5D5WB

Crystal structure of chaetomium thermophilum skn7 with hse dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
94
Chain Sequence
b'SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRPYGRDAWEFKHPEFRADRKDNLDNIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HSE DNA
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transcription
total genus 23
structure length 94
sequence length 102
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5wB00
1ZHFA 1ON2A 5FO5A 1G4DA 1P2FA 4RGSA 1I6XA 1DPUA 3T5XA 4HLXA 3TDUC 4UXNA 4CYDA 2Y75A 3RJPA 5BOXA 4IRGA 2V1UA 3FXRA 3LQQA 3HTSB 1EH8A 1O7FA 3V8KA 4ZZLA 1MKMA 2JTVA 2RC4A 1RIOH 1TNSA 3J81Z 4F7ZA 3L09A 4M72A 4LG0A 2QENA 3MEXA 1G6NA 2YX7A 4G6QA 3QU3A 1GXQA 2MA3A 5E20A 5DCFA 4WF2A 4HDUA 4HX4A 3C18A 3MFKA 2EFOA 3F21A 1IN6A 2GXBA 2NYXA 2MH2A 1ONVA 4O3MA 1BM9A 3ERED 2E7WA 1XGOA 4PGGA 3HSEA 1TQPA 1Z9CA 3FHZA 1ZGAA 5H6QA 1UHWA 2YU3A 3E6BA 3EYIA 5HS8A 5HLIA 4EJUA 4AIJA 3I0TA 2KKOA 1ZRDA 4LB6B 2F5DA 3JTGA 1JE8A 3FM3A 1BI3A 2P7CB 4XSXF 1KQ8A 2PMHA 5HS7A 5L3EA 3M1EA 1J0RA 1FLIA 2VT3A 4EJVA 1TBXA 2OAZA 2BBYA 2H94A 4NHJA 3WODF 5CVRA 2VC0A 2XHKA 2EV0A 2XAQA 3HRTA 1SMTA 3P9KA 1SD7A 2K02A 3CO6C 2YX4A 1FZPB 4GXOA 1SFEA 3P9CA 1HW2A 3LWFA 4HOBA 2ZNZA 4Y17A 4JK1X 4B09A 3PQKA 2QWWA 2H6CA 2ZNYA 2QBYA 2VC1A 1XCBA 2TDXA 3T8RA 2IJLA 3WTZA 1Z1DA 2HKOA 2O6GE 1G3SA 3FF5A 5DD4A 2K7LA 3DP7A 4MEXF 1LVAA 2AXLA 5DDGA 2M30A 5D4SA 2E7XA 4H0EA 4MHGA 1FP2A 1XN7A 3TKYA 1T6SA 3U1DA 3O3KA 3VB2A 5F6FA 3LAJA 5J8FA 2R7FA 4GO1A 2CGPA 4MQVA 4G7HF 2HR3A 2P7VB 4Q5SF 1S3JA 2PN6A 3GZ6A 2DPDA 4FT8A 2E1CA 4I09A 2MH9A 4KIFA 1FYMA 4IRIA 2STTA 1HW5A 3NQOA 2W85A 2ESHA 2F5FA 3LA2A 1HQCA 2XUBA 4HX7A 1MGTA 2HTJA 3D0SA 3HHGA 4E70A 5DD8A 1YG2A 3ZPLA 1O3RA 3SFZA 1FYLA 2EFPA 4G7ZF 4LD5A 5FLXZ 1FSHA 2WV0A 5ICEA 1FX7A 1JGSA 4IXAA 1K79A 5H20A 2FA5A 3CJNA 3SHFA 2GA1A 3KETA 1SMYF 3KP6A 2FRHA 3L2CA 4GCVA 3DQVC 5FFXA 3O2PE 2DPUA 5DCMB 2EB7A 4I7HA 2XROA 3BJ6A 4QWQA 1WQ2A 5CVUA 3R0JA 2YR2A 5HVQC 5BMZA 4ON0A 2VN2A 1QQIA 1H9TA 1RUOA 2VT2A 2LSOA 1DUXC 5CVJA 3GW2A 4FX0A 1T39A 3CUQB 2VE9A 2VODA 2CYYA 3RDIA 4ZYDA 3GZ5A 4RAYA 5E17F 4U88A 1LEAA 3MZYA 3SZTA 1XMKA 4M73A 3WU0A 2ZJ2A 3IC7A 1J9IA 1R1TA 1TNTA 2DK5A 5EEHA 4Q48A 1IUYA 2CG4A 5BPDA 2DT5A 4A6EA 3IKTA 5ILSA 3HOTA 3WTVC 4HQMA 1HKTA 1ZLJA 1QBJA 2R3SA 1HSTA 1HSJA 1Z6TA 3IHUA 2VBYA 4I0AA 5JFRA 1RI7A 4HAMA 1H9GA 4GGGA 3ZMUA 2ZMEA 3BPVA 4EMSA 4RS8A 4LB5A 3BY6A 3GUDA 1OKRA 5D8KB 5IT3A 2YPRA 1O3TA 4LG0B 4RB0A 2RDPA 5L3GA 3ROUA 1W7PD 4ZZDA 2HS5A 5AIQA 3F6VA 2AS5F 4AWXB 1YS6A 1R5HA 2XAFA 2M8EA 2EFWA 1K6OA 1JXSA 3TDZC 1FC3A 2HQNA 4S05A 1O57A 4GYGA 1BI2A 4MGRA 1L0OC 4ESBA 3V8JA 2XIGA 2IP2A 1QZYA 2ZXJA 2UZKA 3IRRA 1V4RA 3K1PA 4EQQA 4EVIA 2Z33A 3GFJA 5DYMA 2VONA 3WTSC 1R58A 4Q4ZF 3M8FA 2L01A 3E3VA 2CQKA 1XGNA 1S8NA 1B6AA 1T98A 4HYEA 3F23A 3RYRA 2JPCA 5D8LB 2OZUA 2Z99A 4MEYF 2KIUA 2RN7A 2F5CA 3ZMTA 4YFNF 1ZG1A 4A2UA 1T2KA 1I1SA 2JSCA 5AIPA 3MQ0A 1KYWA 5LRSA 1D8KA 3FXUA 4KN7X 3TO7A 2XAGA 4EJWA 2QBYB 2EFQA 1YTYA 3IL2A 4XRFA 3ELKA 4U0WA 3WGGA 4IVNA 3EQLF 4IHSA 5HLHA 2WC2A 3K69A 4EM2A 3GEZA 4CXFA 4BNCA 3GYHX 2JT1A 3R0AA 2L4MA 1IN5A 1H0MA 3WGHA 2HFHA 4R8HA 5CVIA 5ICCA 4KA4A 5HDGA 1U6GA 1YW9A 3ABTA 1RUNA 1R5GA 2P8TA 3DPLC 1LEBA 1B1BA 3SQNA 2H6BA 3JTHA 2OBPA 2H27A 1FPQA 4MTDA 3BROA 4K2EA 3RTRA 1DP7P 3C1DA 2ZFWA 2QQ9A 2OD5A 2HQRA 2GWRA 4UNOA 4ETSA 2PJPA 3H3UA 2XAHA 1RZ4A 1YW7A 2LF8A 2GQQA 3E5QA 4M9XA 1CF7B 1HXDA 5J8CA 2DLLA 3L7WA 5BS6A 3G3ZA 5ED4A 4RB1A 1U5TC 1WWXA 2CFXA 3DPTA 1BIAA 4KIGA 2A6HF 1A04A 2A68F 2EFNA 3J80Z 4HF2A 5K1YA 1OPCA 1QO0D 3HRMA 1ZGJA 3GXOA 2K27A 4Y15A 1Z05A 4HV6A 3JSOA 4NQWA 1B4AA 3R6SA 2DK8A 2ESNA 3CO7C 3AAFA 3KFWX 1S7OA 2QLZA 1SD4A 2OQRA 1U2WA 3E6MA 5AONA 1PUEE 3BP8A 1ODDA 1SFXA 5E18F 3TO6A 3JAMK 3DF8A 3KCCA 4A0XA 3HHHA 4P96A 1LDJA 3DEUA 3GFMA 4RGRA 2L54A 2HZTA 4RB3C 3LSTA 3FXQA 1I1GA 2Q2EA 2XVCA 3EETA 2STWA 3KEQA 1XGSA 4UHTA 3ECOA 4KT5C 2IA0A 2DW4A 1IZ1A 4MNUA 5LBQA 1ZG5A 1R23A 3BDDA 4AIHA 1F9NA 3U9GA 2RVCA 1QNTA 3DV8A 4CGZA 3I54A 1U78A 5CVVA 1IXCA 2IA1A 1YS7A 1XGMA 3LA7A 3EYYA 1ON1A 1U8RA 1W5TA 4P55A 5LHIA 3RKYA 4N0BA 3ZN1A 3GO5A 3F6OA 5D4RA 3ML6A 1E17A 5BQTA 1O3SA 1LQ1A 1IXRC 2MBFA 5L3FA 3EUHA 3CUQC 1U3EM 4AD9A 2HEOA 1MJ9A 1TQMA 1YLFA 5DUKA 3L00A 1EH7A 1KA8A 2LKPA 2DTRA 2CW0F 2PQ8A 1BI0A 1NHAA 3KZZA 3T0YA 4WXCA 4HLYA 1XB4A 3BWGA 3KLNA 3E5UA 5FB2A 2J5OA 1GHCA 1UHMA 2X4HA 4NB5A 5KK1A 3QOPA 4HW0A 3Q9SA 3E6DA 1BOAA 2BE5F 2PEXA 2O0YA 3ISPA 3TOBA 2NRAC 1ZYRF 3KP2A 2V6CA 3J81K 3HIFA 4DNCA 3ZMSA 3FX3A 5HDNA 1JHHA 1XSXA 2V1XA 5FD6A 5HS9A 1F4KA 1OMIA 2BYVE 2RGVA 4AVPA 3FMSA 1P4XA 2Y0MA 1Y0UA 1J2XA 2FU4A 3KP4A 4KMFA 1Q1HA 1SD5A 1SD6A 3L9FA 1J7KA 2O3FA 1D3YA 3JSPA 3I64A 4GYIA 3J7AO 3F22A 4UVAA 4LK1F 1TLHB 4M6XA 2EA4A 4A12A 4ENJA 5LGUA 5HDKA 2Q8KA 2PLYA 3HYIA 3ULQB 3SXYA 4BH9A 1S7AA 5JVTA 5D5VB 1E2XA 3TQNA 3KZYA 3FWEA 2X0LA 2VOPA 3WTXC 4HDVA 5FD5A 2JRTA 1QZZA 5HLGA 2FE3A 4BHPA 2FBHA 3NEUA 4HX8A 2NNNA 2H09A 4OIOF 5F1RA 3TO9A 4LFUA 3IKVA 3BJOA 5A2QZ 5ILUA 4RGXA 2FOKA 4ZYHA 1R1VA 4LGWA 2FNPA 4MQ9F 1WKMA 3P7NA 3LA3A 2ZBKA 2QUFA 1JHFA 3QP5A 3HRUA 1WI9A 3T1BA 3GFIA 3V4GA 2D1VA 4YG2F 5TRDA 2EV6A 4OIPF 4WXHA 4AIKA 1Z91A 3ZMVA 3I71A 2XAJA 4P5OA 2XRNA 4M74A 2GAUA 5DV5A 2QM3A 3LFKA 4BHBA 3F8MA 3RPUA 1OYIA 1TTYA 1XMAA 2D2WA 2A61A 1IRFA 2RKHA 3QAHA 2L02A 4IHTA 4ENKA 2IT0A 2OA4A 2PBIA 3RI4A 1AWCA 3PFIA 3K9TA 3TOAA 5CJ9A 1O7LA 2L4AA 1U5TA 2G7UA 2NNYA 3B02A 4L18B 2XGXA 4RB2C 4BYYA 4G7OF 2IW5A 5JI6A 2JPBA 3H92A 1XDSA 5FLXK 3E97A 3V7CA 4LMYA 5F64A 2P5KA 1LJ9A 2W25A 5TJJA 2Z5UA 5E8GA 4OMZA 2UWMA 1R7JA 3KLOA 2PG4A 2LF7A 4WXDA 2DAOA 3KP7A 3COAC 3CUOA 2A07F 1YQAA 4L0YB 1S29A 1D8JA 4ESFA 2XASA 1R36A 3V8LA 5KVRA 5D5UB 4U0YA 3M8EA 4I02A 4LLGF 1KQ0A 2YSRA 2B0LA 2F5EA 4YFXF 4OOIA 3REOA 1PDNC 4I0BA 3U2RA 1OYWA 2FBIA 1XSDA 4CICA 3C3WA 4B8XA 5HOOA 2Y48A 3HRSA 4KNYA 1KU3A 1UCRA 4FX4A 1K78A 3GVAA 1IRGA 2M87A 3BZ6A 2CWEA 3S2WA 1SFUA 5IT9K 2RNJA 5D5WB 1LB2A 4IJAA 4EM0B 4IPAA 1LNWA 1USTA 2HTSA 3GX4X 2MC3A 4KICA 1AOYA 4MTEA 2ZCWA 2V9VA 1YFHA 4UUVA 4YIIA 4M9SA 1FSEA 2VE8A 4R1HA 3KP5A 1USSA 1IAWA 3QP6A 1GVJA 2HKXA 1IW7F 2MD5A 4PZJA 4L9NA 3ZQ7A 2FEZA 1XDUA 1DDNA 3Q9VA 3O6BB 2PMUA 1ZAOA 4Y13A 3DFGA 3F8NA 3ECHA 3CDHA 3KP3A 2ACJA 1C0WA 1BJAA 1FWZA 3K1MA 5L3CA 3R60A 1YW8A 2Z3YA 4ASNA 1QPMA 1G3TA 2QQBA 3M7GA 5EEGA 1YYVA 1MDMA 4DQ2A 4P9FA 3E6CC 4A6DA 2D1HA 1IN8A 2K4JA 4LK0F 2GIVA 3WTYC 4EGYA 1J75A 1J5YA 3M9AA 1QGPA 1W4MA 4R79A 5LHHA 4KFCA 4KYWA 2GA2A 1OYYA 3H3ZA 2ZKZA 3C7JA 1W7PA 2P5VA 1XCVA 4ENNA 1TQIA 4A5MA 1P6RA 3OOPA 5E8IA 5K5OA 4BHCA 1W5SA 2M5WA 4EM1A 1CGPA 1XD7A 3I59A 4PCQA 4WWCA 4KUMA 3E5XA 1STZA 4XSZF 2FNAA 2OZ6A 4PGHA 1YO5C 4XLNF 1UFMA 1G3WA 4TV7A 1REPC 4BXUA 2PI0A 4G6DA 4A0YA 1LDDA 2MLKA 5ERIA 1S6LA 1EV7A 4JQFA 3G73A 5E1XA 4RAZA 3QPHA 3QPTA 1BC8C 6PAXA 2NS0A 2RQPA 4BAYA 3GWZA 2D45A 2CSOA 3CLOA 1FBQA 4BQAA 3K2ZA 3WTUC 2FXAA 3BOQA 4L9VA 2QYOA 1KU9A 1TW2A 2VBXA 2M45A 5ICGA 1YIOA 5JHUA 1R00A 5E1WA 3ABUA 1ZARA 1T38A 3VODA 1ZH5A 1Z6RA 1DPRA 1GXPA 4ZH4F 2FMLA 4I01A 2ZMEB 4ZYEA 4OIQF 2GZWA 2LNBA 2XV4S 2FF4A 2EA2A 4OINF 2J5PA 2P4WA 3VOEA 5LEKA 2EK5A 4UV8A 2ELHA 3OV8A 1FYKA 3GF2A 4M71A 3RIRA 5L3BA 1SAXA 1D5VA 2VOOA 5K5RA 4M9ZA 2OQGA 2W57A 2QVOA 1U5TB 5FFZA 4OMYA 2P5LC 3GFLA 4A0ZA 2XKPA 5LLQA 2A6EF 2ADUA 2EWNA 4YIFA 3I53A 4G8XA 4O5VA 3ZMZA 3W6JB 2GXGA 4HBLA 4RGUA 3CTAA 3IWFA 3WU1B 3F8BA 1F5TA 2LDUA 2FQ3A 4XBFA 3R61A 4L5IA 5LRRA 3T8TA 3IWZA 4G9YA 2KIFA 4I98B 1VTNC 3N97A 1R22A 3J80K 1RNLA 4FHTA 4KIBA 4HZFA 3P9IA 2BEOA 2KRFA 2HGCA 3EDPA 3HUGA 2VXZA 2IPQX 2NAZA 4PDKA 2Z9OA 1FY7A 5CYVA 1FBUA 1L3LA 1P92A 4HQEA 2WTEA 4P9UA 2ISYA 1IN4A 1CF7A 3W6KB 3GLXA 5D5XB 2COMA 2DQLA 1HKQA 2HYGD 2Q0OA 3JW4A 1FOKA 1BIBA 1ZRFA 3RKWA 1B9NA 4KMUX 4EJOA 1K78B 4HF1A 4CDGA 4JBAA 1MZBA 4EGZA 3F8FA 4WK8F 4CZZA 2A3SA 4U7DA 2HOEA 2XKOA 3VFZA 3SZPA 2O61A 4HV5A 3QU6A 2UXNA 3F3XA 3I58A 3WGIA 3WG9A 2OU2A 1EH6A 4HA8A 4D0PA 1T0FA 5FGMA 1TW3A 2A5YB 2O03A 4CO8A 2FBKA 4OIRF 3N4MA 2MLGA 4O6JA 2DU9A 3PQJA 1MD0A 4A5NA 2ISZA 5LHGA 5LGNA 3TGNA 3KEOA 5LGTA 4WX9A 2JZYA 3WE3A 4YFKF 1P4WA 4KN4X 3IRQA 3V7RA 4UVBA 1KQ9A 3DKWA 1FP1D 4EJTA 4L9JA 3RPQA 4LLNA 1KU7A 2PFBA 2RV8A 3VEPA 1ZLKA 2K86A 2DO7A 1FNNA 4CHUA 5IT9Z 1KGSA 1UB9A 1KYZA 4QLCU 3K1NA 2UXXA 2DFIA 1ZRCA 4LJZF 1IF1A 5J6XA 1KU2A 1I27A 4HF0A 1MDMB 3MZHA 2EJRA 1ZN2A 1P4AA 1R1UA 2EV5A 4IRHA 5ICFA 2WWYA 5H6RA 2BGCA 1FT9A 1BC7C 4Z2YA 3ZP5A 4UV9A 3FMRA 4KDPA 2L3DA 3FM5A 3V7SA 5E1ZB 3ZN0A 4ENMA 1W7PB 1BN5A 2ZO4A 5CLSA 2QZ8A 4XLPF 2BV6A 2KJBA 2W24A 2O8XA 1WSUA 3MAJA 3Q5FA 4N9HA 4N9IA 3HTUA 3ZMDA 3F72A 3I59B 1ULYA 1X3UA 2W84A 2KJCA 1LDKB 3K0LA 1PP7U 2VBZA 1IN7A 4Q47A 3KE2A 2A69F 3D5LA 2IA2A 2IVMA 1HKSA 3MWMA 4ESJA 5L3DA 3I5UA 1XSVA 5JR3A 3R4KA 4UVCA 2G7HA 1BI1A 1G3YA 2FMYA 3BJAA 4L5JA 3HOSA 5D6FA 1WRJA 2KIMA 2G9WA 5DEQA 2HDCA 4ZYGA 4L0ZB 3WTWC 4L9TA 3LAPA 3DXJF 1F1ZA 5D6EA 3JAMZ 1ZG3A 5ILVA 2M1BA 2R7DA 4IF4A 2E1NA 2P6SA 1I5ZA 4S04A 3FZVA 4EV0A 1B9MA 2V1DA 3HSRA 2C6YA 1ZREA 3F8CA 3BPXA 5DCMA 2P6TA 3WTTC 4LLLA 4G94A 5DUIA 5A2QK 2QQAA 2DI3A 2ETHA 4U0VA 2VBWA 5LEJA 1HW1A 1IXSB 1J59A 1B59A 2CO5A 4I2OA 4WCGA 3LQRA 2DBBA 3MCZA 2FSWA 3HSFA 3RYPA 3WE2A 3B73A 2F2EA 2HYFA 2DQRA 1MJBA 2IRFG 2HWVA 5BPIA 5K5QA 3I4PA 3RKXA 3CUQA 1O3QA 1FBSA 1OR7A 3QRFF 3FMQA 1V3FA 1Z7UA 2V79A 1HBXG 3NRVA 1PP8F 4M6YA 1MJAA 1K7AA 4U7BA 1BBYA 4OU0A 2K4BA
chains in the Genus database with same CATH superfamily
1ZHFA 2HPMA 1ON2A 5FO5A 1G4DA 1I50J 2L9NA 3HC7A 1P2FA 4JOMA 4RGSA 1I6XA 3PNYA 4D5FA 2DTZA 5C44J 3CCSI 3HOZJ 3ZQQA 1DPUA 3T5XA 4RAFA 2BHZA 2OTLI 4HLXA 3TDUC 4UXNA 4CYDA 2Y75A 1RESA 2DXIA 3RJPA 3CCRI 2LRDA 5BOXA 3VWBA 1X1AA 4IRGA 5FROA 3CP8A 2V1UA 1PUFA 3OYAA 4H4KC 3FXRA 4B44A 2KRCA 3LQQA 4BY7J 1E3HA 3HTSB 1EH8A 1ACIA 1O7FA 3V8KA 4ZZLA 1MKMA 2JTVA 2RC4A 4B48A 1RIOH 1I39A 1TNSA 3K6GA 3HOWJ 4HPQA 3J81Z 5F0FA 4F7ZA 3L09A 4M72A 4LG0A 1OCCH 1VQ5I 4KJZA 5JHFA 4XLHA 2R5ZA 2QENA 3LOCA 4D5CA 3MEXA 1G6NA 2YX7A 4G6QA 5EG0B 3QU3A 1GXQA 2MA3A 2WBMA 5M5XJ 3HOUJ 5CPRB 5E20A 5DCFA 4WF2A 1APLC 4HDUA 1VQMI 4HX4A 1FJLA 4UUSA 3SDGA 1G59A 3C18A 3MFKA 2EFOA 3F21A 5B1BH 1IN6A 5K7HA 2GXBA 2OPTA 2NXNB 4BJ5C 1BJZA 2HDWA 3RSNA 2NYXA 2MH2A 1WJCA 1ONVA 1YE9A 4O3MA 1BM9A 4CCOA 3ERED 2E7WA 1XGOA 4PGGA 3A02A 4IX7A 3HSEA 1TQPA 1Z9CA 3FHZA 1ZGAA 1ZR2A 5H6QA 1UHWA 2F6CA 2YU3A 1I3AA 3E6BA 3EYIA 5HS8A 2XC7A 5HLIA 4EJUA 4AIJA 3I0TA 4M3BA 3OYFA 2KKOA 3VDXA 1VQ4I 1W36C 1ZRDA 4LB6B 2LOOA 4C9YA 5EZHA 2F5DA 3A01B 3JTGA 1JE8A 3NWSA 3FM3A 2WV1A 1BI3A 2GXAA 2P7CB 4XSXF 1KQ8A 2PMHA 3BG5A 1AKHA 1DGRM 5HS7A 3M1EA 5L3EA 4IHYA 1J0RA 2DMQA 2R5YA 5DTDA 4FCYA 1FLIA 1U9OA 2VT3A 1ERDA 4EJVA 1VQPI 1TBXA 2X51A 2OAZA 3S32A 2BBYA 2H94A 4CCNA 3SZGA 4NHJA 3I4MJ 3PO2J 3WODF 3CF5F 2K40A 2ID6A 5CVRA 2PJRA 2VC0A 3CD6I 5E3LA 2XHKA 5FLVA 2EV0A 4IKFA 2XAQA 3HRTA 3IUOA 4LG3A 1SMTA 3P9KA 3RKQA 5IP6A 1SD7A 1ZTRA 2K02A 2B9SA 2WA0A 5F04A 3CO6C 2E1MC 1W0TA 3A0BC 2YX4A 3BTLA 1FZPB 4GXOA 1SFEA 3P9CA 1HW2A 2JUCA 4I99C 3LWFA 2V6EA 2F4OB 3P5JA 4HOBA 2ZNZA 4IL6C 4M3EA 4Y17A 4JK1X 1YRNB 1LVKA 4FQGA 4B09A 3CF2A 1VQ6I 3PQKA 2CQ7A 3RPUD 2W1OA 2QWWA 2H6CA 5HLTA 4S0HB 4AYBA 1RPWA 2ZNYA 2LP0A 2QBYA 1RETA 2VC1A 5BNGA 1XCBA 2TDXA 3G6EI 3T8RA 2IJLA 3WTZA 1Z1DA 3MKYB 1QHGA 2HKOA 3ZGKA 2O6GE 2IGNA 5FKKA 5CQGA 4E7SA 2FJ1A 2VQGA 1G3SA 3FF5A 3L2VA 3VYUB 1D0ZA 2G0EA 5DD4A 1H8AC 2K7LA 3DP7A 1NH3A 4MEXF 3QYFA 1LVAA 2AXLA 5DDGA 4Y7NJ 2M30A 5D4SA 2E7XA 1TZLA 4ITVA 4H0EA 3LSRA 4MHGA 1FP2A 1XN7A 2IEKA 3TKYA 1T6SA 1JUPA 2XAUA 3MVPA 4NC8A 3U1DA 3BG7A 3O3KA 4BU2A 3VB2A 1VQOI 1PYVA 2JA8J 4UUTA 5F6FA 3LAJA 2GOMA 5K7ZA 5J8FA 4Y52J 2R7FA 4GO1A 