2M1BA

Solution structure of the chxr dna-binding domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
116
Chain Sequence
HSVPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSDDGDKKFSQQDTKLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical response regulator ChxR from Chlamydia trachomatis is structurally poised for DNA binding.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Transcription regulator
molecule keywords Transcriptional regulatory protein, C terminal family protei
total genus 14
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m1bA00
4KIGA 2F5EA 4OIPF 4BYYA 2VBXA 4EJTA 2IJLA 3FMQA 1I27A 1FSEA 2QM3A 3TDUC 1ZREA 1FP2A 4UV8A 2QUFA 4WF2A 4RAZA 4H0EA 2A3SA 1R58A 2OZUA 1XCVA 1MDMA 2K27A 1KU3A 1W7PA 3GFMA 3B02A 2CFXA 2FMYA 2EFPA 2ETHA 2HQNA 5KVRA 5D5VB 4P9UA 4LJZF 4MTDA 4OIOF 2DBBA 5LRRA 3BWGA 2MH9A 3HSRA 4EM1A 3E6DA 1PP8F 4KMFA 1JE8A 2HKOA 4B8XA 2XRNA 1GXPA 1Y0UA 2DW4A 3FXRA 2EK5A 2H94A 1OYYA 3KE2A 1P6RA 1BIAA 2A61A 4LLNA 3TO9A 1IUYA 1A04A 3J81K 3BJAA 1XGSA 4G94A 4WXHA 4ESJA 5JFRA 2L4MA 1YFHA 3E5UA 1T2KA 2YX7A 1U5TA 4HDUA 2CG4A 3TQNA 3V7CA 3T5XA 2ZNYA 4S05A 1IN7A 1Q1HA 4WXDA 2JZYA 4R8HA 4GCVA 4XRFA 3RKXA 3ZMZA 3W6KB 1O3RA 1K7AA 3MCZA 2QWWA 3ROUA 4LMYA 3J80Z 1TW3A 3E97A 5FGMA 2DO7A 2X0LA 5AIQA 3M9AA 3Q9SA 1G6NA 3F8NA 3GW2A 1ZRDA 5L3GA 3EYYA 3GX4X 2DI3A 2Z5UA 3ELKA 1HQCA 1B4AA 1FBUA 1IW7F 3GZ5A 3O3KA 2RDPA 2W57A 3ZMVA 3TGNA 4BHCA 2DFIA 4HAMA 3I5UA 5TJJA 1HKSA 4CICA 2HTJA 1S3JA 3LAPA 5ERIA 4G7ZF 1QPMA 4UV9A 1O3TA 1LQ1A 1P4XA 3LSTA 4JBAA 2XUBA 1YW7A 3HOSA 3KP3A 2KKOA 1JHHA 1O7FA 3IKVA 2XVCA 4FX4A 1CGPA 3LA3A 4IRHA 4BXUA 4IHTA 3CUQC 1ZYRF 3JTGA 4YG2F 4KN7X 3E6MA 4XLNF 5CYVA 1ZLJA 1IN6A 3GYHX 1FYKA 1IRGA 4HQMA 3ULQB 5E18F 3ML6A 2EFWA 1U2WA 4IXAA 3RKWA 2P4WA 1ODDA 1YIOA 2F5DA 4G8XA 2OBPA 2ZNZA 4MNUA 3WGGA 3JTHA 4LGWA 2FRHA 3KEQA 1ZRFA 1PP7U 2PEXA 2M45A 3FXUA 3KZYA 3L7WA 2ZMEA 3H3ZA 4LD5A 3FMSA 4L0YB 2V1UA 1WWXA 3M1EA 1ZG3A 5BPIA 4O3MA 1D5VA 3RPQA 4AIJA 4N9HA 5E20A 3RKYA 1Z1DA 1XSXA 4WX9A 2NNYA 3LA7A 2L54A 2DU9A 3CLOA 3FXQA 2Y0MA 3CJNA 4G7OF 3R61A 3VOEA 5D5XB 2IRFG 1I5ZA 1TQIA 5JVTA 3HIFA 4XBFA 4WWCA 4OOIA 2XKOA 2A6EF 3LFKA 2ISYA 4L18B 1YTYA 2DLLA 4M9XA 1BJAA 2HTSA 2IPQX 2BV6A 3P7NA 2LNBA 2Z9OA 3HUGA 3HRUA 4G6QA 4U7BA 4RAYA 4KFCA 2PG4A 1KYZA 4OIQF 2P8TA 1EH6A 5L3FA 4A6DA 3KEOA 1MKMA 3WE2A 4RGRA 5HDGA 4L5JA 2M87A 4HBLA 4IJAA 2OU2A 3RTRA 4KIFA 4M6XA 1G3WA 3C1DA 1UHMA 1IXRC 5ICFA 4M6YA 2FOKA 2EFQA 2HFHA 4N0BA 3L2CA 1J0RA 2L02A 3MQ0A 5HDKA 2GA2A 3FM3A 2FNPA 4GYGA 2LF7A 4JK1X 3DFGA 2Q2EA 3K0LA 4P9FA 1O57A 3WTYC 4LG0B 4A5MA 3WODF 3C3WA 3F72A 2FU4A 4ENMA 2IA1A 1KQ0A 1WSUA 3HTSB 4KNYA 1BC7C 5LBQA 1DPUA 2PFBA 3M7GA 4WXCA 1STZA 4DNCA 5LHHA 1IN5A 2YSRA 2UZKA 2IP2A 1HSTA 1KA8A 1QO0D 3TOAA 2XKPA 1FPQA 1YLFA 3ABUA 3F8MA 2ADUA 3TOBA 3FM5A 1RIOH 3V4GA 4I98B 1J75A 5CVRA 5A2QZ 2NNNA 3CTAA 1KU7A 1O3SA 5F64A 2KIMA 5F6FA 4NHJA 2MC3A 1KQ8A 4BHPA 5DCFA 1R00A 3OV8A 4LFUA 2LKPA 2RV8A 2VT3A 2DK5A 3WTWC 4IF4A 4MQ9F 5K5RA 1EV7A 2QENA 2O6GE 3QAHA 2HEOA 2P7CB 3CUQB 5AIPA 4I7HA 4AIHA 1HW5A 1JXSA 5ICCA 5AONA 2EFOA 5K5OA 2FXAA 2P6TA 4WK8F 2D45A 3QP6A 3N4MA 1FSHA 1WI9A 3JAMK 4G6DA 4S04A 3L00A 2VODA 3P9CA 2PJPA 2JTVA 3U2RA 4ON0A 1S29A 1FZPB 2O8XA 1LEBA 3WGHA 2XASA 1EH7A 2ZJ2A 2P7VB 3TDZC 4RS8A 1SAXA 3CUOA 5FD5A 3KP2A 3D5LA 2DQRA 5TRDA 4EGYA 2VXZA 3WTTC 2VC1A 5EEGA 3KZZA 5E8IA 3F23A 2OQRA 4ZZLA 4HDVA 5HS7A 3HYIA 4IVNA 5LGUA 2E1CA 2RN7A 3JW4A 4PGHA 1GXQA 1FYMA 5E1ZB 2PLYA 2W85A 3K1MA 2A69F 3K1PA 1B9MA 3LAJA 1QQIA 3MEXA 5E1XA 2MA3A 3QPTA 2YX4A 2YU3A 3GFLA 2W24A 4FT8A 1HBXG 3GF2A 1F5TA 5HDNA 3GO5A 2E1NA 2P5KA 3V7SA 3G3ZA 1FX7A 1P92A 1GVJA 3ZPLA 1Z6RA 4U7DA 4PZJA 3DKWA 4EQQA 1R23A 5JI6A 2KIUA 4LLGF 1F1ZA 1MD0A 1CF7A 3M8EA 2R3SA 2EV5A 1DP7P 2ELHA 2HQRA 3ABTA 4I01A 4HZFA 2H09A 2VN2A 4RGXA 3REOA 5D6EA 2FQ3A 1PUEE 2DPDA 4IPAA 2KRFA 2W84A 2M30A 1BN5A 3J80K 1B59A 1X3UA 1U5TC 5CJ9A 2L01A 1F9NA 1R1UA 4U0WA 5IT3A 1DUXC 2TDXA 1FWZA 4BNCA 3K2ZA 4UHTA 5CVVA 2MLGA 2W25A 4ENJA 5LEJA 5DV5A 2GQQA 3SZPA 2OZ6A 1BI0A 4I0AA 5BMZA 5DEQA 4TV7A 2XHKA 5HVQC 3T0YA 2XROA 1ON2A 4KICA 3F21A 3I58A 5K1YA 3MZYA 4HF2A 4A0YA 2F5CA 5FFXA 1OKRA 1FYLA 5CVUA 2NS0A 3K69A 3LQRA 4CXFA 3B73A 2P5VA 4LB5A 3GFJA 2EV6A 3CUQA 3MWMA 2WTEA 2FSWA 2CGPA 2PN6A 2Z3YA 5BS6A 3BP8A 2H6BA 2ZO4A 4O5VA 5L3EA 5D4RA 2GA1A 3U1DA 2GAUA 2DTRA 1K6OA 4L9JA 5D4SA 4KMUX 1K79A 5DCMB 5EEHA 1XGOA 2XAGA 3FF5A 3ZMTA 1MDMB 4A12A 2D1HA 4M74A 3GZ6A 2E7XA 2DAOA 2EJRA 3P9KA 1SFXA 1TNTA 3HSEA 1KGSA 4WCGA 3EQLF 3ZN0A 1TW2A 2V1DA 2FF4A 3RPUA 3N97A 3CO6C 3I4PA 3PQKA 3E5XA 3GLXA 4LK0F 4D0PA 5CVJA 4UNOA 2PMUA 1MJAA 2YR2A 2E7WA 5L3CA 1AOYA 3SXYA 2DT5A 3DEUA 1YS6A 4KT5C 5BQTA 2X4HA 3F6OA 1J7KA 2NRAC 3HRMA 2Y48A 3HHHA 3F6VA 1U3EM 4KA4A 2ZMEB 3J81Z 3QPHA 2RQPA 1SD5A 4HA8A 5E8GA 4I09A 3IWZA 2FA5A 2RGVA 4ASNA 2CSOA 2OAZA 1NHAA 4M72A 1AWCA 1QBJA 3L09A 5FD6A 1H9GA 3IRQA 4U0VA 3S2WA 3HSFA 1YW8A 4YIFA 1REPC 1ZLKA 3WTUC 3SFZA 3NQOA 2F5FA 3JSPA 2Z99A 3GVAA 2FE3A 3MFKA 4ESFA 4KN4X 1Z05A 3ZMSA 5K5QA 3T8RA 2UXXA 3MZHA 2STTA 1H9TA 4HQEA 5LHIA 1U5TB 4MTEA 2EA2A 1BBYA 3ERED 2LDUA 1FBQA 1DDNA 4Z2YA 1Z9CA 1E17A 1BI3A 4OINF 4MGRA 1ZHFA 1IN8A 3WGIA 1SMTA 4AVPA 4RB3C 1SD6A 3FWEA 4HLYA 2VC0A 5H6RA 2XGXA 2WV0A 1R7JA 3HRTA 3I0TA 2ACJA 5D5UB 1R5GA 2K86A 1QZZA 5FO5A 4YFXF 1TBXA 1YQAA 2XAFA 4KIBA 3P9IA 2OA4A 3I64A 4JQFA 1RNLA 4LLLA 4I02A 3U9GA 5E1WA 3D0SA 1W7PB 2KJBA 3ZQ7A 2IA0A 4YIIA 2HYFA 5BOXA 1U8RA 1HKTA 3DPLC 1JGSA 4Q48A 2UWMA 1XB4A 4N9IA 2G7HA 2QLZA 3BPVA 3HTUA 4UVCA 1BM9A 1TQPA 2JPBA 1XGMA 1UHWA 4ZYGA 1QZYA 3BJOA 1FT9A 1D8KA 4G7HF 3KP5A 2XIGA 3PQJA 4U88A 4XSZF 2ESNA 3COAC 4HX4A 4PGGA 1ZN2A 1HSJA 1MJ9A 2O03A 1LEAA 2C6YA 2K7LA 2LF8A 2EB7A 3E5QA 4OMYA 3ZMUA 4HX7A 1ONVA 1BIBA 1ZAOA 5E17F 1YS7A 1SD7A 4P5OA 5LGNA 1O7LA 1FC3A 2IA2A 3JAMZ 4CDGA 2K4JA 3GWZA 4MHGA 2O3FA 1T0FA 3M8FA 1VTNC 4KDPA 4LB6B 1IZ1A 2MBFA 4EGZA 2K4BA 1UB9A 4CHUA 2ISZA 3FMRA 2VOOA 3IWFA 2D2WA 1FOKA 4EJVA 2VBWA 3ZN1A 3KP6A 3GEZA 3KETA 4HF1A 2STWA 4ZYDA 3HRSA 4AWXB 1SD4A 5ED4A 1USSA 4A0XA 1OMIA 4UVBA 1LDDA 2Y75A 1UCRA 2QQ9A 4NB5A 2OQGA 4ZYEA 4P96A 5J8FA 1G4DA 1J9IA 3RIRA 1KYWA 2V9VA 3BPXA 3WTZA 1MGTA 2QZ8A 4GYIA 4A5NA 4CO8A 2D1VA 3J7AO 1W4MA 2J5OA 3DXJF 1KU2A 3DF8A 4HF0A 4EMSA 1Z91A 2MD5A 3KCCA 1H0MA 5FFZA 4Y15A 2HYGD 1DPRA 3T1BA 3ISPA 1R1TA 3I54A 5F1RA 2BE5F 2ESHA 2YPRA 2RVCA 3W6JB 4LK1F 1XD7A 2ZKZA 4YFNF 4EJOA 2UXNA 5FLXZ 3R0JA 5CLSA 1T6SA 2IW5A 1SFEA 1S7AA 3EDPA 1W5SA 1WKMA 5HS8A 1J5YA 1B9NA 1QGPA 3H3UA 1P4WA 4O6JA 3KP4A 2BYVE 1QNTA 1LDKB 4MEYF 1I1GA 4PDKA 1K78B 5HLGA 3RYPA 1S6LA 1G3SA 3DV8A 1USTA 3VFZA 1FBSA 1KU9A 4HX8A 2Q0OA 1FY7A 1G3TA 5HS9A 3OOPA 5JR3A 4L5IA 4Q4ZF 5DD4A 3JSOA 2PQ8A 1RZ4A 1ZG5A 2M1BA 1TTYA 1MZBA 2L4AA 2P5LC 3T8TA 5CVIA 3O2PE 5ICGA 5DDGA 1FNNA 3GUDA 4EVIA 2PBIA 3V8LA 1HXDA 5HOOA 5DD8A 3IL2A 2QQBA 1J59A 2H6CA 1BI1A 2HS5A 2DQLA 4OIRF 4M9SA 3ZP5A 2DK8A 3F22A 4EV0A 1R1VA 2HOEA 4MEXF 5L3BA 1ZH5A 1ON1A 3WU0A 4NQWA 1T98A 5D6FA 5D8LB 2HZTA 1E2XA 2XAQA 2FBKA 4G9YA 5DCMA 4QLCU 1XSDA 2IVMA 3HOTA 6PAXA 4OMZA 2K02A 1LJ9A 2FBIA 4RGSA 4Q47A 1FP1D 3AAFA 5J8CA 2MLKA 4ETSA 3SQNA 3RDIA 1LDJA 2FEZA 3R60A 1R5HA 5DYMA 4R79A 1OYIA 3SZTA 2J5PA 3KFWX 2ZXJA 2RC4A 1BC8C 1W7PD 1K78A 1G3YA 4EM2A 2KJCA 5H6QA 3TO6A 4A0ZA 1TQMA 2CWEA 3QU6A 2IT0A 3BY6A 2CO5A 2CW0F 1TNSA 2G7UA 3WE3A 2RNJA 2V79A 3I59A 1IF1A 3FHZA 4BH9A 1YYVA 2FBHA 2WC2A 1GHCA 4PCQA 4UXNA 2GIVA 4HLXA 4QWQA 2O0YA 1EH8A 3L9FA 3BZ6A 2BBYA 3KLOA 1XMAA 3BJ6A 1ZGAA 4M9ZA 3EUHA 5BPDA 2VBYA 5HLHA 4GO1A 4K2EA 3CDHA 2JPCA 3C7JA 1D8JA 2VE8A 4ZH4F 3F8CA 1S7OA 4AIKA 3V8KA 3QP5A 4XSXF 3IRRA 1B6AA 4HOBA 2R7FA 2QBYA 1ZRCA 2AXLA 1XSVA 1WQ2A 4F7ZA 2QVOA 4ZZDA 5J6XA 1I6XA 1D3YA 2MH2A 2V6CA 4I0BA 4L9NA 2HWVA 1U78A 5DUKA 2LSOA 5H20A 3LQQA 4A6EA 2FNAA 2ZBKA 3IC7A 2DPUA 1F4KA 4DQ2A 3EETA 5HLIA 4L9VA 1CF7B 3VODA 1RUNA 2VT2A 2A68F 2BEOA 2PMHA 1V3FA 5A2QK 2GWRA 2JT1A 2ZFWA 5IT9Z 1LNWA 4RGUA 4M71A 3VB2A 1TLHB 3SHFA 3WTXC 4E70A 4I2OA 3DP7A 1C0WA 3RYRA 1OYWA 4P55A 2QQAA 3F8FA 4BQAA 2QBYB 4CZZA 3CO7C 2B0LA 1U6GA 2GXBA 4B09A 3GXOA 1XCBA 4BAYA 4XLPF 4KUMA 2NAZA 4EJUA 1R36A 4FHTA 2G9WA 2JSCA 2RKHA 5ICEA 1LVAA 4Y13A 3F3XA 5JHUA 1BOAA 3K9TA 3E6CC 2BGCA 3Q5FA 1SFUA 2HR3A 1OR7A 1YW9A 3C18A 1LB2A 4Y17A 4IRIA 1IXSB 2PI0A 1I1SA 2EA4A 3GFIA 2H27A 2M5WA 3DPTA 4L9TA 5LHGA 2XV4S 3I71A 2V1XA 3ECHA 1HW1A 4RB0A 2VONA 1W5TA 3QRFF 3BROA 1UFMA 2WWYA 2XAHA 5ILUA 3IKTA 3RI4A 3F8BA 1KQ9A 2KIFA 5L3DA 2EV0A 1ULYA 3DQVC 1RI7A 3V8JA 4EJWA 4Q5SF 1XDUA 1YG2A 3WG9A 4BHBA 1IAWA 1Z7UA 4GXOA 3MAJA 4UUVA 1BI2A 4HV5A 3O6BB 5LGTA 1MJBA 1SMYF 3E3VA 2FMLA 2GXGA 1S8NA 2JRTA 1RUOA 4UVAA 1WRJA 4ZYHA 1ZGJA 3LWFA 4IHSA 2EWNA 2NYXA 2COMA 4GGGA 4LG0A 2Z33A 5LEKA 2A07F 4U0YA 5LRSA 2CYYA 5D5WB 2QYOA 4FX0A 3TKYA 4A2UA 4HV6A 1ZARA 3QOPA 3R4KA 1PDNC 2A5YB 3NEUA 2F2EA 3I59B 1R22A 1IRFA 2HGCA 3FX3A 4AD9A 1HKQA 4ENKA 2M8EA 2XAJA 3BDDA 3I53A 1XDSA 2GZWA 2VE9A 2AS5F 5KK1A 3WU1B 3FZVA 4YFKF 3H92A 3WTSC 1ZG1A 4RB2C 1XN7A 2O61A 3V7RA 2HKXA 5FB2A 3PFIA 3TO7A 4HW0A 3KP7A 3BOQA 3ZMDA 4CGZA 1XGNA 5LLQA 1HW2A 1T38A 2P6SA 2ZCWA 2A6HF 3RJPA 3R0AA 1L3LA 2VBZA 2Q8KA 4RB1A 1XMKA 1OPCA 5IT9K 1B1BA 1J2XA 1JHFA 3R6SA 1V4RA 4MQVA 3WTVC 4KYWA 3EYIA 1O3QA 3VEPA 1Z6TA 4HYEA 5D8KB 1IN4A 4M73A 2VOPA 1P4AA 3HHGA 1FLIA 3K1NA 2L3DA 2R7DA 3ECOA 3KLNA 4ESBA 1P2FA 5ILSA 4IRGA 5DUIA 5ILVA 2HDCA 3LA2A 3IHUA 3G73A 4OU0A 3NRVA 3E6BA 4L0ZB 1IXCA 4ENNA 1YO5C 4EM0B 5FLXK 2EFNA 1T39A 2CQKA 3Q9VA 3QU3A 4R1HA 4CYDA 1L0OC 2OD5A
chains in the Genus database with same CATH superfamily
4KIGA 2F5EA 4PSXA 4OIPF 2H1LA 3ZQGA 2JA5J 3OMYA 3RZDJ 3CCSI 4C2UA 2E1MC 2HXOA 4BYYA 2ELJA 2JA8J 3GTOJ 2VBXA 1RKWA 1MBHA 4EJTA 2X1CA 4U87A 2IJLA 3FMQA 5C4XJ 5J1UA 3BG9A 3MVPA 1I27A 1FSEA 2EIKH 2EZHA 2QM3A 3LFUA 4IQJA 3TDUC 4D1QA 1ZREA 1VFCA 4XLHA 2Y9ZA 1OCZH 1FP2A 2DJNA 1SVOA 4UV8A 3J7YJ 2QUFA 4WF2A 4RAZA 4H0EA 2A3SA 3PUFA 5EEAA 1R58A 1QHHD 2OZUA 4BJ6C 1XCVA 1MDMA 2K27A 1KU3A 1W7PA 2RQQA 3GFMA 3B02A 1BR1A 2CFXA 5GAHJ 2VKDA 2R93J 2FMYA 2DFFA 4NC8A 3IH3A 2EFPA 2ETHA 2HQNA 5KVRA 5D5VB 4P9UA 4LJZF 2V9PA 4JX6A 4PUSA 2O7OA 4IHWA 1U0JA 3MKWB 2OJED 4MTDA 2HPMA 1NK3P 2DBBA 5LRRA 1Z3YA 2IEKA 2MH9A 2XPUA 3BWGA 4OIOF 4AM3A 3HSRA 2IS4A 1LVKA 4YIRX 4EM1A 2P81A 3E6DA 2BY1A 1ENHA 1PP8F 1PJRA 2Z16A 5IPAA 2KZGA 2M8GX 4KMFA 1JE8A 2HKOA 4B8XA 2XRNA 4IX7A 3B6CA 3DU6A 2R7WA 1OLTA 2DA4A 4B44A 1GXPA 1Y0UA 1ETVA 2DW4A 1X1PA 3FXRA 2EK5A 2H94A 3WU2C 1OYYA 4DZPA 3KE2A 4RMNA 1P6RA 2PMZN 1BIAA 3ZQLA 2A61A 3CCUI 1PUFB 4LLNA 3BC8A 3TO9A 3PO2J 1IUYA 2JUGA 5F04A 4HEA2 1IDZA 1J09A 4A3DJ 2KISA 4P1WA 1A04A 3GTMJ 3J81K 3BJAA 1XGSA 4G94A 4WXHA 5JFRA 4ESJA 2L4MA 1YFHA 3E5UA 1T2KA 1WJBA 2YX7A 1U5TA 4HDUA 2X51A 2IGNA 4OWRB 2CG4A 3TQNA 3V7CA 1X4PA 3T5XA 1ZGWA 1N77A 2LKSA 4A3LJ 2ZNYA 2WADA 1DQUA 2MC4A 1POGA 4S05A 1IN7A 1Q1HA 4UY8I 4WXDA 2JZYA 4R8HA 2OUMA 4GCVA 4XRFA 3RKXA 1U9OA 2DFHA 5FKNA 3ZMZA 2JWTA 4BBRJ 3W6KB 1O3RA 1K7AA 1GDTA 3MCZA 2NS8A 2QWWA 5EG0A 2NVUB 3LSRA 3ROUA 2LYCA 3OSFA 4LMYA 1YIJI 3J80Z 1TW3A 4B48A 3E97A 5FGMA 4DBRA 2DO7A 2X0LA 5AIQA 3M9AA 5FLVA 3Q9SA 3ZGKA 1G6NA 3F8NA 4IOAF 5E3OA 2ZXWH 4BBSJ 3GW2A 1ZRDA 5L3GA 3EYYA 3GX4X 2DI3A 2Z5UA 4PK4A 3ELKA 1PUFA 1HQCA 1B4AA 3SJMA 1WI3A 4CH7A 2A6TA 1FBUA 1IW7F 3TW7A 2CMPA 3GZ5A 3O3KA 4C2TA 2RDPA 1UJ8A 2W57A 3ZMVA 2HDDA 3TGNA 2BXYA 4BHCA 1WVRA 2DFIA 4HAMA 4YRVA 2E34A 3I5UA 1JI8A 2DOAA 3FIWA 2VJ4A 3OYEA 5TJJA 3IAM2 1EA3A 1HKSA 4JOMA 1ZR2A 4CICA 2HTJA 3OWTA 1S3JA 3LAPA 1IV8A 5ERIA 3MMYB 2NVXJ 4G7ZF 3CLQA 1QPMA 4UV9A 1O3TA 1LQ1A 3M07A 1OR7C 2MSYA 1P4XA 3LSTA 2R5ZB 4JBAA 2XUBA 3ZQIA 1Q1VA 1Y1VJ 2M3AA 4BY7J 1ETYA 4PSWA 4A3EJ 4Y7NJ 2MABA 