5D5WB

Crystal structure of chaetomium thermophilum skn7 with hse dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
94
Chain Sequence
SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRPYGRDAWEFKHPEFRADRKDNLDNIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HSE DNA
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 23
structure length 94
sequence length 102
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5wB00
2QYOA 1Q1HA 4U7DA 2FBKA 1LDKB 3VFZA 4LG0B 2H27A 4M74A 1H9GA 3R0AA 3ERED 4LLNA 2XKOA 3I4PA 4P96A 1DPRA 2E1NA 5A2QK 1IZ1A 2VT3A 4LMYA 3RPQA 3ZN1A 3WTYC 2M45A 4BNCA 1U78A 2E7XA 2ISYA 1U5TC 5KK1A 3ZQ7A 5J6XA 1FZPB 3LFKA 1B6AA 2ZXJA 3IKTA 3M8FA 1DUXC 1I1GA 3B73A 1SMTA 3KZZA 3WG9A 4HV6A 1BN5A 4EQQA 2GA1A 2H6CA 4WWCA 1K7AA 4S04A 4HQMA 2QLZA 3CDHA 1OYYA 3I5UA 1K6OA 3L2CA 3MZHA 2F2EA 2ETHA 4HX4A 2DW4A 2P6TA 1H0MA 2R7DA 2IJLA 4BH9A 3LWFA 3ULQB 1JXSA 2CFXA 3RDIA 1HW2A 3HOSA 1DP7P 1P4XA 3CLOA 1OR7A 1YS7A 1WRJA 2XHKA 4XSXF 2W25A 3ISPA 5LRRA 1U5TB 3LQRA 3L9FA 4HDVA 2O03A 4EM0B 2RGVA 5CVVA 5IT3A 2RV8A 3E5UA 2VE8A 5L3CA 2ZMEB 4IVNA 1BIAA 1LJ9A 2BGCA 3TO7A 4KIGA 2L4MA 2JPBA 4RGXA 5ERIA 4BAYA 1L0OC 1S7OA 5FD5A 4HF1A 1RNLA 4ZYGA 4U0VA 4HV5A 4UNOA 4MQVA 1HW5A 1TW2A 4EJTA 4KA4A 2JZYA 1Z9CA 3Q9VA 3PQJA 4BHPA 3M7GA 2A68F 4YFNF 3E6DA 3QP5A 1EH7A 5LRSA 5FFZA 1FX7A 4IPAA 2M87A 3G3ZA 1IN5A 1S7AA 4AVPA 3WTVC 4RB0A 1WSUA 3H3ZA 2DQLA 3FM3A 4HF2A 4Z2YA 3BDDA 2F5CA 2JTVA 2HKXA 4H0EA 2XAFA 3KE2A 1SMYF 4HZFA 4UVBA 2KIMA 3ABTA 3T1BA 3F8NA 3KP2A 5K1YA 4Q47A 3TOBA 4FT8A 4PDKA 5K5RA 4A5NA 4I01A 4G8XA 4LG0A 4AIJA 2EB7A 3Q5FA 3ZMVA 1TW3A 5LGNA 1Z6RA 1TLHB 4EJOA 4IRGA 3V8JA 3MCZA 3R6SA 3M1EA 1IRGA 4RS8A 2VT2A 4RGSA 3I59B 1ZAOA 1SD7A 3HUGA 3JAMZ 5BS6A 3QPTA 2F5EA 1IAWA 2HYFA 2BYVE 4EM2A 3QP6A 2XIGA 1ZGJA 3I64A 1G3WA 1ZG5A 2Z3YA 1ZYRF 3BJAA 4HX8A 2IA0A 2K27A 1P4AA 2MA3A 4G94A 4IJAA 4CGZA 3EUHA 1KQ9A 4CHUA 3CJNA 2DO7A 4EJVA 2EFWA 2HTJA 4NHJA 2UXNA 1F4KA 2O6GE 1RUOA 1TNSA 1I5ZA 2GIVA 2M1BA 2ZBKA 3KLOA 1U2WA 4L9VA 1QPMA 3RPUA 1FSEA 3BWGA 4IF4A 5D6FA 2NYXA 1I1SA 1R00A 3DPTA 4YFKF 3IWZA 5E1ZB 3GWZA 4L18B 1V3FA 1FSHA 3QRFF 5HOOA 2H09A 5H6RA 3WGGA 3HRSA 1SAXA 2D1VA 1LNWA 4LLLA 5E8GA 4CYDA 3DF8A 5F6FA 1KU9A 2LDUA 2E7WA 3HSFA 2DAOA 3HRUA 3WU1B 5FD6A 4EM1A 1J5YA 4JQFA 1FPQA 1SFEA 1QO0D 1WQ2A 1E2XA 4RGRA 1L3LA 2UZKA 3J81K 1TTYA 2P5VA 4CZZA 3VODA 5JVTA 2NNYA 1VTNC 2MC3A 5AIPA 2P7CB 4A0XA 1ZARA 5ICEA 2KJBA 2XRNA 1NHAA 1BI1A 1XCVA 2EFQA 3J80K 2FE3A 5D4SA 4UV9A 2K86A 1EH8A 5FLXK 5EEHA 3M8EA 4P55A 4WXDA 2BV6A 4OMYA 2HYGD 2L4AA 2V79A 1I6XA 2IRFG 3BY6A 1LVAA 5HS7A 1ZREA 3QOPA 1IF1A 3WTUC 4I09A 4WX9A 3ZN0A 2QVOA 1UCRA 3V7SA 3RIRA 2Y48A 1XSVA 1YLFA 4B8XA 1HKSA 4U7BA 3S2WA 3C18A 2YPRA 1T0FA 4KNYA 2MLKA 2YX7A 4XLPF 3DKWA 2FRHA 3HOTA 5CYVA 3JTHA 5CLSA 5D5UB 1U3EM 5LHGA 2AS5F 4ZH4F 3I58A 1XMKA 2P8TA 5LHHA 4EJWA 3LA2A 5L3DA 5JHUA 4ZYDA 2AXLA 4ESBA 1IN6A 3GO5A 1P6RA 5D5VB 1MJBA 2J5OA 4M6XA 1Z6TA 4BHCA 3RYRA 2A07F 3IWFA 1XN7A 2PBIA 2C6YA 2EK5A 3BROA 1J59A 3ML6A 2HDCA 5DCMB 3RKYA 1MZBA 2CG4A 2PG4A 2WTEA 1KU2A 1G3SA 2ZFWA 4WCGA 3U9GA 2DK5A 2QBYB 2RQPA 4AWXB 2XGXA 3BJ6A 2O8XA 4M6YA 3I54A 4GO1A 4MTDA 2MLGA 4HLYA 2DQRA 2OU2A 2QZ8A 3I0TA 5CVRA 3C3WA 4FX0A 4ASNA 5CJ9A 2W24A 1T39A 1T98A 1BI2A 2FBHA 4GYGA 1T2KA 2FNPA 3KEQA 3FXQA 1W5SA 5HDGA 2M5WA 5L3FA 4XSZF 3LA7A 3E6BA 4RAZA 2QWWA 5D4RA 3I53A 1OYIA 3TDUC 3C7JA 1FYKA 4MTEA 3ABUA 3WTTC 4KICA 3FM5A 1DPUA 3G73A 2OZUA 1P2FA 2OQRA 4O3MA 5D6EA 4FX4A 2EWNA 1FWZA 1LEAA 1YYVA 2VC0A 2STWA 2IW5A 1K78B 1V4RA 4KIFA 4ON0A 1FYMA 1XGNA 2Z5UA 1C0WA 6PAXA 2YR2A 1YW7A 2RC4A 3GX4X 4ENJA 3HSRA 2DT5A 1ZG1A 2LF7A 1RZ4A 1J2XA 2LKPA 3FWEA 1FBSA 3BP8A 2G9WA 1F9NA 5DCFA 2MD5A 4ZZDA 2VONA 1B9NA 1USTA 3CUQA 1O7LA 2EV0A 2FF4A 2ZNZA 3GFJA 2FNAA 1BC8C 2L3DA 2Y0MA 2VBZA 4N0BA 4R8HA 2WWYA 1IXCA 1YW8A 1O3SA 3F6VA 1Z91A 4M73A 4G6DA 4BHBA 5BQTA 4OIPF 4R1HA 2A3SA 5LGUA 2F5DA 1B1BA 4KIBA 2O0YA 3SZPA 2HWVA 5AIQA 2RDPA 5L3EA 2CW0F 4GGGA 3DPLC 1OYWA 2GWRA 2JRTA 1T38A 2M8EA 2RKHA 3EETA 4Q4ZF 2QENA 4QLCU 3SHFA 3P9IA 4ETSA 4KMUX 2NNNA 4ZYEA 2DK8A 2D45A 5LEKA 1HQCA 4G7ZF 2GA2A 2VBXA 2K4JA 1TQPA 4WXHA 5D8KB 2IT0A 5DCMA 3MQ0A 1IN8A 2PEXA 4XBFA 3MFKA 3R0JA 3DV8A 3NRVA 3K69A 1W7PD 1UFMA 2CQKA 4LB6B 2QBYA 4AIKA 2VC1A 3OV8A 1CF7A 2LNBA 2EFOA 2X4HA 3V7CA 3DP7A 4N9HA 4M9XA 1STZA 3P9CA 3F8CA 4ESFA 4HW0A 2K4BA 1JHFA 2L02A 4LJZF 4LFUA 5D8LB 1HBXG 2K02A 1TBXA 5IT9K 3JW4A 1F1ZA 4MGRA 3KP6A 2JPCA 5AONA 1USSA 3GZ5A 1KU7A 2FSWA 4L9TA 2XAJA 4RB3C 4U88A 2Y75A 3V8KA 3N4MA 1DDNA 1BI3A 4YIIA 4R79A 3T8TA 2OAZA 2XVCA 1K78A 2YU3A 1YQAA 3GXOA 4MQ9F 5DD8A 2QUFA 2EA4A 4KN7X 2PN6A 1ZRDA 3ZMSA 5HDNA 4G7HF 2LSOA 2OA4A 3HHGA 1TNTA 1ZG3A 5L3GA 1PDNC 1R1UA 2P6SA 4XRFA 1HKQA 2LF8A 2UWMA 1HXDA 5E20A 2GAUA 3FX3A 1KQ0A 1RUNA 4OMZA 5LBQA 1A04A 1YFHA 1R7JA 3C1DA 2A6HF 1KU3A 3TGNA 3HRTA 2A61A 1JGSA 4O6JA 4KUMA 5D5XB 1FT9A 5E17F 2UXXA 1U5TA 2XROA 2HEOA 4WXCA 1J0RA 5TJJA 5HDKA 3GEZA 1O3TA 3E5QA 2XAQA 2F5FA 4PCQA 5JFRA 2KRFA 4UV8A 3MEXA 3F21A 5LHIA 4UXNA 2GXBA 2FMYA 2ZMEA 4M71A 3HTUA 4D0PA 1E17A 1SFXA 4S05A 1X3UA 2J5PA 5E1XA 3HRMA 5FGMA 5DEQA 4AIHA 3J7AO 4A2UA 2O3FA 5J8FA 2OBPA 3O6BB 1R1VA 4LK1F 5HLGA 4CICA 2DFIA 5FFXA 3KP7A 3F3XA 4HF0A 5E1WA 1AWCA 2ZCWA 3SZTA 5BMZA 1OMIA 2IA2A 1D8JA 2V6CA 3MWMA 4U0YA 1Z7UA 1BIBA 1R23A 2CWEA 4ESJA 4OIRF 4YG2F 1BC7C 3ELKA 4EVIA 4EMSA 1JE8A 5K5OA 3RI4A 1SD5A 2W85A 3TO6A 3OOPA 1EH6A 2ADUA 2BBYA 1CGPA 4RAYA 1JHHA 1O3QA 2OQGA 3WU0A 2Q0OA 5HVQC 2ZO4A 3EDPA 1BI0A 1FNNA 3VEPA 1MGTA 3SXYA 2BEOA 2IPQX 1RI7A 2NS0A 4I2OA 2P4WA 1IXSB 4YFXF 1D8KA 2HTSA 2OD5A 2YX4A 2DTRA 4OINF 3O3KA 3WTZA 5CVUA 4IRHA 1W4MA 3GFIA 3I59A 2FU4A 2ISZA 3WE3A 1YS6A 4RB1A 1LQ1A 4G6QA 3LA3A 4LGWA 2G7HA 3LAPA 1IXRC 1IW7F 3L7WA 1I27A 3KP4A 3HIFA 4OIQF 4K2EA 2VN2A 5BOXA 2V1DA 1KQ8A 4A0YA 1W5TA 3TO9A 3LQQA 2FXAA 4L5JA 1FBQA 1PP7U 1R58A 1KA8A 3JSOA 3T8RA 3L09A 4EGZA 4MHGA 5FB2A 3QU6A 2P5KA 1PP8F 2P5LC 4EJUA 1MJAA 4HLXA 4NQWA 1ZN2A 2KIFA 3JAMK 3K1PA 3EYIA 2XAGA 1XDSA 4P9FA 5DD4A 1HSTA 3BPXA 4EV0A 3HYIA 2IA1A 3F23A 4LLGF 2FQ3A 4UVCA 2XAHA 2NRAC 3KEOA 3ECOA 3K2ZA 2GZWA 2WV0A 2V9VA 3WTXC 1ODDA 1PUEE 3GFMA 1XB4A 3WE2A 2DPDA 3QPHA 4A5MA 4OOIA 1G3TA 1K79A 2Z33A 1Y0UA 2PLYA 2COMA 4G7OF 2RNJA 4IRIA 3GFLA 2ESNA 3FHZA 2X0LA 1LDJA 3O2PE 4ZYHA 3F8MA 1H9TA 1OPCA 3FMRA 4Q48A 3FXRA 2A5YB 4P9UA 4IXAA 4HX7A 4PGHA 3T5XA 1QNTA 2DBBA 1YG2A 2Z99A 1YIOA 1BOAA 4RB2C 1HSJA 2ELHA 1R5GA 4QWQA 3V8LA 2R3SA 3K0LA 1W7PB 3ECHA 1GXPA 3DXJF 3TKYA 2IP2A 4AD9A 3F8BA 2GQQA 2EJRA 2VBWA 1FC3A 1ZHFA 4OU0A 4N9IA 2Q2EA 4MNUA 4LD5A 1KGSA 4Y15A 3K1MA 1XSXA 2HKOA 2QQAA 1ZRFA 3SFZA 2KIUA 2VE9A 2H6BA 5ICCA 3N97A 2H94A 3VB2A 1YTYA 4UVAA 1Z1DA 4LK0F 2QM3A 2ZKZA 5F1RA 1G3YA 2OZ6A 2WC2A 3F8FA 4A6DA 5HLHA 3TQNA 1FLIA 2M30A 2VOOA 1J75A 2L01A 2MBFA 2ACJA 5DV5A 3WTSC 1LB2A 1SD4A 3R4KA 3KETA 1OKRA 2GXGA 3REOA 3AAFA 2DU9A 3KZYA 1GVJA 3WTWC 4BXUA 4M9ZA 4M9SA 2D2WA 4KYWA 5F64A 3CO7C 1FY7A 1G4DA 4L0ZB 2JT1A 3LAJA 4Y17A 3J81Z 5BPIA 4CDGA 3DFGA 4A0ZA 2PMHA 1R22A 4HAMA 2NAZA 5JI6A 3H3UA 3GW2A 3J80Z 3RKXA 3F22A 1SFUA 2A6EF 2A69F 2V1UA 1XCBA 1ZLJA 5FLXZ 3BJOA 3F6OA 4XLNF 3FF5A 1IN7A 3BOQA 3F72A 2PQ8A 1WKMA 1ONVA 2VOPA 1RIOH 3BPVA 2V1XA 2QQ9A 3RJPA 3NQOA 3CO6C 3E6CC 3GYHX 2EA2A 1LDDA 4PZJA 4I02A 1ZH5A 3KCCA 2PI0A 1TQIA 1MD0A 5LGTA 3W6KB 3M9AA 3IL2A 3FZVA 3GLXA 3FMSA 4JK1X 4DQ2A 3PQKA 3KLNA 3ROUA 1S8NA 4I0BA 4WF2A 2PFBA 1YW9A 4P5OA 1TQMA 1G6NA 3NEUA 3RTRA 1S6LA 3V4GA 1IRFA 1W7PA 4ENNA 5LEJA 4JBAA 1XGMA 4ZZLA 4M72A 4E70A 2VBYA 1IN4A 1UB9A 1FP1D 2PMUA 3IRRA 2Z9OA 1GXQA 1WWXA 2HGCA 4L9NA 2FBIA 1ON1A 4IHSA 5ICGA 3RKWA 1ZRCA 2EFPA 3QU3A 3IHUA 3ZMZA 4F7ZA 3COAC 3VOEA 1P4WA 3CUOA 3IKVA 2EV6A 4A12A 3DEUA 5E8IA 4RGUA 2D1HA 2E1CA 3D0SA 3U1DA 3I71A 1LEBA 3KFWX 1FBUA 1SD6A 1REPC 1O57A 1UHWA 3DQVC 1AOYA 5D5WB 2RN7A 3CTAA 2KKOA 1MKMA 4HYEA 5DUIA 5ICFA 3GZ6A 4NB5A 2XASA 2B0LA 2VXZA 2RVCA 3Q9SA 4KFCA 3P7NA 4A6EA 4GXOA 3HHHA 3U2RA 4HQEA 5H6QA 4MEXF 4TV7A 1U6GA 3BZ6A 4B09A 3SQNA 5BPDA 5E18F 4L5IA 4CXFA 4L0YB 1WI9A 4KMFA 2CSOA 2FA5A 5A2QZ 4OIOF 5CVJA 1QQIA 2EFNA 3E97A 1XDUA 5K5QA 2HZTA 3B02A 3L00A 2MH9A 3LSTA 3TDZC 1B4AA 4U0WA 3HTSB 1MDMB 4HDUA 1O3RA 1D3YA 4ENMA 4HOBA 4KDPA 4EGYA 1BJAA 3TOAA 4KN4X 1HKTA 1XMAA 1XGSA 3WGHA 2HFHA 3T0YA 5ILVA 3WGIA 2HS5A 5KVRA 2EV5A 1D5VA 1GHCA 4CO8A 3V7RA 5DUKA 5TRDA 1UHMA 3R61A 1IUYA 3HSEA 4GCVA 4I0AA 4BYYA 3CUQC 2XUBA 1F5TA 1ON2A 2IVMA 2ZNYA 2HQNA 4ENKA 4WK8F 1QBJA 3IC7A 3PFIA 1T6SA 4DNCA 2P7VB 3K1NA 2Q8KA 4LB5A 2O61A 2L54A 3P9KA 3ZP5A 4MEYF 2XV4S 1XGOA 1FP2A 2MH2A 1S3JA 3EYYA 2ESHA 2KJCA 1BBYA 1Z05A 3EQLF 2TDXA 4G9YA 5LLQA 5HLIA 2W57A 2FOKA 1O7FA 3JTGA 5HS8A 4PGGA 1MJ9A 1KYZA 2R7FA 1FYLA 4BQAA 2HOEA 3CUQB 5L3BA 3IRQA 3E5XA 2FEZA 4Y13A 3ZMDA 1XD7A 5H20A 2FMLA 2HQRA 3KP5A 1J7KA 5DYMA 1QZYA 1ULYA 1FOKA 2YSRA 5JR3A 2STTA 3GF2A 3ZMTA 1B9MA 5DDGA 1QGPA 1S29A 3QAHA 4FHTA 2CO5A 4UUVA 4UHTA 1BM9A 1ZGAA 5EEGA 5ED4A 5HS9A 2CYYA 1ZLKA 3FXUA 4YIFA 1J9IA 2VODA 2W84A 1P92A 5J8CA 4O5VA 4GYIA 5ILSA 3D5LA 2K7LA 1R1TA 3FMQA 4L9JA 2DPUA 1XSDA 3MZYA 1HW1A 3ZMUA 3KP3A 5IT9Z 5FO5A 1QZZA 1U8RA 2DI3A 3WODF 3R60A 1KYWA 2G7UA 3GUDA 2PJPA 2BE5F 4IHTA 3RYPA 3E6MA 4I7HA 3W6JB 3GVAA 3K9TA 4HBLA 1R5HA 2JSCA 2ZJ2A 2DLLA 4Q5SF 3ZPLA 1CF7B 3E3VA 1EV7A 2CGPA 1YO5C 2HR3A 4HA8A 3MAJA 5CVIA 4I98B 2QQBA 1R36A 2XKPA 5ILUA 3JSPA 1MDMA 3H92A 4KT5C 1B59A
chains in the Genus database with same CATH superfamily
2QYOA 3CCLI 2VKHA 2VKVA 3ZQGA 3VDXA 1Q1HA 4M3FA 4U7DA 2FBKA 1LDKB 2Y30A 1HCRA 4AVZA 3VFZA 1LFPA 1F43A 4LG0B 4BBSJ 2VPRA 3CCUI 5F27A 4XOTA 2H27A 2P81A 2HI3A 3RKQA 4M74A 3DLAA 1H9GA 3R0AA 3ERED 4LLNA 2XKOA 3I4PA 4P96A 3GTLJ 3I9V2 1DPRA 4IOCF 1OISA 2E1NA 2ZXHA 3PSIA 5A2QK 1IZ1A 2VT3A 4LMYA 3RPQA 4HNTA 4RM2A 3ZN1A 4NNJA 3WTYC 1MBHA 2M45A 4BNCA 1U78A 1TZLA 1MNDA 3PIPF 3TL4X 2E7XA 2F48A 4A3JJ 2ISYA 1VQMI 1E3HA 1U5TC 5KK1A 3DWLE 3ZQ7A 1MBFA 1SAUA 5J6XA 1FZPB 1NK2P 3LFKA 3SZGA 4ZTJA 1B6AA 2ZXJA 2K85A 3IKTA 2EQRA 3M8FA 1DUXC 1I1GA 1JI8A 3B73A 1SFOJ 1SMTA 3KZZA 4NUBA 3WG9A 5J4VA 4HV6A 1IV6A 2XC7A 2LK2A 2W82A 4H4KC 4RLQA 3DBRB 1BN5A 4E7KA 1V5EA 4EQQA 2GA1A 2H6CA 1VQ9I 1AKHA 1ZELA 4WWCA 2ZMEC 1K7AA 2FQ4A 4S04A 4HQMA 2QLZA 3CDHA 1OYYA 1X58A 4IHVA 2R5ZA 3I5UA 4HNVA 1MBGA 1FTTA 1K6OA 3L2CA 3MZHA 1YRNB 2F2EA 4RBOA 2CJJA 1U9OA 3CZ6A 2DN0A 4YELA 3JRAA 2ETHA 4HX4A 3VPRA 5M5XJ 3HGGA 2DW4A 2P6TA 3LFUA 1H0MA 2R7DA 1ETOA 3HKZN 2IJLA 4BH9A 3LWFA 3ULQB 1JXSA 2CFXA 3RDIA 2VQHA 3BR5A 1R9TJ 1HW2A 3HOSA 1JJ6C 1H88C 1IUFA 2NVXJ 1DP7P 1P4XA 2R7SA 3OYJA 3ZQLA 3LSMA 3CLOA 1OR7A 1YS7A 4MO7A 2LREA 1WRJA 2XHKA 3FXJA 4XSXF 2W25A 3ISPA 4C2TA 4Y4RA 3F0CA 5LRRA 1U5TB 3LQRA 3L9FA 3HOZJ 2E5NA 2IGOA 2HNHA 2JN6A 4M6VA 4HDVA 1HC8A 3GCMA 2O03A 2W48A 2QA4I 2M0CA 2CQ7A 4EM0B 2QGUA 2RGVA 4HEA2 3BR6A 2R7TA 2AQEA 5CVVA 1OCOH 5IT3A 3CC2I 3KPHA 2RV8A 3E5UA 2VE8A 2ZSIB 5L3CA 3I56I 1WHUA 2ZMEB 4IVNA 1BIAA 1LJ9A 2BGCA 3PNVA 3TO7A 5GAGJ 4KIGA 2DA5A 2WY8Q 1OLTA 2JPBA 2L4MA 1OCRH 4RGXA 5ERIA 3FDYA 4BAYA 1L0OC 3H0GJ 1S7OA 5FD5A 4HF1A 1RNLA 4ZYGA 2IEKA 3PNYA 4G12A 4CCJA 5GTHC 4U0VA 4HV5A 4UNOA 2EINH 2TCTA 4MQVA 1HW5A 1TW2A 3ONQA 4EJTA 3K70C 3E0JB 3FK7A 4KA4A 1TWAJ 2JZYA 2R4GA 1Z9CA 3Q9VA 3DU5A 3PQJA 1LFBA 4BHPA 3M7GA 2A68F 4YFNF 4MFEA 3E6DA 1N25A 3QP5A 3BG5A 1EH7A 5LRSA 5FFZA 1FX7A 1Z21A 4IPAA 3BG3A 2M87A 1VQ5I 2E35A 3G3ZA 1X19A 1IN5A 1S7AA 5FKNA 1POGA 4BQOA 5M3MJ 3IH4A 4AVPA 2H8WA 1OFCX 1YJNI 5FROA 3WTVC 4RB0A 1WSUA 3H3ZA 1T33A 4MIMA 3PJRA 1ZR4A 4IO9F 2DQLA 4BY7J 3O8GA 4NBQA 3FM3A 4HF2A 4Z2YA 3BDDA 4BU2A 1T0FC 1QHGA 3CP2A 5IY5H 2F5CA 2JTVA 5C4XJ 5C44J 2HKXA 2IXSA 4UUSA 2BY3A 2R5YB 2I8DA 4H0EA 4FE4A 2XAFA 3KE2A 3S15J 