5CKTA

Crystal structure of kora, a plasmid-encoded, global transcription regulator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TrfB transcriptional repressor protein
publication title Flexibility of KorA, a plasmid-encoded, global transcription regulator, in the presence and the absence of its operator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16509 KORA TrfB plasmid transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5cktA00
3M8JA 5CKTA 2W7NA
chains in the Genus database with same CATH superfamily
4E7IA 1AKHA 5FD6A 3ZMTA 2E1OA 1FSEA 1B8IB 1I1SA 2AXLA 2QKMB 3QU3A 2OAZA 3HKZN 1U8RA 2VQCA 1WPKA 2LH9A 2R7SA 1JI8A 3M8FA 3KZZA 3MAJA 3HOWJ 4B48A 1D0ZA 1MKMA 1LJ9A 4FE7A 2XAJA 3T8RA 5ICEA 5J1YA 1ZYRF 5KHDA 2LY9A 2Y0SN 1WGXA 4I01A 5F64A 4JX5A 5LD2C 3PFYA 3DLLF 1Y8QB 4FT8A 3VFZA 3A01B 4RGUA 2PMZN 1ETWA 1I3AA 5JR3A 4MO7A 3BG7A 4E7SA 2M0MA 3KP4A 3WGGA 4B8XA 1LQ1A 1YITI 2L7MP 2LKXA 2RKHA 2VKDA 2CUZA 2YU3A 5F0HA 3M4OJ 3V7RA 1S3JA 4M74A 2Z2SB 3ISPA 2E2IJ 5DCFA 2CV1A 2FQ4A 3K2ZA 3S15J 2VC0A 3GVAA 2D1VA 2XAQA 5L3BA 1ZG1A 4M3BA 2WAQA 1ZTRA 2R7RA 2XC7A 1ZR4A 5HDGA 2VOOA 4JP0A 5LRSA 1NTCA 2L3DA 2VJ5A 3CMYA 4L0YB 4UV9A 2R7ZJ 2GZWA 4A2UA 1HDDC 1E0EA 1LE8A 4IOCF 4Q4ZF 3LOCA 3GO5A 3GXOA 1W5CC 4P5OA 5J4YA 4HDUA 2ADUA 3FM3A 2Y75A 3TMOA 1YHQI 4D5FA 2CUEA 1NG6A 3KLOA 3I56I 1B72B 4A5MA 3WGHA 3IWZA 4M6YA 4UUVA 3S2DJ 4HDVA 1RESA 3JTGA 1WJCA 5HDKA 5J8CA 1SC7A 4M3GA 2KIMA 4EJOA 1MW7A 2ZXIA 4L9NA 1VQ9I 1YO5C 2A5YB 4LLLA 3J81Z 2KT0A 2VBZA 1QGPA 3BLYA 3LQRA 1UHWA 4HW0A 4YFKF 3A0BC 2BVLA 4EM2A 4RMNA 4BH9A 1BIBA 5L3CA 5LGUA 1SVMA 2GXAA 4BE2A 2CQQA 4Q5SF 3B02A 4KN7X 2L4MA 1MBFA 4IJAA 3M1CA 4XLFA 4B4CA 4G7ZF 1IDZA 2LY1A 1UAAA 2A5WA 2K4BA 4HV6A 4G7OF 1WJBA 1U3EM 3HM5A 4ENKA 3VOEA 2H27A 2PLYA 2PMHA 3GCMA 2XAUA 1ZLJA 4LJZF 1B8IA 1TQIA 1BR4A 1JTYA 5FD5A 1XC5A 2HQAA 3L09A 2NVTJ 2DPDA 2QGUA 1S29A 3BG6A 1FIAA 1FP2A 2JTVA 3L2UA 1S8NA 5HNFA 3RZDJ 2R7OA 5KNLA 2KKOA 3TBIA 1TQPA 2KDZA 4A3CJ 2BY2A 1B9NA 2GAUA 1NH3A 4J01A 2JVHA 4EMSA 3A01A 4LGWA 2ETHA 4D9JA 3PIOF 1TZLA 2KPMA 1XSXA 1IGNA 3F8MA 2O61A 1F36A 3WG7H 3BJ6A 2R7WA 5CVRA 4EGYA 1LDDA 1P6RA 1X58A 5ICCA 3IAM2 4GYIA 3HUGB 4Z2YA 1X4OA 2X51A 4ZZLA 3HOSA 3G4SI 5FLXK 1K83J 2H09A 2ZXWH 3JTHA 2Z1DA 4BJ6C 2NOGA 3Q0UA 4QPQA 1YX5A 5K5RA 1D1BA 2E34A 4L9JA 1H0MA 4DJAA 1YOVB 1HQCA 3HRUA 5FGMA 4A3KJ 1XN7A 3E6MA 3TQNA 3OYMA 4G7HF 2QCOA 4MTDA 1TT5B 4S04A 5LFAA 3GX4X 4XLEA 2QQ9A 2G9WA 2J5PA 2VUMJ 3P9KA 5HVQC 1LDJA 4XICA 2X48A 2FSWA 4J19A 4KDPA 4OU0A 3P9CA 2DA5A 3LSPA 2ID6A 1QZZA 4BUPA 2PX9A 1HW1A 3MWMA 1OR7A 4I0AA 2STTA 1LFPA 1R58A 1B72A 2K3PA 1YG2A 3DP7A 2WV1A 3B73A 2IBDA 3P9IA 2XPUA 4HNUA 2QBYB 1RKWA 1FLIA 2H6CA 2QF7A 2V9VA 4NB5A 4RA2A 3DV8A 5D4SA 4BQNA 4WX9A 2L7KA 3ABLH 4U7DA 2Q2EB 5BMZA 2UUZA 2OV7A 3CCSI 2FMLA 1MSEC 5F1JA 2QQ8A 1YX3A 3F8CA 3RKXA 3MKYB 3PNTA 5DDGA 1M1EB 4I76A 1K61A 1ZKGA 4GGGA 4HAMA 4MFDA 1LUJB 1YQAA 2P5KA 4D1QA 3AKZA 4OIRF 2HXIA 3OOUA 2F48A 1A04A 3ZR8X 1WI9A 1XCVA 2HOTA 2WAQN 1OISA 2ESHA 3A1YA 5LLQA 2XB0X 1UELB 2Y9ZA 5EDNA 2Y2ZA 2BY0A 2LP0A 3QWLA 5D8LB 2D1HA 1XD7A 5K5OA 1EH8A 5ILVA 2M7AA 3GTPJ 3S2HJ 1UHSA 1E3OC 2R7TA 2PJPA 1J9IA 1IN6A 2HDWA 1POGA 4I6ZA 2K85A 4W1UA 1QZEA 3F6OA 3V42A 3IRQA 1OCTC 2PEXA 2O8XA 4PJMA 1S6LA 1X3ZB 4FX0A 4XSZF 5M5XJ 1L3LA 2CS3A 4QSHA 2XASA 1YJ9I 4UXNA 4LB5A 4A6EA 2ICWG 4ETSA 1U5TB 1HSJA 4XRSA 3J7AO 1XGSA 5B1AH 5FLXZ 3OYHA 3F3XA 3QQAA 4KT6A 3H35A 3DU5A 1SAXA 4OIQF 3HUGA 4RAGA 5CYVA 2LOOA 3TGNA 4DBRA 1USSA 4AIKA 2EJRA 4XLCA 2BW3B 1ON2A 3BTIA 5J3LA 4KFCA 2KIUA 3TP3A 1RETA 2DMUA 2X1EA 1H9TA 4E7LA 4N9IA 2R92J 3MZ8A 1P4AA 1VQKI 3RZOJ 1V5GA 1R7JA 5EJCA 3BG3A 2DK5A 1SMYF 1J09A 3B6AA 4QWQA 3CDHA 2W84A 3D5RC 4A93J 3S93A 1ETVA 2ME6A 5BS6A 3HXLA 2R93J 3V8LA 2HZDA 4LLGF 2XKOA 1D5YA 2P4WA 1ZK8A 2JMWA 3WTXC 3E6DA 2GXBA 1LFBA 2L54A 2LLKA 4EJWA 1F4KA 4II2A 2MYSA 3HRSA 5D5WB 3SZPA 4BGDA 3JRIA 2VT2A 3TW7A 3WTWC 2LMDA 3OS0A 2QBYA 2EH3A 1RUOA 3ABTA 3GMEA 2IS1A 2NVXJ 3CO6C 2LYCA 2Q2EA 1IZ1A 2XF6A 3NRVA 1WQ2A 1YIOA 3W2AA 4KMUX 1APLC 2ESNA 3PFIA 1W36C 4BY1J 3R0AA 4BL0B 2XGEA 5DM7F 3PUFA 2VQGA 5JFRA 3SYTA 2VKHA 3QYEA 1XPXA 2PJRB 2L2OA 3M3YJ 5DD8A 1Z0XA 2E5NA 4IHVA 4RB1A 1TT0A 1YYVA 1MSFC 2P5VA 3K1PA 2IA1A 4PUSA 2DOEA 3LSJA 3R4KA 3L2VA 2ZMEB 4BJTA 5M3MJ 1FOXA 1K7AA 4GO1A 2EA4A 3FXJA 3FHNA 3KP3A 1OCCH 4XLPF 4YFXF 4L0ZB 2PQ8A 2XF5A 4E6KG 4RDUA 4B3XA 3BQZA 4CH7A 2HQNA 3ZN1A 1ZARA 1W36D 2WADA 3CESA 2CFXA 3HTUA 3MMYB 4A3DJ 2JZYA 1JKPC 3S1QJ 3GEZA 4LMYA 1XDUA 4M6XA 4D7NA 1Z7UA 2OA4A 1Z7LA 4MFEA 2WY7Q 1VQOI 5CVUA 4L5EA 1V54H 2ZKZA 4HV5A 3RCOA 2Y30A 3H36A 2P81A 1KGSA 2LC2A 1U5TA 2GBYA 4KA4A 4BYYA 3CUQC 2B9SA 4YG2F 3JAMK 4A3JJ 3ZGKA 4UB8C 2B0LA 3CC2I 1FYKA 1T0FC 2DQRA 2K9LA 3WU2C 4D5CA 1VNDA 3GLLA 3FF5A 5JHUA 1TWHJ 4HEA2 2A6HF 1ZR2A 3CLQA 4LOCA 4RLQA 4IX7A 1A35A 1SD7A 3OIPA 1U0JA 1DPUA 1E3PA 2BHYA 3ZQQA 3RI4A 1J5YA 1ZHFA 1TLHB 3PQJA 4M72A 5BOXA 2CQNA 2EILH 2K9SA 1TNTA 1IN8A 3MFKA 4KNYA 1Y0UA 5D5XB 1I6XA 2OTLI 4B44A 1IXRC 2K9NA 1XTAA 1IN5A 1IUYA 2HTJA 4AYBA 2EIKH 3NEUA 2DTZA 1FJLA 3K4KA 3LAJA 3OS2A 2QLZA 1EH6A 3HRMA 4A6DA 1MDMB 5E8IA 3GZNB 4H0EA 3K7AJ 3OMYA 3LL7A 3T8TA 1ON1A 5CJ9A 2KL4A 3FXQA 2EFPA 2HS5A 2K86A 2VXZA 4XL9A 2YS9A 4EM0B 1I1GA 1OCOH 1SFOJ 2PJRA 2OTJI 3C7JA 1XGOA 1MNEA 3HPGA 1K6OA 2OU2A 3ROUA 2XPWA 1FTZA 5C4JJ 4C2TA 3LSMA 3SHFA 1G8XA 2JK3A 5FKNA 2ZMEA 4HZFA 4XN0A 5FKKA 4PCQA 4M3FA 1PVEA 1KYWA 4DZPA 1W0TA 4UVAA 1D0YA 2JRMA 3WG9A 5J1RA 3C2GA 1TW2A 2X6OA 2R5YB 2E71A 2M45A 3ABUA 5FKOA 3ZQIA 1U8BA 3NARA 1G3TA 1GXPA 5EZGA 3DKXA 4M9XA 3A03A 2BOLA 1R4NB 2M8GX 2ZBKA 1T56A 2VI6A 1QU3A 2CUJA 2W24A 1ZQ3P 3JRFA 2ZMEC 3L1PA 1V4RA 4BU2A 2GOMA 4BXXJ 2VJIA 1R71A 1WH5A 4DGWB 2KZGA 3EDPA 4OWRB 5HLTA 4BE0A 2NVUB 1PP7U 2IPQX 1BR1A 2H94A 3P7NA 1IXSB 3JRCA 3D5SC 2CSOA 2XROA 3REOA 4YIFA 4HF1A 3LNQA 3LA7A 3OOPA 1RR7A 4HF2A 1GV2A 1VQ7I 2OQGA 1ZRFA 2AHQA 2HYGD 4ZTFA 3U9GA 1SMTA 1D3YA 3L2WA 3IHUA 1O3RA 3ZQCA 1VQNI 4RGRA 9ANTA 1MBJA 1FZPB 2HDDA 1VQ8I 5GAHJ 2HWVA 2VL8A 4CYCB 1IC8A 4O6JA 4PGHA 5HODA 3RPUA 1P2FA 2K9MA 2L9NA 3CP8A 2QUFA 4I2OA 3BWGA 1P4WA 1EF4A 4F55A 2P0WA 3N05A 1WI3A 3FDYA 4MLOA 3LAPA 2VBXA 3EUAA 3PIPF 3DTEA 1TL8A 3SZGA 4S0HB 2XGDA 1W0UA 4DQ2A 3JREA 3QPTA 3ZQFA 1J59A 1Z91A 3DBRB 3HPHA 3O8HA 3GTMJ 2DA3A 5H6RA 4WF2A 5F1RA 3HOVJ 3AG1H 1G3WA 2EZLA 4FISA 1A6QA 3OYIA 4U87A 1MDMA 1TNSA 2MA3A 1VZ0A 2DA1A 1FSHA 3I3LA 1U6GA 1D8KA 1BN5A 3HL2A 2X9DA 1ZLKA 4XBFA 4B09A 2HKXA 3M7GA 2G7HA 3OYCA 3Q5FA 1JKRC 4XKCA 1Z3XA 3UNGC 3OWTA 4ZZDA 3U1DA 4C30A 4I7HA 4BBSJ 4ZDLA 3G3ZA 2QKLB 1UZCA 3ABMH 5CPRB 4PK4A 4DOZA 5F0FA 3CJQB 2V7FA 1Y1VJ 2ACJA 4C3JJ 3H9JA 1I6HJ 3KP6A 3RPUD 4NC7A 3E0JB 3C18A 3F6VA 3HIFA 3PO3J 3ZQLA 1F43A 2QA4I 2R5YA 2ZFWA 2I10A 2R5ZB 2XRLA 2K4JA 1VF9A 1H89C 4ANJA 3BDDA 2JVGA 3AL0C 4UB6C 2CW8A 4HX7A 5L3FA 4A3GJ 5LGTA 3DF8A 1AA7A 4AYBN 1X2NA 2ZXJA 2QSHX 1YFHA 4II3A 3I4NJ 2GA2A 2MABA 1G3YA 1R1TA 4KUMA 2WY8Q 3K4LA 5DUKA 2OPTA 3ZQ7A 1VTNC 5DS9A 3K4JA 4N4NB 1D8JA 1VFCA 1BR2A 5IYCJ 3E7LA 5M5YJ 3HOTA 2DFFA 4RB0A 2EIJH 4BDYA 1YTYA 1ZAOA 5C3EJ 1WFXA 3CCJI 4X6AJ 3AFHA 2Z33A 3ZMSA 2GA1A 2KMUA 2EFWA 4U7BA 3I58A 3DFGA 2V4JC 3B6CA 3J80K 4IKFA 3WE3A 2CU7A 1EH7A 1KQ9A 1TWCJ 4AWXB 4EJVA 4CYCA 4ESJA 2D5VA 4KN4X 3GWZA 4Y13A 5K7ZA 1MH4A 3M8JA 4D7MA 2L9VA 4QLCU 3U1KA 5FRMA 2MSYA 4FQGA 4BHPA 3DEEA 4YRVA 3JSPA 1UCRA 2CO5A 3N97A 3LSIA 5F08A 2XUBA 1SFUA 2VLAA 2DOAA 5TISC 4Y7NJ 4RAZA 4FX4A 3IAS2 5EGOB 3EPZA 