5CKTA

Crystal structure of kora, a plasmid-encoded, global transcription regulator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TrfB transcriptional repressor protein
publication title Flexibility of KorA, a plasmid-encoded, global transcription regulator, in the presence and the absence of its operator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16509 KORA TrfB plasmid transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5cktA00
3M8JA 5CKTA 2W7NA
chains in the Genus database with same CATH superfamily
1OJLA 1QVUA 2NVYJ 4MFEA 1ZR2A 1FYLA 1VZ0A 1LDDA 2L01A 5CQGA 3HSFA 3E7LA 2AO9A 3N05A 3PQKA 5GPAA 1ETYA 5GAEJ 3BTLA 2D1HA 1OYWA 2LP0A 3BWGA 1JHFA 1TQMA 3W3CA 1LPQA 1U9OA 4A3DJ 2W82A 1FIAA 1V4RA 4BE1A 3F8NA 2ZNZA 5FB2A 4BXUA 1FOXA 1QHHD 3ZPLA 2M8EA 4P5OA 2KFDA 4N4OB 4NQWA 2ZXHA 4YFKF 1Y1VJ 3KEOA 3RYPA 3WTVC 2WAQN 3ZMSA 4O5VA 3MD2A 2XASA 1VQ7I 2QSFX 4XQFA 3L2RA 2K02A 3QP5A 2P8TA 4RGSA 4KNYA 3E3VA 2L7ZA 2BZTA 5B3SH 2HYGD 5EEHA 4HX4A 1K79A 2H1LA 1PYVA 2OF7A 3EUKL 1R5GA 2MC4A 1RRJA 1J9IA 3K70C 3PO3J 2OUMA 1ZREA 2EZHA 1WQ2A 1SAUA 4QPQA 2A6HF 1BI2A 4Z2YA 1Z6TA 2K3PA 4E7HA 3FXOA 2MH2A 3M3YJ 3C2HA 2YS9A 2LK2A 1H9GA 3M8JA 3IV5A 4MEXF 4UV9A 2COMA 2P0WA 1XMXA 4V2GA 1D1BA 1W0TA 5TISC 3ML6A 3BG3A 2VKDA 1CQTA 2ME0A 4LLLA 3VYTB 1LFPA 4XL9A 5GTIC 3PNTA 3OYCA 2X85A 4L5JA 4IKFA 3CDLA 3S14J 1P92A 2BBYA 3L2VA 4HF1A 2W4SA 4AWXB 3B73A 3HL2A 5E1WA 4XICA 1ERDA 4BEHB 2OD5A 4ABZA 1REPC 1Z7UA 3DCFA 1P6RA 3BCAA 3AG1H 2ZO4A 4G7OF 2XGCA 4LB6B 4U7DA 5M5XJ 1B59A 4B3XA 4AIJA 2RC4A 4HF0A 1HKSA 4O6JA 4MQVA 4ENMA 3CDHA 2VKEA 3JTHA 4ESBA 4PJLA 3LOCA 3TQNA 2BOLA 2F4OB 2VC1A 1ACIA 4Y15A 2K4BA 3WTWC 3LSPA 1GV2A 5L3EA 1WPKA 2BV6A 4U0VA 2LR8A 2DA7A 4UUTA 3CJNA 1X4PA 2ACJA 1EV7A 4EJVA 2K9LA 1B9MA 1BOAA 4CCKA 1MMNA 2Z99A 1OCPA 1ETWA 2XF7A 3M9AA 4FT8A 4ZDLA 1J59A 4FE4A 1BR1A 2ZNYA 4AVPA 1ZH5A 5IT3A 1W36D 5JLWA 5K7FA 4IOCF 1IXSB 4DZPA 3FDYA 3QPLA 2QM3A 1SANA 2EZIA 4ITVA 2VQLA 2R4GA 2M4GA 4XMYA 3HOUJ 5FJ8J 1Q1VA 4G12A 1YS6A 1U8RA 2X51A 1AU7A 1MNDA 4HOBA 4BY1J 1FSEA 1U6GA 5CVJA 3OR2C 4B47A 2PMZN 1QPMA 3LQRA 5IYCJ 3CC2I 1KQ8A 3WE2A 1G3SA 3BTCA 1IAWA 4F52A 1R4NB 2JPBA 2L7FP 1AWCA 1MGTA 5F0CA 1WVRA 4Y13A 3LSRA 3G6EI 5FLVA 1X19A 3GTGJ 2NOJB 1Y6IA 4MTEA 4BKXA 3I4PA 1LB2A 1V54H 1SFOJ 2K9MA 3HOXJ 4I0AA 4MIMA 3D1NI 4NC7A 4RMNA 2HYJA 3TGNA 1JJ8C 3KP7A 3H0DA 4PJ0C 2DOEA 2B0LA 1KA8A 2XGXA 1BJAA 3BQZA 3TMOA 3ZQHA 2L9NA 1MIJA 3EUHC 3I4NJ 2Z5UA 2M0MA 2JRMA 1G3WA 4IX7A 2HWVA 3F6OA 2VQHA 1Y0UA 3RYRA 4M9XA 3BG7A 3T8RA 2BY2A 1RC9A 2P6SA 3OYHA 3BJ6A 2X9DA 3M1EA 1D0YA 2DA6A 2ADUA 3JSOA 1VQ9I 1R22A 5DS9A 3ROUA 2J5PA 5E18F 1IN6A 4FX4A 3RZOJ 2LG4A 2ID6A 3DLLF 3CJTB 2JT1A 2FNAA 3S1QJ 1S3JA 3OYDA 2Y0MA 2W00A 1SFEA 3ZQLA 2CU7A 3T5XA 6PAXA 2ECCA 5K7ZA 4EV0A 1A04A 2ELJA 4UUSA 2EB7A 3GFLA 1OISA 4XRSA 4YFNF 2KZVA 1YW9A 4NQWB 3E6BA 1G4DA 2M9HA 3WE3A 2ZXWH 3ELKA 3GBGA 1W5SA 4M6YA 2MH9A 2QYOA 3GYHX 3O8GA 2XB0X 2FBHA 3K1MA 1R58A 1YO5C 1IGNA 2EIMH 2L2OA 1DU6A 4RB1A 3GLLA 2LNBA 5FLXZ 4NBQA 1PVEA 4YEJA 2E36A 1B72B 1YX3A 1HDDC 1SD6A 1VQNI 3S93A 5EDNA 1IJWC 2GLOA 2TCTA 5EEGA 2L4MA 4IHSA 1VQ4I 1CGPA 2V9KA 2UWMA 5HS7A 2RGVA 3OYIA 1MBHA 3I55I 3H0GJ 3W2VA 2DMTA 3KLNA 3Q3SA 4A3EJ 3WTSC 5JVTA 2DJNA 5DD4A 2EJRA 3J81Z 2HFHA 3RSNA 3OL3A 3HHHA 3MZ8A 3OSFA 5DDGA 1LUJB 4OMYA 3K69A 3CCJI 3CDIA 4A3FJ 2QENA 2IGKA 1TL8A 1FMVA 4E7SA 1BI0A 3TW7A 4WWCA 2F2EA 3L2CA 2EFPA 4ZJZA 5DCFA 1YS7A 1BR2A 3CUOA 2MBFA 5CQEA 3HM5A 2W84A 4RGRA 5C4JJ 2K3FA 2MC3A 2ICWG 1WH5A 1K83J 2H6CA 2E7WA 3RKXA 2D45A 2A68F 4XOTA 2XGEA 1KU9A 2MG4A 3ABKH 2DT6A 3E1SA 3S2WA 3DFGA 4I99C 2DQRA 1IUFA 4RM2A 1J0RA 2DK5A 2NXNB 3FKJA 1BOBA 3LMMA 4AYBN 4XR6A 3LSGA 2B7EA 1IRZA 3M8FA 4Y3OA 3BR2A 4L9JA 4A3MJ 4CICA 1Y1WJ 2X0LA 2VJIA 1TW3A 4ZYAA 5LD2C 2VPLA 3WTUC 3E6MA 2NNNA 1OCTC 1GLNA 1R36A 1JUSA 3H5RA 2Y0SN 3F3XA 1UJ8A 4PJNA 2CV2A 2FJ1A 1V5GA 2ESHA 3ESWB 3CCLI 2BY3A 1SEUA 3PQJA 1T0FC 3ZQIA 4A3LJ 4KIFA 2V1DA 2QVOA 3BPVA 3R0JA 2E1NA 2H1KA 2E7XA 4B8XA 2OZUA 4E7ZA 2JMWA 3L7WA 3HRTA 5B66C 4IOAF 2LKPA 3HPGA 3QU6A 4XSXF 3RPUA 5GTHC 1X2MA 4J01A 3FBNB 4LG3A 3FHNA 5TJJA 1FP1D 3DF8A 3IWZA 2Z16A 1Y56A 4CA0A 4A3IJ 2ELKA 1POGA 4HRIA 3JRAA 3F8FA 4PK4A 3F23A 1APLC 3IAM2 2FX0A 2VKVA 2OCEA 3OY9A 4CYDA 4F91B 1P7JA 1U0JA 3KP3A 1TWGJ 2ESNA 3DKXA 2WWYA 1T39A 1R1TA 1FY7A 2F5EA 3ECOA 5J8CA 3CCSI 1RUOA 1DU0A 4N9HA 4RGUA 2D2WA 3G1OA 4HNVA 1MBGA 5D8LB 1X4OA 1LKXA 5L3DA 1IDZA 2KISA 3FK7A 4PJMA 4XLAA 1ZQ3P 1GVDA 1ULYA 4YIIA 4XONA 1QO0D 4KIBA 4L9VA 2DFFA 4AIHA 3SDGA 4UB8C 2CQ7A 4KITB 1FIPA 3GX4X 2LF7A 1ZYRF 4HEA2 3WU1B 3NRVA 3H5NA 4IHYA 5EZHA 1IRXA 4CCLA 3I59A 1K6YA 3FXRA 3GZNB 3HUGA 1T0FA 3C3WA 2MLKA 1X1CA 3U1DA 2HTSA 3IHUA 3SHFA 2M8GX 3OYKA 1OCOH 3MKWB 3L09A 4S05A 1ETVA 4ZDOA 4S04A 3JRIA 4A0XA 2H6BA 5CYVA 3FXKA 2EV6A 4N4NB 5J8FA 1L0OC 2V1XA 3JCUC 3TDZC 2P5VA 4UUSB 1T6SA 1S8NA 2O03A 3DV8A 2R5ZA 4H0EA 1HF0A 2CWEA 2VJ4A 1D8KA 1W1WE 2FQ4A 1EH7A 4QTRA 2GQQA 3K2ZA 3VPRA 4E4HA 3GFIA 1E0EA 3OYAA 5F0FA 5DEQA 4LLGF 3ERED 3VDXA 3A4CA 4RAYA 2WA0A 3LFUA 4WXDA 1FC3A 4D5FA 3V7RA 2HQNA 2Y9YA 1HQCA 3MKYB 3ZRGA 2O3FA 1G2HA 2KMUA 4IHVA 5E79C 1ZLJA 2IA0A 2OCCH 1JTXA 2M87A 4A3KJ 4ENKA 2G9WA 3GFJA 3K0LA 4P9FA 1ZK8A 2DK8A 3LA7A 2KZGA 4F7ZA 1JI8A 3ZR8X 5HDKA 1X1BA 5D5XB 1ETXA 3FXJA 4Y4RA 2BGCA 4IHXA 3MWMA 5J4VA 3FM3A 2DW4A 3B6CA 3WU2C 2IS2A 4V2FA 3CO6C 2K7LA 2XPWA 1TC3C 2D5VA 4C3HJ 2CV0A 3HRSA 3AFHA 3WG9A 1YX5A 5FKLA 4AD9A 5ILVA 3WTTC 3U21A 3ZN0A 2RN7A 3P9IA 3TP3A 3JRBA 4G7HF 3HBLA 1WI9A 2RDPA 4G9YA 3AG3H 2PN6A 1SD5A 1I6XA 1SVMA 2L02A 1IN7A 1IXRC 2IA2A 4XORA 1OLTA 2XRLA 4C9YA 2LY1A 4PJJA 2QWWA 2V26A 4C3JJ 4D0PA 4MGRA 3RQ4A 3K4CA 2LTPA 2HS5A 2EA2A 3J7YJ 2H8RA 5FLXK 3OR1C 2WY8Q 3CF5F 1PUEE 3SXYA 3CC4I 2MD5A 3C18A 3CMYA 4M74A 2ZXJA 3NQOA 3DBRB 1DQUA 2ZC2A 2NVXJ 4LG0A 2TRTA 1F43A 2KIMA 3H9JA 3RPUD 1R7JA 5IPAA 1HDPA 2JSPA 1WJEA 1XGMA 4Y17A 2RNGA 4EJOA 3BC8A 2E1OA 5BPIA 2GZWA 4M3FA 1N75A 3BZKA 1MJAA 3LSHA 4FX0A 2BHZA 3W6JB 1IV6A 4XSZF 2V1UA 1H89C 3S16J 2VI6A 2R7VA 2HGCA 2O8KA 4OAZA 1VNDA 3WGIA 2E2JJ 4UUVA 4OMZA 3HZJA 5F1RA 1S5LC 3J81K 3VSKA 1B1BA 3HTUA 5IP9J 1WFXA 2R7OA 2JTVA 3ZQFA 1X1DA 4CXFA 1JXSA 3GO5A 2BVLA 2CO5A 2KIQA 1RETA 2HPMA 3OV8A 2X1CA 3IRQA 2GBYA 1P9QC 2DAOA 1WCMJ 3OYNA 3DTKA 2EZKA 3HPHA 1FLIA 5L3BA 1VQMI 3HC7A 4WX9A 2UXNA 3FKIJ 3BR1A 2DYRH 1WJ5A 2M45A 2Y30A 3E5QA 2DFHA 3T1BA 4EGYA 4DYCA 2DQLA 3G73A 5ILSA 1ORKA 3A0BC 3ONQA 4WK8F 3E5UA 1ZRCA 5DV5A 1DUXC 3F8BA 4FHTA 1O7FA 1VI0A 4XLCA 2EA4A 3P9KA 5D8KB 2FNPA 4G8XA 1RKWA 3HOSA 3JAMZ 3W2AA 4OIOF 3O3KA 2MABA 4HPQA 3LQQA 2G0EA 4PFOA 3O6BB 3BPXA 4AM3A 5ICEA 3VEPA 1JE8A 1XTAA 1LEAA 1B6AA 3I59B 4ZTJA 4HG2A 3HUGB 4KUMA 3JRGA 1WSUA 2ZXIA 4DYRA 2X6OA 3MQ0A 5J4YA 4RBOA 4HBLA 2E60A 3HGGA 2G7HA 3M7GA 3A2KA 4LGWA 5LRRA 2RQQA 4UHTA 3RQIA 3DEUA 4JP0A 2HVRA 3FX3A 4ZH4F 5BPDA 1SFKA 4I09A 4RLFA 3V7SA 2UZKA 5IT9Z 1XDSA 4PFPA 2R7RA 2QEXI 2VE9A 1IN4A 3I5UA 1XG1A 4B4CA 1RIOH 2VBYA 4EM0B 2DLLA 3SFIA 1Z67A 2R5ZB 3BG5A 3D5RC 3C7JA 3A0HC 3RIRA 3OWTA 1XCBA 1E3OC 2HOAA 2OZ6A 1T2KA 1MMSA 4NC6A 3ZP5A 2LSOA 1EA3A 2E2HJ 5L3GA 3ZMUA 4R1HA 3IUOA 2WB1A 3M4OJ 2LD5A 2O9LA 1ZG3A 2YU9J 1R00A 1D5VA 1ZAOA 2Z9OA 5AONA 4G7ZF 1B72A 4BJ5C 2XVCA 4F55A 4KDPA 4GYGA 1R23A 3F8MA 3J80Z 3F72A 4ZYHA 5E3OA 1K78A 4I01A 3GTPJ 2I10A 2CRGA 3DQVC 2VT2A 2L3DA 2VQGA 5AIQA 1CF7B 3PUBA 2QQ9A 2CSOA 2QUFA 2VL8A 2XUBA 3R61A 1UCRA 3COAC 5HODA 3KX2A 3N4MA 4LLNA 5FGMA 1A31A 3HB9A 1KONA 