1SMYF 4HZFA 2GBYA 2R7UA 4UVBA 3HOYJ 2KIMA 3ABTA 3OYLA 3T1BA 3F8NA 3KP2A 4AM3A 5GAHJ 5K1YA 4Q47A 1PUFB 5B1AH 3TOBA 1R6RA 4FT8A 4PDKA 5K5RA 4A5NA 4I01A 3RQIA 4B3AA 4G8XA 4LG0A 1A6QA 2EB7A 3SDGA 4AIJA 3Q5FA 3ZMVA 2JA2A 2CFOA 1TW3A 2X1EA 1Z6RA 5LGNA 3IP4B 2VQCA 1TLHB 4EJOA 4IRGA 3V8JA 3MCZA 3R6SA 2E2HJ 3M1EA 1JKOC 1IRGA 4RS8A 2VT2A 2DMQA 4BDYA 2LG4A 3AG1H 2E2IJ 3K4MA 4BJTA 2IBDA 4RGSA 3I59B 1N77A 4AYBN 4I6ZA 2HQAA 1ZAOA 1XPXA 2Y69H 1SD7A 3HUGA 1HLVA 2LTPA 3JAMZ 5BS6A 3QPTA 2F5EA 1IAWA 2HYFA 2RREA 5GADJ 5IOZA 2BYVE 1RR8C 4EM2A 4XRSA 3QP6A 2XIGA 1DU6A 1ZGJA 5GAEJ 3I64A 1G3WA 3O8HA 2K9SA 1ZG5A 2KL4A 3DEWA 3LOCA 2Z3YA 1ZYRF 3BJAA 4HX8A 2V9PA 3JREA 4C2MJ 2IA0A 1YJWI 1IGNA 1UZCA 2DT7B 2K27A 1P4AA 2MA3A 3S1RJ 1YRNA 3KEYA 4G94A 4IJAA 3CMEI 1R71A 4CGZA 2CW8A 2L7FP 2W4SA 3EUHA 4E7SA 2L7ZA 1KQ9A 4DGWB 3OYMA 4CHUA 3CJNA 5M5WJ 5E3OA 2DO7A 4EJVA 4D7NA 2EFWA 1EKEA 1CQTA 2DMPA 2HTJA 2K5CA 3JRHA 4NHJA 4XLCA 2UXNA 2IGNA 1S5LC 1F4KA 5M5YJ 2O6GE 2YU9J 1RUOA 2A5WA 2JVHA 2MW8A 1TNSA 1ETVA 3GTKJ 1I5ZA 2GIVA 3BZCA 2M1BA 2RNGA 3CJQB 3OYNA 3CC7I 4HG2A 4NQWB 1IJWC 2N8GA 3LSRA 2JRMA 5DS9A 2VXDA 4IQJA 4E6KG 1UJ8A 4QIWN 2ZBKA 2XGCA 2LR8A 3MKYB 1Z67A 1U2WA 3KLOA 2ICWG 4L9VA 4DZJA 1QPMA 3RPUA 1RKWA 1FSEA 3BWGA 4IF4A 5D6FA 2NYXA 4E7IA 1I1SA 1R00A 1SC7A 3KIOA 5GPCA 3DPTA 2KFDA 4YFKF 3IWZA 5E1ZB 3GWZA 4L18B 1O4XA 3GTJJ 1V3FA 3DLLF 2BZTA 3S14J 1FSHA 3QRFF 3I3LA 1X4OA 5HOOA 1JUSA 2WY7Q 1K4SA 4QTRA 4V2FA 2XRLA 2H09A 3ZOBA 2GLOA 2JQ7A 4Y3OA 5H6RA 3M1CA 3WGGA 3HRSA 4IZZA 4BE0A 1NK3P 3S8PA 5IYCJ 3IV5A 2ELJA 4V2GA 1SAXA 1Y1WJ 2FOWA 1Z3XA 4GRIA 4E7LA 1WPKA 9ANTA 2K3FA 2DA7A 2D1VA 1LNWA 2R7OA 3WHBA 3IH2A 4XN0A 4LLLA 5E8GA 4CYDA 3DF8A 5F6FA 1KU9A 1A5JA 2LDUA 2E7WA 4BE1A 3HSFA 1A36A 2DAOA 2HPMA 2Y0SA 3H3VK 3HZJA 2WB1N 3HRUA 5F04A 4IOAF 3L1PA 3WU1B 4BEHB 2Y9ZA 5FD6A 3DU6A 4EM1A 1W36D 1J5YA 4JQFA 3RCOA 1BA5A 2M2EA 2OUMA 3G71I 1FPQA 1SFEA 1FOYA 3H35A 1QO0D 1WQ2A 2HDWA 1FTZA 1TWCJ 3A03A 4HNUA 4CZCA 3CCEI 1UMQA 3RQ4A 1E2XA 3DKXA 4RGRA 1L3LA 2L2OA 4FTHA 2UZKA 3J81K 1TTYA 2P5VA 2DCEA 4CZZA 3VODA 2XPWA 5JVTA 2NNYA 1VTNC 1P7JA 3DTIA 2MC3A 5AIPA 2P7CB 2R5YA 4A0XA 1ZARA 5ICEA 2KJBA 5JVGF 2XRNA 1NHAA 1BI1A 1XCVA 2EFQA 4XLAA 3J80K 2FE3A 3CMMA 4LIVA 5D4SA 1R4MB 4UV9A 1A6IA 2K86A 2Q2EB 1EH8A 4E4HA 5FLXK 3SEZA 1GV5A 2I10A 5EEHA 2IS2A 4XLFA 3M8EA 4P55A 4WXDA 2BV6A 4RAFA 2ID6A 4OMYA 3EUAA 1MBKA 2HYGD 3EUKL 2L4AA 2V79A 1I6XA 2IRFG 3BY6A 1LVAA 1S7EA 5HS7A 3L2UA 1ZREA 1Y8RB 4XLHA 3QOPA 2A05A 1IF1A 4Y33A 3WTUC 4I09A 4WX9A 4PFPA 3ZN0A 1WI3A 1V5GA 1SVMA 2QVOA 2XAUA 4C30A 2W7NA 1UCRA 3A1YA 4B47A 2EILH 3V7SA 2IGMA 3RIRA 2K9LA 1ZQ3P 2AXTC 2Y48A 1XSVA 1YLFA 3HM5A 4B8XA 2R7ZJ 1HKSA 2BXZA 4XOPA 4U7BA 1I39A 1P7IA 3S2WA 2JVGA 3KYDB 5IYBJ 2FJ1A 2QSFX 2QSGX 3C18A 2YPRA 1T0FA 3E1SA 4A69C 2YUSA 5JLWA 2MLKA 2LY9A 4KNYA 1MNEA 2YX7A 4BL0B 2XGEA 4XLPF 3DKWA 2FRHA 3HOTA 5CYVA 3JTHA 1YE9A 5CLSA 5D5UB 1U3EM 4Y7NJ 5LHGA 3DBHB 2AS5F 1VQ6I 4ZH4F 3WHCA 2EPFA 3I58A 1XMKA 3PL8A 4N4OB 2DA3A 1PYVA 2P8TA 2LKSA 1HF0A 1R5ID 1D1CA 4UB8C 3FKJA 5LHHA 4M3DA 4YEJA 3K4JA 2OCEA 4EJWA 3OS1A 2F4OB 3LA2A 4C3IJ 2ECCA 5L3DA 2EIJH 5JHUA 3H9GA 4ZYDA 2AXLA 1MMAA 2DA1A 4ESBA 1IN6A 1A35A 3GO5A 2TRTA 5FKOA 1P6RA 1IO2A 4L5EA 3HDDA 2JUCA 5D5VB 2X9DA 3ASNH 4BJ6C 1MJBA 2J5OA 4OAYA 4M6XA 2GM4A 1Z6TA 4BHCA 1MH3A 2XF5A 1W1WE 2ZXIA 3RYRA 2A07F 3IWFA 2CUZA 4RA2A 3OOUA 1XN7A 1BR2A 2HVQA 1FMWA 2LBFB 4PK4A 1F36A 2QF7A 2PBIA 2C6YA 3L2WA 3QYEA 2EK5A 3BROA 4DYCA 4RAGA 3S2HJ 4B1RA 3W2VA 1J59A 4ABZA 3ML6A 3S3MA 2ZJQF 2HDCA 2E19A 5DCMB 5TISC 3RKYA 1MZBA 1A31A 4HRIA 3K4LA 2CG4A 2PG4A 1QU3A 2WTEA 3JR9A 3A02A 2KMUA 2R93J 3WU2C 1KU2A 4F52A 3A2KA 3VWBA 4NC7A 1G3SA 2ZFWA 2H1LA 4WCGA 3CC4I 3U9GA 2DK5A 2LYCA 2RQPA 3W2WA 3TEDA 2QBYB 4AWXB 1ZKGA 3HL2A 2XGXA 3BJ6A 2O8XA 4M6YA 5J47A 3I54A 4GO1A 2X85A 1OJLA 4MTDA 2MLGA 3JRDA 4HLYA 2DQRA 3CD6I 2OU2A 2QZ8A 1AA7A 3JRIA 3I0TA 5CVRA 3OYGA 2O9LA 3C3WA 2M9HA 4FX0A 2M4GA 4ASNA 5CJ9A 1S72I 2W24A 1T39A 1T98A 1BI2A 4IKFA 2DJNA 5CKTA 1LE8A 2FBHA 4GYGA 3FXKA 1T2KA 1D5YA 1HA8A 5B5EC 2HVRA 3U21A 2FNPA 3KEQA 2ZXWH 3FXQA 3V42A 2LMDA 2LP0A 1W5SA 5HDGA 1YIJI 2M5WA 2VJ5A 5L3FA 4XSZF 4XRMA 3LA7A 4J19A 2VPLA 4XM3A 3E6BA 3IAS2 4RAZA 4XIDA 2QWWA 5D4RA 3I53A 1NG6A 1OYIA 3TDUC 3C7JA 5JHFA 1FYKA 4JX4A 3AG2H 4MTEA 3ABUA 4PJMA 1VQPI 3WTTC 3CDIA 4KICA 3A01A 3FM5A 1DPUA 2LRDA 2ME0A 3OS0A 1ZK8A 1IRZA 4BACA 3G73A 2PMZN 2OZUA 1P2FA 1WFXA 2OQRA 2KDZA 4O3MA 5D6EA 4XICA 4FX4A 2OTLI 2W1OA 4BS9A 2EWNA 1FWZA 4M3GA 1LEAA 3ABKH 1EA3A 2CV1A 1YYVA 1K83J 4BDZA 3CJRB 2VC0A 2BVLA 1Y6IA 2QKLB 3H5AA 1DGRM 2JK3A 2OCCH 4PSXA 2STWA 3ZCOA 2IW5A 2F6CA 1K78B 1V4RA 4KIFA 5HODA 2XPUA 4ON0A 1FYMA 1XGNA 3K10A 3B6AA 1AU7A 5K7FA 4LOCA 2Z5UA 1VQ7I 3RZDJ 3OMYA 1C0WA 6PAXA 3QODA 2YR2A 1YW7A 4JX6A 2RC4A 3GX4X 4ENJA 3HKZA 3HSRA 2DT5A 2BOLA 3DCFA 1ZG1A 1MBEA 4A3CJ 2LF7A 2Q1ZB 1RZ4A 3W6VA 3OIOA 4JYKA 1J2XA 2M34A 2PJRB 2LKPA 3FWEA 3OL3A 5HLTA 1FBSA 3BP8A 2E2JJ 3B6CA 4C3HJ 3Q0VA 2G9WA 1F9NA 5DCFA 2MD5A 1WJEA 4ZZDA 2VONA 1B9NA 2ZB9A 2XB0X 1USTA 2WAFA 2OV7A 3CUQA 4CYCA 1O7LA 2EV0A 2FF4A 4KISA 2E34A 2ZNZA 3GFJA 1IDZA 5J1UA 4XK4A 2FNAA 2NOJB 3OWTA 2MC4A 2JSPA 1BC8C 2L3DA 3NAUA 2Y0MA 2VBZA 1HDPA 1OCPA 1RPWA 4BQNA 4N0BA 1B8IB 2MFZA 4R8HA 2WWYA 1IXCA 1YW8A 2VQLA 3Q3SA 5GP9A 3F6VA 1O3SA 1Z91A 3UKGA 4M73A 4G6DA 2CUFA 4BHBA 5BQTA 3FK6A 1RESA 3PO2J 4OIPF 3OY9A 1IC8A 4R1HA 2A3SA 5IPAA 5LGUA 4ZJZA 2F5DA 1B1BA 4KIBA 2O0YA 3SZPA 2HWVA 5AIQA 2RDPA 5L3EA 2R92J 3N05A 2CW0F 4NC8A 4E7JA 4GGGA 2BW3B 3DPLC 2MSYA 4PFOA 1OYWA 4HSTA 3J7ZI 2GWRA 2M7AA 4XN3A 2JRTA 1T38A 2M8EA 2RKHA 3EETA 1ETKA 2X6OA 4C9YA 4Q4ZF 3OYKA 3E7LA 3ZQHA 2QENA 1PJRA 4U87A 4QLCU 3SHFA 3P9IA 4ETSA 2FUG2 4KMUX 1B72B 2XSJC 2O5RA 1JGGA 2NNNA 3AG4H 2HZDA 2E36A 4ZYEA 2M3AA 2DK8A 1Y39A 3S3NA 4F3QA 2D45A 5LEKA 1HQCA 4G7ZF 4FCYA 2GA2A 2VBXA 1WGXA 4EEFG 2VJ4A 2JA8J 3VSKA 2K4JA 1TQPA 3HPHA 4JOMA 4WXHA 5D8KB 2IT0A 4CSWA 5DCMA 2HYJA 2QQ8A 1FEXA 4IL6C 1N78A 3MQ0A 3JRFA 1IN8A 2PEXA 4XBFA 3MFKA 3BCBA 3R0JA 1X1DA 3DV8A 1FMVA 3FISA 3NRVA 3K69A 1W7PD 1UFMA 2CQKA 4LB6B 3IAM2 2QBYA 1TC3C 1OCTC 2WBMA 2DJIA 4AIKA 2VC1A 3BR3A 1MH4A 5IYDJ 3VYSB 1WVRA 3OV8A 5B1BH 1W36C 1CF7A 3I55I 2LNBA 2EFOA 3GTQJ 2X4HA 2V7FA 3V7CA 2L7KA 3DP7A 3FXLA 1U9NA 3BTLA 3CCJI 4N9HA 1X2NA 4M9XA 1D0ZA 1STZA 3P9CA 1W0UA 3F8CA 4X1EA 4ESFA 5B66C 4HW0A 1Z0XA 2K4BA 3G2BA 1JHFA 2L02A 3BG7A 4LJZF 2R7QA 4LFUA 3LSPA 5D8LB 5E3LA 1HBXG 2K02A 5IP9J 1TBXA 3BLYA 5IT9K 2H8RA 2H1KA 4MFDA 3JW4A 3D5RC 1F1ZA 1Z3YA 4MGRA 3KP6A 2JPCA 1HOMA 2NS7A 5AONA 1USSA 3HEFA 3GZ5A 1KU7A 1WCMJ 2FSWA 2X51A 4BBRJ 4L9TA 2COBA 2MYSA 3RSNA 3LSIA 3JRCA 2XAJA 4RB3C 4U88A 2Y75A 5FLVA 3V8KA 1BW5A 3N4MA 1DDNA 3MMYB 2LD5A 1YX3A 4AYBA 2O7OA 1EJ9A 2AO9A 1BI3A 4F92B 2NXNB 4YIIA 1VZ0A 1NG7A 1TT0A 2JA5J 2WA0A 4R79A 1VQNI 2ZSHB 3GBGA 2DA6A 3T8TA 4A3KJ 2OAZA 1I50J 2XVCA 2QKMB 1K78A 1ACIA 2YU3A 1YQAA 3GXOA 4MQ9F 5DD8A 2JMWA 2QUFA 3LMMA 2EA4A 3QWLA 5KAIC 4KN7X 2KLOA 2PN6A 2D5VA 1ZRDA 1X1AA 1Z77A 5C4JJ 3ZMSA 3MVPA 5HDNA 5C3EJ 4G7HF 3F9KA 2LSOA 1U0JA 2OA4A 3HHGA 4QPQA 1IV8A 1TNTA 4JX5A 1ZG3A 2PX9A 5L3GA 1PDNC 1R1UA 2HOSA 2Y9YA 3BG9A 2P6SA 4XRFA 5E3NA 1HKQA 2PJRA 3VYRB 3ABLH 1XS9A 2LF8A 3NWTA 3GTPJ 2UWMA 2XB5A 1BW6A 4BE2A 1TL8A 3K4CA 1HXDA 2CU7A 5E20A 2GAUA 3FX3A 1VQKI 1KQ0A 1RUNA 2DMNA 1IDYA 3K4KA 4OMZA 2CQQA 5LBQA 1A04A 3LSKA 1YFHA 4XNFA 1R7JA 3C1DA 2HU9A 2A6HF 1KU3A 3TGNA 1ZR2A 4AIDA 3HRTA 2A61A 2ZJRF 1JGSA 1WJDA 4O6JA 4KUMA 5D5XB 1FT9A 5E17F 3K7AJ 2UXXA 1XX5A 3DBLB 4J01A 1U5TA 2XROA 5HNHA 3A0HC 3TP3A 4YRVA 1BL0A 2HEOA 3ASOH 2E60A 4WXCA 1J0RA 4W97A 3ZQFA 5TJJA 5HDKA 3GEZA 2EZIA 1O3TA 5HNFA 1PVEA 5DM6F 3E5QA 2K3PA 1TWFJ 3NWSA 4I99C 2O8KA 2XAQA 2F5FA 3H36A 4PCQA 5JFRA 1SFKA 5IOYA 2KRFA 4UV8A 3MEXA 3F21A 4XKVA 4UXNA 5LHIA 3MKZA 2GXBA 2FMYA 2NVUB 2LOOA 2ZMEA 4D1QA 3MKLA 4M71A 1P9QC 2BW3A 3HTUA 2X6WA 3OL4A 1JUMA 4D0PA 3CCMI 3S93A 1E17A 3BTIA 1SFXA 4S05A 1X3UA 2J5PA 5FJ8J 3AFHA 4XORA 5E1XA 2L7MP 3HRMA 1SEUA 3HOUJ 4BXFA 5FKKA 5FGMA 3H9QA 5DEQA 3IUOA 4J00A 3J7AY 1I3QJ 4AIHA 5CQEA 3J7AO 3W2AA 3HC7A 2WAQN 4A2UA 2O3FA 1KZHA 5FLMJ 4ITVA 3G4SI 5J8FA 4FISA 2OBPA 1UG2A 1R1VA 3BR2A 3O6BB 4LK1F 4CICA 5HLGA 2KRCA 2DFIA 5FFXA 3KP7A 3F3XA 4HF0A 5E1WA 2WB1A 1AWCA 5J1RA 2ZCWA 3SZTA 5BMZA 1OMIA 2IA2A 3OYHA 2XSDC 1D8JA 2V6CA 1MW7A 3MWMA 3ERMA 3FBNB 2B63J 5E79C 1QHHD 2DOFA 3VSLA 4U0YA 1Z7UA 1WJCA 1BIBA 1R23A 2DTZA 4CH7A 2LY1A 5DM7F 4B4CA 4PJLA 2B9SA 4W1UA 2CWEA 2M7BA 4ESJA 1X3ZB 2Y31A 3K2AA 4OIRF 3K6GA 4YG2F 1BC7C 1UG0A 3ELKA 4RLFA 1OQYA 4EVIA 2CQNA 2F4MB 4EMSA 2CUEA 1JE8A 1X4PA 4DZPA 5K5OA 3RI4A 4DJAA 1SD5A 2W85A 2EZHA 1MMSA 3TO6A 1RRJA 3SEQA 3OOPA 1EH6A 2JA7J 2ADUA 1T95A 2BBYA 1CGPA 2MG4A 2VKDA 3CP8A 4RAYA 3SJMA 1JHHA 5EZHA 1O3QA 1PUFA 2OQGA 3WU0A 2Q0OA 5HVQC 2ZO4A 3EDPA 5KAFC 1BI0A 1FNNA 4BUPA 3VEPA 2NOGA 1MGTA 3SXYA 2BEOA 3S1QJ 2IPQX 1RI7A 2NS0A 1MMGA 3HG9A 4I2OA 3DTEA 2P4WA 1IXSB 4YFXF 1MSFC 3OYAA 1D8KA 3CDLA 2HTSA 2OD5A 2YX4A 2DTRA 4OINF 3O3KA 1AKHB 4E7ZA 3WTZA 4AU7A 5EGOB 4AC0A 5CVUA 4IRHA 2EH3A 1W4MA 3GFIA 3I59A 2FU4A 2ISZA 3WE3A 1YS6A 2DT6A 3NARA 4RB1A 1LQ1A 1FOWA 4PUSA 1X2MA 1H8AC 4QSHA 4IQ4A 4AUXA 2GXAA 3FKIJ 4G6QA 3I4MJ 3LA3A 4LGWA 2R7XA 1ETYA 2G7HA 3LAPA 2XGDA 1IXRC 1IW7F 3BQZA 2Z1DA 3QOEA 2L0KA 3L7WA 2OF7A 1I27A 3KP4A 2QCOA 1JJ8C 3HIFA 3LSHA 5IP7J 4OIQF 4K2EA 2JJ7A 2IS1A 2VN2A 3PM1A 5BOXA 4XR6A 4B44A 2V1DA 1KQ8A 3OYFA 4A0YA 1W5TA 3BT9A 3CLQA 3TO9A 1VF9A 4DYRA 1GV2A 3LQQA 3ABMH 2FXAA 2VLAA 3AL0C 3QQAA 4L5JA 1FJLA 1FBQA 2EBIA 1D1AA 4B48A 1PP7U 1JKRC 1G59A 1R58A 1KA8A 3JSOA 3T8RA 2XF7A 1GT0C 4RMNA 3L09A 5H2FC 3PNTA 1D1BA 4EGZA 4MHGA 5FB2A 4IHWA 3QU6A 3LNQA 2P5KA 4Z6YA 3CJTB 2BY2A 1PP8F 2ZJPF 2P5LC 2DXIA 4EJUA 1MJAA 4HLXA 4ZC3A 4NQWA 1LKXA 1ZN2A 2KIFA 3JAMK 3K1PA 1QVUA 4OAZA 4B43A 2CH0A 5EEAA 1SVLA 3EYIA 1J09A 2XAGA 1XDSA 4P9FA 1D0XA 2K9QA 5DD4A 1HSTA 1X1BA 3ZQQA 3J7YJ 3GMEA 3BPXA 3VYUB 3TW6A 4EV0A 3HYIA 4OWRB 2IA1A 3P5JA 4LLGF 3F23A 2FQ3A 5F0HA 4UVCA 4A3MJ 1RC9A 2IAIA 5J3LA 2XAHA 2NRAC 3KEOA 3ECOA 3K2ZA 3SYTA 2HXOA 2GZWA 2WV0A 2V9VA 2DA4A 2DODA 4S0HB 3WTXC 1ODDA 1PUEE 3GFMA 2L9VA 5EZGA 1XB4A 3WE2A 2DPDA 3QPHA 4A5MA 4GDFA 4OOIA 4F93B 4FE7A 1G3TA 3QPSA 1JKPC 1K79A 1M1EB 2Z33A 3MKWB 1YX5A 3AL0B 2L9RA 1Y0UA 3JRBA 4IEJA 2PLYA 2COMA 4CCOA 4G7OF 2RNJA 4IRIA 3GFLA 2ESNA 3GTGJ 2DFHA 3FHZA 2X0LA 1LDJA 3O2PE 4ZYHA 4IHXA 3F8MA 1H9TA 1OPCA 4DIQA 3FMRA 4Q48A 3FXRA 2A5YB 5FKMA 5EF6A 4P9UA 4XONA 3HPGA 4XKBA 4IXAA 1E3PA 5GPAA 4UUSB 2PMZA 4HX7A 1JKQC 4XMYA 4BEHA 3M4OJ 4PGHA 3T5XA 1QNTA 2IS4A 4BKXA 4A3DJ 2DBBA 3HXLA 1BR1A 1FOXA 1YG2A 2Z99A 1U8BA 1WH5A 1YIOA 4B3XA 3HBLA 4HPQA 2HXIA 1BOAA 2EIKH 3OSGA 2WV1A 1YITI 2VL8A 2VQGA 4RB2C 1HSJA 2DYRH 2ELHA 1R5GA 4QWQA 3V8LA 3X2QH 3QYBA 1Y56A 1NTCA 2R3SA 3K0LA 1W7PB 3JRGA 3ECHA 4LITA 1GXPA 3EUHC 3DXJF 3TKYA 1UELB 2OTJI 2IP2A 4AD9A 4ZDOA 2KPMA 2MABA 3F8BA 3FBIB 4QPOA 2V6EA 2GQQA 2EJRA 2VBWA 5M3FJ 2CV2A 1FC3A 3S32A 1ZHFA 3I4NJ 4OU0A 1TT5B 2LC2A 4D5FA 2LFBA 4N9IA 3S2DJ 1YJ9I 2Q2EA 4MNUA 4LD5A 5K7ZA 2ECBA 1KGSA 1V5FA 3K1MA 4Y15A 1Y8QB 3GLLA 1I6HJ 1XSXA 3KZIC 2DYSH 2VUMJ 2LVSA 4ZYAA 2HKOA 3HUGB 2QQAA 3BCAA 5KNLA 2XF6A 4CUGA 1ZRFA 1Y0NA 3SFZA 3CMAI 3CESA 3HOVJ 2KIUA 4JP0A 2VE9A 2H6BA 5EGOA 3VYTB 5ICCA 2Y2ZA 3N97A 3S1NJ 3RZOJ 2H94A 3VB2A 1YTYA 4UVAA 1GVDA 4Y52J 1Z1DA 2DMTA 4LK0F 2QM3A 2DOAA 3BC8A 4BY1J 2ZKZA 3H5NA 5F1RA 4GFBA 1G3YA 2ELKA 5F0CA 2OZ6A 3L2QA 2WC2A 3SDBA 3F8FA 4A6DA 5HLHA 2HOAA 4D9JA 3TQNA 2HVSA 5FKLA 2M30A 1FLIA 2K9MA 2BHYA 4PJJA 2KRHA 2VOOA 1J75A 2L01A 2IS6A 2MBFA 2HQ5A 2L9NA 3OYEA 2ACJA 5DV5A 3WTSC 1LB2A 4D7MA 2M8GX 1ENHA 2CMPA 1SD4A 2ID3A 3OS2A 3R4KA 3KETA 4YIRX 1OKRA 2GXGA 3REOA 1HDDC 