2M1BA

Solution structure of the chxr dna-binding domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
116
Chain Sequence
HSVPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSDDGDKKFSQQDTKLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical response regulator ChxR from Chlamydia trachomatis is structurally poised for DNA binding.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Transcription regulator
molecule keywords Transcriptional regulatory protein, C terminal family protei
total genus 14
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m1bA00
2QQ9A 5CVRA 3GVAA 1TBXA 1T6SA 4B8XA 5HOOA 5LLQA 3DPTA 3DP7A 3HSEA 4FT8A 1Z6TA 4ZYEA 4GYGA 4I02A 3JSOA 4BHBA 5FD6A 2IW5A 2YSRA 1G3YA 3BPXA 4Q48A 3FMSA 2DU9A 3F8CA 1P6RA 3PFIA 3F21A 1E2XA 4P5OA 3JTHA 2PLYA 1R58A 2LDUA 3I53A 4A5MA 3KEQA 4KT5C 2PG4A 1B9MA 1TQMA 1Z05A 4HBLA 2H6BA 3MZYA 2QLZA 1JHHA 4A0YA 4KDPA 1S3JA 1T38A 5FGMA 1XGSA 4AWXB 3V4GA 2XKOA 3K1PA 4AVPA 1I27A 1J75A 3CO6C 1R1VA 3KCCA 4FHTA 3LWFA 1ZHFA 1IXCA 4OINF 2NRAC 3C3WA 1G6NA 1X3UA 4YFXF 2A61A 3TDZC 3JTGA 3U9GA 1TLHB 3JAMK 2FBIA 2QQAA 4KIGA 4L5IA 4Y13A 5DUIA 3IWZA 2ZXJA 4YFNF 4IHSA 4JBAA 3CDHA 4LJZF 2VOOA 2KIUA 4WK8F 2L54A 3J81K 1CF7A 3AAFA 2FU4A 2A3SA 3DFGA 3HHGA 1B9NA 1DPUA 2MD5A 5D5WB 4EM2A 1BM9A 4YFKF 2M45A 4ESFA 1YIOA 4LMYA 5DCMB 1K79A 2JSCA 2FF4A 2EA2A 2F5DA 1G3SA 4HQEA 2G7UA 2W84A 2IVMA 3MCZA 1KQ0A 1OPCA 3MQ0A 2QUFA 3FM3A 2DAOA 2QBYB 2CSOA 4WXDA 1STZA 2CYYA 1O7LA 3CUQC 2M87A 5JFRA 3IL2A 1BI0A 2CQKA 2LF7A 4HLXA 3V8KA 1Z7UA 3CJNA 1QO0D 3ML6A 5LGUA 2ZMEA 3R61A 3REOA 1USTA 4I01A 3SZPA 2W24A 4ZZLA 3ROUA 4WF2A 1D5VA 3NQOA 3JSPA 2XAQA 1QZZA 5FD5A 4HDUA 4MGRA 2Q2EA 2W25A 1J7KA 5J8CA 5BS6A 2F2EA 1LDJA 2BGCA 5E17F 2CG4A 5DUKA 1J5YA 2EA4A 2B0LA 2KJCA 2O3FA 5CVVA 1IAWA 5E18F 3C18A 1Q1HA 1KYZA 1O3RA 1P4XA 4Q47A 3BZ6A 4FX4A 2A6HF 1RUOA 1HBXG 1Z9CA 2MLGA 2IJLA 4HX8A 3J81Z 2CWEA 3WGIA 3IKVA 3WGHA 1QZYA 1KA8A 5D4RA 1YW9A 5ICCA 3H3ZA 5D4SA 3I0TA 2XVCA 1XSDA 4I0BA 1CF7B 1UB9A 3R60A 4R1HA 2XAFA 2V1UA 1O3QA 3KEOA 2Z33A 1YG2A 2XAGA 2G7HA 4KIBA 4L9JA 2VC1A 3IHUA 4XLPF 1FLIA 4KMUX 2HTJA 5DCFA 1HKSA 2A5YB 3RDIA 3DPLC 5HVQC 2DBBA 2X4HA 1ULYA 4MNUA 5D8LB 2HYGD 4OU0A 3E6DA 1U3EM 3W6JB 3VOEA 3FF5A 1YFHA 2OBPA 3SQNA 1W5TA 1SD7A 1LDDA 3HYIA 3WTWC 2P5LC 3P9CA 3ULQB 2D1VA 2XAHA 3FWEA 2IA0A 2Z9OA 2BYVE 2FA5A 3QP5A 2NNNA 2VN2A 4A2UA 3OV8A 1MJ9A 3V7RA 4ESBA 2HKOA 3HUGA 1P4WA 1TW3A 1JGSA 2VT3A 5DD8A 2ESHA 2VE9A 4WXCA 1L3LA 1GVJA 4EM0B 2RVCA 1W4MA 3E3VA 1FOKA 1SFEA 2F5CA 1EH7A 2EFPA 5A2QK 1LB2A 2V1DA 2FMLA 1DPRA 4UVCA 1D8JA 1ZLKA 4LK1F 3ABTA 1YLFA 3E97A 1IW7F 3ECHA 1BC7C 4HOBA 3HRTA 1RUNA 4OIQF 1F4KA 3BROA 3FM5A 2XGXA 2MC3A 5L3FA 1PUEE 1K78B 3WTYC 5E1WA 4BH9A 3P9KA 3J80K 3DF8A 4UNOA 3W6KB 3O6BB 3QPHA 3U1DA 3WTXC 5K5QA 2L3DA 1YO5C 2HZTA 4ZZDA 5J6XA 3LSTA 1K78A 2OZUA 3T8TA 2RN7A 5HS8A 1JE8A 4O6JA 5TRDA 5L3GA 2V6CA 1IF1A 3E6CC 3RIRA 2G9WA 2X0LA 4OIRF 4CYDA 4RB3C 2D1HA 1KU9A 2HKXA 4PGGA 1BC8C 5A2QZ 3C7JA 3L00A 1W7PD 1IN6A 2IA2A 2OD5A 3HRMA 4HX7A 1ZG3A 3DV8A 5BOXA 4CGZA 5IT3A 1TNSA 3F72A 3QRFF 1V3FA 1I1SA 5FB2A 3K0LA 2E1NA 4M71A 1S6LA 3I54A 2XRNA 2UXNA 1D3YA 2FNAA 2IA1A 1QPMA 2NYXA 3GFJA 1U8RA 4KN7X 1O3SA 4HAMA 4R79A 4BNCA 4RB1A 4MTDA 2DQLA 1KQ8A 3LAJA 1KYWA 2P8TA 4CO8A 5F6FA 3E5XA 5CYVA 5AIQA 5EEHA 4NHJA 2UZKA 2VE8A 2M1BA 2VOPA 1QBJA 4RS8A 5K5OA 2IRFG 2RGVA 3QOPA 4MEYF 2GA1A 5IT9K 1SAXA 4U88A 2E1CA 4BHCA 3TO7A 1FP2A 1YYVA 2BV6A 5D6EA 4HDVA 2HFHA 4ZYDA 2WWYA 3ELKA 2GXBA 5ILVA 4LFUA 2A07F 2E7WA 1ON2A 1TQIA 4QLCU 1UHMA 2O8XA 2BE5F 4PZJA 3TO9A 1KU3A 1OYYA 1U2WA 4MTEA 3FXUA 2XROA 4S04A 2OU2A 3F3XA 3VFZA 3IC7A 1MJAA 2DK5A 1Y0UA 3VODA 1UCRA 2HWVA 5E8GA 2CFXA 5BQTA 3LQRA 3SHFA 5L3CA 2WC2A 1F9NA 2L4MA 2D2WA 3PQJA 4E70A 3TQNA 1EH8A 1LDKB 1MKMA 1GXPA 3ZMTA 2JPBA 2V9VA 1SFXA 3K69A 1S8NA 3L7WA 1DUXC 3CTAA 4KNYA 3R0JA 1XDUA 4UV9A 4NQWA 3H92A 4IVNA 2H09A 4IXAA 3WE3A 1B59A 3O3KA 1O57A 2BEOA 2FSWA 1FYMA 3CUQA 4L18B 3RPQA 1RI7A 4LG0B 4HW0A 5HLHA 4A12A 4G94A 1BI1A 1TNTA 2HGCA 1IN4A 3KP4A 2PJPA 5HDNA 1IZ1A 1FY7A 4TV7A 2F5FA 3HHHA 3R6SA 2J5PA 1Z6RA 4U7BA 1W7PB 1D8KA 4BQAA 5FFXA 1T98A 2MLKA 3BY6A 2Z5UA 4EJVA 3GZ5A 3TOBA 2C6YA 3P9IA 2H27A 4A0ZA 1UFMA 1TQPA 1KGSA 1E17A 1HSTA 4OMYA 1T39A 4RAYA 2QYOA 3RPUA 2VC0A 1FYKA 1R00A 3EUHA 1FSEA 2QENA 3WE2A 1WWXA 2JPCA 2HDCA 2EFWA 3GFIA 5HLIA 3N97A 4G6QA 4PGHA 4CICA 1LNWA 1B6AA 3Q9VA 5F1RA 3I64A 3GX4X 2GQQA 4CHUA 3TO6A 1FBSA 4L9NA 4L9VA 3K9TA 4M72A 5KK1A 2FE3A 2P5VA 4I0AA 2ISYA 3LA3A 3RKXA 4ENMA 2HEOA 4P55A 2KIFA 1BI2A 1HW2A 4HZFA 4YIFA 3J7AO 2UXXA 2YPRA 4ON0A 2RKHA 3HOTA 2QBYA 3GEZA 3QU3A 4RB0A 2LNBA 2JRTA 1R5GA 3HTUA 4HA8A 4EJWA 2OQRA 3IRQA 3K1MA 1R1UA 2TDXA 3BDDA 4CXFA 1YQAA 3NRVA 2M5WA 3I59B 4EVIA 2ESNA 3CUOA 2R3SA 2OZ6A 1DDNA 1OR7A 1OKRA 4CDGA 2GWRA 2HTSA 1ZGJA 1WI9A 3E5UA 4PCQA 3EYIA 4BHPA 2RQPA 5LBQA 3BJ6A 2KRFA 5ICFA 2L02A 4MQVA 4XSXF 1QNTA 4M6XA 2WV0A 1ZLJA 3WGGA 5ICEA 4RGRA 3TKYA 3MWMA 3O2PE 2P6SA 5ED4A 4U0YA 2FQ3A 3EYYA 4RGXA 1G3WA 1ZYRF 1IN5A 2XIGA 1IXRC 3GXOA 1XGMA 2Q8KA 1J0RA 2JZYA 4OIPF 2HR3A 3ERED 1H0MA 4Z2YA 3BPVA 2FRHA 4P9UA 1PDNC 3ABUA 4HV6A 4M6YA 2O6GE 4I09A 4JK1X 4LB5A 2DPUA 2E7XA 2PMUA 4EGZA 4KN4X 1WRJA 1PP7U 2P4WA 3G3ZA 3FZVA 5ICGA 4G7OF 1WQ2A 4RB2C 2PFBA 2YR2A 1FZPB 3VEPA 3HOSA 1FBUA 2MA3A 4UXNA 3RI4A 2RNJA 1IRGA 4ENNA 1ZREA 3ZN1A 3R0AA 4K2EA 3C1DA 4LK0F 4PDKA 4HLYA 4BAYA 2BBYA 1I6XA 5LHGA 3E5QA 4KICA 4EJUA 2H6CA 4ETSA 1MDMB 3FMRA 4Y15A 4YG2F 2YX4A 5ILSA 4ENKA 1MD0A 3GF2A 1FNNA 2O61A 1OYIA 2PI0A 4LB6B 1R23A 4I98B 4QWQA 1R7JA 2P7VB 3I4PA 1XN7A 4N9HA 4DNCA 5JI6A 3F22A 2XHKA 3T1BA 1KU7A 3DXJF 2ISZA 4IF4A 4L5JA 1F5TA 3IWFA 4AIHA 1U5TB 5LHIA 1U5TA 1HKTA 4I7HA 2NAZA 2EFQA 5H6RA 1EV7A 5AONA 1R5HA 2IP2A 1FP1D 4UV8A 2P6TA 1ZAOA 3HRUA 1HQCA 4RGSA 5K1YA 5FLXK 5L3DA 1LVAA 3FMQA 3ZMZA 2IT0A 2D45A 3GLXA 4WWCA 5HDKA 2QZ8A 5D6FA 5H6QA 2RDPA 3FXQA 1FYLA 3TOAA 2L4AA 1LQ1A 3L9FA 1RIOH 4AIJA 1ON1A 3TGNA 2VBXA 1G4DA 1JXSA 1OYWA 1S7OA 2ZNYA 3HRSA 4L0YB 1R1TA 3E6BA 3P7NA 5LHHA 4N9IA 2OA4A 4I2OA 2ZFWA 3JW4A 1NHAA 3M8EA 5L3EA 4IHTA 1BIAA 5DEQA 4LLNA 1FX7A 3L09A 4ESJA 1C0WA 1PP8F 1XMAA 1L0OC 1QGPA 3DEUA 3B73A 1CGPA 4UHTA 2R7DA 5HS7A 1FWZA 5E8IA 5LGTA 2EK5A 3CLOA 1IXSB 3WG9A 2M30A 2Q0OA 3WU0A 4KYWA 2Y0MA 4XRFA 3SZTA 3G73A 3VB2A 2K7LA 2ZKZA 1B1BA 1H9TA 2EB7A 2DW4A 2P7CB 1ZRCA 3LAPA 2DPDA 3GFMA 2XKPA 2L01A 5FLXZ 3B02A 3H3UA 2LF8A 4B09A 4XLNF 1B4AA 1YTYA 3WTUC 2CGPA 1Z91A 1R22A 2PQ8A 2ACJA 2AS5F 2LSOA 1S7AA 2PMHA 1IUYA 5ERIA 4IRIA 3K1NA 4HF2A 3KLNA 4HF0A 4EV0A 4IJAA 5TJJA 4M9SA 1GXQA 2M8EA 5K5RA 3RKYA 3I71A 3GW2A 3KP2A 1SMYF 4ASNA 1BI3A 2IPQX 3F6OA 4P9FA 4UVBA 1K7AA 1U5TC 2STTA 2O03A 5DDGA 4OOIA 3ZP5A 5FO5A 1I1GA 1MJBA 2DI3A 2VBZA 1YS6A 3F23A 1ZG1A 4KMFA 2Z3YA 1YS7A 1XSVA 2XAJA 1S29A 4A5NA 3L2CA 1XGOA 1UHWA 3LA2A 1O7FA 5BPDA 2WTEA 2FMYA 4EQQA 3F6VA 1XDSA 2ZCWA 4L9TA 5D5VB 1BIBA 3KP3A 2MBFA 2VONA 1BOAA 5CVJA 3BJAA 1MZBA 1FPQA 2HYFA 5LRRA 4WCGA 2A68F 4KUMA 3KP5A 3MAJA 1ODDA 1WSUA 4LD5A 1LEAA 3DKWA 1U78A 2PBIA 4N0BA 3D5LA 2DT5A 4HF1A 4Y17A 3BWGA 1ONVA 3TDUC 1TTYA 2UWMA 2EFNA 1FT9A 1ZARA 3F8BA 4DQ2A 1XB4A 4LGWA 4U0VA 1J9IA 3PQKA 2CW0F 1P92A 1HW1A 3OOPA 4ZH4F 2W57A 3MEXA 3GWZA 4AIKA 3QU6A 4Q5SF 4MEXF 5IT9Z 3R4KA 3GUDA 2H94A 4GO1A 1F1ZA 3QP6A 3WTTC 2EFOA 2KKOA 2XUBA 1IN8A 2R7FA 3V8LA 5LGNA 1IRFA 2RV8A 3V8JA 2K4JA 5LRSA 4LG0A 4HX4A 1HKQA 2DTRA 6PAXA 1XGNA 2DQRA 2QM3A 3ZMSA 3KLOA 4UVAA 5D5XB 3GO5A 4NB5A 2DK8A 3D0SA 3V7SA 2Y48A 4GGGA 1EH6A 2XV4S 2NS0A 2QWWA 2ZNZA 1XCBA 1BBYA 1HXDA 2YX7A 4GXOA 5DD4A 4ZYGA 3ZMUA 1QQIA 3GZ6A 3M7GA 1BN5A 4HV5A 3NEUA 2K02A 1U6GA 4RGUA 2LKPA 3KZYA 2PEXA 4WX9A 5DV5A 1T2KA 2AXLA 1SFUA 3EDPA 4M9ZA 1USSA 2COMA 5LEKA 2XASA 3RTRA 5BPIA 3WTSC 1RZ4A 1YW8A 4EMSA 3HSFA 4OIOF 5L3BA 3U2RA 3ZMVA 4EJOA 2HOEA 5E1ZB 2K86A 2GXGA 3QPTA 1P2FA 2ZMEB 1I5ZA 4IRGA 3RJPA 3IRRA 1ZH5A 2ELHA 2W85A 2VXZA 4FX0A 5D5UB 3N4MA 1W7PA 1ZG5A 4S05A 4G8XA 2JTVA 3F8NA 4OMZA 1XCVA 5CLSA 2Z99A 2VT2A 2EV0A 3KE2A 3WTZA 1AOYA 1HSJA 2A6EF 4M74A 3CO7C 2O0YA 1H9GA 4LLLA 5CVUA 1DP7P 3J80Z 1VTNC 3LQQA 3MFKA 2GAUA 3M9AA 4G6DA 1SMTA 4KA4A 4U0WA 5AIPA 1R36A 5D8KB 1W5SA 4G7ZF 1BJAA 4O5VA 4EJTA 1TW2A 3Q5FA 3GFLA 2FOKA 3M1EA 4EGYA 4KIFA 3T0YA 5JVTA 3FHZA 4BXUA 1JHFA 1XMKA 4HYEA 3ZMDA 1T0FA 3COAC 4BYYA 2HQNA 1J59A 1A04A 1MGTA 2PN6A 3ZN0A 4ENJA 1V4RA 3ZPLA 4WXHA 5FFZA 3EETA 1SD6A 3RKWA 3I5UA 5E20A 3LA7A 4U7DA 2ETHA 2FXAA 5LEJA 5HS9A 4L0ZB 1ZGAA 2QVOA 4XSZF 1SD5A 3S2WA 3QAHA 5H20A 2NNYA 4R8HA 3HIFA 3K2ZA 2EV5A 2HS5A 4YIIA 3JAMZ 5BMZA 1P4AA 2QQBA 3GYHX 1WKMA 3I58A 1FBQA 1SD4A 3EQLF 1K6OA 2RC4A 3SFZA 2JT1A 1YW7A 1LEBA 3IKTA 5ILUA 4RAZA 2DO7A 4O3MA 3V7CA 4G7HF 1AWCA 4IPAA 4XBFA 2P5KA 3E6MA 3I59A 4GYIA 1GHCA 2ZBKA 3ISPA 4AD9A 1IN7A 1Z1DA 2YU3A 3T5XA 2GA2A 2FNPA 1KQ9A 2F5EA 1OMIA 2DLLA 2VBWA 2STWA 5JR3A 4GCVA 3KP7A 2DFIA 1HW5A 2VBYA 2A69F 2MH9A 4MQ9F 4CZZA 4ZYHA 1G3TA 2FBKA 2FEZA 2ZO4A 2EWNA 2VODA 2HQRA 3ECOA 3BOQA 4KFCA 3KP6A 3ZQ7A 4H0EA 3WTVC 4A6DA 3KETA 3HTSB 5JHUA 5HDGA 3KZZA 5F64A 3FXRA 5KVRA 4Q4ZF 2FBHA 2ADUA 4MHGA 3M8FA 1ZRDA 3F8FA 2EJRA 5CVIA 1O3TA 3LFKA 1LJ9A 2J5OA 3KFWX 1ZRFA 2OAZA 2GZWA 5HLGA 3BP8A 4IRHA 3MZHA 5J8FA 4G9YA 5CJ9A 4F7ZA 3SXYA 1REPC 3FX3A 4A0XA 1J2XA 3HSRA 2V1XA 3F8MA 4JQFA 3DQVC 2V79A 4HQMA 5EEGA 1MDMA 4D0PA 2MH2A 3WU1B 4M73A 3RYPA 4EM1A 2ZJ2A 2CO5A 4P96A 2OQGA 5DYMA 1FC3A 4UUVA 1XSXA 3RYRA 4M9XA 1KU2A 2Y75A 4A6EA 1ZN2A 3WODF 2KIMA 4LLGF 5DCMA 2K27A 1FSHA 1RNLA 2KJBA 3Q9SA 2EV6A 1XD7A 2K4BA 3BJOA 5E1XA 3CUQB 3T8RA 2GIVA
chains in the Genus database with same CATH superfamily
2QQ9A 5CVRA 1JJ6C 3FK6A 3GVAA 2LY9A 4UB8C 1TBXA 1T6SA 3CZ6A 4B8XA 5KHDA 5HOOA 5LLQA 1EF4A 4I76A 3G1LA 3DTIA 1VQ9I 1TWGJ 2X6XA 3DPTA 2BZTA 4J01A 2F4IA 3DP7A 3GTQJ 3HSEA 4FT8A 1Z6TA 4IKFA 2CUFA 2RREA 4J00A 4ZYEA 2WA0A 3QODA 2DA7A 4A3CJ 4GYGA 4I02A 3ZCOA 3JSOA 4BHBA 2DA4A 3BTIA 1AU7A 5FD6A 1VZ0A 4BL0B 2IW5A 2YSRA 2AQEA 3J7AY 1G3YA 5J4VA 3BPXA 2IGOA 4Q48A 2KL4A 3VYRB 3FMSA 5GPAA 1S7EA 2O5RA 2DU9A 4BE1A 1HC8A 3F8CA 1P6RA 3PFIA 3F21A 1E2XA 3K4LA 4P5OA 3JTHA 2LBFA 4QPOA 1WJBA 2M0CA 2PLYA 1R58A 2LDUA 3I53A 3ZR8X 4A5MA 4ZDOA 2N8GA 2EIMH 3KEQA 4KT5C 5FKOA 2R5YA 2PG4A 2X1CA 4CZCA 1BA5A 1B9MA 1Y8QB 1TQMA 3LSJA 1Z05A 3IAS2 2K85A 4HBLA 1AHDP 2H6BA 3MZYA 2HPIA 1QVTA 4IHYA 4NUBA 2QLZA 1JHHA 4A0YA 2JK3A 3OYHA 3L2VA 4KDPA 3PUBA 1S3JA 1SFKA 3QYFA 1D0YA 2MSYA 1X19A 4PJMA 4PFOA 1T38A 4V19K 1F36A 1YE9A 1XGSA 5FGMA 1A6IA 4AWXB 3JCUC 3A2KA 1XX5A 2K3FA 3DWLE 3V4GA 5DM6F 4BJTA 5B1BH 2XKOA 3K1PA 4AVPA 1I27A 1J75A 4XIDA 2E36A 3CO6C 1I6HJ 1WH5A 1R1VA 3BQZA 3KCCA 1X4PA 4FHTA 2DODA 4F55A 3K4CA 3LWFA 2X1DA 5CPRB 1ZHFA 1IXCA 4OINF 2JQ7A 2NRAC 1APLC 3C3WA 1G6NA 1X3UA 4YFXF 2A61A 3GMEA 3TDZC 1WH7A 1A6QA 4XKWA 2O8KA 4AUXA 1MNMC 3JTGA 2OCCH 3U9GA 3O8GA 4YELA 4BQQA 1WZ2A 4XLAA 1TLHB 4A3FJ 3JAMK 3OR2C 4I6ZA 2FBIA 5KCMA 2CS3A 2QQAA 4KIGA 4L5IA 4Y13A 5DUIA 3IWZA 4HG2A 5F1JA 4DYQA 2ZXJA 1V5GA 4ZYAA 4XONA 4YFNF 1HLVA 1XPXA 3B6CA 4IHSA 4JBAA 4M3BA 3OWTA 3CDHA 2UV1A 1MSEC 1FTZA 4LJZF 1DU0A 2O9LA 2LKXA 2VOOA 2KIUA 4JP0A 4WK8F 2L54A 4QIWN 2EIKH 3J81K 1CF7A 3AAFA 2FU4A 3CCLI 2A3SA 1YJ9I 1FMWA 3AFHA 3DFGA 3EUHC 3HHGA 1P7JA 5EDNA 1B9NA 4CCKA 5JLWA 5EGOB 2NVTJ 1DPUA 5FKKA 1NG7A 2MD5A 2L5QA 3BCBA 5D5WB 5FKNA 1BM9A 4EM2A 2JMWA 2M45A 4YFKF 1JTXA 1ORKA 4ESFA 3OS0A 1S72I 1MMDA 1YIOA 4CCOA 1SAUA 4LMYA 3I3LA 5DCMB 3VWBA 2HVQA 1K79A 4CA0A 2ZMEC 2F5VA 4PFPA 2JSCA 2FF4A 2EA2A 2F5DA 1G3SA 2XF5A 4E7KA 4XM3A 2E2JJ 4HQEA 4C2TA 2G7UA 1XC5A 2W84A 2IVMA 3MCZA 1KQ0A 1OPCA 3DCFA 3MQ0A 4JX5A 2QUFA 3FM3A 2DAOA 4CCLA 3BZCA 2QBYB 2CSOA 3S17J 4WXDA 1STZA 2CYYA 5J1UA 3RKQA 3RPUD 1O7LA 3HOZJ 4E7HA 3CUQC 2M87A 5JFRA 