1PUFA 4FQGA 4IXAA 1Q1HA 1C0WA 3UNGC 4GO1A 4OIQF 1ZHFA 2WAQA 2E1MC 2LMDA 3H36A 1JKOC 2R7TA 4HW0A 4PGHA 2HKOA 3SYTA 3FIWA 2LC2A 2CMPA 2DFEA 2HXIA 3REOA 4C3IJ 4DNCA 5E8GA 2X1DA 2JUCA 1K4SA 3FHZA 3PSIA 4DZJA 1J7KA 2K5CA 3N97A 2PJRB 1S9HA 3Q0UA 2JPCA 2R93J 3IL2A 3KE2A 2ZKZA 1JT6A 1WRJA 4AVZA 1D0ZA 3G71I 3E0JB 2O5RA 3S17J 1MBEA 1LEBA 3E6CC 3F6VA 2DBBA 2F4MB 2VONA 3AL0C 4KMUX 2WY7Q 3A03A 3BOQA 5CVIA 4LG0B 3CC7I 1FBQA 2NS7A 3O8HA 1F4KA 1VQKI 3GF2A 3CP8A 3BZ6A 2UXXA 1ETKA 4RDUA 4ENJA 3KCCA 2VJ5A 2YR2A 3CTAA 5M3MJ 4OINF 2PG4A 3CUQC 2XC7A 1IUYA 1Z7LA 4XLFA 1G3TA 2BW3A 2EV0A 3OIQA 3DPTA 3GLXA 4UVAA 4CCOA 2STWA 3BG9A 2UUZA 4P1WA 2LLKA 2JA7J 3LAJA 3TO9A 2FUG2 3BLYA 3A02A 5ICGA 1U5TC 3KYDB 3GTKJ 5E3NA 5EEAA 4CUGA 3R0AA 4X1EA 5BNGA 2IPQX 3OYMA 2JJ7A 4HQEA 2QKLB 3HGYA 3S3MA 2ID3A 2L4AA 4BQOA 2V6EA 1HA8A 2GOMA 2PMUA 4B48A 5BQTA 1ZRFA 2WADA 4DBQA 1OPCA 5HNHA 2MD0A 2QBYA 1A5JA 2G7UA 3JTGA 5GAGJ 2XHKA 4JBAA 3H3ZA 2HEOA 4HLXA 2F5VA 5DM7F 3PNYA 2LDUA 1W4MA 3GWZA 4RM3A 2R7DA 3ERMA 2A5WA 4CYCA 3HXLA 4LK0F 4O3MA 1UHMA 1HSTA 5CJ9A 1YJNI 2B9SA 1Z3YA 2D1VA 2WBMA 3OMYA 3CCEI 4R8HA 3T8TA 3AKZA 2IP2A 2JVGA 5FD5A 1MW7A 4M6XA 5DM6F 1ZRDA 3DBHB 1MNEA 1MH3A 1JHHA 3I54A 4UV8A 2ZFWA 2FXAA 2E71A 3CP2A 3ABUA 5LEJA 3OS1A 4XRMA 3LSMA 3CJRB 4M6VA 2PMZA 3E5XA 1XB4A 2VOOA 5D5VB 1LDJA 4C2TA 1XN7A 3CJQB 2IXSA 2M34A 2QLZA 1XGOA 3LFKA 3V8LA 4GDFA 5IY5H 3ABLH 2A61A 1DGWY 1BW5A 3Q0WA 2KIUA 3JSPA 3ZQCA 3KPHA 3PFIA 3L9FA 4G94A 4A3CJ 4UVBA 5A2QZ 3AAFA 4XKWA 3BQYA 1HOMA 5LGTA 1USSA 1U3EM 2QZ8A 3IWFA 1FT9A 2MYSA 3DLAA 3I56I 3SJMA 4CHUA 1I50J 2XAGA 2ZMEC 3OYGA 2HQRA 3CMMA 1IO2A 1LVKA 1G6NA 3HKZA 2FBIA 3WG7H 5IP6A 5HLHA 1O3RA 1OQYA 3BT9A 5LEKA 2HQAA 3L2QA 1PDNC 1SVLA 3JAMK 3BZCA 3DU5A 2FRHA 4ENNA 1BC7C 3DPUA 4IJAA 3A1YA 5BMZA 4BHPA 1LVAA 1IXCA 2PI0A 3S1MJ 2OV7A 2RV8A 3EUHA 4A5MA 1EH8A 2XROA 1GDTA 4HAMA 4CCJA 2R0QC 4XIDA 2DMUA 3ASOH 4DIQA 3EDPA 1K78B 1SMYF 2ZSIB 4KN4X 4AU7A 3GVAA 1TT0A 1XSVA 2ISYA 4RS8A 5DCMA 4XLNF 2IVMA 1AA7A 5F27A 3ZN1A 4HDUA 2K9NA 3LSTA 1DGRM 5LGUA 4DGWB 3GTJJ 2VOPA 3RPQA 2X48A 1H0MA 4MTDA 1PUFB 1O7LA 4LD5A 4YELA 2JZYA 1MMDA 1P4XA 3WTXC 3M1CA 3C1DA 1UG0A 1YFHA 4HSRA 1RPWA 1FX7A 3VYRB 2IRFG 4MO7A 3K70D 2COBA 4HNTA 5JHFA 2A05A 2E34A 2O61A 3MCZA 1YIJI 1XGSA 1XS9A 1AKHA 4I98B 1U2WA 4LK1F 2FA5A 3VYSB 4Q5SF 2ZMEA 2B63J 2AHQA 2FEZA 4U87A 3OIOA 3MKLA 5E3LA 5FRMA 1OCRH 3OOUA 3JRHA 2IW5A 2MLGA 1JKQC 2BE5F 2V9PA 4Q47A 5C4XJ 3SFZA 2GWRA 3RCOA 2HZTA 3ZQ7A 4YRVA 3GTLJ 3BY6A 3P7NA 5J1YA 2JUGA 2M5WA 3J80K 2E5ZA 4XN0A 2HOSA 1P7IA 3E97A 4CSWA 3QP6A 1YJ9I 4BHCA 4HV6A 4XK4A 1A6IA 2EILH 2BEOA 5JI6A 2FF4A 3QYEA 2HR3A 2DOFA 2W7NA 2ECBA 2NVQJ 3QPHA 3MFKA 4RLQA 2LYCA 4BH9A 3ISPA 3H5AA 2K86A 4EMSA 2VBXA 1BI1A 4IHWA 2HU9A 2BW3B 4M73A 5EGOB 2X6XA 1OFCX 1ZGWA 3TW6A 3CMEI 3SEZA 3MVPA 4ASNA 2YPRA 2OA4A 2E1MB 5E20A 2LOOA 4EJUA 4Q4ZF 4D9JA 1LFUP 1W5CC 1USTA 3QOPA 1SAXA 2J5OA 3L2UA 1R9TJ 3U1KA 3IP4B 4EEFG 2ZJQF 4J00A 3BR5A 3QYBA 4PCQA 2XKPA 3HEFA 2BYVE 1TWAJ 5B5EC 1M1EB 2KDZA 1VQLI 4AYBA 1HLVA 2QSHX 5J6XA 5K5QA 3FK6A 3BTIA 3GW2A 5H20A 5IOZA 4IHTA 3TOAA 3KYCB 1Z05A 4KA4A 1W0UA 1ZN2A 5DUKA 1E3HA 2QBYB 1QQIA 2CUJA 1RUNA 4BE2A 1QVTA 2KHMA 4UY8I 3AL0B 2O8XA 4OWRB 5FKMA 2EZLA 1RR8C 1ON1A 1Z91A 5KNLA 3OS0A 3W6KB 4CYCB 5K5RA 1VQPI 4NB5A 4U0YA 3CO7C 3HIFA 4I2OA 3IKTA 3W6VA 1RI7A 4MFDA 1FOWA 1SD4A 3P9CA 2IGMA 3DTEA 4JX5A 1ON2A 1R1VA 1NG7A 2VB6A 4RAGA 1UHWA 3BR0A 4UB6C 1NK3P 2FE3A 1F5TA 3ULQB 4HA8A 1OKRA 1WJDA 2MGQA 1Z1DA 3CUQB 2IS6A 1BJZA 2IJLA 2IT0A 1H9TA 2VKHA 3GEZA 2BXYA 3S1NJ 4IEJA 3PIOF 3SDBA 2STTA 3Q9SA 2OAZA 3DXJF 2VLAA 1PP8F 3GTMJ 3K4NA 5J3LA 4FTHA 4YIRX 3K9TA 1U5TB 3NARA 1FBSA 3EQLF 5D6FA 2BY1A 2Y48A 2E2IJ 1ODDA 2M4KA 2L7KA 1QZZA 4LFUA 1X1PA 5E8IA 2NNYA 5LHHA 1ZG5A 1GT0C 3VWBA 1TP4A 2DJIA 1OYYA 2Y31A 2XAFA 3TP0A 1GXPA 1HC8A 2R7FA 2A3SA 2PLYA 1SMTA 3M8EA 4BQQA 4J19A 2LREA 1QNTA 5HOOA 2FD5A 4BE0A 4C2UA 1UMQA 1UZCA 1R5HA 2XKOA 1FNNA 3K1NA 3K1PA 1SC7A 3I0TA 5L3CA 1KGSA 4JYKA 4M72A 2LRDA 4PGGA 3QOEA 1E2XA 3QAHA 3BG6A 5CPRB 3R4KA 1KU7A 1FOYA 1LQ1A 4BXFA 3JW4A 3TO6A 2R7XA 1XX5A 4C30A 5F64A 3OL4A 4BYYA 5LHIA 1I1SA 4GFBA 2WC2A 2FQ3A 4IZZA 2HDCA 2JA2A 1B8IA 1WJCA 4BDYA 5IOYA 2A6EF 3FMSA 2K4JA 4CZZA 4XKCA 4ANJA 3QU3A 4WXHA 3LSIA 4Q48A 5DCMB 1G3YA 3TBIA 5DTDA 3WHCA 4BAYA 1IG7A 1IV8A 1HBXG 3G4SI 2XAUA 3DBLB 4AIKA 1CF7A 1KYWA 1N78A 3TKYA 4NC8A 3JRCA 3ABMH 2FMYA 1T98A 2O0YA 2JA6J 1WJBA 2A6TA 1OCZH 4G6TB 2Q2EA 1XSXA 3V8JA 5A2QK 2F4IA 3HOZJ 4A3JJ 1EKEA 3WU0A 5J1RA 1XPXA 2BHYA 2L9SA 1A6QA 1TT5B 3CQZJ 4U0WA 4PSWA 5HDNA 1U8BA 3KP4A 3WGGA 2L7MP 4IL6C 1MDMB 1QZEA 4CDGA 2CQXA 1AKHB 1BM9A 3WHBA 4A6DA 4MLOA 1UAAA 2ZMEB 5KHDA 3KLOA 1YI2I 4HF2A 1FYKA 1ZGJA 3DKWA 3I9V2 2PJRA 2JK3A 1BR4A 2K9SA 3GCMA 1FOKA 1Z0XA 2IA1A 3CCVI 2FBKA 3RKWA 3JREA 1I3AA 3HSEA 1XDUA 2EPFA 5LFAA 2K9QA 3WGHA 2DFIA 1K6OA 2GXGA 1G8XA 5EJCA 4ZYEA 3DPLC 4W97A 2CQQA 2FSWA 3MN2A 3S3NA 2Z2SB 2QCOA 4KICA 3KZIC 2M7BA 1WJFA 2JSCA 3ZOBA 1D1AA 1V3FA 3LNQA 1X3ZB 3G1LA 1W36C 5FROA 1LJ9A 3TOBA 3KP6A 1DP7P 1Y39A 4G6QA 1FWZA 2Y2ZA 1KQ9A 3FBIB 4XLEA 2Q8KA 4D5CA 2XV4S 4QIWN 2VPRA 1HW5A 4ESFA 2DI3A 2DA1A 2DT5A 2AQEA 3DWLE 5H6RA 1S7EA 3DEEA 2X4HA 2RQPA 3LWFA 4HV5A 3QWLA 1YOVB 2CW0F 4I0BA 5EG0A 5IYDJ 1E17A 1E3PA 1P4WA 2DYSH 5F08A 3ASNH 1WZ2A 3J7AO 2HXOA 2IGOA 4ZC3A 1BIBA 1XMAA 3D5LA 1B4AA 4Y52J 5KAFC 1F1ZA 2DOAA 1V5FA 3IH4A 4QSHA 2HNHA 2RAEA 3KYLA 2JWTA 1FSHA 4A93J 5FKKA 1MBFA 3S2HJ 3KEQA 4ZZLA 2QQ8A 1OR7C 1NK2P 2AQFA 1OMIA 3SEQA 1XC5A 1RNLA 1WI3A 3FXMA 2DA5A 1FTZA 3PFYA 2CQNA 4CCNA 2GA2A 5ED4A 1D1CA 1VQ5I 4KJZA 4ZYDA 3OIPA 2F5CA 1UFMA 4P9UA 4LIVA 3OYLA 1XCVA 3L2WA 5D6EA 2CW8A 5ERIA 3IH2A 4XOPA 2NAZA 4GGGA 4ZYGA 4D7NA 2Y69H 4BJTA 1W7PA 1N25A 4FETA 4A5NA 3FF5A 4FISA 3G3ZA 1KU2A 3J7ZI 1YRNA 2FOKA 5AIPA 4ZZDA 5CVVA 5DD8A 2TDXA 4V19K 2ETHA 1D0XA 3CESA 2M0CA 2DPUA 3C2GA 2M2EA 2XPUA 2VODA 2PBIA 1MSFC 1FJLA 3WTZA 3DP7A 3MZYA 4II3A 1LFBA 1TBXA 3HOTA 2OQGA 1TQPA 2R7QA 3LSJA 4BY7J 1T8IA 3C2BA 2WB1N 1WJAA 4KFCA 5B1BH 2GAUA 4LIUA 2CFXA 3FZVA 1VTNC 2OC6A 1ENHA 4M3BA 2DDAA 5HLIA 3B6AA 4EGZA 2HI3A 2OPTA 5LLQA 4KIGA 4NHJA 3CCRI 2MA3A 3JRDA 1IN8A 2DA4A 2LFBA 9ANTA 5HLGA 3ZCOA 5B1AH 3RKQA 4GRIA 1WHUA 1YITI 4MQ9F 2X6WA 4RAFA 3I3LA 3RDIA 2QF7A 3HHGA 1LDKB 4K2EA 2CJJA 2W1OA 2VASA 2OBPA 1B8IB 1TQIA 3ZQQA 2XF5A 3H3UA 4FCYA 3NEUA 5HNFA 2Z3YA 4QLCU 3A01B 3K6GA 3PJRA 4XM3A 4WCGA 3KZYA 4M9ZA 5FLMJ 4KISA 1MD0A 2VBZA 4AUXA 3H92A 2JA5J 1X58A 1ZTRA 1Z21A 5ICFA 4F93B 1VFCA 1JTYA 3KIOA 3ZXSA 4M3EA 4RB3C 1B9NA 1YTYA 2KJBA 2Q2EB 3FMQA 2EIKH 3VODA 3LAPA 2PX9A 2PQ8A 5DUIA 1LNWA 2QA4I 2P6TA 2A5YB 5F04A 5L3FA 4HZFA 4B1RA 1HW1A 5JLXA 3R60A 2M1BA 2E35A 3CLQA 4H4KC 5E1XA 1K61A 4XNFA 2P7VB 2JA8J 2GIZA 2WAEA 4HNUA 2KPMA 3I64A 2KDOA 3BTJA 4RGXA 1BW6A 3K4MA 3B02A 2EBIA 3MMYB 4EQQA 1BC8C 3BDDA 2UV1A 3K10A 1SD7A 4A69C 2V7FA 3HRMA 3PNVA 3CLOA 3QRFF 3JR9A 3I58A 3RZDJ 1BBYA 3HSRA 5H6QA 2CGPA 2R7ZJ 2X1EA 3EYIA 5BS6A 3ZQGA 4OU0A 2HQ5A 4PDKA 5LBQA 1EH6A 4WXCA 4M9SA 1YJWI 3SQNA 4XBFA 4JOMA 1J75A 1I3QJ 2M7AA 2DN0A 1UG2A 2MSYA 1O3SA 3ZMVA 4BNCA 2DPDA 4A3GJ 5EGOA 4KT6A 4N9IA 2WAFA 5DYMA 4B44A 4E7JA 1S29A 1IF1A 4XLHA 4M3DA 5EG0B 1NH3A 2IS1A 1UELB 2L9RA 4LJZF 2R5YB 5JFRA 2YX4A 2V6CA 4EJTA 2R92J 3EYYA 2GM4A 1XGNA 2DCEA 1YG2A 5CLSA 2LY2A 2KRCA 1R71A 2E19A 2ZJRF 3K4LA 4BQAA 4BU2A 2CS3A 1YLFA 1HXDA 1O3TA 1IRFA 2AXLA 2PMHA 3U9GA 1D8JA 2HDDA 5LGNA 5HS9A 4I6ZA 3DKYA 4KN7X 5FD6A 2OTLI 2AXTC 1RESA 