5CKTA

Crystal structure of kora, a plasmid-encoded, global transcription regulator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TrfB transcriptional repressor protein
publication title Flexibility of KorA, a plasmid-encoded, global transcription regulator, in the presence and the absence of its operator.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16509 KORA TrfB plasmid transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5cktA00
2W7NA 5CKTA 3M8JA
chains in the Genus database with same CATH superfamily
3MMYB 4E7SA 1DPRA 1OR7A 5J8CA 1SD6A 1P7JA 2UUZA 1S8NA 3ISPA 5D6FA 4FE7A 4ZDOA 1I3QJ 4LIUA 1BC7C 4ETSA 1Q1VA 4L5IA 3WGIA 5ILVA 2M1BA 5L3GA 3F3XA 4F91B 3KFWX 1C0WA 4QPOA 1Z67A 5HLTA 3LSMA 1RC9A 1EH6A 2XGCA 2LDUA 2IJLA 1IAWA 1FOXA 2E2JJ 4DBRA 3GTQJ 2HU9A 4RBOA 1K4SA 1I39A 1PJRA 3CCYA 3U9GA 2R5ZA 3ZQQA 4L9VA 3SZTA 3EUAA 3VB2A 1ZQ3P 1MGTA 3S17J 2VLAA 4OIOF 2FNAA 1O3QA 4JX6A 5IYCJ 4C2TA 1LUJB 3ABUA 3HKZN 1MNMC 2DA6A 3AG4H 1VQMI 2W82A 3FX3A 3LFUA 2VXDA 1JKOC 2UWMA 4H0EA 1FOYA 2XAGA 2KIFA 3QPSA 4XRSG 4I7HA 2XHKA 1BJAA 1QZZA 2TCTA 2KZVA 3VSLA 2M7AA 1FIPA 3PUFA 1J5YA 2CO5A 2R92J 5HNHA 2HVRA 2XRNA 5HDKA 2KQRA 4ZZDA 1W7PA 4ITVA 1WWXA 4DBQA 4N4NB 2LREA 3SZPA 2HVQA 2NS8A 3NARA 2E7XA 5LFAA 2EZHA 1AU7A 2QGUA 4MTEA 3LSKA 1BI0A 1HW2A 3COAC 2G0EA 2WAQN 5IPAA 1F5TA 4RLFA 4RAFA 2L9SA 5FLVA 4B8XA 1KZHA 3CCQI 5DUIA 3F21A 2V79A 4PZJA 1K78A 1T38A 1EA3A 3G1LA 3R61A 2KMUA 1R4NB 2X1EA 3I53A 4G94A 3WU2C 3ZMDA 1T39A 3BQZA 1RETA 2DAOA 2LR8A 4EGZA 2F2EA 5KAFC 4XLAA 2MGQA 3CCMI 1XX5A 1S29A 2DOFA 2WA0A 3FWEA 3MVPA 4D7MA 5DD4A 1F36A 3FMSA 2DDBA 3D5LA 4TV7A 2NS0A 2G7UA 5J1RA 2M45A 3GTJJ 1Z91A 1IUFA 1YYVA 2AXLA 2HFHA 3OYDA 3JAMK 3ZXSA 2BY1A 5LEKA 2COBA 1KYWA 3RZOJ 4A93J 4R1HA 5EJCA 2JUGA 4ASNA 2JTVA 5E1XA 4A3FJ 4N9IA 2P81A 2E60A 3S8PA 5LBQA 3ZQLA 4KICA 3Q0WA 4A5MA 1ZLJA 2W4SA 3GYHX 1ZR2A 1F9NA 4Y3OA 1DP7P 4IHSA 1F4KA 1VZ0A 1SAUA 4QWQA 5HS9A 1U3EM 2FD5A 2WAFA 2STWA 5CQGA 5IYBJ 2CUJA 2VIXA 4EM2A 5ICGA 1W0UA 3NWSA 2VUMJ 5M3MJ 4B09A 1A6QA 4CGZA 4L9TA 2F6CA 3S93A 2TRTA 4HZFA 3QOPA 3HGYA 2EPFA 4V2GA 4I0BA 3ZMUA 2CW8A 4FQGA 2BYVE 4KT5C 2XSJC 3BJAA 2LTPA 4XICA 3T5XA 1FNNA 1V4RA 2KRFA 5B1BH 3LSJA 4XRSA 2BOLA 2JWTA 3GXOA 5LEJA 1X19A 3HTUA 3KP3A 3HHHA 2EILH 3FBIB 4ZC3A 4BYYA 1XCBA 2ZNZA 3SQNA 5EG0A 3HL2A 3S1NJ 2DFFA 3S1QJ 2HEOA 1X3UA 2BEOA 4DOZA 1WSUA 2ESNA 2QA4I 4A3JJ 1O3SA 2W24A 1T08B 1B1BA 2OBPA 2L7KA 2R5YA 3K1PA 2A68F 3KX2A 1MDMB 3BR0A 4AYBA 4ENJA 4ZTJA 4BAYA 1W5SA 1HQCA 4CZZA 2XAQA 5KCMA 2X1CA 2EZIA 3TO9A 2Y0MA 1I50J 2VQLA 2K86A 2QQBA 2HYGD 2E1MC 5D4SA 1ZELA 5CYVA 3JTHA 4HPQA 2E7WA 4C9YA 5LGNA 1TL8A 3DKYA 3RQ4A 3OYIA 1HKSA 2IGMA 3L2RA 3IRQA 6PAXA 2EIKH 2FBIA 2JZYA 2CUZA 3WHCA 4AIDA 2X9DA 1AWCA 2KIUA 5FFXA 1YJWI 4U7DA 1IRGA 3VDXA 1FOKA 1LEAA 2LKSA 4L0ZB 2KRCA 1ZLKA 4X1EA 2CW0F 3ABMH 5DTDA 3H9QA 3J7AO 1FSEA 4XM3A 2O3FA 1JKRC 1B72B 4Q47A 1UG2A 2R93J 1R22A 3VWBA 2P5VA 2L4AA 2VC0A 5FLXK 5FGMA 4M3EA 2CQNA 3KYLA 1V5EA 4MEXF 4A3GJ 2X6WA 2OUMA 2V9VA 2ESHA 3F8MA 1USTA 2BW3A 5E8GA 1H89C 2HWVA 2YR2A 3GLXA 1ZGWA 1JJ6C 2GM4A 1LQ1A 1YG2A 1OJLA 3CDIA 1YFHA 3H92A 4JQFA 4PCQA 4LG0B 2W48A 2CYYA 1KONA 2MLKA 3DPTA 4F93B 1SVOA 4P55A 1LNWA 1IRFA 3RPUA 3JR9A 2I8DA 2DMTA 3FF5A 2V4JC 4BXUA 2JSPA 4YELA 2HKOA 4MQVA 3BTJA 3HRMA 3JCUC 3VYRB 3G73A 4RS8A 2JVHA 3U1KA 2BHZA 2V1NA 1UHMA 3REOA 3I55I 4A2UA 2Y69H 3OS1A 3OYGA 4PSWA 3K7AJ 1XCVA 4XQFA 1LFUP 2BV6A 4AVPA 4PJMA 3L1PA 3H5RA 4JYKA 3TW6A 3HOYJ 3OSGA 4XIDA 4PFOA 3OYJA 5FFZA 2NYXA 2VPRA 3VYTB 1YITI 4PJNA 3GZ6A 2IGKA 4J00A 2YU3A 5A2QK 1X3ZB 1FP2A 3LSIA 1B9MA 4FX0A 2ZSHB 3ASNH 2E1NA 3V4GA 1A5JA 4YFKF 2IGNA 1V55H 4XLEA 4BKXA 2HOEA 3J80Z 5HS8A 5KNLA 1S72I 2L4MA 1OYIA 4KITB 2PBIA 2L7ZA 1LDDA 3SFZA 1MSFC 1H9GA 1LVKA 3PFIA 3MKZA 1QPIA 1IXRC 3BG6A 2M0MA 4XN0A 5GAGJ 1G3SA 2FQ4A 1FEXA 4BXXJ 2DCEA 4M9SA 4M3GA 3DBHB 2DA1A 3BR6A 3K9TA 5DCMB 1QHHD 3M8JA 1OPCA 2HGCA 1KU2A 2VKDA 2WB1N 1VQ6I 1UMQA 3EYYA 3H35A 4I02A 4LLLA 5AIPA 4N4OB 3OOPA 3WTYC 2VQCA 2NS7A 4C2UA 2TDXA 5DM6F 3CDHA 3D5SC 1Y1WJ 3CCEI 1DUXC 2O0YA 3ZOBA 3N05A 4P5OA 1RRJA 1Z7UA 2MW8A 3QPTA 3MKWB 3PO2J 2HR3A 1YQAA 1WHUA 2PLYA 5CKTA 4A6EA 1QU3A 3LMMA 1VF9A 2ETHA 1P9QC 5J1UA 2ZJQF 3J81Z 1BC8C 1PVEA 2EFPA 2EK5A 1IN6A 1HSJA 4O3MA 1WH5A 5GADJ 2K9NA 4HQEA 2FOKA 2QM3A 3BZKA 3K2AA 4BGDA 3HUGB 2VBYA 1RIOH 1X1PA 4NNJA 4C3HJ 1S6LA 1XN7A 4ZTFA 2YS9A 1NK2P 1FY7A 2GA1A 1JKPC 4OAYA 2KJBA 5F6FA 3BTLA 2RREA 3GW2A 5E3MA 3WTTC 4ESBA 1JUPA 3S16J 1VNDA 2LF8A 4HLYA 5JVTA 4XSZF 1WPKA 1BIAA 4L9NA 2M4GA 3O3KA 2QBYB 2IA0A 5EZGA 3WG7H 5J8FA 2XGEA 2ZSIB 2ECCA 4PUSA 4E6KG 1YRNB 3N97A 1TWAJ 3SFIA 5FLMJ 4I09A 4M3BA 1LFBA 3TMOA 2CV2A 1HA8A 2ME6A 3K2ZA 3OYEA 1ZHFA 2K3FA 4XLFA 3I59B 1HDPA 4CYDA 3IH3A 5GTIC 1PDNC 1VQ8I 3A03A 3FDYA 5BMZA 4AIKA 3R6SA 2DK8A 1E3HA 3DFGA 3UNGC 3FHNA 3J7AY 2R7SA 2BHYA 4WXCA 3RI4A 1D3YA 2D1HA 3PUBA 2IVMA 2LY2A 4PSXA 1ZK8A 1YW7A 2X85A 4MNUA 1MDMA 4M3FA 4UXNA 2HQNA 4HSTA 3MD2A 3X2QH 2LSOA 3PIPF 1HDDC 3TDZC 3VOEA 5CJ9A 2PJPA 2ZBKA 1EKEA 3IP4B 1VTNC 3F9KA 4GXOA 3FXOA 4MFDA 5JLXA 1TQMA 2XV4S 1OCZH 2EB7A 3GTMJ 2XDVA 1UELB 2EINH 2RQQA 2FMYA 2CQ7A 4E7ZA 3BP8A 4FASD 2VQHA 2R3SA 4AWXB 5EEGA 1BR1A 2M87A 3PM1A 2EZKA 3TO7A 4L18B 3TOAA 1T56A 3ERMA 1TWCJ 2X51A 1AHDP 1TWHJ 2STTA 2MH9A 4LITA 1H9TA 2QZ8A 4B43A 5EDNA 4Y52J 3G1OA 5FJ8J 1KQ8A 3RIRA 3S32A 1W36C 2PFBA 2MD5A 3JRHA 4LLNA 2NVXJ 5CVJA 3HGGA 1NG7A 3S1RJ 4P9FA 4IX7A 1W7PD 3RKQA 2LK2A 4QLCU 4EVIA 5IP7J 1M1EB 1ZYRF 3A1YA 3ZN0A 2X4HA 4U0WA 3V8LA 4E7LA 2WV0A 4PDKA 2A69F 2W57A 3QYBA 2LKXA 4KYWA 1D1AA 4A3KJ 2CQKA 1BW5A 2PN6A 4DYRA 2RGVA 2G7HA 1ULYA 1I6HJ 4B48A 3HTSB 4UB8C 3WTWC 2GIVA 3IH4A 1ERDA 1IRZA 2ELJA 2A05A 1JUSA 3GX4X 4HA8A 2QSFX 3EETA 3O2PE 1J09A 1JTXA 4GGGA 3GTGJ 2COMA 1OCOH 1HW1A 2M5WA 2HZDA 3ZMZA 3BTIA 4IQ4A 2NOJB 2Z3YA 2LBFB 1IW7F 1X1BA 3A0HC 3KZZA 1YW8A 3PO3J 5CLSA 2UXXA 1USSA 1VQPI 4HF1A 3JRBA 3CP2A 3VEPA 2Z5UA 3ERED 4XKBA 3BG5A 3G1MA 1TBXA 4ZH4F 1MH3A 3G71I 5HS7A 2VPLA 2IA2A 2KZGA 3ABTA 2JA8J 1IG7A 4I2OA 2Y2ZA 2P4WA 4X0GA 1P4WA 2IAIA 2AQEA 2QCOA 4GDFA 4LLGF 4DJAA 1D1BA 1CQTA 1WJBA 4B4CA 3QRFF 3HOXJ 2AQFA 3KPHA 2DODA 1ETXA 2FUG2 5FLXZ 4D7NA 1LB2A 4Y17A 3DPUA 4RAGA 2ZXJA 3OL4A 1X4PA 3WTXC 1QNTA 3HOTA 3I54A 1GV2A 3RKYA 1JGGA 1FX7A 2W25A 2VONA 1KQ9A 5DCMA 2XGDA 3DEEA 4Z6YA 3KYDB 2KFDA 2H94A 2BVMA 4HOBA 2R5YB 1YS6A 3QP5A 3E5QA 4BU2A 2FX0A 2F4MB 3TEDA 4LD5A 2JK3A 1Z77A 2E2IJ 2PX9A 3CJRB 1QZEA 1TTYA 4HQMA 4PJJA 4XN3A 1W5TA 3LOCA 3P5JA 2EV6A 4AU7A 3GTLJ 4F3QA 2R7QA 2NOGA 1N75A 2E1OA 3RYPA 4HDUA 2R7WA 4IHVA 2X6OA 3KIOA 2XAFA 1E17A 2QEXI 4BJ5C 4A0YA 5F64A 2JRTA 3BLYA 2IXSA 1Y1VJ 3CD6I 3PSIA 3C2HA 3GBGA 2IGOA 3G3ZA 4CH7A 2J5OA 5EYRA 3QPLA 3BOQA 2BY2A 2F5EA 2LP0A 2PEXA 1OLTA 4BQNA 1OYWA 5L3BA 3VYSB 4ZJZA 2L2OA 2Y48A 3S14J 2N8GA 2M8GX 2W00A 3J80K 1AA7A 2VXZA 2GXAA 4EEFG 5HOOA 2UZKA 1WJCA 5M5YJ 2R7DA 1SFXA 4ZYGA 5A2QZ 2CWEA 2EWNA 1WVRA 3ZQFA 1E0EA 2L5QA 2B7EA 2LOOA 3B6CA 1OFCX 2R7UA 2BW3B 3DLAA 3DEUA 2QBYA 2DLLA 2O9LA 3CZ6A 3BR5A 3C2GA 1ZR4A 1YS7A 3NRVA 2VE9A 1YRNA 4DZPA 1MBFA 1BI2A 4UHTA 1XPXA 1MBHA 2X48A 4FISA 1STZA 1XGSA 4EMSA 3I59A 4P9UA 4Q4ZF 2CV1A 2RC4A 5IOYA 5IOZA 1BR4A 4B1RA 3GFJA 4LJZF 3ABLH 3RYRA 2NRAC 3HOVJ 3GEZA 3MZYA 4UV8A 2DA7A 2O5RA 1U9NA 4A3LJ 1ETVA 2EA2A 5J3LA 1FLIA 2DFHA 3DQVC 2QQ8A 3ROUA 3J81K 2V6CA 3MN2A 3CTAA 3FKJA 4RMNA 3R60A 4E4HA 5LHGA 3WTZA 1Y39A 4II2A 4M9XA 1IJWC 1V5GA 2BVLA 2H6CA 3I71A 4CCLA 3RSNA 