1YW7A 2XGCA 3HOSA 3DWLE 3KP3A 2KKOA 5F08A 1JKQC 1JHHA 1O7FA 5K7HA 4RAGA 4BQNA 2KDOA 2QQ8A 3IKVA 1WJDA 1WH7A 2XVCA 3HOVJ 2AQFA 5FKKA 2ECBA 4AIDA 4FX4A 1CGPA 3IH2A 3LA3A 4IRHA 4BXUA 4IHTA 3FXMA 3CUQC 3PIOF 3LSIA 1ZYRF 2ZXHA 1HCRA 2DA6A 3JTGA 4YG2F 4X0GA 2VQLA 3W6VA 3ASOH 4KN7X 4IZZA 2VB6A 3E6MA 5FKMA 4XLNF 5CYVA 1IC8A 1ZLJA 3CF2A 3PL8A 1IN6A 3A4CA 1MBKA 3GYHX 2OPTA 5FKLA 1XG1A 5IYBJ 1FYKA 5HNFA 1IRGA 4HQMA 4KISA 3I9V2 3ULQB 5E18F 3ML6A 1X1BA 2CUJA 1U2WA 2EZLA 2GBYA 4IXAA 2EFWA 3L2UA 1VQKI 3RKWA 2VQHA 2R7OA 1X2NA 2DMUA 3OS1A 1LUJB 2UUZA 1JGGA 2P4WA 1ODDA 1YIOA 2HDWA 1HOMA 4ITVA 2R7UA 3K6GA 2HVRA 2F5DA 4G8XA 3A03A 2OBPA 2ZNZA 1QPIA 4MNUA 3SYTA 3QPLA 3JTHA 4LGWA 3WGGA 2FRHA 1V5FA 3KEQA 5M5YJ 1ZRFA 1PP7U 4JYKA 4PJJA 1V55H 2EZKA 2PEXA 1JTXA 2M45A 3FXUA 1UG2A 3L1PA 3KZYA 3L7WA 2ZMEA 2L2OA 4V2FA 3H3ZA 4LD5A 5TISC 4PJNA 3FMSA 4L0YB 3M3YJ 2V1UA 4B47A 4W1UA 1WWXA 2HVQA 3M1EA 2K3FA 2LP0A 3CMYA 1ZG3A 5BPIA 2CW7A 2L9VA 3FHNA 4O3MA 1CQTA 1D5VA 3RPQA 4AIJA 1R4NB 2LKXA 4N9HA 2XSDC 5E20A 3RKYA 1D0ZA 1Z1DA 1XSXA 3X2QH 4WX9A 4Y33A 2I8DA 2NNYA 3LA7A 1E3OC 2F4MB 2L54A 2DU9A 3IAS2 2NVTJ 2DN0A 5J1YA 2E1MB 3CLOA 3FXQA 2Y0MA 2F4OB 3CJNA 4XLAA 3GLLA 2CQNA 1MMDA 3HOUJ 4G7OF 2V1NA 3R61A 1OQYA 3VOEA 5D5XB 2IRFG 3FISA 1I5ZA 1VQ5I 1TQIA 5JVTA 3HIFA 4XBFA 4WWCA 2JN6A 2M7AA 4OOIA 5B5EC 3CMMA 2A5WA 3OYHA 3IH4A 1D1BA 4NNJA 2XKOA 1MMNA 4QSHA 2A6EF 4S0HB 1LFBA 3LFKA 2KFDA 2ISYA 4L18B 1T95A 2WY7Q 2K5CA 4LIVA 1YTYA 2DLLA 3S17J 4M9XA 1BJAA 2HTSA 2IPQX 2BV6A 3NWTA 1WHUA 3P7NA 4JX4A 4V19K 2LNBA 2Z9OA 3HUGA 3HRUA 3SEQA 3A01A 4G6QA 3OIOA 2HQ5A 4ZC3A 4FETA 4U7BA 4RAYA 4GFBA 4HG2A 3HL2A 2XF7A 4KFCA 2XRLA 2PG4A 1KYZA 2HYJA 3GZNB 4OIQF 2P8TA 2LFBA 1EH6A 2Q2EB 5L3FA 4A6DA 3KEOA 5EZGA 1MKMA 3CESA 1T56A 3WE2A 2V26A 4RGRA 2V4JC 5HDGA 4L5JA 2M87A 3A0HC 4IOCF 2DMNA 4HBLA 3L2RA 4IJAA 3RSNA 3CJTB 2OU2A 3RTRA 1X3WB 4XM3A 4AYBA 4KIFA 4M6XA 3VWBA 2O9LA 4I76A 1G3WA 3C1DA 1UHMA 1IXRC 2L7FP 5ICFA 4M6YA 3HM5A 2FOKA 4UB6C 3G6EI 2EFQA 2LTPA 3QYBA 1ACIA 3ZRGA 2KZVA 2HFHA 1A6QA 2IAIA 4N0BA 4NC6A 3L2CA 1XPXA 2HZDA 2PJRB 3ABLH 1J0RA 2L02A 3MQ0A 5HDKA 2ZMEC 2KPMA 4IHYA 2GA2A 1OISA 2RAEA 3FM3A 2FNPA 5EZHA 4GYGA 2LF7A 4M6VA 1F36A 1RRJA 1LE8A 2IS6A 4JK1X 3DFGA 2Q2EA 3K0LA 1E3HA 4P9FA 1O57A 3WTYC 4LG0B 4A5MA 2WB1A 3WODF 3K7AJ 3C3WA 3F72A 4BU2A 2FU4A 3K4BA 1JUMA 4ENMA 2IA1A 1KQ0A 2DA3A 1WSUA 3HTSB 4KNYA 3W2WA 1BC7C 5LBQA 1DPUA 2LBFA 2PFBA 2WAQN 1MW7A 3M7GA 4WXCA 2B63J 1STZA 4DNCA 5LHHA 1IN5A 2R7RA 2YSRA 2UZKA 2IP2A 1A31A 1HSTA 1KA8A 3HGYA 2DDAA 1QO0D 3HJEA 2IGOA 4I6ZA 3TOAA 2XKPA 3H9JA 1FPQA 1YLFA 3ABUA 4XL9A 1N78A 2CFOA 3F8MA 1R6RA 2ADUA 2AQEA 4XK4A 1Y0NA 1MBFA 3FM5A 3TOBA 4D5CA 3DCFA 3V4GA 4I98B 1RIOH 4FASD 1J75A 3WG7H 5CVRA 3AG2H 1UAAA 3QYEA 3D1NI 1SEUA 2CUZA 2K3PA 4UUTA 5A2QZ 4A3IJ 2NVYJ 2YU9J 1FJLA 2NNNA 3CTAA 3ONQA 2K9SA 3BZKA 1KU7A 3HG9A 3RPUD 5J4YA 1O3SA 4HNVA 5F64A 1VQ7I 2KIMA 2DYRH 5F6FA 1K4SA 3OYLA 4NHJA 2MC3A 2JQ7A 4BHPA 1IV6A 1KQ8A 2K9NA 5DCFA 1XTAA 3W2VA 1R00A 3OV8A 1TT0A 4LFUA 2LKPA 3DTIA 2RV8A 2VT3A 2R0QC 3S15J 3LSPA 2DK5A 3WTWC 4IF4A 4MQ9F 5K5RA 1EV7A 4FQGA 1HA8A 2QENA 2O6GE 1XS9A 3QAHA 2HEOA 1IG7A 2P7CB 3LSHA 3CUQB 5IYCJ 2VQGA 3FKJA 5AIPA 4DYQA 1JTYA 4I7HA 4AIHA 2M9HA 1HW5A 1JXSA 3OY9A 4AVZA 5ICCA 2L7ZA 2BY0A 1Y6IA 2EFOA 5AONA 1APLC 2DMTA 5K5OA 3AG1H 2FXAA 2P6TA 4WK8F 2D45A 1EJ9A 3QP6A 3N4MA 3S1QJ 1K83J 3SDBA 1FSHA 2WAFA 2WV1A 1WI9A 2DA1A 3JAMK 4PJ0C 2Q1ZB 4G6DA 2WAEA 3L00A 4RLFA 4S04A 2VODA 3P9CA 2PJPA 1FOYA 1ZELA 1TL8A 4HSRA 4DW6A 3GTGJ 3K4LA 3S32A 4LIUA 2JTVA 4C30A 4F3QA 4ZTJA 3ABKH 2LOOA 3U2RA 4ON0A 1S29A 5GADJ 1YOVB 1FZPB 2KRCA 2LG4A 2O8XA 1LEBA 3WGHA 2XASA 2L5QA 4E7JA 1EH7A 1F43A 2ZJ2A 2P7VB 3TDZC 4ZJZA 3I3LA 3KIOA 4RS8A 1SAXA 1YX5A 3S8PA 3CUOA 3P5JA 5FD5A 3KP2A 2EQRA 4GDFA 3D5LA 2R5YB 1WGXA 2DQRA 5TRDA 2X6WA 3CDIA 2W48A 4EGYA 3KYLA 1X4OA 3BG7A 2BY3A 2VXZA 4CYCB 3WTTC 2VC1A 2KT0A 3GBGA 3KZZA 5EEGA 5E8IA 3NWSA 3F23A 1YHQI 2Y0SN 2LY2A 3B6AA 2Y30A 4QPQA 2OQRA 4ZZLA 3E1SA 5LFAA 1D0YA 3RZOJ 2CUEA 5TGTA 4HDVA 5HS7A 3HYIA 4IVNA 5LGUA 1W5CC 2E1CA 2RN7A 3JW4A 4PGHA 1GXQA 1OCPA 3IP4B 1TWAJ 5KAIC 3ZOBA 1FYMA 1SFOJ 5E1ZB 2VQCA 4M3DA 3HOYJ 2H8WA 3U1KA 2FJ1A 2PLYA 2W85A 3K1MA 1VQOI 2A69F 3K1PA 4FE4A 5IP7J 1B9MA 1JKRC 5EJCA 3LAJA 1MNMC 1QQIA 3A02A 3MEXA 2QA4I 4B1RA 2LR8A 1JT6A 4BEHB 2W00A 3WHBA 5E1XA 2ICWG 2MA3A 1I50J 3QPTA 2YX4A 3ZQCA 2YU3A 3GFLA 2W24A 4FT8A 1HBXG 3GF2A 2BXZA 5F0FA 1F5TA 4JX5A 5HDNA 3GO5A 1SFKA 2E1NA 3BR2A 2HU9A 3EUAA 2QSHX 3CCQI 4E7KA 2P5KA 3KX2A 3V7SA 3G3ZA 1DU6A 1FX7A 1A5JA 5B1AH 1P92A 4CCLA 4Y52J 1GVJA 4XKCA 2H1KA 1LFUP 3ZPLA 1Z6RA 4U7DA 5E79C 3S1RJ 3RQ4A 4PZJA 2K9QA 3DKWA 1D1AA 4EQQA 1R23A 5JI6A 4MIMA 1BA5A 1EKEA 2KIUA 4LLGF 1F1ZA 1MD0A 4IQ4A 1CF7A 3M8EA 2R3SA 3JRAA 2M7BA 1S72I 2EV5A 1DP7P 2ELHA 2HQRA 3ABTA 5F0CA 1VQLI 4I01A 4HZFA 2H09A 1HLVA 2VN2A 3FDYA 2VJ5A 4RGXA 4HSTA 3REOA 5D6EA 2WB1N 2Y31A 4J01A 1UELB 3PIPF 2FQ3A 1PUEE 2DPDA 4IPAA 2KRFA 2ZSIB 2W84A 3H35A 3VDXA 2M30A 3BR1A 2EPFA 3DLLF 3S3MA 3HGGA 2E1OA 1BN5A 2WAQA 2ME6A 3J80K 1RR7A 1B59A 2CV1A 1GT0C 1V5EA 2E5NA 4C2MJ 3J7AY 1X3UA 2X6XA 1U5TC 2ID3A 3BCBA 5K7ZA 5CJ9A 4XICA 3L2QA 3S3NA 2L01A 1F9NA 1R1UA 4U0WA 5IT3A 3IV5A 1W0TA 1DUXC 2TDXA 1FWZA 2XAUA 4BNCA 3K2ZA 1FEXA 4NBQA 3GTKJ 4M3GA 2QSFX 4UHTA 2DT6A 5CVVA 1AA7A 2MLGA 2W25A 4ENJA 1SAUA 5LEJA 3DBRB 1JJ8C 5DV5A 4MLOA 4ABZA 2XSJC 2GQQA 2NOGA 2GM4A 3SZPA 2OZ6A 4YELA 1BI0A 4I0AA 5BMZA 5DEQA 2DXIA 3CC7I 4TV7A 2XHKA 4F93B 5HVQC 3T0YA 2XROA 1ON2A 2M0MA 4BS9A 4KICA 3F21A 2I5UA 2DT7B 3I58A 3MZYA 5K1YA 4HF2A 4A0YA 4XQFA 2OC6A 2F5CA 5FFXA 1OKRA 1I6HJ 4H4KC 3H0DA 1X3ZB 2ME0A 1S9HA 3QODA 1FYLA 5CVUA 2NS0A 3K69A 2XGDA 5FJ8J 3LQRA 4BGDA 3K4MA 4E7LA 4CXFA 1G2HA 1U9NA 3B73A 2ECCA 2P5VA 1N75A 4LB5A 3A0BC 1Z21A 3GFJA 2EV6A 3CUQA 3JRDA 3MWMA 4A69C 2WTEA 2FSWA 4CSWA 1H88C 2JSPA 3E7LA 2CGPA 2W7NA 2JK3A 2PN6A 2CUFA 2LVSA 2JVGA 2VKHA 2Z3YA 3M4OJ 2EIJH 3ASNH 1P9QC 5BS6A 3BP8A 2KL4A 3D5SC 2H6BA 2VKEA 1MMSA 2ZO4A 4O5VA 5L3EA 5D4RA 2GA1A 2KP6A 4PJLA 3U1DA 3H9GA 1DGWY 2GAUA 2DTRA 1K6OA 4L9JA 1IDYA 1IRZA 4HNUA 3I56I 1UMQA 5D4SA 4KMUX 3OYBA 1K79A 5DCMB 5EEHA 4QIWN 1XGOA 2XAGA 3GTJJ 3FF5A 2WY8Q 4XLEA 3ZMTA 1MDMB 4A12A 3PUBA 1X1DA 3CJRB 1TT5B 5J4VA 2KMUA 2D1HA 4M74A 3GZ6A 2E7XA 2DAOA 3ABMH 2EJRA 3P9KA 3BTJA 2Y69H 1SANA 2HOSA 1SFXA 1R71A 1TNTA 3HSEA 1MSFC 1KGSA 3CQZJ 4A93J 4WCGA 4Y4RA 3G1OA 3EUHC 4FTHA 2HVSA 4X1EA 1X1AA 1HF0A 3EQLF 1BJZA 3CF5F 3ZN0A 3TEDA 4IHXA 4E7SA 1TW2A 1N25A 1RESA 2V1DA 2FF4A 3OL3A 4A3FJ 4NC7A 3RPUA 3N97A 3BR3A 4AYBN 3CO6C 3I4PA 2FQ4A 1V5GA 4PJMA 3PQKA 2Y0SA 1X1CA 3IUOA 3E5XA 2FX0A 3GLXA 4LK0F 4D0PA 1MH3A 3CCRI 5CVJA 4UNOA 2PMUA 3RKQA 2X1EA 1KONA 3LOCA 2JJ7A 4BKXA 1ZTRA 1MJAA 2YR2A 2E7WA 5L3CA 3HKZN 3QYFA 2BW3A 2N8GA 4BE1A 1M1EB 1AOYA 2R92J 3SXYA 2FOWA 5FRMA 2DT5A 3DEUA 4HPQA 1P7JA 3BCAA 1YS6A 3BG5A 4KT5C 2HQAA 5BQTA 5CQEA 2X4HA 5C44J 3F6OA 1GV5A 1J7KA 5IOYA 1XC5A 1AHDP 2NRAC 1BW5A 3HRMA 2E5ZA 3ZR8X 4BL0B 3OYIA 2Y48A 3SEZA 3HHHA 3CDLA 3F6VA 2O8KA 1RC9A 1U3EM 2X9DA 4KA4A 2ZMEB 4G12A 2HI3A 4DJAA 3J81Z 3QPHA 2PMZA 2F4IA 1YE9A 2RQPA 1SD5A 4HA8A 2ZJPF 2X1DA 3GCMA 3FBNB 1TWGJ 3LSKA 5E8GA 4I09A 1XX5A 3ESWB 3IWZA 1LKXA 3S3OA 5LD2C 2FA5A 5FROA 2BOLA 2RGVA 4ASNA 2CSOA 4XIDA 1IJWC 2OAZA 1NHAA 4LG3A 4LOCA 4M72A 1AWCA 1QBJA 1NK2P 5M3MJ 4E7IA 3L09A 5FD6A 4A3KJ 1H9GA 3IRQA 4U0VA 3S2WA 5F27A 1T8IA 3HDDA 5GP9A 3HSFA 4ZTFA 1YW8A 4YIFA 5HLTA 1REPC 1ZLKA 3G1MA 5FLMJ 1D0XA 1OCRH 2LC2A 3S14J 3WTUC 3SFZA 3NQOA 3ZQHA 2F5FA 2CJJA 2JUCA 3JSPA 2Z99A 3GVAA 3H36A 2FE3A 3MFKA 4E4HA 4ESFA 4KN4X 1Z05A 5E3MA 3ZMSA 2ZC2A 5K5QA 4J19A 3T8RA 2YS9A 3CP2A 1S7EA 2MW8A 2UXXA 1YITI 5E3LA 3ERMA 3MZHA 4DYCA 1TWCJ 3HZJA 4L5EA 1H9TA 2STTA 4HQEA 1B72A 5LHIA 1U5TB 1X58A 3Q3SA 2EA2A 4MTEA 3Q0UA 4B4CA 5KHDA 1BBYA 3ERED 2LDUA 1FBQA 1DDNA 4Z2YA 3DBLB 1Z9CA 3OYNA 2D5VA 1FIPA 3JRGA 1E17A 3FK7A 1BI3A 4OINF 4MGRA 1ZHFA 1V54H 1IN8A 2DA7A 3WGIA 1SMTA 4AVPA 4RB3C 1SD6A 2GOMA 2PJRA 1DP3A 3FWEA 4HLYA 2VC0A 2E2HJ 5H6RA 2VJJA 3QPSA 3O8HA 2XGXA 2L9RA 2WV0A 2ZFUA 3DEWA 1R7JA 3TP3A 3HRTA 3I0TA 2ACJA 5GAGJ 1W1WE 1R5GA 4XLFA 5D5UB 2BZTA 3JRBA 2K86A 1ERDA 2ZJQF 1QZZA 5FO5A 4YFXF 4ZDLA 5GTIC 5CQGA 2OTLI 3HBLA 1TBXA 1YQAA 2XAFA 3DKYA 4DBQA 4AC0A 3PO3J 3EUKL 4KIBA 1GLNA 1IRXA 3P9IA 2DODA 4A3GJ 1B8IA 2OA4A 3I64A 2VKVA 2MD0A 2GOXB 4JQFA 4RA2A 1RNLA 2HOAA 4LLLA 4I02A 3U9GA 5E1WA 4CYCA 4E7HA 1A36A 3D0SA 1W7PB 2ID6A 2KJBA 2LY1A 2AXTC 3ZQ7A 2QF7A 3MD2A 2IA0A 4YIIA 2HYFA 4C3JJ 2LLKA 3G1LA 5BOXA 1U8RA 1HKTA 2HXIA 3DPLC 1SVLA 3AFHA 1JGSA 4Q48A 3VYRB 2UWMA 2R7TA 1XB4A 4N9IA 3OYGA 5M5WJ 2VIXA 1AU7A 2NOJB 1Z77A 2G7HA 2L7KA 3TL4X 2JRMA 2QLZA 3BPVA 3HTUA 3NARA 2WA0A 4UVCA 1BM9A 5DM7F 1W36C 3OYDA 3MZ8A 1TQPA 4E6KG 2JPBA 1UHSA 1XGMA 1UHWA 1ZK8A 3KEYA 4BJTA 5IP9J 3VSKA 4ZYGA 1QZYA 3BJOA 1KZHA 1FT9A 1D8KA 1TP4A 2DYSH 1LPQA 4G7HF 3KP5A 3PSFA 4C3IJ 4CA0A 2XIGA 3PQJA 4U88A 2XB0X 4DOZA 4XSZF 2ESNA 3COAC 3OIPA 4HX4A 4PGGA 3A2KA 1ZN2A 2B9SA 4RAFA 2KIQA 1HSJA 1MJ9A 2O03A 1MBEA 4BUPA 1LEAA 2C6YA 2K7LA 1I3QJ 2LF8A 4CZCA 1NTCA 4NQWB 2EB7A 5DM6F 2K85A 3E5QA 2E2JJ 4BDZA 4OMYA 1HDDC 3ZMUA 5J1RA 4XN3A 4HX7A 1ONVA 2F5VA 1BIBA 4BY1J 3CCMI 2P0WA 4UUSA 1ZAOA 5E17F 3H3VK 1YS7A 3FBIB 4YEJA 4A3JJ 3CJQB 1SD7A 2JA7J 4CCOA 2M4GA 1B8IB 4P5OA 5LGNA 1O7LA 2IS1A 2BVMA 2W82A 1FC3A 2IA2A 3H5AA 9ANTA 2OCEA 1JKPC 3JAMZ 2YUSA 4BE0A 2DCEA 4CDGA 2CQXA 2K4JA 3GWZA 3M1CA 3S2HJ 4DYRA 4MHGA 2O3FA 1T0FA 3M8FA 1MSEC 1VF9A 1YRNB 1PVEA 1P7IA 1VTNC 5GAEJ 4IHVA 4XKBA 2E35A 4KDPA 4BXXJ 4LB6B 1IZ1A 2MBFA 4EGZA 2K4BA 1UB9A 3PNTA 3C2HA 3SZGA 4CHUA 2EIMH 5FKOA 2ISZA 3FMRA 3V42A 2VOOA 1FTZA 2LREA 3IWFA 5C4JJ 1YX3A 3ZQFA 3K4CA 5DTDA 1ZR4A 2BVLA 3ZCOA 2D2WA 2XC7A 1FOKA 2W1OA 1A6IA 4EJVA 2VBWA 3J7ZI 2HNHA 1ETWA 3ZN1A 4BQOA 5F1JA 3KP6A 3GEZA 3KETA 3DTKA 1RR8C 4LITA 4HF1A 2STWA 3H9QA 2GXAA 4ZYDA 2LBFB 3HRSA 4AWXB 1SD4A 3VYSB 5ED4A 3PJRA 1USSA 4A0XA 1OMIA 1MIJA 2QEXI 4BQQA 4UVBA 4D9JA 1LDDA 2Y75A 1G8XA 1UCRA 2QQ9A 4NB5A 1WPKA 2OQGA 4ZYEA 5EGOA 2M4KA 4P96A 4BJ5C 1ZKGA 5J8FA 2LD5A 1G59A 2VUMJ 2H8RA 1LE8B 1G4DA 1J9IA 3RIRA 5JHFA 1KYWA 2F48A 2V9VA 3BPXA 3WTZA 1MGTA 3QQAA 2QZ8A 4OAZA 4GYIA 4A5NA 2DMQA 4CO8A 5IY5H 2D1VA 2XF6A 1JT0A 3TBIA 3J7AO 1VQNI 1FMWA 1W4MA 3K70D 2J5OA 3DXJF 2E2IJ 2BW3B 1KU2A 2GLOA 3S2DJ 2EZIA 3DF8A 3JRHA 1BOBA 4HF0A 1MBJA 4EMSA 1Z91A 2MD5A 3KCCA 3BQYA 3BR0A 3CCJI 1H0MA 3HOWJ 5FFZA 4Y15A 4EEFG 2HYGD 2Y9YA 1DPRA 3RCOA 3OYMA 4A3BJ 2FUG2 2TRTA 3JREA 3BLYA 1BL0A 2IGKA 2MGQA 2PX9A 3T1BA 3ISPA 4M3FA 2R7ZJ 1WJFA 1T0FC 1R1TA 1YJ9I 1S5LC 5GPAA 4NDLA 2BY2A 2M0CA 3I54A 1DGRM 5F1RA 2IS2A 2BE5F 4CCNA 5CKTA 2ESHA 2OV7A 3OR1C 2YPRA 2RVCA 3AG4H 3W6JB 2DFEA 4LK1F 1TZLA 1XD7A 2ZKZA 4YFNF 4EJOA 3S16J 2UXNA 5FLXZ 4IEJA 3R0JA 2JA6J 5CLSA 4W97A 3D5RC 1T6SA 2IW5A 1VI0A 2VPLA 1SFEA 1S7AA 3EDPA 2CH0A 3L2VA 5EGOB 1W5SA 3GTPJ 2X85A 1WKMA 5HS8A 4XNFA 5HODA 3G2BA 1J5YA 1B9NA 3FK6A 1QGPA 2VJIA 3BT9A 3FXKA 3H3UA 3A1YA 1P4WA 3OYCA 4ZDOA 4O6JA 3KP4A 2BYVE 2NXNB 4QTRA 1QNTA 2O5RA 1LDKB 4MEYF 1I1GA 4PDKA 1K78B 4Z6YA 1Z7LA 5HLGA 1ETQA 4XKVA 4RDUA 3RYPA 2R7XA 1S6LA 2K40A 4N4OB 4C3HJ 1G3SA 4RM3A 3UKGA 3DV8A 1USTA 3OR2C 4RM2A 3VFZA 1FBSA 1KU9A 4HX8A 4CUGA 4CCJA 4D7NA 2Q0OA 3AKZA 1FY7A 1G3TA 1W36D 5HS9A 3OOPA 5JR3A 3CC2I 4L5IA 4Q4ZF 3K4NA 5DD4A 3H1CA 3JSOA 2PQ8A 1ETXA 3S1NJ 1RZ4A 1JKOC 1ZG5A 2B7EA 2M1BA 1IO2A 1TTYA 2AO9A 1HDPA 1GV2A 3I4MJ 1MZBA 4MFDA 2EILH 2L4AA 4D7MA 3MKZA 2P5LC 3T8TA 1BW6A 5CVIA 3O2PE 3K2AA 3HKZA 4FE7A 4UB8C 5B66C 1GVDA 5ICGA 3HPHA 4HRIA 5DDGA 1FNNA 3GUDA 4EVIA 2XF5A 2PBIA 3V8LA 3HPGA 3VYUB 1HXDA 5HOOA 1T33A 3FXOA 4CCMA 5DD8A 1YI2I 3IL2A 2QQBA 5IP6A 1J59A 2L9NA 2H6CA 1BI1A 2E71A 2HS5A 2DQLA 