4CH7A 2XRNA 1IDYA 1W7PD 2HPIA 3TDUC 3BJAA 1KU3A 2Z33A 3P5JA 2DTZA 1T33A 1GVJA 3TEDA 3Q5FA 2EK5A 1O3QA 2DXIA 3KP5A 2RVCA 2XIGA 1LE8A 2PJPA 1N77A 2OQRA 4FE7A 1X3WB 1X3UA 1FZPB 2BY0A 3BCBA 4L18B 4BGDA 4GCVA 3S1RJ 2VT3A 3RI4A 2F5DA 3I71A 1JGSA 2RREA 2XDVA 4EM2A 4IQJA 1F36A 4XRSG 3WODF 5C44J 1H88C 3GTQJ 1TNSA 4XLPF 4HDVA 3R6SA 3UR3C 4QPOA 4E7IA 2L54A 1W7PB 2XPVA 2FU4A 2IAIA 4L0ZB 4PZJA 3HOWJ 3CUQA 4HSTA 4NNJA 4PUSA 4I02A 5CVUA 1NG6A 1YRNB 5HVQC 3F22A 4U7BA 2GA1A 2WTEA 3CCMI 2ZBKA 4BJ6C 1ZGAA 4ESJA 2W24A 2CQKA 3IH3A 2OJED 5HS8A 5EF6A 1U5TA 2VN2A 5FKNA 1K4TA 3V4GA 1J2XA 2LBFA 3HKZN 4BQNA 5IP7J 2NVUB 1R5ID 2KL4A 3QPSA 3IAS2 5TGTA 3V7CA 3VSLA 2GOXB 2CUZA 2Y9ZA 4BDZA 3PL8A 5D5WB 4HX7A 5FRNA 2DO7A 4LOCA 1QA6A 2DTRA 4BACA 3FXLA 3FMRA 2R7UA 2P4WA 2Z1DA 2F5FA 5J47A 3EETA 3SZGA 2CUEA 3CCQI 5GAHJ 2XSDC 3GUDA 1QZYA 3X2QH 5F0HA 2H94A 4I76A 4YFXF 1MSEC 1VQ8I 4QWQA 5EYRA 3S2DJ 5HDGA 1SVOA 3AG4H 1U9NA 2VC0A 1SFXA 2CG4A 3HG9A 3U2RA 1PJRA 1T56A 2LF8A 1X2NA 3EUAA 2P81A 4ZDPA 3OYJA 4DQ2A 1VQOI 2EFNA 4OOIA 1W5TA 2LVSA 1TWCJ 5M5WJ 2DDBA 2IBDA 3L00A 5F1JA 2BVMA 3M07A 3ZMZA 4DBRA 3HRUA 4F92B 2BXZA 3LSKA 5IT9K 2V1NA 2XSJC 2KT0A 3W2WA 1Y8RB 3H9GA 4L9NA 3GFMA 1KZHA 5K1YA 2ZJPF 1Y0NA 1PP7U 2CUFA 2P5LC 2NRAC 3FM5A 1AHDP 2OTJI 3RTRA 1MDMA 4S0HB 3QPTA 2NS0A 2XB5A 2JVHA 3CCUI 4JK1X 3HYIA 1GXQA 4I7HA 2DODA 5KCMA 2HVSA 2ZCWA 1GHCA 1P2FA 1ONVA 5D5UB 4AIDA 2H27A 4KYWA 4R79A 1I6HJ 3DTIA 2L0KA 4TV7A 2IS4A 2F6CA 2K40A 2KRFA 1YYVA 5KAIC 4HLYA 1YW8A 2ELHA 2XAQA 3PIPF 1QBJA 5BOXA 2E1CA 2QSGX 4A0YA 5FFZA 2QGUA 4EATA 4DYQA 4IPAA 1YE9A 2K85A 1MKMA 4B09A 2XAHA 4PSXA 3K4KA 2VXZA 3BR3A 1X1AA 1XSDA 1EF4A 2GIVA 5E17F 3ABTA 1HSJA 2LKSA 3HJEA 4A12A 1TWFJ 1WWXA 2KJCA 3K7AJ 1FBUA 2CYYA 4UXNA 4A2UA 2V79A 1MNMC 4CCMA 1IRGA 4JX6A 5D4RA 1JKPC 2C6YA 2JN6A 3GTOJ 3F0CA 4G6DA 4RB0A 2DMNA 1A35A 3HOYJ 1HKTA 1F9NA 2DA2A 2EV5A 4W1UA 5FO5A 4Y7NJ 4BXXJ 5K7HA 3OSGA 3HDDA 2EQRA 4BBRJ 4IF4A 4L9TA 1IZ1A 1V5EA 3FWEA 5FFXA 2EWNA 2R7WA 1BL0A 4KT5C 4F3QA 2XGDA 2WV1A 3CZ6A 2V9VA 3EPZA 1WGXA 2YU3A 3KEYA 2EFWA 1DP3A 2CFOA 3GZ5A 4EM1A 2KRHA 2FMLA 3DEWA 2Y0SA 1I5ZA 3OYEA 1LE8B 2R3SA 1DDNA 4HQMA 3ZMTA 2H8WA 2HTJA 2DU9A 1Z77A 2KQRA 1ZR4A 2EINH 2L9VA 1S6LA 1QRYA 4XKBA 2HZDA 5ILUA 4JX4A 3JRFA 5IYBJ 4CZCA 1FYMA 1EJ9A 1JGGA 1J09A 2I8DA 3KFWX 4IO9F 1QU3A 4B43A 1YHQI 3UKGA 1FP2A 3NWTA 5FKOA 4BS9A 4D7MA 4Z6YA 2DT7B 1BI3A 1JUPA 1T95A 5CVRA 2AS5F 1NHAA 1MJBA 1XMKA 4B3AA 4C2MJ 1SFUA 4BL0B 1GUUA 4RA2A 3QYFA 2MFZA 2EFOA 2F48A 3T0YA 1VQ6I 1TTYA 1A36A 1BA5A 4MNUA 4M3GA 3LL7A 1T38A 1ZARA 3BP8A 2LBFB 3G2BA 1Z6RA 2IGNA 4DOZA 3S3OA 3RKYA 3LA3A 3PUFA 4CO8A 4L5IA 2A69F 1S72I 4CGZA 2I5UA 4RB2C 3NAUA 2DMQA 1D5YA 5M3FJ 3FISA 1BN5A 3F9KA 3CCYA 3DU6A 1H8AC 1MBJA 3S8PA 2EFQA 1TWHJ 4A0ZA 1K7AA 2GXAA 2KP6A 1YW7A 1HKQA 2KIFA 3TO7A 3D5SC 4BHBA 2EH3A 2DA3A 3OYFA 1JJ6C 1U78A 1QPIA 3I4MJ 2NVTJ 4HYEA 5M5YJ 1MBKA 2QQAA 5EZGA 1MZBA 2O6GE 3L1PA 3SZTA 4YIFA 4LITA 2P5KA 4U88A 5GADJ 3FXUA 2RKHA 4XKVA 1ETQA 2CH0A 2LY9A 3HOVJ 4AC0A 2JRTA 3BR6A 1V55H 2YUSA 3PSFA 3KZZA 1WH7A 3A01A 3J7AY 2MW8A 1FMWA 1UHSA 1L3LA 4M71A 4E6KG 5KK1A 5GP9A 2Y75A 4N0BA 3Q0VA 5F6FA 3F8CA 1MJ9A 3F21A 3IRRA 1Z9CA 4ZTFA 1R1UA 5D4SA 2CV1A 3OOPA 2E5NA 2VBWA 1GV5A 3H3VK 2KKOA 2ISZA 1I1GA 3FXQA 3QODA 4OAYA 4E7LA 2VJJA 1XD7A 2EIJH 2W48A 4BBSJ 3WTYC 1ITYA 3TL4X 2FOWA 2LH9A 2RNJA 4FASD 2CW7A 4A6EA 5HLTA 2A07F 1KYZA 3GZ6A 2ZFUA 3OYBA 3S15J 2W85A 4NDLA 2ME6A 4HX8A 4MHGA 4IVNA 3AG2H 3E6DA 1IN5A 2VQCA 1IW7F 1ETOA 1WKMA 3CD6I 1OYIA 1D3YA 2IEKA 3ZMDA 1O4XA 3VOEA 1G59A 1I39A 1FTTA 4IRHA 1DPRA 1TLHB 1R4MB 2W25A 1JKRC 1AOYA 4D1QA 2VE8A 4L0YB 3MEXA 3KETA 2L5QA 2ZSHB 4LB5A 4ETSA 4JQFA 3LA2A 4BEHA 1STZA 3VB2A 1TNTA 4A3BJ 4YG2F 5H2FC 1NTCA 1TW2A 2NYXA 2DMPA 3V42A 2JQ7A 3KP2A 4LMYA 1VF9A 4WF2A 3O2PE 2W57A 3HTSB 4X0GA 3CMAI 3IC7A 2HDWA 4X6AJ 1P4AA 2ZJ2A 2QQBA 2WV0A 3H1CA 1FEXA 1ZLKA 2PFBA 2HKXA 3MAJA 1J5YA 2NOGA 3MZHA 5ICCA 2VIXA 2R5YA 4IQ4A 3K2AA 4IRGA 1MMAA 3GXOA 4P55A 2OU2A 4BUPA 1TZLA 1R6RA 2YSRA 1QHGA 5C3EJ 2P7CB 4E7KA 4KMFA 3H35A 3QQAA 2X6YA 2PEXA 4OIRF 1ZELA 3RJPA 3SZPA 2Q0OA 3Q9VA 3VYUB 1ZG1A 3BROA 4EVIA 4ON0A 1JT0A 2N8GA 2ZB9A 1HW2A 5TRDA 5JHUA 2XF6A 3G1MA 1YQAA 2K27A 1S7AA 3IKVA 1MH4A 1R49A 3K4JA 3VFZA 2V4JC 4GYIA 5KVRA 2H09A 4GXOA 2M3AA 2YX7A 1IC8A 5LRSA 4OIPF 4RAZA 3PM1A 5J1UA 1I27A 4II2A 5JR3A 4Y33A 5E1ZB 4DW6A 1FPQA 4IRIA 4UNOA 1JUMA 1T08B 2QKMB 1S7OA 1ZKGA 5GPCA 2NS8A 1RKTA 1RR7A 3H9QA 4DJAA 1DPUA 3V8KA 4E70A 2HYFA 4L5EA 1O57A 1RZ4A 1UB9A 4MEYF 2Q1ZB 3ECHA 3I53A 1KQ0A 1Z3XA 3PO2J 2XAJA 4XRFA 4P96A 2R7SA 3K4BA 1QGPA 1BIAA 3GMEA 1OCCH 2GXBA 1Y8QB 5LHGA 3BJOA 4EJWA 2O7OA 3NWSA 3D0SA 2LKXA 3S32A 4NUBA 2VUMJ 5CKTA 4XN3A 1MMGA 2M30A 2HOTA 2KLOA 1YIOA 2VXDA 5J40A 1HCRA 3CF2A 5JVGF 5E3MA 2HVQA 2HOEA 3ZGKA 3MKZA 1OR7A 3OS2A 5K5OA 4UVCA
chains in the Genus database with same CATH topology
1N77A 3BCBA 1VZ0A 2IS2A 5CQGA 4BGDA 2CV0A 2RREA 3N05A 2XDVA 3QYEA 4IQJA 2W7NA 3AFHA 4RLQA 2LYCA 1YX5A 3H5AA 3UR3C 3W3CA 4QPOA 3U21A 2HU9A 2BW3B 4E7IA 2W82A 2X6XA 4BE1A 4HSTA 3SEZA 4NNJA 1QHHD 4PUSA 1NG6A 2E1MB 4P5OA 5HVQC 2LOOA 4N4OB 4U7BA 2ZXHA 4D9JA 4XORA 4BJ6C 3L2UA 1OLTA 3MD2A 3IP4B 4J00A 3QYBA 4C9YA 4XQFA 2LY1A 3L2RA 4PJJA 2V26A 3RQ4A 3K4CA 4AYBA 2LBFA 1PYVA 4BQNA 3EUKL 2MC4A 3OR1C 2WY8Q 3K70C 2OUMA 2KL4A 3IAS2 5TGTA 1SAUA 4QPQA 3VSLA 2GOXB 2CUZA 2CUJA 4BE2A 1DQUA 2KHMA 3PL8A 4BDZA 3H9JA 2K3PA 3RPUD 5FRNA 3AL0B 2JSPA 1WJEA 4OWRB 4E7HA 4BACA 2RNGA 5KNLA 3OS0A 3BC8A 3C2HA 2R7UA 1N75A 3LSHA 3M8JA 2Z1DA 2P0WA 3SZGA 4Y4RA 1D1BA 2IGMA 2VKDA 3DTEA 2R7VA 4OAZA 3VYTB 1LFPA 1NG7A 4XL9A 3PNTA 2VB6A 3OYCA 2X85A 4IKFA 1WJDA 3VSKA 2IS6A 1WFXA 2R7OA 2VKHA 1X1DA 3HG9A 3SDBA 3L2VA 2W4SA 2BVLA 1PJRA 2VLAA 2HPMA 3HL2A 1ERDA 3EUAA 3K4NA 2X1CA 4BEHB 1P9QC 4ZDPA 3OYJA 3BCAA 3OYNA 3DTKA 3HPHA 4B3XA 3HC7A 2BVMA 2M4KA 2L7KA 4DBRA 1WJ5A 4F92B 4PJLA 3LSKA 2BOLA 3VWBA 2DJIA 2V1NA 2XSJC 3W2WA 3H9GA 3ONQA 4BQQA 2LREA 5HOOA 4BE0A 3RTRA 4XLCA 4C2UA 1X4PA 2K9LA 3HOSA 4CCKA 1MMNA 2JVHA 3W2AA 2LRDA 2MABA 2XF7A 3QOEA 4HPQA 4ZDLA 4PFOA 5KCMA 3BG6A 5CPRB 2HVSA 1BR1A 1W36D 4BXFA 2R7XA 4C30A 4R79A 3OL4A 3DTIA 3FDYA 4HG2A 3HUGB 4ZTJA 2IS4A 4IZZA 2F6CA 4ITVA 2JA2A 2VQLA 2ZXIA 2R4GA 1WJCA 4BDYA 2M4GA 4XMYA 2E60A 3A2KA 4XKCA 4ANJA 2RQQA 2X51A 3LSIA 3TBIA 1MNDA 2HVRA 2XAUA 4EATA 3OR2C 4B47A 1N78A 1SFKA 4RLFA 1YE9A 4NC8A 4PFPA 2R7RA 4PSXA 3K4KA 2VXZA 1WJBA 1X1AA 2A6TA 4F52A 4G6TB 2F4IA 1X19A 2NOJB 1Y6IA 2L9SA 3D5RC 4PSWA 3OWTA 2K9MA 4NC7A 4RMNA 4CCMA 1EA3A 3IUOA 4MLOA 1UAAA 5KHDA 3H0DA 2WB1A 3I9V2 3TMOA 2PJRA 2L9NA 3EUHC 1BR4A 2M0MA 4IX7A 4BJ5C 5LFAA 1V5EA 2R7WA 4F55A 2VQHA 1G8XA 4F3QA 3CZ6A 3DPLC 3EPZA 3BG7A 3S3NA 2Z2SB 3KEYA 3OYHA 1DP3A 1D0YA 2CFOA 2M7BA 1WJFA 2KRHA 1D1AA 2Y0SA 3DQVC 3OYEA 2VQGA 3PUBA 2VL8A 5FROA 1W36C 2LG4A 3KX2A 2KQRA 4XLEA 3FBIB 1KONA 3OYDA 2W00A 4XKBA 2HZDA 2AQEA 3UNGC 4CZCA 3DWLE 1J09A 2I8DA 1QU3A 4B43A 3DEEA 2ELJA 3NWTA 4BS9A 2WAQA 2E1MC 3OS2A 2R7TA 2DT7B 2KZVA 1T95A 3SYTA 2LC2A 4NQWB 2CMPA 2IGOA 4ZC3A 3GBGA 3D5LA 4BL0B 2X1DA 3QYFA 2MFZA 3PSIA 2DOAA 2K5CA 1V5FA 2PJRB 1S9HA 2L2OA 2HNHA 3KYLA 3LL7A 4YEJA 4DOZA 2LBFB 3G2BA 2IGNA 3S3OA 4AVZA 1D0ZA 1YX3A 3E0JB 2O5RA 3S93A 1OR7C 2AQFA 3SEQA 3AL0C 2WY7Q 3F9KA 3PFYA 2V9KA 3DU6A 4CCNA 3S8PA 1D1CA 2UWMA 3CP8A 4KJZA 2KP6A 3OYIA 3OIPA 3D5SC 3OYFA 2VJ5A 4LIVA 3OYLA 3W2VA 3L2WA 2CW8A 4XOPA 3RSNA 3OL3A 2XC7A 1Z7LA 4XLFA 4LITA 4BJTA 2BW3A 3OIQA 3DPTA 4FETA 