2M1BA

Solution structure of the chxr dna-binding domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
116
Chain Sequence
b'HSVPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSDDGDKKFSQQDTKLSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein, C terminal family protei
publication title Atypical response regulator ChxR from Chlamydia trachomatis is structurally poised for DNA binding.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Transcription regulator
total genus 14
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m1bA00
3L7WA 2GIVA 3BROA 4Q48A 2OZUA 4EVIA 4AIHA 2VONA 4UVCA 2ESNA 4U7BA 3LA7A 2LSOA 2A07F 4PDKA 2CW0F 4G94A 3HTUA 3BOQA 2L54A 4M72A 2AS5F 4BNCA 5LRSA 3HSRA 3LSTA 3F8CA 1S29A 4YFXF 4Y15A 3LA2A 3I71A 3OOPA 1WSUA 4HBLA 5DYMA 2K4BA 4RGSA 2DBBA 1SD5A 3CLOA 3U9GA 2ZJ2A 1F4KA 1SFXA 5K1YA 4XBFA 2HOEA 5EEHA 3HTSB 2RDPA 3EDPA 3LAPA 5J6XA 3ZN1A 2DQLA 4I98B 2H94A 3FWEA 5E8IA 3JAMK 1YYVA 3LQRA 2D1HA 2PLYA 4G9YA 3I5UA 3V8JA 2JPBA 3H92A 2ISYA 3R6SA 3NRVA 2FBHA 5DEQA 2O61A 5AIQA 2F2EA 3IL2A 2KJCA 4XSZF 1O3RA 2DT5A 4L5JA 1RUOA 3BJOA 2XAJA 2IA1A 1W7PA 5J8CA 3ECHA 3F72A 1XGOA 5ICCA 5L3DA 1LQ1A 2HYGD 1RZ4A 4ZYHA 4AVPA 2D2WA 4A0YA 5ERIA 1KQ0A 3R60A 2XROA 4G7ZF 1IUYA 4K2EA 3WG9A 2CSOA 5LHHA 2ELHA 1G4DA 4A6DA 1R5HA 2DO7A 4R1HA 4I2OA 4MEYF 1R00A 4FX4A 5BS6A 2QWWA 2OQGA 1FZPB 1T0FA 1P92A 2QBYA 2EB7A 3F8MA 2O6GE 1BBYA 3RI4A 2ZXJA 1OYWA 3DPTA 2QBYB 4Q47A 2MLGA 3KP7A 4RB0A 1R22A 4P5OA 1ZGAA 4JQFA 3JTHA 3BJ6A 4PZJA 2FNPA 1K79A 2DK8A 1FYMA 4R79A 1SMYF 4ZZLA 4I01A 2PG4A 4HF1A 4KUMA 4LLGF 5E17F 1I1SA 1JE8A 4GYIA 2XIGA 2MH2A 2W84A 4WX9A 4BQAA 1SAXA 2YR2A 1G3YA 4YIFA 2CO5A 5D8LB 1JHFA 2W85A 2QUFA 3FXUA 1ZARA 1XSXA 1BI3A 4B8XA 1B9NA 4Y17A 1SFEA 1U5TA 2GQQA 1LDJA 1U5TB 5KVRA 5K5RA 4LGWA 2EFQA 4MQ9F 4M74A 2Z9OA 3FXRA 2HZTA 1LNWA 2HYFA 5D5VB 3NEUA 3HIFA 4GO1A 1GXQA 2EA4A 3MAJA 3RJPA 2GZWA 1IZ1A 2M30A 1ZN2A 2HDCA 5ED4A 1LB2A 4BAYA 4HYEA 1FT9A 2MA3A 3R4KA 3RIRA 3GZ6A 4EJWA 2QQBA 2HQNA 3N4MA 2MD5A 2HFHA 3WODF 1HKSA 5HLHA 2IA0A 2Z5UA 1FBQA 4AD9A 3HOTA 3HRSA 1I1GA 5D4RA 4EJTA 4CZZA 1D8KA 5BOXA 4CDGA 2COMA 3ZMZA 2KKOA 2H09A 2DK5A 2OD5A 2FU4A 2QENA 2Z3YA 3RPUA 4IRIA 4LB6B 2XVCA 1IRFA 1J2XA 2G7HA 4KIGA 1LEBA 5L3FA 2WWYA 1XGSA 3WTYC 1FPQA 5H6QA 1G3TA 2A3SA 2MLKA 4RGXA 3J81Z 3ZP5A 1O3QA 2XV4S 1T39A 1YFHA 4G6DA 4UVAA 1IN7A 4LLLA 2YSRA 1XCVA 2LF8A 4BHCA 4KIBA 4ENNA 1RIOH 3SFZA 4PCQA 2E1NA 4MGRA 5DCFA 5DCMA 2PMHA 2GXGA 5DCMB 4OMYA 2XKPA 3O2PE 2H6CA 1YTYA 3ROUA 4P9UA 4G7HF 5CVJA 5TRDA 3MZHA 3LA3A 3ML6A 2MBFA 3E6BA 2F5DA 4G7OF 3R0AA 1XCBA 2RNJA 1Z05A 3K1MA 4FT8A 4KN4X 3W6KB 1YIOA 2XRNA 5DD8A 2BBYA 2A61A 2ZCWA 4A12A 5FB2A 1MZBA 1KU2A 4RB1A 4HLYA 3RKWA 3TO9A 3F23A 4OMZA 3L9FA 1FSHA 2W25A 4N9IA 1STZA 3I4PA 1KU7A 4Y13A 2HEOA 2O03A 4O3MA 1ZHFA 2ZO4A 3T8RA 1SFUA 2Y0MA 2HQRA 2LF7A 3R61A 2P5VA 2A5YB 2VODA 2IVMA 1V4RA 1DP7P 3HHGA 3P9CA 4CHUA 1UHMA 3ABUA 3IC7A 4RB3C 2P6SA 1F5TA 2W57A 5LGNA 1BN5A 3TGNA 4A0ZA 2CFXA 2XGXA 5LEJA 1ZG3A 4EV0A 3COAC 3DPLC 2ETHA 2D45A 3KCCA 4LK0F 3EQLF 5E1ZB 3FF5A 1S3JA 5F64A 2Q0OA 5LHIA 1OKRA 3ULQB 1PP8F 4OIRF 4NB5A 1R1VA 5CLSA 5A2QZ 1J7KA 3BDDA 3PQJA 3RDIA 4IPAA 1W4MA 3WGGA 2ACJA 4HDVA 4A6EA 2RGVA 3IKVA 2BV6A 5D8KB 1OMIA 3B02A 1U78A 4CYDA 3GUDA 1MDMA 3QU3A 1MDMB 4OIOF 3IRQA 2E7WA 4XSXF 4HF2A 2VOPA 1TW2A 1EH7A 2HKXA 1OPCA 2ZMEA 2XKOA 1R5GA 4UV9A 2KIFA 1EV7A 3LQQA 2ZMEB 1D8JA 2RN7A 3WTTC 1GHCA 4L0ZB 5L3EA 1KGSA 1FWZA 5D5XB 1R36A 2V9VA 1YS7A 2F5CA 4P9FA 3KFWX 2OA4A 1FY7A 2A69F 2HWVA 3F8NA 4HF0A 4ON0A 3TO7A 1IXCA 1O7FA 4EGYA 2P7VB 3JW4A 3V7SA 2RQPA 2VN2A 1MJAA 2PFBA 3QAHA 5E8GA 4U0WA 2NAZA 2VXZA 2XAFA 5FD5A 2F5FA 2QZ8A 2KIUA 2XAGA 2IP2A 4BH9A 1W7PD 5DD4A 4HA8A 4XLNF 2XHKA 3QRFF 3I59B 2EV0A 2DPDA 3TKYA 2H6BA 3DFGA 2KIMA 1XMKA 1UB9A 3AAFA 1P4AA 1Z9CA 3KZYA 4CICA 2FSWA 2IW5A 4KFCA 3WGIA 5LEKA 3GXOA 3GW2A 4IVNA 4HV6A 4RAZA 3MQ0A 4ESJA 3CUQC 3E6CC 2TDXA 1YO5C 2G9WA 3ZMUA 4S05A 4EMSA 2IA2A 2M5WA 4WCGA 1Q1HA 1IF1A 3J80Z 3WTUC 5TJJA 4MTEA 4I02A 1FBUA 1FOKA 5LBQA 3MWMA 3IWFA 3T0YA 1HKQA 5LHGA 3ERED 1B59A 1RUNA 3FM3A 3SHFA 4BHPA 5DUKA 4EJOA 4LG0A 2QLZA 5AIPA 1LVAA 4Q5SF 2KRFA 5E1XA 4LG0B 3QOPA 3F8FA 5ICGA 4GGGA 5L3GA 3GEZA 5JR3A 3RYPA 3FMQA 5ICEA 3SZPA 3JSPA 1IRGA 2Y75A 4R8HA 2FMYA 3KP6A 1QZYA 4ESBA 3ZMTA 1I6XA 4RGRA 5BMZA 3QP6A 5BQTA 3IHUA 4M6XA 5F1RA 5HDNA 1YG2A 5D5WB 3BP8A 4U88A 1YS6A 2LNBA 1F9NA 3QP5A 2BGCA 1R7JA 1OYIA 4HV5A 3GWZA 3HUGA 4LD5A 2VBZA 2VBXA 2EA2A 1R58A 1IAWA 3RYRA 3F3XA 3W6JB 5FFXA 3TOBA 4UUVA 2V1UA 1DPUA 2PN6A 3M7GA 4OIQF 5CVVA 4MTDA 4M9ZA 3I53A 3MEXA 2PMUA 1P4XA 2DW4A 4KN7X 1U3EM 2GWRA 2JPCA 3GLXA 5H6RA 3MZYA 3K2ZA 5L3CA 4OOIA 2DFIA 2E1CA 5L3BA 1XD7A 5CVRA 3IRRA 2EFNA 1PUEE 4ZYDA 1MD0A 4BYYA 1ZG5A 3GYHX 3TDZC 4ENKA 5FGMA 5ILVA 3ZMSA 4I0BA 1LDKB 2XAHA 4L9VA 4YIIA 3B73A 3K1NA 1QPMA 3QPTA 2GXBA 1FLIA 1S8NA 4IJAA 5HLIA 2K7LA 1K6OA 4UVBA 3EYIA 4QWQA 3KLOA 1KQ9A 1REPC 4CO8A 3DEUA 2PJPA 1JHHA 1BC7C 4YFKF 2FBKA 2EJRA 4AIKA 1FP2A 2J5PA 2EV6A 3I54A 1HSJA 1IXSB 2HGCA 3KLNA 1R1TA 2P8TA 4IRHA 3KP2A 5D6EA 1TTYA 2L01A 3DV8A 3O3KA 2FRHA 3K9TA 2DAOA 4L9JA 5DUIA 4GYGA 5FO5A 1KA8A 1QBJA 1HBXG 5E1WA 1DUXC 1ON1A 4KT5C 4S04A 1LJ9A 4HX4A 2NNNA 4HZFA 5KK1A 3SQNA 2XUBA 4M71A 1J0RA 3C1DA 3ECOA 2JT1A 5HDKA 4M9SA 4L18B 2ZFWA 3H3ZA 1UCRA 3V8LA 3VEPA 2ESHA 1T38A 5JI6A 4HAMA 4HDUA 5F6FA 1SD4A 3M1EA 4OU0A 3E5XA 4RB2C 1W5SA 2M1BA 1O3TA 2P5KA 1P4WA 2BE5F 4MHGA 3E97A 5DV5A 5D4SA 3KEOA 1FYLA 2FQ3A 2OU2A 5HS7A 3D0SA 3V7CA 5ILUA 1D3YA 1HW1A 3CO7C 4ESFA 6PAXA 1B9MA 5LGUA 2JRTA 4MNUA 4ETSA 1HSTA 1XDUA 1IW7F 3FXQA 2EWNA 5ICFA 1P2FA 1TQIA 3H3UA 3NQOA 1O57A 2VOOA 2MH9A 4H0EA 1G6NA 3C3WA 5JVTA 4HLXA 4MQVA 3HSFA 3KZZA 2PEXA 1T2KA 1GXPA 1QNTA 2IRFG 1FYKA 5H20A 4EQQA 1USSA 3O6BB 3KP5A 5HLGA 1J59A 3DXJF 1S7OA 3L09A 1MKMA 2VBWA 2DQRA 4BXUA 4ASNA 2STWA 1BI1A 4QLCU 2Q8KA 3KETA 1TQMA 4A5MA 1KYWA 3BZ6A 4PGGA 3MCZA 2CGPA 4WXCA 1Z1DA 3P7NA 4M9XA 5CVUA 4CXFA 1EH8A 3WE3A 2BYVE 1USTA 5K5QA 3KE2A 3U1DA 2YX7A 1WKMA 5K5OA 4KMFA 2W24A 1U8RA 1DDNA 3D5LA 1QQIA 3VFZA 2Z33A 3CUQA 2YU3A 4BHBA 4ZH4F 3CUQB 2VT2A 2L4AA 2V1XA 3GO5A 1XMAA 4A0XA 2RC4A 3LFKA 1K7AA 1PDNC 1U2WA 2GA2A 1Z91A 1R1UA 3DF8A 5D6FA 4JBAA 4WK8F 1UFMA 2UWMA 1W5TA 2OAZA 1IN5A 5HOOA 3FMRA 3ZPLA 2FA5A 1BM9A 5HS9A 1H9GA 2BEOA 3F21A 2PI0A 3GX4X 1ZRFA 3CDHA 2IJLA 1MGTA 4KMUX 1B4AA 2UXXA 2B0LA 3V4GA 2M8EA 3K69A 3Q9SA 2VT3A 2VC1A 1XDSA 3GFLA 5FLXZ 4EJUA 4U0YA 2ADUA 2AXLA 2K02A 2CWEA 1ZLKA 2Y48A 3FHZA 4WXDA 4O5VA 3J80K 4AIJA 2K27A 2JTVA 2R7FA 1S6LA 2HS5A 1BOAA 3WU0A 2CG4A 1KU9A 1KQ8A 2WC2A 4JK1X 1QZZA 4N0BA 3KP3A 4FX0A 4LMYA 2GAUA 1FC3A 4L9TA 3I59A 3VOEA 1CF7A 4G8XA 1OR7A 4F7ZA 2LDUA 2YX4A 3TO6A 5LGTA 3HOSA 1CF7B 5IT9Z 3V8KA 3C18A 3SXYA 2UXNA 2X0LA 3DQVC 3F6OA 1TNTA 2A6EF 4O6JA 3TOAA 1HW5A 3HSEA 3OV8A 4EGZA 1S7AA 2DLLA 1MJ9A 1WQ2A 3BWGA 5BPIA 1KU3A 3KEQA 1T98A 4LLNA 3ZN0A 3BY6A 1IN8A 2P4WA 2FEZA 4LK1F 3CUOA 1BI0A 2P7CB 2VE8A 3V7RA 3BPVA 2FNAA 3RKYA 1AWCA 1E17A 3FM5A 4LJZF 4ENJA 2ZNYA 1YW9A 1IXRC 4WWCA 1F1ZA 5CVIA 2DI3A 4IRGA 3PFIA 3CJNA 4GCVA 1G3SA 1ULYA 1B1BA 2JSCA 1FBSA 2Q2EA 3EETA 2P6TA 2O8XA 3S2WA 4A2UA 1NHAA 2QYOA 3E3VA 3FX3A 1OYYA 4IF4A 3ZMVA 1ZRCA 1W7PB 4HX7A 1E2XA 1B6AA 3F22A 3ZQ7A 4DQ2A 1I27A 1RNLA 3GF2A 2R7DA 2HKOA 1VTNC 2Z99A 3E6MA 1O7LA 5FD6A 4EM1A 3EYYA 4CGZA 2V6CA 2UZKA 4M6YA 2VC0A 4KDPA 1ZH5A 2J5OA 4U7DA 4NQWA 1V3FA 2PQ8A 3N97A 2ISZA 2EFOA 3P9IA 4M73A 3JAMZ 5LLQA 3HHHA 2ZBKA 1Z7UA 1XN7A 2FF4A 1TQPA 1SD6A 1WWXA 2HTJA 5J8FA 2V79A 1UHWA 1BI2A 3TDUC 2L4MA 1TNSA 4B09A 3WTWC 4Q4ZF 3R0JA 2V1DA 3ELKA 5JHUA 2IT0A 4AWXB 4TV7A 1AOYA 1HQCA 3T8TA 2DU9A 2OZ6A 2NNYA 4OIPF 2OBPA 3M9AA 3P9KA 3CTAA 2VE9A 5CJ9A 1Y0UA 2EFPA 3T1BA 4LB5A 4RAYA 3DP7A 2M45A 1H0MA 2FXAA 3GFJA 4NHJA 5E18F 3IWZA 5HDGA 3ISPA 3WTZA 1C0WA 1WI9A 1IN6A 1Z6RA 1YLFA 2KJBA 5JFRA 3J81K 2IPQX 2RV8A 3MFKA 4D0PA 1HXDA 1RI7A 2NS0A 2X4HA 3GZ5A 2EFWA 5CYVA 4Z2YA 3BJAA 2YPRA 4I7HA 2G7UA 3M8FA 2QQAA 1DPRA 2XAQA 1ZREA 5HS8A 1ZYRF 1YW8A 2STTA 2JZYA 4RS8A 3LWFA 5FFZA 3SZTA 4A5NA 1ZAOA 2O0YA 1ZRDA 2L02A 4GXOA 1ZG1A 3L00A 1XSVA 4WXHA 3RTRA 1BC8C 4P96A 3GFIA 2XASA 1BIAA 4IHTA 3VODA 1EH6A 1FX7A 2CQKA 3WU1B 3Q9VA 1O3SA 3M8EA 4HQMA 3ABTA 3G73A 4P55A 3KP4A 4YFNF 3T5XA 4IXAA 3EUHA 1YW7A 5IT3A 4YG2F 4ENMA 1TLHB 1H9TA 1PP7U 2M87A 2QM3A 3Q5FA 1P6RA 2P5LC 4PGHA 1X3UA 5EEGA 3K0LA 1ZLJA 4N9HA 2H27A 2OQRA 1JXSA 3L2CA 1LDDA 1YQAA 3E5UA 3E6DA 3IKTA 1IN4A 4EJVA 3WTXC 3CO6C 4EM0B 4RGUA 2ZKZA 5D5UB 2D1VA 3J7AO 4HOBA 1KYZA 1MJBA 1GVJA 4U0VA 4KICA 1A04A 1U5TC 4HQEA 1L3LA 4LFUA 4KNYA 4KA4A 5A2QK 4EM2A 1TBXA 2O3FA 4UNOA 1J75A 3DKWA 1XGNA 3REOA 1J5YA 2WV0A 1U6GA 1J9IA 4I0AA 1G3WA 4UV8A 3I58A 4KIFA 3HYIA 2EV5A 3F6VA 3ZMDA 2K86A 4G6QA 2HTSA 5ILSA 2ZNZA 1HKTA 5E20A 2K4JA 3E5QA 3PQKA 3FMSA 4HX8A 2R3SA 1ON2A 4UHTA 4OINF 1L0OC 2WTEA 1T6SA 4L0YB 1ODDA 2F5EA 2RVCA 2A68F 1TW3A 4DNCA 2C6YA 4FHTA 4ZYEA 5AONA 2PBIA 4ZZDA 4I09A 2FMLA 3HRMA 2HR3A 3HRTA 3JTGA 1WRJA 5FLXK 4XLPF 3BPXA 3LAJA 2FBIA 1R23A 1ONVA 3I64A 1CGPA 4UXNA 3RKXA 1K78A 3FZVA 3VB2A 4KYWA 4MEXF 1XSDA 1I5ZA 1K78B 2DTRA 1XB4A 2GA1A 3WTVC 2E7XA 3RPQA 2DPUA 2NYXA 3C7JA 3HRUA 3WGHA 1FP1D 1D5VA 2LKPA 3WE2A 2RKHA 3I0TA 1HW2A 3QU6A 1BJAA 1XGMA 1BIBA 5LRRA 1FNNA 3F8BA 5IT9K 2FE3A 3U2RA 4L5IA 2EK5A 2VBYA 3G3ZA 5BPDA 2A6HF 4XRFA 3TQNA 2L3DA 2NRAC 4IHSA 4E70A 4ZYGA 2QQ9A 3WTSC 1SD7A 1Z6TA 3JSOA 1QGPA 3GVAA 2FOKA 3GFMA 1FSEA 3K1PA 1QO0D 5HVQC 1SMTA 2MC3A 4WF2A 5DDGA 2CYYA 4HW0A 1LEAA 2QVOA 3QPHA 1ZGJA 4L9NA 1JGSA
chains in the Genus database with same CATH superfamily
4G12A 4XKVA 3S1NJ 1FMWA 3L7WA 3GCMA 4MIMA 1DGRM 2GIVA 3BROA 4Q48A 3VSKA 1ETXA 3QPSA 3S3OA 2OZUA 4EVIA 1IRXA 4PSXA 4AIHA 2VONA 4UVCA 2ESNA 4U7BA 2IGMA 2LSOA 3LA7A 2A07F 1X2MA 4PDKA 2CW0F 4G94A 3HTUA 3BOQA 2V9PA 1ETWA 2L54A 4M72A 2AS5F 2HU9A 4BS9A 3BT9A 4A3FJ 4BNCA 5LRSA 3HSRA 5HLTA 3LSTA 3F8CA 2CV2A 2GXAA 1S29A 3MKLA 5C3EJ 4YFXF 4Y15A 3LA2A 3I71A 1QHHD 1MMAA 3OOPA 1WSUA 3RZOJ 4HBLA 5DYMA 5IPAA 5K7FA 2K4BA 3CZ6A 5IYDJ 2QSHX 3PSIA 1IG7A 1O4XA 4RGSA 2DBBA 1SD5A 2JN6A 3CLOA 2JRMA 3U9GA 4QPOA 1LKXA 2ZJ2A 3BG7A 1F4KA 3W2AA 2DCEA 1SFXA 2WV1A 1WJBA 5K1YA 4XLAA 4XBFA 3QYFA 5J47A 2HOEA 5EEHA 3M8JA 5M5YJ 3HTSB 4BXXJ 2UUZA 3HOUJ 2RDPA 1VQ9I 3BTLA 3EDPA 3LAPA 3FHNA 1SC7A 5J6XA 3ZN1A 2DQLA 5B5EC 5FRNA 2V7FA 3S3MA 2XPVA 4FE7A 2XGDA 3S1QJ 4I98B 2V9KA 1RR8C 2H94A 2L9NA 3FWEA 5E8IA 4KISA 2CFOA 3JAMK 2KP6A 3ZCOA 3HGYA 4BJ5C 1YYVA 3I4NJ 3LQRA 2KZVA 2D1HA 2PLYA 2IXSA 4G9YA 3AG2H 3I5UA 4LITA 3V8JA 2JPBA 1BR2A 2EH3A 3H92A 2ISYA 3R6SA 4C2UA 3NRVA 5GAEJ 2L7ZA 2FBHA 5DEQA 1N78A 2O61A 4QIWN 3BG3A 5AIQA 4DBQA 2R7VA 2F2EA 1OLTA 3IL2A 2KJCA 3TEDA 1MIJA 4HRIA 4XSZF 1O3RA 2Y31A 3QOEA 2DT5A 4L5JA 1RUOA 1G59A 3BJOA 2XAJA 1ZQ3P 1NG6A 1NK3P 2IA1A 1W7PA 5J8CA 3ECHA 3F72A 1XGOA 2KDZA 2Y2ZA 5ICCA 4D7NA 3W2VA 5L3DA 4X6AJ 2VJ5A 1HCRA 4IQJA 2DA1A 5GPCA 2ZMEC 5CKTA 5H2FC 1LQ1A 2WA0A 4EEFG 4XONA 3GBGA 4XRMA 5EYRA 2HYGD 3CF2A 1RZ4A 4ZYHA 2K40A 4PJJA 4D1QA 3QPLA 2D2WA 2M3AA 4AVPA 3MN2A 4A0YA 3A02A 4Y52J 1I3QJ 1RKTA 4KT6A 5ERIA 1KQ0A 3R60A 1GLNA 2XROA 4G7ZF 1IUYA 4K2EA 2RNGA 3WG9A 2DDBA 2CSOA 1BOBA 4II2A 5LHHA 2KDOA 2ELHA 2QF7A 1G4DA 2M0MA 2VJIA 1R5HA 2DO7A 3CDIA 4A6DA 4UUSA 4R1HA 4I2OA 4MEYF 1R00A 4RM2A 1JT0A 1FIPA 5FKKA 4UUSB 4BBSJ 4FX4A 1XX5A 5BS6A 2QWWA 2OQGA 1R71A 1FZPB 3LMMA 5LFAA 1T0FA 1P92A 2QBYA 2EB7A 3F8MA 2O6GE 1BBYA 2K9LA 3RI4A 3IH4A 2KFDA 2ZXJA 1WVRA 1OYWA 3DPTA 2QBYB 4Q47A 1R6RA 2MLGA 3KP7A 4RB0A 1R22A 4P5OA 5J1YA 2Z16A 1ZGAA 4JQFA 3A01A 4B43A 3JTHA 4M3GA 2TRTA 3BJ6A 2LKSA 4PZJA 2FNPA 1K79A 3OS1A 2JA7J 2DK8A 2F5VA 3DBHB 3A01B 2BY1A 1FYMA 4R79A 1SMYF 4ZZLA 2H8RA 4I01A 4B48A 2OTLI 2BXZA 2PG4A 