5D5WB

Crystal structure of chaetomium thermophilum skn7 with hse dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
94
Chain Sequence
SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRPYGRDAWEFKHPEFRADRKDNLDNIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human heat-shock transcription factor 1 in complex with DNA.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transcription
molecule keywords HSE DNA
total genus 23
structure length 94
sequence length 102
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d5wB00
2Z33A 1S29A 2DQLA 3D5LA 1ZYRF 5ILSA 2D1HA 3R61A 2F2EA 1R58A 3IRRA 2MC3A 2EFWA 5FD5A 1XN7A 1Z1DA 2OD5A 5D5XB 2CWEA 3N97A 3F6OA 4WXHA 3G73A 3ZMZA 3ECHA 2Y75A 2Z9OA 1Y0UA 2FSWA 2XGXA 5DEQA 4LG0A 1QO0D 1E17A 1QNTA 3WU1B 1W5SA 4I2OA 1LB2A 3CTAA 4L9TA 2QM3A 3KP6A 3WGHA 1IZ1A 1FNNA 3U9GA 2VN2A 3LQRA 1QQIA 4HZFA 1XSDA 3G3ZA 5LRSA 4AIKA 3KLNA 1IXRC 3ABTA 1YIOA 4CDGA 1FZPB 2G9WA 3SXYA 3R60A 2WV0A 4LB5A 2F5EA 3F3XA 2XUBA 3OOPA 1OPCA 5DCMB 4L9VA 4A5MA 4EM1A 1XB4A 5E1WA 2QQ9A 4KNYA 3V8LA 1MD0A 2ZKZA 3C3WA 2EV6A 4YIFA 1O3TA 4YIIA 4I98B 2EFPA 2BV6A 3V7SA 4EJVA 2F5DA 3C7JA 3BZ6A 1NHAA 2D2WA 2YX4A 5FFXA 3WGGA 3SZTA 2E1CA 4LLLA 2FMLA 3ERED 2ZBKA 3QP6A 5K1YA 3SFZA 3SZPA 2VBZA 4A2UA 2R3SA 4CZZA 2B0LA 3WTYC 3T5XA 3JSPA 4IHSA 1R00A 2KIMA 5CJ9A 1R5GA 2Z5UA 2ZCWA 5JI6A 1O7LA 3EDPA 1BI0A 4ZYHA 2HYFA 3IHUA 5EEHA 2QENA 1W7PB 2XKOA 4UV9A 1G3YA 2ZNYA 4WXCA 2W24A 1XGMA 5D5UB 3ULQB 3BY6A 1ZGAA 2L02A 1TTYA 5E8GA 4CGZA 4O6JA 5F64A 4M9XA 5F1RA 2ISYA 1D8JA 5DUIA 4M74A 4FX0A 2E7WA 5KK1A 1FBQA 2FQ3A 5LRRA 3RKYA 3TOAA 2P8TA 3QPHA 3I54A 2UXXA 1YS6A 1T6SA 4ENKA 3KZZA 1L0OC 5IT9K 2M30A 2W25A 2XAFA 4CXFA 4TV7A 5LHGA 3H3ZA 2P7CB 2OBPA 2F5FA 3LSTA 1G3SA 2A6HF 4KUMA 4R79A 2QQAA 4GYGA 3ROUA 1K78B 3C1DA 2VE9A 5CVVA 3I53A 4I02A 3GFIA 2DU9A 4P55A 3FWEA 2ETHA 5E1XA 5JR3A 4LB6B 3ZMVA 3BJOA 3SHFA 4R1HA 2XV4S 1FBSA 1TQMA 3EQLF 3O2PE 5BS6A 3P9KA 2HZTA 3LA3A 1R1VA 1OKRA 3FMQA 3JW4A 3WGIA 2P5KA 2IPQX 5E8IA 3BPXA 2R7DA 1FC3A 2PQ8A 3FX3A 4B09A 1FYKA 1ODDA 4I0AA 5D8KB 2HDCA 2KKOA 2LDUA 4EM0B 3GEZA 4A0ZA 5CVJA 2JPCA 1G4DA 4PCQA 4ESFA 1FT9A 3L2CA 2V1UA 3VODA 2J5OA 2M5WA 3LA7A 1QZYA 4FT8A 5HS7A 4ASNA 5LGNA 1WI9A 4P5OA 2A69F 3JSOA 1YTYA 4Q48A 4IVNA 4UVAA 3GVAA 2HS5A 1ON1A 4L0YB 1KU7A 1I1SA 5DCMA 2OQRA 2HWVA 4YFXF 4I09A 1IRGA 1P4AA 2GQQA 2XHKA 5LLQA 2EFQA 2BGCA 3QRFF 1OYIA 1W7PD 2ADUA 3IRQA 4LK1F 3QU3A 2LF8A 1LNWA 4KN7X 4UUVA 3J7AO 3H92A 3K1NA 5BQTA 3CUOA 3MEXA 4JQFA 3LQQA 1ON2A 2PBIA 3E6BA 4CYDA 4MEYF 3LA2A 1F4KA 2DLLA 5BPDA 3R4KA 2CG4A 4I01A 2HTSA 2QBYA 2ZNZA 2VBYA 4HX7A 4EJOA 1R7JA 3Q5FA 2HOEA 2RC4A 3SQNA 4KFCA 1USSA 1EH8A 1J5YA 4AWXB 2D1VA 3CUQC 2P5LC 3DEUA 1PP8F 4HW0A 4L5JA 3IKVA 2ZXJA 3DV8A 3VB2A 1O3RA 4A5NA 1KQ0A 4HQEA 3E6MA 3WTVC 1T38A 1RUOA 2MBFA 2TDXA 2L01A 2HR3A 1ZRDA 1R23A 4BXUA 2STWA 3T8TA 2Y48A 1AOYA 3GFLA 3IKTA 2K4BA 1KYWA 1WRJA 2CW0F 3CUQA 1Z7UA 1DDNA 4IF4A 4LLNA 2HYGD 2FF4A 1K79A 3VEPA 1JGSA 3V8JA 4MEXF 1XGOA 5L3EA 4HA8A 3V8KA 3I71A 1PUEE 1J59A 3ZQ7A 3VFZA 4MNUA 4N0BA 3CO6C 1Z6RA 4HDVA 4G9YA 3COAC 2O03A 1LDKB 2AXLA 3I5UA 1B59A 4U0VA 4YG2F 2CQKA 5ICFA 4D0PA 1IN8A 2DK8A 3JTHA 3RTRA 3ZN0A 2GXGA 5HDGA 3WTSC 1UHMA 5JHUA 2IA1A 3CO7C 1O3SA 3AAFA 4HOBA 3BJAA 4LG0B 2K7LA 2ZFWA 3QP5A 4ZYEA 2RV8A 4EJTA 4Y17A 1V3FA 3GWZA 2H09A 1BIAA 4M71A 1FLIA 3KP3A 3HRTA 5DD4A 3LAJA 4G7OF 3DF8A 1IF1A 4PZJA 4HV6A 3FHZA 1CGPA 2JTVA 1MKMA 2V79A 4KMUX 3IWFA 2MH2A 1G3WA 2EJRA 3TO9A 2R7FA 1YFHA 4ENJA 1XCBA 5D4SA 1GVJA 3HHHA 1JHFA 2YSRA 2IJLA 1KYZA 1WKMA 5K5RA 4BHPA 4LJZF 4UXNA 1DUXC 1MDMB 2GZWA 1HQCA 3LWFA 3B73A 3Q9SA 1Z05A 2VODA 4U7DA 1I6XA 2W57A 3TDZC 2M87A 3I64A 2PMUA 5CVIA 3FXQA 2QWWA 1HKSA 3RPUA 2RKHA 3KE2A 5ILVA 1QPMA 5TJJA 2PFBA 1XSVA 3KP4A 4YFKF 4LFUA 4G7HF 1T2KA 4HLXA 3V4GA 3RKXA 1REPC 3F72A 2K86A 1UB9A 2WTEA 4BQAA 5ERIA 4DNCA 5ED4A 3FXUA 3V7CA 3RI4A 4MTDA 3HOSA 1TW3A 4BYYA 3P9CA 2YR2A 4EMSA 3I59A 3R6SA 5LGUA 4PGHA 3BJ6A 1XDUA 4OMYA 3CLOA 3DPTA 2QBYB 1SFEA 4M9SA 3EYYA 1YQAA 3DQVC 1YW9A 5EEGA 2XAGA 2UZKA 1AWCA 5DDGA 1DPUA 3IL2A 1BBYA 4GO1A 2Q2EA 2GXBA 1SD7A 5H6QA 4Q4ZF 2DW4A 1LQ1A 4IRGA 5HOOA 1HSTA 4PDKA 1SMYF 1OR7A 4RS8A 2GWRA 1V4RA 2O61A 1QZZA 4HF0A 1P4WA 4QLCU 2MLKA 2Z3YA 2NNNA 2QZ8A 3PFIA 1PP7U 4IJAA 3ML6A 2W85A 4YFNF 1BC7C 4UHTA 2XIGA 1IXCA 5TRDA 4XSXF 2JZYA 4UVBA 1SFXA 2ESHA 3HRSA 3GW2A 5CLSA 1SD6A 2UWMA 5FD6A 1W7PA 4ZZLA 2OZUA 3LFKA 3J81Z 2YU3A 1FBUA 3CDHA 3NEUA 2HEOA 5ICGA 3FMRA 4S04A 2FOKA 1KU3A 5D5WB 2K27A 2E7XA 1XGSA 3HSEA 1T39A 4RB0A 1IN7A 3KLOA 5IT3A 5FGMA 5LBQA 4MTEA 3KEOA 2G7HA 1O7FA 2W84A 4MHGA 5DUKA 2H6BA 2RGVA 2BEOA 5L3GA 2L4MA 1FSHA 3GXOA 2YPRA 2P7VB 4ENNA 3O3KA 1LDJA 4I7HA 2BE5F 2MLGA 2OAZA 2CGPA 4Q5SF 2EWNA 5E20A 1C0WA 4RB1A 5HS8A 1KA8A 4OU0A 5LHIA 1XGNA 2A5YB 5HVQC 1G6NA 2JSCA 4WK8F 2ZMEB 4KN4X 2RQPA 1OYYA 1ZGJA 1E2XA 2FXAA 1YS7A 4N9IA 4KIGA 5AONA 3R0JA 4DQ2A 2ELHA 2DO7A 2L4AA 3ABUA 3HIFA 4NHJA 2A6EF 3I59B 4AIJA 4RAYA 5CVUA 3L09A 1R22A 4A6DA 5BOXA 2K4JA 4ESJA 3ZN1A 3IWZA 4ENMA 3F8BA 5E1ZB 4BAYA 1XMAA 4RB2C 1ZHFA 4KIBA 3BDDA 2NS0A 4M6XA 2FA5A 2YX7A 2O0YA 2EB7A 1ZRCA 4ON0A 1S8NA 2IP2A 2Z99A 5LHHA 1IN4A 1EH6A 3ZPLA 3KP5A 1ZARA 4CHUA 1U5TA 1XMKA 3K2ZA 4IHTA 3TKYA 3F8MA 1MJAA 2DPDA 4GYIA 1D3YA 1R1UA 4LK0F 1KU2A 4XRFA 2XASA 1YW8A 2FNPA 4P9UA 4P9FA 3TGNA 4XSZF 2MD5A 3BOQA 4Y13A 3WTUC 4EV0A 4HQMA 3WE3A 2F5CA 4PGGA 4OIPF 3GX4X 1Z91A 4G7ZF 1GXQA 3HTSB 1H9GA 2FU4A 3E5UA 2GA2A 1S6LA 4L5IA 4K2EA 1MDMA 3D0SA 2RNJA 2H27A 4RGUA 3HRMA 2PLYA 2XAQA 3L00A 1F1ZA 2RVCA 1B1BA 1YW7A 3DXJF 4HAMA 1STZA 1ZN2A 3FZVA 4KT5C 3F8FA 2XROA 3MZYA 4JBAA 4CICA 2HGCA 1XD7A 3HOTA 3VOEA 2PI0A 3K1PA 3K9TA 2ISZA 1RZ4A 4ZZDA 2QVOA 5AIPA 1FPQA 2EV0A 1HKTA 3E6DA 3GZ5A 5DD8A 1FX7A 1KQ9A 4ZYDA 5KVRA 2OQGA 1U78A 2EV5A 2VOPA 2AS5F 1J7KA 2JRTA 5F6FA 3HSFA 2KJCA 2QYOA 3EUHA 3ZP5A 4KA4A 3HTUA 1HBXG 4L18B 1D8KA 1ZG3A 1USTA 1FP2A 2FBKA 1MZBA 4HF1A 3QU6A 2EFOA 3HSRA 2IVMA 4ZYGA 3FXRA 4KYWA 1TQPA 3RDIA 1IN6A 2JPBA 3HYIA 1WWXA 2LNBA 2VXZA 2VC0A 5AIQA 3KFWX 1CF7A 4IXAA 2A3SA 3RYPA 1VTNC 1I27A 1IUYA 4EVIA 4P96A 2NYXA 2GAUA 1R1TA 4LGWA 3F21A 4BHBA 4IRHA 1B6AA 2OU2A 3TDUC 5FFZA 2DAOA 4HF2A 2DTRA 2GIVA 1BOAA 3MCZA 4GCVA 3I4PA 2FE3A 4LMYA 2EA2A 1K6OA 1FWZA 1TNTA 4G6QA 2V1DA 3S2WA 5ILUA 3TOBA 4AIHA 1ZG1A 4UNOA 4A0XA 3TO6A 4M9ZA 1BC8C 4XLPF 1B4AA 3U2RA 2PEXA 4L9JA 2LSOA 4HX8A 2RN7A 3RPQA 3JAMZ 2HKOA 2ACJA 1BM9A 2IT0A 3WTTC 4I0BA 3WTXC 5ICEA 4QWQA 4WWCA 5J6XA 3O6BB 5DYMA 1JE8A 2O8XA 2J5PA 1U2WA 2BYVE 2D45A 1RI7A 1BI1A 4G8XA 2VC1A 4F7ZA 4E70A 2FBIA 2LF7A 2H6CA 1U5TC 6PAXA 1SD5A 1UCRA 3JAMK 1ONVA 5BPIA 2IA0A 3TQNA 1EH7A 2NRAC 1OYWA 5LGTA 1MJBA 5L3FA 3FMSA 4EJWA 3W6KB 1W4MA 2CO5A 5FB2A 3RKWA 1HW1A 2KJBA 2UXNA 3RIRA 3MQ0A 1SAXA 4XLNF 4UVCA 3FM5A 2M8EA 2K02A 4OINF 3F22A 2H94A 1P6RA 4FX4A 2V6CA 1RNLA 3CUQB 5D4RA 1GHCA 2MA3A 3M7GA 2HFHA 2V9VA 4M73A 2DBBA 3WG9A 1U3EM 1J9IA 1BN5A 4A6EA 1HXDA 4HX4A 2P6SA 1SD4A 1MJ9A 3M8EA 4HYEA 1FY7A 1IAWA 4GXOA 3NRVA 4KMFA 2Q8KA 2X0LA 2M1BA 5BMZA 4OIQF 2Y0MA 2GA1A 1ZREA 5D6FA 1YLFA 5HDNA 4M72A 1FYLA 4H0EA 1O3QA 2FMYA 4NQWA 4L0ZB 3OV8A 2G7UA 3WTWC 3BROA 1BJAA 1KGSA 5J8CA 2V1XA 1LEAA 4A0YA 4EGZA 2BBYA 1K78A 1B9NA 2XRNA 4A12A 2IW5A 3ZMUA 5LEKA 1FSEA 1O57A 4XBFA 3CJNA 3J81K 4HDUA 4EJUA 5D6EA 1P2FA 3ZMDA 1BI3A 1DP7P 1JXSA 1I5ZA 2VT3A 3MAJA 4L9NA 1R36A 5DCFA 2OZ6A 2PMHA 3Q9VA 2XVCA 1LJ9A 2P4WA 2PN6A 3FF5A 4CO8A 3L9FA 1D5VA 2Q0OA 2IRFG 4M6YA 5HLHA 1Z6TA 3KCCA 2DI3A 2O6GE 2LKPA 4AD9A 4KIFA 1H0MA 1YO5C 1WQ2A 2DT5A 2VBXA 3ELKA 2P6TA 3V7RA 4ZH4F 5D8LB 4EM2A 3L7WA 2KIUA 3J80K 4EQQA 3P7NA 5L3CA 1ZLKA 1QBJA 1EV7A 3GO5A 3WTZA 1T98A 1TNSA 1TQIA 1Q1HA 1ZH5A 3U1DA 1DPRA 3K69A 5ICCA 2CFXA 4MQ9F 3GF2A 2FEZA 3T8RA 3F8CA 4R8HA 4LLGF 5J8FA 4AVPA 4Q47A 5HLGA 4U0YA 1ULYA 3E5XA 1F5TA 1TBXA 3GZ6A 2ESNA 2NAZA 2CSOA 2A07F 1XSXA 2HTJA 3F23A 5HS9A 1QGPA 3E5QA 4WCGA 2X4HA 5L3BA 2L54A 4WX9A 5D5VB 2DFIA 1R5HA 1SMTA 4Y15A 1UFMA 1S3JA 3R0AA 2DK5A 3J80Z 1L3LA 2KRFA 2ZMEA 1LEBA 2VT2A 3PQKA 1XDSA 3QOPA 3GUDA 5K5OA 2VE8A 4IPAA 2OA4A 1P4XA 3BWGA 2MH9A 4LD5A 1ZRFA 4O3MA 3GFJA 4O5VA 1W5TA 3GLXA 1PDNC 3HHGA 1IW7F 1H9TA 4RGSA 3JTGA 3IC7A 4NB5A 3DP7A 3M9AA 2DQRA 4MGRA 1Z9CA 4OMZA 1TLHB 4U0WA 4RGXA 1YG2A 3MWMA 3K0LA 4EGYA 1OMIA 1SFUA 2RDPA 1XCVA 3KZYA 1HSJA 2QUFA 1LVAA 5E18F 2JT1A 2ZO4A 1A04A 3DKWA 3ZMTA 2XKPA 4BHCA 3RYRA 2C6YA 3WU0A 4HLYA 1HW2A 1G3TA 5IT9Z 3HUGA 4OIRF 2O3FA 1J0RA 4ESBA 3DFGA 3N4MA 3K1MA 3B02A 3KP7A 3FM3A 1HW5A 2A68F 3ZMSA 1F9NA 4B8XA 3TO7A 2L3DA 5JVTA 1S7OA 3I58A 1YYVA 3I0TA 5FO5A 4BNCA 1IN5A 3F8NA 1U6GA 4FHTA 3E97A 1BI2A 1WSUA 1LDDA 4ETSA 2VOOA 2HKXA 2CYYA 5HLIA 2WC2A 4Z2YA 1HKQA 4UV8A 1IRFA 3EYIA 3REOA 5A2QK 2NNYA 2PJPA 2STTA 3GYHX 3E6CC 2HQNA 3HRUA 4HV5A 5CVRA 3F6VA 2VBWA 2XAJA 3DPLC 2ZJ2A 2COMA 3M8FA 1TW2A 3BP8A 3KEQA 1FOKA 4JK1X 4G6DA 3H3UA 1P92A 2PG4A 3WE2A 3M1EA 3QAHA 3BPVA 3RJPA 5H6RA 1S7AA 3KP2A 2FNAA 1RIOH 4HBLA 1K7AA 4MQVA 5DV5A 1U8RA 2EA4A 1I1GA 1UHWA 5CYVA 1B9MA 4U7BA 1U5TB 2EFNA 4OOIA 5JFRA 4RB3C 3C18A 4GGGA 5K5QA 5FLXK 3LAPA 4N9HA 2P5VA 5A2QZ 2FRHA 5FLXZ 2A61A 1ZG5A 1T0FA 2M45A 2DPUA 3T1BA 4WXDA 4IRIA 1KQ8A 3E3VA 3MFKA 1J2XA 3ISPA 4KDPA 3QPTA 1KU9A 1ZLJA 4U88A 3KETA 5LEJA 3PQJA 1MGTA 1X3UA 3P9IA 2E1NA 2QLZA 2VONA 1FP1D 1GXPA 5L3DA 1IXSB 1JHHA 3EETA 5E17F 1CF7B 2EK5A 4S05A 5HDKA 2FBHA 3NQOA 2IA2A 2QQBA 3W6JB 1RUNA 2WWYA 4KICA 4WF2A 4OIOF 1ZAOA 4BH9A 5H20A 3WODF 3ECOA 3T0YA 1BIBA 1J75A 2KIFA 2HQRA 4RGRA 1FYMA 3MZHA 2XAHA 3GFMA 4RAZA 4G94A
chains in the Genus database with same CATH superfamily
2Z33A 1S29A 2DQLA 3D5LA 1ZYRF 5ILSA 2DOFA 4E7ZA 2D1HA 1B8IB 3R61A 2F2EA 1R58A 3CZ6A 3IRRA 2MC3A 5EJCA 5FD5A 2EFWA 1XN7A 3S3OA 1D1AA 1Z1DA 5F1JA 2OD5A 3JRBA 5D5XB 2CWEA 3N97A 3DU5A 3F6OA 4WXHA 3G73A 3ZMZA 1DGRM 1T0FC 3QPLA 3JRDA 3ECHA 1RESA 4CH7A 3GCMA 3GTLJ 2Y75A 4QPQA 2VJIA 1VFCA 4DBRA 1Y0UA 2FSWA 2XGXA 3BR0A 5DEQA 2Z9OA 4LG0A 2JUCA 3Q0WA 3G1MA 1QO0D 5LFAA 1E17A 3J7AY 1QNTA 1YJNI 3WU1B 1ETKA 3CCEI 1W5SA 2YS9A 2X6YA 3KEYA 4I2OA 1LB2A 2ME0A 2BZTA 3CTAA 5HNHA 4L9TA 1MSEC 2QM3A 3KP6A 3WGHA 4YIRX 2HI3A 1IZ1A 1IO2A 3OMYA 1FNNA 3U9GA 2BXYA 4JX6A 2VN2A 3LQRA 1QQIA 4HZFA 3HGGA 4E6KG 2R5ZB 1XSDA 3G3ZA 2PMZN 3HM5A 5LRSA 1A6QA 1OLTA 3KLNA 5H2FC 1IXRC 3ABTA 1YIOA 4CDGA 4AIKA 2G9WA 1FZPB 1YITI 3SXYA 3R60A 1JTXA 1W0TA 2WV0A 1RR7A 4LB5A 2F5EA 1VQLI 3F3XA 1X1DA 4MFEA 3HL2A 3OL3A 1PUFA 3FK7A 2XUBA 3OOPA 1UG2A 1OPCA 5DCMB 4L9VA 3PNTA 4A5MA 1J09A 2M4GA 4EM1A 1XB4A 5E1WA 2QQ9A 4C2TA 1U9OA 3DLAA 3MD2A 2ZMEC 2QGUA 4PFOA 2Y69H 4KNYA 3V8LA 1VQOI 1MD0A 2ZKZA 2JA5J 3C3WA 1RPWA 2EV6A 4HRIA 1BL0A 4YIFA 2MGQA 4RM3A 1O3TA 2OCCH 4YIIA 3PUBA 5J3LA 4I98B 1EF4A 2EFPA 2BV6A 5CKTA 3V7SA 4EJVA 3KPHA 3IAM2 3HOXJ 2F5DA 2DODA 1IUFA 2IGOA 3C7JA 3BZ6A 1NHAA 1UMQA 4NC7A 1GLNA 1X1AA 2BVLA 2B7EA 4AIDA 2CUZA 2D2WA 4RM2A 2YX4A 5FFXA 3WGGA 3E7LA 1UJ8A 4NC6A 4LLLA 3SZTA 2FMLA 3ERED 2E1CA 2ZBKA 3PSFA 1VQ6I 4JOMA 5B5EC 3QP6A 2QSGX 5K1YA 3SFZA 2LD5A 3SZPA 3ABKH 2VBZA 1RKTA 3RCOA 4A2UA 2R3SA 4CZZA 2B0LA 2VIXA 5E3MA 5GPAA 3WTYC 5EGOA 3T5XA 3JSPA 3DBLB 2K3PA 4IHSA 4PUSA 3I4MJ 1R00A 1WZ2A 2KIMA 3B6AA 2KT0A 5CJ9A 2NXNB 4XORA 4XOTA 1TP4A 2DYRH 3J7YJ 1R5GA 1CQTA 1FIAA 2ZCWA 2Z5UA 5KCMA 5JI6A 3JRFA 1O7LA 3G2BA 2QQ8A 3EDPA 3QYEA 4LITA 3H0DA 2W4SA 4F91B 1B8IA 1BI0A 2DOAA 5FRMA 2KPMA 4ZYHA 2NVTJ 3FK6A 3A4CA 3DTEA 1ZKGA 3OYJA 2CUFA 2HYFA 5FKKA 3PIOF 3IHUA 5EEHA 2QENA 1W7PB 1QVUA 2WA0A 2TRTA 2XKOA 4XKWA 2V7FA 4UV9A 1G3YA 2ZNYA 1Z77A 4WXCA 2W24A 1XGMA 5D5UB 3ULQB 3BY6A 2VQGA 1ZGAA 4BBRJ 2L02A 1TTYA 5E8GA 4CGZA 2EZLA 4O6JA 1SANA 3K4JA 3DBHB 5F64A 4M9XA 5F1RA 2ISYA 3A0BC 1D8JA 4AC0A 1X3WB 1X3ZB 5DUIA 4M74A 4FX0A 2E7WA 2LRDA 1A31A 5KK1A 