1RKTA 1TLHB 3RPUD 3BZCA 3S15J 2P8TA 3MAJA 1D8KA 2WV1A 4PGHA 2DXIA 1X2MA 2IS1A 3H0GJ 5C44J 4C3JJ 1BI1A 4JP0A 1A04A 5D5VB 2KDZA 2WADA 3V7RA 2KIQA 2CUEA 4UY8I 2P5KA 2XB5A 2QWWA 1MNEA 2DA5A 3JSPA 3BCAA 1MZBA 5GAEJ 1KU3A 5IP6A 1HKQA 2WC2A 5H6QA 1MBJA 1WFXA 3LA2A 5LHIA 1WI3A 2RAEA 1X2NA 1EH7A 3H9GA 2O03A 2VKHA 3FMQA 1TNSA 4G8XA 3LAPA 4MTDA 2EH3A 3L2WA 1G8XA 4E7JA 2L01A 3GZ5A 2MYSA 3M7GA 1CGPA 5D5XB 2B9SA 4IF4A 3KLNA 1UFMA 2BXYA 3KE2A 3G2BA 1NH3A 1TT0A 4IRGA 3OYKA 2DT5A 3MZ8A 1KA8A 1BM9A 2OZ6A 2BGCA 3CQZJ 3I3LA 5DV5A 3JRAA 1FYLA 1P4XA 3FM3A 3OV8A 2HI3A 4GRIA 3B02A 5E1ZB 4IOAF 5JHUA 1LE8B 5D5WB 1J7KA 4Q48A 4UVBA 3A01B 3IWZA 4FTHA 2V1UA 1QQIA 5JR3A 3BR1A 2O8XA 4NBQA 3QP6A 1R7JA 2LFBA 2VC1A 5CVUA 1Y6IA 2R7FA 1N77A 3LSHA 2LBFA 4XNFA 5E3LA 1GDTA 2DQRA 2ECBA 4U7BA 4P1WA 2P5LC 1ZAOA 1WJEA 4NC8A 1WKMA 2VJJA 3PNTA 3WE3A 5LRSA 2QSHX 2BE5F 1YJ9I 1S7EA 2L9RA 4CUGA 2ZFUA 3EPZA 4KIBA 2JT1A 1XMXA 2E1MB 3BR2A 5BQTA 1KU9A 1OCTC 1U8RA 1T95A 1R1VA 2FBHA 3ZCOA 1R36A 2B0LA 5E79C 1ZGAA 1AOYA 3EUHC 2FA5A 2F5DA 3CO7C 5B1AH 3W6JB 1B4AA 1O57A 4CHUA 2DTZA 1R58A 4LK1F 1ZARA 3HRTA 1FBUA 4EJWA 1D0XA 4XKVA 3FXLA 3JRGA 5DUKA 4IO9F 3GFMA 3OIPA 4CDGA 1H8AC 2CFXA 4HV6A 5FD5A 4KA4A 3NAUA 1QVTA 2OAZA 2ZMEC 4JOMA 4G9YA 4YRVA 5F1RA 2DO7A 3ESWB 1BOAA 2DDAA 2OPTA 1MNDA 4M9ZA 4NDLA 2D45A 3DKWA 1POGA 2E1CA 3FKIJ 3IKTA 4K2EA 5HVQC 3TO6A 2GA2A 1RKWA 1UG0A 2CSOA 4CZCA 5E8IA 1QO0D 1SFKA 4C3IJ 1S5LC 5K7ZA 2QQ9A 3IV5A 1SD7A 1IXSB 5J4YA 1IV8A 3OR1C 5F04A 4QPQA 2ID6A 2RV8A 2DJIA 3RKWA 3FIWA 2IBDA 1XTAA 3Q9VA 4ZZLA 1U8BA 4QTRA 1R5HA 1TWGJ 3MWMA 4OWRB 1IV6A 3KLOA 2CG4A 3C3WA 1FTTA 5L3EA 1U6GA 4BBSJ 4M71A 1ZKGA 4XR6A 2M9HA 2A07F 2PMZN 3DBRB 3H3UA 4GYIA 1VQOI 1VQ7I 2IPQX 3ECHA 4DYCA 3NEUA 4BHCA 5C4JJ 5CQEA 1T0FC 2QSGX 1MMGA 1MJBA 2DQLA 4QSHA 2V9KA 3HXLA 3K4JA 4LGWA 5F0CA 4L0YB 3F72A 1NG6A 3IRRA 2YSRA 3B73A 5F27A 2KIMA 3E6MA 3SDGA 1XSVA 1GV5A 2IEKA 2ZXIA 1HC8A 3OYLA 5GTHC 3ML6A 3R4KA 3IAM2 2ELHA 1R71A 2Q8KA 1L3LA 2NVQJ 4WWCA 2BY0A 3PIOF 3T8TA 3ZP5A 4B44A 4DZJA 2GXGA 1V5FA 1PUFB 4IKFA 2DK5A 3HKZA 2CUFA 1EV7A 3LSTA 2K7LA 5JHFA 4AD9A 1UB9A 2Y9YA 4IZZA 1K7AA 5E1WA 4Y33A 1LEBA 5IP9J 5D8KB 2Z16A 1LKXA 2JMWA 2DMPA 4BUPA 4Y4RA 1YJNI 2XASA 5DM7F 1ZRDA 1S7OA 3M07A 3AL0C 1RESA 1S3JA 1AKHA 3P9IA 2WBMA 3KP5A 2CRGA 1GXPA 4RDUA 1JT6A 2LY1A 4GYGA 2KP6A 3H5NA 4HW0A 3MKYB 3OYHA 1PUEE 3W3CA 1FMWA 1OKRA 3BG9A 4LOCA 3CO6C 1QA6A 1WGXA 1J75A 3ULQB 1K6YA 1L0OC 1A35A 5B66C 3CMAI 1FWZA 3G4SI 3IC7A 4ZYAA 2KRHA 4RAZA 3TL4X 3CC4I 2WAQA 3PQJA 4ESFA 2GOXB 2VL8A 2DA3A 3K69A 1SFOJ 1Z0XA 5J6XA 5GPAA 3JTGA 2MLGA 5D8LB 2V1XA 2ZKZA 1H0MA 3OS2A 1JT0A 2M3AA 1HKTA 1SC7A 3FXUA 4ESJA 3EYIA 2QQAA 5DCFA 2DPUA 2MD0A 3I58A 2GXBA 1BA5A 2V6EA 3TP0A 2CFOA 5ICFA 3I64A 1X4OA 3L9FA 4PJLA 4BACA 1RI7A 1SVLA 3CMMA 3BWGA 2LYCA 4XMYA 1WJFA 3M1CA 5ILSA 1T98A 4U0YA 2DT7B 4HF2A 1DGWY 4HYEA 3BROA 4IHTA 2DN0A 3E5UA 3GCMA 2PG4A 4ON0A 1JTYA 2EIJH 2M34A 1LE8A 5CVRA 1OCPA 2JA6J 5JVGF 1O4XA 3A01A 2GOMA 3CCVI 4G7HF 1U2WA 2EJRA 1DPUA 3K4CA 1WCMJ 1KU7A 3CCJI 1R1UA 3L2QA 2WWYA 5GP9A 2E36A 1WRJA 3A2KA 3HOWJ 2EBIA 1MIJA 2O8KA 1J2XA 1FYMA 2MSYA 2MG4A 4F92B 3I0TA 2XF5A 3VPRA 2H09A 4ABZA 2HNHA 3KETA 3OIQA 3DU5A 2CV0A 2ISYA 2L3DA 1ODDA 2P0WA 2MBFA 4KUMA 3T8RA 3M3YJ 2L02A 3V8JA 4RB0A 3WGHA 3EUKL 1MW7A 4CXFA 1QRYA 2Q1ZB 3ABKH 4FE4A 9ANTA 3ZQHA 1YO5C 1R6RA 1N25A 2XAJA 1ZRCA 3HJEA 2GIZA 5F1JA 2ZC2A 1VQ4I 4E7IA 4H4KC 3ZMSA 1ETWA 4A3DJ 4C2MJ 4DQ2A 2Z33A 3G6EI 5F0HA 2VJ5A 3MEXA 3BY6A 2OA4A 2M4KA 5F0FA 1H88C 2EQRA 3WTSC 4XOPA 2VBZA 4S05A 3BG7A 4BHPA 1JGSA 2VODA 2XB0X 3N4MA 1MBEA 3LA7A 4CCOA 1IDYA 2A5YB 2LVSA 3P7NA 3HOUJ 3LSPA 1QGPA 5J1YA 5DS9A 5HODA 2ZJ2A 2LG4A 1DU0A 5KAIC 2XKOA 4D5CA 1MMNA 2L0KA 3O8GA 5CVVA 2IS4A 2JA2A 2E35A 2HYJA 3MKLA 5LLQA 3LNQA 3QYFA 3CF2A 3GLLA 1W36D 4AM3A 1LPQA 1MMSA 4QIWN 3K4MA 3DP7A 1ZGJA 1U9OA 5DDGA 4HDVA 1YE9A 2EIMH 4YEJA 3WU0A 1JE8A 3CESA 2LKPA 2LLKA 2FEZA 4RB1A 3GMEA 3ONQA 3M9AA 4B47A 4WXDA 3HSFA 2JJ7A 2X1DA 1XGOA 2FBKA 1U5TC 4I01A 3E6DA 4GO1A 3BZ6A 4BL0B 3KEQA 1Q1HA 1G3YA 4XSXF 1GVJA 3AG3H 2WAEA 1P92A 1YW9A 2WTEA 2XF6A 1OR7C 5FD6A 3DCFA 1ETQA 4XK4A 1QZYA 3W6KB 1O3RA 3RZDJ 3AG1H 3DU6A 2OJED 2HTSA 4E70A 3OYAA 1I27A 1XG1A 4KDPA 2X6XA 3ZQGA 2XIGA 2K4BA 3HBLA 2DU9A 1ZH5A 4R8HA 1V3FA 2YX4A 2YU9J 5AONA 4U0VA 3BC8A 2KPMA 2CQQA 3VFZA 2NVUB 4M72A 5HLIA 4C30A 3HIFA 3SJMA 1IDZA 2WY7Q 1RR8C 3I4MJ 1KQ0A 3TP3A 2ZCWA 2EFOA 4XLCA 1P4AA 3IH2A 4P96A 4EJOA 2FSWA 2DMUA 1JHFA 5K5QA 1GVDA 4DNCA 4LIVA 2DA4A 1ON1A 2CH0A 3SZGA 1PUFA 3HSRA 3F8FA 5LHHA 5ICCA 2Z2SB 4RB3C 1VI0A 2PJRB 1KGSA 4XBFA 3U1DA 2CGPA 3FK6A 3E1SA 2EA4A 4BY7J 3FHZA 2OCEA 1K4TA 3IKVA 3GZNB 3ASOH 3L7WA 1DGRM 4A0XA 5IT9K 1REPC 3JRCA 3F6VA 2AXTC 1OCRH 4EV0A 3WTUC 2FNPA 4L9JA 4CO8A 1IUYA 1X1CA 3O6BB 4Q5SF 2ME0A 4PK4A 2DW4A 4WXHA 2HZTA 4IPAA 5E3NA 1N78A 1NHAA 3AFHA 1BL0A 5FKNA 4KT6A 3FXMA 3CUQC 3JRIA 4UUVA 2V9PA 4MHGA 3F6OA 3K6GA 2DA2A 2R7XA 5M3FJ 3LL7A 4BQAA 1PYVA 2FE3A 1WJ5A 2EFQA 5KK1A 3FXKA 5KVRA 2HQ5A 4JX4A 1GHCA 2MABA 1ITYA 2A6EF 4ENNA 3BR3A 2HKXA 2MFZA 1MMDA 2DI3A 2K9SA 2R0QC 3PFYA 3KZIC 1EF4A 2XAHA 4UUSB 2HXOA 3RTRA 3OS0A 3OL3A 2VKEA 1SMTA 3DTIA 2WB1A 1HBXG 2LNBA 1BI3A 2VASA 2GLOA 3FK7A 1TT5B 5D6EA 3DTEA 3K1MA 1Z9CA 1ENHA 1YTYA 4MFEA 5H2FC 1GLNA 3FXRA 4MGRA 2VE8A 5BPDA 1FSHA 1UJ8A 4MIMA 1Y56A 3KCCA 3BJOA 4ZYHA 1FZPB 2CW7A 3PL8A 4V2FA 5FROA 3OY9A 2IS2A 2PMHA 2HDWA 5ILUA 2LC2A 2WY8Q 1MBGA 4S0HB 2QENA 4HX8A 3H9JA 4EQQA 3WTVC 4A3MJ 3L2VA 1TC3C 1MKMA 4XRFA 4NHJA 1O7FA 3KP2A 4KJZA 4MEYF 4AVZA 3EDPA 4AYBN 5FKMA 4NC6A 2VI6A 5J40A 2PMUA 1D1CA 3Q0VA 1HCRA 4ANJA 2ZXHA 5E17F 5FKKA 5B3SH 2KT0A 4A3BJ 2D2WA 1X1DA 2HPMA 1HSTA 4BEHB 3SYTA 3K70C 2HOTA 4UV9A 2NAZA 4HF0A 2JVGA 2X6YA 2XGXA 2HQAA 4MQ9F 4G7ZF 3FXQA 1FOWA 3CJTB 4ENMA 2R7VA 1TW3A 2DPDA 3DKXA 2HXIA 2Z1DA 3ZN1A 3S2DJ 3LQQA 3B6AA 1BJZA 3F8BA 1UHSA 3W2VA 3I56I 1NTCA 3I9V2 2DYSH 5KHDA 1YLFA 3K4KA 2GWRA 1Y0UA 4XOTA 2G9WA 3HRSA 4M74A 5E3OA 1R49A 3U21A 4Y15A 1APLC 3E6BA 2J5PA 2E71A 5GAHJ 2KLOA 4UUTA 2VJ4A 1ZTRA 3KP6A 2BZTA 2MC3A 2YX7A 2F48A 3TW7A 2V7FA 3PSFA 5BPIA 3KEYA 4HNUA 1R1TA 2CQXA 3OYMA 1TNTA 1HOMA 2QKMB 3DV8A 3H3ZA 4IHWA 2P6TA 1IN4A 3CCSI 3E97A 4BH9A 4ZDPA 3HPHA 1ETYA 1D5YA 3HEFA 5EZHA 2F4IA 1G4DA 4RLQA 1AKHB 1XD7A 4A3CJ 3K10A 4I76A 1XSDA 3E7LA 1GT0C 3LWFA 2V26A 2IRFG 2JA7J 3HPGA 1K79A 1X3WB 4LG3A 3RJPA 4D5FA 2YPRA 3TGNA 2VOPA 1RNLA 1W5CC 3HG9A 4WK8F 4RM3A 4BE1A 2DMNA 1IC8A 2O61A 3FMRA 1FP1D 3CLOA 4IL6C 1W4MA 5LGTA 4CA0A 1T6SA 1YIJI 3DWLE 2EFNA 1X1AA 2KJCA 3D5RC 5JI6A 3UKGA 3FZVA 1A36A 2BY3A 2HYFA 3GF2A 4MLOA 2LMDA 5ERIA 1JJ8C 3FISA 5CVIA 1J0RA 2RNJA 3FXJA 3SHFA 3L2UA 2P7VB 2W1OA 2Y0SA 4G6QA 3DBLB 2MC4A 3K4NA 4HEA2 1EH8A 2KL4A 3I4NJ 3IWFA 2FQ3A 2XPUA 3CJNA 3OYBA 2P6SA 5LGUA 1E3PA 5L3FA 1WZ2A 3F8NA 2H27A 4KMUX 1U0JA 3CUQA 4IRHA 1PP7U 3JSOA 1ACIA 2VB6A 4CYCB 3RKXA 5TRDA 3M8FA 2HOAA 2QKLB 2AHQA 1QVUA 3CDLA 4A3EJ 1DDNA 2IS6A 5FKLA 3L00A 1RUNA 1HW5A 4YFXF 2MA3A 1VFCA 3DF8A 2BBYA 2DBBA 4O5VA 1I3AA 4IQJA 1G3TA 4E7KA 2OTLI 2ZMEB 3V7CA 4IXAA 2W84A 1ZRFA 4G6DA 3KEOA 2H1KA 2VT3A 2A5WA 2RNGA 2PQ8A 2DFEA 3IAS2 1MSEC 3K4BA 2Y9ZA 1F1ZA 1B59A 1VQ9I 3H1CA 2Z9OA 2PJRA 1A6IA 4RAYA 1HF0A 4J01A 1GXQA 3GUDA 1TP4A 2OU2A 4LK0F 2A6TA 3WE2A 1WJDA 2DOAA 5EF6A 3A4CA 5HDNA 2L54A 1R5ID 1D0ZA 1OYYA 1UZCA 2R7OA 1P2FA 1G59A 1Z3YA 4UNOA 2XF7A 5IT3A 1LVAA 4B3XA 2XSDC 2ZJPF 1HXDA 3VODA 2M8EA 1B9NA 3V7SA 3C1DA 4AIJA 3GVAA 1XGNA 4A12A 2JUCA 5DD8A 