  3AL0 C;  2BOL A;  4G6T B;  2E7W A;  2PG4 A;  2VKD A;  2XPU A;  4EM2 A;  1H9T A;  3CCY A;  1X3Z B;  2ICW G;  3LA7 A;  4OMY A;  3O8H A;  1T08 B;  3I4M J;  3RI4 A;  2VI6 A;  2XIG A;  2EA2 A;  3PFY A;  4PJL A;  3K4J A;  3GBG A;  3FXM A;  4ZZL A;  3QYF A;  5C44 J;  3L2W A;  2VPL A;  2QZ8 A;  1LUJ B;  2WWY A;  2VQL A;  2CW0 F;  2H09 A;  3G1M A;  1YRN A;  3K70 C;  2FQ3 A;  3DPU A;  3CD6 I;  4L0Y B;  4PGH A;  4I76 A;  2A5Y B;  2V9P A;  1U78 A;  2NRA C;  2M7B A;  2XKO A;  1VQ4 I;  5IP6 A;  3WOD F;  2PEX A;  4ZYG A;  5DD4 A;  3K7A J;  3W6J B;  2KDZ A;  5EDN A;  2OTL I;  1WPK A;  2DK5 A;  3DV8 A;  5IYB J;  4UUT A;  4CXF A;  1CGP A;  1Y56 A;  1Y8Q B;  4IJA A;  2K40 A;  3CCV I;  1OCZ H;  1IN7 A;  2MBF A;  1K83 J;  3CC4 I;  2OF7 A;  2ZKZ A;  2DMT A;  4G8X A;  4M9Z A;  3OYA A;  4CYC B;  2YS9 A;  2AO9 A;  3MZY A;  1W5T A;  4DZJ A;  2PJR A;  4B8X A;  4FAS D;  3KLO A;  2A07 F;  3AG2 H;  3U2R A;  2QKM B;  3U1D A;  3S1N J;  2FUG 2;  1OIS A;  1DQU A;  2W00 A;  4UUV A;  3IP4 B;  1SAN A;  4A5N A;  2Y0M A;  1Z3Y A;  1G3T A;  5DD8 A;  2WAE A;  1TTY A;  3Q5F A;  1OLT A;  2M9H A;  3VPR A;  3WE3 A;  4UY8 I;  5D4R A;  1REP C;  3DP7 A;  2QKL B;  1S8N A;  1XX5 A;  2L01 A;  5J1R A;  5GAG J;  2MA3 A;  2M2E A;  1ZAO A;  2HFH A;  2NXN B;  1U9N A;  2OAZ A;  4PJJ A;  4A3G J;  2HU9 A;  2P81 A;  3S3N A;  2FJ1 A;  4XOT A;  4Y7N J;  2BXZ A;  4RBO A;  2AHQ A;  3HPH A;  2D2W A;  5LGT A;  5A2Q Z;  1YOV B;  2JVG A;  1R5I D;  4LK0 F;  2LSO A;  3DCF A;  3CF5 F;  3W2V A;  1ETW A;  1P2F A;  3TOA A;  2STT A;  3LFK A;  2EK5 A;  3GME A;  5JLX A;  2KJC A;  1IGN A;  3WG9 A;  4BHP A;  3BT9 A;  2DA3 A;  4D7M A;  1YO5 C;  5L3D A;  2DA4 A;  3HGG A;  5EG0 B;  3W2A A;  4Q48 A;  1TNT A;  2JN6 A;  1TZL A;  3C2H A;  1BA5 A;  1ERD A;  1RR8 C;  3K0L A;  1A04 A;  2R5Z A;  1VQO I;  1XMX A;  4ENM A;  2PJR B;  1EKE A;  2E36 A;  1T95 A;  3GCM A;  4ZDL A;  4IOA F;  4G7H F;  4MTD A;  1B6A A;  3F21 A;  4CCJ A;  1RNL A;  1P7I A;  3I71 A;  1BC8 C;  2X85 A;  1XGN A;  3HKZ A;  1IN8 A;  2V4J C;  1PP8 F;  4RAY A;  5DUI A;  4Y15 A;  5GTI C;  2ZXJ A;  2G7H A;  1JTY A;  1S7E A;  3MEX A;  4BYY A;  4ESB A;  5LRS A;  2A6H F;  2OU2 A;  1O3T A;  3BQY A;  2GWR A;  2NS0 A;  1O3Q A;  1ORK A;  3HRT A;  1GV5 A;  2L7Z A;  3B02 A;  1FLI A;  4EEF G;  2EH3 A;  4YEL A;  1A35 A;  4RLQ A;  3K10 A;  3IKV A;  3VDX A;  2EFP A;  1KZH A;  2O6G E;  2VBZ A;  5FRN A;  3RJP A;  1QZY A;  2BW3 A;  2FNP A;  3ABK H;  4NC6 A;  3V8K A;  3WTW C;  1K4S A;  2FEZ A;  4Q4Z F;  4HNT A;  4FE4 A;  1ZLJ A;  3CCJ I;  3KEQ A;  2E2J J;  1VQ6 I;  2VJ4 A;  4XOP A;  3BTJ A;  3TGN A;  5F1R A;  2R5Z B;  1RES A;  4EQQ A;  2WC2 A;  3D5L A;  4HAM A;  3RQI A;  4NC7 A;  4A3K J;  1MMG A;  5DYM A;  1TWG J;  3T8T A;  5A2Q K;  4MIM A;  3GTO J;  3CDH A;  3OWT A;  4L9V A;  4NNJ A;  1BJA A;  5ICC A;  3EPZ A;  3ZQ7 A;  1GLN A;  4IHX A;  3GZN B;  1UST A;  2LK2 A;  3SXY A;  4XBF A;  2OJE D;  2E35 A;  5HS7 A;  