4A3MJ 2CGPA 3CCEI 2LLKA 4MQVA 4G7HF 2HR3A 2P7VB 4Q5SF 2L0KA 3L2WA 1S3JA 3FKJA 1BOBA 4Y3OA 2CRGA 2DMUA 2PN6A 2QQ8A 2Y69H 3ZOBA 3GZ6A 3M1CA 2DPDA 2R7QA 1WJBA 4FT8A 2E1CA 3QOEA 2R7UA 2M3AA 4I09A 2MH9A 4KIFA 3CP2A 1FYMA 3ESWB 2EQRA 2F5VA 1ZQ3P 4IRIA 4PFOA 2STTA 1HW5A 3NQOA 2W85A 2ESHA 2F5FA 3LA2A 3ABKH 2Y31A 2VJ5A 2M4KA 1HQCA 5EGOA 2XUBA 4HX7A 1MGTA 2HTJA 2EZHA 3D0SA 1K83J 3HHGA 3Q0UA 2XB0X 5DD8A 4E70A 2OUMA 1YG2A 4CA0A 3ZPLA 1ITYA 1ETWA 3CCVI 1O3RA 1VQ9I 3GLLA 3SFZA 2HYJA 1FYLA 2EFPA 3H9QA 4G7ZF 2R7WA 4LD5A 3H5NA 5FLXZ 1FSHA 1Z3YA 2WV0A 3FIWA 1HCRA 5ICEA 1FX7A 1JGSA 3IAM2 2HU9A 4IXAA 1K79A 3K10A 5H20A 2PX9A 2FA5A 4MO7A 3CJNA 3TW6A 3SHFA 2E19A 4W97A 4XK4A 2JQ7A 2GA1A 3KETA 1SMYF 2IS2A 4C3IJ 3KP6A 3UR3C 1WVRA 4BQOA 4ZTFA 2FRHA 3L2CA 4GCVA 2HQ5A 4IOCF 5KCMA 1BL0A 3DQVC 1YJNI 5FFXA 3O2PE 2DPUA 5DCMB 3AG1H 2EB7A 4RLFA 3DTKA 4I7HA 2XROA 2HOTA 4C2TA 2PMZN 3BJ6A 4QWQA 2DFFA 4D9JA 2RREA 4BJTA 1WQ2A 4V2GA 5CVUA 2VKHA 1ORKA 3MKZA 3R0JA 1BW6A 2YR2A 2W7NA 5HVQC 4BE0A 1TWCJ 4KT6A 4A3IJ 4XKCA 3QPSA 5BMZA 4NUBA 4ON0A 2WY7Q 3TP0A 1TWFJ 3W2WA 2VN2A 1QQIA 1MMNA 1H9TA 3GTQJ 3BZKA 4ZC3A 5IOZA 5EF6A 2WAFA 2Y9YA 2JMWA 1RUOA 4C2MJ 2VT2A 3VYSB 2HOSA 1MMDA 3HG9A 4J19A 3S3NA 3LSGA 2LSOA 1DUXC 5CVJA 3GW2A 2L2OA 4FX0A 1T39A 5DS9A 3I9V2 3J7AY 1RKWA 3CUQB 2VE9A 3MN2A 3QODA 2VODA 2CYYA 2QSHX 1NG7A 1W5CC 3HL2A 3OYNA 4Z6YA 1LE8B 3M4OJ 3RDIA 4ZYDA 3ZQGA 4F3QA 5J1YA 3GZ5A 3JRIA 1IRXA 2O8KA 3GCMA 2QEXI 1OCPA 3BR0A 3G2BA 2P0WA 4RAYA 5GTHC 3JREA 5E17F 3DPUA 2GLOA 1U0JA 4U88A 1LEAA 3S3MA 3MZYA 3SZTA 1XMKA 4M73A 1LFBA 4FASD 2L7FP 2ZJ2A 3IC7A 3WU0A 1J9IA 2LD5A 1R1TA 2P81A 1TNTA 2DK5A 5EEHA 2CQNA 4Q48A 1IUYA 1Y8QB 2CG4A 2X6XA 5BPDA 5EYRA 4MFDA 4QPOA 3M3YJ 2I5UA 3RQ4A 2DT5A 4A6EA 3IKTA 5ILSA 3HOTA 4II3A 3WTVC 4HQMA 3H3VK 1HKTA 1VQKI 1ZLJA 1UELB 2Y2ZA 3EUHC 1QBJA 3OS1A 2R3SA 2K9SA 3JCUC 1HSTA 1HSJA 1YX3A 1Z6TA 4UY8I 3IHUA 1D1CA 2VBYA 1PUFB 3CC2I 4I0AA 5B3SH 2HI3A 5JFRA 1MIJA 3QWLA 4PUSA 1RI7A 1IO2A 4HAMA 4A3JJ 1H9GA 4GGGA 3ZMUA 2ZMEA 2OJED 1B72B 3BPVA 4EMSA 4RS8A 1DU0A 4LB5A 2BHYA 1JKRC 3BY6A 3GUDA 1Y1VJ 2DOFA 1OKRA 5D8KB 3HOYJ 5IT3A 2JUGA 2YPRA 1O3TA 4LG0B 1VQNI 4RB0A 4XONA 2R5ZB 2IS1A 3M07A 2RDPA 5L3GA 3ROUA 1W7PD 1MBJA 4ZZDA 2HS5A 2KZGA 5AIQA 3F6VA 2AS5F 3FK7A 4AWXB 2VPRA 5EDNA 1DP3A 3G1OA 2JJ7A 1YS6A 2K3FA 4A3DJ 3GTJJ 1R5HA 2XAFA 2IAIA 4FE7A 4YEJA 2M8EA 2V26A 2EFWA 1K6OA 4UUSB 2BVMA 1JXSA 3TDZC 1FC3A 2HQNA 3OR1C 4S05A 3OYJA 3HEFA 5M3FJ 1O57A 3K2AA 4XRSA 3CMAI 4GYGA 4B43A 1BI2A 4MGRA 4E7LA 1QVUA 4E7ZA 5C4XJ 2JN6A 1L0OC 4ESBA 1GVDA 3V8JA 1G8XA 2XIGA 2IP2A 4DYQA 3G1MA 2IBDA 1QZYA 2ZXJA 2UZKA 2K9MA 5M3MJ 3IRRA 1V4RA 2BY0A 3K1PA 4EQQA 3LNQA 4EVIA 2Z33A 2UV1A 3GFJA 2DA6A 5DYMA 3GTKJ 2VONA 3WTSC 3RQIA 4A3GJ 3DLLF 1R58A 1DGWY 4Q4ZF 5LFAA 3ZRGA 5FLMJ 3MD2A 3M8FA 1JUSA 2L01A 2KZVA 3S93A 2HZDA 3E3VA 3WHCA 2JRMA 3EUAA 2CQKA 1XGNA 1AKHB 1S8NA 1B6AA 2R5YB 4F52A 4GDFA 3PSFA 1P7JA 1Z21A 1T98A 1TP4A 2CJJA 4HYEA 3F23A 3RYRA 4F93B 3I56I 2JPCA 2L7KA 2W00A 5D8LB 1BA5A 2OZUA 2LR8A 2Z99A 4XLFA 2PJRB 2M7BA 4MEYF 2KIUA 2RN7A 2F5CA 3HKZA 3U1KA 1Z3XA 3ZMTA 1FTTA 2R93J 4YFNF 2XPUA 1WJ5A 3WU2C 1ZG1A 1LFUP 4A2UA 1T2KA 1I1SA 1ENHA 2BW3A 2JSCA 5AIPA 2CUZA 2R92J 4A69C 3MQ0A 1KYWA 5LRSA 1Q1VA 1D8KA 1M1EB 3WHBA 4DYCA 3GTGJ 3OIOA 4BY1J 4OAZA 5IOYA 3FXUA 4KN7X 1XC5A 3I3LA 2KT0A 3TO7A 4DBRA 2XAGA 4EJWA 2ZSIB 2FUG2 2QBYB 4XNFA 2EFQA 2LTPA 4BJ6C 3LFUA 1YTYA 1UAAA 3IL2A 4XRFA 3OOUA 3ZQHA 3PNVA 3ELKA 3H9JA 5CKTA 1B8IA 4U0WA 4XM3A 3OYHA 3WGGA 4IVNA 3EQLF 3TEDA 5HLHA 4IHSA 2WC2A 3K69A 4BBRJ 4XL9A 2NS8A 3GEZA 4EM2A 4CXFA 4BNCA 3GYHX 2JT1A 2WB1N 2BY3A 3R0AA 3K7AJ 2DA2A 5E3OA 3BLYA 2L4MA 3S1MJ 1E3OC 1FIPA 1IN5A 1H0MA 4BXFA 3JRGA 1DQUA 4JX4A 1GDTA 1FTZA 2KMUA 3WGHA 2HFHA 2NVTJ 4R8HA 5CVIA 4FETA 5ICCA 4KA4A 5HDGA 1WJDA 4CZCA 3VPRA 3ZCOA 4BGDA 4J00A 2CW7A 1U6GA 1YW9A 2VLAA 1MMGA 3ABTA 1RUNA 1R5GA 2P8TA 3E1SA 2VJJA 2JVHA 3DPLC 1LEBA 2DA7A 3JRCA 1B1BA 3SQNA 2JA5J 1A31A 2H6BA 1Z7LA 3JTHA 3D5RC 1MW7A 2WAEA 2OBPA 4HG2A 4BKXA 2H27A 1HLVA 3S14J 2H8WA 2DMNA 1FPQA 4MTDA 2VQHA 1U9NA 3BROA 4K2EA 3RTRA 1DP7P 3C1DA 2N8GA 5HODA 2ELJA 4B3AA 2ZFWA 4N4OB 1VF9A 2QQ9A 2OD5A 2HQRA 2MW8A 2GWRA 2LKSA 4UNOA 1N77A 5EGOB 4ETSA 4XIDA 2PJPA 3H3UA 2XAHA 1RZ4A 3DBLB 1YW7A 2LF8A 2GQQA 1WJFA 4BXXJ 3E5QA 4M9XA 1FEXA 1OJLA 1CF7B 1HXDA 4MFEA 5J8CA 1KONA 1VQ7I 2DLLA 2XF5A 3L7WA 4YELA 1WZ2A 1YJ9I 5BS6A 3G3ZA 5ED4A 4RB1A 1U5TC 3A2KA 1WWXA 2CFXA 3DPTA 1BIAA 2F4IA 2EIJH 4KIGA 4HSRA 1NK2P 3EPZA 1NK3P 2OV7A 2A6HF 1A04A 1NG6A 2A68F 3E0JB 2V1NA 4B47A 2EFNA 3J80Z 4HF2A 5K1YA 1OPCA 2WB1A 1QO0D 1R4MB 1K4TA 4LITA 2GM4A 3HRMA 1ZGJA 3GXOA 2K27A 3L2RA 2RNGA 3S17J 1AA7A 4ZYAA 4Y15A 4E7IA 4A3KJ 3LSHA 1Z05A 4HV6A 3JSOA 2Y0SA 3AG2H 2X85A 5J40A 2MG4A 4NQWA 2ZJQF 1B4AA 3R6SA 2DK8A 1QVTA 2ESNA 4F91B 3CO7C 2VI6A 4PJJA 3AAFA 2KQRA 3GTOJ 3KFWX 1S7OA 2QLZA 2OCEA 3CJQB 3HBLA 4ZDPA 1SD4A 3O8GA 2OQRA 1U2WA 3E6MA 1X19A 5AONA 4MLOA 4U87A 1PUEE 3BP8A 1ODDA 2EINH 3EUKL 1SFXA 3OYGA 5EJCA 2ZJRF 5E18F 1V5GA 3TO6A 3JAMK 1SVMA 3DF8A 4AYBN 3KCCA 1YITI 3BT9A 3F0CA 4A0XA 4L5EA 3BR6A 4C30A 1SVLA 4UB6C 1I3QJ 3ERMA 2MABA 2JSPA 4II2A 4BE2A 2JA7J 3HHHA 1SAUA 4GRIA 3KYLA 4P96A 2EZIA 1LDJA 3DEUA 2M7AA 3QYEA 3GFMA 3G4SI 3HOVJ 2CFOA 4RGRA 2L54A 2DT7B 2XGEA 1MBGA 2HZTA 2E34A 4RB3C 3LSTA 4RMNA 3FXQA 4A93J 1I1GA 2Q2EA 1IG7A 2XVCA 2X1DA 3EETA 2STWA 3KEQA 5EZGA 4NC6A 3CLQA 1XGSA 4UHTA 1VQLI 1N75A 1O4XA 2YUSA 2E2HJ 1XG1A 3W3CA 1EJ9A 3ECOA 3OWTA 2IGMA 3D1NI 3S3OA 4KT5C 1T33A 4E4HA 4CCMA 3DKXA 5LD2C 2IA0A 3OL3A 2AQEA 2DW4A 2DODA 1IZ1A 2AXTC 4MNUA 5LBQA 2EH3A 2HVQA 1ZK8A 1Z77A 4IOAF 1WPKA 5F27A 1ZG5A 3K4LA 1R23A 3BDDA 4AIHA 5B66C 2NOGA 1W0UA 1F9NA 3U9GA 1ZR4A 2RVCA 1ETVA 3BG6A 1QNTA 3DV8A 4CGZA 1IV8A 3I54A 1U78A 5CVVA 2LBFA 2DJNA 3O8HA 1IXCA 4B4CA 2IA1A 1YS7A 4BDYA 3PNTA 2O5RA 1XGMA 3LA7A 3EYYA 3QQAA 1ON1A 1U8RA 3L2QA 1W5TA 4OWRB 4P55A 1ETXA 2Q1ZB 2DA4A 5LHIA 3CCQI 3RKYA 1Y56A 4N0BA 3ZN1A 3GO5A 2DDBA 3F6OA 5D4RA 3B6AA 2W4SA 3ML6A 1E17A 3SEZA 3OMYA 2MD0A 5BQTA 4E7KA 2HDDA 1O3SA 3ASOH 2DOEA 1LQ1A 1IXRC 2MBFA 5L3FA 1K6YA 4AVZA 3L1PA 1WJAA 3EUHA 1MNEA 3CUQC 1U3EM 1X1CA 4AD9A 2HEOA 3A0HC 1LFPA 4DJAA 1MJ9A 3CJRB 1JT6A 1TQMA 3K4KA 1WH7A 1YLFA 2R4GA 2V9KA 2LK2A 3IV5A 5DUKA 4F55A 3L00A 3MMYB 1EH7A 1KA8A 1MBHA 4ZTJA 4A3BJ 2FQ4A 2LKPA 3KEYA 3VSLA 2DTRA 2CW0F 1VI0A 2PQ8A 1BI0A 1NHAA 3KZZA 3T0YA 4BEHA 3A4CA 4WXCA 4HLYA 1MMSA 1XB4A 3LSJA 3BWGA 3KLNA 3E5UA 4UB8C 2EPFA 4HEA2 4DIQA 1FIAA 5FB2A 1UZCA 3N05A 2J5OA 5J47A 4ZDLA 1GHCA 1UHMA 2X4HA 4NB5A 3PL8A 5KK1A 3QOPA 4HW0A 3Q9SA 3E6DA 3OY9A 1BOAA 2BE5F 2PEXA 1X58A 3VYRB 1Z67A 2O0YA 3ISPA 3TOBA 3KYCB 2NRAC 1ZYRF 1U8BA 3KP2A 3ZQLA 4IHVA 1RC9A 4A3FJ 2I10A 2V6CA 3J81K 5FRNA 2K5CA 2X1EA 3CJTB 3HIFA 4DNCA 4I76A 3ZMSA 3FX3A 1JHHA 1XSXA 2V1XA 5HDNA 2M0MA 2L5QA 2HPIA 2Y30A 5FD6A 2TRTA 1TWGJ 1X4PA 2IXSA 3OIPA 5HS9A 1F4KA 3DTEA 3OYLA 1OMIA 1JI8A 3OYMA 2BYVE 2RGVA 2R7OA 4AVPA 3FMSA 1P4XA 2Y0MA 4CCLA 1Y0UA 1J2XA 2FU4A 1I6HJ 3KP4A 1OCTC 1GV5A 4KMFA 3Q0VA 2FOWA 1Q1HA 1SD5A 1Z0XA 5GTIC 3ONQA 1SD6A 4CUGA 5H2FC 3L9FA 1Y8RB 3NARA 5GADJ 1J7KA 5CQEA 2BW3B 2O3FA 3HGYA 1D3YA 1J09A 3JSPA 3Q3SA 3I64A 1X1BA 2L7MP 4GYIA 1HA8A 3J7AO 3F22A 4UVAA 4JYKA 4LK1F 1TLHB 4M6XA 2EA4A 4A12A 4ENJA 5LGUA 3BR2A 2KP6A 5HDKA 4W1UA 3JRAA 2Q8KA 3ZQFA 2PLYA 3CDIA 3HYIA 5F1JA 1B8IB 5HNHA 2B7EA 3ULQB 1DU6A 3FXOA 3SXYA 4BH9A 1EKEA 5E3NA 1S7AA 5JVTA 3BG3A 5D5VB 1E2XA 3TQNA 3ASNH 4IQ4A 3KYDB 3KZYA 3FWEA 4BS9A 1XS9A 2X0LA 2VOPA 1TL8A 3WTXC 4HDVA 5FD5A 1OCRH 5B5EC 2JRTA 1QZZA 3HPHA 2R7ZJ 1GUUA 1ETOA 2FE3A 5HLGA 3DCFA 4X1EA 4BHPA 2FBHA 3NEUA 3I4NJ 4HX8A 2DMTA 1FMVA 2NNNA 2H09A 4CYCB 4OIOF 1K61A 1ZGWA 5F1RA 2UUZA 3TO9A 5DM6F 4LFUA 3IKVA 2K9QA 5DM7F 3BJOA 5A2QZ 1MSFC 5ILUA 3KZIC 4RGXA 4Y33A 1MBEA 2FOKA 3BCAA 4ZYHA 1R1VA 4LGWA 3AKZA 5M5WJ 1T95A 2FNPA 4MQ9F 1WKMA 3P7NA 2O9LA 1JT0A 2HXIA 2LVSA 2ZBKA 3LA3A 4RA2A 1ZKGA 2QUFA 3A01A 1JHFA 1W1WE 2IS6A 3BG9A 3QP5A 1BR2A 1FOYA 3HRUA 1WI9A 3T1BA 3GFIA 1A36A 3V4GA 3OS2A 2MSYA 2D1VA 5FKOA 4YG2F 5TRDA 2EV6A 4D7MA 4OIPF 2O7OA 4WXHA 4BQQA 2VPLA 2EBIA 4AIKA 1Z91A 4NNJA 3ZMVA 3I71A 2XAJA 2ZXHA 4BUPA 4P5OA 2XRNA 4M74A 2GAUA 1IUFA 2Z16A 2CUEA 4LIUA 2QM3A 5DV5A 3AL0C 2EZKA 3LFKA 4IZZA 4YIRX 4BHBA 3F8MA 1JKPC 3RPUA 1OYIA 1TTYA 1XMAA 2D2WA 4IO9F 2VB6A 3S2HJ 2A61A 1IRFA 4XLEA 2RKHA 3JRBA 2KFDA 3QAHA 2L02A 4IHTA 2JVGA 3HKZN 4ENKA 2IT0A 2OA4A 1LUJB 2PBIA 3RI4A 2L7ZA 2VJIA 2NVUB 1MBKA 1AWCA 4NQWB 3PFIA 3K9TA 3TOAA 5CJ9A 1O7LA 3FISA 4GFBA 2L4AA 1U5TA 2RAEA 1VFCA 2LY9A 3KIOA 2G7UA 1AU7A 2NNYA 1IC8A 3SYTA 1YX5A 1X3ZB 3B02A 3RZOJ 4BL0B 5F0HA 4L18B 2R7XA 2VXDA 2XGXA 3QPLA 4PFPA 4RB2C 1WH5A 4BYYA 2V9PA 4D7NA 4G7OF 2IW5A 4ANJA 1S5LC 1UMQA 5JI6A 5GP9A 3E7LA 4RDUA 2JPBA 2LG4A 2QKLB 3H92A 5FKLA 3MKWB 3CESA 2OC6A 4M3DA 2EILH 1XDSA 2JA6J 2HXOA 5FLXK 3E97A 2CQXA 3V7CA 3IAS2 1N25A 4LMYA 5F64A 2K9NA 1D0XA 2LH9A 3DBHB 4C2UA 2CH0A 2P5KA 4RAGA 1LJ9A 1SEUA 3UNGC 2K85A 2W25A 5TJJA 2Z5UA 1SFOJ 4C3HJ 5E8GA 4OMZA 4DOZA 3JRHA 2Q2EB 2RQQA 2UWMA 3LSKA 2XDVA 1R7JA 5IP9J 3KLOA 5GAEJ 4IHWA 2PG4A 5KAIC 2LF7A 4WXDA 4KISA 1KZHA 2FX0A 2DAOA 2HNHA 3KP7A 2VKDA 3COAC 3CUOA 4E7JA 4CCKA 3BR5A 2A07F 1E3PA 1YQAA 1S29A 3HZJA 2ME6A 4L0YB 2D5VA 5J4VA 1D8JA 4ESFA 2XASA 4XKVA 1GV2A 1R36A 3F9KA 3OL4A 4X6AJ 1TT5B 3V8LA 4PJNA 2COBA 5KVRA 5D5UB 4U0YA 1HDDC 3M8EA 4I02A 4LLGF 2KISA 4ABZA 3BQZA 3I55I 3SFIA 1MNDA 1KQ0A 2YSRA 2B0LA 2F5EA 4YFXF 2H1KA 4OOIA 3REOA 1PDNC 1HC8A 5KNLA 3LSPA 4I0BA 3U2RA 1OFCX 2E35A 2VKEA 3OYDA 1RR7A 1OYWA 2LBFB 1T0FC 2FBIA 1XSDA 4CICA 3C3WA 4B8XA 2R0QC 5J1UA 1UG0A 5HOOA 2WY8Q 3CZ6A 2Y48A 3HRSA 4KNYA 1RKTA 3H5AA 3PIOF 1KU3A 1Y1WJ 1OQYA 2A5WA 2H8RA 1UCRA 4XKBA 1UJ8A 4FX4A 1K78A 3C2BA 4PSXA 4PJ0C 3GVAA 1IRGA 2DFEA 2M87A 2CWEA 3BZ6A 1YJWI 3S2WA 1IRZA 3DU6A 4XN3A 1SFUA 5IT9K 2QF7A 3QYBA 2RNJA 5D5WB 1LB2A 3FXKA 4M3FA 4IJAA 4E6KG 4EM0B 1LNWA 1USTA 4IPAA 2HTSA 2GOXB 3DEWA 3GX4X 2MC3A 4AUXA 4Y4RA 4KICA 3IH3A 3B6CA 2KL4A 1AOYA 4MTEA 2ZCWA 5GAHJ 5JLWA 2V9VA 1YFHA 4UUVA 4YIIA 4M9SA 1FSEA 2CV0A 2VE8A 4R1HA 3KP5A 1USSA 1IAWA 3QP6A 5FKNA 4DBQA 1EA3A 1GVJA 2HKXA 1IW7F 2MD5A 4PZJA 2E1OA 2OCCH 1WCMJ 2Y0SN 3Q0WA 4L9NA 2FEZA 1LKXA 2LYCA 1XDUA 3ZQ7A 4BEHB 3Q9VA 1YIJI 3O6BB 1DDNA 2PMUA 3OYBA 1X2MA 2KDOA 2ECCA 3X2QH 1P7IA 1ZAOA 3CDLA 5J3LA 3BTJA 4Y13A 3DFGA 4E7HA 3OR2C 3S1NJ 2WAQN 1X3WB 3F8NA 3S1RJ 5C4JJ 2DA5A 3ECHA 4NDLA 3CDHA 3KP3A 1FOXA 2ACJA 4IEJA 4M3GA 3TW7A 1C0WA 5J4YA 1BJAA 4BACA 1FWZA 3HM5A 3ZR8X 3VYTB 3K1MA 5L3CA 3R60A 1LE8A 3DTIA 5B1AH 1YW8A 2Z3YA 4ASNA 1QPMA 1G3TA 1V5EA 2QQBA 3DKYA 5GAGJ 5M5YJ 3M7GA 5IYBJ 3K70D 5EEGA 1YYVA 1MDMA 4DQ2A 4ZJZA 4P9FA 3S2DJ 3E6CC 3H0GJ 4A6DA 3J7YJ 4JX6A 2D1HA 1IN8A 3BTCA 2XGCA 1OISA 2K4JA 4LK0F 2E2JJ 2GIVA 3WTYC 4EGYA 1J75A 1J5YA 1HDPA 3M9AA 3NWTA 1QGPA 1W4MA 1JUMA 2NOJB 4R79A 5LHHA 4KFCA 1P9QC 5IPAA 4KYWA 4EEFG 2GA2A 4AM3A 2A05A 2X1CA 3DBRB 4G6TB 2X6YA 3FK6A 1OYYA 2HVSA 3H3ZA 2KHMA 2ZKZA 3C7JA 1W7PA 1IV6A 2P5VA 1LPQA 1XCVA 3OYCA 3GZNB 1B72A 4ENNA 1TQIA 2CMPA 4A5MA 1P6RA 1D1BA 4PSWA 3OOPA 2DOAA 5E8IA 1XTAA 2LY1A 5K5OA 1IDZA 2WAQA 3D5SC 4BHCA 4AU7A 3JRFA 3PFYA 1W5SA 4BE1A 5E3MA 2M5WA 4EM1A 2M8GX 1CGPA 4JX5A 1VQ8I 3A03A 4HSTA 4P1WA 1XD7A 3I59A 3TP3A 4PCQA 1SVOA 4WWCA 4KUMA 3HJEA 3E5XA 1EF4A 1STZA 3LSIA 4XSZF 4HNTA 2LC2A 2FNAA 5F08A 4HNVA 2OZ6A 4PGHA 1YO5C 4XLNF 1S72I 1UFMA 1G3WA 4TV7A 1REPC 4BXUA 2PI0A 4G6DA 3FBNB 4ZDOA 4A0YA 3BCBA 3PIPF 1LDDA 2E60A 2MLKA 2IGKA 5ERIA 3K4CA 1S6LA 1EV7A 4JQFA 3RCOA 4XQFA 3RZDJ 2AHQA 4PK4A 3G73A 1R6RA 5E1XA 2DMPA 4RAZA 3QPHA 3QPTA 4QPQA 4DYRA 3SJMA 4PJMA 1BC8C 2BZTA 4QTRA 3IH4A 3K4NA 6PAXA 2NS0A 2XGDA 3HDDA 4RM3A 1WJEA 2RQPA 4BAYA 2K9LA 3SDBA 