3AAFA 2JWTA 3FXMA 5KCMA 2CS3A 2DU9A 3KZYA 1VNDA 3C2HA 1GVJA 3ZGKA 3WTWC 2VJJA 4BXUA 4M9ZA 2I5UA 4M9SA 2D2WA 4M3BA 5F08A 4KYWA 4XL9A 5F64A 2LBFA 3OYIA 4G6TB 1VQ8I 3CO7C 1FY7A 1G4DA 4L0ZB 3PFYA 2JT1A 3D5SC 3LAJA 2CUJA 4Y17A 2BY0A 3J81Z 4A3EJ 2KHMA 5BPIA 3OYDA 4CDGA 4NC6A 3DFGA 3K4BA 1FIPA 4A0ZA 1E3OC 2PMHA 1R22A 4HAMA 2NAZA 3ZXSA 4BJ5C 1JT6A 5JI6A 1JTYA 3G1MA 3H3UA 3GW2A 3BZKA 3J80Z 3RKXA 3H0DA 3F22A 1SFUA 2A6EF 2A69F 1WH7A 1X3WB 3FXOA 2V1UA 3BTJA 1XCBA 1ZLJA 5FLXZ 3BJOA 4A3BJ 3F6OA 4XQFA 4XLNF 5CQGA 3FF5A 1IN7A 1WZ2A 2LY2A 3BOQA 3BQYA 1QRYA 3F72A 2PQ8A 1WKMA 2GOMA 1ONVA 2VOPA 1RIOH 2DMUA 3BPVA 2V1XA 2QQ9A 3RJPA 5BNGA 1ZGWA 4ZDLA 4CA0A 3NQOA 3CO6C 1QZEA 3E6CC 3AKZA 3GYHX 2LH9A 2WADA 1LDDA 5DTDA 4PZJA 2KZVA 2K40A 1Z7LA 2DFFA 4I02A 3KCCA 1ZH5A 2PI0A 1TQIA 1MD0A 1K6YA 5KHDA 3JCUC 1FIAA 3OYBA 5LGTA 1QVTA 3M9AA 3W6KB 3IL2A 2V4JC 3FZVA 3GLXA 3FMSA 4JK1X 3CCQI 4DQ2A 3PQKA 2MD0A 3KLNA 2NS8A 1ETQA 2E5ZA 3OIQA 3CF5F 3ROUA 2KT0A 1S8NA 2Z16A 4I0BA 1QPIA 2VI6A 2UV1A 1S9HA 4WF2A 2PFBA 1YW9A 4P5OA 3D1NI 4PJ0C 1IG7A 1QA6A 3CCYA 3PUFA 1K4TA 2DA2A 3L2RA 5LFAA 1TQMA 2F5VA 2WAEA 1G6NA 5J4YA 3NEUA 3S17J 2X1DA 3RTRA 1S6LA 1K61A 3V4GA 4EATA 1IRFA 1G8XA 1W7PA 4ENNA 5LEJA 4JBAA 1XGMA 5F1JA 4ZZLA 2XDVA 2YS9A 4LG3A 4M72A 4E70A 2VBYA 1IN4A 1UB9A 2F4IA 1WJ5A 3BR0A 1XG1A 1FP1D 3M3YJ 4A3GJ 2FD5A 2PMUA 2X1CA 3KX2A 3IRRA 2Z9OA 4P1WA 1GXQA 5EG0B 1WWXA 2HGCA 3A4CA 2FBIA 1ON1A 3HB9A 2HPIA 4L9NA 3CMYA 3OSFA 2KP6A 4IHSA 5ICGA 4HSRA 1N75A 3ESWB 3RKWA 2KQRA 1ZRCA 2EFPA 2XPVA 2CW7A 2FX0A 3RPUD 3DEEA 3QU3A 3IHUA 3BTCA 4LIUA 3H9JA 3ZMZA 3QPLA 4F7ZA 3COAC 3WG7H 4X6AJ 3VOEA 3KYLA 4ANJA 1P4WA 4RDUA 3CUOA 1DGWY 3IKVA 5GTIC 1TWHJ 1MMNA 2EV6A 2KISA 2OJED 4A12A 2E71A 4KT6A 3DEUA 1LVKA 4RGUA 1RETA 2D1HA 5E8IA 1JTXA 4ZTFA 2E1CA 3K4NA 3D0SA 2X6XA 3U1DA 4A3LJ 1H89C 3I71A 4F55A 1LEBA 3KFWX 1FBUA 2RQQA 3HJEA 1NH3A 4UY8I 1SD6A 3OIPA 1REPC 1GLNA 1O57A 1UHWA 3LSJA 4XLEA 2CQXA 3PIOF 1B8IA 3DQVC 1AOYA 4XKCA 5D5WB 2RN7A 3CTAA 2R7RA 1GDTA 2QSHX 4BXXJ 2KKOA 3Q0UA 1MKMA 2GOXB 1KONA 1OCCH 1X1PA 4HYEA 5F0FA 5DUIA 1BOBA 5ICFA 3GZ6A 4NB5A 2XASA 2B0LA 2VXZA 4FASD 3CCRI 2KDOA 2RVCA 1G2HA 4DOZA 4FQGA 5EJCA 3Q9SA 2M4KA 3AG3H 4KFCA 4DBQA 1UAAA 4KITB 3P7NA 1SVOA 2AHQA 4A6EA 1DU0A 4GXOA 3HHHA 2EZLA 3U2RA 4E7HA 4PJNA 4HQEA 3M8JA 1IRXA 5H6QA 4MEXF 2EZKA 4TV7A 2JUGA 2WAQA 1U6GA 1T56A 4A3IJ 4KJZA 1R49A 3HOWJ 3BZ6A 2DOEA 1Q1VA 2BY1A 1B72A 4B09A 1VI0A 3SQNA 5BPDA 4A93J 5E18F 4L5IA 4CXFA 2BHZA 3ZRGA 1MMDA 4L0YB 1WI9A 2LKXA 2CSOA 4MLOA 4ZDPA 4KMFA 4M3EA 2FA5A 4BQQA 1EF4A 5A2QZ 4OIOF 1ETXA 5CVJA 1QQIA 3Q0WA 2W00A 2EFNA 4N4NB 3E97A 2ME6A 2X6YA 4A3FJ 1MNMC 5K7HA 1XDUA 5K5QA 1LUJB 2HZTA 4F91B 1YHQI 4DW6A 3B02A 3K70D 3L00A 2UUZA 2MH9A 1GUUA 3LSTA 3TDZC 1B4AA 2HOTA 2CV0A 2NVTJ 4U0WA 1E0EA 3HTSB 4I76A 1MBJA 1W0TA 1MDMB 4HDUA 2HDDA 1LE8B 3FHNA 4CCLA 1D3YA 3MD2A 1O3RA 1SANA 4ENMA 4UB6C 4HOBA 1ORKA 3OYCA 4CCNA 4EGYA 4KDPA 1BJAA 3TOAA 4KN4X 1HKTA 3CF2A 2NVYJ 2DDBA 3PO3J 1XMAA 1XGSA 3WGHA 4CCKA 2HFHA 3T0YA 5ILVA 1TP4A 3IH3A 3WGIA 3UR3C 2HS5A 5KVRA 2EV5A 2VASA 1X1CA 1AHDP 1D5VA 1GHCA 2BXYA 1R4NB 3CCSI 4CO8A 3V7RA 1VQLI 3HGYA 3BR1A 5DUKA 3PSFA 5TRDA 1UHMA 3R61A 3DPUA 1OCZH 1IUYA 3A01B 3HSEA 4GCVA 4I0AA 4BYYA 2R7WA 1APLC 1BJZA 2Y0SN 3CUQC 2XUBA 1F5TA 1ON2A 2IVMA 2ZNYA 2ZFUA 2HQNA 1OR7C 4ENKA 4WK8F 2MGQA 1T08B 3CQZJ 1QBJA 3IC7A 3PFIA 1RKTA 1T6SA 2A6TA 5TGTA 4DNCA 2AQFA 2P7VB 3OR1C 4XKWA 3K1NA 2K9NA 2Q8KA 2V9KA 4LB5A 2O61A 2L54A 1ETWA 3CCVI 3P9KA 1ZTRA 3ZP5A 4MEYF 1DQUA 2XV4S 2ZC2A 1XGOA 1FP2A 1JT0A 2MH2A 1S3JA 2QEXI 3EYYA 2VB6A 2ESHA 4FETA 2G0EA 2KJCA 3KYCB 5LD2C 1BBYA 2R5ZB 1Z05A 3EQLF 4D5CA 2TDXA 4G9YA 3G1LA 1DP3A 2V26A 3G1OA 5LLQA 3BG6A 5HLIA 2W57A 2FOKA 3LSGA 5EG0A 1O7FA 1LFUP 4V19K 3TW7A 3JTGA 3HOXJ 5HS8A 4PGGA 1MJ9A 2E1MC 1KYZA 2R7FA 1FYLA 4BQAA 4II3A 4DYQA 2NVQJ 2HOEA 3CUQB 2JA6J 2DDAA 3W3CA 4CYCB 5L3BA 1ERDA 5B3SH 2BVMA 3E5XA 3IRQA 2FEZA 4Y13A 3ZMDA 2VKEA 1XD7A 3DTKA 2E1OA 5H20A 2FMLA 2HQRA 1I3AA 5J1YA 1VQOI 3KP5A 1J7KA 5DYMA 1QZYA 1WJAA 5FRMA 1ULYA 1Y1VJ 1FOKA 3MN2A 2YSRA 2OPTA 5JR3A 3S16J 1VFCA 2STTA 4C3JJ 5EDNA 3GF2A 2OC6A 1ITYA 1XTAA 1D0YA 2GIZA 3GTMJ 3ZMTA 1B9MA 3EPZA 5DDGA 5EYRA 2M0MA 2B7EA 1QGPA 1S29A 3QAHA 4XRSG 4FHTA 3TBIA 2CO5A 4BGDA 4UUVA 4UHTA 1BM9A 1ZGAA 3G6EI 4C2UA 5EEGA 4DBRA 5ED4A 4NDLA 2CYYA 5HS9A 3A0BC 5JLXA 1ZLKA 5FRNA 3FXUA 3SFIA 3QYFA 4YIFA 1J9IA 3H5RA 2LLKA 2W84A 1P92A 5J8CA 1W5CC 4X0GA 2VODA 2L9SA 4O5VA 1LPQA 2V1NA 3L2VA 4GYIA 5ILSA 3D5LA 4IX7A 1XMXA 2K7LA 3H1CA 4KT5C 1R1TA 2R7VA 4RM3A 3ZR8X 3ZQIA 1MIJA 3FMQA 4UUTA 3OR2C 4L9JA 2DPUA 1XSDA 3MZYA 1HW1A 1WJFA 2E1MB 3FIWA 1MSEC 3ZMUA 2X48A 1JUPA 3U1KA 3KP3A 5IT9Z 5FO5A 1QZZA 1U8RA 2DI3A 3LL7A 1YOVB 3ZQCA 1V54H 3R60A 3WODF 1KYWA 2G7UA 3GUDA 2EIMH 2PJPA 4II2A 2R0QC 2BE5F 3TMOA 2IGKA 1YI2I 4IHTA 1UHSA 3M07A 3RYPA 1XC5A 4CCMA 3E6MA 4PSWA 3GZNB 3GTOJ 4I7HA 2KIQA 3W6JB 3GVAA 3MZ8A 3K9TA 1V55H 2VJIA 4HBLA 1RR7A 2L5QA 1R5HA 2JSCA 5IP6A 3S3OA 4IHYA 2ZJ2A 2VIXA 5J40A 2RAEA 2DLLA 4Q5SF 3DKYA 3ZPLA 1BR4A 2Z2SB 1CF7B 3S1MJ 1TWGJ 3E3VA 1EV7A 2P0WA 2CGPA 3TP0A 5E3MA 2HR3A 1YO5C 3C2BA 2DFEA 3PUBA 4HA8A 3MAJA 5CVIA 3UNGC 4I98B 2QQBA 1R36A 2CRGA 2XKPA 5ILUA 3C2GA 1T8IA 3JSPA 1MDMA 3H92A 1WJBA 5CPRB 2KZGA 1VQ4I 2EA2A 1B59A
chains in the Genus database with same CATH topology
2QYOA 1Q1HA 4U7DA 2FBKA 1LDKB 3VFZA 4LG0B 2H27A 4M74A 1H9GA 3R0AA 3ERED 4LLNA 2XKOA 3I4PA 4P96A 1DPRA 2E1NA 5A2QK 1IZ1A 2VT3A 4LMYA 3RPQA 3ZN1A 3WTYC 2M45A 4BNCA 1U78A 2E7XA 2ISYA 1U5TC 5KK1A 3ZQ7A 5J6XA 1FZPB 3LFKA 1B6AA 2ZXJA 3IKTA 3M8FA 1DUXC 1I1GA 3B73A 1SMTA 3KZZA 3WG9A 4HV6A 1BN5A 4EQQA 2GA1A 2H6CA 4WWCA 1K7AA 4S04A 4HQMA 2QLZA 3CDHA 1OYYA 3I5UA 1K6OA 3L2CA 3MZHA 2F2EA 2ETHA 4HX4A 2DW4A 2P6TA 1H0MA 2R7DA 2IJLA 4BH9A 3LWFA 3ULQB 1JXSA 2CFXA 3RDIA 1HW2A 3HOSA 1DP7P 1P4XA 3CLOA 1OR7A 1YS7A 1WRJA 2XHKA 4XSXF 2W25A 3ISPA 5LRRA 1U5TB 3LQRA 3L9FA 4HDVA 2O03A 4EM0B 2RGVA 5CVVA 5IT3A 2RV8A 3E5UA 2VE8A 5L3CA 2ZMEB 4IVNA 1BIAA 1LJ9A 2BGCA 3TO7A 4KIGA 2L4MA 2JPBA 4RGXA 5ERIA 4BAYA 1L0OC 1S7OA 5FD5A 4HF1A 1RNLA 4ZYGA 4U0VA 4HV5A 4UNOA 4MQVA 1HW5A 1TW2A 4EJTA 4KA4A 2JZYA 1Z9CA 3Q9VA 3PQJA 4BHPA 3M7GA 2A68F 4YFNF 3E6DA 3QP5A 1EH7A 5LRSA 5FFZA 1FX7A 4IPAA 2M87A 3G3ZA 1IN5A 1S7AA 4AVPA 3WTVC 4RB0A 1WSUA 3H3ZA 2DQLA 3FM3A 4HF2A 4Z2YA 3BDDA 2F5CA 2JTVA 2HKXA 4H0EA 2XAFA 3KE2A 1SMYF 4HZFA 4UVBA 2KIMA 3ABTA 3T1BA 3F8NA 3KP2A 5K1YA 4Q47A 3TOBA 4FT8A 4PDKA 5K5RA 4A5NA 4I01A 4G8XA 4LG0A 4AIJA 2EB7A 3Q5FA 3ZMVA 1TW3A 5LGNA 1Z6RA 1TLHB 4EJOA 4IRGA 3V8JA 3MCZA 3R6SA 3M1EA 1IRGA 4RS8A 2VT2A 4RGSA 3I59B 1ZAOA 1SD7A 3HUGA 3JAMZ 5BS6A 3QPTA 2F5EA 1IAWA 2HYFA 2BYVE 4EM2A 3QP6A 2XIGA 1ZGJA 3I64A 1G3WA 1ZG5A 2Z3YA 1ZYRF 3BJAA 4HX8A 2IA0A 2K27A 1P4AA 2MA3A 4G94A 4IJAA 4CGZA 3EUHA 1KQ9A 4CHUA 3CJNA 2DO7A 4EJVA 2EFWA 2HTJA 4NHJA 2UXNA 1F4KA 2O6GE 1RUOA 1TNSA 1I5ZA 2GIVA 2M1BA 2ZBKA 3KLOA 1U2WA 4L9VA 1QPMA 3RPUA 1FSEA 3BWGA 4IF4A 5D6FA 2NYXA 1I1SA 1R00A 3DPTA 4YFKF 3IWZA 5E1ZB 3GWZA 4L18B 1V3FA 1FSHA 3QRFF 5HOOA 2H09A 5H6RA 3WGGA 3HRSA 1SAXA 2D1VA 1LNWA 4LLLA 5E8GA 4CYDA 3DF8A 5F6FA 1KU9A 2LDUA 2E7WA 3HSFA 2DAOA 3HRUA 3WU1B 5FD6A 4EM1A 1J5YA 4JQFA 1FPQA 1SFEA 1QO0D 1WQ2A 1E2XA 4RGRA 1L3LA 2UZKA 3J81K 1TTYA 2P5VA 4CZZA 3VODA 5JVTA 2NNYA 1VTNC 2MC3A 5AIPA 2P7CB 4A0XA 1ZARA 5ICEA 2KJBA 2XRNA 1NHAA 1BI1A 1XCVA 2EFQA 3J80K 2FE3A 5D4SA 4UV9A 2K86A 1EH8A 5FLXK 5EEHA 3M8EA 4P55A 4WXDA 2BV6A 4OMYA 2HYGD 2L4AA 2V79A 1I6XA 2IRFG 3BY6A 1LVAA 5HS7A 1ZREA 3QOPA 1IF1A 3WTUC 4I09A 4WX9A 3ZN0A 2QVOA 1UCRA 3V7SA 3RIRA 2Y48A 1XSVA 1YLFA 4B8XA 1HKSA 4U7BA 3S2WA 3C18A 2YPRA 1T0FA 4KNYA 2MLKA 2YX7A 4XLPF 3DKWA 2FRHA 3HOTA 5CYVA 3JTHA 5CLSA 5D5UB 1U3EM 5LHGA 2AS5F 4ZH4F 3I58A 1XMKA 2P8TA 5LHHA 4EJWA 3LA2A 5L3DA 5JHUA 4ZYDA 2AXLA 4ESBA 1IN6A 3GO5A 1P6RA 5D5VB 1MJBA 2J5OA 4M6XA 1Z6TA 4BHCA 3RYRA 2A07F 3IWFA 1XN7A 2PBIA 2C6YA 2EK5A 3BROA 1J59A 3ML6A 2HDCA 5DCMB 3RKYA 1MZBA 2CG4A 2PG4A 2WTEA 1KU2A 1G3SA 2ZFWA 4WCGA 3U9GA 2DK5A 2QBYB 2RQPA 4AWXB 2XGXA 3BJ6A 2O8XA 4M6YA 3I54A 4GO1A 4MTDA 2MLGA 4HLYA 2DQRA 2OU2A 2QZ8A 3I0TA 5CVRA 3C3WA 4FX0A 4ASNA 5CJ9A 2W24A 1T39A 1T98A 1BI2A 2FBHA 4GYGA 1T2KA 2FNPA 3KEQA 3FXQA 1W5SA 5HDGA 2M5WA 5L3FA 4XSZF 3LA7A 3E6BA 4RAZA 2QWWA 5D4RA 3I53A 1OYIA 3TDUC 3C7JA 1FYKA 4MTEA 3ABUA 3WTTC 4KICA 3FM5A 1DPUA 3G73A 2OZUA 1P2FA 2OQRA 4O3MA 5D6EA 4FX4A 2EWNA 1FWZA 1LEAA 1YYVA 2VC0A 2STWA 2IW5A 1K78B 1V4RA 4KIFA 4ON0A 1FYMA 1XGNA 2Z5UA 1C0WA 6PAXA 2YR2A 1YW7A 2RC4A 3GX4X 4ENJA 3HSRA 2DT5A 1ZG1A 2LF7A 1RZ4A 1J2XA 2LKPA 3FWEA 1FBSA 3BP8A 2G9WA 1F9NA 5DCFA 2MD5A 4ZZDA 2VONA 1B9NA 1USTA 3CUQA 1O7LA 2EV0A 2FF4A 2ZNZA 3GFJA 2FNAA 1BC8C 2L3DA 2Y0MA 2VBZA 4N0BA 4R8HA 2WWYA 1IXCA 1YW8A 1O3SA 3F6VA 1Z91A 4M73A 4G6DA 4BHBA 5BQTA 4OIPF 4R1HA 2A3SA 5LGUA 2F5DA 1B1BA 4KIBA 2O0YA 3SZPA 2HWVA 5AIQA 2RDPA 5L3EA 2CW0F 4GGGA 3DPLC 1OYWA 2GWRA 2JRTA 1T38A 2M8EA 2RKHA 3EETA 4Q4ZF 2QENA 4QLCU 3SHFA 3P9IA 4ETSA 4KMUX 2NNNA 4ZYEA 2DK8A 2D45A 5LEKA 1HQCA 4G7ZF 2GA2A 2VBXA 2K4JA 1TQPA 4WXHA 5D8KB 2IT0A 5DCMA 3MQ0A 1IN8A 2PEXA 4XBFA 3MFKA 3R0JA 3DV8A 3NRVA 3K69A 1W7PD 1UFMA 2CQKA 4LB6B 2QBYA 4AIKA 2VC1A 3OV8A 1CF7A 2LNBA 2EFOA 2X4HA 3V7CA 3DP7A 4N9HA 4M9XA 1STZA 3P9CA 3F8CA 4ESFA 4HW0A 2K4BA 1JHFA 2L02A 4LJZF 4LFUA 5D8LB 1HBXG 2K02A 1TBXA 5IT9K 3JW4A 1F1ZA 4MGRA 3KP6A 2JPCA 5AONA 1USSA 3GZ5A 1KU7A 2FSWA 4L9TA 2XAJA 4RB3C 4U88A 2Y75A 3V8KA 3N4MA 1DDNA 1BI3A 4YIIA 4R79A 3T8TA 2OAZA 2XVCA 1K78A 2YU3A 1YQAA 3GXOA 4MQ9F 5DD8A 2QUFA 2EA4A 4KN7X 2PN6A 1ZRDA 3ZMSA 5HDNA 4G7HF 2LSOA 2OA4A 3HHGA 1TNTA 1ZG3A 5L3GA 1PDNC 1R1UA 2P6SA 4XRFA 1HKQA 2LF8A 2UWMA 1HXDA 5E20A 2GAUA 3FX3A 1KQ0A 1RUNA 4OMZA 5LBQA 1A04A 1YFHA 1R7JA 3C1DA 2A6HF 1KU3A 3TGNA 3HRTA 2A61A 1JGSA 4O6JA 4KUMA 5D5XB 1FT9A 5E17F 2UXXA 1U5TA 2XROA 2HEOA 4WXCA 1J0RA 5TJJA 5HDKA 3GEZA 1O3TA 3E5QA 2XAQA 2F5FA 4PCQA 5JFRA 2KRFA 4UV8A 3MEXA 3F21A 5LHIA 4UXNA 2GXBA 2FMYA 2ZMEA 4M71A 3HTUA 4D0PA 1E17A 1SFXA 4S05A 1X3UA 2J5PA 5E1XA 3HRMA 5FGMA 5DEQA 4AIHA 3J7AO 4A2UA 2O3FA 5J8FA 2OBPA 3O6BB 1R1VA 4LK1F 5HLGA 4CICA 2DFIA 5FFXA 3KP7A 3F3XA 4HF0A 5E1WA 1AWCA 2ZCWA 3SZTA 5BMZA 1OMIA 2IA2A 1D8JA 2V6CA 3MWMA 4U0YA 1Z7UA 1BIBA 1R23A 2CWEA 4ESJA 4OIRF 4YG2F 1BC7C 3ELKA 4EVIA 4EMSA 1JE8A 5K5OA 3RI4A 1SD5A 2W85A 3TO6A 3OOPA 1EH6A 2ADUA 2BBYA 1CGPA 4RAYA 1JHHA 1O3QA 2OQGA 3WU0A 2Q0OA 5HVQC 2ZO4A 3EDPA 1BI0A 1FNNA 3VEPA 1MGTA 3SXYA 2BEOA 2IPQX 1RI7A 2NS0A 4I2OA 2P4WA 1IXSB 4YFXF 1D8KA 2HTSA 2OD5A 2YX4A 2DTRA 4OINF 3O3KA 3WTZA 5CVUA 4IRHA 1W4MA 3GFIA 3I59A 2FU4A 2ISZA 3WE3A 1YS6A 4RB1A 1LQ1A 4G6QA 3LA3A 4LGWA 2G7HA 3LAPA 1IXRC 1IW7F 3L7WA 1I27A 3KP4A 3HIFA 4OIQF 4K2EA 2VN2A 5BOXA 2V1DA 1KQ8A 4A0YA 1W5TA 3TO9A 3LQQA 2FXAA 4L5JA 1FBQA 1PP7U 1R58A 1KA8A 3JSOA 3T8RA 3L09A 4EGZA 4MHGA 5FB2A 3QU6A 2P5KA 1PP8F 2P5LC 4EJUA 1MJAA 4HLXA 4NQWA 1ZN2A 2KIFA 3JAMK 3K1PA 3EYIA 2XAGA 1XDSA 4P9FA 5DD4A 1HSTA 3BPXA 4EV0A 3HYIA 2IA1A 3F23A 4LLGF 2FQ3A 4UVCA 2XAHA 2NRAC 3KEOA 3ECOA 3K2ZA 2GZWA 2WV0A 2V9VA 3WTXC 1ODDA 1PUEE 3GFMA 1XB4A 3WE2A 2DPDA 3QPHA 4A5MA 4OOIA 1G3TA 1K79A 2Z33A 1Y0UA 2PLYA 2COMA 4G7OF 2RNJA 4IRIA 3GFLA 2ESNA 3FHZA 2X0LA 1LDJA 3O2PE 4ZYHA 3F8MA 1H9TA 1OPCA 3FMRA 4Q48A 3FXRA 2A5YB 4P9UA 4IXAA 4HX7A 4PGHA 3T5XA 1QNTA 2DBBA 1YG2A 2Z99A 1YIOA 1BOAA 4RB2C 1HSJA 2ELHA 1R5GA 4QWQA 3V8LA 2R3SA 3K0LA 1W7PB 3ECHA 1GXPA 3DXJF 3TKYA 2IP2A 4AD9A 3F8BA 2GQQA 2EJRA 2VBWA 1FC3A 1ZHFA 4OU0A 4N9IA 2Q2EA 4MNUA 4LD5A 1KGSA 4Y15A 3K1MA 1XSXA 2HKOA 2QQAA 1ZRFA 3SFZA 2KIUA 2VE9A 2H6BA 5ICCA 3N97A 2H94A 3VB2A 1YTYA 4UVAA 1Z1DA 4LK0F 2QM3A 2ZKZA 5F1RA 1G3YA 2OZ6A 2WC2A 3F8FA 4A6DA 5HLHA 3TQNA 1FLIA 