3GTL J;  4BBS J;  3JRF A;  2PFB A;  1YHQ I;  1I6H J;  2E5Z A;  1I50 J;  1R22 A;  1B9N A;  2HKO A;  4XON A;  3OR2 C;  4RM3 A;  4AD9 A;  1D0Y A;  2JUC A;  3M1E A;  2FSW A;  4BEH B;  2R7W A;  3HKZ N;  3RQ4 A;  2IBD A;  4ENN A;  2M1B A;  1ZN2 A;  3SHF A;  2ZO4 A;  3ERE D;  3VYU B;  3JRB A;  1VFC A;  1TL8 A;  1UAA A;  2KRC A;  4LIV A;  1AA7 A;  1SEU A;  2ECB A;  2RKH A;  4BHB A;  4YFX F;  2BW3 B;  3B6C A;  4OOI A;  1LJ9 A;  3Q0V A;  5F0H A;  3H3V K;  1MIJ A;  3FXJ A;  3TL4 X;  4RB1 A;  4BL0 B;  3MAJ A;  5L3G A;  3T0Y A;  5LRR A;  1S9H A;  2GA1 A;  1IRF A;  3V8L A;  1D5V A;  1BW5 A;  2FBK A;  3OIP A;  2E1M B;  2V9K A;  1VQK I;  1KON A;  4U87 A;  1N25 A;  2PN6 A;  3G2B A;  3A2K A;  1JTX A;  1OQY A;  5FKN A;  5BQT A;  3E6C C;  4KDP A;  1HKQ A;  1FT9 A;  2VQG A;  1W5C C;  2UWM A;  2E1M C;  2VOD A;  2WV1 A;  2FX0 A;  3EQL F;  1V55 H;  3CO6 C;  1RI7 A;  2ZME A;  2E1N A;  2IA0 A;  1QHH D;  3LSR A;  2QQ8 A;  1MBF A;  4BXF A;  1OPC A;  1WI3 A;  1LDJ A;  4LD5 A;  5E3O A;  2MH9 A;  2V79 A;  1T0F A;  2X6W A;  1MSF C;  4R8H A;  1O57 A;  4LK1 F;  4YRV A;  1HKT A;  4Y13 A;  1ZGW A;  3M1C A;  1JHF A;  3BR0 A;  4FIS A;  4DYR A;  1G2H A;  4KIF A;  2IA1 A;  3BC8 A;  3QOD A;  4U0W A;  1F1Z A;  4QSH A;  4W1U A;  3K4N A;  3H0G J;  3OYM A;  4QPQ A;  4B44 A;  2IGN A;  3JAM K;  3WTU C;  3H5A A;  2FQ4 A;  1FBQ A;  1NTC A;  4JX6 A;  3VFZ A;  1FBS A;  4OIR F;  3RPU D;  4IX7 A;  2L9R A;  1MD0 A;  4XLN F;  2DMN A;  4XRM A;  5KAI C;  2LBF A;  3S3M A;  2YX7 A;  3A01 A;  4IRG A;  4F52 A;  4A3L J;  4EJW A;  1Y8R B;  1OCR H;  2K85 A;  4E7K A;  3PSI A;  2DCE A;  2ZME B;  3VYT B;  3HC7 A;  3WTV C;  4O6J A;  5CVV A;  2J5P A;  2JPB A;  4L0Z B;  3PJR A;  1GXQ A;  5GAD J;  1TW2 A;  2CG4 A;  3T5X A;  1SFK A;  4CIC A;  2ZME C;  2FA5 A;  3G6E I;  1MMD A;  2BV6 A;  3FX3 A;  4QWQ A;  1E3P A;  2VL8 A;  2QBY A;  1BIB A;  2OQG A;  4XLE A;  1BI2 A;  2TCT A;  1T39 A;  3OOU A;  2CJJ A;  3AG1 H;  2V1X A;  4N0B A;  5HS8 A;  3VEP A;  4X6A J;  4I7H A;  1IG7 A;  1WZ2 A;  4WX9 A;  1MDM A;  1IRZ A;  5FLX Z;  3H0D A;  2X1D A;  3HOY J;  1IXS B;  1N75 A;  3ML6 A;  2NNN A;  2HR3 A;  3T8R A;  3TED A;  2BGC A;  4KA4 A;  2LC2 A;  2V6C A;  1JXS A;  2IA2 A;  2LBF B;  2DPD A;  2OQR A;  4YFK F;  3A01 B;  2Y9Y A;  1FC3 A;  2IGK A;  2MLG A;  3HOX J;  1R49 A;  4TV7 A;  1MJ9 A;  2DXI A;  1FIA A;  3SZG A;  5EGO B;  2I10 A;  1FTZ A;  4HLX A;  1P4A A;  2PBI A;  3DU5 A;  2JK3 A;  3OV8 A;  3E0J B;  3EUH A;  5ED4 A;  3BG5 A;  1R1V A;  4KMF A;  3HB9 A;  3ASN H;  3ZP5 A;  4LB6 B;  1S6L A;  4BNC A;  1OYW A;  3KCC A;  2JJ7 A;  1JKR C;  3FIW A;  5B1A H;  1Z05 A;  1IUF A;  2KDO A;  4Q47 A;  2LRD A;  3PO3 J;  2XGX A;  3FMR A;  3WGI A;  3LSJ A;  3BP8 A;  4MNU A;  2E5N A;  2ADU A;  4QLC U;  4J01 A;  3I59 B;  3DFG A;  3TDU C;  2LG4 A;  4XLP F;  1L3L A;  2AS5 F;  4XRF A;  3J7Y J;  4ZTJ A;  1MDM B;  2J5O A;  4HBL A;  3HHH A;  3WTS C;  2VN2 A;  2R0Q C;  3H36 A;  