5D5WB

Crystal structure of chaetomium thermophilum skn7 with hse dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
94
Chain Sequence
SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRPYGRDAWEFKHPEFRADRKDNLDNIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HSE DNA
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transcription
total genus 23
structure length 94
sequence length 102
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5wB00
1G3SA 2DPDA 1HXDA 1T0FA 2FNAA 3CUQA 2VBYA 1BI1A 2FE3A 4XSZF 5FO5A 1GXPA 1TBXA 2MH2A 3GVAA 2RC4A 3BOQA 4P9UA 4DQ2A 2CO5A 1IXRC 1F5TA 1UB9A 3KEOA 3CO6C 4Y13A 3HTSB 1WSUA 2STWA 1OMIA 2JT1A 1AWCA 4LLNA 1B1BA 2ZNYA 3T8TA 4A0XA 3PFIA 2HKOA 4LG0B 3K1MA 1A04A 2EFPA 4OMZA 4LGWA 3PQJA 4RGRA 1TNTA 2OQRA 4ON0A 1R5GA 1SD5A 3NEUA 1V3FA 3FMQA 2DQRA 1USSA 1I1GA 2XVCA 4MQ9F 4EMSA 2M87A 1KYZA 2PN6A 1DP7P 3J80Z 2ETHA 3E6DA 1L3LA 2IRFG 2OD5A 1JGSA 1U5TC 4R79A 5JI6A 5BOXA 3MZYA 1LEBA 1FC3A 2MD5A 5AONA 5HS9A 1MZBA 3GW2A 4BHBA 3LAPA 1J75A 2KKOA 2L54A 5LRRA 4EV0A 3SFZA 2QM3A 2H27A 1LQ1A 4HV5A 2PMUA 4U7BA 3HYIA 3FHZA 3R60A 6PAXA 3RI4A 3VODA 2G9WA 1TQPA 4U88A 2M1BA 4U0YA 3I53A 4M71A 2VC1A 1LB2A 2VE8A 3G73A 5DEQA 3H92A 4CXFA 4WXCA 4A5MA 5FLXZ 4O5VA 2RDPA 4HZFA 1K78B 1MJ9A 4KNYA 2JRTA 1BI0A 3FM3A 3U2RA 2D1VA 2GQQA 4A6EA 4LB5A 4EM2A 5FD5A 3WE2A 1YW7A 4N9IA 4EJTA 2UXXA 5E1WA 4AIJA 5DD4A 3HRUA 2VT2A 5EEHA 3JTGA 4IHSA 2F5EA 2GIVA 4E70A 4F7ZA 5A2QZ 2RN7A 5JVTA 1LVAA 4EJUA 3QRFF 2QZ8A 1OYYA 2ZKZA 4RGUA 1CF7B 3E3VA 2WWYA 4LB6B 5IT9K 1IAWA 2V1UA 1W7PB 4GXOA 5IT3A 1J5YA 3VB2A 2UWMA 3WTSC 3B02A 3KE2A 3MWMA 2TDXA 3EETA 3QPTA 1RI7A 1O7LA 3JSOA 2NAZA 4KUMA 2GXGA 2ISYA 5F6FA 2XKPA 4G94A 1P4AA 4R8HA 4RAZA 3MEXA 1KQ9A 1JE8A 5D4SA 1Z05A 4YFKF 3K2ZA 4UV8A 1XCVA 1EH8A 1PP8F 5LHHA 1X3UA 2L4AA 5D6FA 2EA4A 2GZWA 4HLYA 3ECOA 1VTNC 1B4AA 3IWZA 1MD0A 4YIIA 3EUHA 4L9VA 1EH7A 1R5HA 5HLHA 4XRFA 1R00A 3GX4X 2VN2A 2NRAC 2P5KA 5DCMB 3IKTA 4ZZLA 4WCGA 1QQIA 3I0TA 1FY7A 4PGGA 4KICA 1U5TA 2FBHA 2D45A 4KMUX 4HDUA 5LRSA 3CUOA 2IA2A 2RQPA 4EJWA 5JFRA 4Q4ZF 1P4WA 4Y17A 1YW8A 5CVIA 4I02A 2LSOA 2EV0A 4IRIA 4UHTA 2V1DA 3O2PE 2IP2A 4B8XA 1IN7A 4A6DA 2FXAA 3LAJA 3DKWA 4ENKA 1O7FA 2STTA 3F6OA 3FZVA 3E5UA 3C1DA 2V6CA 4EVIA 4HF2A 3TO9A 4ZYGA 3FMRA 3CTAA 1QO0D 4LK0F 1MDMB 4I7HA 4NHJA 1U78A 3ELKA 3FM5A 4I0AA 4PZJA 5CVRA 2MC3A 5IT9Z 3L7WA 2A69F 4HX8A 4AIKA 4KN7X 4MEYF 4DNCA 2ACJA 3COAC 4N0BA 1WI9A 2KRFA 4M9SA 3GYHX 4WXDA 4UNOA 1O3QA 5LHGA 1BC7C 1HW5A 1R1TA 1O3TA 1BBYA 2VT3A 2V9VA 1YQAA 2O3FA 4HF0A 4RGXA 2CG4A 2Z5UA 1UFMA 3WU0A 1K6OA 2GXBA 4BNCA 1XGNA 1SMTA 4IF4A 3I54A 5CLSA 3I5UA 3HSRA 1NHAA 4UUVA 3DXJF 4G6QA 5D6EA 2RV8A 4MNUA 5LBQA 2FU4A 2A5YB 2IVMA 2VE9A 1S6LA 4LG0A 5ILVA 4Q47A 1W5SA 3KCCA 2PG4A 4OIOF 3JAMZ 3Q9VA 3ABTA 1YLFA 2IT0A 4U7DA 4MQVA 1ZARA 2XASA 2F2EA 4LMYA 3HHGA 3REOA 2NNYA 1XB4A 2CFXA 4XLPF 2R7FA 3R6SA 2VXZA 2IPQX 1D8JA 2MH9A 4MGRA 5LGTA 1OPCA 4CICA 4ENMA 5HS7A 4FHTA 2XHKA 3J7AO 2XKOA 1QNTA 2D1HA 1S3JA 2AS5F 2CSOA 2KJBA 4KIBA 2W24A 4YIFA 2DAOA 1Y0UA 2L3DA 1LDJA 1U8RA 2DU9A 4HW0A 3IRRA 1HKSA 4WXHA 3GLXA 3F8FA 4KYWA 1Z6RA 2YX7A 4LK1F 2Y75A 5K5RA 3TDUC 2ZBKA 3FWEA 4S05A 4R1HA 2E7WA 5D8LB 3P7NA 2XGXA 3W6JB 2XAFA 2Q2EA 1BI3A 2P7CB 3EQLF 1K78A 4A2UA 1ZN2A 1FYLA 1TQMA 5BPDA 4A0YA 1T38A 4BYYA 2DI3A 3HOSA 3RYRA 4BH9A 2QQAA 2EA2A 1Z7UA 1S7OA 2K7LA 5E1ZB 5AIPA 4GGGA 5J8FA 1GHCA 1IRGA 1T2KA 3L9FA 1MKMA 2UXNA 4BHPA 2W85A 2Z3YA 3GWZA 4EQQA 1ZREA 3HRMA 3D0SA 2J5OA 5EEGA 1D5VA 3GFJA 3FMSA 2RNJA 5CJ9A 2DT5A 1ZRFA 5D4RA 4G8XA 1ZG1A 1H9GA 2QQ9A 2EWNA 2Z9OA 1CF7A 3V8KA 3F72A 3SQNA 1W7PA 4HAMA 3VEPA 3Q5FA 3EYYA 3MQ0A 3FF5A 2NYXA 3RYPA 2GA1A 3ZN0A 3RKWA 3H3ZA 4A12A 1KU3A 3BPXA 1MGTA 2HQNA 1QPMA 1RNLA 3F22A 1FPQA 3E6CC 2M30A 2YU3A 4HQEA 3V8LA 1RZ4A 2QVOA 1OYWA 4XBFA 2IJLA 3JW4A 1BOAA 2IW5A 2UZKA 4RB3C 4L5IA 3T0YA 1ZLJA 2A61A 3CJNA 3IKVA 3RPUA 3WTYC 3OOPA 2H09A 1B9MA 3HSFA 2FBIA 3EDPA 2KIMA 1I5ZA 1G4DA 2HEOA 2A07F 2CW0F 2RKHA 4M6YA 3TKYA 5E1XA 3QU3A 1SFUA 3K1PA 1F4KA 1D3YA 4MEXF 2PI0A 2KJCA 4IVNA 2QWWA 1IXCA 2QBYB 5DCMA 5D5WB 3O6BB 3RKYA 3LFKA 2XAQA 1LDDA 2HTSA 3IC7A 1W5TA 5HDKA 5DUIA 5F1RA 5ICEA 4B09A 1D8KA 2BV6A 5D5XB 3U1DA 1Z9CA 1SD4A 3QPHA 3HUGA 4P96A 2VC0A 4BXUA 4ZYDA 3WTXC 3HTUA 3RPQA 3W6KB 5JR3A 1XMKA 4OU0A 2CWEA 5KVRA 2PBIA 4KIFA 3IWFA 1BIAA 1E2XA 4WX9A 1DUXC 3KZZA 4RB1A 1Z91A 2ESHA 4AVPA 1O3SA 3VOEA 1Z1DA 2Y48A 2LF8A 2VODA 1YIOA 3C18A 4MTEA 2O0YA 1EV7A 1W7PD 1XGSA 4QWQA 5DD8A 2HYGD 2GA2A 1WKMA 4CYDA 2O61A 4N9HA 3V7SA 5BS6A 4Y15A 2OA4A 5DDGA 4OINF 2WV0A 2W57A 2EK5A 1ZHFA 4HYEA 1JXSA 4EGYA 3ZMDA 3MZHA 3BJ6A 3M7GA 5L3CA 1IRFA 4IJAA 3FXRA 1TW2A 3RJPA 4M73A 4CGZA 2P8TA 1O3RA 3M8EA 3I71A 1LJ9A 3L2CA 1C0WA 2DBBA 1J2XA 2EFNA 3HOTA 3P9KA 2CGPA 5E8IA 4CHUA 2G7HA 3WTUC 2OU2A 3P9CA 3DV8A 4OIRF 3RIRA 5DCFA 2M45A 2FMLA 2GAUA 3I59B 3BY6A 4G7HF 5D5VB 2A6HF 1P92A 2EV6A 4L9TA 3C3WA 2VBWA 2BGCA 2B0LA 1QZYA 3ULQB 1U3EM 2CQKA 1IZ1A 2P7VB 3J81K 3GFMA 3BWGA 2ZFWA 5LGNA 1HSJA 2A3SA 3GEZA 1XGOA 5L3DA 2G7UA 4M6XA 3BJOA 4KT5C 2P6SA 4P5OA 1K7AA 3GZ6A 2L01A 2QUFA 5ERIA 2K4BA 3V4GA 1OYIA 3KP6A 3ZMVA 4GYIA 1KU9A 1EH6A 1STZA 2RVCA 2K27A 1G6NA 2DK8A 1WWXA 1XGMA 4IRGA 1IF1A 3I58A 3KLOA 1S8NA 4XLNF 5TRDA 2KIUA 4GO1A 3LA3A 3I64A 4Q48A 2HR3A 3BP8A 4ENNA 4ESFA 4EGZA 2XV4S 1SFEA 3BPVA 2V1XA 2HS5A 4G9YA 5DYMA 4L5JA 1JHFA 2ZMEB 4L0YB 3HIFA 1FX7A 2PEXA 5CVJA 2FSWA 3F8BA 3T8RA 2DLLA 1I6XA 1R1VA 3HRSA 1L0OC 3F8CA 3KZYA 1KGSA 2ZXJA 4U0WA 2MBFA 2HDCA 1P4XA 2DQLA 1ZRCA 3ZPLA 4MHGA 2E7XA 4NQWA 4MTDA 5DUKA 1USTA 1R22A 2M8EA 3TOAA 1H0MA 4YG2F 1ZG3A 4FT8A 4H0EA 4WK8F 3R61A 1S29A 4ZYHA 2NNNA 1P6RA 1XSVA 4O6JA 2FEZA 2WTEA 3RDIA 2VOPA 3KETA 2LNBA 1QBJA 1PP7U 4KMFA 3L09A 1R7JA 5F64A 3O3KA 1R36A 3ZMTA 4EM1A 3ZMZA 4AIHA 3DF8A 3EYIA 1ZAOA 2XRNA 3J81Z 3M1EA 4D0PA 4ENJA 2EFQA 4ASNA 4KN4X 1XD7A 3CO7C 4M72A 4K2EA 1KU2A 1TTYA 1U2WA 5DV5A 2H94A 4EJOA 1YW9A 1ONVA 2ELHA 2FBKA 3ZP5A 3QP6A 4M74A 2QBYA 3GO5A 2FA5A 4LLGF 2DO7A 4G6DA 3F3XA 3GF2A 1U6GA 3GFLA 3ZMSA 1UCRA 1J7KA 4S04A 1JHHA 2MLGA 3IL2A 1YS6A 1FBQA 2VBXA 2J5PA 3TQNA 3J80K 5K1YA 3D5LA 2OBPA 4HLXA 2ZJ2A 1R23A 4PDKA 2K02A 2D2WA 1IUYA 2H6CA 2FNPA 1WQ2A 3KFWX 2W25A 4FX4A 2QENA 3LWFA 3MFKA 2HYFA 3TDZC 2AXLA 3WGGA 1PUEE 2ISZA 1J0RA 1FNNA 5H6RA 2DPUA 5E17F 5AIQA 2ZNZA 3H3UA 1TNSA 2WC2A 3QAHA 3MCZA 2PMHA 2O8XA 5BMZA 3B73A 1F1ZA 1J9IA 5FLXK 3ZQ7A 4ETSA 5ICCA 3QOPA 1XSXA 3E6MA 1LDKB 2XUBA 3WE3A 3LQQA 2NS0A 3C7JA 1V4RA 1YS7A 3TO7A 4JBAA 4OIPF 5HDNA 5K5QA 1T6SA 2KIFA 4HOBA 1YO5C 3HSEA 5E20A 2GWRA 2XAJA 2HTJA 2QYOA 4G7ZF 2YPRA 1SAXA 4I0BA 3E6BA 2JTVA 5A2QK 1YG2A 2LKPA 3I59A 1RUNA 2EFOA 2COMA 1SMYF 3IRQA 2OZUA 4HA8A 3NRVA 1OR7A 1RIOH 3BJAA 3WODF 1Q1HA 1QGPA 3R0AA 3DFGA 3KP3A 1XDUA 1TW3A 3ZMUA 5E18F 5HLIA 2OQGA 4HDVA 2A68F 3ABUA 4LFUA 3K1NA 2HOEA 5HVQC 2L02A 5L3GA 3ROUA 2QLZA 3AAFA 1ZG5A 2ADUA 4JQFA 4HBLA 1ZLKA 1DPRA 4PCQA 2BE5F 2BEOA 3VFZA 4BAYA 2OAZA 3E5QA 1FSEA 4U0VA 1ULYA 1HW1A 1IN8A 2BYVE 4YFNF 1REPC 3F21A 1SD7A 2LDUA 4O3MA 1IN6A 4I2OA 1FYKA 2HWVA 1KQ0A 1E17A 3DQVC 3FX3A 5D8KB 2VONA 1T39A 1HKTA 3JSPA 2ESNA 1R1UA 1KQ8A 2Y0MA 5CYVA 4P55A 2MLKA 3KP7A 2HZTA 3F8MA 1LNWA 2DK5A 4GCVA 2PJPA 4IXAA 1BC8C 1AOYA 1MDMA 4M9XA 4JK1X 5LEKA 4CO8A 2H6BA 1YYVA 1H9TA 1ON2A 3KP2A 2V79A 4NB5A 2FF4A 2X4HA 1XDSA 2ZMEA 5ED4A 3ISPA 5CVUA 1ODDA 5H20A 4EM0B 1DPUA 4LLLA 3NQOA 2FMYA 2PQ8A 3GZ5A 2EJRA 5FFXA 5ICGA 1ZRDA 3M9AA 3KEQA 1FWZA 1QZZA 1MJAA 2P4WA 4OOIA 3V8JA 4UVBA 1BIBA 3GUDA 1B9NA 5BQTA 3GXOA 3ECHA 4RB0A 3DPTA 1FZPB 2LF7A 3RTRA 2VOOA 1Z6TA 3CUQB 4UXNA 2C6YA 2K4JA 3JTHA 3GFIA 4RGSA 1I1SA 1K79A 1HKQA 2M5WA 3BDDA 3MAJA 2DFIA 1R58A 5L3BA 1FBSA 2F5DA 5FFZA 4XSXF 2R3SA 1J59A 2HGCA 5HS8A 4WWCA 5J8CA 2FRHA 3L00A 1G3TA 4A5NA 3WTVC 3ZN1A 1YFHA 1I27A 5LGUA 4BQAA 1CGPA 5ICFA 4HQMA 4I98B 4A0ZA 4LJZF 3N97A 1IN5A 3TO6A 2DW4A 4LD5A 3P9IA 3WTTC 3JAMK 2YX4A 5LLQA 4UV9A 3PQKA 4ESBA 2XROA 3WGIA 2ZCWA 4BHCA 4AWXB 3WTZA 1B6AA 3E5XA 4UVAA 1HBXG 3DEUA 4IHTA 4L9NA 1KA8A 3N4MA 3ERED 5K5OA 4M9ZA 4RB2C 3TGNA 1XCBA 5LHIA 2F5FA 2YR2A 4KA4A 2PFBA 1HSTA 4RAYA 2FOKA 5FGMA 3DP7A 2EB7A 1P2FA 5D5UB 4WF2A 5HOOA 2F5CA 4QLCU 1S7AA 1ZYRF 2MA3A 3FXUA 4HX4A 3K9TA 2RGVA 1ZGAA 1FOKA 5CVVA 3M8FA 3K0LA 3KLNA 3SZPA 4YFXF 3R0JA 3IHUA 3DPLC 2JPCA 2EFWA 3HHHA 4HV6A 1TQIA 3SZTA 5L3FA 2HFHA 4KIGA 2W84A 2PLYA 2XIGA 4L9JA 2O03A 2EV5A 3CUQC 2P5LC 3R4KA 2HQRA 2BBYA 1IXSB 1FSHA 2FQ3A 1ZGJA 5ILUA 3QP5A 2L4MA 4IRHA 5KK1A 3WGHA 2VBZA 3K69A 4ESJA 1OKRA 3F6VA 3HRTA 2CYYA 2XAHA 3FXQA 1IW7F 1SD6A 1KYWA 4OMYA 1T98A 3V7RA 2R7DA 1BI2A 3CLOA 2JZYA 1FLIA 1XN7A 1BN5A 2JSCA 1UHMA 3BROA 2P6TA 2E1NA 4ZZDA 4Z2YA 2DTRA 4P9FA 4I01A 3I4PA 4PGHA 4UVCA 1XMAA 3LA2A 1TLHB 5JHUA 2IA0A 2E1CA 3U9GA 4RS8A 1DDNA 3T5XA 3OV8A 1WRJA 5J6XA 4HF1A 1F9NA 5BPIA 3KP4A 1BJAA 3RKXA 3WG9A 4OIQF 1KU7A 1FP1D 4EJVA 4CDGA 4Q5SF 1O57A 3V7CA 3TOBA 1BM9A 3SHFA 3QU6A 4I09A 5TJJA 1PDNC 2HKXA 3CDHA 2ZO4A 3KP5A 1RUOA 4L18B 1IN4A 4GYGA 4TV7A 3F23A 1MJBA 1B59A 2Z33A 2IA1A 3SXYA 5HDGA 1UHWA 2YSRA 5FB2A 3F8NA 3S2WA 1U5TB 5ILSA 5H6QA 5FD6A 1SFXA 3G3ZA 1HQCA 2K86A 2QQBA 2X0LA 3LSTA 4HX7A 1ON1A 2Q8KA 3BZ6A 1GXQA 1G3WA 1FT9A 2OZ6A 1ZH5A 1G3YA 4CZZA 1XSDA 3E97A 3WTWC 2O6GE 2XAGA 1GVJA 3WU1B 2A6EF 2Q0OA 2P5VA 3Q9SA 4L0ZB 2Z99A 5E8GA 3LQRA 4ZH4F 5LEJA 4ZYEA 4KDPA 4IPAA 4G7OF 1W4MA 1FBUA 2JPBA 1FP2A 3LA7A 4FX0A 1HW2A 1LEAA 3T1BA 1YTYA 5L3EA 3ML6A 5HLGA 1FYMA 4KFCA 4AD9A
chains in the Genus database with same CATH superfamily
1G3SA 2JK3A 2DPDA 1HXDA 1T0FA 2FNAA 4S0HB 5HODA 4FISA 2GM4A 3O8GA 3CUQA 2VBYA 1BI1A 2FE3A 2LR8A 5EZGA 3JRDA 3MZ8A 4XSZF 2R7QA 4F92B 3OIOA 5FO5A 1UAAA 4JX4A 1GXPA 1TBXA 2MH2A 4XKBA 2W00A 3GVAA 5EF6A 2RC4A 3BOQA 4XLCA 4P9UA 1DQUA 2A6TA 2CO5A 1IXRC 3BT9A 1UB9A 4BQQA 5CPRB 2KMUA 4DQ2A 1F5TA 3KEOA 3CO6C 4Y13A 3HTSB 5IOYA 2EQRA 1WSUA 2STWA 1OMIA 2W4SA 5FKKA 2I8DA 2M4KA 4RLQA 2JT1A 1AWCA 1Y8QB 4LLNA 1B1BA 2KT0A 3CCYA 2ZNYA 3MMYB 4BKXA 3T8TA 4RBOA 4A0XA 3D5SC 3PFIA 1A35A 2HKOA 2ELJA 1QHHD 4LG0B 3OOUA 3K1MA 1A04A 2EFPA 2LD5A 1OCRH 4AU7A 4OMZA 1H88C 4LGWA 3PQJA 4RGRA 4G6TB 1TNTA 2OQRA 2W1OA 2R7SA 2BHYA 3EUHC 4ON0A 2R5ZB 1R5GA 1SD5A 3NEUA 1V3FA 1NG6A 2DQRA 3FMQA 2CV0A 3K70D 2PMZA 1USSA 1I1GA 2XVCA 4MQ9F 4E7ZA 1MBGA 4EMSA 2M87A 1KYZA 2PN6A 1GDTA 5J47A 1DP7P 1WGXA 5FLMJ 1WHUA 3SDBA 2ETHA 3E6DA 3J80Z 2W7NA 5KHDA 1L3LA 2IRFG 3A2KA 3S2HJ 3NWTA 2OD5A 1JGSA 1U5TC 4R79A 5JI6A 2FQ4A 5HNFA 3MZYA 4L5EA 2LBFA 5BOXA 1DU0A 1LEBA 1FC3A 2E19A 1YOVB 1TWHJ 2MD5A 5AONA 5HS9A 4H4KC 1MZBA 3GW2A 5GPAA 4BHBA 5IP9J 3LAPA 4EATA 1J75A 2KKOA 2L54A 5LRRA 5FLVA 4EV0A 2LRDA 2DA1A 5M5YJ 3SFZA 2HI3A 2QM3A 2H27A 2IBDA 4XONA 4A3JJ 4CCOA 1LQ1A 3KX2A 4HV5A 3CCJI 1BW6A 2PMUA 4U7BA 3HYIA 3A0BC 3FHZA 2HQ5A 3R60A 3VDXA 4P1WA 6PAXA 3RI4A 3CMMA 3VODA 2G9WA 1V5FA 1TQPA 3MVPA 4U88A 3TBIA 3DU5A 1QU3A 2M1BA 4U0YA 3TP3A 3I53A 4M3BA 4M71A 1A5JA 2V9KA 3AG4H 1QA6A 2X48A 3ABKH 2VC1A 1LB2A 2VE8A 3G73A 4CZCA 5EGOB 2VKHA 4DYQA 5DEQA 4C3JJ 3H92A 1SANA 4CXFA 2K9MA 1RPWA 2BW3B 2IS2A 4WXCA 4HEA2 4XORA 3RSNA 2UV1A 4PJNA 4A5MA 3I4NJ 2Q2EB 5FLXZ 1LPQA 4O5VA 2RDPA 4HZFA 1K78B 1MJ9A 1Z77A 4OAZA 1W5CC 3ESWB 1TC3C 2JRTA 1BI0A 3KIOA 4KNYA 3MKYB 3FM3A 3U2RA 2DT6A 2D1VA 4Y52J 1MSFC 2M7BA 1OCTC 2EPFA 4DZJA 3PUFA 1QPIA 1TT5B 2GQQA 3FHNA 2HXOA 4A6EA 4LB5A 3BTCA 3B6CA 3WG7H 2DA7A 4EM2A 2DMUA 3GTMJ 5H2FC 5FD5A 2L9VA 3S2DJ 4F3QA 3WE2A 1YW7A 4N9IA 2H8RA 2ZXWH 4EJTA 2UXXA 5E1WA 4AIJA 5DD4A 3FISA 3TEDA 3HRUA 2VT2A 4ZJZA 5EEHA 3JTGA 1T8IA 3OWTA 5F0HA 4IHSA 2F5EA 2GIVA 1X1PA 4E70A 4W97A 3A01A 3W2VA 4F7ZA 5A2QZ 2RN7A 1T33A 3QWLA 1DP3A 5JVTA 1LVAA 1LE8B 4EJUA 4XNFA 3QRFF 2QZ8A 2RNGA 1HA8A 1OYYA 2ZKZA 3AL0B 4RGUA 5E3MA 3NAUA 1CF7B 