4OIRF 3DU5A 4M9SA 3ZP5A 2MG4A 2DK8A 1K6YA 3DEEA 3F22A 1RPWA 1T08B 2XPWA 4EV0A 1R1VA 2HOEA 4MEXF 5L3BA 1ZH5A 2K9MA 3UR3C 1ON1A 3S93A 3WU0A 4NQWA 1T98A 2LK2A 4XMYA 1W0UA 4A3CJ 5D6FA 5D8LB 4D5FA 4FCYA 2HZTA 1E2XA 3EPZA 2XAQA 5F0HA 3GTQJ 3CP8A 2FBKA 2I10A 2LRDA 4G9YA 5DCMA 4QLCU 1XSDA 2IVMA 3HOTA 2VLAA 6PAXA 4OMZA 3OYAA 3F0CA 5EDNA 2K02A 1LJ9A 2QKLB 1IUFA 2FBIA 4RGSA 4Q47A 1FP1D 3AAFA 5J8CA 3NAUA 3JRCA 2MLKA 3K4JA 2XGEA 3OS2A 2JA2A 2OCCH 3VYTB 2KHMA 3SQNA 4ETSA 3RDIA 4KT6A 1LDJA 2FEZA 3R60A 5M5XJ 5E3NA 1R5HA 5DYMA 5BNGA 4B43A 2OTJI 4R79A 1OYIA 2V6EA 3SZTA 2M34A 2J5PA 4IO9F 3KFWX 2ZXJA 2RC4A 2EINH 1OFCX 1W7PD 3LSMA 1K78A 1BC8C 1G3YA 4EM2A 2KJCA 4F91B 5H6QA 5H2FC 3TO6A 4A0ZA 1U8BA 1TQMA 2CWEA 3QU6A 2IT0A 5J3LA 4F52A 5JLWA 1WZ2A 3BY6A 4XRMA 2CO5A 2CW0F 3Q0VA 1TNSA 2G7UA 3PM1A 3WE3A 2RNJA 2V79A 3I59A 1IF1A 3FHZA 3W3CA 1I39A 4BH9A 2QSGX 1YYVA 2FBHA 1VQ6I 2WC2A 4BXFA 1GHCA 3HOZJ 4PCQA 4UXNA 4BDYA 1R4MB 1Z3XA 5KAFC 2GIVA 4HLXA 3DBHB 4QWQA 3OL4A 5B3SH 2O0YA 4BEHA 1EH8A 3PNYA 1Z0XA 3L9FA 4N4NB 3BZ6A 2BBYA 3BQZA 3KLOA 1XMAA 2DOFA 4RLQA 3BJ6A 1ZGAA 4M9ZA 3EUHA 3CCEI 5BPDA 3SDGA 2VBYA 5HLHA 4GO1A 4K2EA 5GPCA 3CDHA 2JPCA 3C7JA 1D8JA 2VE8A 4ZH4F 5HNHA 1H8AC 2RNGA 3F8CA 1S7OA 4AIKA 3V8KA 1MNDA 3QP5A 1QRYA 2ZXIA 4IKFA 1FOWA 3QOEA 4FISA 4XOPA 4XSXF 1PYVA 3IRRA 1B6AA 4DIQA 4HOBA 2R7FA 4DZJA 2NS7A 2QBYA 1ZRCA 2AXLA 2EH3A 2E36A 1XSVA 1Y39A 2KDZA 1WQ2A 4B3XA 1JUSA 1OJLA 2QVOA 4F7ZA 4ZZDA 2A05A 5J6XA 1I6XA 1D3YA 2MH2A 2V6CA 1D5YA 5JVGF 4DGWB 4I99C 2M2EA 2DOEA 4I0BA 4L9NA 2HWVA 1U78A 1GUUA 1WJEA 5DUKA 4BACA 4XORA 2LSOA 5H20A 3LQQA 4A6EA 4RBOA 2R5YA 3W2AA 3LNQA 1OCOH 1VQ9I 1Y8QB 2RREA 2FNAA 2ZBKA 1QVTA 1WH5A 3IC7A 2DPUA 1F4KA 4DQ2A 3EETA 5HLIA 4L9VA 1CF7B 5KNLA 3VODA 5EG0B 1RUNA 1K4TA 2OF7A 3U21A 3A01B 4EATA 3BZCA 1R5ID 2VT2A 2A68F 2BEOA 2PMHA 3CC4I 3KPHA 3JRFA 1V3FA 5A2QK 2GWRA 1DU0A 3DTEA 4PFPA 2COBA 2JT1A 1E3PA 2ZFWA 2V7FA 3FXLA 4AUXA 1WJ5A 2DA5A 5IT9Z 2CU7A 3ZQQA 1LNWA 2G0EA 2XB5A 4M71A 4RGUA 4XLCA 3G4SI 2HOTA 1Z67A 1BR4A 1VNDA 3LL7A 2V9KA 1TLHB 3VB2A 4XONA 2AHQA 3SHFA 3WTXC 2R7QA 4E70A 3N05A 4I2OA 3DP7A 1C0WA 3RYRA 1OYWA 4P55A 2IXSA 2QQAA 3F8FA 4BQAA 2QBYB 4CZZA 2QKMB 2CW8A 3CO7C 3L2WA 2X6YA 2R7SA 1HC8A 2B0LA 1U6GA 4NUBA 2GXBA 2K9LA 4B09A 3GXOA 3KYCB 1XCBA 3DLAA 2IBDA 4BAYA 4XLPF 4KUMA 1MNEA 1ETKA 5EYRA 5JLXA 2NAZA 3BTIA 1XMXA 3TW6A 3WHCA 1OCCH 4EJUA 1VQPI 1JUPA 1R36A 4FHTA 2G9WA 2XPVA 2JSCA 3CD6I 2RKHA 2CS3A 1EF4A 3Q0WA 2L9SA 5ICEA 3FKIJ 1LVAA 1Y56A 2LH9A 4Y13A 4E7ZA 3CZ6A 3F3XA 3CMAI 2LMDA 5JHUA 1BOAA 3K9TA 3E6CC 1X2MA 3MKYB 2BGCA 5CPRB 3Q5FA 1SFUA 4M3EA 2DDBA 2HR3A 2DTZA 2CQQA 1OR7A 2JVHA 2BHYA 1YW9A 1ZQ3P 3C18A 1WCMJ 1LB2A 2NVQJ 4Y17A 4IRIA 1IXSB 2PI0A 4UUSB 1I1SA 4QPOA 1MBGA 4Y3OA 3HOXJ 4PFOA 3AL0C 2EA4A 3GFIA 3UNGC 2H27A 3GTLJ 2M5WA 3DPTA 4L9TA 1ETOA 5LHGA 1RETA 2DA2A 3M8JA 4X6AJ 2XV4S 3I71A 3G71I 2V1XA 2KLOA 3ECHA 1E0EA 2E19A 3F9KA 1HW1A 4RB0A 1I3AA 4CCKA 3KZIC 2MFZA 2VONA 1D1CA 1W5TA 2Y2ZA 4XR6A 5C3EJ 3QRFF 2FD5A 3BROA 1UFMA 2WWYA 2XAHA 5K7FA 5ILUA 3IKTA 3RI4A 4F55A 3F8BA 3C2BA 3FXJA 3BG3A 1KQ9A 4B3AA 2KIFA 5L3DA 2EV0A 3H5RA 1ULYA 3DQVC 5KCMA 2GIZA 4ZDPA 5B1BH 3OS0A 4MO7A 4A3MJ 3O8GA 2XDVA 3QWLA 4OAYA 1RI7A 2BHZA 3V8JA 4EJWA 3K4KA 4Q5SF 1XDUA 4XOTA 3VPRA 4XRSA 1YG2A 2QGUA 3WG9A 1WJCA 5M3FJ 4J00A 4IL6C 3BG6A 4BHBA 2ZJRF 1IAWA 5IYDJ 3JRIA 1Z7UA 4GXOA 3K10A 3MAJA 4UUVA 3RQIA 1BI2A 2R4GA 1TWHJ 1OCTC 4HV5A 1FIAA 4V2GA 2UV1A 3JR9A 3O6BB 3E0JB 5LGTA 5J40A 1H89C 1MJBA 1SMYF 1IGNA 2EBIA 3BTCA 3E3VA 1AKHB 5EF6A 2FMLA 2VI6A 2GXGA 4AU7A 1S8NA 2R5ZA 2JRTA 3LMMA 1RUOA 1A35A 4II3A 4UVAA 1WRJA 4ZYHA 1ZGJA 3HEFA 3LWFA 4IHSA 3CCLI 1O4XA 2EWNA 3BR6A 3DPUA 1VQ8I 2NYXA 1R49A 2COMA 2ZB9A 4GGGA 4II2A 3TP0A 2VASA 5DS9A 2W4SA 1VQMI 4XN0A 2MYSA 2HPIA 1QZEA 4LG0A 2Z33A 3ZXSA 5LEKA 1FTTA 3H0GJ 2A07F 4U0YA 5LRSA 2VXDA 3MN2A 2CYYA 5D5WB 2QYOA 4FX0A 3GMEA 2TCTA 3TKYA 4A2UA 2X48A 3TMOA 4HV6A 2CV0A 1ZARA 3QOPA 3R4KA 1B72B 1PDNC 1BR2A 1RKTA 2A5YB 3HC7A 3NEUA 2F2EA 3I59B 1R22A 1IRFA 2HGCA 2KQRA 3FX3A 2DMPA 3PSIA 4AD9A 4HNTA 4C9YA 4KITB 3VSLA 1HKQA 2E60A 4KJZA 3PFYA 4ENKA 3OYJA 1SVMA 1YJWI 2M8EA 2XAJA 3BDDA 2CQ7A 3I53A 1XDSA 2GZWA 2VE9A 2AS5F 5KK1A 1FMVA 2LY9A 3WU1B 2IGMA 3FZVA 4YFKF 3H92A 3WTSC 1Y1WJ 1ZG1A 3AL0B 1QHGA 2KRHA 1UG0A 4G6TB 3JCUC 4JP0A 1YJNI 4RB2C 1K61A 1XN7A 2ELKA 1QA6A 2O61A 2CRGA 3V7RA 5J47A 4XKWA 3I55I 4M3BA 2HKXA 4GRIA 3DKXA 5FB2A 3PFIA 3TO7A 2R7VA 4HW0A 3KP7A 3K70C 3OSGA 1NG6A 3BOQA 2X6OA 3ZMDA 4CGZA 1XGNA 5LLQA 1HW2A 1T38A 2P6SA 2ZCWA 1WJAA 2A6HF 3HXLA 5GTHC 3RJPA 3R0AA 2JMWA 1L3LA 1MH4A 2VBZA 2Q8KA 4RB1A 2DJIA 3BTLA 3PNVA 3OYKA 2WBMA 1QU3A 1YRNA 1XMKA 1UZCA 3HUGB 2VL8A 3AG3H 1OPCA 1X19A 1SC7A 4F92B 5IT9K 2QCOA 1VZ0A 1B1BA 1J2XA 1JHFA 2VPRA 1LFPA 1V4RA 3R6SA 1AKHA 4MQVA 3WTVC 4KYWA 3CCVI 1VQ4I 3EYIA 1NH3A 3OOUA 1O3QA 4MFEA 3VEPA 1TWFJ 1Z6TA 4HYEA 2F6CA 5D8KB 1IN4A 2Z2SB 1WFXA 4M73A 2VOPA 3OIQA 1ITYA 1P4AA 1QVUA 3HHGA 1FLIA 3K1NA 5FRNA 2L0KA 2L3DA 3MKLA 1MMGA 3CCYA 3LSGA 2R7DA 3ECOA 3KLNA 4ESBA 2ZSHB 1P2FA 3SFIA 5ILSA 3LSJA 3OYFA 4BE2A 1JJ6C 1MMAA 4IRGA 5DUIA 5ILVA 3C2GA 2HDCA 3HB9A 2CV2A 3LA2A 3H5NA 3IHUA 3G73A 4OU0A 3NRVA 1FOXA 3E6BA 2L7MP 1IXCA 3CMEI 4ENNA 4L0ZB 4ANJA 1YO5C 5IOZA 1R9TJ 4XRSG 1NG7A 4EM0B 3I4NJ 5FLXK 1Y8RB 2EFNA 1T39A 3S1MJ 4ZYAA 1ORKA 2CQKA 2Z1DA 3Q9VA 3QU3A 4R1HA 3BR5A 4CYDA 3KYDB 1L0OC 1TC3C 2OD5A
chains in the Genus database with same CATH topology
4KIGA 2F5EA 4OIPF 4BYYA 2VBXA 4EJTA 2IJLA 3FMQA 1I27A 1FSEA 2QM3A 3TDUC 1ZREA 1FP2A 4UV8A 2QUFA 4WF2A 4RAZA 4H0EA 2A3SA 1R58A 2OZUA 1XCVA 1MDMA 2K27A 1KU3A 1W7PA 3GFMA 3B02A 2CFXA 2FMYA 2EFPA 2ETHA 2HQNA 5KVRA 5D5VB 4P9UA 4LJZF 4MTDA 4OIOF 2DBBA 5LRRA 3BWGA 2MH9A 3HSRA 4EM1A 3E6DA 1PP8F 4KMFA 1JE8A 2HKOA 4B8XA 2XRNA 1GXPA 1Y0UA 2DW4A 3FXRA 2EK5A 2H94A 1OYYA 3KE2A 1P6RA 1BIAA 2A61A 4LLNA 3TO9A 1IUYA 1A04A 3J81K 3BJAA 1XGSA 4G94A 4WXHA 4ESJA 5JFRA 2L4MA 1YFHA 3E5UA 1T2KA 2YX7A 1U5TA 4HDUA 2CG4A 3TQNA 3V7CA 3T5XA 2ZNYA 4S05A 1IN7A 1Q1HA 4WXDA 2JZYA 4R8HA 4GCVA 4XRFA 3RKXA 3ZMZA 3W6KB 1O3RA 1K7AA 3MCZA 2QWWA 3ROUA 4LMYA 3J80Z 1TW3A 3E97A 5FGMA 2DO7A 2X0LA 5AIQA 3M9AA 3Q9SA 1G6NA 3F8NA 3GW2A 1ZRDA 5L3GA 3EYYA 3GX4X 2DI3A 2Z5UA 3ELKA 1HQCA 1B4AA 1FBUA 1IW7F 3GZ5A 3O3KA 2RDPA 2W57A 3ZMVA 3TGNA 4BHCA 2DFIA 4HAMA 3I5UA 5TJJA 1HKSA 4CICA 2HTJA 1S3JA 3LAPA 5ERIA 4G7ZF 1QPMA 4UV9A 1O3TA 1LQ1A 1P4XA 3LSTA 4JBAA 2XUBA 1YW7A 3HOSA 3KP3A 2KKOA 1JHHA 1O7FA 3IKVA 2XVCA 4FX4A 1CGPA 3LA3A 4IRHA 4BXUA 4IHTA 3CUQC 1ZYRF 3JTGA 4YG2F 4KN7X 3E6MA 4XLNF 5CYVA 1ZLJA 1IN6A 3GYHX 1FYKA 1IRGA 4HQMA 3ULQB 5E18F 3ML6A 2EFWA 1U2WA 4IXAA 3RKWA 2P4WA 1ODDA 1YIOA 2F5DA 4G8XA 2OBPA 2ZNZA 4MNUA 3WGGA 3JTHA 4LGWA 2FRHA 3KEQA 1ZRFA 1PP7U 2PEXA 2M45A 3FXUA 3KZYA 3L7WA 2ZMEA 3H3ZA 4LD5A 3FMSA 4L0YB 2V1UA 1WWXA 3M1EA 1ZG3A 5BPIA 4O3MA 1D5VA 3RPQA 4AIJA 4N9HA 5E20A 3RKYA 1Z1DA 1XSXA 4WX9A 2NNYA 3LA7A 2L54A 2DU9A 3CLOA 3FXQA 2Y0MA 3CJNA 4G7OF 3R61A 3VOEA 5D5XB 2IRFG 1I5ZA 1TQIA 5JVTA 3HIFA 4XBFA 4WWCA 4OOIA 2XKOA 2A6EF 3LFKA 2ISYA 4L18B 1YTYA 2DLLA 4M9XA 1BJAA 2HTSA 2IPQX 2BV6A 3P7NA 2LNBA 2Z9OA 3HUGA 3HRUA 4G6QA 4U7BA 4RAYA 4KFCA 2PG4A 1KYZA 4OIQF 2P8TA 1EH6A 5L3FA 4A6DA 3KEOA 1MKMA 3WE2A 4RGRA 5HDGA 4L5JA 2M87A 4HBLA 4IJAA 2OU2A 3RTRA 4KIFA 4M6XA 1G3WA 3C1DA 1UHMA 1IXRC 5ICFA 4M6YA 2FOKA 2EFQA 2HFHA 4N0BA 3L2CA 1J0RA 2L02A 3MQ0A 5HDKA 2GA2A 3FM3A 2FNPA 4GYGA 2LF7A 4JK1X 3DFGA 2Q2EA 3K0LA 4P9FA 1O57A 3WTYC 4LG0B 4A5MA 3WODF 3C3WA 3F72A 2FU4A 4ENMA 2IA1A 1KQ0A 1WSUA 3HTSB 4KNYA 1BC7C 5LBQA 1DPUA 2PFBA 3M7GA 4WXCA 1STZA 4DNCA 5LHHA 1IN5A 2YSRA 2UZKA 2IP2A 1HSTA 1KA8A 1QO0D 3TOAA 2XKPA 1FPQA 1YLFA 3ABUA 3F8MA 2ADUA 3TOBA 3FM5A 1RIOH 3V4GA 4I98B 1J75A 5CVRA 5A2QZ 2NNNA 3CTAA 1KU7A 1O3SA 5F64A 2KIMA 5F6FA 4NHJA 2MC3A 1KQ8A 4BHPA 5DCFA 1R00A 3OV8A 4LFUA 2LKPA 2RV8A 2VT3A 2DK5A 3WTWC 4IF4A 4MQ9F 5K5RA 1EV7A 2QENA 2O6GE 3QAHA 2HEOA 2P7CB 3CUQB 5AIPA 4I7HA 4AIHA 1HW5A 1JXSA 5ICCA 5AONA 2EFOA 5K5OA 2FXAA 2P6TA 4WK8F 2D45A 3QP6A 3N4MA 1FSHA 1WI9A 3JAMK 4G6DA 4S04A 3L00A 2VODA 3P9CA 2PJPA 2JTVA 3U2RA 4ON0A 1S29A 1FZPB 2O8XA 1LEBA 3WGHA 2XASA 1EH7A 2ZJ2A 2P7VB 3TDZC 4RS8A 1SAXA 3CUOA 5FD5A 3KP2A 3D5LA 2DQRA 5TRDA 4EGYA 2VXZA 3WTTC 2VC1A 5EEGA 3KZZA 5E8IA 3F23A 2OQRA 4ZZLA 4HDVA 5HS7A 3HYIA 4IVNA 5LGUA 2E1CA 2RN7A 3JW4A 4PGHA 1GXQA 1FYMA 5E1ZB 2PLYA 2W85A 3K1MA 2A69F 3K1PA 1B9MA 3LAJA 1QQIA 3MEXA 5E1XA 2MA3A 3QPTA 2YX4A 2YU3A 3GFLA 2W24A 4FT8A 1HBXG 3GF2A 1F5TA 5HDNA 3GO5A 2E1NA 2P5KA 3V7SA 3G3ZA 1FX7A 1P92A 1GVJA 3ZPLA 1Z6RA 4U7DA 4PZJA 3DKWA 4EQQA 1R23A 5JI6A 2KIUA 4LLGF 1F1ZA 1MD0A 1CF7A 3M8EA 2R3SA 2EV5A 1DP7P 2ELHA 2HQRA 3ABTA 4I01A 4HZFA 2H09A 2VN2A 4RGXA 3REOA 5D6EA 2FQ3A 1PUEE 2DPDA 4IPAA 2KRFA 2W84A 2M30A 1BN5A 3J80K 1B59A 1X3UA 1U5TC 5CJ9A 2L01A 1F9NA 1R1UA 4U0WA 5IT3A 1DUXC 2TDXA 1FWZA 4BNCA 3K2ZA 4UHTA 5CVVA 2MLGA 2W25A 4ENJA 5LEJA 5DV5A 2GQQA 3SZPA 2OZ6A 1BI0A 4I0AA 5BMZA 5DEQA 4TV7A 2XHKA 5HVQC 3T0YA 2XROA 1ON2A 4KICA 3F21A 3I58A 5K1YA 3MZYA 4HF2A 4A0YA 2F5CA 5FFXA 1OKRA 1FYLA 5CVUA 2NS0A 3K69A 3LQRA 4CXFA 3B73A 2P5VA 4LB5A 3GFJA 2EV6A 3CUQA 3MWMA 2WTEA 2FSWA 2CGPA 2PN6A 2Z3YA 5BS6A 3BP8A 2H6BA 2ZO4A 4O5VA 5L3EA 5D4RA 2GA1A 3U1DA 2GAUA 2DTRA 1K6OA 4L9JA 5D4SA 4KMUX 1K79A 5DCMB 5EEHA 1XGOA 2XAGA 3FF5A 3ZMTA 1MDMB 4A12A 2D1HA 4M74A 3GZ6A 2E7XA 2DAOA 2EJRA 3P9KA 1SFXA 1TNTA 3HSEA 1KGSA 4WCGA 3EQLF 3ZN0A 1TW2A 2V1DA 2FF4A 3RPUA 3N97A 3CO6C 3I4PA 3PQKA 3E5XA 3GLXA 4LK0F 4D0PA 5CVJA 4UNOA 2PMUA 1MJAA 2YR2A 2E7WA 5L3CA 1AOYA 3SXYA 2DT5A 3DEUA 1YS6A 4KT5C 5BQTA 2X4HA 3F6OA 1J7KA 2NRAC 3HRMA 2Y48A 3HHHA 3F6VA 1U3EM 4KA4A 2ZMEB 3J81Z 3QPHA 2RQPA 1SD5A 4HA8A 5E8GA 4I09A 3IWZA 2FA5A 2RGVA 4ASNA 2CSOA 2OAZA 1NHAA 4M72A 1AWCA 1QBJA 3L09A 5FD6A 1H9GA 3IRQA 4U0VA 3S2WA 3HSFA 1YW8A 4YIFA 1REPC 1ZLKA 3WTUC 3SFZA 3NQOA 2F5FA 3JSPA 2Z99A 3GVAA 2FE3A 3MFKA 4ESFA 4KN4X 1Z05A 3ZMSA 5K5QA 3T8RA 2UXXA 3MZHA 2STTA 1H9TA 4HQEA 5LHIA 1U5TB 4MTEA 2EA2A 1BBYA 3ERED 2LDUA 1FBQA 1DDNA 4Z2YA 1Z9CA 1E17A 1BI3A 4OINF 4MGRA 1ZHFA 1IN8A 3WGIA 1SMTA 4AVPA 4RB3C 1SD6A 3FWEA 4HLYA 2VC0A 5H6RA 2XGXA 2WV0A 1R7JA 3HRTA 3I0TA 2ACJA 5D5UB 1R5GA 2K86A 1QZZA 5FO5A 4YFXF 1TBXA 1YQAA 2XAFA 4KIBA 3P9IA 2OA4A 3I64A 4JQFA 1RNLA 4LLLA 4I02A 3U9GA 5E1WA 3D0SA 1W7PB 2KJBA 3ZQ7A 2IA0A 4YIIA 2HYFA 5BOXA 1U8RA 1HKTA 3DPLC 1JGSA 4Q48A 2UWMA 1XB4A 4N9IA 2G7HA 2QLZA 3BPVA 3HTUA 4UVCA 1BM9A 1TQPA 2JPBA 1XGMA 1UHWA 4ZYGA 1QZYA 3BJOA 1FT9A 1D8KA 4G7HF 3KP5A 2XIGA 3PQJA 4U88A 4XSZF 2ESNA 3COAC 4HX4A 4PGGA 1ZN2A 1HSJA 1MJ9A 2O03A 1LEAA 2C6YA 2K7LA 2LF8A 2EB7A 3E5QA 4OMYA 3ZMUA 4HX7A 1ONVA 1BIBA 1ZAOA 5E17F 1YS7A 1SD7A 4P5OA 5LGNA 1O7LA 1FC3A 2IA2A 3JAMZ 4CDGA 2K4JA 3GWZA 4MHGA 2O3FA 1T0FA 3M8FA 1VTNC 4KDPA 4LB6B 1IZ1A 2MBFA 4EGZA 2K4BA 1UB9A 4CHUA 2ISZA 3FMRA 2VOOA 3IWFA 2D2WA 1FOKA 4EJVA 2VBWA 3ZN1A 3KP6A 3GEZA 3KETA 4HF1A 2STWA 4ZYDA 3HRSA 4AWXB 1SD4A 5ED4A 1USSA 4A0XA 1OMIA 4UVBA 1LDDA 2Y75A 1UCRA 2QQ9A 4NB5A 2OQGA 4ZYEA 4P96A 5J8FA 1G4DA 1J9IA 3RIRA 1KYWA 2V9VA 3BPXA 3WTZA 1MGTA 2QZ8A 4GYIA 4A5NA 4CO8A 2D1VA 3J7AO 1W4MA 2J5OA 3DXJF 1KU2A 3DF8A 4HF0A 4EMSA 1Z91A 2MD5A 3KCCA 1H0MA 5FFZA 4Y15A 2HYGD 1DPRA 3T1BA 3ISPA 1R1TA 3I54A 5F1RA 2BE5F 2ESHA 2YPRA 2RVCA 3W6JB 4LK1F 1XD7A 2ZKZA 4YFNF 4EJOA 2UXNA 5FLXZ 3R0JA 5CLSA 1T6SA 2IW5A 1SFEA 1S7AA 3EDPA 1W5SA 1WKMA 5HS8A 1J5YA 1B9NA 1QGPA 3H3UA 1P4WA 4O6JA 3KP4A 2BYVE 1QNTA 1LDKB 4MEYF 1I1GA 4PDKA 1K78B 5HLGA 3RYPA 1S6LA 1G3SA 3DV8A 1USTA 3VFZA 1FBSA 1KU9A 4HX8A 2Q0OA 1FY7A 1G3TA 5HS9A 3OOPA 5JR3A 4L5IA 4Q4ZF 5DD4A 3JSOA 2PQ8A 1RZ4A 1ZG5A 2M1BA 1TTYA 1MZBA 2L4AA 2P5LC 3T8TA 5CVIA 3O2PE 5ICGA 5DDGA 1FNNA 3GUDA 4EVIA 2PBIA 