2EZHA 2LBFA 2CUJA 1S7EA 4HF1A 3HPGA 4BY1J 4KUMA 1BA5A 4LLGF 2R7OA 4CZCA 1ITYA 5F1JA 4LIVA 3NWTA 5E17F 1I1SA 1JE8A 3AL0C 4GYIA 1X58A 2XIGA 2MH2A 2W84A 1HOMA 4WX9A 3G2BA 5IP6A 4E7LA 4XOPA 1SAXA 4BQAA 3TMOA 2YR2A 3TBIA 3A1YA 4ITVA 1G3YA 1WPKA 4YIFA 2CO5A 3GMEA 5D8LB 4UB6C 1JHFA 1UHSA 2W85A 5JVGF 2MG4A 2R7ZJ 2JSPA 2QUFA 3FXUA 1BW6A 1NG7A 1ZARA 2VB6A 1XSXA 3F0CA 1V5FA 3OL4A 1BI3A 4B8XA 1B9NA 4Y17A 1Y56A 1SFEA 1U5TA 2A5WA 3AG4H 4E7IA 5HNHA 5FRMA 2GQQA 1LDJA 3CCLI 1IDZA 1U5TB 5KVRA 5K5RA 4LGWA 2EFQA 1WJDA 4MQ9F 1E3OC 3LSGA 2EIJH 4M3DA 4M74A 4CYCA 2Z9OA 3FXRA 2VJJA 2HZTA 1LNWA 2HYFA 5D5VB 2CRGA 3NEUA 1T8IA 1MMSA 1JUPA 2KPMA 3HIFA 4GO1A 5EEAA 1X2NA 3HPHA 1GXQA 5FROA 2X6OA 4DBRA 4IOCF 3S1RJ 1TC3C 5FLVA 4V2FA 2EA4A 3MAJA 3RJPA 2ZC2A 1DP3A 2GZWA 2COBA 1IZ1A 2DT7B 2M30A 4D7MA 4AVZA 1ZN2A 2HDCA 3ZGKA 5ED4A 1LB2A 4RAFA 4HEA2 4BAYA 4HYEA 3HGGA 2BZTA 1DU6A 1FT9A 1YE9A 2MA3A 2HXOA 3R4KA 3RIRA 3GZ6A 3A2KA 3JRGA 4NUBA 3K6GA 4EJWA 1PYVA 2QQBA 1WI3A 2HQNA 2XSDC 3N4MA 1FTZA 2MD5A 2HFHA 3WODF 1HKSA 5HLHA 1X1DA 4W97A 1FOYA 2M4KA 1LUJB 4F52A 2IA0A 2CQNA 3NARA 2XPWA 2Z5UA 5EGOA 1FBQA 4AD9A 1MBJA 2VKDA 1LE8B 3HOTA 3CP8A 3HRSA 1I1GA 5D4RA 3FK7A 4EJTA 1IGNA 4CZZA 1D8KA 5EGOB 1OISA 3KIOA 4CDGA 5BOXA 1W36D 4XICA 3GTGJ 2AQFA 2COMA 3ZMZA 4UUTA 2EILH 2KKOA 2H09A 4DOZA 4A3BJ 2DK5A 2OD5A 2FU4A 2QENA 2Z3YA 5BNGA 3RPUA 4IRIA 4LB6B 2XVCA 3OYDA 1IRFA 1UAAA 4A3MJ 1J2XA 3L2QA 2G7HA 1FMVA 3VYSB 4KIGA 2DOFA 2FUG2 1LEBA 3I55I 5L3FA 2WWYA 1A5JA 1XGSA 3WTYC 4A3KJ 1FPQA 5H6QA 1G3TA 2Y9ZA 3ZRGA 2A3SA 2MLKA 4RGXA 4BDZA 5DTDA 3J81Z 3K2AA 4D5FA 2CQXA 3ZP5A 1O3QA 2XV4S 1T39A 1YFHA 4G6DA 1X3ZB 3G1OA 4BXFA 4UVAA 1IN7A 4LLLA 2YSRA 1XCVA 2LF8A 4BHCA 4A3JJ 3CD6I 1V54H 4KIBA 4RA2A 2DYSH 4ENNA 1RIOH 3SFZA 2JUCA 4PCQA 1WH5A 3HJEA 1MBFA 2E1NA 2ELJA 4MGRA 5DCFA 3S15J 3MKZA 5DCMA 2PMHA 3JCUC 2GXGA 3PO2J 1ZK8A 5DCMB 3E1SA 1QPIA 4OMYA 2XKPA 1U0JA 3O2PE 3CCRI 1XTAA 4BACA 3ZQFA 2H6CA 4ZJZA 1YTYA 2M7BA 3H9QA 2BY2A 3ROUA 4P9UA 4G7HF 5CVJA 5TRDA 3MZHA 2CV1A 3LA3A 3ML6A 2MBFA 3E6BA 3GTLJ 3C2BA 2F5DA 4G7OF 3R0AA 1XCBA 2RNJA 3HM5A 2EINH 3PSFA 1Z05A 3K1MA 3CCUI 4ZDOA 4AUXA 4FT8A 4KN4X 4DJAA 3W6KB 4AC0A 1YIOA 2XRNA 3ASOH 5DD8A 2BBYA 2A61A 1RR7A 2ZCWA 4A12A 2VIXA 5FB2A 1MZBA 1KU2A 1SFOJ 4RB1A 2XGCA 2QSGX 4HLYA 3RKWA 5EDNA 5GTHC 4P1WA 2LY1A 3MZ8A 3ERMA 3TO9A 4YIRX 3F23A 4OMZA 3L9FA 1FSHA 2DXIA 2W25A 4N9IA 1STZA 3I4PA 4BE1A 4Y13A 1KU7A 2HEOA 3OIOA 2O03A 4O3MA 3FDYA 1ZHFA 2ZO4A 5K7ZA 3T8RA 1SFUA 3K4KA 2Y0MA 2HQRA 2DFHA 2DFEA 2LF7A 1D0XA 4YELA 2XRLA 3OS0A 3R61A 2P5VA 2A5YB 1ORKA 4C9YA 2VODA 2HDDA 2IVMA 1V4RA 1DP7P 3HHGA 3K4CA 3P9CA 4U87A 4CHUA 1UHMA 5C4XJ 5KHDA 3ABUA 1VQ6I 2ECBA 4PFOA 3K70C 1ZR2A 3S3NA 2MYSA 3IC7A 4RB3C 3HOZJ 3G6EI 2P6SA 3K4MA 2LR8A 3B6CA 2WAFA 1F5TA 4IEJA 2W82A 2VI6A 2QKLB 1Z3YA 2LTPA 3J7YJ 4AIDA 2W57A 3GTPJ 2DODA 4XRSG 5LGNA 1BN5A 3TGNA 4A0ZA 2CFXA 2JQ7A 2XGXA 3ZXSA 2HI3A 4PFPA 5LEJA 1ZG3A 2FX0A 4EV0A 3COAC 3DPLC 2ETHA 2D45A 3KCCA 3M4OJ 4LK0F 3EQLF 5E1ZB 3FF5A 1S3JA 1X1BA 5F64A 4DZJA 2Q0OA 4YRVA 5LHIA 1OKRA 4C3JJ 3JR9A 3ULQB 1TWHJ 4NC8A 1A36A 1WHUA 3JRAA 1PP8F 2IS2A 1FEXA 2VUMJ 4OIRF 3PIOF 3BQZA 4NB5A 1R1VA 3FBIB 1ZTRA 5CLSA 4JOMA 5A2QZ 1J7KA 4A69C 3BDDA 3PQJA 2L5QA 3RDIA 1K6YA 3B6AA 1IV6A 2L7KA 4IPAA 1W4MA 3WGGA 4XLCA 2ACJA 4HDVA 3K10A 5EZHA 5HODA 2CUZA 4A6EA 2DOAA 4F55A 2NOJB 3OYEA 2RGVA 3IKVA 2H8WA 4C30A 2BV6A 5D8KB 2E2JJ 1OMIA 3IUOA 3BR3A 3B02A 1WCMJ 1U78A 2D5VA 2R4GA 4CYDA 3GUDA 1MDMA 2OPTA 2FQ4A 4Z6YA 3QU3A 5CPRB 4JX6A 3S8PA 1MDMB 3H5NA 1Y1VJ 4OIOF 2I5UA 3IRQA 2E7WA 2K85A 2QSFX 4XSXF 4HF2A 2WAEA 3SEQA 2X48A 3WG7H 4B3XA 2VOPA 2LRDA 1TW2A 1EH7A 1IV8A 2HKXA 1D1CA 3CC4I 1H89C 3S2DJ 1OPCA 3S16J 4E6KG 1OFCX 3MD2A 2ZMEA 2NVQJ 2W48A 2XKOA 1R5GA 3SJMA 4UV9A 3E7LA 2KIFA 1EV7A 2V1NA 3LQQA 2ZMEB 2MW8A 1D8JA 2RN7A 2CQ7A 3CCMI 3WTTC 1GHCA 4CA0A 2GM4A 4L0ZB 5L3EA 3IAS2 1KGSA 1VQPI 3OYIA 1FWZA 2OTJI 2WB1A 3I4MJ 1UG2A 5D5XB 1R36A 2V9VA 1YS7A 2F5CA 1X1AA 4HSRA 4P9FA 3KFWX 2OA4A 1FY7A 2A69F 4J01A 2HWVA 2KT0A 2R7SA 1ENHA 3F8NA 4HF0A 1R49A 4ON0A 3TO7A 1IXCA 3J7AY 1O7FA 2K3FA 4EGYA 1OCRH 3FKIJ 2CS3A 2P7VB 3JW4A 2QKMB 1V5GA 2RQPA 2VN2A 3O8GA 3V7SA 4JX4A 1MJAA 2PFBA 3QAHA 3CCQI 3N05A 5E8GA 4U0WA 2B63J 2NAZA 2VXZA 2XAFA 3KYCB 5FD5A 2F5FA 1JJ6C 2QZ8A 3BR0A 2KIUA 2ZSIB 2XAGA 2XAUA 2HYJA 2IP2A 2DA7A 4BH9A 2CV0A 2Y69H 2E2HJ 5EF6A 1W7PD 3IV5A 2H1LA 3HDDA 3SDGA 1RKWA 5DD4A 4HA8A 2HVRA 1HDPA 4ABZA 4XLNF 2XHKA 5B1BH 3QRFF 3I59B 1WJCA 2EV0A 2DPDA 4LIUA 3GTJJ 1YITI 2VQLA 2X6YA 2H6BA 3TKYA 2OCCH 3DFGA 2KIMA 1XMKA 5IY5H 1UB9A 3PNVA 4XIDA 3AAFA 1AU7A 1P4AA 1Z9CA 1Z67A 3KZYA 4CICA 2HVQA 2LVSA 2ZJRF 2FSWA 2IW5A 4KFCA 2FD5A 4I99C 3WGIA 3DBLB 4AM3A 5LEKA 1D0YA 1ETVA 3GXOA 3DU6A 3GW2A 3AL0B 3BTCA 3K4NA 4IVNA 1LFUP 4HV6A 4E7SA 4RAZA 3MQ0A 3HOXJ 2LKXA 3DTKA 3BCBA 3CUQC 3QQAA 4ESJA 4DW6A 3E6CC 2TDXA 1YO5C 2G9WA 4E4HA 3ZMUA 3IAM2 3GZNB 1PJRA 2E1MC 4S05A 4EMSA 2IA2A 1XC5A 2M5WA 4OAZA 1APLC 3ZQHA 4WCGA 1T56A 1GV2A 1KONA 2R0QC 3ZQCA 1NH3A 2HOTA 1Q1HA 3TW6A 2R93J 1IF1A 3J80Z 3WTUC 5TJJA 2R7XA 4MTEA 4I02A 1FBUA 4MFDA 1FOKA 5LBQA 3MWMA 3IWFA 1VQMI 4XR6A 5B1AH 1MNEA 3T0YA 3CMAI 1HKQA 2BY0A 1B59A 3BC8A 5LHGA 3ERED 3OWTA 1YOVB 1RUNA 3FM3A 3SHFA 5F0FA 2E5NA 2JK3A 4BHPA 1HA8A 5DUKA 4EJOA 4LG0A 2QLZA 3RSNA 5AIPA 1LVAA 4Q5SF 2KRFA 5E1XA 2DOEA 2DN0A 4LG0B 3OOUA 3F8FA 3QOPA 5ICGA 4GGGA 5L3GA 4KITB 2AHQA 4LOCA 3GEZA 3M3YJ 3HEFA 5JR3A 3J7ZI 2KHMA 3RYPA 3FMQA 3CCJI 5ICEA 2NXNB 1JT6A 2Z1DA 4M3FA 3OYAA 3SZPA 3JSPA 1IRGA 2Y75A 4R8HA 4QSHA 3RCOA 2FMYA 3KP6A 2V6EA 1QZYA 4NDLA 1ETKA 3ZMTA 1I6XA 4ESBA 3Q0VA 4RGRA 2M2EA 4XORA 5BMZA 4GDFA 4BQNA 3QP6A 3ZQGA 3P5JA 5BQTA 4XRSA 4NC6A 1JKOC 4CUGA 3IHUA 2DA4A 1XMXA 1S5LC 4M6XA 1TZLA 4W1UA 1F36A 5F1RA 5HDNA 2LP0A 2DFFA 2CUEA 1R9TJ 2E5ZA 2LFBA 1YG2A 5D5WB 2ZFUA 3BP8A 4U88A 1BR4A 5EJCA 3CDLA 4PJLA 1MMDA 5KAIC 1HDDC 2VASA 1YS6A 2LNBA 4HNUA 1F9NA 3GTKJ 3QP5A 2JA5J 4HNVA 2AO9A 1R7JA 3BTJA 2BGCA 1OYIA 2JA8J 3OMYA 2DMPA 1IJWC 4HV5A 4YEJA 3GWZA 3HUGA 2QA4I 1YI2I 4LD5A 5EG0B 2VBZA 2YUSA 4C3IJ 2NS8A 2X9DA 1K4SA 2VBXA 2EA2A 3HUGB 1A6IA 1R58A 2Z2SB 1IAWA 4C3HJ 3RYRA 2ME6A 5FKNA 1OR7C 3F3XA 3PUFA 2E2IJ 3W6JB 5FFXA 3MMYB 3H9GA 4X1EA 3TOBA 1YIJI 4UUVA 2V1UA 1DPUA 4DGWB 2I10A 2PN6A 3M7GA 1R4MB 4OIQF 2EQRA 5CVVA 4MTDA 4M9ZA 3I53A 3MEXA 2LY9A 2PMUA 1P4XA 4RDUA 2DW4A 4KN7X 3OL3A 4ZC3A 1U3EM 2GWRA 1FJLA 2JPCA 3GLXA 3DCFA 2P81A 3S17J 2BW3B 5H6RA 3MZYA 4XKBA 2WB1N 3K2ZA 5L3CA 4OOIA 1W1WE 3CESA 2EZIA 3OSGA 2M34A 4IHWA 2DFIA 2E1CA 2W4SA 5L3BA 1VQ7I 5JLWA 4QTRA 3TP0A 2BVLA 1XD7A 5CVRA 3IRRA 2EFNA 1PUEE 2RREA 4ZYDA 3G1MA 1QVTA 1MD0A 1MMGA 4BYYA 1ZG5A 3U21A 3LSRA 3GYHX 2LD5A 2L9VA 3TDZC 4ENKA 5FGMA 5ILVA 3OYKA 3O8HA 3ZMSA 3BCAA 4I0BA 1LDKB 2LC2A 2XAHA 1XG1A 4D9JA 2AQEA 4L9VA 4YIIA 3RPUD 3B73A 3K1NA 4XLHA 1EF4A 3V42A 1QPMA 3QPTA 1OCCH 2GXBA 1FLIA 2XC7A 2M8GX 1S8NA 3JRIA 4IJAA 5HLIA 1Y1WJ 2K7LA 3FXJA 4UVBA 3OYGA 1K6OA 2VKEA 5CQEA 3EYIA 1J09A 3PM1A 4QWQA 4BQOA 4C2MJ 3JREA 3KLOA 1KQ9A 3LNQA 2HPIA 4CCLA 1REPC 4CO8A 2L7MP 1K61A 2Y0SN 4B47A 3DEUA 2CU7A 4BY7J 2PJPA 1JHHA 1UG0A 1BC7C 1RESA 1VQKI 4YFKF 2FBKA 2ID3A 2GOXB 2EJRA 2KL4A 3HKZA 4PJMA 4AIKA 1FP2A 4MO7A 2J5PA 3FXLA 3WU2C 2EV6A 3I54A 1HSJA 1MBHA 4XLFA 1OCZH 1VQNI 3DPUA 3PO3J 1UZCA 1IXSB 2HGCA 2NVUB 3KLNA 5IOZA 3D5SC 4Y33A 1W0UA 3CC2I 1R1TA 2P8TA 4BJTA 5EZGA 2VQCA 4IRHA 3KP2A 2O9LA 3EPZA 5D6EA 1TL8A 1LE8A 3UNGC 1TTYA 2L01A 4A3EJ 1UMQA 1VF9A 3DV8A 1Y8QB 2BVMA 5B3SH 1MBGA 3O3KA 2FRHA 2F6CA 4OAYA 5GAHJ 3K9TA 5IYCJ 4BKXA 5IOYA 3ASNH 2QCOA 3VWBA 3BQYA 4GRIA 5F08A 2DAOA 4OWRB 5GAGJ 1E3HA 4L9JA 5DUIA 4GYGA 5FO5A 1KA8A 5F04A 4CH7A 1K4TA 1QBJA 4DYCA 1HBXG 5E1WA 1DUXC 1ON1A 4KT5C 4S04A 1SVLA 4RAGA 1LJ9A 2W1OA 2NNNA 4HX4A 1I3AA 1B72B 4HZFA 3DKYA 2CH0A 3NWSA 5KK1A 3SQNA 1OCTC 3OYHA 1U9OA 1LVKA 2VL8A 2XUBA 4M71A 1J0RA 5GTIC 1MMNA 2R5YA 3C1DA 4M6VA 5J40A 3ECOA 3QODA 3L2VA 4IHXA 2WY7Q 1RETA 2R5YB 2E60A 2JT1A 3PNYA 5HDKA 4M9SA 4L18B 1ETYA 2ZFWA 4E7JA 3RQ4A 5LD2C 1JUMA 3H3ZA 1UCRA 3V8LA 3VEPA 4RMNA 1WZ2A 3FKJA 2ESHA 3OYJA 1T38A 2HQ5A 1JTXA 1TT0A 1S72I 2HZDA 5JI6A 4HAMA 4HDUA 1OCOH 5F6FA 5M3MJ 3OIPA 2XB0X 1SD4A 3M1EA 4OU0A 3E5XA 4RB2C 3JRBA 1W5SA 2M1BA 1V55H 3BR1A 3G1LA 1O3TA 2P5KA 3PIPF 1UJ8A 1P4WA 2M0CA 1CQTA 2BE5F 2NVTJ 4MHGA 4FE4A 3E97A 2IGOA 5DV5A 5D4SA 4BUPA 3OYMA 2DMQA 3G71I 2NVXJ 3KEOA 4X0GA 1FYLA 2FQ3A 2OU2A 5HS7A 3D0SA 1Z0XA 3V7CA 5ILUA 1D3YA 1DU0A 1ERDA 1HW1A 3CO7C 3PJRA 1V5EA 4ESFA 2GBYA 6PAXA 2JA6J 1B9MA 5LGUA 2NOGA 2JRTA 4MNUA 2K9QA 4ETSA 1D0ZA 5FJ8J 2XDVA 3CC7I 1HSTA 1U9NA 1XDUA 3IH2A 1IW7F 2DYRH 3SYTA 3BG6A 2EWNA 2E36A 3FXQA 5ICFA 3TP3A 1P2FA 1TQIA 3H3UA 2N8GA 1O57A 3NQOA 2VOOA 3H3VK 2RQQA 3WHCA 4AU7A 2MH9A 1TT5B 4H0EA 1G6NA 3CQZJ 3JRFA 1MNDA 3C3WA 3I9V2 5JVTA 5F0HA 4HLXA 4MQVA 4F3QA 2R7WA 3AG3H 1B8IA 3H1CA 3HSFA 3KZZA 2LG4A 2PEXA 1T2KA 3SZGA 2XGEA 2X6XA 1GXPA 1QNTA 1B8IB 2IRFG 3LSPA 1FYKA 5E3NA 4A93J 4DZPA 1JJ8C 5F0CA 5H20A 4EQQA 2E34A 2B7EA 4XLEA 2JVHA 1USSA 3O6BB 3KP5A 5HLGA 1J59A 2JMWA 5M5XJ 3DXJF 5CQGA 3A03A 3TW7A 5IYBJ 5J1RA 1S7OA 1YJWI 2XF5A 3L09A 1MKMA 2VBWA 2DQRA 4RM3A 4BXUA 3CCEI 2BHZA 2HPMA 2F48A 2L0KA 2GOMA 4ASNA 2STWA 1BI1A 3KYDB 2LMDA 4QLCU 3LSKA 5E3MA 2X1CA 3MVPA 2FOWA 2Q8KA 2UV1A 3KETA 2XF6A 1TQMA 4A5MA 1KYWA 1WJEA 3U1KA 1G8XA 3BZ6A 1ZELA 3SEZA 4FASD 4PGGA 4BEHA 3MCZA 2CGPA 4WXCA 1Z1DA 3OYCA 3OYBA 3P7NA 2IS1A 4M9XA 1RPWA 4FCYA 4BEHB 5CVUA 4CXFA 1EH8A 3WE3A 2BYVE 2RAEA 1USTA 5K5QA 3KE2A 4S0HB 3U1DA 3C2GA 3Q0UA 5F27A 2YX7A 1WKMA 1VI0A 5K5OA 4KMFA 2W24A 1GV5A 1U8RA 1DDNA 1VQ8I 1QA6A 3EUHC 3D5LA 1QQIA 2O5RA 3VFZA 2Z33A 3RQIA 3ZQLA 3CUQA 1K83J 3HKZN 4C2TA 2YU3A 1WJ5A 4PSWA 4BHBA 2LH9A 4ZH4F 2OC6A 4A3IJ 3CUQB 5E3LA 2MGQA 3DBRB 2VT2A 2L4AA 2V1XA 1QZEA 4HG2A 2E1MB 3OYNA 2F4MB 3RKQA 2R7TA 1A35A 4JYKA 2WAQA 4IHVA 4BE2A 4BBRJ 3BG9A 3GO5A 1XMAA 2O7OA 3PUBA 4ZYAA 4A0XA 1TWCJ 5FKMA 4NBQA 2RC4A 2VKHA 3LFKA 4ZTFA 1K7AA 2A05A 1PDNC 1U2WA 2GA2A 5J4VA 1Z91A 2K9NA 4II3A 1H8AC 1R1UA 3DF8A 5D6FA 1ZR4A 3A0BC 4JBAA 4WK8F 1UFMA 2V26A 2UWMA 1M1EB 1W5TA 2OAZA 2XF7A 1IN5A 5HOOA 2GIZA 3FMRA 3I3LA 4RLQA 2FA5A 3ZPLA 4IX7A 3WHBA 4XMYA 1E0EA 3F9KA 2ZJPF 2DT6A 1BM9A 1X19A 3ONQA 1W36C 1IDYA 3L2UA 1WH7A 4N4NB 1YJ9I 5HS9A 1H9GA 2M4GA 2BEOA 3F21A 2PI0A 3GX4X 1ZRFA 3CDHA 2IJLA 1MGTA 2WY8Q 3BR5A 2K9MA 4KMUX 1MW7A 1B4AA 2UXXA 2B0LA 3V4GA 2R7UA 2M8EA 3K69A 3Q9SA 2VT3A 2O8KA 3PFYA 3DKXA 1MH3A 3FXKA 2VC1A 1MSFC 1XDSA 3GFLA 1R4NB 4EJUA 5FLXZ 4U0YA 2DA6A 4E7HA 1OJLA 2ADUA 2AXLA 2K02A 2CWEA 3CF5F 1ZLKA 2EPFA 4XKCA 4CCOA 2Y48A 3AFHA 3FHZA 1EKEA 3H35A 1SVMA 4WXDA 1VQOI 3FK6A 4O5VA 1FIAA 3J80K 3MKWB 2K27A 5C4JJ 4AIJA 2JTVA 5HNFA 2R7FA 3OR2C 4B4CA 3EUKL 1VQ4I 1S6LA 2HS5A 4IO9F 5GP9A 1BOAA 3WU0A 2CG4A 5DM6F 1KU9A 5FKLA 2HVSA 2OCEA 1PVEA 4IQ4A 1KQ8A 2WC2A 4HPQA 4DYQA 4JP0A 4V2GA 2H1KA 2JWTA 2QQ8A 2KQRA 4JK1X 1QZZA 4N0BA 3KP3A 4FX0A 4FQGA 4LMYA 3ZOBA 4F93B 2M7AA 4E7KA 2GAUA 2Y0SA 5IP9J 1S9HA 3D1NI 1FC3A 3LSMA 3I59A 4L9TA 1X3WB 1HLVA 3VOEA 3UKGA 2YU9J 3RZDJ 3JRHA 1CF7A 1X1CA 4G8XA 1OR7A 4F7ZA 3BR2A 2LDUA 3W2WA 4CCMA 1PUFA 2MFZA 1ACIA 3KZIC 2X85A 2YX4A 3TO6A 5LGTA 3HOSA 1CF7B 5IT9Z 3V8KA 1PUFB 3C18A 5FKOA 3L2RA 3SXYA 2UXNA 2X0LA 1H88C 9ANTA 3S1MJ 1BJZA 3DQVC 5GADJ 3F6OA 4B44A 2WBMA 2AXTC 2K5CA 1TNTA 2A6EF 1VFCA 4CCJA 1P9QC 4O6JA 3TOAA 1HW5A 3HSEA 3IP4B 3OV8A 4EGZA 4A3LJ 1S7AA 2DLLA 1MJ9A 1UELB 3VPRA 1WQ2A 3AKZA 3BWGA 3FIWA 4B1RA 2QEXI 5BPIA 1KU3A 3KEQA 1GDTA 1T98A 4LLNA 3HBLA 2LREA 4XL9A 3TL4X 3ZN0A 2MSYA 3BY6A 1IN8A 1I6HJ 1YX3A 2P4WA 5E79C 1OCPA 3DTEA 2VPRA 1VZ0A 2FEZA 4LK1F 3CUOA 1TP4A 1BI0A 2P7CB 2VE8A 2Y30A 3V7RA 1JTYA 2ELKA 2JJ7A 2MD0A 2FNAA 3BPVA 3D5RC 3RKYA 1AWCA 2ZJQF 1E17A 3FM5A 4LJZF 