2M30A 2VOOA 1J75A 2L01A 2MBFA 2ACJA 5DV5A 3WTSC 1LB2A 1SD4A 3R4KA 3KETA 1OKRA 2GXGA 3REOA 3AAFA 2DU9A 3KZYA 1GVJA 3WTWC 4BXUA 4M9ZA 4M9SA 2D2WA 4KYWA 5F64A 3CO7C 1FY7A 1G4DA 4L0ZB 2JT1A 3LAJA 4Y17A 3J81Z 5BPIA 4CDGA 3DFGA 4A0ZA 2PMHA 1R22A 4HAMA 2NAZA 5JI6A 3H3UA 3GW2A 3J80Z 3RKXA 3F22A 1SFUA 2A6EF 2A69F 2V1UA 1XCBA 1ZLJA 5FLXZ 3BJOA 3F6OA 4XLNF 3FF5A 1IN7A 3BOQA 3F72A 2PQ8A 1WKMA 1ONVA 2VOPA 1RIOH 3BPVA 2V1XA 2QQ9A 3RJPA 3NQOA 3CO6C 3E6CC 3GYHX 2EA2A 1LDDA 4PZJA 4I02A 1ZH5A 3KCCA 2PI0A 1TQIA 1MD0A 5LGTA 3W6KB 3M9AA 3IL2A 3FZVA 3GLXA 3FMSA 4JK1X 4DQ2A 3PQKA 3KLNA 3ROUA 1S8NA 4I0BA 4WF2A 2PFBA 1YW9A 4P5OA 1TQMA 1G6NA 3NEUA 3RTRA 1S6LA 3V4GA 1IRFA 1W7PA 4ENNA 5LEJA 4JBAA 1XGMA 4ZZLA 4M72A 4E70A 2VBYA 1IN4A 1UB9A 1FP1D 2PMUA 3IRRA 2Z9OA 1GXQA 1WWXA 2HGCA 4L9NA 2FBIA 1ON1A 4IHSA 5ICGA 3RKWA 1ZRCA 2EFPA 3QU3A 3IHUA 3ZMZA 4F7ZA 3COAC 3VOEA 1P4WA 3CUOA 3IKVA 2EV6A 4A12A 3DEUA 5E8IA 4RGUA 2D1HA 2E1CA 3D0SA 3U1DA 3I71A 1LEBA 3KFWX 1FBUA 1SD6A 1REPC 1O57A 1UHWA 3DQVC 1AOYA 5D5WB 2RN7A 3CTAA 2KKOA 1MKMA 4HYEA 5DUIA 5ICFA 3GZ6A 4NB5A 2XASA 2B0LA 2VXZA 2RVCA 3Q9SA 4KFCA 3P7NA 4A6EA 4GXOA 3HHHA 3U2RA 4HQEA 5H6QA 4MEXF 4TV7A 1U6GA 3BZ6A 4B09A 3SQNA 5BPDA 5E18F 4L5IA 4CXFA 4L0YB 1WI9A 4KMFA 2CSOA 2FA5A 5A2QZ 4OIOF 5CVJA 1QQIA 2EFNA 3E97A 1XDUA 5K5QA 2HZTA 3B02A 3L00A 2MH9A 3LSTA 3TDZC 1B4AA 4U0WA 3HTSB 1MDMB 4HDUA 1O3RA 1D3YA 4ENMA 4HOBA 4KDPA 4EGYA 1BJAA 3TOAA 4KN4X 1HKTA 1XMAA 1XGSA 3WGHA 2HFHA 3T0YA 5ILVA 3WGIA 2HS5A 5KVRA 2EV5A 1D5VA 1GHCA 4CO8A 3V7RA 5DUKA 5TRDA 1UHMA 3R61A 1IUYA 3HSEA 4GCVA 4I0AA 4BYYA 3CUQC 2XUBA 1F5TA 1ON2A 2IVMA 2ZNYA 2HQNA 4ENKA 4WK8F 1QBJA 3IC7A 3PFIA 1T6SA 4DNCA 2P7VB 3K1NA 2Q8KA 4LB5A 2O61A 2L54A 3P9KA 3ZP5A 4MEYF 2XV4S 1XGOA 1FP2A 2MH2A 1S3JA 3EYYA 2ESHA 2KJCA 1BBYA 1Z05A 3EQLF 2TDXA 4G9YA 5LLQA 5HLIA 2W57A 2FOKA 1O7FA 3JTGA 5HS8A 4PGGA 1MJ9A 1KYZA 2R7FA 1FYLA 4BQAA 2HOEA 3CUQB 5L3BA 3IRQA 3E5XA 2FEZA 4Y13A 3ZMDA 1XD7A 5H20A 2FMLA 2HQRA 3KP5A 1J7KA 5DYMA 1QZYA 1ULYA 1FOKA 2YSRA 5JR3A 2STTA 3GF2A 3ZMTA 1B9MA 5DDGA 1QGPA 1S29A 3QAHA 4FHTA 2CO5A 4UUVA 4UHTA 1BM9A 1ZGAA 5EEGA 5ED4A 5HS9A 2CYYA 1ZLKA 3FXUA 4YIFA 1J9IA 2VODA 2W84A 1P92A 5J8CA 4O5VA 4GYIA 5ILSA 3D5LA 2K7LA 1R1TA 3FMQA 4L9JA 2DPUA 1XSDA 3MZYA 1HW1A 3ZMUA 3KP3A 5IT9Z 5FO5A 1QZZA 1U8RA 2DI3A 3WODF 3R60A 1KYWA 2G7UA 3GUDA 2PJPA 2BE5F 4IHTA 3RYPA 3E6MA 4I7HA 3W6JB 3GVAA 3K9TA 4HBLA 1R5HA 2JSCA 2ZJ2A 2DLLA 4Q5SF 3ZPLA 1CF7B 3E3VA 1EV7A 2CGPA 1YO5C 2HR3A 4HA8A 3MAJA 5CVIA 4I98B 2QQBA 1R36A 2XKPA 5ILUA 3JSPA 1MDMA 3H92A 4KT5C 1B59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYO A;  1Q1H A;  4U7D A;  2FBK A;  1LDK B;  3VFZ A;  4LG0 B;  2H27 A;  4M74 A;  1H9G A;  3R0A A;  3ERE D;  4LLN A;  2XKO A;  3I4P A;  4P96 A;  1DPR A;  2E1N A;  5A2Q K;  1IZ1 A;  2VT3 A;  4LMY A;  3RPQ A;  3ZN1 A;  3WTY C;  2M45 A;  4BNC A;  1U78 A;  2E7X A;  2ISY A;  1U5T C;  5KK1 A;  3ZQ7 A;  5J6X A;  1FZP B;  3LFK A;  1B6A A;  2ZXJ A;  3IKT A;  3M8F A;  1DUX C;  1I1G A;  3B73 A;  1SMT A;  3KZZ A;  3WG9 A;  4HV6 A;  1BN5 A;  4EQQ A;  2GA1 A;  2H6C A;  4WWC A;  1K7A A;  4S04 A;  4HQM A;  2QLZ A;  3CDH A;  1OYY A;  3I5U A;  1K6O A;  3L2C A;  3MZH A;  2F2E A;  2ETH A;  4HX4 A;  2DW4 A;  2P6T A;  1H0M A;  2R7D A;  2IJL A;  4BH9 A;  3LWF A;  3ULQ B;  1JXS A;  2CFX A;  3RDI A;  1HW2 A;  3HOS A;  1DP7 P;  1P4X A;  3CLO A;  1OR7 A;  1YS7 A;  1WRJ A;  2XHK A;  4XSX F;  2W25 A;  3ISP A;  5LRR A;  1U5T B;  3LQR A;  3L9F A;  4HDV A;  2O03 A;  4EM0 B;  2RGV A;  5CVV A;  5IT3 A;  2RV8 A;  3E5U A;  2VE8 A;  5L3C A;  2ZME B;  4IVN A;  1BIA A;  1LJ9 A;  2BGC A;  3TO7 A;  4KIG A;  2L4M A;  2JPB A;  4RGX A;  5ERI A;  4BAY A;  1L0O C;  1S7O A;  5FD5 A;  4HF1 A;  1RNL A;  4ZYG A;  4U0V A;  4HV5 A;  4UNO A;  4MQV A;  1HW5 A;  1TW2 A;  4EJT A;  4KA4 A;  2JZY A;  1Z9C A;  3Q9V A;  3PQJ A;  4BHP A;  3M7G A;  2A68 F;  4YFN F;  3E6D A;  3QP5 A;  1EH7 A;  5LRS A;  5FFZ A;  1FX7 A;  4IPA A;  2M87 A;  3G3Z A;  1IN5 A;  1S7A A;  4AVP A;  3WTV C;  4RB0 A;  1WSU A;  3H3Z A;  2DQL A;  3FM3 A;  4HF2 A;  4Z2Y A;  3BDD A;  2F5C A;  2JTV A;  2HKX A;  4H0E A;  2XAF A;  3KE2 A;  1SMY F;  4HZF A;  4UVB A;  2KIM A;  3ABT A;  3T1B A;  3F8N A;  3KP2 A;  5K1Y A;  4Q47 A;  3TOB A;  4FT8 A;  4PDK A;  5K5R A;  4A5N A;  4I01 A;  4G8X A;  4LG0 A;  4AIJ A;  2EB7 A;  3Q5F A;  3ZMV A;  1TW3 A;  5LGN A;  1Z6R A;  1TLH B;  4EJO A;  4IRG A;  3V8J A;  3MCZ A;  3R6S A;  3M1E A;  1IRG A;  4RS8 A;  2VT2 A;  4RGS A;  3I59 B;  1ZAO A;  1SD7 A;  3HUG A;  3JAM Z;  5BS6 A;  3QPT A;  2F5E A;  1IAW A;  2HYF A;  2BYV E;  4EM2 A;  3QP6 A;  2XIG A;  1ZGJ A;  3I64 A;  1G3W A;  1ZG5 A;  2Z3Y A;  1ZYR F;  3BJA A;  4HX8 A;  2IA0 A;  2K27 A;  1P4A A;  2MA3 A;  4G94 A;  4IJA A;  4CGZ A;  3EUH A;  1KQ9 A;  4CHU A;  3CJN A;  2DO7 A;  4EJV A;  2EFW A;  2HTJ A;  4NHJ A;  2UXN A;  1F4K A;  2O6G E;  1RUO A;  1TNS A;  1I5Z A;  2GIV A;  2M1B A;  2ZBK A;  3KLO A;  1U2W A;  4L9V A;  1QPM A;  3RPU A;  1FSE A;  3BWG A;  4IF4 A;  5D6F A;  2NYX A;  1I1S A;  1R00 A;  3DPT A;  4YFK F;  3IWZ A;  5E1Z B;  3GWZ A;  4L18 B;  1V3F A;  1FSH A;  3QRF F;  5HOO A;  2H09 A;  5H6R A;  3WGG A;  3HRS A;  1SAX A;  2D1V A;  1LNW A;  4LLL A;  5E8G A;  4CYD A;  3DF8 A;  5F6F A;  1KU9 A;  2LDU A;  2E7W A;  3HSF A;  2DAO A;  3HRU A;  3WU1 B;  5FD6 A;  4EM1 A;  1J5Y A;  4JQF A;  1FPQ A;  1SFE A;  1QO0 D;  1WQ2 A;  1E2X A;  4RGR A;  1L3L A;  2UZK A;  3J81 K;  1TTY A;  2P5V A;  4CZZ A;  3VOD A;  5JVT A;  2NNY A;  1VTN C;  2MC3 A;  5AIP A;  2P7C B;  4A0X A;  1ZAR A;  5ICE A;  2KJB A;  2XRN A;  1NHA A;  1BI1 A;  1XCV A;  2EFQ A;  3J80 K;  2FE3 A;  5D4S A;  4UV9 A;  2K86 A;  1EH8 A;  5FLX K;  5EEH A;  3M8E A;  4P55 A;  4WXD A;  2BV6 A;  4OMY A;  2HYG D;  2L4A A;  2V79 A;  1I6X A;  2IRF G;  3BY6 A;  1LVA A;  5HS7 A;  1ZRE A;  3QOP A;  1IF1 A;  3WTU C;  4I09 A;  4WX9 A;  3ZN0 A;  2QVO A;  1UCR A;  3V7S A;  3RIR A;  2Y48 A;  1XSV A;  1YLF A;  4B8X A;  1HKS A;  4U7B A;  3S2W A;  3C18 A;  2YPR A;  1T0F A;  4KNY A;  2MLK A;  2YX7 A;  4XLP F;  3DKW A;  2FRH A;  3HOT A;  5CYV A;  3JTH A;  5CLS A;  5D5U B;  1U3E M;  5LHG A;  2AS5 F;  4ZH4 F;  3I58 A;  1XMK A;  2P8T A;  5LHH A;  4EJW A;  3LA2 A;  5L3D A;  5JHU A;  4ZYD A;  2AXL A;  4ESB A;  1IN6 A;  3GO5 A;  1P6R A;  5D5V B;  1MJB A;  2J5O A;  4M6X A;  1Z6T A;  4BHC A;  3RYR A;  2A07 F;  3IWF A;  1XN7 A;  2PBI A;  2C6Y A;  2EK5 A;  3BRO A;  1J59 A;  3ML6 A;  2HDC A;  5DCM B;  3RKY A;  1MZB A;  2CG4 A;  2PG4 A;  2WTE A;  1KU2 A;  1G3S A;  2ZFW A;  4WCG A;  3U9G A;  2DK5 A;  2QBY B;  2RQP A;  4AWX B;  2XGX A;  3BJ6 A;  2O8X A;  4M6Y A;  3I54 A;  4GO1 A;  4MTD A;  2MLG A;  4HLY A;  2DQR A;  2OU2 A;  2QZ8 A;  3I0T A;  5CVR A;  3C3W A;  4FX0 A;  4ASN A;  5CJ9 A;  2W24 A;  1T39 A;  1T98 A;  1BI2 A;  2FBH A;  4GYG A;  1T2K A;  2FNP A;  3KEQ A;  3FXQ A;  1W5S A;  5HDG A;  2M5W A;  5L3F A;  4XSZ F;  3LA7 A;  3E6B A;  4RAZ A;  2QWW A;  5D4R A;  3I53 A;  1OYI A;  3TDU C;  3C7J A;  1FYK A;  4MTE A;  3ABU A;  3WTT C;  4KIC A;  3FM5 A;  1DPU A;  3G73 A;  2OZU A;  1P2F A;  2OQR A;  4O3M A;  5D6E A;  4FX4 A;  2EWN A;  1FWZ A;  1LEA A;  1YYV A;  2VC0 A;  2STW A;  2IW5 A;  1K78 B;  1V4R A;  4KIF A;  4ON0 A;  1FYM A;  1XGN A;  2Z5U A;  1C0W A;  6PAX A;  2YR2 A;  1YW7 A;  2RC4 A;  3GX4 X;  4ENJ A;  3HSR A;  2DT5 A;  1ZG1 A;  2LF7 A;  1RZ4 A;  1J2X A;  2LKP A;  3FWE A;  1FBS A;  3BP8 A;  2G9W A;  1F9N A;  5DCF A;  2MD5 A;  4ZZD A;  2VON A;  1B9N A;  1UST A;  3CUQ A;  1O7L A;  2EV0 A;  2FF4 A;  2ZNZ A;  3GFJ A;  2FNA A;  1BC8 C;  2L3D A;  2Y0M A;  2VBZ A;  4N0B A;  4R8H A;  2WWY A;  1IXC A;  1YW8 A;  1O3S A;  3F6V A;  1Z91 A;  4M73 A;  4G6D A;  4BHB A;  5BQT A;  4OIP F;  4R1H A;  2A3S A;  5LGU A;  2F5D A;  1B1B A;  4KIB A;  2O0Y A;  3SZP A;  2HWV A;  5AIQ A;  2RDP A;  5L3E A;  2CW0 F;  4GGG A;  3DPL C;  1OYW A;  2GWR A;  2JRT A;  1T38 A;  2M8E A;  2RKH A;  3EET A;  4Q4Z F;  2QEN A;  4QLC U;  3SHF A;  3P9I A;  4ETS A;  4KMU X;  2NNN A;  4ZYE A;  2DK8 A;  2D45 A;  5LEK A;  1HQC A;  4G7Z F;  2GA2 A;  2VBX A;  2K4J A;  1TQP A;  4WXH A;  5D8K B;  2IT0 A;  5DCM A;  3MQ0 A;  1IN8 A;  2PEX A;  4XBF A;  3MFK A;  3R0J A;  3DV8 A;  3NRV A;  3K69 A;  1W7P D;  1UFM A;  2CQK A;  4LB6 B;  2QBY A;  4AIK A;  2VC1 A;  3OV8 A;  1CF7 A;  2LNB A;  2EFO A;  2X4H A;  3V7C A;  3DP7 A;  4N9H A;  4M9X A;  1STZ A;  3P9C A;  3F8C A;  4ESF A;  4HW0 A;  2K4B A;  1JHF A;  2L02 A;  4LJZ F;  4LFU A;  5D8L B;  1HBX G;  2K02 A;  1TBX A;  5IT9 K;  3JW4 A;  1F1Z A;  4MGR A;  3KP6 A;  2JPC A;  5AON A;  1USS A;  3GZ5 A;  1KU7 A;  2FSW A;  4L9T A;  2XAJ A;  4RB3 C;  4U88 A;  2Y75 A;  3V8K A;  3N4M A;  1DDN A;  1BI3 A;  4YII A;  4R79 A;  3T8T A;  2OAZ A;  2XVC A;  1K78 A;  2YU3 A;  1YQA A;  3GXO A;  4MQ9 F;  5DD8 A;  2QUF A;  2EA4 A;  4KN7 X;  2PN6 A;  1ZRD A;  3ZMS A;  5HDN A;  4G7H F;  2LSO A;  2OA4 A;  3HHG A;  1TNT A;  1ZG3 A;  5L3G A;  1PDN C;  1R1U A;  2P6S A;  4XRF A;  1HKQ A;  2LF8 A;  2UWM A;  1HXD A;  5E20 A;  2GAU A;  3FX3 A;  1KQ0 A;  1RUN A;  4OMZ A;  5LBQ A;  1A04 A;  1YFH A;  1R7J A;  3C1D A;  2A6H F;  1KU3 A;  3TGN A;  3HRT A;  2A61 A;  1JGS A;  4O6J A;  4KUM A;  5D5X B;  1FT9 A;  5E17 F;  2UXX A;  1U5T A;  2XRO A;  2HEO A;  4WXC A;  1J0R A;  5TJJ A;  5HDK A;  3GEZ A;  1O3T A;  3E5Q A;  2XAQ A;  2F5F A;  4PCQ A;  5JFR A;  2KRF A;  4UV8 A;  3MEX A;  3F21 A;  5LHI A;  4UXN A;  2GXB A;  2FMY A;  2ZME A;  4M71 A;  3HTU A;  4D0P A;  1E17 A;  1SFX A;  4S05 A;  1X3U A;  2J5P A;  5E1X A;  3HRM A;  5FGM A;  5DEQ A;  4AIH A;  3J7A O;  4A2U A;  2O3F A;  5J8F A;  2OBP A;  3O6B B;  1R1V A;  4LK1 F;  5HLG A;  4CIC A;  2DFI A;  5FFX A;  3KP7 A;  3F3X A;  4HF0 A;  5E1W A;  1AWC A;  2ZCW A;  3SZT A;  5BMZ A;  1OMI A;  2IA2 A;  1D8J A;  2V6C A;  3MWM A;  4U0Y A;  1Z7U A;  1BIB A;  1R23 A;  2CWE A;  4ESJ A;  4OIR F;  4YG2 F;  1BC7 C;  3ELK A;  4EVI A;  4EMS A;  1JE8 A;  5K5O A;  3RI4 A;  1SD5 A;  2W85 A;  3TO6 A;  3OOP A;  1EH6 A;  2ADU A;  2BBY A;  1CGP A;  4RAY A;  1JHH A;  1O3Q A;  2OQG A;  3WU0 A;  2Q0O A;  5HVQ C;  2ZO4 A;  3EDP A;  1BI0 A;  1FNN A;  3VEP A;  1MGT A;  3SXY A;  2BEO A;  2IPQ X;  1RI7 A;  2NS0 A;  4I2O A;  2P4W A;  1IXS B;  4YFX F;  1D8K A;  2HTS A;  2OD5 A;  2YX4 A;  2DTR A;  4OIN F;  3O3K A;  3WTZ A;  5CVU A;  4IRH A;  1W4M A;  3GFI A;  3I59 A;  2FU4 A;  2ISZ A;  3WE3 A;  1YS6 A;  4RB1 A;  1LQ1 A;  4G6Q A;  3LA3 A;  4LGW A;  2G7H A;  3LAP A;  1IXR C;  1IW7 F;  3L7W A;  1I27 A;  3KP4 A;  3HIF A;  4OIQ F;  4K2E A;  2VN2 A;  5BOX A;  2V1D A;  1KQ8 A;  4A0Y A;  1W5T A;  3TO9 A;  3LQQ A;  2FXA A;  4L5J A;  1FBQ A;  1PP7 U;  1R58 A;  1KA8 A;  3JSO A;  3T8R A;  3L09 A;  4EGZ A;  4MHG A;  5FB2 A;  3QU6 A;  2P5K A;  1PP8 F;  2P5L C;  4EJU A;  1MJA A;  4HLX A;  4NQW A;  1ZN2 A;  2KIF A;  3JAM K;  3K1P A;  3EYI A;  2XAG A;  1XDS A;  4P9F A;  5DD4 A;  1HST A;  3BPX A;  4EV0 A;  3HYI A;  2IA1 A;  3F23 A;  4LLG F;  2FQ3 A;  4UVC A;  2XAH A;  2NRA C;  3KEO A;  3ECO A;  3K2Z A;  2GZW A;  2WV0 A;  2V9V A;  3WTX C;  1ODD A;  1PUE E;  3GFM A;  1XB4 A;  3WE2 A;  2DPD A;  3QPH A;  4A5M A;  4OOI A;  1G3T A;  1K79 A;  2Z33 A;  1Y0U A;  2PLY A;  2COM A;  4G7O F;  2RNJ A;  4IRI A;  3GFL A;  2ESN A;  3FHZ A;  2X0L A;  1LDJ A;  3O2P E;  4ZYH A;  3F8M A;  1H9T A;  1OPC A;  3FMR A;  4Q48 A;  3FXR A;  2A5Y B;  4P9U A;  4IXA A;  4HX7 A;  4PGH A;  3T5X A;  1QNT A;  2DBB A;  1YG2 A;  2Z99 A;  1YIO A;  1BOA A;  4RB2 C;  1HSJ A;  2ELH A;  1R5G A;  4QWQ A;  3V8L A;  2R3S A;  3K0L