3V8LA 1HXDA 5HOOA 5DD8A 3IL2A 2QQBA 1J59A 2H6CA 1BI1A 2HS5A 2DQLA 4OIRF 4M9SA 3ZP5A 2DK8A 3F22A 4EV0A 1R1VA 2HOEA 4MEXF 5L3BA 1ZH5A 1ON1A 3WU0A 4NQWA 1T98A 5D6FA 5D8LB 2HZTA 1E2XA 2XAQA 2FBKA 4G9YA 5DCMA 4QLCU 1XSDA 2IVMA 3HOTA 6PAXA 4OMZA 2K02A 1LJ9A 2FBIA 4RGSA 4Q47A 1FP1D 3AAFA 5J8CA 2MLKA 4ETSA 3SQNA 3RDIA 1LDJA 2FEZA 3R60A 1R5HA 5DYMA 4R79A 1OYIA 3SZTA 2J5PA 3KFWX 2ZXJA 2RC4A 1BC8C 1W7PD 1K78A 1G3YA 4EM2A 2KJCA 5H6QA 3TO6A 4A0ZA 1TQMA 2CWEA 3QU6A 2IT0A 3BY6A 2CO5A 2CW0F 1TNSA 2G7UA 3WE3A 2RNJA 2V79A 3I59A 1IF1A 3FHZA 4BH9A 1YYVA 2FBHA 2WC2A 1GHCA 4PCQA 4UXNA 2GIVA 4HLXA 4QWQA 2O0YA 1EH8A 3L9FA 3BZ6A 2BBYA 3KLOA 1XMAA 3BJ6A 1ZGAA 4M9ZA 3EUHA 5BPDA 2VBYA 5HLHA 4GO1A 4K2EA 3CDHA 2JPCA 3C7JA 1D8JA 2VE8A 4ZH4F 3F8CA 1S7OA 4AIKA 3V8KA 3QP5A 4XSXF 3IRRA 1B6AA 4HOBA 2R7FA 2QBYA 1ZRCA 2AXLA 1XSVA 1WQ2A 4F7ZA 2QVOA 4ZZDA 5J6XA 1I6XA 1D3YA 2MH2A 2V6CA 4I0BA 4L9NA 2HWVA 1U78A 5DUKA 2LSOA 5H20A 3LQQA 4A6EA 2FNAA 2ZBKA 3IC7A 2DPUA 1F4KA 4DQ2A 3EETA 5HLIA 4L9VA 1CF7B 3VODA 1RUNA 2VT2A 2A68F 2BEOA 2PMHA 1V3FA 5A2QK 2GWRA 2JT1A 2ZFWA 5IT9Z 1LNWA 4RGUA 4M71A 3VB2A 1TLHB 3SHFA 3WTXC 4E70A 4I2OA 3DP7A 1C0WA 3RYRA 1OYWA 4P55A 2QQAA 3F8FA 4BQAA 2QBYB 4CZZA 3CO7C 2B0LA 1U6GA 2GXBA 4B09A 3GXOA 1XCBA 4BAYA 4XLPF 4KUMA 2NAZA 4EJUA 1R36A 4FHTA 2G9WA 2JSCA 2RKHA 5ICEA 1LVAA 4Y13A 3F3XA 5JHUA 1BOAA 3K9TA 3E6CC 2BGCA 3Q5FA 1SFUA 2HR3A 1OR7A 1YW9A 3C18A 1LB2A 4Y17A 4IRIA 1IXSB 2PI0A 1I1SA 2EA4A 3GFIA 2H27A 2M5WA 3DPTA 4L9TA 5LHGA 2XV4S 3I71A 2V1XA 3ECHA 1HW1A 4RB0A 2VONA 1W5TA 3QRFF 3BROA 1UFMA 2WWYA 2XAHA 5ILUA 3IKTA 3RI4A 3F8BA 1KQ9A 2KIFA 5L3DA 2EV0A 1ULYA 3DQVC 1RI7A 3V8JA 4EJWA 4Q5SF 1XDUA 1YG2A 3WG9A 4BHBA 1IAWA 1Z7UA 4GXOA 3MAJA 4UUVA 1BI2A 4HV5A 3O6BB 5LGTA 1MJBA 1SMYF 3E3VA 2FMLA 2GXGA 1S8NA 2JRTA 1RUOA 4UVAA 1WRJA 4ZYHA 1ZGJA 3LWFA 4IHSA 2EWNA 2NYXA 2COMA 4GGGA 4LG0A 2Z33A 5LEKA 2A07F 4U0YA 5LRSA 2CYYA 5D5WB 2QYOA 4FX0A 3TKYA 4A2UA 4HV6A 1ZARA 3QOPA 3R4KA 1PDNC 2A5YB 3NEUA 2F2EA 3I59B 1R22A 1IRFA 2HGCA 3FX3A 4AD9A 1HKQA 4ENKA 2M8EA 2XAJA 3BDDA 3I53A 1XDSA 2GZWA 2VE9A 2AS5F 5KK1A 3WU1B 3FZVA 4YFKF 3H92A 3WTSC 1ZG1A 4RB2C 1XN7A 2O61A 3V7RA 2HKXA 5FB2A 3PFIA 3TO7A 4HW0A 3KP7A 3BOQA 3ZMDA 4CGZA 1XGNA 5LLQA 1HW2A 1T38A 2P6SA 2ZCWA 2A6HF 3RJPA 3R0AA 1L3LA 2VBZA 2Q8KA 4RB1A 1XMKA 1OPCA 5IT9K 1B1BA 1J2XA 1JHFA 3R6SA 1V4RA 4MQVA 3WTVC 4KYWA 3EYIA 1O3QA 3VEPA 1Z6TA 4HYEA 5D8KB 1IN4A 4M73A 2VOPA 1P4AA 3HHGA 1FLIA 3K1NA 2L3DA 2R7DA 3ECOA 3KLNA 4ESBA 1P2FA 5ILSA 4IRGA 5DUIA 5ILVA 2HDCA 3LA2A 3IHUA 3G73A 4OU0A 3NRVA 3E6BA 4L0ZB 1IXCA 4ENNA 1YO5C 4EM0B 5FLXK 2EFNA 1T39A 2CQKA 3Q9VA 3QU3A 4R1HA 4CYDA 1L0OC 2OD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIG A;  2F5E A;  4OIP F;  4BYY A;  2VBX A;  4EJT A;  2IJL A;  3FMQ A;  1I27 A;  1FSE A;  2QM3 A;  3TDU C;  1ZRE A;  1FP2 A;  4UV8 A;  2QUF A;  4WF2 A;  4RAZ A;  4H0E A;  2A3S A;  1R58 A;  2OZU A;  1XCV A;  1MDM A;  2K27 A;  1KU3 A;  1W7P A;  3GFM A;  3B02 A;  2CFX A;  2FMY A;  2EFP A;  2ETH A;  2HQN A;  5KVR A;  5D5V B;  4P9U A;  4LJZ F;  4MTD A;  4OIO F;  2DBB A;  5LRR A;  3BWG A;  2MH9 A;  3HSR A;  4EM1 A;  3E6D A;  1PP8 F;  4KMF A;  1JE8 A;  2HKO A;  4B8X A;  2XRN A;  1GXP A;  1Y0U A;  2DW4 A;  3FXR A;  2EK5 A;  2H94 A;  1OYY A;  3KE2 A;  1P6R A;  1BIA A;  2A61 A;  4LLN A;  3TO9 A;  1IUY A;  1A04 A;  3J81 K;  3BJA A;  1XGS A;  4G94 A;  4WXH A;  4ESJ A;  5JFR A;  2L4M A;  1YFH A;  3E5U A;  1T2K A;  2YX7 A;  1U5T A;  4HDU A;  2CG4 A;  3TQN A;  3V7C A;  3T5X A;  2ZNY A;  4S05 A;  1IN7 A;  1Q1H A;  4WXD A;  2JZY A;  4R8H A;  4GCV A;  4XRF A;  3RKX A;  3ZMZ A;  3W6K B;  1O3R A;  1K7A A;  3MCZ A;  2QWW A;  3ROU A;  4LMY A;  3J80 Z;  1TW3 A;  3E97 A;  5FGM A;  2DO7 A;  2X0L A;  5AIQ A;  3M9A A;  3Q9S A;  1G6N A;  3F8N A;  3GW2 A;  1ZRD A;  5L3G A;  3EYY A;  3GX4 X;  2DI3 A;  2Z5U A;  3ELK A;  1HQC A;  1B4A A;  1FBU A;  1IW7 F;  3GZ5 A;  3O3K A;  2RDP A;  2W57 A;  3ZMV A;  3TGN A;  4BHC A;  2DFI A;  4HAM A;  3I5U A;  5TJJ A;  1HKS A;  4CIC A;  2HTJ A;  1S3J A;  3LAP A;  5ERI A;  4G7Z F;  1QPM A;  4UV9 A;  1O3T A;  1LQ1 A;  1P4X A;  3LST A;  4JBA A;  2XUB A;  1YW7 A;  3HOS A;  3KP3 A;  2KKO A;  1JHH A;  1O7F A;  3IKV A;  2XVC A;  4FX4 A;  1CGP A;  3LA3 A;  4IRH A;  4BXU A;  4IHT A;  3CUQ C;  1ZYR F;  3JTG A;  4YG2 F;  4KN7 X;  3E6M A;  4XLN F;  5CYV A;  1ZLJ A;  1IN6 A;  3GYH X;  1FYK A;  1IRG A;  4HQM A;  3ULQ B;  5E18 F;  3ML6 A;  2EFW A;  1U2W A;  4IXA A;  3RKW A;  2P4W A;  1ODD A;  1YIO A;  2F5D A;  4G8X A;  2OBP A;  2ZNZ A;  4MNU A;  3WGG A;  3JTH A;  4LGW A;  2FRH A;  3KEQ A;  1ZRF A;  1PP7 U;  2PEX A;  2M45 A;  3FXU A;  3KZY A;  3L7W A;  2ZME A;  3H3Z A;  4LD5 A;  3FMS A;  4L0Y B;  2V1U A;  1WWX A;  3M1E A;  1ZG3 A;  5BPI A;  4O3M A;  1D5V A;  3RPQ A;  4AIJ A;  4N9H A;  5E20 A;  3RKY A;  1Z1D A;  1XSX A;  4WX9 A;  2NNY A;  3LA7 A;  2L54 A;  2DU9 A;  3CLO A;  3FXQ A;  2Y0M A;  3CJN A;  4G7O F;  3R61 A;  3VOE A;  5D5X B;  2IRF G;  1I5Z A;  1TQI A;  5JVT A;  3HIF A;  4XBF A;  4WWC A;  4OOI A;  2XKO A;  2A6E F;  3LFK A;  2ISY A;  4L18 B;  1YTY A;  2DLL A;  4M9X A;  1BJA A;  2HTS A;  2IPQ X;  2BV6 A;  3P7N A;  2LNB A;  2Z9O A;  3HUG A;  3HRU A;  4G6Q A;  4U7B A;  4RAY A;  4KFC A;  2PG4 A;  1KYZ A;  4OIQ F;  2P8T A;  1EH6 A;  5L3F A;  4A6D A;  3KEO A;  1MKM A;  3WE2 A;  4RGR A;  5HDG A;  4L5J A;  2M87 A;  4HBL A;  4IJA A;  2OU2 A;  3RTR A;  4KIF A;  4M6X A;  1G3W A;  3C1D A;  1UHM A;  1IXR C;  5ICF A;  4M6Y A;  2FOK A;  2EFQ A;  2HFH A;  4N0B A;  3L2C A;  1J0R A;  2L02 A;  3MQ0 A;  5HDK A;  2GA2 A;  3FM3 A;  2FNP A;  4GYG A;  2LF7 A;  4JK1 X;  3DFG A;  2Q2E A;  3K0L A;  4P9F A;  1O57 A;  3WTY C;  4LG0 B;  4A5M A;  3WOD F;  3C3W A;  3F72 A;  2FU4 A;  4ENM A;  2IA1 A;  1KQ0 A;  1WSU A;  3HTS B;  4KNY A;  1BC7 C;  5LBQ A;  1DPU A;  2PFB A;  3M7G A;  4WXC A;  1STZ A;  4DNC A;  5LHH A;  1IN5 A;  2YSR A;  2UZK A;  2IP2 A;  1HST A;  1KA8 A;  1QO0 D;  3TOA A;  2XKP A;  1FPQ A;  1YLF A;  3ABU A;  3F8M A;  2ADU A;  3TOB A;  3FM5 A;  1RIO H;  3V4G A;  4I98 B;  1J75 A;  5CVR A;  5A2Q Z;  2NNN A;  3CTA A;  1KU7 A;  1O3S A;  5F64 A;  2KIM A;  5F6F A;  4NHJ A;  2MC3 A;  1KQ8 A;  4BHP A;  5DCF A;  1R00 A;  3OV8 A;  4LFU A;  2LKP A;  2RV8 A;  2VT3 A;  2DK5 A;  3WTW C;  4IF4 A;  4MQ9 F;  5K5R A;  1EV7 A;  2QEN A;  2O6G E;  3QAH A;  2HEO A;  2P7C B;  3CUQ B;  5AIP A;  4I7H A;  4AIH A;  1HW5 A;  1JXS A;  5ICC A;  5AON A;  2EFO A;  5K5O A;  2FXA A;  2P6T A;  4WK8 F;  2D45 A;  3QP6 A;  3N4M A;  1FSH A;  1WI9 A;  3JAM K;  4G6D A;  4S04 A;  3L00 A;  2VOD A;  3P9C A;  2PJP A;  2JTV A;  3U2R A;  4ON0 A;  1S29 A;  1FZP B;  2O8X A;  1LEB A;  3WGH A;  2XAS A;  1EH7 A;  2ZJ2 A;  2P7V B;  3TDZ C;  4RS8 A;  1SAX A;  3CUO A;  5FD5 A;  3KP2 A;  3D5L A;  2DQR A;  5TRD A;  4EGY A;  2VXZ A;  3WTT C;  2VC1 A;  5EEG A;  3KZZ A;  5E8I A;  3F23 A;  2OQR A;  4ZZL A;  4HDV A;  5HS7 A;  3HYI A;  4IVN A;  5LGU A;  2E1C A;  2RN7 A;  3JW4 A;  4PGH A;  1GXQ A;  1FYM A;  5E1Z B;  2PLY A;  2W85 A;  3K1M A;  2A69 F;  3K1P A;  1B9M A;  3LAJ A;  1QQI A;  3MEX A;  5E1X A;  2MA3 A;  3QPT A;  2YX4 A;  2YU3 A;  3GFL A;  2W24 A;  4FT8 A;  1HBX G;  3GF2 A;  1F5T A;  5HDN A;  3GO5 A;  2E1N A;  2P5K A;  3V7S A;  3G3Z A;  1FX7 A;  1P92 A;  1GVJ A;  3ZPL A;  1Z6R A;  4U7D A;  4PZJ A;  3DKW A;  4EQQ A;  1R23 A;  5JI6 A;  2KIU A;  4LLG F;  1F1Z A;  1MD0 A;  1CF7 A;  3M8E A;  2R3S A;  2EV5 A;  1DP7 P;  2ELH A;  2HQR A;  3ABT A;  4I01 A;  4HZF A;  2H09 A;  2VN2 A;  4RGX A;  3REO A;  5D6E A;  2FQ3 A;  1PUE E;  2DPD A;  4IPA A;  2KRF A;  2W84 A;  2M30 A;  1BN5 A;  3J80 K;  1B59 A;  1X3U A;  1U5T C;  5CJ9 A;  2L01 A;  1F9N A;  1R1U A;  4U0W A;  5IT3 A;  1DUX C;  2TDX A;  1FWZ A;  4BNC A;  3K2Z A;  4UHT A;  5CVV A;  2MLG A;  2W25 A;  4ENJ A;  5LEJ A;  5DV5 A;  2GQQ A;  3SZP A;  2OZ6 A;  1BI0 A;  4I0A A;  5BMZ A;  5DEQ A;  4TV7 A;  2XHK A;  5HVQ C;  3T0Y A;  2XRO A;  1ON2 A;  4KIC A;  3F21 A;  3I58 A;  5K1Y A;  3MZY A;  4HF2 A;  4A0Y A;  2F5C A;  5FFX A;  1OKR A;  1FYL A;  5CVU A;  2NS0 A;  3K69 A;  3LQR A;  4CXF A;  3B73 A;  2P5V A;  4LB5 A;  3GFJ A;  2EV6 A;  3CUQ A;  3MWM A;  2WTE A;  2FSW A;  2CGP A;  2PN6 A;  2Z3Y A;  5BS6 A;  3BP8 A;  2H6B A;  2ZO4 A;  4O5V A;  5L3E A;  5D4R A;  2GA1 A;  3U1D A;  2GAU A;  2DTR A;  1K6O A;  4L9J A;  5D4S A;  4KMU X;  1K79 A;  5DCM B;  5EEH A;  1XGO A;  2XAG A;  3FF5 A;  3ZMT A;  1MDM B;  4A12 A;  2D1H A;  4M74 A;  3GZ6 A;  2E7X A;  2DAO A;  2EJR A;  3P9K A;  1SFX A;  1TNT A;  3HSE A;  1KGS A;  4WCG A;  3EQL F;  3ZN0 A;  1TW2 A;  2V1D A;  2FF4 A;  3RPU A;  3N97 A;  3CO6 C;  3I4P A;  3PQK A;  3E5X A;  3GLX A;  4LK0 F;  4D0P A;  5CVJ A;  4UNO A;  2PMU A;  1MJA A;  2YR2 A;  2E7W A;  5L3C A;  1AOY A;  3SXY A;  2DT5 A;  3DEU A;  1YS6 A;  4KT5 C;  5BQT A;  2X4H A;  3F6O A;  1J7K A;  2NRA C;  3HRM A;  2Y48 A;  3HHH A;  3F6V A;  1U3E M;  4KA4 A;  2ZME B;  3J81 Z;  3QPH A;  2RQP A;  1SD5 A;  4HA8 A;  5E8G A;  4I09 A;  3IWZ A;  2FA5 A;  2RGV A;  4ASN A;  2CSO A;  2OAZ A;  1NHA A;  4M72 A;  1AWC A;  1QBJ A;  3L09 A;  5FD6 A;  1H9G A;  3IRQ A;  4U0V A;  3S2W A;  3HSF A;  1YW8 A;  4YIF A;  1REP C;  1ZLK A;  3WTU C;  3SFZ A;  3NQO A;  2F5F A;  3JSP A;  2Z99 A;  3GVA A;  2FE3 A;  3MFK A;  4ESF A;  4KN4 X;  1Z05 A;  3ZMS A;  5K5Q A;  3T8R A;  2UXX A;  3MZH A;  2STT A;  1H9T A;  4HQE A;  5LHI A;  1U5T B;  4MTE A;  2EA2 A;  1BBY A;  3ERE D;  2LDU A;  1FBQ A;  1DDN A;  4Z2Y A;  1Z9C A;  1E17 A;  1BI3 A;  4OIN F;  4MGR A;  1ZHF A;  1IN8 A;  3WGI A;  1SMT A;  4AVP A;  4RB3 C;  1SD6 A;  3FWE A;  4HLY A;  2VC0 A;  5H6R A;  2XGX A;  2WV0 A;  1R7J A;  3HRT A;  3I0T A;  2ACJ A;  5D5U B;  1R5G A;  2K86 A;  1QZZ A;  5FO5 A;  4YFX F;  1TBX A;  1YQA A;  2XAF A;  4KIB A;  3P9I A;  2OA4 A;  3I64 A;  4JQF A;  1RNL A;  4LLL A;  4I02 A;  3U9G A;  5E1W A;  3D0S A;  1W7P B;  2KJB A;  3ZQ7 A;  2IA0 A;  4YII A;  2HYF A;  5BOX A;  1U8R A;  1HKT A;  3DPL C;  1JGS A;  4Q48 A;  2UWM A;  1XB4 A;  4N9I A;  2G7H A;  2QLZ A;  3BPV A;  3HTU A;  4UVC A;  1BM9 A;  1TQP A;  2JPB A;  1XGM A;  1UHW A;  4ZYG A;  1QZY A;  3BJO A;  1FT9 A;  1D8K A;  4G7H F;  3KP5 A;  2XIG A;  3PQJ A;  4U88 A;  4XSZ F;  2ESN A;  3COA C;  4HX4 A;  4PGG A;  1ZN2 A;  1HSJ A;  1MJ9 A;  2O03 A;  1LEA A;  2C6Y A;  2K7L A;  2LF8 A;  2EB7 A;  3E5Q A;  4OMY A;  3ZMU A;  4HX7 A;  1ONV A;  1BIB A;  1ZAO A;  5E17 F;  1YS7 A;  1SD7 A;  4P5O A;  5LGN A;  1O7L A;  1FC3 A;  2IA2 A;  3JAM Z;  4CDG A;  2K4J A;  3GWZ A;  4MHG A;  2O3F A;  1T0F A;  3M8F A;  1VTN C;  4KDP A;  4LB6 B;  1IZ1 A;  2MBF A;  4EGZ A;  2K4B A;  1UB9 A;  4CHU A;  2ISZ A;  3FMR A;  2VOO A;  3IWF A;  2D2W A;  1FOK A;  4EJV A;  2VBW A;  3ZN1 A;  3KP6 A;  3GEZ A;  3KET A;  4HF1 A;  2STW A;  4ZYD A;  3HRS A;  4AWX B;  1SD4 A;  5ED4 A;  1USS A;  4A0X A;  1OMI A;  4UVB A;  1LDD A;  2Y75 A;  1UCR A;  2QQ9 A;  4NB5 A;  2OQG A;  4ZYE A;  4P96 A;  5J8F A;  1G4D A;  1J9I A;  3RIR A;  1KYW A;  2V9V A;  3BPX A;  3WTZ A;  1MGT A;  2QZ8 A;  4GYI A;  4A5N A;  4CO8 A;  2D1V A;  3J7A O;  1W4M A;  2J5O A;  3DXJ F;  1KU2 A;  3DF8 A;  4HF0 A;  4EMS A;  1Z91 A;  2MD5 A;  3KCC A;  1H0M A;  5FFZ A;  4Y15 A;  2HYG D;  1DPR A;  3T1B A;  3ISP A;  1R1T A;  3I54 A;  5F1R A;  2BE5 F;  2ESH A;  2YPR A;  2RVC A;  3W6J B;  4LK1 F;  1XD7 A;  2ZKZ A;  4YFN F;  4EJO A;  2UXN A;  5FLX Z;  3R0J A;  5CLS A;  1T6S A;  2IW5 A;  1SFE A;  1S7A A;  3EDP A;  1W5S A;  1WKM A;  5HS8 A;  1J5Y A;  1B9N A;  1QGP A;  3H3U A;  1P4W A;  4O6J A;  3KP4 A;  2BYV E;  1QNT A;  