5IP7J

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ip7J00
5M3MJ 2DMPA 2HXIA 1TC3C 2VKEA 3K7AJ 4XIDA 4M3DA 1APLC 3IH2A 5C4JJ 4V2FA 1NK3P 4L5EA 3BTCA 4NDLA 2M2EA 5FJ8J 2NVTJ 3M3YJ 1H8AC 2XGDA 1ZR2A 3JRDA 1F36A 2VI6A 5DTDA 4A3IJ 2ELKA 1WH7A 1AU7A 1IRZA 3GTMJ 2E2IJ 4BY1J 3HOZJ 1U78A 3Q3SA 1BL0A 4BXXJ 2K9SA 5FKMA 3A01B 1XG1A 3Q0UA 1TWHJ 1W0TA 2XGEA 5J1RA 4FCYA 1ITYA 2AO9A 5IOYA 1WI3A 5J3LA 1IC8A 3BG9A 3GTGJ 1XS9A 1JKQC 3LOCA 2MG4A 2E19A 1IJWC 1TWFJ 4AYBN 3Q0WA 1FTZA 1LFBA 2L7FP 1JTXA 1ZTRA 4D5CA 2XRLA 1FIAA 4G12A 5K7ZA 2MSYA 3QPLA 4DZJA 2LY9A 3CQZJ 1B72B 4IHWA 2O8KA 2DA5A 3D1NI 3S16J 1NTCA 5F0FA 4A93J 3ZOBA 2L9RA 3WHBA 1RKTA 2R5YB 1DU0A 1AKHA 2ECCA 5EEAA 1G2HA 1IGNA 1XC5A 1BA5A 3W6VA 2Y9ZA 3IV5A 3PO2J 2LVSA 3FK6A 4Y52J 1T33A 1WPKA 2LP0A 2M9HA 5EGOB 1WCMJ 1ZR4A 1YRNA 4M6VA 1LFUP 1FIPA 3O8GA 5EZHA 2LKXA 1ZQ3P 2R93J 2HDDA 1ZK8A 3BR1A 1A6IA 2JA7J 3GTKJ 3JRCA 1LE8A 3HEFA 4UUSA 5M3FJ 1JKOC 3PO3J 1TWAJ 2DMNA 3GTLJ 5GP9A 3MN2A 2NS7A 2CU7A 4CYCA 4DZPA 2E2HJ 1JJ6C 5E3OA 1JKPC 4A3LJ 2JMWA 2JJ7A 3BTJA 1UMQA 2NOGA 2DJNA 4C2MJ 1Y1WJ 4S0HB 3GTPJ 5FKOA 3S17J 5FKKA 4DYCA 4IHXA 3UKGA 2HI3A 5F0HA 2DMTA 2ID3A 4RBOA 4M3EA 1VF9A 3M4OJ 2XSDC 4MO7A 2R7ZJ 2YS9A 3LSGA 1H88C 3QPSA 2I10A 2OPTA 5GPAA 5K7FA 1T56A 3ZQFA 3HBLA 4QIWN 2K9NA 2G0EA 2M34A 1MBKA 3RQIA 4Y7NJ 2EBIA 3IH4A 2D5VA 4A3DJ 4BBRJ 1F43A 2WB1N 5FLVA 1ETKA 1OCPA 5JLWA 3FIWA 3JRGA 1ETXA 5EDNA 4M3FA 2XB5A 1U8BA 2N8GA 2E2JJ 4AC0A 2Y30A 3C2BA 2ID6A 1H89C 5IYCJ 2E1OA 2VPRA 5M5XJ 3HDDA 2M8GX 4V2GA 1ORKA 3A01A 2NS8A 2NVYJ 5BNGA 3ZQCA 1B8IB 1U9NA 1ETYA 3G1MA 2FX0A 3WHCA 2ME0A 1BW5A 3S1RJ 1ETWA 3K2AA 1IDZA 2FQ4A 2DMQA 3TEDA 2L7MP 4W97A 4D7MA 2L7ZA 1JT6A 4D5FA 1JUSA 3MKLA 1ETOA 3PM1A 3RZOJ 4AUXA 3S2HJ 1MBFA 4QSHA 3HKZN 3LNQA 1HLVA 2R5ZA 3BR2A 3TW7A 4FISA 3A02A 5E3LA 3GTOJ 3OIOA 2VKVA 5F27A 5IP7J 2EZLA 1GDTA 1TWGJ 5GPCA 5FLMJ 2R92J 1VFCA 4JYKA 3ZQIA 1ENHA 1ETVA 4XICA 3G1LA 5IP9J 2P81A 4BBSJ 1OCTC 5K7HA 2Y0SN 3OSFA 1GT0C 2IAIA 3G1OA 1AHDP 3IH3A 2Y31A 3BT9A 3DCFA 2Y9YA 1RR7A 1K61A 1MH4A 3JRHA 4J19A 4A3CJ 1ZGWA 4A69C 2X48A 2QCOA 4MFDA 3JRFA 4IEJA 4MIMA 5FKNA 3TW6A 1AKHB 2HXOA 3TP0A 5HODA 2LLKA 1W0UA 3S14J 2H8RA 3SFIA 1Y1VJ 4JX4A 3HOUJ 4W1UA 2EZKA 3B6CA 1EF4A 1X58A 2DTZA 3LSPA 3H3VK 2JA5J 1S7EA 3BR3A 1I50J 3HGYA 2LK2A 3GTJJ 1IUFA 1MNMC 3VPRA 2GBYA 4UUTA 5IYDJ 3BG3A 1PUFB 1JT0A 5F08A 2XGCA 4XK4A 5DS9A 1UHSA 1SANA 3MVPA 1Z77A 1CQTA 1MH3A 4I6ZA 2DA3A 3ZQLA 3SDGA 2DMUA 5IYBJ 2K9QA 2DA2A 9ANTA 2ECBA 5C44J 2W48A 2LFBA 4CYCB 2L0KA 2PMZN 4LOCA 3CDLA 1GUUA 4MLOA 3FKIJ 1MSEC 4A3MJ 3FK7A 5EG0A 3E7LA 2HYJA 4M3GA 1QRYA 1Z0XA 1GV5A 4XRSG 2RAEA 4C3HJ 3GBGA 2JA6J 5E3MA 1FEXA 3S2DJ 2WV1A 5F1JA 4GFBA 3BTIA 1K83J 1RESA 4ABZA 2XPUA 2EZHA 1HF0A 4A3EJ 4BY7J 5J1YA 2O9LA 4IHYA 3LSJA 5C4XJ 2IEKA 2EQRA 3LSRA 4A3FJ 1SFOJ 4X6AJ 2ME6A 4DYRA 4EEFG 1UG2A 4C3JJ 4DW6A 2R0QC 2LTPA 5F0CA 2H1KA 3NARA 2CRGA 2NVXJ 4X1EA 1GV2A 4FE4A 2XPVA 2DA1A 2FD5A 4HNVA 2DN0A 1I3QJ 2MGQA 4I76A 1B8IA 1POGA 2HOAA 1HDDC 4B4CA 5EYRA 4C3IJ 3I4MJ 2JK3A 3GTQJ 1OFCX 1FTTA 3HB9A 3HM5A 5M5WJ 5C3EJ 4A3BJ 1BW6A 1WH5A 1MBHA 3HOVJ 3BQYA 2GM4A 2JN6A 3S1MJ 1MBEA 3BTLA 2ZB9A 1B72A 1OJLA 1X2MA 4QTRA 2XPWA 3ZQHA 1X2NA 2CUEA 4A3GJ 2Y2ZA 1ZKGA 3BR5A 2TCTA 1IV6A 1JGGA 2NVQJ 4JP0A 2M0CA 5J1UA 2KDZA 3JR9A 2QF7A 2FJ1A 3HGGA 2R5YA 4FE7A 3O8HA 1IG7A 5IOZA 3CMYA 4DYQA 2GLOA 4XRMA 3JRBA 5EZGA 2OF7A 3L1PA 4XRSA 2R5ZB 1O4XA 2K40A 3BG5A 3FISA 2VUMJ 4A3KJ 5EGOA 3JRIA 3S15J 1GVDA 3ZQGA 2B63J 5JLXA 2O7OA 4BKXA 3HOWJ 1JJ8C 3JREA 2KT0A 3RKQA 1RPWA 4B1RA 1P7IA 2HQ5A 3BR0A 4MFEA 2CQXA 5M5YJ 3BR6A 3H0GJ 1I6HJ 3I4NJ 1WGXA 3SJMA 2YUSA 4M3BA 1QVUA 5F04A 3S1QJ 4IHVA 1RETA 3DEWA 2LD5A 2X6OA 1BJZA 1HDPA 5FKLA 1YRNB 4RDUA 2CUFA 1Q1VA 4A3JJ 1HOMA 1NK2P 2AHQA 2JWTA 3HOXJ 3OSGA 2TRTA 2CQQA 1A5JA 1MBJA 2YU9J 1PUFA 1JUPA 3A03A 2HOSA 2EH3A 1JUMA 2IBDA 4UUSB 1LE8B 3RZDJ 4JX6A 1VNDA 1RKWA 1JKRC 3JRAA 1ETQA 1TWCJ 2DA6A 2X9DA 3QQAA 1E3OC 5IPAA 2COBA 1QPIA 3CCYA 3B6AA 1VI0A 2CJJA 3NAUA 1D5YA 2DA4A 1FJLA 1DU6A 4D7NA 1HCRA 1QVTA 2LR8A 5IP6A 3F0CA 1P7JA 3OOUA 4FTHA 2WAQN 3HOYJ 3BQZA 1MBGA 2XB0X 4B3AA 1JTYA 2MW8A 3TP3A 2EZIA 1MSFC 5EF6A 3Q0VA 2HOTA 1U9OA 2JA8J 1IDYA 4JX5A 1R9TJ 2DA7A 3S1NJ 5E3NA 5EG0B
chains in the Genus database with same CATH superfamily
5GAGJ 3EYYA 2XAHA 4CCNA 3QODA 5F64A 3BG7A 2ZJPF 3ABLH 3K7AJ 2F5FA 2IS4A 2A68F 4XLNF 1F4KA 5C4JJ 1FBUA 2K7LA 3JTHA 5CVIA 4AIDA 2V6CA 4U0WA 2XGDA 4EJUA 2HGCA 4U7BA 2V9VA 2XAGA 3BC8A 2H27A 1LUJB 2ZBKA 3I71A 5FO5A 3RPUD 3OYAA 2M7AA 3QPHA 4BXXJ 5FKMA 1XTAA 2R7VA 2PX9A 4P96A 1W0TA 5EJCA 5ICEA 2HU9A 4U87A 4FCYA 1IC8A 3G2BA 3E6DA 1W36C 3DBHB 3BG9A 2DW4A 3N4MA 2NNNA 1U3EM 3RI4A 1JKQC 2C6YA 2M1BA 2MG4A 2X0LA 1J5YA 3FDYA 2W1OA 4PFOA 2F4OB 2L7FP 3TQNA 2RC4A 4D5CA 1MGTA 2VB6A 1V5GA 4G12A 3S8PA 3CUQB 3QPLA 4ZZLA 2LY9A 4UHTA 3LQRA 2B9SA 5J4VA 5K5OA 3D1NI 2DFEA 3ZGKA 1NTCA 2P0WA 2OJED 4A93J 4HA8A 2XF7A 4Q5SF 3ZOBA 2L9RA 2VT2A 3GEZA 4LD5A 3WHBA 1RKTA 1Z21A 3VYTB 4YFXF 1WSUA 1FBQA 3FXOA 2VQGA 2ECCA 1FX7A 3O6BB 4IX7A 1IGNA 1PP8F 1XMKA 4G6QA 3FBNB 4FETA 2NYXA 2OBPA 1O3RA 2CH0A 1T33A 2LP0A 1P4XA 3CCMI 1VQOI 4AIKA 3KZYA 1ZR4A 1LPQA 3ABUA 1LFUP 3SDBA 5EZHA 2EV0A 2O6GE 3QRFF 2EIMH 1S7OA 3ZMVA 1HW5A 3BR1A 2DU9A 5LGNA 1U5TC 2QSHX 4LK0F 3S3MA 2QENA 4XSZF 2MFZA 2YX4A 1W36D 3B73A 1Q1HA 1ON2A 3FXJA 3RCOA 5J4YA 1Y8QB 3GFLA 2PMHA 3HEFA 2JVHA 3PO3J 4OIRF 2NS7A 3ELKA 5CJ9A 4BHCA 5GTIC 4U7DA 2BY2A 1Y39A 4L18B 3OYEA 4BUPA 2OV7A 2F5EA 2A05A 1HKSA 4B43A 3GZNB 2COMA 5CLSA 3S2WA 2E2HJ 3AFHA 1TLHB 4QWQA 4CXFA 2F6CA 5DV5A 4E7KA 3RDIA 1O7FA 5HNHA 4S0HB 3LWFA 2VBYA 5HDNA 1MMAA 4OU0A 4M6XA 3K2ZA 4P55A 5CPRB 2ZMEC 2W85A 2HKOA 2XF6A 3OV8A 2DBBA 4C2UA 3KLOA 3BZKA 1IW7F 4RBOA 4M3EA 1X4PA 4NNJA 5GAHJ 5DD4A 2ZSHB 2R7ZJ 1H88C 3FM5A 2X6XA 4UVBA 2OPTA 1W4MA 4OIQF 3G6EI 1ZG3A 2CUZA 2Q2EB 3JAMK 3WTYC 3HBLA 2M34A 1LVKA 5E18F 4ENNA 2FEZA 4A3DJ 5E20A 4GGGA 2DAOA 2EILH 2WB1N 1VQLI 1BN5A 1ETKA 1G3WA 3DTIA 4EJOA 2BOLA 4M3FA 1U8BA 3SQNA 2I8DA 2Y30A 3ZQQA 5A2QZ 4HQMA 1KQ0A 2FQ3A 5TISC 2M8GX 3HSRA 2EB7A 3O2PE 2I5UA 1MMNA 2LG4A 2NVYJ 5BNGA 2DDBA 4KN4X 4DGWB 3ZQCA 3HC7A 3G1MA 4BH9A 1K4SA 2R7RA 1EH7A 2GXBA 3A1YA 2UWMA 1BW5A 3F9KA 1D1BA 2UZKA 2DMQA 1AWCA 4W97A 4AVPA 2ZCWA 3DKWA 1JUSA 1ETOA 3IKTA 1SAUA 4XKVA 1B1BA 1MBFA 4IKFA 4L0YB 4NC7A 4M74A 1OISA 2JZYA 3HKZN 3LNQA 3AG2H 2BHZA 1DGRM 3NQOA 4N0BA 2JPBA 1X1BA 5HS7A 3OIOA 2VKVA 2H6BA 2EZLA 4F93B 1P6RA 4ESFA 4KITB 1TWGJ 2V26A 3RKWA 5DUKA 5LHGA 2QQBA 3CLOA 2KJBA 3G1LA 1VTNC 2KRHA 2IXSA 4BBSJ 2IGNA 3A2KA 5IT9Z 5K7HA 5D8KB 1IRXA 1XDSA 4UB8C 3NWSA 3HTUA 4BJTA 3IH3A 5ERIA 4P5OA 1XGSA 1OYYA 2WAQA 1RR7A 1MH4A 1OLTA 3JRHA 5JHUA 4I98B 5J40A 2ZKZA 4J19A 4A69C 1IXCA 3CCRI 2QCOA 2KPMA 4R1HA 3JRFA 3WTZA 4E7LA 3R4KA 4ASNA 4MIMA 2Q1ZB 5FKNA 3TW6A 2O03A 3TP0A 2LLKA 1UELB 1P9QC 3S14J 2VE9A 3KP2A 3K4KA 2KL4A 1W5SA 3I9V2 4N9HA 2K27A 3HYIA 3KLNA 3M7GA 4JK1X 1EF4A 3AKZA 1R5HA 5KAIC 3GF2A 3ESWB 4MTEA 3OYFA 2K02A 4HQEA 3BR3A 1BR1A 4CCMA 4ENJA 3GTJJ 1O3TA 3MZYA 2K9MA 4IRHA 4ZDOA 3RKXA 4E70A 2L9VA 4Q48A 5DS9A 4H4KC 2E5ZA 4DJAA 3H3UA 3CCEI 4UV8A 2QYOA 1N75A 3Q9VA 4TV7A 2KZVA 3I56I 1Z3YA 5FFXA 3HIFA 1XN7A 2DA2A 2E71A 4Y33A 2K85A 5C44J 2LFBA 5AIPA 4PZJA 3AG4H 3MWMA 1RC9A 4CYCB 2L0KA 4MLOA 3WE2A 2OU2A 4KIFA 1FY7A 3DTEA 3S3NA 2WA0A 4HV5A 3E7LA 4O6JA 4M3GA 1P4AA 1QRYA 2VOOA 3ZR8X 3GCMA 3ERMA 4KJZA 1K7AA 3OYKA 3GBGA 5ILUA 5E3MA 2LY1A 1MDMA 3BTIA 3FHNA 2D1VA 4D0PA 3HPHA 2R7TA 3PFIA 4N9IA 2O3FA 2FA5A 5B66C 4IHYA 2CW0F 3ZN1A 4MNUA 4HRIA 2EQRA 5D6FA 3H5AA 2FBKA 4IRIA 1SFOJ 2BXZA 1ZREA 4A6DA 4C3JJ 1MJ9A 2R0QC 2IA2A 4BE1A 4R8HA 3GW2A 3NARA 2J5OA 3FKJA 2RNGA 2HDCA 4MEYF 4FE4A 2CSOA 4WX9A 4Y4RA 4I76A 4RGUA 2ZJRF 3ABMH 4S05A 2FU4A 4L9JA 1XGMA 3I4MJ 2FBIA 1R1UA 3I4PA 3GTQJ 3T8RA 1OR7A 5DUIA 3BLYA 3HRSA 3HB9A 1ZAOA 3HM5A 2LF7A 1P2FA 1EA3A 3CDHA 3FF5A 3H35A 3HOVJ 2A5YB 3BQYA 1U0JA 1X1DA 1S8NA 1MBEA 2V1DA 3KIOA 3OR2C 1T38A 2VQCA 1OJLA 1X2MA 3IKVA 3M9AA 4WWCA 3CCSI 2W57A 2CUEA 3SZPA 1WWXA 3KEOA 2AS5F 3PQJA 2P5VA 1TW2A 3NWTA 1YQAA 2KDZA 2FJ1A 3HGGA 3RPUA 2R5YA 1D5VA 3CMYA 4DYQA 5DCFA 4F91B 1W1WE 3BWGA 4LITA 4Q4ZF 4YFNF 5LEKA 4L5IA 3BZ6A 4BEHB 3L1PA 2R5ZB 2HQRA 2K40A 2QLZA 3OR1C 1S9HA 5TRDA 1U8RA 2VUMJ 1TT0A 1QZEA 5EGOA 1GVDA 1DUXC 3ZQGA 1MZBA 1HXDA 3OMYA 5TJJA 3J81Z 1FC3A 3JREA 1B59A 1FP2A 3RKQA 1RPWA 3OL4A 4JBAA 2X1EA 2P5LC 5CKTA 5GTHC 3ULQB 2VC1A 4CA0A 1XD7A 2BY3A 5D5VB 3BR6A 3U9GA 1WGXA 3ZXSA 3K4NA 5F04A 4PFPA 2ZJ2A 3ZMZA 1R58A 4NBQA 2F5DA 3FXQA 2XROA 1RETA 1IAWA 4IXAA 4Z2YA 1BJZA 4F92B 2XAFA 4I09A 1LJ9A 2BVMA 5HS8A 3GVAA 1YRNB 2CUFA 2E5NA 3K1NA 4I01A 2HQAA 3LSMA 2Z2SB 4A3JJ 5LD2C 3HOXJ 