1FBQA 1HLVA 3RKQA 3LSJA 4AVZA 3GTMJ 2FQ3A 5LRRA 1AA7A 3RKYA 3TOAA 2P8TA 4XOPA 3QPHA 3H9JA 2E2HJ 2R7WA 3I54A 3HOUJ 2UXXA 2F4IA 1YS6A 1T6SA 2KLOA 4QIWN 4ENKA 5EZGA 4D5CA 5TISC 4CCNA 3NARA 3HZJA 1BJZA 3BTIA 2CQNA 3KZZA 4EEFG 5EG0A 1IGNA 1WJEA 1L0OC 2CQXA 5IT9K 1JI8A 2FQ4A 1Y6IA 2O5RA 4XICA 1ETXA 3VYSB 3FDYA 3HOYJ 4PJ0C 3ZPLA 3LSIA 2M30A 2W25A 1W5CC 2XAFA 4CXFA 2BHYA 3LL7A 4TV7A 5LHGA 2HYJA 4X1EA 2Q2EB 1ORKA 4GRIA 2VJ5A 2RQQA 2O7OA 3MN2A 2XGDA 3HXLA 5J4VA 4DYQA 3H3ZA 2P7CB 2OBPA 2F5FA 3LSTA 1G3SA 2A6HF 4KUMA 4R79A 2QQAA 3A03A 4RDUA 4FETA 4GYGA 3ROUA 1K78B 3C1DA 2VE9A 3KYCB 2JVGA 5CVVA 3I53A 4NUBA 4I02A 5FLVA 3GFIA 2M7BA 2DU9A 1TWFJ 2DFEA 4P55A 1F43A 3H9GA 2R0QC 3FWEA 2EQRA 2ETHA 5J40A 2IS4A 1MNDA 3FBNB 5E1XA 2HU9A 5JR3A 4LB6B 3ZMVA 1VQ9I 3BJOA 5C4XJ 4X0GA 3SHFA 4R1HA 3CCJI 2XV4S 1FBSA 1HF0A 1TQMA 2MD0A 4BJ6C 4B48A 4NNJA 3EQLF 2R7UA 4HNTA 3ZQLA 3O2PE 5BS6A 1PJRA 2K9QA 2X6WA 3P9KA 1JUMA 2HZTA 3L2UA 3LA3A 1R1VA 2VJJA 3A01B 1OKRA 1MNEA 3FMQA 4E7IA 1HDDC 3JW4A 5GADJ 3B6CA 3WGIA 2P5KA 2IPQX 5E8IA 2PMZA 4C9YA 3BPXA 1S9HA 1ZR2A 1S5LC 1FC3A 2PQ8A 2R7DA 3FX3A 3GZNB 4B09A 4CCJA 5B1AH 1FYKA 1ODDA 1E3PA 4I0AA 5K7HA 3HOVJ 5D8KB 2HDCA 2KKOA 2LDUA 4BJ5C 4EM0B 2VKDA 4D9JA 3GEZA 4A0ZA 5CVJA 3I9V2 1NTCA 2MYSA 2LY1A 4XONA 1D0ZA 3K6GA 4A3DJ 3HPGA 2JPCA 1G4DA 3DKXA 4PCQA 4ESFA 1FT9A 3L2CA 2V1UA 3VODA 4HPQA 2J5OA 2R92J 3GMEA 2M5WA 2DMUA 3LA7A 1QZYA 1OFCX 3K2AA 2B9SA 2L7ZA 1TC3C 4FT8A 5HS7A 4ASNA 4E4HA 5LGNA 1WI9A 4P5OA 3W2VA 3RZDJ 2D5VA 2A69F 1YHQI 3GTGJ 2HZDA 2E1OA 3JSOA 4RLFA 1GV2A 2HOAA 2OTLI 1FIPA 1YTYA 3BR6A 4Q48A 4IVNA 3BG9A 1ITYA 1YRNB 4UVAA 3GVAA 2HS5A 1ON1A 1R4MB 4L0YB 3HKZN 1KU7A 1I1SA 3ONQA 5DCMA 2OQRA 1VQMI 2HWVA 2I10A 4YFXF 4I09A 2EIJH 2ME6A 3PJRA 1IRGA 1P4AA 4YEJA 2GQQA 2XHKA 4XMYA 5LLQA 1LFPA 2EFQA 2BGCA 3QRFF 1OYIA 1JUPA 1M1EB 1W7PD 2ADUA 4LK1F 3IRQA 3QU3A 2LF8A 4IL6C 1LNWA 2Y2ZA 4KN7X 4ZDLA 3C2HA 4UUVA 3QODA 3ZQFA 4BE2A 1H8AC 3H92A 3J7AO 1VZ0A 3S14J 4IEJA 3K1NA 5BQTA 4MFDA 3CUOA 3MEXA 4JQFA 2OPTA 2HVQA 2ZFUA 9ANTA 2A6TA 2H8RA 3BG3A 1ZGWA 3LQQA 3FXLA 4ZTFA 3GTPJ 4NC8A 1ON2A 2XC7A 2PBIA 3E6BA 4CYDA 1HDPA 1MBFA 4MEYF 3LA2A 1F4KA 2DLLA 5BPDA 2DA3A 3R4KA 2DXIA 2CG4A 1FOWA 4I01A 4BDYA 2HTSA 2OCEA 3H0GJ 4PSXA 2ZSHB 2QBYA 2ZNZA 2VBYA 3OYCA 3OIOA 4HX7A 4EJOA 1R7JA 3Q5FA 2HOEA 1MMAA 2RC4A 3PIPF 3SQNA 4PK4A 3GLLA 3KZIC 2DFFA 4KFCA 1USSA 1EH8A 5F08A 3S1NJ 5FKLA 4Z6YA 5C4JJ 4CUGA 1J5YA 3LNQA 2K3FA 1WI3A 4C30A 4AWXB 3AG1H 4FCYA 4LOCA 2D1VA 1JT6A 2EBIA 3CUQC 2P5LC 3DEUA 1PP8F 1K4TA 1ZTRA 4HW0A 4ZDPA 2MSYA 2V26A 1NG7A 4L5JA 3IKVA 3A01A 2ZXJA 2JMWA 3DV8A 3VB2A 1WCMJ 1BR4A 1Z21A 3CCUI 1MMDA 1O3RA 3Q3SA 3W2WA 1R49A 4A5NA 1Z3YA 1KQ0A 4HQEA 2E35A 5GTIC 3E6MA 3WTVC 1T38A 3H35A 2JWTA 3H3VK 3S2DJ 1RUOA 2MBFA 3CCQI 4I76A 2TDXA 2L01A 2HR3A 1ZRDA 1R23A 4BXUA 2STWA 2Y48A 3T8TA 1AOYA 5IYDJ 3FXKA 1U8BA 3GFLA 3IKTA 2R7SA 2K4BA 1KYWA 1MBEA 1WRJA 2CW0F 4A3MJ 4BXXJ 2KRCA 1U0JA 3CUQA 2IAIA 3M1CA 1Z7UA 2OC6A 4IF4A 5CQEA 1DDNA 4LLNA 2HYGD 2R7QA 2FF4A 4KISA 1K79A 4BY7J 3VEPA 2FOWA 3TEDA 3TW6A 1JGSA 3V8JA 4MEXF 1IV8A 3CMMA 3DTIA 2NVXJ 1XGOA 5L3EA 4HA8A 2B63J 3V8KA 3K70D 3I71A 1PUEE 1GVDA 5B3SH 1J59A 2OUMA 3ZQ7A 4KJZA 5M5XJ 1UELB 3VFZA 4MNUA 4N0BA 4E7KA 4BE1A 3CO6C 1Z6RA 2WADA 5HLTA 4FASD 2GLOA 1ETYA 4HDVA 4G9YA 3COAC 1OJLA 2O03A 1LDKB 1TZLA 2AXLA 3BG5A 3I5UA 5EEAA 1B59A 1ZK8A 4U0VA 4YG2F 2CQKA 4U87A 2QEXI 3OR1C 5ICFA 4D0PA 4KT6A 1IN8A 2DK8A 2WBMA 1QHHD 4J19A 3WG7H 3JTHA 5CPRB 2E1MB 3LSMA 3RTRA 3TMOA 3ZN0A 1G8XA 2GXGA 1E3OC 1TWAJ 3H5AA 5HDGA 3NWSA 2L0KA 1T95A 3OR2C 1UZCA 3G1OA 4QSHA 3WTSC 1UHMA 5JHUA 2IA1A 2KISA 3CO7C 1O3SA 2WY8Q 5IOYA 2L5QA 3DWLE 3AAFA 4HOBA 3BJAA 4LG0B 2K7LA 2ZFWA 2IS1A 3QP5A 4ZYEA 2RV8A 2R7OA 4EJTA 3S2HJ 2KMUA 2NVYJ 2HVSA 4Y17A 1FMVA 1V3FA 3GWZA 2H09A 1BIAA 3FBIB 4M71A 1LE8A 1FLIA 3KP3A 3D5RC 4CZCA 1VQNI 3HRTA 3DPUA 3BR1A 5DD4A 4XKCA 5F0HA 3LAJA 4XIDA 1VQ5I 2DDBA 3SDBA 4G7OF 3DF8A 5FROA 3SFIA 1IF1A 4AYBN 3FKIJ 2MG4A 4JYKA 4PZJA 4HV6A 3FHZA 5EGOB 1CGPA 2JTVA 2ELKA 1MKMA 2V79A 3OL4A 1H89C 4KMUX 3IWFA 1GDTA 3RPUD 2MH2A 2HOTA 1G3WA 4ZYAA 4XLFA 4B44A 1HA8A 2EJRA 4AM3A 3TO9A 2GXAA 2R7FA 1YFHA 2PX9A 3CJQB 4ENJA 1XCBA 1DU6A 3MKYB 5D4SA 2K40A 4DW6A 1GVJA 1MBHA 1JJ8C 3HHHA 1JHFA 2YSRA 1MW7A 2IJLA 1KYZA 2EPFA 4MLOA 1WKMA 5K5RA 4BHPA 4BY1J 4XRSA 4LJZF 4UXNA 1DUXC 1MDMB 1VNDA 2GZWA 3K4KA 1WJCA 1HQCA 3LWFA 3B73A 3Q9SA 1MH4A 2CV1A 1Z05A 2VODA 3LSHA 4U7DA 4F92B 1YE9A 3UKGA 1I6XA 2DDAA 2W57A 3D1NI 3ASOH 3X2QH 3TDZC 2M87A 3I64A 4DJAA 3G1LA 2PMUA 5CVIA 2X51A 3FXQA 1GV5A 2QWWA 3CQZJ 1HKSA 3RPUA 2RKHA 3KE2A 2KZGA 5ILVA 3HPHA 1QPMA 3BZCA 5TJJA 2PFBA 4DOZA 1XSVA 3KP4A 4M6VA 4YFKF 2ZJQF 5GAEJ 4LFUA 1WJBA 2JN6A 1F36A 5IP7J 4G7HF 1MMSA 1T2KA 1I3AA 4HLXA 3V4GA 1P7JA 3RKXA 1REPC 4XL9A 3F72A 1ZQ3P 1TWHJ 2K86A 1UB9A 2AHQA 2WTEA 2H8WA 5ERIA 4BQAA 4DNCA 3V42A 5ED4A 1LVKA 4BEHA 2F5VA 3FXUA 1WFXA 3V7CA 2PJRA 3OSGA 3RI4A 3L1PA 1EJ9A 4MTDA 3PSIA 3HOSA 1SFOJ 2MABA 1TW3A 2BW3B 4BYYA 3HC7A 3P9CA 5GAGJ 2YR2A 3PNVA 4A3CJ 1OISA 2XSJC 1P7IA 2R7TA 4EMSA 1X4PA 3I59A 2W48A 3R6SA 5LGUA 1SEUA 4PGHA 2MC4A 1OR7C 3BJ6A 3JR9A 1XDUA 1BW6A 3UR3C 3M4OJ 3S1MJ 4OMYA 2LC2A 1X4OA 3CLOA 3DPTA 3VYUB 2QBYB 2VQLA 3KIOA 1SFEA 4M9SA 2BY2A 3EYYA 1N75A 1TL8A 3VYTB 2ELJA 3ZRGA 1YQAA 3DQVC 1YW9A 5EEGA 2XAGA 1K6YA 4PSWA 2UZKA 2NOJB 1AWCA 1I39A 1Y8RB 2E5ZA 5DDGA 2DA6A 4DIQA 1JKPC 1DPUA 3IL2A 1BBYA 3S15J 2XRLA 4GO1A 3U21A 3VDXA 2XGCA 2Q2EA 4L5EA 2GXBA 4J01A 1SD7A 5H6QA 4XRSG 3EUHC 2DW4A 4Q4ZF 1LQ1A 4IRGA 5HOOA 1BA5A 1HSTA 2HDWA 3ZXSA 4PDKA 2ICWG 1SMYF 1OR7A 4RS8A 2GWRA 1XTAA 1V4RA 4RMNA 2O61A 1QZZA 1QPIA 4HF0A 2VPRA 3DU6A 1P4WA 3UNGC 4QLCU 2MLKA 3GTQJ 2LKXA 2Z3YA 3ZGKA 4A3KJ 1TT5B 3MKWB 1FOYA 1FMWA 3FISA 3IH2A 2KDZA 2NNNA 3S93A 4A69C 2QZ8A 3PFIA 1PP7U 2LG4A 2ZJRF 4IJAA 1YRNA 1MBKA 3ML6A 1D5YA 4XLCA 2W85A 2M34A 4YFNF 1G2HA 1BC7C 4UHTA 2XIGA 1IXCA 1OCOH 3O8HA 1N25A 3EPZA 5TRDA 4XSXF 2JZYA 2CUJA 4UVBA 1SFXA 2ESHA 5F04A 3GTJJ 1JT0A 3HRSA 3GW2A 5CLSA 1SD6A 4F55A 2UWMA 5FD6A 1A6IA 1W7PA 2JK3A 4XLAA 3AL0B 3E0JB 3HBLA 1HC8A 1X1CA 4FTHA 4XRMA 1EKEA 4HG2A 4ZZLA 5DTDA 2OZUA 3LFKA 3OIPA 3J81Z 2YU3A 2XF6A 1FBUA 1YI2I 2LY9A 2IGMA 1VQ8I 1NK2P 5E3OA 3CDHA 4RA2A 3KYLA 5FKMA 1POGA 3NEUA 2JVHA 2HEOA 5ICGA 4ITVA 3FMRA 4S04A 3H9QA 1ETWA 2L7FP 2FOKA 1KU3A 1WPKA 5D5WB 3ABMH 2AQFA 2K27A 5GTHC 1MNMC 4OWRB 2E5NA 1VQPI 1ETQA 4M3EA 2WAFA 1XX5A 3O8GA 3GTKJ 2E7XA 3ERMA 2Z16A 1XGSA 3CF2A 1SVOA 3HSEA 1T39A 4CCMA 4GFBA 3ZOBA 4RB0A 1IN7A 3KLOA 3NWTA 5IT3A 3QYFA 3IV5A 2MFZA 5FGMA 5LBQA 4MTEA 4PJMA 3C2BA 3KEOA 1KZHA 3CP8A 2P81A 3LOCA 2G7HA 3MKZA 1O7FA 5FKOA 3KYDB 4W97A 2W84A 4MHGA 3LFUA 3QPSA 3QOEA 2VL8A 5DUKA 3CP2A 2H6BA 2RGVA 2BEOA 5L3GA 4UB8C 5M5YJ 2L4MA 1FSHA 2CS3A 2JA8J 2K9LA 3GXOA 2YPRA 2P7VB 2L2OA 2R7XA 3QYBA 5KAFC 3L2RA 3AFHA 4ENNA 3O3KA 1N78A 1B72A 1LDJA 3OYHA 4I7HA 1S72I 2BE5F 2MLGA 2OAZA 2VQHA 2CGPA 2QSFX 4Q5SF 2EWNA 5E20A 2JJ7A 1C0WA 2W7NA 1I3QJ 5HS8A 4RB1A 1KA8A 1WH5A 4OU0A 5LHIA 3TBIA 1XGNA 3BR2A 2A5YB 2GOMA 5HVQC 2WB1A 1G6NA 3OYFA 4MIMA 2JSCA 4E7LA 3S16J 4WK8F 2LOOA 3S3NA 3OYDA 2ZMEB 4KN4X 2E71A 2RQPA 1OYYA 1ZGJA 1E2XA 2DYSH 2FXAA 1YS7A 2R7RA 4N9IA 1BR1A 1WVRA 4E7SA 1Y1WJ 3DBRB 4KIGA 5AONA 3R0JA 3SDGA 2DA7A 3BC8A 4BUPA 4DQ2A 2ELHA 1SAUA 5DS9A 1D1CA 2DO7A 4OAZA 2L4AA 3ABUA 3HIFA 3LSRA 3M3YJ 2Z2SB 4NHJA 2A6EF 3I59B 3J7ZI 4AIJA 3S17J 4RAYA 5CVUA 3L09A 1R22A 4A6DA 3DCFA 2NS7A 4B3AA 1VQKI 3BQYA 5BOXA 2K4JA 2NVQJ 4HEA2 1ETVA 4ESJA 2BW3A 3BR5A 2LBFB 3ZN1A 3IWZA 4ENMA 4II3A 2CW7A 2BY1A 2GBYA 2K5CA 3F8BA 1NK3P 5E1ZB 4M3GA 4BAYA 4UUTA 1XMAA 3L2WA 4RB2C 3OYIA 3JRHA 2IXSA 1X19A 1ZHFA 2M2EA 2O9LA 3QWLA 4KIBA 2X1DA 3K70C 3BDDA 2NS0A 2HDDA 2E1MC 4M6XA 1BR2A 2WAQA 2FA5A 1N77A 2YX7A 2O0YA 2EB7A 1ZRCA 4ON0A 1S8NA 2IP2A 2Z99A 3KX2A 1IN4A 1D1BA 1EH6A 5LHHA 3KP5A 2WV1A 1RETA 3JRAA 5F27A 1ZARA 3SZGA 3SJMA 1A35A 5LD2C 1ERDA 3JRGA 4CHUA 3CC4I 1U5TA 3WHCA 1XMKA 4RAGA 3K2ZA 4IHTA 4ZC3A 3TKYA 3OYGA 4IO9F 1BOBA 3F8MA 2CMPA 4CYCA 3CMAI 1MJAA 2DPDA 4GYIA 1D3YA 1R1UA 3JREA 5GAHJ 2ECCA 1RC9A 4LK0F 1KU2A 4XRFA 2XASA 4I99C 1YW8A 4BEHB 3PNYA 2FNPA 3K4NA 4NBQA 4P9UA 2X9DA 3WHBA 4XLHA 4P9FA 3TGNA 4XSZF 2IGNA 2YUSA 1Z0XA 2MD5A 3BOQA 4Y13A 3RQIA 3WTUC 4EV0A 4HQMA 3MKLA 3AG4H 3CC2I 2X1CA 2E34A 3WE3A 2F5CA 1W36D 2ZJPF 3H5RA 4PGGA 1PUFB 3GX4X 1Z91A 4G7ZF 4OIPF 1T33A 1DQUA 2ECBA 1GXQA 3HTSB 1XC5A 2Y31A 3EUAA 1H9GA 1B72B 1VI0A 2FU4A 3DKYA 4BL0B 1FJLA 3E5UA 3F9KA 4MO7A 2GA2A 1S6LA 4L5IA 1QZEA 4K2EA 2W82A 2CUEA 1X2NA 1MDMA 1AKHA 1WJFA 1Y1VJ 3D0SA 4PJLA 3DEEA 2RNJA 4XNFA 2H27A 1V5EA 4RGUA 2CH0A 1HCRA 2KHMA 3HRMA 4E7HA 2PLYA 1DP3A 2XAQA 3L00A 2UV1A 1F1ZA 2DJNA 5F0CA 2RVCA 1B1BA 2VKHA 1I50J 1YW7A 1ACIA 3DXJF 4N4NB 1ZELA 4HAMA 1STZA 3BQZA 5FRNA 1MSFC 4Y7NJ 4FQGA 1ZN2A 3FZVA 4KT5C 3F8FA 3LSGA 2XROA 3MZYA 3I55I 4JBAA 4CICA 2HGCA 2DT6A 1XD7A 3HOTA 1TWGJ 3VOEA 3ZQQA 2Y9YA 2PI0A 3K1PA 3K9TA 1D0XA 3G4SI 1WHUA 4XQFA 2ISZA 4UY8I 4M3BA 1RZ4A 2BXZA 4ZZDA 2QVOA 2CQQA 2DT7B 5AIPA 3RSNA 1FPQA 2EV0A 1HKTA 3E6DA 3GZ5A 5DD8A 1FX7A 1KQ9A 2L9SA 2UUZA 5E3NA 2JA6J 3HG9A 4ZYDA 1W36C 1T56A 5FJ8J 3CD6I 2FX0A 5KVRA 5J1YA 2OQGA 4XK4A 4BACA 3BTLA 1T8IA 3FKJA 1U78A 2VUMJ 2EV5A 2VOPA 4IQJA 2DA4A 1LKXA 2AS5F 1J7KA 2JRTA 5F6FA 3HSFA 2LH9A 2KJCA 2QYOA 3EUHA 3ZP5A 4IOCF 4A93J 2ID6A 4KA4A 3HTUA 1HBXG 1Y0NA 4L18B 1D8KA 4A3FJ 1ZG3A 4IOAF 2VKEA 1USTA 3TP3A 1FP2A 2FBKA 1MZBA 4HF1A 3LSKA 4E7JA 2JA2A 3IH3A 2EFOA 3QU6A 4QTRA 3HSRA 2IVMA 5F0FA 4ZYGA 5B66C 2HOSA 2JQ7A 2EIKH 3FXRA 4KYWA 1TQPA 3RDIA 1IN6A 4A3LJ 2JPBA 3HYIA 4ZJZA 4BKXA 1Z67A 4DBQA 1WJDA 1WWXA 2IS2A 2DOEA 3H1CA 2LNBA 1R9TJ 1QU3A 1AU7A 2VXZA 2VC0A 5AIQA 5K7ZA 2F6CA 1MH3A 2M0MA 3OWTA 3KFWX 2CV0A 1CF7A 3BTCA 1SFKA 4IXAA 2A3SA 3BR3A 3RYPA 3VSLA 2EINH 4C3JJ 4D5FA 1VTNC 4F3QA 1I27A 1IUYA 4EVIA 3QQAA 4P96A 5FLMJ 3D5SC 2NYXA 1OCCH 2GAUA 1YX5A 1R1TA 4LGWA 3ZCOA 3F21A 5IYCJ 1IV6A 4BHBA 4IRHA 3A0HC 1B6AA 1ENHA 2OU2A 3TDUC 2FJ1A 2O8KA 2K9SA 4HSTA 5FFZA 5EF6A 2DAOA 2XB5A 4XR6A 4HF2A 2DTRA 2GIVA 1BOAA 3OYEA 4CA0A 2CU7A 3VYRB 1NG6A 3MCZA 4GCVA 3HKZA 3ZQHA 5IP9J 1JKOC 4RLQA 3I4PA 2L9VA 2FE3A 3BCBA 1UG0A 4LMYA 4N4OB 4KITB 2JA7J 2EA2A 2L9RA 1K6OA 2M4KA 1E0EA 2QSHX 2KL4A 2KP6A 1FWZA 2RREA 3FHNA 1TNTA 2OTJI 4C3HJ 3CCLI 4G6QA 2V1DA 3E1SA 1MIJA 4I6ZA 1YIJI 2M8GX 3S2WA 2CFOA 5ILUA 1HOMA 2DA1A 2EH3A 3TOBA 2KRHA 2HVRA 3JRIA 1V54H 3LSPA 2ZXHA 4AIHA 1ZG1A 4UNOA 4A0XA 3TO6A 1SVLA 2Y9ZA 1R5ID 2EZHA 4M9ZA 2LKSA 1BC8C 3ASNH 2FD5A 2V1NA 4XLPF 1B4AA 3U2RA 2PEXA 4L9JA 2LSOA 4HX8A 3OYLA 3HOZJ 2RN7A 3N05A 3RPQA 2LREA 2X6XA 4HNVA 4DYCA 4IX7A 3JAMZ 2HKOA 2R93J 2L7MP 2F4MB 3FXOA 2ACJA 1BM9A 2H1KA 2IT0A 1Y39A 4B47A 3WTTC 4I0BA 3WTXC 5ICEA 1TWCJ 4QWQA 4WWCA 3H36A 4IHYA 1E3HA 2DJIA 5J6XA 5EDNA 1KONA 3O6BB 2FUG2 1PVEA 3ZR8X 3OS1A 1OCTC 5DYMA 1JE8A 1UAAA 3CDIA 2O8XA 4H4KC 3Q0UA 1EA3A 2J5PA 1U2WA 2NVUB 4J00A 2BYVE 2D45A 3A2KA 1RI7A 4FISA 1BI1A 3OSFA 3PUFA 2VC1A 2COBA 4G8XA 4F7ZA 4E70A 2BY0A 2FBIA 3FXMA 2LF7A 2H6CA 1U5TC 4ZTJA 2WAQN 1YOVB 6PAXA 1SD5A 1UCRA 3JAMK 3MVPA 1ONVA 1MBGA 2DA2A 3IUOA 1XPXA 2V6EA 1LFUP 3HOWJ 3L2VA 5BPIA 1WJ5A 2DMTA 2XB0X 2IA0A 3TQNA 2DFHA 2HXIA 2QKMB 1EH7A 2NRAC 2TCTA 1OYWA 2XF7A 5LGTA 1IDYA 1MJBA 5L3FA 3FMSA 3S32A 5HODA 4EJWA 3W6KB 4F93B 3F0CA 1OCRH 1W4MA 2CO5A 5IY5H 5FB2A 1V5FA 2ZSIB 2EZIA 1HW1A 1YX3A 3RKWA 2KJBA 2UXNA 4DZJA 1LFBA 3RIRA 2DN0A 3MQ0A 1SAXA 4XLNF 4M3FA 4AU7A 1IRZA 1GUUA 4UVCA 3FM5A 1QRYA 2M8EA 5IOZA 2Y30A 2K02A 1H88C 4OINF 3F22A 1V55H 2H94A 1P6RA 4FX4A 2V6CA 2E60A 4D7NA 2CW8A 1RNLA 2LVSA 2E36A 4PJJA 3S1QJ 3CUQB 2AXTC 3JRCA 5D4RA 1GHCA 2CRGA 3TP0A 1VQ4I 4BGDA 2MA3A 5DM7F 3M7GA 2HFHA 2HPMA 1LE8B 2KIQA 4XLEA 2V9VA 4M73A 5J4YA 3CCRI 2DBBA 2XF5A 