3E3VA 2WWYA 4JX5A 4LB6B 3TMOA 4A69C 1IAWA 4CSWA 2V1UA 5IT9K 1NK3P 1W7PB 1D1AA 4GXOA 2ID3A 5IT3A 1J5YA 3VB2A 1Z3XA 2UWMA 3WTSC 1VQNI 3A0HC 3B02A 3KE2A 3MWMA 2EIKH 2TDXA 2X1EA 3EETA 3QPTA 1SVMA 2KRHA 1AU7A 4V19K 1RI7A 1O7LA 3ZR8X 3JSOA 2NAZA 3K4MA 3H0GJ 2X51A 4KUMA 3IH2A 2GXGA 2ISYA 5F6FA 2M2EA 4QIWN 5HLTA 4E4HA 5B3SH 2VLAA 2XKPA 2MYSA 4G94A 3BQYA 1P4AA 3UR3C 4R8HA 4RAZA 3MEXA 3PIPF 4PJ0C 3JREA 4IEJA 2HDWA 1KQ9A 1I6HJ 1JE8A 3PM1A 3SZGA 5DTDA 5D4SA 1Z05A 3VSKA 4YFKF 1Y8RB 2VKDA 3K2ZA 4UV8A 3CC4I 5EDNA 1XCVA 2R7UA 1EH8A 1U9OA 1JKRC 1FIAA 1X4OA 3CCQI 5FRNA 5EEAA 1UJ8A 1PP8F 5LHHA 3OYHA 1X3UA 2L4AA 2DOEA 2LREA 3IAM2 5D6FA 2EA4A 2IEKA 2DYSH 5FROA 2GZWA 4XQFA 4HLYA 4CYCB 2DDBA 3ECOA 3CCRI 4W1UA 2BY2A 1VTNC 3NWSA 1B4AA 2LG4A 3IWZA 4FE7A 1MD0A 4YIIA 2LP0A 4BDYA 3EUHA 4L9VA 1EH7A 3L2WA 3BTIA 3CC2I 1R5HA 5C4XJ 5HLHA 4BU2A 1U0JA 4XRFA 1R00A 4Z6YA 2ECBA 2HVRA 1MBHA 2FUG2 2L2OA 3GX4X 2VN2A 1V5GA 2NRAC 2P5KA 3A02A 5DCMB 2LTPA 3IKTA 4ZZLA 4WCGA 1JT6A 1QQIA 2MGQA 3I0TA 1FY7A 3A03A 4PGGA 2WADA 4KICA 1U5TA 2FBHA 2D45A 3LL7A 4G12A 4KMUX 4HDUA 1MMAA 3PSIA 5LRSA 1SVLA 3CUOA 2IA2A 2K85A 2AHQA 5CQGA 2RQPA 2VPLA 1OISA 3HUGB 4EJWA 5JFRA 4Q4ZF 2Z2SB 3DEWA 1P4WA 4Y17A 1YW8A 5CVIA 1M1EB 4I02A 2LSOA 2EV0A 2KISA 3HB9A 4IRIA 4UHTA 2V1DA 2AQEA 3O2PE 4IHWA 2IP2A 4B8XA 4F91B 1IN7A 4A6DA 2FXAA 3LAJA 3DKWA 4ENKA 2DODA 1O7FA 3SEQA 3BLYA 2STTA 3F6OA 3G6EI 3FZVA 3ZQLA 2NOJB 1MH3A 2IGMA 5CKTA 3E5UA 2LYCA 2V6CA 3C1DA 4EVIA 3BG7A 4HF2A 3TO9A 4ZYGA 3FMRA 4E7KA 3KPHA 3CTAA 4DW6A 1IDZA 3QPLA 1B8IA 1EA3A 1QO0D 2G0EA 4LK0F 5FRMA 4XRSG 1MDMB 4I7HA 4X1EA 4NHJA 4M3FA 2GXAA 2NS8A 5C3EJ 4BJTA 1U78A 3ELKA 5IY5H 5FKMA 3S93A 3FM5A 1QHGA 5EYRA 4BXXJ 3DTIA 2Y9YA 4I0AA 3AL0C 1X19A 1X1BA 3DKXA 5IYCJ 2NVTJ 3BG5A 4PZJA 5GADJ 4B43A 5CVRA 2MC3A 3BR3A 5IT9Z 2B63J 3L7WA 2A69F 4HX8A 2V1NA 3S16J 4AIKA 4KN7X 4D5FA 4MEYF 4DNCA 2VQGA 5FJ8J 3COAC 2ACJA 1EF4A 4N0BA 1WI9A 2DOAA 2KRFA 4M9SA 3GYHX 3C2HA 2L7KA 2LKXA 1AA7A 1IRXA 4WXDA 3OMYA 4UNOA 4A3BJ 4MO7A 1O3QA 2B7EA 4D7MA 2EZIA 1XG1A 5LHGA 5J40A 1HW5A 1R1TA 1BC7C 1O3TA 1CQTA 1BBYA 3K4JA 2VT3A 2V9VA 4IHVA 1YQAA 1H8AC 1A6IA 3I4MJ 3E1SA 3U21A 4C9YA 4LOCA 1MNDA 2O3FA 2XRLA 4HF0A 2K5CA 4RGXA 2CG4A 2IGOA 2FD5A 1MMSA 2Z5UA 3CD6I 5M5WJ 1UFMA 3RZDJ 3WU0A 1K6OA 2GXBA 2M0CA 4IKFA 4HNVA 4BNCA 4ZTJA 2F6CA 1XGNA 1SMTA 3BTJA 3HG9A 3I54A 4IF4A 5CLSA 3I5UA 3E0JB 3HSRA 1NHAA 4UUVA 3DXJF 4G6QA 5D6EA 2RV8A 2XAUA 4MNUA 2X6WA 3ERMA 5LBQA 2FU4A 4RM3A 2A5YB 2IVMA 2VUMJ 1EKEA 3MKWB 5LFAA 1S6LA 3LSKA 1WI3A 4LG0A 2QEXI 2VE9A 1SVOA 1MMNA 2JUGA 4XLHA 5ILVA 4Q47A 1W5SA 2JVHA 3KCCA 3OYLA 2PG4A 3VYRB 4OIOF 4IHYA 3JAMZ 1T95A 3M1CA 3Q9VA 9ANTA 2N8GA 4BXFA 2MSYA 3ABTA 1TWAJ 1W0TA 1YLFA 2IT0A 4U7DA 4MQVA 3G71I 1ZARA 2XASA 3SEZA 2R5ZA 2F2EA 4LMYA 3HHGA 5DS9A 3REOA 3S8PA 1P7IA 3L1PA 3CZ6A 2NNYA 3OR1C 1A6QA 1XB4A 2CFXA 4XLPF 2R7FA 1OFCX 1IO2A 3DLAA 3HJEA 3R6SA 2VXZA 3ZCOA 1WJAA 3PNTA 3CQZJ 2IPQX 4DGWB 1D8JA 4I99C 1ZKGA 3K10A 2MH9A 4MGRA 5LGTA 4Y4RA 1H89C 2CS3A 3Q3SA 1OPCA 2L7FP 4CICA 1VF9A 4ENMA 1A36A 4AYBA 1DGRM 5HS7A 1MBJA 4FHTA 2VJIA 2M4GA 1D0XA 1IJWC 2XHKA 1QVTA 1E3OC 3J7AO 2XKOA 1QNTA 3I3LA 2D1HA 1S3JA 1NH3A 4BJ6C 2AS5F 1K83J 2CSOA 2KJBA 4KIBA 2W24A 2GIZA 4YIFA 2DAOA 1Y0UA 2L3DA 1N77A 1LDJA 3ZXSA 1U8RA 2DU9A 1ETVA 3MKLA 4HW0A 3MD2A 3PO2J 2K9QA 3CMAI 5F08A 3IRRA 1HKSA 4AVZA 4WXHA 3GLXA 4RM2A 3F8FA 3VYUB 1Y56A 4RAGA 5JLWA 4KYWA 2MG4A 1Z6RA 2K40A 3BC8A 2H1KA 2YX7A 4LK1F 2Y75A 1NTCA 5K5RA 3UKGA 1IC8A 3TDUC 4BQOA 5EGOA 4BBSJ 3HEFA 2ZBKA 2E1OA 3FWEA 2BY0A 4S05A 2HNHA 4R1HA 2E7WA 2BW3A 5D8LB 2DMPA 3P7NA 2XGXA 2HDDA 3W6JB 2XAFA 2Q2EA 1BI3A 3HKZN 3EQLF 2P7CB 3EUAA 3FKJA 1K78A 4A2UA 4ITVA 3ASOH 1XX5A 3OL4A 3EPZA 3H9QA 2CUEA 3OYKA 1ZN2A 2BHZA 4PJMA 1FYLA 2HXIA 1WCMJ 1IV8A 4RDUA 2DFEA 4II2A 2KDZA 2ELKA 1TQMA 3K4KA 5BPDA 4A0YA 5GTIC 4M3GA 1T38A 4BYYA 2DI3A 3HOSA 2ZXIA 3RYRA 4BH9A 2QQAA 2EA2A 3BR0A 1Z7UA 2KQRA 2E5ZA 2JA8J 1S7OA 1X2MA 3P5JA 2K7LA 5E1ZB 5AIPA 1N25A 4GGGA 1XMXA 5J8FA 1HC8A 3WU2C 3HOXJ 3JCUC 3PIOF 1IRGA 1GHCA 3HM5A 1T2KA 1X2NA 3L9FA 3OS0A 2O8KA 3BR5A 1MKMA 2UXNA 4BHPA 1FOYA 2W85A 5FKNA 2Z3YA 3AG2H 3GWZA 4EQQA 5TGTA 1ZREA 1UMQA 3QYBA 3HRMA 2PX9A 3DCFA 3QOEA 2W82A 3D0SA 2J5OA 5EEGA 1D5VA 3GFJA 2DN0A 4A3DJ 3FMSA 2RNJA 5CJ9A 4JYKA 2DT5A 1LE8A 2IXSA 1ZRFA 5D4RA 4G8XA 2OTJI 1ZG1A 4C2TA 1JKPC 1H9GA 2QQ9A 3S32A 2EWNA 1VQ7I 2Z9OA 1CF7A 4NQWB 3LSGA 3I56I 5C44J 3V8KA 2KDOA 3L2QA 3F72A 3SQNA 1W7PA 4HAMA 3VEPA 2HPMA 3Q5FA 2BZTA 3EYYA 3MQ0A 2VL8A 4HRIA 2R93J 1JUSA 3GTJJ 3FF5A 4C2UA 2OJED 4J19A 1V5EA 2R4GA 2OTLI 2NYXA 3RYPA 3HDDA 1Y6IA 2GA1A 5BNGA 3ZN0A 2HVQA 3RKWA 3H3ZA 4A12A 1KU3A 3BPXA 1MGTA 2HQNA 3U1KA 1QPMA 4E7JA 1RNLA 3F22A 1FPQA 1JUPA 5JVGF 1TT0A 1R6RA 1WJBA 3E6CC 2M8GX 4BS9A 4C2MJ 1V55H 2M30A 2YU3A 4HQEA 3V8LA 1RZ4A 1YX3A 2QVOA 2ECCA 4X0GA 1OYWA 2O9LA 3OYEA 4XBFA 2JRMA 2IJLA 4IO9F 1WH7A 1W1WE 3JW4A 1BOAA 3D1NI 2IW5A 2UZKA 4XLEA 4U87A 4RB3C 3HOWJ 3FXKA 4L5IA 3T0YA 1NK2P 1ZLJA 3LSIA 2A61A 3CJNA 1N78A 3IKVA 3RPUA 3WTYC 3OOPA 2H09A 2DJIA 3FBNB 1BOBA 2BOLA 4LITA 1B9MA 3HSFA 2FBIA 3ABLH 3EDPA 3L2UA 3OL3A 2KIMA 1I5ZA 4ANJA 1A31A 1G4DA 2HEOA 4CYCA 2A07F 2DDAA 4OWRB 2CW0F 2RKHA 1ETXA 1LFPA 4CCJA 4OAYA 3S17J 4M6YA 5F04A 3TKYA 5E1XA 3QU3A 1SFUA 3K1PA 2CU7A 1MBFA 1F4KA 1D3YA 4MEXF 2PI0A 3W2AA 2KJCA 3ZQHA 4IVNA 2QWWA 1IXCA 2RQQA 2QBYB 4A93J 1BW5A 5DCMA 2VXDA 5C4JJ 1S5LC 3GTKJ 5D5WB 3O6BB 3RKYA 2EIJH 2WAQA 4Y3OA 3ZOBA 2PMZN 3GTPJ 2HOAA 2CW8A 2DA5A 3LFKA 1JKOC 2DTZA 2XAQA 1LDDA 4Y7NJ 2HTSA 3G4SI 3IC7A 2ZXHA 1W5TA 3H3VK 2F48A 5HDKA 5DUIA 2HPIA 5F1RA 1OCOH 1QVUA 5ICEA 2XF5A 2F5VA 1D8KA 2BV6A 3IH4A 4XOPA 4B09A 5D5XB 3CC7I 3U1DA 1PYVA 1SD4A 4CH7A 2TCTA 3QPHA 1Z9CA 3HUGA 2DXIA 2QSGX 4P96A 2VC0A 4BXUA 4ZYDA 4NBQA 2BXZA 1E0EA 1SAUA 3WTXC 3HTUA 5IOZA 1YJWI 3RPQA 4BE0A 4DJAA 3W6KB 2GLOA 1WJCA 5KNLA 5JR3A 1XMKA 4OU0A 1K61A 1BR4A 4PFPA 2LKSA 2ZJRF 2CWEA 2EZLA 5E3NA 5KVRA 2PBIA 4KIFA 1W36C 3IWFA 1JTXA 2DOFA 1BIAA 2E60A 1E2XA 2LY9A 1X58A 3K2AA 4WX9A 1DUXC 2L7ZA 3KZZA 2CMPA 2EIMH 4RB1A 2EZKA 3ASNH 1Z91A 2ESHA 4AVPA 1RESA 1YRNB 1O3SA 3VOEA 1Z1DA 1DU6A 4GRIA 2LC2A 2Y48A 3ABMH 5TISC 3CESA 2LF8A 3V42A 2VODA 2CUJA 3C18A 1YIOA 4MTEA 2O0YA 1G8XA 1EV7A 3I55I 1TP4A 1E3HA 2BVLA 1W7PD 3S3MA 2V6EA 5K7HA 1XGSA 4QWQA 5DD8A 1XS9A 2HYGD 3BZCA 1FTTA 2GA2A 1G59A 4E7IA 1WKMA 3IH3A 1D0YA 4CYDA 2O61A 1TWCJ 2XSDC 4N9HA 3H5NA 5F0CA 3V7SA 5BS6A 4Y15A 2OA4A 5DDGA 2L9RA 1VQKI 4OINF 2K3FA 2WV0A 1VQ5I 4CCMA 4KT6A 2W57A 4V2FA 2EK5A 1Z21A 1ZHFA 4HYEA 1JXSA 1R9TJ 1RRJA 2NVUB 3HC7A 1YJ9I 5FKLA 1RR8C 4EGYA 3JRAA 3ZMDA 3MZHA 3BJ6A 2R7WA 1PJRA 2JQ7A 3M7GA 3KZIC 3M07A 2ZSIB 1IRFA 5L3CA 4IJAA 3CLQA 3FXRA 3GTQJ 2Y30A 3DBRB 1TW2A 3RJPA 4IQ4A 4M73A 3RPUD 4CGZA 2P8TA 5M3FJ 1O3RA 4A3GJ 1K6YA 3M8EA 3I71A 2KLOA 1P9QC 1LJ9A 3CF5F 4DIQA 2XDVA 3L2CA 2IS1A 2L7MP 2XPUA 1C0WA 3RQ4A 3CMEI 3W6VA 1YI2I 3JRHA 2I5UA 3HGGA 1ETKA 1J2XA 2DBBA 2EFNA 3HOTA 1R4NB 3P9KA 2QKLB 3PSFA 3K4BA 4BGDA 4XLFA 2CGPA 1VQ9I 5HNHA 3QPSA 5E8IA 1T56A 5KAIC 4CHUA 2VIXA 2G7HA 2GBYA 3WTUC 2WAFA 2OU2A 3P9CA 3DV8A 4OIRF 2M9HA 4DBQA 3RIRA 5DCFA 2M45A 2VB6A 2FMLA 1APLC 3S14J 3S1QJ 3JR9A 2GAUA 2MABA 3D5RC 2AO9A 3I59B 4B1RA 3AKZA 4M3EA 2JVGA 3DKYA 3BY6A 2M3AA 4G7HF 5D5VB 2A6HF 1P92A 4HG2A 2ME0A 2EV6A 1WZ2A 4B44A 3JRBA 1ZQ3P 4ZDPA 4L9TA 3C3WA 2VBWA 3PNYA 2BGCA 2B0LA 5EG0B 1QZYA 3ULQB 2Y9ZA 2R5YB 1U3EM 2X1CA 2CQKA 3CP2A 2OF7A 2CQNA 2F4MB 1IZ1A 2P7VB 1VQOI 1SEUA 3J81K 1TWGJ 3GFMA 3K7AJ 5J1YA 5KCMA 4HNUA 4ZC3A 1VZ0A 3BWGA 2ZFWA 2JA6J 3WHCA 3H1CA 5LGNA 1HSJA 2A3SA 2DT7B 3FXJA 3GEZA 1XGOA 3BG6A 4MIMA 5L3DA 3VYTB 2G7UA 4M6XA 2L9NA 4D7NA 3BJOA 4KT5C 2V4JC 3G1OA 4XLAA 3GTGJ 4BBRJ 2Z16A 3DEEA 1T08B 2P6SA 4P5OA 1K7AA 3GZ6A 3ZQQA 3LSPA 2VQCA 2NOGA 3HPGA 5B5EC 1I3AA 1Q1VA 2L01A 2QUFA 2BY1A 5ERIA 4II3A 1U8BA 5B66C 5B1BH 2K4BA 3V4GA 1OYIA 3BR6A 2B9SA 1F43A 3CJRB 3GBGA 3KP6A 5CQEA 3ZMVA 3OYDA 1AHDP 1Y1WJ 4GYIA 1FIPA 1KU9A 2WBMA 2DMNA 1EH6A 3ZQFA 1WFXA 3ZGKA 1STZA 2RVCA 2HVSA 2D5VA 2EINH 2K27A 2DFFA 2W48A 4B4CA 1G6NA 2DK8A 2VPRA 1FEXA 2LOOA 4XMYA 1WWXA 1XGMA 4IRGA 1IF1A 3I58A 3H9JA 3KLOA 1S8NA 1Y0NA 3ZRGA 1YX5A 1X3WB 4XLNF 3DTKA 4BQNA 5TRDA 3GZNB 1EJ9A 4A3MJ 2KIUA 3OIQA 4GO1A 3BZKA 4UB6C 3J7ZI 3M3YJ 2E34A 1K4TA 5E3OA 4C3HJ 3LA3A 4A3KJ 3HXLA 3I64A 4Q48A 2HR3A 3BP8A 4ENNA 3I9V2 3LOCA 4ESFA 4EGZA 2XGCA 2XV4S 2H8WA 4RLFA 3GCMA 2LVSA 1WH5A 1SFEA 3BPVA 2V1XA 3LFUA 4PJLA 2HS5A 4G9YA 5DYMA 4XKCA 4L5JA 1JHFA 2CV2A 2ZMEB 1AKHB 4L0YB 3HIFA 1FX7A 2PEXA 5CVJA 2FSWA 3F8BA 3T8RA 1I6XA 1R1VA 2DLLA 2M34A 3HRSA 1L0OC 3F8CA 3KZYA 1KGSA 2ZXJA 2BY3A 3PL8A 2MBFA 4U0WA 2R0QC 5FKOA 2HDCA 1P4XA 2R7ZJ 2DQLA 1ZRCA 4PJJA 3BG3A 2XF7A 3ZPLA 1NG7A 3DWLE 4MHGA 2E7XA 2V9PA 3OYIA 1GT0C 4A3FJ 4NQWA 4MTDA 5DUKA 1USTA 1R22A 4XM3A 3K6GA 2M8EA 3TOAA 1H0MA 4YG2F 1ZG3A 2F4OB 1I3QJ 4FT8A 4H0EA 3CDLA 2XC7A 4A3LJ 4WK8F 3R61A 1S29A 4ZYHA 2NNNA 4ABZA 1P6RA 2FJ1A 2E2JJ 1OLTA 1XSVA 1FJLA 2E71A 4O6JA 2FEZA 3CCMI 2WTEA 5GAGJ 2LFBA 4E7HA 4B47A 3RDIA 2CUFA 2VOPA 3FXMA 3MN2A 3KETA 2QCOA 3VSLA 1MIJA 2LNBA 1ORKA 3K4CA 2O5RA 3DLLF 2BXYA 1QBJA 2LH9A 1PP7U 4KMFA 3L09A 4RMNA 3WHBA 1OR7C 1R7JA 3BTLA 4BEHB 5F64A 2CFOA 3O3KA 4JX6A 1R36A 3ZMTA 4EM1A 3ZMZA 4AIHA 3PUBA 1V54H 3DF8A 3H35A 3EYIA 1ZAOA 2XRNA 4AC0A 3J81Z 3M1EA 5J4YA 4D0PA 3CF2A 4ENJA 2EFQA 2IS4A 1JGGA 3HZJA 1RKWA 3CCEI 4ASNA 4XRMA 4RA2A 5J1UA 3VPRA 4HPQA 1FTZA 4KN4X 1XD7A 1XTAA 3CO7C 1HDDC 2LY1A 4M72A 4K2EA 1KU2A 1TTYA 1U2WA 4FETA 2H94A 5DV5A 4EJOA 3OYCA 1YW9A 1D1BA 3SFIA 3HOYJ 1ONVA 1N75A 2ELHA 1FOWA 4KISA 2FBKA 3FIWA 3ZP5A 4XR6A 3UNGC 5K7FA 1XC5A 3QP6A 4M74A 4EEFG 2QBYA 1MSEC 2K3PA 5E3LA 3GO5A 2VI6A 1OCZH 4NUBA 1LKXA 2FA5A 4LLGF 3ZQCA 2DO7A 4G6DA 3F3XA 3GF2A 1U6GA 5IP7J 4XK4A 3GFLA 3C2GA 3ZMSA 1UCRA 2KHMA 1J7KA 2E2IJ 3A1YA 4M3DA 2L9SA 1J09A 3ZQGA 4S04A 1JHHA 4M6VA 5B1AH 3J7AY 1MBEA 2MLGA 1R4MB 4CCLA 4PSWA 2E1MB 2XPVA 4CUGA 4AYBN 3IL2A 3L2RA 1YS6A 1FBQA 1VQPI 2KPMA 2VBXA 2MC4A 2R92J 1MMGA 3G1MA 1BJZA 2WA0A 2J5PA 2ZC2A 4FQGA 4B3XA 2Y0SA 3TQNA 2HOSA 4YIRX 3J80K 3H0DA 2QF7A 2AXTC 5K1YA 2M0MA 1B72B 2XPWA 1ENHA 3D5LA 2E35A 1YITI 2NVQJ 1ERDA 2L0KA 2OBPA 4HLXA 2QKMB 2ZJ2A 3OYNA 1E3PA 4FCYA 1R23A 4PDKA 1YRNA 2K02A 5J3LA 2D2WA 1OQYA 1WJ5A 2ZMEC 3DTEA 3JRGA 2V26A 1IUYA 3CCVI 5F1JA 1P7JA 2H6CA 1UG0A 2FNPA 4BY7J 2E5NA 1WQ2A 3KFWX 2W25A 5J1RA 1ETWA 2LK2A 3MKZA 4FX4A 2QENA 3LWFA 1PVEA 2CJJA 2OPTA 3K4NA 3MFKA 2HYFA 3TDZC 3IP4B 2AXLA 3WGGA 1PUEE 2ISZA 3LMMA 1J0RA 1FNNA 5H6RA 2DPUA 1IGNA 3DBHB 5E17F 5AIQA 2ZNZA 2Q1ZB 3F9KA 3FKIJ 4XL9A 4PFOA 3OSGA 1I39A 4CCKA 3H3UA 3RQIA 5DM6F 4ZDOA 1TNSA 3VWBA 2WC2A 3QAHA 4XN3A 3MCZA 2PMHA 1O4XA 2O8XA 3LSMA 5BMZA 2WV1A 3B73A 1F1ZA 1J9IA 3K4LA 5FLXK 2DMTA 2R7OA 4D5CA 3ZQ7A 5KAFC 1OJLA 4ETSA 5ICCA 3QOPA 3L2VA 1XSXA 3E6MA 2WB1A 1LDKB 2XUBA 2HQAA 1POGA 3WE3A 2KZGA 3LQQA 3AFHA 2NS0A 3FDYA 4LIVA 3C7JA 1V4RA 3PNVA 1YS7A 1JT0A 1KZHA 4BDZA 2KZVA 3TO7A 3IV5A 3LSJA 3OYBA 4JBAA 4OIPF 5HDNA 5K5QA 4KITB 4DYCA 5IPAA 3KYCB 3HGYA 1YIJI 1T6SA 2KIFA 4HOBA 1YO5C 3HSEA 5E20A 2GWRA 2XAJA 3SDGA 2HTJA 2QYOA 4G7ZF 2YPRA 4HNTA 2WB1N 1IDYA 1SAXA 4I0BA 3F0CA 4BJ5C 3E6BA 2JTVA 4FASD 3KYLA 2X6YA 4F52A 4UUTA 4BUPA 3M4OJ 5A2QK 1YG2A 1ZR4A 2LKPA 1LUJB 1D1CA 2VJ4A 4IZZA 3I59A 1RUNA 2EFOA 2COMA 3BCBA 1SMYF 3IRQA 3OS2A 4GDFA 2OZUA 4HA8A 2K9SA 3BR2A 3NRVA 1OR7A 3RKQA 1RIOH 2EH3A 3GTLJ 3BJAA 3CCLI 3WODF 4XICA 5EG0A 4QSHA 1Q1HA 1QGPA 3R0AA 4AIDA 1Z7LA 3DFGA 3RCOA 2R5YA 3KP3A 3TW6A 1LFBA 4NC6A 1XDUA 3DPUA 1TW3A 1HCRA 3ZMUA 5E18F 4IX7A 1IG7A 4AUXA 4FE4A 3HOZJ 5HLIA 4BY1J 2NVXJ 2OQGA 2JA5J 3FXOA 2X6XA 4HDVA 4IOCF 1LFUP 2A68F 3ABUA 1IV6A 4LFUA 3PO3J 3HOUJ 3K1NA 2HOEA 5HVQC 2L02A 2E1MC 5L3GA 3ROUA 