3ABLH 4ENJA 2ZNYA 2HQAA 5DM7F 1YW9A 3DLAA 1IXRC 2IBDA 4WWCA 2E1OA 4E7ZA 1F1ZA 1OQYA 1SEUA 5CVIA 4CSWA 3BZCA 2DI3A 4IRGA 3LSJA 3PFIA 1YJNI 4QPQA 3CJNA 4GCVA 1G3SA 1ULYA 4ANJA 1GUUA 1B1BA 1GVDA 2JSCA 2XSJC 1A6QA 1FBSA 2GLOA 2Q2EA 3EETA 3K4LA 3LFUA 2P6TA 3W3CA 3HOYJ 2O8XA 3G4SI 2X1DA 3S2WA 5K7HA 1SFKA 1D5YA 2LK2A 2DMTA 3CJTB 3A4CA 2TCTA 2Q2EB 2DA2A 2E19A 4MLOA 2KISA 3EUAA 4N4OB 4GFBA 2HOAA 1U8BA 4A2UA 1P7IA 1JKPC 4NNJA 1NHAA 2QYOA 3E3VA 3FX3A 4AYBN 1OYYA 4H4KC 4D5CA 3H0GJ 4IF4A 4PJNA 2E35A 3S32A 3ZMVA 1ZRCA 1W7PB 4HX7A 4F91B 1E2XA 3HL2A 5FLMJ 1JKRC 1B6AA 3ZQ7A 3F22A 4DQ2A 1I27A 1RNLA 1TWFJ 1T08B 3GF2A 4ZDLA 4J00A 2R7DA 2HKOA 1D1BA 3HOWJ 1VTNC 3HOVJ 4BL0B 3VYUB 2Z99A 3C2HA 3E6MA 2CW7A 1O7LA 1GT0C 2IGNA 4I76A 4EM1A 3EYYA 4M3BA 2V6CA 5FD6A 2UZKA 4CGZA 4M6YA 2VC0A 3K4BA 4KDPA 1T33A 3LL7A 3OYFA 1ZH5A 4PJ0C 2J5OA 5J1UA 1HC8A 4U7DA 2WAQN 2VKVA 2L2OA 4NQWA 1V3FA 2PQ8A 5EG0A 2KZGA 3N97A 2ISZA 2EFOA 3P9IA 4M73A 2BOLA 3JAMZ 5LLQA 3KYLA 3HHHA 2ZBKA 4NQWB 5JHFA 1Z7UA 4IOAF 5KCMA 3L1PA 1XN7A 2FF4A 4BGDA 4RLFA 2HXIA 1TQPA 1SD6A 1WWXA 2HTJA 2JVGA 2V79A 5J8FA 4KJZA 1UHWA 1BI2A 4FISA 3TDUC 2L4MA 3JRCA 1TNSA 4B09A 3WTWC 4Q4ZF 3R0JA 1LFBA 1JI8A 2V1DA 1Y39A 3UR3C 3ELKA 3S93A 5JHUA 2IT0A 4AWXB 2DA5A 4TV7A 1JKQC 1AOYA 4Y3OA 4I6ZA 1HQCA 2BW3A 2DU9A 4PK4A 3T8TA 2IAIA 3SFIA 2OZ6A 2EIKH 2IEKA 4FTHA 2NNYA 4OIPF 3M07A 2OBPA 4BDYA 3H9JA 3PNTA 3M9AA 3P9KA 3OY9A 3CTAA 4BU2A 1XS9A 2LBFB 2K9SA 3CMMA 4IHYA 3K70D 1SVOA 2VE9A 5CJ9A 1Y0UA 2EFPA 1Z21A 2XPUA 3T1BA 2X1EA 4DYRA 4LB5A 2BY3A 2ZB9A 4RAYA 3DP7A 2M45A 1H0MA 4IL6C 3FISA 2FXAA 3GTOJ 1MBKA 3GFJA 1IC8A 4NHJA 2ZSHB 5E18F 2EZKA 1VQLI 3IWZA 5HDGA 2CMPA 1BL0A 3ISPA 3WTZA 1C0WA 4M3EA 2OUMA 1WI9A 2R92J 1IN6A 1Z6RA 1BW5A 1MBEA 5TISC 1YLFA 2KJBA 2I8DA 3K7AJ 3CLQA 2PX9A 5JFRA 3J81K 2IPQX 2V4JC 3S14J 1RC9A 1AA7A 2RV8A 4NC7A 4XN3A 1JGGA 3DU5A 3MFKA 1VQ5I 2OJED 4D0PA 1HXDA 1RI7A 2NS0A 2YS9A 3CMYA 1NK2P 2X4HA 3GZ5A 2EFWA 1Z77A 2HNHA 1Z3XA 5CYVA 4Z2YA 1R5ID 3BJAA 2CQQA 2YPRA 4I7HA 4CYCB 2PMZA 2EBIA 2G7UA 5B66C 3LOCA 3CMEI 1ETQA 2KIQA 1MH4A 3M8FA 2CW8A 2QQAA 1DPRA 2XAQA 3MKYB 3CP2A 1ZREA 5HS8A 1DQUA 2R7QA 5IP7J 1LPQA 4BQQA 1ZYRF 4Y4RA 1YW8A 2STTA 2X6WA 2JZYA 3Q3SA 3DEEA 3NAUA 4RS8A 3LWFA 5FFZA 2B9SA 1ETOA 3SZTA 4A5NA 3H5AA 1ZAOA 4CCKA 1SAUA 2MC4A 2O0YA 1ZRDA 3DTIA 2L02A 2IS6A 4GXOA 3KEYA 3H36A 1ZG1A 1IO2A 2VQHA 3L00A 1XSVA 4WXHA 4UY8I 3RTRA 1BC8C 3I56I 4IZZA 1QVUA 1B72A 1Z7LA 2XB5A 3VYRB 4P96A 4B3AA 3GFIA 3A0HC 2XASA 3BTIA 1BIAA 4IHTA 1F43A 3VODA 1RRJA 2DDAA 1ZGWA 1HF0A 1EH6A 2K3PA 1T0FC 3DEWA 1Y8RB 2Y9YA 3VSLA 1FX7A 2CQKA 3WU1B 1IRZA 3Q9VA 2R5ZA 2OV7A 3M8EA 1O3SA 4HQMA 3ABTA 3G73A 3ESWB 4P55A 2R5ZB 3KP4A 4YFNF 3T5XA 3ABMH 4IXAA 3JRDA 3EUHA 1YW7A 5IT3A 1X4PA 4YG2F 1ZKGA 2DMNA 2OF7A 1X4OA 4ENMA 3AG1H 1TLHB 1H9TA 1PP7U 1FOXA 2M87A 2QM3A 3Q5FA 1P6RA 2P5LC 4PGHA 2ICWG 1X3UA 5EEGA 4DIQA 2E71A 3K0LA 1W5CC 3PL8A 5DS9A 2HOSA 1ZLJA 2P0WA 3ZQIA 1YRNA 4N9HA 2H27A 2OQRA 3HB9A 3H0DA 1JXSA 3BR6A 1YRNB 5J3LA 4XN0A 2QGUA 2ZXWH 3L2CA 3CJRB 1LDDA 3CJQB 1QRYA 1YQAA 3BZKA 3E5UA 3E6DA 3IKTA 1IN4A 4EJVA 3WTXC 3CO6C 4EM0B 1POGA 2ZKZA 4RGUA 5D5UB 3BG5A 2D1VA 1Y0NA 3J7AO 2KRCA 4HOBA 1KYZA 1MJBA 1GVJA 4U0VA 3KPHA 1FOWA 4KICA 2R7RA 2M9HA 1A04A 4XK4A 5JLXA 3DLLF 2VPLA 1U5TC 2L7FP 4HQEA 1L3LA 3HG9A 4LFUA 2DA3A 3OSFA 1EJ9A 2NS7A 4KNYA 2FJ1A 5J4YA 2VJ4A 4KA4A 5A2QK 2ID6A 1YX5A 1N25A 3QYEA 4EM2A 1TWGJ 1TBXA 3KX2A 2O3FA 4V19K 3VDXA 4UNOA 1FTTA 1G2HA 1XPXA 2JA2A 1J75A 4A3DJ 3HXLA 1BR1A 3Q0WA 2DTZA 3DKWA 3X2QH 4A3GJ 4XKWA 1XGNA 3REOA 1J5YA 2WV0A 3VYTB 1VNDA 2F4IA 1YHQI 3L2WA 1U6GA 1J9IA 4BJ6C 4HNTA 4I0AA 1G3WA 4UV8A 3FBNB 3I58A 2NVYJ 1T95A 2LY2A 3E0JB 4KIFA 2CJJA 1D1AA 2G0EA 3DWLE 3HYIA 2EV5A 4XOTA 1A31A 1QU3A 3F6VA 3ZMDA 1WGXA 3QYBA 1NTCA 2EZLA 2LOOA 2KMUA 2K86A 4G6QA 4XM3A 4Y7NJ 3S2HJ 2HTSA 4EATA 5ILSA 2KLOA 2ZNZA 1W0TA 1HKTA 3LSIA 4IKFA 2BXYA 2JUGA 5E20A 2PJRA 2K4JA 3K4JA 3GTQJ 3E5QA 3PQKA 3FMSA 4HX8A 2R3SA 1ON2A 4UHTA 2MABA 4OINF 2BHYA 1L0OC 2PJRB 2WTEA 1MSEC 1T6SA 1LFPA 4PUSA 3CCYA 3LSHA 5KAFC 4L0YB 1ODDA 2F5EA 2RVCA 2A68F 1TW3A 1TWAJ 3HZJA 4DNCA 4XNFA 5M3FJ 2C6YA 3ZQQA 4FHTA 4ZYEA 3FXMA 5AONA 2W00A 2PBIA 4ZZDA 4I09A 2FMLA 3HRMA 2HR3A 3HRTA 3ABKH 3ZR8X 4AYBA 3JTGA 2VLAA 1WFXA 4G6TB 1WRJA 4ZTJA 5FLXK 4XLPF 3BPXA 4CCNA 4A3CJ 1QHGA 3LAJA 1N77A 2FBIA 4F92B 2Q1ZB 3BLYA 1R23A 1P7JA 1ONVA 3I64A 1IUFA 3HC7A 2DJNA 1CGPA 4UXNA 2VQGA 1Y6IA 2EIMH 2VXDA 3RKXA 3SDBA 1K78A 3FZVA 3VB2A 4KYWA 4MEXF 1XSDA 1I5ZA 5TGTA 1WJAA 4XQFA 2PMZN 1K78B 2IS4A 1KZHA 1XB4A 2DTRA 2GA1A 3WTVC 1I39A 2E7XA 3RPQA 2DPUA 2NYXA 2ECCA 3C7JA 3HRUA 3WGHA 1FP1D 4UB8C 1D5VA 1Q1VA 4ZDPA 4HSTA 2L9RA 1X1PA 3OS2A 1I50J 2LKPA 3WE2A 2RKHA 2ME0A 3OR1C 3I0TA 1HW2A 1AKHA 3QWLA 2HDWA 3QU6A 1BJAA 1XGMA 4JX5A 3W6VA 1AKHB 1BIBA 1WJFA 5M5WJ 1EA3A 5GPAA 3GTMJ 5LRRA 1FNNA 3F8BA 2F4OB 5E3OA 2A6TA 1N75A 5IT9K 4RBOA 2FE3A 2WADA 3U2RA 2X51A 4L5IA 2L9SA 2EK5A 2VBYA 3M1CA 2DMUA 3G3ZA 5BPDA 3FXOA 2A6HF 4XRFA 3TQNA 2L3DA 2NRAC 4IHSA 2ZXHA 4E70A 4ZYGA 2ZXIA 2QQ9A 4L5EA 1AHDP 3WTSC 2LLKA 1SD7A 1SANA 4FETA 1Z6TA 3H5RA 3OYLA 3JSOA 1QGPA 2CUFA 3IH3A 2DJIA 3GVAA 2FOKA 3GFMA 1FSEA 3K1PA 2KRHA 1QO0D 5HVQC 1E3PA 1DGWY 1SMTA 2MC3A 4MFEA 5KNLA 4WF2A 5DDGA 2CYYA 2W7NA 1MNMC 4LG3A 3OIQA 3GLLA 4HW0A 5C44J 2IGKA 4J19A 1LEAA 4BE0A 2QVOA 3QPHA 1JUSA 1ZGJA 4L9NA 3CCSI 3CCVI 2LYCA 1JGSA
chains in the Genus database with same CATH topology
3L7WA 2GIVA 3BROA 4Q48A 2OZUA 4EVIA 4AIHA 2VONA 4UVCA 2ESNA 4U7BA 3LA7A 2LSOA 2A07F 4PDKA 2CW0F 4G94A 3HTUA 3BOQA 2L54A 4M72A 2AS5F 4BNCA 5LRSA 3HSRA 3LSTA 3F8CA 1S29A 4YFXF 4Y15A 3LA2A 3I71A 3OOPA 1WSUA 4HBLA 5DYMA 2K4BA 4RGSA 2DBBA 1SD5A 3CLOA 3U9GA 2ZJ2A 1F4KA 1SFXA 5K1YA 4XBFA 2HOEA 5EEHA 3HTSB 2RDPA 3EDPA 3LAPA 5J6XA 3ZN1A 2DQLA 4I98B 2H94A 3FWEA 5E8IA 3JAMK 1YYVA 3LQRA 2D1HA 2PLYA 4G9YA 3I5UA 3V8JA 2JPBA 3H92A 2ISYA 3R6SA 3NRVA 2FBHA 5DEQA 2O61A 5AIQA 2F2EA 3IL2A 2KJCA 4XSZF 1O3RA 2DT5A 4L5JA 1RUOA 3BJOA 2XAJA 2IA1A 1W7PA 5J8CA 3ECHA 3F72A 1XGOA 5ICCA 5L3DA 1LQ1A 2HYGD 1RZ4A 4ZYHA 4AVPA 2D2WA 4A0YA 5ERIA 1KQ0A 3R60A 2XROA 4G7ZF 1IUYA 4K2EA 3WG9A 2CSOA 5LHHA 2ELHA 1G4DA 4A6DA 1R5HA 2DO7A 4R1HA 4I2OA 4MEYF 1R00A 4FX4A 5BS6A 2QWWA 2OQGA 1FZPB 1T0FA 1P92A 2QBYA 2EB7A 3F8MA 2O6GE 1BBYA 3RI4A 2ZXJA 1OYWA 3DPTA 2QBYB 4Q47A 2MLGA 3KP7A 4RB0A 1R22A 4P5OA 1ZGAA 4JQFA 3JTHA 3BJ6A 4PZJA 2FNPA 1K79A 2DK8A 1FYMA 4R79A 1SMYF 4ZZLA 4I01A 2PG4A 4HF1A 4KUMA 4LLGF 5E17F 1I1SA 1JE8A 4GYIA 2XIGA 2MH2A 2W84A 4WX9A 4BQAA 1SAXA 2YR2A 1G3YA 4YIFA 2CO5A 5D8LB 1JHFA 2W85A 2QUFA 3FXUA 1ZARA 1XSXA 1BI3A 4B8XA 1B9NA 4Y17A 1SFEA 1U5TA 2GQQA 1LDJA 1U5TB 5KVRA 5K5RA 4LGWA 2EFQA 4MQ9F 4M74A 2Z9OA 3FXRA 2HZTA 1LNWA 2HYFA 5D5VB 3NEUA 3HIFA 4GO1A 1GXQA 2EA4A 3MAJA 3RJPA 2GZWA 1IZ1A 2M30A 1ZN2A 2HDCA 5ED4A 1LB2A 4BAYA 4HYEA 1FT9A 2MA3A 3R4KA 3RIRA 3GZ6A 4EJWA 2QQBA 2HQNA 3N4MA 2MD5A 2HFHA 3WODF 1HKSA 5HLHA 2IA0A 2Z5UA 1FBQA 4AD9A 3HOTA 3HRSA 1I1GA 5D4RA 4EJTA 4CZZA 1D8KA 5BOXA 4CDGA 2COMA 3ZMZA 2KKOA 2H09A 2DK5A 2OD5A 2FU4A 2QENA 2Z3YA 3RPUA 4IRIA 4LB6B 2XVCA 1IRFA 1J2XA 2G7HA 4KIGA 1LEBA 5L3FA 2WWYA 1XGSA 3WTYC 1FPQA 5H6QA 1G3TA 2A3SA 2MLKA 4RGXA 3J81Z 3ZP5A 1O3QA 2XV4S 1T39A 1YFHA 4G6DA 4UVAA 1IN7A 4LLLA 2YSRA 1XCVA 2LF8A 4BHCA 4KIBA 4ENNA 1RIOH 3SFZA 4PCQA 2E1NA 4MGRA 5DCFA 5DCMA 2PMHA 2GXGA 5DCMB 4OMYA 2XKPA 3O2PE 2H6CA 1YTYA 3ROUA 4P9UA 4G7HF 5CVJA 5TRDA 3MZHA 3LA3A 3ML6A 2MBFA 3E6BA 2F5DA 4G7OF 3R0AA 1XCBA 2RNJA 1Z05A 3K1MA 4FT8A 4KN4X 3W6KB 1YIOA 2XRNA 5DD8A 2BBYA 2A61A 2ZCWA 4A12A 5FB2A 1MZBA 1KU2A 4RB1A 4HLYA 3RKWA 3TO9A 3F23A 4OMZA 3L9FA 1FSHA 2W25A 4N9IA 1STZA 3I4PA 1KU7A 4Y13A 2HEOA 2O03A 4O3MA 1ZHFA 2ZO4A 3T8RA 1SFUA 2Y0MA 2HQRA 2LF7A 3R61A 2P5VA 2A5YB 2VODA 2IVMA 1V4RA 1DP7P 3HHGA 3P9CA 4CHUA 1UHMA 3ABUA 3IC7A 4RB3C 2P6SA 1F5TA 2W57A 5LGNA 1BN5A 3TGNA 4A0ZA 2CFXA 2XGXA 5LEJA 1ZG3A 4EV0A 3COAC 3DPLC 2ETHA 2D45A 3KCCA 4LK0F 3EQLF 5E1ZB 3FF5A 1S3JA 5F64A 2Q0OA 5LHIA 1OKRA 3ULQB 1PP8F 4OIRF 4NB5A 1R1VA 5CLSA 5A2QZ 1J7KA 3BDDA 3PQJA 3RDIA 4IPAA 1W4MA 3WGGA 2ACJA 4HDVA 4A6EA 2RGVA 3IKVA 2BV6A 5D8KB 1OMIA 3B02A 1U78A 4CYDA 3GUDA 1MDMA 3QU3A 1MDMB 4OIOF 3IRQA 2E7WA 4XSXF 4HF2A 2VOPA 1TW2A 1EH7A 2HKXA 1OPCA 2ZMEA 2XKOA 1R5GA 4UV9A 2KIFA 1EV7A 3LQQA 2ZMEB 1D8JA 2RN7A 3WTTC 1GHCA 4L0ZB 5L3EA 1KGSA 1FWZA 5D5XB 1R36A 2V9VA 1YS7A 2F5CA 4P9FA 3KFWX 2OA4A 1FY7A 2A69F 2HWVA 3F8NA 4HF0A 4ON0A 3TO7A 1IXCA 1O7FA 4EGYA 2P7VB 3JW4A 3V7SA 2RQPA 2VN2A 1MJAA 2PFBA 3QAHA 5E8GA 4U0WA 2NAZA 2VXZA 2XAFA 5FD5A 2F5FA 2QZ8A 2KIUA 2XAGA 2IP2A 4BH9A 1W7PD 5DD4A 4HA8A 4XLNF 2XHKA 3QRFF 3I59B 2EV0A 2DPDA 3TKYA 2H6BA 3DFGA 2KIMA 1XMKA 1UB9A 3AAFA 1P4AA 1Z9CA 3KZYA 4CICA 2FSWA 2IW5A 4KFCA 3WGIA 5LEKA 3GXOA 3GW2A 4IVNA 4HV6A 4RAZA 3MQ0A 4ESJA 3CUQC 3E6CC 2TDXA 1YO5C 2G9WA 3ZMUA 4S05A 4EMSA 2IA2A 2M5WA 4WCGA 1Q1HA 1IF1A 3J80Z 3WTUC 5TJJA 4MTEA 4I02A 1FBUA 1FOKA 5LBQA 3MWMA 3IWFA 3T0YA 1HKQA 5LHGA 3ERED 1B59A 1RUNA 3FM3A 3SHFA 4BHPA 5DUKA 4EJOA 4LG0A 2QLZA 5AIPA 1LVAA 4Q5SF 2KRFA 5E1XA 4LG0B 3QOPA 3F8FA 5ICGA 4GGGA 5L3GA 3GEZA 5JR3A 3RYPA 3FMQA 5ICEA 3SZPA 3JSPA 1IRGA 2Y75A 4R8HA 2FMYA 3KP6A 1QZYA 4ESBA 3ZMTA 1I6XA 4RGRA 5BMZA 3QP6A 5BQTA 3IHUA 4M6XA 5F1RA 5HDNA 1YG2A 5D5WB 3BP8A 4U88A 1YS6A 2LNBA 1F9NA 3QP5A 2BGCA 1R7JA 1OYIA 4HV5A 3GWZA 3HUGA 4LD5A 2VBZA 2VBXA 2EA2A 1R58A 1IAWA 3RYRA 3F3XA 3W6JB 5FFXA 3TOBA 4UUVA 2V1UA 1DPUA 2PN6A 3M7GA 4OIQF 5CVVA 4MTDA 4M9ZA 3I53A 3MEXA 2PMUA 1P4XA 2DW4A 4KN7X 1U3EM 2GWRA 2JPCA 3GLXA 5H6RA 3MZYA 3K2ZA 5L3CA 4OOIA 2DFIA 2E1CA 5L3BA 1XD7A 5CVRA 3IRRA 2EFNA 1PUEE 4ZYDA 1MD0A 4BYYA 1ZG5A 3GYHX 3TDZC 4ENKA 5FGMA 5ILVA 3ZMSA 4I0BA 1LDKB 2XAHA 4L9VA 4YIIA 3B73A 3K1NA 1QPMA 3QPTA 2GXBA 1FLIA 1S8NA 4IJAA 5HLIA 2K7LA 1K6OA 4UVBA 3EYIA 4QWQA 3KLOA 1KQ9A 1REPC 4CO8A 3DEUA 2PJPA 1JHHA 1BC7C 4YFKF 2FBKA 2EJRA 4AIKA 1FP2A 2J5PA 2EV6A 3I54A 1HSJA 1IXSB 2HGCA 3KLNA 1R1TA 2P8TA 4IRHA 3KP2A 5D6EA 1TTYA 2L01A 3DV8A 3O3KA 2FRHA 3K9TA 2DAOA 4L9JA 5DUIA 4GYGA 5FO5A 1KA8A 1QBJA 1HBXG 5E1WA 1DUXC 1ON1A 4KT5C 4S04A 1LJ9A 4HX4A 2NNNA 4HZFA 5KK1A 3SQNA 2XUBA 4M71A 1J0RA 3C1DA 3ECOA 2JT1A 5HDKA 4M9SA 4L18B 2ZFWA 3H3ZA 1UCRA 3V8LA 3VEPA 2ESHA 1T38A 5JI6A 4HAMA 4HDUA 5F6FA 1SD4A 3M1EA 4OU0A 3E5XA 4RB2C 1W5SA 2M1BA 1O3TA 2P5KA 1P4WA 2BE5F 4MHGA 3E97A 5DV5A 5D4SA 3KEOA 1FYLA 2FQ3A 2OU2A 5HS7A 3D0SA 3V7CA 5ILUA 1D3YA 1HW1A 3CO7C 4ESFA 6PAXA 1B9MA 5LGUA 2JRTA 4MNUA 4ETSA 1HSTA 1XDUA 1IW7F 3FXQA 2EWNA 5ICFA 1P2FA 1TQIA 3H3UA 3NQOA 1O57A 2VOOA 2MH9A 4H0EA 1G6NA 3C3WA 5JVTA 4HLXA 4MQVA 3HSFA 3KZZA 2PEXA 1T2KA 1GXPA 1QNTA 2IRFG 1FYKA 5H20A 4EQQA 1USSA 3O6BB 3KP5A 5HLGA 1J59A 3DXJF 1S7OA 3L09A 1MKMA 2VBWA 2DQRA 4BXUA 4ASNA 2STWA 1BI1A 4QLCU 2Q8KA 3KETA 1TQMA 4A5MA 1KYWA 3BZ6A 4PGGA 3MCZA 2CGPA 4WXCA 1Z1DA 3P7NA 4M9XA 5CVUA 4CXFA 1EH8A 3WE3A 2BYVE 1USTA 5K5QA 3KE2A 3U1DA 2YX7A 1WKMA 5K5OA 4KMFA 2W24A 1U8RA 1DDNA 3D5LA 1QQIA 3VFZA 2Z33A 3CUQA 2YU3A 4BHBA 4ZH4F 3CUQB 2VT2A 2L4AA 2V1XA 3GO5A 1XMAA 4A0XA 2RC4A 3LFKA 1K7AA 1PDNC 1U2WA 2GA2A 1Z91A 1R1UA 3DF8A 5D6FA 4JBAA 4WK8F 1UFMA 2UWMA 1W5TA 2OAZA 1IN5A 5HOOA 3FMRA 3ZPLA 2FA5A 1BM9A 5HS9A 1H9GA 2BEOA 3F21A 2PI0A 3GX4X 1ZRFA 3CDHA 2IJLA 1MGTA 4KMUX 1B4AA 2UXXA 2B0LA 3V4GA 2M8EA 3K69A 3Q9SA 2VT3A 2VC1A 1XDSA 3GFLA 5FLXZ 4EJUA 4U0YA 2ADUA 2AXLA 2K02A 2CWEA 1ZLKA 2Y48A 3FHZA 4WXDA 4O5VA 3J80K 4AIJA 2K27A 2JTVA 2R7FA 1S6LA 2HS5A 1BOAA 3WU0A 2CG4A 1KU9A 1KQ8A 2WC2A 4JK1X 1QZZA 4N0BA 3KP3A 4FX0A 4LMYA 2GAUA 1FC3A 4L9TA 3I59A 3VOEA 1CF7A 4G8XA 1OR7A 4F7ZA 2LDUA 2YX4A 3TO6A 5LGTA 3HOSA 1CF7B 5IT9Z 3V8KA 3C18A 3SXYA 2UXNA 2X0LA 3DQVC 3F6OA 1TNTA 2A6EF 4O6JA 3TOAA 1HW5A 3HSEA 3OV8A 4EGZA 1S7AA 