4CCOA 2IGKA 2UUZA 4P1WA 1FMVA 4E7SA 4XKVA 2FUG2 2CH0A 4ZJZA 3BLYA 1BR2A 5CQEA 3PSFA 1D0XA 3J7AY 3CESA 1FMWA 4CUGA 3C2GA 4E6KG 3OYMA 4II3A 3HOTA 2QKLB 2R7QA 3S3MA 4XOTA 4ZTFA 2CV1A 3E1SA 1WJAA 2DT6A 4BQOA 2V6EA 1HA8A 2E5NA 2GOMA 4B48A 4LIUA 4RM2A 2WADA 3FKJA 3QODA 4OAYA 1BOBA 2VJJA 3LMMA 2MD0A 4DBQA 4XR6A 5HNHA 3LSGA 4E7LA 2OC6A 3TL4X 2LH9A 4Y3OA 4FASD 2CW7A 5HLTA 2F5VA 2VJIA 3PNYA 4ZYAA 4RM3A 5LD2C 2VPLA 2ZFUA 2A5WA 3HXLA 3OYBA 1GLNA 3ZCOA 3H5RA 4GRIA 1Z3YA 2WBMA 4PJNA 2CV2A 3OMYA 1V5GA 2VQCA 3AKZA 2X6WA 2JVGA 1MW7A 1T0FC 3I3LA 1MNEA 1LDKB 1G59A 3CP2A 2W1OA 2VASA 3OS1A 4E7ZA 3ZQQA 2XF5A 3LSMA 3HPGA 3CJRB 2PMZA 5HNFA 4C2TA 3CJQB 2IXSA 4D1QA 4J01A 3FBNB 4LG3A 2L5QA 2ZSHB 3K6GA 3FHNA 4JQFA 3PJRA 4BEHA 4XM3A 1DGWY 2Z16A 1Y56A 4KISA 4CA0A 3V42A 1Z21A 4HRIA 4F93B 4PK4A 3ZXSA 3IAM2 3OY9A 4XKWA 4F91B 2Q2EB 1U0JA 4X0GA 3DKXA 2HDWA 2MYSA 3DLAA 1X4OA 1LKXA 2VIXA 4IQ4A 3OYGA 3CMMA 1MMAA 4BUPA 1LVKA 3HKZA 4PJMA 4XLAA 1TZLA 1R6RA 4H4KC 1QHGA 4XNFA 2HQAA 3L2QA 4XONA 3DU5A 2WAEA 4HNUA 2KPMA 3DPUA 3H35A 4E7KA 3A1YA 2KDOA 3K4MA 3MMYB 2OV7A 2X6YA 4KITB 2UV1A 3K10A 4HEA2 1ZELA 3H5NA 4CCLA 1IRXA 2V7FA 3VYUB 1K6YA 3PNVA 4CCJA 1X1CA 2X1EA 2XF6A 4DIQA 3OYKA 2ZSIB 3MKWB 4AU7A 1TT0A 3K4JA 4ZDOA 2V4JC 2M3AA 1AA7A 1DGRM 4JOMA 4DGWB 4N4NB 4II2A 2M7AA 4YELA 4Y33A 1MMDA 3M1CA 2QKMB 1UG0A 4HSRA 3H9QA 4KT6A 4DJAA 2WAFA 4E7JA 4B44A 3VYRB 4XLHA 2IS1A 1UELB 2VJ4A 3K70D 4HNTA 5JHFA 2Q1ZB 1Z3XA 4E4HA 2DCEA 1E0EA 2R7SA 3K4BA 3OYAA 2LY2A 2KRCA 3VYSB 4U87A 3VDXA 3K4LA 3A4CA 2WA0A 4BU2A 3LFUA 2CS3A 5FRMA 3OOUA 3MKYB 3ZRGA 2KMUA 3DKYA 3NWSA 3S32A 4NUBA 5CKTA 4XN3A 1MMGA 3RCOA 4YRVA 4CH7A 2KLOA 2VXDA 2HPIA 3CF2A 2HVQA 1JI8A 3ZR8X 1X1BA 3ZGKA 2JUGA 3MKZA 2E5ZA 4XN0A 4CSWA 2DXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8J A;  5CKT A;  2W7N A; 
#chains in the Genus database with same CATH topology
 1OJL A;  1QVU A;  2NVY J;  4MFE A;  1ZR2 A;  1FYL A;  1VZ0 A;  1LDD A;  2L01 A;  5CQG A;  3HSF A;  3E7L A;  2AO9 A;  3N05 A;  3PQK A;  5GPA A;  1ETY A;  5GAE J;  3BTL A;  2D1H A;  1OYW A;  2LP0 A;  3BWG A;  1JHF A;  1TQM A;  3W3C A;  1LPQ A;  1U9O A;  4A3D J;  2W82 A;  1FIA A;  1V4R A;  4BE1 A;  3F8N A;  2ZNZ A;  5FB2 A;  4BXU A;  1FOX A;  1QHH D;  3ZPL A;  2M8E A;  4P5O A;  2KFD A;  4N4O B;  4NQW A;  2ZXH A;  4YFK F;  1Y1V J;  3KEO A;  3RYP A;  3WTV C;  2WAQ N;  3ZMS A;  4O5V A;  3MD2 A;  2XAS A;  1VQ7 I;  2QSF X;  4XQF A;  3L2R A;  2K02 A;  3QP5 A;  2P8T A;  4RGS A;  4KNY A;  3E3V A;  2L7Z A;  2BZT A;  5B3S H;  2HYG D;  5EEH A;  4HX4 A;  1K79 A;  2H1L A;  1PYV A;  2OF7 A;  3EUK L;  1R5G A;  2MC4 A;  1RRJ A;  1J9I A;  3K70 C;  3PO3 J;  2OUM A;  1ZRE A;  2EZH A;  1WQ2 A;  1SAU A;  4QPQ A;  2A6H F;  1BI2 A;  4Z2Y A;  1Z6T A;  2K3P A;  4E7H A;  3FXO A;  2MH2 A;  3M3Y J;  3C2H A;  2YS9 A;  2LK2 A;  1H9G A;  3M8J A;  3IV5 A;  4MEX F;  4UV9 A;  2COM A;  2P0W A;  1XMX A;  4V2G A;  1D1B A;  1W0T A;  5TIS C;  3ML6 A;  3BG3 A;  2VKD A;  1CQT A;  2ME0 A;  4LLL A;  3VYT B;  1LFP A;  4XL9 A;  5GTI C;  3PNT A;  3OYC A;  2X85 A;  4L5J A;  4IKF A;  3CDL A;  3S14 J;  1P92 A;  2BBY A;  3L2V A;  4HF1 A;  2W4S A;  4AWX B;  3B73 A;  3HL2 A;  5E1W A;  4XIC A;  1ERD A;  4BEH B;  2OD5 A;  4ABZ A;  1REP C;  1Z7U A;  3DCF A;  1P6R A;  3BCA A;  3AG1 H;  2ZO4 A;  4G7O F;  2XGC A;  4LB6 B;  4U7D A;  5M5X J;  1B59 A;  4B3X A;  4AIJ A;  2RC4 A;  4HF0 A;  1HKS A;  4O6J A;  4MQV A;  4ENM A;  3CDH A;  2VKE A;  3JTH A;  4ESB A;  4PJL A;  3LOC A;  3TQN A;  2BOL A;  2F4O B;  2VC1 A;  1ACI A;  4Y15 A;  2K4B A;  3WTW C;  3LSP A;  1GV2 A;  5L3E A;  1WPK A;  2BV6 A;  4U0V A;  2LR8 A;  2DA7 A;  4UUT A;  3CJN A;  1X4P A;  2ACJ A;  1EV7 A;  4EJV A;  2K9L A;  1B9M A;  1BOA A;  4CCK A;  1MMN A;  2Z99 A;  1OCP A;  1ETW A;  2XF7 A;  3M9A A;  4FT8 A;  4ZDL A;  1J59 A;  4FE4 A;  1BR1 A;  2ZNY A;  4AVP A;  1ZH5 A;  5IT3 A;  1W36 D;  5JLW A;  5K7F A;  4IOC F;  1IXS B;  4DZP A;  3FDY A;  3QPL A;  2QM3 A;  1SAN A;  2EZI A;  4ITV A;  2VQL A;  2R4G A;  2M4G A;  4XMY A;  3HOU J;  5FJ8 J;  1Q1V A;  4G12 A;  1YS6 A;  1U8R A;  2X51 A;  1AU7 A;  1MND A;  4HOB A;  4BY1 J;  1FSE A;  1U6G A;  5CVJ A;  3OR2 C;  4B47 A;  2PMZ N;  1QPM A;  3LQR A;  5IYC J;  3CC2 I;  1KQ8 A;  3WE2 A;  1G3S A;  3BTC A;  1IAW A;  4F52 A;  1R4N B;  2JPB A;  2L7F P;  1AWC A;  1MGT A;  5F0C A;  1WVR A;  4Y13 A;  3LSR A;  3G6E I;  5FLV A;  1X19 A;  3GTG J;  2NOJ B;  1Y6I A;  4MTE A;  4BKX A;  3I4P A;  1LB2 A;  1V54 H;  1SFO J;  2K9M A;  3HOX J;  4I0A A;  4MIM A;  3D1N I;  4NC7 A;  4RMN A;  2HYJ A;  3TGN A;  1JJ8 C;  3KP7 A;  3H0D A;  4PJ0 C;  2DOE A;  2B0L A;  1KA8 A;  2XGX A;  1BJA A;  3BQZ A;  3TMO A;  3ZQH A;  2L9N A;  1MIJ A;  3EUH C;  3I4N J;  2Z5U A;  2M0M A;  2JRM A;  1G3W A;  4IX7 A;  2HWV A;  3F6O A;  2VQH A;  1Y0U A;  3RYR A;  4M9X A;  3BG7 A;  3T8R A;  2BY2 A;  1RC9 A;  2P6S A;  3OYH A;  3BJ6 A;  2X9D A;  3M1E A;  1D0Y A;  2DA6 A;  2ADU A;  3JSO A;  1VQ9 I;  1R22 A;  5DS9 A;  3ROU A;  2J5P A;  5E18 F;  1IN6 A;  4FX4 A;  3RZO J;  2LG4 A;  2ID6 A;  3DLL F;  3CJT B;  2JT1 A;  2FNA A;  3S1Q J;  1S3J A;  3OYD A;  2Y0M A;  2W00 A;  1SFE A;  3ZQL A;  2CU7 A;  3T5X A;  6PAX A;  2ECC A;  5K7Z A;  4EV0 A;  1A04 A;  2ELJ A;  4UUS A;  2EB7 A;  3GFL A;  1OIS A;  4XRS A;  4YFN F;  2KZV A;  1YW9 A;  4NQW B;  3E6B A;  1G4D A;  2M9H A;  3WE3 A;  2ZXW H;  3ELK A;  3GBG A;  1W5S A;  4M6Y A;  2MH9 A;  2QYO A;  3GYH X;  3O8G A;  2XB0 X;  2FBH A;  3K1M A;  1R58 A;  1YO5 C;  1IGN A;  2EIM H;  2L2O A;  1DU6 A;  4RB1 A;  3GLL A;  2LNB A;  5FLX Z;  4NBQ A;  1PVE A;  4YEJ A;  2E36 A;  1B72 B;  1YX3 A;  1HDD C;  1SD6 A;  1VQN I;  3S93 A;  5EDN A;  1IJW C;  2GLO A;  2TCT A;  5EEG A;  2L4M A;  4IHS A;  1VQ4 I;  1CGP A;  2V9K A;  2UWM A;  5HS7 A;  2RGV A;  3OYI A;  1MBH A;  3I55 I;  3H0G J;  3W2V A;  2DMT A;  3KLN A;  3Q3S A;  4A3E J;  3WTS C;  5JVT A;  2DJN A;  5DD4 A;  2EJR A;  3J81 Z;  2HFH A;  3RSN A;  3OL3 A;  3HHH A;  3MZ8 A;  3OSF A;  5DDG A;  1LUJ B;  4OMY A;  3K69 A;  3CCJ I;  3CDI A;  4A3F J;  2QEN A;  2IGK A;  1TL8 A;  1FMV A;  4E7S A;  1BI0 A;  3TW7 A;  4WWC A;  2F2E A;  3L2C A;  2EFP A;  4ZJZ A;  5DCF A;  1YS7 A;  1BR2 A;  3CUO A;  2MBF A;  5CQE A;  3HM5 A;  2W84 A;  4RGR A;  5C4J J;  2K3F A;  2MC3 A;  2ICW G;  1WH5 A;  1K83 J;  2H6C A;  2E7W A;  3RKX A;  2D45 A;  2A68 F;  4XOT A;  2XGE A;  1KU9 A;  2MG4 A;  3ABK H;  2DT6 A;  3E1S A;  3S2W A;  3DFG A;  4I99 C;  2DQR A;  1IUF A;  4RM2 A;  1J0R A;  2DK5 A;  2NXN B;  3FKJ A;  1BOB A;  3LMM A;  4AYB N;  4XR6 A;  3LSG A;  2B7E A;  1IRZ A;  3M8F A;  4Y3O A;  3BR2 A;  4L9J A;  4A3M J;  4CIC A;  1Y1W J;  2X0L A;  2VJI A;  1TW3 A;  4ZYA A;  5LD2 C;  2VPL A;  3WTU C;  3E6M A;  2NNN A;  1OCT C;  1GLN A;  1R36 A;  1JUS A;  3H5R A;  2Y0S N;  3F3X A;  1UJ8 A;  4PJN A;  2CV2 A;  2FJ1 A;  1V5G A;  2ESH A;  3ESW B;  3CCL I;  2BY3 A;  1SEU A;  3PQJ A;  1T0F C;  3ZQI A;  4A3L J;  4KIF A;  2V1D A;  2QVO A;  3BPV A;  3R0J A;  2E1N A;  2H1K A;  2E7X A;  4B8X A;  2OZU A;  4E7Z A;  2JMW A;  3L7W A;  3HRT A;  5B66 C;  4IOA F;  2LKP A;  3HPG A;  3QU6 A;  4XSX F;  3RPU A;  5GTH C;  1X2M A;  4J01 A;  3FBN B;  4LG3 A;  3FHN A;  5TJJ A;  1FP1 D;  3DF8 A;  3IWZ A;  2Z16 A;  1Y56 A;  4CA0 A;  4A3I J;  2ELK A;  1POG A;  4HRI A;  3JRA A;  3F8F A;  4PK4 A;  3F23 A;  1APL C;  3IAM 2;  2FX0 A;  2VKV A;  2OCE A;  