1SFOJ 2CQXA 4IOAF 2QLZA 3LSRA 3AAFA 1ZG5A 2ADUA 4JQFA 1UELB 3SYTA 1UG2A 4HBLA 2QSFX 1YJNI 2PJRB 2X9DA 1ZLKA 2P0WA 4XKVA 1DPRA 1QRYA 2OCCH 2BE5F 4PCQA 2BEOA 3VFZA 4BAYA 2OAZA 1X4PA 4D9JA 3OYMA 1SC7A 1FMVA 3E5QA 1JI8A 2JA7J 1FSEA 4U0VA 1ULYA 1HW1A 2R7XA 1IN8A 2BYVE 1OCCH 4YFNF 2YUSA 1REPC 3HL2A 2ZFUA 3F21A 1SD7A 1R5ID 2IGKA 4E7SA 3N05A 2ZJPF 2LDUA 4O3MA 3PFYA 1WJEA 1IN6A 5F0FA 1PUFB 4I2OA 1FYKA 2HWVA 1KQ0A 4BE2A 2WAQN 1E17A 3DQVC 4JP0A 2VKVA 3Q0WA 2HOTA 4ZDLA 3FX3A 2EZHA 5D8KB 2VONA 3S3NA 4MFDA 1T39A 1JKQC 1HKTA 1ZGWA 1Y1VJ 3JSPA 2ESNA 3OYGA 1Z3YA 1R1UA 2M7AA 1KQ8A 2Y0MA 5CYVA 4UUSB 4P55A 3ONQA 2MLKA 3KP7A 2HZTA 5F27A 3F8MA 4J01A 1ZTRA 1LNWA 2DK5A 2CV1A 4GCVA 4HSRA 2OCEA 3QQAA 3TL4X 3OSFA 2WAEA 2PJPA 4DOZA 3DU6A 3CJTB 4IXAA 1BC8C 5IYDJ 1AOYA 1MDMA 4M9XA 2F4IA 4JK1X 5LEKA 4CO8A 2H6BA 1YYVA 1H9TA 1ON2A 3KP2A 1GLNA 1MNEA 2V79A 2A05A 3G2BA 4NB5A 2FF4A 2X4HA 1XDSA 2ZMEA 2DYRH 1AKHA 5ED4A 3QYFA 3ISPA 5CVUA 3QYEA 4RAFA 1ODDA 2VQHA 5H20A 2RREA 4EM0B 1DPUA 4LLLA 3NQOA 1SFKA 1WVRA 2DA4A 1ITYA 2AQFA 2FMYA 2PQ8A 3C2BA 3S15J 5GPCA 3GLLA 3GZ5A 2EJRA 1ETYA 5FFXA 1D0ZA 2QGUA 5ICGA 3OYAA 5J4VA 1ZRDA 2ME6A 2OUMA 3HBLA 1ZR2A 3M9AA 4IQJA 3KEQA 1FWZA 1QZZA 1MJAA 2P4WA 1BR1A 4OOIA 1W0UA 3V8JA 4UVBA 1BIBA 1R49A 3GUDA 1B9NA 1WJDA 4UY8I 1K4SA 2WY7Q 3SJMA 5BQTA 1LVKA 2VASA 2JN6A 1VQLI 3GXOA 3ECHA 4RB0A 3DPTA 4LIUA 1FZPB 2LF7A 3RTRA 2MFZA 3QODA 2UUZA 2VOOA 2LMDA 1Z6TA 3CUQB 4UXNA 3GMEA 1RETA 2C6YA 4BEHA 2K4JA 2JSPA 3JTHA 3X2QH 3GFIA 4RGSA 4YELA 5E79C 1I1SA 3IUOA 1K79A 3S1RJ 2QA4I 1HKQA 2M5WA 3W3CA 3BDDA 3MAJA 2DFIA 2L5QA 1R58A 2DCEA 5L3BA 1FBSA 2F5DA 5FFZA 4XSXF 2R3SA 2Y2ZA 1J59A 2DA3A 3Q0UA 1D5YA 2HGCA 3FK6A 5HS8A 4WWCA 3FBIB 5J8CA 2FRHA 2E2HJ 3L00A 1G3TA 4A5NA 3J7YJ 3EUKL 4MLOA 4CCNA 3OYJA 3WTVC 4B48A 3ZN1A 3JRCA 1YFHA 1TZLA 3OYFA 1I27A 1GV2A 5K7ZA 3KYDB 1ETQA 5LGUA 2XF6A 2QQ8A 4BQAA 2NS7A 1CGPA 1Z0XA 5ICFA 2LY2A 3LNQA 4HQMA 4I98B 4PUSA 4A0ZA 4LJZF 3N97A 1FOXA 1F36A 1IN5A 3TO6A 2DW4A 4LD5A 3P9IA 3WTTC 3JAMK 1WPKA 2COBA 2OC6A 2YX4A 5LLQA 3NARA 4UV9A 3PQKA 4ESBA 2XROA 3WGIA 1GV5A 2ZCWA 2LBFB 1S7EA 4BHCA 4AWXB 3WTZA 1HF0A 4UB8C 3K70C 1GUUA 5M5XJ 2CUZA 2EBIA 4NC8A 1B6AA 4DBRA 1VI0A 2NXNB 3E5XA 1HOMA 4UVAA 4DYRA 2X6OA 1XPXA 3BCAA 3DEUA 1HBXG 1BL0A 2DA6A 2QSHX 4IHTA 2CQQA 4L9NA 1VQ4I 3PJRA 1UZCA 4XRSA 1B72A 1G2HA 3CCSI 1KA8A 1WJFA 3VYSB 3N4MA 4B3AA 3B6AA 3ERED 5K5OA 4LG3A 4I6ZA 4YRVA 4M9ZA 1JJ8C 4RB2C 4AM3A 3TGNA 1XCBA 2LLKA 2XB0X 2F5FA 2YR2A 5LHIA 2JA2A 4KA4A 2YS9A 2K9LA 2PFBA 1HSTA 4RAYA 4NDLA 5GP9A 2JMWA 3CP8A 2FOKA 2XB5A 5FGMA 2ID6A 3DP7A 2EB7A 1P2FA 2Z1DA 3CDIA 5D5UB 1YE9A 4WF2A 5HOOA 2F5CA 2CW7A 4QLCU 1S7AA 1ZYRF 2MA3A 2VQLA 3FXUA 3BG9A 2KP6A 3K9TA 4HX4A 2RGVA 2E36A 1ZGAA 2VJJA 1FOKA 2DA2A 5CVVA 2V7FA 3M8FA 4NC7A 1IUFA 3K0LA 3KLNA 3SZPA 3ZQIA 1BR2A 4YFXF 4NNJA 3R0JA 4DZPA 4N4OB 3IHUA 2H1LA 4PK4A 2NVYJ 3DPLC 4F55A 2JWTA 4CA0A 3CCUI 2OV7A 2JPCA 4F93B 2EFWA 1YHQI 1MBKA 3HHHA 2O7OA 4Y33A 4HV6A 3IAS2 1TQIA 3SZTA 5L3FA 2R7VA 2HFHA 3Q0VA 1U9NA 4KIGA 2W84A 5GTHC 2PLYA 2XIGA 1X1DA 2R7RA 4X6AJ 3OR2C 1T0FC 4L9JA 2O03A 2EV5A 2GOMA 3CUQC 4C30A 4IHXA 3JRFA 2P5LC 2XSJC 1X3ZB 4BL0B 5EJCA 3R4KA 1UHSA 2HQRA 2BBYA 1IXSB 2DJNA 1FSHA 2FQ3A 1VFCA 1ZGJA 5ILUA 4A3IJ 2X1DA 3QP5A 3BQZA 4ZTFA 2CQ7A 3S3OA 2L4MA 3E7LA 4IRHA 3A01B 5KK1A 4MFEA 3WGHA 1OCPA 2VBZA 3K69A 1JTYA 4ESJA 1OKRA 2KFDA 1S9HA 3F6VA 1RR7A 3HRTA 2CYYA 2XAHA 3FXQA 3LSHA 3M8JA 1IW7F 4GFBA 1FMWA 4XKWA 3OS1A 2TRTA 1MH4A 1SD6A 2A5WA 3H36A 1KYWA 1Z67A 4OMYA 4XIDA 1T98A 5JHFA 3H5AA 3V7RA 3OY9A 2IGNA 2R7DA 3CMYA 1IRZA 3TP0A 1BI2A 2XGEA 3CLOA 2JZYA 1FLIA 4A3EJ 1X1AA 2RAEA 1XN7A 1BN5A 2FOWA 2JSCA 1UHMA 3BROA 4A3CJ 1VNDA 2P6TA 2E1NA 4ZZDA 4Z2YA 1ZELA 1RC9A 2DTRA 1JUMA 4P9FA 4I01A 2GOXB 1HDPA 2VJ5A 3I4PA 1MNMC 5EZHA 2P81A 4PGHA 4UVCA 4D1QA 4KJZA 1XMAA 1X1CA 3LA2A 1GVDA 1TLHB 5JHUA 2IA0A 2E1CA 1ZK8A 3TW7A 3U9GA 4RS8A 1DDNA 3T5XA 2ICWG 3OV8A 1WRJA 5J6XA 3H9GA 2PJRA 4HF1A 1F9NA 5BPIA 3KP4A 1BJAA 1MW7A 2CRGA 3RKXA 3WG9A 4OIQF 1KU7A 1FP1D 4EJVA 3FK7A 2K9NA 3OIPA 5GAHJ 4CDGA 2Y69H 4BACA 4Q5SF 1VQ6I 2YU9J 1O57A 4XOTA 3V7CA 3TOBA 1BM9A 1KONA 3BR1A 3SHFA 2IS6A 1TWFJ 3QU6A 4I09A 5LD2C 5TJJA 1ACIA 4N4NB 1VQ8I 1PDNC 2HKXA 1W36D 1ETOA 2DFHA 3CDHA 2HYJA 2ZO4A 3KP5A 1RUOA 4FTHA 4L18B 1IN4A 3O8HA 4GYGA 4TV7A 3F23A 2BVMA 1MJBA 5M3MJ 1PUFA 1B59A 3CJQB 3HPHA 4QPOA 2I10A 2Z33A 2IA1A 3SXYA 5HDGA 1UHWA 2YSRA 5FB2A 3F8NA 3S2WA 3HKZA 1U5TB 5ILSA 5H6QA 5FD6A 1SFXA 4HSTA 3G3ZA 2ZB9A 3G1LA 1Y39A 3DBLB 3H5RA 1HQCA 2JUCA 2K86A 4ZYAA 2QQBA 2KL4A 5IYBJ 4UUSA 2IAIA 2X0LA 3JRIA 3LSTA 4HX7A 1ON1A 2Q8KA 3BZ6A 4IL6C 1GXQA 4V2GA 1G3WA 1FT9A 4I76A 2OZ6A 3GTOJ 2WY8Q 4E6KG 1ZH5A 2R7TA 1I50J 2Y0SN 1G3YA 4CZZA 1XSDA 2MW8A 2FX0A 1MMDA 3E97A 3WTWC 2MD0A 2HU9A 2O6GE 2CH0A 2X85A 2DMQA 2XAGA 4JOMA 1GVJA 3WU1B 2A6EF 3A4CA 2Q0OA 2ZSHB 2P5VA 3Q9SA 4L0ZB 1HLVA 2Z99A 4YEJA 5E8GA 3LQRA 4QPQA 2VKEA 4ZH4F 5LEJA 4BE1A 1TL8A 4ZYEA 4KDPA 4IPAA 1B8IB 1VQMI 4E7LA 1RKTA 3RZOJ 4G7OF 4C3IJ 1W4MA 3KEYA 3AG1H 1JJ6C 1FBUA 2HZDA 2JPBA 2EILH 1BA5A 5DM7F 1FP2A 3LA7A 4FX0A 3S1NJ 5IP6A 1R71A 2JJ7A 1HW2A 5JLXA 2KIQA 3S1MJ 3HOVJ 4QTRA 2XGDA 4PSXA 1S72I 1LEAA 1QZEA 3T1BA 1YTYA 3AG3H 5L3EA 1DGWY 3FXLA 3ML6A 4XN0A 5HLGA 3W2WA 5GAEJ 1FYMA 4KFCA 2ZJQF 4J00A 4AD9A 2KRCA 2Y31A
chains in the Genus database with same CATH topology
1G3SA 2DPDA 1HXDA 1T0FA 2FNAA 3CUQA 2VBYA 1BI1A 2FE3A 4XSZF 5FO5A 1GXPA 1TBXA 2MH2A 3GVAA 2RC4A 3BOQA 4P9UA 4DQ2A 2CO5A 1IXRC 1F5TA 1UB9A 3KEOA 3CO6C 4Y13A 3HTSB 1WSUA 2STWA 1OMIA 2JT1A 1AWCA 4LLNA 1B1BA 2ZNYA 3T8TA 4A0XA 3PFIA 2HKOA 4LG0B 3K1MA 1A04A 2EFPA 4OMZA 4LGWA 3PQJA 4RGRA 1TNTA 2OQRA 4ON0A 1R5GA 1SD5A 3NEUA 1V3FA 3FMQA 2DQRA 1USSA 1I1GA 2XVCA 4MQ9F 4EMSA 2M87A 1KYZA 2PN6A 1DP7P 3J80Z 2ETHA 3E6DA 1L3LA 2IRFG 2OD5A 1JGSA 1U5TC 4R79A 5JI6A 5BOXA 3MZYA 1LEBA 1FC3A 2MD5A 5AONA 5HS9A 1MZBA 3GW2A 4BHBA 3LAPA 1J75A 2KKOA 2L54A 5LRRA 4EV0A 3SFZA 2QM3A 2H27A 1LQ1A 4HV5A 2PMUA 4U7BA 3HYIA 3FHZA 3R60A 6PAXA 3RI4A 3VODA 2G9WA 1TQPA 4U88A 2M1BA 4U0YA 3I53A 4M71A 2VC1A 1LB2A 2VE8A 3G73A 5DEQA 3H92A 4CXFA 4WXCA 4A5MA 5FLXZ 4O5VA 2RDPA 4HZFA 1K78B 1MJ9A 4KNYA 2JRTA 1BI0A 3FM3A 3U2RA 2D1VA 2GQQA 4A6EA 4LB5A 4EM2A 5FD5A 3WE2A 1YW7A 4N9IA 4EJTA 2UXXA 5E1WA 4AIJA 5DD4A 3HRUA 2VT2A 5EEHA 3JTGA 4IHSA 2F5EA 2GIVA 4E70A 4F7ZA 5A2QZ 2RN7A 5JVTA 1LVAA 4EJUA 3QRFF 2QZ8A 1OYYA 2ZKZA 4RGUA 1CF7B 3E3VA 2WWYA 4LB6B 5IT9K 1IAWA 2V1UA 1W7PB 4GXOA 5IT3A 1J5YA 3VB2A 2UWMA 3WTSC 3B02A 3KE2A 3MWMA 2TDXA 3EETA 3QPTA 1RI7A 1O7LA 3JSOA 2NAZA 4KUMA 2GXGA 2ISYA 5F6FA 2XKPA 4G94A 1P4AA 4R8HA 4RAZA 3MEXA 1KQ9A 1JE8A 5D4SA 1Z05A 4YFKF 3K2ZA 4UV8A 1XCVA 1EH8A 1PP8F 5LHHA 1X3UA 2L4AA 5D6FA 2EA4A 2GZWA 4HLYA 3ECOA 1VTNC 1B4AA 3IWZA 1MD0A 4YIIA 3EUHA 4L9VA 1EH7A 1R5HA 5HLHA 4XRFA 1R00A 3GX4X 2VN2A 2NRAC 2P5KA 5DCMB 3IKTA 4ZZLA 4WCGA 1QQIA 3I0TA 1FY7A 4PGGA 4KICA 1U5TA 2FBHA 2D45A 4KMUX 4HDUA 5LRSA 3CUOA 2IA2A 2RQPA 4EJWA 5JFRA 4Q4ZF 1P4WA 4Y17A 1YW8A 5CVIA 4I02A 2LSOA 2EV0A 4IRIA 4UHTA 2V1DA 3O2PE 2IP2A 4B8XA 1IN7A 4A6DA 2FXAA 3LAJA 3DKWA 4ENKA 1O7FA 2STTA 3F6OA 3FZVA 3E5UA 3C1DA 2V6CA 4EVIA 4HF2A 3TO9A 4ZYGA 3FMRA 3CTAA 1QO0D 4LK0F 1MDMB 4I7HA 4NHJA 1U78A 3ELKA 3FM5A 4I0AA 4PZJA 5CVRA 2MC3A 5IT9Z 3L7WA 2A69F 4HX8A 4AIKA 4KN7X 4MEYF 4DNCA 2ACJA 3COAC 4N0BA 1WI9A 2KRFA 4M9SA 3GYHX 4WXDA 4UNOA 1O3QA 5LHGA 1BC7C 1HW5A 1R1TA 1O3TA 1BBYA 2VT3A 2V9VA 1YQAA 2O3FA 4HF0A 4RGXA 2CG4A 2Z5UA 1UFMA 3WU0A 1K6OA 2GXBA 4BNCA 1XGNA 1SMTA 4IF4A 3I54A 5CLSA 3I5UA 3HSRA 1NHAA 4UUVA 3DXJF 4G6QA 5D6EA 2RV8A 4MNUA 5LBQA 2FU4A 2A5YB 2IVMA 2VE9A 1S6LA 4LG0A 5ILVA 4Q47A 1W5SA 3KCCA 2PG4A 4OIOF 3JAMZ 3Q9VA 3ABTA 1YLFA 2IT0A 4U7DA 4MQVA 1ZARA 2XASA 2F2EA 4LMYA 3HHGA 3REOA 2NNYA 1XB4A 2CFXA 4XLPF 2R7FA 3R6SA 2VXZA 2IPQX 1D8JA 2MH9A 4MGRA 5LGTA 1OPCA 4CICA 4ENMA 5HS7A 4FHTA 2XHKA 3J7AO 2XKOA 1QNTA 2D1HA 1S3JA 2AS5F 2CSOA 2KJBA 4KIBA 2W24A 4YIFA 2DAOA 1Y0UA 2L3DA 1LDJA 1U8RA 2DU9A 4HW0A 3IRRA 1HKSA 4WXHA 3GLXA 3F8FA 4KYWA 1Z6RA 2YX7A 4LK1F 2Y75A 5K5RA 3TDUC 2ZBKA 3FWEA 4S05A 4R1HA 2E7WA 5D8LB 3P7NA 2XGXA 3W6JB 2XAFA 2Q2EA 1BI3A 2P7CB 3EQLF 1K78A 4A2UA 1ZN2A 1FYLA 1TQMA 5BPDA 4A0YA 1T38A 4BYYA 2DI3A 3HOSA 3RYRA 4BH9A 2QQAA 2EA2A 1Z7UA 1S7OA 2K7LA 5E1ZB 5AIPA 4GGGA 5J8FA 1GHCA 1IRGA 1T2KA 3L9FA 1MKMA 2UXNA 4BHPA 2W85A 2Z3YA 3GWZA 4EQQA 1ZREA 3HRMA 3D0SA 2J5OA 5EEGA 1D5VA 3GFJA 3FMSA 2RNJA 5CJ9A 2DT5A 1ZRFA 5D4RA 4G8XA 1ZG1A 1H9GA 2QQ9A 2EWNA 2Z9OA 1CF7A 3V8KA 3F72A 3SQNA 1W7PA 4HAMA 3VEPA 3Q5FA 3EYYA 3MQ0A 3FF5A 2NYXA 3RYPA 2GA1A 3ZN0A 3RKWA 3H3ZA 4A12A 1KU3A 3BPXA 1MGTA 2HQNA 1QPMA 1RNLA 3F22A 1FPQA 3E6CC 2M30A 2YU3A 4HQEA 3V8LA 1RZ4A 2QVOA 1OYWA 4XBFA 2IJLA 3JW4A 1BOAA 2IW5A 2UZKA 4RB3C 4L5IA 3T0YA 1ZLJA 2A61A 3CJNA 3IKVA 3RPUA 3WTYC 3OOPA 2H09A 1B9MA 3HSFA 2FBIA 3EDPA 2KIMA 1I5ZA 1G4DA 2HEOA 2A07F 2CW0F 2RKHA 4M6YA 3TKYA 5E1XA 3QU3A 1SFUA 3K1PA 1F4KA 1D3YA 4MEXF 2PI0A 2KJCA 4IVNA 2QWWA 1IXCA 2QBYB 5DCMA 5D5WB 3O6BB 3RKYA 3LFKA 2XAQA 1LDDA 2HTSA 3IC7A 1W5TA 5HDKA 5DUIA 5F1RA 5ICEA 4B09A 1D8KA 2BV6A 5D5XB 3U1DA 1Z9CA 1SD4A 3QPHA 3HUGA 4P96A 2VC0A 4BXUA 4ZYDA 3WTXC 3HTUA 3RPQA 3W6KB 5JR3A 1XMKA 4OU0A 2CWEA 5KVRA 2PBIA 4KIFA 3IWFA 1BIAA 1E2XA 4WX9A 1DUXC 3KZZA 4RB1A 1Z91A 2ESHA 4AVPA 1O3SA 3VOEA 1Z1DA 2Y48A 2LF8A 2VODA 1YIOA 3C18A 4MTEA 2O0YA 1EV7A 1W7PD 1XGSA 4QWQA 5DD8A 2HYGD 2GA2A 1WKMA 4CYDA 2O61A 4N9HA 3V7SA 5BS6A 4Y15A 2OA4A 5DDGA 4OINF 2WV0A 2W57A 2EK5A 1ZHFA 4HYEA 1JXSA 4EGYA 3ZMDA 3MZHA 3BJ6A 3M7GA 5L3CA 1IRFA 4IJAA 3FXRA 1TW2A 3RJPA 4M73A 4CGZA 2P8TA 1O3RA 3M8EA 3I71A 1LJ9A 3L2CA 1C0WA 2DBBA 1J2XA 2EFNA 3HOTA 3P9KA 2CGPA 5E8IA 4CHUA 2G7HA 3WTUC 2OU2A 3P9CA 3DV8A 4OIRF 3RIRA 5DCFA 2M45A 2FMLA 2GAUA 3I59B 3BY6A 4G7HF 5D5VB 2A6HF 1P92A 2EV6A 4L9TA 3C3WA 2VBWA 2BGCA 2B0LA 1QZYA 3ULQB 1U3EM 2CQKA 1IZ1A 2P7VB 3J81K 3GFMA 3BWGA 2ZFWA 5LGNA 1HSJA 2A3SA 3GEZA 1XGOA 5L3DA 2G7UA 4M6XA 3BJOA 4KT5C 2P6SA 4P5OA 1K7AA 3GZ6A 2L01A 2QUFA 5ERIA 2K4BA 3V4GA 1OYIA 3KP6A 3ZMVA 4GYIA 1KU9A 1EH6A 1STZA 2RVCA 2K27A 1G6NA 2DK8A 1WWXA 1XGMA 4IRGA 1IF1A 3I58A 3KLOA 1S8NA 4XLNF 5TRDA 2KIUA 4GO1A 3LA3A 3I64A 4Q48A 2HR3A 3BP8A 4ENNA 4ESFA 4EGZA 2XV4S 1SFEA 3BPVA 2V1XA 2HS5A 4G9YA 5DYMA 4L5JA 1JHFA 2ZMEB 4L0YB 3HIFA 1FX7A 2PEXA 5CVJA 2FSWA 3F8BA 3T8RA 2DLLA 1I6XA 1R1VA 3HRSA 1L0OC 3F8CA 3KZYA 1KGSA 2ZXJA 4U0WA 2MBFA 2HDCA 1P4XA 2DQLA 1ZRCA 3ZPLA 4MHGA 2E7XA 4NQWA 4MTDA 5DUKA 1USTA 1R22A 2M8EA 3TOAA 1H0MA 4YG2F 1ZG3A 4FT8A 4H0EA 4WK8F 3R61A 1S29A 4ZYHA 2NNNA 1P6RA 1XSVA 4O6JA 2FEZA 2WTEA 3RDIA 2VOPA 3KETA 2LNBA 1QBJA 1PP7U 4KMFA 3L09A 1R7JA 5F64A 3O3KA 1R36A 3ZMTA 4EM1A 3ZMZA 4AIHA 3DF8A 3EYIA 1ZAOA 2XRNA 3J81Z 3M1EA 4D0PA 4ENJA 2EFQA 4ASNA 4KN4X 1XD7A 3CO7C 4M72A 4K2EA 1KU2A 1TTYA 1U2WA 5DV5A 2H94A 4EJOA 1YW9A 1ONVA 2ELHA 2FBKA 3ZP5A 3QP6A 4M74A 2QBYA 3GO5A 2FA5A 4LLGF 2DO7A 4G6DA 3F3XA 3GF2A 1U6GA 3GFLA 3ZMSA 1UCRA 1J7KA 4S04A 1JHHA 2MLGA 3IL2A 1YS6A 1FBQA 2VBXA 2J5PA 3TQNA 3J80K 5K1YA 3D5LA 2OBPA 4HLXA 2ZJ2A 1R23A 4PDKA 2K02A 2D2WA 1IUYA 2H6CA 2FNPA 1WQ2A 3KFWX 2W25A 4FX4A 2QENA 3LWFA 3MFKA 2HYFA 3TDZC 2AXLA 3WGGA 1PUEE 2ISZA 1J0RA 1FNNA 5H6RA 2DPUA 5E17F 5AIQA 2ZNZA 3H3UA 1TNSA 2WC2A 3QAHA 3MCZA 2PMHA 2O8XA 5BMZA 3B73A 1F1ZA 1J9IA 5FLXK 3ZQ7A 4ETSA 5ICCA 3QOPA 1XSXA 3E6MA 1LDKB 2XUBA 3WE3A 3LQQA 2NS0A 3C7JA 1V4RA 1YS7A 3TO7A 4JBAA 4OIPF 5HDNA 5K5QA 1T6SA 2KIFA 4HOBA 1YO5C 3HSEA 5E20A 2GWRA 2XAJA 2HTJA 2QYOA 4G7ZF 2YPRA 1SAXA 4I0BA 3E6BA 2JTVA 5A2QK 1YG2A 2LKPA 3I59A 1RUNA 2EFOA 2COMA 1SMYF 3IRQA 2OZUA 4HA8A 3NRVA 1OR7A 1RIOH 3BJAA 3WODF 1Q1HA 1QGPA 3R0AA 3DFGA 3KP3A 1XDUA 1TW3A 3ZMUA 5E18F 5HLIA 2OQGA 4HDVA 2A68F 3ABUA 