1IRFA 2KRCA 2RDPA 2BHZA 2OUMA 1HSTA 4AUXA 4HPQA 5ILSA 2VQHA 1WJFA 3AAFA 3GLXA 3EUKL 1QHHD 4Y3OA 5ILUA 4E7JA 2R7DA 2R4GA 2IS2A 1XDSA 2DBBA 2Q8KA 1DGWY 2GOXB 3VYSB 1XCBA 1Y1WJ 2FOKA 2K5CA 4JK1X 3W3CA 5ICFA 2MC3A 1JUMA 1ZG5A 4CXFA 3EETA 2FQ3A 1X1CA 3A2KA 1Z6RA 3HYIA 1O3TA 2L4AA 2WWYA 1N77A 3ZP5A 2GM4A 3O2PE 5IYBJ 1MBHA 5J1UA 2X4HA 3KIOA 3HG9A 2MC4A 5CVVA 1AWCA 4P55A 1KU3A 4TV7A 3EYYA 2QEXI 2VBYA 4IHSA 2IP2A 1Z21A 4P1WA 2R5ZA 4M3EA 2JSPA 3IH2A 1SD4A 2AO9A 3U21A 4AVPA 4XM3A 3SJMA 2QQAA 2L9RA 1JHFA 1FNNA 4BKXA 4K2EA 4U0WA 4ZYHA 4HNVA 3ZRGA 2DT7B 3GF2A 4J00A 3V8KA 1I39A 3K69A 4RGXA 1F5TA 1ZGJA 5HS8A 3HOUJ 5ERIA 5EG0A 2GWRA 2P7VB 4UVCA 1K79A 2HI3A 5LHIA 2V9KA 2M4KA 2UV1A 4KT5C 2FOWA 1XSVA 1QRYA 3MKLA 2A05A 3QU6A 1IXCA 2HNHA 3FBIB 2BBYA 3HRTA 2BV6A 5AIPA 4AU7A 4LLNA 1I27A 2RGVA 2X0LA 2M1BA 4AVZA 3BC8A 1XMKA 3SFZA 4IF4A 3FXKA 5IYDJ 3J80Z 2XPVA 1S9HA 1W7PA 2UZKA 3BR3A 3BTJA 2NS7A 3W6JB 1I5ZA 2XAFA 3F0CA 2JPCA 2ZCWA 3RQ4A 1NG7A 3BJOA 3ZPLA 2MD0A 4XRFA 4WWCA 1GHCA 4ZYAA 4FTHA 1T2KA 2Z5UA 5JVGF 5CLSA 1OFCX 1X1DA 2Y69H 4BNCA 3S1MJ 2P8TA 4CCNA 2QYOA 2W85A 4Y33A 2C6YA 2R7FA 5GPAA 4ON0A 4A3IJ 3KYDB 2HGCA 3LSKA 3ZMDA 2ECBA 3QODA 5EGOA 4HQEA 1AOYA 1TQMA 2VODA 1ENHA 3K4BA 2G0EA 2FBIA 2IEKA 5E20A 1MMDA 3I53A 1KZHA 4ASNA 2IGOA 4IRIA 1BI3A 3RJPA 1ONVA 1TWFJ 4XKVA 3S16J 1XB4A 2XRNA 2LG4A 5JHFA 1VQLI 5LEJA 3C2BA 4AM3A 4YELA 2P7CB 3H9GA 1REPC 4A3BJ 3VODA 1MNMC 3DPUA 3X2QH 1PJRA 1ULYA 4GRIA 3KFWX 4V19K 2XHKA 4H4KC 1MMSA 3H0GJ 4P9FA 1R5HA 1W7PD 4RGSA 3OIQA 2L9SA 3G1LA 2LBFB 3QOPA 4CGZA 1FYLA 3WGIA 1W5SA 2HXOA 1GVDA 2VASA 1HF0A 1UMQA 2LREA 4CCOA 2HVSA 1QHGA 1HXDA 1DDNA 3WU1B 3JRBA 5L3DA 3RYPA 3OYDA 4WXCA 4XRMA 2FX0A 4G6QA 1IN4A 3K70C 3HZJA 1OPCA 2EV0A 5HDNA 1ETOA 3K1NA 4I09A 5FFXA 4CHUA 1WJ5A 1HKQA 2A68F 1XSDA 5EEAA 3L7WA 2HR3A 3JRAA 4R79A 2F5CA 5DUIA 1QNTA 2AS5F 1RC9A 4X0GA 2DLLA 3BG9A 1FYMA 2M0CA 4XNFA 2YX4A 1ZRCA 1A5JA 3LA3A 4DBQA 1G4DA 2HOAA 1IAWA 2ELHA 4NNJA 3CJTB 3E5QA 2H8RA 2KFDA 1S7EA 1BJAA 2O03A 3PM1A 1BW5A 1T08B 2CUFA 1TWGJ 3GW2A 3QPSA 4QTRA 3CUQB 3K70D 4Y15A 2VJ4A 1NK2P 4YIRX 1BW6A 4F93B 3C1DA 2K40A 2MG4A 2GIVA 3Q0WA 2EZHA 4E70A 2XV4S 1JTXA 1NHAA 2G7UA 1GT0C 3PNYA 3S3MA 2EQRA 2XB5A 2VT3A 5BQTA 2DMNA 1CF7B 2IS6A 1Q1HA 3WTVC 1X3UA 3I9V2 1LVAA 4ESFA 5D6EA 3D5LA 4F92B 2M7BA 4A3MJ 3RTRA 2F4MB 1EKEA 3PQKA 4N9HA 4BEHB 5E79C 4ABZA 3CF5F 2HKOA 4MHGA 3J7ZI 2R7UA 4OOIA 4L9TA 4WXHA 3KLNA 1ZELA 2DA4A 2E7XA 2W00A 4AC0A 2V6EA 4BHCA 4ZDPA 2KDOA 3FXUA 3TO7A 5CVIA 3TDUC 3FXOA 2DFEA 2JPBA 3FXLA 4XOPA 1UHMA 4CSWA 3CCQI 2KLOA 3AG2H 5CQEA 1QPIA 4R8HA 3NWSA 2DN0A 2LR8A 2EV6A 4ZC3A 4S05A 2A69F 5IY5H 2KHMA 4LK0F 3F23A 4EV0A 2M34A 2LBFA 4LITA 2R0QC 2HYJA 4ZDOA 2DMPA 1JKOC 2CGPA 2ZNYA 1S72I 2O8KA 4G6TB 5FKLA 5LGNA 3I0TA 4EATA 1IO2A 2H8WA 2ELJA 2NOJB 3S2WA 4NHJA 1GXQA 2IA2A 5J40A 2XSJC 3S14J 3TO9A 4IO9F 4P96A 2FRHA 2IGKA 1JGSA 1P7IA 2HZTA 1TWAJ 2X1DA 2P5LC 3COAC 3FX3A 3H3VK 2LVSA 2E7WA 2O6GE 4XKBA 3VPRA 3SXYA 5LEKA 2PMUA 2MD5A 3S3OA 1U2WA 2HFHA 1KU2A 1N25A 3DTIA 5F04A 3WTZA 5E3NA 3ZMUA 2NAZA 1ETKA 1JT0A 2R3SA 3I64A 4BHBA 3CD6I 1RNLA 3S3NA 3GTLJ 2E1NA 1FBQA 4IPAA 3VYRB 3SZTA 1B1BA 4XRSG 3BPVA 3KYLA 1OQYA 1RI7A 3CUQA 4YEJA 2YR2A 4D0PA 3H5NA 2DJIA 2FNAA 1DPRA 1T0FA 3A4CA 1VQPI 5E3MA 1V5EA 2RREA 3FK7A 1VQMI 1FPQA 4XOTA 2ZJQF 2K27A 3ZCOA 2NNYA 1MMAA 3KYCB 4PJLA 2DCEA 5HLGA 3HJEA 5GTHC 1CF7A 3I71A 3HOXJ 1MBEA 4IQ4A 1SANA 3SDBA 5B5EC 5CVJA 4A3LJ 4A12A 3IH3A 3QP5A 4F52A 1YLFA 4XORA 3LSHA 4BEHA 2VKVA 1KU7A 3DPLC 1IDYA 3PL8A 1R49A 5GTIC 4I02A 4AIDA 2FUG2 3IRRA 1T39A 3HSFA 1BI0A 1IF1A 1P7JA 3OYBA 3OS1A 2H6BA 3H0DA 3QYBA 3CC4I 2FD5A 3BTLA 4L9VA 2BY3A 1GUUA 3I5UA 1DGRM 2AXTC 2VBWA 1O7LA 4AD9A 5DYMA 2ZC2A 2NYXA 1F9NA 1W1WE 1C0WA 5HOOA 4IRHA 2E5ZA 1OKRA 2IW5A 5J8FA 2JUGA 1VI0A 4ZYDA 2EIMH 2KISA 3BY6A 1YW7A 4G6DA 1OCZH 3K0LA 5E8GA 5F0CA 2R7VA 3GYHX 3IKVA 3LFKA 1K6YA 2O5RA 1BOBA 3MCZA 2JQ7A 3NAUA 3BCBA 3BQYA 3ASOH 4A3EJ 2V1NA 1PDNC 1KYZA 1ZH5A 4Q47A 5IT9K 4KIBA 3IKTA 2PG4A 2HPMA 2NXNB 2ZJPF 2DFHA 1KA8A 4G9YA 2H1LA 3ABKH 2WTEA 1FT9A 3ELKA 3LFUA 3DPTA 4ITVA 3W2VA 1UG2A 4ZYGA 4JOMA 1IV6A 4Y52J 5E17F 1QQIA 1IG7A 3L2CA 1BBYA 2M9HA 2KQRA 4DW6A 2XSDC 3IV5A 2ZO4A 4GCVA 3GZ5A 3AL0B 2VQLA 5K7FA 1HKTA 4RBOA 4CYDA 2E60A 5F27A 4E7HA 5FKMA 4XQFA 2E19A 3OYKA 2QSFX 3QPLA 4IOAF 2LF8A 1RR8C 4IRGA 3RKYA 2VPRA 4FHTA 5B3SH 5HNHA 3KPHA 3CCMI 1V5FA 3J7YJ 3F22A 2LK2A 2V1DA 1D1AA 3BZCA 3FIWA 1VQ6I 2DT5A 1PUFB 2CQXA 1D0XA 3ERED 3RSNA 1WH7A 1HW5A 2O3FA 5HS7A 5E3LA 3K2AA 3JAMZ 3BP8A 4EJUA 1OYWA 1MH3A 3K4MA 3MEXA 4KMFA 1K4SA 4KISA 2V26A 4OIOF 2DPUA 3OY9A 2VB6A 3BR2A 1QZYA 3H3ZA 3HTSB 2FA5A 2IAIA 2CRGA 5BNGA 5D5VB 5KAFC 3KCCA 4FCYA 1AHDP 4UHTA 4M73A 1WKMA 2TDXA 1MBGA 1ZG3A 2XF7A 4BXUA 1VQ5I 2YSRA 1XMXA 2UXNA 2XDVA 3N4MA 1R1VA 4HRIA 2EFOA 1SAUA 1IW7F 3MQ0A 4PJNA 1OMIA 3BTCA 4QPOA 4B1RA 5JLXA 3PUBA 1U9OA 2JA7J 1BIAA 1IRZA 3GZ6A 4U0VA 2V6CA 1MJBA 3I59B 2XGXA 2CWEA 3KP5A 2CFOA 4HLXA 4LFUA 2M2EA 5D4RA 2VE8A 1YW8A 3RPQA 3HSRA 3SQNA 3LA2A 3SEZA 1J75A 4BY7J 5L3GA 5BPDA 5DD4A 3GTGJ 1QBJA 4BQOA 1T8IA 1X1AA 3BG5A 4ENMA 1O7FA 3C3WA 5IT9Z 1G6NA 1R5ID 5K7HA 3M8EA 2KZVA 2A07F 4V2FA 5JI6A 3TKYA 2NS0A 5CKTA 3U2RA 4IHTA 2FEZA 2R7QA 3W2WA 4P9UA 3TEDA 2DA7A 2X6WA 1CQTA 2O7OA 2MBFA 4RAFA 5K5QA 4YFNF 1R36A 4UUSB 3T0YA 3FXMA 1Y0NA 1MBKA 3QP6A 2QM3A 4L18B 4M9ZA 1VQ4I 2P6TA 2RAEA 3R61A 3EYIA 1R6RA 3IWFA 1SD6A 3SFIA 2WAFA 4ZH4F 2HOSA 1LFUP 3OYNA 3H9QA 5J47A 1KONA 2XKPA 3HHGA 1W5TA 2DA6A 3I4MJ 3PSIA 1JXSA 2BXZA 1L0OC 4RM2A 2J5OA 1SFXA 4UY8I 2X85A 4PSWA 2BZTA 2OCCH 2XVCA 4BQAA 2JJ7A 3DQVC 3WE2A 2OQRA 2HQ5A 1JUPA 2V79A 3DEUA 1BJZA 1HOMA 1Q1VA 1PUEE 3GFJA 3FHZA 2ECCA 1O3QA 2Y31A 2KJBA 3UKGA 3TP0A 1PUFA 5JVTA 1TTYA 2HQRA 3E5UA 3VDXA 3PJRA 2X1CA 4KIGA 1WHUA 3RYRA 2A6EF 4W97A 2CMPA 5EG0B 2EWNA 1OJLA 1YI2I 3CP2A 2W48A 4G8XA 5GPCA 1E17A 4HQMA 3OYFA 4F3QA 2EK5A 1P4XA 3K9TA 2ISYA 2DW4A 3QRFF 3ERMA 1O57A 2Q0OA 3BCAA 4RM3A 1Z77A 4PFPA 3ZMVA 4C3IJ 3DEWA 5D5UB 1ERDA 1SEUA 4E7KA 5EF6A 1W7PB 2OC6A 5E3OA 3DXJF 2O9LA 3KP2A 1Y8RB 3VYTB 1FMVA 3CJRB 4OIPF 1QPMA 4N0BA 1FTTA 2JA8J 4X1EA 1LEBA 2JA6J 5LHHA 1MZBA 1R00A 2OJED 2VKEA 1LB2A 3I59A 3MN2A 4EEFG 1KU9A 5IP6A 1H8AC 1JJ8C 4GDFA 1YE9A 2HVQA 2M87A 3HC7A 2ME0A 5M3FJ 3KEYA 4UNOA 2KP6A 3T1BA 3S1NJ 1BM9A 1UFMA 2IXSA 3Q9SA 3QAHA 3PO2J 2HOEA 4LB6B 2DMQA 2DYRH 2Z99A 2ZSHB 4HSTA 5EEGA 3KZYA 3HOZJ 5FO5A 2IT0A 1A36A 4LIUA 1HA8A 4UUSA 2DDBA 2BY1A 1BA5A 1B9MA 3AG4H 5D8KB 3A0HC 4DIQA 3FKIJ 4IVNA 4I99C 1HCRA 3F8BA 4KICA 5HS9A 4A0ZA 4EQQA 3OR2C 3NQOA 1FBUA 1ZN2A 1LKXA 1Y6IA 2E1MC 1XGMA 4BXFA 5FJ8J 5FRNA 2JA5J 1FBSA 2KIQA 2VXDA 1O4XA 3CDIA 4LG3A 4LIVA 2LNBA 5CQGA 3GBGA 2FMYA 3KETA 2JUCA 4JBAA 4UV8A 1BC8C 1HDPA 3BR1A 4IQJA 3OYLA 4IHWA 3F8NA 5B66C 3OSFA 1BC7C 2DAOA 1OLTA 3RQIA 3JRDA 1HW2A 3VEPA 4XK4A 1STZA 4BAYA 3O6BB 3W6KB 2HPIA 4MEXF 3CF2A 1R1UA 2ZFUA 2ZXHA 4EM1A 3JRHA 5LHGA 4C9YA 1FOKA 3E6BA 4ENJA 2W57A 1R23A 3H5AA 1ITYA 3LQQA 2RNGA 5FLVA 2X6XA 2DXIA 4CCJA 3G6EI 2DTRA 2QQBA 2FE3A 3JCUC 5E18F 3WTSC 4DYQA 3CCYA 3HGYA 2RQPA 1LPQA 1LEAA 2OBPA 3OYAA 1JGGA 1U9NA 3SDGA 2DJNA 1GVJA 2PI0A 2OZUA 4XMYA 2F4OB 1YRNA 2EV5A 1WSUA 2E2HJ 4ESBA 5DCMB 2MFZA 2WV0A 5FROA 2DQLA 1EA3A 4ZYEA 4U0YA 2O0YA 2FBHA 4DYRA 3D0SA 3BZ6A 4O3MA 1T6SA 3S1RJ 1IJWC 1T33A 3WHCA 3PNVA 1MMGA 4LK1F 4ZJZA 3BR5A 4B43A 1WJEA 3LSGA 1ZRDA 3HOYJ 2F6CA 3LSTA 1YS7A 4YIIA 3I55I 3A02A 5C4XJ 1SFEA 4F7ZA 3IL2A 2DI3A 2MGQA 2OD5A 1JJ6C 3M1EA 