3Q9V A;  2BHY A;  2DJI A;  4OIQ F;  5BOX A;  3T1B A;  2UV1 A;  2JA6 J;  2EQR A;  4E70 A;  1MGT A;  1Z3X A;  1P7J A;  1QRY A;  1IJW C;  5HLT A;  3LAJ A;  2BBY A;  3CP8 A;  4HA8 A;  4D5C A;  4D1Q A;  2PQ8 A;  4FE7 A;  2ESH A;  1JKO C;  3SDB A;  5J47 A;  1FSE A;  2LFB A;  3W2W A;  1BJZ A;  3K4K A;  3PUB A;  1IW7 F;  1YW9 A;  1QVU A;  2WAQ N;  4A6D A;  2DLL A;  1TT0 A;  1VND A;  2F5E A;  4X1E A;  4U7B A;  4OWR B;  3W6K B;  4DOZ A;  4M3E A;  2GBY A;  2XF7 A;  1B72 A;  2WAF A;  3EUH C;  2PLY A;  1K6Y A;  1XDS A;  2EWN A;  3AAF A;  2F48 A;  5FLX K;  1FWZ A;  3OYK A;  3Q0U A;  3QOE A;  5ILU A;  9ANT A;  4Y33 A;  1J0R A;  1USS A;  3C7J A;  2R93 J;  3F0C A;  3DBH B;  4CZC A;  2DTR A;  3ZQL A;  5F04 A;  2M3A A;  2MC3 A;  3WTY C;  1Z9C A;  4DYC A;  3GLX A;  2VKV A;  3ZQC A;  2HNH A;  3S1R J;  4N4O B;  1SFE A;  1QO0 D;  3K6G A;  1BM9 A;  4UXN A;  4ASN A;  4BE1 A;  5J3L A;  1ZHF A;  4EMS A;  4HST A;  4KJZ A;  2XSD C;  2ZXH A;  1XSV A;  2DJN A;  3KZZ A;  4UVC A;  4RM2 A;  2HWV A;  2EZL A;  2F2E A;  1AU7 A;  1W4M A;  3BZ6 A;  5FFZ A;  5FFX A;  4RGX A;  3BJ6 A;  4V2G A;  5GPC A;  2PMH A;  1VF9 A;  3TBI A;  2KJB A;  4AYB A;  4EJT A;  2P5K A;  5H2F C;  1ETY A;  1GUU A;  3HOZ J;  1PJR A;  3KP2 A;  3OSG A;  1FMV A;  2KPM A;  4G9Y A;  3J80 Z;  1B72 B;  2C6Y A;  3JTH A;  4E7I A;  2QSH X;  1LPQ A;  1BBY A;  1HW2 A;  2ME0 A;  2RV8 A;  1SAX A;  2P0W A;  2X6Y A;  3TKY A;  4OIO F;  3GTP J;  2XHK A;  3GZ5 A;  1MJB A;  4BJT A;  1KQ9 A;  4GRI A;  4BKX A;  4CUG A;  2EV0 A;  4HYE A;  4LMY A;  3S15 J;  1R4N B;  2E2H J;  1JUS A;  5IP7 J;  4UNO A;  2R7Q A;  1UEL B;  2PMZ N;  2EPF A;  4BHC A;  1F43 A;  3CCU I;  1Z21 A;  2L54 A;  4OAZ A;  2D5V A;  5CJ9 A;  1XGM A;  3OYG A;  3BR5 A;  1IV6 A;  4IQ4 A;  3HM5 A;  5E1X A;  1ZLK A;  4ENJ A;  3WTZ A;  3G4S I;  3U1K A;  1IN5 A;  1YLF A;  5K5R A;  4ZC3 A;  3CC2 I;  1HA8 A;  1T8I A;  3HL2 A;  3HEF A;  1LFP A;  1W36 C;  4IHV A;  3JSO A;  1QZZ A;  3MKL A;  3D1N I;  3HOW J;  1WFX A;  2G7U A;  3DWL E;  4PZJ A;  3W3C A;  3M4O J;  5CKT A;  5CQE A;  5IOZ A;  2M0C A;  3QRF F;  3FBI B;  2OZ6 A;  2YU9 J;  1I27 A;  2K7L A;  5DTD A;  2JA8 J;  1P4W A;  1A31 A;  4FX0 A;  2MC4 A;  4GYG A;  3NRV A;  4KN7 X;  4M6X A;  2CV1 A;  3QPH A;  1ZK8 A;  2ZNZ A;  4YIR X;  2O9L A;  1RR7 A;  5JLW A;  4R79 A;  4AVZ A;  4D5F A;  2X6O A;  2LF8 A;  5F08 A;  3DEE A;  2COB A;  3CLO A;  4AID A;  5F64 A;  4I02 A;  4RDU A;  4A0Z A;  1YJN I;  1R58 A;  5FKO A;  2DMQ A;  2IGO A;  2BXY A;  3KX2 A;  3O8G A;  4ON0 A;  3ZMS A;  2L02 A;  2RQP A;  1PYV A;  3GF2 A;  3H92 A;  4PSW A;  4XKV A;  2M34 A;  2QQB A;  2ZSH B;  4IRI A;  2EZK A;  1TLH B;  4WF2 A;  1JHH A;  1Y1W J;  1I5Z A;  1XGO A;  1HF0 A;  4UB6 C;  3REO A;  3V8J A;  3KP6 A;  5E18 F;  1KQ8 A;  2LRE A;  2NVY J;  5E20 A;  4XN3 A;  3J80 K;  1MBH A;  2JSP A;  4IEJ A;  3IHU A;  2GZW A;  3CO7 C;  4C3H J;  1SD7 A;  4KT5 C;  2O0Y A;  1HST A;  2GXA A;  1HQC A;  1V4R A;  1ETV A;  1S5L C;  3J7A O;  3PQK A;  3RIR A;  2RN7 A;  4CH7 A;  4G94 A;  1ZR4 A;  1ZYR F;  2CV2 A;  3FKI J;  1D0X A;  1F5T A;  1WGX A;  4LLN A;  1PDN C;  5B66 C;  5D5V B;  5DCF A;  3K2A A;  4I98 B;  3C1D A;  2HOE A;  3E5Q A;  1RUO A;  2YR2 A;  2RAE A;  3N4M A;  2MW8 A;  3R60 A;  1FTT A;  2L0K A;  4MFE A;  1R7J A;  2CSO A;  3KET A;  1UCR A;  1I1S A;  2STW A;  1VQ9 I;  1YQA A;  3MKW B;  3CC7 I;  2KP6 A;  3BJA A;  4UHT A;  2D1H A;  1E2X A;  1QNT A;  3O3K A;  5L3F A;  1T38 A;  4HEA 2;  3JRI A;  3CLQ A;  3TO6 A;  2E60 A;  2FF4 A;  2IW5 A;  4U0V A;  4A12 A;  4Q5S F;  5IP9 J;  1Z6R A;  3RSN A;  1KU2 A;  2DOA A;  2ZJP F;  2O8X A;  3PIO F;  4KFC A;  4S0H B;  2DA2 A;  3CMA I;  1JUM A;  4A3I J;  3G71 I;  1DPU A;  2VJJ A;  1DP7 P;  1DGW Y;  1ETQ A;  2TRT A;  3PM1 A;  1VQ8 I;  3PUF A;  2V9V A;  2NS8 A;  4A93 J;  1ZG5 A;  4CSW A;  1K78 A;  2NOG A;  2QUF A;  4C2U A;  3JRC A;  3FHZ A;  3VWB A;  2FOK A;  4KIT B;  3NWS A;  2WAD A;  3ZMV A;  3OOP A;  3SQN A;  5J40 A;  2DT5 A;  2HQ5 A;  4L9J A;  2H1K A;  3FKJ A;  2YU3 A;  3O6B B;  1W7P A;  2FOW A;  3KP7 A;  2JRT A;  3JRH A;  2AQE A;  3SDG A;  2CQX A;  1LE8 B;  2LVS A;  3VYR B;  3MMY B;  2L9S A;  5D8L B;  2EIK H;  2HEO A;  1K4T A;  1VQL I;  1FIP A;  2FD5 A;  5D5X B;  5DS9 A;  4L5J A;  4BS9 A;  1O4X A;  3BR3 A;  1B4A A;  2EIJ H;  4J00 A;  2K9S A;  3WTT C;  3IWF A;  1CF7 A;  2AXL A;  2DYS H;  1LFU P;  3JRA A;  4U0Y A;  1YIJ I;  5H6R A;  2RRE A; 
#chains in the Genus database with same CATH homology
 4M73 A;  3ZMD A;  3KP5 A;  2PMU A;  1P4X A;  1FOK A;  3MZH A;  2YPR A;  2HQR A;  2JZY A;  1V3F A;  1J75 A;  3RKY A;  4ZYD A;  3HRM A;  5TRD A;  1K78 B;  2IVM A;  4S05 A;  1H0M A;  5CVU A;  2EA4 A;  2GXG A;  1UHM A;  4KUM A;  5E8G A;  1FY7 A;  3WGH A;  5D5W B;  2NYX A;  3ZN0 A;  4EV0 A;  5H6Q A;  3F8F A;  1LQ1 A;  2Q8K A;  2QVO A;  1HBX G;  3GFL A;  5LHH A;  3GX4 X;  4AWX B;  1O3S A;  2QQ9 A;  4CDG A;  4U88 A;  1WWX A;  1YFH A;  3HSE A;  1TQI A;  5EEH A;  2HZT A;  1TW3 A;  3HTU A;  2IT0 A;  3RKW A;  1SFX A;  1R23 A;  3K1N A;  1D3Y A;  1U2W A;  1J5Y A;  3E6B A;  2W57 A;  5K5O A;  1YW7 A;  2XV4 S;  3K69 A;  4HLY A;  1FYL A;  4WXC A;  3KZY A;  5IT3 A;  1MZB A;  4IPA A;  5J6X A;  4EVI A;  2DU9 A;  4GGG A;  4EJO A;  4LJZ F;  3LAP A;  4UVA A;  5JHU A;  3BDD A;  4HF2 A;  3Q9S A;  2HYG D;  3CUQ A;  1ZG3 A;  1Y0U A;  2QM3 A;  1DDN A;  1C0W A;  4R1H A;  1RIO H;  2FE3 A;  5ICF A;  1HXD A;  4HX7 A;  4YIF A;  5K5Q A;  2M45 A;  1XCV A;  1ONV A;  3IL2 A;  1O7L A;  5D4S A;  4AIK A;  5HLG A;  1OKR A;  3IWZ A;  1ZGJ A;  2TDX A;  1IUY A;  5HLH A;  1KA8 A;  1AWC A;  1B59 A;  3GFJ A;  4GYI A;  2P6T A;  3DEU A;  1T2K A;  3I64 A;  3DPT A;  1I6X A;  5D6F A;  1J9I A;  1S29 A;  3F6V A;  2EFN A;  3HOT A;  1O7F A;  2RVC A;  2EFO A;  2E7X A;  3CUQ B;  3V4G A;  3CUO A;  3S2W A;  1F9N A;  1ZRF A;  5AIQ A;  3CUQ C;  1S7O A;  1IZ1 A;  3HHG A;  2P5L C;  2M30 A;  3U9G A;  4HX4 