A;  1W7P B;  3ECH A;  1GXP A;  3DXJ F;  3TKY A;  2IP2 A;  4AD9 A;  3F8B A;  2GQQ A;  2EJR A;  2VBW A;  1FC3 A;  1ZHF A;  4OU0 A;  4N9I A;  2Q2E A;  4MNU A;  4LD5 A;  1KGS A;  4Y15 A;  3K1M A;  1XSX A;  2HKO A;  2QQA A;  1ZRF A;  3SFZ A;  2KIU A;  2VE9 A;  2H6B A;  5ICC A;  3N97 A;  2H94 A;  3VB2 A;  1YTY A;  4UVA A;  1Z1D A;  4LK0 F;  2QM3 A;  2ZKZ A;  5F1R A;  1G3Y A;  2OZ6 A;  2WC2 A;  3F8F A;  4A6D A;  5HLH A;  3TQN A;  1FLI A;  2M30 A;  2VOO A;  1J75 A;  2L01 A;  2MBF A;  2ACJ A;  5DV5 A;  3WTS C;  1LB2 A;  1SD4 A;  3R4K A;  3KET A;  1OKR A;  2GXG A;  3REO A;  3AAF A;  2DU9 A;  3KZY A;  1GVJ A;  3WTW C;  4BXU A;  4M9Z A;  4M9S A;  2D2W A;  4KYW A;  5F64 A;  3CO7 C;  1FY7 A;  1G4D A;  4L0Z B;  2JT1 A;  3LAJ A;  4Y17 A;  3J81 Z;  5BPI A;  4CDG A;  3DFG A;  4A0Z A;  2PMH A;  1R22 A;  4HAM A;  2NAZ A;  5JI6 A;  3H3U A;  3GW2 A;  3J80 Z;  3RKX A;  3F22 A;  1SFU A;  2A6E F;  2A69 F;  2V1U A;  1XCB A;  1ZLJ A;  5FLX Z;  3BJO A;  3F6O A;  4XLN F;  3FF5 A;  1IN7 A;  3BOQ A;  3F72 A;  2PQ8 A;  1WKM A;  1ONV A;  2VOP A;  1RIO H;  3BPV A;  2V1X A;  2QQ9 A;  3RJP A;  3NQO A;  3CO6 C;  3E6C C;  3GYH X;  2EA2 A;  1LDD A;  4PZJ A;  4I02 A;  1ZH5 A;  3KCC A;  2PI0 A;  1TQI A;  1MD0 A;  5LGT A;  3W6K B;  3M9A A;  3IL2 A;  3FZV A;  3GLX A;  3FMS A;  4JK1 X;  4DQ2 A;  3PQK A;  3KLN A;  3ROU A;  1S8N A;  4I0B A;  4WF2 A;  2PFB A;  1YW9 A;  4P5O A;  1TQM A;  1G6N A;  3NEU A;  3RTR A;  1S6L A;  3V4G A;  1IRF A;  1W7P A;  4ENN A;  5LEJ A;  4JBA A;  1XGM A;  4ZZL A;  4M72 A;  4E70 A;  2VBY A;  1IN4 A;  1UB9 A;  1FP1 D;  2PMU A;  3IRR A;  2Z9O A;  1GXQ A;  1WWX A;  2HGC A;  4L9N A;  2FBI A;  1ON1 A;  4IHS A;  5ICG A;  3RKW A;  1ZRC A;  2EFP A;  3QU3 A;  3IHU A;  3ZMZ A;  4F7Z A;  3COA C;  3VOE A;  1P4W A;  3CUO A;  3IKV A;  2EV6 A;  4A12 A;  3DEU A;  5E8I A;  4RGU A;  2D1H A;  2E1C A;  3D0S A;  3U1D A;  3I71 A;  1LEB A;  3KFW X;  1FBU A;  1SD6 A;  1REP C;  1O57 A;  1UHW A;  3DQV C;  1AOY A;  5D5W B;  2RN7 A;  3CTA A;  2KKO A;  1MKM A;  4HYE A;  5DUI A;  5ICF A;  3GZ6 A;  4NB5 A;  2XAS A;  2B0L A;  2VXZ A;  2RVC A;  3Q9S A;  4KFC A;  3P7N A;  4A6E A;  4GXO A;  3HHH A;  3U2R A;  4HQE A;  5H6Q A;  4MEX F;  4TV7 A;  1U6G A;  3BZ6 A;  4B09 A;  3SQN A;  5BPD A;  5E18 F;  4L5I A;  4CXF A;  4L0Y B;  1WI9 A;  4KMF A;  2CSO A;  2FA5 A;  5A2Q Z;  4OIO F;  5CVJ A;  1QQI A;  2EFN A;  3E97 A;  1XDU A;  5K5Q A;  2HZT A;  3B02 A;  3L00 A;  2MH9 A;  3LST A;  3TDZ C;  1B4A A;  4U0W A;  3HTS B;  1MDM B;  4HDU A;  1O3R A;  1D3Y A;  4ENM A;  4HOB A;  4KDP A;  4EGY A;  1BJA A;  3TOA A;  4KN4 X;  1HKT A;  1XMA A;  1XGS A;  3WGH A;  2HFH A;  3T0Y A;  5ILV A;  3WGI A;  2HS5 A;  5KVR A;  2EV5 A;  1D5V A;  1GHC A;  4CO8 A;  3V7R A;  5DUK A;  5TRD A;  1UHM A;  3R61 A;  1IUY A;  3HSE A;  4GCV A;  4I0A A;  4BYY A;  3CUQ C;  2XUB A;  1F5T A;  1ON2 A;  2IVM A;  2ZNY A;  2HQN A;  4ENK A;  4WK8 F;  1QBJ A;  3IC7 A;  3PFI A;  1T6S A;  4DNC A;  2P7V B;  3K1N A;  2Q8K A;  4LB5 A;  2O61 A;  2L54 A;  3P9K A;  3ZP5 A;  4MEY F;  2XV4 S;  1XGO A;  1FP2 A;  2MH2 A;  1S3J A;  3EYY A;  2ESH A;  2KJC A;  1BBY A;  1Z05 A;  3EQL F;  2TDX A;  4G9Y A;  5LLQ A;  5HLI A;  2W57 A;  2FOK A;  1O7F A;  3JTG A;  5HS8 A;  4PGG A;  1MJ9 A;  1KYZ A;  2R7F A;  1FYL A;  4BQA A;  2HOE A;  3CUQ B;  5L3B A;  3IRQ A;  3E5X A;  2FEZ A;  4Y13 A;  3ZMD A;  1XD7 A;  5H20 A;  2FML A;  2HQR A;  3KP5 A;  1J7K A;  5DYM A;  1QZY A;  1ULY A;  1FOK A;  2YSR A;  5JR3 A;  2STT A;  3GF2 A;  3ZMT A;  1B9M A;  5DDG A;  1QGP A;  1S29 A;  3QAH A;  4FHT A;  2CO5 A;  4UUV A;  4UHT A;  1BM9 A;  1ZGA A;  5EEG A;  5ED4 A;  5HS9 A;  2CYY A;  1ZLK A;  3FXU A;  4YIF A;  1J9I A;  2VOD A;  2W84 A;  1P92 A;  5J8C A;  4O5V A;  4GYI A;  5ILS A;  3D5L A;  2K7L A;  1R1T A;  3FMQ A;  4L9J A;  2DPU A;  1XSD A;  3MZY A;  1HW1 A;  3ZMU A;  3KP3 A;  5IT9 Z;  5FO5 A;  1QZZ A;  1U8R A;  2DI3 A;  3WOD F;  3R60 A;  1KYW A;  2G7U A;  3GUD A;  2PJP A;  2BE5 F;  4IHT A;  3RYP A;  3E6M A;  4I7H A;  3W6J B;  3GVA A;  3K9T A;  4HBL A;  1R5H A;  2JSC A;  2ZJ2 A;  2DLL A;  4Q5S F;  3ZPL A;  1CF7 B;  3E3V A;  1EV7 A;  2CGP A;  1YO5 C;  2HR3 A;  4HA8 A;  3MAJ A;  5CVI A;  4I98 B;  2QQB A;  1R36 A;  2XKP A;  5ILU A;  3JSP A;  1MDM A;  3H92 A;  4KT5 C;  1B59 A; 
#chains in the Genus database with same CATH topology
 2QYO A;  3CCL I;  2VKH A;  2VKV A;  3ZQG A;  3VDX A;  1Q1H A;  4M3F A;  4U7D A;  2FBK A;  1LDK B;  2Y30 A;  1HCR A;  4AVZ A;  3VFZ A;  1LFP A;  1F43 A;  4LG0 B;  4BBS J;  2VPR A;  3CCU I;  5F27 A;  4XOT A;  2H27 A;  2P81 A;  2HI3 A;  3RKQ A;  4M74 A;  3DLA A;  1H9G A;  3R0A A;  3ERE D;  4LLN A;  2XKO A;  3I4P A;  4P96 A;  3GTL J;  3I9V 2;  1DPR A;  4IOC F;  1OIS A;  2E1N A;  2ZXH A;  3PSI A;  5A2Q K;  1IZ1 A;  2VT3 A;  4LMY A;  3RPQ A;  4HNT A;  4RM2 A;  3ZN1 A;  4NNJ A;  3WTY C;  1MBH A;  2M45 A;  4BNC A;  1U78 A;  1TZL A;  1MND A;  3PIP F;  3TL4 X;  2E7X A;  2F48 A;  4A3J J;  2ISY A;  1VQM I;  1E3H A;  1U5T C;  5KK1 A;  3DWL E;  3ZQ7 A;  1MBF A;  1SAU A;  5J6X A;  1FZP B;  1NK2 P;  3LFK A;  3SZG A;  4ZTJ A;  1B6A A;  2ZXJ A;  2K85 A;  3IKT A;  2EQR A;  3M8F A;  1DUX C;  1I1G A;  1JI8 A;  3B73 A;  1SFO J;  1SMT A;  3KZZ A;  4NUB A;  3WG9 A;  5J4V A;  4HV6 A;  1IV6 A;  2XC7 A;  2LK2 A;  2W82 A;  4H4K C;  4RLQ A;  3DBR B;  1BN5 A;  4E7K A;  1V5E A;  4EQQ A;  2GA1 A;  2H6C A;  1VQ9 I;  1AKH A;  1ZEL A;  4WWC A;  2ZME C;  1K7A A;  2FQ4 A;  4S04 A;  4HQM A;  2QLZ A;  3CDH A;  1OYY A;  1X58 A;  4IHV A;  2R5Z A;  3I5U A;  4HNV A;  1MBG A;  1FTT A;  1K6O A;  3L2C A;  3MZH A;  1YRN B;  2F2E A;  4RBO A;  2CJJ A;  1U9O A;  3CZ6 A;  2DN0 A;  4YEL A;  3JRA A;  2ETH A;  4HX4 A;  3VPR A;  5M5X J;  3HGG A;  2DW4 A;  2P6T A;  3LFU A;  1H0M A;  2R7D A;  1ETO A;  3HKZ N;  2IJL A;  4BH9 A;  3LWF A;  3ULQ B;  1JXS A;  2CFX A;  3RDI A;  2VQH A;  3BR5 A;  1R9T J;  1HW2 A;  3HOS A;  1JJ6 C;  1H88 C;  1IUF A;  2NVX J;  1DP7 P;  1P4X A;  2R7S A;  3OYJ A;  3ZQL A;  3LSM A;  3CLO A;  1OR7 A;  1YS7 A;  4MO7 A;  2LRE A;  1WRJ A;  2XHK A;  3FXJ A;  4XSX F;  2W25 A;  3ISP A;  4C2T A;  4Y4R A;  3F0C A;  5LRR A;  1U5T B;  3LQR A;  3L9F A;  3HOZ J;  2E5N A;  2IGO A;  2HNH A;  2JN6 A;  4M6V A;  4HDV A;  1HC8 A;  3GCM A;  2O03 A;  2W48 A;  2QA4 I;  2M0C A;  2CQ7 A;  4EM0 B;  2QGU A;  2RGV A;  4HEA 2;  3BR6 A;  2R7T A;  2AQE A;  5CVV A;  1OCO H;  5IT3 A;  3CC2 I;  3KPH A;  2RV8 A;  3E5U A;  2VE8 A;  2ZSI B;  5L3C A;  3I56 I;  1WHU A;  2ZME B;  4IVN A;  1BIA A;  1LJ9 A;  2BGC A;  3PNV A;  3TO7 A;  5GAG J;  4KIG A;  2DA5 A;  2WY8 Q;  1OLT A;  2JPB A;  2L4M A;  1OCR H;  4RGX A;  5ERI A;  3FDY A;  4BAY A;  1L0O C;  3H0G J;  1S7O A;  5FD5 A;  4HF1 A;  1RNL A;  4ZYG A;  2IEK A;  3PNY A;  4G12 A;  4CCJ A;  5GTH C;  4U0V A;  4HV5 A;  4UNO A;  2EIN H;  2TCT A;  4MQV A;  1HW5 A;  1TW2 A;  3ONQ A;  4EJT A;  3K70 C;  3E0J B;  3FK7 A;  4KA4 A;  1TWA J;  2JZY A;  2R4G A;  1Z9C A;  3Q9V A;  3DU5 A;  3PQJ A;  1LFB A;  4BHP A;  3M7G A;  2A68 F;  4YFN F;  4MFE A;  3E6D A;  1N25 A;  3QP5 A;  3BG5 A;  1EH7 A;  5LRS A;  5FFZ A;  1FX7 A;  1Z21 A;  4IPA A;  3BG3 A;  2M87 A;  1VQ5 I;  2E35 A;  3G3Z A;  1X19 A;  1IN5 A;  1S7A A;  5FKN A;  1POG A;  4BQO A;  5M3M J;  3IH4 A;  4AVP A;  2H8W A;  1OFC X;  1YJN I;  5FRO A;  3WTV C;  4RB0 A;  1WSU A;  3H3Z A;  1T33 A;  4MIM A;  3PJR A;  1ZR4 A;  4IO9 F;  2DQL A;  4BY7 J;  3O8G A;  4NBQ A;  3FM3 A;  4HF2 A;  4Z2Y A;  3BDD A;  4BU2 A;  1T0F C;  1QHG A;  3CP2 A;  5IY5 H;  2F5C A;  2JTV A;  5C4X J;  5C44 J;  2HKX A;  2IXS A;  4UUS A;  2BY3 A;  2R5Y B;  2I8D A;  4H0E A;  4FE4 A;  2XAF A;  3KE2 A;  3S15 J;  1SMY F;  4HZF A;  2GBY A;  2R7U A;  4UVB A;  3HOY J;  2KIM A;  3ABT A;  3OYL A;  3T1B A;  3F8N A;  3KP2 A;  4AM3 A;  5GAH J;  5K1Y A;  4Q47 A;  1PUF B;  5B1A H;  3TOB A;  1R6R A;  4FT8 A;  4PDK A;  5K5R A;  4A5N A;  4I01 A;  3RQI A;  4B3A A;  4G8X A;  4LG0 A;  1A6Q A;  2EB7 A;  3SDG A;  4AIJ A;  3Q5F A;  3ZMV A;  2JA2 A;  2CFO A;  1TW3 A;  2X1E A;  1Z6R A;  5LGN A;  3IP4 B;  2VQC A;  1TLH B;  4EJO A;  4IRG A;  3V8J A;  3MCZ A;  3R6S A;  2E2H J;  3M1E A;  1JKO C;  1IRG A;  4RS8 A;  2VT2 A;  2DMQ A;  4BDY A;  2LG4 A;  3AG1 H;  2E2I J;  3K4M A;  4BJT A;  2IBD A;  4RGS A;  3I59 B;  1N77 A;  4AYB N;  4I6Z A;  2HQA A;  1ZAO A;  1XPX A;  2Y69 H;  1SD7 A;  3HUG A;  1HLV A;  2LTP A;  3JAM Z;  5BS6 A;  3QPT A;  2F5E A;  1IAW A;  2HYF A;  2RRE A;  5GAD J;  5IOZ A;  2BYV E;  1RR8 C;  4EM2 A;  4XRS A;  3QP6 A;  2XIG A;  1DU6 A;  1ZGJ A;  5GAE J;  3I64 A;  1G3W A;  3O8H A;  2K9S A;  1ZG5 A;  2KL4 A;  3DEW A;  3LOC A;  2Z3Y A;  1ZYR F;  3BJA A;  4HX8 A;  2V9P A;  3JRE A;  4C2M J;  2IA0 A;  1YJW I;  1IGN A;  1UZC A;  2DT7 B;  2K27 A;  1P4A A;  2MA3 A;  3S1R J;  1YRN A;  3KEY A;  4G94 A;  4IJA A;  3CME I;  1R71 A;  4CGZ A;  2CW8 A;  2L7F P;  2W4S A;  3EUH A;  4E7S A;  2L7Z A;  1KQ9 A;  4DGW B;  3OYM A;  4CHU A;  3CJN A;  5M5W J;  5E3O A;  2DO7 A;  4EJV A;  4D7N A;  2EFW A;  1EKE A;  1CQT A;  2DMP A;  2HTJ A;  2K5C A;  3JRH A;  4NHJ A;  4XLC A;  2UXN A;  2IGN A;  1S5L C;  1F4K A;  5M5Y J;  2O6G E;  2YU9 J;  1RUO A;  2A5W A;  2JVH A;  2MW8 A;  1TNS A;  1ETV A;  3GTK J;  1I5Z A;  2GIV A;  3BZC A;  2M1B A;  2RNG A;  3CJQ B;  3OYN A;  3CC7 I;  4HG2 A;  4NQW B;  1IJW C;  2N8G A;  3LSR A;  2JRM A;  5DS9 A;  2VXD A;  4IQJ A;  4E6K G;  1UJ8 A;  4QIW N;  2ZBK A;  2XGC A;  2LR8 A;  3MKY B;  1Z67 A;  1U2W A;  3KLO A;  2ICW G;  4L9V A;  4DZJ A;  1QPM A;  3RPU A;  1RKW A;  1FSE A;  3BWG A;  4IF4 A;  5D6F A;  2NYX A;  4E7I A;  1I1S A;  1R00 A;  1SC7 A;  3KIO A;  5GPC A;  3DPT A;  2KFD A;  4YFK F;  3IWZ A;  5E1Z B;  3GWZ A;  4L18 B;  1O4X A;  3GTJ J;  1V3F A;  3DLL F;  2BZT A;  3S14 J;  1FSH A;  3QRF F;  3I3L A;  1X4O A;  5HOO A;  1JUS A;  2WY7 Q;  1K4S A;  4QTR A;  4V2F A;  2XRL A;  2H09 A;  3ZOB A;  2GLO A;  2JQ7 A;  4Y3O A;  5H6R A;  3M1C A;  3WGG A;  3HRS A;  4IZZ A;  4BE0 A;  1NK3 P;  3S8P A;  5IYC J;  3IV5 A;  2ELJ A;  4V2G A;  1SAX A;  1Y1W J;  2FOW A;  1Z3X A;  4GRI A;  4E7L A;  1WPK A;  9ANT A;  2K3F A;  2DA7 A;  2D1V A;  1LNW A;  2R7O A;  3WHB A;  3IH2 A;  4XN0 A;  4LLL A;  5E8G A;  4CYD A;  3DF8 A;  5F6F A;  1KU9 A;  1A5J A;  2LDU A;  2E7W A;  4BE1 A;  3HSF A;  1A36 A;  2DAO A;  2HPM A;  2Y0S A;  3H3V K;  3HZJ A;  2WB1 N;  3HRU A;  5F04 A;  4IOA F;  3L1P A;  3WU1 B;  4BEH B;  2Y9Z A;  5FD6 A;  3DU6 A;  4EM1 A;  1W36 D;  1J5Y A;  4JQF A;  3RCO A;  1BA5 A;  2M2E A;  2OUM A;  3G71 I;  1FPQ A;  1SFE A;  1FOY A;  3H35 A;  1QO0 D;  1WQ2 A;  2HDW A;  1FTZ A;  1TWC J;  3A03 A;  4HNU A;  4CZC A;  3CCE I;  1UMQ A;  3RQ4 A;  1E2X A;  3DKX A;  4RGR A;  1L3L A;  2L2O A;  4FTH A;  2UZK A;  3J81 K;  1TTY A;  2P5V A;  2DCE A;  4CZZ A;  3VOD A;  2XPW A;  5JVT A;  2NNY A;  1VTN C;  1P7J A;  3DTI A;  2MC3 A;  5AIP A;  2P7C B;  2R5Y A;  4A0X A;  1ZAR A;  5ICE A;  2KJB A;  5JVG F;  2XRN A;  1NHA A;  1BI1 A;  1XCV A;  2EFQ A;  4XLA A;  3J80 K;  2FE3 A;  3CMM A;  4LIV A;  5D4S A;  1R4M B;  4UV9 A;  1A6I A;  2K86 A;  2Q2E B;  1EH8 A;  4E4H A;  5FLX K;  3SEZ A;  1GV5 A;  2I10 A;  5EEH A;  2IS2 A;  4XLF A;  3M8E A;  4P55 A;  4WXD A;  2BV6 A;  4RAF A;  2ID6 A;  4OMY A;  3EUA A;  1MBK A;  2HYG D;  3EUK L;  2L4A A;  2V79 A;  1I6X A;  2IRF G;  3BY6 A;  1LVA A;  1S7E A;  5HS7 A;  3L2U A;  1ZRE A;  1Y8R B;  4XLH A;  3QOP A;  2A05 A;  1IF1 A;  4Y33 A;  3WTU C;  4I09 A;  4WX9 A;  4PFP A;  3ZN0 A;  1WI3 A;  1V5G A;  1SVM A;  2QVO A;  2XAU A;  4C30 A;  2W7N A;  1UCR A;  3A1Y A;  