2DLLA 1MJ9A 1WQ2A 3BWGA 5BPIA 1KU3A 3KEQA 1T98A 4LLNA 3ZN0A 3BY6A 1IN8A 2P4WA 2FEZA 4LK1F 3CUOA 1BI0A 2P7CB 2VE8A 3V7RA 3BPVA 2FNAA 3RKYA 1AWCA 1E17A 3FM5A 4LJZF 4ENJA 2ZNYA 1YW9A 1IXRC 4WWCA 1F1ZA 5CVIA 2DI3A 4IRGA 3PFIA 3CJNA 4GCVA 1G3SA 1ULYA 1B1BA 2JSCA 1FBSA 2Q2EA 3EETA 2P6TA 2O8XA 3S2WA 4A2UA 1NHAA 2QYOA 3E3VA 3FX3A 1OYYA 4IF4A 3ZMVA 1ZRCA 1W7PB 4HX7A 1E2XA 1B6AA 3F22A 3ZQ7A 4DQ2A 1I27A 1RNLA 3GF2A 2R7DA 2HKOA 1VTNC 2Z99A 3E6MA 1O7LA 5FD6A 4EM1A 3EYYA 4CGZA 2V6CA 2UZKA 4M6YA 2VC0A 4KDPA 1ZH5A 2J5OA 4U7DA 4NQWA 1V3FA 2PQ8A 3N97A 2ISZA 2EFOA 3P9IA 4M73A 3JAMZ 5LLQA 3HHHA 2ZBKA 1Z7UA 1XN7A 2FF4A 1TQPA 1SD6A 1WWXA 2HTJA 5J8FA 2V79A 1UHWA 1BI2A 3TDUC 2L4MA 1TNSA 4B09A 3WTWC 4Q4ZF 3R0JA 2V1DA 3ELKA 5JHUA 2IT0A 4AWXB 4TV7A 1AOYA 1HQCA 3T8TA 2DU9A 2OZ6A 2NNYA 4OIPF 2OBPA 3M9AA 3P9KA 3CTAA 2VE9A 5CJ9A 1Y0UA 2EFPA 3T1BA 4LB5A 4RAYA 3DP7A 2M45A 1H0MA 2FXAA 3GFJA 4NHJA 5E18F 3IWZA 5HDGA 3ISPA 3WTZA 1C0WA 1WI9A 1IN6A 1Z6RA 1YLFA 2KJBA 5JFRA 3J81K 2IPQX 2RV8A 3MFKA 4D0PA 1HXDA 1RI7A 2NS0A 2X4HA 3GZ5A 2EFWA 5CYVA 4Z2YA 3BJAA 2YPRA 4I7HA 2G7UA 3M8FA 2QQAA 1DPRA 2XAQA 1ZREA 5HS8A 1ZYRF 1YW8A 2STTA 2JZYA 4RS8A 3LWFA 5FFZA 3SZTA 4A5NA 1ZAOA 2O0YA 1ZRDA 2L02A 4GXOA 1ZG1A 3L00A 1XSVA 4WXHA 3RTRA 1BC8C 4P96A 3GFIA 2XASA 1BIAA 4IHTA 3VODA 1EH6A 1FX7A 2CQKA 3WU1B 3Q9VA 1O3SA 3M8EA 4HQMA 3ABTA 3G73A 4P55A 3KP4A 4YFNF 3T5XA 4IXAA 3EUHA 1YW7A 5IT3A 4YG2F 4ENMA 1TLHB 1H9TA 1PP7U 2M87A 2QM3A 3Q5FA 1P6RA 2P5LC 4PGHA 1X3UA 5EEGA 3K0LA 1ZLJA 4N9HA 2H27A 2OQRA 1JXSA 3L2CA 1LDDA 1YQAA 3E5UA 3E6DA 3IKTA 1IN4A 4EJVA 3WTXC 3CO6C 4EM0B 4RGUA 2ZKZA 5D5UB 2D1VA 3J7AO 4HOBA 1KYZA 1MJBA 1GVJA 4U0VA 4KICA 1A04A 1U5TC 4HQEA 1L3LA 4LFUA 4KNYA 4KA4A 5A2QK 4EM2A 1TBXA 2O3FA 4UNOA 1J75A 3DKWA 1XGNA 3REOA 1J5YA 2WV0A 1U6GA 1J9IA 4I0AA 1G3WA 4UV8A 3I58A 4KIFA 3HYIA 2EV5A 3F6VA 3ZMDA 2K86A 4G6QA 2HTSA 5ILSA 2ZNZA 1HKTA 5E20A 2K4JA 3E5QA 3PQKA 3FMSA 4HX8A 2R3SA 1ON2A 4UHTA 4OINF 1L0OC 2WTEA 1T6SA 4L0YB 1ODDA 2F5EA 2RVCA 2A68F 1TW3A 4DNCA 2C6YA 4FHTA 4ZYEA 5AONA 2PBIA 4ZZDA 4I09A 2FMLA 3HRMA 2HR3A 3HRTA 3JTGA 1WRJA 5FLXK 4XLPF 3BPXA 3LAJA 2FBIA 1R23A 1ONVA 3I64A 1CGPA 4UXNA 3RKXA 1K78A 3FZVA 3VB2A 4KYWA 4MEXF 1XSDA 1I5ZA 1K78B 2DTRA 1XB4A 2GA1A 3WTVC 2E7XA 3RPQA 2DPUA 2NYXA 3C7JA 3HRUA 3WGHA 1FP1D 1D5VA 2LKPA 3WE2A 2RKHA 3I0TA 1HW2A 3QU6A 1BJAA 1XGMA 1BIBA 5LRRA 1FNNA 3F8BA 5IT9K 2FE3A 3U2RA 4L5IA 2EK5A 2VBYA 3G3ZA 5BPDA 2A6HF 4XRFA 3TQNA 2L3DA 2NRAC 4IHSA 4E70A 4ZYGA 2QQ9A 3WTSC 1SD7A 1Z6TA 3JSOA 1QGPA 3GVAA 2FOKA 3GFMA 1FSEA 3K1PA 1QO0D 5HVQC 1SMTA 2MC3A 4WF2A 5DDGA 2CYYA 4HW0A 1LEAA 2QVOA 3QPHA 1ZGJA 4L9NA 1JGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7W A;  2GIV A;  3BRO A;  4Q48 A;  2OZU A;  4EVI A;  4AIH A;  2VON A;  4UVC A;  2ESN A;  4U7B A;  3LA7 A;  2LSO A;  2A07 F;  4PDK A;  2CW0 F;  4G94 A;  3HTU A;  3BOQ A;  2L54 A;  4M72 A;  2AS5 F;  4BNC A;  5LRS A;  3HSR A;  3LST A;  3F8C A;  1S29 A;  4YFX F;  4Y15 A;  3LA2 A;  3I71 A;  3OOP A;  1WSU A;  4HBL A;  5DYM A;  2K4B A;  4RGS A;  2DBB A;  1SD5 A;  3CLO A;  3U9G A;  2ZJ2 A;  1F4K A;  1SFX A;  5K1Y A;  4XBF A;  2HOE A;  5EEH A;  3HTS B;  2RDP A;  3EDP A;  3LAP A;  5J6X A;  3ZN1 A;  2DQL A;  4I98 B;  2H94 A;  3FWE A;  5E8I A;  3JAM K;  1YYV A;  3LQR A;  2D1H A;  2PLY A;  4G9Y A;  3I5U A;  3V8J A;  2JPB A;  3H92 A;  2ISY A;  3R6S A;  3NRV A;  2FBH A;  5DEQ A;  2O61 A;  5AIQ A;  2F2E A;  3IL2 A;  2KJC A;  4XSZ F;  1O3R A;  2DT5 A;  4L5J A;  1RUO A;  3BJO A;  2XAJ A;  2IA1 A;  1W7P A;  5J8C A;  3ECH A;  3F72 A;  1XGO A;  5ICC A;  5L3D A;  1LQ1 A;  2HYG D;  1RZ4 A;  4ZYH A;  4AVP A;  2D2W A;  4A0Y A;  5ERI A;  1KQ0 A;  3R60 A;  2XRO A;  4G7Z F;  1IUY A;  4K2E A;  3WG9 A;  2CSO A;  5LHH A;  2ELH A;  1G4D A;  4A6D A;  1R5H A;  2DO7 A;  4R1H A;  4I2O A;  4MEY F;  1R00 A;  4FX4 A;  5BS6 A;  2QWW A;  2OQG A;  1FZP B;  1T0F A;  1P92 A;  2QBY A;  2EB7 A;  3F8M A;  2O6G E;  1BBY A;  3RI4 A;  2ZXJ A;  1OYW A;  3DPT A;  2QBY B;  4Q47 A;  2MLG A;  3KP7 A;  4RB0 A;  1R22 A;  4P5O A;  1ZGA A;  4JQF A;  3JTH A;  3BJ6 A;  4PZJ A;  2FNP A;  1K79 A;  2DK8 A;  1FYM A;  4R79 A;  1SMY F;  4ZZL A;  4I01 A;  2PG4 A;  4HF1 A;  4KUM A;  4LLG F;  5E17 F;  1I1S A;  1JE8 A;  4GYI A;  2XIG A;  2MH2 A;  2W84 A;  4WX9 A;  4BQA A;  1SAX A;  2YR2 A;  1G3Y A;  4YIF A;  2CO5 A;  5D8L B;  1JHF A;  2W85 A;  2QUF A;  3FXU A;  1ZAR A;  1XSX A;  1BI3 A;  4B8X A;  1B9N A;  4Y17 A;  1SFE A;  1U5T A;  2GQQ A;  1LDJ A;  1U5T B;  5KVR A;  5K5R A;  4LGW A;  2EFQ A;  4MQ9 F;  4M74 A;  2Z9O A;  3FXR A;  2HZT A;  1LNW A;  2HYF A;  5D5V B;  3NEU A;  3HIF A;  4GO1 A;  1GXQ A;  2EA4 A;  3MAJ A;  3RJP A;  2GZW A;  1IZ1 A;  2M30 A;  1ZN2 A;  2HDC A;  5ED4 A;  1LB2 A;  4BAY A;  4HYE A;  1FT9 A;  2MA3 A;  3R4K A;  3RIR A;  3GZ6 A;  4EJW A;  2QQB A;  2HQN A;  3N4M A;  2MD5 A;  2HFH A;  3WOD F;  1HKS A;  5HLH A;  2IA0 A;  2Z5U A;  1FBQ A;  4AD9 A;  3HOT A;  3HRS A;  1I1G A;  5D4R A;  4EJT A;  4CZZ A;  1D8K A;  5BOX A;  4CDG A;  2COM A;  3ZMZ A;  2KKO A;  2H09 A;  2DK5 A;  2OD5 A;  2FU4 A;  2QEN A;  2Z3Y A;  3RPU A;  4IRI A;  4LB6 B;  2XVC A;  1IRF A;  1J2X A;  2G7H A;  4KIG A;  1LEB A;  5L3F A;  2WWY A;  1XGS A;  3WTY C;  1FPQ A;  5H6Q A;  1G3T A;  2A3S A;  2MLK A;  4RGX A;  3J81 Z;  3ZP5 A;  1O3Q A;  2XV4 S;  1T39 A;  1YFH A;  4G6D A;  4UVA A;  1IN7 A;  4LLL A;  2YSR A;  1XCV A;  2LF8 A;  4BHC A;  4KIB A;  4ENN A;  1RIO H;  3SFZ A;  4PCQ A;  2E1N A;  4MGR A;  5DCF A;  5DCM A;  2PMH A;  2GXG A;  5DCM B;  4OMY A;  2XKP A;  3O2P E;  2H6C A;  1YTY A;  3ROU A;  4P9U A;  4G7H F;  5CVJ A;  5TRD A;  3MZH A;  3LA3 A;  3ML6 A;  2MBF A;  3E6B A;  2F5D A;  4G7O F;  3R0A A;  1XCB A;  2RNJ A;  1Z05 A;  3K1M A;  4FT8 A;  4KN4 X;  3W6K B;  1YIO A;  2XRN A;  5DD8 A;  2BBY A;  2A61 A;  2ZCW A;  4A12 A;  5FB2 A;  1MZB A;  1KU2 A;  4RB1 A;  4HLY A;  3RKW A;  3TO9 A;  3F23 A;  4OMZ A;  3L9F A;  1FSH A;  2W25 A;  4N9I A;  1STZ A;  3I4P A;  1KU7 A;  4Y13 A;  2HEO A;  2O03 A;  4O3M A;  1ZHF A;  2ZO4 A;  3T8R A;  1SFU A;  2Y0M A;  2HQR A;  2LF7 A;  3R61 A;  2P5V A;  2A5Y B;  2VOD A;  2IVM A;  1V4R A;  1DP7 P;  3HHG A;  3P9C A;  4CHU A;  1UHM A;  3ABU A;  3IC7 A;  4RB3 C;  2P6S A;  1F5T A;  2W57 A;  5LGN A;  1BN5 A;  3TGN A;  4A0Z A;  2CFX A;  2XGX A;  5LEJ A;  1ZG3 A;  4EV0 A;  3COA C;  3DPL C;  2ETH A;  2D45 A;  3KCC A;  4LK0 F;  3EQL F;  5E1Z B;  3FF5 A;  1S3J A;  5F64 A;  2Q0O A;  5LHI A;  1OKR A;  3ULQ B;  1PP8 F;  4OIR F;  4NB5 A;  1R1V A;  5CLS A;  5A2Q Z;  1J7K A;  3BDD A;  3PQJ A;  3RDI A;  4IPA A;  1W4M A;  3WGG A;  2ACJ A;  4HDV A;  4A6E A;  2RGV A;  3IKV A;  2BV6 A;  5D8K B;  1OMI A;  3B02 A;  1U78 A;  4CYD A;  3GUD A;  1MDM A;  3QU3 A;  1MDM B;  4OIO F;  3IRQ A;  2E7W A;  4XSX F;  4HF2 A;  2VOP A;  1TW2 A;  1EH7 A;  2HKX A;  1OPC A;  2ZME A;  2XKO A;  1R5G A;  4UV9 A;  2KIF A;  1EV7 A;  3LQQ A;  2ZME B;  1D8J A;  2RN7 A;  3WTT C;  1GHC A;  4L0Z B;  5L3E A;  1KGS A;  1FWZ A;  5D5X B;  1R36 A;  2V9V A;  1YS7 A;  2F5C A;  4P9F A;  3KFW X;  2OA4 A;  1FY7 A;  2A69 F;  2HWV A;  3F8N A;  4HF0 A;  4ON0 A;  3TO7 A;  1IXC A;  1O7F A;  4EGY A;  2P7V B;  3JW4 A;  3V7S A;  2RQP A;  2VN2 A;  1MJA A;  2PFB A;  3QAH A;  5E8G A;  4U0W A;  2NAZ A;  2VXZ A;  2XAF A;  5FD5 A;  2F5F A;  2QZ8 A;  2KIU A;  2XAG A;  2IP2 A;  4BH9 A;  1W7P D;  5DD4 A;  4HA8 A;  4XLN F;  2XHK A;  3QRF F;  3I59 B;  2EV0 A;  2DPD A;  3TKY A;  2H6B A;  3DFG A;  2KIM A;  1XMK A;  1UB9 A;  3AAF A;  1P4A A;  1Z9C A;  3KZY A;  4CIC A;  2FSW A;  2IW5 A;  4KFC A;  3WGI A;  5LEK A;  3GXO A;  3GW2 A;  4IVN A;  4HV6 A;  4RAZ A;  3MQ0 A;  4ESJ A;  3CUQ C;  3E6C C;  2TDX A;  1YO5 C;  2G9W A;  3ZMU A;  4S05 A;  4EMS A;  2IA2 A;  2M5W A;  4WCG A;  1Q1H A;  1IF1 A;  3J80 Z;  3WTU C;  5TJJ A;  4MTE A;  4I02 A;  1FBU A;  1FOK A;  5LBQ A;  3MWM A;  3IWF A;  3T0Y A;  1HKQ A;  5LHG A;  3ERE D;  1B59 A;  1RUN A;  3FM3 A;  3SHF A;  4BHP A;  5DUK A;  4EJO A;  4LG0 A;  2QLZ A;  5AIP A;  1LVA A;  4Q5S F;  2KRF A;  5E1X A;  4LG0 B;  3QOP A;  3F8F A;  5ICG A;  4GGG A;  5L3G A;  3GEZ A;  5JR3 A;  3RYP A;  3FMQ A;  5ICE A;  3SZP A;  3JSP A;  1IRG A;  2Y75 A;  4R8H A;  2FMY A;  3KP6 A;  1QZY A;  4ESB A;  3ZMT A;  1I6X A;  4RGR A;  5BMZ A;  3QP6 A;  5BQT A;  3IHU A;  4M6X A;  5F1R A;  5HDN A;  1YG2 A;  5D5W B;  3BP8 A;  4U88 A;  1YS6 A;  2LNB A;  1F9N A;  3QP5 A;  2BGC A;  1R7J A;  1OYI A;  4HV5 A;  3GWZ A;  3HUG A;  4LD5 A;  2VBZ A;  2VBX A;  2EA2 A;  1R58 A;  1IAW A;  3RYR A;  3F3X A;  3W6J B;  5FFX A;  3TOB A;  4UUV A;  2V1U A;  1DPU A;  2PN6 A;  3M7G A;  4OIQ F;  5CVV A;  4MTD A;  4M9Z A;  3I53 A;  3MEX A;  2PMU A;  1P4X A;  2DW4 A;  4KN7 X;  1U3E M;  2GWR A;  2JPC A;  3GLX A;  5H6R A;  3MZY A;  3K2Z A;  5L3C A;  4OOI A;  2DFI A;  2E1C A;  5L3B A;  1XD7 A;  5CVR A;  3IRR A;  2EFN A;  1PUE E;  4ZYD A;  1MD0 A;  4BYY A;  1ZG5 A;  3GYH X;  3TDZ C;  4ENK A;  5FGM A;  5ILV A;  3ZMS A;  4I0B A;  1LDK B;  2XAH A;  4L9V A;  4YII A;  3B73 A;  3K1N A;  1QPM A;  3QPT A;  2GXB A;  1FLI A;  1S8N A;  4IJA A;  5HLI A;  2K7L A;  1K6O A;  4UVB A;  3EYI A;  4QWQ A;  3KLO A;  1KQ9 A;  1REP C;  4CO8 A;  3DEU A;  2PJP A;  1JHH A;  1BC7 C;  4YFK F;  2FBK A;  2EJR A;  4AIK A;  1FP2 A;  2J5P A;  2EV6 A;  3I54 A;  1HSJ A;  1IXS B;  2HGC A;  3KLN A;  1R1T A;  2P8T A;  4IRH A;  3KP2 A;  5D6E A;  1TTY A;  2L01 A;  3DV8 A;  3O3K A;  2FRH A;  3K9T A;  2DAO A;  4L9J A;  5DUI A;  4GYG A;  5FO5 A;  1KA8 A;  1QBJ A;  1HBX G;  5E1W A;  1DUX C;  1ON1 A;  4KT5 C;  4S04 A;  1LJ9 A;  4HX4 A;  2NNN A;  4HZF A;  5KK1 A;  3SQN A;  2XUB A;  4M71 A;  1J0R A;  3C1D A;  3ECO A;  2JT1 A;  5HDK A;  4M9S A;  4L18 B;  2ZFW A;  3H3Z A;  1UCR A;  3V8L A;  3VEP A;  2ESH A;  1T38 A;  5JI6 A;  4HAM A;  4HDU A;  5F6F A;  1SD4 A;  3M1E A;  4OU0 A;  3E5X A;  4RB2 C;  1W5S A;  2M1B A;  1O3T A;  2P5K A;  1P4W A;  2BE5 F;  4MHG A;  3E97 A;  5DV5 A;  5D4S A;  3KEO A;  1FYL A;  2FQ3 A;  2OU2 A;  5HS7 A;  3D0S A;  3V7C A;  5ILU A;  1D3Y A;  1HW1 A;  3CO7 C;  4ESF A;  6PAX A;  1B9M A;  5LGU A;  2JRT A;  4MNU A;  4ETS A;  1HST A;  1XDU A;  1IW7 F;  3FXQ A;  2EWN A;  5ICF A;  1P2F A;  1TQI A;  3H3U A;  3NQO A;  1O57 A;  2VOO A;  2MH9 A;  4H0E A;  1G6N A;  3C3W A;  5JVT A;  4HLX A;  4MQV A;  3HSF A;  3KZZ A;  2PEX A;  1T2K A;  1GXP A;  1QNT A;  2IRF G;  1FYK A;  5H20 A;  4EQQ A;  1USS A;  3O6B B;  3KP5 A;  5HLG A;  1J59 A;  3DXJ F;  1S7O A;  3L09 A;  1MKM A;  2VBW A;  2DQR A;  4BXU A;  4ASN A;  2STW A;  1BI1 A;  4QLC U;  2Q8K A;  3KET A;  1TQM A;  4A5M A;  1KYW A;  3BZ6 A;  4PGG A;  3MCZ A;  2CGP A;  4WXC A;  1Z1D A;  3P7N A;  4M9X A;  5CVU A;  4CXF A;  1EH8 A;  3WE3 A;  2BYV E;  1UST A;  5K5Q A;  3KE2 A;  3U1D A;  2YX7 A;  1WKM A;  5K5O A;  4KMF A;  2W24 A;  1U8R A;  1DDN A;  3D5L A;  1QQI A;  3VFZ A;  2Z33 A;  3CUQ A;  2YU3 A;  4BHB A;  4ZH4 F;  3CUQ B;  2VT2 A;  2L4A A;  2V1X A;  3GO5 A;  1XMA A;  4A0X A;  2RC4 A;  3LFK A;  1K7A A;  1PDN C;  1U2W A;  2GA2 A;  1Z91 A;  1R1U A;  3DF8 A;  5D6F A;  4JBA A;  4WK8 F;  1UFM A;  2UWM A;  1W5T A;  2OAZ A;  1IN5 A;  5HOO A;  3FMR A;  3ZPL A;  2FA5 A;  1BM9 A;  5HS9 A;  1H9G A;  2BEO A;  3F21 A;  2PI0 A;  3GX4 X;  1ZRF A;  3CDH A;  2IJL A;  1MGT A;  4KMU X;  1B4A A;  2UXX A;  2B0L A;  3V4G A;  2M8E A;  3K69 A;  3Q9S A;  2VT3 A;  2VC1 A;  1XDS A;  3GFL A;  5FLX Z;  4EJU A;  4U0Y A;  2ADU A;  2AXL A;  2K02 A;  2CWE A;  1ZLK A;  2Y48 A;  3FHZ A;  4WXD A;  4O5V A;  3J80 K;  4AIJ A;  2K27 A;  2JTV A;  2R7F A;  1S6L A;  2HS5 A;  1BOA A;  