3GWZA 3OSGA 1WGXA 3FDYA 2D45A 1D0YA 2CSOA 3CLOA 4XORA 2F48A 1FBQA 4BQAA 3K2ZA 3WTUC 2FXAA 3HOXJ 2QCOA 3BOQA 2E5NA 2L9VA 4L9VA 3CCUI 3G71I 2QYOA 1KU9A 1TW2A 1TT0A 3ABLH 1POGA 4B3XA 2VBXA 5GPAA 3V42A 3C2GA 1MBFA 2M45A 5ICGA 1YIOA 1OCOH 5JHUA 2M2EA 1R00A 5E1WA 3ABUA 5GPCA 1G2HA 1ZARA 3TMOA 2BVLA 1T38A 1XPXA 2XSDC 3VODA 4A3EJ 1ZH5A 1Z6RA 1R49A 2ZC2A 1DPRA 1X4OA 3A1YA 4ZH4F 2FMLA 5KHDA 1GXPA 3HB9A 4I01A 2DN0A 2ZMEB 4ZYEA 4OIQF 4MIMA 2GZWA 2LNBA 2XV4S 2X6WA 2FF4A 2CQQA 2EA2A 3H9GA 4OINF 1OCZH 2J5PA 2P4WA 3MZ8A 4XLCA 4XRSG 2QA4I 3VOEA 5LEKA 2EK5A 4UV8A 2ELHA 3OV8A 1FYKA 3GF2A 4M71A 3RIRA 5L3BA 1SAXA 3FHNA 2GIZA 3BZCA 1A35A 2VOOA 1D5VA 5K5RA 2E71A 4M9ZA 4NC7A 2OQGA 2W57A 2BY2A 2R7SA 2QVOA 1IJWC 1U5TB 5FFZA 3IH2A 4OMYA 2P5LC 3GFLA 1OLTA 1OR7C 5TISC 4A0ZA 2XKPA 1JGGA 5LLQA 2KLOA 2A6TA 2A6EF 2ADUA 2EWNA 4YIFA 3I53A 1K4SA 2ZB9A 2Z2SB 4G8XA 4O5VA 2NS7A 2VJ4A 4XMYA 2KPMA 3ZMZA 3W6JB 3FBIB 2GXGA 4CCJA 1RRJA 4HBLA 4RGUA 5IY5H 2IS4A 3CTAA 3IWFA 4LOCA 3WU1B 2ID3A 1Y0NA 2QSGX 3F8BA 1UHSA 1F5TA 1D1AA 2LDUA 2FQ3A 4XBFA 1GLNA 3R61A 1ETKA 1MH4A 4L5IA 2CUFA 2BY1A 5LRRA 3IWZA 3LMMA 3T8TA 4G9YA 2KIFA 4I98B 1VTNC 4OAYA 3N97A 4DZPA 1R22A 3J80K 3UKGA 1RNLA 4FHTA 3OYKA 4KIBA 2HQAA 4HZFA 1FOWA 2XPVA 3P9IA 1HOMA 2BEOA 2LFBA 2KRFA 2HGCA 1BW5A 3KPHA 4XOPA 3EDPA 3HUGA 3U21A 2VXZA 2VL8A 2IPQX 1YOVB 2NAZA 2XB5A 3JR9A 2CU7A 3OYIA 3CC7I 1H88C 4PDKA 3W2VA 2MGQA 2Z9OA 2V4JC 1FY7A 5CYVA 1FBUA 2KDZA 2X9DA 1L3LA 1P92A 4HQEA 2WTEA 1F36A 4DZJA 1JKOC 2ZFUA 4P9UA 3PUBA 2ISYA 1IN4A 2M34A 1CF7A 3W6KB 4RM2A 3BC8A 2YU9J 4HRIA 3GLXA 5E79C 5D5XB 2COMA 3GTMJ 2DQLA 1HKQA 2HYGD 3H36A 1JKQC 2Q0OA 3JW4A 4G12A 3BQYA 1FOKA 1BR1A 1BIBA 1QRYA 4J01A 2DJIA 1ZRFA 3RKWA 1B9NA 1QA6A 4KMUX 4EJOA 1K78B 1QPIA 3W2AA 4HF1A 4CDGA 1T08B 4JBAA 1VZ0A 1W36D 3BTIA 1MZBA 4EGZA 3F8FA 4WK8F 2AQFA 1MMAA 4CZZA 1MH3A 2A3SA 3G1LA 4U7DA 2HOEA 2XKOA 3SEQA 1WHUA 2BXYA 3SZPA 3VFZA 3GBGA 4HV5A 2Z1DA 4CH7A 2O61A 1TWHJ 3QU6A 2UXNA 3F3XA 3I58A 1X1DA 1YHQI 2KRHA 4BDZA 3WGIA 1QU3A 2VUMJ 3WG9A 3ZXSA 3PSIA 2ZXWH 2OU2A 3CCMI 2H1LA 4XR6A 1EH6A 2E1MB 3KX2A 4HA8A 5EG0A 4D0PA 2W82A 3H35A 2KIQA 1JTXA 1T0FA 5FGMA 1ZELA 1PVEA 2TCTA 1TW3A 1T8IA 5FRMA 1S9HA 2A5YB 2O03A 4CO8A 1QHHD 2FBKA 4OIRF 2L9SA 3N4MA 2MLGA 2XRLA 2NVXJ 4O6JA 2DU9A 1S7EA 3PQJA 3GTLJ 1X1PA 1MD0A 4A5NA 4A3CJ 3PJRA 3CMMA 2ISZA 5LHGA 5J1RA 5LGNA 3TGNA 3KEOA 3LSMA 2VQCA 5LGTA 2VQLA 3HXLA 4WX9A 2JZYA 3WE3A 1T56A 1PJRA 4YFKF 3DLAA 5K7FA 1P4WA 4KN4X 3IRQA 3W6VA 2LKXA 3V7RA 2LREA 4UVBA 4HNUA 1KQ9A 3DKWA 1FP1D 3K4MA 4EJTA 2ME0A 4L9JA 3RPQA 4LLNA 1KU7A 2EZLA 5F0CA 1CQTA 1R9TJ 2PFBA 2RV8A 3VEPA 3DWLE 1ZLKA 2K86A 2DO7A 1FNNA 4CHUA 9ANTA 1KGSA 3NAUA 4YRVA 5IT9Z 1UB9A 3FXJA 4XICA 2ZJPF 1KYZA 4QLCU 4XN0A 3K1NA 2UXXA 2DFIA 1ZRCA 4LJZF 2LMDA 1IF1A 2ZXIA 5J6XA 1KU2A 2DYRH 1XMXA 3H5RA 3M8JA 1I27A 4HF0A 1MDMB 2M4GA 3MZHA 2EJRA 4EATA 2E36A 1RR8C 1ZN2A 1P4AA 1SANA 2R7TA 2CS3A 1R1UA 2EV5A 4IRHA 5ICFA 3S1QJ 5HNFA 1TC3C 2WWYA 2VASA 5H6RA 2BGCA 2PMZA 4IQJA 1FT9A 4FISA 1BC7C 4DW6A 4Z2YA 3ZP5A 4UV9A 2YS9A 1V54H 3DEEA 3FMRA 1X2NA 5IYDJ 4KDPA 2L3DA 3FM5A 1SC7A 1SFKA 3V7SA 3AG4H 4AIDA 5E1ZB 2VIXA 3ZN0A 3H0DA 2AO9A 4ENMA 2K3PA 1W7PB 1BN5A 2NVYJ 2ZO4A 3J7ZI 2V7FA 3ABMH 2Y9ZA 2R7VA 5CLSA 2DDAA 1YRNA 2QZ8A 2QGUA 3TBIA 4XLPF 4N4NB 1TWAJ 2BV6A 1ETQA 3K4JA 3PO3J 3PUFA 2KJBA 3S15J 2W24A 4KITB 4V19K 4QSHA 2I8DA 2JWTA 2O8XA 1WSUA 3MAJA 2DCEA 3Q5FA 4N9HA 4N9IA 3HTUA 4M6VA 3L2UA 3ZMDA 2X6OA 3F72A 1E0EA 3LL7A 3K70C 3ZQCA 3I59B 1ULYA 2DA1A 4AC0A 1X3UA 2W84A 4XLAA 1Y39A 2CUJA 2KJCA 1LDKB 2JK3A 2XF7A 2OTJI 3K0LA 1PP7U 2VBZA 1IN7A 4RBOA 3BR3A 2EIKH 3OYEA 4Q47A 1VNDA 3JRDA 1GT0C 2QSFX 3CMYA 2E2IJ 3KE2A 3HGGA 4XRMA 1HF0A 2A69F 2X48A 3D5LA 2IA2A 2DT6A 2IVMA 1HKSA 1IGNA 1BR4A 3MWMA 3BR1A 3AFHA 4ESJA 5L3DA 4JP0A 3I5UA 1XSVA 5JR3A 3R4KA 4UVCA 2HVRA 2G7HA 1BI1A 1G3YA 2FMYA 3BJAA 4C3JJ 2ICWG 4L5JA 3HOSA 5D6FA 5KAFC 1WRJA 2GBYA 1Y6IA 2BOLA 3C2HA 2KIMA 2G9WA 5DEQA 2HDCA 4ZYGA 2ZSHB 5FKMA 2F4MB 3GMEA 3DU5A 3WTWC 4L0ZB 2XF6A 3H1CA 1MNMC 4PJLA 4D1QA 2EIMH 4L9TA 3LAPA 4IHXA 3DXJF 2B63J 1F1ZA 5D6EA 3OSFA 4LIVA 4F92B 3JAMZ 1ZG3A 3OS0A 1NTCA 3WG7H 3S16J 2FD5A 4XOTA 5ILVA 2M1BA 2R7DA 4IF4A 1YI2I 2E1NA 5JVGF 2P6SA 1I5ZA 4S04A 3FZVA 4V2FA 4EV0A 1B9MA 2ELKA 3ZQIA 1R5ID 2VKVA 1IDYA 2V1DA 2DYSH 3CQZJ 2WADA 3HSRA 4RLQA 4FTHA 2MC4A 2C6YA 1ZREA 4CSWA 1F43A 4NBQA 3F8CA 3BPXA 1V5FA 1R4NB 5DCMA 2CV1A 1V55H 2JA2A 2P6TA 3WTTC 4LLLA 4G94A 1A6IA 3CCYA 5DUIA 5A2QK 2LY2A 2QQAA 1N78A 2DI3A 2ETHA 4U0VA 2VBWA 5LEJA 1HW1A 1IXSB 3CMEI 2DFHA 2M9HA 5FJ8J 1WFXA 2DA3A 1J59A 1JJ6C 2MFZA 4BBSJ 3TL4X 2IGOA 1A6QA 3AL0B 2HOAA 1B59A 2L9RA 2CO5A 2XSJC 4I2OA 4WCGA 3FXMA 1WI3A 3VSKA 1UG2A 3LQRA 2DBBA 3MCZA 2FSWA 1ETYA 3OIQA 1MSEC 3HSFA 2CV2A 1D5YA 3RYPA 3CC4I 4DGWB 3WE2A 3B73A 2F2EA 3CCLI 2HYFA 1QZEA 2DQRA 3MKLA 5C3EJ 2BXZA 3AG3H 1FMWA 1XX5A 1MJBA 5TGTA 4B1RA 3IP4B 2IRFG 2HWVA 3CCJI 2W48A 5BPIA 3GTPJ 5K5QA 1AHDP 3I4PA 1JTYA 2OF7A 5EEAA 3HPGA 4BQNA 1R71A 4FE4A 4X0GA 3PM1A 4A3LJ 3RKXA 2R7RA 3CUQA 1O3QA 2XPWA 2ECBA 4I6ZA 2NVQJ 2QKMB 1FBSA 1A5JA 3FKIJ 1OR7A 4CYCA 2M0CA 3QRFF 2E5ZA 3FMQA 1V3FA 1Z7UA 2V79A 2CW8A 1HBXG 2ZMEC 5IYCJ 2MYSA 3HUGB 3NRVA 1PP8F 3S8PA 4M6YA 5IP7J 4XKWA 4QIWN 1JJ8C 1H89C 1MJAA 5JLXA 1K7AA 4U7BA 3K4BA 1BBYA 4OU0A 2K4BA 3FXLA
chains in the Genus database with same CATH topology
1ZHFA 1ON2A 5FO5A 1G4DA 1P2FA 4RGSA 1I6XA 1DPUA 3T5XA 4HLXA 3TDUC 4UXNA 4CYDA 2Y75A 3RJPA 5BOXA 4IRGA 2V1UA 3FXRA 3LQQA 3HTSB 1EH8A 1O7FA 3V8KA 4ZZLA 1MKMA 2JTVA 2RC4A 1RIOH 1TNSA 3J81Z 4F7ZA 3L09A 4M72A 4LG0A 2QENA 3MEXA 1G6NA 2YX7A 4G6QA 3QU3A 1GXQA 2MA3A 5E20A 5DCFA 4WF2A 4HDUA 4HX4A 3C18A 3MFKA 2EFOA 3F21A 1IN6A 2GXBA 2NYXA 2MH2A 1ONVA 4O3MA 1BM9A 3ERED 2E7WA 1XGOA 4PGGA 3HSEA 1TQPA 1Z9CA 3FHZA 1ZGAA 5H6QA 1UHWA 2YU3A 3E6BA 3EYIA 5HS8A 5HLIA 4EJUA 4AIJA 3I0TA 2KKOA 1ZRDA 4LB6B 2F5DA 3JTGA 1JE8A 3FM3A 1BI3A 2P7CB 4XSXF 1KQ8A 2PMHA 5HS7A 5L3EA 3M1EA 1J0RA 1FLIA 2VT3A 4EJVA 1TBXA 2OAZA 2BBYA 2H94A 4NHJA 3WODF 5CVRA 2VC0A 2XHKA 2EV0A 2XAQA 3HRTA 1SMTA 3P9KA 1SD7A 2K02A 3CO6C 2YX4A 1FZPB 4GXOA 1SFEA 3P9CA 1HW2A 3LWFA 4HOBA 2ZNZA 4Y17A 4JK1X 4B09A 3PQKA 2QWWA 2H6CA 2ZNYA 2QBYA 2VC1A 1XCBA 2TDXA 3T8RA 2IJLA 3WTZA 1Z1DA 2HKOA 2O6GE 1G3SA 3FF5A 5DD4A 2K7LA 3DP7A 4MEXF 1LVAA 2AXLA 5DDGA 2M30A 5D4SA 2E7XA 4H0EA 4MHGA 1FP2A 1XN7A 3TKYA 1T6SA 3U1DA 3O3KA 3VB2A 5F6FA 3LAJA 5J8FA 2R7FA 4GO1A 2CGPA 4MQVA 4G7HF 2HR3A 2P7VB 4Q5SF 1S3JA 2PN6A 3GZ6A 2DPDA 4FT8A 2E1CA 4I09A 2MH9A 4KIFA 1FYMA 4IRIA 2STTA 1HW5A 3NQOA 2W85A 2ESHA 2F5FA 3LA2A 1HQCA 2XUBA 4HX7A 1MGTA 2HTJA 3D0SA 3HHGA 4E70A 5DD8A 1YG2A 3ZPLA 1O3RA 3SFZA 1FYLA 2EFPA 4G7ZF 4LD5A 5FLXZ 1FSHA 2WV0A 5ICEA 1FX7A 1JGSA 4IXAA 1K79A 5H20A 2FA5A 3CJNA 3SHFA 2GA1A 3KETA 1SMYF 3KP6A 2FRHA 3L2CA 4GCVA 3DQVC 5FFXA 3O2PE 2DPUA 5DCMB 2EB7A 4I7HA 2XROA 3BJ6A 4QWQA 1WQ2A 5CVUA 3R0JA 2YR2A 5HVQC 5BMZA 4ON0A 2VN2A 1QQIA 1H9TA 1RUOA 2VT2A 2LSOA 1DUXC 5CVJA 3GW2A 4FX0A 1T39A 3CUQB 2VE9A 2VODA 2CYYA 3RDIA 4ZYDA 3GZ5A 4RAYA 5E17F 4U88A 1LEAA 3MZYA 3SZTA 1XMKA 4M73A 3WU0A 2ZJ2A 3IC7A 1J9IA 1R1TA 1TNTA 2DK5A 5EEHA 4Q48A 1IUYA 2CG4A 5BPDA 2DT5A 4A6EA 3IKTA 5ILSA 3HOTA 3WTVC 4HQMA 1HKTA 1ZLJA 1QBJA 2R3SA 1HSTA 1HSJA 1Z6TA 3IHUA 2VBYA 4I0AA 5JFRA 1RI7A 4HAMA 1H9GA 4GGGA 3ZMUA 2ZMEA 3BPVA 4EMSA 4RS8A 4LB5A 3BY6A 3GUDA 1OKRA 5D8KB 5IT3A 2YPRA 1O3TA 4LG0B 4RB0A 2RDPA 5L3GA 3ROUA 1W7PD 4ZZDA 2HS5A 5AIQA 3F6VA 2AS5F 4AWXB 1YS6A 1R5HA 2XAFA 2M8EA 2EFWA 1K6OA 1JXSA 3TDZC 1FC3A 2HQNA 4S05A 1O57A 4GYGA 1BI2A 4MGRA 1L0OC 4ESBA 3V8JA 2XIGA 2IP2A 1QZYA 2ZXJA 2UZKA 3IRRA 1V4RA 3K1PA 4EQQA 4EVIA 2Z33A 3GFJA 5DYMA 2VONA 3WTSC 1R58A 4Q4ZF 3M8FA 2L01A 3E3VA 2CQKA 1XGNA 1S8NA 1B6AA 1T98A 4HYEA 3F23A 3RYRA 2JPCA 5D8LB 2OZUA 2Z99A 4MEYF 2KIUA 2RN7A 2F5CA 3ZMTA 4YFNF 1ZG1A 4A2UA 1T2KA 1I1SA 2JSCA 5AIPA 3MQ0A 1KYWA 5LRSA 1D8KA 3FXUA 4KN7X 3TO7A 2XAGA 4EJWA 2QBYB 2EFQA 1YTYA 3IL2A 4XRFA 3ELKA 4U0WA 3WGGA 4IVNA 3EQLF 4IHSA 5HLHA 2WC2A 3K69A 4EM2A 3GEZA 4CXFA 4BNCA 3GYHX 2JT1A 3R0AA 2L4MA 1IN5A 1H0MA 3WGHA 2HFHA 4R8HA 5CVIA 5ICCA 4KA4A 5HDGA 1U6GA 1YW9A 3ABTA 1RUNA 1R5GA 2P8TA 3DPLC 1LEBA 1B1BA 3SQNA 2H6BA 3JTHA 2OBPA 2H27A 1FPQA 4MTDA 3BROA 4K2EA 3RTRA 1DP7P 3C1DA 2ZFWA 2QQ9A 2OD5A 2HQRA 2GWRA 4UNOA 4ETSA 2PJPA 3H3UA 2XAHA 1RZ4A 1YW7A 2LF8A 2GQQA 3E5QA 4M9XA 1CF7B 1HXDA 5J8CA 2DLLA 3L7WA 5BS6A 3G3ZA 5ED4A 4RB1A 1U5TC 1WWXA 2CFXA 3DPTA 1BIAA 4KIGA 2A6HF 1A04A 2A68F 2EFNA 3J80Z 4HF2A 5K1YA 1OPCA 1QO0D 3HRMA 1ZGJA 3GXOA 2K27A 4Y15A 1Z05A 4HV6A 3JSOA 4NQWA 1B4AA 3R6SA 2DK8A 2ESNA 3CO7C 3AAFA 3KFWX 1S7OA 2QLZA 1SD4A 2OQRA 1U2WA 3E6MA 5AONA 1PUEE 3BP8A 1ODDA 1SFXA 5E18F 3TO6A 3JAMK 3DF8A 3KCCA 4A0XA 3HHHA 4P96A 1LDJA 3DEUA 3GFMA 4RGRA 2L54A 2HZTA 4RB3C 3LSTA 3FXQA 1I1GA 2Q2EA 2XVCA 3EETA 2STWA 3KEQA 1XGSA 4UHTA 3ECOA 4KT5C 2IA0A 2DW4A 1IZ1A 4MNUA 5LBQA 1ZG5A 1R23A 3BDDA 4AIHA 1F9NA 3U9GA 2RVCA 1QNTA 3DV8A 4CGZA 3I54A 1U78A 5CVVA 1IXCA 2IA1A 1YS7A 1XGMA 3LA7A 3EYYA 1ON1A 1U8RA 1W5TA 4P55A 5LHIA 3RKYA 4N0BA 3ZN1A 3GO5A 3F6OA 5D4RA 3ML6A 1E17A 5BQTA 1O3SA 1LQ1A 1IXRC 2MBFA 5L3FA 3EUHA 3CUQC 1U3EM 4AD9A 2HEOA 1MJ9A 1TQMA 1YLFA 5DUKA 3L00A 1EH7A 1KA8A 2LKPA 2DTRA 2CW0F 2PQ8A 1BI0A 1NHAA 3KZZA 3T0YA 4WXCA 4HLYA 1XB4A 3BWGA 3KLNA 3E5UA 5FB2A 2J5OA 1GHCA 1UHMA 2X4HA 4NB5A 5KK1A 3QOPA 4HW0A 3Q9SA 3E6DA 1BOAA 2BE5F 2PEXA 2O0YA 3ISPA 3TOBA 2NRAC 1ZYRF 3KP2A 2V6CA 3J81K 3HIFA 4DNCA 3ZMSA 3FX3A 5HDNA 1JHHA 1XSXA 2V1XA 5FD6A 5HS9A 1F4KA 1OMIA 2BYVE 2RGVA 4AVPA 3FMSA 1P4XA 2Y0MA 1Y0UA 1J2XA 2FU4A 3KP4A 4KMFA 1Q1HA 1SD5A 1SD6A 3L9FA 1J7KA 2O3FA 1D3YA 3JSPA 3I64A 4GYIA 3J7AO 3F22A 4UVAA 4LK1F 1TLHB 4M6XA 2EA4A 4A12A 4ENJA 5LGUA 5HDKA 2Q8KA 2PLYA 3HYIA 3ULQB 3SXYA 4BH9A 1S7AA 5JVTA 5D5VB 1E2XA 3TQNA 3KZYA 3FWEA 2X0LA 2VOPA 3WTXC 4HDVA 5FD5A 2JRTA 1QZZA 5HLGA 2FE3A 4BHPA 2FBHA 3NEUA 4HX8A 2NNNA 2H09A 4OIOF 5F1RA 3TO9A 4LFUA 3IKVA 3BJOA 5A2QZ 5ILUA 4RGXA 2FOKA 4ZYHA 1R1VA 4LGWA 2FNPA 4MQ9F 1WKMA 3P7NA 3LA3A 2ZBKA 2QUFA 1JHFA 3QP5A 3HRUA 1WI9A 3T1BA 3GFIA 3V4GA 2D1VA 4YG2F 5TRDA 2EV6A 4OIPF 4WXHA 4AIKA 1Z91A 3ZMVA 3I71A 2XAJA 4P5OA 2XRNA 4M74A 2GAUA 5DV5A 2QM3A 3LFKA 4BHBA 3F8MA 3RPUA 1OYIA 1TTYA 1XMAA 2D2WA 2A61A 1IRFA 2RKHA 3QAHA 2L02A 4IHTA 4ENKA 2IT0A 2OA4A 2PBIA 3RI4A 1AWCA 3PFIA 3K9TA 3TOAA 5CJ9A 1O7LA 2L4AA 1U5TA 2G7UA 2NNYA 3B02A 4L18B 2XGXA 4RB2C 4BYYA 4G7OF 2IW5A 5JI6A 2JPBA 3H92A 1XDSA 5FLXK 3E97A 3V7CA 4LMYA 5F64A 2P5KA 1LJ9A 2W25A 5TJJA 2Z5UA 5E8GA 4OMZA 2UWMA 1R7JA 3KLOA 2PG4A 2LF7A 4WXDA 2DAOA 3KP7A 3COAC 3CUOA 2A07F 1YQAA 4L0YB 1S29A 1D8JA 4ESFA 2XASA 1R36A 3V8LA 5KVRA 5D5UB 4U0YA 3M8EA 4I02A 4LLGF 1KQ0A 2YSRA 2B0LA 2F5EA 4YFXF 4OOIA 3REOA 1PDNC 4I0BA 3U2RA 1OYWA 2FBIA 1XSDA 4CICA 3C3WA 4B8XA 5HOOA 2Y48A 3HRSA 4KNYA 1KU3A 1UCRA 4FX4A 1K78A 3GVAA 1IRGA 2M87A 3BZ6A 2CWEA 3S2WA 1SFUA 5IT9K 2RNJA 5D5WB 1LB2A 4IJAA 4EM0B 4IPAA 1LNWA 1USTA 2HTSA 3GX4X 2MC3A 4KICA 1AOYA 4MTEA 2ZCWA 2V9VA 1YFHA 4UUVA 4YIIA 4M9SA 1FSEA 2VE8A 4R1HA 3KP5A 1USSA 1IAWA 3QP6A 1GVJA 2HKXA 1IW7F 2MD5A 4PZJA 4L9NA 3ZQ7A 2FEZA 1XDUA 1DDNA 3Q9VA 3O6BB 2PMUA 1ZAOA 4Y13A 3DFGA 3F8NA 3ECHA 3CDHA 3KP3A 2ACJA 1C0WA 1BJAA 1FWZA 3K1MA 5L3CA 3R60A 1YW8A 2Z3YA 4ASNA 1QPMA 1G3TA 2QQBA 3M7GA 5EEGA 1YYVA 1MDMA 4DQ2A 4P9FA 3E6CC 4A6DA 2D1HA 1IN8A 2K4JA 4LK0F 2GIVA 3WTYC 4EGYA 1J75A 1J5YA 3M9AA 1QGPA 1W4MA 4R79A 5LHHA 4KFCA 4KYWA 2GA2A 1OYYA 3H3ZA 2ZKZA 3C7JA 1W7PA 2P5VA 1XCVA 4ENNA 1TQIA 4A5MA 1P6RA 3OOPA 5E8IA 5K5OA 4BHCA 1W5SA 2M5WA 4EM1A 1CGPA 1XD7A 3I59A 4PCQA 4WWCA 4KUMA 3E5XA 1STZA 4XSZF 2FNAA 2OZ6A 4PGHA 1YO5C 4XLNF 1UFMA 1G3WA 4TV7A 1REPC 4BXUA 2PI0A 4G6DA 4A0YA 1LDDA 2MLKA 5ERIA 