4LFUA 3K1NA 2HOEA 5HVQC 2L02A 5L3GA 3ROUA 2QLZA 3AAFA 1ZG5A 2ADUA 4JQFA 4HBLA 1ZLKA 1DPRA 4PCQA 2BE5F 2BEOA 3VFZA 4BAYA 2OAZA 3E5QA 1FSEA 4U0VA 1ULYA 1HW1A 1IN8A 2BYVE 4YFNF 1REPC 3F21A 1SD7A 2LDUA 4O3MA 1IN6A 4I2OA 1FYKA 2HWVA 1KQ0A 1E17A 3DQVC 3FX3A 5D8KB 2VONA 1T39A 1HKTA 3JSPA 2ESNA 1R1UA 1KQ8A 2Y0MA 5CYVA 4P55A 2MLKA 3KP7A 2HZTA 3F8MA 1LNWA 2DK5A 4GCVA 2PJPA 4IXAA 1BC8C 1AOYA 1MDMA 4M9XA 4JK1X 5LEKA 4CO8A 2H6BA 1YYVA 1H9TA 1ON2A 3KP2A 2V79A 4NB5A 2FF4A 2X4HA 1XDSA 2ZMEA 5ED4A 3ISPA 5CVUA 1ODDA 5H20A 4EM0B 1DPUA 4LLLA 3NQOA 2FMYA 2PQ8A 3GZ5A 2EJRA 5FFXA 5ICGA 1ZRDA 3M9AA 3KEQA 1FWZA 1QZZA 1MJAA 2P4WA 4OOIA 3V8JA 4UVBA 1BIBA 3GUDA 1B9NA 5BQTA 3GXOA 3ECHA 4RB0A 3DPTA 1FZPB 2LF7A 3RTRA 2VOOA 1Z6TA 3CUQB 4UXNA 2C6YA 2K4JA 3JTHA 3GFIA 4RGSA 1I1SA 1K79A 1HKQA 2M5WA 3BDDA 3MAJA 2DFIA 1R58A 5L3BA 1FBSA 2F5DA 5FFZA 4XSXF 2R3SA 1J59A 2HGCA 5HS8A 4WWCA 5J8CA 2FRHA 3L00A 1G3TA 4A5NA 3WTVC 3ZN1A 1YFHA 1I27A 5LGUA 4BQAA 1CGPA 5ICFA 4HQMA 4I98B 4A0ZA 4LJZF 3N97A 1IN5A 3TO6A 2DW4A 4LD5A 3P9IA 3WTTC 3JAMK 2YX4A 5LLQA 4UV9A 3PQKA 4ESBA 2XROA 3WGIA 2ZCWA 4BHCA 4AWXB 3WTZA 1B6AA 3E5XA 4UVAA 1HBXG 3DEUA 4IHTA 4L9NA 1KA8A 3N4MA 3ERED 5K5OA 4M9ZA 4RB2C 3TGNA 1XCBA 5LHIA 2F5FA 2YR2A 4KA4A 2PFBA 1HSTA 4RAYA 2FOKA 5FGMA 3DP7A 2EB7A 1P2FA 5D5UB 4WF2A 5HOOA 2F5CA 4QLCU 1S7AA 1ZYRF 2MA3A 3FXUA 4HX4A 3K9TA 2RGVA 1ZGAA 1FOKA 5CVVA 3M8FA 3K0LA 3KLNA 3SZPA 4YFXF 3R0JA 3IHUA 3DPLC 2JPCA 2EFWA 3HHHA 4HV6A 1TQIA 3SZTA 5L3FA 2HFHA 4KIGA 2W84A 2PLYA 2XIGA 4L9JA 2O03A 2EV5A 3CUQC 2P5LC 3R4KA 2HQRA 2BBYA 1IXSB 1FSHA 2FQ3A 1ZGJA 5ILUA 3QP5A 2L4MA 4IRHA 5KK1A 3WGHA 2VBZA 3K69A 4ESJA 1OKRA 3F6VA 3HRTA 2CYYA 2XAHA 3FXQA 1IW7F 1SD6A 1KYWA 4OMYA 1T98A 3V7RA 2R7DA 1BI2A 3CLOA 2JZYA 1FLIA 1XN7A 1BN5A 2JSCA 1UHMA 3BROA 2P6TA 2E1NA 4ZZDA 4Z2YA 2DTRA 4P9FA 4I01A 3I4PA 4PGHA 4UVCA 1XMAA 3LA2A 1TLHB 5JHUA 2IA0A 2E1CA 3U9GA 4RS8A 1DDNA 3T5XA 3OV8A 1WRJA 5J6XA 4HF1A 1F9NA 5BPIA 3KP4A 1BJAA 3RKXA 3WG9A 4OIQF 1KU7A 1FP1D 4EJVA 4CDGA 4Q5SF 1O57A 3V7CA 3TOBA 1BM9A 3SHFA 3QU6A 4I09A 5TJJA 1PDNC 2HKXA 3CDHA 2ZO4A 3KP5A 1RUOA 4L18B 1IN4A 4GYGA 4TV7A 3F23A 1MJBA 1B59A 2Z33A 2IA1A 3SXYA 5HDGA 1UHWA 2YSRA 5FB2A 3F8NA 3S2WA 1U5TB 5ILSA 5H6QA 5FD6A 1SFXA 3G3ZA 1HQCA 2K86A 2QQBA 2X0LA 3LSTA 4HX7A 1ON1A 2Q8KA 3BZ6A 1GXQA 1G3WA 1FT9A 2OZ6A 1ZH5A 1G3YA 4CZZA 1XSDA 3E97A 3WTWC 2O6GE 2XAGA 1GVJA 3WU1B 2A6EF 2Q0OA 2P5VA 3Q9SA 4L0ZB 2Z99A 5E8GA 3LQRA 4ZH4F 5LEJA 4ZYEA 4KDPA 4IPAA 4G7OF 1W4MA 1FBUA 2JPBA 1FP2A 3LA7A 4FX0A 1HW2A 1LEAA 3T1BA 1YTYA 5L3EA 3ML6A 5HLGA 1FYMA 4KFCA 4AD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3S A;  2DPD A;  1HXD A;  1T0F A;  2FNA A;  3CUQ A;  2VBY A;  1BI1 A;  2FE3 A;  4XSZ F;  5FO5 A;  1GXP A;  1TBX A;  2MH2 A;  3GVA A;  2RC4 A;  3BOQ A;  4P9U A;  4DQ2 A;  2CO5 A;  1IXR C;  1F5T A;  1UB9 A;  3KEO A;  3CO6 C;  4Y13 A;  3HTS B;  1WSU A;  2STW A;  1OMI A;  2JT1 A;  1AWC A;  4LLN A;  1B1B A;  2ZNY A;  3T8T A;  4A0X A;  3PFI A;  2HKO A;  4LG0 B;  3K1M A;  1A04 A;  2EFP A;  4OMZ A;  4LGW A;  3PQJ A;  4RGR A;  1TNT A;  2OQR A;  4ON0 A;  1R5G A;  1SD5 A;  3NEU A;  1V3F A;  3FMQ A;  2DQR A;  1USS A;  1I1G A;  2XVC A;  4MQ9 F;  4EMS A;  2M87 A;  1KYZ A;  2PN6 A;  1DP7 P;  3J80 Z;  2ETH A;  3E6D A;  1L3L A;  2IRF G;  2OD5 A;  1JGS A;  1U5T C;  4R79 A;  5JI6 A;  5BOX A;  3MZY A;  1LEB A;  1FC3 A;  2MD5 A;  5AON A;  5HS9 A;  1MZB A;  3GW2 A;  4BHB A;  3LAP A;  1J75 A;  2KKO A;  2L54 A;  5LRR A;  4EV0 A;  3SFZ A;  2QM3 A;  2H27 A;  1LQ1 A;  4HV5 A;  2PMU A;  4U7B A;  3HYI A;  3FHZ A;  3R60 A;  6PAX A;  3RI4 A;  3VOD A;  2G9W A;  1TQP A;  4U88 A;  2M1B A;  4U0Y A;  3I53 A;  4M71 A;  2VC1 A;  1LB2 A;  2VE8 A;  3G73 A;  5DEQ A;  3H92 A;  4CXF A;  4WXC A;  4A5M A;  5FLX Z;  4O5V A;  2RDP A;  4HZF A;  1K78 B;  1MJ9 A;  4KNY A;  2JRT A;  1BI0 A;  3FM3 A;  3U2R A;  2D1V A;  2GQQ A;  4A6E A;  4LB5 A;  4EM2 A;  5FD5 A;  3WE2 A;  1YW7 A;  4N9I A;  4EJT A;  2UXX A;  5E1W A;  4AIJ A;  5DD4 A;  3HRU A;  2VT2 A;  5EEH A;  3JTG A;  4IHS A;  2F5E A;  2GIV A;  4E70 A;  4F7Z A;  5A2Q Z;  2RN7 A;  5JVT A;  1LVA A;  4EJU A;  3QRF F;  2QZ8 A;  1OYY A;  2ZKZ A;  4RGU A;  1CF7 B;  3E3V A;  2WWY A;  4LB6 B;  5IT9 K;  1IAW A;  2V1U A;  1W7P B;  4GXO A;  5IT3 A;  1J5Y A;  3VB2 A;  2UWM A;  3WTS C;  3B02 A;  3KE2 A;  3MWM A;  2TDX A;  3EET A;  3QPT A;  1RI7 A;  1O7L A;  3JSO A;  2NAZ A;  4KUM A;  2GXG A;  2ISY A;  5F6F A;  2XKP A;  4G94 A;  1P4A A;  4R8H A;  4RAZ A;  3MEX A;  1KQ9 A;  1JE8 A;  5D4S A;  1Z05 A;  4YFK F;  3K2Z A;  4UV8 A;  1XCV A;  1EH8 A;  1PP8 F;  5LHH A;  1X3U A;  2L4A A;  5D6F A;  2EA4 A;  2GZW A;  4HLY A;  3ECO A;  1VTN C;  1B4A A;  3IWZ A;  1MD0 A;  4YII A;  3EUH A;  4L9V A;  1EH7 A;  1R5H A;  5HLH A;  4XRF A;  1R00 A;  3GX4 X;  2VN2 A;  2NRA C;  2P5K A;  5DCM B;  3IKT A;  4ZZL A;  4WCG A;  1QQI A;  3I0T A;  1FY7 A;  4PGG A;  4KIC A;  1U5T A;  2FBH A;  2D45 A;  4KMU X;  4HDU A;  5LRS A;  3CUO A;  2IA2 A;  2RQP A;  4EJW A;  5JFR A;  4Q4Z F;  1P4W A;  4Y17 A;  1YW8 A;  5CVI A;  4I02 A;  2LSO A;  2EV0 A;  4IRI A;  4UHT A;  2V1D A;  3O2P E;  2IP2 A;  4B8X A;  1IN7 A;  4A6D A;  2FXA A;  3LAJ A;  3DKW A;  4ENK A;  1O7F A;  2STT A;  3F6O A;  3FZV A;  3E5U A;  3C1D A;  2V6C A;  4EVI A;  4HF2 A;  3TO9 A;  4ZYG A;  3FMR A;  3CTA A;  1QO0 D;  4LK0 F;  1MDM B;  4I7H A;  4NHJ A;  1U78 A;  3ELK A;  3FM5 A;  4I0A A;  4PZJ A;  5CVR A;  2MC3 A;  5IT9 Z;  3L7W A;  2A69 F;  4HX8 A;  4AIK A;  4KN7 X;  4MEY F;  4DNC A;  2ACJ A;  3COA C;  4N0B A;  1WI9 A;  2KRF A;  4M9S A;  3GYH X;  4WXD A;  4UNO A;  1O3Q A;  5LHG A;  1BC7 C;  1HW5 A;  1R1T A;  1O3T A;  1BBY A;  2VT3 A;  2V9V A;  1YQA A;  2O3F A;  4HF0 A;  4RGX A;  2CG4 A;  2Z5U A;  1UFM A;  3WU0 A;  1K6O A;  2GXB A;  4BNC A;  1XGN A;  1SMT A;  4IF4 A;  3I54 A;  5CLS A;  3I5U A;  3HSR A;  1NHA A;  4UUV A;  3DXJ F;  4G6Q A;  5D6E A;  2RV8 A;  4MNU A;  5LBQ A;  2FU4 A;  2A5Y B;  2IVM A;  2VE9 A;  1S6L A;  4LG0 A;  5ILV A;  4Q47 A;  1W5S A;  3KCC A;  2PG4 A;  4OIO F;  3JAM Z;  3Q9V A;  3ABT A;  1YLF A;  2IT0 A;  4U7D A;  4MQV A;  1ZAR A;  2XAS A;  2F2E A;  4LMY A;  3HHG A;  3REO A;  2NNY A;  1XB4 A;  2CFX A;  4XLP F;  2R7F A;  3R6S A;  2VXZ A;  2IPQ X;  1D8J A;  2MH9 A;  4MGR A;  5LGT A;  1OPC A;  4CIC A;  4ENM A;  5HS7 A;  4FHT A;  2XHK A;  3J7A O;  2XKO A;  1QNT A;  2D1H A;  1S3J A;  2AS5 F;  2CSO A;  2KJB A;  4KIB A;  2W24 A;  4YIF A;  2DAO A;  1Y0U A;  2L3D A;  1LDJ A;  1U8R A;  2DU9 A;  4HW0 A;  3IRR A;  1HKS A;  4WXH A;  3GLX A;  3F8F A;  4KYW A;  1Z6R A;  2YX7 A;  4LK1 F;  2Y75 A;  5K5R A;  3TDU C;  2ZBK A;  3FWE A;  4S05 A;  4R1H A;  2E7W A;  5D8L B;  3P7N A;  2XGX A;  3W6J B;  2XAF A;  2Q2E A;  1BI3 A;  2P7C B;  3EQL F;  1K78 A;  4A2U A;  1ZN2 A;  1FYL A;  1TQM A;  5BPD A;  4A0Y A;  1T38 A;  4BYY A;  2DI3 A;  3HOS A;  3RYR A;  4BH9 A;  2QQA A;  2EA2 A;  1Z7U A;  1S7O A;  2K7L A;  5E1Z B;  5AIP A;  4GGG A;  5J8F A;  1GHC A;  1IRG A;  1T2K A;  3L9F A;  1MKM A;  2UXN A;  4BHP A;  2W85 A;  2Z3Y A;  3GWZ A;  4EQQ A;  1ZRE A;  3HRM A;  3D0S A;  2J5O A;  5EEG A;  1D5V A;  3GFJ A;  3FMS A;  2RNJ A;  5CJ9 A;  2DT5 A;  1ZRF A;  5D4R A;  4G8X A;  1ZG1 A;  1H9G A;  2QQ9 A;  2EWN A;  2Z9O A;  1CF7 A;  3V8K A;  3F72 A;  3SQN A;  1W7P A;  4HAM A;  3VEP A;  3Q5F A;  3EYY A;  3MQ0 A;  3FF5 A;  2NYX A;  3RYP A;  2GA1 A;  3ZN0 A;  3RKW A;  3H3Z A;  4A12 A;  1KU3 A;  3BPX A;  1MGT A;  2HQN A;  1QPM A;  1RNL A;  3F22 A;  1FPQ A;  3E6C C;  2M30 A;  2YU3 A;  4HQE A;  3V8L A;  1RZ4 A;  2QVO A;  1OYW A;  4XBF A;  2IJL A;  3JW4 A;  1BOA A;  2IW5 A;  2UZK A;  4RB3 C;  4L5I A;  3T0Y A;  1ZLJ A;  2A61 A;  3CJN A;  3IKV A;  3RPU A;  3WTY C;  3OOP A;  2H09 A;  1B9M A;  3HSF A;  2FBI A;  3EDP A;  2KIM A;  1I5Z A;  1G4D A;  2HEO A;  2A07 F;  2CW0 F;  2RKH A;  4M6Y A;  3TKY A;  5E1X A;  3QU3 A;  1SFU A;  3K1P A;  1F4K A;  1D3Y A;  4MEX F;  2PI0 A;  2KJC A;  4IVN A;  2QWW A;  1IXC A;  2QBY B;  5DCM A;  5D5W B;  3O6B B;  3RKY A;  3LFK A;  2XAQ A;  1LDD A;  2HTS A;  3IC7 A;  1W5T A;  5HDK A;  5DUI A;  5F1R A;  5ICE A;  4B09 A;  1D8K A;  2BV6 A;  5D5X B;  3U1D A;  1Z9C A;  1SD4 A;  3QPH A;  3HUG A;  4P96 A;  2VC0 A;  4BXU A;  4ZYD A;  3WTX C;  3HTU A;  3RPQ A;  3W6K B;  5JR3 A;  1XMK A;  4OU0 A;  2CWE A;  5KVR A;  2PBI A;  4KIF A;  3IWF A;  1BIA A;  1E2X A;  4WX9 A;  1DUX C;  3KZZ A;  4RB1 A;  1Z91 A;  2ESH A;  4AVP A;  1O3S A;  3VOE A;  1Z1D A;  2Y48 A;  2LF8 A;  2VOD A;  1YIO A;  3C18 A;  4MTE A;  2O0Y A;  1EV7 A;  1W7P D;  1XGS A;  4QWQ A;  5DD8 A;  2HYG D;  2GA2 A;  1WKM A;  4CYD A;  2O61 A;  4N9H A;  3V7S A;  5BS6 A;  4Y15 A;  2OA4 A;  5DDG A;  4OIN F;  2WV0 A;  2W57 A;  2EK5 A;  1ZHF A;  4HYE A;  1JXS A;  4EGY A;  3ZMD A;  3MZH A;  3BJ6 A;  3M7G A;  5L3C A;  1IRF A;  4IJA A;  3FXR A;  1TW2 A;  3RJP A;  4M73 A;  4CGZ A;  2P8T A;  1O3R A;  3M8E A;  3I71 A;  1LJ9 A;  3L2C A;  1C0W A;  2DBB A;  1J2X A;  2EFN A;  3HOT A;  3P9K A;  2CGP A;  5E8I A;  4CHU A;  2G7H A;  3WTU C;  2OU2 A;  3P9C A;  3DV8 A;  4OIR F;  3RIR A;  5DCF A;  2M45 A;  2FML A;  2GAU A;  3I59 B;  3BY6 A;  4G7H F;  5D5V B;  2A6H F;  1P92 A;  2EV6 A;  4L9T A;  3C3W A;  2VBW A;  2BGC A;  2B0L A;  1QZY A;  3ULQ B;  1U3E M;  2CQK A;  1IZ1 A;  2P7V B;  3J81 K;  3GFM A;  3BWG A;  2ZFW A;  5LGN A;  1HSJ A;  2A3S A;  3GEZ A;  1XGO A;  5L3D A;  2G7U A;  4M6X A;  3BJO A;  4KT5 C;  2P6S A;  4P5O A;  1K7A A;  3GZ6 A;  2L01 A;  2QUF A;  5ERI A;  2K4B A;  3V4G A;  1OYI A;  3KP6 A;  3ZMV A;  4GYI A;  1KU9 A;  1EH6 A;  1STZ A;  2RVC A;  2K27 A;  1G6N A;  2DK8 A;  1WWX A;  1XGM A;  4IRG A;  1IF1 A;  3I58 A;  3KLO A;  1S8N A;  4XLN F;  5TRD A;  2KIU A;  4GO1 A;  3LA3 A;  3I64 A;  4Q48 A;  2HR3 A;  3BP8 A;  4ENN A;  4ESF A;  4EGZ A;  2XV4 S;  1SFE A;  3BPV A;  2V1X A;  2HS5 A;  4G9Y A;  5DYM A;  4L5J A;  1JHF A;  2ZME B;  4L0Y B;  3HIF A;  1FX7 A;  2PEX A;  5CVJ A;  2FSW A;  3F8B A;  3T8R A;  2DLL A;  1I6X A;  1R1V A;  3HRS A;  1L0O C;  3F8C A;  3KZY A;  1KGS A;  2ZXJ A;  4U0W A;  2MBF A;  2HDC A;  1P4X A;  2DQL A;  1ZRC A;  3ZPL A;  4MHG A;  2E7X A;  4NQW A;  4MTD A;  5DUK A;  1UST A;  1R22 A;  2M8E A;  3TOA A;  1H0M A;  4YG2 F;  1ZG3 A;  4FT8 A;  4H0E A;  4WK8 F;  3R61 A;  1S29 A;  4ZYH A;  2NNN A;  1P6R A;  1XSV A;  4O6J A;  2FEZ A;  2WTE A;  3RDI A;  2VOP A;  3KET A;  2LNB A;  1QBJ A;  1PP7 U;  4KMF A;  3L09 A;  1R7J A;  5F64 A;  3O3K A;  1R36 A;  3ZMT A;  4EM1 A;  3ZMZ A;  4AIH A;  3DF8 A;  3EYI A;  1ZAO A;  2XRN A;  3J81 Z;  3M1E A;  4D0P A;  4ENJ A;  2EFQ A;  4ASN A;  4KN4 X;  1XD7 A;  3CO7 C;  4M72 A;  4K2E A;  1KU2 A;  1TTY A;  1U2W A;  5DV5 A;  2H94 A;  4EJO A;  1YW9 A;  1ONV A;  2ELH A;  2FBK A;  3ZP5 A;  3QP6 A;  4M74 A;  2QBY A;  3GO5 A;  2FA5 A;  4LLG F;  2DO7 A;  4G6D A;  3F3X A;  3GF2 A;  1U6G A;  3GFL A;  3ZMS A;  1UCR A;  1J7K A;  4S04 A;  1JHH A;  2MLG A;  3IL2 A;  1YS6 A;  1FBQ A;  2VBX A;  2J5P A;  3TQN A;  3J80 K;  5K1Y A;  3D5L A;  2OBP A;  4HLX A;  2ZJ2 A;  1R23 A;  4PDK A;  2K02 A;  2D2W A;  1IUY A;  2H6C A;  2FNP A;  1WQ2 A;  3KFW X;  2W25 A;  4FX4 A;  2QEN A;  3LWF A;  3MFK A;  2HYF A;  3TDZ C;  2AXL A;  3WGG A;  1PUE E;  2ISZ A;  1J0R A;  1FNN A;  5H6R A;  2DPU A;  5E17 F;  5AIQ A;  2ZNZ A;  3H3U A;  1TNS A;  2WC2 A;  3QAH A;  3MCZ A;  2PMH A;  2O8X A;  5BMZ A;  3B73 A;  1F1Z A;  1J9I A;  5FLX K;  3ZQ7 A;  4ETS A;  5ICC A;  3QOP A;  1XSX A;  3E6M A;  1LDK B;  2XUB A;  3WE3 A;  3LQQ A;  2NS0 A;  3C7J A;  1V4R A;  1YS7 A;  3TO7 A;  4JBA A;  4OIP F;  5HDN