3OSGA 4GYGA 1CF7B 4LB5A 5D6EA 3A03A 3TBIA 1S72I 3V8LA 5E1WA 4B48A 3DQVC 4PSXA 1E2XA 2VQLA 3MZHA 4KNYA 4C9YA 2VJ5A 2WADA 2DA6A 4XN0A 2M4KA 2COBA 4G7ZF 1VI0A 4ZDPA 4ENKA 3NAUA 2DA4A 4BE2A 1KU2A 1QVTA 3E5XA 3I59B 2LR8A 3OOUA 1OCOH 1YFHA 3EUAA 3HOYJ 1KQ8A 5D8LB 1A35A 2Q0OA 1MBGA 3OYLA 1SVOA 2XB0X 1WQ2A 4B3AA 2W7NA 2EPFA 2EZIA 2KKOA 3TOAA 5EF6A 2F4IA 3BZCA 2H1LA 2HOTA 3HRTA 4ON0A 1OYWA 3KZZA 1R7JA 3MKZA 1H0MA 1ZELA 1W5TA 2E36A 2KLOA 3X2QH 4ETSA 3CTAA 5EG0B 1D1CA 2LF8A 2MC3A 2UXNA 3U1DA 5M3MJ 3EUHA 2LRDA 3WTUC 3TO6A 4KFCA 3L9FA 2OTLI 4XLFA 3CCVI 2JTVA 2ZNYA 2Y0SA 4XIDA 1APLC 2FOKA 3H92A 4LK1F 4V2FA 3HRMA 3M3YJ 4NDLA 4ZC3A 2NVTJ 3GXOA 4HEA2 4IQ4A 2EFPA 4IRGA 3CMMA 2JUGA 2BW3B 1HSTA 3JRDA 1X3ZB 3VYRB 2VI6A 2CV0A 2IT0A 1RNLA 5DTDA 2XDVA 4M6YA 1AU7A 1LKXA 2CW8A 1H9GA 3I0TA 4BY1J 1K4TA 2XKPA 5J6XA 3RQ4A 3D5RC 3WU2C 1VQMI 3H3ZA 5JVTA 3Q0UA 3C3WA 2L9NA 2M30A 2XGEA 1T08B 1XCVA 3FMRA 2AO9A 1ITYA 5J3LA 1E17A 4L9TA 4PJNA 1XS9A 4EGZA 4XSXF 1V3FA 4O3MA 2WAEA 2ZXIA 2V1UA 2E7XA 4AYBN 4PCQA 4UXNA 2XAQA 1VQNI 4ZYHA 3HL2A 2XC7A 1LFBA 1KONA 1JTXA 5D5UB 1FNNA 1OYIA 4U0VA 4C30A 2GIZA 3SEZA 4AU7A 1XB4A 5K7ZA 2VBWA 4KA4A 2OA4A 4IHWA 3M07A 5EEGA 3S16J 4II2A 4HPQA 2H09A 2L5QA 1N77A 2QM3A 2FOWA 3K0LA 2ESHA 4PJLA 1DPUA 1RI7A 4Y15A 1I3AA 1FP1D 2XIGA 1WJAA 2E1MC 4UVCA 2BE5F 1AKHA 3S32A 1DU0A 2X6YA 3V4GA 2QA4I 1X1AA 4GDFA 2DTRA 3L2VA 4KIGA 2Y9ZA 3W6VA 2V9PA 1LEAA 3PSFA 2ISZA 5D5WB 1SFXA 3FMQA 2WY7Q 2W4SA 3RIRA 3TGNA 4HYEA 1IN4A 1PJRA 2B0LA 1XMXA 5KCMA 1YRNA 1BR2A 3F3XA 5CVJA 3O8GA 2QEXI 1D3YA 2R93J 2GA1A 1BIBA 1IO2A 1OR7C 2JPCA 3GZ5A 2MLGA 3W2VA 1A6IA 1Z05A 1G8XA 3C1DA 1PP7U 1EH6A 3CJQB 2JA7J 1JKOC 2CYYA 1ZG1A 2DMNA 1WJBA 3DEUA 4QLCU 1IXSB 4XR6A 4EQQA 2DYRH 3G3ZA 4HV6A 1UHWA 3L00A 1RUNA 4XN3A 2YPRA 4NQWB 5CVRA 3QYFA 2CV1A 3AAFA 2QSGX 2K4BA 3OYHA 1I27A 2RQPA 3I59A 1L0OC 3F6VA 1I6XA 3I58A 3GTPJ 4QPOA 3I55I 5FKOA 4HX4A 3MAJA 5A2QK 4R79A 3S17J 1LNWA 1DP7P 3UKGA 4ESJA 2HI3A 4CSWA 2DOEA 2BGCA 1Z9CA 2DMTA 3GUDA 2BEOA 2ID3A 2M45A 1G4DA 5F1RA 3K69A 1VF9A 1AOYA 5ICFA 2XSDC 4G8XA 3JTGA 2K9LA 3RPQA 3CJNA 4G94A 1Y0UA 3PJRA 1LDKB 4RS8A 3ZRGA 5HNFA 3LAPA 2R7WA 4BQOA 1Y0NA 1T0FA 3S3OA 3DU5A 2ELHA 2IS6A 3DU6A 4Y7NJ 1YI2I 2GZWA 2GOXB 2IA0A 4YIFA 2Z33A 5ICCA 2ZFUA 4KT6A 3PUFA 2PFBA 2GXGA 1J75A 4CUGA 1ETXA 2BHYA 1Z3XA 5EDNA 2FUG2 4BS9A 3GMEA 1NG6A 2XB5A 4DIQA 1BOBA 2E2JJ 4AC0A 3C18A 4IHTA 3C2BA 1H89C 2P7VB 3QAHA 1E3PA 5IT9K 3OYJA 2FNPA 3HDDA 4V2GA 1Z6RA 2NS8A 4B09A 1U9NA 1ETYA 1IV8A 1IXRC 4PUSA 3IRRA 1YHQI 2LBFB 2FQ4A 1R36A 2V1XA 3U1KA 3IAM2 2KIQA 2ZXJA 3Q5FA 3K70D 3CF5F 2JSCA 3MKLA 3OIQA 1FYMA 1QHHD 1YO5C 1W7PA 1ERDA 5LHIA 3BR2A 3L2WA 4FISA 4IL6C 1CGPA 1A04A 4XLAA 2DPDA 2LYCA 5IP7J 4PK4A 1B4AA 3E1SA 2EWNA 5B5EC 2XAUA 2Z16A 3H1CA 5GPCA 1K6OA 2R92J 4OAZA 1TT5B 1ZHFA 2XASA 1WVRA 3MQ0A 1ENHA 4M73A 3G4SI 4IHSA 4XICA 2ELJA 5LRRA 4LG3A 5IP9J 2P81A 3C7JA 1V54H 1HQCA 5J8CA 1K78B 1GHCA 2CFOA 1LFPA 1WKMA 3VDXA 1SD4A 2HKXA 3DCFA 4IJAA 2VXZA 1K61A 1R1TA 2PJRB 2LKPA 1O7LA 4A3CJ 1ZGWA 2GOMA 1T98A 1WRJA 2IGOA 2Z9OA 5E1XA 2UV1A 4IEJA 3MFKA 3KP4A 1WHUA 1R1VA 2W25A 4EATA 2AQFA 4ZYGA 1YTYA 3OYGA 4E7ZA 2FMYA 3F8BA 4CCOA 4C2TA 1N25A 2F5VA 5CQEA 2A3SA 3FZVA 3W2WA 3H3VK 2JA5J 1S7EA 3HGYA 1I50J 3FMSA 2HPMA 1MNMC 3VPRA 3F23A 4BQAA 4M72A 1ZGJA 3BG3A 3QU3A 1PUFB 1JT0A 4XK4A 4OIOF 5FLXZ 3BCBA 3OS2A 1SANA 4J00A 5DCMA 5B3SH 1CQTA 1HSJA 1KU9A 2LC2A 2DLLA 3T8TA 2DA3A 3ZQLA 1REPC 1FMVA 3SDGA 2OUMA 1KU7A 5DYMA 1OKRA 1YYVA 2MYSA 3OYCA 9ANTA 4A12A 2ECBA 2X85A 4YIIA 1FOYA 2P6SA 1XSDA 2BY1A 4JQFA 5HLGA 1KQ9A 1YJ9I 3FKIJ 4ZTFA 1MSEC 4G6DA 1FBSA 3FK7A 1KZHA 3CC7I 3NRVA 4II3A 3DLAA 1GV5A 1AA7A 3HG9A 3VB2A 2EA2A 4UVAA 2GA2A 3OYDA 3KE2A 1R22A 1WI9A 2EZHA 4HNUA 3KPHA 4BJ6C 4XLPF 4I0AA 1R4MB 4HF2A 2O9LA 2RN7A 1SFKA 4EM0B 4P9UA 2G9WA 2MH2A 3OY9A 1JI8A 1OQYA 1G3YA 1UG2A 1B9MA 1RUOA 5F0CA 3LA3A 2H1KA 2Q8KA 3D0SA 1V5FA 1GV2A 2NS0A 2FD5A 2DN0A 5KHDA 2MGQA 4EGYA 3OYMA 5K5QA 4H0EA 5J8FA 1WJ5A 1NHAA 2HOAA 3QWLA 4LLNA 3J81K 2G7UA 1G3TA 1OFCX 1FTTA 4HAMA 4OIPF 3LSTA 1E0EA 3TKYA 3BY6A 3M8JA 1U2WA 2YU3A 3SEQA 2DT6A 2GM4A 1EH8A 4GO1A 4M9SA 4WF2A 3S1MJ 4XONA 1IN8A 3CUQA 2A69F 3BTLA 2ZB9A 3GO5A 4QTRA 2XPWA 1X2NA 2OAZA 3CJTB 2PQ8A 2VE8A 1IV6A 1JGGA 2NVQJ 1B6AA 1T2KA 3JR9A 2QF7A 1YW7A 1T0FC 3O8HA 3S93A 1IG7A 1FSEA 1TTYA 2JT1A 4MGRA 2GLOA 1X4OA 1VQ9I 3JSOA 3SXYA 1X1PA 4HLXA 1QQIA 2LY2A 1O4XA 1TW3A 3CUOA 2M8EA 3S15J 3KFWX 3JRIA 5H6QA 2PJRA 4RLFA 5LEJA 4HDVA 5JLXA 2O7OA 2QVOA 3HTSB 4XNFA 4MQVA 3CO7C 3J80Z 4D9JA 2PN6A 4YEJA 3L2RA 3L2QA 2CQXA 2XVCA 2P4WA 1G3SA 3H0GJ 4OWRB 1I6HJ 3I4NJ 3VYUB 1QVUA 3S1QJ 3A0HC 4IOCF 1QNTA 3DEWA 1HW1A 2DFIA 2X6OA 4KICA 5FKLA 1IUYA 4L9VA 2LMDA 1Q1VA 1ULYA 3G71I 3IHUA 4NC8A 2ZXHA 5H2FC 1HOMA 1NK2P 1ZH5A 2FMLA 2CQQA 1MBJA 3CP8A 3H9QA 1PUFA 3SZTA 3DP7A 2O8XA 4HW0A 2V6EA 4KISA 3WODF 2BVLA 3RJPA 2RGVA 1F9NA 2EH3A 2QKMB 3IWFA 4QPQA 1JUMA 2IBDA 4UUSB 4BDZA 1QBJA 2JUCA 1VNDA 1RKWA 1QA6A 3JRAA 1ETQA 3ZP5A 1LEBA 2QQ8A 5IPAA 3CDIA 3PNVA 3U2RA 3OYBA 2QBYB 4G7OF 3D5SC 1OCZH 2V79A 2MA3A 1O3SA 1DU6A 1HCRA 4IVNA 5IP6A 3BJOA 5FRNA 4XOPA 2Q2EA 3F0CA 1P7JA 3ASOH 4YIRX 2WAQN 2ZC2A 3BG6A 2OCCH 2KIMA 2RREA 1JTYA 2GAUA 4AWXB 2PLYA 1MSFC 3P9KA 3W6KB 4F7ZA 3H5RA 5LHHA 2GIVA 4G9YA 5KVRA 4CZZA 1TQMA 1ACIA 2EINH 1YJWI 2E34A 4WK8F 1ODDA 1S7AA 3VOEA 3ZMUA 3TOBA 5GADJ 5BMZA 4ZTJA 2O0YA 2VKEA 2O5RA 4XORA 4M3DA 2RVCA 4M9ZA 3IH2A 2LREA 5CQGA 4CCJA 2P8TA 4BAYA 3CCJI 5BQTA 4L5EA 1W7PD 3J7AY 2M2EA 4A0XA 4BU2A 5LGUA 1HKQA 5E1ZB 3RYRA 4HLYA 4DNCA 1F36A 3PFYA 1YITI 3QOEA 2STWA 3IUOA 2ELKA 4ZYEA 3J7AO 2L54A 2R7QA 1T8IA 1QZYA 1YJNI 1K79A 2E2IJ 3HOZJ 1QPMA 4EVIA 2P6TA 1E3HA 4HSRA 3AL0C 5BPDA 5J1RA 4A6EA 1WI3A 1USTA 3IL2A 3GTGJ 2XRNA 1DGWY 2OZ6A 1J2XA 3E6MA 1IJWC 3ERED 3N97A 2NOJB 4IQJA 2DPUA 2FSWA 4OOIA 1U5TB 4KMFA 4BQQA 5FGMA 2NRAC 1S29A 2KMUA 1FIAA 1VQ7I 4EMSA 3PL8A 3HOSA 2VASA 4RGXA 3CQZJ 1MJAA 4BXFA 1B72B 2FXAA 1VQ4I 1IN7A 5F0FA 4M71A 2EIKH 3UNGC 1WFXA 2OD5A 1RRJA 3L09A 4HNTA 2PMZA 2VJ4A 3FXLA 1LB2A 1J0RA 2DCEA 3ML6A 3F72A 1V5EA 2ISYA 5EEAA 2B7EA 3BJAA 2HVRA 3QYEA 4RAYA 1XC5A 3KP3A 4EJTA 4XKWA 3OWTA 4Y52J 3R0AA 2KP6A 3FM3A 1WPKA 4E7IA 2M9HA 4CGZA 3KP6A 2G7HA 4BHBA 4YRVA 2AXLA 1FIPA 2LKXA 2ACJA 4PGHA 2DJIA 3JW4A 2NVUB 2HDDA 4HF1A 4PGGA 4RAFA 2DT7B 3TL4X 4CICA 3JSPA 2QGUA 3IAS2 2QZ8A 4N4OB 3F8MA 5IT3A 3CO6C 2XGXA 2VODA 2A6HF 3BDDA 3GTKJ 1I1SA 3JRCA 4UUSA 5JVGF 5M3FJ 1TWAJ 5D4SA 3CUQC 3F6OA 3MN2A 5GP9A 3ZMSA 3K9TA 3GTLJ 2GXAA 2WTEA 2PI0A 2DQRA 2EV5A 2MABA 1F1ZA 4FX4A 2CU7A 2DDAA 4CYCA 4YELA 3DLLF 3CESA 2WWYA 3LAJA 3GWZA 5E3OA 4A3LJ 1R00A 2JJ7A 3BOQA 4A2UA 1U6GA 3HUGB 3BTJA 2NOGA 2DJNA 4A0YA 4IF4A 4B3XA 1JHFA 1Y1WJ 4IZZA 2RNJA 3N05A 3WU0A 4IHXA 1WJEA 2VONA 5F0HA 2ZNZA 1DPRA 4RLQA 4NHJA 4LG0B 2K4JA 1EV7A 4ESBA 2VBZA 5HLHA 4LLGF 2YS9A 3LSGA 3OYNA 2VT3A 3DXJF 3QPSA 3OS0A 2HWVA 2EIJH 2I10A 3GFJA 2NNYA 1OCCH 5K7FA 1HA8A 1T56A 2QWWA 2DO7A 3K4CA 4UNOA 2V1NA 2K9NA 2JA2A 2E1NA 4CH7A 2LKSA 3R6SA 5CYVA 3GLXA 2EBIA 5JFRA 1YS7A 3ONQA 3TMOA 2D5VA 3HXLA 2L9SA 4BACA 2XSJC 1F43A 5FLVA 3MD2A 1PDNC 4CCLA 3JRGA 3KETA 3V8JA 2HOEA 1SD7A 1P92A 1SFEA 1SC7A 4AVZA 2IW5A 1D0YA 5HLIA 4ZJZA 4E6KG 3CMAI 1Z91A 5K5RA 2R7SA 4KMUX 1YG2A 1ORKA 2XHKA 3ROUA 3WHCA 2HYGD 5J47A 1KYWA 2ME0A 3AG3H 4GYIA 2IGMA 3SFZA 1WZ2A 1IDZA 3DKYA 3RKYA 5HOOA 3TEDA 2L7MP 2DT5A 3O3KA 4D7MA 1DDNA 2L7ZA 4D5FA 3E6BA 4I2OA 3RZOJ 5HVQC 3D5LA 4AUXA 1SMYF 2IRFG 5E8GA 3R61A 4BEHA 1HLVA 2R5ZA 1D0XA 3A02A 3RYPA 5E3LA 3GTOJ 5LBQA 4V19K 3KYLA 5F27A 1ZLKA 4DBRA 1MKMA 3ABTA 3MKWB 4HG2A 4Y3OA 3CLQA 5FLMJ 5K1YA 1VFCA 1YIJI 1IRGA 3ZQIA 2XAJA 4B44A 1T95A 5D5XB 1OCTC 5FLXK 1X3UA 3LSKA 2Y0SN 1GT0C 4Q47A 3CCQI 2IAIA 2WBMA 2HVSA 3F8FA 1UJ8A 1FLIA 3BT9A 1X3WB 2Y9YA 3H9GA 1YIOA 3OYIA 2VKHA 2R7DA 1BC8C 3COAC 1I39A 3LFKA 1TP4A 3Q9SA 4RA2A 4MFDA 5ILSA 1J9IA 2HTSA 1CF7A 5KNLA 2NAZA 4BDYA 3IC7A 1L3LA 4UV9A 3K4BA 2H8RA 2VXDA 3DFGA 3SFIA 3HRUA 5FFZA 2K86A 4K2EA 3DEEA 3PUBA 2RV8A 1ZGAA 4LJZF 2XUBA 4U88A 4W1UA 5FROA 3HOUJ 3B6CA 1IN6A 2R7XA 3VEPA 1A6QA 3CMEI 1UB9A 2IJLA 3LSPA 3I64A 1A36A 4GXOA 6PAXA 4PDKA 1W5CC 2H8WA 3H36A 4UUTA 5IYDJ 3QU6A 1S6LA 3DPTA 3HUGA 5HDKA 2LNBA 3J7ZI 1BR4A 3BROA 3MVPA 1BI1A 1Z77A 2FNAA 1VQ6I 2PMUA 4I6ZA 3MCZA 2GWRA 5EEHA 3REOA 2DMUA 2YR2A 5IYBJ 4XL9A 5L3FA 2K9QA 3HOTA 4XBFA 1R49A 3MKYB 4IO9F 1YOVB 1B9NA 2W48A 2M4GA 3K70C 4BXUA 1GXQA 2CG4A 2A5WA 2Z3YA 3FXUA 1GUUA 2AXTC 5JR3A 5EG0A 3H5NA 2F2EA 2QUFA 2HYJA 4L9NA 3GFIA 2CGPA 1PVEA 3T1BA 4XRSG 3C2GA 4EJVA 2QKLB 3K1PA 2WV1A 5F1JA 2ZSIB 4ABZA 3W3CA 5GAEJ 3PQKA 4WCGA 4A3EJ 1HF0A 1KA8A 3LFUA 3LSJA 5FD6A 2BW3A 2IEKA 4RB0A 1O57A 2HS5A 2OCEA 