3AL0B 3IL2A 1BI0A 2CQKA 2LF7A 1W36C 5IP9J 3H9QA 2HQAA 2EINH 4HLXA 3LL7A 4XNFA 4RBOA 3V8KA 2LH9A 1Z7UA 3CJNA 3AG2H 1QO0D 3BR6A 3A03A 3ML6A 1NTCA 3DBRB 5LGUA 2BVMA 2E71A 2ICWG 2VKEA 3VSLA 3GCMA 2CQ7A 3ESWB 1JKQC 2ZMEA 3R61A 2DDAA 3A0HC 3BT9A 3REOA 1USTA 1DU6A 4IOCF 3AG3H 1VQNI 4I01A 3SZPA 2KT0A 2W24A 1E3HA 4ZZLA 3ROUA 4WF2A 1D5VA 2YS9A 3MVPA 3NQOA 3JSPA 2XAQA 3E1SA 1QZZA 5FD5A 4HDUA 4CUGA 5M5WJ 4GDFA 4MGRA 2Q2EA 2W25A 4XKVA 1J7KA 5J8CA 2UUZA 5BS6A 1XTAA 3GTGJ 2F2EA 3ABLH 1FTTA 2M4KA 1LDJA 1EKEA 2QF7A 1UJ8A 2VQHA 2PMZA 2BGCA 5E17F 2CG4A 5DUKA 1J5YA 2EA4A 3IUOA 2B0LA 3CD6I 2KJCA 5GAHJ 2DMNA 2IGNA 2O3FA 1ENHA 5CVVA 2WY8Q 1IAWA 2R92J 2DJIA 1OCTC 4BXFA 3DKXA 5E18F 1T56A 1VQ5I 5F0FA 5C4JJ 3C18A 1Q1HA 1KYZA 2R7OA 2ZXIA 3K6GA 2DDBA 1O3RA 1P4XA 3ABKH 4Q47A 2DOFA 3BZ6A 4FX4A 2A6HF 2DN0A 2JVHA 1RUOA 1HBXG 3BTCA 4B48A 3CC4I 2CQNA 4M6VA 1Z9CA 2MLGA 2IJLA 4HX8A 2VPRA 3WG7H 3J81Z 1ZQ3P 4BEHA 2CWEA 2LK2A 4AU7A 3WGIA 3IKVA 5J40A 1PUFA 3WGHA 5IOZA 1RC9A 2E60A 3FXLA 1QZYA 1KA8A 4PSXA 5D4RA 1YW9A 5ICCA 3H3ZA 1OQYA 5D4SA 3SYTA 3I0TA 3A0BC 5CKTA 1V5FA 2XVCA 2DFEA 2W82A 2V1NA 2YUSA 1XSDA 3RQ4A 3BQYA 4I0BA 1CF7B 2WB1N 1UB9A 1U8BA 3R60A 4R1HA 2L7FP 1MNEA 2PX9A 2XAFA 2V1UA 3NWTA 3C2HA 1O3QA 3KEOA 2Z33A 3OYNA 1YG2A 4JX6A 1UHSA 3H35A 2XAGA 3IH2A 3SEQA 2G7HA 1Z3XA 2HOSA 1SEUA 4KIBA 4L9JA 2VC1A 2KZGA 3UNGC 1X1AA 3IHUA 4XLPF 3DEWA 4Z6YA 1FLIA 5K7ZA 4KMUX 5CQEA 2HTJA 4Y33A 5C3EJ 3KIOA 4ZTJA 5DCFA 1HKSA 2IEKA 2A5YB 2FJ1A 2DT7B 4ZC3A 3RDIA 3WHCA 3S8PA 3DPLC 3NARA 2NOJB 4BGDA 5HVQC 4IHWA 3CJTB 2DBBA 2X4HA 1V55H 1ULYA 3TEDA 4ANJA 4F52A 4MNUA 2V26A 5D8LB 2AXTC 2HYGD 1TWFJ 1A36A 4OU0A 1QHGA 3E6DA 2V4JC 1U3EM 3W6JB 3VOEA 3ZOBA 3FF5A 4XMYA 1YFHA 3CF5F 2OBPA 3SQNA 1W5TA 2KDZA 1LE8B 1H89C 1SD7A 4F91B 1LDDA 3HYIA 3WTWC 4AYBA 2P5LC 2HNHA 3P9CA 3ULQB 3WU2C 1VFCA 2D1VA 4CYCA 1SVOA 2XAHA 3FWEA 2ZXHA 2IA0A 1R4NB 2BHYA 2A5WA 2BYVE 2Z9OA 2FA5A 3QP5A 2JJ7A 2NNNA 4BS9A 3HOUJ 3CCVI 2VN2A 4M3DA 4A2UA 2PMZN 3TP0A 3OV8A 1MJ9A 1JUPA 3UKGA 3V7RA 4ESBA 3FHNA 1GV5A 1UG0A 1ZTRA 3JRBA 3L2UA 2HKOA 3HUGA 1UZCA 1P4WA 1TW3A 2Y30A 1GVDA 1JGSA 2VT3A 1OCRH 1W36D 5DD8A 2VUMJ 2R7RA 4BJ5C 4D7MA 5FRNA 2ESHA 1YX5A 4QPQA 3S3NA 3K10A 3HPHA 1VQ8I 2VE9A 3CC2I 4WXCA 1L3LA 1GVJA 4EM0B 2KQRA 2RVCA 1EJ9A 2W00A 4FCYA 1W4MA 3E3VA 1U9NA 1FOKA 5LFAA 1SFEA 1T08B 2F5CA 3G6EI 3LMMA 1EH7A 2E5NA 2R7UA 1D1AA 2EFPA 2FX0A 5A2QK 4P1WA 4PJ0C 1X1BA 1LB2A 2KMUA 2V1DA 2FMLA 3DLLF 3PO2J 1DPRA 4UVCA 4CCNA 1D8JA 4NBQA 4BDYA 1ZLKA 4LK1F 2GOXB 3ABTA 1YLFA 3OYEA 2Y2ZA 3HOWJ 3E97A 4H4KC 2AHQA 1IW7F 1VF9A 3ECHA 2KZVA 1BC7C 4HOBA 2VQGA 3HRTA 3HPGA 1RUNA 3I55I 1F4KA 4OIQF 3BROA 3FM5A 2XGXA 2CV0A 2ZJRF 2MC3A 5L3FA 1WJEA 1PUEE 1K78B 3SZGA 2XGEA 4JX4A 5E1WA 4BH9A 3WTYC 2W7NA 3P9KA 2W4SA 4C30A 3J80K 4FTHA 2QKLB 2VXDA 3SDBA 3DF8A 4G12A 4UNOA 1Y0NA 2VKDA 3W6KB 3O6BB 3QPHA 4C9YA 3U1DA 3WTXC 5K5QA 2L3DA 4BY7J 1ETYA 3S16J 4CCJA 2HZTA 4IZZA 1YO5C 2JWTA 2Y31A 2LR8A 4ZZDA 5J6XA 3LSTA 2HVRA 1I50J 1K78A 1BR4A 2OZUA 3T8TA 1E0EA 2X6YA 2DA1A 2RN7A 3SEZA 5HS8A 1JE8A 2E34A 3WHBA 1VQPI 4O6JA 5TRDA 5L3GA 2V6CA 1IF1A 3E6CC 4BQNA 5M5XJ 1MBKA 3HBLA 3RIRA 4MLOA 2M7BA 2ECCA 4AM3A 5LD2C 2ECBA 1VNDA 4IHXA 1Z3YA 1PVEA 1ETWA 3HKZA 3K4JA 2G9WA 4DJAA 2HVSA 2X0LA 4OIRF 4CYDA 4RB3C 2D1HA 1KU9A 2HKXA 4PGGA 1MW7A 2H8RA 2FOWA 3H0DA 1BC8C 5A2QZ 4DYCA 3PFYA 1FIPA 3C7JA 3L00A 1W7PD 4FISA 1IN6A 2ME6A 3SFIA 1FOXA 2IA2A 2LY1A 2OD5A 3HRMA 2F4MB 2KHMA 2WAQN 4HX7A 1ZG3A 3DV8A 4AC0A 1QRYA 3S15J 1ETKA 2EILH 1FOWA 5BOXA 3EUKL 4II3A 4XR6A 1JKPC 4CGZA 3PNTA 2E1OA 5IT3A 2KISA 2XPUA 1TNSA 3F72A 1ZKGA 3QRFF 5EYRA 4EEFG 2X6WA 1LKXA 2DA6A 3OY9A 3CCQI 3HL2A 2JA7J 1W1WE 1R49A 1V3FA 2VJIA 5FB2A 1I1SA 3K0LA 2E1NA 1I3QJ 2FUG2 1S6LA 4M71A 3H5NA 1KZHA 2KFDA 3I54A 2XRNA 2UXNA 1D3YA 1OJLA 2DYSH 2FNAA 2IA1A 1QPMA 2NYXA 3G1MA 3GFJA 3H1CA 3H0GJ 1OCZH 1MBFA 3W2VA 1U8RA 4KN7X 1O3SA 1U0JA 4HAMA 3M4OJ 1WGXA 4R79A 1QPIA 4BNCA 4RB1A 4MTDA 1UELB 1Z77A 2JA5J 4Y3OA 2DQLA 2W48A 2VI6A 4AIDA 1KQ8A 3LAJA 1KYWA 2P8TA 4CO8A 5F6FA 3K70D 3E5XA 5CYVA 5AIQA 2BY1A 5EEHA 4NHJA 2UZKA 1AKHB 2VE8A 2M1BA 3UR3C 2VOPA 1QBJA 4RS8A 2NXNB 5K5OA 4NC8A 2IRFG 2RGVA 4D7NA 3QOPA 3Q0VA 1JT0A 3EUAA 4JYKA 3P5JA 4MEYF 2GA1A 5IT9K 3CC7I 1SAXA 4U88A 2E1CA 4BHCA 3TO7A 1FP2A 5FJ8J 1WPKA 1YYVA 2BV6A 5GTHC 4Y52J 5D6EA 4HDVA 4XORA 3FKJA 2XB0X 2KDOA 1RKWA 2HOTA 1MBJA 2HFHA 4ZYDA 3F9KA 3ELKA 4KJZA 2WWYA 3DBLB 3PNYA 5EEAA 3MN2A 2GXBA 4HNTA 5B3SH 5ILVA 3S1QJ 2P81A 4LFUA 2A07F 2E7WA 1ON2A 1TQIA 4QLCU 1UHMA 2O8XA 2BE5F 4E6KG 1FIAA 4PZJA 1OCPA 3TO9A 1ETQA 1KU3A 1JUMA 1OYYA 3Q0WA 3M07A 1U2WA 4MTEA 4BJ6C 3KX2A 3BZKA 2VLAA 1Z0XA 3A02A 3FXUA 3TBIA 3KYLA 4ZJZA 4CH7A 3Q3SA 1S5LC 1I3AA 2MFZA 2XROA 4S04A 2LP0A 2OU2A 3F3XA 3VFZA 3IC7A 1MJAA 2DK5A 2D5VA 4A3LJ 1Y0UA 1E3OC 2Y0SA 2EZLA 3VODA 1UCRA 2HWVA 2KRCA 1QHHD 4XN0A 5E8GA 4G6TB 1H8AC 1IRZA 3QYEA 2CFXA 2CU7A 5BQTA 1O4XA 3LQRA 1SANA 3SHFA 1U9OA 4UUSB 5L3CA 4FE4A 2WC2A 1F9NA 3FK7A 2L4MA 2LOOA 3ASNH 5B5EC 3L2QA 2D2WA 3PQJA 4E70A 3TQNA 2KLOA 1EH8A 1LDKB 2NS8A 1MKMA 3AL0C 1GXPA 3ZMTA 1J09A 2JPBA 5JLXA 2V9VA 4XRSA 1SFXA 1X4OA 1S8NA 3K69A 3L7WA 1DUXC 2BOLA 3CTAA 1YRNA 3IAM2 2OUMA 4E7IA 4KNYA 1GV2A 3R0JA 1K61A 1XDUA 2H1KA 4UV9A 4NQWA 2HU9A 2VASA 3H92A 4A3BJ 1VI0A 3V42A 3HB9A 4KISA 4IVNA 2BY2A 1K4TA 1NK2P 3FBIB 2H09A 3FKIJ 3H9GA 4IXAA 3WE3A 1OCOH 1B59A 2HYJA 1ITYA 1WJCA 3O3KA 2VQCA 1O57A 2BEOA 5IP6A 2FSWA 1R9TJ 1FYMA 4NC6A 3CUQA 4L18B 2X9DA 3W2AA 1E3PA 3RPQA 1RI7A 2JSPA 4HW0A 1IV6A 3D5RC 4LG0B 4Y4RA 1XMXA 5HLHA 4A12A 4NQWB 5GAGJ 4G94A 1BI1A 2I10A 1TNTA 2F6CA 2HGCA 3U1KA 4ITVA 2R4GA 3FIWA 2CQXA 3LSHA 3I9V2 1IN4A 2FQ4A 3KP4A 2PJPA 5HDNA 1IZ1A 1FY7A 4BUPA 4TV7A 1MMSA 3OYDA 1HCRA 4XL9A 1ETXA 5HNHA 2F5FA 5DS9A 3HHHA 3R6SA 2J5PA 1Z6RA 4U7BA 1W7PB 1D8KA 5FLMJ 4BY1J 3S93A 4BQAA 3ZQCA 2CUEA 1Z21A 5FFXA 1T98A 4FE7A 2BW3B 2MLKA 3BY6A 3JRDA 2Z5UA 4EJVA 3GZ5A 1JKOC 1Y6IA 3TOBA 1B72B 3CCRI 2C6YA 2HOAA 5GP9A 3P9IA 3HG9A 2LLKA 4E7LA 2H27A 4A0ZA 1UFMA 1TQPA 1KGSA 1E17A 2L9VA 1HSTA 4CCMA 4OMYA 1T39A 3C2GA 2X51A 3KEYA 1MSFC 4RAYA 2VL8A 2QYOA 4KT6A 5F04A 4B1RA 3J7ZI 3RPUA 3W3CA 2VC0A 1FYKA 2L9RA 2XGDA 1SFOJ 3AKZA 1R00A 3DU5A 3DU6A 3EUHA 4AYBN 1FSEA 2QENA 5F27A 3WE2A 3GZNB 1WWXA 2JPCA 1RPWA 2HDCA 2EFWA 3GFIA 2WB1A 1PYVA 5HLIA 3N97A 3ZGKA 4G6QA 4PGHA 2JRMA 2OTLI 1LVKA 4CICA 1LNWA 1B6AA 3GTOJ 3Q9VA 1P9QC 2R5YB 2B7EA 4X6AJ 5F1RA 4PSWA 3I64A 3C2BA 4HSRA 3GX4X 1N77A 2GQQA 3CLQA 4CHUA 2HXIA 3TO6A 3QPLA 4DZPA 1FBSA 2M34A 2DJNA 4L9NA 4B44A 4L9VA 1RR8C 3BR0A 4D5CA 3K9TA 4M72A 5KK1A 2FE3A 2P5VA 3HUGB 3PSIA 4I0AA 2CV2A 2ISYA 3LA3A 3RKXA 4ENMA 2YU9J 4M3EA 2HEOA 5GPCA 4BU2A 1WHUA 5J1YA 1OLTA 2KIFA 1BI2A 4P55A 3TW7A 2K9LA 1HW2A 2BHZA 3K4BA 3IH4A 4HZFA 4YIFA 1VQ4I 1MBGA 2UXXA 3J7AO 1W0TA 2YPRA 2Y9ZA 2DCEA 4ON0A 4F3QA 1TT0A 4MIMA 2RKHA 5JHFA 3HOTA 2XB5A 3MKZA 2QBYA 1LPQA 5IP7J 2RAEA 5B66C 3GEZA 4RA2A 1R5ID 3QU3A 3VDXA 4RB0A 2LNBA 2DA3A 2JRTA 1R5GA 2CUZA 2ZSHB 3HTUA 4HA8A 4EJWA 2OQRA 3IRQA 3K1MA 4XKCA 1R1UA 2TDXA 1UG2A 3BDDA 9ANTA 3CESA 4OWRB 4CXFA 1YQAA 3NRVA 2QKMB 1YRNB 1IJWC 3RZOJ 2ZJQF 2CJJA 2O7OA 2M4GA 4JOMA 2M5WA 3I59B 4EVIA 2ESNA 3CUOA 2W1OA 2R3SA 3OYJA 5F0HA 2OZ6A 1TT5B 2JUCA 1ETOA 2TCTA 3CDLA 4ZDLA 4NNJA 1DDNA 3FISA 1H88C 1OR7A 1OKRA 2R0QC 3OIPA 4CDGA 2XRLA 2GWRA 2HTSA 1ZGJA 3OYAA 1WI9A 3E5UA 1MMGA 4PCQA 3EYIA 4I99C 4BHPA 2RQPA 5LBQA 3BJ6A 3OIQA 3I4NJ 2KRFA 5C44J 1YOVB 5ICFA 2L02A 4MQVA 3CQZJ 2IS2A 4XSXF 2BXZA 2NVQJ 1QNTA 4M6XA 1IG7A 2EPFA 1R6RA 2WV0A 1A5JA 1Z7LA 1ZLJA 5DTDA 4BE2A 3OL4A 3WGGA 5ICEA 5EF6A 2HQ5A 3QYBA 4RGRA 3TKYA 1B8IB 2CQQA 3MWMA 3O2PE 2R7VA 3OSGA 2P6SA 5ED4A 4U0YA 2L7MP 2FQ3A 3EYYA 4RGXA 4BBSJ 3K70C 1G3WA 1ZYRF 1IN5A 2XIGA 4A3IJ 1IXRC 3GXOA 2XGCA 1T8IA 1XGMA 2Q8KA 1J0RA 2R7WA 2XAUA 4DYRA 4ZDPA 2JZYA 4M3FA 4OIPF 1WI3A 3DTEA 2HR3A 2CRGA 1NH3A 5C4XJ 3ERED 1H0MA 1R71A 1PUFB 1IGNA 4Z2YA 3PSFA 3BPVA 2R7ZJ 5FLVA 2FRHA 4P9UA 5EG0A 1PDNC 3ABUA 2IS1A 3BG6A 2R5ZA 4HV6A 4M6YA 1NK3P 4I09A 4JK1X 2O6GE 4LB5A 2M7AA 3PJRA 4B4CA 2DPUA 2LG4A 2E7XA 3LSRA 3HOVJ 2V9PA 2PMUA 4EGZA 1N25A 4KN4X 3BR3A 1WRJA 2WAFA 1PP7U 2BVLA 2P4WA 3G3ZA 3FZVA 5ICGA 4G7OF 2QSGX 1WQ2A 4RB2C 2IXSA 3IP4B 2IS6A 2PFBA 4XLHA 1WVRA 2F4OB 2YR2A 1FZPB 2CFOA 2R5ZB 3VSKA 3VEPA 5EG0B 3JRCA 3HOSA 1FBUA 3G2BA 2MA3A 4NC7A 4UXNA 5IY5H 3OYGA 1SVMA 4XICA 3RI4A 2RNJA 4W97A 1TL8A 1IRGA 4ENNA 1ZREA 3ZN1A 4LIVA 2MG4A 4UUTA 3NWSA 5EZHA 3S32A 3KZIC 3R0AA 4K2EA 2LYCA 3C1DA 4LK0F 4PDKA 1OR7C 3ZQHA 4HLYA 3MKYB 4OAZA 3QQAA 4BAYA 2BBYA 1I6XA 2QGUA 5LHGA 5EGOA 3E5QA 4XLFA 2ZB9A 2EQRA 4KICA 4V2FA 2JVGA 4EJUA 2H6CA 4ETSA 3BCAA 5GADJ 3FMRA 1MDMB 4XLEA 2ME0A 4Y15A 4YG2F 2YX4A 5ILSA 4D5FA 4ENKA 2L2OA 1Q1VA 1MD0A 5M3FJ 3GF2A 1FNNA 2IGKA 3OYFA 2F48A 2LREA 1OYIA 3QPSA 2O61A 2Q2EB 1K6YA 2PI0A 4LB6B 1R23A 4BBRJ 3J7YJ 4I98B 4QWQA 5J3LA 1R7JA 2P7VB 3I4PA 1XN7A 4N9HA 4DNCA 3OS1A 5JI6A 1BR1A 3F22A 3BR1A 2MC4A 2XHKA 3T1BA 3ONQA 1KU7A 3DXJF 2ISZA 4W1UA 2QSHX 4IF4A 3OSFA 2E2HJ 4L5JA 1F5TA 1HF0A 3IWFA 4AIHA 3HEFA 4M3GA 4J19A 3L1PA 1GDTA 2QEXI 1U5TB 3GBGA 1U5TA 5LHIA 1HKTA 1R4MB 2ZXWH 1GUUA 4RLQA 4I7HA 2NAZA 2MD0A 2EFQA 3FBNB 2DOEA 5H6RA 1M1EB 1EV7A 2EZHA 5AONA 1R5HA 3S3MA 1LFUP 2IP2A 2A05A 3CF2A 3ZQQA 2L9SA 1FP1D 4UV8A 2P6TA 1MMAA 3BTJA 1ZAOA 1SVLA 2M0MA 1FEXA 3HRUA 1HQCA 4RGSA 5K1YA 5FLXK 3GTPJ 1Z67A 5L3DA 4XRMA 1T95A 1LVAA 3DBHB 3FMQA 2BXYA 2Y0SN 3ZMZA 5E3MA 2D45A 2IT0A 3GLXA 4WWCA 3S2DJ 2QZ8A 5D6FA 5H6QA 5HDKA 2RDPA 3FXQA 2QSFX 1FYLA 5DM7F 3TOAA 2L4AA 1LQ1A 3L9FA 1RIOH 3BR5A 5IOYA 4PJLA 4AIJA 1ON1A 3TGNA 1N75A 1VQ7I 4XK4A 2XSDC 2R7SA 2VBXA 3TL4X 1YITI 1G4DA 2LMDA 2H8WA 1OYWA 4X1EA 1JXSA 4D1QA 1S7OA 1MH4A 2ZNYA 3BG3A 3EPZA 3HRSA 4GFBA 5E79C 4L0YB 1R1TA 1F43A 3CJRB 3E6BA 3P7NA 1HDDC 5LHHA 4N9IA 2OA4A 2XDVA 2LD5A 4I2OA 4B3XA 2Z16A 3LSPA 4S0HB 2GXAA 1VQ6I 2K40A 2ZFWA 2X85A 3JW4A 3A01B 1NHAA 4C3JJ 3M8EA 5L3EA 4IHTA 4XRSG 3ZQFA 4A3KJ 3BG7A 1BIAA 5DEQA 4LLNA 1FX7A 3L09A 4ESJA 3H9JA 1WCMJ 3TP3A 1PP8F 1C0WA 1XMAA 1L0OC 1QGPA 3FDYA 1GLNA 3DEUA 3B73A 1CGPA 4UHTA 2R7DA 5HS7A 1FWZA 5E8IA 2KRHA 5LGTA 2EK5A 1X2MA 2V6EA 2MABA 3CLOA 4RM3A 3KYCB 3K7AJ 4L5EA 5EZGA 4DBRA 1RETA 3G71I 4RAGA 3LNQA 5HLTA 1IXSB 1X3WB 2FD5A 4RM2A 4LIUA 3WG9A 4HSTA 1Y1VJ 2JA2A 2NOGA 2M30A 2Q0OA 2B63J 3WU0A 2DOAA 4KYWA 2XPWA 3JREA 2Y0MA 3MKLA 3MZ8A 2Y9YA 4XRFA 3SZTA 3G73A 2E1MB 3VB2A 2K7LA 2ZKZA 1B1BA 1H9TA 2I5UA 1OISA 2EB7A 4RLFA 1T0FC 5GAEJ 4PK4A 2DW4A 3DEEA 2P7CB 1ZRCA 3SJMA 3LAPA 2DPDA 4HEA2 3GFMA 3LFUA 2XKPA 2L01A 5FLXZ 3B02A 1DP3A 2K3PA 3H3UA 2WV1A 2LY2A 4U87A 2LF8A 4B09A 1VQKI 2ID6A 1ETVA 1B8IA 2WAEA 1CQTA 4XLNF 1B4AA 3ASOH 3HDDA 1YTYA 3WTUC 1ACIA 5B1AH 2CGPA 4DGWB 4A93J 1XG1A 1R22A 1MBHA 1Y56A 1Z91A 2PQ8A 4IQ4A 4A3MJ 2ACJA 2AS5F 1TP4A 1I39A 1X58A 5GTIC 4KITB 2EBIA 2LSOA 2IS4A 1S7AA 2PMHA 3GTJJ 1IUYA 5ERIA 1Y39A 5BNGA 4IRIA 3K1NA 3A1YA 4HF2A 3KLNA 2KP6A 2M2EA 4HF0A 1JTYA 2COBA 4BACA 4NDLA 3ABMH 4XLCA 2WADA 2VPLA 4EV0A 2HDWA 4IJAA 5TJJA 1TWCJ 2DMQA 4BQOA 3SDGA 4M9SA 2KIQA 1GXQA 2M8EA 5K5RA 2AQFA 3RKYA 3I71A 3FXJA 1YX3A 1RKTA 3GW2A 2R7QA 1RRJA 3KP2A 3QWLA 1SMYF 2X48A 4ASNA 1BI3A 2ZJPF 2IPQX 3F6OA 1VQOI 4P9FA 3CCMI 1QVUA 4UVBA 1K7AA 1D0ZA 4LOCA 1U5TC 2STTA 2O03A 3S3OA 3K4MA 5DDGA 4XOPA 1AKHA 1QU3A 3A4CA 4OOIA 3ZP5A 5FO5A 4BE0A 1I1GA 5E3NA 1X3ZB 5HODA 1MJBA 2DI3A 2VBZA 1YS6A 3CP8A 3F23A 5IPAA 1ZG1A 2VIXA 4KMFA 2Z3YA 4ABZA 4Y7NJ 1YS7A 1XSVA 4CSWA 5FKMA 4UUSA 1X1PA 2XAJA 4GRIA 1S29A 4A5NA 1W0UA 2L0KA 3L2CA 1XGOA 1UHWA 3S14J 3JRFA 3LA2A 1O7FA 3LOCA 3HGYA 5BPDA 2WTEA 3Q0UA 5TGTA 4IEJA 2FMYA 3RSNA 4BEHB 3N05A 4EQQA 5H2FC 3F6VA 1XDSA 2ZCWA 5IYBJ 2WAQA 4L9TA 5D5VB 1MIJA 3H5AA 1BIBA 5E3LA 4CYCB 3KP3A 2MBFA 2OV7A 2GOMA 1BOAA 3OOUA 