1S6LA 1EV7A 4JQFA 3G73A 5E1XA 4RAZA 3QPHA 3QPTA 1BC8C 6PAXA 2NS0A 2RQPA 4BAYA 3GWZA 2D45A 2CSOA 3CLOA 1FBQA 4BQAA 3K2ZA 3WTUC 2FXAA 3BOQA 4L9VA 2QYOA 1KU9A 1TW2A 2VBXA 2M45A 5ICGA 1YIOA 5JHUA 1R00A 5E1WA 3ABUA 1ZARA 1T38A 3VODA 1ZH5A 1Z6RA 1DPRA 1GXPA 4ZH4F 2FMLA 4I01A 2ZMEB 4ZYEA 4OIQF 2GZWA 2LNBA 2XV4S 2FF4A 2EA2A 4OINF 2J5PA 2P4WA 3VOEA 5LEKA 2EK5A 4UV8A 2ELHA 3OV8A 1FYKA 3GF2A 4M71A 3RIRA 5L3BA 1SAXA 1D5VA 2VOOA 5K5RA 4M9ZA 2OQGA 2W57A 2QVOA 1U5TB 5FFZA 4OMYA 2P5LC 3GFLA 4A0ZA 2XKPA 5LLQA 2A6EF 2ADUA 2EWNA 4YIFA 3I53A 4G8XA 4O5VA 3ZMZA 3W6JB 2GXGA 4HBLA 4RGUA 3CTAA 3IWFA 3WU1B 3F8BA 1F5TA 2LDUA 2FQ3A 4XBFA 3R61A 4L5IA 5LRRA 3T8TA 3IWZA 4G9YA 2KIFA 4I98B 1VTNC 3N97A 1R22A 3J80K 1RNLA 4FHTA 4KIBA 4HZFA 3P9IA 2BEOA 2KRFA 2HGCA 3EDPA 3HUGA 2VXZA 2IPQX 2NAZA 4PDKA 2Z9OA 1FY7A 5CYVA 1FBUA 1L3LA 1P92A 4HQEA 2WTEA 4P9UA 2ISYA 1IN4A 1CF7A 3W6KB 3GLXA 5D5XB 2COMA 2DQLA 1HKQA 2HYGD 2Q0OA 3JW4A 1FOKA 1BIBA 1ZRFA 3RKWA 1B9NA 4KMUX 4EJOA 1K78B 4HF1A 4CDGA 4JBAA 1MZBA 4EGZA 3F8FA 4WK8F 4CZZA 2A3SA 4U7DA 2HOEA 2XKOA 3VFZA 3SZPA 2O61A 4HV5A 3QU6A 2UXNA 3F3XA 3I58A 3WGIA 3WG9A 2OU2A 1EH6A 4HA8A 4D0PA 1T0FA 5FGMA 1TW3A 2A5YB 2O03A 4CO8A 2FBKA 4OIRF 3N4MA 2MLGA 4O6JA 2DU9A 3PQJA 1MD0A 4A5NA 2ISZA 5LHGA 5LGNA 3TGNA 3KEOA 5LGTA 4WX9A 2JZYA 3WE3A 4YFKF 1P4WA 4KN4X 3IRQA 3V7RA 4UVBA 1KQ9A 3DKWA 1FP1D 4EJTA 4L9JA 3RPQA 4LLNA 1KU7A 2PFBA 2RV8A 3VEPA 1ZLKA 2K86A 2DO7A 1FNNA 4CHUA 5IT9Z 1KGSA 1UB9A 1KYZA 4QLCU 3K1NA 2UXXA 2DFIA 1ZRCA 4LJZF 1IF1A 5J6XA 1KU2A 1I27A 4HF0A 1MDMB 3MZHA 2EJRA 1ZN2A 1P4AA 1R1UA 2EV5A 4IRHA 5ICFA 2WWYA 5H6RA 2BGCA 1FT9A 1BC7C 4Z2YA 3ZP5A 4UV9A 3FMRA 4KDPA 2L3DA 3FM5A 3V7SA 5E1ZB 3ZN0A 4ENMA 1W7PB 1BN5A 2ZO4A 5CLSA 2QZ8A 4XLPF 2BV6A 2KJBA 2W24A 2O8XA 1WSUA 3MAJA 3Q5FA 4N9HA 4N9IA 3HTUA 3ZMDA 3F72A 3I59B 1ULYA 1X3UA 2W84A 2KJCA 1LDKB 3K0LA 1PP7U 2VBZA 1IN7A 4Q47A 3KE2A 2A69F 3D5LA 2IA2A 2IVMA 1HKSA 3MWMA 4ESJA 5L3DA 3I5UA 1XSVA 5JR3A 3R4KA 4UVCA 2G7HA 1BI1A 1G3YA 2FMYA 3BJAA 4L5JA 3HOSA 5D6FA 1WRJA 2KIMA 2G9WA 5DEQA 2HDCA 4ZYGA 4L0ZB 3WTWC 4L9TA 3LAPA 3DXJF 1F1ZA 5D6EA 3JAMZ 1ZG3A 5ILVA 2M1BA 2R7DA 4IF4A 2E1NA 2P6SA 1I5ZA 4S04A 3FZVA 4EV0A 1B9MA 2V1DA 3HSRA 2C6YA 1ZREA 3F8CA 3BPXA 5DCMA 2P6TA 3WTTC 4LLLA 4G94A 5DUIA 5A2QK 2QQAA 2DI3A 2ETHA 4U0VA 2VBWA 5LEJA 1HW1A 1IXSB 1J59A 1B59A 2CO5A 4I2OA 4WCGA 3LQRA 2DBBA 3MCZA 2FSWA 3HSFA 3RYPA 3WE2A 3B73A 2F2EA 2HYFA 2DQRA 1MJBA 2IRFG 2HWVA 5BPIA 5K5QA 3I4PA 3RKXA 3CUQA 1O3QA 1FBSA 1OR7A 3QRFF 3FMQA 1V3FA 1Z7UA 2V79A 1HBXG 3NRVA 1PP8F 4M6YA 1MJAA 1K7AA 4U7BA 1BBYA 4OU0A 2K4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHF A;  1ON2 A;  5FO5 A;  1G4D A;  1P2F A;  4RGS A;  1I6X A;  1DPU A;  3T5X A;  4HLX A;  3TDU C;  4UXN A;  4CYD A;  2Y75 A;  3RJP A;  5BOX A;  4IRG A;  2V1U A;  3FXR A;  3LQQ A;  3HTS B;  1EH8 A;  1O7F A;  3V8K A;  4ZZL A;  1MKM A;  2JTV A;  2RC4 A;  1RIO H;  1TNS A;  3J81 Z;  4F7Z A;  3L09 A;  4M72 A;  4LG0 A;  2QEN A;  3MEX A;  1G6N A;  2YX7 A;  4G6Q A;  3QU3 A;  1GXQ A;  2MA3 A;  5E20 A;  5DCF A;  4WF2 A;  4HDU A;  4HX4 A;  3C18 A;  3MFK A;  2EFO A;  3F21 A;  1IN6 A;  2GXB A;  2NYX A;  2MH2 A;  1ONV A;  4O3M A;  1BM9 A;  3ERE D;  2E7W A;  1XGO A;  4PGG A;  3HSE A;  1TQP A;  1Z9C A;  3FHZ A;  1ZGA A;  5H6Q A;  1UHW A;  2YU3 A;  3E6B A;  3EYI A;  5HS8 A;  5HLI A;  4EJU A;  4AIJ A;  3I0T A;  2KKO A;  1ZRD A;  4LB6 B;  2F5D A;  3JTG A;  1JE8 A;  3FM3 A;  1BI3 A;  2P7C B;  4XSX F;  1KQ8 A;  2PMH A;  5HS7 A;  5L3E A;  3M1E A;  1J0R A;  1FLI A;  2VT3 A;  4EJV A;  1TBX A;  2OAZ A;  2BBY A;  2H94 A;  4NHJ A;  3WOD F;  5CVR A;  2VC0 A;  2XHK A;  2EV0 A;  2XAQ A;  3HRT A;  1SMT A;  3P9K A;  1SD7 A;  2K02 A;  3CO6 C;  2YX4 A;  1FZP B;  4GXO A;  1SFE A;  3P9C A;  1HW2 A;  3LWF A;  4HOB A;  2ZNZ A;  4Y17 A;  4JK1 X;  4B09 A;  3PQK A;  2QWW A;  2H6C A;  2ZNY A;  2QBY A;  2VC1 A;  1XCB A;  2TDX A;  3T8R A;  2IJL A;  3WTZ A;  1Z1D A;  2HKO A;  2O6G E;  1G3S A;  3FF5 A;  5DD4 A;  2K7L A;  3DP7 A;  4MEX F;  1LVA A;  2AXL A;  5DDG A;  2M30 A;  5D4S A;  2E7X A;  4H0E A;  4MHG A;  1FP2 A;  1XN7 A;  3TKY A;  1T6S A;  3U1D A;  3O3K A;  3VB2 A;  5F6F A;  3LAJ A;  5J8F A;  2R7F A;  4GO1 A;  2CGP A;  4MQV A;  4G7H F;  2HR3 A;  2P7V B;  4Q5S F;  1S3J A;  2PN6 A;  3GZ6 A;  2DPD A;  4FT8 A;  2E1C A;  4I09 A;  2MH9 A;  4KIF A;  1FYM A;  4IRI A;  2STT A;  1HW5 A;  3NQO A;  2W85 A;  2ESH A;  2F5F A;  3LA2 A;  1HQC A;  2XUB A;  4HX7 A;  1MGT A;  2HTJ A;  3D0S A;  3HHG A;  4E70 A;  5DD8 A;  1YG2 A;  3ZPL A;  1O3R A;  3SFZ A;  1FYL A;  2EFP A;  4G7Z F;  4LD5 A;  5FLX Z;  1FSH A;  2WV0 A;  5ICE A;  1FX7 A;  1JGS A;  4IXA A;  1K79 A;  5H20 A;  2FA5 A;  3CJN A;  3SHF A;  2GA1 A;  3KET A;  1SMY F;  3KP6 A;  2FRH A;  3L2C A;  4GCV A;  3DQV C;  5FFX A;  3O2P E;  2DPU A;  5DCM B;  2EB7 A;  4I7H A;  2XRO A;  3BJ6 A;  4QWQ A;  1WQ2 A;  5CVU A;  3R0J A;  2YR2 A;  5HVQ C;  5BMZ A;  4ON0 A;  2VN2 A;  1QQI A;  1H9T A;  1RUO A;  2VT2 A;  2LSO A;  1DUX C;  5CVJ A;  3GW2 A;  4FX0 A;  1T39 A;  3CUQ B;  2VE9 A;  2VOD A;  2CYY A;  3RDI A;  4ZYD A;  3GZ5 A;  4RAY A;  5E17 F;  4U88 A;  1LEA A;  3MZY A;  3SZT A;  1XMK A;  4M73 A;  3WU0 A;  2ZJ2 A;  3IC7 A;  1J9I A;  1R1T A;  1TNT A;  2DK5 A;  5EEH A;  4Q48 A;  1IUY A;  2CG4 A;  5BPD A;  2DT5 A;  4A6E A;  3IKT A;  5ILS A;  3HOT A;  3WTV C;  4HQM A;  1HKT A;  1ZLJ A;  1QBJ A;  2R3S A;  1HST A;  1HSJ A;  1Z6T A;  3IHU A;  2VBY A;  4I0A A;  5JFR A;  1RI7 A;  4HAM A;  1H9G A;  4GGG A;  3ZMU A;  2ZME A;  3BPV A;  4EMS A;  4RS8 A;  4LB5 A;  3BY6 A;  3GUD A;  1OKR A;  5D8K B;  5IT3 A;  2YPR A;  1O3T A;  4LG0 B;  4RB0 A;  2RDP A;  5L3G A;  3ROU A;  1W7P D;  4ZZD A;  2HS5 A;  5AIQ A;  3F6V A;  2AS5 F;  4AWX B;  1YS6 A;  1R5H A;  2XAF A;  2M8E A;  2EFW A;  1K6O A;  1JXS A;  3TDZ C;  1FC3 A;  2HQN A;  4S05 A;  1O57 A;  4GYG A;  1BI2 A;  4MGR A;  1L0O C;  4ESB A;  3V8J A;  2XIG A;  2IP2 A;  1QZY A;  2ZXJ A;  2UZK A;  3IRR A;  1V4R A;  3K1P A;  4EQQ A;  4EVI A;  2Z33 A;  3GFJ A;  5DYM A;  2VON A;  3WTS C;  1R58 A;  4Q4Z F;  3M8F A;  2L01 A;  3E3V A;  2CQK A;  1XGN A;  1S8N A;  1B6A A;  1T98 A;  4HYE A;  3F23 A;  3RYR A;  2JPC A;  5D8L B;  2OZU A;  2Z99 A;  4MEY F;  2KIU A;  2RN7 A;  2F5C A;  3ZMT A;  4YFN F;  1ZG1 A;  4A2U A;  1T2K A;  1I1S A;  2JSC A;  5AIP A;  3MQ0 A;  1KYW A;  5LRS A;  1D8K A;  3FXU A;  4KN7 X;  3TO7 A;  2XAG A;  4EJW A;  2QBY B;  2EFQ A;  1YTY A;  3IL2 A;  4XRF A;  3ELK A;  4U0W A;  3WGG A;  4IVN A;  3EQL F;  4IHS A;  5HLH A;  2WC2 A;  3K69 A;  4EM2 A;  3GEZ A;  4CXF A;  4BNC A;  3GYH X;  2JT1 A;  3R0A A;  2L4M A;  1IN5 A;  1H0M A;  3WGH A;  2HFH A;  4R8H A;  5CVI A;  5ICC A;  4KA4 A;  5HDG A;  1U6G A;  1YW9 A;  3ABT A;  1RUN A;  1R5G A;  2P8T A;  3DPL C;  1LEB A;  1B1B A;  3SQN A;  2H6B A;  3JTH A;  2OBP A;  2H27 A;  1FPQ A;  4MTD A;  3BRO A;  4K2E A;  3RTR A;  1DP7 P;  3C1D A;  2ZFW A;  2QQ9 A;  2OD5 A;  2HQR A;  2GWR A;  4UNO A;  4ETS A;  2PJP A;  3H3U A;  2XAH A;  1RZ4 A;  1YW7 A;  2LF8 A;  2GQQ A;  3E5Q A;  4M9X A;  1CF7 B;  1HXD A;  5J8C A;  2DLL A;  3L7W A;  5BS6 A;  3G3Z A;  5ED4 A;  4RB1 A;  1U5T C;  1WWX A;  2CFX A;  3DPT A;  1BIA A;  4KIG A;  2A6H F;  1A04 A;  2A68 F;  2EFN A;  3J80 Z;  4HF2 A;  5K1Y A;  1OPC A;  1QO0 D;  3HRM A;  1ZGJ A;  3GXO A;  2K27 A;  4Y15 A;  1Z05 A;  4HV6 A;  3JSO A;  4NQW A;  1B4A A;  3R6S A;  2DK8 A;  2ESN A;  3CO7 C;  3AAF A;  3KFW X;  1S7O A;  2QLZ A;  1SD4 A;  2OQR A;  1U2W A;  3E6M A;  5AON A;  1PUE E;  3BP8 A;  1ODD A;  1SFX A;  5E18 F;  3TO6 A;  3JAM K;  3DF8 A;  3KCC A;  4A0X A;  3HHH A;  4P96 A;  1LDJ A;  3DEU A;  3GFM A;  4RGR A;  2L54 A;  2HZT A;  4RB3 C;  3LST A;  3FXQ A;  1I1G A;  2Q2E A;  2XVC A;  3EET A;  2STW A;  3KEQ A;  1XGS A;  4UHT A;  3ECO A;  4KT5 C;  2IA0 A;  2DW4 A;  1IZ1 A;  4MNU A;  5LBQ A;  1ZG5 A;  1R23 A;  3BDD A;  4AIH A;  1F9N A;  3U9G A;  2RVC A;  1QNT A;  3DV8 A;  4CGZ A;  3I54 A;  1U78 A;  5CVV A;  1IXC A;  2IA1 A;  1YS7 A;  1XGM A;  3LA7 A;  3EYY A;  1ON1 A;  1U8R A;  1W5T A;  4P55 A;  5LHI A;  3RKY A;  4N0B A;  3ZN1 A;  3GO5 A;  3F6O A;  5D4R A;  3ML6 A;  1E17 A;  5BQT A;  1O3S A;  1LQ1 A;  1IXR C;  2MBF A;  5L3F A;  3EUH A;  3CUQ C;  1U3E M;  4AD9 A;  2HEO A;  1MJ9 A;  1TQM A;  1YLF A;  5DUK A;  3L00 A;  1EH7 A;  1KA8 A;  2LKP A;  2DTR A;  2CW0 F;  2PQ8 A;  1BI0 A;  1NHA A;  3KZZ A;  3T0Y A;  4WXC A;  4HLY A;  1XB4 A;  3BWG A;  3KLN A;  3E5U A;  5FB2 A;  2J5O A;  1GHC A;  1UHM A;  2X4H A;  4NB5 A;  5KK1 A;  3QOP A;  4HW0 A;  3Q9S A;  3E6D A;  1BOA A;  2BE5 F;  2PEX A;  2O0Y A;  3ISP A;  3TOB A;  2NRA C;  1ZYR F;  3KP2 A;  2V6C A;  3J81 K;  3HIF A;  4DNC A;  3ZMS A;  3FX3 A;  5HDN A;  1JHH A;  1XSX A;  2V1X A;  5FD6 A;  5HS9 A;  1F4K A;  1OMI A;  2BYV E;  2RGV A;  4AVP A;  3FMS A;  1P4X A;  2Y0M A;  1Y0U A;  1J2X A;  2FU4 A;  3KP4 A;  4KMF A;  1Q1H A;  1SD5 A;  1SD6 A;  3L9F A;  1J7K A;  2O3F A;  1D3Y A;  3JSP A;  3I64 A;  4GYI A;  3J7A O;  3F22 A;  4UVA A;  4LK1 F;  1TLH B;  4M6X A;  2EA4 A;  4A12 A;  4ENJ A;  5LGU A;  5HDK A;  2Q8K A;  2PLY A;  3HYI A;  3ULQ B;  3SXY A;  4BH9 A;  1S7A A;  5JVT A;  5D5V B;  1E2X A;  3TQN A;  3KZY A;  3FWE A;  2X0L A;  2VOP A;  3WTX C;  4HDV A;  5FD5 A;  2JRT A;  1QZZ A;  5HLG A;  2FE3 A;  4BHP A;  2FBH A;  3NEU A;  4HX8 A;  2NNN A;  2H09 A;  4OIO F;  5F1R A;  3TO9 A;  4LFU A;  3IKV A;  3BJO A;  5A2Q Z;  5ILU A;  4RGX A;  2FOK A;  4ZYH A;  1R1V A;  4LGW A;  2FNP A;  4MQ9 F;  1WKM A;  3P7N A;  3LA3 A;  2ZBK A;  2QUF A;  1JHF A;  3QP5 A;  3HRU A;  1WI9 A;  3T1B A;  3GFI A;  3V4G A;  2D1V A;  4YG2 F;  5TRD A;  2EV6 A;  4OIP F;  4WXH A;  4AIK A;  1Z91 A;  3ZMV A;  3I71 A;  2XAJ A;  4P5O A;  2XRN A;  4M74 A;  2GAU A;  5DV5 A;  2QM3 A;  3LFK A;  4BHB A;  3F8M A;  3RPU A;  1OYI A;  1TTY A;  1XMA A;  2D2W A;  2A61 A;  1IRF A;  2RKH A;  3QAH A;  2L02 A;  4IHT A;  4ENK A;  2IT0 A;  2OA4 A;  2PBI A;  3RI4 A;  1AWC A;  3PFI A;  3K9T A;  3TOA A;  5CJ9 A;  1O7L A;  2L4A A;  1U5T A;  2G7U A;  2NNY A;  3B02 A;  4L18 B;  2XGX A;  4RB2 C;  4BYY A;  4G7O F;  2IW5 A;  5JI6 A;  2JPB A;  3H92 A;  1XDS A;  5FLX K;  3E97 A;  3V7C A;  4LMY A;  5F64 A;  2P5K A;  1LJ9 A;  2W25 A;  5TJJ A;  2Z5U A;  5E8G A;  4OMZ A;  2UWM A;  1R7J A;  3KLO A;  2PG4 A;  2LF7 A;  4WXD A;  2DAO A;  3KP7 A;  3COA C;  3CUO A;  2A07 F;  1YQA A;  4L0Y B;  1S29 A;  1D8J A;  4ESF A;  2XAS A;  1R36 A;  3V8L A;  5KVR A;  5D5U B;  4U0Y A;  3M8E A;  4I02 A;  4LLG F;  1KQ0 A;  2YSR A;  2B0L A;  2F5E A;  4YFX F;  4OOI A;  3REO A;  1PDN C;  4I0B A;  3U2R A;  1OYW A;  2FBI A;  1XSD A;  4CIC A;  3C3W A;  4B8X A;  5HOO A;  2Y48 A;  3HRS A;  4KNY A;  1KU3 A;  1UCR A;  4FX4 A;  1K78 A;  3GVA A;  1IRG A;  2M87 A;  3BZ6 A;  2CWE A;  3S2W A;  1SFU A;  5IT9 K;  2RNJ A;  5D5W B;  1LB2 A;  4IJA A;  4EM0 B;  4IPA A;  1LNW A;  1UST A;  2HTS A;  3GX4 X;  2MC3 A;  4KIC A;  1AOY A;  4MTE A;  2ZCW A;  2V9V A;  1YFH A;  4UUV A;  4YII A;  4M9S A;  1FSE A;  2VE8 A;  4R1H A;  3KP5 A;  1USS A;  1IAW A;  3QP6 A;  1GVJ A;  2HKX A;  1IW7 F;  2MD5 A;  4PZJ A;  4L9N A;  3ZQ7 A;  2FEZ A;  1XDU A;  1DDN A;  3Q9V A;  3O6B B;  2PMU A;  1ZAO A;  4Y13 A;  3DFG A;  3F8N A;  3ECH A;  3CDH A;  3KP3 A;  2ACJ A;  1C0W A;  1BJA A;  1FWZ A;  3K1M A;  5L3C A;  3R60 A;  1YW8 A;  2Z3Y A;  4ASN A;  1QPM A;  1G3T A;  2QQB A;  3M7G A;  5EEG A;  1YYV A;  1MDM A;  4DQ2 A;  4P9F A;  3E6C C;  4A6D A;  2D1H A;  1IN8 A;  2K4J A;  4LK0 F;  2GIV A;  3WTY C;  4EGY A;  1J75 A;  1J5Y A;  3M9A A;  1QGP A;  1W4M A;  4R79 A;  