5IY5H 4A3FJ 3K10A 3IRQA 3EQLF 4X6AJ 2E1CA 1FSHA 2VBXA 5BOXA 4DW6A 4LFUA 2LTPA 1ZG5A 1HKTA 3W2AA 2JVGA 1IZ1A 3IWZA 2MD5A 1T39A 4X1EA 5HDGA 2XPVA 1D8JA 2DA1A 4OMZA 4HNVA 1NG7A 2BV6A 1WJFA 5E8IA 1BM9A 3M8EA 5KK1A 1ZLJA 2L7KA 1XGOA 2IS1A 2EFOA 3LSIA 3LMMA 1BI3A 4NUBA 4MHGA 3J80K 4XOTA 3VSKA 4DOZA 2K3PA 5C3EJ 3K1MA 4A3BJ 1BW6A 1WH5A 3MZ8A 3F22A 3EPZA 2JN6A 3E3VA 2F4MB 2MH9A 3ABKH 2CW7A 4P1WA 3FX3A 3ZQHA 2PJPA 2OZUA 2KIUA 1Z1DA 4JP0A 1OCRH 2A6EF 2M0CA 2O61A 4ITVA 2WV0A 4KT5C 1QZZA 4LIUA 1XSXA 3EUHC 4FE7A 3G73A 5IOZA 3K4LA 4P9FA 4A5MA 3JRBA 5LRSA 2ADUA 4KDPA 2WC2A 2OF7A 1R5GA 4XRSA 1YLFA 3TO7A 4I02A 3BG5A 2EFNA 3WU1B 1QGPA 2LH9A 4G6TB 3PIOF 2B63J 5E17F 4BYYA 1F5TA 1SVMA 2CQNA 1Z7LA 3ASNH 4HSTA 4BKXA 3HOWJ 2KT0A 2L4MA 1TNTA 1P7IA 3KEQA 2HQ5A 2W82A 2ESNA 3DBLB 2V4JC 2V7FA 3SJMA 4M3BA 2EK5A 3MMYB 5ILVA 2IPQX 3DKXA 2F48A 4HX8A 2R4GA 2LD5A 3WTSC 3OL3A 1XDUA 1HDPA 1ZRDA 4RDUA 2HR3A 5H6RA 1TQPA 1SMTA 3I53A 3ISPA 5JI6A 4NQWA 2BXYA 1TL8A 1UG0A 1IN5A 2X51A 3EETA 2WB1A 2VOPA 2VKDA 2YU9J 1JUPA 2HYFA 1MNDA 3A0BC 5AIQA 2HOSA 1O3QA 5JHFA 1STZA 1LE8B 3RZDJ 2D45A 3H9JA 2STTA 1QU3A 4MQ9F 2FBHA 2HNHA 4MEXF 4EM2A 1WJCA 2X9DA 3GYHX 1E3OC 5F6FA 1ON1A 2M3AA 2VIXA 3CC4I 2LOOA 3EDPA 4I99C 2MBFA 3B6AA 3BJ6A 3FBIB 4XLCA 3FXKA 2ETHA 2CJJA 4FASD 3KYCB 3CCUI 1TZLA 3BPXA 2QQAA 4CZCA 1EKEA 1D5YA 4UB6C 4D7NA 1FJLA 1SD5A 3E5UA 3E97A 1R71A 3F21A 2A07F 2W84A 2ZJQF 3EYIA 3VWBA 1VZ0A 3HKZA 1YX5A 1OPCA 3WGHA 3TP3A 2GQQA 3ZMTA 4ZYAA 2L4AA 1U9OA 1IDYA 2VPLA 4JX5A 1LDDA 5E3NA 3DTKA 1ZRCA 2DMPA 2HXIA 1SFUA 1GVJA 4E7SA 1UZCA 4ZZDA 1TC3C 3HSFA 1MDMB 1NK3P 3BTCA 5FJ8J 2IA1A 1TNSA 1H8AC 5L3EA 1ZN2A 1ZR2A 2LBFA 3T0YA 2M5WA 5D4RA 3WTXC 4A3IJ 1WH7A 1XSVA 1QHGA 2L3DA 2E1MB 2M7BA 4PJJA 1IRZA 1XCBA 3V42A 2VJIA 3M1CA 4X0GA 3GTMJ 4Y17A 4LGWA 4YFKF 3AG1H 1U78A 3Q3SA 1BL0A 3CCLI 2K9SA 3A01B 1X19A 2Y75A 1XG1A 1TWHJ 1FMWA 2WAFA 5IOYA 3SZGA 1I5ZA 2KRCA 4E7JA 2RKHA 2HVQA 3IP4B 3LOCA 3W6JB 1VQ5I 2EFWA 4CHUA 2E19A 3P9CA 1TWFJ 3Q0WA 3DPUA 4KYWA 2KQRA 2KISA 2Y0MA 3CP2A 3ECHA 1FTZA 1BC7C 3F8NA 3J7YJ 4RGRA 2EV6A 3DPLC 4ZYDA 1K78A 1ZTRA 5DM7F 2XRLA 1JHHA 2MLKA 2E7WA 3VYSB 3PNTA 2VL8A 1M1EB 2MSYA 2JQ7A 4I7HA 4OAYA 4DZJA 4RB1A 2O8KA 3B02A 2DA5A 4CDGA 1XGNA 4RMNA 1YW8A 2FRHA 2FE3A 3T5XA 3SYTA 3PIPF 2R5YB 3OIPA 4GRIA 1G2HA 1YX3A 2HTJA 3CZ6A 1BA5A 3SHFA 2H6CA 3IV5A 2LVSA 3PO2J 1DP3A 4FHTA 3FK6A 2Y48A 4XRFA 4UY8I 2P7CB 2EFQA 5LGTA 1PUEE 5EGOB 1WCMJ 2BY0A 2KZGA 1BJAA 2Z5UA 4M6VA 4PJ0C 5FB2A 1ZQ3P 5DDGA 1ZK8A 1PYVA 4HZFA 1J7KA 1KYZA 2BYVE 3M8FA 1RIOH 2CQKA 4ENMA 4XLHA 1LE8A 2DOAA 2PEXA 1XMAA 4J01A 2CFXA 1MMSA 2DI3A 3V8KA 4CYDA 5ICGA 4AM3A 2R3SA 1JE8A 3R60A 4CCKA 1LDJA 3CJRB 2A61A 2ZFWA 2DQLA 4DZPA 1JJ6C 1JKPC 2JMWA 2KDOA 3H0DA 1MW7A 2LDUA 1UMQA 2TDXA 5LFAA 3GLLA 4C2MJ 4KUMA 1UCRA 3RTRA 4FT8A 4FQGA 1RR8C 4IPAA 2F5CA 3WGGA 5BS6A 2BBYA 1N78A 1MNEA 1EJ9A 1QO0D 2R7FA 5FKKA 3K4JA 4DYCA 4NB5A 3M4OJ 4RB2C 1UFMA 4MO7A 5AONA 4IOAF 3BCAA 1G59A 1KGSA 4EM1A 2IS2A 4B8XA 5GPAA 4L5JA 4PJMA 3WGIA 1T6SA 3ZQFA 4N4NB 4Z6YA 3A4CA 1S5LC 4QIWN 2G0EA 1MBKA 2X1DA 2DXIA 3RQIA 4RAGA 1KU3A 3IH4A 4BBRJ 2J5PA 4HX7A 1OCPA 5JLWA 3FIWA 1V55H 4D1QA 3KEYA 1V4RA 3MEXA 4A5NA 2H94A 3ZMDA 2KIFA 3UR3C 1R23A 2N8GA 2CS3A 3HJEA 3VSLA 1XPXA 3I5UA 2ID6A 5IYCJ 2E1OA 3R0JA 2VPRA 2Y69H 5M5XJ 3V7CA 4AIHA 2OC6A 4G7HF 2HQNA 3A01A 2KJCA 3QYBA 1USSA 1B8IB 2CV2A 2JRMA 1JGSA 5L3BA 2FX0A 1SAXA 3FXRA 2V9KA 1VQKI 4ZH4F 4O5VA 3S1RJ 1ETWA 3K2AA 5B1BH 3HSEA 1Z6TA 2CWEA 4LIVA 2KFDA 3JAMZ 3QP5A 1JT6A 3PM1A 3S2HJ 3K4MA 2JSPA 5L3DA 5CVUA 1YS6A 3KZIC 4QSHA 2EJRA 2PBIA 3HZJA 3GFMA 1IRFA 4L0ZB 3TW7A 2R7UA 3HPGA 3GX4X 1Y56A 2DK8A 1GDTA 4LMYA 4XM3A 3KYDB 1ZYRF 4JYKA 3U21A 1ONVA 1ETVA 1OMIA 3KCCA 3FWEA 4CO8A 4S04A 3OSFA 2R7OA 2CMPA 1VQ8I 3G1OA 1AHDP 2W24A 2Y31A 3L2CA 2K5CA 2ZMEB 3V7RA 4E7HA 2X48A 4HF0A 1SD6A 2HFHA 4NC6A 2E60A 4GCVA 1AKHB 2HXOA 5HODA 1S3JA 2CUJA 3LA2A 1W0UA 5FRMA 1Y1VJ 4JX4A 4KN7X 3WG7H 2EZKA 1SEUA 3DF8A 1X58A 2DTZA 2LK2A 1YW9A 1IUFA 2A6TA 4RGSA 5L3CA 2P5KA 2GBYA 1FT9A 3WG9A 3FHZA 3L7WA 2RDPA 3VFZA 2QBYA 3L2UA 1HC8A 5F08A 3CC2I 2XGCA 1GLNA 1UHSA 1IF1A 1J09A 3K6GA 3LL7A 3GZ6A 2KHMA 1MH3A 2HDWA 4KIBA 4WXHA 2X1CA 3TO9A 4MTDA 4F55A 1BI2A 1Y8RB 2VQHA 1I1GA 2VLAA 4Y13A 4RB3C 2IGKA 2VC0A 2ZXWH 4DQ2A 3E5QA 1Y6IA 1TQIA 1FOKA 1MIJA 2PMZN 2UXXA 1G6NA 3E0JB 3VODA 4LOCA 3CDLA 3WE3A 4A3MJ 5E79C 1TBXA 2CO5A 2M0MA 2HEOA 2VN2A 4AYBA 2HZTA 1Z0XA 5CVVA 1MMDA 2UUZA 3LQQA 1DQUA 5KAFC 2RAEA 1BI0A 4UUVA 4C3HJ 5HLTA 2JA6J 1LQ1A 1FEXA 3S2DJ 2XKOA 4GFBA 1WJDA 2RQQA 1K83J 1RESA 4BJ5C 2XPUA 3QOPA 4BY7J 5J1YA 2FF4A 1FYKA 2W00A 2HZDA 1HW2A 4WXDA 5C4XJ 4OINF 1A31A 2XF5A 3P9IA 3LSRA 1JXSA 3V7SA 2NXNB 3WTWC 2ME6A 4DYRA 4EEFG 4XQFA 3BPVA 1R6RA 4BHPA 1FOWA 1HBXG 1BOAA 1SVLA 4RM2A 3QPTA 2CRGA 1D8KA 2IVMA 2NVXJ 4EV0A 1J59A 4HBLA 3KX2A 1I3QJ 1B8IA 4JOMA 5DM6F 3WTVC 5BPIA 1POGA 2MD0A 3LSHA 3HHHA 2QQ9A 4ZDLA 1HDDC 4B4CA 3I54A 5EYRA 4C3IJ 4M9XA 2LSOA 2JK3A 2M87A 3ZPLA 3TDUC 1X1CA 4ANJA 2L02A 1U5TA 3FXMA 4LB6B 2KRFA 1Z7UA 5M5WJ 3DBRB 3PNYA 2DFHA 2Z1DA 1MBHA 4HOBA 3ECOA 2OTJI 1FYLA 2DOFA 4E4HA 1GXPA 1B72A 1R5ID 5H20A 5FD5A 1FOXA 2YX7A 4A3GJ 1FWZA 2Y2ZA 1ZKGA 3BR5A 2TCTA 3TDZC 5J1UA 2L01A 5DD8A 4B47A 4AD9A 4XKBA 4XRMA 4BQNA 1ZRFA 3KP7A 1UAAA 5EZGA 1W7PB 1YE9A 1ZARA 5ED4A 1H9TA 1LVAA 3I3LA 2X4HA 3EUKL 4BGDA 4HDUA 1Z67A 2DFFA 2VJJA 3FISA 4A3KJ 5B1AH 3PSIA 3WTTC 1D0ZA 2ZMEA 3M1EA 3DV8A 1BBYA 3KP5A 3BP8A 5LLQA 1JJ8C 2IP2A 4YG2F 1K6YA 3CD6I 4B1RA 3HHGA 2YSRA 4XLEA 1FZPB 2Z99A 3BR0A 4MFEA 5M5YJ 2DODA 4I0BA 3ZQ7A 3C2HA 4XMYA 2YUSA 3P7NA 3CF2A 4PSWA 2DK5A 2ZO4A 1FPQA 1NH3A 4IHVA 3OOPA 1MD0A 4RAZA 2AQEA 2MC4A 2DYSH 5L3GA 2EA4A 4EJWA 2K3FA 3ZN0A 4RM3A 2AHQA 2JWTA 2PG4A 4WXCA 2TRTA 1XX5A 1A5JA 1P4WA 5TGTA 1UHMA 3JCUC 4LLLA 2BZTA 1RZ4A 3ZCOA 4U0YA 4JX6A 4DBQA 2D2WA 1VQPI 1JKRC 1TWCJ 2E35A 2ICWG 2OQRA 4XKCA 1R4NB 3F8CA 4OMYA 2HPIA 2X6WA 3QQAA 4LG0A 3DWLE 1D1AA 2D1HA 1QPIA 3CCYA 2L2OA 1BIAA 2CQ7A 5HS9A 2WY8Q 2XV4S 5DCMB 4F3QA 4FTHA 1MMGA 2OQGA 5DEQA 3BQZA 3P5JA 4BL0B 4A0ZA 2MW8A 3QP6A 3RSNA 3NEUA 3AL0B 4BE0A 2QSFX 3LA7A 4BNCA 3Q0VA 2JA8J 2JRTA 1MJBA 4AIJA 1R9TJ 4FX0A 2DA7A 4F52A 3S1NJ 3E6CC 3OS1A 1C0WA
chains in the Genus database with same CATH topology
5M3MJ 2DMPA 2HXIA 1TC3C 2VKEA 3K7AJ 4XIDA 4M3DA 1APLC 3IH2A 5C4JJ 4V2FA 1NK3P 4L5EA 3BTCA 4NDLA 2M2EA 5FJ8J 2NVTJ 3M3YJ 1H8AC 2XGDA 1ZR2A 3JRDA 1F36A 2VI6A 5DTDA 4A3IJ 2ELKA 1WH7A 1AU7A 1IRZA 3GTMJ 2E2IJ 4BY1J 3HOZJ 1U78A 3Q3SA 1BL0A 4BXXJ 2K9SA 5FKMA 3A01B 1XG1A 3Q0UA 1TWHJ 1W0TA 2XGEA 5J1RA 4FCYA 1ITYA 2AO9A 5IOYA 1WI3A 5J3LA 1IC8A 3BG9A 3GTGJ 1XS9A 1JKQC 3LOCA 2MG4A 2E19A 1IJWC 1TWFJ 4AYBN 3Q0WA 1FTZA 1LFBA 2L7FP 1JTXA 1ZTRA 4D5CA 2XRLA 1FIAA 4G12A 5K7ZA 2MSYA 3QPLA 4DZJA 2LY9A 3CQZJ 1B72B 4IHWA 2O8KA 2DA5A 3D1NI 3S16J 1NTCA 5F0FA 4A93J 3ZOBA 2L9RA 3WHBA 1RKTA 2R5YB 1DU0A 1AKHA 2ECCA 5EEAA 1G2HA 1IGNA 1XC5A 1BA5A 3W6VA 2Y9ZA 3IV5A 3PO2J 2LVSA 3FK6A 4Y52J 1T33A 1WPKA 2LP0A 2M9HA 5EGOB 1WCMJ 1ZR4A 1YRNA 4M6VA 1LFUP 1FIPA 3O8GA 5EZHA 2LKXA 1ZQ3P 2R93J 2HDDA 1ZK8A 3BR1A 1A6IA 2JA7J 3GTKJ 3JRCA 1LE8A 3HEFA 4UUSA 5M3FJ 1JKOC 3PO3J 1TWAJ 2DMNA 3GTLJ 5GP9A 3MN2A 2NS7A 2CU7A 4CYCA 4DZPA 2E2HJ 1JJ6C 5E3OA 1JKPC 4A3LJ 2JMWA 2JJ7A 3BTJA 1UMQA 2NOGA 2DJNA 4C2MJ 1Y1WJ 4S0HB 3GTPJ 5FKOA 3S17J 5FKKA 4DYCA 4IHXA 3UKGA 2HI3A 5F0HA 2DMTA 2ID3A 4RBOA 4M3EA 1VF9A 3M4OJ 2XSDC 4MO7A 2R7ZJ 2YS9A 3LSGA 1H88C 3QPSA 2I10A 2OPTA 5GPAA 5K7FA 1T56A 3ZQFA 3HBLA 4QIWN 2K9NA 2G0EA 2M34A 1MBKA 3RQIA 4Y7NJ 2EBIA 3IH4A 2D5VA 4A3DJ 4BBRJ 1F43A 2WB1N 5FLVA 1ETKA 1OCPA 5JLWA 3FIWA 3JRGA 1ETXA 5EDNA 4M3FA 2XB5A 1U8BA 2N8GA 2E2JJ 4AC0A 2Y30A 3C2BA 2ID6A 1H89C 5IYCJ 2E1OA 2VPRA 5M5XJ 3HDDA 2M8GX 4V2GA 1ORKA 3A01A 2NS8A 2NVYJ 5BNGA 3ZQCA 1B8IB 1U9NA 1ETYA 3G1MA 2FX0A 3WHCA 2ME0A 1BW5A 3S1RJ 1ETWA 3K2AA 1IDZA 2FQ4A 2DMQA 3TEDA 2L7MP 4W97A 4D7MA 2L7ZA 1JT6A 4D5FA 1JUSA 3MKLA 1ETOA 3PM1A 3RZOJ 4AUXA 3S2HJ 1MBFA 4QSHA 3HKZN 3LNQA 1HLVA 2R5ZA 3BR2A 3TW7A 4FISA 3A02A 5E3LA 3GTOJ 3OIOA 2VKVA 5F27A 5IP7J 2EZLA 1GDTA 1TWGJ 5GPCA 5FLMJ 2R92J 1VFCA 4JYKA 3ZQIA 1ENHA 1ETVA 4XICA 3G1LA 5IP9J 2P81A 4BBSJ 1OCTC 5K7HA 2Y0SN 3OSFA 1GT0C 2IAIA 3G1OA 1AHDP 3IH3A 2Y31A 3BT9A 3DCFA 2Y9YA 1RR7A 1K61A 1MH4A 3JRHA 4J19A 4A3CJ 1ZGWA 4A69C 2X48A 2QCOA 4MFDA 3JRFA 4IEJA 4MIMA 5FKNA 3TW6A 1AKHB 2HXOA 3TP0A 5HODA 2LLKA 1W0UA 3S14J 2H8RA 3SFIA 1Y1VJ 4JX4A 3HOUJ 4W1UA 2EZKA 3B6CA 1EF4A 1X58A 2DTZA 3LSPA 3H3VK 2JA5J 1S7EA 3BR3A 1I50J 3HGYA 2LK2A 3GTJJ 1IUFA 1MNMC 3VPRA 2GBYA 4UUTA 5IYDJ 3BG3A 1PUFB 1JT0A 5F08A 2XGCA 4XK4A 5DS9A 1UHSA 1SANA 3MVPA 1Z77A 1CQTA 1MH3A 4I6ZA 2DA3A 3ZQLA 3SDGA 2DMUA 5IYBJ 