4XRMA 2L9VA 4Y7NJ 4BQQA 3LAJA 1QPMA 1OCCH 4HLXA 5BOXA 3SEZA 1I1SA 3C2BA 1BIBA 4YFNF 2KISA 4UVAA 2JA5J 4B3AA 4GFBA 2B63J 1LDKB 4X6AJ 3GO5A 2EV5A 3S1MJ 1ETKA 4OINF 4D0PA 4LB5A 2O7OA 3OYNA 2ZB9A 3KP4A 2P7CB 2R7TA 2LRDA 4HSRA 2X0LA 4NQWA 3D1NI 2UV1A 3BDDA 5FO5A 3CMYA 4A5NA 4UUSA 3GTOJ 3BT9A 3Q9SA 4ZYEA 4I99C 4BE2A 2HOSA 3P9CA 3IUOA 2LD5A 4A3IJ 2R7ZJ 3MZHA 3RDIA 1G3WA 3BTCA 2ADUA 4W97A 2OD5A 2Y30A 2F5CA 3GFLA 3UR3C 3K4LA 3SEQA 3QQAA 3CC7I 3ZGKA 2C6YA 2Q2EA 3BPXA 1FYKA 1OISA 3CMEI 2ZJRF 2R4GA 4KMFA 1IRXA 1FTZA 1WQ2A 5C4XJ 2EFWA 3ZQCA 4S04A 4RGXA 4BQOA 1V54H 2HS5A 3S3MA 3CP8A 5GPCA 4F52A 2AO9A 3F22A 2I5UA 3HOSA 2E2HJ 4HAMA 3QOEA 2IA1A 1DQUA 3WHBA 3ECOA 4RGSA 2VJIA 3QU3A 3KZYA 1UCRA 5J4VA 1FBSA 2FRHA 1SD4A 4KIGA 1TWFJ 4PGGA 1TZLA 5IT9Z 2VKVA 4KN7X 4BEHA 3PNYA 2Y31A 4RM2A 4IEJA 3O8HA 4CSWA 4HNTA 4I6ZA 3AL0B 3A0BC 2K9MA 3GTKJ 4M6YA 4BJTA 1EJ9A 1SANA 4HG2A 1FJLA 4BY1J 1XC5A 3HRUA 5L3CA 5D5UB 3WG9A 2QLZA 1J9IA 3K1NA 1BN5A 4U87A 2ZXWH 1MJ9A 2CJJA 4IHXA 2KHMA 4XLHA 1JHHA 3DEWA 4HRIA 1IZ1A 2Q0OA 3H0DA 4LFUA 4XONA 2D1VA 3S3OA 3WGGA 1IN7A 4DIQA 2NVTJ 4YIFA 1X58A 1MH4A 4EM0B 3OYFA 4D1QA 4AC0A 1I6XA 4WCGA 3BQYA 4D9JA 4L5JA 1MBKA 5K1YA 4EATA 3HYIA 4BXFA 2UXNA 2IP2A 2RN7A 3CCLI 1B6AA 4HV5A 2K02A 3VYUB 1VQKI 1FC3A 1MMAA 1YOVB 4OU0A 4BBRJ 1Y8QB 4F7ZA 3IL2A 1Z1DA 4BHBA 4O6JA 3DTKA 4II3A 3W2AA 3RPQA 1HLVA 3F23A 5EEHA 5F08A 1T8IA 4R79A 3QPHA 4OOIA 5FRNA 4OMZA 1B8IB 2KKOA 2H1LA 2M7BA 1IF1A 4V19K 5EEAA 4DW6A 1FPQA 3JRDA 2OTJI 2ZO4A 1YI2I 3JREA 2V1DA 1VQNI 5E18F 2DOEA 4YIIA 3FM5A 3S3NA 5M5XJ 4XKCA 3D0SA 1T2KA 1JKQC 2VOOA 5HLGA 2R7RA 2JPCA 3L2CA 2EZLA 3BJ6A 3F8CA 2XROA 4XLNF 1UAAA 1BOBA 5HLHA 2K3PA 4A6DA 4WX9A 3J7YJ 3A02A 4L5EA 4MO7A 3T1BA 4DGWB 3EUHA 5EGOB 3SXYA 4CYCA 4M6VA 3CLQA 4EM1A 4ENKA 1ORKA 4BE0A 2LF7A 2RVCA 3U2RA 3V42A 2IW5A 2D5VA 3HM5A 1R9TJ 3LSRA 1O3TA 2OZUA 2XC7A 1Z6RA 3S2WA 4A0ZA 2DYRH 2CS3A 3HSEA 1FT9A 5K5RA 2H6BA 2HQRA 2ZMEA 3Q3SA 4Z2YA 1XMAA 1DU6A 2A6HF 2L7FP 2E5NA 2JPBA 2FU4A 2Y75A 1W0TA 3HOZJ 1IGNA 3PQKA 4U88A 1LJ9A 2NNYA 5D4RA 2E34A 1ZG3A 1RZ4A 3I4PA 3SDBA 4IOCF 1Z05A 3PNVA 4EJTA 1D0YA 4N9HA 4M3DA 5DEQA 1JUMA 2E19A 3ELKA 3DLLF 2CU7A 2OV7A 3E6CC 3CCRI 1K61A 2GZWA 4BJ6C 4UB6C 1WJAA 3R0AA 3M8EA 5K7FA 1YX5A 2LH9A 3ZRGA 4I98B 3CJQB 4CCNA 5K7HA 2F5FA 3AKZA 3BCBA 3R0JA 1K83J 1OQYA 1P6RA 1U5TB 2JQ7A 4ZDLA 2H8WA 5ICEA 3CC2I 3AAFA 4NC7A 5K5OA 5FB2A 2K9QA 1Z21A 4FT8A 2FXAA 3BPVA 2XPWA 2L9NA 5ED4A 1CF7B 2XUBA 3OWTA 3OMYA 3F0CA 2K9LA 4RB2C 3TKYA 2A61A 5BNGA 3M1EA 2K4JA 4CCKA 2AS5F 5TISC 5LD2C 2NXNB 4IHYA 3DPLC 3TDUC 3HDDA 2RKHA 4CICA 1G6NA 3JW4A 4PFPA 1T0FA 4AIHA 2QF7A 5AIQA 1BBYA 1TQIA 3LA3A 1Z6TA 3VSKA 3JRFA 3QAHA 2K40A 5H6RA 5HDGA 3OOUA 3ZR8X 4KFCA 5FRMA 1JI8A 2ZFWA 5CPRB 1A31A 1MJAA 2W85A 3GFIA 1G2HA 3OR2C 2R5ZB 2BXZA 1RUOA 3CF5F 5B5EC 2F4OB 2ZNYA 1XB4A 2DMQA 1J59A 3Q5FA 2OQGA 2KDOA 3ZMVA 4IVNA 2YUSA 2ISZA 4XLPF 4GCVA 4LB6B 4JX5A 1XDUA 3C7JA 3JAMZ 4I0AA 4G7OF 1ON2A 2JSCA 2ICWG 5DYMA 2ACJA 1BW6A 4AUXA 2VBXA 2PMZA 2I10A 1Z3XA 4EGYA 1K6OA 1ZG5A 2M0CA 4KIFA 3E5XA 4ZYDA 5L3DA 2ELKA 2O6GE 3QU6A 3I5UA 5J47A 1W7PB 2OCCH 1LFPA 5JLWA 1PP8F 3J7ZI 2PI0A 2VBWA 2XPVA 3CCUI 1WI9A 2JN6A 5TJJA 2H8RA 1E2XA 2XKPA 4EJUA 2RDPA 5E20A 1B72A 4CCMA 2OF7A 4A69C 3CUQB 2HVSA 4Y13A 1K78B 4OAZA 3TBIA 1SMYF 1SVMA 1ZG1A 3GTPJ 2FOWA 4KNYA 2LY9A 1YIOA 3ZQ7A 4NB5A 2M30A 2VT2A 2Y0SN 1SAXA 1FIAA 3M4OJ 5M5WJ 1UHWA 5HNFA 1SEUA 4WF2A 1FBQA 4LMYA 1TW2A 4NUBA 3H3VK 3NWTA 4LG0A 3K0LA 3Q0UA 1IO2A 1YHQI 5JFRA 1TQPA 4BNCA 1R23A 2W7NA 1XGMA 3TQNA 1IXCA 3ZMTA 5IYDJ 1GUUA 2FJ1A 3OSFA 1D8JA 2OQRA 4N0BA 3C18A 2K27A 1S9HA 3HZJA 2XRLA 1WH7A 4JBAA 3T0YA 2FF4A 1FMVA 2NNNA 3KYCB 1E3OC 3HB9A 3QYEA 1D5VA 4KISA 4FHTA 4IJAA 4BS9A 2E5ZA 3V8KA 4W1UA 3W2WA 2HDCA 1B8IA 3IHUA 1SFEA 2DTRA 2RQPA 1IN5A 3HHGA 3W6VA 3FBNB 5BS6A 2A3SA 3BG3A 2QUFA 2QYOA 4J19A 2DT6A 2FMLA 3OYCA 3MQ0A 1KYZA 1XS9A 3CUOA 1JXSA 3OIOA 4XL9A 1S7AA 1Y8RB 2F5VA 2K85A 4JK1X 1ZN2A 2CMPA 1VQ5I 1ETOA 1OMIA 4NQWB 4BDYA 3QWLA 3E0JB 5C3EJ 2VN2A 1QHGA 1R4MB 4CCJA 3DXJF 4YG2F 3P9KA 1MD0A 3ZQIA 4HX7A 1T33A 4PJ0C 1LDJA 1F43A 2JRMA 4XORA 3H36A 5H20A 5TGTA 3RCOA 5EGOA 1O7LA 3WODF 4OIPF 1XDSA 1Z7LA 4HNVA 3TOBA 5EG0B 1I5ZA 2Q2EB 5FKOA 1RR7A 2VQGA 3K70D 4FETA 4OMYA 4FX4A 4OIRF 3LFKA 2GQQA 3LSGA 3LQRA 4RA2A 1IN8A 5LRRA 3S2HJ 1U78A 4HBLA 1P7IA 1YX3A 3KP7A 2IT0A 4KN4X 4IRIA 2L7MP 1NK3P 2DJNA 4UVCA 1ONVA 1SD5A 2ID3A 2GAUA 4RGUA 1DP3A 1Y0NA 2HPIA 4HX4A 4FCYA 1QBJA 2OC6A 3ZPLA 1XSXA 4M73A 4RGRA 4F55A 4OIQF 3MFKA 2XAUA 1I1GA 2QVOA 4DYQA 1XMKA 3QODA 3GWZA 3NQOA 1RPWA 2EV0A 2HTJA 4EJVA 1SFUA 2MH2A 2DFIA 2NVYJ 3EQLF 3WU1B 3RQIA 5IY5H 1W1WE 4M6XA 4E7HA 3H5AA 3PJRA 3HUGA 1R00A 4BDZA 2M2EA 1U5TA 3MCZA 2K5CA 1R5GA 3HC7A 3L09A 2HDDA 3AG2H 4YIRX 1BR2A 2GBYA 2XVCA 4G6TB 3E3VA 2Z99A 1ZREA 1VQLI 4G12A 4XKWA 1CF7A
chains in the Genus database with same CATH topology
3MMYB 4E7SA 2R7TA 2LRDA 1NG7A 4HSRA 2UUZA 2UV1A 2MD0A 4IX7A 4ZDOA 2V6EA 4LIUA 2CFOA 1X4OA 3A1YA 4PJLA 4BACA 4BE2A 3CMMA 3IUOA 4E7LA 2LYCA 4XMYA 3QYBA 4F91B 1WJFA 3M1CA 1D1AA 4QPOA 2DT7B 5HLTA 3LSMA 1DGWY 3UR3C 3K4LA 3SEQA 3ZGKA 4B48A 1ERDA 2R4GA 1IRXA 2ELJA 4DBRA 2GOMA 2HU9A 1J09A 4BQOA 1PJRA 3K4CA 3S3MA 3CP8A 3ZQQA 3EUAA 4F52A 2HZDA 3HOSA 3L2QA 2VLAA 4IQ4A 3A2KA 2NOJB 3QOEA 2LBFB 1DQUA 4C2TA 1X1BA 2VJIA 2W82A 3LFUA 2UWMA 2VXDA 4F92B 3CP2A 1TZLA 2XF5A 4XKBA 2HNHA 4BEHA 3OIQA 3DU5A 3PNYA 2CV0A 4RM2A 2KZVA 3VSLA 2M7AA 2VPLA 2P0WA 4CSWA 4HNTA 3AL0B 3EUKL 1MW7A 5HNHA 2HVRA 2K9MA 2KQRA 2Q1ZB 4X0GA 4ITVA 4BJTA 1R6RA 4DBQA 4HG2A 4N4NB 2AQEA 2LREA 2HVQA 4DJAA 5LFAA 1D1BA 1WJBA 2AQFA 4U87A 3LSKA 4E7IA 4H4KC 2FUG2 4RLFA 2L9SA 3DPUA 2KHMA 4XLHA 3OL4A 1X4PA 2VJ5A 4HRIA 3H0DA 1EA3A 3HOTA 4XONA 2KMUA 2M4KA 3S3OA 4DIQA 2X1EA 4XOPA 3DEEA 3BG7A 2BVMA 4XLAA 4BU2A 3OYFA 4D1QA 2WA0A 4CCOA 4D9JA 3CJRB 4EATA 4PJJA 4XN3A 4BXFA 2LG4A 1MMNA 3D5LA 2IS4A 2JA2A 3VYUB 4AU7A 3QYFA 4F3QA 2R7QA 3OYDA 1MMAA 1N75A 3CF2A 3ZXSA 2R7WA 1W36D 3K4MA 4BJ5C 3BLYA 2JUGA 3DTKA 4II3A 2IXSA 3W2AA 1YE9A 3S8PA 2E60A 4YEJA 3PSIA 3C2HA 3CESA 3GBGA 2IGOA 4CH7A 2W4SA 3ONQA 4Y3OA 4R79A 4B47A 1VZ0A 5FRNA 1SAUA 2X1DA 1OLTA 4BQNA 2WAFA 3VYSB 4ZJZA 2L2OA 2M7BA 5CQGA 4BL0B 2W00A 1AA7A 2VXZA 2CUJA 2VIXA 5HOOA 3NWSA 1WJCA 2WAEA 3OS2A 2XF6A 1OR7C 3S3NA 2F6CA 1E0EA 4XKCA 2L5QA 2LOOA 3DU6A 3S93A 3OYAA 2R7UA 2R7RA 2CW8A 2X6XA 2BW3B 3DLAA 2XSJC 3CZ6A 3C2GA 1UAAA 2BOLA 1BOBA 2K3PA 3BC8A 2KPMA 1X19A 4DGWB 3FBIB 4ZC3A 4C30A 2CV1A 3HL2A 2WY7Q 4BE0A 3V42A 1BR4A 4XLCA 4DOZA 2XC7A 2O5RA 2CS3A 2L7KA 3DQVC 3KX2A 4LIVA 3SZGA 2CH0A 3FKJA 4RMNA 4AYBA 2E5NA 4E4HA 4ZTJA 2Z2SB 4II2A 2PJRB 5KCMA 1V5GA 2BVLA 2X1CA 2VQLA 3SDBA 4CCLA 3E1SA 3RSNA 3PNVA 1D0YA 3RPUD 2DXIA 1DGRM 2E1MC 2IS1A 1ZELA 4HPQA 4C9YA 2OV7A 3DKYA 3RQ4A 3OYIA 4BJ6C 2IGMA 3L2RA 1WJAA 2WADA 1X1CA 2CUZA 1YX5A 2LH9A 4PK4A 3ZRGA 3VDXA 1N78A 3CJQB 3AFHA 4CCNA 3AKZA 1MNEA 2KRCA 3BCBA 3BCAA 4KT6A 3H9QA 4ZDLA 4XM3A 3K6GA 1WFXA 3VWBA 2R7XA 3LL7A 1PYVA 4NC7A 1WJ5A 3KYLA 3H9GA 1Z21A 1V5EA 2VKHA 2MABA 2L9NA 2MFZA 1MMDA 3L2WA 2X6WA 1G8XA 3OWTA 3PFYA 4E7JA 3OMYA 2K9LA 2MYSA 2OUMA 3OS0A 3RTRA 2BW3A 3OL3A 4CCKA 5LD2C 3DTIA 2WB1A 3DPLC 3G2BA 2VASA 1TT0A 3OYKA 3DTEA 4PFPA 4JQFA 1GLNA 3I3LA 3VSKA 1KONA 3DPTA 1Y56A 4F93B 3OOUA 4GRIA 3ZR8X 2CW7A 3PL8A 5FRMA 1JI8A 5FROA 3OY9A 2IS2A 5CPRB 2I8DA 2HDWA 2LC2A 2V4JC 2WY8Q 2JSPA 4YELA 3H9JA 3OR2C 3VYRB 3L2VA 2JVHA 4KJZA 2V1NA 1Y6IA 1N77A 4AVZA 3LSHA 3OS1A 2LBFA 4XNFA 