4JX4A 4Y33A 3WG9A 2IGKA 5EZHA 2NS8A 2QF7A 3S3MA 1U3EM 1A36A 1J9IA 1BN5A 4A6EA 4CCKA 2DMNA 1HXDA 4HX4A 2P6SA 3CESA 2XSDC 1SD4A 1MJ9A 1JUSA 3M8EA 2F48A 3SYTA 4HYEA 1IC8A 1FY7A 4X6AJ 1IAWA 3G71I 4GXOA 3NRVA 4KMFA 2Q8KA 2X0LA 2M1BA 3PO2J 3VSKA 5BMZA 1SC7A 4OIQF 2Y0MA 1WJAA 2GA1A 3BLYA 2W00A 2PJRB 3K10A 4DGWB 1ZREA 1FOXA 5D6FA 4JP0A 2R7VA 2OJED 1YLFA 5FKNA 5HDNA 1JTYA 2A5WA 5EG0B 4M72A 2M9HA 2VASA 3M07A 1FYLA 4H0EA 1O3QA 2FMYA 1DU0A 4NQWA 4L0ZB 3CCVI 2IBDA 3OV8A 4BQQA 2G7UA 3WTWC 3BROA 1BJAA 1KGSA 1MBJA 4B43A 2ZXWH 5J8CA 2V1XA 1LEAA 4A0YA 2IS6A 5JLWA 1Z3XA 4EGZA 2BBYA 2LMDA 1B9NA 2XRNA 1K78A 2VLAA 4A12A 2F4OB 4UUSB 4AUXA 2IW5A 3ZMUA 5LEKA 1FSEA 1O57A 4XBFA 3CJNA 5IP6A 3J81K 2VQCA 4HDUA 4EJUA 1RR8C 5D6EA 1P2FA 2BVMA 5JHFA 3I4NJ 3ZMDA 2Q1ZB 3OYNA 1BI3A 4FE4A 1Y56A 4UUSA 4Y52J 1DP7P 1JXSA 1I5ZA 3BZKA 4CCOA 2OV7A 2VT3A 3MAJA 4L9NA 1R36A 2QCOA 5DCFA 2OZ6A 3FXJA 2PMHA 3HB9A 3Q9VA 2XVCA 1JKRC 3JCUC 1LJ9A 2BY3A 3G6EI 1SVMA 1YJWI 2P4WA 3SEZA 2PN6A 3FF5A 4CO8A 2WB1N 3L9FA 3W2AA 1D5VA 2Q0OA 3HDDA 4G6TB 2H1LA 3AG3H 2IRFG 4M6YA 5HLHA 3SEQA 1Z6TA 4F52A 2ZC2A 3KCCA 1PYVA 2DI3A 2Y0SN 2R5ZA 2LKPA 2O6GE 4AD9A 4A3JJ 4KIFA 2LR8A 1H0MA 1YO5C 1WQ2A 2DT5A 2DA5A 4CCLA 4A3IJ 4YELA 1VQ7I 1Z7LA 2V9PA 2VBXA 3H5NA 3ELKA 2P6TA 4LG3A 2M7AA 3V7RA 4ZH4F 2E2IJ 5D8LB 4CYCB 4EM2A 3OYAA 4XKVA 2N8GA 3L7WA 2ZB9A 4IHVA 2CJJA 3GBGA 2KIUA 2CV2A 3J80K 5TGTA 4EQQA 3BG6A 2JUGA 2GIZA 3P7NA 1DGWY 5L3CA 3CMYA 1ZLKA 1QBJA 1EV7A 3GO5A 3WTZA 1T98A 1TNSA 1RKWA 3WU2C 1IJWC 1TQIA 2E2JJ 5GPCA 1Q1HA 3BCAA 4V19K 3K4MA 1ZH5A 3U1DA 1DPRA 3K69A 3OIQA 5ICCA 2CFXA 4MQ9F 4BBSJ 4HSRA 3GF2A 2FEZA 3T8RA 3F8CA 4R8HA 4ZDOA 4LLGF 4PJNA 3ZQGA 5J8FA 1FTTA 2Y0SA 4S0HB 1XMXA 4AVPA 1R4NB 4Q47A 5HLGA 4U0YA 1ULYA 3E5XA 1F5TA 1TBXA 1X1BA 3GZ6A 1JGGA 3Q0VA 3ESWB 2ESNA 3K4LA 3K7AJ 2HQ5A 3DEWA 2X48A 2NAZA 2CSOA 1WH7A 1ETOA 2A07F 2QKLB 1XSXA 4BDZA 2JSPA 2HTJA 3F23A 5HS9A 1QGPA 3E5QA 4WCGA 2X4HA 3CCYA 3MMYB 2M3AA 5L3BA 3PO3J 2L54A 4V2GA 4WX9A 5D5VB 2DFIA 1R5HA 1SMTA 1BW5A 2IEKA 1UHSA 4Y15A 3DTKA 3FIWA 2HNHA 4DYRA 1UFMA 2JRMA 2XPVA 3TW7A 1OCPA 1S3JA 4IHXA 3R0AA 1AKHB 2DK5A 3J80Z 4D1QA 1L3LA 2KRFA 2ZMEA 2EZKA 1LEBA 3OYKA 2VT2A 1XS9A 3PQKA 3OS0A 3TL4X 1XDSA 3LMMA 5BNGA 2LP0A 2X85A 1P9QC 1MMGA 3QOPA 3GUDA 2VKVA 4M3DA 2WY7Q 5K5OA 2VE8A 2EILH 2DMPA 4IPAA 2OA4A 1P4XA 3BWGA 5E3LA 4LIVA 3IH4A 2XPUA 3M8JA 2MH9A 3HGYA 4LD5A 1ZRFA 1QVTA 3GFJA 4O5VA 4O3MA 1W5TA 3CCSI 3GLXA 1PDNC 3HHGA 3PM1A 1IW7F 1H9TA 4NQWB 4XN3A 2I8DA 4RGSA 3JTGA 1S7EA 1X58A 3IC7A 3RZOJ 4XN0A 4NB5A 5JVGF 3DP7A 3M9AA 3OY9A 4OAYA 2DQRA 4MGRA 4UB6C 5IPAA 1Z9CA 4OMZA 1R6RA 4RBOA 2AO9A 1AHDP 3U1KA 1TLHB 1OCZH 4U0WA 4RGXA 2WAEA 1YG2A 4RAFA 2XAUA 3HUGB 3ZQIA 5GP9A 3MWMA 3PFYA 5E79C 3K0LA 2XGEA 1OMIA 4EGYA 2RDPA 2R4GA 1SFUA 4IKFA 2L9NA 1XCVA 4FE7A 5KNLA 4BU2A 3KZYA 2RAEA 1HSJA 4B3XA 2QUFA 1LVAA 2CQ7A 5E18F 4BQOA 3HEFA 4C2MJ 2OF7A 2JT1A 2XPWA 2ZO4A 4Y3OA 4G12A 2LTPA 1A04A 3DKWA 3ZMTA 2XKPA 4BHCA 3RYRA 1ZR4A 1JKQC 2C6YA 2R7ZJ 5B1BH 3WU0A 1G3TA 4HLYA 1HW2A 5IT9Z 3HUGA 4OIRF 1APLC 3CMEI 2O3FA 3C2GA 2ID3A 2R5YB 4W1UA 1X2MA 1J0RA 1FTZA 1O4XA 3S1RJ 1MMNA 1V5GA 2KZVA 4D7MA 2KFDA 2V9KA 5C44J 5IYBJ 1K4SA 3IP4B 4ESBA 3DFGA 3N4MA 2GOXB 2P0WA 5M3FJ 5M5WJ 3K1MA 4AYBA 3BT9A 3B02A 3KP7A 3CC7I 2G0EA 3NAUA 3FM3A 1HW5A 2A68F 5DM6F 3CCMI 3DLLF 2BHZA 4B1RA 3ZMSA 1F9NA 4B8XA 4PFPA 3TO7A 2L3DA 3OOUA 2HQAA 5JVTA 5JLXA 4XKBA 1S7OA 3I58A 2LFBA 1YYVA 3I0TA 5FO5A 3AG2H 3CLQA 1IN5A 3EUKL 4BNCA 1WGXA 2ZXIA 5C3EJ 3OYBA 3F8NA 1U6GA 4FHTA 3E97A 4B4CA 1LUJB 4BS9A 1BI2A 2XDVA 1WSUA 1LDDA 4ETSA 3ZQCA 2VOOA 2HKXA 2CYYA 2DMQA 5HLIA 2WC2A 4Z2YA 3PL8A 1HKQA 4UV8A 1IRFA 3EYIA 3K4CA 3REOA 5A2QK 2NNYA 3VWBA 4IHWA 2PJPA 4IZZA 5EYRA 1D0YA 2STTA 3GYHX 1JJ6C 4QPOA 2Z1DA 2KDOA 1G59A 1OQYA 2KQRA 3E6CC 2HQNA 2VI6A 3CJTB 3HRUA 4HV5A 4V2FA 5J1UA 5CVRA 2QA4I 3F6VA 1U9NA 3CJRB 1RRJA 2VBWA 2XAJA 3DPLC 2ZJ2A 2COMA 5J1RA 3M8FA 1TW2A 2MW8A 3BP8A 3I3LA 1Q1VA 3KEQA 4JK1X 1FOKA 2LK2A 4G6DA 2W1OA 3H3UA 3I56I 1QHGA 3BTJA 2YU9J 1P92A 4BQNA 2PG4A 3WE2A 3M1EA 3QAHA 3BPVA 4NDLA 3W3CA 1T08B 3RJPA 5H6RA 1S7AA 4ANJA 3AKZA 3KP2A 2X6OA 2FNAA 1VF9A 4XM3A 2R5YA 1RIOH 3ABLH 4HBLA 1K7AA 2VJ4A 4MQVA 5M3MJ 5DV5A 3VPRA 1U8RA 2EA4A 1I1GA 2LBFA 1UHWA 4GDFA 4YRVA 2K9NA 5CYVA 3GTOJ 2K85A 1B9MA 4U7BA 2NOGA 1U5TB 2DCEA 2EFNA 1X1PA 1Y8QB 4LIUA 4OOIA 5JFRA 4A3BJ 2LY2A 4RB3C 1I6HJ 3C18A 4GGGA 2X1EA 4BXFA 5K5QA 1LPQA 3LAPA 5FLXK 5HNFA 4N9HA 2P5VA 3CDLA 2V4JC 4BJTA 2AQEA 3A02A 1NH3A 4A3GJ 4HNUA 4EATA 5A2QZ 2FRHA 4IQ4A 2I5UA 5FLXZ 3A1YA 2A61A 1ZG5A 4C2UA 4ABZA 4Y4RA 2BOLA 3OS2A 1T0FA 2M45A 3OYMA 2DPUA 3P5JA 3T1BA 4WXDA 4IRIA 1KQ8A 3E3VA 2EIMH 2HXOA 4A3EJ 3MFKA 1A5JA 1J2XA 3ISPA 1FEXA 4KDPA 3QPTA 1KU9A 1ZLJA 4U88A 3MZ8A 3KETA 5LEJA 1IDZA 4BE0A 5KAIC 2GM4A 2A05A 3HJEA 3S8PA 3PQJA 1MGTA 1R71A 1X3UA 3IAS2 3P9IA 2E1NA 2QLZA 2VONA 2RNGA 1FP1D 1W1WE 2VB6A 1GXPA 1QA6A 5L3DA 1IXSB 1JHHA 2L7KA 2VXDA 4DZPA 5CQGA 3EETA 1TT0A 2K9MA 2HPIA 5E17F 1IG7A 1XG1A 1CF7B 2VPLA 2EK5A 4S05A 5HDKA 4CSWA 3L2QA 4P1WA 2FBHA 2DTZA 1IRXA 3NQOA 2IA2A 2QQBA 4C3IJ 4II2A 3W6JB 3CF5F 1RUNA 2WWYA 4KICA 4WF2A 4OIOF 1W0UA 1ZAOA 5K7FA 4BH9A 2LYCA 2LLKA 5H20A 3WODF 3RQ4A 1K61A 3W6VA 3ECOA 3BG7A 3T0YA 5J47A 1BIBA 1K83J 1YJ9I 4JX5A 1J75A 2KIFA 2HQRA 3K4BA 4RGRA 1FYMA 3MZHA 1GT0C 3AL0C 2M0CA 2XAHA 5KHDA 3GFMA 2E19A 4RAZA 4G94A
chains in the Genus database with same CATH topology
2Z33A 1S29A 2DQLA 3D5LA 1ZYRF 5ILSA 2D1HA 3R61A 2F2EA 1R58A 3IRRA 2MC3A 2EFWA 5FD5A 1XN7A 1Z1DA 2OD5A 5D5XB 2CWEA 3N97A 3F6OA 4WXHA 3G73A 3ZMZA 3ECHA 2Y75A 2Z9OA 1Y0UA 2FSWA 2XGXA 5DEQA 4LG0A 1QO0D 1E17A 1QNTA 3WU1B 1W5SA 4I2OA 1LB2A 3CTAA 4L9TA 2QM3A 3KP6A 3WGHA 1IZ1A 1FNNA 3U9GA 2VN2A 3LQRA 1QQIA 4HZFA 1XSDA 3G3ZA 5LRSA 4AIKA 3KLNA 1IXRC 3ABTA 1YIOA 4CDGA 1FZPB 2G9WA 3SXYA 3R60A 2WV0A 4LB5A 2F5EA 3F3XA 2XUBA 3OOPA 1OPCA 5DCMB 4L9VA 4A5MA 4EM1A 1XB4A 5E1WA 2QQ9A 4KNYA 3V8LA 1MD0A 2ZKZA 3C3WA 2EV6A 4YIFA 1O3TA 4YIIA 4I98B 2EFPA 2BV6A 3V7SA 4EJVA 2F5DA 3C7JA 3BZ6A 1NHAA 2D2WA 2YX4A 5FFXA 3WGGA 3SZTA 2E1CA 4LLLA 2FMLA 3ERED 2ZBKA 3QP6A 5K1YA 3SFZA 3SZPA 2VBZA 4A2UA 2R3SA 4CZZA 2B0LA 3WTYC 3T5XA 3JSPA 4IHSA 1R00A 2KIMA 5CJ9A 1R5GA 2Z5UA 2ZCWA 5JI6A 1O7LA 3EDPA 1BI0A 4ZYHA 2HYFA 3IHUA 5EEHA 2QENA 1W7PB 2XKOA 4UV9A 1G3YA 2ZNYA 4WXCA 2W24A 1XGMA 5D5UB 3ULQB 3BY6A 1ZGAA 2L02A 1TTYA 5E8GA 4CGZA 4O6JA 5F64A 4M9XA 5F1RA 2ISYA 1D8JA 5DUIA 4M74A 4FX0A 2E7WA 5KK1A 1FBQA 2FQ3A 5LRRA 3RKYA 3TOAA 2P8TA 3QPHA 3I54A 2UXXA 1YS6A 1T6SA 4ENKA 3KZZA 1L0OC 5IT9K 2M30A 2W25A 2XAFA 4CXFA 4TV7A 5LHGA 3H3ZA 2P7CB 2OBPA 2F5FA 3LSTA 1G3SA 2A6HF 4KUMA 4R79A 2QQAA 4GYGA 3ROUA 1K78B 3C1DA 2VE9A 5CVVA 3I53A 4I02A 3GFIA 2DU9A 4P55A 3FWEA 2ETHA 5E1XA 5JR3A 4LB6B 3ZMVA 3BJOA 3SHFA 4R1HA 2XV4S 1FBSA 1TQMA 3EQLF 3O2PE 5BS6A 3P9KA 2HZTA 3LA3A 1R1VA 1OKRA 3FMQA 3JW4A 3WGIA 2P5KA 2IPQX 5E8IA 3BPXA 2R7DA 1FC3A 2PQ8A 3FX3A 4B09A 1FYKA 1ODDA 4I0AA 5D8KB 2HDCA 2KKOA 2LDUA 4EM0B 3GEZA 4A0ZA 5CVJA 2JPCA 1G4DA 4PCQA 4ESFA 1FT9A 3L2CA 2V1UA 3VODA 2J5OA 2M5WA 3LA7A 1QZYA 4FT8A 5HS7A 4ASNA 5LGNA 1WI9A 4P5OA 2A69F 3JSOA 1YTYA 4Q48A 4IVNA 4UVAA 3GVAA 2HS5A 1ON1A 4L0YB 1KU7A 1I1SA 5DCMA 2OQRA 2HWVA 4YFXF 4I09A 1IRGA 1P4AA 2GQQA 2XHKA 5LLQA 2EFQA 2BGCA 3QRFF 1OYIA 1W7PD 2ADUA 3IRQA 4LK1F 3QU3A 2LF8A 1LNWA 4KN7X 4UUVA 3J7AO 3H92A 3K1NA 5BQTA 3CUOA 3MEXA 4JQFA 3LQQA 1ON2A 2PBIA 3E6BA 4CYDA 4MEYF 3LA2A 1F4KA 2DLLA 5BPDA 3R4KA 2CG4A 4I01A 2HTSA 2QBYA 2ZNZA 2VBYA 4HX7A 4EJOA 1R7JA 3Q5FA 2HOEA 2RC4A 3SQNA 4KFCA 1USSA 1EH8A 1J5YA 4AWXB 2D1VA 3CUQC 2P5LC 3DEUA 1PP8F 4HW0A 4L5JA 3IKVA 2ZXJA 3DV8A 3VB2A 1O3RA 4A5NA 1KQ0A 4HQEA 3E6MA 3WTVC 1T38A 1RUOA 2MBFA 2TDXA 2L01A 2HR3A 1ZRDA 1R23A 4BXUA 2STWA 3T8TA 2Y48A 1AOYA 3GFLA 3IKTA 2K4BA 1KYWA 1WRJA 2CW0F 3CUQA 1Z7UA 1DDNA 4IF4A 4LLNA 2HYGD 2FF4A 1K79A 3VEPA 1JGSA 3V8JA 4MEXF 1XGOA 5L3EA 4HA8A 3V8KA 3I71A 1PUEE 1J59A 3ZQ7A 3VFZA 4MNUA 4N0BA 3CO6C 1Z6RA 4HDVA 4G9YA 3COAC 2O03A 1LDKB 2AXLA 3I5UA 1B59A 4U0VA 4YG2F 2CQKA 5ICFA 4D0PA 1IN8A 2DK8A 3JTHA 3RTRA 3ZN0A 2GXGA 5HDGA 3WTSC 1UHMA 5JHUA 2IA1A 3CO7C 1O3SA 3AAFA 4HOBA 3BJAA 4LG0B 2K7LA 2ZFWA 3QP5A 4ZYEA 2RV8A 4EJTA 4Y17A 1V3FA 3GWZA 2H09A 1BIAA 4M71A 1FLIA 3KP3A 3HRTA 5DD4A 3LAJA 4G7OF 3DF8A 1IF1A 4PZJA 4HV6A 3FHZA 1CGPA 2JTVA 1MKMA 2V79A 4KMUX 3IWFA 2MH2A 1G3WA 2EJRA 3TO9A 2R7FA 1YFHA 4ENJA 1XCBA 5D4SA 1GVJA 3HHHA 1JHFA 2YSRA 2IJLA 1KYZA 1WKMA 5K5RA 4BHPA 4LJZF 4UXNA 1DUXC 1MDMB 2GZWA 1HQCA 3LWFA 3B73A 3Q9SA 1Z05A 2VODA 4U7DA 1I6XA 2W57A 3TDZC 2M87A 3I64A 2PMUA 5CVIA 3FXQA 2QWWA 1HKSA 3RPUA 2RKHA 3KE2A 5ILVA 1QPMA 5TJJA 2PFBA 1XSVA 3KP4A 4YFKF 4LFUA 4G7HF 1T2KA 4HLXA 3V4GA 3RKXA 1REPC 3F72A 2K86A 1UB9A 2WTEA 4BQAA 5ERIA 4DNCA 5ED4A 3FXUA 3V7CA 3RI4A 4MTDA 3HOSA 1TW3A 4BYYA 3P9CA 2YR2A 4EMSA 3I59A 3R6SA 5LGUA 4PGHA 3BJ6A 1XDUA 4OMYA 3CLOA 3DPTA 2QBYB 1SFEA 4M9SA 3EYYA 1YQAA 3DQVC 1YW9A 5EEGA 2XAGA 2UZKA 1AWCA 5DDGA 1DPUA 3IL2A 1BBYA 4GO1A 2Q2EA 2GXBA 1SD7A 5H6QA 4Q4ZF 2DW4A 1LQ1A 4IRGA 5HOOA 1HSTA 4PDKA 1SMYF 1OR7A 4RS8A 2GWRA 1V4RA 2O61A 1QZZA 4HF0A 1P4WA 4QLCU 2MLKA 2Z3YA 2NNNA 2QZ8A 3PFIA 1PP7U 4IJAA 3ML6A 2W85A 4YFNF 1BC7C 4UHTA 2XIGA 1IXCA 5TRDA 4XSXF 2JZYA 4UVBA 1SFXA 2ESHA 3HRSA 3GW2A 5CLSA 1SD6A 2UWMA 5FD6A 1W7PA 4ZZLA 2OZUA 3LFKA 3J81Z 2YU3A 1FBUA 3CDHA 3NEUA 2HEOA 5ICGA 3FMRA 4S04A 2FOKA 1KU3A 5D5WB 2K27A 2E7XA 1XGSA 3HSEA 1T39A 4RB0A 1IN7A 3KLOA 5IT3A 5FGMA 5LBQA 4MTEA 3KEOA 2G7HA 1O7FA 2W84A 4MHGA 5DUKA 2H6BA 2RGVA 2BEOA 5L3GA 2L4MA 1FSHA 3GXOA 2YPRA 2P7VB 4ENNA 3O3KA 1LDJA 4I7HA 2BE5F 2MLGA 2OAZA 2CGPA 4Q5SF 2EWNA 5E20A 1C0WA 4RB1A 5HS8A 1KA8A 4OU0A 5LHIA 1XGNA 2A5YB 5HVQC 1G6NA 2JSCA 4WK8F 2ZMEB 4KN4X 2RQPA 1OYYA 1ZGJA 1E2XA 2FXAA 1YS7A 4N9IA 4KIGA 5AONA 3R0JA 4DQ2A 2ELHA 2DO7A 2L4AA 3ABUA 3HIFA 4NHJA 2A6EF 3I59B 4AIJA 4RAYA 5CVUA 3L09A 1R22A 4A6DA 5BOXA 2K4JA 4ESJA 3ZN1A 3IWZA 4ENMA 3F8BA 5E1ZB 4BAYA 1XMAA 4RB2C 1ZHFA 4KIBA 3BDDA 2NS0A 4M6XA 2FA5A 2YX7A 2O0YA 2EB7A 1ZRCA 4ON0A 1S8NA 2IP2A 2Z99A 5LHHA 1IN4A 1EH6A 3ZPLA 3KP5A 1ZARA 4CHUA 1U5TA 1XMKA 3K2ZA 4IHTA 3TKYA 3F8MA 1MJAA 2DPDA 4GYIA 1D3YA 1R1UA 4LK0F 1KU2A 4XRFA 2XASA 1YW8A 2FNPA 4P9UA 4P9FA 3TGNA 4XSZF 2MD5A 3BOQA 4Y13A 3WTUC 4EV0A 4HQMA 3WE3A 2F5CA 4PGGA 4OIPF 3GX4X 1Z91A 4G7ZF 1GXQA 3HTSB 1H9GA 2FU4A 3E5UA 2GA2A 1S6LA 4L5IA 4K2EA 1MDMA 3D0SA 2RNJA 2H27A 4RGUA 3HRMA 2PLYA 2XAQA 3L00A 1F1ZA 2RVCA 1B1BA 1YW7A 3DXJF 4HAMA 1STZA 1ZN2A 3FZVA 4KT5C 3F8FA 2XROA 3MZYA 4JBAA 4CICA 2HGCA 1XD7A 3HOTA 3VOEA 2PI0A 3K1PA 3K9TA 2ISZA 1RZ4A 4ZZDA 2QVOA 5AIPA 1FPQA 2EV0A 1HKTA 3E6DA 3GZ5A 5DD8A 1FX7A 1KQ9A 4ZYDA 5KVRA 2OQGA 1U78A 2EV5A 2VOPA 2AS5F 1J7KA 2JRTA 5F6FA 3HSFA 2KJCA 2QYOA 3EUHA 3ZP5A 4KA4A 3HTUA 1HBXG 4L18B 1D8KA 1ZG3A 1USTA 1FP2A 2FBKA 1MZBA 4HF1A 3QU6A 2EFOA 3HSRA 2IVMA 4ZYGA 3FXRA 4KYWA 1TQPA 3RDIA 1IN6A 2JPBA 3HYIA 1WWXA 2LNBA 2VXZA 2VC0A 5AIQA 3KFWX 1CF7A 4IXAA 2A3SA 3RYPA 1VTNC 1I27A 1IUYA 4EVIA 4P96A 2NYXA 2GAUA 1R1TA 4LGWA 3F21A 4BHBA 4IRHA 1B6AA 2OU2A 3TDUC 5FFZA 2DAOA 4HF2A 2DTRA 2GIVA 1BOAA 3MCZA 4GCVA 3I4PA 2FE3A 4LMYA 2EA2A 1K6OA 1FWZA 1TNTA 4G6QA 2V1DA 3S2WA 5ILUA 3TOBA 4AIHA 1ZG1A 4UNOA 4A0XA 3TO6A 4M9ZA 1BC8C 4XLPF 1B4AA 3U2RA 2PEXA 4L9JA 2LSOA 4HX8A 2RN7A 3RPQA 3JAMZ 2HKOA 2ACJA 1BM9A 2IT0A 3WTTC 4I0BA 3WTXC 5ICEA 4QWQA 4WWCA 5J6XA 3O6BB 5DYMA 1JE8A 2O8XA 2J5PA 1U2WA 2BYVE 2D45A 1RI7A 1BI1A 4G8XA 2VC1A 4F7ZA 4E70A 2FBIA 2LF7A 2H6CA 1U5TC 6PAXA 1SD5A 1UCRA 3JAMK 1ONVA 5BPIA 2IA0A 3TQNA 1EH7A 2NRAC 1OYWA 5LGTA 1MJBA 5L3FA 3FMSA 4EJWA 3W6KB 1W4MA 2CO5A 5FB2A 3RKWA 1HW1A 2KJBA 2UXNA 3RIRA 3MQ0A 1SAXA 4XLNF 4UVCA 3FM5A 2M8EA 2K02A 4OINF 3F22A 2H94A 1P6RA 4FX4A 2V6CA 1RNLA 