A;  5K5Q A;  1T6S A;  2KIF A;  4HOB A;  1YO5 C;  3HSE A;  5E20 A;  2GWR A;  2XAJ A;  2HTJ A;  2QYO A;  4G7Z F;  2YPR A;  1SAX A;  4I0B A;  3E6B A;  2JTV A;  5A2Q K;  1YG2 A;  2LKP A;  3I59 A;  1RUN A;  2EFO A;  2COM A;  1SMY F;  3IRQ A;  2OZU A;  4HA8 A;  3NRV A;  1OR7 A;  1RIO H;  3BJA A;  3WOD F;  1Q1H A;  1QGP A;  3R0A A;  3DFG A;  3KP3 A;  1XDU A;  1TW3 A;  3ZMU A;  5E18 F;  5HLI A;  2OQG A;  4HDV A;  2A68 F;  3ABU A;  4LFU A;  3K1N A;  2HOE A;  5HVQ C;  2L02 A;  5L3G A;  3ROU A;  2QLZ A;  3AAF A;  1ZG5 A;  2ADU A;  4JQF A;  4HBL A;  1ZLK A;  1DPR A;  4PCQ A;  2BE5 F;  2BEO A;  3VFZ A;  4BAY A;  2OAZ A;  3E5Q A;  1FSE A;  4U0V A;  1ULY A;  1HW1 A;  1IN8 A;  2BYV E;  4YFN F;  1REP C;  3F21 A;  1SD7 A;  2LDU A;  4O3M A;  1IN6 A;  4I2O A;  1FYK A;  2HWV A;  1KQ0 A;  1E17 A;  3DQV C;  3FX3 A;  5D8K B;  2VON A;  1T39 A;  1HKT A;  3JSP A;  2ESN A;  1R1U A;  1KQ8 A;  2Y0M A;  5CYV A;  4P55 A;  2MLK A;  3KP7 A;  2HZT A;  3F8M A;  1LNW A;  2DK5 A;  4GCV A;  2PJP A;  4IXA A;  1BC8 C;  1AOY A;  1MDM A;  4M9X A;  4JK1 X;  5LEK A;  4CO8 A;  2H6B A;  1YYV A;  1H9T A;  1ON2 A;  3KP2 A;  2V79 A;  4NB5 A;  2FF4 A;  2X4H A;  1XDS A;  2ZME A;  5ED4 A;  3ISP A;  5CVU A;  1ODD A;  5H20 A;  4EM0 B;  1DPU A;  4LLL A;  3NQO A;  2FMY A;  2PQ8 A;  3GZ5 A;  2EJR A;  5FFX A;  5ICG A;  1ZRD A;  3M9A A;  3KEQ A;  1FWZ A;  1QZZ A;  1MJA A;  2P4W A;  4OOI A;  3V8J A;  4UVB A;  1BIB A;  3GUD A;  1B9N A;  5BQT A;  3GXO A;  3ECH A;  4RB0 A;  3DPT A;  1FZP B;  2LF7 A;  3RTR A;  2VOO A;  1Z6T A;  3CUQ B;  4UXN A;  2C6Y A;  2K4J A;  3JTH A;  3GFI A;  4RGS A;  1I1S A;  1K79 A;  1HKQ A;  2M5W A;  3BDD A;  3MAJ A;  2DFI A;  1R58 A;  5L3B A;  1FBS A;  2F5D A;  5FFZ A;  4XSX F;  2R3S A;  1J59 A;  2HGC A;  5HS8 A;  4WWC A;  5J8C A;  2FRH A;  3L00 A;  1G3T A;  4A5N A;  3WTV C;  3ZN1 A;  1YFH A;  1I27 A;  5LGU A;  4BQA A;  1CGP A;  5ICF A;  4HQM A;  4I98 B;  4A0Z A;  4LJZ F;  3N97 A;  1IN5 A;  3TO6 A;  2DW4 A;  4LD5 A;  3P9I A;  3WTT C;  3JAM K;  2YX4 A;  5LLQ A;  4UV9 A;  3PQK A;  4ESB A;  2XRO A;  3WGI A;  2ZCW A;  4BHC A;  4AWX B;  3WTZ A;  1B6A A;  3E5X A;  4UVA A;  1HBX G;  3DEU A;  4IHT A;  4L9N A;  1KA8 A;  3N4M A;  3ERE D;  5K5O A;  4M9Z A;  4RB2 C;  3TGN A;  1XCB A;  5LHI A;  2F5F A;  2YR2 A;  4KA4 A;  2PFB A;  1HST A;  4RAY A;  2FOK A;  5FGM A;  3DP7 A;  2EB7 A;  1P2F A;  5D5U B;  4WF2 A;  5HOO A;  2F5C A;  4QLC U;  1S7A A;  1ZYR F;  2MA3 A;  3FXU A;  4HX4 A;  3K9T A;  2RGV A;  1ZGA A;  1FOK A;  5CVV A;  3M8F A;  3K0L A;  3KLN A;  3SZP A;  4YFX F;  3R0J A;  3IHU A;  3DPL C;  2JPC A;  2EFW A;  3HHH A;  4HV6 A;  1TQI A;  3SZT A;  5L3F A;  2HFH A;  4KIG A;  2W84 A;  2PLY A;  2XIG A;  4L9J A;  2O03 A;  2EV5 A;  3CUQ C;  2P5L C;  3R4K A;  2HQR A;  2BBY A;  1IXS B;  1FSH A;  2FQ3 A;  1ZGJ A;  5ILU A;  3QP5 A;  2L4M A;  4IRH A;  5KK1 A;  3WGH A;  2VBZ A;  3K69 A;  4ESJ A;  1OKR A;  3F6V A;  3HRT A;  2CYY A;  2XAH A;  3FXQ A;  1IW7 F;  1SD6 A;  1KYW A;  4OMY A;  1T98 A;  3V7R A;  2R7D A;  1BI2 A;  3CLO A;  2JZY A;  1FLI A;  1XN7 A;  1BN5 A;  2JSC A;  1UHM A;  3BRO A;  2P6T A;  2E1N A;  4ZZD A;  4Z2Y A;  2DTR A;  4P9F A;  4I01 A;  3I4P A;  4PGH A;  4UVC A;  1XMA A;  3LA2 A;  1TLH B;  5JHU A;  2IA0 A;  2E1C A;  3U9G A;  4RS8 A;  1DDN A;  3T5X A;  3OV8 A;  1WRJ A;  5J6X A;  4HF1 A;  1F9N A;  5BPI A;  3KP4 A;  1BJA A;  3RKX A;  3WG9 A;  4OIQ F;  1KU7 A;  1FP1 D;  4EJV A;  4CDG A;  4Q5S F;  1O57 A;  3V7C A;  3TOB A;  1BM9 A;  3SHF A;  3QU6 A;  4I09 A;  5TJJ A;  1PDN C;  2HKX A;  3CDH A;  2ZO4 A;  3KP5 A;  1RUO A;  4L18 B;  1IN4 A;  4GYG A;  4TV7 A;  3F23 A;  1MJB A;  1B59 A;  2Z33 A;  2IA1 A;  3SXY A;  5HDG A;  1UHW A;  2YSR A;  5FB2 A;  3F8N A;  3S2W A;  1U5T B;  5ILS A;  5H6Q A;  5FD6 A;  1SFX A;  3G3Z A;  1HQC A;  2K86 A;  2QQB A;  2X0L A;  3LST A;  4HX7 A;  1ON1 A;  2Q8K A;  3BZ6 A;  1GXQ A;  1G3W A;  1FT9 A;  2OZ6 A;  1ZH5 A;  1G3Y A;  4CZZ A;  1XSD A;  3E97 A;  3WTW C;  2O6G E;  2XAG A;  1GVJ A;  3WU1 B;  2A6E F;  2Q0O A;  2P5V A;  3Q9S A;  4L0Z B;  2Z99 A;  5E8G A;  3LQR A;  4ZH4 F;  5LEJ A;  4ZYE A;  4KDP A;  4IPA A;  4G7O F;  1W4M A;  1FBU A;  2JPB A;  1FP2 A;  3LA7 A;  4FX0 A;  1HW2 A;  1LEA A;  3T1B A;  1YTY A;  5L3E A;  3ML6 A;  5HLG A;  1FYM A;  4KFC A;  4AD9 A; 
#chains in the Genus database with same CATH topology
 1G3S A;  2JK3 A;  2DPD A;  1HXD A;  1T0F A;  2FNA A;  4S0H B;  5HOD A;  4FIS A;  2GM4 A;  3O8G A;  3CUQ A;  2VBY A;  1BI1 A;  2FE3 A;  2LR8 A;  5EZG A;  3JRD A;  3MZ8 A;  4XSZ F;  2R7Q A;  4F92 B;  3OIO A;  5FO5 A;  1UAA A;  4JX4 A;  1GXP A;  1TBX A;  2MH2 A;  4XKB A;  2W00 A;  3GVA A;  5EF6 A;  2RC4 A;  3BOQ A;  4XLC A;  4P9U A;  1DQU A;  2A6T A;  2CO5 A;  1IXR C;  3BT9 A;  1UB9 A;  4BQQ A;  5CPR B;  2KMU A;  4DQ2 A;  1F5T A;  3KEO A;  3CO6 C;  4Y13 A;  3HTS B;  5IOY A;  2EQR A;  1WSU A;  2STW A;  1OMI A;  2W4S A;  5FKK A;  2I8D A;  2M4K A;  4RLQ A;  2JT1 A;  1AWC A;  1Y8Q B;  4LLN A;  1B1B A;  2KT0 A;  3CCY A;  2ZNY A;  3MMY B;  4BKX A;  3T8T A;  4RBO A;  4A0X A;  3D5S C;  3PFI A;  1A35 A;  2HKO A;  2ELJ A;  1QHH D;  4LG0 B;  3OOU A;  3K1M A;  1A04 A;  2EFP A;  2LD5 A;  1OCR H;  4AU7 A;  4OMZ A;  1H88 C;  4LGW A;  3PQJ A;  4RGR A;  4G6T B;  1TNT A;  2OQR A;  2W1O A;  2R7S A;  2BHY A;  3EUH C;  4ON0 A;  2R5Z B;  1R5G A;  1SD5 A;  3NEU A;  1V3F A;  1NG6 A;  2DQR A;  3FMQ A;  2CV0 A;  3K70 D;  2PMZ A;  1USS A;  1I1G A;  2XVC A;  4MQ9 F;  4E7Z A;  1MBG A;  4EMS A;  2M87 A;  1KYZ A;  2PN6 A;  1GDT A;  5J47 A;  1DP7 P;  1WGX A;  5FLM J;  1WHU A;  3SDB A;  2ETH A;  3E6D A;  3J80 Z;  2W7N A;  5KHD A;  1L3L A;  2IRF G;  3A2K A;  3S2H J;  3NWT A;  2OD5 A;  1JGS A;  1U5T C;  4R79 A;  5JI6 A;  2FQ4 A;  5HNF A;  3MZY A;  4L5E A;  2LBF A;  5BOX A;  1DU0 A;  1LEB A;  1FC3 A;  2E19 A;  1YOV B;  1TWH J;  2MD5 A;  5AON A;  5HS9 A;  4H4K C;  1MZB A;  3GW2 A;  5GPA A;  4BHB A;  5IP9 J;  3LAP A;  4EAT A;  1J75 A;  2KKO A;  2L54 A;  5LRR A;  5FLV A;  4EV0 A;  2LRD A;  2DA1 A;  5M5Y J;  3SFZ A;  2HI3 A;  2QM3 A;  2H27 A;  2IBD A;  4XON A;  4A3J J;  4CCO A;  1LQ1 A;  3KX2 A;  4HV5 A;  3CCJ I;  1BW6 A;  2PMU A;  4U7B A;  3HYI A;  3A0B C;  3FHZ A;  2HQ5 A;  3R60 A;  3VDX A;  4P1W A;  6PAX A;  3RI4 A;  3CMM A;  3VOD A;  2G9W A;  1V5F A;  1TQP A;  3MVP A;  4U88 A;  3TBI A;  3DU5 A;  1QU3 A;  2M1B A;  4U0Y A;  3TP3 A;  3I53 A;  4M3B A;  4M71 A;  1A5J A;  2V9K A;  3AG4 H;  1QA6 A;  2X48 A;  3ABK H;  2VC1 A;  1LB2 A;  2VE8 A;  3G73 A;  4CZC A;  5EGO B;  2VKH A;  4DYQ A;  5DEQ A;  4C3J J;  3H92 A;  1SAN A;  4CXF A;  2K9M A;  1RPW A;  2BW3 B;  2IS2 A;  4WXC A;  4HEA 2;  4XOR A;  3RSN A;  2UV1 A;  4PJN A;  4A5M A;  3I4N J;  2Q2E B;  5FLX Z;  1LPQ A;  4O5V A;  2RDP A;  4HZF A;  1K78 B;  1MJ9 A;  1Z77 A;  4OAZ A;  1W5C C;  3ESW B;  1TC3 C;  2JRT A;  1BI0 A;  3KIO A;  4KNY A;  3MKY B;  3FM3 A;  3U2R A;  2DT6 A;  2D1V A;  4Y52 J;  1MSF C;  2M7B A;  1OCT C;  2EPF A;  4DZJ A;  3PUF A;  1QPI A;  1TT5 B;  2GQQ A;  3FHN A;  2HXO A;  4A6E A;  4LB5 A;  3BTC A;  3B6C A;  3WG7 H;  2DA7 A;  4EM2 A;  2DMU A;  3GTM J;  5H2F C;  5FD5 A;  2L9V A;  3S2D J;  4F3Q A;  3WE2 A;  1YW7 A;  4N9I A;  2H8R A;  2ZXW H;  4EJT A;  2UXX A;  5E1W A;  4AIJ A;  5DD4 A;  3FIS A;  3TED A;  3HRU A;  2VT2 A;  4ZJZ A;  5EEH A;  3JTG A;  1T8I A;  3OWT A;  5F0H A;  4IHS A;  2F5E A;  2GIV A;  1X1P A;  4E70 A;  4W97 A;  3A01 A;  3W2V A;  4F7Z A;  5A2Q Z;  2RN7 A;  1T33 A;  3QWL A;  1DP3 A;  5JVT A;  1LVA A;  1LE8 B;  4EJU A;  4XNF A;  3QRF F;  2QZ8 A;  2RNG A;  1HA8 A;  1OYY A;  2ZKZ A;  3AL0 B;  4RGU A;  5E3M A;  3NAU A;  1CF7 B;  3E3V A;  2WWY A;  4JX5 A;  4LB6 B;  3TMO A;  4A69 C;  1IAW A;  4CSW A;  2V1U A;  5IT9 K;  1NK3 P;  1W7P B;  1D1A A;  4GXO A;  2ID3 A;  5IT3 A;  1J5Y A;  3VB2 A;  1Z3X A;  2UWM A;  3WTS C;  1VQN I;  3A0H C;  3B02 A;  3KE2 A;  3MWM A;  2EIK H;  2TDX A;  2X1E A;  3EET A;  3QPT A;  1SVM A;  2KRH A;  1AU7 A;  4V19 K;  1RI7 A;  1O7L A;  3ZR8 X;  3JSO A;  2NAZ A;  3K4M A;  3H0G J;  2X51 A;  4KUM A;  3IH2 A;  2GXG A;  2ISY A;  5F6F A;  2M2E A;  4QIW N;  5HLT A;  4E4H A;  5B3S H;  2VLA A;  2XKP A;  2MYS A;  4G94 A;  3BQY A;  1P4A A;  3UR3 C;  4R8H A;  4RAZ A;  3MEX A;  3PIP F;  4PJ0 C;  3JRE A;  4IEJ A;  2HDW A;  1KQ9 A;  1I6H J;  1JE8 A;  3PM1 A;  3SZG A;  5DTD A;  5D4S A;  1Z05 A;  3VSK A;  4YFK F;  1Y8R B;  2VKD A;  3K2Z A;  4UV8 A;  3CC4 I;  5EDN A;  1XCV A;  2R7U A;  1EH8 A;  1U9O A;  1JKR C;  1FIA A;  1X4O A;  3CCQ I;  5FRN A;  5EEA A;  1UJ8 A;  1PP8 F;  5LHH A;  3OYH A;  1X3U A;  2L4A A;  2DOE A;  2LRE A;  3IAM 2;  5D6F A;  2EA4 A;  2IEK A;  2DYS H;  5FRO A;  2GZW A;  4XQF A;  4HLY A;  4CYC B;  2DDB A;  3ECO A;  3CCR I;  4W1U A;  2BY2 A;  1VTN C;  3NWS A;  1B4A A;  2LG4 A;  3IWZ A;  4FE7 A;  1MD0 A;  4YII A;  2LP0 A;  4BDY A;  3EUH A;  4L9V A;  1EH7 A;  3L2W A;  3BTI A;  3CC2 I;  1R5H A;  5C4X J;  5HLH A;  4BU2 A;  1U0J A;  4XRF A;  1R00 A;  4Z6Y A;  2ECB A;  2HVR A;  1MBH A;  2FUG 2;  2L2O A;  3GX4 X;  2VN2 A;  1V5G A;  2NRA C;  2P5K A;  3A02 A;  5DCM B;  2LTP A;  3IKT A;  4ZZL A;  4WCG A;  1JT6 A;  1QQI A;  2MGQ A;  3I0T A;  1FY7 A;  3A03 A;  4PGG A;  2WAD A;  4KIC A;  1U5T A;  2FBH A;  2D45 A;  3LL7 A;  4G12 A;  4KMU X;  4HDU A;  1MMA A;  3PSI A;  5LRS A;  1SVL A;  3CUO A;  2IA2 A;  2K85 A;  2AHQ A;  5CQG A;  2RQP A;  2VPL A;  1OIS A;  3HUG B;  4EJW A;  5JFR A;  4Q4Z F;  2Z2S B;  3DEW A;  1P4W A;  4Y17 A;  1YW8 A;  5CVI A;  1M1E B;  4I02 A;  2LSO A;  2EV0 A;  2KIS A;  3HB9 A;  4IRI A;  4UHT A;  2V1D A;  2AQE A;  3O2P E;  4IHW A;  2IP2 A;  4B8X A;  4F91 B;  1IN7 A;  4A6D A;  2FXA A;  3LAJ A;  3DKW A;  4ENK A;  2DOD A;  1O7F A;  3SEQ A;  3BLY A;  2STT A;  3F6O A;  3G6E I;  3FZV A;  3ZQL A;  2NOJ B;  1MH3 A;  2IGM A;  5CKT A;  3E5U A;  2LYC A;  2V6C A;  3C1D A;  4EVI A;  3BG7 A;  4HF2 A;  3TO9 A;  4ZYG A;  3FMR A;  4E7K A;  3KPH A;  3CTA A;  4DW6 A;  1IDZ A;  3QPL A;  1B8I A;  1EA3 A;  1QO0 D;  2G0E A;  4LK0 F;  5FRM A;  4XRS G;  1MDM B;  4I7H A;  4X1E A;  4NHJ A;  4M3F A;  2GXA A;  2NS8 A;  5C3E J;  4BJT A;  1U78 A;  3ELK A;  5IY5 H;  5FKM A;  3S93 A;  3FM5 A;  1QHG A;  5EYR A;  4BXX J;  3DTI A;  2Y9Y A;  4I0A A;  3AL0 C;  1X19 A;  1X1B A;  3DKX A;  5IYC J;  2NVT J;  3BG5 A;  4PZJ A;  5GAD J;  4B43 A;  5CVR A;  2MC3 A;  3BR3 A;  5IT9 Z;  2B63 J;  3L7W A;  2A69 F;  4HX8 A;  2V1N A;  3S16 J;  4AIK A;  4KN7 X;  4D5F A;  4MEY F;  4DNC A;  2VQG A;  5FJ8 J;  3COA C;  2ACJ A;  1EF4 A;  4N0B A;  1WI9 A;  2DOA A;  2KRF A;  4M9S A;  3GYH X;  3C2H A;  2L7K A;  2LKX A;  1AA7 A;  1IRX A;  4WXD A;  3OMY A;  4UNO A;  4A3B J;  4MO7 A;  1O3Q A;  2B7E A;  4D7M A;  2EZI A;  1XG1 A;  5LHG A;  5J40 A;  1HW5 A;  1R1T A;  1BC7 C;  1O3T A;  1CQT A;  1BBY A;  3K4J A;  2VT3 A;  2V9V A;  4IHV A;  1YQA A;  1H8A C;  1A6I A;  3I4M J;  3E1S A;  3U21 A;  4C9Y A;  4LOC A;  1MND A;  2O3F A;  2XRL A;  4HF0 A;  2K5C A;  4RGX A;  2CG4 A;  2IGO A;  2FD5 A;  1MMS A;  2Z5U A;  3CD6 I;  5M5W J;  1UFM A;  3RZD J;  3WU0 A;  1K6O A;  2GXB A;  2M0C A;  4IKF A;  4HNV A;  4BNC A;  4ZTJ A;  2F6C A;  1XGN A;  1SMT A;  3BTJ A;  3HG9 A;  3I54 A;  4IF4 A;  5CLS A;  3I5U A;  3E0J B;  3HSR A;  1NHA A;  4UUV A;  3DXJ F;  4G6Q A;  5D6E A;  2RV8 A;  2XAU A;  4MNU A;  2X6W A;  3ERM A;  5LBQ A;  2FU4 A;  4RM3 A;  2A5Y B;  2IVM A;  2VUM J;  1EKE A;  3MKW B;  5LFA A;  1S6L A;  3LSK A;  1WI3 A;  4LG0 A;  2QEX I;  2VE9 A;  1SVO A;  1MMN A;  2JUG A;  4XLH A;  5ILV A;  4Q47 A;  1W5S A;  2JVH A;  3KCC A;  