4PSWA 3OYGA 4XQFA 4U7BA 1D1CA 2KDOA 4P1WA 4PJMA 4ANJA 2ZXHA 1WJEA 3H5RA 3PNTA 2VJJA 4NC8A 1X1DA 2HPMA 4CUGA 2ZFUA 3EPZA 4BEHB 4PFOA 3SYTA 3OYJA 3K70C 3VYTB 4PJNA 2PMZA 2IGKA 4J00A 1Z3XA 2E1MB 2JVGA 2X6YA 3LSIA 2HQAA 2ZSHB 1LFPA 1T95A 2R7VA 2IGNA 3DKXA 3ZCOA 2Z1DA 4XLEA 5KNLA 3W2VA 3EUHC 4KITB 3I9V2 4CCMA 5KHDA 3K4KA 4XOTA 1LVKA 3MKZA 2HVSA 3BG6A 2M0MA 4XN0A 3U21A 2DCEA 1D0XA 4OAZA 4XKVA 3TBIA 2KLOA 3OIPA 2VJ4A 1QHHD 3M8JA 4JOMA 2VKDA 4YRVA 2V7FA 3H35A 3PSFA 5HNFA 3KEYA 4HNUA 4N4OB 4C2UA 1MNDA 2VQCA 4NUBA 3OYMA 3NWTA 2QKMB 5HVQC 3D5SC 1UG0A 4CZCA 4ZDPA 3HPHA 1SFKA 3N05A 2W7NA 4P5OA 2F4IA 3MKWB 4RLQA 5CKTA 1QU3A 1S9HA 3LMMA 3K10A 3OR1C 4QPQA 1P9QC 1FMVA 2DJIA 2V26A 3HPGA 3QYEA 4KISA 4LG3A 4BS9A 2E5ZA 3W2WA 3HG9A 4BE1A 4RM3A 4BGDA 3HUGB 4NNJA 4ZTFA 3FBNB 4OAYA 4OWRB 4CA0A 2DT6A 2RREA 3DWLE 1X1AA 3OYCA 3D5RC 4XR6A 4MLOA 4XL9A 2F5VA 2CMPA 3L2UA 4BDYA 4NQWB 2W1OA 2Y0SA 3E0JB 2MC4A 2M4GA 3K4NA 4HEA2 2KL4A 5CQEA 1QHGA 1T0FC 4CCJA 2ZSIB 4PUSA 4E6KG 1MMGA 3OYBA 2V9KA 3HXLA 3K4JA 1U0JA 4XORA 5TGTA 3TMOA 2CV2A 3RCOA 3OYEA 1NG6A 2VB6A 1HA8A 4XLFA 1Z7LA 2QKLB 2Q2EB 2ZXIA 3FDYA 2IS6A 2VQGA 3K70D 3OYLA 4FETA 3UNGC 3LSGA 3IAM2 3FHNA 3J7AY 2R7SA 4IQJA 3PUBA 2LY2A 4E7KA 4PSXA 4B44A 2X85A 1YX3A 1V5FA 4IKFA 2A5WA 2RNGA 3IAS2 3HKZA 4HSTA 3K4BA 3MD2A 5JHFA 2PJRA 3IP4B 4IZZA 4J01A 4Y33A 2Z16A 1LKXA 3F9KA 1DP3A 4BUPA 2A6TA 4Y4RA 1WJDA 2DOAA 2HPIA 3A4CA 3AL0C 2OC6A 1D0ZA 4F55A 2XAUA 2WBMA 2R7OA 2XDVA 1UELB 1G59A 1Z3YA 2LY1A 2XF7A 2RQQA 2KP6A 3H5NA 3QODA 3MKYB 4B3XA 3OYHA 3W3CA 1FMWA 4E7ZA 4FASD 2VQHA 1BR1A 1K6YA 4E7HA 4BQQA 3H5AA 2X51A 3PJRA 4BDZA 4ZYAA 2KRHA 3TL4X 3SEZA 2WAQA 4LITA 2GOXB 2K5CA 3HC7A 4B43A 2VL8A 1BR2A 4G6TB 1LDKB 3S32A 1W36C 3OYNA 4XKWA 2M3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7N A;  5CKT A;  3M8J A; 
#chains in the Genus database with same CATH topology
 3MMY B;  4E7S A;  1DPR A;  1OR7 A;  5J8C A;  1SD6 A;  1P7J A;  2UUZ A;  1S8N A;  3ISP A;  5D6F A;  4FE7 A;  4ZDO A;  1I3Q J;  4LIU A;  1BC7 C;  4ETS A;  1Q1V A;  4L5I A;  3WGI A;  5ILV A;  2M1B A;  5L3G A;  3F3X A;  4F91 B;  3KFW X;  1C0W A;  4QPO A;  1Z67 A;  5HLT A;  3LSM A;  1RC9 A;  1EH6 A;  2XGC A;  2LDU A;  2IJL A;  1IAW A;  1FOX A;  2E2J J;  4DBR A;  3GTQ J;  2HU9 A;  4RBO A;  1K4S A;  1I39 A;  1PJR A;  3CCY A;  3U9G A;  2R5Z A;  3ZQQ A;  4L9V A;  3SZT A;  3EUA A;  3VB2 A;  1ZQ3 P;  1MGT A;  3S17 J;  2VLA A;  4OIO F;  2FNA A;  1O3Q A;  4JX6 A;  5IYC J;  4C2T A;  1LUJ B;  3ABU A;  3HKZ N;  1MNM C;  2DA6 A;  3AG4 H;  1VQM I;  2W82 A;  3FX3 A;  3LFU A;  2VXD A;  1JKO C;  2UWM A;  4H0E A;  1FOY A;  2XAG A;  2KIF A;  3QPS A;  4XRS G;  4I7H A;  2XHK A;  1BJA A;  1QZZ A;  2TCT A;  2KZV A;  3VSL A;  2M7A A;  1FIP A;  3PUF A;  1J5Y A;  2CO5 A;  2R92 J;  5HNH A;  2HVR A;  2XRN A;  5HDK A;  2KQR A;  4ZZD A;  1W7P A;  4ITV A;  1WWX A;  4DBQ A;  4N4N B;  2LRE A;  3SZP A;  2HVQ A;  2NS8 A;  3NAR A;  2E7X A;  5LFA A;  2EZH A;  1AU7 A;  2QGU A;  4MTE A;  3LSK A;  1BI0 A;  1HW2 A;  3COA C;  2G0E A;  2WAQ N;  5IPA A;  1F5T A;  4RLF A;  4RAF A;  2L9S A;  5FLV A;  4B8X A;  1KZH A;  3CCQ I;  5DUI A;  3F21 A;  2V79 A;  4PZJ A;  1K78 A;  1T38 A;  1EA3 A;  3G1L A;  3R61 A;  2KMU A;  1R4N B;  2X1E A;  3I53 A;  4G94 A;  3WU2 C;  3ZMD A;  1T39 A;  3BQZ A;  1RET A;  2DAO A;  2LR8 A;  4EGZ A;  2F2E A;  5KAF C;  4XLA A;  2MGQ A;  3CCM I;  1XX5 A;  1S29 A;  2DOF A;  2WA0 A;  3FWE A;  3MVP A;  4D7M A;  5DD4 A;  1F36 A;  3FMS A;  2DDB A;  3D5L A;  4TV7 A;  2NS0 A;  2G7U A;  5J1R A;  2M45 A;  3GTJ J;  1Z91 A;  1IUF A;  1YYV A;  2AXL A;  2HFH A;  3OYD A;  3JAM K;  3ZXS A;  2BY1 A;  5LEK A;  2COB A;  1KYW A;  3RZO J;  4A93 J;  4R1H A;  5EJC A;  2JUG A;  4ASN A;  2JTV A;  5E1X A;  4A3F J;  4N9I A;  2P81 A;  2E60 A;  3S8P A;  5LBQ A;  3ZQL A;  4KIC A;  3Q0W A;  4A5M A;  1ZLJ A;  2W4S A;  3GYH X;  1ZR2 A;  1F9N A;  4Y3O A;  1DP7 P;  4IHS A;  1F4K A;  1VZ0 A;  1SAU A;  4QWQ A;  5HS9 A;  1U3E M;  2FD5 A;  2WAF A;  2STW A;  5CQG A;  5IYB J;  2CUJ A;  2VIX A;  4EM2 A;  5ICG A;  1W0U A;  3NWS A;  2VUM J;  5M3M J;  4B09 A;  1A6Q A;  4CGZ A;  4L9T A;  2F6C A;  3S93 A;  2TRT A;  4HZF A;  3QOP A;  3HGY A;  2EPF A;  4V2G A;  4I0B A;  3ZMU A;  2CW8 A;  4FQG A;  2BYV E;  4KT5 C;  2XSJ C;  3BJA A;  2LTP A;  4XIC A;  3T5X A;  1FNN A;  1V4R A;  2KRF A;  5B1B H;  3LSJ A;  4XRS A;  2BOL A;  2JWT A;  3GXO A;  5LEJ A;  1X19 A;  3HTU A;  3KP3 A;  3HHH A;  2EIL H;  3FBI B;  4ZC3 A;  4BYY A;  1XCB A;  2ZNZ A;  3SQN A;  5EG0 A;  3HL2 A;  3S1N J;  2DFF A;  3S1Q J;  2HEO A;  1X3U A;  2BEO A;  4DOZ A;  1WSU A;  2ESN A;  2QA4 I;  4A3J J;  1O3S A;  2W24 A;  1T08 B;  1B1B A;  2OBP A;  2L7K A;  2R5Y A;  3K1P A;  2A68 F;  3KX2 A;  1MDM B;  3BR0 A;  4AYB A;  4ENJ A;  4ZTJ A;  4BAY A;  1W5S A;  1HQC A;  4CZZ A;  2XAQ A;  5KCM A;  2X1C A;  2EZI A;  3TO9 A;  2Y0M A;  1I50 J;  2VQL A;  2K86 A;  2QQB A;  2HYG D;  2E1M C;  5D4S A;  1ZEL A;  5CYV A;  3JTH A;  4HPQ A;  2E7W A;  4C9Y A;  5LGN A;  1TL8 A;  3DKY A;  3RQ4 A;  3OYI A;  1HKS A;  2IGM A;  3L2R A;  3IRQ A;  6PAX A;  2EIK H;  2FBI A;  2JZY A;  2CUZ A;  3WHC A;  4AID A;  2X9D A;  1AWC A;  2KIU A;  5FFX A;  1YJW I;  4U7D A;  1IRG A;  3VDX A;  1FOK A;  1LEA A;  2LKS A;  4L0Z B;  2KRC A;  1ZLK A;  4X1E A;  2CW0 F;  3ABM H;  5DTD A;  3H9Q A;  3J7A O;  1FSE A;  4XM3 A;  2O3F A;  1JKR C;  1B72 B;  4Q47 A;  1UG2 A;  2R93 J;  1R22 A;  3VWB A;  2P5V A;  2L4A A;  2VC0 A;  5FLX K;  5FGM A;  4M3E A;  2CQN A;  3KYL A;  1V5E A;  4MEX F;  4A3G J;  2X6W A;  2OUM A;  2V9V A;  2ESH A;  3F8M A;  1UST A;  2BW3 A;  5E8G A;  1H89 C;  2HWV A;  2YR2 A;  3GLX A;  1ZGW A;  1JJ6 C;  2GM4 A;  1LQ1 A;  1YG2 A;  1OJL A;  3CDI A;  1YFH A;  3H92 A;  4JQF A;  4PCQ A;  4LG0 B;  2W48 A;  2CYY A;  1KON A;  2MLK A;  3DPT A;  4F93 B;  1SVO A;  4P55 A;  1LNW A;  1IRF A;  3RPU A;  3JR9 A;  2I8D A;  2DMT A;  3FF5 A;  2V4J C;  4BXU A;  2JSP A;  4YEL A;  2HKO A;  4MQV A;  3BTJ A;  3HRM A;  3JCU C;  3VYR B;  3G73 A;  4RS8 A;  2JVH A;  3U1K A;  2BHZ A;  2V1N A;  1UHM A;  3REO A;  3I55 I;  4A2U A;  2Y69 H;  3OS1 A;  3OYG A;  4PSW A;  3K7A J;  1XCV A;  4XQF A;  1LFU P;  2BV6 A;  4AVP A;  4PJM A;  3L1P A;  3H5R A;  4JYK A;  3TW6 A;  3HOY J;  3OSG A;  4XID A;  4PFO A;  3OYJ A;  5FFZ A;  2NYX A;  2VPR A;  3VYT B;  1YIT I;  4PJN A;  3GZ6 A;  2IGK A;  4J00 A;  2YU3 A;  5A2Q K;  1X3Z B;  1FP2 A;  3LSI A;  1B9M A;  4FX0 A;  2ZSH B;  3ASN H;  2E1N A;  3V4G A;  1A5J A;  4YFK F;  2IGN A;  1V55 H;  4XLE A;  4BKX A;  2HOE A;  3J80 Z;  5HS8 A;  5KNL A;  1S72 I;  2L4M A;  1OYI A;  4KIT B;  2PBI A;  2L7Z A;  1LDD A;  3SFZ A;  1MSF C;  1H9G A;  1LVK A;  3PFI A;  3MKZ A;  1QPI A;  1IXR C;  3BG6 A;  2M0M A;  4XN0 A;  5GAG J;  1G3S A;  2FQ4 A;  1FEX A;  4BXX J;  2DCE A;  4M9S A;  4M3G A;  3DBH B;  2DA1 A;  3BR6 A;  3K9T A;  5DCM B;  1QHH D;  3M8J A;  1OPC A;  2HGC A;  1KU2 A;  2VKD A;  2WB1 N;  1VQ6 I;  1UMQ A;  3EYY A;  3H35 A;  4I02 A;  4LLL A;  5AIP A;  4N4O B;  3OOP A;  3WTY C;  2VQC A;  2NS7 A;  4C2U A;  2TDX A;  5DM6 F;  3CDH A;  3D5S C;  1Y1W J;  3CCE I;  1DUX C;  2O0Y A;  3ZOB A;  3N05 A;  4P5O A;  1RRJ A;  1Z7U A;  2MW8 A;  3QPT A;  3MKW B;  3PO2 J;  2HR3 A;  1YQA A;  1WHU A;  2PLY A;  5CKT A;  4A6E A;  1QU3 A;  3LMM A;  1VF9 A;  2ETH A;  1P9Q C;  5J1U A;  2ZJQ F;  3J81 Z;  1BC8 C;  1PVE A;  2EFP A;  