5LHH A;  4KFC A;  4KYW A;  2GA2 A;  1OYY A;  3H3Z A;  2ZKZ A;  3C7J A;  1W7P A;  2P5V A;  1XCV A;  4ENN A;  1TQI A;  4A5M A;  1P6R A;  3OOP A;  5E8I A;  5K5O A;  4BHC A;  1W5S A;  2M5W A;  4EM1 A;  1CGP A;  1XD7 A;  3I59 A;  4PCQ A;  4WWC A;  4KUM A;  3E5X A;  1STZ A;  4XSZ F;  2FNA A;  2OZ6 A;  4PGH A;  1YO5 C;  4XLN F;  1UFM A;  1G3W A;  4TV7 A;  1REP C;  4BXU A;  2PI0 A;  4G6D A;  4A0Y A;  1LDD A;  2MLK A;  5ERI A;  1S6L A;  1EV7 A;  4JQF A;  3G73 A;  5E1X A;  4RAZ A;  3QPH A;  3QPT A;  1BC8 C;  6PAX A;  2NS0 A;  2RQP A;  4BAY A;  3GWZ A;  2D45 A;  2CSO A;  3CLO A;  1FBQ A;  4BQA A;  3K2Z A;  3WTU C;  2FXA A;  3BOQ A;  4L9V A;  2QYO A;  1KU9 A;  1TW2 A;  2VBX A;  2M45 A;  5ICG A;  1YIO A;  5JHU A;  1R00 A;  5E1W A;  3ABU A;  1ZAR A;  1T38 A;  3VOD A;  1ZH5 A;  1Z6R A;  1DPR A;  1GXP A;  4ZH4 F;  2FML A;  4I01 A;  2ZME B;  4ZYE A;  4OIQ F;  2GZW A;  2LNB A;  2XV4 S;  2FF4 A;  2EA2 A;  4OIN F;  2J5P A;  2P4W A;  3VOE A;  5LEK A;  2EK5 A;  4UV8 A;  2ELH A;  3OV8 A;  1FYK A;  3GF2 A;  4M71 A;  3RIR A;  5L3B A;  1SAX A;  1D5V A;  2VOO A;  5K5R A;  4M9Z A;  2OQG A;  2W57 A;  2QVO A;  1U5T B;  5FFZ A;  4OMY A;  2P5L C;  3GFL A;  4A0Z A;  2XKP A;  5LLQ A;  2A6E F;  2ADU A;  2EWN A;  4YIF A;  3I53 A;  4G8X A;  4O5V A;  3ZMZ A;  3W6J B;  2GXG A;  4HBL A;  4RGU A;  3CTA A;  3IWF A;  3WU1 B;  3F8B A;  1F5T A;  2LDU A;  2FQ3 A;  4XBF A;  3R61 A;  4L5I A;  5LRR A;  3T8T A;  3IWZ A;  4G9Y A;  2KIF A;  4I98 B;  1VTN C;  3N97 A;  1R22 A;  3J80 K;  1RNL A;  4FHT A;  4KIB A;  4HZF A;  3P9I A;  2BEO A;  2KRF A;  2HGC A;  3EDP A;  3HUG A;  2VXZ A;  2IPQ X;  2NAZ A;  4PDK A;  2Z9O A;  1FY7 A;  5CYV A;  1FBU A;  1L3L A;  1P92 A;  4HQE A;  2WTE A;  4P9U A;  2ISY A;  1IN4 A;  1CF7 A;  3W6K B;  3GLX A;  5D5X B;  2COM A;  2DQL A;  1HKQ A;  2HYG D;  2Q0O A;  3JW4 A;  1FOK A;  1BIB A;  1ZRF A;  3RKW A;  1B9N A;  4KMU X;  4EJO A;  1K78 B;  4HF1 A;  4CDG A;  4JBA A;  1MZB A;  4EGZ A;  3F8F A;  4WK8 F;  4CZZ A;  2A3S A;  4U7D A;  2HOE A;  2XKO A;  3VFZ A;  3SZP A;  2O61 A;  4HV5 A;  3QU6 A;  2UXN A;  3F3X A;  3I58 A;  3WGI A;  3WG9 A;  2OU2 A;  1EH6 A;  4HA8 A;  4D0P A;  1T0F A;  5FGM A;  1TW3 A;  2A5Y B;  2O03 A;  4CO8 A;  2FBK A;  4OIR F;  3N4M A;  2MLG A;  4O6J A;  2DU9 A;  3PQJ A;  1MD0 A;  4A5N A;  2ISZ A;  5LHG A;  5LGN A;  3TGN A;  3KEO A;  5LGT A;  4WX9 A;  2JZY A;  3WE3 A;  4YFK F;  1P4W A;  4KN4 X;  3IRQ A;  3V7R A;  4UVB A;  1KQ9 A;  3DKW A;  1FP1 D;  4EJT A;  4L9J A;  3RPQ A;  4LLN A;  1KU7 A;  2PFB A;  2RV8 A;  3VEP A;  1ZLK A;  2K86 A;  2DO7 A;  1FNN A;  4CHU A;  5IT9 Z;  1KGS A;  1UB9 A;  1KYZ A;  4QLC U;  3K1N A;  2UXX A;  2DFI A;  1ZRC A;  4LJZ F;  1IF1 A;  5J6X A;  1KU2 A;  1I27 A;  4HF0 A;  1MDM B;  3MZH A;  2EJR A;  1ZN2 A;  1P4A A;  1R1U A;  2EV5 A;  4IRH A;  5ICF A;  2WWY A;  5H6R A;  2BGC A;  1FT9 A;  1BC7 C;  4Z2Y A;  3ZP5 A;  4UV9 A;  3FMR A;  4KDP A;  2L3D A;  3FM5 A;  3V7S A;  5E1Z B;  3ZN0 A;  4ENM A;  1W7P B;  1BN5 A;  2ZO4 A;  5CLS A;  2QZ8 A;  4XLP F;  2BV6 A;  2KJB A;  2W24 A;  2O8X A;  1WSU A;  3MAJ A;  3Q5F A;  4N9H A;  4N9I A;  3HTU A;  3ZMD A;  3F72 A;  3I59 B;  1ULY A;  1X3U A;  2W84 A;  2KJC A;  1LDK B;  3K0L A;  1PP7 U;  2VBZ A;  1IN7 A;  4Q47 A;  3KE2 A;  2A69 F;  3D5L A;  2IA2 A;  2IVM A;  1HKS A;  3MWM A;  4ESJ A;  5L3D A;  3I5U A;  1XSV A;  5JR3 A;  3R4K A;  4UVC A;  2G7H A;  1BI1 A;  1G3Y A;  2FMY A;  3BJA A;  4L5J A;  3HOS A;  5D6F A;  1WRJ A;  2KIM A;  2G9W A;  5DEQ A;  2HDC A;  4ZYG A;  4L0Z B;  3WTW C;  4L9T A;  3LAP A;  3DXJ F;  1F1Z A;  5D6E A;  3JAM Z;  1ZG3 A;  5ILV A;  2M1B A;  2R7D A;  4IF4 A;  2E1N A;  2P6S A;  1I5Z A;  4S04 A;  3FZV A;  4EV0 A;  1B9M A;  2V1D A;  3HSR A;  2C6Y A;  1ZRE A;  3F8C A;  3BPX A;  5DCM A;  2P6T A;  3WTT C;  4LLL A;  4G94 A;  5DUI A;  5A2Q K;  2QQA A;  2DI3 A;  2ETH A;  4U0V A;  2VBW A;  5LEJ A;  1HW1 A;  1IXS B;  1J59 A;  1B59 A;  2CO5 A;  4I2O A;  4WCG A;  3LQR A;  2DBB A;  3MCZ A;  2FSW A;  3HSF A;  3RYP A;  3WE2 A;  3B73 A;  2F2E A;  2HYF A;  2DQR A;  1MJB A;  2IRF G;  2HWV A;  5BPI A;  5K5Q A;  3I4P A;  3RKX A;  3CUQ A;  1O3Q A;  1FBS A;  1OR7 A;  3QRF F;  3FMQ A;  1V3F A;  1Z7U A;  2V79 A;  1HBX G;  3NRV A;  1PP8 F;  4M6Y A;  1MJA A;  1K7A A;  4U7B A;  1BBY A;  4OU0 A;  2K4B A; 
#chains in the Genus database with same CATH topology
 1ZHF A;  2HPM A;  1ON2 A;  5FO5 A;  1G4D A;  1I50 J;  2L9N A;  3HC7 A;  1P2F A;  4JOM A;  4RGS A;  1I6X A;  3PNY A;  4D5F A;  2DTZ A;  5C44 J;  3CCS I;  3HOZ J;  3ZQQ A;  1DPU A;  3T5X A;  4RAF A;  2BHZ A;  2OTL I;  4HLX A;  3TDU C;  4UXN A;  4CYD A;  2Y75 A;  1RES A;  2DXI A;  3RJP A;  3CCR I;  2LRD A;  5BOX A;  3VWB A;  1X1A A;  4IRG A;  5FRO A;  3CP8 A;  2V1U A;  1PUF A;  3OYA A;  4H4K C;  3FXR A;  4B44 A;  2KRC A;  3LQQ A;  4BY7 J;  1E3H A;  3HTS B;  1EH8 A;  1ACI A;  1O7F A;  3V8K A;  4ZZL A;  1MKM A;  2JTV A;  2RC4 A;  4B48 A;  1RIO H;  1I39 A;  1TNS A;  3K6G A;  3HOW J;  4HPQ A;  3J81 Z;  5F0F A;  4F7Z A;  3L09 A;  4M72 A;  4LG0 A;  1OCC H;  1VQ5 I;  4KJZ A;  5JHF A;  4XLH A;  2R5Z A;  2QEN A;  3LOC A;  4D5C A;  3MEX A;  1G6N A;  2YX7 A;  4G6Q A;  5EG0 B;  3QU3 A;  1GXQ A;  2MA3 A;  2WBM A;  5M5X J;  3HOU J;  5CPR B;  5E20 A;  5DCF A;  4WF2 A;  1APL C;  4HDU A;  1VQM I;  4HX4 A;  1FJL A;  4UUS A;  3SDG A;  1G59 A;  3C18 A;  3MFK A;  2EFO A;  3F21 A;  5B1B H;  1IN6 A;  5K7H A;  2GXB A;  2OPT A;  2NXN B;  4BJ5 C;  1BJZ A;  2HDW A;  3RSN A;  2NYX A;  2MH2 A;  1WJC A;  1ONV A;  1YE9 A;  4O3M A;  1BM9 A;  4CCO A;  3ERE D;  2E7W A;  1XGO A;  4PGG A;  3A02 A;  4IX7 A;  3HSE A;  1TQP A;  1Z9C A;  3FHZ A;  1ZGA A;  1ZR2 A;  5H6Q A;  1UHW A;  2F6C A;  2YU3 A;  1I3A A;  3E6B A;  3EYI A;  5HS8 A;  2XC7 A;  5HLI A;  4EJU A;  4AIJ A;  3I0T A;  4M3B A;  3OYF A;  2KKO A;  3VDX A;  1VQ4 I;  1W36 C;  1ZRD A;  4LB6 B;  2LOO A;  4C9Y A;  5EZH A;  2F5D A;  3A01 B;  3JTG A;  1JE8 A;  3NWS A;  3FM3 A;  2WV1 A;  1BI3 A;  2GXA A;  2P7C B;  4XSX F;  1KQ8 A;  2PMH A;  3BG5 A;  1AKH A;  1DGR M;  5HS7 A;  3M1E A;  5L3E A;  4IHY A;  1J0R A;  2DMQ A;  2R5Y A;  5DTD A;  4FCY A;  1FLI A;  1U9O A;  2VT3 A;  1ERD A;  4EJV A;  1VQP I;  1TBX A;  2X51 A;  2OAZ A;  3S32 A;  2BBY A;  2H94 A;  4CCN A;  3SZG A;  4NHJ A;  3I4M J;  3PO2 J;  3WOD F;  3CF5 F;  2K40 A;  2ID6 A;  5CVR A;  2PJR A;  2VC0 A;  3CD6 I;  5E3L A;  2XHK A;  5FLV A;  2EV0 A;  4IKF A;  2XAQ A;  3HRT A;  3IUO A;  4LG3 A;  1SMT A;  3P9K A;  3RKQ A;  5IP6 A;  1SD7 A;  1ZTR A;  2K02 A;  2B9S A;  2WA0 A;  5F04 A;  3CO6 C;  2E1M C;  1W0T A;  3A0B C;  2YX4 A;  3BTL A;  1FZP B;  4GXO A;  1SFE A;  3P9C A;  1HW2 A;  2JUC A;  4I99 C;  3LWF A;  2V6E A;  2F4O B;  3P5J A;  4HOB A;  2ZNZ A;  4IL6 C;  4M3E A;  4Y17 A;  4JK1 X;  1YRN B;  1LVK A;  4FQG A;  4B09 A;  3CF2 A;  1VQ6 I;  3PQK A;  2CQ7 A;  3RPU D;  2W1O A;  2QWW A;  2H6C A;  5HLT A;  4S0H B;  4AYB A;  1RPW A;  2ZNY A;  2LP0 A;  2QBY A;  1RET A;  2VC1 A;  5BNG A;  1XCB A;  2TDX A;  3G6E I;  3T8R A;  2IJL A;  3WTZ A;  1Z1D A;  3MKY B;  1QHG A;  2HKO A;  3ZGK A;  2O6G E;  2IGN A;  5FKK A;  5CQG A;  4E7S A;  2FJ1 A;  2VQG A;  1G3S A;  3FF5 A;  3L2V A;  3VYU B;  1D0Z A;  2G0E A;  5DD4 A;  1H8A C;  2K7L A;  3DP7 A;  1NH3 A;  4MEX F;  3QYF A;  1LVA A;  2AXL A;  5DDG A;  4Y7N J;  2M30 A;  5D4S A;  2E7X A;  1TZL A;  4ITV A;  4H0E A;  3LSR A;  4MHG A;  1FP2 A;  1XN7 A;  2IEK A;  3TKY A;  1T6S A;  1JUP A;  2XAU A;  3MVP A;  4NC8 A;  3U1D A;  3BG7 A;  3O3K A;  4BU2 A;  3VB2 A;  1VQO I;  1PYV A;  2JA8 J;  4UUT A;  5F6F A;  3LAJ A;  2GOM A;  5K7Z A;  5J8F A;  4Y52 J;  2R7F A;  4GO1 A;  4A3M J;  2CGP A;  3CCE I;  2LLK A;  4MQV A;  4G7H F;  2HR3 A;  2P7V B;  4Q5S F;  2L0K A;  3L2W A;  1S3J A;  3FKJ A;  1BOB A;  4Y3O A;  2CRG A;  2DMU A;  2PN6 A;  2QQ8 A;  2Y69 H;  3ZOB A;  3GZ6 A;  3M1C A;  2DPD A;  2R7Q A;  1WJB A;  4FT8 A;  2E1C A;  3QOE A;  2R7U A;  2M3A A;  4I09 A;  2MH9 A;  4KIF A;  3CP2 A;  1FYM A;  3ESW B;  2EQR A;  2F5V A;  1ZQ3 P;  4IRI A;  4PFO A;  2STT A;  1HW5 A;  3NQO A;  2W85 A;  2ESH A;  2F5F A;  3LA2 A;  3ABK H;  2Y31 A;  2VJ5 A;  2M4K A;  1HQC A;  5EGO A;  2XUB A;  4HX7 A;  1MGT A;  2HTJ A;  2EZH A;  3D0S A;  1K83 J;  3HHG A;  3Q0U A;  2XB0 X;  5DD8 A;  4E70 A;  2OUM A;  1YG2 A;  4CA0 A;  3ZPL A;  1ITY A;  1ETW A;  3CCV I;  1O3R A;  1VQ9 I;  3GLL A;  3SFZ A;  2HYJ A;  1FYL A;  2EFP A;  3H9Q A;  4G7Z F;  2R7W A;  4LD5 A;  3H5N A;  5FLX Z;  1FSH A;  1Z3Y A;  2WV0 A;  3FIW A;  1HCR A;  5ICE A;  1FX7 A;  1JGS A;  3IAM 2;  2HU9 A;  4IXA A;  1K79 A;  3K10 A;  5H20 A;  2PX9 A;  2FA5 A;  4MO7 A;  3CJN A;  3TW6 A;  3SHF A;  2E19 A;  4W97 A;  4XK4 A;  2JQ7 A;  2GA1 A;  3KET A;  1SMY F;  2IS2 A;  4C3I J;  3KP6 A;  3UR3 C;  1WVR A;  4BQO A;  4ZTF A;  2FRH A;  3L2C A;  4GCV A;  2HQ5 A;  4IOC F;  5KCM A;  1BL0 A;  3DQV C;  1YJN I;  5FFX A;  3O2P E;  2DPU A;  5DCM B;  3AG1 H;  2EB7 A;  4RLF A;  3DTK A;  4I7H A;  2XRO A;  2HOT A;  4C2T A;  2PMZ N;  3BJ6 A;  4QWQ A;  2DFF A;  4D9J A;  2RRE A;  4BJT A;  1WQ2 A;  4V2G A;  5CVU A;  2VKH A;  1ORK A;  3MKZ A;  3R0J A;  1BW6 A;  2YR2 A;  2W7N A;  5HVQ C;  4BE0 A;  1TWC J;  4KT6 A;  4A3I J;  4XKC A;  3QPS A;  5BMZ A;  4NUB A;  4ON0 A;  2WY7 Q;  3TP0 A;  1TWF J;  3W2W A;  2VN2 A;  1QQI A;  1MMN A;  1H9T A;  3GTQ J;  3BZK A;  4ZC3 A;  5IOZ A;  5EF6 A;  2WAF A;  2Y9Y A;  2JMW A;  1RUO A;  4C2M J;  2VT2 A;  3VYS B;  2HOS A;  1MMD A;  3HG9 A;  4J19 A;  3S3N A;  3LSG A;  2LSO A;  1DUX C;  5CVJ A;  3GW2 A;  2L2O A;  4FX0 A;  1T39 A;  5DS9 A;  3I9V 2;  3J7A Y;  1RKW A;  3CUQ B;  2VE9 A;  3MN2 A;  3QOD A;  2VOD A;  2CYY A;  2QSH X;  1NG7 A;  1W5C C;  3HL2 A;  3OYN A;  4Z6Y A;  1LE8 B;  3M4O J;  3RDI A;  4ZYD A;  3ZQG A;  4F3Q A;  5J1Y A;  3GZ5 A;  3JRI A;  1IRX A;  2O8K A;  3GCM A;  2QEX I;  1OCP A;  3BR0 A;  3G2B A;  2P0W A;  4RAY A;  5GTH C;  3JRE A;  5E17 F;  3DPU A;  2GLO A;  1U0J A;  4U88 A;  1LEA A;  3S3M A;  3MZY A;  3SZT A;  1XMK A;  4M73 A;  1LFB A;  4FAS D;  2L7F P;  2ZJ2 A;  3IC7 A;  3WU0 A;  1J9I A;  2LD5 A;  1R1T A;  2P81 A;  1TNT A;  2DK5 A;  5EEH A;  2CQN A;  4Q48 A;  1IUY A;  1Y8Q B;  2CG4 A;  2X6X A;  5BPD A;  5EYR A;  4MFD A;  4QPO A;  3M3Y J;  2I5U A;  3RQ4 A;  2DT5 A;  4A6E A;  3IKT A;  5ILS A;  3HOT A;  4II3 A;  3WTV C;  4HQM A;  3H3V K;  1HKT A;  1VQK I;  1ZLJ A;  1UEL B;  2Y2Z A;  3EUH C;  1QBJ A;  3OS1 A;  2R3S A;  2K9S A;  3JCU C;  1HST A;  1HSJ A;  1YX3 A;  1Z6T A;  4UY8 I;  3IHU A;  1D1C A;  2VBY A;  1PUF B;  3CC2 I;  4I0A A;  5B3S H;  2HI3 A;  5JFR A;  1MIJ A;  3QWL A;  4PUS A;  1RI7 A;  1IO2 A;  4HAM A;  4A3J J;  1H9G A;  4GGG A;  3ZMU A;  2ZME A;  2OJE D;  1B72 B;  3BPV A;  4EMS A;  4RS8 A;  1DU0 A;  4LB5 A;  2BHY A;  1JKR C;  3BY6 A;  3GUD A;  1Y1V J;  2DOF A;  1OKR A;  5D8K B;  3HOY J;  5IT3 A;  2JUG A;  2YPR A;  1O3T A;  4LG0 B;  1VQN I;  4RB0 A;  4XON A;  2R5Z B;  2IS1 A;  3M07 A;  2RDP A;  5L3G A;  3ROU A;  1W7P D;  1MBJ A;  4ZZD A;  2HS5 A;  2KZG A;  5AIQ A;  3F6V A;  2AS5 F;  3FK7 A;  4AWX B;  2VPR A;  5EDN A;  1DP3 A;  3G1O A;  2JJ7 A;  1YS6 A;  2K3F A;  4A3D J;  3GTJ J;  1R5H A;  2XAF A;  2IAI A;  4FE7 A;  4YEJ A;  2M8E A;  2V26 A;  2EFW A;  1K6O A;  4UUS B;  2BVM A;  1JXS A;  3TDZ C;  1FC3 A;  2HQN A;  3OR1 C;  4S05 A;  3OYJ A;  3HEF A;  5M3F J;  1O57 A;  3K2A A;  4XRS A;  3CMA I;  4GYG A;  4B43 A;  1BI2 A;  4MGR A;  4E7L A;  1QVU A;  4E7Z A;  5C4X J;  2JN6 A;  1L0O C;  4ESB A;  1GVD A;  3V8J A;  1G8X A;  2XIG A;  2IP2 A;  4DYQ A;  3G1M A;  2IBD A;  1QZY A;  