1OCPA 2Y48A 3GFMA 3Q9VA 4CO8A 1IUFA 1J7KA 5FLMJ 1D5VA 4HLYA 4LG0B 3H3UA 3CCRI 4CZCA 5FFZA 1TBXA 1FC3A 1WVRA 3MZYA 3E6CC 2NVYJ 2WBMA 2ZNZA 3O3KA 3OL3A 4MQ9F 2F4IA 1MJAA 4KIFA 4BE1A 3FKJA 3FMQA 4HBLA 2BGCA 2AQFA 5DEQA 3ZOBA 4I98B 4XLAA 5DV5A 4A0YA 2LF7A 6PAXA 3WTYC 4A5NA 3BZKA 3DCFA 5DM6F 3LSRA 3ZQGA 3QPHA 4WXDA 1B4AA 1G2HA 3ZMZA 1JT6A 1FIPA 4JQFA 3WU0A 4WK8F 2ISZA 4MGRA 1V3FA 2W4SA 2UWMA 1ZGAA 4RB3C 3RIRA 5IP9J 4PJJA 1Y39A 2LKPA 1D1CA 1OYYA 2EINH 2CQ7A 4GXOA 3JRGA 3CC7I 4FE4A 4A69C 4DYCA 1WZ2A 4OINF 2XAGA 2MLKA 4O5VA 3GTQJ 4NBQA 3VB2A 3ZXSA 1P92A 5E1ZB 2LFBA 3H92A 3G2BA 1XG1A 4C2UA 1RKTA 3K10A 3KZIC 3DWLE 2Q1ZB 3OYEA 2YX7A 5E1XA 3VSLA 4ENNA 2IRFG 2PFBA 1USTA 4KITB 4M9SA 3OR1C 2K3FA 3CMAI 1OR7C 2NRAC 4Y17A 3GTJJ 4BQQA 1QVTA 2JWTA 2GXGA 1AU7A 1SD5A 1JE8A 2RC4A 1N75A 5IPAA 4RLFA 5DCMA 1DP3A 1X3WB 1P9QC 2F5VA 2NS8A 4EVIA 3MD2A 1RZ4A 1Z9CA 4IL6C 4OMYA 3DTKA 4DZJA 4XIDA 1UG0A 2LSOA 3R60A 1W4MA 2XAHA 3DBLB 4JYKA 2MH9A 1K4TA 4HNTA 3T5XA 2F5EA 2I8DA 1DQUA 1E2XA 2BE5F 3S17J 4GFBA 4RS8A 3J7AY 4RAYA 3K4NA 4HX8A 3FK6A 5ICGA 2EFNA 2F5FA 4HYEA 2LY2A 3VYUB 2KRFA 1T98A 2EPFA 3WTUC 3OV8A 2D45A 1UB9A 1BI2A 2CH0A 3I54A 3IUOA 4LD5A 4CCMA 5K1YA 1DP7P 3HHHA 1FOYA 4RB2C 2VOPA 1QVUA 2YPRA 4EGZA 4L5IA 2L01A 4LG0A 2PN6A 2W7NA 3K6GA 2UXXA 3R6SA 4HA8A 2OCEA 2NNNA 4M71A 1RRJA 2H1KA 3FBNB 2EA2A 1FEXA 2DT6A 3DLAA 2OZ6A 1F1ZA 2TCTA 1EV7A 2Y9YA 1ETYA 2VONA 4B3AA 2CV2A 2CV0A 3F72A 2ZJRF 4MTEA 2F5DA 2DOFA 2XIGA 2IA0A 3KEQA 5J6XA 4WCGA 4PJ0C 2LD5A 1MGTA 1U78A 4Y4RA 4NQWB 2L7ZA 4XSXF 2FNPA 3W6VA 3SEQA 3L9FA 2YU9J 1IV8A 1H88C 2Z16A 3BROA 1RUNA 1LVKA 1Z05A 2DMTA 2RV8A 2QSGX 2Y0MA 2A6TA 2JSCA 5KCMA 1IN7A 1R22A 2LKSA 3CTAA 2E2JJ 4UVBA 5TGTA 2DO7A 3DKWA 3MVPA 5GAEJ 1J0RA 2ELKA 2LDUA 2QWWA 3GUDA 2QENA 4KYWA 2CYYA 1R5GA 2GLOA 3EQLF 2RNJA 2K9QA 4PZJA 2GIZA 5FB2A 3CO7C 5TRDA 3BJAA 1JKQC 4OAYA 2D2WA 3OL4A 3ONQA 3BR0A 2WC2A 2A61A 3ZQHA 1T95A 1ORKA 3ML6A 1ODDA 2LRDA 2FJ1A 2Z9OA 1XGNA 4V2GA 1Y56A 5M5WJ 1DU6A 3D1NI 4CDGA 4XLHA 5JLWA 3MKZA 5GP9A 4HG2A 4A0XA 1ZREA 2IGNA 2N8GA 5ED4A 3GTKJ 1IRXA 3ESWB 1WJAA 3RKWA 4CCLA 1RIOH 3HB9A 1Z1DA 2GQQA 3AG3H 3WHBA 1QO0D 2F2EA 1GDTA 1YJNI 4GYGA 5DTDA 2FF4A 3GFLA 3HGGA 4NDLA 2AQEA 4R1HA 2CJJA 1ZGWA 1YS6A 5GADJ 1NK3P 5IT3A 1X19A 3F21A 3KEOA 2W82A 2WAEA 1EJ9A 3HDDA 3CUOA 1X1PA 1B6AA 3G1OA 2QVOA 1QA6A 2IVMA 3LWFA 1HBXG 1LDKB 2VJJA 5J4VA 4IXAA 5LRRA 3FXRA 1X4PA 2W1OA 3R0JA 4BS9A 3CMEI 3V7SA 2RVCA 4NC6A 4AIJA 5IP7J 2K7LA 5KVRA 1RPWA 3CDLA 5L3EA 2IJLA 1S5LC 3P5JA 2E35A 3EUHA 5LBQA 2DYSH 2COMA 4NC8A 3RDIA 3BOQA 2DK8A 1ETQA 2ID3A 2Z3YA 4E4HA 1KQ8A 1SFKA 1TC3C 3TO6A 2NVQJ 4M3DA 3H1CA 3Q3SA 3V4GA 2BW3A 4IZZA 3HEFA 1OYIA 4KJZA 3I4PA 1Z67A 4C3HJ 4E7ZA 1XS9A 2M30A 4HOBA 4IHYA 3TDZC 2YUSA 5A2QK 1MNDA 4IEJA 3ECOA 4NQWA 1FP1D 1HKSA 3DU6A 3OYGA 5IOYA 2V1UA 1U5TC 2DA2A 2VE9A 1HC8A 1GV5A 3EUHC 3QYFA 4CZZA 2BEOA 1G59A 2ZJ2A 2HVRA 3GFIA 3OIOA 4XN3A 1XMAA 1JHHA 2K02A 2BYVE 1YJWI 3G71I 1MJ9A 1WCMJ 2CW7A 2A3SA 2EBIA 2HU9A 2JN6A 3FM5A 2WB1A 1FMWA 2VN2A 3ASNH 2CG4A 2RQQA 2XGCA 2IGMA 1HLVA 3FISA 3L00A 4FASD 3CCEI 3G1MA 2W25A 4OAZA 5AONA 1CGPA 2EB7A 1K78B 3E97A 2HTSA 3JW4A 3TOAA 4UUTA 2M4GA 1E3HA 2LTPA 3TW6A 3ULQB 2TRTA 1T38A 4BDZA 2OF7A 4XLNF 3HKZA 3BT9A 1ETXA 2ZB9A 2KRHA 4MQVA 1Z3YA 4XR6A 4JX4A 3JSOA 4ZTJA 3HBLA 1TP4A 2DODA 4Z6YA 2COBA 1G3SA 1Z6TA 3GTOJ 1BL0A 3RKQA 1R9TJ 4G94A 2Y0SA 4PFOA 4N4OB 3C2HA 4MEYF 1J2XA 3IP4B 4OMZA 2M3AA 1O3SA 2VPLA 1TW3A 1FOWA 2I5UA 4Q48A 2PMZA 4NUBA 2BVMA 4PGGA 2FXAA 3E1SA 3FWEA 1GLNA 1JUSA 4C2MJ 3CJNA 5KAIC 3H5RA 1WJDA 1WWXA 2E1CA 4BJ5C 5H20A 3K1MA 5GAGJ 1A31A 4XKWA 1KQ0A 2QZ8A 2CQKA 4HX4A 2L0KA 2STWA 5C44J 3OYJA 3M07A 4AIHA 3WTTC 1AKHB 2BXYA 4G12A 1A6IA 5AIQA 1MMNA 4FETA 5EYRA 2P6SA 2EZIA 3ZN0A 2JRTA 4MIMA 4QIWN 3LMMA 3S32A 2PBIA 5A2QZ 5H2FC 3NWTA 2L02A 3BPXA 3CMMA 2E36A 2VC1A 2EZKA 3IC7A 1FX7A 4CICA 3CCLI 2JA2A 3FMSA 2IS4A 1DUXC 2R7XA 4CUGA 1S7OA 1WRJA 2B63J 3V7CA 2V1XA 2E1MB 1X2MA 4XONA 5F6FA 1PYVA 3S8PA 1FY7A 3KE2A 1YIJI 1BOAA 3L2QA 4PSXA 3QOEA 2VIXA 5EZHA 3KP7A 3VWBA 1B59A 1H9GA 2MW8A 3TOBA 1V55H 1OCRH 3O8GA 3MKWB 2DDAA 3FMRA 5TJJA 1XX5A 3IH4A 1BI1A 3CCVI 2L5QA 5IOZA 5H6QA 4HF0A 3K4CA 1K78A 4L5JA 1S7AA 3E5XA 4B47A 1I50J 4CA0A 5KK1A 4F91B 2X6YA 4EJTA 3OSGA 3CQZJ 2KIFA 3CZ6A 3DBHB 1MD0A 1I3QJ 5HLIA 3V8JA 3VSKA 2HEOA 1LE8B 2M5WA 3CLOA 3FZVA 2WA0A 5BPIA 4U88A 3HSEA 5HLHA 4I0BA 4IHXA 2DFIA 2HYFA 1ACIA 2MLGA 1LNWA 2JT1A 4M6VA 2DU9A 1SVLA 2V9PA 2L7FP 3DKYA 4BACA 1IRGA 1N78A 4PDKA 2B7EA 3WODF 2M8EA 2RN7A 2KJCA 3JR9A 4JX6A 5B1BH 1X1BA 3F8FA 3L2RA 1SVOA 3TL4X 5EEHA 2EFQA 3MZHA 4A3FJ 2CW0F 1R4MB 2FU4A 4CCKA 1PP8F 1MIJA 4HSRA 5D6FA 4MNUA 3J81K 1UJ8A 1YW9A 2WB1N 3UR3C 3KX2A 1FWZA 3G73A 3Q0VA 1DU0A 3ECHA 3PSFA 1YRNB 3M9AA 3E3VA 3CCUI 5E1WA 2ZSIB 2MH2A 3BR6A 4DNCA 4BBRJ 2FBKA 2HDCA 3F9KA
chains in the Genus database with same CATH topology
4G6TB 4XN0A 4E7IA 4CZCA 4EATA 2ELJA 2QKMB 2NOJB 2WBMA 3OL3A 2VQCA 1D0YA 2LH9A 2R7SA 1JI8A 2F4IA 2XSJC 3C2GA 4B48A 2IGKA 1D0ZA 4BE1A 3FKJA 3DKXA 2X1DA 5KHDA 2BOLA 2AQFA 4XKBA 2CUJA 5LD2C 1QU3A 4XLAA 3PFYA 3S3OA 3DTIA 4BU2A 2GOMA 2VJIA 4DGWB 3BG7A 4E7SA 2M0MA 4OWRB 3S3NA 5HLTA 4BE0A 3VYRB 1BR1A 4JQFA 3D5SC 2VKDA 2CUZA 3KYLA 4YEJA 2W4SA 2UWMA 3H5NA 4PJJA 1D1CA 2Z2SB 2CV1A 2DJIA 3A4CA 4ZTFA 1V5EA 2RREA 3L2WA 4XOTA 3ZCOA 1MMAA 4PJLA 2DCEA 3ZXSA 2WAQA 3G2BA 2R7RA 2XC7A 4C2UA 3K10A 2VL8A 3DWLE 2Q1ZB 3OYEA 4IQ4A 2VJ5A 3SDBA 3VSLA 2K9MA 2L9NA 3CP8A 1E0EA 4KITB 4F55A 2P0WA 3N05A 3FDYA 4MLOA 4P5OA 3OR1C 4F52A 4XORA 1OR7C 3EUAA 3LSHA 4BEHA 3DTEA 3TMOA 3SZGA 3DPLC 3PL8A 1NG6A 4BQQA 2FUG2 1N75A 4RLFA 1DP3A 3HPHA 1P9QC 3OYBA 2F5VA 3OS1A 3H0DA 1WJCA 3MD2A 3QYBA 1MW7A 2ZXIA 3OYIA 3DTKA 1UG0A 4U87A 1VZ0A 3I3LA 3BLYA 1DGRM 3HL2A 4HNTA 2BVLA 2I8DA 1DQUA 4RMNA 5HOOA 3OYCA 4BE2A 3K4NA 2E5ZA 4XKCA 3J7AY 1Z3XA 2JUGA 3UNGC 2LY2A 3OWTA 3VYUB 4C30A 4ZDLA 3M1CA 2QKLB 4XLFA 2LY1A 1UAAA 2A5WA 2CH0A 3IUOA 4CCMA 5CPRB 2R7VA 1WJBA 4PK4A 4DOZA 1K6YA 2O5RA 3CJQB 1BOBA 2V7FA 3BCBA 2W7NA 3K6GA 2XAUA 3H9JA 2V1NA 3RPUD 4NC7A 3E0JB 1BR4A 3FBNB 2DT6A 3DLAA 2HQAA 2HPMA 3BG6A 2CV2A 2CV0A 3L2UA 5HNFA 2R7OA 5KNLA 3LFUA 4ITVA 3W2VA 3DPTA 3TBIA 4ANJA 4JOMA 2JVGA 3AL0C 2CW8A 1AA7A 4J01A 2JVHA 4Y4RA 4NQWB 2KQRA 3SEQA 3AL0B 2VQLA 4II3A 2MABA 2Z16A 4D9JA 4E7HA 1LVKA 1TZLA 2E60A 3OYKA 4XQFA 2WY8Q 3K4LA 2A6TA 5KCMA 2KPMA 3K4JA 4N4NB 1BR2A 5HNHA 5TGTA 2R7WA 1V5FA 3HOTA 3IAM2 3HUGB 4BDYA 1X4OA 1D1AA 1WFXA 2X51A 3HOSA 3AFHA 2Z1DA 2KMUA 4BJ6C 4OAYA 4U7BA 3OL4A 3ONQA 4QPQA 1YX5A 2V4JC 1D0XA 3RSNA 1D1BA 4IKFA 4DJAA 1T95A 3OYMA 3K4MA 5LFAA 4KISA 4XLEA 2LRDA 2V26A 3M8JA 3OY9A 2VB6A 5FRMA 1Y56A 5HVQC 3DEEA 4YRVA 4XLHA 3MKZA 4HG2A 2IGNA 3LSIA 1IRXA 4BUPA 1WJAA 4CCLA 2VLAA 2DOAA 1LFPA 2K3PA 3IAS2 3EPZA 2KRCA 2XF7A 2OUMA 4HPQA 2VQHA 1WJFA 2XDVA 4HNUA 4HRIA 1SAUA 3EUKL 1QHHD 2AQEA 4PJNA 4Y3OA 4QPOA 4E7JA 2R4GA 4BQNA 2L7KA 3PUBA 2Q2EB 2IS2A 2UUZA 2OV7A 1DGWY 1X19A 2GOXB 3VYSB 2W82A 2WAEA 1YX3A 2CFOA 3MKYB 3PNTA 2K5CA 3SEZA 3W3CA 3AKZA 4D1QA 4BQOA 1LDKB 2VJJA 1X1AA 1X1CA 3OOUA 1X4PA 2W1OA 3A2KA 4BS9A 3ZR8X 1N77A 2KZVA 3A1YA 1UELB 3HG9A 5CKTA 2MC4A 2R7QA 3W2WA 2X6WA 4NC8A 2M7AA 4E4HA 2R7TA 2HDWA 1SFKA 1Z21A 4P1WA 2JSPA 2BW3A 3U21A 4KJZA 4IZZA 4XM3A 3V42A 4E7ZA 1MNDA 3ZRGA 2DT7B 4PJMA 4J00A 3OYGA 3DU6A 1R6RA 2WAFA 3OYNA 2CS3A 3H9QA 1KONA 3EUHC 2V9KA 2M4KA 2UV1A 3PSIA 3QYFA 1G59A 4RM2A 2HVRA 2HNHA 2X85A 4PSWA 3FBIB 4XN3A 3OYHA 4KT6A 3H35A 4AU7A 