3OY9 A;  4CYD A;  4F91 B;  1P7J A;  1U0J A;  3KP3 A;  1TWG J;  2ESN A;  3DKX A;  2WWY A;  1T39 A;  1R1T A;  1FY7 A;  2F5E A;  3ECO A;  5J8C A;  3CCS I;  1RUO A;  1DU0 A;  4N9H A;  4RGU A;  2D2W A;  3G1O A;  4HNV A;  1MBG A;  5D8L B;  1X4O A;  1LKX A;  5L3D A;  1IDZ A;  2KIS A;  3FK7 A;  4PJM A;  4XLA A;  1ZQ3 P;  1GVD A;  1ULY A;  4YII A;  4XON A;  1QO0 D;  4KIB A;  4L9V A;  2DFF A;  4AIH A;  3SDG A;  4UB8 C;  2CQ7 A;  4KIT B;  1FIP A;  3GX4 X;  2LF7 A;  1ZYR F;  4HEA 2;  3WU1 B;  3NRV A;  3H5N A;  4IHY A;  5EZH A;  1IRX A;  4CCL A;  3I59 A;  1K6Y A;  3FXR A;  3GZN B;  3HUG A;  1T0F A;  3C3W A;  2MLK A;  1X1C A;  3U1D A;  2HTS A;  3IHU A;  3SHF A;  2M8G X;  3OYK A;  1OCO H;  3MKW B;  3L09 A;  4S05 A;  1ETV A;  4ZDO A;  4S04 A;  3JRI A;  4A0X A;  2H6B A;  5CYV A;  3FXK A;  2EV6 A;  4N4N B;  5J8F A;  1L0O C;  2V1X A;  3JCU C;  3TDZ C;  2P5V A;  4UUS B;  1T6S A;  1S8N A;  2O03 A;  3DV8 A;  2R5Z A;  4H0E A;  1HF0 A;  2CWE A;  2VJ4 A;  1D8K A;  1W1W E;  2FQ4 A;  1EH7 A;  4QTR A;  2GQQ A;  3K2Z A;  3VPR A;  4E4H A;  3GFI A;  1E0E A;  3OYA A;  5F0F A;  5DEQ A;  4LLG F;  3ERE D;  3VDX A;  3A4C A;  4RAY A;  2WA0 A;  3LFU A;  4WXD A;  1FC3 A;  4D5F A;  3V7R A;  2HQN A;  2Y9Y A;  1HQC A;  3MKY B;  3ZRG A;  2O3F A;  1G2H A;  2KMU A;  4IHV A;  5E79 C;  1ZLJ A;  2IA0 A;  2OCC H;  1JTX A;  2M87 A;  4A3K J;  4ENK A;  2G9W A;  3GFJ A;  3K0L A;  4P9F A;  1ZK8 A;  2DK8 A;  3LA7 A;  2KZG A;  4F7Z A;  1JI8 A;  3ZR8 X;  5HDK A;  1X1B A;  5D5X B;  1ETX A;  3FXJ A;  4Y4R A;  2BGC A;  4IHX A;  3MWM A;  5J4V A;  3FM3 A;  2DW4 A;  3B6C A;  3WU2 C;  2IS2 A;  4V2F A;  3CO6 C;  2K7L A;  2XPW A;  1TC3 C;  2D5V A;  4C3H J;  2CV0 A;  3HRS A;  3AFH A;  3WG9 A;  1YX5 A;  5FKL A;  4AD9 A;  5ILV A;  3WTT C;  3U21 A;  3ZN0 A;  2RN7 A;  3P9I A;  3TP3 A;  3JRB A;  4G7H F;  3HBL A;  1WI9 A;  2RDP A;  4G9Y A;  3AG3 H;  2PN6 A;  1SD5 A;  1I6X A;  1SVM A;  2L02 A;  1IN7 A;  1IXR C;  2IA2 A;  4XOR A;  1OLT A;  2XRL A;  4C9Y A;  2LY1 A;  4PJJ A;  2QWW A;  2V26 A;  4C3J J;  4D0P A;  4MGR A;  3RQ4 A;  3K4C A;  2LTP A;  2HS5 A;  2EA2 A;  3J7Y J;  2H8R A;  5FLX K;  3OR1 C;  2WY8 Q;  3CF5 F;  1PUE E;  3SXY A;  3CC4 I;  2MD5 A;  3C18 A;  3CMY A;  4M74 A;  2ZXJ A;  3NQO A;  3DBR B;  1DQU A;  2ZC2 A;  2NVX J;  4LG0 A;  2TRT A;  1F43 A;  2KIM A;  3H9J A;  3RPU D;  1R7J A;  5IPA A;  1HDP A;  2JSP A;  1WJE A;  1XGM A;  4Y17 A;  2RNG A;  4EJO A;  3BC8 A;  2E1O A;  5BPI A;  2GZW A;  4M3F A;  1N75 A;  3BZK A;  1MJA A;  3LSH A;  4FX0 A;  2BHZ A;  3W6J B;  1IV6 A;  4XSZ F;  2V1U A;  1H89 C;  3S16 J;  2VI6 A;  2R7V A;  2HGC A;  2O8K A;  4OAZ A;  1VND A;  3WGI A;  2E2J J;  4UUV A;  4OMZ A;  3HZJ A;  5F1R A;  1S5L C;  3J81 K;  3VSK A;  1B1B A;  3HTU A;  5IP9 J;  1WFX A;  2R7O A;  2JTV A;  3ZQF A;  1X1D A;  4CXF A;  1JXS A;  3GO5 A;  2BVL A;  2CO5 A;  2KIQ A;  1RET A;  2HPM A;  3OV8 A;  2X1C A;  3IRQ A;  2GBY A;  1P9Q C;  2DAO A;  1WCM J;  3OYN A;  3DTK A;  2EZK A;  3HPH A;  1FLI A;  5L3B A;  1VQM I;  3HC7 A;  4WX9 A;  2UXN A;  3FKI J;  3BR1 A;  2DYR H;  1WJ5 A;  2M45 A;  2Y30 A;  3E5Q A;  2DFH A;  3T1B A;  4EGY A;  4DYC A;  2DQL A;  3G73 A;  5ILS A;  1ORK A;  3A0B C;  3ONQ A;  4WK8 F;  3E5U A;  1ZRC A;  5DV5 A;  1DUX C;  3F8B A;  4FHT A;  1O7F A;  1VI0 A;  4XLC A;  2EA4 A;  3P9K A;  5D8K B;  2FNP A;  4G8X A;  1RKW A;  3HOS A;  3JAM Z;  3W2A A;  4OIO F;  3O3K A;  2MAB A;  4HPQ A;  3LQQ A;  2G0E A;  4PFO A;  3O6B B;  3BPX A;  4AM3 A;  5ICE A;  3VEP A;  1JE8 A;  1XTA A;  1LEA A;  1B6A A;  3I59 B;  4ZTJ A;  4HG2 A;  3HUG B;  4KUM A;  3JRG A;  1WSU A;  2ZXI A;  4DYR A;  2X6O A;  3MQ0 A;  5J4Y A;  4RBO A;  4HBL A;  2E60 A;  3HGG A;  2G7H A;  3M7G A;  3A2K A;  4LGW A;  5LRR A;  2RQQ A;  4UHT A;  3RQI A;  3DEU A;  4JP0 A;  2HVR A;  3FX3 A;  4ZH4 F;  5BPD A;  1SFK A;  4I09 A;  4RLF A;  3V7S A;  2UZK A;  5IT9 Z;  1XDS A;  4PFP A;  2R7R A;  2QEX I;  2VE9 A;  1IN4 A;  3I5U A;  1XG1 A;  4B4C A;  1RIO H;  2VBY A;  4EM0 B;  2DLL A;  3SFI A;  1Z67 A;  2R5Z B;  3BG5 A;  3D5R C;  3C7J A;  3A0H C;  3RIR A;  3OWT A;  1XCB A;  1E3O C;  2HOA A;  2OZ6 A;  1T2K A;  1MMS A;  4NC6 A;  3ZP5 A;  2LSO A;  1EA3 A;  2E2H J;  5L3G A;  3ZMU A;  4R1H A;  3IUO A;  2WB1 A;  3M4O J;  2LD5 A;  2O9L A;  1ZG3 A;  2YU9 J;  1R00 A;  1D5V A;  1ZAO A;  2Z9O A;  5AON A;  4G7Z F;  1B72 A;  4BJ5 C;  2XVC A;  4F55 A;  4KDP A;  4GYG A;  1R23 A;  3F8M A;  3J80 Z;  3F72 A;  4ZYH A;  5E3O A;  1K78 A;  4I01 A;  3GTP J;  2I10 A;  2CRG A;  3DQV C;  2VT2 A;  2L3D A;  2VQG A;  5AIQ A;  1CF7 B;  3PUB A;  2QQ9 A;  2CSO A;  2QUF A;  2VL8 A;  2XUB A;  3R61 A;  1UCR A;  3COA C;  5HOD A;  3KX2 A;  3N4M A;  4LLN A;  5FGM A;  1A31 A;  3HB9 A;  1KON A;  1PUF A;  4FQG A;  4IXA A;  1Q1H A;  1C0W A;  3UNG C;  4GO1 A;  4OIQ F;  1ZHF A;  2WAQ A;  2E1M C;  2LMD A;  3H36 A;  1JKO C;  2R7T A;  4HW0 A;  4PGH A;  2HKO A;  3SYT A;  3FIW A;  2LC2 A;  2CMP A;  2DFE A;  2HXI A;  3REO A;  4C3I J;  4DNC A;  5E8G A;  2X1D A;  2JUC A;  1K4S A;  3FHZ A;  3PSI A;  4DZJ A;  1J7K A;  2K5C A;  3N97 A;  2PJR B;  1S9H A;  3Q0U A;  2JPC A;  2R93 J;  3IL2 A;  3KE2 A;  2ZKZ A;  1JT6 A;  1WRJ A;  4AVZ A;  1D0Z A;  3G71 I;  3E0J B;  2O5R A;  3S17 J;  1MBE A;  1LEB A;  3E6C C;  3F6V A;  2DBB A;  2F4M B;  2VON A;  3AL0 C;  4KMU X;  2WY7 Q;  3A03 A;  3BOQ A;  5CVI A;  4LG0 B;  3CC7 I;  1FBQ A;  2NS7 A;  3O8H A;  1F4K A;  1VQK I;  3GF2 A;  3CP8 A;  3BZ6 A;  2UXX A;  1ETK A;  4RDU A;  4ENJ A;  3KCC A;  2VJ5 A;  2YR2 A;  3CTA A;  5M3M J;  4OIN F;  2PG4 A;  3CUQ C;  2XC7 A;  1IUY A;  1Z7L A;  4XLF A;  1G3T A;  2BW3 A;  2EV0 A;  3OIQ A;  3DPT A;  3GLX A;  4UVA A;  4CCO A;  2STW A;  3BG9 A;  2UUZ A;  4P1W A;  2LLK A;  2JA7 J;  3LAJ A;  3TO9 A;  2FUG 2;  3BLY A;  3A02 A;  5ICG A;  1U5T C;  3KYD B;  3GTK J;  5E3N A;  5EEA A;  4CUG A;  3R0A A;  4X1E A;  5BNG A;  2IPQ X;  3OYM A;  2JJ7 A;  4HQE A;  2QKL B;  3HGY A;  3S3M A;  2ID3 A;  2L4A A;  4BQO A;  2V6E A;  1HA8 A;  2GOM A;  2PMU A;  4B48 A;  5BQT A;  1ZRF A;  2WAD A;  4DBQ A;  1OPC A;  5HNH A;  2MD0 A;  2QBY A;  1A5J A;  2G7U A;  3JTG A;  5GAG J;  2XHK A;  4JBA A;  3H3Z A;  2HEO A;  4HLX A;  2F5V A;  5DM7 F;  3PNY A;  2LDU A;  1W4M A;  3GWZ A;  4RM3 A;  2R7D A;  3ERM A;  2A5W A;  4CYC A;  3HXL A;  4LK0 F;  4O3M A;  1UHM A;  1HST A;  5CJ9 A;  1YJN I;  2B9S A;  1Z3Y A;  2D1V A;  2WBM A;  3OMY A;  3CCE I;  4R8H A;  3T8T A;  3AKZ A;  2IP2 A;  2JVG A;  5FD5 A;  1MW7 A;  4M6X A;  5DM6 F;  1ZRD A;  3DBH B;  1MNE A;  1MH3 A;  1JHH A;  3I54 A;  4UV8 A;  2ZFW A;  2FXA A;  2E71 A;  3CP2 A;  3ABU A;  5LEJ A;  3OS1 A;  4XRM A;  3LSM A;  3CJR B;  4M6V A;  2PMZ A;  3E5X A;  1XB4 A;  2VOO A;  5D5V B;  1LDJ A;  4C2T A;  1XN7 A;  3CJQ B;  2IXS A;  2M34 A;  2QLZ A;  1XGO A;  3LFK A;  3V8L A;  4GDF A;  5IY5 H;  3ABL H;  2A61 A;  1DGW Y;  1BW5 A;  3Q0W A;  2KIU A;  3JSP A;  3ZQC A;  3KPH A;  3PFI A;  3L9F A;  4G94 A;  4A3C J;  4UVB A;  5A2Q Z;  3AAF A;  4XKW A;  3BQY A;  1HOM A;  5LGT A;  1USS A;  1U3E M;  2QZ8 A;  3IWF A;  1FT9 A;  2MYS A;  3DLA A;  3I56 I;  3SJM A;  4CHU A;  1I50 J;  2XAG A;  2ZME C;  3OYG A;  2HQR A;  3CMM A;  1IO2 A;  1LVK A;  1G6N A;  3HKZ A;  2FBI A;  3WG7 H;  5IP6 A;  5HLH A;  1O3R A;  1OQY A;  3BT9 A;  5LEK A;  2HQA A;  3L2Q A;  1PDN C;  1SVL A;  3JAM K;  3BZC A;  3DU5 A;  2FRH A;  4ENN A;  1BC7 C;  