2EK5 A;  1IN6 A;  1HSJ A;  4O3M A;  1WH5 A;  5GAD J;  2K9N A;  4HQE A;  2FOK A;  2QM3 A;  3BZK A;  3K2A A;  4BGD A;  3HUG B;  2VBY A;  1RIO H;  1X1P A;  4NNJ A;  4C3H J;  1S6L A;  1XN7 A;  4ZTF A;  2YS9 A;  1NK2 P;  1FY7 A;  2GA1 A;  1JKP C;  4OAY A;  2KJB A;  5F6F A;  3BTL A;  2RRE A;  3GW2 A;  5E3M A;  3WTT C;  4ESB A;  1JUP A;  3S16 J;  1VND A;  2LF8 A;  4HLY A;  5JVT A;  4XSZ F;  1WPK A;  1BIA A;  4L9N A;  2M4G A;  3O3K A;  2QBY B;  2IA0 A;  5EZG A;  3WG7 H;  5J8F A;  2XGE A;  2ZSI B;  2ECC A;  4PUS A;  4E6K G;  1YRN B;  3N97 A;  1TWA J;  3SFI A;  5FLM J;  4I09 A;  4M3B A;  1LFB A;  3TMO A;  2CV2 A;  1HA8 A;  2ME6 A;  3K2Z A;  3OYE A;  1ZHF A;  2K3F A;  4XLF A;  3I59 B;  1HDP A;  4CYD A;  3IH3 A;  5GTI C;  1PDN C;  1VQ8 I;  3A03 A;  3FDY A;  5BMZ A;  4AIK A;  3R6S A;  2DK8 A;  1E3H A;  3DFG A;  3UNG C;  3FHN A;  3J7A Y;  2R7S A;  2BHY A;  4WXC A;  3RI4 A;  1D3Y A;  2D1H A;  3PUB A;  2IVM A;  2LY2 A;  4PSX A;  1ZK8 A;  1YW7 A;  2X85 A;  4MNU A;  1MDM A;  4M3F A;  4UXN A;  2HQN A;  4HST A;  3MD2 A;  3X2Q H;  2LSO A;  3PIP F;  1HDD C;  3TDZ C;  3VOE A;  5CJ9 A;  2PJP A;  2ZBK A;  1EKE A;  3IP4 B;  1VTN C;  3F9K A;  4GXO A;  3FXO A;  4MFD A;  5JLX A;  1TQM A;  2XV4 S;  1OCZ H;  2EB7 A;  3GTM J;  2XDV A;  1UEL B;  2EIN H;  2RQQ A;  2FMY A;  2CQ7 A;  4E7Z A;  3BP8 A;  4FAS D;  2VQH A;  2R3S A;  4AWX B;  5EEG A;  1BR1 A;  2M87 A;  3PM1 A;  2EZK A;  3TO7 A;  4L18 B;  3TOA A;  1T56 A;  3ERM A;  1TWC J;  2X51 A;  1AHD P;  1TWH J;  2STT A;  2MH9 A;  4LIT A;  1H9T A;  2QZ8 A;  4B43 A;  5EDN A;  4Y52 J;  3G1O A;  5FJ8 J;  1KQ8 A;  3RIR A;  3S32 A;  1W36 C;  2PFB A;  2MD5 A;  3JRH A;  4LLN A;  2NVX J;  5CVJ A;  3HGG A;  1NG7 A;  3S1R J;  4P9F A;  4IX7 A;  1W7P D;  3RKQ A;  2LK2 A;  4QLC U;  4EVI A;  5IP7 J;  1M1E B;  1ZYR F;  3A1Y A;  3ZN0 A;  2X4H A;  4U0W A;  3V8L A;  4E7L A;  2WV0 A;  4PDK A;  2A69 F;  2W57 A;  3QYB A;  2LKX A;  4KYW A;  1D1A A;  4A3K J;  2CQK A;  1BW5 A;  2PN6 A;  4DYR A;  2RGV A;  2G7H A;  1ULY A;  1I6H J;  4B48 A;  3HTS B;  4UB8 C;  3WTW C;  2GIV A;  3IH4 A;  1ERD A;  1IRZ A;  2ELJ A;  2A05 A;  1JUS A;  3GX4 X;  4HA8 A;  2QSF X;  3EET A;  3O2P E;  1J09 A;  1JTX A;  4GGG A;  3GTG J;  2COM A;  1OCO H;  1HW1 A;  2M5W A;  2HZD A;  3ZMZ A;  3BTI A;  4IQ4 A;  2NOJ B;  2Z3Y A;  2LBF B;  1IW7 F;  1X1B A;  3A0H C;  3KZZ A;  1YW8 A;  3PO3 J;  5CLS A;  2UXX A;  1USS A;  1VQP I;  4HF1 A;  3JRB A;  3CP2 A;  3VEP A;  2Z5U A;  3ERE D;  4XKB A;  3BG5 A;  3G1M A;  1TBX A;  4ZH4 F;  1MH3 A;  3G71 I;  5HS7 A;  2VPL A;  2IA2 A;  2KZG A;  3ABT A;  2JA8 J;  1IG7 A;  4I2O A;  2Y2Z A;  2P4W A;  4X0G A;  1P4W A;  2IAI A;  2AQE A;  2QCO A;  4GDF A;  4LLG F;  4DJA A;  1D1B A;  1CQT A;  1WJB A;  4B4C A;  3QRF F;  3HOX J;  2AQF A;  3KPH A;  2DOD A;  1ETX A;  2FUG 2;  5FLX Z;  4D7N A;  1LB2 A;  4Y17 A;  3DPU A;  4RAG A;  2ZXJ A;  3OL4 A;  1X4P A;  3WTX C;  1QNT A;  3HOT A;  3I54 A;  1GV2 A;  3RKY A;  1JGG A;  1FX7 A;  2W25 A;  2VON A;  1KQ9 A;  5DCM A;  2XGD A;  3DEE A;  4Z6Y A;  3KYD B;  2KFD A;  2H94 A;  2BVM A;  4HOB A;  2R5Y B;  1YS6 A;  3QP5 A;  3E5Q A;  4BU2 A;  2FX0 A;  2F4M B;  3TED A;  4LD5 A;  2JK3 A;  1Z77 A;  2E2I J;  2PX9 A;  3CJR B;  1QZE A;  1TTY A;  4HQM A;  4PJJ A;  4XN3 A;  1W5T A;  3LOC A;  3P5J A;  2EV6 A;  4AU7 A;  3GTL J;  4F3Q A;  2R7Q A;  2NOG A;  1N75 A;  2E1O A;  3RYP A;  4HDU A;  2R7W A;  4IHV A;  2X6O A;  3KIO A;  2XAF A;  1E17 A;  2QEX I;  4BJ5 C;  4A0Y A;  5F64 A;  2JRT A;  3BLY A;  2IXS A;  1Y1V J;  3CD6 I;  3PSI A;  3C2H A;  3GBG A;  2IGO A;  3G3Z A;  4CH7 A;  2J5O A;  5EYR A;  3QPL A;  3BOQ A;  2BY2 A;  2F5E A;  2LP0 A;  2PEX A;  1OLT A;  4BQN A;  1OYW A;  5L3B A;  3VYS B;  4ZJZ A;  2L2O A;  2Y48 A;  3S14 J;  2N8G A;  2M8G X;  2W00 A;  3J80 K;  1AA7 A;  2VXZ A;  2GXA A;  4EEF G;  5HOO A;  2UZK A;  1WJC A;  5M5Y J;  2R7D A;  1SFX A;  4ZYG A;  5A2Q Z;  2CWE A;  2EWN A;  1WVR A;  3ZQF A;  1E0E A;  2L5Q A;  2B7E A;  2LOO A;  3B6C A;  1OFC X;  2R7U A;  2BW3 B;  3DLA A;  3DEU A;  2QBY A;  2DLL A;  2O9L A;  3CZ6 A;  3BR5 A;  3C2G A;  1ZR4 A;  1YS7 A;  3NRV A;  2VE9 A;  1YRN A;  4DZP A;  1MBF A;  1BI2 A;  4UHT A;  1XPX A;  1MBH A;  2X48 A;  4FIS A;  1STZ A;  1XGS A;  4EMS A;  3I59 A;  4P9U A;  4Q4Z F;  2CV1 A;  2RC4 A;  5IOY A;  5IOZ A;  1BR4 A;  4B1R A;  3GFJ A;  4LJZ F;  3ABL H;  3RYR A;  2NRA C;  3HOV J;  3GEZ A;  3MZY A;  4UV8 A;  2DA7 A;  2O5R A;  1U9N A;  4A3L J;  1ETV A;  2EA2 A;  5J3L A;  1FLI A;  2DFH A;  3DQV C;  2QQ8 A;  3ROU A;  3J81 K;  2V6C A;  3MN2 A;  3CTA A;  3FKJ A;  4RMN A;  3R60 A;  4E4H A;  5LHG A;  3WTZ A;  1Y39 A;  4II2 A;  4M9X A;  1IJW C;  1V5G A;  2BVL A;  2H6C A;  3I71 A;  4CCL A;  3RSN A;  1RKT A;  1TLH B;  3RPU D;  3BZC A;  3S15 J;  2P8T A;  3MAJ A;  1D8K A;  2WV1 A;  4PGH A;  2DXI A;  1X2M A;  2IS1 A;  3H0G J;  5C44 J;  4C3J J;  1BI1 A;  4JP0 A;  1A04 A;  5D5V B;  2KDZ A;  2WAD A;  3V7R A;  2KIQ A;  2CUE A;  4UY8 I;  2P5K A;  2XB5 A;  2QWW A;  1MNE A;  2DA5 A;  3JSP A;  3BCA A;  1MZB A;  5GAE J;  1KU3 A;  5IP6 A;  1HKQ A;  2WC2 A;  5H6Q A;  1MBJ A;  1WFX A;  3LA2 A;  5LHI A;  1WI3 A;  2RAE A;  1X2N A;  1EH7 A;  3H9G A;  2O03 A;  2VKH A;  3FMQ A;  1TNS A;  4G8X A;  3LAP A;  4MTD A;  2EH3 A;  3L2W A;  1G8X A;  4E7J A;  2L01 A;  3GZ5 A;  2MYS A;  3M7G A;  1CGP A;  5D5X B;  2B9S A;  4IF4 A;  3KLN A;  1UFM A;  2BXY A;  3KE2 A;  3G2B A;  1NH3 A;  1TT0 A;  4IRG A;  3OYK A;  2DT5 A;  3MZ8 A;  1KA8 A;  1BM9 A;  2OZ6 A;  2BGC A;  3CQZ J;  3I3L A;  5DV5 A;  3JRA A;  1FYL A;  1P4X A;  3FM3 A;  3OV8 A;  2HI3 A;  4GRI A;  3B02 A;  5E1Z B;  4IOA F;  5JHU A;  1LE8 B;  5D5W B;  1J7K A;  4Q48 A;  4UVB A;  3A01 B;  3IWZ A;  4FTH A;  2V1U A;  1QQI A;  5JR3 A;  3BR1 A;  2O8X A;  4NBQ A;  3QP6 A;  1R7J A;  2LFB A;  2VC1 A;  5CVU A;  1Y6I A;  2R7F A;  1N77 A;  3LSH A;  2LBF A;  4XNF A;  5E3L A;  1GDT A;  2DQR A;  2ECB A;  4U7B A;  4P1W A;  2P5L C;  1ZAO A;  1WJE A;  4NC8 A;  1WKM A;  2VJJ A;  3PNT A;  3WE3 A;  5LRS A;  2QSH X;  2BE5 F;  1YJ9 I;  1S7E A;  2L9R A;  4CUG A;  2ZFU A;  3EPZ A;  4KIB A;  2JT1 A;  1XMX A;  2E1M B;  3BR2 A;  5BQT A;  1KU9 A;  1OCT C;  1U8R A;  1T95 A;  1R1V A;  2FBH A;  3ZCO A;  1R36 A;  2B0L A;  5E79 C;  1ZGA A;  1AOY A;  3EUH C;  2FA5 A;  2F5D A;  3CO7 C;  5B1A H;  3W6J B;  1B4A A;  1O57 A;  4CHU A;  2DTZ A;  1R58 A;  4LK1 F;  1ZAR A;  3HRT A;  1FBU A;  4EJW A;  1D0X A;  4XKV A;  3FXL A;  3JRG A;  5DUK A;  4IO9 F;  3GFM A;  3OIP A;  4CDG A;  1H8A C;  2CFX A;  4HV6 A;  5FD5 A;  4KA4 A;  3NAU A;  1QVT A;  2OAZ A;  2ZME C;  4JOM A;  4G9Y A;  4YRV A;  5F1R A;  2DO7 A;  3ESW B;  1BOA A;  2DDA A;  2OPT A;  1MND A;  4M9Z A;  4NDL A;  2D45 A;  3DKW A;  1POG A;  2E1C A;  3FKI J;  3IKT A;  4K2E A;  5HVQ C;  3TO6 A;  2GA2 A;  1RKW A;  1UG0 A;  2CSO A;  4CZC A;  5E8I A;  1QO0 D;  1SFK A;  4C3I J;  1S5L C;  5K7Z A;  2QQ9 A;  3IV5 A;  1SD7 A;  1IXS B;  5J4Y A;  1IV8 A;  3OR1 C;  5F04 A;  4QPQ A;  2ID6 A;  2RV8 A;  2DJI A;  3RKW A;  3FIW A;  2IBD A;  1XTA A;  3Q9V A;  4ZZL A;  1U8B A;  4QTR A;  1R5H A;  1TWG J;  3MWM A;  4OWR B;  1IV6 A;  3KLO A;  2CG4 A;  3C3W A;  1FTT A;  5L3E A;  1U6G A;  4BBS J;  4M71 A;  1ZKG A;  4XR6 A;  2M9H A;  2A07 F;  2PMZ N;  3DBR B;  3H3U A;  4GYI A;  1VQO I;  1VQ7 I;  2IPQ X;  3ECH A;  4DYC A;  3NEU A;  4BHC A;  5C4J J;  5CQE A;  