3DU5A 3DQVC 2CW7A 2HU9A 4AVZA 3BC8A 2LOOA 1FMWA 2WB1A 4DBRA 2RQQA 2IGMA 1S9HA 4XLCA 2BW3B 4FASD 2X1EA 4OAZA 3PJRA 3VDXA 4E7LA 2X1CA 1V5GA 3RQ4A 1NG7A 1J09A 2CMPA 2M4GA 2MD0A 3CP2A 4BDZA 4ZYAA 3HKZA 3D5RC 3OYFA 3S93A 4F3QA 3HXLA 2HZDA 1X1DA 2KRHA 4RM3A 1Z3YA 3BCAA 4XR6A 4CCNA 4PFPA 4ZTJA 4Y33A 1ERDA 4E7KA 2OC6A 3LSKA 4PFOA 2Y0SA 4II2A 3QODA 2MYSA 1FMVA 3CJRB 4N4OB 3C2HA 3VYTB 4BGDA 3IP4B 2VPLA 2M3AA 3K4BA 2PMZA 3OS0A 1MMDA 2IGOA 4NUBA 2BVMA 2IS1A 3E1SA 4XKVA 2LYCA 1GLNA 2LG4A 2XF6A 5JHFA 3H5RA 3W2AA 4YELA 3H9GA 1WJDA 1W36C 3DPUA 1PJRA 4GRIA 4BJ5C 4BL0B 4H4KC 2VQGA 1YE9A 2HVQA 4XKWA 3SYTA 2VKHA 3HC7A 3QYEA 2PJRB 3OIQA 2L9SA 2L2OA 2LBFB 2E5NA 3KEYA 2KP6A 1TT0A 3OYJA 2IXSA 4PUSA 2VASA 2HVSA 4CCOA 2LREA 3L2VA 1QHGA 4BJTA 4HSTA 2ZSHB 1MMNA 4FETA 3OYDA 3FHNA 2XF5A 4LIUA 4E6KG 4B3XA 3K70C 1HA8A 3LMMA 3S32A 4CH7A 3NWTA 1W36D 2WADA 3CESA 3MMYB 1WJ5A 3CMMA 4DIQA 4R79A 1Z7LA 2JA2A 3OR2C 2IS4A 2WY7Q 2E1MC 1LKXA 1Y6IA 4BXFA 2R7XA 4X0GA 4CUGA 5FRNA 2VXDA 3RCOA 4XNFA 4LG3A 4LIVA 4DBQA 5CQGA 2E1MB 2LC2A 4XONA 4NNJA 3GBGA 1PYVA 3S8PA 4IQJA 3OYLA 3L2QA 4PSXA 1OLTA 3ZGKA 3QOEA 2VIXA 3VWBA 1T0FC 3K70D 2HPIA 2VJ4A 3CF2A 2K9LA 2ZFUA 2ZXHA 4F93B 3MKWB 4HEA2 4C9YA 2L5QA 3H5AA 4RLQA 4IX7A 3PNYA 3S3MA 3K4CA 2RNGA 3OIPA 1U0JA 4B47A 2X6XA 4CA0A 2DXIA 2IS6A 4F91B 4CCJA 3ZQQA 2X6YA 3CZ6A 3I9V2 3D5LA 4F92B 2M7BA 3VSKA 3OYAA 3RTRA 2WA0A 4BEHB 4XMYA 2R7UA 4B44A 1ZELA 3DKYA 4BACA 4AYBA 1N78A 2MFZA 2W00A 5FROA 2V6EA 4ZDPA 2KDOA 1EA3A 3K4KA 3OS2A 1X1BA 3L2RA 3PNVA 1MMGA 3TL4X 3OMYA 4ZJZA 4XOPA 4B43A 4CSWA 2KLOA 5CQEA 1WJEA 3LSGA 3NWSA 3LL7A 4ZC3A 2F6CA 2KL4A 2VXZA 4CCKA 4HSRA 2KHMA 4XL9A 3UR3C 3KX2A 2PJRA 2LBFA 3PSFA 1MNEA 3HPGA 4LITA 4ZDOA 2ZSIB 4C2TA 3LSMA 1G8XA 3F9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8J A;  5CKT A;  2W7N A; 
#chains in the Genus database with same CATH topology
 4E7I A;  1AKH A;  5FD6 A;  3ZMT A;  2E1O A;  1FSE A;  1B8I B;  1I1S A;  2AXL A;  2QKM B;  3QU3 A;  2OAZ A;  3HKZ N;  1U8R A;  2VQC A;  1WPK A;  2LH9 A;  2R7S A;  1JI8 A;  3M8F A;  3KZZ A;  3MAJ A;  3HOW J;  4B48 A;  1D0Z A;  1MKM A;  1LJ9 A;  4FE7 A;  2XAJ A;  3T8R A;  5ICE A;  5J1Y A;  1ZYR F;  5KHD A;  2LY9 A;  2Y0S N;  1WGX A;  4I01 A;  5F64 A;  4JX5 A;  5LD2 C;  3PFY A;  3DLL F;  1Y8Q B;  4FT8 A;  3VFZ A;  3A01 B;  4RGU A;  2PMZ N;  1ETW A;  1I3A A;  5JR3 A;  4MO7 A;  3BG7 A;  4E7S A;  2M0M A;  3KP4 A;  3WGG A;  4B8X A;  1LQ1 A;  1YIT I;  2L7M P;  2LKX A;  2RKH A;  2VKD A;  2CUZ A;  2YU3 A;  5F0H A;  3M4O J;  3V7R A;  1S3J A;  4M74 A;  2Z2S B;  3ISP A;  2E2I J;  5DCF A;  2CV1 A;  2FQ4 A;  3K2Z A;  3S15 J;  2VC0 A;  3GVA A;  2D1V A;  2XAQ A;  5L3B A;  1ZG1 A;  4M3B A;  2WAQ A;  1ZTR A;  2R7R A;  2XC7 A;  1ZR4 A;  5HDG A;  2VOO A;  4JP0 A;  5LRS A;  1NTC A;  2L3D A;  2VJ5 A;  3CMY A;  4L0Y B;  4UV9 A;  2R7Z J;  2GZW A;  4A2U A;  1HDD C;  1E0E A;  1LE8 A;  4IOC F;  4Q4Z F;  3LOC A;  3GO5 A;  3GXO A;  1W5C C;  4P5O A;  5J4Y A;  4HDU A;  2ADU A;  3FM3 A;  2Y75 A;  3TMO A;  1YHQ I;  4D5F A;  2CUE A;  1NG6 A;  3KLO A;  3I56 I;  1B72 B;  4A5M A;  3WGH A;  3IWZ A;  4M6Y A;  4UUV A;  3S2D J;  4HDV A;  1RES A;  3JTG A;  1WJC A;  5HDK A;  5J8C A;  1SC7 A;  4M3G A;  2KIM A;  4EJO A;  1MW7 A;  2ZXI A;  4L9N A;  1VQ9 I;  1YO5 C;  2A5Y B;  4LLL A;  3J81 Z;  2KT0 A;  2VBZ A;  1QGP A;  3BLY A;  3LQR A;  1UHW A;  4HW0 A;  4YFK F;  3A0B C;  2BVL A;  4EM2 A;  4RMN A;  4BH9 A;  1BIB A;  5L3C A;  5LGU A;  1SVM A;  2GXA A;  4BE2 A;  2CQQ A;  4Q5S F;  3B02 A;  4KN7 X;  2L4M A;  1MBF A;  4IJA A;  3M1C A;  4XLF A;  4B4C A;  4G7Z F;  1IDZ A;  2LY1 A;  1UAA A;  2A5W A;  2K4B A;  4HV6 A;  4G7O F;  1WJB A;  1U3E M;  3HM5 A;  4ENK A;  3VOE A;  2H27 A;  2PLY A;  2PMH A;  3GCM A;  2XAU A;  1ZLJ A;  4LJZ F;  1B8I A;  1TQI A;  1BR4 A;  1JTY A;  5FD5 A;  1XC5 A;  2HQA A;  3L09 A;  2NVT J;  2DPD A;  2QGU A;  1S29 A;  3BG6 A;  1FIA A;  1FP2 A;  2JTV A;  3L2U A;  1S8N A;  5HNF A;  3RZD J;  2R7O A;  5KNL A;  2KKO A;  3TBI A;  1TQP A;  2KDZ A;  4A3C J;  2BY2 A;  1B9N A;  2GAU A;  1NH3 A;  4J01 A;  2JVH A;  4EMS A;  3A01 A;  4LGW A;  2ETH A;  4D9J A;  3PIO F;  1TZL A;  2KPM A;  1XSX A;  1IGN A;  3F8M A;  2O61 A;  1F36 A;  3WG7 H;  3BJ6 A;  2R7W A;  5CVR A;  4EGY A;  1LDD A;  1P6R A;  1X58 A;  5ICC A;  3IAM 2;  4GYI A;  3HUG B;  4Z2Y A;  1X4O A;  2X51 A;  4ZZL A;  3HOS A;  3G4S I;  5FLX K;  1K83 J;  2H09 A;  2ZXW H;  3JTH A;  2Z1D A;  4BJ6 C;  2NOG A;  3Q0U A;  4QPQ A;  1YX5 A;  5K5R A;  1D1B A;  2E34 A;  4L9J A;  1H0M A;  4DJA A;  1YOV B;  1HQC A;  3HRU A;  5FGM A;  4A3K J;  1XN7 A;  3E6M A;  3TQN A;  3OYM A;  4G7H F;  2QCO A;  4MTD A;  1TT5 B;  4S04 A;  5LFA A;  3GX4 X;  4XLE A;  2QQ9 A;  2G9W A;  2J5P A;  2VUM J;  3P9K A;  5HVQ C;  1LDJ A;  4XIC A;  2X48 A;  2FSW A;  4J19 A;  4KDP A;  4OU0 A;  3P9C A;  2DA5 A;  3LSP A;  2ID6 A;  1QZZ A;  4BUP A;  2PX9 A;  1HW1 A;  3MWM A;  1OR7 A;  4I0A A;  2STT A;  1LFP A;  1R58 A;  1B72 A;  2K3P A;  1YG2 A;  3DP7 A;  2WV1 A;  3B73 A;  2IBD A;  3P9I A;  2XPU A;  4HNU A;  2QBY B;  1RKW A;  1FLI A;  2H6C A;  2QF7 A;  2V9V A;  4NB5 A;  4RA2 A;  3DV8 A;  5D4S A;  4BQN A;  4WX9 A;  2L7K A;  3ABL H;  4U7D A;  2Q2E B;  5BMZ A;  2UUZ A;  2OV7 A;  3CCS I;  2FML A;  1MSE C;  5F1J A;  2QQ8 A;  1YX3 A;  3F8C A;  3RKX A;  3MKY B;  3PNT A;  5DDG A;  1M1E B;  4I76 A;  1K61 A;  1ZKG A;  4GGG A;  4HAM A;  4MFD A;  1LUJ B;  1YQA A;  2P5K A;  4D1Q A;  3AKZ A;  4OIR F;  2HXI A;  3OOU A;  2F48 A;  1A04 A;  3ZR8 X;  1WI9 A;  1XCV A;  2HOT A;  2WAQ N;  1OIS A;  2ESH A;  3A1Y A;  5LLQ A;  2XB0 X;  1UEL B;  2Y9Z A;  5EDN A;  2Y2Z A;  2BY0 A;  2LP0 A;  3QWL A;  5D8L B;  2D1H A;  1XD7 A;  5K5O A;  1EH8 A;  5ILV A;  2M7A A;  3GTP J;  3S2H J;  1UHS A;  1E3O C;  2R7T A;  2PJP A;  1J9I A;  1IN6 A;  2HDW A;  1POG A;  4I6Z A;  2K85 A;  4W1U A;  1QZE A;  3F6O A;  3V42 A;  3IRQ A;  1OCT C;  2PEX A;  2O8X A;  4PJM A;  1S6L A;  1X3Z B;  4FX0 A;  4XSZ F;  5M5X J;  1L3L A;  2CS3 A;  4QSH A;  2XAS A;  1YJ9 I;  4UXN A;  4LB5 A;  4A6E A;  2ICW G;  4ETS A;  1U5T B;  1HSJ A;  4XRS A;  3J7A O;  1XGS A;  5B1A H;  5FLX Z;  3OYH A;  3F3X A;  3QQA A;  4KT6 A;  3H35 A;  3DU5 A;  1SAX A;  4OIQ F;  3HUG A;  4RAG A;  5CYV A;  2LOO A;  3TGN A;  4DBR A;  1USS A;  4AIK A;  2EJR A;  4XLC A;  2BW3 B;  1ON2 A;  3BTI A;  5J3L A;  4KFC A;  2KIU A;  3TP3 A;  1RET A;  2DMU A;  2X1E A;  1H9T A;  4E7L A;  4N9I A;  2R92 J;  3MZ8 A;  1P4A A;  1VQK I;  3RZO J;  1V5G A;  1R7J A;  5EJC A;  3BG3 A;  2DK5 A;  1SMY F;  1J09 A;  3B6A A;  4QWQ A;  3CDH A;  2W84 A;  3D5R C;  4A93 J;  3S93 A;  1ETV A;  2ME6 A;  5BS6 A;  3HXL A;  2R93 J;  3V8L A;  2HZD A;  4LLG F;  2XKO A;  1D5Y A;  2P4W A;  1ZK8 A;  2JMW A;  3WTX C;  3E6D A;  2GXB A;  1LFB A;  2L54 A;  2LLK A;  4EJW A;  1F4K A;  4II2 A;  2MYS A;  3HRS A;  5D5W B;  3SZP A;  4BGD A;  3JRI A;  2VT2 A;  3TW7 A;  3WTW C;  2LMD A;  3OS0 A;  2QBY A;  2EH3 A;  1RUO A;  3ABT A;  3GME A;  2IS1 A;  2NVX J;  3CO6 C;  2LYC A;  2Q2E A;  1IZ1 A;  2XF6 A;  3NRV A;  1WQ2 A;  1YIO A;  3W2A A;  4KMU X;  1APL C;  2ESN A;  3PFI A;  1W36 C;  4BY1 J;  3R0A A;  4BL0 B;  2XGE A;  5DM7 F;  3PUF A;  2VQG A;  5JFR A;  3SYT A;  2VKH A;  3QYE A;  1XPX A;  2PJR B;  2L2O A;  3M3Y J;  5DD8 A;  1Z0X A;  2E5N A;  4IHV A;  4RB1 A;  1TT0 A;  1YYV A;  1MSF C;  2P5V A;  3K1P A;  2IA1 A;  4PUS A;  