A;  2R7D A;  4IHS A;  3GFI A;  1ZRD A;  1TQP A;  2KIF A;  1R1U A;  3FM3 A;  4KIG A;  4PDK A;  5JVT A;  1FX7 A;  3LA3 A;  1OYI A;  4M71 A;  3DQV C;  1YYV A;  5LHI A;  1LEA A;  4HQM A;  3BPX A;  5DCM A;  3FMQ A;  3I53 A;  4L5I A;  1KYZ A;  4YII A;  2XAG A;  5LGN A;  4JBA A;  3CTA A;  2IRF G;  4XSX F;  2HTJ A;  5ICG A;  3RTR A;  2O61 A;  1ON2 A;  3F6O A;  1KU7 A;  4MTE A;  3HSR A;  2ISY A;  4G7O F;  3KLN A;  2YSR A;  3QPT A;  4LFU A;  1B1B A;  3ZMU A;  3F8N A;  3BJO A;  3M9A A;  2HS5 A;  3L2C A;  1LEB A;  2DPU A;  2D45 A;  2Z5U A;  2EV5 A;  2P6S A;  4PCQ A;  3WU0 A;  1OR7 A;  4OMZ A;  4OIP F;  2XRN A;  3R4K A;  4IVN A;  3GW2 A;  4PGG A;  5FO5 A;  1LB2 A;  4EM1 A;  4ETS A;  5BS6 A;  3ZPL A;  3DF8 A;  3C18 A;  1FBU A;  3E6D A;  3E5U A;  2XAJ A;  2HDC A;  1WI9 A;  1YG2 A;  4H0E A;  2OBP A;  2QBY B;  1WKM A;  3GXO A;  1XMA A;  5L3C A;  4DQ2 A;  5L3E A;  1XMK A;  4WWC A;  2Z33 A;  3F8M A;  3F22 A;  1SMT A;  2Z3Y A;  5F6F A;  2VOO A;  1IAW A;  3BWG A;  2BYV E;  3KE2 A;  3MCZ A;  4P55 A;  2WV0 A;  4EM0 B;  1Z6T A;  4M6Y A;  1HSJ A;  1H9G A;  2P5V A;  3ZMZ A;  3HUG A;  2M87 A;  4EGY A;  2R7F A;  3QP6 A;  4G6Q A;  1FYM A;  3HRU A;  4FT8 A;  4RGR A;  2GA2 A;  4EGZ A;  3KEO A;  4ZH4 F;  2CQK A;  4M74 A;  3G3Z A;  3FMS A;  4MQ9 F;  4A2U A;  1FPQ A;  4WXH A;  5H20 A;  4O5V A;  4NHJ A;  1G3W A;  4S04 A;  3ABU A;  3LQR A;  3WTX C;  3NEU A;  1K6O A;  3RYP A;  2K02 A;  2ZNY A;  5AIP A;  1EV7 A;  2CYY A;  3WGG A;  5HDG A;  2RDP A;  3H3Z A;  1R36 A;  3FZV A;  3F8C A;  4KIB A;  1KYW A;  1U5T A;  1TBX A;  1I1G A;  2H94 A;  3NQO A;  1XB4 A;  2DBB A;  1EH6 A;  2MD5 A;  3E97 A;  2DI3 A;  3CJN A;  5FD5 A;  2RC4 A;  1P6R A;  1R1T A;  2DK8 A;  4D0P A;  2DQR A;  2K86 A;  2W25 A;  2GQQ A;  3F3X A;  3I54 A;  2JTV A;  4HX8 A;  3WU1 B;  2RGV A;  4A6E A;  2ACJ A;  3H3U A;  2VBY A;  1IXR C;  1PP7 U;  1W5S A;  3TDZ C;  4B09 A;  4GCV A;  3KP4 A;  3I5U A;  2MH2 A;  1AOY A;  1X3U A;  5J8F A;  2VC0 A;  1LDK B;  4L9N A;  3GWZ A;  4YFN F;  1IRG A;  5FGM A;  4FHT A;  1K7A A;  1W7P D;  5D6E A;  4K2E A;  5LHG A;  1O3R A;  2JT1 A;  2P4W A;  3QU3 A;  5J8C A;  2VON A;  1ZH5 A;  3ROU A;  3M7G A;  2V1D A;  3WE2 A;  2OZU A;  3E6M A;  1UB9 A;  2JPC A;  1L0O C;  5DDG A;  6PAX A;  3HSF A;  1Z7U A;  3ELK A;  5D5U B;  2PI0 A;  2FML A;  4HDU A;  3I4P A;  2GXB A;  5HS9 A;  2HTS A;  2QYO A;  3N97 A;  3FXR A;  1K79 A;  1HW5 A;  4JQF A;  3BPV A;  1BIA A;  3JW4 A;  1LVA A;  4RGS A;  1YS6 A;  2Z9O A;  2H6C A;  4ENK A;  1SMY F;  4P5O A;  2XAS A;  3K9T A;  2EFW A;  1IF1 A;  2XAQ A;  5HDK A;  1P92 A;  2Y48 A;  2QEN A;  2XAH A;  3ECH A;  3E5X A;  4HW0 A;  3E3V A;  3V7S A;  4HV6 A;  3TQN A;  2KIM A;  3LQQ A;  2DQL A;  2F5F A;  1YTY A;  4WXD A;  2H27 A;  4RS8 A;  1T98 A;  4MHG A;  4KYW A;  2UXX A;  2H6B A;  1QQI A;  3K2Z A;  2VE9 A;  2O3F A;  3VOD A;  2GAU A;  3HTS B;  4RB2 C;  3ABT A;  3M8E A;  3VB2 A;  1FSH A;  2A3S A;  1LNW A;  3V7R A;  