3DPU A;  4IJA A;  3A1Y A;  5BMZ A;  4BHP A;  1LVA A;  1IXC A;  2PI0 A;  3S1M J;  2OV7 A;  2RV8 A;  3EUH A;  4A5M A;  1EH8 A;  2XRO A;  1GDT A;  4HAM A;  4CCJ A;  2R0Q C;  4XID A;  2DMU A;  3ASO H;  4DIQ A;  3EDP A;  1K78 B;  1SMY F;  2ZSI B;  4KN4 X;  4AU7 A;  3GVA A;  1TT0 A;  1XSV A;  2ISY A;  4RS8 A;  5DCM A;  4XLN F;  2IVM A;  1AA7 A;  5F27 A;  3ZN1 A;  4HDU A;  2K9N A;  3LST A;  1DGR M;  5LGU A;  4DGW B;  3GTJ J;  2VOP A;  3RPQ A;  2X48 A;  1H0M A;  4MTD A;  1PUF B;  1O7L A;  4LD5 A;  4YEL A;  2JZY A;  1MMD A;  1P4X A;  3WTX C;  3M1C A;  3C1D A;  1UG0 A;  1YFH A;  4HSR A;  1RPW A;  1FX7 A;  3VYR B;  2IRF G;  4MO7 A;  3K70 D;  2COB A;  4HNT A;  5JHF A;  2A05 A;  2E34 A;  2O61 A;  3MCZ A;  1YIJ I;  1XGS A;  1XS9 A;  1AKH A;  4I98 B;  1U2W A;  4LK1 F;  2FA5 A;  3VYS B;  4Q5S F;  2ZME A;  2B63 J;  2AHQ A;  2FEZ A;  4U87 A;  3OIO A;  3MKL A;  5E3L A;  5FRM A;  1OCR H;  3OOU A;  3JRH A;  2IW5 A;  2MLG A;  1JKQ C;  2BE5 F;  2V9P A;  4Q47 A;  5C4X J;  3SFZ A;  2GWR A;  3RCO A;  2HZT A;  3ZQ7 A;  4YRV A;  3GTL J;  3BY6 A;  3P7N A;  5J1Y A;  2JUG A;  2M5W A;  3J80 K;  2E5Z A;  4XN0 A;  2HOS A;  1P7I A;  3E97 A;  4CSW A;  3QP6 A;  1YJ9 I;  4BHC A;  4HV6 A;  4XK4 A;  1A6I A;  2EIL H;  2BEO A;  5JI6 A;  2FF4 A;  3QYE A;  2HR3 A;  2DOF A;  2W7N A;  2ECB A;  2NVQ J;  3QPH A;  3MFK A;  4RLQ A;  2LYC A;  4BH9 A;  3ISP A;  3H5A A;  2K86 A;  4EMS A;  2VBX A;  1BI1 A;  4IHW A;  2HU9 A;  2BW3 B;  4M73 A;  5EGO B;  2X6X A;  1OFC X;  1ZGW A;  3TW6 A;  3CME I;  3SEZ A;  3MVP A;  4ASN A;  2YPR A;  2OA4 A;  2E1M B;  5E20 A;  2LOO A;  4EJU A;  4Q4Z F;  4D9J A;  1LFU P;  1W5C C;  1UST A;  3QOP A;  1SAX A;  2J5O A;  3L2U A;  1R9T J;  3U1K A;  3IP4 B;  4EEF G;  2ZJQ F;  4J00 A;  3BR5 A;  3QYB A;  4PCQ A;  2XKP A;  3HEF A;  2BYV E;  1TWA J;  5B5E C;  1M1E B;  2KDZ A;  1VQL I;  4AYB A;  1HLV A;  2QSH X;  5J6X A;  5K5Q A;  3FK6 A;  3BTI A;  3GW2 A;  5H20 A;  5IOZ A;  4IHT A;  3TOA A;  3KYC B;  1Z05 A;  4KA4 A;  1W0U A;  1ZN2 A;  5DUK A;  1E3H A;  2QBY B;  1QQI A;  2CUJ A;  1RUN A;  4BE2 A;  1QVT A;  2KHM A;  4UY8 I;  3AL0 B;  2O8X A;  4OWR B;  5FKM A;  2EZL A;  1RR8 C;  1ON1 A;  1Z91 A;  5KNL A;  3OS0 A;  3W6K B;  4CYC B;  5K5R A;  1VQP I;  4NB5 A;  4U0Y A;  3CO7 C;  3HIF A;  4I2O A;  3IKT A;  3W6V A;  1RI7 A;  4MFD A;  1FOW A;  1SD4 A;  3P9C A;  2IGM A;  3DTE A;  4JX5 A;  1ON2 A;  1R1V A;  1NG7 A;  2VB6 A;  4RAG A;  1UHW A;  3BR0 A;  4UB6 C;  1NK3 P;  2FE3 A;  1F5T A;  3ULQ B;  4HA8 A;  1OKR A;  1WJD A;  2MGQ A;  1Z1D A;  3CUQ B;  2IS6 A;  1BJZ A;  2IJL A;  2IT0 A;  1H9T A;  2VKH A;  3GEZ A;  2BXY A;  3S1N J;  4IEJ A;  3PIO F;  3SDB A;  2STT A;  3Q9S A;  2OAZ A;  3DXJ F;  2VLA A;  1PP8 F;  3GTM J;  3K4N A;  5J3L A;  4FTH A;  4YIR X;  3K9T A;  1U5T B;  3NAR A;  1FBS A;  3EQL F;  5D6F A;  2BY1 A;  2Y48 A;  2E2I J;  1ODD A;  2M4K A;  2L7K A;  1QZZ A;  4LFU A;  1X1P A;  5E8I A;  2NNY A;  5LHH A;  1ZG5 A;  1GT0 C;  3VWB A;  1TP4 A;  2DJI A;  1OYY A;  2Y31 A;  2XAF A;  3TP0 A;  1GXP A;  1HC8 A;  2R7F A;  2A3S A;  2PLY A;  1SMT A;  3M8E A;  4BQQ A;  4J19 A;  2LRE A;  1QNT A;  5HOO A;  2FD5 A;  4BE0 A;  4C2U A;  1UMQ A;  1UZC A;  1R5H A;  2XKO A;  1FNN A;  3K1N A;  3K1P A;  1SC7 A;  3I0T A;  5L3C A;  1KGS A;  4JYK A;  4M72 A;  2LRD A;  4PGG A;  3QOE A;  1E2X A;  3QAH A;  3BG6 A;  5CPR B;  3R4K A;  1KU7 A;  1FOY A;  1LQ1 A;  4BXF A;  3JW4 A;  3TO6 A;  2R7X A;  1XX5 A;  4C30 A;  5F64 A;  3OL4 A;  4BYY A;  5LHI A;  1I1S A;  4GFB A;  2WC2 A;  2FQ3 A;  4IZZ A;  2HDC A;  2JA2 A;  1B8I A;  1WJC A;  4BDY A;  5IOY A;  2A6E F;  3FMS A;  2K4J A;  4CZZ A;  4XKC A;  4ANJ A;  3QU3 A;  4WXH A;  3LSI A;  4Q48 A;  5DCM B;  1G3Y A;  3TBI A;  5DTD A;  3WHC A;  4BAY A;  1IG7 A;  1IV8 A;  1HBX G;  3G4S I;  2XAU A;  3DBL B;  4AIK A;  1CF7 A;  1KYW A;  1N78 A;  3TKY A;  4NC8 A;  3JRC A;  3ABM H;  2FMY A;  1T98 A;  2O0Y A;  2JA6 J;  1WJB A;  2A6T A;  1OCZ H;  4G6T B;  2Q2E A;  1XSX A;  3V8J A;  5A2Q K;  2F4I A;  3HOZ J;  4A3J J;  1EKE A;  3WU0 A;  5J1R A;  1XPX A;  2BHY A;  2L9S A;  1A6Q A;  1TT5 B;  3CQZ J;  4U0W A;  4PSW A;  5HDN A;  1U8B A;  3KP4 A;  3WGG A;  2L7M P;  4IL6 C;  1MDM B;  1QZE A;  4CDG A;  2CQX A;  1AKH B;  1BM9 A;  3WHB A;  4A6D A;  4MLO A;  1UAA A;  2ZME B;  5KHD A;  3KLO A;  1YI2 I;  4HF2 A;  1FYK A;  1ZGJ A;  3DKW A;  3I9V 2;  2PJR A;  2JK3 A;  1BR4 A;  2K9S A;  3GCM A;  1FOK A;  1Z0X A;  2IA1 A;  3CCV I;  2FBK A;  3RKW A;  3JRE A;  1I3A A;  3HSE A;  1XDU A;  2EPF A;  5LFA A;  2K9Q A;  3WGH A;  2DFI A;  1K6O A;  2GXG A;  1G8X A;  5EJC A;  4ZYE A;  3DPL C;  4W97 A;  2CQQ A;  2FSW A;  3MN2 A;  3S3N A;  2Z2S B;  2QCO A;  4KIC A;  3KZI C;  2M7B A;  1WJF A;  2JSC A;  3ZOB A;  1D1A A;  1V3F A;  3LNQ A;  1X3Z B;  3G1L A;  1W36 C;  5FRO A;  1LJ9 A;  3TOB A;  3KP6 A;  1DP7 P;  1Y39 A;  4G6Q A;  1FWZ A;  2Y2Z A;  1KQ9 A;  3FBI B;  4XLE A;  2Q8K A;  4D5C A;  2XV4 S;  4QIW N;  2VPR A;  1HW5 A;  4ESF A;  2DI3 A;  2DA1 A;  2DT5 A;  2AQE A;  3DWL E;  5H6R A;  1S7E A;  3DEE A;  2X4H A;  2RQP A;  3LWF A;  4HV5 A;  3QWL A;  1YOV B;  2CW0 F;  4I0B A;  5EG0 A;  5IYD J;  1E17 A;  1E3P A;  1P4W A;  2DYS H;  5F08 A;  3ASN H;  1WZ2 A;  3J7A O;  2HXO A;  2IGO A;  4ZC3 A;  1BIB A;  1XMA A;  3D5L A;  1B4A A;  4Y52 J;  5KAF C;  1F1Z A;  2DOA A;  1V5F A;  3IH4 A;  4QSH A;  2HNH A;  2RAE A;  3KYL A;  2JWT A;  1FSH A;  4A93 J;  5FKK A;  1MBF A;  3S2H J;  3KEQ A;  4ZZL A;  2QQ8 A;  1OR7 C;  1NK2 P;  2AQF A;  1OMI A;  3SEQ A;  1XC5 A;  1RNL A;  1WI3 A;  3FXM A;  2DA5 A;  1FTZ A;  3PFY A;  2CQN A;  4CCN A;  2GA2 A;  5ED4 A;  1D1C A;  1VQ5 I;  4KJZ A;  4ZYD A;  3OIP A;  2F5C A;  1UFM A;  4P9U A;  4LIV A;  3OYL A;  1XCV A;  3L2W A;  5D6E A;  2CW8 A;  5ERI A;  3IH2 A;  4XOP A;  2NAZ A;  4GGG A;  4ZYG A;  4D7N A;  2Y69 H;  4BJT A;  1W7P A;  1N25 A;  4FET A;  4A5N A;  3FF5 A;  4FIS A;  3G3Z A;  1KU2 A;  3J7Z I;  1YRN A;  2FOK A;  5AIP A;  4ZZD A;  5CVV A;  5DD8 A;  2TDX A;  4V19 K;  2ETH A;  1D0X A;  3CES A;  2M0C A;  2DPU A;  3C2G A;  2M2E A;  2XPU A;  2VOD A;  2PBI A;  1MSF C;  1FJL A;  3WTZ A;  3DP7 A;  3MZY A;  4II3 A;  1LFB A;  1TBX A;  3HOT A;  2OQG A;  1TQP A;  2R7Q A;  3LSJ A;  4BY7 J;  1T8I A;  3C2B A;  2WB1 N;  1WJA A;  4KFC A;  5B1B H;  2GAU A;  4LIU A;  2CFX A;  3FZV A;  1VTN C;  2OC6 A;  1ENH A;  4M3B A;  2DDA A;  5HLI A;  3B6A A;  4EGZ A;  2HI3 A;  2OPT A;  5LLQ A;  4KIG A;  4NHJ A;  3CCR I;  2MA3 A;  3JRD A;  1IN8 A;  2DA4 A;  2LFB A;  9ANT A;  5HLG A;  3ZCO A;  5B1A H;  3RKQ A;  4GRI A;  1WHU A;  1YIT I;  4MQ9 F;  2X6W A;  4RAF A;  3I3L A;  3RDI A;  2QF7 A;  3HHG A;  1LDK B;  4K2E A;  2CJJ A;  2W1O A;  2VAS A;  2OBP A;  1B8I B;  1TQI A;  3ZQQ A;  2XF5 A;  3H3U A;  4FCY A;  3NEU A;  5HNF A;  2Z3Y A;  4QLC U;  3A01 B;  3K6G A;  3PJR A;  4XM3 A;  4WCG A;  3KZY A;  4M9Z A;  5FLM J;  4KIS A;  1MD0 A;  2VBZ A;  4AUX A;  3H92 A;  2JA5 J;  1X58 A;  1ZTR A;  1Z21 A;  5ICF A;  4F93 B;  1VFC A;  1JTY A;  3KIO A;  3ZXS A;  4M3E A;  4RB3 C;  1B9N A;  1YTY A;  2KJB A;  2Q2E B;  3FMQ A;  2EIK H;  3VOD A;  3LAP A;  2PX9 A;  2PQ8 A;  5DUI A;  1LNW A;  2QA4 I;  2P6T A;  2A5Y B;  5F04 A;  5L3F A;  4HZF A;  4B1R A;  1HW1 A;  5JLX A;  3R60 A;  2M1B A;  2E35 A;  3CLQ A;  4H4K C;  5E1X A;  1K61 A;  4XNF A;  2P7V B;  2JA8 J;  2GIZ A;  2WAE A;  4HNU A;  2KPM A;  3I64 A;  