3CUQB 5D4RA 1GHCA 2MA3A 3M7GA 2HFHA 2V9VA 4M73A 2DBBA 3WG9A 1U3EM 1J9IA 1BN5A 4A6EA 1HXDA 4HX4A 2P6SA 1SD4A 1MJ9A 3M8EA 4HYEA 1FY7A 1IAWA 4GXOA 3NRVA 4KMFA 2Q8KA 2X0LA 2M1BA 5BMZA 4OIQF 2Y0MA 2GA1A 1ZREA 5D6FA 1YLFA 5HDNA 4M72A 1FYLA 4H0EA 1O3QA 2FMYA 4NQWA 4L0ZB 3OV8A 2G7UA 3WTWC 3BROA 1BJAA 1KGSA 5J8CA 2V1XA 1LEAA 4A0YA 4EGZA 2BBYA 1K78A 1B9NA 2XRNA 4A12A 2IW5A 3ZMUA 5LEKA 1FSEA 1O57A 4XBFA 3CJNA 3J81K 4HDUA 4EJUA 5D6EA 1P2FA 3ZMDA 1BI3A 1DP7P 1JXSA 1I5ZA 2VT3A 3MAJA 4L9NA 1R36A 5DCFA 2OZ6A 2PMHA 3Q9VA 2XVCA 1LJ9A 2P4WA 2PN6A 3FF5A 4CO8A 3L9FA 1D5VA 2Q0OA 2IRFG 4M6YA 5HLHA 1Z6TA 3KCCA 2DI3A 2O6GE 2LKPA 4AD9A 4KIFA 1H0MA 1YO5C 1WQ2A 2DT5A 2VBXA 3ELKA 2P6TA 3V7RA 4ZH4F 5D8LB 4EM2A 3L7WA 2KIUA 3J80K 4EQQA 3P7NA 5L3CA 1ZLKA 1QBJA 1EV7A 3GO5A 3WTZA 1T98A 1TNSA 1TQIA 1Q1HA 1ZH5A 3U1DA 1DPRA 3K69A 5ICCA 2CFXA 4MQ9F 3GF2A 2FEZA 3T8RA 3F8CA 4R8HA 4LLGF 5J8FA 4AVPA 4Q47A 5HLGA 4U0YA 1ULYA 3E5XA 1F5TA 1TBXA 3GZ6A 2ESNA 2NAZA 2CSOA 2A07F 1XSXA 2HTJA 3F23A 5HS9A 1QGPA 3E5QA 4WCGA 2X4HA 5L3BA 2L54A 4WX9A 5D5VB 2DFIA 1R5HA 1SMTA 4Y15A 1UFMA 1S3JA 3R0AA 2DK5A 3J80Z 1L3LA 2KRFA 2ZMEA 1LEBA 2VT2A 3PQKA 1XDSA 3QOPA 3GUDA 5K5OA 2VE8A 4IPAA 2OA4A 1P4XA 3BWGA 2MH9A 4LD5A 1ZRFA 4O3MA 3GFJA 4O5VA 1W5TA 3GLXA 1PDNC 3HHGA 1IW7F 1H9TA 4RGSA 3JTGA 3IC7A 4NB5A 3DP7A 3M9AA 2DQRA 4MGRA 1Z9CA 4OMZA 1TLHB 4U0WA 4RGXA 1YG2A 3MWMA 3K0LA 4EGYA 1OMIA 1SFUA 2RDPA 1XCVA 3KZYA 1HSJA 2QUFA 1LVAA 5E18F 2JT1A 2ZO4A 1A04A 3DKWA 3ZMTA 2XKPA 4BHCA 3RYRA 2C6YA 3WU0A 4HLYA 1HW2A 1G3TA 5IT9Z 3HUGA 4OIRF 2O3FA 1J0RA 4ESBA 3DFGA 3N4MA 3K1MA 3B02A 3KP7A 3FM3A 1HW5A 2A68F 3ZMSA 1F9NA 4B8XA 3TO7A 2L3DA 5JVTA 1S7OA 3I58A 1YYVA 3I0TA 5FO5A 4BNCA 1IN5A 3F8NA 1U6GA 4FHTA 3E97A 1BI2A 1WSUA 1LDDA 4ETSA 2VOOA 2HKXA 2CYYA 5HLIA 2WC2A 4Z2YA 1HKQA 4UV8A 1IRFA 3EYIA 3REOA 5A2QK 2NNYA 2PJPA 2STTA 3GYHX 3E6CC 2HQNA 3HRUA 4HV5A 5CVRA 3F6VA 2VBWA 2XAJA 3DPLC 2ZJ2A 2COMA 3M8FA 1TW2A 3BP8A 3KEQA 1FOKA 4JK1X 4G6DA 3H3UA 1P92A 2PG4A 3WE2A 3M1EA 3QAHA 3BPVA 3RJPA 5H6RA 1S7AA 3KP2A 2FNAA 1RIOH 4HBLA 1K7AA 4MQVA 5DV5A 1U8RA 2EA4A 1I1GA 1UHWA 5CYVA 1B9MA 4U7BA 1U5TB 2EFNA 4OOIA 5JFRA 4RB3C 3C18A 4GGGA 5K5QA 5FLXK 3LAPA 4N9HA 2P5VA 5A2QZ 2FRHA 5FLXZ 2A61A 1ZG5A 1T0FA 2M45A 2DPUA 3T1BA 4WXDA 4IRIA 1KQ8A 3E3VA 3MFKA 1J2XA 3ISPA 4KDPA 3QPTA 1KU9A 1ZLJA 4U88A 3KETA 5LEJA 3PQJA 1MGTA 1X3UA 3P9IA 2E1NA 2QLZA 2VONA 1FP1D 1GXPA 5L3DA 1IXSB 1JHHA 3EETA 5E17F 1CF7B 2EK5A 4S05A 5HDKA 2FBHA 3NQOA 2IA2A 2QQBA 3W6JB 1RUNA 2WWYA 4KICA 4WF2A 4OIOF 1ZAOA 4BH9A 5H20A 3WODF 3ECOA 3T0YA 1BIBA 1J75A 2KIFA 2HQRA 4RGRA 1FYMA 3MZHA 2XAHA 3GFMA 4RAZA 4G94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z33 A;  1S29 A;  2DQL A;  3D5L A;  1ZYR F;  5ILS A;  2D1H A;  3R61 A;  2F2E A;  1R58 A;  3IRR A;  2MC3 A;  2EFW A;  5FD5 A;  1XN7 A;  1Z1D A;  2OD5 A;  5D5X B;  2CWE A;  3N97 A;  3F6O A;  4WXH A;  3G73 A;  3ZMZ A;  3ECH A;  2Y75 A;  2Z9O A;  1Y0U A;  2FSW A;  2XGX A;  5DEQ A;  4LG0 A;  1QO0 D;  1E17 A;  1QNT A;  3WU1 B;  1W5S A;  4I2O A;  1LB2 A;  3CTA A;  4L9T A;  2QM3 A;  3KP6 A;  3WGH A;  1IZ1 A;  1FNN A;  3U9G A;  2VN2 A;  3LQR A;  1QQI A;  4HZF A;  1XSD A;  3G3Z A;  5LRS A;  4AIK A;  3KLN A;  1IXR C;  3ABT A;  1YIO A;  4CDG A;  1FZP B;  2G9W A;  3SXY A;  3R60 A;  2WV0 A;  4LB5 A;  2F5E A;  3F3X A;  2XUB A;  3OOP A;  1OPC A;  5DCM B;  4L9V A;  4A5M A;  4EM1 A;  1XB4 A;  5E1W A;  2QQ9 A;  4KNY A;  3V8L A;  1MD0 A;  2ZKZ A;  3C3W A;  2EV6 A;  4YIF A;  1O3T A;  4YII A;  4I98 B;  2EFP A;  2BV6 A;  3V7S A;  4EJV A;  2F5D A;  3C7J A;  3BZ6 A;  1NHA A;  2D2W A;  2YX4 A;  5FFX A;  3WGG A;  3SZT A;  2E1C A;  4LLL A;  2FML A;  3ERE D;  2ZBK A;  3QP6 A;  5K1Y A;  3SFZ A;  3SZP A;  2VBZ A;  4A2U A;  2R3S A;  4CZZ A;  2B0L A;  3WTY C;  3T5X A;  3JSP A;  4IHS A;  1R00 A;  2KIM A;  5CJ9 A;  1R5G A;  2Z5U A;  2ZCW A;  5JI6 A;  1O7L A;  3EDP A;  1BI0 A;  4ZYH A;  2HYF A;  3IHU A;  5EEH A;  2QEN A;  1W7P B;  2XKO A;  4UV9 A;  1G3Y A;  2ZNY A;  4WXC A;  2W24 A;  1XGM A;  5D5U B;  3ULQ B;  3BY6 A;  1ZGA A;  2L02 A;  1TTY A;  5E8G A;  4CGZ A;  4O6J A;  5F64 A;  4M9X A;  5F1R A;  2ISY A;  1D8J A;  5DUI A;  4M74 A;  4FX0 A;  2E7W A;  5KK1 A;  1FBQ A;  2FQ3 A;  5LRR A;  3RKY A;  3TOA A;  2P8T A;  3QPH A;  3I54 A;  2UXX A;  1YS6 A;  1T6S A;  4ENK A;  3KZZ A;  1L0O C;  5IT9 K;  2M30 A;  2W25 A;  2XAF A;  4CXF A;  4TV7 A;  5LHG A;  3H3Z A;  2P7C B;  2OBP A;  2F5F A;  3LST A;  1G3S A;  2A6H F;  4KUM A;  4R79 A;  2QQA A;  4GYG A;  3ROU A;  1K78 B;  3C1D A;  2VE9 A;  5CVV A;  3I53 A;  4I02 A;  3GFI A;  2DU9 A;  4P55 A;  3FWE A;  2ETH A;  5E1X A;  5JR3 A;  4LB6 B;  3ZMV A;  3BJO A;  3SHF A;  4R1H A;  2XV4 S;  1FBS A;  1TQM A;  3EQL F;  3O2P E;  5BS6 A;  3P9K A;  2HZT A;  3LA3 A;  1R1V A;  1OKR A;  3FMQ A;  3JW4 A;  3WGI A;  2P5K A;  2IPQ X;  5E8I A;  3BPX A;  2R7D A;  1FC3 A;  2PQ8 A;  3FX3 A;  4B09 A;  1FYK A;  1ODD A;  4I0A A;  5D8K B;  2HDC A;  2KKO A;  2LDU A;  4EM0 B;  3GEZ A;  4A0Z A;  5CVJ A;  2JPC A;  1G4D A;  4PCQ A;  4ESF A;  1FT9 A;  3L2C A;  2V1U A;  3VOD A;  2J5O A;  2M5W A;  3LA7 A;  1QZY A;  4FT8 A;  5HS7 A;  4ASN A;  5LGN A;  1WI9 A;  4P5O A;  2A69 F;  3JSO A;  1YTY A;  4Q48 A;  4IVN A;  4UVA A;  3GVA A;  2HS5 A;  1ON1 A;  4L0Y B;  1KU7 A;  1I1S A;  5DCM A;  2OQR A;  2HWV A;  4YFX F;  4I09 A;  1IRG A;  1P4A A;  2GQQ A;  2XHK A;  5LLQ A;  2EFQ A;  2BGC A;  3QRF F;  1OYI A;  1W7P D;  2ADU A;  3IRQ A;  4LK1 F;  3QU3 A;  2LF8 A;  1LNW A;  4KN7 X;  4UUV A;  3J7A O;  3H92 A;  3K1N A;  5BQT A;  3CUO A;  3MEX A;  4JQF A;  3LQQ A;  1ON2 A;  2PBI A;  3E6B A;  4CYD A;  4MEY F;  3LA2 A;  1F4K A;  2DLL A;  5BPD A;  3R4K A;  2CG4 A;  4I01 A;  2HTS A;  2QBY A;  2ZNZ A;  2VBY A;  4HX7 A;  4EJO A;  1R7J A;  3Q5F A;  2HOE A;  2RC4 A;  3SQN A;  4KFC A;  1USS A;  1EH8 A;  1J5Y A;  4AWX B;  2D1V A;  3CUQ C;  2P5L C;  3DEU A;  1PP8 F;  4HW0 A;  4L5J A;  3IKV A;  2ZXJ A;  3DV8 A;  3VB2 A;  1O3R A;  4A5N A;  1KQ0 A;  4HQE A;  3E6M A;  3WTV C;  1T38 A;  1RUO A;  2MBF A;  2TDX A;  2L01 A;  2HR3 A;  1ZRD A;  1R23 A;  4BXU A;  2STW A;  3T8T A;  2Y48 A;  1AOY A;  3GFL A;  3IKT A;  2K4B A;  1KYW A;  1WRJ A;  2CW0 F;  3CUQ A;  1Z7U A;  1DDN A;  4IF4 A;  4LLN A;  2HYG D;  2FF4 A;  1K79 A;  3VEP A;  1JGS A;  3V8J A;  4MEX F;  1XGO A;  5L3E A;  4HA8 A;  3V8K A;  3I71 A;  1PUE E;  1J59 A;  3ZQ7 A;  3VFZ A;  4MNU A;  4N0B A;  3CO6 C;  1Z6R A;  4HDV A;  4G9Y A;  3COA C;  2O03 A;  1LDK B;  2AXL A;  3I5U A;  1B59 A;  4U0V A;  4YG2 F;  2CQK A;  5ICF A;  4D0P A;  1IN8 A;  2DK8 A;  3JTH A;  3RTR A;  3ZN0 A;  2GXG A;  5HDG A;  3WTS C;  1UHM A;  5JHU A;  2IA1 A;  3CO7 C;  1O3S A;  3AAF A;  4HOB A;  3BJA A;  4LG0 B;  2K7L A;  2ZFW A;  3QP5 A;  4ZYE A;  2RV8 A;  4EJT A;  4Y17 A;  1V3F A;  3GWZ A;  2H09 A;  1BIA A;  4M71 A;  1FLI A;  3KP3 A;  3HRT A;  5DD4 A;  3LAJ A;  4G7O F;  3DF8 A;  1IF1 A;  4PZJ A;  4HV6 A;  3FHZ A;  1CGP A;  2JTV A;  1MKM A;  2V79 A;  4KMU X;  3IWF A;  2MH2 A;  1G3W A;  2EJR A;  3TO9 A;  2R7F A;  1YFH A;  4ENJ A;  1XCB A;  5D4S A;  1GVJ A;  3HHH A;  1JHF A;  2YSR A;  2IJL A;  1KYZ A;  1WKM A;  5K5R A;  4BHP A;  4LJZ F;  4UXN A;  1DUX C;  1MDM B;  2GZW A;  1HQC A;  3LWF A;  3B73 A;  3Q9S A;  1Z05 A;  2VOD A;  4U7D A;  1I6X A;  2W57 A;  3TDZ C;  2M87 A;  3I64 A;  2PMU A;  5CVI A;  3FXQ A;  2QWW A;  1HKS A;  3RPU A;  2RKH A;  3KE2 A;  5ILV A;  1QPM A;  5TJJ A;  2PFB A;  1XSV A;  3KP4 A;  4YFK F;  4LFU A;  4G7H F;  1T2K A;  4HLX A;  3V4G A;  3RKX A;  1REP C;  3F72 A;  2K86 A;  1UB9 A;  2WTE A;  4BQA A;  5ERI A;  4DNC A;  5ED4 A;  3FXU A;  3V7C A;  3RI4 A;  4MTD A;  3HOS A;  1TW3 A;  4BYY A;  3P9C A;  2YR2 A;  4EMS A;  3I59 A;  3R6S A;  5LGU A;  4PGH A;  3BJ6 A;  1XDU A;  4OMY A;  3CLO A;  3DPT A;  2QBY B;  1SFE A;  4M9S A;  3EYY A;  1YQA A;  3DQV C;  1YW9 A;  5EEG A;  2XAG A;  2UZK A;  1AWC A;  5DDG A;  1DPU A;  3IL2 A;  1BBY A;  4GO1 A;  2Q2E A;  2GXB A;  1SD7 A;  5H6Q A;  4Q4Z F;  2DW4 A;  1LQ1 A;  4IRG A;  5HOO A;  1HST A;  4PDK A;  1SMY F;  1OR7 A;  4RS8 A;  2GWR A;  1V4R A;  2O61 A;  1QZZ A;  4HF0 A;  1P4W A;  4QLC U;  2MLK A;  2Z3Y A;  2NNN A;  2QZ8 A;  3PFI A;  1PP7 U;  4IJA A;  3ML6 A;  2W85 A;  4YFN F;  1BC7 C;  4UHT A;  2XIG A;  1IXC A;  5TRD A;  4XSX F;  2JZY A;  4UVB A;  1SFX A;  2ESH A;  3HRS A;  3GW2 A;  5CLS A;  1SD6 A;  2UWM A;  5FD6 A;  1W7P A;  4ZZL A;  2OZU A;  3LFK A;  3J81 Z;  2YU3 A;  1FBU A;  3CDH A;  3NEU A;  2HEO A;  5ICG A;  3FMR A;  4S04 A;  2FOK A;  1KU3 A;  5D5W B;  2K27 A;  2E7X A;  1XGS A;  3HSE A;  1T39 A;  4RB0 A;  1IN7 A;  3KLO A;  5IT3 A;  5FGM A;  5LBQ A;  4MTE A;  3KEO A;  2G7H A;  1O7F A;  2W84 A;  4MHG A;  5DUK A;  2H6B A;  2RGV A;  2BEO A;  5L3G A;  2L4M A;  1FSH A;  3GXO A;  2YPR A;  2P7V B;  4ENN A;  3O3K A;  1LDJ A;  4I7H A;  2BE5 F;  2MLG A;  2OAZ A;  2CGP A;  4Q5S F;  2EWN A;  5E20 A;  1C0W A;  4RB1 A;  5HS8 A;  1KA8 A;  4OU0 A;  5LHI A;  1XGN A;  2A5Y B;  5HVQ C;  1G6N A;  2JSC A;  4WK8 F;  2ZME B;  4KN4 X;  2RQP A;  1OYY A;  1ZGJ A;  1E2X A;  2FXA A;  1YS7 A;  4N9I A;  4KIG A;  5AON A;  3R0J A;  4DQ2 A;  2ELH A;  2DO7 A;  2L4A A;  3ABU A;  3HIF A;  4NHJ A;  2A6E F;  3I59 B;  4AIJ A;  4RAY A;  5CVU A;  3L09 A;  1R22 A;  4A6D A;  5BOX A;  2K4J A;  4ESJ A;  3ZN1 A;  3IWZ A;  4ENM A;  3F8B A;  5E1Z B;  4BAY A;  1XMA A;  4RB2 C;  1ZHF A;  4KIB A;  3BDD A;  2NS0 A;  4M6X A;  2FA5 A;  2YX7 A;  2O0Y A;  2EB7 A;  1ZRC A;  4ON0 A;  1S8N A;  2IP2 A;  2Z99 A;  5LHH A;  1IN4 A;  1EH6 A;  3ZPL A;  3KP5 A;  1ZAR A;  4CHU A;  1U5T A;  1XMK A;  3K2Z A;  4IHT A;  3TKY A;  3F8M A;  1MJA A;  2DPD A;  4GYI A;  1D3Y A;  1R1U A;  4LK0 F;  1KU2 A;  4XRF A;  2XAS A;  1YW8 A;  2FNP A;  4P9U A;  4P9F A;  3TGN A;  4XSZ F;  2MD5 A;  3BOQ A;  4Y13 A;  3WTU C;  4EV0 A;  4HQM A;  3WE3 A;  2F5C A;  4PGG A;  4OIP F;  3GX4 X;  1Z91 A;  4G7Z F;  1GXQ A;  3HTS B;  1H9G A;  2FU4 A;  3E5U A;  2GA2 A;  1S6L A;  4L5I A;  4K2E A;  1MDM A;  3D0S A;  2RNJ A;  2H27 A;  4RGU A;  3HRM A;  2PLY A;  2XAQ A;  3L00 A;  1F1Z A;  2RVC A;  1B1B A;  1YW7 A;  3DXJ F;  4HAM A;  1STZ A;  1ZN2 A;  3FZV A;  4KT5 C;  3F8F A;  2XRO A;  3MZY A;  4JBA A;  4CIC A;  2HGC A;  1XD7 A;  3HOT A;  3VOE A;  2PI0 A;  3K1P A;  3K9T A;  2ISZ A;  1RZ4 A;  4ZZD A;  2QVO A;  5AIP A;  1FPQ A;  2EV0 A;  1HKT A;  3E6D A;  3GZ5 A;  5DD8 A;  1FX7 A;  1KQ9 A;  4ZYD A;  5KVR A;  2OQG A;  1U78 A;  2EV5 A;  2VOP A;  2AS5 F;  1J7K A;  2JRT A;  5F6F A;  3HSF A;  2KJC A;  2QYO A;  3EUH A;  3ZP5 A;  4KA4 A;  3HTU A;  1HBX G;  4L18 B;  1D8K A;  1ZG3 A;  1UST A;  1FP2 A;  2FBK A;  1MZB A;  4HF1 A;  3QU6 A;  2EFO A;  3HSR A;  2IVM A;  4ZYG A;  3FXR A;  4KYW A;  1TQP A;  3RDI A;  1IN6 A;  2JPB A;  3HYI A;  1WWX A;  2LNB A;  2VXZ A;  2VC0 A;  5AIQ A;  3KFW X;  1CF7 A;  4IXA A;  2A3S A;  3RYP A;  1VTN C;  1I27 A;  1IUY A;  4EVI A;  4P96 A;  2NYX A;  2GAU A;  1R1T A;  4LGW A;  3F21 A;  4BHB A;  4IRH A;  1B6A A;  2OU2 A;  3TDU C;  5FFZ A;  2DAO A;  4HF2 A;  2DTR A;  2GIV A;  1BOA A;  3MCZ A;  4GCV A;  3I4P A;  2FE3 A;  4LMY A;  2EA2 A;  1K6O A;  1FWZ A;  1TNT A;  4G6Q A;  2V1D A;  3S2W A;  5ILU A;  3TOB A;  4AIH A;  1ZG1 A;  4UNO A;  4A0X A;  3TO6 A;  4M9Z A;  1BC8 C;  4XLP F;  1B4A A;  3U2R A;  2PEX A;  4L9J A;  2LSO A;  4HX8 A;  2RN7 A;  3RPQ A;  3JAM Z;  2HKO A;  2ACJ A;  1BM9 A;  2IT0 A;  3WTT C;  4I0B A;  3WTX C;  5ICE A;  4QWQ A;  4WWC A;  5J6X A;  3O6B B;  5DYM A;  1JE8 A;  2O8X A;  2J5P A;  1U2W A;  2BYV E;  2D45 A;  1RI7 A;  1BI1 A;  4G8X A;  2VC1 A;  4F7Z A;  