4B47 A;  2EIL H;  3V7S A;  2IGM A;  3RIR A;  2K9L A;  1ZQ3 P;  2AXT C;  2Y48 A;  1XSV A;  1YLF A;  3HM5 A;  4B8X A;  2R7Z J;  1HKS A;  2BXZ A;  4XOP A;  4U7B A;  1I39 A;  1P7I A;  3S2W A;  2JVG A;  3KYD B;  5IYB J;  2FJ1 A;  2QSF X;  2QSG X;  3C18 A;  2YPR A;  1T0F A;  3E1S A;  4A69 C;  2YUS A;  5JLW A;  2MLK A;  2LY9 A;  4KNY A;  1MNE A;  2YX7 A;  4BL0 B;  2XGE A;  4XLP F;  3DKW A;  2FRH A;  3HOT A;  5CYV A;  3JTH A;  1YE9 A;  5CLS A;  5D5U B;  1U3E M;  4Y7N J;  5LHG A;  3DBH B;  2AS5 F;  1VQ6 I;  4ZH4 F;  3WHC A;  2EPF A;  3I58 A;  1XMK A;  3PL8 A;  4N4O B;  2DA3 A;  1PYV A;  2P8T A;  2LKS A;  1HF0 A;  1R5I D;  1D1C A;  4UB8 C;  3FKJ A;  5LHH A;  4M3D A;  4YEJ A;  3K4J A;  2OCE A;  4EJW A;  3OS1 A;  2F4O B;  3LA2 A;  4C3I J;  2ECC A;  5L3D A;  2EIJ H;  5JHU A;  3H9G A;  4ZYD A;  2AXL A;  1MMA A;  2DA1 A;  4ESB A;  1IN6 A;  1A35 A;  3GO5 A;  2TRT A;  5FKO A;  1P6R A;  1IO2 A;  4L5E A;  3HDD A;  2JUC A;  5D5V B;  2X9D A;  3ASN H;  4BJ6 C;  1MJB A;  2J5O A;  4OAY A;  4M6X A;  2GM4 A;  1Z6T A;  4BHC A;  1MH3 A;  2XF5 A;  1W1W E;  2ZXI A;  3RYR A;  2A07 F;  3IWF A;  2CUZ A;  4RA2 A;  3OOU A;  1XN7 A;  1BR2 A;  2HVQ A;  1FMW A;  2LBF B;  4PK4 A;  1F36 A;  2QF7 A;  2PBI A;  2C6Y A;  3L2W A;  3QYE A;  2EK5 A;  3BRO A;  4DYC A;  4RAG A;  3S2H J;  4B1R A;  3W2V A;  1J59 A;  4ABZ A;  3ML6 A;  3S3M A;  2ZJQ F;  2HDC A;  2E19 A;  5DCM B;  5TIS C;  3RKY A;  1MZB A;  1A31 A;  4HRI A;  3K4L A;  2CG4 A;  2PG4 A;  1QU3 A;  2WTE A;  3JR9 A;  3A02 A;  2KMU A;  2R93 J;  3WU2 C;  1KU2 A;  4F52 A;  3A2K A;  3VWB A;  4NC7 A;  1G3S A;  2ZFW A;  2H1L A;  4WCG A;  3CC4 I;  3U9G A;  2DK5 A;  2LYC A;  2RQP A;  3W2W A;  3TED A;  2QBY B;  4AWX B;  1ZKG A;  3HL2 A;  2XGX A;  3BJ6 A;  2O8X A;  4M6Y A;  5J47 A;  3I54 A;  4GO1 A;  2X85 A;  1OJL A;  4MTD A;  2MLG A;  3JRD A;  4HLY A;  2DQR A;  3CD6 I;  2OU2 A;  2QZ8 A;  1AA7 A;  3JRI A;  3I0T A;  5CVR A;  3OYG A;  2O9L A;  3C3W A;  2M9H A;  4FX0 A;  2M4G A;  4ASN A;  5CJ9 A;  1S72 I;  2W24 A;  1T39 A;  1T98 A;  1BI2 A;  4IKF A;  2DJN A;  5CKT A;  1LE8 A;  2FBH A;  4GYG A;  3FXK A;  1T2K A;  1D5Y A;  1HA8 A;  5B5E C;  2HVR A;  3U21 A;  2FNP A;  3KEQ A;  2ZXW H;  3FXQ A;  3V42 A;  2LMD A;  2LP0 A;  1W5S A;  5HDG A;  1YIJ I;  2M5W A;  2VJ5 A;  5L3F A;  4XSZ F;  4XRM A;  3LA7 A;  4J19 A;  2VPL A;  4XM3 A;  3E6B A;  3IAS 2;  4RAZ A;  4XID A;  2QWW A;  5D4R A;  3I53 A;  1NG6 A;  1OYI A;  3TDU C;  3C7J A;  5JHF A;  1FYK A;  4JX4 A;  3AG2 H;  4MTE A;  3ABU A;  4PJM A;  1VQP I;  3WTT C;  3CDI A;  4KIC A;  3A01 A;  3FM5 A;  1DPU A;  2LRD A;  2ME0 A;  3OS0 A;  1ZK8 A;  1IRZ A;  4BAC A;  3G73 A;  2PMZ N;  2OZU A;  1P2F A;  1WFX A;  2OQR A;  2KDZ A;  4O3M A;  5D6E A;  4XIC A;  4FX4 A;  2OTL I;  2W1O A;  4BS9 A;  2EWN A;  1FWZ A;  4M3G A;  1LEA A;  3ABK H;  1EA3 A;  2CV1 A;  1YYV A;  1K83 J;  4BDZ A;  3CJR B;  2VC0 A;  2BVL A;  1Y6I A;  2QKL B;  3H5A A;  1DGR M;  2JK3 A;  2OCC H;  4PSX A;  2STW A;  3ZCO A;  2IW5 A;  2F6C A;  1K78 B;  1V4R A;  4KIF A;  5HOD A;  2XPU A;  4ON0 A;  1FYM A;  1XGN A;  3K10 A;  3B6A A;  1AU7 A;  5K7F A;  4LOC A;  2Z5U A;  1VQ7 I;  3RZD J;  3OMY A;  1C0W A;  6PAX A;  3QOD A;  2YR2 A;  1YW7 A;  4JX6 A;  2RC4 A;  3GX4 X;  4ENJ A;  3HKZ A;  3HSR A;  2DT5 A;  2BOL A;  3DCF A;  1ZG1 A;  1MBE A;  4A3C J;  2LF7 A;  2Q1Z B;  1RZ4 A;  3W6V A;  3OIO A;  4JYK A;  1J2X A;  2M34 A;  2PJR B;  2LKP A;  3FWE A;  3OL3 A;  5HLT A;  1FBS A;  3BP8 A;  2E2J J;  3B6C A;  4C3H J;  3Q0V A;  2G9W A;  1F9N A;  5DCF A;  2MD5 A;  1WJE A;  4ZZD A;  2VON A;  1B9N A;  2ZB9 A;  2XB0 X;  1UST A;  2WAF A;  2OV7 A;  3CUQ A;  4CYC A;  1O7L A;  2EV0 A;  2FF4 A;  4KIS A;  2E34 A;  2ZNZ A;  3GFJ A;  1IDZ A;  5J1U A;  4XK4 A;  2FNA A;  2NOJ B;  3OWT A;  2MC4 A;  2JSP A;  1BC8 C;  2L3D A;  3NAU A;  2Y0M A;  2VBZ A;  1HDP A;  1OCP A;  1RPW A;  4BQN A;  4N0B A;  1B8I B;  2MFZ A;  4R8H A;  2WWY A;  1IXC A;  1YW8 A;  2VQL A;  3Q3S A;  5GP9 A;  3F6V A;  1O3S A;  1Z91 A;  3UKG A;  4M73 A;  4G6D A;  2CUF A;  4BHB A;  5BQT A;  3FK6 A;  1RES A;  3PO2 J;  4OIP F;  3OY9 A;  1IC8 A;  4R1H A;  2A3S A;  5IPA A;  5LGU A;  4ZJZ A;  2F5D A;  1B1B A;  4KIB A;  2O0Y A;  3SZP A;  2HWV A;  5AIQ A;  2RDP A;  5L3E A;  2R92 J;  3N05 A;  2CW0 F;  4NC8 A;  4E7J A;  4GGG A;  2BW3 B;  3DPL C;  2MSY A;  4PFO A;  1OYW A;  4HST A;  3J7Z I;  2GWR A;  2M7A A;  4XN3 A;  2JRT A;  1T38 A;  2M8E A;  2RKH A;  3EET A;  1ETK A;  2X6O A;  4C9Y A;  4Q4Z F;  3OYK A;  3E7L A;  3ZQH A;  2QEN A;  1PJR A;  4U87 A;  4QLC U;  3SHF A;  3P9I A;  4ETS A;  2FUG 2;  4KMU X;  1B72 B;  2XSJ C;  2O5R A;  1JGG A;  2NNN A;  3AG4 H;  2HZD A;  2E36 A;  4ZYE A;  2M3A A;  2DK8 A;  1Y39 A;  3S3N A;  4F3Q A;  2D45 A;  5LEK A;  1HQC A;  4G7Z F;  4FCY A;  2GA2 A;  2VBX A;  1WGX A;  4EEF G;  2VJ4 A;  2JA8 J;  3VSK A;  2K4J A;  1TQP A;  3HPH A;  4JOM A;  4WXH A;  5D8K B;  2IT0 A;  4CSW A;  5DCM A;  2HYJ A;  2QQ8 A;  1FEX A;  4IL6 C;  1N78 A;  3MQ0 A;  3JRF A;  1IN8 A;  2PEX A;  4XBF A;  3MFK A;  3BCB A;  3R0J A;  1X1D A;  3DV8 A;  1FMV A;  3FIS A;  3NRV A;  3K69 A;  1W7P D;  1UFM A;  2CQK A;  4LB6 B;  3IAM 2;  2QBY A;  1TC3 C;  1OCT C;  2WBM A;  2DJI A;  4AIK A;  2VC1 A;  3BR3 A;  1MH4 A;  5IYD J;  3VYS B;  1WVR A;  3OV8 A;  5B1B H;  1W36 C;  1CF7 A;  3I55 I;  2LNB A;  2EFO A;  3GTQ J;  2X4H A;  2V7F A;  3V7C A;  2L7K A;  3DP7 A;  3FXL A;  1U9N A;  3BTL A;  3CCJ I;  4N9H A;  1X2N A;  4M9X A;  1D0Z A;  1STZ A;  3P9C A;  1W0U A;  3F8C A;  4X1E A;  4ESF A;  5B66 C;  4HW0 A;  1Z0X A;  2K4B A;  3G2B A;  1JHF A;  2L02 A;  3BG7 A;  4LJZ F;  2R7Q A;  4LFU A;  3LSP A;  5D8L B;  5E3L A;  1HBX G;  2K02 A;  5IP9 J;  1TBX A;  3BLY A;  5IT9 K;  2H8R A;  2H1K A;  4MFD A;  3JW4 A;  3D5R C;  1F1Z A;  1Z3Y A;  4MGR A;  3KP6 A;  2JPC A;  1HOM A;  2NS7 A;  5AON A;  1USS A;  3HEF A;  3GZ5 A;  1KU7 A;  1WCM J;  2FSW A;  2X51 A;  4BBR J;  4L9T A;  2COB A;  2MYS A;  3RSN A;  3LSI A;  3JRC A;  2XAJ A;  4RB3 C;  4U88 A;  2Y75 A;  5FLV A;  3V8K A;  1BW5 A;  3N4M A;  1DDN A;  3MMY B;  2LD5 A;  1YX3 A;  4AYB A;  2O7O A;  1EJ9 A;  2AO9 A;  1BI3 A;  4F92 B;  2NXN B;  4YII A;  1VZ0 A;  1NG7 A;  1TT0 A;  2JA5 J;  2WA0 A;  4R79 A;  1VQN I;  2ZSH B;  3GBG A;  2DA6 A;  3T8T A;  4A3K J;  2OAZ A;  1I50 J;  2XVC A;  2QKM B;  1K78 A;  1ACI A;  2YU3 A;  1YQA A;  3GXO A;  4MQ9 F;  5DD8 A;  2JMW A;  2QUF A;  3LMM A;  2EA4 A;  3QWL A;  5KAI C;  4KN7 X;  2KLO A;  2PN6 A;  2D5V A;  1ZRD A;  1X1A A;  1Z77 A;  5C4J J;  3ZMS A;  3MVP A;  5HDN A;  5C3E J;  4G7H F;  3F9K A;  2LSO A;  1U0J A;  2OA4 A;  3HHG A;  4QPQ A;  1IV8 A;  1TNT A;  4JX5 A;  1ZG3 A;  2PX9 A;  5L3G A;  1PDN C;  1R1U A;  2HOS A;  2Y9Y A;  3BG9 A;  2P6S A;  4XRF A;  5E3N A;  1HKQ A;  2PJR A;  3VYR B;  3ABL H;  1XS9 A;  2LF8 A;  3NWT A;  3GTP J;  2UWM A;  2XB5 A;  1BW6 A;  4BE2 A;  1TL8 A;  3K4C A;  1HXD A;  2CU7 A;  5E20 A;  2GAU A;  3FX3 A;  1VQK I;  1KQ0 A;  1RUN A;  2DMN A;  1IDY A;  3K4K A;  4OMZ A;  2CQQ A;  5LBQ A;  1A04 A;  3LSK A;  1YFH A;  4XNF A;  1R7J A;  3C1D A;  2HU9 A;  2A6H F;  1KU3 A;  3TGN A;  1ZR2 A;  4AID A;  3HRT A;  2A61 A;  2ZJR F;  1JGS A;  1WJD A;  4O6J A;  4KUM A;  5D5X B;  1FT9 A;  5E17 F;  3K7A J;  2UXX A;  1XX5 A;  3DBL B;  4J01 A;  1U5T A;  2XRO A;  5HNH A;  3A0H C;  3TP3 A;  4YRV A;  1BL0 A;  2HEO A;  3ASO H;  2E60 A;  4WXC A;  1J0R A;  4W97 A;  3ZQF A;  5TJJ A;  5HDK A;  3GEZ A;  2EZI A;  1O3T A;  5HNF A;  1PVE A;  5DM6 F;  3E5Q A;  2K3P A;  1TWF J;  3NWS A;  4I99 C;  2O8K A;  2XAQ A;  2F5F A;  3H36 A;  4PCQ A;  5JFR A;  1SFK A;  5IOY A;  2KRF A;  4UV8 A;  3MEX A;  3F21 A;  4XKV A;  4UXN A;  5LHI A;  3MKZ A;  2GXB A;  2FMY A;  2NVU B;  2LOO A;  2ZME A;  4D1Q A;  3MKL A;  4M71 A;  1P9Q C;  2BW3 A;  3HTU A;  2X6W A;  3OL4 A;  1JUM A;  4D0P A;  3CCM I;  3S93 A;  1E17 A;  3BTI A;  1SFX A;  4S05 A;  1X3U A;  2J5P A;  5FJ8 J;  3AFH A;  4XOR A;  5E1X A;  2L7M P;  3HRM A;  1SEU A;  3HOU J;  4BXF A;  5FKK A;  5FGM A;  3H9Q A;  5DEQ A;  3IUO A;  4J00 A;  3J7A Y;  1I3Q J;  4AIH A;  5CQE A;  3J7A O;  3W2A A;  3HC7 A;  2WAQ N;  4A2U A;  2O3F A;  1KZH A;  5FLM J;  4ITV A;  3G4S I;  5J8F A;  4FIS A;  2OBP A;  1UG2 A;  1R1V A;  3BR2 A;  3O6B B;  4LK1 F;  4CIC A;  5HLG A;  2KRC A;  2DFI A;  5FFX A;  3KP7 A;  3F3X A;  4HF0 A;  5E1W A;  2WB1 A;  1AWC A;  5J1R A;  2ZCW A;  3SZT A;  5BMZ A;  1OMI A;  2IA2 A;  3OYH A;  2XSD C;  1D8J A;  2V6C A;  1MW7 A;  3MWM A;  3ERM A;  3FBN B;  2B63 J;  5E79 C;  1QHH D;  2DOF A;  3VSL A;  4U0Y A;  1Z7U A;  1WJC A;  1BIB A;  1R23 A;  2DTZ A;  4CH7 A;  2LY1 A;  5DM7 F;  4B4C A;  4PJL A;  2B9S A;  4W1U A;  2CWE A;  2M7B A;  4ESJ A;  1X3Z B;  2Y31 A;  3K2A A;  4OIR F;  3K6G A;  4YG2 F;  1BC7 C;  1UG0 A;  3ELK A;  4RLF A;  1OQY A;  4EVI A;  2CQN A;  2F4M B;  4EMS A;  2CUE A;  1JE8 A;  1X4P A;  4DZP A;  5K5O A;  3RI4 A;  4DJA A;  1SD5 A;  2W85 A;  2EZH A;  1MMS A;  3TO6 A;  1RRJ A;  3SEQ A;  3OOP A;  1EH6 A;  2JA7 J;  2ADU A;  1T95 A;  2BBY A;  1CGP A;  2MG4 A;  2VKD A;  3CP8 A;  4RAY A;  3SJM A;  1JHH A;  5EZH A;  1O3Q A;  1PUF A;  2OQG A;  3WU0 A;  2Q0O A;  5HVQ C;  2ZO4 A;  3EDP A;  5KAF C;  1BI0 A;  1FNN A;  4BUP A;  3VEP A;  2NOG A;  1MGT A;  3SXY A;  2BEO A;  3S1Q J;  2IPQ X;  1RI7 A;  2NS0 A;  1MMG A;  3HG9 A;  4I2O A;  3DTE A;  2P4W A;  1IXS B;  4YFX F;  1MSF C;  3OYA A;  1D8K A;  3CDL A;  2HTS A;  2OD5 A;  2YX4 A;  2DTR A;  4OIN F;  3O3K A;  1AKH B;  4E7Z A;  3WTZ A;  4AU7 A;  5EGO B;  4AC0 A;  5CVU A;  4IRH A;  2EH3 A;  1W4M A;  3GFI A;  3I59 A;  2FU4 A;  2ISZ A;  3WE3 A;  1YS6 A;  2DT6 A;  3NAR A;  4RB1 A;  1LQ1 A;  1FOW A;  4PUS A;  1X2M A;  1H8A C;  4QSH A;  4IQ4 A;  4AUX A;  2GXA A;  3FKI J;  4G6Q A;  3I4M J;  3LA3 A;  4LGW A;  2R7X A;  1ETY A;  2G7H A;  3LAP A;  2XGD A;  1IXR C;  1IW7 F;  3BQZ A;  2Z1D A;  3QOE A;  2L0K A;  3L7W A;  2OF7 A;  1I27 A;  3KP4 A;  2QCO A;  1JJ8 C;  3HIF A;  3LSH A;  5IP7 J;  4OIQ F;  4K2E A;  2JJ7 A;  2IS1 A;  2VN2 A;  3PM1 A;  5BOX A;  4XR6 A;  4B44 A;  2V1D A;  1KQ8 A;  3OYF A;  4A0Y A;  1W5T A;  3BT9 A;  3CLQ A;  3TO9 A;  1VF9 A;  4DYR A;  1GV2 A;  3LQQ A;  3ABM H;  2FXA A;  2VLA A;  3AL0 C;  3QQA A;  4L5J A;  1FJL A;  1FBQ A;  2EBI A;  1D1A A;  4B48 A;  1PP7 U;  1JKR C;  1G59 A;  1R58 A;  1KA8 A;  3JSO A;  3T8R A;  2XF7 A;  1GT0 C;  4RMN A;  3L09 A;  5H2F C;  3PNT A;  1D1B A;  4EGZ A;  4MHG A;  5FB2 A;  4IHW A;  3QU6 A;  3LNQ A;  2P5K A;  4Z6Y A;  3CJT B;  2BY2 A;  1PP8 F;  2ZJP F;  2P5L C;  2DXI A;  4EJU A;  1MJA A;  4HLX A;  4ZC3 A;  4NQW A;  1LKX A;  1ZN2 A;  2KIF A;  3JAM K;  3K1P A;  1QVU A;  4OAZ A;  4B43 A;  2CH0 A;  5EEA A;  1SVL A;  3EYI A;  1J09 A;  2XAG A;  1XDS A;  4P9F A;  1D0X A;  2K9Q A;  5DD4 A;  1HST A;  1X1B A;  3ZQQ A;  3J7Y J;  3GME A;  3BPX A;  3VYU B;  3TW6 A;  4EV0 A;  3HYI A;  4OWR B;  2IA1 A;  3P5J A;  4LLG F;  3F23 A;  2FQ3 A;  5F0H A;  4UVC A;  4A3M J;  1RC9 A;  2IAI A;  5J3L A;  2XAH A;  2NRA C;  3KEO A;  3ECO A;  3K2Z A;  3SYT A;  2HXO A;  2GZW A;  2WV0 A;  2V9V A;  2DA4 A;  2DOD A;  4S0H B;  3WTX C;  1ODD A;  1PUE E;  3GFM A;  2L9V A;  5EZG A;  1XB4 A;  3WE2 A;  2DPD A;  3QPH A;  4A5M A;  4GDF A;  4OOI A;  4F93 B;  4FE7 A;  1G3T A;  3QPS A;  1JKP C;  1K79 A;  1M1E B;  2Z33 A;  3MKW B;  1YX5 A;  3AL0 B;  2L9R A;  1Y0U A;  3JRB A;  4IEJ A;  2PLY A;  2COM A;  4CCO A;  4G7O F;  2RNJ A;  4IRI A;  3GFL A;  2ESN A;  3GTG J;  2DFH A;  3FHZ A;  2X0L A;  1LDJ A;  3O2P E;  4ZYH A;  4IHX A;  3F8M A;  1H9T A;  1OPC A;  4DIQ A;  