2K9QA 2DA2A 9ANTA 2ECBA 5C44J 2W48A 2LFBA 4CYCB 2L0KA 2PMZN 4LOCA 3CDLA 1GUUA 4MLOA 3FKIJ 1MSEC 4A3MJ 3FK7A 5EG0A 3E7LA 2HYJA 4M3GA 1QRYA 1Z0XA 1GV5A 4XRSG 2RAEA 4C3HJ 3GBGA 2JA6J 5E3MA 1FEXA 3S2DJ 2WV1A 5F1JA 4GFBA 3BTIA 1K83J 1RESA 4ABZA 2XPUA 2EZHA 1HF0A 4A3EJ 4BY7J 5J1YA 2O9LA 4IHYA 3LSJA 5C4XJ 2IEKA 2EQRA 3LSRA 4A3FJ 1SFOJ 4X6AJ 2ME6A 4DYRA 4EEFG 1UG2A 4C3JJ 4DW6A 2R0QC 2LTPA 5F0CA 2H1KA 3NARA 2CRGA 2NVXJ 4X1EA 1GV2A 4FE4A 2XPVA 2DA1A 2FD5A 4HNVA 2DN0A 1I3QJ 2MGQA 4I76A 1B8IA 1POGA 2HOAA 1HDDC 4B4CA 5EYRA 4C3IJ 3I4MJ 2JK3A 3GTQJ 1OFCX 1FTTA 3HB9A 3HM5A 5M5WJ 5C3EJ 4A3BJ 1BW6A 1WH5A 1MBHA 3HOVJ 3BQYA 2GM4A 2JN6A 3S1MJ 1MBEA 3BTLA 2ZB9A 1B72A 1OJLA 1X2MA 4QTRA 2XPWA 3ZQHA 1X2NA 2CUEA 4A3GJ 2Y2ZA 1ZKGA 3BR5A 2TCTA 1IV6A 1JGGA 2NVQJ 4JP0A 2M0CA 5J1UA 2KDZA 3JR9A 2QF7A 2FJ1A 3HGGA 2R5YA 4FE7A 3O8HA 1IG7A 5IOZA 3CMYA 4DYQA 2GLOA 4XRMA 3JRBA 5EZGA 2OF7A 3L1PA 4XRSA 2R5ZB 1O4XA 2K40A 3BG5A 3FISA 2VUMJ 4A3KJ 5EGOA 3JRIA 3S15J 1GVDA 3ZQGA 2B63J 5JLXA 2O7OA 4BKXA 3HOWJ 1JJ8C 3JREA 2KT0A 3RKQA 1RPWA 4B1RA 1P7IA 2HQ5A 3BR0A 4MFEA 2CQXA 5M5YJ 3BR6A 3H0GJ 1I6HJ 3I4NJ 1WGXA 3SJMA 2YUSA 4M3BA 1QVUA 5F04A 3S1QJ 4IHVA 1RETA 3DEWA 2LD5A 2X6OA 1BJZA 1HDPA 5FKLA 1YRNB 4RDUA 2CUFA 1Q1VA 4A3JJ 1HOMA 1NK2P 2AHQA 2JWTA 3HOXJ 3OSGA 2TRTA 2CQQA 1A5JA 1MBJA 2YU9J 1PUFA 1JUPA 3A03A 2HOSA 2EH3A 1JUMA 2IBDA 4UUSB 1LE8B 3RZDJ 4JX6A 1VNDA 1RKWA 1JKRC 3JRAA 1ETQA 1TWCJ 2DA6A 2X9DA 3QQAA 1E3OC 5IPAA 2COBA 1QPIA 3CCYA 3B6AA 1VI0A 2CJJA 3NAUA 1D5YA 2DA4A 1FJLA 1DU6A 4D7NA 1HCRA 1QVTA 2LR8A 5IP6A 3F0CA 1P7JA 3OOUA 4FTHA 2WAQN 3HOYJ 3BQZA 1MBGA 2XB0X 4B3AA 1JTYA 2MW8A 3TP3A 2EZIA 1MSFC 5EF6A 3Q0VA 2HOTA 1U9OA 2JA8J 1IDYA 4JX5A 1R9TJ 2DA7A 3S1NJ 5E3NA 5EG0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M J;  2DMP A;  2HXI A;  1TC3 C;  2VKE A;  3K7A J;  4XID A;  4M3D A;  1APL C;  3IH2 A;  5C4J J;  4V2F A;  1NK3 P;  4L5E A;  3BTC A;  4NDL A;  2M2E A;  5FJ8 J;  2NVT J;  3M3Y J;  1H8A C;  2XGD A;  1ZR2 A;  3JRD A;  1F36 A;  2VI6 A;  5DTD A;  4A3I J;  2ELK A;  1WH7 A;  1AU7 A;  1IRZ A;  3GTM J;  2E2I J;  4BY1 J;  3HOZ J;  1U78 A;  3Q3S A;  1BL0 A;  4BXX J;  2K9S A;  5FKM A;  3A01 B;  1XG1 A;  3Q0U A;  1TWH J;  1W0T A;  2XGE A;  5J1R A;  4FCY A;  1ITY A;  2AO9 A;  5IOY A;  1WI3 A;  5J3L A;  1IC8 A;  3BG9 A;  3GTG J;  1XS9 A;  1JKQ C;  3LOC A;  2MG4 A;  2E19 A;  1IJW C;  1TWF J;  4AYB N;  3Q0W A;  1FTZ A;  1LFB A;  2L7F P;  1JTX A;  1ZTR A;  4D5C A;  2XRL A;  1FIA A;  4G12 A;  5K7Z A;  2MSY A;  3QPL A;  4DZJ A;  2LY9 A;  3CQZ J;  1B72 B;  4IHW A;  2O8K A;  2DA5 A;  3D1N I;  3S16 J;  1NTC A;  5F0F A;  4A93 J;  3ZOB A;  2L9R A;  3WHB A;  1RKT A;  2R5Y B;  1DU0 A;  1AKH A;  2ECC A;  5EEA A;  1G2H A;  1IGN A;  1XC5 A;  1BA5 A;  3W6V A;  2Y9Z A;  3IV5 A;  3PO2 J;  2LVS A;  3FK6 A;  4Y52 J;  1T33 A;  1WPK A;  2LP0 A;  2M9H A;  5EGO B;  1WCM J;  1ZR4 A;  1YRN A;  4M6V A;  1LFU P;  1FIP A;  3O8G A;  5EZH A;  2LKX A;  1ZQ3 P;  2R93 J;  2HDD A;  1ZK8 A;  3BR1 A;  1A6I A;  2JA7 J;  3GTK J;  3JRC A;  1LE8 A;  3HEF A;  4UUS A;  5M3F J;  1JKO C;  3PO3 J;  1TWA J;  2DMN A;  3GTL J;  5GP9 A;  3MN2 A;  2NS7 A;  2CU7 A;  4CYC A;  4DZP A;  2E2H J;  1JJ6 C;  5E3O A;  1JKP C;  4A3L J;  2JMW A;  2JJ7 A;  3BTJ A;  1UMQ A;  2NOG A;  2DJN A;  4C2M J;  1Y1W J;  4S0H B;  3GTP J;  5FKO A;  3S17 J;  5FKK A;  4DYC A;  4IHX A;  3UKG A;  2HI3 A;  5F0H A;  2DMT A;  2ID3 A;  4RBO A;  4M3E A;  1VF9 A;  3M4O J;  2XSD C;  4MO7 A;  2R7Z J;  2YS9 A;  3LSG A;  1H88 C;  3QPS A;  2I10 A;  2OPT A;  5GPA A;  5K7F A;  1T56 A;  3ZQF A;  3HBL A;  4QIW N;  2K9N A;  2G0E A;  2M34 A;  1MBK A;  3RQI A;  4Y7N J;  2EBI A;  3IH4 A;  2D5V A;  4A3D J;  4BBR J;  1F43 A;  2WB1 N;  5FLV A;  1ETK A;  1OCP A;  5JLW A;  3FIW A;  3JRG A;  1ETX A;  5EDN A;  4M3F A;  2XB5 A;  1U8B A;  2N8G A;  2E2J J;  4AC0 A;  2Y30 A;  3C2B A;  2ID6 A;  1H89 C;  5IYC J;  2E1O A;  2VPR A;  5M5X J;  3HDD A;  2M8G X;  4V2G A;  1ORK A;  3A01 A;  2NS8 A;  2NVY J;  5BNG A;  3ZQC A;  1B8I B;  1U9N A;  1ETY A;  3G1M A;  2FX0 A;  3WHC A;  2ME0 A;  1BW5 A;  3S1R J;  1ETW A;  3K2A A;  1IDZ A;  2FQ4 A;  2DMQ A;  3TED A;  2L7M P;  4W97 A;  4D7M A;  2L7Z A;  1JT6 A;  4D5F A;  1JUS A;  3MKL A;  1ETO A;  3PM1 A;  3RZO J;  4AUX A;  3S2H J;  1MBF A;  4QSH A;  3HKZ N;  3LNQ A;  1HLV A;  2R5Z A;  3BR2 A;  3TW7 A;  4FIS A;  3A02 A;  5E3L A;  3GTO J;  3OIO A;  2VKV A;  5F27 A;  5IP7 J;  2EZL A;  1GDT A;  1TWG J;  5GPC A;  5FLM J;  2R92 J;  1VFC A;  4JYK A;  3ZQI A;  1ENH A;  1ETV A;  4XIC A;  3G1L A;  5IP9 J;  2P81 A;  4BBS J;  1OCT C;  5K7H A;  2Y0S N;  3OSF A;  1GT0 C;  2IAI A;  3G1O A;  1AHD P;  3IH3 A;  2Y31 A;  3BT9 A;  3DCF A;  2Y9Y A;  1RR7 A;  1K61 A;  1MH4 A;  3JRH A;  4J19 A;  4A3C J;  1ZGW A;  4A69 C;  2X48 A;  2QCO A;  4MFD A;  3JRF A;  4IEJ A;  4MIM A;  5FKN A;  3TW6 A;  1AKH B;  2HXO A;  3TP0 A;  5HOD A;  2LLK A;  1W0U A;  3S14 J;  2H8R A;  3SFI A;  1Y1V J;  4JX4 A;  3HOU J;  4W1U A;  2EZK A;  3B6C A;  1EF4 A;  1X58 A;  2DTZ A;  3LSP A;  3H3V K;  2JA5 J;  1S7E A;  3BR3 A;  1I50 J;  3HGY A;  2LK2 A;  3GTJ J;  1IUF A;  1MNM C;  3VPR A;  2GBY A;  4UUT A;  5IYD J;  3BG3 A;  1PUF B;  1JT0 A;  5F08 A;  2XGC A;  4XK4 A;  5DS9 A;  1UHS A;  1SAN A;  3MVP A;  1Z77 A;  1CQT A;  1MH3 A;  4I6Z A;  2DA3 A;  3ZQL A;  3SDG A;  2DMU A;  5IYB J;  2K9Q A;  2DA2 A;  9ANT A;  2ECB A;  5C44 J;  2W48 A;  2LFB A;  4CYC B;  2L0K A;  2PMZ N;  4LOC A;  3CDL A;  1GUU A;  4MLO A;  3FKI J;  1MSE C;  4A3M J;  3FK7 A;  5EG0 A;  3E7L A;  2HYJ A;  4M3G A;  1QRY A;  1Z0X A;  1GV5 A;  4XRS G;  2RAE A;  4C3H J;  3GBG A;  2JA6 J;  5E3M A;  1FEX A;  3S2D J;  2WV1 A;  5F1J A;  4GFB A;  3BTI A;  1K83 J;  1RES A;  4ABZ A;  2XPU A;  2EZH A;  1HF0 A;  4A3E J;  4BY7 J;  5J1Y A;  2O9L A;  4IHY A;  3LSJ A;  5C4X J;  2IEK A;  2EQR A;  3LSR A;  4A3F J;  1SFO J;  4X6A J;  2ME6 A;  4DYR A;  4EEF G;  1UG2 A;  4C3J J;  4DW6 A;  2R0Q C;  2LTP A;  5F0C A;  2H1K A;  3NAR A;  2CRG A;  2NVX J;  4X1E A;  1GV2 A;  4FE4 A;  2XPV A;  2DA1 A;  2FD5 A;  4HNV A;  2DN0 A;  1I3Q J;  2MGQ A;  4I76 A;  1B8I A;  1POG A;  2HOA A;  1HDD C;  4B4C A;  5EYR A;  4C3I J;  3I4M J;  2JK3 A;  3GTQ J;  1OFC X;  1FTT A;  3HB9 A;  3HM5 A;  5M5W J;  5C3E J;  4A3B J;  1BW6 A;  1WH5 A;  1MBH A;  3HOV J;  3BQY A;  2GM4 A;  2JN6 A;  3S1M J;  1MBE A;  3BTL A;  2ZB9 A;  1B72 A;  1OJL A;  1X2M A;  4QTR A;  2XPW A;  3ZQH A;  1X2N A;  2CUE A;  4A3G J;  2Y2Z A;  1ZKG A;  3BR5 A;  2TCT A;  1IV6 A;  1JGG A;  2NVQ J;  4JP0 A;  2M0C A;  5J1U A;  2KDZ A;  3JR9 A;  2QF7 A;  2FJ1 A;  3HGG A;  2R5Y A;  4FE7 A;  3O8H A;  1IG7 A;  5IOZ A;  3CMY A;  4DYQ A;  2GLO A;  4XRM A;  3JRB A;  5EZG A;  2OF7 A;  3L1P A;  4XRS A;  2R5Z B;  1O4X A;  2K40 A;  3BG5 A;  3FIS A;  2VUM J;  4A3K J;  5EGO A;  3JRI A;  3S15 J;  1GVD A;  3ZQG A;  2B63 J;  5JLX A;  2O7O A;  4BKX A;  3HOW J;  1JJ8 C;  3JRE A;  2KT0 A;  3RKQ A;  1RPW A;  4B1R A;  1P7I A;  2HQ5 A;  3BR0 A;  4MFE A;  2CQX A;  5M5Y J;  3BR6 A;  3H0G J;  1I6H J;  3I4N J;  1WGX A;  3SJM A;  2YUS A;  4M3B A;  1QVU A;  5F04 A;  3S1Q J;  4IHV A;  1RET A;  3DEW A;  2LD5 A;  2X6O A;  1BJZ A;  1HDP A;  5FKL A;  1YRN B;  4RDU A;  2CUF A;  1Q1V A;  4A3J J;  1HOM A;  1NK2 P;  2AHQ A;  2JWT A;  3HOX J;  3OSG A;  2TRT A;  2CQQ A;  1A5J A;  1MBJ A;  2YU9 J;  1PUF A;  1JUP A;  3A03 A;  2HOS A;  2EH3 A;  1JUM A;  2IBD A;  4UUS B;  1LE8 B;  3RZD J;  4JX6 A;  1VND A;  1RKW A;  1JKR C;  3JRA A;  1ETQ A;  1TWC J;  2DA6 A;  2X9D A;  3QQA A;  1E3O C;  5IPA A;  2COB A;  1QPI A;  3CCY A;  3B6A A;  1VI0 A;  2CJJ A;  3NAU A;  1D5Y A;  2DA4 A;  1FJL A;  1DU6 A;  4D7N A;  1HCR A;  1QVT A;  2LR8 A;  5IP6 A;  3F0C A;  1P7J A;  3OOU A;  4FTH A;  2WAQ N;  3HOY J;  3BQZ A;  1MBG A;  2XB0 X;  4B3A A;  1JTY A;  2MW8 A;  3TP3 A;  2EZI A;  1MSF C;  5EF6 A;  3Q0V A;  2HOT A;  1U9O A;  2JA8 J;  1IDY A;  4JX5 A;  1R9T J;  2DA7 A;  3S1N J;  5E3N A;  5EG0 B; 
#chains in the Genus database with same CATH topology