2KDO A;  3BTJ A;  4RGX A;  1BW6 A;  3K4M A;  3B02 A;  2EBI A;  3MMY B;  4EQQ A;  1BC8 C;  3BDD A;  2UV1 A;  3K10 A;  1SD7 A;  4A69 C;  2V7F A;  3HRM A;  3PNV A;  3CLO A;  3QRF F;  3JR9 A;  3I58 A;  3RZD J;  1BBY A;  3HSR A;  5H6Q A;  2CGP A;  2R7Z J;  2X1E A;  3EYI A;  5BS6 A;  3ZQG A;  4OU0 A;  2HQ5 A;  4PDK A;  5LBQ A;  1EH6 A;  4WXC A;  4M9S A;  1YJW I;  3SQN A;  4XBF A;  4JOM A;  1J75 A;  1I3Q J;  2M7A A;  2DN0 A;  1UG2 A;  2MSY A;  1O3S A;  3ZMV A;  4BNC A;  2DPD A;  4A3G J;  5EGO A;  4KT6 A;  4N9I A;  2WAF A;  5DYM A;  4B44 A;  4E7J A;  1S29 A;  1IF1 A;  4XLH A;  4M3D A;  5EG0 B;  1NH3 A;  2IS1 A;  1UEL B;  2L9R A;  4LJZ F;  2R5Y B;  5JFR A;  2YX4 A;  2V6C A;  4EJT A;  2R92 J;  3EYY A;  2GM4 A;  1XGN A;  2DCE A;  1YG2 A;  5CLS A;  2LY2 A;  2KRC A;  1R71 A;  2E19 A;  2ZJR F;  3K4L A;  4BQA A;  4BU2 A;  2CS3 A;  1YLF A;  1HXD A;  1O3T A;  1IRF A;  2AXL A;  2PMH A;  3U9G A;  1D8J A;  2HDD A;  5LGN A;  5HS9 A;  4I6Z A;  3DKY A;  4KN7 X;  5FD6 A;  2OTL I;  2AXT C;  1RES A;  4CH7 A;  2XRN A;  1IDY A;  1W7P D;  2HPI A;  3TDU C;  3BJA A;  1KU3 A;  2Z33 A;  3P5J A;  2DTZ A;  1T33 A;  1GVJ A;  3TED A;  3Q5F A;  2EK5 A;  1O3Q A;  2DXI A;  3KP5 A;  2RVC A;  2XIG A;  1LE8 A;  2PJP A;  1N77 A;  2OQR A;  4FE7 A;  1X3W B;  1X3U A;  1FZP B;  2BY0 A;  3BCB A;  4L18 B;  4BGD A;  4GCV A;  3S1R J;  2VT3 A;  3RI4 A;  2F5D A;  3I71 A;  1JGS A;  2RRE A;  2XDV A;  4EM2 A;  4IQJ A;  1F36 A;  4XRS G;  3WOD F;  5C44 J;  1H88 C;  3GTQ J;  1TNS A;  4XLP F;  4HDV A;  3R6S A;  3UR3 C;  4QPO A;  4E7I A;  2L54 A;  1W7P B;  2XPV A;  2FU4 A;  2IAI A;  4L0Z B;  4PZJ A;  3HOW J;  3CUQ A;  4HST A;  4NNJ A;  4PUS A;  4I02 A;  5CVU A;  1NG6 A;  1YRN B;  5HVQ C;  3F22 A;  4U7B A;  2GA1 A;  2WTE A;  3CCM I;  2ZBK A;  4BJ6 C;  1ZGA A;  4ESJ A;  2W24 A;  2CQK A;  3IH3 A;  2OJE D;  5HS8 A;  5EF6 A;  1U5T A;  2VN2 A;  5FKN A;  1K4T A;  3V4G A;  1J2X A;  2LBF A;  3HKZ N;  4BQN A;  5IP7 J;  2NVU B;  1R5I D;  2KL4 A;  3QPS A;  3IAS 2;  5TGT A;  3V7C A;  3VSL A;  2GOX B;  2CUZ A;  2Y9Z A;  4BDZ A;  3PL8 A;  5D5W B;  4HX7 A;  5FRN A;  2DO7 A;  4LOC A;  1QA6 A;  2DTR A;  4BAC A;  3FXL A;  3FMR A;  2R7U A;  2P4W A;  2Z1D A;  2F5F A;  5J47 A;  3EET A;  3SZG A;  2CUE A;  3CCQ I;  5GAH J;  2XSD C;  3GUD A;  1QZY A;  3X2Q H;  5F0H A;  2H94 A;  4I76 A;  4YFX F;  1MSE C;  1VQ8 I;  4QWQ A;  5EYR A;  3S2D J;  5HDG A;  1SVO A;  3AG4 H;  1U9N A;  2VC0 A;  1SFX A;  2CG4 A;  3HG9 A;  3U2R A;  1PJR A;  1T56 A;  2LF8 A;  1X2N A;  3EUA A;  2P81 A;  4ZDP A;  3OYJ A;  4DQ2 A;  1VQO I;  2EFN A;  4OOI A;  1W5T A;  2LVS A;  1TWC J;  5M5W J;  2DDB A;  2IBD A;  3L00 A;  5F1J A;  2BVM A;  3M07 A;  3ZMZ A;  4DBR A;  3HRU A;  4F92 B;  2BXZ A;  3LSK A;  5IT9 K;  2V1N A;  2XSJ C;  2KT0 A;  3W2W A;  1Y8R B;  3H9G A;  4L9N A;  3GFM A;  1KZH A;  5K1Y A;  2ZJP F;  1Y0N A;  1PP7 U;  2CUF A;  2P5L C;  2NRA C;  3FM5 A;  1AHD P;  2OTJ I;  3RTR A;  1MDM A;  4S0H B;  3QPT A;  2NS0 A;  2XB5 A;  2JVH A;  3CCU I;  4JK1 X;  3HYI A;  1GXQ A;  4I7H A;  2DOD A;  5KCM A;  2HVS A;  2ZCW A;  1GHC A;  1P2F A;  1ONV A;  5D5U B;  4AID A;  2H27 A;  4KYW A;  4R79 A;  1I6H J;  3DTI A;  2L0K A;  4TV7 A;  2IS4 A;  2F6C A;  2K40 A;  2KRF A;  1YYV A;  5KAI C;  4HLY A;  1YW8 A;  2ELH A;  2XAQ A;  3PIP F;  1QBJ A;  5BOX A;  2E1C A;  2QSG X;  4A0Y A;  5FFZ A;  2QGU A;  4EAT A;  4DYQ A;  4IPA A;  1YE9 A;  2K85 A;  1MKM A;  4B09 A;  2XAH A;  4PSX A;  3K4K A;  2VXZ A;  3BR3 A;  1X1A A;  1XSD A;  1EF4 A;  2GIV A;  5E17 F;  3ABT A;  1HSJ A;  2LKS A;  3HJE A;  4A12 A;  1TWF J;  1WWX A;  2KJC A;  3K7A J;  1FBU A;  2CYY A;  4UXN A;  4A2U A;  2V79 A;  1MNM C;  4CCM A;  1IRG A;  4JX6 A;  5D4R A;  1JKP C;  2C6Y A;  2JN6 A;  3GTO J;  3F0C A;  4G6D A;  4RB0 A;  2DMN A;  1A35 A;  3HOY J;  1HKT A;  1F9N A;  2DA2 A;  2EV5 A;  4W1U A;  5FO5 A;  4Y7N J;  4BXX J;  5K7H A;  3OSG A;  3HDD A;  2EQR A;  4BBR J;  4IF4 A;  4L9T A;  1IZ1 A;  1V5E A;  3FWE A;  5FFX A;  2EWN A;  2R7W A;  1BL0 A;  4KT5 C;  4F3Q A;  2XGD A;  2WV1 A;  3CZ6 A;  2V9V A;  3EPZ A;  1WGX A;  2YU3 A;  3KEY A;  2EFW A;  1DP3 A;  2CFO A;  3GZ5 A;  4EM1 A;  2KRH A;  2FML A;  3DEW A;  2Y0S A;  1I5Z A;  3OYE A;  1LE8 B;  2R3S A;  1DDN A;  4HQM A;  3ZMT A;  2H8W A;  2HTJ A;  2DU9 A;  1Z77 A;  2KQR A;  1ZR4 A;  2EIN H;  2L9V A;  1S6L A;  1QRY A;  4XKB A;  2HZD A;  5ILU A;  4JX4 A;  3JRF A;  5IYB J;  4CZC A;  1FYM A;  1EJ9 A;  1JGG A;  1J09 A;  2I8D A;  3KFW X;  4IO9 F;  1QU3 A;  4B43 A;  1YHQ I;  3UKG A;  1FP2 A;  3NWT A;  5FKO A;  4BS9 A;  4D7M A;  4Z6Y A;  2DT7 B;  1BI3 A;  1JUP A;  1T95 A;  5CVR A;  2AS5 F;  1NHA A;  1MJB A;  1XMK A;  4B3A A;  4C2M J;  1SFU A;  4BL0 B;  1GUU A;  4RA2 A;  3QYF A;  2MFZ A;  2EFO A;  2F48 A;  3T0Y A;  1VQ6 I;  1TTY A;  1A36 A;  1BA5 A;  4MNU A;  4M3G A;  3LL7 A;  1T38 A;  1ZAR A;  3BP8 A;  2LBF B;  3G2B A;  1Z6R A;  2IGN A;  4DOZ A;  3S3O A;  3RKY A;  3LA3 A;  3PUF A;  4CO8 A;  4L5I A;  2A69 F;  1S72 I;  4CGZ A;  2I5U A;  4RB2 C;  3NAU A;  2DMQ A;  1D5Y A;  5M3F J;  3FIS A;  1BN5 A;  3F9K A;  3CCY A;  3DU6 A;  1H8A C;  1MBJ A;  3S8P A;  2EFQ A;  1TWH J;  4A0Z A;  1K7A A;  2GXA A;  2KP6 A;  1YW7 A;  1HKQ A;  2KIF A;  3TO7 A;  3D5S C;  4BHB A;  2EH3 A;  2DA3 A;  3OYF A;  1JJ6 C;  1U78 A;  1QPI A;  3I4M J;  2NVT J;  4HYE A;  5M5Y J;  1MBK A;  2QQA A;  5EZG A;  1MZB A;  2O6G E;  3L1P A;  3SZT A;  4YIF A;  4LIT A;  2P5K A;  4U88 A;  5GAD J;  3FXU A;  2RKH A;  4XKV A;  1ETQ A;  2CH0 A;  2LY9 A;  3HOV J;  4AC0 A;  2JRT A;  3BR6 A;  1V55 H;  2YUS A;  3PSF A;  3KZZ A;  1WH7 A;  3A01 A;  3J7A Y;  2MW8 A;  1FMW A;  1UHS A;  1L3L A;  4M71 A;  4E6K G;  5KK1 A;  5GP9 A;  2Y75 A;  4N0B A;  3Q0V A;  5F6F A;  3F8C A;  1MJ9 A;  3F21 A;  3IRR A;  1Z9C A;  4ZTF A;  1R1U A;  5D4S A;  2CV1 A;  3OOP A;  2E5N A;  2VBW A;  1GV5 A;  3H3V K;  2KKO A;  2ISZ A;  1I1G A;  3FXQ A;  3QOD A;  4OAY A;  4E7L A;  2VJJ A;  1XD7 A;  2EIJ H;  2W48 A;  4BBS J;  3WTY C;  1ITY A;  3TL4 X;  2FOW A;  2LH9 A;  2RNJ A;  4FAS D;  2CW7 A;  4A6E A;  5HLT A;  2A07 F;  1KYZ A;  3GZ6 A;  2ZFU A;  3OYB A;  3S15 J;  2W85 A;  4NDL A;  2ME6 A;  4HX8 A;  4MHG A;  4IVN A;  3AG2 H;  3E6D A;  1IN5 A;  2VQC A;  1IW7 F;  1ETO A;  1WKM A;  3CD6 I;  1OYI A;  1D3Y A;  2IEK A;  3ZMD A;  1O4X A;  3VOE A;  1G59 A;  1I39 A;  1FTT A;  4IRH A;  1DPR A;  1TLH B;  1R4M B;  2W25 A;  1JKR C;  1AOY A;  4D1Q A;  2VE8 A;  4L0Y B;  3MEX A;  3KET A;  2L5Q A;  2ZSH B;  4LB5 A;  4ETS A;  4JQF A;  3LA2 A;  4BEH A;  1STZ A;  3VB2 A;  1TNT A;  4A3B J;  4YG2 F;  5H2F C;  1NTC A;  1TW2 A;  2NYX A;  2DMP A;  3V42 A;  2JQ7 A;  3KP2 A;  4LMY A;  1VF9 A;  4WF2 A;  3O2P E;  2W57 A;  3HTS B;  4X0G A;  3CMA I;  3IC7 A;  2HDW A;  4X6A J;  1P4A A;  2ZJ2 A;  2QQB A;  2WV0 A;  3H1C A;  1FEX A;  1ZLK A;  2PFB A;  2HKX A;  3MAJ A;  1J5Y A;  2NOG A;  3MZH A;  5ICC A;  2VIX A;  2R5Y A;  4IQ4 A;  3K2A A;  4IRG A;  1MMA A;  3GXO A;  4P55 A;  2OU2 A;  4BUP A;  1TZL A;  1R6R A;  2YSR A;  1QHG A;  5C3E J;  2P7C B;  4E7K A;  4KMF A;  3H35 A;  3QQA A;  2X6Y A;  2PEX A;  4OIR F;  1ZEL A;  3RJP A;  3SZP A;  2Q0O A;  3Q9V A;  3VYU B;  1ZG1 A;  3BRO A;  4EVI A;  4ON0 A;  1JT0 A;  2N8G A;  2ZB9 A;  1HW2 A;  5TRD A;  5JHU A;  2XF6 A;  3G1M A;  1YQA A;  2K27 A;  1S7A A;  3IKV A;  1MH4 A;  1R49 A;  3K4J A;  3VFZ A;  2V4J C;  4GYI A;  5KVR A;  2H09 A;  4GXO A;  2M3A A;  2YX7 A;  1IC8 A;  5LRS A;  4OIP F;  4RAZ A;  3PM1 A;  5J1U A;  1I27 A;  4II2 A;  5JR3 A;  4Y33 A;  5E1Z B;  4DW6 A;  1FPQ A;  4IRI A;  4UNO A;  1JUM A;  1T08 B;  2QKM B;  1S7O A;  1ZKG A;  5GPC A;  2NS8 A;  1RKT A;  1RR7 A;  3H9Q A;  4DJA A;  1DPU A;  3V8K A;  4E70 A;  2HYF A;  4L5E A;  1O57 A;  1RZ4 A;  1UB9 A;  4MEY F;  2Q1Z B;  3ECH A;  3I53 A;  1KQ0 A;  1Z3X A;  3PO2 J;  2XAJ A;  4XRF A;  4P96 A;  2R7S A;  3K4B A;  1QGP A;  1BIA A;  3GME A;  1OCC H;  2GXB A;  1Y8Q B;  5LHG A;  3BJO A;  4EJW A;  2O7O A;  3NWS A;  3D0S A;  2LKX A;  3S32 A;  4NUB A;  2VUM J;  5CKT A;  4XN3 A;  1MMG A;  2M30 A;  2HOT A;  2KLO A;  1YIO A;  2VXD A;  5J40 A;  1HCR A;  3CF2 A;  5JVG F;  5E3M A;  2HVQ A;  2HOE A;  3ZGK A;  3MKZ A;  1OR7 A;  3OS2 A;  5K5O A;  4UVC A; 