3FMR A;  4Q48 A;  3FXR A;  2A5Y B;  5FKM A;  5EF6 A;  4P9U A;  4XON A;  3HPG A;  4XKB A;  4IXA A;  1E3P A;  5GPA A;  4UUS B;  2PMZ A;  4HX7 A;  1JKQ C;  4XMY A;  4BEH A;  3M4O J;  4PGH A;  3T5X A;  1QNT A;  2IS4 A;  4BKX A;  4A3D J;  2DBB A;  3HXL A;  1BR1 A;  1FOX A;  1YG2 A;  2Z99 A;  1U8B A;  1WH5 A;  1YIO A;  4B3X A;  3HBL A;  4HPQ A;  2HXI A;  1BOA A;  2EIK H;  3OSG A;  2WV1 A;  1YIT I;  2VL8 A;  2VQG A;  4RB2 C;  1HSJ A;  2DYR H;  2ELH A;  1R5G A;  4QWQ A;  3V8L A;  3X2Q H;  3QYB A;  1Y56 A;  1NTC A;  2R3S A;  3K0L A;  1W7P B;  3JRG A;  3ECH A;  4LIT A;  1GXP A;  3EUH C;  3DXJ F;  3TKY A;  1UEL B;  2OTJ I;  2IP2 A;  4AD9 A;  4ZDO A;  2KPM A;  2MAB A;  3F8B A;  3FBI B;  4QPO A;  2V6E A;  2GQQ A;  2EJR A;  2VBW A;  5M3F J;  2CV2 A;  1FC3 A;  3S32 A;  1ZHF A;  3I4N J;  4OU0 A;  1TT5 B;  2LC2 A;  4D5F A;  2LFB A;  4N9I A;  3S2D J;  1YJ9 I;  2Q2E A;  4MNU A;  4LD5 A;  5K7Z A;  2ECB A;  1KGS A;  1V5F A;  3K1M A;  4Y15 A;  1Y8Q B;  3GLL A;  1I6H J;  1XSX A;  3KZI C;  2DYS H;  2VUM J;  2LVS A;  4ZYA A;  2HKO A;  3HUG B;  2QQA A;  3BCA A;  5KNL A;  2XF6 A;  4CUG A;  1ZRF A;  1Y0N A;  3SFZ A;  3CMA I;  3CES A;  3HOV J;  2KIU A;  4JP0 A;  2VE9 A;  2H6B A;  5EGO A;  3VYT B;  5ICC A;  2Y2Z A;  3N97 A;  3S1N J;  3RZO J;  2H94 A;  3VB2 A;  1YTY A;  4UVA A;  1GVD A;  4Y52 J;  1Z1D A;  2DMT A;  4LK0 F;  2QM3 A;  2DOA A;  3BC8 A;  4BY1 J;  2ZKZ A;  3H5N A;  5F1R A;  4GFB A;  1G3Y A;  2ELK A;  5F0C A;  2OZ6 A;  3L2Q A;  2WC2 A;  3SDB A;  3F8F A;  4A6D A;  5HLH A;  2HOA A;  4D9J A;  3TQN A;  2HVS A;  5FKL A;  2M30 A;  1FLI A;  2K9M A;  2BHY A;  4PJJ A;  2KRH A;  2VOO A;  1J75 A;  2L01 A;  2IS6 A;  2MBF A;  2HQ5 A;  2L9N A;  3OYE A;  2ACJ A;  5DV5 A;  3WTS C;  1LB2 A;  4D7M A;  2M8G X;  1ENH A;  2CMP A;  1SD4 A;  2ID3 A;  3OS2 A;  3R4K A;  3KET A;  4YIR X;  1OKR A;  2GXG A;  3REO A;  1HDD C;  3AAF A;  2JWT A;  3FXM A;  5KCM A;  2CS3 A;  2DU9 A;  3KZY A;  1VND A;  3C2H A;  1GVJ A;  3ZGK A;  3WTW C;  2VJJ A;  4BXU A;  4M9Z A;  2I5U A;  4M9S A;  2D2W A;  4M3B A;  5F08 A;  4KYW A;  4XL9 A;  5F64 A;  2LBF A;  3OYI A;  4G6T B;  1VQ8 I;  3CO7 C;  1FY7 A;  1G4D A;  4L0Z B;  3PFY A;  2JT1 A;  3D5S C;  3LAJ A;  2CUJ A;  4Y17 A;  2BY0 A;  3J81 Z;  4A3E J;  2KHM A;  5BPI A;  3OYD A;  4CDG A;  4NC6 A;  3DFG A;  3K4B A;  1FIP A;  4A0Z A;  1E3O C;  2PMH A;  1R22 A;  4HAM A;  2NAZ A;  3ZXS A;  4BJ5 C;  1JT6 A;  5JI6 A;  1JTY A;  3G1M A;  3H3U A;  3GW2 A;  3BZK A;  3J80 Z;  3RKX A;  3H0D A;  3F22 A;  1SFU A;  2A6E F;  2A69 F;  1WH7 A;  1X3W B;  3FXO A;  2V1U A;  3BTJ A;  1XCB A;  1ZLJ A;  5FLX Z;  3BJO A;  4A3B J;  3F6O A;  4XQF A;  4XLN F;  5CQG A;  3FF5 A;  1IN7 A;  1WZ2 A;  2LY2 A;  3BOQ A;  3BQY A;  1QRY A;  3F72 A;  2PQ8 A;  1WKM A;  2GOM A;  1ONV A;  2VOP A;  1RIO H;  2DMU A;  3BPV A;  2V1X A;  2QQ9 A;  3RJP A;  5BNG A;  1ZGW A;  4ZDL A;  4CA0 A;  3NQO A;  3CO6 C;  1QZE A;  3E6C C;  3AKZ A;  3GYH X;  2LH9 A;  2WAD A;  1LDD A;  5DTD A;  4PZJ A;  2KZV A;  2K40 A;  1Z7L A;  2DFF A;  4I02 A;  3KCC A;  1ZH5 A;  2PI0 A;  1TQI A;  1MD0 A;  1K6Y A;  5KHD A;  3JCU C;  1FIA A;  3OYB A;  5LGT A;  1QVT A;  3M9A A;  3W6K B;  3IL2 A;  2V4J C;  3FZV A;  3GLX A;  3FMS A;  4JK1 X;  3CCQ I;  4DQ2 A;  3PQK A;  2MD0 A;  3KLN A;  2NS8 A;  1ETQ A;  2E5Z A;  3OIQ A;  3CF5 F;  3ROU A;  2KT0 A;  1S8N A;  2Z16 A;  4I0B A;  1QPI A;  2VI6 A;  2UV1 A;  1S9H A;  4WF2 A;  2PFB A;  1YW9 A;  4P5O A;  3D1N I;  4PJ0 C;  1IG7 A;  1QA6 A;  3CCY A;  3PUF A;  1K4T A;  2DA2 A;  3L2R A;  5LFA A;  1TQM A;  2F5V A;  2WAE A;  1G6N A;  5J4Y A;  3NEU A;  3S17 J;  2X1D A;  3RTR A;  1S6L A;  1K61 A;  3V4G A;  4EAT A;  1IRF A;  1G8X A;  1W7P A;  4ENN A;  5LEJ A;  4JBA A;  1XGM A;  5F1J A;  4ZZL A;  2XDV A;  2YS9 A;  4LG3 A;  4M72 A;  4E70 A;  2VBY A;  1IN4 A;  1UB9 A;  2F4I A;  1WJ5 A;  3BR0 A;  1XG1 A;  1FP1 D;  3M3Y J;  4A3G J;  2FD5 A;  2PMU A;  2X1C A;  3KX2 A;  3IRR A;  2Z9O A;  4P1W A;  1GXQ A;  5EG0 B;  1WWX A;  2HGC A;  3A4C A;  2FBI A;  1ON1 A;  3HB9 A;  2HPI A;  4L9N A;  3CMY A;  3OSF A;  2KP6 A;  4IHS A;  5ICG A;  4HSR A;  1N75 A;  3ESW B;  3RKW A;  2KQR A;  1ZRC A;  2EFP A;  2XPV A;  2CW7 A;  2FX0 A;  3RPU D;  3DEE A;  3QU3 A;  3IHU A;  3BTC A;  4LIU A;  3H9J A;  3ZMZ A;  3QPL A;  4F7Z A;  3COA C;  3WG7 H;  4X6A J;  3VOE A;  3KYL A;  4ANJ A;  1P4W A;  4RDU A;  3CUO A;  1DGW Y;  3IKV A;  5GTI C;  1TWH J;  1MMN A;  2EV6 A;  2KIS A;  2OJE D;  4A12 A;  2E71 A;  4KT6 A;  3DEU A;  1LVK A;  4RGU A;  1RET A;  2D1H A;  5E8I A;  1JTX A;  4ZTF A;  2E1C A;  3K4N A;  3D0S A;  2X6X A;  3U1D A;  4A3L J;  1H89 C;  3I71 A;  4F55 A;  1LEB A;  3KFW X;  1FBU A;  2RQQ A;  3HJE A;  1NH3 A;  4UY8 I;  1SD6 A;  3OIP A;  1REP C;  1GLN A;  1O57 A;  1UHW A;  3LSJ A;  4XLE A;  2CQX A;  3PIO F;  1B8I A;  3DQV C;  1AOY A;  4XKC A;  5D5W B;  2RN7 A;  3CTA A;  2R7R A;  1GDT A;  2QSH X;  4BXX J;  2KKO A;  3Q0U A;  1MKM A;  2GOX B;  1KON A;  1OCC H;  1X1P A;  4HYE A;  5F0F A;  5DUI A;  1BOB A;  5ICF A;  3GZ6 A;  4NB5 A;  2XAS A;  2B0L A;  2VXZ A;  4FAS D;  3CCR I;  2KDO A;  2RVC A;  1G2H A;  4DOZ A;  4FQG A;  5EJC A;  3Q9S A;  2M4K A;  3AG3 H;  4KFC A;  4DBQ A;  1UAA A;  4KIT B;  3P7N A;  1SVO A;  2AHQ A;  4A6E A;  1DU0 A;  4GXO A;  3HHH A;  2EZL A;  3U2R A;  4E7H A;  4PJN A;  4HQE A;  3M8J A;  1IRX A;  5H6Q A;  4MEX F;  2EZK A;  4TV7 A;  2JUG A;  2WAQ A;  1U6G A;  1T56 A;  4A3I J;  4KJZ A;  1R49 A;  3HOW J;  3BZ6 A;  2DOE A;  1Q1V A;  2BY1 A;  1B72 A;  4B09 A;  1VI0 A;  3SQN A;  5BPD A;  4A93 J;  5E18 F;  4L5I A;  4CXF A;  2BHZ A;  3ZRG A;  1MMD A;  4L0Y B;  1WI9 A;  2LKX A;  2CSO A;  4MLO A;  4ZDP A;  4KMF A;  4M3E A;  2FA5 A;  4BQQ A;  1EF4 A;  5A2Q Z;  4OIO F;  1ETX A;  5CVJ A;  1QQI A;  3Q0W A;  2W00 A;  2EFN A;  4N4N B;  3E97 A;  2ME6 A;  2X6Y A;  4A3F J;  1MNM C;  5K7H A;  1XDU A;  5K5Q A;  1LUJ B;  2HZT A;  4F91 B;  1YHQ I;  4DW6 A;  3B02 A;  3K70 D;  3L00 A;  2UUZ A;  2MH9 A;  1GUU A;  3LST A;  3TDZ C;  1B4A A;  2HOT A;  2CV0 A;  2NVT J;  4U0W A;  1E0E A;  3HTS B;  4I76 A;  1MBJ A;  1W0T A;  1MDM B;  4HDU A;  2HDD A;  1LE8 B;  3FHN A;  4CCL A;  1D3Y A;  3MD2 A;  1O3R A;  1SAN A;  4ENM A;  4UB6 C;  4HOB A;  1ORK A;  3OYC A;  4CCN A;  4EGY A;  4KDP A;  1BJA A;  3TOA A;  4KN4 X;  1HKT A;  3CF2 A;  2NVY J;  2DDB A;  3PO3 J;  1XMA A;  1XGS A;  3WGH A;  4CCK A;  2HFH A;  3T0Y A;  5ILV A;  1TP4 A;  3IH3 A;  3WGI A;  3UR3 C;  2HS5 A;  5KVR A;  2EV5 A;  2VAS A;  1X1C A;  1AHD P;  1D5V A;  1GHC A;  2BXY A;  1R4N B;  3CCS I;  4CO8 A;  3V7R A;  1VQL I;  3HGY A;  3BR1 A;  5DUK A;  3PSF A;  5TRD A;  1UHM A;  3R61 A;  3DPU A;  1OCZ H;  1IUY A;  3A01 B;  3HSE A;  4GCV A;  4I0A A;  4BYY A;  2R7W A;  1APL C;  1BJZ A;  2Y0S N;  3CUQ C;  2XUB A;  1F5T A;  1ON2 A;  2IVM A;  2ZNY A;  2ZFU A;  2HQN A;  1OR7 C;  4ENK A;  4WK8 F;  2MGQ A;  1T08 B;  3CQZ J;  1QBJ A;  3IC7 A;  3PFI A;  1RKT A;  1T6S A;  2A6T A;  5TGT A;  4DNC A;  2AQF A;  2P7V B;  3OR1 C;  4XKW A;  3K1N A;  2K9N A;  2Q8K A;  2V9K A;  4LB5 A;  2O61 A;  2L54 A;  1ETW A;  3CCV I;  3P9K A;  1ZTR A;  3ZP5 A;  4MEY F;  1DQU A;  2XV4 S;  2ZC2 A;  1XGO A;  1FP2 A;  1JT0 A;  2MH2 A;  1S3J A;  2QEX I;  3EYY A;  2VB6 A;  2ESH A;  4FET A;  2G0E A;  2KJC A;  3KYC B;  5LD2 C;  1BBY A;  2R5Z B;  1Z05 A;  3EQL F;  4D5C A;  2TDX A;  4G9Y A;  3G1L A;  1DP3 A;  2V26 A;  3G1O A;  5LLQ A;  3BG6 A;  5HLI A;  2W57 A;  2FOK A;  3LSG A;  5EG0 A;  1O7F A;  1LFU P;  4V19 K;  3TW7 A;  3JTG A;  3HOX J;  5HS8 A;  4PGG A;  1MJ9 A;  2E1M C;  1KYZ A;  2R7F A;  1FYL A;  4BQA A;  4II3 A;  4DYQ A;  2NVQ J;  2HOE A;  3CUQ B;  2JA6 J;  2DDA A;  3W3C A;  4CYC B;  5L3B A;  1ERD A;  5B3S H;  2BVM A;  3E5X A;  3IRQ A;  2FEZ A;  4Y13 A;  3ZMD A;  2VKE A;  1XD7 A;  3DTK A;  2E1O A;  5H20 A;  2FML A;  2HQR A;  1I3A A;  5J1Y A;  1VQO I;  3KP5 A;  1J7K A;  5DYM A;  1QZY A;  1WJA A;  5FRM A;  1ULY A;  1Y1V J;  1FOK A;  3MN2 A;  2YSR A;  2OPT A;  5JR3 A;  3S16 J;  1VFC A;  2STT A;  4C3J J;  5EDN A;  3GF2 A;  2OC6 A;  1ITY A;  1XTA A;  1D0Y A;  2GIZ A;  3GTM J;  3ZMT A;  1B9M A;  3EPZ A;  5DDG A;  5EYR A;  2M0M A;  2B7E A;  1QGP A;  1S29 A;  3QAH A;  4XRS G;  4FHT A;  3TBI A;  2CO5 A;  4BGD A;  4UUV A;  4UHT A;  1BM9 A;  1ZGA A;  3G6E I;  4C2U A;  5EEG A;  4DBR A;  5ED4 A;  4NDL A;  2CYY A;  5HS9 A;  3A0B C;  5JLX A;  1ZLK A;  5FRN A;  3FXU A;  3SFI A;  3QYF A;  4YIF A;  1J9I A;  3H5R A;  2LLK A;  2W84 A;  1P92 A;  5J8C A;  1W5C C;  4X0G A;  2VOD A;  2L9S A;  4O5V A;  1LPQ A;  2V1N A;  3L2V A;  4GYI A;  5ILS A;  3D5L A;  4IX7 A;  1XMX A;  2K7L A;  3H1C A;  4KT5 C;  1R1T A;  2R7V A;  4RM3 A;  3ZR8 X;  3ZQI A;  1MIJ A;  3FMQ A;  4UUT A;  3OR2 C;  4L9J A;  2DPU A;  1XSD A;  3MZY A;  1HW1 A;  1WJF A;  2E1M B;  3FIW A;  1MSE C;  3ZMU A;  2X48 A;  1JUP A;  3U1K A;  3KP3 A;  5IT9 Z;  5FO5 A;  1QZZ A;  1U8R A;  2DI3 A;  3LL7 A;  1YOV B;  3ZQC A;  1V54 H;  3R60 A;  3WOD F;  1KYW A;  2G7U A;  3GUD A;  2EIM H;  2PJP A;  4II2 A;  2R0Q C;  2BE5 F;  3TMO A;  2IGK A;  1YI2 I;  4IHT A;  1UHS A;  3M07 A;  3RYP A;  1XC5 A;  4CCM A;  3E6M A;  4PSW A;  3GZN B;  3GTO J;  4I7H A;  2KIQ A;  3W6J B;  3GVA A;  3MZ8 A;  3K9T A;  1V55 H;  2VJI A;  4HBL A;  1RR7 A;  2L5Q A;  1R5H A;  2JSC A;  5IP6 A;  3S3O A;  4IHY A;  2ZJ2 A;  2VIX A;  5J40 A;  2RAE A;  2DLL A;  4Q5S F;  3DKY A;  3ZPL A;  1BR4 A;  2Z2S B;  1CF7 B;  3S1M J;  1TWG J;  3E3V A;  1EV7 A;  2P0W A;  2CGP A;  3TP0 A;  5E3M A;  2HR3 A;  1YO5 C;  3C2B A;  2DFE A;  3PUB A;  4HA8 A;  3MAJ A;  5CVI A;  3UNG C;  4I98 B;  2QQB A;  1R36 A;  2CRG A;  2XKP A;  5ILU A;  3C2G A;  1T8I A;  3JSP A;  1MDM A;  3H92 A;  1WJB A;  5CPR B;  2KZG A;  1VQ4 I;  2EA2 A;  1B59 A; 
#chains in the Genus database with same CATH homology
 2QYO A;  1Q1H A;  4U7D A;  2FBK A;  1LDK B;  3VFZ A;  4LG0 B;  2H27 A;  4M74 A;  1H9G A;  3R0A A;  3ERE D;  4LLN A;  2XKO A;  3I4P A;  4P96 A;  1DPR A;  2E1N A;  5A2Q K;  1IZ1 A;  2VT3 A;  4LMY A;  3RPQ A;  3ZN1 A;  3WTY C;  2M45 A;  4BNC A;  1U78 A;  2E7X A;  2ISY A;  1U5T C;  5KK1 A;  3ZQ7 A;  5J6X A;  1FZP B;  3LFK A;  1B6A A;  2ZXJ A;  3IKT A;  3M8F A;  1DUX C;  1I1G A;  3B73 A;  1SMT A;  3KZZ A;  3WG9 A;  4HV6 A;  1BN5 A;  4EQQ A;  2GA1 A;  2H6C A;  4WWC A;  1K7A A;  4S04 A;  4HQM A;  2QLZ A;  3CDH A;  1OYY A;  3I5U A;  1K6O A;  3L2C A;  3MZH A;  2F2E A;  2ETH A;  4HX4 A;  2DW4 A;  2P6T A;  1H0M A;  2R7D A;  2IJL A;  4BH9 A;  3LWF A;  3ULQ B;  1JXS A;  2CFX A;  3RDI A;  1HW2 A;  3HOS A;  1DP7 P;  1P4X A;  3CLO A;  1OR7 A;  1YS7 A;  1WRJ A;  2XHK A;  4XSX F;  2W25 A;  3ISP A;  5LRR A;  1U5T B;  3LQR A;  3L9F A;  4HDV A;  2O03 A;  4EM0 B;  2RGV A;  5CVV A;  5IT3 A;  2RV8 A;  3E5U A;  2VE8 A;  5L3C A;  2ZME B;  4IVN A;  1BIA A;  1LJ9 A;  2BGC A;  3TO7 A;  4KIG A;  2L4M A;  2JPB A;  4RGX A;  5ERI A;  4BAY A;  1L0O C;  1S7O A;  5FD5 A;  4HF1 A;  1RNL A;  4ZYG A;  4U0V A;  4HV5 A;  4UNO A;  4MQV A;  1HW5 A;  1TW2 A;  4EJT A;  4KA4 A;  2JZY A;  1Z9C A;  3Q9V A;  3PQJ A;  4BHP A;  3M7G A;  2A68 F;  4YFN F;  3E6D A;  3QP5 A;  1EH7 A;  5LRS A;  5FFZ A;  1FX7 A;  4IPA A;  2M87 A;  3G3Z A;  1IN5 A;  1S7A A;  4AVP A;  3WTV C;  4RB0 A;  1WSU A;  3H3Z A;  2DQL A;  3FM3 A;  4HF2 A;  4Z2Y A;  3BDD A;  2F5C A;  2JTV A;  2HKX A;  4H0E A;  2XAF A;  3KE2 A;  1SMY F;  4HZF A;  4UVB A;  2KIM A;  3ABT A;  3T1B A;  3F8N A;  3KP2 A;  5K1Y A;  4Q47 A;  3TOB A;  4FT8 A;  4PDK A;  5K5R A;  4A5N A;  4I01 A;  4G8X A;  4LG0 A;  4AIJ A;  2EB7 A;  3Q5F A;  3ZMV