1XSD A;  1Z1D A;  2XUB A;  4UVB A;  2PJP A;  5ERI A;  3R6S A;  1R5H A;  3P7N A;  2A61 A;  4YG2 F;  3QP5 A;  3FXQ A;  4RAZ A;  5K1Y A;  4OU0 A;  4NB5 A;  3GEZ A;  2P7V B;  4KIC A;  5CLS A;  2ESN A;  1Z91 A;  3R0J A;  2EFQ A;  4HF0 A;  2F5C A;  1JE8 A;  4UV9 A;  1W7P B;  1YS7 A;  2DFI A;  3IC7 A;  1TQM A;  4Y17 A;  1XN7 A;  5DV5 A;  5LEJ A;  4WCG A;  3D0S A;  2ETH A;  4M9X A;  1OYY A;  3QU6 A;  4I0B A;  1ZGA A;  4AIH A;  1CF7 B;  2JSC A;  4AVP A;  2DW4 A;  1HW1 A;  3ISP A;  3R61 A;  2YX4 A;  4ESF A;  4HV5 A;  4HQE A;  2VC1 A;  4BH9 A;  2XRO A;  1TNS A;  3JSP A;  4F7Z A;  3FM5 A;  1BC7 C;  1S3J A;  2M5W A;  3O2P E;  1STZ A;  1LDD A;  4RGU A;  5LBQ A;  4FX4 A;  4CYD A;  4XSZ F;  1J2X A;  4LG0 A;  2IJL A;  4HDV A;  1Q1H A;  2OD5 A;  2KRF A;  5BPD A;  2ZCW A;  1J7K A;  4MGR A;  2DAO A;  2W24 A;  4L9T A;  1KU9 A;  2P8T A;  2R3S A;  4MQV A;  4ESJ A;  2P7C B;  2KIU A;  2UXN A;  5LLQ A;  1D8K A;  1R00 A;  3EET A;  1BN5 A;  3RYR A;  4KNY A;  5HLI A;  2WTE A;  5HDN A;  3L7W A;  2W84 A;  2GIV A;  2G9W A;  4ZYH A;  3DKW A;  1QGP A;  3LA2 A;  2BE5 F;  2HQN A;  4U7D A;  1RUN A;  1GHC A;  3SZT A;  4LG0 B;  3JTG A;  1FYK A;  5AON A;  4BQA A;  4EJV A;  3V7C A;  3JAM Z;  3HIF A;  1GXP A;  3M8F A;  3ZN1 A;  2FBH A;  3G73 A;  4P9F A;  4WK8 F;  2V1U A;  1WQ2 A;  4L18 B;  4IXA A;  3IRR A;  5JFR A;  4A0X A;  3RDI A;  4BAY A;  2VOP A;  2K4B A;  2L4A A;  2Q2E A;  1S7A A;  3EDP A;  1KGS A;  2RNJ A;  3BOQ A;  5JI6 A;  2FBI A;  1U3E M;  3QOP A;  2F5D A;  1GVJ A;  2XAF A;  3F23 A;  2QWW A;  4HZF A;  2FRH A;  3DXJ F;  1BI3 A;  1J59 A;  3FXU A;  1FNN A;  2FU4 A;  1ZRE A;  4Z2Y A;  1MJA A;  3DPL C;  4LGW A;  3TO9 A;  3MWM A;  2VBX A;  3HRS A;  3B73 A;  5DUK A;  2XKP A;  5EEG A;  2FXA A;  2VT2 A;  4I01 A;  3SZP A;  4LLG F;  5IT9 Z;  4MEX F;  5BPI A;  3GZ6 A;  2E1C A;  2M8E A;  4GXO A;  3J81 Z;  4N9I A;  3ECO A;  3HYI A;  3QAH A;  1PUE E;  1SD6 A;  1YW8 A;  2Y75 A;  2L4M A;  2ZFW A;  2OA4 A;  2NAZ A;  3VOE A;  4G7Z F;  2KKO A;  3R0A A;  1G6N A;  2HKX A;  1UFM A;  2W85 A;  4P9U A;  1DUX C;  3KP3 A;  2O03 A;  2EB7 A;  1KQ0 A;  3SFZ A;  4OIN F;  3L00 A;  4KN4 X;  3IKT A;  1ZG1 A;  4EJU A;  4DNC A;  4HF1 A;  1ON1 A;  5DCM B;  3GYH X;  2K27 A;  1SD4 A;  4I09 A;  1BI1 A;  3I59 A;  4P96 A;  5KVR A;  1WSU A;  3LST A;  2CGP A;  2COM A;  2LNB A;  2VXZ A;  1B9M A;  3C3W A;  5ILS A;  1FZP B;  2ELH A;  4M9S A;  2VT3 A;  1FP1 D;  3MQ0 A;  1EH7 A;  2LDU A;  5LEK A;  3GUD A;  3COA C;  3TO7 A;  1D8J A;  1ZRC A;  5IT9 K;  3L9F A;  3BRO A;  4LLL A;  2CWE A;  2LKP A;  3I58 A;  3J81 K;  5ILV A;  4AIJ A;  1U8R A;  4GO1 A;  2A68 F;  1HKS A;  5ICE A;  4HOB A;  1ZAR A;  2D1V A;  1RZ4 A;  2QLZ A;  2ZBK A;  1MKM A;  3EYI A;  3RKX A;  4ZYE A;  2IP2 A;  1ODD A;  1IXC A;  3TOB A;  4RB0 A;  5E1Z B;  4CHU A;  5L3B A;  2B0L A;  1SD5 A;  4IHT A;  1G3S A;  3RPU A;  5HOO A;  4CZZ A;  1QBJ A;  2A6E F;  4M72 A;  4MEY F;  2FMY A;  2MLK A;  