1T0F C;  2QSG X;  1MMG A;  1MJB A;  2DQL A;  4QSH A;  2V9K A;  3HXL A;  3K4J A;  4LGW A;  5F0C A;  4L0Y B;  3F72 A;  1NG6 A;  3IRR A;  2YSR A;  3B73 A;  5F27 A;  2KIM A;  3E6M A;  3SDG A;  1XSV A;  1GV5 A;  2IEK A;  2ZXI A;  1HC8 A;  3OYL A;  5GTH C;  3ML6 A;  3R4K A;  3IAM 2;  2ELH A;  1R71 A;  2Q8K A;  1L3L A;  2NVQ J;  4WWC A;  2BY0 A;  3PIO F;  3T8T A;  3ZP5 A;  4B44 A;  4DZJ A;  2GXG A;  1V5F A;  1PUF B;  4IKF A;  2DK5 A;  3HKZ A;  2CUF A;  1EV7 A;  3LST A;  2K7L A;  5JHF A;  4AD9 A;  1UB9 A;  2Y9Y A;  4IZZ A;  1K7A A;  5E1W A;  4Y33 A;  1LEB A;  5IP9 J;  5D8K B;  2Z16 A;  1LKX A;  2JMW A;  2DMP A;  4BUP A;  4Y4R A;  1YJN I;  2XAS A;  5DM7 F;  1ZRD A;  1S7O A;  3M07 A;  3AL0 C;  1RES A;  1S3J A;  1AKH A;  3P9I A;  2WBM A;  3KP5 A;  2CRG A;  1GXP A;  4RDU A;  1JT6 A;  2LY1 A;  4GYG A;  2KP6 A;  3H5N A;  4HW0 A;  3MKY B;  3OYH A;  1PUE E;  3W3C A;  1FMW A;  1OKR A;  3BG9 A;  4LOC A;  3CO6 C;  1QA6 A;  1WGX A;  1J75 A;  3ULQ B;  1K6Y A;  1L0O C;  1A35 A;  5B66 C;  3CMA I;  1FWZ A;  3G4S I;  3IC7 A;  4ZYA A;  2KRH A;  4RAZ A;  3TL4 X;  3CC4 I;  2WAQ A;  3PQJ A;  4ESF A;  2GOX B;  2VL8 A;  2DA3 A;  3K69 A;  1SFO J;  1Z0X A;  5J6X A;  5GPA A;  3JTG A;  2MLG A;  5D8L B;  2V1X A;  2ZKZ A;  1H0M A;  3OS2 A;  1JT0 A;  2M3A A;  1HKT A;  1SC7 A;  3FXU A;  4ESJ A;  3EYI A;  2QQA A;  5DCF A;  2DPU A;  2MD0 A;  3I58 A;  2GXB A;  1BA5 A;  2V6E A;  3TP0 A;  2CFO A;  5ICF A;  3I64 A;  1X4O A;  3L9F A;  4PJL A;  4BAC A;  1RI7 A;  1SVL A;  3CMM A;  3BWG A;  2LYC A;  4XMY A;  1WJF A;  3M1C A;  5ILS A;  1T98 A;  4U0Y A;  2DT7 B;  4HF2 A;  1DGW Y;  4HYE A;  3BRO A;  4IHT A;  2DN0 A;  3E5U A;  3GCM A;  2PG4 A;  4ON0 A;  1JTY A;  2EIJ H;  2M34 A;  1LE8 A;  5CVR A;  1OCP A;  2JA6 J;  5JVG F;  1O4X A;  3A01 A;  2GOM A;  3CCV I;  4G7H F;  1U2W A;  2EJR A;  1DPU A;  3K4C A;  1WCM J;  1KU7 A;  3CCJ I;  1R1U A;  3L2Q A;  2WWY A;  5GP9 A;  2E36 A;  1WRJ A;  3A2K A;  3HOW J;  2EBI A;  1MIJ A;  2O8K A;  1J2X A;  1FYM A;  2MSY A;  2MG4 A;  4F92 B;  3I0T A;  2XF5 A;  3VPR A;  2H09 A;  4ABZ A;  2HNH A;  3KET A;  3OIQ A;  3DU5 A;  2CV0 A;  2ISY A;  2L3D A;  1ODD A;  2P0W A;  2MBF A;  4KUM A;  3T8R A;  3M3Y J;  2L02 A;  3V8J A;  4RB0 A;  3WGH A;  3EUK L;  1MW7 A;  4CXF A;  1QRY A;  2Q1Z B;  3ABK H;  4FE4 A;  9ANT A;  3ZQH A;  1YO5 C;  1R6R A;  1N25 A;  2XAJ A;  1ZRC A;  3HJE A;  2GIZ A;  5F1J A;  2ZC2 A;  1VQ4 I;  4E7I A;  4H4K C;  3ZMS A;  1ETW A;  4A3D J;  4C2M J;  4DQ2 A;  2Z33 A;  3G6E I;  5F0H A;  2VJ5 A;  3MEX A;  3BY6 A;  2OA4 A;  2M4K A;  5F0F A;  1H88 C;  2EQR A;  3WTS C;  4XOP A;  2VBZ A;  4S05 A;  3BG7 A;  4BHP A;  1JGS A;  2VOD A;  2XB0 X;  3N4M A;  1MBE A;  3LA7 A;  4CCO A;  1IDY A;  2A5Y B;  2LVS A;  3P7N A;  3HOU J;  3LSP A;  1QGP A;  5J1Y A;  5DS9 A;  5HOD A;  2ZJ2 A;  2LG4 A;  1DU0 A;  5KAI C;  2XKO A;  4D5C A;  1MMN A;  2L0K A;  3O8G A;  5CVV A;  2IS4 A;  2JA2 A;  2E35 A;  2HYJ A;  3MKL A;  5LLQ A;  3LNQ A;  3QYF A;  3CF2 A;  3GLL A;  1W36 D;  4AM3 A;  1LPQ A;  1MMS A;  4QIW N;  3K4M A;  3DP7 A;  1ZGJ A;  1U9O A;  5DDG A;  4HDV A;  1YE9 A;  2EIM H;  4YEJ A;  3WU0 A;  1JE8 A;  3CES A;  2LKP A;  2LLK A;  2FEZ A;  4RB1 A;  3GME A;  3ONQ A;  3M9A A;  4B47 A;  4WXD A;  3HSF A;  2JJ7 A;  2X1D A;  1XGO A;  2FBK A;  1U5T C;  4I01 A;  3E6D A;  4GO1 A;  3BZ6 A;  4BL0 B;  3KEQ A;  1Q1H A;  1G3Y A;  4XSX F;  1GVJ A;  3AG3 H;  2WAE A;  1P92 A;  1YW9 A;  2WTE A;  2XF6 A;  1OR7 C;  5FD6 A;  3DCF A;  1ETQ A;  4XK4 A;  1QZY A;  3W6K B;  1O3R A;  3RZD J;  3AG1 H;  3DU6 A;  2OJE D;  2HTS A;  4E70 A;  3OYA A;  1I27 A;  1XG1 A;  4KDP A;  2X6X A;  3ZQG A;  2XIG A;  2K4B A;  3HBL A;  2DU9 A;  1ZH5 A;  4R8H A;  1V3F A;  2YX4 A;  2YU9 J;  5AON A;  4U0V A;  3BC8 A;  2KPM A;  2CQQ A;  3VFZ A;  2NVU B;  4M72 A;  5HLI A;  4C30 A;  3HIF A;  3SJM A;  1IDZ A;  2WY7 Q;  1RR8 C;  3I4M J;  1KQ0 A;  3TP3 A;  2ZCW A;  2EFO A;  4XLC A;  1P4A A;  3IH2 A;  4P96 A;  4EJO A;  2FSW A;  2DMU A;  1JHF A;  5K5Q A;  1GVD A;  4DNC A;  4LIV A;  2DA4 A;  1ON1 A;  2CH0 A;  3SZG A;  1PUF A;  3HSR A;  3F8F A;  5LHH A;  5ICC A;  2Z2S B;  4RB3 C;  1VI0 A;  2PJR B;  1KGS A;  4XBF A;  3U1D A;  2CGP A;  3FK6 A;  3E1S A;  2EA4 A;  4BY7 J;  3FHZ A;  2OCE A;  1K4T A;  3IKV A;  3GZN B;  3ASO H;  3L7W A;  1DGR M;  4A0X A;  5IT9 K;  1REP C;  3JRC A;  3F6V A;  2AXT C;  1OCR H;  4EV0 A;  3WTU C;  2FNP A;  4L9J A;  4CO8 A;  1IUY A;  1X1C A;  3O6B B;  4Q5S F;  2ME0 A;  4PK4 A;  2DW4 A;  4WXH A;  2HZT A;  4IPA A;  5E3N A;  1N78 A;  1NHA A;  3AFH A;  1BL0 A;  5FKN A;  4KT6 A;  3FXM A;  3CUQ C;  3JRI A;  4UUV A;  2V9P A;  4MHG A;  3F6O A;  3K6G A;  2DA2 A;  2R7X A;  5M3F J;  3LL7 A;  4BQA A;  1PYV A;  2FE3 A;  1WJ5 A;  2EFQ A;  5KK1 A;  3FXK A;  5KVR A;  2HQ5 A;  4JX4 A;  1GHC A;  2MAB A;  1ITY A;  2A6E F;  4ENN A;  3BR3 A;  2HKX A;  2MFZ A;  1MMD A;  2DI3 A;  2K9S A;  2R0Q C;  3PFY A;  3KZI C;  1EF4 A;  2XAH A;  4UUS B;  2HXO A;  3RTR A;  3OS0 A;  3OL3 A;  2VKE A;  1SMT A;  3DTI A;  2WB1 A;  1HBX G;  2LNB A;  1BI3 A;  2VAS A;  2GLO A;  3FK7 A;  1TT5 B;  5D6E A;  3DTE A;  3K1M A;  1Z9C A;  1ENH A;  1YTY A;  4MFE A;  5H2F C;  1GLN A;  3FXR A;  4MGR A;  2VE8 A;  5BPD A;  1FSH A;  1UJ8 A;  4MIM A;  1Y56 A;  3KCC A;  3BJO A;  4ZYH A;  1FZP B;  2CW7 A;  3PL8 A;  4V2F A;  5FRO A;  3OY9 A;  2IS2 A;  2PMH A;  2HDW A;  5ILU A;  2LC2 A;  2WY8 Q;  1MBG A;  4S0H B;  2QEN A;  4HX8 A;  3H9J A;  4EQQ A;  3WTV C;  4A3M J;  3L2V A;  1TC3 C;  1MKM A;  4XRF A;  4NHJ A;  1O7F A;  3KP2 A;  4KJZ A;  4MEY F;  4AVZ A;  3EDP A;  4AYB N;  5FKM A;  4NC6 A;  2VI6 A;  5J40 A;  2PMU A;  1D1C A;  3Q0V A;  1HCR A;  4ANJ A;  2ZXH A;  5E17 F;  5FKK A;  5B3S H;  2KT0 A;  4A3B J;  2D2W A;  1X1D A;  2HPM A;  1HST A;  4BEH B;  3SYT A;  3K70 C;  2HOT A;  4UV9 A;  2NAZ A;  4HF0 A;  2JVG A;  2X6Y A;  2XGX A;  2HQA A;  4MQ9 F;  4G7Z F;  3FXQ A;  1FOW A;  3CJT B;  4ENM A;  2R7V A;  1TW3 A;  2DPD A;  3DKX A;  2HXI A;  2Z1D A;  3ZN1 A;  3S2D J;  3LQQ A;  3B6A A;  1BJZ A;  3F8B A;  1UHS A;  3W2V A;  3I56 I;  1NTC A;  3I9V 2;  2DYS H;  5KHD A;  1YLF A;  3K4K A;  2GWR A;  1Y0U A;  4XOT A;  2G9W A;  3HRS A;  4M74 A;  5E3O A;  1R49 A;  3U21 A;  4Y15 A;  1APL C;  3E6B A;  2J5P A;  2E71 A;  5GAH J;  2KLO A;  4UUT A;  2VJ4 A;  1ZTR A;  3KP6 A;  2BZT A;  2MC3 A;  2YX7 A;  2F48 A;  3TW7 A;  2V7F A;  3PSF A;  5BPI A;  3KEY A;  4HNU A;  1R1T A;  2CQX A;  3OYM A;  1TNT A;  1HOM A;  2QKM B;  3DV8 A;  3H3Z A;  4IHW A;  2P6T A;  1IN4 A;  3CCS I;  3E97 A;  4BH9 A;  4ZDP A;  3HPH A;  1ETY A;  1D5Y A;  3HEF A;  5EZH A;  2F4I A;  1G4D A;  4RLQ A;  1AKH B;  1XD7 A;  4A3C J;  3K10 A;  4I76 A;  1XSD A;  3E7L A;  1GT0 C;  3LWF A;  2V26 A;  2IRF G;  2JA7 J;  3HPG A;  1K79 A;  1X3W B;  4LG3 A;  3RJP A;  4D5F A;  2YPR A;  3TGN A;  2VOP A;  1RNL A;  1W5C C;  3HG9 A;  4WK8 F;  4RM3 A;  4BE1 A;  2DMN A;  1IC8 A;  2O61 A;  3FMR A;  1FP1 D;  3CLO A;  4IL6 C;  1W4M A;  5LGT A;  4CA0 A;  1T6S A;  1YIJ I;  3DWL E;  2EFN A;  1X1A A;  2KJC A;  3D5R C;  5JI6 A;  3UKG A;  3FZV A;  1A36 A;  2BY3 A;  2HYF A;  3GF2 A;  4MLO A;  2LMD A;  5ERI A;  1JJ8 C;  3FIS A;  5CVI A;  1J0R A;  2RNJ A;  3FXJ A;  3SHF A;  3L2U A;  2P7V B;  2W1O A;  2Y0S A;  4G6Q A;  3DBL B;  2MC4 A;  3K4N A;  4HEA 2;  1EH8 A;  2KL4 A;  3I4N J;  3IWF A;  2FQ3 A;  2XPU A;  3CJN A;  3OYB A;  