2DOE A;  3LSJ A;  3R4K A;  3L2V A;  2ZME B;  4BJT A;  5M3M J;  1FOX A;  1K7A A;  4GO1 A;  2EA4 A;  3FXJ A;  3FHN A;  3KP3 A;  1OCC H;  4XLP F;  4YFX F;  4L0Z B;  2PQ8 A;  2XF5 A;  4E6K G;  4RDU A;  4B3X A;  3BQZ A;  4CH7 A;  2HQN A;  3ZN1 A;  1ZAR A;  1W36 D;  2WAD A;  3CES A;  2CFX A;  3HTU A;  3MMY B;  4A3D J;  2JZY A;  1JKP C;  3S1Q J;  3GEZ A;  4LMY A;  1XDU A;  4M6X A;  4D7N A;  1Z7U A;  2OA4 A;  1Z7L A;  4MFE A;  2WY7 Q;  1VQO I;  5CVU A;  4L5E A;  1V54 H;  2ZKZ A;  4HV5 A;  3RCO A;  2Y30 A;  3H36 A;  2P81 A;  1KGS A;  2LC2 A;  1U5T A;  2GBY A;  4KA4 A;  4BYY A;  3CUQ C;  2B9S A;  4YG2 F;  3JAM K;  4A3J J;  3ZGK A;  4UB8 C;  2B0L A;  3CC2 I;  1FYK A;  1T0F C;  2DQR A;  2K9L A;  3WU2 C;  4D5C A;  1VND A;  3GLL A;  3FF5 A;  5JHU A;  1TWH J;  4HEA 2;  2A6H F;  1ZR2 A;  3CLQ A;  4LOC A;  4RLQ A;  4IX7 A;  1A35 A;  1SD7 A;  3OIP A;  1U0J A;  1DPU A;  1E3P A;  2BHY A;  3ZQQ A;  3RI4 A;  1J5Y A;  1ZHF A;  1TLH B;  3PQJ A;  4M72 A;  5BOX A;  2CQN A;  2EIL H;  2K9S A;  1TNT A;  1IN8 A;  3MFK A;  4KNY A;  1Y0U A;  5D5X B;  1I6X A;  2OTL I;  4B44 A;  1IXR C;  2K9N A;  1XTA A;  1IN5 A;  1IUY A;  2HTJ A;  4AYB A;  2EIK H;  3NEU A;  2DTZ A;  1FJL A;  3K4K A;  3LAJ A;  3OS2 A;  2QLZ A;  1EH6 A;  3HRM A;  4A6D A;  1MDM B;  5E8I A;  3GZN B;  4H0E A;  3K7A J;  3OMY A;  3LL7 A;  3T8T A;  1ON1 A;  5CJ9 A;  2KL4 A;  3FXQ A;  2EFP A;  2HS5 A;  2K86 A;  2VXZ A;  4XL9 A;  2YS9 A;  4EM0 B;  1I1G A;  1OCO H;  1SFO J;  2PJR A;  2OTJ I;  3C7J A;  1XGO A;  1MNE A;  3HPG A;  1K6O A;  2OU2 A;  3ROU A;  2XPW A;  1FTZ A;  5C4J J;  4C2T A;  3LSM A;  3SHF A;  1G8X A;  2JK3 A;  5FKN A;  2ZME A;  4HZF A;  4XN0 A;  5FKK A;  4PCQ A;  4M3F A;  1PVE A;  1KYW A;  4DZP A;  1W0T A;  4UVA A;  1D0Y A;  2JRM A;  3WG9 A;  5J1R A;  3C2G A;  1TW2 A;  2X6O A;  2R5Y B;  2E71 A;  2M45 A;  3ABU A;  5FKO A;  3ZQI A;  1U8B A;  3NAR A;  1G3T A;  1GXP A;  5EZG A;  3DKX A;  4M9X A;  3A03 A;  2BOL A;  1R4N B;  2M8G X;  2ZBK A;  1T56 A;  2VI6 A;  1QU3 A;  2CUJ A;  2W24 A;  1ZQ3 P;  3JRF A;  2ZME C;  3L1P A;  1V4R A;  4BU2 A;  2GOM A;  4BXX J;  2VJI A;  1R71 A;  1WH5 A;  4DGW B;  2KZG A;  3EDP A;  4OWR B;  5HLT A;  4BE0 A;  2NVU B;  1PP7 U;  2IPQ X;  1BR1 A;  2H94 A;  3P7N A;  1IXS B;  3JRC A;  3D5S C;  2CSO A;  2XRO A;  3REO A;  4YIF A;  4HF1 A;  3LNQ A;  3LA7 A;  3OOP A;  1RR7 A;  4HF2 A;  1GV2 A;  1VQ7 I;  2OQG A;  1ZRF A;  2AHQ A;  2HYG D;  4ZTF A;  3U9G A;  1SMT A;  1D3Y A;  3L2W A;  3IHU A;  1O3R A;  3ZQC A;  1VQN I;  4RGR A;  9ANT A;  1MBJ A;  1FZP B;  2HDD A;  1VQ8 I;  5GAH J;  2HWV A;  2VL8 A;  4CYC B;  1IC8 A;  4O6J A;  4PGH A;  5HOD A;  3RPU A;  1P2F A;  2K9M A;  2L9N A;  3CP8 A;  2QUF A;  4I2O A;  3BWG A;  1P4W A;  1EF4 A;  4F55 A;  2P0W A;  3N05 A;  1WI3 A;  3FDY A;  4MLO A;  3LAP A;  2VBX A;  3EUA A;  3PIP F;  3DTE A;  1TL8 A;  3SZG A;  4S0H B;  2XGD A;  1W0U A;  4DQ2 A;  3JRE A;  3QPT A;  3ZQF A;  1J59 A;  1Z91 A;  3DBR B;  3HPH A;  3O8H A;  3GTM J;  2DA3 A;  5H6R A;  4WF2 A;  5F1R A;  3HOV J;  3AG1 H;  1G3W A;  2EZL A;  4FIS A;  1A6Q A;  3OYI A;  4U87 A;  1MDM A;  1TNS A;  2MA3 A;  1VZ0 A;  2DA1 A;  1FSH A;  3I3L A;  1U6G A;  1D8K A;  1BN5 A;  3HL2 A;  2X9D A;  1ZLK A;  4XBF A;  4B09 A;  2HKX A;  3M7G A;  2G7H A;  3OYC A;  3Q5F A;  1JKR C;  4XKC A;  1Z3X A;  3UNG C;  3OWT A;  4ZZD A;  3U1D A;  4C30 A;  4I7H A;  4BBS J;  4ZDL A;  3G3Z A;  2QKL B;  1UZC A;  3ABM H;  5CPR B;  4PK4 A;  4DOZ A;  5F0F A;  3CJQ B;  2V7F A;  1Y1V J;  2ACJ A;  4C3J J;  3H9J A;  1I6H J;  3KP6 A;  3RPU D;  4NC7 A;  3E0J B;  3C18 A;  3F6V A;  3HIF A;  3PO3 J;  3ZQL A;  1F43 A;  2QA4 I;  2R5Y A;  2ZFW A;  2I10 A;  2R5Z B;  2XRL A;  2K4J A;  1VF9 A;  1H89 C;  4ANJ A;  3BDD A;  2JVG A;  3AL0 C;  4UB6 C;  2CW8 A;  4HX7 A;  5L3F A;  4A3G J;  5LGT A;  3DF8 A;  1AA7 A;  4AYB N;  1X2N A;  2ZXJ A;  2QSH X;  1YFH A;  4II3 A;  3I4N J;  2GA2 A;  2MAB A;  1G3Y A;  1R1T A;  4KUM A;  2WY8 Q;  3K4L A;  5DUK A;  2OPT A;  3ZQ7 A;  1VTN C;  5DS9 A;  3K4J A;  4N4N B;  1D8J A;  1VFC A;  1BR2 A;  5IYC J;  3E7L A;  5M5Y J;  3HOT A;  2DFF A;  4RB0 A;  2EIJ H;  4BDY A;  1YTY A;  1ZAO A;  5C3E J;  1WFX A;  3CCJ I;  4X6A J;  3AFH A;  2Z33 A;  3ZMS A;  2GA1 A;  2KMU A;  2EFW A;  4U7B A;  3I58 A;  3DFG A;  2V4J C;  3B6C A;  3J80 K;  4IKF A;  3WE3 A;  2CU7 A;  1EH7 A;  1KQ9 A;  1TWC J;  4AWX B;  4EJV A;  4CYC A;  4ESJ A;  2D5V A;  4KN4 X;  3GWZ A;  4Y13 A;  5K7Z A;  1MH4 A;  3M8J A;  4D7M A;  2L9V A;  4QLC U;  3U1K A;  5FRM A;  2MSY A;  4FQG A;  4BHP A;  3DEE A;  4YRV A;  3JSP A;  1UCR A;  2CO5 A;  3N97 A;  3LSI A;  5F08 A;  2XUB A;  1SFU A;  2VLA A;  2DOA A;  5TIS C;  4Y7N J;  4RAZ A;  4FX4 A;  3IAS 2;  5EGO B;  3EPZ A;  1IRF A;  2KRC A;  2RDP A;  2BHZ A;  2OUM A;  1HST A;  4AUX A;  4HPQ A;  5ILS A;  2VQH A;  1WJF A;  3AAF A;  3GLX A;  3EUK L;  1QHH D;  4Y3O A;  5ILU A;  4E7J A;  2R7D A;  2R4G A;  2IS2 A;  1XDS A;  2DBB A;  2Q8K A;  1DGW Y;  2GOX B;  3VYS B;  1XCB A;  1Y1W J;  2FOK A;  2K5C A;  4JK1 X;  3W3C A;  5ICF A;  2MC3 A;  1JUM A;  1ZG5 A;  4CXF A;  3EET A;  2FQ3 A;  1X1C A;  3A2K A;  1Z6R A;  3HYI A;  1O3T A;  2L4A A;  2WWY A;  1N77 A;  3ZP5 A;  2GM4 A;  3O2P E;  5IYB J;  1MBH A;  5J1U A;  2X4H A;  3KIO A;  3HG9 A;  2MC4 A;  5CVV A;  1AWC A;  4P55 A;  1KU3 A;  4TV7 A;  3EYY A;  2QEX I;  2VBY A;  4IHS A;  2IP2 A;  1Z21 A;  4P1W A;  2R5Z A;  4M3E A;  2JSP A;  3IH2 A;  1SD4 A;  2AO9 A;  3U21 A;  4AVP A;  4XM3 A;  3SJM A;  2QQA A;  2L9R A;  1JHF A;  1FNN A;  4BKX A;  4K2E A;  4U0W A;  4ZYH A;  4HNV A;  3ZRG A;  2DT7 B;  3GF2 A;  4J00 A;  3V8K A;  1I39 A;  3K69 A;  4RGX A;  1F5T A;  1ZGJ A;  5HS8 A;  3HOU J;  5ERI A;  5EG0 A;  2GWR A;  2P7V B;  4UVC A;  1K79 A;  2HI3 A;  5LHI A;  2V9K A;  2M4K A;  2UV1 A;  4KT5 C;  2FOW A;  1XSV A;  1QRY A;  3MKL A;  2A05 A;  3QU6 A;  1IXC A;  2HNH A;  3FBI B;  2BBY A;  3HRT A;  2BV6 A;  5AIP A;  4AU7 A;  4LLN A;  1I27 A;  2RGV A;  2X0L A;  2M1B A;  4AVZ A;  3BC8 A;  1XMK A;  3SFZ A;  4IF4 A;  3FXK A;  5IYD J;  3J80 Z;  2XPV A;  1S9H A;  1W7P A;  2UZK A;  3BR3 A;  3BTJ A;  2NS7 A;  3W6J B;  1I5Z A;  2XAF A;  3F0C A;  2JPC A;  2ZCW A;  3RQ4 A;  1NG7 A;  3BJO A;  3ZPL A;  2MD0 A;  4XRF A;  4WWC A;  1GHC A;  4ZYA A;  4FTH A;  1T2K A;  2Z5U A;  5JVG F;  5CLS A;  1OFC X;  1X1D A;  2Y69 H;  4BNC A;  3S1M J;  2P8T A;  4CCN A;  2QYO A;  2W85 A;  4Y33 A;  2C6Y A;  2R7F A;  5GPA A;  4ON0 A;  4A3I J;  3KYD B;  2HGC A;  3LSK A;  3ZMD A;  2ECB A;  3QOD A;  5EGO A;  4HQE A;  1AOY A;  1TQM A;  2VOD A;  1ENH A;  3K4B A;  2G0E A;  2FBI A;  2IEK A;  5E20 A;  1MMD A;  3I53 A;  1KZH A;  4ASN A;  2IGO A;  4IRI A;  1BI3 A;  3RJP A;  1ONV A;  1TWF J;  4XKV A;  3S16 J;  1XB4 A;  2XRN A;  2LG4 A;  5JHF A;  1VQL I;  5LEJ A;  3C2B A;  4AM3 A;  4YEL A;  2P7C B;  3H9G A;  1REP C;  4A3B J;  3VOD A;  1MNM C;  3DPU A;  3X2Q H;  1PJR A;  1ULY A;  4GRI A;  3KFW X;  4V19 K;  2XHK A;  4H4K C;  1MMS A;  3H0G J;  4P9F A;  1R5H A;  1W7P D;  4RGS A;  3OIQ A;  2L9S A;  3G1L A;  2LBF B;  3QOP A;  4CGZ A;  1FYL A;  3WGI A;  1W5S A;  2HXO A;  1GVD A;  2VAS A;  1HF0 A;  1UMQ A;  2LRE A;  4CCO A;  2HVS A;  1QHG A;  1HXD A;  1DDN A;  3WU1 B;  3JRB A;  5L3D A;  3RYP A;  3OYD A;  4WXC A;  4XRM A;  2FX0 A;  4G6Q A;  1IN4 A;  3K70 C;  3HZJ A;  1OPC A;  2EV0 A;  5HDN A;  1ETO A;  3K1N A;  4I09 A;  