4NQW A;  3ULQ B;  2VE8 A;  2HYF A;  4BXU A;  3LWF A;  1VTN C;  2ISZ A;  5E17 F;  4A0Y A;  2CO5 A;  5D8K B;  3MFK A;  2FNA A;  3FF5 A;  5KK1 A;  3RPQ A;  2HGC A;  2Q0O A;  4KMU X;  2X4H A;  1XDU A;  2K4J A;  3GO5 A;  5CVJ A;  5BMZ A;  2XVC A;  2LF7 A;  1BI0 A;  5CYV A;  3K1P A;  1IN4 A;  1DPR A;  1R5G A;  5TJJ A;  1ULY A;  4LB5 A;  2VBW A;  1G4D A;  5FD6 A;  3P9K A;  1XGS A;  4CGZ A;  1BOA A;  3L09 A;  3KFW X;  1G3Y A;  3F8B A;  5CVR A;  5JR3 A;  3IRQ A;  4IRH A;  3F72 A;  2NNY A;  4A5M A;  1U5T B;  2A69 F;  1U6G A;  1FP2 A;  3ZMT A;  3GVA A;  5HVQ C;  1U5T C;  2EV6 A;  1XSX A;  4ZZD A;  2QQA A;  2ZJ2 A;  3I0T A;  4I2O A;  1KU3 A;  3HOS A;  3BY6 A;  1WRJ A;  3EYY A;  4I0A A;  1F4K A;  4IF4 A;  5CVI A;  5LGU A;  1XD7 A;  1UHW A;  1T6S A;  1EH8 A;  3PFI A;  3P9I A;  1XCB A;  1JGS A;  3FWE A;  2L3D A;  1YIO A;  2EJR A;  3P9C A;  5DEQ A;  2IPQ X;  4UV8 A;  4N9H A;  2X0L A;  1IN6 A;  2UZK A;  1E17 A;  3K1M A;  3GFM A;  5E1W A;  4O3M A;  1QPM A;  2Z99 A;  5E8I A;  4JK1 X;  4G6D A;  4CO8 A;  1NHA A;  2DO7 A;  2BEO A;  1SFU A;  1OMI A;  2CFX A;  3PQJ A;  5FB2 A;  4RB3 C;  2E7W A;  2PG4 A;  1H9T A;  4EM2 A;  3LA7 A;  4OMY A;  3RI4 A;  2XIG A;  2EA2 A;  4ZZL A;  2QZ8 A;  2WWY A;  2CW0 F;  2H09 A;  2FQ3 A;  4L0Y B;  4PGH A;  2A5Y B;  1U78 A;  2NRA C;  2XKO A;  3WOD F;  2PEX A;  4ZYG A;  5DD4 A;  3W6J B;  2DK5 A;  3DV8 A;  4CXF A;  1CGP A;  4IJA A;  1IN7 A;  2MBF A;  2ZKZ A;  4G8X A;  4M9Z A;  3MZY A;  1W5T A;  4B8X A;  3KLO A;  2A07 F;  3U2R A;  3U1D A;  4UUV A;  4A5N A;  2Y0M A;  1G3T A;  5DD8 A;  1TTY A;  3Q5F A;  3WE3 A;  5D4R A;  1REP C;  3DP7 A;  1S8N A;  2L01 A;  2MA3 A;  1ZAO A;  2HFH A;  2OAZ A;  5A2Q Z;  2D2W A;  5LGT A;  4LK0 F;  2LSO A;  1P2F A;  3TOA A;  2STT A;  3LFK A;  2EK5 A;  2KJC A;  3WG9 A;  4BHP A;  1YO5 C;  5L3D A;  4Q48 A;  1TNT A;  3K0L A;  1A04 A;  4ENM A;  4G7H F;  4MTD A;  1B6A A;  3F21 A;  1RNL A;  3I71 A;  1BC8 C;  1XGN A;  1IN8 A;  1PP8 F;  4RAY A;  5DUI A;  4Y15 A;  2ZXJ A;  2G7H A;  3MEX A;  4BYY A;  4ESB A;  5LRS A;  2A6H F;  2OU2 A;  1O3T A;  2GWR A;  2NS0 A;  1O3Q A;  3HRT A;  3B02 A;  1FLI A;  3IKV A;  2EFP A;  2O6G E;  2VBZ A;  3RJP A;  1QZY A;  2FNP A;  3V8K A;  3WTW C;  2FEZ A;  4Q4Z F;  1ZLJ A;  3KEQ A;  5F1R A;  3TGN A;  4EQQ A;  2WC2 A;  3D5L A;  4HAM A;  5DYM A;  3T8T A;  5A2Q K;  3CDH A;  4L9V A;  1BJA A;  5ICC A;  3ZQ7 A;  1UST A;  3SXY A;  4XBF A;  5HS7 A;  2PFB A;  1R22 A;  1B9N A;  2HKO A;  4AD9 A;  3M1E A;  2FSW A;  4ENN A;  2M1B A;  1ZN2 A;  3SHF A;  2ZO4 A;  3ERE D;  2RKH A;  4BHB A;  4YFX F;  4OOI A;  1LJ9 A;  4RB1 A;  3MAJ A;  5L3G A;  3T0Y A;  5LRR A;  2GA1 A;  1IRF A;  3V8L A;  1D5V A;  2FBK A;  2PN6 A;  5BQT A;  3E6C C;  4KDP A;  1HKQ A;  1FT9 A;  2UWM A;  2VOD A;  3CO6 C;  3EQL F;  1RI7 A;  2ZME A;  2E1N A;  2IA0 A;  1OPC A;  1LDJ A;  4LD5 A;  2MH9 A;  2V79 A;  1T0F A;  4R8H A;  1O57 A;  4LK1 F;  1HKT A;  4Y13 A;  1JHF A;  4KIF