4E70 A;  2FBI A;  2LF7 A;  2H6C A;  1U5T C;  6PAX A;  1SD5 A;  1UCR A;  3JAM K;  1ONV A;  5BPI A;  2IA0 A;  3TQN A;  1EH7 A;  2NRA C;  1OYW A;  5LGT A;  1MJB A;  5L3F A;  3FMS A;  4EJW A;  3W6K B;  1W4M A;  2CO5 A;  5FB2 A;  3RKW A;  1HW1 A;  2KJB A;  2UXN A;  3RIR A;  3MQ0 A;  1SAX A;  4XLN F;  4UVC A;  3FM5 A;  2M8E A;  2K02 A;  4OIN F;  3F22 A;  2H94 A;  1P6R A;  4FX4 A;  2V6C A;  1RNL A;  3CUQ B;  5D4R A;  1GHC A;  2MA3 A;  3M7G A;  2HFH A;  2V9V A;  4M73 A;  2DBB A;  3WG9 A;  1U3E M;  1J9I A;  1BN5 A;  4A6E A;  1HXD A;  4HX4 A;  2P6S A;  1SD4 A;  1MJ9 A;  3M8E A;  4HYE A;  1FY7 A;  1IAW A;  4GXO A;  3NRV A;  4KMF A;  2Q8K A;  2X0L A;  2M1B A;  5BMZ A;  4OIQ F;  2Y0M A;  2GA1 A;  1ZRE A;  5D6F A;  1YLF A;  5HDN A;  4M72 A;  1FYL A;  4H0E A;  1O3Q A;  2FMY A;  4NQW A;  4L0Z B;  3OV8 A;  2G7U A;  3WTW C;  3BRO A;  1BJA A;  1KGS A;  5J8C A;  2V1X A;  1LEA A;  4A0Y A;  4EGZ A;  2BBY A;  1K78 A;  1B9N A;  2XRN A;  4A12 A;  2IW5 A;  3ZMU A;  5LEK A;  1FSE A;  1O57 A;  4XBF A;  3CJN A;  3J81 K;  4HDU A;  4EJU A;  5D6E A;  1P2F A;  3ZMD A;  1BI3 A;  1DP7 P;  1JXS A;  1I5Z A;  2VT3 A;  3MAJ A;  4L9N A;  1R36 A;  5DCF A;  2OZ6 A;  2PMH A;  3Q9V A;  2XVC A;  1LJ9 A;  2P4W A;  2PN6 A;  3FF5 A;  4CO8 A;  3L9F A;  1D5V A;  2Q0O A;  2IRF G;  4M6Y A;  5HLH A;  1Z6T A;  3KCC A;  2DI3 A;  2O6G E;  2LKP A;  4AD9 A;  4KIF A;  1H0M A;  1YO5 C;  1WQ2 A;  2DT5 A;  2VBX A;  3ELK A;  2P6T A;  3V7R A;  4ZH4 F;  5D8L B;  4EM2 A;  3L7W A;  2KIU A;  3J80 K;  4EQQ A;  3P7N A;  5L3C A;  1ZLK A;  1QBJ A;  1EV7 A;  3GO5 A;  3WTZ A;  1T98 A;  1TNS A;  1TQI A;  1Q1H A;  1ZH5 A;  3U1D A;  1DPR A;  3K69 A;  5ICC A;  2CFX A;  4MQ9 F;  3GF2 A;  2FEZ A;  3T8R A;  3F8C A;  4R8H A;  4LLG F;  5J8F A;  4AVP A;  4Q47 A;  5HLG A;  4U0Y A;  1ULY A;  3E5X A;  1F5T A;  1TBX A;  3GZ6 A;  2ESN A;  2NAZ A;  2CSO A;  2A07 F;  1XSX A;  2HTJ A;  3F23 A;  5HS9 A;  1QGP A;  3E5Q A;  4WCG A;  2X4H A;  5L3B A;  2L54 A;  4WX9 A;  5D5V B;  2DFI A;  1R5H A;  1SMT A;  4Y15 A;  1UFM A;  1S3J A;  3R0A A;  2DK5 A;  3J80 Z;  1L3L A;  2KRF A;  2ZME A;  1LEB A;  2VT2 A;  3PQK A;  1XDS A;  3QOP A;  3GUD A;  5K5O A;  2VE8 A;  4IPA A;  2OA4 A;  1P4X A;  3BWG A;  2MH9 A;  4LD5 A;  1ZRF A;  4O3M A;  3GFJ A;  4O5V A;  1W5T A;  3GLX A;  1PDN C;  3HHG A;  1IW7 F;  1H9T A;  4RGS A;  3JTG A;  3IC7 A;  4NB5 A;  3DP7 A;  3M9A A;  2DQR A;  4MGR A;  1Z9C A;  4OMZ A;  1TLH B;  4U0W A;  4RGX A;  1YG2 A;  3MWM A;  3K0L A;  4EGY A;  1OMI A;  1SFU A;  2RDP A;  1XCV A;  3KZY A;  1HSJ A;  2QUF A;  1LVA A;  5E18 F;  2JT1 A;  2ZO4 A;  1A04 A;  3DKW A;  3ZMT A;  2XKP A;  4BHC A;  3RYR A;  2C6Y A;  3WU0 A;  4HLY A;  1HW2 A;  1G3T A;  5IT9 Z;  3HUG A;  4OIR F;  2O3F A;  1J0R A;  4ESB A;  3DFG A;  3N4M A;  3K1M A;  3B02 A;  3KP7 A;  3FM3 A;  1HW5 A;  2A68 F;  3ZMS A;  1F9N A;  4B8X A;  3TO7 A;  2L3D A;  5JVT A;  1S7O A;  3I58 A;  1YYV A;  3I0T A;  5FO5 A;  4BNC A;  1IN5 A;  3F8N A;  1U6G A;  4FHT A;  3E97 A;  1BI2 A;  1WSU A;  1LDD A;  4ETS A;  2VOO A;  2HKX A;  2CYY A;  5HLI A;  2WC2 A;  4Z2Y A;  1HKQ A;  4UV8 A;  1IRF A;  3EYI A;  3REO A;  5A2Q K;  2NNY A;  2PJP A;  2STT A;  3GYH X;  3E6C C;  2HQN A;  3HRU A;  4HV5 A;  5CVR A;  3F6V A;  2VBW A;  2XAJ A;  3DPL C;  2ZJ2 A;  2COM A;  3M8F A;  1TW2 A;  3BP8 A;  3KEQ A;  1FOK A;  4JK1 X;  4G6D A;  3H3U A;  1P92 A;  2PG4 A;  3WE2 A;  3M1E A;  3QAH A;  3BPV A;  3RJP A;  5H6R A;  1S7A A;  3KP2 A;  2FNA A;  1RIO H;  4HBL A;  1K7A A;  4MQV A;  5DV5 A;  1U8R A;  2EA4 A;  1I1G A;  1UHW A;  5CYV A;  1B9M A;  4U7B A;  1U5T B;  2EFN A;  4OOI A;  5JFR A;  4RB3 C;  3C18 A;  4GGG A;  5K5Q A;  5FLX K;  3LAP A;  4N9H A;  2P5V A;  5A2Q Z;  2FRH A;  5FLX Z;  2A61 A;  1ZG5 A;  1T0F A;  2M45 A;  2DPU A;  3T1B A;  4WXD A;  4IRI A;  1KQ8 A;  3E3V A;  3MFK A;  1J2X A;  3ISP A;  4KDP A;  3QPT A;  1KU9 A;  1ZLJ A;  4U88 A;  3KET A;  5LEJ A;  3PQJ A;  1MGT A;  1X3U A;  3P9I A;  2E1N A;  2QLZ A;  2VON A;  1FP1 D;  1GXP A;  5L3D A;  1IXS B;  1JHH A;  3EET A;  5E17 F;  1CF7 B;  2EK5 A;  4S05 A;  5HDK A;  2FBH A;  3NQO A;  2IA2 A;  2QQB A;  3W6J B;  1RUN A;  2WWY A;  4KIC A;  4WF2 A;  4OIO F;  1ZAO A;  4BH9 A;  5H20 A;  3WOD F;  3ECO A;  3T0Y A;  1BIB A;  1J75 A;  2KIF A;  2HQR A;  4RGR A;  1FYM A;  3MZH A;  2XAH A;  3GFM A;  4RAZ A;  4G94 A; 
#chains in the Genus database with same CATH topology
 2Z33 A;  1S29 A;  2DQL A;  3D5L A;  1ZYR F;  5ILS A;  2DOF A;  4E7Z A;  2D1H A;  1B8I B;  3R61 A;  2F2E A;  1R58 A;  3CZ6 A;  3IRR A;  2MC3 A;  5EJC A;  5FD5 A;  2EFW A;  1XN7 A;  3S3O A;  1D1A A;  1Z1D A;  5F1J A;  2OD5 A;  3JRB A;  5D5X B;  2CWE A;  3N97 A;  3DU5 A;  3F6O A;  4WXH A;  3G73 A;  3ZMZ A;  1DGR M;  1T0F C;  3QPL A;  3JRD A;  3ECH A;  1RES A;  4CH7 A;  3GCM A;  3GTL J;  2Y75 A;  4QPQ A;  2VJI A;  1VFC A;  4DBR A;  1Y0U A;  2FSW A;  2XGX A;  3BR0 A;  5DEQ A;  2Z9O A;  4LG0 A;  2JUC A;  3Q0W A;  3G1M A;  1QO0 D;  5LFA A;  1E17 A;  3J7A Y;  1QNT A;  1YJN I;  3WU1 B;  1ETK A;  3CCE I;  1W5S A;  2YS9 A;  2X6Y A;  3KEY A;  4I2O A;  1LB2 A;  2ME0 A;  2BZT A;  3CTA A;  5HNH A;  4L9T A;  1MSE C;  2QM3 A;  3KP6 A;  3WGH A;  4YIR X;  2HI3 A;  1IZ1 A;  1IO2 A;  3OMY A;  1FNN A;  3U9G A;  2BXY A;  4JX6 A;  2VN2 A;  3LQR A;  1QQI A;  4HZF A;  3HGG A;  4E6K G;  2R5Z B;  1XSD A;  3G3Z A;  2PMZ N;  3HM5 A;  5LRS A;  1A6Q A;  1OLT A;  3KLN A;  5H2F C;  1IXR C;  3ABT A;  1YIO A;  4CDG A;  4AIK A;  2G9W A;  1FZP B;  1YIT I;  3SXY A;  3R60 A;  1JTX A;  1W0T A;  2WV0 A;  1RR7 A;  4LB5 A;  2F5E A;  1VQL I;  3F3X A;  1X1D A;  4MFE A;  3HL2 A;  3OL3 A;  1PUF A;  3FK7 A;  2XUB A;  3OOP A;  1UG2 A;  1OPC A;  5DCM B;  4L9V A;  3PNT A;  4A5M A;  1J09 A;  2M4G A;  4EM1 A;  1XB4 A;  5E1W A;  2QQ9 A;  4C2T A;  1U9O A;  3DLA A;  3MD2 A;  2ZME C;  2QGU A;  4PFO A;  2Y69 H;  4KNY A;  3V8L A;  1VQO I;  1MD0 A;  2ZKZ A;  2JA5 J;  3C3W A;  1RPW A;  2EV6 A;  4HRI A;  1BL0 A;  4YIF A;  2MGQ A;  4RM3 A;  1O3T A;  2OCC H;  4YII A;  3PUB A;  5J3L A;  4I98 B;  1EF4 A;  2EFP A;  2BV6 A;  5CKT A;  3V7S A;  4EJV A;  3KPH A;  3IAM 2;  3HOX J;  2F5D A;  2DOD A;  1IUF A;  2IGO A;  3C7J A;  3BZ6 A;  1NHA A;  1UMQ A;  4NC7 A;  1GLN A;  1X1A A;  2BVL A;  2B7E A;  4AID A;  2CUZ A;  2D2W A;  4RM2 A;  2YX4 A;  5FFX A;  3WGG A;  3E7L A;  1UJ8 A;  4NC6 A;  4LLL A;  3SZT A;  2FML A;  3ERE D;  2E1C A;  2ZBK A;  3PSF A;  1VQ6 I;  4JOM A;  5B5E C;  3QP6 A;  2QSG X;  5K1Y A;  3SFZ A;  2LD5 A;  3SZP A;  3ABK H;  2VBZ A;  1RKT A;  3RCO A;  4A2U A;  2R3S A;  4CZZ A;  2B0L A;  2VIX A;  5E3M A;  5GPA A;  3WTY C;  5EGO A;  3T5X A;  3JSP A;  3DBL B;  2K3P A;  4IHS A;  4PUS A;  3I4M J;  1R00 A;  1WZ2 A;  2KIM A;  3B6A A;  2KT0 A;  5CJ9 A;  2NXN B;  4XOR A;  4XOT A;  1TP4 A;  2DYR H;  3J7Y J;  1R5G A;  1CQT A;  1FIA A;  2ZCW A;  2Z5U A;  5KCM A;  5JI6 A;  3JRF A;  1O7L A;  3G2B A;  2QQ8 A;  3EDP A;  3QYE A;  4LIT A;  3H0D A;  2W4S A;  4F91 B;  1B8I A;  1BI0 A;  2DOA A;  5FRM A;  2KPM A;  4ZYH A;  2NVT J;  3FK6 A;  3A4C A;  3DTE A;  1ZKG A;  3OYJ A;  2CUF A;  2HYF A;  5FKK A;  3PIO F;  3IHU A;  5EEH A;  2QEN A;  1W7P B;  1QVU A;  2WA0 A;  2TRT A;  2XKO A;  4XKW A;  2V7F A;  4UV9 A;  1G3Y A;  2ZNY A;  1Z77 A;  4WXC A;  2W24 A;  1XGM A;  5D5U B;  3ULQ B;  3BY6 A;  2VQG A;  1ZGA A;  4BBR J;  2L02 A;  1TTY A;  5E8G A;  4CGZ A;  2EZL A;  4O6J A;  1SAN A;  3K4J A;  3DBH B;  5F64 A;  4M9X A;  5F1R A;  2ISY A;  3A0B C;  1D8J A;  4AC0 A;  1X3W B;  1X3Z B;  5DUI A;  4M74 A;  4FX0 A;  2E7W A;  2LRD A;  1A31 A;  5KK1 A;  1FBQ A;  1HLV A;  3RKQ A;  3LSJ A;  4AVZ A;  3GTM J;  2FQ3 A;  5LRR A;  1AA7 A;  3RKY A;  3TOA A;  2P8T A;  4XOP A;  3QPH A;  3H9J A;  2E2H J;  2R7W A;  3I54 A;  3HOU J;  2UXX A;  2F4I A;  1YS6 A;  1T6S A;  2KLO A;  4QIW N;  4ENK A;  5EZG A;  4D5C A;  5TIS C;  4CCN A;  3NAR A;  3HZJ A;  1BJZ A;  3BTI A;  2CQN A;  3KZZ A;  4EEF G;  5EG0 A;  1IGN A;  1WJE A;  1L0O C;  2CQX A;  5IT9 K;  1JI8 A;  2FQ4 A;  1Y6I A;  2O5R A;  4XIC A;  1ETX A;  3VYS B;  3FDY A;  3HOY J;  4PJ0 C;  3ZPL A;  3LSI A;  2M30 A;  2W25 A;  1W5C C;  2XAF A;  4CXF A;  2BHY A;  3LL7 A;  4TV7 A;  5LHG A;  2HYJ A;  4X1E A;  2Q2E B;  1ORK A;  4GRI A;  2VJ5 A;  2RQQ A;  2O7O A;  3MN2 A;  2XGD A;  3HXL A;  5J4V A;  4DYQ A;  3H3Z A;  2P7C B;  2OBP A;  2F5F A;  3LST A;  1G3S A;  2A6H F;  4KUM A;  4R79 A;  2QQA A;  3A03 A;  4RDU A;  4FET A;  4GYG A;  3ROU A;  1K78 B;  3C1D A;  2VE9 A;  3KYC B;  2JVG A;  5CVV A;  3I53 A;  4NUB A;  4I02 A;  5FLV A;  3GFI A;  2M7B A;  2DU9 A;  1TWF J;  2DFE A;  4P55 A;  1F43 A;  3H9G A;  2R0Q C;  3FWE A;  2EQR A;  2ETH A;  5J40 A;  2IS4 A;  1MND A;  3FBN B;  5E1X A;  2HU9 A;  5JR3 A;  4LB6 B;  3ZMV A;  1VQ9 I;  3BJO A;  5C4X J;  4X0G A;  3SHF A;  4R1H A;  3CCJ I;  2XV4 S;  1FBS A;  1HF0 A;  1TQM A;  2MD0 A;  4BJ6 C;  4B48 A;  4NNJ A;  3EQL F;  2R7U A;  4HNT A;  3ZQL A;  3O2P E;  5BS6 A;  1PJR A;  2K9Q A;  2X6W A;  3P9K A;  1JUM A;  2HZT A;  3L2U A;  3LA3 A;  1R1V A;  2VJJ A;  3A01 B;  1OKR A;  1MNE A;  3FMQ A;  4E7I A;  1HDD C;  3JW4 A;  5GAD J;  3B6C A;  3WGI A;  2P5K A;  2IPQ X;  5E8I A;  2PMZ A;  4C9Y A;  3BPX A;  1S9H A;  1ZR2 A;  1S5L C;  1FC3 A;  2PQ8 A;  2R7D A;  3FX3 A;  3GZN B;  4B09 A;  4CCJ A;  5B1A H;  1FYK A;  1ODD A;  1E3P A;  4I0A A;  5K7H A;  3HOV J;  5D8K B;  2HDC A;  2KKO A;  2LDU A;  4BJ5 C;  4EM0 B;  2VKD A;  4D9J A;  3GEZ A;  4A0Z A;  5CVJ A;  3I9V 2;  1NTC A;  2MYS A;  2LY1 A;  4XON A;  1D0Z A;  3K6G A;  4A3D J;  3HPG A;  2JPC A;  1G4D A;  3DKX A;  4PCQ A;  4ESF A;  1FT9 A;  3L2C A;  2V1U A;  3VOD A;  4HPQ A;  2J5O A;  2R92 J;  3GME A;  2M5W A;  2DMU A;  3LA7 A;  1QZY A;  1OFC X;  3K2A A;  2B9S A;  2L7Z A;  1TC3 C;  4FT8 A;  5HS7 A;  4ASN A;  4E4H A;  5LGN A;  1WI9 A;  4P5O A;  3W2V A;  3RZD J;  2D5V A;  2A69 F;  1YHQ I;  3GTG J;  2HZD A;  2E1O A;  3JSO A;  4RLF A;  1GV2 A;  2HOA A;  2OTL I;  1FIP A;  1YTY A;  3BR6 A;  4Q48 A;  4IVN A;  3BG9 A;  1ITY A;  1YRN B;  4UVA A;  3GVA A;  2HS5 A;  1ON1 A;  1R4M B;  4L0Y B;  3HKZ N;  1KU7 A;  1I1S A;  3ONQ A;  5DCM A;  2OQR A;  1VQM I;  2HWV A;  2I10 A;  4YFX F;  4I09 A;  2EIJ H;  2ME6 A;  3PJR A;  1IRG A;  1P4A A;  4YEJ A;  2GQQ A;  2XHK A;  4XMY A;  5LLQ A;  1LFP A;  2EFQ A;  2BGC A;  3QRF F;  1OYI A;  1JUP A;  1M1E B;  1W7P D;  2ADU A;  4LK1 F;  3IRQ A;  3QU3 A;  2LF8 A;  4IL6 C;  1LNW A;  2Y2Z A;  4KN7 X;  4ZDL A;  3C2H A;  4UUV A;  3QOD A;  3ZQF A;  4BE2 A;  1H8A C;  3H92 A;  3J7A O;  1VZ0 A;  3S14 J;  4IEJ A;  3K1N A;  5BQT A;  4MFD A;  3CUO A;  3MEX A;  4JQF A;  2OPT A;  2HVQ A;  2ZFU A;  9ANT A;  2A6T A;  2H8R A;  3BG3 A;  1ZGW A;  3LQQ A;  3FXL A;  4ZTF A;  3GTP J;  4NC8 A;  1ON2 A;  2XC7 A;  2PBI A;  3E6B A;  4CYD A;  1HDP A;  1MBF A;  4MEY F;  3LA2 A;  1F4K A;  2DLL A;  5BPD A;  2DA3 A;  3R4K A;  2DXI A;  2CG4 A;  1FOW A;  4I01 A;  4BDY A;  2HTS A;  2OCE A;  3H0G J;  4PSX A;  2ZSH B;  2QBY A;  2ZNZ A;  2VBY A;  3OYC A;  3OIO A;  4HX7 A;  4EJO A;  1R7J A;  3Q5F A;  2HOE A;  1MMA A;  2RC4 A;  3PIP F;  3SQN A;  4PK4 A;  3GLL A;  3KZI C;  2DFF A;  4KFC A;  1USS A;  1EH8 A;  5F08 A;  3S1N J;  5FKL A;  4Z6Y A;  5C4J J;  4CUG A;  1J5Y A;  3LNQ A;  2K3F A;  1WI3 A;  4C30 A;  4AWX B;  3AG1 H;  4FCY A;  4LOC A;  2D1V A;  1JT6 A;  2EBI A;  3CUQ C;  2P5L C;  3DEU A;  1PP8 F;  1K4T A;  1ZTR A;  4HW0 A;  4ZDP A;  2MSY A;  2V26 A;  1NG7 A;  4L5J A;  3IKV A;  3A01 A;  2ZXJ A;  2JMW A;  3DV8 A;  3VB2 A;  1WCM J;  1BR4 A;  1Z21 A;  3CCU I;  1MMD A;  1O3R A;  3Q3S A;  3W2W