2ZXJ A;  2UZK A;  2K9M A;  5M3M J;  3IRR A;  1V4R A;  2BY0 A;  3K1P A;  4EQQ A;  3LNQ A;  4EVI A;  2Z33 A;  2UV1 A;  3GFJ A;  2DA6 A;  5DYM A;  3GTK J;  2VON A;  3WTS C;  3RQI A;  4A3G J;  3DLL F;  1R58 A;  1DGW Y;  4Q4Z F;  5LFA A;  3ZRG A;  5FLM J;  3MD2 A;  3M8F A;  1JUS A;  2L01 A;  2KZV A;  3S93 A;  2HZD A;  3E3V A;  3WHC A;  2JRM A;  3EUA A;  2CQK A;  1XGN A;  1AKH B;  1S8N A;  1B6A A;  2R5Y B;  4F52 A;  4GDF A;  3PSF A;  1P7J A;  1Z21 A;  1T98 A;  1TP4 A;  2CJJ A;  4HYE A;  3F23 A;  3RYR A;  4F93 B;  3I56 I;  2JPC A;  2L7K A;  2W00 A;  5D8L B;  1BA5 A;  2OZU A;  2LR8 A;  2Z99 A;  4XLF A;  2PJR B;  2M7B A;  4MEY F;  2KIU A;  2RN7 A;  2F5C A;  3HKZ A;  3U1K A;  1Z3X A;  3ZMT A;  1FTT A;  2R93 J;  4YFN F;  2XPU A;  1WJ5 A;  3WU2 C;  1ZG1 A;  1LFU P;  4A2U A;  1T2K A;  1I1S A;  1ENH A;  2BW3 A;  2JSC A;  5AIP A;  2CUZ A;  2R92 J;  4A69 C;  3MQ0 A;  1KYW A;  5LRS A;  1Q1V A;  1D8K A;  1M1E B;  3WHB A;  4DYC A;  3GTG J;  3OIO A;  4BY1 J;  4OAZ A;  5IOY A;  3FXU A;  4KN7 X;  1XC5 A;  3I3L A;  2KT0 A;  3TO7 A;  4DBR A;  2XAG A;  4EJW A;  2ZSI B;  2FUG 2;  2QBY B;  4XNF A;  2EFQ A;  2LTP A;  4BJ6 C;  3LFU A;  1YTY A;  1UAA A;  3IL2 A;  4XRF A;  3OOU A;  3ZQH A;  3PNV A;  3ELK A;  3H9J A;  5CKT A;  1B8I A;  4U0W A;  4XM3 A;  3OYH A;  3WGG A;  4IVN A;  3EQL F;  3TED A;  5HLH A;  4IHS A;  2WC2 A;  3K69 A;  4BBR J;  4XL9 A;  2NS8 A;  3GEZ A;  4EM2 A;  4CXF A;  4BNC A;  3GYH X;  2JT1 A;  2WB1 N;  2BY3 A;  3R0A A;  3K7A J;  2DA2 A;  5E3O A;  3BLY A;  2L4M A;  3S1M J;  1E3O C;  1FIP A;  1IN5 A;  1H0M A;  4BXF A;  3JRG A;  1DQU A;  4JX4 A;  1GDT A;  1FTZ A;  2KMU A;  3WGH A;  2HFH A;  2NVT J;  4R8H A;  5CVI A;  4FET A;  5ICC A;  4KA4 A;  5HDG A;  1WJD A;  4CZC A;  3VPR A;  3ZCO A;  4BGD A;  4J00 A;  2CW7 A;  1U6G A;  1YW9 A;  2VLA A;  1MMG A;  3ABT A;  1RUN A;  1R5G A;  2P8T A;  3E1S A;  2VJJ A;  2JVH A;  3DPL C;  1LEB A;  2DA7 A;  3JRC A;  1B1B A;  3SQN A;  2JA5 J;  1A31 A;  2H6B A;  1Z7L A;  3JTH A;  3D5R C;  1MW7 A;  2WAE A;  2OBP A;  4HG2 A;  4BKX A;  2H27 A;  1HLV A;  3S14 J;  2H8W A;  2DMN A;  1FPQ A;  4MTD A;  2VQH A;  1U9N A;  3BRO A;  4K2E A;  3RTR A;  1DP7 P;  3C1D A;  2N8G A;  5HOD A;  2ELJ A;  4B3A A;  2ZFW A;  4N4O B;  1VF9 A;  2QQ9 A;  2OD5 A;  2HQR A;  2MW8 A;  2GWR A;  2LKS A;  4UNO A;  1N77 A;  5EGO B;  4ETS A;  4XID A;  2PJP A;  3H3U A;  2XAH A;  1RZ4 A;  3DBL B;  1YW7 A;  2LF8 A;  2GQQ A;  1WJF A;  4BXX J;  3E5Q A;  4M9X A;  1FEX A;  1OJL A;  1CF7 B;  1HXD A;  4MFE A;  5J8C A;  1KON A;  1VQ7 I;  2DLL A;  2XF5 A;  3L7W A;  4YEL A;  1WZ2 A;  1YJ9 I;  5BS6 A;  3G3Z A;  5ED4 A;  4RB1 A;  1U5T C;  3A2K A;  1WWX A;  2CFX A;  3DPT A;  1BIA A;  2F4I A;  2EIJ H;  4KIG A;  4HSR A;  1NK2 P;  3EPZ A;  1NK3 P;  2OV7 A;  2A6H F;  1A04 A;  1NG6 A;  2A68 F;  3E0J B;  2V1N A;  4B47 A;  2EFN A;  3J80 Z;  4HF2 A;  5K1Y A;  1OPC A;  2WB1 A;  1QO0 D;  1R4M B;  1K4T A;  4LIT A;  2GM4 A;  3HRM A;  1ZGJ A;  3GXO A;  2K27 A;  3L2R A;  2RNG A;  3S17 J;  1AA7 A;  4ZYA A;  4Y15 A;  4E7I A;  4A3K J;  3LSH A;  1Z05 A;  4HV6 A;  3JSO A;  2Y0S A;  3AG2 H;  2X85 A;  5J40 A;  2MG4 A;  4NQW A;  2ZJQ F;  1B4A A;  3R6S A;  2DK8 A;  1QVT A;  2ESN A;  4F91 B;  3CO7 C;  2VI6 A;  4PJJ A;  3AAF A;  2KQR A;  3GTO J;  3KFW X;  1S7O A;  2QLZ A;  2OCE A;  3CJQ B;  3HBL A;  4ZDP A;  1SD4 A;  3O8G A;  2OQR A;  1U2W A;  3E6M A;  1X19 A;  5AON A;  4MLO A;  4U87 A;  1PUE E;  3BP8 A;  1ODD A;  2EIN H;  3EUK L;  1SFX A;  3OYG A;  5EJC A;  2ZJR F;  5E18 F;  1V5G A;  3TO6 A;  3JAM K;  1SVM A;  3DF8 A;  4AYB N;  3KCC A;  1YIT I;  3BT9 A;  3F0C A;  4A0X A;  4L5E A;  3BR6 A;  4C30 A;  1SVL A;  4UB6 C;  1I3Q J;  3ERM A;  2MAB A;  2JSP A;  4II2 A;  4BE2 A;  2JA7 J;  3HHH A;  1SAU A;  4GRI A;  3KYL A;  4P96 A;  2EZI A;  1LDJ A;  3DEU A;  2M7A A;  3QYE A;  3GFM A;  3G4S I;  3HOV J;  2CFO A;  4RGR A;  2L54 A;  2DT7 B;  2XGE A;  1MBG A;  2HZT A;  2E34 A;  4RB3 C;  3LST A;  4RMN A;  3FXQ A;  4A93 J;  1I1G A;  2Q2E A;  1IG7 A;  2XVC A;  2X1D A;  3EET A;  2STW A;  3KEQ A;  5EZG A;  4NC6 A;  3CLQ A;  1XGS A;  4UHT A;  1VQL I;  1N75 A;  1O4X A;  2YUS A;  2E2H J;  1XG1 A;  3W3C A;  1EJ9 A;  3ECO A;  3OWT A;  2IGM A;  3D1N I;  3S3O A;  4KT5 C;  1T33 A;  4E4H A;  4CCM A;  3DKX A;  5LD2 C;  2IA0 A;  3OL3 A;  2AQE A;  2DW4 A;  2DOD A;  1IZ1 A;  2AXT C;  4MNU A;  5LBQ A;  2EH3 A;  2HVQ A;  1ZK8 A;  1Z77 A;  4IOA F;  1WPK A;  5F27 A;  1ZG5 A;  3K4L A;  1R23 A;  3BDD A;  4AIH A;  5B66 C;  2NOG A;  1W0U A;  1F9N A;  3U9G A;  1ZR4 A;  2RVC A;  1ETV A;  3BG6 A;  1QNT A;  3DV8 A;  4CGZ A;  1IV8 A;  3I54 A;  1U78 A;  5CVV A;  2LBF A;  2DJN A;  3O8H A;  1IXC A;  4B4C A;  2IA1 A;  1YS7 A;  4BDY A;  3PNT A;  2O5R A;  1XGM A;  3LA7 A;  3EYY A;  3QQA A;  1ON1 A;  1U8R A;  3L2Q A;  1W5T A;  4OWR B;  4P55 A;  1ETX A;  2Q1Z B;  2DA4 A;  5LHI A;  3CCQ I;  3RKY A;  1Y56 A;  4N0B A;  3ZN1 A;  3GO5 A;  2DDB A;  3F6O A;  5D4R A;  3B6A A;  2W4S A;  3ML6 A;  1E17 A;  3SEZ A;  3OMY A;  2MD0 A;  5BQT A;  4E7K A;  2HDD A;  1O3S A;  3ASO H;  2DOE A;  1LQ1 A;  1IXR C;  2MBF A;  5L3F A;  1K6Y A;  4AVZ A;  3L1P A;  1WJA A;  3EUH A;  1MNE A;  3CUQ C;  1U3E M;  1X1C A;  4AD9 A;  2HEO A;  3A0H C;  1LFP A;  4DJA A;  1MJ9 A;  3CJR B;  1JT6 A;  1TQM A;  3K4K A;  1WH7 A;  1YLF A;  2R4G A;  2V9K A;  2LK2 A;  3IV5 A;  5DUK A;  4F55 A;  3L00 A;  3MMY B;  1EH7 A;  1KA8 A;  1MBH A;  4ZTJ A;  4A3B J;  2FQ4 A;  2LKP A;  3KEY A;  3VSL A;  2DTR A;  2CW0 F;  1VI0 A;  2PQ8 A;  1BI0 A;  1NHA A;  3KZZ A;  3T0Y A;  4BEH A;  3A4C A;  4WXC A;  4HLY A;  1MMS A;  1XB4 A;  3LSJ A;  3BWG A;  3KLN A;  3E5U A;  4UB8 C;  2EPF A;  4HEA 2;  4DIQ A;  1FIA A;  5FB2 A;  1UZC A;  3N05 A;  2J5O A;  5J47 A;  4ZDL A;  1GHC A;  1UHM A;  2X4H A;  4NB5 A;  3PL8 A;  5KK1 A;  3QOP A;  4HW0 A;  3Q9S A;  3E6D A;  3OY9 A;  1BOA A;  2BE5 F;  2PEX A;  1X58 A;  3VYR B;  1Z67 A;  2O0Y A;  3ISP A;  3TOB A;  3KYC B;  2NRA C;  1ZYR F;  1U8B A;  3KP2 A;  3ZQL A;  4IHV A;  1RC9 A;  4A3F J;  2I10 A;  2V6C A;  3J81 K;  5FRN A;  2K5C A;  2X1E A;  3CJT B;  3HIF A;  4DNC A;  4I76 A;  3ZMS A;  3FX3 A;  1JHH A;  1XSX A;  2V1X A;  5HDN A;  2M0M A;  2L5Q A;  2HPI A;  2Y30 A;  5FD6 A;  2TRT A;  1TWG J;  1X4P A;  2IXS A;  3OIP A;  5HS9 A;  1F4K A;  3DTE A;  3OYL A;  1OMI A;  1JI8 A;  3OYM A;  2BYV E;  2RGV A;  2R7O A;  4AVP A;  3FMS A;  1P4X A;  2Y0M A;  4CCL A;  1Y0U A;  1J2X A;  2FU4 A;  1I6H J;  3KP4 A;  1OCT C;  1GV5 A;  4KMF A;  3Q0V A;  2FOW A;  1Q1H A;  1SD5 A;  1Z0X A;  5GTI C;  3ONQ A;  1SD6 A;  4CUG A;  5H2F C;  3L9F A;  1Y8R B;  3NAR A;  5GAD J;  1J7K A;  5CQE A;  2BW3 B;  2O3F A;  3HGY A;  1D3Y A;  1J09 A;  3JSP A;  3Q3S A;  3I64 A;  1X1B A;  2L7M P;  4GYI A;  1HA8 A;  3J7A O;  3F22 A;  4UVA A;  4JYK A;  4LK1 F;  1TLH B;  4M6X A;  2EA4 A;  4A12 A;  4ENJ A;  5LGU A;  3BR2 A;  2KP6 A;  5HDK A;  4W1U A;  3JRA A;  2Q8K A;  3ZQF A;  2PLY A;  3CDI A;  3HYI A;  5F1J A;  1B8I B;  5HNH A;  2B7E A;  3ULQ B;  1DU6 A;  3FXO A;  3SXY A;  4BH9 A;  1EKE A;  5E3N A;  1S7A A;  5JVT A;  3BG3 A;  5D5V B;  1E2X A;  3TQN A;  3ASN H;  4IQ4 A;  3KYD B;  3KZY A;  3FWE A;  4BS9 A;  1XS9 A;  2X0L A;  2VOP A;  1TL8 A;  3WTX C;  4HDV A;  5FD5 A;  1OCR H;  5B5E C;  2JRT A;  1QZZ A;  3HPH A;  2R7Z J;  1GUU A;  1ETO A;  2FE3 A;  5HLG A;  3DCF A;  4X1E A;  4BHP A;  2FBH A;  3NEU A;  3I4N J;  4HX8 A;  2DMT A;  1FMV A;  2NNN A;  2H09 A;  4CYC B;  4OIO F;  1K61 A;  1ZGW A;  5F1R A;  2UUZ A;  3TO9 A;  5DM6 F;  4LFU A;  3IKV A;  2K9Q A;  5DM7 F;  3BJO A;  5A2Q Z;  1MSF C;  5ILU A;  3KZI C;  4RGX A;  4Y33 A;  1MBE A;  2FOK A;  3BCA A;  4ZYH A;  1R1V A;  4LGW A;  3AKZ A;  5M5W J;  1T95 A;  2FNP A;  4MQ9 F;  1WKM A;  3P7N A;  2O9L A;  1JT0 A;  2HXI A;  2LVS A;  2ZBK A;  3LA3 A;  4RA2 A;  1ZKG A;  2QUF A;  3A01 A;  1JHF A;  1W1W E;  2IS6 A;  3BG9 A;  3QP5 A;  1BR2 A;  1FOY A;  3HRU A;  1WI9 A;  3T1B A;  3GFI A;  1A36 A;  3V4G A;  3OS2 A;  2MSY A;  2D1V A;  5FKO A;  4YG2 F;  5TRD A;  2EV6 A;  4D7M A;  4OIP F;  2O7O A;  4WXH A;  4BQQ A;  2VPL A;  2EBI A;  4AIK A;  1Z91 A;  4NNJ A;  3ZMV A;  3I71 A;  2XAJ A;  2ZXH A;  4BUP A;  4P5O A;  2XRN A;  4M74 A;  2GAU A;  1IUF A;  2Z16 A;  2CUE A;  4LIU A;  2QM3 A;  5DV5 A;  3AL0 C;  2EZK A;  3LFK A;  4IZZ A;  4YIR X;  4BHB A;  3F8M A;  1JKP C;  3RPU A;  1OYI A;  1TTY A;  1XMA A;  2D2W A;  4IO9 F;  2VB6 A;  3S2H J;  2A61 A;  1IRF A;  4XLE A;  2RKH A;  3JRB A;  2KFD A;  3QAH A;  2L02 A;  4IHT A;  2JVG A;  3HKZ N;  4ENK A;  2IT0 A;  2OA4 A;  1LUJ B;  2PBI A;  3RI4 A;  2L7Z A;  2VJI A;  2NVU B;  1MBK A;  1AWC A;  4NQW B;  3PFI A;  3K9T A;  3TOA A;  5CJ9 A;  1O7L A;  3FIS A;  4GFB A;  2L4A A;  1U5T A;  2RAE A;  1VFC A;  2LY9 A;  3KIO A;  2G7U A;  1AU7 A;  2NNY A;  1IC8 A;  3SYT A;  1YX5 A;  1X3Z B;  3B02 A;  3RZO J;  4BL0 B;  5F0H A;  4L18 B;  2R7X A;  2VXD A;  2XGX A;  3QPL A;  4PFP A;  4RB2 C;  1WH5 A;  4BYY A;  2V9P A;  4D7N A;  4G7O F;  2IW5 A;  4ANJ A;  1S5L C;  1UMQ A;  5JI6 A;  5GP9 A;  3E7L A;  4RDU A;  2JPB A;  2LG4 A;  2QKL B;  3H92 A;  5FKL A;  3MKW B;  3CES A;  2OC6 A;  4M3D A;  2EIL H;  1XDS A;  2JA6 J;  2HXO A;  5FLX K;  3E97 A;  2CQX A;  3V7C A;  3IAS 2;  1N25 A;  4LMY A;  5F64 A;  2K9N A;  1D0X A;  2LH9 A;  3DBH B;  4C2U A;  2CH0 A;  2P5K A;  4RAG A;  1LJ9 A;  1SEU A;  3UNG C;  2K85 A;  2W25 A;  5TJJ A;  2Z5U A;  1SFO J;  4C3H J;  5E8G A;  4OMZ A;  4DOZ A;  3JRH A;  2Q2E B;  2RQQ A;  2UWM A;  3LSK A;  2XDV A;  1R7J A;  5IP9 J;  3KLO A;  5GAE J;  4IHW A;  2PG4 A;  5KAI C;  2LF7 A;  4WXD A;  4KIS A;  1KZH A;  2FX0 A;  2DAO A;  2HNH A;  3KP7 A;  2VKD A;  3COA C;  3CUO A;  4E7J A;  4CCK A;  3BR5 A;  2A07 F;  1E3P A;  1YQA A;  1S29 A;  3HZJ A;  2ME6 A;  4L0Y B;  2D5V A;  5J4V A;  1D8J A;  4ESF A;  2XAS A;  4XKV A;  1GV2 A;  1R36 A;  3F9K A;  3OL4 A;  4X6A J;  1TT5 B;  3V8L A;  4PJN A;  2COB A;  5KVR A;  5D5U B;  4U0Y A;  1HDD C;  3M8E A;  4I02 A;  4LLG F;  2KIS A;  4ABZ A;  3BQZ A;  3I55 I;  3SFI A;  1MND A;  1KQ0 A;  2YSR A;  2B0L A;  2F5E A;  4YFX F;  2H1K A;  4OOI A;  3REO A;  1PDN C;  1HC8 A;  5KNL A;  3LSP A;  4I0B A;  3U2R A;  1OFC X;  2E35 A;  2VKE A;  3OYD A;  1RR7 A;  1OYW A;  2LBF B;  1T0F C;  2FBI A;  1XSD A;  4CIC A;  3C3W A;  4B8X A;  2R0Q C;  5J1U A;  1UG0 A;  5HOO A;  2WY8 Q;  3CZ6 A;  2Y48 A;  3HRS A;  4KNY A;  1RKT A;  3H5A A;  3PIO F;  1KU3 A;  1Y1W J;  1OQY A;  2A5W A;  2H8R A;  1UCR A;  4XKB A;  1UJ8 A;  4FX4 A;  1K78 A;  3C2B A;  4PSX A;  4PJ0 C;  3GVA A;  1IRG A;  2DFE A;  2M87 A;  2CWE A;  3BZ6 A;  1YJW I;  3S2W A;  1IRZ A;  3DU6 A;  4XN3 A;  1SFU A;  5IT9 K;  2QF7 A;  3QYB A;  2RNJ A;  5D5W B;  1LB2 A;  3FXK A;  4M3F A;  4IJA A;  4E6K G;  4EM0 B;  1LNW A;  1UST A;  4IPA A;  2HTS A;  2GOX B;  3DEW A;  3GX4 X;  2MC3 A;  4AUX A;  4Y4R A;  4KIC A;  3IH3 A;  3B6C A;  2KL4 A;  1AOY A;  4MTE A;  2ZCW A;  5GAH J;  5JLW A;  2V9V A;  1YFH A;  4UUV A;  4YII A;  4M9S A;  1FSE A;  2CV0 A;  2VE8 A;  4R1H A;  3KP5 A;  1USS A;  1IAW A;  3QP6 A;  5FKN A;  4DBQ A;  1EA3 A;  1GVJ A;  2HKX A;  1IW7 F;  2MD5 A;  4PZJ A;  2E1O A;  2OCC H;  1WCM J;  2Y0S N;  3Q0W A;  4L9N A;  2FEZ A;  1LKX A;  2LYC A;  1XDU A;  3ZQ7 A;  4BEH B;  3Q9V A;  1YIJ I;  3O6B B;  1DDN A;  2PMU A;  3OYB A;  1X2M A;  2KDO A;  2ECC A;  3X2Q H;  1P7I A;  1ZAO A;  3CDL A;  5J3L A;  3BTJ A;  4Y13 A;  3DFG A;  4E7H A;  3OR2 C;  3S1N J;  2WAQ N;  1X3W B;  3F8N A;  3S1R J;  5C4J J;  2DA5 A;  3ECH A;  4NDL A;  3CDH A;  3KP3 A;  1FOX A;  2ACJ A;  4IEJ A;  4M3G A;  3TW7 A;  1C0W A;  5J4Y A;  1BJA A;  4BAC A;  1FWZ A;  3HM5 A;  3ZR8 X;  3VYT B;  3K1M A;  5L3C A;  3R60 A;  1LE8 A;  3DTI A;  5B1A H;  1YW8 A;  2Z3Y A;  4ASN A;  1QPM A;  1G3T A;  1V5E A;  2QQB A;  3DKY A;  5GAG J;  5M5Y J;  3M7G A;  5IYB J;  3K70 D;  5EEG A;  1YYV A;  1MDM A;  4DQ2 A;  4ZJZ A;  4P9F A;  3S2D J;  3E6C C;  3H0G J;  4A6D A;  3J7Y J;  4JX6 A;  2D1H A;  1IN8 A;  3BTC A;  2XGC A;  1OIS A;  2K4J A;  4LK0 F;  2E2J J;  2GIV A;  3WTY C;  4EGY A;  1J75 A;  1J5Y A;  1HDP A;  3M9A A;  3NWT A;  1QGP A;  1W4M A;  1JUM A;  2NOJ B;  4R79 A;  5LHH A;  4KFC A;  1P9Q C;  5IPA A;  4KYW A;  4EEF G;  2GA2 A;  4AM3 A;  2A05 A;  2X1C A;  3DBR B;  4G6T B;  2X6Y A;  3FK6 A;  1OYY A;  2HVS A;  3H3Z A;  2KHM A;  2ZKZ A;  3C7J A;  1W7P A;  1IV6 A;  2P5V A;  1LPQ A;  1XCV A;  3OYC A;  3GZN B;  1B72 A;  4ENN A;  1TQI A;  2CMP A;  4A5M A;  1P6R A;  1D1B A;  4PSW A;  3OOP A;  2DOA A;  5E8I A;  1XTA A;  2LY1 A;  5K5O A;  1IDZ A;  2WAQ A;  3D5S C;  4BHC A;  4AU7 A;  3JRF A;  3PFY A;  1W5S A;  4BE1 A;  5E3M A;  2M5W A;  4EM1 A;  2M8G X;  1CGP A;  4JX5 A;  1VQ8 I;  3A03 A;  4HST A;  4P1W A;  1XD7 A;  3I59 A;  3TP3 A;  4PCQ A;  1SVO A;  4WWC A;  4KUM A;  3HJE A;  3E5X A;  1EF4 A;  1STZ A;  3LSI A;  4XSZ F;  4HNT A;  2LC2 A;  2FNA A;  5F08 A;  4HNV A;  2OZ6 A;  4PGH A;  1YO5 C;  4XLN F;  1S72 I;  1UFM A;  1G3W A;  4TV7 A;  1REP C;  4BXU A;  2PI0 A;  4G6D A;  3FBN B;  4ZDO A;  4A0Y A;  3BCB A;  3PIP F;  1LDD A;  2E60 A;  2MLK A;  2IGK A;  5ERI A;  3K4C A;  1S6L A;  1EV7 A;  4JQF A;  3RCO A;  4XQF A;  3RZD J;  2AHQ A;  4PK4 A;  3G73 A;  1R6R A;  5E1X A;  2DMP A;  4RAZ A;  3QPH A;  3QPT A;  4QPQ A;  4DYR A;  3SJM A;  4PJM A;  1BC8 C;  2BZT A;  4QTR A;  3IH4 A;  3K4N A;  6PAX A;  2NS0 A;  2XGD A;  3HDD A;  4RM3 A;  1WJE A;  2RQP A;  4BAY A;  2K9L A;  3SDB A;  3GWZ A;  3OSG A;  1WGX A;  3FDY A;  2D45 A;  1D0Y A;  2CSO A;  3CLO A;  4XOR A;  2F48 A;  1FBQ A;  4BQA A;  3K2Z A;  3WTU C;  2FXA A;  3HOX J;  2QCO A;  3BOQ A;  2E5N A;  2L9V A;  4L9V A;  3CCU I;  3G71 I;  2QYO A;  1KU9 A;  1TW2 A;  1TT0 A;  3ABL H;  1POG A;  4B3X A;  2VBX A;  5GPA A;  3V42 A;  3C2G A;  1MBF A;  2M45 A;  5ICG A;  1YIO A;  1OCO H;  5JHU A;  2M2E A;  1R00 A;  5E1W A;  3ABU A;  5GPC A;  1G2H A;  1ZAR A;  3TMO A;  2BVL A;  1T38 A;  1XPX A;  2XSD C;  3VOD A;  4A3E J;  1ZH5 A;  1Z6R A;  1R49 A;  2ZC2 A;  1DPR A;  1X4O A;  3A1Y A;  4ZH4 F;  2FML A;  5KHD A;  1GXP A;  3HB9 A;  4I01 A;  2DN0 A;  2ZME B;  4ZYE A;  4OIQ F;  4MIM A;  2GZW A;  2LNB A;  2XV4 S;  2X6W A;  2FF4 A;  2CQQ A;  2EA2 A;  3H9G A;  4OIN F;  1OCZ H;  2J5P A;  2P4W A;  3MZ8 A;  4XLC A;  4XRS G;  2QA4 I;  3VOE A;  5LEK A;  2EK5 A;  4UV8 A;  2ELH A;  3OV8 A;  1FYK A;  3GF2 A;  4M71 A;  3RIR A;  5L3B A;  1SAX A;  3FHN A;  2GIZ A;  3BZC A;  1A35 A;  2VOO A;  1D5V A;  5K5R A;  2E71 A;  4M9Z A;  4NC7 A;  2OQG A;  2W57 A;  2BY2 A;  2R7S A;  2QVO A;  1IJW C;  1U5T B;  5FFZ A;  3IH2 A;  4OMY A;  2P5L C;  3GFL A;  1OLT A;  1OR7 C;  5TIS C;  4A0Z A;  2XKP A;  1JGG A;  5LLQ A;  2KLO A;  2A6T A;  2A6E F;  2ADU A;  2EWN A;  4YIF A;  3I53 A;  1K4S A;  2ZB9 A;  2Z2S B;  4G8X A;  4O5V A;  2NS7 A;  2VJ4 A;  4XMY A;  2KPM A;  3ZMZ A;  3W6J B;  3FBI B;  2GXG A;  4CCJ A;  1RRJ A;  4HBL A;  4RGU A;  5IY5 H;  2IS4 A;  3CTA A;  3IWF A;  4LOC A;  3WU1 B;  2ID3 A;  1Y0N A;  2QSG X;  3F8B A;  1UHS A;  1F5T A;  1D1A A;  2LDU A;  2FQ3 A;  4XBF A;  1GLN A;  3R61 A;  1ETK A;  1MH4 A;  4L5I A;  2CUF A;  2BY1 A;  5LRR A;  3IWZ A;  3LMM A;  3T8T A;  4G9Y A;  2KIF A;  4I98 B;  1VTN C;  4OAY A;  3N97 A;  4DZP A;  1R22 A;  3J80 K;  3UKG A;  1RNL A;  4FHT A;  3OYK A;  4KIB A;  2HQA A;  4HZF A;  1FOW A;  2XPV A;  3P9I A;  1HOM A;  2BEO A;  2LFB A;  2KRF A;  2HGC A;  1BW5 A;  3KPH A;  4XOP A;  3EDP A;  3HUG A;  3U21 A;  2VXZ A;  2VL8 A;  2IPQ X;  1YOV B;  2NAZ A;  2XB5 A;  3JR9 A;  2CU7 A;  3OYI A;  3CC7 I;  1H88 C;  4PDK A;  3W2V A;  2MGQ A;  2Z9O A;  2V4J C;  1FY7 A;  5CYV A;  1FBU A;  2KDZ A;  2X9D A;  1L3L A;  1P92 A;  4HQE A;  2WTE A;  1F36 A;  4DZJ A;  1JKO C;  2ZFU A;  4P9U A;  3PUB A;  2ISY A;  1IN4 A;  2M34 A;  1CF7 A;  3W6K B;  4RM2 A;  3BC8 A;  2YU9 J;  4HRI A;  3GLX A;  5E79 C;  5D5X B;  2COM A;  3GTM J;  2DQL A;  1HKQ A;  2HYG D;  3H36 A;  1JKQ C;  2Q0O A;  3JW4 A;  4G12 A;  3BQY A;  1FOK A;  1BR1 A;  1BIB A;  1QRY A;  4J01 A;  2DJI A;  1ZRF A;  3RKW A;  1B9N A;  1QA6 A;  4KMU X;  4EJO A;  1K78 B;  1QPI A;  3W2A A;  4HF1 A;  4CDG A;  1T08 B;  4JBA A;  1VZ0 A;  1W36 D;  3BTI A;  1MZB A;  4EGZ A;  3F8F A;  4WK8 F;  2AQF A;  1MMA A;  4CZZ A;  1MH3 A;  2A3S A;  3G1L A;  4U7D A;  2HOE A;  2XKO A;  3SEQ A;  1WHU A;  2BXY A;  3SZP A;  3VFZ A;  3GBG A;  4HV5 A;  2Z1D A;  4CH7 A;  2O61 A;  1TWH J;  3QU6 A;  2UXN A;  3F3X A;  3I58 A;  1X1D A;  1YHQ I;  2KRH A;  4BDZ A;  3WGI A;  1QU3 A;  2VUM J;  3WG9 A;  3ZXS A;  3PSI A;  2ZXW H;  2OU2 A;  3CCM I;  2H1L A;  4XR6 A;  1EH6 A;  2E1M B;  3KX2 A;  4HA8 A;  5EG0 A;  4D0P A;  2W82 A;  3H35 A;  2KIQ A;  1JTX A;  1T0F A;  5FGM A;  1ZEL A;  1PVE A;  2TCT A;  1TW3 A;  1T8I A;  5FRM A;  1S9H A;  2A5Y B;  2O03 A;  4CO8 A;  1QHH D;  2FBK A;  4OIR F;  2L9S A;  3N4M A;  2MLG A;  2XRL A;  2NVX J;  4O6J A;  2DU9 A;  1S7E A;  3PQJ A;  3GTL J;  1X1P A;  1MD0 A;  4A5N A;  4A3C J;  3PJR A;  3CMM A;  2ISZ A;  5LHG A;  5J1R A;  5LGN A;  3TGN A;  3KEO A;  3LSM A;  2VQC A;  5LGT A;  2VQL A;  3HXL A;  4WX9 A;  2JZY A;  3WE3 A;  1T56 A;  1PJR A;  4YFK F;  3DLA A;  5K7F A;  1P4W A;  4KN4 X;  3IRQ A;  3W6V A;  2LKX A;  3V7R A;  2LRE A;  4UVB A;  4HNU A;  1KQ9 A;  3DKW A;  1FP1 D;  3K4M A;  4EJT A;  2ME0 A;  4L9J A;  3RPQ A;  4LLN A;  1KU7 A;  2EZL A;  5F0C A;  1CQT A;  1R9T J;  2PFB A;  2RV8 A;  3VEP A;  3DWL E;  1ZLK A;  2K86 A;  2DO7 A;  1FNN A;  4CHU A;  9ANT A;  1KGS A;  3NAU A;  4YRV A;  5IT9 Z;  1UB9 A;  3FXJ A;  4XIC A;  2ZJP F;  1KYZ A;  4QLC U;  4XN0 A;  3K1N A;  2UXX A;  2DFI A;  1ZRC A;  4LJZ F;  2LMD A;  1IF1 A;  2ZXI A;  5J6X A;  1KU2 A;  2DYR H;  1XMX A;  3H5R A;  3M8J A;  1I27 A;  4HF0 A;  1MDM B;  2M4G A;  3MZH A;  2EJR A;  4EAT A;  2E36 A;  1RR8 C;  1ZN2 A;  1P4A A;  1SAN A;  2R7T A;  2CS3 A;  1R1U A;  2EV5 A;  4IRH A;  5ICF A;  3S1Q J;  5HNF A;  1TC3 C;  2WWY A;  2VAS A;  5H6R A;  2BGC A;  2PMZ A;  4IQJ A;  1FT9 A;  4FIS A;  1BC7 C;  4DW6 A;  4Z2Y A;  3ZP5 A;  4UV9 A;  2YS9 A;  1V54 H;  3DEE A;  3FMR A;  1X2N A;  5IYD J;  4KDP A;  2L3D A;  3FM5 A;  1SC7 A;  1SFK A;  3V7S A;  3AG4 H;  4AID A;  5E1Z B;  2VIX A;  3ZN0 A;  3H0D A;  2AO9 A;  4ENM A;  2K3P A;  1W7P B;  1BN5 A;  2NVY J;  2ZO4 A;  3J7Z I;  2V7F A;  3ABM H;  2Y9Z A;  2R7V A;  5CLS A;  2DDA A;  1YRN A;  2QZ8 A;  2QGU A;  3TBI A;  4XLP F;  4N4N B;  1TWA J;  2BV6 A;  1ETQ A;  3K4J A;  3PO3 J;  3PUF A;  2KJB A;  3S15 J;  2W24 A;  4KIT B;  4V19 K;  4QSH A;  2I8D A;  2JWT A;  2O8X A;  1WSU A;  3MAJ A;  2DCE A;  3Q5F A;  4N9H A;  4N9I A;  3HTU A;  4M6V A;  3L2U A;  3ZMD A;  2X6O A;  3F72 A;  1E0E A;  3LL7 A;  3K70 C;  3ZQC A;  3I59 B;  1ULY A;  2DA1 A;  4AC0 A;  1X3U A;  2W84 A;  4XLA A;  1Y39 A;  2CUJ A;  2KJC A;  1LDK B;  2JK3 A;  2XF7 A;  2OTJ I;  3K0L A;  1PP7 U;  2VBZ A;  1IN7 A;  4RBO A;  3BR3 A;  2EIK H;  3OYE A;  4Q47 A;  1VND A;  3JRD A;  1GT0 C;  2QSF X;  3CMY A;  2E2I J;  3KE2 A;  3HGG A;  4XRM A;  1HF0 A;  2A69 F;  2X48 A;  3D5L A;  2IA2 A;  2DT6 A;  2IVM A;  1HKS A;  1IGN A;  1BR4 A;  3MWM A;  3BR1 A;  3AFH A;  4ESJ A;  5L3D A;  4JP0 A;  3I5U A;  1XSV A;  5JR3 A;  3R4K A;  4UVC A;  2HVR A;  2G7H A;  1BI1 A;  1G3Y A;  2FMY A;  3BJA A;  4C3J J;  2ICW G;  4L5J A;  3HOS A;  5D6F A;  5KAF C;  1WRJ A;  2GBY A;  1Y6I A;  2BOL A;  3C2H A;  2KIM A;  2G9W A;  5DEQ A;  2HDC A;  4ZYG A;  2ZSH B;  5FKM A;  2F4M B;  3GME A;  3DU5 A;  3WTW C;  4L0Z B;  2XF6 A;  3H1C A;  1MNM C;  4PJL A;  4D1Q A;  2EIM H;  4L9T A;  3LAP A;  4IHX A;  3DXJ F;  2B63 J;  1F1Z A;  5D6E A;  3OSF A;  4LIV A;  4F92 B;  3JAM Z;  1ZG3 A;  3OS0 A;  1NTC A;  3WG7 H;  3S16 J;  2FD5 A;  4XOT A;  5ILV A;  2M1B A;  2R7D A;  4IF4 A;  1YI2 I;  2E1N A;  5JVG F;  2P6S A;  1I5Z A;  4S04 A;  3FZV A;  4V2F A;  4EV0 A;  1B9M A;  2ELK A;  3ZQI A;  1R5I D;  2VKV A;  1IDY A;  2V1D A;  2DYS H;  3CQZ J;  2WAD A;  3HSR A;  4RLQ A;  4FTH A;  2MC4 A;  2C6Y A;  1ZRE A;  4CSW A;  1F43 A;  4NBQ A;  3F8C A;  3BPX A;  1V5F A;  1R4N B;  5DCM A;  2CV1 A;  1V55 H;  2JA2 A;  2P6T A;  3WTT C;  4LLL A;  4G94 A;  1A6I A;  3CCY A;  5DUI A;  5A2Q K;  2LY2 A;  2QQA A;  1N78 A;  2DI3 A;  2ETH A;  4U0V A;  2VBW A;  5LEJ A;  1HW1 A;  1IXS B;  3CME I;  2DFH A;  2M9H A;  5FJ8 J;  1WFX A;  2DA3 A;  1J59 A;  1JJ6 C;  2MFZ A;  4BBS J;  3TL4 X;  2IGO A;  1A6Q A;  3AL0 B;  2HOA A;  1B59 A;  2L9R A;  2CO5 A;  2XSJ C;  4I2O A;  4WCG A;  3FXM A;  1WI3 A;  3VSK A;  1UG2 A;  3LQR A;  2DBB A;  3MCZ A;  2FSW A;  1ETY A;  3OIQ A;  1MSE C;  3HSF A;  2CV2 A;  1D5Y A;  3RYP A;  3CC4 I;  4DGW B;  3WE2 A;  3B73 A;  2F2E A;  3CCL I;  2HYF A;  1QZE A;  2DQR A;  3MKL A;  5C3E J;  2BXZ A;  3AG3 H;  1FMW A;  1XX5 A;  1MJB A;  5TGT A;  4B1R A;  3IP4 B;  2IRF G;  2HWV A;  3CCJ I;  2W48 A;  5BPI A;  3GTP J;  5K5Q A;  1AHD P;  3I4P A;  1JTY A;  2OF7 A;  5EEA A;  3HPG A;  4BQN A;  1R71 A;  4FE4 A;  4X0G A;  3PM1 A;  4A3L J;  3RKX A;  2R7R A;  3CUQ A;  1O3Q A;  2XPW A;  2ECB A;  4I6Z A;  2NVQ J;  2QKM B;  1FBS A;  1A5J A;  3FKI J;  1OR7 A;  4CYC A;  2M0C A;  3QRF F;  2E5Z A;  3FMQ A;  1V3F A;  1Z7U A;  2V79 A;  2CW8 A;  1HBX G;  2ZME C;  5IYC J;  2MYS A;  3HUG B;  3NRV A;  1PP8 F;  3S8P A;  4M6Y A;  5IP7 J;  4XKW A;  4QIW N;  1JJ8 C;  1H89 C;  1MJA A;  5JLX A;  1K7A A;  4U7B A;  3K4B A;  1BBY A;  4OU0 A;  2K4B A;  3FXL A; 
#chains in the Genus database with same CATH homology
 1ZHF A;  1ON2 A;  5FO5 A;  1G4D A;  1P2F A;  4RGS A;  1I6X A;  1DPU A;  3T5X A;  4HLX A;  3TDU C;  4UXN A;  4CYD A;  2Y75 A;  3RJP A;  5BOX A;  4IRG A;  2V1U A;  3FXR A;  3LQQ A;  3HTS B;  1EH8 A;  1O7F A;  3V8K A;  4ZZL A;  1MKM A;  2JTV A;  2RC4 A;  1RIO H;  1TNS A;  3J81 Z;  4F7Z A;  3L09 A;  4M72 A;  4LG0 A;  2QEN A;  3MEX A;  1G6N A;  2YX7 A;  4G6Q A;  3QU3 A;  1GXQ A;  2MA3 A;  5E20 A;  5DCF A;  4WF2 A;  4HDU A;  4HX4 A;  3C18 A;  3MFK A;  2EFO A;  3F21 A;  1IN6 A;  2GXB A;  2NYX A;  2MH2 A;  1ONV A;  4O3M A;  1BM9 A;  3ERE D;  2E7W A;  1XGO A;  4PGG A;  3HSE A;  1TQP A;  1Z9C A;  3FHZ A;  1ZGA A;  5H6Q A;  1UHW A;  2YU3 A;  3E6B A;  3EYI A;  5HS8 A;  5HLI A;  4EJU A;  4AIJ A;  3I0T A;  2KKO A;  1ZRD A;  4LB6 B;  2F5D A;  3JTG A;  1JE8 A;  3FM3 A;  1BI3 A;  2P7C B;  4XSX F;  1KQ8 A;  2PMH A;  5HS7 A;  5L3E A;  3M1E A;  1J0R A;  1FLI A;  2VT3 A;  4EJV A;  1TBX A;  2OAZ A;  2BBY A;  2H94 A;  4NHJ A;  3WOD F;  5CVR A;  2VC0 A;  2XHK A;  2EV0 A;  2XAQ A;  3HRT A;  1SMT A;  3P9K A;  1SD7 A;  2K02 A;  3CO6 C;  2YX4 A;  1FZP B;  4GXO A;  1SFE A;  3P9C A;  1HW2 A;  3LWF A;  4HOB A;  2ZNZ A;  4Y17 A;  4JK1 X;  4B09 A;  3PQK A;  2QWW A;  2H6C A;  2ZNY A;  2QBY A;  2VC1 A;  1XCB A;  2TDX A;  3T8R A;  2IJL A;  3WTZ A;  1Z1D A;  2HKO A;  2O6G E;  1G3S A;  3FF5 A;  5DD4 A;  2K7L A;  3DP7 A;  4MEX F;  1LVA A;  2AXL A;  5DDG A;  2M30 A;  5D4S A;  2E7X A;  4H0E A;  4MHG A;  1FP2 A;  1XN7 A;  3TKY A;  1T6S A;  3U1D A;  3O3K A;  3VB2 A;  5F6F A;  3LAJ A;  5J8F A;  2R7F A;  4GO1 A;  2CGP A;  4MQV A;  4G7H F;  2HR3 A;  2P7V B;  4Q5S F;  1S3J A;  2PN6 A;  3GZ6 A;  2DPD A;  4FT8 A;  2E1C A;  4I09 A;  2MH9 A;  4KIF A;  1FYM A;  4IRI A;  2STT A;  