 5GAG J;  3EYY A;  2XAH A;  4CCN A;  3QOD A;  5F64 A;  3BG7 A;  2ZJP F;  3ABL H;  3K7A J;  2F5F A;  2IS4 A;  2A68 F;  4XLN F;  1F4K A;  5C4J J;  1FBU A;  2K7L A;  3JTH A;  5CVI A;  4AID A;  2V6C A;  4U0W A;  2XGD A;  4EJU A;  2HGC A;  4U7B A;  2V9V A;  2XAG A;  3BC8 A;  2H27 A;  1LUJ B;  2ZBK A;  3I71 A;  5FO5 A;  3RPU D;  3OYA A;  2M7A A;  3QPH A;  4BXX J;  5FKM A;  1XTA A;  2R7V A;  2PX9 A;  4P96 A;  1W0T A;  5EJC A;  5ICE A;  2HU9 A;  4U87 A;  4FCY A;  1IC8 A;  3G2B A;  3E6D A;  1W36 C;  3DBH B;  3BG9 A;  2DW4 A;  3N4M A;  2NNN A;  1U3E M;  3RI4 A;  1JKQ C;  2C6Y A;  2M1B A;  2MG4 A;  2X0L A;  1J5Y A;  3FDY A;  2W1O A;  4PFO A;  2F4O B;  2L7F P;  3TQN A;  2RC4 A;  4D5C A;  1MGT A;  2VB6 A;  1V5G A;  4G12 A;  3S8P A;  3CUQ B;  3QPL A;  4ZZL A;  2LY9 A;  4UHT A;  3LQR A;  2B9S A;  5J4V A;  5K5O A;  3D1N I;  2DFE A;  3ZGK A;  1NTC A;  2P0W A;  2OJE D;  4A93 J;  4HA8 A;  2XF7 A;  4Q5S F;  3ZOB A;  2L9R A;  2VT2 A;  3GEZ A;  4LD5 A;  3WHB A;  1RKT A;  1Z21 A;  3VYT B;  4YFX F;  1WSU A;  1FBQ A;  3FXO A;  2VQG A;  2ECC A;  1FX7 A;  3O6B B;  4IX7 A;  1IGN A;  1PP8 F;  1XMK A;  4G6Q A;  3FBN B;  4FET A;  2NYX A;  2OBP A;  1O3R A;  2CH0 A;  1T33 A;  2LP0 A;  1P4X A;  3CCM I;  1VQO I;  4AIK A;  3KZY A;  1ZR4 A;  1LPQ A;  3ABU A;  1LFU P;  3SDB A;  5EZH A;  2EV0 A;  2O6G E;  3QRF F;  2EIM H;  1S7O A;  3ZMV A;  1HW5 A;  3BR1 A;  2DU9 A;  5LGN A;  1U5T C;  2QSH X;  4LK0 F;  3S3M A;  2QEN A;  4XSZ F;  2MFZ A;  2YX4 A;  1W36 D;  3B73 A;  1Q1H A;  1ON2 A;  3FXJ A;  3RCO A;  5J4Y A;  1Y8Q B;  3GFL A;  2PMH A;  3HEF A;  2JVH A;  3PO3 J;  4OIR F;  2NS7 A;  3ELK A;  5CJ9 A;  4BHC A;  5GTI C;  4U7D A;  2BY2 A;  1Y39 A;  4L18 B;  3OYE A;  4BUP A;  2OV7 A;  2F5E A;  2A05 A;  1HKS A;  4B43 A;  3GZN B;  2COM A;  5CLS A;  3S2W A;  2E2H J;  3AFH A;  1TLH B;  4QWQ A;  4CXF A;  2F6C A;  5DV5 A;  4E7K A;  3RDI A;  1O7F A;  5HNH A;  4S0H B;  3LWF A;  2VBY A;  5HDN A;  1MMA A;  4OU0 A;  4M6X A;  3K2Z A;  4P55 A;  5CPR B;  2ZME C;  2W85 A;  2HKO A;  2XF6 A;  3OV8 A;  2DBB A;  4C2U A;  3KLO A;  3BZK A;  1IW7 F;  4RBO A;  4M3E A;  1X4P A;  4NNJ A;  5GAH J;  5DD4 A;  2ZSH B;  2R7Z J;  1H88 C;  3FM5 A;  2X6X A;  4UVB A;  2OPT A;  1W4M A;  4OIQ F;  3G6E I;  1ZG3 A;  2CUZ A;  2Q2E B;  3JAM K;  3WTY C;  3HBL A;  2M34 A;  1LVK A;  5E18 F;  4ENN A;  2FEZ A;  4A3D J;  5E20 A;  4GGG A;  2DAO A;  2EIL H;  2WB1 N;  1VQL I;  1BN5 A;  1ETK A;  1G3W A;  3DTI A;  4EJO A;  2BOL A;  4M3F A;  1U8B A;  3SQN A;  2I8D A;  2Y30 A;  3ZQQ A;  5A2Q Z;  4HQM A;  1KQ0 A;  2FQ3 A;  5TIS C;  2M8G X;  3HSR A;  2EB7 A;  3O2P E;  2I5U A;  1MMN A;  2LG4 A;  2NVY J;  5BNG A;  2DDB A;  4KN4 X;  4DGW B;  3ZQC A;  3HC7 A;  3G1M A;  4BH9 A;  1K4S A;  2R7R A;  1EH7 A;  2GXB A;  3A1Y A;  2UWM A;  1BW5 A;  3F9K A;  1D1B A;  2UZK A;  2DMQ A;  1AWC A;  4W97 A;  4AVP A;  2ZCW A;  3DKW A;  1JUS A;  1ETO A;  3IKT A;  1SAU A;  4XKV A;  1B1B A;  1MBF A;  4IKF A;  4L0Y B;  4NC7 A;  4M74 A;  1OIS A;  2JZY A;  3HKZ N;  3LNQ A;  3AG2 H;  2BHZ A;  1DGR M;  3NQO A;  4N0B A;  2JPB A;  1X1B A;  5HS7 A;  3OIO A;  2VKV A;  2H6B A;  2EZL A;  4F93 B;  1P6R A;  4ESF A;  4KIT B;  1TWG J;  2V26 A;  3RKW A;  5DUK A;  5LHG A;  2QQB A;  3CLO A;  2KJB A;  3G1L A;  1VTN C;  2KRH A;  2IXS A;  4BBS J;  2IGN A;  3A2K A;  5IT9 Z;  5K7H A;  5D8K B;  1IRX A;  1XDS A;  4UB8 C;  3NWS A;  3HTU A;  4BJT A;  3IH3 A;  5ERI A;  4P5O A;  1XGS A;  1OYY A;  2WAQ A;  1RR7 A;  1MH4 A;  1OLT A;  3JRH A;  5JHU A;  4I98 B;  5J40 A;  2ZKZ A;  4J19 A;  4A69 C;  1IXC A;  3CCR I;  2QCO A;  2KPM A;  4R1H A;  3JRF A;  3WTZ A;  4E7L A;  3R4K A;  4ASN A;  4MIM A;  2Q1Z B;  5FKN A;  3TW6 A;  2O03 A;  3TP0 A;  2LLK A;  1UEL B;  1P9Q C;  3S14 J;  2VE9 A;  3KP2 A;  3K4K A;  2KL4 A;  1W5S A;  3I9V 2;  4N9H A;  2K27 A;  3HYI A;  3KLN A;  3M7G A;  4JK1 X;  1EF4 A;  3AKZ A;  1R5H A;  5KAI C;  3GF2 A;  3ESW B;  4MTE A;  3OYF A;  2K02 A;  4HQE A;  3BR3 A;  1BR1 A;  4CCM A;  4ENJ A;  3GTJ J;  1O3T A;  3MZY A;  2K9M A;  4IRH A;  4ZDO A;  3RKX A;  4E70 A;  2L9V A;  4Q48 A;  5DS9 A;  4H4K C;  2E5Z A;  4DJA A;  3H3U A;  3CCE I;  4UV8 A;  2QYO A;  1N75 A;  3Q9V A;  4TV7 A;  2KZV A;  3I56 I;  1Z3Y A;  5FFX A;  3HIF A;  1XN7 A;  2DA2 A;  2E71 A;  4Y33 A;  2K85 A;  5C44 J;  2LFB A;  5AIP A;  4PZJ A;  3AG4 H;  3MWM A;  1RC9 A;  4CYC B;  2L0K A;  4MLO A;  3WE2 A;  2OU2 A;  4KIF A;  1FY7 A;  3DTE A;  3S3N A;  2WA0 A;  4HV5 A;  3E7L A;  4O6J A;  4M3G A;  1P4A A;  1QRY A;  2VOO A;  3ZR8 X;  3GCM A;  3ERM A;  4KJZ A;  1K7A A;  3OYK A;  3GBG A;  5ILU A;  5E3M A;  2LY1 A;  1MDM A;  3BTI A;  3FHN A;  2D1V A;  4D0P A;  3HPH A;  2R7T A;  3PFI A;  4N9I A;  2O3F A;  2FA5 A;  5B66 C;  4IHY A;  2CW0 F;  3ZN1 A;  4MNU A;  4HRI A;  2EQR A;  5D6F A;  3H5A A;  2FBK A;  4IRI A;  1SFO J;  2BXZ A;  1ZRE A;  4A6D A;  4C3J J;  1MJ9 A;  2R0Q C;  2IA2 A;  4BE1 A;  4R8H A;  3GW2 A;  3NAR A;  2J5O A;  3FKJ A;  2RNG A;  2HDC A;  4MEY F;  4FE4 A;  2CSO A;  4WX9 A;  4Y4R A;  4I76 A;  4RGU A;  2ZJR F;  3ABM H;  4S05 A;  2FU4 A;  4L9J A;  1XGM A;  3I4M J;  2FBI A;  1R1U A;  3I4P A;  3GTQ J;  3T8R A;  1OR7 A;  5DUI A;  3BLY A;  3HRS A;  3HB9 A;  1ZAO A;  3HM5 A;  2LF7 A;  1P2F A;  1EA3 A;  3CDH A;  3FF5 A;  3H35 A;  3HOV J;  2A5Y B;  3BQY A;  1U0J A;  1X1D A;  1S8N A;  1MBE A;  2V1D A;  3KIO A;  3OR2 C;  1T38 A;  2VQC A;  1OJL A;  1X2M A;  3IKV A;  3M9A A;  4WWC A;  3CCS I;  2W57 A;  2CUE A;  3SZP A;  1WWX A;  3KEO A;  2AS5 F;  3PQJ A;  2P5V A;  1TW2 A;  3NWT A;  1YQA A;  2KDZ A;  2FJ1 A;  3HGG A;  3RPU A;  2R5Y A;  1D5V A;  3CMY A;  4DYQ A;  5DCF A;  4F91 B;  1W1W E;  3BWG A;  4LIT A;  4Q4Z F;  4YFN F;  5LEK A;  4L5I A;  3BZ6 A;  4BEH B;  3L1P A;  2R5Z B;  2HQR A;  2K40 A;  2QLZ A;  3OR1 C;  1S9H A;  5TRD A;  1U8R A;  2VUM J;  1TT0 A;  1QZE A;  5EGO A;  1GVD A;  1DUX C;  3ZQG A;  1MZB A;  1HXD A;  3OMY A;  5TJJ A;  3J81 Z;  1FC3 A;  3JRE A;  1B59 A;  1FP2 A;  3RKQ A;  1RPW A;  3OL4 A;  4JBA A;  2X1E A;  2P5L C;  5CKT A;  5GTH C;  3ULQ B;  2VC1 A;  4CA0 A;  1XD7 A;  2BY3 A;  5D5V B;  3BR6 A;  3U9G A;  1WGX A;  3ZXS A;  3K4N A;  5F04 A;  4PFP A;  2ZJ2 A;  3ZMZ A;  1R58 A;  4NBQ A;  2F5D A;  3FXQ A;  2XRO A;  1RET A;  1IAW A;  4IXA A;  4Z2Y A;  1BJZ A;  4F92 B;  2XAF A;  4I09 A;  1LJ9 A;  2BVM A;  5HS8 A;  3GVA A;  1YRN B;  2CUF A;  2E5N A;  3K1N A;  4I01 A;  2HQA A;  3LSM A;  2Z2S B;  4A3J J;  5LD2 C;  3HOX J;  3OSG A;  4GYG A;  1CF7 B;  4LB5 A;  5D6E A;  3A03 A;  3TBI A;  1S72 I;  3V8L A;  5E1W A;  4B48 A;  3DQV C;  4PSX A;  1E2X A;  2VQL A;  3MZH A;  4KNY A;  4C9Y A;  2VJ5 A;  2WAD A;  2DA6 A;  4XN0 A;  2M4K A;  2COB A;  4G7Z F;  1VI0 A;  4ZDP A;  4ENK A;  3NAU A;  2DA4 A;  4BE2 A;  1KU2 A;  1QVT A;  3E5X A;  3I59 B;  2LR8 A;  3OOU A;  1OCO H;  1YFH A;  3EUA A;  3HOY J;  1KQ8 A;  5D8L B;  1A35 A;  2Q0O A;  1MBG A;  3OYL A;  1SVO A;  2XB0 X;  1WQ2 A;  4B3A A;  2W7N A;  2EPF A;  2EZI A;  2KKO A;  3TOA A;  5EF6 A;  2F4I A;  3BZC A;  2H1L A;  2HOT A;  3HRT A;  4ON0 A;  1OYW A;  3KZZ A;  1R7J A;  3MKZ A;  1H0M A;  1ZEL A;  1W5T A;  2E36 A;  2KLO A;  3X2Q H;  4ETS A;  3CTA A;  5EG0 B;  1D1C A;  2LF8 A;  2MC3 A;  2UXN A;  3U1D A;  5M3M J;  3EUH A;  2LRD A;  3WTU C;  3TO6 A;  4KFC A;  3L9F A;  2OTL I;  4XLF A;  3CCV I;  2JTV A;  2ZNY A;  2Y0S A;  4XID A;  1APL C;  2FOK A;  3H92 A;  4LK1 F;  4V2F A;  3HRM A;  3M3Y J;  4NDL A;  4ZC3 A;  2NVT J;  3GXO A;  4HEA 2;  4IQ4 A;  2EFP A;  4IRG A;  3CMM A;  2JUG A;  2BW3 B;  1HST A;  3JRD A;  1X3Z B;  3VYR B;  2VI6 A;  2CV0 A;  2IT0 A;  1RNL A;  5DTD A;  2XDV A;  4M6Y A;  1AU7 A;  1LKX A;  2CW8 A;  1H9G A;  3I0T A;  4BY1 J;  1K4T A;  2XKP A;  5J6X A;  3RQ4 A;  3D5R C;  3WU2 C;  1VQM I;  3H3Z A;  5JVT A;  3Q0U A;  3C3W A;  2L9N A;  2M30 A;  2XGE A;  1T08 B;  1XCV A;  3FMR A;  2AO9 A;  1ITY A;  5J3L A;  1E17 A;  4L9T A;  4PJN A;  1XS9 A;  4EGZ A;  4XSX F;  1V3F A;  4O3M A;  2WAE A;  2ZXI A;  2V1U A;  2E7X A;  4AYB N;  4PCQ A;  4UXN A;  2XAQ A;  1VQN I;  4ZYH A;  3HL2 A;  2XC7 A;  1LFB A;  1KON A;  1JTX A;  5D5U B;  1FNN A;  1OYI A;  4U0V A;  4C30 A;  2GIZ A;  3SEZ A;  4AU7 A;  1XB4 A;  5K7Z A;  2VBW A;  4KA4 A;  2OA4 A;  4IHW A;  3M07 A;  5EEG A;  3S16 J;  4II2 A;  4HPQ A;  2H09 A;  2L5Q A;  1N77 A;  2QM3 A;  2FOW A;  3K0L A;  2ESH A;  4PJL A;  1DPU A;  1RI7 A;  4Y15 A;  1I3A A;  1FP1 D;  2XIG A;  1WJA A;  2E1M C;  4UVC A;  2BE5 F;  1AKH A;  3S32 A;  1DU0 A;  2X6Y A;  3V4G A;  2QA4 I;  1X1A A;  4GDF A;  2DTR A;  3L2V A;  4KIG A;  2Y9Z A;  3W6V A;  2V9P A;  1LEA A;  3PSF A;  2ISZ A;  5D5W B;  1SFX A;  3FMQ A;  2WY7 Q;  2W4S A;  3RIR A;  3TGN A;  4HYE A;  1IN4 A;  1PJR A;  2B0L A;  1XMX A;  5KCM A;  1YRN A;  1BR2 A;  3F3X A;  5CVJ A;  3O8G A;  2QEX I;  1D3Y A;  2R93 J;  2GA1 A;  1BIB A;  1IO2 A;  1OR7 C;  2JPC A;  3GZ5 A;  2MLG A;  3W2V A;  1A6I A;  1Z05 A;  1G8X A;  3C1D A;  1PP7 U;  1EH6 A;  3CJQ B;  2JA7 J;  1JKO C;  2CYY A;  1ZG1 A;  2DMN A;  1WJB A;  3DEU A;  4QLC U;  1IXS B;  4XR6 A;  4EQQ A;  2DYR H;  3G3Z A;  4HV6 A;  1UHW A;  