A;  1R49 A;  4A5N A;  1Z3Y A;  1KQ0 A;  4HQE A;  2E35 A;  5GTI C;  3E6M A;  3WTV C;  1T38 A;  3H35 A;  2JWT A;  3H3V K;  3S2D J;  1RUO A;  2MBF A;  3CCQ I;  4I76 A;  2TDX A;  2L01 A;  2HR3 A;  1ZRD A;  1R23 A;  4BXU A;  2STW A;  2Y48 A;  3T8T A;  1AOY A;  5IYD J;  3FXK A;  1U8B A;  3GFL A;  3IKT A;  2R7S A;  2K4B A;  1KYW A;  1MBE A;  1WRJ A;  2CW0 F;  4A3M J;  4BXX J;  2KRC A;  1U0J A;  3CUQ A;  2IAI A;  3M1C A;  1Z7U A;  2OC6 A;  4IF4 A;  5CQE A;  1DDN A;  4LLN A;  2HYG D;  2R7Q A;  2FF4 A;  4KIS A;  1K79 A;  4BY7 J;  3VEP A;  2FOW A;  3TED A;  3TW6 A;  1JGS A;  3V8J A;  4MEX F;  1IV8 A;  3CMM A;  3DTI A;  2NVX J;  1XGO A;  5L3E A;  4HA8 A;  2B63 J;  3V8K A;  3K70 D;  3I71 A;  1PUE E;  1GVD A;  5B3S H;  1J59 A;  2OUM A;  3ZQ7 A;  4KJZ A;  5M5X J;  1UEL B;  3VFZ A;  4MNU A;  4N0B A;  4E7K A;  4BE1 A;  3CO6 C;  1Z6R A;  2WAD A;  5HLT A;  4FAS D;  2GLO A;  1ETY A;  4HDV A;  4G9Y A;  3COA C;  1OJL A;  2O03 A;  1LDK B;  1TZL A;  2AXL A;  3BG5 A;  3I5U A;  5EEA A;  1B59 A;  1ZK8 A;  4U0V A;  4YG2 F;  2CQK A;  4U87 A;  2QEX I;  3OR1 C;  5ICF A;  4D0P A;  4KT6 A;  1IN8 A;  2DK8 A;  2WBM A;  1QHH D;  4J19 A;  3WG7 H;  3JTH A;  5CPR B;  2E1M B;  3LSM A;  3RTR A;  3TMO A;  3ZN0 A;  1G8X A;  2GXG A;  1E3O C;  1TWA J;  3H5A A;  5HDG A;  3NWS A;  2L0K A;  1T95 A;  3OR2 C;  1UZC A;  3G1O A;  4QSH A;  3WTS C;  1UHM A;  5JHU A;  2IA1 A;  2KIS A;  3CO7 C;  1O3S A;  2WY8 Q;  5IOY A;  2L5Q A;  3DWL E;  3AAF A;  4HOB A;  3BJA A;  4LG0 B;  2K7L A;  2ZFW A;  2IS1 A;  3QP5 A;  4ZYE A;  2RV8 A;  2R7O A;  4EJT A;  3S2H J;  2KMU A;  2NVY J;  2HVS A;  4Y17 A;  1FMV A;  1V3F A;  3GWZ A;  2H09 A;  1BIA A;  3FBI B;  4M71 A;  1LE8 A;  1FLI A;  3KP3 A;  3D5R C;  4CZC A;  1VQN I;  3HRT A;  3DPU A;  3BR1 A;  5DD4 A;  4XKC A;  5F0H A;  3LAJ A;  4XID A;  1VQ5 I;  2DDB A;  3SDB A;  4G7O F;  3DF8 A;  5FRO A;  3SFI A;  1IF1 A;  4AYB N;  3FKI J;  2MG4 A;  4JYK A;  4PZJ A;  4HV6 A;  3FHZ A;  5EGO B;  1CGP A;  2JTV A;  2ELK A;  1MKM A;  2V79 A;  3OL4 A;  1H89 C;  4KMU X;  3IWF A;  1GDT A;  3RPU D;  2MH2 A;  2HOT A;  1G3W A;  4ZYA A;  4XLF A;  4B44 A;  1HA8 A;  2EJR A;  4AM3 A;  3TO9 A;  2GXA A;  2R7F A;  1YFH A;  2PX9 A;  3CJQ B;  4ENJ A;  1XCB A;  1DU6 A;  3MKY B;  5D4S A;  2K40 A;  4DW6 A;  1GVJ A;  1MBH A;  1JJ8 C;  3HHH A;  1JHF A;  2YSR A;  1MW7 A;  2IJL A;  1KYZ A;  2EPF A;  4MLO A;  1WKM A;  5K5R A;  4BHP A;  4BY1 J;  4XRS A;  4LJZ F;  4UXN A;  1DUX C;  1MDM B;  1VND A;  2GZW A;  3K4K A;  1WJC A;  1HQC A;  3LWF A;  3B73 A;  3Q9S A;  1MH4 A;  2CV1 A;  1Z05 A;  2VOD A;  3LSH A;  4U7D A;  4F92 B;  1YE9 A;  3UKG A;  1I6X A;  2DDA A;  2W57 A;  3D1N I;  3ASO H;  3X2Q H;  3TDZ C;  2M87 A;  3I64 A;  4DJA A;  3G1L A;  2PMU A;  5CVI A;  2X51 A;  3FXQ A;  1GV5 A;  2QWW A;  3CQZ J;  1HKS A;  3RPU A;  2RKH A;  3KE2 A;  2KZG A;  5ILV A;  3HPH A;  1QPM A;  3BZC A;  5TJJ A;  2PFB A;  4DOZ A;  1XSV A;  3KP4 A;  4M6V A;  4YFK F;  2ZJQ F;  5GAE J;  4LFU A;  1WJB A;  2JN6 A;  1F36 A;  5IP7 J;  4G7H F;  1MMS A;  1T2K A;  1I3A A;  4HLX A;  3V4G A;  1P7J A;  3RKX A;  1REP C;  4XL9 A;  3F72 A;  1ZQ3 P;  1TWH J;  2K86 A;  1UB9 A;  2AHQ A;  2WTE A;  2H8W A;  5ERI A;  4BQA A;  4DNC A;  3V42 A;  5ED4 A;  1LVK A;  4BEH A;  2F5V A;  3FXU A;  1WFX A;  3V7C A;  2PJR A;  3OSG A;  3RI4 A;  3L1P A;  1EJ9 A;  4MTD A;  3PSI A;  3HOS A;  1SFO J;  2MAB A;  1TW3 A;  2BW3 B;  4BYY A;  3HC7 A;  3P9C A;  5GAG J;  2YR2 A;  3PNV A;  4A3C J;  1OIS A;  2XSJ C;  1P7I A;  2R7T A;  4EMS A;  1X4P A;  3I59 A;  2W48 A;  3R6S A;  5LGU A;  1SEU A;  4PGH A;  2MC4 A;  1OR7 C;  3BJ6 A;  3JR9 A;  1XDU A;  1BW6 A;  3UR3 C;  3M4O J;  3S1M J;  4OMY A;  2LC2 A;  1X4O A;  3CLO A;  3DPT A;  3VYU B;  2QBY B;  2VQL A;  3KIO A;  1SFE A;  4M9S A;  2BY2 A;  3EYY A;  1N75 A;  1TL8 A;  3VYT B;  2ELJ A;  3ZRG A;  1YQA A;  3DQV C;  1YW9 A;  5EEG A;  2XAG A;  1K6Y A;  4PSW A;  2UZK A;  2NOJ B;  1AWC A;  1I39 A;  1Y8R B;  2E5Z A;  5DDG A;  2DA6 A;  4DIQ A;  1JKP C;  1DPU A;  3IL2 A;  1BBY A;  3S15 J;  2XRL A;  4GO1 A;  3U21 A;  3VDX A;  2XGC A;  2Q2E A;  4L5E A;  2GXB A;  4J01 A;  1SD7 A;  5H6Q A;  4XRS G;  3EUH C;  2DW4 A;  4Q4Z F;  1LQ1 A;  4IRG A;  5HOO A;  1BA5 A;  1HST A;  2HDW A;  3ZXS A;  4PDK A;  2ICW G;  1SMY F;  1OR7 A;  4RS8 A;  2GWR A;  1XTA A;  1V4R A;  4RMN A;  2O61 A;  1QZZ A;  1QPI A;  4HF0 A;  2VPR A;  3DU6 A;  1P4W A;  3UNG C;  4QLC U;  2MLK A;  3GTQ J;  2LKX A;  2Z3Y A;  3ZGK A;  4A3K J;  1TT5 B;  3MKW B;  1FOY A;  1FMW A;  3FIS A;  3IH2 A;  2KDZ A;  2NNN A;  3S93 A;  4A69 C;  2QZ8 A;  3PFI A;  1PP7 U;  2LG4 A;  2ZJR F;  4IJA A;  1YRN A;  1MBK A;  3ML6 A;  1D5Y A;  4XLC A;  2W85 A;  2M34 A;  4YFN F;  1G2H A;  1BC7 C;  4UHT A;  2XIG A;  1IXC A;  1OCO H;  3O8H A;  1N25 A;  3EPZ A;  5TRD A;  4XSX F;  2JZY A;  2CUJ A;  4UVB A;  1SFX A;  2ESH A;  5F04 A;  3GTJ J;  1JT0 A;  3HRS A;  3GW2 A;  5CLS A;  1SD6 A;  4F55 A;  2UWM A;  5FD6 A;  1A6I A;  1W7P A;  2JK3 A;  4XLA A;  3AL0 B;  3E0J B;  3HBL A;  1HC8 A;  1X1C A;  4FTH A;  4XRM A;  1EKE A;  4HG2 A;  4ZZL A;  5DTD A;  2OZU A;  3LFK A;  3OIP A;  3J81 Z;  2YU3 A;  2XF6 A;  1FBU A;  1YI2 I;  2LY9 A;  2IGM A;  1VQ8 I;  1NK2 P;  5E3O A;  3CDH A;  4RA2 A;  3KYL A;  5FKM A;  1POG A;  3NEU A;  2JVH A;  2HEO A;  5ICG A;  4ITV A;  3FMR A;  4S04 A;  3H9Q A;  1ETW A;  2L7F P;  2FOK A;  1KU3 A;  1WPK A;  5D5W B;  3ABM H;  2AQF A;  2K27 A;  5GTH C;  1MNM C;  4OWR B;  2E5N A;  1VQP I;  1ETQ A;  4M3E A;  2WAF A;  1XX5 A;  3O8G A;  3GTK J;  2E7X A;  3ERM A;  2Z16 A;  1XGS A;  3CF2 A;  1SVO A;  3HSE A;  1T39 A;  4CCM A;  4GFB A;  3ZOB A;  4RB0 A;  1IN7 A;  3KLO A;  3NWT A;  5IT3 A;  3QYF A;  3IV5 A;  2MFZ A;  5FGM A;  5LBQ A;  4MTE A;  4PJM A;  3C2B A;  3KEO A;  1KZH A;  3CP8 A;  2P81 A;  3LOC A;  2G7H A;  3MKZ A;  1O7F A;  5FKO A;  3KYD B;  4W97 A;  2W84 A;  4MHG A;  3LFU A;  3QPS A;  3QOE A;  2VL8 A;  5DUK A;  3CP2 A;  2H6B A;  2RGV A;  2BEO A;  5L3G A;  4UB8 C;  5M5Y J;  2L4M A;  1FSH A;  2CS3 A;  2JA8 J;  2K9L A;  3GXO A;  2YPR A;  2P7V B;  2L2O A;  2R7X A;  3QYB A;  5KAF C;  3L2R A;  3AFH A;  4ENN A;  3O3K A;  1N78 A;  1B72 A;  1LDJ A;  3OYH A;  4I7H A;  1S72 I;  2BE5 F;  2MLG A;  2OAZ A;  2VQH A;  2CGP A;  2QSF X;  4Q5S F;  2EWN A;  5E20 A;  2JJ7 A;  1C0W A;  2W7N A;  1I3Q J;  5HS8 A;  4RB1 A;  1KA8 A;  1WH5 A;  4OU0 A;  5LHI A;  3TBI A;  1XGN A;  3BR2 A;  2A5Y B;  2GOM A;  5HVQ C;  2WB1 A;  1G6N A;  3OYF A;  4MIM A;  2JSC A;  4E7L A;  3S16 J;  4WK8 F;  2LOO A;  3S3N A;  3OYD A;  2ZME B;  4KN4 X;  2E71 A;  2RQP A;  1OYY A;  1ZGJ A;  1E2X A;  2DYS H;  2FXA A;  1YS7 A;  2R7R A;  4N9I A;  1BR1 A;  1WVR A;  4E7S A;  1Y1W J;  3DBR B;  4KIG A;  5AON A;  3R0J A;  3SDG A;  2DA7 A;  3BC8 A;  4BUP A;  4DQ2 A;  2ELH A;  1SAU A;  5DS9 A;  1D1C A;  2DO7 A;  4OAZ A;  2L4A A;  3ABU A;  3HIF A;  3LSR A;  3M3Y J;  2Z2S B;  4NHJ A;  2A6E F;  3I59 B;  3J7Z I;  4AIJ A;  3S17 J;  4RAY A;  5CVU A;  3L09 A;  1R22 A;  4A6D A;  3DCF A;  2NS7 A;  4B3A A;  1VQK I;  3BQY A;  5BOX A;  2K4J A;  2NVQ J;  4HEA 2;  1ETV A;  4ESJ A;  2BW3 A;  3BR5 A;  2LBF B;  3ZN1 A;  3IWZ A;  4ENM A;  4II3 A;  2CW7 A;  2BY1 A;  2GBY A;  2K5C A;  3F8B A;  1NK3 P;  5E1Z B;  4M3G A;  4BAY A;  4UUT A;  1XMA A;  3L2W A;  4RB2 C;  3OYI A;  3JRH A;  2IXS A;  1X19 A;  1ZHF A;  2M2E A;  2O9L A;  3QWL A;  4KIB A;  2X1D A;  3K70 C;  3BDD A;  2NS0 A;  2HDD A;  2E1M C;  4M6X A;  1BR2 A;  2WAQ A;  2FA5 A;  1N77 A;  2YX7 A;  2O0Y A;  2EB7 A;  1ZRC A;  4ON0 A;  1S8N A;  2IP2 A;  2Z99 A;  3KX2 A;  1IN4 A;  1D1B A;  1EH6 A;  5LHH A;  3KP5 A;  2WV1 A;  1RET A;  3JRA A;  5F27 A;  1ZAR A;  3SZG A;  3SJM A;  1A35 A;  5LD2 C;  1ERD A;  3JRG A;  4CHU A;  3CC4 I;  1U5T A;  3WHC A;  1XMK A;  4RAG A;  3K2Z A;  4IHT A;  4ZC3 A;  3TKY A;  3OYG A;  4IO9 F;  1BOB A;  3F8M A;  2CMP A;  4CYC A;  3CMA I;  1MJA A;  2DPD A;  4GYI A;  1D3Y A;  1R1U A;  3JRE A;  5GAH J;  2ECC A;  1RC9 A;  4LK0 F;  1KU2 A;  4XRF A;  2XAS A;  4I99 C;  1YW8 A;  4BEH B;  3PNY A;  2FNP A;  3K4N A;  4NBQ A;  4P9U A;  2X9D A;  3WHB A;  4XLH A;  4P9F A;  3TGN A;  4XSZ F;  2IGN A;  2YUS A;  1Z0X A;  2MD5 A;  3BOQ A;  4Y13 A;  3RQI A;  3WTU C;  4EV0 A;  4HQM A;  3MKL A;  3AG4 H;  3CC2 I;  2X1C A;  2E34 A;  3WE3 A;  2F5C A;  1W36 D;  2ZJP F;  3H5R A;  4PGG A;  1PUF B;  3GX4 X;  1Z91 A;  4G7Z F;  4OIP F;  1T33 A;  1DQU A;  2ECB A;  1GXQ A;  3HTS B;  1XC5 A;  2Y31 A;  3EUA A;  1H9G A;  1B72 B;  1VI0 A;  2FU4 A;  3DKY A;  4BL0 B;  1FJL A;  3E5U A;  3F9K A;  4MO7 A;  2GA2 A;  1S6L A;  4L5I A;  1QZE A;  4K2E A;  2W82 A;  2CUE A;  1X2N A;  1MDM A;  1AKH A;  1WJF A;  1Y1V J;  3D0S A;  4PJL A;  3DEE A;  2RNJ A;  4XNF A;  2H27 A;  1V5E A;  4RGU A;  2CH0 A;  1HCR A;  2KHM A;  3HRM A;  4E7H A;  2PLY A;  1DP3 A;  2XAQ A;  3L00 A;  2UV1 A;  1F1Z A;  2DJN A;  5F0C A;  2RVC A;  1B1B A;  2VKH A;  1I50 J;  1YW7 A;  1ACI A;  3DXJ F;  4N4N B;  1ZEL A;  4HAM A;  1STZ A;  3BQZ A;  5FRN A;  1MSF C;  4Y7N J;  4FQG A;  1ZN2 A;  3FZV A;  4KT5 C;  3F8F A;  3LSG A;  2XRO A;  3MZY A;  3I55 I;  4JBA A;  4CIC A;  2HGC A;  2DT6 A;  1XD7 A;  3HOT A;  1TWG J;  3VOE A;  3ZQQ A;  2Y9Y A;  2PI0 A;  3K1P A;  3K9T A;  1D0X A;  3G4S I;  1WHU A;  4XQF A;  2ISZ A;  4UY8 I;  4M3B A;  1RZ4 A;  2BXZ A;  4ZZD A;  2QVO A;  2CQQ A;  2DT7 B;  5AIP A;  3RSN A;  1FPQ A;  2EV0 A;  1HKT A;  3E6D A;  3GZ5 A;  5DD8 A;  1FX7 A;  1KQ9 A;  2L9S A;  2UUZ A;  5E3N A;  2JA6 J;  3HG9 A;  4ZYD A;  1W36 C;  1T56 A;  5FJ8 J;  3CD6 I;  2FX0 A;  5KVR A;  5J1Y A;  2OQG A;  4XK4 A;  4BAC A;  3BTL A;  1T8I A;  3FKJ A;  1U78 A;  2VUM J;  2EV5 A;  2VOP A;  4IQJ A;  2DA4 A;  1LKX A;  2AS5 F;  1J7K A;  2JRT A;  5F6F A;  3HSF A;  2LH9 A;  2KJC A;  2QYO A;  3EUH A;  3ZP5 A;  4IOC F;  4A93 J;  2ID6 A;  4KA4 A;  3HTU A;  1HBX G;  1Y0N A;  4L18 B;  1D8K A;  4A3F J;  1ZG3 A;  4IOA F;  2VKE A;  1UST A;  3TP3 A;  1FP2 A;  2FBK A;  1MZB A;  4HF1 A;  3LSK A;  4E7J A;  2JA2 A;  3IH3 A;  2EFO A;  3QU6 A;  4QTR A;  3HSR A;  2IVM A;  5F0F A;  4ZYG A;  5B66 C;  2HOS A;  2JQ7 A;  2EIK H;  3FXR A;  4KYW A;  1TQP A;  3RDI A;  1IN6 A;  4A3L J;  2JPB A;  3HYI A;  4ZJZ A;  4BKX A;  1Z67 A;  4DBQ A;  1WJD A;  1WWX A;  2IS2 A;  2DOE A;  3H1C A;  2LNB A;  1R9T J;  1QU3 A;  1AU7 A;  2VXZ A;  2VC0 A;  5AIQ A;  5K7Z A;  2F6C A;  1MH3 A;  2M0M A;  3OWT A;  3KFW X;  2CV0 A;  1CF7 A;  3BTC A;  1SFK A;  4IXA A;  2A3S A;  3BR3 A;  3RYP A;  3VSL A;  2EIN H;  4C3J J;  4D5F A;  1VTN C;  4F3Q A;  1I27 A;  1IUY A;  4EVI A;  3QQA A;  4P96 A;  5FLM J;  3D5S C;  2NYX A;  1OCC H;  2GAU A;  1YX5 A;  1R1T A;  4LGW A;  3ZCO A;  3F21 A;  5IYC J;  1IV6 A;  4BHB A;  4IRH A;  3A0H C;  1B6A A;  1ENH A;  2OU2 A;  3TDU C;  2FJ1 A;  2O8K A;  2K9S A;  4HST A;  5FFZ A;  5EF6 A;  2DAO A;  2XB5 A;  4XR6 A;  4HF2 A;  2DTR A;  2GIV A;  1BOA A;  3OYE A;  4CA0 A;  2CU7 A;  3VYR B;  1NG6 A;  3MCZ A;  4GCV A;  3HKZ A;  3ZQH A;  5IP9 J;  1JKO C;  4RLQ A;  3I4P A;  2L9V A;  2FE3 A;  3BCB A;  1UG0 A;  4LMY A;  4N4O B;  4KIT B;  2JA7 J;  2EA2 A;  2L9R A;  1K6O A;  2M4K A;  1E0E A;  2QSH X;  2KL4 A;  2KP6 A;  1FWZ A;  2RRE A;  3FHN A;  1TNT A;  2OTJ I;  4C3H J;  3CCL I;  4G6Q A;  2V1D A;  3E1S A;  1MIJ A;  4I6Z A;  1YIJ I;  2M8G X;  3S2W A;  2CFO A;  5ILU A;  1HOM A;  2DA1 A;  2EH3 A;  3TOB A;  2KRH A;  2HVR A;  3JRI A;  1V54 H;  3LSP A;  2ZXH A;  4AIH A;  1ZG1 A;  4UNO A;  4A0X A;  3TO6 A;  1SVL A;  2Y9Z A;  1R5I D;  2EZH A;  4M9Z A;  2LKS A;  1BC8 C;  3ASN H;  2FD5 A;  2V1N A;  4XLP F;  1B4A