2VONA 5CVJA 2HI3A 3BJAA 1MZBA 1FPQA 2HYFA 5LRRA 2A68F 4WCGA 2DFFA 3KP5A 3MAJA 4KUMA 1ODDA 1WSUA 2OJED 4LD5A 1LEAA 2K9SA 3DKWA 1U78A 3VYSB 1MNDA 2PBIA 4N0BA 3D5LA 2CMPA 2DT5A 4HF1A 3BTLA 2BY0A 4Y17A 3BWGA 1ONVA 2HDDA 1IV8A 2EZKA 5E3OA 3TDUC 1TTYA 2ZFUA 1FJLA 3OYLA 2ZC2A 3W6VA 2UWMA 3TMOA 2XSJC 1G8XA 3M3YJ 2EFNA 2R7XA 1FT9A 2LKSA 1ZARA 3F8BA 4DQ2A 1XB4A 4LGWA 4U0VA 1J9IA 3PQKA 1X1CA 1P92A 1HW1A 2CW0F 5TISC 4EATA 3OOPA 4IQJA 3HOYJ 4ZH4F 5J47A 1G59A 2W57A 2RNGA 2BY3A 2MYSA 4F92B 2MGQA 3HXLA 2HZDA 4A3DJ 3MEXA 1IC8A 3GWZA 3H3VK 4AIKA 3QU6A 2DMPA 4Q5SF 4MEXF 5IT9Z 3BC8A 3R4KA 3GTLJ 3GUDA 3ERMA 2H94A 2MW8A 3K2AA 5FROA 4GO1A 3OS2A 1F1ZA 1JKRC 1D0XA 3OYBA 3QP6A 4XKBA 2EFOA 3HGGA 3RCOA 3WTTC 4E7ZA 2KKOA 2XUBA 1UMQA 1IN8A 1DGWY 2VKVA 1GT0C 2R7FA 3V8LA 5LGNA 2M8GX 4XQFA 1IRFA 1K4SA 3HJEA 2RV8A 2K9NA 1WJFA 3GTKJ 1A35A 2Y69H 1PJRA 3V8JA 2NVXJ 2K4JA 3G4SI 2DFHA 1POGA 5LRSA 4IO9F 3OIOA 4HX4A 4LG0A 2CV1A 2B9SA 1HKQA 2DTRA 2LBFB 3K4NA 6PAXA 2CW8A 2WY7Q 1XGNA 2DQRA 2QM3A 3IV5A 3ZMSA 3KLOA 2JA6J 3L2RA 2P0WA 4UVAA 5D5XB 3JRHA 2QQ8A 3GO5A 3KYDB 3PM1A 4NB5A 2DK8A 3D0SA 3V7SA 3RZDJ 2Y48A 4GGGA 1EH6A 3LSGA 1TWAJ 1BW6A 1N78A 1A31A 2CW7A 3ZQIA 4DZJA 2XV4S 1SC7A 3OR1C 1WJDA 2NS0A 1ZGWA 2QWWA 3CMMA 2ZNZA 3PUFA 1XCBA 1HOMA 3LSIA 3DKYA 4XOTA 3H36A 1BBYA 2VKHA 2HXOA 2NVYJ 2R7TA 1BW5A 1AA7A 1HXDA 2YX7A 4GXOA 5DD4A 4ZYGA 3ZMUA 1IUFA 2K9QA 1YJWI 1QQIA 2R93J 3GZ6A 3O8HA 3VYTB 1T33A 3M7GA 1BN5A 3NAUA 4C2MJ 4HV5A 3NEUA 3A01A 4DOZA 2K02A 1U6GA 4RGUA 3BR2A 2LKPA 1NG6A 2PEXA 3KZYA 4WX9A 2GLOA 5DV5A 1T2KA 2AXLA 4E7JA 1RR7A 2X1EA 1IO2A 3CCEI 1SFUA 3EDPA 4M9ZA 1JJ8C 4FASD 1USSA 2COMA 3S1MJ 5LEKA 3U21A 2XASA 3L2WA 5JVGF 1TWHJ 3RTRA 5BPIA 2KPMA 3X2QH 3WTSC 1V54H 3PNVA 1RZ4A 1ZR4A 1YW8A 4EMSA 3HSFA 2QA4I 4OIOF 1BJZA 5L3BA 2ZSIB 3U2RA 3ZMVA 5EJCA 4EJOA 1LE8A 2HOEA 5E1ZB 2K86A 2GXGA 1FMVA 1P2FA 3M1CA 2ZMEB 3QPTA 1I5ZA 4IRGA 4RMNA 3RJPA 3IRRA 1ZH5A 2EIJH 3I4MJ 1WFXA 2ELKA 2ELHA 2W85A 2LC2A 2VXZA 4FX0A 5D5UB 4C2UA 3N4MA 2L7ZA 2OPTA 3H5RA 4PJJA 1W7PA 1ZG5A 1WJ5A 2LVSA 4S05A 4MO7A 4G8XA 1VQMI 1YIJI 4II2A 1LFPA 2JTVA 3F8NA 4OMZA 1XCVA 2IBDA 5CLSA 5M5YJ 2Z99A 2CUJA 2VT2A 2EV0A 2L7KA 2OCEA 3HKZN 3KE2A 3WTZA 1AOYA 1YHQI 1HSJA 2A6EF 3CCJI 2Q1ZB 4M74A 4DBQA 4A3GJ 3CO7C 2O0YA 1H9GA 4LLLA 3BG5A 5CVUA 1DP7P 3J80Z 1VTNC 3ZQGA 2GBYA 3BG9A 2GIZA 3LQQA 1ZR2A 2PJRA 4MFDA 3MFKA 1WJAA 5FRMA 2GAUA 3M9AA 4G6DA 4DIQA 4UY8I 1SMTA 3BLYA 4KA4A 1ERDA 2IAIA 2XF7A 3VYUB 3E0JB 2HPMA 4U0WA 1LUJB 5AIPA 1R36A 1JI8A 5D8KB 1W5SA 4D9JA 3B6AA 4G7ZF 3CDIA 1BJAA 4O5VA 3ZRGA 1TW2A 2PJRB 1X2NA 4EJTA 4HRIA 3Q5FA 3GFLA 2FOKA 3M1EA 4EGYA 4KIFA 3CJQB 3AG1H 3CCYA 3T0YA 5HNFA 4BXUA 5JVTA 3FHZA 3D1NI 1JHFA 1XMKA 4E7SA 4HYEA 1IDZA 3K4KA 3ZMDA 1T0FA 1ZK8A 3COAC 4BYYA 2HQNA 1J59A 1A04A 2TRTA 5J4YA 2Z2SB 4LITA 1MGTA 3S1RJ 2DXIA 4FQGA 2PN6A 3ZN0A 4ENJA 1V4RA 3ZPLA 4WXHA 5FFZA 3G1OA 5J1RA 1XS9A 4HPQA 1HDPA 3EETA 2H1LA 4C3IJ 3KPHA 3JRAA 1SD6A 1FOYA 2CH0A 3RKWA 3I5UA 5E20A 3LA7A 4QTRA 2ELJA 4V2GA 5IYDJ 4U7DA 2GM4A 3ZXSA 2DMUA 4YIRX 5F08A 4E4HA 4C3HJ 1DQUA 2ETHA 2FXAA 5KAFC 5LEJA 5HS9A 4L0ZB 2NS7A 1ZGAA 2QVOA 2VB6A 1D1CA 1SD5A 4XSZF 5F0CA 1YJNI 3PL8A 3CCSI 3S2WA 3TW6A 3QAHA 4F93B 5H20A 2NNYA 3AG4H 3FXOA 1KONA 4R8HA 3HIFA 3K2ZA 2XC7A 1S9HA 2EV5A 2HS5A 4YIIA 3JAMZ 5BMZA 3FXKA 3LSMA 2VJJA 1P4AA 2QQBA 3CP2A 1UAAA 1ZELA 3GYHX 4QSHA 1BR2A 1WKMA 5K7HA 1MH3A 2VJ4A 3I58A 2X6OA 1FBQA 2JN6A 3OYCA 3OYMA 1SD4A 3EQLF 4A69C 2RC4A 1K6OA 2E19A 3SFZA 3HC7A 2JT1A 4PJNA 3DLAA 4N4OB 3MMYB 1YW7A 4MFEA 4AVZA 1LEBA 2I8DA 3IH3A 4B3AA 3IKTA 1RESA 5ILUA 1TC3C 3JR9A 4RAZA 2DO7A 4O3MA 2VJ5A 3V7CA 3CMYA 4X0GA 4G7HF 1W5CC 2DYRH 1AWCA 1OFCX 4IPAA 3OYKA 4YRVA 2JUGA 4XBFA 2V9KA 4XN3A 2P5KA 3HOXJ 2V7FA 2DT6A 1QZEA 1G2HA 1X1DA 3E6MA 5IYCJ 3I59A 4GYIA 1GHCA 2ZBKA 3GTMJ 3ISPA 2OTJI 4AD9A 1IN7A 4UB6C 1Z1DA 2YU3A 3T5XA 2GA2A 2FNPA 1KQ9A 1BOBA 1D1BA 4BXXJ 2F5EA 1OMIA 2DLLA 2M3AA 2VBWA 2STWA 3VPRA 5JR3A 3OMYA 4GCVA 3KP7A 2DFIA 1HW5A 2VBYA 2ID3A 2A69F 2E1MC 2LTPA 2MH9A 3PIPF 3ZQLA 4MQ9F 2XF6A 4CZZA 4ZYHA 2DMTA 3CCUI 1G3TA 2FBKA 2FEZA 2ZO4A 3JRIA 2EWNA 3HZJA 2IGMA 4HNVA 2HQRA 3ECOA 2VODA 2K9MA 4A3JJ 3BOQA 4KFCA 1V5EA 4DW6A 3KP6A 1IDYA 3ZQ7A 4H0EA 3WTVC 3RQIA 4A6DA 3FXMA 3KETA 3HTSB 5JHUA 3DPUA 2OF7A 3CMAI 4ZTFA 1JT6A 3QOEA 5HDGA 2E5ZA 3CMEI 3KZZA 3GLLA 5F64A 2DA2A 3MD2A 3FXRA 4LG3A 5KVRA 2FBHA 2ADUA 2VQLA 3M8FA 4MHGA 4Q4ZF 1TZLA 3F8FA 4HNUA 5M3MJ 4IX7A 2EJRA 3OYIA 1ZRDA 5CVIA 1O3TA 1K83J 3HM5A 2JA8J 5CQGA 3LFKA 1LJ9A 2J5OA 3KFWX 1HA8A 5KNLA 4N4NB 2NVUB 1ZRFA 2OAZA 1D5YA 2GZWA 3W2WA 5KAIC 5HLGA 3PIOF 1YI2I 3BP8A 2EZIA 2G0EA 2WBMA 4IRHA 2Z1DA 2DA5A 3PO3J 1MBEA 3S2HJ 2K5CA 3MZHA 4OAYA 5J8FA 1EA3A 4BDZA 4G9YA 5CJ9A 4F7ZA 3SXYA 3I56I 5K7FA 3M8JA 3MKWB 3S1NJ 2E35A 1REPC 2EH3A 3F0CA 3FX3A 4A0XA 1J2XA 2LFBA 3HSRA 2V1XA 3LSKA 3F8MA 2A6TA 4IOAF 1Y8RB 4A3EJ 4JQFA 1LFBA 2OC6A 2RQQA 3DQVC 2V79A 4HQMA 3E7LA 5EEGA 1BL0A 1OCCH 1MDMA 2M9HA 4D0PA 2MH2A 3WU1B 2L9NA 4M73A 2DTZA 3DTKA 3RYPA 4IL6C 4EM1A 3OL3A 1JGGA 2ZJ2A 2CO5A 5FKLA 2XPVA 4P96A 4B43A 1IRXA 2OQGA 5DYMA 1FC3A 4UUVA 1MMNA 4IHVA 4RAFA 4PUSA 1XSXA 3RYRA 4M9XA 2QCOA 1P7IA 1Y1WJ 4RDUA 1KU2A 4FETA 4B47A 2Y75A 4A6EA 1ZN2A 1DGRM 3D5SC 2KIMA 4LLGF 3WODF 1B72A 5DCMA 2K27A 1FSHA 1RNLA 1JUSA 2KJBA 3Q9SA 2EV6A 3JRGA 1XD7A 2K4BA 3BJOA 4YEJA 1VQLI 2AO9A 5E1XA 3CUQB 3T8RA 4BKXA 2BW3A 1QA6A 2E2IJ 2GIVA 2LRDA
chains in the Genus database with same CATH topology
2QQ9A 5CVRA 3GVAA 1TBXA 1T6SA 4B8XA 5HOOA 5LLQA 3DPTA 3DP7A 3HSEA 4FT8A 1Z6TA 4ZYEA 4GYGA 4I02A 3JSOA 4BHBA 5FD6A 2IW5A 2YSRA 1G3YA 3BPXA 4Q48A 3FMSA 2DU9A 3F8CA 1P6RA 3PFIA 3F21A 1E2XA 4P5OA 3JTHA 2PLYA 1R58A 2LDUA 3I53A 4A5MA 3KEQA 4KT5C 2PG4A 1B9MA 1TQMA 1Z05A 4HBLA 2H6BA 3MZYA 2QLZA 1JHHA 4A0YA 4KDPA 1S3JA 1T38A 5FGMA 1XGSA 4AWXB 3V4GA 2XKOA 3K1PA 4AVPA 1I27A 1J75A 3CO6C 1R1VA 3KCCA 4FHTA 3LWFA 1ZHFA 1IXCA 4OINF 2NRAC 3C3WA 1G6NA 1X3UA 4YFXF 2A61A 3TDZC 3JTGA 3U9GA 1TLHB 3JAMK 2FBIA 2QQAA 4KIGA 4L5IA 4Y13A 5DUIA 3IWZA 2ZXJA 4YFNF 4IHSA 4JBAA 3CDHA 4LJZF 2VOOA 2KIUA 4WK8F 2L54A 3J81K 1CF7A 3AAFA 2FU4A 2A3SA 3DFGA 3HHGA 1B9NA 1DPUA 2MD5A 5D5WB 4EM2A 1BM9A 4YFKF 2M45A 4ESFA 1YIOA 4LMYA 5DCMB 1K79A 2JSCA 2FF4A 2EA2A 2F5DA 1G3SA 4HQEA 2G7UA 2W84A 2IVMA 3MCZA 1KQ0A 1OPCA 3MQ0A 2QUFA 3FM3A 2DAOA 2QBYB 2CSOA 4WXDA 1STZA 2CYYA 1O7LA 3CUQC 2M87A 5JFRA 3IL2A 1BI0A 2CQKA 2LF7A 4HLXA 3V8KA 1Z7UA 3CJNA 1QO0D 3ML6A 5LGUA 2ZMEA 3R61A 3REOA 1USTA 4I01A 3SZPA 2W24A 4ZZLA 3ROUA 4WF2A 1D5VA 3NQOA 3JSPA 2XAQA 1QZZA 5FD5A 4HDUA 4MGRA 2Q2EA 2W25A 1J7KA 5J8CA 5BS6A 2F2EA 1LDJA 2BGCA 5E17F 2CG4A 5DUKA 1J5YA 2EA4A 2B0LA 2KJCA 2O3FA 5CVVA 1IAWA 5E18F 3C18A 1Q1HA 1KYZA 1O3RA 1P4XA 4Q47A 3BZ6A 4FX4A 2A6HF 1RUOA 1HBXG 1Z9CA 2MLGA 2IJLA 4HX8A 3J81Z 2CWEA 3WGIA 3IKVA 3WGHA 1QZYA 1KA8A 5D4RA 1YW9A 5ICCA 3H3ZA 5D4SA 3I0TA 2XVCA 1XSDA 4I0BA 1CF7B 1UB9A 3R60A 4R1HA 2XAFA 2V1UA 1O3QA 3KEOA 2Z33A 1YG2A 2XAGA 2G7HA 4KIBA 4L9JA 2VC1A 3IHUA 4XLPF 1FLIA 4KMUX 2HTJA 5DCFA 1HKSA 2A5YB 3RDIA 3DPLC 5HVQC 2DBBA 2X4HA 1ULYA 4MNUA 5D8LB 2HYGD 4OU0A 3E6DA 1U3EM 3W6JB 3VOEA 3FF5A 1YFHA 2OBPA 3SQNA 1W5TA 1SD7A 1LDDA 3HYIA 3WTWC 2P5LC 3P9CA 3ULQB 2D1VA 2XAHA 3FWEA 2IA0A 2Z9OA 2BYVE 2FA5A 3QP5A 2NNNA 2VN2A 4A2UA 3OV8A 1MJ9A 3V7RA 4ESBA 2HKOA 3HUGA 1P4WA 1TW3A 1JGSA 2VT3A 5DD8A 2ESHA 2VE9A 4WXCA 1L3LA 1GVJA 4EM0B 2RVCA 1W4MA 3E3VA 1FOKA 1SFEA 2F5CA 1EH7A 2EFPA 5A2QK 1LB2A 2V1DA 2FMLA 1DPRA 4UVCA 1D8JA 1ZLKA 4LK1F 3ABTA 1YLFA 3E97A 1IW7F 3ECHA 1BC7C 4HOBA 3HRTA 1RUNA 4OIQF 1F4KA 3BROA 3FM5A 2XGXA 2MC3A 5L3FA 1PUEE 1K78B 3WTYC 5E1WA 4BH9A 3P9KA 3J80K 3DF8A 4UNOA 3W6KB 3O6BB 3QPHA 3U1DA 3WTXC 5K5QA 2L3DA 1YO5C 2HZTA 4ZZDA 5J6XA 3LSTA 1K78A 2OZUA 3T8TA 2RN7A 5HS8A 1JE8A 4O6JA 5TRDA 5L3GA 2V6CA 1IF1A 3E6CC 3RIRA 2G9WA 2X0LA 4OIRF 4CYDA 4RB3C 2D1HA 1KU9A 2HKXA 4PGGA 1BC8C 5A2QZ 3C7JA 3L00A 1W7PD 1IN6A 2IA2A 2OD5A 3HRMA 4HX7A 1ZG3A 3DV8A 5BOXA 4CGZA 5IT3A 1TNSA 3F72A 3QRFF 1V3FA 1I1SA 5FB2A 3K0LA 2E1NA 4M71A 1S6LA 3I54A 2XRNA 2UXNA 1D3YA 2FNAA 2IA1A 1QPMA 2NYXA 3GFJA 1U8RA 4KN7X 1O3SA 4HAMA 4R79A 4BNCA 4RB1A 4MTDA 2DQLA 1KQ8A 3LAJA 1KYWA 2P8TA 4CO8A 5F6FA 3E5XA 5CYVA 5AIQA 5EEHA 4NHJA 2UZKA 2VE8A 2M1BA 2VOPA 1QBJA 4RS8A 5K5OA 2IRFG 2RGVA 3QOPA 4MEYF 2GA1A 5IT9K 1SAXA 4U88A 2E1CA 4BHCA 3TO7A 1FP2A 1YYVA 2BV6A 5D6EA 4HDVA 2HFHA 4ZYDA 2WWYA 3ELKA 2GXBA 5ILVA 4LFUA 2A07F 2E7WA 1ON2A 1TQIA 4QLCU 1UHMA 2O8XA 2BE5F 4PZJA 3TO9A 1KU3A 1OYYA 1U2WA 4MTEA 3FXUA 2XROA 4S04A 2OU2A 3F3XA 3VFZA 3IC7A 1MJAA 2DK5A 1Y0UA 3VODA 1UCRA 2HWVA 5E8GA 2CFXA 5BQTA 3LQRA 3SHFA 5L3CA 2WC2A 1F9NA 2L4MA 2D2WA 3PQJA 4E70A 3TQNA 1EH8A 1LDKB 1MKMA 1GXPA 3ZMTA 2JPBA 2V9VA 1SFXA 3K69A 1S8NA 3L7WA 1DUXC 3CTAA 4KNYA 3R0JA 1XDUA 4UV9A 4NQWA 3H92A 4IVNA 2H09A 4IXAA 3WE3A 1B59A 3O3KA 1O57A 2BEOA 2FSWA 1FYMA 3CUQA 4L18B 3RPQA 1RI7A 4LG0B 4HW0A 5HLHA 4A12A 4G94A 1BI1A 1TNTA 2HGCA 1IN4A 3KP4A 2PJPA 5HDNA 1IZ1A 1FY7A 4TV7A 2F5FA 3HHHA 3R6SA 2J5PA 1Z6RA 4U7BA 1W7PB 1D8KA 4BQAA 5FFXA 1T98A 2MLKA 3BY6A 2Z5UA 4EJVA 3GZ5A 3TOBA 2C6YA 3P9IA 2H27A 4A0ZA 1UFMA 1TQPA 1KGSA 1E17A 1HSTA 4OMYA 1T39A 4RAYA 2QYOA 3RPUA 2VC0A 1FYKA 1R00A 3EUHA 1FSEA 2QENA 3WE2A 1WWXA 2JPCA 2HDCA 2EFWA 3GFIA 5HLIA 3N97A 4G6QA 4PGHA 4CICA 1LNWA 1B6AA 3Q9VA 5F1RA 3I64A 3GX4X 2GQQA 4CHUA 3TO6A 1FBSA 4L9NA 4L9VA 3K9TA 4M72A 5KK1A 2FE3A 2P5VA 4I0AA 2ISYA 3LA3A 3RKXA 4ENMA 2HEOA 4P55A 2KIFA 1BI2A 1HW2A 4HZFA 4YIFA 3J7AO 2UXXA 2YPRA 4ON0A 2RKHA 3HOTA 2QBYA 3GEZA 3QU3A 4RB0A 2LNBA 2JRTA 1R5GA 3HTUA 4HA8A 4EJWA 2OQRA 3IRQA 3K1MA 1R1UA 2TDXA 3BDDA 4CXFA 1YQAA 3NRVA 2M5WA 3I59B 4EVIA 2ESNA 3CUOA 2R3SA 2OZ6A 1DDNA 1OR7A 1OKRA 4CDGA 2GWRA 2HTSA 1ZGJA 1WI9A 3E5UA 4PCQA 3EYIA 4BHPA 2RQPA 5LBQA 3BJ6A 2KRFA 5ICFA 2L02A 4MQVA 4XSXF 1QNTA 4M6XA 2WV0A 1ZLJA 3WGGA 5ICEA 4RGRA 3TKYA 3MWMA 3O2PE 2P6SA 5ED4A 4U0YA 2FQ3A 3EYYA 4RGXA 1G3WA 1ZYRF 1IN5A 2XIGA 1IXRC 3GXOA 1XGMA 2Q8KA 1J0RA 2JZYA 4OIPF 2HR3A 3ERED 1H0MA 4Z2YA 3BPVA 2FRHA 4P9UA 1PDNC 3ABUA 4HV6A 4M6YA 2O6GE 4I09A 4JK1X 4LB5A 2DPUA 2E7XA 2PMUA 4EGZA 4KN4X 1WRJA 1PP7U 2P4WA 3G3ZA 3FZVA 5ICGA 4G7OF 1WQ2A 4RB2C 2PFBA 2YR2A 1FZPB 3VEPA 3HOSA 1FBUA 2MA3A 4UXNA 3RI4A 2RNJA 1IRGA 4ENNA 1ZREA 3ZN1A 3R0AA 4K2EA 3C1DA 4LK0F 4PDKA 4HLYA 4BAYA 2BBYA 1I6XA 5LHGA 3E5QA 4KICA 4EJUA 2H6CA 4ETSA 1MDMB 3FMRA 4Y15A 4YG2F 2YX4A 5ILSA 4ENKA 1MD0A 3GF2A 1FNNA 2O61A 1OYIA 2PI0A 4LB6B 1R23A 4I98B 4QWQA 1R7JA 2P7VB 3I4PA 1XN7A 4N9HA 4DNCA 5JI6A 3F22A 2XHKA 3T1BA 1KU7A 3DXJF 2ISZA 4IF4A 4L5JA 1F5TA 3IWFA 4AIHA 1U5TB 5LHIA 1U5TA 1HKTA 4I7HA 2NAZA 2EFQA 5H6RA 1EV7A 5AONA 1R5HA 2IP2A 1FP1D 4UV8A 2P6TA 1ZAOA 3HRUA 1HQCA 4RGSA 5K1YA 5FLXK 5L3DA 1LVAA 3FMQA 3ZMZA 2IT0A 2D45A 3GLXA 4WWCA 5HDKA 2QZ8A 5D6FA 5H6QA 2RDPA 3FXQA 1FYLA 3TOAA 2L4AA 1LQ1A 3L9FA 1RIOH 4AIJA 1ON1A 3TGNA 2VBXA 1G4DA 1JXSA 1OYWA 1S7OA 2ZNYA 3HRSA 4L0YB 1R1TA 3E6BA 3P7NA 5LHHA 4N9IA 2OA4A 4I2OA 2ZFWA 3JW4A 1NHAA 3M8EA 5L3EA 4IHTA 1BIAA 5DEQA 4LLNA 1FX7A 3L09A 4ESJA 1C0WA 1PP8F 1XMAA 1L0OC 1QGPA 3DEUA 3B73A 1CGPA 4UHTA 2R7DA 5HS7A 1FWZA 5E8IA 5LGTA 2EK5A 3CLOA 1IXSB 3WG9A 2M30A 2Q0OA 3WU0A 4KYWA 2Y0MA 4XRFA 3SZTA 3G73A 3VB2A 2K7LA 2ZKZA 1B1BA 1H9TA 2EB7A 2DW4A 2P7CB 1ZRCA 3LAPA 2DPDA 3GFMA 2XKPA 2L01A 5FLXZ 3B02A 3H3UA 2LF8A 4B09A 4XLNF 1B4AA 1YTYA 3WTUC 2CGPA 1Z91A 1R22A 2PQ8A 2ACJA 2AS5F 2LSOA 1S7AA 2PMHA 1IUYA 5ERIA 4IRIA 3K1NA 4HF2A 3KLNA 4HF0A 4EV0A 4IJAA 5TJJA 4M9SA 1GXQA 2M8EA 5K5RA 3RKYA 3I71A 3GW2A 3KP2A 1SMYF 4ASNA 1BI3A 2IPQX 3F6OA 4P9FA 4UVBA 1K7AA 1U5TC 2STTA 2O03A 5DDGA 4OOIA 3ZP5A 5FO5A 1I1GA 1MJBA 2DI3A 2VBZA 1YS6A 3F23A 1ZG1A 4KMFA 2Z3YA 1YS7A 1XSVA 2XAJA 1S29A 4A5NA 3L2CA 1XGOA 1UHWA 3LA2A 1O7FA 5BPDA 2WTEA 2FMYA 4EQQA 3F6VA 1XDSA 2ZCWA 4L9TA 5D5VB 1BIBA 3KP3A 2MBFA 2VONA 1BOAA 5CVJA 3BJAA 1MZBA 1FPQA 2HYFA 5LRRA 4WCGA 2A68F 4KUMA 3KP5A 3MAJA 1ODDA 1WSUA 4LD5A 1LEAA 3DKWA 1U78A 2PBIA 4N0BA 3D5LA 2DT5A 4HF1A 4Y17A 3BWGA 1ONVA 3TDUC 1TTYA 2UWMA 2EFNA 1FT9A 1ZARA 3F8BA 4DQ2A 1XB4A 4LGWA 4U0VA 1J9IA 3PQKA 2CW0F 1P92A 1HW1A 3OOPA 4ZH4F 2W57A 3MEXA 3GWZA 4AIKA 3QU6A 4Q5SF 4MEXF 5IT9Z 3R4KA 3GUDA 2H94A 4GO1A 1F1ZA 3QP6A 3WTTC 2EFOA 2KKOA 2XUBA 1IN8A 2R7FA 3V8LA 5LGNA 1IRFA 2RV8A 3V8JA 2K4JA 5LRSA 4LG0A 4HX4A 1HKQA 2DTRA 6PAXA 1XGNA 2DQRA 2QM3A 3ZMSA 3KLOA 4UVAA 5D5XB 3GO5A 4NB5A 2DK8A 3D0SA 3V7SA 2Y48A 4GGGA 1EH6A 2XV4S 2NS0A 2QWWA 2ZNZA 1XCBA 1BBYA 1HXDA 2YX7A 4GXOA 5DD4A 4ZYGA 3ZMUA 1QQIA 3GZ6A 3M7GA 1BN5A 4HV5A 3NEUA 2K02A 1U6GA 4RGUA 2LKPA 3KZYA 2PEXA 4WX9A 5DV5A 1T2KA 2AXLA 1SFUA 3EDPA 4M9ZA 1USSA 2COMA 5LEKA 2XASA 3RTRA 5BPIA 3WTSC 1RZ4A 1YW8A 4EMSA 3HSFA 4OIOF 5L3BA 3U2RA 3ZMVA 4EJOA 2HOEA 5E1ZB 2K86A 2GXGA 3QPTA 1P2FA 2ZMEB 1I5ZA 4IRGA 3RJPA 3IRRA 1ZH5A 2ELHA 2W85A 2VXZA 4FX0A 5D5UB 3N4MA 1W7PA 1ZG5A 4S05A 4G8XA 2JTVA 3F8NA 4OMZA 1XCVA 5CLSA 2Z99A 2VT2A 2EV0A 3KE2A 3WTZA 1AOYA 1HSJA 2A6EF 4M74A 3CO7C 2O0YA 1H9GA 4LLLA 5CVUA 1DP7P 3J80Z 1VTNC 3LQQA 3MFKA 2GAUA 3M9AA 4G6DA 1SMTA 4KA4A 4U0WA 5AIPA 1R36A 5D8KB 1W5SA 4G7ZF 1BJAA 4O5VA 4EJTA 1TW2A 3Q5FA 3GFLA 2FOKA 3M1EA 4EGYA 4KIFA 3T0YA 5JVTA 3FHZA 4BXUA 1JHFA 1XMKA 4HYEA 3ZMDA 1T0FA 3COAC 4BYYA 2HQNA 1J59A 1A04A 1MGTA 2PN6A 3ZN0A 4ENJA 1V4RA 3ZPLA 4WXHA 5FFZA 3EETA 1SD6A 3RKWA 3I5UA 5E20A 3LA7A 4U7DA 2ETHA 2FXAA 5LEJA 5HS9A 4L0ZB 1ZGAA 2QVOA 4XSZF 1SD5A 3S2WA 3QAHA 5H20A 2NNYA 4R8HA 3HIFA 3K2ZA 2EV5A 2HS5A 4YIIA 3JAMZ 5BMZA 1P4AA 2QQBA 3GYHX 1WKMA 3I58A 1FBQA 1SD4A 3EQLF 1K6OA 2RC4A 3SFZA 2JT1A 1YW7A 1LEBA 3IKTA 5ILUA 4RAZA 2DO7A 4O3MA 3V7CA 4G7HF 1AWCA 4IPAA 4XBFA 2P5KA 3E6MA 3I59A 4GYIA 1GHCA 2ZBKA 3ISPA 4AD9A 1IN7A 1Z1DA 2YU3A 3T5XA 2GA2A 2FNPA 1KQ9A 2F5EA 1OMIA 2DLLA 2VBWA 2STWA 5JR3A 4GCVA 3KP7A 2DFIA 1HW5A 2VBYA 2A69F 2MH9A 4MQ9F 4CZZA 4ZYHA 1G3TA 2FBKA 2FEZA 2ZO4A 2EWNA 2VODA 2HQRA 3ECOA 3BOQA 4KFCA 3KP6A 3ZQ7A 4H0EA 3WTVC 4A6DA 3KETA 3HTSB 5JHUA 5HDGA 3KZZA 5F64A 3FXRA 5KVRA 4Q4ZF 2FBHA 2ADUA 4MHGA 3M8FA 1ZRDA 3F8FA 2EJRA 5CVIA 1O3TA 3LFKA 1LJ9A 2J5OA 3KFWX 1ZRFA 2OAZA 2GZWA 5HLGA 3BP8A 4IRHA 3MZHA 5J8FA 4G9YA 5CJ9A 4F7ZA 3SXYA 1REPC 3FX3A 4A0XA 1J2XA 3HSRA 2V1XA 3F8MA 4JQFA 3DQVC 2V79A 4HQMA 5EEGA 1MDMA 4D0PA 2MH2A 3WU1B 4M73A 3RYPA 4EM1A 2ZJ2A 2CO5A 4P96A 2OQGA 5DYMA 1FC3A 4UUVA 1XSXA 3RYRA 4M9XA 1KU2A 2Y75A 4A6EA 1ZN2A 3WODF 2KIMA 4LLGF 5DCMA 2K27A 1FSHA 1RNLA 2KJBA 3Q9SA 2EV6A 1XD7A 2K4BA 3BJOA 5E1XA 3CUQB 3T8RA 2GIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQ9 A;  5CVR A;  3GVA A;  1TBX A;  1T6S A;  4B8X A;  5HOO A;  5LLQ A;  3DPT A;  3DP7 A;  3HSE A;  4FT8 A;  1Z6T A;  4ZYE A;  4GYG A;  4I02 A;  3JSO A;  4BHB A;  5FD6 A;  2IW5 A;  2YSR A;  1G3Y A;  3BPX A;  4Q48 A;  3FMS A;  2DU9 A;  3F8C A;  1P6R A;  3PFI A;  3F21 A;  1E2X A;  4P5O A;  3JTH A;  2PLY A;  1R58 A;  2LDU A;  3I53 A;  4A5M A;  3KEQ A;  4KT5 C;  2PG4 A;  1B9M A;  1TQM A;  1Z05 A;  4HBL A;  2H6B A;  3MZY A;  2QLZ A;  1JHH A;  4A0Y A;  4KDP A;  1S3J A;  1T38 A;  5FGM A;  1XGS A;  4AWX B;  3V4G A;  2XKO A;  3K1P A;  4AVP A;  1I27 A;  1J75 A;  3CO6 C;  1R1V A;  3KCC A;  4FHT A;  3LWF A;  1ZHF A;  1IXC A;  4OIN F;  2NRA C;  3C3W A;  1G6N A;  1X3U A;  4YFX F;  2A61 A;  3TDZ C;  3JTG A;  3U9G A;  1TLH B;  3JAM K;  2FBI A;  2QQA A;  4KIG A;  4L5I A;  4Y13 A;  5DUI A;  3IWZ A;  2ZXJ A;  4YFN F;  4IHS A;  4JBA A;  3CDH A;  4LJZ F;  2VOO A;  2KIU A;  4WK8 F;  2L54 A;  3J81 K;  1CF7 A;  3AAF A;  2FU4 A;  2A3S A;  3DFG A;  3HHG A;  1B9N A;  1DPU A;  2MD5 A;  5D5W B;  4EM2 A;  1BM9 A;  4YFK F;  2M45 A;  4ESF A;  1YIO A;  4LMY A;  5DCM B;  1K79 A;  2JSC A;  2FF4 A;  2EA2 A;  2F5D A;  1G3S A;  4HQE A;  2G7U A;  2W84 A;  2IVM A;  3MCZ A;  1KQ0 A;  1OPC A;  3MQ0 A;  2QUF A;  3FM3 A;  2DAO A;  2QBY B;  2CSO A;  4WXD A;  1STZ A;  2CYY A;  1O7L A;  3CUQ C;  2M87 A;  5JFR A;  3IL2 A;  1BI0 A;  2CQK A;  2LF7 A;  4HLX A;  3V8K A;  1Z7U A;  3CJN A;  1QO0 D;  3ML6 A;  5LGU A;  2ZME A;  3R61 A;  3REO A;  1UST A;  4I01 A;  3SZP A;  2W24 A;  4ZZL A;  3ROU A;  4WF2 A;  1D5V A;  3NQO A;  3JSP A;  2XAQ A;  1QZZ A;  5FD5 A;  4HDU A;  4MGR A;  2Q2E A;  2W25 A;  1J7K A;  5J8C A;  5BS6 A;  2F2E A;  1LDJ A;  2BGC A;  5E17 F;  2CG4 A;  5DUK A;  1J5Y A;  2EA4 A;  2B0L A;  2KJC A;  2O3F A;  5CVV A;  1IAW A;  5E18 F;  3C18 A;  1Q1H A;  1KYZ A;  1O3R A;  1P4X A;  4Q47 A;  3BZ6 A;  4FX4 A;  2A6H F;  1RUO A;  1HBX G;  1Z9C A;  2MLG A;  2IJL A;  4HX8 A;  3J81 Z;  2CWE A;  3WGI A;  3IKV A;  3WGH A;  1QZY A;  1KA8 A;  5D4R A;  1YW9 A;  5ICC A;  3H3Z A;  5D4S A;  3I0T A;  2XVC A;  1XSD A;  4I0B A;  1CF7 B;  1UB9 A;  3R60 A;  4R1H A;  2XAF A;  2V1U A;  1O3Q A;  3KEO A;  2Z33 A;  1YG2 A;  2XAG A;  2G7H A;  4KIB A;  4L9J A;  2VC1 A;  3IHU A;  4XLP F;  1FLI A;  4KMU X;  2HTJ A;  5DCF A;  1HKS A;  2A5Y B;  3RDI A;  3DPL C;  5HVQ C;  2DBB A;  2X4H A;  1ULY A;  4MNU A;  5D8L B;  2HYG D;  4OU0 A;  3E6D A;  1U3E M;  3W6J B;  3VOE A;  3FF5 A;  1YFH A;  2OBP A;  3SQN A;  1W5T A;  1SD7 A;  1LDD A;  3HYI A;  3WTW C;  2P5L C;  3P9C A;  3ULQ B;  2D1V A;  2XAH A;  3FWE A;  2IA0 A;  2Z9O A;  2BYV E;  2FA5 A;  3QP5 A;  2NNN A;  2VN2 A;  4A2U A;  3OV8 A;  1MJ9 A;  3V7R A;  4ESB A;  2HKO A;  3HUG A;  1P4W A;  1TW3 A;  1JGS A;  2VT3 A;  5DD8 A;  2ESH A;  2VE9 A;  4WXC A;  1L3L A;  1GVJ A;  4EM0 B;  2RVC A;  1W4M A;  3E3V A;  1FOK A;  1SFE A;  2F5C A;  1EH7 A;  2EFP A;  5A2Q K;  1LB2 A;  2V1D A;  2FML A;  1DPR A;  4UVC A;  1D8J A;  1ZLK A;  4LK1 F;  3ABT A;  1YLF A;  3E97 A;  1IW7 F;  3ECH A;  1BC7 C;  4HOB A;  3HRT A;  1RUN A;  4OIQ F;  1F4K A;  3BRO A;  3FM5 A;  2XGX A;  2MC3 A;  5L3F A;  1PUE E;  1K78 B;  3WTY C;  5E1W A;  4BH9 A;  3P9K A;  3J80 K;  3DF8 A;  4UNO A;  3W6K B;  3O6B B;  3QPH A;  3U1D A;  3WTX C;  5K5Q A;  2L3D A;  1YO5 C;  2HZT A;  4ZZD A;  5J6X A;  3LST A;  1K78 A;  2OZU A;  3T8T A;  2RN7 A;  5HS8 A;  1JE8 A;  4O6J A;  5TRD A;  5L3G A;  2V6C A;  1IF1 A;  3E6C C;  3RIR A;  2G9W A;  2X0L A;  4OIR F;  4CYD A;  4RB3 C;  2D1H A;  1KU9 A;  2HKX A;  4PGG A;  1BC8 C;  5A2Q Z;  3C7J A;  3L00 A;  1W7P D;  1IN6 A;  2IA2 A;  2OD5 A;  3HRM A;  4HX7 A;  1ZG3 A;  3DV8 A;  5BOX A;  4CGZ A;  5IT3 A;  1TNS A;  3F72 A;  3QRF F;  1V3F A;  1I1S A;  5FB2 A;  3K0L A;  2E1N A;  4M71 A;  1S6L A;  3I54 A;  2XRN A;  2UXN A;  1D3Y A;  2FNA A;  2IA1 A;  1QPM A;  2NYX A;  3GFJ A;  1U8R A;  4KN7 X;  1O3S A;  4HAM A;  4R79 A;  4BNC A;  4RB1 A;  4MTD A;  2DQL A;  1KQ8 A;  3LAJ A;  1KYW A;  2P8T A;  4CO8 A;  5F6F A;  3E5X A;  5CYV A;  5AIQ A;  5EEH A;  4NHJ A;  2UZK A;  2VE8 A;  2M1B A;  2VOP A;  1QBJ A;  4RS8 A;  5K5O A;  2IRF G;  2RGV A;  3QOP A;  4MEY F;  2GA1 A;  5IT9 K;  1SAX A;  4U88 A;  2E1C A;  4BHC A;  3TO7 A;  1FP2 A;  1YYV A;  2BV6 A;  5D6E A;  4HDV A;  2HFH A;  4ZYD A;  2WWY A;  3ELK A;  2GXB A;  5ILV A;  4LFU A;  2A07 F;  2E7W A;  1ON2 A;  1TQI A;  4QLC U;  1UHM A;  2O8X A;  2BE5 F;  4PZJ A;  3TO9 A;  1KU3 A;  1OYY A;  1U2W A;  4MTE A;  3FXU A;  2XRO A;  4S04 A;  2OU2 A;  3F3X A;  3VFZ A;  3IC7 A;  1MJA A;  2DK5 A;  1Y0U A;  3VOD A;  1UCR A;  2HWV A;  5E8G A;  2CFX A;  5BQT A;  3LQR A;  3SHF A;  5L3C A;  2WC2 A;  1F9N A;  2L4M A;  2D2W A;  3PQJ A;  4E70 A;  3TQN A;  1EH8 A;  1LDK B;  1MKM A;  1GXP A;  3ZMT A;  2JPB A;  2V9V A;  1SFX A;  3K69 A;  1S8N A;  3L7W A;  1DUX C;  3CTA A;  4KNY A;  3R0J A;  1XDU A;  4UV9 A;  4NQW A;  3H92 A;  4IVN A;  2H09 A;  4IXA A;  3WE3 A;  1B59 A;  3O3K A;  1O57 A;  2BEO A;  2FSW A;  1FYM A;  3CUQ A;  4L18 B;  3RPQ A;  1RI7 A;  4LG0 B;  4HW0 A;  5HLH A;  4A12 A;  4G94 A;  1BI1 A;  1TNT A;  2HGC A;  1IN4 A;  3KP4 A;  2PJP A;  5HDN A;  1IZ1 A;  1FY7 A;  4TV7 A;  2F5F A;  3HHH A;  3R6S A;  2J5P A;  1Z6R A;  4U7B A;  1W7P B;  1D8K A;  4BQA A;  5FFX A;  1T98 A;  2MLK A;  3BY6 A;  2Z5U A;  4EJV A;  3GZ5 A;  3TOB A;  2C6Y A;  3P9I A;  2H27 A;  4A0Z A;  1UFM A;  1TQP A;  1KGS A;  1E17 A;  1HST A;  4OMY A;  1T39 A;  4RAY A;  2QYO A;  3RPU A;  2VC0 A;  1FYK A;  1R00 A;  3EUH A;  1FSE A;  2QEN A;  3WE2 A;  1WWX A;  2JPC A;  2HDC A;  2EFW A;  3GFI A;  5HLI A;  3N97 A;  4G6Q A;  4PGH A;  4CIC A;  1LNW A;  1B6A A;  3Q9V A;  5F1R A;  3I64 A;  3GX4 X;  2GQQ A;  4CHU A;  3TO6 A;  1FBS A;  4L9N A;  4L9V A;  3K9T A;  4M72 A;  5KK1 A;  2FE3 A;  2P5V A;  4I0A A;  2ISY A;  3LA3 A;  3RKX A;  4ENM A;  2HEO A;  4P55 A;  2KIF A;  1BI2 A;  1HW2 A;  4HZF A;  4YIF A;  3J7A O;  2UXX A;  2YPR A;  4ON0 A;  2RKH A;  3HOT A;  2QBY A;  3GEZ A;  3QU3 A;  4RB0 A;  2LNB A;  2JRT A;  1R5G A;  3HTU A;  4HA8 A;  4EJW A;  2OQR A;  3IRQ A;  3K1M A;  1R1U A;  2TDX A;  3BDD A;  4CXF A;  1YQA A;  3NRV A;  2M5W A;  3I59 B;  4EVI A;  2ESN A;  3CUO A;  2R3S A;  2OZ6 A;  1DDN A;  1OR7 A;  1OKR A;  4CDG A;  2GWR A;  2HTS A;  1ZGJ A;  1WI9 A;  3E5U A;  4PCQ A;  3EYI A;  4BHP A;  2RQP A;  5LBQ A;  3BJ6 A;  2KRF A;  5ICF A;  2L02 A;  4MQV A;  4XSX F;  1QNT A;  4M6X A;  2WV0 A;  1ZLJ A;  3WGG A;  5ICE A;  4RGR A;  3TKY A;  3MWM A;  3O2P E;  2P6S A;  5ED4 A;  4U0Y A;  2FQ3 A;  3EYY A;  4RGX A;  1G3W A;  1ZYR F;  1IN5 A;  2XIG A;  1IXR C;  3GXO A;  1XGM A;  2Q8K A;  1J0R A;  2JZY A;  4OIP F;  2HR3 A;  3ERE D;  1H0M A;  4Z2Y A;  3BPV A;  2FRH A;  4P9U A;  1PDN C;  3ABU A;  4HV6 A;  4M6Y A;  2O6G E;  4I09 A;  4JK1 X;  4LB5 A;  2DPU A;  2E7X A;  2PMU A;  4EGZ A;  4KN4 X;  1WRJ A;  1PP7 U;  2P4W A;  3G3Z A;  3FZV A;  5ICG A;  4G7O F;  1WQ2 A;  4RB2 C;  2PFB A;  2YR2 A;  1FZP B;  3VEP A;  3HOS A;  1FBU A;  2MA3 A;  4UXN A;  3RI4 A;  2RNJ A;  1IRG A;  4ENN A;  1ZRE A;  3ZN1 A;  3R0A A;  4K2E A;  3C1D A;  4LK0 F;  4PDK A;  4HLY A;  4BAY A;  2BBY A;  1I6X A;  5LHG A;  3E5Q A;  4KIC A;  4EJU A;  2H6C A;  4ETS A;  1MDM B;  3FMR A;  4Y15 A;  4YG2 F;  2YX4 A;  5ILS A;  4ENK A;  1MD0 A;  3GF2 A;  1FNN A;  2O61 A;  1OYI A;  2PI0 A;  4LB6 B;  1R23 A;  4I98 B;  4QWQ A;  1R7J A;  2P7V B;  3I4P A;  1XN7 A;  4N9H A;  4DNC A;  5JI6 A;  3F22 A;  2XHK A;  3T1B A;  1KU7 A;  3DXJ F;  2ISZ A;  4IF4 A;  4L5J A;  1F5T A;  3IWF A;  4AIH A;  1U5T B;  5LHI A;  1U5T A;  1HKT A;  4I7H A;  2NAZ A;  2EFQ A;  5H6R A;  1EV7 A;  5AON A;  1R5H A;  2IP2 A;  1FP1 D;  4UV8 A;  2P6T A;  1ZAO A;  3HRU A;  1HQC A;  4RGS A;  5K1Y A;  5FLX K;  5L3D A;  1LVA A;  3FMQ A;  3ZMZ A;  2IT0 A;  2D45 A;  3GLX A;  4WWC A;  5HDK A;  2QZ8 A;  5D6F A;  5H6Q A;  2RDP A;  3FXQ A;  1FYL A;  3TOA A;  2L4A A;  1LQ1 A;  3L9F A;  1RIO H;  4AIJ A;  1ON1 A;  3TGN A;  2VBX A;  1G4D A;  1JXS A;  1OYW A;  1S7O A;  2ZNY A;  3HRS A;  4L0Y B;  1R1T A;  3E6B A;  3P7N A;  5LHH A;  4N9I A;  2OA4 A;  4I2O A;  2ZFW A;  3JW4 A;  1NHA A;  3M8E A;  5L3E A;  4IHT A;  1BIA A;  5DEQ A;  4LLN A;  1FX7 A;  3L09 A;  4ESJ A;  1C0W A;  1PP8 F;  1XMA A;  1L0O C;  1QGP A;  3DEU A;  3B73 A;  1CGP A;  4UHT A;  2R7D A;  5HS7 A;  1FWZ A;  5E8I A;  5LGT A;  2EK5 A;  3CLO A;  1IXS B;  3WG9 A;  2M30 A;  2Q0O A;  3WU0 A;  4KYW A;  2Y0M A;  4XRF A;  3SZT A;  3G73 A;  3VB2 A;  2K7L A;  2ZKZ A;  1B1B A;  1H9T A;  2EB7 A;  2DW4 A;  2P7C B;  1ZRC A;  3LAP A;  2DPD A;  3GFM A;  2XKP A;  2L01 A;  5FLX Z;  3B02 A;  3H3U A;  2LF8 A;  4B09 A;  4XLN F;  1B4A A;  1YTY A;  3WTU C;  2CGP A;  1Z91 A;  1R22 A;  2PQ8 A;  2ACJ A;  2AS5 F;  2LSO A;  1S7A A;  2PMH A;  1IUY A;  5ERI A;  4IRI A;  3K1N A;  4HF2 A;  3KLN A;  4HF0 A;  4EV0 A;  4IJA A;  5TJJ A;  4M9S A;  