2P6S A;  5LGU A;  1E3P A;  5L3F A;  1WZ2 A;  3F8N A;  2H27 A;  4KMU X;  1U0J A;  3CUQ A;  4IRH A;  1PP7 U;  3JSO A;  1ACI A;  2VB6 A;  4CYC B;  3RKX A;  5TRD A;  3M8F A;  2HOA A;  2QKL B;  2AHQ A;  1QVU A;  3CDL A;  4A3E J;  1DDN A;  2IS6 A;  5FKL A;  3L00 A;  1RUN A;  1HW5 A;  4YFX F;  2MA3 A;  1VFC A;  3DF8 A;  2BBY A;  2DBB A;  4O5V A;  1I3A A;  4IQJ A;  1G3T A;  4E7K A;  2OTL I;  2ZME B;  3V7C A;  4IXA A;  2W84 A;  1ZRF A;  4G6D A;  3KEO A;  2H1K A;  2VT3 A;  2A5W A;  2RNG A;  2PQ8 A;  2DFE A;  3IAS 2;  1MSE C;  3K4B A;  2Y9Z A;  1F1Z A;  1B59 A;  1VQ9 I;  3H1C A;  2Z9O A;  2PJR A;  1A6I A;  4RAY A;  1HF0 A;  4J01 A;  1GXQ A;  3GUD A;  1TP4 A;  2OU2 A;  4LK0 F;  2A6T A;  3WE2 A;  1WJD A;  2DOA A;  5EF6 A;  3A4C A;  5HDN A;  2L54 A;  1R5I D;  1D0Z A;  1OYY A;  1UZC A;  2R7O A;  1P2F A;  1G59 A;  1Z3Y A;  4UNO A;  2XF7 A;  5IT3 A;  1LVA A;  4B3X A;  2XSD C;  2ZJP F;  1HXD A;  3VOD A;  2M8E A;  1B9N A;  3V7S A;  3C1D A;  4AIJ A;  3GVA A;  1XGN A;  4A12 A;  2JUC A;  5DD8 A;  4XRM A;  2L9V A;  4Y7N J;  4BQQ A;  3LAJ A;  1QPM A;  1OCC H;  4HLX A;  5BOX A;  3SEZ A;  1I1S A;  3C2B A;  1BIB A;  4YFN F;  2KIS A;  4UVA A;  2JA5 J;  4B3A A;  4GFB A;  2B63 J;  1LDK B;  4X6A J;  3GO5 A;  2EV5 A;  3S1M J;  1ETK A;  4OIN F;  4D0P A;  4LB5 A;  2O7O A;  3OYN A;  2ZB9 A;  3KP4 A;  2P7C B;  2R7T A;  2LRD A;  4HSR A;  2X0L A;  4NQW A;  3D1N I;  2UV1 A;  3BDD A;  5FO5 A;  3CMY A;  4A5N A;  4UUS A;  3GTO J;  3BT9 A;  3Q9S A;  4ZYE A;  4I99 C;  4BE2 A;  2HOS A;  3P9C A;  3IUO A;  2LD5 A;  4A3I J;  2R7Z J;  3MZH A;  3RDI A;  1G3W A;  3BTC A;  2ADU A;  4W97 A;  2OD5 A;  2Y30 A;  2F5C A;  3GFL A;  3UR3 C;  3K4L A;  3SEQ A;  3QQA A;  3CC7 I;  3ZGK A;  2C6Y A;  2Q2E A;  3BPX A;  1FYK A;  1OIS A;  3CME I;  2ZJR F;  2R4G A;  4KMF A;  1IRX A;  1FTZ A;  1WQ2 A;  5C4X J;  2EFW A;  3ZQC A;  4S04 A;  4RGX A;  4BQO A;  1V54 H;  2HS5 A;  3S3M A;  3CP8 A;  5GPC A;  4F52 A;  2AO9 A;  3F22 A;  2I5U A;  3HOS A;  2E2H J;  4HAM A;  3QOE A;  2IA1 A;  1DQU A;  3WHB A;  3ECO A;  4RGS A;  2VJI A;  3QU3 A;  3KZY A;  1UCR A;  5J4V A;  1FBS A;  2FRH A;  1SD4 A;  4KIG A;  1TWF J;  4PGG A;  1TZL A;  5IT9 Z;  2VKV A;  4KN7 X;  4BEH A;  3PNY A;  2Y31 A;  4RM2 A;  4IEJ A;  3O8H A;  4CSW A;  4HNT A;  4I6Z A;  3AL0 B;  3A0B C;  2K9M A;  3GTK J;  4M6Y A;  4BJT A;  1EJ9 A;  1SAN A;  4HG2 A;  1FJL A;  4BY1 J;  1XC5 A;  3HRU A;  5L3C A;  5D5U B;  3WG9 A;  2QLZ A;  1J9I A;  3K1N A;  1BN5 A;  4U87 A;  2ZXW H;  1MJ9 A;  2CJJ A;  4IHX A;  2KHM A;  4XLH A;  1JHH A;  3DEW A;  4HRI A;  1IZ1 A;  2Q0O A;  3H0D A;  4LFU A;  4XON A;  2D1V A;  3S3O A;  3WGG A;  1IN7 A;  4DIQ A;  2NVT J;  4YIF A;  1X58 A;  1MH4 A;  4EM0 B;  3OYF A;  4D1Q A;  4AC0 A;  1I6X A;  4WCG A;  3BQY A;  4D9J A;  4L5J A;  1MBK A;  5K1Y A;  4EAT A;  3HYI A;  4BXF A;  2UXN A;  2IP2 A;  2RN7 A;  3CCL I;  1B6A A;  4HV5 A;  2K02 A;  3VYU B;  1VQK I;  1FC3 A;  1MMA A;  1YOV B;  4OU0 A;  4BBR J;  1Y8Q B;  4F7Z A;  3IL2 A;  1Z1D A;  4BHB A;  4O6J A;  3DTK A;  4II3 A;  3W2A A;  3RPQ A;  1HLV A;  3F23 A;  5EEH A;  5F08 A;  1T8I A;  4R79 A;  3QPH A;  4OOI A;  5FRN A;  4OMZ A;  1B8I B;  2KKO A;  2H1L A;  2M7B A;  1IF1 A;  4V19 K;  5EEA A;  4DW6 A;  1FPQ A;  3JRD A;  2OTJ I;  2ZO4 A;  1YI2 I;  3JRE A;  2V1D A;  1VQN I;  5E18 F;  2DOE A;  4YII A;  3FM5 A;  3S3N A;  5M5X J;  4XKC A;  3D0S A;  1T2K A;  1JKQ C;  2VOO A;  5HLG A;  2R7R A;  2JPC A;  3L2C A;  2EZL A;  3BJ6 A;  3F8C A;  2XRO A;  4XLN F;  1UAA A;  1BOB A;  5HLH A;  2K3P A;  4A6D A;  4WX9 A;  3J7Y J;  3A02 A;  4L5E A;  4MO7 A;  3T1B A;  4DGW B;  3EUH A;  5EGO B;  3SXY A;  4CYC A;  4M6V A;  3CLQ A;  4EM1 A;  4ENK A;  1ORK A;  4BE0 A;  2LF7 A;  2RVC A;  3U2R A;  3V42 A;  2IW5 A;  2D5V A;  3HM5 A;  1R9T J;  3LSR A;  1O3T A;  2OZU A;  2XC7 A;  1Z6R A;  3S2W A;  4A0Z A;  2DYR H;  2CS3 A;  3HSE A;  1FT9 A;  5K5R A;  2H6B A;  2HQR A;  2ZME A;  3Q3S A;  4Z2Y A;  1XMA A;  1DU6 A;  2A6H F;  2L7F P;  2E5N A;  2JPB A;  2FU4 A;  2Y75 A;  1W0T A;  3HOZ J;  1IGN A;  3PQK A;  4U88 A;  1LJ9 A;  2NNY A;  5D4R A;  2E34 A;  1ZG3 A;  1RZ4 A;  3I4P A;  3SDB A;  4IOC F;  1Z05 A;  3PNV A;  4EJT A;  1D0Y A;  4N9H A;  4M3D A;  5DEQ A;  1JUM A;  2E19 A;  3ELK A;  3DLL F;  2CU7 A;  2OV7 A;  3E6C C;  3CCR I;  1K61 A;  2GZW A;  4BJ6 C;  4UB6 C;  1WJA A;  3R0A A;  3M8E A;  5K7F A;  1YX5 A;  2LH9 A;  3ZRG A;  4I98 B;  3CJQ B;  4CCN A;  5K7H A;  2F5F A;  3AKZ A;  3BCB A;  3R0J A;  1K83 J;  1OQY A;  1P6R A;  1U5T B;  2JQ7 A;  4ZDL A;  2H8W A;  5ICE A;  3CC2 I;  3AAF A;  4NC7 A;  5K5O A;  5FB2 A;  2K9Q A;  1Z21 A;  4FT8 A;  2FXA A;  3BPV A;  2XPW A;  2L9N A;  5ED4 A;  1CF7 B;  2XUB A;  3OWT A;  3OMY A;  3F0C A;  2K9L A;  4RB2 C;  3TKY A;  2A61 A;  5BNG A;  3M1E A;  2K4J A;  4CCK A;  2AS5 F;  5TIS C;  5LD2 C;  2NXN B;  4IHY A;  3DPL C;  3TDU C;  3HDD A;  2RKH A;  4CIC A;  1G6N A;  3JW4 A;  4PFP A;  1T0F A;  4AIH A;  2QF7 A;  5AIQ A;  1BBY A;  1TQI A;  3LA3 A;  1Z6T A;  3VSK A;  3JRF A;  3QAH A;  2K40 A;  5H6R A;  5HDG A;  3OOU A;  3ZR8 X;  4KFC A;  5FRM A;  1JI8 A;  2ZFW A;  5CPR B;  1A31 A;  1MJA A;  2W85 A;  3GFI A;  1G2H A;  3OR2 C;  2R5Z B;  2BXZ A;  1RUO A;  3CF5 F;  5B5E C;  2F4O B;  2ZNY A;  1XB4 A;  2DMQ A;  1J59 A;  3Q5F A;  2OQG A;  2KDO A;  3ZMV A;  4IVN A;  2YUS A;  2ISZ A;  4XLP F;  4GCV A;  4LB6 B;  4JX5 A;  1XDU A;  3C7J A;  3JAM Z;  4I0A A;  4G7O F;  1ON2 A;  2JSC A;  2ICW G;  5DYM A;  2ACJ A;  1BW6 A;  4AUX A;  2VBX A;  2PMZ A;  2I10 A;  1Z3X A;  4EGY A;  1K6O A;  1ZG5 A;  2M0C A;  4KIF A;  3E5X A;  4ZYD A;  5L3D A;  2ELK A;  2O6G E;  3QU6 A;  3I5U A;  5J47 A;  1W7P B;  2OCC H;  1LFP A;  5JLW A;  1PP8 F;  3J7Z I;  2PI0 A;  2VBW A;  2XPV A;  3CCU I;  1WI9 A;  2JN6 A;  5TJJ A;  2H8R A;  1E2X A;  2XKP A;  4EJU A;  2RDP A;  5E20 A;  1B72 A;  4CCM A;  2OF7 A;  4A69 C;  3CUQ B;  2HVS A;  4Y13 A;  1K78 B;  4OAZ A;  3TBI A;  1SMY F;  1SVM A;  1ZG1 A;  3GTP J;  2FOW A;  4KNY A;  2LY9 A;  1YIO A;  3ZQ7 A;  4NB5 A;  2M30 A;  2VT2 A;  2Y0S N;  1SAX A;  1FIA A;  3M4O J;  5M5W J;  1UHW A;  5HNF A;  1SEU A;  4WF2 A;  1FBQ A;  4LMY A;  1TW2 A;  4NUB A;  3H3V K;  3NWT A;  4LG0 A;  3K0L A;  3Q0U A;  1IO2 A;  1YHQ I;  5JFR A;  1TQP A;  4BNC A;  1R23 A;  2W7N A;  1XGM A;  3TQN A;  1IXC A;  3ZMT A;  5IYD J;  1GUU A;  2FJ1 A;  3OSF A;  1D8J A;  2OQR A;  4N0B A;  3C18 A;  2K27 A;  1S9H A;  3HZJ A;  2XRL A;  1WH7 A;  4JBA A;  3T0Y A;  2FF4 A;  1FMV A;  2NNN A;  3KYC B;  1E3O C;  3HB9 A;  3QYE A;  1D5V A;  4KIS A;  4FHT A;  4IJA A;  4BS9 A;  2E5Z A;  3V8K A;  4W1U A;  3W2W A;  2HDC A;  1B8I A;  3IHU A;  1SFE A;  2DTR A;  2RQP A;  1IN5 A;  3HHG A;  3W6V A;  3FBN B;  5BS6 A;  2A3S A;  3BG3 A;  2QUF A;  2QYO A;  4J19 A;  2DT6 A;  2FML A;  3OYC A;  3MQ0 A;  1KYZ A;  1XS9 A;  3CUO A;  1JXS A;  3OIO A;  4XL9 A;  1S7A A;  1Y8R B;  2F5V A;  2K85 A;  4JK1 X;  1ZN2 A;  2CMP A;  1VQ5 I;  1ETO A;  1OMI A;  4NQW B;  4BDY A;  3QWL A;  3E0J B;  5C3E J;  2VN2 A;  1QHG A;  1R4M B;  4CCJ A;  3DXJ F;  4YG2 F;  3P9K A;  1MD0 A;  3ZQI A;  4HX7 A;  1T33 A;  4PJ0 C;  1LDJ A;  1F43 A;  2JRM A;  4XOR A;  3H36 A;  5H20 A;  5TGT A;  3RCO A;  5EGO A;  1O7L A;  3WOD F;  4OIP F;  1XDS A;  1Z7L A;  4HNV A;  3TOB A;  5EG0 B;  1I5Z A;  2Q2E B;  5FKO A;  1RR7 A;  2VQG A;  3K70 D;  4FET A;  4OMY A;  4FX4 A;  4OIR F;  3LFK A;  2GQQ A;  3LSG A;  3LQR A;  4RA2 A;  1IN8 A;  5LRR A;  3S2H J;  1U78 A;  4HBL A;  1P7I A;  1YX3 A;  3KP7 A;  2IT0 A;  4KN4 X;  4IRI A;  2L7M P;  1NK3 P;  2DJN A;  4UVC A;  1ONV A;  1SD5 A;  2ID3 A;  2GAU A;  4RGU A;  1DP3 A;  1Y0N A;  2HPI A;  4HX4 A;  4FCY A;  1QBJ A;  2OC6 A;  3ZPL A;  1XSX A;  4M73 A;  4RGR A;  4F55 A;  4OIQ F;  3MFK A;  2XAU A;  1I1G A;  2QVO A;  4DYQ A;  1XMK A;  3QOD A;  3GWZ A;  3NQO A;  1RPW A;  2EV0 A;  2HTJ A;  4EJV A;  1SFU A;  2MH2 A;  2DFI A;  2NVY J;  3EQL F;  3WU1 B;  3RQI A;  5IY5 H;  1W1W E;  4M6X A;  4E7H A;  3H5A A;  3PJR A;  3HUG A;  1R00 A;  4BDZ A;  2M2E A;  1U5T A;  3MCZ A;  2K5C A;  1R5G A;  3HC7 A;  3L09 A;  2HDD A;  3AG2 H;  4YIR X;  1BR2 A;  2GBY A;  2XVC A;  4G6T B;  3E3V A;  2Z99 A;  1ZRE A;  1VQL I;  4G12 A;  4XKW A;  1CF7 A; 