3L00 A;  1RUN A;  4XN3 A;  2YPR A;  4NQW B;  5CVR A;  3QYF A;  2CV1 A;  3AAF A;  2QSG X;  2K4B A;  3OYH A;  1I27 A;  2RQP A;  3I59 A;  1L0O C;  3F6V A;  1I6X A;  3I58 A;  3GTP J;  4QPO A;  3I55 I;  5FKO A;  4HX4 A;  3MAJ A;  5A2Q K;  4R79 A;  3S17 J;  1LNW A;  1DP7 P;  3UKG A;  4ESJ A;  2HI3 A;  4CSW A;  2DOE A;  2BGC A;  1Z9C A;  2DMT A;  3GUD A;  2BEO A;  2ID3 A;  2M45 A;  1G4D A;  5F1R A;  3K69 A;  1VF9 A;  1AOY A;  5ICF A;  2XSD C;  4G8X A;  3JTG A;  2K9L A;  3RPQ A;  3CJN A;  4G94 A;  1Y0U A;  3PJR A;  1LDK B;  4RS8 A;  3ZRG A;  5HNF A;  3LAP A;  2R7W A;  4BQO A;  1Y0N A;  1T0F A;  3S3O A;  3DU5 A;  2ELH A;  2IS6 A;  3DU6 A;  4Y7N J;  1YI2 I;  2GZW A;  2GOX B;  2IA0 A;  4YIF A;  2Z33 A;  5ICC A;  2ZFU A;  4KT6 A;  3PUF A;  2PFB A;  2GXG A;  1J75 A;  4CUG A;  1ETX A;  2BHY A;  1Z3X A;  5EDN A;  2FUG 2;  4BS9 A;  3GME A;  1NG6 A;  2XB5 A;  4DIQ A;  1BOB A;  2E2J J;  4AC0 A;  3C18 A;  4IHT A;  3C2B A;  1H89 C;  2P7V B;  3QAH A;  1E3P A;  5IT9 K;  3OYJ A;  2FNP A;  3HDD A;  4V2G A;  1Z6R A;  2NS8 A;  4B09 A;  1U9N A;  1ETY A;  1IV8 A;  1IXR C;  4PUS A;  3IRR A;  1YHQ I;  2LBF B;  2FQ4 A;  1R36 A;  2V1X A;  3U1K A;  3IAM 2;  2KIQ A;  2ZXJ A;  3Q5F A;  3K70 D;  3CF5 F;  2JSC A;  3MKL A;  3OIQ A;  1FYM A;  1QHH D;  1YO5 C;  1W7P A;  1ERD A;  5LHI A;  3BR2 A;  3L2W A;  4FIS A;  4IL6 C;  1CGP A;  1A04 A;  4XLA A;  2DPD A;  2LYC A;  5IP7 J;  4PK4 A;  1B4A A;  3E1S A;  2EWN A;  5B5E C;  2XAU A;  2Z16 A;  3H1C A;  5GPC A;  1K6O A;  2R92 J;  4OAZ A;  1TT5 B;  1ZHF A;  2XAS A;  1WVR A;  3MQ0 A;  1ENH A;  4M73 A;  3G4S I;  4IHS A;  4XIC A;  2ELJ A;  5LRR A;  4LG3 A;  5IP9 J;  2P81 A;  3C7J A;  1V54 H;  1HQC A;  5J8C A;  1K78 B;  1GHC A;  2CFO A;  1LFP A;  1WKM A;  3VDX A;  1SD4 A;  2HKX A;  3DCF A;  4IJA A;  2VXZ A;  1K61 A;  1R1T A;  2PJR B;  2LKP A;  1O7L A;  4A3C J;  1ZGW A;  2GOM A;  1T98 A;  1WRJ A;  2IGO A;  2Z9O A;  5E1X A;  2UV1 A;  4IEJ A;  3MFK A;  3KP4 A;  1WHU A;  1R1V A;  2W25 A;  4EAT A;  2AQF A;  4ZYG A;  1YTY A;  3OYG A;  4E7Z A;  2FMY A;  3F8B A;  4CCO A;  4C2T A;  1N25 A;  2F5V A;  5CQE A;  2A3S A;  3FZV A;  3W2W A;  3H3V K;  2JA5 J;  1S7E A;  3HGY A;  1I50 J;  3FMS A;  2HPM A;  1MNM C;  3VPR A;  3F23 A;  4BQA A;  4M72 A;  1ZGJ A;  3BG3 A;  3QU3 A;  1PUF B;  1JT0 A;  4XK4 A;  4OIO F;  5FLX Z;  3BCB A;  3OS2 A;  1SAN A;  4J00 A;  5DCM A;  5B3S H;  1CQT A;  1HSJ A;  1KU9 A;  2LC2 A;  2DLL A;  3T8T A;  2DA3 A;  3ZQL A;  1REP C;  1FMV A;  3SDG A;  2OUM A;  1KU7 A;  5DYM A;  1OKR A;  1YYV A;  2MYS A;  3OYC A;  9ANT A;  4A12 A;  2ECB A;  2X85 A;  4YII A;  1FOY A;  2P6S A;  1XSD A;  2BY1 A;  4JQF A;  5HLG A;  1KQ9 A;  1YJ9 I;  3FKI J;  4ZTF A;  1MSE C;  4G6D A;  1FBS A;  3FK7 A;  1KZH A;  3CC7 I;  3NRV A;  4II3 A;  3DLA A;  1GV5 A;  1AA7 A;  3HG9 A;  3VB2 A;  2EA2 A;  4UVA A;  2GA2 A;  3OYD A;  3KE2 A;  1R22 A;  1WI9 A;  2EZH A;  4HNU A;  3KPH A;  4BJ6 C;  4XLP F;  4I0A A;  1R4M B;  4HF2 A;  2O9L A;  2RN7 A;  1SFK A;  4EM0 B;  4P9U A;  2G9W A;  2MH2 A;  3OY9 A;  1JI8 A;  1OQY A;  1G3Y A;  1UG2 A;  1B9M A;  1RUO A;  5F0C A;  3LA3 A;  2H1K A;  2Q8K A;  3D0S A;  1V5F A;  1GV2 A;  2NS0 A;  2FD5 A;  2DN0 A;  5KHD A;  2MGQ A;  4EGY A;  3OYM A;  5K5Q A;  4H0E A;  5J8F A;  1WJ5 A;  1NHA A;  2HOA A;  3QWL A;  4LLN A;  3J81 K;  2G7U A;  1G3T A;  1OFC X;  1FTT A;  4HAM A;  4OIP F;  3LST A;  1E0E A;  3TKY A;  3BY6 A;  3M8J A;  1U2W A;  2YU3 A;  3SEQ A;  2DT6 A;  2GM4 A;  1EH8 A;  4GO1 A;  4M9S A;  4WF2 A;  3S1M J;  4XON A;  1IN8 A;  3CUQ A;  2A69 F;  3BTL A;  2ZB9 A;  3GO5 A;  4QTR A;  2XPW A;  1X2N A;  2OAZ A;  3CJT B;  2PQ8 A;  2VE8 A;  1IV6 A;  1JGG A;  2NVQ J;  1B6A A;  1T2K A;  3JR9 A;  2QF7 A;  1YW7 A;  1T0F C;  3O8H A;  3S93 A;  1IG7 A;  1FSE A;  1TTY A;  2JT1 A;  4MGR A;  2GLO A;  1X4O A;  1VQ9 I;  3JSO A;  3SXY A;  1X1P A;  4HLX A;  1QQI A;  2LY2 A;  1O4X A;  1TW3 A;  3CUO A;  2M8E A;  3S15 J;  3KFW X;  3JRI A;  5H6Q A;  2PJR A;  4RLF A;  5LEJ A;  4HDV A;  5JLX A;  2O7O A;  2QVO A;  3HTS B;  4XNF A;  4MQV A;  3CO7 C;  3J80 Z;  4D9J A;  2PN6 A;  4YEJ A;  3L2R A;  3L2Q A;  2CQX A;  2XVC A;  2P4W A;  1G3S A;  3H0G J;  4OWR B;  1I6H J;  3I4N J;  3VYU B;  1QVU A;  3S1Q J;  3A0H C;  4IOC F;  1QNT A;  3DEW A;  1HW1 A;  2DFI A;  2X6O A;  4KIC A;  5FKL A;  1IUY A;  4L9V A;  2LMD A;  1Q1V A;  1ULY A;  3G71 I;  3IHU A;  4NC8 A;  2ZXH A;  5H2F C;  1HOM A;  1NK2 P;  1ZH5 A;  2FML A;  2CQQ A;  1MBJ A;  3CP8 A;  3H9Q A;  1PUF A;  3SZT A;  3DP7 A;  2O8X A;  4HW0 A;  2V6E A;  4KIS A;  3WOD F;  2BVL A;  3RJP A;  2RGV A;  1F9N A;  2EH3 A;  2QKM B;  3IWF A;  4QPQ A;  1JUM A;  2IBD A;  4UUS B;  4BDZ A;  1QBJ A;  2JUC A;  1VND A;  1RKW A;  1QA6 A;  3JRA A;  1ETQ A;  3ZP5 A;  1LEB A;  2QQ8 A;  5IPA A;  3CDI A;  3PNV A;  3U2R A;  3OYB A;  2QBY B;  4G7O F;  3D5S C;  1OCZ H;  2V79 A;  2MA3 A;  1O3S A;  1DU6 A;  1HCR A;  4IVN A;  5IP6 A;  3BJO A;  5FRN A;  4XOP A;  2Q2E A;  3F0C A;  1P7J A;  3ASO H;  4YIR X;  2WAQ N;  2ZC2 A;  3BG6 A;  2OCC H;  2KIM A;  2RRE A;  1JTY A;  2GAU A;  4AWX B;  2PLY A;  1MSF C;  3P9K A;  3W6K B;  4F7Z A;  3H5R A;  5LHH A;  2GIV A;  4G9Y A;  5KVR A;  4CZZ A;  1TQM A;  1ACI A;  2EIN H;  1YJW I;  2E34 A;  4WK8 F;  1ODD A;  1S7A A;  3VOE A;  3ZMU A;  3TOB A;  5GAD J;  5BMZ A;  4ZTJ A;  2O0Y A;  2VKE A;  2O5R A;  4XOR A;  4M3D A;  2RVC A;  4M9Z A;  3IH2 A;  2LRE A;  5CQG A;  4CCJ A;  2P8T A;  4BAY A;  3CCJ I;  5BQT A;  4L5E A;  1W7P D;  3J7A Y;  2M2E A;  4A0X A;  4BU2 A;  5LGU A;  1HKQ A;  5E1Z B;  3RYR A;  4HLY A;  4DNC A;  1F36 A;  3PFY A;  1YIT I;  3QOE A;  2STW A;  3IUO A;  2ELK A;  4ZYE A;  3J7A O;  2L54 A;  2R7Q A;  1T8I A;  1QZY A;  1YJN I;  1K79 A;  2E2I J;  3HOZ J;  1QPM A;  4EVI A;  2P6T A;  1E3H A;  4HSR A;  3AL0 C;  5BPD A;  5J1R A;  4A6E A;  1WI3 A;  1UST A;  3IL2 A;  3GTG J;  2XRN A;  1DGW Y;  2OZ6 A;  1J2X A;  3E6M A;  1IJW C;  3ERE D;  3N97 A;  2NOJ B;  4IQJ A;  2DPU A;  2FSW A;  4OOI A;  1U5T B;  4KMF A;  4BQQ A;  5FGM A;  2NRA C;  1S29 A;  2KMU A;  1FIA A;  1VQ7 I;  4EMS A;  3PL8 A;  3HOS A;  2VAS A;  4RGX A;  3CQZ J;  1MJA A;  4BXF A;  1B72 B;  2FXA A;  1VQ4 I;  1IN7 A;  5F0F A;  4M71 A;  2EIK H;  3UNG C;  1WFX A;  2OD5 A;  1RRJ A;  3L09 A;  4HNT A;  2PMZ A;  2VJ4 A;  3FXL A;  1LB2 A;  1J0R A;  2DCE A;  3ML6 A;  3F72 A;  1V5E A;  2ISY A;  5EEA A;  2B7E A;  3BJA A;  2HVR A;  3QYE A;  4RAY A;  1XC5 A;  3KP3 A;  4EJT A;  4XKW A;  3OWT A;  4Y52 J;  3R0A A;  2KP6 A;  3FM3 A;  1WPK A;  4E7I A;  2M9H A;  4CGZ A;  3KP6 A;  2G7H A;  4BHB A;  4YRV A;  2AXL A;  1FIP A;  2LKX A;  2ACJ A;  4PGH A;  2DJI A;  3JW4 A;  2NVU B;  2HDD A;  4HF1 A;  4PGG A;  4RAF A;  2DT7 B;  3TL4 X;  4CIC A;  3JSP A;  2QGU A;  3IAS 2;  2QZ8 A;  4N4O B;  3F8M A;  5IT3 A;  3CO6 C;  2XGX A;  2VOD A;  2A6H F;  3BDD A;  3GTK J;  1I1S A;  3JRC A;  4UUS A;  5JVG F;  5M3F J;  1TWA J;  5D4S A;  3CUQ C;  3F6O A;  3MN2 A;  5GP9 A;  3ZMS A;  3K9T A;  3GTL J;  2GXA A;  2WTE A;  2PI0 A;  2DQR A;  2EV5 A;  2MAB A;  1F1Z A;  4FX4 A;  2CU7 A;  2DDA A;  4CYC A;  4YEL A;  3DLL F;  3CES A;  2WWY A;  3LAJ A;  3GWZ A;  5E3O A;  4A3L J;  1R00 A;  2JJ7 A;  3BOQ A;  4A2U A;  1U6G A;  3HUG B;  3BTJ A;  2NOG A;  2DJN A;  4A0Y A;  4IF4 A;  4B3X A;  1JHF A;  1Y1W J;  4IZZ A;  2RNJ A;  3N05 A;  3WU0 A;  4IHX A;  1WJE A;  2VON A;  5F0H A;  2ZNZ A;  1DPR A;  4RLQ A;  4NHJ A;  4LG0 B;  2K4J A;  1EV7 A;  4ESB A;  2VBZ A;  5HLH A;  4LLG F;  2YS9 A;  3LSG A;  3OYN A;  2VT3 A;  3DXJ F;  3QPS A;  3OS0 A;  2HWV A;  2EIJ H;  2I10 A;  3GFJ A;  2NNY A;  1OCC H;  5K7F A;  1HA8 A;  1T56 A;  2QWW A;  2DO7 A;  3K4C A;  4UNO A;  2V1N A;  2K9N A;  2JA2 A;  2E1N A;  4CH7 A;  2LKS A;  3R6S A;  5CYV A;  3GLX A;  2EBI A;  5JFR A;  1YS7 A;  3ONQ A;  3TMO A;  2D5V A;  3HXL A;  2L9S A;  4BAC A;  2XSJ C;  1F43 A;  5FLV A;  3MD2 A;  1PDN C;  4CCL A;  3JRG A;  3KET A;  3V8J A;  2HOE A;  1SD7 A;  1P92 A;  1SFE A;  1SC7 A;  4AVZ A;  2IW5 A;  1D0Y A;  5HLI A;  4ZJZ A;  4E6K G;  3CMA I;  1Z91 A;  5K5R A;  2R7S A;  4KMU X;  1YG2 A;  1ORK A;  2XHK A;  3ROU A;  3WHC A;  2HYG D;  5J47 A;  1KYW A;  2ME0 A;  3AG3 H;  4GYI A;  2IGM A;  3SFZ A;  1WZ2 A;  1IDZ A;  3DKY A;  3RKY A;  5HOO A;  3TED A;  2L7M P;  2DT5 A;  3O3K A;  4D7M A;  1DDN A;  2L7Z A;  4D5F A;  3E6B A;  4I2O A;  3RZO J;  5HVQ C;  3D5L A;  4AUX A;  1SMY F;  2IRF G;  5E8G A;  3R61 A;  4BEH A;  1HLV A;  2R5Z A;  1D0X A;  3A02 A;  3RYP A;  5E3L A;  3GTO J;  5LBQ A;  4V19 K;  3KYL A;  5F27 A;  1ZLK A;  4DBR A;  