1LDK B;  4MEY F;  1I1G A;  4PDK A;  1K78 B;  5HLG A;  3RYP A;  1S6L A;  1G3S A;  3DV8 A;  1UST A;  3VFZ A;  1FBS A;  1KU9 A;  4HX8 A;  2Q0O A;  1FY7 A;  1G3T A;  5HS9 A;  3OOP A;  5JR3 A;  4L5I A;  4Q4Z F;  5DD4 A;  3JSO A;  2PQ8 A;  1RZ4 A;  1ZG5 A;  2M1B A;  1TTY A;  1MZB A;  2L4A A;  2P5L C;  3T8T A;  5CVI A;  3O2P E;  5ICG A;  5DDG A;  1FNN A;  3GUD A;  4EVI A;  2PBI A;  3V8L A;  1HXD A;  5HOO A;  5DD8 A;  3IL2 A;  2QQB A;  1J59 A;  2H6C A;  1BI1 A;  2HS5 A;  2DQL A;  4OIR F;  4M9S A;  3ZP5 A;  2DK8 A;  3F22 A;  4EV0 A;  1R1V A;  2HOE A;  4MEX F;  5L3B A;  1ZH5 A;  1ON1 A;  3WU0 A;  4NQW A;  1T98 A;  5D6F A;  5D8L B;  2HZT A;  1E2X A;  2XAQ A;  2FBK A;  4G9Y A;  5DCM A;  4QLC U;  1XSD A;  2IVM A;  3HOT A;  6PAX A;  4OMZ A;  2K02 A;  1LJ9 A;  2FBI A;  4RGS A;  4Q47 A;  1FP1 D;  3AAF A;  5J8C A;  2MLK A;  4ETS A;  3SQN A;  3RDI A;  1LDJ A;  2FEZ A;  3R60 A;  1R5H A;  5DYM A;  4R79 A;  1OYI A;  3SZT A;  2J5P A;  3KFW X;  2ZXJ A;  2RC4 A;  1BC8 C;  1W7P D;  1K78 A;  1G3Y A;  4EM2 A;  2KJC A;  5H6Q A;  3TO6 A;  4A0Z A;  1TQM A;  2CWE A;  3QU6 A;  2IT0 A;  3BY6 A;  2CO5 A;  2CW0 F;  1TNS A;  2G7U A;  3WE3 A;  2RNJ A;  2V79 A;  3I59 A;  1IF1 A;  3FHZ A;  4BH9 A;  1YYV A;  2FBH A;  2WC2 A;  1GHC A;  4PCQ A;  4UXN A;  2GIV A;  4HLX A;  4QWQ A;  2O0Y A;  1EH8 A;  3L9F A;  3BZ6 A;  2BBY A;  3KLO A;  1XMA A;  3BJ6 A;  1ZGA A;  4M9Z A;  3EUH A;  5BPD A;  2VBY A;  5HLH A;  4GO1 A;  4K2E A;  3CDH A;  2JPC A;  3C7J A;  1D8J A;  2VE8 A;  4ZH4 F;  3F8C A;  1S7O A;  4AIK A;  3V8K A;  3QP5 A;  4XSX F;  3IRR A;  1B6A A;  4HOB A;  2R7F A;  2QBY A;  1ZRC A;  2AXL A;  1XSV A;  1WQ2 A;  4F7Z A;  2QVO A;  4ZZD A;  5J6X A;  1I6X A;  1D3Y A;  2MH2 A;  2V6C A;  4I0B A;  4L9N A;  2HWV A;  1U78 A;  5DUK A;  2LSO A;  5H20 A;  3LQQ A;  4A6E A;  2FNA A;  2ZBK A;  3IC7 A;  2DPU A;  1F4K A;  4DQ2 A;  3EET A;  5HLI A;  4L9V A;  1CF7 B;  3VOD A;  1RUN A;  2VT2 A;  2A68 F;  2BEO A;  2PMH A;  1V3F A;  5A2Q K;  2GWR A;  2JT1 A;  2ZFW A;  5IT9 Z;  1LNW A;  4RGU A;  4M71 A;  3VB2 A;  1TLH B;  3SHF A;  3WTX C;  4E70 A;  4I2O A;  3DP7 A;  1C0W A;  3RYR A;  1OYW A;  4P55 A;  2QQA A;  3F8F A;  4BQA A;  2QBY B;  4CZZ A;  3CO7 C;  2B0L A;  1U6G A;  2GXB A;  4B09 A;  3GXO A;  1XCB A;  4BAY A;  4XLP F;  4KUM A;  2NAZ A;  4EJU A;  1R36 A;  4FHT A;  2G9W A;  2JSC A;  2RKH A;  5ICE A;  1LVA A;  4Y13 A;  3F3X A;  5JHU A;  1BOA A;  3K9T A;  3E6C C;  2BGC A;  3Q5F A;  1SFU A;  2HR3 A;  1OR7 A;  1YW9 A;  3C18 A;  1LB2 A;  4Y17 A;  4IRI A;  1IXS B;  2PI0 A;  1I1S A;  2EA4 A;  3GFI A;  2H27 A;  2M5W A;  3DPT A;  4L9T A;  5LHG A;  2XV4 S;  3I71 A;  2V1X A;  3ECH A;  1HW1 A;  4RB0 A;  2VON A;  1W5T A;  3QRF F;  3BRO A;  1UFM A;  2WWY A;  2XAH A;  5ILU A;  3IKT A;  3RI4 A;  3F8B A;  1KQ9 A;  2KIF A;  5L3D A;  2EV0 A;  1ULY A;  3DQV C;  1RI7 A;  3V8J A;  4EJW A;  4Q5S F;  1XDU A;  1YG2 A;  3WG9 A;  4BHB A;  1IAW A;  1Z7U A;  4GXO A;  3MAJ A;  4UUV A;  1BI2 A;  4HV5 A;  3O6B B;  5LGT A;  1MJB A;  1SMY F;  3E3V A;  2FML A;  2GXG A;  1S8N A;  2JRT A;  1RUO A;  4UVA A;  1WRJ A;  4ZYH A;  1ZGJ A;  3LWF A;  4IHS A;  2EWN A;  2NYX A;  2COM A;  4GGG A;  4LG0 A;  2Z33 A;  5LEK A;  2A07 F;  4U0Y A;  5LRS A;  2CYY A;  5D5W B;  2QYO A;  4FX0 A;  3TKY A;  4A2U A;  4HV6 A;  1ZAR A;  3QOP A;  3R4K A;  1PDN C;  2A5Y B;  3NEU A;  2F2E A;  3I59 B;  1R22 A;  1IRF A;  2HGC A;  3FX3 A;  4AD9 A;  1HKQ A;  4ENK A;  2M8E A;  2XAJ A;  3BDD A;  3I53 A;  1XDS A;  2GZW A;  2VE9 A;  2AS5 F;  5KK1 A;  3WU1 B;  3FZV A;  4YFK F;  3H92 A;  3WTS C;  1ZG1 A;  4RB2 C;  1XN7 A;  2O61 A;  3V7R A;  2HKX A;  5FB2 A;  3PFI A;  3TO7 A;  4HW0 A;  3KP7 A;  3BOQ A;  3ZMD A;  4CGZ A;  1XGN A;  5LLQ A;  1HW2 A;  1T38 A;  2P6S A;  2ZCW A;  2A6H F;  3RJP A;  3R0A A;  1L3L A;  2VBZ A;  2Q8K A;  4RB1 A;  1XMK A;  1OPC A;  5IT9 K;  1B1B A;  1J2X A;  1JHF A;  3R6S A;  1V4R A;  4MQV A;  3WTV C;  4KYW A;  3EYI A;  1O3Q A;  3VEP A;  1Z6T A;  4HYE A;  5D8K B;  1IN4 A;  4M73 A;  2VOP A;  1P4A A;  3HHG A;  1FLI A;  3K1N A;  2L3D A;  2R7D A;  3ECO A;  3KLN A;  4ESB A;  1P2F A;  5ILS A;  4IRG A;  5DUI A;  5ILV A;  2HDC A;  3LA2 A;  3IHU A;  3G73 A;  4OU0 A;  3NRV A;  3E6B A;  4L0Z B;  1IXC A;  4ENN A;  1YO5 C;  4EM0 B;  5FLX K;  2EFN A;  1T39 A;  2CQK A;  3Q9V A;  3QU3 A;  4R1H A;  4CYD A;  1L0O C;  2OD5 A; 
#chains in the Genus database with same CATH topology
 4KIG A;  2F5E A;  4PSX A;  4OIP F;  2H1L A;  3ZQG A;  2JA5 J;  3OMY A;  3RZD J;  3CCS I;  4C2U A;  2E1M C;  2HXO A;  4BYY A;  2ELJ A;  2JA8 J;  3GTO J;  2VBX A;  1RKW A;  1MBH A;  4EJT A;  2X1C A;  4U87 A;  2IJL A;  3FMQ A;  5C4X J;  5J1U A;  3BG9 A;  3MVP A;  1I27 A;  1FSE A;  2EIK H;  2EZH A;  2QM3 A;  3LFU A;  4IQJ A;  3TDU C;  4D1Q A;  1ZRE A;  1VFC A;  4XLH A;  2Y9Z A;  1OCZ H;  1FP2 A;  2DJN A;  1SVO A;  4UV8 A;  3J7Y J;  2QUF A;  4WF2 A;  4RAZ A;  4H0E A;  2A3S A;  3PUF A;  5EEA A;  1R58 A;  1QHH D;  2OZU A;  4BJ6 C;  1XCV A;  1MDM A;  2K27 A;  1KU3 A;  1W7P A;  2RQQ A;  3GFM A;  3B02 A;  1BR1 A;  2CFX A;  5GAH J;  2VKD A;  2R93 J;  2FMY A;  2DFF A;  4NC8 A;  3IH3 A;  2EFP A;  2ETH A;  2HQN A;  5KVR A;  5D5V B;  4P9U A;  4LJZ F;  2V9P A;  4JX6 A;  4PUS A;  2O7O A;  4IHW A;  1U0J A;  3MKW B;  2OJE D;  4MTD A;  2HPM A;  1NK3 P;  2DBB A;  5LRR A;  1Z3Y A;  2IEK A;  2MH9 A;  2XPU A;  3BWG A;  4OIO F;  4AM3 A;  3HSR A;  2IS4 A;  1LVK A;  4YIR X;  4EM1 A;  2P81 A;  3E6D A;  2BY1 A;  1ENH A;  1PP8 F;  1PJR A;  2Z16 A;  5IPA A;  2KZG A;  2M8G X;  4KMF A;  1JE8 A;  2HKO A;  4B8X A;  2XRN A;  4IX7 A;  3B6C A;  3DU6 A;  2R7W A;  1OLT A;  2DA4 A;  4B44 A;  1GXP A;  1Y0U A;  1ETV A;  2DW4 A;  1X1P A;  3FXR A;  2EK5 A;  2H94 A;  3WU2 C;  1OYY A;  4DZP A;  3KE2 A;  4RMN A;  1P6R A;  2PMZ N;  1BIA A;  3ZQL A;  2A61 A;  3CCU I;  1PUF B;  4LLN A;  3BC8 A;  3TO9 A;  3PO2 J;  1IUY A;  2JUG A;  5F04 A;  4HEA 2;  1IDZ A;  1J09 A;  4A3D J;  2KIS A;  4P1W A;  1A04 A;  3GTM J;  3J81 K;  3BJA A;  1XGS A;  4G94 A;  4WXH A;  5JFR A;  4ESJ A;  2L4M A;  1YFH A;  3E5U A;  1T2K A;  1WJB A;  2YX7 A;  1U5T A;  4HDU A;  2X51 A;  2IGN A;  4OWR B;  2CG4 A;  3TQN A;  3V7C A;  1X4P A;  3T5X A;  1ZGW A;  1N77 A;  2LKS A;  4A3L J;  2ZNY A;  2WAD A;  1DQU A;  2MC4 A;  1POG A;  4S05 A;  1IN7 A;  1Q1H A;  4UY8 I;  4WXD A;  2JZY A;  4R8H A;  2OUM A;  4GCV A;  4XRF A;  3RKX A;  1U9O A;  2DFH A;  5FKN A;  3ZMZ A;  2JWT A;  4BBR J;  3W6K B;  1O3R A;  1K7A A;  1GDT A;  3MCZ A;  2NS8 A;  2QWW A;  5EG0 A;  2NVU B;  3LSR A;  3ROU A;  2LYC A;  3OSF A;  4LMY A;  1YIJ I;  3J80 Z;  1TW3 A;  4B48 A;  3E97 A;  5FGM A;  4DBR A;  2DO7 A;  2X0L A;  5AIQ A;  3M9A A;  5FLV A;  3Q9S A;  3ZGK A;  1G6N A;  3F8N A;  4IOA F;  5E3O A;  2ZXW H;  4BBS J;  3GW2 A;  1ZRD A;  5L3G A;  3EYY A;  3GX4 X;  2DI3 A;  2Z5U A;  4PK4 A;  3ELK A;  1PUF A;  1HQC A;  1B4A A;  3SJM A;  1WI3 A;  4CH7 A;  2A6T A;  1FBU A;  1IW7 F;  3TW7 A;  2CMP A;  3GZ5 A;  3O3K A;  4C2T A;  2RDP A;  1UJ8 A;  2W57 A;  3ZMV A;  2HDD A;  3TGN A;  2BXY A;  4BHC A;  1WVR A;  2DFI A;  4HAM A;  4YRV A;  2E34 A;  3I5U A;  1JI8 A;  2DOA A;  3FIW A;  2VJ4 A;  3OYE A;  5TJJ A;  3IAM 2;  1EA3 A;  1HKS A;  4JOM A;  1ZR2 A;  4CIC A;  2HTJ A;  3OWT A;  1S3J A;  3LAP A;  1IV8 A;  5ERI A;  3MMY B;  2NVX J;  4G7Z F;  3CLQ A;  1QPM A;  4UV9 A;  1O3T A;  1LQ1 A;  3M07 A;  1OR7 C;  2MSY A;  1P4X A;  3LST A;  2R5Z B;  4JBA A;  2XUB A;  3ZQI A;  1Q1V A;  1Y1V J;  2M3A A;  4BY7 J;  1ETY A;  4PSW A;  4A3E J;  4Y7N J;  2MAB A;  1YW7 A;  2XGC A;  3HOS A;  3DWL E;  3KP3 A;  2KKO A;  5F08 A;  1JKQ C;  1JHH A;  1O7F A;  5K7H A;  4RAG A;  4BQN A;  2KDO A;  2QQ8 A;  3IKV A;  1WJD A;  1WH7 A;  2XVC A;  3HOV J;  2AQF A;  5FKK A;  2ECB A;  4AID A;  4FX4 A;  1CGP A;  3IH2 A;  3LA3 A;  4IRH A;  4BXU A;  4IHT A;  3FXM A;  3CUQ C;  3PIO F;  3LSI A;  1ZYR F;  2ZXH A;  1HCR A;  2DA6 A;  3JTG A;  4YG2 F;  4X0G A;  2VQL A;  3W6V A;  3ASO H;  4KN7 X;  4IZZ A;  2VB6 A;  3E6M A;  5FKM A;  4XLN F;  5CYV A;  1IC8 A;  1ZLJ A;  3CF2 A;  3PL8 A;  1IN6 A;  3A4C A;  1MBK A;  3GYH X;  2OPT A;  5FKL A;  1XG1 A;  5IYB J;  1FYK A;  5HNF A;  1IRG A;  4HQM A;  4KIS A;  3I9V 2;  3ULQ B;  5E18 F;  3ML6 A;  1X1B A;  2CUJ A;  1U2W A;  2EZL A;  2GBY A;  4IXA A;  2EFW A;  3L2U A;  1VQK I;  3RKW A;  2VQH A;  2R7O A;  1X2N A;  2DMU A;  3OS1 A;  1LUJ B;  2UUZ A;  1JGG A;  2P4W A;  1ODD A;  1YIO A;  2HDW A;  1HOM A;  4ITV A;  2R7U A;  3K6G A;  2HVR A;  2F5D A;  4G8X A;  3A03 A;  2OBP A;  2ZNZ A;  1QPI A;  4MNU A;  3SYT A;  3QPL A;  3JTH A;  4LGW A;  3WGG A;  2FRH A;  1V5F A;  3KEQ A;  5M5Y J;  1ZRF A;  1PP7 U;  4JYK A;  4PJJ A;  1V55 H;  2EZK A;  2PEX A;  1JTX A;  2M45 A;  3FXU A;  1UG2 A;  3L1P A;  3KZY A;  3L7W A;  2ZME A;  2L2O A;  4V2F A;  3H3Z A;  4LD5 A;  5TIS C;  4PJN A;  3FMS A;  4L0Y B;  3M3Y J;  2V1U A;  4B47 A;  4W1U A;  1WWX A;  2HVQ A;  3M1E A;  2K3F A;  2LP0 A;  3CMY A;  1ZG3 A;  5BPI A;  2CW7 A;  2L9V A;  3FHN A;  4O3M A;  1CQT A;  1D5V A;  3RPQ A;  4AIJ A;  1R4N B;  2LKX A;  4N9H A;  2XSD C;  5E20 A;  3RKY A;  1D0Z A;  1Z1D A;  1XSX A;  3X2Q H;  4WX9 A;  4Y33 A;  2I8D A;  2NNY A;  3LA7 A;  1E3O C;  2F4M B;  2L54 A;  2DU9 A;  3IAS 2;  2NVT J;  2DN0 A;  5J1Y A;  2E1M B;  3CLO A;  3FXQ A;  2Y0M A;  2F4O B;  3CJN A;  4XLA A;  3GLL A;  2CQN A;  1MMD A;  3HOU J;  4G7O F;  2V1N A;  3R61 A;  1OQY A;  3VOE A;  5D5X B;  2IRF G;  3FIS A;  1I5Z A;  1VQ5 I;  1TQI A;  5JVT A;  3HIF A;  4XBF A;  4WWC A;  2JN6 A;  2M7A A;  4OOI A;  5B5E C;  3CMM A;  2A5W A;  3OYH A;  3IH4 A;  1D1B A;  4NNJ A;  2XKO A;  1MMN A;  4QSH A;  2A6E F;  4S0H B;  1LFB A;  3LFK A;  2KFD A;  2ISY A;  4L18 B;  1T95 A;  2WY7 Q;  2K5C A;  4LIV A;  1YTY A;  2DLL A;  3S17 J;  4M9X A;  1BJA A;  2HTS A;  2IPQ X;  2BV6 A;  3NWT A;  1WHU A;  3P7N A;  4JX4 A;  4V19 K;  2LNB A;  2Z9O A;  3HUG A;  3HRU A;  3SEQ A;  3A01 A;  4G6Q A;  3OIO A;  2HQ5 A;  4ZC3 A;  4FET A;  4U7B A;  4RAY A;  4GFB A;  4HG2 A;  3HL2 A;  2XF7 A;  4KFC A;  2XRL A;  2PG4 A;  1KYZ A;  2HYJ A;  3GZN B;  4OIQ F;  2P8T A;  2LFB A;  1EH6 A;  2Q2E B;  5L3F A;  4A6D A;  3KEO A;  5EZG A;  1MKM A;  3CES A;  1T56 A;  3WE2 A;  2V26 A;  4RGR A;  2V4J C;  5HDG A;  4L5J A;  2M87 A;  3A0H C;  4IOC F;  2DMN A;  4HBL A;  3L2R A;  4IJA A;  3RSN A;  3CJT B;  2OU2 A;  3RTR A;  1X3W B;  4XM3 A;  4AYB A;  4KIF A;  4M6X A;  3VWB A;  2O9L A;  4I76 A;  1G3W A;  3C1D A;  1UHM A;  1IXR C;  2L7F P;  5ICF A;  4M6Y A;  3HM5 A;  2FOK A;  4UB6 C;  3G6E I;  2EFQ A;  2LTP A;  3QYB A;  1ACI A;  3ZRG A;  2KZV A;  2HFH A;  1A6Q A;  2IAI A;  4N0B A;  4NC6 A;  3L2C A;  1XPX A;  2HZD A;  2PJR B;  3ABL H;  1J0R A;  2L02 A;  3MQ0 A;  5HDK A;  2ZME C;  2KPM A;  4IHY A;  2GA2 A;  1OIS A;  2RAE A;  3FM3 A;  2FNP A;  5EZH A;  4GYG A;  2LF7 A;  4M6V A;  1F36 A;  1RRJ A;  1LE8 A;  2IS6 A;  4JK1 X;  3DFG A;  2Q2E A;  3K0L A;  1E3H A;  4P9F A;  1O57 A;  3WTY C;  4LG0 B;  4A5M A;  2WB1 A;  3WOD F;  3K7A J;  3C3W A;  3F72 A;  4BU2 A;  2FU4 A;  3K4B A;  1JUM A;  4ENM A;  2IA1 A;  1KQ0 A;  2DA3 A;  1WSU A;  3HTS B;  4KNY A;  3W2W A;  1BC7 C;  5LBQ A;  1DPU A;  2LBF A;  2PFB A;  2WAQ N;  1MW7 A;  3M7G A;  4WXC A;  2B63 J;  1STZ A;  4DNC A;  5LHH A;  1IN5 A;  2R7R A;  2YSR A;  2UZK A;  2IP2 A;  1A31 A;  1HST A;  1KA8 A;  3HGY A;  2DDA A;  1QO0 D;  3HJE A;  2IGO A;  4I6Z A;  3TOA A;  2XKP A;  3H9J A;  1FPQ A;  1YLF A;  3ABU A;  4XL9 A;  1N78 A;  2CFO A;  3F8M A;  1R6R A;  2ADU A;  2AQE A;  4XK4 A;  1Y0N A;  1MBF A;  3FM5 A;  3TOB A;  