3OYL A;  2PG4 A;  3VYR B;  4OIO F;  4IHY A;  3JAM Z;  1T95 A;  3M1C A;  3Q9V A;  9ANT A;  2N8G A;  4BXF A;  2MSY A;  3ABT A;  1TWA J;  1W0T A;  1YLF A;  2IT0 A;  4U7D A;  4MQV A;  3G71 I;  1ZAR A;  2XAS A;  3SEZ A;  2R5Z A;  2F2E A;  4LMY A;  3HHG A;  5DS9 A;  3REO A;  3S8P A;  1P7I A;  3L1P A;  3CZ6 A;  2NNY A;  3OR1 C;  1A6Q A;  1XB4 A;  2CFX A;  4XLP F;  2R7F A;  1OFC X;  1IO2 A;  3DLA A;  3HJE A;  3R6S A;  2VXZ A;  3ZCO A;  1WJA A;  3PNT A;  3CQZ J;  2IPQ X;  4DGW B;  1D8J A;  4I99 C;  1ZKG A;  3K10 A;  2MH9 A;  4MGR A;  5LGT A;  4Y4R A;  1H89 C;  2CS3 A;  3Q3S A;  1OPC A;  2L7F P;  4CIC A;  1VF9 A;  4ENM A;  1A36 A;  4AYB A;  1DGR M;  5HS7 A;  1MBJ A;  4FHT A;  2VJI A;  2M4G A;  1D0X A;  1IJW C;  2XHK A;  1QVT A;  1E3O C;  3J7A O;  2XKO A;  1QNT A;  3I3L A;  2D1H A;  1S3J A;  1NH3 A;  4BJ6 C;  2AS5 F;  1K83 J;  2CSO A;  2KJB A;  4KIB A;  2W24 A;  2GIZ A;  4YIF A;  2DAO A;  1Y0U A;  2L3D A;  1N77 A;  1LDJ A;  3ZXS A;  1U8R A;  2DU9 A;  1ETV A;  3MKL A;  4HW0 A;  3MD2 A;  3PO2 J;  2K9Q A;  3CMA I;  5F08 A;  3IRR A;  1HKS A;  4AVZ A;  4WXH A;  3GLX A;  4RM2 A;  3F8F A;  3VYU B;  1Y56 A;  4RAG A;  5JLW A;  4KYW A;  2MG4 A;  1Z6R A;  2K40 A;  3BC8 A;  2H1K A;  2YX7 A;  4LK1 F;  2Y75 A;  1NTC A;  5K5R A;  3UKG A;  1IC8 A;  3TDU C;  4BQO A;  5EGO A;  4BBS J;  3HEF A;  2ZBK A;  2E1O A;  3FWE A;  2BY0 A;  4S05 A;  2HNH A;  4R1H A;  2E7W A;  2BW3 A;  5D8L B;  2DMP A;  3P7N A;  2XGX A;  2HDD A;  3W6J B;  2XAF A;  2Q2E A;  1BI3 A;  3HKZ N;  3EQL F;  2P7C B;  3EUA A;  3FKJ A;  1K78 A;  4A2U A;  4ITV A;  3ASO H;  1XX5 A;  3OL4 A;  3EPZ A;  3H9Q A;  2CUE A;  3OYK A;  1ZN2 A;  2BHZ A;  4PJM A;  1FYL A;  2HXI A;  1WCM J;  1IV8 A;  4RDU A;  2DFE A;  4II2 A;  2KDZ A;  2ELK A;  1TQM A;  3K4K A;  5BPD A;  4A0Y A;  5GTI C;  4M3G A;  1T38 A;  4BYY A;  2DI3 A;  3HOS A;  2ZXI A;  3RYR A;  4BH9 A;  2QQA A;  2EA2 A;  3BR0 A;  1Z7U A;  2KQR A;  2E5Z A;  2JA8 J;  1S7O A;  1X2M A;  3P5J A;  2K7L A;  5E1Z B;  5AIP A;  1N25 A;  4GGG A;  1XMX A;  5J8F A;  1HC8 A;  3WU2 C;  3HOX J;  3JCU C;  3PIO F;  1IRG A;  1GHC A;  3HM5 A;  1T2K A;  1X2N A;  3L9F A;  3OS0 A;  2O8K A;  3BR5 A;  1MKM A;  2UXN A;  4BHP A;  1FOY A;  2W85 A;  5FKN A;  2Z3Y A;  3AG2 H;  3GWZ A;  4EQQ A;  5TGT A;  1ZRE A;  1UMQ A;  3QYB A;  3HRM A;  2PX9 A;  3DCF A;  3QOE A;  2W82 A;  3D0S A;  2J5O A;  5EEG A;  1D5V A;  3GFJ A;  2DN0 A;  4A3D J;  3FMS A;  2RNJ A;  5CJ9 A;  4JYK A;  2DT5 A;  1LE8 A;  2IXS A;  1ZRF A;  5D4R A;  4G8X A;  2OTJ I;  1ZG1 A;  4C2T A;  1JKP C;  1H9G A;  2QQ9 A;  3S32 A;  2EWN A;  1VQ7 I;  2Z9O A;  1CF7 A;  4NQW B;  3LSG A;  3I56 I;  5C44 J;  3V8K A;  2KDO A;  3L2Q A;  3F72 A;  3SQN A;  1W7P A;  4HAM A;  3VEP A;  2HPM A;  3Q5F A;  2BZT A;  3EYY A;  3MQ0 A;  2VL8 A;  4HRI A;  2R93 J;  1JUS A;  3GTJ J;  3FF5 A;  4C2U A;  2OJE D;  4J19 A;  1V5E A;  2R4G A;  2OTL I;  2NYX A;  3RYP A;  3HDD A;  1Y6I A;  2GA1 A;  5BNG A;  3ZN0 A;  2HVQ A;  3RKW A;  3H3Z A;  4A12 A;  1KU3 A;  3BPX A;  1MGT A;  2HQN A;  3U1K A;  1QPM A;  4E7J A;  1RNL A;  3F22 A;  1FPQ A;  1JUP A;  5JVG F;  1TT0 A;  1R6R A;  1WJB A;  3E6C C;  2M8G X;  4BS9 A;  4C2M J;  1V55 H;  2M30 A;  2YU3 A;  4HQE A;  3V8L A;  1RZ4 A;  1YX3 A;  2QVO A;  2ECC A;  4X0G A;  1OYW A;  2O9L A;  3OYE A;  4XBF A;  2JRM A;  2IJL A;  4IO9 F;  1WH7 A;  1W1W E;  3JW4 A;  1BOA A;  3D1N I;  2IW5 A;  2UZK A;  4XLE A;  4U87 A;  4RB3 C;  3HOW J;  3FXK A;  4L5I A;  3T0Y A;  1NK2 P;  1ZLJ A;  3LSI A;  2A61 A;  3CJN A;  1N78 A;  3IKV A;  3RPU A;  3WTY C;  3OOP A;  2H09 A;  2DJI A;  3FBN B;  1BOB A;  2BOL A;  4LIT A;  1B9M A;  3HSF A;  2FBI A;  3ABL H;  3EDP A;  3L2U A;  3OL3 A;  2KIM A;  1I5Z A;  4ANJ A;  1A31 A;  1G4D A;  2HEO A;  4CYC A;  2A07 F;  2DDA A;  4OWR B;  2CW0 F;  2RKH A;  1ETX A;  1LFP A;  4CCJ A;  4OAY A;  3S17 J;  4M6Y A;  5F04 A;  3TKY A;  5E1X A;  3QU3 A;  1SFU A;  3K1P A;  2CU7 A;  1MBF A;  1F4K A;  1D3Y A;  4MEX F;  2PI0 A;  3W2A A;  2KJC A;  3ZQH A;  4IVN A;  2QWW A;  1IXC A;  2RQQ A;  2QBY B;  4A93 J;  1BW5 A;  5DCM A;  2VXD A;  5C4J J;  1S5L C;  3GTK J;  5D5W B;  3O6B B;  3RKY A;  2EIJ H;  2WAQ A;  4Y3O A;  3ZOB A;  2PMZ N;  3GTP J;  2HOA A;  2CW8 A;  2DA5 A;  3LFK A;  1JKO C;  2DTZ A;  2XAQ A;  1LDD A;  4Y7N J;  2HTS A;  3G4S I;  3IC7 A;  2ZXH A;  1W5T A;  3H3V K;  2F48 A;  5HDK A;  5DUI A;  2HPI A;  5F1R A;  1OCO H;  1QVU A;  5ICE A;  2XF5 A;  2F5V A;  1D8K A;  2BV6 A;  3IH4 A;  4XOP A;  4B09 A;  5D5X B;  3CC7 I;  3U1D A;  1PYV A;  1SD4 A;  4CH7 A;  2TCT A;  3QPH A;  1Z9C A;  3HUG A;  2DXI A;  2QSG X;  4P96 A;  2VC0 A;  4BXU A;  4ZYD A;  4NBQ A;  2BXZ A;  1E0E A;  1SAU A;  3WTX C;  3HTU A;  5IOZ A;  1YJW I;  3RPQ A;  4BE0 A;  4DJA A;  3W6K B;  2GLO A;  1WJC A;  5KNL A;  5JR3 A;  1XMK A;  4OU0 A;  1K61 A;  1BR4 A;  4PFP A;  2LKS A;  2ZJR F;  2CWE A;  2EZL A;  5E3N A;  5KVR A;  2PBI A;  4KIF A;  1W36 C;  3IWF A;  1JTX A;  2DOF A;  1BIA A;  2E60 A;  1E2X A;  2LY9 A;  1X58 A;  3K2A A;  4WX9 A;  1DUX C;  2L7Z A;  3KZZ A;  2CMP A;  2EIM H;  4RB1 A;  2EZK A;  3ASN H;  1Z91 A;  2ESH A;  4AVP A;  1RES A;  1YRN B;  1O3S A;  3VOE A;  1Z1D A;  1DU6 A;  4GRI A;  2LC2 A;  2Y48 A;  3ABM H;  5TIS C;  3CES A;  2LF8 A;  3V42 A;  2VOD A;  2CUJ A;  3C18 A;  1YIO A;  4MTE A;  2O0Y A;  1G8X A;  1EV7 A;  3I55 I;  1TP4 A;  1E3H A;  2BVL A;  1W7P D;  3S3M A;  2V6E A;  5K7H A;  1XGS A;  4QWQ A;  5DD8 A;  1XS9 A;  2HYG D;  3BZC A;  1FTT A;  2GA2 A;  1G59 A;  4E7I A;  1WKM A;  3IH3 A;  1D0Y A;  4CYD A;  2O61 A;  1TWC J;  2XSD C;  4N9H A;  3H5N A;  5F0C A;  3V7S A;  5BS6 A;  4Y15 A;  2OA4 A;  5DDG A;  2L9R A;  1VQK I;  4OIN F;  2K3F A;  2WV0 A;  1VQ5 I;  4CCM A;  4KT6 A;  2W57 A;  4V2F A;  2EK5 A;  1Z21 A;  1ZHF A;  4HYE A;  1JXS A;  1R9T J;  1RRJ A;  2NVU B;  3HC7 A;  1YJ9 I;  5FKL A;  1RR8 C;  4EGY A;  3JRA A;  3ZMD A;  3MZH A;  3BJ6 A;  2R7W A;  1PJR A;  2JQ7 A;  3M7G A;  3KZI C;  3M07 A;  2ZSI B;  1IRF A;  5L3C A;  4IJA A;  3CLQ A;  3FXR A;  3GTQ J;  2Y30 A;  3DBR B;  1TW2 A;  3RJP A;  4IQ4 A;  4M73 A;  3RPU D;  4CGZ A;  2P8T A;  5M3F J;  1O3R A;  4A3G J;  1K6Y A;  3M8E A;  3I71 A;  2KLO A;  1P9Q C;  1LJ9 A;  3CF5 F;  4DIQ A;  2XDV A;  3L2C A;  2IS1 A;  2L7M P;  2XPU A;  1C0W A;  3RQ4 A;  3CME I;  3W6V A;  1YI2 I;  3JRH A;  2I5U A;  3HGG A;  1ETK A;  1J2X A;  2DBB A;  2EFN A;  3HOT A;  1R4N B;  3P9K A;  2QKL B;  3PSF A;  3K4B A;  4BGD A;  4XLF A;  2CGP A;  1VQ9 I;  5HNH A;  3QPS A;  5E8I A;  1T56 A;  5KAI C;  4CHU A;  2VIX A;  2G7H A;  2GBY A;  3WTU C;  2WAF A;  2OU2 A;  3P9C A;  3DV8 A;  4OIR F;  2M9H A;  4DBQ A;  3RIR A;  5DCF A;  2M45 A;  2VB6 A;  2FML A;  1APL C;  3S14 J;  3S1Q J;  3JR9 A;  2GAU A;  2MAB A;  3D5R C;  2AO9 A;  3I59 B;  4B1R A;  3AKZ A;  4M3E A;  2JVG A;  3DKY A;  3BY6 A;  2M3A A;  4G7H F;  5D5V B;  2A6H F;  1P92 A;  4HG2 A;  2ME0 A;  2EV6 A;  1WZ2 A;  4B44 A;  3JRB A;  1ZQ3 P;  4ZDP A;  4L9T A;  3C3W A;  2VBW A;  3PNY A;  2BGC A;  2B0L A;  5EG0 B;  1QZY A;  3ULQ B;  2Y9Z A;  2R5Y B;  1U3E M;  2X1C A;  2CQK A;  3CP2 A;  2OF7 A;  2CQN A;  2F4M B;  1IZ1 A;  2P7V B;  1VQO I;  1SEU A;  3J81 K;  1TWG J;  3GFM A;  3K7A J;  5J1Y A;  5KCM A;  4HNU A;  4ZC3 A;  1VZ0 A;  3BWG A;  2ZFW A;  2JA6 J;  3WHC A;  3H1C A;  5LGN A;  1HSJ A;  2A3S A;  2DT7 B;  3FXJ A;  3GEZ A;  1XGO A;  3BG6 A;  4MIM A;  5L3D A;  3VYT B;  2G7U A;  4M6X A;  2L9N A;  4D7N A;  3BJO A;  4KT5 C;  2V4J C;  3G1O A;  4XLA A;  3GTG J;  4BBR J;  2Z16 A;  3DEE A;  1T08 B;  2P6S A;  4P5O A;  1K7A A;  3GZ6 A;  3ZQQ A;  3LSP A;  2VQC A;  2NOG A;  3HPG A;  5B5E C;  1I3A A;  1Q1V A;  2L01 A;  2QUF A;  2BY1 A;  5ERI A;  4II3 A;  1U8B A;  5B66 C;  5B1B H;  2K4B A;  3V4G A;  1OYI A;  3BR6 A;  2B9S A;  1F43 A;  3CJR B;  3GBG A;  3KP6 A;  5CQE A;  3ZMV A;  3OYD A;  1AHD P;  1Y1W J;  4GYI A;  1FIP A;  1KU9 A;  2WBM A;  2DMN A;  1EH6 A;  3ZQF A;  1WFX A;  3ZGK A;  1STZ A;  2RVC A;  2HVS A;  2D5V A;  2EIN H;  2K27 A;  2DFF A;  2W48 A;  4B4C A;  1G6N A;  2DK8 A;  2VPR A;  1FEX A;  2LOO A;  4XMY A;  1WWX A;  1XGM A;  4IRG A;  1IF1 A;  3I58 A;  3H9J A;  3KLO A;  1S8N A;  1Y0N A;  3ZRG A;  1YX5 A;  1X3W B;  4XLN F;  3DTK A;  4BQN A;  5TRD A;  3GZN B;  1EJ9 A;  4A3M J;  2KIU A;  3OIQ A;  4GO1 A;  3BZK A;  4UB6 C;  3J7Z I;  3M3Y J;  2E34 A;  1K4T A;  5E3O A;  4C3H J;  3LA3 A;  4A3K J;  3HXL A;  3I64 A;  4Q48 A;  2HR3 A;  3BP8 A;  4ENN A;  3I9V 2;  3LOC A;  4ESF A;  4EGZ A;  2XGC A;  2XV4 S;  2H8W A;  4RLF A;  3GCM A;  2LVS A;  1WH5 A;  1SFE A;  3BPV A;  2V1X A;  3LFU A;  4PJL A;  2HS5 A;  4G9Y A;  5DYM A;  4XKC A;  4L5J A;  1JHF A;  2CV2 A;  2ZME B;  1AKH B;  4L0Y B;  3HIF A;  1FX7 A;  2PEX A;  5CVJ A;  2FSW A;  3F8B A;  3T8R A;  1I6X A;  1R1V A;  2DLL A;  2M34 A;  3HRS A;  1L0O C;  3F8C A;  3KZY A;  1KGS A;  2ZXJ A;  2BY3 A;  3PL8 A;  2MBF A;  4U0W A;  2R0Q C;  5FKO A;  2HDC A;  1P4X A;  2R7Z J;  2DQL A;  1ZRC A;  4PJJ A;  3BG3 A;  2XF7 A;  3ZPL A;  1NG7 A;  3DWL E;  4MHG A;  2E7X A;  2V9P A;  3OYI A;  1GT0 C;  4A3F J;  4NQW A;  4MTD A;  5DUK A;  1UST A;  1R22 A;  4XM3 A;  3K6G A;  2M8E A;  3TOA A;  1H0M A;  4YG2 F;  1ZG3 A;  2F4O B;  1I3Q J;  4FT8 A;  4H0E A;  3CDL A;  2XC7 A;  4A3L J;  4WK8 F;  3R61 A;  1S29 A;  4ZYH A;  2NNN A;  4ABZ A;  1P6R A;  2FJ1 A;  2E2J J;  1OLT A;  1XSV A;  1FJL A;  2E71 A;  4O6J A;  2FEZ A;  3CCM I;  2WTE A;  5GAG J;  2LFB A;  4E7H A;  4B47 A;  3RDI A;  2CUF A;  2VOP A;  3FXM A;  3MN2 A;  3KET A;  2QCO A;  3VSL A;  1MIJ A;  2LNB A;  1ORK A;  3K4C A;  2O5R A;  3DLL F;  2BXY A;  1QBJ A;  2LH9 A;  1PP7 U;  4KMF A;  3L09 A;  4RMN A;  3WHB A;  1OR7 C;  1R7J A;  3BTL A;  4BEH B;  5F64 A;  2CFO A;  3O3K A;  4JX6 A;  1R36 A;  3ZMT A;  4EM1 A;  3ZMZ A;  4AIH A;  3PUB A;  1V54 H;  3DF8 A;  3H35 A;  3EYI A;  1ZAO A;  2XRN A;  4AC0 A;  3J81 Z;  3M1E A;  5J4Y A;  4D0P A;  3CF2 A;  4ENJ A;  2EFQ A;  2IS4 A;  1JGG A;  3HZJ A;  1RKW A;  3CCE I;  4ASN A;  4XRM A;  4RA2 A;  5J1U A;  3VPR A;  4HPQ A;  1FTZ A;  4KN4 X;  1XD7 A;  1XTA A;  3CO7 C;  1HDD C;  2LY1 A;  4M72 A;  4K2E A;  1KU2 A;  1TTY A;  1U2W A;  4FET A;  2H94 A;  5DV5 A;  4EJO A;  3OYC A;  1YW9 A;  1D1B A;  3SFI A;  3HOY J;  1ONV A;  1N75 A;  2ELH A;  1FOW A;  4KIS A;  2FBK A;  3FIW A;  3ZP5 A;  4XR6 A;  3UNG C;  5K7F A;  1XC5 A;  3QP6 A;  4M74 A;  4EEF G;  2QBY A;  1MSE C;  2K3P A;  5E3L A;  3GO5 A;  2VI6 A;  1OCZ H;  4NUB A;  1LKX A;  2FA5 A;  4LLG F;  3ZQC A;  2DO7 A;  4G6D A;  3F3X A;  3GF2 A;  1U6G A;  5IP7 J;  4XK4 A;  3GFL A;  3C2G A;  3ZMS A;  1UCR A;  2KHM A;  1J7K A;  2E2I J;  3A1Y A;  4M3D A;  2L9S A;  1J09 A;  3ZQG A;  4S04 A;  1JHH A;  4M6V A;  5B1A H;  3J7A Y;  1MBE A;  2MLG A;  1R4M B;  4CCL A;  4PSW A;  2E1M B;  2XPV A;  4CUG A;  4AYB N;  3IL2 A;  3L2R A;  1YS6 A;  1FBQ A;  1VQP I;  2KPM A;  2VBX A;  2MC4 A;  2R92 J;  1MMG A;  3G1M A;  1BJZ A;  2WA0 A;  2J5P A;  2ZC2 A;  4FQG A;  4B3X A;  2Y0S A;  3TQN A;  2HOS A;  4YIR X;  3J80 K;  3H0D A;  2QF7 A;  2AXT C;  5K1Y A;  2M0M A;  1B72 B;  2XPW A;  1ENH A;  3D5L A;  2E35 A;  1YIT I;  2NVQ J;  1ERD A;  2L0K A;  2OBP A;  4HLX A;  2QKM B;  2ZJ2 A;  3OYN A;  1E3P A;  4FCY A;  1R23 A;  4PDK A;  1YRN A;  2K02 A;  5J3L A;  2D2W A;  1OQY A;  1WJ5 A;  2ZME C;  3DTE A;  3JRG A;  2V26 A;  1IUY A;  3CCV I;  5F1J A;  1P7J A;  2H6C A;  1UG0 A;  2FNP A;  4BY7 J;  2E5N A;  1WQ2 A;  3KFW X;  2W25 A;  5J1R A;  1ETW A;  2LK2 A;  3MKZ A;  4FX4 A;  2QEN A;  3LWF A;  1PVE A;  2CJJ A;  2OPT A;  3K4N A;  3MFK A;  2HYF A;  3TDZ C;  3IP4 B;  2AXL A;  3WGG A;  1PUE E;  2ISZ A;  3LMM A;  1J0R A;  1FNN A;  5H6R A;  2DPU A;  1IGN A;  3DBH B;  5E17 F;  5AIQ A;  2ZNZ A;  2Q1Z B;  3F9K A;  3FKI J;  4XL9 A;  4PFO A;  3OSG A;  1I39 A;  4CCK A;  3H3U A;  3RQI A;  5DM6 F;  4ZDO A;  1TNS A;  3VWB A;  2WC2 A;  3QAH A;  4XN3 A;  3MCZ A;  2PMH A;  1O4X A;  2O8X A;  3LSM A;  5BMZ A;  2WV1 A;  3B73 A;  1F1Z A;  1J9I A;  3K4L A;  5FLX K;  2DMT A;  2R7O A;  4D5C A;  3ZQ7 A;  5KAF C;  1OJL A;  4ETS A;  5ICC A;  3QOP A;  3L2V A;  1XSX A;  3E6M A;  2WB1 A;  1LDK B;  2XUB A;  2HQA A;  1POG A;  3WE3 A;  2KZG A;  3LQQ A;  3AFH A;  2NS0 A;  3FDY A;  4LIV A;  3C7J A;  1V4R A;  3PNV A;  1YS7 A;  1JT0 A;  1KZH A;  4BDZ A;  2KZV A;  3TO7 A;  3IV5 A;  3LSJ A;  3OYB A;  4JBA A;  4OIP F;  5HDN A;  5K5Q A;  4KIT B;  4DYC A;  5IPA A;  3KYC B;  3HGY A;  1YIJ I;  1T6S A;  2KIF A;  4HOB A;  1YO5 C;  3HSE A;  5E20 A;  2GWR A;  2XAJ A;  3SDG A;  2HTJ A;  2QYO A;  4G7Z F;  2YPR A;  4HNT A;  2WB1 N;  1IDY A;  1SAX A;  4I0B A;  3F0C A;  4BJ5 C;  3E6B A;  2JTV A;  4FAS D;  3KYL A;  2X6Y A;  4F52 A;  4UUT A;  4BUP A;  3M4O J;  5A2Q K;  1YG2 A;  1ZR4 A;  2LKP A;  1LUJ B;  1D1C A;  2VJ4 A;  4IZZ A;  3I59 A;  1RUN A;  2EFO A;  2COM A;  3BCB A;  1SMY F;  3IRQ A;  3OS2 A;  4GDF A;  2OZU A;  4HA8 A;  2K9S A;  3BR2 A;  3NRV A;  1OR7 A;  3RKQ A;  1RIO H;  2EH3 A;  3GTL J;  3BJA A;  3CCL I;  3WOD F;  4XIC A;  5EG0 A;  4QSH A;  1Q1H A;  1QGP A;  3R0A A;  4AID A;  1Z7L A;  3DFG A;  3RCO A;  2R5Y A;  3KP3 A;  3TW6 A;  1LFB A;  4NC6 A;  1XDU A;  3DPU A;  1TW3 A;  1HCR A;  3ZMU A;  5E18 F;  4IX7 A;  1IG7 A;  4AUX A;  4FE4 A;  3HOZ J;  5HLI A;  4BY1 J;  2NVX J;  2OQG A;  2JA5 J;  3FXO A;  2X6X A;  4HDV A;  4IOC F;  1LFU P;  2A68 F;  3ABU A;  1IV6 A;  4LFU A;  3PO3 J;  3HOU J;  3K1N A;  2HOE A;  5HVQ C;  2L02 A;  2E1M C;  5L3G A;  3ROU A;  1SFO J;  2CQX A;  4IOA F;  2QLZ A;  3LSR A;  3AAF A;  1ZG5 A;  2ADU A;  4JQF A;  1UEL B;  3SYT A;  1UG2 A;  4HBL A;  2QSF X;  1YJN I;  2PJR B;  2X9D A;  1ZLK A;  2P0W A;  4XKV A;  1DPR A;  1QRY A;  2OCC H;  2BE5 F;  4PCQ A;  2BEO A;  3VFZ A;  4BAY A;  2OAZ A;  1X4P A;  4D9J A;  3OYM A;  1SC7 A;  1FMV A;  3E5Q A;  1JI8 A;  2JA7 J;  1FSE A;  4U0V A;  1ULY A;  1HW1 A;  2R7X A;  1IN8 A;  2BYV E;  1OCC H;  4YFN F;  2YUS A;  1REP C;  3HL2 A;  2ZFU A;  3F21 A;  1SD7 A;  1R5I D;  2IGK A;  4E7S A;  3N05 A;  2ZJP F;  2LDU A;  4O3M A;  3PFY A;  1WJE A;  1IN6 A;  5F0F A;  1PUF B;  4I2O A;  1FYK A;  2HWV A;  1KQ0 A;  4BE2 A;  2WAQ N;  1E17 A;  3DQV C;  4JP0 A;  2VKV A;  3Q0W A;  2HOT A;  4ZDL A;  3FX3 A;  2EZH A;  5D8K B;  2VON A;  3S3N A;  4MFD A;  1T39 A;  1JKQ C;  1HKT A;  1ZGW A;  1Y1V J;  3JSP A;  2ESN A;  3OYG A;  1Z3Y A;  1R1U A;  2M7A A;  1KQ8 A;  2Y0M A;  5CYV A;  4UUS B;  4P55 A;  3ONQ A;  2MLK A;  3KP7 A;  2HZT A;  5F27 A;  3F8M A;  4J01 A;  1ZTR A;  1LNW A;  2DK5 A;  2CV1 A;  4GCV A;  4HSR A;  2OCE A;  3QQA A;  3TL4 X;  3OSF A;  2WAE A;  2PJP A;  4DOZ A;  3DU6 A;  3CJT B;  4IXA A;  1BC8 C;  5IYD J;  1AOY A;  1MDM A;  4M9X A;  2F4I A;  4JK1 X;  5LEK A;  4CO8 A;  2H6B A;  1YYV A;  1H9T A;  1ON2 A;  3KP2 A;  1GLN A;  1MNE A;  2V79 A;  2A05 A;  3G2B A;  4NB5 A;  2FF4 A;  2X4H A;  1XDS A;  2ZME A;  2DYR H;  1AKH A;  5ED4 A;  3QYF A;  3ISP A;  5CVU A;  3QYE A;  4RAF A;  1ODD A;  2VQH A;  5H20 A;  2RRE A;  4EM0 B;  1DPU A;  4LLL A;  3NQO A;  1SFK A;  1WVR A;  2DA4 A;  1ITY A;  2AQF A;  2FMY A;  2PQ8 A;  3C2B A;  3S15 J;  5GPC A;  3GLL A;  3GZ5 A;  2EJR A;  1ETY A;  5FFX A;  1D0Z A;  2QGU A;  5ICG A;  3OYA A;  5J4V A;  1ZRD A;  2ME6 A;  2OUM A;  3HBL A;  1ZR2 A;  3M9A A;  4IQJ A;  3KEQ A;  1FWZ A;  1QZZ A;  1MJA A;  2P4W A;  1BR1 A;  4OOI A;  1W0U A;  3V8J A;  4UVB A;  1BIB A;  1R49 A;  3GUD A;  1B9N A;  1WJD A;  4UY8 I;  1K4S A;  2WY7 Q;  3SJM A;  5BQT A;  1LVK A;  2VAS A;  2JN6 A;  1VQL I;  3GXO A;  3ECH A;  4RB0 A;  3DPT A;  4LIU A;  1FZP B;  2LF7 A;  3RTR A;  2MFZ A;  3QOD A;  2UUZ A;  2VOO A;  2LMD A;  1Z6T A;  3CUQ B;  4UXN A;  3GME A;  1RET A;  2C6Y A;  4BEH A;  2K4J A;  2JSP A;  3JTH A;  3X2Q H;  3GFI A;  4RGS A;  4YEL A;  5E79 C;  1I1S A;  3IUO A;  1K79 A;  3S1R J;  2QA4 I;  1HKQ A;  2M5W A;  3W3C A;  3BDD A;  3MAJ A;  2DFI A;  2L5Q A;  1R58 A;  2DCE A;  5L3B A;  1FBS A;  2F5D A;  5FFZ A;  4XSX F;  2R3S A;  2Y2Z A;  1J59 A;  2DA3 A;  3Q0U A;  1D5Y A;  2HGC A;  3FK6 A;  5HS8 A;  4WWC A;  3FBI B;  5J8C A;  2FRH A;  2E2H J;  3L00 A;  1G3T A;  4A5N A;  3J7Y J;  3EUK L;  4MLO A;  4CCN A;  3OYJ A;  3WTV C;  4B48 A;  3ZN1 A;  3JRC A;  1YFH A;  1TZL A;  3OYF A;  1I27 A;  1GV2 A;  5K7Z A;  3KYD B;  1ETQ A;  5LGU A;  2XF6 A;  2QQ8 A;  4BQA A;  2NS7 A;  1CGP A;  1Z0X A;  5ICF A;  2LY2 A;  3LNQ A;  4HQM A;  4I98 B;  4PUS A;  4A0Z A;  4LJZ F;  3N97 A;  1FOX A;  1F36 A;  1IN5 A;  3TO6 A;  2DW4 A;  4LD5 A;  3P9I A;  3WTT C;  3JAM K;  1WPK A;  2COB A;  2OC6 A;  2YX4 A;  5LLQ A;  3NAR A;  4UV9 A;  3PQK A;  4ESB A;  2XRO A;  3WGI A;  1GV5 A;  2ZCW A;  2LBF B;  1S7E A;  4BHC A;  4AWX B;  3WTZ A;  1HF0 A;  4UB8 C;  3K70 C;  1GUU A;  5M5X J;  2CUZ A;  2EBI A;  4NC8 A;  1B6A A;  4DBR A;  1VI0 A;  2NXN B;  3E5X A;  1HOM A;  4UVA A;  4DYR A;  2X6O A;  1XPX A;  3BCA A;  3DEU A;  1HBX G;  1BL0 A;  2DA6 A;  2QSH X;  4IHT A;  2CQQ A;  4L9N A;  1VQ4 I;  3PJR A;  1UZC A;  4XRS A;  1B72 A;  1G2H A;  3CCS I;  1KA8 A;  1WJF A;  3VYS B;  3N4M A;  4B3A A;  3B6A A;  3ERE D;  5K5O A;  4LG3 A;  4I6Z A;  4YRV A;  4M9Z A;  1JJ8 C;  4RB2 C;  4AM3 A;  3TGN A;  1XCB A;  2LLK A;  2XB0 X;  2F5F A;  2YR2 A;  5LHI A;  2JA2 A;  4KA4 A;  2YS9 A;  2K9L A;  2PFB A;  1HST A;  4RAY A;  4NDL A;  5GP9 A;  2JMW A;  3CP8 A;  2FOK A;  2XB5 A;  5FGM A;  2ID6 A;  3DP7 A;  2EB7 A;  1P2F A;  2Z1D A;  3CDI A;  5D5U B;  1YE9 A;  4WF2 A;  5HOO A;  2F5C A;  2CW7 A;  4QLC U;  1S7A A;  1ZYR F;  2MA3 A;  2VQL A;  3FXU A;  3BG9 A;  2KP6 A;  3K9T A;  4HX4 A;  2RGV A;  2E36 A;  1ZGA A;  2VJJ A;  1FOK A;  2DA2 A;  5CVV A;  2V7F A;  3M8F A;  4NC7 A;  1IUF A;  3K0L A;  3KLN A;  3SZP A;  3ZQI A;  1BR2 A;  4YFX F;  4NNJ A;  3R0J A;  4DZP A;  4N4O B;  3IHU A;  2H1L A;  4PK4 A;  2NVY J;  3DPL C;  4F55 A;  2JWT A;  4CA0 A;  3CCU I;  2OV7 A;  2JPC A;  4F93 B;  2EFW A;  1YHQ I;  1MBK A;  3HHH A;  2O7O A;  4Y33 A;  4HV6 A;  3IAS 2;  1TQI A;  3SZT A;  5L3F A;  2R7V A;  2HFH A;  3Q0V A;  1U9N A;  4KIG A;  2W84 A;  5GTH C;  2PLY A;  2XIG A;  1X1D A;  2R7R A;  4X6A J;  3OR2 C;  1T0F C;  4L9J A;  2O03 A;  2EV5 A;  2GOM A;  3CUQ C;  4C30 A;  4IHX A;  3JRF A;  2P5L C;  2XSJ C;  1X3Z B;  4BL0 B;  5EJC A;  3R4K A;  1UHS A;  2HQR A;  2BBY A;  1IXS B;  2DJN A;  1FSH A;  2FQ3 A;  1VFC A;  1ZGJ A;  5ILU A;  4A3I J;  2X1D A;  3QP5 A;  3BQZ A;  4ZTF A;  2CQ7 A;  3S3O A;  2L4M A;  3E7L A;  4IRH A;  3A01 B;  5KK1 A;  4MFE A;  3WGH A;  1OCP A;  2VBZ A;  3K69 A;  1JTY A;  4ESJ A;  1OKR A;  2KFD A;  1S9H A;  3F6V A;  1RR7 A;  3HRT A;  2CYY A;  2XAH A;  3FXQ A;  3LSH A;  3M8J A;  1IW7 F;  4GFB A;  1FMW A;  4XKW A;  3OS1 A;  2TRT A;  1MH4 A;  1SD6 A;  2A5W A;  3H36 A;  1KYW A;  1Z67 A;  4OMY A;  4XID A;  1T98 A;  5JHF A;  3H5A A;  3V7R A;  3OY9 A;  2IGN A;  2R7D A;  3CMY A;  1IRZ A;  3TP0 A;  1BI2 A;  2XGE A;  3CLO A;  2JZY A;  1FLI A;  4A3E J;  1X1A A;  2RAE A;  1XN7 A;  1BN5 A;  2FOW A;  2JSC A;  1UHM A;  3BRO A;  4A3C J;  1VND A;  2P6T A;  2E1N A;  4ZZD A;  4Z2Y A;  1ZEL A;  1RC9 A;  2DTR A;  1JUM A;  4P9F A;  4I01 A;  2GOX B;  1HDP A;  2VJ5 A;  3I4P A;  1MNM C;  5EZH A;  2P81 A;  4PGH A;  4UVC A;  4D1Q A;  4KJZ A;  1XMA A;  1X1C A;  3LA2 A;  1GVD A;  1TLH B;  5JHU A;  2IA0 A;  2E1C A;  1ZK8 A;  3TW7 A;  3U9G A;  4RS8 A;  1DDN A;  3T5X A;  2ICW G;  3OV8 A;  1WRJ A;  5J6X A;  3H9G A;  2PJR A;  4HF1 A;  1F9N A;  5BPI A;  3KP4 A;  1BJA A;  1MW7 A;  2CRG A;  3RKX A;  3WG9 A;  4OIQ F;  1KU7 A;  1FP1 D;  4EJV A;  3FK7 A;  2K9N A;  3OIP A;  5GAH J;  4CDG A;  2Y69 H;  4BAC A;  4Q5S F;  1VQ6 I;  2YU9 J;  1O57 A;  4XOT A;  3V7C A;  3TOB A;  1BM9 A;  1KON A;  3BR1 A;  3SHF A;  2IS6 A;  1TWF J;  3QU6 A;  4I09 A;  5LD2 C;  5TJJ A;  1ACI A;  4N4N B;  1VQ8 I;  1PDN C;  2HKX A;  1W36 D;  1ETO A;  2DFH A;  3CDH A;  2HYJ A;  2ZO4 A;  3KP5 A;  1RUO A;  4FTH A;  4L18 B;  1IN4 A;  3O8H A;  4GYG A;  4TV7 A;  3F23 A;  2BVM A;  1MJB A;  5M3M J;  1PUF A;  1B59 A;  3CJQ B;  3HPH A;  4QPO A;  2I10 A;  2Z33 A;  2IA1 A;  3SXY A;  5HDG A;  1UHW A;  2YSR A;  5FB2 A;  3F8N A;  3S2W A;  3HKZ A;  1U5T B;  5ILS A;  5H6Q A;  5FD6 A;  1SFX A;  4HST A;  3G3Z A;  2ZB9 A;  3G1L A;  1Y39 A;  3DBL B;  3H5R A;  1HQC A;  2JUC A;  2K86 A;  4ZYA A;  2QQB A;  2KL4 A;  5IYB J;  4UUS A;  2IAI A;  2X0L A;  3JRI A;  3LST A;  4HX7 A;  1ON1 A;  2Q8K A;  3BZ6 A;  4IL6 C;  1GXQ A;  4V2G A;  1G3W A;  1FT9 A;  4I76 A;  2OZ6 A;  3GTO J;  2WY8 Q;  4E6K G;  1ZH5 A;  2R7T A;  1I50 J;  2Y0S N;  1G3Y A;  4CZZ A;  1XSD A;  2MW8 A;  2FX0 A;  1MMD A;  3E97 A;  3WTW C;  2MD0 A;  2HU9 A;  2O6G E;  2CH0 A;  2X85 A;  2DMQ A;  2XAG A;  4JOM A;  1GVJ A;  3WU1 B;  2A6E F;  3A4C A;  2Q0O A;  2ZSH B;  2P5V A;  3Q9S A;  4L0Z B;  1HLV A;  2Z99 A;  4YEJ A;  5E8G A;  3LQR A;  4QPQ A;  2VKE A;  4ZH4 F;  5LEJ A;  4BE1 A;  1TL8 A;  4ZYE A;  4KDP A;  4IPA A;  1B8I B;  1VQM I;  4E7L A;  1RKT A;  3RZO J;  4G7O F;  4C3I J;  1W4M A;  3KEY A;  3AG1 H;  1JJ6 C;  1FBU A;  2HZD A;  2JPB A;  2EIL H;  1BA5 A;  5DM7 F;  1FP2 A;  3LA7 A;  4FX0 A;  3S1N J;  5IP6 A;  1R71 A;  2JJ7 A;  1HW2 A;  5JLX A;  2KIQ A;  3S1M J;  3HOV J;  4QTR A;  2XGD A;  4PSX A;  1S72 I;  1LEA A;  1QZE A;  3T1B A;  1YTY A;  3AG3 H;  5L3E A;  1DGW Y;  3FXL A;  3ML6 A;  4XN0 A;  5HLG A;  3W2W A;  5GAE J;  1FYM A;  4KFC A;  2ZJQ F;  4J00 A;  4AD9 A;  2KRC A;  2Y31 A; 
#chains in the Genus database with same CATH homology
 1G3S A;  2DPD A;  1HXD A;  1T0F A;  2FNA A;  3CUQ A;  2VBY A;  1BI1 A;  2FE3 A;  4XSZ F;  5FO5 A;  1GXP A;  1TBX A;  2MH2 A;  3GVA A;  2RC4 A;  3BOQ A;  4P9U A;  4DQ2 A;  2CO5 A;  1IXR C;  1F5T A;  1UB9 A;  3KEO A;  3CO6 C;  4Y13 A;  3HTS B;  1WSU A;  2STW A;  1OMI A;  2JT1 A;  1AWC A;  4LLN A;  1B1B A;  2ZNY A;  3T8T A;  4A0X A;  3PFI A;  2HKO A;  4LG0 B;  3K1M A;  1A04 A;  2EFP A;  4OMZ A;  4LGW A;  3PQJ A;  4RGR A;  1TNT A;  2OQR A;  4ON0 A;  1R5G A;  1SD5 A;  3NEU A;  1V3F A;  3FMQ A;  2DQR A;  1USS A;  1I1G A;  2XVC A;  4MQ9 F;  4EMS A;  2M87 A;  1KYZ A;  2PN6 A;  1DP7 P;  3J80 Z;  2ETH A;  3E6D A;  1L3L A;  2IRF G;  2OD5 A;  1JGS A;  1U5T C;  4R79 A;  5JI6 A;  5BOX A;  3MZY A;  1LEB A;  1FC3 A;  2MD5 A;  5AON A;  5HS9 A;  1MZB A;  3GW2 A;  4BHB A;  3LAP A;  1J75 A;  2KKO A;  2L54 A;  5LRR A;  4EV0 A;  3SFZ A;  2QM3 A;  2H27 A;  1LQ1 A;  4HV5 A;  2PMU A;  4U7B A;  3HYI A;  3FHZ A;  3R60 A;  6PAX A;  3RI4 A;  3VOD A;  2G9W A;  1TQP A;  4U88 A;  2M1B A;  4U0Y A;  3I53 A;  4M71 A;  2VC1 A;  1LB2 A;  2VE8 A;  3G73 A;  5DEQ A;  3H92 A;  4CXF A;  4WXC A;  4A5M A;  5FLX Z;  4O5V A;  2RDP A;  4HZF A;  1K78 B;  1MJ9 A;  4KNY A;  2JRT A;  1BI0 A;  3FM3 A;  3U2R A;  2D1V A;  2GQQ A;  4A6E A;  4LB5 A;  4EM2 A;  5FD5 A;  3WE2 A;  1YW7 A;  4N9I A;  4EJT A;  2UXX A;  5E1W A;  4AIJ A;  5DD4 A;  3HRU A;  2VT2 A;  5EEH A;  3JTG A;  4IHS A;  2F5E A;  2GIV A;  4E70 A;  4F7Z A;  5A2Q Z;  2RN7 A;  5JVT A;  1LVA A;  4EJU A;  3QRF F;  2QZ8 A;  1OYY A;  2ZKZ A;  4RGU A;  1CF7 B;  3E3V A;  2WWY A;  4LB6 B;  5IT9 K;  1IAW A;  2V1U A;  1W7P B;  4GXO A;  5IT3 A;  1J5Y A;  3VB2 A;  2UWM A;  3WTS C;  3B02 A;  3KE2 A;  3MWM A;  2TDX A;  3EET A;  3QPT A;  