1MKM A;  3ABT A;  3MKW B;  4HG2 A;  4Y3O A;  3CLQ A;  5FLM J;  5K1Y A;  1VFC A;  1YIJ I;  1IRG A;  3ZQI A;  2XAJ A;  4B44 A;  1T95 A;  5D5X B;  1OCT C;  5FLX K;  1X3U A;  3LSK A;  2Y0S N;  1GT0 C;  4Q47 A;  3CCQ I;  2IAI A;  2WBM A;  2HVS A;  3F8F A;  1UJ8 A;  1FLI A;  3BT9 A;  1X3W B;  2Y9Y A;  3H9G A;  1YIO A;  3OYI A;  2VKH A;  2R7D A;  1BC8 C;  3COA C;  1I39 A;  3LFK A;  1TP4 A;  3Q9S A;  4RA2 A;  4MFD A;  5ILS A;  1J9I A;  2HTS A;  1CF7 A;  5KNL A;  2NAZ A;  4BDY A;  3IC7 A;  1L3L A;  4UV9 A;  3K4B A;  2H8R A;  2VXD A;  3DFG A;  3SFI A;  3HRU A;  5FFZ A;  2K86 A;  4K2E A;  3DEE A;  3PUB A;  2RV8 A;  1ZGA A;  4LJZ F;  2XUB A;  4U88 A;  4W1U A;  5FRO A;  3HOU J;  3B6C A;  1IN6 A;  2R7X A;  3VEP A;  1A6Q A;  3CME I;  1UB9 A;  2IJL A;  3LSP A;  3I64 A;  1A36 A;  4GXO A;  6PAX A;  4PDK A;  1W5C C;  2H8W A;  3H36 A;  4UUT A;  5IYD J;  3QU6 A;  1S6L A;  3DPT A;  3HUG A;  5HDK A;  2LNB A;  3J7Z I;  1BR4 A;  3BRO A;  3MVP A;  1BI1 A;  1Z77 A;  2FNA A;  1VQ6 I;  2PMU A;  4I6Z A;  3MCZ A;  2GWR A;  5EEH A;  3REO A;  2DMU A;  2YR2 A;  5IYB J;  4XL9 A;  5L3F A;  2K9Q A;  3HOT A;  4XBF A;  1R49 A;  3MKY B;  4IO9 F;  1YOV B;  1B9N A;  2W48 A;  2M4G A;  3K70 C;  4BXU A;  1GXQ A;  2CG4 A;  2A5W A;  2Z3Y A;  3FXU A;  1GUU A;  2AXT C;  5JR3 A;  5EG0 A;  3H5N A;  2F2E A;  2QUF A;  2HYJ A;  4L9N A;  3GFI A;  2CGP A;  1PVE A;  3T1B A;  4XRS G;  3C2G A;  4EJV A;  2QKL B;  3K1P A;  2WV1 A;  5F1J A;  2ZSI B;  4ABZ A;  3W3C A;  5GAE J;  3PQK A;  4WCG A;  4A3E J;  1HF0 A;  1KA8 A;  3LFU A;  3LSJ A;  5FD6 A;  2BW3 A;  2IEK A;  4RB0 A;  1O57 A;  2HS5 A;  2OCE A;  5IY5 H;  4A3F J;  3K10 A;  3IRQ A;  3EQL F;  4X6A J;  2E1C A;  1FSH A;  2VBX A;  5BOX A;  4DW6 A;  4LFU A;  2LTP A;  1ZG5 A;  1HKT A;  3W2A A;  2JVG A;  1IZ1 A;  3IWZ A;  2MD5 A;  1T39 A;  4X1E A;  5HDG A;  2XPV A;  1D8J A;  2DA1 A;  4OMZ A;  4HNV A;  1NG7 A;  2BV6 A;  1WJF A;  5E8I A;  1BM9 A;  3M8E A;  5KK1 A;  1ZLJ A;  2L7K A;  1XGO A;  2IS1 A;  2EFO A;  3LSI A;  3LMM A;  1BI3 A;  4NUB A;  4MHG A;  3J80 K;  4XOT A;  3VSK A;  4DOZ A;  2K3P A;  5C3E J;  3K1M A;  4A3B J;  1BW6 A;  1WH5 A;  3MZ8 A;  3F22 A;  3EPZ A;  2JN6 A;  3E3V A;  2F4M B;  2MH9 A;  3ABK H;  2CW7 A;  4P1W A;  3FX3 A;  3ZQH A;  2PJP A;  2OZU A;  2KIU A;  1Z1D A;  4JP0 A;  1OCR H;  2A6E F;  2M0C A;  2O61 A;  4ITV A;  2WV0 A;  4KT5 C;  1QZZ A;  4LIU A;  1XSX A;  3EUH C;  4FE7 A;  3G73 A;  5IOZ A;  3K4L A;  4P9F A;  4A5M A;  3JRB A;  5LRS A;  2ADU A;  4KDP A;  2WC2 A;  2OF7 A;  1R5G A;  4XRS A;  1YLF A;  3TO7 A;  4I02 A;  3BG5 A;  2EFN A;  3WU1 B;  1QGP A;  2LH9 A;  4G6T B;  3PIO F;  2B63 J;  5E17 F;  4BYY A;  1F5T A;  1SVM A;  2CQN A;  1Z7L A;  3ASN H;  4HST A;  4BKX A;  3HOW J;  2KT0 A;  2L4M A;  1TNT A;  1P7I A;  3KEQ A;  2HQ5 A;  2W82 A;  2ESN A;  3DBL B;  2V4J C;  2V7F A;  3SJM A;  4M3B A;  2EK5 A;  3MMY B;  5ILV A;  2IPQ X;  3DKX A;  2F48 A;  4HX8 A;  2R4G A;  2LD5 A;  3WTS C;  3OL3 A;  1XDU A;  1HDP A;  1ZRD A;  4RDU A;  2HR3 A;  5H6R A;  1TQP A;  1SMT A;  3I53 A;  3ISP A;  5JI6 A;  4NQW A;  2BXY A;  1TL8 A;  1UG0 A;  1IN5 A;  2X51 A;  3EET A;  2WB1 A;  2VOP A;  2VKD A;  2YU9 J;  1JUP A;  2HYF A;  1MND A;  3A0B C;  5AIQ A;  2HOS A;  1O3Q A;  5JHF A;  1STZ A;  1LE8 B;  3RZD J;  2D45 A;  3H9J A;  2STT A;  1QU3 A;  4MQ9 F;  2FBH A;  2HNH A;  4MEX F;  4EM2 A;  1WJC A;  2X9D A;  3GYH X;  1E3O C;  5F6F A;  1ON1 A;  2M3A A;  2VIX A;  3CC4 I;  2LOO A;  3EDP A;  4I99 C;  2MBF A;  3B6A A;  3BJ6 A;  3FBI B;  4XLC A;  3FXK A;  2ETH A;  2CJJ A;  4FAS D;  3KYC B;  3CCU I;  1TZL A;  3BPX A;  2QQA A;  4CZC A;  1EKE A;  1D5Y A;  4UB6 C;  4D7N A;  1FJL A;  1SD5 A;  3E5U A;  3E97 A;  1R71 A;  3F21 A;  2A07 F;  2W84 A;  2ZJQ F;  3EYI A;  3VWB A;  1VZ0 A;  3HKZ A;  1YX5 A;  1OPC A;  3WGH A;  3TP3 A;  2GQQ A;  3ZMT A;  4ZYA A;  2L4A A;  1U9O A;  1IDY A;  2VPL A;  4JX5 A;  1LDD A;  5E3N A;  3DTK A;  1ZRC A;  2DMP A;  2HXI A;  1SFU A;  1GVJ A;  4E7S A;  1UZC A;  4ZZD A;  1TC3 C;  3HSF A;  1MDM B;  1NK3 P;  3BTC A;  5FJ8 J;  2IA1 A;  1TNS A;  1H8A C;  5L3E A;  1ZN2 A;  1ZR2 A;  2LBF A;  3T0Y A;  2M5W A;  5D4R A;  3WTX C;  4A3I J;  1WH7 A;  1XSV A;  1QHG A;  2L3D A;  2E1M B;  2M7B A;  4PJJ A;  1IRZ A;  1XCB A;  3V42 A;  2VJI A;  3M1C A;  4X0G A;  3GTM J;  4Y17 A;  4LGW A;  4YFK F;  3AG1 H;  1U78 A;  3Q3S A;  1BL0 A;  3CCL I;  2K9S A;  3A01 B;  1X19 A;  2Y75 A;  1XG1 A;  1TWH J;  1FMW A;  2WAF A;  5IOY A;  3SZG A;  1I5Z A;  2KRC A;  4E7J A;  2RKH A;  2HVQ A;  3IP4 B;  3LOC A;  3W6J B;  1VQ5 I;  2EFW A;  4CHU A;  2E19 A;  3P9C A;  1TWF J;  3Q0W A;  3DPU A;  4KYW A;  2KQR A;  2KIS A;  2Y0M A;  3CP2 A;  3ECH A;  1FTZ A;  1BC7 C;  3F8N A;  3J7Y J;  4RGR A;  2EV6 A;  3DPL C;  4ZYD A;  1K78 A;  1ZTR A;  5DM7 F;  2XRL A;  1JHH A;  2MLK A;  2E7W A;  3VYS B;  3PNT A;  2VL8 A;  1M1E B;  2MSY A;  2JQ7 A;  4I7H A;  4OAY A;  4DZJ A;  4RB1 A;  2O8K A;  3B02 A;  2DA5 A;  4CDG A;  1XGN A;  4RMN A;  1YW8 A;  2FRH A;  2FE3 A;  3T5X A;  3SYT A;  3PIP F;  2R5Y B;  3OIP A;  4GRI A;  1G2H A;  1YX3 A;  2HTJ A;  3CZ6 A;  1BA5 A;  3SHF A;  2H6C A;  3IV5 A;  2LVS A;  3PO2 J;  1DP3 A;  4FHT A;  3FK6 A;  2Y48 A;  4XRF A;  4UY8 I;  2P7C B;  2EFQ A;  5LGT A;  1PUE E;  5EGO B;  1WCM J;  2BY0 A;  2KZG A;  1BJA A;  2Z5U A;  4M6V A;  4PJ0 C;  5FB2 A;  1ZQ3 P;  5DDG A;  1ZK8 A;  1PYV A;  4HZF A;  1J7K A;  1KYZ A;  2BYV E;  3M8F A;  1RIO H;  2CQK A;  4ENM A;  4XLH A;  1LE8 A;  2DOA A;  2PEX A;  1XMA A;  4J01 A;  2CFX A;  1MMS A;  2DI3 A;  3V8K A;  4CYD A;  5ICG A;  4AM3 A;  2R3S A;  1JE8 A;  3R60 A;  4CCK A;  1LDJ A;  3CJR B;  2A61 A;  2ZFW A;  2DQL A;  4DZP A;  1JJ6 C;  1JKP C;  2JMW A;  2KDO A;  3H0D A;  1MW7 A;  2LDU A;  1UMQ A;  2TDX A;  5LFA A;  3GLL A;  4C2M J;  4KUM A;  1UCR A;  3RTR A;  4FT8 A;  4FQG A;  1RR8 C;  4IPA A;  2F5C A;  3WGG A;  5BS6 A;  2BBY A;  1N78 A;  1MNE A;  1EJ9 A;  1QO0 D;  2R7F A;  5FKK A;  3K4J A;  4DYC A;  4NB5 A;  3M4O J;  4RB2 C;  1UFM A;  4MO7 A;  5AON A;  4IOA F;  3BCA A;  1G59 A;  1KGS A;  4EM1 A;  2IS2 A;  4B8X A;  5GPA A;  4L5J A;  4PJM A;  3WGI A;  1T6S A;  3ZQF A;  4N4N B;  4Z6Y A;  3A4C A;  1S5L C;  4QIW N;  2G0E A;  1MBK A;  2X1D A;  2DXI A;  3RQI A;  4RAG A;  1KU3 A;  3IH4 A;  4BBR J;  2J5P A;  4HX7 A;  1OCP A;  5JLW A;  3FIW A;  1V55 H;  4D1Q A;  3KEY A;  1V4R A;  3MEX A;  4A5N A;  2H94 A;  3ZMD A;  2KIF A;  3UR3 C;  1R23 A;  2N8G A;  2CS3 A;  3HJE A;  3VSL A;  1XPX A;  3I5U A;  2ID6 A;  5IYC J;  2E1O A;  3R0J A;  2VPR A;  2Y69 H;  5M5X J;  3V7C A;  4AIH A;  2OC6 A;  4G7H F;  2HQN A;  3A01 A;  2KJC A;  3QYB A;  1USS A;  1B8I B;  2CV2 A;  2JRM A;  1JGS A;  5L3B A;  2FX0 A;  1SAX A;  3FXR A;  2V9K A;  1VQK I;  4ZH4 F;  4O5V A;  3S1R J;  1ETW A;  3K2A A;  5B1B H;  3HSE A;  1Z6T A;  2CWE A;  4LIV A;  2KFD A;  3JAM Z;  3QP5 A;  1JT6 A;  3PM1 A;  3S2H J;  3K4M A;  2JSP A;  5L3D A;  5CVU A;  1YS6 A;  3KZI C;  4QSH A;  2EJR A;  2PBI A;  3HZJ A;  3GFM A;  1IRF A;  4L0Z B;  3TW7 A;  2R7U A;  3HPG A;  3GX4 X;  1Y56 A;  2DK8 A;  1GDT A;  4LMY A;  4XM3 A;  3KYD B;  1ZYR F;  4JYK A;  3U21 A;  1ONV A;  1ETV A;  1OMI A;  3KCC A;  3FWE A;  4CO8 A;  4S04 A;  3OSF A;  2R7O A;  2CMP A;  1VQ8 I;  3G1O A;  1AHD P;  2W24 A;  2Y31 A;  3L2C A;  2K5C A;  2ZME B;  3V7R A;  4E7H A;  2X48 A;  4HF0 A;  1SD6 A;  2HFH A;  4NC6 A;  2E60 A;  4GCV A;  1AKH B;  2HXO A;  5HOD A;  1S3J A;  2CUJ A;  3LA2 A;  1W0U A;  5FRM A;  1Y1V J;  4JX4 A;  4KN7 X;  3WG7 H;  2EZK A;  1SEU A;  3DF8 A;  1X58 A;  2DTZ A;  2LK2 A;  1YW9 A;  1IUF A;  2A6T A;  4RGS A;  5L3C A;  2P5K A;  2GBY A;  1FT9 A;  3WG9 A;  3FHZ A;  3L7W A;  2RDP A;  3VFZ A;  2QBY A;  3L2U A;  1HC8 A;  5F08 A;  3CC2 I;  2XGC A;  1GLN A;  1UHS A;  1IF1 A;  1J09 A;  3K6G A;  3LL7 A;  3GZ6 A;  2KHM A;  1MH3 A;  2HDW A;  4KIB A;  4WXH A;  2X1C A;  3TO9 A;  4MTD A;  4F55 A;  1BI2 A;  1Y8R B;  2VQH A;  1I1G A;  2VLA A;  4Y13 A;  4RB3 C;  2IGK A;  2VC0 A;  2ZXW H;  4DQ2 A;  3E5Q A;  1Y6I A;  1TQI A;  1FOK A;  1MIJ A;  2PMZ N;  2UXX A;  1G6N A;  3E0J B;  3VOD A;  4LOC A;  3CDL A;  3WE3 A;  4A3M J;  5E79 C;  1TBX A;  2CO5 A;  2M0M A;  2HEO A;  2VN2 A;  4AYB A;  2HZT A;  1Z0X A;  5CVV A;  1MMD A;  2UUZ A;  3LQQ A;  1DQU A;  5KAF C;  2RAE A;  1BI0 A;  4UUV A;  4C3H J;  5HLT A;  2JA6 J;  1LQ1 A;  1FEX A;  3S2D J;  2XKO A;  4GFB A;  1WJD A;  2RQQ A;  1K83 J;  1RES A;  4BJ5 C;  2XPU A;  3QOP A;  4BY7 J;  5J1Y A;  2FF4 A;  1FYK A;  2W00 A;  2HZD A;  1HW2 A;  4WXD A;  5C4X J;  4OIN F;  1A31 A;  2XF5 