#chains in the Genus database with same CATH homology
 1N77 A;  3BCB A;  1VZ0 A;  2IS2 A;  5CQG A;  4BGD A;  2CV0 A;  2RRE A;  3N05 A;  2XDV A;  3QYE A;  4IQJ A;  2W7N A;  3AFH A;  4RLQ A;  2LYC A;  1YX5 A;  3H5A A;  3UR3 C;  3W3C A;  4QPO A;  3U21 A;  2HU9 A;  2BW3 B;  4E7I A;  2W82 A;  2X6X A;  4BE1 A;  4HST A;  3SEZ A;  4NNJ A;  1QHH D;  4PUS A;  1NG6 A;  2E1M B;  4P5O A;  5HVQ C;  2LOO A;  4N4O B;  4U7B A;  2ZXH A;  4D9J A;  4XOR A;  4BJ6 C;  3L2U A;  1OLT A;  3MD2 A;  3IP4 B;  4J00 A;  3QYB A;  4C9Y A;  4XQF A;  2LY1 A;  3L2R A;  4PJJ A;  2V26 A;  3RQ4 A;  3K4C A;  4AYB A;  2LBF A;  1PYV A;  4BQN A;  3EUK L;  2MC4 A;  3OR1 C;  2WY8 Q;  3K70 C;  2OUM A;  2KL4 A;  3IAS 2;  5TGT A;  1SAU A;  4QPQ A;  3VSL A;  2GOX B;  2CUZ A;  2CUJ A;  4BE2 A;  1DQU A;  2KHM A;  3PL8 A;  4BDZ A;  3H9J A;  2K3P A;  3RPU D;  5FRN A;  3AL0 B;  2JSP A;  1WJE A;  4OWR B;  4E7H A;  4BAC A;  2RNG A;  5KNL A;  3OS0 A;  3BC8 A;  3C2H A;  2R7U A;  1N75 A;  3LSH A;  3M8J A;  2Z1D A;  2P0W A;  3SZG A;  4Y4R A;  1D1B A;  2IGM A;  2VKD A;  3DTE A;  2R7V A;  4OAZ A;  3VYT B;  1LFP A;  1NG7 A;  4XL9 A;  3PNT A;  2VB6 A;  3OYC A;  2X85 A;  4IKF A;  1WJD A;  3VSK A;  2IS6 A;  1WFX A;  2R7O A;  2VKH A;  1X1D A;  3HG9 A;  3SDB A;  3L2V A;  2W4S A;  2BVL A;  1PJR A;  2VLA A;  2HPM A;  3HL2 A;  1ERD A;  3EUA A;  3K4N A;  2X1C A;  4BEH B;  1P9Q C;  4ZDP A;  3OYJ A;  3BCA A;  3OYN A;  3DTK A;  3HPH A;  4B3X A;  3HC7 A;  2BVM A;  2M4K A;  2L7K A;  4DBR A;  1WJ5 A;  4F92 B;  4PJL A;  3LSK A;  2BOL A;  3VWB A;  2DJI A;  2V1N A;  2XSJ C;  3W2W A;  3H9G A;  3ONQ A;  4BQQ A;  2LRE A;  5HOO A;  4BE0 A;  3RTR A;  4XLC A;  4C2U A;  1X4P A;  2K9L A;  3HOS A;  4CCK A;  1MMN A;  2JVH A;  3W2A A;  2LRD A;  2MAB A;  2XF7 A;  3QOE A;  4HPQ A;  4ZDL A;  4PFO A;  5KCM A;  3BG6 A;  5CPR B;  2HVS A;  1BR1 A;  1W36 D;  4BXF A;  2R7X A;  4C30 A;  4R79 A;  3OL4 A;  3DTI A;  3FDY A;  4HG2 A;  3HUG B;  4ZTJ A;  2IS4 A;  4IZZ A;  2F6C A;  4ITV A;  2JA2 A;  2VQL A;  2ZXI A;  2R4G A;  1WJC A;  4BDY A;  2M4G A;  4XMY A;  2E60 A;  3A2K A;  4XKC A;  4ANJ A;  2RQQ A;  2X51 A;  3LSI A;  3TBI A;  1MND A;  2HVR A;  2XAU A;  4EAT A;  3OR2 C;  4B47 A;  1N78 A;  1SFK A;  4RLF A;  1YE9 A;  4NC8 A;  4PFP A;  2R7R A;  4PSX A;  3K4K A;  2VXZ A;  1WJB A;  1X1A A;  2A6T A;  4F52 A;  4G6T B;  2F4I A;  1X19 A;  2NOJ B;  1Y6I A;  2L9S A;  3D5R C;  4PSW A;  3OWT A;  2K9M A;  4NC7 A;  4RMN A;  4CCM A;  1EA3 A;  3IUO A;  4MLO A;  1UAA A;  5KHD A;  3H0D A;  2WB1 A;  3I9V 2;  3TMO A;  2PJR A;  2L9N A;  3EUH C;  1BR4 A;  2M0M A;  4IX7 A;  4BJ5 C;  5LFA A;  1V5E A;  2R7W A;  4F55 A;  2VQH A;  1G8X A;  4F3Q A;  3CZ6 A;  3DPL C;  3EPZ A;  3BG7 A;  3S3N A;  2Z2S B;  3KEY A;  3OYH A;  1DP3 A;  1D0Y A;  2CFO A;  2M7B A;  1WJF A;  2KRH A;  1D1A A;  2Y0S A;  3DQV C;  3OYE A;  2VQG A;  3PUB A;  2VL8 A;  5FRO A;  1W36 C;  2LG4 A;  3KX2 A;  2KQR A;  4XLE A;  3FBI B;  1KON A;  3OYD A;  2W00 A;  4XKB A;  2HZD A;  2AQE A;  3UNG C;  4CZC A;  3DWL E;  1J09 A;  2I8D A;  1QU3 A;  4B43 A;  3DEE A;  2ELJ A;  3NWT A;  4BS9 A;  2WAQ A;  2E1M C;  3OS2 A;  2R7T A;  2DT7 B;  2KZV A;  1T95 A;  3SYT A;  2LC2 A;  4NQW B;  2CMP A;  2IGO A;  4ZC3 A;  3GBG A;  3D5L A;  4BL0 B;  2X1D A;  3QYF A;  2MFZ A;  3PSI A;  2DOA A;  2K5C A;  1V5F A;  2PJR B;  1S9H A;  2L2O A;  2HNH A;  3KYL A;  3LL7 A;  4YEJ A;  4DOZ A;  2LBF B;  3G2B A;  2IGN A;  3S3O A;  4AVZ A;  1D0Z A;  1YX3 A;  3E0J B;  2O5R A;  3S93 A;  1OR7 C;  2AQF A;  3SEQ A;  3AL0 C;  2WY7 Q;  3F9K A;  3PFY A;  2V9K A;  3DU6 A;  4CCN A;  3S8P A;  1D1C A;  2UWM A;  3CP8 A;  4KJZ A;  2KP6 A;  3OYI A;  3OIP A;  3D5S C;  3OYF A;  2VJ5 A;  4LIV A;  3OYL A;  3W2V A;  3L2W A;  2CW8 A;  4XOP A;  3RSN A;  3OL3 A;  2XC7 A;  1Z7L A;  4XLF A;  4LIT A;  4BJT A;  2BW3 A;  3OIQ A;  3DPT A;  4FET A;  4CCO A;  2IGK A;  2UUZ A;  4P1W A;  1FMV A;  4E7S A;  4XKV A;  2FUG 2;  2CH0 A;  4ZJZ A;  3BLY A;  1BR2 A;  5CQE A;  3PSF A;  1D0X A;  3J7A Y;  3CES A;  1FMW A;  4CUG A;  3C2G A;  4E6K G;  3OYM A;  4II3 A;  3HOT A;  2QKL B;  2R7Q A;  3S3M A;  4XOT A;  4ZTF A;  2CV1 A;  3E1S A;  1WJA A;  2DT6 A;  4BQO A;  2V6E A;  1HA8 A;  2E5N A;  2GOM A;  4B48 A;  4LIU A;  4RM2 A;  2WAD A;  3FKJ A;  3QOD A;  4OAY A;  1BOB A;  2VJJ A;  3LMM A;  2MD0 A;  4DBQ A;  4XR6 A;  5HNH A;  3LSG A;  4E7L A;  2OC6 A;  3TL4 X;  2LH9 A;  4Y3O A;  4FAS D;  2CW7 A;  5HLT A;  2F5V A;  2VJI A;  3PNY A;  4ZYA A;  4RM3 A;  5LD2 C;  2VPL A;  2ZFU A;  2A5W A;  3HXL A;  3OYB A;  1GLN A;  3ZCO A;  3H5R A;  4GRI A;  1Z3Y A;  2WBM A;  4PJN A;  2CV2 A;  3OMY A;  1V5G A;  2VQC A;  3AKZ A;  2X6W A;  2JVG A;  1MW7 A;  1T0F C;  3I3L A;  1MNE A;  1LDK B;  1G59 A;  3CP2 A;  2W1O A;  2VAS A;  3OS1 A;  4E7Z A;  3ZQQ A;  2XF5 A;  3LSM A;  3HPG A;  3CJR B;  2PMZ A;  5HNF A;  4C2T A;  3CJQ B;  2IXS A;  4D1Q A;  4J01 A;  3FBN B;  4LG3 A;  2L5Q A;  2ZSH B;  3K6G A;  3FHN A;  4JQF A;  3PJR A;  4BEH A;  4XM3 A;  1DGW Y;  2Z16 A;  1Y56 A;  4KIS A;  4CA0 A;  3V42 A;  1Z21 A;  4HRI A;  4F93 B;  4PK4 A;  3ZXS A;  3IAM 2;  3OY9 A;  4XKW A;  4F91 B;  2Q2E B;  1U0J A;  4X0G A;  3DKX A;  2HDW A;  2MYS A;  3DLA A;  1X4O A;  1LKX A;  2VIX A;  4IQ4 A;  3OYG A;  3CMM A;  1MMA A;  4BUP A;  1LVK A;  3HKZ A;  4PJM A;  4XLA A;  1TZL A;  1R6R A;  4H4K C;  1QHG A;  4XNF A;  2HQA A;  3L2Q A;  4XON A;  3DU5 A;  2WAE A;  4HNU A;  2KPM A;  3DPU A;  3H35 A;  4E7K A;  3A1Y A;  2KDO A;  3K4M A;  3MMY B;  2OV7 A;  2X6Y A;  4KIT B;  2UV1 A;  3K10 A;  4HEA 2;  1ZEL A;  3H5N A;  4CCL A;  1IRX A;  2V7F A;  3VYU B;  1K6Y A;  3PNV A;  4CCJ A;  1X1C A;  2X1E A;  2XF6 A;  4DIQ A;  3OYK A;  2ZSI B;  3MKW B;  4AU7 A;  1TT0 A;  3K4J A;  4ZDO A;  2V4J C;  2M3A A;  1AA7 A;  1DGR M;  4JOM A;  4DGW B;  4N4N B;  4II2 A;  2M7A A;  4YEL A;  4Y33 A;  1MMD A;  3M1C A;  2QKM B;  1UG0 A;  4HSR A;  3H9Q A;  4KT6 A;  4DJA A;  2WAF A;  4E7J A;  4B44 A;  3VYR B;  4XLH A;  2IS1 A;  1UEL B;  2VJ4 A;  3K70 D;  4HNT A;  5JHF A;  2Q1Z B;  1Z3X A;  4E4H A;  2DCE A;  1E0E A;  2R7S A;  3K4B A;  3OYA A;  2LY2 A;  2KRC A;  3VYS B;  4U87 A;  3VDX A;  3K4L A;  3A4C A;  2WA0 A;  4BU2 A;  3LFU A;  2CS3 A;  5FRM A;  3OOU A;  3MKY B;  3ZRG A;  2KMU A;  3DKY A;  3NWS A;  3S32 A;  4NUB A;  5CKT A;  4XN3 A;  1MMG A;  3RCO A;  4YRV A;  4CH7 A;  2KLO A;  2VXD A;  2HPI A;  3CF2 A;  2HVQ A;  1JI8 A;  3ZR8 X;  1X1B A;  3ZGK A;  2JUG A;  3MKZ A;  2E5Z A;  4XN0 A;  4CSW A;  2DXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...