3WU0 A;  2CG4 A;  1KU9 A;  1KQ8 A;  2WC2 A;  4JK1 X;  1QZZ A;  4N0B A;  3KP3 A;  4FX0 A;  4LMY A;  2GAU A;  1FC3 A;  4L9T A;  3I59 A;  3VOE A;  1CF7 A;  4G8X A;  1OR7 A;  4F7Z A;  2LDU A;  2YX4 A;  3TO6 A;  5LGT A;  3HOS A;  1CF7 B;  5IT9 Z;  3V8K A;  3C18 A;  3SXY A;  2UXN A;  2X0L A;  3DQV C;  3F6O A;  1TNT A;  2A6E F;  4O6J A;  3TOA A;  1HW5 A;  3HSE A;  3OV8 A;  4EGZ A;  1S7A A;  2DLL A;  1MJ9 A;  1WQ2 A;  3BWG A;  5BPI A;  1KU3 A;  3KEQ A;  1T98 A;  4LLN A;  3ZN0 A;  3BY6 A;  1IN8 A;  2P4W A;  2FEZ A;  4LK1 F;  3CUO A;  1BI0 A;  2P7C B;  2VE8 A;  3V7R A;  3BPV A;  2FNA A;  3RKY A;  1AWC A;  1E17 A;  3FM5 A;  4LJZ F;  4ENJ A;  2ZNY A;  1YW9 A;  1IXR C;  4WWC A;  1F1Z A;  5CVI A;  2DI3 A;  4IRG A;  3PFI A;  3CJN A;  4GCV A;  1G3S A;  1ULY A;  1B1B A;  2JSC A;  1FBS A;  2Q2E A;  3EET A;  2P6T A;  2O8X A;  3S2W A;  4A2U A;  1NHA A;  2QYO A;  3E3V A;  3FX3 A;  1OYY A;  4IF4 A;  3ZMV A;  1ZRC A;  1W7P B;  4HX7 A;  1E2X A;  1B6A A;  3F22 A;  3ZQ7 A;  4DQ2 A;  1I27 A;  1RNL A;  3GF2 A;  2R7D A;  2HKO A;  1VTN C;  2Z99 A;  3E6M A;  1O7L A;  5FD6 A;  4EM1 A;  3EYY A;  4CGZ A;  2V6C A;  2UZK A;  4M6Y A;  2VC0 A;  4KDP A;  1ZH5 A;  2J5O A;  4U7D A;  4NQW A;  1V3F A;  2PQ8 A;  3N97 A;  2ISZ A;  2EFO A;  3P9I A;  4M73 A;  3JAM Z;  5LLQ A;  3HHH A;  2ZBK A;  1Z7U A;  1XN7 A;  2FF4 A;  1TQP A;  1SD6 A;  1WWX A;  2HTJ A;  5J8F A;  2V79 A;  1UHW A;  1BI2 A;  3TDU C;  2L4M A;  1TNS A;  4B09 A;  3WTW C;  4Q4Z F;  3R0J A;  2V1D A;  3ELK A;  5JHU A;  2IT0 A;  4AWX B;  4TV7 A;  1AOY A;  1HQC A;  3T8T A;  2DU9 A;  2OZ6 A;  2NNY A;  4OIP F;  2OBP A;  3M9A A;  3P9K A;  3CTA A;  2VE9 A;  5CJ9 A;  1Y0U A;  2EFP A;  3T1B A;  4LB5 A;  4RAY A;  3DP7 A;  2M45 A;  1H0M A;  2FXA A;  3GFJ A;  4NHJ A;  5E18 F;  3IWZ A;  5HDG A;  3ISP A;  3WTZ A;  1C0W A;  1WI9 A;  1IN6 A;  1Z6R A;  1YLF A;  2KJB A;  5JFR A;  3J81 K;  2IPQ X;  2RV8 A;  3MFK A;  4D0P A;  1HXD A;  1RI7 A;  2NS0 A;  2X4H A;  3GZ5 A;  2EFW A;  5CYV A;  4Z2Y A;  3BJA A;  2YPR A;  4I7H A;  2G7U A;  3M8F A;  2QQA A;  1DPR A;  2XAQ A;  1ZRE A;  5HS8 A;  1ZYR F;  1YW8 A;  2STT A;  2JZY A;  4RS8 A;  3LWF A;  5FFZ A;  3SZT A;  4A5N A;  1ZAO A;  2O0Y A;  1ZRD A;  2L02 A;  4GXO A;  1ZG1 A;  3L00 A;  1XSV A;  4WXH A;  3RTR A;  1BC8 C;  4P96 A;  3GFI A;  2XAS A;  1BIA A;  4IHT A;  3VOD A;  1EH6 A;  1FX7 A;  2CQK A;  3WU1 B;  3Q9V A;  1O3S A;  3M8E A;  4HQM A;  3ABT A;  3G73 A;  4P55 A;  3KP4 A;  4YFN F;  3T5X A;  4IXA A;  3EUH A;  1YW7 A;  5IT3 A;  4YG2 F;  4ENM A;  1TLH B;  1H9T A;  1PP7 U;  2M87 A;  2QM3 A;  3Q5F A;  1P6R A;  2P5L C;  4PGH A;  1X3U A;  5EEG A;  3K0L A;  1ZLJ A;  4N9H A;  2H27 A;  2OQR A;  1JXS A;  3L2C A;  1LDD A;  1YQA A;  3E5U A;  3E6D A;  3IKT A;  1IN4 A;  4EJV A;  3WTX C;  3CO6 C;  4EM0 B;  4RGU A;  2ZKZ A;  5D5U B;  2D1V A;  3J7A O;  4HOB A;  1KYZ A;  1MJB A;  1GVJ A;  4U0V A;  4KIC A;  1A04 A;  1U5T C;  4HQE A;  1L3L A;  4LFU A;  4KNY A;  4KA4 A;  5A2Q K;  4EM2 A;  1TBX A;  2O3F A;  4UNO A;  1J75 A;  3DKW A;  1XGN A;  3REO A;  1J5Y A;  2WV0 A;  1U6G A;  1J9I A;  4I0A A;  1G3W A;  4UV8 A;  3I58 A;  4KIF A;  3HYI A;  2EV5 A;  3F6V A;  3ZMD A;  2K86 A;  4G6Q A;  2HTS A;  5ILS A;  2ZNZ A;  1HKT A;  5E20 A;  2K4J A;  3E5Q A;  3PQK A;  3FMS A;  4HX8 A;  2R3S A;  1ON2 A;  4UHT A;  4OIN F;  1L0O C;  2WTE A;  1T6S A;  4L0Y B;  1ODD A;  2F5E A;  2RVC A;  2A68 F;  1TW3 A;  4DNC A;  2C6Y A;  4FHT A;  4ZYE A;  5AON A;  2PBI A;  4ZZD A;  4I09 A;  2FML A;  3HRM A;  2HR3 A;  3HRT A;  3JTG A;  1WRJ A;  5FLX K;  4XLP F;  3BPX A;  3LAJ A;  2FBI A;  1R23 A;  1ONV A;  3I64 A;  1CGP A;  4UXN A;  3RKX A;  1K78 A;  3FZV A;  3VB2 A;  4KYW A;  4MEX F;  1XSD A;  1I5Z A;  1K78 B;  2DTR A;  1XB4 A;  2GA1 A;  3WTV C;  2E7X A;  3RPQ A;  2DPU A;  2NYX A;  3C7J A;  3HRU A;  3WGH A;  1FP1 D;  1D5V A;  2LKP A;  3WE2 A;  2RKH A;  3I0T A;  1HW2 A;  3QU6 A;  1BJA A;  1XGM A;  1BIB A;  5LRR A;  1FNN A;  3F8B A;  5IT9 K;  2FE3 A;  3U2R A;  4L5I A;  2EK5 A;  2VBY A;  3G3Z A;  5BPD A;  2A6H F;  4XRF A;  3TQN A;  2L3D A;  2NRA C;  4IHS A;  4E70 A;  4ZYG A;  2QQ9 A;  3WTS C;  1SD7 A;  1Z6T A;  3JSO A;  1QGP A;  3GVA A;  2FOK A;  3GFM A;  1FSE A;  3K1P A;  1QO0 D;  5HVQ C;  1SMT A;  2MC3 A;  4WF2 A;  5DDG A;  2CYY A;  4HW0 A;  1LEA A;  2QVO A;  3QPH A;  1ZGJ A;  4L9N A;  1JGS A; 
#chains in the Genus database with same CATH topology
 4G12 A;  4XKV A;  3S1N J;  1FMW A;  3L7W A;  3GCM A;  4MIM A;  1DGR M;  2GIV A;  3BRO A;  4Q48 A;  3VSK A;  1ETX A;  3QPS A;  3S3O A;  2OZU A;  4EVI A;  1IRX A;  4PSX A;  4AIH A;  2VON A;  4UVC A;  2ESN A;  4U7B A;  2IGM A;  2LSO A;  3LA7 A;  2A07 F;  1X2M A;  4PDK A;  2CW0 F;  4G94 A;  3HTU A;  3BOQ A;  2V9P A;  1ETW A;  2L54 A;  4M72 A;  2AS5 F;  2HU9 A;  4BS9 A;  3BT9 A;  4A3F J;  4BNC A;  5LRS A;  3HSR A;  5HLT A;  3LST A;  3F8C A;  2CV2 A;  2GXA A;  1S29 A;  3MKL A;  5C3E J;  4YFX F;  4Y15 A;  3LA2 A;  3I71 A;  1QHH D;  1MMA A;  3OOP A;  1WSU A;  3RZO J;  4HBL A;  5DYM A;  5IPA A;  5K7F A;  2K4B A;  3CZ6 A;  5IYD J;  2QSH X;  3PSI A;  1IG7 A;  1O4X A;  4RGS A;  2DBB A;  1SD5 A;  2JN6 A;  3CLO A;  2JRM A;  3U9G A;  4QPO A;  1LKX A;  2ZJ2 A;  3BG7 A;  1F4K A;  3W2A A;  2DCE A;  1SFX A;  2WV1 A;  1WJB A;  5K1Y A;  4XLA A;  4XBF A;  3QYF A;  5J47 A;  2HOE A;  5EEH A;  3M8J A;  5M5Y J;  3HTS B;  4BXX J;  2UUZ A;  3HOU J;  2RDP A;  1VQ9 I;  3BTL A;  3EDP A;  3LAP A;  3FHN A;  1SC7 A;  5J6X A;  3ZN1 A;  2DQL A;  5B5E C;  5FRN A;  2V7F A;  3S3M A;  2XPV A;  4FE7 A;  2XGD A;  3S1Q J;  4I98 B;  2V9K A;  1RR8 C;  2H94 A;  2L9N A;  3FWE A;  5E8I A;  4KIS A;  2CFO A;  3JAM K;  2KP6 A;  3ZCO A;  3HGY A;  4BJ5 C;  1YYV A;  3I4N J;  3LQR A;  2KZV A;  2D1H A;  2PLY A;  2IXS A;  4G9Y A;  3AG2 H;  3I5U A;  4LIT A;  3V8J A;  2JPB A;  1BR2 A;  2EH3 A;  3H92 A;  2ISY A;  3R6S A;  4C2U A;  3NRV A;  5GAE J;  2L7Z A;  2FBH A;  5DEQ A;  1N78 A;  2O61 A;  4QIW N;  3BG3 A;  5AIQ A;  4DBQ A;  2R7V A;  2F2E A;  1OLT A;  3IL2 A;  2KJC A;  3TED A;  1MIJ A;  4HRI A;  4XSZ F;  1O3R A;  2Y31 A;  3QOE A;  2DT5 A;  4L5J A;  1RUO A;  1G59 A;  3BJO A;  2XAJ A;  1ZQ3 P;  1NG6 A;  1NK3 P;  2IA1 A;  1W7P A;  5J8C A;  3ECH A;  3F72 A;  1XGO A;  2KDZ A;  2Y2Z A;  5ICC A;  4D7N A;  3W2V A;  5L3D A;  4X6A J;  2VJ5 A;  1HCR A;  4IQJ A;  2DA1 A;  5GPC A;  2ZME C;  5CKT A;  5H2F C;  1LQ1 A;  2WA0 A;  4EEF G;  4XON A;  3GBG A;  4XRM A;  5EYR A;  2HYG D;  3CF2 A;  1RZ4 A;  4ZYH A;  2K40 A;  4PJJ A;  4D1Q A;  3QPL A;  2D2W A;  2M3A A;  4AVP A;  3MN2 A;  4A0Y A;  3A02 A;  4Y52 J;  1I3Q J;  1RKT A;  4KT6 A;  5ERI A;  1KQ0 A;  3R60 A;  1GLN A;  2XRO A;  4G7Z F;  1IUY A;  4K2E A;  2RNG A;  3WG9 A;  2DDB A;  2CSO A;  1BOB A;  4II2 A;  5LHH A;  2KDO A;  2ELH A;  2QF7 A;  1G4D A;  2M0M A;  2VJI A;  1R5H A;  2DO7 A;  3CDI A;  4A6D A;  4UUS A;  4R1H A;  4I2O A;  4MEY F;  1R00 A;  4RM2 A;  1JT0 A;  1FIP A;  5FKK A;  4UUS B;  4BBS J;  4FX4 A;  1XX5 A;  5BS6 A;  2QWW A;  2OQG A;  1R71 A;  1FZP B;  3LMM A;  5LFA A;  1T0F A;  1P92 A;  2QBY A;  2EB7 A;  3F8M A;  2O6G E;  1BBY A;  2K9L A;  3RI4 A;  3IH4 A;  2KFD A;  2ZXJ A;  1WVR A;  1OYW A;  3DPT A;  2QBY B;  4Q47 A;  1R6R A;  2MLG A;  3KP7 A;  4RB0 A;  1R22 A;  4P5O A;  5J1Y A;  2Z16 A;  1ZGA A;  4JQF A;  3A01 A;  4B43 A;  3JTH A;  4M3G A;  2TRT A;  3BJ6 A;  2LKS A;  4PZJ A;  2FNP A;  1K79 A;  3OS1 A;  2JA7 J;  2DK8 A;  2F5V A;  3DBH B;  3A01 B;  2BY1 A;  1FYM A;  4R79 A;  1SMY F;  4ZZL A;  2H8R A;  4I01 A;  4B48 A;  2OTL I;  2BXZ A;  2PG4 A;  2EZH A;  2LBF A;  2CUJ A;  1S7E A;  4HF1 A;  3HPG A;  4BY1 J;  4KUM A;  1BA5 A;  4LLG F;  2R7O A;  4CZC A;  1ITY A;  5F1J A;  4LIV A;  3NWT A;  5E17 F;  1I1S A;  1JE8 A;  3AL0 C;  4GYI A;  1X58 A;  2XIG A;  2MH2 A;  2W84 A;  1HOM A;  4WX9 A;  3G2B A;  5IP6 A;  4E7L A;  4XOP A;  1SAX A;  4BQA A;  3TMO A;  2YR2 A;  3TBI A;  3A1Y A;  4ITV A;  1G3Y A;  1WPK A;  4YIF A;  2CO5 A;  3GME A;  5D8L B;  4UB6 C;  1JHF A;  1UHS A;  2W85 A;  5JVG F;  2MG4 A;  2R7Z J;  2JSP A;  2QUF A;  3FXU A;  1BW6 A;  1NG7 A;  1ZAR A;  2VB6 A;  1XSX A;  3F0C A;  1V5F A;  3OL4 A;  1BI3 A;  4B8X A;  1B9N A;  4Y17 A;  1Y56 A;  1SFE A;  1U5T A;  2A5W A;  3AG4 H;  4E7I A;  5HNH A;  5FRM A;  2GQQ A;  1LDJ A;  3CCL I;  1IDZ A;  1U5T B;  5KVR A;  5K5R A;  4LGW A;  2EFQ A;  1WJD A;  4MQ9 F;  1E3O C;  3LSG A;  2EIJ H;  4M3D A;  4M74 A;  4CYC A;  2Z9O A;  3FXR A;  2VJJ A;  2HZT A;  1LNW A;  2HYF A;  5D5V B;  2CRG A;  3NEU A;  1T8I A;  1MMS A;  1JUP A;  2KPM A;  3HIF A;  4GO1 A;  5EEA A;  1X2N A;  3HPH A;  1GXQ A;  5FRO A;  2X6O A;  4DBR A;  4IOC F;  3S1R J;  1TC3 C;  5FLV A;  4V2F A;  2EA4 A;  3MAJ A;  3RJP A;  2ZC2 A;  1DP3 A;  2GZW A;  2COB A;  1IZ1 A;  2DT7 B;  2M30 A;  4D7M A;  4AVZ A;  1ZN2 A;  2HDC A;  3ZGK A;  5ED4 A;  1LB2 A;  4RAF A;  4HEA 2;  4BAY A;  4HYE A;  3HGG A;  2BZT A;  1DU6 A;  1FT9 A;  1YE9 A;  2MA3 A;  2HXO A;  3R4K A;  3RIR A;  3GZ6 A;  3A2K A;  3JRG A;  4NUB A;  3K6G A;  4EJW A;  1PYV A;  2QQB A;  1WI3 A;  2HQN A;  2XSD C;  3N4M A;  1FTZ A;  2MD5 A;  2HFH A;  3WOD F;  1HKS A;  5HLH A;  1X1D A;  4W97 A;  1FOY A;  2M4K A;  1LUJ B;  4F52 A;  2IA0 A;  2CQN A;  3NAR A;  2XPW A;  2Z5U A;  5EGO A;  1FBQ A;  4AD9 A;  1MBJ A;  2VKD A;  1LE8 B;  3HOT A;  3CP8 A;  3HRS A;  1I1G A;  5D4R A;  3FK7 A;  4EJT A;  1IGN A;  4CZZ A;  1D8K A;  5EGO B;  1OIS A;  3KIO A;  4CDG A;  5BOX A;  1W36 D;  4XIC A;  3GTG J;  2AQF A;  2COM A;  3ZMZ A;  4UUT A;  2EIL H;  2KKO A;  2H09 A;  4DOZ A;  4A3B J;  2DK5 A;  2OD5 A;  2FU4 A;  2QEN A;  2Z3Y A;  5BNG A;  3RPU A;  4IRI A;  4LB6 B;  2XVC A;  3OYD A;  1IRF A;  1UAA A;  4A3M J;  1J2X A;  3L2Q A;  2G7H A;  1FMV A;  3VYS B;  4KIG A;  2DOF A;  2FUG 2;  1LEB A;  3I55 I;  5L3F A;  2WWY A;  1A5J A;  1XGS A;  3WTY C;  4A3K J;  1FPQ A;  5H6Q A;  1G3T A;  2Y9Z A;  3ZRG A;  2A3S A;  2MLK A;  4RGX A;  4BDZ A;  5DTD A;  3J81 Z;  3K2A A;  4D5F A;  2CQX A;  3ZP5 A;  1O3Q A;  2XV4 S;  1T39 A;  1YFH A;  4G6D A;  1X3Z B;  3G1O A;  4BXF A;  4UVA A;  1IN7 A;  4LLL A;  2YSR A;  1XCV A;  2LF8 A;  4BHC A;  4A3J J;  3CD6 I;  1V54 H;  4KIB A;  4RA2 A;  2DYS H;  4ENN A;  1RIO H;  3SFZ A;  2JUC A;  4PCQ A;  1WH5 A;  3HJE A;  1MBF A;  2E1N A;  2ELJ A;  4MGR A;  5DCF A;  3S15 J;  3MKZ A;  5DCM A;  2PMH A;  3JCU C;  2GXG A;  3PO2 J;  1ZK8 A;  5DCM B;  3E1S A;  1QPI A;  4OMY A;  2XKP A;  1U0J A;  3O2P E;  3CCR I;  1XTA A;  4BAC A;  3ZQF A;  2H6C A;  4ZJZ A;  1YTY A;  2M7B A;  3H9Q A;  2BY2 A;  3ROU A;  4P9U A;  4G7H F;  5CVJ A;  5TRD A;  3MZH A;  2CV1 A;  3LA3 A;  3ML6 A;  2MBF A;  3E6B A;  3GTL J;  3C2B A;  2F5D A;  4G7O F;  3R0A A;  1XCB A;  2RNJ A;  3HM5 A;  2EIN H;  3PSF A;  1Z05 A;  3K1M A;  3CCU I;  4ZDO A;  4AUX A;  4FT8 A;  4KN4 X;  4DJA A;  3W6K B;  4AC0 A;  1YIO A;  2XRN A;  3ASO H;  5DD8 A;  2BBY A;  2A61 A;  1RR7 A;  2ZCW A;  4A12 A;  2VIX A;  5FB2 A;  1MZB A;  1KU2 A;  1SFO J;  4RB1 A;  2XGC A;  2QSG X;  4HLY A;  3RKW A;  5EDN A;  5GTH C;  4P1W A;  2LY1 A;  3MZ8 A;  3ERM A;  3TO9 A;  4YIR X;  3F23 A;  4OMZ A;  3L9F A;  1FSH A;  2DXI A;  2W25 A;  4N9I A;  1STZ A;  3I4P A;  4BE1 A;  4Y13 A;  1KU7 A;  2HEO A;  3OIO A;  2O03 A;  4O3M A;  3FDY A;  1ZHF A;  2ZO4 A;  5K7Z A;  3T8R A;  1SFU A;  3K4K A;  2Y0M A;  2HQR A;  2DFH A;  2DFE A;  2LF7 A;  1D0X A;  4YEL A;  2XRL A;  3OS0 A;  3R61 A;  2P5V A;  2A5Y B;  1ORK A;  4C9Y A;  2VOD A;  2HDD A;  2IVM A;  1V4R A;  1DP7 P;  3HHG A;  3K4C A;  3P9C A;  4U87 A;  4CHU A;  1UHM A;  5C4X J;  5KHD A;  3ABU A;  