A;  1TW3 A;  5LGN A;  1Z6R A;  1TLH B;  4EJO A;  4IRG A;  3V8J A;  3MCZ A;  3R6S A;  3M1E A;  1IRG A;  4RS8 A;  2VT2 A;  4RGS A;  3I59 B;  1ZAO A;  1SD7 A;  3HUG A;  3JAM Z;  5BS6 A;  3QPT A;  2F5E A;  1IAW A;  2HYF A;  2BYV E;  4EM2 A;  3QP6 A;  2XIG A;  1ZGJ A;  3I64 A;  1G3W A;  1ZG5 A;  2Z3Y A;  1ZYR F;  3BJA A;  4HX8 A;  2IA0 A;  2K27 A;  1P4A A;  2MA3 A;  4G94 A;  4IJA A;  4CGZ A;  3EUH A;  1KQ9 A;  4CHU A;  3CJN A;  2DO7 A;  4EJV A;  2EFW A;  2HTJ A;  4NHJ A;  2UXN A;  1F4K A;  2O6G E;  1RUO A;  1TNS A;  1I5Z A;  2GIV A;  2M1B A;  2ZBK A;  3KLO A;  1U2W A;  4L9V A;  1QPM A;  3RPU A;  1FSE A;  3BWG A;  4IF4 A;  5D6F A;  2NYX A;  1I1S A;  1R00 A;  3DPT A;  4YFK F;  3IWZ A;  5E1Z B;  3GWZ A;  4L18 B;  1V3F A;  1FSH A;  3QRF F;  5HOO A;  2H09 A;  5H6R A;  3WGG A;  3HRS A;  1SAX A;  2D1V A;  1LNW A;  4LLL A;  5E8G A;  4CYD A;  3DF8 A;  5F6F A;  1KU9 A;  2LDU A;  2E7W A;  3HSF A;  2DAO A;  3HRU A;  3WU1 B;  5FD6 A;  4EM1 A;  1J5Y A;  4JQF A;  1FPQ A;  1SFE A;  1QO0 D;  1WQ2 A;  1E2X A;  4RGR A;  1L3L A;  2UZK A;  3J81 K;  1TTY A;  2P5V A;  4CZZ A;  3VOD A;  5JVT A;  2NNY A;  1VTN C;  2MC3 A;  5AIP A;  2P7C B;  4A0X A;  1ZAR A;  5ICE A;  2KJB A;  2XRN A;  1NHA A;  1BI1 A;  1XCV A;  2EFQ A;  3J80 K;  2FE3 A;  5D4S A;  4UV9 A;  2K86 A;  1EH8 A;  5FLX K;  5EEH A;  3M8E A;  4P55 A;  4WXD A;  2BV6 A;  4OMY A;  2HYG D;  2L4A A;  2V79 A;  1I6X A;  2IRF G;  3BY6 A;  1LVA A;  5HS7 A;  1ZRE A;  3QOP A;  1IF1 A;  3WTU C;  4I09 A;  4WX9 A;  3ZN0 A;  2QVO A;  1UCR A;  3V7S A;  3RIR A;  2Y48 A;  1XSV A;  1YLF A;  4B8X A;  1HKS A;  4U7B A;  3S2W A;  3C18 A;  2YPR A;  1T0F A;  4KNY A;  2MLK A;  2YX7 A;  4XLP F;  3DKW A;  2FRH A;  3HOT A;  5CYV A;  3JTH A;  5CLS A;  5D5U B;  1U3E M;  5LHG A;  2AS5 F;  4ZH4 F;  3I58 A;  1XMK A;  2P8T A;  5LHH A;  4EJW A;  3LA2 A;  5L3D A;  5JHU A;  4ZYD A;  2AXL A;  4ESB A;  1IN6 A;  3GO5 A;  1P6R A;  5D5V B;  1MJB A;  2J5O A;  4M6X A;  1Z6T A;  4BHC A;  3RYR A;  2A07 F;  3IWF A;  1XN7 A;  2PBI A;  2C6Y A;  2EK5 A;  3BRO A;  1J59 A;  3ML6 A;  2HDC A;  5DCM B;  3RKY A;  1MZB A;  2CG4 A;  2PG4 A;  2WTE A;  1KU2 A;  1G3S A;  2ZFW A;  4WCG A;  3U9G A;  2DK5 A;  2QBY B;  2RQP A;  4AWX B;  2XGX A;  3BJ6 A;  2O8X A;  4M6Y A;  3I54 A;  4GO1 A;  4MTD A;  2MLG A;  4HLY A;  2DQR A;  2OU2 A;  2QZ8 A;  3I0T A;  5CVR A;  3C3W A;  4FX0 A;  4ASN A;  5CJ9 A;  2W24 A;  1T39 A;  1T98 A;  1BI2 A;  2FBH A;  4GYG A;  1T2K A;  2FNP A;  3KEQ A;  3FXQ A;  1W5S A;  5HDG A;  2M5W A;  5L3F A;  4XSZ F;  3LA7 A;  3E6B A;  4RAZ A;  2QWW A;  5D4R A;  3I53 A;  1OYI A;  3TDU C;  3C7J A;  1FYK A;  4MTE A;  3ABU A;  3WTT C;  4KIC A;  3FM5 A;  1DPU A;  3G73 A;  2OZU A;  1P2F A;  2OQR A;  4O3M A;  5D6E A;  4FX4 A;  2EWN A;  1FWZ A;  1LEA A;  1YYV A;  2VC0 A;  2STW A;  2IW5 A;  1K78 B;  1V4R A;  4KIF A;  4ON0 A;  1FYM A;  1XGN A;  2Z5U A;  1C0W A;  6PAX A;  2YR2 A;  1YW7 A;  2RC4 A;  3GX4 X;  4ENJ A;  3HSR A;  2DT5 A;  1ZG1 A;  2LF7 A;  1RZ4 A;  1J2X A;  2LKP A;  3FWE A;  1FBS A;  3BP8 A;  2G9W A;  1F9N A;  5DCF A;  2MD5 A;  4ZZD A;  2VON A;  1B9N A;  1UST A;  3CUQ A;  1O7L A;  2EV0 A;  2FF4 A;  2ZNZ A;  3GFJ A;  2FNA A;  1BC8 C;  2L3D A;  2Y0M A;  2VBZ A;  4N0B A;  4R8H A;  2WWY A;  1IXC A;  1YW8 A;  1O3S A;  3F6V A;  1Z91 A;  4M73 A;  4G6D A;  4BHB A;  5BQT A;  4OIP F;  4R1H A;  2A3S A;  5LGU A;  2F5D A;  1B1B A;  4KIB A;  2O0Y A;  3SZP A;  2HWV A;  5AIQ A;  2RDP A;  5L3E A;  2CW0 F;  4GGG A;  3DPL C;  1OYW A;  2GWR A;  2JRT A;  1T38 A;  2M8E A;  2RKH A;  3EET A;  4Q4Z F;  2QEN A;  4QLC U;  3SHF A;  3P9I A;  4ETS A;  4KMU X;  2NNN A;  4ZYE A;  2DK8 A;  2D45 A;  5LEK A;  1HQC A;  4G7Z F;  2GA2 A;  2VBX A;  2K4J A;  1TQP A;  4WXH A;  5D8K B;  2IT0 A;  5DCM A;  3MQ0 A;  1IN8 A;  2PEX A;  4XBF A;  3MFK A;  3R0J A;  3DV8 A;  3NRV A;  3K69 A;  1W7P D;  1UFM A;  2CQK A;  4LB6 B;  2QBY A;  4AIK A;  2VC1 A;  3OV8 A;  1CF7 A;  2LNB A;  2EFO A;  2X4H A;  3V7C A;  3DP7 A;  4N9H A;  4M9X A;  1STZ A;  3P9C A;  3F8C A;  4ESF A;  4HW0 A;  2K4B A;  1JHF A;  2L02 A;  4LJZ F;  4LFU A;  5D8L B;  1HBX G;  2K02 A;  1TBX A;  5IT9 K;  3JW4 A;  1F1Z A;  4MGR A;  3KP6 A;  2JPC A;  5AON A;  1USS A;  3GZ5 A;  1KU7 A;  2FSW A;  4L9T A;  2XAJ A;  4RB3 C;  4U88 A;  2Y75 A;  3V8K A;  3N4M A;  1DDN A;  1BI3 A;  4YII A;  4R79 A;  3T8T A;  2OAZ A;  2XVC A;  1K78 A;  2YU3 A;  1YQA A;  3GXO A;  4MQ9 F;  5DD8 A;  2QUF A;  2EA4 A;  4KN7 X;  2PN6 A;  1ZRD A;  3ZMS A;  5HDN A;  4G7H F;  2LSO A;  2OA4 A;  3HHG A;  1TNT A;  1ZG3 A;  5L3G A;  1PDN C;  1R1U A;  2P6S A;  4XRF A;  1HKQ A;  2LF8 A;  2UWM A;  1HXD A;  5E20 A;  2GAU A;  3FX3 A;  1KQ0 A;  1RUN A;  4OMZ A;  5LBQ A;  1A04 A;  1YFH A;  1R7J A;  3C1D A;  2A6H F;  1KU3 A;  3TGN A;  3HRT A;  2A61 A;  1JGS A;  4O6J A;  4KUM A;  5D5X B;  1FT9 A;  5E17 F;  2UXX A;  1U5T A;  2XRO A;  2HEO A;  4WXC A;  1J0R A;  5TJJ A;  5HDK A;  3GEZ A;  1O3T A;  3E5Q A;  2XAQ A;  2F5F A;  4PCQ A;  5JFR A;  2KRF A;  4UV8 A;  3MEX A;  3F21 A;  5LHI A;  4UXN A;  2GXB A;  2FMY A;  2ZME A;  4M71 A;  3HTU A;  4D0P A;  1E17 A;  1SFX A;  4S05 A;  1X3U A;  2J5P A;  5E1X A;  3HRM A;  5FGM A;  5DEQ A;  4AIH A;  3J7A O;  4A2U A;  2O3F A;  5J8F A;  2OBP A;  3O6B B;  1R1V A;  4LK1 F;  5HLG A;  4CIC A;  2DFI A;  5FFX A;  3KP7 A;  3F3X A;  4HF0 A;  5E1W A;  1AWC A;  2ZCW A;  3SZT A;  5BMZ A;  1OMI A;  2IA2 A;  1D8J A;  2V6C A;  3MWM A;  4U0Y A;  1Z7U A;  1BIB A;  1R23 A;  2CWE A;  4ESJ A;  4OIR F;  4YG2 F;  1BC7 C;  3ELK A;  4EVI A;  4EMS A;  1JE8 A;  5K5O A;  3RI4 A;  1SD5 A;  2W85 A;  3TO6 A;  3OOP A;  1EH6 A;  2ADU A;  2BBY A;  1CGP A;  4RAY A;  1JHH A;  1O3Q A;  2OQG A;  3WU0 A;  2Q0O A;  5HVQ C;  2ZO4 A;  3EDP A;  1BI0 A;  1FNN A;  3VEP A;  1MGT A;  3SXY A;  2BEO A;  2IPQ X;  1RI7 A;  2NS0 A;  4I2O A;  2P4W A;  1IXS B;  4YFX F;  1D8K A;  2HTS A;  2OD5 A;  2YX4 A;  2DTR A;  4OIN F;  3O3K A;  3WTZ A;  5CVU A;  4IRH A;  1W4M A;  3GFI A;  3I59 A;  2FU4 A;  2ISZ A;  3WE3 A;  1YS6 A;  4RB1 A;  1LQ1 A;  4G6Q A;  3LA3 A;  4LGW A;  2G7H A;  3LAP A;  1IXR C;  1IW7 F;  3L7W A;  1I27 A;  3KP4 A;  3HIF A;  4OIQ F;  4K2E A;  2VN2 A;  5BOX A;  2V1D A;  1KQ8 A;  4A0Y A;  1W5T A;  3TO9 A;  3LQQ A;  2FXA A;  4L5J A;  1FBQ A;  1PP7 U;  1R58 A;  1KA8 A;  3JSO A;  3T8R A;  3L09 A;  4EGZ A;  4MHG A;  5FB2 A;  3QU6 A;  2P5K A;  1PP8 F;  2P5L C;  4EJU A;  1MJA A;  4HLX A;  4NQW A;  1ZN2 A;  2KIF A;  3JAM K;  3K1P A;  3EYI A;  2XAG A;  1XDS A;  4P9F A;  5DD4 A;  1HST A;  3BPX A;  4EV0 A;  3HYI A;  2IA1 A;  3F23 A;  4LLG F;  2FQ3 A;  4UVC A;  2XAH A;  2NRA C;  3KEO A;  3ECO A;  3K2Z A;  2GZW A;  2WV0 A;  2V9V A;  3WTX C;  1ODD A;  1PUE E;  3GFM A;  1XB4 A;  3WE2 A;  2DPD A;  3QPH A;  4A5M A;  4OOI A;  1G3T A;  1K79 A;  2Z33 A;  1Y0U A;  2PLY A;  2COM A;  4G7O F;  2RNJ A;  4IRI A;  3GFL A;  2ESN A;  3FHZ A;  2X0L A;  1LDJ A;  3O2P E;  4ZYH A;  3F8M A;  1H9T A;  1OPC A;  3FMR A;  4Q48 A;  3FXR A;  2A5Y B;  4P9U A;  4IXA A;  4HX7 A;  4PGH A;  3T5X A;  1QNT A;  2DBB A;  1YG2 A;  2Z99 A;  1YIO A;  1BOA A;  4RB2 C;  1HSJ A;  2ELH A;  1R5G A;  4QWQ A;  3V8L A;  2R3S A;  3K0L A;  1W7P B;  3ECH A;  1GXP A;  3DXJ F;  3TKY A;  2IP2 A;  4AD9 A;  3F8B A;  2GQQ A;  2EJR A;  2VBW A;  1FC3 A;  1ZHF A;  4OU0 A;  4N9I A;  2Q2E A;  4MNU A;  4LD5 A;  1KGS A;  4Y15 A;  3K1M A;  1XSX A;  2HKO A;  2QQA A;  1ZRF A;  3SFZ A;  2KIU A;  2VE9 A;  2H6B A;  5ICC A;  3N97 A;  2H94 A;  3VB2 A;  1YTY A;  4UVA A;  1Z1D A;  4LK0 F;  2QM3 A;  2ZKZ A;  5F1R A;  1G3Y A;  2OZ6 A;  2WC2 A;  3F8F A;  4A6D A;  5HLH A;  3TQN A;  1FLI A;  2M30 A;  2VOO A;  1J75 A;  2L01 A;  2MBF A;  2ACJ A;  5DV5 A;  3WTS C;  1LB2 A;  1SD4 A;  3R4K A;  3KET A;  1OKR A;  2GXG A;  3REO A;  3AAF A;  2DU9 A;  3KZY A;  1GVJ A;  3WTW C;  4BXU A;  4M9Z A;  4M9S A;  2D2W A;  4KYW A;  5F64 A;  3CO7 C;  1FY7 A;  1G4D A;  4L0Z B;  2JT1 A;  3LAJ A;  4Y17 A;  3J81 Z;  5BPI A;  4CDG A;  3DFG A;  4A0Z A;  2PMH A;  1R22 A;  4HAM A;  2NAZ A;  5JI6 A;  3H3U A;  3GW2 A;  3J80 Z;  3RKX A;  3F22 A;  1SFU A;  2A6E F;  2A69 F;  2V1U A;  1XCB A;  1ZLJ A;  5FLX Z;  3BJO A;  3F6O A;  4XLN F;  3FF5 A;  1IN7 A;  3BOQ A;  3F72 A;  2PQ8 A;  1WKM A;  1ONV A;  2VOP A;  1RIO H;  3BPV A;  2V1X A;  2QQ9 A;  3RJP A;  3NQO A;  3CO6 C;  3E6C C;  3GYH X;  2EA2 A;  1LDD A;  4PZJ A;  4I02 A;  1ZH5 A;  3KCC A;  2PI0 A;  1TQI A;  1MD0 A;  5LGT A;  3W6K B;  3M9A A;  3IL2 A;  3FZV A;  3GLX A;  3FMS A;  4JK1 X;  4DQ2 A;  3PQK A;  3KLN A;  3ROU A;  1S8N A;  4I0B A;  4WF2 A;  2PFB A;  1YW9 A;  4P5O A;  1TQM A;  1G6N A;  3NEU A;  3RTR A;  1S6L A;  3V4G A;  1IRF A;  1W7P A;  4ENN A;  5LEJ A;  4JBA A;  1XGM A;  4ZZL A;  4M72 A;  4E70 A;  2VBY A;  1IN4 A;  1UB9 A;  1FP1 D;  2PMU A;  3IRR A;  2Z9O A;  1GXQ A;  1WWX A;  2HGC A;  4L9N A;  2FBI A;  1ON1 A;  4IHS A;  5ICG A;  3RKW A;  1ZRC A;  2EFP A;  3QU3 A;  3IHU A;  3ZMZ A;  4F7Z A;  3COA C;  3VOE A;  1P4W A;  3CUO A;  3IKV A;  2EV6 A;  4A12 A;  3DEU A;  5E8I A;  4RGU A;  2D1H A;  2E1C A;  3D0S A;  3U1D A;  3I71 A;  1LEB A;  3KFW X;  1FBU A;  1SD6 A;  1REP C;  1O57 A;  1UHW A;  3DQV C;  1AOY A;  5D5W B;  2RN7 A;  3CTA A;  2KKO A;  1MKM A;  4HYE A;  5DUI A;  5ICF A;  3GZ6 A;  4NB5 A;  2XAS A;  2B0L A;  2VXZ A;  2RVC A;  3Q9S A;  4KFC A;  3P7N A;  4A6E A;  4GXO A;  3HHH A;  3U2R A;  4HQE A;  5H6Q A;  4MEX F;  4TV7 A;  1U6G A;  3BZ6 A;  4B09 A;  3SQN A;  5BPD A;  5E18 F;  4L5I A;  4CXF A;  4L0Y B;  1WI9 A;  4KMF A;  2CSO A;  2FA5 A;  5A2Q Z;  4OIO F;  5CVJ A;  1QQI A;  2EFN A;  3E97 A;  1XDU A;  5K5Q A;  2HZT A;  3B02 A;  3L00 A;  2MH9 A;  3LST A;  3TDZ C;  1B4A A;  4U0W A;  3HTS B;  1MDM B;  4HDU A;  1O3R A;  1D3Y A;  4ENM A;  4HOB A;  4KDP A;  4EGY A;  1BJA A;  3TOA A;  4KN4 X;  1HKT A;  1XMA A;  1XGS A;  3WGH A;  2HFH A;  3T0Y A;  5ILV A;  3WGI A;  2HS5 A;  5KVR A;  2EV5 A;  1D5V A;  1GHC A;  4CO8 A;  3V7R A;  5DUK A;  5TRD A;  1UHM A;  3R61 A;  1IUY A;  3HSE A;  4GCV A;  4I0A A;  4BYY A;  3CUQ C;  2XUB A;  1F5T A;  1ON2 A;  2IVM A;  2ZNY A;  2HQN A;  4ENK A;  4WK8 F;  1QBJ A;  3IC7 A;  3PFI A;  1T6S A;  4DNC A;  2P7V B;  3K1N A;  2Q8K A;  4LB5 A;  2O61 A;  2L54 A;  3P9K A;  3ZP5 A;  4MEY F;  2XV4 S;  1XGO A;  1FP2 A;  2MH2 A;  1S3J A;  3EYY A;  2ESH A;  2KJC A;  1BBY A;  1Z05 A;  3EQL F;  2TDX A;  4G9Y A;  5LLQ A;  5HLI A;  2W57 A;  2FOK A;  1O7F A;  3JTG A;  5HS8 A;  4PGG A;  1MJ9 A;  1KYZ A;  2R7F A;  1FYL A;  4BQA A;  2HOE A;  3CUQ B;  5L3B A;  3IRQ A;  3E5X A;  2FEZ A;  4Y13 A;  3ZMD A;  1XD7 A;  5H20 A;  2FML A;  2HQR A;  3KP5 A;  1J7K A;  5DYM A;  1QZY A;  1ULY A;  1FOK A;  2YSR A;  5JR3 A;  2STT A;  3GF2 A;  3ZMT A;  1B9M A;  5DDG A;  1QGP A;  1S29 A;  3QAH A;  4FHT A;  2CO5 A;  4UUV A;  4UHT A;  1BM9 A;  1ZGA A;  5EEG A;  5ED4 A;  5HS9 A;  2CYY A;  1ZLK A;  3FXU A;  4YIF A;  1J9I A;  2VOD A;  2W84 A;  1P92 A;  5J8C A;  4O5V A;  4GYI A;  5ILS A;  3D5L A;  2K7L A;  1R1T A;  3FMQ A;  4L9J A;  2DPU A;  1XSD A;  3MZY A;  1HW1 A;  3ZMU A;  3KP3 A;  5IT9 Z;  5FO5 A;  1QZZ A;  1U8R A;  2DI3 A;  3WOD F;  3R60 A;  1KYW A;  2G7U A;  3GUD A;  2PJP A;  2BE5 F;  4IHT A;  3RYP A;  3E6M A;  4I7H A;  3W6J B;  3GVA A;  3K9T A;  4HBL A;  1R5H A;  2JSC A;  2ZJ2 A;  2DLL A;  4Q5S F;  3ZPL A;  1CF7 B;  3E3V A;  1EV7 A;  2CGP A;  1YO5 C;  2HR3 A;  4HA8 A;  3MAJ A;  5CVI A;  4I98 B;  2QQB A;  1R36 A;  2XKP A;  5ILU A;  3JSP A;  1MDM A;  3H92 A;  4KT5 C;  1B59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...