A;  3P9I A;  3LSR A;  1JXS A;  3V7S A;  2NXN B;  3WTW C;  2ME6 A;  4DYR A;  4EEF G;  4XQF A;  3BPV A;  1R6R A;  4BHP A;  1FOW A;  1HBX G;  1BOA A;  1SVL A;  4RM2 A;  3QPT A;  2CRG A;  1D8K A;  2IVM A;  2NVX J;  4EV0 A;  1J59 A;  4HBL A;  3KX2 A;  1I3Q J;  1B8I A;  4JOM A;  5DM6 F;  3WTV C;  5BPI A;  1POG A;  2MD0 A;  3LSH A;  3HHH A;  2QQ9 A;  4ZDL A;  1HDD C;  4B4C A;  3I54 A;  5EYR A;  4C3I J;  4M9X A;  2LSO A;  2JK3 A;  2M87 A;  3ZPL A;  3TDU C;  1X1C A;  4ANJ A;  2L02 A;  1U5T A;  3FXM A;  4LB6 B;  2KRF A;  1Z7U A;  5M5W J;  3DBR B;  3PNY A;  2DFH A;  2Z1D A;  1MBH A;  4HOB A;  3ECO A;  2OTJ I;  1FYL A;  2DOF A;  4E4H A;  1GXP A;  1B72 A;  1R5I D;  5H20 A;  5FD5 A;  1FOX A;  2YX7 A;  4A3G J;  1FWZ A;  2Y2Z A;  1ZKG A;  3BR5 A;  2TCT A;  3TDZ C;  5J1U A;  2L01 A;  5DD8 A;  4B47 A;  4AD9 A;  4XKB A;  4XRM A;  4BQN A;  1ZRF A;  3KP7 A;  1UAA A;  5EZG A;  1W7P B;  1YE9 A;  1ZAR A;  5ED4 A;  1H9T A;  1LVA A;  3I3L A;  2X4H A;  3EUK L;  4BGD A;  4HDU A;  1Z67 A;  2DFF A;  2VJJ A;  3FIS A;  4A3K J;  5B1A H;  3PSI A;  3WTT C;  1D0Z A;  2ZME A;  3M1E A;  3DV8 A;  1BBY A;  3KP5 A;  3BP8 A;  5LLQ A;  1JJ8 C;  2IP2 A;  4YG2 F;  1K6Y A;  3CD6 I;  4B1R A;  3HHG A;  2YSR A;  4XLE A;  1FZP B;  2Z99 A;  3BR0 A;  4MFE A;  5M5Y J;  2DOD A;  4I0B A;  3ZQ7 A;  3C2H A;  4XMY A;  2YUS A;  3P7N A;  3CF2 A;  4PSW A;  2DK5 A;  2ZO4 A;  1FPQ A;  1NH3 A;  4IHV A;  3OOP A;  1MD0 A;  4RAZ A;  2AQE A;  2MC4 A;  2DYS H;  5L3G A;  2EA4 A;  4EJW A;  2K3F A;  3ZN0 A;  4RM3 A;  2AHQ A;  2JWT A;  2PG4 A;  4WXC A;  2TRT A;  1XX5 A;  1A5J A;  1P4W A;  5TGT A;  1UHM A;  3JCU C;  4LLL A;  2BZT A;  1RZ4 A;  3ZCO A;  4U0Y A;  4JX6 A;  4DBQ A;  2D2W A;  1VQP I;  1JKR C;  1TWC J;  2E35 A;  2ICW G;  2OQR A;  4XKC A;  1R4N B;  3F8C A;  4OMY A;  2HPI A;  2X6W A;  3QQA A;  4LG0 A;  3DWL E;  1D1A A;  2D1H A;  1QPI A;  3CCY A;  2L2O A;  1BIA A;  2CQ7 A;  5HS9 A;  2WY8 Q;  2XV4 S;  5DCM B;  4F3Q A;  4FTH A;  1MMG A;  2OQG A;  5DEQ A;  3BQZ A;  3P5J A;  4BL0 B;  4A0Z A;  2MW8 A;  3QP6 A;  3RSN A;  3NEU A;  3AL0 B;  4BE0 A;  2QSF X;  3LA7 A;  4BNC A;  3Q0V A;  2JA8 J;  2JRT A;  1MJB A;  4AIJ A;  1R9T J;  4FX0 A;  2DA7 A;  4F52 A;  3S1N J;  3E6C C;  3OS1 A;  1C0W A; 
#chains in the Genus database with same CATH homology
 5M3M J;  2DMP A;  2HXI A;  1TC3 C;  2VKE A;  3K7A J;  4XID A;  4M3D A;  1APL C;  3IH2 A;  5C4J J;  4V2F A;  1NK3 P;  4L5E A;  3BTC A;  4NDL A;  2M2E A;  5FJ8 J;  2NVT J;  3M3Y J;  1H8A C;  2XGD A;  1ZR2 A;  3JRD A;  1F36 A;  2VI6 A;  5DTD A;  4A3I J;  2ELK A;  1WH7 A;  1AU7 A;  1IRZ A;  3GTM J;  2E2I J;  4BY1 J;  3HOZ J;  1U78 A;  3Q3S A;  1BL0 A;  4BXX J;  2K9S A;  5FKM A;  3A01 B;  1XG1 A;  3Q0U A;  1TWH J;  1W0T A;  2XGE A;  5J1R A;  4FCY A;  1ITY A;  2AO9 A;  5IOY A;  1WI3 A;  5J3L A;  1IC8 A;  3BG9 A;  3GTG J;  1XS9 A;  1JKQ C;  3LOC A;  2MG4 A;  2E19 A;  1IJW C;  1TWF J;  4AYB N;  3Q0W A;  1FTZ A;  1LFB A;  2L7F P;  1JTX A;  1ZTR A;  4D5C A;  2XRL A;  1FIA A;  4G12 A;  5K7Z A;  2MSY A;  3QPL A;  4DZJ A;  2LY9 A;  3CQZ J;  1B72 B;  4IHW A;  2O8K A;  2DA5 A;  3D1N I;  3S16 J;  1NTC A;  5F0F A;  4A93 J;  3ZOB A;  2L9R A;  3WHB A;  1RKT A;  2R5Y B;  1DU0 A;  1AKH A;  2ECC A;  5EEA A;  1G2H A;  1IGN A;  1XC5 A;  1BA5 A;  3W6V A;  2Y9Z A;  3IV5 A;  3PO2 J;  2LVS A;  3FK6 A;  4Y52 J;  1T33 A;  1WPK A;  2LP0 A;  2M9H A;  5EGO B;  1WCM J;  1ZR4 A;  1YRN A;  4M6V A;  1LFU P;  1FIP A;  3O8G A;  5EZH A;  2LKX A;  1ZQ3 P;  2R93 J;  2HDD A;  1ZK8 A;  3BR1 A;  1A6I A;  2JA7 J;  3GTK J;  3JRC A;  1LE8 A;  3HEF A;  4UUS A;  5M3F J;  1JKO C;  3PO3 J;  1TWA J;  2DMN A;  3GTL J;  5GP9 A;  3MN2 A;  2NS7 A;  2CU7 A;  4CYC A;  4DZP A;  2E2H J;  1JJ6 C;  5E3O A;  1JKP C;  4A3L J;  2JMW A;  2JJ7 A;  3BTJ A;  1UMQ A;  2NOG A;  2DJN A;  4C2M J;  1Y1W J;  4S0H B;  3GTP J;  5FKO A;  3S17 J;  5FKK A;  4DYC A;  4IHX A;  3UKG A;  2HI3 A;  5F0H A;  2DMT A;  2ID3 A;  4RBO A;  4M3E A;  1VF9 A;  3M4O J;  2XSD C;  4MO7 A;  2R7Z J;  2YS9 A;  3LSG A;  1H88 C;  3QPS A;  2I10 A;  2OPT A;  5GPA A;  5K7F A;  1T56 A;  3ZQF A;  3HBL A;  4QIW N;  2K9N A;  2G0E A;  2M34 A;  1MBK A;  3RQI A;  4Y7N J;  2EBI A;  3IH4 A;  2D5V A;  4A3D J;  4BBR J;  1F43 A;  2WB1 N;  5FLV A;  1ETK A;  1OCP A;  5JLW A;  3FIW A;  3JRG A;  1ETX A;  5EDN A;  4M3F A;  2XB5 A;  1U8B A;  2N8G A;  2E2J J;  4AC0 A;  2Y30 A;  3C2B A;  2ID6 A;  1H89 C;  5IYC J;  2E1O A;  2VPR A;  5M5X J;  3HDD A;  2M8G X;  4V2G A;  1ORK A;  3A01 A;  2NS8 A;  2NVY J;  5BNG A;  3ZQC A;  1B8I B;  1U9N A;  1ETY A;  3G1M A;  2FX0 A;  3WHC A;  2ME0 A;  1BW5 A;  3S1R J;  1ETW A;  3K2A A;  1IDZ A;  2FQ4 A;  2DMQ A;  3TED A;  2L7M P;  4W97 A;  4D7M A;  2L7Z A;  1JT6 A;  4D5F A;  1JUS A;  3MKL A;  1ETO A;  3PM1 A;  3RZO J;  4AUX A;  3S2H J;  1MBF A;  4QSH A;  3HKZ N;  3LNQ A;  1HLV A;  2R5Z A;  3BR2 A;  3TW7 A;  4FIS A;  3A02 A;  5E3L A;  3GTO J;  3OIO A;  2VKV A;  5F27 A;  5IP7 J;  2EZL A;  1GDT A;  1TWG J;  5GPC A;  5FLM J;  2R92 J;  1VFC A;  4JYK A;  3ZQI A;  1ENH A;  1ETV A;  4XIC A;  3G1L A;  5IP9 J;  2P81 A;  4BBS J;  1OCT C;  5K7H A;  2Y0S N;  3OSF A;  1GT0 C;  2IAI A;  3G1O A;  1AHD P;  3IH3 A;  2Y31 A;  3BT9 A;  3DCF A;  2Y9Y A;  1RR7 A;  1K61 A;  1MH4 A;  3JRH A;  4J19 A;  4A3C J;  1ZGW A;  4A69 C;  2X48 A;  2QCO A;  4MFD A;  3JRF A;  4IEJ A;  4MIM A;  5FKN A;  3TW6 A;  1AKH B;  2HXO A;  3TP0 A;  5HOD A;  2LLK A;  1W0U A;  3S14 J;  2H8R A;  3SFI A;  1Y1V J;  4JX4 A;  3HOU J;  4W1U A;  2EZK A;  3B6C A;  1EF4 A;  1X58 A;  2DTZ A;  3LSP A;  3H3V K;  2JA5 J;  1S7E A;  3BR3 A;  1I50 J;  3HGY A;  2LK2 A;  3GTJ J;  1IUF A;  1MNM C;  3VPR A;  2GBY A;  4UUT A;  5IYD J;  3BG3 A;  1PUF B;  1JT0 A;  5F08 A;  2XGC A;  4XK4 A;  5DS9 A;  1UHS A;  1SAN A;  3MVP A;  1Z77 A;  1CQT A;  1MH3 A;  4I6Z A;  2DA3 A;  3ZQL A;  3SDG A;  2DMU A;  5IYB J;  2K9Q A;  2DA2 A;  9ANT A;  2ECB A;  5C44 J;  2W48 A;  2LFB A;  4CYC B;  2L0K A;  2PMZ N;  4LOC A;  3CDL A;  1GUU A;  4MLO A;  3FKI J;  1MSE C;  4A3M J;  3FK7 A;  5EG0 A;  3E7L A;  2HYJ A;  4M3G A;  1QRY A;  1Z0X A;  1GV5 A;  4XRS G;  2RAE A;  4C3H J;  3GBG A;  2JA6 J;  5E3M A;  1FEX A;  3S2D J;  2WV1 A;  5F1J A;  4GFB A;  3BTI A;  1K83 J;  1RES A;  4ABZ A;  2XPU A;  2EZH A;  1HF0 A;  4A3E J;  4BY7 J;  5J1Y A;  2O9L A;  4IHY A;  3LSJ A;  5C4X J;  2IEK A;  2EQR A;  3LSR A;  4A3F J;  1SFO J;  4X6A J;  2ME6 A;  4DYR A;  4EEF G;  1UG2 A;  4C3J J;  4DW6 A;  2R0Q C;  2LTP A;  5F0C A;  2H1K A;  3NAR A;  2CRG A;  2NVX J;  4X1E A;  1GV2 A;  4FE4 A;  2XPV A;  2DA1 A;  2FD5 A;  4HNV A;  2DN0 A;  1I3Q J;  2MGQ A;  4I76 A;  1B8I A;  1POG A;  2HOA A;  1HDD C;  4B4C A;  5EYR A;  4C3I J;  3I4M J;  2JK3 A;  3GTQ J;  1OFC X;  1FTT A;  3HB9 A;  3HM5 A;  5M5W J;  5C3E J;  4A3B J;  1BW6 A;  1WH5 A;  1MBH A;  3HOV J;  3BQY A;  2GM4 A;  2JN6 A;  3S1M J;  1MBE A;  3BTL A;  2ZB9 A;  1B72 A;  1OJL A;  1X2M A;  4QTR A;  2XPW A;  3ZQH A;  1X2N A;  2CUE A;  4A3G J;  2Y2Z A;  1ZKG A;  3BR5 A;  2TCT A;  1IV6 A;  1JGG A;  2NVQ J;  4JP0 A;  2M0C A;  5J1U A;  2KDZ A;  3JR9 A;  2QF7 A;  2FJ1 A;  3HGG A;  2R5Y A;  4FE7 A;  3O8H A;  1IG7 A;  5IOZ A;  3CMY A;  4DYQ A;  2GLO A;  4XRM A;  3JRB A;  5EZG A;  2OF7 A;  3L1P A;  4XRS A;  2R5Z B;  1O4X A;  2K40 A;  3BG5 A;  3FIS A;  2VUM J;  4A3K J;  5EGO A;  3JRI A;  3S15 J;  1GVD A;  3ZQG A;  2B63 J;  5JLX A;  2O7O A;  4BKX A;  3HOW J;  1JJ8 C;  3JRE A;  2KT0 A;  3RKQ A;  1RPW A;  4B1R A;  1P7I A;  2HQ5 A;  3BR0 A;  4MFE A;  2CQX A;  5M5Y J;  3BR6 A;  3H0G J;  1I6H J;  3I4N J;  1WGX A;  3SJM A;  2YUS A;  4M3B A;  1QVU A;  5F04 A;  3S1Q J;  4IHV A;  1RET A;  3DEW A;  2LD5 A;  2X6O A;  1BJZ A;  1HDP A;  5FKL A;  1YRN B;  4RDU A;  2CUF A;  1Q1V A;  4A3J J;  1HOM A;  1NK2 P;  2AHQ A;  2JWT A;  3HOX J;  3OSG A;  2TRT A;  2CQQ A;  1A5J A;  1MBJ A;  2YU9 J;  1PUF A;  1JUP A;  3A03 A;  2HOS A;  2EH3 A;  1JUM A;  2IBD A;  4UUS B;  1LE8 B;  3RZD J;  4JX6 A;  1VND A;  1RKW A;  1JKR C;  3JRA A;  1ETQ A;  1TWC J;  2DA6 A;  2X9D A;  3QQA A;  1E3O C;  5IPA A;  2COB A;  1QPI A;  3CCY A;  3B6A A;  1VI0 A;  2CJJ A;  3NAU A;  1D5Y A;  2DA4 A;  1FJL A;  1DU6 A;  4D7N A;  1HCR A;  1QVT A;  2LR8 A;  5IP6 A;  3F0C A;  1P7J A;  3OOU A;  4FTH A;  2WAQ N;  3HOY J;  3BQZ A;  1MBG A;  2XB0 X;  4B3A A;  1JTY A;  2MW8 A;  3TP3 A;  2EZI A;  1MSF C;  5EF6 A;  3Q0V A;  2HOT A;  1U9O A;  2JA8 J;  1IDY A;  4JX5 A;  1R9T J;  2DA7 A;  3S1N J;  5E3N A;  5EG0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...