5FFX A;  4CHU A;  1WJ5 A;  1HKQ A;  2A68 F;  1XSD A;  5EEA A;  3L7W A;  2HR3 A;  3JRA A;  4R79 A;  2F5C A;  5DUI A;  1QNT A;  2AS5 F;  1RC9 A;  4X0G A;  2DLL A;  3BG9 A;  1FYM A;  2M0C A;  4XNF A;  2YX4 A;  1ZRC A;  1A5J A;  3LA3 A;  4DBQ A;  1G4D A;  2HOA A;  1IAW A;  2ELH A;  4NNJ A;  3CJT B;  3E5Q A;  2H8R A;  2KFD A;  1S7E A;  1BJA A;  2O03 A;  3PM1 A;  1BW5 A;  1T08 B;  2CUF A;  1TWG J;  3GW2 A;  3QPS A;  4QTR A;  3CUQ B;  3K70 D;  4Y15 A;  2VJ4 A;  1NK2 P;  4YIR X;  1BW6 A;  4F93 B;  3C1D A;  2K40 A;  2MG4 A;  2GIV A;  3Q0W A;  2EZH A;  4E70 A;  2XV4 S;  1JTX A;  1NHA A;  2G7U A;  1GT0 C;  3PNY A;  3S3M A;  2EQR A;  2XB5 A;  2VT3 A;  5BQT A;  2DMN A;  1CF7 B;  2IS6 A;  1Q1H A;  3WTV C;  1X3U A;  3I9V 2;  1LVA A;  4ESF A;  5D6E A;  3D5L A;  4F92 B;  2M7B A;  4A3M J;  3RTR A;  2F4M B;  1EKE A;  3PQK A;  4N9H A;  4BEH B;  5E79 C;  4ABZ A;  3CF5 F;  2HKO A;  4MHG A;  3J7Z I;  2R7U A;  4OOI A;  4L9T A;  4WXH A;  3KLN A;  1ZEL A;  2DA4 A;  2E7X A;  2W00 A;  4AC0 A;  2V6E A;  4BHC A;  4ZDP A;  2KDO A;  3FXU A;  3TO7 A;  5CVI A;  3TDU C;  3FXO A;  2DFE A;  2JPB A;  3FXL A;  4XOP A;  1UHM A;  4CSW A;  3CCQ I;  2KLO A;  3AG2 H;  5CQE A;  1QPI A;  4R8H A;  3NWS A;  2DN0 A;  2LR8 A;  2EV6 A;  4ZC3 A;  4S05 A;  2A69 F;  5IY5 H;  2KHM A;  4LK0 F;  3F23 A;  4EV0 A;  2M34 A;  2LBF A;  4LIT A;  2R0Q C;  2HYJ A;  4ZDO A;  2DMP A;  1JKO C;  2CGP A;  2ZNY A;  1S72 I;  2O8K A;  4G6T B;  5FKL A;  5LGN A;  3I0T A;  4EAT A;  1IO2 A;  2H8W A;  2ELJ A;  2NOJ B;  3S2W A;  4NHJ A;  1GXQ A;  2IA2 A;  5J40 A;  2XSJ C;  3S14 J;  3TO9 A;  4IO9 F;  4P96 A;  2FRH A;  2IGK A;  1JGS A;  1P7I A;  2HZT A;  1TWA J;  2X1D A;  2P5L C;  3COA C;  3FX3 A;  3H3V K;  2LVS A;  2E7W A;  2O6G E;  4XKB A;  3VPR A;  3SXY A;  5LEK A;  2PMU A;  2MD5 A;  3S3O A;  1U2W A;  2HFH A;  1KU2 A;  1N25 A;  3DTI A;  5F04 A;  3WTZ A;  5E3N A;  3ZMU A;  2NAZ A;  1ETK A;  1JT0 A;  2R3S A;  3I64 A;  4BHB A;  3CD6 I;  1RNL A;  3S3N A;  3GTL J;  2E1N A;  1FBQ A;  4IPA A;  3VYR B;  3SZT A;  1B1B A;  4XRS G;  3BPV A;  3KYL A;  1OQY A;  1RI7 A;  3CUQ A;  4YEJ A;  2YR2 A;  4D0P A;  3H5N A;  2DJI A;  2FNA A;  1DPR A;  1T0F A;  3A4C A;  1VQP I;  5E3M A;  1V5E A;  2RRE A;  3FK7 A;  1VQM I;  1FPQ A;  4XOT A;  2ZJQ F;  2K27 A;  3ZCO A;  2NNY A;  1MMA A;  3KYC B;  4PJL A;  2DCE A;  5HLG A;  3HJE A;  5GTH C;  1CF7 A;  3I71 A;  3HOX J;  1MBE A;  4IQ4 A;  1SAN A;  3SDB A;  5B5E C;  5CVJ A;  4A3L J;  4A12 A;  3IH3 A;  3QP5 A;  4F52 A;  1YLF A;  4XOR A;  3LSH A;  4BEH A;  2VKV A;  1KU7 A;  3DPL C;  1IDY A;  3PL8 A;  1R49 A;  5GTI C;  4I02 A;  4AID A;  2FUG 2;  3IRR A;  1T39 A;  3HSF A;  1BI0 A;  1IF1 A;  1P7J A;  3OYB A;  3OS1 A;  2H6B A;  3H0D A;  3QYB A;  3CC4 I;  2FD5 A;  3BTL A;  4L9V A;  2BY3 A;  1GUU A;  3I5U A;  1DGR M;  2AXT C;  2VBW A;  1O7L A;  4AD9 A;  5DYM A;  2ZC2 A;  2NYX A;  1F9N A;  1W1W E;  1C0W A;  5HOO A;  4IRH A;  2E5Z A;  1OKR A;  2IW5 A;  5J8F A;  2JUG A;  1VI0 A;  4ZYD A;  2EIM H;  2KIS A;  3BY6 A;  1YW7 A;  4G6D A;  1OCZ H;  3K0L A;  5E8G A;  5F0C A;  2R7V A;  3GYH X;  3IKV A;  3LFK A;  1K6Y A;  2O5R A;  1BOB A;  3MCZ A;  2JQ7 A;  3NAU A;  3BCB A;  3BQY A;  3ASO H;  4A3E J;  2V1N A;  1PDN C;  1KYZ A;  1ZH5 A;  4Q47 A;  5IT9 K;  4KIB A;  3IKT A;  2PG4 A;  2HPM A;  2NXN B;  2ZJP F;  2DFH A;  1KA8 A;  4G9Y A;  2H1L A;  3ABK H;  2WTE A;  1FT9 A;  3ELK A;  3LFU A;  3DPT A;  4ITV A;  3W2V A;  1UG2 A;  4ZYG A;  4JOM A;  1IV6 A;  4Y52 J;  5E17 F;  1QQI A;  1IG7 A;  3L2C A;  1BBY A;  2M9H A;  2KQR A;  4DW6 A;  2XSD C;  3IV5 A;  2ZO4 A;  4GCV A;  3GZ5 A;  3AL0 B;  2VQL A;  5K7F A;  1HKT A;  4RBO A;  4CYD A;  2E60 A;  5F27 A;  4E7H A;  5FKM A;  4XQF A;  2E19 A;  3OYK A;  2QSF X;  3QPL A;  4IOA F;  2LF8 A;  1RR8 C;  4IRG A;  3RKY A;  2VPR A;  4FHT A;  5B3S H;  5HNH A;  3KPH A;  3CCM I;  1V5F A;  3J7Y J;  3F22 A;  2LK2 A;  2V1D A;  1D1A A;  3BZC A;  3FIW A;  1VQ6 I;  2DT5 A;  1PUF B;  2CQX A;  1D0X A;  3ERE D;  3RSN A;  1WH7 A;  1HW5 A;  2O3F A;  5HS7 A;  5E3L A;  3K2A A;  3JAM Z;  3BP8 A;  4EJU A;  1OYW A;  1MH3 A;  3K4M A;  3MEX A;  4KMF A;  1K4S A;  4KIS A;  2V26 A;  4OIO F;  2DPU A;  3OY9 A;  2VB6 A;  3BR2 A;  1QZY A;  3H3Z A;  3HTS B;  2FA5 A;  2IAI A;  2CRG A;  5BNG A;  5D5V B;  5KAF C;  3KCC A;  4FCY A;  1AHD P;  4UHT A;  4M73 A;  1WKM A;  2TDX A;  1MBG A;  1ZG3 A;  2XF7 A;  4BXU A;  1VQ5 I;  2YSR A;  1XMX A;  2UXN A;  2XDV A;  3N4M A;  1R1V A;  4HRI A;  2EFO A;  1SAU A;  1IW7 F;  3MQ0 A;  4PJN A;  1OMI A;  3BTC A;  4QPO A;  4B1R A;  5JLX A;  3PUB A;  1U9O A;  2JA7 J;  1BIA A;  1IRZ A;  3GZ6 A;  4U0V A;  2V6C A;  1MJB A;  3I59 B;  2XGX A;  2CWE A;  3KP5 A;  2CFO A;  4HLX A;  4LFU A;  2M2E A;  5D4R A;  2VE8 A;  1YW8 A;  3RPQ A;  3HSR A;  3SQN A;  3LA2 A;  3SEZ A;  1J75 A;  4BY7 J;  5L3G A;  5BPD A;  5DD4 A;  3GTG J;  1QBJ A;  4BQO A;  1T8I A;  1X1A A;  3BG5 A;  4ENM A;  1O7F A;  3C3W A;  5IT9 Z;  1G6N A;  1R5I D;  5K7H A;  3M8E A;  2KZV A;  2A07 F;  4V2F A;  5JI6 A;  3TKY A;  2NS0 A;  5CKT A;  3U2R A;  4IHT A;  2FEZ A;  2R7Q A;  3W2W A;  4P9U A;  3TED A;  2DA7 A;  2X6W A;  1CQT A;  2O7O A;  2MBF A;  4RAF A;  5K5Q A;  4YFN F;  1R36 A;  4UUS B;  3T0Y A;  3FXM A;  1Y0N A;  1MBK A;  3QP6 A;  2QM3 A;  4L18 B;  4M9Z A;  1VQ4 I;  2P6T A;  2RAE A;  3R61 A;  3EYI A;  1R6R A;  3IWF A;  1SD6 A;  3SFI A;  2WAF A;  4ZH4 F;  2HOS A;  1LFU P;  3OYN A;  3H9Q A;  5J47 A;  1KON A;  2XKP A;  3HHG A;  1W5T A;  2DA6 A;  3I4M J;  3PSI A;  1JXS A;  2BXZ A;  1L0O C;  4RM2 A;  2J5O A;  1SFX A;  4UY8 I;  2X85 A;  4PSW A;  2BZT A;  2OCC H;  2XVC A;  4BQA A;  2JJ7 A;  3DQV C;  3WE2 A;  2OQR A;  2HQ5 A;  1JUP A;  2V79 A;  3DEU A;  1BJZ A;  1HOM A;  1Q1V A;  1PUE E;  3GFJ A;  3FHZ A;  2ECC A;  1O3Q A;  2Y31 A;  2KJB A;  3UKG A;  3TP0 A;  1PUF A;  5JVT A;  1TTY A;  2HQR A;  3E5U A;  3VDX A;  3PJR A;  2X1C A;  4KIG A;  1WHU A;  3RYR A;  2A6E F;  4W97 A;  2CMP A;  5EG0 B;  2EWN A;  1OJL A;  1YI2 I;  3CP2 A;  2W48 A;  4G8X A;  5GPC A;  1E17 A;  4HQM A;  3OYF A;  4F3Q A;  2EK5 A;  1P4X A;  3K9T A;  2ISY A;  2DW4 A;  3QRF F;  3ERM A;  1O57 A;  2Q0O A;  3BCA A;  4RM3 A;  1Z77 A;  4PFP A;  3ZMV A;  4C3I J;  3DEW A;  5D5U B;  1ERD A;  1SEU A;  4E7K A;  5EF6 A;  1W7P B;  2OC6 A;  5E3O A;  3DXJ F;  2O9L A;  3KP2 A;  1Y8R B;  3VYT B;  1FMV A;  3CJR B;  4OIP F;  1QPM A;  4N0B A;  1FTT A;  2JA8 J;  4X1E A;  1LEB A;  2JA6 J;  5LHH A;  1MZB A;  1R00 A;  2OJE D;  2VKE A;  1LB2 A;  3I59 A;  3MN2 A;  4EEF G;  1KU9 A;  5IP6 A;  1H8A C;  1JJ8 C;  4GDF A;  1YE9 A;  2HVQ A;  2M87 A;  3HC7 A;  2ME0 A;  5M3F J;  3KEY A;  4UNO A;  2KP6 A;  3T1B A;  3S1N J;  1BM9 A;  1UFM A;  2IXS A;  3Q9S A;  3QAH A;  3PO2 J;  2HOE A;  4LB6 B;  2DMQ A;  2DYR H;  2Z99 A;  2ZSH B;  4HST A;  5EEG A;  3KZY A;  3HOZ J;  5FO5 A;  2IT0 A;  1A36 A;  4LIU A;  1HA8 A;  4UUS A;  2DDB A;  2BY1 A;  1BA5 A;  1B9M A;  3AG4 H;  5D8K B;  3A0H C;  4DIQ A;  3FKI J;  4IVN A;  4I99 C;  1HCR A;  3F8B A;  4KIC A;  5HS9 A;  4A0Z A;  4EQQ A;  3OR2 C;  3NQO A;  1FBU A;  1ZN2 A;  1LKX A;  1Y6I A;  2E1M C;  1XGM A;  4BXF A;  5FJ8 J;  5FRN A;  2JA5 J;  1FBS A;  2KIQ A;  2VXD A;  1O4X A;  3CDI A;  4LG3 A;  4LIV A;  2LNB A;  5CQG A;  3GBG A;  2FMY A;  3KET A;  2JUC A;  4JBA A;  4UV8 A;  1BC8 C;  1HDP A;  3BR1 A;  4IQJ A;  3OYL A;  4IHW A;  3F8N A;  