4D5C A;  3DCF A;  3V4G A;  4I98 B;  1RIO H;  4FAS D;  1J75 A;  3WG7 H;  5CVR A;  3AG2 H;  1UAA A;  3QYE A;  3D1N I;  1SEU A;  2CUZ A;  2K3P A;  4UUT A;  5A2Q Z;  4A3I J;  2NVY J;  2YU9 J;  1FJL A;  2NNN A;  3CTA A;  3ONQ A;  2K9S A;  3BZK A;  1KU7 A;  3HG9 A;  3RPU D;  5J4Y A;  1O3S A;  4HNV A;  5F64 A;  1VQ7 I;  2KIM A;  2DYR H;  5F6F A;  1K4S A;  3OYL A;  4NHJ A;  2MC3 A;  2JQ7 A;  4BHP A;  1IV6 A;  1KQ8 A;  2K9N A;  5DCF A;  1XTA A;  3W2V A;  1R00 A;  3OV8 A;  1TT0 A;  4LFU A;  2LKP A;  3DTI A;  2RV8 A;  2VT3 A;  2R0Q C;  3S15 J;  3LSP A;  2DK5 A;  3WTW C;  4IF4 A;  4MQ9 F;  5K5R A;  1EV7 A;  4FQG A;  1HA8 A;  2QEN A;  2O6G E;  1XS9 A;  3QAH A;  2HEO A;  1IG7 A;  2P7C B;  3LSH A;  3CUQ B;  5IYC J;  2VQG A;  3FKJ A;  5AIP A;  4DYQ A;  1JTY A;  4I7H A;  4AIH A;  2M9H A;  1HW5 A;  1JXS A;  3OY9 A;  4AVZ A;  5ICC A;  2L7Z A;  2BY0 A;  1Y6I A;  2EFO A;  5AON A;  1APL C;  2DMT A;  5K5O A;  3AG1 H;  2FXA A;  2P6T A;  4WK8 F;  2D45 A;  1EJ9 A;  3QP6 A;  3N4M A;  3S1Q J;  1K83 J;  3SDB A;  1FSH A;  2WAF A;  2WV1 A;  1WI9 A;  2DA1 A;  3JAM K;  4PJ0 C;  2Q1Z B;  4G6D A;  2WAE A;  3L00 A;  4RLF A;  4S04 A;  2VOD A;  3P9C A;  2PJP A;  1FOY A;  1ZEL A;  1TL8 A;  4HSR A;  4DW6 A;  3GTG J;  3K4L A;  3S32 A;  4LIU A;  2JTV A;  4C30 A;  4F3Q A;  4ZTJ A;  3ABK H;  2LOO A;  3U2R A;  4ON0 A;  1S29 A;  5GAD J;  1YOV B;  1FZP B;  2KRC A;  2LG4 A;  2O8X A;  1LEB A;  3WGH A;  2XAS A;  2L5Q A;  4E7J A;  1EH7 A;  1F43 A;  2ZJ2 A;  2P7V B;  3TDZ C;  4ZJZ A;  3I3L A;  3KIO A;  4RS8 A;  1SAX A;  1YX5 A;  3S8P A;  3CUO A;  3P5J A;  5FD5 A;  3KP2 A;  2EQR A;  4GDF A;  3D5L A;  2R5Y B;  1WGX A;  2DQR A;  5TRD A;  2X6W A;  3CDI A;  2W48 A;  4EGY A;  3KYL A;  1X4O A;  3BG7 A;  2BY3 A;  2VXZ A;  4CYC B;  3WTT C;  2VC1 A;  2KT0 A;  3GBG A;  3KZZ A;  5EEG A;  5E8I A;  3NWS A;  3F23 A;  1YHQ I;  2Y0S N;  2LY2 A;  3B6A A;  2Y30 A;  4QPQ A;  2OQR A;  4ZZL A;  3E1S A;  5LFA A;  1D0Y A;  3RZO J;  2CUE A;  5TGT A;  4HDV A;  5HS7 A;  3HYI A;  4IVN A;  5LGU A;  1W5C C;  2E1C A;  2RN7 A;  3JW4 A;  4PGH A;  1GXQ A;  1OCP A;  3IP4 B;  1TWA J;  5KAI C;  3ZOB A;  1FYM A;  1SFO J;  5E1Z B;  2VQC A;  4M3D A;  3HOY J;  2H8W A;  3U1K A;  2FJ1 A;  2PLY A;  2W85 A;  3K1M A;  1VQO I;  2A69 F;  3K1P A;  4FE4 A;  5IP7 J;  1B9M A;  1JKR C;  5EJC A;  3LAJ A;  1MNM C;  1QQI A;  3A02 A;  3MEX A;  2QA4 I;  4B1R A;  2LR8 A;  1JT6 A;  4BEH B;  2W00 A;  3WHB A;  5E1X A;  2ICW G;  2MA3 A;  1I50 J;  3QPT A;  2YX4 A;  3ZQC A;  2YU3 A;  3GFL A;  2W24 A;  4FT8 A;  1HBX G;  3GF2 A;  2BXZ A;  5F0F A;  1F5T A;  4JX5 A;  5HDN A;  3GO5 A;  1SFK A;  2E1N A;  3BR2 A;  2HU9 A;  3EUA A;  2QSH X;  3CCQ I;  4E7K A;  2P5K A;  3KX2 A;  3V7S A;  3G3Z A;  1DU6 A;  1FX7 A;  1A5J A;  5B1A H;  1P92 A;  4CCL A;  4Y52 J;  1GVJ A;  4XKC A;  2H1K A;  1LFU P;  3ZPL A;  1Z6R A;  4U7D A;  5E79 C;  3S1R J;  3RQ4 A;  4PZJ A;  2K9Q A;  3DKW A;  1D1A A;  4EQQ A;  1R23 A;  5JI6 A;  4MIM A;  1BA5 A;  1EKE A;  2KIU A;  4LLG F;  1F1Z A;  1MD0 A;  4IQ4 A;  1CF7 A;  3M8E A;  2R3S A;  3JRA A;  2M7B A;  1S72 I;  2EV5 A;  1DP7 P;  2ELH A;  2HQR A;  3ABT A;  5F0C A;  1VQL I;  4I01 A;  4HZF A;  2H09 A;  1HLV A;  2VN2 A;  3FDY A;  2VJ5 A;  4RGX A;  4HST A;  3REO A;  5D6E A;  2WB1 N;  2Y31 A;  4J01 A;  1UEL B;  3PIP F;  2FQ3 A;  1PUE E;  2DPD A;  4IPA A;  2KRF A;  2ZSI B;  2W84 A;  3H35 A;  3VDX A;  2M30 A;  3BR1 A;  2EPF A;  3DLL F;  3S3M A;  3HGG A;  2E1O A;  1BN5 A;  2WAQ A;  2ME6 A;  3J80 K;  1RR7 A;  1B59 A;  2CV1 A;  1GT0 C;  1V5E A;  2E5N A;  4C2M J;  3J7A Y;  1X3U A;  2X6X A;  1U5T C;  2ID3 A;  3BCB A;  5K7Z A;  5CJ9 A;  4XIC A;  3L2Q A;  3S3N A;  2L01 A;  1F9N A;  1R1U A;  4U0W A;  5IT3 A;  3IV5 A;  1W0T A;  1DUX C;  2TDX A;  1FWZ A;  2XAU A;  4BNC A;  3K2Z A;  1FEX A;  4NBQ A;  3GTK J;  4M3G A;  2QSF X;  4UHT A;  2DT6 A;  5CVV A;  1AA7 A;  2MLG A;  2W25 A;  4ENJ A;  1SAU A;  5LEJ A;  3DBR B;  1JJ8 C;  5DV5 A;  4MLO A;  4ABZ A;  2XSJ C;  2GQQ A;  2NOG A;  2GM4 A;  3SZP A;  2OZ6 A;  4YEL A;  1BI0 A;  4I0A A;  5BMZ A;  5DEQ A;  2DXI A;  3CC7 I;  4TV7 A;  2XHK A;  4F93 B;  5HVQ C;  3T0Y A;  2XRO A;  1ON2 A;  2M0M A;  4BS9 A;  4KIC A;  3F21 A;  2I5U A;  2DT7 B;  3I58 A;  3MZY A;  5K1Y A;  4HF2 A;  4A0Y A;  4XQF A;  2OC6 A;  2F5C A;  5FFX A;  1OKR A;  1I6H J;  4H4K C;  3H0D A;  1X3Z B;  2ME0 A;  1S9H A;  3QOD A;  1FYL A;  5CVU A;  2NS0 A;  3K69 A;  2XGD A;  5FJ8 J;  3LQR A;  4BGD A;  3K4M A;  4E7L A;  4CXF A;  1G2H A;  1U9N A;  3B73 A;  2ECC A;  2P5V A;  1N75 A;  4LB5 A;  3A0B C;  1Z21 A;  3GFJ A;  2EV6 A;  3CUQ A;  3JRD A;  3MWM A;  4A69 C;  2WTE A;  2FSW A;  4CSW A;  1H88 C;  2JSP A;  3E7L A;  2CGP A;  2W7N A;  2JK3 A;  2PN6 A;  2CUF A;  2LVS A;  2JVG A;  2VKH A;  2Z3Y A;  3M4O J;  2EIJ H;  3ASN H;  1P9Q C;  5BS6 A;  3BP8 A;  2KL4 A;  3D5S C;  2H6B A;  2VKE A;  1MMS A;  2ZO4 A;  4O5V A;  5L3E A;  5D4R A;  2GA1 A;  2KP6 A;  4PJL A;  3U1D A;  3H9G A;  1DGW Y;  2GAU A;  2DTR A;  1K6O A;  4L9J A;  1IDY A;  1IRZ A;  4HNU A;  3I56 I;  1UMQ A;  5D4S A;  4KMU X;  3OYB A;  1K79 A;  5DCM B;  5EEH A;  4QIW N;  1XGO A;  2XAG A;  3GTJ J;  3FF5 A;  2WY8 Q;  4XLE A;  3ZMT A;  1MDM B;  4A12 A;  3PUB A;  1X1D A;  3CJR B;  1TT5 B;  5J4V A;  2KMU A;  2D1H A;  4M74 A;  3GZ6 A;  2E7X A;  2DAO A;  3ABM H;  2EJR A;  3P9K A;  3BTJ A;  2Y69 H;  1SAN A;  2HOS A;  1SFX A;  1R71 A;  1TNT A;  3HSE A;  1MSF C;  1KGS A;  3CQZ J;  4A93 J;  4WCG A;  4Y4R A;  3G1O A;  3EUH C;  4FTH A;  2HVS A;  4X1E A;  1X1A A;  1HF0 A;  3EQL F;  1BJZ A;  3CF5 F;  3ZN0 A;  3TED A;  4IHX A;  4E7S A;  1TW2 A;  1N25 A;  1RES A;  2V1D A;  2FF4 A;  3OL3 A;  4A3F J;  4NC7 A;  3RPU A;  3N97 A;  3BR3 A;  4AYB N;  3CO6 C;  3I4P A;  2FQ4 A;  1V5G A;  4PJM A;  3PQK A;  2Y0S A;  1X1C A;  3IUO A;  3E5X A;  2FX0 A;  3GLX A;  4LK0 F;  4D0P A;  1MH3 A;  3CCR I;  5CVJ A;  4UNO A;  2PMU A;  3RKQ A;  2X1E A;  1KON A;  3LOC A;  2JJ7 A;  4BKX A;  1ZTR A;  1MJA A;  2YR2 A;  2E7W A;  5L3C A;  3HKZ N;  3QYF A;  2BW3 A;  2N8G A;  4BE1 A;  1M1E B;  1AOY A;  2R92 J;  3SXY A;  2FOW A;  5FRM A;  2DT5 A;  3DEU A;  4HPQ A;  1P7J A;  3BCA A;  1YS6 A;  3BG5 A;  4KT5 C;  2HQA A;  5BQT A;  5CQE A;  2X4H A;  5C44 J;  3F6O A;  1GV5 A;  1J7K A;  5IOY A;  1XC5 A;  1AHD P;  2NRA C;  1BW5 A;  3HRM A;  2E5Z A;  3ZR8 X;  4BL0 B;  3OYI A;  2Y48 A;  3SEZ A;  3HHH A;  3CDL A;  3F6V A;  2O8K A;  1RC9 A;  1U3E M;  2X9D A;  4KA4 A;  2ZME B;  4G12 A;  2HI3 A;  4DJA A;  3J81 Z;  3QPH A;  2PMZ A;  2F4I A;  1YE9 A;  2RQP A;  1SD5 A;  4HA8 A;  2ZJP F;  2X1D A;  3GCM A;  3FBN B;  1TWG J;  3LSK A;  5E8G A;  4I09 A;  1XX5 A;  3ESW B;  3IWZ A;  1LKX A;  3S3O A;  5LD2 C;  2FA5 A;  5FRO A;  2BOL A;  2RGV A;  4ASN A;  2CSO A;  4XID A;  1IJW C;  2OAZ A;  1NHA A;  4LG3 A;  4LOC A;  4M72 A;  1AWC A;  1QBJ A;  1NK2 P;  5M3M J;  4E7I A;  3L09 A;  5FD6 A;  4A3K J;  1H9G A;  3IRQ A;  4U0V A;  3S2W A;  5F27 A;  1T8I A;  3HDD A;  5GP9 A;  3HSF A;  4ZTF A;  1YW8 A;  4YIF A;  5HLT A;  1REP C;  1ZLK A;  3G1M A;  5FLM J;  1D0X A;  1OCR H;  2LC2 A;  3S14 J;  3WTU C;  3SFZ A;  3NQO A;  3ZQH A;  2F5F A;  2CJJ A;  2JUC A;  3JSP A;  2Z99 A;  3GVA A;  3H36 A;  2FE3 A;  3MFK A;  4E4H A;  4ESF A;  4KN4 X;  1Z05 A;  5E3M A;  3ZMS A;  2ZC2 A;  5K5Q A;  4J19 A;  3T8R A;  2YS9 A;  3CP2 A;  1S7E A;  2MW8 A;  2UXX A;  1YIT I;  5E3L A;  3ERM A;  3MZH A;  4DYC A;  1TWC J;  3HZJ A;  4L5E A;  1H9T A;  2STT A;  4HQE A;  1B72 A;  5LHI A;  1U5T B;  1X58 A;  3Q3S A;  2EA2 A;  4MTE A;  3Q0U A;  4B4C A;  5KHD A;  1BBY A;  3ERE D;  2LDU A;  1FBQ A;  1DDN A;  4Z2Y A;  3DBL B;  1Z9C A;  3OYN A;  2D5V A;  1FIP A;  3JRG A;  1E17 A;  3FK7 A;  1BI3 A;  4OIN F;  4MGR A;  1ZHF A;  1V54 H;  1IN8 A;  2DA7 A;  3WGI A;  1SMT A;  4AVP A;  4RB3 C;  1SD6 A;  2GOM A;  2PJR A;  1DP3 A;  3FWE A;  4HLY A;  2VC0 A;  2E2H J;  5H6R A;  2VJJ A;  3QPS A;  3O8H A;  2XGX A;  2L9R A;  2WV0 A;  2ZFU A;  3DEW A;  1R7J A;  3TP3 A;  3HRT A;  3I0T A;  2ACJ A;  5GAG J;  1W1W E;  1R5G A;  4XLF A;  5D5U B;  2BZT A;  3JRB A;  2K86 A;  1ERD A;  2ZJQ F;  1QZZ A;  5FO5 A;  4YFX F;  4ZDL A;  5GTI C;  5CQG A;  2OTL I;  3HBL A;  1TBX A;  1YQA A;  2XAF A;  3DKY A;  4DBQ A;  4AC0 A;  3PO3 J;  3EUK L;  4KIB A;  1GLN A;  1IRX A;  3P9I A;  2DOD A;  4A3G J;  1B8I A;  2OA4 A;  3I64 A;  2VKV A;  2MD0 A;  2GOX B;  4JQF A;  4RA2 A;  1RNL A;  2HOA A;  4LLL A;  4I02 A;  3U9G A;  5E1W A;  4CYC A;  4E7H A;  1A36 A;  3D0S A;  1W7P B;  2ID6 A;  2KJB A;  2LY1 A;  2AXT C;  3ZQ7 A;  2QF7 A;  3MD2 A;  2IA0 A;  4YII A;  2HYF A;  4C3J J;  2LLK A;  3G1L A;  5BOX A;  1U8R A;  1HKT A;  2HXI A;  3DPL C;  1SVL A;  3AFH A;  1JGS A;  4Q48 A;  3VYR B;  2UWM A;  2R7T A;  1XB4 A;  4N9I A;  3OYG A;  5M5W J;  2VIX A;  1AU7 A;  2NOJ B;  1Z77 A;  2G7H A;  2L7K A;  3TL4 X;  2JRM A;  2QLZ A;  3BPV A;  3HTU A;  3NAR A;  2WA0 A;  4UVC A;  1BM9 A;  5DM7 F;  1W36 C;  3OYD A;  3MZ8 A;  1TQP A;  4E6K G;  2JPB A;  1UHS A;  1XGM A;  1UHW A;  1ZK8 A;  3KEY A;  4BJT A;  5IP9 J;  3VSK A;  4ZYG A;  1QZY A;  3BJO A;  1KZH A;  1FT9 A;  1D8K A;  1TP4 A;  2DYS H;  1LPQ A;  4G7H F;  3KP5 A;  3PSF A;  4C3I J;  4CA0 A;  2XIG A;  3PQJ A;  4U88 A;  2XB0 X;  4DOZ A;  4XSZ F;  2ESN A;  3COA C;  3OIP A;  4HX4 A;  4PGG A;  3A2K A;  1ZN2 A;  2B9S A;  4RAF A;  2KIQ A;  1HSJ A;  1MJ9 A;  2O03 A;  1MBE A;  4BUP A;  1LEA A;  2C6Y A;  2K7L A;  1I3Q J;  2LF8 A;  4CZC A;  1NTC A;  4NQW B;  2EB7 A;  5DM6 F;  2K85 A;  3E5Q A;  2E2J J;  4BDZ A;  4OMY A;  1HDD C;  3ZMU A;  5J1R A;  4XN3 A;  4HX7 A;  1ONV A;  2F5V A;  1BIB A;  4BY1 J;  3CCM I;  2P0W A;  4UUS A;  1ZAO A;  5E17 F;  3H3V K;  1YS7 A;  3FBI B;  4YEJ A;  4A3J J;  3CJQ B;  1SD7 A;  2JA7 J;  4CCO A;  2M4G A;  1B8I B;  4P5O A;  5LGN A;  1O7L A;  2IS1 A;  2BVM A;  2W82 A;  1FC3 A;  2IA2 A;  3H5A A;  9ANT A;  2OCE A;  1JKP C;  3JAM Z;  2YUS A;  4BE0 A;  2DCE A;  4CDG A;  2CQX A;  2K4J A;  3GWZ A;  3M1C A;  3S2H J;  4DYR A;  4MHG A;  2O3F A;  1T0F A;  3M8F A;  1MSE C;  1VF9 A;  1YRN B;  1PVE A;  1P7I A;  1VTN C;  5GAE J;  4IHV A;  4XKB A;  2E35 A;  4KDP A;  4BXX J;  4LB6 B;  1IZ1 A;  2MBF A;  4EGZ A;  2K4B A;  1UB9 A;  3PNT A;  3C2H A;  3SZG A;  4CHU A;  2EIM H;  5FKO A;  2ISZ A;  3FMR A;  3V42 A;  2VOO A;  1FTZ A;  2LRE A;  3IWF A;  5C4J J;  1YX3 A;  3ZQF A;  3K4C A;  5DTD A;  1ZR4 A;  2BVL A;  3ZCO A;  2D2W A;  2XC7 A;  1FOK A;  2W1O A;  1A6I A;  4EJV A;  2VBW A;  3J7Z I;  2HNH A;  1ETW A;  3ZN1 A;  4BQO A;  5F1J A;  3KP6 A;  3GEZ A;  3KET A;  3DTK A;  1RR8 C;  4LIT A;  4HF1 A;  2STW A;  3H9Q A;  2GXA A;  4ZYD A;  2LBF B;  3HRS A;  4AWX B;  1SD4 A;  3VYS B;  5ED4 A;  3PJR A;  1USS A;  4A0X A;  1OMI A;  1MIJ A;  2QEX I;  4BQQ A;  4UVB A;  4D9J A;  1LDD A;  2Y75 A;  1G8X A;  1UCR A;  2QQ9 A;  4NB5 A;  1WPK A;  2OQG A;  4ZYE A;  5EGO A;  2M4K A;  4P96 A;  4BJ5 C;  1ZKG A;  5J8F A;  2LD5 A;  1G59 A;  2VUM J;  2H8R A;  1LE8 B;  1G4D A;  1J9I A;  3RIR A;  5JHF A;  1KYW A;  2F48 A;  2V9V A;  3BPX A;  3WTZ A;  1MGT A;  3QQA A;  2QZ8 A;  4OAZ A;  4GYI A;  4A5N A;  2DMQ A;  4CO8 A;  5IY5 H;  2D1V A;  2XF6 A;  1JT0 A;  3TBI A;  3J7A O;  1VQN I;  1FMW A;  1W4M A;  3K70 D;  2J5O A;  3DXJ F;  2E2I J;  2BW3 B;  1KU2 A;  2GLO A;  3S2D J;  2EZI A;  3DF8 A;  3JRH A;  1BOB A;  4HF0 A;  1MBJ A;  4EMS A;  1Z91 A;  2MD5 A;  3KCC A;  3BQY A;  3BR0 A;  3CCJ I;  1H0M A;  3HOW J;  5FFZ A;  4Y15 A;  4EEF G;  2HYG D;  2Y9Y A;  1DPR A;  3RCO A;  3OYM A;  4A3B J;  2FUG 2;  2TRT A;  3JRE A;  3BLY A;  1BL0 A;  2IGK A;  2MGQ A;  