A;  2IA1 A;  4U0W A;  1F1Z A;  3JAM K;  3WTU C;  1FBQ A;  3VFZ A;  1FBS A;  4OIR F;  1MD0 A;  4XLN F;  2YX7 A;  4IRG A;  4EJW A;  2ZME B;  3WTV C;  4O6J A;  5CVV A;  2J5P A;  2JPB A;  4L0Z B;  1GXQ A;  1TW2 A;  2CG4 A;  3T5X A;  4CIC A;  2FA5 A;  2BV6 A;  3FX3 A;  4QWQ A;  2QBY A;  1BIB A;  2OQG A;  1BI2 A;  1T39 A;  2V1X A;  4N0B A;  5HS8 A;  3VEP A;  4I7H A;  4WX9 A;  1MDM A;  5FLX Z;  1IXS B;  3ML6 A;  2NNN A;  2HR3 A;  3T8R A;  2BGC A;  4KA4 A;  2V6C A;  1JXS A;  2IA2 A;  2DPD A;  2OQR A;  4YFK F;  1FC3 A;  2MLG A;  4TV7 A;  1MJ9 A;  4HLX A;  1P4A A;  2PBI A;  3OV8 A;  3EUH A;  5ED4 A;  1R1V A;  4KMF A;  4BNC A;  3ZP5 A;  4LB6 B;  1S6L A;  1OYW A;  3KCC A;  1Z05 A;  4Q47 A;  2XGX A;  3FMR A;  3WGI A;  4MNU A;  3BP8 A;  2ADU A;  4QLC U;  3I59 B;  3DFG A;  3TDU C;  4XLP F;  1L3L A;  2AS5 F;  4XRF A;  1MDM B;  2J5O A;  4HBL A;  3HHH A;  3WTS C;  2VN2 A;  3Q9V A;  4OIQ F;  5BOX A;  3T1B A;  4E70 A;  1MGT A;  3LAJ A;  2BBY A;  4HA8 A;  2PQ8 A;  2ESH A;  1FSE A;  1IW7 F;  1YW9 A;  4A6D A;  2DLL A;  2F5E A;  4U7B A;  3W6K B;  2PLY A;  1XDS A;  2EWN A;  3AAF A;  5FLX K;  1FWZ A;  5ILU A;  1J0R A;  1USS A;  3C7J A;  2DTR A;  2MC3 A;  3WTY C;  1Z9C A;  3GLX A;  1SFE A;  1QO0 D;  1BM9 A;  4UXN A;  4ASN A;  1ZHF A;  4EMS A;  1XSV A;  3KZZ A;  4UVC A;  2HWV A;  2F2E A;  1W4M A;  3BZ6 A;  5FFZ A;  5FFX A;  4RGX A;  3BJ6 A;  2PMH A;  2KJB A;  4EJT A;  2P5K A;  3KP2 A;  4G9Y A;  3J80 Z;  2C6Y A;  3JTH A;  1BBY A;  1HW2 A;  2RV8 A;  1SAX A;  3TKY A;  4OIO F;  2XHK A;  3GZ5 A;  1MJB A;  1KQ9 A;  2EV0 A;  4HYE A;  4LMY A;  4UNO A;  4BHC A;  2L54 A;  5CJ9 A;  1XGM A;  5E1X A;  1ZLK A;  4ENJ A;  3WTZ A;  1IN5 A;  1YLF A;  5K5R A;  3JSO A;  1QZZ A;  2G7U A;  4PZJ A;  3QRF F;  2OZ6 A;  1I27 A;  2K7L A;  1P4W A;  4FX0 A;  4KN7 X;  4GYG A;  3NRV A;  4M6X A;  3QPH A;  2ZNZ A;  4R79 A;  2LF8 A;  3CLO A;  5F64 A;  4I02 A;  4A0Z A;  1R58 A;  4ON0 A;  3ZMS A;  2L02 A;  2RQP A;  3GF2 A;  3H92 A;  2QQB A;  4IRI A;  1TLH B;  4WF2 A;  1JHH A;  1I5Z A;  1XGO A;  3REO A;  3V8J A;  3KP6 A;  5E18 F;  1KQ8 A;  5E20 A;  3J80 K;  3IHU A;  2GZW A;  3CO7 C;  1SD7 A;  4KT5 C;  2O0Y A;  1HST A;  1HQC A;  1V4R A;  3J7A O;  3PQK A;  3RIR A;  2RN7 A;  4G94 A;  1ZYR F;  1F5T A;  4LLN A;  1PDN C;  5D5V B;  5DCF A;  4I98 B;  3C1D A;  2HOE A;  3E5Q A;  1RUO A;  2YR2 A;  3N4M A;  3R60 A;  1R7J A;  2CSO A;  3KET A;  1UCR A;  1I1S A;  2STW A;  1YQA A;  3BJA A;  4UHT A;  2D1H A;  1E2X A;  1QNT A;  3O3K A;  5L3F A;  1T38 A;  3TO6 A;  2FF4 A;  2IW5 A;  4U0V A;  4A12 A;  4Q5S F;  1Z6R A;  1KU2 A;  2O8X A;  4KFC A;  1DPU A;  1DP7 P;  2V9V A;  1ZG5 A;  1K78 A;  2QUF A;  3FHZ A;  2FOK A;  3ZMV A;  3OOP A;  3SQN A;  2DT5 A;  4L9J A;  2YU3 A;  3O6B B;  1W7P A;  3KP7 A;  2JRT A;  5D8L B;  2HEO A;  5D5X B;  4L5J A;  1B4A A;  3WTT C;  1CF7 A;  3IWF A;  2AXL A;  4U0Y A;  5H6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...