A;  3U2R A;  2PEX A;  4L9J A;  2LSO A;  4HX8 A;  3OYL A;  3HOZ J;  2RN7 A;  3N05 A;  3RPQ A;  2LRE A;  2X6X A;  4HNV A;  4DYC A;  4IX7 A;  3JAM Z;  2HKO A;  2R93 J;  2L7M P;  2F4M B;  3FXO A;  2ACJ A;  1BM9 A;  2H1K A;  2IT0 A;  1Y39 A;  4B47 A;  3WTT C;  4I0B A;  3WTX C;  5ICE A;  1TWC J;  4QWQ A;  4WWC A;  3H36 A;  4IHY A;  1E3H A;  2DJI A;  5J6X A;  5EDN A;  1KON A;  3O6B B;  2FUG 2;  1PVE A;  3ZR8 X;  3OS1 A;  1OCT C;  5DYM A;  1JE8 A;  1UAA A;  3CDI A;  2O8X A;  4H4K C;  3Q0U A;  1EA3 A;  2J5P A;  1U2W A;  2NVU B;  4J00 A;  2BYV E;  2D45 A;  3A2K A;  1RI7 A;  4FIS A;  1BI1 A;  3OSF A;  3PUF A;  2VC1 A;  2COB A;  4G8X A;  4F7Z A;  4E70 A;  2BY0 A;  2FBI A;  3FXM A;  2LF7 A;  2H6C A;  1U5T C;  4ZTJ A;  2WAQ N;  1YOV B;  6PAX A;  1SD5 A;  1UCR A;  3JAM K;  3MVP A;  1ONV A;  1MBG A;  2DA2 A;  3IUO A;  1XPX A;  2V6E A;  1LFU P;  3HOW J;  3L2V A;  5BPI A;  1WJ5 A;  2DMT A;  2XB0 X;  2IA0 A;  3TQN A;  2DFH A;  2HXI A;  2QKM B;  1EH7 A;  2NRA C;  2TCT A;  1OYW A;  2XF7 A;  5LGT A;  1IDY A;  1MJB A;  5L3F A;  3FMS A;  3S32 A;  5HOD A;  4EJW A;  3W6K B;  4F93 B;  3F0C A;  1OCR H;  1W4M A;  2CO5 A;  5IY5 H;  5FB2 A;  1V5F A;  2ZSI B;  2EZI A;  1HW1 A;  1YX3 A;  3RKW A;  2KJB A;  2UXN A;  4DZJ A;  1LFB A;  3RIR A;  2DN0 A;  3MQ0 A;  1SAX A;  4XLN F;  4M3F A;  4AU7 A;  1IRZ A;  1GUU A;  4UVC A;  3FM5 A;  1QRY A;  2M8E A;  5IOZ A;  2Y30 A;  2K02 A;  1H88 C;  4OIN F;  3F22 A;  1V55 H;  2H94 A;  1P6R A;  4FX4 A;  2V6C A;  2E60 A;  4D7N A;  2CW8 A;  1RNL A;  2LVS A;  2E36 A;  4PJJ A;  3S1Q J;  3CUQ B;  2AXT C;  3JRC A;  5D4R A;  1GHC A;  2CRG A;  3TP0 A;  1VQ4 I;  4BGD A;  2MA3 A;  5DM7 F;  3M7G A;  2HFH A;  2HPM A;  1LE8 B;  2KIQ A;  4XLE A;  2V9V A;  4M73 A;  5J4Y A;  3CCR I;  2DBB A;  2XF5 A;  4JX4 A;  4Y33 A;  3WG9 A;  2IGK A;  5EZH A;  2NS8 A;  2QF7 A;  3S3M A;  1U3E M;  1A36 A;  1J9I A;  1BN5 A;  4A6E A;  4CCK A;  2DMN A;  1HXD A;  4HX4 A;  2P6S A;  3CES A;  2XSD C;  1SD4 A;  1MJ9 A;  1JUS A;  3M8E A;  2F48 A;  3SYT A;  4HYE A;  1IC8 A;  1FY7 A;  4X6A J;  1IAW A;  3G71 I;  4GXO A;  3NRV A;  4KMF A;  2Q8K A;  2X0L A;  2M1B A;  3PO2 J;  3VSK A;  5BMZ A;  1SC7 A;  4OIQ F;  2Y0M A;  1WJA A;  2GA1 A;  3BLY A;  2W00 A;  2PJR B;  3K10 A;  4DGW B;  1ZRE A;  1FOX A;  5D6F A;  4JP0 A;  2R7V A;  2OJE D;  1YLF A;  5FKN A;  5HDN A;  1JTY A;  2A5W A;  5EG0 B;  4M72 A;  2M9H A;  2VAS A;  3M07 A;  1FYL A;  4H0E A;  1O3Q A;  2FMY A;  1DU0 A;  4NQW A;  4L0Z B;  3CCV I;  2IBD A;  3OV8 A;  4BQQ A;  2G7U A;  3WTW C;  3BRO A;  1BJA A;  1KGS A;  1MBJ A;  4B43 A;  2ZXW H;  5J8C A;  2V1X A;  1LEA A;  4A0Y A;  2IS6 A;  5JLW A;  1Z3X A;  4EGZ A;  2BBY A;  2LMD A;  1B9N A;  2XRN A;  1K78 A;  2VLA A;  4A12 A;  2F4O B;  4UUS B;  4AUX A;  2IW5 A;  3ZMU A;  5LEK A;  1FSE A;  1O57 A;  4XBF A;  3CJN A;  5IP6 A;  3J81 K;  2VQC A;  4HDU A;  4EJU A;  1RR8 C;  5D6E A;  1P2F A;  2BVM A;  5JHF A;  3I4N J;  3ZMD A;  2Q1Z B;  3OYN A;  1BI3 A;  4FE4 A;  1Y56 A;  4UUS A;  4Y52 J;  1DP7 P;  1JXS A;  1I5Z A;  3BZK A;  4CCO A;  2OV7 A;  2VT3 A;  3MAJ A;  4L9N A;  1R36 A;  2QCO A;  5DCF A;  2OZ6 A;  3FXJ A;  2PMH A;  3HB9 A;  3Q9V A;  2XVC A;  1JKR C;  3JCU C;  1LJ9 A;  2BY3 A;  3G6E I;  1SVM A;  1YJW I;  2P4W A;  3SEZ A;  2PN6 A;  3FF5 A;  4CO8 A;  2WB1 N;  3L9F A;  3W2A A;  1D5V A;  2Q0O A;  3HDD A;  4G6T B;  2H1L A;  3AG3 H;  2IRF G;  4M6Y A;  5HLH A;  3SEQ A;  1Z6T A;  4F52 A;  2ZC2 A;  3KCC A;  1PYV A;  2DI3 A;  2Y0S N;  2R5Z A;  2LKP A;  2O6G E;  4AD9 A;  4A3J J;  4KIF A;  2LR8 A;  1H0M A;  1YO5 C;  1WQ2 A;  2DT5 A;  2DA5 A;  4CCL A;  4A3I J;  4YEL A;  1VQ7 I;  1Z7L A;  2V9P A;  2VBX A;  3H5N A;  3ELK A;  2P6T A;  4LG3 A;  2M7A A;  3V7R A;  4ZH4 F;  2E2I J;  5D8L B;  4CYC B;  4EM2 A;  3OYA A;  4XKV A;  2N8G A;  3L7W A;  2ZB9 A;  4IHV A;  2CJJ A;  3GBG A;  2KIU A;  2CV2 A;  3J80 K;  5TGT A;  4EQQ A;  3BG6 A;  2JUG A;  2GIZ A;  3P7N A;  1DGW Y;  5L3C A;  3CMY A;  1ZLK A;  1QBJ A;  1EV7 A;  3GO5 A;  3WTZ A;  1T98 A;  1TNS A;  1RKW A;  3WU2 C;  1IJW C;  1TQI A;  2E2J J;  5GPC A;  1Q1H A;  3BCA A;  4V19 K;  3K4M A;  1ZH5 A;  3U1D A;  1DPR A;  3K69 A;  3OIQ A;  5ICC A;  2CFX A;  4MQ9 F;  4BBS J;  4HSR A;  3GF2 A;  2FEZ A;  3T8R A;  3F8C A;  4R8H A;  4ZDO A;  4LLG F;  4PJN A;  3ZQG A;  5J8F A;  1FTT A;  2Y0S A;  4S0H B;  1XMX A;  4AVP A;  1R4N B;  4Q47 A;  5HLG A;  4U0Y A;  1ULY A;  3E5X A;  1F5T A;  1TBX A;  1X1B A;  3GZ6 A;  1JGG A;  3Q0V A;  3ESW B;  2ESN A;  3K4L A;  3K7A J;  2HQ5 A;  3DEW A;  2X48 A;  2NAZ A;  2CSO A;  1WH7 A;  1ETO A;  2A07 F;  2QKL B;  1XSX A;  4BDZ A;  2JSP A;  2HTJ A;  3F23 A;  5HS9 A;  1QGP A;  3E5Q A;  4WCG A;  2X4H A;  3CCY A;  3MMY B;  2M3A A;  5L3B A;  3PO3 J;  2L54 A;  4V2G A;  4WX9 A;  5D5V B;  2DFI A;  1R5H A;  1SMT A;  1BW5 A;  2IEK A;  1UHS A;  4Y15 A;  3DTK A;  3FIW A;  2HNH A;  4DYR A;  1UFM A;  2JRM A;  2XPV A;  3TW7 A;  1OCP A;  1S3J A;  4IHX A;  3R0A A;  1AKH B;  2DK5 A;  3J80 Z;  4D1Q A;  1L3L A;  2KRF A;  2ZME A;  2EZK A;  1LEB A;  3OYK A;  2VT2 A;  1XS9 A;  3PQK A;  3OS0 A;  3TL4 X;  1XDS A;  3LMM A;  5BNG A;  2LP0 A;  2X85 A;  1P9Q C;  1MMG A;  3QOP A;  3GUD A;  2VKV A;  4M3D A;  2WY7 Q;  5K5O A;  2VE8 A;  2EIL H;  2DMP A;  4IPA A;  2OA4 A;  1P4X A;  3BWG A;  5E3L A;  4LIV A;  3IH4 A;  2XPU A;  3M8J A;  2MH9 A;  3HGY A;  4LD5 A;  1ZRF A;  1QVT A;  3GFJ A;  4O5V A;  4O3M A;  1W5T A;  3CCS I;  3GLX A;  1PDN C;  3HHG A;  3PM1 A;  1IW7 F;  1H9T A;  4NQW B;  4XN3 A;  2I8D A;  4RGS A;  3JTG A;  1S7E A;  1X58 A;  3IC7 A;  3RZO J;  4XN0 A;  4NB5 A;  5JVG F;  3DP7 A;  3M9A A;  3OY9 A;  4OAY A;  2DQR A;  4MGR A;  4UB6 C;  5IPA A;  1Z9C A;  4OMZ A;  1R6R A;  4RBO A;  2AO9 A;  1AHD P;  3U1K A;  1TLH B;  1OCZ H;  4U0W A;  4RGX A;  2WAE A;  1YG2 A;  4RAF A;  2XAU A;  3HUG B;  3ZQI A;  5GP9 A;  3MWM A;  3PFY A;  5E79 C;  3K0L A;  2XGE A;  1OMI A;  4EGY A;  2RDP A;  2R4G A;  1SFU A;  4IKF A;  2L9N A;  1XCV A;  4FE7 A;  5KNL A;  4BU2 A;  3KZY A;  2RAE A;  1HSJ A;  4B3X A;  2QUF A;  1LVA A;  2CQ7 A;  5E18 F;  4BQO A;  3HEF A;  4C2M J;  2OF7 A;  2JT1 A;  2XPW A;  2ZO4 A;  4Y3O A;  4G12 A;  2LTP A;  1A04 A;  3DKW A;  3ZMT A;  2XKP A;  4BHC A;  3RYR A;  1ZR4 A;  1JKQ C;  2C6Y A;  2R7Z J;  5B1B H;  3WU0 A;  1G3T A;  4HLY A;  1HW2 A;  5IT9 Z;  3HUG A;  4OIR F;  1APL C;  3CME I;  2O3F A;  3C2G A;  2ID3 A;  2R5Y B;  4W1U A;  1X2M A;  1J0R A;  1FTZ A;  1O4X A;  3S1R J;  1MMN A;  1V5G A;  2KZV A;  4D7M A;  2KFD A;  2V9K A;  5C44 J;  5IYB J;  1K4S A;  3IP4 B;  4ESB A;  3DFG A;  3N4M A;  2GOX B;  2P0W A;  5M3F J;  5M5W J;  3K1M A;  4AYB A;  3BT9 A;  3B02 A;  3KP7 A;  3CC7 I;  2G0E A;  3NAU A;  3FM3 A;  1HW5 A;  2A68 F;  5DM6 F;  3CCM I;  3DLL F;  2BHZ A;  4B1R A;  3ZMS A;  1F9N A;  4B8X A;  4PFP A;  3TO7 A;  2L3D A;  3OOU A;  2HQA A;  5JVT A;  5JLX A;  4XKB A;  1S7O A;  3I58 A;  2LFB A;  1YYV A;  3I0T A;  5FO5 A;  3AG2 H;  3CLQ A;  1IN5 A;  3EUK L;  4BNC A;  1WGX A;  2ZXI A;  5C3E J;  3OYB A;  3F8N A;  1U6G A;  4FHT A;  3E97 A;  4B4C A;  1LUJ B;  4BS9 A;  1BI2 A;  2XDV A;  1WSU A;  1LDD A;  4ETS A;  3ZQC A;  2VOO A;  2HKX A;  2CYY A;  2DMQ A;  5HLI A;  2WC2 A;  4Z2Y A;  3PL8 A;  1HKQ A;  4UV8 A;  1IRF A;  3EYI A;  3K4C A;  3REO A;  5A2Q K;  2NNY A;  3VWB A;  4IHW A;  2PJP A;  4IZZ A;  5EYR A;  1D0Y A;  2STT A;  3GYH X;  1JJ6 C;  4QPO A;  2Z1D A;  2KDO A;  1G59 A;  1OQY A;  2KQR A;  3E6C C;  2HQN A;  2VI6 A;  3CJT B;  3HRU A;  4HV5 A;  4V2F A;  5J1U A;  5CVR A;  2QA4 I;  3F6V A;  1U9N A;  3CJR B;  1RRJ A;  2VBW A;  2XAJ A;  3DPL C;  2ZJ2 A;  2COM A;  5J1R A;  3M8F A;  1TW2 A;  2MW8 A;  3BP8 A;  3I3L A;  1Q1V A;  3KEQ A;  4JK1 X;  1FOK A;  2LK2 A;  4G6D A;  2W1O A;  3H3U A;  3I56 I;  1QHG A;  3BTJ A;  2YU9 J;  1P92 A;  4BQN A;  2PG4 A;  3WE2 A;  3M1E A;  3QAH A;  3BPV A;  4NDL A;  3W3C A;  1T08 B;  3RJP A;  5H6R A;  1S7A A;  4ANJ A;  3AKZ A;  3KP2 A;  2X6O A;  2FNA A;  1VF9 A;  4XM3 A;  2R5Y A;  1RIO H;  3ABL H;  4HBL A;  1K7A A;  2VJ4 A;  4MQV A;  5M3M J;  5DV5 A;  3VPR A;  1U8R A;  2EA4 A;  1I1G A;  2LBF A;  1UHW A;  4GDF A;  4YRV A;  2K9N A;  5CYV A;  3GTO J;  2K85 A;  1B9M A;  4U7B A;  2NOG A;  1U5T B;  2DCE A;  2EFN A;  1X1P A;  1Y8Q B;  4LIU A;  4OOI A;  5JFR A;  4A3B J;  2LY2 A;  4RB3 C;  1I6H J;  3C18 A;  4GGG A;  2X1E A;  4BXF A;  5K5Q A;  1LPQ A;  3LAP A;  5FLX K;  5HNF A;  4N9H A;  2P5V A;  3CDL A;  2V4J C;  4BJT A;  2AQE A;  3A02 A;  1NH3 A;  4A3G J;  4HNU A;  4EAT A;  5A2Q Z;  2FRH A;  4IQ4 A;  2I5U A;  5FLX Z;  3A1Y A;  2A61 A;  1ZG5 A;  4C2U A;  4ABZ A;  4Y4R A;  2BOL A;  3OS2 A;  1T0F A;  2M45 A;  3OYM A;  2DPU A;  3P5J A;  3T1B A;  4WXD A;  4IRI A;  1KQ8 A;  3E3V A;  2EIM H;  2HXO A;  4A3E J;  3MFK A;  1A5J A;  1J2X A;  3ISP A;  1FEX A;  4KDP A;  3QPT A;  1KU9 A;  1ZLJ A;  4U88 A;  3MZ8 A;  3KET A;  5LEJ A;  1IDZ A;  4BE0 A;  5KAI C;  2GM4 A;  2A05 A;  3HJE A;  3S8P A;  3PQJ A;  1MGT A;  1R71 A;  1X3U A;  3IAS 2;  3P9I A;  2E1N A;  2QLZ A;  2VON A;  2RNG A;  1FP1 D;  1W1W E;  2VB6 A;  1GXP A;  1QA6 A;  5L3D A;  1IXS B;  1JHH A;  2L7K A;  2VXD A;  4DZP A;  5CQG A;  3EET A;  1TT0 A;  2K9M A;  2HPI A;  5E17 F;  1IG7 A;  1XG1 A;  1CF7 B;  2VPL A;  2EK5 A;  4S05 A;  5HDK A;  4CSW A;  3L2Q A;  4P1W A;  2FBH A;  2DTZ A;  1IRX A;  3NQO A;  2IA2 A;  2QQB A;  4C3I J;  4II2 A;  3W6J B;  3CF5 F;  1RUN A;  2WWY A;  4KIC A;  4WF2 A;  4OIO F;  1W0U A;  1ZAO A;  5K7F A;  4BH9 A;  2LYC A;  2LLK A;  5H20 A;  3WOD F;  3RQ4 A;  1K61 A;  3W6V A;  3ECO A;  3BG7 A;  3T0Y A;  5J47 A;  1BIB A;  1K83 J;  1YJ9 I;  4JX5 A;  1J75 A;  2KIF A;  2HQR A;  3K4B A;  4RGR A;  1FYM A;  3MZH A;  1GT0 C;  3AL0 C;  2M0C A;  2XAH A;  5KHD A;  3GFM A;  2E19 A;  4RAZ A;  4G94 A; 
#chains in the Genus database with same CATH homology