2PX9 A;  3T1B A;  3ISP A;  4M3F A;  2R7Z J;  1WJF A;  1T0F C;  1R1T A;  1YJ9 I;  1S5L C;  5GPA A;  4NDL A;  2BY2 A;  2M0C A;  3I54 A;  1DGR M;  5F1R A;  2IS2 A;  2BE5 F;  4CCN A;  5CKT A;  2ESH A;  2OV7 A;  3OR1 C;  2YPR A;  2RVC A;  3AG4 H;  3W6J B;  2DFE A;  4LK1 F;  1TZL A;  1XD7 A;  2ZKZ A;  4YFN F;  4EJO A;  3S16 J;  2UXN A;  5FLX Z;  4IEJ A;  3R0J A;  2JA6 J;  5CLS A;  4W97 A;  3D5R C;  1T6S A;  2IW5 A;  1VI0 A;  2VPL A;  1SFE A;  1S7A A;  3EDP A;  2CH0 A;  3L2V A;  5EGO B;  1W5S A;  3GTP J;  2X85 A;  1WKM A;  5HS8 A;  4XNF A;  5HOD A;  3G2B A;  1J5Y A;  1B9N A;  3FK6 A;  1QGP A;  2VJI A;  3BT9 A;  3FXK A;  3H3U A;  3A1Y A;  1P4W A;  3OYC A;  4ZDO A;  4O6J A;  3KP4 A;  2BYV E;  2NXN B;  4QTR A;  1QNT A;  2O5R A;  1LDK B;  4MEY F;  1I1G A;  4PDK A;  1K78 B;  4Z6Y A;  1Z7L A;  5HLG A;  1ETQ A;  4XKV A;  4RDU A;  3RYP A;  2R7X A;  1S6L A;  2K40 A;  4N4O B;  4C3H J;  1G3S A;  4RM3 A;  3UKG A;  3DV8 A;  1UST A;  3OR2 C;  4RM2 A;  3VFZ A;  1FBS A;  1KU9 A;  4HX8 A;  4CUG A;  4CCJ A;  4D7N A;  2Q0O A;  3AKZ A;  1FY7 A;  1G3T A;  1W36 D;  5HS9 A;  3OOP A;  5JR3 A;  3CC2 I;  4L5I A;  4Q4Z F;  3K4N A;  5DD4 A;  3H1C A;  3JSO A;  2PQ8 A;  1ETX A;  3S1N J;  1RZ4 A;  1JKO C;  1ZG5 A;  2B7E A;  2M1B A;  1IO2 A;  1TTY A;  2AO9 A;  1HDP A;  1GV2 A;  3I4M J;  1MZB A;  4MFD A;  2EIL H;  2L4A A;  4D7M A;  3MKZ A;  2P5L C;  3T8T A;  1BW6 A;  5CVI A;  3O2P E;  3K2A A;  3HKZ A;  4FE7 A;  4UB8 C;  5B66 C;  1GVD A;  5ICG A;  3HPH A;  4HRI A;  5DDG A;  1FNN A;  3GUD A;  4EVI A;  2XF5 A;  2PBI A;  3V8L A;  3HPG A;  3VYU B;  1HXD A;  5HOO A;  1T33 A;  3FXO A;  4CCM A;  5DD8 A;  1YI2 I;  3IL2 A;  2QQB A;  5IP6 A;  1J59 A;  2L9N A;  2H6C A;  1BI1 A;  2E71 A;  2HS5 A;  2DQL A;  4OIR F;  3DU5 A;  4M9S A;  3ZP5 A;  2MG4 A;  2DK8 A;  1K6Y A;  3DEE A;  3F22 A;  1RPW A;  1T08 B;  2XPW A;  4EV0 A;  1R1V A;  2HOE A;  4MEX F;  5L3B A;  1ZH5 A;  2K9M A;  3UR3 C;  1ON1 A;  3S93 A;  3WU0 A;  4NQW A;  1T98 A;  2LK2 A;  4XMY A;  1W0U A;  4A3C J;  5D6F A;  5D8L B;  4D5F A;  4FCY A;  2HZT A;  1E2X A;  3EPZ A;  2XAQ A;  5F0H A;  3GTQ J;  3CP8 A;  2FBK A;  2I10 A;  2LRD A;  4G9Y A;  5DCM A;  4QLC U;  1XSD A;  2IVM A;  3HOT A;  2VLA A;  6PAX A;  4OMZ A;  3OYA A;  3F0C A;  5EDN A;  2K02 A;  1LJ9 A;  2QKL B;  1IUF A;  2FBI A;  4RGS A;  4Q47 A;  1FP1 D;  3AAF A;  5J8C A;  3NAU A;  3JRC A;  2MLK A;  3K4J A;  2XGE A;  3OS2 A;  2JA2 A;  2OCC H;  3VYT B;  2KHM A;  3SQN A;  4ETS A;  3RDI A;  4KT6 A;  1LDJ A;  2FEZ A;  3R60 A;  5M5X J;  5E3N A;  1R5H A;  5DYM A;  5BNG A;  4B43 A;  2OTJ I;  4R79 A;  1OYI A;  2V6E A;  3SZT A;  2M34 A;  2J5P A;  4IO9 F;  3KFW X;  2ZXJ A;  2RC4 A;  2EIN H;  1OFC X;  1W7P D;  3LSM A;  1K78 A;  1BC8 C;  1G3Y A;  4EM2 A;  2KJC A;  4F91 B;  5H6Q A;  5H2F C;  3TO6 A;  4A0Z A;  1U8B A;  1TQM A;  2CWE A;  3QU6 A;  2IT0 A;  5J3L A;  4F52 A;  5JLW A;  1WZ2 A;  3BY6 A;  4XRM A;  2CO5 A;  2CW0 F;  3Q0V A;  1TNS A;  2G7U A;  3PM1 A;  3WE3 A;  2RNJ A;  2V79 A;  3I59 A;  1IF1 A;  3FHZ A;  3W3C A;  1I39 A;  4BH9 A;  2QSG X;  1YYV A;  2FBH A;  1VQ6 I;  2WC2 A;  4BXF A;  1GHC A;  3HOZ J;  4PCQ A;  4UXN A;  4BDY A;  1R4M B;  1Z3X A;  5KAF C;  2GIV A;  4HLX A;  3DBH B;  4QWQ A;  3OL4 A;  5B3S H;  2O0Y A;  4BEH A;  1EH8 A;  3PNY A;  1Z0X A;  3L9F A;  4N4N B;  3BZ6 A;  2BBY A;  3BQZ A;  3KLO A;  1XMA A;  2DOF A;  4RLQ A;  3BJ6 A;  1ZGA A;  4M9Z A;  3EUH A;  3CCE I;  5BPD A;  3SDG A;  2VBY A;  5HLH A;  4GO1 A;  4K2E A;  5GPC A;  3CDH A;  2JPC A;  3C7J A;  1D8J A;  2VE8 A;  4ZH4 F;  5HNH A;  1H8A C;  2RNG A;  3F8C A;  1S7O A;  4AIK A;  3V8K A;  1MND A;  3QP5 A;  1QRY A;  2ZXI A;  4IKF A;  1FOW A;  3QOE A;  4FIS A;  4XOP A;  4XSX F;  1PYV A;  3IRR A;  1B6A A;  4DIQ A;  4HOB A;  2R7F A;  4DZJ A;  2NS7 A;  2QBY A;  1ZRC A;  2AXL A;  2EH3 A;  2E36 A;  1XSV A;  1Y39 A;  2KDZ A;  1WQ2 A;  4B3X A;  1JUS A;  1OJL A;  2QVO A;  4F7Z A;  4ZZD A;  2A05 A;  5J6X A;  1I6X A;  1D3Y A;  2MH2 A;  2V6C A;  1D5Y A;  5JVG F;  4DGW B;  4I99 C;  2M2E A;  2DOE A;  4I0B A;  4L9N A;  2HWV A;  1U78 A;  1GUU A;  1WJE A;  5DUK A;  4BAC A;  4XOR A;  2LSO A;  5H20 A;  3LQQ A;  4A6E A;  4RBO A;  2R5Y A;  3W2A A;  3LNQ A;  1OCO H;  1VQ9 I;  1Y8Q B;  2RRE A;  2FNA A;  2ZBK A;  1QVT A;  1WH5 A;  3IC7 A;  2DPU A;  1F4K A;  4DQ2 A;  3EET A;  5HLI A;  4L9V A;  1CF7 B;  5KNL A;  3VOD A;  5EG0 B;  1RUN A;  1K4T A;  2OF7 A;  3U21 A;  3A01 B;  4EAT A;  3BZC A;  1R5I D;  2VT2 A;  2A68 F;  2BEO A;  2PMH A;  3CC4 I;  3KPH A;  3JRF A;  1V3F A;  5A2Q K;  2GWR A;  1DU0 A;  3DTE A;  4PFP A;  2COB A;  2JT1 A;  1E3P A;  2ZFW A;  2V7F A;  3FXL A;  4AUX A;  1WJ5 A;  2DA5 A;  5IT9 Z;  2CU7 A;  3ZQQ A;  1LNW A;  2G0E A;  2XB5 A;  4M71 A;  4RGU A;  4XLC A;  3G4S I;  2HOT A;  1Z67 A;  1BR4 A;  1VND A;  3LL7 A;  2V9K A;  1TLH B;  3VB2 A;  4XON A;  2AHQ A;  3SHF A;  3WTX C;  2R7Q A;  4E70 A;  3N05 A;  4I2O A;  3DP7 A;  1C0W A;  3RYR A;  1OYW A;  4P55 A;  2IXS A;  2QQA A;  3F8F A;  4BQA A;  2QBY B;  4CZZ A;  2QKM B;  2CW8 A;  3CO7 C;  3L2W A;  2X6Y A;  2R7S A;  1HC8 A;  2B0L A;  1U6G A;  4NUB A;  2GXB A;  2K9L A;  4B09 A;  3GXO A;  3KYC B;  1XCB A;  3DLA A;  2IBD A;  4BAY A;  4XLP F;  4KUM A;  1MNE A;  1ETK A;  5EYR A;  5JLX A;  2NAZ A;  3BTI A;  1XMX A;  3TW6 A;  3WHC A;  1OCC H;  4EJU A;  1VQP I;  1JUP A;  1R36 A;  4FHT A;  2G9W A;  2XPV A;  2JSC A;  3CD6 I;  2RKH A;  2CS3 A;  1EF4 A;  3Q0W A;  2L9S A;  5ICE A;  3FKI J;  1LVA A;  1Y56 A;  2LH9 A;  4Y13 A;  4E7Z A;  3CZ6 A;  3F3X A;  3CMA I;  2LMD A;  5JHU A;  1BOA A;  3K9T A;  3E6C C;  1X2M A;  3MKY B;  2BGC A;  5CPR B;  3Q5F A;  1SFU A;  4M3E A;  2DDB A;  2HR3 A;  2DTZ A;  2CQQ A;  1OR7 A;  2JVH A;  2BHY A;  1YW9 A;  1ZQ3 P;  3C18 A;  1WCM J;  1LB2 A;  2NVQ J;  4Y17 A;  4IRI A;  1IXS B;  2PI0 A;  4UUS B;  1I1S A;  4QPO A;  1MBG A;  4Y3O A;  3HOX J;  4PFO A;  3AL0 C;  2EA4 A;  3GFI A;  3UNG C;  2H27 A;  3GTL J;  2M5W A;  3DPT A;  4L9T A;  1ETO A;  5LHG A;  1RET A;  2DA2 A;  3M8J A;  4X6A J;  2XV4 S;  3I71 A;  3G71 I;  2V1X A;  2KLO A;  3ECH A;  1E0E A;  2E19 A;  3F9K A;  1HW1 A;  4RB0 A;  1I3A A;  4CCK A;  3KZI C;  2MFZ A;  2VON A;  1D1C A;  1W5T A;  2Y2Z A;  4XR6 A;  5C3E J;  3QRF F;  2FD5 A;  3BRO A;  1UFM A;  2WWY A;  2XAH A;  5K7F A;  5ILU A;  3IKT A;  3RI4 A;  4F55 A;  3F8B A;  3C2B A;  3FXJ A;  3BG3 A;  1KQ9 A;  4B3A A;  2KIF A;  5L3D A;  2EV0 A;  3H5R A;  1ULY A;  3DQV C;  5KCM A;  2GIZ A;  4ZDP A;  5B1B H;  3OS0 A;  4MO7 A;  4A3M J;  3O8G A;  2XDV A;  3QWL A;  4OAY A;  1RI7 A;  2BHZ A;  3V8J A;  4EJW A;  3K4K A;  4Q5S F;  1XDU A;  4XOT A;  3VPR A;  4XRS A;  1YG2 A;  2QGU A;  3WG9 A;  1WJC A;  5M3F J;  4J00 A;  4IL6 C;  3BG6 A;  4BHB A;  2ZJR F;  1IAW A;  5IYD J;  3JRI A;  1Z7U A;  4GXO A;  3K10 A;  3MAJ A;  4UUV A;  3RQI A;  1BI2 A;  2R4G A;  1TWH J;  1OCT C;  4HV5 A;  1FIA A;  4V2G A;  2UV1 A;  3JR9 A;  3O6B B;  3E0J B;  5LGT A;  5J40 A;  1H89 C;  1MJB A;  1SMY F;  1IGN A;  2EBI A;  3BTC A;  3E3V A;  1AKH B;  5EF6 A;  2FML A;  2VI6 A;  2GXG A;  4AU7 A;  1S8N A;  2R5Z A;  2JRT A;  3LMM A;  1RUO A;  1A35 A;  4II3 A;  4UVA A;  1WRJ A;  4ZYH A;  1ZGJ A;  3HEF A;  3LWF A;  4IHS A;  3CCL I;  1O4X A;  2EWN A;  3BR6 A;  3DPU A;  1VQ8 I;  2NYX A;  1R49 A;  2COM A;  2ZB9 A;  4GGG A;  4II2 A;  3TP0 A;  2VAS A;  5DS9 A;  2W4S A;  1VQM I;  4XN0 A;  2MYS A;  2HPI A;  1QZE A;  4LG0 A;  2Z33 A;  3ZXS A;  5LEK A;  1FTT A;  3H0G J;  2A07 F;  4U0Y A;  5LRS A;  2VXD A;  3MN2 A;  2CYY A;  5D5W B;  2QYO A;  4FX0 A;  3GME A;  2TCT A;  3TKY A;  4A2U A;  2X48 A;  3TMO A;  4HV6 A;  2CV0 A;  1ZAR A;  3QOP A;  3R4K A;  1B72 B;  1PDN C;  1BR2 A;  1RKT A;  2A5Y B;  3HC7 A;  3NEU A;  2F2E A;  3I59 B;  1R22 A;  1IRF A;  2HGC A;  2KQR A;  3FX3 A;  2DMP A;  3PSI A;  4AD9 A;  4HNT A;  4C9Y A;  4KIT B;  3VSL A;  1HKQ A;  2E60 A;  4KJZ A;  3PFY A;  4ENK A;  3OYJ A;  1SVM A;  1YJW I;  2M8E A;  2XAJ A;  3BDD A;  2CQ7 A;  3I53 A;  1XDS A;  2GZW A;  2VE9 A;  2AS5 F;  5KK1 A;  1FMV A;  2LY9 A;  3WU1 B;  2IGM A;  3FZV A;  4YFK F;  3H92 A;  3WTS C;  1Y1W J;  1ZG1 A;  3AL0 B;  1QHG A;  2KRH A;  1UG0 A;  4G6T B;  3JCU C;  4JP0 A;  1YJN I;  4RB2 C;  1K61 A;  1XN7 A;  2ELK A;  1QA6 A;  2O61 A;  2CRG A;  3V7R A;  5J47 A;  4XKW A;  3I55 I;  4M3B A;  2HKX A;  4GRI A;  3DKX A;  5FB2 A;  3PFI A;  3TO7 A;  2R7V A;  4HW0 A;  3KP7 A;  3K70 C;  3OSG A;  1NG6 A;  3BOQ A;  2X6O A;  3ZMD A;  4CGZ A;  1XGN A;  5LLQ A;  1HW2 A;  1T38 A;  2P6S A;  2ZCW A;  1WJA A;  2A6H F;  3HXL A;  5GTH C;  3RJP A;  3R0A A;  2JMW A;  1L3L A;  1MH4 A;  2VBZ A;  2Q8K A;  4RB1 A;  2DJI A;  3BTL A;  3PNV A;  3OYK A;  2WBM A;  1QU3 A;  1YRN A;  1XMK A;  1UZC A;  3HUG B;  2VL8 A;  3AG3 H;  1OPC A;  1X19 A;  1SC7 A;  4F92 B;  5IT9 K;  2QCO A;  1VZ0 A;  1B1B A;  1J2X A;  1JHF A;  2VPR A;  1LFP A;  1V4R A;  3R6S A;  1AKH A;  4MQV A;  3WTV C;  4KYW A;  3CCV I;  1VQ4 I;  3EYI A;  1NH3 A;  3OOU A;  1O3Q A;  4MFE A;  3VEP A;  1TWF J;  1Z6T A;  4HYE A;  2F6C A;  5D8K B;  1IN4 A;  2Z2S B;  1WFX A;  4M73 A;  2VOP A;  3OIQ A;  1ITY A;  1P4A A;  1QVU A;  3HHG A;  1FLI A;  3K1N A;  5FRN A;  2L0K A;  2L3D A;  3MKL A;  1MMG A;  3CCY A;  3LSG A;  2R7D A;  3ECO A;  3KLN A;  4ESB A;  2ZSH B;  1P2F A;  3SFI A;  5ILS A;  3LSJ A;  3OYF A;  4BE2 A;  1JJ6 C;  1MMA A;  4IRG A;  5DUI A;  5ILV A;  3C2G A;  2HDC A;  3HB9 A;  2CV2 A;  3LA2 A;  3H5N A;  3IHU A;  3G73 A;  4OU0 A;  3NRV A;  1FOX A;  3E6B A;  2L7M P;  1IXC A;  3CME I;  4ENN A;  4L0Z B;  4ANJ A;  1YO5 C;  5IOZ A;  1R9T J;  4XRS G;  1NG7 A;  4EM0 B;  3I4N J;  5FLX K;  1Y8R B;  2EFN A;  1T39 A;  3S1M J;  4ZYA A;  1ORK A;  2CQK A;  2Z1D A;  3Q9V A;  3QU3 A;  4R1H A;  3BR5 A;  4CYD A;  3KYD B;  1L0O C;  1TC3 C;  2OD5 A; 
#chains in the Genus database with same CATH homology