1GXQ A;  2M8E A;  5K5R A;  3RKY A;  3I71 A;  3GW2 A;  3KP2 A;  1SMY F;  4ASN A;  1BI3 A;  2IPQ X;  3F6O A;  4P9F A;  4UVB A;  1K7A A;  1U5T C;  2STT A;  2O03 A;  5DDG A;  4OOI A;  3ZP5 A;  5FO5 A;  1I1G A;  1MJB A;  2DI3 A;  2VBZ A;  1YS6 A;  3F23 A;  1ZG1 A;  4KMF A;  2Z3Y A;  1YS7 A;  1XSV A;  2XAJ A;  1S29 A;  4A5N A;  3L2C A;  1XGO A;  1UHW A;  3LA2 A;  1O7F A;  5BPD A;  2WTE A;  2FMY A;  4EQQ A;  3F6V A;  1XDS A;  2ZCW A;  4L9T A;  5D5V B;  1BIB A;  3KP3 A;  2MBF A;  2VON A;  1BOA A;  5CVJ A;  3BJA A;  1MZB A;  1FPQ A;  2HYF A;  5LRR A;  4WCG A;  2A68 F;  4KUM A;  3KP5 A;  3MAJ A;  1ODD A;  1WSU A;  4LD5 A;  1LEA A;  3DKW A;  1U78 A;  2PBI A;  4N0B A;  3D5L A;  2DT5 A;  4HF1 A;  4Y17 A;  3BWG A;  1ONV A;  3TDU C;  1TTY A;  2UWM A;  2EFN A;  1FT9 A;  1ZAR A;  3F8B A;  4DQ2 A;  1XB4 A;  4LGW A;  4U0V A;  1J9I A;  3PQK A;  2CW0 F;  1P92 A;  1HW1 A;  3OOP A;  4ZH4 F;  2W57 A;  3MEX A;  3GWZ A;  4AIK A;  3QU6 A;  4Q5S F;  4MEX F;  5IT9 Z;  3R4K A;  3GUD A;  2H94 A;  4GO1 A;  1F1Z A;  3QP6 A;  3WTT C;  2EFO A;  2KKO A;  2XUB A;  1IN8 A;  2R7F A;  3V8L A;  5LGN A;  1IRF A;  2RV8 A;  3V8J A;  2K4J A;  5LRS A;  4LG0 A;  4HX4 A;  1HKQ A;  2DTR A;  6PAX A;  1XGN A;  2DQR A;  2QM3 A;  3ZMS A;  3KLO A;  4UVA A;  5D5X B;  3GO5 A;  4NB5 A;  2DK8 A;  3D0S A;  3V7S A;  2Y48 A;  4GGG A;  1EH6 A;  2XV4 S;  2NS0 A;  2QWW A;  2ZNZ A;  1XCB A;  1BBY A;  1HXD A;  2YX7 A;  4GXO A;  5DD4 A;  4ZYG A;  3ZMU A;  1QQI A;  3GZ6 A;  3M7G A;  1BN5 A;  4HV5 A;  3NEU A;  2K02 A;  1U6G A;  4RGU A;  2LKP A;  3KZY A;  2PEX A;  4WX9 A;  5DV5 A;  1T2K A;  2AXL A;  1SFU A;  3EDP A;  4M9Z A;  1USS A;  2COM A;  5LEK A;  2XAS A;  3RTR A;  5BPI A;  3WTS C;  1RZ4 A;  1YW8 A;  4EMS A;  3HSF A;  4OIO F;  5L3B A;  3U2R A;  3ZMV A;  4EJO A;  2HOE A;  5E1Z B;  2K86 A;  2GXG A;  3QPT A;  1P2F A;  2ZME B;  1I5Z A;  4IRG A;  3RJP A;  3IRR A;  1ZH5 A;  2ELH A;  2W85 A;  2VXZ A;  4FX0 A;  5D5U B;  3N4M A;  1W7P A;  1ZG5 A;  4S05 A;  4G8X A;  2JTV A;  3F8N A;  4OMZ A;  1XCV A;  5CLS A;  2Z99 A;  2VT2 A;  2EV0 A;  3KE2 A;  3WTZ A;  1AOY A;  1HSJ A;  2A6E F;  4M74 A;  3CO7 C;  2O0Y A;  1H9G A;  4LLL A;  5CVU A;  1DP7 P;  3J80 Z;  1VTN C;  3LQQ A;  3MFK A;  2GAU A;  3M9A A;  4G6D A;  1SMT A;  4KA4 A;  4U0W A;  5AIP A;  1R36 A;  5D8K B;  1W5S A;  4G7Z F;  1BJA A;  4O5V A;  4EJT A;  1TW2 A;  3Q5F A;  3GFL A;  2FOK A;  3M1E A;  4EGY A;  4KIF A;  3T0Y A;  5JVT A;  3FHZ A;  4BXU A;  1JHF A;  1XMK A;  4HYE A;  3ZMD A;  1T0F A;  3COA C;  4BYY A;  2HQN A;  1J59 A;  1A04 A;  1MGT A;  2PN6 A;  3ZN0 A;  4ENJ A;  1V4R A;  3ZPL A;  4WXH A;  5FFZ A;  3EET A;  1SD6 A;  3RKW A;  3I5U A;  5E20 A;  3LA7 A;  4U7D A;  2ETH A;  2FXA A;  5LEJ A;  5HS9 A;  4L0Z B;  1ZGA A;  2QVO A;  4XSZ F;  1SD5 A;  3S2W A;  3QAH A;  5H20 A;  2NNY A;  4R8H A;  3HIF A;  3K2Z A;  2EV5 A;  2HS5 A;  4YII A;  3JAM Z;  5BMZ A;  1P4A A;  2QQB A;  3GYH X;  1WKM A;  3I58 A;  1FBQ A;  1SD4 A;  3EQL F;  1K6O A;  2RC4 A;  3SFZ A;  2JT1 A;  1YW7 A;  1LEB A;  3IKT A;  5ILU A;  4RAZ A;  2DO7 A;  4O3M A;  3V7C A;  4G7H F;  1AWC A;  4IPA A;  4XBF A;  2P5K A;  3E6M A;  3I59 A;  4GYI A;  1GHC A;  2ZBK A;  3ISP A;  4AD9 A;  1IN7 A;  1Z1D A;  2YU3 A;  3T5X A;  2GA2 A;  2FNP A;  1KQ9 A;  2F5E A;  1OMI A;  2DLL A;  2VBW A;  2STW A;  5JR3 A;  4GCV A;  3KP7 A;  2DFI A;  1HW5 A;  2VBY A;  2A69 F;  2MH9 A;  4MQ9 F;  4CZZ A;  4ZYH A;  1G3T A;  2FBK A;  2FEZ A;  2ZO4 A;  2EWN A;  2VOD A;  2HQR A;  3ECO A;  3BOQ A;  4KFC A;  3KP6 A;  3ZQ7 A;  4H0E A;  3WTV C;  4A6D A;  3KET A;  3HTS B;  5JHU A;  5HDG A;  3KZZ A;  5F64 A;  3FXR A;  5KVR A;  4Q4Z F;  2FBH A;  2ADU A;  4MHG A;  3M8F A;  1ZRD A;  3F8F A;  2EJR A;  5CVI A;  1O3T A;  3LFK A;  1LJ9 A;  2J5O A;  3KFW X;  1ZRF A;  2OAZ A;  2GZW A;  5HLG A;  3BP8 A;  4IRH A;  3MZH A;  5J8F A;  4G9Y A;  5CJ9 A;  4F7Z A;  3SXY A;  1REP C;  3FX3 A;  4A0X A;  1J2X A;  3HSR A;  2V1X A;  3F8M A;  4JQF A;  3DQV C;  2V79 A;  4HQM A;  5EEG A;  1MDM A;  4D0P A;  2MH2 A;  3WU1 B;  4M73 A;  3RYP A;  4EM1 A;  2ZJ2 A;  2CO5 A;  4P96 A;  2OQG A;  5DYM A;  1FC3 A;  4UUV A;  1XSX A;  3RYR A;  4M9X A;  1KU2 A;  2Y75 A;  4A6E A;  1ZN2 A;  3WOD F;  2KIM A;  4LLG F;  5DCM A;  2K27 A;  1FSH A;  1RNL A;  2KJB A;  3Q9S A;  2EV6 A;  1XD7 A;  2K4B A;  3BJO A;  5E1X A;  3CUQ B;  3T8R A;  2GIV A; 
#chains in the Genus database with same CATH topology
 2QQ9 A;  5CVR A;  1JJ6 C;  3FK6 A;  3GVA A;  2LY9 A;  4UB8 C;  1TBX A;  1T6S A;  3CZ6 A;  4B8X A;  5KHD A;  5HOO A;  5LLQ A;  1EF4 A;  4I76 A;  3G1L A;  3DTI A;  1VQ9 I;  1TWG J;  2X6X A;  3DPT A;  2BZT A;  4J01 A;  2F4I A;  3DP7 A;  3GTQ J;  3HSE A;  4FT8 A;  1Z6T A;  4IKF A;  2CUF A;  2RRE A;  4J00 A;  4ZYE A;  2WA0 A;  3QOD A;  2DA7 A;  4A3C J;  4GYG A;  4I02 A;  3ZCO A;  3JSO A;  4BHB A;  2DA4 A;  3BTI A;  1AU7 A;  5FD6 A;  1VZ0 A;  4BL0 B;  2IW5 A;  2YSR A;  2AQE A;  3J7A Y;  1G3Y A;  5J4V A;  3BPX A;  2IGO A;  4Q48 A;  2KL4 A;  3VYR B;  3FMS A;  5GPA A;  1S7E A;  2O5R A;  2DU9 A;  4BE1 A;  1HC8 A;  3F8C A;  1P6R A;  3PFI A;  3F21 A;  1E2X A;  3K4L A;  4P5O A;  3JTH A;  2LBF A;  4QPO A;  1WJB A;  2M0C A;  2PLY A;  1R58 A;  2LDU A;  3I53 A;  3ZR8 X;  4A5M A;  4ZDO A;  2N8G A;  2EIM H;  3KEQ A;  4KT5 C;  5FKO A;  2R5Y A;  2PG4 A;  2X1C A;  4CZC A;  1BA5 A;  1B9M A;  1Y8Q B;  1TQM A;  3LSJ A;  1Z05 A;  3IAS 2;  2K85 A;  4HBL A;  1AHD P;  2H6B A;  3MZY A;  2HPI A;  1QVT A;  4IHY A;  4NUB A;  2QLZ A;  1JHH A;  4A0Y A;  2JK3 A;  3OYH A;  3L2V A;  4KDP A;  3PUB A;  1S3J A;  1SFK A;  3QYF A;  1D0Y A;  2MSY A;  1X19 A;  4PJM A;  4PFO A;  1T38 A;  4V19 K;  1F36 A;  1YE9 A;  1XGS A;  5FGM A;  1A6I A;  4AWX B;  3JCU C;  3A2K A;  1XX5 A;  2K3F A;  3DWL E;  3V4G A;  5DM6 F;  4BJT A;  5B1B H;  2XKO A;  3K1P A;  4AVP A;  1I27 A;  1J75 A;  4XID A;  2E36 A;  3CO6 C;  1I6H J;  1WH5 A;  1R1V A;  3BQZ A;  3KCC A;  1X4P A;  4FHT A;  2DOD A;  4F55 A;  3K4C A;  3LWF A;  2X1D A;  5CPR B;  1ZHF A;  1IXC A;  4OIN F;  2JQ7 A;  2NRA C;  1APL C;  3C3W A;  1G6N A;  1X3U A;  4YFX F;  2A61 A;  3GME A;  3TDZ C;  1WH7 A;  1A6Q A;  4XKW A;  2O8K A;  4AUX A;  1MNM C;  3JTG A;  2OCC H;  3U9G A;  3O8G A;  4YEL A;  4BQQ A;  1WZ2 A;  4XLA A;  1TLH B;  4A3F J;  3JAM K;  3OR2 C;  4I6Z A;  2FBI A;  5KCM A;  2CS3 A;  2QQA A;  4KIG A;  4L5I A;  4Y13 A;  5DUI A;  3IWZ A;  4HG2 A;  5F1J A;  4DYQ A;  2ZXJ A;  1V5G A;  4ZYA A;  4XON A;  4YFN F;  1HLV A;  1XPX A;  3B6C A;  4IHS A;  4JBA A;  4M3B A;  3OWT A;  3CDH A;  2UV1 A;  1MSE C;  1FTZ A;  4LJZ F;  1DU0 A;  2O9L A;  2LKX A;  2VOO A;  2KIU A;  4JP0 A;  4WK8 F;  2L54 A;  4QIW N;  2EIK H;  3J81 K;  1CF7 A;  3AAF A;  2FU4 A;  3CCL I;  2A3S A;  1YJ9 I;  1FMW A;  3AFH A;  3DFG A;  3EUH C;  3HHG A;  1P7J A;  5EDN A;  1B9N A;  4CCK A;  5JLW A;  5EGO B;  2NVT J;  1DPU A;  5FKK A;  1NG7 A;  2MD5 A;  2L5Q A;  3BCB A;  5D5W B;  5FKN A;  1BM9 A;  4EM2 A;  2JMW A;  2M45 A;  4YFK F;  1JTX A;  1ORK A;  4ESF A;  3OS0 A;  1S72 I;  1MMD A;  1YIO A;  4CCO A;  1SAU A;  4LMY A;  3I3L A;  5DCM B;  3VWB A;  2HVQ A;  1K79 A;  4CA0 A;  2ZME C;  2F5V A;  4PFP A;  2JSC A;  2FF4 A;  2EA2 A;  2F5D A;  1G3S A;  2XF5 A;  4E7K A;  4XM3 A;  2E2J J;  4HQE A;  4C2T A;  2G7U A;  1XC5 A;  2W84 A;  2IVM A;  3MCZ A;  1KQ0 A;  1OPC A;  3DCF A;  3MQ0 A;  4JX5 A;  2QUF A;  3FM3 A;  2DAO A;  4CCL A;  3BZC A;  2QBY B;  2CSO A;  3S17 J;  4WXD A;  1STZ A;  2CYY A;  5J1U A;  3RKQ A;  3RPU D;  1O7L A;  3HOZ J;  4E7H A;  3CUQ C;  2M87 A;  5JFR A;  3AL0 B;  3IL2 A;  1BI0 A;  2CQK A;  2LF7 A;  1W36 C;  5IP9 J;  3H9Q A;  2HQA A;  2EIN H;  4HLX A;  3LL7 A;  4XNF A;  4RBO A;  3V8K A;  2LH9 A;  1Z7U A;  3CJN A;  3AG2 H;  1QO0 D;  3BR6 A;  3A03 A;  3ML6 A;  1NTC A;  3DBR B;  5LGU A;  2BVM A;  2E71 A;  2ICW G;  2VKE A;  3VSL A;  3GCM A;  2CQ7 A;  3ESW B;  1JKQ C;  2ZME A;  3R61 A;  2DDA A;  3A0H C;  3BT9 A;  3REO A;  1UST A;  1DU6 A;  4IOC F;  3AG3 H;  1VQN I;  4I01 A;  3SZP A;  2KT0 A;  2W24 A;  1E3H A;  4ZZL A;  3ROU A;  4WF2 A;  1D5V A;  2YS9 A;  3MVP A;  3NQO A;  3JSP A;  2XAQ A;  3E1S A;  1QZZ A;  5FD5 A;  4HDU A;  4CUG A;  5M5W J;  4GDF A;  4MGR A;  2Q2E A;  2W25 A;  4XKV A;  1J7K A;  5J8C A;  2UUZ A;  5BS6 A;  1XTA A;  3GTG J;  2F2E A;  3ABL H;  1FTT A;  2M4K A;  1LDJ A;  1EKE A;  2QF7 A;  1UJ8 A;  2VQH A;  2PMZ A;  2BGC A;  5E17 F;  2CG4 A;  5DUK A;  1J5Y A;  2EA4 A;  3IUO A;  2B0L A;  3CD6 I;  2KJC A;  5GAH J;  2DMN A;  2IGN A;  2O3F A;  1ENH A;  5CVV A;  2WY8 Q;  1IAW A;  2R92 J;  2DJI A;  1OCT C;  4BXF A;  3DKX A;  5E18 F;  1T56 A;  1VQ5 I;  5F0F A;  5C4J J;  3C18 A;  1Q1H A;  1KYZ A;  2R7O A;  2ZXI A;  3K6G A;  2DDB A;  1O3R A;  1P4X A;  3ABK H;  4Q47 A;  2DOF A;  3BZ6 A;  4FX4 A;  2A6H F;  2DN0 A;  2JVH A;  1RUO A;  1HBX G;  3BTC A;  4B48 A;  3CC4 I;  2CQN A;  4M6V A;  1Z9C A;  2MLG A;  2IJL A;  4HX8 A;  2VPR A;  3WG7 H;  3J81 Z;  1ZQ3 P;  4BEH A;  2CWE A;  2LK2 A;  4AU7 A;  3WGI A;  3IKV A;  5J40 A;  1PUF A;  3WGH A;  5IOZ A;  1RC9 A;  2E60 A;  3FXL A;  1QZY A;  1KA8 A;  4PSX A;  5D4R A;  1YW9 A;  5ICC A;  3H3Z A;  1OQY A;  5D4S A;  3SYT A;  3I0T A;  3A0B C;  5CKT A;  1V5F A;  2XVC A;  2DFE A;  2W82 A;  2V1N A;  2YUS A;  1XSD A;  3RQ4 A;  3BQY A;  4I0B A;  1CF7 B;  2WB1 N;  1UB9 A;  1U8B A;  3R60 A;  4R1H A;  2L7F P;  1MNE A;  2PX9 A;  2XAF A;  2V1U A;  3NWT A;  3C2H A;  1O3Q A;  3KEO A;  2Z33 A;  3OYN A;  1YG2 A;  4JX6 A;  1UHS A;  3H35 A;  2XAG A;  3IH2 A;  3SEQ A;  2G7H A;  1Z3X A;  2HOS A;  1SEU A;  4KIB A;  4L9J A;  2VC1 A;  2KZG A;  3UNG C;  1X1A A;  3IHU A;  4XLP F;  3DEW A;  4Z6Y A;  1FLI A;  5K7Z A;  4KMU X;  5CQE A;  2HTJ A;  4Y33 A;  5C3E J;  3KIO A;  4ZTJ A;  5DCF A;  1HKS A;  2IEK A;  2A5Y B;  2FJ1 A;  2DT7 B;  4ZC3 A;  3RDI A;  3WHC A;  3S8P A;  3DPL C;  3NAR A;  2NOJ B;  4BGD A;  5HVQ C;  4IHW A;  3CJT B;  2DBB A;  2X4H A;  1V55 H;  1ULY A;  3TED A;  4ANJ A;  4F52 A;  4MNU A;  2V26 A;  5D8L B;  2AXT C;  2HYG D;  1TWF J;  1A36 A;  4OU0 A;  1QHG A;  3E6D A;  2V4J C;  1U3E M;  3W6J B;  3VOE A;  3ZOB A;  3FF5 A;  4XMY A;  1YFH A;  3CF5 F;  2OBP A;  3SQN A;  1W5T A;  2KDZ A;  1LE8 B;  1H89 C;  1SD7 A;  4F91 B;  1LDD A;  3HYI A;  3WTW C;  4AYB A;  2P5L C;  2HNH A;  3P9C A;  3ULQ B;  3WU2 C;  1VFC A;  2D1V A;  4CYC A;  1SVO A;  2XAH A;  3FWE A;  2ZXH A;  2IA0 A;  1R4N B;  2BHY A;  2A5W A;  2BYV E;  2Z9O A;  2FA5 A;  3QP5 A;  2JJ7 A;  2NNN A;  4BS9 A;  3HOU J;  3CCV I;  2VN2 A;  4M3D A;  4A2U A;  2PMZ N;  3TP0 A;  3OV8 A;  1MJ9 A;  1JUP A;  3UKG A;  3V7R A;  4ESB A;  3FHN A;  1GV5 A;  1UG0 A;  1ZTR A;  3JRB A;  3L2U A;  2HKO A;  3HUG A;  1UZC A;  1P4W A;  1TW3 A;  2Y30 A;  1GVD A;  1JGS A;  2VT3 A;  1OCR H;  1W36 D;  5DD8 A;  2VUM J;  2R7R A;  4BJ5 C;  4D7M A;  5FRN A;  2ESH A;  1YX5 A;  4QPQ A;  3S3N A;  3K10 A;  3HPH A;  1VQ8 I;  2VE9 A;  3CC2 I;  4WXC A;  1L3L A;  1GVJ A;  4EM0 B;  2KQR A;  2RVC A;  1EJ9 A;  2W00 A;  4FCY A;  1W4M A;  3E3V A;  1U9N A;  1FOK A;  5LFA A;  1SFE A;  1T08 B;  2F5C A;  3G6E I;  3LMM A;  1EH7 A;  2E5N A;  2R7U A;  1D1A A;  2EFP A;  2FX0 A;  5A2Q K;  4P1W A;  4PJ0 C;  1X1B A;  1LB2 A;  2KMU A;  2V1D A;  2FML A;  3DLL F;  3PO2 J;  1DPR A;  4UVC A;  4CCN A;  1D8J A;  4NBQ A;  4BDY A;  1ZLK A;  4LK1 F;  2GOX B;  3ABT A;  1YLF A;  3OYE A;  2Y2Z A;  3HOW J;  3E97 A;  4H4K C;  2AHQ A;  1IW7 F;  1VF9 A;  3ECH A;  2KZV A;  1BC7 C;  4HOB A;  2VQG A;  3HRT A;  3HPG A;  1RUN A;  3I55 I;  1F4K A;  4OIQ F;  3BRO A;  3FM5 A;  2XGX A;  2CV0 A;  2ZJR F;  2MC3 A;  