1VQ6 I;  2ECB A;  4PFO A;  3K70 C;  1ZR2 A;  3S3N A;  2MYS A;  3IC7 A;  4RB3 C;  3HOZ J;  3G6E I;  2P6S A;  3K4M A;  2LR8 A;  3B6C A;  2WAF A;  1F5T A;  4IEJ A;  2W82 A;  2VI6 A;  2QKL B;  1Z3Y A;  2LTP A;  3J7Y J;  4AID A;  2W57 A;  3GTP J;  2DOD A;  4XRS G;  5LGN A;  1BN5 A;  3TGN A;  4A0Z A;  2CFX A;  2JQ7 A;  2XGX A;  3ZXS A;  2HI3 A;  4PFP A;  5LEJ A;  1ZG3 A;  2FX0 A;  4EV0 A;  3COA C;  3DPL C;  2ETH A;  2D45 A;  3KCC A;  3M4O J;  4LK0 F;  3EQL F;  5E1Z B;  3FF5 A;  1S3J A;  1X1B A;  5F64 A;  4DZJ A;  2Q0O A;  4YRV A;  5LHI A;  1OKR A;  4C3J J;  3JR9 A;  3ULQ B;  1TWH J;  4NC8 A;  1A36 A;  1WHU A;  3JRA A;  1PP8 F;  2IS2 A;  1FEX A;  2VUM J;  4OIR F;  3PIO F;  3BQZ A;  4NB5 A;  1R1V A;  3FBI B;  1ZTR A;  5CLS A;  4JOM A;  5A2Q Z;  1J7K A;  4A69 C;  3BDD A;  3PQJ A;  2L5Q A;  3RDI A;  1K6Y A;  3B6A A;  1IV6 A;  2L7K A;  4IPA A;  1W4M A;  3WGG A;  4XLC A;  2ACJ A;  4HDV A;  3K10 A;  5EZH A;  5HOD A;  2CUZ A;  4A6E A;  2DOA A;  4F55 A;  2NOJ B;  3OYE A;  2RGV A;  3IKV A;  2H8W A;  4C30 A;  2BV6 A;  5D8K B;  2E2J J;  1OMI A;  3IUO A;  3BR3 A;  3B02 A;  1WCM J;  1U78 A;  2D5V A;  2R4G A;  4CYD A;  3GUD A;  1MDM A;  2OPT A;  2FQ4 A;  4Z6Y A;  3QU3 A;  5CPR B;  4JX6 A;  3S8P A;  1MDM B;  3H5N A;  1Y1V J;  4OIO F;  2I5U A;  3IRQ A;  2E7W A;  2K85 A;  2QSF X;  4XSX F;  4HF2 A;  2WAE A;  3SEQ A;  2X48 A;  3WG7 H;  4B3X A;  2VOP A;  2LRD A;  1TW2 A;  1EH7 A;  1IV8 A;  2HKX A;  1D1C A;  3CC4 I;  1H89 C;  3S2D J;  1OPC A;  3S16 J;  4E6K G;  1OFC X;  3MD2 A;  2ZME A;  2NVQ J;  2W48 A;  2XKO A;  1R5G A;  3SJM A;  4UV9 A;  3E7L A;  2KIF A;  1EV7 A;  2V1N A;  3LQQ A;  2ZME B;  2MW8 A;  1D8J A;  2RN7 A;  2CQ7 A;  3CCM I;  3WTT C;  1GHC A;  4CA0 A;  2GM4 A;  4L0Z B;  5L3E A;  3IAS 2;  1KGS A;  1VQP I;  3OYI A;  1FWZ A;  2OTJ I;  2WB1 A;  3I4M J;  1UG2 A;  5D5X B;  1R36 A;  2V9V A;  1YS7 A;  2F5C A;  1X1A A;  4HSR A;  4P9F A;  3KFW X;  2OA4 A;  1FY7 A;  2A69 F;  4J01 A;  2HWV A;  2KT0 A;  2R7S A;  1ENH A;  3F8N A;  4HF0 A;  1R49 A;  4ON0 A;  3TO7 A;  1IXC A;  3J7A Y;  1O7F A;  2K3F A;  4EGY A;  1OCR H;  3FKI J;  2CS3 A;  2P7V B;  3JW4 A;  2QKM B;  1V5G A;  2RQP A;  2VN2 A;  3O8G A;  3V7S A;  4JX4 A;  1MJA A;  2PFB A;  3QAH A;  3CCQ I;  3N05 A;  5E8G A;  4U0W A;  2B63 J;  2NAZ A;  2VXZ A;  2XAF A;  3KYC B;  5FD5 A;  2F5F A;  1JJ6 C;  2QZ8 A;  3BR0 A;  2KIU A;  2ZSI B;  2XAG A;  2XAU A;  2HYJ A;  2IP2 A;  2DA7 A;  4BH9 A;  2CV0 A;  2Y69 H;  2E2H J;  5EF6 A;  1W7P D;  3IV5 A;  2H1L A;  3HDD A;  3SDG A;  1RKW A;  5DD4 A;  4HA8 A;  2HVR A;  1HDP A;  4ABZ A;  4XLN F;  2XHK A;  5B1B H;  3QRF F;  3I59 B;  1WJC A;  2EV0 A;  2DPD A;  4LIU A;  3GTJ J;  1YIT I;  2VQL A;  2X6Y A;  2H6B A;  3TKY A;  2OCC H;  3DFG A;  2KIM A;  1XMK A;  5IY5 H;  1UB9 A;  3PNV A;  4XID A;  3AAF A;  1AU7 A;  1P4A A;  1Z9C A;  1Z67 A;  3KZY A;  4CIC A;  2HVQ A;  2LVS A;  2ZJR F;  2FSW A;  2IW5 A;  4KFC A;  2FD5 A;  4I99 C;  3WGI A;  3DBL B;  4AM3 A;  5LEK A;  1D0Y A;  1ETV A;  3GXO A;  3DU6 A;  3GW2 A;  3AL0 B;  3BTC A;  3K4N A;  4IVN A;  1LFU P;  4HV6 A;  4E7S A;  4RAZ A;  3MQ0 A;  3HOX J;  2LKX A;  3DTK A;  3BCB A;  3CUQ C;  3QQA A;  4ESJ A;  4DW6 A;  3E6C C;  2TDX A;  1YO5 C;  2G9W A;  4E4H A;  3ZMU A;  3IAM 2;  3GZN B;  1PJR A;  2E1M C;  4S05 A;  4EMS A;  2IA2 A;  1XC5 A;  2M5W A;  4OAZ A;  1APL C;  3ZQH A;  4WCG A;  1T56 A;  1GV2 A;  1KON A;  2R0Q C;  3ZQC A;  1NH3 A;  2HOT A;  1Q1H A;  3TW6 A;  2R93 J;  1IF1 A;  3J80 Z;  3WTU C;  5TJJ A;  2R7X A;  4MTE A;  4I02 A;  1FBU A;  4MFD A;  1FOK A;  5LBQ A;  3MWM A;  3IWF A;  1VQM I;  4XR6 A;  5B1A H;  1MNE A;  3T0Y A;  3CMA I;  1HKQ A;  2BY0 A;  1B59 A;  3BC8 A;  5LHG A;  3ERE D;  3OWT A;  1YOV B;  1RUN A;  3FM3 A;  3SHF A;  5F0F A;  2E5N A;  2JK3 A;  4BHP A;  1HA8 A;  5DUK A;  4EJO A;  4LG0 A;  2QLZ A;  3RSN A;  5AIP A;  1LVA A;  4Q5S F;  2KRF A;  5E1X A;  2DOE A;  2DN0 A;  4LG0 B;  3OOU A;  3F8F A;  3QOP A;  5ICG A;  4GGG A;  5L3G A;  4KIT B;  2AHQ A;  4LOC A;  3GEZ A;  3M3Y J;  3HEF A;  5JR3 A;  3J7Z I;  2KHM A;  3RYP A;  3FMQ A;  3CCJ I;  5ICE A;  2NXN B;  1JT6 A;  2Z1D A;  4M3F A;  3OYA A;  3SZP A;  3JSP A;  1IRG A;  2Y75 A;  4R8H A;  4QSH A;  3RCO A;  2FMY A;  3KP6 A;  2V6E A;  1QZY A;  4NDL A;  1ETK A;  3ZMT A;  1I6X A;  4ESB A;  3Q0V A;  4RGR A;  2M2E A;  4XOR A;  5BMZ A;  4GDF A;  4BQN A;  3QP6 A;  3ZQG A;  3P5J A;  5BQT A;  4XRS A;  4NC6 A;  1JKO C;  4CUG A;  3IHU A;  2DA4 A;  1XMX A;  1S5L C;  4M6X A;  1TZL A;  4W1U A;  1F36 A;  5F1R A;  5HDN A;  2LP0 A;  2DFF A;  2CUE A;  1R9T J;  2E5Z A;  2LFB A;  1YG2 A;  5D5W B;  2ZFU A;  3BP8 A;  4U88 A;  1BR4 A;  5EJC A;  3CDL A;  4PJL A;  1MMD A;  5KAI C;  1HDD C;  2VAS A;  1YS6 A;  2LNB A;  4HNU A;  1F9N A;  3GTK J;  3QP5 A;  2JA5 J;  4HNV A;  2AO9 A;  1R7J A;  3BTJ A;  2BGC A;  1OYI A;  2JA8 J;  3OMY A;  2DMP A;  1IJW C;  4HV5 A;  4YEJ A;  3GWZ A;  3HUG A;  2QA4 I;  1YI2 I;  4LD5 A;  5EG0 B;  2VBZ A;  2YUS A;  4C3I J;  2NS8 A;  2X9D A;  1K4S A;  2VBX A;  2EA2 A;  3HUG B;  1A6I A;  1R58 A;  2Z2S B;  1IAW A;  4C3H J;  3RYR A;  2ME6 A;  5FKN A;  1OR7 C;  3F3X A;  3PUF A;  2E2I J;  3W6J B;  5FFX A;  3MMY B;  3H9G A;  4X1E A;  3TOB A;  1YIJ I;  4UUV A;  2V1U A;  1DPU A;  4DGW B;  2I10 A;  2PN6 A;  3M7G A;  1R4M B;  4OIQ F;  2EQR A;  5CVV A;  4MTD A;  4M9Z A;  3I53 A;  3MEX A;  2LY9 A;  2PMU A;  1P4X A;  4RDU A;  2DW4 A;  4KN7 X;  3OL3 A;  4ZC3 A;  1U3E M;  2GWR A;  1FJL A;  2JPC A;  3GLX A;  3DCF A;  2P81 A;  3S17 J;  2BW3 B;  5H6R A;  3MZY A;  4XKB A;  2WB1 N;  3K2Z A;  5L3C A;  4OOI A;  1W1W E;  3CES A;  2EZI A;  3OSG A;  2M34 A;  4IHW A;  2DFI A;  2E1C A;  2W4S A;  5L3B A;  1VQ7 I;  5JLW A;  4QTR A;  3TP0 A;  2BVL A;  1XD7 A;  5CVR A;  3IRR A;  2EFN A;  1PUE E;  2RRE A;  4ZYD A;  3G1M A;  1QVT A;  1MD0 A;  1MMG A;  4BYY A;  1ZG5 A;  3U21 A;  3LSR A;  3GYH X;  2LD5 A;  2L9V A;  3TDZ C;  4ENK A;  5FGM A;  5ILV A;  3OYK A;  3O8H A;  3ZMS A;  3BCA A;  4I0B A;  1LDK B;  2LC2 A;  2XAH A;  1XG1 A;  4D9J A;  2AQE A;  4L9V A;  4YII A;  3RPU D;  3B73 A;  3K1N A;  4XLH A;  1EF4 A;  3V42 A;  1QPM A;  3QPT A;  1OCC H;  2GXB A;  1FLI A;  2XC7 A;  2M8G X;  1S8N A;  3JRI A;  4IJA A;  5HLI A;  1Y1W J;  2K7L A;  3FXJ A;  4UVB A;  3OYG A;  1K6O A;  2VKE A;  5CQE A;  3EYI A;  1J09 A;  3PM1 A;  4QWQ A;  4BQO A;  4C2M J;  3JRE A;  3KLO A;  1KQ9 A;  3LNQ A;  2HPI A;  4CCL A;  1REP C;  4CO8 A;  2L7M P;  1K61 A;  2Y0S N;  4B47 A;  3DEU A;  2CU7 A;  4BY7 J;  2PJP A;  1JHH A;  1UG0 A;  1BC7 C;  1RES A;  1VQK I;  4YFK F;  2FBK A;  2ID3 A;  2GOX B;  2EJR A;  2KL4 A;  3HKZ A;  4PJM A;  4AIK A;  1FP2 A;  4MO7 A;  2J5P A;  3FXL A;  3WU2 C;  2EV6 A;  3I54 A;  1HSJ A;  1MBH A;  4XLF A;  1OCZ H;  1VQN I;  3DPU A;  3PO3 J;  1UZC A;  1IXS B;  2HGC A;  2NVU B;  3KLN A;  5IOZ A;  3D5S C;  4Y33 A;  1W0U A;  3CC2 I;  1R1T A;  2P8T A;  4BJT A;  5EZG A;  2VQC A;  4IRH A;  3KP2 A;  2O9L A;  3EPZ A;  5D6E A;  1TL8 A;  1LE8 A;  3UNG C;  1TTY A;  2L01 A;  4A3E J;  1UMQ A;  1VF9 A;  3DV8 A;  1Y8Q B;  2BVM A;  5B3S H;  1MBG A;  3O3K A;  2FRH A;  2F6C A;  4OAY A;  5GAH J;  3K9T A;  5IYC J;  4BKX A;  5IOY A;  3ASN H;  2QCO A;  3VWB A;  3BQY A;  4GRI A;  5F08 A;  2DAO A;  4OWR B;  5GAG J;  1E3H A;  4L9J A;  5DUI A;  4GYG A;  5FO5 A;  1KA8 A;  5F04 A;  4CH7 A;  1K4T A;  1QBJ A;  4DYC A;  1HBX G;  5E1W A;  1DUX C;  1ON1 A;  4KT5 C;  4S04 A;  1SVL A;  4RAG A;  1LJ9 A;  2W1O A;  2NNN A;  4HX4 A;  1I3A A;  1B72 B;  4HZF A;  3DKY A;  2CH0 A;  3NWS A;  5KK1 A;  3SQN A;  1OCT C;  3OYH A;  1U9O A;  1LVK A;  2VL8 A;  2XUB A;  4M71 A;  1J0R A;  5GTI C;  1MMN A;  2R5Y A;  3C1D A;  4M6V A;  5J40 A;  3ECO A;  3QOD A;  3L2V A;  4IHX A;  2WY7 Q;  1RET A;  2R5Y B;  2E60 A;  2JT1 A;  3PNY A;  5HDK A;  4M9S A;  4L18 B;  1ETY A;  2ZFW A;  4E7J A;  3RQ4 A;  5LD2 C;  1JUM A;  3H3Z A;  1UCR A;  3V8L A;  3VEP A;  4RMN A;  1WZ2 A;  3FKJ A;  2ESH A;  3OYJ A;  1T38 A;  2HQ5 A;  1JTX A;  1TT0 A;  1S72 I;  2HZD A;  5JI6 A;  4HAM A;  4HDU A;  1OCO H;  5F6F A;  5M3M J;  3OIP A;  2XB0 X;  1SD4 A;  3M1E A;  4OU0 A;  3E5X A;  4RB2 C;  3JRB A;  1W5S A;  2M1B A;  1V55 H;  3BR1 A;  3G1L A;  1O3T A;  2P5K A;  3PIP F;  1UJ8 A;  1P4W A;  2M0C A;  1CQT A;  2BE5 F;  2NVT J;  4MHG A;  4FE4 A;  3E97 A;  2IGO A;  5DV5 A;  5D4S A;  4BUP A;  3OYM A;  2DMQ A;  3G71 I;  2NVX J;  3KEO A;  4X0G A;  1FYL A;  2FQ3 A;  2OU2 A;  5HS7 A;  3D0S A;  1Z0X A;  3V7C A;  5ILU A;  1D3Y A;  1DU0 A;  1ERD A;  1HW1 A;  3CO7 C;  3PJR A;  1V5E A;  4ESF A;  2GBY A;  6PAX A;  2JA6 J;  1B9M A;  5LGU A;  2NOG A;  2JRT A;  4MNU A;  2K9Q A;  4ETS A;  1D0Z A;  5FJ8 J;  2XDV A;  3CC7 I;  1HST A;  1U9N A;  1XDU A;  3IH2 A;  1IW7 F;  2DYR H;  3SYT A;  3BG6 A;  2EWN A;  2E36 A;  3FXQ A;  5ICF A;  3TP3 A;  1P2F A;  1TQI A;  3H3U A;  2N8G A;  1O57 A;  3NQO A;  2VOO A;  3H3V K;  2RQQ A;  3WHC A;  4AU7 A;  2MH9 A;  1TT5 B;  4H0E A;  1G6N A;  3CQZ J;  3JRF A;  1MND A;  3C3W A;  3I9V 2;  5JVT A;  5F0H A;  4HLX A;  4MQV A;  4F3Q A;  2R7W A;  3AG3 H;  1B8I A;  3H1C A;  3HSF A;  3KZZ A;  2LG4 A;  2PEX A;  1T2K A;  3SZG A;  2XGE A;  2X6X A;  1GXP A;  1QNT A;  1B8I B;  2IRF G;  3LSP A;  1FYK A;  5E3N A;  4A93 J;  4DZP A;  1JJ8 C;  5F0C A;  5H20 A;  4EQQ A;  2E34 A;  2B7E A;  4XLE A;  2JVH A;  1USS A;  3O6B B;  3KP5 A;  5HLG A;  1J59 A;  2JMW A;  5M5X J;  3DXJ F;  5CQG A;  3A03 A;  3TW7 A;  5IYB J;  5J1R A;  1S7O A;  1YJW I;  2XF5 A;  3L09 A;  1MKM A;  2VBW A;  2DQR A;  4RM3 A;  4BXU A;  3CCE I;  2BHZ A;  2HPM A;  2F48 A;  2L0K A;  2GOM A;  4ASN A;  2STW A;  1BI1 A;  3KYD B;  2LMD A;  4QLC U;  3LSK A;  5E3M A;  2X1C A;  3MVP A;  2FOW A;  2Q8K A;  2UV1 A;  3KET A;  2XF6 A;  1TQM A;  4A5M A;  1KYW A;  1WJE A;  3U1K A;  1G8X A;  3BZ6 A;  1ZEL A;  3SEZ A;  4FAS D;  4PGG A;  4BEH A;  3MCZ A;  2CGP A;  4WXC A;  1Z1D A;  3OYC A;  3OYB A;  3P7N A;  2IS1 A;  4M9X A;  1RPW A;  4FCY A;  4BEH B;  5CVU A;  4CXF A;  1EH8 A;  3WE3 A;  2BYV E;  2RAE A;  1UST A;  5K5Q A;  3KE2 A;  4S0H B;  3U1D A;  3C2G A;  3Q0U A;  5F27 A;  2YX7 A;  1WKM A;  1VI0 A;  5K5O A;  4KMF A;  2W24 A;  1GV5 A;  1U8R A;  1DDN A;  1VQ8 I;  1QA6 A;  3EUH C;  3D5L A;  1QQI A;  2O5R A;  3VFZ A;  2Z33 A;  3RQI A;  3ZQL A;  3CUQ A;  1K83 J;  3HKZ N;  4C2T A;  2YU3 A;  1WJ5 A;  4PSW A;  4BHB A;  2LH9 A;  4ZH4 F;  2OC6 A;  4A3I J;  3CUQ B;  5E3L A;  2MGQ A;  3DBR B;  2VT2 A;  2L4A A;  2V1X A;  1QZE A;  4HG2 A;  2E1M B;  3OYN A;  2F4M B;  3RKQ A;  2R7T A;  1A35 A;  4JYK A;  2WAQ A;  4IHV A;  4BE2 A;  4BBR J;  3BG9 A;  3GO5 A;  1XMA A;  2O7O A;  3PUB A;  4ZYA A;  4A0X A;  1TWC J;  5FKM A;  4NBQ A;  2RC4 A;  2VKH A;  3LFK A;  4ZTF A;  1K7A A;  2A05 A;  1PDN C;  1U2W A;  2GA2 A;  5J4V A;  1Z91 A;  2K9N A;  4II3 A;  1H8A C;  1R1U A;  3DF8 A;  5D6F A;  1ZR4 A;  3A0B C;  4JBA A;  4WK8 F;  1UFM A;  2V26 A;  2UWM A;  1M1E B;  1W5T A;  2OAZ A;  2XF7 A;  1IN5 A;  5HOO A;  2GIZ A;  3FMR A;  3I3L A;  4RLQ A;  2FA5 A;  3ZPL A;  4IX7 A;  3WHB A;  4XMY A;  1E0E A;  3F9K A;  2ZJP F;  2DT6 A;  1BM9 A;  1X19 A;  3ONQ A;  1W36 C;  1IDY A;  3L2U A;  1WH7 A;  4N4N B;  1YJ9 I;  5HS9 A;  1H9G A;  2M4G A;  2BEO A;  3F21 A;  2PI0 A;  3GX4 X;  1ZRF A;  3CDH A;  2IJL A;  1MGT A;  2WY8 Q;  3BR5 A;  2K9M A;  4KMU X;  1MW7 A;  1B4A A;  2UXX A;  2B0L A;  3V4G A;  2R7U A;  2M8E A;  3K69 A;  3Q9S A;  2VT3 A;  2O8K A;  3PFY A;  3DKX A;  1MH3 A;  3FXK A;  2VC1 A;  1MSF C;  1XDS A;  3GFL A;  1R4N B;  4EJU A;  5FLX Z;  4U0Y A;  2DA6 A;  4E7H A;  1OJL A;  2ADU A;  