#chains in the Genus database with same CATH homology
 3MMY B;  4E7S A;  2R7T A;  2LRD A;  1NG7 A;  4HSR A;  2UUZ A;  2UV1 A;  2MD0 A;  4IX7 A;  4ZDO A;  2V6E A;  4LIU A;  2CFO A;  1X4O A;  3A1Y A;  4PJL A;  4BAC A;  4BE2 A;  3CMM A;  3IUO A;  4E7L A;  2LYC A;  4XMY A;  3QYB A;  4F91 B;  1WJF A;  3M1C A;  1D1A A;  4QPO A;  2DT7 B;  5HLT A;  3LSM A;  1DGW Y;  3UR3 C;  3K4L A;  3SEQ A;  3ZGK A;  4B48 A;  1ERD A;  2R4G A;  1IRX A;  2ELJ A;  4DBR A;  2GOM A;  2HU9 A;  1J09 A;  4BQO A;  1PJR A;  3K4C A;  3S3M A;  3CP8 A;  3ZQQ A;  3EUA A;  4F52 A;  2HZD A;  3HOS A;  3L2Q A;  2VLA A;  4IQ4 A;  3A2K A;  2NOJ B;  3QOE A;  2LBF B;  1DQU A;  4C2T A;  1X1B A;  2VJI A;  2W82 A;  3LFU A;  2UWM A;  2VXD A;  4F92 B;  3CP2 A;  1TZL A;  2XF5 A;  4XKB A;  2HNH A;  4BEH A;  3OIQ A;  3DU5 A;  3PNY A;  2CV0 A;  4RM2 A;  2KZV A;  3VSL A;  2M7A A;  2VPL A;  2P0W A;  4CSW A;  4HNT A;  3AL0 B;  3EUK L;  1MW7 A;  5HNH A;  2HVR A;  2K9M A;  2KQR A;  2Q1Z B;  4X0G A;  4ITV A;  4BJT A;  1R6R A;  4DBQ A;  4HG2 A;  4N4N B;  2AQE A;  2LRE A;  2HVQ A;  4DJA A;  5LFA A;  1D1B A;  1WJB A;  2AQF A;  4U87 A;  3LSK A;  4E7I A;  4H4K C;  2FUG 2;  4RLF A;  2L9S A;  3DPU A;  2KHM A;  4XLH A;  3OL4 A;  1X4P A;  2VJ5 A;  4HRI A;  3H0D A;  1EA3 A;  3HOT A;  4XON A;  2KMU A;  2M4K A;  3S3O A;  4DIQ A;  2X1E A;  4XOP A;  3DEE A;  3BG7 A;  2BVM A;  4XLA A;  4BU2 A;  3OYF A;  4D1Q A;  2WA0 A;  4CCO A;  4D9J A;  3CJR B;  4EAT A;  4PJJ A;  4XN3 A;  4BXF A;  2LG4 A;  1MMN A;  3D5L A;  2IS4 A;  2JA2 A;  3VYU B;  4AU7 A;  3QYF A;  4F3Q A;  2R7Q A;  3OYD A;  1MMA A;  1N75 A;  3CF2 A;  3ZXS A;  2R7W A;  1W36 D;  3K4M A;  4BJ5 C;  3BLY A;  2JUG A;  3DTK A;  4II3 A;  2IXS A;  3W2A A;  1YE9 A;  3S8P A;  2E60 A;  4YEJ A;  3PSI A;  3C2H A;  3CES A;  3GBG A;  2IGO A;  4CH7 A;  2W4S A;  3ONQ A;  4Y3O A;  4R79 A;  4B47 A;  1VZ0 A;  5FRN A;  1SAU A;  2X1D A;  1OLT A;  4BQN A;  2WAF A;  3VYS B;  4ZJZ A;  2L2O A;  2M7B A;  5CQG A;  4BL0 B;  2W00 A;  1AA7 A;  2VXZ A;  2CUJ A;  2VIX A;  5HOO A;  3NWS A;  1WJC A;  2WAE A;  3OS2 A;  2XF6 A;  1OR7 C;  3S3N A;  2F6C A;  1E0E A;  4XKC A;  2L5Q A;  2LOO A;  3DU6 A;  3S93 A;  3OYA A;  2R7U A;  2R7R A;  2CW8 A;  2X6X A;  2BW3 B;  3DLA A;  2XSJ C;  3CZ6 A;  3C2G A;  1UAA A;  2BOL A;  1BOB A;  2K3P A;  3BC8 A;  2KPM A;  1X19 A;  4DGW B;  3FBI B;  4ZC3 A;  4C30 A;  2CV1 A;  3HL2 A;  2WY7 Q;  4BE0 A;  3V42 A;  1BR4 A;  4XLC A;  4DOZ A;  2XC7 A;  2O5R A;  2CS3 A;  2L7K A;  3DQV C;  3KX2 A;  4LIV A;  3SZG A;  2CH0 A;  3FKJ A;  4RMN A;  4AYB A;  2E5N A;  4E4H A;  4ZTJ A;  2Z2S B;  4II2 A;  2PJR B;  5KCM A;  1V5G A;  2BVL A;  2X1C A;  2VQL A;  3SDB A;  4CCL A;  3E1S A;  3RSN A;  3PNV A;  1D0Y A;  3RPU D;  2DXI A;  1DGR M;  2E1M C;  2IS1 A;  1ZEL A;  4HPQ A;  4C9Y A;  2OV7 A;  3DKY A;  3RQ4 A;  3OYI A;  4BJ6 C;  2IGM A;  3L2R A;  1WJA A;  2WAD A;  1X1C A;  2CUZ A;  1YX5 A;  2LH9 A;  4PK4 A;  3ZRG A;  3VDX A;  1N78 A;  3CJQ B;  3AFH A;  4CCN A;  3AKZ A;  1MNE A;  2KRC A;  3BCB A;  3BCA A;  4KT6 A;  3H9Q A;  4ZDL A;  4XM3 A;  3K6G A;  1WFX A;  3VWB A;  2R7X A;  3LL7 A;  1PYV A;  4NC7 A;  1WJ5 A;  3KYL A;  3H9G A;  1Z21 A;  1V5E A;  2VKH A;  2MAB A;  2L9N A;  2MFZ A;  1MMD A;  3L2W A;  2X6W A;  1G8X A;  3OWT A;  3PFY A;  4E7J A;  3OMY A;  2K9L A;  2MYS A;  2OUM A;  3OS0 A;  3RTR A;  2BW3 A;  3OL3 A;  4CCK A;  5LD2 C;  3DTI A;  2WB1 A;  3DPL C;  3G2B A;  2VAS A;  1TT0 A;  3OYK A;  3DTE A;  4PFP A;  4JQF A;  1GLN A;  3I3L A;  3VSK A;  1KON A;  3DPT A;  1Y56 A;  4F93 B;  3OOU A;  4GRI A;  3ZR8 X;  2CW7 A;  3PL8 A;  5FRM A;  1JI8 A;  5FRO A;  3OY9 A;  2IS2 A;  5CPR B;  2I8D A;  2HDW A;  2LC2 A;  2V4J C;  2WY8 Q;  2JSP A;  4YEL A;  3H9J A;  3OR2 C;  3VYR B;  3L2V A;  2JVH A;  4KJZ A;  2V1N A;  1Y6I A;  1N77 A;  4AVZ A;  3LSH A;  3OS1 A;  2LBF A;  4XNF A;  4PSW A;  3OYG A;  4XQF A;  4U7B A;  1D1C A;  2KDO A;  4P1W A;  4PJM A;  4ANJ A;  2ZXH A;  1WJE A;  3H5R A;  3PNT A;  2VJJ A;  4NC8 A;  1X1D A;  2HPM A;  4CUG A;  2ZFU A;  3EPZ A;  4BEH B;  4PFO A;  3SYT A;  3OYJ A;  3K70 C;  3VYT B;  4PJN A;  2PMZ A;  2IGK A;  4J00 A;  1Z3X A;  2E1M B;  2JVG A;  2X6Y A;  3LSI A;  2HQA A;  2ZSH B;  1LFP A;  1T95 A;  2R7V A;  2IGN A;  3DKX A;  3ZCO A;  2Z1D A;  4XLE A;  5KNL A;  3W2V A;  3EUH C;  4KIT B;  3I9V 2;  4CCM A;  5KHD A;  3K4K A;  4XOT A;  1LVK A;  3MKZ A;  2HVS A;  3BG6 A;  2M0M A;  4XN0 A;  3U21 A;  2DCE A;  1D0X A;  4OAZ A;  4XKV A;  3TBI A;  2KLO A;  3OIP A;  2VJ4 A;  1QHH D;  3M8J A;  4JOM A;  2VKD A;  4YRV A;  2V7F A;  3H35 A;  3PSF A;  5HNF A;  3KEY A;  4HNU A;  4N4O B;  4C2U A;  1MND A;  2VQC A;  4NUB A;  3OYM A;  3NWT A;  2QKM B;  5HVQ C;  3D5S C;  1UG0 A;  4CZC A;  4ZDP A;  3HPH A;  1SFK A;  3N05 A;  2W7N A;  4P5O A;  2F4I A;  3MKW B;  4RLQ A;  5CKT A;  1QU3 A;  1S9H A;  3LMM A;  3K10 A;  3OR1 C;  4QPQ A;  1P9Q C;  1FMV A;  2DJI A;  2V26 A;  3HPG A;  3QYE A;  4KIS A;  4LG3 A;  4BS9 A;  2E5Z A;  3W2W A;  3HG9 A;  4BE1 A;  4RM3 A;  4BGD A;  3HUG B;  4NNJ A;  4ZTF A;  3FBN B;  4OAY A;  4OWR B;  4CA0 A;  2DT6 A;  2RRE A;  3DWL E;  1X1A A;  3OYC A;  3D5R C;  4XR6 A;  4MLO A;  4XL9 A;  2F5V A;  2CMP A;  3L2U A;  4BDY A;  4NQW B;  2W1O A;  2Y0S A;  3E0J B;  2MC4 A;  2M4G A;  3K4N A;  4HEA 2;  2KL4 A;  5CQE A;  1QHG A;  1T0F C;  4CCJ A;  2ZSI B;  4PUS A;  4E6K G;  1MMG A;  3OYB A;  2V9K A;  3HXL A;  3K4J A;  1U0J A;  4XOR A;  5TGT A;  3TMO A;  2CV2 A;  3RCO A;  3OYE A;  1NG6 A;  2VB6 A;  1HA8 A;  4XLF A;  1Z7L A;  2QKL B;  2Q2E B;  2ZXI A;  3FDY A;  2IS6 A;  2VQG A;  3K70 D;  3OYL A;  4FET A;  3UNG C;  3LSG A;  3IAM 2;  3FHN A;  3J7A Y;  2R7S A;  4IQJ A;  3PUB A;  2LY2 A;  4E7K A;  4PSX A;  4B44 A;  2X85 A;  1YX3 A;  1V5F A;  4IKF A;  2A5W A;  2RNG A;  3IAS 2;  3HKZ A;  4HST A;  3K4B A;  3MD2 A;  5JHF A;  2PJR A;  3IP4 B;  4IZZ A;  4J01 A;  4Y33 A;  2Z16 A;  1LKX A;  3F9K A;  1DP3 A;  4BUP A;  2A6T A;  4Y4R A;  1WJD A;  2DOA A;  2HPI A;  3A4C A;  3AL0 C;  2OC6 A;  1D0Z A;  4F55 A;  2XAU A;  2WBM A;  2R7O A;  2XDV A;  1UEL B;  1G59 A;  1Z3Y A;  2LY1 A;  2XF7 A;  2RQQ A;  2KP6 A;  3H5N A;  3QOD A;  3MKY B;  4B3X A;  3OYH A;  3W3C A;  1FMW A;  4E7Z A;  4FAS D;  2VQH A;  1BR1 A;  1K6Y A;  4E7H A;  4BQQ A;  3H5A A;  2X51 A;  3PJR A;  4BDZ A;  4ZYA A;  2KRH A;  3TL4 X;  3SEZ A;  2WAQ A;  4LIT A;  2GOX B;  2K5C A;  3HC7 A;  4B43 A;  2VL8 A;  1BR2 A;  4G6T B;  1LDK B;  3S32 A;  1W36 C;  3OYN A;  4XKW A;  2M3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...