5L3F A;  1WJE A;  1PUE E;  1K78 B;  3SZG A;  2XGE A;  4JX4 A;  5E1W A;  4BH9 A;  3WTY C;  2W7N A;  3P9K A;  2W4S A;  4C30 A;  3J80 K;  4FTH A;  2QKL B;  2VXD A;  3SDB A;  3DF8 A;  4G12 A;  4UNO A;  1Y0N A;  2VKD A;  3W6K B;  3O6B B;  3QPH A;  4C9Y A;  3U1D A;  3WTX C;  5K5Q A;  2L3D A;  4BY7 J;  1ETY A;  3S16 J;  4CCJ A;  2HZT A;  4IZZ A;  1YO5 C;  2JWT A;  2Y31 A;  2LR8 A;  4ZZD A;  5J6X A;  3LST A;  2HVR A;  1I50 J;  1K78 A;  1BR4 A;  2OZU A;  3T8T A;  1E0E A;  2X6Y A;  2DA1 A;  2RN7 A;  3SEZ A;  5HS8 A;  1JE8 A;  2E34 A;  3WHB A;  1VQP I;  4O6J A;  5TRD A;  5L3G A;  2V6C A;  1IF1 A;  3E6C C;  4BQN A;  5M5X J;  1MBK A;  3HBL A;  3RIR A;  4MLO A;  2M7B A;  2ECC A;  4AM3 A;  5LD2 C;  2ECB A;  1VND A;  4IHX A;  1Z3Y A;  1PVE A;  1ETW A;  3HKZ A;  3K4J A;  2G9W A;  4DJA A;  2HVS A;  2X0L A;  4OIR F;  4CYD A;  4RB3 C;  2D1H A;  1KU9 A;  2HKX A;  4PGG A;  1MW7 A;  2H8R A;  2FOW A;  3H0D A;  1BC8 C;  5A2Q Z;  4DYC A;  3PFY A;  1FIP A;  3C7J A;  3L00 A;  1W7P D;  4FIS A;  1IN6 A;  2ME6 A;  3SFI A;  1FOX A;  2IA2 A;  2LY1 A;  2OD5 A;  3HRM A;  2F4M B;  2KHM A;  2WAQ N;  4HX7 A;  1ZG3 A;  3DV8 A;  4AC0 A;  1QRY A;  3S15 J;  1ETK A;  2EIL H;  1FOW A;  5BOX A;  3EUK L;  4II3 A;  4XR6 A;  1JKP C;  4CGZ A;  3PNT A;  2E1O A;  5IT3 A;  2KIS A;  2XPU A;  1TNS A;  3F72 A;  1ZKG A;  3QRF F;  5EYR A;  4EEF G;  2X6W A;  1LKX A;  2DA6 A;  3OY9 A;  3CCQ I;  3HL2 A;  2JA7 J;  1W1W E;  1R49 A;  1V3F A;  2VJI A;  5FB2 A;  1I1S A;  3K0L A;  2E1N A;  1I3Q J;  2FUG 2;  1S6L A;  4M71 A;  3H5N A;  1KZH A;  2KFD A;  3I54 A;  2XRN A;  2UXN A;  1D3Y A;  1OJL A;  2DYS H;  2FNA A;  2IA1 A;  1QPM A;  2NYX A;  3G1M A;  3GFJ A;  3H1C A;  3H0G J;  1OCZ H;  1MBF A;  3W2V A;  1U8R A;  4KN7 X;  1O3S A;  1U0J A;  4HAM A;  3M4O J;  1WGX A;  4R79 A;  1QPI A;  4BNC A;  4RB1 A;  4MTD A;  1UEL B;  1Z77 A;  2JA5 J;  4Y3O A;  2DQL A;  2W48 A;  2VI6 A;  4AID A;  1KQ8 A;  3LAJ A;  1KYW A;  2P8T A;  4CO8 A;  5F6F A;  3K70 D;  3E5X A;  5CYV A;  5AIQ A;  2BY1 A;  5EEH A;  4NHJ A;  2UZK A;  1AKH B;  2VE8 A;  2M1B A;  3UR3 C;  2VOP A;  1QBJ A;  4RS8 A;  2NXN B;  5K5O A;  4NC8 A;  2IRF G;  2RGV A;  4D7N A;  3QOP A;  3Q0V A;  1JT0 A;  3EUA A;  4JYK A;  3P5J A;  4MEY F;  2GA1 A;  5IT9 K;  3CC7 I;  1SAX A;  4U88 A;  2E1C A;  4BHC A;  3TO7 A;  1FP2 A;  5FJ8 J;  1WPK A;  1YYV A;  2BV6 A;  5GTH C;  4Y52 J;  5D6E A;  4HDV A;  4XOR A;  3FKJ A;  2XB0 X;  2KDO A;  1RKW A;  2HOT A;  1MBJ A;  2HFH A;  4ZYD A;  3F9K A;  3ELK A;  4KJZ A;  2WWY A;  3DBL B;  3PNY A;  5EEA A;  3MN2 A;  2GXB A;  4HNT A;  5B3S H;  5ILV A;  3S1Q J;  2P81 A;  4LFU A;  2A07 F;  2E7W A;  1ON2 A;  1TQI A;  4QLC U;  1UHM A;  2O8X A;  2BE5 F;  4E6K G;  1FIA A;  4PZJ A;  1OCP A;  3TO9 A;  1ETQ A;  1KU3 A;  1JUM A;  1OYY A;  3Q0W A;  3M07 A;  1U2W A;  4MTE A;  4BJ6 C;  3KX2 A;  3BZK A;  2VLA A;  1Z0X A;  3A02 A;  3FXU A;  3TBI A;  3KYL A;  4ZJZ A;  4CH7 A;  3Q3S A;  1S5L C;  1I3A A;  2MFZ A;  2XRO A;  4S04 A;  2LP0 A;  2OU2 A;  3F3X A;  3VFZ A;  3IC7 A;  1MJA A;  2DK5 A;  2D5V A;  4A3L J;  1Y0U A;  1E3O C;  2Y0S A;  2EZL A;  3VOD A;  1UCR A;  2HWV A;  2KRC A;  1QHH D;  4XN0 A;  5E8G A;  4G6T B;  1H8A C;  1IRZ A;  3QYE A;  2CFX A;  2CU7 A;  5BQT A;  1O4X A;  3LQR A;  1SAN A;  3SHF A;  1U9O A;  4UUS B;  5L3C A;  4FE4 A;  2WC2 A;  1F9N A;  3FK7 A;  2L4M A;  2LOO A;  3ASN H;  5B5E C;  3L2Q A;  2D2W A;  3PQJ A;  4E70 A;  3TQN A;  2KLO A;  1EH8 A;  1LDK B;  2NS8 A;  1MKM A;  3AL0 C;  1GXP A;  3ZMT A;  1J09 A;  2JPB A;  5JLX A;  2V9V A;  4XRS A;  1SFX A;  1X4O A;  1S8N A;  3K69 A;  3L7W A;  1DUX C;  2BOL A;  3CTA A;  1YRN A;  3IAM 2;  2OUM A;  4E7I A;  4KNY A;  1GV2 A;  3R0J A;  1K61 A;  1XDU A;  2H1K A;  4UV9 A;  4NQW A;  2HU9 A;  2VAS A;  3H92 A;  4A3B J;  1VI0 A;  3V42 A;  3HB9 A;  4KIS A;  4IVN A;  2BY2 A;  1K4T A;  1NK2 P;  3FBI B;  2H09 A;  3FKI J;  3H9G A;  4IXA A;  3WE3 A;  1OCO H;  1B59 A;  2HYJ A;  1ITY A;  1WJC A;  3O3K A;  2VQC A;  1O57 A;  2BEO A;  5IP6 A;  2FSW A;  1R9T J;  1FYM A;  4NC6 A;  3CUQ A;  4L18 B;  2X9D A;  3W2A A;  1E3P A;  3RPQ A;  1RI7 A;  2JSP A;  4HW0 A;  1IV6 A;  3D5R C;  4LG0 B;  4Y4R A;  1XMX A;  5HLH A;  4A12 A;  4NQW B;  5GAG J;  4G94 A;  1BI1 A;  2I10 A;  1TNT A;  2F6C A;  2HGC A;  3U1K A;  4ITV A;  2R4G A;  3FIW A;  2CQX A;  3LSH A;  3I9V 2;  1IN4 A;  2FQ4 A;  3KP4 A;  2PJP A;  5HDN A;  1IZ1 A;  1FY7 A;  4BUP A;  4TV7 A;  1MMS A;  3OYD A;  1HCR A;  4XL9 A;  1ETX A;  5HNH A;  2F5F A;  5DS9 A;  3HHH A;  3R6S A;  2J5P A;  1Z6R A;  4U7B A;  1W7P B;  1D8K A;  5FLM J;  4BY1 J;  3S93 A;  4BQA A;  3ZQC A;  2CUE A;  1Z21 A;  5FFX A;  1T98 A;  4FE7 A;  2BW3 B;  2MLK A;  3BY6 A;  3JRD A;  2Z5U A;  4EJV A;  3GZ5 A;  1JKO C;  1Y6I A;  3TOB A;  1B72 B;  3CCR I;  2C6Y A;  2HOA A;  5GP9 A;  3P9I A;  3HG9 A;  2LLK A;  4E7L A;  2H27 A;  4A0Z A;  1UFM A;  1TQP A;  1KGS A;  1E17 A;  2L9V A;  1HST A;  4CCM A;  4OMY A;  1T39 A;  3C2G A;  2X51 A;  3KEY A;  1MSF C;  4RAY A;  2VL8 A;  2QYO A;  4KT6 A;  5F04 A;  4B1R A;  3J7Z I;  3RPU A;  3W3C A;  2VC0 A;  1FYK A;  2L9R A;  2XGD A;  1SFO J;  3AKZ A;  1R00 A;  3DU5 A;  3DU6 A;  3EUH A;  4AYB N;  1FSE A;  2QEN A;  5F27 A;  3WE2 A;  3GZN B;  1WWX A;  2JPC A;  1RPW A;  2HDC A;  2EFW A;  3GFI A;  2WB1 A;  1PYV A;  5HLI A;  3N97 A;  3ZGK A;  4G6Q A;  4PGH A;  2JRM A;  2OTL I;  1LVK A;  4CIC A;  1LNW A;  1B6A A;  3GTO J;  3Q9V A;  1P9Q C;  2R5Y B;  2B7E A;  4X6A J;  5F1R A;  4PSW A;  3I64 A;  3C2B A;  4HSR A;  3GX4 X;  1N77 A;  2GQQ A;  3CLQ A;  4CHU A;  2HXI A;  3TO6 A;  3QPL A;  4DZP A;  1FBS A;  2M34 A;  2DJN A;  4L9N A;  4B44 A;  4L9V A;  1RR8 C;  3BR0 A;  4D5C A;  3K9T A;  4M72 A;  5KK1 A;  2FE3 A;  2P5V A;  3HUG B;  3PSI A;  4I0A A;  2CV2 A;  2ISY A;  3LA3 A;  3RKX A;  4ENM A;  2YU9 J;  4M3E A;  2HEO A;  5GPC A;  4BU2 A;  1WHU A;  5J1Y A;  1OLT A;  2KIF A;  1BI2 A;  4P55 A;  3TW7 A;  2K9L A;  1HW2 A;  2BHZ A;  3K4B A;  3IH4 A;  4HZF A;  4YIF A;  1VQ4 I;  1MBG A;  2UXX A;  3J7A O;  1W0T A;  2YPR A;  2Y9Z A;  2DCE A;  4ON0 A;  4F3Q A;  1TT0 A;  4MIM A;  2RKH A;  5JHF A;  3HOT A;  2XB5 A;  3MKZ A;  2QBY A;  1LPQ A;  5IP7 J;  2RAE A;  5B66 C;  3GEZ A;  4RA2 A;  1R5I D;  3QU3 A;  3VDX A;  4RB0 A;  2LNB A;  2DA3 A;  2JRT A;  1R5G A;  2CUZ A;  2ZSH B;  3HTU A;  4HA8 A;  4EJW A;  2OQR A;  3IRQ A;  3K1M A;  4XKC A;  1R1U A;  2TDX A;  1UG2 A;  3BDD A;  9ANT A;  3CES A;  4OWR B;  4CXF A;  1YQA A;  3NRV A;  2QKM B;  1YRN B;  1IJW C;  3RZO J;  2ZJQ F;  2CJJ A;  2O7O A;  2M4G A;  4JOM A;  2M5W A;  3I59 B;  4EVI A;  2ESN A;  3CUO A;  2W1O A;  2R3S A;  3OYJ A;  5F0H A;  2OZ6 A;  1TT5 B;  2JUC A;  1ETO A;  2TCT A;  3CDL A;  4ZDL A;  4NNJ A;  1DDN A;  3FIS A;  1H88 C;  1OR7 A;  1OKR A;  2R0Q C;  3OIP A;  4CDG A;  2XRL A;  2GWR A;  2HTS A;  1ZGJ A;  3OYA A;  1WI9 A;  3E5U A;  1MMG A;  4PCQ A;  3EYI A;  4I99 C;  4BHP A;  2RQP A;  5LBQ A;  3BJ6 A;  3OIQ A;  3I4N J;  2KRF A;  5C44 J;  1YOV B;  5ICF A;  2L02 A;  4MQV A;  3CQZ J;  2IS2 A;  4XSX F;  2BXZ A;  2NVQ J;  1QNT A;  4M6X A;  1IG7 A;  2EPF A;  1R6R A;  2WV0 A;  1A5J A;  1Z7L A;  1ZLJ A;  5DTD A;  4BE2 A;  3OL4 A;  3WGG A;  5ICE A;  5EF6 A;  2HQ5 A;  3QYB A;  4RGR A;  3TKY A;  1B8I B;  2CQQ A;  3MWM A;  3O2P E;  2R7V A;  3OSG A;  2P6S A;  5ED4 A;  4U0Y A;  2L7M P;  2FQ3 A;  3EYY A;  4RGX A;  4BBS J;  3K70 C;  1G3W A;  1ZYR F;  1IN5 A;  2XIG A;  4A3I J;  1IXR C;  3GXO A;  2XGC A;  1T8I A;  1XGM A;  2Q8K A;  1J0R A;  2R7W A;  2XAU A;  4DYR A;  4ZDP A;  2JZY A;  4M3F A;  4OIP F;  1WI3 A;  3DTE A;  2HR3 A;  2CRG A;  1NH3 A;  5C4X J;  3ERE D;  1H0M A;  1R71 A;  1PUF B;  1IGN A;  4Z2Y A;  3PSF A;  3BPV A;  2R7Z J;  5FLV A;  2FRH A;  4P9U A;  5EG0 A;  1PDN C;  3ABU A;  2IS1 A;  3BG6 A;  2R5Z A;  4HV6 A;  4M6Y A;  1NK3 P;  4I09 A;  4JK1 X;  2O6G E;  4LB5 A;  2M7A A;  3PJR A;  4B4C A;  2DPU A;  2LG4 A;  2E7X A;  3LSR A;  3HOV J;  2V9P A;  2PMU A;  4EGZ A;  1N25 A;  4KN4 X;  3BR3 A;  1WRJ A;  2WAF A;  1PP7 U;  2BVL A;  2P4W A;  3G3Z A;  3FZV A;  5ICG A;  4G7O F;  2QSG X;  1WQ2 A;  4RB2 C;  2IXS A;  3IP4 B;  2IS6 A;  2PFB A;  4XLH A;  1WVR A;  2F4O B;  2YR2 A;  1FZP B;  2CFO A;  2R5Z B;  3VSK A;  3VEP A;  5EG0 B;  3JRC A;  3HOS A;  1FBU A;  3G2B A;  2MA3 A;  4NC7 A;  4UXN A;  5IY5 H;  3OYG A;  1SVM A;  4XIC A;  3RI4 A;  2RNJ A;  4W97 A;  1TL8 A;  1IRG A;  4ENN A;  1ZRE A;  3ZN1 A;  4LIV A;  2MG4 A;  4UUT A;  3NWS A;  5EZH A;  3S32 A;  3KZI C;  3R0A A;  4K2E A;  2LYC A;  3C1D A;  4LK0 F;  4PDK A;  1OR7 C;  3ZQH A;  4HLY A;  3MKY B;  4OAZ A;  3QQA A;  4BAY A;  2BBY A;  1I6X A;  2QGU A;  5LHG A;  5EGO A;  3E5Q A;  4XLF A;  2ZB9 A;  2EQR A;  4KIC A;  4V2F A;  2JVG A;  4EJU A;  2H6C A;  4ETS A;  3BCA A;  5GAD J;  3FMR A;  1MDM B;  4XLE A;  2ME0 A;  4Y15 A;  4YG2 F;  2YX4 A;  5ILS A;  4D5F A;  4ENK A;  2L2O A;  1Q1V A;  1MD0 A;  5M3F J;  3GF2 A;  1FNN A;  2IGK A;  3OYF A;  2F48 A;  2LRE A;  1OYI A;  3QPS A;  2O61 A;  2Q2E B;  1K6Y A;  2PI0 A;  4LB6 B;  1R23 A;  4BBR J;  3J7Y J;  4I98 B;  4QWQ A;  5J3L A;  1R7J A;  2P7V B;  3I4P A;  1XN7 A;  4N9H A;  4DNC A;  3OS1 A;  5JI6 A;  1BR1 A;  3F22 A;  3BR1 A;  2MC4 A;  2XHK A;  3T1B A;  3ONQ A;  1KU7 A;  3DXJ F;  2ISZ A;  4W1U A;  2QSH X;  4IF4 A;  3OSF A;  2E2H J;  4L5J A;  1F5T A;  1HF0 A;  3IWF A;  4AIH A;  3HEF A;  4M3G A;  4J19 A;  3L1P A;  1GDT A;  2QEX I;  1U5T B;  3GBG A;  1U5T A;  5LHI A;  1HKT A;  1R4M B;  2ZXW H;  1GUU A;  4RLQ A;  4I7H A;  2NAZ A;  2MD0 A;  2EFQ A;  3FBN B;  2DOE A;  5H6R A;  1M1E B;  1EV7 A;  2EZH A;  5AON A;  1R5H A;  3S3M A;  1LFU P;  2IP2 A;  2A05 A;  3CF2 A;  3ZQQ A;  2L9S A;  1FP1 D;  4UV8 A;  2P6T A;  1MMA A;  3BTJ A;  1ZAO A;  1SVL A;  2M0M A;  1FEX A;  3HRU A;  1HQC A;  4RGS A;  5K1Y A;  5FLX K;  3GTP J;  1Z67 A;  5L3D A;  4XRM A;  1T95 A;  1LVA A;  3DBH B;  3FMQ A;  2BXY A;  2Y0S N;  3ZMZ A;  5E3M A;  2D45 A;  2IT0 A;  3GLX A;  4WWC A;  3S2D J;  2QZ8 A;  5D6F A;  5H6Q A;  5HDK A;  2RDP A;  3FXQ A;  2QSF X;  1FYL A;  5DM7 F;  3TOA A;  2L4A A;  1LQ1 A;  3L9F A;  1RIO H;  3BR5 A;  5IOY A;  4PJL A;  4AIJ A;  1ON1 A;  3TGN A;  1N75 A;  1VQ7 I;  4XK4 A;  2XSD C;  2R7S A;  2VBX A;  3TL4 X;  1YIT I;  1G4D A;  2LMD A;  2H8W A;  1OYW A;  4X1E A;  1JXS A;  4D1Q A;  1S7O A;  1MH4 A;  2ZNY A;  3BG3 A;  3EPZ A;  3HRS A;  4GFB A;  5E79 C;  4L0Y B;  1R1T A;  1F43 A;  3CJR B;  3E6B A;  3P7N A;  1HDD C;  5LHH A;  4N9I A;  2OA4 A;  2XDV A;  2LD5 A;  4I2O A;  4B3X A;  2Z16 A;  3LSP A;  4S0H B;  2GXA A;  1VQ6 I;  2K40 A;  2ZFW A;  2X85 A;  3JW4 A;  3A01 B;  1NHA A;  4C3J J;  3M8E A;  5L3E A;  4IHT A;  4XRS G;  3ZQF A;  4A3K J;  3BG7 A;  1BIA A;  5DEQ A;  4LLN A;  1FX7 A;  3L09 A;  4ESJ A;  3H9J A;  1WCM J;  3TP3 A;  1PP8 F;  1C0W A;  1XMA A;  1L0O C;  1QGP A;  3FDY A;  1GLN A;  3DEU A;  3B73 A;  1CGP A;  4UHT A;  2R7D A;  5HS7 A;  1FWZ A;  5E8I A;  2KRH A;  5LGT A;  2EK5 A;  1X2M A;  2V6E A;  2MAB A;  3CLO A;  4RM3 A;  3KYC B;  3K7A J;  4L5E A;  5EZG A;  4DBR A;  1RET A;  3G71 I;  4RAG A;  3LNQ A;  5HLT A;  1IXS B;  1X3W B;  2FD5 A;  4RM2 A;  4LIU A;  3WG9 A;  4HST A;  1Y1V J;  2JA2 A;  2NOG A;  2M30 A;  2Q0O A;  2B63 J;  3WU0 A;  2DOA A;  4KYW A;  2XPW A;  3JRE A;  2Y0M A;  3MKL A;  3MZ8 A;  2Y9Y A;  4XRF A;  3SZT A;  3G73 A;  2E1M B;  3VB2 A;  2K7L A;  2ZKZ A;  1B1B A;  1H9T A;  2I5U A;  1OIS A;  2EB7 A;  4RLF A;  1T0F C;  5GAE J;  4PK4 A;  2DW4 A;  3DEE A;  2P7C B;  1ZRC A;  3SJM A;  3LAP A;  2DPD A;  4HEA 2;  3GFM A;  3LFU A;  2XKP A;  2L01 A;  5FLX Z;  