 4KIG A;  2F5E A;  4OIP F;  4BYY A;  2VBX A;  4EJT A;  2IJL A;  3FMQ A;  1I27 A;  1FSE A;  2QM3 A;  3TDU C;  1ZRE A;  1FP2 A;  4UV8 A;  2QUF A;  4WF2 A;  4RAZ A;  4H0E A;  2A3S A;  1R58 A;  2OZU A;  1XCV A;  1MDM A;  2K27 A;  1KU3 A;  1W7P A;  3GFM A;  3B02 A;  2CFX A;  2FMY A;  2EFP A;  2ETH A;  2HQN A;  5KVR A;  5D5V B;  4P9U A;  4LJZ F;  4MTD A;  4OIO F;  2DBB A;  5LRR A;  3BWG A;  2MH9 A;  3HSR A;  4EM1 A;  3E6D A;  1PP8 F;  4KMF A;  1JE8 A;  2HKO A;  4B8X A;  2XRN A;  1GXP A;  1Y0U A;  2DW4 A;  3FXR A;  2EK5 A;  2H94 A;  1OYY A;  3KE2 A;  1P6R A;  1BIA A;  2A61 A;  4LLN A;  3TO9 A;  1IUY A;  1A04 A;  3J81 K;  3BJA A;  1XGS A;  4G94 A;  4WXH A;  4ESJ A;  5JFR A;  2L4M A;  1YFH A;  3E5U A;  1T2K A;  2YX7 A;  1U5T A;  4HDU A;  2CG4 A;  3TQN A;  3V7C A;  3T5X A;  2ZNY A;  4S05 A;  1IN7 A;  1Q1H A;  4WXD A;  2JZY A;  4R8H A;  4GCV A;  4XRF A;  3RKX A;  3ZMZ A;  3W6K B;  1O3R A;  1K7A A;  3MCZ A;  2QWW A;  3ROU A;  4LMY A;  3J80 Z;  1TW3 A;  3E97 A;  5FGM A;  2DO7 A;  2X0L A;  5AIQ A;  3M9A A;  3Q9S A;  1G6N A;  3F8N A;  3GW2 A;  1ZRD A;  5L3G A;  3EYY A;  3GX4 X;  2DI3 A;  2Z5U A;  3ELK A;  1HQC A;  1B4A A;  1FBU A;  1IW7 F;  3GZ5 A;  3O3K A;  2RDP A;  2W57 A;  3ZMV A;  3TGN A;  4BHC A;  2DFI A;  4HAM A;  3I5U A;  5TJJ A;  1HKS A;  4CIC A;  2HTJ A;  1S3J A;  3LAP A;  5ERI A;  4G7Z F;  1QPM A;  4UV9 A;  1O3T A;  1LQ1 A;  1P4X A;  3LST A;  4JBA A;  2XUB A;  1YW7 A;  3HOS A;  3KP3 A;  2KKO A;  1JHH A;  1O7F A;  3IKV A;  2XVC A;  4FX4 A;  1CGP A;  3LA3 A;  4IRH A;  4BXU A;  4IHT A;  3CUQ C;  1ZYR F;  3JTG A;  4YG2 F;  4KN7 X;  3E6M A;  4XLN F;  5CYV A;  1ZLJ A;  1IN6 A;  3GYH X;  1FYK A;  1IRG A;  4HQM A;  3ULQ B;  5E18 F;  3ML6 A;  2EFW A;  1U2W A;  4IXA A;  3RKW A;  2P4W A;  1ODD A;  1YIO A;  2F5D A;  4G8X A;  2OBP A;  2ZNZ A;  4MNU A;  3WGG A;  3JTH A;  4LGW A;  2FRH A;  3KEQ A;  1ZRF A;  1PP7 U;  2PEX A;  2M45 A;  3FXU A;  3KZY A;  3L7W A;  2ZME A;  3H3Z A;  4LD5 A;  3FMS A;  4L0Y B;  2V1U A;  1WWX A;  3M1E A;  1ZG3 A;  5BPI A;  4O3M A;  1D5V A;  3RPQ A;  4AIJ A;  4N9H A;  5E20 A;  3RKY A;  1Z1D A;  1XSX A;  4WX9 A;  2NNY A;  3LA7 A;  2L54 A;  2DU9 A;  3CLO A;  3FXQ A;  2Y0M A;  3CJN A;  4G7O F;  3R61 A;  3VOE A;  5D5X B;  2IRF G;  1I5Z A;  1TQI A;  5JVT A;  3HIF A;  4XBF A;  4WWC A;  4OOI A;  2XKO A;  2A6E F;  3LFK A;  2ISY A;  4L18 B;  1YTY A;  2DLL A;  4M9X A;  1BJA A;  2HTS A;  2IPQ X;  2BV6 A;  3P7N A;  2LNB A;  2Z9O A;  3HUG A;  3HRU A;  4G6Q A;  4U7B A;  4RAY A;  4KFC A;  2PG4 A;  1KYZ A;  4OIQ F;  2P8T A;  1EH6 A;  5L3F A;  4A6D A;  3KEO A;  1MKM A;  3WE2 A;  4RGR A;  5HDG A;  4L5J A;  2M87 A;  4HBL A;  4IJA A;  2OU2 A;  3RTR A;  4KIF A;  4M6X A;  1G3W A;  3C1D A;  1UHM A;  1IXR C;  5ICF A;  4M6Y A;  2FOK A;  2EFQ A;  2HFH A;  4N0B A;  3L2C A;  1J0R A;  2L02 A;  3MQ0 A;  5HDK A;  2GA2 A;  3FM3 A;  2FNP A;  4GYG A;  2LF7 A;  4JK1 X;  3DFG A;  2Q2E A;  3K0L A;  4P9F A;  1O57 A;  3WTY C;  4LG0 B;  4A5M A;  3WOD F;  3C3W A;  3F72 A;  2FU4 A;  4ENM A;  2IA1 A;  1KQ0 A;  1WSU A;  3HTS B;  4KNY A;  1BC7 C;  5LBQ A;  1DPU A;  2PFB A;  3M7G A;  4WXC A;  1STZ A;  4DNC A;  5LHH A;  1IN5 A;  2YSR A;  2UZK A;  2IP2 A;  1HST A;  1KA8 A;  1QO0 D;  3TOA A;  2XKP A;  1FPQ A;  1YLF A;  3ABU A;  3F8M A;  2ADU A;  3TOB A;  3FM5 A;  1RIO H;  3V4G A;  4I98 B;  1J75 A;  5CVR A;  5A2Q Z;  2NNN A;  3CTA A;  1KU7 A;  1O3S A;  5F64 A;  2KIM A;  5F6F A;  4NHJ A;  2MC3 A;  1KQ8 A;  4BHP A;  5DCF A;  1R00 A;  3OV8 A;  4LFU A;  2LKP A;  2RV8 A;  2VT3 A;  2DK5 A;  3WTW C;  4IF4 A;  4MQ9 F;  5K5R A;  1EV7 A;  2QEN A;  2O6G E;  3QAH A;  2HEO A;  2P7C B;  3CUQ B;  5AIP A;  4I7H A;  4AIH A;  1HW5 A;  1JXS A;  5ICC A;  5AON A;  2EFO A;  5K5O A;  2FXA A;  2P6T A;  4WK8 F;  2D45 A;  3QP6 A;  3N4M A;  1FSH A;  1WI9 A;  3JAM K;  4G6D A;  4S04 A;  3L00 A;  2VOD A;  3P9C A;  2PJP A;  2JTV A;  3U2R A;  4ON0 A;  1S29 A;  1FZP B;  2O8X A;  1LEB A;  3WGH A;  2XAS A;  1EH7 A;  2ZJ2 A;  2P7V B;  3TDZ C;  4RS8 A;  1SAX A;  3CUO A;  5FD5 A;  3KP2 A;  3D5L A;  2DQR A;  5TRD A;  4EGY A;  2VXZ A;  3WTT C;  2VC1 A;  5EEG A;  3KZZ A;  5E8I A;  3F23 A;  2OQR A;  4ZZL A;  4HDV A;  5HS7 A;  3HYI A;  4IVN A;  5LGU A;  2E1C A;  2RN7 A;  3JW4 A;  4PGH A;  1GXQ A;  1FYM A;  5E1Z B;  2PLY A;  2W85 A;  3K1M A;  2A69 F;  3K1P A;  1B9M A;  3LAJ A;  1QQI A;  3MEX A;  5E1X A;  2MA3 A;  3QPT A;  2YX4 A;  2YU3 A;  3GFL A;  2W24 A;  4FT8 A;  1HBX G;  3GF2 A;  1F5T A;  5HDN A;  3GO5 A;  2E1N A;  2P5K A;  3V7S A;  3G3Z A;  1FX7 A;  1P92 A;  1GVJ A;  3ZPL A;  1Z6R A;  4U7D A;  4PZJ A;  3DKW A;  4EQQ A;  1R23 A;  5JI6 A;  2KIU A;  4LLG F;  1F1Z A;  1MD0 A;  1CF7 A;  3M8E A;  2R3S A;  2EV5 A;  1DP7 P;  2ELH A;  2HQR A;  3ABT A;  4I01 A;  4HZF A;  2H09 A;  2VN2 A;  4RGX A;  3REO A;  5D6E A;  2FQ3 A;  1PUE E;  2DPD A;  4IPA A;  2KRF A;  2W84 A;  2M30 A;  1BN5 A;  3J80 K;  1B59 A;  1X3U A;  1U5T C;  5CJ9 A;  2L01 A;  1F9N A;  1R1U A;  4U0W A;  5IT3 A;  1DUX C;  2TDX A;  1FWZ A;  4BNC A;  3K2Z A;  4UHT A;  5CVV A;  2MLG A;  2W25 A;  4ENJ A;  5LEJ A;  5DV5 A;  2GQQ A;  3SZP A;  2OZ6 A;  1BI0 A;  4I0A A;  5BMZ A;  5DEQ A;  4TV7 A;  2XHK A;  5HVQ C;  3T0Y A;  2XRO A;  1ON2 A;  4KIC A;  3F21 A;  3I58 A;  5K1Y A;  3MZY A;  4HF2 A;  4A0Y A;  2F5C A;  5FFX A;  1OKR A;  1FYL A;  5CVU A;  2NS0 A;  3K69 A;  3LQR A;  4CXF A;  3B73 A;  2P5V A;  4LB5 A;  3GFJ A;  2EV6 A;  3CUQ A;  3MWM A;  2WTE A;  2FSW A;  2CGP A;  2PN6 A;  2Z3Y A;  5BS6 A;  3BP8 A;  2H6B A;  2ZO4 A;  4O5V A;  5L3E A;  5D4R A;  2GA1 A;  3U1D A;  2GAU A;  2DTR A;  1K6O A;  4L9J A;  5D4S A;  4KMU X;  1K79 A;  5DCM B;  5EEH A;  1XGO A;  2XAG A;  3FF5 A;  3ZMT A;  1MDM B;  4A12 A;  2D1H A;  4M74 A;  3GZ6 A;  2E7X A;  2DAO A;  2EJR A;  3P9K A;  1SFX A;  1TNT A;  3HSE A;  1KGS A;  4WCG A;  3EQL F;  3ZN0 A;  1TW2 A;  2V1D A;  2FF4 A;  3RPU A;  3N97 A;  3CO6 C;  3I4P A;  3PQK A;  3E5X A;  3GLX A;  4LK0 F;  4D0P A;  5CVJ A;  4UNO A;  2PMU A;  1MJA A;  2YR2 A;  2E7W A;  5L3C A;  1AOY A;  3SXY A;  2DT5 A;  3DEU A;  1YS6 A;  4KT5 C;  5BQT A;  2X4H A;  3F6O A;  1J7K A;  2NRA C;  3HRM A;  2Y48 A;  3HHH A;  3F6V A;  1U3E M;  4KA4 A;  2ZME B;  3J81 Z;  3QPH A;  2RQP A;  1SD5 A;  4HA8 A;  5E8G A;  4I09 A;  3IWZ A;  2FA5 A;  2RGV A;  4ASN A;  2CSO A;  2OAZ A;  1NHA A;  4M72 A;  1AWC A;  1QBJ A;  3L09 A;  5FD6 A;  1H9G A;  3IRQ A;  4U0V A;  3S2W A;  3HSF A;  1YW8 A;  4YIF A;  1REP C;  1ZLK A;  3WTU C;  3SFZ A;  3NQO A;  2F5F A;  3JSP A;  2Z99 A;  3GVA A;  2FE3 A;  3MFK A;  4ESF A;  4KN4 X;  1Z05 A;  3ZMS A;  5K5Q A;  3T8R A;  2UXX A;  3MZH A;  2STT A;  1H9T A;  4HQE A;  5LHI A;  1U5T B;  4MTE A;  2EA2 A;  1BBY A;  3ERE D;  2LDU A;  1FBQ A;  1DDN A;  4Z2Y A;  1Z9C A;  1E17 A;  1BI3 A;  4OIN F;  4MGR A;  1ZHF A;  1IN8 A;  3WGI A;  1SMT A;  4AVP A;  4RB3 C;  1SD6 A;  3FWE A;  4HLY A;  2VC0 A;  5H6R A;  2XGX A;  2WV0 A;  1R7J A;  3HRT A;  3I0T A;  2ACJ A;  5D5U B;  1R5G A;  2K86 A;  1QZZ A;  5FO5 A;  4YFX F;  1TBX A;  1YQA A;  2XAF A;  4KIB A;  3P9I A;  2OA4 A;  3I64 A;  4JQF A;  1RNL A;  4LLL A;  4I02 A;  3U9G A;  5E1W A;  3D0S A;  1W7P B;  2KJB A;  3ZQ7 A;  2IA0 A;  4YII A;  2HYF A;  5BOX A;  1U8R A;  1HKT A;  3DPL C;  1JGS A;  4Q48 A;  2UWM A;  1XB4 A;  4N9I A;  2G7H A;  2QLZ A;  3BPV A;  3HTU A;  4UVC A;  1BM9 A;  1TQP A;  2JPB A;  1XGM A;  1UHW A;  4ZYG A;  1QZY A;  3BJO A;  1FT9 A;  1D8K A;  4G7H F;  3KP5 A;  2XIG A;  3PQJ A;  4U88 A;  4XSZ F;  2ESN A;  3COA C;  4HX4 A;  4PGG A;  1ZN2 A;  1HSJ A;  1MJ9 A;  2O03 A;  1LEA A;  2C6Y A;  2K7L A;  2LF8 A;  2EB7 A;  3E5Q A;  4OMY A;  3ZMU A;  4HX7 A;  1ONV A;  1BIB A;  1ZAO A;  5E17 F;  1YS7 A;  1SD7 A;  4P5O A;  5LGN A;  1O7L A;  1FC3 A;  2IA2 A;  3JAM Z;  4CDG A;  2K4J A;  3GWZ A;  4MHG A;  2O3F A;  1T0F A;  3M8F A;  1VTN C;  4KDP A;  4LB6 B;  1IZ1 A;  2MBF A;  4EGZ A;  2K4B A;  1UB9 A;  4CHU A;  2ISZ A;  3FMR A;  2VOO A;  3IWF A;  2D2W A;  1FOK A;  4EJV A;  2VBW A;  3ZN1 A;  3KP6 A;  3GEZ A;  3KET A;  4HF1 A;  2STW A;  4ZYD A;  3HRS A;  4AWX B;  1SD4 A;  5ED4 A;  1USS A;  4A0X A;  1OMI A;  4UVB A;  1LDD A;  2Y75 A;  1UCR A;  2QQ9 A;  4NB5 A;  2OQG A;  4ZYE A;  4P96 A;  5J8F A;  1G4D A;  1J9I A;  3RIR A;  1KYW A;  2V9V A;  3BPX A;  3WTZ A;  1MGT A;  2QZ8 A;  4GYI A;  4A5N A;  4CO8 A;  2D1V A;  3J7A O;  1W4M A;  2J5O A;  3DXJ F;  1KU2 A;  3DF8 A;  4HF0 A;  4EMS A;  1Z91 A;  2MD5 A;  3KCC A;  1H0M A;  5FFZ A;  4Y15 A;  2HYG D;  1DPR A;  3T1B A;  3ISP A;  1R1T A;  3I54 A;  5F1R A;  2BE5 F;  2ESH A;  2YPR A;  2RVC A;  3W6J B;  4LK1 F;  1XD7 A;  2ZKZ A;  4YFN F;  4EJO A;  2UXN A;  5FLX Z;  3R0J A;  5CLS A;  1T6S A;  2IW5 A;  1SFE A;  1S7A A;  3EDP A;  1W5S A;  1WKM A;  5HS8 A;  1J5Y A;  1B9N A;  1QGP A;  3H3U A;  1P4W A;  4O6J A;  3KP4 A;  2BYV E;  1QNT A;  1LDK B;  4MEY F;  1I1G A;  4PDK A;  1K78 B;  5HLG A;  3RYP A;  1S6L A;  1G3S A;  3DV8 A;  1UST A;  3VFZ A;  1FBS A;  1KU9 A;  4HX8 A;  2Q0O A;  1FY7 A;  1G3T A;  5HS9 A;  3OOP A;  5JR3 A;  4L5I A;  4Q4Z F;  5DD4 A;  3JSO A;  2PQ8 A;  1RZ4 A;  1ZG5 A;  2M1B A;  1TTY A;  1MZB A;  2L4A A;  2P5L C;  3T8T A;  5CVI A;  3O2P E;  5ICG A;  5DDG A;  1FNN A;  3GUD A;  4EVI A;  2PBI A;  3V8L A;  1HXD A;  5HOO A;  5DD8 A;  3IL2 A;  2QQB A;  1J59 A;  2H6C A;  1BI1 A;  2HS5 A;  2DQL A;  4OIR F;  4M9S A;  3ZP5 A;  2DK8 A;  3F22 A;  4EV0 A;  1R1V A;  2HOE A;  4MEX F;  5L3B A;  1ZH5 A;  1ON1 A;  3WU0 A;  4NQW A;  1T98 A;  5D6F A;  5D8L B;  2HZT A;  1E2X A;  2XAQ A;  2FBK A;  4G9Y A;  5DCM A;  4QLC U;  1XSD A;  2IVM A;  3HOT A;  6PAX A;  4OMZ A;  2K02 A;  1LJ9 A;  2FBI A;  4RGS A;  4Q47 A;  1FP1 D;  3AAF A;  5J8C A;  2MLK A;  4ETS A;  3SQN A;  3RDI A;  1LDJ A;  2FEZ A;  3R60 A;  1R5H A;  5DYM A;  4R79 A;  1OYI A;  3SZT A;  2J5P A;  3KFW X;  2ZXJ A;  2RC4 A;  1BC8 C;  1W7P D;  1K78 A;  1G3Y A;  4EM2 A;  2KJC A;  5H6Q A;  3TO6 A;  4A0Z A;  1TQM A;  2CWE A;  3QU6 A;  2IT0 A;  3BY6 A;  2CO5 A;  2CW0 F;  1TNS A;  2G7U A;  3WE3 A;  2RNJ A;  2V79 A;  3I59 A;  1IF1 A;  3FHZ A;  4BH9 A;  1YYV A;  2FBH A;  2WC2 A;  1GHC A;  4PCQ A;  4UXN A;  2GIV A;  4HLX A;  4QWQ A;  2O0Y A;  1EH8 A;  3L9F A;  3BZ6 A;  2BBY A;  3KLO A;  1XMA A;  3BJ6 A;  1ZGA A;  4M9Z A;  3EUH A;  5BPD A;  2VBY A;  5HLH A;  4GO1 A;  4K2E A;  3CDH A;  2JPC A;  3C7J A;  1D8J A;  2VE8 A;  4ZH4 F;  3F8C A;  1S7O A;  4AIK A;  3V8K A;  3QP5 A;  4XSX F;  3IRR A;  1B6A A;  4HOB A;  2R7F A;  2QBY A;  1ZRC A;  2AXL A;  1XSV A;  1WQ2 A;  4F7Z A;  2QVO A;  4ZZD A;  5J6X A;  1I6X A;  1D3Y A;  2MH2 A;  2V6C A;  4I0B A;  4L9N A;  2HWV A;  1U78 A;  5DUK A;  2LSO A;  5H20 A;  3LQQ A;  4A6E A;  2FNA A;  2ZBK A;  3IC7 A;  2DPU A;  1F4K A;  4DQ2 A;  3EET A;  5HLI A;  4L9V A;  1CF7 B;  3VOD A;  1RUN A;  2VT2 A;  2A68 F;  2BEO A;  2PMH A;  1V3F A;  5A2Q K;  2GWR A;  2JT1 A;  2ZFW A;  5IT9 Z;  1LNW A;  4RGU A;  4M71 A;  3VB2 A;  1TLH B;  3SHF A;  3WTX C;  4E70 A;  4I2O A;  3DP7 A;  1C0W A;  3RYR A;  1OYW A;  4P55 A;  2QQA A;  3F8F A;  4BQA A;  2QBY B;  4CZZ A;  3CO7 C;  2B0L A;  1U6G A;  2GXB A;  4B09 A;  3GXO A;  1XCB A;  4BAY A;  4XLP F;  4KUM A;  2NAZ A;  4EJU A;  1R36 A;  4FHT A;  2G9W A;  2JSC A;  2RKH A;  5ICE A;  1LVA A;  4Y13 A;  3F3X A;  5JHU A;  1BOA A;  3K9T A;  3E6C C;  2BGC A;  3Q5F A;  1SFU A;  2HR3 A;  1OR7 A;  1YW9 A;  3C18 A;  1LB2 A;  4Y17 A;  4IRI A;  1IXS B;  2PI0 A;  1I1S A;  2EA4 A;  3GFI A;  2H27 A;  2M5W A;  3DPT A;  4L9T A;  5LHG A;  2XV4 S;  3I71 A;  2V1X A;  3ECH A;  1HW1 A;  4RB0 A;  2VON A;  1W5T A;  3QRF F;  3BRO A;  1UFM A;  2WWY A;  2XAH A;  5ILU A;  3IKT A;  3RI4 A;  3F8B A;  1KQ9 A;  2KIF A;  5L3D A;  2EV0 A;  1ULY A;  3DQV C;  1RI7 A;  3V8J A;  4EJW A;  4Q5S F;  1XDU A;  1YG2 A;  3WG9 A;  4BHB A;  1IAW A;  1Z7U A;  4GXO A;  3MAJ A;  4UUV A;  1BI2 A;  4HV5 A;  3O6B B;  5LGT A;  1MJB A;  1SMY F;  3E3V A;  2FML A;  2GXG A;  1S8N A;  2JRT A;  1RUO A;  4UVA A;  1WRJ A;  4ZYH A;  1ZGJ A;  3LWF A;  4IHS A;  2EWN A;  2NYX A;  2COM A;  4GGG A;  4LG0 A;  2Z33 A;  5LEK A;  2A07 F;  4U0Y A;  5LRS A;  2CYY A;  5D5W B;  2QYO A;  4FX0 A;  3TKY A;  4A2U A;  4HV6 A;  1ZAR A;  3QOP A;  3R4K A;  1PDN C;  2A5Y B;  3NEU A;  2F2E A;  3I59 B;  1R22 A;  1IRF A;  2HGC A;  3FX3 A;  4AD9 A;  1HKQ A;  4ENK A;  2M8E A;  2XAJ A;  3BDD A;  3I53 A;  1XDS A;  2GZW A;  2VE9 A;  2AS5 F;  5KK1 A;  3WU1 B;  3FZV A;  4YFK F;  3H92 A;  3WTS C;  1ZG1 A;  4RB2 C;  1XN7 A;  2O61 A;  3V7R A;  2HKX A;  5FB2 A;  3PFI A;  3TO7 A;  4HW0 A;  3KP7 A;  3BOQ A;  3ZMD A;  4CGZ A;  1XGN A;  5LLQ A;  1HW2 A;  1T38 A;  2P6S A;  2ZCW A;  2A6H F;  3RJP A;  3R0A A;  1L3L A;  2VBZ A;  2Q8K A;  4RB1 A;  1XMK A;  1OPC A;  5IT9 K;  1B1B A;  1J2X A;  1JHF A;  3R6S A;  1V4R A;  4MQV A;  3WTV C;  4KYW A;  3EYI A;  1O3Q A;  3VEP A;  1Z6T A;  4HYE A;  5D8K B;  1IN4 A;  4M73 A;  2VOP A;  1P4A A;  3HHG A;  1FLI A;  3K1N A;  2L3D A;  2R7D A;  3ECO A;  3KLN A;  4ESB A;  1P2F A;  5ILS A;  4IRG A;  5DUI A;  5ILV A;  2HDC A;  3LA2 A;  3IHU A;  3G73 A;  4OU0 A;  3NRV A;  3E6B A;  4L0Z B;  1IXC A;  4ENN A;  1YO5 C;  4EM0 B;  5FLX K;  2EFN A;  1T39 A;  2CQK A;  3Q9V A;  3QU3 A;  4R1H A;  4CYD A;  1L0O C;  2OD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...