 2Z33 A;  1S29 A;  2DQL A;  3D5L A;  1ZYR F;  5ILS A;  2D1H A;  3R61 A;  2F2E A;  1R58 A;  3IRR A;  2MC3 A;  2EFW A;  5FD5 A;  1XN7 A;  1Z1D A;  2OD5 A;  5D5X B;  2CWE A;  3N97 A;  3F6O A;  4WXH A;  3G73 A;  3ZMZ A;  3ECH A;  2Y75 A;  2Z9O A;  1Y0U A;  2FSW A;  2XGX A;  5DEQ A;  4LG0 A;  1QO0 D;  1E17 A;  1QNT A;  3WU1 B;  1W5S A;  4I2O A;  1LB2 A;  3CTA A;  4L9T A;  2QM3 A;  3KP6 A;  3WGH A;  1IZ1 A;  1FNN A;  3U9G A;  2VN2 A;  3LQR A;  1QQI A;  4HZF A;  1XSD A;  3G3Z A;  5LRS A;  4AIK A;  3KLN A;  1IXR C;  3ABT A;  1YIO A;  4CDG A;  1FZP B;  2G9W A;  3SXY A;  3R60 A;  2WV0 A;  4LB5 A;  2F5E A;  3F3X A;  2XUB A;  3OOP A;  1OPC A;  5DCM B;  4L9V A;  4A5M A;  4EM1 A;  1XB4 A;  5E1W A;  2QQ9 A;  4KNY A;  3V8L A;  1MD0 A;  2ZKZ A;  3C3W A;  2EV6 A;  4YIF A;  1O3T A;  4YII A;  4I98 B;  2EFP A;  2BV6 A;  3V7S A;  4EJV A;  2F5D A;  3C7J A;  3BZ6 A;  1NHA A;  2D2W A;  2YX4 A;  5FFX A;  3WGG A;  3SZT A;  2E1C A;  4LLL A;  2FML A;  3ERE D;  2ZBK A;  3QP6 A;  5K1Y A;  3SFZ A;  3SZP A;  2VBZ A;  4A2U A;  2R3S A;  4CZZ A;  2B0L A;  3WTY C;  3T5X A;  3JSP A;  4IHS A;  1R00 A;  2KIM A;  5CJ9 A;  1R5G A;  2Z5U A;  2ZCW A;  5JI6 A;  1O7L A;  3EDP A;  1BI0 A;  4ZYH A;  2HYF A;  3IHU A;  5EEH A;  2QEN A;  1W7P B;  2XKO A;  4UV9 A;  1G3Y A;  2ZNY A;  4WXC A;  2W24 A;  1XGM A;  5D5U B;  3ULQ B;  3BY6 A;  1ZGA A;  2L02 A;  1TTY A;  5E8G A;  4CGZ A;  4O6J A;  5F64 A;  4M9X A;  5F1R A;  2ISY A;  1D8J A;  5DUI A;  4M74 A;  4FX0 A;  2E7W A;  5KK1 A;  1FBQ A;  2FQ3 A;  5LRR A;  3RKY A;  3TOA A;  2P8T A;  3QPH A;  3I54 A;  2UXX A;  1YS6 A;  1T6S A;  4ENK A;  3KZZ A;  1L0O C;  5IT9 K;  2M30 A;  2W25 A;  2XAF A;  4CXF A;  4TV7 A;  5LHG A;  3H3Z A;  2P7C B;  2OBP A;  2F5F A;  3LST A;  1G3S A;  2A6H F;  4KUM A;  4R79 A;  2QQA A;  4GYG A;  3ROU A;  1K78 B;  3C1D A;  2VE9 A;  5CVV A;  3I53 A;  4I02 A;  3GFI A;  2DU9 A;  4P55 A;  3FWE A;  2ETH A;  5E1X A;  5JR3 A;  4LB6 B;  3ZMV A;  3BJO A;  3SHF A;  4R1H A;  2XV4 S;  1FBS A;  1TQM A;  3EQL F;  3O2P E;  5BS6 A;  3P9K A;  2HZT A;  3LA3 A;  1R1V A;  1OKR A;  3FMQ A;  3JW4 A;  3WGI A;  2P5K A;  2IPQ X;  5E8I A;  3BPX A;  2R7D A;  1FC3 A;  2PQ8 A;  3FX3 A;  4B09 A;  1FYK A;  1ODD A;  4I0A A;  5D8K B;  2HDC A;  2KKO A;  2LDU A;  4EM0 B;  3GEZ A;  4A0Z A;  5CVJ A;  2JPC A;  1G4D A;  4PCQ A;  4ESF A;  1FT9 A;  3L2C A;  2V1U A;  3VOD A;  2J5O A;  2M5W A;  3LA7 A;  1QZY A;  4FT8 A;  5HS7 A;  4ASN A;  5LGN A;  1WI9 A;  4P5O A;  2A69 F;  3JSO A;  1YTY A;  4Q48 A;  4IVN A;  4UVA A;  3GVA A;  2HS5 A;  1ON1 A;  4L0Y B;  1KU7 A;  1I1S A;  5DCM A;  2OQR A;  2HWV A;  4YFX F;  4I09 A;  1IRG A;  1P4A A;  2GQQ A;  2XHK A;  5LLQ A;  2EFQ A;  2BGC A;  3QRF F;  1OYI A;  1W7P D;  2ADU A;  3IRQ A;  4LK1 F;  3QU3 A;  2LF8 A;  1LNW A;  4KN7 X;  4UUV A;  3J7A O;  3H92 A;  3K1N A;  5BQT A;  3CUO A;  3MEX A;  4JQF A;  3LQQ A;  1ON2 A;  2PBI A;  3E6B A;  4CYD A;  4MEY F;  3LA2 A;  1F4K A;  2DLL A;  5BPD A;  3R4K A;  2CG4 A;  4I01 A;  2HTS A;  2QBY A;  2ZNZ A;  2VBY A;  4HX7 A;  4EJO A;  1R7J A;  3Q5F A;  2HOE A;  2RC4 A;  3SQN A;  4KFC A;  1USS A;  1EH8 A;  1J5Y A;  4AWX B;  2D1V A;  3CUQ C;  2P5L C;  3DEU A;  1PP8 F;  4HW0 A;  4L5J A;  3IKV A;  2ZXJ A;  3DV8 A;  3VB2 A;  1O3R A;  4A5N A;  1KQ0 A;  4HQE A;  3E6M A;  3WTV C;  1T38 A;  1RUO A;  2MBF A;  2TDX A;  2L01 A;  2HR3 A;  1ZRD A;  1R23 A;  4BXU A;  2STW A;  3T8T A;  2Y48 A;  1AOY A;  3GFL A;  3IKT A;  2K4B A;  1KYW A;  1WRJ A;  2CW0 F;  3CUQ A;  1Z7U A;  1DDN A;  4IF4 A;  4LLN A;  2HYG D;  2FF4 A;  1K79 A;  3VEP A;  1JGS A;  3V8J A;  4MEX F;  1XGO A;  5L3E A;  4HA8 A;  3V8K A;  3I71 A;  1PUE E;  1J59 A;  3ZQ7 A;  3VFZ A;  4MNU A;  4N0B A;  3CO6 C;  1Z6R A;  4HDV A;  4G9Y A;  3COA C;  2O03 A;  1LDK B;  2AXL A;  3I5U A;  1B59 A;  4U0V A;  4YG2 F;  2CQK A;  5ICF A;  4D0P A;  1IN8 A;  2DK8 A;  3JTH A;  3RTR A;  3ZN0 A;  2GXG A;  5HDG A;  3WTS C;  1UHM A;  5JHU A;  2IA1 A;  3CO7 C;  1O3S A;  3AAF A;  4HOB A;  3BJA A;  4LG0 B;  2K7L A;  2ZFW A;  3QP5 A;  4ZYE A;  2RV8 A;  4EJT A;  4Y17 A;  1V3F A;  3GWZ A;  2H09 A;  1BIA A;  4M71 A;  1FLI A;  3KP3 A;  3HRT A;  5DD4 A;  3LAJ A;  4G7O F;  3DF8 A;  1IF1 A;  4PZJ A;  4HV6 A;  3FHZ A;  1CGP A;  2JTV A;  1MKM A;  2V79 A;  4KMU X;  3IWF A;  2MH2 A;  1G3W A;  2EJR A;  3TO9 A;  2R7F A;  1YFH A;  4ENJ A;  1XCB A;  5D4S A;  1GVJ A;  3HHH A;  1JHF A;  2YSR A;  2IJL A;  1KYZ A;  1WKM A;  5K5R A;  4BHP A;  4LJZ F;  4UXN A;  1DUX C;  1MDM B;  2GZW A;  1HQC A;  3LWF A;  3B73 A;  3Q9S A;  1Z05 A;  2VOD A;  4U7D A;  1I6X A;  2W57 A;  3TDZ C;  2M87 A;  3I64 A;  2PMU A;  5CVI A;  3FXQ A;  2QWW A;  1HKS A;  3RPU A;  2RKH A;  3KE2 A;  5ILV A;  1QPM A;  5TJJ A;  2PFB A;  1XSV A;  3KP4 A;  4YFK F;  4LFU A;  4G7H F;  1T2K A;  4HLX A;  3V4G A;  3RKX A;  1REP C;  3F72 A;  2K86 A;  1UB9 A;  2WTE A;  4BQA A;  5ERI A;  4DNC A;  5ED4 A;  3FXU A;  3V7C A;  3RI4 A;  4MTD A;  3HOS A;  1TW3 A;  4BYY A;  3P9C A;  2YR2 A;  4EMS A;  3I59 A;  3R6S A;  5LGU A;  4PGH A;  3BJ6 A;  1XDU A;  4OMY A;  3CLO A;  3DPT A;  2QBY B;  1SFE A;  4M9S A;  3EYY A;  1YQA A;  3DQV C;  1YW9 A;  5EEG A;  2XAG A;  2UZK A;  1AWC A;  5DDG A;  1DPU A;  3IL2 A;  1BBY A;  4GO1 A;  2Q2E A;  2GXB A;  1SD7 A;  5H6Q A;  4Q4Z F;  2DW4 A;  1LQ1 A;  4IRG A;  5HOO A;  1HST A;  4PDK A;  1SMY F;  1OR7 A;  4RS8 A;  2GWR A;  1V4R A;  2O61 A;  1QZZ A;  4HF0 A;  1P4W A;  4QLC U;  2MLK A;  2Z3Y A;  2NNN A;  2QZ8 A;  3PFI A;  1PP7 U;  4IJA A;  3ML6 A;  2W85 A;  4YFN F;  1BC7 C;  4UHT A;  2XIG A;  1IXC A;  5TRD A;  4XSX F;  2JZY A;  4UVB A;  1SFX A;  2ESH A;  3HRS A;  3GW2 A;  5CLS A;  1SD6 A;  2UWM A;  5FD6 A;  1W7P A;  4ZZL A;  2OZU A;  3LFK A;  3J81 Z;  2YU3 A;  1FBU A;  3CDH A;  3NEU A;  2HEO A;  5ICG A;  3FMR A;  4S04 A;  2FOK A;  1KU3 A;  5D5W B;  2K27 A;  2E7X A;  1XGS A;  3HSE A;  1T39 A;  4RB0 A;  1IN7 A;  3KLO A;  5IT3 A;  5FGM A;  5LBQ A;  4MTE A;  3KEO A;  2G7H A;  1O7F A;  2W84 A;  4MHG A;  5DUK A;  2H6B A;  2RGV A;  2BEO A;  5L3G A;  2L4M A;  1FSH A;  3GXO A;  2YPR A;  2P7V B;  4ENN A;  3O3K A;  1LDJ A;  4I7H A;  2BE5 F;  2MLG A;  2OAZ A;  2CGP A;  4Q5S F;  2EWN A;  5E20 A;  1C0W A;  4RB1 A;  5HS8 A;  1KA8 A;  4OU0 A;  5LHI A;  1XGN A;  2A5Y B;  5HVQ C;  1G6N A;  2JSC A;  4WK8 F;  2ZME B;  4KN4 X;  2RQP A;  1OYY A;  1ZGJ A;  1E2X A;  2FXA A;  1YS7 A;  4N9I A;  4KIG A;  5AON A;  3R0J A;  4DQ2 A;  2ELH A;  2DO7 A;  2L4A A;  3ABU A;  3HIF A;  4NHJ A;  2A6E F;  3I59 B;  4AIJ A;  4RAY A;  5CVU A;  3L09 A;  1R22 A;  4A6D A;  5BOX A;  2K4J A;  4ESJ A;  3ZN1 A;  3IWZ A;  4ENM A;  3F8B A;  5E1Z B;  4BAY A;  1XMA A;  4RB2 C;  1ZHF A;  4KIB A;  3BDD A;  2NS0 A;  4M6X A;  2FA5 A;  2YX7 A;  2O0Y A;  2EB7 A;  1ZRC A;  4ON0 A;  1S8N A;  2IP2 A;  2Z99 A;  5LHH A;  1IN4 A;  1EH6 A;  3ZPL A;  3KP5 A;  1ZAR A;  4CHU A;  1U5T A;  1XMK A;  3K2Z A;  4IHT A;  3TKY A;  3F8M A;  1MJA A;  2DPD A;  4GYI A;  1D3Y A;  1R1U A;  4LK0 F;  1KU2 A;  4XRF A;  2XAS A;  1YW8 A;  2FNP A;  4P9U A;  4P9F A;  3TGN A;  4XSZ F;  2MD5 A;  3BOQ A;  4Y13 A;  3WTU C;  4EV0 A;  4HQM A;  3WE3 A;  2F5C A;  4PGG A;  4OIP F;  3GX4 X;  1Z91 A;  4G7Z F;  1GXQ A;  3HTS B;  1H9G A;  2FU4 A;  3E5U A;  2GA2 A;  1S6L A;  4L5I A;  4K2E A;  1MDM A;  3D0S A;  2RNJ A;  2H27 A;  4RGU A;  3HRM A;  2PLY A;  2XAQ A;  3L00 A;  1F1Z A;  2RVC A;  1B1B A;  1YW7 A;  3DXJ F;  4HAM A;  1STZ A;  1ZN2 A;  3FZV A;  4KT5 C;  3F8F A;  2XRO A;  3MZY A;  4JBA A;  4CIC A;  2HGC A;  1XD7 A;  3HOT A;  3VOE A;  2PI0 A;  3K1P A;  3K9T A;  2ISZ A;  1RZ4 A;  4ZZD A;  2QVO A;  5AIP A;  1FPQ A;  2EV0 A;  1HKT A;  3E6D A;  3GZ5 A;  5DD8 A;  1FX7 A;  1KQ9 A;  4ZYD A;  5KVR A;  2OQG A;  1U78 A;  2EV5 A;  2VOP A;  2AS5 F;  1J7K A;  2JRT A;  5F6F A;  3HSF A;  2KJC A;  2QYO A;  3EUH A;  3ZP5 A;  4KA4 A;  3HTU A;  1HBX G;  4L18 B;  1D8K A;  1ZG3 A;  1UST A;  1FP2 A;  2FBK A;  1MZB A;  4HF1 A;  3QU6 A;  2EFO A;  3HSR A;  2IVM A;  4ZYG A;  3FXR A;  4KYW A;  1TQP A;  3RDI A;  1IN6 A;  2JPB A;  3HYI A;  1WWX A;  2LNB A;  2VXZ A;  2VC0 A;  5AIQ A;  3KFW X;  1CF7 A;  4IXA A;  2A3S A;  3RYP A;  1VTN C;  1I27 A;  1IUY A;  4EVI A;  4P96 A;  2NYX A;  2GAU A;  1R1T A;  4LGW A;  3F21 A;  4BHB A;  4IRH A;  1B6A A;  2OU2 A;  3TDU C;  5FFZ A;  2DAO A;  4HF2 A;  2DTR A;  2GIV A;  1BOA A;  3MCZ A;  4GCV A;  3I4P A;  2FE3 A;  4LMY A;  2EA2 A;  1K6O A;  1FWZ A;  1TNT A;  4G6Q A;  2V1D A;  3S2W A;  5ILU A;  3TOB A;  4AIH A;  1ZG1 A;  4UNO A;  4A0X A;  3TO6 A;  4M9Z A;  1BC8 C;  4XLP F;  1B4A A;  3U2R A;  2PEX A;  4L9J A;  2LSO A;  4HX8 A;  2RN7 A;  3RPQ A;  3JAM Z;  2HKO A;  2ACJ A;  1BM9 A;  2IT0 A;  3WTT C;  4I0B A;  3WTX C;  5ICE A;  4QWQ A;  4WWC A;  5J6X A;  3O6B B;  5DYM A;  1JE8 A;  2O8X A;  2J5P A;  1U2W A;  2BYV E;  2D45 A;  1RI7 A;  1BI1 A;  4G8X A;  2VC1 A;  4F7Z A;  4E70 A;  2FBI A;  2LF7 A;  2H6C A;  1U5T C;  6PAX A;  1SD5 A;  1UCR A;  3JAM K;  1ONV A;  5BPI A;  2IA0 A;  3TQN A;  1EH7 A;  2NRA C;  1OYW A;  5LGT A;  1MJB A;  5L3F A;  3FMS A;  4EJW A;  3W6K B;  1W4M A;  2CO5 A;  5FB2 A;  3RKW A;  1HW1 A;  2KJB A;  2UXN A;  3RIR A;  3MQ0 A;  1SAX A;  4XLN F;  4UVC A;  3FM5 A;  2M8E A;  2K02 A;  4OIN F;  3F22 A;  2H94 A;  1P6R A;  4FX4 A;  2V6C A;  1RNL A;  3CUQ B;  5D4R A;  1GHC A;  2MA3 A;  3M7G A;  2HFH A;  2V9V A;  4M73 A;  2DBB A;  3WG9 A;  1U3E M;  1J9I A;  1BN5 A;  4A6E A;  1HXD A;  4HX4 A;  2P6S A;  1SD4 A;  1MJ9 A;  3M8E A;  4HYE A;  1FY7 A;  1IAW A;  4GXO A;  3NRV A;  4KMF A;  2Q8K A;  2X0L A;  2M1B A;  5BMZ A;  4OIQ F;  2Y0M A;  2GA1 A;  1ZRE A;  5D6F A;  1YLF A;  5HDN A;  4M72 A;  1FYL A;  4H0E A;  1O3Q A;  2FMY A;  4NQW A;  4L0Z B;  3OV8 A;  2G7U A;  3WTW C;  3BRO A;  1BJA A;  1KGS A;  5J8C A;  2V1X A;  1LEA A;  4A0Y A;  4EGZ A;  2BBY A;  1K78 A;  1B9N A;  2XRN A;  4A12 A;  2IW5 A;  3ZMU A;  5LEK A;  1FSE A;  1O57 A;  4XBF A;  3CJN A;  3J81 K;  4HDU A;  4EJU A;  5D6E A;  1P2F A;  3ZMD A;  1BI3 A;  1DP7 P;  1JXS A;  1I5Z A;  2VT3 A;  3MAJ A;  4L9N A;  1R36 A;  5DCF A;  2OZ6 A;  2PMH A;  3Q9V A;  2XVC A;  1LJ9 A;  2P4W A;  2PN6 A;  3FF5 A;  4CO8 A;  3L9F A;  1D5V A;  2Q0O A;  2IRF G;  4M6Y A;  5HLH A;  1Z6T A;  3KCC A;  2DI3 A;  2O6G E;  2LKP A;  4AD9 A;  4KIF A;  1H0M A;  1YO5 C;  1WQ2 A;  2DT5 A;  2VBX A;  3ELK A;  2P6T A;  3V7R A;  4ZH4 F;  5D8L B;  4EM2 A;  3L7W A;  2KIU A;  3J80 K;  4EQQ A;  3P7N A;  5L3C A;  1ZLK A;  1QBJ A;  1EV7 A;  3GO5 A;  3WTZ A;  1T98 A;  1TNS A;  1TQI A;  1Q1H A;  1ZH5 A;  3U1D A;  1DPR A;  3K69 A;  5ICC A;  2CFX A;  4MQ9 F;  3GF2 A;  2FEZ A;  3T8R A;  3F8C A;  4R8H A;  4LLG F;  5J8F A;  4AVP A;  4Q47 A;  5HLG A;  4U0Y A;  1ULY A;  3E5X A;  1F5T A;  1TBX A;  3GZ6 A;  2ESN A;  2NAZ A;  2CSO A;  2A07 F;  1XSX A;  2HTJ A;  3F23 A;  5HS9 A;  1QGP A;  3E5Q A;  4WCG A;  2X4H A;  5L3B A;  2L54 A;  4WX9 A;  5D5V B;  2DFI A;  1R5H A;  1SMT A;  4Y15 A;  1UFM A;  1S3J A;  3R0A A;  2DK5 A;  3J80 Z;  1L3L A;  2KRF A;  2ZME A;  1LEB A;  2VT2 A;  3PQK A;  1XDS A;  3QOP A;  3GUD A;  5K5O A;  2VE8 A;  4IPA A;  2OA4 A;  1P4X A;  3BWG A;  2MH9 A;  4LD5 A;  1ZRF A;  4O3M A;  3GFJ A;  4O5V A;  1W5T A;  3GLX A;  1PDN C;  3HHG A;  1IW7 F;  1H9T A;  4RGS A;  3JTG A;  3IC7 A;  4NB5 A;  3DP7 A;  3M9A A;  2DQR A;  4MGR A;  1Z9C A;  4OMZ A;  1TLH B;  4U0W A;  4RGX A;  1YG2 A;  3MWM A;  3K0L A;  4EGY A;  1OMI A;  1SFU A;  2RDP A;  1XCV A;  3KZY A;  1HSJ A;  2QUF A;  1LVA A;  5E18 F;  2JT1 A;  2ZO4 A;  1A04 A;  3DKW A;  3ZMT A;  2XKP A;  4BHC A;  3RYR A;  2C6Y A;  3WU0 A;  4HLY A;  1HW2 A;  1G3T A;  5IT9 Z;  3HUG A;  4OIR F;  2O3F A;  1J0R A;  4ESB A;  3DFG A;  3N4M A;  3K1M A;  3B02 A;  3KP7 A;  3FM3 A;  1HW5 A;  2A68 F;  3ZMS A;  1F9N A;  4B8X A;  3TO7 A;  2L3D A;  5JVT A;  1S7O A;  3I58 A;  1YYV A;  3I0T A;  5FO5 A;  4BNC A;  1IN5 A;  3F8N A;  1U6G A;  4FHT A;  3E97 A;  1BI2 A;  1WSU A;  1LDD A;  4ETS A;  2VOO A;  2HKX A;  2CYY A;  5HLI A;  2WC2 A;  4Z2Y A;  1HKQ A;  4UV8 A;  1IRF A;  3EYI A;  3REO A;  5A2Q K;  2NNY A;  2PJP A;  2STT A;  3GYH X;  3E6C C;  2HQN A;  3HRU A;  4HV5 A;  5CVR A;  3F6V A;  2VBW A;  2XAJ A;  3DPL C;  2ZJ2 A;  2COM A;  3M8F A;  1TW2 A;  3BP8 A;  3KEQ A;  1FOK A;  4JK1 X;  4G6D A;  3H3U A;  1P92 A;  2PG4 A;  3WE2 A;  3M1E A;  3QAH A;  3BPV A;  3RJP A;  5H6R A;  1S7A A;  3KP2 A;  2FNA A;  1RIO H;  4HBL A;  1K7A A;  4MQV A;  5DV5 A;  1U8R A;  2EA4 A;  1I1G A;  1UHW A;  5CYV A;  1B9M A;  4U7B A;  1U5T B;  2EFN A;  4OOI A;  5JFR A;  4RB3 C;  3C18 A;  4GGG A;  5K5Q A;  5FLX K;  3LAP A;  4N9H A;  2P5V A;  5A2Q Z;  2FRH A;  5FLX Z;  2A61 A;  1ZG5 A;  1T0F A;  2M45 A;  2DPU A;  3T1B A;  4WXD A;  4IRI A;  1KQ8 A;  3E3V A;  3MFK A;  1J2X A;  3ISP A;  4KDP A;  3QPT A;  1KU9 A;  1ZLJ A;  4U88 A;  3KET A;  5LEJ A;  3PQJ A;  1MGT A;  1X3U A;  3P9I A;  2E1N A;  2QLZ A;  2VON A;  1FP1 D;  1GXP A;  5L3D A;  1IXS B;  1JHH A;  3EET A;  5E17 F;  1CF7 B;  2EK5 A;  4S05 A;  5HDK A;  2FBH A;  3NQO A;  2IA2 A;  2QQB A;  3W6J B;  1RUN A;  2WWY A;  4KIC A;  4WF2 A;  4OIO F;  1ZAO A;  4BH9 A;  5H20 A;  3WOD F;  3ECO A;  3T0Y A;  1BIB A;  1J75 A;  2KIF A;  2HQR A;  4RGR A;  1FYM A;  3MZH A;  2XAH A;  3GFM A;  4RAZ A;  4G94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...