2AXL A;  2K02 A;  2CWE A;  3CF5 F;  1ZLK A;  2EPF A;  4XKC A;  4CCO A;  2Y48 A;  3AFH A;  3FHZ A;  1EKE A;  3H35 A;  1SVM A;  4WXD A;  1VQO I;  3FK6 A;  4O5V A;  1FIA A;  3J80 K;  3MKW B;  2K27 A;  5C4J J;  4AIJ A;  2JTV A;  5HNF A;  2R7F A;  3OR2 C;  4B4C A;  3EUK L;  1VQ4 I;  1S6L A;  2HS5 A;  4IO9 F;  5GP9 A;  1BOA A;  3WU0 A;  2CG4 A;  5DM6 F;  1KU9 A;  5FKL A;  2HVS A;  2OCE A;  1PVE A;  4IQ4 A;  1KQ8 A;  2WC2 A;  4HPQ A;  4DYQ A;  4JP0 A;  4V2G A;  2H1K A;  2JWT A;  2QQ8 A;  2KQR A;  4JK1 X;  1QZZ A;  4N0B A;  3KP3 A;  4FX0 A;  4FQG A;  4LMY A;  3ZOB A;  4F93 B;  2M7A A;  4E7K A;  2GAU A;  2Y0S A;  5IP9 J;  1S9H A;  3D1N I;  1FC3 A;  3LSM A;  3I59 A;  4L9T A;  1X3W B;  1HLV A;  3VOE A;  3UKG A;  2YU9 J;  3RZD J;  3JRH A;  1CF7 A;  1X1C A;  4G8X A;  1OR7 A;  4F7Z A;  3BR2 A;  2LDU A;  3W2W A;  4CCM A;  1PUF A;  2MFZ A;  1ACI A;  3KZI C;  2X85 A;  2YX4 A;  3TO6 A;  5LGT A;  3HOS A;  1CF7 B;  5IT9 Z;  3V8K A;  1PUF B;  3C18 A;  5FKO A;  3L2R A;  3SXY A;  2UXN A;  2X0L A;  1H88 C;  9ANT A;  3S1M J;  1BJZ A;  3DQV C;  5GAD J;  3F6O A;  4B44 A;  2WBM A;  2AXT C;  2K5C A;  1TNT A;  2A6E F;  1VFC A;  4CCJ A;  1P9Q C;  4O6J A;  3TOA A;  1HW5 A;  3HSE A;  3IP4 B;  3OV8 A;  4EGZ A;  4A3L J;  1S7A A;  2DLL A;  1MJ9 A;  1UEL B;  3VPR A;  1WQ2 A;  3AKZ A;  3BWG A;  3FIW A;  4B1R A;  2QEX I;  5BPI A;  1KU3 A;  3KEQ A;  1GDT A;  1T98 A;  4LLN A;  3HBL A;  2LRE A;  4XL9 A;  3TL4 X;  3ZN0 A;  2MSY A;  3BY6 A;  1IN8 A;  1I6H J;  1YX3 A;  2P4W A;  5E79 C;  1OCP A;  3DTE A;  2VPR A;  1VZ0 A;  2FEZ A;  4LK1 F;  3CUO A;  1TP4 A;  1BI0 A;  2P7C B;  2VE8 A;  2Y30 A;  3V7R A;  1JTY A;  2ELK A;  2JJ7 A;  2MD0 A;  2FNA A;  3BPV A;  3D5R C;  3RKY A;  1AWC A;  2ZJQ F;  1E17 A;  3FM5 A;  4LJZ F;  3ABL H;  4ENJ A;  2ZNY A;  2HQA A;  5DM7 F;  1YW9 A;  3DLA A;  1IXR C;  2IBD A;  4WWC A;  2E1O A;  4E7Z A;  1F1Z A;  1OQY A;  1SEU A;  5CVI A;  4CSW A;  3BZC A;  2DI3 A;  4IRG A;  3LSJ A;  3PFI A;  1YJN I;  4QPQ A;  3CJN A;  4GCV A;  1G3S A;  1ULY A;  4ANJ A;  1GUU A;  1B1B A;  1GVD A;  2JSC A;  2XSJ C;  1A6Q A;  1FBS A;  2GLO A;  2Q2E A;  3EET A;  3K4L A;  3LFU A;  2P6T A;  3W3C A;  3HOY J;  2O8X A;  3G4S I;  2X1D A;  3S2W A;  5K7H A;  1SFK A;  1D5Y A;  2LK2 A;  2DMT A;  3CJT B;  3A4C A;  2TCT A;  2Q2E B;  2DA2 A;  2E19 A;  4MLO A;  2KIS A;  3EUA A;  4N4O B;  4GFB A;  2HOA A;  1U8B A;  4A2U A;  1P7I A;  1JKP C;  4NNJ A;  1NHA A;  2QYO A;  3E3V A;  3FX3 A;  4AYB N;  1OYY A;  4H4K C;  4D5C A;  3H0G J;  4IF4 A;  4PJN A;  2E35 A;  3S32 A;  3ZMV A;  1ZRC A;  1W7P B;  4HX7 A;  4F91 B;  1E2X A;  3HL2 A;  5FLM J;  1JKR C;  1B6A A;  3ZQ7 A;  3F22 A;  4DQ2 A;  1I27 A;  1RNL A;  1TWF J;  1T08 B;  3GF2 A;  4ZDL A;  4J00 A;  2R7D A;  2HKO A;  1D1B A;  3HOW J;  1VTN C;  3HOV J;  4BL0 B;  3VYU B;  2Z99 A;  3C2H A;  3E6M A;  2CW7 A;  1O7L A;  1GT0 C;  2IGN A;  4I76 A;  4EM1 A;  3EYY A;  4M3B A;  2V6C A;  5FD6 A;  2UZK A;  4CGZ A;  4M6Y A;  2VC0 A;  3K4B A;  4KDP A;  1T33 A;  3LL7 A;  3OYF A;  1ZH5 A;  4PJ0 C;  2J5O A;  5J1U A;  1HC8 A;  4U7D A;  2WAQ N;  2VKV A;  2L2O A;  4NQW A;  1V3F A;  2PQ8 A;  5EG0 A;  2KZG A;  3N97 A;  2ISZ A;  2EFO A;  3P9I A;  4M73 A;  2BOL A;  3JAM Z;  5LLQ A;  3KYL A;  3HHH A;  2ZBK A;  4NQW B;  5JHF A;  1Z7U A;  4IOA F;  5KCM A;  3L1P A;  1XN7 A;  2FF4 A;  4BGD A;  4RLF A;  2HXI A;  1TQP A;  1SD6 A;  1WWX A;  2HTJ A;  2JVG A;  2V79 A;  5J8F A;  4KJZ A;  1UHW A;  1BI2 A;  4FIS A;  3TDU C;  2L4M A;  3JRC A;  1TNS A;  4B09 A;  3WTW C;  4Q4Z F;  3R0J A;  1LFB A;  1JI8 A;  2V1D A;  1Y39 A;  3UR3 C;  3ELK A;  3S93 A;  5JHU A;  2IT0 A;  4AWX B;  2DA5 A;  4TV7 A;  1JKQ C;  1AOY A;  4Y3O A;  4I6Z A;  1HQC A;  2BW3 A;  2DU9 A;  4PK4 A;  3T8T A;  2IAI A;  3SFI A;  2OZ6 A;  2EIK H;  2IEK A;  4FTH A;  2NNY A;  4OIP F;  3M07 A;  2OBP A;  4BDY A;  3H9J A;  3PNT A;  3M9A A;  3P9K A;  3OY9 A;  3CTA A;  4BU2 A;  1XS9 A;  2LBF B;  2K9S A;  3CMM A;  4IHY A;  3K70 D;  1SVO A;  2VE9 A;  5CJ9 A;  1Y0U A;  2EFP A;  1Z21 A;  2XPU A;  3T1B A;  2X1E A;  4DYR A;  4LB5 A;  2BY3 A;  2ZB9 A;  4RAY A;  3DP7 A;  2M45 A;  1H0M A;  4IL6 C;  3FIS A;  2FXA A;  3GTO J;  1MBK A;  3GFJ A;  1IC8 A;  4NHJ A;  2ZSH B;  5E18 F;  2EZK A;  1VQL I;  3IWZ A;  5HDG A;  2CMP A;  1BL0 A;  3ISP A;  3WTZ A;  1C0W A;  4M3E A;  2OUM A;  1WI9 A;  2R92 J;  1IN6 A;  1Z6R A;  1BW5 A;  1MBE A;  5TIS C;  1YLF A;  2KJB A;  2I8D A;  3K7A J;  3CLQ A;  2PX9 A;  5JFR A;  3J81 K;  2IPQ X;  2V4J C;  3S14 J;  1RC9 A;  1AA7 A;  2RV8 A;  4NC7 A;  4XN3 A;  1JGG A;  3DU5 A;  3MFK A;  1VQ5 I;  2OJE D;  4D0P A;  1HXD A;  1RI7 A;  2NS0 A;  2YS9 A;  3CMY A;  1NK2 P;  2X4H A;  3GZ5 A;  2EFW A;  1Z77 A;  2HNH A;  1Z3X A;  5CYV A;  4Z2Y A;  1R5I D;  3BJA A;  2CQQ A;  2YPR A;  4I7H A;  4CYC B;  2PMZ A;  2EBI A;  2G7U A;  5B66 C;  3LOC A;  3CME I;  1ETQ A;  2KIQ A;  1MH4 A;  3M8F A;  2CW8 A;  2QQA A;  1DPR A;  2XAQ A;  3MKY B;  3CP2 A;  1ZRE A;  5HS8 A;  1DQU A;  2R7Q A;  5IP7 J;  1LPQ A;  4BQQ A;  1ZYR F;  4Y4R A;  1YW8 A;  2STT A;  2X6W A;  2JZY A;  3Q3S A;  3DEE A;  3NAU A;  4RS8 A;  3LWF A;  5FFZ A;  2B9S A;  1ETO A;  3SZT A;  4A5N A;  3H5A A;  1ZAO A;  4CCK A;  1SAU A;  2MC4 A;  2O0Y A;  1ZRD A;  3DTI A;  2L02 A;  2IS6 A;  4GXO A;  3KEY A;  3H36 A;  1ZG1 A;  1IO2 A;  2VQH A;  3L00 A;  1XSV A;  4WXH A;  4UY8 I;  3RTR A;  1BC8 C;  3I56 I;  4IZZ A;  1QVU A;  1B72 A;  1Z7L A;  2XB5 A;  3VYR B;  4P96 A;  4B3A A;  3GFI A;  3A0H C;  2XAS A;  3BTI A;  1BIA A;  4IHT A;  1F43 A;  3VOD A;  1RRJ A;  2DDA A;  1ZGW A;  1HF0 A;  1EH6 A;  2K3P A;  1T0F C;  3DEW A;  1Y8R B;  2Y9Y A;  3VSL A;  1FX7 A;  2CQK A;  3WU1 B;  1IRZ A;  3Q9V A;  2R5Z A;  2OV7 A;  3M8E A;  1O3S A;  4HQM A;  3ABT A;  3G73 A;  3ESW B;  4P55 A;  2R5Z B;  3KP4 A;  4YFN F;  3T5X A;  3ABM H;  4IXA A;  3JRD A;  3EUH A;  1YW7 A;  5IT3 A;  1X4P A;  4YG2 F;  1ZKG A;  2DMN A;  2OF7 A;  1X4O A;  4ENM A;  3AG1 H;  1TLH B;  1H9T A;  1PP7 U;  1FOX A;  2M87 A;  2QM3 A;  3Q5F A;  1P6R A;  2P5L C;  4PGH A;  2ICW G;  1X3U A;  5EEG A;  4DIQ A;  2E71 A;  3K0L A;  1W5C C;  3PL8 A;  5DS9 A;  2HOS A;  1ZLJ A;  2P0W A;  3ZQI A;  1YRN A;  4N9H A;  2H27 A;  2OQR A;  3HB9 A;  3H0D A;  1JXS A;  3BR6 A;  1YRN B;  5J3L A;  4XN0 A;  2QGU A;  2ZXW H;  3L2C A;  3CJR B;  1LDD A;  3CJQ B;  1QRY A;  1YQA A;  3BZK A;  3E5U A;  3E6D A;  3IKT A;  1IN4 A;  4EJV A;  3WTX C;  3CO6 C;  4EM0 B;  1POG A;  2ZKZ A;  4RGU A;  5D5U B;  3BG5 A;  2D1V A;  1Y0N A;  3J7A O;  2KRC A;  4HOB A;  1KYZ A;  1MJB A;  1GVJ A;  4U0V A;  3KPH A;  1FOW A;  4KIC A;  2R7R A;  2M9H A;  1A04 A;  4XK4 A;  5JLX A;  3DLL F;  2VPL A;  1U5T C;  2L7F P;  4HQE A;  1L3L A;  3HG9 A;  4LFU A;  2DA3 A;  3OSF A;  1EJ9 A;  2NS7 A;  4KNY A;  2FJ1 A;  5J4Y A;  2VJ4 A;  4KA4 A;  5A2Q K;  2ID6 A;  1YX5 A;  1N25 A;  3QYE A;  4EM2 A;  1TWG J;  1TBX A;  3KX2 A;  2O3F A;  4V19 K;  3VDX A;  4UNO A;  1FTT A;  1G2H A;  1XPX A;  2JA2 A;  1J75 A;  4A3D J;  3HXL A;  1BR1 A;  3Q0W A;  2DTZ A;  3DKW A;  3X2Q H;  4A3G J;  4XKW A;  1XGN A;  3REO A;  1J5Y A;  2WV0 A;  3VYT B;  1VND A;  2F4I A;  1YHQ I;  3L2W A;  1U6G A;  1J9I A;  4BJ6 C;  4HNT A;  4I0A A;  1G3W A;  4UV8 A;  3FBN B;  3I58 A;  2NVY J;  1T95 A;  2LY2 A;  3E0J B;  4KIF A;  2CJJ A;  1D1A A;  2G0E A;  3DWL E;  3HYI A;  2EV5 A;  4XOT A;  1A31 A;  1QU3 A;  3F6V A;  3ZMD A;  1WGX A;  3QYB A;  1NTC A;  2EZL A;  2LOO A;  2KMU A;  2K86 A;  4G6Q A;  4XM3 A;  4Y7N J;  3S2H J;  2HTS A;  4EAT A;  5ILS A;  2KLO A;  2ZNZ A;  1W0T A;  1HKT A;  3LSI A;  4IKF A;  2BXY A;  2JUG A;  5E20 A;  2PJR A;  2K4J A;  3K4J A;  3GTQ J;  3E5Q A;  3PQK A;  3FMS A;  4HX8 A;  2R3S A;  1ON2 A;  4UHT A;  2MAB A;  4OIN F;  2BHY A;  1L0O C;  2PJR B;  2WTE A;  1MSE C;  1T6S A;  1LFP A;  4PUS A;  3CCY A;  3LSH A;  5KAF C;  4L0Y B;  1ODD A;  2F5E A;  2RVC A;  2A68 F;  1TW3 A;  1TWA J;  3HZJ A;  4DNC A;  4XNF A;  5M3F J;  2C6Y A;  3ZQQ A;  4FHT A;  4ZYE A;  3FXM A;  5AON A;  2W00 A;  2PBI A;  4ZZD A;  4I09 A;  2FML A;  3HRM A;  2HR3 A;  3HRT A;  3ABK H;  3ZR8 X;  4AYB A;  3JTG A;  2VLA A;  1WFX A;  4G6T B;  1WRJ A;  4ZTJ A;  5FLX K;  4XLP F;  3BPX A;  4CCN A;  4A3C J;  1QHG A;  3LAJ A;  1N77 A;  2FBI A;  4F92 B;  2Q1Z B;  3BLY A;  1R23 A;  1P7J A;  1ONV A;  3I64 A;  1IUF A;  3HC7 A;  2DJN A;  1CGP A;  4UXN A;  2VQG A;  1Y6I A;  2EIM H;  2VXD A;  3RKX A;  3SDB A;  1K78 A;  3FZV A;  3VB2 A;  4KYW A;  4MEX F;  1XSD A;  1I5Z A;  5TGT A;  1WJA A;  4XQF A;  2PMZ N;  1K78 B;  2IS4 A;  1KZH A;  1XB4 A;  2DTR A;  2GA1 A;  3WTV C;  1I39 A;  2E7X A;  3RPQ A;  2DPU A;  2NYX A;  2ECC A;  3C7J A;  3HRU A;  3WGH A;  1FP1 D;  4UB8 C;  1D5V A;  1Q1V A;  4ZDP A;  4HST A;  2L9R A;  1X1P A;  3OS2 A;  1I50 J;  2LKP A;  3WE2 A;  2RKH A;  2ME0 A;  3OR1 C;  3I0T A;  1HW2 A;  1AKH A;  3QWL A;  2HDW A;  3QU6 A;  1BJA A;  1XGM A;  4JX5 A;  3W6V A;  1AKH B;  1BIB A;  1WJF A;  5M5W J;  1EA3 A;  5GPA A;  3GTM J;  5LRR A;  1FNN A;  3F8B A;  2F4O B;  5E3O A;  2A6T A;  1N75 A;  5IT9 K;  4RBO A;  2FE3 A;  2WAD A;  3U2R A;  2X51 A;  4L5I A;  2L9S A;  2EK5 A;  2VBY A;  3M1C A;  2DMU A;  3G3Z A;  5BPD A;  3FXO A;  2A6H F;  4XRF A;  3TQN A;  2L3D A;  2NRA C;  4IHS A;  2ZXH A;  4E70 A;  4ZYG A;  2ZXI A;  2QQ9 A;  4L5E A;  1AHD P;  3WTS C;  2LLK A;  1SD7 A;  1SAN A;  4FET A;  1Z6T A;  3H5R A;  3OYL A;  3JSO A;  1QGP A;  2CUF A;  3IH3 A;  2DJI A;  3GVA A;  2FOK A;  3GFM A;  1FSE A;  3K1P A;  2KRH A;  1QO0 D;  5HVQ C;  1E3P A;  1DGW Y;  1SMT A;  2MC3 A;  4MFE A;  5KNL A;  4WF2 A;  5DDG A;  2CYY A;  2W7N A;  1MNM C;  4LG3 A;  3OIQ A;  3GLL A;  4HW0 A;  5C44 J;  2IGK A;  4J19 A;  1LEA A;  4BE0 A;  2QVO A;  3QPH A;  1JUS A;  1ZGJ A;  4L9N A;  3CCS I;  3CCV I;  2LYC A;  1JGS A; 
#chains in the Genus database with same CATH homology