5B66 C;  3OSF A;  1BC7 C;  2DAO A;  1OLT A;  3RQI A;  3JRD A;  1HW2 A;  3VEP A;  4XK4 A;  1STZ A;  4BAY A;  3O6B B;  3W6K B;  2HPI A;  4MEX F;  3CF2 A;  1R1U A;  2ZFU A;  2ZXH A;  4EM1 A;  3JRH A;  5LHG A;  4C9Y A;  1FOK A;  3E6B A;  4ENJ A;  2W57 A;  1R23 A;  3H5A A;  1ITY A;  3LQQ A;  2RNG A;  5FLV A;  2X6X A;  2DXI A;  4CCJ A;  3G6E I;  2DTR A;  2QQB A;  2FE3 A;  3JCU C;  5E18 F;  3WTS C;  4DYQ A;  3CCY A;  3HGY A;  2RQP A;  1LPQ A;  1LEA A;  2OBP A;  3OYA A;  1JGG A;  1U9N A;  3SDG A;  2DJN A;  1GVJ A;  2PI0 A;  2OZU A;  4XMY A;  2F4O B;  1YRN A;  2EV5 A;  1WSU A;  2E2H J;  4ESB A;  5DCM B;  2MFZ A;  2WV0 A;  5FRO A;  2DQL A;  1EA3 A;  4ZYE A;  4U0Y A;  2O0Y A;  2FBH A;  4DYR A;  3D0S A;  3BZ6 A;  4O3M A;  1T6S A;  3S1R J;  1IJW C;  1T33 A;  3WHC A;  3PNV A;  1MMG A;  4LK1 F;  4ZJZ A;  3BR5 A;  4B43 A;  1WJE A;  3LSG A;  1ZRD A;  3HOY J;  2F6C A;  3LST A;  1YS7 A;  4YII A;  3I55 I;  3A02 A;  5C4X J;  1SFE A;  4F7Z A;  3IL2 A;  2DI3 A;  2MGQ A;  2OD5 A;  1JJ6 C;  3M1E A;  1OCP A;  2Y48 A;  3GFM A;  3Q9V A;  4CO8 A;  1IUF A;  1J7K A;  5FLM J;  1D5V A;  4HLY A;  4LG0 B;  3H3U A;  3CCR I;  4CZC A;  5FFZ A;  1TBX A;  1FC3 A;  1WVR A;  3MZY A;  3E6C C;  2NVY J;  2WBM A;  2ZNZ A;  3O3K A;  3OL3 A;  4MQ9 F;  2F4I A;  1MJA A;  4KIF A;  4BE1 A;  3FKJ A;  3FMQ A;  4HBL A;  2BGC A;  2AQF A;  5DEQ A;  3ZOB A;  4I98 B;  4XLA A;  5DV5 A;  4A0Y A;  2LF7 A;  6PAX A;  3WTY C;  4A5N A;  3BZK A;  3DCF A;  5DM6 F;  3LSR A;  3ZQG A;  3QPH A;  4WXD A;  1B4A A;  1G2H A;  3ZMZ A;  1JT6 A;  1FIP A;  4JQF A;  3WU0 A;  4WK8 F;  2ISZ A;  4MGR A;  1V3F A;  2W4S A;  2UWM A;  1ZGA A;  4RB3 C;  3RIR A;  5IP9 J;  4PJJ A;  1Y39 A;  2LKP A;  1D1C A;  1OYY A;  2EIN H;  2CQ7 A;  4GXO A;  3JRG A;  3CC7 I;  4FE4 A;  4A69 C;  4DYC A;  1WZ2 A;  4OIN F;  2XAG A;  2MLK A;  4O5V A;  3GTQ J;  4NBQ A;  3VB2 A;  3ZXS A;  1P92 A;  5E1Z B;  2LFB A;  3H92 A;  3G2B A;  1XG1 A;  4C2U A;  1RKT A;  3K10 A;  3KZI C;  3DWL E;  2Q1Z B;  3OYE A;  2YX7 A;  5E1X A;  3VSL A;  4ENN A;  2IRF G;  2PFB A;  1UST A;  4KIT B;  4M9S A;  3OR1 C;  2K3F A;  3CMA I;  1OR7 C;  2NRA C;  4Y17 A;  3GTJ J;  4BQQ A;  1QVT A;  2JWT A;  2GXG A;  1AU7 A;  1SD5 A;  1JE8 A;  2RC4 A;  1N75 A;  5IPA A;  4RLF A;  5DCM A;  1DP3 A;  1X3W B;  1P9Q C;  2F5V A;  2NS8 A;  4EVI A;  3MD2 A;  1RZ4 A;  1Z9C A;  4IL6 C;  4OMY A;  3DTK A;  4DZJ A;  4XID A;  1UG0 A;  2LSO A;  3R60 A;  1W4M A;  2XAH A;  3DBL B;  4JYK A;  2MH9 A;  1K4T A;  4HNT A;  3T5X A;  2F5E A;  2I8D A;  1DQU A;  1E2X A;  2BE5 F;  3S17 J;  4GFB A;  4RS8 A;  3J7A Y;  4RAY A;  3K4N A;  4HX8 A;  3FK6 A;  5ICG A;  2EFN A;  2F5F A;  4HYE A;  2LY2 A;  3VYU B;  2KRF A;  1T98 A;  2EPF A;  3WTU C;  3OV8 A;  2D45 A;  1UB9 A;  1BI2 A;  2CH0 A;  3I54 A;  3IUO A;  4LD5 A;  4CCM A;  5K1Y A;  1DP7 P;  3HHH A;  1FOY A;  4RB2 C;  2VOP A;  1QVU A;  2YPR A;  4EGZ A;  4L5I A;  2L01 A;  4LG0 A;  2PN6 A;  2W7N A;  3K6G A;  2UXX A;  3R6S A;  4HA8 A;  2OCE A;  2NNN A;  4M71 A;  1RRJ A;  2H1K A;  3FBN B;  2EA2 A;  1FEX A;  2DT6 A;  3DLA A;  2OZ6 A;  1F1Z A;  2TCT A;  1EV7 A;  2Y9Y A;  1ETY A;  2VON A;  4B3A A;  2CV2 A;  2CV0 A;  3F72 A;  2ZJR F;  4MTE A;  2F5D A;  2DOF A;  2XIG A;  2IA0 A;  3KEQ A;  5J6X A;  4WCG A;  4PJ0 C;  2LD5 A;  1MGT A;  1U78 A;  4Y4R A;  4NQW B;  2L7Z A;  4XSX F;  2FNP A;  3W6V A;  3SEQ A;  3L9F A;  2YU9 J;  1IV8 A;  1H88 C;  2Z16 A;  3BRO A;  1RUN A;  1LVK A;  1Z05 A;  2DMT A;  2RV8 A;  2QSG X;  2Y0M A;  2A6T A;  2JSC A;  5KCM A;  1IN7 A;  1R22 A;  2LKS A;  3CTA A;  2E2J J;  4UVB A;  5TGT A;  2DO7 A;  3DKW A;  3MVP A;  5GAE J;  1J0R A;  2ELK A;  2LDU A;  2QWW A;  3GUD A;  2QEN A;  4KYW A;  2CYY A;  1R5G A;  2GLO A;  3EQL F;  2RNJ A;  2K9Q A;  4PZJ A;  2GIZ A;  5FB2 A;  3CO7 C;  5TRD A;  3BJA A;  1JKQ C;  4OAY A;  2D2W A;  3OL4 A;  3ONQ A;  3BR0 A;  2WC2 A;  2A61 A;  3ZQH A;  1T95 A;  1ORK A;  3ML6 A;  1ODD A;  2LRD A;  2FJ1 A;  2Z9O A;  1XGN A;  4V2G A;  1Y56 A;  5M5W J;  1DU6 A;  3D1N I;  4CDG A;  4XLH A;  5JLW A;  3MKZ A;  5GP9 A;  4HG2 A;  4A0X A;  1ZRE A;  2IGN A;  2N8G A;  5ED4 A;  3GTK J;  1IRX A;  3ESW B;  1WJA A;  3RKW A;  4CCL A;  1RIO H;  3HB9 A;  1Z1D A;  2GQQ A;  3AG3 H;  3WHB A;  1QO0 D;  2F2E A;  1GDT A;  1YJN I;  4GYG A;  5DTD A;  2FF4 A;  3GFL A;  3HGG A;  4NDL A;  2AQE A;  4R1H A;  2CJJ A;  1ZGW A;  1YS6 A;  5GAD J;  1NK3 P;  5IT3 A;  1X19 A;  3F21 A;  3KEO A;  2W82 A;  2WAE A;  1EJ9 A;  3HDD A;  3CUO A;  1X1P A;  1B6A A;  3G1O A;  2QVO A;  1QA6 A;  2IVM A;  3LWF A;  1HBX G;  1LDK B;  2VJJ A;  5J4V A;  4IXA A;  5LRR A;  3FXR A;  1X4P A;  2W1O A;  3R0J A;  4BS9 A;  3CME I;  3V7S A;  2RVC A;  4NC6 A;  4AIJ A;  5IP7 J;  2K7L A;  5KVR A;  1RPW A;  3CDL A;  5L3E A;  2IJL A;  1S5L C;  3P5J A;  2E35 A;  3EUH A;  5LBQ A;  2DYS H;  2COM A;  4NC8 A;  3RDI A;  3BOQ A;  2DK8 A;  1ETQ A;  2ID3 A;  2Z3Y A;  4E4H A;  1KQ8 A;  1SFK A;  1TC3 C;  3TO6 A;  2NVQ J;  4M3D A;  3H1C A;  3Q3S A;  3V4G A;  2BW3 A;  4IZZ A;  3HEF A;  1OYI A;  4KJZ A;  3I4P A;  1Z67 A;  4C3H J;  4E7Z A;  1XS9 A;  2M30 A;  4HOB A;  4IHY A;  3TDZ C;  2YUS A;  5A2Q K;  1MND A;  4IEJ A;  3ECO A;  4NQW A;  1FP1 D;  1HKS A;  3DU6 A;  3OYG A;  5IOY A;  2V1U A;  1U5T C;  2DA2 A;  2VE9 A;  1HC8 A;  1GV5 A;  3EUH C;  3QYF A;  4CZZ A;  2BEO A;  1G59 A;  2ZJ2 A;  2HVR A;  3GFI A;  3OIO A;  4XN3 A;  1XMA A;  1JHH A;  2K02 A;  2BYV E;  1YJW I;  3G71 I;  1MJ9 A;  1WCM J;  2CW7 A;  2A3S A;  2EBI A;  2HU9 A;  2JN6 A;  3FM5 A;  2WB1 A;  1FMW A;  2VN2 A;  3ASN H;  2CG4 A;  2RQQ A;  2XGC A;  2IGM A;  1HLV A;  3FIS A;  3L00 A;  4FAS D;  3CCE I;  3G1M A;  2W25 A;  4OAZ A;  5AON A;  1CGP A;  2EB7 A;  1K78 B;  3E97 A;  2HTS A;  3JW4 A;  3TOA A;  4UUT A;  2M4G A;  1E3H A;  2LTP A;  3TW6 A;  3ULQ B;  2TRT A;  1T38 A;  4BDZ A;  2OF7 A;  4XLN F;  3HKZ A;  3BT9 A;  1ETX A;  2ZB9 A;  2KRH A;  4MQV A;  1Z3Y A;  4XR6 A;  4JX4 A;  3JSO A;  4ZTJ A;  3HBL A;  1TP4 A;  2DOD A;  4Z6Y A;  2COB A;  1G3S A;  1Z6T A;  3GTO J;  1BL0 A;  3RKQ A;  1R9T J;  4G94 A;  2Y0S A;  4PFO A;  4N4O B;  3C2H A;  4MEY F;  1J2X A;  3IP4 B;  4OMZ A;  2M3A A;  1O3S A;  2VPL A;  1TW3 A;  1FOW A;  2I5U A;  4Q48 A;  2PMZ A;  4NUB A;  2BVM A;  4PGG A;  2FXA A;  3E1S A;  3FWE A;  1GLN A;  1JUS A;  4C2M J;  3CJN A;  5KAI C;  3H5R A;  1WJD A;  1WWX A;  2E1C A;  4BJ5 C;  5H20 A;  3K1M A;  5GAG J;  1A31 A;  4XKW A;  1KQ0 A;  2QZ8 A;  2CQK A;  4HX4 A;  2L0K A;  2STW A;  5C44 J;  3OYJ A;  3M07 A;  4AIH A;  3WTT C;  1AKH B;  2BXY A;  4G12 A;  1A6I A;  5AIQ A;  1MMN A;  4FET A;  5EYR A;  2P6S A;  2EZI A;  3ZN0 A;  2JRT A;  4MIM A;  4QIW N;  3LMM A;  3S32 A;  2PBI A;  5A2Q Z;  5H2F C;  3NWT A;  2L02 A;  3BPX A;  3CMM A;  2E36 A;  2VC1 A;  2EZK A;  3IC7 A;  1FX7 A;  4CIC A;  3CCL I;  2JA2 A;  3FMS A;  2IS4 A;  1DUX C;  2R7X A;  4CUG A;  1S7O A;  1WRJ A;  2B63 J;  3V7C A;  2V1X A;  2E1M B;  1X2M A;  4XON A;  5F6F A;  1PYV A;  3S8P A;  1FY7 A;  3KE2 A;  1YIJ I;  1BOA A;  3L2Q A;  4PSX A;  3QOE A;  2VIX A;  5EZH A;  3KP7 A;  3VWB A;  1B59 A;  1H9G A;  2MW8 A;  3TOB A;  1V55 H;  1OCR H;  3O8G A;  3MKW B;  2DDA A;  3FMR A;  5TJJ A;  1XX5 A;  3IH4 A;  1BI1 A;  3CCV I;  2L5Q A;  5IOZ A;  5H6Q A;  4HF0 A;  3K4C A;  1K78 A;  4L5J A;  1S7A A;  3E5X A;  4B47 A;  1I50 J;  4CA0 A;  5KK1 A;  4F91 B;  2X6Y A;  4EJT A;  3OSG A;  3CQZ J;  2KIF A;  3CZ6 A;  3DBH B;  1MD0 A;  1I3Q J;  5HLI A;  3V8J A;  3VSK A;  2HEO A;  1LE8 B;  2M5W A;  3CLO A;  3FZV A;  2WA0 A;  5BPI A;  4U88 A;  3HSE A;  5HLH A;  4I0B A;  4IHX A;  2DFI A;  2HYF A;  1ACI A;  2MLG A;  1LNW A;  2JT1 A;  4M6V A;  2DU9 A;  1SVL A;  2V9P A;  2L7F P;  3DKY A;  4BAC A;  1IRG A;  1N78 A;  4PDK A;  2B7E A;  3WOD F;  2M8E A;  2RN7 A;  2KJC A;  3JR9 A;  4JX6 A;  5B1B H;  1X1B A;  3F8F A;  3L2R A;  1SVO A;  3TL4 X;  5EEH A;  2EFQ A;  3MZH A;  4A3F J;  2CW0 F;  1R4M B;  2FU4 A;  4CCK A;  1PP8 F;  1MIJ A;  4HSR A;  5D6F A;  4MNU A;  3J81 K;  1UJ8 A;  1YW9 A;  2WB1 N;  3UR3 C;  3KX2 A;  1FWZ A;  3G73 A;  3Q0V A;  1DU0 A;  3ECH A;  3PSF A;  1YRN B;  3M9A A;  3E3V A;  3CCU I;  5E1W A;  2ZSI B;  2MH2 A;  3BR6 A;  4DNC A;  4BBR J;  2FBK A;  2HDC A;  3F9K A; 