3B02 A;  1DP3 A;  2K3P A;  3H3U A;  2WV1 A;  2LY2 A;  4U87 A;  2LF8 A;  4B09 A;  1VQK I;  2ID6 A;  1ETV A;  1B8I A;  2WAE A;  1CQT A;  4XLN F;  1B4A A;  3ASO H;  3HDD A;  1YTY A;  3WTU C;  1ACI A;  5B1A H;  2CGP A;  4DGW B;  4A93 J;  1XG1 A;  1R22 A;  1MBH A;  1Y56 A;  1Z91 A;  2PQ8 A;  4IQ4 A;  4A3M J;  2ACJ A;  2AS5 F;  1TP4 A;  1I39 A;  1X58 A;  5GTI C;  4KIT B;  2EBI A;  2LSO A;  2IS4 A;  1S7A A;  2PMH A;  3GTJ J;  1IUY A;  5ERI A;  1Y39 A;  5BNG A;  4IRI A;  3K1N A;  3A1Y A;  4HF2 A;  3KLN A;  2KP6 A;  2M2E A;  4HF0 A;  1JTY A;  2COB A;  4BAC A;  4NDL A;  3ABM H;  4XLC A;  2WAD A;  2VPL A;  4EV0 A;  2HDW A;  4IJA A;  5TJJ A;  1TWC J;  2DMQ A;  4BQO A;  3SDG A;  4M9S A;  2KIQ A;  1GXQ A;  2M8E A;  5K5R A;  2AQF A;  3RKY A;  3I71 A;  3FXJ A;  1YX3 A;  1RKT A;  3GW2 A;  2R7Q A;  1RRJ A;  3KP2 A;  3QWL A;  1SMY F;  2X48 A;  4ASN A;  1BI3 A;  2ZJP F;  2IPQ X;  3F6O A;  1VQO I;  4P9F A;  3CCM I;  1QVU A;  4UVB A;  1K7A A;  1D0Z A;  4LOC A;  1U5T C;  2STT A;  2O03 A;  3S3O A;  3K4M A;  5DDG A;  4XOP A;  1AKH A;  1QU3 A;  3A4C A;  4OOI A;  3ZP5 A;  5FO5 A;  4BE0 A;  1I1G A;  5E3N A;  1X3Z B;  5HOD A;  1MJB A;  2DI3 A;  2VBZ A;  1YS6 A;  3CP8 A;  3F23 A;  5IPA A;  1ZG1 A;  2VIX A;  4KMF A;  2Z3Y A;  4ABZ A;  4Y7N J;  1YS7 A;  1XSV A;  4CSW A;  5FKM A;  4UUS A;  1X1P A;  2XAJ A;  4GRI A;  1S29 A;  4A5N A;  1W0U A;  2L0K A;  3L2C A;  1XGO A;  1UHW A;  3S14 J;  3JRF A;  3LA2 A;  1O7F A;  3LOC A;  3HGY A;  5BPD A;  2WTE A;  3Q0U A;  5TGT A;  4IEJ A;  2FMY A;  3RSN A;  4BEH B;  3N05 A;  4EQQ A;  5H2F C;  3F6V A;  1XDS A;  2ZCW A;  5IYB J;  2WAQ A;  4L9T A;  5D5V B;  1MIJ A;  3H5A A;  1BIB A;  5E3L A;  4CYC B;  3KP3 A;  2MBF A;  2OV7 A;  2GOM A;  1BOA A;  3OOU A;  2VON A;  5CVJ A;  2HI3 A;  3BJA A;  1MZB A;  1FPQ A;  2HYF A;  5LRR A;  2A68 F;  4WCG A;  2DFF A;  3KP5 A;  3MAJ A;  4KUM A;  1ODD A;  1WSU A;  2OJE D;  4LD5 A;  1LEA A;  2K9S A;  3DKW A;  1U78 A;  3VYS B;  1MND A;  2PBI A;  4N0B A;  3D5L A;  2CMP A;  2DT5 A;  4HF1 A;  3BTL A;  2BY0 A;  4Y17 A;  3BWG A;  1ONV A;  2HDD A;  1IV8 A;  2EZK A;  5E3O A;  3TDU C;  1TTY A;  2ZFU A;  1FJL A;  3OYL A;  2ZC2 A;  3W6V A;  2UWM A;  3TMO A;  2XSJ C;  1G8X A;  3M3Y J;  2EFN A;  2R7X A;  1FT9 A;  2LKS A;  1ZAR A;  3F8B A;  4DQ2 A;  1XB4 A;  4LGW A;  4U0V A;  1J9I A;  3PQK A;  1X1C A;  1P92 A;  1HW1 A;  2CW0 F;  5TIS C;  4EAT A;  3OOP A;  4IQJ A;  3HOY J;  4ZH4 F;  5J47 A;  1G59 A;  2W57 A;  2RNG A;  2BY3 A;  2MYS A;  4F92 B;  2MGQ A;  3HXL A;  2HZD A;  4A3D J;  3MEX A;  1IC8 A;  3GWZ A;  3H3V K;  4AIK A;  3QU6 A;  2DMP A;  4Q5S F;  4MEX F;  5IT9 Z;  3BC8 A;  3R4K A;  3GTL J;  3GUD A;  3ERM A;  2H94 A;  2MW8 A;  3K2A A;  5FRO A;  4GO1 A;  3OS2 A;  1F1Z A;  1JKR C;  1D0X A;  3OYB A;  3QP6 A;  4XKB A;  2EFO A;  3HGG A;  3RCO A;  3WTT C;  4E7Z A;  2KKO A;  2XUB A;  1UMQ A;  1IN8 A;  1DGW Y;  2VKV A;  1GT0 C;  2R7F A;  3V8L A;  5LGN A;  2M8G X;  4XQF A;  1IRF A;  1K4S A;  3HJE A;  2RV8 A;  2K9N A;  1WJF A;  3GTK J;  1A35 A;  2Y69 H;  1PJR A;  3V8J A;  2NVX J;  2K4J A;  3G4S I;  2DFH A;  1POG A;  5LRS A;  4IO9 F;  3OIO A;  4HX4 A;  4LG0 A;  2CV1 A;  2B9S A;  1HKQ A;  2DTR A;  2LBF B;  3K4N A;  6PAX A;  2CW8 A;  2WY7 Q;  1XGN A;  2DQR A;  2QM3 A;  3IV5 A;  3ZMS A;  3KLO A;  2JA6 J;  3L2R A;  2P0W A;  4UVA A;  5D5X B;  3JRH A;  2QQ8 A;  3GO5 A;  3KYD B;  3PM1 A;  4NB5 A;  2DK8 A;  3D0S A;  3V7S A;  3RZD J;  2Y48 A;  4GGG A;  1EH6 A;  3LSG A;  1TWA J;  1BW6 A;  1N78 A;  1A31 A;  2CW7 A;  3ZQI A;  4DZJ A;  2XV4 S;  1SC7 A;  3OR1 C;  1WJD A;  2NS0 A;  1ZGW A;  2QWW A;  3CMM A;  2ZNZ A;  3PUF A;  1XCB A;  1HOM A;  3LSI A;  3DKY A;  4XOT A;  3H36 A;  1BBY A;  2VKH A;  2HXO A;  2NVY J;  2R7T A;  1BW5 A;  1AA7 A;  1HXD A;  2YX7 A;  4GXO A;  5DD4 A;  4ZYG A;  3ZMU A;  1IUF A;  2K9Q A;  1YJW I;  1QQI A;  2R93 J;  3GZ6 A;  3O8H A;  3VYT B;  1T33 A;  3M7G A;  1BN5 A;  3NAU A;  4C2M J;  4HV5 A;  3NEU A;  3A01 A;  4DOZ A;  2K02 A;  1U6G A;  4RGU A;  3BR2 A;  2LKP A;  1NG6 A;  2PEX A;  3KZY A;  4WX9 A;  2GLO A;  5DV5 A;  1T2K A;  2AXL A;  4E7J A;  1RR7 A;  2X1E A;  1IO2 A;  3CCE I;  1SFU A;  3EDP A;  4M9Z A;  1JJ8 C;  4FAS D;  1USS A;  2COM A;  3S1M J;  5LEK A;  3U21 A;  2XAS A;  3L2W A;  5JVG F;  1TWH J;  3RTR A;  5BPI A;  2KPM A;  3X2Q H;  3WTS C;  1V54 H;  3PNV A;  1RZ4 A;  1ZR4 A;  1YW8 A;  4EMS A;  3HSF A;  2QA4 I;  4OIO F;  1BJZ A;  5L3B A;  2ZSI B;  3U2R A;  3ZMV A;  5EJC A;  4EJO A;  1LE8 A;  2HOE A;  5E1Z B;  2K86 A;  2GXG A;  1FMV A;  1P2F A;  3M1C A;  2ZME B;  3QPT A;  1I5Z A;  4IRG A;  4RMN A;  3RJP A;  3IRR A;  1ZH5 A;  2EIJ H;  3I4M J;  1WFX A;  2ELK A;  2ELH A;  2W85 A;  2LC2 A;  2VXZ A;  4FX0 A;  5D5U B;  4C2U A;  3N4M A;  2L7Z A;  2OPT A;  3H5R A;  4PJJ A;  1W7P A;  1ZG5 A;  1WJ5 A;  2LVS A;  4S05 A;  4MO7 A;  4G8X A;  1VQM I;  1YIJ I;  4II2 A;  1LFP A;  2JTV A;  3F8N A;  4OMZ A;  1XCV A;  2IBD A;  5CLS A;  5M5Y J;  2Z99 A;  2CUJ A;  2VT2 A;  2EV0 A;  2L7K A;  2OCE A;  3HKZ N;  3KE2 A;  3WTZ A;  1AOY A;  1YHQ I;  1HSJ A;  2A6E F;  3CCJ I;  2Q1Z B;  4M74 A;  4DBQ A;  4A3G J;  3CO7 C;  2O0Y A;  1H9G A;  4LLL A;  3BG5 A;  5CVU A;  1DP7 P;  3J80 Z;  1VTN C;  3ZQG A;  2GBY A;  3BG9 A;  2GIZ A;  3LQQ A;  1ZR2 A;  2PJR A;  4MFD A;  3MFK A;  1WJA A;  5FRM A;  2GAU A;  3M9A A;  4G6D A;  4DIQ A;  4UY8 I;  1SMT A;  3BLY A;  4KA4 A;  1ERD A;  2IAI A;  2XF7 A;  3VYU B;  3E0J B;  2HPM A;  4U0W A;  1LUJ B;  5AIP A;  1R36 A;  1JI8 A;  5D8K B;  1W5S A;  4D9J A;  3B6A A;  4G7Z F;  3CDI A;  1BJA A;  4O5V A;  3ZRG A;  1TW2 A;  2PJR B;  1X2N A;  4EJT A;  4HRI A;  3Q5F A;  3GFL A;  2FOK A;  3M1E A;  4EGY A;  4KIF A;  3CJQ B;  3AG1 H;  3CCY A;  3T0Y A;  5HNF A;  4BXU A;  5JVT A;  3FHZ A;  3D1N I;  1JHF A;  1XMK A;  4E7S A;  4HYE A;  1IDZ A;  3K4K A;  3ZMD A;  1T0F A;  1ZK8 A;  3COA C;  4BYY A;  2HQN A;  1J59 A;  1A04 A;  2TRT A;  5J4Y A;  2Z2S B;  4LIT A;  1MGT A;  3S1R J;  2DXI A;  4FQG A;  2PN6 A;  3ZN0 A;  4ENJ A;  1V4R A;  3ZPL A;  4WXH A;  5FFZ A;  3G1O A;  5J1R A;  1XS9 A;  4HPQ A;  1HDP A;  3EET A;  2H1L A;  4C3I J;  3KPH A;  3JRA A;  1SD6 A;  1FOY A;  2CH0 A;  3RKW A;  3I5U A;  5E20 A;  3LA7 A;  4QTR A;  2ELJ A;  4V2G A;  5IYD J;  4U7D A;  2GM4 A;  3ZXS A;  2DMU A;  4YIR X;  5F08 A;  4E4H A;  4C3H J;  1DQU A;  2ETH A;  2FXA A;  5KAF C;  5LEJ A;  5HS9 A;  4L0Z B;  2NS7 A;  1ZGA A;  2QVO A;  2VB6 A;  1D1C A;  1SD5 A;  4XSZ F;  5F0C A;  1YJN I;  3PL8 A;  3CCS I;  3S2W A;  3TW6 A;  3QAH A;  4F93 B;  5H20 A;  2NNY A;  3AG4 H;  3FXO A;  1KON A;  4R8H A;  3HIF A;  3K2Z A;  2XC7 A;  1S9H A;  2EV5 A;  2HS5 A;  4YII A;  3JAM Z;  5BMZ A;  3FXK A;  3LSM A;  2VJJ A;  1P4A A;  2QQB A;  3CP2 A;  1UAA A;  1ZEL A;  3GYH X;  4QSH A;  1BR2 A;  1WKM A;  5K7H A;  1MH3 A;  2VJ4 A;  3I58 A;  2X6O A;  1FBQ A;  2JN6 A;  3OYC A;  3OYM A;  1SD4 A;  3EQL F;  4A69 C;  2RC4 A;  1K6O A;  2E19 A;  3SFZ A;  3HC7 A;  2JT1 A;  4PJN A;  3DLA A;  4N4O B;  3MMY B;  1YW7 A;  4MFE A;  4AVZ A;  1LEB A;  2I8D A;  3IH3 A;  4B3A A;  3IKT A;  1RES A;  5ILU A;  1TC3 C;  3JR9 A;  4RAZ A;  2DO7 A;  4O3M A;  2VJ5 A;  3V7C A;  3CMY A;  4X0G A;  4G7H F;  1W5C C;  2DYR H;  1AWC A;  1OFC X;  4IPA A;  3OYK A;  4YRV A;  2JUG A;  4XBF A;  2V9K A;  4XN3 A;  2P5K A;  3HOX J;  2V7F A;  2DT6 A;  1QZE A;  1G2H A;  1X1D A;  3E6M A;  5IYC J;  3I59 A;  4GYI A;  1GHC A;  2ZBK A;  3GTM J;  3ISP A;  2OTJ I;  4AD9 A;  1IN7 A;  4UB6 C;  1Z1D A;  2YU3 A;  3T5X A;  2GA2 A;  2FNP A;  1KQ9 A;  1BOB A;  1D1B A;  4BXX J;  2F5E A;  1OMI A;  2DLL A;  2M3A A;  2VBW A;  2STW A;  3VPR A;  5JR3 A;  3OMY A;  4GCV A;  3KP7 A;  2DFI A;  1HW5 A;  2VBY A;  2ID3 A;  2A69 F;  2E1M C;  2LTP A;  2MH9 A;  3PIP F;  3ZQL A;  4MQ9 F;  2XF6 A;  4CZZ A;  4ZYH A;  2DMT A;  3CCU I;  1G3T A;  2FBK A;  2FEZ A;  2ZO4 A;  3JRI A;  2EWN A;  3HZJ A;  2IGM A;  4HNV A;  2HQR A;  3ECO A;  2VOD A;  2K9M A;  4A3J J;  3BOQ A;  4KFC A;  1V5E A;  4DW6 A;  3KP6 A;  1IDY A;  3ZQ7 A;  4H0E A;  3WTV C;  3RQI A;  4A6D A;  3FXM A;  3KET A;  3HTS B;  5JHU A;  3DPU A;  2OF7 A;  3CMA I;  4ZTF A;  1JT6 A;  3QOE A;  5HDG A;  2E5Z A;  3CME I;  3KZZ A;  3GLL A;  5F64 A;  2DA2 A;  3MD2 A;  3FXR A;  4LG3 A;  5KVR A;  2FBH A;  2ADU A;  2VQL A;  3M8F A;  4MHG A;  4Q4Z F;  1TZL A;  3F8F A;  4HNU A;  5M3M J;  4IX7 A;  2EJR A;  3OYI A;  1ZRD A;  5CVI A;  1O3T A;  1K83 J;  3HM5 A;  2JA8 J;  5CQG A;  3LFK A;  1LJ9 A;  2J5O A;  3KFW X;  1HA8 A;  5KNL A;  4N4N B;  2NVU B;  1ZRF A;  2OAZ A;  1D5Y A;  2GZW A;  3W2W A;  5KAI C;  5HLG A;  3PIO F;  1YI2 I;  3BP8 A;  2EZI A;  2G0E A;  2WBM A;  4IRH A;  2Z1D A;  2DA5 A;  3PO3 J;  1MBE A;  3S2H J;  2K5C A;  3MZH A;  4OAY A;  5J8F A;  1EA3 A;  4BDZ A;  4G9Y A;  5CJ9 A;  4F7Z A;  3SXY A;  3I56 I;  5K7F A;  3M8J A;  3MKW B;  3S1N J;  2E35 A;  1REP C;  2EH3 A;  3F0C A;  3FX3 A;  4A0X A;  1J2X A;  2LFB A;  3HSR A;  2V1X A;  3LSK A;  3F8M A;  2A6T A;  4IOA F;  1Y8R B;  4A3E J;  4JQF A;  1LFB A;  2OC6 A;  2RQQ A;  3DQV C;  2V79 A;  4HQM A;  3E7L A;  5EEG A;  1BL0 A;  1OCC H;  1MDM A;  2M9H A;  4D0P A;  2MH2 A;  3WU1 B;  2L9N A;  4M73 A;  2DTZ A;  3DTK A;  3RYP A;  4IL6 C;  4EM1 A;  3OL3 A;  1JGG A;  2ZJ2 A;  2CO5 A;  5FKL A;  2XPV A;  4P96 A;  4B43 A;  1IRX A;  2OQG A;  5DYM A;  1FC3 A;  4UUV A;  1MMN A;  4IHV A;  4RAF A;  4PUS A;  1XSX A;  3RYR A;  4M9X A;  2QCO A;  1P7I A;  1Y1W J;  4RDU A;  1KU2 A;  4FET A;  4B47 A;  2Y75 A;  4A6E A;  1ZN2 A;  1DGR M;  3D5S C;  2KIM A;  4LLG F;  3WOD F;  1B72 A;  5DCM A;  2K27 A;  1FSH A;  1RNL A;  1JUS A;  2KJB A;  3Q9S A;  2EV6 A;  3JRG A;  1XD7 A;  2K4B A;  3BJO A;  4YEJ A;  1VQL I;  2AO9 A;  5E1X A;  3CUQ B;  3T8R A;  4BKX A;  2BW3 A;  1QA6 A;  2E2I J;  2GIV A;  2LRD A; 
#chains in the Genus database with same CATH homology