 3L7W A;  2GIV A;  3BRO A;  4Q48 A;  2OZU A;  4EVI A;  4AIH A;  2VON A;  4UVC A;  2ESN A;  4U7B A;  3LA7 A;  2LSO A;  2A07 F;  4PDK A;  2CW0 F;  4G94 A;  3HTU A;  3BOQ A;  2L54 A;  4M72 A;  2AS5 F;  4BNC A;  5LRS A;  3HSR A;  3LST A;  3F8C A;  1S29 A;  4YFX F;  4Y15 A;  3LA2 A;  3I71 A;  3OOP A;  1WSU A;  4HBL A;  5DYM A;  2K4B A;  4RGS A;  2DBB A;  1SD5 A;  3CLO A;  3U9G A;  2ZJ2 A;  1F4K A;  1SFX A;  5K1Y A;  4XBF A;  2HOE A;  5EEH A;  3HTS B;  2RDP A;  3EDP A;  3LAP A;  5J6X A;  3ZN1 A;  2DQL A;  4I98 B;  2H94 A;  3FWE A;  5E8I A;  3JAM K;  1YYV A;  3LQR A;  2D1H A;  2PLY A;  4G9Y A;  3I5U A;  3V8J A;  2JPB A;  3H92 A;  2ISY A;  3R6S A;  3NRV A;  2FBH A;  5DEQ A;  2O61 A;  5AIQ A;  2F2E A;  3IL2 A;  2KJC A;  4XSZ F;  1O3R A;  2DT5 A;  4L5J A;  1RUO A;  3BJO A;  2XAJ A;  2IA1 A;  1W7P A;  5J8C A;  3ECH A;  3F72 A;  1XGO A;  5ICC A;  5L3D A;  1LQ1 A;  2HYG D;  1RZ4 A;  4ZYH A;  4AVP A;  2D2W A;  4A0Y A;  5ERI A;  1KQ0 A;  3R60 A;  2XRO A;  4G7Z F;  1IUY A;  4K2E A;  3WG9 A;  2CSO A;  5LHH A;  2ELH A;  1G4D A;  4A6D A;  1R5H A;  2DO7 A;  4R1H A;  4I2O A;  4MEY F;  1R00 A;  4FX4 A;  5BS6 A;  2QWW A;  2OQG A;  1FZP B;  1T0F A;  1P92 A;  2QBY A;  2EB7 A;  3F8M A;  2O6G E;  1BBY A;  3RI4 A;  2ZXJ A;  1OYW A;  3DPT A;  2QBY B;  4Q47 A;  2MLG A;  3KP7 A;  4RB0 A;  1R22 A;  4P5O A;  1ZGA A;  4JQF A;  3JTH A;  3BJ6 A;  4PZJ A;  2FNP A;  1K79 A;  2DK8 A;  1FYM A;  4R79 A;  1SMY F;  4ZZL A;  4I01 A;  2PG4 A;  4HF1 A;  4KUM A;  4LLG F;  5E17 F;  1I1S A;  1JE8 A;  4GYI A;  2XIG A;  2MH2 A;  2W84 A;  4WX9 A;  4BQA A;  1SAX A;  2YR2 A;  1G3Y A;  4YIF A;  2CO5 A;  5D8L B;  1JHF A;  2W85 A;  2QUF A;  3FXU A;  1ZAR A;  1XSX A;  1BI3 A;  4B8X A;  1B9N A;  4Y17 A;  1SFE A;  1U5T A;  2GQQ A;  1LDJ A;  1U5T B;  5KVR A;  5K5R A;  4LGW A;  2EFQ A;  4MQ9 F;  4M74 A;  2Z9O A;  3FXR A;  2HZT A;  1LNW A;  2HYF A;  5D5V B;  3NEU A;  3HIF A;  4GO1 A;  1GXQ A;  2EA4 A;  3MAJ A;  3RJP A;  2GZW A;  1IZ1 A;  2M30 A;  1ZN2 A;  2HDC A;  5ED4 A;  1LB2 A;  4BAY A;  4HYE A;  1FT9 A;  2MA3 A;  3R4K A;  3RIR A;  3GZ6 A;  4EJW A;  2QQB A;  2HQN A;  3N4M A;  2MD5 A;  2HFH A;  3WOD F;  1HKS A;  5HLH A;  2IA0 A;  2Z5U A;  1FBQ A;  4AD9 A;  3HOT A;  3HRS A;  1I1G A;  5D4R A;  4EJT A;  4CZZ A;  1D8K A;  5BOX A;  4CDG A;  2COM A;  3ZMZ A;  2KKO A;  2H09 A;  2DK5 A;  2OD5 A;  2FU4 A;  2QEN A;  2Z3Y A;  3RPU A;  4IRI A;  4LB6 B;  2XVC A;  1IRF A;  1J2X A;  2G7H A;  4KIG A;  1LEB A;  5L3F A;  2WWY A;  1XGS A;  3WTY C;  1FPQ A;  5H6Q A;  1G3T A;  2A3S A;  2MLK A;  4RGX A;  3J81 Z;  3ZP5 A;  1O3Q A;  2XV4 S;  1T39 A;  1YFH A;  4G6D A;  4UVA A;  1IN7 A;  4LLL A;  2YSR A;  1XCV A;  2LF8 A;  4BHC A;  4KIB A;  4ENN A;  1RIO H;  3SFZ A;  4PCQ A;  2E1N A;  4MGR A;  5DCF A;  5DCM A;  2PMH A;  2GXG A;  5DCM B;  4OMY A;  2XKP A;  3O2P E;  2H6C A;  1YTY A;  3ROU A;  4P9U A;  4G7H F;  5CVJ A;  5TRD A;  3MZH A;  3LA3 A;  3ML6 A;  2MBF A;  3E6B A;  2F5D A;  4G7O F;  3R0A A;  1XCB A;  2RNJ A;  1Z05 A;  3K1M A;  4FT8 A;  4KN4 X;  3W6K B;  1YIO A;  2XRN A;  5DD8 A;  2BBY A;  2A61 A;  2ZCW A;  4A12 A;  5FB2 A;  1MZB A;  1KU2 A;  4RB1 A;  4HLY A;  3RKW A;  3TO9 A;  3F23 A;  4OMZ A;  3L9F A;  1FSH A;  2W25 A;  4N9I A;  1STZ A;  3I4P A;  1KU7 A;  4Y13 A;  2HEO A;  2O03 A;  4O3M A;  1ZHF A;  2ZO4 A;  3T8R A;  1SFU A;  2Y0M A;  2HQR A;  2LF7 A;  3R61 A;  2P5V A;  2A5Y B;  2VOD A;  2IVM A;  1V4R A;  1DP7 P;  3HHG A;  3P9C A;  4CHU A;  1UHM A;  3ABU A;  3IC7 A;  4RB3 C;  2P6S A;  1F5T A;  2W57 A;  5LGN A;  1BN5 A;  3TGN A;  4A0Z A;  2CFX A;  2XGX A;  5LEJ A;  1ZG3 A;  4EV0 A;  3COA C;  3DPL C;  2ETH A;  2D45 A;  3KCC A;  4LK0 F;  3EQL F;  5E1Z B;  3FF5 A;  1S3J A;  5F64 A;  2Q0O A;  5LHI A;  1OKR A;  3ULQ B;  1PP8 F;  4OIR F;  4NB5 A;  1R1V A;  5CLS A;  5A2Q Z;  1J7K A;  3BDD A;  3PQJ A;  3RDI A;  4IPA A;  1W4M A;  3WGG A;  2ACJ A;  4HDV A;  4A6E A;  2RGV A;  3IKV A;  2BV6 A;  5D8K B;  1OMI A;  3B02 A;  1U78 A;  4CYD A;  3GUD A;  1MDM A;  3QU3 A;  1MDM B;  4OIO F;  3IRQ A;  2E7W A;  4XSX F;  4HF2 A;  2VOP A;  1TW2 A;  1EH7 A;  2HKX A;  1OPC A;  2ZME A;  2XKO A;  1R5G A;  4UV9 A;  2KIF A;  1EV7 A;  3LQQ A;  2ZME B;  1D8J A;  2RN7 A;  3WTT C;  1GHC A;  4L0Z B;  5L3E A;  1KGS A;  1FWZ A;  5D5X B;  1R36 A;  2V9V A;  1YS7 A;  2F5C A;  4P9F A;  3KFW X;  2OA4 A;  1FY7 A;  2A69 F;  2HWV A;  3F8N A;  4HF0 A;  4ON0 A;  3TO7 A;  1IXC A;  1O7F A;  4EGY A;  2P7V B;  3JW4 A;  3V7S A;  2RQP A;  2VN2 A;  1MJA A;  2PFB A;  3QAH A;  5E8G A;  4U0W A;  2NAZ A;  2VXZ A;  2XAF A;  5FD5 A;  2F5F A;  2QZ8 A;  2KIU A;  2XAG A;  2IP2 A;  4BH9 A;  1W7P D;  5DD4 A;  4HA8 A;  4XLN F;  2XHK A;  3QRF F;  3I59 B;  2EV0 A;  2DPD A;  3TKY A;  2H6B A;  3DFG A;  2KIM A;  1XMK A;  1UB9 A;  3AAF A;  1P4A A;  1Z9C A;  3KZY A;  4CIC A;  2FSW A;  2IW5 A;  4KFC A;  3WGI A;  5LEK A;  3GXO A;  3GW2 A;  4IVN A;  4HV6 A;  4RAZ A;  3MQ0 A;  4ESJ A;  3CUQ C;  3E6C C;  2TDX A;  1YO5 C;  2G9W A;  3ZMU A;  4S05 A;  4EMS A;  2IA2 A;  2M5W A;  4WCG A;  1Q1H A;  1IF1 A;  3J80 Z;  3WTU C;  5TJJ A;  4MTE A;  4I02 A;  1FBU A;  1FOK A;  5LBQ A;  3MWM A;  3IWF A;  3T0Y A;  1HKQ A;  5LHG A;  3ERE D;  1B59 A;  1RUN A;  3FM3 A;  3SHF A;  4BHP A;  5DUK A;  4EJO A;  4LG0 A;  2QLZ A;  5AIP A;  1LVA A;  4Q5S F;  2KRF A;  5E1X A;  4LG0 B;  3QOP A;  3F8F A;  5ICG A;  4GGG A;  5L3G A;  3GEZ A;  5JR3 A;  3RYP A;  3FMQ A;  5ICE A;  3SZP A;  3JSP A;  1IRG A;  2Y75 A;  4R8H A;  2FMY A;  3KP6 A;  1QZY A;  4ESB A;  3ZMT A;  1I6X A;  4RGR A;  5BMZ A;  3QP6 A;  5BQT A;  3IHU A;  4M6X A;  5F1R A;  5HDN A;  1YG2 A;  5D5W B;  3BP8 A;  4U88 A;  1YS6 A;  2LNB A;  1F9N A;  3QP5 A;  2BGC A;  1R7J A;  1OYI A;  4HV5 A;  3GWZ A;  3HUG A;  4LD5 A;  2VBZ A;  2VBX A;  2EA2 A;  1R58 A;  1IAW A;  3RYR A;  3F3X A;  3W6J B;  5FFX A;  3TOB A;  4UUV A;  2V1U A;  1DPU A;  2PN6 A;  3M7G A;  4OIQ F;  5CVV A;  4MTD A;  4M9Z A;  3I53 A;  3MEX A;  2PMU A;  1P4X A;  2DW4 A;  4KN7 X;  1U3E M;  2GWR A;  2JPC A;  3GLX A;  5H6R A;  3MZY A;  3K2Z A;  5L3C A;  4OOI A;  2DFI A;  2E1C A;  5L3B A;  1XD7 A;  5CVR A;  3IRR A;  2EFN A;  1PUE E;  4ZYD A;  1MD0 A;  4BYY A;  1ZG5 A;  3GYH X;  3TDZ C;  4ENK A;  5FGM A;  5ILV A;  3ZMS A;  4I0B A;  1LDK B;  2XAH A;  4L9V A;  4YII A;  3B73 A;  3K1N A;  1QPM A;  3QPT A;  2GXB A;  1FLI A;  1S8N A;  4IJA A;  5HLI A;  2K7L A;  1K6O A;  4UVB A;  3EYI A;  4QWQ A;  3KLO A;  1KQ9 A;  1REP C;  4CO8 A;  3DEU A;  2PJP A;  1JHH A;  1BC7 C;  4YFK F;  2FBK A;  2EJR A;  4AIK A;  1FP2 A;  2J5P A;  2EV6 A;  3I54 A;  1HSJ A;  1IXS B;  2HGC A;  3KLN A;  1R1T A;  2P8T A;  4IRH A;  3KP2 A;  5D6E A;  1TTY A;  2L01 A;  3DV8 A;  3O3K A;  2FRH A;  3K9T A;  2DAO A;  4L9J A;  5DUI A;  4GYG A;  5FO5 A;  1KA8 A;  1QBJ A;  1HBX G;  5E1W A;  1DUX C;  1ON1 A;  4KT5 C;  4S04 A;  1LJ9 A;  4HX4 A;  2NNN A;  4HZF A;  5KK1 A;  3SQN A;  2XUB A;  4M71 A;  1J0R A;  3C1D A;  3ECO A;  2JT1 A;  5HDK A;  4M9S A;  4L18 B;  2ZFW A;  3H3Z A;  1UCR A;  3V8L A;  3VEP A;  2ESH A;  1T38 A;  5JI6 A;  4HAM A;  4HDU A;  5F6F A;  1SD4 A;  3M1E A;  4OU0 A;  3E5X A;  4RB2 C;  1W5S A;  2M1B A;  1O3T A;  2P5K A;  1P4W A;  2BE5 F;  4MHG A;  3E97 A;  5DV5 A;  5D4S A;  3KEO A;  1FYL A;  2FQ3 A;  2OU2 A;  5HS7 A;  3D0S A;  3V7C A;  5ILU A;  1D3Y A;  1HW1 A;  3CO7 C;  4ESF A;  6PAX A;  1B9M A;  5LGU A;  2JRT A;  4MNU A;  4ETS A;  1HST A;  1XDU A;  1IW7 F;  3FXQ A;  2EWN A;  5ICF A;  1P2F A;  1TQI A;  3H3U A;  3NQO A;  1O57 A;  2VOO A;  2MH9 A;  4H0E A;  1G6N A;  3C3W A;  5JVT A;  4HLX A;  4MQV A;  3HSF A;  3KZZ A;  2PEX A;  1T2K A;  1GXP A;  1QNT A;  2IRF G;  1FYK A;  5H20 A;  4EQQ A;  1USS A;  3O6B B;  3KP5 A;  5HLG A;  1J59 A;  3DXJ F;  1S7O A;  3L09 A;  1MKM A;  2VBW A;  2DQR A;  4BXU A;  4ASN A;  2STW A;  1BI1 A;  4QLC U;  2Q8K A;  3KET A;  1TQM A;  4A5M A;  1KYW A;  3BZ6 A;  4PGG A;  3MCZ A;  2CGP A;  4WXC A;  1Z1D A;  3P7N A;  4M9X A;  5CVU A;  4CXF A;  1EH8 A;  3WE3 A;  2BYV E;  1UST A;  5K5Q A;  3KE2 A;  3U1D A;  2YX7 A;  1WKM A;  5K5O A;  4KMF A;  2W24 A;  1U8R A;  1DDN A;  3D5L A;  1QQI A;  3VFZ A;  2Z33 A;  3CUQ A;  2YU3 A;  4BHB A;  4ZH4 F;  3CUQ B;  2VT2 A;  2L4A A;  2V1X A;  3GO5 A;  1XMA A;  4A0X A;  2RC4 A;  3LFK A;  1K7A A;  1PDN C;  1U2W A;  2GA2 A;  1Z91 A;  1R1U A;  3DF8 A;  5D6F A;  4JBA A;  4WK8 F;  1UFM A;  2UWM A;  1W5T A;  2OAZ A;  1IN5 A;  5HOO A;  3FMR A;  3ZPL A;  2FA5 A;  1BM9 A;  5HS9 A;  1H9G A;  2BEO A;  3F21 A;  2PI0 A;  3GX4 X;  1ZRF A;  3CDH A;  2IJL A;  1MGT A;  4KMU X;  1B4A A;  2UXX A;  2B0L A;  3V4G A;  2M8E A;  3K69 A;  3Q9S A;  2VT3 A;  2VC1 A;  1XDS A;  3GFL A;  5FLX Z;  4EJU A;  4U0Y A;  2ADU A;  2AXL A;  2K02 A;  2CWE A;  1ZLK A;  2Y48 A;  3FHZ A;  4WXD A;  4O5V A;  3J80 K;  4AIJ A;  2K27 A;  2JTV A;  2R7F A;  1S6L A;  2HS5 A;  1BOA A;  3WU0 A;  2CG4 A;  1KU9 A;  1KQ8 A;  2WC2 A;  4JK1 X;  1QZZ A;  4N0B A;  3KP3 A;  4FX0 A;  4LMY A;  2GAU A;  1FC3 A;  4L9T A;  3I59 A;  3VOE A;  1CF7 A;  4G8X A;  1OR7 A;  4F7Z A;  2LDU A;  2YX4 A;  3TO6 A;  5LGT A;  3HOS A;  1CF7 B;  5IT9 Z;  3V8K A;  3C18 A;  3SXY A;  2UXN A;  2X0L A;  3DQV C;  3F6O A;  1TNT A;  2A6E F;  4O6J A;  3TOA A;  1HW5 A;  3HSE A;  3OV8 A;  4EGZ A;  1S7A A;  2DLL A;  1MJ9 A;  1WQ2 A;  3BWG A;  5BPI A;  1KU3 A;  3KEQ A;  1T98 A;  4LLN A;  3ZN0 A;  3BY6 A;  1IN8 A;  2P4W A;  2FEZ A;  4LK1 F;  3CUO A;  1BI0 A;  2P7C B;  2VE8 A;  3V7R A;  3BPV A;  2FNA A;  3RKY A;  1AWC A;  1E17 A;  3FM5 A;  4LJZ F;  4ENJ A;  2ZNY A;  1YW9 A;  1IXR C;  4WWC A;  1F1Z A;  5CVI A;  2DI3 A;  4IRG A;  3PFI A;  3CJN A;  4GCV A;  1G3S A;  1ULY A;  1B1B A;  2JSC A;  1FBS A;  2Q2E A;  3EET A;  2P6T A;  2O8X A;  3S2W A;  4A2U A;  1NHA A;  2QYO A;  3E3V A;  3FX3 A;  1OYY A;  4IF4 A;  3ZMV A;  1ZRC A;  1W7P B;  4HX7 A;  1E2X A;  1B6A A;  3F22 A;  3ZQ7 A;  4DQ2 A;  1I27 A;  1RNL A;  3GF2 A;  2R7D A;  2HKO A;  1VTN C;  2Z99 A;  3E6M A;  1O7L A;  5FD6 A;  4EM1 A;  3EYY A;  4CGZ A;  2V6C A;  2UZK A;  4M6Y A;  2VC0 A;  4KDP A;  1ZH5 A;  2J5O A;  4U7D A;  4NQW A;  1V3F A;  2PQ8 A;  3N97 A;  2ISZ A;  2EFO A;  3P9I A;  4M73 A;  3JAM Z;  5LLQ A;  3HHH A;  2ZBK A;  1Z7U A;  1XN7 A;  2FF4 A;  1TQP A;  1SD6 A;  1WWX A;  2HTJ A;  5J8F A;  2V79 A;  1UHW A;  1BI2 A;  3TDU C;  2L4M A;  1TNS A;  4B09 A;  3WTW C;  4Q4Z F;  3R0J A;  2V1D A;  3ELK A;  5JHU A;  2IT0 A;  4AWX B;  4TV7 A;  1AOY A;  1HQC A;  3T8T A;  2DU9 A;  2OZ6 A;  2NNY A;  4OIP F;  2OBP A;  3M9A A;  3P9K A;  3CTA A;  2VE9 A;  5CJ9 A;  1Y0U A;  2EFP A;  3T1B A;  4LB5 A;  4RAY A;  3DP7 A;  2M45 A;  1H0M A;  2FXA A;  3GFJ A;  4NHJ A;  5E18 F;  3IWZ A;  5HDG A;  3ISP A;  3WTZ A;  1C0W A;  1WI9 A;  1IN6 A;  1Z6R A;  1YLF A;  2KJB A;  5JFR A;  3J81 K;  2IPQ X;  2RV8 A;  3MFK A;  4D0P A;  1HXD A;  1RI7 A;  2NS0 A;  2X4H A;  3GZ5 A;  2EFW A;  5CYV A;  4Z2Y A;  3BJA A;  2YPR A;  4I7H A;  2G7U A;  3M8F A;  2QQA A;  1DPR A;  2XAQ A;  1ZRE A;  5HS8 A;  1ZYR F;  1YW8 A;  2STT A;  2JZY A;  4RS8 A;  3LWF A;  5FFZ A;  3SZT A;  4A5N A;  1ZAO A;  2O0Y A;  1ZRD A;  2L02 A;  4GXO A;  1ZG1 A;  3L00 A;  1XSV A;  4WXH A;  3RTR A;  1BC8 C;  4P96 A;  3GFI A;  2XAS A;  1BIA A;  4IHT A;  3VOD A;  1EH6 A;  1FX7 A;  2CQK A;  3WU1 B;  3Q9V A;  1O3S A;  3M8E A;  4HQM A;  3ABT A;  3G73 A;  4P55 A;  3KP4 A;  4YFN F;  3T5X A;  4IXA A;  3EUH A;  1YW7 A;  5IT3 A;  4YG2 F;  4ENM A;  1TLH B;  1H9T A;  1PP7 U;  2M87 A;  2QM3 A;  3Q5F A;  1P6R A;  2P5L C;  4PGH A;  1X3U A;  5EEG A;  3K0L A;  1ZLJ A;  4N9H A;  2H27 A;  2OQR A;  1JXS A;  3L2C A;  1LDD A;  1YQA A;  3E5U A;  3E6D A;  3IKT A;  1IN4 A;  4EJV A;  3WTX C;  3CO6 C;  4EM0 B;  4RGU A;  2ZKZ A;  5D5U B;  2D1V A;  3J7A O;  4HOB A;  1KYZ A;  1MJB A;  1GVJ A;  4U0V A;  4KIC A;  1A04 A;  1U5T C;  4HQE A;  1L3L A;  4LFU A;  4KNY A;  4KA4 A;  5A2Q K;  4EM2 A;  1TBX A;  2O3F A;  4UNO A;  1J75 A;  3DKW A;  1XGN A;  3REO A;  1J5Y A;  2WV0 A;  1U6G A;  1J9I A;  4I0A A;  1G3W A;  4UV8 A;  3I58 A;  4KIF A;  3HYI A;  2EV5 A;  3F6V A;  3ZMD A;  2K86 A;  4G6Q A;  2HTS A;  5ILS A;  2ZNZ A;  1HKT A;  5E20 A;  2K4J A;  3E5Q A;  3PQK A;  3FMS A;  4HX8 A;  2R3S A;  1ON2 A;  4UHT A;  4OIN F;  1L0O C;  2WTE A;  1T6S A;  4L0Y B;  1ODD A;  2F5E A;  2RVC A;  2A68 F;  1TW3 A;  4DNC A;  2C6Y A;  4FHT A;  4ZYE A;  5AON A;  2PBI A;  4ZZD A;  4I09 A;  2FML A;  3HRM A;  2HR3 A;  3HRT A;  3JTG A;  1WRJ A;  5FLX K;  4XLP F;  3BPX A;  3LAJ A;  2FBI A;  1R23 A;  1ONV A;  3I64 A;  1CGP A;  4UXN A;  3RKX A;  1K78 A;  3FZV A;  3VB2 A;  4KYW A;  4MEX F;  1XSD A;  1I5Z A;  1K78 B;  2DTR A;  1XB4 A;  2GA1 A;  3WTV C;  2E7X A;  3RPQ A;  2DPU A;  2NYX A;  3C7J A;  3HRU A;  3WGH A;  1FP1 D;  1D5V A;  2LKP A;  3WE2 A;  2RKH A;  3I0T A;  1HW2 A;  3QU6 A;  1BJA A;  1XGM A;  1BIB A;  5LRR A;  1FNN A;  3F8B A;  5IT9 K;  2FE3 A;  3U2R A;  4L5I A;  2EK5 A;  2VBY A;  3G3Z A;  5BPD A;  2A6H F;  4XRF A;  3TQN A;  2L3D A;  2NRA C;  4IHS A;  4E70 A;  4ZYG A;  2QQ9 A;  3WTS C;  1SD7 A;  1Z6T A;  3JSO A;  1QGP A;  3GVA A;  2FOK A;  3GFM A;  1FSE A;  3K1P A;  1QO0 D;  5HVQ C;  1SMT A;  2MC3 A;  4WF2 A;  5DDG A;  2CYY A;  4HW0 A;  1LEA A;  2QVO A;  3QPH A;  1ZGJ A;  4L9N A;  1JGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...