1HW5 A;  3NQO A;  2W85 A;  2ESH A;  2F5F A;  3LA2 A;  1HQC A;  2XUB A;  4HX7 A;  1MGT A;  2HTJ A;  3D0S A;  3HHG A;  4E70 A;  5DD8 A;  1YG2 A;  3ZPL A;  1O3R A;  3SFZ A;  1FYL A;  2EFP A;  4G7Z F;  4LD5 A;  5FLX Z;  1FSH A;  2WV0 A;  5ICE A;  1FX7 A;  1JGS A;  4IXA A;  1K79 A;  5H20 A;  2FA5 A;  3CJN A;  3SHF A;  2GA1 A;  3KET A;  1SMY F;  3KP6 A;  2FRH A;  3L2C A;  4GCV A;  3DQV C;  5FFX A;  3O2P E;  2DPU A;  5DCM B;  2EB7 A;  4I7H A;  2XRO A;  3BJ6 A;  4QWQ A;  1WQ2 A;  5CVU A;  3R0J A;  2YR2 A;  5HVQ C;  5BMZ A;  4ON0 A;  2VN2 A;  1QQI A;  1H9T A;  1RUO A;  2VT2 A;  2LSO A;  1DUX C;  5CVJ A;  3GW2 A;  4FX0 A;  1T39 A;  3CUQ B;  2VE9 A;  2VOD A;  2CYY A;  3RDI A;  4ZYD A;  3GZ5 A;  4RAY A;  5E17 F;  4U88 A;  1LEA A;  3MZY A;  3SZT A;  1XMK A;  4M73 A;  3WU0 A;  2ZJ2 A;  3IC7 A;  1J9I A;  1R1T A;  1TNT A;  2DK5 A;  5EEH A;  4Q48 A;  1IUY A;  2CG4 A;  5BPD A;  2DT5 A;  4A6E A;  3IKT A;  5ILS A;  3HOT A;  3WTV C;  4HQM A;  1HKT A;  1ZLJ A;  1QBJ A;  2R3S A;  1HST A;  1HSJ A;  1Z6T A;  3IHU A;  2VBY A;  4I0A A;  5JFR A;  1RI7 A;  4HAM A;  1H9G A;  4GGG A;  3ZMU A;  2ZME A;  3BPV A;  4EMS A;  4RS8 A;  4LB5 A;  3BY6 A;  3GUD A;  1OKR A;  5D8K B;  5IT3 A;  2YPR A;  1O3T A;  4LG0 B;  4RB0 A;  2RDP A;  5L3G A;  3ROU A;  1W7P D;  4ZZD A;  2HS5 A;  5AIQ A;  3F6V A;  2AS5 F;  4AWX B;  1YS6 A;  1R5H A;  2XAF A;  2M8E A;  2EFW A;  1K6O A;  1JXS A;  3TDZ C;  1FC3 A;  2HQN A;  4S05 A;  1O57 A;  4GYG A;  1BI2 A;  4MGR A;  1L0O C;  4ESB A;  3V8J A;  2XIG A;  2IP2 A;  1QZY A;  2ZXJ A;  2UZK A;  3IRR A;  1V4R A;  3K1P A;  4EQQ A;  4EVI A;  2Z33 A;  3GFJ A;  5DYM A;  2VON A;  3WTS C;  1R58 A;  4Q4Z F;  3M8F A;  2L01 A;  3E3V A;  2CQK A;  1XGN A;  1S8N A;  1B6A A;  1T98 A;  4HYE A;  3F23 A;  3RYR A;  2JPC A;  5D8L B;  2OZU A;  2Z99 A;  4MEY F;  2KIU A;  2RN7 A;  2F5C A;  3ZMT A;  4YFN F;  1ZG1 A;  4A2U A;  1T2K A;  1I1S A;  2JSC A;  5AIP A;  3MQ0 A;  1KYW A;  5LRS A;  1D8K A;  3FXU A;  4KN7 X;  3TO7 A;  2XAG A;  4EJW A;  2QBY B;  2EFQ A;  1YTY A;  3IL2 A;  4XRF A;  3ELK A;  4U0W A;  3WGG A;  4IVN A;  3EQL F;  4IHS A;  5HLH A;  2WC2 A;  3K69 A;  4EM2 A;  3GEZ A;  4CXF A;  4BNC A;  3GYH X;  2JT1 A;  3R0A A;  2L4M A;  1IN5 A;  1H0M A;  3WGH A;  2HFH A;  4R8H A;  5CVI A;  5ICC A;  4KA4 A;  5HDG A;  1U6G A;  1YW9 A;  3ABT A;  1RUN A;  1R5G A;  2P8T A;  3DPL C;  1LEB A;  1B1B A;  3SQN A;  2H6B A;  3JTH A;  2OBP A;  2H27 A;  1FPQ A;  4MTD A;  3BRO A;  4K2E A;  3RTR A;  1DP7 P;  3C1D A;  2ZFW A;  2QQ9 A;  2OD5 A;  2HQR A;  2GWR A;  4UNO A;  4ETS A;  2PJP A;  3H3U A;  2XAH A;  1RZ4 A;  1YW7 A;  2LF8 A;  2GQQ A;  3E5Q A;  4M9X A;  1CF7 B;  1HXD A;  5J8C A;  2DLL A;  3L7W A;  5BS6 A;  3G3Z A;  5ED4 A;  4RB1 A;  1U5T C;  1WWX A;  2CFX A;  3DPT A;  1BIA A;  4KIG A;  2A6H F;  1A04 A;  2A68 F;  2EFN A;  3J80 Z;  4HF2 A;  5K1Y A;  1OPC A;  1QO0 D;  3HRM A;  1ZGJ A;  3GXO A;  2K27 A;  4Y15 A;  1Z05 A;  4HV6 A;  3JSO A;  4NQW A;  1B4A A;  3R6S A;  2DK8 A;  2ESN A;  3CO7 C;  3AAF A;  3KFW X;  1S7O A;  2QLZ A;  1SD4 A;  2OQR A;  1U2W A;  3E6M A;  5AON A;  1PUE E;  3BP8 A;  1ODD A;  1SFX A;  5E18 F;  3TO6 A;  3JAM K;  3DF8 A;  3KCC A;  4A0X A;  3HHH A;  4P96 A;  1LDJ A;  3DEU A;  3GFM A;  4RGR A;  2L54 A;  2HZT A;  4RB3 C;  3LST A;  3FXQ A;  1I1G A;  2Q2E A;  2XVC A;  3EET A;  2STW A;  3KEQ A;  1XGS A;  4UHT A;  3ECO A;  4KT5 C;  2IA0 A;  2DW4 A;  1IZ1 A;  4MNU A;  5LBQ A;  1ZG5 A;  1R23 A;  3BDD A;  4AIH A;  1F9N A;  3U9G A;  2RVC A;  1QNT A;  3DV8 A;  4CGZ A;  3I54 A;  1U78 A;  5CVV A;  1IXC A;  2IA1 A;  1YS7 A;  1XGM A;  3LA7 A;  3EYY A;  1ON1 A;  1U8R A;  1W5T A;  4P55 A;  5LHI A;  3RKY A;  4N0B A;  3ZN1 A;  3GO5 A;  3F6O A;  5D4R A;  3ML6 A;  1E17 A;  5BQT A;  1O3S A;  1LQ1 A;  1IXR C;  2MBF A;  5L3F A;  3EUH A;  3CUQ C;  1U3E M;  4AD9 A;  2HEO A;  1MJ9 A;  1TQM A;  1YLF A;  5DUK A;  3L00 A;  1EH7 A;  1KA8 A;  2LKP A;  2DTR A;  2CW0 F;  2PQ8 A;  1BI0 A;  1NHA A;  3KZZ A;  3T0Y A;  4WXC A;  4HLY A;  1XB4 A;  3BWG A;  3KLN A;  3E5U A;  5FB2 A;  2J5O A;  1GHC A;  1UHM A;  2X4H A;  4NB5 A;  5KK1 A;  3QOP A;  4HW0 A;  3Q9S A;  3E6D A;  1BOA A;  2BE5 F;  2PEX A;  2O0Y A;  3ISP A;  3TOB A;  2NRA C;  1ZYR F;  3KP2 A;  2V6C A;  3J81 K;  3HIF A;  4DNC A;  3ZMS A;  3FX3 A;  5HDN A;  1JHH A;  1XSX A;  2V1X A;  5FD6 A;  5HS9 A;  1F4K A;  1OMI A;  2BYV E;  2RGV A;  4AVP A;  3FMS A;  1P4X A;  2Y0M A;  1Y0U A;  1J2X A;  2FU4 A;  3KP4 A;  4KMF A;  1Q1H A;  1SD5 A;  1SD6 A;  3L9F A;  1J7K A;  2O3F A;  1D3Y A;  3JSP A;  3I64 A;  4GYI A;  3J7A O;  3F22 A;  4UVA A;  4LK1 F;  1TLH B;  4M6X A;  2EA4 A;  4A12 A;  4ENJ A;  5LGU A;  5HDK A;  2Q8K A;  2PLY A;  3HYI A;  3ULQ B;  3SXY A;  4BH9 A;  1S7A A;  5JVT A;  5D5V B;  1E2X A;  3TQN A;  3KZY A;  3FWE A;  2X0L A;  2VOP A;  3WTX C;  4HDV A;  5FD5 A;  2JRT A;  1QZZ A;  5HLG A;  2FE3 A;  4BHP A;  2FBH A;  3NEU A;  4HX8 A;  2NNN A;  2H09 A;  4OIO F;  5F1R A;  3TO9 A;  4LFU A;  3IKV A;  3BJO A;  5A2Q Z;  5ILU A;  4RGX A;  2FOK A;  4ZYH A;  1R1V A;  4LGW A;  2FNP A;  4MQ9 F;  1WKM A;  3P7N A;  3LA3 A;  2ZBK A;  2QUF A;  1JHF A;  3QP5 A;  3HRU A;  1WI9 A;  3T1B A;  3GFI A;  3V4G A;  2D1V A;  4YG2 F;  5TRD A;  2EV6 A;  4OIP F;  4WXH A;  4AIK A;  1Z91 A;  3ZMV A;  3I71 A;  2XAJ A;  4P5O A;  2XRN A;  4M74 A;  2GAU A;  5DV5 A;  2QM3 A;  3LFK A;  4BHB A;  3F8M A;  3RPU A;  1OYI A;  1TTY A;  1XMA A;  2D2W A;  2A61 A;  1IRF A;  2RKH A;  3QAH A;  2L02 A;  4IHT A;  4ENK A;  2IT0 A;  2OA4 A;  2PBI A;  3RI4 A;  1AWC A;  3PFI A;  3K9T A;  3TOA A;  5CJ9 A;  1O7L A;  2L4A A;  1U5T A;  2G7U A;  2NNY A;  3B02 A;  4L18 B;  2XGX A;  4RB2 C;  4BYY A;  4G7O F;  2IW5 A;  5JI6 A;  2JPB A;  3H92 A;  1XDS A;  5FLX K;  3E97 A;  3V7C A;  4LMY A;  5F64 A;  2P5K A;  1LJ9 A;  2W25 A;  5TJJ A;  2Z5U A;  5E8G A;  4OMZ A;  2UWM A;  1R7J A;  3KLO A;  2PG4 A;  2LF7 A;  4WXD A;  2DAO A;  3KP7 A;  3COA C;  3CUO A;  2A07 F;  1YQA A;  4L0Y B;  1S29 A;  1D8J A;  4ESF A;  2XAS A;  1R36 A;  3V8L A;  5KVR A;  5D5U B;  4U0Y A;  3M8E A;  4I02 A;  4LLG F;  1KQ0 A;  2YSR A;  2B0L A;  2F5E A;  4YFX F;  4OOI A;  3REO A;  1PDN C;  4I0B A;  3U2R A;  1OYW A;  2FBI A;  1XSD A;  4CIC A;  3C3W A;  4B8X A;  5HOO A;  2Y48 A;  3HRS A;  4KNY A;  1KU3 A;  1UCR A;  4FX4 A;  1K78 A;  3GVA A;  1IRG A;  2M87 A;  3BZ6 A;  2CWE A;  3S2W A;  1SFU A;  5IT9 K;  2RNJ A;  5D5W B;  1LB2 A;  4IJA A;  4EM0 B;  4IPA A;  1LNW A;  1UST A;  2HTS A;  3GX4 X;  2MC3 A;  4KIC A;  1AOY A;  4MTE A;  2ZCW A;  2V9V A;  1YFH A;  4UUV A;  4YII A;  4M9S A;  1FSE A;  2VE8 A;  4R1H A;  3KP5 A;  1USS A;  1IAW A;  3QP6 A;  1GVJ A;  2HKX A;  1IW7 F;  2MD5 A;  4PZJ A;  4L9N A;  3ZQ7 A;  2FEZ A;  1XDU A;  1DDN A;  3Q9V A;  3O6B B;  2PMU A;  1ZAO A;  4Y13 A;  3DFG A;  3F8N A;  3ECH A;  3CDH A;  3KP3 A;  2ACJ A;  1C0W A;  1BJA A;  1FWZ A;  3K1M A;  5L3C A;  3R60 A;  1YW8 A;  2Z3Y A;  4ASN A;  1QPM A;  1G3T A;  2QQB A;  3M7G A;  5EEG A;  1YYV A;  1MDM A;  4DQ2 A;  4P9F A;  3E6C C;  4A6D A;  2D1H A;  1IN8 A;  2K4J A;  4LK0 F;  2GIV A;  3WTY C;  4EGY A;  1J75 A;  1J5Y A;  3M9A A;  1QGP A;  1W4M A;  4R79 A;  5LHH A;  4KFC A;  4KYW A;  2GA2 A;  1OYY A;  3H3Z A;  2ZKZ A;  3C7J A;  1W7P A;  2P5V A;  1XCV A;  4ENN A;  1TQI A;  4A5M A;  1P6R A;  3OOP A;  5E8I A;  5K5O A;  4BHC A;  1W5S A;  2M5W A;  4EM1 A;  1CGP A;  1XD7 A;  3I59 A;  4PCQ A;  4WWC A;  4KUM A;  3E5X A;  1STZ A;  4XSZ F;  2FNA A;  2OZ6 A;  4PGH A;  1YO5 C;  4XLN F;  1UFM A;  1G3W A;  4TV7 A;  1REP C;  4BXU A;  2PI0 A;  4G6D A;  4A0Y A;  1LDD A;  2MLK A;  5ERI A;  1S6L A;  1EV7 A;  4JQF A;  3G73 A;  5E1X A;  4RAZ A;  3QPH A;  3QPT A;  1BC8 C;  6PAX A;  2NS0 A;  2RQP A;  4BAY A;  3GWZ A;  2D45 A;  2CSO A;  3CLO A;  1FBQ A;  4BQA A;  3K2Z A;  3WTU C;  2FXA A;  3BOQ A;  4L9V A;  2QYO A;  1KU9 A;  1TW2 A;  2VBX A;  2M45 A;  5ICG A;  1YIO A;  5JHU A;  1R00 A;  5E1W A;  3ABU A;  1ZAR A;  1T38 A;  3VOD A;  1ZH5 A;  1Z6R A;  1DPR A;  1GXP A;  4ZH4 F;  2FML A;  4I01 A;  2ZME B;  4ZYE A;  4OIQ F;  2GZW A;  2LNB A;  2XV4 S;  2FF4 A;  2EA2 A;  4OIN F;  2J5P A;  2P4W A;  3VOE A;  5LEK A;  2EK5 A;  4UV8 A;  2ELH A;  3OV8 A;  1FYK A;  3GF2 A;  4M71 A;  3RIR A;  5L3B A;  1SAX A;  1D5V A;  2VOO A;  5K5R A;  4M9Z A;  2OQG A;  2W57 A;  2QVO A;  1U5T B;  5FFZ A;  4OMY A;  2P5L C;  3GFL A;  4A0Z A;  2XKP A;  5LLQ A;  2A6E F;  2ADU A;  2EWN A;  4YIF A;  3I53 A;  4G8X A;  4O5V A;  3ZMZ A;  3W6J B;  2GXG A;  4HBL A;  4RGU A;  3CTA A;  3IWF A;  3WU1 B;  3F8B A;  1F5T A;  2LDU A;  2FQ3 A;  4XBF A;  3R61 A;  4L5I A;  5LRR A;  3T8T A;  3IWZ A;  4G9Y A;  2KIF A;  4I98 B;  1VTN C;  3N97 A;  1R22 A;  3J80 K;  1RNL A;  4FHT A;  4KIB A;  4HZF A;  3P9I A;  2BEO A;  2KRF A;  2HGC A;  3EDP A;  3HUG A;  2VXZ A;  2IPQ X;  2NAZ A;  4PDK A;  2Z9O A;  1FY7 A;  5CYV A;  1FBU A;  1L3L A;  1P92 A;  4HQE A;  2WTE A;  4P9U A;  2ISY A;  1IN4 A;  1CF7 A;  3W6K B;  3GLX A;  5D5X B;  2COM A;  2DQL A;  1HKQ A;  2HYG D;  2Q0O A;  3JW4 A;  1FOK A;  1BIB A;  1ZRF A;  3RKW A;  1B9N A;  4KMU X;  4EJO A;  1K78 B;  4HF1 A;  4CDG A;  4JBA A;  1MZB A;  4EGZ A;  3F8F A;  4WK8 F;  4CZZ A;  2A3S A;  4U7D A;  2HOE A;  2XKO A;  3VFZ A;  3SZP A;  2O61 A;  4HV5 A;  3QU6 A;  2UXN A;  3F3X A;  3I58 A;  3WGI A;  3WG9 A;  2OU2 A;  1EH6 A;  4HA8 A;  4D0P A;  1T0F A;  5FGM A;  1TW3 A;  2A5Y B;  2O03 A;  4CO8 A;  2FBK A;  4OIR F;  3N4M A;  2MLG A;  4O6J A;  2DU9 A;  3PQJ A;  1MD0 A;  4A5N A;  2ISZ A;  5LHG A;  5LGN A;  3TGN A;  3KEO A;  5LGT A;  4WX9 A;  2JZY A;  3WE3 A;  4YFK F;  1P4W A;  4KN4 X;  3IRQ A;  3V7R A;  4UVB A;  1KQ9 A;  3DKW A;  1FP1 D;  4EJT A;  4L9J A;  3RPQ A;  4LLN A;  1KU7 A;  2PFB A;  2RV8 A;  3VEP A;  1ZLK A;  2K86 A;  2DO7 A;  1FNN A;  4CHU A;  5IT9 Z;  1KGS A;  1UB9 A;  1KYZ A;  4QLC U;  3K1N A;  2UXX A;  2DFI A;  1ZRC A;  4LJZ F;  1IF1 A;  5J6X A;  1KU2 A;  1I27 A;  4HF0 A;  1MDM B;  3MZH A;  2EJR A;  1ZN2 A;  1P4A A;  1R1U A;  2EV5 A;  4IRH A;  5ICF A;  2WWY A;  5H6R A;  2BGC A;  1FT9 A;  1BC7 C;  4Z2Y A;  3ZP5 A;  4UV9 A;  3FMR A;  4KDP A;  2L3D A;  3FM5 A;  3V7S A;  5E1Z B;  3ZN0 A;  4ENM A;  1W7P B;  1BN5 A;  2ZO4 A;  5CLS A;  2QZ8 A;  4XLP F;  2BV6 A;  2KJB A;  2W24 A;  2O8X A;  1WSU A;  3MAJ A;  3Q5F A;  4N9H A;  4N9I A;  3HTU A;  3ZMD A;  3F72 A;  3I59 B;  1ULY A;  1X3U A;  2W84 A;  2KJC A;  1LDK B;  3K0L A;  1PP7 U;  2VBZ A;  1IN7 A;  4Q47 A;  3KE2 A;  2A69 F;  3D5L A;  2IA2 A;  2IVM A;  1HKS A;  3MWM A;  4ESJ A;  5L3D A;  3I5U A;  1XSV A;  5JR3 A;  3R4K A;  4UVC A;  2G7H A;  1BI1 A;  1G3Y A;  2FMY A;  3BJA A;  4L5J A;  3HOS A;  5D6F A;  1WRJ A;  2KIM A;  2G9W A;  5DEQ A;  2HDC A;  4ZYG A;  4L0Z B;  3WTW C;  4L9T A;  3LAP A;  3DXJ F;  1F1Z A;  5D6E A;  3JAM Z;  1ZG3 A;  5ILV A;  2M1B A;  2R7D A;  4IF4 A;  2E1N A;  2P6S A;  1I5Z A;  4S04 A;  3FZV A;  4EV0 A;  1B9M A;  2V1D A;  3HSR A;  2C6Y A;  1ZRE A;  3F8C A;  3BPX A;  5DCM A;  2P6T A;  3WTT C;  4LLL A;  4G94 A;  5DUI A;  5A2Q K;  2QQA A;  2DI3 A;  2ETH A;  4U0V A;  2VBW A;  5LEJ A;  1HW1 A;  1IXS B;  1J59 A;  1B59 A;  2CO5 A;  4I2O A;  4WCG A;  3LQR A;  2DBB A;  3MCZ A;  2FSW A;  3HSF A;  3RYP A;  3WE2 A;  3B73 A;  2F2E A;  2HYF A;  2DQR A;  1MJB A;  2IRF G;  2HWV A;  5BPI A;  5K5Q A;  3I4P A;  3RKX A;  3CUQ A;  1O3Q A;  1FBS A;  1OR7 A;  3QRF F;  3FMQ A;  1V3F A;  1Z7U A;  2V79 A;  1HBX G;  3NRV A;  1PP8 F;  4M6Y A;  1MJA A;  1K7A A;  4U7B A;  1BBY A;  4OU0 A;  2K4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...