 2QQ9 A;  5CVR A;  3GVA A;  1TBX A;  1T6S A;  4B8X A;  5HOO A;  5LLQ A;  3DPT A;  3DP7 A;  3HSE A;  4FT8 A;  1Z6T A;  4ZYE A;  4GYG A;  4I02 A;  3JSO A;  4BHB A;  5FD6 A;  2IW5 A;  2YSR A;  1G3Y A;  3BPX A;  4Q48 A;  3FMS A;  2DU9 A;  3F8C A;  1P6R A;  3PFI A;  3F21 A;  1E2X A;  4P5O A;  3JTH A;  2PLY A;  1R58 A;  2LDU A;  3I53 A;  4A5M A;  3KEQ A;  4KT5 C;  2PG4 A;  1B9M A;  1TQM A;  1Z05 A;  4HBL A;  2H6B A;  3MZY A;  2QLZ A;  1JHH A;  4A0Y A;  4KDP A;  1S3J A;  1T38 A;  5FGM A;  1XGS A;  4AWX B;  3V4G A;  2XKO A;  3K1P A;  4AVP A;  1I27 A;  1J75 A;  3CO6 C;  1R1V A;  3KCC A;  4FHT A;  3LWF A;  1ZHF A;  1IXC A;  4OIN F;  2NRA C;  3C3W A;  1G6N A;  1X3U A;  4YFX F;  2A61 A;  3TDZ C;  3JTG A;  3U9G A;  1TLH B;  3JAM K;  2FBI A;  2QQA A;  4KIG A;  4L5I A;  4Y13 A;  5DUI A;  3IWZ A;  2ZXJ A;  4YFN F;  4IHS A;  4JBA A;  3CDH A;  4LJZ F;  2VOO A;  2KIU A;  4WK8 F;  2L54 A;  3J81 K;  1CF7 A;  3AAF A;  2FU4 A;  2A3S A;  3DFG A;  3HHG A;  1B9N A;  1DPU A;  2MD5 A;  5D5W B;  4EM2 A;  1BM9 A;  4YFK F;  2M45 A;  4ESF A;  1YIO A;  4LMY A;  5DCM B;  1K79 A;  2JSC A;  2FF4 A;  2EA2 A;  2F5D A;  1G3S A;  4HQE A;  2G7U A;  2W84 A;  2IVM A;  3MCZ A;  1KQ0 A;  1OPC A;  3MQ0 A;  2QUF A;  3FM3 A;  2DAO A;  2QBY B;  2CSO A;  4WXD A;  1STZ A;  2CYY A;  1O7L A;  3CUQ C;  2M87 A;  5JFR A;  3IL2 A;  1BI0 A;  2CQK A;  2LF7 A;  4HLX A;  3V8K A;  1Z7U A;  3CJN A;  1QO0 D;  3ML6 A;  5LGU A;  2ZME A;  3R61 A;  3REO A;  1UST A;  4I01 A;  3SZP A;  2W24 A;  4ZZL A;  3ROU A;  4WF2 A;  1D5V A;  3NQO A;  3JSP A;  2XAQ A;  1QZZ A;  5FD5 A;  4HDU A;  4MGR A;  2Q2E A;  2W25 A;  1J7K A;  5J8C A;  5BS6 A;  2F2E A;  1LDJ A;  2BGC A;  5E17 F;  2CG4 A;  5DUK A;  1J5Y A;  2EA4 A;  2B0L A;  2KJC A;  2O3F A;  5CVV A;  1IAW A;  5E18 F;  3C18 A;  1Q1H A;  1KYZ A;  1O3R A;  1P4X A;  4Q47 A;  3BZ6 A;  4FX4 A;  2A6H F;  1RUO A;  1HBX G;  1Z9C A;  2MLG A;  2IJL A;  4HX8 A;  3J81 Z;  2CWE A;  3WGI A;  3IKV A;  3WGH A;  1QZY A;  1KA8 A;  5D4R A;  1YW9 A;  5ICC A;  3H3Z A;  5D4S A;  3I0T A;  2XVC A;  1XSD A;  4I0B A;  1CF7 B;  1UB9 A;  3R60 A;  4R1H A;  2XAF A;  2V1U A;  1O3Q A;  3KEO A;  2Z33 A;  1YG2 A;  2XAG A;  2G7H A;  4KIB A;  4L9J A;  2VC1 A;  3IHU A;  4XLP F;  1FLI A;  4KMU X;  2HTJ A;  5DCF A;  1HKS A;  2A5Y B;  3RDI A;  3DPL C;  5HVQ C;  2DBB A;  2X4H A;  1ULY A;  4MNU A;  5D8L B;  2HYG D;  4OU0 A;  3E6D A;  1U3E M;  3W6J B;  3VOE A;  3FF5 A;  1YFH A;  2OBP A;  3SQN A;  1W5T A;  1SD7 A;  1LDD A;  3HYI A;  3WTW C;  2P5L C;  3P9C A;  3ULQ B;  2D1V A;  2XAH A;  3FWE A;  2IA0 A;  2Z9O A;  2BYV E;  2FA5 A;  3QP5 A;  2NNN A;  2VN2 A;  4A2U A;  3OV8 A;  1MJ9 A;  3V7R A;  4ESB A;  2HKO A;  3HUG A;  1P4W A;  1TW3 A;  1JGS A;  2VT3 A;  5DD8 A;  2ESH A;  2VE9 A;  4WXC A;  1L3L A;  1GVJ A;  4EM0 B;  2RVC A;  1W4M A;  3E3V A;  1FOK A;  1SFE A;  2F5C A;  1EH7 A;  2EFP A;  5A2Q K;  1LB2 A;  2V1D A;  2FML A;  1DPR A;  4UVC A;  1D8J A;  1ZLK A;  4LK1 F;  3ABT A;  1YLF A;  3E97 A;  1IW7 F;  3ECH A;  1BC7 C;  4HOB A;  3HRT A;  1RUN A;  4OIQ F;  1F4K A;  3BRO A;  3FM5 A;  2XGX A;  2MC3 A;  5L3F A;  1PUE E;  1K78 B;  3WTY C;  5E1W A;  4BH9 A;  3P9K A;  3J80 K;  3DF8 A;  4UNO A;  3W6K B;  3O6B B;  3QPH A;  3U1D A;  3WTX C;  5K5Q A;  2L3D A;  1YO5 C;  2HZT A;  4ZZD A;  5J6X A;  3LST A;  1K78 A;  2OZU A;  3T8T A;  2RN7 A;  5HS8 A;  1JE8 A;  4O6J A;  5TRD A;  5L3G A;  2V6C A;  1IF1 A;  3E6C C;  3RIR A;  2G9W A;  2X0L A;  4OIR F;  4CYD A;  4RB3 C;  2D1H A;  1KU9 A;  2HKX A;  4PGG A;  1BC8 C;  5A2Q Z;  3C7J A;  3L00 A;  1W7P D;  1IN6 A;  2IA2 A;  2OD5 A;  3HRM A;  4HX7 A;  1ZG3 A;  3DV8 A;  5BOX A;  4CGZ A;  5IT3 A;  1TNS A;  3F72 A;  3QRF F;  1V3F A;  1I1S A;  5FB2 A;  3K0L A;  2E1N A;  4M71 A;  1S6L A;  3I54 A;  2XRN A;  2UXN A;  1D3Y A;  2FNA A;  2IA1 A;  1QPM A;  2NYX A;  3GFJ A;  1U8R A;  4KN7 X;  1O3S A;  4HAM A;  4R79 A;  4BNC A;  4RB1 A;  4MTD A;  2DQL A;  1KQ8 A;  3LAJ A;  1KYW A;  2P8T A;  4CO8 A;  5F6F A;  3E5X A;  5CYV A;  5AIQ A;  5EEH A;  4NHJ A;  2UZK A;  2VE8 A;  2M1B A;  2VOP A;  1QBJ A;  4RS8 A;  5K5O A;  2IRF G;  2RGV A;  3QOP A;  4MEY F;  2GA1 A;  5IT9 K;  1SAX A;  4U88 A;  2E1C A;  4BHC A;  3TO7 A;  1FP2 A;  1YYV A;  2BV6 A;  5D6E A;  4HDV A;  2HFH A;  4ZYD A;  2WWY A;  3ELK A;  2GXB A;  5ILV A;  4LFU A;  2A07 F;  2E7W A;  1ON2 A;  1TQI A;  4QLC U;  1UHM A;  2O8X A;  2BE5 F;  4PZJ A;  3TO9 A;  1KU3 A;  1OYY A;  1U2W A;  4MTE A;  3FXU A;  2XRO A;  4S04 A;  2OU2 A;  3F3X A;  3VFZ A;  3IC7 A;  1MJA A;  2DK5 A;  1Y0U A;  3VOD A;  1UCR A;  2HWV A;  5E8G A;  2CFX A;  5BQT A;  3LQR A;  3SHF A;  5L3C A;  2WC2 A;  1F9N A;  2L4M A;  2D2W A;  3PQJ A;  4E70 A;  3TQN A;  1EH8 A;  1LDK B;  1MKM A;  1GXP A;  3ZMT A;  2JPB A;  2V9V A;  1SFX A;  3K69 A;  1S8N A;  3L7W A;  1DUX C;  3CTA A;  4KNY A;  3R0J A;  1XDU A;  4UV9 A;  4NQW A;  3H92 A;  4IVN A;  2H09 A;  4IXA A;  3WE3 A;  1B59 A;  3O3K A;  1O57 A;  2BEO A;  2FSW A;  1FYM A;  3CUQ A;  4L18 B;  3RPQ A;  1RI7 A;  4LG0 B;  4HW0 A;  5HLH A;  4A12 A;  4G94 A;  1BI1 A;  1TNT A;  2HGC A;  1IN4 A;  3KP4 A;  2PJP A;  5HDN A;  1IZ1 A;  1FY7 A;  4TV7 A;  2F5F A;  3HHH A;  3R6S A;  2J5P A;  1Z6R A;  4U7B A;  1W7P B;  1D8K A;  4BQA A;  5FFX A;  1T98 A;  2MLK A;  3BY6 A;  2Z5U A;  4EJV A;  3GZ5 A;  3TOB A;  2C6Y A;  3P9I A;  2H27 A;  4A0Z A;  1UFM A;  1TQP A;  1KGS A;  1E17 A;  1HST A;  4OMY A;  1T39 A;  4RAY A;  2QYO A;  3RPU A;  2VC0 A;  1FYK A;  1R00 A;  3EUH A;  1FSE A;  2QEN A;  3WE2 A;  1WWX A;  2JPC A;  2HDC A;  2EFW A;  3GFI A;  5HLI A;  3N97 A;  4G6Q A;  4PGH A;  4CIC A;  1LNW A;  1B6A A;  3Q9V A;  5F1R A;  3I64 A;  3GX4 X;  2GQQ A;  4CHU A;  3TO6 A;  1FBS A;  4L9N A;  4L9V A;  3K9T A;  4M72 A;  5KK1 A;  2FE3 A;  2P5V A;  4I0A A;  2ISY A;  3LA3 A;  3RKX A;  4ENM A;  2HEO A;  4P55 A;  2KIF A;  1BI2 A;  1HW2 A;  4HZF A;  4YIF A;  3J7A O;  2UXX A;  2YPR A;  4ON0 A;  2RKH A;  3HOT A;  2QBY A;  3GEZ A;  3QU3 A;  4RB0 A;  2LNB A;  2JRT A;  1R5G A;  3HTU A;  4HA8 A;  4EJW A;  2OQR A;  3IRQ A;  3K1M A;  1R1U A;  2TDX A;  3BDD A;  4CXF A;  1YQA A;  3NRV A;  2M5W A;  3I59 B;  4EVI A;  2ESN A;  3CUO A;  2R3S A;  2OZ6 A;  1DDN A;  1OR7 A;  1OKR A;  4CDG A;  2GWR A;  2HTS A;  1ZGJ A;  1WI9 A;  3E5U A;  4PCQ A;  3EYI A;  4BHP A;  2RQP A;  5LBQ A;  3BJ6 A;  2KRF A;  5ICF A;  2L02 A;  4MQV A;  4XSX F;  1QNT A;  4M6X A;  2WV0 A;  1ZLJ A;  3WGG A;  5ICE A;  4RGR A;  3TKY A;  3MWM A;  3O2P E;  2P6S A;  5ED4 A;  4U0Y A;  2FQ3 A;  3EYY A;  4RGX A;  1G3W A;  1ZYR F;  1IN5 A;  2XIG A;  1IXR C;  3GXO A;  1XGM A;  2Q8K A;  1J0R A;  2JZY A;  4OIP F;  2HR3 A;  3ERE D;  1H0M A;  4Z2Y A;  3BPV A;  2FRH A;  4P9U A;  1PDN C;  3ABU A;  4HV6 A;  4M6Y A;  2O6G E;  4I09 A;  4JK1 X;  4LB5 A;  2DPU A;  2E7X A;  2PMU A;  4EGZ A;  4KN4 X;  1WRJ A;  1PP7 U;  2P4W A;  3G3Z A;  3FZV A;  5ICG A;  4G7O F;  1WQ2 A;  4RB2 C;  2PFB A;  2YR2 A;  1FZP B;  3VEP A;  3HOS A;  1FBU A;  2MA3 A;  4UXN A;  3RI4 A;  2RNJ A;  1IRG A;  4ENN A;  1ZRE A;  3ZN1 A;  3R0A A;  4K2E A;  3C1D A;  4LK0 F;  4PDK A;  4HLY A;  4BAY A;  2BBY A;  1I6X A;  5LHG A;  3E5Q A;  4KIC A;  4EJU A;  2H6C A;  4ETS A;  1MDM B;  3FMR A;  4Y15 A;  4YG2 F;  2YX4 A;  5ILS A;  4ENK A;  1MD0 A;  3GF2 A;  1FNN A;  2O61 A;  1OYI A;  2PI0 A;  4LB6 B;  1R23 A;  4I98 B;  4QWQ A;  1R7J A;  2P7V B;  3I4P A;  1XN7 A;  4N9H A;  4DNC A;  5JI6 A;  3F22 A;  2XHK A;  3T1B A;  1KU7 A;  3DXJ F;  2ISZ A;  4IF4 A;  4L5J A;  1F5T A;  3IWF A;  4AIH A;  1U5T B;  5LHI A;  1U5T A;  1HKT A;  4I7H A;  2NAZ A;  2EFQ A;  5H6R A;  1EV7 A;  5AON A;  1R5H A;  2IP2 A;  1FP1 D;  4UV8 A;  2P6T A;  1ZAO A;  3HRU A;  1HQC A;  4RGS A;  5K1Y A;  5FLX K;  5L3D A;  1LVA A;  3FMQ A;  3ZMZ A;  2IT0 A;  2D45 A;  3GLX A;  4WWC A;  5HDK A;  2QZ8 A;  5D6F A;  5H6Q A;  2RDP A;  3FXQ A;  1FYL A;  3TOA A;  2L4A A;  1LQ1 A;  3L9F A;  1RIO H;  4AIJ A;  1ON1 A;  3TGN A;  2VBX A;  1G4D A;  1JXS A;  1OYW A;  1S7O A;  2ZNY A;  3HRS A;  4L0Y B;  1R1T A;  3E6B A;  3P7N A;  5LHH A;  4N9I A;  2OA4 A;  4I2O A;  2ZFW A;  3JW4 A;  1NHA A;  3M8E A;  5L3E A;  4IHT A;  1BIA A;  5DEQ A;  4LLN A;  1FX7 A;  3L09 A;  4ESJ A;  1C0W A;  1PP8 F;  1XMA A;  1L0O C;  1QGP A;  3DEU A;  3B73 A;  1CGP A;  4UHT A;  2R7D A;  5HS7 A;  1FWZ A;  5E8I A;  5LGT A;  2EK5 A;  3CLO A;  1IXS B;  3WG9 A;  2M30 A;  2Q0O A;  3WU0 A;  4KYW A;  2Y0M A;  4XRF A;  3SZT A;  3G73 A;  3VB2 A;  2K7L A;  2ZKZ A;  1B1B A;  1H9T A;  2EB7 A;  2DW4 A;  2P7C B;  1ZRC A;  3LAP A;  2DPD A;  3GFM A;  2XKP A;  2L01 A;  5FLX Z;  3B02 A;  3H3U A;  2LF8 A;  4B09 A;  4XLN F;  1B4A A;  1YTY A;  3WTU C;  2CGP A;  1Z91 A;  1R22 A;  2PQ8 A;  2ACJ A;  2AS5 F;  2LSO A;  1S7A A;  2PMH A;  1IUY A;  5ERI A;  4IRI A;  3K1N A;  4HF2 A;  3KLN A;  4HF0 A;  4EV0 A;  4IJA A;  5TJJ A;  4M9S A;  1GXQ A;  2M8E A;  5K5R A;  3RKY A;  3I71 A;  3GW2 A;  3KP2 A;  1SMY F;  4ASN A;  1BI3 A;  2IPQ X;  3F6O A;  4P9F A;  4UVB A;  1K7A A;  1U5T C;  2STT A;  2O03 A;  5DDG A;  4OOI A;  3ZP5 A;  5FO5 A;  1I1G A;  1MJB A;  2DI3 A;  2VBZ A;  1YS6 A;  3F23 A;  1ZG1 A;  4KMF A;  2Z3Y A;  1YS7 A;  1XSV A;  2XAJ A;  1S29 A;  4A5N A;  3L2C A;  1XGO A;  1UHW A;  3LA2 A;  1O7F A;  5BPD A;  2WTE A;  2FMY A;  4EQQ A;  3F6V A;  1XDS A;  2ZCW A;  4L9T A;  5D5V B;  1BIB A;  3KP3 A;  2MBF A;  2VON A;  1BOA A;  5CVJ A;  3BJA A;  1MZB A;  1FPQ A;  2HYF A;  5LRR A;  4WCG A;  2A68 F;  4KUM A;  3KP5 A;  3MAJ A;  1ODD A;  1WSU A;  4LD5 A;  1LEA A;  3DKW A;  1U78 A;  2PBI A;  4N0B A;  3D5L A;  2DT5 A;  4HF1 A;  4Y17 A;  3BWG A;  1ONV A;  3TDU C;  1TTY A;  2UWM A;  2EFN A;  1FT9 A;  1ZAR A;  3F8B A;  4DQ2 A;  1XB4 A;  4LGW A;  4U0V A;  1J9I A;  3PQK A;  2CW0 F;  1P92 A;  1HW1 A;  3OOP A;  4ZH4 F;  2W57 A;  3MEX A;  3GWZ A;  4AIK A;  3QU6 A;  4Q5S F;  4MEX F;  5IT9 Z;  3R4K A;  3GUD A;  2H94 A;  4GO1 A;  1F1Z A;  3QP6 A;  3WTT C;  2EFO A;  2KKO A;  2XUB A;  1IN8 A;  2R7F A;  3V8L A;  5LGN A;  1IRF A;  2RV8 A;  3V8J A;  2K4J A;  5LRS A;  4LG0 A;  4HX4 A;  1HKQ A;  2DTR A;  6PAX A;  1XGN A;  2DQR A;  2QM3 A;  3ZMS A;  3KLO A;  4UVA A;  5D5X B;  3GO5 A;  4NB5 A;  2DK8 A;  3D0S A;  3V7S A;  2Y48 A;  4GGG A;  1EH6 A;  2XV4 S;  2NS0 A;  2QWW A;  2ZNZ A;  1XCB A;  1BBY A;  1HXD A;  2YX7 A;  4GXO A;  5DD4 A;  4ZYG A;  3ZMU A;  1QQI A;  3GZ6 A;  3M7G A;  1BN5 A;  4HV5 A;  3NEU A;  2K02 A;  1U6G A;  4RGU A;  2LKP A;  3KZY A;  2PEX A;  4WX9 A;  5DV5 A;  1T2K A;  2AXL A;  1SFU A;  3EDP A;  4M9Z A;  1USS A;  2COM A;  5LEK A;  2XAS A;  3RTR A;  5BPI A;  3WTS C;  1RZ4 A;  1YW8 A;  4EMS A;  3HSF A;  4OIO F;  5L3B A;  3U2R A;  3ZMV A;  4EJO A;  2HOE A;  5E1Z B;  2K86 A;  2GXG A;  3QPT A;  1P2F A;  2ZME B;  1I5Z A;  4IRG A;  3RJP A;  3IRR A;  1ZH5 A;  2ELH A;  2W85 A;  2VXZ A;  4FX0 A;  5D5U B;  3N4M A;  1W7P A;  1ZG5 A;  4S05 A;  4G8X A;  2JTV A;  3F8N A;  4OMZ A;  1XCV A;  5CLS A;  2Z99 A;  2VT2 A;  2EV0 A;  3KE2 A;  3WTZ A;  1AOY A;  1HSJ A;  2A6E F;  4M74 A;  3CO7 C;  2O0Y A;  1H9G A;  4LLL A;  5CVU A;  1DP7 P;  3J80 Z;  1VTN C;  3LQQ A;  3MFK A;  2GAU A;  3M9A A;  4G6D A;  1SMT A;  4KA4 A;  4U0W A;  5AIP A;  1R36 A;  5D8K B;  1W5S A;  4G7Z F;  1BJA A;  4O5V A;  4EJT A;  1TW2 A;  3Q5F A;  3GFL A;  2FOK A;  3M1E A;  4EGY A;  4KIF A;  3T0Y A;  5JVT A;  3FHZ A;  4BXU A;  1JHF A;  1XMK A;  4HYE A;  3ZMD A;  1T0F A;  3COA C;  4BYY A;  2HQN A;  1J59 A;  1A04 A;  1MGT A;  2PN6 A;  3ZN0 A;  4ENJ A;  1V4R A;  3ZPL A;  4WXH A;  5FFZ A;  3EET A;  1SD6 A;  3RKW A;  3I5U A;  5E20 A;  3LA7 A;  4U7D A;  2ETH A;  2FXA A;  5LEJ A;  5HS9 A;  4L0Z B;  1ZGA A;  2QVO A;  4XSZ F;  1SD5 A;  3S2W A;  3QAH A;  5H20 A;  2NNY A;  4R8H A;  3HIF A;  3K2Z A;  2EV5 A;  2HS5 A;  4YII A;  3JAM Z;  5BMZ A;  1P4A A;  2QQB A;  3GYH X;  1WKM A;  3I58 A;  1FBQ A;  1SD4 A;  3EQL F;  1K6O A;  2RC4 A;  3SFZ A;  2JT1 A;  1YW7 A;  1LEB A;  3IKT A;  5ILU A;  4RAZ A;  2DO7 A;  4O3M A;  3V7C A;  4G7H F;  1AWC A;  4IPA A;  4XBF A;  2P5K A;  3E6M A;  3I59 A;  4GYI A;  1GHC A;  2ZBK A;  3ISP A;  4AD9 A;  1IN7 A;  1Z1D A;  2YU3 A;  3T5X A;  2GA2 A;  2FNP A;  1KQ9 A;  2F5E A;  1OMI A;  2DLL A;  2VBW A;  2STW A;  5JR3 A;  4GCV A;  3KP7 A;  2DFI A;  1HW5 A;  2VBY A;  2A69 F;  2MH9 A;  4MQ9 F;  4CZZ A;  4ZYH A;  1G3T A;  2FBK A;  2FEZ A;  2ZO4 A;  2EWN A;  2VOD A;  2HQR A;  3ECO A;  3BOQ A;  4KFC A;  3KP6 A;  3ZQ7 A;  4H0E A;  3WTV C;  4A6D A;  3KET A;  3HTS B;  5JHU A;  5HDG A;  3KZZ A;  5F64 A;  3FXR A;  5KVR A;  4Q4Z F;  2FBH A;  2ADU A;  4MHG A;  3M8F A;  1ZRD A;  3F8F A;  2EJR A;  5CVI A;  1O3T A;  3LFK A;  1LJ9 A;  2J5O A;  3KFW X;  1ZRF A;  2OAZ A;  2GZW A;  5HLG A;  3BP8 A;  4IRH A;  3MZH A;  5J8F A;  4G9Y A;  5CJ9 A;  4F7Z A;  3SXY A;  1REP C;  3FX3 A;  4A0X A;  1J2X A;  3HSR A;  2V1X A;  3F8M A;  4JQF A;  3DQV C;  2V79 A;  4HQM A;  5EEG A;  1MDM A;  4D0P A;  2MH2 A;  3WU1 B;  4M73 A;  3RYP A;  4EM1 A;  2ZJ2 A;  2CO5 A;  4P96 A;  2OQG A;  5DYM A;  1FC3 A;  4UUV A;  1XSX A;  3RYR A;  4M9X A;  1KU2 A;  2Y75 A;  4A6E A;  1ZN2 A;  3WOD F;  2KIM A;  4LLG F;  5DCM A;  2K27 A;  1FSH A;  1RNL A;  2KJB A;  3Q9S A;  2EV6 A;  1XD7 A;  2K4B A;  3BJO A;  5E1X A;  3CUQ B;  3T8R A;  2GIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...