#chains in the Genus database with same CATH homology
 4G6T B;  4XN0 A;  4E7I A;  4CZC A;  4EAT A;  2ELJ A;  2QKM B;  2NOJ B;  2WBM A;  3OL3 A;  2VQC A;  1D0Y A;  2LH9 A;  2R7S A;  1JI8 A;  2F4I A;  2XSJ C;  3C2G A;  4B48 A;  2IGK A;  1D0Z A;  4BE1 A;  3FKJ A;  3DKX A;  2X1D A;  5KHD A;  2BOL A;  2AQF A;  4XKB A;  2CUJ A;  5LD2 C;  1QU3 A;  4XLA A;  3PFY A;  3S3O A;  3DTI A;  4BU2 A;  2GOM A;  2VJI A;  4DGW B;  3BG7 A;  4E7S A;  2M0M A;  4OWR B;  3S3N A;  5HLT A;  4BE0 A;  3VYR B;  1BR1 A;  4JQF A;  3D5S C;  2VKD A;  2CUZ A;  3KYL A;  4YEJ A;  2W4S A;  2UWM A;  3H5N A;  4PJJ A;  1D1C A;  2Z2S B;  2CV1 A;  2DJI A;  3A4C A;  4ZTF A;  1V5E A;  2RRE A;  3L2W A;  4XOT A;  3ZCO A;  1MMA A;  4PJL A;  2DCE A;  3ZXS A;  2WAQ A;  3G2B A;  2R7R A;  2XC7 A;  4C2U A;  3K10 A;  2VL8 A;  3DWL E;  2Q1Z B;  3OYE A;  4IQ4 A;  2VJ5 A;  3SDB A;  3VSL A;  2K9M A;  2L9N A;  3CP8 A;  1E0E A;  4KIT B;  4F55 A;  2P0W A;  3N05 A;  3FDY A;  4MLO A;  4P5O A;  3OR1 C;  4F52 A;  4XOR A;  1OR7 C;  3EUA A;  3LSH A;  4BEH A;  3DTE A;  3TMO A;  3SZG A;  3DPL C;  3PL8 A;  1NG6 A;  4BQQ A;  2FUG 2;  1N75 A;  4RLF A;  1DP3 A;  3HPH A;  1P9Q C;  3OYB A;  2F5V A;  3OS1 A;  3H0D A;  1WJC A;  3MD2 A;  3QYB A;  1MW7 A;  2ZXI A;  3OYI A;  3DTK A;  1UG0 A;  4U87 A;  1VZ0 A;  3I3L A;  3BLY A;  1DGR M;  3HL2 A;  4HNT A;  2BVL A;  2I8D A;  1DQU A;  4RMN A;  5HOO A;  3OYC A;  4BE2 A;  3K4N A;  2E5Z A;  4XKC A;  3J7A Y;  1Z3X A;  2JUG A;  3UNG C;  2LY2 A;  3OWT A;  3VYU B;  4C30 A;  4ZDL A;  3M1C A;  2QKL B;  4XLF A;  2LY1 A;  1UAA A;  2A5W A;  2CH0 A;  3IUO A;  4CCM A;  5CPR B;  2R7V A;  1WJB A;  4PK4 A;  4DOZ A;  1K6Y A;  2O5R A;  3CJQ B;  1BOB A;  2V7F A;  3BCB A;  2W7N A;  3K6G A;  2XAU A;  3H9J A;  2V1N A;  3RPU D;  4NC7 A;  3E0J B;  1BR4 A;  3FBN B;  2DT6 A;  3DLA A;  2HQA A;  2HPM A;  3BG6 A;  2CV2 A;  2CV0 A;  3L2U A;  5HNF A;  2R7O A;  5KNL A;  3LFU A;  4ITV A;  3W2V A;  3DPT A;  3TBI A;  4ANJ A;  4JOM A;  2JVG A;  3AL0 C;  2CW8 A;  1AA7 A;  4J01 A;  2JVH A;  4Y4R A;  4NQW B;  2KQR A;  3SEQ A;  3AL0 B;  2VQL A;  4II3 A;  2MAB A;  2Z16 A;  4D9J A;  4E7H A;  1LVK A;  1TZL A;  2E60 A;  3OYK A;  4XQF A;  2WY8 Q;  3K4L A;  2A6T A;  5KCM A;  2KPM A;  3K4J A;  4N4N B;  1BR2 A;  5HNH A;  5TGT A;  2R7W A;  1V5F A;  3HOT A;  3IAM 2;  3HUG B;  4BDY A;  1X4O A;  1D1A A;  1WFX A;  2X51 A;  3HOS A;  3AFH A;  2Z1D A;  2KMU A;  4BJ6 C;  4OAY A;  4U7B A;  3OL4 A;  3ONQ A;  4QPQ A;  1YX5 A;  2V4J C;  1D0X A;  3RSN A;  1D1B A;  4IKF A;  4DJA A;  1T95 A;  3OYM A;  3K4M A;  5LFA A;  4KIS A;  4XLE A;  2LRD A;  2V26 A;  3M8J A;  3OY9 A;  2VB6 A;  5FRM A;  1Y56 A;  5HVQ C;  3DEE A;  4YRV A;  4XLH A;  3MKZ A;  4HG2 A;  2IGN A;  3LSI A;  1IRX A;  4BUP A;  1WJA A;  4CCL A;  2VLA A;  2DOA A;  1LFP A;  2K3P A;  3IAS 2;  3EPZ A;  2KRC A;  2XF7 A;  2OUM A;  4HPQ A;  2VQH A;  1WJF A;  2XDV A;  4HNU A;  4HRI A;  1SAU A;  3EUK L;  1QHH D;  2AQE A;  4PJN A;  4Y3O A;  4QPO A;  4E7J A;  2R4G A;  4BQN A;  2L7K A;  3PUB A;  2Q2E B;  2IS2 A;  2UUZ A;  2OV7 A;  1DGW Y;  1X19 A;  2GOX B;  3VYS B;  2W82 A;  2WAE A;  1YX3 A;  2CFO A;  3MKY B;  3PNT A;  2K5C A;  3SEZ A;  3W3C A;  3AKZ A;  4D1Q A;  4BQO A;  1LDK B;  2VJJ A;  1X1A A;  1X1C A;  3OOU A;  1X4P A;  2W1O A;  3A2K A;  4BS9 A;  3ZR8 X;  1N77 A;  2KZV A;  3A1Y A;  1UEL B;  3HG9 A;  5CKT A;  2MC4 A;  2R7Q A;  3W2W A;  2X6W A;  4NC8 A;  2M7A A;  4E4H A;  2R7T A;  2HDW A;  1SFK A;  1Z21 A;  4P1W A;  2JSP A;  2BW3 A;  3U21 A;  4KJZ A;  4IZZ A;  4XM3 A;  3V42 A;  4E7Z A;  1MND A;  3ZRG A;  2DT7 B;  4PJM A;  4J00 A;  3OYG A;  3DU6 A;  1R6R A;  2WAF A;  3OYN A;  2CS3 A;  3H9Q A;  1KON A;  3EUH C;  2V9K A;  2M4K A;  2UV1 A;  3PSI A;  3QYF A;  1G59 A;  4RM2 A;  2HVR A;  2HNH A;  2X85 A;  4PSW A;  3FBI B;  4XN3 A;  3OYH A;  4KT6 A;  3H35 A;  4AU7 A;  3DU5 A;  3DQV C;  2CW7 A;  2HU9 A;  4AVZ A;  3BC8 A;  2LOO A;  1FMW A;  2WB1 A;  4DBR A;  2RQQ A;  2IGM A;  1S9H A;  4XLC A;  2BW3 B;  4FAS D;  2X1E A;  4OAZ A;  3PJR A;  3VDX A;  4E7L A;  2X1C A;  1V5G A;  3RQ4 A;  1NG7 A;  1J09 A;  2CMP A;  2M4G A;  2MD0 A;  3CP2 A;  4BDZ A;  4ZYA A;  3HKZ A;  3D5R C;  3OYF A;  3S93 A;  4F3Q A;  3HXL A;  2HZD A;  1X1D A;  2KRH A;  4RM3 A;  1Z3Y A;  3BCA A;  4XR6 A;  4CCN A;  4PFP A;  4ZTJ A;  4Y33 A;  1ERD A;  4E7K A;  2OC6 A;  3LSK A;  4PFO A;  2Y0S A;  4II2 A;  3QOD A;  2MYS A;  1FMV A;  3CJR B;  4N4O B;  3C2H A;  3VYT B;  4BGD A;  3IP4 B;  2VPL A;  2M3A A;  3K4B A;  2PMZ A;  3OS0 A;  1MMD A;  2IGO A;  4NUB A;  2BVM A;  2IS1 A;  3E1S A;  4XKV A;  2LYC A;  1GLN A;  2LG4 A;  2XF6 A;  5JHF A;  3H5R A;  3W2A A;  4YEL A;  3H9G A;  1WJD A;  1W36 C;  3DPU A;  1PJR A;  4GRI A;  4BJ5 C;  4BL0 B;  4H4K C;  2VQG A;  1YE9 A;  2HVQ A;  4XKW A;  3SYT A;  2VKH A;  3HC7 A;  3QYE A;  2PJR B;  3OIQ A;  2L9S A;  2L2O A;  2LBF B;  2E5N A;  3KEY A;  2KP6 A;  1TT0 A;  3OYJ A;  2IXS A;  4PUS A;  2VAS A;  2HVS A;  4CCO A;  2LRE A;  3L2V A;  1QHG A;  4BJT A;  4HST A;  2ZSH B;  1MMN A;  4FET A;  3OYD A;  3FHN A;  2XF5 A;  4LIU A;  4E6K G;  4B3X A;  3K70 C;  1HA8 A;  3LMM A;  3S32 A;  4CH7 A;  3NWT A;  1W36 D;  2WAD A;  3CES A;  3MMY B;  1WJ5 A;  3CMM A;  4DIQ A;  4R79 A;  1Z7L A;  2JA2 A;  3OR2 C;  2IS4 A;  2WY7 Q;  2E1M C;  1LKX A;  1Y6I A;  4BXF A;  2R7X A;  4X0G A;  4CUG A;  5FRN A;  2VXD A;  3RCO A;  4XNF A;  4LG3 A;  4LIV A;  4DBQ A;  5CQG A;  2E1M B;  2LC2 A;  4XON A;  4NNJ A;  3GBG A;  1PYV A;  3S8P A;  4IQJ A;  3OYL A;  3L2Q A;  4PSX A;  1OLT A;  3ZGK A;  3QOE A;  2VIX A;  3VWB A;  1T0F C;  3K70 D;  2HPI A;  2VJ4 A;  3CF2 A;  2K9L A;  2ZFU A;  2ZXH A;  4F93 B;  3MKW B;  4HEA 2;  4C9Y A;  2L5Q A;  3H5A A;  4RLQ A;  4IX7 A;  3PNY A;  3S3M A;  3K4C A;  2RNG A;  3OIP A;  1U0J A;  4B47 A;  2X6X A;  4CA0 A;  2DXI A;  2IS6 A;  4F91 B;  4CCJ A;  3ZQQ A;  2X6Y A;  3CZ6 A;  3I9V 2;  3D5L A;  4F92 B;  2M7B A;  3VSK A;  3OYA A;  3RTR A;  2WA0 A;  4BEH B;  4XMY A;  2R7U A;  4B44 A;  1ZEL A;  3DKY A;  4BAC A;  4AYB A;  1N78 A;  2MFZ A;  2W00 A;  5FRO A;  2V6E A;  4ZDP A;  2KDO A;  1EA3 A;  3K4K A;  3OS2 A;  1X1B A;  3L2R A;  3PNV A;  1MMG A;  3TL4 X;  3OMY A;  4ZJZ A;  4XOP A;  4B43 A;  4CSW A;  2KLO A;  5CQE A;  1WJE A;  3LSG A;  3NWS A;  3LL7 A;  4ZC3 A;  2F6C A;  2KL4 A;  2VXZ A;  4CCK A;  4HSR A;  2KHM A;  4XL9 A;  3UR3 C;  3KX2 A;  2PJR A;  2LBF A;  3PSF A;  1MNE A;  3HPG A;  4LIT A;  4ZDO A;  2ZSI B;  4C2T A;  3LSM A;  1G8X A;  3F9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...