1RI7 A;  1O7L A;  3JSO A;  2NAZ A;  4KUM A;  2GXG A;  2ISY A;  5F6F A;  2XKP A;  4G94 A;  1P4A A;  4R8H A;  4RAZ A;  3MEX A;  1KQ9 A;  1JE8 A;  5D4S A;  1Z05 A;  4YFK F;  3K2Z A;  4UV8 A;  1XCV A;  1EH8 A;  1PP8 F;  5LHH A;  1X3U A;  2L4A A;  5D6F A;  2EA4 A;  2GZW A;  4HLY A;  3ECO A;  1VTN C;  1B4A A;  3IWZ A;  1MD0 A;  4YII A;  3EUH A;  4L9V A;  1EH7 A;  1R5H A;  5HLH A;  4XRF A;  1R00 A;  3GX4 X;  2VN2 A;  2NRA C;  2P5K A;  5DCM B;  3IKT A;  4ZZL A;  4WCG A;  1QQI A;  3I0T A;  1FY7 A;  4PGG A;  4KIC A;  1U5T A;  2FBH A;  2D45 A;  4KMU X;  4HDU A;  5LRS A;  3CUO A;  2IA2 A;  2RQP A;  4EJW A;  5JFR A;  4Q4Z F;  1P4W A;  4Y17 A;  1YW8 A;  5CVI A;  4I02 A;  2LSO A;  2EV0 A;  4IRI A;  4UHT A;  2V1D A;  3O2P E;  2IP2 A;  4B8X A;  1IN7 A;  4A6D A;  2FXA A;  3LAJ A;  3DKW A;  4ENK A;  1O7F A;  2STT A;  3F6O A;  3FZV A;  3E5U A;  3C1D A;  2V6C A;  4EVI A;  4HF2 A;  3TO9 A;  4ZYG A;  3FMR A;  3CTA A;  1QO0 D;  4LK0 F;  1MDM B;  4I7H A;  4NHJ A;  1U78 A;  3ELK A;  3FM5 A;  4I0A A;  4PZJ A;  5CVR A;  2MC3 A;  5IT9 Z;  3L7W A;  2A69 F;  4HX8 A;  4AIK A;  4KN7 X;  4MEY F;  4DNC A;  2ACJ A;  3COA C;  4N0B A;  1WI9 A;  2KRF A;  4M9S A;  3GYH X;  4WXD A;  4UNO A;  1O3Q A;  5LHG A;  1BC7 C;  1HW5 A;  1R1T A;  1O3T A;  1BBY A;  2VT3 A;  2V9V A;  1YQA A;  2O3F A;  4HF0 A;  4RGX A;  2CG4 A;  2Z5U A;  1UFM A;  3WU0 A;  1K6O A;  2GXB A;  4BNC A;  1XGN A;  1SMT A;  4IF4 A;  3I54 A;  5CLS A;  3I5U A;  3HSR A;  1NHA A;  4UUV A;  3DXJ F;  4G6Q A;  5D6E A;  2RV8 A;  4MNU A;  5LBQ A;  2FU4 A;  2A5Y B;  2IVM A;  2VE9 A;  1S6L A;  4LG0 A;  5ILV A;  4Q47 A;  1W5S A;  3KCC A;  2PG4 A;  4OIO F;  3JAM Z;  3Q9V A;  3ABT A;  1YLF A;  2IT0 A;  4U7D A;  4MQV A;  1ZAR A;  2XAS A;  2F2E A;  4LMY A;  3HHG A;  3REO A;  2NNY A;  1XB4 A;  2CFX A;  4XLP F;  2R7F A;  3R6S A;  2VXZ A;  2IPQ X;  1D8J A;  2MH9 A;  4MGR A;  5LGT A;  1OPC A;  4CIC A;  4ENM A;  5HS7 A;  4FHT A;  2XHK A;  3J7A O;  2XKO A;  1QNT A;  2D1H A;  1S3J A;  2AS5 F;  2CSO A;  2KJB A;  4KIB A;  2W24 A;  4YIF A;  2DAO A;  1Y0U A;  2L3D A;  1LDJ A;  1U8R A;  2DU9 A;  4HW0 A;  3IRR A;  1HKS A;  4WXH A;  3GLX A;  3F8F A;  4KYW A;  1Z6R A;  2YX7 A;  4LK1 F;  2Y75 A;  5K5R A;  3TDU C;  2ZBK A;  3FWE A;  4S05 A;  4R1H A;  2E7W A;  5D8L B;  3P7N A;  2XGX A;  3W6J B;  2XAF A;  2Q2E A;  1BI3 A;  2P7C B;  3EQL F;  1K78 A;  4A2U A;  1ZN2 A;  1FYL A;  1TQM A;  5BPD A;  4A0Y A;  1T38 A;  4BYY A;  2DI3 A;  3HOS A;  3RYR A;  4BH9 A;  2QQA A;  2EA2 A;  1Z7U A;  1S7O A;  2K7L A;  5E1Z B;  5AIP A;  4GGG A;  5J8F A;  1GHC A;  1IRG A;  1T2K A;  3L9F A;  1MKM A;  2UXN A;  4BHP A;  2W85 A;  2Z3Y A;  3GWZ A;  4EQQ A;  1ZRE A;  3HRM A;  3D0S A;  2J5O A;  5EEG A;  1D5V A;  3GFJ A;  3FMS A;  2RNJ A;  5CJ9 A;  2DT5 A;  1ZRF A;  5D4R A;  4G8X A;  1ZG1 A;  1H9G A;  2QQ9 A;  2EWN A;  2Z9O A;  1CF7 A;  3V8K A;  3F72 A;  3SQN A;  1W7P A;  4HAM A;  3VEP A;  3Q5F A;  3EYY A;  3MQ0 A;  3FF5 A;  2NYX A;  3RYP A;  2GA1 A;  3ZN0 A;  3RKW A;  3H3Z A;  4A12 A;  1KU3 A;  3BPX A;  1MGT A;  2HQN A;  1QPM A;  1RNL A;  3F22 A;  1FPQ A;  3E6C C;  2M30 A;  2YU3 A;  4HQE A;  3V8L A;  1RZ4 A;  2QVO A;  1OYW A;  4XBF A;  2IJL A;  3JW4 A;  1BOA A;  2IW5 A;  2UZK A;  4RB3 C;  4L5I A;  3T0Y A;  1ZLJ A;  2A61 A;  3CJN A;  3IKV A;  3RPU A;  3WTY C;  3OOP A;  2H09 A;  1B9M A;  3HSF A;  2FBI A;  3EDP A;  2KIM A;  1I5Z A;  1G4D A;  2HEO A;  2A07 F;  2CW0 F;  2RKH A;  4M6Y A;  3TKY A;  5E1X A;  3QU3 A;  1SFU A;  3K1P A;  1F4K A;  1D3Y A;  4MEX F;  2PI0 A;  2KJC A;  4IVN A;  2QWW A;  1IXC A;  2QBY B;  5DCM A;  5D5W B;  3O6B B;  3RKY A;  3LFK A;  2XAQ A;  1LDD A;  2HTS A;  3IC7 A;  1W5T A;  5HDK A;  5DUI A;  5F1R A;  5ICE A;  4B09 A;  1D8K A;  2BV6 A;  5D5X B;  3U1D A;  1Z9C A;  1SD4 A;  3QPH A;  3HUG A;  4P96 A;  2VC0 A;  4BXU A;  4ZYD A;  3WTX C;  3HTU A;  3RPQ A;  3W6K B;  5JR3 A;  1XMK A;  4OU0 A;  2CWE A;  5KVR A;  2PBI A;  4KIF A;  3IWF A;  1BIA A;  1E2X A;  4WX9 A;  1DUX C;  3KZZ A;  4RB1 A;  1Z91 A;  2ESH A;  4AVP A;  1O3S A;  3VOE A;  1Z1D A;  2Y48 A;  2LF8 A;  2VOD A;  1YIO A;  3C18 A;  4MTE A;  2O0Y A;  1EV7 A;  1W7P D;  1XGS A;  4QWQ A;  5DD8 A;  2HYG D;  2GA2 A;  1WKM A;  4CYD A;  2O61 A;  4N9H A;  3V7S A;  5BS6 A;  4Y15 A;  2OA4 A;  5DDG A;  4OIN F;  2WV0 A;  2W57 A;  2EK5 A;  1ZHF A;  4HYE A;  1JXS A;  4EGY A;  3ZMD A;  3MZH A;  3BJ6 A;  3M7G A;  5L3C A;  1IRF A;  4IJA A;  3FXR A;  1TW2 A;  3RJP A;  4M73 A;  4CGZ A;  2P8T A;  1O3R A;  3M8E A;  3I71 A;  1LJ9 A;  3L2C A;  1C0W A;  2DBB A;  1J2X A;  2EFN A;  3HOT A;  3P9K A;  2CGP A;  5E8I A;  4CHU A;  2G7H A;  3WTU C;  2OU2 A;  3P9C A;  3DV8 A;  4OIR F;  3RIR A;  5DCF A;  2M45 A;  2FML A;  2GAU A;  3I59 B;  3BY6 A;  4G7H F;  5D5V B;  2A6H F;  1P92 A;  2EV6 A;  4L9T A;  3C3W A;  2VBW A;  2BGC A;  2B0L A;  1QZY A;  3ULQ B;  1U3E M;  2CQK A;  1IZ1 A;  2P7V B;  3J81 K;  3GFM A;  3BWG A;  2ZFW A;  5LGN A;  1HSJ A;  2A3S A;  3GEZ A;  1XGO A;  5L3D A;  2G7U A;  4M6X A;  3BJO A;  4KT5 C;  2P6S A;  4P5O A;  1K7A A;  3GZ6 A;  2L01 A;  2QUF A;  5ERI A;  2K4B A;  3V4G A;  1OYI A;  3KP6 A;  3ZMV A;  4GYI A;  1KU9 A;  1EH6 A;  1STZ A;  2RVC A;  2K27 A;  1G6N A;  2DK8 A;  1WWX A;  1XGM A;  4IRG A;  1IF1 A;  3I58 A;  3KLO A;  1S8N A;  4XLN F;  5TRD A;  2KIU A;  4GO1 A;  3LA3 A;  3I64 A;  4Q48 A;  2HR3 A;  3BP8 A;  4ENN A;  4ESF A;  4EGZ A;  2XV4 S;  1SFE A;  3BPV A;  2V1X A;  2HS5 A;  4G9Y A;  5DYM A;  4L5J A;  1JHF A;  2ZME B;  4L0Y B;  3HIF A;  1FX7 A;  2PEX A;  5CVJ A;  2FSW A;  3F8B A;  3T8R A;  2DLL A;  1I6X A;  1R1V A;  3HRS A;  1L0O C;  3F8C A;  3KZY A;  1KGS A;  2ZXJ A;  4U0W A;  2MBF A;  2HDC A;  1P4X A;  2DQL A;  1ZRC A;  3ZPL A;  4MHG A;  2E7X A;  4NQW A;  4MTD A;  5DUK A;  1UST A;  1R22 A;  2M8E A;  3TOA A;  1H0M A;  4YG2 F;  1ZG3 A;  4FT8 A;  4H0E A;  4WK8 F;  3R61 A;  1S29 A;  4ZYH A;  2NNN A;  1P6R A;  1XSV A;  4O6J A;  2FEZ A;  2WTE A;  3RDI A;  2VOP A;  3KET A;  2LNB A;  1QBJ A;  1PP7 U;  4KMF A;  3L09 A;  1R7J A;  5F64 A;  3O3K A;  1R36 A;  3ZMT A;  4EM1 A;  3ZMZ A;  4AIH A;  3DF8 A;  3EYI A;  1ZAO A;  2XRN A;  3J81 Z;  3M1E A;  4D0P A;  4ENJ A;  2EFQ A;  4ASN A;  4KN4 X;  1XD7 A;  3CO7 C;  4M72 A;  4K2E A;  1KU2 A;  1TTY A;  1U2W A;  5DV5 A;  2H94 A;  4EJO A;  1YW9 A;  1ONV A;  2ELH A;  2FBK A;  3ZP5 A;  3QP6 A;  4M74 A;  2QBY A;  3GO5 A;  2FA5 A;  4LLG F;  2DO7 A;  4G6D A;  3F3X A;  3GF2 A;  1U6G A;  3GFL A;  3ZMS A;  1UCR A;  1J7K A;  4S04 A;  1JHH A;  2MLG A;  3IL2 A;  1YS6 A;  1FBQ A;  2VBX A;  2J5P A;  3TQN A;  3J80 K;  5K1Y A;  3D5L A;  2OBP A;  4HLX A;  2ZJ2 A;  1R23 A;  4PDK A;  2K02 A;  2D2W A;  1IUY A;  2H6C A;  2FNP A;  1WQ2 A;  3KFW X;  2W25 A;  4FX4 A;  2QEN A;  3LWF A;  3MFK A;  2HYF A;  3TDZ C;  2AXL A;  3WGG A;  1PUE E;  2ISZ A;  1J0R A;  1FNN A;  5H6R A;  2DPU A;  5E17 F;  5AIQ A;  2ZNZ A;  3H3U A;  1TNS A;  2WC2 A;  3QAH A;  3MCZ A;  2PMH A;  2O8X A;  5BMZ A;  3B73 A;  1F1Z A;  1J9I A;  5FLX K;  3ZQ7 A;  4ETS A;  5ICC A;  3QOP A;  1XSX A;  3E6M A;  1LDK B;  2XUB A;  3WE3 A;  3LQQ A;  2NS0 A;  3C7J A;  1V4R A;  1YS7 A;  3TO7 A;  4JBA A;  4OIP F;  5HDN A;  5K5Q A;  1T6S A;  2KIF A;  4HOB A;  1YO5 C;  3HSE A;  5E20 A;  2GWR A;  2XAJ A;  2HTJ A;  2QYO A;  4G7Z F;  2YPR A;  1SAX A;  4I0B A;  3E6B A;  2JTV A;  5A2Q K;  1YG2 A;  2LKP A;  3I59 A;  1RUN A;  2EFO A;  2COM A;  1SMY F;  3IRQ A;  2OZU A;  4HA8 A;  3NRV A;  1OR7 A;  1RIO H;  3BJA A;  3WOD F;  1Q1H A;  1QGP A;  3R0A A;  3DFG A;  3KP3 A;  1XDU A;  1TW3 A;  3ZMU A;  5E18 F;  5HLI A;  2OQG A;  4HDV A;  2A68 F;  3ABU A;  4LFU A;  3K1N A;  2HOE A;  5HVQ C;  2L02 A;  5L3G A;  3ROU A;  2QLZ A;  3AAF A;  1ZG5 A;  2ADU A;  4JQF A;  4HBL A;  1ZLK A;  1DPR A;  4PCQ A;  2BE5 F;  2BEO A;  3VFZ A;  4BAY A;  2OAZ A;  3E5Q A;  1FSE A;  4U0V A;  1ULY A;  1HW1 A;  1IN8 A;  2BYV E;  4YFN F;  1REP C;  3F21 A;  1SD7 A;  2LDU A;  4O3M A;  1IN6 A;  4I2O A;  1FYK A;  2HWV A;  1KQ0 A;  1E17 A;  3DQV C;  3FX3 A;  5D8K B;  2VON A;  1T39 A;  1HKT A;  3JSP A;  2ESN A;  1R1U A;  1KQ8 A;  2Y0M A;  5CYV A;  4P55 A;  2MLK A;  3KP7 A;  2HZT A;  3F8M A;  1LNW A;  2DK5 A;  4GCV A;  2PJP A;  4IXA A;  1BC8 C;  1AOY A;  1MDM A;  4M9X A;  4JK1 X;  5LEK A;  4CO8 A;  2H6B A;  1YYV A;  1H9T A;  1ON2 A;  3KP2 A;  2V79 A;  4NB5 A;  2FF4 A;  2X4H A;  1XDS A;  2ZME A;  5ED4 A;  3ISP A;  5CVU A;  1ODD A;  5H20 A;  4EM0 B;  1DPU A;  4LLL A;  3NQO A;  2FMY A;  2PQ8 A;  3GZ5 A;  2EJR A;  5FFX A;  5ICG A;  1ZRD A;  3M9A A;  3KEQ A;  1FWZ A;  1QZZ A;  1MJA A;  2P4W A;  4OOI A;  3V8J A;  4UVB A;  1BIB A;  3GUD A;  1B9N A;  5BQT A;  3GXO A;  3ECH A;  4RB0 A;  3DPT A;  1FZP B;  2LF7 A;  3RTR A;  2VOO A;  1Z6T A;  3CUQ B;  4UXN A;  2C6Y A;  2K4J A;  3JTH A;  3GFI A;  4RGS A;  1I1S A;  1K79 A;  1HKQ A;  2M5W A;  3BDD A;  3MAJ A;  2DFI A;  1R58 A;  5L3B A;  1FBS A;  2F5D A;  5FFZ A;  4XSX F;  2R3S A;  1J59 A;  2HGC A;  5HS8 A;  4WWC A;  5J8C A;  2FRH A;  3L00 A;  1G3T A;  4A5N A;  3WTV C;  3ZN1 A;  1YFH A;  1I27 A;  5LGU A;  4BQA A;  1CGP A;  5ICF A;  4HQM A;  4I98 B;  4A0Z A;  4LJZ F;  3N97 A;  1IN5 A;  3TO6 A;  2DW4 A;  4LD5 A;  3P9I A;  3WTT C;  3JAM K;  2YX4 A;  5LLQ A;  4UV9 A;  3PQK A;  4ESB A;  2XRO A;  3WGI A;  2ZCW A;  4BHC A;  4AWX B;  3WTZ A;  1B6A A;  3E5X A;  4UVA A;  1HBX G;  3DEU A;  4IHT A;  4L9N A;  1KA8 A;  3N4M A;  3ERE D;  5K5O A;  4M9Z A;  4RB2 C;  3TGN A;  1XCB A;  5LHI A;  2F5F A;  2YR2 A;  4KA4 A;  2PFB A;  1HST A;  4RAY A;  2FOK A;  5FGM A;  3DP7 A;  2EB7 A;  1P2F A;  5D5U B;  4WF2 A;  5HOO A;  2F5C A;  4QLC U;  1S7A A;  1ZYR F;  2MA3 A;  3FXU A;  4HX4 A;  3K9T A;  2RGV A;  1ZGA A;  1FOK A;  5CVV A;  3M8F A;  3K0L A;  3KLN A;  3SZP A;  4YFX F;  3R0J A;  3IHU A;  3DPL C;  2JPC A;  2EFW A;  3HHH A;  4HV6 A;  1TQI A;  3SZT A;  5L3F A;  2HFH A;  4KIG A;  2W84 A;  2PLY A;  2XIG A;  4L9J A;  2O03 A;  2EV5 A;  3CUQ C;  2P5L C;  3R4K A;  2HQR A;  2BBY A;  1IXS B;  1FSH A;  2FQ3 A;  1ZGJ A;  5ILU A;  3QP5 A;  2L4M A;  4IRH A;  5KK1 A;  3WGH A;  2VBZ A;  3K69 A;  4ESJ A;  1OKR A;  3F6V A;  3HRT A;  2CYY A;  2XAH A;  3FXQ A;  1IW7 F;  1SD6 A;  1KYW A;  4OMY A;  1T98 A;  3V7R A;  2R7D A;  1BI2 A;  3CLO A;  2JZY A;  1FLI A;  1XN7 A;  1BN5 A;  2JSC A;  1UHM A;  3BRO A;  2P6T A;  2E1N A;  4ZZD A;  4Z2Y A;  2DTR A;  4P9F A;  4I01 A;  3I4P A;  4PGH A;  4UVC A;  1XMA A;  3LA2 A;  1TLH B;  5JHU A;  2IA0 A;  2E1C A;  3U9G A;  4RS8 A;  1DDN A;  3T5X A;  3OV8 A;  1WRJ A;  5J6X A;  4HF1 A;  1F9N A;  5BPI A;  3KP4 A;  1BJA A;  3RKX A;  3WG9 A;  4OIQ F;  1KU7 A;  1FP1 D;  4EJV A;  4CDG A;  4Q5S F;  1O57 A;  3V7C A;  3TOB A;  1BM9 A;  3SHF A;  3QU6 A;  4I09 A;  5TJJ A;  1PDN C;  2HKX A;  3CDH A;  2ZO4 A;  3KP5 A;  1RUO A;  4L18 B;  1IN4 A;  4GYG A;  4TV7 A;  3F23 A;  1MJB A;  1B59 A;  2Z33 A;  2IA1 A;  3SXY A;  5HDG A;  1UHW A;  2YSR A;  5FB2 A;  3F8N A;  3S2W A;  1U5T B;  5ILS A;  5H6Q A;  5FD6 A;  1SFX A;  3G3Z A;  1HQC A;  2K86 A;  2QQB A;  2X0L A;  3LST A;  4HX7 A;  1ON1 A;  2Q8K A;  3BZ6 A;  1GXQ A;  1G3W A;  1FT9 A;  2OZ6 A;  1ZH5 A;  1G3Y A;  4CZZ A;  1XSD A;  3E97 A;  3WTW C;  2O6G E;  2XAG A;  1GVJ A;  3WU1 B;  2A6E F;  2Q0O A;  2P5V A;  3Q9S A;  4L0Z B;  2Z99 A;  5E8G A;  3LQR A;  4ZH4 F;  5LEJ A;  4ZYE A;  4KDP A;  4IPA A;  4G7O F;  1W4M A;  1FBU A;  2JPB A;  1FP2 A;  3LA7 A;  4FX0 A;  1HW2 A;  1LEA A;  3T1B A;  1YTY A;  5L3E A;  3ML6 A;  5HLG A;  1FYM A;  4KFC A;  4AD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...